1TL1A

Crystal structure of hiv-1 reverse transcriptase in complex with gw451211
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 146
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tl1A05
5JXSA 4CJWA 2W8KA 1TV6A 3LAMA 1RDAA 2XGPA 4E3SA 1IO2A 3CWJA 4ZP6A 5KFFA 1K1QA 4EO6A 3TARA 1VSKA 1IKWA 4ID1A 1N6QB 4M3ZA 1MU2A 4CJFA 3KLIA 4KB1A 1S6QA 1WSIA 4ECQA 3TAEA 1JXBA 2XY6A 3HP9A 1HMVA 1R0AB 2G8VA 1TVRB 1TP7A 3I0RA 4F3OA 4RZRA 3L2VA 1IKYB 5L1JA 3LWMA 3AVBA 2AU0A 4CK3A 3E51A 4NLYA 4TY8B 4DQPA 2KZZA 4KV8A 1LV5A 3AVMA 3QETA 4J9KA 4KHWA 2VA2A 2JEJA 4FJJA 4IR1A 2JEIA 4DLGA 1RCHA 1JLCA 3LP2A 2XY8A 4HUFA 4N56A 1Y97A 4CFDA 4FXDA 2RF2B 2OPPA 4Y2CA 2VG6B 4J9OA 4R8UB 1XI1A 4CJVA 4WZQA 4WFZA 4N47A 4AHRA 4LQ9A 2HMIA 5DMRA 3QNNA 1YVUA 4K4YA 4NLOA 3VQDA 1TVRA 4ECXA 4OL8A 4CJSA 3L2RA 3HT3A 3EPGA 3Q8QB 3BDPA 4J9LA 4JLHA 3K5MA 3S9HA 5KFNA 1T03B 4KI4A 1VRTA 3DM2B 3KK2A 2CKWA 4DTOA 2OYQA 4DL3A 1GOBA 4NCAA 1TKZA 3VA3A 3HXMA 4B9SA 1KLNA 1QAIA 1U45A 1IKVB 4GC6A 1YTUA 2E6LA 3TAMA 4ECWA 1VSEA 1JLFA 1T94A 3KK2B 4IH6A 1LW0A 4EYIB 3LP1B 2LSNA 4NLWA 1JX4A 3ZSYA 3T5KA 1Z25A 2QKKA 4Z4FA 3U3GA 3G6XA 4B08A 4B3OA 4DSLA 5C24B 4YR0A 5DQGA 1RDRA 4KB0A 1NOZA 4JV2A 2A1RA 3HVTA 1RTIB 2OPSB 3LAKA 4DL6A 2ASJA 5KFAA 3NF7A 1TAQA 3M8SA 1EP4B 3DMJA 3CFPA 4IG3B 1T8EA 3NBPA 3PR5B 4HYKA 4FZYA 3M8PA 3DYAB 3L2QA 4J9NA 4YFUA 5F8JA 3V9ZA 2R8KA 4DU4A 3NL0A 4G1QA 4ZHRA 4TSXA 2YNHB 1W25A 1HPZA 4YQWA 4ZP9A 2OH2A 4CF8A 1LAVA 1TKTA 3KTQA 5F8HA 1VSFA 2HNDA 3H59A 4BWMA 4IH7A 1UAXA 4E0DA 1LAWA 4CEDA 5C24A 1S48A 2D0AA 4TXSA 3RB0A 2D5RA 4I7FB 3I5CA 5C42A 3C95A 1RT3B 1RDBA 4WE1A 1T05B 1KVAA 3EZUA 4I9LA 1TL1A 1CLQA 3V1QA 3L3UA 3U3YA 3LP3A 2ZD1B 3OSNA 3AO3A 5KFWA 4ZPCA 2W8LA 4C8MA 1K6YA 2IBKA 4RW9B 4R5PB 2G8KA 3B6OA 1FKOB 1SL2A 4TYBA 1S1XB 4DSFA 2WK4A 2B5JB 3AVNA 4ZHRB 3OYEA 5FDLB 1S49A 1D5AA 2GC8A 3SFGA 3GILA 4OPJA 3FFIB 1N48A 5KRTA 2O5DA 3NH2A 1ZTTA 1A5XA 1GOCA 4CERA 5DQHA 4B9VA 1HQUB 2C2RA 4K8ZA 3M8RA 4E7KA 3VQEA 4FJ8A 1C6VA 1J9AA 2OPPB 4FLTA 4NYZA 5HROA 1D8YA 1IKXB 1Q8IA 4RW6B 4XIUA 3OYNA 3NGYA 1J5OB 1BQMA 2AWZA 4ECUA 3MEEB 2ITGA 4O5BA 4JUZA 4CIGA 3EYZA 4G3IA 1DTTB 3DRPB 4MH8A 4H4OB 4FLWA 4O44B 1SUQB 1G15A 4CEEA 5T14A 1C2PA 1RDDA 4IRKA 3ASMA 3DRSA 5KG7A 2X6NA 2QV6A 3LPUA 3I5BA 3V6HA 2WOMB 4B9NA 4KBIA 4FK2A 4PWDB 1I39A 1VRTB 3DM2A 4ED2A 3NH1A 3CYMA 4URSA 2KFNA 5CY4A 4UQGA 2AGOA 2BQ3A 4EBEA 4BWJA 1TL3A 2GBZA 4M3XA 3ZCMA 1TV6B 4F4YA 5DG7A 3TAQA 4FJMA 3AVLA 3L2UA 1VSHA 4CJ3A 2ZKUA 1RYSA 4E1MA 3NBPB 4F2SA 3V9UA 1F21A 2D41A 5D3GA 4KFBB 1KFDA 2GIRA 3KK1A 1KVBA 1XR7A 4Y34A 3ICLA 3NF6A 2HHUA 4BDPA 5KFZA 2IA6A 4ZPBA 4CEOA 4DF8A 1LWCB 2XO7A 3SPZA 2W9BB 2R2TA 4CHPA 4CECA 2WTFA 4KAIA 3SUOA 4TY8A 4W5TA 1RTIA 2OPSA 2WOMA 2F8SA 1KVCA 4IFYA 3MECA 4Y1DA 1IH7A 4N41A 4CJQA 3PO5A 4K4TA 1RT1B 3KK1B 3CG7A 4M3TA 5KFPA 1CZ9A 5KFVA 3ZSRA 4GMJB 1K1SA 1RT4A 4IH5A 3SQ0A 1S1VB 3QLHA 1KLMB 4KV8B 1RT5A 3NDKA 4NLUA 2XHBA 1S97A 4EO8A 4N5SA 3KLGB 1N56A 2X78A 4MQ3A 4OGEA 4YR2A 1WSGA 4CE9A 4M94A 1JLCB 3V6KA 3DOLA 3IG1B 4OJRA 1LW2A 1S0NA 3DRRB 2HNDB 1LWCA 2XI3A 4Q45A 3DI6B 3CDEA 2YKNB 2DTUA 3PW4A 4K50A 1T3NA 4M45A 1T03A 3AVGA 3D0PA 2EC0A 1TKXB 4DG1A 4IFYB 1RBTA 5C25A 4Y2AA 3B6PA 4AH9A 3G6YA 4FW1A 1JLQA 4RUAA 4CJ5A 3LZIA 3QEPA 1C0UB 4IDKA 3MEDA 1XHZA 1WSEA 3NF9A 2YHAA 4DTRA 3TR8A 3SI6A 4K4VA 2R7YA 2R2UA 3CDWA 4W5QA 4B9MA 1OS5A 2B43A 1WSFA 3TAMB 1XWLA 2E9RX 4CJ4A 5HP1A 2W42A 1ZBIA 2V0NA 4KHMA 4FLVA 3UDLA 1U04A 4KHSA 3PW2A 1RBSA 5KFCA 1EETA 4RW6A 3AA4A 3DRRA 4ED1A 2Y1JA 1S5JA 3M9MB 4B9UA 4QWEA 2XGQA 2IC3A 4FJXA 3HKWA 4Q5VA 3OJSA 4QWDA 4DG1B 4OLBA 3SUPA 4F4ZA 2PYJA 3V81B 1S6PB 1C1AA 4O44A 4C8NA 4U6PA 3MXMA 3D28A 4MKAA 4QWAA 3QIPA 1VSIA 1WAJA 5KFQA 4ZMMA 3EZ5A 4FS2A 2YHBA 4KAZA 1HJRA 4CJPA 5L1LA 4FW2A 3IGNA 5KT5A 3L8BA 5DLFA 3O4QA 5T7BA 2RN2A 5KFIA 1NKEA 1BQNB 2R2SA 4IBNA 3SQ2A 2OA8A 4FYDA 1RTDB 3PJWA 1TKTB 5CZ2A 4FJ5A 1BI4A 3K57A 4DTMA 3VQBA 4ECZA 4WFXA 4O55A 4WXOA 4CGIA 1NK9A 5KFMA 4K4SA 3RAXA 4BDZA 4CK1A 4IG0B 3QZ8A 3D45A 4HKQA 4M3UA 3RB4A 4FK0A 1S1TB 4ELTA 4WZMA 1S1WA 4NLSA 4KO0B 2PYLA 2J6TA 4GW6A 3SYZA 4KHNA 3V6JA 3LPTA 1RT3A 3SI8A 2VA3A 4NCGA 2G8UA 4J2AA 2ATQA 2YNGA 2EHGA 3BR9A 1BISA 2G8IA 3HP6A 4I2PA 3OYKA 4FM0A 4HUGA 3A2FA 4J2DA 3DOLB 1QHTA 3G86A 4ZTJA 3PVXA 2ILYA 3LZJA 4URGA 1ZBFA 1RDCA 1S1UA 1CXUA 3ZT1A 5CYMB 5KFYA 3GIJA 3KLEB 4CEFA 3KLIB 3KHLA 3C6TB 4CJRA 3VQ7A 2DY4A 2CJQA 4NLTA 3BJYA 3ZSZA 4DQSA 4GC7A 3M8PB 2Y1IA 3PHEA 2V9WA 3K2PA 3UPFA 3BGRB 2Z1HA 5KG6A 3IRXA 4Z4IA 2HVIA 1ZBHA 2HW3A 1RTJB 1W9HA 2P5GA 5HRNA 3RMDA 3DLKB 4KI6A 2XY5A 3CJ4A 3PX0A 1EKEA 3TAPA 4E89A 4DFKA 3ZSQA 3NAEA 5L9XA 3PY8A 4Q8FA 3PR4A 1S0OA 1UWBB 3NAIA 1X9SA 3OS2A 4NLGA 4DQQA 5DG8A 3IS9A 2RDIA 1JLEB 3KLFA 1WNEA 3TABA 2FVQA 4WFYA 4I7FA 2NUBA 1RTHA 3NE6A 4RW9A 1B92A 2FC0A 3QNOA 1C1BB 1HQEB 4M3YA 5F9NA 2E6MA 4F4XA 4IQXA 1TKZB 4DU3A 2YNFA 4ED7A 3ISND 2FLPA 1L5UA 4RW4A 3IAYA 2AGPA 3MECB 3PV8A 4CFBA 3AVFA 4CJTA 2ETJA 4J2BA 4PUOA 4O3OA 3SV3A 1RT7A 4MFBB 2BR0A 4FBTA 5FDLA 2DPIA 3UIQA 1I3AA 4NLDA 2FLNA 3C6UB 1JLBA 3AA2A 3NH0A 1Q9XA 5KFEA 2B6AA 1TKDA 3T1AA 5KT4A 3DLBA 4HCCA 4W5RA 1C1CB 2AX0A 4NCBA 4DF4A 4NZ0A 2FBXA 5F8LA 4E19A 3IG1A 3LANA 3F9KA 3DLRA 3QEIA 4RU9A 4ZP8A 1B9DA 2O4IA 4HHTA 5KGXA 3DOKA 1BGXT 1WSHA 4OKEA 1X1PA 3PUFA 2FVRA 2IGIA 4WYLA 1S9GA 4RNOA 5KFKA 4TN2A 4IKFA 3PW0A 2C2EA 4CF1A 2ZQBA 3AVCA 1LW2B 4K8XA 4C8OA 1A5VA 4O4RA 2XCPA 3SZ2A 5EDWA 1D0EA 3OYJA 3SJJA 2KFZA 1NJWA 3C6UA 3VA0A 1JXEA 3TI0A 2HNZA 4IRCA 5I3UA 5CYQA 4NLVA 4KFBA 1EX4A 5KG5A 1JLQB 3OS0A 4EBCA 2XI2A 4QAGA 2HNYB 3M8QB 3CJ0A 3O4NA 4CJKA 4ELUA 1Z26A 4K4UA 1LWEB 4NLXA 4EZ6A 3P5JA 4CFCA 5L1KA 3P1GA 1BCOA 3KHHA 1NHUA 1S9EA 4JRQA 1SL0A 4B8CA 4NLQA 1T7PA 2R8GA 4YNQA 5CYQB 3BSNA 3O3HA 2RDJA 1ZBLA 2V4QA 5HBMA 3HSTB 2F8TA 3F73A 3NGIA 3M8QA 2JEFA 1ASUA 4DEZA 3PJXA 1GX5A 4DL7A 4QW9A 4RG8A 1JKHA 2JEGA 4OKKA 2IC3B 3RRGA 2R8JA 5J1EB 5KG0A 4J9SA 2P5OA 1HYSB 3KIOA 3ZT0A 2GUIA 1GOAA 4H4MB 3L2WA 4O3RA 3DDKA 3KD1E 4TYAA 1ASVA 4DSJA 3OHBA 4MIBA 2G8FA 4O0JA 1KLMA 1RA7A 4HCBA 2IAJA 3NKYA 1D1UA 1YTAA 3SNNA 2XWYA 4CJUA 3KHRA 1SH0A 4BE1A 1MU2B 3V6DB 2YKMA 4M41A 1HYSA 4Z0UA 1RILA 1BHLA 1U49A 4H4MA 3V9WA 3VQ9A 1R0AA 4DL4A 4FCYA 1BI4B 2OPQB 5KFXA 1XC9A 2HHXA 2E4LA 1JXLA 1VSDA 4NCGB 2IS3A 2BANB 2XCAA 3BQ0A 4DMNA 3SFUA 4QWBA 1NK6A 1A5WA 4DQIA 2X6SA 4B8AB 1EP4A 1SV5B 2PZSA 2AQ4A 3VN5A 4NRTA 3LP2B 2FBTA 4LD0A 5KT7A 3BSCA 4RW4B 3MFIA 5JS1A 4DL2A 2P1JA 4ED8A 3MR3A 3VQPA 3E01A 3PX4A 2ILZA 3VQQA 1QSSA 2KZMA 3G6VA 3NGDA 4Q8EA 3OL9A 3ZT4A 4I2PB 3AVJA 1ASWA 2D0CA 1REVB 5FROA 1CSJA 4OPKA 1JLBB 5DG9A 4M3RA 1DLOA 3JYTA 4EEYA 1S1VA 3QLHB 2FJXA 3I8DA 1KCFA 3QIDA 3K5NA 3K59A 4WE1B 4FS1A 5F8MA 4DL5A 4I2QA 3NHGA 4ICLB 4ZVFA 1TL1B 3KMQA 3KKSA 3FDSA 4N76A 3OYCA 2HHWA 4ECRA 4ECVA 3H5YA 5KG1A 3UR0A 3HPOA 4RW7B 4ZPDA 3H40A 1CXQA 3V1OA 2KQ2A 1IM4A 3TVKA 1J5OA 1U48A 4J9QA 3MXIA 4FJHA 5SWMA 3QYYA 5HROB 3TANA 5SZTA 1BQNA 1DTQA 2OPRB 1S4FA 3FFIA 3OYIA 3SCXA 4DTJA 5KFLA 4IFVA 3CO9A 1S1WB 1U47A 3ZT2A 3OYGA 3HPGA 1D9DA 4CHOA 1WN7A 1N5YB 3OS1A 1VRUA 2UVRA 3TAGA 1IKXA 5C25B 1FK9A 1KHVA 3MXJA 1S10A 2VWJA 4NYNA 5KI6A 3KK3B 4ED0A 1XHXA 3RBDA 3RRHA 4E7HA 1J54A 1QQCA 2FJWA 3ZSOA 2G8WA 1WNSA 1JLGB 4FK4A 1BL3A 2YNGB 3BSAA 4KHRA 4FBUA 1C1BA 1NK0A 3LP0B 1QUVA 4K4XA 4FJ9A 2ATLA 1FK9B 3P83D 3KNAA 1HPZB 4AHVA 3HM9A 3JSMA 1RBRA 1XR5A 3RB6A 4CFAA 3M9OB 4OKJA 2BQRA 1EETB 3I5AA 1U4BA 4I9QA 2P51A 2HHQA 5L1IA 4Z4CA 4XPCA 1C0TA 1C1CA 2JC0A 5HLFB 4RNHA 5KT6A 2GV9A 1JIHA 2ASLA 1MMLA 2RKIA 4ZVHA 3KHGA 4CGJA 4KTWA 1HYVA 4CEQA 3V6DA 3LP0A 1RT1A 2QE5A 2XRIA 4MK7A 4KHQA 3QO9B 2UVWA 3PW7A 1BIZA 5J2PA 1RTDA 3GQCA 1N4LA 3DLGB 1RBUA 4FM2A 3V1RA 5F8IA 4B3OB 3MR5A 5KG4A 2W9CB 4B9LA 5J2NB 3KLHA 1KHWA 4KHYA 2AGQA 3GIIA 3BREA 1ITGA 3H5SA 4CESA 5J2MA 1JLFB 2Z1IA 3IRXB 2E9ZA 4LH5A 3N6LA 3CIZA 3BQ1A 3QZ7A 2YNIA 4Q43A 1NK7A 1DLOB 3T5HA 1X9WA 4ED3A 1UA0A 3N6NA 1NK8A 2HHSA 1LWFA 2JLEA 3CFRA 3HVTB 2ALZA 1HNIB 2IJNA 1IKWB 3ISNC 2OZMA 4FJIA 1RYRA 3AA5X 1NK5A 3WNGA 4OVLA 4ICLA 4R0EA 1RT4B 4LSLB 2I5JB 2YNHA 4DU1A 1RNHA 4LH4A 3IS9B 5KFOA 3CFOA 1SKSA 4WXWA 3KMSA 3RTVA 3FQLA 1C0MA 3QINA 3NGZA 1IKYA 2V4RA 2JC1A 3RMBA 5F8NA 4HVJA 2DPJA 5EUHA 2HNYA 1LWFB 3VQ4A 3ZSVA 1SKWA 1TGOA 4RNFA 4G1QB 5FRMA 3C94A 1L3TA 1WAFA 1RAJA 3RR8A 2HMIB 3H5XA 3MEEA 4FJNA 3OYMA 4CEZA 2IM1A 2ZE2B 4IR9A 2FBVA 5KFGA 2HHTA 2F8EX 4AILC 4PUOB 3QEXA 1C0UA 4ELVA 1RT7B 3QERA 3OLAA 2GIQA 4XO0A 4CIFA 1QS4A 1DTQB 2OPRA 4ID5A 2PY5A 1YVFA 4QCLA 1NK4A 2C2DA 2ASDA 2XC9A 4DSKA 2RF2A 1EXQA 4CGGA 5HRPA 1SL1A 4DS4A 4CGFA 4KHUA 1FKOA 1RT6B 5KG2A 2B5JA 1QSLA 4PQUB 2BRLA 3NCIA 3LP1A 3Q8RB 3KK3A 4CGDA 1FKPB 2BANA 4FJGA 2QKBA 2HWIA 3HJFA 4CGHA 3QIOA 4CEBA 1S6PA 1DTTA 1RTHB 3ZSWA 5KGWA 3OYHA 3UQSA 3CJ5A 3LALA 4YP3A 2WCXA 4FJKA 4PQUA 4DLEA 1S1TA 3SUNA 1L3UA 2YNFB 1ZETA 1JLGA 2IM0A 3RBEA 3VQ8A 2WHOA 3HVAA 4IG0A 5HLFA 2IDOA 1QTMA 3AVIA 2DFHA 1S6QB 1ZBUA 4ECSA 3PW5A 3O3GA 4KSEB 4LSNA 4CF0A 2WRMA 4QWCA 3AVKA 4OLAA 3IGVA 4AHTA 4RUCA 4JV1A 4DTNA 1C0TB 4IG3A 3AVHA 3L3VA 3VQAA 5KFUA 2RKIB 3MR2A 3T3FA 2B6AB 1TKXA 3GYNA 4Y1CA 4BE2A 1B9FA 3DLEA 4FZZA 2W9AA 1ZTWA 1KFSA 4W5OA 1KRPA 3DMJB 3S3MA 5CYMA 4HTUA 5KFJA 4KB7A 3BSOA 3I0SA 3DI6A 4BDYA 3C6TA 3LWLA 4F50A 4TQSA 3OVNA 3HO1A 5J2QB 2IJFA 2RPIA 3WNEA 3V4IA 4QPXA 5EWFA 3T19A 3DLEB 1HNIA 1QSYA 2FVCA 1RBVA 1JL2A 3RWUA 4W5NA 4IFVB 5C5JA 1TK0A 3RR7A 4RW8A 2VG7A 3QGHA 3TAFA 5I42A 5FRNA 4QW8A 4Q0BA 4GVMA 4XPEA 3PX6A 2I1RA 4DSIA 3V81A 2UUTA 4QOZB 4KREA 3OL6A 3OHAA 4EYHB 3VQSA 1SV5A 4K4ZA 2QXFA 5E41A 3THVA 2YV0X 2OPQA 4F8RA 1NJYA 3K5LA 2YKNA 3CQ8A 3U6FA 2ZE2A 3V4IB 5DQIA 4O3PA 1HRHA 4M95A 3EPIA 2FVSA 4LY7A 4NYFA 2BE2A 3QIPB 2VWKA 4FM1A 1HMVB 4RW8B 4H54A 3KLVA 1NHVA 2C22A 4DTUA 4MKBA 3GV5B 4O3QA 4PWDA 1JLAB 3LDSA 3T5LA 3PZPA 2JGUA 1NNDA 3JSMB 4NLRA 3NMAA 5KRSA 3H4DA 3I0RB 1UA1A 4CJEA 4J9RA 3CM6A 3K58A 1CZBA 4O4GB 3KLHB 5J2NA 5HRRA 3DRPA 2IAJB 3FSIA 2BQUA 3KKRA 2HHVA 3O3FA 3CVKA 5HP1B 3VQCA 2W7OA 1D9FA 3QEWA 4B9TA 2VG6A 3AVAA 4R8UA 3Q8PB 4DFJA 5KFDA 3HPHA 2O4GA 4IOBA 3KJVB 2W9BA 3DYAA 5HRSA 4J9MA 5K14B 4ZVGA 3H4BA 3OYFA 4F4KA 1XR6A 3MF5A 4FJ7A 2E9TA 1IG9A 3TWHA 2XY7A 4CF2A 3G10A 3WNHA 1SH2A 3ITHA 2W7PA 1J53A 4FLXA 2DFEA 2HB5A 1S9GB 2QK9A 4H8KA 3QGGA 4CK2A 3S3OA 1S1UB 3NF8A 4KE5A 2X74A 1VRUB 4Z4HA 3SPYA 4RNMA 5I3UB 4DTSA 5KFBA 4NRUA 1RA6A 4CHZA 3M9NB 3DOKB 3FQKA 3ALYA 4U7CA 4KKOB 4MK9A 3HHKA 1L3SA 2AJQA 3E01B 4O3SA 3MTKA 4EP5A 2FJVA 4TQRA 3OL8A 2C28A 4IKAA 1RTJA 4ZP7A 4CHQA 4TLRA 4C8KA 4AHCA 1BIUA 1GX6A 3RAQA 3CDUA 1BQMB 4CCHA 4Y3CA 5J2QA 3ITHB 5KT3A 1WSJA 5KFSA 5J2PB 3AO1A 3DLGA 4PY5A 3HL8A 2AX1A 1TQLA 4FLZA 1KTQA 2HVHA 1UOCA 3V9XA 2A1SA 4J9PA 2FBYA 4Q0BB 3CJ3A 2WONB 4C8LA 1HARA 5DGBA 2FVPA 4KKOA 4EP4A 5J1EA 1Z4UA 2D0BA 2VG5B 4KRFA 5F8GA 3SQ1A 1TL3B 5C42B 4Z4EA 1RT6A 4DFPA 2EX3A 1HQEA 3N6MA 1VSMA 2YKMB 3KLEA 3DRSB 4LSLA 2I5JA 3GV7B 5CZ1A 4F3TA 3MR6A 3DLHA 1VSLA 1HNVA 4JV0A 3DLKA 2HAIA 5KT2A 3PO4A 4DWIA 2IM3A 3NFAA 4E7LA 3HYFA 4DFMA 4WYWA 4KPYA 1N5YA 2D7SA 5DK5A 1JLAA 4ECYA 2DFFA 3BGRA 2Z1JA 1VSJA 4X2BA 4L8RB 1UWBA 3SUQA 4CF9A 1SH3A 3QEVA 4JRPA 2UUWA 1NJZA 4CHYA 2UVUA 1NKBA 4DTXA 3CM5A 2ZD1A 1FXXA 2WONA 2FLLA 3AO2A 3FRZA 1HQUA 5K14A 3OL7A 3AA3A 4E7IA 4LSNB 3HVRA 3S3NA 3OY9A 1W0HA 3IN5A 3AV9A 3H08A 4ID5B 3SQ4A 4EZ9A 3QO9A 1TK8A 1TAUA 3AO4A 3MFHA 1QE1B 1TK5A 3HVWA 4FVMA 2Q3SA 4NLPA 4F4WA 2IOCA 1L3VA 4AHSA 1LWEA 3OSPA 4PA1A 1X9MA 3I0SB 4CEAA 2VG7B 3MEGB 1RT2B 5EU7A 3GIMA 4J2EA 1RT5B 3RMAA 5DLGA 3HK2A 4E7JA 3H98A 3GV8B 2HNZB 1N6QA 3BQ2A 1JL1A 4KO0A 4I2QB 3OYBA 4M3WA 4DTPA 2WB4A 3T5JA 4BE0A 1SUQA 2BRKA 3EY1A 1REVA 1S0MA 1T05A 4M42A 4URQU 3ULDA 4FLUA 3JYTB 3MEGA 4JS5A 4ECTA 3K5OA 1NKCA 1S9EB 1Q9YA 1YT3A 5KFHA 3RB3A 4BACA 5KFRA 2R8IA 4OGCA 2OZSA 4DSEA 2IMWP 3CJ2A 4R5PA 3RMCA 3WNFA 2D3UA 2HWHA 4RW7A 4LQ3A 3QESA 2BE2B 4ZVEA 5EWEA 1JKHB 2J6SA 3NAHA 1RT2A 2BDPA 2IM2A 4ED6A 4K4WA 3TQ1A 3VQ5A 2BGGA 3ZSXA 5D3GB 3G0ZA 4TY9A 4MIAA 1I6JA 2R2RA 2J6UA 1NOYA 2UVVA 3AO5A 1NJXA 3KD5E 1S1XA 3KOAA 3H5UA 4DQRA 5EWGA 4DS5A 3D5MA 4O4GA 3MAQA 4ZTFA 1HNVB 4AHUA 5JS2A 1O1WA 3V9SA 4KTQA 3KLGA 4FLYA 1LW0B 4H4OA 1SKRA 4YR3A 3OYAA 2KW4A 1ZYQA 3OJUA 4MK8A 1IKVA 3QGIA 5F9LA 5JUMA 4KTZA 4O3NA 4O0IA 2VG5A 4RNNA 3SV4A 5I42B 4HUEA 1JLEA 3KLFB 1FKPA 2D3ZA 4Q44A 4E1NA 2KTQA 2Z1GA 4F2RA 5KTQA 4FZXC 2G8HA 4CJLA 4CIEA 1KSPA 2B4JA 4JS4A 3ZT3A 2F96A 3OYDA 4Z4GA 1HYZA 3GIKA 1VK0A 1BCMA 5HBMB 4IRDA 2R8HA 4IDKB 1U09A 3VQ6A 5KFTA 1S9FA 5J2MB 4MFBA 5DGAA 1WLJA 4YMEA 3H2LA 3KJVA 4FJLA 3Q8SB 4CHNA 2YNIB 2W9CA 3OYLA 3OLBA 1QAJA 4EBDA 1QE1A 4ZPAA 5KG3A 3MEDB
chains in the Genus database with same CATH superfamily
1D4XA 1IV0A 2NXJA 5AQXA 3LAMA 2I7PA 4QR2A 4OYZA 4E3SA 3CWJA 4QS9A 3FMWA 1DJ0A 1E4FT 1K1QA 1U1MA 3EZWA 2KVIA 1Q53A 2VJVA 4JI0J 4QOTA 5RUBA 3QRPA 4ECQA 5F3TA 4YHHK 1JXBA 4HHHA 1FJGJ 2G8VA 1TVRB 3I0RA 2MKJA 4RZRA 3G82A 1KKHA 4LF4F 3AVBA 4FWLA 3T1YK 2OTLN 4DQPA 3UD5A 4KV8A 3D0HE 2YKOA 2V9KA 1PILA 2JEJA 4FJJA 4P6QA 1IR1A 3BPDA 2JEIA 4CJ7A 4C3KA 2ACYA 4HDHA 2QTDA 3LP2A 2N3LA 3UB5A 3A13A 5F1XA 3OQ2A 3MM8A 3GFHA 4N56A 2M2BA 4KRWA 1Z6RA 3VWSA 2XMAA 4FXDA 1A7GE 4LT6A 2VG6B 4J9OA 4L74A 4DX6A 5ETTA 4CJVA 4WFZA 2CGLA 2RH3A 2HMIA 4LQ9A 3TSPA 5GAHP 2CPFA 3D7EO 1X5TA 4JI2K 4ILHA 3L2RA 3HT3A 3PXGa 3K5MA 1EKRA 4FVUA 1T03B 1I3OB 2OFHX 4PXEA 4DR2F 1NGHA 3EGNA 3JS9A 2E1PA 3HXMA 3IUCA 4WFNL 1RU2A 1IKVB 1WDDA 1YTUA 4M5IA 2NQPA 4JOUA 2E6LA 3MX2A 2RU9A 2M8DB 3TAMA 4DV2K 1K73T 1VSEA 1JLFA 5HL7Q 4EYIB 5E0OA 3LP1B 4NLWA 1JX4A 3R2CJ 2QKKA 4UOHA 2GELA 3H1QA 3G6XA 5EOYA 2ITMA 4L73A 1NSQA 4FWMA 4KB0A 1NOZA 1FEHA 3W2VB 2OPSB 4CYUA 2AEFA 1CJVB 2J0QD 3LAKA 2DXEA 4WKYA 3MPDA 3VAJA 1TUUA 1TAQA 4B9QA 3ZTQA 4BCAA 2LXUA 1MN7A 4OHXA 2DNNA 3RVCA 3V9ZA 3THPA 4OYPA 3MDQA 1B7FA 3NL0A 5AQZA 4TSXA 2HOEA 2V5HG 2HRUA 2YNHB 4E8UA 2OH2A 1LAVA 3A8YA 4CNYA 2DXFA 1FDNA 4RL1A 1UAXA 4E0DA 1ATNA 2YPYA 3S8SA 1YZ6A 4OZ2A 1WI8A 2QA4G 3CCES 2VIHA 2P9PA 1ZPVA 2G13A 2MQPA 1G4CA 3D1HA 3OSNA 3AO3A 5ITHA 3NEKA 2W8LA 4C8MA 3ENBA 1K6YA 3LM2A 3J8AA 2LKZA 2MZQA 2A2CA 3R5BA 1FKOB 4FP9A 4X84A 4ZPWR 1Y0HA 2CPDA 5DM7Q 5ETVA 3CCJS 5FDLB 2IVNA 2YH0A 2VBZA 3BR8A 3FBFA 5KRTA 2O5DA 4JI6F 4HTIA 1A5XA 1GOCA 2C3MA 3OD2A 1RE1B 1PJ6A 2QZ8A 4HEA9 1U8WA 2OMLA 3CB4A 4E7KA 3VQEA 4KGXB 5M1QA 2OPPB 2ZNZA 4H5NA 4RW6B 4XIUA 3OYNA 2VGNA 2BVZA 4LC9B 2G2YA 1KC8T 2AWZA 3ZX2A 1Q8LA 4QU6A 3U27A 3DRPB 3GU0A 4CEEA 1FRXA 2DCLA 5T14A 3BUZB 4ZN1A 2C2ZB 1C2PA 1RHKB 1R8BA 3ASMA 4NB4A 4WFBQ 1PJ7A 4B9NA 1U6ZA 1TL7B 5A8RB 1FJ7A 2EK1A 5CY4A 2W2PP 4W4MA 2AGOA 4EBEA 2V68A 3MX5A 4A4JA 4PG7A 3WZ0A 4O5FA 3SSQA 4CJ3A 2ZKUA 4LF4K 1GLBG 2FUG9 3NBPB 4F2SA 5D3GA 4B3SF 1KFDA 3L4QA 2QWQA 1U24A 2Y0SD 3AXMA 3SQGA 4DV5F 3GBTA 3W8GA 5HQLA 4AQYK 3NF6A 5KFZA 5AZIA 1LWCB 2RD5C 2DK2A 2YWGA 3C16B 5D77A 3SUOA 1VQ7S 3THWB 1C4AA 4GVBA 4TY8A 3CC7S 2FTRA 2R9LA 4N41A 4L76A 4CJQA 4K4TA 1RT1B 1VAZA 4CM0A 3KK1B 2XEXA 4M3TA 4K25A 4YB6A 2ZBPA 2YWKA 1K1SA 5ETMA 3SQ0A 1IBKK 5MLCQ 4WJBA 3QLHA 2KM8C 5AQMA 1P1LA 5B0FA 4N5SA 1N56A 4M5JA 2X78A 4JD2A 1JLCB 4MT1A 3WXIA 3S01A 4P74A 2UUBF 2CQBA 2RB7A 1FTRA 4Q45A 1KVJA 4LR8A 3CI5A 2G2OA 5B0GA 1U1NA 4CO4A 4AH9A 4X4VA 4FW1A 3ISZA 2ZNYA 1ILYA 3LPEA 4DTRA 2E8AA 1JK9B 3TR8A 2WSEC 3MD1A 3CDWA 4W5QA 4B9MA 2KRRA 1WSFA 2FJEB 3VGMA 2B7CB 4B3RJ 4WK1A 5HP1A 2W42A 3MZIA 1UL3A 4CD3A 3ZEUA 4QU7A 2ZJQL 2BW7A 4KHMA 3AY9A 4F04B 4D3GA 3DN9A 1EIYB 1FRLA 2BW2A 2UXCF 2B51A 3IRWP 2ALYB 1SVDA 1H3DA 1U1LA 3GWCA 2WB1D 2UU9J 1S6PB 2M52A 3DXKB 5BR8J 2AJ4A 3MCNA 1HHTP 4B17A 3W2WB 1G7CB 3OVSA 4DV2F 4ID8A 4FS2A 2YHBA 2KL8A 3POTA 1Q95G 4FW2A 4JBCA 3OA9A 3L8BA 5KFIA 2R2SA 5AJ3J 4IBNA 3ELHA 4O23A 3ADAC 3PJWA 1WI6A 4FJ5A 4DCPB 5HJXA 4O55A 4WXOA 2X1GA 3BO3A 4CK1A 4ETXA 1CULA 1GLFO 1KD1T 1YXQA 5H9EJ 3RB4A 2GCFA 4ELTA 1K73O 3PSIA 1MLAA 2P9GA 1WC6A 3QRRA 4X4UA 1GMWA 1S77D 3HSDA 4Z2XA 1PSDA 3O1BA 2B4PA 4KHNA 3LPTA 1RT3A 3A5OC 2G8UA 1Y11A 4X62K 4C23A 2EHGA 4WFBL 4I1TA 4KC5A 2HAFA 1BISA 2HK3A 2G8IA 4I2PA 3CNQP 1HR0J 3A2FA 1FDBA 4J2DA 3DOLB 1QHTA 1ZM9A 4OI4A 4EHUA 3LZJA 1F9HA 2KJVA 1UEVA 1X4AA 1SS6A 2QFJA 4AXIA 5CYMB 1X0FA 3KLEB 4A47A 2J0WA 4M7XA 3KHLA 4CJRA 3CCEN 3IC1A 3VQ7A 4JK7A 2MB0B 2VOOA 4KGMA 4DQSA 3GG4A 3WEEA 4AL7A 3M8PB 1MA9B 3SJHA 3QFHA 1FRHA 3UPFA 1NDCA 3AJDA 2DGUA 4Q2LA 5E84A 2O67A 2XG8A 4Z4IA 2HBKA 1UWAA 2DNYA 1UCNA 1LQ9A 3CO0P 2C3YA 2UXDK 3M5RA 3UW1A 1N36J 3QBCA 3PX0A 1WHWA 3DOMA 3NAEA 5L9XA 4F3QA 4HWIA 3PY8A 3P38A 3HSGA 1UWBB 3AT1B 1ZA2B 2FGCA 4DQQA 3MN9A 2UP1A 1Q82O 5DG8A 1WKJA 1JLEB 4DV0F 3HZEA 3CIPA 1BE4A 3ETMA 3R3LA 3H8YA 1JCEA 2NUBA 4NEYA 4A8WA 4ZLNA 2X51A 3QNOA 2JSXA 2B9XA 4DN0A 5AQNA 2V8DA 3BDEA 5DDQC 4IQXA 1QDUB 4BG8A 2J76E 3FKBA 3ISND 4ED7A 3BBCA 4DPXA 4PKDB 3PV8A 2DR5A 4NXMJ 4PPZA 3IBCB 2HS4A 4PUOA 2ZUGA 1WTFA 2ZUAA 2R7XA 3CCWA 5FDLA 2DPIA 1P27B 2FLNA 3C6UB 1JLBA 3AA2A 4DR4K 3DLBA 2CDQA 5EXWA 1RADB 2ZH3A 4E98A 1HWKA 4L3NA 3JS6A 1C1CB 3W2VA 5F8LA 3F9KA 1B9DA 1ZA1B 2A0FB 2HBJA 2HG4A 5KGXA 3HTVA 2DGQA 2DNQA 1WSHA 1YBTA 3MPYA 2V94A 1S9GA 1TFWA 4RNOA 1KC8O 2WZ1A 3M8ZA 2PI4A 4DPTA 2MDAA 4FWPA 2Z57B 3NVKA 5LJVA 8AT1B 3GYGA 2XCPA 1SCJB 1D0EA 3OYJA 2YI1A 3SJJA 2GVZA 4GNIA 2MKSA 2HNZA 1REGX 5CYQA 4NLVA 5KG5A 5BREA 3CJ0A 3O4NA 3M05A 4NLXA 1ZBTA 2DHHA 1NGCA 3P5JA 4WP3A 4GRSA 4DXLA 1NHUA 1RP5A 4X64F 4BRGA 1UAWA 4U95A 1KWMA 4LSZB 2E88A 3BSNA 4OJGA 3AJ2A 1ZBLA 2F8TA 3F73A 1O13A 3M8QA 2JEFA 1RAHB 5HMWA 4MLHA 5CCLA 4RG8A 5AQHA 1JKHA 5D4OA 2IC3B 4NYPA 2O8DB 3H0PA 3CQXA 5KG0A 1HYSB 3ZT0A 5C10A 3QJJA 3KD1E 1JWWA 1U6FA 2RNEA 1VMBA 1MW7A 3GFYA 2GIFA 4GVEA 1T3OA 4O0JA 1RA7A 4HCBA 5C15A 1Q0NA 2R7RA 3E66A 3G8SA 4DUYK 2RMLA 3OXFA 1P1TA 4I6WA 1N52B 3BGFA 4X66J 1BHLA 1U49A 3P5BP 4F0KA 1V5VA 4YB5A 4FCYA 1BI4B 2OCEA 1PJ5A 5KFXA 1XC9A 1PYOB 3AD8C 1ZM4A 4IOAL 3AOCA 1JXLA 1NM1A 2XCAA 1FI4A 4DMNA 4PKIA 3IR7B 4K42A 3UWTA 2H5JB 4DQIA 2YJFA 4QYZK 4B8AB 3FVYA 2B7BB 2AQ4A 5LOQA 4NRTA 3I55S 4P73A 1TUVA 4BLGA 2ZFHA 4PRFA 2M3DA 1Y7PA 4MMOA 2RT3A 3NCRA 3AOBA 3PX4A 2ILZA 5H9FK 3VQQA 1QSSA 3G6VA 4WCEQ 4MLEA 4I6AA 4X4PA 2N7CA 1SC1B 1JLBB 5DG9A 5MAOA 3KVGA 1DLOA 3JYTA 1H7WA 4EEYA 4JP8A 1S1VA 4M5DA 3K5NA 2KXNB 3NVMA 5F8MA 4ICLB 3KMQA 4TU7A 1R0CB 4UUWA 4ECVA 2EXUA 3H5YA 3HPOA 3H40A 2DH9A 5JMNA 4WBFA 2U1AA 3D1OA 5GMEA 3GR0A 4TVAB 1I1GA 3VGLA 2Q1NA 1U48A 3BN4A 3MXIA 5C2FA 1YI2S 3RU0A 5HROB 2DEJA 3T1YJ 2OPRB 3A12A 3L7OA 3FFIA 2D3O1 3SCXA 2OTLS 1BD6A 2ZHOA 1WC3A 3WXJA 2B0GA 4OYWA 4FNHA 1D9DA 1WN7A 2MKYA 4LF9J 3OS1A 2UVRA 3HSZA 3TAGA 5AQLA 4GV3A 5GAGU 1KD1O 5KI6A 2EFOA 3KK3B 5CXTA 4ED0A 1HUXA 1W7AA 1J54A 2G8WA 3ZSOA 4ZIWA 3D1QA 4C7QA 1VCTA 1KVKA 3NNCA 4FK4A 2HGLA 4KHRA 1NK0A 4WIQA 1FK9B 2V8PA 3BBFA 3R6LB 2JWKA 3P83D 5M1FA 1IM6A 1HPZB 1FRIA 5BRFA 5CZXA 5B8HA 3RB6A 3U1MA 3I5AA 1VIOA 1YIJS 5L1IA 3T6JA 3L6QA 4N8OA 2RKIA 7FD1A 2YVSA 4FSVA 4IEIA 4HACA 1N34K 2ERRA 4MK7A 3LF0A 4KHQA 3N5FA 1RQ0A 3PW7A 1RTDA 1F5BA 3GQCA 2HFZA 2W9CB 4B9LA 3D6RA 5M1KA 1KHWA 1NB2A 5IQ6A 2AGQA 4GKJK 2NPIA 2CQIA 3ZTOA 2DR6A 2E9ZA 4GKJJ 1RWOB 2BUPA 4DV6F 2YNIA 2V2KA 2MQOA 5IT9O 4S0MA 1X9WA 4MIWA 1IBLF 2U2FA 1ZH5A 3PKMA 3N6NA 1NK8A 1X3NA 3CFRA 2JLEA 3HI0A 1HNIB 2IJNA 3GSIA 3UNGC 4R0EA 4L3QA 4NO7A 1UJ6A 4LH4A 4C11A 3KMSA 2AJ2A 3QQCD 2P9UA 5B7WA 1DGKN 2JC1A 4HVJA 4ZCLA 2DPJA 1BOTO 1LWFB 3HHNB 2GAHC 1YKWA 2KT5A 3VQ4A 2RE1A 4DZDA 4G1QB 2YPZA 3C94A 1YJVA 5IC4B 4P2MA 5D6GA 2OI2A 1FF2A 3MEEA 3CPEA 4FJNA 5E3QA 2VQFK 4M63A 2F8EX 4PUOB 2CJXB 3HT0A 5A76A 1RT7B 4ZCMA 4LJMA 5K8MA 1DTQB 1NCLA 2BJDA 2DNOA 2CYYA 1YVFA 2C2DA 3PIOL 4EU0A 2XMUA 1YZ7A 2M4MA 3D6TB 1DT9A 2QWNA 4FF1A 1A0OB 3BM7A 1U25A 2V2VA 3S7RA 4BC3A 3BH6B 1FKOA 5HMYA 2I9SA 4BRCA 2E44A 4Q2MA 3Q8RB 4OV6A 3E9OA 1FKPB 3G8QA 2FSNA 2CJ9A 2F9TA 2HVDA 2BANA 2D0PA 2P9SA 2YKAA 3QIOA 3MCMA 3D6MB 1DTTA 5KGWA 2KXFA 3OYHA 3LALA 2DYAA 4YP3A 2E5LJ 4ZIVA 3CCZA 4CLTA 3F2KA 4DLEA 3SUNA 3M32A 1FERA 1L3UA 2YNFB 1ZETA 2H4YB 2DNZA 3HVAA 4K0KF 4IG0A 2HBLA 2QC3A 3THYA 3AVIA 1HWIA 4LSNA 3IFRA 4AHTA 1NDKA 4YOXA 4JI3K 1SPBP 3Q89A 3R27A 1NLKL 4DTNA 2RQCA 1LNQA 4QR1A 2HFUA 4EI2A 4H0PA 3VAKA 2B6AB 1X4DA 4ITSA 2ZH6A 1FFWB 3DLEA 2RRBA 1ZTWA 2IRUA 3VEWA 2VASA 4OHVA 2V52B 1Q7YO 3RGIA 2DGOA 1X8DA 3ET6B 4OI2A 3DI6A 2ZJQQ 4F50A 3OVNA 3HO1A 5J2QB 2IJFA 4YOVA 5EWFA 5F2RA 5DS7A 3T19A 2ZH4A 2PMWA 1RBVA 4JI5J 2QWMA 3RR7A 2J0SD 1CS4B 3QGHA 2QLXA 3TAFA 2Q36A 3SCJE 3CC2N 3NNAA 4Q0BA 2DNLA 4XPEA 3M6UA 3PX6A 1N34J 4PR6A 3ZNJ1 1SJ4P 2HBZB 3QBXA 4UOGA 1CBKA 1T11A 1Y3JA 1G99A 3VQSA 4K4ZA 2QXFA 4X65F 1VR6A 3C15B 5SUHA 4CZLA 4QYRA 3K5LA 4Z7CA 4UUXA 2AD9A 4JYAJ 1JJ2M 5DQIA 4O3PA 3U1LA 4K59A 4BR5A 1F1BB 2E1RA 1RWPB 1MROB 1DEJA 3EPIA 5D0RA 3O6WA 3LDPA 5U47A 3H46O 2VWKA 2HQ3A 2FLOA 1NHVA 5IWAJ 4DTUA 3GV5B 3N9UC 4PWDA 1GTEA 3E9PA 2K3KA 1HW9A 2P9NA 2EK6A 2JGUA 3CJTA 4NLRA 4DX5A 1H74A 2GMHA 5HN0A 4FPIA 4BRLA 2IAJB 4L6V3 2HHVA 5K8PA 2DRAA 3QMLA 3O3FA 1CQMA 5HP1B 2UXBF 3VQCA 2W7OA 1D9FA 3ZEUB 3IWLA 2HQIA 3Q8PB 4DFJA 3KHYA 3OXGA 2NZTA 1O51A 2O4GA 1VK3A 2W9BA 1NH7A 4J9MA 2FJDB 3QT7A 4USWA 1OH8A 4KH0B 4ZVGA 1U1KA 2P9KA 4MO5A 5AQJA 4F4KA 3OYFA 2DT9A 4PL8A 1XR6A 4CNZA 2KYZA 3NCPA 5BXIA 5JVGL 2HIQA 2GUPA 3WNHA 2BKPA 3BO4A 4JI8K 4OMFG 2M8HA 2IRXA 4DR4J 5IV4A 2QK9A 2KH9A 2W4DA 3S3OA 1S1UB 2IIHA 2MQQA 1MMDA 2HBRB 3CCSS 2NRTA 1KP6A 5K20B 4RNMA 1U02A 5KFBA 3OVAA 3MM7A 5AQYA 1DARA 1RA6A 2MSSA 2J8SA 3DOKB 1SJ1A 2QG9B 1TR0A 3HHKA 4BBYA 3E01B 3D3BJ 4WFAL 1VJQA 2YJEA 2POKA 3L7PA 5ETRA 4LF8K 4IKAA 4J91A 4ZP7A 4IUFA 3B4MA 4TLRA 1BIUA 1UVNA 3RAQA 4EHTA 4CCHA 3NWGA 3ENQA 1WSJA 2AP1A 3MTJA 3CPWR 4DPWA 2ROEA 3HL8A 2QI2A 1YJNS 1K9MO 2AX1A 1TQLA 4CH1A 2W40A 3OW2R 4ZN3A 1DY3A 4J9PA 5LY3A 4Q0BB 2EBEA 4XH1A 1GTHA 2QGFB 3B54A 4X4OA 4LRAA 3ZNUA 3R7SB 1TL3B 4Z4EA 1RT6A 1HQEA 3N6MA 1VSMA 4IZ9A 3MMCA 4LSLA 2I5JA 5CZ1A 3MR6A 4U9RA 3DLHA 1HNVA 3DLKA 1IBLK 5KT2A 3PO4A 1UW4A 1ULRA 3KK7A 3SLCA 4DFMA 4EGLA 2D7SA 2KO1A 2DFFA 3I31A 3WC2A 1G3OA 4Y6IA 2UVUA 3CM5A 2ZD1A 3LGMA 2ZVSA 3AO2A 4OX9K 4PYAA 2OO4A 1WDTA 2WW8A 4E7IA 2D1CA 4RBVA 1R6VA 2RU3A 4X62J 3OY9A 2G2ZA 3IN5A 3SQ4A 4WTYA 3B78A 3LDLA 2R7UA 1TK8A 3QO9A 3WT0A 4QIGA 2F9JA 5IS2A 3MFHA 3MN7A 1YHQS 1QE1B 5H9EK 4FVMA 1YK9A 2Q3SA 1CJVA 5E33A 2XMMA 1RKIA 2XB2D 5BYRA 3I0SB 4KGKA 1RT2B 1HLWA 1Q82T 5EU7A 1RT5B 4E7JA 3HJVA 3HZ6A 3MK6A 3BQ2A 3OYBA 5HAOA 3KWGA 4M3WA 4FWSA 3ZZZA 2WB4A 4WF9L 4LMZA 2ZDOA 1CZAN 1SUQA 4OZLA 1ZM3A 4DUZK 1T05A 3FEYB 2JL9A 4LIWA 2PI5A 1OPIA 3MEGA 3K5OA 4ECTA 3VF4A 1SZ2A 1J5EJ 1ATSA 4M63C 1RWUA 5BR8K 2V67A 4Z37A 4N77A 5KFRA 4BC2A 1XNQF 4OGCA 1N8RO 2LXIA 4NE9C 2IMWP 4R5PA 3RMCA 3KJQB 3UNYA 3WNFA 3WBZA 4RW7A 2GFFA 2DISA 4JKEA 3EGWB 1FTCA 4ZLLA 3NAHA 2MJUA 1FRJA 1SKUB 1KAZA 4ED6A 4K4WA 3UCUP 3TQ1A 1WG4A 3ZSXA 3TJ9A 4FPRA 4PL7A 3MM9A 2F4VJ 4DPYA 1ZAXA 2DGXA 4MIAA 4N8NA 4NX9A 1S7IA 1NJXA 3KD5E 3CD6N 2E7VA 3H5UA 4DQRA 2DKOB 3CCUS 4O4GA 2FZCB 2ZH8A 4ZTFA 3EDRB 3OXLA 3MOZA 4M5NA 2HBMA 4BY9C 5E7OB 3KLGA 3NGUA 1LW0B 4DR5K 1SKRA 4YR3A 1D3WA 2BZ2A 2ZZTA 2ZBIA 3OYAA 4RLEA 1IKVA 4ENOA 3POTB 2D3ZA 2KTQA 1MG7A 2Z1GA 4FZXC 2G8HA 2QM1A 3IMXA 3HSJA 4CZIA 2B4JA 1M1GA 4ZVRB 3MUVP 2F96A 4FYWB 2PDAA 5LMNJ 4Z4GA 2CVEA 3KG0A 2F65A 4UT4A 2FZKB 2XHWA 4YMEA 1X4HA 2O01C 4CLPA 4DCJB 2V2ZA 4EBDA 1YRUA 3ZZYA 5GIPA 2CWXA 5KG3A 2M0GB 4QJVA 2B9WA 2XGPA 1X4CA 4YOYA 4ZP6A 4EO6A 1AYEA 4DR6K 3TARA 2JH3A 3EGZA 1IKWA 1N6QB 2O8CA 2L9NA 3KLIA 1XEZA 3D2WA 1S6QA 2NXNA 5E3CA 4RJVA 2BACA 4NLCA 3CC7N 2IDEA 2WUSA 4DX8H 1IKYB 4CK3A 2NRWA 4NLYA 2KZZA 3DRXA 4MJKA 4DV1F 4J9KA 3R8EA 4BR7A 3KYLA 2E1YA 2ABYA 2RSQA 3BGUA 4JD2B 2Y1LB 1JLCA 3BEGB 1UFWA 3K2YA 1RACB 1WEYA 3FR0A 1N32F 1FJGK 2RF2B 2OPPA 1WBBA 4Y2CA 2K06A 4LBHA 2VWBA 5CCMA 4N47A 4WZQA 5TKYA 2A42A 1YVUA 2HSTA 1YDLA 1KS2A 4ECXA 3M6XA 4OL8A 5M2UA 1ITPA 3HHDA 4JLHA 3PYGA 3S9HA 4KI4A 1BUPA 2HYIB 1VRTA 3QSYB 3KK2A 2NSCA 3A5NC 5KOXA 1TKZA 2W25A 3VA3A 3KJNB 1KLNA 5L8RC 3MAAB 4KHPF 4ECWA 3P39A 4B3TF 6FDRA 3A8JA 1T94A 4K5SA 3A3NB 2LSNA 3T5KA 2NPFA 4QIWD 5C24B 1RDRA 2B56A 2A1RA 3HVTA 1RCOB 3C14B 1K8KB 5KFAA 1AUSL 3M8SA 2XULA 1EP4B 4IG3B 3NBPA 2ZWHA 2BA9A 4HYKA 4H5VA 3CCTA 1S76D 4R25A 1VQ6S 5ETOA 3P6YC 5F8JA 2R8KA 2H5IB 2O3DA 4FF2A 1W25A 2QWRA 1FXDA 4YQWA 1HBOA 5B0CA 4ZP9A 3KTQA 1IG8A 5F8HA 4DV0K 3TZWA 3H59A 4BWMA 3RAMA 4IH7A 3GOIA 3I5CA 4HTLA 1RT3B 1RDBA 5K9FA 1KVAA 1OVQA 1XTZA 4I9LA 3FFKB 1NAQA 3V1QA 1IBCB 4ZOSA 1DQAA 3CHWA 3U3YA 2ZD1B 2GS8A 5FJ4A 4CZFA 1VRQC 3M1VA 3J7ZO 2KT3A 3EVOA 1IBLJ 1QVFR 3B6OA 2YX6A 1GLEG 2V4JA 3T6BA 2WK4A 3AVNA 2GMLA 3R1HA 3G71N 1S49A 4OX8A 4LF4J 4A62A 4OPJA 1C0FA 3IKMA 3NH2A 4WPAA 2VJUA 3D2FA 2MSTA 4CERA 5DQHA 2HBQB 3CERA 3FEXB 4YB7A 5I3QA 2C2RA 4K8ZA 3C0BA 2Y9HA 3M8RA 2EFPA 4NYZA 4DR7J 3SEOA 1Q8IA 4ANEA 2QT7A 3M2UA 3W8PA 3Q24A 2WVBA 1BQMA 4DR3F 1FNMA 3MEEB 3VAGA 2ITGA 2EBGA 1N54B 2P9UB 4OHYA 3JQMA 2LA6A 2QRRA 6AT1B 1SJQA 1XMQJ 5ETLA 3MMJA 4JKHA 4ES2A 5ADZA 3DRSA 1KVIA 3LPUA 2FC9A 4KBIA 4H4KA 3TA0A 4FK2A 4PWDB 2DH8A 2RVJA 2A3ZA 3E3XA 4CIOA 2NREA 1HD1A 2IVFB 3O8WA 3O5TB 2GBZA 3I4HX 4NYOA 3ZCMA 4F4YA 5DG7A 3GE9A 3L2UA 4JV5K 1X0PA 3I8BA 1RYSA 1CC8A 1SC4B 1XIQA 1X4FA 2VUGA 4YORA 2MGZB 4WIIA 5A2QO 3KK1A 3HFKA 1KVBA 2E66A 2JWNA 5GADI 4EWTA 1AB8A 4PXCA 3RZAA 1HBMA 4KGVB 5FLXY 4DF8A 3ID8A 3SPZA 1J5EF 4AM7A 4U96A 1B7YB 4KAIA 2ZC4A 1P90A 1UJ4A 2GZOA 1KVCA 1SI9A 4Y00A 1N32K 4Y1DA 1BC6A 2BMBA 3CG7A 5A0YB 2D74B 3NG8A 4NL5A 3HLUA 3MMBB 4I6MA 1KLMB 1WKLA 5IZHA 2XHBA 1S97A 3TZZA 3AODA 2SXLA 4HH1A 4X4SA 3KLGB 4L72B 2MKCA 2HS0A 4I64A 5EX0A 4OGEA 4YR2A 2VCPA 4M94A 3V6KA 3DOLA 3IG1B 4OJRA 2PE8A 3DRRB 3W66A 3OW2M 2XI3A 4CO2A 3JSBA 2QYGA 3CDEA 1P8ZA 2DTUA 1E6YA 2X1BA 1DZ5A 1RAAB 3BEXA 1T03A 3OR2A 3AVGA 1RBTA 5C25A 1RGIA 3GG0A 2G0IA 3B6PA 2Z58B 3G6YA 1BWFO 1YHQN 1C0UB 2Y0BB 2BX6A 4FXWA 1XHZA 1WSEA 2WTUA 5E5NA 1VQKS 3BGOP 2W7AA 4JN4A 4K4VA 1XUPO 1H38A 4DR2J 3MM6B 3F56A 3TAMB 3PRVA 1YRXA 1XWLA 2VKRA 3AB2B 4BRNA 3BS9A 2MYFA 2D9OA 4PG6A 2BTFA 3OBIA 2R42A 3DXKA 4KHSA 1RBSA 4RW6A 3D2FB 4YN3B 1WACA 3AA4A 1TL5A 3DRRA 4ED1A 1S5JA 4B9UA 2W41A 1E4GT 2Z2ZA 3SXLA 3D67A 3QFWA 2M9KA 5AQVA 3OJSA 3JTNA 4DG1B 3VENA 3SUPA 4F4ZA 3LGNA 1YF5L 4XDDA 3OTOF 1WD6A 3MMCB 4O44A 3FZBA 4C8NA 4U6PA 2P6TA 1KONA 3D28A 4YUDA 4MKAA 1M1KO 4QWAA 4FYVB 3QIPA 4JI7F 1WAJA 4ZMMA 4B3TK 4A8XA 4MTPA 1HJRA 1RHRB 3WXLA 3IGNA 5KT5A 4HT7A 1AW0A 1BQNB 5DDPC 5AE2A 5AZJA 3HMJG 4L3KA 3SQ2A 5FD1A 2OA8A 3VZIA 1NM2A 1WG5A 5CZ2A 3GE1A 3NGRA 1BI4A 3K57A 4BVOA 4CTAA 1NK9A 4H5RA 4CGIA 5KFMA 3GMGA 2DR8A 1VQLS 4K4SA 3IR5B 4LFCJ 3W5ZA 4IG0B 4H0VB 4HKQA 2HF3A 4M3UA 4AUKA 1KNZA 3SMPA 4WZMA 1HI8A 2RDDA 1VQOS 3P3DA 4NLSA 3G96A 1N0UA 5AXMA 2V50A 2BOPA 2BE7D 2HQCA 1JJHA 2PYLA 3X1LB 3L3CA 1XBWA 2F3JA 4F67A 3SI8A 3E1YA 2XLIA 4J5OA 2ATQA 2CGJA 3R1XA 3I55N 5M1NA 4LF8F 2H48B 5LJWA 3GIRA 4BGBA 3VGTA 3OYKA 4FM0A 2PA3A 4CM2A 2KFYA 2ILYA 4URGA 4CTAB 4NA3A 1RDCA 3ZT1A 5KFYA 3GIJA 4JI3F 1UVJA 3KLIB 3VHQA 4C3MA 2DRDA 3UD3P 4ANDA 5L38A 4OPAA 2GV1A 3SQOP 1XC3A 2WAQD 3BJYA 5AQOA 2JJ4D 1KAXA 2V8VA 5ETKA 4GC7A 1RWVB 3PHEA 3UKUA 2GNKA 2YHXA 4HI2A 1S6OA 2X1FA 1VLYA 3QJPA 4DJBA 3R5GA 1W9HA 4PG4A 4DV6K 5HRNA 1VQ8N 4DCHA 5A8RA 3K0JA 5IWAK 1QQMA 2QLFB 3LDOA 4Q8FA 2VZ9A 3PR4A 1S0OA 2GVDA 1V3RA 3NAIA 4BR4A 4QZVB 3CJCA 3OS2A 3EKUA 4ZVPB 3V4MA 4OI1A 3CCQN 3I6PA 2RDIA 3KLFA 5D78A 4OX9F 3WX8A 4OYIA 3W2WA 2FHKA 4WFYA 4YDUC 4I7FA 2A1BA 3NE6A 4RW9A 1WC0A 4CQ1A 1X3MA 3N4PA 4USJC 2HZCA 1NMNA 4DU3A 2YNFA 3THWA 3LW5C 1L5UA 4RW4A 1QUPA 3H3OB 3W61A 3MECB 2E2QA 4CFBA 3VGSA 4JI4K 3AVFA 4CI6A 3SBMA 1IWAA 2E1AA 2UYTA 3SV3A 4MFBB 1RAGB 4IFEA 2B4VA 1VQNS 2DXDA 3CCQS 1GEHA 3NH0A 1TKDA 3VR1A 3T1AA 4FZVA 5KT4A 5C2DA 2WSCC 4W5RA 4NCBA 3HFVA 1Y5IB 3D66A 2NSBA 4LF7F 2VU5A 3IAM9 3LANA 1SC3B 1QQNA 3JQJA 5IFMA 3DLRA 2XYGB 4J37A 2O4IA 3O9RA 3Q8YA 3V5RA 4DR3K 1HD0A 1T9UA 1WKKA 1X1PA 2RQKA 3IBFB 5BRHA 2IGIA 1CJUA 3CCLN 5KFKA 2XM3A 1U7LA 4CZHA 4CLWA 2C2EA 2VOPA 2DHSA 4UY8T 4I67A 3AVCA 1OWXA 1A5VA 2QLBB 4O4RA 2B4UA 4BC9A 2PN6A 2KFZA 4DL0C 4PHTX 2VL1A 2A5XA 3NWRA 3DXMB 5D15A 4KFBA 4USIA 4WF9Q 3OS0A 1Y3KA 3OTOK 2VBXA 3NMUA 1NGIA 4ELUA 2E5LK 2BH1A 1HNZK 1LWEB 2QWLA 4EZ6A 4LF1A 2XYHB 3RSEB 5L1KA 1JCFA 4LFAF 2XS5A 3SAFA 2EKNA 4U7UD 1FO1A 1Q8BA 5HI7A 2RAQA 4P7TA 2RDJA 2IVMA 1AZSA 3HSTB 3ID6A 3NGIA 5TKWA 1MMNA 1ZBSA 2JDJA 2Q6BA 2ZHAA 4D3HA 5CZVA 4DEZA 3R3TA 3JB9k 4QW9A 2FF3B 2DNHA 2GQ2A 4OKKA 2UUBJ 4OPHA 2E2PA 3RUBL 1XNRJ 1RLDA 3TA2A 2R8JA 3TVYA 1IN0A 4JNEA 4FF4A 3L2WA 4O3RA 4FNIA 2F1FA 1ASVA 4J9VA 4MIBA 2UXCK 4M1KA 1GXUA 1KLMA 2IAJA 5AQPA 4BRAA 1D1UA 1YTAA 2XWYA 2HS3A 3KHRA 4CJUA 1CULB 1MU2B 5JLHA 2XZTB 1WSRA 4ZCIA 4Z0UA 3VEOA 2EFGA 2OTJN 3P5TL 3P45B 3V9WA 3TJ8A 3VQ9A 2NUUG 1UEUA 1RWWB 1WEXA 4YY3K 1R89A 4B1UB 3SFUA 2X6SA 1HW8A 1VGYA 2HFVA 3VN5A 4AFFA 4F02A 4F4AA 3LP2B 4LD0A 5KT7A 5JVHL 4RW4B 3S1TA 5FPEA 3MM8B 2L3MA 3C6HA 1RWMB 4IXCA 2HURA 3TUJC 5A2QY 2NYHA 2PEHA 4I2PB 2J9DA 3H25A 1ASWA 4JYAK 1CSJA 4OPKA 4M3RA 4OZ5A 2IVOA 1RUSA 2G9OA 3TP2A 1ZXOA 4AYBD 4LF5F 3QIDA 4WE1B 4X4QA 1E6VA 4DL5A 2QA4S 4WU3A 3NHGA 1N5QA 2J0XA 3FDSA 5KAKA 4BRMA 2HHWA 4CZMA 3UR0A 1XMBA 2F7VA 2PAVA 1CJUB 3PJ9A 3MUMP 1CXQA 1KOOA 2ZGZA 2KQ2A 3US5A 1J5OA 3WXMB 3MMAB 1T44A 3B6BA 4J9QA 3EXCX 1IR0A 3TANA 1BQNA 2P2CB 3VEXA 3CF5Q 5G0RA 5AZJB 5BPLA 3TU5A 3DCAA 4JI8F 3OYIA 3TTFA 3CC2S 3IP0A 4DTJA 4IFVA 1Z05A 1S1WB 3ZT2A 2MZSA 4QIFA 1IJEB 3OYGA 3HPGA 5JVGQ 2RRAA 2CQPA 3TEGA 4C1NK 3R6MA 3FUYA 3LDNA 2XQCA 2ZZMA 2L48A 1N5YB 1VRUA 1CG2A 2PMHA 3J7ZT 1IKXA 5C25B 1S10A 2GHVC 4CDIA 2LEPA 3A0IX 3NS6A 2ZEJA 2DIVA 4MDBA 4CRJA 2MXYA 2BBEA 1BHNA 3ZTRA 2BM1A 4R0JA 5ELZA 1BL3A 3VEZA 2A18A 1C1BA 3JAMO 2O8DA 1S22A 4K4XA 2ATLA 2HWTA 2CWKA 4AHVA 2XMVA 1VBYA 3M9OB 1U4BA 4W92B 2QX0A 2HHQA 4P52A 1EWRA 2JC0A 1RXOB 5KT6A 2HHHJ 2GV9A 1JIHA 5D4NA 4ZVHA 3KHGA 5FLXU 4NZ7A 4IJNA 4FYXB 1RT1A 2QE5A 3C8YA 3DHWC 3K8VA 3I56S 2XRIA 4FWRA 4DB3A 3ZO7A 2LQ9A 3PEHA 3QO9B 3AD9C 4FO0A 1QZ6A 3A3OB 1S57A 2XYPB 3DLGB 3GP9A 4CLUA 1RBUA 1YG0A 5F8IA 3BH7B 3N28A 2OFGX 3GIIA 4B1XB 1BA1A 2A40A 3ZZPA 2OHDA 3N6LA 3QZ7A 2D3OR 4I68A 2J7KA 4NMLA 1NK7A 1UPMB 4DR7K 3W9IA 4ZA1A 2QA1A 2HHSA 3HVTB 1N88A 2ALZA 1RABB 3ISNC 5IXUA 4CBUA 4FJIA 3AA5X 1QVGM 4ICLA 2EEYA 4CZCA 3HSCA 1DFDA 5AQQA 2Z2YB 2ZGYA 3JTOA 5DETA 4DR2K 3AA8A 5KFOA 3CFOA 2WBRA 5LXYA 4HVZA 2AMCB 3CETA 1C0MA 4X65J 4BC4A 3QINA 3AAQA 5AQWA 4CLKA 1IKYA 2O8EA 3MM5B 2ASMA 2YXLA 1LKZA 1Q7YT 1P9YA 3ZSVA 3ZLJA 1FX2A 3KJFB 4J90A 3HFZB 4P71A 5FRMA 4UZBA 2HMIB 1UVMA 3H5XA 3OYMA 4CEZA 2IM1A 2ZE2B 2W2QP 3J7AP 3G6EN 2VFRA 2YWEA 3QEXA 4RKUC 2JFDA 4XO0A 1QS4A 4ID5A 4A46A 3D2EA 4CLLA 3NNHA 4QCLA 1NWKA 1NK4A 2ASDA 1VHIA 2XC9A 2NS1B 2NRZA 3UD4P 2RF2A 3EM1A 2O8EB 1RHJB 1W97L 2CA9A 4P75A 3O3LA 4CGGA 5HRPA 4K2XA 2DITA 3CQYA 4DS4A 4CGFA 3EGVA 1U0HA 4QQBA 2CGKA 5AJ3F 1HI1A 3M2UB 2CJBA 2MEWA 4FJGA 2N3OA 1RDWX 3HJFA 3WDOA 4P2SA 3ZSWA 1VS3A 2NZCA 2LDIA 3VTIA 4IO8A 1SQGA 1HR0K 2ASPA 2RQ4A 3N79A 4PQUA 3UFCX 1V4TA 2A6AA 4LRBA 1SQKA 4USTA 4LF5K 2IM0A 3RBEA 2WHOA 1FA0A 2KI2A 2NXUA 5HLFA 2IDOA 1KQGB 2DFHA 4AF1A 2DGWA 3IGVA 5DJBA 3J7AN 4CZKA 1C0TB 3ONQA 4IG3A 3NS7B 2I2YA 3OFHA 3M2RA 3RBZA 1HKBA 3MR2A 4RUHA 3MD3A 3O9UA 3I87A 2E1ZA 2MGZA 3GYNA 4BE2A 1XMOK 1Q78A 2MHNA 1KFSA 4H03B 4JKGA 5BYSA 5HK4A 4YB1P 5CYMA 4ZLJA 1ROFA 1C0GA 1H2TZ 5EVZA 2PSZA 4TQSA 2P8IA 2GGPA 2OP5A 1T9XA 2J9CA 3WNEA 3V4IA 2CQDA 3MM7B 1TUYA 3JXUA 2DEIA 3RYLA 4PABA 1DQ8A 1JL2A 3RWUA 2XWXA 3D6FB 2LP4A 2M88A 1OPZA 2MLZA 3QAUA 3HRGA 4RW8A 4DDFA 2XSFA 2VG7A 1V9OA 4MDAA 3CJKA 4I6MB 1Q79A 1WOSA 4DSIA 1F2GA 3R5CA 3OL6A 2E5JA 3U4LA 5E41A 3EZOA 4WCEL 4B3MK 4H5WA 5IC6B 3PFOA 1E3MA 2NRHA 2AJ0A 1B99A 1YJUA 4MKYA 2YKNA 4CH0S 3PKYA 3V4IB 2R4FA 2OSRA 2FVSA 4NXNK 3UCZP 4JI1J 4RW8B 2HFOA 3KLVA 1FESA 2C22A 4MKBA 4M5MA 1HLUA 3GCWP 1JLAB 2XSJB 4ERDA 4AL6A 3JSMB 1OMSA 2ACMA 1MROA 3NMAA 3I0RB 1UA1A 4CJEA 3CM6A 1X5SA 3P96A 3K58A 4O4GB 3KLHB 5J2NA 5HRRA 3FSIA 2BQUA 2BJ3A 1T6CA 1F5CA 1JJ2R 2YY3A 4C8YA 5HMXA 2MQMA 4WTOB 3HPHA 4DUYJ 1FE0A 2VFUA 2B3TB 4FYYB 4IOBA 2RQMA 1XNQK 2PIIA 2HSEB 3DYAA 2HIYA 1RTZA 4Y2MA 2QL9B 3MCOA 3MF5A 2F9WA 3VAFA 1ZOTA 1B0TA 3GG1A 2VC0A 1P8GA 1RBOB 4BRPA 4JI5F 2W7PA 1OY8A 1J53A 2FGOA 2GJIA 5KQ8A 3HM8A 2DFEA 2HB5A 1S9GB 2B8QA 2IYGA 4CK2A 1O6XA 4M8LA 4O8UA 1U1PA 1VRUB 2GO9A 4U67L 2F63A 2VDIA 5I3UB 4DTSA 4CP5A 4U8VA 3ZZ0A 4CHZA 2W2OP 3F9MA 1GMWD 3MMBA 4B1ZA 5GMDA 4UZCA 3AQOA 2FJVA 3OL8A 3W5YA 4PQAA 2C28A 3PNIA 1NG9A 4C8KA 1GX6A 3CDUA 5AJ3K 3KWMA 4FXVA 3J7Z5 2GGPB 3CUNA 2YWWA 4OHWA 2J4RA 3I96A 3DLGA 1JB0C 4PY5A 3D68A 1YBAA 3J7YP 3CT9A 1MNEA 4ZVQB 4OIXA 1VJWA 3W7BA 2A1SA 1HARA 1E6YB 3JSRA 5DGBA 4PAAA 3HHLC 3ZZTA 2P9SB 4KKOA 1WF2A 4KH1B 3ULEB 4EP4A 2D0BA 3ZX0A 2VG5B 4EUVA 2CZ4A 4KRFA 5AQRA 5C42B 1RB0A 2OJ3A 3ENVA 4MO4A 1HBNB 4WK3A 4DR6J 2BM0A 4A57A 1VSLA 1UJ5A 1W2IA 2PEBA 1VQKN 2LA4A 5AQGA 1VC5A 2IA0A 3MAAA 2IM3A 3HYFA 1HA1A 4WYWA 3EEQA 3MPWA 5AXLA 1VSJA 4JKFA 3Q7CA 2JNJA 4L8RB 2CPIA 3BZCA 2CPZA 4JRPA 1NJZA 3KXDA 4DTXA 2KKHA 4JKBA 3L09A 2ATCB 3VPZA 3CCMN 2FLLA 1T0TV 3UKRA 4J9UE 3MI7X 2A6OA 4FL9A 1CJKB 1VBXA 3TZXA 2NXCA 4HDGA 1K8KA 3S3NA 2MTLA 2DY1A 4HI1A 4EZ9A 2HFNA 1RBAA 4GO5X 1Q1KA 5F3ZA 4RU2A 4JKCA 3AO4A 4PYDA 3TNVA 1P9QC 4YDDB 1RHQB 4F3MA 3HVWA 5IOLA 3O5BA 3VEVA 3F5TA 4NLPA 4F4WA 1L3VA 2IOCA 2BV3A 2PGCA 2LQBA 4HL9A 1NH8A 4CEAA 3I56N 3TPQA 3MEGB 3KFWX 2QYCA 3NMRA 5H1SQ 2B9YA 3ZTSA 4J2EA 4BS2A 4IOXA 4UOCA 3RMAA 4I2QB 3G87A 3T5JA 3DDNA 1WBDA 3M8WA 4BE0A 3DU5A 3QDKA 1REVA 3VVUA 4URQU 2DGSA 2QMUB 4PXDA 2BKNA 3SIPB 3BKUA 4KPCA 4FDFA 1Y5LB 3DRYA 2NRRA 1S9EB 4X64K 1YT3A 1TUWA 5KFHA 3RB3A 1F9FA 1YUWA 2E1MC 3CJ2A 4EAHD 2G4BA 2B9EA 1JKHB 4UQTA 2J6SA 3C16A 2UUAF 2BGGA 2CIMA 4DHYA 1UKUA 1FXRA 2EWSA 4TY9A 4QS8A 1I6JA 2R2RA 1NOYA 1UTAA 3AO5A 3AGKA 3EL2A 1OVYA 4NASA 4EFAC 4LRCA 1HKCA 1U1RA 3MAQA 2CH6A 1HNVB 2MZTA 4AHUA 4K5RA 1BY9A 5JS2A 4PZVA 4P7VA 2HGMA 4FLYA 2Q0UA 4H4OA 5AQIA 3W65A 5AQUA 4MK8A 5F9LA 3D2EB 3ULEA 4P72A 1QZ5A 1JQGA 5C2GA 4USKA 3SV4A 1GMVA 3KLFB 1FKPA 4Q44A 4E1NA 1MWZA 3UN2A 5KTQA 4DR1F 4P2FA 4CIEA 1KSPA 4JS4A 1NU0A 4DX7A 3GIKA 1JXVA 5E2QA 4LFBJ 2R8HA 1UFLA 5KFTA 5J2MB 2FHJD 4OX9J 3H2LA 1YJRA 3KJVA 3FEZA 3A1YG 4FJLA 3OR1A 3Q8SB 4OZJA 2HQGA 3H90A 1F5AA 4NPOA 5HANA 2UXBK 4JI0K 1IQTA 4KQZA 3MEDB 2ADCA 3M3ZA 5JXSA 2W8KA 2DNKA 1RDAA 3CMAN 1HBMB 4B3MF 5DM6L 2VPZB 1BUXA 5BYQA 4M5DB 1U2CA 1YJ9S 1MU2A 4OJ3A 4CJFA 4KB1A 2J5AA 1KEKA 3IO1A 3TAEA 3HP9A 2LVWA 1TP7A 4OYXA 3L2VA 4IOAQ 2ZKTA 3LWMA 2AU0A 3E51A 4YOTA 1PYSB 1LV5A 4KHWA 3Q8UA 4EIAA 4USVA 1HNWJ 2GX9A 1TMMA 1RCHA 1DHMA 4C0HA 4AT1B 3MDFA 4ED5A 2AIRB 5LL6Z 3CXCR 1BWVA 3H2VE 2UV8A 4HUFA 3AD7C 1F0XA 3GL1A 2WVCA 3QGPA 4KH5A 5KOWA 3QRQA 2CJYB 3CCRN 2I38A 3MPVA 1XI1A 4AHRA 3QNNA 2P9CA 3HD2A 4K4YA 3VQDA 4DR5J 4ILMA 1HR0F 3OHRA 1TVRA 4DV2J 3CEDA 1U26A 2W4PA 3EPGA 4K0KJ 4J9LA 5KFNA 2JFKA 2HK2A 4OZ1A 3DM2B 2CKWA 2OYQA 1H2UX 4DL3A 1GOBA 3O9TA 2Q43A 3D0IE 1YWXA 4B9SA 3BF3A 4ZVUB 1PBUA 4OX7A 4JI2J 1UPPA 1TU0B 2CDRB 4LBIA 3NOCA 5E3PA 4H4KC 2MKIA 3N5BA 2XMTA 1EJ7L 2CJKA 3KK2B 4IH6A 4B1WB 1LW0A 4ZJOA 2H9ZA 2XNQA 2QLWA 3JAMU 4F36A 2LU1A 4Z4FA 3HOTA 1FT8A 4B3OA 1FE4A 4YR0A 3H7HB 1ZAWA 1PYTA 2J7UA 1IBMF 2Z56B 2ASJA 2I7NA 1ZZFA 5FPDA 4DV4J 2Q3PA 2V7ZA 1I94K 5FLXO 3D4JA 3CFPA 2KN4A 1UVIA 1RBLA 3EO3A 3DXBA 3M8PA 3L2QA 5LMNF 1U2VB 3WIUA 2X1AA 2RUGA 3CTRA 2V63A 3CJ7A 3BF4A 4G1QA 4ZHRA 4NA1A 4W90B 3CCJN 3IM8A 3CCVS 3PSFA 1TKTA 1VSFA 3JXOA 2HNDA 1W2BR 3WUHA 2HLUA 3V2UC 1S48A 3TUPA 4TXSA 2D0AA 4BRDA 2KU7A 2D5RA 5C42A 5LSLA 2LU2A 3AGRA 1T05B 2VHGA 3EZUA 1K44A 1D09B 1CLQA 4NWBA 3OTDA 1YX2A 1XQSC 3ATUA 1HBOB 3LP3A 2RS2A 1OSDA 5KFWA 1RDUA 2ZH9A 2IBKA 5LT5A 2L9WA 3TJAA 4R5PB 2G8KA 2ZF5O 2MY7A 1SL2A 4TYBA 4ZHRB 3T41A 3J7A1 2P6SA 2ZC3A 3FMBA 3IWNC 3UN5A 1EARA 4ES3A 4JI7K 1D5AA 2GC8A 3SFGA 3E8OA 3FFIB 1GXTA 1NU4A 3J81j 3PYEA 1ZTTA 4O8KA 1NGBA 3OR2B 3RW7A 3MPUB 4B9VA 1HQUB 4A5BA 2LEAA 4LF7K 4FJ8A 4FLTA 2EKYA 5EX3A 2CPHA 1F6TA 2UUAK 3NGYA 1J5OB 5GAHI 1UVKA 4O5BA 4JUZA 4CIGA 3EYZA 1SAZA 3GPAA 4F25A 2WW4A 4G3IA 1DTTB 2RIJA 1FDAA 4O44B 3EXYA 1G15A 1VQ8S 3UCGA 4FOIA 3TO8A 4C2MA 3U9ZA 1RDDA 1F3VA 4QPTA 3H2UB 4IRKA 2QTWA 5KG7A 2X6NA 3T1HK 3W60A 3C65A 3V6HA 2WOMB 1RI7A 2H1YA 5D0HA 3ETOA 2Q66A 4FPAA 3DM2A 3CYMA 4URSA 3G4SN 3OPKA 2RRNA 2KFNA 4KH6A 3VF0B 4UQGA 4V1Ak 4BWJA 4M3XA 1TMJA 1S99A 1TV6B 3I9ZA 3VESA 4FJMA 3AVLA 2BOAA 5AQTA 3MURP 3FBEA 2RHKA 1W7WA 4DR1K 4RWXA 2QL5B 3OTCA 3V9UA 1F21A 3WQPA 1PKUA 4ALZA 1SJ3P 2WC9A 2NCKL 4ILLA 2ROPA 1ZM2A 1GK8A 1NZ8A 1XR7A 4M5LA 4YOEA 4Y34A 4A8SA 4LF9K 2IA6A 4ZPBA 4CEOA 2XO7A 1EX8A 3GR1A 3A5LC 4CECA 1VBKA 5A6PA 2F8MA 1SBRA 1TYQA 4W5TA 2OPSA 2WOMA 4CYUB 3J81O 4IFYA 3MECA 4GKKK 1NGGA 3PO5A 3UKRB 5KFVA 3ZSRA 4GMJB 2V8GA 1RK8A 1RT4A 3AAWB 2ZM6K 1ACMB 2I8EA 5K5MA 1RT5A 3EE9A 4NLUA 2PFFB 3NDKA 3A8EA 3EVMA 4EO8A 4M5KA 4C4WA 3PYDA 3EX7B 2CUYA 1WSGA 2GHWA 3IA0A 2FY8A 5AFUA 1ZPWX 2VICA 1V6HA 2HNDB 1LWCA 2VPYB 2XMJA 2OELA 1SIZA 3CSKA 1EAYC 1B0PA 1T3NA 4M45A 2Z4PA 1TKXB 2FHJA 4IFYB 5GADP 4JI6J 3R97A 1Z2LA 5K8NA 1JLQA 2YHWA 3MEDA 2FPHX 2NUHA 3NF9A 2YHAA 1V4SA 3LOUA 4JI4F 3U7JA 2R7YA 2R2UA 5C7PA 3CJKB 2ZOGA 1WORA 4CJ4A 4DV7J 3BB5A 3BKFA 4BROA 4K0KK 1ZBIA 4KJIA 3HOSA 2H5EA 2V0NA 3SAGA 2UV8G 3UDLA 1U04A 3PW2A 5KFCA 2DBBA 5G4DA 3CDAA 3M9MB 4FWOA 2N82B 2A2DA 3Q7BA 3MWTA 4K43A 4CLFA 1RSCA 1KDNA 3AXKA 4FJXA 3G9CA 4CZJA 4Q5VA 4DR1J 4H5TA 1D8ZA 3QSIA 4OLBA 2PYJA 2FHMA 5CAAA 4FF3A 3ATVA 1HNZF 1NPRA 3MCPA 2IBOA 3MXMA 2NNWA 1IBKF 4UY85 3CJ1A 4A48A 4LREA 5AE1A 3EZ5A 3SMSA 2CQ4A 4CJPA 1NJIO 2CNLB 3CC4N 4FWQA 3O4QA 5T7BA 2IPOB 2GJ2A 3THYB 3C2PA 2Y3YA 4ZCKA 5L9NA 3FZ2A 4JI5K 2YQ1A 4WQ5A 4ZVTB 4IWVA 1VQ4S 3VGUA 1KAYA 4DTMA 4ECZA 4WFXA 3RG6A 3HCXA 5DZ7A 4BDZA 2E5LF 2PD1A 3D45A 3A8IA 3WXKA 1S5ZA 5B0AA 3FCVA 2MZ1A 1BMQB 3H6EA 5B0EA 2D9PA 5B0DA 2J6TA 4GW6A 4H0XB 5ADXH 3SYZA 3AFGA 4NMXA 4I6YA 1FFSB 1GMUA 4J2AA 3CC4S 4UF4A 3CJ9A 3BR9A 1QJHA 2LECA 2Q97A 5CHIA 2CFXA 1PO6A 2FSJA 3CD5A 3G86A 4ZTJA 1VQ4N 3GLJA 1FWKA 2E29A 4LFBK 2FSKA 2MPUA 1ZBFA 4F7VA 3IXQA 3BZKA 1SJFA 1E6VB 1V3ZA 3FZMA 2KVQE 4CEFA 4B3SK 1QAXA 2EG2A 4ANCA 3C6TB 4CO0A 4JK8A 3ZX3A 1GLAG 2DY4A 2D4WA 4ZITA 2CJQA 2HF4A 4BRQA 4CLZA 4NLTA 2GO8A 3ZSZA 4ILRA 5EGYA 3FBCA 2UXCJ 3TEHB 2NRVA 2VFSA 2JLGA 1M1HA 1T9VA 1VYAA 4KYZA 4OFZA 2E5HA 4X4RA 1OQ6A 2HVIA 3SSRA 4CO5A 1ZBHA 1I94F 2E5GA 1ZAVA 5HVGA 1WEZA 4U67Q 2CNKB 3DLKB 4DHVA 5CHCB 4KI6A 1Z2ZA 3DU6A 3CJ4A 1VFJA 2GAGC 5IM0B 2BXJA 2V2QA 2IJRA 2IYIA 4EFHA 1N5VA 3CCRS 3TW0A 3UVJB 1OSCA 2QWOA 2EW9A 1X9SA 2LQ8A 4Y28C 1GAOA 4TU8A 2MKKA 3M32B 4K2JA 2VH7A 3IS9A 2LQJA 5AT1B 1MN9A 4FOEA 3M6VA 1CLFA 4GKKF 3J80U 1B92A 2FC0A 4QYZJ 4NXMK 3PG9A 3KUEA 1VQ9N 4ISEA 1C1BB 4M3YA 1RU1A 2C2NA 1VQMN 1RGVA 2FLPA 2QFIA 2AGPA 1N33F 4CJTA 2ETJA 4J2BA 2ASOA 3MWPA 1S4EA 4O3OA 1RT7A 1SC6A 1YJWN 4FBTA 3FBBA 4C0OC 3GONA 1FKAF 3UIQA 3THXB 3G8TA 1I3AA 1N5TA 3AB4B 4NLDA 3M2RB 1I5OB 2W2NP 5KFEA 3N01A 5KQDA 4IQMA 3VMFB 5GAEP 1NGFA 4E19A 3IG1A 3K9KA 2XS2A 2ZWOA 5JICA 1N36K 2E5IA 3QEIA 4RU9A 4ZP8A 3QWPA 3SDEB 4HHTA 3DOKA 1BGXT 3PUFA 3EVWA 3D3CJ 4RUBA 2FVRA 1K8AO 4WYLA 4IKFA 3PW0A 2OEMA 4ETZA 3JTPA 2AYEA 1LW2B 2ZM6F 4F26A 5EDWA 3QPIA 1NJWA 3C6UA 3MAHA 3VA0A 1JXEA 4LF6K 2YX4A 4IJAA 5I3UA 4QAGA 1VC0A 4DPOA 4GV9A 4K4UA 1GT8A 4BG9A 4DR6F 3BV8A 3MM6A 1A6LA 3P1GA 1BCOA 2O66A 1VBZA 3CCVN 3MUTP 1DURA 1S9EA 1SL0A 4JRQA 1T7PA 4NLQA 4B8CA 2R8GA 2AEMA 1XQIA 4YNQA 2QIFA 3PEJA 3ZYYX 2BE9B 5CA5A 3C6AA 4WWSA 1H7XA 1IXKA 1ASUA 4NZ6A 2DNGA 1GX5A 2M70A 4DL7A 2JEGA 4JK9A 2X7IA 3FLCO 5AXKA 3T9ZA 5HQMA 5J1EB 2XTJP 2P5OA 3KIOA 2NYIA 2OEKA 2DNRA 3Q83A 2GUIA 4MYUA 1WF0A 3JAMY 4DU7A 1RCXB 3DDKA 2K3IA 3C14A 8RUCA 5DO2A 1URNA 2ASYA 4TYAA 4DSJA 2MQ8A 5THWA 2KXHA 3A5MC 5AXNA 3NKYA 2NLWA 1AUDA 3L9ZA 3LUYA 3FZKA 4BE1A 5LMUJ 3V6DB 2V8HA 4CI0B 2YKMA 4M41A 2FIUA 1RILA 4H4MA 2AZ1A 4RCHA 1R0AA 1R27B 3R5DA 1KQKA 4OHZA 2HHXA 2E4LA 4BVPA 1VSDA 4NCGB 1KQFB 2IS3A 4I69A 4QWBA 3DNCA 3QATA 3C19A 3G4SS 1BDGA 1SV5B 3QFPA 1S12A 2VFTA 3MGJA 1HWJA 5HVHA 1NSKL 2OUGA 3BSCA 2DR9A 1YJNN 1XN9A 3FSYA 3BYRA 4OYBA 4QBUA 2P1JA 3Q2TC 2ZJRQ 4OV1A 3VQPA 4C11B 3E01A 4V19X 4B3RK 4YDXA 4Q8EA 2WVFA 4DU8A 3AAPA 1LEOA 3AVJA 2AHOB 2D0CA 2FZGB 1LOUA 4C98A 2UXDJ 3GCXP 4ZDNA 4J8FA 4DCOB 2MY8A 3I8DA 2ZJPQ 1ZS6A 2FC8A 3VGVA 4FS1A 4X64J 4I2QA 4LVOP 3DXMA 1KR4A 1HBUA 3KKSA 3N4QA 2CJAA 3MCSA 4N76A 3OYCA 4CT9A 3CMQA 1OKJA 5KG1A 4RW7B 4ZPDA 3T9NA 4B3TJ 4RPFA 3MM5A 1OY6A 5SWMA 3D54A 3KUGA 5SZTA 4C3LA 1NJIT 2R3VA 5EX5A 1WTBA 1IBKJ 2BEFA 3S41A 3CO9A 3CJRA 3EMTA 1UETA 2AKWB 1KQSR 4B02A 5C2CA 1G6BA 3KG1A 5CR4A 2CPEA 2HEKA 1NEEA 3MXJA 1X4EA 4NYNA 2D0OA 4ZK7M 2EFQA 1JCGA 3BPSP 3RBDA 3RRHA 2AYGA 4E7HA 1T95A 3VEYA 1QQCA 1XMOF 1QY7A