3LP2A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/hydrolase
total genus 153
structure length 554
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp2A05
3HKWA 4ID1A 4JLHA 3SYZA 5F8MA 4DSJA 4CJSA 3QO9B 1LW2A 1TVRA 1VSDA 1BI4B 4ZP9A 3O3GA 4CJTA 1HYZA 3KLFB 4DTXA 1O1WA 2D0CA 2HHXA 3M8QA 3JSMA 3HPHA 1CXUA 3KOAA 3OYBA 4Z4EA 4RUCA 3U3YA 3P5JA 1A5VA 1RTIA 4RW9A 4DF4A 4AHSA 2A1SA 4KKOA 4KO0A 1DTQB 4CE9A 4KAZA 4N5SA 1S1WA 4NLGA 4CECA 3M8SA 3NE6A 2XI2A 3RBDA 1VK0A 3OYKA 2B6AB 3DRRA 4URGA 4BDPA 5HRSA 4N41A 2X78A 4FJNA 2ZE2B 2UUTA 5L1KA 4K4WA 2ASLA 1SL1A 3QZ7A 4DQPA 3MECB 2IA6A 5KGXA 3DDKA 4FS1A 1EXQA 3DYAB 1NJYA 4IRKA 3HYFA 4C8MA 4AHVA 1NK4A 2DTUA 4IDKA 2BRLA 4ED1A 4B8AB 3GILA 4F3OA 2R8JA 2JEIA 2J6UA 3EPGA 3ZT1A 3ZT0A 1RT5A 3AA5X 2XGPA 2WK4A 1K6YA 4HKQA 2KW4A 4ZTJA 3F9KA 2ITGA 3K5LA 4NLPA 4O55A 4RW6A 3CFOA 3DRSA 3KK2A 2PYLA 3CJ3A 3MFHA 2R8KA 4L8RB 3MEDB 3BR9A 4NCGB 4KHNA 1GOAA 4CIFA 5DG7A 2ATLA 1FKOA 3M9OB 4QW9A 5FROA 1N56A 3RRHA 2AGOA 1HPZB 1KHWA 1MU2A 1UAXA 3SFUA 2F96A 5KRSA 1JLEB 2W9BA 1RTDB 3HVWA 5KFZA 3DLRA 1REVB 4DF8A 4B9LA 3F73A 1XI1A 1X9MA 4J9OA 3SCXA 1RT2A 4NLTA 4HUFA 5EU7A 1EP4B 1SKRA 3VQ6A 3MTKA 2P1JA 1S97A 3ICLA 1KVAA 2FBXA 4DU3A 4R5PA 2R8GA 3BSCA 1NK9A 1Z4UA 1VRUB 5DLGA 4JRPA 3DM2B 4ID5B 4E7IA 3VQ8A 3V9WA 2W42A 3KLIB 1S1TA 5J2PA 4KBIA 2Y1IA 2BQ3A 3G86A 4EZ6A 2XY7A 3TARA 3V1RA 4CHZA 3ZSWA 3CIZA 1IKXA 1RYSA 3OS0A 3I5CA 4FJIA 1QE1B 5CYMA 2UVVA 4H4MA 2R2TA 3HVAA 4ED6A 3KLVA 1BL3A 5SWMA 4FJ5A 3I0RB 3L3UA 3RMBA 5F9LA 3PX0A 3AVBA 1C0UA 2X6SA 1J53A 4DG1A 4KPYA 4J9SA 3HVTA 1FK9A 1T7PA 4HVJA 3V9XA 1ZBIA 3ITHB 3DI6B 2ASJA 4IRDA 4K4XA 4YP3A 4QWBA 3AO4A 1S6PA 4W5RA 2PYJA 5JXSA 4RW8B 2ZD1A 4TLRA 5CYQA 1QSLA 4PY5A 4IBNA 3DMJA 1SL2A 3DOLA 2VG6B 4DFKA 1JL2A 3MEEB 4CERA 4OPJA 4NYFA 3GIMA 2IOCA 4LSNA 3LP2A 4CEQA 3LANA 1HQUA 3SQ1A 1S9EA 3BQ0A 4CJFA 1KFSA 4DS5A 4IH6A 3FFIB 4J2EA 3RAQA 1WSJA 4O4GB 4ZHRA 1NK8A 3HP9A 2AQ4A 1W9HA 1D9DA 4QCLA 4CF8A 2ATQA 4BDZA 1N5YA 4TY8B 3C6UA 4F50A 5HROA 5F8HA 5F8JA 4M95A 1TKTA 2O5DA 4FLVA 4BE2A 4WYWA 1S5JA 3OYAA 5EWEA 4TSXA 3WNEA 3HL8A 3TAEA 2GBZA 4KTZA 2AGQA 2G8FA 4CEOA 1TKXB 1JLCA 1I3AA 4I2PB 4WYLA 3DLHA 2IM1A 2OPPB 3M8RA 4IFYB 4DL5A 4DQRA 2Z1GA 4E0DA 1HNIA 4ICLA 4DQIA 3QIPA 3NBPA 3V1OA 4ZTFA 2IM2A 1F21A 3V81B 4DFJA 4CIEA 2GV9A 4DTJA 4DL4A 1R0AB 2HWHA 4RZRA 3I0SA 2EX3A 4M41A 3N6MA 1TVRB 2AX1A 3QESA 3OS1A 1GX5A 2OPRA 1JLGA 4KI4A 2WOMA 1EETA 4PQUA 1C1BA 5KFQA 4Q8EA 4B08A 3H5XA 4E7LA 3AA2A 4TYAA 4O0JA 4KV8B 5C5JA 3NH0A 4RNOA 1LAVA 2OZSA 4IKFA 2XY5A 3H40A 3JSMB 4RNNA 1MMLA 3VN5A 3HPOA 1LV5A 4RU9A 1RT4B 4BACA 4M3WA 4C8OA 2G8UA 1S1UB 1RDRA 1S1WB 4NCBA 4KAIA 3RWUA 2HHWA 3KKSA 4NLOA 3RTVA 2IGIA 4KB1A 3SQ0A 3JYTA 5F8GA 4CJEA 2HAIA 3AVMA 4B8CA 4FW2A 1QTMA 3TVKA 3MXMA 4ED7A 2FJVA 2P5GA 4GVMA 3A2FA 1T03B 2RF2A 3PW2A 1C6VA 4I9QA 4DQSA 3H5UA 3LP1A 3CFPA 1EX4A 4B3OA 3OYHA 3P83D 5HBMA 1S10A 2XWYA 4CF1A 4FBTA 4CCHA 5DGBA 4CJPA 1RBRA 4YR0A 1T8EA 2D41A 4CJUA 3MXJA 1LW0A 4DMNA 3FQKA 3DRPB 1S48A 3KHHA 2B5JB 5KFVA 3ALYA 3CO9A 2D0AA 3VQ7A 4MIBA 4HTUA 4YQWA 3SUPA 3FDSA 4F2RA 3SQ2A 5KFLA 3KD5E 1HNVB 3CVKA 1RT3B 4EEYA 1J5OA 1UA1A 4B9VA 5KT6A 3CWJA 1TV6A 2Z1HA 1DLOA 3GIJA 1SV5B 1U47A 1YVFA 1RT7A 4ZMMA 4OGEA 2FJXA 3DLKB 5KT7A 3NDKA 3EZ5A 5KG6A 4CJ3A 1TL1A 5C25B 3N6NA 4IR1A 5CY4A 3SI6A 4Q0BA 4NLDA 4MKAA 3PR4A 3B6OA 1GX6A 2R2SA 4C8KA 4Q44A 3V9UA 3D5MA 1HMVB 1NJXA 2BR0A 4PA1A 1QSYA 4ELVA 4KFBB 4FM1A 5HP1A 4IH5A 2RPIA 1TK0A 2W9AA 3PW5A 4CGJA 3VA3A 3QZ8A 4CHQA 3PW4A 2DPIA 1VSIA 3RMAA 3E51A 1WSGA 2RKIA 3KLEB 4CK3A 4FCYA 4DQQA 4M3ZA 5KFJA 3QIDA 3TAQA 1SL0A 4CF2A 1BHLA 4U6PA 3CJ0A 4CIGA 1C0UB 3P1GA 4J9NA 3M9NB 1LWFA 3HXMA 4NLSA 3PO5A 4IG3A 2AJQA 3KK3B 3K57A 2BE2B 3NF6A 3LP3A 4M42A 4ELTA 3IN5A 3DOKB 4ECYA 1TP7A 3CJ4A 3D28A 4CGGA 1QQCA 3IRXA 2E6MA 3AVGA 4R8UA 2VA3A 3TAFA 1TL3B 1IKVA 4EYIB 1WSFA 4IH7A 3G10A 1UOCA 4TN2A 3KTQA 3E01B 1RAJA 3AVNA 3OYLA 4FK2A 2PY5A 4MK7A 4O3PA 2HNZA 1ASVA 4OGCA 5K14A 1VSMA 4ZPCA 4CGIA 1S9EB 1NHUA 4FZZA 3KIOA 4WFXA 5J2NA 4AHUA 3TAPA 4ZPDA 4DSKA 3VA0A 2HNDA 1RBTA 4WZQA 1RTHB 1JLAA 4IFVB 2AU0A 3HHKA 2YNFB 1HYSB 4OJRA 3M9MB 3PW0A 3D45A 1JLQB 4CJ5A 4FK0A 1N6QA 2JC0A 5HROB 2FBTA 1NJWA 3ZT4A 3O3HA 5DK5A 3OLBA 2Z1JA 3OYCA 2PZSA 1TKTB 1RBUA 5KT2A 3QERA 3H08A 1NKCA 1A5WA 3LZJA 1S1VA 1BIZA 3OYFA 4Z4GA 1WSHA 3KJVB 4J9LA 2IM3A 4WFZA 4LH5A 4E7HA 3BGRA 4JS5A 3C6TA 3MR2A 1BCMA 5HRRA 4FLXA 4EO6A 2C22A 1T05A 1WAFA 4NLXA 5F8LA 4ZVHA 1HYVA 4O4RA 5DG8A 2WTFA 2D0BA 1IM4A 4EP5A 1NJZA 3ZSOA 3NMAA 3UPFA 3LPUA 4I7FA 3OLAA 4Y2AA 1NOZA 2HNYB 4DL2A 2E9RX 4FJXA 4J9PA 3WNGA 4FW1A 4CEEA 4HUGA 3I0SB 3G6VA 2FBYA 4Z4HA 3UQSA 3OYMA 4O44B 1WN7A 3IS9A 1C0TA 3RB6A 2OZMA 4ECVA 1B9FA 3LZIA 1CLQA 3LP0B 3UDLA 3MR6A 1N48A 2IC3A 4H4OB 1XHXA 4CFBA 1S1XA 2B4JA 2W7OA 2YNGB 4Z4CA 4DSEA 1LWCB 2ASDA 5J2MA 1JXLA 4GW6A 2YHBA 4M3TA 1VRTB 4QW8A 4K50A 3Q8QB 2WRMA 2G8WA 4LSLB 3LWMA 2OYQA 4N76A 5KFAA 1IKWA 1RILA 2JGUA 4CJKA 2FC0A 3OYJA 1RCHA 5KGWA 2HHSA 5FDLA 1TKDA 3M8PB 1B9DA 2VG5B 5D3GB 1IH7A 3L2WA 2GC8A 3CDUA 4URQU 3KHRA 1GOCA 5C42A 2X6NA 4EO8A 4WE1B 3V6DA 3PVXA 3QGHA 3OYGA 1DTTA 3KNAA 2WONB 4G1QB 4CEFA 3AVKA 3NCIA 4ECSA 5J1EA 1S6QA 3DLEA 5EUHA 3SPZA 3ISND 3OHAA 2W8LA 1GOBA 4I2QB 1D9FA 3N6LA 1KLMA 4CHPA 4F4WA 1UWBA 4CEAA 1RT6B 2VWJA 4ELUA 2HWIA 3DLGA 2OPSB 1BQMA 3IGVA 5KFTA 3HO1A 1JL1A 4YNQA 3AVCA 3G6XA 4WZMA 4HUEA 1U45A 5JS1A 3IG1B 3QLHA 5L9XA 2RDJA 1RTJB 4J9QA 4OPKA 2GUIA 1ZBUA 4CFCA 3PY8A 4NLQA 2JC1A 4PWDA 1FKPB 2C2EA 3RR8A 4CF9A 5I3UA 1RDCA 1Y97A 3MR3A 4MFBA 3T5HA 2HHQA 4DL3A 2Q3SA 4BWMA 5T7BA 1SH3A 5J2QA 3KD1E 3CJ2A 4M3RA 2X74A 1NOYA 2OA8A 3OJUA 2P5OA 2KZZA 3PJWA 3V4IB 3SNNA 1X9SA 2YKMA 2ZKUA 3BJYA 2XRIA 4TY9A 3AVJA 4O5BA 1FXXA 4CESA 4U7CA 4FXDA 3HT3A 3RMDA 3FRZA 5DMRA 4BDYA 1S0OA 1RNHA 1IKYB 1KVBA 1CXQA 4DTRA 2O4IA 4DFMA 4CK1A 2KFZA 2E9TA 3KLGA 5KFKA 3OVNA 1NK0A 4J2AA 1KLNA 4MH8A 1WNEA 2YNIA 1C1CB 2F8EX 1BQNB 3L2UA 1HQEB 3AVIA 1J9AA 2AX0A 3MXIA 4Q5VA 3HK2A 1JKHA 3KK1B 2YNHA 5L1IA 4Z0UA 4O3NA 5KG1A 3NFAA 4IG0A 2OPQA 1BIUA 4OL8A 5KFGA 4EBCA 4TXSA 3KMQA 3QIOA 1ZETA 4ECRA 1LWEA 2DY4A 4PUOA 2BANB 4CHYA 3MEGA 1TQLA 4ED2A 1S0NA 2HHTA 4B9SA 4K4TA 3DLBA 4DTSA 3B6PA 2IAJB 4ZVFA 3PX4A 4Z4FA 2FVQA 5C24A 2V4RA 1SUQA 3KLHA 5F9NA 3T5KA 2HHVA 2R7YA 2F8SA 3QO9A 2VG7B 3IAYA 1WLJA 2YKNB 2ETJA 4RW4B 3KLFA 3VQPA 2QXFA 3QEXA 4B9TA 1KCFA 1VSKA 3D0PA 1JLAB 1TAUA 4B9MA 1QS4A 2I5JB 4RW7A 3TWHA 4K8XA 2ALZA 4E7KA 2I1RA 3MF5A 4DSFA 1LW2B 1DTQA 4IKAA 4F4YA 2Z1IA 4BE0A 2AWZA 4Q8FA 4M94A 3KHGA 2WHOA 2BRKA 5KFXA 3M8QB 1L5UA 4QWAA 2B6AA 4DLGA 4FJ8A 4KREA 2IMWP 5DLFA 5KFPA 3RB3A 4NRUA 2ZE2A 1RTIB 5KTQA 3CJ5A 2QKKA 4RW9B 4ZP8A 1T05B 4KKOB 4K8ZA 4KO0B 3O4NA 3MECA 2C28A 2KTQA 4QOZB 1NK6A 3ZSQA 3DYAA 3SUOA 2CJQA 4KTWA 2XI3A 5F8IA 4AHCA 3DRRB 1CZ9A 4AHRA 4QWEA 3EY1A 3CDWA 4CGHA 1T94A 4YFUA 4FJ7A 4FLTA 2NUBA 2IBKA 4JS4A 2IJFA 4FJKA 3H59A 1ZBFA 4IR9A 4RNFA 2IM0A 4ED3A 2D3UA 2FBVA 3ZSYA 3CQ8A 1VSFA 4CEDA 1U48A 4IDKB 3HSTB 2V0NA 3MEDA 4NCGA 4CFDA 5KFDA 1RT5B 3G6YA 4KE5A 1RDAA 5KI6A 2C2RA 2FVCA 3ULDA 1JLBA 1HPZA 3PV8A 4RW6B 3L2RA 3DRSB 2QKBA 3KK2B 4ZPBA 1NKBA 1YTUA 1JLEA 3SFGA 5DGAA 1RTDA 4ZP6A 3SQ4A 1REVA 5FDLB 4FJJA 3OL6A 4KI6A 4JUZA 4H54A 1FKOB 4W5TA 2JEGA 3FQLA 3S9HA 3AVLA 3ISNC 4W5NA 1EP4A 1RBSA 1DTTB 1MU2B 4HCCA 4KHMA 4Y1CA 3SV3A 2W9BB 5KRTA 3O4QA 4CGDA 2IS3A 1VRUA 1G15A 3K2PA 4N56A 3DM2A 4WXOA 4KTQA 3SUQA 1HRHA 2IJNA 1S6QB 3GV5B 3KLIA 5CZ1A 3DLEB 3CYMA 1RT2B 1SKSA 2VA2A 4MK9A 3V9ZA 4Q43A 4EZ9A 1S0MA 1JX4A 4R5PB 4K4SA 4HYKA 2HW3A 3BDPA 1QE1A 4KSEB 1KTQA 3NL0A 3NH1A 1X9WA 4WFYA 5DG9A 1WSEA 5DQHA 1S1TB 2G8KA 5J2PB 4ECWA 3TAGA 3I0RA 4RNHA 4O3SA 3AVFA 4M3UA 4NLYA 1IKXB 4MKBA 3BREA 2CKWA 4RUAA 1Q9XA 2JEFA 3ITHA 1XR6A 5CYMB 3DI6A 4H4MB 2RDIA 4UQGA 1HJRA 4KHYA 1YT3A 4F4KA 1YTAA 3NF7A 3WNHA 5KFYA 4TYBA 2XY6A 3GV7B 3TAMA 5J2QB 4RW8A 1L3TA 2QE5A 2LSNA 2XHBA 1NKEA 4DG1B 2R8HA 4CJVA 3HVTB 1FK9B 2VG6A 4IOBA 4LQ9A 2UVWA 3MEEA 1A5XA 5KFEA 3VQSA 4YMEA 2UVUA 4CHOA 4EBEA 1S6PB 3QEVA 4NLUA 4K4UA 3TR8A 2XO7A 4Y34A 2ZD1B 5FRMA 5CYQB 1KSPA 1VSJA 3DMJB 4FJMA 3DOLB 3FFIA 4ZVGA 3LWLA 4JRQA 4O4GA 1U04A 4OLAA 4LSNB 3VQCA 2BGGA 4DU4A 1TK8A 2YNIB 3NGYA 4B9UA 3LP2B 3LDSA 3V6KA 2JEJA 1HQUB 5KG2A 4TY8A 2BDPA 1QHTA 4NRTA 2G8IA 2Y1JA 5KFOA 5FRNA 1Z25A 4FM2A 4HCBA 4Z4IA 4ZHRB 3KMSA 1BISA 3EYZA 2YHAA 2DPJA 1N5YB 4AHTA 3OL8A 5EWGA 1BCOA 3VQ4A 2OPPA 3C6UB 1XR5A 2E6LA 2VWKA 5KFRA 2FJWA 3S3NA 2QV6A 4KB0A 3IGNA 3K5OA 1KFDA 4M45A 3V81A 2XC9A 3RB0A 4NCAA 4FJLA 2RN2A 2DFHA 3SV4A 4LQ3A 4ZVEA 1R0AA 2UVRA 3KLHB 1JLCB 1TKZA 5KFWA 2D3ZA 3QGGA 4CJ4A 1HNIB 4NZ0A 4CEZA 3PO4A 4ICLB 4FM0A 3QIPB 3NBPB 1SH2A 2JLEA 4KV8A 3K59A 4H8KA 4RW7B 3VQQA 3OYEA 4DFPA 2W9CA 1RT4A 2W8KA 1RA6A 4CGFA 5KG7A 4O0IA 3LAMA 2OPRB 1JLGB 3T3FA 1S1UA 2WOMB 1EETB 4PQUB 1C1BB 5KG0A 5KFFA 3K5NA 4FBUA 3LAKA 5DQIA 1ZTWA 1QUVA 3S3MA 4KHQA 1QAIA 1XC9A 3RR7A 3NAHA 2HVIA 3HVRA 3MFIA 4I9LA 1YVUA 4URSA 3SJJA 1Q8IA 1ASWA 3HM9A 1T03A 1T3NA 5KT5A 2QK9A 1XWLA 3CFRA 3QNNA 1VSLA 2F8TA 4QWDA 1W25A 5KFSA 3JYTB 4CJQA 2J6SA 4F4ZA 1C2PA 4TQSA 3EZUA 3SPYA 2O4GA 4ZP7A 4E3SA 2EC0A 3H5SA 1U4BA 1S4FA 2RF2B 3BQ1A 1TGOA 5F8NA 3NAIA 3K58A 3OSPA 3SZ2A 3SI8A 3ZSVA 4DSLA 3TI0A 3LP1B 5I42A 4FJGA 4NYNA 4B3OB 1B92A 2FLNA 3VQ5A 5HBMB 5KG5A 3L8BA 3DRPA 2FVSA 4CJRA 2B5JA 1JLBB 4RNMA 3GIIA 3BQ2A 4E1MA 1S9GA 3RMCA 3T5JA 1HNVA 2R2RA 2J6TA 1RT3A 4YR2A 4ZPAA 3GIKA 3THVA 1LW0B 4DTMA 1SV5A 4W5OA 5L1JA 3NGIA 5CZ2A 4Y3CA 4EBDA 4EYHB 4B9NA 3QETA 3DLKA 3GYNA 4DS4A 4QAGA 1N4LA 3G0ZA 3PZPA 1CSJA 1D1UA 5HLFA 1J54A 5C25A 4J9MA 1J5OB 4FJ9A 3ZSRA 2E4LA 3OS2A 1TV6B 1DLOB 3BSNA 3BSAA 1RYRA 4J2BA 1HMVA 3H2LA 1RT7B 4ECQA 1HARA 4MIAA 4KFBA 4DL6A 2HMIA 4J9KA 4JV1A 2B43A 1KRPA 2FVPA 4M3XA 2BQRA 4CF0A 4E7JA 1IG9A 1TL1B 1OS5A 2V9WA 4DSIA 4Q0BB 4OKEA 3KLEA 4NLWA 4F4XA 3OSNA 5HRNA 1RDBA 1NK7A 4QPXA 5HP1B 3C94A 1QSSA 4MQ3A 3I5BA 3KKRA 3NF9A 3NGZA 1BGXT 3OHBA 3KK3A 1VSEA 1RT1A 2BE2A 1D8YA 4F2SA 2ILYA 4K4ZA 1JLFA 4J2DA 2RKIB 1JXBA 3DOKA 5T14A 4ED8A 3VQ9A 3TAMB 2EHGA 4LY7A 3HP6A 4FLZA 3AO3A 3I5AA 2IDOA 3AA3A 1LWFB 1TL3A 4IG3B 3NAEA 3OYDA 4IQXA 3E01A 3ZSZA 1ZBHA 1WAJA 2V4QA 3C95A 3KHLA 3OYIA 4QWCA 3IRXB 3H4BA 2ZQBA 3I8DA 1SH0A 4R8UB 1ZBLA 1UA0A 2AGPA 3AA4A 3H5YA 1NHVA 1IKVB 2FLLA 4KHRA 3L2QA 1RTHA 4IFVA 1L3UA 2YNFA 1HYSA 2HB5A 4GC7A 5KT3A 3T1AA 1JLQA 4OLBA 1ZTTA 2DFEA 5KFCA 4BWJA 3PJXA 4E89A 4CJLA 2HNZB 5K14B 3ZSXA 1KVCA 1L3SA 4FLUA 3OYNA 1BI4A 4CJWA 5J2NB 1CZBA 3TABA 4FZYA 5KFMA 3AO1A 2HNDB 4K4YA 3AO5A 2KQ2A 3KJVA 4FS2A 3PUFA 4JV2A 4DTUA 3U3GA 2FLPA 1N6QB 4ECZA 4RG8A 4KHUA 3NGDA 1K1SA 3BSOA 2HNYA 4AILC 1S1VB 2C2DA 3H98A 3HPGA 4XPEA 3PX6A 3AVHA 3BGRB 3C6TB 4KHWA 4O3RA 1TKZB 3QEIA 1RBVA 4O44A 1TK5A 1D5AA 4NLRA 1TAQA 3OL9A 5KFUA 3LP0A 4I7FB 4H4OA 4IRCA 4ED0A 4XPCA 3AO2A 3MAQA 4OKKA 2YNGA 4G3IA 1LWCA 4WXWA 4XIUA 2W9CB 4C8LA 1VRTA 3NF8A 1NK5A 4BE1A 4OVLA 4F8RA 3IS9B 1C0TB 4JV0A 4LSLA 3PW7A 2A1RA 3LPTA 1IO2A 3ASMA 2IC3B 2YV0X 3U6FA 2KZMA 5EWFA 1S1XB 4DWIA 5KFHA 4OKJA 3L3VA 5DQGA 4DTNA 3LALA 3V6JA 2KFNA 3V6HA 5J2MB 3RB4A 4FLYA 2XY8A 5KT4A 3M8PA 2P51A 2WCXA 1RA7A 2VG5A 5D3GA 1SKWA 4GMJB 3VQBA 1RDDA 1I39A 4YR3A 3GV8B 3ZT2A 3RRGA 4WE1A 3Q8PB 2HHUA 1C1AA 4M3YA 2WONA 4G1QA 3HJFA 1IKWB 4DTPA 3EPIA 3RAXA 1JIHA 4GC6A 1X1PA 3QNOA 1K1QA 2XGQA 4DLEA 4LH4A 5JS2A 2DFFA 5C42B 4ECUA 4CK2A 4F3TA 4Y2CA 3OY9A 4FYDA 4I2QA 4C8NA 3V6DB 4FK4A 5KFBA 3VQDA 5I42B 3NKYA 1RT6A 4ID5A 3FSIA 1L3VA 1D0EA 4KB7A 5J1EB 4NYZA 2OPSA 4K4VA 2D5RA 4DEZA 4X2BA 4O3QA 1ZYQA 1NNDA 1S9GB 4CEBA 2FVRA 3T5LA 3T19A 1WSIA 3IG1A 1KLMB 3Q8RB 1RTJA 2XCAA 2OH2A 1UWBB 4TQRA 3PHEA 1LAWA 4CFAA 2XCPA 3ZCMA 3NHGA 1FKPA 1ITGA 1WNSA 3DLGB 3GQCA 1BQMB 3L2VA 4Q45A 1Q9YA 5KFIA 4XO0A 2GIQA 1W0HA 2GIRA 3S3OA 2D7SA 5HLFB 3QLHB 2ILZA 4DU1A 3V4IA 5E41A 4N47A 3CDEA 3UR0A 4PWDB 4AH9A 2G8HA 3AVAA 3V9SA 4O3OA 1JXEA 4CHNA 5I3UB 3OJSA 5KG4A 5SZTA 4KRFA 2HMIB 4MFBB 4DTOA 3CG7A 3MR5A 2BQUA 4ECTA 2UUWA 1IKYA 5KG3A 2E9ZA 1C0MA 2YKMB 4NLVA 4KHSA 2WB4A 1U49A 1C1CA 3TQ1A 1BQNA 3CM5A 1HQEA 1QAJA 3H4DA 5JUMA 3O3FA 4DL7A 3K5MA 3KK1A 3QEWA 3QGIA 5KFNA 3QINA 1RT1B 2W7PA 3RBEA 3VQAA 3OL7A 3KLGB 4MK8A 1JLFB 1U09A 2HVHA 5L1LA 2R8IA 1ASUA 1EKEA 4FLWA 2G8VA 1KHVA 3QYYA 2BANA 4Y1DA 3UIQA 1JKHB 4E1NA 4LD0A 2YNHB 3V1QA 1XHZA 3CM6A 4IG0B 4J9RA 2OPQB 3AV9A 2IAJA 1XR7A 3NH2A 2R2UA 1TKXA 1I6JA 3WNFA 4I2PA 1LWEB 4FJHA 1S9FA 2VG7A 4PUOB 3SUNA 4IFYA 3VQEA 4E19A 3MEGB 4EP4A 3Q8SB 5HRPA 4HHTA 3PR5B 2YKNA 4RW4A 4R0EA 1S49A 4FZXC 5EDWA 1VSHA 3QEPA 4FVMA 4ECXA 3TANA 1Z26A 2I5JA 3ZT3A 5C24B 4W5QA 1SUQB
chains in the Genus database with same CATH superfamily
4DSJA 5ETRA 4NLCA 3QO9B 1LW2A 1TVRA 1YSJA 2XMAA 3MM9A 1T11A 2CVEA 4CJTA 3EGZA 3KLFB 4DTXA 2OI2A 1O1WA 3L4IA 1WEZA 1CXUA 3KOAA 1A5VA 4RW9A 3TEGA 3ENAA 1DTQB 1MA9B 4CE9A 4YDDB 4X62J 1LQ9A 2QZ8A 2CZ4A 3L9ZA 4CECA 4H0TB 3CCEN 3NE6A 2XI2A 3HI9A 2FHMA 2OP5A 1VK0A 2R7QA 3MDQA 4I6MA 4A47A 2B6AB 3DRRA 2E2OA 1VQ9N 1P8ZA 5HRSA 2X78A 3J7AP 1H98A 4H03B 5GAHI 4K4WA 1DARA 1SL1A 3QZ7A 4DQPA 3NP5A 3MECB 1EO1A 1HWLA 3DYAB 5HMXA 5AQRA 1FDAA 3NVMA 4OZNA 2MHEA 4B8AB 1PYOB 4F3OA 2JEIA 3LDPA 5CD4H 4MDBA 2V69A 2XGPA 2E66A 3RUBL 1DGKN 4HKQA 1NGGA 4LF4K 3R1LA 2MQMA 3DRSA 1RWOB 1HI8A 2FC9A 4GVBA 2R8KA 3WXIA 4L8RB 1XC3A 5D8HB 2L3MA 1FFWB 3KWGA 1Y3JA 3MM8A 3B54A 1DZ5A 3P39A 1KHWA 2FLOA 1IN0A 1MU2A 2XMUA 3BGLA 1BDGA 3PIPQ 2W9BA 2I6WA 5M2UA 4TU9A 3DLRA 2OTJN 3PIPL 1REVB 2VICA 4DF8A 4B9LA 5HVFA 5HQ8A 2O1PA 4BG9A 3SCXA 3W2VA 2QSFA 4GMKA 3CJ8A 5IT9Y 1V6HA 9ATCB 2IYGA 2FBXA 1KBRA 3I9V9 1DQ9A 1Z4UA 5DLGA 4JRPA 4L6V3 1FXDA 2W42A 3KLIB 1S1TA 1NGAA 4CZJA 2Y1IA 2ASMA 1GLFO 2ZBQA 2F7TA 3RRKA 2BQ3A 3G86A 3TARA 2Z0GA 3MAAB 2HBLA 2MKYA 2CPJA 3US5A 1IKXA 3EXCX 4PXDA 1YJNN 1NWKA 3AAPA 3WIUA 3KLVA 1BL3A 3CD6S 4FJ5A 2P9PA 1YKWA 1KS2A 4C8YA 2KYZA 4DV4J 1MWQA 4LF8J 3RAMA 1WKJA 1T7PA 3ITHB 1N5SA 3VVTA 1Q8LA 3AO4A 2J9CA 1S6PA 5JXSA 3AY9A 4TLRA 1U0HB 4PY5A 3A5LC 3DMJA 3F9MA 4DU8A 2VG6B 3TX8A 3JXUA 1JL2A 3MEEB 4CERA 1J27A 1PJ6A 1UZHA 1WACA 1LNQA 3M8YA 4FYWB 1T9UA 3BQ0A 1KFSA 4LFAK 2DH9A 4QR0A 3OXFA 3VEZA 4K0KF 4IH6A 5BRHA 3FFIB 2IVYA 4K59A 3UO0A 4O4GB 5HO4A 4ZHRA 1HD1A 3EXYA 3GDQA 2P9NA 2JX2A 2WVDA 2YJFA 2ZJRQ 4CF8A 2ATQA 4BDZA 1CJTA 2XMWA 2ZJRL 4OX9J 1TKTA 2O5DA 4FLVA 4BE2A 1OY6A 3D6HB 2BJEA 3K89A 4G65A 4JI5K 5BPLA 5KAKA 3HHLD 4I2PB 3M8RA 2ZBRA 3TTCA 1OKJA 2Z1GA 3I82A 4ICLA 3MZIA 1MROB 3AH6A 3QIPA 3V1OA 3L6QA 2V8VA 4DFJA 1Q5VA 2HWHA 5LMUJ 4PXEA 3I0SA 1YJUA 3N6MA 1DKGD 2NUUG 1RCXB 2Q2RA 2YHXA 4BRIA 4KHPK 4Q8EA 1KAYA 4L76A 1G7CB 4B08A 3AA2A 3CPEA 4NWBA 3H2UB 4KV8B 5C5JA 2CDRB 4RNOA 1LAVA 2NLXA 1YITS 4JKFA 3HPOA 3WC2A 4DV6K 2R7RA 3IWNC 1RT4B 1TL4A 4PWWA 1H38A 2GVZB 1KQKA 2GQQA 2VQFK 2OTLS 2PGCA 2HZCA 1K0TA 3RWUA 2HHWA 1RSCA 1U7LA 3NWGA 3L3CA 3O6WA 2VU5A 2HAIA 1YIJS 4YB7A 3C66A 3TVKA 1HW9A 3KJFB 4QR1A 4GVMA 1PYSB 3PW2A 4BBYA 3GSIA 1C6VA 3VF6A 2V2VA 3M1VA 3M05A 3R5BA 1CLFA 1X5SA 3LP1A 3WEEB 1EX4A 3OYHA 3P83D 3KK7A 3T1HJ 5HBMA 3ZZZA 3AOAA 1QUPA 4HHHA 1IBKF 1N32J 4CF1A 4CCHA 2HLTA 4USMA 4X4QA 3TJ9A 4JKCA 1RBRA 3GG4A 3J81O 2HBMA 3WZ0A 4P9SA 1I94K 2EWHA 2FY1A 3ZYYX 2GCFA 1IXKA 1GXTA 3CO9A 4A62A 2D0AA 4MIBA 4ZDNA 1FFSB 3PACA 3SQ2A 1NSPA 1Y7PA 3CVKA 3W7BA 3TWZA 4F67A 4PKDB 1F3FA 4JI8J 4JV5K 1YZ6A 3K0JA 1DLOA 1ZM9A 1X0PA 2BE9B 2FJXA 3VETA 3DLKB 4RR5A 3FZKA 5KPTA 1RWKB 1B70B 1TL1A 1YBAA 4JI4J 5CY4A 3SI6A 4JHDB 4Q0BA 2KT3A 3B6OA 1FO1A 4BGAA 5DM7Q 4B1YB 3ET6B 4FM1A 3RBZA 3TSQA 1ZPVA 2NPIA 1TK0A 5DM7L 5C2CA 2HFVA 3AFGA 3PW4A 2BA9A 2A2DA 1VSIA 1K9MO 1NXIA 4NEYA 1BMQB 3GJQB 3KLEB 2XZDB 3VEVA 4CK3A 2QXLA 2YWGA 4F7VA 1Q1KA 3QIDA 5IWAF 2WUSA 3M2RB 5IT0A 4U6PA 3CJ0A 2QWLA 1C0UB 3P1GA 3M9NB 1LWFA 3KDNA 2AJQA 3KK3B 3R9PA 4I67A 5AXMA 3LP3A 3N9UC 1NBEB 4ECYA 4ERDA 3UKRA 5F2RA 4V1Ak 3AD7C 1TL3B 1IKVA 3Q22A 4EYIB 4IH7A 1UOCA 2I7NA 4TN2A 5IQ6A 3E01B 1M1KT 3EGWB 2LEPA 4A2BA 5ETMA 2AJ2A 3C14A 5K14A 1VSMA 4ZPCA 3BEGB 3I4HX 1S9EB 4FZZA 2EFGA 4H5TA 4WFXA 4AHUA 2HNDA 4WZQA 5CCLA 3HHKA 2F5GA 4Y00A 1NBWA 4CJ5A 4KH4A 4RU2A 2PE8A 5HROB 3ZT4A 3O3HA 2PZSA 2R4FA 1S6OA 3QERA 3HT0A 1A5WA 3CXCR 4M5MA 2HRUA 3MCSA 4MAKA 1BIZA 4Z4GA 3KJVB 4LF9K 3ID8A 1QD1A 3BGRA 1T9TA 4B1UB 4LR7A 5HRRA 2C22A 1BO5O 5F8LA 2F65A 2D0BA 3UNGC 2O66A 1SZ2A 4UOCA 4BRKA 1NDPA 4UZBA 2WVCA 3TA1A 1NOZA 2GTDA 2F4VK 2HNYB 4JKBA 4JP8A 3P8BB 4FJXA 2KJWA 1WWHA 4WK1A 3WNGA 2C3PA 2CG4A 3G6VA 5EGYA 3UQSA 2KDOA 3CTRA 1FFGB 3KUHA 3SQGA 2MKKA 1CLQA 3UDLA 3MR6A 1D4XA 2IC3A 1CULB 3CCQS 1VQ5N 3DNCA 4Y0FA 5AQOA 4CLKA 1Q7LB 2YHBA 3VGLA 4WQ5C 5BN9A 3BF3A 2MQQA 5CCMA 3NOGA 5LSRA 4EFAC 3F2KA 3Q8QB 4NASA 1XBWA 2JSXA 5KFAA 1REGX 5D0HA 2QFIA 1NNEA 3THXB 3Q7BA 2XG8A 3OYJA 3DDNA 3M8PB 2UP1A 1Z6RA 3PXGa 2P9EA 2ALYB 2VG5B 5D3GB 3L2WA 1LWXA 2X6NA 3HHEA 4KH1B 3SCJE 4X4SA 4HEA9 3V6DA 1D09B 1RWMB 1UW9A 3KNAA 2WONB 3K2YA 1D9AA 4ECSA 4DV7K 2YQ0A 5T7LA 3ISND 1ILYA 4OHVA 2E5HA 1LFPA 1UTAA 2P9UA 4CHPA 1TFYA 3HSCA 4ELUA 1VQPS 2IDLA 3E9OA 4O8UA 3DLGA 1CJUA 3EGVA 3HO1A 1MWMA 1JL1A 4WZMA 5JS1A 3IG1B 1YRXA 4DR1K 2RDJA 1RTJB 1H2TZ 2JC1A 1X3MA 4YHHF 1FKPB 4DUZK 3J80Y 1GXLA 3RR8A 1RDCA 3MPVA 3MR3A 3EVMA 3T5HA 1B0VA 1R3NA 4DL3A 4BWMA 4BRAA 1IR2A 4PPDA 5AJ3F 2P5OA 1X9SA 4AL5A 2XRIA 3EKSA 3AVJA 4FP9A 4CO2A 4BGBA 2EEYA 4FXDA 1U1NA 3HT3A 2FJDB 1T02A 1RNHA 2UV8G 1X8DA 2OGUA 1KVBA 2P2CB 4DTRA 4DFMA 2KFZA 2VBZA 5HVGA 2E9TA 2RU3A 2BYCA 2GV1A 2ZZTA 1KLNA 3C46A 1U1LA 4JI7K 4FOEA 4ZLPA 1N0UA 1S22A 3MXIA 4Q5VA 3OFFA 1JKHA 4FKYA 2E7VA 4H0OA 2YNHA 1JJ4A 2GHPA 5L1IA 2LU1A 4CLLA 4Z0UA 4IG0A 1QVFM 1Q95G 2FJAB 4CO5A 3CJAA 3SMZA 2E44A 1HBOA 2B9XA 3AJDA 4DR7J 4CRJA 4EGLA 1LWEA 2V5HG 3W63A 2DY4A 3FGUA 3Q23A 4CHYA 3VENA 3CEDA 1YQHA 1TQLA 4ED2A 4B9SA 3DLBA 3B6PA 2IAJB 4Z4FA 2GS8A 2K1RB 2V4RA 2C42A 2DR9A 3KLHA 5F9NA 3QO9A 4X64J 2RS8A 1PSDA 2N7CA 2M8HA 3O8MA 2Q6CA 3M6VA 4RW4B 3KLFA 2QXFA 3I55N 1KCFA 3PJ9A 3LO3A 1VSKA 3VEWA 4B9MA 2NZTA 3GJRB 1R8CA 4MYTA 2RAQA 4PL7A 4CTAB 4LC9B 1DTQA 4LF4F 2Z1IA 1RHUB 5AQFA 1F1BB 2VPXB 3K7RA 2BZ2A 4W4MA 4DOZA 1UVJA 3QQCD 2NREA 2WHOA 1HNXK 1L5UA 3M8QB 3D0HE 4QWAA 2B6AA 4FJ8A 1KQSM 1KTVA 5DLFA 2GFFA 4TKTA 2QKKA 1T05B 3O4NA 3MECA 2WVBA 1WOPA 3UVJB 4FKXA 3DYAA 2OMLA 2AMCB 4KTWA 4AHCA 3HOSA 4QWEA 4H5RA 2LXIA 4YFUA 3TUIC 4K2XA 1B7YB 1PO6A 1JNRB 1RXOB 3DXMB 4L73A 1NB2A 1LK5A 1NLVA 3H59A 1DFDA 4BC2A 3W65A 3B82A 2OD6A 3OTOJ 2L9WA 2CPYA 2BW7A 3CQ8A 2C3UA 5EOYA 3EJMA 3GL1A 1C0GA 1RDAA 3CCRS 1RWXB 3MMAB 3DLLQ 1PCAA 4YOTA 5EY4A 4K42A 3DLLL 1GNKA 2G1HA 2M5YA 2K7KA 3KK2B 5LXYA 3NMRA 3SFGA 1M5PC 1REVA 3OL6A 4KI6A 5CABA 1FKOB 2JEGA 3FQLA 4CZHA 4IOXA 2FHJA 3S9HA 2H4WB 2ZWHA 1RBSA 1YI2S 2EBGA 5AE1A 3TYTA 3G2XA 2Q1NA 3CDBA 3GYXB 4PR6A 2OD4A 3ID6A 2OMOA 1S6QB 1VBXA 3KLIA 4DUYK 4OYBA 2J9DE 2EKNA 2UUCJ 1SKSA 1S79A 1DAXA 4Q43A 3CCTA 2M8DB 5GAHP 1U26A 4P7VA 1JCEA 1HNZK 5M1NA 3MAAA 3VGUA 2WBMA 4AXJA 1FE0A 1IJJA 4B9QA 1DT9A 1VQ7S 4HYKA 2OHDA 3WXKA 1OIAA 3NL0A 5DG9A 1XIQA 5J2PB 4YY3J 1A9NB 2MJUA 5AJ3J 2NXCA 3G6EN 3E3XA 1FXRA 2IRYA 4LFAF 4R79A 3ITHA 3VZIA 3G8SA 1U1MA 1UWAA 4UQGA 1YT3A 1HA1A 3GV7B 3TAMA 5J2QB 5H9EK 4QPTA 2LSNA 2E1YA 3SMPA 1U0HA 4ILMA 1NKEA 2K8GA 1K8AT 2VG6A 4LQ9A 4DDFA 3MEEA 3EVOA 2LQ9A 2DGTA 4ES1A 4JI5F 1YDLA 3SXLA 2UVUA 4CHOA 4NZ7A 2QN6B 1N0VC 3TR8A 5FRMA 4Z7YA 2HG4A 1Q18A 3FFIA 4QU7A 1J5EF 1VQ8S 4JRQA 4O4GA 5AR0A 4ZVRB 5K5MA 3NGYA 3LDSA 3HD2A 4LF6J 1C0FA 1HQUB 2QLBB 2IVMA 4NRTA 2Y1JA 2B51A 4KHPF 2OAUA 3C6HA 7FD1A 3K8WA 3GYGA 5FRNA 1HBNB 3SEOA 3KMSA 3HHLB 2YHAA 4NA2A 3HSDA 4DV6F 1R6YA 2QWOA 2A40A 3VQ4A 3NCRA 3JSRA 2E6LA 3V2UC 5KFRA 4WWSA 1MROA 2LFVA 2VQFF 2V50A 3K5OA 2F1FA 4M45A 1QVGM 3RB0A 4FJLA 2RN2A 3KG1A 3KYLA 2M2BA 4S0MA 5C2FA 1JLCB 2V94A 1JXVA 2D3ZA 2Q79A 3QGGA 1XJWB 1UVMA 3ONQA 1O6XA 3OA9A 2ZH3A 4KV8A 3HHNB 3NGSA 3K59A 1NRKA 3M6WA 2RRNA 1YXQA 4C4WA 3ZX0A 1S72S 2O01C 1RFQA 1RT4A 2W8KA 3LAMA 1UW4A 2NRTA 2GVZA 1JLGB 4OQJA 3FZLA 4FBUA 2DHSA 3LAKA 4K43A 1VQOS 2GQ2A 3QGPA 4JKGB 2HVIA 4DR3K 1LXNA 1I94F 3SJJA 2MKJA 1ASWA 2P9IB 1GTHA 3CFRA 5SUHA 3A8IA 2XMMA 5D4OA 1CZAN 3WEEA 4HTJA 1C2PA 4JV5F 5BJRA 3EZUA 3GONA 2ZH7A 1YBTA 4E1JA 1TGOA 3NAIA 1H3DA 4CDIA 5HQLA 1WUAA 2DNPA 2FLNA 1BWEA 3VQ5A 4P2FA 1FT8A 1EQMA 2FVSA 3ZETB 1WF2A 2QTDA 2ITMA 3LM9A 2R3VA 1FXLA 1S9GA 4DR2F 5B0FA 3T5JA 4HT7A 2YX4A 3THVA 1LW0B 2ASOA 2ZH5A 4V19J 4OYZA 5AQNA 4W5OA 1EKSA 4TVAB 4B9NA 3DLKA 1CS4B 1N4LA 2AV5A 4L3QA 3J7YP 1TMJA 3ILOA 2LCWA 1J54A 4J9MA 2XHWA 3ZSRA 4JHDA 4RLEA 2DYAA 2LU2A 5B0BA 4BR2A 3M32A 1RYRA 4AQYK 2IVFB 2CNLB 3ET6A 2Q36A 4MIAA 1MWKA 2Q1LA 1RAIB 4JV1A 1KRPA 3CCZA 1IG9A 4FPAA 4XDCA 4BRLA 3AODA 5D0EA 4QYRA 3SCIE 1HWJA 3H25A 4DSIA 2B8PA 1RHQB 3KLEA 4F4XA 5AQTA 3OSNA 1ZBSA 2D1KA 4JI6K 4QPXA 1HI0P 4PG5A 2D3OR 1QQNA 1IG8A 2CGLA 4MQ3A 3NF9A 3BBFA 2L48A 3NGZA 3K9KA 2H65B 3KK3A 2XYPB 4Z37A 2FSJA 2VPWB 3R8YA 2ILYA 1WOOA 2RKIB 1GLAG 5E3AA 4F0KA 3VAFA 4BRDA 5T14A 5FLXU 2EHGA 3HP6A 1J5EJ 1TL3A 3RJMB 3NAEA 3CD6N 2ROGA 3VGKA 4IQXA 3E01A 4ED5A 3D1OA 4LF9F 1MSWD 3PYFA 1Q4RA 3KHLA 4WK3A 1AUSL 1UFLA 2YWFA 3ZZTA 3I96A 3H4BA 4NA1A 2ZQBA 4R8UB 1ZBLA 1UA0A 3DWLA 3R7NB 3FR0A 1R0CB 4LR9A 4F4AA 1F5BA 2ABYA 2HB5A 3PG9A 5KT3A 3A13A 3EE3A 4KH6A 3T1AA 1Y5LB 4BWJA 4E89A 3GTYX 1GAOA 1NSKL 2JH3A 1BI4A 4CJWA 1AT1B 4PRFA 1VDHA 3AO5A 3KJVA 4FS2A 1KVIA 3LDOA 4X84A 3C7NB 3RGIA 2FLPA 4A8KA 4E8UA 4ILHA 3GFZA 4X4OA 3G96A 3QWUA 3OBYA 5KQDA 5CQGA 3NGDA 4LFCJ 5E26A 2HNYA 4AILC 2W41A 2F9DA 4ZVPB 4XPEA 3PX6A 3EE8A 4DV5K 1FVQA 4PAAA 4OI3A 3UDCA 3SAGA 2XB2D 3QEIA 4DJBA 2HGNA 3C16B 2NRVA 1TAQA 5KFUA 3FCVA 4M5LA 4ED0A 4XPCA 1CULA 1ATNA 2Q3PA 2MSSA 2XLKA 4WXWA 2W9CB 4C8LA 3NF8A 4DV7F 2DRDA 1NGHA 4F8RA 3IS9B 1C0TB 2MKHA 4JV0A 3LPTA 3M6GA 4BRPA 1Q5YA 1K73O 3U6FA 2YV0X 1CG2A 4ILGB 3LW5C 3THXA 3L3VA 4A8FA 4DTNA 1B64A 3D7SB 5J2MB 3M8PA 2VG5A 5D3GA 1SKWA 3VQBA 3HM8A 4H5NA 3GV8B 3RRGA 4YDXA 3Q8PB 3W66A 3IAS9 3P49B 3M6UA 4RUHA 2WONA 2HSEB 3HJFA 4JEPA 4DTPA 4DR1F 1N33J 3THWB 2VFVA 1K73T 2NS1B 4GC6A 1WC1A 4DUZF 3RW6A 5FPNA 4DR2J 2VQEJ 5C42B 2ZJPQ 4CK2A 4F3TA 4Y2CA 3OY9A 3J81Y 4C8NA 1VQLN 2ZJPL 4BRGA 5LY3A 4FK4A 5KFBA 3D6MB 3MOZA 1LEOA 3VQDA 5I42B 1GMWD 4ID5A 3UCGA 4KB7A 4JKDA 3QAUA 4LIWA 1RCOB 2UXDK 3SSRA 4J90A 4IOCQ 5LT5A 4AYBD 4YN3B 2D9OA 4JBCA 3WIVA 1R0BG 1T6CA 2PI4A 4IOCL 3IG1A 3U1NA 1KLMB 1Z05A 1RTJA 3FNNA 3PHEA 1LAWA 4CFAA 2XCPA 1FKPA 1ITGA 2V2KA 1BA1A 1UCNA 3BO4A 2CQBA 1HBUA 4FWRA 3EZOA 5AQWA 4Q45A 2CQIA 5KFIA 3I87A 4XO0A 1WSVA 1W0HA 4LF7F 2GIRA 2YTCA 2LDIA 5IV4A 4GKJJ 2DNLA 3FZFA 1ZA1B 4O3OA 5I3UB 5SZTA 4X66J 4DTOA 5B08A 4GVEA 4IJNA 2YKAA 2ZBPA 1Q53A 1HPMA 2YKMB 1WTBA 4NLVA 4FZVA 5DO2A 3JAMU 4LBIA 4KHSA 2WB4A 2CQDA 2JJ4D 5U47A 1YF5L 2ZOMA 1U49A 2IIHA 2MZRA 1QAJA 3H4DA 1G1XA 3O3FA 2RUGA 2CNNB 2GZOA 2N3OA 2CPFA 3K5MA 2M70A 2YCHA 3KUEA 3QINA 3VQAA 2K3IA 1WHXA 2XWXA 5D78A 4BR0A 4C23A 2R8IA 1ASUA 4A5BA 4BQZA 4MLHA 4OYMA 2VL1A 1O0PA 2G8VA 2MQ8A 4Y1DA 3R97A 2NRHA 8RUCA 2XLIA 4M7XA 3F44A 2HAFA 5E84A 2OPQB 2IAJA 2CNOB 2QM1A 2FDNA 1SPBP 1HNXF 1XR7A 4ZS6A 5THWA 2K1RA 1HJOA 3NH2A 3EUNA 4JNEA 1BHNA 1TKXA 1I6JA 4TLQA 1VHFA 2KHOA 1S9FA 2CWXA 4PUOB 3UNYA 3Q8SB 1ATRA 3GPAA 4RW4A 1RTZA 1HBMB 4R0EA 2CNKB 2AEJA 3SLCA 4PG7A 3QEPA 4FVMA 5C24B 2AZ3A 1BWFO 3A3NB 5AFUH 1SUQB 2DISA 4ID1A 2NRWA 2L9DA 4CTAA 1XNRK 1FVSA 2VFUA 1KDNA 3CULA 2FF3B 2HHXA 1TTHB 1JNZB 3M8QA 3JSMA 5AQYA 4HL9A 3OYBA 4Z4EA 3U3YA 3TW0A 4M1KA 2A1SA 4R25A 4KAZA 2KI2A 3I33A 3DDIA 1S1WA 3O5BA 4NX9A 1S7HA 5L39A 1GLCG 4N8NA 1RJJA 5CA5A 3FUYA 4BDPA 4DR5K 4N41A 2UUTA 1EZZB 1FEHA 3LDNA 2ASLA 2XULA 1YJ7A 1Q86O 3DXMA 1QZ6A 4DV3K 2VB6A 3DDKA 3MM5B 4FS1A 5JLFA 2PA8D 1IR1A 1JJCB 2NCKL 4C8MA 5A76A 1PIEA 5I9EB 3MUVP 3F56A 4OI1A 4ED1A 2R8JA 2J6UA 3EPGA 2WK4A 1K6YA 4DUYF 3MMAA 2ITGA 4N77A 4CP5A 2CAJA 1GT8A 3LGHA 2WSCC 1Q86T 3KK2A 1HNZF 4MTPA 2PYLA 1ULRA 3MFHA 3Q0AA 2YH1A 2Y1LB 1WDTA 3BR9A 3K8VA 2RQKA 3R1HA 1SJ4P 4KHNA 2B4PA 4CIFA 3CCQN 1R89A 1NZ8A 1FKOA 2PT0A 3ZTPA 1VIXA 5JVHQ 5FIIA 3RRHA 2AGOA 3VAJA 3GG1A 5JVHL 2J9EA 4X62K 3IO1A 3MWPA 1R7IA 5KRSA 1JLEB 1RTDB 3HVWA 5KFZA 4FWLA 2WB1D 1KOHA 2O8FB 2XHCA 1AA1B 1XI1A 2KO1A 4NLTA 4HLBA 3CETA 1EP4B 2JVOA 1SKRA 2RUSA 3MX2A 3QFPA 2QMUB 3W8GA 3ICLA 1KVAA 4PPZA 5IT9O 2W7AA 1VQKS 3BSCA 2DD8S 2F3JA 3DM2B 1VC6A 4E7IA 3VQ8A 4KH5A 5A8KB 2B9YA 4Y2IA 5J2PA 5ETQA 5LJ5Y 2HS0A 4LF7J 2V2ZA 4W98A 3J8AA 4EZ6A 1UJ5A 2E5LJ 4CHZA 2PMHA 1YK9A 3ZSWA 3BEXA 1RYSA 5CZXA 1NLKL 2C2MB 2UVVA 3HVAA 3SCKE 3BDEA 4KYZA 1NCLA 4QZVB 1V4TA 1QDUB 1F2HA 3RMBA 1W97L 4AM6A 3D1HA 1OVQA 3IFEA 4C2MA 4A8MP 3MN9A 3DI6B 2P6SA 1LK7A 2HGLA 4K4XA 3ADAC 4FL9A 4W5RA 1PJ5A 2PYJA 4XH1A 3EKUA 2Z2MA 3ZZPA 2HBYB 2ZGYA 3UDEA 3FCWA 1OH5A 4OJHA 1XMOJ 4CEQA 3LANA 1LFWA 3O5TB 1HQUA 2AP1A 1EHWA 4ETZA 4BRFA 4GV6A 3MM7A 3AGRA 2DKOB 4X4TA 4CJFA 3DXBA 4CLZA 3KG4A 2DEJA 2NSCA 4QIEA 1UFKA 2QG9B 1VJWA 3CC7S 4J2EA 4BRMA 4UF4A 1EQYA 4CZMA 1HBNA 3HP9A 3QT6A 2EG1A 2CDQA 3HHLA 5B7WA 2GX8A 3LGMA 3A8JA 4NI2B 4DV4K 4Y2MA 4U67Q 4LF8K 3I32A 4U67L 1P8GA 3W9JA 3TAEA 3D9BA 3IMXA 2AGQA 3I9ZA 4JK9A 1I3AA 1JLCA 4DR3F 4ZITA 3OQ2A 3ZXWA 2IM1A 4IFYB 4GO5X 4DQRA 2XNQA 4DQIA 2R7VA 4L74A 4ZTFA 2IM2A 4OV1A 4PQAA 3JTOA 2HRYA 3W60A 3MXHP 3CMES 2I38A 4OJ1A 2QL5B 4M41A 3JTNA 4OO1J 3B4DA 1TVRB 1SC6A 3QESA 2JLFA 3FZMA 3OS1A 1GX5A 1JLGA 5EX3A 1QQOA 4E7LA 3H5XA 3M5RA 4TYAA 2DNQA 1LOTB 3PTWA 2C3OA 4IKFA 3OUYB 4RNNA 3MDFA 1S99A 4F0HA 4JKGA 4CBXA 4ZA1A 2ZHBA 4C8OA 1MW7A 2ZUGA 5CZVA 2P9IA 4OX9K 4NXMJ 4CD3A 4ZPVR 3RTVA 3KKSA 2AA4A 4ZVQB 5F8GA 5AXNA 2KB2A 1CJVA 4CJEA 1GK8A 2DR6A 4GKKJ 4B8CA 3H20A 2H3EB 2X7IA 4JI2F 3T41A 4B3SJ 1NGBA 4FPBA 4ED7A 2P5GA 3A2FA 4FWSA 3U9DA 1P9YA 1FJ7A 3H5UA 4KGXB 3THTA 2RS2A 4BC4A 1SJQA 3ENQA 4K2JA 1NGJA 3ZETA 4AQYF 4FBTA 3CCWA 5DGBA 4CJPA 2DXFA 1FA0A 3CD7A 1IBLJ 5JJBA 1IJEB 1CQMA 2E1ZA 2MQNA 1TL5A 4YR0A 1T8EA 3QRRA 2D41A 4ZLNA 3R6GB 1LW0A 1SS6A 2BX6A 3TOQA 3MEKA 2BOPA 3PM9A 3E1YA 3CERA 2GNKA 2B5JB 5KFVA 1B3TA 3VHQA 2NZ4A 3ALYA 4DPXA 4YQWA 5D0RA 3D66A 5HJYA 4JI6F 1CS4A 2MYFA 1YJRA 3GIRA 3VGTA 1UL3A 5KFLA 2NNWA 3CCRN 3TNVA 1HQ2A 3HFVA 1I51B 4LF2A 4B9VA 3CWJA 1JCGA 2W4PA 4FNHA 2QFJA 4FYXB 3GIJA 1I1GA 1SV5B 4CO3A 2L9NA 3LPEA 4ZMMA 3PIOQ 2FHJD 4XAKA 2UUBJ 5GIPA 3PIOL 1NM2A 3HZ6A 1Q82T 3BGOP 5C25B 2PD1A 4IR1A 1HIYA 2EVZA 2HVEA 4F36A 1SJFA 1YI2N 1GX6A 2R2SA 4DV1J 3T1HK 4Q44A 4QIVA 2DO0A 4WKRA 1NDKA 1H2UX 2ADCA 1HMVB 1NJXA 4ELVA 4PA1A 5IS2A 4KFBB 2UV8A 4WTOB 4NPOA 3W3DA 1N32K 2KH9A 3MTJA 4CGJA 5LOQA 4IEEA 1SQFA 1CPZA 1EKRA 3PYDA 4EU0A 2WFBA 3RMAA 1M90O 4PG6A 3ILJA 2RKIA 1NMEB 3VGMA 5KFJA 2HHHJ 3FEXB 3TAQA 1WKKA 1X5TA 1VQ7N 1VBYA 2ZJQQ 1BHLA 5BR9A 5IC6B 4CIGA 4CD1A 2AF6A 1FJCA 3PO5A 2ZJQL 4DPWA 4F26A 2MLZA 3AD8C 2DGSA 5A2QU 4M42A 4JI8K 4V19S 4IEIA 3CJ4A 3D28A 4R0JA 2Y3YA 4R8UA 3D6RA 1BOTO 2J0QD 3G10A 1MWYA 4YOEA 2BVZA 1RK8A 3KTQA 2K06A 2YH0A 2QO3A 4JI4K 4PYDA 3AVNA 2QYCA 3IRWP 4ZCKA 5B0CA 1FD8A 1URNA 2RQCA 4NMLA 1ASVA 3QICA 2KLAA 2GHVC 1Z2ZA 1OSCA 3A8KA 4KIAA 3CF5Q 3TAPA 4ZPDA 2L08A 1VBZA 4ZJQA 1RBTA 2QA4G 3CF5L 1JLAA 4IFVB 2AU0A 3W9IA 2YNFB 1HYSB 2P9NB 3CNQP 3FGVA 3PW0A 3C7NA 4LJMA 1KP6A 3GB0A 1CJTB 1VQ8N 1GH8A 2JC0A 4JN4A 3LF0A 2FBTA 5DK5A 3OYCA 2Z1JA 1TKTB 5H9FJ 1RBUA 3LM2A 3TTDA 2IJRA 1KEKA 1NKCA 2DRAA 1Q0NA 4WBFA 1U25A 5HK4A 1KD1T 3W1YC 1EJ7L 1VGYA 4LVOP 1VS3A 1BCMA 2FHOB 1NMNA 4FLXA 4EO6A 4NLXA 3DRYA 1WD6A 3C16A 1X60A 4P75A 1IM4A 4EP5A 1ATSA 2YXLA 3OT9A 3C19A 4BC7A 3LPUA 2G2ZA 1WHWA 4Y2AA 2DHAA 5E3RA 3UWTA 4FW1A 4HUGA 3LH2S 3I0SB 2FBYA 2HFSA 1HWIA 3IS9A 1C0TA 3RB6A 3MWBA 1B9FA 3LZIA 3LP0B 1N48A 1CC7A 2Y8YA 4CFBA 2B4JA 1NH8A 2W7OA 2YNGB 4DSEA 4JI2J 2QWMA 2QT7A 2ZVIA 5J2MA 4GW6A 1C4CA 1RE1B 3KNGA 4M3TA 3G82B 1VRTB 5DZ7A 4DV2J 2K3KA 4D3GA 2UXDF 3QJJA 2M52A 4DQ8A 4C3MA 4LSLB 1S72N 1OYDA 2R7WA 1VQ4S 2JGUA 4CJKA 4NL5A 2FC0A 2DXEA 1Y11A 2MY7A 4H4KA 4IOAQ 1RCHA 5KGWA 1VQON 1F9EB 3UDVA 1IH7A 4IOAL 2GC8A 4ES2A 1RBOB 1GOCA 5C42A 3QT7A 1DTTA 3J7YU 4G1QB 3M1VB 3NCIA 1IQZA 4UZCA 1UVNA 2HS4A 4J9UE 3CT9A 3FEZA 3DLEA 5EUHA 4ILRA 3MK6A 1GOBA 3VEOA 1VQ6N 3QMLA 1VQYA 1D9FA 1KLMA 3R7SB 1FJGF 2C1EB 2HS3A 3A5NC 1Q79A 7FDRA 3VAIA 4GV9A 3IGVA 5BYSA 2V8HA 2FUG9 1I5OB 3MOJB 4BCAA 1RHMB 1JQGA 4HUEA 1U45A 5I3QA 2Q66A 3H7HB 2CWKA 4OPKA 2GUIA 1IBMF 4Z94A 2A2CA 5GINA 1OJ4A 3EM1A 1Z1ZA 5AQHA 5M1OA 1K0VA 2J0SD 2R7OA 2VBXA 1YX2A 5I3UA 1F5CA 3MHYA 3J80O 5T7BA 4U8VA 3QAEA 3CO0P 4M3RA 3V4IB 3NS5A 3SNNA 2YKMA 3IM9A 3HZEA 2IA0A 4TY9A 1UZDA 4O5BA 1FXXA 3BO2A 3S01A 3RMDA 3G9CA 3FRZA 2W40A 5ADXA 2KKHA 2Y8WA 4ZLJA 2CQPA 1IKYB 1CXQA 3CC2S 4OZ0A 4J2AA 4ZLLA 2EFNA 4MH8A 2KFYA 1WNEA 4G1IA 2CQ0A 1C1CB 1WC6A 1U8WA 3IR5B 3R3LA 3AVIA 2CJAA 2A41A 2AX0A 1XNRF 4CZLA 3KK1B 1DQAA 4A57A 5GADU 3NFAA 2RE2A 2OPQA 1R8PA 4NLBA 1GMVA 2QL9B 3QIOA 3W3SA 3NVKA 1B7FA 1FDBA 4JYAJ 2P8IA 4DPOA 1TELA 4ECRA 1EX8A 3D2EA 4PUOA 1X4AA 2RILA 1S0NA 3BZKA 1HBMA 3AOBA 3PLAA 3EO3A 4DTSA 5C24A 1VIOA 3AQPA 1SUQA 3GJTB 4DR5F 1G4CA 3OBIA 2F8SA 2P9GA 2G0IA 1WLJA 2YKNB 1XNQJ 4DV3F 3X1LB 4ZN3A 4FYVB 3QEXA 4B9TA 1TAUA 2I5JB 3OBWA 4RW7A 1J2VA 1S5ZA 2VKRA 1M1HA 2ALZA 3G4SN 2VH7A 1RLDA 3BH6B 2JOQA 1YTYA 5AXLA 5IOLA 2KKZA 4DMZA 4M94A 4FWOA 3KHGA 5KFXA 5D4NA 3CCSN 2IMWP 4U7UD 4NRUA 2G0JA 5KTQA 4C48A 4KKOB 1X4GA 4KO0B 3AJ1A 4DR7K 2E20A 4L72B 3DKDA 3MM5A 1NK6A 2KT5A 3F41A 3IMQJ 4X62F 4JKHA 3DLJA 2V2QA 1WHYA 2A6OA 1T94A 2XYGB 4QJVA 1UPMB 2NUBA 1UMJA 2KVQE 5JICA 2HFUA 5JVGQ 2FC8A 2PMWA 4X64K 5JVGL 4FJKA 1ZBFA 4RNFA 3CE8A 2XBPA 2IDEA 3TSUA 2FGOA 4IDKB 2V0NA 2KVIA 3NGKA 2ASYA 2ROPA 3PKYA 1BC6A 1I3OB 4ANDA 4ZK7M 2C2RA 1JLBA 3PV8A 4RW6B 2JWLA 4ZPBA 1NPRA 1JLEA 5DGAA 1RTDA 2ZOGA 1GXUA 1HHQA 4F02A 1T9XA 4JUZA 4JI3J 2VC1A 3TO8A 2CPZA 2HRTA 4JI0J 3AVLA 1EP4A 2DH7A 3NNCA 4AUKA 1FJGJ 4LFBJ 4HCCA 4DL0C 1X5OA 1Y3KA 3MMJA 4I69A 3DM2A 2IFXA 1HRHA 4BR5A 5A8KA 3D4JA 1U6BA 4UQTA 1RT2B 3EL2A 3BYPA 3GR0A 4MK9A 1FTRA 3PCOB 3V9ZA 4ZVTB 5FLXO 1TUVA 2H5EA 2C2OB 1IBMJ 3TP2A 4Y2KA 1VI7A 4R5PB 4FF3A 3OTOK 3P45B 3BDPA 1KTQA 2MQLA 2PA3A 1KC8O 1R8AA 2VGMA 1CJUB 4ECWA 4ER8A 2Y9HA 3TAGA 2VDHA 2MQPA 4O8KA 3QFWA 1RADB 1FWLA 3SJHA 4NLYA 1W2BM 4MKBA 3BREA 2CKWA 2YHWA 1XR6A 1NU4A 3DI6A 3BR8A 3O9UA 1E4GT 4KHYA 2F8HA 3ZNUA 1M5HA 5KFYA 4TYBA 2LKZA 4NMXA 1QVFR 3X3UA 2VFSA 4H0PA 4ILJA 1KC8T 4DX6A 1VQNS 2HQGA 4GRSA 4X65J 2HBZB 1FK9B 4IOBA 1ESVA 4DV4F 2UVWA 1H1VA 4LF8F 1IR0A 5KFEA 1DHMA 4YMEA 5RUBA 1JJ2M 3NOCA 4EBEA 3QEVA 4NLUA 2UUCK 1H0HB 4DV0J 5CR4A 5GMKa 2ZD1B 5CYQB 1KSPA 2F4VJ 2NRZA 1UETA 4FJMA 3IP0A 3LWLA 3GLJA 3KXDA 4OLAA 4JI1F 4F0MA 4LSNB 4CWBA 1SB6A 2DY9A 3V6KA 4YY3K 5KG2A 1TL7A 4OMFG 5AJ3K 3QBWA 2CJYB 4NI2A 5KFOA 1N5VA 1U1QA 3EYZA 2BJ9A 1NDCA 1XMQJ 1X7VA 4AHTA 5EWGA 2PC6A 1BCOA 3CCES 5KQ8A 3C6UB 1KQSR 1HR0J 3HHDA 4EWTA 4CM2A 3TTFA 2VPYB 1SC1B 3ZEUA 4KB0A 1X4HA 4OX9F 3IBFB 1A6LA 2DGQA 3N5BA 1WBDA 4OX6A 3KLHB 3MCMA 4DPYA 4AE5A 3CCLN 2D0PA 1HNIB 4FM0A 3O6QA 3HFKA 1RWNB 3NBPB 1SH2A 3O80A 1VC0A 5HQMA 3OUYA 1U0SA 4BHQA 2EK1A 4A61A 3VQQA 4IFEA 4I6YA 1VHXA 2Z30B 3GBTA 2WVFA 3BY5A 4CGFA 4LF6K 2OPRB 3KDOA 5LMUF 3CMAN 5DM6Q 3H45C 2WOMB 1EETB 1ZBTA 5KFFA 3NRBA 1YJTA 5DQIA 5DM6L 1QUVA 3ZX3A 2QLFB 2RHKA 1YJWN 3PEHA 1QAIA 1XC9A 1HUXA 3CQYA 4CZKA 3RR7A 2NZCA 4BS2A 1Y00A 3BF4A 3VPZA 4IYQA 4K5RA 3Q8YA 5E3PA 4U95A 2P6TA 1Q8IA 2ZKTA 3H46O 3HM9A 1T3NA 2F63A 2OTJS 3SDEB 2HQDA 4QWDA 2KXFA 4JK8A 2H1YA 2FB0A 1B4SA 3SPYA 2O4GA 4ZP7A 4E3SA 2EC0A 3H5SA 1U4BA 2BM1A 1Y9OA 1VFJA 2ZC4A 1ZM3A 3BQ1A 3K58A 2E1CA 3QJLA 3D54A 3ZSVA 4DSLA 3TI0A 4NYNA 4B3OB 3VR1A 4LMZA 4QIFA 2GO9A 3L8BA 4HWIA 3CC4N 1KVKA 2KT2A 2B5JA 4NE9C 3T1HF 4NEZA 4L75A 2VBYA 3GIIA 4E1MA 4Y0WA 2EPIA 4YOXA 2N7YA 1N32F 2W6KA 2M7SA 1RWWB 2P9SA 5LL6d 2YI1A 2JWKA 3JAMO 1TR0A 2W2NP 1SV5A 5T41A 4Y3CA 4BC5A 4EBDA 1X4BA 1RWPB 3U9ZA 5L38A 3HTVA 2E7WA 1V3ZA 4DS4A 4QAGA 3OW2M 2MZQA 2HLUA 1CSJA 1D1UA 4ISEA 5C25A 1J5OB 4E2FB 2D3O1 1TV6B 2NRRA 4Y6IA 1Q8KA 3SBMA 3BSAA 3CJ1A 2B4UA 4JI8F 1FWPA 2XZTB 1HMVA 4ECQA 4KFBA 3BKFA 4BRHA 3ILLA 1U6ZA 2QIFA 1SQGA 4E7JA 4IJAA 2MY8A 5KPRA 1FX2A 2QSWA 4ISGA 1ZZFA 4A8OA 4JI4F 5LMNJ 2MZ1A 1FDDA 1VQKN 4GV3A 2F9TA 1NK7A 2B3TB 5HP1B 2GWKA 3G8TA 1QSSA 2JWNA 3MMCB 1FERA 3GU0A 2D74B 1BGXT 1VSEA 3TVZA 3R2DJ 3KKFA 4F2SA 3PYEA 4J2DA 3VEXA 2BM0A 2ACMA 3VQ9A 5B0EA 3TAMB 1WG5A 2XM3A 2QW9A 3AA3A 3QJPA 4IG3B 1B0PA 2QYGA 4JI1J 7AT1B 2ERRA 5E3QA 4XTTA 3R27A 4FWMA 3ZSZA 1WAJA 2V4QA 1W26A 5LXRA 4F9OA 4NYOA 2LQ8A 1QVGR 5JMVA 4QR2A 3AA4A 2AYBA 1NHVA 2UXCJ 1WB9A 4P2XA 3L2QA 4M7YA 1M5SA 4IFVA 4USTA 2YNFA 1HYSA 5DRKA 4GC7A 4WU3A 3ULEB 3NLCA 5KFCA 3PJXA 1EWQA 1DURA 4AM7A 1S76D 4ZOSA 5DJBA 5KFMA 2DNKA 2OKQA 3POTB 3TSPA 2KQ2A 4BRQA 3PUFA 4DTUA 5F41A 4D3HA 2YQ3A 4ECZA 1OWXA 2B7BB 3O8WA 2PEBA 4PEOA 4LRBA 1J5EK 2B56A 1RQ0A 3H98A 5HMYA 5K8MA 3G25A 3AVHA 3EDQB 2BACA 4HDGA 2RRAA 5C10A 5AQIA 4I56A 3LP0A 3BZCA 5IV3A 3M6XA 3AO2A 2UUAF 4OKKA 2YNGA 5IC4B 2MDAA 1F9HA 1FDNA 3KJQB 2L41A 1YGYA 1X4CA 2E1RA 3G82A 1VRTA 2CQ4A 4OVLA 3HOTA 3J7YI 5GIOA 3CMEN 2GUPA 2RHQB 4LSLA 3PW7A 5EWFA 3CGIA 1S1XB 3DU6A 4AFFA 4IZ9A 2E1AA 1MN9A 2IRXA 3F0NA 2GJIA 2XSJB 5DQGA 1N34J 1F9FA 3Q2SC 1RB0A 4FLYA 4FVUA 2WCXA 1RA7A 3QT5A 1EIYB 2EI5A 1N54B 4USUA 5L9NA 5TKYA 2PEHA 2HHUA 1C1AA 2FGCA 3THYB 4A8YA 4G1QA 4LFCK 2W4CA 1IKWB 1GMWA 4FXWA 3EPIA 1YG0A 2LYVA 4A8QA 1AZSA 1K1QA 2F7VA 3CCMS 3PYGA 2CJKA 5A8WB 5JS2A 1GMUA 5AZIB 4BREA 2DFFA 4DR6J 4ECUA 1QJHA 2BKNA 2LP4A 2FPHX 2KXHA 2Y0SD 3N4QA 4DCHA 5ITHA 4DKWA 1MMDA 1W7WA 1SC4B 2B8QA 1FF2A 3NKYA 2ZNZA 3A3OB 4BY9C 5J1EB 3F5TA 2GJFA 3EEQA 5ELZA 4BRCA 2A0FB 3R5GA 4X2BA 2COLA 4CM0A 1NNDA 1S9GB 5HL7Q 1FJEB 4CEBA 2FVRA 3T5LA 3T19A 4GY2B 8ATCB 5HL7L 2ZH9A 2HF3A 3ZCMA 1WNSA 3GQCA 2ZEJA 1T9WA 1BQMB 2GIQA 3ISZA 3S3OA 3TX0A 3QLHB 3V4IA 5E41A 1JCFA 2FIUA 3MUMP 3GCWP 5H1SQ 2OIHA 1N33K 3UR0A 4AH9A 3AVAA 3M32B 1T44A 3V9SA 3BBCA 1Q81O 2HK3A 4MFBB 4DR2K 5GADI 2VQEK 1DJ0A 4ECTA 2QWQA 1IKYA 3T9NA 2J76E 2E9ZA 4B3RJ 1SJ1A 1DQ8A 5F0XA 3MPUB 4OI0A 1RU2A 1XQIA 1P1TA 4OLOA 2Q97A 1HLWA 1C1CA 2GWJA 3L7OA 2O8BB 4NXNJ 4CZIA 2NR0A 3KK1A 3FFKB 1Q81T 3EGNA 3QGIA 5KFNA 2HIQA 2W7PA 4KRWA 3RBEA 1YHQS 2IVOA 1WELA 3AB4B 1F60B 1U09A 2GHWA 4MYUA 1T95A 1K9MT 1EKEA 2O8CA 1VISA 1TZ0A 2M3DA 3C3LA 2ZH8A 4LD0A 3TJAA 1XHZA 4OFZA 2V51B 3FZHA 1NPPA 3AV9A 1HWKA 2RU9A 4OZ5A 4GKJK 3CI5A 3OTDA 3OXGA 3RBXA 1WDDA 1V5IB 2E5IA 4X66K 3PR5B 4DR7F 2YKNA 5BYRA 1G6BA 1OH8A 4C6AA 3ZNJ1 1GLLO 3CCUS 3FC9A 1Z26A 1EARA 2I5JA 3ZT3A 4A8XA 4LRFA 2W1BA 3HKWA 1V5VA 4WYBA 4JLHA 2E88A 3SYZA 1X9JA 4IXCA 2DHGA 2E2PA 1BI4B 3AJ2A 4FDFA 4X64F 1PBAA 3UR3C 5G0RB 4OX8A 4RUCA 5BRDA 3P5JA 2C3MA 1T9VA 2RT3A 2KHCA 4AHSA 4KKOA 1YJ9S 4KO0A 2UUAJ 5B0GA 4C98A 2XNRA 2QA1A 3RBDA 4MIWA 5CHCB 4URGA 1RHKB 5AE2A 4FJNA 4RBTA 1YAGA 4NB4A 3P3DA 5L1KA 1BD6A 3P38A 1PJ7A 2IA6A 5KGXA 3C65A 2VASA 1EXQA 2DNMA 5LJ3Y 3HYFA 4AHVA 2DTUA 4IDKA 2BRLA 3VOVA 5DDQC 4B3TJ 3LDLA 2KU7A 3ZT1A 3AA5X 1LOUA 4CNYA 3I56S 4ZTJA 3MCOA 3F9KA 3NEKA 4NLPA 3BN7A 3CJRA 4LF5J 4RW6A 1KONA 3CFOA 2KM8B 2A3ZA 3CJ3A 3T1YJ 2LMIA 4KH0B 3OTOF 3L95X 2E2NA 4NCGB 4CO0A 1GOAA 4ZKAA 1RWVB 2CPEA 3M9OB 3A8EA 5FROA 2HURA 4ZVUB 1HPZB 2XS2A 3CPWM 1UAXA 2DJWA 2F96A 4P72A 3M8ZA 3HZGA 2POKA 4JKEA 1CJKB 5ADXH 3M4XA 2OSRA 1R43A 1WJ9A 5GAEU 2WSFC 3F73A 2QJ3A 1X9MA 4XH5A 4J9OA 3GG0A 1RT2A 2HGMA 2PO4A 4HUFA 4AL6A 4K7QA 5DZ6A 5EU7A 2ZGZA 2PI5A 3VQ6A 1RGIA 1HHSA 3MTKA 2P1JA 2Z2ZA 1S97A 3AHPA 2PIIA 2A6MA 5CE3A 4G9ZA 2DR5A 2A6AA 4DU3A 2MKCA 4R5PA 2OLWA 2R8GA 5ETTA 3DCAA 4ID5B 5A2QO 3NCQA 4UY8O 3V9WA 4FF2A 2IVNA 4CLWA 2QMXA 3LUYA 4KBIA 3FK4A 5CHIA 2XY7A 5A6WA 2UUCF 1N36J 1VMBA 3AXMA 3CIZA 2VUGA 3OS0A 4RPFA 3I5CA 1QE1B 3Q24A 2R2TA 4K41A 1HBUB 4UY8T 2XSFA 4YY3F 2DY1A 1N52B 5F9LA 3R9LA 1MWZA 3AVBA 2QMWA 3GR1A 3AQOA 3W62A 1H2VZ 4J9SA 1FK9A 3O44A 1ZBIA 4HVJA 2CFXA 2ASJA 4GNIA 2A10A 3BF1A 4YP3A 1OSDA 3VTHA 4MKVA 1PG5B 3ZTQA 3Q89A 2DGUA 2OEJA 1ZH5A 2ZD1A 5CYQA 1QSLA 4DPTA 4WFBQ 4H5VA 4HHUA 4DFKA 3AAWB 4HTLA 2AHOB 4WFBL 4NYFA 2Z56B 3CCVS 3GIMA 4LSNA 1WUUA 2VGNA 4LF7K 3I55S 3SQ1A 2SXLA 3AOCA 4DS5A 1UAWA 4USJC 2IBOA 5GMDA 3U7JA 2E5LK 3RYLA 2FXUA 3RAQA 1FRXA 1WSJA 1Q16B 3CC2N 2HMPA 2AQ4A 4DN9A 3O1LA 1W9HA 2AYEA 4NA3A 1D9DA 4L3KA 3ZC4A 2X1FA 3I31A 4JKAA 2WC9A 4TY8B 4ZPWR 3C6UA 4F50A 1ITPA 4EHUA 2HSTA 4LF6F 5F8JA 1ZOTA 5MLCQ 1R27B 4IO8A 4WYWA 3C0BA 3RU0A 4QS8A 4KC5A 3B78A 2UU9J 3WNEA 3HL8A 2DITA 4B1WB 1TKXB 1XK8A 2ZM6J 5HAOA 1GLDG 1F5AA 4DL5A 1HNIA 4MT1A 4H0YB 3NBPA 3FLCO 4KR0B 3V81B 4P74A 1F21A 4CIEA 2GV9A 2BOAA 4WQ4C 1R0AB 4RZRA 5BR8J 2EX3A 1XMOK 2MKIA 2OPRA 2WOMA 1EETA 4RKUC 5K9FA 1NM1A 4ES3A 3NH0A 2UXBJ 2XY5A 3H40A 3JSMB 4CLPA 4PABA 3VN5A 1ZAVA 4JK7A 2PDAA 1LV5A 4QS9A 3KWIA 4RU9A 3SBTA 4M3WA 2VONA 2ZH6A 1AW0A 2G8UA 1HI1A 2VIHA 3HRGA 2DT9A 4OX7A 1RDRA 1S1WB 3SDEA 1SJRA 4NLOA 2IGIA 4KB1A 2AYGA 2ACYA 3QNWB 3AVMA 3UKUB 1QTMA 2IHR1 3KVGA 2B9WA 3B6BA 3MXMA 3W5ZA 2BABA 2QRRA 3QMQA 4I9QA 4DQSA 2PSZA 5B8HA 4KY3A 4B3OA 1Q78A 3Q7CA 4C11B 3FJ2A 2DNOA 2ZOFA 2XWYA 1FRLA 2O3DA 3P31A 4A2AA 3SBGA 3OR1B 4C7QA 4CJUA 1BLUA 2U2FA 4UW2A 2F8MA 2N4DA 1S48A 4CT9A 4PL8A 4HTUA 3EN9A 3N28A 3SUPA 2WVEA 4C3KA 4I4BA 4RO0A 3VQTA 3MWTA 4NXMK 1RT3B 1J5OA 1UA1A 5L8RC 5KT6A 2HZAA 1TV6A 5FLXY 4FWKA 4GKKK 1YVFA 2XMJA 1FE4A 3DAWA 4OGEA 4B3SK 1S77D 5KT7A 3NDKA 2BE7D 5ETSA 1M5KC 4NLDA 4OI6A 5J1PA 4MKAA 3PR4A 4OYXA 1WI8A 2CPXA 4LR8A 3V9UA 3GMGA 2G9OA 2BR0A 4CQ1A 1NDLA 3OXLA 5HP1A 1X4EA 4IH5A 2RPIA 2W9AA 3PW5A 2VKZG 3TUPA 3MMCA 4GO7X 3VA3A 2OFHX 4QIWD 2HFZA 4CHQA 1QAXA 2DPIA 1IBLK 2QLXA 2NXJA 2BJ1A 3ATVA 3J7Z5 1OPZA 3AB2B 3I8BA 2YVSA 2XYHB 1SL0A 4BC9A 2I7PA 2ZHAA 3HXMA 4NLSA 4BR7A 1AXQA 1HFEL 4IG3A 3TA0A 3K57A 5AE3A 2BE2B 3W5YA 3OTEA 1TUUA 4FNIA 2WBRA 1YRUA 4CGGA 2YWHA 2E6MA 3AVGA 3DC2A 1XERA 1HNWJ 2EFQA 2HBQB 5D0GA 4ZJOA 2UUBK 4FVCA 4DPUA 3QRQA 2KRBA 1RAJA 3OYLA 2DBBA 1NB7A 4FK2A 2PY5A 2DIUA 4MK7A 3DHWC 3ULEA 4DV1K 3M3ZA 4CH1A 2XS7A 4OI4A 4O3PA 3MM7B 2CVIA 2PFUA 4CGIA 1NHUA 3KIOA 2P9LB 3L4BC 2H51B 2RQMA 3VA0A 3POTA 1RTHB 2FJEB 1GFWB 2MLYA 2H4YB 4CLUA 3D45A 2YX7A 3MAHA 1JLQB 4EHTA 2BJ7A 2HHHK 3HHLC 4DR4J 3EWGA 4AT1B 1WOSA 2WZ1A 3HLUA 2GW8A 3HFZB 5KT2A 2KXNB 3H08A 4CI6A 3GFYA 3D3BJ 3B8HA 2LA6A 3LZJA 1WSHA 2IM3A 4WFZA 4FXVA 4OYOA 4ZVHA 4U9RA 1D3WA 5DG8A 2FTRA 1NJZA 2H48B 2QTWA 1P27B 4YDUA 3UPFA 3CCJS 4RJVA 3OLAA 2PFFB 4WP3A 4LFCF 5C2GA 5FPDA 4CEEA 4HI2A 1RI7A 2X1GA 2GMHA 2NXNA 4Z4HA 2Q6BA 1CVJA 2RIJA 4O44B 2OZMA 3CIMA 4ECVA 4DN0A 3IAM9 1VR6A 4H4OB 1XHXA 1S1XA 2ZVSA 1M1GA 3E66A 2XSJA 1YBUA 2ASDA 5F0WA 3JSYA 4QW8A 2PBDA 3RZAA 3R7BB 4K8RA 4WKYA 1KXPA 4XH4A 2EFPA 3LWMA 3THYA 5H9FK 1NU0A 1NMDA 1IKWA 1CJVB 3KWMA 3VERA 1WEYA 2HQFA 5FDLA 1TKDA 1B9DA 3CDUA 5A8WA 5AZIA 3KHRA 4EO8A 3NS7B 2AJFE 3PVXA 3BBBA 3OYGA 1OQ3A 4CEFA 3AVKA 3E9LA 2LXFA 2O8DB 5M1PA 2OUGA 5J1EA 1N33F 1P6TA 3SPZA 4OZ3A 3HX9A 3FCHA 3OHAA 2W8LA 4QIGA 4BVOA 2MZTA 2VQEF 3J81j 3JAMY 3N6LA 2HZVA 1GQEA 1CC8A 2FD2A 1SBRA 1GTEA 1RT6B 4JI2K 4OJGA 2ZBIA 2HWIA 2NXEA 2BJDA 2OPSB 1UPPA 1BQMA 1X5PA 4DV2K 3PHTA 2HQIA 3RG6A 2ZWOA 4YNQA 3AVCA 4M63C 3QLHA 1ZBUA 4CFCA 2CUYA 3HSGA 3PY8A 4NLQA 3S41A 4HDHA 2C2EA 2HQCA 3S8SA 1T0TV 1WC0A 3HMJG 4HACB 2JFKA 4MFBA 2VWBA 1ZXOA 1AUDA 2Q3SA 1SH3A 2HPUA 5FD1A 5FPMA 1VK8A 2GMJA 1NOYA 2OA8A 5D4PA 3U1LA 2KZZA 3M2VB 4HI1A 2DTJA 2E1MC 2ZKUA 3VCDA 6FD1A 2QC3A 5AQMA 1S59A 4GKJF 4U7CA 3DGPB 5ETNA 2N4CA 2GIFA 2HQ3A 2O8BA 4CO4A 3T6BA 3FSXA 2RJZA 5DMRA 4BDYA 1S0OA 2KG0A 4X66F 3VEYA 3PFOA 1NGFA 1DEJA 1HL6A 4RWXA 2W01A 1NHKL 5KFKA 3OVNA 1U2FA 1H7XA 4B3MF 3W64A 1Y64A 1BU6O 4BR4A 2YNIA 2F8EX 2F40A 2VHGA 1HQEB 2VC0A 1J9AA 3OFEA 3HK2A 4V19X 1HKAA 3K0SA 2CGKA 4LRAA 3FMBA 3EICA 4O3NA 3HI0A 4G1PA 1R8BA 4OL8A 5KFGA 4EBCA 3ZFVA 3KMQA 4AD6A 1TYQB 1PAUB 3OFHA 2HHTA 1HHTP 4K4TA 1H73A 1O8BA 3PX4A 1ACMB 1NZAA 1C4AA 3SAFA 4OYPA 5IM0B 2CPDA 2R7YA 4BVPA 3AA9A 3OR2B 1M5OC 3IAYA 2F9JA 2EC2A 1OYEA 2W2QP 2ETJA 5GADP 2GO8A 3D0PA 1JLAB 2ROEA 1QS4A 2J0WA 4LIRA 5G0RA 4WFNQ 4AXIA 4E7KA 3R2CJ 4IQMA 3S6EA 4DSFA 3GCXP 4WFNL 3WXJA 2ZWPA 2C2NA 4IKAA 4F4YA 4BE0A 4YOVA 3KJNB 2YBVA 2BXJA 4Q8FA 1S7IA 2CG8A 2BRKA 4OHZA 5KFPA 3RB3A 4LT6A 2HVZA 1NAQA 4DB3A 1RTIB 4BR9A 3CJ5A 4ZP8A 2QL7B 4JYAK 2B9EA 1ZAXA 2C28A 4DX8H 2KTQA 2IIRA 1WKLA 4QOZB 3ZSQA 1WORA 2CJQA 3SAHA 2VF3A 2BW2A 3AD9C 3D1QA 3EY1A 3WQPA 3NGRA 1VC5A 1Q8BA 2MHNA 1VQLS 3W0LA 1AROP 4NZ6A 3AY0A 3BUZB 5D4LA 4JS4A 4IR9A 2CIMA 5ETVA 1XNQK 2IM0A 4ED3A 2D3UA 4ZJLA 1VYAA 2FBVA 3ETMA 4Q7AA 2B0GA 5GAEI 4CEDA 4CYUB 4NCGA 3L09A 1RT5B 2GVDB 2MGZB 5HATA 4KE5A 1YITN 2FYXA 2MSTA 2NSBA 2BMBA 2FVCA 1HPZA 1SAZA 4X4PA 3L2RA 2P9KB 1PAEX 1AFJA 2QKBA 1NSAA 1NKBA 2AZ1A 2QX0A 4JD2B 2VDIA 4ZP6A 2OTLN 1CJKA 1UJ6A 5G4DA 4H4KC 5A6PA 3ISNC 1YIJN 4W5NA 1DTTB 3LGNA 2CXEA 4Y1CA 3SV3A 5KRTA