3LP2A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/hydrolase
total genus 153
structure length 554
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp2A05
4DF4A 1KVBA 1EXQA 2RF2A 1WSJA 3AVFA 4W5NA 4FK4A 2FVPA 3RRHA 1O1WA 2HW3A 3RB3A 1TV6A 4BE0A 2HHTA 3VN5A 4J9MA 3BDPA 1NKEA 3VQAA 3L2UA 4IG0A 2CKWA 1RYRA 5HP1A 4ECZA 3DRPB 1A5VA 4TN2A 4RNOA 4OKEA 1NK7A 5I42B 4Q44A 1ZBFA 4E19A 3KLGA 2QV6A 5KFXA 4E7HA 4FZYA 3SI8A 1S1WA 4GC6A 1YVUA 3L3UA 2RN2A 2PZSA 4NLGA 3QEXA 3F73A 1U47A 3CM5A 1T03A 3EYZA 4DTUA 2BRLA 2ATQA 4CESA 3QINA 1S1UA 2V4RA 4CJWA 2HWIA 4ELVA 1LW0B 1JKHA 4E0DA 3HVAA 1JLBA 1EP4B 3C95A 3CJ2A 3MEEB 1HNIB 3SFGA 3CDEA 4CEDA 4DL3A 1QSYA 1IKXA 1RT3A 3V6KA 5JXSA 5DG8A 4FJGA 4ZTFA 2E6LA 2QE5A 1TKZB 4NZ0A 1KVAA 3KLFA 5KFYA 1C1BB 5C24B 2BQUA 3HT3A 3WNEA 3OYLA 3V9XA 4DS4A 4HUEA 2EHGA 3U3GA 1MMLA 3MR2A 2G8UA 3S9HA 4K4ZA 3RMDA 5KT5A 1XC9A 3OL8A 2YNGB 4KHMA 1Q9YA 4QW9A 3KLIA 5KGWA 3QEVA 3BQ1A 1S9EA 5EWFA 1JLCA 1TQLA 1VRTB 4R8UA 4RW6B 4LH4A 3M8PA 4PWDB 5HRSA 3ZT1A 3ICLA 4QWCA 1ZTTA 3QGIA 1IKVA 3NHGA 1NJWA 4JS4A 4O3SA 3IS9A 4JLHA 1NK5A 4MFBA 3NF8A 2FJVA 1KHWA 3H40A 4GW6A 3AVMA 4LD0A 1NOZA 1EETA 3PR5B 1VSJA 5CYMA 3BQ2A 4DL2A 1IM4A 2IGIA 4J9NA 4WFZA 4ED1A 2VA2A 4CJLA 3I5BA 4IRCA 3SZ2A 2DPJA 3EZ5A 4LY7A 4NLTA 5F9LA 3LALA 1S1VA 3IRXA 2OH2A 3CJ5A 4Y34A 3ITHA 1IG9A 3G10A 4HCCA 3ALYA 4DL6A 3DOLB 4B9NA 1U49A 5KT6A 3DRSA 4EBEA 5FROA 3RB4A 4EO6A 4DQIA 3SQ4A 4CK2A 2ZD1A 4QCLA 4IR9A 2V9WA 1HQUB 1RDCA 2DFFA 4RZRA 2GV9A 3OS0A 1RT1A 1UA0A 1QAIA 4M94A 3AVIA 4RW9B 4QW8A 1Q8IA 1T3NA 4CJFA 3SUNA 4K8XA 1BQNB 4CEEA 3P5JA 5C42B 2OPQA 3MXJA 1KRPA 4Q8EA 3KKSA 3QGHA 2DPIA 1T05A 5KFAA 5DQIA 3SQ2A 4AHTA 3PW7A 4GVMA 2I5JB 3AO2A 1DTQB 1U4BA 3M8RA 4KTZA 4E89A 3KD5E 3C6TA 2FVCA 3MEDB 2ASLA 4LQ9A 4FS1A 1FKPA 1NK9A 1UAXA 1C0TA 3BGRB 1BGXT 4DFJA 1LWFB 3SCXA 5J2QA 3QEIA 1C0UA 2OZMA 5J1EB 2W9AA 4I9LA 2QKBA 1TK0A 1LWEB 2WONA 2OZSA 1HYZA 1IKWB 4TY8B 3PX4A 4MH8A 4X2BA 4ZVFA 3M9OB 3UPFA 1EX4A 3OHBA 4I2QA 2HNDA 5KI6A 2WK4A 3QLHA 2WB4A 3PV8A 3VA3A 1FK9B 3RR8A 2VG6A 4J2DA 3ZSWA 4ID5B 5J2PA 2YNIB 3ZSRA 3RTVA 4KHNA 4KAIA 1VSMA 1RBVA 3KIOA 3Q8PB 3M9NB 1CXUA 5KFDA 4Y1DA 4HVJA 4M45A 1RTHB 2KFZA 5F8JA 2RKIA 4DSLA 3RWUA 4CHOA 1YTUA 4B9UA 3L8BA 4KKOB 3QESA 1U48A 2HHUA 1VRUB 3DLEB 1TVRA 1C0MA 4FJ9A 4KSEB 5F8NA 3PJXA 2FBVA 1TAUA 1QUVA 1LV5A 1S1XB 2XY7A 4DTRA 1OS5A 3PY8A 4K4UA 3HYFA 3RBDA 2PYJA 1DLOA 2FLNA 1TL1A 3OSPA 3DM2A 3HHKA 4RW8A 4ZVEA 2E9ZA 1RDDA 3K5MA 4HKQA 2AGOA 1RT5A 4K4TA 1LWCA 4FZXC 4J9QA 3P83D 3L2WA 1CXQA 3O3GA 4KFBA 4IFYA 4FJLA 3ISND 2R8JA 1ZBIA 4B3OA 2JC1A 1L5UA 3I0SB 2HMIA 3AVLA 3NDKA 2R7YA 4G1QA 2C2EA 2W8LA 4WXOA 1GX6A 1Z26A 1N6QB 3MXIA 3V4IA 3TARA 3SV4A 4DWIA 3SPZA 2HNZB 4ECYA 3NGDA 3RB6A 4M3UA 5F8GA 4BE2A 4GMJB 4KV8B 3DDKA 3IAYA 2W42A 5DLGA 3CM6A 1S0NA 2A1SA 2RF2B 4KB1A 4YFUA 3CVKA 5C25B 2NUBA 5DMRA 4AILC 4Z4HA 5KFJA 4IG0B 2IA6A 4ELTA 3Q8SB 4H4MA 3S3OA 1SL2A 4CEOA 3AV9A 4Q45A 5D3GA 3NH1A 1J5OA 4CJKA 2Z1IA 2X74A 1S1WB 3VQ5A 5KRTA 3U3YA 3AO3A 1L3VA 1SH3A 4W5TA 2W7PA 3I0RA 1J53A 1NJYA 3TAMA 4K4VA 4M3ZA 2XWYA 3NF9A 1L3TA 1S1UB 1BI4A 1QE1B 1D5AA 4LQ3A 1JKHB 4DQPA 4ED8A 4CFCA 1JLBB 4XO0A 5HRRA 4C8OA 4CJPA 2JEGA 3VQ8A 1NHVA 2BE2B 1Z25A 1SH2A 4O3PA 1IKXB 1RT3B 1D9DA 4KB0A 2VWJA 2WCXA 2HHXA 4J9OA 2YNHA 4B8AB 3CFPA 2J6TA 4ZHRA 2IOCA 4KB7A 2FVRA 3MF5A 3GIMA 1S0MA 1ZYQA 3DRRA 4F4WA 2X6NA 3TR8A 5JS1A 3CQ8A 3RRGA 2R2RA 3LAKA 3NGZA 3KLFB 1SH0A 3H5XA 4YR3A 3RR7A 3WNGA 1TKXA 3HP6A 1SKRA 2G8IA 2F8EX 3ZCMA 2XCPA 5DQHA 4LH5A 1R0AA 5DG9A 3ZT2A 3FDSA 4TYBA 2QXFA 4I9QA 3KK1A 4HYKA 1LAVA 4KO0A 3O4NA 3OLAA 3DI6B 4CF2A 2OYQA 2GC8A 3KLIB 1S9EB 4O44A 4HTUA 1JLCB 4U7CA 5J2MA 4R8UB 5EWGA 1SUQA 3MEGB 3CDWA 2R8GA 3HL8A 2CJQA 1IKVB 1XWLA 3VQBA 4F4ZA 3IS9B 5KFCA 5SWMA 3VQ6A 4FJMA 3T5KA 3NBPA 3HO1A 1EETB 2IJFA 4ICLA 5CYMB 1S48A 3DYAA 3H5UA 4J2AA 4ECSA 4Z4GA 1SL1A 4RNMA 4PQUA 3SQ1A 1N5YB 4CJQA 3OYKA 2IM2A 4CJ5A 2ZE2A 3U6FA 3NAHA 3V81A 4M41A 2IM0A 3ZT4A 3OJSA 4FLZA 3LPTA 3QYYA 1XR5A 4K4XA 1S9GB 1S1VB 3OY9A 3IRXB 4DFKA 4JV2A 4B9TA 4DG1B 3TVKA 1HYSB 2G8FA 1TK8A 3ITHB 3OYMA 3PUFA 4B9SA 4ELUA 4CFBA 2FVQA 2JLEA 4ZP8A 3DRSB 4F4YA 2XGPA 4M3YA 3GQCA 1C1CA 2B4JA 4J9RA 4ECQA 3K5NA 2ZD1B 4PUOA 3KLVA 3RMCA 4Z4FA 4DU3A 4IDKB 4NLXA 2KQ2A 4DLEA 1QAJA 3MR3A 4CHQA 3OL6A 4WYLA 5FRNA 2OPQB 2XC9A 1YVFA 3TI0A 3ULDA 1MU2B 4O0IA 3OYHA 3T19A 3QEPA 3TAPA 4H54A 1T05B 3OSNA 4Q0BB 3RAQA 1RT2A 2HHQA 5HBMB 3FSIA 1WSHA 3V6JA 5CYQB 1NK8A 3SFUA 3C6TB 3D5MA 1FKPB 2D0BA 2YKNA 1UWBB 2D0CA 3ZT3A 5J2QB 3KMQA 2D41A 5KFBA 4ZPDA 1RDBA 4KAZA 2C28A 4M3RA 4CECA 4DSIA 4Q5VA 2XGQA 4E1NA 1WSGA 1QSLA 3LANA 4NLRA 3GV5B 1RBSA 3OYBA 4I2QB 1KFSA 1S1TA 3JSMA 2FLLA 3ZSVA 5J2NB 2HNDB 3QLHB 4YNQA 5KFFA 4BACA 4MKAA 1HQEA 4DEZA 4CF1A 1C2PA 1JLGA 1Z4UA 4ECUA 3N6NA 3DLRA 3DMJB 1WAFA 3V1RA 5HRNA 1TGOA 3TANA 1X9WA 2YV0X 3MECB 3KTQA 3IG1B 4WE1A 4IG3A 1U09A 4O3QA 2D5RA 5KFUA 3SV3A 4E7KA 2Z1HA 1JX4A 3VQPA 3A2FA 1TVRB 2AX1A 2FBTA 2R8IA 2YHBA 3HVTA 3CO9A 1CLQA 1CSJA 4UQGA 4NLWA 1I3AA 4AHUA 4IBNA 2A1RA 1TL1B 3DM2B 4RW8B 4FLXA 2ILYA 5KG6A 5JS2A 4N41A 4QWEA 3HM9A 1WSFA 2WOMA 4EP4A 4C8NA 4OPJA 4IFVA 3HPGA 4CE9A 4K4WA 2JC0A 1HPZA 4KFBB 4IFYB 3NF7A 4R0EA 1W0HA 1RT4A 4B3OB 5T7BA 3T5LA 5L9XA 2HMIB 3BSOA 2W8KA 3ISNC 4JS5A 4G1QB 2G8WA 1NNDA 5KFWA 5KT7A 3V9UA 4Q43A 2AGQA 1RT7A 3G6XA 4CERA 5K14A 4E1MA 3JYTA 2XI3A 4K50A 2ATLA 3K2PA 2VG7A 1S5JA 5HLFA 3H4DA 3LWLA 1Q9XA 4G3IA 2HB5A 3VQQA 3QO9B 1GOBA 4YR2A 4QWAA 2D7SA 4TY9A 1HJRA 4NLOA 3BSCA 3SJJA 3VA0A 3HSTB 3RB0A 5HROA 4B9LA 4DSEA 3TAEA 1WSIA 4RUCA 4NCGA 3HJFA 4F4XA 4CFAA 2Z1JA 1JLAA 5CZ1A 4N47A 4OJRA 3LP1A 3KK3A 5L1LA 1JL2A 1NKBA 2G8HA 2F8SA 4MKBA 2HVHA 3C6UA 4OLBA 3TWHA 4KHSA 1JXEA 4C8KA 1Y97A 4KREA 1HMVA 1RA7A 3G6VA 3UQSA 5KFEA 1FKOA 3I0RB 4JV0A 4EEYA 4EZ9A 1TKTA 1NOYA 2IMWP 5SZTA 1N56A 1BI4B 4RW4A 4CK3A 4Y1CA 3MTKA 3NGIA 3V9WA 4CJRA 4O4GA 4KPYA 4KE5A 3KLEB 2BANA 4ECXA 4FLWA 4R5PA 3DLGA 3UDLA 1IKYB 3OYEA 3DOKA 4EYHB 1VSIA 2YNHB 2XRIA 5I42A 4DQRA 1NK0A 3KMSA 3DRRB 4NLDA 1IH7A 4CEAA 4OL8A 4FJ8A 4ZVGA 5FDLA 2B5JB 2QKKA 1T7PA 2OA8A 5KG4A 2GIRA 1TKXB 4DMNA 1WNEA 2HNYB 4EYIB 4CEFA 1RDRA 4RNNA 3H08A 1LW0A 2W9BB 4QAGA 1EP4A 2R8KA 2OPSA 2XCAA 3LP2B 4KO0B 1HNIA 3O4QA 1KSPA 3M8QB 1S6QB 4DTMA 4O44B 2GUIA 3IN5A 5J2MB 3SUQA 4CHYA 4F8RA 4AHVA 1SUQB 4CJUA 3GIIA 5KFVA 1VSDA 3B6PA 3M8SA 4C8LA 3CJ4A 2OPRA 1S0OA 1RCHA 3C94A 3GV7B 2JGUA 1B9DA 3EPGA 2AU0A 4HUGA 3NBPB 4ZPAA 3PR4A 4M95A 3T5JA 4PA1A 2YNFA 3V6DA 3DYAB 3GYNA 4DTPA 2OPPA 3PO4A 4CCHA 2D0AA 5F8HA 2FJXA 5F8LA 5EDWA 3DLKB 3V1QA 2YNGA 3V81B 4CGHA 3L2VA 4NLSA 4HHTA 3OS2A 3QIPB 1NJXA 5KT3A 2FBXA 4CIGA 1JXLA 4QWDA 4OGCA 4KTWA 4KHYA 4CJSA 3QGGA 2DFHA 4GC7A 4O0JA 4M42A 2IDOA 4URQU 4FBUA 3LZJA 3E01A 3OVNA 1XI1A 3QZ7A 4Y2AA 1KVCA 4AHSA 1RT6B 4PUOB 2J6SA 1ASWA 4ZPCA 4E7JA 5KFLA 5DK5A 3MXMA 2XY6A 3SI6A 4YQWA 1RBRA 3KOAA 2ZKUA 3QZ8A 1S6PA 4CGDA 5KTQA 1TV6B 3AA4A 3K59A 2ITGA 1N48A 5HP1B 4FK2A 1RT2B 3CWJA 4E7LA 4DFMA 4DL7A 1XHZA 3DOLA 3NH2A 4ECWA 1RDAA 5KFMA 3KLGB 3CJ0A 3PJWA 5EWEA 4Z4CA 4M3XA 1DTTA 4NLQA 2YKNB 1HRHA 1RBUA 3V6HA 4FW1A 3V9ZA 3AO5A 4F3OA 4KHQA 1T03B 4CHPA 4I2PA 1RILA 2KZMA 3B6OA 3TABA 2FVSA 1U45A 3UR0A 1BIUA 2V4QA 5KG7A 4DTJA 4L8RB 1S1TB 3JSMB 3LDSA 2W7OA 3I5AA 4FM1A 4J9SA 4CHZA 2HWHA 2I5JA 1JIHA 4FW2A 3MAQA 4FJ5A 2FLPA 1HQEB 4MK7A 3AVAA 4ID1A 4QWBA 4OGEA 1UOCA 4BDPA 2XY8A 2BGGA 4NCBA 3H5YA 1RTIA 4HCBA 1S49A 5KFNA 3SYZA 1RTJA 3NKYA 3HPOA 4O3NA 4WE1B 4EP5A 4ZP9A 3NAIA 3KKRA 5KG1A 2G8VA 2KZZA 1JL1A 1RA6A 3H5SA 4IQXA 3HVRA 3RMBA 1U04A 3LZIA 1S9FA 2YKMA 2P5GA 1S4FA 3UIQA 1EKEA 3T3FA 1D0EA 4WFYA 3HXMA 3L2QA 4Q8FA 4WFXA 4C8MA 3HVTB 2DY4A 3M8PB 4DF8A 2E9RX 3OYIA 4ID5A 3RMAA 2YNIA 3NAEA 4RNFA 1JLEA 4FLVA 1K1QA 4ZTJA 1VSEA 5KG3A 1JXBA 4MFBB 4FVMA 3FQKA 4Y3CA 1BQMA 4F2RA 2WOMB 3I5CA 1BL3A 4IFVB 4DU4A 2FBYA 2DFEA 4ECTA 3NFAA 1HPZB 4CEBA 3OHAA 4FZZA 1RT4B 1KHVA 4ZP6A 4F4KA 4JUZA 4KKOA 2BR0A 3KD1E 1VRUA 1ZBUA 1JLFA 1RNHA 4RW7A 3S3NA 4WZMA 3JYTB 1L3SA 3LP0A 1ASVA 1CZBA 3LWMA 2VG7B 4FJ7A 1C6VA 4O4RA 2Z1GA 4CEZA 2XO7A 1NHUA 4ED0A 2UUTA 3KHGA 2JEFA 3KLHA 3FRZA 4JRPA 4LSLA 3HK2A 3SUPA 5HROB 4U6PA 1KLMA 4OKJA 3OS1A 5DGBA 4CGGA 4KI6A 1WN7A 3TAQA 3I0SA 3ZSOA 3AVKA 3VQ4A 1RT1B 5KFOA 1BCOA 2HHSA 1TAQA 3DLHA 3E51A 1JLAB 1ZTWA 3KK3B 4FJIA 1YTAA 4CF0A 4B8CA 3C6UB 4LSNA 4BE1A 2KFNA 1TL3A 3AA5X 1HMVB 4IR1A 1RBTA 3FQLA 1GX5A 3BREA 2X6SA 1FKOB 1RTDA 3MR5A 5EU7A 3RBEA 4Z0UA 5KFRA 3RAXA 1GOCA 1TKTB 4XPCA 2R8HA 4KHWA 5C25A 3CJ3A 1KTQA 3NH0A 4Z4EA 3AVBA 4RW4B 3QERA 3T5HA 4YMEA 2G8KA 1C0TB 4KHUA 3BSAA 2E4LA 4O4GB 4DTOA 3VQ9A 3VQ7A 3WNFA 3QNOA 2B6AA 2BANB 4R5PB 4CJEA 1C0UB 3DLGB 1BISA 3DOKB 4O3OA 3EPIA 1A5XA 4I7FA 2IAJA 4H4OA 3HVWA 1W9HA 2VG5A 5L1JA 2WONB 3PX0A 2WTFA 3GIKA 4CK1A 4FCYA 5FDLB 1K6YA 4NCAA 2AQ4A 4J9LA 3SQ0A 4XPEA 2B43A 3NCIA 4IH7A 2RDJA 4NLPA 3VQCA 1WNSA 4N76A 4EBDA 2AX0A 1S97A 1QE1A 2VG6B 4ED6A 1SV5A 5J2PB 4RU9A 1F21A 4B9MA 4OKKA 2F96A 3HP9A 2OPSB 2PY5A 2C2RA 4DSJA 1J54A 2BE2A 1N4LA 2W9CA 4IRDA 1X1PA 5C5JA 2EX3A 3G86A 4TQRA 4NYNA 3L3VA 2HHVA 3AVNA 4BWJA 4K4SA 2RKIB 4J9KA 5JUMA 2OPRB 5CY4A 1JLQA 3Q8RB 2D3UA 2BQRA 4EO8A 4B9VA 5KFSA 3PHEA 4KBIA 3OLBA 4E3SA 2YNFB 3PW4A 3V6DB 3K57A 3OYFA 2OPPB 3H59A 1QS4A 3QEWA 2HAIA 1DLOB 2IC3A 1SL0A 2RPIA 1IO2A 3M9MB 3DI6A 4AHCA 1QTMA 3KNAA 4WYWA 4DL5A 3GV8B 4WZQA 1RT5B 5KG5A 1LWCB 2UUWA 4KI4A 3EY1A 2DTUA 1VSKA 3HKWA 3FFIA 4E7IA 1QQCA 3MEGA 4DSKA 1REVA 5HRPA 3THVA 5I3UA 4MIBA 5F9NA 4FJJA 4WXWA 2C2DA 3AVHA 1BCMA 3E01B 3V4IB 1NKCA 3AVCA 3S3MA 1X9MA 4BDZA 3G0ZA 2IBKA 2P5OA 4BWMA 2WRMA 1BIZA 1N5YA 3TAGA 5KFPA 1KCFA 2D3ZA 4AH9A 4DFPA 4QPXA 4CF9A 4FJHA 2UVRA 3TAFA 4Z4IA 3QETA 1S9GA 1S6PB 4DL4A 4Y2CA 4DG1A 3PW5A 1HYSA 2O5DA 3MR6A 3K58A 4ECRA 5E41A 3AO4A 5L1IA 4FJNA 4H4MB 4M3TA 1B9FA 1HNVA 4EBCA 1VSLA 5D3GB 1J5OB 1BHLA 3D45A 5CZ2A 5DQGA 3H98A 1LW2A 4W5RA 2VWKA 4M3WA 3TQ1A 1DTTB 3CFRA 4FM0A 1ZBLA 4N56A 3KK2A 4F3TA 3KJVA 4N5SA 4JV1A 3BQ0A 4IDKA 4IKFA 4I2PB 3TAMB 4FLYA 1VK0A 2YHAA 3N6LA 5KFHA 5DG7A 2E9TA 3HPHA 1MU2A 3O3HA 2HHWA 3PW2A 4W5QA 3NL0A 1J9AA 4O5BA 2Q3SA 4Q0BA 1SKWA 3DRPA 5HBMA 3AA3A 4ZHRB 4CJVA 5CYQA 3OYDA 3GILA 4MIAA 4TXSA 3CYMA 4DTSA 3D28A 3BJYA 2J6UA 1WAJA 3VQSA 1UWBA 1RYSA 4NYZA 3LPUA 2AJQA 2JEIA 1RTIB 4DS5A 3ZSXA 5EUHA 1NK6A 1RTJB 3QNNA 4F50A 3CG7A 1ZBHA 1K1SA 3MFIA 3F9KA 3VQEA 1R0AB 4NRUA 1KFDA 2O4IA 1X9SA 3OYCA 3KK1B 3MEEA 2YKMB 4DSFA 3CIZA 4ZP7A 3P1GA 1SKSA 4QOZB 2XI2A 4MK9A 3VQDA 5J2NA 3OL9A 4KRFA 3D0PA 3ZSZA 2WHOA 1JLEB 1TKZA 4AHRA 4NYFA 2ASDA 4CEQA 3DMJA 1C1BA 3LP3A 4CIFA 5C24A 2QK9A 5KFIA 1TK5A 4K8ZA 1BQMB 3MECA 3I8DA 4ICLB 3GIJA 1KLNA 3NMAA 3IG1A 2LSNA 2RDIA 4ED2A 2P1JA 3SPYA 3PO5A 4PQUB 2JEJA 4EZ6A 2ZE2B 3QIDA 1JLFB 1I39A 4ZVHA 4CGIA 5T14A 4RW7B 1VRTA 1I6JA 1T94A 4RW6A 3LP0B 4O3RA 4CHNA 4URSA 1D8YA 4J2EA 2BRKA 4PWDA 5F8IA 1C1AA 4KHRA 2EC0A 3ZSYA 4ZPBA 4IKAA 5KFQA 3SNNA 1CZ9A 5KFKA 1TP7A 4DQQA 1RAJA 3KLHB 2V0NA 1HYVA 3WNHA 2BQ3A 1T8EA 4TYAA 3K5OA 2R2UA 2AWZA 4LSLB 3ZSQA 1KLMB 2O4GA 1C1CB 4CFDA 3L2RA 4XIUA 4OVLA 5KFTA 3AVGA 2P51A 3OYGA 1WLJA 4FLUA 2ILZA 4J2BA 5KRSA 2KW4A 4CGFA 5KG0A 4CF8A 3K5LA 3DLBA 3T1AA 4LSNB 1NJZA 4OLAA 3IGNA 3ASMA 1D9FA 2BDPA 1TL3B 4FM2A 3QO9A 1FXXA 4MQ3A 4NLVA 1XR7A 2UVWA 1RTDB 1HARA 2I1RA 1L3UA 4IH5A 1GOAA 2ZQBA 4B08A 4IOBA 4J9PA 1S10A 1W25A 3KHRA 5KG2A 3ZT0A 4KTQA 1HQUA 2B6AB 1ASUA 5KT2A 1D1UA 4F2SA 4FLTA 4I7FB 4BDYA 2IAJB 4H4OB 4RW9A 2IJNA 2VG5B 1NK4A 1BQNA 4RNHA 4DTNA 4DQSA 1YT3A 5C42A 2GIQA 1XHXA 3H2LA 3N6MA 3KHLA 3BSNA 3NF6A 3CFOA 1DTQA 2UVUA 4NLYA 4CGJA 3V1OA 4CJ3A 2UVVA 3Q8QB 3MEDA 1SV5B 1JLGB 4ECVA 3OL7A 3BGRA 1B92A 1LWFA 3KLEA 2W9CB 2R2TA 3AVJA 1IKYA 4DU1A 4FBTA 5J1EA 1A5WA 5KT4A 2GBZA 5KGXA 4MK8A 4FS2A 1LWEA 4IG3B 4H8KA 4CIEA 3OYJA 1IKWA 4TY8A 2ETJA 4CJTA 2B5JA 4ZMMA 3PW0A 3KHHA 1JLQB 2IS3A 2ASJA 3OYAA 3QIOA 2C22A 3O3FA 2HNYA 2IM1A 3LAMA 4DLGA 4NRTA 1FK9A 2Y1JA 5L1KA 4OPKA 2W9BA 2F8TA 4URGA 2IC3B 3LP2A 2FJWA 3AO1A 2Y1IA 4ED3A 2HVIA 3M8QA 4W5OA 1S6QA 4PY5A 3NE6A 2VA3A 1ITGA 4TSXA 4NLUA 3MFHA 1QHTA 3FFIB 4O55A 1RTHA 3H4BA 1REVB 3OYNA 1G15A 5I3UB 3NGYA 4FK0A 1RT7B 1VSFA 3DLEA 5K14B 4TLRA 4JRQA 3SUOA 4IH6A 2ALZA 1S1XA 2XHBA 3BR9A 4FYDA 5HLFB 1WSEA 4TQSA 3G6YA 1LAWA 3DLKA 4RG8A 4FXDA 3IGVA 5DGAA 4CJ4A 4ED7A 3QIPA 3PVXA 2FC0A 3V9SA 1XR6A 2PYLA 2X78A 2XY5A 2KTQA 4YR0A 3OJUA 4IRKA 2AGPA 4K4YA 5F8MA 3EZUA 2IM3A 4NCGB 4HUFA 5DLFA 3PX6A 4RUAA 4DTXA 4YP3A 2E6MA 1HNVB 1TKDA 5KFGA 1N6QA 1UA1A 3LP1B 2R2SA 1LW2B 3PZPA 2HNZA 5FRMA 3KK2B 1QSSA 3CDUA 1VSHA 4KV8A 1RT6A 3KJVB 3AA2A 4FJKA 1ZETA 4FJXA 5KFZA
chains in the Genus database with same CATH superfamily
4DF4A 2CGLA 1VR6A 5HATA 4WIQA 1U26A 1N32K 4W5NA 2FVPA 2MQ8A 1O1WA 2HW3A 1WHVA 1TV6A 3RB3A 4CO5A 4FOEA 4XEIA 2V2VA 3VQAA 1RYRA 2CKWA 5CE3A 3DRPB 5LSLA 1TFYA 4KYZA 4EGLA 5H9EJ 3BO4A 1H72C 2GHWA 1VIXA 2Q0RA 1T03A 2KU7A 1BOTO 2BRLA 2ATQA 4CESA 1S59A 1T11A 5K20B 4DCOB 3LUYA 1S1UA 2LQ9A 1CQMA 2HWIA 3RVCA 3HVAA 1EP4B 2C3PA 1WD6A 3MEEB 5H9FJ 3UE2A 1SQFA 1QSYA 5IZHA 1U2VA 2F5GA 4W92B 3FVYA 1RHMB 1CJKA 4LF8F 2RU3A 1RAEB 1CZAN 5GAGI 1UVLA 1X4GA 4NZ0A 1KVAA 3L09A 4J9UE 2QJ3A 5L38A 3V9XA 1S77D 3U3GA 4A8KA 2RILA 2G8UA 5LJVA 4K4ZA 5KT5A 1XC9A 3OL8A 3DU6A 3T1YJ 5CAAA 1Q9YA 1B0TA 5DZ6A 4NZ7A 3QEVA 3AB4B 2F8HA 2NXCA 3MAAB 3RU0A 1FHTA 1TQLA 2YQ3A 1IXKA 2BKOA 3CPWM 1IR2A 3ICLA 5HMXA 3E1YA 4YHHF 1RKJA 2YWHA 4JKCA 2E44A 4O3SA 3IS9A 2YQ1A 1NK5A 4DR2J 2ZITA 3G8QA 3GG0A 3OPKA 4OYMA 5JICA 4GW6A 2J9CA 4FPIA 3M2RA 1VSJA 2LVWA 4IOAL 4OZ1A 3FNNA 4IRCA 1NGIA 3EZ5A 3RBXA 5D78A 4LY7A 2HFOA 5BN9A 3NNCA 3LALA 1S1VA 2LECA 3ZZ0A 4USIA 4MO4A 3FEZA 2UXCF 3OUYB 1IBLJ 2OTJS 3NG8A 3BP8A 4MO5A 4HCCA 4DL6A 3B6BA 2LQ5A 1UP1A 1UVKA 3TUIC 3RB4A 2BOAA 3BH7B 2GQ2A 2VL1A 2V9WA 2JVRA 4KJIA 2GV9A 3OS0A 3MMAB 3AVIA 2V8GA 2DHAA 4PXEA 4LBHA 4X4OA 3ULEA 2MSSA 3LGHA 4K8XA 3OVSA 4PAAA 1BQNB 4DUZF 1RFQA 4CEEA 3FJ2A 3HI9A 1WUAA 5C42B 1IJFB 1U1NA 4UZBA 2F9DA 1YXQA 4CZIA 3QGHA 2QIFA 1RAOA 3TEHB 4UT4A 3MUMP 3SQ2A 1VI7A 5FLXY 5BYSA 3MOJB 3M8RA 4E89A 2FVCA 3MEDB 2ASLA 2ZHAA 5BR8F 4LQ9A 4FS1A 2P9KB 3ZTQA 1LWFB 2QA4N 2WB1D 4NLCA 1C0UA 3DOMA 1U2FA 3U1MA 2OZMA 5J1EB 2W9AA 2DNRA 5LT5A 2WONA 3ENOA 4P52A 1BD6A 1Q5VA 1VC5A 4MH8A 3M9OB 3MPVA 3UPFA 1EX4A 4CQ1A 5DM7L 1E6VA 2ZHOA 4FWPA 4QIVA 2QWMA 2OMLA 1FK9B 3HMJG 2VG6A 3RR8A 4J2DA 2YNIB 1K0TA 2OO4A 1XQSC 4C6AA 2DH8A 3W60A 1HBUA 3M9NB 1DGKN 1CXUA 4Y1DA 2DNPA 2HGLA 3UB5A 5HL7L 3DC2A 1SC1B 1WACA 4CHOA 4DR4K 1YTUA 2OD4A 1U48A 5LMUK 3M1VA 3QDKA 3QESA 2HHUA 2ZWHA 1N36J 2DY9A 4FJ9A 3PJXA 1TAUA 4KT0C 4QPTA 1UJ5A 3UCZP 2F63A 2IPOB 1S1XB 2XY7A 5AZIA 3P31A 1DLOA 3DM2A 1FERA 3HHKA 4RW8A 4ZVEA 2E9ZA 4JI0J 3K5MA 2DKOB 1RT5A 1PYSB 3OQ2A 2M8HA 4PXDA 3L7UA 2L9DA 5CABA 1H74A 2JC1A 5IV3A 3AVLA 4A2BA 1RWOB 2JDJA 4FPAA 1NMNA 2OI2A 2RRNA 3SV4A 1XQIA 2DD8S 2DGTA 4M3UA 3NGDA 3G6ES 4BE2A 2KXNB 3UKUB 4U96A 3IAYA 4IEEA 2QWNA 1YF5L 3CM6A 4CYUB 4YFUA 3CVKA 1ULRA 2Z0GA 4L73A 1R0BG 2NUBA 1YJWN 5IT0A 4Z4HA 3FZBA 3THWA 5KFJA 4IG0B 5GADU 4OZ0A 5L39A 1NLKL 2IA6A 1KEKA 3DDIA 3MN7A 5D3GA 4K42A 2D9PA 3HZGA 2DXFA 4DX8H 3J7YP 1CEZA 2CPJA 3MMJA 4YB7A 3RYLA 5IT4A 3VQ5A 5KRTA 3U3YA 3AO3A 1L3VA 1N54B 1SH3A 3N0VA 2V63A 1OH8A 3AOBA 1SQEA 4BCAA 7FD1A 4CZKA 2HQFA 3NVMA 1BI4A 1QE1B 1QDUB 5AT1B 1FW6A 4LQ3A 1FE0A 1JLBB 4XO0A 4JK8A 4U67L 3MXHP 2BE2B 4BG8A 1IKXB 1D9DA 4KB0A 2WCXA 4P75A 4PHTX 1U1OA 2J6TA 4ZHRA 2FVRA 1XNQF 3GZ7A 4JB8B 5H1SQ 2HS3A 4YS2A 2KT3A 4CT9A 4Y0WA 3HFZB 3A3PB 2CNLB 4YR3A 2F9WA 3V2UC 1YJ9S 5DRKA 1T02A 5ETLA 3D0GE 4EMDA 3HP6A 2J9DA 3OFEA 3ZLJA 2G8IA 3PKMA 4LBIA 5HSPA 4WK1A 5IWAJ 2XCPA 1O5JA 1YITS 4LH5A 1R0AA 1Q8LA 5AQOA 1F1BB 4C1NI 4XAKA 1M90T 4TYBA 1VQ5S 3KK1A 4HYKA 1U8WA 2L41A 3DI6B 4CF2A 4RLEA 1VC6A 2VGNA 4A48A 1MROB 3HI0A 3D6FB 4R8UB 2KYXA 1EAYC 2FHJA 3N4WA 4UUWA 3GR0A 2CJQA 4QBUA 1XWLA 2K8GA 2HVEA 3UD5A 2ASMA 3E8OA 2MXYA 5EXWA 3W63A 1RQ0A 3NBPA 1EETB 2G2OA 3CXCR 5LL6Z 3PIOL 4D3HA 4ICLA 4LFAK 2PFUA 2DGUA 5CYMB 2ZBCA 4Z4GA 2OEJA 3ISZA 4LMZA 3DGVA 1V9OA 1N5YB 3DXKA 1XBWA 4M41A 1VMBA 1N34J 4CBUA 3EE9A 1I94F 2ZDOA 5DJBA 4DFKA 1T3OA 4B9TA 1FFSB 2QO3A 2QWRA 3FE1A 1F2HA 3ITHB 1WC1A 1BMQB 3PUFA 3TJ9A 5D4PA 2OTLS 2CH6A 4CFBA 3HX9A 3DRSB 4PG5A 3FZHA 2K1RA 3H20A 2KM8B 1OMSA 3HD1A 3JTNA 2RT3A 4TU9A 2E66A 3JTPA 5AQGA 2KQ2A 2QWLA 5KQDA 4QOTA 4WYLA 3T9ZA 5M2PA 4AL6A 1YVFA 3MGJA 3T19A 2MLXA 1T05B 3WX4A 4Q0BB 3FR0A 2YWEA 2RQ4A 4CZHA 5CYQB 3CJTA 3D1HA 3SFUA 3QBXA 3SDEB 2D0BA 3H6EA 1UWBB 2AKWB 3BGFA 2CA9A 3JS9A 5KFBA 1N0VC 2IMOA 1N5VA 4DV2K 4KAZA 3PSFA 4DSIA 4Q5VA 5A2QO 2XGQA 4E1NA 2YX6A 3G87A 1VCTA 5AJ3K 5AE3A 3W2VA 1RBSA 5LM7E 3OYBA 4I2QB 4CP5A 2GWJA 2YX7A 1WEZA 4DEZA 1M5KC 4CF1A 1C2PA 3D6RA 2ABYA 1A7GE 4JI8F 1RAHB 3DLRA 3DMJB 4P9SA 1HLUA 4QU7A 1X9WA 1YK9A 2YV0X 2ZH4A 2V7YA 2CADA 4WE1A 1MSWD 2FHKA 2Z58B 3SSSA 4BRLA 2M9KA 1SC6A 3ID6A 3JXOA 2Z1HA 4OX9K 2LA6A 2PA8D 2AX1A 1WF0A 2R8IA 1NGGA 3CO9A 1RHQB 3PKYA 1CLQA 1NSKL 1RKIA 2UUCK 4LF4K 1X7VA 4F0KA 2BZ2A 1LNQA 1HR0J 2A0FB 1TL1B 1CS4B 4FLXA 2ILYA 5B8HA 2NYHA 2UXBF 3KUEA 1WSFA 4EP4A 4OPJA 3CC2N 1GFWB 1DURA 2DHXA 3NF7A 1X4HA 4B3OB 1N33J 3T5LA 4JEPA 1BWEA 3BSOA 2UXDJ 1ACMB 1H38A 2AGQA 4OYIA 2P9NB 4WQ4C 4CERA 5K14A 4AQYF 2H5JB 1WC4A 2EFVA 4F26A 4K50A 3TW0A 3K2PA 4B3MJ 5A76A 2VG7A 4GKKJ 2VONA 2C2MB 4G3IA 3VQQA 4M5NA 3GPAA 4FF2A 5ETPA 2OJ3A 2QMWA 3J7Z5 1N8RO 4CW7B 1SC3B 3BSCA 5F3ZA 2HHHK 1VQLS 4B9LA 4DSEA 3UVJA 4BQZA 1D3WA 5I4MA 1GLJO 5BPMA 4JKGA 3D67A 1MWQA 1RCXB 3CT9A 1U0HB 4GV3A 4CFAA 4WKYA 3MWPA 4DV3F 4N47A 4FF4A 3KK3A 2ZJQL 2E29A 1FXRA 4MKBA 4OLBA 3TWHA 2I38A 4KHSA 3DHXA 1K8KA 4DV1F 4EIAA 4KREA 1RA7A 3GE1A 2ZUGA 4KH0B 3UQSA 4FKYA 3IA0A 3I0RB 3BR8A 2HHPA 1N52B 3R1XA 5SZTA 2ZVIA 4CK3A 1WG5A 4Y1CA 2WSFC 3V9WA 4O4GA 1HBMB 4FLWA 3G71N 4A8SA 4EYHB 4CO3A 2FHMA 1WJ9A 2XRIA 3NOCA 3IBFB 4YOEA 4DQRA 1NK0A 3KMSA 2CDQA 2WW4A 3TU5A 4NLDA 1IH7A 3EE8A 2YI1A 4FJ8A 5IV4A 1LFPA 2BX6A 2Q3PA 3RRKA 1SBRA 2BYCA 3CJRA 2AF6A 2GIRA 3AOCA 4YDUC 4JI4F 4EYIB 2VH7A 2V51B 4BRCA 4CEFA 1IQZA 3IAS9 1PAUB 5K9FA 1LW0A 2AYMA 2XCAA 4KO0B 1HNIA 1KSPA 4OZLA 4DTMA 3IN5A 1KQGB 3TRGA 2ZH8A 4CHYA 3HM8A 4FWOA 4EFAC 1SUQB 1NSAA 4OO1J 3B6PA 2KRBA 2H4WB 1Q82T 2OPRA 4CD3A 4JI2F 4JI3K 4C97A 2AU0A 3BO2A 1U24A 5F3TA 2CQCA 4AFFA 3DYAB 3GYNA 4DTPA 4CCHA 2D0AA 4M5IA 1RU2A 1VJWA 5A2QU 3V81B 2AYBA 1YLXA 1QY7A 1NGDA 2V2QA 2F4FA 2FBXA 3R1LA 2CH5A 4OGCA 4LF8J 2X3DA 4B1WB 4CH0S 3QGGA 1RAFB 3HSJA 1HWUA 2KM8C 3JSBA 1RHRB 2XBPA 1Q1KA 4FBUA 3LZJA 3MX5A 4GVBB 2J0WA 3GG4A 5B0BA 3PM9A 2DGXA 4OJHA 2J6SA 3JAMO 2RQCA 2VQFF 3MXMA 1YJ7A 1U6FA 4YQWA 2O8FB 1RBRA 5AR0A 2ZKUA 4ZLLA 1HW8A 4CGDA 5KTQA 3K59A 2HQIA 2FSJA 2E8AA 1HNWK 4YHHJ 1SAZA 5BR9A 4X84A 4CT8A 1XHZA 3C14A 3MPUB 3CJ0A 4BR4A 3EDQB 3AOAA 4X4QA 2YKPA 3D3CJ 5JJBA 2E7VA 1HRHA 1RBUA 3V6HA 5LXYA 4Y0FA 1M1KO 3OFGA 2IVPA 1KQSM 1NEEA 4RBVA 4ZVUB 2FF6A 4JKEA 1WWHA 3SMPA 2W2MP 4ZPWR 2FC9A 4RPFA 2V4QA 2UXCJ 2BBEA 5KG7A 2HQCA 2LDIA 1S1TB 4FM1A 1PBAA 3I5AA 2C2OB 1J27A 1IG8A 2R7SA 3MAQA 3CCLS 2OMOA 1S7IA 3R9LA 2DXEA 4MK7A 4N8OA 3HSDA 4JI1F 5A8RB 1VQ9N 3AA8A 1RTIA 1OIAA 3KDNA 4HCBA 1NSPA 3MHYA 2B9WA 5SUHA 3KWMA 2PEHA 4ZP9A 3CIMA 2E1YA 3TJAA 4IQXA 4DUZJ 4WPAA 2Y8YA 3MD3A 3KK7A 4WFYA 4F4AA 3IWLA 3K8VA 3PYFA 4Q8FA 4WFXA 4ZS6A 1VBZA 5CD4H 2DNHA 4CVNE 5ETKA 5BR8J 1WORA 4HLBA 4DX7A 4JHDA 1WG1A 2LLZA 4Y3CA 1JCFA 3NGSA 1Y4ZB 2WOMB 3I5CA 3R6MA 5JVHQ 1H2UX 4CBXA 3I31A 4DU4A 3CO0P 4ECTA 3NFAA 1T6CA 4FWQA 4X4VA 1KHVA 2EK1A 1TELA 3TR5A 1GH8A 3HHEA 2VDIA 4F4KA 2EKNA 5D0RA 2BR0A 3CQYA 3NCRA 1PBUA 3G9CA 3S3NA 3JYTB 1L3SA 4BGAA 1CZBA 2J9DE 4ALZA 1FRJA 1UVNA 3FMWA 2UUTA 2JEFA 3KLHA 4A2AA 4P2XA 4ZJOA 4DR5F 3CDBA 3D66A 4EAHD 4LSLA 3SUPA 4U6PA 4OKJA 3T41A 4CD1A 1WN7A 1KD1T 5G0RA 3I0SA 1VQSA 2E1RA 3VQ4A 5KFOA 1BCOA 2O8CB 1RBAA 3A3NB 1S4EA 3MUVP 3DLHA 4X62K 2JRSA 4I1TA 3CCVN 4ES1A 2ZDPA 4PG4A 4CF0A 4B8CA 3C6UB 4LSNA 4UOCA 3MK6A 1HMVB 3FQLA 1GX5A 3BREA 1FKOB 4H5RA 5EU7A 3G2XA 1FRLA 1GOCA 2Y1RI 4XPCA 2R8HA 2ZGZA 4BLGA 3AVBA 3QERA 3AT1B 3T5HA 2Z4PA 4XH1A 3UDVA 4KHUA 1ZZFA 3BSAA 2BANB 2ZH1A 3DLGB 1BUXA 4O3OA 4CIOA 3MM8B 3EPIA 5AQZA 2KO1A 1LKZA 3ZZOA 2IAJA 4H4OA 3JQJA 3SMSA 4EFHA 2I9SA 3LM2A 3D1OA 1J5EF 2D0PA 4FCYA 4NCAA 3QMQA 1NH7A 1GXTA 4XPEA 1QQOA 2B43A 4IH7A 1Q81T 3WEEB 1WNSA 4YN3B 2KDOA 3ET6B 3JAMU 3I32A 3ZX2A 5J2PB 3T1HF 2OPSB 2C2RA 2O8BB 4DSJA 4YUDA 3HF5A 1AROP 1N4LA 4IRDA 2DBBA 4NYNA 1Y3JA 1ZBSA 4BWJA 4DR6F 3AVNA 5JUMA 5T7LA 4H0YB 1UL3A 2Q36A 3CETA 2D3UA 1RACB 2V7ZA 4OX6A 1PAEX 2BQRA 5L8RC 1VQ7N 4B9VA 3QJJA 3PHEA 4KBIA 3QT8A 3K57A 4PL8A 1ZM2A 5ADXH 1NPKA 1KQKA 1IR0A 2RPIA 2MB0B 2XSJB 4OHZA 1HBNB 4USWA 5KG5A 1LWCB 4DCHA 1FJGK 1XNQJ 3EY1A 1VSKA 4USHA 2DRAA 1NMEB 1WOSA 1HPMA 2XMMA 3CNQP 2HBYB 3ZTSA 1C4CA 2RUSA 2VIHA 1FKAF 3A5LC 3ILIA 2XMVA 3CCSS 2GVZA 2L3MA 4BC3A 3E9OA 3S3MA 1W2BM 1BIZA 3TSUA 3EVMA 2D3ZA 2D1KA 2K06A 4QPXA 3MAHA 1X3NA 4L3KA 4Z4IA 4Y2CA 1MWZA 2O8DB 2UP1A 1BDGA 2QRRA 1HYSA 4R25A 2HRYA 4ECRA 5L1IA 1CLFA 1S6UA 2AYGA 4EBCA 3NMUA 1UW4A 3H98A 1BA1A 2C2NA 3TQ1A 1V3RA 2A3JA 4FM0A 1S22A 1ZBLA 1JMTA 4IKFA 4IO9Q 5GADI 1F6TA 1JJ2M 5GADP 4I2PB 3QMLA 1PYOB 3CJ9A 1JJHA 5KFHA 4YB1P 2CNNB 2W4CA 2QL7B 1I94J 2AZ1A 2OD6A 1MU2A 1X4AA 1EB0A 3NL0A 2FZGB 2ITMA 3MUTP 2E2NA 3DRPA 2Q0UA 4ANCA 3GJRB 3C6HA 3NGRA 4MIAA 4O5FA 3D28A 4TLQA 2J6UA 4H5NA 2AJQA 2FDNA 1MN9A 1NZ8A 4JI5K 4DS5A 2R7XA 3ZSXA 4JYAK 4IFEA 1KFDA 3OYCA 3MEEA 5DDRC 2RNEA 3ATUA 2XI2A 3VQDA 4C4WA 4JI7F 2GX9A 1LK7A 2XZWA 1JLEB 2QWPA 4NYFA 5LJ3Y 1BUPA 3FEYB 5KFIA 5M2UA 3MECA 2YKQA 2LU2A 2DNKA 5J1NA 5D6GA 3NMAA 3IG1A 2LSNA 1CJVA 4OYOA 4ED2A 1VHIA 1EZZB 3GL1A 5F1XA 2JEJA 2ZE2B 3R8YA 4PKIA 3ETMA 2YVSA 2IFXA 4A62A 1KTVA 3CDAA 4ZVHA 3MAAA 1XMQK 4LFBK 2QWOA 4Y2IA 4O3RA 2D9OA 1D8YA 2FTRA 2EC0A 2NZCA 4Y65A 4IKAA 4JI8J 1Q8KA 1FD2A 3D0IE 1FA0A 4DU8A 4WCEL 4M63C 1EARA 3WNHA 3K5OA 2R2UA 2HZCA 2DGVA 3BKTA 2K7JA 2RSQA 1C1CB 4BC2A 3EGVA 3CW2C 4OVLA 2P51A 1WLJA 2B9XA 4MYTA 1ITPA 5AQVA 3VF2A 1EKRA 3T1AA 2V2KA 4QQBA 1NJZA 4YEAA 4OLAA 5M2RA 1H7WA 1JXVA 3ASMA 4BRAA 3OUYA 3CCJN 1FXXA 3N5BA 3SAGA 4ERDA 4NLVA 1GMWD 4Y28C 3J7ZO 2UXBJ 1WBDA 2ZQBA 4IOBA 4J9PA 2LXIA 4MDBA 1C4AA 3W2WB 1IBMK 3ZZPA 1NSQA 4YOYA 3ENVA 2E20A 1LWXA 4P6QA 5KT2A 1D1UA 3MMAA 3O3LA 2KG0A 4FLTA 4LVOP 4DHVA 2HZVA 4I0WA 4AQYJ 2VDHA 1BQNA 4DQSA 4NO7A 2HWTA 1YT3A 5C42A 5AQPA 1U1KA 4K43A 4OI6A 2M88A 3KHLA 3BSNA 3LGMA 2QFJA 3P4IA 2FGCA 3V1OA 3CTRA 3MEDA 1AZSA 1SV5B 5H9EK 1JLGB 4W4MA 4J37A 2OELA 2P9KA 3OL7A 4PG7A 1Z2ZA 4H0TB 1H0HB 3OHRA 2V8DA 5K5MA 4A57A 3IAM9 1LWFA 3W1YC 1IKYA 4DU1A 4GVLA 5J1EA 1A5WA 1T9TA 2N7YA 5KPTA 4ATNA 4DV3J 3TA1A 3HLUA 4IG3B 2ZH7A 4CJTA 4K0KF 1R3NA 2B5JA 5GAHI 1ATRA 4BY9C 3SSRA 3KHHA 5H9FK 1DT9A 2RH3A 1JLQB 2ASJA 3AQPA 4DV1J 1BG3A 3O3FA 1P8ZA 1HLWA 1S72S 3KVGA 3TTCA 3OTOF 4I64A 4K25A 1SJ1A 1FK9A 3R6LB 2ZEJA 2Y1JA 4DZDA 3TQEA 1R89A 3W5ZA 2F8TA 5AZJB 2OUGA 5D4LA 5JLHA 4PY5A 5ADZA 2MLYA 1XERA 2VA3A 4B3SF 1ITGA 2W25A 1VQOS 2BJEA 1OY9A 1MNEA 1REVB 3OYNA 1PGZA 1G15A 4U95A 3PYEA 3DDNA 4DV7F 1LK5A 4CTAA 3T1YK 5I3UB 4BC9A 2BW2A 4P2FA 1VSFA 1YKWA 3BGOP 4JI4J 1S1XA 4IYQA 1JJCB 3BR9A 3ILJA 3CCRN 1LAWA 4IXCA 3DLKA 2HKEA 4FXDA 1YRTA 2UV8A 5DGAA 4DR2K 4ED7A 2V34A 3PVXA 3V9SA 4RX6A 3OJUA 2KHCA 2YY3A 5F8MA 1M5OC 3PX6A 2E6MA 1HI0P 1LW2B 4BR5A 3AHPA 1NZAA 2JWKA 1O8BA 5FJ4A 5FRMA 3M5RA 1WOQA 5HQLA 1RT6A 1BWVA 3UKUA 1DQ9A 1IBLK 3DLLL 3AA2A 4FJKA 3FMBA 2GQCA 4CYUA 3P6YC 1EO1A 1WSJA 3W61A 3AVFA 1N5SA 3PG9A 2AZ3A 4A5AA 4FK4A 2P9EA 4OI2A 4BE0A 2ZBPA 1NKEA 2WVEA 4IG0A 1W2IA 2GV1A 3L95X 5HP1A 6FD1A 4AXJA 3AFGA 1S6OA 2P2CB 1NK7A 4E19A 2EI5A 5B0CA 4NXNF 1R8HA 3WXKA 1JJ4A 5KFXA 2F65A 3SI8A 4GC6A 2DRBA 2MQOA 2RN2A 2HF4A 1WTBA 4NLGA 3QEXA 3QFHA 2HLTA 4DTUA 2VQFJ 5M1NA 1NXIA 4RU2A 1IBCB 2CQHA 1M0SA 2V4RA 4Q7AA 4BRIA 4ELVA 2XQCA 4ISGA 1JLBA 3CF5L 2J7UA 4RWXA 1WSRA 3CDEA 4CEDA 4BRKA 1IKXA 1UVMA 5JXSA 5DG8A 2QL5B 2J9EA 2BUNA 2GMJA 2QYCA 4FL9A 4ANEA 3JS6A 3RBZA 1FFWB 3PIPL 1TKZB 2X3GA 5IM0B 2XHWA 1MDUB 3PFOA 5KFYA 1C1BB 2KHOA 2YCHA 4KH4A 2BQUA 4WIIA 5IS2A 2RIJA 2B51A 3WNEA 3OYLA 4KGXB 2R3VA 4ZLNA 2EHGA 3CCQN 1MMLA 2JZ5A 1ZM4A 1X4BA 3GSDA 4KHMA 5B0GA 4YDUA 3MOZA 1ZS6A 3VZHA 4OPAA 3BQ1A 1ZH5A 3MDQA 5EWFA 1R31A 1P6TA 3HKZD 2OIHA 4R8UA 4RW6B 3M8PA 4PWDB 3OD2A 2O1PA 5LJWA 4QWCA 2CQGA 3NHGA 1NJWA 4JI1J 4DR3F 4X65F 1CJTB 4BS2A 1BO5O 4JS4A 3WUHA 4JLHA 4BC7A 3O6QA 3MI7X 1N36K 1R43A 4LD0A 1NOZA 1EETA 4M7XA 1AXQA 1V5IB 5CYMA 2O67A 3UD3P 4DL2A 2IGIA 1X0PA 1P8GA 2MZ1A 1HI8A 4CJLA 3I5BA 4JI0K 1DQ8A 1YBUA 2EG1A 3SAFA 4JKAA 1HFEL 3M30B 3TX8A 2OANA 4Y34A 3I56N 3ITHA 4WF9Q 3C15B 1SQKA 2J0XA 3G10A 4MKYA 4KGKA 1HHSA 1FJEB 3DOLB 4MLHA 1U49A 4LVNP 4A59A 3MM9B 3DRSA 4N77A 5FROA 2Z56B 4DQIA 3SQ4A 4FPRA 3Q0AA 2N3LA 1RDCA 2DFFA 1RP5A 2H5IB 2M7SA 4RZRA 1TTHB 4RUBA 3EZWA 1QAIA 4M94A 2A42A 4B3RF 3RW6A 4RW9B 3IR5B 4Q2MA 4WFBQ 4DXLA 3SUNA 4CRJA 1DZ5A 1EWQA 2M3DA 3P5JA 2KHDA 1ICEB 4DV6F 1U6ZA 1J2VA 1T05A 5KFAA 5DQIA 1RCOB 4NASA 4GVMA 2I5JB 3AO2A 3NNHA 3P3DA 1URNA 3JSYA 2FSNA 2XZDB 2MQPA 4DR5J 3SDEA 1XIQA 2QX0A 2HYIB 5GAEU 1UAXA 3BGRB 1BGXT 3V5RA 2GAGC 3QEIA 1N88A 3OA9A 1YJRA 3IR6B 3E9PA 4CLLA 2R7UA 4IJAA 3W9HA 3H8YA 4NXMF 4CLUA 1HKCA 1VQYA 3FCWA 3W9JA 1QM9A 3CD6N 3UN5A 2VFUA 3R3LA 2J4RA 1NDKA 3A1YG 4ZVFA 4QIFA 4X2BA 3X3UA 3THXB 4I2QA 2WBRA 3G4SN 2WK4A 1BA0A 3WZ0A 3VA3A 5GAGU 3ZSWA 2VBWA 2A1BA 4ID5B 2Z8QA 2MLZA 4KHNA 4LFCF 3BF4A 4CLKA 4BVOA 3J80Y 4B3TF 2WVCA 4FNIA 2ZH2A 2YHXA 1IR1A 3Q8PB 1T9WA 4C2MA 4RBUA 1BU6O 5IWAK 1WHXA 1RTHB 4WFNL 3VCDA 5F8JA 1RU1A 2RKIA 1J5EJ 1RI7A 3RWUA 1SIZA 4OYPA 4KKOB 3VERA 3ZZTA 3DXMB 1NB2A 2IVOA 3DLEB 1C0MA 5F8NA 1X4EA 1QUVA 4C3LA 3LOUA 3PY8A 2ZJRL 5EX5A 3RBDA 3T1HJ 3VESA 2PYJA 2FLNA 1TL1A 2ZKTA 1CS4A 1FD8A 4YB6A 3WC0A 1S7HA 4OHVA 1O6XA 5AQXA 4BG9A 2QLBB 4HKQA 2AGOA 2OCEA 3P83D 2FHOB 2MZSA 5EX0A 5HAOA 1CXQA 3AY0A 3O3GA 1FJ7A 3ZYYX 2RAQA 1ZBIA 4B3OA 4HR2A 4YY3F 2R7YA 4WXOA 3UN2A 2VCPA 1GX6A 1N34K 4DCJB 2P9NA 3MXIA 3N5FA 3T9NA 2OFHX 1S76D 1FXLA 4DWIA 2HNZB 3WIUA 3ILLA 1BXNA 5DLGA 1VBXA 4KB1A 5C25B 5EX3A 4OI1A 4ISFA 2CQ1A 2FPHX 4IOAQ 4AILC 3QBCA 2X1GA 4DV4F 2DRDA 4B1YB 4H5VA 4JP8A 4GV9A 1U0HA 2DGOA 4H4MA 1T95A 1SL2A 2G0JA 4CH1A 1ESVA 4Q45A 2A6AA 3NH1A 4CJKA 1KP6A 2QWQA 1FVQA 1S1WB 4UUXA 2QMXA 2O8EA 3CJBA 4YDDB 1DAXA 4ER8A 2IY5B 3I0RA 2CVEA 3TAMA 3BN7A 2XWYA 1L3TA 1FX2A 1VLOA 1D5AA 2F1FA 2WFBA 1JKHB 4DQPA 4ED8A 3NP5A 2IJRA 4CJPA 1SQGA 2MZRA 3RAMA 1NHVA 1Z25A 4O3PA 1HBMA 2CQBA 1VQ4N 1OY8A 1RT3B 3FLCO 3QFPA 4IOCL 2QA4S 5DDOC 4J9OA 3W9IA 2IOCA 2CAJA 2E1MC 3IFRA 3MF5A 3GIMA 3D2EB 1LOTB 2UYTA 5F2RA 5AQUA 2R2RA 3ZNJ1 3LAKA 4YOTA 3KLFB 3GMGA 3GFYA 2MDAA 3RR7A 2XYPB 3MM5B 3C0BA 2W2OP 2R7VA 3HFVA 2LKZA 5DQHA 1I3OB 4QR1A 1OO0B 3FDSA 2QXFA 4I9QA 2OSQA 4KO0A 3O4NA 3OLAA 3MN6A 3S8SA 4B1XB 1JLCB 4A8FA 2RU9A 2CNKB 4CZLA 1UEVA 1SUQA 3MEGB 1RSCA 4FKXA 1X5TA 4NYOA 2BM0A 1IKVB 3VQBA 4DV5F 4WFAL 5DM7Q 1ZPWX 2XNQA 1GLAG 5KFCA 4KGZB 4FJMA 3T5KA 2P9CA 2MKCA 3FGVA 1S48A 2MQQA 4DUTA 3DYAA 1FFGB 2FLOA 1HR0K 4PQUA 4C8ZA 4KQZA 3SQ1A 1CJUB 2XMKA 3U6FA 3NCPA 3V81A 4M5DB 4UTGA 4ED4A 4XTTA 4OJGA 2E7XA 3MM7A 1XR5A 5HL7Q 4K4XA 2Y8WA 1S9GB 3TVYA 3OXLA 2DNZA 4JI7J 1Q7YO 1N33K 2IYIA 3C7NB 2G8FA 1GEHA 2UXDK 2H5EA 2BKNA 4NI2B 3U27A 1FEHA 4B9SA 2GUPA 2FVQA 4PL7A 2EEYA 4GVBA 2XGPA 4B3MK 2U2FA 1WOOA 3D2FB 2COLA 4GKKK 3K17A 3SQGB 2H4YB 2ZD1B 3KLVA 2M5YA 3RMCA 2CQ3A 1UJ6A 4RWTA 4DU3A 3K0JA 4IDKB 1VDHA 2RRBA 4HHUA 4WQ5A 4WU3A 4ENOA 2MZJA 4DLEA 3O44A 3BY5A 1ZAVA 4CHQA 1NDLA 2OPQB 3TI0A 3ULDA 1F9FA 1YJWS 4DV0F 3OSNA 1I1GA 3FSIA 4OX8A 1JNRB 3C6TB 3D5MA 3MWTA 2HFNA 1FKPB 3POTB 1YX2A 3IRWP 3R9PA 3J81j 3KMQA 4ZPTR 1HNXF 5KPRA 1RDBA 3ELHA 2DB1A 4CECA 3TO8A 1WSGA 2CJXB 4ZVQB 4B9QA 3LANA 2C3MA 3EGZA 1S1TA 3AJ1A 3NRBA 2I6WA 2YWGA 2P9LB 5J2NB 3O5BA 4HEA9 2IVMA 5KFFA 4BR2A 4MKAA 3ONQA 2RUGA 1FX4A 5A8RA 3V1RA 1YZ6A 3B82A 4MTPA 5HJXA 3VGSA 1TGOA 3TANA 3LDOA 2N7CA 1ROFA 2XYHB 1A9NB 1U09A 2E5GA 4U67Q 2HSEB 1X5SA 3I55S 4C23A 3SV3A 4DPOA 2GTDA 3F9MA 2DCUB 1TVRB 4L74A 4ZPVR 2GA7A 4CI6A 2YHBA 1PJ6A 3US5A 1CSJA 2Q6CA 1ZM3A 1I3AA 4OLPA 3AD9C 2DVIA 4IBNA 2B0GA 2A1RA 4OZ3A 4N41A 3ZX3A 2H51B 2J8SA 2WOMA 4C8NA 2KKZA 4JKBA 3HPGA 4EU0A 4OPHA 4K4WA 2JC0A 4KFBB 4ZJQA 4IFYB 1K47A 3A3OB 4R0EA 1W0HA 3ZNUA 1PC4A 3BEXA 1Q5YA 4IO1A 1FF2A 4K0KJ 2PN6A 5L9XA 2R9LA 3ZX0A 2MGZA 2W8KA 4JNEA 1DY3A 3AGRA 5KT7A 4Q43A 1RT7A 1FRKA 4A61A 4OHXA 3A4TA 4E1MA 3JYTA 3OTOJ 2XI3A 4YOXA 1ATNA 1K44A 2AV5A 4LF8K 2V8HA 1WC0A 1Q9XA 2HB5A 3QO9B 5LSOA 3OW2R 3BGLA 2PMHA 4UOFA 5E3AA 3PIOQ 4B3SJ 3SJJA 5AQYA 1WHWA 2V2ZA 3RB0A 3TAEA 1WSIA 4RUCA 4NCGA 4E2FB 4DV7J 5AQMA 3SAHA 1WELA 2O8CA 1N0UA 5ETMA 4C3MA 2Z1JA 5JVGL 4OJRA 3LP1A 1CG2A 4GMKA 2QN6B 2G8HA 4MLEA 3C6UA 4LSZB 5C2GA 4YHHK 2ROEA 1HMVA 4C11A 1QAXA 4K7QA 3S6EA 1FKOA 3GE9A 5D0HA 2MJNA 4GVEA 3WBZA 1IJJA 1G3OA 3BB5A 4KPYA 3KLEB 2BANA 4P74A 5DM6L 3DLGA 2RHSB 3OYEA 3MM8A 2YNHB 4PPDA 4P7TA 5I42A 3DRRB 4OL8A 4A46A 1GLFO 2UXCK 3UD4P 2GGPB 1TKXB 4DQ8A 3H7HB 2SXLA 4A8OA 3ET6A 1RDRA 4OLOA 1SJRA 2VV5A 4RNNA 1HNZF 4CO4A 4KR0B 2R8KA 2OPSA 3LP2B 2O8BA 1S6QB 4O44B 3M6UA 2GUIA 2NQPA 3WQPA 5J2MB 4F8RA 3M8WA 1IM6A 3DU5A 4CJUA 4NXNJ 2CYYA 4DUZK 4WK3A 4BRNA 4DUYF 3EMTA 1HD1A 4YDXA 3O5TB 3RZAA 3CIPA 2JGUA 4WP3A 4ILRA 5KQ8A 4ZPAA 3PR4A 4M95A 3T5JA 3KWIA 4PA1A 3OT9A 5BR8K 1H6KX 2AYEA 2GS8A 1KQSR 5F8HA 5F8LA 2W24A 2YNGA 2XSJA 4HHTA 5D4OA 3OS2A 3QIPB 1NJXA 2WUSA 2YWFA 4PG8A 2LMIA 1JXLA 3CC2S 4PKHA 5HMZA 2NPFA 4DBQA 3UW1A 1RLDA 5HI7A 3O08A 1OPIA 2Z57B 2HRUA 2ZF5O 4M42A 3AQOA 4L75A 3C3LA 2W1BA 2BJ9A 3C65A 3VF4A 3OVNA 1XI1A 1RABB 3MMCB 1KVCA 3R8EA 1ASWA 5KFLA 2GMHA 3EKSA 5DO2A 1NB7A 2WAQD 4QR2A 2D3OR 3HFKA 3MMVA 1TV6B 2O8DA 1HW9A 3CC7N 2NRRA 3KHYA 2ROGA 3HTVA 4DR3J 4X65J 1RT2B 4E7LA 3EX7B 1H2VZ 3EVWA 3O9QA 1F60B 3NH2A 1B7FA 3KJQB 5KFMA 3TUPA 1B0PA 4Z4CA 1GLCG 4NLQA 1B99A 2YKNB 2APOA 3V9ZA 3G25A 1LXNA 3O1BA 1T03B 4LRDA 2XO6A 4CHPA 4I2PA 1RILA 1N5QA 5ETVA 4E8UA 2H9ZA 4QYZJ 2VBZA 4I6AA 3B6OA 3TABA 2ZC3A 1U45A 1NBWA 4DJBA 3EZOA 3O8MA 4DTJA 3LDSA 3JSMB 5IT9Y 2NSCA 3VEVA 8AT1B 5EY4A 1JIHA 3G71S 1NU4A 5D8HB 2ZJQQ 2FLPA 1F0XA 5FPEA 1HQEB 3M8YA 3J7A1 4PPZA 4ID1A 2FZCB 5DDQC 3M8ZA 4BDPA 1SZ2A 3LM9A 1YIJN 4HHHA 3L3CA 3SYZA 4B3RJ 4KC5A 4O3NA 3V4MA 3SSQA 5M1KA 3AH6A 2CJKA 2G8VA 1JL1A 2NS1B 2OAUA 1V4TA 3W3DA 5E26A 1WHYA 1NGCA 4DV6J 1UVIA 3T3FA 1EKEA 1D0EA 3HSZA 3HXMA 5BPLA 1R27B 3BS9A 3TZYA 2IVFB 4MDAA 3BPDA 2OEKA 3Q22A 1JLEA 3CCUN 4NEYA 4V19J 3HHLD 3VPZA 4NX9A 3I9ZA 3C8YA 3FQKA 4NA2A 3HJVA 3CE8A 1HA1A 5CXTA 2HS0A 4IFVB 2HQDA 4X64F 4NXMJ 1HPZB 3OHAA 1D4XA 4FZZA 4I56A 3ATVA 1HWIA 4ZP6A 3HHLB 3R5AA 1MA9B 2I2YA 1VRUA 1ZBUA 1UPMB 2EKYA 1XNQK 4QYRA 3LWMA 2Q1NA 5AXLA 2CG8A 2ZOMA 5CHIA 4HI1A 4PXCA 5CZXA 4LFCJ 3KHGA 4B3TJ 3BZKA 4ZJLA 1XEZA 3H2VE 4OIXA 5IQQA 1RGIA 1E6YB 3MCAB 2ZFHA 1T9VA 3MM6B 5DGBA 5L9NA 3ZSOA 3QT5A 3T6JA 2W4PA 1YHQN 3WXIA 3IP0A 4USJC 4F67A 1Y0HA 3PYDA 2LQJA 2DISA 2KFNA 2AJ0A 1RAIB 1RBTA 1BE4A 5A0YB 2BV3A 3SEOA 3RBEA 4Z0UA 1TKTB 2DR5A 3NH0A 1G2EA 3R5JB 4RW4B 1Q78A 3MPYA 3CXCM 4IEIA 3MCPA 3W2WA 3W66A 1XNRF 5EVZA 2YKOA 2MY7A 4DTOA 3WNFA 3QNOA 2IIHA 4CJEA 1C0UB 4YY3J 1GMWA 3DOKB 2Z2LA 1WF1A 3Q2TC 1QVFM 2CDRB 4F0HA 2WONB 3GIKA 1I94K 5FDLB 1K6YA 3PJ9A 2AQ4A 3FEXB 5GAEI 2GO9A 5GAEP 3NCIA 2RDJA 4NLPA 2FUG9 1S97A 2VG6B 4CM0A 1SV5A 4RU9A 4OKKA 1KN6A 2F96A 2PY5A 3FZKA 5IFMA 1J54A 2P9SA 1S5ZA 4DV4J 2G2YA 3WQTA 1VQ9S 1IWGA 3TX0A 3CJKB 3L3VA 2HHVA 1FWKA 3GFZA 2JJ4D 4J9KA 5GAGP 2QG9B 5CY4A 1JLQA 4F25A 3GLJA 4J90A 4EO8A 4E3SA 1IQTA 3H59A 1DLOB 1JJ2R 2DY1A 2O66A 5AZJA 3LTOA 1EKSA 4AHCA 4DL5A 4BRPA 4WZQA 4ITSA 1RT5B 1V5VA 1R6YA 4H5WA 3UE5A 1VRQC 3NEKA 3SCIE 1EQYA 3L9ZA 1BHNA 1QQCA 3M2UA 1REVA 4JV5F 3PYGA 3THVA 2IYGA 3FBFA 3Q89A 5I3UA 4RR5A 5B08A 5ETOA 3CC4N 2NZTA 2C2DA 3EGNA 1U0SA 5J1PA 4U7BA 2K3KA 3PACA 3OVBA 1PJ7A 4J5OA 3AVCA 3FZFA 2FIUA 2WRMA 4JI8K 3M32A 5KFPA 1NAQA 2EFPA 4CF9A 2UVRA 4M5LA 3CPEA 2B7CB 1BC6A 1M5HA 4ZVSB 4NMXA 4DG1A 1X60A 1DARA 2O5DA 3TA2A 2UUAF 4DV5J 5C7PA 4M3TA 5D3GB 1BHLA 3AY9A 1LW2A 1H1VA 4W5RA 3CCVS 2ROPA 3CFRA 3W8PA 5FPDA 1VBYA 1YUWA 4I69A 2CPEA 4XDDA 1IV0A 2UXBK 2QTDA 3G96A 1GTHA 1VJQA 5F0UA 8RUCA 1VK0A 3N6LA 5KOXA 3TTDA 3H0PA 2VHGA 4HACB 4QU6A 3O3HA 5ETTA 2NXUA 1J9AA 1TL5A 2XB2D 1SKWA 5HBMA 1XMQF 3IBCB 3FGUA 3AA3A 4ZHRB 3A5OC 4AQYK 3GILA 4ILLA 1TYQB 3M3ZA 3R5GA 1NU0A 2LU1A 1YVNA 3VAIA 1HWLA 2W6KA 1RTJB 2RVJA 1SJFA 1E4GT 3MFIA 4BVPA 1R0AB 3CD0A 4NRUA 5B0DA 3AJ2A 3D6HB 2DR8A 3KK1B 2YKMB 2FXUA 1M5SA 2E5JA 4DV0J 3P1GA 4J8FA 3JQKA 2RE2A 2GCFA 3HD2A 3OL9A 1XMBA 4C7QA 4DV3K 4KRFA 3D0PA 4BQLA 1VQKN 2HIYA 2V68A 2DGSA 2POKA 3VGLA 2JHEA 2EFNA 1TKZA 1P27B 4CEQA 3DJCA 1AB8A 1UPPA 2BJ8A 1C1BA 3ZZZA 4CIFA 4DV1K 3TSPA 3HHLC 1TK5A 1HNXJ 2BXJA 1S3XA 4ICLB 3GIJA 1VQ7S 3H1QA 3SIPB 2RDIA 1NGAA 2P1JA 3SPYA 3PO5A 1IBMF 4U8YA 1WSVA 3DXKB 4XK8C 4EZ6A 4AD6A 3EKUA 3QIDA 1JLFB 4RW7B 4FWMA 4RW6A 3LP0B 2BRKA 4PWDA 3MZIA 1C1AA 3IUCA 3H3OB 3TZZA 2JLFA 1VQ6N 3PRBA 1NPRA 2A10A 5KFQA 3U9ZA 1CJTA 3N4QA 2HK3A 3H46O 1HYVA 1RWNB 4JI4K 3BKUA 2QLFB 3VGVA 2VD3A 1KAZA 2K1RB 3ZZUA 4J91A 3L2RA 4CO2A 2RD5C 4XIUA 5HJYA 4BROA 3KG4A 2IA0A 5F0WA 2AEFA 3QRPA 3DCAA 3AVGA 4FLUA 1TL4A 2ILZA 1NLVA 2KW4A 3GCWP 4CGFA 3BZCA 3VVTA 3K5LA 3L4BC 3D2WA 4DMZA 5FPMA 1TL3B 2HBLA 4MQ3A 3C15A 2EWSA 5DDPC 3BZQA 5E84A 2UVWA 1RTDB 1FRXA 1OKJA 4B08A 1GOAA 4H0XB 3MM9A 4DN0A 1PSDA 5BRFA 2OEMA 3KHRA 4JI6F 4KTQA 3ENWA 4NE9C 2Q66A 4BDYA 2OP5A 5IC4B 4RW9A 1NK4A 4OYXA 1SS6A 4JAXA 2GIQA 2DYAA 2VUGA 2DR7A 3W2VB 1WKJA 4LF6F 4CLZA 2ZBRA 2ZZNA 2UVUA 2UVVA 1BQXA 3A5MC 3O8WA 4JK7A 3BGRA 2DIVA 2W7AA 3NMRA 1H7XA 1FNOA 1SC4B 3D4JA 2VQFK 3G8TA 1TUVA 5KGXA 3LL3A 4CO1A 4MK8A 2DH9A 2VWBA 1G7CB 4Z2XA 5HO4A 3VTIA 2ADBA 3RSEB 4Z94A 2C22A 2W6LA 9RUBA 5CD4A 2HNYA 2IM1A 3EXCX 4X4PA 1ZA2B 1T0TV 4DLGA 3I55N 2W9BA 1VC0A 2HS4A 2IC3B 5B09A 2FJWA 3AO1A 2HVIA 3M8QA 3NE6A 4KPCA 1WUUA 4ZVTB 3FFIB 1RTHA 1KKHA 2GHPA 2IRYA 4L3NA 1HQ2A 1T9XA 1X4DA 3UR3C 1EQ0A 3AXKA 3NGYA 2BA9A 2BE7D 3DXMA 4USTA 3DLEA 5K14B 4JRQA 3SUOA 2IDLA 2UZAA 1PKUA 2NREA 4ZLPA 4NPOA 1HNZJ 1TUYA 4JI1K 2LA4A 2PT0A 4DX5A 3EL2A 4V19X 4NA1A 3NY0A 1XR6A 2XY5A 2OLWA 3BF1A 3DXSX 1WC3A 5A8KB 3UVJB 3M05A 2IM3A 4UY8T 4DKWA 3GTYX 5HQMA 2FY8A 4DUYJ 4B1ZA 5M1QA 1LQ9A 2P9PA 2VU5A 4DTXA 4YP3A 4NA3A 1HNVB 3SLCA 1WEYA 1E3MA 1UEUA 2XS7A 1FDAA 3QRRA 1P90A 2HNZA 1GNKA 1MN7A 3AODA 4NZ6A 3KJVB 4FSVA 1YJTA 1B0VA 3CCJS 4WCEQ 4UZCA 3PRDA 2C1EB 3R7BB 3J81Y 1VGYA 3ENBA 1T44A 3UI3A 4B02A 2E1ZA 4UY8O 3L2UA 5AQKA 1AUSL 2ALYB 1H98A 4IUFA 4DR1F 4RNOA 2B3TB 5AXMA 2KG1A 4OKEA 1ZBFA 1OWXA 1Z05A 3KLGA 4E7HA 1PG5B 1QAYA 1S1WA 3CJ7A 3L3UA 3EGWB 3MPDA 2PZSA 3CM5A 3KKFA 3KUGA 3GFHA 1NJIO 3ENHA 2X7IA 2ACMA 1HHQA 5AQSA 3QINA 1EJ7L 4GKJF 4FWRA 4DR5K 1LW0B 1JKHA 3C95A 3KJFB 3VEXA 2XLIA 3CJ2A 4Q2LA 1HNIB 3Q8UA 3MCMA 1RT3A 2V9KA 3VAJA 5FPNA 1RUSA 1QVGR 3D2EA 3EXYA 2B8QA 4KH1B 3H2UB 5G4DA 5GAHU 4CNZA 3MX2A 4DR7F 5DZ7A 2QL9B 3HBTA 1JQGA 3KLFA 2VFRA 1YDLA 2F7VA 2HRTA 2LEAA 3MM5A 2VGMA 5ADXA 4FOIA 1P1LA 3MR2A 2RQKA 1WI6A 1TL7B 2XTJP 2DO4A 3ZTRA 5AQTA 1MMDA 1WTFA 5KGWA 4LF5F 1JLCA 1UAWA 4LH4A 4O23A 2NPIA 3KUHA 3ZT1A 3E66A 1RWKB 4M5GA 1ZTTA 3QGIA 1J5EK 4F36A 4NLBA 1IKVA 2A3ZA 4OYBA 1N8RT 3R3TA 4MFBA 2DR6A 3NF8A 1KHWA 4ID8A 3AVMA 3PR5B 3VF0B 3UDEA 4CM2A 3G82B 4I6WA 2UUBJ 3BQ2A 3RGIA 4KHPF 1IM4A 2LEPA 3T1HK 4J9NA 4BR9A 4P2MA 2Q43A 4WFZA 2VA2A 1VK3A 3CCRS 1XTZA 3H45C 2EFGA 1ELOA 3SZ2A 2DPJA 4M5DA 5GINA 5F9LA 4MYUA 2Q6BA 4YOVA 2JNJA 4ZVOB 3AAWB 4F3QA 1APSA 3UO0A 2GO8A 1U1QA 4LF9F 3HHNB 3C7NA 3PTWA 4NI2A 4HH1A 4PRFA 3JSRA 4KIAA 5MAOA 1TUUA 5KT6A 3C14B 2R7TA 1FNXH 4EBEA 4X64J 3D2FA 4EO6A 2LCWA 2IRXA 4CK2A 3SQGA 2ZD1A 4IR9A 5LJ5Y 2Q1LA 4ZDNA 4PWWA 1RT1A 3MWBA 1I51B 3K0SA 1R8PA 1T3NA 4QS9A 4CJFA 4FN5A 4X4RA 2ZOFA 2OPQA 3MXJA 4CLSA 1KOOA 4Q8EA 4B1VA 2VPZB 1G99A 2QSWA 4AHTA 3PW7A 4MMOA 3Q23A 4FWSA 3KD5E 3C6TA 4BC4A 1FKPA 3POTA 1NK9A 1C0TA 4DFJA 3DLLQ 1FDBA 3SCXA 3WXMB 4DDFA 1VK8A 2J0QD 1B3TA 4EI2A 2FJEB 2F7TA 5AE2A 4RWWA 5E3CA 5EHHA 1RHUB 1TK0A 4MT1A 4EWTA 2OZSA 3MDFA 3CCMN 1KAXA 3J80O 3PX4A 1PO6A 4LF7F 4DL0C 5KI6A 1UFWA 3PV8A 1QQNA 2P9UA 2MZTA 3RTVA 4KAIA 1RBVA 1TMMA 1XNRJ 4RUHA 1IBKF 3MTJA 2YJEA 5KFDA 4HVJA 5C0YA 1KVIA 4AE5A 3FZ2A 4PEOA 1R8CA 1FCAA 3CF5Q 3CCQS 4DSLA 4I67A 4ZCLA 4B9UA 2K7KA 2Y3YA 2A6OA 5EN1A 3HT0A 1TVRA 1ZAXA 2NUUG 4KSEB 2V50A 4DTRA 1OS5A 4A8YA 5AE1A 1AT1B 3PIPQ 1DHMA 4LRAA 4K8RA 3SCLE 1RDDA 1FDDA 4K4TA 2GWKA 4FZXC 4J9QA 2HOEA 5E3QA 2ZJPL 4RO0A 2Q31A 4KFBA 4IFYA 3ENAA 2CQPA 4FJLA 3ISND 1RISA 1TUGB 2EBGA 2R8JA 5G0RB 1L5UA 3I0SB 2J76E 5IXUA 3NDKA 3DXBA 3ILOA 2V4JA 1Z26A 1P9YA 1N6QB 3V4IA 4CDIA 2MQLA 1AYEA 3SPZA 3JXUA 3LDLA 3RB6A 4JI7K 3W0LA 4GMJB 1M1KT 2MQMA 4KV8B 4HDHA 1S0NA 2A1SA 3I56S 4IQMA 2RF2B 4NEZA 1DRZA 1CULB 1SIWB 2MEWA 2VQEF 2ZZTA 5DMRA 4JV5J 4LUBA 3KG1A 4ELTA 3Q8SB 4CEOA 2W2QP 1VQPN 1J5OA 2BOPA 2XWXA 2Z1IA 4P72A 3L6QA 1RDWX 2EW9A 1QHAA 2CG4A 2R7OA 1G6BA 5DETA 3FSYA 3PRVA 3A5NC 2K2PA 2N4DA 2AJ1A 3HOSA 1J53A 1Q86O 3I82A 1U6BA 4K4VA 1HX1A 4M3ZA 2WVFA 1NO8A 1FNMA 3DWLA 2UV8G 3QGPA 2F4VF 4CFCA 1HR0F 5HRRA 4C9DA 3BH6B 2JEGA 3ZTPA 3K8WA 1CVJA 2UUAJ 3T69A 3BN4A 4IDHA 4B8AB 2YNHA 1Q0NA 3CFPA 4KB7A 3ZZRA 4G1PA 2ZM6F 5IOLA 1ZYQA 3DRRA 4F4WA 1D09B 4U7UD 3TR8A 5JS1A 3RRGA 2ZUAA 3CD6S 2UXDF 1FXDA 2CGKA 1NHKL 1P9QC 1QLNA 3H5XA 4R79A 2GGPA 3WNGA 4BR0A 1TKXA 1SKRA 2MKSA 4FYXB 3R5BA 3U1NA 2PI5A 5CA5A 1GT8A 3G4SS 1EQMA 2F8EX 2H54B 4GO5X 3QNWB 3ZT2A 1HBOB 3H90A 1LAVA 3CERA 1FI4A 2VASA 2YBVA 3EVOA 1X4FA 3GJSB 3GIRA 3KLIB 1S9EB 4O44A 4HTUA 5J2MA 4CJ7A 1TMJA 5D15A 3HL8A 2Y0SD 5CYJA 4U7UK 2N4CA 4ZIVA 2DNGA 5B0FA 2NUHA 4L3QA 3IC1A 3H3NO 3JB9k 2L08A 3HO1A 3DGPA 4M7YA 2A2CA 4ECSA 4RNMA 4NL5A 4PYAA 2IM2A 4CJ5A 3TWZA 1QJHA 3NAHA 7AT1B 2IM0A 1U2RA 3O6WA 4FLZA 4OI0A 3J80U 5AQIA 1HJOA 3NGUA 3QYYA 1NBEB 5M1PA 4WFNQ 3OY9A 3IRXB 4RBTA 3TVKA 4K0KK 2M8DB 1HYSB 3ID8A 1TK8A 4NOHA 2QLJB 5AXNA 3OYMA 2NZ4A 3ZEUB 3FBEA 4BBYA 4H03B 1YWXA 2DH7A 2JLEA 3TOQA 3OTOK 4QIGA 1K8AO 4F4YA 4M3YA 3MMCA 2ZJRQ 2B4JA 2NXEA 1REGX 2GNKA 2CZVC 2IRUA 5GMDA 2E5LF 4ZCIA 2JH3A 4B3SK 4LRFA 3VEZA 1QAJA 3MR3A 3U9DA 3AAQA 2AMCB 2DNMA 2UU9F 1MU2B 3OYHA 1HL6A 2X1AA 3TAPA 4DV7K 4H54A 1RT2A 2HHQA 3S01A 1RBOB 2CJBA 3HULA 2DGQA 2GVDB 1JWWA 2VKZG 4U8VA 3QATA 2YKNA 3SJHA 5E3PA 3I33A 3UFCX 5RUBA 5J2QB 3NGTA 1V3ZA 1OY6A 3P49B 1WBBA 3WHIA 2E2OA 3CMAN 3VGTA 2BJDA 4NLRA 4DHYA 1KFSA 3JSMA 3ZSVA 1RWPB 1VQ4S 2HNDB 3QLHB 3KWGA 4BACA 2GJ2A 1HQEA 2QLWA 1Z4UA 1AA1B 4ECUA 2YWWA 4JI6J 1JCEA 4F3MA 3A8KA 1YGYA 5C12A 3U02A 3FRYA 3MECB 1PIEA 3KTQA 5L46A 2NSBA 3IG1B 1CJVB 1FTRA 4OZJA 2ADCA 5JMNA 3AAPA 1NGFA 2P9IB 2Q79A 5KFUA 1FVSA 4E7KA 4IOCQ 3NOGA 5B0EA 1Y5IB 2DHHA 4LF6J 1Q18A 2FBTA 5E3RA 2H65B 4UQGA 4CZCA 4NLWA 4NXNK 2FC8A 5LXRA 4AHUA 4HH0A 3TTFA 1EIYB 1IUJA 5KG6A 4DPYA 2QMUB 1HKAA 3HM9A 2AP6A 1S99A 4A8WA 4IFVA 2PO4A 3WXJA 2QEXN 4CE9A 4K2JA 1HPZA 5BYRA 3BM7A 3OR1B 2HMIB 3HHLA 3IBWA 3ISNC 4G1QB 2G8WA 3V9UA 1X0FA 1UFLA 3MMBB 2B8PA 4UF4A 2ATLA 1R8BA 3VGKA 1F3VA 3BEGB 5HLFA 3H4DA 5ETRA 1U2CA 5HMYA 4WFAQ 1TFWA 2C3OA 4QWAA 2D7SA 4AYBD 1A0OB 2RQMA 4F9OA 5AQFA 1RAGB 4Y2KA 2X1BA 1E6YA 3MM6A 5LMNF 3ZTOA 2ZH3A 3HJFA 4F4XA 1IJEB 2J7KA 4DPTA 4FXWA 4C3KA 2CZ4A 1R0CB 5CZ1A 4A8MP 4H5TA 3H1VX 2F8SA 4JK9A 1LOUA 2WSCC 1O13A 1Y97A 4DR3K 3G6VA 5A0YA 4X65K 4V1Ak 2B4VA 4EEYA 2JOQA 1NM1A 2KB2A 1TKTA 4Z37A 1N56A 2KYZA 3QB0A 2NNWA 1AZSB 3CJQA 4RW4A 2HFZA 4I6YA 2PA3A 2DNNA 4WTYA 5M1OA 3R1HA 3DHWC 4CJRA 4ECXA 1IKYB 1OYEA 1VOMA 3DOKA 2C2ZB 3OFFA 5C2FA 3TEGA 2A2DA 3CCTA 4QYZK 1IVZA 2ZH6A 4CEAA 2P9GA 3W5YA 2FY1A 5FDLA 4YB5A 2B5JB 1QUPA 2QKKA 2V94A 2P8IA 1T7PA 2OA8A 3A8EA 1WNEA 4WKRA 1QD1A 2CPXA 2VFVA 4DCPB 3GG1A 1EP4A 2AJ4A 1ZOTA 3DFEA 1AW0A 3AARA 3C46A 4K59A 1NDPA 4DR1J 4B3RK 3SUQA 3CJKA 2G1DA 3GIIA 1AFIA 5KFVA 1GAOA 1VSDA 1SI9A 4C8LA 4CTAB 3CJ4A 1U1RA 1RCHA 4DV6K 1ZAWA 3C94A 3BKFA 4K41A 1B9DA 5U47A 2ZVSA 3R6GB 1SPBP 2YH1A 1GMUA 4GKJJ 4LF2A 2MPUA 3TVZA 3FCHA 4HI2A 3MD1A 5EDWA 3DLKB 4ZN3A 2XMUA 3R7NB 4NLSA 2AHOB 1XMOF 2KXHA 3DAWA 4CIGA 4NXMK 4QWDA 2MMYA 3O9RA 2CQ0A 4E98A 4CJSA 4DR7J 3J7ZT 4GC7A 4O0JA 4C0BA 4HTJA 2BMBA 4URQU 2WSEC 4RL1A 3B8HA 4DPWA 2DHSA 4Y2AA 4CLYA 2DNOA 3AGKA 4AHSA 1RT6B 4PUOB 2RRAA 4LFCK 3VOVA 4IOXA 4Y2MA 2PE8A 4ZPCA 4E7JA 5DK5A 3VMFB 4B3TK 3SI6A 3VEOA 3VZIA 4OHWA 2VKRA 1ZZNA 3KOAA 4LF5J 2D3O1 3MCSA 3FCVA 4X66F 1R59O 5E2QA 1NNEA 4M5KA 5HP1B 4FK2A 2YKAA 4DFMA 4QS8A 3J7YI 4KHPJ 3U1LA 2CJYB 4F3OA 3AO5A 5IT9O 3BF3A 4K5RA 2ZGYA 1UZDA 4JD2B 3EWGA 2C3UA 3TUJC 2NXNA 2FVSA 1TUWA 4HACA 3UR0A 1BIUA 1X9JA 3EE3A 4LF9J 2LP4A 5K8PA 1OVQA 1CC7A 2GJIA 2E2PA