1TL1A

Crystal structure of hiv-1 reverse transcriptase in complex with gw451211
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
516
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 146
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tl1A05
3KK2B 3DLKA 4DSJA 3SFUA 1VSMA 4HCBA 3PJXA 4QWCA 4XPEA 3NE6A 2HNYB 3F73A 4NCAA 4GW6A 4KI6A 2FBTA 1A5XA 3C6UA 5KFEA 2DY4A 1TKZA 2HW3A 4ELUA 3QIDA 3I0RA 3QGHA 3ZT1A 2UUWA 4ZP7A 1HMVA 1BI4B 3CYMA 4OGEA 2RKIA 2OPSB 1SH3A 5HBMA 3ZSYA 1S6PB 2HNZA 3DLEB 4FBTA 1X1PA 4CFCA 3SNNA 2R2RA 2LSNA 5DLFA 2IM2A 2FLLA 4ED2A 1WSIA 1SL1A 3KOAA 4CJTA 1T94A 4O5BA 1LAVA 3S9HA 4U7CA 1TQLA 1RT3B 5C42A 2OPQA 2HVHA 1DTTA 2RN2A 4RG8A 1T05A 2HNDB 4H4OA 2R8JA 4OLAA 3CDWA 2I1RA 3RR7A 4H8KA 3NF6A 3HHKA 2XHBA 1UWBA 3K2PA 2IMWP 1BGXT 4KHMA 1JLFA 2YNHB 3KLVA 4UQGA 2QV6A 3T5KA 4ECUA 4CFBA 4CECA 4ELTA 1JLQA 1YVUA 4JRPA 3M9MB 1N5YA 4DEZA 5KFGA 4CJRA 3KD1E 2AGOA 4FJNA 1RILA 4ED7A 4IKAA 3HP6A 5J2NB 4M3RA 1VRUB 2KQ2A 3RB0A 2QE5A 4AHSA 2HHXA 3BR9A 3SUOA 3AVAA 1X9SA 3UIQA 4F4ZA 3OL9A 1RDBA 3F9KA 4NLTA 4MFBB 2VG5A 4EZ6A 3AVKA 3OYEA 1RT6A 4CHQA 1LWEA 3SQ2A 2IJFA 1A5WA 3IGVA 2BRKA 1LWFA 4KB1A 3CJ4A 3MTKA 5C5JA 3TARA 2BE2B 2HHTA 1FXXA 4LD0A 3TAGA 4J9QA 1C0UB 1GX6A 1VSHA 4BE2A 3OS0A 4CERA 3LAMA 4ID5A 4F4YA 5CZ1A 1BCOA 4FZYA 3TAPA 4RNFA 2C28A 2AGQA 1S1UA 1CZBA 1Q8IA 1SKSA 4J2DA 3HJFA 3NL0A 1ZTWA 2WONB 4KB0A 1ZBIA 3CJ3A 4RW9A 4IG0B 4ECZA 4DTJA 4Z0UA 4F4KA 2RF2A 4KPYA 3CG7A 5T14A 4K4YA 3KK2A 3DOLB 2ATQA 1LW2A 4RW6B 3MR2A 3SUPA 2B5JA 1GOBA 4CF1A 1Y97A 4FJ9A 2HNYA 2JC0A 3PW4A 4EEYA 3KLGB 2F8SA 2ZE2B 3D5MA 4BACA 3TANA 3L2WA 4IR1A 2ITGA 4ECRA 1TK8A 1RYSA 1VSIA 1BI4A 1D9FA 1S48A 4U6PA 2OPSA 3OYCA 1RTIA 1QSYA 1HARA 3DM2B 1S6PA 3TABA 3LPTA 3C94A 1BL3A 3DLEA 1J9AA 4DU4A 1CXUA 3D45A 4TXSA 3H98A 5KFDA 1LV5A 4Z4HA 3L3UA 3OYAA 4E7HA 5KFAA 3HYFA 5F8NA 1ASVA 4W5QA 4Q0BB 5KFIA 3ZT2A 4DU1A 4FJMA 1SL0A 4EYIB 4IRDA 4J9KA 2JLEA 4ZP9A 2XCPA 3VQAA 1BQNB 3HO1A 3QZ7A 3VQCA 4FW2A 2A1RA 4M3WA 2Z1JA 3ZSOA 1YTUA 1TAUA 3OL8A 5JUMA 1S0MA 2UVRA 4K4WA 4WE1B 1FKOA 3KK1B 2XY5A 4B3OB 5KT2A 2ILZA 4FLTA 3ZSXA 3O3GA 3ZSRA 3AVJA 2VA3A 2PZSA 3AA4A 1MU2B 2E9ZA 1WNSA 1HNIB 3N6MA 3VQEA 2IM1A 1REVA 3QEIA 3OSPA 1C1BB 4KV8B 2XY7A 3HVTB 4PQUB 3LP1A 2DPIA 1XR7A 2FJWA 4J9OA 3QEXA 4O0IA 4J2AA 3UQSA 3KLIB 4O0JA 5I42B 4IDKA 3RRHA 3RBDA 3ZCMA 3SFGA 5J2NA 4R0EA 2HWIA 1F21A 5KG2A 1JKHA 4K4ZA 4KTWA 1C0MA 3AO1A 1WAFA 5KI6A 4FLZA 1VRTB 4BDYA 5KFRA 3WNHA 3S3MA 5DQHA 5FROA 3OYJA 4C8NA 3DYAB 3OYNA 2HMIA 2WTFA 3QLHB 3AVLA 3G86A 2BE2A 3SZ2A 4FBUA 1U45A 2R7YA 3PW2A 1ZBFA 2OZMA 4QW8A 1IH7A 3ZT0A 4E1MA 3OYIA 3DRSB 4ID1A 1U04A 3EY1A 3M9NB 1KHVA 3PR5B 2E4LA 5CZ2A 4HHTA 1TL1B 4IG0A 2J6SA 1L3SA 4WFXA 4NLUA 3DOLA 2GIQA 4WFZA 5L1IA 1BIZA 3LWMA 1JXLA 3V9SA 4J9MA 4E7JA 3GILA 3RB6A 2G8FA 4KO0A 3L2QA 1I39A 2E9RX 4LSLB 1C1AA 3G6YA 4YMEA 1NJZA 1NKCA 2R8GA 3MEEA 4IR9A 1VSEA 4DG1B 3ISND 4Z4IA 2BANA 4FS1A 2WRMA 1YTAA 4CIEA 1Q9XA 4B08A 1UOCA 5F8HA 4K4SA 4R5PB 1NK4A 1RA7A 4DLGA 4E3SA 5JS1A 3FQLA 3JYTA 4CHPA 3BSCA 1RNHA 3LAKA 5KRSA 4Q0BA 4FJXA 4J9RA 1IKWA 1B9FA 1TV6A 3SPZA 4ICLB 5HRSA 4NLOA 1FKPB 4I7FB 1N56A 1GX5A 1SUQA 3DLGA 4NLWA 5KFLA 2D0BA 1HPZA 4J9SA 1QUVA 4G1QB 4WE1A 4IOBA 5DG9A 5HLFA 2RDIA 3HL8A 4AHRA 4PA1A 3GYNA 1S9EA 3KLHA 1NHUA 3MR6A 2JEJA 3CDUA 4IBNA 3PO4A 3FRZA 1MU2A 4FYDA 5KT6A 4O4RA 2Z1HA 4KTQA 3C6UB 1RT5B 5KRTA 4KV8A 2JEIA 1TKZB 4WXWA 3I0RB 4URQU 4ZVFA 3SQ4A 1HMVB 1GOAA 2ZQBA 2RKIB 1QAIA 4WYWA 5HBMB 2HNZB 5J2MB 1TKTA 3MEDA 1CSJA 4TY9A 3AVBA 1U4BA 4O3SA 3NGDA 4FJJA 1KVCA 3PHEA 3LP0A 5HROB 2ETJA 4Q8EA 1I3AA 3NH0A 4FM0A 3PW7A 2EC0A 2VG7A 4ZVGA 2RDJA 5L1LA 1S5JA 1RBVA 5KG4A 3MAQA 5C42B 1HQUA 4K4XA 3DYAA 4NLQA 1VSLA 1UAXA 1DTTB 1W0HA 3DOKA 3ITHA 5T7BA 3QLHA 4CIFA 4H4OB 4TY8B 5JXSA 4QAGA 2GC8A 3Q8QB 4I9LA 4TYBA 4E7IA 1HQEA 5EWFA 2IM0A 5KFKA 2IM3A 1RTJA 4CHYA 1NK9A 2HHWA 5F8JA 4CJ4A 5KFVA 1L5UA 1RYRA 3T19A 1TL1A 2QKKA 4IQXA 3AO3A 3KTQA 5KFUA 3RMDA 1NKBA 2D7SA 1JLQB 1LW0A 3OYFA 2HVIA 4F8RA 3RWUA 4KRFA 5KFWA 1HRHA 3V1QA 1T03A 3AVNA 4O55A 3M8SA 2Y1JA 4ZPCA 5CYMA 2IAJA 2FVPA 1Q9YA 5J2PA 2IBKA 3DRPA 4IRCA 1EP4A 3CM5A 3MEGA 2VG5B 1TGOA 3NCIA 3EPIA 2FLNA 4BWMA 2GIRA 4NZ0A 1BHLA 1LWFB 3OYBA 1RTHA 4M3ZA 4ID5B 3M9OB 2Y1IA 4RU9A 4QWDA 1FKPA 1C2PA 4I7FA 3U3YA 3KKRA 3NAIA 4FZZA 2W9BA 1NK8A 2RF2B 5C25A 4DTRA 2NUBA 2JC1A 4PUOA 1LW2B 1N6QB 2HHSA 4JLHA 3V6JA 2GUIA 2XRIA 2FVCA 2B5JB 3PY8A 4LH4A 3VQDA 4M3YA 1S9GB 1KRPA 2HHQA 3V6HA 1J53A 3GV5B 1RT5A 1JL2A 4FW1A 1NJYA 4CEOA 2G8UA 4NYNA 4URSA 1ASWA 4NLXA 2FLPA 3P83D 1WSHA 3T5LA 3C6TA 3K5LA 1RTIB 2O5DA 4ZTJA 5F8GA 4ECQA 1WSJA 3CFRA 2YNIA 5J2MA 4F50A 1ZBUA 3PUFA 4M95A 4EYHB 3VA0A 2IC3B 5HROA 2FBXA 2WB4A 4IKFA 3ZSQA 4CHOA 4XPCA 3V9UA 3PO5A 3L3VA 4BDPA 4DF8A 1WSEA 4ED1A 2AU0A 4Y3CA 5KFPA 4O4GA 1TK5A 3QZ8A 3QIPA 3WNFA 4TY8A 3HSTB 3KJVA 4FJKA 2W7PA 1S9FA 1JLCA 1FKOB 4B9LA 1NOZA 1BIUA 1D1UA 4DMNA 1S49A 2X6NA 3EYZA 2C22A 5CYQB 4ED6A 2YHAA 3NAHA 2KFNA 2BGGA 4QW9A 1QE1A 3AA3A 4EZ9A 2FJVA 1DTQA 1KVBA 1NNDA 1NK6A 2ASDA 3NFAA 1REVB 5FDLB 4N5SA 3I0SA 3OS2A 3LP1B 3MFIA 1RBUA 2AX1A 2R8IA 1B92A 3HT3A 1SH0A 4W5OA 4DWIA 3SCXA 1KLMA 1EXQA 5KFYA 4TQSA 3PVXA 3P1GA 3NGIA 4DS5A 4CEAA 4JS5A 3BSOA 2FC0A 4IDKB 1ZTTA 4WXOA 2JGUA 3OYKA 3AVHA 5DK5A 3M8QB 3KLEA 2EX3A 3VN5A 4NLYA 1JKHB 4ZP8A 3SYZA 3UPFA 2KW4A 4CGDA 2FVSA 3V1RA 4QOZB 1WNEA 4GVMA 2G8WA 1HJRA 2HMIB 3NF7A 4TSXA 3BREA 4B9SA 3RR8A 5KT5A 4CFAA 4FLYA 3WNEA 4YP3A 2AWZA 4KHRA 3LZJA 1D0EA 2XO7A 3I5AA 4MK8A 4CGFA 4CJ5A 4ZPAA 5KG7A 4KI4A 4CJQA 1IKVB 4FLVA 2YKNA 3IRXA 4FCYA 4DTMA 4KKOA 1N6QA 1RBSA 3TQ1A 2YHBA 4EP4A 3VQ6A 4KSEB 3GV8B 1S9GA 4F3TA 4ZPDA 1JXEA 4DFKA 3QETA 4KO0B 4CEZA 5DQGA 4RW7A 3QGIA 4GMJB 5KG0A 3S3NA 4KREA 4AHCA 3MEEB 1CLQA 2G8KA 3EPGA 2BANB 4DFPA 2ATLA 4OVLA 5KGWA 4RW8B 1JLEA 4JS4A 4J9NA 2IC3A 4C8KA 3AVMA 3V9ZA 3CJ2A 3LP3A 3JYTB 1T3NA 3Q8SB 2WHOA 5HRNA 1TK0A 2I5JB 3GIJA 3BGRA 3NAEA 1IKWB 4ZHRB 1K1SA 4FLXA 3V6DA 1TV6B 4CCHA 3HP9A 2R8HA 2O4GA 4CJPA 2DTUA 5DMRA 4K4VA 1IM4A 1SUQB 3PW0A 3BJYA 3DLGB 4J9LA 1HPZB 4Z4EA 4B9UA 1RBRA 1XC9A 5HLFB 3CJ0A 3VQ7A 1KFSA 2P51A 4KAZA 5CYQA 5EUHA 2OH2A 1S9EB 3KLHB 4B9NA 1QAJA 4ECTA 2G8VA 3M8PA 1A5VA 3IS9A 2Z1IA 3NH2A 5FDLA 4NLPA 1TP7A 4DL3A 4RNMA 2D5RA 3VQSA 2F8EX 4KHYA 4Y2AA 3OLAA 3I5BA 3MFHA 1TKTB 3MEDB 1K6YA 3RRGA 4L8RB 1RBTA 2BQ3A 3G6VA 3H4BA 3LP0B 3N6NA 3M8QA 3OY9A 3U6FA 2KFZA 4EP5A 3CQ8A 4NCGB 4HUFA 2VG7B 5KFBA 3KKSA 1RDDA 1VSFA 4HVJA 4RNNA 1HQUB 2GV9A 1C0TA 4IRKA 3CWJA 3RMCA 5L1KA 2CJQA 5FRMA 1NJWA 2ASLA 4CHZA 3DOKB 3NH1A 3ITHB 2OYQA 4OPJA 3ISNC 2D0CA 4DSIA 5KFMA 1HQEB 5DQIA 4DTSA 1RTJB 1ASUA 2X74A 4NRTA 4BWJA 1OS5A 1WLJA 2W9CB 2QXFA 3NMAA 4HKQA 3K58A 4NLSA 5F8IA 4Q45A 3S3OA 1IKVA 2VWJA 1O1WA 2UUTA 2G8IA 4B8CA 1RDAA 2E6LA 1QQCA 2XY6A 1LW0B 5FRNA 4ECYA 4IH5A 1Z25A 4M41A 2KZMA 1T03B 2C2EA 3SV3A 3E01A 4O3QA 4YR2A 2ALZA 3MECA 3SQ1A 4E1NA 5CYMB 2X78A 2IAJB 2IJNA 1JXBA 1S6QB 2F8TA 1JLBA 5J2PB 3DRPB 1EP4B 4YR0A 3ASMA 2D41A 3MXJA 4CF8A 1NK7A 3MEGB 4FM1A 4DU3A 5KFOA 3HK2A 4RW8A 4TYAA 3AVCA 4KHNA 5K14A 5HRRA 4YR3A 3B6OA 2R2TA 3O3FA 4ZVEA 4EO8A 3CFOA 1T8EA 1RTHB 5KFNA 1B9DA 2OZSA 4F3OA 2I5JA 3RBEA 4ZHRA 3OSNA 4B8AB 3OYDA 4Y1DA 3T1AA 1VSDA 4DTOA 4OKJA 2W9AA 2W42A 4FJ8A 3PW5A 2V0NA 4QCLA 3K57A 2FVRA 4I9QA 4O44A 1RDCA 1RT2B 1I6JA 3E51A 2UVWA 4OGCA 1QSSA 3TAMB 3DLBA 4M42A 2R8KA 3VQ4A 2W9BB 4DTXA 5C25B 4BE1A 4IG3A 1CXQA 4PUOB 1RT7A 4Y34A 2XWYA 2B43A 3T5JA 4DF4A 2YNGA 3SPYA 4WZMA 1RDRA 1J5OA 1JLAA 1MMLA 3QESA 4KHSA 4CEFA 1BISA 2VG6B 4E7LA 3C6TB 1W25A 4EBDA 4TLRA 2A1SA 3UDLA 1RA6A 2YNIB 5C24A 1VSKA 1T7PA 4PWDB 2JEFA 1SV5A 4I2QA 2V9WA 4F2RA 4JV1A 4MK9A 4DFMA 3K59A 4FJGA 4NCGA 3IGNA 1JIHA 4QWAA 3VQPA 4H54A 3H5YA 2DFHA 3V4IB 5I3UA 2ZKUA 2PY5A 2OPRB 1J54A 2UVUA 3QO9A 4O4GB 4DL5A 3QIPB 3SI8A 4HUGA 4LQ3A 3KJVB 1TVRA 3OVNA 3SUQA 1JLCB 3GV7B 1EETA 3D28A 1LAWA 5KT4A 2OPPA 3OLBA 2W9CA 3DI6A 3NF8A 1QE1B 1DTQB 2ZD1A 3BQ1A 3BQ0A 4O3PA 3H5UA 1U49A 4W5TA 3O4NA 1LWCB 4AILC 5KFZA 5DGAA 4ED8A 3H59A 3I0SB 4FK0A 2AGPA 1NK0A 2HWHA 1KFDA 4CGHA 4CGGA 3KMSA 3HVWA 1KLMB 1HYSB 1RTDA 1U48A 4J2EA 3G0ZA 4WYLA 4FS2A 3AA5X 4K8ZA 4ECSA 4RUAA 4ZMMA 1XHXA 3KLEB 3NKYA 3RAXA 3V9WA 1S6QA 4I2PA 4TQRA 3RTVA 1HYZA 3I5CA 2C2RA 1UA0A 5DLGA 4EBEA 4EO6A 4CJVA 4O3RA 1TL3A 1XI1A 4ECWA 2IA6A 3HM9A 1SKRA 3SJJA 4FJ5A 4N47A 4BDZA 3TI0A 1IKXA 2DFEA 2HB5A 4DL6A 2YKMB 3KMQA 5SZTA 4CEEA 3BDPA 2CKWA 3PX4A 4B9VA 2XC9A 1G15A 3AO5A 1RT2A 3TAMA 2KTQA 2GBZA 4QWBA 3KHGA 5KTQA 2X6SA 2YKNB 3IRXB 1IG9A 3L2UA 4DSKA 4KKOB 3NGZA 5F8MA 4M3UA 4MKAA 3QEPA 3H4DA 4FZXC 1K1QA 3PV8A 5J2QA 3V81A 1Z4UA 2PYLA 1TKXA 2D0AA 3CDEA 5KFHA 3CVKA 4FJIA 2B4JA 3THVA 4YQWA 4JRQA 4OKKA 4IFYB 4KBIA 3OL7A 3VQQA 3BSAA 3RB3A 3MXMA 2UVVA 4RW7B 3KD5E 2VG6A 3RMBA 3K5MA 4DSLA 4NYFA 2W8LA 4CGJA 1L3VA 2AQ4A 3FDSA 3G6XA 4CESA 3ULDA 4N41A 4LSNA 4PWDA 4ELVA 1JLEB 4F2SA 3VQ8A 1SH2A 4CK3A 4K8XA 3KK3B 3FFIB 4QWEA 1KCFA 4Q43A 4ZTFA 3V4IA 4ECVA 4PY5A 3BGRB 4CGIA 3V6DB 2OPRA 4W5RA 1HNVA 3HPHA 4KFBA 4F4WA 3QEWA 3U3GA 3DMJA 5J1EA 2DFFA 4DL2A 3HXMA 3MXIA 1QHTA 4E19A 4BE0A 1KHWA 1D9DA 1S0OA 2KZZA 3M8PB 1NKEA 4DL4A 1XWLA 2AX0A 2BRLA 3VQ9A 4DTUA 3IS9B 1XR6A 4CK2A 5KFFA 1LWCA 3QEVA 3PR4A 3QNOA 4CJUA 1S0NA 4GC6A 4KHQA 1BQMB 5L9XA 4RUCA 4Z4CA 1SL2A 3AVFA 2B6AA 1XR5A 4RW4A 4CEDA 1FK9A 5KFCA 1QS4A 5SWMA 1HYSA 4DQQA 3PX6A 3EZUA 4KAIA 4H4MA 4Q5VA 1S1VB 1VK0A 4IFVB 1R0AA 3Q8RB 5KFSA 3KHLA 2DPJA 4K4UA 4QPXA 3HVAA 5CY4A 2WOMA 3HVRA 2WK4A 3ZSWA 4Y2CA 1KVAA 1RT4B 1C0TB 4Y1CA 3DLRA 5HP1A 2W7OA 4FJLA 3C95A 1DLOB 4FJ7A 4KE5A 3CM6A 3OYMA 3OYLA 4R8UB 3OJSA 4RNHA 1IKYA 1S1XA 2IOCA 2BDPA 4FXDA 2FJXA 2YKMA 4DLEA 1RT1A 3GIKA 4J9PA 3SUNA 1NJXA 4AHVA 2G8HA 4Z4FA 3ZT3A 3KLFA 4EBCA 1L3TA 3OS1A 2C2DA 3CIZA 3T5HA 3O3HA 3KHHA 1BCMA 2YV0X 3MR5A 3E01B 5D3GA 1IO2A 2IGIA 4IFYA 3MECB 1JLGA 3OHAA 4M94A 1YVFA 4CJKA 1S1WA 3AA2A 3QERA 4FLWA 3IG1B 5HRPA 3NF9A 2ILYA 1JLBB 4B9TA 1C1CB 4MQ3A 4HTUA 4DQSA 2JEGA 3ALYA 3I8DA 4MH8A 1X9WA 5E41A 4WZQA 4M3XA 1U47A 5K14B 3TR8A 3KK3A 3FFIA 3H08A 4N56A 1KTQA 2RPIA 4DTPA 3M8RA 3V1OA 4OPKA 4RNOA 4NYZA 4ED0A 4C8MA 3IAYA 1S1TB 3AO2A 4DQPA 3GIIA 3D0PA 4AHTA 1JX4A 2VWKA 3KIOA 1EX4A 1ITGA 4XIUA 4O44B 3T3FA 1D5AA 1XHZA 4HCCA 3QIOA 4NRUA 1N48A 4IG3B 4WFYA 4ZPBA 3OHBA 1RT3A 1RT7B 4Z4GA 3VQ5A 3H2LA 2P5GA 3NGYA 2YNGB 1WAJA 4C8LA 2HNDA 4CJEA 5F9LA 3HPOA 1J5OB 3JSMB 3TAQA 1JLAB 3DDKA 5KG1A 4CK1A 3HKWA 1EKEA 1BQMA 4OKEA 3FQKA 3CO9A 5KG3A 3GIMA 1Z26A 2P5OA 3OYHA 2Q3SA 3BSNA 3LPUA 4G3IA 5EDWA 3IN5A 4O3OA 5C24B 5F8LA 4MK7A 5EWGA 2YNHA 4NCBA 1SV5B 4CF9A 4I2QB 1S1VA 4IFVA 4HYKA 2V4RA 3HPGA 4MKBA 1ZBHA 5I3UB 1RAJA 2FBYA 2FVQA 1RT4A 2ASJA 1WSGA 3K5OA 3ICLA 3KHRA 3QO9B 4K4TA 3PJWA 4NLVA 5KFQA 3L2VA 3FSIA 1DLOA 4JV2A 1TVRB 1VRUA 1EETB 4Q44A 4ZP6A 4R8UA 3QINA 1UA1A 4MFBA 2OPPB 3SI6A 3DI6B 4MIAA 4FK4A 2XI2A 4CE9A 2ZD1B 3CFPA 2QKBA 3NBPB 1C0UA 4M45A 4CJSA 1QTMA 4IH6A 3MR3A 4LQ9A 1RTDB 2R2SA 2WONA 2O4IA 1YT3A 2HHVA 1SKWA 4KB7A 3IG1A 4ECXA 2HAIA 4I2PB 4NLGA 1D8YA 4OJRA 4RW6A 3AVGA 1C1CA 4CIGA 2YNFB 4HUEA 5KT3A 3H40A 3RMAA 3H5SA 1WN7A 2BQRA 3KLGA 3LANA 1RCHA 1TL3B 2D3ZA 4AH9A 2ZE2A 1GOCA 4NLRA 4B9MA 3VQBA 3P5JA 3LZIA 4AHUA 1NK5A 1HYVA 2XY8A 2OA8A 1S1TA 3DM2A 4FLUA 4CJLA 3L2RA 4CFDA 2XI3A 4RZRA 1IKXB 3AVIA 3WNGA 3V6KA 2J6UA 4N76A 3LP2B 3QNNA 1U09A 1C6VA 4W5NA 2E6MA 2V4QA 3DRRB 2J6TA 2D3UA 4ZVHA 3N6LA 4CHNA 3PX0A 1BQNA 5J2QB 3V81B 1TKXB 2R2UA 5KT7A 4KTZA 3PZPA 4E89A 3B6PA 3GQCA 5KG6A 4F4XA 1QSLA 3JSMA 1WSFA 3KK1A 4B3OA 3RB4A 4CJ3A 3DLKB 5KG5A 4C8OA 4ED3A 5EU7A 2IDOA 1S97A 5DGBA 4CJWA 3UR0A 4OLBA 2QK9A 1KSPA 3NDKA 3K5NA 1HNIA 4LSNB 4DL7A 3EZ5A 1VSJA 4CJFA 1C1BA 5L1JA 3HVTA 4FK2A 4PQUA 4K50A 2EHGA 2WCXA 5KFXA 3OJUA 3KLIA 4CEBA 2FBVA 4JUZA 5I42A 3SV4A 1HNVB 4DSFA 4KHUA 4KFBB 5JS2A 1KLNA 4NLDA 4LY7A 4FVMA 3SQ0A 3DMJB 3H5XA 5J1EB 4DS4A 5KGXA 1ZBLA 2XGQA 2P1JA 1JL1A 1VRTA 1ZETA 2W8KA 4MIBA 2OPQB 4CF2A 3KNAA 4YFUA 3LALA 3RAQA 1ZYQA 1T05B 3NHGA 1S4FA 3O4QA 3NBPA 4J2BA 4JV0A 3VA3A 3LWLA 3CJ5A 4CEQA 2BR0A 3QGGA 2E9TA 1X9MA 3ZSVA 5KFTA 2B6AB 4RW4B 1FK9B 4YNQA 1TAQA 2F96A 3DRSA 4Q8FA 2IS3A 3V9XA 1UWBB 4H4MB 4X2BA 4CF0A 1JLFB 4DQIA 5F9NA 1R0AB 3OYGA 3TVKA 3A2FA 1NHVA 3ZSZA 4DSEA 2YNFA 1CZ9A 2WOMB 1N5YB 2BQUA 4DQRA 3OL6A 1S10A 3MF5A 3AO4A 4DTNA 5HP1B 4LH5A 2VA2A 2XCAA 4LSLA 2HHUA 4E0DA 3Q8PB 4FJHA 4KHWA 5DG7A 4M3TA 3TWHA 3AV9A 4DG1A 3TAEA 1L3UA 1NOYA 1IKYB 1S1XB 3QYYA 4E7KA 3G10A 1RT6B 1W9HA 1LWEB 4IH7A 5KFJA 1RT1B 4R5PA 3L8BA 3LP2A 2AJQA 1TKDA 4URGA 3DLHA 3KLFB 4XO0A 3DRRA 5DG8A 5EWEA 3TAFA 4OL8A 4ICLA 2PYJA 2XGPA 1S1UB 4TN2A 4O3NA 3LDSA 1N4LA 5D3GB 4FM2A 4DFJA 4GC7A 2Z1GA 1JLGB 4G1QA 4RW9B 3BQ2A 3ZT4A 1S1WB
chains in the Genus database with same CATH superfamily
3DLKA 3G82B 3ZTQA 1Z05A 3BBCA 5LL6Z 1OQ3A 3N5FA 2CVIA 2G2ZA 3NE6A 3MI7X 5M2PA 1FEEA 2HNYB 3W5ZA 3S6EA 1WOQA 2DY4A 2HBRB 2GQ2A 4E8UA 3QIDA 3I0RA 3SAFA 4ZP7A 4DUYJ 3CCJN 1HBMA 2LVWA 1S6PB 3M6WA 3DLEB 3ETOA 4CFCA 3WXMB 5DLFA 1C4AA 2XBPA 3EL2A 4H5TA 4CBUA 2CVEA 1K8AO 1LAVA 4WFBL 1N8RO 3BGLA 1RHJB 4NXMK 5C42A 1MW7A 1ZM9A 2HVHA 2H3EB 2KVIA 1FJCA 3CJ9A 2RN2A 1YXQA 2R8JA 2R7XA 3FFKB 2UZAA 1IG8A 5EY4A 3C14B 2CQ4A 2WZ1A 3KFWX 4FF2A 3CDWA 1HA1A 4M63C 5KAKA 3W5XA 4WIIA 4FDFA 2PFDA 1MWKA 2IJRA 1BGXT 5A76A 4OJ3A 4UQGA 4JKGA 1VQMN 3T5KA 3GONA 3K5PA 4NZ7A 3ENAA 2E5HA 4GNIA 4CFBA 3R1HA 4L74A 1YVUA 1N5YA 4JI6F 4AXJA 4DEZA 3OBWA 1OH6A 2COLA 4C98A 4ED7A 4EHUA 3L7UA 4CZMA 2QE5A 4R79A 4P7TA 4F4ZA 1EKRA 1KQFB 3F9KA 1YI2S 4EZ6A 1RT6A 4I64A 4G1IA 4CHQA 3J7ZO 2UUAJ 5DDQC 4GV3A 3DGPB 3R2CJ 1LWFA 3QBCA 3VWSA 2ROPA 3VOVA 1HKAA 4WCEQ 4C8ZA 4J9QA 4PZVA 2LQBA 4QYZK 1GLJO 3LAMA 2ZJQL 3S41A 1DRZA 1SKSA 3MCOA 2ADCA 3UE5A 3HJFA 4E2FB 1U6ZA 2UXDK 2DR7A 3NS5A 5AZJA 1GMWA 3CJ3A 4IG0B 3OVSA 2RF2A 8AT1B 2HSEB 3KK2A 5DZ7A 1LW2A 2VPXB 1NH8A 1UW9A 4DXLA 1Y97A 2OEKA 2DCLA 5K9FA 4BC3A 2F8SA 3U02A 1N5VA 1N5QA 3TANA 4IR1A 2IPOB 3QRPA 1TK8A 5H9FJ 5IT9U 1VSIA 1BI4A 1D9FA 1S48A 1NPRA 4NASA 2YWHA 3LPTA 3C94A 1BL3A 5T41A 2YVSA 3H98A 5KFDA 2P9PA 4Z4HA 3MMBA 5F8NA 4W5QA 2AYMA 1K73T 3ZT2A 3MCSA 1R59O 2EWSA 2CQ2A 4ZP9A 2MQQA 3E9OA 2H51B 3W1YC 3HO1A 3QFHA 1N0UA 3QZ7A 4DR2K 4EAHD 4FW2A 4ISGA 2A1RA 2XZTB 4RCHA 4A8XA 5I9EB 3O8MA 2P9EA 3KK1B 1LK5A 2DNLA 3NGSA 1YRTA 3ZSXA 2RNEA 4FP9A 2MSTA 2KM8B 2HBQB 1Q0NA 4UW2A 3N6MA 4QS9A 1X4EA 1SZ2A 2GTDA 4LIRA 1VRQC 5D0RA 3MEKA 2DPIA 1WWHA 1XR7A 5H1SV 1D3WA 4J9OA 1CJTB 3WDOA 5BR8F 3KLIB 3MUVP 4C11A 4YN3B 2KG1A 4OPHA 1VC0A 5F41A 3MTJA 4X66K 5J2NA 3O1WA 5FLXY 1RQ0A 5AJ3F 4O8UA 1JKHA 3DNCA 4K4ZA 2EFPA 2FHJA 3AO1A 3SBGA 2YX6A 1TL5A 2F9DA 4DR2J 4DR4J 4BR7A 1IQZA 5FROA 3CC4N 1N32K 3LTOA 2HMIA 4DHYA 5E3PA 5L46A 3M05A 3SZ2A 2OCEA 4DV6K 1U45A 1ZC6A 2RRNA 2R7YA 4I6MA 4Q2MA 1ZBFA 2RILA 1C0FA 3C16A 4BRCA 3ONQA 4JI8K 3DRSB 4ID1A 1U04A 2B4UA 2WVCA 3U7JA 5CZ2A 4WFXA 3AODA 1UVKA 3VAFA 2WSFC 1BIZA 4GKKK 1J27A 2FPHX 4E7JA 3RB6A 2KHOA 5IWAK 4X66J 2ABYA 3H25A 5E84A 2E9RX 3HZ6A 2R42A 1FDDA 4YMEA 1CS4B 4IR9A 4DG1B 3FRYA 3AD8C 4LFBK 4HT5A 4FS1A 3AJDA 3HRGA 4B08A 4JI3K 4A8YA 1UOCA 1UAWA 3VGLA 4E3SA 1YLXA 3ELHA 3FQLA 4EWTA 1KDNA 4YY3J 4FJXA 3MWPA 4FWKA 3L3CA 4HT7A 2V7YA 3VF2A 3PNIA 1IKWA 3J80Y 1HW8A 1RADB 2E1CA 4ICLB 1AUSL 2HG4A 1RKJA 2ZDPA 1SUQA 3GYGA 4IEIA 5KFLA 3BZCA 4WE1A 4IOBA 2KKHA 5DG9A 3TJ9A 1OWXA 3PRDA 4GKKJ 3HL8A 2Z30B 3PSIA 3T41A 3PM9A 5IWAJ 4OI0A 1RAEB 1P8ZA 3CDUA 3PO4A 4H5WA 1Q8KA 1WDDA 2QWLA 3Q8VA 5KT6A 3RG6A 2Z1HA 5JVGL 2OFGX 5GAEU 4WXWA 3I0RB 2HIQA 1VHIA 4LFBJ 1OYDA 1GOAA 1NEEA 1R3NA 3PYFA 3R7SB 1RAGB 1HBMB 2UP1A 2ZGZA 2J7WA 3NGDA 2ZM6K 1VQLN 4FJJA 1RHRB 1JNRB 4JB8B 1I3AA 2ZBIA 3PW7A 2EC0A 5B0EA 2RDJA 1S5JA 1EARA 2VICA 5C42B 4UY8T 5GAEI 3P49B 2EBEA 2OELA 2RUSA 4X65F 1W0HA 5T7BA 3QLHA 1RWWB 6FDRA 4NOHA 3M8ZA 4QAGA 3VEWA 2GC8A 3Q8QB 4E7IA 1HQEA 1YF5L 5KFKA 2CQ1A 5J1NA 4DV2J 1EKSA 1NK9A 2QA4G 2EW9A 5KQDA 1GMWD 4BR2A 4ZS6A 3OFEA 4U9RA 3G9CA 1H6KX 4YOUA 4JKGB 5KFUA 1LEOA 4F8RA 2IFXA 2AT1B 3CC2N 3WZ0A 3V5RA 2PBDA 1Q9YA 5J2PA 3DRPA 3GFYA 2P9LB 4JI0F 4Y2IA 5JVHL 5L9NA 3MEGA 1Q18A 2M70A 2FLNA 4NZ0A 4YDDB 1LWFB 1Z2ZA 3T1HK 1FTRA 2CH5A 3OYBA 4DHVA 3A5MC 5A6PA 2J0WA 5F0UA 2AF6A 5IT4A 3DLJA 1NMNA 1C2PA 4C0BA 1RAAB 5AXKA 1NGHA 4H03B 5AZJB 2RF2B 2M88A 5C25A 4DV0K 4PUOA 1LW2B 1N6QB 3GFZA 1E3MA 4B1VA 4Q2LA 4B3MK 3VQDA 4B3RF 3V6HA 1J53A 4BC5A 4U95A 3ETMA 4LF9J 4URSA 1A9NB 4NLXA 5ETNA 1WSHA 2EG1A 3C6TA 2F8HA 4TVAB 1Q81O 4WJBA 1EX8A 2MQ8A 3CFRA 8ATCB 4HDHA 4PXEA 3PUFA 2Q6CA 4EYHB 4USJC 4R25A 2P9PB 5HROA 1T9YA 4C48A 2FBXA 2WB4A 3FEYB 5D0GA 3ZSQA 4XPCA 3MMBB 4CHOA 3SLCA 5LMUJ 2A0FB 3R6LB 1S4EA 4DF8A 5IT0A 2AU0A 3K0JA 4O4GA 4NXMF 3QZ8A 1FE0A 4C7QA 2X1BA 2W7PA 5BN8A 4WCEL 1JLCA 4B9LA 2BM0A 4B9QA 1D1UA 3NP5A 3EYZA 4USWA 4B3MJ 3NAHA 3ENVA 1W97L 3EO3A 2FJVA 1DTQA 1CJVA 4F02A 3UDCA 2Y1LB 2AX1A 4H0PA 2RE1A 1KAYA 1SH0A 5GINA 4C11B 4KBOA 4C3KA 3NGIA 4IYQA 2FC0A 1ZTTA 4WXOA 5DK5A 3M8QB 4LF6K 1DURA 1JKHB 3SYZA 2IA0A 5IQ6A 2FVSA 3D7EO 4DX5A 4LIWA 3V1RA 4GVMA 2G8WA 2MJNA 2A2DA 2HMIB 3NF7A 1HLUA 4TSXA 2CPIA 2BKOA 1U1LA 2JDJA 4WFNQ 2AWZA 4KHRA 1K9MT 2EEYA 1E4FT 3C16B 3I5AA 4CGFA 1HD1A 4A8WA 3O80A 4KI4A 4PXCA 3CXCR 1WB9A 4BQZA 3PLAA 1PYTA 2JJ4D 2NZTA 5F3TA 2YKNA 3IRXA 4FCYA 3ZTRA 2UXDF 2HZVA 1VHXA 3N9UC 2XZDB 3CF5Q 1HNZJ 3GCXP 1FJGK 3GV8B 2QYGA 1JXEA 1B4SA 1OIAA 4DFKA 2HFVA 4CEZA 4RW7A 2DITA 4KREA 5HJXA 4IUFA 1YJ7A 1U02A 4DFPA 3W2VA 1S22A 4JI1K 1QVGM 1NG9A 4OV1A 4RW8B 2XSFA 3NOCA 1WEYA 1FRLA 3EUNA 1FO1A 1MROA 4ZCKA 4PABA 2NNWA 2QX0A 3CB4A 4E1JA 2MQLA 2MXYA 2H5JB 3FEXB 2GCFA 1TK0A 1IKWB 4CCHA 2X3DA 2R8HA 4LFCJ 3CD5A 1IM4A 1SUQB 1WHXA 2GVDA 5HATA 4JNEA 2V94A 3G6EN 1S77D 2KO1A 2HKEA 2HBZB 4B9UA 2GMLA 1XC9A 5MAOA 5EUHA 4B9NA 5D77A 4ECTA 1T44A 3T9ZA 4ES1A 3T1YK 4PKHA 3ZZZA 2AIRB 4PXBA 2CJXB 4FF3A 5FDLA 2LYVA 5K8PA 5HMYA 3FCWA 3DOMA 2MY8A 4PAAA 4B1ZA 2D5RA 2RVJA 3OLAA 5C2FA 2EFQA 1AYEA 1RBTA 2BQ3A 3G6VA 4QYRA 4KHPF 2RUGA 2CG8A 2L41A 9ATCB 1F3FA 4W98A 3WBZA 5TKWA 1TL7B 2CWKA 4ETZA 1WG1A 5KFBA 3LDOA 2WW4A 3KKSA 3UVJA 3R5DA 1TMJA 4K2XA 1DFDA 3O2IA 3AQPA 2C2NA 1O0PA 2F4VJ 3CCVN 3KXDA 3D6HB 4OPJA 1N32F 1HQEB 4RLEA 2J9DE 3ILJA 4YOTA 2PEBA 4PKGA 1YJ9N 3E9PA 4DV6F 3QICA 2QXFA 2DVIA 4CT8A 3PIPL 3K58A 3S3OA 3RBZA 4JI8F 3SQOP 2VWJA 1O1WA 2YHXA 1QQCA 2DPNA 5FRNA 1K73O 4FVUA 3D6TB 4HEA9 2QW9A 3HKZD 2ROGA 1RHQB 3AJ1A 3MN5A 5J2PB 3DRPB 2V7ZA 4HVZA 4CM0A 1NK7A 3ULHA 3MEGB 4CTAA 2GEMA 2CGLA 4DU3A 2RQ4A 2DRDA 1VR6A 3BYRA 2J9DA 3M8YA 2ZBRA 2NSBA 1IV0A 2R7QA 2RU3A 4WP9A 4IXCA 2I5JA 2UUCK 4CLUA 3T1AA 4DTOA 4A2AA 3MXHP 3WC0A 4I9QA 3THPA 1QSSA 3RUBL 4M42A 2R8KA 3UB5A 5C25B 3TU5A 4PUOB 3J80U 1V5IB 2XWYA 5CA5A 1U1KA 1JMTA 3T5JA 2XHCA 4DF4A 3SPYA 1M1KT 1KBRA 4X64J 3MM8B 3ZZOA 3TUZC 4KHSA 1BISA 2VFSA 3HMJG 4E7LA 3C6TB 2GIFA 4FOEA 1TYQB 1M5PC 3D2WA 2ERRA 3UDLA 1Q7YT 1T7PA 3A3NB 3AD9C 5CAAA 1M0SA 3Q23A 3JB9k 4I67A 2QO3A 2ZM6F 4NXNK 4NCGA 3V4IB 5I3UA 2ZKUA 1XQSC 2OPRB 1J54A 1WG4A 1S7HA 4O4GB 4ID8A 2OEMA 2QFJA 1JLCB 1Q82T 3WIUA 2GZOA 1RAFB 2X1FA 3VENA 5IS2A 4DCOB 1R6YA 3DI6A 1AT1B 4IOCL 1VLOA 2DNKA 3RZAA 1WBDA 1DTQB 5GAGU 4WP3A 3LUYA 1MLAA 2E1ZA 3BQ1A 3BQ0A 2K06A 2OFHX 2MKYA 1CJVB 1U49A 3O4NA 3W9JA 1T02A 1GAOA 2HWHA 3GDQA 3N4WA 4ILGB 2RT3A 3KMSA 3LPEA 5E33A 4HWIA 4CZLA 2WVDA 1VK3A 1XHXA 3VF0B 2DXEA 4X65J 5GAGI 1N54B 4I2PA 4DV3J 1HYZA 4ILLA 2B7BB 1UA0A 1MA9B 2ALYB 1ATSA 3QSIA 3GYXB 2DR6A 3J8AA 3PJ9A 1RUSA 3Q86A 3UO0A 9RUBA 4M7YA 2BJ8A 3HM9A 4WU3A 5KQ8A 2NXEA 3AOCA 2EI5A 5J1PA 1RCOB 4LRCA 3D7SB 3T1HF 2BV3A 3ZTOA 3ZXWA 1ATRA 1IKXA 3KMQA 4ISEA 3BBFA 4FZVA 3B4MA 2PEHA 3ZNJ1 2KT2A 3J7Z5 2YKPA 2KTQA 2X6SA 2YKNB 3IRXB 3L2UA 4XK8C 3NGZA 4PWUA 2IVYA 5F8MA 3QEPA 2GJ2A 3H4DA 3P38A 4RWTA 1K1QA 3PV8A 4CJ7A 1Z4UA 3C2PA 2ZOFA 2D0AA 2QLBB 4M5LA 2Z56B 4UY8O 1SC6A 2UU9K 3OL7A 2MKCA 2UVVA 4RW7B 1HBNA 2Z58B 2KH9A 1VBZA 4USUA 1OY9A 1L3VA 2AQ4A 3W2VB 3G6XA 2ZH3A 1J6ZA 3CMQA 1YRUA 2B4OA 1UJ4A 4F2SA 2PGCA 3WC2A 3LO3A 4EFHA 1SH2A 1MROB 4K8XA 2M8HA 3I31A 3FFIB 3CCWA 2P9GA 3SAGA 2CNLB 3UN5A 4BS2A 2P6TA 1QD1A 2V34A 2NRXA 1HNVA 4KJIA 3UR3C 5L8RC 3IR5B 3CGIA 4DPWA 3QEWA 3CQYA 3NMUA 3DMJA 5J1EA 5M2UA 3K9JA 2DFFA 4B3RJ 1QHTA 1GLAG 5AQUA 3W9IA 2KZZA 1UFWA 4DTUA 4CK2A 4ILMA 3R6GB 2HFSA 3GPAA 2VFTA 5D0HA 4CJUA 3DOMB 4KHQA 5HQMA 1SL2A 1DQ9A 1EO1A 5HVFA 3AVFA 3RAMA 4RW4A 3FGUA 4ZVTB 5SWMA 2XMTA 1IM6A 1BWVA 4CBXA 4H4MA 4LRFA 1S1VB 1WF1A 1R0AA 2V68A 4CH1A 3UKRB 1ZH5A 5A8WA 2B8QA 4FWOA 1PAUB 3CPWM 4F0KA 5D4PA 4Y1CA 4IOXA 3BH7B 4MO4A 4LVNP 1FVSA 5IOLA 2ZHBA 1WDTA 1O13A 2P9CA 1U8SA 4R8UB 4RNHA 3R27A 1IWAA 4FXDA 2QWRA 1OQ6A 3OR1A 4HI2A 1IR0A 3VEZA 1ZPWX 4DV7K 3GIKA 1U1PA 5RUBA 3OS1A 5SUHA 3CIZA 4UOFA 3T5HA 2E1MC 2HHPA 3KUGA 4CYUA 3FZHA 1X7VA 3UCGA 1FJEB 2VUGA 3LF0A 3MR5A 5D3GA 1MWZA 1XK8A 1BLUA 1ILYA 5K20B 4M94A 4CJKA 1S1WA 3ZC4A 3QBWA 4PKIA 3QERA 4G9ZA 4LF7K 1GLDG 4DQSA 2HRUA 1QQMA 3I8DA 3WIVA 1V3RA 3P45B 3TTCA 5AQJA 2AJ2A 2DR5A 1HNXK 4JI1F 2VDHA 1AB8A 2KXHA 4CLLA 5DDRC 1UFKA 2VYPA 3KK3A 3CCUS 2RPIA 4DTPA 3M8RA 1T11A 2IMOA 4NYZA 4ED0A 4C8MA 2FY1A 3IAYA 2Q1NA 4DQPA 2J8AA 4P9SA 1TELA 1HI8A 1JX4A 4AQYJ 3BKTA 3NLCA 3O44A 1OO0B 1ITGA 1FFSB 3UCZP 2H65B 5HL7L 1Y3KA 3A8EA 4HCCA 2LFVA 4CH0S 4NRUA 2GO9A 4USTA 1H38A 2EK1A 4WFYA 1RT3A 4Z4GA 3VQ5A 3H2LA 5E7OB 4JK8A 4GVBA 2KXFA 1JCGA 2LCWA 1ZPVA 4CJEA 3HPOA 5KG1A 4CK1A 1UZDA 5KG3A 3GIMA 1HNXJ 5EDWA 2A3JA 5F8LA 4K8RA 2KI2A 1VC6A 1K9MO 3IR6B 4DV5K 1TUWA 1PIEA 3HPGA 4K5RA 1HWUA 4M5GA 4MKBA 2E88A 5I3UB 1RAJA 1RT4A 2EG2A 3IAM9 2ASJA 3CHWA 1WSGA 2BUNA 3ICLA 3KHRA 1VQ4S 4K4TA 4PHTX 1R89A 4DR7K 2DY9A 2W2MP 3CCSS 3AGRA 2HQFA 1N33F 1JJ2M 1VRUA 4Q44A 1WEZA 4C0OC 1WC0A 1IBLF 3DI6B 1VQ6N 2AJ0A 4UQTA 4MIAA 1QAXA 2AJ1A 2K3KA 3VHQA 5GIOA 3HHLA 5HO4A 4DOZA 2WUSA 1WC1A 3QT7A 1HBUA 1RBLA 1XUPO 2K8GA 4LQ9A 1YSJA 4X4NA 4L3KA 3GLJA 4UOCA 4L75A 4MAKA 4NI2A 1YT3A 4JK9A 4P2FA 4I2PB 1IR2A 3DFEA 1D8YA 1C1CA 1M1GA 2YNFB 4I0WA 4CIGA 1H74A 2PI4A 4DR7J 5IQQA 3TZZA 1KQGB 1IWGA 4B9MA 3VQBA 3P5JA 1PILA 4JI4K 3J81U 5A8KA 4ZJQA 4J5OA 2NYHA 1S1TA 3MM9A 1H2TZ 4RZRA 1IKXB 3AVIA 1WHVA 2J6UA 5AQGA 2C3MA 3QAEA 3CCRN 1F6TA 5ETRA 2PMWA 3THXA 1WUAA 3NWGA 4JYAF 3PCOB 3DRRB 3BO2A 4F26A 3BH6B 4ZVHA 3N6LA 4CHNA 4F3QA 1BQNA 1WF0A 1FKAF 3MD3A 3J81O 2YPYA 1N5SA 2VKZG 2M7SA 3R8YA 3MDQA 4R0JA 1QSLA 1Y00A 4B3OA 4CJ3A 5KG5A 3NCQA 4B3TF 2IVPA 1VQ7N 2QWMA 2EBGA 2UUBJ 1LOUA 4CJWA 4OJHA 2BX6A 3UR0A 2QK9A 1Q79A 3NDKA 5E5NA 4JI2F 4NEZA 3EZ5A 2V4JA 1GMVA 4JI4J 3E1YA 4PQUA 4K50A 1K0VA 4NXNF 4DPXA 1HNVB 1UEKA 1I3OB 3VQTA 2VJVA 1QLNA 4NLDA 2CAJA 3OA9A 4PG4A 4FVMA 4A48A 3DMJB 3H5XA 5J1EB 4DS4A 2OLWA 2KJWA 1ZBLA 3TOQA 1JL1A 3KJFB 4MIBA 2FTRA 4YFUA 1QTNB 5AQPA 4PG7A 3POTB 3HZGA 3DHXA 1CULB 1Y10A 5BRHA 7AT1B 2WAQD 2W25A 5FPDA 2IVNA 1FRIA 2E9TA 3OVBA 2OSQA 5KFTA 1MMNA 3BPSP 4RW4B 2CPEA 2CNKB 2OGUA 4C0HA 1XNQJ 4H4MB 1TFYA 1GLCG 1R0AB 1ZBSA 3OYGA 4LF8K 1PJ5A 1G99A 1NHVA 3OFHA 4G1PA 2OD6A 1TFWA 1JJHA 2SXLA 4DQRA 4OI2A 2VF3A 4BRMA 3MF5A 3AO4A 2B3TB 4LH5A 2D0OA 2KLAA 2M8DB 1GLLO 5AQZA 4LSLA 1LK7A 2HHUA 4KHWA 1M1KO 5LOQA 3HX9A 3OUYA 3W0LA 1NOYA 4AE5A 3GWCA 3QYYA 4B17A 1EJ7L 4E7KA 3OR1B 2E2PA 2MY7A 3FJ2A 5KFJA 2XHWA 4QR0A 1QUPA 3L8BA 3CMAN 4CD1A 4DN9A 4WF9Q 2ZUAA 4ZIVA 1QY7A 1WEXA 5EWEA 2M0GB 3PKMA 2WB1D 4CYUB 5HQLA 2PYJA 1S1UB 4TN2A 4ZJOA 2VPYB 1MWYA 5D3GB 4DR6K 3CO0P 4RW9B 3HLUA 3UD3P 3ZT4A 1S1WB 2YCHA 2P9SA 4F0HA 2DY1A 4DSJA 2UU9F 4CO3A 3SFUA 4K43A 1VSMA 2D9PA 1Q82O 4XPEA 2MKIA 4NCAA 4GW6A 3QJPA 1A5XA 4HHUA 1PCAA 1TKZA 4ELUA 3QGHA 3N0VA 2ZH6A 2G0IA 2M2BA 1UEVA 4OGEA 4Z7YA 2OPSB 1SH3A 1D4XA 3ZSYA 1R8CA 2VFVA 2D3O1 1GH8A 1X4BA 4CT9A 3KOAA 2QSWA 1T94A 1OJ4A 4U7CA 5LT5A 2HHHK 4DL0C 1Q5YA 3M2VB 1RT3B 1N36K 4WYBA 2GGPA 3W2WA 3FSXA 4GVBB 2V8VA 3C0BA 4DUTA 3CJRA 4HR2A 1FJ7A 2ZC3A 2G0CA 3NF6A 3HHKA 4B02A 5DRKA 5B0AA 1UWBA 1N88A 3CC7S 1JLFA 3OXGA 4TU9A 4I6YA 3KLVA 4ZCLA 1WI6A 2QV6A 5CZVA 4NEYA 3H3OB 4MLEA 2DNYA 3VGVA 2D74B 2BA9A 3M9MB 1UCNA 1FE4A 3MPDA 4F7VA 3SSSA 2POKA 4QBUA 5KFGA 4CJRA 4OZLA 4M1KA 3HHNB 2QLWA 4IKAA 1NGIA 3H45C 1VYAA 1T9VA 4XAKA 3ZZYA 2OTLS 1VRUB 2KQ2A 4AHSA 2HHXA 4MO5A 1UETA 3BR9A 3WEEA 2RD5C 3SUOA 1X9SA 1UZHA 3UIQA 1BQXA 3OL9A 1RDBA 3OYEA 1LWEA 3T69A 3SQ2A 2Q3PA 1S76D 1XIQA 3IGVA 4KB1A 1RAHB 3AD7C 3MTKA 5C5JA 2HIYA 3TARA 5D78A 2HHTA 1YG0A 5ADZA 2E1YA 3TAGA 3EWGA 4DV7F 5C12A 5GMDA 1N34F 1NGJA 3GJSB 4ID5A 3PIOQ 3BYPA 4F4YA 1BCOA 4FOIA 3SMZA 4RNFA 2MPUA 2C28A 3QBXA 2VJUA 1Q8IA 3M2RA 4N7TA 2V8GA 1RXOB 4NI2B 4ZDNA 4F4KA 4KPYA 1RI7A 3QPIA 4K4YA 3DOLB 5K8MA 2EFVA 5FJ4A 2B5JA 1GOBA 4CF1A 3ZLJA 1QVFM 4LF7F 5IC4B 3CD6S 2ZNZA 2FHOB 2O67A 3QRQA 3VEOA 2ITGA 3DDIA 1R0CB 4U6PA 1Y11A 5A8KB 1QSYA 2P9KA 3TABA 1R8AA 1EAYC 1UTAA 1CXUA 1XNRK 2CWXA 4TXSA 2JFDA 4M8LA 1U7LA 3IMQJ 4E7HA 5KFAA 3CCSN 4H4KA 3VAKA 3THXB 3U27A 1AXQA 4FJMA 1MMDA 1TZ0A 3FBEA 4J9KA 2XCPA 3VQAA 1BQNB 4M3WA 3H3NO 3IFRA 3E66A 1TAUA 4K4WA 4OX6A 2XY5A 4B3OB 5KT2A 1PG5B 4FLTA 3WXJA 3OPKA 2VA3A 2PZSA 1CC7A 5JJBA 3AA4A 1MU2B 4WQ5A 3AAWB 2MLYA 3CMES 2V4JB 1REVA 5C2GA 4KV8B 2E5LF 2XY7A 4PQUB 2GWJA 4DV5F 2XSJA 5ETQA 3QEXA 4O0IA 3UN3A 1FA0A 5B08A 4J2AA 2IHR1 5G4DA 3M30A 4O0JA 4K0KJ 1SJ3P 4BR9A 1VQON 1C0GA 4P74A 1ZAWA 4IO8A 3CCLS 3KG0A 1S72S 5E3AA 3EE8A 4R0EA 5KG2A 2DK2A 2DTJA 3QWPA 1RU2A 4NMLA 1WAFA 3RRKA 3EE9A 1E4GT 4JKCA 1ZA2B 3CIMA 4CLWA 3K89A 3MCMA 4C8NA 4BRIA 4GVEA 4OX9J 2WTFA 4LRDA 4FF4A 3G86A 2BE2A 2AHOB 4QIEA 1VQKS 3GJRB 3PRVA 4ETXA 2VPWB 1QVGR 2VQEK 1WG5A 3LGNA 3IBFB 2OZMA 4WFAQ 3A8IA 1F5BA 3MN6A 4QW8A 4E1MA 2FZKB 3MM5A 4B1XB 3BKFA 3ZTSA 3C46A 5K8OA 4KPCA 1XEZA 2E4LA 2QTWA 3BN7A 3NNHA 1IXKA 2GIQA 5C10A 2XG8A 4U8YA 4ZK7M 3V9SA 3AB2B 1N33J 4BREA 4XH1A 1X5TA 2IDLA 1IBLJ 3VGKA 2GV1A 1UPMB 2UXBK 4LSLB 3D54A 4MKYA 1C1AA 2WSEC 2R8GA 1WOPA 1VSEA 3ISND 3B54A 4Z4IA 2BANA 1S6UA 3C66A 3CCZA 2WRMA 1SJRA 4CIEA 3LM9A 2RB7A 2B51A 2HQGA 2DGQA 4BG8A 3HDSA 2Y9HA 2G1HA 4CHPA 3O3LA 3AXKA 5KRSA 3HZEA 4Q0BA 2EFGA 1T6DA 1U6FA 5IFMA 4NLOA 1FKPB 4I7FB 4U96A 1N56A 4DV4J 3C3LA 5E3RA 4J9SA 1RGVA 2P9SB 1NDKA 3EGWB 3IP0A 4PA1A 4IWVA 2B0GA 2A1BA 3KLHA 1KAXA 3N79A 3NNCA 3N4QA 2XEXA 5LSLA 3TSUA 1B3TA 1RT5B 2OJ3A 2GX9A 1TKZB 4QIVA 3FCHA 3UFCX 1U2RA 3KUEA 3SQ4A 2XNRA 4WYWA 3ZX3A 4JI7F 4TY9A 3AVBA 1J2VA 3EDRB 1KVCA 3O9TA 2JVRA 4LFAK 2ETJA 3NH0A 3F56A 3UW1A 3SQGA 5EHHA 3DRXA 4CWBA 5CQGA 5BPNA 1FX2A 1HQUA 2GGPB 1U1QA 1X9JA 3DYAA 4NLQA 4B3TJ 4BRGA 2P9IA 4CIFA 4WF9L 4JD2A 1VQYA 4FWSA 4I9LA 4JI2J 4GO5X 1RTJA 3A3OB 2AYEA 4CHYA 1RACB 4KR0B 2B7CB 1HL6A 2E2QA 3DU5A 3CEDA 4CJ4A 5KFVA 1RWPB 2VCPA 2AP6A 4A61A 1HW9A 1TL1A 4IQXA 4B3SJ 3KTQA 3OFFA 3TPQA 1NKBA 2D7SA 3U9ZA 1NNEA 5KFWA 1HRHA 4LF8F 3J7AN 3V1QA 1T03A 3M8SA 2Y1JA 5ITHA 3SJHA 3AY9A 2BW7A 1R7IA 2ZKTA 2IBKA 2JZ5A 1EP4A 3D3BJ 3CM5A 3BR8A 2GHWA 1Q16B 1FRMA 2YQ3A 3NCIA 4NA2A 1P27B 3AB4B 4L3NA 4A8FA 3AQOA 1WORA 4BWMA 1BHLA 4OZ0A 3TTFA 1XMOF 1OYEA 3FSYA 1RHKB 4YB6A 4FNHA 4M3ZA 2V6AA 4ITSA 4ID5B 2RRBA 4RR5A 3KKRA 1X0FA 3NAIA 2D1KA 2F4FA 4BCAA 4GO7X 4YHHF 5M1KA 1DQAA 2I38A 3L4IA 4DR6F 2RU9A 2NUBA 2YJEA 4HH1A 3EGZA 2PSZA 2B5JB 3CTRA 4IO9Q 2QLJB 2ZZNA 3GV5B 3HSDA 2QWPA 1J5EK 2LP4A 1GQEA 4ED4A 1ASWA 3IBCB 3P83D 4BRLA 2P9KB 3THWA 4GRSA 5F8GA 4DJBA 4OLPA 5J2MA 1ZBUA 3HTVA 2CJ9A 2IYGA 4IKFA 4ES2A 3S1TA 2HQ3A 3PYEA 4AL7A 3L3VA 3T6JA 2I9SA 4BDPA 2ASOA 2QMXA 1WSEA 2ZJRQ 2YPZA 2HHHF 5KFPA 3GE1A 3CJ1A 1N36F 4TY8A 3UDVA 4NLBA 4KGXB 1S9FA 1GTHA 1FXLA 4AT1B 4BQLA 1BIUA 1K0TA 1CJKA 1S49A 3OD2A 2X6NA 3PIOL 2I7NA 5E2QA 5DDOC 2MDAA 2QC3A 6FD1A 4QW9A 2E66A 2NXCA 4ZVOB 1REVB 5A2QY 1APSA 4BRAA 3DWLA 2R8IA 2V9KA 2RS8A 1KLMA 2N4DA 3M30B 4M5MA 1EXQA 4BRDA 4USIA 1O51A 3PVXA 1I5OB 4WKRA 4JS5A 1HJOA 2IRUA 3BSOA 3VPZA 2I0XA 2QA4S 2OKQA 2XS2A 2RE2A 3FZFA 4LBIA 3KLEA 4NLYA 4ZP8A 3MCAB 2KW4A 2ZBPA 1XBWA 2RQMA 2C2KB 3DRYA 2VBXA 4HTIA 1UP1A 4IJNA 1U26A 4PKDB 1HJRA 2M52A 2KYZA 2IVMA 3CULA 3RR8A 4FLYA 5D4LA 4YP3A 1VQ9N 4I56A 4A59A 1NLKL 4OX8A 1D0EA 2IRYA 4LF2A 4CJ5A 2VC0A 3MM5B 5KG7A 3D67A 2Y1RI 3TRGA 2VBZA 2ZNYA 2W2NP 2MQNA 2DGXA 1QM9A 4CLZA 5CCMA 3OW2M 4HDGA 2CJKA 2QA2A 1S5ZA 3L0QA 2XMAA 3VQ6A 3MMAA 3M6XA 4F67A 1S9GA 2W2PP 2HF4A 2ZGYA 3CMEN 3BDEA 1FDBA 2RAQA 3QGIA 2IVOA 4GMJB 2RIJA 2G8KA 3TNVA 2BANB 1HR0F 2P2CB 2H4YB 1B99A 2XQCA 5KGWA 2AJFE 4FYVB 2W6KA 1JLEA 2IC3A 3X1LB 1S72N 3V9ZA 3LP3A 1NCLA 2DT9A 4WU2A 3VTIA 2VKRA 1VC5A 2MHNA 1F5AA 1Q1KA 2QN6B 4ATNA 3MDFA 4ZHRB 1K1SA 4GV6A 3HP9A 2O4GA 4K4VA 2KFYA 1K8KA 3BJYA 2MQMA 4J9LA 3M6VA 3CPWR 1VQKN 1UMJA 4HTJA 1KC8T 3VQ7A 4DU7A 2P51A 5CYQA 3KLHB 3HSZA 4QIGA 1QAJA 4DN0A 1FFWB 3L4QA 5F0WA 4YDXA 2ASMA 1IBMK 3VMFB 4NLPA 2FJBB 1R8BA 4RNMA 4Y2AA 4O8KA 2QWOA 3NY0A 3MFHA 2CPDA 4OJ1A 1K6YA 2GFFA 3B6BA 3OY9A 1IJJA 3U6FA 4EP5A 3SQGB 5H9EK 2O66A 3GFHA 1XQIA 3TTDA 5MLCQ 3CJBA 1HQUB 4IRKA 5L1KA 3CCEN 1GEHA 1B0VA 3BY5A 4RBVA 1NJWA 2OYQA 4OYXA 2XLKA 2P9IB 4U67L 4RX6A 4DSIA 3CJ7A 4FWMA 4DX7A 5DQIA 4MDAA 2W7AA 3NMRA 2E2NA 4DTSA 1T3VA 1RTJB 3EX7B 4NRTA 4PR6A 4H0XB 3L6QA 2VB6A 3NMAA 1UVJA 5CABA 4LF4J 5F8IA 2DBBA 1IKVA 1SJ4P 1DJ0A 3AA9A 2WBMA 1RK8A 3OTOK 3NS6A 1X3MA 4LF5J 4EIAA 2J0XA 1K47A 3I4HX 4IH5A 4KRWA 1RDUA 1NDLA 4M41A 3K8VA 1T03B 2KZMA 4C2MA 2XZWA 3V2UC 3SV3A 4O3QA 3N28A 1S12A 3SQ1A 4FPRA 3A12A 2X78A 4NA1A 2IJNA 3UN2A 2ZVSA 4ZPTR 2F8TA 1AZSB 2UXBF 1EP4B 3R97A 2AEMA 3ASMA 3M8WA 4FM1A 4A47A 5KFOA 3D0IE 3GG0A 3HK2A 4F9OA 1BC6A 3QSYB 4KHNA 5HJYA 5K14A 2A6OA 3ENBA 3TUPA 4ZVEA 1EWRA 2WC9A 5KFNA 2OZSA 5HN0A 1RWUA 2Z2ZA 3OSNA 4B8AB 3OYDA 4Y1DA 4OKJA 3R7BB 4ZPWR 2LQJA 4FJ8A 4M63A 1S79A 1GT8A 1I6JA 3G71N 1ULRA 3DLBA 3KWIA 4IG3A 4QU7A 3KUHA 4JI5F 3J7YI 3AAQA 2W2OP 4EGLA 1JJ2R 2B43A 2UXCF 4DV1J 2I8EA 4WZMA 5KPTA 3WX4A 1RDRA 1WELA 3A1YG 4DX6A 2G9OA 4CEFA 2XMUA 2VG6B 4UZBA 3P3DA 4UOGA 2CNNB 2RMLA 4EBDA 4BY9C 2A1SA 3THWB 2NREA 1RA6A 3MWBA 1W26A 4PWDB 2JEFA 3D1HA 1MWMA 3RVCA 5AQHA 2NRWA 4F2RA 4BLGA 4DFMA 3IGNA 4QWAA 1JIHA 3IXQA 4LFAF 2E20A 4H54A 3H5YA 3VQPA 4DUZF 3LPYA 2PY5A 1SI9A 2UVUA 3ZX2A 2ADBA 4HUGA 2DGUA 2CGJA 3OVNA 3MX2A 1AUDA 3SUQA 1EETA 1XERA 3IFEA 1GLEG 3FLCO 1CJKB 5KT4A 2BZ2A 3OLBA 2W9CA 3NF8A 3ATVA 1RHMB 1VQ5S 3P39A 1BWFO 1VFJA 4AILC 1V5VA 5DGAA 1SIWB 4OI4A 5I3PA 1NU0A 4GKJF 1KFDA 4CGHA 4CGGA 3O6WA 1HFEL 1KLMB 1W7AA 3WX8A 3G0ZA 2BUPA 4FS2A 3SEOA 3AA5X 3KNGA 1U6BA 3PKYA 3MN9A 4ECSA 4RUAA 4ZMMA 2HOEA 3KLEB 3RAXA 1V4SA 3V9WA 1S6QA 5BR9A 1SIZA 4TQRA 3PG9A 3V4MA 4YB5A 3QFUA 2ITMA 3DJCA 3M1FA 3A4TA 4EO6A 4WP8A 1TL3A 4USMA 1XI1A 2OAUA 2IA6A 4N47A 4WQ4C 1ZZFA 4BDZA 4DUYK 1IBKJ 2ZJRL 2DFEA 4OZJA 4DL6A 2YKMB 5SZTA 3BDPA 3AO5A 1GFWB 1UJ5A 2AZ1A 1RT2A 5AR0A 3TAMA 2GBZA 4ZCMA 2VQFF 3KHGA 1YTYA 5KTQA 2X1AA 1KOOA 4HHJA 4M3UA 4FZXC 3MMAB 4CVNE 5J2QA 2K7JA 1UVMA 1LOTB 1TKXA 2FGCA 3CVKA 3L09A 4YQWA 4JRQA 4OKKA 3LQVA 4KBIA 3O1LA 3UE2A 3GSIA 3MXMA 1J5EF 3BGFA 2IY5B 2A5XA 2KG0A 3W64A 1XMOJ 2QMWA 1Y9OA 4CESA 4N41A 4LSNA 3VEVA 4ELVA 2J7UA 2BE9B 1JLEB 3VQ8A 2AD9A 3W8GA 3ZETB 5AQVA 4CK3A 4QWEA 4FYXB 4MYUA 3UWTA 3MMCB 5LMNJ 4ECVA 4PY5A 2OIHA 4YHHJ 3JQMA 2J5AA 4W5RA 3HPHA 1NGBA 3MAAA 3D0HE 3EZWA 2JL9A 3AFGA 4JV5J 5DM6Q 3L7OA 2PC6A 3KVGA 4XH4A 2FF6A 1X60A 3HXMA 1NGCA 5CD4A 1D9DA 4DL4A 1XWLA 3GR1A 1BMQB 4DCJB 3VQ9A 2UUAK 1VOMA 2O8CA 3ILLA 1LWCA 3PEJA 4P2XA 4EU0A 3WXKA 2JSXA 2LXUA 3OR2A 1BQMB 5L9XA 3RW7A 3VR1A 4RUCA 2K3IA 4Z4CA 1XR5A 1FK9A 1QS4A 4USHA 1HYSA 4DQQA 2DH7A 2EVZA 3ZFVA 2NRHA 4L72B 1RWMB 2W1BA 3IA0A 4Q5VA 3R5JB 2DNQA 4IFVB 3KHLA 3MK6A 4DPUA 5A2QU 3AH6A 2D4WA 4A62A 3G4SS 5H1SQ 3DXMA 2XULA 5HP1A 4KGVB 1HWJA 2W7OA 1KAZA 3C95A 4DR3J 1DLOB 4DR5F 4FJ7A 1F3VA 3CM6A 3OYLA 4JKBA 5H9FK 4PQAA 1IKYA 4BBYA 2AYBA 3IWNC 2RQCA 2MYFA 1RT1A 4A8OA 4J9PA 1NJXA 3PYGA 4Z4FA 2HPUA 3D68A 4EBCA 4YS2A 1L3TA 2YWEA 1NGEA 3KHHA 1BCMA 1DHMA 2M4MA 2K1RB 5C2DA 3QFWA 1VJWA 1IO2A 2QLFB 1O8BA 3D4JA 4IFYA 3MWTA 4CW7B 1YJWN 1VQPS 4MTPA 2QWNA 1RB0A 3CI5A 5B0GA 5HRPA 3NF9A 4OHZA 4ZIWA 1E6YA 4HTUA 2JEGA 2HBLA 2GHPA 1YWXA 5E41A 4WZQA 3B8HA 5K14B 3R1XA 3ZX0A 4P2SA 1QDUB 2O8EB 3H08A 2E1AA 4OPKA 2DJWA 4TNOA 1WKKA 5A8RA 3AO2A 3F2KA 3D0PA 2OO4A 2ZHOA 3VGTA 4PRFA 3FZLA 2D69A 3GG4A 2EKYA 2UV8G 1D5AA 1XHZA 3QIOA 3ADAC 1O6XA 5BREA 1JJ4A 4IG3B 2BJ1A 4OLOA 1FESA 2QJ3A 3NGYA 2DHHA 5IT9O 3Q89A 4DR4K 3C19A 2CPJA 4LR9A 3R9PA 3TAQA 4LRAA 3EZOA 4OKEA 3SIPB 1IBMF 2Q3SA 5ETTA 5IV4A 3ZZPA 1SQGA 3IN5A 4O3OA 4OZ3A 3SDEB 3GB0A 3QB0A 4NX9A 5AQIA 1JB0C 1HBOA 4ZN1A 5HMWA 3DDNA 2E5GA 2BJEA 1YIJS 2Q2RA 2FSNA 4NLVA 5KFQA 3L2VA 1NDPA 3PHTA 4OYAA 4JV2A 1QVFR 4FPBA 1EETB 1HKBA 2GS8A 3QINA 5M1OA 2C2MB 4OYPA 3ENHA 3I32A 4Z94A 2GAHC 3FC9A 4CE9A 4XH5A 2QKBA 3NBPB 4W92B 2C3YA 5E3CA 4YY3K 1SXLA 1M5OC 1RHUB 3SXLA 4Q7AA 3OTOF 4IH6A 3VV2B 3P31A 5DS7A 2HRTA 2WONA 3Q8UA 3GE9A 1NGDA 2HHVA 4J9VA 4KB7A 2NUHA 2YXLA 3IG1A 5LSRA 4NLGA 4RW6A 1BUPA 4X4TA 1U24A 3UD5A 3CSKA 1VIXA 1KC8O 4H5VA 2HBMA 3RSEB 2O3DA 1TL3B 4MIWA 2ZE2A 1GOCA 2E7XA 2H4WB 1NK5A 3HULA 3EVOA 3A8YA 1HYVA 2XY8A 3DM2A 4FLUA 2YH1A 2XI3A 2I2YA 3WNGA 3FGVA 3Q2SC 1Q95G 3CDAA 3GMGA 1C6VA 2WVEA 2V4QA 2CPZA 5LSOA 4LVOP 1VQNS 2J6TA 4BRFA 5AFUH 3SCLE 3PX0A 1I94K 5J2QB 1TKXB 5DJBA 1NWKA 3MGJA 4CO1A 3H90A 3PZPA 4I6AA 3GQCA 2MLZA 3JSMA 4OYBA 1WSFA 3QJLA 2DGWA 4I4BA 3DLKB 5AQOA 1KONA 2Q1LA 4C8OA 1F2GA 5EU7A 2QWQA 5D6GA 4DV2K 2JWKA 4LSNB 4W90B 1YHQS 3VCDA 1G1XA 1FTCA 1VSJA 3HVTA 2HGLA 4TLQA 1SS6A 3UI3A 3A13A 1NPKA 2CGKA 4WBFA 1TR0A 5I42A 2HZCA 1XN9A 3THYA 3MAAB 3JAMY 5JS2A 3KG4A 4JI5J 1H73A 1P9YA 4Y2MA 4HACA 1TUVA 2A18A 1PO6A 1WI8A 2XGQA 2P1JA 1VRTA 1I94J 3KDOA 2W8KA 2QTDA 3TZWA 3H1VX 4ZLNA 4H4KC 4DR1K 4CF2A 1V3SA 1S7IA 3PXGa 3LALA 1FNXH 3NHGA 1XMQJ 1X3NA 3G8QA 4B1UB 4J2BA 4JV0A 3J7A1 3VA3A 1NAQA 1TMMA 1TUGB 4CEQA 2BR0A 1M5HA 4I1TA 3ZSVA 3NG8A 5F0XA 4X62F 1FK9B 4YNQA 2F96A 4Q8FA 3V9XA 1XTZA 1UW4A 2JX2A 4DUZJ 4DMZA 3HD1A 4X2BA 1PC4A 1HNWF 4WQ5C 2PI5A 5AE3A 2CG4A 4CH7A 1N5YB 1RZMA 2QLXA 3OL6A 1YVNA 1BG3A 3DXMB 4UT4A 4KT0C 2XMJA 2CZ9A 5HP1B 1PJ6A 2BOAA 1OY6A 3LOUA 1BY9A 4H5NA 2VA2A 2NR0A 4WPAA 2DIVA 4E0DA 2J9EA 2AZ3A 1LFWA 2J9CA 1FXDA 4NMXA 2RS2A 4LF9K 3TAEA 4DR1J 2Z2LA 1L3UA 3I9ZA 1IKYB 2FJDB 1S6OA 3G10A 1RT6B 1W9HA 2R7SA 1RT1B 3N4PA 4R5PA 4DUYF 3LP2A 3P4UB 2NYIA 4UF4A 3DLHA 1VCTA 1HHTP 2CADA 1U1NA 3R5GA 2FJAB 1WTFA 5LMUK 4OL8A 2JRSA 2FSKA 2KJVA 1FCAA 1YITS 2QEXS 1N4LA 2HF3A 2EWHA 4DFJA 3GCWP 5EGYA 3IWXA 3AOBA 3BQ2A 1FX4A 3SBTA 3KK2B 3VETA 1LWXA 2LQ8A 3TX8A 2FJEB 1E6YB 3VAGA 2MKHA 4OZ1A 4QWCA 2Z2MA 4KI6A 2FBTA 3C6UA 2QL9B 1FFGB 3ZT1A 4LBHA 5CXTA 3SCKE 2F9TA 1BI4B 3CYMA 2RKIA 3G4SN 5HBMA 5A8RB 3UCUP 2HNZA 1RBAA 1WKLA 3GTYX 5U47A 1X1PA 2BM1A 3SNNA 2QFIA 2LSNA 2KVQE 2IM2A 1SL1A 1WSIA 2FHJD 4LMZA 3H1QA 2FZGB 3S9HA 2NZCA 2H5EA 4TU8A 3IKMA 2E5IA 1ZM2A 1C4CA 3IRWP 2YWKA 2OPQA 1YI2N 2YJFA 1DGKN 2IIRA 1DTTA 4RG8A 1T05A 5GIPA 2CPXA 2JFKA 4C3MA 5C0YA 2HLUA 4OLAA 5M1FA 3VAJA 2UUAF 2HSTA 3RR7A 4H8KA 1KN6A 3Q83A 4DCHA 2XHBA 3DCAA 5C2CA 5AZIA 3K2PA 2CPFA 4KHMA 3BZKA 1IJEB 1VQPN 2FDNA 4JI6K 1CPZA 4ECUA 2OANA 1WC3A 4ELTA 1JLQA 3A8JA 4JRPA 2F63A 1HBOB 4C8YA 2PDAA 3AJ2A 2QRRA 3KYLA 4IDHA 4FJNA 4P72A 1O5JA 1HNZK 3GFXA 5J2NB 4M3RA 1UL3A 2YKAA 4WFBQ 3W63A 3FBBA 4NLTA 2RHSB 3AVKA 2GWKA 5BXIA 1X5SA 2IJFA 1A5WA 2BRKA 3CJ4A 3HT0A 4ZLLA 1GX6A 1VSHA 4BE2A 1LQ9A 1FWPA 3MPUB 4TKTA 4I6MB 5CZ1A 4NYPA 3TAPA 4PL8A 2AGQA 4USVA 4PYDA 1CZBA 4CI6A 4J2DA 2CJBA 3NL0A 1LXJA 2GJIA 1ZTWA 2WONB 4JI6J 4KB0A 4LFCK 2DD8S 4ECZA 4Z0UA 1IR1A 1QQOA 2ATQA 3G8SA 1VHFA 3KG1A 4RW6B 2CIMA 3MR2A 4DR5J 2HNYA 3D2FA 2VODA 2HBYB 2OMLA 3PW4A 3ILOA 4EEYA 1JJCB 2ZE2B 1VI7A 3D5MA 4ECRA 2Q36A 1RYSA 2GHVC 3EE3A 3OYCA 1RTIA 1TTHB 3W61A 3DM2B 1S6PA 1IVZA 4PEOA 3DLEA 1J9AA 2PMHA 4DU4A 2HLTA 3E9LA 1KP6A 2AJ4A 3OYAA 2IYIA 3O8WA 3TVZA 3NVMA 4DU1A 3B4DA 1SL0A 4EYIB 1NGGA 4IRDA 4TU7A 5IC6B 2BVZA 4PL7A 5ETSA 2Y8WA 3I82A 4OHXA 3VQCA 2F40A 5CZXA 1NHKL 4B1WB 5ADXH 2ZZTA 3ZSOA 2F4VK 1YTUA 2VZ9A 1RKIA 4CLFA 3TWZA 5JUMA 1S0MA 2UVRA 4WE1B 4DR2F 4DR4F 3C14A 4YB1P 2ILZA 2NRVA 3ZSRA 2PN6A 4YOXA 4UUXA 3QMQA 2E9ZA 2P6SA 2BTFA 5C7PA 2IM1A 2V2KA 1H2UX 3QEIA 3OSPA 1P90A 3HVTB 3ET6A 3OTEA 2A6AA 2OSRA 2DNMA 3IAS9 5DO2A 3L95X 3MHYA 3QFPA 2NUUG 3I55S 1VQSA 3UQSA 3LDPA 4YOEA 4M7XA 2DHSA 1P6TA 1VIOA 3KJNB 5I42B 2PIIA 1E6VA 3MAHA 3THYB 2N3OA 2C3OA 4IDKA 2BW2A 3OW2R 1LKZA 3KJQB 3ZCMA 3SFGA 5AQKA 1QAYA 1F21A 3NCPA 3N5BA 4WKYA 5M1NA 4X66F 1ROFA 2GQQA 1VRTB 5K5MA 2KT5A 2KXNB 2GO8A 5DQHA 1S57A 2P8IA 4DB3A 3C65A 2ZUGA 3OYNA 3ZZTA 3QLHB 3AVLA 5GAHP 2WVFA 1GNKA 2E5JA 1ZAVA 5FLXU 3C15A 1Z6RA 4QR2A 3WXIA 1TU0B 2I7PA 2A2CA 1IH7A 3ZT0A 2DGSA 3OYIA 4GV9A 2Z57B 4YY3F 1Q8LA 1SQKA 3EY1A 1KHVA 3G25A 5BR8J 3PR5B 2EFNA 5E26A 2MZJA 2FSJA 4HHTA 4IG0A 2J6SA 1L3SA 4FXVA 5KPRA 4NLUA 5FPMA 5L1IA 4WFZA 2G1DA 1U1RA 3FZMA 5EX5A 5AJ3J 2F5GA 1WHYA 2V51B 4CLKA 3JS6A 3F44A 1RSCA 3CQXA 5FLXO 4GKKF 5JMVA 3L2QA 4ZKAA 5IWAF 4M5DA 3AHPA 2H3GX 3G6YA 4X64K 4A5BA 1NJZA 3H42A 1NKCA 3MEEA 2ROEA 3QATA 2AV5A 4ZVRB 2HFUA 1MSWD 2QGFB 3CC4S 4QS7A 4L6V3 5F8HA 4NLCA 4LFBF 4R5PB 2C2ZB 3W5YA 1RA7A 4DLGA 4JI3F 5JS1A 3LAKA 1HHSA 2KHDA 1FDNA 4J9RA 2HQIA 3F5TA 1B9FA 1TV6A 3SPZA 2AKWB 3HI0A 2C1EB 1RWNB 4NLWA 1HPZA 4Y6IA 4PPZA 5HVGA 3IC1A 2NXUA 2NS1B 4WTOB 3ZZUA 1W2BM 2VOOA 4C3LA 3MR6A 5HMXA 3FRZA 3VF6A 1Q7LB 5FPEA 2XTJP 3C6UB 1NJIT 4DV2F 2JEIA 1ZZNA 3TA0A 1R43A 2Z2YB 2AMCB 4ZVFA 4O5FA 1NSPA 3MMVA 2RKIB 2XMKA 5HBMB 4AXIA 2HNZB 3MEDA 1CSJA 2HEKA 2XMVA 4CLSA 1U4BA 4O3SA 2JNJA 3M1VA 1U1OA 3PHEA 1B0TA 3LDLA 3LP0A 3GIRA 1QZ5A 5HROB 3J80O 4FM0A 4CZHA 4FWQA 4C1NK 2CJYB 4ZVGA 1YUWA 4X65K 5HK4A 3MAQA 4DV3K 1FHTA 1HUXA 3PSFA 3U1MA 1VMBA 1VSLA 1OVYA 1GTEA 1DTTB 3MPYA 3Q22A 5JXSA 3VVUA 2F65A 4Z37A 5AQTA 4DPTA 1ELOA 2BKPA 1L5UA 1RYRA 3NEKA 4IQMA 5AZIB 2QEXN 1ACMB 4BRNA 5JVGQ 3CJQA 3TUJC 5GADP 4WWSA 2DGTA 1FD8A 4ZVSB 1JLQB 1LW0A 3H20A 2HVIA 3OYFA 3RWUA 3B8AX 3VGSA 3TEHB 2APOA 4ZPCA 4ER8A 2HYIB 5CYMA 3K2YA 3CJ8A 4JI0K 3R3LA 1CS4A 2B9WA 1UEUA 3M32A 2YWFA 1NO8A 1EB0A 3KKFA 2G4BA 4X62J 2VBWA 3FR0A 4B1YB 4L3QA 1Q5VA 3TZYA 1FW6A 1RGIA 2AEJA 1RCXB 1NGAA 2Y1IA 1R0BG 1CC8A 1RAOA 3U3YA 4ANEA 5LMUF 3HD2A 4FZZA 3ZEUA 4BC4A 5TKYA 2W9BA 1NK8A 4DTRA 1FEHA 2ACYA 2HHSA 3SBMA 4B3RK 2CQDA 2XRIA 3PACA 3PY8A 4DV0F 3T7ZA 2HHQA 3D2FB 2EKNA 3GJTB 2MZ1A 3CC2S 3EEQA 3O9QA 4JI0J 4A5AA 1UKUA 1JL2A 4OI6A 4B3MF 1Y3JA 1XJWB 4FW1A 5EX3A 1IJFB 4GMKA 4CEOA 4NYNA 2LU2A 3Q8YA 2NLWA 2FLPA 4RUBA 4IJAA 3T5LA 4MKVA 4X84A 1RTIB 1VAZA 3H2VE 2O5DA 4ZTJA 5JVHQ 4F50A 4OHYA 4OYMA 4KC5A 5ELZA 1F9EB 4M95A 4ZVPB 3VA0A 3R5CA 3V9UA 3GBTA 3PO5A 4NE9C 3OQ2A 2LU1A 2X51A 4K59A 4ED1A 1P8GA 2DNRA 3FMWA 1KKHA 1TK5A 3QIPA 1F60B 3HSTB 2GVDB 3KJVA 2AP1A 4PG8A 2P9UA 4WFNL 3O9SA 1NOZA 3Q7CA 2C22A 4ED6A 1DT9A 1OPIA 5ETMA 2DEJA 3Q2TC 1QE1A 5BYSA 3CD0A 3DXSX 4H0VB 1NK6A 2ASDA 5FDLB 2GJFA 4M5IA 4N5SA 1UPPA 3I0SA 3ET6B 3OS2A 1RBUA 4A8MP 1GXTA 1B92A 4MYTA 4DWIA 3CF5L 2ZH9A 1M90T 3SCXA 3IM9A 3LDQA 3UD4P 4TQSA 3P1GA 4RWXA 4DS5A 1E6VB 4DPYA 4IDKB 2JGUA 1SB6A 2KM8C 3EMTA 1HNZF 4NXMJ 3UPFA 2P9LA 3W65A 4I68A 3UVJB 4LF6F 2ZZMA 4QOZB 3EJMA 3KWMA 1L3KA 4QIFA 2JHEA 3OXFA 1YBUA 4ZLPA 4HTLA 1Y5IB 2VBYA 3BREA 4B9SA 3O5BA 1VBKA 2BABA 3C15B 5B0BA 8RUCA 2O8DA 2NZ4A 2XO7A 4F36A 1FWKA 1HPMA 4ZPAA 4Y0WA 4H5RA 2MTLA 3EGNA 4CJQA 4AQYK 2HRYA 3CE8A 4FNIA 1VLYA 1KOHA 4LFCF 2LQ9A 4KKOA 1N6QA 1RBSA 3TQ1A 3G2XA 4FXWA 4EP4A 1YJNS 5AQNA 4F3TA 4ZPDA 1YBAA 3PYDA 1U2VA 1FJGF 4M5DB 2GA7A 4AHCA 3MEEB 3I55N 1CLQA 3QJJA 4ZOSA 4CTAB 4F3MA 3ZZ0A 3CJCA 4OVLA 2ZH7A 3NGKA 3JXUA 1RWXB 3AVMA 3CJ2A 5F2RA 4QYZJ 1BU6O 3IWLA 3VTHA 3Q8SB 1NBEB 2KYXA 2I5JB 3GIJA 3BGRA 3V6DA 3G96A 1TV6B 2UXDJ 2YH0A 1WKJA 4ZN3A 3PW0A 1FNMA 3NS7B 1HPZB 4QZVB 1RBRA 1V9OA 3CJ0A 2GQCA 1KFSA 2F4VF 4CLTA 4YUDA 2I6WA 3HFZB 4QS8A 4AL6A 2DH8A 4OI3A 1A5VA 1SCJB 1YJVA 1WACA 3T1YF 3H6EA 3NH2A 2CUYA 3BGOP 1X4FA 1TP7A 3W66A 1M1HA 3H8YA 2EC2A 2L9WA 2F8EX 2DR8A 5CYJA 3I5BA 4KHPK 3MEDB 4L8RB 3M1VB 2MQPA 4YOVA 2CQ0A 2J76E 3LP0B 3M8QA 2KFZA 4Y00A 4NCGB 3W8PA 4MJKA 3ZO7A 1RDDA 4HVJA 4RNNA 3WQPA 1C0TA 3CWJA 3EVWA 5ADXA 2CJQA 5FRMA 2ASLA 4CHZA 3G6ES 3J7YP 2V2VA 3BUZB 2D0CA 2X74A 2YTCA 4BWJA 4U7BA 1OS5A 1NSQA 3BO4A 4HKQA 2Z8QA 4FN5A 4JKDA 4NLSA 2VGMA 2NQPA 2G8IA 2V2ZA 1RDAA 2E6LA 4KHPJ 1LW0B 4H0YB 4ECYA 3O08A 4KH1B 1KWMA 1EQ0A 3E01A 4YR2A 3ZYYX 2R7UA 3HSJA 3MECA 4E1NA 5CYMB 1JXBA 3HSGA 5LM7E 2CYYA 4FWRA 2LDYA 1N32J 4X64F 2D41A 3M32B 3MXJA 3FZKA 2UUBK 1JWWA 4RW8A 2BXJA 1F2HA 1MN7A 3CCVS 5LJWA 3AVCA 4DV6J 5BRFA 3L4BC 4FYYB 5HSPA 1VJQA 1YK9A 2R2TA 3B6OA 3O3FA 4C1NI 3CFOA 4YOWA 4BG9A 1ZA1B 4F3OA 2RSQA 1YJ9S 4JI8J 1A0OB 2ZH4A 2V2QA 1VSDA 2DO0A 2W9AA 2U1AA 2EK6A 4D3HA 2CQIA 3PW5A 2UUCF 2FVRA 3PIPQ 3CJTA 3ZEUB 1RDCA 2UVWA 1OY8A 3U1LA 3VQ4A 2W9BB 4L73A 3E2EA 1CXQA 2R7VA 1RT7A 4L76A 4Y34A 3HBTA 5D0EA 2MQOA 5LXRA 2XYPB 2W01A 2CQ3A 1J5OA 3MM6A 4XDCA 3MX5A 1JLAA 1MMLA 3QESA 1HBNB 1W25A 4CP5A 4JI3J <