3LP2A

Hiv-1 reverse transcriptase with inhibitor
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
558
structure length
554
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibition of RNase H activity of HIV-1 reverse transcriptase by RNase H active site-directed inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 153
structure length 554
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3lp2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3lp2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lp2A05
2IM3A 1BGXT 1EKEA 3BQ2A 2OPSB 3LP2B 1C0TB 4DTPA 2P1JA 2PYLA 4EEYA 1FK9A 1RDAA 3S9HA 4HCCA 4CJRA 4RW6A 1XI1A 5DG8A 1KHVA 5KTQA 1YTAA 3G10A 4ZHRA 1VSJA 3NF8A 2V4RA 2C28A 1BI4A 4ZPDA 3F73A 3CIZA 2WB4A 3HVWA 2W8KA 5KFOA 3MAQA 5HLFA 4H4OA 1NJYA 3LWLA 4OLAA 2F8EX 3CJ4A 5HP1A 4CJTA 4NYNA 3I0SB 1KCFA 4J9RA 3U3YA 5KRTA 3KJVA 4K8XA 1S10A 2QK9A 1NK0A 3T3FA 4OGCA 1D0EA 2X6SA 3L3VA 3UDLA 2RKIA 1HYSA 1IKXA 4O4GA 4CIEA 1BIZA 4B9UA 4DG1B 4OPKA 4XIUA 3L2RA 1RAJA 2JEIA 3ZT1A 1WAJA 4CJFA 3VA0A 3K57A 4CHOA 3OL9A 2ZD1B 2WONB 1XWLA 3KK2B 4CGFA 3O3FA 2J6UA 4PUOA 1S1TA 3TR8A 5EWGA 2YKNB 3KNAA 4RW4A 3QETA 5F9LA 2RF2B 1RCHA 3NF9A 1S6QB 2JEJA 4QWAA 4CIFA 3S3MA 3HSTB 2OZSA 4ELVA 2R8KA 3AVMA 2KFZA 1HNVB 3T5LA 3DLRA 2BRLA 3H08A 1SKRA 1YTUA 5KT4A 3PW0A 3KK3B 2AX0A 4Y1DA 3PR5B 4RW4B 3C94A 3NH0A 2A1RA 1GOCA 1HMVB 4IQXA 3G0ZA 4DL7A 3L2VA 2HVIA 5F8HA 4PA1A 1C1BB 3S3NA 1TAQA 1RTIA 5L9XA 1QAIA 4Z0UA 4DTRA 3RMCA 4YMEA 3VQAA 3QO9A 1NHVA 1RT7A 2EX3A 1SH3A 4F4WA 4QPXA 4IDKB 2VG7A 3M8SA 3OSPA 1S9EA 2D7SA 3KTQA 4DSLA 4U7CA 3NAEA 3S3OA 1QE1B 3KLGA 1KFDA 2OZMA 3DRSB 3H5SA 3EPGA 1BQNA 2QV6A 4ID1A 5D3GA 1SH0A 3CDEA 2HW3A 3BJYA 4DF4A 1QSSA 4H4OB 4M3YA 4O3SA 5L1IA 2ASDA 3GIKA 5DGAA 1C1AA 5KFCA 1REVB 1GX6A 3TAMB 2G8HA 5KFDA 4FLTA 1B9DA 2FBXA 4XO0A 4E0DA 1JXEA 1W0HA 2PZSA 2HHSA 4F8RA 4Q8FA 3SQ1A 3C95A 3U3GA 3OVNA 5SWMA 1IKXB 1SV5A 3VQ4A 3SPZA 4M3UA 1JLQA 1S6PA 4IFYB 3LZIA 5DG7A 3KK1A 2HNZA 2IA6A 1U04A 2ILZA 3K59A 4LQ3A 1LV5A 4Q43A 4HCBA 1C6VA 1TKZA 5J1EB 3SI8A 4KO0B 2D0CA 4FCYA 1J54A 2KZZA 1W25A 3QGHA 4KBIA 3KHRA 4O0IA 2V0NA 2YKNA 2YKMB 2VWJA 3TANA 3OHAA 1IM4A 4RNNA 2FLNA 2B6AB 1S6QA 4J9KA 2FLPA 3IGVA 5J2PB 4KHQA 4RUAA 4BE0A 1HYZA 1HRHA 4NCGA 3ZSXA 3OJSA 2DY4A 4FZYA 4FM0A 5KG7A 1TV6A 1HNVA 3HT3A 1RT2B 2IJNA 3NAIA 1W9HA 3DLEB 2YNHA 1RBSA 1WSJA 2E9TA 4L8RB 1RT1B 3DLEA 3OL8A 4ED3A 4ED0A 4CJQA 3CDUA 4ED6A 3H5YA 3ISND 1U4BA 4NLSA 2E9RX 1RTIB 1HQUB 1LWFA 4YR3A 1RTJA 4CGDA 5J2QB 3IAYA 5KFTA 5FROA 3OS1A 3HVRA 3U6FA 3KLIB 1D9FA 2IJFA 4DQRA 4JS5A 3LAMA 4AHSA 5KFXA 5L1KA 3HP9A 4TYBA 4O55A 3OYGA 1A5VA 4NLYA 4B9VA 2HWIA 2FVRA 4CJEA 4W5OA 4CJSA 1NK9A 1D5AA 1NKEA 4R5PA 5CZ1A 4FYDA 3BR9A 3VQSA 4F50A 1MMLA 3PX6A 2OH2A 4W5RA 4YP3A 2XC9A 3HK2A 1WN7A 3HM9A 4CF9A 5F8NA 4KKOA 3KMSA 1NOYA 3QEIA 4IH7A 3O4NA 1JLAA 3CFRA 5KFZA 2HAIA 1FXXA 4R5PB 3RAQA 5FDLA 4YQWA 3QINA 4ECUA 2Z1JA 3SJJA 1S97A 1KLNA 1DTQB 5JXSA 3NGIA 1SUQA 1LWCA 3V6DA 3O3HA 3SQ4A 5KFWA 1X9WA 4KTQA 3EZ5A 3V6DB 4M3RA 2YNGA 2OA8A 3GV5B 4Y3CA 4CIGA 3V4IA 4DFPA 3VQPA 4ZPCA 3SNNA 3SUNA 4M3TA 3JSMA 4U6PA 4DTXA 4R0EA 3NL0A 1RDDA 1NJZA 1KFSA 2G8IA 2XCAA 4DQPA 1HJRA 4QAGA 3BSNA 1J5OA 3TI0A 4J9LA 3I0RB 4PY5A 3SUQA 1RBRA 1Z4UA 2YNGB 2OPPB 3VQCA 3I0RA 4B9NA 4FLVA 4KPYA 3DI6B 3T5HA 4OPJA 3DRRA 4Q0BB 1ZETA 4E19A 1ZYQA 5J2NB 1ASUA 3DOKB 3CJ0A 4DU4A 1ASVA 1C2PA 3LP0B 4FS2A 5KFLA 3RB3A 3DOKA 1TP7A 5K14A 3CG7A 3V1RA 2KFNA 5KFQA 2OPPA 4E1NA 1XC9A 3CQ8A 2JC0A 3OYFA 4QW8A 3ALYA 1S9GB 3JYTB 4IR1A 4G3IA 2GV9A 1RT1A 5KFMA 3KLEA 1NNDA 1T03A 1IKYA 4DL2A 1TK0A 3QGGA 3N6LA 4CECA 2C2EA 5CYMB 1LWFB 2GBZA 4EYIB 5KG2A 2VG6A 3QERA 2X6NA 1EETA 4QWCA 4KTZA 4CFBA 4ZPBA 4RG8A 5KT5A 4URGA 1C0UB 4ID5B 1JLEB 4DWIA 4GC6A 4ECWA 2WK4A 1RTHB 1EETB 2XGPA 4K4SA 1JLCB 5DQIA 3CM5A 4FLYA 3GIIA 4Z4EA 2UVUA 3QESA 3DLHA 3HPHA 4IG3A 3IRXB 4HYKA 4DFKA 1WAFA 4N47A 4KKOB 5KFYA 5HBMA 4DLEA 3IN5A 3UR0A 5FDLB 3OLAA 4EYHB 3RB0A 3C6UB 2XHBA 3NBPA 3SYZA 1T7PA 3IRXA 1J9AA 4BDPA 3MECA 3BQ0A 4CEEA 1TQLA 4J9MA 3BGRA 4TY8A 5CYQB 5SZTA 3IS9A 3V4IB 3O4QA 4JV2A 3LANA 4CJ3A 3GV8B 3TVKA 2IC3A 1Z26A 3AO3A 4KHYA 4Q5VA 2KTQA 3AV9A 1JLFA 1TKTA 3V9WA 1ZBFA 4OKEA 3ZSQA 3LP1B 4HKQA 4NLVA 1RDRA 3V1OA 4M94A 4RW6B 1VSMA 2G8VA 1T8EA 3OYMA 1S1VB 2GC8A 5CYQA 4FJIA 4CJKA 3KD5E 3NF6A 3MR5A 3H40A 3QIPB 1XHXA 3NE6A 2I1RA 2E9ZA 2A1SA 3MEDA 4IG0A 3C6TA 3TAQA 5KFRA 4Y2CA 5CZ2A 5HLFB 3C6TB 4FBTA 2I5JB 4DSIA 4DSJA 1Y97A 5EU7A 4ED7A 2D41A 4GVMA 2G8KA 1XHZA 4DTNA 1UA1A 2PYJA 3SV3A 3OL7A 2CJQA 4C8KA 4G1QA 4I9QA 4M3XA 2FVPA 1KVBA 1WNEA 3QEXA 4DQIA 1K1QA 4ZVFA 2Z1HA 4CJVA 3DOLB 5KFKA 5KFJA 3HO1A 2YNIB 4LSLA 4CEAA 3QIDA 4AHVA 4RW8A 2JC1A 5KFNA 4DSEA 1TK5A 3ITHA 2AWZA 1K1SA 4ZVGA 4O4GB 3DLKB 5DMRA 2DPJA 3N6MA 3L2WA 4RNMA 3HKWA 4WXWA 1JL2A 1S9FA 1NK7A 5KFAA 3MEEB 2FC0A 1TKXA 2DTUA 3ISNC 2RF2A 2ZD1A 1EX4A 4ELTA 1GOAA 3M8QB 3H59A 1TKXB 2WONA 3E51A 4CHYA 3PHEA 2BQ3A 3DLKA 1S1XB 3MEGB 3M8RA 5KG6A 3LPUA 2FVCA 4ZTJA 1NOZA 4KHMA 5HBMB 4IFVB 5HRNA 3WNFA 3MEGA 3RAXA 4LD0A 3SFUA 4I9LA 4FM1A 3M8PB 3QEPA 3G6VA 4KI4A 4AILC 1BISA 4ZPAA 1BCMA 3AVNA 4O3RA 3KLHB 5L1JA 2HNDA 5EDWA 4DLGA 4HUFA 4CFCA 4CHZA 1C0TA 1U49A 2HHWA 4ELUA 4KHWA 4E1MA 1EXQA 5DQGA 3AA4A 4O3OA 1KLMA 4NRTA 1RBVA 1S49A 4TLRA 4CJLA 3CJ3A 3V9ZA 4DF8A 1IG9A 1L3VA 4DSKA 2FJXA 3WNHA 3QLHA 1Q9YA 4O5BA 2BQUA 4NYFA 4CJ4A 4CHNA 2D0AA 4NLOA 1JXLA 5FRNA 2JEFA 4KB1A 4I2QB 3RBEA 5HP1B 2GIQA 2PY5A 3QO9B 3KJVB 1DLOB 4FZXC 4WE1B 4W5QA 3UPFA 4FXDA 4B3OB 4OJRA 1JL1A 4EP4A 4KI6A 1BCOA 2AU0A 5KRSA 1XR7A 1SKWA 3HVTA 3KHGA 1KVAA 4KAIA 1N4LA 2R2UA 2AGPA 3OYHA 4J9OA 1SV5B 1XR6A 2UVWA 4X2BA 2ATQA 3DRSA 2W9CA 4B9MA 2JGUA 4AHUA 2D5RA 4DU3A 5D3GB 5HRPA 2HNYA 1NKBA 3K5NA 2W9CB 1BQMB 4IH5A 3HL8A 1NK8A 3I5AA 4J2BA 3PW2A 4F2SA 3OY9A 3PW5A 2J6TA 4CERA 4JV1A 4NLPA 3KHHA 4CF1A 3SCXA 3AVKA 4DTMA 4O44B 1T3NA 4ZP7A 2IM1A 1BQMA 3KK2A 1TL3A 3IG1B 1NK5A 1QSLA 4CHQA 3OS0A 2OPQB 1VSKA 1TL3B 4K8ZA 1NHUA 4JRQA 3MTKA 4FK0A 3FDSA 4WYLA 2RDJA 2FVQA 4Z4HA 4ECYA 5KG5A 1T05B 3UIQA 1WSFA 4I2PB 2VA3A 1JX4A 4M45A 2WOMB 4ZP6A 2FLLA 1D8YA 4KV8B 1N48A 1BIUA 3FRZA 3KK3A 4BWJA 2E6LA 4QW9A 2WHOA 2FJWA 1X9SA 2QXFA 4FJ8A 2WCXA 2XI2A 4R8UB 4GMJB 3QYYA 2IGIA 4R8UA 5J2QA 3D28A 3UQSA 2ASJA 3ZT4A 3H98A 4TSXA 2YNHB 5T7BA 1R0AA 4BE2A 1DTTA 4ECXA 1I39A 2Y1IA 3WNGA 4CJWA 2YHBA 1REVA 3AVAA 2OPRA 1QUVA 4Z4IA 3NDKA 4DEZA 4TYAA 1RTJB 4NCBA 4LH4A 3L2QA 3T1AA 4F4KA 1LWEA 4LY7A 1ZBHA 4B3OA 5F8MA 4KTWA 1DTTB 2XY5A 4QWDA 4HVJA 4KFBA 1N6QB 3F9KA 3OHBA 4RZRA 1S5JA 2ZKUA 5C25A 3CJ5A 3M9MB 2IOCA 2FBYA 1LWCB 5KG3A 2Z1GA 3G6XA 1FKPB 1SL2A 2HHUA 2W9AA 3AVLA 1RYSA 4LH5A 4CFAA 2BDPA 4OKJA 3CFOA 3LPTA 4KB7A 2ZQBA 1ZTTA 3Q8SB 3DM2A 2YKMA 2AGOA 4MFBB 2FBTA 3BSAA 4CGGA 4PQUB 2C22A 1JKHB 1S48A 5I42B 3RRHA 1FKPA 2O4GA 4IKFA 1LAWA 3KLVA 3TAEA 1I6JA 4OLBA 2XY6A 4ECSA 3V6HA 4K4XA 1D1UA 4FS1A 5L1LA 1RA7A 3VA3A 3PV8A 3GILA 1WLJA 2D3ZA 1BHLA 1UOCA 1ZBIA 3E01B 2XWYA 4GC7A 4PQUA 4OL8A 2EC0A 3OYEA 3TAPA 3HYFA 4FJHA 2Z1IA 2BE2A 2AQ4A 5F8JA 3DMJA 1A5XA 3AVHA 4J9PA 4CF2A 2ASLA 3MXJA 4ECRA 3I5BA 2V4QA 3GIMA 4H54A 4JV0A 3OLBA 1C1CA 1Q9XA 2R8HA 4JLHA 3KLIA 4FK2A 4YR0A 4CGHA 4XPEA 4RW7B 3VQ5A 5C42A 3V9SA 2HHTA 1A5WA 2O4IA 1IKYB 4YNQA 3V81A 1X1PA 5I3UB 4Z4FA 1JLBA 4MK8A 5CYMA 3K2PA 3DMJB 4ZTFA 3V1QA 5I3UA 2R2TA 4Q8EA 2AGQA 4CGJA 4FLXA 1TVRB 2BANA 2WRMA 4WZQA 2KQ2A 2J6SA 4MKBA 3HXMA 3OYAA 1MU2A 1Q8IA 1QAJA 3ZSOA 1MU2B 1JLGB 4FW2A 3FFIA 3ZT0A 1C0UA 4ID5A 4DS4A 3PR4A 3CJ2A 2IAJA 1N5YA 3HPOA 3NH1A 4DSFA 2G8FA 3FSIA 4E7HA 2IAJB 1N5YB 4ZP9A 2HB5A 4RNOA 3L2UA 3GQCA 2NUBA 4KHUA 4WFXA 1EP4B 4YFUA 1HNIA 1SUQB 4NCAA 3NCIA 1UWBA 3VQBA 3NGZA 3OYJA 4B8AB 3OL6A 1T94A 4FW1A 3MR6A 1RILA 1RTDB 3NMAA 2BGGA 4F4ZA 4K4YA 3KLFA 2KZMA 4WYWA 2XO7A 1JIHA 3I5CA 1YVFA 4F4XA 4ED8A 1HPZA 4MIAA 4KHNA 3LP3A 3RTVA 1CZBA 2XCPA 2YNFA 1RDCA 3LP1A 4IG3B 4E7LA 4O3QA 2HHXA 4WFZA 1KVCA 4NLGA 1S1VA 4EP5A 4AHTA 1RT5A 3SI6A 3BQ1A 2GUIA 1X9MA 4LSNA 3QIPA 4K50A 3CDWA 4I7FB 4C8NA 5KFPA 4KAZA 1C0MA 4B9TA 4KE5A 4DTUA 1YT3A 2XI3A 1QS4A 2I5JA 5F9NA 1U48A 3NAHA 1LW0B 2R2RA 5KGXA 4TY8B 3Q8RB 4Y2AA 5KFHA 3OYLA 4IG0B 1LW0A 3LP2A 3AA2A 4CF8A 2W42A 2IC3B 1HYVA 3RB6A 1Z25A 3OS2A 3EY1A 4N76A 5DQHA 3EZUA 4NRUA 1CLQA 4G1QB 2VG5A 2C2DA 2VG5B 1RYRA 1UAXA 1VRTA 5DLGA 4CHPA 3ULDA 4FJJA 5CY4A 2UUWA 4RW7A 2G8UA 1KSPA 2IM0A 2UVVA 1B9FA 4EO6A 4CEFA 1NK6A 2ETJA 2HHQA 2HHVA 3ZSZA 4ZMMA 4TXSA 1LAVA 3T5JA 2GIRA 1ZBLA 4LSLB 4YR2A 3H2LA 4FLWA 4EO8A 3FFIB 3ITHB 4FJ9A 1QTMA 3DRPB 2R2SA 4FLZA 4MK7A 3P5JA 2IS3A 4DMNA 3G6YA 1SKSA 4JUZA 4UQGA 1EP4A 1L3UA 4E3SA 4FJXA 2W7OA 4BWMA 4QOZB 3KKSA 3NKYA 3NBPB 3ZT3A 1RTHA 2E4LA 5C24A 2YNIA 3DYAB 3N6NA 5C24B 3KLHA 5HROA 3Q8PB 2AJQA 1RTDA 4DL5A 1S1UB 5DK5A 3KLFB 2Q3SA 2B43A 5DGBA 3AA5X 3OYCA 2RKIB 3NF7A 4W5TA 4J9NA 5KFIA 3PW4A 3RMBA 4N5SA 3C6UA 1KLMB 4CESA 4ED1A 4CEOA 4F3TA 2G8WA 4DFJA 4BDYA 3IGNA 5HROB 5KFGA 3ASMA 3IS9B 3T19A 4CJPA 4IRCA 3AVIA 5KT2A 2EHGA 3QZ7A 3L8BA 4TY9A 4K4WA 1VSIA 3D5MA 1WSHA 4ECZA 4E89A 2W7PA 2BRKA 3H4BA 3RRGA 4FJ5A 2HVHA 2HNDB 1RT7B 3NFAA 4DS5A 1S1WA 3G86A 4J9SA 4K4ZA 3QLHB 1CSJA 4IDKA 1CZ9A 1U47A 4FK4A 3KKRA 3AVBA 1HQEB 4M41A 1QQCA 2ALZA 1WSIA 1S9EB 3GV7B 1VSDA 4C8MA 1ITGA 4I2QA 5KFFA 3DLBA 3HVAA 3ZSWA 4H4MB 4DTOA 3V6JA 1RNHA 4CEZA 1IKVB 3HHKA 3Q8QB 3OJUA 2KW4A 5EUHA 5KT7A 3MR2A 3DLGB 3RMAA 2R8JA 4MQ3A 1IKWA 4FJLA 4DTJA 5F8GA 4O3NA 3H4DA 3MFIA 3DLGA 4JS4A 2HNYB 1IKWB 3VQDA 2RDIA 3D45A 1NJXA 1VSLA 3MR3A 1VSHA 3O3GA 1S0NA 2UUTA 4MK9A 3MEEA 3AO1A 4OKKA 3RBDA 2Y1JA 4M3ZA 4J2EA 3TAFA 2ZE2B 3M8QA 2JLEA 2XGQA 3AA3A 4ECTA 1RDBA 2X78A 4M95A 2OYQA 1S1XA 4E7IA 3VQ7A 1WNSA 3RR8A 3KD1E 3LZJA 4IFVA 1S1TB 3HVTB 4CE9A 1HYSB 3EYZA 3CVKA 4W5NA 3BREA 4EBCA 4FJ7A 4B9SA 2IM2A 1KTQA 1T05A 3TABA 4KO0A 3L3UA 4I2PA 3MFHA 4DG1A 2WOMA 4EZ9A 3I8DA 5KT3A 3NGDA 2IMWP 1UA0A 4FM2A 3PZPA 5KG1A 2E6MA 3KK1B 4O44A 3LALA 2CKWA 2QE5A 2RN2A 3LAKA 3OYBA 4WFYA 1GX5A 1RT2A 3HPGA 3IG1A 3M9OB 5J1EA 4ECQA 4PUOB 1SL0A 2OPQA 5JS1A 3SUPA 4H8KA 2R8GA 3ZSVA 1ZBUA 4NLWA 3NHGA 4TQRA 3KLGB 3RB4A 3PY8A 1HQUA 4URSA 2F96A 1NKCA 3PO5A 4O4RA 3H5XA 4NCGB 4XPCA 3WNEA 1J53A 1BQNB 3PVXA 4EBDA 2XY8A 1HQEA 4RNFA 2YV0X 1CXQA 1R0AB 3FQLA 1LWEB 1HMVA 1L3TA 1WSEA 5E41A 1KRPA 3PX0A 2XY7A 1C1BA 4M42A 2OPRB 2UVRA 4IH6A 4MIBA 1YVUA 1QE1A 2D0BA 2VWKA 4M3WA 4ZVEA 3SPYA 1DLOA 2VG7B 4WE1A 1RT4A 3CM6A 4OGEA 2ATLA 1RT4B 4JRPA 1L3SA 1NJWA 3PUFA 5JS2A 5EWEA 1F21A 4B8CA 1S0MA 4Z4GA 4MFBA 1JLQB 1S6PB 4Z4CA 5J2MA 3ZSYA 2HNZB 2W8LA 4KHRA 2ZE2A 4EBEA 3B6OA 5HRRA 2P5GA 3TAMA 3NH2A 1DTQA 4FZZA 4KSEB 2F8SA 4PWDB 3BDPA 2IDOA 3BSCA 4NZ0A 4ZP8A 4MH8A 3MF5A 1TKZB 3AVJA 4DU1A 3DM2B 4MKAA 4ICLB 4KFBB 1N6QA 2FBVA 4O3PA 3GYNA 4ICLA 5J2MB 2DFFA 4ZVHA 4K4TA 1VSEA 3PW7A 4IFYA 1VSFA 4FJMA 3KHLA 4CFDA 1TGOA 4RNHA 5T14A 2DPIA 4IOBA 4KV8A 5DLFA 4DL6A 4GW6A 1TK8A 5F8LA 4TN2A 3RR7A 3DRRB 4B08A 4BDZA 3NGYA 4C8OA 4CEQA 2V9WA 3JSMB 3RMDA 4AHCA 3V81B 4K4UA 3LP0A 4CJ5A 2B6AA 1ZTWA 3H5UA 4DL3A 3K58A 4E7KA 2P5OA 2DFHA 3V9XA 1J5OB 4CK2A 4HTUA 1NK4A 1TVRA 2BANB 4NLRA 1TL1B 1TV6B 4NLTA 1TAUA 3OYDA 1RT6B 1TL1A 2B5JA 1S0OA 3AVCA 4DQSA 2ITGA 3OYKA 1RT6A 2B5JB 4KB0A 5J2PA 4NLUA 4CEBA 3P83D 1ASWA 4DQQA 2BE2B 2HWHA 1KHWA 3CYMA 3OSNA 4O0JA 1O1WA 4IR9A 1C1CB 4NLQA 4CGIA 3AVGA 3CFPA 3SQ0A 2C2RA 4IBNA 1UWBB 3M9NB 1SL1A 5EWFA 1CXUA 3K5OA 4HUEA 1T03B 2WTFA 1QSYA 2VA2A 2DFEA 3LWMA 1JLAB 5KT6A 1U45A 3FQKA 4Y1CA 3QIOA 4IKAA 3T5KA 4FLUA 2XRIA 4ECVA 5KGWA 2QKBA 3PX4A 3BSOA 3QGIA 1G15A 2IBKA 4FBUA 3P1GA 1JXBA 3THVA 2W9BA 3DDKA 5C25B 4DFMA 4OVLA 3SUOA 2HMIB 4LSNB 3K5MA 4E7JA 1U09A 2W9BB 4WZMA 2B4JA 4I7FA 4PWDA 4URQU 1JLCA 1VK0A 4KHSA 4BACA 4FJNA 1TKDA 2RPIA 3HP6A 5KI6A 3HJFA 4DL4A 1IH7A 4C8LA 3SFGA 4J2AA 4Q0BA 3QNOA 3VQQA 4HUGA 3ZCMA 1JKHA 2HMIA 5I42A 4QWBA 1JLFB 1HPZB 1B92A 4CCHA 3AO2A 1D9DA 4ED2A 3ZSRA 3TWHA 3MXMA 1WSGA 3GIJA 4CK1A 4F2RA 2O5DA 3KIOA 1VRTB 5C42B 1QHTA 3AVFA 4Y34A 2FJVA 2BQRA 3E01A 4N41A 2X74A 5KG0A 4IRDA 3QEWA 3KLEB 3AO4A 2R8IA 5KFEA 2FVSA 1JLBB 3VN5A 5F8IA 1VRUA 1FK9B 5J2NA 2LSNA 1LW2A 4NLDA 1VRUB 3SZ2A 4EZ6A 3TARA 3B6PA 4LQ9A 3ZT2A 4RU9A 2QKKA 2F8TA 5KG4A 4FVMA 3VQ9A 4B9LA 4AH9A 4F4YA 3DI6A 1XR5A 1BI4B 3D0PA 1S9GA 3JYTA 1S4FA 4NLXA 5KFUA 1JLEA 4HHTA 3MEDB 3DRPA 3OYIA 4AHRA 5K14B 1LW2B 3DOLA 3SV4A 3MXIA 4CJUA 4Q45A 5DG9A 3ICLA 3AO5A 3VQEA 1L5UA 4J9QA 4QWEA 3I0SA 4DTSA 5KFSA 1N56A 1FKOA 4RW8B 1JLGA 4BE1A 1IO2A 3PO4A 3SQ2A 4RW9B 1SH2A 2YHAA 1HARA 3KOAA 4RW9A 4CF0A 4N56A 3QZ8A 4QCLA 1K6YA 2VG6B 4WXOA 3CO9A 3PJXA 3K5LA 1HNIB 3QEVA 4F3OA 4CK3A 1FKOB 2BR0A 4FJGA 1RBTA 1BL3A 3LDSA 5C5JA 5JUMA 3TQ1A 4CEDA 2D3UA 5KFBA 1RT3B 4IRKA 3RWUA 3EPIA 3KMQA 3PJWA 3A2FA 3M8PA 2AX1A 4K4VA 3OYNA 1TKTB 4RUCA 3QNNA 3CWJA 5FRMA 4Q44A 2YNFB 5HRSA 3DYAA 4KREA 1S1WB 1S1UA 1OS5A 3V9UA 3BGRB 3VQ8A 4J2DA 5KFVA 1RT3A 3V6KA 1RT5B 4NYZA 2OPSA 2P51A 3TAGA 2ILYA 3VQ6A 1I3AA 1RA6A 2JEGA 4KRFA 3MECB 4FJKA 2R7YA 4H4MA 1GOBA 4TQSA 1IKVA 1RBUA 4ZHRB
chains in the Genus database with same CATH superfamily
1WC5A 2BBEA 1MA9B 3LP2B 4DTPA 4EI2A 1NHKL 2RUSA 1XN9A 1FK9A 1SVDA 3O4WA 2HGNA 4HCCA 4CJRA 4RW6A 5D15A 1YTAA 1VLYA 1VSJA 2W7AA 2C28A 1BI4A 1YWXA 2VBZA 3F73A 3M32B 3L6QA 5KFOA 4R79A 3SBTA 2C42A 3FBFA 3ZTRA 4PG7A 3MM7A 3VF0B 4KY3A 3I0SB 3PNIA 2GJ2A 3W66A 3U3YA 5KRTA 3THYB 3T3FA 1D0EA 4WF9Q 3L3VA 2DGWA 1XK8A 4OI3A 3EJMA 1HYSA 3TTDA 2CWXA 4F4AA 1CPZA 4JNEA 1YZ6A 1WAJA 1W2IA 2ERRA 1FCAA 2UV8G 3KK2B 4JD2B 3KZBA 3CUNA 3CO0P 4PUOA 5BPLA 3MHYA 3H45C 1KC8O 5EWGA 3PYDA 3QSIA 4JI8J 3KNAA 1K73O 4DV6J 3R2DJ 3MM8A 5F9LA 3GMGA 2UUAK 3D2FA 5AZJB 1ZZNA 5HL7Q 3VEOA 2A5XA 5HSPA 2BRLA 1SKRA 2H4WB 3KK3B 3TTCA 3JSBA 1RWOB 5GAGP 4IYQA 3PR5B 3NH0A 4WTYA 2LQBA 2YKQA 2VUGA 3UD5A 1WACA 1RTIA 3MCOA 1QAIA 4Z0UA 4DTRA 3RMCA 4YMEA 5AR0A 5HQ8A 3VQAA 1NHVA 3OBYA 1OO0B 4L3NA 2EX3A 2VPWB 4QPXA 3CCUS 2K8GA 4GKKJ 4FOEA 3PKYA 1S9EA 3K9KA 5JLFA 1YBUA 1OYDA 3NAEA 2DNPA 1HBOA 4QIVA 1O13A 1U26A 4PG4A 4OYBA 4YHHF 2P9GA 4A5AA 4XTTA 3KXDA 4AL5A 3EPGA 4B3SF 3IWXA 3MPUB 2QV6A 2JLGA 5D3GA 1SH0A 1FXDA 3BJYA 4LMZA 4Z37A 3QWUA 1YBAA 4UY85 4B1WB 2RT3A 2VQFF 2W40A 4M3YA 5A8RA 3UKRA 5L1IA 5KAKA 1C1AA 2DGVA 1REVB 4JI7F 3Q8UA 3TAMB 3TOQA 2PMZD 4FLTA 1N36F 1B9DA 4XO0A 4E0DA 4LREA 2D74B 2HHSA 4F8RA 4Q8FA 4OI1A 2QX0A 2O8EB 1U24A 2WB1D 1Z2ZA 2O3DA 1OPIA 3CT9A 3MCSA 2XSJB 3AGKA 3VQ4A 4M3UA 3AD8C 2W2NP 1JLQA 3KK1A 1M5KC 3HSJA 1U8SA 5IWAJ 1C6VA 4KO0B 2D0CA 1N52B 4MYTA 3QGHA 4KHPK 4F9OA 2R9LA 3PSIA 2OD4A 2YKMB 2EK1A 3HHLC 1TZ0A 5DZ7A 2IHR1 1IM4A 4RNNA 2B6AB 1S6QA 3NGRA 3HHLD 3D6RA 1HRHA 2OLWA 2WVDA 1TV6A 1HNVA 5AQHA 4QYRA 3FSXA 1RT2B 2IJNA 2QWOA 5J1PA 2YI1A 1RWWB 2V34A 3UFCX 2E9TA 5D6GA 4L8RB 3OL8A 3QPIA 1RWNB 3NEKA 2FGOA 1EARA 1EZZB 3H5YA 4BRKA 3ISND 4NLSA 3CCWA 4CGDA 4CI0B 1NGFA 3IAYA 4JI2K 5KFTA 2ZOFA 2DRAA 3U6FA 3KLIB 3GONA 2FHJD 2O01C 4CBWA 4QYZK 3CCZA 1RDUA 3OYGA 4NLYA 4BY9C 2HWIA 2FVRA 5AQKA 4W5OA 5CZ1A 4FYDA 3BR9A 3CETA 1DQAA 3QJJA 4AM6A 1C4AA 4W5RA 1Z6RA 3HK2A 1WN7A 3KYLA 2VBYA 3H3NO 3KMSA 4BRIA 3AQPA 2P9IB 4MLHA 3RAQA 4X4TA 2NCKL 3QINA 4JI6J 2QN6B 1SUQA 3WXJA 3V6DA 3FBBA 4KTQA 1UETA 3V6DB 3VOVA 4M3RA 2QC3A 2AJFE 4Y3CA 4DFPA 3VQPA 4ZPCA 3SUNA 4U6PA 4UF4A 2ZNYA 2VU5A 2A3JA 1NJZA 4DV0F 2V6AA 1Y3JA 3FUYA 2IVYA 3TI0A 1J5OA 1WORA 2FHOB 1Q53A 4PY5A 1RBRA 4F3MA 3I0RA 4BS2A 1X4BA 2HSEB 2EKNA 2HIQA 2E5IA 4E19A 4JI4K 3MM5B 1M90T 1XNQJ 3DOKB 1HHTP 5JICA 1C2PA 3LP0B 2YXLA 4FS2A 3MM5A 3ENOA 4FL9A 5AQIA 3JB9k 2QXLA 2DITA 4E1NA 1XC9A 4C6AA 4QW8A 1CZAN 1S9GB 3JYTB 3CDBA 3DRXA 4RUBA 2GV9A 2C2MB 1KOHA 1IBCB 3KLEA 2LQ5A 3M1FA 4Y6IA 5IXUA 1RHRB 2MQNA 1XMQK 1LWFB 2EFQA 4EYIB 3VEXA 3D1OA 2VG6A 3QERA 2X6NA 2UXBF 1NM1A 3JQJA 1XMOF 3NNAA 5KT5A 4URGA 2G13A 2VC0A 3R1XA 5BRHA 4ILLA 3QFHA 2YHYA 1JLCB 3SAFA 3GIIA 2AEJA 3ZXWA 3VENA 3BGLA 4YOYA 4EWTA 1WSRA 2XLKA 2CVEA 5DETA 4OYZA 2HGMA 2QL5B 3A8IA 2L48A 4DLEA 3UR0A 1GAOA 1HKAA 2QWQA 2VD3A 2NLWA 1CQMA 2RJZA 1J9AA 1RWKB 5EX5A 3MWBA 2GAGC 2G2OA 1F60B 4TY8A 1G7CB 1P9QC 2Z58B 3GV8B 1LEOA 4FZVA 5M1FA 3DXKA 4KHYA 1QAXA 4LFBF 2KTQA 1IJJA 1MROB 2DNMA 1TKTA 2XYPB 4RKUC 1VI7A 2F9DA 5JVHQ 4XAKA 5AQJA 3ILLA 3ZSQA 1EQ0A 3HSDA 1RDRA 2KI2A 1T8EA 1FRIA 4FJIA 5CYQA 3QATA 3SSRA 4CJKA 1K8AT 3KD5E 1HHQA 3QIPB 2PN6A 1KKHA 1VRQC 2JJ4D 3QWPA 2E9ZA 2A1SA 1TUGB 3DOMB 5GADP 5GADU 3A12A 5HLFB 3TU5A 2I5JB 4OI0A 3GPAA 4DSJA 3SCIE 2QWNA 2CJYB 3A5MC 2ZH6A 4FPAA 5BN8A 5BRDA 4YB6A 4DTNA 3PACA 2PYJA 3OL7A 4CM0A 2CJQA 3AAPA 4F3QA 3FEZA 4A8KA 4LF8J 2FVPA 1M5HA 1KVBA 1WNEA 3EE9A 4ZVFA 3HO1A 3PEHA 1YIJN 4MKYA 4OX6A 2NUHA 4Y2IA 4USVA 1YRTA 1RBLA 4O4GB 5ETSA 3QMQA 2B4UA 3N6MA 2FXUA 3L2WA 4D3GA 2JDJA 1K8KA 3ZEUB 3I56N 5KFAA 1TKXA 1K8KB 1NGBA 2QM1A 2RF2A 2ZD1A 1GOAA 3M8QB 2FSNA 3E51A 1R89A 4USWA 2BQ3A 2G1DA 3DLKA 2GV1A 2QEXS 1Q86T 1EWRA 3EE8A 4C11B 2FVCA 4ZTJA 2VBWA 4KHMA 1RSCA 1IBLK 4Y28C 1E4GT 3WNFA 3LPEA 3CC4S 1JCEA 1IR2A 3M8PB 3QEPA 2UV8A 3D2FB 2FJBB 3JTOA 4DUYK 4DUTA 5EDWA 4DLGA 3ILJA 4DR5J 2NSBA 3VTHA 3MCMA 4HUFA 4LSZB 2WTUA 1PO6A 2I38A 4CHZA 1U49A 3K7RA 3PCOB 2BOAA 2LKZA 4JV5F 4KHWA 4QIEA 3EKUA 3BPDA 2F65A 1HW9A 2V69A 1K47A 3IAM9 2ZBRA 2KJVA 1S49A 3ENAA 1WWHA 2DRBA 3T6BA 2FJXA 5GIOA 3CCVN 4EU0A 4Z2XA 5BXIA 4FXWA 4O5BA 2CXEA 2D0AA 4Y00A 4NLCA 1VQMN 4NLOA 1S6OA 5HQLA 2ZZTA 2Z8QA 3BKUA 4OX9J 2PY5A 2VYPA 2CGJA 1H38A 3CCLN 2A2CA 4FZXC 4X64J 4W5QA 4YOVA 4NXNK 3UPFA 3Q22A 5AZIA 4OJRA 4EP4A 1BCOA 4DPYA 2HK2A 4ZN1A 2AU0A 1NGIA 2NZ4A 5B0BA 1SKWA 2GHWA 2OSQA 2ZHBA 1I1GA 1N4LA 4KAIA 3OYHA 5DM7L 1XR6A 2Y8WA 4OV1A 5F41A 3DRSA 2W9CA 4P2XA 4AHUA 3LM9A 4EHUA 4LFBJ 5D3GB 1NKBA 4CLFA 3K5NA 2W9CB 1QDUB 1DY3A 1NK8A 3D6FB 3VWSA 2B9EA 4CZEA 4CERA 4NA3A 4JV1A 3HZEA 4YOWA 3VAJA 1NCLA 3R7NB 4X65J 3AHPA 3DWLA 1RHQB 1RDWX 4CO0A 3SBMA 5GAEU 3MTJA 4ZLPA 2UP1A 1WJ9A 1PJ5A 3OW2R 4K8ZA 3IWNC 1FDAA 4ZJOA 2DHSA 3RBZA 3RG6A 4ECYA 1I3OB 1R8CA 1AB8A 1S59A 3H1VX 2OGUA 4P73A 5SUHA 4M45A 2HF4A 1M1KT 1QVFM 5H9EK 3MUTP 2J7WA 4H0YB 3BBBA 5CD4A 3UR3C 5DS7A 1UFKA 2IDLA 4GMJB 4I68A 1K8AO 3J8AA 1LKZA 4S0MA 4R8UA 5J2QA 3D28A 1CJTA 3UQSA 2ASJA 4YY3K 5BYRA 1IVZA 2R7VA 2YNHB 5T7BA 4FF2A 3P49B 1TUUA 4K2XA 1DTTA 4ZLLA 5FPDA 2Q0UA 3D2EA 2Y1IA 4J9UE 2V2QA 1UZDA 3WNGA 4CJWA 4G1IA 2RQKA 2YHBA 1NH7A 3AVAA 4Z4IA 1KONA 2ZC3A 4TYAA 4LF9F 4LH4A 3BPSP 2HWTA 4QS9A 4BGAA 3T1AA 2ZWOA 3IR7B 4KTWA 2XY5A 2ZOGA 3Q89A 2ZUGA 1S5ZA 3F9KA 3OHBA 3ZFVA 2KT2A 3CJ5A 3GR0A 3VAMA 2CH5A 1VC5A 5AQXA 2Z1GA 2ZH9A 2V2KA 3AVLA 4LH5A 4BLGA 5GIPA 4I64A 3CCES 2BDPA 2J0QD 3OFHA 4HI1A 3S6EA 3PLAA 4KB7A 1CJKA 4MFBB 4ID8A 4PQUB 1B0PA 1S48A 3TNVA 1HWJA 4C97A 1IR1A 1FKPA 4F02A 4IO9L 4LF9J 3KLVA 1YVNA 1RBOB 4JI3F 2O1PA 4K4XA 2FLOA 1FVQA 4JI8F 4TU9A 4BG8A 2D3ZA 1ZBIA 5CR4A 4GC7A 4PQUA 2FSJA 3NOGA 1H3DA 2EC0A 3GIRA 2V7ZA 3C16A 1NRKA 2HS3A 1FHTA 5IZHA 3H46O 2Z1IA 2BE2A 3CIMA 2AQ4A 1A5XA 4CF2A 4J9PA 5C0YA 4ECRA 1IBKJ 1YITS 3OLBA 1ZPVA 3D9BA 4U67L 1REGX 3R1HA 4CGHA 1KNZA 3OR2B 3V9SA 5I3UB 4MK8A 3BZQA 2BJEA 5I3UA 1TVRB 2WRMA 2KQ2A 3MN7A 4V1Ak 3MD1A 2M7SA 1MU2B 5BR8J 1C0UA 2OELA 3PR4A 2IAJA 2V8GA 3NH1A 2UU9K 2G8FA 2IAJB 3RW6A 2HB5A 2LCWA 3L2UA 2L3MA 2ALYB 4YFUA 1HNIA 3TX8A 3G9CA 1SUQB 1VR6A 2I0XA 4RWTA 3VQBA 3NGZA 3FGUA 2XMTA 3H3OB 3T1HK 2AT1B 3J7ZO 3W1YC 1R8AA 1NB2A 3WHIA 2V8PA 2HFOA 2QTWA 5ETKA 5GMDA 4KHNA 4BR9A 2XCPA 1FWLA 4WFZA 3ZTQA 2Z57B 5IFMA 4EP5A 2HBYB 2YWKA 3BQ1A 3M30B 1X9MA 3QIPA 3FBCA 1U0HB 1C0MA 4OPHA 1WOQA 2WFBA 5B09A 4CDIA 1NU0A 3JSYA 4ZKAA 3TJ9A 3NAHA 1LW0B 1ZM2A 4TNOA 3KFWX 1AXQA 3QFPA 1IM6A 1BOTO 4YUDA 3THXA 4KGKA 1W2BR 3AA2A 4CF8A 3J80U 2ZHAA 4LUBA 4N76A 4JOUA 2HVEA 3EZUA 1VQ8S 3K17A 2C2DA 4PYDA 4AM7A 2HS4A 2IYIA 1U02A 3T1YK 3AXKA 4BRFA 1UAXA 5DLGA 4GKKK 4DUZK 4CHPA 1Q5YA 5CY4A 2UUWA 4ZDNA 2GX8A 2U1AA 4PPDA 5LL6Z 4JKCA 4J90A 2VPYB 4PRFA 1S0VA 4C7QA 1NK6A 5LMUJ 2ETJA 4C9DA 4IUFA 2AYMA 3MMCB 2HHVA 4NXMJ 4ZMMA 2OIHA 2VGMA 3O9SA 2I9SA 4EO8A 3FFIB 2YJFA 1CJUA 2DGUA 1PKUA 2R2SA 3P3DA 4MK7A 1EIYB 4DMNA 5IWAK 2P9CA 5AJ3K 2ACMA 4LFCK 4BWMA 4DJBA 2KHCA 3BGUA 4EUVA 3JQMA 3NBPB 1NUEA 1WD6A 2EPIA 5C24A 3CMAS 1FO1A 3N6NA 3UE5A 3KLHA 5HROA 2AJQA 3O6QA 1S1UB 3CC7S 5DK5A 3G6ES 4A57A 3F56A 2DB1A 2RKIB 1PBAA 4ZA1A 5FLXY 2P9SB 2N7YA 1HBUB 3VEZA 1B0TA 3GG4A 9RUBA 4N5SA 5ETLA 4ZVUB 1Q7YO 2BKNA 1OIAA 4H0TB 3UD3P 4BREA 4BDYA 5HROB 4UY8O 2LECA 2D9PA 1LFPA 3EN9A 3NY0A 4KR0B 1X31C 3BUZB 3Q23A 4IRCA 2NXUA 2OUGA 3IRWP 3AVIA 4DOZA 3H8YA 4EFAC 2AP1A 3QZ7A 4ZLJA 6FDRA 3EGNA 1WSHA 3RRGA 2QMXA 5GAGU 3BH7B 2HNDB 2W4DA 1B99A 3G86A 4R0JA 2O8CB 3QLHB 4FK4A 1HQEB 3IFRA 2ALZA 1S9EB 1UFLA 3SEOA 4C8MA 1VYAA 3QT5A 3DLBA 1UVJA 2GEMA 4DTOA 1HA1A 3V6JA 3GOIA 1NLVA 1RHUB 1IKVB 3OJUA 3O6WA 1ICEB 1R8HA 5KT7A 3MR2A 3HJVA 2E2PA 4BRNA 4O3NA 1IKWB 3OTOJ 2A1BA 2RDIA 3RRKA 3R3TA 3QSYB 3MMCA 1VHIA 1N0VC 3GL1A 2UUTA 3R7BB 3AO1A 3MEEA 2PDAA 4OKKA 4WK1A 2VKZG 1NMDA 3G4SS 2P9PA 5GAGI 1XERA 3AA3A 4ECTA 4M95A 4JI3K 1CJUB 4WQ5C 1S1XA 3N5BA 1OSCA 1VMBA 1WNSA 4DV0J 3RR8A 3R8EA 2IFXA 3HVTB 3NRBA 4JKGA 2ADBA 1JCFA 3BREA 3OXFA 5GVQA 4FJ7A 4C48A 2IM2A 3CCRS 3TABA 4KO0A 4H0XB 5HQMA 4I2PA 3FZKA 1H1VA 2KM8C 2J9CA 3WT0A 5CXTA 3CJSA 3I8DA 3NGDA 2MSTA 4LT6A 2E5LF 4U9RA 5KG1A 2Z2ZA 4HT5A 2QE5A 3GSIA 4JYAJ 4LF8K 2MY8A 5J1EA 5RUBA 1SL0A 4H8KA 2R8GA 2KLAA 1NAQA 1DRZA 2CGLA 3NHGA 4N7TA 1G1XA 3PY8A 4FNIA 1LK5A 1KDNA 3ZNJ1 2W2MP 3H5XA 2HBRB 3C65A 1J53A 4A8OA 3PVXA 2XY8A 3PRVA 2YV0X 4CLKA 3W2VA 1HMVA 3CCLS 4OYXA 5E41A 4WFAQ 1U2VB 1C1BA 2UVRA 1VQMS 5HOOA 4M3WA 2DIUA 2K7JA 2VG7B 1RACB 1X4AA 3WXIA 3MM9B 3PUFA 3M6VA 4C8YA 3NXZA 4JI1J 5EWEA 1S0MA 2PMWA 4WBFA 1S6PB 3CMQA 3QMLA 3W64A 4ZVOB 2E1RA 3OR1B 1RBAA 1SC6A 1IN0A 3OTOF 2IDOA 5EOYA 4NZ0A 4USTA 3AAQA 8RUCA 2MPUA 1RABB 3DM2B 4EAHD 2O8EA 4MKAA 1N36K 1NNEA 3PG9A 3TA2A 4ZVHA 3UCUP 3OR1A 1NBEB 2D3OR 4OYMA 3RAMA 1ZM9A 2BM1A 5DLFA 9ATCB 3GE9A 4DL6A 2Q36A 1WKLA 5L9NA 2ZDOA 5LT5A 3DRRB 3SK3A 4KGXB 1VC6A 4DV2J 3NGYA 3JSMB 3PIOQ 3RMDA 4AHCA 3V81B 3MMAA 4K4UA 3I6PA 1ZTWA 4FKYA 2R7OA 1X4GA 4E7KA 3WXLA 3V9XA 1NK4A 2K2PA 4NPOA 3C19A 2B5JA 1N34F 3GYXB 1IBKF 4M5HA 4DQSA 2B5JB 5IT0A 2VDHA 2HHHK 4Y0FA 1WI6A 1K73T 3KJNB 4KT0C 4JI5K 4IXCA 3AVGA 3SQ0A 2C1EB 1U25A 2MQPA 2C2RA 4IBNA 4USMA 5CQGA 1NZAA 2KYZA 1CXUA 4BQLA 2VZ9A 4HUEA 2WTFA 4BR2A 2NRHA 5MLCV 4DMZA 3QIOA 2GX9A 1V5IB 4ECVA 2JWKA 3UW1A 2QKBA 1XMQJ 1B4SA 4Z7CA 3U9ZA 3PDNA 2KL8A 1JXBA 3OTEA 2W9BA 2VQEF 5C25B 3HM8A 2V4JB 1MMDA 3MURP 1D3WA 1N36J 2GMJA 1N32J 1KQKA 2GWJA 3HP6A 1W26A 2E20A 5KI6A 4DL4A 2CWKA 2EFGA 4DX6A 1EO1A 1RWXB 3C16B 4HUGA 3ZCMA 2QYGA 2YWGA 1HWIA 1JJ2M 1E6YA 4QWBA 1WDDA 1VHFA 2KB2A 1J6ZA 3AO2A 1WTFA 1CBKA 4IWVA 2Z2LA 3DCAA 4F2RA 1BD6A 4JKFA 3KIOA 4KH1B 1QHTA 5C42B 2WVFA 4P2FA 3THXB 1QQOA 3IR5B 2BQRA 3SJHA 2CQ1A 3AO4A 1NGJA 1TELA 4NE9C 4ZVQB 1GLBG 2X3GA 5J2NA 4J8FA 1LW2A 2NZCA 1FVSA 4RU9A 4DR1K 3VZIA 2BW7A 4HL9A 4JI7K 3MPYA 3CC2S 3VQ9A 1UCNA 4B9LA 5AQWA 1VLOA 1XR5A 5G0RA 1S9GA 3JYTA 1S4FA 4NLXA 1JLEA 3N28A 4OJ1A 5H9EJ 3A8YA 3BS9A 2DXEA 2E8AA 1NXIA 5ADZA 4Q45A 4CZHA 1PYOB 3VQEA 2P9EA 4QWEA 3A5LC 3IDHA 1XNRJ 1FKOA 4DV6F 2NQPA 1H7XA 2WC9A 4RW9B 3CJ8A 2YHAA 3WXKA 3BN7A 2FGCA 1S22A 3KOAA 5E3CA 1GXLA 2RU3A 4F25A 1N8RO 4WXOA 3UCGA 4CLSA 4X4SA 3CJAA 1IWAA 4FJGA 4DV4J 5DDRC 4IOAQ 2OP5A 3W61A 3LDSA 5JUMA 3TQ1A 4I1TA 2V50A 4RCHA 2HZVA 1HI8A 2QSWA 4BC4A 3M2VA 3DC2A 2BX6A 3RWUA 5BJRA 1WTBA 2N82B 3KMQA 3PJWA 1TKTB 1V9OA 1X9JA 2YNFB 4GKJJ 1UP1A 2RD5C 3OBIA 1WUAA 3VPZA 1RT3A 4X4QA 4CZLA 2QO3A 3W63A 3SQOP 1PSDA 2IRUA 1I3AA 1MWZA 4JYAF 5KPTA 2N3LA 2VPZB 4I6WA 1WEXA 5F3ZA 3UDEA 4FJKA 3VR1A 1WG1A 1IKVA 2OJ3A 5A0YA 3BQ2A 2OPSB 5DM6Q 4EEYA 4WCEL 1RDAA 2KJWA 4W92B 2GHPA 3EO3A 2FZKB 1AFJA 2V4RA 2P9PB 2NXEA 2MKIA 3HVWA 2W8KA 2OKQA 3FMWA 1H72C 3UO0A 2EBEA 2LQJA 3W3DA 4JEPA 3TSPA 5HP1A 1KCFA 1M90O 2E1CA 4NLBA 2ASPA 3KJVA 1S10A 2QK9A 2XLIA 1NK0A 4HACA 3EVMA 4OGCA 3OTDA 3UKUB 2VDIA 1U8WA 2W25A 5D0EA 2RKIA 1IKXA 4CIEA 3G4SN 4B9UA 4DR4K 1HNXK 1N33J 3TO8A 2I2YA 2JEIA 3ZT1A 3GFZA 2UUBF 3LOUA 3DJCA 1PBUA 1RHMB 1HW8A 1DFDA 4DR3F 4FP9A 1XJWB 3OL9A 4TU7A 2APOA 4LRCA 4C98A 5AZJA 2V63A 1IUJA 3TR8A 1S1TA 2UZAA 4CBUA 2DKOB 2YKNB 1IBKK 4RBTA 4RW4A 2MEWA 3LDPA 5E33A 2WVCA 2RF2B 2GWKA 3NF9A 1FRXA 1BXNA 3CQXA 2JEJA 3EX7B 4KH6A 4QWAA 1F9FA 4X4PA 1RZMA 3HSTB 2R8KA 2QSFA 3DLRA 2DH8A 2EFPA 1KTVA 2AX0A 5I3QA 2QZ8A 2A1RA 2MKSA 1GOCA 3CMEN 3BV8A 4CVNE 3MZIA 2HVIA 1UVIA 5F8HA 3S3NA 1TAQA 2DHGA 1P27B 1SJ4P 2NLXA 4ZJQA 3EL2A 1RT7A 4FF1A 1BUPA 4IDKB 3A4TA 2WSCC 1HNWK 4L6V3 2HPUA 3J7YU 1HBOB 3I9V9 2D7SA 4QPTA 3O1WA 1QE1B 3KLGA 1LNQA 2OZMA 4JK8A 3H5SA 1BQNA 3GTYX 4N8NA 3TEHB 1NDCA 1X4HA 3PYEA 4DF4A 2GTDA 3W7BA 1QSSA 1FJCA 4HTJA 5CA5A 2AYBA 2VGNA 3MMJA 5AQVA 2FZCB 5DGAA 5KFCA 4PXCA 2MYFA 5KFDA 5AQGA 5GMKa 4LRFA 3M1VA 1JXEA 2E1ZA 1N5QA 2XWXA 1P8ZA 3Q2TC 1W0HA 2PZSA 2CQCA 1W97L 1NGCA 1Y3KA 3GWCA 4DR6K 5SWMA 1RADB 1IKXB 4ZCMA 1WEYA 2NPIA 4QOTA 1UVLA 4I67A 3RGIA 2A41A 4V19J 4QR2A 4DV4K 2IPOB 1B70B 1YLXA 2DBBA 2YY3A 1U04A 4B02A 2VB6A 2LMIA 4LF7K 5ITHA 2AJ2A 4X62K 4LQ3A 1LV5A 4Q43A 3THTA 5J1EB 2GCFA 1J54A 1Y5IB 1YG0A 1W25A 4DBQA 2BYCA 3OUYB 4KBIA 3KHRA 4O0IA 1CJKB 4DR2K 4HDGA 5CCMA 5THWA 1HBMA 2P9NA 2FLPA 3CD5A 3K8VA 2H4YB 4KHQA 4RUAA 4M5IA 2YCHA 4FZYA 5KG7A 2I7PA 3L09A 3HT3A 4YOTA 3EWGA 2YNHA 3FCWA 3PXGa 6FD1A 5LXYA 1RT1B 4LFAF 4ED0A 2K06A 4ED6A 2VIHA 2AYEA 2IIRA 1OY6A 1LWFA 4FYVB 5FROA 3FKBA 3OS1A 2JX2A 3AJ2A 3L95X 1D9FA 3R9LA 4P2SA 2IJFA 1ZA1B 3OXGA 2ZBIA 5L1KA 2D4WA 3R5BA 4CJEA 1NK9A 2IY5B 3ATVA 1OMSA 3FCVA 4M1KA 3IA0A 4XH5A 1MMLA 2HMPA 4YS2A 3OBWA 3FEYB 4LJMA 4OO1J 2XC9A 2AKWB 3W5ZA 1J5EJ 4H0VB 4KKOA 3B8AX 2XULA 1NOYA 1JLAA 2GJFA 1PYSB 4R5PB 1Q18A 1JNRB 1NSAA 4ECUA 2Z1JA 4C23A 1S97A 3SJJA 2JZ5A 5JXSA 3C14B 2MHEA 5K9FA 4RR5A 1X9WA 4FOIA 3EZ5A 4BR7A 2QFIA 3D66A 2YNGA 2X1GA 1TYQB 1RB0A 3CERA 5TKWA 1XEZA 4PAAA 1LXJA 5A76A 1RDDA 2XCAA 2GMHA 2QEXN 1HJRA 1F5BA 1U7LA 1QUPA 4QAGA 2VV5A 3AJDA 3I0RB 3G71N 3SUQA 2WBMA 2KKZA 2OPPB 3D2WA 3TSQA 2H65B 3I56S 3ILIA 2BJ9A 3DI6B 2DHAA 5E26A 4DV5J 3DRRA 1BG3A 4Q0BB 3GP9A 1VK3A 3PFOA 4KYZA 2HBMA 5J2NB 1ASUA 3CJ0A 3P4UB 5KFLA 4JKEA 5BREA 4OZ2A 1F5CA 3ZZRA 2XMJA 2IBOA 2F9JA 3H7HB 4K25A 1U2FA 2OPPA 2QWLA 1HHSA 3OFFA 2JC0A 2XLJA 3E1YA 1RHKB 5G0RB 1R0BG 4OLPA 3ALYA 1RWMB 4F26A 4G3IA 3BBFA 4MKVA 4DL2A 1S77D 3QGGA 4CECA 2E5LK 4ZVRB 1OQ3A 4LR8A 5HMZA 5IQ6A 1T9YA 2VPXB 1EETA 4ED4A 4QWCA 4KTZA 3TPQA 4K41A 4BRQA 4CFBA 4PR6A 3Q7BA 3HFVA 4MIWA 4ID5B 1WKJA 1WHWA 5H9FJ 2ZDPA 3ZETB 2MXYA 3RVCA 2ZJPL 2V4JA 1WG4A 2FJAB 2UUCF 3DGPA 2XGPA 3Q7CA 3K0JA 2NRZA 3CM5A 3J7AN 3DLHA 5EX3A 3HPHA 3SAHA 3IRXB 2WSFC 2ATCB 1WAFA 5IV4A 4I6MA 3BGFA 5GAHP 1KQGB 4N47A 5KFYA 5HBMA 4LC9B 1GTEA 2ZM6F 2BACA 3R5JB 3DGPB 3IRXA 5M1PA 3HDSA 2RRAA 3A8KA 4CEEA 4J9MA 3KUHA 2GHVC 5CYQB 1T95A 5SZTA 4AL6A 2OEJA 1VQ7S 4BVPA 3V4IB 3O4QA 3DXKB 3BN4A 3LANA 2PA8D 2L08A 2D1KA 3TVKA 3L4BC 3AO3A 5AQSA 1MW7A 3FK4A 2J0SD 5A6WA 1YAGA 1T6DA 2HG4A 1JLFA 1ZBFA 3LP1B 4NLVA 3JQKA 2CADA 4M5NA 3T1YF 1S1VB 3U8XA 1WUUA 2JHEA 4M7YA 2CJXB 3GE1A 2I1RA 4AE5A 4J9VA 2ZH3A 4AD6A 3O8MA 4DSIA 5D4LA 2CPDA 1Y97A 5EU7A 3BO2A 4U95A 3SCKE 3GJTB 2D41A 1XHZA 2DNNA 2B4PA 1KQFB 1SQGA 3ELHA 4C8KA 4G1QA 4BRDA 2R4FA 1B0VA 3MM7B 4Q2LA 3QEXA 3W2WA 3UWTA 3DOLB 1UWAA 1RGIA 3A13A 4DV1J 3QIDA 2CQIA 4HH0A 4AHVA 4RW8A 1TK5A 3AODA 3ITHA 1KR4A 1EQYA 4ZVGA 3CJ9A 4LF5F 5DMRA 4AXIA 2HBJA 4ZCIA 2A40A 1NBWA 1T0TV 1YRXA 3MEEB 1X4CA 1R6VA 3R8YA 1S7HA 4ELTA 1EX4A 3H59A 1TKXB 2WONA 4JI5F 4CHYA 2KN4A 2QLBB 4FPIA 4CD1A 4C0HA 2COLA 1P8GA 1S1XB 2FZGB 3MEGB 3M8RA 3LPUA 1VQ6S 5HBMB 5HRNA 3MEGA 3RAXA 1VC0A 3MOJB 4KI4A 4CH1A 1IBLF 1BCMA 3MOZA 2HNDA 2FJDB 4ANCA 2ROGA 4WQ5A 2LEBA 4CFCA 4X65F 5L46A 1U1OA 1FE0A 1M5VC 2V8DA 3KNGA 3IM8A 3P38A 4GVEA 3D7SB 1N54B 2FY1A 2P9KB 2DR6A 3N4PA 3WEEB 1IG9A 1HQ2A 2WW8A 2HRUA 1NJIT 3QLHA 4CJ4A 4K59A 1JXLA 5FRNA 2JEFA 3OW2M 1VQLN 4I2QB 2BUPA 5HP1B 2LQ9A 3DHXA 2QJ3A 2C2ZB 2RHQB 3LH2S 2WUSA 1DLOB 4NASA 4WE1B 1YBTA 2XS5A 4DKWA 2PEBA 1Q81O 4FXDA 1H2VZ 1JL1A 5JVGQ 3OHRA 5MAOA 5KRSA 2QWPA 3KHGA 4HI2A 3BO3A 5AQNA 2R2UA 1SV5B 2UVWA 4X2BA 2ATQA 2XZTB 3JSRA 4LBHA 3K9JA 2DYAA 2VQFJ 1BWEA 3WC0A 4B9MA 2JGUA 4J37A 3S1TA 3A5OC 1I5OB 3E66A 2C3OA 2PA3A 3I5AA 4J2BA 1NDLA 2BEFA 3P39A 3OY9A 3UI3A 1MMNA 3AVKA 2V2ZA 3K8WA 1AT1B 4O44B 4BCAA 1FRHA 1ZOTA 1T3NA 1EJ7L 1BQMA 3IG1B 5HANA 1XUPO 4WP8A 1HD1A 1VSKA 1HNZJ 1NHUA 4YB7A 1VHXA 4TLQA 3FDSA 2FVQA 4Y2KA 1BU6O 2AA4A 2BOPA 2VA3A 1JX4A 2WOMB 2DGOA 4KV8B 1WC6A 5LJ3Y 1BIUA 3KK3A 1KOOA 1X7VA 1SS6A 1NGDA 8ATCB 2MKKA 4FJ8A 3GZ7A 4PKHA 2BA9A 3QYYA 4WU3A 5K20B 2IGIA 4X66K 2XG8A 4M5DA 3TW0A 4LFCF 1T9UA 1I94J 3B6BA 4TSXA 2GELA 2I8EA 2DH9A 4UY8T 4CO2A 4LF6F 3G71S 3DLJA 5C7PA 4DQ8A 5HO4A 1REVA 3GFHA 1QUVA 2HF3A 3C6HA 2CZ9A 4F0HA 4JKDA 3L2QA 4ALZA 2KKHA 3N79A 1IJEB 2HOEA 2W6LA 1ZS6A 3TR5A 2ASOA 3L3CA 2MB0B 1DTTB 2HZAA 4HVJA 1KVJA 1N6QB 3IAS9 1MDUB 5B0FA 1S5JA 1U6BA 5B0DA 1PG5B 2R3VA 2FBYA 2MQMA 1QZ5A 1FX2A 5KG3A 4CLZA 2HFZA 5ETQA 1FKPB 1SL2A 2W9AA 1RYSA 2Q3PA 4CFAA 4CZMA 1Y5NB 3ZNUA 4MMOA 2ZQBA 5T7LA 3W0LA 2J0WA 3Q8SB 3DM2A 3HHDA 2O8DB 3MPVA 2AGOA 2FBTA 3VAGA 2CNLB 3M5RA 1BA1A 2O4GA 4FWKA 2GA7A 1LAWA 5K5MA 3TAEA 1I6JA 4CRJA 1YKWA 5B8HA 2ROEA 4FS1A 5L1LA 1BHLA 4HR2A 4OHVA 2R7WA 3FFKB 4NWBA 2B7BB 1GNKA 4FJHA 2UUAJ 2OTJS 4CO4A 2KHOA 2DJWA 2ASLA 3CTRA 1SJ1A 3NCRA 1WC3A 1EAYC 3BZCA 2ZZMA 4NEZA 2DXFA 4FK2A 1ESVA 1VIOA 1DEJA 1TUWA 3CB4A 3VQ5A 3CSKA 5E3QA 2EFNA 3EMTA 2O4IA 1IKYB 4GO5X 1ULRA 3K2PA 3JTNA 2Y1RI 1WG5A 4WZQA 4IO1A 3HXMA 3UN3A 4CH0S 5C10A 4XH4A 1V4TA 2ROPA 2ZZNA 5B08A 1JLGB 5DRKA 5KQ8A 2HEKA 1NEEA 4ATNA 4DSFA 2EWSA 1GXUA 1N5YB 5F0WA 4KHUA 5C2FA 2D0PA 2PFDA 1V5VA 3HX9A 3EE3A 3PM9A 3OL6A 1H6KX 1T94A 3TYTA 2YX6A 3FZLA 3THWA 3NOCA 2K1RB 3NMAA 4F4ZA 3NGTA 2WBNA 2Y0BB 4YOUA 1X5PA 2KZMA 1S99A 2XO7A 1Z1ZA 4DV5F 1IWGA 3I5CA 4ED8A 3T1YJ 1HPZA 3R27A 1FJGJ 3HHEA 4DV7K 2Z56B 3HHLA 4IG3B 3GU0A 2HHXA 1RXOB 3BP8A 4NLGA 1Y10A 4AHTA 3KJFB 1CQNA 2DTJA 4I0WA 5KFPA 4X4VA 1XQIA 4KE5A 2ZJPQ 4X64K 1AUSL 1DAXA 2MDAA 5AQRA 2J7UA 4FYXB 4UUXA 2R2RA 1YJVA 1Q7LB 5JMNA 5KFHA 4DR6F 3W65A 3FRYA 3ET6A 4E8UA 1Z25A 5AQZA 4QU7A 4DR7J 2UXCJ 2CPYA 1CLQA 3US5A 3SMPA 4F67A 4CT9A 1Q8BA 1RYRA 1VRTA 1HNWJ 3CJQA 3ZZYA 4FJJA 5K8PA 1ZM4A 1KSPA 4ISEA 3TA1A 1B9FA 2OO4A 3C6AA 2V52B 2UXCF 4DR7F 2PSZA 3M6UA 1NDPA 1LAVA 4NB4A 1BWVA 1ZBLA 3LGHA 2W4PA 4YR2A 3FZBA 2VWBA 3ITHB 4KHPF 5LOQA 4FLZA 3KKFA 3P5JA 1U1PA 4AQYK 1SKSA 3FVYA 1EP4A 3AARA 2W7OA 2FIUA 3W2WB 3KKSA 3ETOA 3NKYA 2KG0A 3GJSB 5GAEP 2EFOA 1NWKA 3DYAB 5C24B 2LXUA 3EGWB 1BMQB 2B43A 2Q3SA 3TQEA 1VQYA 3A8EA 3QRRA 4J9NA 1LQ9A 2MZ1A 3VVTA 3NCQA 4X66F 4ED1A 2CQPA 2NRWA 4CEOA 3HI9A 2G8WA 2C2NA 2E7XA 1VBZA 1HR0F 2B3TB 4ZVTB 3CD0A 5KFGA 1BLUA 2B7CB 5CHCB 4CJPA 2CPXA 4AFFA 1MWMA 1K44A 3BYPA 4OJGA 2EHGA 3BF1A 4TY9A 3U1NA 1WHXA 2BMBA 3D5MA 2IRXA 3I87A 4RU2A 1PAEX 1CC7A 4WQ4A 2DNOA 4JK9A 4DS5A 4QR1A 4FDFA 2QRRA 3NG8A 3AVBA 1QQCA 1S4EA 3T6JA 2VFRA 3B8HA 4M63C 3E9PA 4G9ZA 1NMEB 1H74A 4H4MB 2YQ1A 2R7TA 1WC1A 3HHKA 4FWRA 2XMUA 2KW4A 4A8YA 2DK2A 2MQLA 3EM1A 3DLGB 2H3GX 2R8JA 1SI9A 1GMWA 1IKWA 5F8GA 3MFIA 4JI1K 4XDCA 4K42A 5A2QO 2HNYB 4IO9Q 3VQDA 2RHSB 3OFGA 4M5KA 3MM6B 1VSLA 3O3GA 1D9AA 2IMOA 2RE2A 3RBDA 4M3ZA 4J2EA 3VGSA 2RILA 1WOOA 2JLEA 4CTAB 3QDKA 3KJQB 2X78A 1ATNA 1M0SA 1MG7A 2O8FB 1M1GA 4E7IA 3OV7A 5DM6L 3WBZA 3VQ7A 2OEKA 3KD1E 3LZJA 2H5IB 1GLLO 4IFVA 1MWQA 3MM6A 3EYZA 4W5NA 2GFFA 2A42A 3M1VB 2O8FA 2B8QA 1SAZA 4P9SA 4B3TF 3LGNA 1U0SA 3J80Y 3MCAB 3MFHA 4DG1A 2WOMA 1G2EA 2W24A 4EZ9A 4DPTA 3FZHA 1PC4A 1Q0NA 4J5OA 2ASYA 4FM2A 1Q1KA 5HN0A 3PZPA 4CLYA 2CKWA 2RN2A 4OYPA 4A5BA 4WFYA 1X4FA 2R7SA 3MD3A 1RT2A 2FDNA 4ECQA 1TUVA 2Z2MA 4PXDA 5A2QY 2BJ3A 4I6AA 3OUYA 5LJWA 1GQEA 3D0GE 1HR0J 3ZSVA 1XTZA 3LM2A 2XMKA 3AB2B 1IG8A 3KLGB 1HQUA 4ZITA 3PO5A 3ZC4A 4O4RA 3CXCR 3L0QA 1ATSA 4XPCA 2FYXA 1BQNB 4XDDA 4DR4J 1OH5A 4RNFA 1R0AB 5M2RA 4LF4F 3IXQA 2I6WA 4M42A 2E2QA 2QYCA 4IH6A 4MIBA 4CLWA 1NGHA 3DKDA 4A8FA 4ZCLA 2KDOA 3SPYA 1DLOA 4RBVA 3WQPA 4OGEA 2DGTA 2ATLA 3GR1A 1RT4B 1P1TA 1F21A 4B8CA 1GMUA 4Z4GA 3S7RA 4MFBA 3JAMO 1DJ0A 1HI1A 2HNZB 2ZE2A 2G2YA 2DNGA 1DTQA 1T11A 3BSCA 4MH8A 2MZQA 4PEOA 3MF5A 1B7FA 1TKZB 3C15B 4C3KA 4K0KK 3J81U 1RAHB 4DU1A 4OHXA 3FZMA 1N6QA 4ZPVR 2FBVA 4O3PA 4QS7A 4ILRA 3M3ZA 1DURA 4K4TA 1H73A 2VASA 1VSFA 4FJMA 3KHLA 1VCTA 4CO1A 3KK7A 3DAWA 1R8PA 1S12A 4KV8A 4OIXA 4GW6A 4ZVSB 3QBCA 1RCOB 3RSEB 2MKJA 3FBEA 1C0GA 1WI8A 4C8OA 3MN5A 4I4BA 2GGPA 3LP0A 1KD1O 2JNJA 2DFHA 1J5OB 5JLHA 3CULA 1TVRA 3AXMA 1ZAWA 3MR7A 1TV6B 3SDEA 3R97A 1J5EF 2YHWA 2HHHF 1RT6B 1TL1A 1YUWA 4OZ5A 4DB3A 4KB0A 5J2PA 4CEBA 2E1YA 4DQQA 2BE2B 1X5OA 1KHWA 2MZSA 3CYMA 3RZAA 4GMKA 1O1WA 1S72S 4IR9A 1WC0A 2P8IA 1SBRA 4CGIA 1X4EA 3CC7N 5A8KB 4JP8A 1KAZA 4AQYJ 1VQ4S 2NNWA 3CMAN 3THWB 1YJ7A 4CNZA 5CCLA 1QSYA 2DFEA 5LMUF 2G0CA 4U7UK 1JLAB 3QT6A 3K0SA 2WVEA 1U45A 2XRIA 1AZSA 4JI2J 1P9YA 1YJRA 2ZKTA 1G15A 4DHYA 2IBKA 3P1GA 1RKIA 4MO4A 1CC8A 4CZJA 1PYTA 2NYIA 4ZS6A 4IFEA 2YWEA 4OVLA 1SC1B 4E7JA 1U09A 3SCJE 2B4JA 4CBXA 4DR1J 4I7FA 5CAAA 3HMJG 1AZSB 2PT0A 1JLCA 3MX5A 5H1SQ 3Q8VA 1NZ8A 4RL1A 4BACA 3DHWC 4UZBA 1RAGB 3MMBA 3B82A 3HJFA 4MJKA 3ENVA 2IVMA 4C8LA 4B1VA 2Y0SD 4TVAB 2CQBA 4B1ZA 1EB0A 4H0PA 4AT1B 3QNOA 1JKHA 3GYGA 3L9ZA 4RPFA 2HMIA 2E1MC 5I42A 4A8SA 1JLFB 1PCAA 1RAAB 1D9DA 5C2CA 1ZM3A 2RB7A 4A62A 3TWHA 3G8TA 4YB5A 3OTOK 3AVFA 2FJVA 3TUJC 1TL7B 4IRDA 1FJGF 2FF3B 3QEWA 1KS2A 3KLEB 2AW0A 2FVSA 1DQ9A 4GVLA 4HHJA 3QT7A 3DOMA 2RMLA 5M1QA 2FPHX 2P9LB 4NL5A 1X8DA 3LL3A 4DR6J 4B3SJ 1FD2A 4EZ6A 1NPKA 4PPZA 5E5NA 1K0VA 1ATRA 5EHHA 4F4YA 4ANDA 3T69A 1BI4B 2HBZB 4UOGA 1IQZA 4NX9A 4BRPA 4USJC 1FDBA 3MEDB 3DRPA 3OYIA 3CQYA 2CZ4A 4WFNQ 5K14B 1RISA 1LW2B 4IOCQ 2X1AA 4PL8A 5DG9A 3AO5A 1L5UA 4UTGA 4J9QA 4DTSA 1F9HA 4RW8B 1JLGA 4OV6A 1UVKA 2OI2A 2AJ1A 4H4KC 4OZ0A 3GDQA 3O9RA 1K6YA 1W2BM 2VG6B 2W4CA 2X1BA 2QT7A 1O0PA 3QEVA 4F3OA 4CD3A 4CK3A 3QB0A 1FKOB 1WELA 1VISA 3VEYA 1VFJA 4CEDA 1RT3B 4IRKA 2CPFA 1YJWS 2HVDA 2WVBA 5GAEI 2VL1A 3AQOA 2YWFA 3AA8A 3T9ZA 4PQAA 1QLNA 1A6LA 3QNNA 3CWJA 5FRMA 4Q44A 1BDGA 3GCWP 4JI0K 1NH8A 4WYBA 1S1WB 1S1UA 3BGRB 3VQ8A 5KFVA 2OHDA 1NGAA 4NYZA 2P51A 4ZJLA 3UE2A 4A46A 1QQNA 1RA6A 2SXLA 4OQJA 1WBDA 3W9JA 2QW9A 3JS9A 4LF9K 1MROA 1SB6A 4E98A 4H4MA 2RRBA 3C7NA 1RBUA 2ZJRQ 3CIPA 4JBCA 2IM3A 1BGXT 4BBYA 3POTB 3A3NB 2CQ3A 1XC3A 3S9HA 4FPBA 2M5YA 1SC4B 1XI1A 4MAKA 1KHVA 5KTQA 1U1MA 2E1PA 4ZHRA 4DN9A 3NF8A 2NYHA 4ZPDA 4K0KF 3PTWA 3CIZA 3HFZB 2WB4A 4BRMA 3IMXA 3MAQA 5HLFA 3LWLA 1FRKA 1UTAA 4X62F 2F8EX 2KRRA 3CJ4A 3THYA 5JMVA 4J9RA 4UUWA 1JNZB 4K8XA 1JCGA 1HNXF 2UXDJ 3RU0A 2X6SA 2WBRA 3C3LA 4O4GA 2H5JB 4OX7A 5BR8F 3L2RA 5AQQA 4HTLA 3VA0A 2ZH1A 4HEA9 4CHOA 4FYWB 2ZD1B 3I96A 1M5PC 1HNXJ 2AEMA 4FKXA 4KH4A 5A8WA 4A48A 2J6UA 3PEJA 3QT8A 3MGJA 1OVYA 1VGYA 4ZPWR 4USIA 2NXCA 4CW7B 2CG4A 4CIFA 3R9PA 4WFNL 1SC3B 4ELVA 2O8BA 3AVMA 1HNVB 3QJLA 3T5LA 1I94F 2R7UA 3H08A 1YTUA 3PW0A 5AQMA 2F7VA 4KC5A 3C94A 1HMVB 3ZO7A 4IQXA 4ZLNA 4DL7A 3IBFB 3UN5A 5LMUK 2G9OA 3M8YA 4P7VA 4YY3F 1X3NA 3KG1A 2CJ9A 4ILGB 3ZX3A 4X65K 3QO9A 2VJVA 2G0IA 3V2UC 2GS8A 3OA9A 2WW4A 1SH3A 2IIHA 4DCHA 4V19X 3HT0A 4MT1A 2ZGYA 1YX2A 3BEGB 3OSPA 4MTPA 3LPYA 4LIRA 1X4DA 1X5SA 1JJ4A 1UJ5A 3CC2N 1HNWF 1ACMB 1KFDA 1T6CA 2P2CB 3N4QA 1YJWN 4WU2A 4JYAK 2Q2RA 5BRFA 4GRSA 4WKYA 4ID1A 2XBPA 2HW3A 3DDNA 3J81j 3D6MB 4H4OB 4O3SA 2VFVA 1YF5L 1R43A 2ASDA 3GIKA 1KXPA 4B1XB 3NNCA 2G8HA 2DNKA 4IEIA 3FC9A 5HATA 3O44A 1RAIB 4PYAA 4DV4F 3U3GA 2ZH7A 1RWVB 4IOCL 2GQ2A 2GMLA 1FJGK 4LF7F 4CNYA 1S6PA 4ISGA 2EKYA 2N4DA 5DG7A 2NUUG 2IA6A 4JV5J 5IC4B 5LSLA 2LXIA 2ILZA 4HCBA 1TKZA 3C15A 3SI8A 4FCYA 4X4RA 2FUG9 3VV2B 2KZZA 3MWTA 2HBQB 2XNRA 4HTIA 2V0NA 2YKNA 2O8DA 4NZ6A 4YN3B 1YI2S 3TANA 2C3UA 1URRA 4FVUA 3OHAA 5BPMA 4LVNP 4J9KA 3CJTA 4JI0J 3IGVA 4DPXA 1FDDA 3FLCO 3M2RA 5E0OA 3F41A 1TFWA 4EK2A 2PIIA 1W9HA 1RBSA 4FN5A 1K9MO 5B0GA 3DLEA 4F36A 3FZFA 3EEQA 2E9RX 4BR0A 1HBNA 1HQUB 4YR3A 1RTJA 1OSDA 4OI4A 3VGTA 4DV3F 1DGKN 3G87A 3ULEB 1WF0A 2VICA 2UU9F 4G1PA 2LDIA 3D6HB 4GNIA 4JS5A 2LEPA 5KFXA 3HP9A 5FPMA 4MDBA 2RS8A 1IV0A 4B9VA 1RWUA 4CJSA 1X0FA 1NKEA 1D5AA 3VMFB 4HHHA 3DXMA 3VQSA 5GINA 4CWBA 5A8KA 1CLFA 2OH2A 2L9NA 2K1RA 1T3OA 2C3YA 4PKGA 2A6OA 3HM9A 4CF9A 2B9WA 3CCSN 5F8NA 1JJHA 2J9DE 3QEIA 3O4NA 3SQGA 4XK8C 5KFZA 2BJ1A 5FDLA 4YQWA 3FEXB 3U9DA 4M7XA 5HAOA 3NGIA 1LWCA 4WQ4C 3EZWA 2FQQB 2YHXA 3SQ4A 5KFWA 3IUCA 1HWUA 2FB0A 2CJKA 4P71A 4ES2A 3QFUA 2OA8A 3LDQA 3M2UB 2AZ3A 2GO9A 4CIGA 3V4IA 2WAQD 2FJEB 3R7SB 3SSSA 1H2UX 3SNNA 1RGVA 2Q79A 1CVJA 2JWNA 4DTXA 2CPZA 3OXLA 1HKGA 1YJ9N 3ULHA 5KOXA 1S72N 2E44A 1XIQA 2G8IA 1T3VA 4YOXA 4J9LA 3H25A 5C12A 4OYIA 4B9NA 3VQCA 2KHDA 3HLUA 3NS5A 3QNWB 2MQQA 2W6KA 4DR1F 2DO4A 1Z05A 1AA1B 1ZETA 1YJTA 4DCPB 1AROP 1ZYQA 3FCHA 4DR3K 4DU4A 1OPZA 4YY3J 4O5FA 2F3JA 3CG7A 3U27A 1N32K 3V1RA 5KFQA 2E5HA 2NRXA 3CMES 3CQ8A 1Q8LA 2KT5A 1PAUB 3EVOA 4CYUA 4IR1A 4P2MA 1QZ6A 1RT1A 1J5EK 1NNDA 4IJAA 4BRCA 1IKYA 4BGBA 1WBBA 5CYMB 3H42A 2BJDA 2GBZA 3SMSA 1QAYA 4CO5A 5KG2A 3E8OA 3WIUA 2GQCA 2E88A 4ZPBA 1G3OA 1FESA 1HLUA 4QBUA 4L3KA 5IWAF 2VKRA 2AYGA 1TFYA 1V3RA 1SXLA 3QICA 2D9OA 2JRSA 4PWWA 3R5DA 2KG1A 3QJPA 5C2GA 1VQOS 5HI7A 4IO8A 3P5BP 1EETB 5DQIA 4GV6A 4FLYA 4Z4EA 2UVUA 3QESA 3IKMA 4BRLA 3PJ9A 4X4NA 2PGCA 3UNYA 3IN5A 3PFEA 5FDLB 5LJVA 4W98A 3OLAA 4EYHB 3RB0A 2DXDA 1HL6A 3C6UB 4GVBA 4DX8H 4AL7A 2DR8A 2K3IA 4DX5A 3MECA 3BQ0A 3V5RA 1TQLA 1Q16B 1GLCG 2HFSA 4B3MF 3MEKA 3IS9A 2LXFA 4JV2A 5D78A 3O9QA 2IC3A 2HQ3A 3R6LB 1R7IA 1Z26A 2VH7A 2BJ7A 4Q5VA 2P9LA 2L9WA 3AV9A 4CH7A 2K7KA 4JB8B 1VBXA 1UJ6A 4OKEA 3Q24A 4LF4J 4MLEA 1Z2LA 2VOOA 3V1OA 3KG4A 1VSMA 2LA6A 1G99A 3MR5A 2HQGA 1XHXA 3NE6A 4NO7A 5B0CA 4IG0A 3C6TA 4JKAA 3TAQA 5HVGA 4PCQA 5CZ2A 4YB1P 3C6TB 5U47A 2CYYA 3NWGA 2KVIA 4L76A 2ZH2A 4ED7A 4K5RA 5CE3A 2QWRA 2V7YA 4JI6F 4GVMA 2G8KA 2XB2D 1UA1A 1VQ9S 3SV3A 5M2UA 4F0MA 2D1CA 3G25A 1LK7A 4M3XA 2GVDA 4DQIA 1K1QA 2Z1HA 4KH5A 2ZWPA 1Q5VA 4WWSA 4OZNA 4QJVA 4I56A 3I9ZA 3VCDA 2XNQA 2PMHA 5HMYA 1RE1B 2D3O1 2HFNA 2EFVA 1VQNN 2JC1A 4FWQA 1NDKA 3PIPL 4DSEA 2AWZA 1K1SA 3H90A 1D4XA 4AF1A 4WJBA 5AXMA 3I33A 3F2KA 1NSKL 1KBRA 4P10A 4WKRA 2GZOA 1DZ5A 1BY9A 1JL2A 4KQZA 1S9FA 2FC0A 4QIGA 4U8YA 4JKBA 2QLWA 2RH3A 3BYRA 4HACB 2PI4A 2GIFA 2HAFA 2DD8S 4G6VB 3M6WA 2O8BB 1SJRA 2DRDA 2C3MA 3MCNA 1NOZA 3HD1A 4IFVB 4JKHA 3G6EN 1Q86O 5LSRA 2NREA 5AXNA 2P9SA 4LD0A 4GY2B 3SFUA 4I9LA 3HOSA 1VQPS 3SSQA 4ZPAA 2RHKA 5L1JA 2V8VA 2E1AA 1XNRK 2DEIA 2MQOA 2MQ8A 1U6ZA 2HHWA 3TA0A 4ELUA 4NOHA 1EXQA 4RX6A 3AA4A 4USUA 4O3OA 1SZ2A 1KLMA 1RBVA 4TLRA 5A2QU 1NGEA 3V9ZA 1L3VA 3AAWB 4DSKA 2HLUA 3IBCB 3WNHA 3N5FA 2BQUA 4NYFA 5IM0B 5DZ6A 4CHNA 4I69A 4CM2A 3NVMA 2CQHA 2IYGA 4WFBQ 3E9LA 4NZ7A 4LRAA 2CQ2A 2IVPA 3KJVB 1B7YB 4DZDA 3H20A 1GEHA 3C8YA 4B3OB 2B4OA 2MKCA 4H5VA 2N3OA 1R31A 4PKIA 2DHXA 2M88A 4FF4A 2QWMA 1KVAA 4JKGB 2RUGA 2AGPA 4B3RK 2Q6CA 4ETXA 5D4NA 4GKKF 4HDHA 2D5RA 4DU3A 2CFXA 2HNYA 5A8WB 1BQMB 3HL8A 5K8OA 3DGVA 1Y0HA 5LSOA 5T7LB 5AE3A 1D8ZA 3PW2A 4F2SA 2HFVA 2J6TA 3QBXA 4CTAA 2XZWA 4CF1A 2DR9A 1LXNA 5ETVA 4QR0A 4W4MA 4DR5F 2ZH4A 3M2RB 1HD0A 2QLJB 4A2AA 3KK2A 4JD2A 1NK5A 1QSLA 4CHQA 3OS0A 2OPQB 4XH1A 3P8BB 1SJFA 2DEJA 3WQUA 2HURA 2LU2A 2RDJA 1Q4RA 2E5JA 3EZOA 4GKJK 4LF5J 1SJ3P 3UIQA 4DV6K 1HNZK 4OHZA 2J4RA 2B9XA 3UD4P 2QL7B 1D8YA 2FLLA 1N48A 1MWYA 3UDVA 3FRZA 3IP0A 4BWJA 4L3QA 1X9SA 2QXFA 2HKEA 3VQTA 5H1SV 1M1KO 2F63A 2H51B 2WCXA 2XI2A 4R8UB 2DH7A 3WDOA 2D0OA 2DNZA 1N33F 3BO4A 3O9UA 3D4JA 4NMLA 3CD7A 1QQMA 1M5SA 1CS4B 2OANA 1BE4A 1O51A 3W62A 4WFAL 1FWPA 2KT3A 4X4UA 1TUYA 1R0AA 2V9KA 4BE2A 4ECXA 1DBDA 1I39A 3U02A 2F1FA 1P90A 3UCZP 5M2PA 2HGLA 2OPRA 3EDQB 1ITPA 3NDKA 4DEZA 2RAQA 1BC6A 2RU9A 5IT9Y 4F4KA 4AUKA 2YKOA 4LY7A 1CJVA 1ZBHA 4M5MA 1Q95G 5KPRA 4DV1F 3C0BA 4PABA 4QWDA 3D7EO 4B3MK 2DNRA 1ZXOA 2BZ2A 4RZRA 2ZKUA 2FC9A 5C25A 1B3TA 1OVQA 2IOCA 2QTDA 4OHYA 3HOTA 2KXFA 3G6XA 2HHUA 5CYJA 2XMMA 3A3OB 1QTNB 1WEZA 4OKJA 3SCLE 4PG6A 2DT9A 3S8SA 2G1HA 4CGGA 1OYEA 2C22A 2J76E 4ZCKA 5D0RA 2ZM6J 5I42B 4LRDA 2GGPB 3VEVA 3CCRN 5DO2A 2CVIA 2XY6A 2ZGZA 2F9TA 3OTBA 5HK4A 4BC3A 1D1UA 1RA7A 3VA3A 2FHKA 3GILA 1WLJA 3E01B 2XWYA 1H7WA 4P6QA 1G4CA 2POKA 2UUCJ 3OYEA 3HYFA 1HIYA 1PJ6A 4ILMA 1JK9B 1Q82O 3I5BA 4B1UB 1KQSR 3B4MA 3KLIA 2PC6A 2VONA 4XPEA 5EN1A 5C42A 1MN9A 4CT8A 4X4OA 4YNQA 3CCQS 3V81A 3D68A 4EIAA 4Z4FA 3PHTA 3RW7A 1F5AA 5CYMA 1YDLA 1UEVA 3DMJB 3V1QA 2R2TA 1T02A 2M9KA 4Q8EA 2AGQA 3HD2A 4CGJA 3T1HJ 2M3DA 2BANA 3S01A 4FLXA 2J6SA 4MKBA 1MU2A 1IBMK 3ZSOA 5I9EB 1PILA 1V6HA 3ZT0A 3KDNA 4ID5A 4DS4A 3CJ2A 3D2EB 2RE1A 3L7UA 1P6TA 2V8HA 2FY8A 2NUBA 4WFXA 1EP4B 3CJ1A 4K2JA 2BTFA 4N77A 4NCAA 4NXMK 2J9EA 3NCIA 1UWBA 2ZM6K 4ZN3A 5LL6d 3ZX2A 1N5SA 2XMWA 4U7BA 3QAUA 4B8AB 3BBCA 4NYPA 6AT1B 3C66A 2JSXA 4AXJA 3IBWA 1AFIA 4KJIA 1SJQA 3MMBB 1RILA 2BGGA 4K4YA 3KLFA 2E7WA 1JIHA 3CXCM 3TX0A 1O8BA 4F4XA 5AQFA 4QS8A 5FPNA 3MAHA 2W01A 5M1NA 2YNFA 3LP1A 1PC5A 1RQ0A 4EMDA 4NA2A 4UOFA 4E7LA 3HHLB 1S1VA 2XYHB 1RT5A 2GUIA 1G6BA 4LSNA 4LF4K 2X7IA