1TL1A

Crystal structure of hiv-1 reverse transcriptase in complex with gw451211
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 146
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tl1A05
1YVFA 3KLHA 1HRHA 4BE0A 3JSMA 1R0AA 3D5MA 4DL5A 3DRPB 1FKOA 2IAJA 4Z4EA 2KFZA 1FKPA 3PVXA 2JEJA 3VQCA 1S1VB 4QOZB 1RT3B 5FDLB 2JGUA 4KAIA 4FZZA 4ECXA 3OYFA 3VQQA 2XI3A 4H4OB 2KQ2A 3PX4A 5FRMA 4IG3B 4JUZA 3KK1B 3V9UA 4RW8B 2HNZB 3KMSA 3NF6A 3PY8A 3WNFA 1UWBB 4KTZA 4AHUA 5C24B 2RDJA 4DTSA 4ECWA 1Z26A 3NHGA 4MFBA 3DM2A 2BQ3A 3AO1A 4K4ZA 5F8JA 3DLRA 3AO2A 3PW2A 2B6AA 3GIKA 4FK4A 1N6QA 4RUCA 3QEPA 3DLKB 3AA5X 1TKXB 3NAEA 2W7OA 1N5YB 5EWFA 4G1QA 1HMVA 3IAYA 1TAQA 2E9RX 4BACA 5KT4A 2XY6A 1JXEA 3NGZA 3V6HA 5KFUA 1U48A 4M95A 4HCBA 2C2DA 3LZJA 4U6PA 4KREA 4Q8FA 5HBMA 3ZT1A 3SUQA 5C25A 2B4JA 2V4RA 1S1WB 1GOAA 5T14A 4NLRA 4PUOB 3DMJB 5DQHA 3VQ4A 4Z4IA 4RUAA 3SZ2A 2D3UA 4IH5A 2V4QA 1EP4B 4DQQA 1LWFB 2YNFB 3AVFA 4HKQA 1BL3A 3AVJA 3H98A 4ZPCA 3OL6A 3OSNA 3WNHA 1QS4A 1S1UB 5J2PA 3PR5B 3FRZA 4FW1A 2DY4A 2F8TA 1RA6A 4JLHA 4R0EA 1S1XA 3AA3A 3QNNA 3IG1B 2JLEA 4CK1A 2DTUA 4ECQA 4CFBA 3KK2B 3H2LA 1HYSB 4EEYA 3EY1A 5KFGA 4IFYA 3RRHA 2WONA 5KFPA 3H5XA 3V9XA 2PYLA 3T5JA 3LWMA 4CEZA 3VQSA 4DSJA 3MEDA 4FJGA 1RILA 3BQ1A 4KTQA 2FVPA 3DLEB 3V6KA 4GC6A 1L3VA 4DG1B 4BE2A 1Q9XA 4FJIA 2EC0A 2FLLA 1KFDA 3VA3A 3SQ1A 5CYMA 1VSDA 4MH8A 5F8MA 1NK7A 4MQ3A 3A2FA 3MXJA 4DL6A 4FYDA 3CIZA 4AHVA 4GW6A 2YHBA 4RW6B 4NLTA 4Y2CA 2DFEA 1XI1A 2VWKA 2HHWA 1TKTB 1S6PB 2IOCA 4QWBA 1J53A 4CEEA 5EUHA 2BQRA 1EETB 1XWLA 1C1CA 1B9DA 4KHRA 3UPFA 4LD0A 4O3SA 4E19A 1WAJA 4CFCA 3LWLA 1T3NA 2OPQA 1ZBHA 1U04A 3TR8A 3P83D 3ZT0A 2HHTA 3CJ5A 4DQSA 3HSTB 3DOKA 4F4XA 3ASMA 1RBRA 4URQU 2E9TA 1NKBA 3U6FA 4XPCA 4ZVHA 3KLIB 4AHRA 1IM4A 3OLBA 5KFEA 3HVAA 4NLQA 4TQSA 2LSNA 2BE2B 4DFKA 2FJXA 2PYJA 1RDCA 2AX0A 3NCIA 1WNEA 3DLBA 2XHBA 2HNYB 4FLXA 4E3SA 4QCLA 4B8AB 3QIPB 1NOZA 1LW2B 2HW3A 4L8RB 2IA6A 3QEVA 4DSLA 3TAQA 5F9LA 1C0TA 4IRDA 4AILC 4ECVA 4O3PA 4FK0A 3CJ4A 4J2DA 1RT1A 3Q8QB 3LAMA 3AVCA 2AWZA 3FDSA 1TL1B 4Z4FA 2G8IA 2XY7A 1ZBIA 2YNHB 3KLEA 5SWMA 4QW9A 1S10A 3AVAA 3ZT3A 1JL1A 5KFVA 4EBCA 4W5QA 3I0RA 4KRFA 1TKZB 4K8ZA 3MEDB 3PX0A 4FVMA 4M42A 2HHUA 1T05A 4ZVEA 2ILZA 1SV5A 4TQRA 2QXFA 5KT6A 5J2NA 3EZUA 3M8PA 4RZRA 4EBEA 5J1EA 3K5OA 2F8SA 5CYMB 5KFYA 1RT6B 2WCXA 3KKRA 4EYHB 4FLZA 4E1NA 1T03A 4RW9B 4O3OA 1LAWA 1U4BA 3UQSA 4KSEB 3HK2A 1LAVA 2OPRB 5KG7A 3BDPA 1VSEA 3L3UA 4O4RA 3O4QA 1RCHA 5L9XA 1WSHA 2BRKA 4ID5A 2WB4A 4WFZA 2JC0A 1LWCB 2YV0X 3NAHA 4DFPA 2VA3A 2OPSB 4KFBA 1I39A 2UVUA 4O4GA 2ZE2A 4CJPA 3ZSRA 4DTNA 4N76A 4DTUA 4JRQA 1HJRA 3KLVA 2IC3A 1IKWA 1Y97A 5L1IA 1GX5A 4CJ4A 4FJLA 3QIOA 2I5JA 2XCPA 3DYAB 2E4LA 3TQ1A 1HNVA 2X74A 2E9ZA 4CCHA 3RR7A 3H59A 4ECZA 3VQPA 1JX4A 4ED6A 1SL2A 3RAQA 1Q8IA 4QWCA 3MFIA 2G8UA 5CZ2A 5C42A 4KHQA 1BIUA 3ZCMA 4J9SA 1VRTB 4ZHRA 2IM2A 3GV8B 3LP2B 4CJ5A 4CGHA 4CECA 3MR6A 4IRCA 2FLNA 4KKOA 4LSNB 2ILYA 3KLGB 2X78A 1WAFA 1KRPA 5E41A 5I3UA 4ELVA 1BIZA 3M8RA 2R2RA 3VQ6A 4Y34A 3JYTB 2W9BB 4CHQA 4CEAA 3QO9B 3V9SA 1YT3A 2R2TA 4DLGA 4I9LA 3CJ3A 3N6LA 4Q43A 2C22A 1TKDA 1HARA 4J9OA 1GOBA 3HVWA 4K4WA 1IKVA 2C2RA 3SFGA 4B9NA 1WLJA 3MEGB 4IG0B 4GVMA 4J9QA 4YFUA 3ZSYA 3O3GA 4DS4A 3LANA 4ZP8A 2PY5A 4K8XA 2R2UA 3KHGA 1JXBA 4F2SA 3S3NA 4WFYA 4IKFA 3IRXA 2B5JB 1KSPA 2XI2A 3LP3A 3ISND 3V6DA 3KK3A 5KFSA 4OJRA 3OYCA 3TAMA 1XR5A 4B9MA 5DLGA 4U7CA 3V81A 4ELTA 3NGYA 2FBVA 4KB0A 2GBZA 1LW0B 3ITHA 4CJSA 5KT5A 3VQ7A 4CJTA 3BJYA 4PWDA 5JXSA 4EZ6A 3HKWA 3DLHA 2C28A 4DFJA 3LPUA 1L3SA 2WHOA 4RNMA 2GC8A 3RTVA 3E01A 1BCMA 1Z4UA 4ZP9A 2BQUA 3HT3A 4FJ5A 5CY4A 1HNVB 1JLCA 3OS2A 2Y1IA 2ASDA 3S3MA 4K4SA 4CJ3A 3FQLA 1VRUA 3CDUA 1RBUA 4FS2A 2W9CB 3C6UA 5KG2A 2HB5A 4RW4B 3GIMA 3T19A 5KFMA 4OKEA 2GUIA 1JLBA 3AVMA 4BE1A 4O3QA 1TL3A 3KJVB 2AGOA 4CJLA 4CJKA 5DG9A 2FVSA 4KHUA 4IBNA 4FJNA 1LWEA 3HYFA 4EYIB 2E6MA 4ED7A 4CF2A 2JEGA 4O3NA 2Y1JA 3HXMA 4CEOA 1QSSA 3MF5A 3LZIA 3GV7B 5EWGA 2QK9A 1FXXA 3TWHA 4MIAA 4O44A 4PQUA 2I1RA 5HLFA 5CYQA 2FVCA 4NZ0A 1RT5B 4FZXC 4C8NA 4YNQA 3OYIA 4M3WA 3QZ8A 3VN5A 5F8HA 1S6QA 5L1JA 3CJ2A 4Q45A 2BDPA 3G6YA 1D8YA 1N4LA 3CM5A 3OL8A 4JS5A 3NBPB 4NCGA 4F50A 3C6TB 1JLGB 2WRMA 1ITGA 1DTTA 3RB3A 4KPYA 3T5HA 2ZD1B 2FVRA 2OYQA 3N6MA 4J2EA 4YQWA 1BQNA 5FRNA 1ASVA 4I2QA 1MU2A 3QGIA 5KFAA 4TY8B 4B9LA 1DTQA 1L3UA 1JL2A 1XC9A 3MFHA 3BGRA 4DU4A 1JLAB 4LQ9A 3M8QA 3NGIA 5KFHA 4CFDA 4CJEA 1O1WA 1TVRB 1IKYA 3DI6B 4Q5VA 2FBXA 3RB6A 4UQGA 4HYKA 4ZVFA 4LQ3A 3OLAA 4JRPA 4FBUA 4CE9A 1BQMA 3M9NB 5T7BA 4I7FA 3VQBA 4EO8A 1ASUA 1JLCB 5KT3A 5HP1B 4YR0A 3E51A 4NLYA 4Z0UA 3DDKA 3UR0A 1S1TA 4EZ9A 4QWAA 5KT2A 3OYNA 2OH2A 4CJFA 3NGDA 5L1KA 3VQAA 3RB4A 4EBDA 4FLYA 1ASWA 5KFTA 4E7JA 3FSIA 3TVKA 2R8GA 4OPKA 5D3GB 5KG0A 5K14B 3SV4A 4CEFA 1SUQA 2KZZA 1SKRA 4E7LA 4CK3A 5CZ1A 3H5SA 4FLTA 4W5RA 3OS0A 1U09A 5DG7A 2HNDB 1C1AA 1RTJA 4FCYA 5HLFB 2R2SA 2Z1GA 4DFMA 4ZMMA 4FS1A 4M45A 1RT4A 1JLFA 2RKIB 2RPIA 1RT7A 1NK6A 4DF4A 1RDAA 3V9ZA 4OGCA 4YMEA 1KHVA 4Q0BA 4O0JA 3ALYA 4ICLA 1CSJA 1TK8A 3NAIA 1DTTB 2IMWP 2VG6A 3MEEB 4N56A 2HWHA 2J6UA 3DRRA 4H4MB 1ZTWA 4KE5A 3MXMA 3AVGA 1QE1B 1REVB 3KLHB 1J54A 4ED3A 1MU2B 1WSJA 4WZQA 2XO7A 4O5BA 3JSMB 2VA2A 1TV6A 2AQ4A 4NLOA 1R0AB 4W5TA 2A1RA 1FKOB 3CM6A 2YKNA 4FXDA 2IAJB 1IKYB 1FKPB 1NK8A 1RDRA 5J2MA 3OYGA 3RB0A 5HRPA 1L5UA 4GC7A 1D5AA 3L8BA 4I7FB 1TQLA 4HCCA 2JEIA 4E1MA 2BANA 4TSXA 3CFPA 4FLUA 2HMIA 4URGA 4HHTA 1NOYA 4JV1A 4MIBA 1TK0A 2D0BA 4R8UA 2V0NA 5KI6A 2IJNA 4URSA 2XGPA 2D0AA 4CGGA 4EO6A 4DU1A 3S3OA 2FBYA 5KFRA 3IN5A 3V9WA 4R5PA 4FJMA 4FLWA 2X6SA 4MFBB 3DM2B 3QYYA 3CYMA 4K4VA 5SZTA 1RAJA 1IKXA 1RTDA 1SUQB 1UA1A 4HUGA 1VSFA 2B6AB 1N6QB 5DG8A 2XC9A 3BSOA 4KBIA 3G10A 4ELUA 4G1QB 3AO5A 1SH2A 3PW4A 1HMVB 3HL8A 4XPEA 4QWEA 3QGHA 4CEBA 3RMDA 1OS5A 2BRLA 2WK4A 1ZBFA 5JS1A 3MTKA 3OYKA 5HBMB 3KNAA 4FLVA 4NRTA 4DSEA 4DTPA 5C25B 1RBVA 2IM0A 3DRSA 3TABA 3GIJA 4M3TA 3Q8PB 4FJ9A 5F8IA 1C1BA 1QQCA 4NYNA 2UUWA 3HHKA 4TXSA 4F4ZA 2VG6B 4O3RA 3VQ8A 1S9EA 1WNSA 1S9GA 2G8KA 2ZQBA 3DRRB 2XCAA 4LSLA 4J9MA 4KAZA 3QGGA 4IR9A 5HRSA 4JV0A 1Z25A 4I2PA 4MKBA 3PZPA 2FJVA 2O5DA 4CIGA 4KHMA 2QE5A 4IKAA 1DLOA 4NLVA 2VG5A 3PO4A 4FJHA 2IJFA 3EPIA 5J2PB 1RNHA 4RNNA 3K59A 5KRTA 5DLFA 3D28A 4G3IA 5J2MB 4IOBA 1RTHA 4Y3CA 1J9AA 2HHQA 4ECYA 2B43A 3OJSA 2O4GA 1S1XB 3NH0A 5F8NA 3I5BA 4CERA 4Y1CA 1K1SA 5KFDA 3MECA 4F3TA 3V4IA 1BI4A 1RTIA 2ASJA 1A5XA 4WE1A 4CHYA 3VQ5A 1NK9A 4KTWA 4B3OA 4TYBA 3SQ0A 3OL9A 2D0CA 4IFYB 3N6NA 3CJ0A 2WONB 1SH3A 1N56A 2VG7A 3QEWA 4F4YA 4FBTA 4NLDA 1MMLA 2UUTA 3I0SA 3CWJA 4RNOA 3DOLA 3ZSWA 5KFWA 3FQKA 3GILA 1D9DA 1NNDA 5F8GA 4ED0A 4DMNA 4E89A 4MK7A 1RTDB 4NLXA 3H4DA 2FC0A 4K4UA 4J9NA 1NJYA 3MR3A 4BDZA 3FFIA 4CHZA 4AH9A 1YTUA 4ZP6A 4CJQA 4FM0A 3BQ0A 4KI6A 1X1PA 4F4WA 3IGVA 4DTOA 1HQUA 3SQ4A 2VWJA 3OVNA 1C1CB 4FJJA 3AA4A 1X9MA 5KFBA 2OPQB 3HVTA 4WXOA 1TGOA 1VSJA 4FM2A 1NK0A 4F8RA 4TYAA 2GIRA 4FW2A 4N47A 2AX1A 4DSIA 3KD1E 3DOKB 4DTJA 2Q3SA 3SI6A 1BGXT 5KFLA 1IH7A 3HPHA 1UOCA 3V1RA 4DL4A 1FK9A 1TAUA 3M8SA 1KTQA 2YNGA 4ZPAA 1JXLA 4OLBA 4DTMA 4MK8A 1X9WA 4TY9A 1C0UA 4HUEA 5KFCA 2R8IA 3OY9A 3KTQA 2W8LA 2GV9A 4J9RA 4FJ7A 2IBKA 2IGIA 3DLGA 3M9OB 4OKJA 1QTMA 2KTQA 2OPPA 4BDPA 5KRSA 1C0TB 3AA2A 2F8EX 3CO9A 1RT1B 3V4IB 3OS1A 3LP0A 4BWMA 1VSHA 2Z1IA 4DQPA 4ZP7A 4B8CA 4XIUA 3KLEB 3Q8RB 3NDKA 3I0RB 4QWDA 1I6JA 5DQIA 3RRGA 5JS2A 3LPTA 1JLQA 1T05B 3HPGA 4HVJA 1VSIA 3VQ9A 1SV5B 3AO4A 5HROA 3P1GA 5J2NB 3L2QA 3M8PB 3TAEA 5J1EB 5J2QA 3KOAA 4C8OA 2F96A 1SKWA 1HNIA 5KFJA 3SUPA 1J5OA 4PY5A 3CG7A 4CGJA 1T03B 2FBTA 1WSEA 4IH7A 2RF2A 1A5VA 4CHPA 3BSAA 4FJ8A 4ID5B 3SCXA 4IDKA 1S0OA 2G8VA 1SL1A 4CHNA 3T3FA 4Q44A 4KFBB 2YKMA 4O4GB 3OYHA 4KO0A 1NKCA 2ZE2B 2X6NA 4J2AA 1QUVA 1JKHA 2IC3B 1IKWB 4M3YA 4M3XA 4ECSA 3NH2A 4BDYA 4IR1A 2I5JB 2GIQA 1CXUA 4CFAA 2W42A 3QEIA 3QLHA 2KW4A 1NJWA 3L2WA 2R7YA 1VSKA 2QKKA 3L2RA 3T5LA 1S1VA 5C42B 1RT3A 5FDLA 1G15A 3OSPA 3GIIA 4ZHRB 3LP1A 4NRUA 3VQEA 3GV5B 2CKWA 3U3GA 3K5LA 3AVKA 4KKOB 4E0DA 5EWEA 4W5NA 4M3UA 1ZBLA 3NE6A 4H4OA 4H54A 1ZBUA 1YVUA 3KK1A 2OPPB 4ZTJA 5I3UB 2P51A 4TLRA 2HNZA 2P5OA 3LP0B 3VQDA 3OYJA 1UWBA 5C24A 2IDOA 3ZT2A 2HHVA 3ZSXA 3VA0A 1IKVB 4AHSA 1RYRA 4ECTA 3V1OA 4Y1DA 5KFKA 3IGNA 4RW7A 3DLKA 3V1QA 3UDLA 1TKXA 4FZYA 3F9KA 1S5JA 4CJUA 3IRXB 4ECRA 3OYDA 3UIQA 5J2QB 1D0EA 2YHAA 3V6DB 3KK3B 3TAMB 4BWJA 1W9HA 1J5OB 4CGDA 3PW5A 4K4TA 2KFNA 3PR4A 3PUFA 4KI4A 3V81B 3ZT4A 3OYLA 3KLFA 3BR9A 1KFSA 3BREA 3QERA 1BCOA 3ITHB 2HHSA 1S1WA 2O4IA 3KIOA 4PWDB 5KFNA 3B6PA 2PZSA 2YKMB 3NFAA 3HP6A 2YNIA 4HTUA 1C0MA 2BGGA 3AV9A 3G6VA 5F8LA 1QSYA 1EP4A 1JKHB 1U47A 3E01B 1XR7A 4OVLA 2YNFA 4KB1A 4QPXA 3KHRA 5DGBA 3ZSOA 1XR6A 4CESA 3T5KA 3CQ8A 2IS3A 3WNEA 4DQRA 3QLHB 3EPGA 4CHOA 3L2UA 3IS9A 1TP7A 1S1UA 1VRUB 2D7SA 2XWYA 2G8WA 1GOCA 1LV5A 3C6UB 1ZYQA 3MAQA 4XO0A 3LAKA 1KCFA 3SPZA 4F2RA 1JLBB 4JV2A 3QINA 3LP1B 1TL3B 3IG1A 4J9KA 2XRIA 3I5AA 4OGEA 2DFFA 4CIFA 4Y2AA 3KK2A 4KV8A 3AVHA 1LWEB 1HYSA 1KLNA 3S9HA 1Q9YA 3KD5E 4ED8A 2E6LA 3ULDA 2W9AA 2QV6A 5EU7A 3RAXA 3TARA 1TK5A 1N48A 4DTRA 3DLEA 4B9UA 4O44B 4PQUB 2AGQA 4OLAA 4DG1A 4TN2A 5CYQB 3NF9A 4N5SA 2A1SA 3G86A 4NCAA 4FK2A 2DFHA 4OPJA 4RW7B 3RR8A 2R8JA 1S6QB 4YP3A 3F73A 4RW6A 3B6OA 3LDSA 1JIHA 5KG5A 2D5RA 4RNFA 1TKTA 1KLMA 4NCGB 1NJXA 1S6PA 3TAPA 1WSGA 3KMQA 4GMJB 2OZSA 3THVA 1EETA 3KLFB 3CDEA 1W0HA 1RBSA 3OL7A 1BQNB 4CGFA 4I2QB 4E7IA 1DTQB 4Z4GA 2XY5A 3OJUA 3BGRB 1EXQA 3BSNA 2YNIB 3M8QB 1CZ9A 4AHCA 2W8KA 2AGPA 3OYMA 3KLIA 1VSMA 4NLWA 4CJVA 3RMAA 3MXIA 5KFZA 1QAJA 3C94A 2J6TA 1BQMB 2BE2A 4LH4A 3OHBA 1XHXA 4M3ZA 4CF8A 1S97A 5C5JA 1HPZA 3KHHA 3IS9B 1HYZA 5KGWA 3CFRA 4QW8A 3QZ7A 3OYEA 2XGQA 2HNYA 1S1TB 3QIPA 3QNOA 4J2BA 1LW2A 5KFFA 1RDBA 3NF7A 2D41A 4MK9A 3AVBA 3L3VA 3TAGA 4KV8B 1TL1A 3HVRA 3HPOA 4HUFA 2YNHA 3H4BA 5I42A 1B92A 3NL0A 3K57A 1KHWA 1RT2A 1TKZA 2IM1A 1RTJB 1T7PA 4ZVGA 5JUMA 5KG3A 1CXQA 3BSCA 3BQ2A 5L1LA 4Z4CA 1RA7A 1RT6A 3PJXA 2EX3A 3O3FA 1RT4B 1JLFB 1WN7A 1RDDA 2G8FA 4YR3A 1RT7B 2UVVA 4RW9A 3SI8A 2OPRA 3ICLA 3KHLA 1NK4A 4Q0BB 4F4KA 3PW7A 4CIEA 4DL7A 1EKEA 4WZMA 4ICLB 1KLMB 4NYZA 4F3OA 5FROA 1T8EA 4M94A 1LWCA 3QETA 3ZSZA 4RNHA 2OPSA 4W5OA 3TI0A 3AVLA 4FM1A 4IFVA 3I5CA 3RBDA 1HYVA 4AHTA 3SV3A 1T94A 4CEQA 1I3AA 4M41A 2HWIA 4B08A 1TV6B 5HRNA 1S48A 1NHUA 3DYAA 1W25A 3P5JA 1B9FA 3PW0A 2Z1HA 2YKNB 2DPIA 3HM9A 3AVIA 2AJQA 3SFUA 1RBTA 2ATQA 4DSKA 2ATLA 3I8DA 5KFQA 4NCBA 2FVQA 2BANB 1VRTA 1HPZB 3LP2A 3V6JA 1QSLA 2HHXA 1U45A 2HMIB 3NF8A 1SL0A 3K58A 2BR0A 2G8HA 2HVHA 4LSNA 4R8UB 2J6SA 3U3YA 1VK0A 1IO2A 4NLGA 3KLGA 5KFOA 3H40A 3JYTA 5KG1A 2W9BA 3QO9A 3SPYA 4QAGA 4C8LA 2DPJA 4R5PB 1A5WA 3PHEA 2HVIA 4B9VA 1IKXB 5F9NA 5I42B 3EZ5A 2OA8A 3MEGA 4IG0A 3RMCA 2HAIA 1RT2B 3SUNA 3O4NA 4ECUA 4KB7A 3PX6A 4J9LA 3TANA 2Z1JA 4B9TA 5DK5A 2B5JA 3GYNA 1YTAA 1C2PA 1KVCA 2FJWA 3EYZA 4FJKA 4FJXA 3QEXA 3DRSB 3NH1A 1IG9A 1LW0A 1D9FA 1C1BB 4KHSA 3D45A 4NYFA 2W7PA 1WSFA 1S0NA 1S9EB 2WOMA 3D0PA 1S9GB 4LSLB 5DGAA 4IFVB 4WXWA 4I2PB 2C2EA 3K2PA 4RU9A 2CJQA 4DU3A 5KG6A 3H5YA 4LH5A 1DLOB 2VG5B 2OZMA 2XY8A 1JLEA 3RBEA 2UVRA 1RTHB 4LY7A 2W9CA 4RW4A 5KGXA 3L2VA 4DLEA 4O55A 1XHZA 3CVKA 4K4YA 3MECB 2NUBA 1U49A 3KJVA 2JEFA 3NMAA 1ZTTA 3PO5A 1BI4B 1RTIB 3O3HA 3WNGA 4WE1B 4DTXA 2JC1A 5KT7A 4B3OB 2P5GA 3OHAA 3TAFA 4CF1A 4CK2A 2VG7B 4WYWA 5KFXA 4YR2A 1ZETA 4ZPDA 3T1AA 1EX4A 1NJZA 3I0SB 3AVNA 3DOLB 4KHWA 3ISNC 1X9SA 3LALA 2ASLA 3KKSA 4CJWA 5KFIA 3SNNA 2RN2A 1RT5A 2KZMA 3M9MB 1F21A 4RG8A 4MKAA 1QHTA 2P1JA 4DL2A 3FFIB 4WYLA 1SH0A 3RWUA 4CF0A 4DSFA 3HP9A 3NKYA 1S9FA 3MR5A 3SUOA 4OKKA 1HQEA 1HQUB 3NBPA 3SJJA 3H5UA 4NLPA 3C6TA 1JLGA 2V9WA 2ZD1A 1RYSA 2FLPA 2IM3A 4M3RA 3GQCA 3K5MA 4ID1A 1UA0A 3HVTB 4E7KA 4CEDA 4CGIA 2RDIA 4I9QA 4TY8A 4C8MA 3MR2A 1SKSA 5DMRA 2WOMB 1KVAA 4EP5A 3G6XA 1JLAA 3DRPA 3Q8SB 3ZSVA 4PA1A 1L3TA 1FK9B 2QKBA 1TVRA 3DI6A 4IH6A 2YNGB 2R8KA 4K50A 4CJRA 4IRKA 2R8HA 5KG4A 1S49A 1NHVA 4N41A 2ZKUA 3QESA 1C0UB 1UAXA 3RMBA 4WFXA 1K1QA 1JLEB 5KTQA 4ZTFA 3SQ2A 5HP1A 3DLGB 4IG3A 4DQIA 3C95A 3ZSQA 4RW8A 4JS4A 1GX6A 4DF8A 1BHLA 1WSIA 4IQXA 4ED1A 3PJWA 3CFOA 4J9PA 4E7HA 4CF9A 3AO3A 1S0MA 3HJFA 4DL3A 5D3GA 3CDWA 5K14A 1C6VA 4ZPBA 5EDWA 4X2BA 4H8KA 4O0IA 1NK5A 4EP4A 1NKEA 1JLQB 3OYAA 1KVBA 5DQGA 1QAIA 5HROB 1N5YA 2HNDA 3SYZA 2D3ZA 1D1UA 1K6YA 2AU0A 4Z4HA 1HNIB 5HRRA 2ALZA 3PV8A 2RKIA 2RF2B 2WTFA 1VSLA 4B9SA 4K4XA 4ED2A 4KHNA 2ETJA 3K5NA 4IDKB 1HQEB 1CZBA 1CLQA 4NLSA 4Q8EA 3HO1A 3OYBA 4PUOA 3DMJA 4NLUA 4DWIA 3MEEA 4KO0B 3G0ZA 3QIDA 2ITGA 2UVWA 4OL8A 1BISA 4H4MA 4DS5A 4C8KA 3H08A 4KHYA 2EHGA 4DEZA 1S4FA 1QE1A 1LWFA 1REVA
chains in the Genus database with same CATH superfamily
4ZCLA 2RVJA 4PXCA 1HRHA 2ZKTA 1Q8BA 2Q79A 3DRPB 4F9OA 4CT9A 1KVKA 2O1PA 1P8GA 3PVXA 3VQCA 3VPZA 1RT3B 1Q7YT 3MM5B 5C7PA 3HDSA 4OJGA 1U2FA 5GVQA 4B17A 4TU9A 4LVOP 4C0BA 1IR1A 2PEHA 4FZZA 3VQQA 4OZLA 2BXJA 1WC1A 2XI3A 4YB5A 2DR5A 3DCAA 4NA2A 2VFSA 1HLUA 3KK1B 1WUUA 4DR5F 3C0BA 3IO1A 1F6TA 4YOUA 3NF6A 2CQ2A 3WNFA 1M90O 1EQMA 4NZ7A 3OVBA 1ZA2B 4KH5A 5AQZA 3OBYA 1H0HB 1FD2A 3PW2A 3UFCX 2B9XA 4WWSA 1YBAA 3QEPA 4RUCA 2VGMA 4IDHA 3NAEA 2W7OA 3VEVA 3ZZZA 5EWFA 1XERA 3IAYA 3UN2A 4BACA 4DR6K 2QLJB 3QATA 1JXEA 5A8KB 1Y5NB 5KFUA 1NUEA 4ZVSB 1VC5A 2ZFHA 4CIOA 2UUAK 3JTNA 1XMQK 2QM1A 5IQQA 3SUQA 2CADA 5BREA 2WTUA 5T14A 3RG6A 1CULB 2BMBA 4QIWD 3VQ4A 4Z4IA 4C23A 3TJ9A 3TSUA 4OYWA 4IH5A 1LXNA 2BM0A 3HHLB 2V4QA 1HQ2A 4DQQA 1LWFB 2YNFB 3FEZA 4HKQA 1MN9A 3AVJA 2R4FA 4E2FB 2R3VA 3H98A 4ZPCA 3OL6A 4A8QA 4X62K 1BWFO 4CO2A 3LO3A 1QM9A 3KJFB 3KG1A 4FVUA 1S1UB 2JWNA 5J2PA 2GAGC 1H98A 4RJVA 2DO4A 3P96A 3FRZA 2V2QA 4FW1A 2X1GA 5A2QU 2F8TA 4ZA1A 3CJCA 2DGQA 4H0OA 3IG1B 4K2XA 4BRQA 2DTUA 4DUZJ 2A2CA 1KAXA 3EY1A 4WKRA 2V4JA 1Y7PA 1X5OA 3G8TA 3RRHA 2GZOA 2UXCF 3V9XA 3IR7B 4UOCA 5D0HA 1OKJA 3LWMA 1FRMA 4CEZA 4DSJA 2VFUA 3MEDA 3BQ1A 1VDHA 2FVPA 3CMES 2EKNA 1FERA 4BE2A 2NUUG 2FLLA 1HFEL 1N5SA 2FY1A 3VEZA 2BJ7A 5F8MA 3DLLL 2CFXA 4QIEA 4NLTA 2P6SA 4PXBA 2DISA 3LPYA 2DFEA 2EKYA 2BUNA 2UU9K 4QWBA 1HW8A 3CXCR 4CEEA 4UZBA 1EETB 1C1CA 1B9DA 4CFCA 4P10A 3OTBA 5AQJA 4CZEA 2UXDJ 2HHTA 2CWKA 3UKUA 1W2BR 4JV5J 3KWGA 1DQAA 3DOKA 3WQUA 1RBRA 4URQU 2Q6BA 5KPZA 1IVZA 3W3DA 3DRXA 2W2QP 1RKJA 2WW4A 1Q7YO 3HVAA 4PABA 4DV5F 3AH6A 4FF3A 4CZMA 5AQPA 2IVNA 1PJ7A 2AX0A 3GZ7A 3D0GE 2XHBA 2HNYB 2CWXA 4E3SA 1RKIA 5M2PA 2HSTA 1WF0A 1LW2B 5K8MA 4OO1J 3QEVA 2CQCA 4F3QA 1C0TA 4AILC 4UOFA 2AP1A 3D6TB 3PJ9A 1SJQA 4P2FA 3FDSA 3H0PA 2X7IA 3QT5A 1N54B 4P6QA 3AVAA 1VQ7S 1JL1A 3C6AA 5KFVA 1R3NA 4MO5A 2MQNA 3G87A 5GAHU 5ETTA 4CLKA 3NMRA 2XMUA 1WWHA 3MEDB 5G0RB 2HHUA 3CPWR 3LDLA 2LP4A 3T1YF 2ILZA 5CHCB 4U67L 5KT6A 4RZRA 3EZUA 1YRXA 3UDEA 3TUPA 1RT6B 1PGZA 3T7ZA 1YJ9N 4FLZA 3R9PA 1YIJS 1T03A 4RW9B 4CYUA 4KSEB 1LAVA 2OPRB 2DR9A 2YHXA 3W2WA 2GTDA 2V63A 2P9KB 3VTIA 2JC0A 3MPYA 2QZ8A 3M6UA 1UVIA 2UVUA 4O4GA 2ZE2A 3ZSRA 4BQLA 3KLVA 1B0PA 5ETQA 4M7XA 3FLCO 5BPNA 3SCLE 1DKGD 4EAHD 2LYVA 3TQ1A 1UL3A 2PFDA 2E9ZA 4DR7F 4DR6J 1RZMA 2OUGA 2RQMA 4BRNA 1JX4A 3RAQA 3N79A 4QWCA 1TYQB 1VQNS 2ZBIA 2UUAJ 1XMQJ 2IM2A 2F7VA 2VC1A 4ZJQA 2FLNA 2UV8G 3I56S 4OYXA 1D09B 4LSNB 2LQJA 3THXB 2A6MA 3GYXB 1KWMA 2HVZA 1KRPA 1TTHB 5E41A 3IP0A 2YX7A 5I3UA 2R2RA 4F4AA 3WIUA 4I9LA 5AZIA 3CJ3A 3N6LA 3LM2A 3MOJB 4J9OA 4X62J 3HVWA 4IZ9A 1IKVA 2C2RA 3SFGA 3A13A 3I8BA 4HHHA 3C66A 1WLJA 5LMNK 2LECA 4YFUA 1V4TA 2PEBA 4DS4A 3FUYA 4IOAL 2R2UA 3RBXA 3KHGA 5BRHA 2ROEA 3IRXA 1HNWF 1KSPA 2KL8A 3OHRA 3LP3A 4L72B 4ANDA 5KFSA 3OYCA 1YVNA 3NGUA 2DH8A 4ELTA 3JSBA 3MMBB 4CJSA 3POTA 1YBUA 2J0QD 4CJTA 3GR1A 3TSQA 3BJYA 5JXSA 4EZ6A 2MHEA 4OJ1A 4ED4A 2P9PB 2DVIA 3VEOA 2GC8A 1UP1A 1BCMA 4EUVA 1SJFA 2BQUA 1NZ8A 4HTIA 4FWKA 4F26A 1JLCA 3AOCA 2Y1IA 2UU9J 3OS2A 3S3MA 2AYGA 3UWTA 4WK3A 1WD6A 5AT1B 4FS2A 2W9CB 1NDLA 2MZSA 1K73O 1RU2A 2OELA 3J81O 3HSGA 4NASA 1TL3A 3J81Y 2RT3A 2AGOA 4CJLA 3VEWA 1JCGA 3MN9A 4BRCA 1RAEB 1U25A 2NQPA 1GLDG 3HYFA 4EYIB 2QJ3A 4PG4A 2JEGA 3J7Z5 2HQFA 1QSSA 1A0OB 3MCSA 1M5PC 4BVOA 3UNYA 2VOOA 1ZA1B 5EGYA 2CPIA 2QK9A 1FXXA 2ZGYA 4MIAA 3HOTA 2F63A 5CYQA 1X8DA 2FVCA 4NZ0A 5CA5A 4X64K 3U7JA 3LGMA 2V7ZA 3QZ8A 3TX8A 1S6QA 5L1JA 1BOTO 5IT0A 1T9VA 1D8YA 2B7CB 2C1EB 3IM9A 5AQVA 3AHPA 3OL8A 2ZBCA 4F50A 4ZN1A 1WBDA 3C6TB 2DBBA 2E7WA 3FKBA 3C15A 2ASPA 1RAHB 4FYYB 3VMFB 4PG6A 1Y11A 1NMEB 4J2EA 2R7WA 4X66K 5EX0A 3QGIA 1GK8A 2CIMA 3AQPA 3MFHA 4LQ9A 4LSZB 4I4BA 1BA0A 3NGIA 5KFHA 4CFDA 4J37A 1U1MA 1TL7A 1IKYA 1VIOA 2FBXA 1LOUA 2W4PA 3RB6A 5L38A 2R7VA 1SJ4P 4I7FA 1WTFA 4EO8A 2P9LA 1JLCB 5BN8A 4PXDA 4UTGA 1SBRA 3E51A 5CAAA 4Z0UA 1MDUB 1S1TA 1AZSB 2A0FB 1WF2A 3OYNA 2YH1A 5LJVA 3G8SA 3VQAA 4EBDA 1G3OA 3WC0A 2PFUA 2BW7A 3FSIA 3TVKA 4A5BA 2ZHAA 2RRBA 1RHRB 5K14B 1SUQA 1RU1A 4C0OC 3RGIA 2A3JA 4I0WA 4CK3A 1KOHA 2HBJA 3H5SA 2K8GA 3OS0A 3O9TA 3M32A 2HGNA 4KH1B 3R1HA 3ENWA 1U26A 4YORA 2HZAA 2ZNYA 4EK2A 4PL7A 3MWTA 1CC8A 4OGCA 3MAAA 1KHVA 4Q0BA 3ALYA 4C2MA 2UUBK 4O8UA 4LR7A 3MTJA 1IBMF 2OHDA 2NZCA 4N56A 2MLXA 1YWXA 2FY8A 4AXJA 4I6MA 4KE5A 1VR6A 3AVGA 1K0TA 3H20A 1HBNB 5LMNJ 3KLHB 1J54A 5F2RA 3NS5A 4UY8O 2QA4G 4O5BA 2VA2A 2AQ4A 3AD7C 4W5TA 1W26A 4HL9A 2L9WA 1FKOB 5CD4A 1ATRA 3CM6A 2IAJB 1IKYB 3IMQJ 3VTHA 1RDRA 5J2MA 2KM8B 1RAFB 5HRPA 2IVPA 1W2IA 4JI8K 1CEZA 2QYCA 4I7FB 4HCCA 4E1MA 5AJ3K 5RUBA 4Y0FA 2CPYA 2DR7A 2WZ1A 3FZKA 1TK0A 2MKYA 1NGGA 4RKUC 4CGGA 4XTTA 4L6V3 4DU1A 2HVEA 3S3OA 3GG4A 4C9DA 5KFRA 2LDYA 3V9WA 5JVHL 4FJMA 1VQ7N 2MMYA 3QYYA 1H7WA 1RAJA 1RTDA 2CZ4A 4F3MA 1SUQB 1WHVA 3R5BA 2B6AB 1A7GE 1N6QB 2HEKA 3L4QA 4G1QB 1SH2A 4IO8A 3PW4A 1HMVB 3HL8A 1YI2S 3EN9A 3QGHA 3RMDA 2QMUB 2MYFA 1EB0A 1T3OA 4PG5A 3R2CJ 2WK4A 3ET6B 1OH6A 3MDFA 4JBCA 1RBVA 5D15A 3CE8A 2IM0A 3BO2A 3GIJA 4M3TA 3CD0A 1S22A 4FJ9A 1QQCA 3S1TA 1XEZA 2YWKA 3KUEA 2AP6A 2J9EA 2UUWA 4DCPB 4MIWA 4Y28C 3HD1A 2YCHA 1WNSA 5BYRA 2ZQBA 4I6MB 4J9MA 3QFUA 4FXWA 3F41A 1UFKA 4TNOA 4X64J 3BM7A 1Z25A 1QZ5A 4I2PA 4JI2F 2CQGA 2DY1A 1KEKA 3H6EA 2OAUA 1SZ2A 2E1ZA 2IA0A 4IKAA 2MY7A 1S76D 4AE5A 4JKGB 4WQ5A 3CCSS 4FO0A 4G3IA 4A8KA 5J2MB 4ECYA 3NH0A 1EARA 3BBCA 4X66J 1R6VA 4CERA 1K1SA 3ID8A 1HHSA 1A5XA 3VAMA 4CHYA 2B9WA 4TYBA 4I69A 2D0CA 1S7IA 3IFRA 4JEPA 2P9NB 3QEWA 4USKA 2DHAA 5IC4B 1S7HA 4NLDA 2ZJPQ 1MMLA 4RNOA 1SC4B 4USHA 3GILA 4PKDB 1O5JA 4E89A 4DMNA 5AQMA 3BF4A 1RTDB 2OFGX 2FC0A 1YITS 4K4UA 1KDNA 4BDZA 3RUBL 4CHZA 4EFAC 1PAEX 2JX2A 2UXDF 5FLXO 4DTOA 3GG1A 5B0DA 1IWAA 5FLXY 1NNEA 4GVBA 4FJJA 3NWGA 1OSCA 2OPQB 4JI3F 3VQTA 4F8RA 2HRTA 4FW2A 4DSIA 3KD1E 2Q3SA 4DX5A 3LOUA 2EFGA 3MCMA 3M8SA 2VONA 3LM9A 1X60A 3OTOK 1P6TA 1YHQS 2YNGA 2MHNA 1Y9OA 5IWAF 4MLEA 2NRHA 1X9WA 3NNCA 4J90A 4LFAK 4TY9A 1VYAA 1FVSA 3HSDA 2UUBJ 4I1TA 4HUEA 5KFCA 4XEIA 2W8LA 4OX8A 3LDNA 2CPXA 4FZVA 2OPPA 4NZ6A 2F8EX 3BPDA 3ELHA 4L3QA 3CO9A 3OS1A 2OGUA 3O1WA 4BG9A 2Y8YA 3KYLA 4B8CA 3Q8RB 2V94A 2JSXA 1MA9B 5IT4A 1BWVA 3ZZTA 2GHWA 2F8MA 3M05A 1U1OA 3ADAC 4JI8J 1T05B 2ATCB 3HPGA 3I9ZA 1UJ4A 3VQ9A 3P1GA 5AJ3J 1BA1A 1K9MT 3SEOA 4C8OA 5KQ8A 5HAOA 5KFJA 3FBCA 4NOHA 2VL1A 2FBTA 3LF0A 5AXMA 1OY9A 2RF2A 2W6KA 2MGZA 1A5VA 4CHPA 2OSRA 1S0OA 2AYBA 1SL1A 1GAOA 4C48A 1UEVA 3T3FA 4IO9Q 2YKMA 1VOMA 4Z7YA 5JLFA 4Y2MA 1FRKA 3T6JA 2KRRA 4J2AA 1QUVA 2IC3B 1VQYA 3W9HA 1VQ6S 2OFHX 2F5GA 4BS2A 1ZAVA 2I5JB 2UUAF 4CFAA 4DV2K 3JSYA 9RUBA 2W42A 3BH7B 1XK8A 3L2WA 2QKKA 3HZEA 1PC4A 2D4WA 1RAGB 4AUKA 5M1PA 4L76A 5DM7L 1G15A 3CCRN 2HQGA 5C12A 4KR0B 5E3PA 3VQEA 3LUYA 3BEXA 3WZ0A 5DETA 2ABYA 5EWEA 1DURA 1YGYA 1ZBLA 1WSVA 3UVJA 2OPPB 1U6BA 2JWKA 3GYGA 3CJ7A 1MN7A 3W65A 4TLRA 2LKZA 5LSOA 3VQDA 4J8FA 4ZPWR 1E3MA 3A5MC 1VQMS 3VA0A 4YDXA 1B64A 3E1YA 4BHQA 2HFOA 2H5EA 5KFKA 3AGKA 3RSEA 3DLKA 3I6PA 2RU3A 3UDLA 3VF0B 4BVPA 1S72N 4CJUA 3OYDA 2C2NA 2YKQA 3V6DB 3KK3B 4BWJA 2BJEA 2MKSA 1W9HA 2MKCA 4K4TA 3PR4A 4ISFA 3V81B 2W1BA 2K2PA 2AZ3A 3UI3A 3BREA 2BJ3A 1CBKA 3QERA 2HHSA 4B3MF 5HQLA 2LQBA 4FPBA 2O4IA 3KIOA 5KFNA 4M5JA 2BZ2A 2L48A 3B6PA 3ULHA 1YLXA 1PILA 2YKMB 3VGVA 2YNIA 3TA0A 2ZF5O 2BGGA 1T02A 2ZH7A 3G6VA 8ATCB 1EP4A 4MMOA 1REGX 2RS2A 3AQOA 2W2OP 1YZ7A 3S8SA 1XR6A 2ZH8A 4GRSA 4EHTA 2H48B 1S57A 3L2UA 1TP7A 2CPHA 1HW9A 1VRUB 3PNIA 2XWYA 2KG1A 3CEDA 4JNEA 5BPLA 1QUPA 1LV5A 5HL7Q 1ZYQA 1J2VA 1HI0P 2AT1B 4F2RA 4P75A 1VQLN 3I5AA 2W25A 1MLAA 4OGEA 1GMVA 2DNHA 2DFFA 1OYDA 3KWMA 3I32A 4KV8A 1LWEB 2GQ2A 1P8ZA 3CMAN 3S9HA 3BZKA 3ENHA 3OTOJ 2E6LA 2PA8D 5ETPA 5E5NA 1N34K 1VBKA 2QV6A 1WDDA 4LFAJ 4U8VA 3W9IA 4DTRA 4O44B 4PQUB 4TN2A 4DV6K 4M5NA 4NCAA 2WBRA 4FK2A 1NB2A 4OPJA 3O9SA 3BV8A 2R8JA 1TKTA 1NJXA 1K8AT 4BROA 1RXOB 1N8RT 3M2UB 3KMQA 3T1HF 1UZDA 2FC9A 2DR6A 3THVA 4I67A 2YKPA 1W0HA 1T11A 1RBSA 4X4UA 4LF4K 2CDRB 2L9DA 1U6FA 4E7IA 2Y8WA 1DTQB 1NM2A 2QA4S 4MKVA 4HH1A 2YNIB 3M8QB 4P7TA 1CZ9A 1B0VA 3CJRA 4B3SF 4CJVA 3RMAA 3C94A 1TL4A 2J6TA 1FT8A 2ZBPA 1NB7A 3OHBA 4CF8A 2YTCA 4DU7A 3HSJA 3FFKB 3CFRA 4QW8A 3TW0A 2P9IA 3AOAA 3EGNA 2L9NA 3QIPA 4J2BA 2C42A 1FFWB 3VF6A 2GCFA 1C4CA 2E1AA 2D41A 3VAIA 3QNWB 4C6AA 1RK8A 4DV2J 1DJ0A 3OR2A 3DXMB 3L3VA 3TAGA 4KV8B 3KFWX 1TL1A 2YNHA 3ZZOA 5FIIA 2KRBA 3K0JA 1GLJO 4YOWA 1HLWA 1HL6A 2CQ4A 4LFCK 3D66A 1YITN 5L1LA 1RA7A 2EX3A 3A3OB 4DR1K 4EFHA 1RDDA 2MLYA 3AD9C 4FP9A 3SI8A 2AZ1A 3KHLA 4BREA 3H25A 4F4KA 3PW7A 1N32K 4O23A 2J9DE 1X5PA 1TUYA 2BBEA 4ZVOB 3K8WA 1AFJA 3D6HB 1LWCA 2ZWOA 1Y4ZB 1NGEA 1QAYA 3QETA 4W5OA 4HHJA 2A5XA 4X4OA 3TI0A 3AVLA 4C7QA 3BBFA 3I5CA 2Z8QA 3GE1A 3RBDA 3SV3A 4B1UB 3KWIA 1MWQA 2W7AA 1O6XA 3NGTA 1B9FA 2YKNB 2DPIA 2NXJA 1RE1B 4UW2A 2EK6A 1F5AA 1NMDA 1Q5VA 3OT9A 4MYTA 2VPXB 3SFUA 1RBTA 2ATQA 3A8KA 2ATLA 3I8DA 4X4NA 5KFQA 3C7NB 2BANB 2ROGA 1OPZA 1BY9A 2QA1A 4QBUA 2EFPA 4M5GA 2HMIB 3IC1A 3NF8A 3K58A 2WSCC 3EE9A 4B3TF 3PRDA 1KD1T 2G8HA 3VGMA 4BC7A 3CUNA 4ZS6A 4ISGA 3ZTQA 4B1ZA 3SDEB 4BY9C 2WW8A 3JYTA 3QO9A 4FWRA 3EEQA 3PLAA 3O5TB 4H4KC 4F0HA 2DPJA 1SKUB 4X4SA 1A5WA 1SQEA 1FTRA 1X4EA 3PHEA 4NPOA 2NSCA 3DLJA 4B9VA 1IKXB 2ACMA 2P6TA 5F9NA 3J80U 4ZVQB 4IG0A 4WFBQ 1WEXA 2HAIA 3SUNA 3W5ZA 3FRYA 4YB6A 4I6AA 1HWLA 3THTA 4H4KA 3TANA 3B8AX 1N8RO 1OYEA 1V5VA 3PSIA 1X5TA 4JI4K 1C2PA 5KAKA 1KVCA 2R9LA 3HSZA 2FJWA 5FD1A 4FJXA 1D8ZA 3HZ6A 1HNZF 1C1BB 1NRKA 1V5IB 3DHXA 4NYFA 1N34J 2FJEB 4PG8A 1WSFA 1EX8A 1S0NA 1S9EB 2WOMA 4M63A 3D0PA 1S9GB 1K8KB 2I8EA 4DV6J 4JI5K 2E7XA 3R5CA 2O8BA 2HURA 4RU9A 1Q82T 3MCNA 2OLWA 4LH5A 2VG5B 3OR1B 4Y2KA 2XY8A 1S6OA 4PKGA 4OZ0A 2ZJQL 2EBGA 3MUTP 2BW2A 4HR2A 4B1WB 4LY7A 1YRUA 3PFOA 4C1NI 2JJ4D 4DLEA 4LF4J 3WC2A 1LK7A 2CQIA 3MR7A 3BGFA 2XHCA 3PO5A 1F2GA 1BI4B 3EDRB 3O3HA 4DTXA 2AJ4A 4B3OB 2P5GA 1U1NA 1FEEA 3OHAA 3TAFA 4CK2A 3OFFA 4WYWA 4AFFA 2RE1A 4WIIA 2ZOGA 5HATA 4FF1A 3T1AA 1NJZA 3SSRA 2CJYB 3AVNA 3CHWA 5FPMA 2ZJRL 4JHDA 3BF3A 2NLWA 4CZGA 1X9SA 4X65F 3LALA 2BYCA 2MEWA 3MN6A 4CP5A 3KKSA 1EJ7L 4CJWA 5KFIA 2RN2A 1RT5A 1F21A 4MKAA 3TUZC 4WYLA 2IVOA 3D2EB 3NGRA 3MWPA 4KHPK 3T9ZA 4YY3F 1HQEA 2Z56B 4NLPA 2G13A 2BA9A 2GAHC 2V9WA 4LF6K 2IM3A 3SK3A 2IFXA 1UA0A 3HVTB 1UFWA 3OTDA 3A8YA 4H0YB 3R1XA 2AHOB 3MMCB 2HYIB 1MMNA 2WOMB 5F0XA 1JLAA 4LFCJ 1CG2A 5D6GA 2UUBF 5BR8K 1TVRA 3DI6A 4IH6A 4B02A 4DR1J 2N3LA 4CJRA 4OX9K 4OZ3A 5KG4A 5AXKA 5M1KA 3QESA 4DV4F 3D1HA 1N32J 4PYDA 4USMA 2ZH9A 4WFXA 5AFUH 3EO3A 5I9EB 2V8HA 4J9VA 3I31A 4DQIA 2VJUA 4XH5A 1FFGB 1YK9A 3THYB 5A2QO 3ONQA 2HFNA 1WSIA 4JI8F 1V3SA 3SMSA 4CF9A 5A2QY 3VCDA 5AJ3F 1S0MA 2Y1LB 2V8GA 5D3GA 1XJWB 3CCTA 3TPQA 2RQCA 1TL5A 4LRCA 1NK5A 4EP4A 1JLQB 3A5OC 4ZVRB 5HROB 3EXCX 4WF9L 3CJQA 1N5YA 2HNDA 2B4PA 1SQGA 2MQ8A 2OTLS 4Z4HA 1MNEA 1H6KX 2B8PA 1UKUA 3HLUA 2DHHA 2I7PA 4OX6A 2XQCA 1WACA 4ED2A 1MROA 1HQEB 3SSSA 1CZBA 1WJ9A 3OYBA 1B3TA 3OVSA 3MEEA 2P8IA 1YF5L 3QIDA 5GAEI 3ZEUB 4OL8A 4C8KA 1BISA 3S6EA 3SCIE 4KHYA 1YJWS 1FDBA 3A3PB 2QA4N 5B0FA 1JQGA 1YAGA 2RHKA 4AF1A 1R0AA 3K9KA 4DL5A 1RADB 3GP9A 2N7CA 4EGLA 3UCUP 1H72C 1U6ZA 1TU0B 1U02A 1U8SA 2JEJA 4JI4J 1S1VB 4QOZB 5FDLB 1JJCB 4X4PA 3G82B 3UW1A 3WX4A 4S0MA 4QQBA 2KB2A 3OYFA 4WTYA 2HWTA 4LRAA 4F25A 4JUZA 3UD3P 2R7UA 4WBFA 1SJ3P 4JI5J 1I1GA 1UPPA 3HHNB 1U2VA 2HNZB 3SAFA 3I4PA 4KTZA 3MMJA 4AHUA 2F8HA 1IG8A 4ECWA 1Z26A 4K42A 2PI5A 3NHGA 2O8FA 3DM2A 2HS3A 4IJAA 3AO2A 2GEMA 1FRJA 3GIKA 3AA5X 3TA1A 1TKXB 2XNRA 4NEZA 1N5YB 3D68A 1R43A 3WXJA 1TAQA 2E9RX 5C15A 5KT4A 3I55S 4LBHA 3NGZA 1FFSB 3TRGA 4HCBA 3T41A 1AROP 3MX2A 1WDTA 5HBMA 3C16B 1IR0A 4FN5A 5C25A 2YQ0A 1KC8O 2V4RA 1S1WB 4RUHA 4KPCA 1GOAA 2DHXA 5DQHA 4WYBA 4KH0B 5C2FA 3SZ2A 3V4MA 1VFJA 4OZJA 3AVFA 2P9UA 2FJBB 1WKKA 1IBKK 1WELA 3LA0A 3R7BB 4KHPJ 3R9LA 3OSNA 1CLFA 3WNHA 4LJMA 3J81U 4A8SA 4LBPA 2NZ4A 5HVGA 1U1PA 3RU0A 4WP8A 1RA6A 1HI8A 4LF6J 1S1XA 2DCLA 3VEXA 1MWZA 2G2ZA 3K8VA 4DX7A 3DGVA 2EXUA 2B3TB 1PYOB 4KH6A 4OYBA 5GAGI 1EO1A 3KK2B 3H2LA 1FWPA 2DKOB 1AW0A 2VF3A 1ESVA 5BR8J 1CQMA 5KFPA 3T5JA 4U7BA 4OX9J 1PO6A 5GMKa 4KC5A 2DH9A 1RILA 1SCJB 3JS9A 1KTVA 4BR4A 1K0VA 1Q16B 3V6KA 4GC6A 4FJIA 2EC0A 1FNXH 3VA3A 5CYMA 1E6VA 4M7YA 2W40A 2ZDOA 4MQ3A 2XSFA 4TU7A 3MXJA 3H7HB 2D1KA 4FYDA 2OEJA 3CIZA 2QXLA 2RHQB 3CCUN 2P9SA 2HLTA 1X0PA 2NS1B 2IOCA 1J53A 4Z2XA 4YOTA 5EUHA 2BQRA 2ZM6F 1U1LA 2EFNA 2NYIA 1OH7A 3A12A 2QN6B 5GAEU 1BO5O 2NCKL 1T3NA 4CZIA 5K5MA 3JQKA 2OD6A 3P83D 3CJ5A 2LXFA 2CNKB 4YHHF 5DDRC 2EG2A 4UQTA 2NRRA 1FTCA 4F4XA 2NNWA 3ID6A 1NKBA 3U6FA 4ZVHA 3NG8A 5HMZA 1N33K 4OJHA 4ZLJA 3OLBA 3RBZA 1RISA 1X4CA 2BE2B 3P5BP 5BJRA 4DFKA 3W64A 2PYJA 3N0VA 1Q78A 1YKWA 3WQTA 4WCEL 2ZDPA 4N7TA 2U2FA 4DL0C 4DUTA 4FLXA 4QCLA 1I94F 3A8JA 4ZKAA 2HW3A 2IDLA 2IA6A 2BJDA 3QFPA 4ECVA 4O3PA 4FK0A 4MO4A 3R97A 3CJ4A 4J2DA 1RT1A 2XY7A 1ZBIA 2G0IA 5SWMA 5LY3A 1S10A 3HFZB 5GAEP 1AB8A 2YH0A 3I0RA 2H54B 4Q7AA 4K8ZA 4DB3A 4ZVEA 2PN6A 3HFVA 1SV5A 4TQRA 4OI1A 4H5NA 3MM8A 2DXFA 3M8PA 4EBEA 1WEZA 5J1EA 3K5OA 2F8SA 5CYMB 1T9UA 2G2YA 5KFYA 4EYHB 4LC9B 1U4BA 3TQEA 3MM7A 3BDPA 4DUYK 2P9SB 2F4VK 1VSEA 3M6XA 1RCHA 5B08A 3H45C 4A4JA 5DRKA 3ENBA 2HK3A 1UAWA 4WFZA 4ES2A 2YV0X 1JMTA 3NAHA 4DFPA 2VCPA 2OPSB 4KFBA 1I39A 1NGCA 1CJVA 1PBUA 4N76A 4DTNA 5CCLA 1HJRA 4LF5K 4ZIWA 4NA1A 1IKWA 1JB0C 4CJ4A 4FJLA 2XCPA 1XQSC 4YOXA 3AY9A 1CJKB 2QRRA 3RR7A 1CJUA 1RDUA 4ECZA 2LDIA 2RRNA 3CO0P 4U96A 4ED6A 3CCEN 3QMQA 2DJWA 2H3EB 2IDEA 5C42A 4QR2A 4KHQA 4YOEA 2FJAB 1VRTB 4ZHRA 1ZH5A 3LP2B 2GA7A 4KQZA 1ZPWX 3VZHA 4CGHA 3MR6A 2CXEA 1H38A 4IRCA 4HI1A 2O8EB 4YDDB 1BLUA 2MDAA 2ILYA 1FO1A 1E6YA 2CQPA 3KLGB 1WAFA 4FWLA 4Y34A 2W9BB 3V9SA 3MM9A 1QD1A 3R8YA 4A8FA 1IBKJ 3G71N 3D2WA 3PKMA 4CQ1A 1Q95G 3PCOB 4ZLPA 5D0EA 3MEGB 3ZSYA 3O3GA 1XQIA 1EQ0A 2OTLN 1JXBA 4F2SA 5IFMA 3NP5A 2W24A 4IOCQ 4OJRA 3TAMA 4B9MA 3VALA 4LFBJ 4FOIA 2AJFE 5DLGA 1F9HA 1FRLA 3M1FA 3NVMA 2GBZA 5GINA 3R7SB 3LDQA 1ZZNA 1LW0B 1FNOA 3VQ7A 4FWPA 2YQ1A 4PWDA 3HKWA 5HQMA 5AZJB 5GAGP 2C28A 3LPUA 2WHOA 4RNMA 3PIPL 3MMAA 2NR0A 3D2FA 3L09A 1Z4UA 2O66A 2HMPA 4LF4F 4FJ5A 5CY4A 5L46A 1CJUB 3FQLA 2LU1A 2HFVA 1RBUA 3C6UA 1S5ZA 5KG2A 2HB5A 4RW4B 2DK2A 1TR0A 5A8RA 1FJGK 4OKEA 3CCLN 2GUIA 1JLBA 1P9YA 4CJKA 1VQ8N 2DGWA 3JSRA 4IBNA 1M1GA 4FJNA 1E6YB 2MQMA 1H2VZ 2E6MA 2DNKA 1N33J 4O3NA 2EWSA 2M88A 3MF5A 3GV7B 5EWGA 1O13A 2A3ZA 1ZOTA 4DCHA 2HG4A 3QT6A 4P7VA 4X4VA 4FKXA 5HLFA 1NDCA 3FSYA 1V9OA 4K59A 1GXLA 3TZYA 3U02A 1WI8A 4YNQA 3FZBA 3EJMA 4JD2B 4M3WA 5FLXU 4CTAA 2HBMA 1NPRA 5F8HA 1BD6A 3CDBA 3I55N 3FR0A 4JS5A 3NBPB 1OWXA 1UVKA 1JLGB 2OKQA 3VGLA 2FDNA 4LR8A 3T5HA 2FVRA 3QBCA 1TUUA 4L74A 3N6MA 1BQNA 2QG9B 5FRNA 2XS5A 3CCVS 4I2QA 4K2JA 1XMBA 2V68A 4B9LA 1L3UA 3IBFB 1XC9A 2U1AA 4DU4A 4MDBA 3FVYA 2DNQA 5LXRA 1YJTA 2VFRA 3BGUA 1O1WA 3MX5A 1DHMA 3UCZP 3H90A 4ZVFA 2VQEF 4LQ3A 3AAPA 4JRPA 4MT1A 4FBUA 1DY3A 4OHXA 4DUYJ 2F4VJ 4CE9A 3TJ8A 3VQBA 2M0GB 2YX1A 2FGCA 1NDPA 4GKJF 1RAAB 3BY5A 5KT3A 3W60A 2XS7A 3O80A 3Q83A 3FMBA 1R8PA 4K43A 4LF5J 1WEYA 5HSPA 4CJ7A 3IR5B 3O2IA 3OUYA 1ASWA 5LOQA 4E7JA 2UZAA 5IM0B 3FEYB 2WVEA 1UCNA 1VQ5N 4M5DA 1Y64A 1DQ8A 1R27B 4RCHA 4W5RA 2ZH6A 1WORA 5DG7A 5E3RA 2VB6A 1RTJA 1BUPA 5HLFB 2R2SA 4DFMA 4Q2MA 2BUPA 4X84A 4AM6A 2RKIB 4LT6A 1RT7A 1G7CB 4J91A 1F9FA 3W2VA 4R25A 5IS2A 3V9ZA 1FWLA 1TUGB 4YB1P 1VQKN 4ICLA 4G65A 1OMSA 1NO8A 1VQ9S 4LRBA 4NE9C 2FF6A 3M2VA 4H4MB 3UN3A 3EX7B 4JI6K 1REVB 2QTDA 2HFUA 2VWBA 5GADI 4BRMA 3JSMB 4BC4A 1TV6A 2DD8S 1HKCA 5B0CA 3CMQA 4N8OA 3C6HA 2I38A 2M8HA 3SXLA 5LMUK 2OMLA 2DNRA 2CH5A 2GVDA 4EIAA 4FXDA 5A8WA 3N4QA 1ROFA 1FKPB 3G4SS 1WOOA 5SUHA 3JTPA 2KDOA 3J7YI 4JI5F 1WSRA 2AYEA 1NSPA 2C2MB 1TQLA 4D3HA 3QRRA 2QLBB 4PEOA 4FLUA 3T69A 3CJ8A 3ENVA 1NOYA 2CDQA 1NU0A 2KHOA 4R8UA 2J76E 2JVOA 2WFBA 1UETA 5KI6A 1MSWD 4EO6A 2PT0A 2FBYA 1N36F 2DIUA 1D3WA 1NGBA 3IN5A 2E5LF 3GG0A 5AQIA 3Q0AA 4R5PA 2E2OA 1SPBP 4FLWA 4MFBB 2KVIA 3F2KA 4JYAK 1RHMB 1YRTA 4HUGA 5IOLA 2HRUA 1EIYB 3BPSP 4A48A 2XC9A 3BSOA 4KBIA 1FJGJ 1XN9A 3C3LA 4ELUA 2LXIA 1RB0A 3DC2A 1PYSB 3TSPA 1QTNB 4BR9A 1VC6A 4NLCA 3M30A 1QVFM 2FHKA 2M7SA 2CNNB 3MTKA 4FLVA 2BEFA 3HX9A 5A6PA 4DSEA 2ZH3A 1T9WA 4BRLA 3DOMA 1Q7LB 4QJVA 2WBMA 4NYNA 1DT9A 4F4ZA 4KHPF 2UUCF 2QX0A 3C2PA 4O3RA 4RTFD 4XH1A 2XCAA 4KAZA 2H4WB 5HRSA 4JV0A 1VQOS 2IYIA 4BC5A 4A8XA 2V51B 5M1QA 3PZPA 3OXLA 4F0KA 3HTVA 2VHGA 1DLOA 1X5SA 4FJHA 2ERRA 1RNHA 2DEJA 3K59A 4DDFA 5KRTA 5E84A 3D28A 2QTWA 1FDNA 4GO7X 1RTHA 4NXMK 3HMJG 4UT4A 5F8NA 1CS4B 4Y0WA 3V4IA 1RTIA 2ASJA 5ETSA 2YJFA 1NK9A 4IFYB 1Y10A 2WONB 4AQYJ 3VGTA 2RUSA 3CNQP 2VG7A 3MN7A 3IKMA 4FBTA 4NI2B 4QS7A 3R8EA 3DOLA 2D69A 3THWA 3WX8A 1M1KO 1D9DA 5F8GA 2MKJA 3O6QA 1RWPB 4GO5X 9ATCB 3H4DA 4J9NA 3QGPA 2A2DA 4AH9A 1DRZA 1YTUA 3AOBA 2CQDA 3JXUA 4FM0A 4KI6A 1X1PA 4DX8H 4F4WA 4OMFG 3CIMA 1RWUA 4GV6A 2M9KA 2QEXN 1NJIT 5ADXA 3AA4A 3CCJN 2PC6A 1FEHA 1TGOA 3DOMB 1VSJA 4DR2K 4FM2A 4NWBA 4TYAA 5GADU 4QIFA 4L3NA 1B4SA 1BGXT 2XYPB 1TAUA 4WFNL 3DU5A 3EUNA 2OTJS 4DTMA 1C0UA 5C0YA 3HCXA 4H0TB 3ILLA 4DMZA 4J9RA 5HO4A 2IBKA 5EY4A 2IGIA 2Q1NA 4OKJA 1X4DA 2KTQA 4CO5A 2L3MA 2F7TA 3AA2A 4JI6J 3MCOA 4WFAL 2FZCB 3SIPB 3D7EO 3V4IB 3UN5A 5DDPC 2VV5A 2Z1IA 4XIUA 3KLEB 5LMUJ 3PYGA 5AQXA 2ZEJA 4OLOA 3NVKA 1AUSL 4QWDA 1I6JA 2C3PA 2JFDA 5DQIA 1ZM2A 2MZ1A 1JK9B 3LQVA 4USJC 3LPTA 2O8DA 1SC1B 1M90T 3EGZA 5GADP 2P5VA 2UXBF 4KRWA 5J2NB 3CXCM 1Y5IB 3WT0A 4QR1A 3CULA 4KGZB 3OTCA 1HNIA 2GNKA 2ZWPA 1O51A 2GUPA 1A9NB 5LXYA 5MLCQ 3PIOL 4JKHA 3BSAA 4FJ8A 1W2BM 3J7YP 4ID5B 2N7YA 3M6GA 5HQ8A 4KO0A 1Q8LA 3O08A 4JYAJ 1FX2A 3ZYYX 1JKHA 4M3XA 4ECSA 3N01A 1H3DA 3NH2A 4BDYA 2MZQA 3AXMA 2A41A 4P2MA 3NOGA 1HNXK 5B0GA 2PO4A 2ITMA 1Z2LA 5K20B 2JRSA 3T5LA 3QICA 1RT3A 1URRA 2X1BA 3MM5A 3OSPA 4CZLA 4NRUA 4K8RA 4DV7F 1NH8A 3GV5B 2IVYA 4JI0F 1HR0K 2VDIA 2YPYA 2N82B 1NGFA 3JQJA 4KKOB 2GHVC 2LLZA 4M3UA 3NE6A 3KK1A 3J7A1 4DX6A 4LRDA 3QDKA 3CPWM 2LCWA 3KUGA 3ZT2A 4ITSA 1RBLA 4AHSA 3N5BA 3ULEB 2V2KA 4UOGA 1T9XA 1RYRA 1VS3A 1LEOA 3EICA 4NXMJ 3X3UA 3CCQN 3QWPA 2MSSA 1GMWA 4FZYA 3F9KA 1H2TZ 2DRAA 1S5JA 1GMWD 1QAXA 3VF4A 5DM6Q 2FC8A 1QQOA 3RJMB 4BG8A 3HHLC 1RHQB 5A8KA 4CGDA 3M8WA 3PUFA 2D74B 1YQHA 1QZ6A 1NPKA 1XMOK 5GMDA 3JS6A 3ITHB 1U7LA 1CULA 1XTZA 2KYXA 1GLBG 2YKAA 3HHLA 3DWLA 2CUYA 3HHLD 5F8LA 1JKHB 3R2DJ 1U47A 3E01B 4OVLA 2YNFA 2B51A 3CQXA 4KB1A 4HACB 1T3VA 3KHRA 4FWOA 2VICA 1R7IA 4CESA 3T5KA 3CC2S 3CQ8A 2IS3A 2P9GA 3GU0A 3TWZA 4DQRA 2B4UA 1Q5YA 3EPGA 3IS9A 2VPWB 3ZZPA 1S1UA 4JI7F 4HLBA 4RX6A 2DY9A 2HZVA 1GOCA 1ZM9A 2MTLA 3MAQA 3GJRB 1GNKA 4JV2A 2PMHA 1HJOA 2MQPA 3IG1A 4J9KA 4DR2J 4NLBA 1HI1A 4LREA 3AVHA 1KLNA 3QFWA 1SJRA 4A61A 1Q9YA 1FE4A 4A8YA 3LDPA 3Q24A 3BGLA 4B9UA 4OLAA 1VJQA 4N5SA 4G6VB 2E2PA 4H0VB 4FOEA 2DFHA 2CZVC 2E66A 3J80O 3SCJE 5KQDA 5A0YB 4FYWB 1QLNA 1JIHA 5B8HA 3G9CA 5KG5A 2D5RA 3J80Y 4RNFA 3C65A 4NCGB 2YWHA 3AB4B 3TAPA 2IRXA 2RUGA 2NLXA 2XMTA 1XNQJ 1EETA 1M5KC 3OL7A 4JKEA 5HOOA 4QYZK 4PPZA 2VODA 3BGRB 3DXSX 1EXQA 4H03B 1VQON 3EM1A 1PKUA 1ZM4A 3OYMA 1VSMA 3UE2A 4H5VA 1BQMB 4DV3F 1S97A 5C2CA 3VV2B 4LF8K 3IS9B 1HYZA 3QZ7A 3OYEA 3M7VA 2HNYA 2NRTA 1LNQA 1LW2A 1RDBA 2KXNB 5L9NA 5DS7A 3CPEA 2VQFK 1NGAA 1KAYA 3DN9A 3WXIA 3CW2C 2PBDA 3OW2M 3HVRA 1HNXJ 3HPOA 1OQ6A 3H4BA 1PIEA 3NL0A 4BC9A 3CC7N 2V7YA 1WG1A 3HRGA 1XUPO 3QJJA 2HBLA 1ZS6A 5G0RA 2IM1A 1T7PA 3CJTA 3R5GA 4LF1A 3BSCA 1HR0J 3VHQA 5LSRA 2IHR1 1RT6A 2QW9A 3PJXA 1RT4B 2OANA 1JLFB 4LMZA 2NREA 2EVZA 2UVVA 4RW9A 5A76A 4LF9F 5D78A 1CJTA 4KT0C 2OPRA 5U47A 1ZBTA 4CIEA 4KY3A 4WZMA 2P9KA 1DEJA 1T8EA 2BOAA 3FNNA 3CD6N 2ZC4A 4W98A 4HHUA 4W92B 4FM1A 5ETRA 4IFVA 1T44A 1GLAG 5GMEA 1T94A 4ER8A 2LMIA 4M41A 2HWIA 1WHXA 2R7SA 2FXUA 4K5RA 3O9UA 3P5JA 3VGSA 1ITPA 3THPA 3R6LB 3DLLQ 3W8GA 3AVIA 1MW7A 3M2RB 5JMVA 2J9DA 1KVIA 4C3MA 1TYQA 1XMOJ 1KS2A 2BKOA 4D3GA 1YJNN 4RLEA 3F0NA 4RR5A 3NNAA 3NMUA 2X1AA 3V6JA 4E8UA 1QSLA 1RQ0A 1U45A 1SL0A 2GJ2A 3UCGA 2EFOA 2V67A 3QWUA 4LSNA 2J6SA 3THXA 4RU2A 1IO2A 3G6EN 2KXFA 1K73T 1U8WA 1YTYA 2Y3YA 5AR0A 5IV4A 2KG0A 8AT1B 4DR3F 1FJGF 2IVFB 4ATNA 2HVIA 2V50A 4Q2LA 2OA8A 4U7UK 4K25A 4CH7A 4HT7A 5AQKA 5FPDA 3O44A 2G1HA 4KB7A 4M5HA 3PX6A 1UVNA 1NDKA 2F1FA 4J9LA 3RW6A 4B9TA 2Q43A 4DPTA 2NXNA 2G0CA 1CJTB 4LIWA 4DHYA 2E1YA 3QEXA 3DRSB 3MMBA 1D9FA 1BMQB 1HWIA 1TMJA 4MLHA 1E4FT 2N3OA 2P9PA 1TMMA 1PAUB 4LSLB 3L4IA 4WIQA 4IFVB 1Q8KA 4C11A 3AGRA 2C2EA 1GLCG 5C2GA 2RHSB 2HOEA 4DV1K 1WKJA 5KG6A 3H5YA 4U67Q 4ZK7M 2W41A 2ASOA 2E20A 2E5GA 3ZC4A 2APOA 3FCVA 4WU3A 2UXCK 3KUHA 1X4HA 4P2SA 1NSAA 4DBQA 2C3OA 2W9CA 4E1JA 5D77A 4OHZA 1FF2A 4ZVTB 1NAQA 1UMJA 3L2VA 2Q0UA 1XHZA 2DT9A 4ZVPB 3ILJA 3MECB 3OBIA 2NRVA 1ZTTA 4QYZJ 2CVIA 2WVDA 3WNGA 4WE1B 2DITA 4CO1A 2JC1A 2VBZA 5HVHA 4QS9A 1NG9A 4RL1A 2V52B 2QWMA 4YR2A 1ZETA 4ILGB 4ZPDA 2RE2A 1EX4A 3UR3C 1RWVB 3I0SB 2MXYA 4F04B 2ALYB 4KHWA 2B0GA 4LF8J 4NXNF 2Q66A 4P73A 2KZMA 1JCFA 5CH7B 3KK7A 1QHTA 4U95A 2P1JA 3FFIB 3RWUA 4CF0A 4DSFA 1BHNA 3HP9A 4Z94A 1V3RA 2VQFJ 1S9FA 2UV8A 2NPIA 1HQUB 2WBNA 2GMJA 2VFTA 3E9PA 3H5UA 3SJJA 4CD3A 4U8YA 3C6TA 2FPHX 4M3RA 3MMVA 4GVEA 1MWYA 2K3IA 4CEDA 4I9QA 1Y00A 3RRKA 1SKSA 2PSZA 5DMRA 4HEA9 1KVAA 4BC3A 3G6XA 2P2CB 5JVGL 1VHIA 3B78A 3S01A 1L3TA 1FK9B 4PWUA 4C11B 3CC2N 3CETA 4IOAQ 3DXBA 2Z4PA 4UY8T 1VQSA 4JI6F 1QY7A 4NB4A 1R8HA 4TKTA 1VQPS 3WXLA 3RMBA 1YZ6A 2Z0GA 1K1QA 4FWMA 3MHYA 5KTQA 5D4PA 3GCXP 4LF7F 3DLGB 3FJ2A 4IG3A 1AZSA 3C95A 1ILYA 4L73A 1U0HB 2IIHA 3A3NB 2MZTA 1CZAN 2BV3A 2QIFA 1GX6A 5TKWA 2H5IB 2R7XA 4IQXA 1XNRF 2J7WA 4ED1A 5M1FA 4J9PA 4E7HA 3DFEA 5EX5A 3SAHA 2H1YA 3IBCB 3A8IA 3IWNC 3CDWA 5K14A 1C6VA 5EDWA 4X2BA 4O0IA 2E5IA 3OYAA 1KVBA 2JL9A 1HHQA 2QSWA 4QIGA 1QAIA 3SYZA 2FHOB 2D3ZA 3K5PA 4X4TA 2E88A 2AU0A 3CJAA 1RUSA 2QYGA 1HBOB 3DGPB 1FX4A 1S6UA 4UOHA 3M5RA 4IDKB 2QWQA 4WU2A 4DR7K 4NLSA 4Q8EA 3HO1A 4PUOA 3DMJA 2WSFC 2FHJA 4DWIA 2C3UA 2FHJD 1RBAA 3G0ZA 2UVWA 5D4LA 2KM8C 2XMKA 3H08A 3SBMA 1HBNA 3D3BJ 3KLHA 1YXQA 4A2BA 4DPXA 2COLA 3D5MA 1CC7A 4XDCA 1FKOA 5AQWA 2IAJA 2KFZA 1FJCA 4CDIA 1LFPA 4USVA 2JGUA 1SIZA 1ZZFA 3A0IX 4ECXA 1HIYA 3I82A 2HKEA 1NPPA 3DDNA 1F9EB 1I51B 3LL3A 5CE3A 3E3XA 3W3SA 4H4OB 5FRMA 3PX4A 4IG3B 5AE2A 3KVGA 1RLCL 2NSBA 2FIUA 1CVJA 4NXMF 1M5SA 2K1RB 2VASA 3KMSA 3PY8A 1UWBB 3IWLA 4DV1J 5C24B 3CCZA 4DTSA 1IWGA 3QJLA 4K4ZA 3H42A 3DLRA 2UXCJ 5M1NA 3H2VE 4YOVA 3D7SB 2B6AA 1N0UA 3ZNJ1 3CMEN 4FK4A 1N6QA 1J5EK 2SXLA 4M5MA 3GJSB 3E2EA 1TFYA 3W9JA 1T0TV 4G1QA 1HMVA 2XY6A 3MM6B 1I3OB 4ALZA 1W7AA 4ANEA 3TYTA 4M95A 1U48A 1JJHA 4OI6A 2C2DA 4U6PA 3LZJA 4KREA 5T41A 1Q79A 2FF3B 5AQOA 3CJKB 1BWEA 3ET6A 3ZT1A 2GJFA 1DARA 4PUOB 3DMJB 2BKPA 1LFWA 2CNOB 3S41A 1QVGR 1X4AA 1WOQA 2DHGA 3TX0A 3KDOA 2HQ3A 4ZCKA 1FXLA 2V5HG 3L4BC 3A5NC 4MJKA 3FBEA 2CPJA 4CLTA 4I56A 5EXWA 4GY2B 4DR2F 5M2RA 4JKGA 1QQMA 2FUG9 2KT2A 3PR5B 2F9WA 4PZVA 2DY4A 2DNPA 4LRFA 4JLHA 3VERA 3AA3A 3R6GB 3M1VB 4ZDNA 1VC0A 2D0PA 2W2NP 4I68A 2JLEA 4BCAA 4CFBA 1HYSB 1Y3JA 5KFGA 1JJ2M 3I9V9 1B70B 1LWXA 2CPEA 3H5XA 2P9NA 2VH7A 4OHWA 1U24A 4LVNP 3TVZA 5AQNA 2AA4A 3TZWA 4FJGA 1VBYA 1RBOB 1BQXA 4ILMA 3FZFA 3DLEB 1WOSA 3LPEA 3C46A 4DG1B 2HPUA 2RU9A 1KFDA 3Q2SC 5AE1A 1S77D 3SQ1A 1VSDA 4MH8A 5M2UA 1HA1A 2O67A 2AJ2A 3ZX2A 4AHVA 2YHBA 2ZH4A 2I7NA 4RW6B 5BPMA 1X3MA 1XI1A 4CZJA 2VWKA 4BR2A 1S6PB 3ENQA 1X4BA 1YIJN 2GO9A 3K9JA 1XWLA 2H3GX 4KHRA 3UPFA 4LD0A 3AARA 4O3SA 3FC9A 4OZ2A 4EMDA 1WAJA 4E19A 3LWLA 1RABB 4OZ5A 5JMNA 2D3OR 4LR9A 2OPQA 3DXKB 1ZBHA 2QWPA 1U04A 5I3QA 1VIXA 5JVHQ 3ZT0A 5HVFA 2CPDA 2DHSA 3FGUA 4WQ5C 3HSTB 4JN4A 3ASMA 3BYRA 4Z37A 4XPCA 4ES3A 3KLIB 2C3MA 2D9PA 4KBOA 5BRDA 4CBXA 2MQOA 3ZETB 4NLQA 4TQSA 5E33A 2ZZNA 1Z6RA 1WNEA 4DR7J 3DLBA 1WUAA 2RS8A 4DUZF 1VQNN 1UTAA 1NOZA 4OI3A 1GLEG 2GS8A 3F56A 4DSLA 5F9LA 4ZPTR 5KOXA 3I56N 5HI7A 1GH8A 1H1VA 1VLYA 3LAMA 3X1LB 2AWZA 3F44A 1WC3A 4CVNE 2YWFA 3BN4A 4QW9A 3ZT3A 4DPUA 4KRFA 1TKZB 4M42A 1T05A 5AQGA 1IBMK 4IQMA 5E3QA 5HMWA 3CJ1A 4P74A 1GMUA 2WCXA 1ACMB 2CQ0A 3GL1A 4E1NA 1LAWA 4XAKA 3UQSA 3HK2A 5KG7A 3L3UA 4O4RA 2CG8A 3OBWA 3NS6A 5L9XA 4BRFA 2WB4A 4CLUA 2J9CA 2AEFA 3VAJA 4JKAA 4JV5F 2XEXA 2VA3A 2B8QA 1FXRA 4USIA 3E66A 4CJPA 3FSXA 1N0VC 3EGWB 4JRQA 2IC3A 2VUGA 2HF3A 2OSQA 1Y97A 5L1IA 1GX5A 2YX6A 3CIPA 1J5EJ 2I5JA 2E4LA 3DYAB 1VJWA 2D9OA 4X4RA 1H2UX 1HNVA 4JI1K 2X74A 4CCHA 5L8RC 2G4BA 1FJEB 2QWLA 5BR9A 1IJJA 1SL2A 2BJ1A 3MFIA 2G8UA 4C8YA 5CZ2A 3ZCMA 2QL5B 2VC0A 3V5RA 3H2UB 4CT8A 3IR6B 1RDWX 3SQOP 2QT7A 5ETOA 1RWOB 4ELVA 1BIZA 3VQ6A 4CHQA 2DR8A 2GVZB 1YT3A 4DLGA 4ERDA 2PA3A 1UW9A 1TKDA 4YB7A 2GGPB 4DPWA 5IXUA 3UKRB 4J9QA 2WAQD 3CSKA 1B7YB 1H7XA 1RWMB 1MMDA 1YJ9S 2BTFA 2CJKA 3Q2TC 3EWGA 5F0WA 4IKFA 4WFYA 2B5JB 3MEKA 4A8OA 3ISND 3V6DA 3KK3A 5AQYA 4JI2K 3GOIA 4U7CA 3V81A 2JZ5A 3VENA 4KB0A 2EEYA 2KLAA 3SAGA 3SQGB 1Q86O 3GE9A 5MAOA 3EKUA 5IT9U 1J27A 2UP1A 5HANA 4DFJA 1L3SA 3B4DA 3ZZYA 1OPIA 4DR6F 1HKGA 2DGSA 3U9DA 1HBMB 4QOTA 3L9ZA 4ZP9A 3HT3A 1XMQF 1OSDA 2Z2MA 4HI2A 2FYXA 1HNVB 3ILOA 2ZITA 5B7WA 2ASDA 2D3O1 4CJ3A 1VRUA 4W90B 4C4WA 3VAGA 3T19A 5KOWA 5IZHA 2NRXA 4BE1A 2KKHA 5ETLA 3I4HX 3KJVB 2P9CA 3PXGa 5DG9A 2FVSA 4KHUA 2Z2ZA 4X62F 1UEUA 1RWNB 1LWEA 1OQ3A 1VRQC 3UO0A 4CLSA 4ED7A 3WXKA 3SJHA 4CI6A 3LZIA 2EFVA 4MAKA 7AT1B 3M8YA 3TWHA 4ZCMA 4O44A 4PQUA 2UYTA 3MPWA 4DU8A 4Z7CA 5LSLA 3CTRA 1WBBA 4FZXC 4C8NA 3AODA 4ZVUB 2QFJA 1X4GA 5DM7Q 3OYIA 4FWSA 3QJPA 4JI3K 3TNVA 2B56A 3CJ2A 4Q45A 2BDPA 1N4LA 3JQMA 2KXHA 4HDGA 3QBWA 1EHWA 1DTTA 3M2UA 4AT1B 2JVRA 2DGOA 1PSDA 2ZD1B 5IWAK 4UUWA 4TU8A 3GDQA 2DXEA 1ASVA 4ILRA 1IBCB 4L75A 3MUMP 4TY8B 4WKYA 4OYPA 1DTQA 1JL2A 1IBMJ 1SI9A 2HIYA 2XMVA 3M8QA 4L3KA 2XLIA 2UU9F 2WVBA 4CJEA 4OV1A 4Q5VA 1F5CA 3CD7A 4UQGA 3V2UC 2MPUA 3SMPA 3M9NB 4UY85 3LGHA 4IWVA 4ETXA 2HF4A 4ILLA 3Q7CA 5HP1B 4YR0A 4NLYA 4H5RA 3UR0A 1IR2A 3WIVA 3J7AN 3J7ZO 1KONA 4QWAA 2MLZA 3QT7A 2O8CB 4FYVB 5KT2A 3SSQA 3BBBA 2OH2A 1CQNA 4CJFA 2MQQA 4FLYA 3DXMA 2H51B 3A8EA 4JI1J 4AM7A 1LK5A 2R8GA 4BRHA 3W63A 4OPKA 2W4DA 5GAHI 3SV4A 2B7BB 2KZZA 3M3ZA 2CGLA 1N88A 1W7WA 4HDHA 5CZ1A 2CA9A 1OH8A 4FLTA 1OH5A 1KXPA 3P3DA 3UE5A 1U09A 3CCWA 4FCYA 5F0UA 2Z1GA 3G96A 4RWTA 2RH3A 2CGKA 4DF4A 2X3GA 2AJ0A 1YI2N 2K7KA 3C14B 4YMEA 4A46A 1R8BA 2J7KA 5D0GA 1CSJA 4DHVA 2KN4A 1DTTB 2VG6A 2HWHA 3DRRA 1ZTWA 3TU5A 5LM7E 1KAZA 1EWQA 1QE1B 1HKAA 2NPFA 2OO4A 2ZHBA 1WSJA 4WZQA 2CQ3A 3PEHA 3PYDA 1BU6O 1SJ1A 3MZIA 4NLOA 2A1RA 3P49B 3OXGA 2Z30B 4K0KK 2YKNA 1U2RA 2Z2LA 2PGCA 1IM6A 1F3FA 3ETOA 5EHHA 4CH1A 4JI2J 3RB0A 1RTZA 5M1OA 4XK8C 4GC7A 1D5AA 2XBPA 2JEIA 3C7NA 2BANA 2XYGB 3CCSN 4TSXA 4ZOSA 2WC9A 3H8YA 3CFPA 4DV1F 2HMIA 4URGA 1FCAA 4MIBA 4DZDA 2A6AA 4UUXA 2XGPA 4G1PA 2ZC3A 3SDEA 1WG5A 3GLJA 2K06A 2V34A 3US5A 4A5AA 2X6SA 3CYMA 5SZTA 1IKXA 1YG0A 4CM0A 1UA1A 4IJNA 3IAM9 4B3MK 3G10A 4N8NA 3AO5A 2J5AA 4AYBD 5ETKA 5EX3A 3P8BB 4OI2A 2FJDB 4XPEA 4H0PA 2MY8A 4CEBA 2H4YB 4NYOA 1OS5A 2BRLA 5JS1A 3OYKA 3OD2A 1SAZA 3AAQA 5LMNF 4DTPA 4CD1A 3IAS9 3TABA 3Q8PB 3L3CA 2JOQA 1C1BA 3HHKA 4F67A 2VG6B 3VQ8A 1S9EA 1S9GA 1K8KA 2G8KA 3DRRB 3RAMA 3QGGA 4IR9A 3L6QA 2AEJA 5L39A 2CVEA 3SBGA 1P27B 2VKRA 2FJVA 4JI3J 3P31A 2M5YA 4MKYA 2QE5A 4NLVA 2VG5A 1Z2ZA 3OR1A 3PO4A 1QQNA 5ELZA 3TTCA 3NGKA 3U1LA 3EPIA 5J2PB 4RNNA 1YHQN 2DPNA 1NZAA 2BX6A 1EQYA 5DLFA 1WF1A 4Y3CA 4OYZA 5IWAJ 2B43A 1GTHA 2O4GA 2GELA 4BR5A 3GJQB 3I5BA 1L3KA 4Y1CA 3BDEA 2VD3A 4B9QA 2HBZB 3ZTOA 4F3TA 1BI4A 3BKFA 5H1SQ 3VQ5A 4KTWA 4B3OA 1V3ZA 2V4JB 1YDLA 2MKKA 3EVOA 1N56A 1GLLO 2GQCA 3FEXB 4F4YA 4A2AA 3L7PA 2UUTA 1WC6A 1VMBA 5G4DA 3T1HK 4I64A 3FQKA 2L41A 1Z1ZA 3O6WA 4ED0A 5FJ4A 4MK7A 3ZTRA 2XMWA 2MQLA 4NLXA 2BKNA 3D2EA 4ZP6A 3BQ0A 4M63C 1KVJA 4B3SK 3MURP 1APSA 1DFDA 3ETMA 3KHYA 3OVNA 1C1CB 2Z2YB 4JP8A 1X9MA 4X64F 3HVTA 2M8DB 4WXOA 1IN0A 3DHWC 3UKUB 2GIRA 1R0BG 2AX1A 3MMCA 2DIVA 3DOKB 4DTJA 2H65B 2VJVA 4A8MP 1Y5LB 1VQ6N 1ZPVA 1IH7A 3J8AA 1UOCA 3V1RA 4LIRA 3VGKA 3I96A 4BQZA 2VOPA 4ZPAA 5GAHP 1JXLA 2N4CA 3KG4A 3O4WA 4X66F 1KQKA 2FD2A 4ES1A 4QR0A 3P4IA 5CD4H 2R8IA 4DPOA 3KTQA 3NRBA