1TL1A

Crystal structure of hiv-1 reverse transcriptase in complex with gw451211
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 146
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tl1A05
1ITGA 3QIPA 4OPJA 4CJLA 2WRMA 4K4YA 4CGHA 4ID1A 2IC3A 2IM3A 4ZVHA 4IKFA 4DTUA 4Q0BB 1JLCA 2HNDA 2ITGA 2YNHB 2R8IA 2UVUA 3P83D 2C2EA 2J6TA 5FRNA 5KT7A 1KTQA 3OYHA 4EO8A 3CFPA 4WXWA 4MKBA 4HCBA 4IOBA 4E7JA 2O4GA 1BQNB 3V1QA 5CYQA 2F96A 3MXIA 2QKBA 4K4SA 4J9KA 1U09A 1S1WB 1TL3B 2HNYA 5FDLA 2XC9A 4C8NA 1SKSA 4KFBB 2GC8A 1TK0A 3H59A 4H4MB 3QEVA 4CIGA 5I3UA 4W5OA 1C0TA 4RW7A 3SJJA 4J9MA 3S3MA 1LAWA 2HNZB 3RAQA 2ZKUA 1S0NA 1NK6A 1C6VA 4Z4GA 5KFGA 4XPEA 3A2FA 2YNIA 2IAJB 4R8UA 4RW6B 1DTQB 3IN5A 3L2VA 1T05B 3HK2A 1N5YB 5J1EB 4E7KA 3M9OB 2GIRA 3G86A 3CG7A 4F8RA 4ED2A 1YT3A 3CJ0A 3T3FA 4RNHA 2D41A 4TSXA 4ECWA 5FROA 3VQ5A 4E0DA 3T5LA 4FZXC 4KRFA 1JLAB 3OYLA 2D0AA 1RTDB 4KBIA 1CZBA 2WHOA 3TAPA 2UVRA 3H40A 4GW6A 4OL8A 4O3SA 1CSJA 3SV3A 2J6SA 2FC0A 1BQNA 3G6YA 2GBZA 3VQ4A 3HP6A 1ZBHA 4CHNA 4DU1A 1S1XB 4HKQA 5KT2A 1UA1A 1TL3A 4EEYA 4ECYA 3RR7A 4ZVGA 2XI2A 1LWFB 2XY8A 3D28A 1NK0A 4FLWA 1N4LA 5KT6A 2F8EX 4F4XA 3I5BA 1NKBA 2HNZA 2IS3A 4AHTA 2W8LA 3AVLA 2YHBA 5C25B 2KFZA 4O4GB 2VWJA 4NLUA 4IFVB 1R0AB 3VQ6A 1N56A 1ASUA 2IAJA 2R2SA 4RW6A 1DTQA 5KRTA 3UDLA 2D7SA 3SV4A 1T05A 3V6JA 1LWEB 5J1EA 4W5TA 2I1RA 2R2RA 4XO0A 3IRXB 3DRRA 2G8HA 5EWEA 3CJ5A 4ED1A 4EZ9A 3G6XA 3RRGA 1Q9YA 3D5MA 4E89A 4CK1A 2OA8A 5F8MA 3H5YA 5C5JA 4RNMA 4JS4A 4FJ7A 3V9WA 2X6SA 4MFBB 4DF8A 3G10A 3LPTA 4J9OA 3Q8SB 1JKHB 3QYYA 4E7LA 1RTDA 4ID5B 4KHMA 2R7YA 4YMEA 1HQUA 3AV9A 1C1CA 1RT5A 2FVQA 2RPIA 4RUCA 2WK4A 3OYEA 3LWMA 1NNDA 3SUNA 3CQ8A 4OPKA 1J5OB 4Z4CA 5KFIA 1IO2A 2D3UA 1JLFB 1S1XA 3QO9A 4CJKA 4DQPA 4I9QA 4Z4FA 2HMIB 1GOBA 2W9BB 3OYGA 4ED6A 3O3FA 4Y3CA 3KOAA 1LWFA 2X74A 3RTVA 2R2UA 4EO6A 1N6QB 4O3RA 3RMAA 4RW9B 3OS2A 2XGPA 4CGFA 3V9XA 5F8JA 1BISA 3PO5A 2JLEA 3QEXA 2KZZA 3RMDA 3VQAA 3G0ZA 5CY4A 4LY7A 1HNVB 4O4GA 1R0AA 3E51A 2YKMB 5L1LA 1ZETA 3IS9B 3K59A 4CFCA 2JEJA 4I2QB 1LWEA 2WCXA 3GV7B 4FLTA 5F9LA 3EPGA 3QNOA 5KFJA 3M8PB 4J9SA 3F73A 4URSA 2KFNA 4FLUA 2EC0A 3VQCA 3NH1A 3PW0A 4RUAA 2LSNA 4ZPAA 4CJSA 1NJXA 5KG4A 2A1RA 1JKHA 1L3TA 3SI8A 4KE5A 2UUWA 1K6YA 4WZMA 4ECVA 4PQUB 2IJFA 5HBMA 3AVBA 2ATQA 5CZ2A 1SL1A 4CJUA 3KHHA 3Q8PB 4RW4B 1J5OA 2ASDA 3AO2A 1GOAA 2KZMA 1VSHA 4IRDA 1JLFA 4TY8A 4CJTA 1TL1A 1RT6B 2AQ4A 4N47A 4O0JA 2HMIA 4B9LA 2W7PA 2W9BA 1SL2A 4X2BA 3KLVA 4KHUA 4ED0A 4CHOA 3C6UA 3OYDA 3NHGA 4DSFA 4BDYA 1HYZA 4KO0B 3CJ4A 2UVVA 2XY5A 3TAGA 4PY5A 1C2PA 2HHQA 3OYIA 1KLNA 1IKWB 4RW9A 4CHPA 3V6DA 5CZ1A 4CESA 4QWBA 4CHZA 2XY6A 4CJEA 1DTTA 3ZSVA 4I2PA 3JSMB 3OVNA 1HNVA 2WB4A 3M8QB 1L5UA 2ZQBA 4CEAA 3VQEA 1B92A 5DGBA 3I5CA 2FLNA 2CKWA 4Y1DA 2PZSA 3AVFA 3PX6A 4I2QA 4NLVA 5DG9A 1HRHA 2V4RA 5KFEA 4FJ9A 1LW0B 1RA6A 2FVRA 3M8PA 1KSPA 5C24A 4FBUA 2RDJA 4KV8B 3Q8QB 4WXOA 3QETA 3LZJA 2F8SA 3K57A 1SH0A 3OYBA 2JGUA 1NOYA 3CM5A 2RF2A 3OLAA 3BREA 3DLKA 3NKYA 4FLYA 3V9UA 4CEZA 2R8JA 1S6PA 3RB4A 3ZSXA 3IGNA 4JLHA 4CIEA 3VA3A 1KLMA 4RW4A 3B6OA 5HRNA 3K5OA 3NGYA 1SUQB 1S6QB 3V9ZA 4QW9A 3PVXA 2XCPA 3LP0A 1ASVA 4F3TA 1RT6A 4O44B 3KJVA 4DLEA 4RZRA 4CGDA 3AVHA 4M3YA 3ZSQA 5HRPA 5J2MB 1Z26A 1TAQA 2EX3A 4H8KA 4FK2A 4DQRA 4KO0A 4CF1A 3UR0A 3MEDB 1IKWA 2O5DA 4CEEA 3DLEA 4CHQA 4KB0A 2VWKA 1Q9XA 4FW2A 3TAMB 5KFQA 4OKKA 5JS1A 1S1VB 1RDBA 2B4JA 2FJWA 3C6TB 3KK2B 1K1QA 1T3NA 1HYSA 3KIOA 3MECB 1RTJB 3GYNA 5E41A 2FLLA 3WNEA 3T1AA 4ZHRB 1TV6B 4YR3A 1U4BA 1LW0A 3RBEA 4Z4EA 4NLSA 2DPIA 3PX4A 3PJXA 1HYVA 4CGJA 3PR5B 3C95A 3V81A 3WNFA 1BIZA 1NK4A 4B9TA 1KFSA 3KTQA 3H4DA 4QWAA 3JYTA 3Q8RB 2AWZA 4U6PA 2BANB 2HB5A 4B08A 1KVCA 3BSOA 4FW1A 4O0IA 5HROA 4LSNA 3M9NB 3V6KA 2YNFB 3PZPA 1WSIA 3GIIA 1C1BB 4EBCA 4MIAA 4ZPCA 2VG5A 3AA2A 1S6QA 4KHNA 4MH8A 1NHUA 4O44A 5F8HA 4FLZA 4Q8FA 2BDPA 1WN7A 4JRPA 4XIUA 3H5SA 4RNOA 4QWEA 3QLHA 4JV2A 2IM2A 2HHSA 4O5BA 1KVBA 4NCBA 5J2MA 5F8IA 1BCMA 3HPHA 4J9NA 3H2LA 3MEDA 4ZP6A 3KMQA 4YR0A 2JC1A 2P51A 3HO1A 5HRSA 5KFZA 1T03A 3WNGA 4HUEA 1J53A 5F8LA 3OL9A 2HW3A 4B9NA 3H5UA 2G8FA 3AO5A 4DTOA 4CF0A 2G8IA 4GMJB 3KK2A 1CZ9A 2G8UA 3MECA 4RNNA 4AHRA 2OPQB 3FSIA 2IDOA 2FVPA 3MXMA 4F4ZA 4ZHRA 1TV6A 3ZSYA 4O3QA 1F21A 3ITHA 1D8YA 3V4IB 2HHUA 2BR0A 2W42A 2VG7B 1T94A 4Q45A 4LSLB 5D3GB 3AVJA 2VG6B 4ECTA 2W9AA 2HHVA 3HVRA 1VRTA 3ZT1A 1ZBLA 1TKTA 2BANA 1JL2A 2B43A 4B9UA 1YVFA 1S5JA 5HLFA 2ZD1B 4GVMA 4MIBA 4ZPDA 2FLPA 1U48A 4OGEA 3OSNA 1IKXB 4YP3A 4DL5A 2BE2B 4OJRA 1C1BA 5K14B 4QOZB 1XC9A 1LW2B 3ZT3A 4TN2A 3VQ8A 5C42A 5EDWA 4FK0A 4DMNA 1GX6A 3ZSWA 1QQCA 4R5PB 3N6LA 3ULDA 2IMWP 3BJYA 2VA2A 2XWYA 2D5RA 3UPFA 3FQLA 2B5JB 4NYFA 4CJRA 4ZMMA 1REVB 1MU2B 3BSAA 1X9MA 3IGVA 3CFRA 5JUMA 3KNAA 1B9DA 4QCLA 4IQXA 4JV0A 4NCGA 5J2PA 1JXBA 2R8GA 4EYHB 4NRTA 3MTKA 4ED3A 1RBTA 1L3UA 1BCOA 1EX4A 2DY4A 4RW8A 1BL3A 2OPQA 4DS5A 4I7FB 3GIMA 2OZSA 3TARA 1A5VA 3NCIA 2FJVA 1RDCA 4FCYA 3V4IA 2VG7A 4LSLA 5D3GA 4Q0BA 2XCAA 4L8RB 2YNHA 2VG6A 4J2BA 4M3WA 2JEGA 4CJVA 3VQSA 5EWFA 3PW7A 2VA3A 4QW8A 1NKEA 4DL2A 3EZUA 1S49A 4TYBA 4E1NA 4ZTFA 2YKNB 4KI6A 1RDAA 1JXEA 1IKXA 1YTAA 4WFYA 2NUBA 2BE2A 2I5JB 1JX4A 4TQSA 4EP5A 3UQSA 1S1WA 5K14A 1QSSA 4EZ6A 1LW2A 4KFBA 1U47A 4M3XA 1UWBB 1VSKA 4HCCA 3AVIA 3DYAB 4OLBA 3O3GA 4H4MA 3HVTB 4CGGA 2DFHA 4R5PA 4IBNA 1YTUA 4HTUA 1KFDA 4IR1A 3NAEA 4M41A 2B5JA 5KFAA 4YNQA 3DLRA 3M8RA 4FJJA 2GUIA 4E3SA 3RMBA 3OYJA 3MR6A 3BDPA 3CJ2A 5KG6A 4CJWA 4FJ8A 3NF7A 3SQ0A 2HAIA 2ASJA 3ISND 5KFMA 4G1QB 4PWDB 1N5YA 4J9LA 5T7BA 4FM0A 4F4YA 4KB1A 1GX5A 1NK9A 1FKOB 2FBYA 1VSMA 1S1UB 4E19A 3HPOA 4ELVA 1BHLA 1LV5A 4IH7A 3CDWA 3S3NA 3DI6B 3TR8A 3BR9A 4KB7A 4CEOA 1EKEA 4DEZA 5L9XA 3S3OA 3TI0A 1JLAA 3MEEB 4JV1A 3BQ0A 3TVKA 4DQIA 1BI4B 3T5JA 2XY7A 2UUTA 4FS1A 2IBKA 5DG8A 4DLGA 1Y97A 4PA1A 3NGIA 4CEQA 4HVJA 2YKNA 4OKJA 1QUVA 4DQQA 3U6FA 4DG1B 3CJ3A 3I0RB 2JC0A 4NCAA 3OL7A 1EETB 1SH2A 3ZSRA 1EP4B 3GV5B 5KGWA 3IG1B 1VSIA 3OS0A 3AO3A 1RT1B 2ILZA 3PO4A 2W8KA 2Z1GA 3P1GA 1RBSA 5KFKA 5KFHA 3HYFA 3THVA 5KFYA 3L2WA 2R8KA 2CJQA 4URQU 2YNGB 2YV0X 4K4TA 5KG1A 5C25A 2QXFA 4OKEA 4KHYA 1NJZA 3NFAA 4IFVA 4RNFA 1YVUA 1W9HA 4FZZA 3OY9A 5KG7A 3SI6A 1JLQB 1BQMB 5KFSA 4CHYA 4PWDA 4FVMA 3NAIA 1T7PA 2WONB 3CDUA 4URGA 2G8KA 3IRXA 1S1UA 2FJXA 4IG3B 3ASMA 4DL7A 1S0OA 3KKSA 4NLDA 3DI6A 4F4WA 4M42A 3TABA 4DFPA 4LH4A 4QWDA 1RILA 3SPZA 2IM1A 1NOZA 4IG0B 2P1JA 1N48A 4DF4A 4IRCA 3OYFA 4MFBA 3KMSA 4KAIA 3MEEA 5DG7A 2E9ZA 3VQ9A 1WNEA 4ID5A 1X1PA 3SCXA 2DFFA 1BI4A 1BGXT 4ZPBA 4MK9A 3QGGA 3KK1B 3GV8B 4FJXA 1HMVB 3H98A 4FZYA 3HM9A 3BSCA 5KTQA 4FJHA 2OH2A 4NLQA 4NLRA 5JXSA 4DG1A 1K1SA 3L3UA 3I0RA 4YR2A 1WAFA 4BE0A 2QK9A 3PW2A 3IG1A 4K50A 3L2RA 3RBDA 1RT1A 1S9GB 1U04A 3PY8A 1N6QA 2JEIA 1CXUA 2Z1IA 3G6VA 3D0PA 2GV9A 4NLTA 2YNGA 3HJFA 1KCFA 3DM2B 3MEGB 2WOMB 2C2DA 1TKZB 4YFUA 5L1KA 4B9VA 1JLGB 2YKMA 3VQ7A 4IKAA 3IS9A 3BGRB 1TAUA 1JLQA 3N6MA 4CJ5A 1BQMA 3SPYA 1JL1A 4ZP7A 4Q8EA 3B6PA 4Q5VA 4NLGA 2WONA 3H08A 4K4VA 2QKKA 1NJYA 4CJQA 4IG3A 2BQ3A 1ZYQA 4DTSA 2AX0A 3QGIA 4CERA 3I0SB 4IG0A 1ZBUA 4DL3A 3BSNA 1LWCB 3OLBA 3OYCA 5SZTA 3KHGA 3K5NA 4TQRA 5KFOA 5DLGA 3MFIA 4PQUA 3AVNA 4ECZA 3T19A 3KK1A 1QAIA 3K5MA 4LQ3A 4B9SA 5FRMA 1XI1A 3E01B 3P5JA 4ED8A 4BDZA 4W5NA 4CECA 2AGOA 1RT4B 4M3RA 4C8OA 4FJLA 3DOLB 2HHTA 2R2TA 3RAXA 4NLPA 2QE5A 3KHLA 4B9MA 1RT2B 3RB6A 3RR8A 3LWLA 1S9GA 3EPIA 3DRPB 3UIQA 4TYAA 4QAGA 4KHWA 5I42B 4KI4A 4K8XA 5CYMB 5KFBA 5KFRA 4IH5A 3NDKA 4AILC 2FVCA 3JSMA 1TKZA 1KHWA 1VRUB 3AVGA 3FDSA 5KFTA 1TKDA 4N41A 3M8QA 1JLGA 5KFLA 3BGRA 1KVAA 3U3YA 5T14A 3H4BA 2C2RA 3QNNA 3WNHA 4BWJA 4EP4A 3BQ1A 1SKRA 4DSLA 4K4UA 3VN5A 4NYNA 3TAQA 1VK0A 4OVLA 2ZE2B 1QE1B 3VQDA 3SFGA 1NJWA 3AO4A 1J54A 4KV8A 5KT5A 2PYLA 1S9EB 4ECXA 2XHBA 1RBUA 3I0SA 4KTWA 1VSEA 4M45A 3V1OA 2IGIA 3KLEB 3OYMA 4DL4A 3QIPB 4NYZA 3AA5X 3KHRA 4HUFA 4B3OB 2ILYA 2KTQA 2RDIA 1I39A 4CFDA 2HNDB 3RB0A 1TVRB 3E01A 2IM0A 2KW4A 4G3IA 1SUQA 5EWGA 3HT3A 3RRHA 4KPYA 4FJGA 4GC7A 2Z1JA 1X9WA 5KI6A 3DRPA 4DWIA 1RA7A 3CWJA 3OYKA 4FM1A 1CLQA 5I42A 2HNYB 3SQ4A 4CJ4A 5CYMA 1A5WA 3PR4A 4U7CA 3DLGB 1VRUA 3I8DA 3TAMA 3PJWA 4AHSA 3PUFA 1C0TB 3NGDA 4CEDA 3HHKA 3PV8A 3L8BA 1S1VA 1NK7A 3C6TA 4F50A 4O4RA 3M9MB 1QHTA 1RTJA 5KFUA 3CFOA 4DU3A 2EHGA 3NMAA 5JS2A 4AH9A 2OPRB 2F8TA 3DLHA 3SQ2A 4J9PA 4W5QA 2HHWA 4E1MA 4DTRA 3VQPA 1RDDA 2D3ZA 4H54A 1SV5B 3KK3B 2AU0A 3K58A 3U3GA 1HNIB 4BDPA 4NLXA 5F9NA 4B3OA 1RTIB 4PUOB 3V9SA 3VA0A 3OL6A 1TVRA 3NE6A 2YNFA 1HQEB 1W0HA 2ASLA 1JIHA 4NZ0A 3K2PA 4AHUA 4J2AA 2HWHA 1RT3B 3GQCA 2BRLA 3L2UA 4IRKA 3LZIA 1JLBB 1ZBIA 3QGHA 4E7IA 5KRSA 3AVMA 3CM6A 1LAVA 3PX0A 4JUZA 1B9FA 4KHRA 1QS4A 2RKIB 3KLIB 3NBPB 4DFJA 1QSYA 4HUGA 4HYKA 4DSJA 3DLGA 3QZ8A 2XI3A 3F9KA 3LAKA 4DTXA 2G8WA 4DSEA 3HVAA 4DTMA 4DTJA 3LAMA 4ZP9A 5KG2A 1TK8A 4DL6A 4CFAA 3QIDA 3OHAA 2P5GA 1HPZB 2BQUA 4CJ3A 1C0MA 1FXXA 5KG5A 4K8ZA 5KFWA 2V9WA 1DLOB 3SUPA 2DPJA 2OPRA 4MK7A 3SUQA 3AO1A 4WFZA 3GIKA 4CCHA 3IAYA 4WFXA 3LPUA 3MF5A 3RB3A 5KGXA 1O1WA 3LP2B 3DRRB 1SV5A 1JLEB 5KT3A 3KK3A 1BIUA 1KRPA 4Z0UA 3H5XA 1HNIA 2GIQA 1OS5A 3NGZA 4FYDA 3ISNC 2ZD1A 4NLYA 3SYZA 1RTIA 1U49A 4PUOA 3GIJA 4F2RA 2C28A 2OYQA 2IJNA 2OPPB 1Z25A 4KTZA 3MAQA 1HQEA 3AVAA 3EZ5A 1RT3A 1HQUB 2Z1HA 2Y1IA 3SZ2A 1C1CB 5KFXA 1RT5B 4CEBA 4Y1CA 3LALA 4O55A 3LP3A 1W25A 1JLBA 2E6LA 3O3HA 4R0EA 3QZ7A 4IH6A 2OZMA 4IR9A 4DTPA 2X78A 2BRKA 3MFHA 2RKIA 3QO9B 2ATLA 1KHVA 3KLIA 3TAEA 3PHEA 1RYSA 3NBPA 1WSEA 1IKVB 1ZTTA 3OYNA 4AHCA 1REVA 4ICLB 1MU2A 5HP1B 1RDRA 3VQBA 4M3ZA 3QIOA 3ALYA 1S1TB 3TAFA 4Y34A 2AJQA 1NK8A 1IH7A 5EUHA 4FK4A 3KKRA 1D0EA 3CIZA 5L1JA 3NF6A 4DTNA 4I7FA 1HPZA 4K4WA 5DQIA 1DLOA 3MR2A 1TK5A 1I3AA 4LH5A 4C8KA 1CXQA 2DTUA 5L1IA 3SNNA 3MXJA 1T8EA 4Q44A 3OHBA 4M3TA 4NLWA 4OLAA 2RN2A 1X9SA 1RTHB 3LP2A 3SUOA 1JLEA 2AX1A 4WYLA 2UVWA 3FQKA 2A1SA 1I6JA 1C0UB 4C8MA 3L2QA 4BACA 5KT4A 4MK8A 1HARA 4Z4HA 3QINA 4I9LA 1RBVA 4YQWA 2OPPA 1WLJA 2I5JA 4KSEB 3C94A 1IG9A 3KLFB 2IA6A 1NHVA 2O4IA 3MR5A 1NK5A 4FXDA 5HBMB 1S97A 4CEFA 1UWBA 1RAJA 4DU4A 4ZP8A 3HVWA 3DYAA 4ZTJA 4AHVA 2X6NA 5DQHA 2DFEA 3HVTA 3KD5E 3BQ2A 2XRIA 4TY8B 4ECSA 4O3PA 1TL1B 4M3UA 2IOCA 2FBTA 3I5AA 4KAZA 3EY1A 1IKVA 4IFYB 2V0NA 3HL8A 4ICLA 5HP1A 1J9AA 4H4OB 3C6UB 4FLXA 1S1TA 3HP9A 2W9CB 1WSHA 2D0BA 1RCHA 1L3VA 5J2NB 4FLVA 1SH3A 2AGPA 4G1QA 3HPGA 4ELUA 3V6DB 1RBRA 1FKOA 5DLFA 4M95A 1DTTB 4DFKA 4I2PB 4CE9A 1XR6A 1WSGA 3KLGB 1WAJA 3O4QA 1RT7B 4TLRA 3NAHA 1FK9B 3CYMA 1D9DA 3FFIB 4N56A 5KFFA 4WZQA 5HRRA 4B8AB 4CIFA 2E9TA 5F8GA 1RTHA 4F4KA 3SQ1A 5C24B 4E7HA 4GC6A 1C0UA 2ALZA 3AA3A 2E6MA 2KQ2A 3PW4A 3OS1A 1D9FA 3M8SA 3KLHB 2E9RX 4CK3A 3OJUA 2E4LA 2RF2B 4K4ZA 4FJMA 3GILA 2HVIA 3DLKB 1A5XA 3KLFA 3TQ1A 1EETA 4EBDA 2D0CA 3HXMA 2BQRA 1EP4A 3O4NA 4RG8A 1S6PB 3MR3A 3PW5A 4QWCA 1ASWA 4FS2A 5KFPA 3CVKA 1VSJA 4KTQA 1KLMB 5F8NA 4B8CA 5DMRA 4BE2A 1WNSA 3AA4A 4IDKB 5KFCA 4Y2CA 4MQ3A 3TWHA 3LP0B 1Z4UA 3KJVB 2AGQA 1VSLA 5DQGA 4IFYA 4J9QA 4DQSA 4OGCA 3QERA 3NH2A 4BWMA 3QESA 4CF2A 4DFMA 3HSTB 4CGIA 4H4OA 4EBEA 2ETJA 4J2EA 5SWMA 3CDEA 4KHSA 4FM2A 2Y1JA 2W9CA 4W5RA 1RNHA 5J2NA 1TKXB 1XHZA 5KFDA 3DLEB 1FKPB 1GOCA 2FVSA 3VQQA 2Q3SA 3NF8A 2V4QA 1ZBFA 1S4FA 4ED7A 1D5AA 1Q8IA 4K4XA 4DS4A 3KLGA 2BGGA 1IM4A 4JS5A 4JRQA 1SL0A 3DRSB 3NL0A 2J6UA 2PY5A 2OPSB 3ICLA 3RWUA 1RT7A 1HYSB 1FK9A 2R8HA 4CF8A 1QAJA 1IKYB 5KFVA 3FFIA 3TANA 4CJFA 4RU9A 4Z4IA 4LQ9A 3S9HA 3T5KA 1UOCA 3OYAA 4NRUA 4N76A 1U45A 5EU7A 4FJ5A 4CF9A 4CFBA 3LANA 5J2QB 4KHQA 3DMJB 1SKWA 3V81B 3LP1B 1HMVA 3KLHA 2WTFA 5KG3A 2B6AB 3JYTB 4ZVEA 3ZSZA 3KD1E 3QEWA 4M94A 3ZT0A 3HKWA 4BE1A 1S9FA 1L3SA 5HROB 4LSNB 1S48A 4F3OA 3NH0A 1XWLA 1UA0A 1WSFA 4IDKA 1QTMA 2VG5B 3FRZA 1RYRA 3OL8A 3D45A 2P5OA 4CJPA 3DM2A 3MEGA 2WOMA 3QLHB 1S0MA 3SFUA 2XGQA 1G15A 3L3VA 1TKXA 3ZT4A 3QEPA 1FKPA 4FJKA 4O3OA 4F2SA 3ZSOA 1T03B 1EXQA 1MMLA 4KKOB 4EYIB 4WE1B 1TQLA 4J9RA 4O3NA 2FBVA 1XR7A 3DRSA 1JXLA 4ECUA 1VSFA 2HHXA 3AVKA 2OPSA 1VSDA 2PYJA 4CK2A 4LD0A 3V6HA 4UQGA 1HJRA 4MKAA 3DOKB 1IKYA 1TP7A 1NKCA 1LWCA 4FJIA 1ZTWA 3NF9A 4HHTA 4Q43A 4DSKA 1TGOA 3ITHB 2IC3B 2C22A 3DDKA 5J2QA 1WSJA 3DMJA 1JLCB 3LP1A 3OSPA 4QPXA 2W7OA 2FBXA 4J2DA 5KG0A 5KFNA 2G8VA 1RT4A 2B6AA 1VRTB 3T5HA 1TKTB 3DOLA 3ZCMA 5HLFB 4TXSA 2HVHA 3AVCA 1RT2A 1D1UA 3OJSA 3EYZA 5DGAA 1XR5A 3RMCA 5CYQB 4C8LA 3LDSA 5FDLB 1C1AA 2QV6A 4FJNA 3N6NA 4WYWA 5C42B 4Y2AA 3K5LA 1QSLA 2HWIA 4ELTA 3V1RA 5I3UB 4NLOA 4RW7B 3DLBA 4DSIA 4N5SA 4KREA 3ZT2A 4KKOA 2YHAA 4TY9A 4WE1A 3QEIA 2XO7A 4FBTA 2ZE2A 1S10A 2YNIB 1QE1A 4R8UB 4NCGB 5J2PB 3CO9A 1XHXA 1S9EA 4XPCA 4ZVFA 4ECQA 1UAXA 4ECRA 3KLEA 4RW8B 2JEFA 3DOKA 5DK5A
chains in the Genus database with same CATH superfamily
1ITGA 2PMWA 2YX4A 1YJNS 4K4YA 4P52A 3SBGA 1Q5VA 2QWMA 1QLNA 2P6TA 1BY9A 5FLXY 3EUNA 1XC3A 2HNDA 1FRMA 2ITGA 2YNHB 3QRPA 4JI0F 3P83D 2C2EA 4FF2A 2P9SB 2O8DA 2OEKA 5LT5A 2QA4N 1W2IA 2N82B 4JI3F 2O4GA 2CVEA 1BQNB 3V1QA 5CYQA 2QKBA 4J9KA 3TA1A 3T1YF 4HEA9 1TL3B 2F8MA 1B70B 1SKSA 2W2NP 3DN9A 4WFBQ 1WORA 1TK0A 2P9NB 2GQ2A 3N5FA 3QEVA 4DV5F 3OQ2A 1OWXA 2DTJA 1C0TA 1NGEA 4P9SA 3OUYB 1NK6A 5KFGA 3VGUA 2KM8C 3CJCA 2HFZA 4JKFA 2YNIA 3U1MA 1HLUA 1DTQB 3IN5A 5A8WA 5J1EB 4USWA 1E6VA 3ENOA 2CIMA 2QW9A 3M9OB 3P3DA 5KPZA 3CG7A 1FCAA 3MMJA 1FDBA 4ED2A 3J8AA 1HWLA 4RNHA 3K5PA 3H46O 2CPIA 3MI7X 2RDDA 4NASA 4E0DA 3T5LA 2FGCA 2AKWB 1RTDB 1P27B 5K5MA 3AAQA 2WHOA 3SDEB 1VMBA 3QT8A 3X3UA 2DR7A 4GW6A 1PC5A 3SV3A 1GLCG 4O5FA 1BQNA 3UNYA 5HVFA 4EAHD 2HBZB 4JOUA 2C3OA 1S1XB 4HKQA 1TL3A 2HFOA 3MCPA 2M2BA 1NLKL 4X4SA 2LA4A 1U2VB 3OBIA 2M9KA 1CJKB 3D7EO 2XI2A 5HL7L 1VQKN 1LWFB 3N5BA 4A59A 1N4LA 2P9GA 2J76E 3I8BA 5HOOA 1OSCA 3HHLB 4LSZB 2YHBA 4DUTA 4CZMA 3KNGA 4WFNL 4IFVB 3VQ6A 4JK7A 2R2SA 5BPNA 1R7IA 1DTQA 2DR5A 3THWA 3V6JA 4DV3F 4ILLA 3OR1B 5J1EA 4USKA 5AXMA 3L09A 2X3GA 2R2RA 2EG1A 3G6XA 1Q9YA 4M5DB 2YCHA 4CK1A 5C5JA 2UUCF 4JS4A 4FJ7A 4JKHA 3A8YA 2X6SA 3LPTA 4J9OA 4JI0J 2YX6A 1QZ5A 1RTDA 3TTCA 4YMEA 2R7YA 3DAWA 4CLTA 3AV9A 3SDEA 5DM7Q 4JYAK 4RUCA 2WK4A 3T6BA 4JI3J 1J5OB 1F3FA 3W5YA 3R6MA 1JLFB 3OW2M 1S1XA 4DPOA 4Z4FA 3T1YJ 2UUAF 2HPUA 2W9BB 3OYGA 1U25A 2GJFA 3VZHA 1H6KX 2MMYA 4Y3CA 3W5ZA 1YX2A 1LWFA 8ATCB 4DV5J 4EO6A 1N6QB 5C15A 3RMAA 3OS2A 3CHWA 1APSA 5BN8A 2BV3A 4CNYA 3U27A 4ANEA 3D1QA 2KZZA 3PLAA 3G0ZA 4WU2A 5CY4A 1BA0A 1S3XA 6FDRA 4ER8A 1HBUB 3US5A 2QN6B 3ULEB 3JAMU 3OR1A 3CSKA 4FLTA 5F9LA 3A5OC 1HWUA 3QNOA 2HAFA 2KFYA 3AB4B 4J9SA 4URSA 3CJAA 4FF3A 5HANA 2EC0A 4M5DA 4WP3A 5GIOA 1T9VA 1RGIA 4ZS6A 4C6AA 4DV6K 4BY9C 4RUAA 2D9OA 1FRHA 4CJSA 3R6GB 3VF0B 4V19J 1Q1KA 3A3PB 4DPWA 1OPZA 2UUWA 3JB9k 2HFSA 2HVZA 2QWQA 3OFFA 3IMQJ 2ZDOA 4M63A 2JNJA 1SL1A 3HJVA 5C10A 3Q8PB 4RW4B 1J5OA 1JLFA 4DV2F 3W61A 3M1FA 2UZAA 3H7HB 2DGTA 4B9LA 1VIXA 2W9BA 1UP1A 4ED0A 2FDNA 5GAGI 1VIOA 2F9WA 3NHGA 3H1QA 1E6YB 3SSRA 2HHQA 1O13A 2GMJA 4CHPA 1V4TA 4OI4A 2MQOA 1PCAA 4X4RA 1H98A 2XY6A 2KHOA 2M3DA 2OSRA 2WFBA 4X65F 1KVIA 2WB4A 4F36A 4OJ3A 1YRXA 1A0OB 4HTIA 2ZQBA 1B92A 3VHQA 2FLNA 2CKWA 4P2XA 3AVFA 3ULEA 2V2ZA 4NYPA 3PX6A 4DV3J 4NLVA 3MN9A 3TWZA 2V4RA 1LW0B 1RA6A 3V4MA 2FVRA 1KSPA 2RIJA 1RGVA 2VJUA 2UUCJ 2F8SA 3R5BA 3K57A 2V8PA 3SCJE 3OYBA 3FE1A 5LSOA 5I9EB 3CM5A 3OLAA 5GAEI 3QWPA 1WHVA 4Z2XA 1FRJA 5GINA 3PJ9A 4GV9A 3ZSXA 2Q6BA 5L38A 2VH7A 4LF8K 4JI2K 3CTRA 4CIEA 4L73A 1UJ5A 4B1WB 4RW4A 3IWNC 1NWKA 5HRNA 3OHRA 2EK6A 3UO0A 4DXLA 2GELA 4O44B 3KJVA 2UUAJ 1AZSA 3F2KA 4IOCL 3BH6B 2UXBK 4CGDA 2A1BA 2RS2A 2HK2A 2DEIA 3ZSQA 2VQFK 5J2MB 2EX3A 5CCLA 4CF1A 4K0KK 1WC3A 3DGVA 3BP8A 3W7BA 2O5DA 4CEEA 4CHQA 4KB0A 3ZXWA 4LIWA 3EVMA 2H4WB 3OD2A 4U67Q 3HZ6A 1Q9XA 1HD1A 3ZX0A 1UZHA 1XJWB 1QJHA 2ACYA 3AGKA 3FZLA 3MECB 2FLLA 3WNEA 1Q86O 1LW0A 1CJVB 2HS4A 4NLSA 5A76A 2NPIA 4OYIA 1HYVA 4LFCF 3PR5B 3HFKA 3V81A 3FZKA 1KTVA 4OZ3A 2CH5A 4PYAA 5DDQC 2EBEA 1BIZA 1NK4A 2VC0A 1EZZB 4CT8A 4DZDA 4U6PA 3MXHP 2IFXA 3FMBA 4NI2B 1ZAVA 4YEAA 3BSOA 3M32B 1T3OA 1EIYB 2RD5C 4OJHA 3M9NB 2YNFB 3PZPA 1FX4A 3GIIA 4ZPCA 4DV2J 1ICEB 4O44A 3H20A 4RNOA 2DNKA 4JV2A 3QLHA 1NGHA 2D69A 2PA8D 2HHSA 3UCUP 3C2PA 2XMUA 4RBUA 3NMUA 1KVBA 3MM9B 5J2MA 3JSRA 3TZWA 3H2LA 5AQLA 4YR0A 4BHQA 2CQ2A 4XTTA 4N7TA 2OTJS 2PBDA 4WTOB 3WNGA 4L75A 4HUEA 5AE2A 4A48A 4X65J 1QQOA 2HW3A 3HI9A 1FXLA 3H5UA 3AO5A 1XNRF 3VF2A 2YKPA 2DRAA 3MECA 5BYSA 4C4WA 2NQPA 2Q2RA 1AFJA 2MLXA 1YIJN 2OPQB 2M70A 3O6WA 4F4ZA 3U9DA 1RWPB 4ZOSA 4FZVA 2E5LF 3SQOP 3GFZA 1NPKA 2VG7B 4Q45A 1XMQF 2VG6B 5F3TA 2V52B 3EDRB 2GJIA 1U26A 1MWZA 3DXSX 3J81Y 5AQQA 4KH6A 4NI2A 4B9UA 4Y2MA 1RCOB 1JCFA 4J7CA 4GVMA 1T6CA 4KPCA 4A4JA 1GT8A 1U48A 3VAFA 3MK6A 2CQIA 2CPXA 3MMCB 1LW2B 1SQKA 3ZT3A 1T9UA 4TN2A 3WT0A 2XMMA 2B9YA 1OPIA 4FK0A 1NH7A 1QQCA 2H5JB 4R5PB 1Q86T 2UXDF 3MM9A 2H5EA 4ZVUB 2DXDA 2QWPA 3CJ7A 3UD5A 5AE1A 3H2UB 1CJTB 3BJYA 3UPFA 3TPQA 5GADU 2LQ9A 1H7XA 3NGRA 3DU6A 2I8EA 1JK9B 4QCLA 3O2IA 3GONA 4LF6K 4E8UA 4EYHB 4LBPA 1RBTA 2MQPA 4XH5A 1BL3A 2OPQA 3UN2A 3MPYA 2OZSA 5HSPA 2NRZA 4CNZA 2P9CA 2QWNA 4L3NA 1AT1B 3VVUA 2QMXA 4LFCJ 1H7WA 2VG7A 3AH6A 3QRRA 4Q0BA 2V2QA 2VG6A 1QAXA 2DEJA 1WB9A 3ID8A 1X5OA 1HI8A 2CDRB 1VHXA 2VA3A 1HI0P 1HWIA 5FPDA 5KAKA 4ZTFA 2BABA 3L4BC 1F5AA 5IWAF 2V6AA 4BRKA 1AB8A 3TX8A 3UQSA 3NOCA 2NLWA 1LW2A 4KFBA 4ISEA 1VSKA 4HCCA 3AVIA 3DYAB 2GMLA 2BACA 1PAEX 2DNZA 2EC2A 1S99A 4CGGA 4R5PA 1P8GA 3RG6A 5B7WA 2E88A 4IBNA 5F0WA 2PI5A 5DM6Q 2XZDB 1KFDA 1CJTA 1V3SA 4A5AA 4I6MB 1U2FA 3M05A 4P73A 3R5JB 3R7SB 4UY85 4AXJA 2YBVA 5KG6A 3JSBA 4CJWA 2XMJA 2HAIA 1S6OA 3MDFA 5DZ6A 5KFMA 1XNRJ 1N5YA 4JKGA 2F3JA 1C4CA 3W5XA 1NK9A 3KJFB 2Z30B 2FBYA 1S1UB 1R6VA 3AD8C 1LV5A 5H9EJ 2P9LB 1EKSA 2E5LJ 3ETMA 3HOTA 3E9PA 1DKGD 4CEOA 1XMQJ 1EKEA 3TI0A 4JV1A 3WXIA 2CQGA 1NZAA 1IWGA 1EJ7L 3VF6A 2QFIA 1BI4B 3V2UC 3H1VX 3T5JA 2XY7A 5AQTA 1VQ5N 2IBKA 5DG8A 3NGIA 3C19A 1PKUA 3UD3P 2DVIA 4BR4A 5A2QU 2ZBQA 1QUVA 4DG1B 4I56A 4UQTA 4FO0A 2EEYA 4ZIVA 3H25A 3PEHA 3ZSRA 2OFGX 3IG1B 4DCOB 5KOWA 5IT4A 2W8KA 2M0GB 1NGFA 5BRDA 2Z1GA 4AQYK 2FB0A 1RBSA 2UXDJ 3ZTOA 3L2WA 2CGJA 1YJ7A 1RACB 2KN4A 3CO0P 4A62A 4K4TA 2X1FA 2QSWA 5KG1A 1AROP 2KYXA 5C25A 3AAWB 4JYAF 1NJZA 1W2BM 5GMEA 4RNFA 1YVUA 3OY9A 1JLQB 1H2TZ 2M88A 3MCNA 5BPMA 4CHYA 1FDAA 4FVMA 3NAIA 2LLZA 2ZEJA 1TMMA 4URGA 1S1UA 1CQMA 4DL7A 1KR4A 2P9LA 2BOAA 4A5BA 1VBXA 4DFPA 4NLBA 2DK2A 4P2SA 4JI5F 2UUBF 4PQAA 1SJ1A 3KMSA 1SC4B 4USTA 4KAIA 3FCVA 3CE8A 4ID5A 4M5NA 4X64F 1BI4A 1QVGM 1U1RA 4YY3K 2HG4A 3QGGA 3GV8B 1U1QA 4WPAA 1R27B 1WJ9A 3RGIA 3BSCA 3CMES 4FJHA 5IWAJ 1CC8A 1BHNA 4CLFA 4NLQA 4DG1A 4YR2A 4KT0C 2YX1A 5F2RA 1TZ0A 4IYQA 2WSFC 4RO0A 1OY6A 2YTCA 3IG1A 4H5TA 2AHOB 2ZKTA 3L2RA 3RBDA 3VOVA 4ZDNA 3CCMS 5HJYA 3BB5A 3VEYA 1ROFA 3MZIA 4LF9F 1CJUB 2JEIA 4NA2A 3R3LA 2CQDA 3D0PA 2GGPB 2GV9A 4NLTA 1Q7LB 3BBFA 3FCWA 2CAJA 2WBNA 3HJFA 3MEGB 4YFUA 3K2YA 4B9VA 3O8MA 4Q7AA 4FKXA 3CMQA 4PPZA 3VQ7A 4IKAA 2EXUA 1JLQA 1ZM3A 1EX8A 2DRDA 4OI0A 3H90A 2WC9A 3IA0A 3RSEB 3B6PA 1XNQK 3NOGA 4CLPA 1Q4RA 2YPZA 1GTHA 1WHWA 1A7GE 2IVYA 2D9PA 1IBMF 3MPWA 1LWCB 1QQMA 3OYCA 3KHGA 1U1KA 4TQRA 3L7UA 3MFIA 1JB0C 3CCVS 4ECZA 1KKHA 3QBWA 2HBQB 1XERA 2HEKA 2BUNA 3P5JA 2RILA 4YOYA 1GXUA 4JKCA 2PEBA 2V4JA 2MY7A 4OYOA 4M3RA 4FJLA 2ZJPQ 3E66A 7AT1B 2BUPA 4BREA 3LWLA 1BUXA 1EWQA 1IR0A 5JVHQ 4OV1A 1VYAA 2V34A 1CJUA 2YY3A 4QAGA 3VAJA 5K8OA 5I42B 3R5AA 5CYMB 2GGPA 2G0IA 3GB0A 1XQIA 2W4DA 3M8YA 1SIWB 3F5TA 3R7NB 1TKDA 3D6MB 4JYAJ 4GNIA 2JZ5A 2P9IB 4DUZF 2QMUB 3MN5A 3C8YA 3EZWA 3QNNA 3SK3A 3IDHA 4K4UA 2DT9A 1VK0A 1PSDA 1QE1B 1X5TA 2G0JA 4KV8A 4IFEA 1LXNA 5KT5A 3BH7B 1RBUA 2IVMA 3EGVA 4JI5J 4KTWA 3S41A 1VSEA 2UUBJ 4M45A 1SXLA 3VAHA 5GAHU 2BX6A 5ETTA 4DL4A 3QIPB 4MLHA 1EQ0A 3UDCA 3FZMA 1UJ4A 4B3OB 4X64J 1ZS6A 3TNVA 3NY0A 2ILYA 5KQDA 2B8PA 3UN5A 1TVRB 2ZOGA 2IM0A 2V2VA 4P2MA 1YXQA 1VRQC 2CPJA 2EFOA 4CD1A 2MTLA 1S5ZA 1JJ2R 2GX9A 3HT3A 4LF5F 4FJGA 4GC7A 5AQHA 2HBYB 2J8AA 1X31C 4IQMA 4LF9J 4UT4A 4B1ZA 1HFEL 2VC1A 1LOTB 5I42A 3TUPA 3PXGa 5CYMA 4ZLPA 4CJ4A 1DGKN 1ACMB 2DNGA 3G87A 9RUBA 2WSCC 4AHSA 2P9IA 3PV8A 2RRNA 3L8BA 1NK7A 1OIAA 5DS7A 4F50A 3M9MB 2XMTA 1QHTA 1XEZA 1RTJA 2IIRA 5ADZA 2EHGA 1F2HA 3NMAA 2ZUGA 2F8TA 4CLLA 3VAKA 2EKNA 1FJ7A 4ZCLA 5D0HA 1KP6A 4JHDB 4K2JA 1N5QA 4IXCA 1PO6A 2MSTA 1IBMJ 1NJIO 2G4BA 3A5NC 2AU0A 1D3WA 3GG0A 3U3GA 5LMNF 4B3OA 4X4TA 3J7YI 3KXDA 1RTIB 3V9SA 2PIIA 3UKUB 1TVRA 3GE1A 2RRAA 1IJJA 3EEQA 3GQCA 3Q23A 2Q1LA 4P2FA 1Q0NA 3L2UA 5HO4A 1PIEA 2XULA 1HNXK 4E7IA 1ZA1B 2VDIA 3CM6A 1LAVA 4IO9L 2V51B 1N33F 4JUZA 3DXBA 3JS9A 3WXMB 4DFJA 2CNKB 4K25A 3RAMA 2LU1A 4HYKA 3CIPA 3QZ8A 2XI3A 3CJSA 1HHTP 3F9KA 4FPAA 1K0TA 1F1BB 4DTJA 1FFGB 4ES1A 2CQPA 4ZP9A 1DURA 2RVJA 2BJ8A 4CFAA 1B64A 2OELA 3OHAA 5EOYA 5H9FK 1IG8A 4AT1B 3CJRA 3SCLE 5KFWA 2V9WA 2DPJA 1B4SA 2P5VA 2QA4G 3GIKA 5B09A 1RAFB 4WFXA 4XDCA 3LPUA 4NB4A 3MF5A 3RB3A 3GYGA 2Q6CA 1VLOA 1BWFO 1JLEB 1NUEA 3POTA 1BIUA 1KRPA 2GIQA 1OS5A 5B08A 2ZD1A 2OHDA 4NLYA 4BRNA 2RAQA 5A0YB 1RTIA 2C28A 2RMLA 3OFEA 3UKUA 2IJNA 3UW1A 5IV4A 3A4TA 4C3KA 2Z1HA 5F0XA 5DDPC 3I33A 4OYAA 1W25A 4LF5J 2E6LA 1VR6A 3A5LC 3AOBA 4DTPA 2ZBCA 3CT9A 1KHVA 1IKVB 1ZTTA 1UWAA 1KD1T 1REVA 1R0CB 2BA9A 3GZ7A 3VQBA 1NJIT 3QIOA 1S1TB 2MLYA 5ETNA 4KH1B 1VJWA 3I56S 5EUHA 3HFVA 1TUUA 3CIZA 4ES3A 3NF6A 4DTNA 4ALZA 4I7FA 4K4WA 2DNHA 3BN4A 2Q36A 1U1NA 3O3LA 4BRPA 3MXJA 2C3MA 3L9ZA 5AFUA 1HPMA 5EXWA 4CRJA 3HMJG 2RN2A 3A8EA 1JLEA 2AX1A 4WYLA 1DQ8A 2A1SA 1TELA 5LMNJ 2BJ7A 3Q7BA 3FZFA 4PHTX 4P72A 5A0YA 3VGSA 4I9LA 2I5JA 4BS2A 4KSEB 2CPHA 2WVDA 4KY3A 4JAXA 3UR3C 1IJEB 2MSSA 4CO5A 2O4IA 2L41A 2ZFHA 2Y9HA 1GMUA 4FXDA 3LH2S 5HBMB 2W25A 3DDIA 1UWBA 4KC5A 2H9ZA 2DFEA 1N33J 4LMZA 4TY8B 4MYUA 4A8XA 4R0JA 4O3PA 4H5VA 4M3UA 4KAZA 1IKVA 1BG3A 1J9AA 1SVDA 3DHXA 2QWOA 1S1TA 2W9CB 1Q81O 2VKRA 5J2NB 4RUBA 4ILMA 3V6DB 2B51A 1FKOA 4M95A 1WSGA 1WAJA 2QA4S 1U2RA 3NAHA 5D78A 3B8HA 3CYMA 3CB4A 3S6EA 3FJ2A 1YZ7A 5KFFA 3R1LA 4B8AB 4CIFA 1IBKF 2PDAA 2A3ZA 3MMVA 5K8PA 3DWLA 2KQ2A 3PW4A 3IWLA 4B02A 1NGAA 3OVAA 2RF2B 3GILA 2HVIA 2H65B 1REGX 4M5HA 4YB1P 3HXMA 5JICA 1EB0A 1S72N 4LRCA 3CEDA 4QWCA 2E2QA 4O8UA 1VSJA 5F8NA 3O80A 4BE2A 1WNSA 1D9AA 3AA4A 4IDKB 5KFCA 3ENAA 3LM9A 3TWHA 5BYRA 2AGQA 5BREA 4A61A 1VSLA 2Y1LB 2RJZA 2VODA 3QERA 1K0VA 2C3YA 3QESA 3SMSA 1YJVA 3HSTB 2L9WA 2QL5B 3N4WA 4EBEA 3GMGA 2DH9A 4ZCKA 1KS2A 4QYZJ 4FM2A 3ET6B 2W9CA 4BC4A 4F3MA 4W5RA 5J2NA 2I9SA 5KFDA 4CO4A 5LSLA 4C11B 5ETLA 5B0GA 1ZBFA 1MN9A 3W8GA 3H45C 1D5AA 3KUGA 1Q8IA 4I0WA 2GIFA 4Y2KA 3VETA 1X4GA 2OPSB 1F9EB 3ZX2A 3TZYA 1F2GA 4CF8A 1QAJA 1IKYB 1LXJA 4H4KC 3NGKA 4NRUA 4N76A 1U45A 4EU0A 1VQKS 4CFBA 4FKYA 5J2QB 4Q2LA 1NH8A 2Y0BB 1LK5A 3JYTB 2MZTA 4WQ5A 2DO0A 4ZVEA 1L3KA 3ZSZA 1Q81T 2NYHA 3OVSA 3ZT0A 3HKWA 4DX8H 3CC2N 5IT9O 4K43A 5HROB 4LSNB 2ZC4A 3NH0A 1UA0A 4IDKA 2VG5B 2NRVA 2QEXS 1RYRA 2J8SA 4B3TF 4EIAA 2QJ3A 1VQ8N 3DM2A 1G3OA 1QVGR 1RHUB 4ZA1A 5HVHA 1S0MA 3SFUA 4OI3A 4OZNA 4JB8B 2CADA 3ET6A 5AQSA 3SAFA 1UVKA 3KYLA 4I67A 1T03B 1VISA 2BKNA 1GAOA 4EYIB 1SS6A 4CJ7A 4JV5K 1XR7A 3D0IE 3FZ2A 2ASOA 4QBUA 3F56A 3AVKA 4AF1A 2OPSA 4GMKA 2QG9B 4LD0A 2RSQA 3VCDA 4W98A 1YHQN 5L9NA 1WUUA 2I7NA 3ELHA 1IKYA 3DRXA 4OX7A 2LQBA 4NZ7A 3NF9A 4HHTA 1IBKJ 3ITHB 2IC3B 1ATRA 4C98A 2OTLN 2C22A 4MO5A 5J2QA 1JLCB 5KG0A 4DU8A 3CMAN 2G8VA 3R8EA 4JI8K 2JJ4D 1CULB 1Q7YO 2ZJQL 2V63A 3R8YA 5D77A 1J5EK 4J91A 3AVCA 4BRGA 3G82A 1XR5A 4ZVOB 5IV3A 2IVNA 5FDLB 2BZ2A 3GG1A 3N6NA 4WYWA 4CYUA 2Z2YB 4J37A 3K5LA 3T1HF 3EE9A 3V1RA 5I3UB 2QMWA 3D2FB 1NSAA 4FWQA 3BO2A 1MMNA 1FFWB 1A9NB 3SBMA 2GHPA 1GLEG 2QLWA 4MAKA 2GVZB 3MCMA 4NO7A 1NEEA 2ZE2A 1S10A 4U7UK 5LJ3Y 5C2DA 4NCGB 5J2PB 2KB2A 4RBVA 3CO9A 1XHXA 4WF9L 4XPCA 4ZVFA 5HL7Q 2ZZNA 1NBWA 4YB7A 1UAXA 2FHJA 4ECRA 3KLEA 4PXBA 1HW8A 4B1VA 3RBXA 1FDNA 3LTOA 4CJLA 2WRMA 3A0IX 3J80Y 4CGHA 2NUHA 1VK3A 2IC3A 2YI1A 2IM3A 3LUYA 3IP0A 4DTUA 4WFNQ 2VOPA 1JLCA 2UVUA 2DGUA 2J6TA 3LDLA 1KTQA 3CFPA 4MKBA 4IOBA 4PG7A 1FEEA 3IKMA 4E7JA 1S22A 5DDRC 1SBRA 2HF4A 1WELA 3MXIA 4K4SA 2ZVIA 1U09A 5B0EA 5FDLA 2NZ4A 1GMWA 2XC9A 2GFFA 2GC8A 4CLZA 1WC0A 4B3TJ 4CLUA 4CIGA 5I3UA 1QHAA 4CI6A 4W5OA 5FLXO 2AEMA 2R7WA 2DR9A 5AQFA 4OZ5A 2HNZB 2BEFA 3NEKA 5CD4A 3RAQA 2ZKUA 1S0NA 1C6VA 1SAZA 2CJXB 1Y3KA 2MKKA 3WIVA 2IJRA 2UYTA 1FF2A 2RHQB 1Q7YT 4C1NI 2GTDA 1T05B 3HK2A 3ZFVA 2BOPA 1K8AO 2DO4A 4TU8A 1RQ0A 1S59A 3BEGB 2IVPA 1YT3A 4PG6A 3CJ0A 4JI7K 3M8ZA 2MY8A 1Z1ZA 3VQ5A 2A18A 4USMA 1RDUA 1JLAB 4DR5F 5JVGL 3P5TL 2OEJA 5M2RA 1HBNB 2D0AA 4KBIA 2UVRA 3LGHA 4DV4K 5BR8F 3W9JA 1QTNB 1RFQA 4I4BA 5AQYA 1RAHB 2RU3A 4GKJK 1VQYA 4QS7A 3GSDA 4CHNA 3PFOA 4DU1A 1B0TA 4EEYA 4ECYA 1F60B 3RR7A 3JAMY 3W60A 2XY8A 3T1HJ 3D68A 3J81U 3T41A 1IVZA 4F4XA 3I5BA 1NKBA 3OA9A 2HNZA 2DXFA 4AHTA 2KFZA 4P7VA 2ZZTA 2VWJA 3EJMA 4CM0A 4DR4F 1FRLA 2O8BB 2G1HA 1VQON 2D7SA 3SV4A 1T05A 4F02A 1LWEB 2L9NA 2I6WA 1WDTA 1O5JA 4KHPK 1YJ9S 3DRRA 1UFWA 4UOHA 5EGYA 3CJ5A 3AD9C 4DN9A 2AYEA 3D5MA 2HGMA 4MTPA 2QSFA 3H5YA 4RNMA 3V9WA 4MFBB 4DF8A 2RUGA 1HBNA 1C1CA 2KRRA 2FVQA 1NM2A 1JCEA 3WXJA 1NCLA 4BC3A 4LFBK 1OH8A 1HBMA 3CQ8A 2JFKA 5KFIA 4ILJA 4DR1K 3W1YC 4KIAA 1YIJS 4CJKA 4I9QA 4RTFD 5IT0A 4LC9B 4KR0B 5M2UA 3P8BB 1GOBA 3QICA 2LYVA 4JKDA 4TKTA 3O44A 3KOAA 1UTAA 2X74A 1R31A 3RTVA 1MROB 2KDOA 4J9VA 4CGFA 3V9XA 3PO5A 3QEXA 3VMFB 2FXUA 3VQAA 1SJ4P 4LY7A 1HNVB 4PG4A 1VHFA 2O8BA 2N4DA 4IOCQ 2O8FA 2WVBA 4CFCA 2XWXA 2F65A 1LWEA 2LEBA 1T02A 2GUPA 2WCXA 3EPGA 3GL1A 5KFJA 2AJFE 3F73A 2KFNA 3GG4A 3MPUB 3D6TB 4IWVA 3IBCB 1R6YA 3VQCA 3QJLA 4K41A 1YITN 4P75A 1LFWA 3PW0A 3C14B 4NXNF 3O9QA 2BJ1A 2LSNA 2DNQA 4PPDA 1NGIA 1WBBA 2A1RA 4DR5J 3SI8A 3HD2A 4JI4F 4KE5A 2KT5A 4WFAQ 1K6YA 2UXCF 4PQUB 4NEYA 3ATVA 5CZ2A 5GMKa 5BR8J 3LW5C 4BRMA 3PACA 3AO2A 2ASDA 4YOEA 2KZMA 1UMJA 1TL1A 1N32F 4N47A 4O0JA 2JH3A 3VPZA 2B7CB 3OR2B 1SL2A 4CHOA 3C6UA 3MM5A 3RYLA 3QT6A 3OYDA 4DSFA 3W2VB 2FC8A 1DJ0A 1JJ4A 4KO0B 2BE7D 4FYVB 4MLEA 2N3LA 2KVIA 4CHZA 3CF5L 4CJEA 1DTTA 3OVNA 4ZJLA 1HNVA 1QM9A 3NWGA 3M8QB 2KYZA 1RISA 1L5UA 4DR4J 3I5CA 1DT9A 3I96A 2A42A 3TU5A 3CIMA 2PZSA 4NX9A 4EWTA 1HUXA 1YBTA 1HRHA 5KFEA 2MB0B 3BV8A 3JXOA 3UE2A 2D4WA 2HBJA 4WQ4A 2KM8B 3LZJA 2Y8WA 2GO9A 3C14A 3M30B 2HRUA 1MNEA 2CDQA 5A8RB 1FFSB 2YX7A 1GQEA 2XLIA 3DLKA 2XB2D 1Z6RA 3NKYA 5DO2A 1ZA2B 4CEZA 4ZVPB 3RB4A 4FPIA 4A8YA 4A2BA 2LQJA 3HHLC 1RCXB 4ZPWR 3B6OA 3UVJB 4QIVA 2VICA 1S6QB 3V9ZA 3J7AN 5T41A 3LP0A 3H2VE 4OYWA 2F4FA 4H0XB 4DL0C 1CPZA 2ZHBA 3H42A 3AVHA 5MLCV 5HRPA 3WC2A 1TAQA 3W2VA 4UZCA 4KO0A 5IOLA 4WK3A 3DLEA 1QVFR 2DH7A 2VWKA 2MQNA 1HLWA 2BJ3A 4FWLA 3TAMB 1VQ5S 2XO6A 3MURP 1S1VB 1MSWD 2FJWA 3DFEA 1TUGB 1T3NA 5LSRA 3GYNA 5GAGP 5E41A 4V19S 2J9DE 2QFJA 1U4BA 2NXUA 2F9JA 4Z4EA 4B9QA 3PJXA 1IUJA 3MN7A 5C12A 3VAIA 2PAVA 2DBBA 4NXNJ 4GKKF 2DITA 3KTQA 5A8RA 2N4CA 3CULA 2HB5A 2A2DA 3UFCX 4JI4J 4B08A 1UPPA 2UXCJ 4JV5F 3DOMB 3MAAB 4LRDA 3V6KA 1SB6A 1WSIA 5IM0A 1FJEB 3DU5A 2HQ3A 2KI2A 3UVJA 2D0OA 1S6QA 4KHNA 1FE4A 1NHUA 1N32J 4F0KA 4JRPA 1U1PA 4XIUA 3E9LA 3EKSA 2IM2A 3Q8YA 2PMHA 1GLFO 2I38A 4O5BA 5GAEP 2OD6A 5F8IA 3HPHA 1S7IA 2JL9A 3QT5A 2YKOA 3KMQA 2GZOA 2GEMA 1N0VC 4ZPTR 4JI8F 2IYGA 3D2WA 1IM6A 2IVOA 3TTFA 3HSGA 1J5EF 4IO1A 2FGOA 3CJKB 4JI0K 3LF0A 1V6HA 2G8IA 4GMJB 2G8UA 4X4OA 4PXEA 3MXMA 3W66A 1C0GA 3BS9A 4JI3K 5DJBA 3EX7B 5CAAA 4KGMA 2HHUA 5D3GB 4X66F 5AXLA 3T1YK 3AVJA 1Q18A 3HVRA 1V5IB 5HVGA 3ZT1A 1TKTA 1S5JA 1BLUA 3VF4A 4NPOA 3PKYA 2FLPA 2O67A 3DOMA 5AQXA 4OGEA 1IKXB 4AUKA 2P9KB 4FSVA 1O51A 2LXFA 4OJRA 2AMCB 1PYTA 4QOZB 3EN9A 1HD0A 5C42A 3QGPA 2WUSA 4DMNA 2H4YB 4XDDA 4KGKA 2ZWOA 1A6LA 3N6LA 3RVCA 3AJ1A 1KQKA 2VA2A 2W2OP 1RJJA 4E98A 2B5JB 4NYFA 4N77A 3CQXA 2DNNA 3J81O 1TL7B 1MU2B 3BSAA 4YDDB 1X9MA 1HQ2A 1QUPA 1IBLF 1OVYA 3IGVA 1M90O 2CVIA 4CO3A 4JV0A 3GPAA 2P2CB 3SSQA 2K1RA 4PWUA 1ATNA 3MTKA 1G4CA 4ED3A 1L3UA 3VAMA 1BCOA 1EX4A 4RW8A 4DS5A 3ADAC 2DB1A 1NNEA 2XYPB 3PYEA 3TSPA 3OTOF 3QFUA 3RZAA 2FJVA 5HN0A 3R27A 5TKYA 5D3GA 3AXMA 2CPEA 2KVQE 2ZHAA 2M8DB 4L8RB 4GKKJ 3HBTA 4J2BA 1FTCA 4CJVA 2ZUAA 4QW8A 1NKEA 3M8WA 4DL2A 1WSVA 4CLYA 2MXYA 4TYBA 4E1NA 1JJHA 4GVEA 4JV5J 2YKNB 2C2KB 5T7LB 4KI6A 1IKXA 2YQ0A 1EQYA 1RB0A 3OXGA 3C0BA 2P9KA 3M6UA 4GVLA 3BGFA 3MMBB 3TVYA 4TQSA 2V5HG 1VCTA 1S1WA 2F9TA 1U47A 4M3XA 3CCTA 3TUJC 2QC3A 3O3GA 4H4MA 5IFMA 3MAHA 2JVOA 4QIWD 3HVTB 3A8KA 4DV3K 3I32A 2YHYA 4M41A 2B5JA 4JI8J 4TNOA 4YNQA 3DLRA 3M8RA 4FJJA 3OTDA 8AT1B 3DNCA 4FOIA 2UUCK 3RMBA 3BDPA 3CJ2A 1J5EJ 3IFRA 4GKJF 3VGMA 2ASMA 3L0QA 4FM0A 1GX5A 3HPOA 6FD1A 2I7PA 4BRFA 3CDWA 4KGXB 4JI6F 4U96A 4U9RA 1HNZF 3O1BA 2ABYA 3IXQA 3BR9A 1KAYA 4G9ZA 3CXCM 4WFBL 4DEZA 4X66J 2UUAK 1T9TA 4NE9C 1PBUA 1Y97A 2YHWA 4PA1A 5CZVA 4X4NA 2YKNA 2ZDPA 5T7LA 2ZHOA 1M90T 2YWGA 3CJ3A 3MMBA 4NCAA 4C1NK 3B4DA 2XSFA 2YQ3A 4A8WA 3GV5B 2OP5A 4OZLA 1N8RO 1Q8BA 3M5RA 4EI2A 4DV7F 3THVA 1WF0A 5KFYA 4K42A 3O5TB 3D3BJ 3OT9A 5JMNA 2F8HA 2GW8A 5FPEA 2QXFA 1IBLJ 3A13A 2WW8A 5B0FA 4AL6A 4LFBF 4LRFA 1SPBP 4KRWA 3HTVA 5CHIA 3P6YC 2YKAA 3ETOA 2GV1A 3C46A 4OZJA 1IJFB 1QD1A 3MWBA 2FHOB 3CDUA 2G8KA 3IRXA 1U1OA 4JKEA 1OKJA 1OO0B 1PJ5A 3GFHA 3OTOJ 4YORA 4NLDA 4UOCA 3SMZA 4XH4A 3TABA 3D67A 4QWDA 2BH1A 3GCXP 4WK1A 4Y65A 3M6XA 1NOZA 4IG0B 2KO1A 2P1JA 1ZH5A 1N48A 4BC5A 3M2UB 4DV2K 3OYFA 4ZKAA 3QJPA 4I68A 2JX2A 3M6GA 2N3OA 4WTYA 1WNEA 1KDNA 3T6JA 3SCXA 3KK7A 1BOTO 4A57A 2UV8A 1VBKA 1TU0B 2B4PA 3H98A 3HM9A 4L3KA 3CCZA 5JXSA 4A8FA 3L3UA 1WAFA 1EARA 2JLFA 4RL1A 3PW2A 4ZJQA 4K50A 1SQGA 1S9GB 1U04A 4TVAB 2YPYA 1Z05A 1CG2A 1M5KC 4FWSA 4BVOA 3LL3A 2CPFA 1LWXA 1FNXH 3HFZB 3WDOA 1KQGB 2C2DA 2XM3A 2BKPA 2B3TB 2Z8QA 5L1KA 2MKCA 3C66A 3L4IA 1S79A 3C15B 1JLGB 2YKMA 2R4FA 3N9UC 4GRSA 3IS9A 3BGRB 2Q3PA 1TAUA 1WHXA 4O8KA 2UV8G 3J81j 3N6MA 2ZH3A 4GKJJ 3VV2B 4FN5A 1JJCB 4ZP7A 4Q5VA 1OMSA 1JNRB 2GVDA 4CZFA 4G1PA 4J90A 4CTAB 4JI6J 8RUCA 4HLBA 1Q8LA 1HNZJ 3I0SB 2P9UB 4OX6A 4WU3A 4IG0A 3P38A 1N8RT 3BSNA 4DUYF 3OLBA 2G1DA 2ADBA 5BN9A 1QQNA 3T19A 1U8WA 2C1EB 2E5JA 4B9SA 1XK8A 4BDZA 4W5NA 4ED8A 4OX9F 1GLDG 4CECA 5CQGA 2AGOA 5FPMA 2IDLA 2WBMA 2R42A 3QBXA 2RRBA 3W3SA 5HAOA 3FBCA 4ETXA 1H74A 4OJ1A 2HHTA 1BUPA 3KHLA 1RT2B 1TMJA 2XNRA 3CETA 1S9GA 2OUGA 4GV3A 1YUWA 3UIQA 4USIA 2HYIB 4KHWA 1LQ9A 3BUZB 3KJNB 1K47A 1FNMA 3THXB 2GA7A 4IH5A 4BROA 3N01A 3NDKA 1U1MA 4AILC 3JSMA 1DFDA 4LFCK 3FDSA 5CABA 4N41A 1JLGA 2CGKA 3BGRA 4LFBJ 4FWRA 3PEJA 4IO9Q 3BQ1A 2K2PA 1SKRA 2QWRA 3ZZYA 4DSLA 5THWA 2A5XA 2VD3A 2H5IB 5EX0A 3VVTA 2MLZA 2H51B 3VQDA 2MJNA 1NJWA 1J54A 3C65A 1S9EB 3I0SA 3R97A 3OYMA 3HHLD 5AQWA 4WCEL 3KHRA 1OSDA 2RDIA 1VQ4N 2HNDB 1SUQA 1RLCL 1PBAA 5J1PA 3NS6A 3JXUA 2PO4A 3U7JA 3OBYA 4LJMA 2Z1JA 4DOZA 1K73O 3CWJA 3OYKA 1UJ6A 3THXA 3MOZA 4OYZA 5KPRA 1VOMA 2Y8YA 2EFQA 2E5LK 3DLGB 5LL6Z 3VZIA 2E1MC 3QMLA 4QR2A 1XMQK 2ZH9A 1C0TB 3NGDA 2XS7A 2VPZB 4YOTA 5LMUF 4JNEA 1MWKA 3C6TA 4O4RA 4CO2A 3TW0A 5KFUA 1NRKA 2HOEA 3Q22A 2YH1A 4EGLA 1IBCB 3CFOA 4DU3A 5ELZA 5DZ7A 1YSJA 1S72S 2V8VA 4Y00A 5HK4A 2BJDA 2YWKA 3NCPA 1EQMA 2HBRB 4E1MA 4DTRA 2HQCA 4DUYJ 1ZAXA 4QR1A 1OH6A 4PXDA 1X4HA 2BM0A 2UXDK 4PUOB 3OL6A 1NDKA 4OX9J 2ASLA 1JIHA 4IEEA 2IRXA 1UZDA 3PDNA 2GAGC 4XAKA 1ZBIA 3KUEA 4ES2A 4WP9A 3CD0A 3HHDA 5GAHP 4KHRA 4HL9A 2RKIB 1RE1B 1QSYA 1WD6A 2G9OA 4DSJA 2HQGA 3DLGA 3AQPA 1KN6A 4S0MA 2VHGA 3HVAA 3DLJA 1C0FA 4DTMA 1N36F 2DGWA 4DL6A 3R6LB 2FSNA 4A8MP 3JSYA 1HPZB 5ETSA 2BQUA 3CC2S 1DLOB 2P9PB 4E1JA 4MK7A 4HI1A 3AO1A 3CD7A 5IWAK 4WFZA 4RUHA 4CCHA 3THWB 4A8OA 3BGUA 4NA3A 4HR2A 3LP2B 5KT3A 1VQ8S 3H5XA 2MHNA 2V8GA 4FYDA 1CBKA 3EVOA 1NM1A 1HKCA 4PUOA 2A41A 2I2YA 2L08A 2ATCB 3WXLA 3MAQA 2E8AA 1ATSA 3EZ5A 3PYGA 4CEBA 4Y1CA 1RWXB 3LALA 3CCUN 3TVZA 3O3HA 4R0EA 3QZ7A 4DR6F 3L7PA 1YHQS 2X78A 3J80U 1IR1A 2RKIA 3J7YP 3PHEA 1RYSA 4IUFA 3OYNA 4AHCA 1RAOA 2DHXA 3ZYYX 1RHKB 1IR2A 2OTLS 4M3ZA 3ALYA 4Y34A 2AJQA 1K8KB 3OXLA 4CT9A 3DJCA 3CMAS 5LMUJ 3KKRA 1WC5A 1D0EA 2VQEK 4KQZA 4BR2A 5L1JA 3EXCX 1H0HB 1KOOA 4LR9A 1HPZA 1PC4A 3CCES 4Q2MA 1VC5A 4U8YA 5DQIA 1DLOA 3BF4A 3MR2A 2P9PA 2LQ5A 1B0VA 3NVMA 4C8KA 1I3AA 2DTUA 1CXQA 3B4MA 3FZBA 2HFUA 2OSQA 3VEOA 4I69A 1I94F 1T8EA 2A6AA 3EGZA 3M3ZA 2QEXN 4M3TA 4OLAA 3LP2A 3SUOA 3FGUA 1I6JA 4LREA 4C8MA 3FNNA 4KGZB 2HBKA 4BACA 2Z2MA 4MK8A 1HARA 2WSEC 4YQWA 1GLLO 3C94A 1P90A 2IA6A 1PJ6A 4C0BA 1FE0A 3MR5A 3M2RB 1S97A 1AA1B 2V7YA 1RAJA 2Y1RI 3GBTA 3AJ2A 4AHVA 1UEVA 2E5IA 2XRIA 4AM6A 4WYBA 3W2WA 2LU2A 2DISA 3I5AA 1X3NA 3AGRA 2V0NA 3HL8A 2MZJA 3K9JA 4H4OB 2NRTA 1Y7PA 3HP9A 4JI5K 2UUBK 1K8KA 4FLVA 1SH3A 4G1QA 2XMKA 3MUVP 3HPGA 1N36J 1IN0A 1RBRA 2MQ8A 3ZC4A 2QGFB 2FZCB 1HKAA 4X64K 4EUVA 4DFKA 1XR6A 1SJFA 3THPA 3O4QA 1WEZA 3VEVA 3PSIA 3VGTA 1HWJA 2WAQD 3P39A 4N56A 5HRRA 2R7RA 5F8GA 2HIQA 1KBRA 5HJXA 2V69A 2ALZA 4BRHA 1GEHA 3R9LA 4BRDA 4LF9K 3M8SA 2AA4A 3KLHB 3ZTRA 5MAOA 1HNWK 5M1QA 3OJUA 2DNOA 2E4LA 2HRTA 4Y2IA 1RHQB 4Y0WA 1EETA 3SJHA 2SXLA 4V19X 2BQRA 4V1Ak 1EP4A 3M2RA 3IM9A 4UW2A 2KG0A 3MR3A 4NEZA 3G71N 3CVKA 4KTQA 2J7UA 4DR6J 1VBYA 4BRAA 4A47A 3WHIA 3NXZA 3KJVB 3I82A 5GAGU 2P6SA 3P4UB 1AZSB 5DQGA 4DQSA 3NH2A 4ED4A 2OMOA 4CF2A 1MW7A 4ISFA 1D8ZA 4H4OA 2ZJQQ 4CGIA 2UU9F 1FERA 3P45B 2Y1JA 2VBWA 4ILGB 1IBMK 1TKXB 2IPOB 4ZVQB 1F9HA 2B9XA 3O1LA 3R5GA 4K4XA 4DS4A 2BGGA 1IM4A 3DRSB 3NL0A 2J6UA 2CH6A 4CZHA 4N8NA 2R8HA 2ZNZA 1I94J 1KAXA 4CJFA 3VTHA 4FVUA 1V5VA 1UOCA 2E7VA 5EU7A 4CF9A 4M7XA 1MWMA 5AE3A 3DMJB 3V81B 3LP1B 5GAEU 4BVPA 1HMVA 3KLHA 4G6VB 2B6AB 3GWCA 4DHYA 4WF9Q 3VESA 2EW9A 2QYGA 3A5MC 3QEWA 4M94A 1QDUB 4K59A 1RU1A 4PABA 4BE1A 1S9FA 4DUZK 1L3SA 5ETPA 3O6QA 1VQOS 2Y0SD 1WSFA 1QTMA 5AQUA 5DDOC 3FRZA 3OL8A 2BJEA 1OYDA 4B1XB 3MGJA 2WOMA 3QLHB 5D15A 4LR7A 4CW7B 4B1YB 2ROGA 4OHVA 5EX3A 1VQ7N 3L3VA 1TKXA 1XMOF 4FJKA 4O3OA 1P1LA 1BD6A 3ZSOA 2F4VF 4WE1B 4BRQA 2FBVA 3B82A 3DRSA 1JXLA 2HHXA 3VERA 4RWWA 1V4SA 5LJVA 3V6HA 2BBEA 4UQGA 3VAGA 4MKAA 3JTNA 4FJIA 4DSKA 1RBLA 4LF5K 1S76D 1HBOB 2W2MP 3HSDA 2NLXA 4UZBA 3DMJA 3LP1A 2BW2A 4QPXA 5D4LA 1S6UA 1QZ6A 1E3MA 5B0DA 1RT4A 2LFVA 4D3GA 5IZHA 2B6AA 5LXRA 4DR2F 3T5HA 2HURA 3GDQA 4OHXA 3DOLA 1WG4A 2NZTA 1XBWA 4TXSA 4ERDA 2HVHA 2DHAA 4HHUA 4GV6A 3EYZA 4CI0B 4CD3A 5DGAA 4WKYA 1KQSR 3MPVA 1RWNB 2KXNB 3SSSA 4KH5A 2NXJA 1D09B 4OMFG 1FJGK 2ERRA 1YJ9N 1N5TA 1GNKA 3Q8UA 4CVNE 5D4PA 4UOGA 1QSLA 2HWIA 2E2PA 1YITS 2UU9J 1AUSL 4DV0K 4NLOA 3TUIC 1V3ZA 4NMLA 4DSIA 5F0UA 4N5SA 4HT5A 3H0PA 5LMNK 3BDEA 4WE1A 4PL8A 2XO7A 3CDBA 3R1HA 3ONQA 2B4VA 2D1KA 3CPWR 4YDXA 1TYQA 4M7YA 4H0TB 1FD8A 3HKZD 1NU4A 2ZJPL 2YJFA 2JEFA 3AY0A 4FWPA 4DU7A 3WX8A 4F0HA 2WTUA 4OPJA 2PT0A 4ID1A 4USHA 3PRBA 4PKDB 2HZCA 1HBOA 5K9FA 2VFRA 3UI3A 3H6EA 3LQVA 1IXKA 1N33K 1AXQA 1KNZA 3N4QA 1X5PA 3GR1A 3UWTA 4Q0BB 2R7OA 2R8IA 2MJUA 3FSXA 5FRNA 5KT7A 3OYHA 2ZM6F 2HQIA 4HT7A 4WXWA 3UD4P 2IVFB 4JI1F 4BBYA 2EBGA 1RAGB 4BR9A 2X3DA 2AJ1A 2VJVA 1ITPA 4RJVA 4W92B 4IZ9A 4MKVA 2HNYA 3C6AA 4KFBB 1F6TA 1T0TV 3J80O 4CZIA 2QO3A 2XMAA 4ZPVR 5LOQA 3U02A 3SJJA 3LM2A 1YWXA 2IMOA 2YWEA 4OO1J 4J9MA 1XMOJ 3CJBA 2KH9A 1U2CA 1FEHA 4Z4GA 4XPEA 4CLWA 2F4VJ 1I5OB 2IAJB 2U1AA 4RW6B 2O8CA 2EPIA 2HWTA 4C3LA 1N5YB 2ZWHA 4JKGB 2E7WA 3FSYA 4E7KA 1BWEA 4NMXA 2VBZA 2DH8A 2ZJRQ 4TSXA 2AYMA 4ECWA 1LCUA 2R7VA 2MGZB 5FROA 3GJSB 4FZXC 3SIPB 2HVDA 3OYLA 1ILYA 3TAPA 3MDQA 4DR2J 3H40A 1JWWA 3Q0AA 4OL8A 4QYZK 4P10A 2ZZMA 2CWXA 3G6YA 2GBZA 3VQ4A 1ZBHA 2JVRA 1RWVB 1UA1A 3M7VA 2VUGA 1T3VA 3UCZP 2PGCA 4PZVA 2HS0A 4XK8C 3EDQB 4ZVGA 1WDDA 3JS6A 3NMRA 1NK0A 3QRQA 4FLWA 4CZGA 3CERA 5AJ3F 3I9ZA 4FPRA 4H0PA 1F5CA 2ADCA 3C16B 1F5BA 3CCSN 1FX2A 3M1VA 2IS3A 3DLLQ 2VGNA 2WVEA 5C25B 4O4GB 4NLUA 5AXNA 1R0AB 5AZJA 1VC6A 1ASUA 2IAJA 3PCOB 4RW6A 3OVBA 5KRTA 1W26A 4RR5A 3OTEA 3ZZPA 3HDSA 5KOXA 1F3VA 4M5MA 4XO0A 4YOXA 2CZ4A 2HFVA 2G8HA 5EWEA 3D3CJ 3JAMO 2N7CA 4EZ9A 2MZSA 2OLWA 4E89A 4DR7F 5F8MA 4UUWA 3EVWA 4OI2A 1YBAA 3H8YA 3Q2TC 2MGZA 1O8BA 4NYOA 4C3MA 2ZVSA 3BZCA 4E7LA 2VQEF 4ID5B 3TSQA 1HQUA 2LQ8A 5I3QA 1RT5A 2ZM6J 2RPIA 4CP5A 3TJ8A 4BCAA 4JI1J 1NNDA 2QTDA 4H4KA 3BF3A 1S12A 4OPKA 4Z4CA 1IO2A 1HKBA 1WKLA 2EI5A 2R9LA 3QO9A 4DQPA 5M2PA 1Y5LB 4ED6A 1VI7A 2APOA 5HQ8A 3O3FA 1OH5A 2C2ZB 1U1LA 3HSJA 3PIOL 2R2UA 4O3RA 4OZ0A 4RW9B 2XGPA 2CQ3A 3C16A 3IFEA 3K89A 4NXMF 2A3JA 1IBKK 2JLEA 1P9QC 3AB2B 3VENA 1OYEA 4ZIWA 4O4GA 1R0AA 5L1LA 2HF3A 3L6QA 3K59A 3O5BA 2JEJA 2W41A 2X1BA 1FDDA 1FXRA 1UCNA 2V68A 4BC2A 1OQ3A 3AT1B 4FPBA 4IOAL 2B9EA 3GV7B 2VFTA 3M8PB 3PFEA 3QFWA 2K7JA 3LPEA 2Z0GA 2MKJA 3PNIA 3FBEA 3G4SN 2ITMA 4YB5A 3W63A 3NH1A 3RRKA 3HZGA 4G1IA 4K7QA 3MEKA 3GTYX 5KG4A 1L3TA 3FUYA 4WZMA 4ECVA 2I0XA 2IJFA 3AVBA 5IS2A 1NPRA 4CJUA 4Z7CA 4FYXB 4UY8O 2NCKL 4OPAA 3D6HB 2OEMA 1GOAA 1VSHA 4LF4F 4BG9A 2V4JB 4ILHA 4CJTA 2FTRA 3TZXA 3UN3A 3MOJB 2AQ4A 1P1TA 2XG8A 3KWMA 3HZEA 4KHUA 2RB7A 5U47A 3FC9A 4F9OA 3CJ4A 4PY5A 3EM1A 1H2UX 1C2PA 4YUDA 1KLNA 3OYIA 4RW9A 5AJ3J 5ADXA 1VS3A 2W7AA 1HNWF 3CCLN 2W2PP 2H54B 4CESA 4QWBA 1RBOB 4M5IA 4I2PA 4J9UE 3WQUA 2YWWA 5IT9Y 2BKOA 4OYMA 3G8SA 1ZPVA 4CEAA 1FT8A 5DGBA 4C0HA 4Y1DA 4NLCA 2NSBA 1GXTA 2J0QD 3OW2R 1VGYA 4B3SF 3M8PA 4QYRA 5C24A 3I4PA 1WG1A 3CJTA 3O9TA 4KV8B 2X1GA 3QETA 4DR7J 5I4MA 4P74A 2MQMA 1NOYA 2AIRB 1UKUA 2FC9A 4B3TK 4K5RA 4WKRA 1EKRA 2VQEJ 1NGGA 4FLYA 2PN6A 2R8JA 1RK8A 1S6PA 1RBAA 1MLAA 5IC6B 5E3AA 1KLMA 2KG1A 4F3TA 4RKUC 3CJ9A 4DLEA 2QLJB 4F26A 1RWWB 1R8AA 4ILRA 3SBTA 1R0BG 3D0HE 1BO5O 2DCLA 3BR8A 3TA0A 4FK2A 4H8KA 1RUSA 1Q5YA 3UR0A 3MEDB 1NPPA 4C48A 2XLJA 4NXMJ 4QJVA 2J4RA 3LDQA 1X5SA 4GO5X 5EHHA 1OVQA 4FW2A 4CO0A 5KFQA 3MM6B 4OKKA 5JS1A 1RDBA 2B4JA 1DY3A 3KK2B 1HYSA 2XLKA 1RTJB 2FJAB 4UY8T 3T1AA 4ZHRB 1TV6B 5ETKA 3RBEA 4DPTA 1Y4ZB 2NZCA 2J0XA 1R8PA 3BKTA 2DPIA 2X1AA 2NRWA 1HL6A 2O1PA 4CGJA 1MG7A 2YVSA 2ACMA 3C95A 3U1NA 1B3TA 4USVA 1EWRA 1U24A 4H0YB 2CQBA 2AWZA 3HT0A 2BANB 4C2MA 1KVCA 3A8IA 3T1HK 4O0IA 4K5SA 3HHEA 2ROPA 2AJ0A 1ZBTA 2KT2A 4M5KA 5B0CA 4LF4J 5JMVA 4FLZA 2BDPA 1WN7A 3SLCA 4PKHA 1R43A 3MM7A 1TTHB 3PRVA 1URRA 4OZ2A 3QSYB 2E29A 3CJ8A 4EK2A 3MEDA 4ZP6A 2HBLA 1NGDA 5KFZA 1HNWJ 2HSTA 1U02A 5SUHA 3CW2C 2ZNYA 3A1YG 3ILLA 1J53A 3W9HA 3OL9A 4L74A 1RLDA 4B9NA 3T7ZA 3MM6A 2G8FA 4DTOA 4FYWB 3OFGA 4CF0A 3K7RA 3F44A 4PKGA 3KK2A 1CZ9A 3ENVA 4NOHA 1FHTA 4AHRA 3VALA 2FVPA 1FJGF 1X7VA 1W97L 4ZHRA 1TV6A 4B3SJ 3ZSYA 5FIIA 4O3QA 1X4BA 4ZN1A 3WEEA 5M1FA 2RS8A 2VF3A 1U6BA 3AA9A 1FWPA 4DV0F 5ETRA 4ECTA 2A6OA 2LDYA 2W9AA 1VRTA 3POTB 3J7YU 1ZBLA 2BANA 1JL2A 3EL2A 2FY8A 1YVFA 2H3EB 5HLFA 2ZD1B 3HSZA 4ZPDA 5JLFA 2KL8A 2EFNA 3OSNA 2ROEA 4OHZA 5HMWA 4YP3A 2BE2B 2A2CA 2CJAA 1WF1A 2AT1B 1WF2A 1XC9A 3VQ8A 2WVFA 5EDWA 2F7VA 1HR0F 3EKUA 4ZLLA 4P6QA 3CDAA 3TZZA 1KEKA 3P5BP 5AQZA 3ULDA 3LO3A 2IMWP 3EGWB 4UUXA 2E1RA 3FQLA 3KHYA 3BF1A 4CJRA 2M4MA 1DHMA 1REVB 2EKYA 5CHCB 3IAM9 2KKZA 3CFRA 2LVWA 1I1GA 1YG0A 2C2NA 2R8GA 4NRTA 4DUZJ 1X4FA 4ANDA 2JOQA 4KYZA 1H1VA 4DR5K 5DRKA 1Y10A 3KDOA 4I7FB 1SJQA 3GIMA 2R3VA 4UTGA 5BR8K 2G13A 4CZCA 4FCYA 2QM1A 3ZX3A 2XCAA 4YDUC 3QJJA 2YNHA 4M3WA 2F63A 2JEGA 4H5RA 1WEXA 2P9SA 3VQSA 5EWFA 3PW7A 2IDEA 3HOSA 4H0OA 3EZUA 1S49A 3WX4A 5JLHA 3IR5B 2K7KA 4CZKA 1YTAA 2BE2A 2I5JB 1JX4A 4PAAA 4EP5A 4CQ1A 1QSSA 5E2QA 4C23A 1MWYA 5A2QO 4J5OA 1UWBB 4DR4K 2P9NA 2MKYA 5BYQA 1URNA 1ZM9A 4OQJA 2DFHA 2YH0A 1YTUA 3AY9A 1UVIA 4IR1A 3NAEA 3OUYA 2DGXA 5KFAA 2PC6A 2HZAA 3RU0A 2KHDA 2GUIA 1NB2A 4E3SA 2QT7A 2CYYA 3OYJA 3NF7A 9ATCB 1VQ4S 1W7AA 3ISND 5A6PA 4PWDB 4J9LA 2LEAA 2HHHF 3BM7A 4F4YA 2R7TA 4KB1A 1UVNA 1FKOB 5HATA 2V67A 1FJGJ 3PIPQ 4IH7A 1RHJB 3DI6B 3TR8A 1NMNA 4PWWA 3L95X 4DV0J 1VQMN 2DRBA 3MEEB 3W0LA 1ESVA 1KVJA 2Q31A 2VFSA 2MKSA 1MWQA 4OI1A 1G1XA 1DEJA 3DGPB 1WSRA 3SCKE 1NAQA 2UUTA 3IBFB 3S7RA 4FS1A 4DLGA 4HVJA 4WJBA 2FHJD 3TJAA 3QPIA 2Y3YA 3NGSA 4F4AA 3U6FA 3I0RB 5E5NA 5TKWA 2D1CA 3OL7A 1SH2A 4PXCA 5KGWA 1VSIA 1U2VA 3AO3A 2ILZA 1CJKA 2CJBA 4CLSA 1HR0J 4HVZA 5AQKA 1FESA 1WACA 3P1GA 3DC2A 5KFKA 5C2GA 4YHHF 1RAAB 3G6ES 3HHLA 1WC6A 2DIVA 2CJQA 4URQU 2YV0X 3HSCA 1VC0A 2HIYA 4ED5A 2XMWA 2YWFA 4HDHA 2E5HA 5CR4A 1M5HA 4IFVA 1W9HA 3AD7C 2NRRA 5KG7A 4NXNK 2QI2A 1YI2N 4DX7A 4FNHA 3TQEA 4PWDA 2AEFA 1GMWD 1WHYA 4JI4K 1T7PA 4RPFA 3G8TA 5LJWA 2DKOB 2UXCK 3NS7B 3THYB 3OBWA 2FJXA 1S0OA 4U8VA 3KKSA 2CQHA 4F67A 3DI6A 5AQJA 5M1KA 4M42A 1ZZNA 2MQLA 3MUMP 2VPXB 4IRCA 1N32K 3MEEA 5DG7A 2E9ZA 4JP8A 1X1PA 2ZH1A 4C8YA 3DGPA 2DFFA 3EE8A 3CNQP 4ZPBA 4A8SA 4FJXA 1FXDA 5KTQA 3BKUA 2OH2A 5ETOA 3L3CA 2AEJA 3I0RA 1O6XA 5M1OA 2IBOA 2UP1A 3TUZC 4MIWA 1LFPA 1UVJA 2E44A 2QK9A 3WQPA 2G2YA 3QAEA 4WCEQ 3HCXA 3HI0A 1ZAWA 1N6QA 3OV7A 3MD3A 5E0OA 3ZZRA 3ULHA 1VQLS 3AHPA 1KCFA 3DM2B 4MKYA 2KJWA 1HBUA 4DZ6A 4CJ5A 2VBYA 3MX2A 3SPYA 1NSKL 3CCQN 3Q83A 2HHHJ 1VQ9N 2CPYA 3U8XA 2RH3A 1JJ2M 4NLGA 2J9EA 2O3DA 1VLYA 4K4VA 3THYA 4ZVSB 4LUBA 4CJQA 2CQ0A 3CCUS 7FDRA 1ZYQA 2ZH5A 4DTSA 3G9CA 3QGIA 2PFFB 2IIHA 2AZ1A 1ZBUA 4YOWA 5DLGA