3ZSOA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsoA00
1HPZA 4RW8A 1I39A 3OS0A 4F8RA 3VQ7A 4E7JA 1HNIA 3QEVA 3NF8A 2HNYA 3MECA 1ASUA 4PWDA 4CJ5A 1TAUA 3KK3A 3OYLA 2YNFA 4F3OA 3AO5A 3DYAA 3PUFA 2YHAA 3NH2A 2D0AA 4IBNA 4CEAA 3TWHA 2Y1IA 4F3TA 3QETA 2LSNA 1VSEA 3C94A 3P1GA 3OY9A 3OYMA 1TK5A 1KSPA 1C1AA 1KVCA 4RW7A 3VQ4A 3E01A 4FVMA 1JLCA 3PY8A 3K5NA 3SPYA 1RDCA 4FJHA 5FRMA 4H4OA 3HYFA 1S1XA 3PX6A 3LAMA 4EP5A 3SUPA 1SKRA 1K6YA 3LPUA 4BDYA 5T7BA 4DQQA 1FK9A 3NFAA 1B9FA 3TAMA 4FJMA 1UWBA 3L3UA 3D0PA 4OGEA 3F9KA 1C0MA 3T19A 4KFBA 4CJ3A 3AVBA 4DLGA 1MU2A 5SWMA 2VWKA 2KQ2A 3NH1A 4CGIA 5J2PA 1KLNA 2PYLA 3HVRA 1RT4A 3WNEA 4DU4A 1QE1A 4DWIA 2F8SA 1XHZA 4KPYA 2IGIA 3PX0A 3DLEA 1D9FA 4B9VA 4C8LA 5HRSA 3MXIA 3OYFA 3DLBA 4ID5A 4OJRA 3MEEA 2AJQA 1VSKA 3VQ6A 4J2EA 4CK3A 1RBSA 3KTQA 1C6VA 3NE6A 4KHQA 4CFDA 4DTOA 4DF8A 3V9ZA 4AHRA 4B9NA 1ZBIA 4KREA 1KFDA 2ZQBA 3SUQA 3ZSQA 4H8KA 2I5JA 1DLOA 1S9GA 4EZ9A 4O0JA 2BGGA 3QEXA 3HSTB 1EKEA 3AVCA 3KJVA 4E7KA 3ZT0A 1T03A 3OYBA 5J2MA 1A5VA 3CG7A 3P5JA 2YV0X 5J2NA 4NCBA 1S1WA 2VWJA 4F2RA 5D3GA 2HHSA 1HRHA 4R5PA 1Z26A 1JXEA 5HRPA 4CF1A 3KKRA 4BACA 4W5NA 1B9DA 5EU7A 3OYCA 3V4IA 3U3YA 4JRPA 1TK0A 4EP4A 4ELUA 3ZSXA 4FJ8A 4CEQA 1EXQA 4DTUA 3K57A 3QIOA 4N56A 2IAJA 2RF2A 3KLGA 1VK0A 1TAQA 4GMJB 4CEZA 3KKSA 3H08A 4CJKA 1TVRA 3AO1A 1X9MA 1RNHA 2X6SA 4JS5A 4E7LA 4C8KA 1JLAA 4DFJA 3QERA 4E19A 3PX4A 3I8DA 4KAZA 4CIEA 3SCXA 1IKXA 3ZT2A 2RN2A 3DRRA 4CJRA 3G10A 1RTJA 3CFPA 3SNNA 2HW3A 4FW2A 3RR7A 2FBVA 3O3FA 3DM2A 4CHPA 2QKBA 3NGYA 4F4KA 4B3OA 3SUOA 2OPPA 5K14A 4KB0A 4B9SA 3NGZA 2D0BA 1CZBA 3C6UA 1WSJA 5FDLA 3KK2A 3RMAA 2OA8A 4HCCA 3AVHA 1QQCA 1ZBFA 2HHXA 1SL0A 1DTQA 3OVNA 3CFOA 4CEBA 3CM5A 3L8BA 2JGUA 4CJEA 3OYEA 4CHQA 4OKJA 3VQQA 3M8SA 2EHGA 4IFVA 2HB5A 3SUNA 2G8HA 3LPTA 5HRRA 2IDOA 1C0TA 1IKVA 2HNDA 5KTQA 4OLBA 2WONA 4XIUA 1A5XA 1S1TA 4M41A 3OYDA 4B9MA 1QTMA 4AHSA 1S1UA 3LANA 2KFNA 1B92A 1WAJA 4LSLA 1TK8A 4OVLA 1VRUA 2O4GA 4IDKA 2Y1JA 3K58A 3AVFA 4FK0A 3WNHA 4OGCA 3L2QA 3HPHA 3L2RA 3NDKA 4OPKA 3TARA 4ZTJA 1NK7A 4KTQA 2KW4A 3DOKA 1HYZA 3S3NA 1T05A 3LP2A 1KTQA 3HPOA 3WNFA 3VQ8A 2D5RA 4RW6A 1NJYA 4BWMA 4FLTA 1FKOA 1NK9A 1BCMA 1RDBA 5CYQA 1RT7A 3OYNA 3AO2A 5DK5A 2A1RA 3DLHA 3ISNC 3QLHA 3QNNA 2IC3A 4CHZA 1SKWA 3L2UA 1U47A 3QESA 4CGDA 4H4MA 3TAGA 2ETJA 4FJJA 4KI6A 3JSMA 1S9EA 3LZIA 3G0ZA 1J9AA 4DTMA 3TAPA 4M3TA 4GVMA 3SQ1A 4FZXC 1BGXT 4Y1DA 5JS1A 4FLWA 4FJIA 4CF0A 4I7FA 3SV4A 4CECA 1JLEA 3DLRA 5DMRA 1CZ9A 1WSEA 3TAFA 3MXMA 4KHSA 1LWEA 1WLJA 4DU3A 2F8TA 1ASWA 4Z4HA 4FJGA 4CIGA 4DQRA 3KLFA 4FJ5A 1RILA 1TKDA 2G8VA 3HJFA 2HHVA 4W5RA 3ZSZA 3O4QA 3S3OA 1XC9A 2A1SA 1ASVA 2ITGA 3NGIA 3LWLA 1LV5A 1REVA 4FJ9A 3RMCA 2YNHA 1LAWA 1KFSA 4ICLA 3SZ2A 1JXBA 3AA4A 3NH0A 5I3UA 3V1QA 4Z4FA 1ITGA 1W0HA 4DFMA 1RDAA 1RCHA 4ZHRA 2E4LA 4DTJA 4C8NA 3HVTA 4FJLA 4J2BA 2XRIA 5CYMA 5KGXA 1GOCA 1ZBLA 2PY5A 1BIZA 5KRTA 3S9HA 3LP3A 4CJQA 4FJNA 3PO5A 4DF4A 3V9UA 4IKFA 1SKSA 2G8UA 4PY5A 3QIPA 1LW0A 4KI4A 1YT3A 4KB1A 1RT5A 1LWCA 2GUIA 3P83D 3CM6A 4CJFA 1CXUA 3DRPA 3HO1A 3BDPA 3JYTA 2XHBA 1CLQA 3ZT4A 3K5MA 1C0UA 3ALYA 1WSHA 1RBRA 2KZZA 1RT6A 4CF2A 1RTIA 1VSMA 5I42A 3I0RA 4FM0A 2OYQA 3TAQA 4FZZA 2Z1GA 1X1PA 3TAEA 4M3UA 1UA0A 4BE0A 4DS5A 1RTHA 3OJSA 3LALA 1KCFA 4Q5VA 3KLHA 4F2SA 3AVIA 1Y97A 3F73A 1JLBA 3RWUA 1LWFA 4DSEA 2OZMA 4FLZA 5C24A 4N76A 2D0CA 1C1CA 1JLQA 3M8QA 4I2PA 4I9LA 3V1RA 3O3GA 2XO7A 3TI0A 4FLXA 2E6MA 3EY1A 3IAYA 3QO9A 4E1NA 4PA1A 4E89A 3RR8A 1SL1A 3C6TA 1TL1A 1WSFA 4QAGA 3AVGA 4RW9A 4W5TA 4HUEA 4O55A 1IKYA 1XWLA 4B08A 4CJSA 1BHLA 1TKTA 4CESA 1U4BA 3C95A 4N47A 3LDSA 3TABA 2FBTA 4DQPA 3BGRA 4DG1A 4E7IA 2YKMA 4CEOA 3L2WA 4QCLA 1RDDA 1NK6A 1J54A 1U04A 1JKHA 5JS2A 4DSKA 1U45A 3VQ9A 4HUGA 1RBVA 3IRXA 4PUOA 3K5LA 1ZBUA 3SPZA 4AHTA 3MEGA 1JLFA 2HMIA 2DFFA 2FC0A 4AH9A 4E3SA 4O44A 1TL3A 2IS3A 1EP4A 2Q3SA 3NAEA 3RRHA 4FJKA 5HBMA 2X74A 3AVKA 3KK1A 5C25A 3OYGA 1IKWA 2HHUA 1HQUA 4FW1A 3QEPA 4AHVA 2B6AA 3MXJA 3ZCMA 4KRFA 5CY4A 1S5JA 2ZD1A 4DFKA 1NJZA 1RBUA 3V9XA 1L3VA 4K8XA 3U3GA 3OYIA 1VSLA 4KO0A 4HHTA 4KHUA 3AVMA 1G15A 3DMJA 3V9SA 1D9DA 3SYZA 4ELVA 4O5BA 4M3ZA 3ZSRA 1J5OA 3M8RA 4WE1A 1SL2A 4CJLA 3VQPA 3K5OA 1DTTA 2RPIA 4RG8A 1BI4B 2XY5A 2Z1JA 4CGGA 4B9TA 1NK8A 2X78A 4CJUA 2F96A 2P1JA 5J2QA 4FLYA 1N6QA 2BDPA 2OZSA 1N5YA 4M3XA 1S6QA 3QNOA 3FFIA 4OLAA 1WAFA 1FKPA 4DQSA 4JS4A 4BDPA 3LZJA 3VQ5A 4DQIA 2KTQA 1YTUA 1A5WA 4GW6A 4FM1A 4Z4GA 4CF8A 3DLGA 4CGHA 1XHXA 3HP9A 4DLEA 1J53A 1LW2A 3VQCA 2PZSA 4B9UA 1BL3A 1EX4A 4OKKA 3V81A 3OYAA 4FJ7A 3L3VA 3LAKA 2Z1HA 2FBYA 4NYFA 4M3RA 1WN7A 4N5SA 4N41A 2B5JA 4KTZA 3D45A 3ZSOA 2OPQA 5J1EA 4FZYA 4DTSA 4W5OA 4Z4IA 1UOCA 4I9QA 3HXMA 4ZTFA 1R0AA 4ID1A 1QHTA 3SQ2A 3AA5X 3ZT1A 3PV8A 3THVA 2X6NA 4CK1A 4CHNA 1X9SA 3L2VA 5CZ1A 1GOBA 2FBXA 5HRNA 4M45A 3NHGA 1KLMA 1NK0A 3VQEA 5HLFA 4CHYA 1XI1A 4NCGA 1HYSA 2YNGA 1D8YA 4E1MA 4UQGA 1IO2A 4W5QA 1QS4A 2B4JA 4YFUA 1SUQA 2ATQA 2HVHA 3AA3A 3VA0A 2P5GA 3B6PA 4K8ZA 1VSHA 3AVJA 1WNSA 4Y1CA 1QSYA 2G8WA 4M3WA 1JL1A 3OJUA 4CGJA 3K59A 3EYZA 2XY7A 1NKCA 3RMDA 4DSIA 3DOLA 1RT3A 4JLHA 4DTRA 4DTNA 4J2DA 4CIFA 4E7HA 2HHTA 3T1AA 4O0IA 4AILC 3I0SA 3QINA 4LD0A 1VSJA 4B8AB 4KHYA 3CFRA 4KHNA 1HQEA 4L8RB 1RT2A 2GV9A 3LP0A 5SZTA 4FLUA 1BCOA 1HYVA 3MAQA 3CYMA 3VN5A 4CJVA 2DFHA 3V9WA 3T3FA 4J2AA 1D5AA 2G8FA 1LAVA 5CZ2A 4IFYA 3OS1A 4FCYA 1CXQA 4DFPA 1TGOA 4Z4EA 4CERA 1U48A 1NJWA 4CEFA 1NOZA 1C1BA 3O4NA 3HL8A 3KLEA 3OYKA 5HP1A 2HVIA 3UIQA 3SI6A 1BQNA 1YVUA 1TV6A 4CFCA 3NF9A 4OPJA 3SQ4A 1UA1A 4TSXA 2KFZA 3LWMA 4RW4A 4QOZB 1IG9A 2NUBA 3NCIA 2HHWA 1RTDA 1T7PA 3VA3A 3V6DA 1NOYA 3IS9A 1Z25A 3SV3A 3HM9A 3SQ0A 3ULDA 4CJWA 2DFEA 3AA2A 2Z1IA 4KKOA 3A2FA 4CEEA 4HUFA 4CJTA 4FK4A 2HNZA 3VQBA 1BI4A 1BQMA 1FXXA 1TKXA 3AO3A 4YNQA 3RTVA 4FK2A 4CGFA 4BE2A 4DTPA 4Z0UA 4MFBA 4ELTA 3SJJA 3TANA 1KRPA 1W9HA 3ITHA 4CCHA 5KI6A 2W42A 1NK5A 1VSIA 3O3HA 4DS4A 4NYNA 4CFAA 2YKNA 1NKBA 4E0DA 1ZBHA 1VSDA 3AO4A 4CFBA 1HMVA 3NF6A 2E6LA 3AVAA 4IG0A 1Q9XA 1TKZA 1F21A 1S1VA 4O4GA 4CHOA 3IG1A 3RRGA 4LSNA 1VRTA 4C8MA 2VG7A 3AVLA 1NJXA 2YHBA 2DY4A 2ZE2A 1QSLA 3KD1E 5KRSA 3OS2A 1Q8IA 4HVJA 2P5OA 4AHUA 2XY6A 1QSSA 4BDZA 3MEDA 4PQUA 5FRNA 3HP6A 1EETA 4B9LA 5KGWA 4LH4A 1WSGA 1JLGA 4KHWA 3AV9A 4MQ3A 2RKIA 3DLKA 3U6FA 4M42A 4LY7A 2OPRA 3ZSWA 1U49A 3LP1A 1L5UA 2EX3A 2GBZA 3VQDA 4DU1A 2OPSA 3AVNA 2XY8A 1L3SA 4FYDA 3NF7A 2G8KA 2VG5A 2O4IA 1JL2A 4IG3A 3DRSA 3V1OA 2QXFA 1S6PA 3ZSYA 4DTXA 2G8IA 4OKEA 4B8CA 2R7YA 1BIUA 2JLEA 1GOAA 1L3UA 1SV5A 4Z4CA 4I2QA 3TR8A 3EZ5A 1KVAA 3DI6A 2KZMA 3K2PA 4EZ6A 1Q9YA 4KV8A 3KLIA 1BISA 3M8PA 1YTAA 4CEDA 4FM2A 4Q0BA 4G1QA 2WOMA 2QK9A 2HHQA 4FLVA 4CJPA 4JRQA 1RBTA 4CJ4A 4M3YA 1T8EA 3OYHA 4BE1A 2P51A 4HTUA 4FXDA 2PYJA 3ZT3A 3WNGA 3HT3A 3CQ8A 1L3TA 1HNVA 1I3AA 2YNIA 3ZSVA 3PO4A 2DTUA 3B6OA 1NKEA 1IH7A 5E41A 3KIOA 1WSIA 3KD5E 5C42A 1HJRA 4AHCA 3S3MA 4DSLA 3HPGA 3QEWA 3HK2A 2IOCA 4KTWA 3VQAA 4C8OA 4CE9A 1O1WA 2VG6A 4CF9A 3QEIA 3OYJA 5FROA 1X9WA 2BANA 4DSJA 1RT1A 1NK4A 4HCBA 1UAXA 4CK2A 1KVBA 2BE2A 4LH5A 5HROA 4NCAA 3ASMA 3RMBA 1ZYQA 4BWJA 4FJXA 2QKKA 4DSFA 4DMNA 3NBPA 1VSFA
chains in the Genus database with same CATH superfamily
4RW8A 4JKFA 1I39A 4F8RA 2CH6A 5GAEP 3QEVA 3MECA 1ASUA 1NG9A 2QA4N 3VGKA 3KK3A 1BDGA 3AO5A 3PUFA 3QFUA 3NH2A 2Y1IA 4CEAA 3C6HA 3P1GA 1TK5A 4O8UA 1EO1A 3VQ4A 3MN6A 3E01A 3PY8A 3VEVA 3MMVA 3C0BA 3HYFA 2I7NA 3SUPA 5JMVA 5T7BA 1FK9A 5MLCQ 4M7XA 3L3UA 2KKZA 4KFBA 3MK6A 2VWKA 3THWB 4CGIA 1Q81O 5M1QA 5AZJB 1BA0A 1OH6A 1QE1A 3CQXA 2VGMA 5HRSA 1WBDA 3MEEA 3O6WA 3L6QA 5F0XA 1RBSA 4LF8K 3NE6A 3SK3A 4CFDA 3S41A 1NGCA 3B8AX 2Q0RA 4NXMK 3SUQA 3ZSQA 4H8KA 4BRKA 1DLOA 2P9NA 4BGBA 4EZ9A 4LF7K 3KJVA 2Q31A 1A5VA 1JCEA 5J2NA 5D3GA 3HM8A 3E1YA 1Z26A 3H3OB 3R8EA 5EU7A 4JI4K 3U3YA 1TK0A 3LDQA 3CC2N 2NRZA 2RF2A 4JK8A 4BR9A 3KKSA 4CJKA 4JS5A 4E7LA 4C8KA 5ADXH 4E19A 3PX4A 3SCXA 3DLLL 2PFUA 3G10A 3CIPA 2Q36A 3CCLN 2A41A 4H0XB 1OKJA 4JI2K 1FW6A 1E4GT 4F4KA 3QDKA 4B3OA 5K14A 3NGZA 3QB0A 3Q7CA 2UUBK 1ZBFA 2HHXA 1OVQA 5C10A 3THYB 1QHAA 4B3RK 4H0OA 4C23A 2EHGA 2QXLA 1VQPN 2HSTA 4PKHA 2IDOA 2HNDA 1IKVA 1MDUB 4CZGA 1GLCG 1QTMA 3VMFB 3LANA 3O9SA 1WAJA 1TK8A 2Y1JA 5JVGL 3THWA 3TARA 3DOKA 3K0SA 3HPOA 4BREA 4BRDA 2E1ZA 1NJYA 4FLTA 1GLJO 3OYNA 3VPZA 5DK5A 2ITMA 3ISNC 4EAHD 5M1OA 3QNNA 4M63C 1DKGD 4H4MA 3TAGA 1Q86O 2FSKA 3JSMA 4KI6A 1S9EA 2FSJA 2AA4A 4FO0A 2YJFA 5BPNA 3CERA 2Q2RA 2NZTA 5AQRA 4OX9K 3J7YP 4FZXC 4KBOA 2D1KA 3KHYA 2ZJRL 4FLWA 1ATSA 3SV4A 4JK7A 3DLRA 1BUPA 1HKCA 1H1VA 4KHSA 1K9MO 2WUSA 2GTDA 2P9PB 3AAPA 5BRFA 5AQHA 1DT9A 3VEYA 4OO1J 5GIPA 2ZJQL 3AA4A 3SZ2A 1W7AA 4Z4FA 1HUXA 1YVNA 3O9RA 1T6DA 3NVMA 4DTJA 3HVTA 2PY5A 1GOCA 2E88A 1ZBLA 1BIZA 3THYA 5AQOA 3PO5A 1HKGA 1YT3A 3D2FB 3SJHA 3DRPA 5JLHA 3BDPA 1CLQA 2KZZA 3ALYA 2IIRA 3LDPA 3I8BA 2OYQA 4FZZA 4B3MK 1KCFA 4JEPA 1JCFA 2QKBA 2D0CA 3QO9A 1YIJN 4PA1A 2NRVA 1SL1A 4QAGA 4EFHA 4HUEA 1XWLA 4CD1A 4CJSA 1GLEG 4H5RA 4CESA 4A61A 4N47A 3TABA 2FBTA 1GLFO 3UB5A 4DG1A 2YKMA 4IXCA 5JS2A 3QBWA 3FZLA 4DR1K 3G71N 2HBMA 2YHWA 4G9ZA 3K9JA 4O44A 1TL3A 2IS3A 1EP4A 4BRLA 3RRHA 5BN8A 4FJKA 1VQ6N 5C25A 3OYGA 1IKWA 4RWTA 3CCVN 4EHTA 1S5JA 2ZM6K 4EIAA 2P9SB 2P9PA 4KO0A 4HHTA 3C7NB 1G15A 3V9SA 4WQ5A 2HBKA 3M8RA 3LM9A 3VQPA 2XY5A 3CJBA 4FL9A 4OLAA 4A62A 4DQSA 3CI5A 4BRHA 5AQKA 5E26A 4DQIA 4GW6A 4FM1A 4B9UA 4DLEA 3GOIA 3VQCA 1EX4A 3L3VA 1ZBIA 4N41A 2FBYA 1NLVA 3D2FA 4Z4IA 1V4SA 3ZX2A 3PV8A 1NGIA 3THVA 4CK1A 3L2VA 2A6AA 5HRNA 3NHGA 1KLMA 5HLFA 5CE3A 4WYBA 4NCGA 4KH5A 1HYSA 4JNEA 1D8YA 3PSFA 2A42A 4W5QA 2E2PA 4YFUA 1SUQA 2HVHA 3AA3A 2P5GA 4K8ZA 3VENA 4Y1CA 3AVJA 3MCAB 1QSYA 2G8WA 4M3WA 3OBWA 3O9UA 1YJNN 4QS9A 4B9QA 4DV4K 2V7ZA 3RMDA 1RT3A 4GV3A 4MO4A 4DV6K 3T1AA 4O0IA 4AILC 3I0SA 3QINA 4LD0A 4DR3K 1VSJA 4B8AB 3VEXA 3CFRA 5M1PA 4L8RB 3CYMA 3VN5A 4QS8A 4MLEA 4J2AA 5CZ2A 4IFYA 4JK9A 2HF4A 3U8XA 3OS1A 4FCYA 1NJWA 1C1BA 4IDHA 2PBDA 4NLCA 3SI6A 4OPJA 3AGRA 5AFUH 1UA1A 4TSXA 4RW4A 1GLLO 3ZX3A 2NUBA 3JS6A 1T7PA 2OTLN 1DGKN 4DV2K 3C7NA 1Z25A 5KPZA 3SQ0A 3LM2A 5C15A 3AA2A 2Z1IA 4KKOA 4CEEA 2HNZA 2JWKA 2E2QA 2BH1A 3HI0A 3P4IA 4CGFA 1SZ2A 1NGBA 3AO4A 3A5NC 3NF6A 2E6LA 5CHIA 4IWVA 2P9IB 4H0VB 4DV3K 1J5EK 3IG1A 4LSNA 1VRTA 4C8MA 1NJXA 1N36K 1QVGM 4JI7K 3C6AA 3OS2A 2NRXA 1QSSA 2XY6A 4BDZA 3E9PA 4LH4A 4B1YB 2RKIA 3ZSWA 2OPRA 2EX3A 2GBZA 3VQDA 1VQ4N 4DV5K 3WQTA 2G8KA 2O4IA 3V1OA 4IG3A 1YXQA 1SV5A 5ELZA 3DI6A 4IO9L 3ULEB 2ASOA 1BISA 3PIPL 1YTAA 3ENHA 4Q0BA 3J80O 4JRQA 3RSEB 1WOQA 3M3ZA 1BOTO 3OYHA 1YITN 4K25A 3OTOK 1L3TA 2DTUA 3PO4A 1IH7A 5E41A 2HF3A 4DSLA 1VHXA 2IOCA 4CE9A 1O1WA 5B8HA 4BVPA 1NK4A 4IJNA 1KAZA 1KVBA 5HROA 5EX5A 1ZYQA 2FF6A 4JKGB 3NBPA 1VSFA 5AQNA 1N8RO 5IT9O 3G6EN 2D0OA 4H0PA 1HNIA 4CJ5A 2O8CA 3OYLA 3CPEA 3DYAA 4HTLA 1U6ZA 2D0AA 3MN5A 4BC5A 3C94A 1BG3A 5GINA 3JAMO 3EKSA 1C1AA 1Z6RA 4PKGA 5GADP 2P9IA 1VQMN 4FVMA 3DXMB 2F7TA 3U4LA 5FRMA 4H4OA 3PX6A 3LAMA 3LPUA 1C0FA 1UWBA 1VQ5N 2KQ2A 2QWRA 5J2PA 3HVRA 3TTCA 1XHZA 4KPYA 5LY3A 1NMDA 4FWLA 3PX0A 3MXIA 3DLBA 5KQDA 4J2EA 3MX5A 3KTQA 4BG9A 4ISEA 4JN4A 3J7AP 2I5JA 3SMSA 3UE5A 5AQWA 3FLCO 2OCEA 2HHHK 1EKEA 4E7KA 3P5JA 1BO5O 1S1WA 2HHSA 4BRAA 3CETA 3KKRA 2F9TA 1B9DA 3OYCA 2Q97A 3V4IA 4FJ8A 5C2FA 2W6KA 3K57A 3QIOA 3RVCA 4XH5A 2IVPA 2PAVA 3H08A 2WTUA 1RNHA 4LFCK 4NO7A 1IKXA 3EKUA 4DV1K 2QWNA 4CJRA 3SAGA 3CFPA 4IOCL 3SNNA 4JKGA 3DM2A 4CHPA 3CCRN 3NGYA 5HL7L 2OPPA 4DR4K 4KB0A 1CZBA 4KH4A 5FDLA 1NU0A 3KK2A 1N33K 1QQCA 4DV7K 4CZMA 4JKBA 3OVNA 1OH8A 3OYEA 3DXMA 3ID8A 4CHQA 4OKJA 1OH7A 4IFVA 2G8HA 5HRRA 1C0TA 3OHRA 5KTQA 4OLBA 2WONA 5LL6Z 4B9MA 1S1UA 1B92A 4LSLA 1VRUA 2E20A 5EVZA 1ILYA 3L2QA 3NDKA 4OPKA 1NK7A 3ZEUB 2NRHA 1KTQA 4CZEA 3WNFA 4RW6A 5AQIA 1NK9A 1G99A 3DLHA 1RDBA 2E8AA 1KQSM 1QQNA 2P9UB 2IC3A 4CHZA 4BC3A 2NRWA 5TKYA 1YJWN 4H5TA 1HNWK 4FWPA 1IBKK 1S3XA 1ZBSA 3SQ1A 1BGXT 3F5TA 1GLDG 2F4VK 4I7FA 2IVNA 2QTDA 2UXBK 2ASPA 4LF9K 1LWEA 1ASWA 4Z4HA 2VGNA 1YJ9N 4NB4A 1RILA 3VETA 2G8VA 5ADXA 2HHVA 1Q7YO 4W5RA 2VQEK 3ZSZA 3O4QA 3S3OA 1XC9A 2A1SA 2ITGA 3ZX0A 3NGIA 4M7YA 1IJJA 1KFSA 3NH0A 3L4IA 1ITGA 4DFMA 3J7ZO 1U2VB 5LJWA 1RCHA 4JV5K 2E4LA 4C8NA 5KGXA 5I9EB 3LDLA 4FOIA 4QS7A 4UY8O 2UXCK 4FJNA 4PY5A 1SKSA 3QIPA 1RT5A 1LWCA 3CM6A 1MWMA 3JYTA 3ZT4A 1RBRA 4A5AA 5A2QO 1RTIA 3I0RA 4M3UA 4DS5A 1RTHA 3OJSA 2QM1A 4Q5VA 1YHQN 3F73A 4CD3A 1JLBA 2ASMA 4DSEA 2OZMA 4N76A 4K42A 4I2PA 3M8QA 3TI0A 3UKUA 2YHXA 3ZEUA 4E89A 4BRPA 3RR8A 1TL1A 3AVGA 5TKWA 4RW9A 3KZBA 1IKYA 2QI2A 3NMUA 4B1VA 2CGKA 5AQYA 4BG8A 5AQVA 1TKTA 2P9UA 3LDSA 3E9OA 1RDDA 1J54A 1JKHA 1NWKA 4PUOA 3K5LA 1HLUA 4FPAA 2FC0A 4E3SA 3H6EA 1T44A 2P9KB 5HBMA 3AVKA 3VESA 3A0IX 5C0YA 1HQUA 1SQKA 1NJZA 2ZD1A 3U9DA 4DFKA 1RBUA 3FGUA 3V9XA 3OA9A 1VSLA 3DMJA 4O5BA 3ZSRA 4CW7B 1J5OA 4CJLA 4B9TA 4RG8A 3TSQA 1M90O 5AZJA 3CCSN 4DB3A 2BDPA 5J2QA 4NXNK 4M3XA 1S6QA 4ISGA 1U2VA 4BDPA 4MDBA 3LZJA 4FVUA 4MDAA 1CZAN 1GLBG 3SBGA 2PZSA 1BL3A 2I7PA 4OKKA 4H03B 4XH4A 4FJ7A 4NYFA 3LAKA 2Z1HA 4M3RA 1WN7A 2B5JA 3VF6A 3ZSOA 4FWMA 1KD1O 5J1EA 4W5OA 1JCGA 4DCHA 2RHKA 2X6NA 1EWQA 4M45A 4JI6K 1NGAA 1XI1A 4A57A 4UQGA 4DR5K 1QQOA 3VA0A 3B6PA 4XH1A 1VSHA 3UKRB 4IJAA 3OJUA 4WCEL 1M1KO 3LDOA 3FZMA 4DSIA 3HTVA 3DOLA 4DTNA 2V7YA 5EXWA 4LFAK 4KHNA 4IFEA 5SZTA 1BCOA 1HYVA 5LMUK 3ENBA 3E66A 1NGFA 1MA9B 4GNIA 1U48A 1QZ6A 1NOZA 4ILGB 2P9KA 3IDHA 3TPQA 4PL7A 2UU9K 5HP1A 4B1ZA 1BQNA 1P8ZA 1K73O 1TV6A 4CFCA 1GLAG 3EE9A 1YAGA 4DQ8A 3NCIA 2HHWA 1RTDA 3AAQA 3CJAA 3HOSA 5LJVA 1KXPA 4LF5K 2DFEA 3VQBA 1TKXA 1BQMA 1FXXA 4CBUA 4YNQA 4BE2A 3VGLA 4DR2K 1W2BM 4ELTA 5KPRA 4BRCA 1W9HA 5IWAK 1NK5A 3O3HA 2YKNA 4E0DA 1ZBHA 5E84A 4C1NK 4ISFA 3AVAA 4IG0A 1Q9XA 1F21A 1S1VA 3PIOL 1FJGK 2VG7A 3AVLA 2YHBA 1QSLA 3KD1E 1Q8IA 4JKCA 1ATRA 2P5OA 4JI3K 3MEDA 5KGWA 5F1XA 5LMNK 1Q18A 3VTHA 4M42A 4JKAA 3N4PA 3M6GA 4BQLA 4DTXA 3UKRA 2G8IA 3FFKB 4OKEA 4B8CA 2JLEA 1GOAA 1L3UA 4I2QA 3TR8A 1KVAA 5FLXO 5F2RA 3BY5A 4KV8A 3M8PA 1RGIA 2QK9A 4BROA 3EN9A 2HHQA 3OBYA 1RDWX 1RBTA 5AQGA 4M3YA 2P51A 4BR4A 4FXDA 3ZT3A 3WNGA 1I3AA 3WXIA 3M5RA 2OTJN 3T69A 3SAFA 5C42A 3KD5E 4ILHA 3S3MA 4AM6A 3MN9A 3HOTA 4C8OA 4CF9A 3KVGA 3VEOA 2W40A 4DSJA 1RT1A 5AQJA 4H0YB 4NCAA 3ASMA 3G25A 1OVYA 3O9QA 5BPLA 4E7JA 2HNYA 1VQ7N 4PWDA 3H3NO 1TAUA 3CCJN 3CCEN 5BN9A 2YNFA 1YUWA 2YHAA 1W97L 3TWHA 4F3TA 3OY9A 4FWQA 1KVCA 4RW7A 3DXKB 2GEMA 1RDCA 4FJHA 1YF5L 3FZHA 4Z94A 3QBXA 4LC9B 4EP5A 1SKRA 4BDYA 5AQQA 3TAMA 3VERA 4FJMA 3MWTA 2ZGZA 4OGEA 3F9KA 3D0PA 5AQLA 3T19A 4CJ3A 4DLGA 5SWMA 3NH1A 1RT4A 4DU4A 4DWIA 2F8SA 3CMEN 2IGIA 4C8LA 3OYFA 2P9SA 1VSKA 3PSIA 4FWOA 4CK3A 3ZETB 4KHQA 1HKBA 1NBWA 4LF4K 4DTOA 4DF8A 3BZKA 4AHRA 3CJCA 4B1UB 4BRFA 2ZQBA 2A5XA 1S9GA 1NGHA 3KWGA 2Q1NA 5AZIB 2BGGA 4EHUA 3HSTB 1SAZA 3EE8A 3OYBA 5J2MA 3CG7A 2YV0X 4F2RA 2VWJA 4I6MB 2YCHA 4R5PA 1JXEA 4W5NA 4BRNA 4CF1A 4BACA 5JICA 1T6CA 2O8DB 3D2EB 4JRPA 3T7ZA 4EP4A 3ZSXA 4CEQA 1EXQA 3N4QA 3VF4A 2WFBA 5FPMA 3KLGA 1VK0A 1TAQA 3WXLA 2JWLA 4GMJB 4CEZA 3AO1A 3BF1A 1X9MA 2X6SA 3CXCM 3R1XA 1BA1A 2A40A 4JKHA 5AR0A 3QERA 4CIEA 3ZT2A 2RN2A 4JKDA 1RTJA 2HW3A 5BR9A 3RR7A 4XEIA 4JYAK 3SUOA 3HZ6A 3CJ7A 2D0BA 3C6UA 4HCCA 2AP1A 3RMAA 3CC7N 3SLCA 3CFOA 3CM5A 3L8BA 2FSNA 2JGUA 5AQPA 4CJEA 3VQQA 3DXKA 4WF9L 3SUNA 2BTFA 4XIUA 1A5XA 4M41A 3OYDA 3W0LA 1HNZK 2KFNA 4B1XB 4OVLA 1KAXA 2O4GA 2KLAA 1VQ8N 3WNHA 4R79A 4OGCA 4YOXA 1TYQB 3GG4A 3TSPA 2KW4A 2E2NA 4DR7K 4BR5A 1T05A 5AQZA 3LP2A 3VQ8A 2D5RA 5GIOA 4BWMA 1BCMA 4JI8K 3ZETA 2VWBA 1SKWA 3PLAA 3L2UA 1U47A 3QESA 1QQMA 5AZIA 4FJJA 1E3MA 2NRTA 4DTMA 3G0ZA 1R59O 3TAPA 1NGDA 4X65K 1NMNA 1HX1A 2WC9A 4I6MA 1Y64A 1TUYA 4Y1DA 5JS1A 4CF0A 2VCPA 4ILJA 3D2EA 2O8DA 4CECA 1JLEA 4C1NI 1CZ9A 4X62K 1WLJA 3O1BA 4FJGA 4CZIA 4CIGA 4AM7A 4DQRA 2FLOA 1TKDA 4YORA 3F9MA 1ASVA 3LWLA 1LV5A 3RMCA 2YNHA 1LAWA 2HBJA 4ICLA 1JXBA 1W0HA 4DUZK 4ZHRA 5FPEA 4FJLA 3ULEA 3CJ9A 5KRTA 2ZF5O 1J6ZA 3LP3A 3S9HA 4CJQA 4DF4A 4KI4A 4CZJA 3SMPA 3DAWA 3RSEA 4JHDB 3CCMN 4IOAL 4E1JA 1ZXOA 2XHBA 3K5MA 1RDUA 1LOTB 3BEXA 1RT6A 4CF2A 1VSMA 1IBMK 3O9TA 2CH5A 2Z1GA 3TAEA 4WQ4A 2E1YA 1UA0A 4BE0A 4F2SA 3LALA 3KLHA 3AVIA 4K41A 1Y97A 1BWFO 1LWFA 1TYQA 4FLZA 2XO7A 1C1CA 1JLQA 4I9LA 4FLXA 3EY1A 2KHOA 4DKWA 4W5TA 2YI1A 3GL1A 3BF3A 4O55A 3CHWA 1KAYA 1BHLA 3A5MC 1U4BA 3BGRA 3L2WA 2HBLA 4QCLA 1NK6A 3ENOA 3ZYYX 3VQ9A 5GAGP 3WXMB 4H0TB 1I94K 3SPZA 1JLFA 2HMIA 2DFFA 2QWPA 5AQXA 2VYPA 4BR0A 2X74A 4X66K 3KK1A 2ZWHA 2HHUA 3L0QA 4BC2A 4BR2A 1NNEA 2B6AA 3MXJA 3ZCMA 4YOWA 4KRFA 5CY4A 1S22A 3U3GA 3OYIA 4FOEA 4KHUA 3AVMA 1D9DA 3VF2A 3SYZA 4M3ZA 5AJ3K 1SL2A 4CGGA 1NK8A 3TU5A 3VEZA 4CJUA 1N5YA 3O80A 4WFBL 1WAFA 1FKPA 3VQ5A 5C12A 1YTUA 1A5WA 3H1QA 4Z4GA 4YHHK 3L4QA 3HP9A 4B3TK 1J53A 1LW2A 3V81A 3OYAA 4GY2B 2GWJA 3EEQA 4N5SA 3I56N 4KTZA 3D45A 4JHDA 4DTSA 1UOCA 4I9QA 2IVOA 3HXMA 4ZTFA 4ID1A 3NVKA 3SQ2A 3AA5X 3ZT1A 1X9SA 5CZ1A 2FBXA 4YOTA 1X9JA 3K9KA 3VQEA 1NM1A 4CHYA 3ID6A 2O8BB 4FWRA 2YNGA 1D4XA 3P31A 1QS4A 5HOOA 4LFBK 1WNSA 4CGJA 3K59A 4BRMA 1WBBA 3EYZA 2XY7A 4CBXA 1NKCA 3I55N 3CCUN 4CIFA 2HHTA 1XMQK 4KHYA 1RT2A 2GV9A 3MAQA 1XMOK 1LAVA 3VEWA 4AQYK 1RFQA 1CXQA 4DFPA 3WXJA 4Z4EA 4K0KK 3O4NA 4CZLA 3HL8A 3KLEA 3EO3A 1YVUA 4PL8A 3NF9A 3SQ4A 1IV0A 1C0GA 3LWMA 4QOZB 1IG9A 3ATUA 4BC4A 3VA3A 1NOYA 2QWLA 2W41A 3ULDA 3A2FA 4HUFA 3RTVA 3AO3A 4YY3K 5AQMA 4HWIA 3I33A 1K8AO 4IO8A 2Q0UA 3TANA 3W3DA 4CZHA 5KI6A 2W42A 4WFNL 3VTIA 1VSIA 4DS4A 4JI1K 4NYNA 4CFAA 1NKBA 1VSDA 1NGJA 1HMVA 4H5WA 4JI0K 3GDQA 3FR0A 3RRGA 2DY4A 4IEIA 5KRSA 4YOVA 4AHUA 4CZFA 3O1WA 3HP6A 1EETA 3VGMA 4B9LA 5M1NA 1JLGA 3AV9A 4MQ3A 2CGJA 3EL2A 4JAXA 4LY7A 2O8BA 3LP1A 4YDUA 4DU1A 1L3SA 2OPSA 3NF7A 2VG5A 2FF3B 3A8YA 1JL2A 3DRSA 1S72N 4NLBA 3MDQA 1BIUA 3CQYA 4Z4CA 4BQZA 2KZMA 4EZ6A 4WQ4C 3KLIA 5AQUA 4FLVA 4V19S 4CJ4A 3WT0A 4BE1A 3P38A 2PYJA 1WUAA 3HT3A 3TSUA 1XUPO 1HNVA 2YNIA 3ZSVA 3B6OA 1NKEA 3KIOA 1WSIA 1HJRA 5BRDA 4PHTX 1NJIO 3HK2A 3EZWA 3QEIA 3OYJA 5FROA 1X9WA 4HCBA 1HJOA 1UAXA 4CK2A 4LH5A 3R3LA 3MWPA 3RMBA 4DHYA 4FJXA 2QKKA 4DSFA 3J81O 1HPZA 3OS0A 3VQ7A 2HMPA 3LDNA 5JVHL 3NF8A 4CZKA 4F3OA 4IBNA 4YOUA 3QETA 2LSNA 1VSEA 2NNWA 1KSPA 3OYMA 3CJ1A 2E5LK 3CCQN 1JLCA 5AQSA 3K5NA 3SPYA 1S1XA 5FPNA 1K6YA 3H45C 4DQQA 4MO5A 3NFAA 1B9FA 4DR6K 1C0MA 3AVBA 1MU2A 1TUUA 1KLNA 2PYLA 3WNEA 4CI6A 4B9VA 3DLEA 3H1VX 1D9FA 4BRQA 4ID5A 4OJRA 2AJQA 3VQ6A 1QZ5A 1C6VA 4BRIA 3SAHA 1YI2N 4GVEA 3V9ZA 4KREA 4B9NA 2YX6A 1KFDA 4IEEA 4FWNA 5FPDA 4U7BA 4O0JA 3QEXA 3WXKA 3AVCA 3ZT0A 1T03A 1N32K 3HBTA 1IBLK 4NCBA 1HRHA 3JXUA 5HRPA 3WQUA 1VQKN 1ATNA 2GUPA 4BRGA 5GAHP 4ELUA 2NRRA 4DTUA 3TTDA 2QW9A 2UYTA 3E9LA 4N56A 4JI5K 2IAJA 3BP8A 2QWMA 1TVRA 2NLXA 3O08A 1JLAA 2O8FB 4DFJA 3G4SN 2J4RA 3I8DA 4KAZA 1KC8O 3DRRA 3F2KA 3IMXA 4KH6A 4FW2A 2QWOA 4BGAA 2ZGYA 2FBVA 3A5OC 3O3FA 4GV6A 3FZFA 4B9SA 3MX2A 2VQFK 1WSJA 2OA8A 3AVHA 1SL0A 1DTQA 5KPTA 4CEBA 4B1WB 2P9LB 2V51B 4JKEA 4Y0WA 3M8SA 3M1FA 5CR4A 2HB5A 3LPTA 3D6RA 1S1TA 3AY9A 4DUYK 4AHSA 4IDKA 3K58A 3AVFA 4FK0A 3FE1A 3O4WA 5AFUA 1NGEA 3HPHA 3L2RA 4ZTJA 2OANA 1HYZA 3S3NA 3TTFA 4GV9A 3QFPA 2F8TA 1FKOA 5CYQA 1RT7A 2A1RA 3AO2A 1OH5A 3QLHA 3ZLJA 4YDUC 4CGDA 2ETJA 2O8EB 1O13A 2UUCK 2BUPA 3LZIA 4M3TA 1J9AA 4GVMA 5DM6L 4O5FA 3U9ZA 4RTFD 1Q82O 4FJIA 3CMAN 5DMRA 1WSEA 4FWKA 3CF5L 3TAFA 3MXMA 4DU3A 1Z05A 3KLFA 1K8KB 2WBNA 4J8FA 4FJ5A 4L3QA 2RE2A 1LCUA 3HJFA 2O8FA 3BUZB 1REVA 3T1HK 4FJ9A 1NGGA 5I3UA 3V1QA 1RDAA 3R6MA 4DV0K 3BZCA 4J2BA 2XRIA 5CYMA 2YJEA 1XC3A 4AF1A 1XNQK 4IKFA 3V9UA 2P9LA 2G8UA 4CJ7A 1LW0A 4KB1A 2GUIA 3MCPA 3P83D 4CJFA 1CXUA 3HO1A 2E2OA 2ZJPL 1C0UA 1WSHA 4FSVA 1BU6O 1X3NA 3FZKA 4O8KA 5I42A 3A5LC 1SS6A 4FM0A 3O8MA 3TAQA 2GELA 1X1PA 2D0PA 3RWUA 2D4WA 3IUCA 2DPNA 3HSCA 3ATVA 5C24A 2HOEA 3V1RA 3O3GA 3IAYA 2E6MA 4E1NA 2O8CB 3C6TA 1WSFA 5C2DA 3DWLA 3D7EO 1V4TA 4GKJK 3QICA 4B08A 1ZC6A 1N34K 3C95A 1VAZA 4DQPA 4E7IA 2UUAK 4JD2B 4CEOA 2O8EA 1WB9A 1U04A 4DSKA 1U45A 4HUGA 1RBVA 3IRXA 4CBWA 1ZBUA 4AHTA 2A3ZA 3MEGA 4OPAA 3OW2M 4AH9A 3NAEA 2Q3SA 2QEXN 3WUHA 5BREA 5M1FA 5KQ8A 4FW1A 3QEPA 4AHVA 5JLFA 2QWQA 4K8XA 1L3VA 4GKKK 3T1YK 1K8KA 4H5NA 4ELVA 5AQFA 4WE1A 3K5OA 4H5VA 1DTTA 2RPIA 1BI4B 2Z1JA 2X78A 4B3SK 4WFAL 2F96A 2P1JA 2OZSA 4FLYA 1N6QA 2F9WA 4A59A 3QNOA 3FFIA 4FPBA 4JS4A 1XQSC 2KTQA 4OPHA 4CF8A 3DLGA 4CGHA 1XHXA 3QMLA 3WEEB 3THXB 4KTQA 2EWSA 3CPWM 1P90A 3O5BA 3IFRA 2OPQA 4FZYA 1E4FT 1R0AA 1QHTA 4CHNA 1GOBA 1NK0A 4E1MA 1IO2A 2B4JA 1DEJA 2ATQA 2YHYA 1VQ9N 1XNRK 3IKMA 4YOYA 1JL1A 2FXUA 3VOVA 3DJCA 4U67L 4WQ5C 4JLHA 4DTRA 4A2AA 4J2DA 4E7HA 1IG8A 1HQEA 5EOYA 4K43A 1JJ2M 2W6LA 4JD2A 3LP0A 4FLUA 4X64K 4CJVA 2DFHA 3V9WA 3KWIA 3T3FA 1D5AA 2G8FA 5DM7L 1TGOA 4CERA 4CEFA 4MLHA 4PKIA 3OYKA 2HVIA 3UIQA 1VQNN 1ESVA 2KFZA 3P39A 1X3MA 3V6DA 3IS9A 2H3GX 3R9PA 3SV3A 1HR0K 3HM9A 4RCHA 4CJWA 5EY4A 4FWSA 4CJTA 4FK4A 3HRGA 4BVOA 1BI4A 1VQON 3C65A 2UXDK 5BRHA 4FK2A 4DTPA 4Z0UA 4MFBA 3SJJA 2GWKA 1KRPA 3AGKA 3ITHA 4CCHA 1QVFM 1EWRA 4CFBA 3THXA 3WEEA 3SBTA 1TKZA 4O4GA 4CHOA 2GX9A 3Q7BA 2ZE2A 3KK7A 4BR7A 5M1KA 4HVJA 3J8AA 3LL3A 4PQUA 5BR8K 5FRNA 1WSGA 1EQYA 4KHWA 1HPMA 3DLKA 3U6FA 1L5UA 1U49A 3AVNA 1MWKA 2XY8A 4FYDA 1VQLN 2QXFA 1T3VA 1S6PA 3ZSYA 3MN7A 1HNXK 5BPMA 2R7YA 3AARA 4F9OA 3EZ5A 4IZ9A 3K2PA 2CGLA 4BY9C 1Q9YA 4A2BA 2P9NB 4CEDA 4FM2A 4G1QA 2WOMA 3CD6N 4CJPA 4CVNE 5AQTA 1T8EA 4HTUA 3CQ8A 4LF6K 3CC4N 4AHCA 3HPGA 3QEWA 4KHPK 4KTWA 3VQAA 2VG6A 3UKUB 4IOXA 3H46O 2BANA 3GBTA 2BE2A 5H1SQ 4BWJA 3GE1A 4DMNA 4A5BA 2V52B
chains in the Genus database with same CATH topology
1HPZA 4RW8A 1I39A 3OS0A 4F8RA 3VQ7A 4E7JA 1HNIA 3QEVA 3NF8A 2HNYA 3MECA 1ASUA 4PWDA 4CJ5A 1TAUA 3KK3A 3OYLA 2YNFA 4F3OA 3AO5A 3DYAA 3PUFA 2YHAA 3NH2A 2D0AA 4IBNA 4CEAA 3TWHA 2Y1IA 4F3TA 3QETA 2LSNA 1VSEA 3C94A 3P1GA 3OY9A 3OYMA 1TK5A 1KSPA 1C1AA 1KVCA 4RW7A 3VQ4A 3E01A 4FVMA 1JLCA 3PY8A 3K5NA 3SPYA 1RDCA 4FJHA 5FRMA 4H4OA 3HYFA 1S1XA 3PX6A 3LAMA 4EP5A 3SUPA 1SKRA 1K6YA 3LPUA 4BDYA 5T7BA 4DQQA 1FK9A 3NFAA 1B9FA 3TAMA 4FJMA 1UWBA 3L3UA 3D0PA 4OGEA 3F9KA 1C0MA 3T19A 4KFBA 4CJ3A 3AVBA 4DLGA 1MU2A 5SWMA 2VWKA 2KQ2A 3NH1A 4CGIA 5J2PA 1KLNA 2PYLA 3HVRA 1RT4A 3WNEA 4DU4A 1QE1A 4DWIA 2F8SA 1XHZA 4KPYA 2IGIA 3PX0A 3DLEA 1D9FA 4B9VA 4C8LA 5HRSA 3MXIA 3OYFA 3DLBA 4ID5A 4OJRA 3MEEA 2AJQA 1VSKA 3VQ6A 4J2EA 4CK3A 1RBSA 3KTQA 1C6VA 3NE6A 4KHQA 4CFDA 4DTOA 4DF8A 3V9ZA 4AHRA 4B9NA 1ZBIA 4KREA 1KFDA 2ZQBA 3SUQA 3ZSQA 4H8KA 2I5JA 1DLOA 1S9GA 4EZ9A 4O0JA 2BGGA 3QEXA 3HSTB 1EKEA 3AVCA 3KJVA 4E7KA 3ZT0A 1T03A 3OYBA 5J2MA 1A5VA 3CG7A 3P5JA 2YV0X 5J2NA 4NCBA 1S1WA 2VWJA 4F2RA 5D3GA 2HHSA 1HRHA 4R5PA 1Z26A 1JXEA 5HRPA 4CF1A 3KKRA 4BACA 4W5NA 1B9DA 5EU7A 3OYCA 3V4IA 3U3YA 4JRPA 1TK0A 4EP4A 4ELUA 3ZSXA 4FJ8A 4CEQA 1EXQA 4DTUA 3K57A 3QIOA 4N56A 2IAJA 2RF2A 3KLGA 1VK0A 1TAQA 4GMJB 4CEZA 3KKSA 3H08A 4CJKA 1TVRA 3AO1A 1X9MA 1RNHA 2X6SA 4JS5A 4E7LA 4C8KA 1JLAA 4DFJA 3QERA 4E19A 3PX4A 3I8DA 4KAZA 4CIEA 3SCXA 1IKXA 3ZT2A 2RN2A 3DRRA 4CJRA 3G10A 1RTJA 3CFPA 3SNNA 2HW3A 4FW2A 3RR7A 2FBVA 3O3FA 3DM2A 4CHPA 2QKBA 3NGYA 4F4KA 4B3OA 3SUOA 2OPPA 5K14A 4KB0A 4B9SA 3NGZA 2D0BA 1CZBA 3C6UA 1WSJA 5FDLA 3KK2A 3RMAA 2OA8A 4HCCA 3AVHA 1QQCA 1ZBFA 2HHXA 1SL0A 1DTQA 3OVNA 3CFOA 4CEBA 3CM5A 3L8BA 2JGUA 4CJEA 3OYEA 4CHQA 4OKJA 3VQQA 3M8SA 2EHGA 4IFVA 2HB5A 3SUNA 2G8HA 3LPTA 5HRRA 2IDOA 1C0TA 1IKVA 2HNDA 5KTQA 4OLBA 2WONA 4XIUA 1A5XA 1S1TA 4M41A 3OYDA 4B9MA 1QTMA 4AHSA 1S1UA 3LANA 2KFNA 1B92A 1WAJA 4LSLA 1TK8A 4OVLA 1VRUA 2O4GA 4IDKA 2Y1JA 3K58A 3AVFA 4FK0A 3WNHA 4OGCA 3L2QA 3HPHA 3L2RA 3NDKA 4OPKA 3TARA 4ZTJA 1NK7A 4KTQA 2KW4A 3DOKA 1HYZA 3S3NA 1T05A 3LP2A 1KTQA 3HPOA 3WNFA 3VQ8A 2D5RA 4RW6A 1NJYA 4BWMA 4FLTA 1FKOA 1NK9A 1BCMA 1RDBA 5CYQA 1RT7A 3OYNA 3AO2A 5DK5A 2A1RA 3DLHA 3ISNC 3QLHA 3QNNA 2IC3A 4CHZA 1SKWA 3L2UA 1U47A 3QESA 4CGDA 4H4MA 3TAGA 2ETJA 4FJJA 4KI6A 3JSMA 1S9EA 3LZIA 3G0ZA 1J9AA 4DTMA 3TAPA 4M3TA 4GVMA 3SQ1A 4FZXC 1BGXT 4Y1DA 5JS1A 4FLWA 4FJIA 4CF0A 4I7FA 3SV4A 4CECA 1JLEA 3DLRA 5DMRA 1CZ9A 1WSEA 3TAFA 3MXMA 4KHSA 1LWEA 1WLJA 4DU3A 2F8TA 1ASWA 4Z4HA 4FJGA 4CIGA 4DQRA 3KLFA 4FJ5A 1RILA 1TKDA 2G8VA 3HJFA 2HHVA 4W5RA 3ZSZA 3O4QA 3S3OA 1XC9A 2A1SA 1ASVA 2ITGA 3NGIA 3LWLA 1LV5A 1REVA 4FJ9A 3RMCA 2YNHA 1LAWA 1KFSA 4ICLA 3SZ2A 1JXBA 3AA4A 3NH0A 5I3UA 3V1QA 4Z4FA 1ITGA 1W0HA 4DFMA 1RDAA 1RCHA 4ZHRA 2E4LA 4DTJA 4C8NA 3HVTA 4FJLA 4J2BA 2XRIA 5CYMA 5KGXA 1GOCA 1ZBLA 2PY5A 1BIZA 5KRTA 3S9HA 3LP3A 4CJQA 4FJNA 3PO5A 4DF4A 3V9UA 4IKFA 1SKSA 2G8UA 4PY5A 3QIPA 1LW0A 4KI4A 1YT3A 4KB1A 1RT5A 1LWCA 2GUIA 3P83D 3CM6A 4CJFA 1CXUA 3DRPA 3HO1A 3BDPA 3JYTA 2XHBA 1CLQA 3ZT4A 3K5MA 1C0UA 3ALYA 1WSHA 1RBRA 2KZZA 1RT6A 4CF2A 1RTIA 1VSMA 5I42A 3I0RA 4FM0A 2OYQA 3TAQA 4FZZA 2Z1GA 1X1PA 3TAEA 4M3UA 1UA0A 4BE0A 4DS5A 1RTHA 3OJSA 3LALA 1KCFA 4Q5VA 3KLHA 4F2SA 3AVIA 1Y97A 3F73A 1JLBA 3RWUA 1LWFA 4DSEA 2OZMA 4FLZA 5C24A 4N76A 2D0CA 1C1CA 1JLQA 3M8QA 4I2PA 4I9LA 3V1RA 3O3GA 2XO7A 3TI0A 4FLXA 2E6MA 3EY1A 3IAYA 3QO9A 4E1NA 4PA1A 4E89A 3RR8A 1SL1A 3C6TA 1TL1A 1WSFA 4QAGA 3AVGA 4RW9A 4W5TA 4HUEA 4O55A 1IKYA 1XWLA 4B08A 4CJSA 1BHLA 1TKTA 4CESA 1U4BA 3C95A 4N47A 3LDSA 3TABA 2FBTA 4DQPA 3BGRA 4DG1A 4E7IA 2YKMA 4CEOA 3L2WA 4QCLA 1RDDA 1NK6A 1J54A 1U04A 1JKHA 5JS2A 4DSKA 1U45A 3VQ9A 4HUGA 1RBVA 3IRXA 4PUOA 3K5LA 1ZBUA 3SPZA 4AHTA 3MEGA 1JLFA 2HMIA 2DFFA 2FC0A 4AH9A 4E3SA 4O44A 1TL3A 2IS3A 1EP4A 2Q3SA 3NAEA 3RRHA 4FJKA 5HBMA 2X74A 3AVKA 3KK1A 5C25A 3OYGA 1IKWA 2HHUA 1HQUA 4FW1A 3QEPA 4AHVA 2B6AA 3MXJA 3ZCMA 4KRFA 5CY4A 1S5JA 2ZD1A 4DFKA 1NJZA 1RBUA 3V9XA 1L3VA 4K8XA 3U3GA 3OYIA 1VSLA 4KO0A 4HHTA 4KHUA 3AVMA 1G15A 3DMJA 3V9SA 1D9DA 3SYZA 4ELVA 4O5BA 4M3ZA 3ZSRA 1J5OA 3M8RA 4WE1A 1SL2A 4CJLA 3VQPA 3K5OA 1DTTA 2RPIA 4RG8A 1BI4B 2XY5A 2Z1JA 4CGGA 4B9TA 1NK8A 2X78A 4CJUA 2F96A 2P1JA 5J2QA 4FLYA 1N6QA 2BDPA 2OZSA 1N5YA 4M3XA 1S6QA 3QNOA 3FFIA 4OLAA 1WAFA 1FKPA 4DQSA 4JS4A 4BDPA 3LZJA 3VQ5A 4DQIA 2KTQA 1YTUA 1A5WA 4GW6A 4FM1A 4Z4GA 4CF8A 3DLGA 4CGHA 1XHXA 3HP9A 4DLEA 1J53A 1LW2A 3VQCA 2PZSA 4B9UA 1BL3A 1EX4A 4OKKA 3V81A 3OYAA 4FJ7A 3L3VA 3LAKA 2Z1HA 2FBYA 4NYFA 4M3RA 1WN7A 4N5SA 4N41A 2B5JA 4KTZA 3D45A 3ZSOA 2OPQA 5J1EA 4FZYA 4DTSA 4W5OA 4Z4IA 1UOCA 4I9QA 3HXMA 4ZTFA 1R0AA 4ID1A 1QHTA 3SQ2A 3AA5X 3ZT1A 3PV8A 3THVA 2X6NA 4CK1A 4CHNA 1X9SA 3L2VA 5CZ1A 1GOBA 2FBXA 5HRNA 4M45A 3NHGA 1KLMA 1NK0A 3VQEA 5HLFA 4CHYA 1XI1A 4NCGA 1HYSA 2YNGA 1D8YA 4E1MA 4UQGA 1IO2A 4W5QA 1QS4A 2B4JA 4YFUA 1SUQA 2ATQA 2HVHA 3AA3A 3VA0A 2P5GA 3B6PA 4K8ZA 1VSHA 3AVJA 1WNSA 4Y1CA 1QSYA 2G8WA 4M3WA 1JL1A 3OJUA 4CGJA 3K59A 3EYZA 2XY7A 1NKCA 3RMDA 4DSIA 3DOLA 1RT3A 4JLHA 4DTRA 4DTNA 4J2DA 4CIFA 4E7HA 2HHTA 3T1AA 4O0IA 4AILC 3I0SA 3QINA 4LD0A 1VSJA 4B8AB 4KHYA 3CFRA 4KHNA 1HQEA 4L8RB 1RT2A 2GV9A 3LP0A 5SZTA 4FLUA 1BCOA 1HYVA 3MAQA 3CYMA 3VN5A 4CJVA 2DFHA 3V9WA 3T3FA 4J2AA 1D5AA 2G8FA 1LAVA 5CZ2A 4IFYA 3OS1A 4FCYA 1CXQA 4DFPA 1TGOA 4Z4EA 4CERA 1U48A 1NJWA 4CEFA 1NOZA 1C1BA 3O4NA 3HL8A 3KLEA 3OYKA 5HP1A 2HVIA 3UIQA 3SI6A 1BQNA 1YVUA 1TV6A 4CFCA 3NF9A 4OPJA 3SQ4A 1UA1A 4TSXA 2KFZA 3LWMA 4RW4A 4QOZB 1IG9A 2NUBA 3NCIA 2HHWA 1RTDA 1T7PA 3VA3A 3V6DA 1NOYA 3IS9A 1Z25A 3SV3A 3HM9A 3SQ0A 3ULDA 4CJWA 2DFEA 3AA2A 2Z1IA 4KKOA 3A2FA 4CEEA 4HUFA 4CJTA 4FK4A 2HNZA 3VQBA 1BI4A 1BQMA 1FXXA 1TKXA 3AO3A 4YNQA 3RTVA 4FK2A 4CGFA 4BE2A 4DTPA 4Z0UA 4MFBA 4ELTA 3SJJA 3TANA 1KRPA 1W9HA 3ITHA 4CCHA 5KI6A 2W42A 1NK5A 1VSIA 3O3HA 4DS4A 4NYNA 4CFAA 2YKNA 1NKBA 4E0DA 1ZBHA 1VSDA 3AO4A 4CFBA 1HMVA 3NF6A 2E6LA 3AVAA 4IG0A 1Q9XA 1TKZA 1F21A 1S1VA 4O4GA 4CHOA 3IG1A 3RRGA 4LSNA 1VRTA 4C8MA 2VG7A 3AVLA 1NJXA 2YHBA 2DY4A 2ZE2A 1QSLA 3KD1E 5KRSA 3OS2A 1Q8IA 4HVJA 2P5OA 4AHUA 2XY6A 1QSSA 4BDZA 3MEDA 4PQUA 5FRNA 3HP6A 1EETA 4B9LA 5KGWA 4LH4A 1WSGA 1JLGA 4KHWA 3AV9A 4MQ3A 2RKIA 3DLKA 3U6FA 4M42A 4LY7A 2OPRA 3ZSWA 1U49A 3LP1A 1L5UA 2EX3A 2GBZA 3VQDA 4DU1A 2OPSA 3AVNA 2XY8A 1L3SA 4FYDA 3NF7A 2G8KA 2VG5A 2O4IA 1JL2A 4IG3A 3DRSA 3V1OA 2QXFA 1S6PA 3ZSYA 4DTXA 2G8IA 4OKEA 4B8CA 2R7YA 1BIUA 2JLEA 1GOAA 1L3UA 1SV5A 4Z4CA 4I2QA 3TR8A 3EZ5A 1KVAA 3DI6A 2KZMA 3K2PA 4EZ6A 1Q9YA 4KV8A 3KLIA 1BISA 3M8PA 1YTAA 4CEDA 4FM2A 4Q0BA 4G1QA 2WOMA 2QK9A 2HHQA 4FLVA 4CJPA 4JRQA 1RBTA 4CJ4A 4M3YA 1T8EA 3OYHA 4BE1A 2P51A 4HTUA 4FXDA 2PYJA 3ZT3A 3WNGA 3HT3A 3CQ8A 1L3TA 1HNVA 1I3AA 2YNIA 3ZSVA 3PO4A 2DTUA 3B6OA 1NKEA 1IH7A 5E41A 3KIOA 1WSIA 3KD5E 5C42A 1HJRA 4AHCA 3S3MA 4DSLA 3HPGA 3QEWA 3HK2A 2IOCA 4KTWA 3VQAA 4C8OA 4CE9A 1O1WA 2VG6A 4CF9A 3QEIA 3OYJA 5FROA 1X9WA 2BANA 4DSJA 1RT1A 1NK4A 4HCBA 1UAXA 4CK2A 1KVBA 2BE2A 4LH5A 5HROA 4NCAA 3ASMA 3RMBA 1ZYQA 4BWJA 4FJXA 2QKKA 4DSFA 4DMNA 3NBPA 1VSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HPZ A;  4RW8 A;  1I39 A;  3OS0 A;  4F8R A;  3VQ7 A;  4E7J A;  1HNI A;  3QEV A;  3NF8 A;  2HNY A;  3MEC A;  1ASU A;  4PWD A;  4CJ5 A;  1TAU A;  3KK3 A;  3OYL A;  2YNF A;  4F3O A;  3AO5 A;  3DYA A;  3PUF A;  2YHA A;  3NH2 A;  2D0A A;  4IBN A;  4CEA A;  3TWH A;  2Y1I A;  4F3T A;  3QET A;  2LSN A;  1VSE A;  3C94 A;  3P1G A;  3OY9 A;  3OYM A;  1TK5 A;  1KSP A;  1C1A A;  1KVC A;  4RW7 A;  3VQ4 A;  3E01 A;  4FVM A;  1JLC A;  3PY8 A;  3K5N A;  3SPY A;  1RDC A;  4FJH A;  5FRM A;  4H4O A;  3HYF A;  1S1X A;  3PX6 A;  3LAM A;  4EP5 A;  3SUP A;  1SKR A;  1K6Y A;  3LPU A;  4BDY A;  5T7B A;  4DQQ A;  1FK9 A;  3NFA A;  1B9F A;  3TAM A;  4FJM A;  1UWB A;  3L3U A;  3D0P A;  4OGE A;  3F9K A;  1C0M A;  3T19 A;  4KFB A;  4CJ3 A;  3AVB A;  4DLG A;  1MU2 A;  5SWM A;  2VWK A;  2KQ2 A;  3NH1 A;  4CGI A;  5J2P A;  1KLN A;  2PYL A;  3HVR A;  1RT4 A;  3WNE A;  4DU4 A;  1QE1 A;  4DWI A;  2F8S A;  1XHZ A;  4KPY A;  2IGI A;  3PX0 A;  3DLE A;  1D9F A;  4B9V A;  4C8L A;  5HRS A;  3MXI A;  3OYF A;  3DLB A;  4ID5 A;  4OJR A;  3MEE A;  2AJQ A;  1VSK A;  3VQ6 A;  4J2E A;  4CK3 A;  1RBS A;  3KTQ A;  1C6V A;  3NE6 A;  4KHQ A;  4CFD A;  4DTO A;  4DF8 A;  3V9Z A;  4AHR A;  4B9N A;  1ZBI A;  4KRE A;  1KFD A;  2ZQB A;  3SUQ A;  3ZSQ A;  4H8K A;  2I5J A;  1DLO A;  1S9G A;  4EZ9 A;  4O0J A;  2BGG A;  3QEX A;  3HST B;  1EKE A;  3AVC A;  3KJV A;  4E7K A;  3ZT0 A;  1T03 A;  3OYB A;  5J2M A;  1A5V A;  3CG7 A;  3P5J A;  2YV0 X;  5J2N A;  4NCB A;  1S1W A;  2VWJ A;  4F2R A;  5D3G A;  2HHS A;  1HRH A;  4R5P A;  1Z26 A;  1JXE A;  5HRP A;  4CF1 A;  3KKR A;  4BAC A;  4W5N A;  1B9D A;  5EU7 A;  3OYC A;  3V4I A;  3U3Y A;  4JRP A;  1TK0 A;  4EP4 A;  4ELU A;  3ZSX A;  4FJ8 A;  4CEQ A;  1EXQ A;  4DTU A;  3K57 A;  3QIO A;  4N56 A;  2IAJ A;  2RF2 A;  3KLG A;  1VK0 A;  1TAQ A;  4GMJ B;  4CEZ A;  3KKS A;  3H08 A;  4CJK A;  1TVR A;  3AO1 A;  1X9M A;  1RNH A;  2X6S A;  4JS5 A;  4E7L A;  4C8K A;  1JLA A;  4DFJ A;  3QER A;  4E19 A;  3PX4 A;  3I8D A;  4KAZ A;  4CIE A;  3SCX A;  1IKX A;  3ZT2 A;  2RN2 A;  3DRR A;  4CJR A;  3G10 A;  1RTJ A;  3CFP A;  3SNN A;  2HW3 A;  4FW2 A;  3RR7 A;  2FBV A;  3O3F A;  3DM2 A;  4CHP A;  2QKB A;  3NGY A;  4F4K A;  4B3O A;  3SUO A;  2OPP A;  5K14 A;  4KB0 A;  4B9S A;  3NGZ A;  2D0B A;  1CZB A;  3C6U A;  1WSJ A;  5FDL A;  3KK2 A;  3RMA A;  2OA8 A;  4HCC A;  3AVH A;  1QQC A;  1ZBF A;  2HHX A;  1SL0 A;  1DTQ A;  3OVN A;  3CFO A;  4CEB A;  3CM5 A;  3L8B A;  2JGU A;  4CJE A;  3OYE A;  4CHQ A;  4OKJ A;  3VQQ A;  3M8S A;  2EHG A;  4IFV A;  2HB5 A;  3SUN A;  2G8H A;  3LPT A;  5HRR A;  2IDO A;  1C0T A;  1IKV A;  2HND A;  5KTQ A;  4OLB A;  2WON A;  4XIU A;  1A5X A;  1S1T A;  4M41 A;  3OYD A;  4B9M A;  1QTM A;  4AHS A;  1S1U A;  3LAN A;  2KFN A;  1B92 A;  1WAJ A;  4LSL A;  1TK8 A;  4OVL A;  1VRU A;  2O4G A;  4IDK A;  2Y1J A;  3K58 A;  3AVF A;  4FK0 A;  3WNH A;  4OGC A;  3L2Q A;  3HPH A;  3L2R A;  3NDK A;  4OPK A;  3TAR A;  4ZTJ A;  1NK7 A;  4KTQ A;  2KW4 A;  3DOK A;  1HYZ A;  3S3N A;  1T05 A;  3LP2 A;  1KTQ A;  3HPO A;  3WNF A;  3VQ8 A;  2D5R A;  4RW6 A;  1NJY A;  4BWM A;  4FLT A;  1FKO A;  1NK9 A;  1BCM A;  1RDB A;  5CYQ A;  1RT7 A;  3OYN A;  3AO2 A;  5DK5 A;  2A1R A;  3DLH A;  3ISN C;  3QLH A;  3QNN A;  2IC3 A;  4CHZ A;  1SKW A;  3L2U A;  1U47 A;  3QES A;  4CGD A;  4H4M A;  3TAG A;  2ETJ A;  4FJJ A;  4KI6 A;  3JSM A;  1S9E A;  3LZI A;  3G0Z A;  1J9A A;  4DTM A;  3TAP A;  4M3T A;  4GVM A;  3SQ1 A;  4FZX C;  1BGX T;  4Y1D A;  5JS1 A;  4FLW A;  4FJI A;  4CF0 A;  4I7F A;  3SV4 A;  4CEC A;  1JLE A;  3DLR A;  5DMR A;  1CZ9 A;  1WSE A;  3TAF A;  3MXM A;  4KHS A;  1LWE A;  1WLJ A;  4DU3 A;  2F8T A;  1ASW A;  4Z4H A;  4FJG A;  4CIG A;  4DQR A;  3KLF A;  4FJ5 A;  1RIL A;  1TKD A;  2G8V A;  3HJF A;  2HHV A;  4W5R A;  3ZSZ A;  3O4Q A;  3S3O A;  1XC9 A;  2A1S A;  1ASV A;  2ITG A;  3NGI A;  3LWL A;  1LV5 A;  1REV A;  4FJ9 A;  3RMC A;  2YNH A;  1LAW A;  1KFS A;  4ICL A;  3SZ2 A;  1JXB A;  3AA4 A;  3NH0 A;  5I3U A;  3V1Q A;  4Z4F A;  1ITG A;  1W0H A;  4DFM A;  1RDA A;  1RCH A;  4ZHR A;  2E4L A;  4DTJ A;  4C8N A;  3HVT A;  4FJL A;  4J2B A;  2XRI A;  5CYM A;  5KGX A;  1GOC A;  1ZBL A;  2PY5 A;  1BIZ A;  5KRT A;  3S9H A;  3LP3 A;  4CJQ A;  4FJN A;  3PO5 A;  4DF4 A;  3V9U A;  4IKF A;  1SKS A;  2G8U A;  4PY5 A;  3QIP A;  1LW0 A;  4KI4 A;  1YT3 A;  4KB1 A;  1RT5 A;  1LWC A;  2GUI A;  3P83 D;  3CM6 A;  4CJF A;  1CXU A;  3DRP A;  3HO1 A;  3BDP A;  3JYT A;  2XHB A;  1CLQ A;  3ZT4 A;  3K5M A;  1C0U A;  3ALY A;  1WSH A;  1RBR A;  2KZZ A;  1RT6 A;  4CF2 A;  1RTI A;  1VSM A;  5I42 A;  3I0R A;  4FM0 A;  2OYQ A;  3TAQ A;  4FZZ A;  2Z1G A;  1X1P A;  3TAE A;  4M3U A;  1UA0 A;  4BE0 A;  4DS5 A;  1RTH A;  3OJS A;  3LAL A;  1KCF A;  4Q5V A;  3KLH A;  4F2S A;  3AVI A;  1Y97 A;  3F73 A;  1JLB A;  3RWU A;  1LWF A;  4DSE A;  2OZM A;  4FLZ A;  5C24 A;  4N76 A;  2D0C A;  1C1C A;  1JLQ A;  3M8Q A;  4I2P A;  4I9L A;  3V1R A;  3O3G A;  2XO7 A;  3TI0 A;  4FLX A;  2E6M A;  3EY1 A;  3IAY A;  3QO9 A;  4E1N A;  4PA1 A;  4E89 A;  3RR8 A;  1SL1 A;  3C6T A;  1TL1 A;  1WSF A;  4QAG A;  3AVG A;  4RW9 A;  4W5T A;  4HUE A;  4O55 A;  1IKY A;  1XWL A;  4B08 A;  4CJS A;  1BHL A;  1TKT A;  4CES A;  1U4B A;  3C95 A;  4N47 A;  3LDS A;  3TAB A;  2FBT A;  4DQP A;  3BGR A;  4DG1 A;  4E7I A;  2YKM A;  4CEO A;  3L2W A;  4QCL A;  1RDD A;  1NK6 A;  1J54 A;  1U04 A;  1JKH A;  5JS2 A;  4DSK A;  1U45 A;  3VQ9 A;  4HUG A;  1RBV A;  3IRX A;  4PUO A;  3K5L A;  1ZBU A;  3SPZ A;  4AHT A;  3MEG A;  1JLF A;  2HMI A;  2DFF A;  2FC0 A;  4AH9 A;  4E3S A;  4O44 A;  1TL3 A;  2IS3 A;  1EP4 A;  2Q3S A;  3NAE A;  3RRH A;  4FJK A;  5HBM A;  2X74 A;  3AVK A;  3KK1 A;  5C25 A;  3OYG A;  1IKW A;  2HHU A;  1HQU A;  4FW1 A;  3QEP A;  4AHV A;  2B6A A;  3MXJ A;  3ZCM A;  4KRF A;  5CY4 A;  1S5J A;  2ZD1 A;  4DFK A;  1NJZ A;  1RBU A;  3V9X A;  1L3V A;  4K8X A;  3U3G A;  3OYI A;  1VSL A;  4KO0 A;  4HHT A;  4KHU A;  3AVM A;  1G15 A;  3DMJ A;  3V9S A;  1D9D A;  3SYZ A;  4ELV A;  4O5B A;  4M3Z A;  3ZSR A;  1J5O A;  3M8R A;  4WE1 A;  1SL2 A;  4CJL A;  3VQP A;  3K5O A;  1DTT A;  2RPI A;  4RG8 A;  1BI4 B;  2XY5 A;  2Z1J A;  4CGG A;  4B9T A;  1NK8 A;  2X78 A;  4CJU A;  2F96 A;  2P1J A;  5J2Q A;  4FLY A;  1N6Q A;  2BDP A;  2OZS A;  1N5Y A;  4M3X A;  1S6Q A;  3QNO A;  3FFI A;  4OLA A;  1WAF A;  1FKP A;  4DQS A;  4JS4 A;  4BDP A;  3LZJ A;  3VQ5 A;  4DQI A;  2KTQ A;  1YTU A;  1A5W A;  4GW6 A;  4FM1 A;  4Z4G A;  4CF8 A;  3DLG A;  4CGH A;  1XHX A;  3HP9 A;  4DLE A;  1J53 A;  1LW2 A;  3VQC A;  2PZS A;  4B9U A;  1BL3 A;  1EX4 A;  4OKK A;  3V81 A;  3OYA A;  4FJ7 A;  3L3V A;  3LAK A;  2Z1H A;  2FBY A;  4NYF A;  4M3R A;  1WN7 A;  4N5S A;  4N41 A;  2B5J A;  4KTZ A;  3D45 A;  3ZSO A;  2OPQ A;  5J1E A;  4FZY A;  4DTS A;  4W5O A;  4Z4I A;  1UOC A;  4I9Q A;  3HXM A;  4ZTF A;  1R0A A;  4ID1 A;  1QHT A;  3SQ2 A;  3AA5 X;  3ZT1 A;  3PV8 A;  3THV A;  2X6N A;  4CK1 A;  4CHN A;  1X9S A;  3L2V A;  5CZ1 A;  1GOB A;  2FBX A;  5HRN A;  4M45 A;  3NHG A;  1KLM A;  1NK0 A;  3VQE A;  5HLF A;  4CHY A;  1XI1 A;  4NCG A;  1HYS A;  2YNG A;  1D8Y A;  4E1M A;  4UQG A;  1IO2 A;  4W5Q A;  1QS4 A;  2B4J A;  4YFU A;  1SUQ A;  2ATQ A;  2HVH A;  3AA3 A;  3VA0 A;  2P5G A;  3B6P A;  4K8Z A;  1VSH A;  3AVJ A;  1WNS A;  4Y1C A;  1QSY A;  2G8W A;  4M3W A;  1JL1 A;  3OJU A;  4CGJ A;  3K59 A;  3EYZ A;  2XY7 A;  1NKC A;  3RMD A;  4DSI A;  3DOL A;  1RT3 A;  4JLH A;  4DTR A;  4DTN A;  4J2D A;  4CIF A;  4E7H A;  2HHT A;  3T1A A;  4O0I A;  4AIL C;  3I0S A;  3QIN A;  4LD0 A;  1VSJ A;  4B8A B;  4KHY A;  3CFR A;  4KHN A;  1HQE A;  4L8R B;  1RT2 A;  2GV9 A;  3LP0 A;  5SZT A;  4FLU A;  1BCO A;  1HYV A;  3MAQ A;  3CYM A;  3VN5 A;  4CJV A;  2DFH A;  3V9W A;  3T3F A;  4J2A A;  1D5A A;  2G8F A;  1LAV A;  5CZ2 A;  4IFY A;  3OS1 A;  4FCY A;  1CXQ A;  4DFP A;  1TGO A;  4Z4E A;  4CER A;  1U48 A;  1NJW A;  4CEF A;  1NOZ A;  1C1B A;  3O4N A;  3HL8 A;  3KLE A;  3OYK A;  5HP1 A;  2HVI A;  3UIQ A;  3SI6 A;  1BQN A;  1YVU A;  1TV6 A;  4CFC A;  3NF9 A;  4OPJ A;  3SQ4 A;  1UA1 A;  4TSX A;  2KFZ A;  3LWM A;  4RW4 A;  4QOZ B;  1IG9 A;  2NUB A;  3NCI A;  2HHW A;  1RTD A;  1T7P A;  3VA3 A;  3V6D A;  1NOY A;  3IS9 A;  1Z25 A;  3SV3 A;  3HM9 A;  3SQ0 A;  3ULD A;  4CJW A;  2DFE A;  3AA2 A;  2Z1I A;  4KKO A;  3A2F A;  4CEE A;  4HUF A;  4CJT A;  4FK4 A;  2HNZ A;  3VQB A;  1BI4 A;  1BQM A;  1FXX A;  1TKX A;  3AO3 A;  4YNQ A;  3RTV A;  4FK2 A;  4CGF A;  4BE2 A;  4DTP A;  4Z0U A;  4MFB A;  4ELT A;  3SJJ A;  3TAN A;  1KRP A;  1W9H A;  3ITH A;  4CCH A;  5KI6 A;  2W42 A;  1NK5 A;  1VSI A;  3O3H A;  4DS4 A;  4NYN A;  4CFA A;  2YKN A;  1NKB A;  4E0D A;  1ZBH A;  1VSD A;  3AO4 A;  4CFB A;  1HMV A;  3NF6 A;  2E6L A;  3AVA A;  4IG0 A;  1Q9X A;  1TKZ A;  1F21 A;  1S1V A;  4O4G A;  4CHO A;  3IG1 A;  3RRG A;  4LSN A;  1VRT A;  4C8M A;  2VG7 A;  3AVL A;  1NJX A;  2YHB A;  2DY4 A;  2ZE2 A;  1QSL A;  3KD1 E;  5KRS A;  3OS2 A;  1Q8I A;  4HVJ A;  2P5O A;  4AHU A;  2XY6 A;  1QSS A;  4BDZ A;  3MED A;  4PQU A;  5FRN A;  3HP6 A;  1EET A;  4B9L A;  5KGW A;  4LH4 A;  1WSG A;  1JLG A;  4KHW A;  3AV9 A;  4MQ3 A;  2RKI A;  3DLK A;  3U6F A;  4M42 A;  4LY7 A;  2OPR A;  3ZSW A;  1U49 A;  3LP1 A;  1L5U A;  2EX3 A;  2GBZ A;  3VQD A;  4DU1 A;  2OPS A;  3AVN A;  2XY8 A;  1L3S A;  4FYD A;  3NF7 A;  2G8K A;  2VG5 A;  2O4I A;  1JL2 A;  4IG3 A;  3DRS A;  3V1O A;  2QXF A;  1S6P A;  3ZSY A;  4DTX A;  2G8I A;  4OKE A;  4B8C A;  2R7Y A;  1BIU A;  2JLE A;  1GOA A;  1L3U A;  1SV5 A;  4Z4C A;  4I2Q A;  3TR8 A;  3EZ5 A;  1KVA A;  3DI6 A;  2KZM A;  3K2P A;  4EZ6 A;  1Q9Y A;  4KV8 A;  3KLI A;  1BIS A;  3M8P A;  1YTA A;  4CED A;  4FM2 A;  4Q0B A;  4G1Q A;  2WOM A;  2QK9 A;  2HHQ A;  4FLV A;  4CJP A;  4JRQ A;  1RBT A;  4CJ4 A;  4M3Y A;  1T8E A;  3OYH A;  4BE1 A;  2P51 A;  4HTU A;  4FXD A;  2PYJ A;  3ZT3 A;  3WNG A;  3HT3 A;  3CQ8 A;  1L3T A;  1HNV A;  1I3A A;  2YNI A;  3ZSV A;  3PO4 A;  2DTU A;  3B6O A;  1NKE A;  1IH7 A;  5E41 A;  3KIO A;  1WSI A;  3KD5 E;  5C42 A;  1HJR A;  4AHC A;  3S3M A;  4DSL A;  3HPG A;  3QEW A;  3HK2 A;  2IOC A;  4KTW A;  3VQA A;  4C8O A;  4CE9 A;  1O1W A;  2VG6 A;  4CF9 A;  3QEI A;  3OYJ A;  5FRO A;  1X9W A;  2BAN A;  4DSJ A;  1RT1 A;  1NK4 A;  4HCB A;  1UAX A;  4CK2 A;  1KVB A;  2BE2 A;  4LH5 A;  5HRO A;  4NCA A;  3ASM A;  3RMB A;  1ZYQ A;  4BWJ A;  4FJX A;  2QKK A;  4DSF A;  4DMN A;  3NBP A;  1VSF A; 
#chains in the Genus database with same CATH topology
 4RW8 A;  4JKF A;  1I39 A;  4F8R A;  2CH6 A;  5GAE P;  3QEV A;  3MEC A;  1ASU A;  1NG9 A;  2QA4 N;  3VGK A;  3KK3 A;  1BDG A;  3AO5 A;  3PUF A;  3QFU A;  3NH2 A;  2Y1I A;  4CEA A;  3C6H A;  3P1G A;  1TK5 A;  4O8U A;  1EO1 A;  3VQ4 A;  3MN6 A;  3E01 A;  3PY8 A;  3VEV A;  3MMV A;  3C0B A;  3HYF A;  2I7N A;  3SUP A;  5JMV A;  5T7B A;  1FK9 A;  5MLC Q;  4M7X A;  3L3U A;  2KKZ A;  4KFB A;  3MK6 A;  2VWK A;  3THW B;  4CGI A;  1Q81 O;  5M1Q A;  5AZJ B;  1BA0 A;  1OH6 A;  1QE1 A;  3CQX A;  2VGM A;  5HRS A;  1WBD A;  3MEE A;  3O6W A;  3L6Q A;  5F0X A;  1RBS A;  4LF8 K;  3NE6 A;  3SK3 A;  4CFD A;  3S41 A;  1NGC A;  3B8A X;  2Q0R A;  4NXM K;  3SUQ A;  3ZSQ A;  4H8K A;  4BRK A;  1DLO A;  2P9N A;  4BGB A;  4EZ9 A;  4LF7 K;  3KJV A;  2Q31 A;  1A5V A;  1JCE A;  5J2N A;  5D3G A;  3HM8 A;  3E1Y A;  1Z26 A;  3H3O B;  3R8E A;  5EU7 A;  4JI4 K;  3U3Y A;  1TK0 A;  3LDQ A;  3CC2 N;  2NRZ A;  2RF2 A;  4JK8 A;  4BR9 A;  3KKS A;  4CJK A;  4JS5 A;  4E7L A;  4C8K A;  5ADX H;  4E19 A;  3PX4 A;  3SCX A;  3DLL L;  2PFU A;  3G10 A;  3CIP A;  2Q36 A;  3CCL N;  2A41 A;  4H0X B;  1OKJ A;  4JI2 K;  1FW6 A;  1E4G T;  4F4K A;  3QDK A;  4B3O A;  5K14 A;  3NGZ A;  3QB0 A;  3Q7C A;  2UUB K;  1ZBF A;  2HHX A;  1OVQ A;  5C10 A;  3THY B;  1QHA A;  4B3R K;  4H0O A;  4C23 A;  2EHG A;  2QXL A;  1VQP N;  2HST A;  4PKH A;  2IDO A;  2HND A;  1IKV A;  1MDU B;  4CZG A;  1GLC G;  1QTM A;  3VMF B;  3LAN A;  3O9S A;  1WAJ A;  1TK8 A;  2Y1J A;  5JVG L;  3THW A;  3TAR A;  3DOK A;  3K0S A;  3HPO A;  4BRE A;  4BRD A;  2E1Z A;  1NJY A;  4FLT A;  1GLJ O;  3OYN A;  3VPZ A;  5DK5 A;  2ITM A;  3ISN C;  4EAH D;  5M1O A;  3QNN A;  4M63 C;  1DKG D;  4H4M A;  3TAG A;  1Q86 O;  2FSK A;  3JSM A;  4KI6 A;  1S9E A;  2FSJ A;  2AA4 A;  4FO0 A;  2YJF A;  5BPN A;  3CER A;  2Q2R A;  2NZT A;  5AQR A;  4OX9 K;  3J7Y P;  4FZX C;  4KBO A;  2D1K A;  3KHY A;  2ZJR L;  4FLW A;  1ATS A;  3SV4 A;  4JK7 A;  3DLR A;  1BUP A;  1HKC A;  1H1V A;  4KHS A;  1K9M O;  2WUS A;  2GTD A;  2P9P B;  3AAP A;  5BRF A;  5AQH A;  1DT9 A;  3VEY A;  4OO1 J;  5GIP A;  2ZJQ L;  3AA4 A;  3SZ2 A;  1W7A A;  4Z4F A;  1HUX A;  1YVN A;  3O9R A;  1T6D A;  3NVM A;  4DTJ A;  3HVT A;  2PY5 A;  1GOC A;  2E88 A;  1ZBL A;  1BIZ A;  3THY A;  5AQO A;  3PO5 A;  1HKG A;  1YT3 A;  3D2F B;  3SJH A;  3DRP A;  5JLH A;  3BDP A;  1CLQ A;  2KZZ A;  3ALY A;  2IIR A;  3LDP A;  3I8B A;  2OYQ A;  4FZZ A;  4B3M K;  1KCF A;  4JEP A;  1JCF A;  2QKB A;  2D0C A;  3QO9 A;  1YIJ N;  4PA1 A;  2NRV A;  1SL1 A;  4QAG A;  4EFH A;  4HUE A;  1XWL A;  4CD1 A;  4CJS A;  1GLE G;  4H5R A;  4CES A;  4A61 A;  4N47 A;  3TAB A;  2FBT A;  1GLF O;  3UB5 A;  4DG1 A;  2YKM A;  4IXC A;  5JS2 A;  3QBW A;  3FZL A;  4DR1 K;  3G71 N;  2HBM A;  2YHW A;  4G9Z A;  3K9J A;  4O44 A;  1TL3 A;  2IS3 A;  1EP4 A;  4BRL A;  3RRH A;  5BN8 A;  4FJK A;  1VQ6 N;  5C25 A;  3OYG A;  1IKW A;  4RWT A;  3CCV N;  4EHT A;  1S5J A;  2ZM6 K;  4EIA A;  2P9S B;  2P9P A;  4KO0 A;  4HHT A;  3C7N B;  1G15 A;  3V9S A;  4WQ5 A;  2HBK A;  3M8R A;  3LM9 A;  3VQP A;  2XY5 A;  3CJB A;  4FL9 A;  4OLA A;  4A62 A;  4DQS A;  3CI5 A;  4BRH A;  5AQK A;  5E26 A;  4DQI A;  4GW6 A;  4FM1 A;  4B9U A;  4DLE A;  3GOI A;  3VQC A;  1EX4 A;  3L3V A;  1ZBI A;  4N41 A;  2FBY A;  1NLV A;  3D2F A;  4Z4I A;  1V4S A;  3ZX2 A;  3PV8 A;  1NGI A;  3THV A;  4CK1 A;  3L2V A;  2A6A A;  5HRN A;  3NHG A;  1KLM A;  5HLF A;  5CE3 A;  4WYB A;  4NCG A;  4KH5 A;  1HYS A;  4JNE A;  1D8Y A;  3PSF A;  2A42 A;  4W5Q A;  2E2P A;  4YFU A;  1SUQ A;  2HVH A;  3AA3 A;  2P5G A;  4K8Z A;  3VEN A;  4Y1C A;  3AVJ A;  3MCA B;  1QSY A;  2G8W A;  4M3W A;  3OBW A;  3O9U A;  1YJN N;  4QS9 A;  4B9Q A;  4DV4 K;  2V7Z A;  3RMD A;  1RT3 A;  4GV3 A;  4MO4 A;  4DV6 K;  3T1A A;  4O0I A;  4AIL C;  3I0S A;  3QIN A;  4LD0 A;  4DR3 K;  1VSJ A;  4B8A B;  3VEX A;  3CFR A;  5M1P A;  4L8R B;  3CYM A;  3VN5 A;  4QS8 A;  4MLE A;  4J2A A;  5CZ2 A;  4IFY A;  4JK9 A;  2HF4 A;  3U8X A;  3OS1 A;  4FCY A;  1NJW A;  1C1B A;  4IDH A;  2PBD A;  4NLC A;  3SI6 A;  4OPJ A;  3AGR A;  5AFU H;  1UA1 A;  4TSX A;  4RW4 A;  1GLL O;  3ZX3 A;  2NUB A;  3JS6 A;  1T7P A;  2OTL N;  1DGK N;  4DV2 K;  3C7N A;  1Z25 A;  5KPZ A;  3SQ0 A;  3LM2 A;  5C15 A;  3AA2 A;  2Z1I A;  4KKO A;  4CEE A;  2HNZ A;  2JWK A;  2E2Q A;  2BH1 A;  3HI0 A;  3P4I A;  4CGF A;  1SZ2 A;  1NGB A;  3AO4 A;  3A5N C;  3NF6 A;  2E6L A;  5CHI A;  4IWV A;  2P9I B;  4H0V B;  4DV3 K;  1J5E K;  3IG1 A;  4LSN A;  1VRT A;  4C8M A;  1NJX A;  1N36 K;  1QVG M;  4JI7 K;  3C6A A;  3OS2 A;  2NRX A;  1QSS A;  2XY6 A;  4BDZ A;  3E9P A;  4LH4 A;  4B1Y B;  2RKI A;  3ZSW A;  2OPR A;  2EX3 A;  2GBZ A;  3VQD A;  1VQ4 N;  4DV5 K;  3WQT A;  2G8K A;  2O4I A;  3V1O A;  4IG3 A;  1YXQ A;  1SV5 A;  5ELZ A;  3DI6 A;  4IO9 L;  3ULE B;  2ASO A;  1BIS A;  3PIP L;  1YTA A;  3ENH A;  4Q0B A;  3J80 O;  4JRQ A;  3RSE B;  1WOQ A;  3M3Z A;  1BOT O;  3OYH A;  1YIT N;  4K25 A;  3OTO K;  1L3T A;  2DTU A;  3PO4 A;  1IH7 A;  5E41 A;  2HF3 A;  4DSL A;  1VHX A;  2IOC A;  4CE9 A;  1O1W A;  5B8H A;  4BVP A;  1NK4 A;  4IJN A;  1KAZ A;  1KVB A;  5HRO A;  5EX5 A;  1ZYQ A;  2FF6 A;  4JKG B;  3NBP A;  1VSF A;  5AQN A;  1N8R O;  5IT9 O;  3G6E N;  2D0O A;  4H0P A;  1HNI A;  4CJ5 A;  2O8C A;  3OYL A;  3CPE A;  3DYA A;  4HTL A;  1U6Z A;  2D0A A;  3MN5 A;  4BC5 A;  3C94 A;  1BG3 A;  5GIN A;  3JAM O;  3EKS A;  1C1A A;  1Z6R A;  4PKG A;  5GAD P;  2P9I A;  1VQM N;  4FVM A;  3DXM B;  2F7T A;  3U4L A;  5FRM A;  4H4O A;  3PX6 A;  3LAM A;  3LPU A;  1C0F A;  1UWB A;  1VQ5 N;  2KQ2 A;  2QWR A;  5J2P A;  3HVR A;  3TTC A;  1XHZ A;  4KPY A;  5LY3 A;  1NMD A;  4FWL A;  3PX0 A;  3MXI A;  3DLB A;  5KQD A;  4J2E A;  3MX5 A;  3KTQ A;  4BG9 A;  4ISE A;  4JN4 A;  3J7A P;  2I5J A;  3SMS A;  3UE5 A;  5AQW A;  3FLC O;  2OCE A;  2HHH K;  1EKE A;  4E7K A;  3P5J A;  1BO5 O;  1S1W A;  2HHS A;  4BRA A;  3CET A;  3KKR A;  2F9T A;  1B9D A;  3OYC A;  2Q97 A;  3V4I A;  4FJ8 A;  5C2F A;  2W6K A;  3K57 A;  3QIO A;  3RVC A;  4XH5 A;  2IVP A;  2PAV A;  3H08 A;  2WTU A;  1RNH A;  4LFC K;  4NO7 A;  1IKX A;  3EKU A;  4DV1 K;  2QWN A;  4CJR A;  3SAG A;  3CFP A;  4IOC L;  3SNN A;  4JKG A;  3DM2 A;  4CHP A;  3CCR N;  3NGY A;  5HL7 L;  2OPP A;  4DR4 K;  4KB0 A;  1CZB A;  4KH4 A;  5FDL A;  1NU0 A;  3KK2 A;  1N33 K;  1QQC A;  4DV7 K;  4CZM A;  4JKB A;  3OVN A;  1OH8 A;  3OYE A;  3DXM A;  3ID8 A;  4CHQ A;  4OKJ A;  1OH7 A;  4IFV A;  2G8H A;  5HRR A;  1C0T A;  3OHR A;  5KTQ A;  4OLB A;  2WON A;  5LL6 Z;  4B9M A;  1S1U A;  1B92 A;  4LSL A;  1VRU A;  2E20 A;  5EVZ A;  1ILY A;  3L2Q A;  3NDK A;  4OPK A;  1NK7 A;  3ZEU B;  2NRH A;  1KTQ A;  4CZE A;  3WNF A;  4RW6 A;  5AQI A;  1NK9 A;  1G99 A;  3DLH A;  1RDB A;  2E8A A;  1KQS M;  1QQN A;  2P9U B;  2IC3 A;  4CHZ A;  4BC3 A;  2NRW A;  5TKY A;  1YJW N;  4H5T A;  1HNW K;  4FWP A;  1IBK K;  1S3X A;  1ZBS A;  3SQ1 A;  1BGX T;  3F5T A;  1GLD G;  2F4V K;  4I7F A;  2IVN A;  2QTD A;  2UXB K;  2ASP A;  4LF9 K;  1LWE A;  1ASW A;  4Z4H A;  2VGN A;  1YJ9 N;  4NB4 A;  1RIL A;  3VET A;  2G8V A;  5ADX A;  2HHV A;  1Q7Y O;  4W5R A;  2VQE K;  3ZSZ A;  3O4Q A;  3S3O A;  1XC9 A;  2A1S A;  2ITG A;  3ZX0 A;  3NGI A;  4M7Y A;  1IJJ A;  1KFS A;  3NH0 A;  3L4I A;  1ITG A;  4DFM A;  3J7Z O;  1U2V B;  5LJW A;  1RCH A;  4JV5 K;  2E4L A;  4C8N A;  5KGX A;  5I9E B;  3LDL A;  4FOI A;  4QS7 A;  4UY8 O;  2UXC K;  4FJN A;  4PY5 A;  1SKS A;  3QIP A;  1RT5 A;  1LWC A;  3CM6 A;  1MWM A;  3JYT A;  3ZT4 A;  1RBR A;  4A5A A;  5A2Q O;  1RTI A;  3I0R A;  4M3U A;  4DS5 A;  1RTH A;  3OJS A;  2QM1 A;  4Q5V A;  1YHQ N;  3F73 A;  4CD3 A;  1JLB A;  2ASM A;  4DSE A;  2OZM A;  4N76 A;  4K42 A;  4I2P A;  3M8Q A;  3TI0 A;  3UKU A;  2YHX A;  3ZEU A;  4E89 A;  4BRP A;  3RR8 A;  1TL1 A;  3AVG A;  5TKW A;  4RW9 A;  3KZB A;  1IKY A;  2QI2 A;  3NMU A;  4B1V A;  2CGK A;  5AQY A;  4BG8 A;  5AQV A;  1TKT A;  2P9U A;  3LDS A;  3E9O A;  1RDD A;  1J54 A;  1JKH A;  1NWK A;  4PUO A;  3K5L A;  1HLU A;  4FPA A;  2FC0 A;  4E3S A;  3H6E A;  1T44 A;  2P9K B;  5HBM A;  3AVK A;  3VES A;  3A0I X;  5C0Y A;  1HQU A;  1SQK A;  1NJZ A;  2ZD1 A;  3U9D A;  4DFK A;  1RBU A;  3FGU A;  3V9X A;  3OA9 A;  1VSL A;  3DMJ A;  4O5B A;  3ZSR A;  4CW7 B;  1J5O A;  4CJL A;  4B9T A;  4RG8 A;  3TSQ A;  1M90 O;  5AZJ A;  3CCS N;  4DB3 A;  2BDP A;  5J2Q A;  4NXN K;  4M3X A;  1S6Q A;  4ISG A;  1U2V A;  4BDP A;  4MDB A;  3LZJ A;  4FVU A;  4MDA A;  1CZA N;  1GLB G;  3SBG A;  2PZS A;  1BL3 A;  2I7P A;  4OKK A;  4H03 B;  4XH4 A;  4FJ7 A;  4NYF A;  3LAK A;  2Z1H A;  4M3R A;  1WN7 A;  2B5J A;  3VF6 A;  3ZSO A;  4FWM A;  1KD1 O;  5J1E A;  4W5O A;  1JCG A;  4DCH A;  2RHK A;  2X6N A;  1EWQ A;  4M45 A;  4JI6 K;  1NGA A;  1XI1 A;  4A57 A;  4UQG A;  4DR5 K;  1QQO A;  3VA0 A;  3B6P A;  4XH1 A;  1VSH A;  3UKR B;  4IJA A;  3OJU A;  4WCE L;  1M1K O;  3LDO A;  3FZM A;  4DSI A;  3HTV A;  3DOL A;  4DTN A;  2V7Y A;  5EXW A;  4LFA K;  4KHN A;  4IFE A;  5SZT A;  1BCO A;  1HYV A;  5LMU K;  3ENB A;  3E66 A;  1NGF A;  1MA9 B;  4GNI A;  1U48 A;  1QZ6 A;  1NOZ A;  4ILG B;  2P9K A;  3IDH A;  3TPQ A;  4PL7 A;  2UU9 K;  5HP1 A;  4B1Z A;  1BQN A;  1P8Z A;  1K73 O;  1TV6 A;  4CFC A;  1GLA G;  3EE9 A;  1YAG A;  4DQ8 A;  3NCI A;  2HHW A;  1RTD A;  3AAQ A;  3CJA A;  3HOS A;  5LJV A;  1KXP A;  4LF5 K;  2DFE A;  3VQB A;  1TKX A;  1BQM A;  1FXX A;  4CBU A;  4YNQ A;  4BE2 A;  3VGL A;  4DR2 K;  1W2B M;  4ELT A;  5KPR A;  4BRC A;  1W9H A;  5IWA K;  1NK5 A;  3O3H A;  2YKN A;  4E0D A;  1ZBH A;  5E84 A;  4C1N K;  4ISF A;  3AVA A;  4IG0 A;  1Q9X A;  1F21 A;  1S1V A;  3PIO L;  1FJG K;  2VG7 A;  3AVL A;  2YHB A;  1QSL A;  3KD1 E;  1Q8I A;  4JKC A;  1ATR A;  2P5O A;  4JI3 K;  3MED A;  5KGW A;  5F1X A;  5LMN K;  1Q18 A;  3VTH A;  4M42 A;  4JKA A;  3N4P A;  3M6G A;  4BQL A;  4DTX A;  3UKR A;  2G8I A;  3FFK B;  4OKE A;  4B8C A;  2JLE A;  1GOA A;  1L3U A;  4I2Q A;  3TR8 A;  1KVA A;  5FLX O;  5F2R A;  3BY5 A;  4KV8 A;  3M8P A;  1RGI A;  2QK9 A;  4BRO A;  3EN9 A;  2HHQ A;  3OBY A;  1RDW X;  1RBT A;  5AQG A;  4M3Y A;  2P51 A;  4BR4 A;  4FXD A;  3ZT3 A;  3WNG A;  1I3A A;  3WXI A;  3M5R A;  2OTJ N;  3T69 A;  3SAF A;  5C42 A;  3KD5 E;  4ILH A;  3S3M A;  4AM6 A;  3MN9 A;  3HOT A;  4C8O A;  4CF9 A;  3KVG A;  3VEO A;  2W40 A;  4DSJ A;  1RT1 A;  5AQJ A;  4H0Y B;  4NCA A;  3ASM A;  3G25 A;  1OVY A;  3O9Q A;  5BPL A;  4E7J A;  2HNY A;  1VQ7 N;  4PWD A;  3H3N O;  1TAU A;  3CCJ N;  3CCE N;  5BN9 A;  2YNF A;  1YUW A;  2YHA A;  1W97 L;  3TWH A;  4F3T A;  3OY9 A;  4FWQ A;  1KVC A;  4RW7 A;  3DXK B;  2GEM A;  1RDC A;  4FJH A;  1YF5 L;  3FZH A;  4Z94 A;  3QBX A;  4LC9 B;  4EP5 A;  1SKR A;  4BDY A;  5AQQ A;  3TAM A;  3VER A;  4FJM A;  3MWT A;  2ZGZ A;  4OGE A;  3F9K A;  3D0P A;  5AQL A;  3T19 A;  4CJ3 A;  4DLG A;  5SWM A;  3NH1 A;  1RT4 A;  4DU4 A;  4DWI A;  2F8S A;  3CME N;  2IGI A;  4C8L A;  3OYF A;  2P9S A;  1VSK A;  3PSI A;  4FWO A;  4CK3 A;  3ZET B;  4KHQ A;  1HKB A;  1NBW A;  4LF4 K;  4DTO A;  4DF8 A;  3BZK A;  4AHR A;  3CJC A;  4B1U B;  4BRF A;  2ZQB A;  2A5X A;  1S9G A;  1NGH A;  3KWG A;  2Q1N A;  5AZI B;  2BGG A;  4EHU A;  3HST B;  1SAZ A;  3EE8 A;  3OYB A;  5J2M A;  3CG7 A;  2YV0 X;  4F2R A;  2VWJ A;  4I6M B;  2YCH A;  4R5P A;  1JXE A;  4W5N A;  4BRN A;  4CF1 A;  4BAC A;  5JIC A;  1T6C A;  2O8D B;  3D2E B;  4JRP A;  3T7Z A;  4EP4 A;  3ZSX A;  4CEQ A;  1EXQ A;  3N4Q A;  3VF4 A;  2WFB A;  5FPM A;  3KLG A;  1VK0 A;  1TAQ A;  3WXL A;  2JWL A;  4GMJ B;  4CEZ A;  3AO1 A;  3BF1 A;  1X9M A;  2X6S A;  3CXC M;  3R1X A;  1BA1 A;  2A40 A;  4JKH A;  5AR0 A;  3QER A;  4CIE A;  3ZT2 A;  2RN2 A;  4JKD A;  1RTJ A;  2HW3 A;  5BR9 A;  3RR7 A;  4XEI A;  4JYA K;  3SUO A;  3HZ6 A;  3CJ7 A;  2D0B A;  3C6U A;  4HCC A;  2AP1 A;  3RMA A;  3CC7 N;  3SLC A;  3CFO A;  3CM5 A;  3L8B A;  2FSN A;  2JGU A;  5AQP A;  4CJE A;  3VQQ A;  3DXK A;  4WF9 L;  3SUN A;  2BTF A;  4XIU A;  1A5X A;  4M41 A;  3OYD A;  3W0L A;  1HNZ K;  2KFN A;  4B1X B;  4OVL A;  1KAX A;  2O4G A;  2KLA A;  1VQ8 N;  3WNH A;  4R79 A;  4OGC A;  4YOX A;  1TYQ B;  3GG4 A;  3TSP A;  2KW4 A;  2E2N A;  4DR7 K;  4BR5 A;  1T05 A;  5AQZ A;  3LP2 A;  3VQ8 A;  2D5R A;  5GIO A;  4BWM A;  1BCM A;  4JI8 K;  3ZET A;  2VWB A;  1SKW A;  3PLA A;  3L2U A;  1U47 A;  3QES A;  1QQM A;  5AZI A;  4FJJ A;  1E3M A;  2NRT A;  4DTM A;  3G0Z A;  1R59 O;  3TAP A;  1NGD A;  4X65 K;  1NMN A;  1HX1 A;  2WC9 A;  4I6M A;  1Y64 A;  1TUY A;  4Y1D A;  5JS1 A;  4CF0 A;  2VCP A;  4ILJ A;  3D2E A;  2O8D A;  4CEC A;  1JLE A;  4C1N I;  1CZ9 A;  4X62 K;  1WLJ A;  3O1B A;  4FJG A;  4CZI A;  4CIG A;  4AM7 A;  4DQR A;  2FLO A;  1TKD A;  4YOR A;  3F9M A;  1ASV A;  3LWL A;  1LV5 A;  3RMC A;  2YNH A;  1LAW A;  2HBJ A;  4ICL A;  1JXB A;  1W0H A;  4DUZ K;  4ZHR A;  5FPE A;  4FJL A;  3ULE A;  3CJ9 A;  5KRT A;  2ZF5 O;  1J6Z A;  3LP3 A;  3S9H A;  4CJQ A;  4DF4 A;  4KI4 A;  4CZJ A;  3SMP A;  3DAW A;  3RSE A;  4JHD B;  3CCM N;  4IOA L;  4E1J A;  1ZXO A;  2XHB A;  3K5M A;  1RDU A;  1LOT B;  3BEX A;  1RT6 A;  4CF2 A;  1VSM A;  1IBM K;  3O9T A;  2CH5 A;  2Z1G A;  3TAE A;  4WQ4 A;  2E1Y A;  1UA0 A;  4BE0 A;  4F2S A;  3LAL A;  3KLH A;  3AVI A;  4K41 A;  1Y97 A;  1BWF O;  1LWF A;  1TYQ A;  4FLZ A;  2XO7 A;  1C1C A;  1JLQ A;  4I9L A;  4FLX A;  3EY1 A;  2KHO A;  4DKW A;  4W5T A;  2YI1 A;  3GL1 A;  3BF3 A;  4O55 A;  3CHW A;  1KAY A;  1BHL A;  3A5M C;  1U4B A;  3BGR A;  3L2W A;  2HBL A;  4QCL A;  1NK6 A;  3ENO A;  3ZYY X;  3VQ9 A;  5GAG P;  3WXM B;  4H0T B;  1I94 K;  3SPZ A;  1JLF A;  2HMI A;  2DFF A;  2QWP A;  5AQX A;  2VYP A;  4BR0 A;  2X74 A;  4X66 K;  3KK1 A;  2ZWH A;  2HHU A;  3L0Q A;  4BC2 A;  4BR2 A;  1NNE A;  2B6A A;  3MXJ A;  3ZCM A;  4YOW A;  4KRF A;  5CY4 A;  1S22 A;  3U3G A;  3OYI A;  4FOE A;  4KHU A;  3AVM A;  1D9D A;  3VF2 A;  3SYZ A;  4M3Z A;  5AJ3 K;  1SL2 A;  4CGG A;  1NK8 A;  3TU5 A;  3VEZ A;  4CJU A;  1N5Y A;  3O80 A;  4WFB L;  1WAF A;  1FKP A;  3VQ5 A;  5C12 A;  1YTU A;  1A5W A;  3H1Q A;  4Z4G A;  4YHH K;  3L4Q A;  3HP9 A;  4B3T K;  1J53 A;  1LW2 A;  3V81 A;  3OYA A;  4GY2 B;  2GWJ A;  3EEQ A;  4N5S A;  3I56 N;  4KTZ A;  3D45 A;  4JHD A;  4DTS A;  1UOC A;  4I9Q A;  2IVO A;  3HXM A;  4ZTF A;  4ID1 A;  3NVK A;  3SQ2 A;  3AA5 X;  3ZT1 A;  1X9S A;  5CZ1 A;  2FBX A;  4YOT A;  1X9J A;  3K9K A;  3VQE A;  1NM1 A;  4CHY A;  3ID6 A;  2O8B B;  4FWR A;  2YNG A;  1D4X A;  3P31 A;  1QS4 A;  5HOO A;  4LFB K;  1WNS A;  4CGJ A;  3K59 A;  4BRM A;  1WBB A;  3EYZ A;  2XY7 A;  4CBX A;  1NKC A;  3I55 N;  3CCU N;  4CIF A;  2HHT A;  1XMQ K;  4KHY A;  1RT2 A;  2GV9 A;  3MAQ A;  1XMO K;  1LAV A;  3VEW A;  4AQY K;  1RFQ A;  1CXQ A;  4DFP A;  3WXJ A;  4Z4E A;  4K0K K;  3O4N A;  4CZL A;  3HL8 A;  3KLE A;  3EO3 A;  1YVU A;  4PL8 A;  3NF9 A;  3SQ4 A;  1IV0 A;  1C0G A;  3LWM A;  4QOZ B;  1IG9 A;  3ATU A;  4BC4 A;  3VA3 A;  1NOY A;  2QWL A;  2W41 A;  3ULD A;  3A2F A;  4HUF A;  3RTV A;  3AO3 A;  4YY3 K;  5AQM A;  4HWI A;  3I33 A;  1K8A O;  4IO8 A;  2Q0U A;  3TAN A;  3W3D A;  4CZH A;  5KI6 A;  2W42 A;  4WFN L;  3VTI A;  1VSI A;  4DS4 A;  4JI1 K;  4NYN A;  4CFA A;  1NKB A;  1VSD A;  1NGJ A;  1HMV A;  4H5W A;  4JI0 K;  3GDQ A;  3FR0 A;  3RRG A;  2DY4 A;  4IEI A;  5KRS A;  4YOV A;  4AHU A;  4CZF A;  3O1W A;  3HP6 A;  1EET A;  3VGM A;  4B9L A;  5M1N A;  1JLG A;  3AV9 A;  4MQ3 A;  2CGJ A;  3EL2 A;  4JAX A;  4LY7 A;  2O8B A;  3LP1 A;  4YDU A;  4DU1 A;  1L3S A;  2OPS A;  3NF7 A;  2VG5 A;  2FF3 B;  3A8Y A;  1JL2 A;  3DRS A;  1S72 N;  4NLB A;  3MDQ A;  1BIU A;  3CQY A;  4Z4C A;  4BQZ A;  2KZM A;  4EZ6 A;  4WQ4 C;  3KLI A;  5AQU A;  4FLV A;  4V19 S;  4CJ4 A;  3WT0 A;  4BE1 A;  3P38 A;  2PYJ A;  1WUA A;  3HT3 A;  3TSU A;  1XUP O;  1HNV A;  2YNI A;  3ZSV A;  3B6O A;  1NKE A;  3KIO A;  1WSI A;  1HJR A;  5BRD A;  4PHT X;  1NJI O;  3HK2 A;  3EZW A;  3QEI A;  3OYJ A;  5FRO A;  1X9W A;  4HCB A;  1HJO A;  1UAX A;  4CK2 A;  4LH5 A;  3R3L A;  3MWP A;  3RMB A;  4DHY A;  4FJX A;  2QKK A;  4DSF A;  3J81 O;  1HPZ A;  3OS0 A;  3VQ7 A;  2HMP A;  3LDN A;  5JVH L;  3NF8 A;  4CZK A;  4F3O A;  4IBN A;  4YOU A;  3QET A;  2LSN A;  1VSE A;  2NNW A;  1KSP A;  3OYM A;  3CJ1 A;  2E5L K;  3CCQ N;  1JLC A;  5AQS A;  3K5N A;  3SPY A;  1S1X A;  5FPN A;  1K6Y A;  3H45 C;  4DQQ A;  4MO5 A;  3NFA A;  1B9F A;  4DR6 K;  1C0M A;  3AVB A;  1MU2 A;  1TUU A;  1KLN A;  2PYL A;  3WNE A;  4CI6 A;  4B9V A;  3DLE A;  3H1V X;  1D9F A;  4BRQ A;  4ID5 A;  4OJR A;  2AJQ A;  3VQ6 A;  1QZ5 A;  1C6V A;  4BRI A;  3SAH A;  1YI2 N;  4GVE A;  3V9Z A;  4KRE A;  4B9N A;  2YX6 A;  1KFD A;  4IEE A;  4FWN A;  5FPD A;  4U7B A;  4O0J A;  3QEX A;  3WXK A;  3AVC A;  3ZT0 A;  1T03 A;  1N32 K;  3HBT A;  1IBL K;  4NCB A;  1HRH A;  3JXU A;  5HRP A;  3WQU A;  1VQK N;  1ATN A;  2GUP A;  4BRG A;  5GAH P;  4ELU A;  2NRR A;  4DTU A;  3TTD A;  2QW9 A;  2UYT A;  3E9L A;  4N56 A;  4JI5 K;  2IAJ A;  3BP8 A;  2QWM A;  1TVR A;  2NLX A;  3O08 A;  1JLA A;  2O8F B;  4DFJ A;  3G4S N;  2J4R A;  3I8D A;  4KAZ A;  1KC8 O;  3DRR A;  3F2K A;  3IMX A;  4KH6 A;  4FW2 A;  2QWO A;  4BGA A;  2ZGY A;  2FBV A;  3A5O C;  3O3F A;  4GV6 A;  3FZF A;  4B9S A;  3MX2 A;  2VQF K;  1WSJ A;  2OA8 A;  3AVH A;  1SL0 A;  1DTQ A;  5KPT A;  4CEB A;  4B1W B;  2P9L B;  2V51 B;  4JKE A;  4Y0W A;  3M8S A;  3M1F A;  5CR4 A;  2HB5 A;  3LPT A;  3D6R A;  1S1T A;  3AY9 A;  4DUY K;  4AHS A;  4IDK A;  3K58 A;  3AVF A;  4FK0 A;  3FE1 A;  3O4W A;  5AFU A;  1NGE A;  3HPH A;  3L2R A;  4ZTJ A;  2OAN A;  1HYZ A;  3S3N A;  3TTF A;  4GV9 A;  3QFP A;  2F8T A;  1FKO A;  5CYQ A;  1RT7 A;  2A1R A;  3AO2 A;  1OH5 A;  3QLH A;  3ZLJ A;  4YDU C;  4CGD A;  2ETJ A;  2O8E B;  1O13 A;  2UUC K;  2BUP A;  3LZI A;  4M3T A;  1J9A A;  4GVM A;  5DM6 L;  4O5F A;  3U9Z A;  4RTF D;  1Q82 O;  4FJI A;  3CMA N;  5DMR A;  1WSE A;  4FWK A;  3CF5 L;  3TAF A;  3MXM A;  4DU3 A;  1Z05 A;  3KLF A;  1K8K B;  2WBN A;  4J8F A;  4FJ5 A;  4L3Q A;  2RE2 A;  1LCU A;  3HJF A;  2O8F A;  3BUZ B;  1REV A;  3T1H K;  4FJ9 A;  1NGG A;  5I3U A;  3V1Q A;  1RDA A;  3R6M A;  4DV0 K;  3BZC A;  4J2B A;  2XRI A;  5CYM A;  2YJE A;  1XC3 A;  4AF1 A;  1XNQ K;  4IKF A;  3V9U A;  2P9L A;  2G8U A;  4CJ7 A;  1LW0 A;  4KB1 A;  2GUI A;  3MCP A;  3P83 D;  4CJF A;  1CXU A;  3HO1 A;  2E2O A;  2ZJP L;  1C0U A;  1WSH A;  4FSV A;  1BU6 O;  1X3N A;  3FZK A;  4O8K A;  5I42 A;  3A5L C;  1SS6 A;  4FM0 A;  3O8M A;  3TAQ A;  2GEL A;  1X1P A;  2D0P A;  3RWU A;  2D4W A;  3IUC A;  2DPN A;  3HSC A;  3ATV A;  5C24 A;  2HOE A;  3V1R A;  3O3G A;  3IAY A;  2E6M A;  4E1N A;  2O8C B;  3C6T A;  1WSF A;  5C2D A;  3DWL A;  3D7E O;  1V4T A;  4GKJ K;  3QIC A;  4B08 A;  1ZC6 A;  1N34 K;  3C95 A;  1VAZ A;  4DQP A;  4E7I A;  2UUA K;  4JD2 B;  4CEO A;  2O8E A;  1WB9 A;  1U04 A;  4DSK A;  1U45 A;  4HUG A;  1RBV A;  3IRX A;  4CBW A;  1ZBU A;  4AHT A;  2A3Z A;  3MEG A;  4OPA A;  3OW2 M;  4AH9 A;  3NAE A;  2Q3S A;  2QEX N;  3WUH A;  5BRE A;  5M1F A;  5KQ8 A;  4FW1 A;  3QEP A;  4AHV A;  5JLF A;  2QWQ A;  4K8X A;  1L3V A;  4GKK K;  3T1Y K;  1K8K A;  4H5N A;  4ELV A;  5AQF A;  4WE1 A;  3K5O A;  4H5V A;  1DTT A;  2RPI A;  1BI4 B;  2Z1J A;  2X78 A;  4B3S K;  4WFA L;  2F96 A;  2P1J A;  2OZS A;  4FLY A;  1N6Q A;  2F9W A;  4A59 A;  3QNO A;  3FFI A;  4FPB A;  4JS4 A;  1XQS C;  2KTQ A;  4OPH A;  4CF8 A;  3DLG A;  4CGH A;  1XHX A;  3QML A;  3WEE B;  3THX B;  4KTQ A;  2EWS A;  3CPW M;  1P90 A;  3O5B A;  3IFR A;  2OPQ A;  4FZY A;  1E4F T;  1R0A A;  1QHT A;  4CHN A;  1GOB A;  1NK0 A;  4E1M A;  1IO2 A;  2B4J A;  1DEJ A;  2ATQ A;  2YHY A;  1VQ9 N;  1XNR K;  3IKM A;  4YOY A;  1JL1 A;  2FXU A;  3VOV A;  3DJC A;  4U67 L;  4WQ5 C;  4JLH A;  4DTR A;  4A2A A;  4J2D A;  4E7H A;  1IG8 A;  1HQE A;  5EOY A;  4K43 A;  1JJ2 M;  2W6L A;  4JD2 A;  3LP0 A;  4FLU A;  4X64 K;  4CJV A;  2DFH A;  3V9W A;  3KWI A;  3T3F A;  1D5A A;  2G8F A;  5DM7 L;  1TGO A;  4CER A;  4CEF A;  4MLH A;  4PKI A;  3OYK A;  2HVI A;  3UIQ A;  1VQN N;  1ESV A;  2KFZ A;  3P39 A;  1X3M A;  3V6D A;  3IS9 A;  2H3G X;  3R9P A;  3SV3 A;  1HR0 K;  3HM9 A;  4RCH A;  4CJW A;  5EY4 A;  4FWS A;  4CJT A;  4FK4 A;  3HRG A;  4BVO A;  1BI4 A;  1VQO N;  3C65 A;  2UXD K;  5BRH A;  4FK2 A;  4DTP A;  4Z0U A;  4MFB A;  3SJJ A;  2GWK A;  1KRP A;  3AGK A;  3ITH A;  4CCH A;  1QVF M;  1EWR A;  4CFB A;  3THX A;  3WEE A;  3SBT A;  1TKZ A;  4O4G A;  4CHO A;  2GX9 A;  3Q7B A;  2ZE2 A;  3KK7 A;  4BR7 A;  5M1K A;  4HVJ A;  3J8A A;  3LL3 A;  4PQU A;  5BR8 K;  5FRN A;  1WSG A;  1EQY A;  4KHW A;  1HPM A;  3DLK A;  3U6F A;  1L5U A;  1U49 A;  3AVN A;  1MWK A;  2XY8 A;  4FYD A;  1VQL N;  2QXF A;  1T3V A;  1S6P A;  3ZSY A;  3MN7 A;  1HNX K;  5BPM A;  2R7Y A;  3AAR A;  4F9O A;  3EZ5 A;  4IZ9 A;  3K2P A;  2CGL A;  4BY9 C;  1Q9Y A;  4A2B A;  2P9N B;  4CED A;  4FM2 A;  4G1Q A;  2WOM A;  3CD6 N;  4CJP A;  4CVN E;  5AQT A;  1T8E A;  4HTU A;  3CQ8 A;  4LF6 K;  3CC4 N;  4AHC A;  3HPG A;  3QEW A;  4KHP K;  4KTW A;  3VQA A;  2VG6 A;  3UKU B;  4IOX A;  3H46 O;  2BAN A;  3GBT A;  2BE2 A;  5H1S Q;  4BWJ A;  3GE1 A;  4DMN A;  4A5B A;  2V52 B; 
#chains in the Genus database with same CATH homology
 1HPZ A;  4RW8 A;  1I39 A;  3OS0 A;  4F8R A;  3VQ7 A;  4E7J A;  1HNI A;  3QEV A;  3NF8 A;  2HNY A;  3MEC A;  1ASU A;  4PWD A;  4CJ5 A;  1TAU A;  3KK3 A;  3OYL A;  2YNF A;  4F3O A;  3AO5 A;  3DYA A;  3PUF A;  2YHA A;  3NH2 A;  2D0A A;  4IBN A;  4CEA A;  3TWH A;  2Y1I A;  4F3T A;  3QET A;  2LSN A;  1VSE A;  3C94 A;  3P1G A;  3OY9 A;  3OYM A;  1TK5 A;  1KSP A;  1C1A A;  1KVC A;  4RW7 A;  3VQ4 A;  3E01 A;  4FVM A;  1JLC A;  3PY8 A;  3K5N A;  3SPY A;  1RDC A;  4FJH A;  5FRM A;  4H4O A;  3HYF A;  1S1X A;  3PX6 A;  3LAM A;  4EP5 A;  3SUP A;  1SKR A;  1K6Y A;  3LPU A;  4BDY A;  5T7B A;  4DQQ A;  1FK9 A;  3NFA A;  1B9F A;  3TAM A;  4FJM A;  1UWB A;  3L3U A;  3D0P A;  4OGE A;  3F9K A;  1C0M A;  3T19 A;  4KFB A;  4CJ3 A;  3AVB A;  4DLG A;  1MU2 A;  5SWM A;  2VWK A;  2KQ2 A;  3NH1 A;  4CGI A;  5J2P A;  1KLN A;  2PYL A;  3HVR A;  1RT4 A;  3WNE A;  4DU4 A;  1QE1 A;  4DWI A;  2F8S A;  1XHZ A;  4KPY A;  2IGI A;  3PX0 A;  3DLE A;  1D9F A;  4B9V A;  4C8L A;  5HRS A;  3MXI A;  3OYF A;  3DLB A;  4ID5 A;  4OJR A;  3MEE A;  2AJQ A;  1VSK A;  3VQ6 A;  4J2E A;  4CK3 A;  1RBS A;  3KTQ A;  1C6V A;  3NE6 A;  4KHQ A;  4CFD A;  4DTO A;  4DF8 A;  3V9Z A;  4AHR A;  4B9N A;  1ZBI A;  4KRE A;  1KFD A;  2ZQB A;  3SUQ A;  3ZSQ A;  4H8K A;  2I5J A;  1DLO A;  1S9G A;  4EZ9 A;  4O0J A;  2BGG A;  3QEX A;  3HST B;  1EKE A;  3AVC A;  3KJV A;  4E7K A;  3ZT0 A;  1T03 A;  3OYB A;  5J2M A;  1A5V A;  3CG7 A;  3P5J A;  2YV0 X;  5J2N A;  4NCB A;  1S1W A;  2VWJ A;  4F2R A;  5D3G A;  2HHS A;  1HRH A;  4R5P A;  1Z26 A;  1JXE A;  5HRP A;  4CF1 A;  3KKR A;  4BAC A;  4W5N A;  1B9D A;  5EU7 A;  3OYC A;  3V4I A;  3U3Y A;  4JRP A;  1TK0 A;  4EP4 A;  4ELU A;  3ZSX A;  4FJ8 A;  4CEQ A;  1EXQ A;  4DTU A;  3K57 A;  3QIO A;  4N56 A;  2IAJ A;  2RF2 A;  3KLG A;  1VK0 A;  1TAQ A;  4GMJ B;  4CEZ A;  3KKS A;  3H08 A;  4CJK A;  1TVR A;  3AO1 A;  1X9M A;  1RNH A;  2X6S A;  4JS5 A;  4E7L A;  4C8K A;  1JLA A;  4DFJ A;  3QER A;  4E19 A;  3PX4 A;  3I8D A;  4KAZ A;  4CIE A;  3SCX A;  1IKX A;  3ZT2 A;  2RN2 A;  3DRR A;  4CJR A;  3G10 A;  1RTJ A;  3CFP A;  3SNN A;  2HW3 A;  4FW2 A;  3RR7 A;  2FBV A;  3O3F A;  3DM2 A;  4CHP A;  2QKB A;  3NGY A;  4F4K A;  4B3O A;  3SUO A;  2OPP A;  5K14 A;  4KB0 A;  4B9S A;  3NGZ A;  2D0B A;  1CZB A;  3C6U A;  1WSJ A;  5FDL A;  3KK2 A;  3RMA A;  2OA8 A;  4HCC A;  3AVH A;  1QQC A;  1ZBF A;  2HHX A;  1SL0 A;  1DTQ A;  3OVN A;  3CFO A;  4CEB A;  3CM5 A;  3L8B A;  2JGU A;  4CJE A;  3OYE A;  4CHQ A;  4OKJ A;  3VQQ A;  3M8S A;  2EHG A;  4IFV A;  2HB5 A;  3SUN A;  2G8H A;  3LPT A;  5HRR A;  2IDO A;  1C0T A;  1IKV A;  2HND A;  5KTQ A;  4OLB A;  2WON A;  4XIU A;  1A5X A;  1S1T A;  4M41 A;  3OYD A;  4B9M A;  1QTM A;  4AHS A;  1S1U A;  3LAN A;  2KFN A;  1B92 A;  1WAJ A;  4LSL A;  1TK8 A;  4OVL A;  1VRU A;  2O4G A;  4IDK A;  2Y1J A;  3K58 A;  3AVF A;  4FK0 A;  3WNH A;  4OGC A;  3L2Q A;  3HPH A;  3L2R A;  3NDK A;  4OPK A;  3TAR A;  4ZTJ A;  1NK7 A;  4KTQ A;  2KW4 A;  3DOK A;  1HYZ A;  3S3N A;  1T05 A;  3LP2 A;  1KTQ A;  3HPO A;  3WNF A;  3VQ8 A;  2D5R A;  4RW6 A;  1NJY A;  4BWM A;  4FLT A;  1FKO A;  1NK9 A;  1BCM A;  1RDB A;  5CYQ A;  1RT7 A;  3OYN A;  3AO2 A;  5DK5 A;  2A1R A;  3DLH A;  3ISN C;  3QLH A;  3QNN A;  2IC3 A;  4CHZ A;  1SKW A;  3L2U A;  1U47 A;  3QES A;  4CGD A;  4H4M A;  3TAG A;  2ETJ A;  4FJJ A;  4KI6 A;  3JSM A;  1S9E A;  3LZI A;  3G0Z A;  1J9A A;  4DTM A;  3TAP A;  4M3T A;  4GVM A;  3SQ1 A;  4FZX C;  1BGX T;  4Y1D A;  5JS1 A;  4FLW A;  4FJI A;  4CF0 A;  4I7F A;  3SV4 A;  4CEC A;  1JLE A;  3DLR A;  5DMR A;  1CZ9 A;  1WSE A;  3TAF A;  3MXM A;  4KHS A;  1LWE A;  1WLJ A;  4DU3 A;  2F8T A;  1ASW A;  4Z4H A;  4FJG A;  4CIG A;  4DQR A;  3KLF A;  4FJ5 A;  1RIL A;  1TKD A;  2G8V A;  3HJF A;  2HHV A;  4W5R A;  3ZSZ A;  3O4Q A;  3S3O A;  1XC9 A;  2A1S A;  1ASV A;  2ITG A;  3NGI A;  3LWL A;  1LV5 A;  1REV A;  4FJ9 A;  3RMC A;  2YNH A;  1LAW A;  1KFS A;  4ICL A;  3SZ2 A;  1JXB A;  3AA4 A;  3NH0 A;  5I3U A;  3V1Q A;  4Z4F A;  1ITG A;  1W0H A;  4DFM A;  1RDA A;  1RCH A;  4ZHR A;  2E4L A;  4DTJ A;  4C8N A;  3HVT A;  4FJL A;  4J2B A;  2XRI A;  5CYM A;  5KGX A;  1GOC A;  1ZBL A;  2PY5 A;  1BIZ A;  5KRT A;  3S9H A;  3LP3 A;  4CJQ A;  4FJN A;  3PO5 A;  4DF4 A;  3V9U A;  4IKF A;  1SKS A;  2G8U A;  4PY5 A;  3QIP A;  1LW0 A;  4KI4 A;  1YT3 A;  4KB1 A;  1RT5 A;  1LWC A;  2GUI A;  3P83 D;  3CM6 A;  4CJF A;  1CXU A;  3DRP A;  3HO1 A;  3BDP A;  3JYT A;  2XHB A;  1CLQ A;  3ZT4 A;  3K5M A;  1C0U A;  3ALY A;  1WSH A;  1RBR A;  2KZZ A;  1RT6 A;  4CF2 A;  1RTI A;  1VSM A;  5I42 A;  3I0R A;  4FM0 A;  2OYQ A;  3TAQ A;  4FZZ A;  2Z1G A;  1X1P A;  3TAE A;  4M3U A;  1UA0 A;  4BE0 A;  4DS5 A;  1RTH A;  3OJS A;  3LAL A;  1KCF A;  4Q5V A;  3KLH A;  4F2S A;  3AVI A;  1Y97 A;  3F73 A;  1JLB A;  3RWU A;  1LWF A;  4DSE A;  2OZM A;  4FLZ A;  5C24 A;  4N76 A;  2D0C A;  1C1C A;  1JLQ A;  3M8Q A;  4I2P A;  4I9L A;  3V1R A;  3O3G A;  2XO7 A;  3TI0 A;  4FLX A;  2E6M A;  3EY1 A;  3IAY A;  3QO9 A;  4E1N A;  4PA1 A;  4E89 A;  3RR8 A;  1SL1 A;  3C6T A;  1TL1 A;  1WSF A;  4QAG A;  3AVG A;  4RW9 A;  4W5T A;  4HUE A;  4O55 A;  1IKY A;  1XWL A;  4B08 A;  4CJS A;  1BHL A;  1TKT A;  4CES A;  1U4B A;  3C95 A;  4N47 A;  3LDS A;  3TAB A;  2FBT A;  4DQP A;  3BGR A;  4DG1 A;  4E7I A;  2YKM A;  4CEO A;  3L2W A;  4QCL A;  1RDD A;  1NK6 A;  1J54 A;  1U04 A;  1JKH A;  5JS2 A;  4DSK A;  1U45 A;  3VQ9 A;  4HUG A;  1RBV A;  3IRX A;  4PUO A;  3K5L A;  1ZBU A;  3SPZ A;  4AHT A;  3MEG A;  1JLF A;  2HMI A;  2DFF A;  2FC0 A;  4AH9 A;  4E3S A;  4O44 A;  1TL3 A;  2IS3 A;  1EP4 A;  2Q3S A;  3NAE A;  3RRH A;  4FJK A;  5HBM A;  2X74 A;  3AVK A;  3KK1 A;  5C25 A;  3OYG A;  1IKW A;  2HHU A;  1HQU A;  4FW1 A;  3QEP A;  4AHV A;  2B6A A;  3MXJ A;  3ZCM A;  4KRF A;  5CY4 A;  1S5J A;  2ZD1 A;  4DFK A;  1NJZ A;  1RBU A;  3V9X A;  1L3V A;  4K8X A;  3U3G A;  3OYI A;  1VSL A;  4KO0 A;  4HHT A;  4KHU A;  3AVM A;  1G15 A;  3DMJ A;  3V9S A;  1D9D A;  3SYZ A;  4ELV A;  4O5B A;  4M3Z A;  3ZSR A;  1J5O A;  3M8R A;  4WE1 A;  1SL2 A;  4CJL A;  3VQP A;  3K5O A;  1DTT A;  2RPI A;  4RG8 A;  1BI4 B;  2XY5 A;  2Z1J A;  4CGG A;  4B9T A;  1NK8 A;  2X78 A;  4CJU A;  2F96 A;  2P1J A;  5J2Q A;  4FLY A;  1N6Q A;  2BDP A;  2OZS A;  1N5Y A;  4M3X A;  1S6Q A;  3QNO A;  3FFI A;  4OLA A;  1WAF A;  1FKP A;  4DQS A;  4JS4 A;  4BDP A;  3LZJ A;  3VQ5 A;  4DQI A;  2KTQ A;  1YTU A;  1A5W A;  4GW6 A;  4FM1 A;  4Z4G A;  4CF8 A;  3DLG A;  4CGH A;  1XHX A;  3HP9 A;  4DLE A;  1J53 A;  1LW2 A;  3VQC A;  2PZS A;  4B9U A;  1BL3 A;  1EX4 A;  4OKK A;  3V81 A;  3OYA A;  4FJ7 A;  3L3V A;  3LAK A;  2Z1H A;  2FBY A;  4NYF A;  4M3R A;  1WN7 A;  4N5S A;  4N41 A;  2B5J A;  4KTZ A;  3D45 A;  3ZSO A;  2OPQ A;  5J1E A;  4FZY A;  4DTS A;  4W5O A;  4Z4I A;  1UOC A;  4I9Q A;  3HXM A;  4ZTF A;  1R0A A;  4ID1 A;  1QHT A;  3SQ2 A;  3AA5 X;  3ZT1 A;  3PV8 A;  3THV A;  2X6N A;  4CK1 A;  4CHN A;  1X9S A;  3L2V A;  5CZ1 A;  1GOB A;  2FBX A;  5HRN A;  4M45 A;  3NHG A;  1KLM A;  1NK0 A;  3VQE A;  5HLF A;  4CHY A;  1XI1 A;  4NCG A;  1HYS A;  2YNG A;  1D8Y A;  4E1M A;  4UQG A;  1IO2 A;  4W5Q A;  1QS4 A;  2B4J A;  4YFU A;  1SUQ A;  2ATQ A;  2HVH A;  3AA3 A;  3VA0 A;  2P5G A;  3B6P A;  4K8Z A;  1VSH A;  3AVJ A;  1WNS A;  4Y1C A;  1QSY A;  2G8W A;  4M3W A;  1JL1 A;  3OJU A;  4CGJ A;  3K59 A;  3EYZ A;  2XY7 A;  1NKC A;  3RMD A;  4DSI A;  3DOL A;  1RT3 A;  4JLH A;  4DTR A;  4DTN A;  4J2D A;  4CIF A;  4E7H A;  2HHT A;  3T1A A;  4O0I A;  4AIL C;  3I0S A;  3QIN A;  4LD0 A;  1VSJ A;  4B8A B;  4KHY A;  3CFR A;  4KHN A;  1HQE A;  4L8R B;  1RT2 A;  2GV9 A;  3LP0 A;  5SZT A;  4FLU A;  1BCO A;  1HYV A;  3MAQ A;  3CYM A;  3VN5 A;  4CJV A;  2DFH A;  3V9W A;  3T3F A;  4J2A A;  1D5A A;  2G8F A;  1LAV A;  5CZ2 A;  4IFY A;  3OS1 A;  4FCY A;  1CXQ A;  4DFP A;  1TGO A;  4Z4E A;  4CER A;  1U48 A;  1NJW A;  4CEF A;  1NOZ A;  1C1B A;  3O4N A;  3HL8 A;  3KLE A;  3OYK A;  5HP1 A;  2HVI A;  3UIQ A;  3SI6 A;  1BQN A;  1YVU A;  1TV6 A;  4CFC A;  3NF9 A;  4OPJ A;  3SQ4 A;  1UA1 A;  4TSX A;  2KFZ A;  3LWM A;  4RW4 A;  4QOZ B;  1IG9 A;  2NUB A;  3NCI A;  2HHW A;  1RTD A;  1T7P A;  3VA3 A;  3V6D A;  1NOY A;  3IS9 A;  1Z25 A;  3SV3 A;  3HM9 A;  3SQ0 A;  3ULD A;  4CJW A;  2DFE A;  3AA2 A;  2Z1I A;  4KKO A;  3A2F A;  4CEE A;  4HUF A;  4CJT A;  4FK4 A;  2HNZ A;  3VQB A;  1BI4 A;  1BQM A;  1FXX A;  1TKX A;  3AO3 A;  4YNQ A;  3RTV A;  4FK2 A;  4CGF A;  4BE2 A;  4DTP A;  4Z0U A;  4MFB A;  4ELT A;  3SJJ A;  3TAN A;  1KRP A;  1W9H A;  3ITH A;  4CCH A;  5KI6 A;  2W42 A;  1NK5 A;  1VSI A;  3O3H A;  4DS4 A;  4NYN A;  4CFA A;  2YKN A;  1NKB A;  4E0D A;  1ZBH A;  1VSD A;  3AO4 A;  4CFB A;  1HMV A;  3NF6 A;  2E6L A;  3AVA A;  4IG0 A;  1Q9X A;  1TKZ A;  1F21 A;  1S1V A;  4O4G A;  4CHO A;  3IG1 A;  3RRG A;  4LSN A;  1VRT A;  4C8M A;  2VG7 A;  3AVL A;  1NJX A;  2YHB A;  2DY4 A;  2ZE2 A;  1QSL A;  3KD1 E;  5KRS A;  3OS2 A;  1Q8I A;  4HVJ A;  2P5O A;  4AHU A;  2XY6 A;  1QSS A;  4BDZ A;  3MED A;  4PQU A;  5FRN A;  3HP6 A;  1EET A;  4B9L A;  5KGW A;  4LH4 A;  1WSG A;  1JLG A;  4KHW A;  3AV9 A;  4MQ3 A;  2RKI A;  3DLK A;  3U6F A;  4M42 A;  4LY7 A;  2OPR A;  3ZSW A;  1U49 A;  3LP1 A;  1L5U A;  2EX3 A;  2GBZ A;  3VQD A;  4DU1 A;  2OPS A;  3AVN A;  2XY8 A;  1L3S A;  4FYD A;  3NF7 A;  2G8K A;  2VG5 A;  2O4I A;  1JL2 A;  4IG3 A;  3DRS A;  3V1O A;  2QXF A;  1S6P A;  3ZSY A;  4DTX A;  2G8I A;  4OKE A;  4B8C A;  2R7Y A;  1BIU A;  2JLE A;  1GOA A;  1L3U A;  1SV5 A;  4Z4C A;  4I2Q A;  3TR8 A;  3EZ5 A;  1KVA A;  3DI6 A;  2KZM A;  3K2P A;  4EZ6 A;  1Q9Y A;  4KV8 A;  3KLI A;  1BIS A;  3M8P A;  1YTA A;  4CED A;  4FM2 A;  4Q0B A;  4G1Q A;  2WOM A;  2QK9 A;  2HHQ A;  4FLV A;  4CJP A;  4JRQ A;  1RBT A;  4CJ4 A;  4M3Y A;  1T8E A;  3OYH A;  4BE1 A;  2P51 A;  4HTU A;  4FXD A;  2PYJ A;  3ZT3 A;  3WNG A;  3HT3 A;  3CQ8 A;  1L3T A;  1HNV A;  1I3A A;  2YNI A;  3ZSV A;  3PO4 A;  2DTU A;  3B6O A;  1NKE A;  1IH7 A;  5E41 A;  3KIO A;  1WSI A;  3KD5 E;  5C42 A;  1HJR A;  4AHC A;  3S3M A;  4DSL A;  3HPG A;  3QEW A;  3HK2 A;  2IOC A;  4KTW A;  3VQA A;  4C8O A;  4CE9 A;  1O1W A;  2VG6 A;  4CF9 A;  3QEI A;  3OYJ A;  5FRO A;  1X9W A;  2BAN A;  4DSJ A;  1RT1 A;  1NK4 A;  4HCB A;  1UAX A;  4CK2 A;  1KVB A;  2BE2 A;  4LH5 A;  5HRO A;  4NCA A;  3ASM A;  3RMB A;  1ZYQ A;  4BWJ A;  4FJX A;  2QKK A;  4DSF A;  4DMN A;  3NBP A;  1VSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...