3LP2A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 153
structure length 554
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp2A05
2IJNA 4ZMMA 4G3IA 1RBTA 4EBDA 4RW9A 1X9MA 1RT7B 2R8KA 3V9XA 1S1VA 3S3OA 4E7IA 2FBVA 2P51A 3MF5A 5F8GA 5KG0A 4WFXA 3NF6A 1HNVB 1BIZA 3FRZA 1EX4A 4KHYA 4E7KA 1IM4A 3T5LA 4Q0BA 1HQEA 4RW7B 4B9UA 5D3GA 2VA3A 1REVB 4XIUA 3NAHA 1N4LA 1C0UA 4CFCA 4N47A 4FJKA 5CY4A 4GC7A 5DGAA 2FLNA 1HYZA 2D41A 3LPUA 4ZVHA 1VRTB 5I42A 5KT5A 4EP5A 1RTDB 4WFYA 4M3RA 3U3YA 2Y1JA 4FK0A 4RNHA 3FSIA 4C8MA 2OPRB 1WNSA 3VQDA 4HUFA 1RA7A 4KTZA 3EZ5A 1SL0A 3O3GA 3CJ2A 4RUCA 4ZPDA 4ECQA 3OYMA 4OPJA 1ZBIA 3BSOA 4DTPA 4MK9A 3KK1A 2PYLA 1SH0A 1RBUA 4CHPA 1MMLA 2IA6A 4LSLB 1FKPA 1HYSB 3PV8A 4M94A 1RTIB 5F8HA 2W8KA 4Y1CA 4E1MA 4JRPA 2FVPA 3JYTB 4IRDA 4M42A 4DSLA 3NHGA 1I3AA 4CJUA 2GIRA 1JLQB 4FLXA 1RTIA 2V0NA 3PX6A 4KTQA 3KLIB 2R8JA 2YNGA 1HQUA 3SUNA 1JLEB 4IG0A 3T5KA 4B9NA 1IKXA 5KFDA 4DTXA 1Q8IA 1HMVA 4J9MA 4ED1A 4FM0A 2Z1IA 3OVNA 1KLMA 2NUBA 1S48A 4AILC 1WSJA 4CFBA 4X2BA 1C1CA 4CJKA 4FJXA 3H4BA 3OS1A 1J9AA 1Z26A 3QESA 4GVMA 3K2PA 5DLFA 3TWHA 4CHYA 4Q8FA 4URQU 2G8KA 5T7BA 4LSNB 1TK8A 5HLFA 1REVA 3ISNC 3KK3B 4KSEB 2AGPA 3VN5A 4Q0BB 4NYFA 1J5OA 2HMIB 3G6YA 4EEYA 2KZMA 2CKWA 3ULDA 1TAUA 1NKBA 1TKXB 3OYHA 3CDUA 3LP1A 4ED2A 3KLVA 4QAGA 1ZBFA 4RG8A 4RW9B 1S1UA 1S6PA 2J6SA 1TL1A 1VSFA 5F8JA 4JLHA 5C5JA 4IFVA 4QOZB 4E3SA 2IC3A 3PJXA 2BR0A 1S6QB 5CYQB 3V4IB 4WZMA 1ZBHA 3LANA 4FLWA 1RDCA 3HSTB 1HNIA 2BANA 3DLKA 3TAEA 3EYZA 1JLCB 2P5GA 1IKWA 1IKYA 1RYSA 3I5AA 1UWBA 4EP4A 3HXMA 4G1QB 3VQBA 2DTUA 2KTQA 4DL7A 4CEFA 3RWUA 2ZD1B 3DOKA 1S1WA 5KFNA 2ATQA 3LZIA 3MFHA 4ZP6A 5HRRA 3WNGA 3Q8PB 4BWJA 4DTNA 4DSJA 1KRPA 4WE1B 4I2PA 4AHVA 5KT2A 4F2SA 5L1IA 3RAQA 3QNOA 1JLFA 2UUWA 4F3OA 1HPZB 5HP1B 2Z1HA 3DOLB 4K4YA 3OYFA 3QLHA 3QEXA 3E01A 4O3NA 2WHOA 3DLRA 3ZT2A 3DDKA 5FDLB 4M3UA 2VG7A 4ZVGA 3V81B 4F3TA 1W9HA 3QGHA 3KLGA 3H2LA 3C6UA 2ITGA 3SJJA 3I0SB 5HROA 2ZQBA 3OL6A 1L5UA 4NLRA 2X78A 1TVRA 3OSPA 4AHTA 3H5YA 4FYDA 3NGDA 2A1RA 4I2QA 1QS4A 1VSEA 1WSIA 3QIPB 2V9WA 4OJRA 1JLGA 3PO4A 5DG9A 3ZT1A 2OPQA 4ZP7A 3FFIA 4K8ZA 4Y2AA 4H4OB 3SZ2A 4N41A 1B9FA 2C2DA 4K4SA 3T5JA 3EZUA 4IG3B 3L3UA 4URGA 2UVRA 3TAGA 1SUQB 5KT3A 5EUHA 4CEDA 1U09A 4FLYA 3SCXA 4DTUA 4QWBA 3PO5A 3LAMA 1QHTA 3VQ8A 1NKEA 2XO7A 1RTHA 1A5WA 4ZPBA 4K50A 3TARA 1S0MA 3K5MA 2OPSA 3QGGA 3LP0B 5J2NB 2FBTA 3DI6B 1NK6A 2WK4A 1HARA 1WNEA 5L1JA 2IBKA 2ZE2A 1JKHA 2Y1IA 2WOMB 2OPSB 1S9FA 1LWCA 3PHEA 1HJRA 4BACA 1VSJA 2WB4A 2RDIA 4AHCA 3VQEA 1G15A 3UIQA 3UDLA 2X6NA 2GBZA 2YKMB 3NGYA 2YKNB 3L2RA 1U48A 4YP3A 3ITHA 1RBRA 2R2RA 2BQ3A 4KFBA 4DSIA 4Z0UA 3NF9A 1UA0A 5KT6A 2QKBA 2YNIA 1ZETA 4DSFA 4L8RB 1EETA 3AA4A 3IGVA 1BCOA 1NHVA 1UOCA 4CJVA 3BSNA 3K57A 5C25A 1F21A 1JXEA 2WCXA 2R8IA 4B9MA 4CJPA 4O55A 4BDZA 4FJGA 1QE1A 4DQQA 5KRTA 3KMQA 4IQXA 3H59A 1XWLA 3HKWA 1VSIA 4B9VA 2ASLA 4FBUA 4J9LA 2OZSA 3ZCMA 5KG3A 3KLHB 1S9GB 3SQ2A 4FM1A 2GV9A 3N6LA 4NLXA 4H54A 1VRUA 4OKKA 2PYJA 2ILZA 3CWJA 4NLOA 2B4JA 1C1AA 2YKMA 4M3ZA 1TV6B 4EZ6A 4ELTA 3VQ6A 1CLQA 1L3SA 4DFMA 2AU0A 3OL7A 4RNNA 5EWGA 4ZTJA 3MXIA 4MKAA 2F96A 4CEQA 2HHVA 4HTUA 3I0RA 2HNZB 5KFPA 4DS4A 2WONB 3AO1A 5HBMA 4U7CA 3V6KA 2XY8A 4BE1A 4CFDA 1RT4A 3MR3A 4DEZA 3C6UB 3HL8A 3TAFA 3T5HA 4URSA 4Z4CA 3NGZA 1RTJB 1L3TA 4YMEA 4Z4EA 3AVBA 3V4IA 3M8PA 4DTOA 1TKZA 4R8UB 3KD1E 4ECYA 4ECUA 5F9LA 3SUQA 2UUTA 5KT7A 3SYZA 3SUOA 3AVGA 1JLBA 3NGIA 1RT3B 2LSNA 1S1UB 1U4BA 2JEGA 4F2RA 2BE2B 1BHLA 1TK5A 3CDWA 2BE2A 3PR5B 3TAPA 1RT3A 2D0BA 3LALA 3RB6A 3M8SA 2YNHB 2AWZA 4F4ZA 4F4YA 3MEEB 4C8NA 1BGXT 4R8UA 3HYFA 4KI4A 4QWAA 3KLHA 4Y3CA 4KHMA 4ECZA 4KAZA 3SI6A 4NCGB 1S1TB 3UQSA 4CF9A 3BQ1A 2XY5A 4ICLB 3I0SA 3RBEA 4EBEA 2R8GA 4CGGA 3CG7A 1RILA 2HB5A 4EYHB 1JIHA 4FM2A 3I5BA 5F8LA 4JV1A 2W8LA 4ED3A 1S10A 3CFOA 4IFVB 3AO2A 5DMRA 3KJVB 4TYBA 4DL5A 3SQ4A 4EO6A 1QSSA 3RRGA 3H5UA 4CGJA 1NK5A 2HHTA 5KFGA 2W42A 1TKTB 2YHAA 4Q5VA 3V9SA 3VA3A 1IKXB 3I8DA 2YNIB 3PW2A 4O0IA 4K8XA 5KFXA 1VSMA 3QINA 5J2MA 3OHAA 1XHZA 4KO0A 5I3UA 1TKTA 4RW8B 3ITHB 1VSKA 1WLJA 3ZSVA 1ASWA 3NCIA 4AHRA 4CESA 2UVUA 4AH9A 2YKNA 4ELVA 4CE9A 5JS1A 2AGQA 1Z4UA 2XI3A 4UQGA 2KFNA 3RR8A 4Z4IA 3F9KA 5HLFB 4H8KA 4RNFA 4LQ3A 1RYRA 1KSPA 4O3SA 1BQNB 1NK0A 1SKRA 1LW0B 2HHQA 4F50A 1LWEB 4IOBA 4O5BA 3JSMB 1KTQA 4FCYA 3SQ0A 5HBMB 3LPTA 3SUPA 2WONA 1QAIA 3DMJA 2IC3B 4FJHA 2HW3A 4J9QA 1LWEA 4JRQA 4IH6A 5KGWA 4DQRA 3HHKA 3PX0A 1ZTTA 1FKOB 1A5VA 1CZBA 1XC9A 3RMCA 1VRTA 1C0MA 3HPGA 3LP1B 2G8HA 3V6HA 3BR9A 5FRNA 4LH5A 2HHUA 4FZXC 4IR1A 4I9LA 1T94A 4KO0B 1RT6B 4DL6A 4DQPA 1IO2A 2OZMA 3LP2A 1WSGA 2ZKUA 4O4RA 5DQGA 4ECTA 1D9FA 1HYSA 2OPQB 3AA5X 4NLTA 4K4VA 3AVLA 4LQ9A 4PQUB 2ALZA 3RB4A 2Z1JA 1BI4B 4QPXA 1Q9YA 4J9RA 4CIGA 3LP0A 4QW9A 4WXWA 2JGUA 1T8EA 3VQPA 2QKKA 4ICLA 4FLVA 2R2SA 4DMNA 4B8AB 4CERA 1KLMB 4KI6A 3GV8B 4ID5B 3M9NB 2FVRA 1JL1A 4MK8A 4TQRA 1KFSA 2Q3SA 2Z1GA 4E0DA 4KKOA 2BRKA 5KFIA 4MH8A 3GIJA 3V9UA 3HM9A 5D3GB 3QIDA 2D0AA 4IG3A 5DK5A 4RW7A 3SFUA 1JLFB 1L3VA 3CIZA 3V9ZA 3AVIA 3TABA 1NK7A 2X74A 1CXUA 4FJ5A 4WZQA 2QXFA 3PW7A 3ZSRA 4DF4A 2D7SA 2G8FA 4JS4A 3DOKB 2E9TA 4PUOA 3UR0A 4DSEA 4K4UA 3QYYA 1NHUA 4TYAA 1VSHA 1TP7A 1FXXA 4ZVEA 5KRSA 4CJQA 2IDOA 4PQUA 4KPYA 2FJWA 3L3VA 1QTMA 4HCCA 2RPIA 4DTRA 1EETB 4B9TA 3KHGA 2GUIA 4YNQA 4GC6A 3N6MA 4ID1A 4OPKA 4FJIA 4E7HA 3BGRB 3D0PA 1S9EA 3HVTA 1WAJA 2PZSA 4C8LA 3KHRA 2IM3A 3AA2A 5KG2A 5KFVA 3SQ1A 3CJ5A 4WE1A 3MEGA 5J2MB 4DQSA 3RRHA 3BDPA 4E7LA 3MECB 1SH3A 4I7FA 4H4MB 3NH1A 4ECVA 4NLUA 2YV0X 3P5JA 3MR6A 1IH7A 2IM0A 1R0AA 4CHZA 1JKHB 5KFKA 2RKIA 2HAIA 4EO8A 4NLPA 3CM6A 3EY1A 2VA2A 5L1LA 1RTJA 5F8MA 2AX0A 4FLUA 3S9HA 3V6DA 3SFGA 1CSJA 1GOBA 1NOYA 3V1QA 1SH2A 4FLZA 5T14A 1KVBA 4WXOA 4O44A 1K1QA 2BDPA 5KG5A 4IKFA 3PZPA 4E89A 4IRCA 1RAJA 1S97A 3V81A 4OLBA 2OPPA 2O4IA 2V4RA 5C25B 1VSLA 5FRMA 5KFLA 5KFYA 1XI1A 1HMVB 1KHWA 3LWLA 4R0EA 3FQLA 5J2PB 4DG1A 4Y34A 4OKEA 1L3UA 2F8SA 2RDJA 5KFOA 3KLIA 4ED0A 4C8KA 1UA1A 1SKWA 3AVJA 1JLBB 1SV5B 4KV8B 2FJVA 1S0NA 4KKOB 3BGRA 1LAVA 4IKAA 2W9CB 1NK4A 1Y97A 4FS2A 2I5JB 1FK9A 2W9BA 1IG9A 2W7PA 3V9WA 1NJZA 4KREA 2AJQA 4DS5A 3KLGB 3Q8SB 3DLKB 3AVKA 4RNOA 4E7JA 2XI2A 1J53A 3HT3A 1BI4A 4MQ3A 4PUOB 1K1SA 3QEWA 3EPIA 4I7FB 3KLFA 2YNHA 2P1JA 3ZSWA 1D5AA 3FDSA 3B6PA 1YTUA 5HP1A 3G6VA 5I42B 4HUEA 1LAWA 4M3TA 5JS2A 4YR2A 4RW4A 5KG1A 1TKXA 4W5QA 3QZ7A 2B5JA 3GILA 1VRUB 1C6VA 2W7OA 3L2WA 1S9EB 2BQRA 1C0TA 4IR9A 3OHBA 1B9DA 3IG1A 4XPEA 4NLWA 1EKEA 1B92A 4Q8EA 3DLHA 4H4OA 4QWCA 1U45A 3KHLA 3AA3A 3NBPB 4FBTA 4NZ0A 1T3NA 3OJUA 1VK0A 4Y2CA 4CF2A 1KHVA 1TVRB 2KW4A 1S6QA 3B6OA 5J2NA 4RUAA 1QE1B 4KHNA 2HVIA 4FJ7A 2DFFA 1U04A 3PJWA 3DYAB 3CFPA 5K14B 3IRXA 4NLYA 4HVJA 1N5YA 1LW0A 1RT5A 3K5NA 2GC8A 4K4TA 4B9SA 3PW4A 1WSEA 2VG7B 4NLQA 4J2DA 3IS9A 1XR7A 2DPIA 1JLEA 2YNGB 4KFBB 2J6UA 4DTSA 2C28A 4B3OA 3KTQA 1J5OB 2HMIA 4O3OA 4YFUA 1X1PA 3MTKA 5KFTA 1HQEB 2D3ZA 2XGPA 3RB3A 1RDBA 3KK3A 3NFAA 2UVVA 5KFQA 2UVWA 1BQMB 4OKJA 2D0CA 4YR3A 5HRSA 4MIAA 1DTQA 5KG4A 3M9MB 1N56A 2XY6A 1LWCB 2XGQA 4NRUA 3DMJB 2GIQA 1BCMA 2ZE2B 3ZT0A 3V6JA 2CJQA 3L2QA 4FS1A 4FLTA 3VQQA 1JXLA 4K4ZA 1CZ9A 1S1XB 1QUVA 3JSMA 3OY9A 2HHXA 1NJXA 4ZPAA 1TQLA 1D8YA 5DQHA 1WSHA 5KFMA 3OYIA 3KKRA 1BQNA 3BQ2A 3IN5A 4Z4HA 2J6TA 3E01B 3TANA 2XCAA 1RT6A 5HRNA 3HVWA 5KFRA 4C8OA 3MAQA 4J9SA 3TAMB 4LY7A 1ASVA 4CJEA 4DLEA 4CJ4A 4RW4B 4I2PB 3JYTA 3LAKA 5EU7A 4EZ9A 1FKOA 5DGBA 4R5PB 2O4GA 1HRHA 3TVKA 3NF8A 2VG5A 3QERA 3KK2B 1N6QB 4TY9A 4M41A 3RMAA 4IBNA 1RT7A 5F8IA 3HK2A 4E19A 3T3FA 3QGIA 3K5OA 3SPZA 4FJMA 1IKWB 3M8RA 2ASJA 1HNIB 1RT4B 3GIIA 2R7YA 4M3YA 3VQSA 1O1WA 2FC0A 4Q44A 3QEPA 3OYEA 1D9DA 4IRKA 2W9CA 3PVXA 1UAXA 1RT1B 4CF1A 4CGDA 1S49A 3ICLA 1JX4A 3MEEA 3H5XA 1SUQA 1JXBA 3WNEA 3G6XA 2YNFA 4KBIA 1NK9A 1HPZA 3OSNA 3Q8RB 3OLAA 1X9WA 4CEZA 4YR0A 2HHSA 4F4XA 1HNVA 3VA0A 4RU9A 2WTFA 3ZT4A 1GX6A 1JLGB 1JLQA 1LW2A 3KJVA 4FW1A 4DLGA 4BDYA 4DSKA 3QIOA 4CJFA 3MXMA 2ZD1A 1TKZB 5J2QA 1BL3A 4OGCA 3OYDA 3G0ZA 1NK8A 5CYMB 1UWBB 4KHWA 3C6TB 3DLGB 4KE5A 5KFWA 3QZ8A 4MK7A 2OH2A 4FJLA 4CEOA 1IKVB 2JC0A 4FZZA 3KK1B 3DRRB 4J2AA 1J54A 3DRSB 4W5TA 3T1AA 4CGFA 3O3FA 1C1CB 1KLNA 4RNMA 4TY8A 2KFZA 4KB7A 4NYNA 2HNZA 4IH7A 5KFSA 1ASUA 1WSFA 4H4MA 3MECA 2F8EX 4KB0A 3AO4A 4FXDA 2IM2A 2QE5A 4CJTA 1TV6A 2EX3A 4K4WA 1VSDA 3D28A 4MIBA 2IGIA 2C22A 1K6YA 1EP4B 4J9OA 2HNYA 2IS3A 4CGIA 3ZSQA 5KFEA 5KFZA 3PR4A 2B43A 3K59A 2G8WA 2IMWP 3OJSA 4EYIB 5C24A 3P83D 1HYVA 3G10A 1FKPB 3ALYA 3GIMA 2IJFA 1DLOA 1JLCA 1TK0A 4ECXA 4CHOA 4KHUA 4CK1A 4CK2A 2XCPA 3HVRA 1XHXA 2ILYA 4CECA 1U47A 5EWEA 4RW6B 2R2UA 2JEIA 3I0RB 4PWDB 3IRXB 5C42B 4CJLA 2XWYA 3OL8A 4IFYB 3AVMA 4CCHA 4NLVA 1QAJA 1HQUB 4TLRA 5KG7A 5CZ1A 3U6FA 1NJYA 3O4QA 4DQIA 3H98A 1TGOA 2FVQA 5EDWA 1S9GA 1GOCA 3AO5A 4FW2A 1NKCA 4KB1A 4N76A 3RTVA 3RMBA 2HNYB 2FBYA 2B5JB 5DLGA 4WFZA 1S1VB 2XHBA 1GOAA 4OLAA 4K4XA 1I39A 2WOMA 3CJ4A 1GX5A 2KQ2A 3C94A 4NCBA 4CHNA 2RF2B 3M8QA 5HROB 4CHQA 4ED6A 4RW6A 4FK4A 3KLEA 2FLPA 4BE0A 4GMJB 4Y1DA 2OPRA 3BSCA 1JLAB 3S3MA 3DRSA 2BGGA 4O4GA 3RMDA 2XY7A 3PY8A 4JV0A 2O5DA 4DL2A 2B6AB 1RDRA 2PY5A 2E6MA 2I5JA 3TAQA 1RCHA 4DU1A 4FK2A 3HO1A 4DL3A 1U49A 2G8IA 3KMSA 3K5LA 1DTTB 4M45A 1RDDA 4CJSA 4O3RA 4XPCA 1WN7A 1EP4A 2E4LA 1C1BB 4NCAA 4NYZA 3IGNA 3HP6A 1S1WB 3CO9A 4FJJA 2JEJA 4ECSA 3VQAA 5KFBA 4DG1B 3BSAA 4IDKA 1RT2A 3KHHA 4IFYA 3GYNA 4F4WA 3LZJA 4F4KA 2YNFB 3NF7A 4W5OA 2ASDA 3DLBA 1NOZA 3DI6A 3VQ7A 3AVFA 1T05B 4O3QA 1D1UA 1S5JA 4LH4A 4HUGA 2EC0A 3THVA 3ZSYA 3SNNA 3N6NA 3IAYA 2OYQA 3DM2A 3QETA 1RTHB 3U3GA 1RTDA 4PY5A 3V1OA 2EHGA 4QCLA 3D45A 4J9NA 5FDLA 4DFKA 1TL1B 1ZTWA 1DLOB 1S6PB 3E51A 3NKYA 2DFEA 4RW8A 1C0UB 1TL3A 3OYCA 3CFRA 1R0AB 3MFIA 3CJ3A 4CK3A 3OYKA 2VG6B 5J1EB 4MKBA 3ZSOA 3TQ1A 1C2PA 3ZSXA 5KI6A 1RDAA 4YQWA 3FFIB 3ZSZA 5J1EA 3A2FA 1C1BA 3NAIA 3GV7B 3QIPA 2KZZA 4JS5A 3QEVA 3BJYA 3UPFA 4I2QB 4Z4FA 4ECWA 2P5OA 5CZ2A 3AV9A 2BRLA 4OL8A 4O3PA 2HWHA 4ZP9A 3NH2A 3KKSA 4O4GB 3SV4A 4CJ3A 4ELUA 2FLLA 3DM2B 2FVSA 5SWMA 4W5RA 3V1RA 3BREA 3LDSA 3CQ8A 5KFAA 2D5RA 4KHSA 4CF0A 1WAFA 4CF8A 1IKVA 3S3NA 1T05A 3QLHB 4EBCA 2JLEA 3AVNA 3NE6A 1BIUA 1QSLA 2OA8A 4CEAA 5KTQA 1SKSA 4IG0B 1EXQA 1XR6A 1Z25A 4AHUA 4RZRA 4FJ8A 1LW2B 2IAJB 2V4QA 3MEDA 4DL4A 3TR8A 4PA1A 1X9SA 3NH0A 3QNNA 4NLGA 4J2BA 3PW5A 2HVHA 2D3UA 3M8PB 3VQ5A 4G1QA 4B3OB 4LSNA 3SPYA 3OYNA 3QO9B 3IS9B 4NLDA 2F8TA 2R8HA 3C95A 4KRFA 3VQ4A 2DPJA 3DRPA 3H4DA 5CYQA 5EWFA 4W5NA 4ID5A 3MR2A 3AVAA 4PWDA 4JV2A 4M95A 3MXJA 4CJ5A 1KVAA 2BQUA 1NJWA 4U6PA 1TKDA 1YTAA 3NDKA 4CGHA 4B8CA 4ZP8A 3QEIA 4QWEA 1ZBUA 3O3HA 3OYBA 3RBDA 4KTWA 3RB0A 5KFHA 4DFPA 1XR5A 3KK2A 1N6QA 4TN2A 2VG5B 3G86A 1OS5A 4MFBB 1ITGA 3HPHA 4ZHRB 4Z4GA 2VG6A 4NRTA 1CXQA 3LP2B 2XC9A 3CYMA 3D5MA 2QK9A 3KD5E 4Q45A 4FZYA 1W25A 3CVKA 3OL9A 3L8BA 2FBXA 4HKQA 3VQ9A 3PW0A 4MFBA 1RNHA 3OYJA 2E6LA 5JXSA 1ZBLA 3TAMA 4ZVFA 4E1NA 3KNAA 4LSLA 2ATLA 1RA6A 5JUMA 2JC1A 4KAIA 3OS0A 4HYKA 1JL2A 1QQCA 4JUZA 4DF8A 1RT5B 4CEEA 3MR5A 2E9ZA 5DG8A 3KLFB 3GQCA 4BWMA 5F8NA 3DYAA 3KLEB 3K58A 1MU2B 5L9XA 3SV3A 3DRPB 4O0JA 2ETJA 4WYLA 2RN2A 2FVCA 5KFJA 1RT2B 3RR7A 3DRRA 4IDKB 4DWIA 4F8RA 3KIOA 3AO3A 4QW8A 3SI8A 4CIFA 3GIKA 1DTQB 5CYMA 1W0HA 3WNHA 1FK9B 5J2QB 2W9BB 2AQ4A 1LV5A 3H40A 3PX4A 2I1RA 1BQMA 5DQIA 2R2TA 5SZTA 4M3XA 1C0TB 3ISND 3L2VA 1LWFA 2DY4A 3F73A 4N5SA 2HHWA 3GV5B 2IAJA 1KVCA 5I3UB 3AVCA 2G8UA 4ZTFA 2FJXA 4CIEA 5F9NA 4N56A 5KFUA 1S0OA 3EPGA 3M9OB 4J2EA 1TL3B 3TI0A 5L1KA 1MU2A 3HP9A 2AX1A 3VQCA 4KHQA 1N5YB 4BE2A 5KT4A 3L2UA 2RF2A 3M8QB 3FQKA 1QSYA 2OPPB 4WYWA 5HRPA 4OVLA 1Q9XA 3I5CA 1NNDA 3T19A 3BQ0A 4HCBA 5DG7A 4CJWA 1YVFA 4B08A 4TQSA 3OYLA 4FJNA 1S1TA 3NMAA 5KFFA 4NCGA 1ZYQA 3NBPA 2X6SA 3PUFA 3HVAA 2WRMA 2RKIB 2DFHA 2W9AA 5FROA 3IG1B 5KFCA 3ZT3A 3DLEB 4ZHRA 4FVMA 3OLBA 3DLEA 3MEDB 4HHTA 2IM1A 3RAXA 4FJ9A 3CDEA 1YT3A 5J2PA 2G8VA 3OYGA 3OS2A 4DTJA 2IOCA 2HWIA 3Q8QB 1DTTA 1TAQA 2YHBA 4NLSA 3P1GA 3HPOA 5KGXA 1D0EA 3KOAA 4CJRA 1RT1A 4GW6A 4DFJA 5C42A 2C2RA 4J9KA 4XO0A 1T03A 3OYAA 4BDPA 2XRIA 1A5XA 3AVHA 4CFAA 4B9LA 4M3WA 4O44B 3CJ0A 3QO9A 3V6DB 1T03B 4ECRA 3C6TA 3DLGA 3DOLA 3LP3A 4OGEA 2C2EA 5C24B 4LD0A 3NL0A 4DU3A 1RBSA 2HNDA 3H5SA 4I9QA 1RBVA 4KHRA 4R5PA 4ZPCA 4IH5A 4CEBA 1SV5A 4KV8A 3WNFA 2VWJA 1LWFB 2QV6A 3MEGB 4TXSA 1KFDA 1N48A 4DTMA 2HNDB 1I6JA 1SL1A 4DU4A 4J9PA 3HVTB 2E9RX 1KCFA 3NAEA 1YVUA 3HJFA 2B6AA 4ED8A 2JEFA 1T7PA 1IKYB 5KG6A 4QWDA 4ED7A 3O4NA 4TY8B 3CM5A 5E41A 2BANB 1JLAA 3ASMA 4TSXA 4AHSA 1SL2A 2VWKA 1BISA 3LWMA 3H08A 1S4FA 4Q43A 2A1SA 1S1XA 2AGOA 5K14A
chains in the Genus database with same CATH superfamily
2IDEA 4G3IA 4BC7A 4CLKA 4RW9A 3CXCR 4B1WB 5AJ3F 1X9MA 1RT7B 3V9XA 1XNRF 2HQ3A 5F8GA 3NF6A 3C7NA 2MSTA 5CAAA 3GBTA 2NS1B 1YRTA 3HHLA 4CLUA 1RHMB 4E7KA 3BP8A 2RHKA 1LXJA 4RW7B 4B9UA 1KD1T 4XIUA 1OVQA 4CNYA 5CABA 2DRBA 1TUUA 4CFCA 4N47A 3DLLQ 3B4MA 1YITN 5E26A 1TFWA 1C0FA 2OFHX 2WBRA 3N0VA 2QLWA 1O8BA 5I42A 1FRXA 4KPCA 2Y1JA 2CJXB 3PFEA 2MGZB 2OPRB 3IM8A 1WNSA 2EK1A 3AB4B 3R7SB 1RA7A 2RSQA 3O3GA 4L6V3 3CJ2A 4ECQA 4ZA1A 4J37A 4IFEA 1W2BM 1VC0A 4ISGA 1SH0A 3OT9A 3J80O 1MDUB 2M9KA 4QU7A 2DVIA 1T02A 2W8KA 1IV0A 3MHYA 1FWKA 4ALZA 4EIAA 3JYTB 4IRDA 1K8KA 3NHGA 5CHCB 2F1FA 2HHPA 4WU3A 5B0AA 3VAGA 1FTRA 1GH8A 4B9NA 3C2PA 2DNOA 2FIUA 4PG4A 2V8VA 4ED1A 3MM8B 4DV5K 2Z1IA 1KLMA 2NUBA 5DDRC 1S48A 2PMWA 1WSJA 2PDAA 4X2BA 4WP9A 4K0KJ 1FA0A 4NYOA 3OS1A 1Q18A 3QESA 3TWHA 3GLJA 5F3TA 3CJQA 1HKCA 2HGLA 4URQU 3I32A 3F9MA 3KK3B 1P1TA 4RBUA 2KG0A 3OTEA 2HMIB 5HMZA 3G6YA 5M2PA 2KZMA 1YRXA 4H0XB 1IBKK 3DDIA 2HK3A 2W2MP 2D74B 2BKNA 3OYHA 2VQFJ 4CTAB 3KLVA 4QAGA 3SMPA 4RG8A 2KRBA 4BRPA 3UO0A 1U1RA 1TL1A 5C5JA 2QA4N 3TUZC 2NXNA 3PJXA 1PBAA 3EMTA 1ZBHA 1CULB 2M70A 2CADA 1E6VB 1HR0F 2BMBA 5AQZA 4D3HA 1JLCB 4DX7A 1IKYA 1RYSA 1EAYC 4R79A 4X4RA 3L6QA 2ASMA 2KTQA 1HI8A 1HNWK 3P3DA 3FZMA 3CCLN 1S1WA 1F5AA 2XYPB 4LF4F 4HT5A 3V4MA 1FJGF 1OY9A 4DSJA 1KRPA 4WU2A 1N36J 1FFSB 2UUWA 5CXTA 2CQPA 1UCNA 4BGBA 3QLHA 4MKYA 3E01A 3MI7X 3J8AA 1F3VA 2KJWA 2B4UA 1WEYA 2CVIA 1RADB 1QVFM 4USUA 2ITGA 3FE1A 2DTJA 1CLFA 1M5VC 3T1YJ 3MM7A 4NLRA 4F4AA 1TVRA 2OUGA 3H5YA 2MXYA 2A1RA 4I2QA 2LP4A 4LF1A 5T7LB 1QS4A 1WSIA 2DXFA 1JLGA 2P9UB 1U25A 3PO4A 3JAMU 4ZP7A 2C3PA 3I33A 2QWNA 4OYWA 4UT4A 4QR2A 3IAM9 4IG3B 3THPA 4URGA 3OVBA 1FHTA 3G8TA 4DV2K 3TAGA 1VQOS 5KT3A 3DKDA 4A62A 4CEDA 3T6JA 1U09A 2CDQA 3TA2A 3VF4A 3FMWA 4CJ7A 4CZEA 3P8BB 1QHTA 2XO7A 1G2EA 1MWKA 3ZX3A 1S0MA 4JOUA 3WEEA 3L9ZA 3TYTA 3K5MA 1WOQA 3UCUP 3QGGA 5DZ6A 4X4NA 2LLZA 3FBCA 3DI6B 2WK4A 2Z8QA 5L39A 2IBKA 1BOTO 3T41A 2ZE2A 4FPRA 2OPSB 1S9FA 3O8MA 3FCVA 2DISA 3IKMA 1P90A 2HFVA 2VFRA 1VSJA 4BC9A 1LOUA 2EBEA 1X5TA 1S6UA 3UIQA 3UDLA 2X6NA 3WQTA 2J0SD 2DNQA 2YKMB 4P75A 1PJ5A 5DM7Q 2KYZA 5AQIA 2HZVA 3QFPA 2JH3A 2Q31A 1OSCA 4I67A 1YF5L 2YI1A 2QKBA 2YNIA 4DSFA 1ZETA 1UZHA 4L8RB 1EETA 1WOPA 1Q1KA 2VC1A 5H9EJ 3SAGA 4A57A 4CJVA 4DN9A 2FB0A 1RDUA 5C25A 4BRGA 2R8IA 4P7TA 4B9MA 1N5VA 4RO0A 3T1HJ 2UXBK 4P7VA 5I3PA 5AQKA 3CF5L 5DS7A 3BH6B 4KGXB 1YG0A 2ASLA 2C42A 2VFUA 2NXCA 2OZSA 4E1JA 1CEZA 3HSJA 5KG3A 3KLHB 3EDQB 1D8ZA 3SQ2A 4DPTA 4JD2A 4V19J 1VBYA 4JI0J 2KM8B 4NLXA 1ZM3A 3O6QA 1EARA 4H54A 2WBNA 4PXBA 3CWJA 2B4JA 4DQ8A 1VK3A 3F41A 2WSEC 1UVLA 4DR5J 4DUZK 2DY9A 2HFSA 5IT9U 4BC2A 4BRQA 1NUEA 2HHVA 1NH8A 3I0RA 1DARA 1KEKA 2WONB 3VAMA 1U1MA 3O1BA 3AO1A 3OW2M 3NCRA 3M6GA 3F56A 3J7YI 3HL8A 1OWXA 1N52B 3PKMA 2V9KA 3W8PA 2RNEA 4URSA 4Z4CA 4YMEA 2LQ9A 1QQNA 2VODA 2XTJP 5BR9A 8ATCB 1S79A 3CCJN 4ECYA 3WT0A 3G87A 2CJAA 5BRHA 3SYZA 2DNMA 2OSQA 2CQ4A 1WELA 1S1UB 1U4BA 2CG8A 4YDUC 2AT1B 1BA0A 1TK5A 2Q3PA 2KXHA 3TAPA 2OTLN 1HNZJ 1NGIA 2QL5B 1B64A 5BYSA 4C8NA 1W97L 1BGXT 3HYFA 2P9SB 4KHMA 3C15B 4ZN3A 2HHHK 3WQUA 3UQSA 3HHLD 3THXA 2X7IA 4WK3A 1W7WA 4F0HA 1Z2ZA 2R8GA 1PGZA 4HR2A 5A8KA 2YX4A 5LSOA 4LFCJ 2A18A 4B3MJ 4IFVB 3AO2A 3CCMN 5AQVA 2FY1A 3SQ4A 1QSSA 1U6ZA 3RZAA 3H5UA 2HHTA 5KFGA 1TKTB 4PPDA 4DV4K 2Y3YA 1YJUA 1IKXB 3RUBL 4K8XA 4USIA 2DXEA 3QINA 4M5HA 4ZPWR 1N36K 3MCOA 2HMPA 4QU6A 4NYPA 3ITHB 1VSKA 1WTFA 4AH9A 3ZXWA 4A8MP 4Z4IA 5HLFB 4H8KA 2VL1A 5JVGQ 2LU2A 1H2VZ 2HLTA 3ENAA 4F50A 2MQPA 4NO7A 5IV4A 2MKCA 2I6WA 3JSMB 4A2BA 4FCYA 1Y64A 3MOJB 2GIFA 4LF4K 3LPTA 2BKPA 4ZLLA 3DMJA 2IC3B 4ZIWA 4FJHA 4IH6A 5HANA 2CPIA 4A47A 4LFCF 1Q0NA 3PX0A 1ZTTA 4E98A 2NZCA 1CZBA 4YDUA 3RMCA 2MQOA 3PIOL 2CPYA 1HBOA 4CZFA 4LH5A 4FYVB 1DZ5A 3G9CA 3FLCO 4IR1A 1T94A 1RT6B 2EKYA 4DL6A 1XNQJ 4FWLA 2R4FA 3CMAS 1HYSA 3AA5X 4K4VA 4LQ9A 2IFXA 3OVAA 4OX7A 3RB4A 2Z1JA 1SC6A 5AXMA 4P74A 2V69A 3FVYA 2MQQA 2EWSA 3EN9A 3LP0A 4B1YB 1S77D 3CCES 2W4PA 1T8EA 5JJBA 1ZPWX 4KI6A 2APOA 2FVRA 1JL1A 4IOAL 2D3OR 3QRQA 4E0DA 4X4PA 2O8FA 3FCWA 4B1UB 4UQTA 2X1BA 3V9UA 3FFKB 1F2HA 2DYAA 5D3GB 3SFUA 2HF3A 3CETA 1L3VA 2OAUA 4C48A 3OBWA 4MKVA 2ERRA 4FJ5A 1H1VA 2CWXA 2ZH5A 3KHYA 4A8KA 2W24A 3DOKB 4PUOA 1KR4A 1Q79A 3FBFA 3UR0A 5BR8K 3QYYA 3D1OA 4A5AA 1VSHA 3MN9A 6FD1A 4ZVEA 3GFYA 5KRSA 2Y9HA 3D2EA 3TUIC 4GMKA 7FD1A 1WOSA 4DTRA 1Q82O 3JB9k 4TVAB 2BKOA 4YNQA 1O6XA 4OPKA 4E7HA 3BGRB 4K41A 1J27A 5AR0A 2O8EA 1HHQA 1WAJA 1QJHA 3QATA 5KG2A 1IWGA 1QZ5A 1XMBA 3M6WA 2RS2A 2FZKB 3MUMP 1IBKJ 2UXDK 3DRYA 1XNRJ 1VQNS 3BDPA 4GVLA 4DCJB 2VOPA 4H4MB 2JVRA 1IH7A 4FWOA 2ZH7A 2EXUA 5HAOA 4CHZA 2UV8A 4FPBA 2RKIA 2BM1A 3EY1A 3IXQA 3BO3A 4FSVA 2AX0A 4L74A 4FLUA 3S9HA 4BCAA 1CSJA 3NP5A 1GOBA 1HLUA 1VLOA 1KVBA 3NG8A 4WP3A 1ZZFA 5KG5A 2D1KA 3PZPA 3FGVA 2QYGA 4E89A 5B7WA 5AE2A 1JCGA 1S97A 3Q8YA 3V81A 4WK1A 5HVGA 1XTZA 5M2RA 1RZMA 5KFYA 5LMNJ 2E8AA 2DGQA 3FZBA 1RI7A 1FJCA 4JI4K 1FEEA 5KPZA 1NSAA 2V8DA 4KV8B 2MZJA 1S0NA 1R27B 3BGRA 1LAVA 1FKAF 3AD7C 1Y97A 2VJUA 4USKA 1N0UA 2AZ3A 3P5TL 4HDHA 3QICA 5IWAK 1BDGA 4ZVSB 4PR6A 1T0TV 3P45B 3KZBA 3DLKB 5HVFA 4RNOA 1N34F 3S7RA 1IBMF 3D68A 1N33F 2P9SA 4EAHD 1K0VA 4PUOB 4ZN1A 5LMUK 4DR6K 2FJEB 5GAGI 2J8AA 5C12A 3ZSWA 1D5AA 4BREA 2HF4A 1YTUA 4K0KF 5HP1A 3G6VA 2DITA 3IWXA 2BJ9A 4JI7K 5KG1A 1TKXA 3CD5A 1JMTA 3HHEA 4W5QA 5LL6d 3QZ7A 4CZCA 3GWCA 3VESA 4C1NK 4P9SA 1HNXK 2ABYA 5C10A 1DURA 1YQHA 3IG1A 4XPEA 4DUYK 2O8FB 3VGSA 4Q8EA 3DLHA 4H4OA 2CGJA 1PAUB 3W9HA 2HBYB 1YRUA 4L73A 1Y5IB 1LQ9A 2HVIA 2DFFA 1D3WA 3BR8A 3ENQA 2W4CA 3OTOK 2GC8A 1DKGD 4JHDB 1RP5A 2KT5A 1NGGA 3VERA 1XR7A 2DPIA 4XDCA 2YNGB 4KFBB 2J6UA 4B3OA 1RAEB 3KTQA 2RUGA 1J5OB 2QMWA 1QDUB 3GONA 1HQEB 3TU5A 1RDBA 3NFAA 1YWXA 3QRPA 1BQMB 2FTRA 3R1LA 3DN9A 4ZPTR 2E1AA 1OY6A 5MLCQ 2D0CA 2QLFB 4DX6A 5HRSA 3D2FA 1N56A 1LWCB 4UY8T 2DHAA 4NRUA 3DMJB 2GIQA 1I94F 3ZT0A 4FWNA 2CJQA 2NRHA 4FS1A 4AF1A 1M1KT 2U2FA 2H3EB 4CLPA 4DV7F 3JSMA 5IT4A 5GAEU 1TQLA 1IBLJ 1CJTB 2HEKA 2ZWOA 2XB2D 2Q6BA 3IWNC 1WSHA 4WP8A 3G82A 2HBKA 4ETZA 1U24A 3E01B 2XSJA 3MDQA 5HRNA 4CLTA 3HFZB 1GMVA 3WX8A 4LY7A 1FDDA 4CI6A 4DLEA 4CJ4A 4RW4B 2L48A 3TEHB 5CYJA 3FRYA 4OHWA 4EZ9A 3A3PB 2E7XA 2GTDA 2HBQB 3ENHA 4DV1K 3NF8A 2HQCA 3CC2N 4QR0A 3C8YA 3ATVA 1FD8A 3BS9A 1GFWB 2YH1A 4M41A 3RMAA 3T3FA 3QGIA 2BW7A 2HHHF 3QDKA 1IQZA 6FDRA 2IVMA 4X62F 2LFVA 3A8IA 3A5OC 2PD1A 1U0SA 3LPYA 1R6YA 1D9DA 4LT6A 4WTOB 4P2FA 1RT1B 3A8JA 3FEZA 2E5HA 1JX4A 1U1NA 3H5XA 3R97A 2OJ3A 7FDRA 4X4SA 2M8DB 2NR0A 4X66K 3GP9A 2EBGA 3OXLA 2LDIA 4ISEA 2GELA 1HNVA 2RQ4A 2UXDJ 2VGMA 1GX6A 1JLGB 4OX6A 3ULEA 1YX2A 3UW1A 4FW1A 1ZH5A 4ZDNA 4CJFA 2CJBA 2HSEB 1UEKA 5GIPA 4OGCA 1NK8A 3C6TB 3CXCM 4FJLA 2HHHJ 1J54A 2EC2A 1FDAA 2R7QA 3T1AA 4CGFA 1ATNA 5B09A 2M8HA 1VJWA 4TY8A 4IH7A 1ASUA 3CCEN 3MM8A 5IS2A 1HW9A 1H74A 1ZBSA 2F8EX 3AO4A 2IM2A 4CJTA 1DGKN 2OIHA 2CYYA 4PABA 2MZSA 2PO4A 2VD3A 2QO3A 2QM1A 4J9VA 2IS3A 1OH5A 1SCJB 4CGIA 2J76E 1K73O 1U6FA 3J7Z5 2G8WA 2IMWP 2UZAA 3M05A 4EYIB 1WD6A 1HYVA 3J81j 3G10A 1I3OB 2IJFA 2QLXA 3KG1A 1JLCA 4LUBA 1UJ5A 4ECXA 5K8PA 2H3GX 4CK1A 2J9DA 4CK2A 4BHQA 1HFEL 1Y4ZB 4UZBA 3HVRA 4AQYK 4M5JA 2QA4S 1XBWA 3OD2A 3D6MB 3IRXB 8RUCA 2MGZA 1NH7A 3MX5A 4KIAA 3QT8A 4HHHA 1R0BG 5KG7A 3O4QA 1X60A 4P2MA 4FW2A 4N76A 5AXNA 2YBVA 1VGYA 4ILLA 4BQLA 3M8WA 3UN3A 4OX9F 5E0OA 4WFZA 3CT9A 1RHQB 2B9YA 2GW8A 1RXOB 2M0GB 1I39A 3CCRN 2QWQA 1JK9B 2RF2B 2KJVA 5AXKA 2J4RA 5HROB 4M5MA 4NXNF 3CC2S 3AA8A 4IO8A 4BE0A 4CT8A 4Y1DA 3P39A 2ITMA 4I1TA 2N7CA 5EOYA 2GVDB 3PY8A 1HR0K 1RDRA 2IDLA 4DU1A 3H20A 3H3OB 4ER8A 3K5LA 3ATUA 1HW8A 1RDDA 3KYLA 4O3RA 1WN7A 1EP4A 2HKEA 1CG2A 4X64J 3K8WA 5HK4A 1HWKA 2VF3A 3I31A 4FJJA 1GXLA 5KFBA 2DY1A 3BSAA 4IDKA 3KHHA 5T7LA 3BO4A 4F4KA 3NF7A 2ASDA 3DLBA 3OFGA 5D15A 1NDKA 4IO9L 4LH4A 1CC8A 2EC0A 3MWPA 2M7SA 2MQ8A 2V34A 4RKUC 3QETA 3ID6A 4PY5A 2FHKA 2LQJA 2XNRA 1NMEB 1WF0A 3V1OA 3LL3A 4LRDA 2PEBA 3TVZA 1VMBA 4DFKA 1S6PB 3Q2TC 3ILLA 3E51A 3NKYA 2HGNA 4AE5A 2HRTA 5GADI 1R0AB 2UUBF 1XQSC 3GE9A 4EHTA 2QTDA 3DGPB 4M7YA 3MFIA 4CK3A 2VG6B 5J1EB 2FYXA 3ZSOA 4CD3A 3OBYA 5EGYA 2XYHB 4YQWA 1F9HA 4JKHA 2DNLA 1Y5NB 4ZLJA 3QIPA 2DEJA 4JS5A 3VCDA 2P5OA 4C0HA 4JI5J 3ZEUA 4A8FA 5IWAF 1WC0A 4O3PA 5DJBA 4ZP9A 1UAWA 3DM2B 3V1RA 1ZA1B 4OYIA 4DJBA 3OV7A 3CQ8A 1CJTA 2FJAB 4I6MA 1T05A 1EJ7L 3NLCA 2QL9B 3NE6A 3SBGA 1BIUA 1SKSA 4KH4A 4RZRA 5BN9A 3B78A 2IAJB 1P1LA 5ADZA 1IR2A 4LRBA 1DFDA 2V4QA 4I0WA 3MCPA 3TR8A 4FF2A 2L9DA 1FX2A 3CIPA 4PA1A 4IYQA 2DO0A 2D3UA 3M8PB 3E9LA 4B3OB 3O5TB 3OYNA 4QR1A 4M1KA 4PRFA 2ADBA 1RDWX 1BUPA 5THWA 1TUGB 3DRPA 1YIJS 1GMWA 2EVZA 3T1HK 1X4GA 1T6DA 2EFOA 4NE9C 3AVAA 2ZBIA 4JV2A 3MTJA 4CJ5A 1DRZA 2CQIA 5DRKA 4BRCA 1YTAA 2DHGA 4KYZA 1E6YB 3QEIA 3LDQA 1TMJA 3HRGA 2V94A 5KFHA 1XR5A 8AT1B 4DV6K 1CQNA 3M30A 4MFBB 1EWRA 3LP2B 3CYMA 5BYQA 3D5MA 2L41A 2BVZA 2ZKTA 3KD5E 4FN5A 2B0GA 3O80A 2FBXA 4HKQA 2ZJPQ 3VQ9A 2E6LA 1V4TA 1E4FT 2DCLA 3WC0A 2R7UA 3W0LA 2VB6A 4E1NA 3GZ7A 3KNAA 1MG7A 3G8QA 2ATLA 5G0RB 2X1FA 3C16B 1JL2A 4JUZA 2QC3A 2IY5B 4OJHA 4V19X 1VHIA 2UV8G 4KHPK 1RT5B 2E9ZA 2VPZB 3GQCA 4H5NA 4FOIA 2H4YB 2XS2A 2EK6A 1QLNA 5KFJA 3RR7A 5CQGA 3AO3A 3I9ZA 3NMUA 2HURA 1W0HA 1ZC6A 1EB0A 5H9FJ 3H40A 3P38A 2I1RA 1BQMA 2ZNYA 4M3XA 3A13A 1C0TB 3L2VA 3EJMA 4NZ6A 4A59A 2HHWA 3GV5B 1KVCA 2FJXA 4CIEA 4N56A 5KFUA 3CCVN 3CCRS 5AXLA 1AA1B 3M9OB 3VAKA 1SJ3P 4JHDA 2CQ1A 4BRHA 3EXYA 4ZCKA 4OFZA 5C15A 3C65A 4KHQA 3PEHA 4BE2A 3L2UA 4NASA 2NUUG 2O8BB 1RISA 3AQOA 3I5CA 3VGVA 3R2CJ 3BQ0A 1Q9XA 1OH8A 1N36F 5DG7A 4X62K 4B08A 1XNQK 3OTBA 2E1YA 3RW7A 4FNHA 5EX3A 2RKIB 4LFBK 4ZK7M 5FROA 3IG1B 5KFCA 2V2ZA 4ZHRA 2BABA 2IM1A 4G9ZA 1W2IA 4X4VA 4FJ9A 3OYGA 3JTPA 3Q24A 1KAYA 4JKGA 3P1GA 5B08A 1WBBA 4RWWA 3R5JB 2E5GA 3OYAA 3AGRA 2XRIA 5ETTA 1HBMB 1A5XA 2HAFA 4B9LA 2IJRA 2A41A 4M3WA 2B4OA 2PMHA 2VQEK 4O44B 3IR5B 3QO9A 3V6DB 2IYIA 3LP3A 3H2UB 4O23A 4DU3A 2WAQD 3G25A 3EGWB 3H5SA 4I9QA 2KI2A 3HTVA 3CJKB 4R5PA 3M2UB 1Z2LA 4KV8A 3BDEA 4LF5K 2HYIB 3M2UA 3ZFVA 3MEGB 4TXSA 1KFDA 4BRLA 1SL1A 4DU4A 2K7KA 3NEKA 3HVTB 1KCFA 2B6AA 4ED8A 2DR8A 1QM9A 3Q7CA 2ASOA 3HBTA 3VETA 3EVMA 4ED7A 5B8HA 3GYGA 4TSXA 5RUBA 2VWKA 5AQUA 3LWMA 1QVGR 3S6EA 1HBMA 1ZOTA 1VQPN 1S1XA 4ZCLA 2ZEJA 3J7AP 4DI6A 1MLAA 4ZMMA 1GMUA 5M1PA 3DWLA 2IRXA 1I94J 1EX8A 5G0RA 1IUJA 2WC9A 2FBVA 5KG0A 4WFXA 3J7ZT 3FRZA 4K59A 1EX4A 2ZWHA 3BV8A 3W5ZA 3CCVS 1IM4A 2ALYB 4Q0BA 2VA3A 1ICEB 2AA4A 1NPKA 2WVCA 4H5RA 1HBOB 2LQ8A 4NMLA 5AQRA 5DGAA 3SMZA 2E5LJ 1HYZA 2D41A 3WXIA 4MYTA 3PYDA 3U3YA 4WFYA 1X8DA 3FSIA 1UVJA 4NXMJ 4FO0A 2QSWA 1HA1A 3UKUB 1XC3A 2D69A 2J9DE 1GQEA 2C2MB 4ZPDA 3E66A 5J1PA 1YTYA 1MSWD 3OYMA 4YOTA 4OPJA 1N33K 3BSOA 3GFHA 3KK1A 1WC4A 3EWGA 1RBUA 1OMSA 1FKPA 1X31C 3JTNA 3PV8A 5K8MA 4RL1A 4AUKA 4E1MA 4JRPA 1KDNA 3J7YP 2RB7A 3MD3A 1YJNS 4M42A 4XH1A 3PJ9A 1I3AA 3EKSA 4IQMA 1JLQB 2D4WA 1RTIA 2UU9K 4IUFA 4KTQA 3MZIA 3O9SA 4JKEA 3PACA 1JLEB 2PFUA 3T5KA 2OELA 1IKXA 2O1PA 4LBIA 4Q2MA 1H7WA 4ETXA 1NNEA 2MB0B 1HMVA 2KVQE 1N8RT 4NA3A 4M5NA 4BG9A 3OVNA 4AILC 4DOZA 4CFBA 2XZTB 2V5HG 1C1CA 2QFIA 4FJXA 3H4BA 1A7GE 1U1QA 4DR7F 3K2PA 1WG5A 3IFRA 2VYPA 4OZ3A 4JI1K 4IO9Q 3BKUA 1U0HB 2G8KA 4RUHA 1MWMA 1FERA 2DCUB 5E7OB 1REVA 2OEKA 2UUBK 2VQFK 3ILJA 1ZM4A 4KSEB 3BF1A 1S59A 4DB3A 4NYFA 3NVMA 1TYQA 4DR4F 4EEYA 4WFNL 3HSGA 3POTA 3JAMO 2CXEA 3H7HB 2PI4A 3AOAA 1TAUA 5BPLA 5B0CA 5LMUF 2F7TA 2HS3A 2HGMA 1S1UA 1S6PA 4V19S 2J6SA 1Y10A 1X0PA 4QOZB 3IA0A 1ATSA 2IC3A 4GKJJ 1S6QB 3LANA 4FLWA 4X64F 1RDCA 1TELA 2XQCA 2ZOMA 4BC3A 2WB1D 5LJWA 1OJ4A 2GAGC 2Z56B 3I5AA 1FF2A 5AJ3J 1S22A 4EP4A 3ENBA 1FXLA 3VQBA 2DTUA 3CERA 2ZD1B 3SCJE 2AYBA 1WUUA 1S4EA 1R8PA 3ADAC 2B7CB 3LZIA 4OZLA 3T6BA 4ZP6A 1VC5A 1WWHA 4OYOA 3Q8PB 3PYGA 3ZTOA 4BWJA 5DO2A 3QWUA 2MKIA 3PM9A 5L1IA 4F2SA 3VZIA 3JS9A 3QNOA 1JLFA 3C6AA 2HBRB 4F3OA 3UVJB 1SQKA 1HPZB 2LXUA 4X84A 2RUSA 5LMUJ 3DOLB 5AQNA 2HQGA 3QEXA 1YBUA 4O3NA 3DLRA 3W60A 5FDLB 2LQ5A 3HHLC 3PLAA 4A46A 4ZVGA 4HH1A 3DXSX 2AHOB 1W9HA 1T9XA 1UETA 3FSYA 3H2LA 3BGUA 4LF7F 2EEYA 5HROA 2J8SA 2ZH4A 3OTOJ 2X78A 2PE8A 1GXUA 3EXCX 3TZWA 3QIPB 1UW9A 5D4NA 3ZT1A 3GSDA 1XNRK 2VV5A 3UE2A 3SZ2A 4PG8A 5BJRA 2FC9A 4FL9A 5FPDA 3D0IE 4DV7K 2HFOA 1NCLA 3H6EA 5IT9O 1KD1O 4FWMA 1WBDA 3SCXA 2QWMA 3BH7B 3LAMA 4JI6K 5LXYA 3O5BA 4EGLA 2ROGA 3IP0A 4PYDA 2W1BA 3VAIA 2OPSA 3UWTA 3KNGA 2CQ3A 4RR5A 1HARA 3VHQA 4IWVA 4X65K 2NCKL 3TTDA 1JKHA 1LK5A 4OLOA 1VOMA 1BLUA 1KQKA 4AHCA 3AB2B 3JAMY 1R59O 1S12A 2ZGZA 2GBZA 2WVBA 2YKNB 3L2RA 2MZQA 3BKTA 4YP3A 5GAGP 1HHTP 2VQEF 3QSYB 4KY3A 3ZC4A 2XZDB 5KT6A 5B0FA 3A1YG 1QAYA 1C0GA 4P71A 2HRUA 1WKKA 1WHYA 3HX9A 4WPAA 3I87A 5L8RC 3BSNA 5E3CA 3CMQA 3A5NC 2FPHX 4FYXB 4LF9K 1QE1A 4DQQA 2Q2RA 1F9EB 2RQCA 2EFVA 1V5IB 4U8YA 4FXVA 2EFGA 4CI0B 3AAQA 1FJGJ 2GV9A 4L75A 4JKDA 3TJ8A 2DPNA 1YI2N 2GUPA 3BN4A 4NLOA 1KTVA 4BC4A 4YOXA 2EG1A 2YPYA 2YKMA 2DT9A 4M3ZA 2QEXS 4X4TA 3D6RA 3VR1A 1L3SA 4DFMA 2AU0A 3J7ZO 4FWRA 3D9BA 2IVOA 4F3QA 4RNNA 1J5EK 2A10A 4CEQA 4HTUA 1VQNN 4EFHA 4JI8F 2F9WA 2HNZB 5KFPA 3MUVP 5HI7A 4JI1J 2NRZA 4DZ6A 1LFPA 1NMNA 2GGPA 4MJKA 4U7CA 2ZH8A 4CFDA 1H7XA 3WQPA 5M1KA 2E66A 3TAFA 4UOHA 2VFVA 2L9WA 4M5IA 1L3TA 4Z4EA 2DGTA 1WDTA 2CWKA 3AVBA 2E1PA 1VQKN 2ATCB 2Q66A 4ECUA 1FJ7A 2K1RA 2VIHA 2UUTA 1EKSA 3BB5A 3MCMA 1JLBA 1RT3B 4AQYF 4X4QA 3CJ7A 3RG6A 4A8YA 3CDWA 2BE2A 3PR5B 2D0BA 3U27A 1KVIA 1IBMJ 3M8SA 2BZ2A 2POKA 3US5A 3R8EA 2AWZA 4M63C 4F4ZA 3TOQA 1P27B 4R8UA 4KI4A 4Z7YA 4RLEA 2DNYA 1CVJA 3AA9A 4FWQA 3GG1A 4KAZA 2FHJD 3EX7B 2HG4A 1S1TB 2P9KB 2A42A 3VVUA 2OTJN 4ICLB 4CLWA 3VWSA 3RBEA 4CGGA 4NB4A 1GTEA 3LPEA 4EYHB 1JIHA 2RU3A 4JV1A 2W8LA 4ED3A 1I5OB 1Q5VA 4BRIA 1X4DA 4TYBA 4DL5A 3T69A 2QMXA 1NK5A 4U9RA 2W42A 2YXLA 3G8SA 2UU9J 2YHAA 4PKDB 1WC5A 3V9SA 1GEHA 3MX2A 5KFXA 1VSMA 5J2MA 5AE1A 1J5EF 4KO0A 5I3UA 4C97A 2WSFC 4RW8B 1WLJA 4AHRA 2YKNA 1TU0B 3UN5A 4CE9A 3R2DJ 3CJAA 5JS1A 3CULA 1Z4UA 4U7UK 1X0FA 1RWKB 1YKWA 3B54A 1U0HA 2YTCA 4O3SA 1SKRA 2AP6A 2NZTA 1W7AA 3K17A 1LWEB 4IOBA 1CJUA 5FPEA 3TVYA 2GMHA 2OMOA 2CGLA 3IC1A 1KAXA 4DV0J 3MAHA 3SUPA 4EI2A 2GO8A 3VEVA 3UFCX 1BY9A 4JRQA 3LDOA 4HACB 3DHXA 4DUZJ 4AM7A 1XC9A 2AJ2A 3MPYA 4MO4A 3CJ8A 1W2BR 3VEZA 4DPYA 1WI8A 2HS0A 3BR9A 2HFUA 3V5RA 5FRNA 4FZXC 1WUAA 1PC4A 4I9LA 1T9WA 1NZ8A 5AQLA 3N5FA 4YOWA 4B1VA 3L4BC 1LEOA 4IDHA 3ILIA 1WSGA 5DQGA 1SQFA 4ECTA 1X5SA 3AVLA 1H38A 4X65J 4HT7A 4QPXA 2WTUA 2EW9A 1Q9YA 4KGMA 4J9RA 3BGOP 4DR3J 5JMVA 4M5DA 1ROFA 2MY8A 3VQPA 4FLVA 1KQGB 2UXBF 4DMNA 1JNRB 1KLMB 4ID5B 2VBXA 4TQRA 1KFSA 2MLXA 5ELZA 2Q3SA 5AFUH 1FCAA 2FSKA 2BRKA 1KQSR 4MH8A 4WWSA 4WFAQ 2G2YA 2ZUGA 3HM9A 3IR7B 2YHYA 3QIDA 3L0QA 5DK5A 1HNZF 1JLFB 4U96A 1NK7A 4OZ0A 1CXUA 5D77A 4WZQA 4PKIA 4B3MK 3L4QA 1HD0A 3PW7A 3AY0A 1ZAXA 1XN9A 2CQBA 2D7SA 5A76A 2G8FA 4JS4A 3VTIA 4JEPA 4BR0A 4BGAA 1H2TZ 4QS8A 3WX4A 3CC7S 4TYAA 2QMUB 1YJWS 2LCWA 3TX8A 2IDOA 3BN7A 1D09B 3BZKA 4KPYA 3U4LA 1WKLA 3Q8UA 3CCJS 3FMBA 1SC4B 3KHGA 2HPUA 2BBEA 3N6MA 3D0PA 3HVTA 2K7JA 2HLUA 4YHHK 2PZSA 4C8LA 2IM3A 3MMBB 3SQ1A 3CJ5A 5DDQC 4WE1A 3MEGA 1WG1A 3RRHA 1AYEA 2DNNA 2A0FB 5HMYA 2XHWA 5GVQA 4U67L 1H73A 2JWKA 3WIUA 2IM0A 2FC8A 4J91A 4EO8A 3RW6A 2K3KA 1GXTA 3V6DA 5D0EA 1NOYA 2GX8A 3V1QA 3UB5A 2DO4A 4WXOA 4O44A 1K1QA 4PWUA 5B0BA 3HFVA 3JSBA 5AQSA 3PXGa 4PQAA 2V4RA 2HZAA 3MDFA 4OJ1A 1NU4A 1XI1A 1HMVB 1J6ZA 1Q86O 4OLPA 3WXLA 2OMLA 3FQLA 5AQWA 1DJ0A 3I56N 4CNZA 2I7NA 4DG1A 1L3UA 5KAKA 3ZZTA 2ZVIA 3TX0A 4FF1A 3R6GB 1SKWA 1XNQF 4G65A 3AVJA 2FJVA 3DJCA 2H5JB 3OBIA 3RU0A 4CH0S 2P9NA 2GHVC 1UVKA 3IAS9 1NGEA 1M90T 3CCWA 2MSSA 2LA6A 4FS2A 1FK9A 1M5HA 2W9BA 1NDCA 4KJIA 3H1VX 2QLBB 1ZS6A 4KREA 2DNPA 3KLGB 4ILGB 4FP9A 4E7JA 2XI2A 2W40A 3Q86A 4K2JA 3RRKA 2CJYB 5AE3A 1DY3A 4RTFD 1K1SA 3QEWA 3DCAA 2CH6A 4BROA 3BUZB 4QQBA 4CLZA 1Y7PA 3CCLS 1N88A 4HUEA 1LAWA 2COLA 1XMQK 3FKBA 3DU5A 4YR2A 4LF7J 2VH7A 2B5JA 4ID8A 3BKFA 4I6YA 1VRUB 4ILHA 1QQMA 1C0TA 4IR9A 3OHBA 3DHWC 3S41A 4JI0K 4A8XA 4LFAK 4QWCA 4OI6A 3RBXA 3KHLA 3AA3A 3M3ZA 4QIGA 2Q97A 4FBTA 1VI7A 2AEFA 1RWWB 4Y2CA 4CF2A 1U2VA 2DGXA 1NHKL 1KHVA 2KW4A 2EI5A 4CO4A 3B6OA 4RUAA 4KHNA 3G4SS 3PJWA 2FSNA 5GADP 4C23A 4NLYA 1IWAA 1EKRA 1IVZA 1H98A 1RT5A 1DQ9A 3S01A 1SB6A 1UJ6A 4K4TA 1WSEA 3WC2A 3CF5Q 2VG7B 4J2DA 3IS9A 3N4PA 2KG1A 1JLEA 2P6SA 3GB0A 3NNHA 2B9WA 3NGRA 4O3OA 4YFUA 1Q8BA 3FC9A 3MTKA 5KFTA 4B3RF 1K73T 4DV2J 2YQ0A 4FWKA 3MR7A 2UVVA 3AODA 2MKHA 3ZZYA 3UKRB 3SXLA 1SS6A 1IN0A 2HWTA 4P72A 4TU9A 2PAVA 3CQYA 3VGKA 2AMCB 1F3FA 2RIJA 1OYEA 1BCMA 3OFFA 4FLTA 4YB7A 4K4ZA 2NNWA 2VQEJ 5D8HB 1QUVA 2HHXA 2HBLA 4ZPAA 1UVMA 5DQHA 5KFMA 3KKRA 1BQNA 4L72B 3TANA 2XCAA 2Y8WA 1RT6A 3NCPA 3HVWA 1S0VA 3FZLA 5HATA 3TAMB 4PG6A 4CJEA 1DBDA 2CJKA 5FPMA 3RJMB 5TKYA 4LR7A 5ETKA 2NRVA 2MLZA 4WFAL 1HRHA 4DU7A 3QERA 2LYVA 1N6QB 4TY9A 3O2IA 5AQJA 4CYUA 4E19A 1NPPA 1E4GT 4DV0K 4TNOA 4C4WA 3VF6A 4FJMA 3P4UB 4EHUA 1IKWB 3IMXA 1OIAA 1HNIB 3GIIA 3M2RB 4M3YA 1FNOA 2ZUAA 3A3OB 1O1WA 2GA7A 1BWEA 3ZNJ1 1VQ4S 1RUSA 2XMMA 4YOYA 3MEEA 2HFZA 3G6XA 2YNFA 1P8ZA 1IBKF 2YKOA 3PKYA 1UJ4A 3OLAA 1FDBA 4CEZA 2CPJA 2HHSA 3VA0A 4RU9A 1S57A 4ILJA 1WDDA 3CJKA 1LW2A 4DLGA 3T7ZA 2I9SA 2VFSA 2R7VA 3VAFA 3GMGA 1TKZB 1BL3A 1UWBB 4KHWA 4KE5A 1L3KA 1VBZA 3QZ8A 1IKVB 1D4XA 3DRSB 1WTBA 1KLNA 4HI1A 4RNMA 3C15A 2KFZA 1APSA 3PCOB 3OA9A 1UFLA 1V9OA 1WSFA 5A6WA 2DNGA 3CPWM 4GV9A 5B0EA 1PG5B 7AT1B 1Q86T 2ZJPL 1RLCL 2QEXN 3QAUA 1VQSA 2QE5A 2JZ5A 1PAEX 4E8UA 1RLDA 1VSDA 1VIXA 2WVEA 2IGIA 2XMTA 2C22A 2OGUA 2RE1A 3N9UC 1UEUA 1EP4B 4J9OA 2HNYA 1F9FA 3ZSQA 5KFEA 3O1WA 5KFZA 3PR4A 2B43A 2B9XA 4PWWA 5CCLA 2DGUA 1N32J 5C24A 3G71S 3ALYA 3Q8VA 4Q7AA 4CHOA 1N33J 5A2QY 1E6YA 4O8UA 1XHXA 4CECA 1G1XA 4DU8A 5BREA 3I0RB 2DHXA 3PHTA 5C42B 1CC7A 2YKAA 4LF9F 3CCMS 2XS7A 3UE5A 3FK4A 3VF2A 3BM7A 1QVFR 1IR0A 1YIJN 4F04B 5D0RA 1X7VA 4BY9C 1PO6A 3O9UA 2VDHA 3CD6S 1HQUB 4TLRA 3U6FA 3W1YC 1NJYA 3CHWA 3H98A 1DQ8A 3IDHA 1TGOA 2V8HA 5EDWA 3AO5A 1HIYA 4FKYA 3RMBA 3CO0P 1IM6A 3HOSA 1R3NA 4KGZB 5ETPA 2VC0A 2OTLS 3DXKA 2B8QA 4DR4K 2VHGA 4K4XA 2WOMA 1GX5A 2F8HA 2P9IB 3ZX0A 4YOVA 3M8QA 4CHQA 1NDLA 2L3MA 3KXDA 3TTCA 2GZOA 3W7BA 2O8DB 4ZLPA 2BUNA 2RU9A 4GKKF 1HKBA 1JLAB 3KJNB 3UNGC 2BGGA 3RMDA 2IIRA 2NPFA 3QPIA 2XY7A 3DXMA 4JV0A 4GV6A 2RILA 3ZX2A 3EVOA 2R7WA 1M90O 5GAHI 2E6MA 2I5JA 3TAQA 1N5TA 1UW4A 3TQEA 4JK7A 4Z7CA 1JWWA 1M5KC 1RWOB 4YN3B 1NAQA 2B9EA 2ZFHA 2E4LA 3R27A 1EHWA 4OPHA 1IJEB 2SXLA 3DC2A 2YCHA 2C3OA 3HP6A 1S1WB 3CO9A 4ECSA 2E2OA 1F0XA 4IO1A 1CZAN 1RT2A 4IFYA 3LZJA 3SK3A 3DI6A 5E3AA 3AVFA 1GLEG 3ZTQA 1IBLF 4H0OA 1SJ4P 1S5JA 5CR4A 3THVA 3WIVA 2A3JA 4MAKA 5IM0B 3IAYA 4I68A 1EQMA 3NWGA 2DRDA 4AXJA 4QCLA 2EHGA 5L38A 1YZ6A 3VAJA 2P9EA 3JXUA 1TL1B 3BBBA 4B3TF 4RW8A 2CQ0A 3OYCA 1R8BA 1VBKA 1VQMS 4WFBL 3SSQA 1U2CA 3TQ1A 2Q1NA 1RDAA 4CIOA 3ZSZA 3A2FA 3NAIA 3GV7B 4C0OC 4DUZF 2QLJB 3BJYA 2V8PA 2QYCA 4I2QB 3W9IA 2GX9A 4OZ1A 2XWXA 4KGVB 3FZKA 1LFWA 2HWHA 3PEJA 2B4VA 3KKSA 5BR8J 3SV4A 4ELUA 3MWTA 4W5RA 3QMQA 3BREA 3LDSA 2HQIA 3ILOA 3G6ES 4USHA 4KHSA 3VAHA 4CZGA 4KHPJ 3QLHB 3A5MC 2JLGA 2ZNZA 4NI2A 2MLYA 1Q7LB 3LDNA 3I6PA 1MMDA 3D0GE 4ZS6A 2Z0GA 3T1HF 3MUTP 4AHUA 4FJ8A 2ZDOA 4RX6A 1PJ7A 4CBUA 1M1KO 4DL4A 2Q0RA 1X9SA 2BJ7A 4NLGA 1BD6A 3QFWA 4OX9J 4KH6A 4J2BA 3T9NA 3KWMA 1VCTA 3PG9A 4LSNA 1EWQA 1LNQA 1M1GA 2YWEA 5LMNK 3M32B 4LFBJ 3CE8A 2R8HA 5AQMA 3E9PA 1DEJA 2KO1A 4NXNJ 2GNKA 3AXMA 3QFHA 1WKJA 5D78A 4K7QA 1CJVA 3R7BB 2OHDA 5FIIA 3W5YA 3MXJA 1KVAA 2BQUA 1NJWA 3IM9A 3OFHA 3CEDA 2BUPA 4WQ4A 3NDKA 4CGHA 4B8CA 4KHPF 3J81U 4ZP8A 4CTAA 1ZBUA 3MGJA 5HOOA 1RABB 3G86A 3GR1A 1RWMB 3H2VE 2XC9A 2G1DA 4WBFA 1W25A 4RCHA 3ELHA 4YS2A 5JXSA 1ZBLA 3QAEA 4DCHA 3DU6A 4LSLA 3OXFA 3P31A 5JUMA 2JC1A 2KN4A 4KAIA 3HD1A 3ULHA 1QQCA 4KBOA 4DF8A 3D6HB 3KLFB 1FVQA 3EZOA 4QZVB 4BWMA 2OI2A 5F8NA 4F02A 1FRKA 1MU2B 3AXKA 3T1YK 2V7ZA 2XMKA 2ETJA 4WYLA 5IOLA 4JKAA 1RT2B 3KIOA 4C3KA 4QW8A 3SI8A 5D4OA 1DTQB 5GAHU 5C0YA 4C0BA 1LV5A 4CP5A 1KC8T 1U1LA 4JV5F 5AQHA 1S72S 4N5SA 1N8RO 1VQ9S 1FD2A 4TLQA 3AVCA 2G8UA 5F9NA 2KB2A 2WVDA 3CCSS 1JXVA 2LXFA 4X4UA 4J2EA 2O8DA 2XMJA 3VQCA 4B3RJ 5KT4A 3M8QB 1QSYA 2OPPB 5HRPA 4ENOA 2DRAA 1NNDA 4DCOB 4UF4A 1NGCA 4CJWA 4LRCA 1YVFA 2QA2A 1U1KA 3D3BJ 1VQKS 4NCGA 3NBPA 4YY3J 2KHCA 4Y0WA 2C3UA 4F67A 3QFUA 2A40A 3U7JA 2R3VA 2FZGB 4AL6A 4FVMA 2Z2LA 5LT5A 4IJNA 3C3LA 3DLEA 4CLSA 1G99A 3GSIA 1S7HA 2G8VA 3OTOF 1XMOJ 2IOCA 2HWIA 3Q8QB 4NLSA 3VMFB 3HPOA 2QWPA 5KGXA 1D0EA 4JI2K 2YWGA 2AEMA 5C42A 3QBCA 1T03A 2NQPA 2DH9A 4BDPA 2VPYB 3VQTA 3AVHA 3VEYA 1TL5A 4DXLA 4ECRA 3C6TA 3DOLA 4OGEA 5C24B 2VDIA 5K9FA 1D9AA 1OQ6A 2G0CA 4WF9L 1RBSA 1RBVA 5E3RA 4ZVUB 4KHRA 3TZXA 4YY3F 2C2OB 4OX8A 1B7FA 2IVNA 2MTLA 4CZLA 4CEBA 1SV5A 5HSPA 3WNFA 2VWJA 3P6YC 4DTMA 2HNDB 3O3LA 4F0KA 2RHQB 3FZ2A 3M6VA 3NOGA 2JEFA 2I0XA 5KG6A 4QWDA 2J9CA 2KXNB 3R3TA 4BC5A 2BH1A 3W62A 1EQ0A 3N5BA 3ASMA 1HHSA 4DV2F 1SL2A 2O8CB 3PIOQ 2A1SA 4HWIA 1QTNB 3PRDA 1VQ6S 3GOIA 1AUDA 4ED5A 3N79A 5HN0A 2AJ4A 4EBDA 4DV1F 3W3SA 3M8ZA 5KOWA 4DL0C 4YOEA 2V67A 4IOXA 4OI2A 2MZTA 2YX6A 1NO8A 2R8KA 1S1VA 3S3OA 1RTZA 4E7IA 2P51A 1K8AO 3MF5A 2RHSB 3EEQA 3T5LA 1RU2A 1F5CA 4DUTA 3AOCA 5D3GA 1REVB 2QXLA 3NAHA 1N4LA 1C0UA 3JQMA 2FLNA 5AQTA 2E20A 3LPUA 3EGNA 3MN7A 3I96A 2KKZA 4EP5A 1YJVA 1RTDB 4M3RA 4KGKA 3TTFA 4H0PA 3D3CJ 4HUFA 1NDPA 4YDXA 3EZ5A 4LRFA 4USVA 5EHHA 1RQ0A 1ZBIA 4MK9A 4AFFA 2VOOA 4GV3A 2PYLA 4UY85 3PRVA 1MMLA 2IA6A 1P9QC 1VQ8S 3DXKB 2P9CA 1HYSB 3BO2A 2Z2YB 1RTIB 5F8HA 1XQIA 4Y1CA 4CLYA 1XMQF 3QGPA 5C2CA 2FVPA 3LUYA 5AQQA 2KKHA 1R7IA 3O4WA 1VQ7S 4CJUA 2GIRA 2NSBA 4LVOP 1QQOA 2V0NA 1QHAA 3TZZA 3PX6A 2YNGA 2AYMA 1HQUA 3OFEA 2YX1A 2JLFA 4YHHF 2P9PB 4TU8A 3EDRB 1VK8A 4DTXA 1FESA 4CLLA 4J9MA 1RAHB 1WOOA 4J8FA 3NGSA 1Q4RA 5LJ3Y 1NWKA 3THTA 2GWJA 4KC5A 4CJKA 4EFAC 3EGVA 4U7UD 4AQYJ 4PL8A 2H54B 2HQFA 1J9AA 1Z26A 2CDRB 1ZZNA 4GVMA 5DLFA 1B0PA 2G13A 3NS5A 3LQVA 3R1XA 5T7BA 1TK8A 5HLFA 4H0VB 3V2UC 3ISNC 1PSDA 4B3SJ 1VQ8N 5K5MA 2AGPA 2IMOA 3O9QA 4OX9K 3OR2B 3PIPQ 2HQDA 4Q0BB 1EQYA 3VN5A 1NSPA 2VKZG 2IHR1 1OSDA 2W25A 2CKWA 1WHVA 1T44A 1KOHA 2BOPA 1RFQA 1NKBA 2E1RA 2PFFB 1TKXB 1KNZA 2GQ2A 3LP1A 4ED2A 2HOEA 1ZBFA 1Q81O 2W7AA 5A2QU 1UTAA 2G9OA 4HDGA 4PYAA 1Z1ZA 3TEGA 1I94K 1RACB 1VSFA 4JLHA 1SXLA 3Q83A 4USMA 4IFVA 3O1LA 3UDCA 2BR0A 3KK7A 4WZMA 2GFFA 3DLKA 2P5GA 3D67A 3Q89A 2YWHA 1YBAA 1UWBA 1T9VA 4G1QB 1M1HA 2UXCK 4NOHA 2E88A 3JSYA 4DL7A 4CEFA 2F65A 3RWUA 3SQGB 3DOKA 3NY0A 5KFNA 2ZHAA 3BBCA 4WE1B 4I2PA 1NM1A 4ITSA 2XO6A 2HZCA 2E5LF 1AB8A 4JYAF 3MPDA 2V2KA 1BWFO 4K4YA 3OYFA 3ZT2A 2WHOA 2BE7D 2VG7A 4DHYA 3V81B 2CPZA 1HNWJ 1X3MA 4CZIA 3CDBA 3KLGA 3SJJA 3M2RA 2DHSA 2ZQBA 3OL6A 4LF8K 1UPPA 2CZ4A 2K2PA 3W65A 4FYDA 2RRNA 4AHTA 2JVOA 3R6LB 4K43A 3H8YA 1VSEA 1T9YA 4DV7J 4ANDA 1ZPVA 4NA1A 5DG9A 4AYBD 5BR8F 2P5VA 4LR9A 4Y2AA 5D0GA 1B9FA 4X65F 4K4SA 3T5JA 1VQ5S 4WF9Q 3L3UA 2GQCA 2Q0UA 2UUAK 1HBNA 1SUQB 2DKOB 4I4BA 3MEKA 4FLYA 3M4XA 5KQDA 3PO5A 2VICA 4WIQA 1NKEA 4MDBA 4ZPBA 1RHUB 2GJ2A 5AJ3K 3M2VA 3MURP 3TARA 4OYBA 4DR7J 4BLGA 3MM6B 3THYB 2JFDA 4M5DB 3U1MA 1HNWF 5J2NB 1VJQA 3TUPA 4XEIA 3GTYX 4A2AA 2ZBRA 1PC5A 1WNEA 5L1JA 4Y6IA 5L9NA 5IFMA 3AAWB 3K89A 1RSCA 1V3SA 4PHTX 3AGKA 3PHEA 1HJRA 2ZJRL 1Y00A 2VBZA 3VQEA 3ONQA 2DNHA 4AL5A 5A2QO 2QL7B 3MN5A 5D0HA 1VQPS 1RWPB 4FDFA 2ZWPA 5I3QA 2QA4G 1G3OA 3W2WB 3ITHA 5F3ZA 2YWKA 2R2RA 4CO5A 2BQ3A 1RBRA 4C11B 1JJ4A 4LF6J 4Z0UA 3NF9A 2V7YA 2DD8S 1UA0A 2RT3A 4GNIA 4QS7A 4WJBA 4HACA 1BCOA 1NHVA 1UOCA 2PC6A 4NL5A 3K57A 4GY2B 3BF3A 2UXDF 1F21A 1JXEA 4OYXA 2V63A 2WCXA 2FDNA 1M0SA 4CJPA 4O55A 5GAGU 2QRRA 1PKUA 2ZZTA 4FJGA 5KRTA 3KMQA 3WEEB 1XWLA 3HKWA 2RD5C 3CUNA 1ZBTA 4AXIA 5I9EB 1VFJA 4JI8K 4FF3A 4JI5K 3ZCMA 5ADXH 1S9GB 2UUAF 4FM1A 3TJ9A 4F7VA 2DHHA 3N6LA 4LFAJ 4DDFA 1RCOB 1VRUA 2PYJA 2ILZA 1SIZA 2ZVSA 3BEXA 3AAPA 1TV6B 4EZ6A 4ELTA 1CLQA 3CCQS 2E2QA 3OL7A 2DNKA 1SJ1A 4ZTJA 1FDNA 3BBFA 4JV5J 3EO3A 2CGKA 4DS4A 2J7WA 4QIEA 3SJHA 2YY3A 2E1MC 5D4PA 1M5PC 2XY8A 1R31A 1RT4A 1BMQB 1HNXF 1NJIO 5EVZA 4DEZA 3T5HA 2J9EA 2BTFA 2D0PA 1Q5YA 1RTJB 3Q23A 3CI5A 2DGWA 4OV1A 3K9JA 3V4IA 3M8PA 4DTOA 2VJVA 4R8UB 3KD1E 3HHDA 4DR4J 2GMLA 2YQ3A 4ZVPB 1VDHA 5A8RA 1KWMA 2RRAA 2LSNA 3HF5A 2JEGA 2BE2B 2R42A 1BHLA 1RT3A 3LALA 3RB6A 4NWBA 2YNHB 3R1HA 4F4YA 3LOUA 2FJDB 4BVOA 3KLHA 4Y3CA 2KT3A 4LC9B 4U67Q 3KDOA 4PXDA 4USTA 4NCGB 4YB1P 2G0IA 5A8KB 2LECA 4CF9A 2F9JA 3BQ1A 2XY5A 4K42A 1SJFA 3I4PA 1LK7A 3I0SA 2GGPB 4EBEA 3OTCA 3VVTA 2I7PA 3CG7A 2HB5A 5M2UA 4FM2A 3I5BA 1ILYA 1NB7A 3CFOA 1MNEA 5E84A 3KJVB 3R3LA 2X1GA 4EO6A 5LSLA 1HNZK 4CGJA 3K8VA 2NXUA 3ZZOA 2YNIB 3PW2A 4JK9A 3OHAA 3TW0A 2H1YA 3ZSVA 3AJDA 2CIMA 3NCIA 2UVUA 2E7WA 1PYOB 2NSCA 4ELVA 4A8OA 2AGQA 4LBPA 4Z2XA 1UFKA 4RNFA 2R9LA 4LQ3A 2PFDA 4P10A 1NK0A 4QYZK 1GLAG 3AY9A 1LW0B 2HHQA 1SZ2A 3E2EA 3IRWP 3TP2A 4J7CA 3NOCA 4DUYF 3SQ0A 3LM2A 3UD4P 1R43A 3KKFA 2WONA 4F3MA 2HW3A 1VQMN 1LWEA 2J0XA 3MCNA 1HLWA 1WSVA 5TKWA 1A5VA 1FNMA 1VRTA 1OPZA 1RKIA 4CO2A 3ENVA 4YUDA 5G4DA 1N5QA 3V6HA 3ZZPA 1A0OB 4NLBA 2EPIA 4LF5J 1Y3JA 1WI6A 5KPTA 4KO0B 3VOVA 2CQHA 1HJOA 4DQPA 3L7OA 3I55S 1G6BA 5AFUA 4O4RA 3TUJC 1D9FA 1VS3A 1UWAA 2QT7A 4OZ5A 4WKRA 3F44A 4PQUB 1FE4A 4LF8F 3PNIA 1BI4B 5DZ7A 2D9OA 1ZM2A 3VGMA 4CIGA 3E9OA 3HT0A 4MIWA 4QW9A 2LQBA 4HLBA 2QKKA 2KM8C 4ICLA 1RGVA 1RAGB 4B8AB 5IWAJ 1X5PA 2P9KA 2E5LK 2EFQA 5IT0A 1BO5O 4UTGA 2VPXB 4DBQA 2IBOA 4KKOA 5AZIA 5KFIA 4LF6K 1U8SA 4HTJA 4RW7A 4IOAQ 3L4IA 4RBVA 4J5OA 1KXPA 4U95A 3V9ZA 3TABA 2X74A 2G1HA 5BPNA 1AXQA 5JVGL 3L09A 4DF4A 3EGZA 1XMQJ 2QW9A 2YKQA 4QBUA 4J90A 4LF8J 2HIYA 4BRMA 1NHUA 3SBMA 1FXXA 1N54B 1XUPO 3EVWA 1QY7A 3NGTA 4PQUA 3CIMA 2FJWA 3L3VA 3NXZA 1QTMA 1JJCB 4P2XA 2RPIA 4B9TA 5CH7B 2CJ9A 2GUIA 2UU9F 1NGHA 4GC6A 4ID1A 3CJCA 1S9EA 5IZHA 4LIWA 3UVJA 4Y2MA 5E2QA 2E5JA 3K5PA 2DJWA 3PRBA 5E3PA 4ILMA 3SDEB 3NMRA 3U02A 1QVGM 1RAFB 2K8GA 5J2MB 1WF1A 3CCZA 3M6XA 2RS8A 4JKBA 4NMXA 2RMLA 3CD0A 2ZH1A 1SH3A 2W2QP 4ECVA 2DIVA 1FJEB 4Z94A 4JYAK 3HSCA 3WZ0A 1JKHB 3LA0A 5KFKA 2IYGA 5L1LA 1RTJA 5F8MA 2KRRA 1VQ7N 2XG8A 3SFGA 4EMDA 1FO1A 2V51B 1SH2A 4FLZA 5T14A 4DMZA 4BVPA 4CLFA 4IKFA 1HWLA 1BWVA 4IRCA 5H1SV 2RRBA 4OLBA 3VENA 3GG0A 2GEMA 5FRMA 1KHWA 2LMIA 2ZZNA 4OO1J 3LWLA 5J2PB 1JNZB 4MDAA 4OKEA 5GINA 2F8SA 1EO1A 2OEMA 2GWKA 3CTRA 2XS5A 4AL7A 3AT1B 4C8KA 3AFGA 1JLBB 3OPKA 1K8KB 3O44A 1NK4A 2RE2A 2AIRB 2I5JB 1HI1A 1NJZA 3TPQA 4DR3F 3V9WA 2AJQA 3A0IX 2JOQA 2C2NA 1WACA 4GO7X 3GJSB 3R6MA 3MPUB 2E1ZA 1AZSA 3AVKA 2UXBJ 2H4WB 3TZYA 5CD4H 1YJTA 1FE0A 2XMWA 3EPIA 4DR1K 1GLBG 4I7FB 4I6AA 2ZM6J 2UP1A 1KQSM 4CVNE 2YNHA 3FDSA 4JI2J 3B6PA 5I42B 3VTHA 4M3TA 4PL7A 5JS2A 1WF2A 4RW4A 3HZ6A 2KVIA 2ZOGA 2VKRA 2CAJA 2MQNA 4PZVA 5U47A 2YHWA 2W7OA 2BQRA 1BQXA 1S72N 4GRSA 1UVIA 2V4JB 1OYDA 1EKEA 1B92A 4I64A 4LF7K 2V50A 1HL6A 1U45A 2YVSA 2CRLA 2WW4A 3OJUA 3NRBA 4YDDB 2FGOA 2LEPA 1S6QA 5J2NA 2PI5A 1QE1B 4FJ7A 3DYAB 3UKUA 4LF4J 1MN9A 3CFPA 5K14B 1F1BB 3QQCD 1YDLA 4HVJA 1N5YA 1URRA 1TUYA 1MWQA 3K5NA 3MCAB 4CH1A 3ENWA 2ZHOA 1ZA2B 4B9SA 2ZM6F 3MOZA 2X3DA 4JI2F 5K20B 2C28A 1KBRA 1TYQB 2R7RA 1X1PA 3TSPA 2XGPA 3HSDA 4W90B 4B17A 4OMFG 3WDOA 2UVWA 4H0TB 4RUBA 2Y0BB 4RJVA 2GJIA 3W2VB 5BPMA 1JJ2M 2F40A 3CJSA 4YR3A 5HO4A 3KG4A 3JQKA 5KG4A 2QGFB 2XY6A 1VHFA 2D9PA 3V6JA 3L2QA 3HZEA 2M52A 1CZ9A 3R7NB 2NLWA 1S1XB 3OY9A 4UOGA 4LF6F 2RAQA 2MKSA 3OXGA 4Y28C 3OYIA 3GR0A 3BQ2A 3TA0A 4FF4A 4NPOA 4Z4HA 2KLAA 3C6HA 4M8LA 3FZFA 1FRLA 5KFRA 4C8OA 1QUPA 1U2RA 3MAQA 2J5AA 4J9SA 4I69A 1Y0HA 1XMOK 1Q7YT 1LWXA 4I2PB 3R8YA 4OPAA 4IEEA 3LAKA 2VZ9A 2OP5A 3POTB 1FKOA 5DGBA 4R5PB 4X66J 1HD1A 2VG5A 2KFYA 2E7VA 3KK2B 1FI4A 1RT7A 5F8IA 3RAMA 3AOBA 5ETSA 2DGSA 5AQXA 2ZJRQ 5GIOA 1HWJA 2N82B 1WC3A 9RUBA 3DOMA 1UEVA 4W98A 4M63A 3TRGA 2FC0A 5DM6Q 3OYEA 3M8YA 3MMAB 4OJ3A 1Z05A 1UAXA 1U8WA 5J1NA 3QJLA 2QZ8A 2VBWA 4CF1A 4HHJA 1U7LA 4DV5F 1S49A 4CGDA 3EKUA 5M1NA 3Q22A 4QIVA 1SUQA 1JXBA 3WNEA 3B4DA 4KBIA 1VIOA 1NK9A 3A8YA 4LFBF 4WQ5A 1HPZA 1F5BA 4HVZA 2H48B 1RAAB 1X9WA