1TL1A

Crystal structure of hiv-1 reverse transcriptase in complex with gw451211
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
516
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 146
structure length 516
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tl1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tl1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tl1A05
2W9AA 3KK1A 2W7OA 4Q5VA 3KD5E 3K5LA 2ASJA 5CY4A 1EETB 2R2SA 2W8KA 1KVAA 1J53A 3C6UB 3RB4A 4WFZA 4E1MA 1FK9A 1IKXA 3DLEB 3QGHA 5KFMA 4J9SA 3KMQA 1RBVA 4KKOA 5C42A 1C0UB 3V6HA 3SV3A 4LQ3A 1HQEB 4CE9A 4B8CA 1RTIB 1FK9B 3DLEA 1LW2A 4C8NA 3TANA 1YVUA 1RT4A 3NHGA 1U4BA 5L1LA 1C1AA 4DL4A 3DRRB 2BR0A 4OKJA 4KAIA 3T5KA 2FBVA 4CJ5A 4CK1A 4QWEA 3L3UA 2J6TA 4CJLA 5KG4A 1R0AB 4FJXA 1IKYB 1LWFB 4J9NA 2ETJA 2FVRA 5KFKA 3RAQA 4PWDA 2KZMA 3FSIA 4WE1B 3UDLA 4FZXC 3MR2A 3OJSA 2XC9A 2D0AA 1N5YA 2JC1A 5T14A 3KKRA 4DFJA 3K5OA 3OYEA 3HK2A 3PX4A 4LD0A 4LSLA 4KHQA 3WNGA 4ECQA 1WSJA 4AHSA 2VG5A 4C8OA 4EBEA 1SKRA 1DTQA 3WNFA 1QQCA 4FLWA 5C5JA 2OH2A 1Y97A 4TYAA 3RTVA 3RBDA 4HYKA 4R0EA 2B4JA 2BANA 4ED6A 3CFRA 4GVMA 3AO5A 2CKWA 4G1QA 4ZPAA 5KG7A 1R0AA 2D3UA 2XY5A 4N41A 3AVBA 3TABA 1SKWA 3CQ8A 3MXMA 1D5AA 1XI1A 4J2BA 3ZT3A 5KGXA 3RMBA 2IC3B 1JIHA 4IH5A 3D45A 2ZD1B 2IA6A 2P51A 3ZSXA 2RN2A 1JLGB 3CG7A 1IKVB 3OL8A 4J9LA 3EY1A 3HHKA 3DRSB 3GIKA 3SJJA 4DTXA 4CESA 5F9LA 5KFWA 1KLNA 4H4MB 4FJJA 4FJLA 4KPYA 2E6LA 1RYRA 4K8ZA 2E9TA 1KLMA 2WB4A 5KT3A 1XWLA 1J54A 2KFZA 2O5DA 1WNSA 2B43A 1A5XA 4IH6A 1T03B 3DLHA 5KFXA 4M3TA 1CZ9A 4O44B 4ZHRA 4IFYA 3JSMA 1S1WA 1HMVA 2B6AB 4PUOA 3QIPB 3H59A 4QWAA 4HCCA 1B92A 4AH9A 1DLOA 4TXSA 4QOZB 5F8GA 3U3GA 2DFEA 1RTJA 1IKYA 5SZTA 5JXSA 4CHYA 1VSJA 3PUFA 1HARA 1RDCA 1SH0A 4DSKA 2XGQA 2G8HA 2A1RA 5HLFA 3KLIA 2B6AA 3LP1A 3OL6A 3H08A 3L2UA 4DQPA 4LY7A 1LW2B 4EO6A 2ATQA 4OPKA 4IG3A 3RR7A 3VQPA 4CEDA 3L3VA 3OYCA 3LP1B 5KTQA 1L3VA 5I3UA 5HLFB 1JXEA 4NLTA 4JRQA 3AVGA 4EBCA 4MFBB 4NCGA 2J6UA 3KD1E 5J2MA 2RPIA 3OL7A 2C2RA 4CJUA 4KO0A 1GOCA 1K1SA 1TAQA 1JLBA 3HP9A 4XO0A 3VA3A 4CJRA 3CJ0A 4ZP8A 3UQSA 3C95A 1Z4UA 2ALZA 3LP0B 3UIQA 2YNHB 3S3NA 2IM0A 1U48A 3I0SA 3VQSA 1NJYA 3QNOA 3OYLA 3VQ9A 3HPGA 4ELTA 3WNHA 3GIJA 2C22A 1T8EA 2DTUA 3ZT0A 1QAIA 4IRDA 5HP1B 3I5BA 4TQSA 4ZTFA 1KVCA 1JXBA 3NGDA 4Z4CA 2DFHA 1BI4B 4ZP7A 3EPIA 4WE1A 3FFIB 1G15A 2IOCA 1TKXA 5KFDA 1REVB 2WHOA 2D5RA 1TKDA 2RDIA 4DSFA 2O4IA 4QW9A 2VA2A 4ED3A 1RNHA 4M42A 1RT5B 4IQXA 4C8KA 1TKXB 5J2MB 3DLBA 3G10A 2JEIA 3NGYA 3K59A 3OS1A 2IGIA 4R8UA 4CHPA 1NK7A 3IRXB 1TK0A 3HJFA 1HPZA 2IS3A 2YNFA 5KG1A 1QS4A 1IG9A 1EX4A 1WLJA 4AILC 3CDWA 1KHWA 2AQ4A 3EZ5A 4KSEB 4M3RA 3SPZA 1LAVA 2R2UA 1QHTA 2QK9A 2IJFA 1TKZB 1N4LA 3OS2A 2YNGA 2IBKA 2XY7A 3GYNA 2OPRA 3O4NA 1DTTB 3KJVB 4KRFA 4MIAA 5J1EB 1ZBLA 1JLBB 5KFSA 3B6OA 5F8IA 5FRNA 3MTKA 1KFSA 2IM2A 3V9UA 3DI6B 4ZVEA 4JRPA 1NOYA 4KV8A 3AVLA 3GIIA 3LP3A 3NFAA 4CEOA 4N5SA 4CEZA 4CIFA 4RW9B 3HXMA 5KRTA 1S0MA 4ZHRB 3PJXA 1OS5A 5F8MA 1SV5B 1TL1B 5KFQA 1HMVB 1RDAA 2Z1JA 3SUNA 4ZVFA 4TLRA 2Y1JA 2G8UA 4TY8B 2QKKA 4K4VA 4RW9A 1HPZB 2FJVA 3S9HA 3NH2A 3SPYA 1C6VA 4CJVA 1ZBFA 3IAYA 4CK2A 3QIDA 4K4SA 5JUMA 1HJRA 1HYSA 2G8KA 3C6UA 1MU2A 3KLFA 2WCXA 2W8LA 3MF5A 4O0IA 3SI8A 3QIPA 4G1QB 4OL8A 3CIZA 2E4LA 3DOKA 2I1RA 4EEYA 4Z0UA 4Z4FA 1X9WA 2XCAA 4EYIB 1JLCB 1S9EA 2HMIA 4J9KA 2BQ3A 4E7KA 4ECZA 5F8LA 1MU2B 3KIOA 3KLFB 3KHHA 4TYBA 4CFDA 4FCYA 1RA7A 1N56A 2ASLA 1KLMB 3CWJA 3PZPA 4NLOA 4I9QA 3IG1A 3VQ4A 4I2PA 4LSLB 3HKWA 2XY8A 1VRTA 4ID5A 4YR0A 1UAXA 5SWMA 4JLHA 3NH1A 2OPPA 4ECXA 4KHNA 4M3UA 1JLCA 1S9EB 2VA3A 3NE6A 2P5OA 4BDPA 1S9GA 4RNFA 4CHZA 3QNNA 4FYDA 1N5YB 2HNDA 2R7YA 3LP2A 5E41A 1D9DA 2W9CB 2BQRA 3O3HA 1UOCA 1EXQA 2WRMA 3QEIA 4HKQA 4WYWA 3H2LA 3OSNA 1ASVA 1HYSB 4OKKA 3FFIA 3ITHB 3QERA 4DTRA 4MFBA 4CFAA 1SL2A 2XRIA 3OYMA 5FRMA 3TAGA 1MMLA 1JXLA 2OPQB 2E9ZA 4LH5A 1SL0A 2P1JA 2G8FA 4NYFA 3DLRA 5FDLB 2G8VA 3I0RB 2ZE2A 1HQUB 2IMWP 1RBSA 1XC9A 4NRTA 1J5OA 1B9DA 4FJ9A 4O55A 5CYMA 4Q0BB 5KG5A 2V4RA 3GV8B 2LSNA 4PWDB 2ZKUA 1RCHA 3AO4A 1TV6A 1S97A 2FVQA 4ELVA 3LAMA 1Z26A 2JGUA 3PO5A 4AHUA 3DI6A 4ICLB 1JLQB 2X74A 3OYNA 4IOBA 4FLZA 4BE2A 4EO8A 4KHSA 4Z4HA 3AO2A 1IKXB 3AO1A 4ZMMA 1BHLA 4CEAA 4MKBA 1JLQA 3V6JA 5DQGA 5C25B 3H5SA 3M9NB 1W9HA 3K2PA 4W5TA 1LW0A 4CFBA 1S1VB 4H4OA 3TAFA 3CM6A 2OZMA 3JSMB 3JYTA 3DLKA 4NLYA 5JS2A 5KFAA 2UVWA 5KFZA 1S6PA 1Q8IA 2YNFB 4R5PA 4PQUB 2FVSA 3FQLA 1XHXA 3OYJA 1SUQA 1ASWA 3IRXA 4DL5A 3V9WA 3DLGB 3GQCA 1BQNB 2BDPA 4KHRA 1RTJB 4N56A 4K8XA 1JKHA 1EETA 5I42A 4WFXA 2FJXA 3RRHA 4DTJA 1JL2A 4ECRA 1F21A 1SKSA 4MKAA 3AVAA 4DMNA 3Q8QB 5FROA 3PW7A 3AVHA 4AHTA 2AX0A 4O44A 4FJ7A 1JL1A 3FRZA 1QSLA 1LWEA 5EWGA 3ZSRA 3VN5A 3QEWA 3NH0A 1VSMA 5KFOA 2V0NA 3SQ1A 5KT4A 4IH7A 2R8KA 5HP1A 1RT6B 1ZETA 3QINA 4Y2CA 4C8MA 3DDKA 1KVBA 3P5JA 5KFBA 5EU7A 3BSNA 1NK4A 5F8NA 3ASMA 3M9MB 3KKSA 3G0ZA 5CZ1A 4NLSA 3H5YA 3DM2B 1CXUA 5KFRA 4MK7A 1TQLA 4O5BA 2R8IA 4YMEA 4DSJA 4HTUA 2BANB 3LP0A 1GX6A 1JX4A 3BR9A 5DG7A 3HYFA 3VA0A 5EWFA 2QKBA 4F4ZA 1RAJA 3PW5A 1SH2A 4DL3A 1TKTB 4IDKA 3OVNA 2YNIA 5KI6A 3MAQA 3OLBA 4O3RA 2PY5A 1SUQB 4J2EA 1GX5A 3V9ZA 4FM0A 4E7LA 3AVKA 3HT3A 2R8HA 2ITGA 1WN7A 3F9KA 4O3NA 4DU3A 4UQGA 4MK8A 1FKOA 4YR3A 4XIUA 2JEFA 3GV5B 2W42A 2FBTA 3KHRA 3PJWA 2IM1A 3L2QA 3ZSOA 1X9MA 2UUWA 5L1KA 3L2WA 4RW8B 4ECWA 2FVPA 2P5GA 2HNDB 5KFNA 3KLEA 2XI3A 4FVMA 4FW1A 5F8JA 2VG6B 2R8JA 1WSHA 4ED1A 1C0UA 3HVAA 4OVLA 3ICLA 3DM2A 4RG8A 4NLUA 4CJQA 3PW4A 1VRTB 3OHAA 3B6PA 4FLXA 2G8IA 4CHQA 3H4BA 3HVTB 3I0RA 1RT3B 3KK2A 1WNEA 4ED0A 3MXJA 2HHXA 3OY9A 3SNNA 2C2EA 3NMAA 3VQ7A 3V6DB 3OYIA 4PY5A 4U7CA 2ILYA 4FZZA 5KT7A 4NCAA 4MH8A 1LWEB 1U49A 4DU4A 3AA5X 2B5JB 4IFVA 4RZRA 3RMDA 4F8RA 4DEZA 1C0TA 1IO2A 4M94A 4FJGA 2XWYA 4NLGA 1VK0A 2GV9A 3HVWA 3V1OA 5KFEA 1VSKA 2RF2B 4O3SA 4Q45A 3HPHA 3LZJA 4KTQA 2ZQBA 3KHLA 2BGGA 3CJ4A 1GOBA 4QPXA 3HVTA 3M8QA 1NJZA 3LANA 1HNIA 4FJIA 3TAMA 4URQU 4EP4A 3OYGA 3QGGA 3LPUA 2VG7A 4B9NA 4FJMA 3QO9A 4NLRA 2FLLA 2D3ZA 4J2AA 1W0HA 1LWFA 3MECB 4RW6A 5EUHA 4M3WA 1RTHB 2GC8A 5KFVA 2GUIA 1VSLA 2WOMA 4F3OA 3KLVA 3DOLA 2KZZA 4QWCA 4Q43A 5KG6A 1JLEB 4RW6B 3MEEB 3FQKA 1WAFA 3RAXA 4FJ5A 3IGVA 3QLHB 3PHEA 2AWZA 1VSEA 1NK9A 4B9LA 3TI0A 1IH7A 2XO7A 2WONB 5CZ2A 1BISA 3L8BA 1BL3A 3VQ5A 4CJPA 3SI6A 4W5OA 1JLEA 3RB0A 2HHSA 1HYZA 1QUVA 1S1VA 4H4OB 3MFIA 5L1JA 4DL6A 4DF8A 1C0MA 3ZT1A 5C25A 2A1SA 2W9BA 2R8GA 1Z25A 2PZSA 1S5JA 3P83D 1LWCB 3KK1B 3VQBA 4I7FB 1KHVA 3BSOA 3QO9B 5DGAA 3K5NA 4E7HA 4WFYA 1REVA 4RW4A 4I2QA 3V81A 1T05B 5L9XA 2HW3A 4MK9A 3U6FA 4DSIA 4Q0BA 4Y1DA 4JV0A 4KI6A 4ECVA 1TKZA 3OYDA 3THVA 1WAJA 5DQIA 2FBXA 4DS5A 2Z1GA 2AGPA 3MR6A 4OGCA 5C24A 4OLBA 5KT5A 3ZCMA 4CGIA 4NRUA 1RDRA 4DFMA 1JLAB 4L8RB 4Z4GA 5HRRA 2YNIB 1EP4A 5DG9A 1WSIA 2OPQA 4FM1A 1S1UA 4GC6A 1BIZA 2GIRA 2HNZB 2IC3A 3PX0A 3AVMA 1ZYQA 3RBEA 3DRSA 4Z4EA 4DSEA 3HO1A 1JLGA 3T1AA 4OLAA 2HHUA 3RWUA 4BDYA 4DS4A 1B9FA 1W25A 2DFFA 4ECYA 3HL8A 4KO0B 3I5CA 2Y1IA 4DTSA 3LZIA 1DTQB 2I5JA 2J6SA 3QEXA 4CJEA 3SUOA 1RTDA 4LH4A 3LALA 4DFPA 3KK2B 1U47A 2GBZA 2DPIA 4QAGA 4FK0A 3MXIA 1ZBIA 3OHBA 1VRUA 4W5NA 3SZ2A 3Q8SB 1HQEA 3RMCA 4TN2A 5KFLA 4B8AB 3E01A 5T7BA 2YKNA 2KQ2A 1IM4A 3K58A 4KHMA 1TK5A 3CM5A 4FJHA 3JYTB 2FJWA 4I7FA 5J2QB 4J9RA 3I0SB 3DOKB 2Z1IA 2YNHA 2AJQA 4KHUA 4O4GA 3BJYA 4CJSA 2QXFA 4RW7B 1O1WA 4WZMA 5J1EA 4CHOA 2KTQA 4FLUA 3DRPA 3TVKA 3DLGA 3KMSA 1QE1B 3I8DA 2F8TA 3NGZA 4EZ6A 4DWIA 1RT4B 4ZVHA 4M3YA 2IAJB 4Q8FA 3ZSWA 3SFGA 2Z1HA 4U6PA 3BGRB 1BCOA 3QEPA 4QWDA 4CF0A 3OYBA 4JS4A 1NKEA 1S1XA 1RT1B 3WNEA 4YFUA 4B9SA 4EYHB 1J5OB 1T94A 3H98A 4ED2A 3Q8RB 4CK3A 3N6LA 3BGRA 3VQQA 3MEEA 4IR9A 1YT3A 3K5MA 2IAJA 1RT5A 4F50A 1GOAA 4IDKB 4OJRA 4C8LA 3HPOA 4OKEA 4KB1A 1FKPB 1ZTTA 4PA1A 3QETA 5KFYA 3VQ8A 4ZPBA 1DLOB 1L3SA 4RW7A 2EHGA 3KK3B 4PUOB 3F73A 4RNOA 2VG7B 4ZVGA 3BQ2A 1TAUA 1S9GB 3E01B 1S10A 1HQUA 4Y2AA 5CYQA 2XCPA 4B9VA 3SQ2A 1JLAA 1Q9YA 1TL3B 5JS1A 2BRKA 2FBYA 4Q8EA 4IG0B 3IG1B 3SUPA 4R8UB 2HNYA 1C0TB 2ZD1A 5EDWA 2B5JA 1KCFA 4FK4A 4Q44A 3CJ3A 3KLGA 4DFKA 4DTNA 2VG6A 4ELUA 4DLEA 3T19A 2HWIA 2UUTA 3NBPA 3RMAA 1C1BA 1RDBA 4IKFA 4CHNA 4FXDA 4DL7A 4FK2A 3NF7A 1WSFA 3BQ0A 1EP4B 3U3YA 2F8SA 2ASDA 2VG5B 4O4RA 3AV9A 3QYYA 1S6QA 5KFUA 3T3FA 4DF4A 1KRPA 1J9AA 4IRKA 4URSA 4NLPA 3ALYA 3NF6A 2HB5A 4AHCA 4JUZA 1A5WA 2CJQA 4M41A 1S1XB 3V1RA 1TL1A 2UVVA 4DL2A 3IS9A 3BDPA 2VWKA 2ATLA 3OLAA 1VSFA 3AO3A 1SV5A 3L2RA 3PR5B 1U45A 1S9FA 1TKTA 4Y1CA 3OJUA 4FBTA 3K57A 3VQDA 1YVFA 3PW0A 1TK8A 4ICLA 3V4IA 4KBIA 4DSLA 3ITHA 5K14A 1D8YA 3NCIA 3CO9A 4DG1A 3MEGA 4F4YA 2G8WA 5HRPA 3NDKA 4HCBA 4CF2A 3DYAB 4O3OA 2OYQA 5CYMB 5FDLA 3AVJA 3PVXA 5HRSA 1L3UA 1BGXT 4HUFA 4LSNB 4I9LA 4CGFA 5KG0A 5J2PB 4F4KA 1WSGA 4KI4A 3M8RA 3LWMA 3DOLB 1XR5A 4K4ZA 1S0OA 3O3FA 4F2RA 1U09A 3KLHB 4CJFA 1ZTWA 4DLGA 1D9FA 4B9UA 4KE5A 3AA2A 1LAWA 4O4GB 4IRCA 2W7PA 3G6XA 4CJKA 5DLFA 4HUEA 4FS2A 4AHVA 3MEDB 3RB6A 3SV4A 3H4DA 3T5JA 4KTWA 2EX3A 1IKWB 4YNQA 4K4UA 2JEJA 4ZPDA 1BI4A 3CDUA 1XR6A 4KFBB 4FJKA 1S6QB 2D0CA 2XY6A 4B08A 2HHVA 4HVJA 4R5PB 2HAIA 3OL9A 1RA6A 1T7PA 3L2VA 1BIUA 2FLNA 4KHWA 3KOAA 5DGBA 3QZ7A 2Q3SA 3LDSA 1S1TA 4NLWA 1C1BB 3PR4A 5J2NA 3V81B 3PW2A 1CLQA 4B3OA 3H40A 3C94A 4IFVB 3EZUA 4DU1A 3QESA 1FKPA 4CJTA 4TY9A 4CJWA 1XHZA 2YHAA 3VQEA 3GILA 1S1UB 5DLGA 3V6DA 2KFNA 1C2PA 5KFCA 3AVNA 4M3ZA 4CJ3A 1IKWA 3NF8A 4E7IA 4FM2A 3V6KA 3NAHA 3OYHA 4BWMA 2HHQA 4CCHA 1RT1A 4YR2A 3SQ0A 3A2FA 2XHBA 3KLEB 2JLEA 2OPSA 4J9QA 3MR5A 4FJNA 4DG1B 3AA4A 3ZSQA 1CSJA 3C6TB 3T5LA 4E0DA 4ZPCA 3GIMA 3G6VA 3LWLA 3BQ1A 4CIEA 5KFPA 3ZSZA 4J2DA 1LWCA 2E6MA 4URGA 4ED8A 3KJVA 1DTTA 3G6YA 3D0PA 4E3SA 1S1WB 3C6TA 3TAMB 5J2PA 5HROA 1I3AA 4QWBA 1X1PA 2IM3A 4IBNA 4IG3B 4FS1A 1NK5A 4B9MA 4DQRA 3IS9B 3SYZA 3IGNA 2NUBA 2O4GA 1CZBA 1HNIB 2BQUA 3OYAA 4DQIA 3NF9A 3HM9A 2ZE2B 4CEFA 3OSPA 3CYMA 3ISND 4H4MA 3N6NA 3CDEA 2RKIB 4X2BA 4ECTA 1NK0A 2FLPA 4K4XA 1TP7A 1IKVA 1RT6A 4CERA 3AVIA 4RU9A 4J9MA 1VRUB 4CF8A 4K4WA 1XR7A 1HYVA 4FJ8A 3RB3A 1WSEA 4AHRA 4B3OB 4J9PA 5KFGA 3D28A 4CGHA 3P1GA 3NBPB 2E9RX 2X78A 1S1TB 3VQAA 1ZBHA 3MR3A 5J2NB 2YV0X 4GMJB 5D3GB 3PO4A 4F4WA 1VSHA 3TWHA 2XGPA 1QTMA 1JKHB 5I42B 2BRLA 1BQNA 4KB7A 4KTZA 4Z4IA 3I5AA 4GC7A 1X9SA 4B9TA 1RBTA 1YTUA 2HNYB 2FVCA 1C1CA 4E7JA 1UWBB 1FXXA 4K4TA 4PQUA 3AA3A 4DTOA 1QSYA 1ASUA 1NHUA 2JC0A 2AGQA 1NOZA 1N48A 1K6YA 5HBMA 4W5RA 3H5UA 3QIOA 1NJXA 4NYZA 4E19A 1D1UA 3MFHA 1T05A 1LW0B 4TQRA 3SFUA 5DG8A 1BCMA 2D7SA 3CJ2A 2X6SA 2RDJA 5KG3A 4EBDA 2F96A 3DMJB 5HRNA 4HUGA 1NJWA 3LPTA 2BE2A 4O3PA 3Q8PB 2HNZA 1NK8A 1RILA 2YKMA 3UR0A 4FBUA 4Y34A 3NAIA 1HNVB 4CEQA 2YHBA 1U04A 2RKIA 4N76A 5KFTA 5L1IA 2OPRB 1RT3A 5KFJA 4ZP6A 2C2DA 3SUQA 4ZP9A 5F9NA 4TY8A 4ED7A 1KTQA 4ECUA 3EPGA 1TGOA 3GV7B 1RTIA 4KKOB 2IJNA 3O4QA 2R2RA 1KSPA 1RYSA 5C42B 4I2QB 4KV8B 1KFDA 4KREA 3E51A 1D0EA 5K14B 4BE0A 1RT2A 4KAZA 1CXQA 2F8EX 2KW4A 1QE1A 4GW6A 2W9BB 1RTHA 1VSIA 2C28A 4IR1A 1SL1A 2R2TA 4CEEA 1VSDA 3LP2B 2HHTA 4BWJA 4CFCA 3NGIA 3VQ6A 2DPJA 1FKOB 1UA1A 4JV1A 4IFYB 1T03A 4FLTA 5J2QA 1K1QA 1TV6B 2WK4A 2QE5A 2OPSB 3KTQA 1LV5A 5KG2A 3HP6A 3M8QB 4RUAA 1UWBA 4O0JA 3ZSYA 2HWHA 3NKYA 3TQ1A 2HVIA 4CECA 4NLVA 2VWJA 4QCLA 1RBRA 1TL3A 2RF2A 3DRPB 4DTUA 1RTDB 4YP3A 2UVUA 3PV8A 4NCBA 3V9XA 1A5VA 2I5JB 2HMIB 1QSSA 2DY4A 1TVRA 3NL0A 5DK5A 5F8HA 3NAEA 5KGWA 3HVRA 1NNDA 4FW2A 1L5UA 2V4QA 2AU0A 3KK3A 1NK6A 3TAEA 1JLFB 3RRGA 4IG0A 3V9SA 3TAPA 2OA8A 3S3MA 3AVFA 3FDSA 5CYQB 3H5XA 1HRHA 4HHTA 3ZT2A 4M3XA 3DRRA 3S3OA 4F2SA 4DQSA 3TAQA 3DLKB 5KT6A 3QGIA 3DYAA 3SCXA 2AGOA 4G3IA 2AX1A 3MEDA 4MQ3A 4O3QA 1ZBUA 2D41A 1NHVA 2QV6A 3TR8A 2EC0A 4RW4B 2HVHA 1RT2B 4IKAA 4RW8A 3N6MA 5DQHA 3PY8A 5KFIA 4JV2A 3KLHA 5I3UB 1TVRB 4NCGB 4EP5A 5KFFA 2UVRA 4ZTJA 4NZ0A 3M8SA 3OYKA 4J9OA 3HSTB 1EKEA 1I39A 4CGJA 1RDDA 3CFPA 4CEBA 4XPCA 2XI2A 2WTFA 4EZ9A 4TSXA 4DQQA 2D0BA 3KHGA 4N47A 3QEVA 4F4XA 4M45A 4M95A 2YKNB 4CGGA 1I6JA 1UA0A 4JS5A 3LAKA 2BE2B 1RBUA 3IN5A 4XPEA 1QAJA 4ID1A 1HNVA 5HROB 3V4IB 1S4FA 2YKMB 4CF1A 4CGDA 4WXWA 3O3GA 1Q9XA 3V1QA 1S49A 4H54A 3TARA 4NYNA 3M8PA 1NKCA 3M9OB 5DMRA 4E1NA 1N6QA 5KFHA 5KT2A 3CVKA 3KLGB 4ECSA 2GIQA 3QZ8A 4H8KA 4LQ9A 4CIGA 1L3TA 2YNGB 4BACA 3QLHA 3ISNC 1C1CB 1RT7A 2IDOA 3ZT4A 3ZSVA 4E89A 3T5HA 4NLXA 3CFOA 4RNHA 3OYFA 2X6NA 4I2PB 4OPJA 3ULDA 5D3GA 3BSCA 2OZSA 2WOMB 1BQMA 4FLYA 4WYLA 3MECA 4BE1A 4F3TA 4K50A 2PYJA 4NLDA 4RNNA 1NKBA 3DMJA 3CJ5A 2HHWA 1JLFA 5EWEA 2W9CA 1ITGA 1S48A 3UPFA 3M8PB 4YQWA 2FC0A 4NLQA 4Y3CA 2ILZA 1S0NA 3D5MA 4KB0A 3G86A 5KRSA 4QW8A 1BQMB 5HBMB 4CJ4A 4DTMA 3BSAA 3OS0A 3BREA 2JEGA 4WZQA 2OPPB 3EYZA 4ID5B 4LSNA 3KNAA 4MIBA 4RUCA 1T3NA 3VQCA 3SQ4A 4W5QA 5C24B 4WXOA 3PX6A 4KFBA 1YTAA 4KHYA 2WONA 1RT7B 2V9WA 3RR8A 4FZYA 4OGEA 2PYLA 4RNMA 1S6PB 3KLIB 4FLVA 4DTPA 1SH3A 4K4YA 3MEGB 4CF9A 3AVCA 1N6QB 4BDZA
chains in the Genus database with same CATH superfamily
2K2PA 1YHQS 2CRLA 4Q5VA 3CCJS 5AQYA 3K5LA 5GADI 2ASJA 1IQTA 2R2SA 1F60B 1J53A 2R7SA 2PAVA 4PKIA 2AV5A 4E1MA 4CM0A 3T9ZA 4ILJA 2DNKA 2EPIA 2K06A 3D1QA 3E9OA 4J9SA 4FWNA 2FF6A 1RWWB 4HHJA 4DBQA 5C42A 3FZLA 3SV3A 2W2OP 1HNZJ 1HQEB 1EB0A 2GMHA 3LL3A 4B8CA 4Y6IA 1LW2A 2A5XA 1NHKL 2ZH8A 4V19J 3ONQA 2BR0A 3CNQP 3H7HB 3T5KA 4CK1A 2PI4A 4RWTA 2VDIA 1VFJA 4ZIVA 2CPZA 3IUCA 3L3UA 1ZM3A 3K0JA 4CI0B 2W25A 2BOAA 3DXKB 2KKHA 3N4PA 1HKCA 5AQQA 2KZMA 2KVIA 3G8QA 1K9MO 4FZXC 3MR2A 3WXKA 1ZS6A 5LM7E 5T14A 3KKRA 3Q89A 4DFJA 3K5OA 1BO5O 2VFTA 2ASYA 2CDQA 4W4MA 1WSJA 2VG5A 2WSEC 4EBEA 4JI3J 2EKNA 3WNFA 4FLWA 2YBVA 2EK1A 4QPTA 4HYKA 4R0EA 2UUBJ 4CM2A 3IFEA 2RHQB 2HK2A 3D7EO 4ED6A 3CFRA 1WD6A 2BV3A 1FWLA 2Z4PA 3H1QA 2D3UA 4N41A 1NSKL 3AVBA 1YBTA 3TABA 3IBFB 4I6YA 4YOTA 1K73T 3ZT3A 5KGXA 1JIHA 4OX9J 1MNEA 2RT3A 3DC2A 3OL8A 3EY1A 1FNMA 4OHVA 3DRSB 1TMMA 1KLNA 2F9WA 4K0KK 4FJLA 2B4PA 5KT3A 4JI7K 1XWLA 2O5DA 3OR1B 1WNSA 2B43A 1A5XA 4PG4A 1HX1A 2Q79A 4M3TA 2Z0GA 4BR2A 3MN6A 1VQMN 1S99A 3TUZC 1S1WA 3LUYA 3R5JB 2B6AB 1VQKN 5FJ4A 4HCCA 5D77A 1J5EK 4LREA 1T6DA 3AY9A 3R1LA 2I6WA 3TP2A 3U1MA 1IKYA 1ZXOA 3DHWC 4DSKA 3HX9A 3X1LB 4ZKAA 4ANDA 2A1RA 3NGKA 5HLFA 4PQAA 3LP1A 3OL6A 1R6YA 4DR5K 2HQFA 3L2UA 4A8KA 5C15A 1YDLA 2BJ1A 3W2WB 1VBXA 3RR7A 2L3MA 3LDOA 3DLJA 1FD2A 1X7VA 3GU0A 1JXEA 4Q2LA 3QAUA 4KHPK 3KD1E 5B09A 3W62A 2RPIA 5E3RA 1DZ5A 1UW4A 1K1SA 4ZP8A 1FESA 3UQSA 2B8PA 3GONA 2ALZA 2IM0A 1NGDA 1NJYA 1OSDA 1O8BA 2PA3A 3TTFA 2LQ8A 4NX9A 3VQ9A 1RHQB 5ETRA 2AMCB 5I3PA 5AJ3J 3CIPA 1RTZA 2QMWA 3U7JA 3ZT0A 2HFOA 2ASOA 4OZJA 3TUJC 4IDHA 2N7CA 4TQSA 2JHEA 4DR4F 1G15A 2KH9A 4DCOB 2Y8YA 4YHHF 2D5RA 3HJVA 1TKDA 2O4IA 2VPWB 4GVEA 4QW9A 1Q79A 4ED3A 1G4CA 4M42A 5DZ6A 3F5TA 3MOZA 4OZ1A 5GAGU 1NMNA 3C46A 3G10A 4X64F 1FTRA 4BG9A 2E66A 3DHXA 1NK7A 3QSYB 3N4WA 4OLPA 2FJDB 2IS3A 2YNFA 1QS4A 3CMQA 3KUEA 3D0GE 3CDWA 4JYAK 4LF9J 1LAVA 2QK9A 2IJFA 4B3SF 1N4LA 1QJHA 3GTYX 1OY8A 2YNGA 2IBKA 2F4VF 3PIOL 3GYNA 2OPRA 3O4NA 2EWSA 1NBEB 3I87A 3O6QA 4P2MA 1JLBB 1KN6A 1TZ0A 4I56A 5KFSA 4LT6A 2E1RA 4NLBA 4J91A 1YAGA 4JRPA 4U95A 1U26A 3MPWA 4KV8A 2DEIA 3FZKA 2GVZA 4CYUA 5AQUA 2OD4A 2HGMA 5KRTA 1VAZA 2JOQA 3PJXA 1Z6RA 2O3DA 2B9WA 4Y65A 4FF1A 1WDDA 3W65A 3CCZA 1IBLJ 1IN0A 2Y1JA 1WC3A 1J6ZA 1V9OA 4JKCA 4YY3K 4TY8B 1BMQB 1CS4B 2FJVA 3S9HA 1T3OA 2HBKA 3LO3A 4JKDA 1U0HB 4X4TA 1RAHB 2XM3A 1EQYA 3C6UA 3PTWA 4BLGA 4CZFA 3BEXA 1HWLA 4DPTA 4O0IA 5E2QA 4G1QB 4CW7B 3GG0A 2MKIA 5A8RA 2E4LA 2I1RA 4WF9Q 5CD4H 4ZPWR 3CHWA 3NS7B 4CWBA 2JL9A 2BQ3A 1OJ4A 3CIMA 1S72N 4FCYA 1N56A 1PILA 1KLMB 4DV4K 2V4JB 2A10A 4I9QA 4PG7A 1VRTA 2H48B 4CNZA 4JLHA 2HFUA 3CB4A 3J7Z5 3K9JA 1LXNA 2VA3A 5CE3A 3NE6A 2V8HA 4WKYA 8ATCB 5E7OB 2P5OA 2QA2A 2RQCA 5HMYA 4QIGA 4CHZA 4OYOA 3O9TA 3VOVA 4FYDA 1N5YB 3TUIC 2X3GA 2R7YA 3HM8A 1LFPA 4CNYA 1CJVB 2YI1A 3HDSA 1E6YA 1SZ2A 4CLFA 4WYWA 2GUPA 3OSNA 1HYSB 1P6TA 3ITHB 4MFBA 3NGSA 1IG8A 5FPMA 4TU9A 1VC6A 2A42A 3O08A 4OFZA 3SLCA 3M6GA 3FZHA 1SL0A 1SC1B 4NYFA 1XC9A 2IMWP 3AH6A 2O66A 3T1HJ 2DNZA 1J5OA 4CO0A 4USHA 3UO0A 2P8IA 2QA4G 4A46A 1ZZNA 4A48A 2V4RA 1OY9A 2ZKUA 4DV6F 1RAOA 4B3MF 1Z26A 3CCQS 1JLQB 1RWKB 1K8AT 4IOBA 3THWB 4EO8A 3OV7A 1XNRJ 4KHSA 3AO2A 4CZHA 3CXCR 2E5LK 4ZMMA 4H4KA 2HSTA 3V6JA 3D9BA 1T9TA 5DQGA 3M9NB 3K2PA 4W5TA 3ET6A 4CFBA 2OZMA 2CNKB 4A2BA 4WFNL 4WWSA 1GNKA 2HIYA 4A4JA 4M5JA 4NLYA 5JS2A 5IWAF 4QS7A 2DHGA 1X5OA 3DKDA 1ASWA 4FWMA 1OPZA 3RSEB 1XC3A 2M7SA 2Z30B 2IDEA 3CO0P 3ETOA 4MKAA 4DMNA 3Q8QB 4H5TA 2ZC4A 1UEVA 3UD3P 4O44A 1VHFA 4RUBA 2C3YA 4OI0A 1WTBA 5EWGA 4K2JA 3QEWA 3KJNB 5KFOA 3GFYA 4JYAJ 1UVJA 4JKGB 4HDGA 2R8KA 1OSCA 4ITSA 3PYGA 1GTHA 5LSLA 3DDKA 2BJDA 2DGVA 3HSZA 3EGVA 5F8NA 2MGZB 1ZAVA 4PYAA 5IWAK 2I9SA 1NMDA 2E7WA 3ZO7A 2NREA 1OWXA 4O5BA 3M05A 1FXDA 2RE2A 4C0OC 4A5AA 3MPVA 3BGLA 3PM9A 2ZJRQ 4I6WA 1WWHA 3BR9A 3C6AA 3FFKB 3VA0A 5EWFA 1GMUA 4F4ZA 5IOLA 3RAMA 5DDPC 3O2IA 3IWNC 3QICA 4B02A 4YY3J 4IDKA 2YNIA 4I0WA 1N0UA 3MAQA 4V19S 1D3WA 3OLBA 1M90O 5KPRA 1FCAA 4ALZA 2R3VA 4A8WA 3QBCA 2NXJA 3W63A 1S57A 2CQHA 2BJ3A 3IMQJ 4FM0A 2Q6BA 3HT3A 2PFFB 5AZJB 5LSOA 3FLCO 3QT7A 3CULA 4CLYA 5LMUK 3PSIA 2UXDF 4UQGA 4EMDA 1S4EA 1QY7A 4ZCKA 4OX9F 3U9ZA 4CLLA 1HR0K 2IM1A 4EFAC 3L2QA 2WAQD 1X9MA 1JQGA 3L2WA 1GLBG 4ECWA 3OXLA 3V4MA 2M70A 2FVPA 3SDEB 4IOAQ 5FPDA 2DNQA 3J8AA 4ZJLA 1W97L 3GDQA 4ED1A 3C6HA 4OVLA 4RKUC 1DARA 5ADZA 3DM2A 3OHAA 2HZAA 2C1EB 4CHQA 4E2FB 3I0RA 1WORA 4WFNQ 1WNEA 2HHXA 4ED0A 2BJ9A 2C2EA 3VQ7A 3CD0A 4PY5A 1KBRA 3CCRS 4L3KA 3VGUA 2IFXA 2FHJA 5KT7A 3E9PA 1LWEB 3AA5X 2B5JB 4IFVA 3OTOJ 3AQOA 1IO2A 3EKSA 4PG8A 2X1GA 2UV8A 1WKJA 2MY8A 2QA1A 4QOTA 2B3TB 1SQFA 1R0CB 2GV9A 3EGNA 5KFEA 3ZTQA 2RF2B 5HJYA 4O3SA 4Q45A 4KR0B 4B3RK 3MCNA 3VEWA 3LZJA 2ZQBA 3KHLA 3ENOA 2ZJPQ 3M8QA 2KHOA 1WACA 1X5TA 2F3JA 1FVSA 1KQKA 3TAMA 5A2QU 4EP4A 2V2ZA 1R27B 3Q86A 3QGGA 2HEKA 2ZHAA 2VB6A 4FOEA 2OMOA 4UZCA 2FLLA 2XS7A 2CQ0A 1JNZB 4FWSA 3LDQA 4RW6A 4GV6A 3K89A 1E4GT 2GC8A 2WOMA 1NGAA 4CZKA 1Q5VA 5AQZA 4ANCA 2KZZA 2APOA 1WC4A 4Q43A 3GOIA 3MEEB 2BKOA 1TUVA 4C11A 1YVNA 3RAXA 4FJ5A 5E5NA 4JI7F 1K8KA 2VYPA 1IUJA 2NNWA 4YDXA 2F40A 2ZNZA 1NK9A 1WHXA 1IH7A 2WONB 1BL3A 5AQWA 4M1KA 3N79A 4AFFA 5M1QA 2VL1A 3KG4A 1UPPA 1QUVA 4X64J 2P9LB 2PMHA 1VYAA 1K0VA 2DB1A 4WQ4A 3AT1B 5IXUA 2HRUA 1UCNA 1LWCB 3P83D 2LVWA 3BSOA 3MUVP 1N5QA 1K47A 2EWHA 4E7HA 1REVA 5IV3A 4V19X 4I2QA 5HMXA 4AXIA 4B1WB 1CJTB 3FZMA 4DSIA 2NZ4A 3MHYA 1MA9B 4HH1A 1HHTP 4BC2A 3QRPA 3GB0A 4DS5A 1HJOA 2Z1GA 1VLOA 5B0AA 5KT5A 1YRTA 4NRUA 1Y3KA 1QQOA 3KZBA 4FM1A 1S1UA 2VV5A 2GIRA 2HNZB 3RBEA 3T1YK 4L6V3 3HO1A 3W8PA 1YK9A 3T1AA 4BR4A 1NMEB 3DXBA 4BDYA 2O1PA 3RG6A 3K0SA 2Y1IA 1IBLF 4DTSA 5F3TA 2XMKA 3LZIA 1DTQB 2J6SA 5AQNA 4OYMA 1RTDA 3M2UA 5KPZA 3LALA 4ZA1A 2MJNA 2BE9B 2HAFA 4QAGA 5A6PA 3KJFB 3ZETB 5IC4B 1H0HB 3MXIA 1FO1A 1VISA 2IRXA 3SZ2A 1H6KX 2F7VA 5GAHI 2DGWA 5B0DA 5DM7L 5F2RA 1VQNN 3E01A 2KQ2A 4FWKA 4KHMA 3W2VB 1NSQA 3TSUA 3MCOA 4I7FA 1JJ2M 4HI2A 1QVGM 3JSYA 3L7OA 3I0SB 2Z1IA 4ID8A 3BJYA 4CJSA 5GIOA 2VONA 2YPYA 1O1WA 2HOEA 4OJ1A 3SMPA 1WOSA 2EFVA 4FLUA 2CPEA 3DLGA 1MWKA 3VEYA 2F5GA 1MROA 3B6BA 2HHHK 3W5ZA 1RT4B 3QT5A 3SSQA 2QC3A 1MDUB 2Z1HA 4U6PA 1BCOA 4CLTA 4CF0A 3OYBA 2JWKA 1GT8A 4YFUA 4W92B 3Q8RB 3BGRA 4ZITA 4UW2A 3UWTA 3MEEA 4CT8A 1FA0A 1B7YB 4F50A 2FYXA 3Q22A 4OJRA 4X4OA 3M2RA 1VQYA 4KB1A 3QETA 4NEYA 2V50A 2BTFA 3GE9A 1HI0P 3BF3A 3T1HK 1L3SA 3F73A 2J5AA 4RNOA 4FZVA 4ZVGA 2M8HA 2RIJA 2XMAA 4EFHA 2XWXA 2NCKL 3O1LA 5IM0B 2KRRA 3I4HX 3I33A 2KYZA 1NJIT 4KGMA 2G2ZA 2LYVA 1S10A 4YB5A 2ZH4A 1DRZA 4Y2AA 5CYQA 2XCPA 1JLAA 1PJ5A 2E7XA 1NNEA 4IG0B 3IG1B 3TVZA 4ZDNA 2ZBCA 4QR1A 2QLWA 4EWTA 2HNYA 5L38A 1KAXA 1FEHA 3CPWM 3CCMS 2B5JA 1KCFA 5IQ6A 2E88A 3CJ3A 2FGCA 2PFUA 4ELUA 1V3RA 3T19A 5THWA 2BABA 2HWIA 2PEHA 3RMAA 1VDHA 1FX4A 2RB7A 2MJUA 4FXDA 4FK2A 2Y3YA 3NF7A 1TU0B 3L09A 1YZ7A 3BQ0A 1X0FA 3UKUB 1M90T 1IBMJ 4I6MB 3U3YA 2F8SA 1U24A 2VG5B 4KGXB 1A7GE 1RQ0A 1KRPA 1Y64A 3PFEA 3MUTP 1U6FA 3L95X 1CZAN 3NF6A 4JUZA 3TW0A 4M41A 2CJQA 4BQLA 1S1XB 4DL2A 4KQZA 1EZZB 5MAOA 1VSFA 3MAHA 3PR5B 1S9FA 4Y1CA 4FBTA 3VQDA 1NGEA 3PW0A 2FHOB 4OZLA 3CJSA 3VEVA 4ICLA 4KBIA 1FWPA 4DG1A 4F4YA 3QMLA 1WKKA 2G8WA 1SJQA 5HRPA 3NDKA 3V2UC 2NLXA 2ZJPL 4LFBK 1XJWB 4X4QA 4B1XB 1BGXT 2FZGB 4I9LA 4ZOSA 5KG0A 1MWYA 4I6AA 3FZ2A 1IJEB 3M8RA 4Y28C 1KNZA 4CH7A 3JB9k 3KWMA 1YJTA 2XNQA 3BZKA 2QSWA 4DLGA 1U1KA 3TJAA 1FHTA 4HT5A 2OD6A 2WBRA 2W7PA 4IQMA 2VQEF 4CJKA 1E4FT 2I7PA 4IOCL 4FS2A 3T5JA 4CO1A 2KT5A 2UXDJ 2EX3A 1IKWB 1X4DA 3VENA 4J9UE 3O44A 1R31A 3A3PB 3AAQA 3QBWA 3AJDA 1CC8A 1PC4A 3ZX2A 4R0JA 3JTOA 2VPZB 1UEUA 3K5PA 1KXPA 3NY0A 1T7PA 2D0PA 2WC9A 3VZHA 3U1LA 3OT9A 3HSCA 5IM0A 1BIUA 4F67A 2Q3SA 3QZ7A 4NLWA 4DR3K 2CJAA 3BY5A 3PR4A 3HSGA 4MIWA 3V81B 2NYIA 1CLQA 1NAQA 4CLZA 4IO9Q 1S76D 5JVGL 1FX2A 1RCXB 2V8VA 3GLJA 1FKPA 3Q2TC 4TY9A 4UQTA 4XDDA 4WQ5C 1NG9A 2YHAA 4JV5F 3VQEA 5GAEI 5KAKA 3GILA 3ZNJ1 5DLGA 5KFCA 4JI8J 3AVNA 4M3ZA 3MN5A 4WYBA 2JVOA 3V6KA 1KWMA 2UP1A 4X64K 1N52B 3SQ0A 4ZPTR 2NPIA 2XHBA 2OPSA 4K25A 4DG1B 3PCOB 3ZSQA 2CA9A 3T5LA 4E0DA 3HI0A 4ZPCA 1Q78A 3E66A 3AB2B 4CO5A 2YWHA 4DR7K 1UAWA 3FEZA 1B7FA 2Q3PA 5CXTA 2FSKA 4QYZK 4C1NK 3CETA 5B8HA 1DTTA 3D0PA 1BG3A 4IG3B 1NK5A 3P31A 4ES2A 4DQIA 2NUBA 2QZ8A 4X62J 3RBZA 3ISND 2LQ9A 4H4MA 3N6NA 3CDEA 2RKIB 3QFUA 2ZKTA 3JSBA 2HQCA 5AQOA 4O5FA 1X4AA 2FLPA 4K4XA 3THYA 1F3FA 3P8BB 1IKVA 1RT6A 1H74A 3HZEA 3AOAA 4CERA 1IR1A 1VRUB 3KYLA 4K4WA 1T02A 4LF4K 4RUHA 1GLLO 2E7VA 5I3QA 5KFGA 2W24A 3D28A 4JI7J 3NBPB 2DO4A 4BBYA 2X78A 4OIXA 4Q2MA 3JQMA 2YV0X 1NJIO 1AT1B 3W5YA 5LMUJ 4XTTA 3VHQA 2XGPA 3WEEA 3GE1A 1QTMA 3CT9A 4Z2XA 1BUPA 3WC2A 2V69A 4LFAJ 4Z4IA 1RWXB 2K1RA 2DR8A 4B9TA 4LF7K 1XMQJ 2HNYB 1YJRA 2FVCA 3MMAA 4LUBA 4E7JA 2XS5A 2GS8A 2J9DE 1FXXA 1U8SA 3AA3A 2RUSA 3B8HA 2B56A 3H5UA 1Y3JA 2BVZA 4PHTX 4BRCA 4QU7A 2XNRA 2FF3B 1LW0B 3QJPA 5DETA 3TJ9A 1YSJA 1BCMA 2X6SA 1F6TA 2RDJA 2DR6A 2MZJA 2CPFA 5AE2A 3Q2SC 2Z2YB 1NJWA 2FZCB 2BE2A 3TJ8A 3LPTA 1RGIA 2UUCJ 2I2YA 1SIZA 3EEQA 3Q8PB 1RILA 4FBUA 3IWXA 5BPNA 3AARA 3M6WA 1HNXK 1Z2LA 1SJFA 5KFTA 5L1IA 1RT3A 5KFJA 4ZP6A 3SUQA 3HD1A 2W1BA 1N8RT 3F44A 4ZP9A 2D74B 1NH8A 4B3MK 3RGIA 2HLTA 3P4UB 4QZVB 4EHTA 1RLCL 4OI6A 3GV7B 1EJ7L 3W66A 1J2VA 4WFBL 3OVBA 2JWLA 5LT5A 5J1PA 1P8GA 1ZOTA 3E51A 4BCAA 4USJC 4HTIA 4KYZA 2ZWPA 4OO1J 2XMJA 5K14B 3F2KA 3W60A 4EUVA 1RT2A 3SQGA 1OQ3A 3NLCA 2C28A 1SJRA 4CEEA 2HLUA 2DNPA 4GV9A 4A8SA 4ZLNA 2DPJA 1CJKA 2VC0A 1UA1A 2PDAA 4JV1A 4IFYB 2OPSB 1C0FA 3HP6A 2AYBA 4O0JA 3GCXP 3C2PA 2BE7D 3B82A 3A8YA 4QIEA 3WQTA 2QX0A 2UXBF 1PYSB 4NLVA 3S41A 4YP3A 4NCBA 3O9RA 4UY8T 1O13A 3V9XA 4MDBA 5LXYA 5DK5A 5DZ7A 4DV7J 2BW2A 5KGWA 2JFKA 2CGJA 4FW2A 4BRNA 5ETTA 4RPFA 3CD6S 1KC8T 3SAFA 4M5HA 3A8JA 1APSA 2VGNA 1JLFB 1NGBA 4FF2A 4KH5A 3THYB 2OA8A 5KPTA 3FGVA 1RZMA 3CCUS 5ETOA 3DRRA 4YORA 4JNEA 3S3OA 1FJGK 1HPMA 3DLKB 2BKNA 3SQOP 3QGIA 3HHLD 3RJMB 3I55N 3R5GA 3SCXA 1V3SA 3MEDA 1HL6A 1N36F 1RBLA 5HQLA 2SXLA 2R7WA 1LCUA 2D41A 1NHVA 2ZH2A 2J8SA 2DHSA 1CVJA 2X51A 3MX2A 5D0RA 4UOGA 3SDEA 5KFFA 3WQPA 2UVRA 4ZTJA 5JVHQ 5CHIA 3VF6A 4J9OA 1H72C 4CGJA 1RDDA 3CFPA 2J7UA 1GLAG 2XI2A 2WTFA 3M3ZA 4DQQA 2ZC3A 2K3KA 4N47A 3OR1A 1VJWA 4OI1A 4CGGA 2D0OA 4JS5A 3TA2A 1YITN 2XYPB 2BE2B 3AOBA 1HNVA 4UT4A 4Y2IA 1T9WA 5AFUH 3EDQB 1WELA 4BRLA 1RUSA 4CF1A 1S0VA 5HOOA 1UVIA 2DTJA 2M4MA 3V1QA 4DPWA 3N9UC 1S49A 4H54A 1RP5A 3VVTA 3M1FA 2VZ9A 3M9OB 3NWRA 1LFWA 4P72A 5KT2A 4ECSA 4H8KA 5F0XA 4LQ9A 5FD1A 1T9XA 4NOHA 1S5ZA 4RWXA 1L3TA 4XH5A 2V7YA 2ZM6F 3UD4P 4FWPA 2FGOA 2IDOA 4NLXA 3OTDA 2W41A 3CFOA 3D2FB 3OFEA 3H3NO 2XBPA 4NYOA 2X6NA 4FNIA 3ATUA 1PO6A 4OPJA 3BSCA 1VQNS 3CSKA 1IJJA 4BQZA 3MECA 3VGMA 2PYJA 4RNNA 1NKBA 2HHWA 2N3LA 5EWEA 5FLXU 1Z05A 1S48A 1PBAA 1QZ5A 2ILZA 3ILOA 4BC9A 3D5MA 3F9MA 3G86A 4QW8A 4FNHA 2PSZA 1X9JA 4DTMA 2MGZA 1UZHA 1Y7PA 2OPPB 3EYZA 3A3OB 2NRTA 1BA1A 1IBKF 2D3OR 3VQCA 1UFKA 5C24B 4PWWA 1YTAA 2P9SB 3M8ZA 3RR8A 4P9SA 1UEKA 3A12A 3AQPA 4XH4A 1FDDA 3O1BA 4JN4A 1DBDA 2H3EB 4JHDA 4A8XA 1IBCB 4ZVPB 1N6QB 3HKZD 4BDZA 2W9AA 3KK1A 5CY4A 2W8KA 4DR1F 4YB6A 4HDHA 4AQYJ 3RB4A 3W3SA 1FK9A 3DLEB 1NB2A 4JHDB 2HGNA 4C3MA 2QA4S 2YVSA 4DR5J 3KMQA 4HTJA 4KKOA 4HLBA 4LQ3A 5B7WA 2JNJA 4CE9A 1RTIB 1FK9B 3DLEA 5E0OA 3TANA 3ULEA 2FDNA 5L1LA 4BS2A 4DL4A 4ZK7M 4CDIA 3CMAS 2J6TA 4CJLA 2JH3A 4P73A 1BD6A 4FJXA 2MLXA 2HQIA 1LWFB 1AXQA 1QZ6A 2FVRA 3ID6A 4NA1A 3GMGA 3RAQA 3VERA 3M6UA 3UDLA 3H1VX 2DJWA 3OJSA 5E3PA 1WUUA 2QG9B 4LRDA 3FVYA 3BH7B 3HK2A 4LSLA 3WNGA 1WC6A 1UWAA 5KOXA 2GEMA 3Q8VA 3T6BA 1SKRA 2V2KA 4L3QA 1QQCA 4DV5F 2C2NA 3ZLJA 1FRLA 1QAXA 1Y97A 3RBDA 4ERDA 1UL3A 5A8RB 2BANA 2Z56B 1XN9A 3AO5A 3B78A 2CKWA 4G1QA 1RXOB 1C4AA 3CQ8A 2H54B 1XI1A 3J80U 2EK6A 3RMBA 2IC3B 3DCAA 4GNIA 3OTOK 4DR3F 1YTYA 4J9LA 4B3TK 3M2VB 3HHKA 3GIKA 4DTXA 4CESA 5F9LA 2QXLA 1RYRA 2F8MA 4BRIA 2E9TA 3M30B 3CCES 2VICA 3KDNA 2RDDA 3VMFB 2R7XA 3WC0A 5KFXA 1CZ9A 4F7VA 3LDLA 4O44B 4FWRA 3ENBA 1NPPA 2VBWA 2CPIA 2VBZA 5FLXO 1HMVA 2UXCF 4F9OA 2HBYB 4YDUC 4JI2F 1NLKL 2RQKA 1DLOA 2X1BA 5F8GA 1RTJA 2PMWA 5SZTA 5JXSA 3RSEA 2E1YA 4HACB 1HARA 1SH0A 2E5LF 5HQ8A 3R5AA 3FRYA 5ETMA 3KLIA 1UP1A 1R89A 4BG8A 3BZQA 4RBVA 4A8YA 4DQPA 1NSAA 2M9KA 4IEIA 3FEXB 1WC0A 4WTYA 1M1KT 4B3TF 1DKGD 4OPKA 1VQPS 2NXEA 2FIUA 2N82B 4DV2K 3L3VA 4CO3A 1P9QC 2FY8A 4M5KA 3GR1A 4MFBB 2E1PA 3I4PA 2J6UA 1P27B 2C2RA 4U7UD 4KO0A 3BP8A 3CJTA 4XO0A 1X4FA 4C48A 3FNNA 3P39A 3VA3A 3CJ0A 2V5HG 3UIQA 5CCMA 3EE9A 1I94F 3I0SA 4DMZA 5ITHA 3QNOA 1F2HA 4ELTA 3GIJA 3CJ8A 3DNCA 2ABYA 3EDRB 2LEBA 1T8EA 2DTUA 2LLZA 3NRBA 4LF8F 2HURA 2WVCA 2ACMA 1Q1KA 3EX7B 3NGDA 4Z4CA 2DFHA 1VOMA 3EPIA 4WE1A 3VF4A 1REVB 4CZMA 2KN4A 4AM7A 4NZ6A 2A6AA 2RDIA 2J76E 3MWPA 2VA2A 4H5RA 1RNHA 3KDOA 4IQXA 1YX2A 4M5DA 2KJVA 2AKWB 2IGIA 1EO1A 3WX4A 4PXEA 4X4NA 4H0YB 4R8UA 5ETVA 1IM6A 2GNKA 3MD3A 5GVQA 2V4JA 1EX4A 1YI2N 3HHLA 5F0UA 3EZ5A 3BGFA 1TUYA 1NBWA 1TKZB 1Y5IB 2LA4A 2DPNA 2ZUAA 3OS2A 1Q81O 5L39A 1WHVA 2M5YA 4KH6A 4F02A 3L6QA 4MIAA 2QFJA 1LOUA 3A8IA 5EX3A 2R7TA 2EG1A 2Z2LA 2IM2A 5HMWA 4ZCIA 3A3NB 1WSVA 4EAHD 1ILYA 3NS6A 3AVLA 5D0HA 5LJWA 3NNCA 4CIFA 4I4BA 3CGIA 1SV5B 5KFQA 1HMVB 2MB0B 2O8FB 4TLRA 3P4IA 1LEOA 5D6GA 3E2EA 2ZF5O 2HZVA 4CZGA 4KRWA 3MN7A 2RH3A 3JAMO 2RILA 4K4VA 4RW9A 4KIAA 3MM6A 3NH2A 3SPYA 1C6VA 1B0TA 4CJVA 1VMBA 3TA1A 5BN8A 3CPWR 4ATNA 2DGOA 3THXB 1IBMK 2NUHA 2NZCA 1MU2A 3KLFA 3GIRA 2DYAA 2OSQA 2WCXA 2NSBA 3MM8B 4P2FA 4OL8A 2DK2A 5BR8F 3DOKA 4EEYA 4Z0UA 4Z4FA 2RQMA 1S9EA 3MD1A 4OJHA 1VQ7N 4EI2A 3KK7A 3Q23A 2A1BA 2QA4N 4CFDA 1RA7A 5B08A 3CWJA 1JB0C 1WJ9A 4LSLB 4NE9C 2U2FA 2YX6A 3D6HB 3AAWB 2GFFA 5SWMA 3MAAB 4ES1A 4KHNA 4M3UA 3CCWA 3R5CA 1UPMB 2G4BA 4MYUA 2J4RA 2HS0A 4RNFA 3SBGA 4P75A 5A0YB 4RO0A 3LP2A 3EO3A 1EWQA 5E41A 2DO0A 1D9AA 4HKQA 3IBCB 2Q6CA 1XQSC 3H2LA 3R7NB 1ASVA 4CFAA 1TUUA 1H2UX 2V8DA 5FRMA 3QJLA 3CJKB 2G2YA 2E9ZA 1SXLA 4LH5A 2BBEA 4C7QA 3VF2A 2GV1A 2B9EA 3DLRA 3I0RB 2GX8A 1HQUB 1VC0A 4NRTA 2JFDA 4B3RF 3P96A 3QFHA 3W2WA 2CNNB 4CLKA 5KG5A 2LSNA 3HBTA 4YOXA 1I51B 4DV3K 2DGSA 3CJKA 3ZZZA 4ICLB 4P74A 2X74A 3OYNA 4H0PA 4F0KA 3GJTB 2DH7A 2ZUGA 2V52B 2XEXA 1BHLA 4MKBA 1S1VB 2MHNA 4IJNA 2A3ZA 4TKTA 3CUNA 1GMWD 4YOEA 5KFAA 2LEPA 4ZS6A 1OMSA 2YJFA 3JS9A 1VQ7S 4PQUB 4P7TA 1BE4A 2F9TA 3FQLA 5IZHA 3J7AP 4H5WA 3OYJA 3SBTA 4QBUA 1I5OB 3IRXA 4DL5A 1BQNB 3D6MB 2BDPA 4DZDA 5H1SV 4K8XA 3FCWA 3RRHA 4DKWA 2DH8A 1JL2A 4ECRA 2ZH3A 4OV1A 2CH6A 5FROA 3PW7A 3AVHA 2F1FA 2W6LA 3E9LA 2CVIA 2D1CA 4OHWA 3U1NA 1JL1A 3ZSRA 5AXMA 4AM6A 3OPKA 1RE1B 4CIOA 3SCLE 5DS7A 3MAAA 3ZYYX 4IH7A 1BY9A 3U27A 3MX5A 1GXLA 4Y2CA 4FWLA 5CHCB 1VQ4N 1NLVA 3P5JA 5EU7A 3R8EA 3CCRN 3L4QA 1NK4A 1NM2A 5GAGI 4FPRA 5AT1B 3FK4A 3G0ZA 4CZJA 1CXUA 1GLJO 2ACYA 4NMXA 1N34J 2ZZNA 3OA9A 3I55S 5AXLA 4I1TA 2P9IB 4F26A 3CCQN 3PW5A 3TOQA 1TKTB 2DKOB 2QWLA 5LJVA 2BJ8A 1B70B 1FW6A 1HBUB 3EZOA 3HHDA 4LR7A 1Q5YA 4J2EA 1GX5A 4DV5J 4S0MA 1T11A 2YY3A 3V9ZA 5G4DA 2R8HA 4C8YA 4O3NA 4YR3A 1CJKB 2HSEB 2XYGB 5AZIA 2NRWA 1HBOA 3IAS9 5LMNK 3LTOA 4LRBA 1DJ0A 4BY9C 1ZPVA 2IYGA 3KHRA 3IA0A 2NUUG 4NO7A 3L3CA 1HR0J 1U1OA 2GGPB 4K0KJ 2EFNA 3ATVA 4RW8B 4ANEA 2GHPA 4KGKA 5KFNA 3KLEA 2XI3A 1RAFB 4H0VB 5AQPA 4KPCA 1URNA 3OR2B 3HVAA 3DDNA 3C7NB 2MPUA 4LRCA 1Q8KA 2QSFA 4RG8A 4PZVA 4CJQA 3PW4A 2GELA 2P9GA 1VRTB 3B6PA 3GG1A 1RBOB 2MYFA 2GWKA 2RRAA 3UKUA 1BU6O 1RT3B 3KK2A 2CJBA 3OY9A 1Q82T 2JVRA 4X62K 3NMAA 2YH1A 1AUDA 4FKYA 3W3DA 2ILYA 4A57A 1SKUB 5F3ZA 4FZZA 1HLWA 2ADCA 3W64A 4NCAA 2HFZA 1U49A 3FCVA 3MM5A 4CP5A 4RZRA 4F8RA 3RMDA 3AD9C 5GMEA 4M94A 4FJGA 5T7LA 2CDRB 4RR5A 2C42A 1OH7A 4JI1K 3TO8A 1NDCA 4DR7F 3V1OA 1VSKA 2CFXA 2DD8S 3W1YC 3J7YP 4IO9L 3HPHA 2DR5A 1QQNA 1FT8A 1VQ5N 3CJ4A 3QBXA 3HVTA 3LM2A 2CQDA 2OKQA 2N4CA 2VKRA 4LC9B 5T7LB 3LANA 1HNIA 4FJIA 2IA0A 3LPUA 3J81Y 4FJMA 4NLRA 1F9HA 4JKHA 4FF3A 4P71A 4J2AA 2PN6A 3A5MC 4P10A 4L76A 3H0PA 3QWUA 3EM1A 1VSLA 2GUIA 2GAHC 3O8MA 3R6LB 1OVQA 1JLEB 5ADXA 1X4HA 3FQKA 1VS3A 2JRSA 2KJWA 3IGVA 3QLHB 3MK6A 2AWZA 1R3NA 3FCHA 2GZOA 4JD2B 3CERA 2BUPA 2QJ3A 2HQDA 5CZ2A 3R5DA 4A62A 4ZIWA 4CJPA 3SI6A 4W5OA 1ELOA 1JLEA 2ZEJA 4DV3J 1RI7A 2HHSA 1P1TA 2HS4A 5L1JA 4DF8A 3ZT1A 1HNZF 2A1SA 3OHRA 2R8GA 4JI4K 2F9DA 2PZSA 1S5JA 3VQBA 1B99A 4I7FB 1KHVA 2EVZA 2DR9A 2IMOA 5DGAA 1BLUA 4RW4A 2DNOA 4FN5A 5L9XA 3U6FA 2ZJQQ 4Q0BA 2QN6B 1F9EB 2F4VJ 4JV0A 5LOQA 2F4VK 3OYDA 4YS2A 1WAJA 3RW6A 4ILMA 4LR9A 2AGPA 2HIQA 3MR6A 3VALA 4OLBA 3ZCMA 3NCRA 4L8RB 4Z4GA 5HRRA 2ADBA 2OPQA 4BGBA 4GC6A 2LU1A 3PX0A 3EICA 3DRSA 2XSJA 2R9LA 3S6EA 4DV0K 1OYEA 4NXNK 2F9JA 4FPBA 4R79A 1B9FA 1NEEA 4ECYA 4KO0B 3I5CA 4RL1A 1CC7A 4C0HA 1S59A 1F1BB 2BH1A 4DX8H 1WF2A 3LGMA 2PI5A 3K9KA 4MT1A 4DFPA 1U47A 3KK2B 1JMTA 5JVGQ 3PRDA 3D2WA 1VRUA 5HVGA 1Y0HA 3N01A 2DNMA 1MWMA 1OVYA 4TN2A 4B1YB 3QAEA 5T7BA 2YKNA 3K58A 3C8YA 2MTLA 3TEGA 3PIPQ 3JYTB 4CYUB 5BYQA 3KVGA 1N5TA 1W7WA 5J2QB 2FXUA 2AP1A 1BWFO 5CD4A 5J1EA 4CHOA 4PG6A 2RMLA 2J0SD 3KMSA 1QE1B 4PR6A 3I8DA 2VBYA 4IWVA 2F7TA 3PACA 2C2KB 4EZ6A 4DWIA 2O8DB 4M3YA 3CTRA 3HLUA 4QWDA 5C2CA 1S1XA 1QD1A 3WNEA 3H98A 3M4XA 4DV0J 2A6OA 3N6LA 3TYTA 4KH0B 4DR2F 3TTCA 4OPAA 2CXEA 3K5MA 1YT3A 1HNZK 1GOAA 3BBBA 3CF5L 4IDKB 3VF0B 4C8LA 2Q66A 3PIOQ 4LF4J 1FKPB 3ELHA 1GXUA 4ZPBA 1IR2A 3RW7A 4RW7A 2EHGA 4DXLA 4O0NA 4P2SA 3KK3B 4PUOB 5M2RA 1TAUA 1S9GB 2XTJP 2J9DA 4DV6J 1HQUA 4ZJOA 3JTPA 3SQ2A 2BRKA 1HA1A 4LF5F 4WTOB 2QRRA 2UUBF 3SUPA 3AHPA 1ROFA 3HT0A 5ETLA 2R7RA 1C0TB 5EDWA 4FK4A 1QVGR 3OFGA 1RB0A 4DFKA 1U8WA 2XLIA 3AODA 2CPHA 5CZXA 3I9V9 2HHHJ 3DJCA 1FXLA 2RD5C 2VH7A 4CHNA 4DL7A 1WSFA 3J7AN 5CR4A 1EP4B 2VFSA 4DV5K 2QL5B 4FYXB 1T44A 4I69A 2W40A 1NDKA 1SCJB 2ASMA 4JI6F 4WFBQ 3AD7C 4QJVA 1HNXF 4NLPA 1A5WA 2KU7A 1TL1A 3MMCA 1VBZA 3BDPA 2ZH9A 2VWKA 4BC4A 4JYAF 4QIWD 4DV4J 3L2RA 1FJ7A 3IKMA 3N0VA 1AA1B 5H9FK 3OJUA 1KQSR 3FGUA 1YVFA 3QQCD 5H1SQ 1PGZA 4DSLA 1B3TA 3NCIA 3CO9A 3RYLA 3WT0A 1XMOF 2IRYA 3TVYA 2VODA 3EE8A 4DUYF 4O3OA 2OYQA 3AVJA 5HN0A 1CJUB 4G9ZA 3D1OA 3MGJA 4CGFA 1LNQA 4DDFA 3NXZA 2B8QA 5J2PB 1W2IA 3BKTA 1RK8A 5FPNA 2Y1RI 4QU6A 1WSGA 3UB5A 3LWMA 1YRXA 3DOLB 1HBMB 1T6CA 3CCTA 4YY3F 2O67A 4CJFA 1F5AA 1D9FA 1QDUB 4B9UA 1SQKA 2CYYA 4CLUA 5C10A 1H7XA 8AT1B 4JI1J 2G9OA 1U1LA 5M1KA 4PXCA 5EHHA 2ROGA 3G6XA 3PJ9A 3RUBL 1RJJA 2DGUA 3UR3C 3RB6A 3H4DA 4OZ0A 4KTWA 2GVDA 4ZVTB 5LMNJ 2NR0A 2UXDK 1IR0A 1XMOK 4MMOA 4ZPDA 1BI4A 3CDUA 2ZNYA 3NGUA 2AT1B 1KVKA 4K5SA 3IRWP 4FJKA 1MMNA 1HR0F 2PT0A 1RDUA 4R5PB 3G9CA 1F5CA 3L2VA 4K42A 3G71S 5HQMA 1KONA 2FLNA 4KHWA 3KOAA 3LDSA 4FVCA 3O1WA 1ZM9A 1CJTA 3OFHA 2CGLA 3CC7N 1PJ6A 5J2NA 2C2OB 3PW2A 1KD1T 1V4SA 6FDRA 4B3OA 4ENOA 3ISZA 4ETXA 1G3OA 4L74A 3QESA 3THXA 4YDUA 2OEMA 3TRGA 1BXNA 4CJTA 1XHZA 1T9VA 1ESVA 3DGVA 1S1UB 3C0BA 1AROP 3V6DA 2KFNA 2HHPA 5EOYA 4N8NA 4UOFA 4LF6K 4BWMA 1Q16B 4Y00A 4X66F 4CCHA 4XDCA 1OPIA 4YR2A 1NB7A 2QIFA 3A2FA 4AXJA 5MLCV 4QYRA 3MR5A 3A0IX 1CSJA 3C6TB 5AQTA 3LWLA 3SAGA 2KM8B 3T1HF 3PIPL 4J2DA 2QTWA 2W2NP 3QNWB 2E6MA 4URGA 5L46A 1TR0A 3M2RB 4Z7CA 5A6WA 1EX8A 1CEZA 1NWKA 5E84A 2X1AA 3G6YA 4E3SA 2W2QP 2A2CA 1TTHB 5D4LA 3C6TA 1X1PA 4UF4A 4AD6A 2QWQA 4IBNA 3PYFA 4AQYK 4B9MA 3SYZA 3IGNA 5ETKA 1CZBA 1HNIB 2BQUA 1IVZA 4PKDB 4CEFA 3OSPA 3CYMA 1AUSL 4V1Ak 5AQFA 4X2BA 1NK0A 1V5IB 1U1RA 1TP7A 3MURP 4WP9A 3GCWP 1XR7A 5HVHA 5TKYA 1WSEA 4UUWA 4B3OB 4NI2A 3P1GA 1KVJA 3ILJA 5K20B 3QFPA 2KXNB 1UVNA 2EFOA 1S1TB 3M1VA 1ZBHA 2O01C 1TFYA 3IFRA 1Q7LB 4M5LA 5D3GB 4F4WA 4CQ1A 4DCPB 3HTVA 1JKHB 1L3KA 1O0PA 4KTZA 1CBKA 1KS2A 2WSFC 2IY5B 1TFWA 1URRA 3C7NA 1CQMA 1EHWA 1NHUA 4D3GA 1N48A 5HBMA 3HSJA 4OZ2A 3VCDA 5ETSA 3HCXA 4E19A 3MFHA 5CZVA 3GFHA 1AB8A 2FD2A 3SFUA 2HF3A 3DRYA 5KG3A 1LK7A 4EBDA 2F96A 3DMJB 4PWUA 4BR0A 4LIRA 4HT7A 4MJKA 4O3PA 3MM9A 2HNZA 4QIFA 3BPDA 3CJ1A 2YKMA 3UR0A 5FPEA 4CEQA 2YHBA 2RKIA 1NH7A 2OPRB 2WVFA 2YXLA 2WW4A 2DT9A 4TY8A 4B1UB 4ECUA 2JDJA 1T9YA 3ZC4A 1VBKA 2V2QA 1U2FA 1KSPA 2E1AA 4CZEA 4I2QB 4KV8B 1VJQA 4KREA 3FC9A 2GVZB 2HVZA 3AFGA 1EIYB 4CLPA 1M5SA 2W9BB 1RTHA 1SJ1A 2DNNA 1SL1A 2NSCA 1VSDA 3HULA 4Z37A 4BWJA 3NGIA 3UDVA 1N33F 3VQ6A 3EVOA 5E3CA 1RHJB 2LEAA 1ICEB 4OYXA 3C65A 3LPEA 3M8QB 3ZSYA 5GADP 3NKYA 4FOIA 2MQNA 4CECA 1UW9A 4JI0F 4QCLA 2FQQB 5IT9U 4C23A 1TL3A 2RF2A 3M2VA 3DRPB 2G0JA 3PV8A 2UVUA 2PFDA 2I5JB 3H3OB 2HMIB 2BUNA 1S7HA 3HOTA 3I8BA 3U9DA 1NNDA 3KK3A 3NS5A 3DU6A 3A1YG 4B1ZA 1NK6A 3UNYA 2JSXA 3HF5A 4ZLJA 3P38A 5KQDA 3S8SA 1D8ZA 1RBAA 4YDDB 3V9SA 2WW8A 2P9EA 3Q8UA 3DDIA 3H5XA 2P6TA 3EMTA 4HHTA 3ZT2A 2ZZMA 4LF4F 4DQSA 4CVNE 2AGOA 4G3IA 2AX1A 2RU9A 1YRUA 5J1NA 3C19A 3J7YU 2LKZA 1A6LA 5BR9A 3PKMA 2EC0A 2HVHA 3U8XA 2ZWHA 3OBIA 4IKAA 4A2AA 1ZA2B 3KKFA 5I3UB 1TVRB 4EP5A 2MZ1A 1IWGA 1H7WA 3GWCA 2V67A 4NZ0A 3OYKA 1RCOB 2DRDA 3CC4S 2VF3A 1I39A 2D3O1 3W8GA 4XPCA 1WI8A 4TSXA 3CI5A 5SUHA 3KHGA 1YF5L 2RUGA 4JI0K 3TNVA 2YKNB 3MUMP 2MHEA 1SBRA 4DUZK 1W26A 4XPEA 1QAJA 4ID1A 4I6MA 2QFIA 5HROB 4ZN3A 4ZJQA 2IIRA 2E5GA 2YKMB 3IR7B 5D78A 2XG8A 4DCHA 3O3GA 1KDNA 3TARA 2K7KA 1FDBA 1FDNA 4E1NA 4OZ3A 1N6QA 5KFHA 1FRIA 2NZTA 1DT9A 1NGGA 4PYDA 1EQMA 3R6MA 3CVKA 3QZ8A 3CJCA 2BKPA 3QRRA 3R6GB 1YJ9N 2E2NA 4BACA 1C1CB 5GAHP 2O8EB 2CQ3A 3ZSVA 3CQYA 1VK3A 2HRYA 1JCGA 4RNHA 1U6ZA 3SSRA 3S1TA 1WHYA 3D6TB 2VPXB 2VFUA 2AEMA 2UU9J 3NMUA 3B54A 3ULDA 3ENQA 4LBPA 1BQMA 1REGX 4H0XB 2YH0A 1F3VA 1ULRA 5HO4A 4AT1B 4FXVA 5GMKa 3DMJA 3G25A 2MKCA 1MN7A 4OZ5A 3K8VA 4DUYJ 2EKYA 4KHPJ 5K8MA 4MYTA 3T1YF 3AGKA 1X4EA 4YQWA 4JI8K 2FC0A 2GAGC 4NLQA 4Y3CA 3AA8A 1Q53A 2YWWA 5I4MA 4WIQA 2ZH7A 1N0VC 5HBMB 4GMKA 4CJ4A 3MDFA 2P9UB 3OS0A 3BREA 2JEGA 4YOYA 4WZQA 2JLFA 1BWEA 4RUCA 2CWKA 4W5QA 3VAJA 4JBCA 2DY1A 3CMAN 4KHYA 5K8PA 5DJBA 4BRMA 2OP5A 4OGEA 3E3XA 1X4BA 4RNMA 1T3VA 1NGHA 4K8RA 2FUG9 5KOWA 4FLVA 2V2VA 4K4YA 1NGFA 1IQZA 1KC8O 1Y5LB 5IS2A 3EVMA 1MROB 4UUXA 1NRKA 1LXJA 5C12A 4PAAA 1HNWF 1I94K 1KVAA 3C6UB 1F0XA 1SIWB 2VQFK 4EGLA 3VVUA 4PKGA 4ZLPA 3QGHA 4DV1J 1MSWD 5KFMA 2M3DA 4U67L 2UUAF 4HEA9 1RBVA 1C0UB 2KHCA 2VASA 4GKKK 2N3OA 4DUZF 4C8NA 1DURA 2NRZA 1S6OA 1TL7A 3NHGA 2XMMA 1C1AA 1SPBP 3DRRB 3MN9A 2IVFB 4CJ5A 2LQBA 4JKBA 4EU0A 4JV5J 2DRAA 5KG4A 1R0AB 4LF2A 3TTDA 3VV2B 3LGHA 4JI8F 3JTNA 5HI7A 4J9NA 5KQ8A 5JMNA 2U1AA 3LF0A 5KFKA 3PLAA 4PWDA 3FSIA 4X66J 4KGVB 1WEZA 2NXCA 3FR0A 2D0AA 1TYQA 1N5YA 2JC1A 2HBLA 2BACA 5GAEP 3OUYA 4YB1P 2XO6A 4HHHA 3W2VA 4DN9A 4LD0A 4KHQA 1VHXA 4DUTA 2VGMA 4C8OA 3TUPA 1DTQA 1HKBA 2P9CA 1NGJA 5C5JA 4GRSA 2OH2A 1U1MA 1HQ2A 4TYAA 3RTVA 1OH8A 3GFXA 3JS6A 5M2UA 5KG7A 3FBCA 3EUNA 4Y2MA 1SKWA 1D5AA 4J2BA 2NXNA 4IH5A 1WC5A 2ZD1B 2IA6A 2LQJA 2P51A 2ZJRL 2RN2A 3CG7A 1IKVB 1YJVA 4YEAA 1HUXA 3AJ2A 3DGPB 2PEBA 1WOPA 3H45C 4FJJA 2G13A 5KFWA 3B4DA 5IQQA 2X3DA 2E6LA 4K8ZA 1KLMA 2WB4A 1Y11A 1J54A 2LCWA 3UCUP 1HIYA 3UN5A 3BZCA 4IH6A 2ZBRA 2AD9A 3OR2A 3HHNB 4C97A 3MEKA 4KC5A 1OH6A 4IFYA 2RU3A 3JSMA 2H9ZA 3P5TL 4PXBA 4LFAF 3QIPB 3H59A 2GTDA 2EBGA 2KM8C 4A8FA 4TXSA 5AQRA 2BA9A 2DFEA 3H25A 1XMQF 4KH4A 3M7VA 1H3DA 2QMUB 2QO3A 1DY3A 2D9OA 5EX0A 3PUFA 4TU7A 1RDCA 1Q95G 2YKOA 1K73O 4KGZB 4C0BA 1HWUA 2B6AA 5BYSA 5CYJA 2ZFHA 5ETQA 3IR6B 4LY7A 3NOCA 2Y9HA 3M5RA 5CH7B 3KUHA 4IG3A 2CZ9A 4PABA 4CEDA 3M30A 2DGQA 4LRAA 4IYQA 3OYCA 3LP1B 3CJQA 4A8OA 5KTQA 2RSQA 5HLFB 4ED5A 4NLTA 1YJWN 3GR0A 4EBCA 2OHDA 2K1RB 3OL7A 3W5XA 1HHQA 1JLBA 1P90A 3HP9A 2GA7A 1FVQA 2J7WA 3EKUA 2HG4A 3B4MA 2CQ2A 1Z4UA 3LP0B 2GCFA 2YNHB 1SJ3P 1C0GA 3VQSA 2XZWA 5H9EK 2HS3A 3CC4N 5GADU 3HPGA 3WNHA 1FFGB 1RWOB 1GAOA 4DZ6A 2C22A 2BJ7A 3IO1A 3THPA 1QAIA 1FRXA 4M63A 2NPFA 2W01A 2DCUB 4QS8A 5HP1B 3I5BA 4ILLA 1GLFO 4ZTFA 1KVCA 1JXBA 3MPDA 2W4CA 1BI4B 5MLCQ 2IOCA 1VGYA 2QWOA 3TR5A 1N33J 4TU8A 5HK4A 3RRKA 4DSFA 4GVLA 2L48A 3ID8A 4HR2A 1VQMS 1V4TA 4OHYA 3HFVA 3NWGA 1ZC6A 4C8KA 3QWPA 5J2MB 3DLBA 2DNLA 3K59A 2JEIA 3NGYA 3TZXA 1SAZA 3DN9A 3ZZTA 3H2UB 2KB2A 3IRXB 1TK0A 1YJ7A 1HPZA 5B0EA 3S7RA 4ZVRB 1OYDA 2HBJA 3HHEA 2ZJQL 4DN0A 4KSEB 4M3RA 8RUCA 4PRFA 5AQSA 2CPDA 1DTTB 1O6XA 1ZBLA 3O9QA 1ZPWX 3I96A 5F8IA 3D66A 3B6OA 5FRNA 3MTKA 3NP5A 5JMVA 3G2XA 3V9UA 1M5OC 3DI6B 1NOYA 1N5VA 4GVBB 3GIIA 3LP3A 4N5SA 3C3LA 3PXGa 4WFAL 1S0MA 1OS5A 5F8MA 4IXCA 1TL1B 2POKA 1RDAA 1P8ZA 4FVUA 1JXVA 1M5KC 2BW7A 2VC1A 3NOGA 2QKKA 3OD2A 1VIOA 2AF6A 4DV2J 1A0OB 1G1XA 4CK2A 3QIDA 2NLWA 4OYPA 5DM7Q 4LFCF 1HBNA 1HJRA 2Y0SD 5BRFA 1YJ9S 1RU2A 1X3MA 4X62F 2G8KA 2UZAA 1VQ9N 3DLLQ 2V6AA 4O8KA 3BBFA 3MF5A 4JI2K 4HTLA 3VAGA 4HH0A 3H90A 2G0CA 3CIZA 2P9PA 5BYRA 4EYIB 1JLCB 3UN2A 4X4RA 2HMIA 1HWKA 4J9KA 4C3KA 2E5JA 4E7KA 5F8LA 4ECZA 3MOJB 4TYBA 5AJ3K 4DL0C 3TSPA 3BV8A 3IG1A 3VQ4A 4I2PA 2XY8A 4NB4A 2P9KB 3CE8A 4ID5A 4A59A 3AA9A 3NH1A 2OPPA 2Z2MA 2P5VA 1JLCA 5EXWA 2Z58B 4BDPA 4YHHK 1S9GA 3PNIA 3ILIA 1KVIA 3BS9A 5D0GA 4LRFA 3QNNA 2YQ1A 3O3HA 1EXQA 2WRMA 2YWKA 3BDEA 1YG0A 2E1CA 3I82A 1G7CB 4USMA 3FFIA 2DNYA 3T41A 3UE5A 4RCHA 2XRIA 4L72B 1X0PA 2GJIA 3D3CJ 1PG5B 1DQ9A 1R8AA 1MMLA 2UU9F 2OPQB 1H2TZ 3CD5A 2G8FA 3J81j 1DQ8A 3ENHA 5E3AA 2CZVC 4Y0FA 4O55A 3T69A 2XMWA 4Q0BB 2QLXA 3GV8B 3AO4A 1RCHA 4FWQA 3QATA 4ELVA 5IT9O 3LAMA 3PO5A 3DI6A 5HANA 4RJVA 1Q18A 4BE2A 1KR4A 4IZ9A 4Z4HA 3V5RA 3WBZA 4WIIA 4MKVA 1JLQA 5C25B 3H5SA 5LSRA 1W9HA 1FDAA 4H4OA 2VPYB 3TAFA 2A18A 4G6VB 4J8FA 3JSMB 2P9NB 3JYTA 3DLKA 2HK3A 4C1NI 3D3BJ 5KFZA 3JXUA 2FVSA 4YOWA 4F4AA 2DIUA 2QWPA 3RBXA 4TNOA 1VQ8N 3BPSP 1XHXA 5E3QA 1TL4A 1SUQA 4UOCA 2ZH1A 5AE1A 4DR1J 1KOHA 2HZCA 3GQCA 4AQYF 3M2UB 4KHRA 4DR1K 5LMUF 5I42A 2FJBB 3QDKA 2RQ4A 1PCAA 3G96A 1Q86O 1E6VA 2XQCA 1EWRA 2W6KA 3FE1A 2UUAJ 3E8OA 2V51B 3FZFA 4AHTA 2RS8A 4FJ7A 4JI5F 1QSLA 5IT0A 5HL7Q 4JI4F 3VN5A 2HPUA 1GXTA 1ITPA 4MDAA 4DUZJ 2CADA 5KT4A 4DV7F 5HP1A 1ZETA 2VJUA 1JWWA 5CA5A 3LGNA 1VQ9S 4JV5K 4BRHA 5KFBA 3BSNA 1QVFR 1OY6A 3ASMA 4C98A 3KKSA 2PO4A 3C15A 5CZ1A 3SMSA 1FE0A 1TQLA 5HSPA 3R3LA 3OXGA 1SJ4P 2UUCF 4HTUA 3TSQA 3LP0A 1AFIA 2PGCA 3PYEA 4P7VA 4DR6F 2YQ3A 5DG7A 3HYFA 2QKBA 1N36J 1I3OB 1SH2A 3F56A 2HFSA 4QIVA 2MZRA 5K8OA 1C4CA 4HL9A 1GMVA 4O3RA 2PY5A 2XMVA 2O8CB 3EGWB 2KKZA 4E7LA 3PG9A 2O8FA 3AVKA 2OFGX 3LQVA 5B0FA 3WXLA 2H5IB 4J7CA 2ITGA 3F9KA 5E33A 4DU3A 4XIUA 2JEFA 3GV5B 2H3GX 2FBTA 1NDPA 1YIJN 1XNRK 1N88A 3PJWA 1QAYA 2DEJA 4E8UA 3SCJE 2UUWA 1MW7A 4JI5K 2ITMA 4FDFA 1HW9A 4MO4A 1ATRA 4JAXA 2P5GA 1FKAF 5GAGP 2HNDB 4FVMA 5F8JA 3IWLA 3J7ZT 4DX7A 2VG6B 2OMLA 5LJ5Y 2E2PA 4AL7A 1C0UA 5EY4A 3H8YA 3ICLA 2ZOFA 3CC2S 3MI7X 4FLXA 2G8IA 2NRVA 4IOCQ 3HVTB 3VAFA 1ZBSA 4LF5K 3R9PA 4LVNP 1X4GA 4LFBJ 3V6DB 3HHLC 2XYHB 2ZM6J 2OFHX 5K5MA 1HHSA 1GK8A 6FD1A 4ETZA 5GAHU 4NWBA 4DU4A 3BR8A 3SMZA 2OI2A 2GW8A 3CCLN 1W2BM 5HJXA 4U9RA 4AF1A 3LDPA 1HBMA 1VK0A 3HVWA 3PSFA 1B0PA 1V6HA 3M6VA 1FJCA 1MLAA 3G6EN 1OO0B 1H2VZ 2H65B 2BGGA 2R4FA 3ULEB 4QPXA 1KOOA 3ZEUA 1RWNB 3AAPA 5A2QO 2A0FB 2E29A 1IBKK 3L7PA 3T6JA 1IBKJ 2FPHX 3ZTOA 5ADXH 1K8KB 3CEDA 2QYCA 1LWFA 4FWOA 4M7YA 2GGPA 5EUHA 4B9QA 3RU0A 2GX9A 4F3OA 3KLVA 3DOLA 4F04B 3J7YI 4QWCA 5KG6A 4RW6B 2WVEA 1WAFA 1IV0A 1XTZA 2HVDA 5AXNA 1VC5A 2J8AA 2BEFA 3PHEA 1RLDA 2IBOA 4ZVOB 2NQPA 2XO7A 1Y00A 3Q8YA 2QEXS 2P9SA 4BC7A 2XS2A 2J7KA 3RB0A 3C16B 4H4OB 2DNGA 5C25A 2F65A 2AEJA 2QYGA 4USTA 2XZTB 1FJGF 3KK1B 4DX5A 2XMTA 3IR5B 1FEEA 3QO9B 5U47A 1TUGB 5BPMA 3K5NA 5AFUA 1GLEG 3N5FA 3V81A 3PEHA 4MK9A 2PA8D 3CCVN 3U4LA 3NGTA 3A5OC 4ECVA 4OGCA 4CGIA 5DRKA 2DHAA 4DFMA 3TQEA 5C0YA 1NU4A 3M32B 3UN3A 2BM0A 1XEZA 4AUKA 1MG7A 1YBAA 1BIZA 5CAAA 2MQOA 2IC3A 5AQGA 1RWMB 2FSJA 4DSEA 5AQXA 1I1GA 1JLGA 4OLAA 1RWUA 4DS4A 2DFFA 1FRMA 1NU0A 3N28A 4JI3F 3VPZA 1IWAA 4OPHA 2I5JA 1SQGA 3NMRA 2H5EA 4W98A 2RRNA 4EHUA 1N32F 4HHUA 1ZBIA 5DDQC 1KTVA 4WP3A 3GJQB 4DOZA 1HQEA 1UJ6A 1IM4A 2LU2A 3FSYA 1VQ8S 1ZAWA 3CM5A 5GMDA 2CQBA 1HNWK 2YJEA 2ROEA 1MMDA 1XQIA 3IBWA 3D2EA 3HOSA 2VUGA 2LDIA 4O4GA 4RW7B 1YGYA 4WZMA 5EGYA 2KTQA 1PAEX 3DRPA 2F8TA 3D2EB 2Z2ZA 3VEOA 1EKRA 2UXCJ 4J9VA 3TU5A 3R3TA 1RHMB 2MLZA 3SFGA 5LXRA 3BGRB 3QEPA 2VQFJ 5AR0A 4JS4A 1RT1B 4B9SA 4EYHB 1J5OB 4ED2A 4R25A 3VQQA 4RWWA 2BMBA 3UCGA