3ZSOA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsoA00
1TK5A 1S1VA 1FKOA 1R0AA 1SKWA 2ETJA 1IKWA 3E01A 1REVA 3ZSQA 5EU7A 5D3GA 4CFBA 2KZMA 4CEQA 4E1NA 1UAXA 5HRRA 3VQCA 3AVHA 4CF0A 1TL3A 2FC0A 4KHNA 4FW1A 3QETA 2DY4A 1WAFA 1EETA 3PO5A 2OZSA 5DMRA 4F4KA 1U49A 3SJJA 5KTQA 5I42A 4FM2A 1LW2A 3CQ8A 1W9HA 4DSEA 1RT6A 2RPIA 4QOZB 4I2QA 4KAZA 3KIOA 5CYMA 4BACA 3SUOA 4ICLA 1RTHA 1S6QA 4DTMA 2X74A 2PYJA 3AA4A 2G8HA 4E7LA 4CEOA 1VSHA 2EHGA 4KV8A 5J1EA 3K59A 3TWHA 3ALYA 4CHZA 1HPZA 1S1WA 2BE2A 3LAKA 3SQ1A 4FZXC 4M3WA 4CGDA 1IG9A 3VQ7A 4RW8A 3V9WA 3L2UA 2FBXA 3DM2A 3MXIA 5HBMA 4KRFA 4B9TA 1J53A 3V81A 4N41A 1RTIA 5K14A 1S5JA 3AA3A 3K2PA 1T8EA 2XRIA 4DQSA 2OA8A 4OKJA 4OLAA 3O3GA 4GVMA 4JS5A 4FJGA 3LALA 3AVBA 3O4QA 1NK8A 2RKIA 2WONA 4B9LA 3VQPA 3U3YA 1UWBA 3ZT3A 3SPYA 2G8IA 2GUIA 3LWLA 4YNQA 4CGJA 4Z4HA 1NK9A 4N76A 2F8TA 3OYAA 1TAUA 1RTDA 2YV0X 1KFDA 4QAGA 4M41A 4ZTJA 3QO9A 1C1BA 1QS4A 1L5UA 3KD1E 1NJZA 1FK9A 1X1PA 3C95A 1RBRA 1JXEA 3AVFA 4CJ5A 3NF9A 3OYDA 1RNHA 3TARA 3F73A 4LH5A 3KD5E 1RBUA 3HVTA 3OYKA 1FXXA 1WAJA 2YHAA 4FW2A 3OS2A 3HPOA 1J5OA 2HHTA 3CM6A 1DTTA 4FJ7A 1RDDA 2HNYA 1J9AA 3M8QA 3DRSA 4JLHA 3DLGA 2D5RA 3LDSA 3PO4A 3VQQA 3QLHA 2F96A 2HNDA 4CJKA 2XY7A 4FYDA 3SQ0A 1VSIA 3OY9A 3ASMA 1FKPA 1RDAA 1KVBA 3PUFA 4W5QA 4BDYA 2EX3A 1CZ9A 5KGWA 3K57A 1B9DA 3OYFA 2E6MA 1NOYA 4FLUA 2X78A 3TAPA 4KTZA 4DU4A 1C0UA 2E4LA 4F2RA 3TANA 1NK5A 3NE6A 4FK4A 4KB1A 2DFFA 1XHXA 4MQ3A 2D0CA 4B3OA 3DLRA 3AV9A 2HHSA 4FJLA 3C6UA 1VRTA 1TKZA 1G15A 1JKHA 4K8ZA 3LP1A 4Q5VA 3KKSA 4OGEA 1L3UA 2A1RA 3OS0A 4C8KA 1U4BA 4FJ9A 4DTXA 2D0AA 4KKOA 4KHWA 1LW0A 4CEFA 4CHNA 5C25A 3VQ9A 4DS4A 4CIFA 5KI6A 3QEWA 2P1JA 3HVRA 3OJUA 4HHTA 1NOZA 4FJJA 4I9LA 4B9UA 3VQ6A 4CERA 3AO3A 4DS5A 4BWMA 1X9MA 4DQPA 4CFDA 2QXFA 3L3UA 1CLQA 3D0PA 5J2QA 4F3TA 1XC9A 3PY8A 3OS1A 5C42A 4F2SA 4M3TA 5HRPA 4KB0A 1A5WA 1D8YA 4JRQA 4H8KA 4LSLA 3B6PA 4CF8A 1RBSA 2VWJA 3DLEA 4KHUA 1HYVA 1RT5A 3TAMA 3OYMA 2G8KA 2KW4A 3RTVA 1WSJA 3V9ZA 1HQUA 4CJ4A 4FJKA 5CYQA 1ZYQA 1C1CA 4E3SA 1Z26A 1QSLA 4DWIA 4E1MA 3I8DA 3RMDA 4CJQA 4ELVA 1W0HA 4BE1A 4E7KA 2RF2A 4OPKA 1HNIA 1KLMA 3ZT2A 3OYNA 4MFBA 3TAGA 3KLHA 1NJXA 1C0MA 4H4OA 3OYEA 1N5YA 4NCBA 3JSMA 1IKVA 1IO2A 1VSFA 3LP3A 3NGYA 4HVJA 3LP2A 2PZSA 3MECA 1UOCA 4FLXA 3QNOA 4CCHA 4QCLA 1JLFA 4ELUA 3QEPA 3KK1A 4AHSA 4FJ8A 1NK4A 1QE1A 4NYNA 4ZHRA 4HUGA 4DU3A 3U6FA 3K5NA 1JL2A 1F21A 3DRRA 4CHPA 3L2QA 3TAFA 3OYJA 3LAMA 1JLGA 5FDLA 4CJPA 3AVLA 4DF8A 1LWCA 3VQ4A 5E41A 2HMIA 2Z1IA 3VQ5A 4J2BA 3PV8A 2YKMA 4G1QA 4B9SA 2HHXA 3K5OA 2YNGA 5T7BA 2HHUA 4FLWA 1N6QA 3D45A 1S1XA 3L2VA 2X6SA 3HL8A 4NYFA 1KVCA 3VQAA 1S1UA 3OYHA 1WLJA 3O3FA 2XO7A 4CEEA 1SUQA 3MEGA 4AHVA 1RILA 1JXBA 1S9EA 1WN7A 3DI6A 3OJSA 4JS4A 2ZD1A 1TAQA 1NK7A 5FROA 1WSGA 4H4MA 1JLCA 1VK0A 4CGHA 1ZBFA 1IKXA 3I0SA 4CK1A 4DLEA 3RMCA 3MXMA 4FJMA 1KFSA 3K58A 4FLZA 3CFOA 3HO1A 1ITGA 4IFVA 4M45A 1BCOA 1GOCA 3MXJA 3HT3A 4DQIA 4BDZA 4XIUA 4M3XA 4ID1A 3HXMA 2F8SA 1T03A 4KFBA 2G8WA 4CJ3A 2A1SA 1TK8A 1ZBUA 3L2WA 4DSJA 3WNFA 4CIGA 3C6TA 1LWFA 1L3SA 4AHCA 1RBVA 3HP6A 5FRMA 1NKCA 1KSPA 4CIEA 3DLBA 3S3OA 2G8UA 4DTJA 3SV4A 1Y97A 1RT1A 1TKXA 3AO4A 3LWMA 4O44A 1B9FA 1U47A 2HHQA 3BGRA 3ZCMA 4CF2A 3DOLA 4DSFA 3H08A 3G0ZA 1WSEA 5JS2A 3TAEA 1QTMA 4DTPA 4W5RA 1NKEA 5SWMA 4C8LA 2XY8A 3AA5X 3CG7A 2B4JA 2R7YA 3KLGA 3TR8A 4W5NA 4DTUA 1EXQA 4M3UA 1D9FA 4CJSA 3KLEA 1WNSA 3HPGA 5CZ1A 3NDKA 4E7JA 2ITGA 4HUEA 4LD0A 1NK6A 4HCCA 3M8PA 3AO1A 4F3OA 4BDPA 2XY6A 4EP4A 3SI6A 4O5BA 4FZZA 1DLOA 3VQEA 2XY5A 1IKYA 3OYBA 4E7IA 1LWEA 1S9GA 1EP4A 3TI0A 3RRGA 4DG1A 3SCXA 1I39A 1X9SA 4O4GA 1CZBA 3SYZA 4AHTA 1NJYA 3L3VA 3AVKA 4IFYA 3HM9A 4PUOA 4Q0BA 1RT4A 2B5JA 3TAQA 3P83D 2VG6A 3NH2A 4CEAA 3S9HA 1L3VA 3P5JA 4PY5A 4KO0A 4LSNA 1Q8IA 2YNHA 5KRTA 3SNNA 2VG7A 1GOAA 2YNFA 4KHSA 3NFAA 1JLBA 4LY7A 4CEZA 4KTWA 3SQ4A 2PY5A 4HCBA 4Y1DA 1DTQA 4OGCA 5KGXA 4DQRA 4J2AA 4IG0A 4O0JA 4PQUA 1VSJA 2P51A 3CM5A 2IOCA 3AVNA 3HK2A 3NF6A 1YTAA 3EZ5A 4FM1A 3B6OA 4CJEA 4B9VA 4O55A 1XHZA 1IH7A 2E6LA 3VQ8A 3NH1A 4FJ5A 4FK2A 1Q9XA 3T1AA 3KJVA 3NBPA 3LP0A 3K5LA 4B9NA 4CJTA 3NH0A 1RDCA 3FFIA 1LAWA 4RG8A 4BWJA 5HRSA 1U04A 3QEIA 3RMBA 1NJWA 4B8CA 1K6YA 3NHGA 1QSYA 1QSSA 4DSIA 1U48A 1SL1A 1Q9YA 2W42A 2QK9A 5J2NA 3HPHA 3AVAA 4CJUA 4OJRA 4Y1CA 4N5SA 1BQMA 4CHQA 4B08A 2XHBA 1UA1A 1BCMA 1D5AA 3QINA 3WNEA 3V6DA 1KVAA 2X6NA 4IDKA 4FM0A 4DFJA 4FXDA 3NCIA 3SUPA 3K5MA 1HQEA 3SZ2A 5HROA 1GOBA 3HJFA 3NGIA 3P1GA 4CHOA 4OKKA 3LANA 4Z4CA 4GMJB 3PX6A 1SL2A 4YFUA 4KHQA 4DFKA 3VA0A 1TKDA 4M3ZA 2YNIA 4N47A 5J2PA 2KTQA 1ASVA 1RCHA 1RT3A 1S1TA 3RR8A 3T19A 2HW3A 2Y1IA 4DTOA 3OYLA 1HJRA 2O4IA 3QIPA 3WNHA 4CHYA 2KQ2A 1X9WA 2OZMA 1TV6A 4DU1A 4CJLA 4DFPA 4FCYA 1TL1A 2OPSA 4E89A 3NGZA 2OYQA 2ZQBA 4N56A 4Z4GA 3M8RA 1RDBA 4DFMA 2HB5A 3LZIA 4RW7A 2B6AA 1RT2A 3QEXA 1NKBA 3BDPA 4M3YA 4DTNA 4CE9A 4FK0A 1YTUA 5I3UA 4L8RB 2WOMA 3DLHA 2JGUA 3DLKA 3ZSXA 3G10A 3SQ2A 1Z25A 3AO5A 2FBVA 4J2EA 2BDPA 3ZT0A 1SKSA 1L3TA 2VWKA 2OPPA 1MU2A 3MEEA 5FRNA 4CK2A 1VRUA 1NK0A 1A5XA 3SPZA 4C8NA 1KRPA 3ZT1A 5SZTA 3SV3A 3PX4A 3O4NA 3UIQA 2GBZA 1I3AA 4CECA 3VA3A 2HHWA 4CGGA 4W5OA 3ZSRA 1VSLA 3VQBA 1ZBIA 4OPJA 4AHRA 2IC3A 4KI4A 3ZSOA 2OPRA 1UA0A 3ZSWA 4DSLA 1VSDA 4AILC 4I9QA 2FBTA 1KTQA 2P5OA 1CXUA 4CJVA 3AVCA 3TABA 4DSKA 3RWUA 3V1OA 1C1AA 4DTRA 1BHLA 3U3GA 5C24A 5HP1A 3M8SA 3OYCA 3SUNA 3L8BA 1XWLA 1TGOA 4CJWA 3QNNA 2BANA 3C94A 2KZZA 4EP5A 4DTSA 3JYTA 1T05A 3V1QA 3AA2A 5KRSA 1HNVA 2Q3SA 1B92A 2YKNA 3KKRA 4LH4A 4RW4A 5CY4A 3ZSZA 1ZBLA 4IKFA 2O4GA 4KI6A 1BI4B 2KFNA 4PA1A 4ELTA 1C0TA 3KLFA 3ZSVA 4B8AB 4F8RA 2HNZA 4OKEA 2PYLA 4KTQA 1TK0A 4FLVA 2Z1GA 4C8MA 4ID5A 4CK3A 1JLEA 3EY1A 4FLYA 3S3MA 1S6PA 1BISA 3CYMA 3ZSYA 4Z0UA 3DMJA 2JLEA 4JRPA 3QEVA 4RW9A 3AVMA 2QKKA 2GV9A 1KLNA 4E19A 3ZT4A 1WSHA 4OLBA 3O3HA 2Y1JA 3LZJA 4B9MA 4BE0A 2AJQA 4CF1A 2DFEA 1TVRA 3A2FA 3V9SA 1JLAA 4PWDA 4Z4FA 3KK3A 3VN5A 3L2RA 3EYZA 3T3FA 3THVA 4UQGA 1JLQA 3MAQA 3V9UA 1LV5A 4KHYA 3I0RA 2HHVA 3DYAA 5DK5A 3VQDA 1C6VA 3V1RA 1BQNA 2KFZA 1BGXT 4M3RA 5CZ2A 1BI4A 4CEBA 4CJFA 3OYGA 4I7FA 3OVNA 2ATQA 4HUFA 2QKBA 1KCFA 4K8XA 3IRXA 4CGFA 3IG1A 4AHUA 4C8OA 1JL1A 4FVMA 4I2PA 1CXQA 4W5TA 3DRPA 3F9KA 2IAJA 2VG5A 3DOKA 4CF9A 1BL3A 1RBTA 2RN2A 4R5PA 3CFPA 1VSMA 4FJNA 3MEDA 4DLGA 4FJHA 3OYIA 1HRHA 2IDOA 2IS3A 3V9XA 1VSEA 2Z1JA 1LAVA 4J2DA 5HRNA 2BGGA 1HMVA 1T7PA 4GW6A 3KTQA 2G8VA 3HSTB 3QIOA 4EZ9A 2Z1HA 4CEDA 4FZYA 4IBNA 4M42A 3NF7A 2I5JA 1YT3A 1RT7A 4NCGA 3V4IA 4KPYA 1EX4A 2D0BA 1A5VA 3PX0A 3LPUA 2HVHA 3WNGA 4CFCA 1HYZA 3IAYA 4Z4IA 3AO2A 4DMNA 4AH9A 3KK2A 4EZ6A 1QQCA 1O1WA 1VSKA 4E0DA 5J2MA 2NUBA 1ASUA 1SV5A 1SL0A 5JS1A 2YHBA 4WE1A 3QERA 1SKRA 2FBYA 1QHTA 3RR7A 3LPTA 4Z4EA 4E7HA 1HYSA 5HLFA 2DFHA 4CJRA 4BE2A 3KLIA 4FLTA 3AVGA 4FJXA 3NAEA 1XI1A 3QESA 4CFAA 3HYFA 4IG3A 3RMAA 2P5GA 2IGIA 4DQQA 4ZTFA 4O0IA 3NF8A 3AVJA 3HP9A 4CGIA 3ULDA 2OPQA 1ZBHA 2DTUA 4FJIA 1YVUA 2LSNA 1WSFA 3AVIA 3ITHA 4TSXA 4DF4A 1BIZA 2G8FA 4OVLA 4CESA 1RTJA 1WSIA 3ISNC 4RW6A 3SUQA 1BIUA 2ZE2A 3IS9A 4KREA 2HVIA 1J54A 1TKTA 1EKEA 1ASWA 3CFRA 1D9DA 4NCAA 1U45A 3S3NA 3RRHA 4HTUA
chains in the Genus database with same CATH superfamily
2HHHK 2ETJA 3VGLA 4IO9L 3E01A 1REVA 2UU9K 4ILGB 3DLLL 3N4QA 4IEEA 2FC0A 4FW1A 1FJGK 3PO5A 4JI2K 4H0TB 3SJJA 5KTQA 1LW2A 1W9HA 3GG4A 4DSEA 4QOZB 4I2QA 3SBGA 3G4SN 4ICLA 1S6QA 4DTMA 2X74A 1KXPA 2YJFA 3K0SA 3J81O 1HPZA 2BE2A 4FZXC 3O9RA 3VQ7A 3V9WA 2E8AA 3L2UA 2FBXA 5AFUH 3WXKA 1X3NA 1RTIA 1VQLN 1QHAA 3K2PA 1T8EA 4JKEA 4OLAA 3O3GA 4JS5A 3WXLA 2DPNA 3AVBA 3O4QA 1NK8A 2WONA 1UWBA 2IIRA 3DXMB 2GUIA 3SPYA 1NK9A 2F8TA 4DHYA 1TAUA 1KFDA 4PL7A 4BC2A 3QO9A 3CPWM 1FK9A 1YUWA 4B3RK 1JXEA 3F2KA 4BRFA 1RNHA 2ZF5O 4LH5A 1RBUA 1FXXA 1WAJA 4U67L 3HPOA 4DR5K 2IVNA 2Q0RA 3BZCA 4JKHA 3CM6A 1DTTA 1RDDA 2HNYA 3DRSA 3PSFA 4JLHA 4LF5K 3PO4A 3R8EA 3DXMA 2F96A 3QLHA 4CJKA 2XY7A 1R59O 4BRQA 3K9KA 3OY9A 3ASMA 1FKPA 3EKUA 1RDAA 3RSEA 1KVBA 1O13A 4BQLA 3K57A 1OH7A 4A61A 3TAPA 4KH4A 4DU4A 5GAGP 4IJAA 4F2RA 3ENBA 4FK4A 4KB1A 4O8UA 4BRMA 4G9ZA 4B3OA 1DKGD 1GLEG 1VRTA 4BRNA 3O8MA 4JK8A 5EY4A 4DV5K 3LP1A 3KKSA 4OGEA 1RDWX 5M1NA 1U4BA 5AFUA 3VQ9A 4K25A 5KI6A 2NRZA 3LL3A 4HHTA 4FJJA 4I9LA 1WBBA 3L4IA 1Q86O 4CFDA 2I7PA 2QXFA 5LY3A 2HF4A 3ZX3A 3KVGA 5C42A 5HRPA 3PIOL 4DR3K 1N8RO 4BRHA 4FWPA 1EWQA 2J4RA 4KHUA 1Q7YO 3HBTA 5GAEP 2F7TA 2NNWA 4BRIA 4IEIA 1ZYQA 4I6MA 1Z26A 1VQON 1Z6RA 4BE1A 1YXQA 4CBXA 4JKGB 3OYNA 1NJXA 1N5YA 3KLHA 3NGYA 1BA0A 3QNOA 3QEPA 4HUGA 1F21A 3DRRA 5E84A 4H5WA 1XNQK 4DF8A 4YHHK 4BGAA 3H45C 3VQ5A 4B9SA 1ATNA 2YKMA 4G1QA 5T7BA 2YNGA 1N6QA 3D45A 4BRDA 3OYHA 5JVHL 1WLJA 3O3FA 4B1ZA 2A42A 1WN7A 3DI6A 4EHUA 3P38A 3SJHA 4BR0A 4JS4A 3O08A 1JCFA 4H4MA 4CK1A 1ZBFA 3MXMA 4FLZA 2A5XA 4B1XB 4BDZA 4X62K 2G8WA 3GL1A 4CJ3A 4JKFA 4DSJA 1GLAG 1L3SA 4MLEA 4AHCA 5FRMA 1KSPA 4FOEA 3SMSA 1YJNN 3AO4A 1EWRA 2HHQA 4DB3A 2QA4N 3QDKA 1Z05A 5JS2A 3MX2A 4DTPA 5AZJB 2R7YA 3CG7A 4W5NA 3HRGA 1GLJO 1WNSA 1HKGA 3NDKA 4E7JA 2V7ZA 2OTJN 4HUEA 4HCCA 4WYBA 3VEZA 3J7AP 4EP4A 4FZZA 1DLOA 1NMDA 2FLOA 1IKYA 1ESVA 1S9GA 3W0LA 1QZ5A 3H3OB 3L3VA 3T69A 3WT0A 1TUUA 3P83D 3NH2A 2P9IB 4CEAA 1ILYA 4ISGA 3N4PA 2YHWA 1Q8IA 2YNHA 2YNFA 5BRHA 4DV3K 3NFAA 2PY5A 3CETA 4J2AA 1DEJA 1WUAA 3CM5A 2IOCA 3HK2A 2OTLN 3VETA 2E6LA 4WF9L 3EO3A 3KJVA 3NBPA 3LP0A 5BPNA 4CJTA 4DUYK 1NWKA 4BWJA 4IFEA 4DSIA 4B8CA 1K6YA 4K43A 4A2AA 3NHGA 1QSYA 1U48A 3E66A 1HJOA 2I7NA 1QVGM 3HPHA 3AVAA 4CJUA 1HKBA 2A40A 2NRHA 3QINA 3WNEA 1NBWA 2X6NA 4IDKA 4F9OA 5F0XA 3NCIA 2CH6A 4WQ5A 3K5MA 1HQEA 3SZ2A 5HROA 4B9QA 4OKKA 3LDQA 4JHDB 1BA1A 4Z4CA 3PX6A 2Q0UA 3MK6A 3VA0A 4M3ZA 2YNIA 5J2PA 1VHXA 1X9JA 1ASVA 1RCHA 3RR8A 2HW3A 3QIPA 3WNHA 4CHYA 2KQ2A 3O6WA 1TL1A 2OYQA 2ZQBA 3M8RA 3CCSN 4DFMA 3LZIA 4B3TK 3BDPA 4DTNA 4CE9A 4CZGA 1XMQK 2Q1NA 3ZSXA 2BTFA 3G10A 3I33A 1Z25A 3EN9A 4IO8A 4JI7K 1H1VA 2OPPA 3VEVA 5SZTA 1I3AA 4FL9A 4BR7A 4PL8A 5JLFA 2NRVA 4OPJA 4PKIA 2P9SB 2ASMA 2IC3A 4KI4A 3ZSOA 3O1BA 3P31A 4DSLA 3C6HA 2P9PB 3VTIA 4B3SK 3OBWA 3AVCA 2QTDA 5HOOA 3VTHA 4DSKA 4DTRA 2A41A 2O8FB 3M8SA 3U9DA 3L8BA 1TGOA 1W97L 4EP5A 3JYTA 1T05A 3V1QA 5KRSA 3MN5A 3KKRA 3LM9A 4RW4A 1ZBLA 3LDNA 2KFNA 4ELTA 4GNIA 4OKEA 4KTQA 3MMVA 5AQFA 4C8MA 4FLYA 4FOIA 1BISA 3CYMA 2QXLA 4JRPA 4RW9A 3SAHA 3DXKA 5AQOA 1WSHA 3LZJA 4B9MA 1VQPN 3A2FA 4FPAA 3L2RA 4JEPA 3EYZA 3T3FA 4UQGA 2EWSA 1S3XA 4KHYA 5DK5A 3NMUA 5IT9O 4CEBA 3OVNA 3THYB 2HBKA 2QKBA 1KAYA 2GWKA 2QWLA 4FVMA 4I2PA 3DRPA 4CF9A 2VG5A 1KC8O 1KAXA 3DOKA 4DR7K 2RN2A 1NGEA 5LJVA 1VSMA 2QWQA 1HRHA 2IDOA 1M1KO 1T7PA 4GW6A 4DV7K 2YHYA 3NF7A 2QEXN 5C2DA 1C0FA 3LPUA 4O5FA 3WNGA 4CFCA 3THYA 1D4XA 4FO0A 4Z4IA 3AO2A 4DMNA 4AH9A 1YIJN 3SMPA 1QQCA 1O1WA 2YHBA 4WE1A 3TSUA 2CGJA 4IOCL 1QHTA 4Z4EA 3U8XA 4E7HA 1E3MA 3EE9A 2DFHA 4FLTA 2GELA 3AVGA 1XI1A 3A8YA 3A0IX 3L0QA 4IG3A 3A5MC 2P5GA 3FR0A 3VEXA 4ZTFA 3AVJA 3HP9A 2OPQA 2AP1A 1BIZA 3CC4N 4LF9K 2V51B 4OPHA 4OPAA 3I56N 1BIUA 2ZE2A 3IS9A 3ZEUA 1J54A 1TKTA 1EKEA 3CFRA 4NCAA 1U45A 1NGAA 4LC9B 2P9LB 5KQ8A 3JS6A 3DWLA 1S1VA 1FKOA 1VAZA 5DM6L 1SKWA 1HR0K 3CERA 5HRRA 3AVHA 3VQCA 2DY4A 2OZSA 1NGFA 5DMRA 4F4KA 2YJEA 3AGRA 2P9NA 4QS9A 3O5BA 3CQ8A 1RT6A 1NGHA 1QQOA 4HTLA 4E7LA 4CEOA 1VSHA 2EHGA 2P9KB 3CQYA 5GINA 3K59A 3TWHA 4PKHA 3SQ1A 2W6LA 1GLFO 4RW8A 4CBUA 2Q31A 2HBJA 3DM2A 1BU6O 3D2EA 5K14A 5JLHA 1S5JA 1KQSM 3VEOA 2XRIA 4FJGA 4KH5A 2RKIA 3LWLA 2RE2A 3A5OC 4CGJA 4Z4HA 1BOTO 4M41A 4ZTJA 3SK3A 4CW7B 2YHXA 3AVFA 2CGLA 3OYDA 5AQLA 1HLUA 3TARA 3HVTA 4JI1K 3CJ7A 4AM7A 5F1XA 1LCUA 4FJ7A 3JAMO 1J9AA 2D5RA 5JVGL 1NU0A 1NGGA 4W5QA 1K73O 3OYFA 2E2PA 2VGMA 1C0UA 1XMOK 3TANA 2WC9A 4DKWA 3NE6A 1XHXA 5AQUA 4FJLA 3C6UA 1TKZA 3FZLA 2VCPA 1JKHA 3AGKA 4K8ZA 1JCEA 3ZX0A 3OS0A 3THXB 4C8KA 4FJ9A 4DTXA 4KKOA 3CJ9A 5C25A 5CHIA 3CPEA 4BR2A 2E1YA 2ZJPL 4EFHA 3OJUA 1NOZA 1SZ2A 5C0YA 4KH6A 4E1JA 3VQ6A 4CERA 4B1UB 1RDUA 1CLQA 3D0PA 2E1ZA 1XC9A 3OS1A 4F2SA 4KB0A 2E5LK 4FWKA 5AZIA 2CGKA 1RBSA 3SBTA 3CC2N 1HYVA 3TAMA 5H1SQ 5AQRA 1HQUA 3LDLA 2UUBK 1U2VB 4YDUC 3U4LA 4E1MA 5C12A 3I8DA 3RMDA 3UKUB 4ELVA 1MA9B 2ITMA 5AQXA 3VPZA 1HNIA 1KLMA 3CCEN 3BZKA 4NCBA 4H5TA 1JCGA 5AJ3K 3JSMA 3CMEN 2PZSA 3MECA 4CCHA 3M6GA 3O9UA 4DCHA 4FJ8A 1NK4A 3BEXA 2Q36A 3U6FA 1IBLK 5AQYA 4CHPA 3TAFA 3OYJA 3FZKA 5FDLA 5FPNA 5E41A 1U2VA 1K8KA 2Z1IA 2HHUA 2HHXA 3VENA 5AQQA 3O9SA 3UKUA 4FLWA 1S1XA 3L2VA 3HL8A 4NYFA 1S1UA 3MEGA 4H5VA 4AHVA 4WQ4C 3MWTA 2PFUA 4YOYA 3MX5A 1WSGA 1VK0A 4CGHA 5GIPA 1IKXA 4DLEA 3ULEA 5LMUK 5AQKA 1T3VA 4JI8K 1XNRK 3HT3A 1W7AA 3CD6N 4H5RA 3THWA 3RSEB 5E26A 1ZBUA 3WNFA 1N32K 3C6TA 1U6ZA 1YAGA 2CH5A 3LM2A 5EVZA 1RBVA 4CIEA 3DLBA 4O44A 1U47A 1OVQA 3ZCMA 3H08A 3TAEA 2W6KA 4C8LA 2XY8A 3CIPA 4DTUA 1EXQA 3HPGA 4HWIA 1YHQN 4LD0A 3M8PA 3QMLA 3C0BA 3CI5A 4XH4A 4BDPA 2XY6A 1VQMN 4BVOA 3CCQN 1VQ5N 2ZGYA 3OYBA 2PBDA 4JI5K 2O8EA 3TI0A 3KK7A 3RRGA 4H0PA 1I39A 5AQPA 4FVUA 1CZAN 1X9SA 4X66K 3CHWA 4IFYA 3AVKA 3MN7A 1GLCG 4PY5A 1ZC6A 3H1VX 1SS6A 3SNNA 2VG7A 1X3MA 2Q97A 3MCPA 1Q81O 4KTWA 4HCBA 3DAWA 1DTQA 4I6MB 4O0JA 2E2OA 4IG0A 1VSJA 2P51A 3NF6A 3B6OA 2KLAA 3R1XA 5AQMA 5A2QO 3NH1A 1DGKN 4R79A 5HRSA 1LAWA 3QEIA 3RMBA 1U04A 3NVMA 3CCLN 4NLBA 2W42A 2QK9A 5J2NA 4OJRA 4Y1CA 5KPZA 1D5AA 4FM0A 4DFJA 3BF1A 3H3NO 4CZHA 4FWRA 3K9JA 3NGIA 1G99A 3LANA 3IMXA 1SL2A 4KBOA 4DFKA 4DR1K 1TKDA 2KTQA 4A5AA 5JMVA 3OYLA 1X9WA 4A62A 2FF6A 3NGZA 2OPSA 4DV0K 1RDBA 2HB5A 4RW7A 4FWSA 1YTUA 2QWOA 5CR4A 3DLKA 2VQFK 3C7NA 2BDPA 1SKSA 4CK2A 1VRUA 3SPZA 4M63C 4C8NA 1KRPA 3ZT1A 3CCRN 3UIQA 2GBZA 3GDQA 4CECA 3VA3A 5M1QA 3ZSRA 1VSLA 3VQBA 3DJCA 1ZBIA 1W2BM 3O80A 4AILC 1V4TA 3RWUA 3QBWA 4CJVA 2FF3B 4U7BA 1C1AA 3FZHA 1BHLA 3U3GA 4YOUA 2D1KA 5C24A 4FWQA 1K9MO 4CJWA 2OANA 2BANA 3C94A 4BREA 2KZZA 4DTSA 3L4QA 2W41A 1HNVA 2Q3SA 5CY4A 3ZSZA 2O4GA 1NNEA 4PA1A 1NLVA 4F8RA 2HNZA 2PYLA 1TK0A 4FLVA 2Z1GA 3EY1A 1JLEA 3S3MA 3HO1A 3ZSYA 4Z0UA 3DMJA 3AVMA 2QKKA 4JK7A 1NMNA 3O3HA 2Y1JA 4BE0A 4CF1A 1TVRA 1JLAA 3KK3A 3VN5A 5B8HA 3THVA 3CF5L 1JLQA 5BRDA 2F9TA 3V9UA 3I0RA 3M3ZA 1J5EK 3DYAA 3NVKA 5HL7L 1C6VA 1BQNA 3O9TA 2KFZA 4ISFA 4I7FA 4QS7A 4K8XA 3IRXA 3IG1A 4O8KA 4BY9C 2VGNA 4W5TA 4B1YB 4R5PA 2IAJA 4C1NK 3CFPA 4CZIA 1BL3A 4FJNA 4EIAA 3MEDA 4BRCA 3AY9A 3OYIA 3V9XA 2BGGA 5HRNA 5AQVA 1HMVA 3BP8A 3QIOA 4RCHA 2Z1HA 1HNWK 4FZYA 4IBNA 2I5JA 1YT3A 4KPYA 1EX4A 4YY3K 3C65A 4YOVA 3KK2A 1VSKA 3MN9A 4E0DA 2NUBA 1SV5A 4WFNL 5IWAK 1SL0A 3TSPA 3HI0A 3QERA 4IJNA 3LPTA 5HLFA 3G25A 1P90A 4CJRA 4LF7K 2OCEA 4CFAA 3I55N 3RMAA 4BC3A 2IGIA 4O0IA 3NF8A 2ASPA 5BN9A 4WFBL 3BUZB 4K41A 3QICA 1WSFA 3ITHA 4CESA 4BRLA 3SUQA 4RW6A 4KREA 3MDQA 4JV5K 4XH1A 4FJKA 1N33K 1R0AA 1Y64A 3C6AA 5M1PA 3ZSQA 4CFBA 4CD3A 4E1NA 3A5NC 3D7EO 2P9UB 2D0OA 1WAFA 4OO1J 4UY8O 3GBTA 1IV0A 1T44A 1U49A 5I42A 3J7ZO 3E9PA 1EQYA 4KAZA 3KIOA 4BRKA 3ZLJA 3LDOA 3DXKB 3OW2M 2PYJA 3AA4A 4KV8A 3ALYA 1OKJA 1M90O 1S1WA 1SQKA 3LAKA 4QS8A 4M3WA 1BG3A 1IG9A 2P9UA 3MXIA 3V81A 1YITN 1OH6A 4NO7A 3D2FA 4DQSA 2OA8A 4OKJA 3LALA 3U3YA 3ZT3A 3M5RA 1DT9A 4MDBA 4QAGA 1XQSC 2QWNA 4DQ8A 2PAVA 1C1BA 1QS4A 3R9PA 3KD1E 1NJZA 5BR9A 1X1PA 4YOWA 3C95A 1RBRA 2F4VK 3CCUN 3T1YK 3NF9A 3MWPA 3KD5E 3OYKA 2YHAA 1TYQA 1J5OA 5JICA 3M8QA 2D0PA 3LDSA 3VQQA 2HNDA 4FYDA 3BF3A 3SQ0A 4BR5A 3KWIA 3PUFA 4B1WB 1YJ9N 1YVNA 5KGWA 4A59A 2E6MA 1NOYA 2X78A 3F9MA 2E4LA 2O8CA 4DR6K 2D0CA 3VGKA 2GEMA 3AV9A 5GIOA 2HHSA 3EZWA 5ADXH 3HZ6A 4CZJA 1G15A 5BPMA 2UXDK 4MLHA 1WBDA 2JWLA 1L3UA 2A1RA 2WBNA 2D0AA 4KHWA 4GKJK 5AQGA 4CHNA 4DS4A 3ZEUB 4CIFA 3UKRA 3HVRA 5LL6Z 4DS5A 2UXBK 4NLCA 4BWMA 1X9MA 2HMPA 3L3UA 1GLLO 1QQNA 4F3TA 3PY8A 4M3TA 1A5WA 1D8YA 2RHKA 4AF1A 4H8KA 3B6PA 3J7YP 1RT5A 4XH5A 2G8KA 2P9NB 4V19S 4CJ4A 4PKGA 2W40A 4YOTA 4BRAA 1MWMA 3CCMN 1C1CA 1QSLA 4CJQA 1W0HA 4JI6K 4M7XA 4OPKA 3OYEA 3TU5A 1IO2A 1VSFA 3LP3A 4HVJA 3LP2A 1UOCA 1JLFA 3ENHA 5GAHP 3KK1A 4AHSA 3D2EB 1QE1A 2QWPA 4NYNA 3K5NA 1JL2A 3TTDA 2JWKA 1JLGA 3ATVA 4DUZK 1LWCA 2HMIA 4JKBA 3CQXA 3K5OA 1MDUB 2X6SA 3I8BA 1KVCA 1BUPA 2VWBA 4CEEA 1SUQA 4GVEA 1JXBA 1S9EA 3WXJA 2ZD1A 3J8AA 1TAQA 5FROA 2VYPA 3WEEA 3R6MA 1JLCA 3RMCA 4DR4K 3K58A 4A2BA 3CFOA 2QM1A 1ITGA 4IFVA 4M45A 2GTDA 1GOCA 4XIUA 4M3XA 3HXMA 5AQJA 2F8SA 1T03A 4KFBA 1XUPO 2NRWA 5AQZA 4AQYK 1TK8A 3L2WA 1LWFA 4X65K 1P8ZA 4H0XB 3HP6A 3S41A 1HKCA 3S3OA 2G8UA 4DTJA 3SV4A 4BRPA 1Y97A 1RT1A 1TKXA 3CJAA 5AQSA 1B9FA 3BGRA 3DOLA 1WSEA 1QTMA 1NKEA 5SWMA 4DV1K 3VMFB 2YCHA 1D9FA 4M7YA 4CJSA 4H5NA 2ITGA 1VQ7N 3HTVA 3H6EA 4IOXA 4O5BA 3E9OA 4AM6A 3VQEA 2XY5A 1E4GT 2KHOA 4E7IA 1KD1O 1EP4A 3FFKB 5EX5A 3FZFA 3FLCO 1CZBA 4AHTA 1NJYA 3HM9A 1HPMA 4Q0BA 3TAQA 5AZIB 2QI2A 3IKMA 4JI3K 4KO0A 4LSNA 5KRTA 1GOAA 4KHSA 3SQ4A 4CEZA 4BROA 4DQRA 5KGXA 4X64K 4WCEL 5M1FA 2AA4A 4PQUA 4NB4A 3AVNA 3KWGA 1YTAA 2NRRA 4B9VA 4O55A 1N36K 3UE5A 3VQ8A 4K42A 4RWTA 1Q9XA 5C15A 3NH0A 4CD1A 1QSSA 5LMNK 1Q9YA 3T7ZA 4N5SA 5C10A 1BQMA 4CHQA 4FPBA 4B08A 5FPMA 2XHBA 3V6DA 3MCAB 1YI2N 1K8KB 3U9ZA 1FW6A 4FXDA 5KPRA 1WOQA 3HJFA 4CHOA 4GMJB 1NGIA 3AARA 4YFUA 4DV2K 5GADP 1VQ6N 2HSTA 4DTOA 4ILJA 4WQ5C 1HJRA 4CI6A 4BG8A 3O9QA 3ULEB 1TV6A 4DU1A 2E88A 3JXUA 4Z4GA 1IBKK 2B6AA 1RT2A 3CMAN 3QB0A 3THWB 5I3UA 4L8RB 5BR8K 2JGUA 4C1NI 1NGDA 5AQIA 2QWRA 1L3TA 2VWKA 1MU2A 3MEEA 1I94K 4LF4K 3SV3A 3PX4A 3O4NA 4CGGA 4W5OA 4AHRA 1VQ9N 4EHTA 2HOEA 4I9QA 3HOSA 2P5OA 1S72N 4DR2K 4BC4A 1RFQA 5HP1A 2A3ZA 3OYCA 3SUNA 4JN4A 1VQNN 1ZXOA 2ZJRL 4EAHD 3AA2A 1B92A 4LH4A 4IKFA 4KI6A 3ATUA 2O8EB 3KLFA 4B8AB 3HSCA 4NXNK 4B1VA 3QEVA 4GY2B 2GV9A 1KLNA 4E19A 3ZT4A 2AJQA 4XEIA 3PIPL 3V9SA 3QBXA 4PWDA 4Z4FA 3MAQA 4JNEA 2HHVA 4MDAA 3HOTA 1BGXT 4M3RA 5CZ2A 3OBYA 5F2RA 3UB5A 1VQKN 2ATQA 1KCFA 4DV4K 1JL1A 3Q7CA 4JI0K 3F9KA 4KHNA 1NGBA 1RBTA 3ENOA 4DLGA 4FJHA 2IS3A 1VSEA 5M1OA 4CJ7A 3HSTB 3V4IA 4JK9A 2D0BA 1A5VA 3EEQA 5AR0A 2GX9A 1E4FT 3FZMA 3CXCM 1WB9A 3IAYA 1XC3A 5J2MA 5JS1A 4H0OA 1SKRA 2FBYA 2VQEK 3RR7A 1HYSA 4A57A 4BE2A 3KLIA 4FJXA 2H3GX 3NAEA 3HYFA 5FPDA 4DQQA 3WQUA 1IG8A 3C7NB 3IUCA 4FJIA 3O4WA 4TSXA 3SLCA 4GV3A 1GLBG 5BRFA 3RRHA 1TK5A 1IKWA 1EO1A 5EU7A 5D3GA 2KZMA 1NGJA 4CEQA 1UAXA 4CF0A 1TL3A 3QETA 1EETA 5TKWA 3VEYA 4FWLA 3KHYA 3T1HK 4FM2A 2RPIA 2ZM6K 1HX1A 5CYMA 1TUYA 4BACA 3SUOA 1RTHA 3H46O 2G8HA 3FGUA 3VEWA 5J1EA 3Q7BA 4H03B 4JKGA 2A6AA 4CHZA 5AQTA 2IVOA 4CGDA 4IXCA 4KRFA 5HBMA 4B9TA 1J53A 4N41A 2E20A 3M1FA 4BG9A 5MLCQ 3AA3A 4GVMA 4K0KK 2FSJA 4IOAL 4B9LA 3B8AX 3VQPA 3HM8A 2G8IA 4N76A 4BR9A 4YNQA 3OYAA 1HNXK 2YV0X 1RTDA 1L5UA 4Y0WA 4CJ5A 3F73A 3A5LC 4ILHA 3OS2A 4FW2A 1NJIO 2FSKA 5AQWA 2HHTA 4JYAK 1NGCA 2WUSA 3AAQA 3DLGA 1K8AO 1YJWN 5EOYA 4JAXA 1J6ZA 1VSIA 3CC7N 2HF3A 2UUAK 4BDYA 4WFAL 1MWKA 1CZ9A 2EX3A 1B9DA 4FLUA 3PLAA 4KTZA 5LJWA 2HBMA 1NK5A 2DFFA 4MQ3A 2F9WA 3J80O 3DLRA 4ISEA 3MN6A 2WFBA 3WQTA 5AZJA 4BRGA 3H1QA 4Q5VA 3GOIA 4GKKK 2IVPA 1LW0A 4CEFA 4YOXA 3CJCA 3QEWA 2P1JA 4CVNE 3SAFA 2E2QA 4LFAK 4B9UA 3AO3A 5ELZA 3CJBA 4DQPA 5M1KA 1NG9A 5J2QA 2O8BB 2BH1A 3E1YA 4JRQA 4YDUA 1YF5L 4LSLA 2P9IA 3G71N 5AQHA 4CF8A 5FPEA 2VWJA 1QQMA 3DLEA 5TKYA 3OYMA 2KW4A 3RTVA 1WSJA 3V9ZA 3IDHA 3VESA 4GV6A 5CYQA 4E3SA 4DWIA 5CE3A 3R3LA 4E7KA 2RF2A 1BO5O 1C0GA 3ZT2A 3TAGA 4MFBA 2O8BA 1C0MA 4H4OA 5FLXO 5AQNA 3QFPA 1IKVA 3CCJN 4QCLA 4FLXA 3FE1A 4ELUA 1SAZA 4ZHRA 3EL2A 4DU3A 1OH8A 3D2FB 2D4WA 3L2QA 4FSVA 3LAMA 4CJPA 3AVLA 4WQ4A 3VQ4A 3GE1A 4J2BA 3PV8A 3F5TA 2ZJQL 4JHDA 3VQAA 4RTFD 4BVPA 2XO7A 2KKZA 1RILA 1N34K 4IDHA 3OJSA 1NK7A 1TYQB 3PSIA 4LF6K 3I0SA 4FJMA 1KFSA 4DQIA 2BUPA 1BCOA 3MXJA 4ID1A 4BGBA 4YORA 4CZFA 1ATSA 2V7YA 2A1SA 3EE8A 4CIGA 5BPLA 3SAGA 4BC5A 1NKCA 1JJ2M 2O8CB 4IZ9A 3LWMA 4CF2A 4DSFA 3G0ZA 2YX6A 4W5RA 2P9SA 3AA5X 2B4JA 3KLGA 3TR8A 2P9PA 4FWNA 2V52B 4M3UA 3KLEA 4OX9K 5CZ1A 3ID6A 1NK6A 2O8FA 3AO1A 3UKRB 1HNZK 4F3OA 4CZMA 4GV9A 3SI6A 4CZKA 3AAPA 1LWEA 1ZBSA 2FXUA 3VOVA 4DG1A 3SCXA 5BN8A 4O4GA 1OVYA 3SYZA 4PUOA 3ID8A 1RT4A 2B5JA 2VG6A 3S9HA 1L3VA 3P5JA 5DM7L 1NM1A 3TTCA 3D6RA 4LY7A 1JLBA 1QZ6A 4Y1DA 4A5BA 2NLXA 4OGCA 3WXIA 1VQ8N 4JD2B 1VQ4N 3EZ5A 4FM1A 4CJEA 2NRXA 1XHZA 2HBLA 1IH7A 5C2FA 4FJ5A 3TTFA 4FK2A 3VGMA 3T1AA 2QW9A 3K5LA 4B9NA 1HUXA 1RDCA 3FFIA 4RG8A 1NJWA 3TSQA 3TPQA 1SL1A 1Q18A 3ZETB 1UA1A 1BCMA 1KVAA 4MO4A 4JD2A 1Q82O 3SUPA 1GOBA 4FWMA 3P1GA 4CZLA 4MO5A 4KHQA 5I9EB 3QFUA 4NXMK 3EKSA 4N47A 5KPTA 1ATRA 1S1TA 1RT3A 2ASOA 3WXMB 3G6EN 4JKDA 1LOTB 3T19A 2Y1IA 2ZWHA 2GWJA 2WTUA 3RVCA 2NRTA 3WEEB 4LFBK 2O4IA 2OZMA 3P39A 4DFPA 4CJLA 3L6QA 4FCYA 4E89A 3ZETA 5ADXA 4N56A 2E2NA 3QEXA 1NKBA 4M3YA 4FK0A 2WOMA 3VF2A 3DLHA 2O8DB 3OTOK 3SQ2A 4Z94A 3OA9A 3AO5A 2FBVA 4J2EA 3ZT0A 5FRNA 1NK0A 1A5XA 3KZBA 2HHWA 3IFRA 2P9LA 1UA0A 2OPRA 2YI1A 3ZSWA 3ZYYX 1VSDA 2FBTA 1KTQA 3LDPA 1CXUA 3TABA 3V1OA 3OHRA 3VERA 2GUPA 2O8DA 1KAZA 1XWLA 3QNNA 1GLDG 1V4SA 1T6CA 1QVFM 4CBWA 2YKNA 4DV6K 3W3DA 2QWMA 1BI4B 1C0TA 3ZSVA 2NZTA 1BDGA 4JKAA 5BREA 4ID5A 4CK3A 1T6DA 1S6PA 2JLEA 4OLBA 2P9KA 2DFEA 1BWFO 4BQZA 1LV5A 2ZGZA 4LF8K 3VQDA 3V1RA 4CJFA 4CZEA 1BI4A 3OYGA 3ZX2A 4HUFA 4CGFA 4KHPK 4AHUA 4C8OA 1CXQA 3BY5A 5EXWA 4JI4K 3VF4A 4L3QA 4B3MK 4PHTX 2Z1JA 4J2DA 1LAVA 5KQDA 3KTQA 3O1WA 2G8VA 4EZ9A 4CEDA 4M42A 1IJJA 1RT7A 4NCGA 4H0VB 3PX0A 2HVHA 2UYTA 2UXCK 3CCVN 4JKCA 1HYZA 4J8FA 4IWVA 4BR4A 2UUCK 4C23A 3P4IA 4H0YB 4EZ6A 2Q2RA 1ASUA 1OH5A 1RGIA 4FWOA 3QESA 1S22A 2FSNA 4CGIA 3ULDA 3WUHA 1ZBHA 2DTUA 3E9LA 3VF6A 1YVUA 2LSNA 3AVIA 4DF4A 2G8FA 4OVLA 3THXA 1RTJA 1WSIA 4LFCK 3ISNC 3CJ1A 2HVIA 1ASWA 1D9DA 3S3NA 1IBMK 4HTUA
chains in the Genus database with same CATH topology
1TK5A 1S1VA 1FKOA 1R0AA 1SKWA 2ETJA 1IKWA 3E01A 1REVA 3ZSQA 5EU7A 5D3GA 4CFBA 2KZMA 4CEQA 4E1NA 1UAXA 5HRRA 3VQCA 3AVHA 4CF0A 1TL3A 2FC0A 4KHNA 4FW1A 3QETA 2DY4A 1WAFA 1EETA 3PO5A 2OZSA 5DMRA 4F4KA 1U49A 3SJJA 5KTQA 5I42A 4FM2A 1LW2A 3CQ8A 1W9HA 4DSEA 1RT6A 2RPIA 4QOZB 4I2QA 4KAZA 3KIOA 5CYMA 4BACA 3SUOA 4ICLA 1RTHA 1S6QA 4DTMA 2X74A 2PYJA 3AA4A 2G8HA 4E7LA 4CEOA 1VSHA 2EHGA 4KV8A 5J1EA 3K59A 3TWHA 3ALYA 4CHZA 1HPZA 1S1WA 2BE2A 3LAKA 3SQ1A 4FZXC 4M3WA 4CGDA 1IG9A 3VQ7A 4RW8A 3V9WA 3L2UA 2FBXA 3DM2A 3MXIA 5HBMA 4KRFA 4B9TA 1J53A 3V81A 4N41A 1RTIA 5K14A 1S5JA 3AA3A 3K2PA 1T8EA 2XRIA 4DQSA 2OA8A 4OKJA 4OLAA 3O3GA 4GVMA 4JS5A 4FJGA 3LALA 3AVBA 3O4QA 1NK8A 2RKIA 2WONA 4B9LA 3VQPA 3U3YA 1UWBA 3ZT3A 3SPYA 2G8IA 2GUIA 3LWLA 4YNQA 4CGJA 4Z4HA 1NK9A 4N76A 2F8TA 3OYAA 1TAUA 1RTDA 2YV0X 1KFDA 4QAGA 4M41A 4ZTJA 3QO9A 1C1BA 1QS4A 1L5UA 3KD1E 1NJZA 1FK9A 1X1PA 3C95A 1RBRA 1JXEA 3AVFA 4CJ5A 3NF9A 3OYDA 1RNHA 3TARA 3F73A 4LH5A 3KD5E 1RBUA 3HVTA 3OYKA 1FXXA 1WAJA 2YHAA 4FW2A 3OS2A 3HPOA 1J5OA 2HHTA 3CM6A 1DTTA 4FJ7A 1RDDA 2HNYA 1J9AA 3M8QA 3DRSA 4JLHA 3DLGA 2D5RA 3LDSA 3PO4A 3VQQA 3QLHA 2F96A 2HNDA 4CJKA 2XY7A 4FYDA 3SQ0A 1VSIA 3OY9A 3ASMA 1FKPA 1RDAA 1KVBA 3PUFA 4W5QA 4BDYA 2EX3A 1CZ9A 5KGWA 3K57A 1B9DA 3OYFA 2E6MA 1NOYA 4FLUA 2X78A 3TAPA 4KTZA 4DU4A 1C0UA 2E4LA 4F2RA 3TANA 1NK5A 3NE6A 4FK4A 4KB1A 2DFFA 1XHXA 4MQ3A 2D0CA 4B3OA 3DLRA 3AV9A 2HHSA 4FJLA 3C6UA 1VRTA 1TKZA 1G15A 1JKHA 4K8ZA 3LP1A 4Q5VA 3KKSA 4OGEA 1L3UA 2A1RA 3OS0A 4C8KA 1U4BA 4FJ9A 4DTXA 2D0AA 4KKOA 4KHWA 1LW0A 4CEFA 4CHNA 5C25A 3VQ9A 4DS4A 4CIFA 5KI6A 3QEWA 2P1JA 3HVRA 3OJUA 4HHTA 1NOZA 4FJJA 4I9LA 4B9UA 3VQ6A 4CERA 3AO3A 4DS5A 4BWMA 1X9MA 4DQPA 4CFDA 2QXFA 3L3UA 1CLQA 3D0PA 5J2QA 4F3TA 1XC9A 3PY8A 3OS1A 5C42A 4F2SA 4M3TA 5HRPA 4KB0A 1A5WA 1D8YA 4JRQA 4H8KA 4LSLA 3B6PA 4CF8A 1RBSA 2VWJA 3DLEA 4KHUA 1HYVA 1RT5A 3TAMA 3OYMA 2G8KA 2KW4A 3RTVA 1WSJA 3V9ZA 1HQUA 4CJ4A 4FJKA 5CYQA 1ZYQA 1C1CA 4E3SA 1Z26A 1QSLA 4DWIA 4E1MA 3I8DA 3RMDA 4CJQA 4ELVA 1W0HA 4BE1A 4E7KA 2RF2A 4OPKA 1HNIA 1KLMA 3ZT2A 3OYNA 4MFBA 3TAGA 3KLHA 1NJXA 1C0MA 4H4OA 3OYEA 1N5YA 4NCBA 3JSMA 1IKVA 1IO2A 1VSFA 3LP3A 3NGYA 4HVJA 3LP2A 2PZSA 3MECA 1UOCA 4FLXA 3QNOA 4CCHA 4QCLA 1JLFA 4ELUA 3QEPA 3KK1A 4AHSA 4FJ8A 1NK4A 1QE1A 4NYNA 4ZHRA 4HUGA 4DU3A 3U6FA 3K5NA 1JL2A 1F21A 3DRRA 4CHPA 3L2QA 3TAFA 3OYJA 3LAMA 1JLGA 5FDLA 4CJPA 3AVLA 4DF8A 1LWCA 3VQ4A 5E41A 2HMIA 2Z1IA 3VQ5A 4J2BA 3PV8A 2YKMA 4G1QA 4B9SA 2HHXA 3K5OA 2YNGA 5T7BA 2HHUA 4FLWA 1N6QA 3D45A 1S1XA 3L2VA 2X6SA 3HL8A 4NYFA 1KVCA 3VQAA 1S1UA 3OYHA 1WLJA 3O3FA 2XO7A 4CEEA 1SUQA 3MEGA 4AHVA 1RILA 1JXBA 1S9EA 1WN7A 3DI6A 3OJSA 4JS4A 2ZD1A 1TAQA 1NK7A 5FROA 1WSGA 4H4MA 1JLCA 1VK0A 4CGHA 1ZBFA 1IKXA 3I0SA 4CK1A 4DLEA 3RMCA 3MXMA 4FJMA 1KFSA 3K58A 4FLZA 3CFOA 3HO1A 1ITGA 4IFVA 4M45A 1BCOA 1GOCA 3MXJA 3HT3A 4DQIA 4BDZA 4XIUA 4M3XA 4ID1A 3HXMA 2F8SA 1T03A 4KFBA 2G8WA 4CJ3A 2A1SA 1TK8A 1ZBUA 3L2WA 4DSJA 3WNFA 4CIGA 3C6TA 1LWFA 1L3SA 4AHCA 1RBVA 3HP6A 5FRMA 1NKCA 1KSPA 4CIEA 3DLBA 3S3OA 2G8UA 4DTJA 3SV4A 1Y97A 1RT1A 1TKXA 3AO4A 3LWMA 4O44A 1B9FA 1U47A 2HHQA 3BGRA 3ZCMA 4CF2A 3DOLA 4DSFA 3H08A 3G0ZA 1WSEA 5JS2A 3TAEA 1QTMA 4DTPA 4W5RA 1NKEA 5SWMA 4C8LA 2XY8A 3AA5X 3CG7A 2B4JA 2R7YA 3KLGA 3TR8A 4W5NA 4DTUA 1EXQA 4M3UA 1D9FA 4CJSA 3KLEA 1WNSA 3HPGA 5CZ1A 3NDKA 4E7JA 2ITGA 4HUEA 4LD0A 1NK6A 4HCCA 3M8PA 3AO1A 4F3OA 4BDPA 2XY6A 4EP4A 3SI6A 4O5BA 4FZZA 1DLOA 3VQEA 2XY5A 1IKYA 3OYBA 4E7IA 1LWEA 1S9GA 1EP4A 3TI0A 3RRGA 4DG1A 3SCXA 1I39A 1X9SA 4O4GA 1CZBA 3SYZA 4AHTA 1NJYA 3L3VA 3AVKA 4IFYA 3HM9A 4PUOA 4Q0BA 1RT4A 2B5JA 3TAQA 3P83D 2VG6A 3NH2A 4CEAA 3S9HA 1L3VA 3P5JA 4PY5A 4KO0A 4LSNA 1Q8IA 2YNHA 5KRTA 3SNNA 2VG7A 1GOAA 2YNFA 4KHSA 3NFAA 1JLBA 4LY7A 4CEZA 4KTWA 3SQ4A 2PY5A 4HCBA 4Y1DA 1DTQA 4OGCA 5KGXA 4DQRA 4J2AA 4IG0A 4O0JA 4PQUA 1VSJA 2P51A 3CM5A 2IOCA 3AVNA 3HK2A 3NF6A 1YTAA 3EZ5A 4FM1A 3B6OA 4CJEA 4B9VA 4O55A 1XHZA 1IH7A 2E6LA 3VQ8A 3NH1A 4FJ5A 4FK2A 1Q9XA 3T1AA 3KJVA 3NBPA 3LP0A 3K5LA 4B9NA 4CJTA 3NH0A 1RDCA 3FFIA 1LAWA 4RG8A 4BWJA 5HRSA 1U04A 3QEIA 3RMBA 1NJWA 4B8CA 1K6YA 3NHGA 1QSYA 1QSSA 4DSIA 1U48A 1SL1A 1Q9YA 2W42A 2QK9A 5J2NA 3HPHA 3AVAA 4CJUA 4OJRA 4Y1CA 4N5SA 1BQMA 4CHQA 4B08A 2XHBA 1UA1A 1BCMA 1D5AA 3QINA 3WNEA 3V6DA 1KVAA 2X6NA 4IDKA 4FM0A 4DFJA 4FXDA 3NCIA 3SUPA 3K5MA 1HQEA 3SZ2A 5HROA 1GOBA 3HJFA 3NGIA 3P1GA 4CHOA 4OKKA 3LANA 4Z4CA 4GMJB 3PX6A 1SL2A 4YFUA 4KHQA 4DFKA 3VA0A 1TKDA 4M3ZA 2YNIA 4N47A 5J2PA 2KTQA 1ASVA 1RCHA 1RT3A 1S1TA 3RR8A 3T19A 2HW3A 2Y1IA 4DTOA 3OYLA 1HJRA 2O4IA 3QIPA 3WNHA 4CHYA 2KQ2A 1X9WA 2OZMA 1TV6A 4DU1A 4CJLA 4DFPA 4FCYA 1TL1A 2OPSA 4E89A 3NGZA 2OYQA 2ZQBA 4N56A 4Z4GA 3M8RA 1RDBA 4DFMA 2HB5A 3LZIA 4RW7A 2B6AA 1RT2A 3QEXA 1NKBA 3BDPA 4M3YA 4DTNA 4CE9A 4FK0A 1YTUA 5I3UA 4L8RB 2WOMA 3DLHA 2JGUA 3DLKA 3ZSXA 3G10A 3SQ2A 1Z25A 3AO5A 2FBVA 4J2EA 2BDPA 3ZT0A 1SKSA 1L3TA 2VWKA 2OPPA 1MU2A 3MEEA 5FRNA 4CK2A 1VRUA 1NK0A 1A5XA 3SPZA 4C8NA 1KRPA 3ZT1A 5SZTA 3SV3A 3PX4A 3O4NA 3UIQA 2GBZA 1I3AA 4CECA 3VA3A 2HHWA 4CGGA 4W5OA 3ZSRA 1VSLA 3VQBA 1ZBIA 4OPJA 4AHRA 2IC3A 4KI4A 3ZSOA 2OPRA 1UA0A 3ZSWA 4DSLA 1VSDA 4AILC 4I9QA 2FBTA 1KTQA 2P5OA 1CXUA 4CJVA 3AVCA 3TABA 4DSKA 3RWUA 3V1OA 1C1AA 4DTRA 1BHLA 3U3GA 5C24A 5HP1A 3M8SA 3OYCA 3SUNA 3L8BA 1XWLA 1TGOA 4CJWA 3QNNA 2BANA 3C94A 2KZZA 4EP5A 4DTSA 3JYTA 1T05A 3V1QA 3AA2A 5KRSA 1HNVA 2Q3SA 1B92A 2YKNA 3KKRA 4LH4A 4RW4A 5CY4A 3ZSZA 1ZBLA 4IKFA 2O4GA 4KI6A 1BI4B 2KFNA 4PA1A 4ELTA 1C0TA 3KLFA 3ZSVA 4B8AB 4F8RA 2HNZA 4OKEA 2PYLA 4KTQA 1TK0A 4FLVA 2Z1GA 4C8MA 4ID5A 4CK3A 1JLEA 3EY1A 4FLYA 3S3MA 1S6PA 1BISA 3CYMA 3ZSYA 4Z0UA 3DMJA 2JLEA 4JRPA 3QEVA 4RW9A 3AVMA 2QKKA 2GV9A 1KLNA 4E19A 3ZT4A 1WSHA 4OLBA 3O3HA 2Y1JA 3LZJA 4B9MA 4BE0A 2AJQA 4CF1A 2DFEA 1TVRA 3A2FA 3V9SA 1JLAA 4PWDA 4Z4FA 3KK3A 3VN5A 3L2RA 3EYZA 3T3FA 3THVA 4UQGA 1JLQA 3MAQA 3V9UA 1LV5A 4KHYA 3I0RA 2HHVA 3DYAA 5DK5A 3VQDA 1C6VA 3V1RA 1BQNA 2KFZA 1BGXT 4M3RA 5CZ2A 1BI4A 4CEBA 4CJFA 3OYGA 4I7FA 3OVNA 2ATQA 4HUFA 2QKBA 1KCFA 4K8XA 3IRXA 4CGFA 3IG1A 4AHUA 4C8OA 1JL1A 4FVMA 4I2PA 1CXQA 4W5TA 3DRPA 3F9KA 2IAJA 2VG5A 3DOKA 4CF9A 1BL3A 1RBTA 2RN2A 4R5PA 3CFPA 1VSMA 4FJNA 3MEDA 4DLGA 4FJHA 3OYIA 1HRHA 2IDOA 2IS3A 3V9XA 1VSEA 2Z1JA 1LAVA 4J2DA 5HRNA 2BGGA 1HMVA 1T7PA 4GW6A 3KTQA 2G8VA 3HSTB 3QIOA 4EZ9A 2Z1HA 4CEDA 4FZYA 4IBNA 4M42A 3NF7A 2I5JA 1YT3A 1RT7A 4NCGA 3V4IA 4KPYA 1EX4A 2D0BA 1A5VA 3PX0A 3LPUA 2HVHA 3WNGA 4CFCA 1HYZA 3IAYA 4Z4IA 3AO2A 4DMNA 4AH9A 3KK2A 4EZ6A 1QQCA 1O1WA 1VSKA 4E0DA 5J2MA 2NUBA 1ASUA 1SV5A 1SL0A 5JS1A 2YHBA 4WE1A 3QERA 1SKRA 2FBYA 1QHTA 3RR7A 3LPTA 4Z4EA 4E7HA 1HYSA 5HLFA 2DFHA 4CJRA 4BE2A 3KLIA 4FLTA 3AVGA 4FJXA 3NAEA 1XI1A 3QESA 4CFAA 3HYFA 4IG3A 3RMAA 2P5GA 2IGIA 4DQQA 4ZTFA 4O0IA 3NF8A 3AVJA 3HP9A 4CGIA 3ULDA 2OPQA 1ZBHA 2DTUA 4FJIA 1YVUA 2LSNA 1WSFA 3AVIA 3ITHA 4TSXA 4DF4A 1BIZA 2G8FA 4OVLA 4CESA 1RTJA 1WSIA 3ISNC 4RW6A 3SUQA 1BIUA 2ZE2A 3IS9A 4KREA 2HVIA 1J54A 1TKTA 1EKEA 1ASWA 3CFRA 1D9DA 4NCAA 1U45A 3S3NA 3RRHA 4HTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TK5 A;  1S1V A;  1FKO A;  1R0A A;  1SKW A;  2ETJ A;  1IKW A;  3E01 A;  1REV A;  3ZSQ A;  5EU7 A;  5D3G A;  4CFB A;  2KZM A;  4CEQ A;  4E1N A;  1UAX A;  5HRR A;  3VQC A;  3AVH A;  4CF0 A;  1TL3 A;  2FC0 A;  4KHN A;  4FW1 A;  3QET A;  2DY4 A;  1WAF A;  1EET A;  3PO5 A;  2OZS A;  5DMR A;  4F4K A;  1U49 A;  3SJJ A;  5KTQ A;  5I42 A;  4FM2 A;  1LW2 A;  3CQ8 A;  1W9H A;  4DSE A;  1RT6 A;  2RPI A;  4QOZ B;  4I2Q A;  4KAZ A;  3KIO A;  5CYM A;  4BAC A;  3SUO A;  4ICL A;  1RTH A;  1S6Q A;  4DTM A;  2X74 A;  2PYJ A;  3AA4 A;  2G8H A;  4E7L A;  4CEO A;  1VSH A;  2EHG A;  4KV8 A;  5J1E A;  3K59 A;  3TWH A;  3ALY A;  4CHZ A;  1HPZ A;  1S1W A;  2BE2 A;  3LAK A;  3SQ1 A;  4FZX C;  4M3W A;  4CGD A;  1IG9 A;  3VQ7 A;  4RW8 A;  3V9W A;  3L2U A;  2FBX A;  3DM2 A;  3MXI A;  5HBM A;  4KRF A;  4B9T A;  1J53 A;  3V81 A;  4N41 A;  1RTI A;  5K14 A;  1S5J A;  3AA3 A;  3K2P A;  1T8E A;  2XRI A;  4DQS A;  2OA8 A;  4OKJ A;  4OLA A;  3O3G A;  4GVM A;  4JS5 A;  4FJG A;  3LAL A;  3AVB A;  3O4Q A;  1NK8 A;  2RKI A;  2WON A;  4B9L A;  3VQP A;  3U3Y A;  1UWB A;  3ZT3 A;  3SPY A;  2G8I A;  2GUI A;  3LWL A;  4YNQ A;  4CGJ A;  4Z4H A;  1NK9 A;  4N76 A;  2F8T A;  3OYA A;  1TAU A;  1RTD A;  2YV0 X;  1KFD A;  4QAG A;  4M41 A;  4ZTJ A;  3QO9 A;  1C1B A;  1QS4 A;  1L5U A;  3KD1 E;  1NJZ A;  1FK9 A;  1X1P A;  3C95 A;  1RBR A;  1JXE A;  3AVF A;  4CJ5 A;  3NF9 A;  3OYD A;  1RNH A;  3TAR A;  3F73 A;  4LH5 A;  3KD5 E;  1RBU A;  3HVT A;  3OYK A;  1FXX A;  1WAJ A;  2YHA A;  4FW2 A;  3OS2 A;  3HPO A;  1J5O A;  2HHT A;  3CM6 A;  1DTT A;  4FJ7 A;  1RDD A;  2HNY A;  1J9A A;  3M8Q A;  3DRS A;  4JLH A;  3DLG A;  2D5R A;  3LDS A;  3PO4 A;  3VQQ A;  3QLH A;  2F96 A;  2HND A;  4CJK A;  2XY7 A;  4FYD A;  3SQ0 A;  1VSI A;  3OY9 A;  3ASM A;  1FKP A;  1RDA A;  1KVB A;  3PUF A;  4W5Q A;  4BDY A;  2EX3 A;  1CZ9 A;  5KGW A;  3K57 A;  1B9D A;  3OYF A;  2E6M A;  1NOY A;  4FLU A;  2X78 A;  3TAP A;  4KTZ A;  4DU4 A;  1C0U A;  2E4L A;  4F2R A;  3TAN A;  1NK5 A;  3NE6 A;  4FK4 A;  4KB1 A;  2DFF A;  1XHX A;  4MQ3 A;  2D0C A;  4B3O A;  3DLR A;  3AV9 A;  2HHS A;  4FJL A;  3C6U A;  1VRT A;  1TKZ A;  1G15 A;  1JKH A;  4K8Z A;  3LP1 A;  4Q5V A;  3KKS A;  4OGE A;  1L3U A;  2A1R A;  3OS0 A;  4C8K A;  1U4B A;  4FJ9 A;  4DTX A;  2D0A A;  4KKO A;  4KHW A;  1LW0 A;  4CEF A;  4CHN A;  5C25 A;  3VQ9 A;  4DS4 A;  4CIF A;  5KI6 A;  3QEW A;  2P1J A;  3HVR A;  3OJU A;  4HHT A;  1NOZ A;  4FJJ A;  4I9L A;  4B9U A;  3VQ6 A;  4CER A;  3AO3 A;  4DS5 A;  4BWM A;  1X9M A;  4DQP A;  4CFD A;  2QXF A;  3L3U A;  1CLQ A;  3D0P A;  5J2Q A;  4F3T A;  1XC9 A;  3PY8 A;  3OS1 A;  5C42 A;  4F2S A;  4M3T A;  5HRP A;  4KB0 A;  1A5W A;  1D8Y A;  4JRQ A;  4H8K A;  4LSL A;  3B6P A;  4CF8 A;  1RBS A;  2VWJ A;  3DLE A;  4KHU A;  1HYV A;  1RT5 A;  3TAM A;  3OYM A;  2G8K A;  2KW4 A;  3RTV A;  1WSJ A;  3V9Z A;  1HQU A;  4CJ4 A;  4FJK A;  5CYQ A;  1ZYQ A;  1C1C A;  4E3S A;  1Z26 A;  1QSL A;  4DWI A;  4E1M A;  3I8D A;  3RMD A;  4CJQ A;  4ELV A;  1W0H A;  4BE1 A;  4E7K A;  2RF2 A;  4OPK A;  1HNI A;  1KLM A;  3ZT2 A;  3OYN A;  4MFB A;  3TAG A;  3KLH A;  1NJX A;  1C0M A;  4H4O A;  3OYE A;  1N5Y A;  4NCB A;  3JSM A;  1IKV A;  1IO2 A;  1VSF A;  3LP3 A;  3NGY A;  4HVJ A;  3LP2 A;  2PZS A;  3MEC A;  1UOC A;  4FLX A;  3QNO A;  4CCH A;  4QCL A;  1JLF A;  4ELU A;  3QEP A;  3KK1 A;  4AHS A;  4FJ8 A;  1NK4 A;  1QE1 A;  4NYN A;  4ZHR A;  4HUG A;  4DU3 A;  3U6F A;  3K5N A;  1JL2 A;  1F21 A;  3DRR A;  4CHP A;  3L2Q A;  3TAF A;  3OYJ A;  3LAM A;  1JLG A;  5FDL A;  4CJP A;  3AVL A;  4DF8 A;  1LWC A;  3VQ4 A;  5E41 A;  2HMI A;  2Z1I A;  3VQ5 A;  4J2B A;  3PV8 A;  2YKM A;  4G1Q A;  4B9S A;  2HHX A;  3K5O A;  2YNG A;  5T7B A;  2HHU A;  4FLW A;  1N6Q A;  3D45 A;  1S1X A;  3L2V A;  2X6S A;  3HL8 A;  4NYF A;  1KVC A;  3VQA A;  1S1U A;  3OYH A;  1WLJ A;  3O3F A;  2XO7 A;  4CEE A;  1SUQ A;  3MEG A;  4AHV A;  1RIL A;  1JXB A;  1S9E A;  1WN7 A;  3DI6 A;  3OJS A;  4JS4 A;  2ZD1 A;  1TAQ A;  1NK7 A;  5FRO A;  1WSG A;  4H4M A;  1JLC A;  1VK0 A;  4CGH A;  1ZBF A;  1IKX A;  3I0S A;  4CK1 A;  4DLE A;  3RMC A;  3MXM A;  4FJM A;  1KFS A;  3K58 A;  4FLZ A;  3CFO A;  3HO1 A;  1ITG A;  4IFV A;  4M45 A;  1BCO A;  1GOC A;  3MXJ A;  3HT3 A;  4DQI A;  4BDZ A;  4XIU A;  4M3X A;  4ID1 A;  3HXM A;  2F8S A;  1T03 A;  4KFB A;  2G8W A;  4CJ3 A;  2A1S A;  1TK8 A;  1ZBU A;  3L2W A;  4DSJ A;  3WNF A;  4CIG A;  3C6T A;  1LWF A;  1L3S A;  4AHC A;  1RBV A;  3HP6 A;  5FRM A;  1NKC A;  1KSP A;  4CIE A;  3DLB A;  3S3O A;  2G8U A;  4DTJ A;  3SV4 A;  1Y97 A;  1RT1 A;  1TKX A;  3AO4 A;  3LWM A;  4O44 A;  1B9F A;  1U47 A;  2HHQ A;  3BGR A;  3ZCM A;  4CF2 A;  3DOL A;  4DSF A;  3H08 A;  3G0Z A;  1WSE A;  5JS2 A;  3TAE A;  1QTM A;  4DTP A;  4W5R A;  1NKE A;  5SWM A;  4C8L A;  2XY8 A;  3AA5 X;  3CG7 A;  2B4J A;  2R7Y A;  3KLG A;  3TR8 A;  4W5N A;  4DTU A;  1EXQ A;  4M3U A;  1D9F A;  4CJS A;  3KLE A;  1WNS A;  3HPG A;  5CZ1 A;  3NDK A;  4E7J A;  2ITG A;  4HUE A;  4LD0 A;  1NK6 A;  4HCC A;  3M8P A;  3AO1 A;  4F3O A;  4BDP A;  2XY6 A;  4EP4 A;  3SI6 A;  4O5B A;  4FZZ A;  1DLO A;  3VQE A;  2XY5 A;  1IKY A;  3OYB A;  4E7I A;  1LWE A;  1S9G A;  1EP4 A;  3TI0 A;  3RRG A;  4DG1 A;  3SCX A;  1I39 A;  1X9S A;  4O4G A;  1CZB A;  3SYZ A;  4AHT A;  1NJY A;  3L3V A;  3AVK A;  4IFY A;  3HM9 A;  4PUO A;  4Q0B A;  1RT4 A;  2B5J A;  3TAQ A;  3P83 D;  2VG6 A;  3NH2 A;  4CEA A;  3S9H A;  1L3V A;  3P5J A;  4PY5 A;  4KO0 A;  4LSN A;  1Q8I A;  2YNH A;  5KRT A;  3SNN A;  2VG7 A;  1GOA A;  2YNF A;  4KHS A;  3NFA A;  1JLB A;  4LY7 A;  4CEZ A;  4KTW A;  3SQ4 A;  2PY5 A;  4HCB A;  4Y1D A;  1DTQ A;  4OGC A;  5KGX A;  4DQR A;  4J2A A;  4IG0 A;  4O0J A;  4PQU A;  1VSJ A;  2P51 A;  3CM5 A;  2IOC A;  3AVN A;  3HK2 A;  3NF6 A;  1YTA A;  3EZ5 A;  4FM1 A;  3B6O A;  4CJE A;  4B9V A;  4O55 A;  1XHZ A;  1IH7 A;  2E6L A;  3VQ8 A;  3NH1 A;  4FJ5 A;  4FK2 A;  1Q9X A;  3T1A A;  3KJV A;  3NBP A;  3LP0 A;  3K5L A;  4B9N A;  4CJT A;  3NH0 A;  1RDC A;  3FFI A;  1LAW A;  4RG8 A;  4BWJ A;  5HRS A;  1U04 A;  3QEI A;  3RMB A;  1NJW A;  4B8C A;  1K6Y A;  3NHG A;  1QSY A;  1QSS A;  4DSI A;  1U48 A;  1SL1 A;  1Q9Y A;  2W42 A;  2QK9 A;  5J2N A;  3HPH A;  3AVA A;  4CJU A;  4OJR A;  4Y1C A;  4N5S A;  1BQM A;  4CHQ A;  4B08 A;  2XHB A;  1UA1 A;  1BCM A;  1D5A A;  3QIN A;  3WNE A;  3V6D A;  1KVA A;  2X6N A;  4IDK A;  4FM0 A;  4DFJ A;  4FXD A;  3NCI A;  3SUP A;  3K5M A;  1HQE A;  3SZ2 A;  5HRO A;  1GOB A;  3HJF A;  3NGI A;  3P1G A;  4CHO A;  4OKK A;  3LAN A;  4Z4C A;  4GMJ B;  3PX6 A;  1SL2 A;  4YFU A;  4KHQ A;  4DFK A;  3VA0 A;  1TKD A;  4M3Z A;  2YNI A;  4N47 A;  5J2P A;  2KTQ A;  1ASV A;  1RCH A;  1RT3 A;  1S1T A;  3RR8 A;  3T19 A;  2HW3 A;  2Y1I A;  4DTO A;  3OYL A;  1HJR A;  2O4I A;  3QIP A;  3WNH A;  4CHY A;  2KQ2 A;  1X9W A;  2OZM A;  1TV6 A;  4DU1 A;  4CJL A;  4DFP A;  4FCY A;  1TL1 A;  2OPS A;  4E89 A;  3NGZ A;  2OYQ A;  2ZQB A;  4N56 A;  4Z4G A;  3M8R A;  1RDB A;  4DFM A;  2HB5 A;  3LZI A;  4RW7 A;  2B6A A;  1RT2 A;  3QEX A;  1NKB A;  3BDP A;  4M3Y A;  4DTN A;  4CE9 A;  4FK0 A;  1YTU A;  5I3U A;  4L8R B;  2WOM A;  3DLH A;  2JGU A;  3DLK A;  3ZSX A;  3G10 A;  3SQ2 A;  1Z25 A;  3AO5 A;  2FBV A;  4J2E A;  2BDP A;  3ZT0 A;  1SKS A;  1L3T A;  2VWK A;  2OPP A;  1MU2 A;  3MEE A;  5FRN A;  4CK2 A;  1VRU A;  1NK0 A;  1A5X A;  3SPZ A;  4C8N A;  1KRP A;  3ZT1 A;  5SZT A;  3SV3 A;  3PX4 A;  3O4N A;  3UIQ A;  2GBZ A;  1I3A A;  4CEC A;  3VA3 A;  2HHW A;  4CGG A;  4W5O A;  3ZSR A;  1VSL A;  3VQB A;  1ZBI A;  4OPJ A;  4AHR A;  2IC3 A;  4KI4 A;  3ZSO A;  2OPR A;  1UA0 A;  3ZSW A;  4DSL A;  1VSD A;  4AIL C;  4I9Q A;  2FBT A;  1KTQ A;  2P5O A;  1CXU A;  4CJV A;  3AVC A;  3TAB A;  4DSK A;  3RWU A;  3V1O A;  1C1A A;  4DTR A;  1BHL A;  3U3G A;  5C24 A;  5HP1 A;  3M8S A;  3OYC A;  3SUN A;  3L8B A;  1XWL A;  1TGO A;  4CJW A;  3QNN A;  2BAN A;  3C94 A;  2KZZ A;  4EP5 A;  4DTS A;  3JYT A;  1T05 A;  3V1Q A;  3AA2 A;  5KRS A;  1HNV A;  2Q3S A;  1B92 A;  2YKN A;  3KKR A;  4LH4 A;  4RW4 A;  5CY4 A;  3ZSZ A;  1ZBL A;  4IKF A;  2O4G A;  4KI6 A;  1BI4 B;  2KFN A;  4PA1 A;  4ELT A;  1C0T A;  3KLF A;  3ZSV A;  4B8A B;  4F8R A;  2HNZ A;  4OKE A;  2PYL A;  4KTQ A;  1TK0 A;  4FLV A;  2Z1G A;  4C8M A;  4ID5 A;  4CK3 A;  1JLE A;  3EY1 A;  4FLY A;  3S3M A;  1S6P A;  1BIS A;  3CYM A;  3ZSY A;  4Z0U A;  3DMJ A;  2JLE A;  4JRP A;  3QEV A;  4RW9 A;  3AVM A;  2QKK A;  2GV9 A;  1KLN A;  4E19 A;  3ZT4 A;  1WSH A;  4OLB A;  3O3H A;  2Y1J A;  3LZJ A;  4B9M A;  4BE0 A;  2AJQ A;  4CF1 A;  2DFE A;  1TVR A;  3A2F A;  3V9S A;  1JLA A;  4PWD A;  4Z4F A;  3KK3 A;  3VN5 A;  3L2R A;  3EYZ A;  3T3F A;  3THV A;  4UQG A;  1JLQ A;  3MAQ A;  3V9U A;  1LV5 A;  4KHY A;  3I0R A;  2HHV A;  3DYA A;  5DK5 A;  3VQD A;  1C6V A;  3V1R A;  1BQN A;  2KFZ A;  1BGX T;  4M3R A;  5CZ2 A;  1BI4 A;  4CEB A;  4CJF A;  3OYG A;  4I7F A;  3OVN A;  2ATQ A;  4HUF A;  2QKB A;  1KCF A;  4K8X A;  3IRX A;  4CGF A;  3IG1 A;  4AHU A;  4C8O A;  1JL1 A;  4FVM A;  4I2P A;  1CXQ A;  4W5T A;  3DRP A;  3F9K A;  2IAJ A;  2VG5 A;  3DOK A;  4CF9 A;  1BL3 A;  1RBT A;  2RN2 A;  4R5P A;  3CFP A;  1VSM A;  4FJN A;  3MED A;  4DLG A;  4FJH A;  3OYI A;  1HRH A;  2IDO A;  2IS3 A;  3V9X A;  1VSE A;  2Z1J A;  1LAV A;  4J2D A;  5HRN A;  2BGG A;  1HMV A;  1T7P A;  4GW6 A;  3KTQ A;  2G8V A;  3HST B;  3QIO A;  4EZ9 A;  2Z1H A;  4CED A;  4FZY A;  4IBN A;  4M42 A;  3NF7 A;  2I5J A;  1YT3 A;  1RT7 A;  4NCG A;  3V4I A;  4KPY A;  1EX4 A;  2D0B A;  1A5V A;  3PX0 A;  3LPU A;  2HVH A;  3WNG A;  4CFC A;  1HYZ A;  3IAY A;  4Z4I A;  3AO2 A;  4DMN A;  4AH9 A;  3KK2 A;  4EZ6 A;  1QQC A;  1O1W A;  1VSK A;  4E0D A;  5J2M A;  2NUB A;  1ASU A;  1SV5 A;  1SL0 A;  5JS1 A;  2YHB A;  4WE1 A;  3QER A;  1SKR A;  2FBY A;  1QHT A;  3RR7 A;  3LPT A;  4Z4E A;  4E7H A;  1HYS A;  5HLF A;  2DFH A;  4CJR A;  4BE2 A;  3KLI A;  4FLT A;  3AVG A;  4FJX A;  3NAE A;  1XI1 A;  3QES A;  4CFA A;  3HYF A;  4IG3 A;  3RMA A;  2P5G A;  2IGI A;  4DQQ A;  4ZTF A;  4O0I A;  3NF8 A;  3AVJ A;  3HP9 A;  4CGI A;  3ULD A;  2OPQ A;  1ZBH A;  2DTU A;  4FJI A;  1YVU A;  2LSN A;  1WSF A;  3AVI A;  3ITH A;  4TSX A;  4DF4 A;  1BIZ A;  2G8F A;  4OVL A;  4CES A;  1RTJ A;  1WSI A;  3ISN C;  4RW6 A;  3SUQ A;  1BIU A;  2ZE2 A;  3IS9 A;  4KRE A;  2HVI A;  1J54 A;  1TKT A;  1EKE A;  1ASW A;  3CFR A;  1D9D A;  4NCA A;  1U45 A;  3S3N A;  3RRH A;  4HTU A; 
#chains in the Genus database with same CATH topology
 2HHH K;  2ETJ A;  3VGL A;  4IO9 L;  3E01 A;  1REV A;  2UU9 K;  4ILG B;  3DLL L;  3N4Q A;  4IEE A;  2FC0 A;  4FW1 A;  1FJG K;  3PO5 A;  4JI2 K;  4H0T B;  3SJJ A;  5KTQ A;  1LW2 A;  1W9H A;  3GG4 A;  4DSE A;  4QOZ B;  4I2Q A;  3SBG A;  3G4S N;  4ICL A;  1S6Q A;  4DTM A;  2X74 A;  1KXP A;  2YJF A;  3K0S A;  3J81 O;  1HPZ A;  2BE2 A;  4FZX C;  3O9R A;  3VQ7 A;  3V9W A;  2E8A A;  3L2U A;  2FBX A;  5AFU H;  3WXK A;  1X3N A;  1RTI A;  1VQL N;  1QHA A;  3K2P A;  1T8E A;  4JKE A;  4OLA A;  3O3G A;  4JS5 A;  3WXL A;  2DPN A;  3AVB A;  3O4Q A;  1NK8 A;  2WON A;  1UWB A;  2IIR A;  3DXM B;  2GUI A;  3SPY A;  1NK9 A;  2F8T A;  4DHY A;  1TAU A;  1KFD A;  4PL7 A;  4BC2 A;  3QO9 A;  3CPW M;  1FK9 A;  1YUW A;  4B3R K;  1JXE A;  3F2K A;  4BRF A;  1RNH A;  2ZF5 O;  4LH5 A;  1RBU A;  1FXX A;  1WAJ A;  4U67 L;  3HPO A;  4DR5 K;  2IVN A;  2Q0R A;  3BZC A;  4JKH A;  3CM6 A;  1DTT A;  1RDD A;  2HNY A;  3DRS A;  3PSF A;  4JLH A;  4LF5 K;  3PO4 A;  3R8E A;  3DXM A;  2F96 A;  3QLH A;  4CJK A;  2XY7 A;  1R59 O;  4BRQ A;  3K9K A;  3OY9 A;  3ASM A;  1FKP A;  3EKU A;  1RDA A;  3RSE A;  1KVB A;  1O13 A;  4BQL A;  3K57 A;  1OH7 A;  4A61 A;  3TAP A;  4KH4 A;  4DU4 A;  5GAG P;  4IJA A;  4F2R A;  3ENB A;  4FK4 A;  4KB1 A;  4O8U A;  4BRM A;  4G9Z A;  4B3O A;  1DKG D;  1GLE G;  1VRT A;  4BRN A;  3O8M A;  4JK8 A;  5EY4 A;  4DV5 K;  3LP1 A;  3KKS A;  4OGE A;  1RDW X;  5M1N A;  1U4B A;  5AFU A;  3VQ9 A;  4K25 A;  5KI6 A;  2NRZ A;  3LL3 A;  4HHT A;  4FJJ A;  4I9L A;  1WBB A;  3L4I A;  1Q86 O;  4CFD A;  2I7P A;  2QXF A;  5LY3 A;  2HF4 A;  3ZX3 A;  3KVG A;  5C42 A;  5HRP A;  3PIO L;  4DR3 K;  1N8R O;  4BRH A;  4FWP A;  1EWQ A;  2J4R A;  4KHU A;  1Q7Y O;  3HBT A;  5GAE P;  2F7T A;  2NNW A;  4BRI A;  4IEI A;  1ZYQ A;  4I6M A;  1Z26 A;  1VQO N;  1Z6R A;  4BE1 A;  1YXQ A;  4CBX A;  4JKG B;  3OYN A;  1NJX A;  1N5Y A;  3KLH A;  3NGY A;  1BA0 A;  3QNO A;  3QEP A;  4HUG A;  1F21 A;  3DRR A;  5E84 A;  4H5W A;  1XNQ K;  4DF8 A;  4YHH K;  4BGA A;  3H45 C;  3VQ5 A;  4B9S A;  1ATN A;  2YKM A;  4G1Q A;  5T7B A;  2YNG A;  1N6Q A;  3D45 A;  4BRD A;  3OYH A;  5JVH L;  1WLJ A;  3O3F A;  4B1Z A;  2A42 A;  1WN7 A;  3DI6 A;  4EHU A;  3P38 A;  3SJH A;  4BR0 A;  4JS4 A;  3O08 A;  1JCF A;  4H4M A;  4CK1 A;  1ZBF A;  3MXM A;  4FLZ A;  2A5X A;  4B1X B;  4BDZ A;  4X62 K;  2G8W A;  3GL1 A;  4CJ3 A;  4JKF A;  4DSJ A;  1GLA G;  1L3S A;  4MLE A;  4AHC A;  5FRM A;  1KSP A;  4FOE A;  3SMS A;  1YJN N;  3AO4 A;  1EWR A;  2HHQ A;  4DB3 A;  2QA4 N;  3QDK A;  1Z05 A;  5JS2 A;  3MX2 A;  4DTP A;  5AZJ B;  2R7Y A;  3CG7 A;  4W5N A;  3HRG A;  1GLJ O;  1WNS A;  1HKG A;  3NDK A;  4E7J A;  2V7Z A;  2OTJ N;  4HUE A;  4HCC A;  4WYB A;  3VEZ A;  3J7A P;  4EP4 A;  4FZZ A;  1DLO A;  1NMD A;  2FLO A;  1IKY A;  1ESV A;  1S9G A;  3W0L A;  1QZ5 A;  3H3O B;  3L3V A;  3T69 A;  3WT0 A;  1TUU A;  3P83 D;  3NH2 A;  2P9I B;  4CEA A;  1ILY A;  4ISG A;  3N4P A;  2YHW A;  1Q8I A;  2YNH A;  2YNF A;  5BRH A;  4DV3 K;  3NFA A;  2PY5 A;  3CET A;  4J2A A;  1DEJ A;  1WUA A;  3CM5 A;  2IOC A;  3HK2 A;  2OTL N;  3VET A;  2E6L A;  4WF9 L;  3EO3 A;  3KJV A;  3NBP A;  3LP0 A;  5BPN A;  4CJT A;  4DUY K;  1NWK A;  4BWJ A;  4IFE A;  4DSI A;  4B8C A;  1K6Y A;  4K43 A;  4A2A A;  3NHG A;  1QSY A;  1U48 A;  3E66 A;  1HJO A;  2I7N A;  1QVG M;  3HPH A;  3AVA A;  4CJU A;  1HKB A;  2A40 A;  2NRH A;  3QIN A;  3WNE A;  1NBW A;  2X6N A;  4IDK A;  4F9O A;  5F0X A;  3NCI A;  2CH6 A;  4WQ5 A;  3K5M A;  1HQE A;  3SZ2 A;  5HRO A;  4B9Q A;  4OKK A;  3LDQ A;  4JHD B;  1BA1 A;  4Z4C A;  3PX6 A;  2Q0U A;  3MK6 A;  3VA0 A;  4M3Z A;  2YNI A;  5J2P A;  1VHX A;  1X9J A;  1ASV A;  1RCH A;  3RR8 A;  2HW3 A;  3QIP A;  3WNH A;  4CHY A;  2KQ2 A;  3O6W A;  1TL1 A;  2OYQ A;  2ZQB A;  3M8R A;  3CCS N;  4DFM A;  3LZI A;  4B3T K;  3BDP A;  4DTN A;  4CE9 A;  4CZG A;  1XMQ K;  2Q1N A;  3ZSX A;  2BTF A;  3G10 A;  3I33 A;  1Z25 A;  3EN9 A;  4IO8 A;  4JI7 K;  1H1V A;  2OPP A;  3VEV A;  5SZT A;  1I3A A;  4FL9 A;  4BR7 A;  4PL8 A;  5JLF A;  2NRV A;  4OPJ A;  4PKI A;  2P9S B;  2ASM A;  2IC3 A;  4KI4 A;  3ZSO A;  3O1B A;  3P31 A;  4DSL A;  3C6H A;  2P9P B;  3VTI A;  4B3S K;  3OBW A;  3AVC A;  2QTD A;  5HOO A;  3VTH A;  4DSK A;  4DTR A;  2A41 A;  2O8F B;  3M8S A;  3U9D A;  3L8B A;  1TGO A;  1W97 L;  4EP5 A;  3JYT A;  1T05 A;  3V1Q A;  5KRS A;  3MN5 A;  3KKR A;  3LM9 A;  4RW4 A;  1ZBL A;  3LDN A;  2KFN A;  4ELT A;  4GNI A;  4OKE A;  4KTQ A;  3MMV A;  5AQF A;  4C8M A;  4FLY A;  4FOI A;  1BIS A;  3CYM A;  2QXL A;  4JRP A;  4RW9 A;  3SAH A;  3DXK A;  5AQO A;  1WSH A;  3LZJ A;  4B9M A;  1VQP N;  3A2F A;  4FPA A;  3L2R A;  4JEP A;  3EYZ A;  3T3F A;  4UQG A;  2EWS A;  1S3X A;  4KHY A;  5DK5 A;  3NMU A;  5IT9 O;  4CEB A;  3OVN A;  3THY B;  2HBK A;  2QKB A;  1KAY A;  2GWK A;  2QWL A;  4FVM A;  4I2P A;  3DRP A;  4CF9 A;  2VG5 A;  1KC8 O;  1KAX A;  3DOK A;  4DR7 K;  2RN2 A;  1NGE A;  5LJV A;  1VSM A;  2QWQ A;  1HRH A;  2IDO A;  1M1K O;  1T7P A;  4GW6 A;  4DV7 K;  2YHY A;  3NF7 A;  2QEX N;  5C2D A;  1C0F A;  3LPU A;  4O5F A;  3WNG A;  4CFC A;  3THY A;  1D4X A;  4FO0 A;  4Z4I A;  3AO2 A;  4DMN A;  4AH9 A;  1YIJ N;  3SMP A;  1QQC A;  1O1W A;  2YHB A;  4WE1 A;  3TSU A;  2CGJ A;  4IOC L;  1QHT A;  4Z4E A;  3U8X A;  4E7H A;  1E3M A;  3EE9 A;  2DFH A;  4FLT A;  2GEL A;  3AVG A;  1XI1 A;  3A8Y A;  3A0I X;  3L0Q A;  4IG3 A;  3A5M C;  2P5G A;  3FR0 A;  3VEX A;  4ZTF A;  3AVJ A;  3HP9 A;  2OPQ A;  2AP1 A;  1BIZ A;  3CC4 N;  4LF9 K;  2V51 B;  4OPH A;  4OPA A;  3I56 N;  1BIU A;  2ZE2 A;  3IS9 A;  3ZEU A;  1J54 A;  1TKT A;  1EKE A;  3CFR A;  4NCA A;  1U45 A;  1NGA A;  4LC9 B;  2P9L B;  5KQ8 A;  3JS6 A;  3DWL A;  1S1V A;  1FKO A;  1VAZ A;  5DM6 L;  1SKW A;  1HR0 K;  3CER A;  5HRR A;  3AVH A;  3VQC A;  2DY4 A;  2OZS A;  1NGF A;  5DMR A;  4F4K A;  2YJE A;  3AGR A;  2P9N A;  4QS9 A;  3O5B A;  3CQ8 A;  1RT6 A;  1NGH A;  1QQO A;  4HTL A;  4E7L A;  4CEO A;  1VSH A;  2EHG A;  2P9K B;  3CQY A;  5GIN A;  3K59 A;  3TWH A;  4PKH A;  3SQ1 A;  2W6L A;  1GLF O;  4RW8 A;  4CBU A;  2Q31 A;  2HBJ A;  3DM2 A;  1BU6 O;  3D2E A;  5K14 A;  5JLH A;  1S5J A;  1KQS M;  3VEO A;  2XRI A;  4FJG A;  4KH5 A;  2RKI A;  3LWL A;  2RE2 A;  3A5O C;  4CGJ A;  4Z4H A;  1BOT O;  4M41 A;  4ZTJ A;  3SK3 A;  4CW7 B;  2YHX A;  3AVF A;  2CGL A;  3OYD A;  5AQL A;  1HLU A;  3TAR A;  3HVT A;  4JI1 K;  3CJ7 A;  4AM7 A;  5F1X A;  1LCU A;  4FJ7 A;  3JAM O;  1J9A A;  2D5R A;  5JVG L;  1NU0 A;  1NGG A;  4W5Q A;  1K73 O;  3OYF A;  2E2P A;  2VGM A;  1C0U A;  1XMO K;  3TAN A;  2WC9 A;  4DKW A;  3NE6 A;  1XHX A;  5AQU A;  4FJL A;  3C6U A;  1TKZ A;  3FZL A;  2VCP A;  1JKH A;  3AGK A;  4K8Z A;  1JCE A;  3ZX0 A;  3OS0 A;  3THX B;  4C8K A;  4FJ9 A;  4DTX A;  4KKO A;  3CJ9 A;  5C25 A;  5CHI A;  3CPE A;  4BR2 A;  2E1Y A;  2ZJP L;  4EFH A;  3OJU A;  1NOZ A;  1SZ2 A;  5C0Y A;  4KH6 A;  4E1J A;  3VQ6 A;  4CER A;  4B1U B;  1RDU A;  1CLQ A;  3D0P A;  2E1Z A;  1XC9 A;  3OS1 A;  4F2S A;  4KB0 A;  2E5L K;  4FWK A;  5AZI A;  2CGK A;  1RBS A;  3SBT A;  3CC2 N;  1HYV A;  3TAM A;  5H1S Q;  5AQR A;  1HQU A;  3LDL A;  2UUB K;  1U2V B;  4YDU C;  3U4L A;  4E1M A;  5C12 A;  3I8D A;  3RMD A;  3UKU B;  4ELV A;  1MA9 B;  2ITM A;  5AQX A;  3VPZ A;  1HNI A;  1KLM A;  3CCE N;  3BZK A;  4NCB A;  4H5T A;  1JCG A;  5AJ3 K;  3JSM A;  3CME N;  2PZS A;  3MEC A;  4CCH A;  3M6G A;  3O9U A;  4DCH A;  4FJ8 A;  1NK4 A;  3BEX A;  2Q36 A;  3U6F A;  1IBL K;  5AQY A;  4CHP A;  3TAF A;  3OYJ A;  3FZK A;  5FDL A;  5FPN A;  5E41 A;  1U2V A;  1K8K A;  2Z1I A;  2HHU A;  2HHX A;  3VEN A;  5AQQ A;  3O9S A;  3UKU A;  4FLW A;  1S1X A;  3L2V A;  3HL8 A;  4NYF A;  1S1U A;  3MEG A;  4H5V A;  4AHV A;  4WQ4 C;  3MWT A;  2PFU A;  4YOY A;  3MX5 A;  1WSG A;  1VK0 A;  4CGH A;  5GIP A;  1IKX A;  4DLE A;  3ULE A;  5LMU K;  5AQK A;  1T3V A;  4JI8 K;  1XNR K;  3HT3 A;  1W7A A;  3CD6 N;  4H5R A;  3THW A;  3RSE B;  5E26 A;  1ZBU A;  3WNF A;  1N32 K;  3C6T A;  1U6Z A;  1YAG A;  2CH5 A;  3LM2 A;  5EVZ A;  1RBV A;  4CIE A;  3DLB A;  4O44 A;  1U47 A;  1OVQ A;  3ZCM A;  3H08 A;  3TAE A;  2W6K A;  4C8L A;  2XY8 A;  3CIP A;  4DTU A;  1EXQ A;  3HPG A;  4HWI A;  1YHQ N;  4LD0 A;  3M8P A;  3QML A;  3C0B A;  3CI5 A;  4XH4 A;  4BDP A;  2XY6 A;  1VQM N;  4BVO A;  3CCQ N;  1VQ5 N;  2ZGY A;  3OYB A;  2PBD A;  4JI5 K;  2O8E A;  3TI0 A;  3KK7 A;  3RRG A;  4H0P A;  1I39 A;  5AQP A;  4FVU A;  1CZA N;  1X9S A;  4X66 K;  3CHW A;  4IFY A;  3AVK A;  3MN7 A;  1GLC G;  4PY5 A;  1ZC6 A;  3H1V X;  1SS6 A;  3SNN A;  2VG7 A;  1X3M A;  2Q97 A;  3MCP A;  1Q81 O;  4KTW A;  4HCB A;  3DAW A;  1DTQ A;  4I6M B;  4O0J A;  2E2O A;  4IG0 A;  1VSJ A;  2P51 A;  3NF6 A;  3B6O A;  2KLA A;  3R1X A;  5AQM A;  5A2Q O;  3NH1 A;  1DGK N;  4R79 A;  5HRS A;  1LAW A;  3QEI A;  3RMB A;  1U04 A;  3NVM A;  3CCL N;  4NLB A;  2W42 A;  2QK9 A;  5J2N A;  4OJR A;  4Y1C A;  5KPZ A;  1D5A A;  4FM0 A;  4DFJ A;  3BF1 A;  3H3N O;  4CZH A;  4FWR A;  3K9J A;  3NGI A;  1G99 A;  3LAN A;  3IMX A;  1SL2 A;  4KBO A;  4DFK A;  4DR1 K;  1TKD A;  2KTQ A;  4A5A A;  5JMV A;  3OYL A;  1X9W A;  4A62 A;  2FF6 A;  3NGZ A;  2OPS A;  4DV0 K;  1RDB A;  2HB5 A;  4RW7 A;  4FWS A;  1YTU A;  2QWO A;  5CR4 A;  3DLK A;  2VQF K;  3C7N A;  2BDP A;  1SKS A;  4CK2 A;  1VRU A;  3SPZ A;  4M63 C;  4C8N A;  1KRP A;  3ZT1 A;  3CCR N;  3UIQ A;  2GBZ A;  3GDQ A;  4CEC A;  3VA3 A;  5M1Q A;  3ZSR A;  1VSL A;  3VQB A;  3DJC A;  1ZBI A;  1W2B M;  3O80 A;  4AIL C;  1V4T A;  3RWU A;  3QBW A;  4CJV A;  2FF3 B;  4U7B A;  1C1A A;  3FZH A;  1BHL A;  3U3G A;  4YOU A;  2D1K A;  5C24 A;  4FWQ A;  1K9M O;  4CJW A;  2OAN A;  2BAN A;  3C94 A;  4BRE A;  2KZZ A;  4DTS A;  3L4Q A;  2W41 A;  1HNV A;  2Q3S A;  5CY4 A;  3ZSZ A;  2O4G A;  1NNE A;  4PA1 A;  1NLV A;  4F8R A;  2HNZ A;  2PYL A;  1TK0 A;  4FLV A;  2Z1G A;  3EY1 A;  1JLE A;  3S3M A;  3HO1 A;  3ZSY A;  4Z0U A;  3DMJ A;  3AVM A;  2QKK A;  4JK7 A;  1NMN A;  3O3H A;  2Y1J A;  4BE0 A;  4CF1 A;  1TVR A;  1JLA A;  3KK3 A;  3VN5 A;  5B8H A;  3THV A;  3CF5 L;  1JLQ A;  5BRD A;  2F9T A;  3V9U A;  3I0R A;  3M3Z A;  1J5E K;  3DYA A;  3NVK A;  5HL7 L;  1C6V A;  1BQN A;  3O9T A;  2KFZ A;  4ISF A;  4I7F A;  4QS7 A;  4K8X A;  3IRX A;  3IG1 A;  4O8K A;  4BY9 C;  2VGN A;  4W5T A;  4B1Y B;  4R5P A;  2IAJ A;  4C1N K;  3CFP A;  4CZI A;  1BL3 A;  4FJN A;  4EIA A;  3MED A;  4BRC A;  3AY9 A;  3OYI A;  3V9X A;  2BGG A;  5HRN A;  5AQV A;  1HMV A;  3BP8 A;  3QIO A;  4RCH A;  2Z1H A;  1HNW K;  4FZY A;  4IBN A;  2I5J A;  1YT3 A;  4KPY A;  1EX4 A;  4YY3 K;  3C65 A;  4YOV A;  3KK2 A;  1VSK A;  3MN9 A;  4E0D A;  2NUB A;  1SV5 A;  4WFN L;  5IWA K;  1SL0 A;  3TSP A;  3HI0 A;  3QER A;  4IJN A;  3LPT A;  5HLF A;  3G25 A;  1P90 A;  4CJR A;  4LF7 K;  2OCE A;  4CFA A;  3I55 N;  3RMA A;  4BC3 A;  2IGI A;  4O0I A;  3NF8 A;  2ASP A;  5BN9 A;  4WFB L;  3BUZ B;  4K41 A;  3QIC A;  1WSF A;  3ITH A;  4CES A;  4BRL A;  3SUQ A;  4RW6 A;  4KRE A;  3MDQ A;  4JV5 K;  4XH1 A;  4FJK A;  1N33 K;  1R0A A;  1Y64 A;  3C6A A;  5M1P A;  3ZSQ A;  4CFB A;  4CD3 A;  4E1N A;  3A5N C;  3D7E O;  2P9U B;  2D0O A;  1WAF A;  4OO1 J;  4UY8 O;  3GBT A;  1IV0 A;  1T44 A;  1U49 A;  5I42 A;  3J7Z O;  3E9P A;  1EQY A;  4KAZ A;  3KIO A;  4BRK A;  3ZLJ A;  3LDO A;  3DXK B;  3OW2 M;  2PYJ A;  3AA4 A;  4KV8 A;  3ALY A;  1OKJ A;  1M90 O;  1S1W A;  1SQK A;  3LAK A;  4QS8 A;  4M3W A;  1BG3 A;  1IG9 A;  2P9U A;  3MXI A;  3V81 A;  1YIT N;  1OH6 A;  4NO7 A;  3D2F A;  4DQS A;  2OA8 A;  4OKJ A;  3LAL A;  3U3Y A;  3ZT3 A;  3M5R A;  1DT9 A;  4MDB A;  4QAG A;  1XQS C;  2QWN A;  4DQ8 A;  2PAV A;  1C1B A;  1QS4 A;  3R9P A;  3KD1 E;  1NJZ A;  5BR9 A;  1X1P A;  4YOW A;  3C95 A;  1RBR A;  2F4V K;  3CCU N;  3T1Y K;  3NF9 A;  3MWP A;  3KD5 E;  3OYK A;  2YHA A;  1TYQ A;  1J5O A;  5JIC A;  3M8Q A;  2D0P A;  3LDS A;  3VQQ A;  2HND A;  4FYD A;  3BF3 A;  3SQ0 A;  4BR5 A;  3KWI A;  3PUF A;  4B1W B;  1YJ9 N;  1YVN A;  5KGW A;  4A59 A;  2E6M A;  1NOY A;  2X78 A;  3F9M A;  2E4L A;  2O8C A;  4DR6 K;  2D0C A;  3VGK A;  2GEM A;  3AV9 A;  5GIO A;  2HHS A;  3EZW A;  5ADX H;  3HZ6 A;  4CZJ A;  1G15 A;  5BPM A;  2UXD K;  4MLH A;  1WBD A;  2JWL A;  1L3U A;  2A1R A;  2WBN A;  2D0A A;  4KHW A;  4GKJ K;  5AQG A;  4CHN A;  4DS4 A;  3ZEU B;  4CIF A;  3UKR A;  3HVR A;  5LL6 Z;  4DS5 A;  2UXB K;  4NLC A;  4BWM A;  1X9M A;  2HMP A;  3L3U A;  1GLL O;  1QQN A;  4F3T A;  3PY8 A;  4M3T A;  1A5W A;  1D8Y A;  2RHK A;  4AF1 A;  4H8K A;  3B6P A;  3J7Y P;  1RT5 A;  4XH5 A;  2G8K A;  2P9N B;  4V19 S;  4CJ4 A;  4PKG A;  2W40 A;  4YOT A;  4BRA A;  1MWM A;  3CCM N;  1C1C A;  1QSL A;  4CJQ A;  1W0H A;  4JI6 K;  4M7X A;  4OPK A;  3OYE A;  3TU5 A;  1IO2 A;  1VSF A;  3LP3 A;  4HVJ A;  3LP2 A;  1UOC A;  1JLF A;  3ENH A;  5GAH P;  3KK1 A;  4AHS A;  3D2E B;  1QE1 A;  2QWP A;  4NYN A;  3K5N A;  1JL2 A;  3TTD A;  2JWK A;  1JLG A;  3ATV A;  4DUZ K;  1LWC A;  2HMI A;  4JKB A;  3CQX A;  3K5O A;  1MDU B;  2X6S A;  3I8B A;  1KVC A;  1BUP A;  2VWB A;  4CEE A;  1SUQ A;  4GVE A;  1JXB A;  1S9E A;  3WXJ A;  2ZD1 A;  3J8A A;  1TAQ A;  5FRO A;  2VYP A;  3WEE A;  3R6M A;  1JLC A;  3RMC A;  4DR4 K;  3K58 A;  4A2B A;  3CFO A;  2QM1 A;  1ITG A;  4IFV A;  4M45 A;  2GTD A;  1GOC A;  4XIU A;  4M3X A;  3HXM A;  5AQJ A;  2F8S A;  1T03 A;  4KFB A;  1XUP O;  2NRW A;  5AQZ A;  4AQY K;  1TK8 A;  3L2W A;  1LWF A;  4X65 K;  1P8Z A;  4H0X B;  3HP6 A;  3S41 A;  1HKC A;  3S3O A;  2G8U A;  4DTJ A;  3SV4 A;  4BRP A;  1Y97 A;  1RT1 A;  1TKX A;  3CJA A;  5AQS A;  1B9F A;  3BGR A;  3DOL A;  1WSE A;  1QTM A;  1NKE A;  5SWM A;  4DV1 K;  3VMF B;  2YCH A;  1D9F A;  4M7Y A;  4CJS A;  4H5N A;  2ITG A;  1VQ7 N;  3HTV A;  3H6E A;  4IOX A;  4O5B A;  3E9O A;  4AM6 A;  3VQE A;  2XY5 A;  1E4G T;  2KHO A;  4E7I A;  1KD1 O;  1EP4 A;  3FFK B;  5EX5 A;  3FZF A;  3FLC O;  1CZB A;  4AHT A;  1NJY A;  3HM9 A;  1HPM A;  4Q0B A;  3TAQ A;  5AZI B;  2QI2 A;  3IKM A;  4JI3 K;  4KO0 A;  4LSN A;  5KRT A;  1GOA A;  4KHS A;  3SQ4 A;  4CEZ A;  4BRO A;  4DQR A;  5KGX A;  4X64 K;  4WCE L;  5M1F A;  2AA4 A;  4PQU A;  4NB4 A;  3AVN A;  3KWG A;  1YTA A;  2NRR A;  4B9V A;  4O55 A;  1N36 K;  3UE5 A;  3VQ8 A;  4K42 A;  4RWT A;  1Q9X A;  5C15 A;  3NH0 A;  4CD1 A;  1QSS A;  5LMN K;  1Q9Y A;  3T7Z A;  4N5S A;  5C10 A;  1BQM A;  4CHQ A;  4FPB A;  4B08 A;  5FPM A;  2XHB A;  3V6D A;  3MCA B;  1YI2 N;  1K8K B;  3U9Z A;  1FW6 A;  4FXD A;  5KPR A;  1WOQ A;  3HJF A;  4CHO A;  4GMJ B;  1NGI A;  3AAR A;  4YFU A;  4DV2 K;  5GAD P;  1VQ6 N;  2HST A;  4DTO A;  4ILJ A;  4WQ5 C;  1HJR A;  4CI6 A;  4BG8 A;  3O9Q A;  3ULE B;  1TV6 A;  4DU1 A;  2E88 A;  3JXU A;  4Z4G A;  1IBK K;  2B6A A;  1RT2 A;  3CMA N;  3QB0 A;  3THW B;  5I3U A;  4L8R B;  5BR8 K;  2JGU A;  4C1N I;  1NGD A;  5AQI A;  2QWR A;  1L3T A;  2VWK A;  1MU2 A;  3MEE A;  1I94 K;  4LF4 K;  3SV3 A;  3PX4 A;  3O4N A;  4CGG A;  4W5O A;  4AHR A;  1VQ9 N;  4EHT A;  2HOE A;  4I9Q A;  3HOS A;  2P5O A;  1S72 N;  4DR2 K;  4BC4 A;  1RFQ A;  5HP1 A;  2A3Z A;  3OYC A;  3SUN A;  4JN4 A;  1VQN N;  1ZXO A;  2ZJR L;  4EAH D;  3AA2 A;  1B92 A;  4LH4 A;  4IKF A;  4KI6 A;  3ATU A;  2O8E B;  3KLF A;  4B8A B;  3HSC A;  4NXN K;  4B1V A;  3QEV A;  4GY2 B;  2GV9 A;  1KLN A;  4E19 A;  3ZT4 A;  2AJQ A;  4XEI A;  3PIP L;  3V9S A;  3QBX A;  4PWD A;  4Z4F A;  3MAQ A;  4JNE A;  2HHV A;  4MDA A;  3HOT A;  1BGX T;  4M3R A;  5CZ2 A;  3OBY A;  5F2R A;  3UB5 A;  1VQK N;  2ATQ A;  1KCF A;  4DV4 K;  1JL1 A;  3Q7C A;  4JI0 K;  3F9K A;  4KHN A;  1NGB A;  1RBT A;  3ENO A;  4DLG A;  4FJH A;  2IS3 A;  1VSE A;  5M1O A;  4CJ7 A;  3HST B;  3V4I A;  4JK9 A;  2D0B A;  1A5V A;  3EEQ A;  5AR0 A;  2GX9 A;  1E4F T;  3FZM A;  3CXC M;  1WB9 A;  3IAY A;  1XC3 A;  5J2M A;  5JS1 A;  4H0O A;  1SKR A;  2FBY A;  2VQE K;  3RR7 A;  1HYS A;  4A57 A;  4BE2 A;  3KLI A;  4FJX A;  2H3G X;  3NAE A;  3HYF A;  5FPD A;  4DQQ A;  3WQU A;  1IG8 A;  3C7N B;  3IUC A;  4FJI A;  3O4W A;  4TSX A;  3SLC A;  4GV3 A;  1GLB G;  5BRF A;  3RRH A;  1TK5 A;  1IKW A;  1EO1 A;  5EU7 A;  5D3G A;  2KZM A;  1NGJ A;  4CEQ A;  1UAX A;  4CF0 A;  1TL3 A;  3QET A;  1EET A;  5TKW A;  3VEY A;  4FWL A;  3KHY A;  3T1H K;  4FM2 A;  2RPI A;  2ZM6 K;  1HX1 A;  5CYM A;  1TUY A;  4BAC A;  3SUO A;  1RTH A;  3H46 O;  2G8H A;  3FGU A;  3VEW A;  5J1E A;  3Q7B A;  4H03 B;  4JKG A;  2A6A A;  4CHZ A;  5AQT A;  2IVO A;  4CGD A;  4IXC A;  4KRF A;  5HBM A;  4B9T A;  1J53 A;  4N41 A;  2E20 A;  3M1F A;  4BG9 A;  5MLC Q;  3AA3 A;  4GVM A;  4K0K K;  2FSJ A;  4IOA L;  4B9L A;  3B8A X;  3VQP A;  3HM8 A;  2G8I A;  4N76 A;  4BR9 A;  4YNQ A;  3OYA A;  1HNX K;  2YV0 X;  1RTD A;  1L5U A;  4Y0W A;  4CJ5 A;  3F73 A;  3A5L C;  4ILH A;  3OS2 A;  4FW2 A;  1NJI O;  2FSK A;  5AQW A;  2HHT A;  4JYA K;  1NGC A;  2WUS A;  3AAQ A;  3DLG A;  1K8A O;  1YJW N;  5EOY A;  4JAX A;  1J6Z A;  1VSI A;  3CC7 N;  2HF3 A;  2UUA K;  4BDY A;  4WFA L;  1MWK A;  1CZ9 A;  2EX3 A;  1B9D A;  4FLU A;  3PLA A;  4KTZ A;  5LJW A;  2HBM A;  1NK5 A;  2DFF A;  4MQ3 A;  2F9W A;  3J80 O;  3DLR A;  4ISE A;  3MN6 A;  2WFB A;  3WQT A;  5AZJ A;  4BRG A;  3H1Q A;  4Q5V A;  3GOI A;  4GKK K;  2IVP A;  1LW0 A;  4CEF A;  4YOX A;  3CJC A;  3QEW A;  2P1J A;  4CVN E;  3SAF A;  2E2Q A;  4LFA K;  4B9U A;  3AO3 A;  5ELZ A;  3CJB A;  4DQP A;  5M1K A;  1NG9 A;  5J2Q A;  2O8B B;  2BH1 A;  3E1Y A;  4JRQ A;  4YDU A;  1YF5 L;  4LSL A;  2P9I A;  3G71 N;  5AQH A;  4CF8 A;  5FPE A;  2VWJ A;  1QQM A;  3DLE A;  5TKY A;  3OYM A;  2KW4 A;  3RTV A;  1WSJ A;  3V9Z A;  3IDH A;  3VES A;  4GV6 A;  5CYQ A;  4E3S A;  4DWI A;  5CE3 A;  3R3L A;  4E7K A;  2RF2 A;  1BO5 O;  1C0G A;  3ZT2 A;  3TAG A;  4MFB A;  2O8B A;  1C0M A;  4H4O A;  5FLX O;  5AQN A;  3QFP A;  1IKV A;  3CCJ N;  4QCL A;  4FLX A;  3FE1 A;  4ELU A;  1SAZ A;  4ZHR A;  3EL2 A;  4DU3 A;  1OH8 A;  3D2F B;  2D4W A;  3L2Q A;  4FSV A;  3LAM A;  4CJP A;  3AVL A;  4WQ4 A;  3VQ4 A;  3GE1 A;  4J2B A;  3PV8 A;  3F5T A;  2ZJQ L;  4JHD A;  3VQA A;  4RTF D;  4BVP A;  2XO7 A;  2KKZ A;  1RIL A;  1N34 K;  4IDH A;  3OJS A;  1NK7 A;  1TYQ B;  3PSI A;  4LF6 K;  3I0S A;  4FJM A;  1KFS A;  4DQI A;  2BUP A;  1BCO A;  3MXJ A;  4ID1 A;  4BGB A;  4YOR A;  4CZF A;  1ATS A;  2V7Y A;  2A1S A;  3EE8 A;  4CIG A;  5BPL A;  3SAG A;  4BC5 A;  1NKC A;  1JJ2 M;  2O8C B;  4IZ9 A;  3LWM A;  4CF2 A;  4DSF A;  3G0Z A;  2YX6 A;  4W5R A;  2P9S A;  3AA5 X;  2B4J A;  3KLG A;  3TR8 A;  2P9P A;  4FWN A;  2V52 B;  4M3U A;  3KLE A;  4OX9 K;  5CZ1 A;  3ID6 A;  1NK6 A;  2O8F A;  3AO1 A;  3UKR B;  1HNZ K;  4F3O A;  4CZM A;  4GV9 A;  3SI6 A;  4CZK A;  3AAP A;  1LWE A;  1ZBS A;  2FXU A;  3VOV A;  4DG1 A;  3SCX A;  5BN8 A;  4O4G A;  1OVY A;  3SYZ A;  4PUO A;  3ID8 A;  1RT4 A;  2B5J A;  2VG6 A;  3S9H A;  1L3V A;  3P5J A;  5DM7 L;  1NM1 A;  3TTC A;  3D6R A;  4LY7 A;  1JLB A;  1QZ6 A;  4Y1D A;  4A5B A;  2NLX A;  4OGC A;  3WXI A;  1VQ8 N;  4JD2 B;  1VQ4 N;  3EZ5 A;  4FM1 A;  4CJE A;  2NRX A;  1XHZ A;  2HBL A;  1IH7 A;  5C2F A;  4FJ5 A;  3TTF A;  4FK2 A;  3VGM A;  3T1A A;  2QW9 A;  3K5L A;  4B9N A;  1HUX A;  1RDC A;  3FFI A;  4RG8 A;  1NJW A;  3TSQ A;  3TPQ A;  1SL1 A;  1Q18 A;  3ZET B;  1UA1 A;  1BCM A;  1KVA A;  4MO4 A;  4JD2 A;  1Q82 O;  3SUP A;  1GOB A;  4FWM A;  3P1G A;  4CZL A;  4MO5 A;  4KHQ A;  5I9E B;  3QFU A;  4NXM K;  3EKS A;  4N47 A;  5KPT A;  1ATR A;  1S1T A;  1RT3 A;  2ASO A;  3WXM B;  3G6E N;  4JKD A;  1LOT B;  3T19 A;  2Y1I A;  2ZWH A;  2GWJ A;  2WTU A;  3RVC A;  2NRT A;  3WEE B;  4LFB K;  2O4I A;  2OZM A;  3P39 A;  4DFP A;  4CJL A;  3L6Q A;  4FCY A;  4E89 A;  3ZET A;  5ADX A;  4N56 A;  2E2N A;  3QEX A;  1NKB A;  4M3Y A;  4FK0 A;  2WOM A;  3VF2 A;  3DLH A;  2O8D B;  3OTO K;  3SQ2 A;  4Z94 A;  3OA9 A;  3AO5 A;  2FBV A;  4J2E A;  3ZT0 A;  5FRN A;  1NK0 A;  1A5X A;  3KZB A;  2HHW A;  3IFR A;  2P9L A;  1UA0 A;  2OPR A;  2YI1 A;  3ZSW A;  3ZYY X;  1VSD A;  2FBT A;  1KTQ A;  3LDP A;  1CXU A;  3TAB A;  3V1O A;  3OHR A;  3VER A;  2GUP A;  2O8D A;  1KAZ A;  1XWL A;  3QNN A;  1GLD G;  1V4S A;  1T6C A;  1QVF M;  4CBW A;  2YKN A;  4DV6 K;  3W3D A;  2QWM A;  1BI4 B;  1C0T A;  3ZSV A;  2NZT A;  1BDG A;  4JKA A;  5BRE A;  4ID5 A;  4CK3 A;  1T6D A;  1S6P A;  2JLE A;  4OLB A;  2P9K A;  2DFE A;  1BWF O;  4BQZ A;  1LV5 A;  2ZGZ A;  4LF8 K;  3VQD A;  3V1R A;  4CJF A;  4CZE A;  1BI4 A;  3OYG A;  3ZX2 A;  4HUF A;  4CGF A;  4KHP K;  4AHU A;  4C8O A;  1CXQ A;  3BY5 A;  5EXW A;  4JI4 K;  3VF4 A;  4L3Q A;  4B3M K;  4PHT X;  2Z1J A;  4J2D A;  1LAV A;  5KQD A;  3KTQ A;  3O1W A;  2G8V A;  4EZ9 A;  4CED A;  4M42 A;  1IJJ A;  1RT7 A;  4NCG A;  4H0V B;  3PX0 A;  2HVH A;  2UYT A;  2UXC K;  3CCV N;  4JKC A;  1HYZ A;  4J8F A;  4IWV A;  4BR4 A;  2UUC K;  4C23 A;  3P4I A;  4H0Y B;  4EZ6 A;  2Q2R A;  1ASU A;  1OH5 A;  1RGI A;  4FWO A;  3QES A;  1S22 A;  2FSN A;  4CGI A;  3ULD A;  3WUH A;  1ZBH A;  2DTU A;  3E9L A;  3VF6 A;  1YVU A;  2LSN A;  3AVI A;  4DF4 A;  2G8F A;  4OVL A;  3THX A;  1RTJ A;  1WSI A;  4LFC K;  3ISN C;  3CJ1 A;  2HVI A;  1ASW A;  1D9D A;  3S3N A;  1IBM K;  4HTU A; 
#chains in the Genus database with same CATH homology
 1TK5 A;  1S1V A;  1FKO A;  1R0A A;  1SKW A;  2ETJ A;  1IKW A;  3E01 A;  1REV A;  3ZSQ A;  5EU7 A;  5D3G A;  4CFB A;  2KZM A;  4CEQ A;  4E1N A;  1UAX A;  5HRR A;  3VQC A;  3AVH A;  4CF0 A;  1TL3 A;  2FC0 A;  4KHN A;  4FW1 A;  3QET A;  2DY4 A;  1WAF A;  1EET A;  3PO5 A;  2OZS A;  5DMR A;  4F4K A;  1U49 A;  3SJJ A;  5KTQ A;  5I42 A;  4FM2 A;  1LW2 A;  3CQ8 A;  1W9H A;  4DSE A;  1RT6 A;  2RPI A;  4QOZ B;  4I2Q A;  4KAZ A;  3KIO A;  5CYM A;  4BAC A;  3SUO A;  4ICL A;  1RTH A;  1S6Q A;  4DTM A;  2X74 A;  2PYJ A;  3AA4 A;  2G8H A;  4E7L A;  4CEO A;  1VSH A;  2EHG A;  4KV8 A;  5J1E A;  3K59 A;  3TWH A;  3ALY A;  4CHZ A;  1HPZ A;  1S1W A;  2BE2 A;  3LAK A;  3SQ1 A;  4FZX C;  4M3W A;  4CGD A;  1IG9 A;  3VQ7 A;  4RW8 A;  3V9W A;  3L2U A;  2FBX A;  3DM2 A;  3MXI A;  5HBM A;  4KRF A;  4B9T A;  1J53 A;  3V81 A;  4N41 A;  1RTI A;  5K14 A;  1S5J A;  3AA3 A;  3K2P A;  1T8E A;  2XRI A;  4DQS A;  2OA8 A;  4OKJ A;  4OLA A;  3O3G A;  4GVM A;  4JS5 A;  4FJG A;  3LAL A;  3AVB A;  3O4Q A;  1NK8 A;  2RKI A;  2WON A;  4B9L A;  3VQP A;  3U3Y A;  1UWB A;  3ZT3 A;  3SPY A;  2G8I A;  2GUI A;  3LWL A;  4YNQ A;  4CGJ A;  4Z4H A;  1NK9 A;  4N76 A;  2F8T A;  3OYA A;  1TAU A;  1RTD A;  2YV0 X;  1KFD A;  4QAG A;  4M41 A;  4ZTJ A;  3QO9 A;  1C1B A;  1QS4 A;  1L5U A;  3KD1 E;  1NJZ A;  1FK9 A;  1X1P A;  3C95 A;  1RBR A;  1JXE A;  3AVF A;  4CJ5 A;  3NF9 A;  3OYD A;  1RNH A;  3TAR A;  3F73 A;  4LH5 A;  3KD5 E;  1RBU A;  3HVT A;  3OYK A;  1FXX A;  1WAJ A;  2YHA A;  4FW2 A;  3OS2 A;  3HPO A;  1J5O A;  2HHT A;  3CM6 A;  1DTT A;  4FJ7 A;  1RDD A;  2HNY A;  1J9A A;  3M8Q A;  3DRS A;  4JLH A;  3DLG A;  2D5R A;  3LDS A;  3PO4 A;  3VQQ A;  3QLH A;  2F96 A;  2HND A;  4CJK A;  2XY7 A;  4FYD A;  3SQ0 A;  1VSI A;  3OY9 A;  3ASM A;  1FKP A;  1RDA A;  1KVB A;  3PUF A;  4W5Q A;  4BDY A;  2EX3 A;  1CZ9 A;  5KGW A;  3K57 A;  1B9D A;  3OYF A;  2E6M A;  1NOY A;  4FLU A;  2X78 A;  3TAP A;  4KTZ A;  4DU4 A;  1C0U A;  2E4L A;  4F2R A;  3TAN A;  1NK5 A;  3NE6 A;  4FK4 A;  4KB1 A;  2DFF A;  1XHX A;  4MQ3 A;  2D0C A;  4B3O A;  3DLR A;  3AV9 A;  2HHS A;  4FJL A;  3C6U A;  1VRT A;  1TKZ A;  1G15 A;  1JKH A;  4K8Z A;  3LP1 A;  4Q5V A;  3KKS A;  4OGE A;  1L3U A;  2A1R A;  3OS0 A;  4C8K A;  1U4B A;  4FJ9 A;  4DTX A;  2D0A A;  4KKO A;  4KHW A;  1LW0 A;  4CEF A;  4CHN A;  5C25 A;  3VQ9 A;  4DS4 A;  4CIF A;  5KI6 A;  3QEW A;  2P1J A;  3HVR A;  3OJU A;  4HHT A;  1NOZ A;  4FJJ A;  4I9L A;  4B9U A;  3VQ6 A;  4CER A;  3AO3 A;  4DS5 A;  4BWM A;  1X9M A;  4DQP A;  4CFD A;  2QXF A;  3L3U A;  1CLQ A;  3D0P A;  5J2Q A;  4F3T A;  1XC9 A;  3PY8 A;  3OS1 A;  5C42 A;  4F2S A;  4M3T A;  5HRP A;  4KB0 A;  1A5W A;  1D8Y A;  4JRQ A;  4H8K A;  4LSL A;  3B6P A;  4CF8 A;  1RBS A;  2VWJ A;  3DLE A;  4KHU A;  1HYV A;  1RT5 A;  3TAM A;  3OYM A;  2G8K A;  2KW4 A;  3RTV A;  1WSJ A;  3V9Z A;  1HQU A;  4CJ4 A;  4FJK A;  5CYQ A;  1ZYQ A;  1C1C A;  4E3S A;  1Z26 A;  1QSL A;  4DWI A;  4E1M A;  3I8D A;  3RMD A;  4CJQ A;  4ELV A;  1W0H A;  4BE1 A;  4E7K A;  2RF2 A;  4OPK A;  1HNI A;  1KLM A;  3ZT2 A;  3OYN A;  4MFB A;  3TAG A;  3KLH A;  1NJX A;  1C0M A;  4H4O A;  3OYE A;  1N5Y A;  4NCB A;  3JSM A;  1IKV A;  1IO2 A;  1VSF A;  3LP3 A;  3NGY A;  4HVJ A;  3LP2 A;  2PZS A;  3MEC A;  1UOC A;  4FLX A;  3QNO A;  4CCH A;  4QCL A;  1JLF A;  4ELU A;  3QEP A;  3KK1 A;  4AHS A;  4FJ8 A;  1NK4 A;  1QE1 A;  4NYN A;  4ZHR A;  4HUG A;  4DU3 A;  3U6F A;  3K5N A;  1JL2 A;  1F21 A;  3DRR A;  4CHP A;  3L2Q A;  3TAF A;  3OYJ A;  3LAM A;  1JLG A;  5FDL A;  4CJP A;  3AVL A;  4DF8 A;  1LWC A;  3VQ4 A;  5E41 A;  2HMI A;  2Z1I A;  3VQ5 A;  4J2B A;  3PV8 A;  2YKM A;  4G1Q A;  4B9S A;  2HHX A;  3K5O A;  2YNG A;  5T7B A;  2HHU A;  4FLW A;  1N6Q A;  3D45 A;  1S1X A;  3L2V A;  2X6S A;  3HL8 A;  4NYF A;  1KVC A;  3VQA A;  1S1U A;  3OYH A;  1WLJ A;  3O3F A;  2XO7 A;  4CEE A;  1SUQ A;  3MEG A;  4AHV A;  1RIL A;  1JXB A;  1S9E A;  1WN7 A;  3DI6 A;  3OJS A;  4JS4 A;  2ZD1 A;  1TAQ A;  1NK7 A;  5FRO A;  1WSG A;  4H4M A;  1JLC A;  1VK0 A;  4CGH A;  1ZBF A;  1IKX A;  3I0S A;  4CK1 A;  4DLE A;  3RMC A;  3MXM A;  4FJM A;  1KFS A;  3K58 A;  4FLZ A;  3CFO A;  3HO1 A;  1ITG A;  4IFV A;  4M45 A;  1BCO A;  1GOC A;  3MXJ A;  3HT3 A;  4DQI A;  4BDZ A;  4XIU A;  4M3X A;  4ID1 A;  3HXM A;  2F8S A;  1T03 A;  4KFB A;  2G8W A;  4CJ3 A;  2A1S A;  1TK8 A;  1ZBU A;  3L2W A;  4DSJ A;  3WNF A;  4CIG A;  3C6T A;  1LWF A;  1L3S A;  4AHC A;  1RBV A;  3HP6 A;  5FRM A;  1NKC A;  1KSP A;  4CIE A;  3DLB A;  3S3O A;  2G8U A;  4DTJ A;  3SV4 A;  1Y97 A;  1RT1 A;  1TKX A;  3AO4 A;  3LWM A;  4O44 A;  1B9F A;  1U47 A;  2HHQ A;  3BGR A;  3ZCM A;  4CF2 A;  3DOL A;  4DSF A;  3H08 A;  3G0Z A;  1WSE A;  5JS2 A;  3TAE A;  1QTM A;  4DTP A;  4W5R A;  1NKE A;  5SWM A;  4C8L A;  2XY8 A;  3AA5 X;  3CG7 A;  2B4J A;  2R7Y A;  3KLG A;  3TR8 A;  4W5N A;  4DTU A;  1EXQ A;  4M3U A;  1D9F A;  4CJS A;  3KLE A;  1WNS A;  3HPG A;  5CZ1 A;  3NDK A;  4E7J A;  2ITG A;  4HUE A;  4LD0 A;  1NK6 A;  4HCC A;  3M8P A;  3AO1 A;  4F3O A;  4BDP A;  2XY6 A;  4EP4 A;  3SI6 A;  4O5B A;  4FZZ A;  1DLO A;  3VQE A;  2XY5 A;  1IKY A;  3OYB A;  4E7I A;  1LWE A;  1S9G A;  1EP4 A;  3TI0 A;  3RRG A;  4DG1 A;  3SCX A;  1I39 A;  1X9S A;  4O4G A;  1CZB A;  3SYZ A;  4AHT A;  1NJY A;  3L3V A;  3AVK A;  4IFY A;  3HM9 A;  4PUO A;  4Q0B A;  1RT4 A;  2B5J A;  3TAQ A;  3P83 D;  2VG6 A;  3NH2 A;  4CEA A;  3S9H A;  1L3V A;  3P5J A;  4PY5 A;  4KO0 A;  4LSN A;  1Q8I A;  2YNH A;  5KRT A;  3SNN A;  2VG7 A;  1GOA A;  2YNF A;  4KHS A;  3NFA A;  1JLB A;  4LY7 A;  4CEZ A;  4KTW A;  3SQ4 A;  2PY5 A;  4HCB A;  4Y1D A;  1DTQ A;  4OGC A;  5KGX A;  4DQR A;  4J2A A;  4IG0 A;  4O0J A;  4PQU A;  1VSJ A;  2P51 A;  3CM5 A;  2IOC A;  3AVN A;  3HK2 A;  3NF6 A;  1YTA A;  3EZ5 A;  4FM1 A;  3B6O A;  4CJE A;  4B9V A;  4O55 A;  1XHZ A;  1IH7 A;  2E6L A;  3VQ8 A;  3NH1 A;  4FJ5 A;  4FK2 A;  1Q9X A;  3T1A A;  3KJV A;  3NBP A;  3LP0 A;  3K5L A;  4B9N A;  4CJT A;  3NH0 A;  1RDC A;  3FFI A;  1LAW A;  4RG8 A;  4BWJ A;  5HRS A;  1U04 A;  3QEI A;  3RMB A;  1NJW A;  4B8C A;  1K6Y A;  3NHG A;  1QSY A;  1QSS A;  4DSI A;  1U48 A;  1SL1 A;  1Q9Y A;  2W42 A;  2QK9 A;  5J2N A;  3HPH A;  3AVA A;  4CJU A;  4OJR A;  4Y1C A;  4N5S A;  1BQM A;  4CHQ A;  4B08 A;  2XHB A;  1UA1 A;  1BCM A;  1D5A A;  3QIN A;  3WNE A;  3V6D A;  1KVA A;  2X6N A;  4IDK A;  4FM0 A;  4DFJ A;  4FXD A;  3NCI A;  3SUP A;  3K5M A;  1HQE A;  3SZ2 A;  5HRO A;  1GOB A;  3HJF A;  3NGI A;  3P1G A;  4CHO A;  4OKK A;  3LAN A;  4Z4C A;  4GMJ B;  3PX6 A;  1SL2 A;  4YFU A;  4KHQ A;  4DFK A;  3VA0 A;  1TKD A;  4M3Z A;  2YNI A;  4N47 A;  5J2P A;  2KTQ A;  1ASV A;  1RCH A;  1RT3 A;  1S1T A;  3RR8 A;  3T19 A;  2HW3 A;  2Y1I A;  4DTO A;  3OYL A;  1HJR A;  2O4I A;  3QIP A;  3WNH A;  4CHY A;  2KQ2 A;  1X9W A;  2OZM A;  1TV6 A;  4DU1 A;  4CJL A;  4DFP A;  4FCY A;  1TL1 A;  2OPS A;  4E89 A;  3NGZ A;  2OYQ A;  2ZQB A;  4N56 A;  4Z4G A;  3M8R A;  1RDB A;  4DFM A;  2HB5 A;  3LZI A;  4RW7 A;  2B6A A;  1RT2 A;  3QEX A;  1NKB A;  3BDP A;  4M3Y A;  4DTN A;  4CE9 A;  4FK0 A;  1YTU A;  5I3U A;  4L8R B;  2WOM A;  3DLH A;  2JGU A;  3DLK A;  3ZSX A;  3G10 A;  3SQ2 A;  1Z25 A;  3AO5 A;  2FBV A;  4J2E A;  2BDP A;  3ZT0 A;  1SKS A;  1L3T A;  2VWK A;  2OPP A;  1MU2 A;  3MEE A;  5FRN A;  4CK2 A;  1VRU A;  1NK0 A;  1A5X A;  3SPZ A;  4C8N A;  1KRP A;  3ZT1 A;  5SZT A;  3SV3 A;  3PX4 A;  3O4N A;  3UIQ A;  2GBZ A;  1I3A A;  4CEC A;  3VA3 A;  2HHW A;  4CGG A;  4W5O A;  3ZSR A;  1VSL A;  3VQB A;  1ZBI A;  4OPJ A;  4AHR A;  2IC3 A;  4KI4 A;  3ZSO A;  2OPR A;  1UA0 A;  3ZSW A;  4DSL A;  1VSD A;  4AIL C;  4I9Q A;  2FBT A;  1KTQ A;  2P5O A;  1CXU A;  4CJV A;  3AVC A;  3TAB A;  4DSK A;  3RWU A;  3V1O A;  1C1A A;  4DTR A;  1BHL A;  3U3G A;  5C24 A;  5HP1 A;  3M8S A;  3OYC A;  3SUN A;  3L8B A;  1XWL A;  1TGO A;  4CJW A;  3QNN A;  2BAN A;  3C94 A;  2KZZ A;  4EP5 A;  4DTS A;  3JYT A;  1T05 A;  3V1Q A;  3AA2 A;  5KRS A;  1HNV A;  2Q3S A;  1B92 A;  2YKN A;  3KKR A;  4LH4 A;  4RW4 A;  5CY4 A;  3ZSZ A;  1ZBL A;  4IKF A;  2O4G A;  4KI6 A;  1BI4 B;  2KFN A;  4PA1 A;  4ELT A;  1C0T A;  3KLF A;  3ZSV A;  4B8A B;  4F8R A;  2HNZ A;  4OKE A;  2PYL A;  4KTQ A;  1TK0 A;  4FLV A;  2Z1G A;  4C8M A;  4ID5 A;  4CK3 A;  1JLE A;  3EY1 A;  4FLY A;  3S3M A;  1S6P A;  1BIS A;  3CYM A;  3ZSY A;  4Z0U A;  3DMJ A;  2JLE A;  4JRP A;  3QEV A;  4RW9 A;  3AVM A;  2QKK A;  2GV9 A;  1KLN A;  4E19 A;  3ZT4 A;  1WSH A;  4OLB A;  3O3H A;  2Y1J A;  3LZJ A;  4B9M A;  4BE0 A;  2AJQ A;  4CF1 A;  2DFE A;  1TVR A;  3A2F A;  3V9S A;  1JLA A;  4PWD A;  4Z4F A;  3KK3 A;  3VN5 A;  3L2R A;  3EYZ A;  3T3F A;  3THV A;  4UQG A;  1JLQ A;  3MAQ A;  3V9U A;  1LV5 A;  4KHY A;  3I0R A;  2HHV A;  3DYA A;  5DK5 A;  3VQD A;  1C6V A;  3V1R A;  1BQN A;  2KFZ A;  1BGX T;  4M3R A;  5CZ2 A;  1BI4 A;  4CEB A;  4CJF A;  3OYG A;  4I7F A;  3OVN A;  2ATQ A;  4HUF A;  2QKB A;  1KCF A;  4K8X A;  3IRX A;  4CGF A;  3IG1 A;  4AHU A;  4C8O A;  1JL1 A;  4FVM A;  4I2P A;  1CXQ A;  4W5T A;  3DRP A;  3F9K A;  2IAJ A;  2VG5 A;  3DOK A;  4CF9 A;  1BL3 A;  1RBT A;  2RN2 A;  4R5P A;  3CFP A;  1VSM A;  4FJN A;  3MED A;  4DLG A;  4FJH A;  3OYI A;  1HRH A;  2IDO A;  2IS3 A;  3V9X A;  1VSE A;  2Z1J A;  1LAV A;  4J2D A;  5HRN A;  2BGG A;  1HMV A;  1T7P A;  4GW6 A;  3KTQ A;  2G8V A;  3HST B;  3QIO A;  4EZ9 A;  2Z1H A;  4CED A;  4FZY A;  4IBN A;  4M42 A;  3NF7 A;  2I5J A;  1YT3 A;  1RT7 A;  4NCG A;  3V4I A;  4KPY A;  1EX4 A;  2D0B A;  1A5V A;  3PX0 A;  3LPU A;  2HVH A;  3WNG A;  4CFC A;  1HYZ A;  3IAY A;  4Z4I A;  3AO2 A;  4DMN A;  4AH9 A;  3KK2 A;  4EZ6 A;  1QQC A;  1O1W A;  1VSK A;  4E0D A;  5J2M A;  2NUB A;  1ASU A;  1SV5 A;  1SL0 A;  5JS1 A;  2YHB A;  4WE1 A;  3QER A;  1SKR A;  2FBY A;  1QHT A;  3RR7 A;  3LPT A;  4Z4E A;  4E7H A;  1HYS A;  5HLF A;  2DFH A;  4CJR A;  4BE2 A;  3KLI A;  4FLT A;  3AVG A;  4FJX A;  3NAE A;  1XI1 A;  3QES A;  4CFA A;  3HYF A;  4IG3 A;  3RMA A;  2P5G A;  2IGI A;  4DQQ A;  4ZTF A;  4O0I A;  3NF8 A;  3AVJ A;  3HP9 A;  4CGI A;  3ULD A;  2OPQ A;  1ZBH A;  2DTU A;  4FJI A;  1YVU A;  2LSN A;  1WSF A;  3AVI A;  3ITH A;  4TSX A;  4DF4 A;  1BIZ A;  2G8F A;  4OVL A;  4CES A;  1RTJ A;  1WSI A;  3ISN C;  4RW6 A;  3SUQ A;  1BIU A;  2ZE2 A;  3IS9 A;  4KRE A;  2HVI A;  1J54 A;  1TKT A;  1EKE A;  1ASW A;  3CFR A;  1D9D A;  4NCA A;  1U45 A;  3S3N A;  3RRH A;  4HTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...