3ZSOA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsoA00
4MQ3A 1ZYQA 3LAKA 3L2QA 5C25A 5HROA 4CJQA 4DQPA 3NF8A 4KRFA 1WNSA 3WNHA 3HM9A 3HL8A 3SV4A 2HB5A 2LSNA 4FJ5A 4FLXA 4CJTA 2FBYA 3VQ9A 3V1RA 3NE6A 3TWHA 4KB1A 1BL3A 3ZSZA 2ATQA 1GOBA 4G1QA 4GMJB 3VQ7A 1LV5A 3QNOA 4FZXC 4HHTA 1RBTA 2D5RA 3IRXA 1NJXA 4PUOA 1JLQA 1QS4A 3AVFA 3P83D 4MFBA 3SQ0A 1L5UA 2E6LA 4N76A 4DFPA 2G8VA 1T8EA 1L3VA 5HRNA 4IG0A 1W9HA 4C8NA 4DQQA 1FKPA 3VQ6A 2GV9A 3AO5A 4Z4CA 4DF8A 1TVRA 4AHRA 4DQRA 3SNNA 2HNYA 1HYSA 1RBRA 4CJ5A 4EP5A 1TK8A 2VWKA 3KKRA 4CJFA 5FRNA 4E7IA 4CEEA 3TAFA 3B6PA 5FROA 2RPIA 1BIUA 2IDOA 3ZSYA 4F8RA 3LPUA 4M3UA 5J2PA 3V4IA 3VQDA 3H08A 3TAGA 1VSJA 4BE1A 1TL1A 3DLHA 3ZSOA 2HW3A 1IH7A 1RNHA 1TV6A 3AVKA 1C1BA 3WNFA 2NUBA 3OJSA 3TI0A 2G8UA 3L3UA 2PYLA 4KHNA 1NK0A 4CGJA 3UIQA 3NBPA 4OKJA 4BE0A 1HYZA 3KTQA 4M3RA 4AILC 5HRSA 1VSEA 1IKWA 3F9KA 3K57A 1RDBA 3KLIA 4F3TA 4DLGA 2RF2A 4B9VA 3NGIA 4FJJA 3V9XA 1NK4A 4J2AA 1RTJA 2Z1HA 1WSJA 5CZ1A 3AV9A 4FJMA 2FC0A 4KB0A 4LSLA 2YNHA 3OYGA 4JRQA 4KI4A 2XRIA 4CEBA 4E89A 1NKCA 3RRHA 3RRGA 1JLEA 4M45A 4PY5A 1B9DA 1T03A 4B08A 3M8PA 1JLBA 3JSMA 1NK8A 5KTQA 3DLRA 4IFYA 3B6OA 4QCLA 4CK2A 3ZT4A 4KTZA 2X6SA 1WSEA 3AO4A 3KD5E 4KKOA 2A1RA 4F2SA 1N5YA 3DLBA 1RT7A 4CJWA 4KHUA 1ZBUA 1LAWA 4OKKA 3P1GA 1SKWA 1EX4A 3VN5A 1LAVA 3L2VA 1RBUA 4CGDA 1J53A 1VSHA 3LP3A 4B8CA 4B8AB 1QTMA 2KZZA 1NK5A 1ASUA 4CHOA 3PX6A 2D0CA 1S1UA 3IAYA 4H8KA 1U47A 3OYDA 1C0MA 1WSFA 4N5SA 4BDZA 4FJGA 2DY4A 1JL1A 3TR8A 5D3GA 1A5XA 5KI6A 3ZSWA 5HLFA 1JLCA 3HYFA 4O5BA 3U6FA 3TAPA 2F96A 3LP2A 1BHLA 2HVIA 3OYMA 4CHYA 5K14A 4TSXA 4GW6A 3OYFA 1BCMA 3ZSXA 3VQBA 3ZT0A 4RW9A 4CJUA 4DF4A 3THVA 1TK5A 2XO7A 4I2QA 3RR7A 2ZE2A 5J2QA 1BISA 3SUPA 4DU4A 1S1XA 4DSEA 3NDKA 4AHVA 4PQUA 1S6QA 1QHTA 4CK1A 1XC9A 4BE2A 1SKSA 1RT5A 4CFDA 3SCXA 3KK1A 4DFMA 3V9SA 3SI6A 4FYDA 4XIUA 2B6AA 4FLUA 1B9FA 4RW4A 4CEAA 1ZBHA 5I3UA 4IFVA 2R7YA 4IKFA 3DM2A 1JL2A 2KW4A 3O4QA 3DYAA 2IC3A 3SPZA 2ETJA 2FBTA 3NCIA 3OY9A 4E7LA 3V9WA 4NYNA 4OKEA 1MU2A 4OVLA 2G8KA 1EP4A 4NCGA 1XHXA 3HXMA 3P5JA 1D8YA 3NF9A 4W5RA 3VQCA 3V9UA 2DFFA 3RMDA 1KSPA 3QO9A 1ZBLA 1SL0A 4FW2A 4ZTJA 1EXQA 3ITHA 3SQ4A 4KAZA 3OYEA 3EZ5A 3HPGA 4KV8A 4HTUA 4DWIA 4CK3A 4KTWA 1ZBIA 4OLAA 4CJRA 4ELTA 2JGUA 3ISNC 4E0DA 4CJPA 3DLKA 4AHCA 4FJLA 4KI6A 4KHWA 5JS2A 5CY4A 4M3ZA 3T19A 3NH0A 4CGIA 1Z26A 3VA3A 2EX3A 2OPQA 4UQGA 4O0IA 3L8BA 2OYQA 1TKZA 3QINA 1HQUA 4M3TA 4FW1A 3AA4A 1YTUA 4E19A 4NCAA 4F2RA 4H4MA 3U3GA 1L3SA 4W5NA 4PWDA 1A5VA 4KHYA 4ZHRA 1SV5A 1BQNA 3AVJA 4FZZA 2DTUA 3QEVA 3I0SA 3NHGA 4AHSA 4E7JA 5J2MA 1Z25A 1C6VA 3S3OA 3L2RA 1T7PA 1RTDA 2PY5A 4I9LA 3JYTA 1DTQA 2XY5A 4Z4HA 1S5JA 3OYBA 4AHUA 1U04A 3MEEA 1WSGA 4WE1A 3QERA 1KLMA 3LAMA 3KLGA 3TANA 1SL1A 1UA1A 1U4BA 2HNDA 3AVCA 4BDYA 1NJWA 2G8WA 1B92A 1D5AA 1HJRA 1HNVA 1GOAA 5CYQA 4CJLA 2XHBA 4I9QA 3LWLA 1BIZA 5CZ2A 4O55A 3NH1A 3I0RA 1UOCA 1DTTA 3CM6A 3DMJA 3S9HA 3NGYA 3KK3A 1FK9A 5T7BA 3I8DA 4J2EA 5HP1A 3FFIA 1LWFA 2IAJA 3M8RA 3SZ2A 3TAEA 4JRPA 4C8LA 3ZSRA 1YTAA 3PUFA 3U3YA 4AH9A 3PV8A 3MEGA 4CF2A 4B9TA 2X6NA 3KKSA 3VQAA 4DS4A 4Q0BA 3DRSA 3M8SA 4DTNA 3HJFA 2XY7A 4DSJA 3T1AA 1KVBA 3HP9A 4DTUA 3TABA 3NF6A 3KK2A 3MXJA 1VSDA 3CG7A 3DOKA 3QETA 2YNIA 1NOYA 1C0TA 1D9DA 4HCCA 5J1EA 2P51A 3AVNA 3TAQA 1VSFA 4OPKA 2P5OA 1QE1A 3L2WA 1S1WA 4FJ9A 4DQSA 4CIEA 2F8SA 4CF0A 3SUNA 4OPJA 3QLHA 4AHTA 3NH2A 3QNNA 3OYNA 1NK9A 2YHBA 4FM0A 1W0HA 3PO5A 3SQ2A 2G8IA 3L2UA 3AVIA 1RT1A 3PO4A 4ZTFA 4FLYA 1FXXA 2HHXA 3LZJA 3D45A 1VSMA 4KTQA 4CJVA 3PY8A 2GBZA 4ID1A 3OJUA 1RDDA 2AJQA 3LP0A 5KGXA 4CGGA 2JLEA 2OPSA 4W5QA 1UA0A 3CQ8A 3CM5A 4C8KA 4CHQA 3LDSA 1CLQA 2E4LA 3RMCA 1X9WA 2IS3A 4KPYA 1HQEA 1S9GA 1NOZA 4F4KA 3MEDA 3HP6A 3C94A 4CGHA 3AVAA 2HVHA 2HHQA 4N47A 4HUFA 3MXMA 3CFRA 3MXIA 4RW6A 1N6QA 2RKIA 4C8MA 4CIGA 3RR8A 4FK2A 3SUOA 3A2FA 1TGOA 4FJNA 3E01A 2P5GA 4DSFA 3K5MA 1IG9A 4DFKA 1S6PA 4JLHA 3O4NA 4O4GA 3OYCA 1KCFA 3AO1A 3V6DA 2HHSA 3OYHA 5CYMA 1I39A 1D9FA 1C1AA 3AO3A 1RBVA 1LWEA 3AVMA 4CERA 4W5TA 1Q9XA 3QIPA 1L3TA 1VSIA 1VK0A 2ZQBA 4DTSA 4DS5A 1HRHA 4CEOA 4LH5A 1UWBA 3HPHA 3V1OA 3OS1A 3RTVA 4EZ9A 5C42A 4CCHA 4DG1A 4O44A 4J2DA 2WONA 4YFUA 3S3MA 4FZYA 3WNGA 4EZ6A 1S1TA 1G15A 4DMNA 2G8HA 1O1WA 1RT4A 4GVMA 3D0PA 4M3YA 2X74A 3TAMA 1TK0A 3QIOA 3KLFA 1NKBA 1IKXA 4FM1A 4Z4FA 2I5JA 3NAEA 3AA5X 4IDKA 4HVJA 2QK9A 5C24A 4EP4A 2X78A 5E41A 1NK7A 3L3VA 4RW7A 3EYZA 3SV3A 2GUIA 4ID5A 4HUGA 1JLFA 3LZIA 3HVRA 1X9MA 4OJRA 1JXEA 1BI4B 2P1JA 4CEFA 4B9SA 4CECA 2A1SA 3CFOA 3LP1A 3K5NA 1EETA 1RILA 5HRRA 5I42A 2VG7A 3PX0A 4BDPA 2HHTA 4CIFA 5DK5A 4IG3A 1X9SA 3NFAA 1RT2A 4YNQA 3QEIA 2OA8A 4ELUA 4CJKA 3AVGA 1WLJA 1NKEA 1IKYA 1FKOA 3C95A 4K8ZA 2FBXA 1JKHA 2HMIA 2YNGA 1WSIA 3CYMA 5HBMA 4CFAA 3KIOA 1WSHA 4CE9A 1ASVA 3HT3A 4BACA 4B3OA 1CXUA 3RWUA 2YNFA 4B9LA 1XHZA 4N41A 4DTPA 3G10A 1T05A 2QKBA 4DTOA 2VG5A 5J2NA 4E3SA 3KJVA 3G0ZA 2OPPA 5EU7A 1S9EA 3K5OA 4CESA 4OLBA 4E1MA 1U48A 4IBNA 1K6YA 3HPOA 4CF9A 4FJHA 1U45A 2B5JA 1X1PA 5KRTA 4FJ7A 2O4GA 4FLWA 3LALA 1SL2A 4FJXA 3AA2A 4CFBA 5HRPA 4F3OA 4E7KA 3K58A 3TARA 4FK0A 1WN7A 1A5WA 3RMAA 3S3NA 2O4IA 4H4OA 3HVTA 3SPYA 4Z4IA 1EKEA 3OYKA 1KRPA 4I7FA 1SUQA 3VQEA 2BE2A 1KVCA 2XY6A 3LANA 4O0JA 1HMVA 3AA3A 3HO1A 1RTIA 1BI4A 1VRUA 4CGFA 3OS2A 4J2BA 3MECA 4CJ4A 2Y1JA 2G8FA 2Q3SA 1SKRA 4Z4GA 1LW0A 3AVBA 3BGRA 3DLGA 3LPTA 3CFPA 4DSKA 2BANA 2YV0X 3SJJA 2OZSA 4N56A 4CHPA 1CZ9A 1Q8IA 4CEZA 1ITGA 1J9AA 3RMBA 1TKDA 1NJZA 4M42A 1TKTA 1QQCA 1RDAA 3AVHA 2KZMA 3C6UA 1KTQA 3DI6A 4BWJA 4K8XA 3OYLA 3T3FA 2OPRA 3DRPA 4DTRA 3KD1E 2XY8A 4OGEA 3O3HA 1RT3A 3ZSVA 3LWMA 4NCBA 5KGWA 2RN2A 4QAGA 2KQ2A 3O3GA 1ASWA 1NJYA 1J5OA 4DQIA 4FK4A 3ALYA 2EHGA 1IO2A 3VA0A 1VSLA 3ZT2A 4CJEA 5SWMA 3QEXA 4CFCA 4DTJA 1R0AA 3V1QA 2WOMA 2FBVA 1RCHA 3M8QA 4Z0UA 4I2PA 3ULDA 2QXFA 2YHAA 4HUEA 3BDPA 4LH4A 4Q5VA 3ASMA 4KO0A 3WNEA 1YT3A 2DFHA 4R5PA 3K59A 1KFSA 4FXDA 3VQPA 3OYJA 4DFJA 1JLGA 2B4JA 5SZTA 1IKVA 3AO2A 1RT6A 3HSTB 4B9MA 1RBSA 4CF1A 4NYFA 2HHUA 1REVA 2Z1JA 2ITGA 1I3AA 4KFBA 2F8TA 2PZSA 1C0UA 2OZMA 1LW2A 4DU1A 1YVUA 2KFZA 4CJ3A 3MAQA 4B9NA 1HPZA 4KREA 4BWMA 1NK6A 1L3UA 2Z1GA 5KRSA 4Y1DA 3OYAA 4FM2A 1XI1A 4LY7A 1TL3A 2W42A 4FJKA 1QSLA 4C8OA 4CHZA 1GOCA 1KFDA 3VQQA 3DLEA 2QKKA 2HNZA 3EY1A 4FLTA 1KLNA 4RG8A 3VQ8A 4DLEA 5JS1A 4FLVA 4Z4EA 1HNIA 1TKXA 1RDCA 4ICLA 4W5OA 1F21A 1Y97A 2E6MA 3OS0A 3V9ZA 3DOLA 4CEQA 4B9UA 1VSKA 4DTMA 3NGZA 1Q9YA 3ZSQA 4M41A 3K2PA 3VQ5A 4M3XA 4DTXA 1RTHA 1BCOA 1QSSA 4CHNA 4Y1CA 4FJ8A 4L8RB 2IOCA 2BGGA 1CXQA 1U49A 3ZT3A 3SUQA 2PYJA 4LD0A 3HK2A 3AVLA 2BDPA 1WAJA 2VG6A 4CJSA 1JXBA 3C6TA 3DRRA 3OVNA 2HHWA 4FCYA 3QESA 4FJIA 1BQMA 2KTQA 3PX4A 2YKMA 2HHVA 1KVAA 1XWLA 1S1VA 3K5LA 1ZBFA 3VQ4A 1J54A 3KLEA 3F73A 2Y1IA 4HCBA 1C1CA 1VRTA 1WAFA 4E1NA 4OGCA 2VWJA 1QSYA 4CF8A 3QEPA 1TAUA 1BGXT 5DMRA 1CZBA 5FDLA 3SQ1A 3ZT1A 2DFEA 4M3WA 1LWCA 3IG1A 4KHQA 1UAXA 3QEWA 4E7HA 2KFNA 4PA1A 2D0AA 4KHSA 4JS5A 2D0BA 3OYIA 3O3FA 3SYZA 3KLHA 4QOZB 1DLOA 2ZD1A 1HYVA 4FLZA 4LSNA 5FRMA 4DSLA 4DU3A 4JS4A 4RW8A 4ELVA 1TAQA 2YKNA 4FVMA 4CEDA 1JLAA 3ZCMA 4DSIA 2Z1IA 3NF7A 2IGIA 3IS9A 3V81A
chains in the Genus database with same CATH superfamily
1W2BM 1ZYQA 5BREA 3HM9A 3HL8A 2HB5A 4DUYK 2HBKA 3TWHA 1BL3A 3ZSZA 2ATQA 3IUCA 4ILHA 2UUAK 4BR7A 3QNOA 5TKWA 4HHTA 2D5RA 1U6ZA 3SQ0A 4N76A 4DFPA 1T8EA 1VHXA 3CCMN 1W9HA 4DF8A 1TVRA 1TK8A 2ZWHA 3KKRA 5FRNA 1XNRK 4E7IA 1VQ7N 4BQLA 4CEEA 3B6PA 3F2KA 3J7AP 3LPUA 4AQYK 3VQDA 4BE1A 3VTIA 2HW3A 3J8AA 3AVKA 2PFUA 3UB5A 5EXWA 1Q82O 1VQ5N 4DR7K 4NO7A 4KHNA 3PIOL 4CGJA 3UIQA 5M1KA 4NLCA 4BE0A 1VSEA 1IKWA 3KLIA 2RF2A 2ZJPL 4FJJA 3V9XA 4J2AA 1RTJA 1Q18A 3HBTA 2FC0A 3VF4A 4CEBA 4M45A 4PY5A 1JLBA 5KTQA 3RVCA 4CK2A 4KTZA 2X6SA 5BRHA 4F2SA 4DV4K 4BRLA 4KHUA 1LAWA 1OH5A 4DV7K 1EX4A 1S22A 4LF6K 4DQ8A 2YHXA 5AQPA 4NXMK 4CHOA 4FPBA 4WQ5A 1YAGA 2UUCK 1U47A 3BF3A 3DWLA 3OYDA 2DY4A 3TR8A 4BG8A 5HLFA 1JLCA 1MDUB 2CGJA 5CHIA 5AFUH 2F96A 3C6AA 2P9SB 3OYMA 4GW6A 5HOOA 1BCMA 1KXPA 3VQBA 3ZT0A 4CJUA 3THVA 2XO7A 4FL9A 3GL1A 4BQZA 4U67L 1X9JA 3JXUA 5J2QA 4AHVA 2FSKA 3VEZA 1XC9A 1SKSA 4BE2A 1RT5A 4AM6A 3SCXA 4FYDA 4EHUA 4LC9B 1ZBHA 4FLUA 1B9FA 1GLCG 4JI0K 3IMXA 4IFVA 3L4QA 2P9PB 2KW4A 3NVKA 4PL8A 2ETJA 3OY9A 4OKEA 1QQNA 4NCGA 1XHXA 3HXMA 3RMDA 2DFFA 3SAHA 5LMNK 4FW2A 4ZTJA 3ITHA 3EZ5A 4RWTA 3THYA 4B1VA 4ELTA 1R59O 2P9UB 3ISNC 2AA4A 2IVOA 4KHWA 3T19A 3VA3A 2YX6A 4MLHA 4MDBA 4K0KK 2P9SA 1VQON 4E19A 4IOCL 4NCAA 4CI6A 2F4VK 2QWNA 4KHYA 1SV5A 1BQNA 3AVJA 2FF3B 1MWMA 4KH4A 1OH6A 3CXCM 1T7PA 4EIAA 3A5OC 4AHUA 4ISGA 4WE1A 3QERA 1KLMA 3KLGA 1U4BA 2QWMA 3AVCA 1NJWA 1RGIA 2P9PA 1HJRA 3LWLA 4UY8O 3H1VX 1EWRA 1DTTA 3ZX2A 3VGMA 1FK9A 4IXCA 3HTVA 2IAJA 3M8RA 3PUFA 3PV8A 1E4GT 4BRQA 3KKSA 3W3DA 3M8SA 2P9UA 4OO1J 3HJFA 4YHHK 3NF6A 4O8KA 3CCJN 3QB0A 5J1EA 3IDHA 1VSFA 1QE1A 3L2WA 1HKBA 4LF9K 1S1WA 4FJ9A 4CIEA 2HBJA 4AHTA 2VQFK 3OYNA 3AVIA 4FLYA 1KAYA 2HHXA 1JJ2M 3OJUA 5KGXA 4JI7K 1CLQA 2E4LA 4KPYA 4ISEA 1S9GA 1NOZA 4F4KA 3HP6A 1E3MA 3AVAA 4N47A 3DLLL 3MXIA 1N6QA 3CERA 4DR1K 2W6KA 3T1HK 4DSFA 4DFKA 4CBXA 3O4NA 4O4GA 1KCFA 3AO1A 3D2EB 3OYHA 1QQOA 1C1AA 3AO3A 3AVMA 1VSIA 4H5NA 4CEOA 2UXBK 3NMUA 4J2DA 4B3TK 1J6ZA 1G15A 4QS9A 4CJ7A 1ILYA 4EAHD 4JKFA 2Q0UA 4FM1A 4RTFD 3AA5X 4IDKA 2Q2RA 3I8BA 3G6EN 3L3VA 2E2OA 4RW7A 3EYZA 2IIRA 3SV3A 3LZIA 3CHWA 3H6EA 2NRHA 1X9MA 5GAEP 1RFQA 4OJRA 3P4IA 4CECA 3UE5A 3SMPA 5I42A 1RT2A 2JWLA 4YNQA 3WQTA 1WLJA 1NKEA 1FKOA 3C95A 3CPWM 2FBXA 4K8ZA 4CFAA 3KIOA 4BACA 4B3OA 1NGGA 3D2EA 2YNFA 4A5BA 5B8HA 4EHTA 2Q97A 3G10A 1M90O 4DTOA 3G0ZA 1YJNN 4KH6A 1U48A 4IBNA 4FJHA 3RSEB 4IO9L 2O4GA 4FLWA 1SL2A 4FWOA 5AQSA 3GOIA 4H4OA 1EKEA 3BEXA 3LANA 3QBWA 1HMVA 4BGAA 3TSQA 3HO1A 2A3ZA 1RTIA 4JAXA 1LW0A 3AVBA 4BRAA 1J9AA 2NRWA 4M42A 1T6CA 3DI6A 4BWJA 3OYLA 3BP8A 3KD1E 2EWSA 3O3HA 3A5LC 3F5TA 3LWMA 2RN2A 4QAGA 1ASWA 1J5OA 4H5WA 4DQIA 4IDHA 2EHGA 2V7YA 3R6MA 3O5BA 1N34K 3RSEA 3V1QA 2FBVA 4DB3A 4I2PA 1NGHA 3WT0A 2W40A 3WNEA 1VQ4N 2DFHA 5AR0A 3AO2A 5AQYA 4CF1A 1REVA 2F8TA 4B9NA 1HPZA 1HNWK 5C0YA 1L3UA 3ULEB 4FM2A 2W42A 4DHYA 3FFKB 4CHZA 3D2FB 1KFDA 4BGBA 1KLNA 1RDUA 4W5OA 4HWIA 3VERA 3V9ZA 4BREA 3UKRB 3TU5A 3ZSQA 4H0YB 1NJIO 3O9QA 4BRCA 3SMSA 2AP1A 1QSSA 2KHOA 1CXQA 1T6DA 2IVPA 3HK2A 1WAJA 2VG6A 1JXBA 2HHWA 4FCYA 4FJIA 3QMLA 1NG9A 3K5LA 3CETA 4CF8A 3QEPA 4H03B 5DMRA 3KHYA 3SQ1A 4F9OA 3AAPA 1LWCA 5LMUK 4KHSA 3O3FA 1HLUA 3U9DA 2ZGZA 3ULEA 4DSLA 4NLBA 3OW2M 3D2FA 2DPNA 2V7ZA 3R1XA 3NF7A 5HP1A 3V81A 4MQ3A 3L2QA 5HROA 5C25A 4BRNA 4FLXA 4CJTA 3UKRA 4K43A 3NE6A 4KB1A 4JKCA 1RDWX 4G1QA 3U9ZA 1N32K 1LV5A 3IRXA 4AF1A 4BRGA 3AVFA 4CW7B 1P90A 3P83D 4IOXA 2E6LA 2G8VA 1L3VA 3GE1A 4IG0A 4JV5K 4DQQA 4C8NA 1FKPA 1CZAN 1BWFO 2GV9A 2QTDA 4AHRA 4JD2B 4DQRA 1HYSA 1RBRA 2W6LA 4GNIA 3TAFA 5FROA 1BIUA 4F8RA 4JI5K 3E9PA 5J2PA 3V4IA 3K9JA 4M3UA 3DLHA 1TL1A 1IH7A 1TV6A 3OJSA 2YHYA 3TI0A 2G8UA 2PYLA 3L3UA 2O8BB 1NK0A 4JKDA 4B3MK 3ZX0A 3KTQA 3SJHA 5HRSA 3CCQN 3F9KA 1RDBA 4M7YA 3CJBA 5M1FA 2Z1HA 5CZ1A 3FZFA 4JK8A 3AV9A 1NBWA 1SZ2A 4FJMA 4LSLA 2YNHA 1MA9B 1YJ9N 5HL7L 4CZKA 3M8PA 4IFYA 5AQGA 3MWPA 2IVNA 1WSEA 3KD5E 2A1RA 2HF3A 1N5YA 1ZBUA 3P1GA 4XEIA 1LAVA 5BRFA 4IO8A 4B8CA 4B8AB 4JI4K 4CZGA 4JD2A 4BC3A 4JKBA 2FXUA 2RHKA 3BZCA 1S1UA 3T69A 5TKYA 3M3ZA 4BDZA 3A0IX 4J8FA 1A5XA 4C1NI 4X66K 3HYFA 1Q7YO 4GKKK 4IJNA 2E5LK 4O5BA 3TAPA 2O8BA 3LP2A 2HVIA 3RR7A 2NNWA 3VMFB 1BISA 2I7PA 4DU4A 3SUPA 4PKGA 5BR8K 4BRKA 1QHTA 3SK3A 1DGKN 4CK1A 1KAXA 4CFDA 3SI6A 3N4QA 4DFMA 5AQZA 4XIUA 2B6AA 4RW4A 4JI6K 4IOAL 3J7YP 2R7YA 3CCLN 4IKFA 3DM2A 1JL2A 3SPZA 3DYAA 2A6AA 3WXKA 3NCIA 4E7LA 4BC2A 4NYNA 1JCEA 1HX1A 2KLAA 2G8KA 1EP4A 1D8YA 1KSPA 2YCHA 4W5RA 3VQCA 3T1YK 5M1OA 2VCPA 3QO9A 1SL0A 3C6HA 1EXQA 3SQ4A 3OYEA 2HBMA 4DWIA 4KTWA 2VYPA 4OLAA 2JGUA 1YXQA 1NGAA 4E0DA 2A40A 5AQHA 3LDNA 5BN9A 3HOSA 1Z26A 2EX3A 4UQGA 3L8BA 1TKZA 3THWB 3AA4A 3FZLA 1YTUA 1QHAA 1VQ8N 4PWDA 2DTUA 3QEVA 3NHGA 4AHSA 5J2MA 2HOEA 2PY5A 2XY5A 1S5JA 1U04A 4BDYA 2G8WA 1GOAA 1BIZA 2YHWA 3AGRA 3I0RA 1UOCA 4BRHA 1YHQN 3R3LA 3CM6A 3DMJA 4YORA 3NGYA 3I8DA 3A8YA 1NWKA 3MX5A 3MK6A 4FVUA 1LWFA 3SZ2A 3TAEA 3H1QA 3EO3A 4AH9A 3WEEB 4B9TA 1YI2N 3VQAA 4Q0BA 5AQKA 3DRSA 4DTNA 1NGEA 4H0VB 1KVBA 2E88A 4DTUA 4FOIA 1VSDA 3DOKA 1NOYA 3K9KA 2P9NB 2P51A 4FWQA 3THWA 4DQSA 2F8SA 1XMOK 4KBOA 3QLHA 3NH2A 4FOEA 3SQ2A 2OCEA 1RT1A 4ZTFA 1FXXA 2PBDA 1XUPO 4KTQA 1IJJA 4CJVA 1S72N 3FLCO 4ID1A 3LP0A 4CGGA 3Q7BA 3LDPA 3A5NC 4C8KA 4JI8K 4JHDB 3RMCA 2IS3A 1HQEA 4XH5A 4BC5A 5I9EB 3SAFA 3MEDA 3O1WA 3C94A 2WBNA 4X65K 3MXMA 3OHRA 4C8MA 4CIGA 3SUOA 4FWNA 1EQYA 1S6PA 4Y0WA 3WEEA 2HHSA 2E1YA 5CYMA 1D9FA 1Q9XA 3KWGA 3CF5L 1KD1O 4LH5A 3HPHA 3RTVA 3ZLJA 4EZ9A 3THXB 2P9NA 4EZ6A 1S1TA 3WUHA 2G8HA 3CCVN 1YUWA 3D0PA 1K9MO 4M3YA 2X74A 3SBGA 3TAMA 4BR4A 4ILGB 1NKBA 4KHPK 1IKXA 4JI2K 4Z4FA 1TYQB 4HVJA 5C24A 3ENBA 3JS6A 3HVRA 1JXEA 2P1JA 4IEIA 4CEFA 4GY2B 4JHDA 3LM9A 1EETA 1RILA 2VG7A 3TTCA 4BDPA 2HHTA 4IG3A 3CJ1A 3W0LA 3AVGA 3MCAB 4XH4A 3VF2A 5GAHP 3ZX3A 2YNGA 1ASVA 5FPEA 2E1ZA 5AQRA 1T05A 4DR3K 3KK7A 4E3SA 3KJVA 2OPPA 5EU7A 4E1MA 3THXA 1K6YA 3HPOA 1X1PA 4LF4K 2QI2A 4FJXA 3QFPA 4CFBA 4F3OA 5AQWA 1A5WA 1NGJA 1TYQA 3CQYA 3RMAA 3S3NA 2QEXN 3CCUN 3HVTA 4I7FA 1SUQA 2O8DB 4H0PA 3AA3A 3OS2A 1EWQA 2Y1JA 3BGRA 3DLGA 3LPTA 3CFPA 2E8AA 3AY9A 5M1QA 3CMEN 2BANA 5AFUA 4N56A 1VQLN 1Q8IA 4CEZA 1TKDA 1NJZA 3IKMA 3K0SA 1RDAA 2KZMA 3EEQA 4JKEA 4DTRA 2QM1A 3WXLA 3JAMO 5KPZA 5KGWA 3SLCA 3ZYYX 1YF5L 4FK4A 4AM7A 3ALYA 2ZJQL 1IO2A 5SWMA 4WQ4C 3QEXA 4CFCA 4DTJA 1OKJA 4CZLA 1VQPN 2E20A 3PIPL 3I55N 3CIPA 3K59A 3ASMA 4KO0A 4R5PA 4CZFA 4BC4A 3VQPA 2Q0RA 1N8RO 4BRFA 5M1PA 5DM7L 3FE1A 3LM2A 1IKVA 2I7NA 2O8DA 2HHUA 4KFBA 1C0UA 4H0XB 4DU1A 2V51B 2H3GX 1X3MA 4BWMA 1TL3A 4HTLA 3CJ9A 1QSLA 1ATRA 3DLEA 2HNZA 5BPLA 4DLEA 1M1KO 1TKXA 4YOYA 3EKSA 1F21A 1Y97A 3OS0A 4CEQA 2WUSA 4DTMA 3NGZA 2CH6A 4K41A 5AQXA 2UXDK 1HJOA 1ATSA 4M41A 4M3XA 1NGFA 1RTHA 4MLEA 4BRDA 4FJ8A 5KPRA 2ZM6K 4LD0A 2BDPA 4CJSA 3DRRA 3OVNA 2P9IB 4LF7K 2HBLA 2KTQA 4WFBL 1KVAA 1ZBFA 3VQ4A 1J54A 3KLEA 4Z4EA 4E1NA 1WAFA 2VWJA 4OGCA 1VQMN 4C23A 1WB9A 1BGXT 1QZ5A 4M3WA 3E9OA 1XNQK 3DXMB 3IG1A 3CC7N 5AZJB 2QA4N 3I56N 2KFNA 1NGIA 4JS5A 1GLDG 2D0BA 3KLHA 3ENHA 4FLZA 4LSNA 3CMAN 1X3NA 1JCGA 1TAQA 3WQUA 3PSIA 4DSIA 3IS9A 4CJQA 3WNHA 3SV4A 1NNEA 4FJ5A 2LSNA 2W41A 3MDQA 2FBYA 3V1RA 4FZXC 1VQNN 3O4WA 1JLQA 5GIPA 4YOWA 4LF8K 1L5UA 4O5FA 2NRRA 4WCEL 5DM6L 2P9IA 3AO5A 4Z4CA 4OPAA 4CJ5A 3WXJA 4EP5A 2VWKA 4CJFA 3HOTA 4O8UA 2RPIA 2IDOA 3ZSYA 4LFBK 3TAGA 4JK9A 4B1ZA 1VSJA 5GINA 1RNHA 3WNFA 1C1BA 2NUBA 3DXMA 3NBPA 4OKJA 1Z05A 3TSPA 4M3RA 4DLGA 4A59A 5JICA 5H1SQ 1NK4A 2PAVA 1WSJA 1V4TA 1XC3A 4KI4A 2XRIA 4E89A 2F9WA 1NKCA 4DV1K 3RRGA 2D1KA 3JSMA 4B3SK 1NK8A 4OX9K 3U4LA 2QXLA 3OTOK 3VEXA 5BRDA 3B6OA 2QW9A 4KKOA 1ESVA 3DLBA 4K25A 4DCHA 1SKWA 4CGDA 1J53A 1QTMA 2KZZA 1NK5A 3R8EA 3FGUA 2D0CA 3IAYA 4H8KA 3M1FA 2NRXA 1WSFA 4N5SA 2ZJRL 1TUUA 4FJGA 1JL1A 3ZSWA 3VGKA 2WC9A 3MN7A 3U6FA 5GAGP 4CHYA 5K14A 4CBWA 3OYFA 3CCSN 3ZSXA 3TTFA 1TK5A 1NU0A 3TPQA 4KH5A 4XH1A 4DSEA 3P39A 4PQUA 4C1NK 3VEVA 4LF5K 4B1WB 4JKAA 3ZEUB 4CEAA 1HPMA 5I3UA 4GV6A 4A5AA 5LY3A 1QZ6A 3O4QA 3VPZA 2FBTA 1NMDA 5BPNA 3V9WA 1MU2A 4OVLA 2P5OA 3P5JA 1IG8A 4JEPA 3GBTA 3O9RA 1ZBLA 1KAZA 4KAZA 4CD1A 4HTUA 1N33K 4CK3A 1ZBIA 4A61A 4CJRA 1U2VB 4FJLA 1YJWN 4KI6A 2O8EB 1SS6A 3NH0A 4CGIA 5LL6Z 2GELA 3QINA 4PL7A 3CJAA 4QS7A 4W5NA 3EE9A 4H4MA 1L3SA 4YDUA 1WBBA 1A5VA 2HHHK 3R9PA 1QQMA 3I0SA 4E7JA 5BR9A 3M6GA 3L2RA 5JVGL 1RTDA 1BDGA 2GTDA 4B1XB 3JYTA 1DTQA 3OYBA 1DT9A 4OPHA 2WFBA 1WSGA 3ZEUA 3LAMA 1SL1A 1UA1A 2HNDA 1B92A 1D5AA 3H3NO 4I9QA 4CJLA 5AQUA 3O1BA 3NH1A 2D0OA 3T7ZA 3S9HA 3AGKA 1ZC6A 5T7BA 4J2EA 2HMPA 4CVNE 4DR5K 4A2AA 3FFIA 4C8LA 4IWVA 1YTAA 3ZSRA 3U3YA 3MEGA 4M63C 4CF2A 2X6NA 3VEYA 1U2VA 2XY7A 4DSJA 3HP9A 5M1NA 3TABA 2O8EA 5AQMA 1C0TA 3L4IA 2WTUA 4HCCA 1SQKA 2NRTA 4BY9C 4OPKA 3O6WA 1Q86O 3SUNA 3BY5A 3QNNA 1NK9A 4FM0A 3PO5A 3D45A 2GBZA 4BR5A 4GV9A 2JLEA 3OA9A 1UA0A 3CM5A 4CHQA 3G25A 3LDSA 1X9WA 2D4WA 2NZTA 3H45C 5C2DA 4CGHA 3HI0A 2HVHA 4RW6A 2RKIA 1TGOA 4M7XA 4FJNA 3E01A 5FLXO 4JLHA 3FZKA 3OYCA 3V6DA 1I39A 4W5TA 2GWJA 5FPDA 2GX9A 4DS5A 1GLAG 3C7NB 1UWBA 3V1OA 2V52B 3OS1A 2BH1A 4DG1A 4YFUA 5AQJA 1DKGD 3UKUB 1O1WA 5AQIA 4DMNA 5F2RA 4L3QA 3QIOA 3KLFA 3NAEA 4BROA 1BG3A 4EP4A 2RE2A 1Y64A 4MO4A 4FWPA 1KQSM 4ID5A 4JK7A 3FZMA 1GLEG 3EN9A 1BI4B 4BR0A 4IZ9A 5F0XA 4B9SA 2A1SA 2YJEA 4CZHA 3CFOA 3LP1A 3K5NA 5HRRA 4YY3K 3PX0A 4CIFA 3NFAA 5AQVA 1TUYA 3QICA 3VTHA 1DEJA 3SBTA 5AQFA 4LFCK 4GVEA 3ATUA 3MMVA 2HMIA 2ITMA 3CYMA 1WSIA 1XMQK 4CE9A 4A2BA 2F9TA 4B9LA 5KQDA 3D7EO 4N41A 4FSVA 4BVOA 3C7NA 3G4SN 1S9EA 3K5OA 4CESA 4OLBA 2QWRA 4CF9A 4Z94A 3B8AX 1NM1A 3UKUA 1O13A 5BN8A 2UXCK 5HRPA 4E7KA 3K58A 4FK0A 5KPTA 4R79A 4Z4IA 1NGDA 1KRPA 4BRIA 3VQEA 1KVCA 3C0BA 1C0FA 4ISFA 1BI4A 1BOTO 2GWKA 5AQLA 1V4SA 4J2BA 3MECA 2G8FA 2OANA 2Q3SA 4B9QA 1SKRA 4Z4GA 2YV0X 1CZ9A 5C2FA 3RMBA 5JMVA 3TSUA 4FWKA 3C6UA 3CJ7A 2OPRA 3DRPA 2A41A 4H0TB 1KC8O 1RT3A 3ZSVA 4NCBA 5E26A 5ADXH 3CCEN 2KQ2A 3CC4N 3HRGA 3O3GA 1NJYA 4BR9A 4CJEA 4K42A 4WQ5C 2WOMA 3E66A 2YHAA 2QWOA 4HUEA 4LH4A 1KFSA 1YT3A 3HZ6A 4GKJK 1JLGA 3KVGA 2B4JA 4NB4A 2UU9K 3OBWA 3HSTB 4B9MA 1RBSA 3BUZB 4NYFA 2ITGA 4CZIA 3VOVA 2OZMA 1LW2A 5JLHA 2KFZA 4CJ3A 3QFUA 4KREA 3THYB 2Z1GA 5KRSA 4QS8A 4LY7A 3C65A 3MX2A 2QKKA 3EY1A 2BTFA 4RG8A 5JS1A 3HM8A 1HNIA 2KKZA 1RDCA 4ICLA 4G9ZA 2E6MA 3DOLA 4B9UA 3O80A 2VGNA 4DTXA 3DJCA 4FPAA 4CHNA 4GV3A 4L8RB 2IOCA 2BGGA 4JI3K 2PYJA 2A42A 3AVLA 2O8FB 2ZF5O 4CZJA 1H1VA 3PX4A 2YKMA 2Y1IA 5C12A 5FPMA 4FWMA 1C1CA 1VRTA 3A5MC 1HKGA 4E1JA 3I33A 1TAUA 1JCFA 3EL2A 5FDLA 4DKWA 3J80O 4KHQA 1UAXA 3DAWA 2D0AA 5EY4A 3OYIA 4QOZB 1ATNA 1DLOA 4CZEA 3DXKB 1HYVA 4DU3A 5AQOA 4ELVA 1JLAA 3ZCMA 5ADXA 4DV3K 4LFAK 2Z1IA 2IGIA 1VQKN 3FR0A 3LAKA 4DQPA 3NF8A 4KRFA 1WNSA 1P8ZA 3OBYA 1K8AO 3VQ9A 4A62A 5JLFA 2UUBK 1GOBA 4GMJB 3VQ7A 4B1UB 1NJXA 1RBTA 4PUOA 4B3RK 3AAQA 1QS4A 4MFBA 5HRNA 2O8FA 3VQ6A 1WBDA 3SNNA 2HNYA 2ZGYA 1QVGM 4MO5A 1BA0A 5F1XA 3KZBA 3H08A 1GLLO 3ZSOA 1HNZK 3CPEA 1YVNA 1HYZA 4AILC 1MWKA 3K57A 5EVZA 3DXKA 4F3TA 4YOTA 5AJ3K 3NGIA 3PLAA 2OTLN 4KB0A 3OYGA 4JRQA 3RRHA 1JLEA 1B9DA 1T03A 4B08A 3MN6A 4DV5K 3DLRA 4FWSA 4BG9A 2CGKA 2F7TA 4QCLA 3ZT4A 4CBUA 1BO5O 3AO4A 4IEEA 4I6MB 1RT7A 4MDAA 4CJWA 1NLVA 4OKKA 2UYTA 3CQXA 1I94K 1GLBG 3VN5A 3CD6N 1XQSC 3E1YA 3L2VA 1RBUA 5AQNA 2A5XA 3ID8A 1VSHA 1NGBA 3LP3A 4YOXA 4JI1K 4CZMA 1ASUA 3PX6A 4WQ4A 2OTJN 1C0MA 4DR4K 4BRPA 5D3GA 1ZBSA 5KI6A 1J5EK 4YOVA 1BUPA 3QBXA 4JN4A 1BHLA 4TSXA 3VGLA 4RW9A 4DF4A 4I2QA 2ZE2A 2E2QA 1S1XA 3VF6A 3NDKA 2GEMA 1S6QA 1OH7A 3MWTA 1QVFM 2FLOA 3KK1A 3V9SA 5IT9O 1LOTB 4ILJA 3J7ZO 3O08A 2IC3A 4DR2K 3IFRA 3WXMB 2CGLA 4I6MA 5C10A 3VEWA 4B9VA 5MLCQ 4EFHA 3NF9A 4H5VA 3V9UA 3HPGA 4KV8A 3H46O 5EX5A 2Q36A 4CJPA 3DLKA 4AHCA 3KWIA 5JS2A 5CY4A 4M3ZA 3ID6A 3GG4A 2OPQA 4X62K 4O0IA 2OYQA 1HQUA 4M3TA 4FW1A 3H3OB 3VEOA 5LJWA 1OVYA 1BU6O 4F2RA 3U3GA 4A57A 4ZHRA 4FZZA 3BZKA 3S3OA 1Z25A 1C6VA 2QWPA 1K8KB 4I9LA 4Z4HA 5A2QO 3MEEA 4X64K 3TANA 2FF6A 5ELZA 5CYQA 1HNVA 2XHBA 4FWLA 5CZ2A 4O55A 2YJFA 3VETA 3G71N 4WF9L 3O9UA 3KK3A 2P9KB 1K73O 3LL3A 2E2NA 1HKCA 5AZJA 4JRPA 4PKIA 5AQQA 2P9LB 4H5RA 1S3XA 4DS4A 4CD3A 1NMNA 3T1AA 4DUZK 3KK2A 3MXJA 3CG7A 2J4RA 3QETA 2YNIA 1D9DA 3MN5A 3AVNA 3TAQA 1C0GA 2GUPA 1EO1A 4CF0A 4OPJA 2G8IA 2YHBA 1W0HA 3L2UA 3PO4A 4YOUA 3LZJA 1VSMA 3O9TA 1K8KA 2VQEK 5C15A 3PY8A 1VQ6N 2QWQA 1RDDA 2AJQA 1YIJN 2OPSA 4W5QA 1VAZA 3CQ8A 2Q1NA 4DV6K 1IBKK 2FSNA 3LDLA 1IV0A 3EZWA 2HHQA 3P38A 4HUFA 3CFRA 3RR8A 3Q7CA 4FK2A 2P9KA 3A2FA 4NXNK 4IJAA 2P5GA 3K5MA 2E2PA 4BR2A 1IG9A 3WXIA 2JWKA 2P9LA 4CERA 2QWLA 1RBVA 1LWEA 3QIPA 1L3TA 1VK0A 2BUPA 2ZQBA 4DTSA 1HRHA 3EE8A 5C42A 4CCHA 4O44A 3J81O 2WONA 3S3MA 4FZYA 3WNGA 3FZHA 1RT4A 1WUAA 4GVMA 5JVHL 1TK0A 1HR0K 2QK9A 2I5JA 3L0QA 3F9MA 4IFEA 2X78A 5E41A 1NK7A 4DR6K 2GUIA 4HUGA 1JLFA 1NGCA 4WFNL 1BA1A 1OVQA 1Z6RA 3LDQA 5DK5A 1X9SA 3LDOA 4BRMA 2OA8A 3QEIA 4ELUA 3AARA 4CJKA 1SAZA 1IKYA 5KQ8A 1JKHA 4YDUC 5HBMA 3CCRN 1WSHA 3HT3A 1CXUA 3RWUA 1XHZA 2NRVA 3O9SA 2QKBA 4DTPA 2VG5A 4JKGB 5J2NA 3QDKA 4JKHA 4H0OA 2D0PA 3EKUA 1U45A 2B5JA 5KRTA 5AZIB 4FJ7A 3VESA 4DV0K 3LALA 2HSTA 3ATVA 3AA2A 3TARA 1WN7A 1HUXA 2O4IA 3S41A 3SPYA 1FJGK 3OYKA 3N4PA 2XY6A 2BE2A 4O0JA 1VRUA 3NVMA 4CGFA 4PHTX 4JNEA 4CJ4A 1GLJO 4DSKA 2OZSA 3SJJA 4H5TA 4CHPA 1ITGA 1LCUA 4RCHA 1TKTA 1QQCA 2NLXA 3AVHA 4V19S 1KTQA 4K8XA 3T3FA 2XY8A 1ZXOA 4OGEA 4B1YB 2HF4A 3VENA 5GIOA 1YITN 5FPNA 2ASPA 3ZETB 4JKGA 3L6QA 1T44A 3CC2N 3P31A 3VA0A 1VSLA 3ZT2A 1R0AA 1RCHA 3M8QA 3D6RA 3M5RA 4Z0UA 5AZIA 3ULDA 2QXFA 2ASOA 3ENOA 3BDPA 1GLFO 4Q5VA 4FXDA 1T3VA 3OYJA 4DFJA 3BF1A 3CJCA 5EOYA 5SZTA 2O8CB 1RT6A 2VGMA 2Z1JA 1I3AA 3E9LA 5CR4A 1HNXK 5E84A 2PZSA 1VQ9N 1W7AA 1YVUA 3MAQA 1NK6A 4WFAL 4Y1DA 2VWBA 3OYAA 2ASMA 4FJKA 4C8OA 1GOCA 3VQQA 4FLTA 4U7BA 3VQ8A 4FLVA 4DV2K 4FO0A 2NRZA 3O8MA 1D4XA 5BPMA 2YI1A 1VSKA 2Q31A 3PSFA 3MN9A 1Q81O 1Q9YA 1WOQA 3VQ5A 3K2PA 3ZETA 3GDQA 3TTDA 5CE3A 3MCPA 1BCOA 4Y1CA 1G99A 3SAGA 1U49A 3ZT3A 3SUQA 5LJVA 5AQTA 3C6TA 4BVPA 3QESA 1OH8A 5GADP 1BQMA 1FW6A 2HHVA 1XWLA 3F73A 1S1VA 2CH5A 4HCBA 1IBLK 1QSYA 2O8CA 4WYBA 1CZBA 3ZT1A 1E4FT 1W97L 2DFEA 2FSJA 3HSCA 3QEWA 1N36K 4E7HA 4JYAK 5IWAK 4PA1A 4FWRA 3SYZA 3CI5A 2ZD1A 3U8XA 4PKHA 5FRMA 1IBMK 4JS4A 4RW8A 2YKNA 4FVMA 4CEDA 1XI1A
chains in the Genus database with same CATH topology
4MQ3A 1ZYQA 3LAKA 3L2QA 5C25A 5HROA 4CJQA 4DQPA 3NF8A 4KRFA 1WNSA 3WNHA 3HM9A 3HL8A 3SV4A 2HB5A 2LSNA 4FJ5A 4FLXA 4CJTA 2FBYA 3VQ9A 3V1RA 3NE6A 3TWHA 4KB1A 1BL3A 3ZSZA 2ATQA 1GOBA 4G1QA 4GMJB 3VQ7A 1LV5A 3QNOA 4FZXC 4HHTA 1RBTA 2D5RA 3IRXA 1NJXA 4PUOA 1JLQA 1QS4A 3AVFA 3P83D 4MFBA 3SQ0A 1L5UA 2E6LA 4N76A 4DFPA 2G8VA 1T8EA 1L3VA 5HRNA 4IG0A 1W9HA 4C8NA 4DQQA 1FKPA 3VQ6A 2GV9A 3AO5A 4Z4CA 4DF8A 1TVRA 4AHRA 4DQRA 3SNNA 2HNYA 1HYSA 1RBRA 4CJ5A 4EP5A 1TK8A 2VWKA 3KKRA 4CJFA 5FRNA 4E7IA 4CEEA 3TAFA 3B6PA 5FROA 2RPIA 1BIUA 2IDOA 3ZSYA 4F8RA 3LPUA 4M3UA 5J2PA 3V4IA 3VQDA 3H08A 3TAGA 1VSJA 4BE1A 1TL1A 3DLHA 3ZSOA 2HW3A 1IH7A 1RNHA 1TV6A 3AVKA 1C1BA 3WNFA 2NUBA 3OJSA 3TI0A 2G8UA 3L3UA 2PYLA 4KHNA 1NK0A 4CGJA 3UIQA 3NBPA 4OKJA 4BE0A 1HYZA 3KTQA 4M3RA 4AILC 5HRSA 1VSEA 1IKWA 3F9KA 3K57A 1RDBA 3KLIA 4F3TA 4DLGA 2RF2A 4B9VA 3NGIA 4FJJA 3V9XA 1NK4A 4J2AA 1RTJA 2Z1HA 1WSJA 5CZ1A 3AV9A 4FJMA 2FC0A 4KB0A 4LSLA 2YNHA 3OYGA 4JRQA 4KI4A 2XRIA 4CEBA 4E89A 1NKCA 3RRHA 3RRGA 1JLEA 4M45A 4PY5A 1B9DA 1T03A 4B08A 3M8PA 1JLBA 3JSMA 1NK8A 5KTQA 3DLRA 4IFYA 3B6OA 4QCLA 4CK2A 3ZT4A 4KTZA 2X6SA 1WSEA 3AO4A 3KD5E 4KKOA 2A1RA 4F2SA 1N5YA 3DLBA 1RT7A 4CJWA 4KHUA 1ZBUA 1LAWA 4OKKA 3P1GA 1SKWA 1EX4A 3VN5A 1LAVA 3L2VA 1RBUA 4CGDA 1J53A 1VSHA 3LP3A 4B8CA 4B8AB 1QTMA 2KZZA 1NK5A 1ASUA 4CHOA 3PX6A 2D0CA 1S1UA 3IAYA 4H8KA 1U47A 3OYDA 1C0MA 1WSFA 4N5SA 4BDZA 4FJGA 2DY4A 1JL1A 3TR8A 5D3GA 1A5XA 5KI6A 3ZSWA 5HLFA 1JLCA 3HYFA 4O5BA 3U6FA 3TAPA 2F96A 3LP2A 1BHLA 2HVIA 3OYMA 4CHYA 5K14A 4TSXA 4GW6A 3OYFA 1BCMA 3ZSXA 3VQBA 3ZT0A 4RW9A 4CJUA 4DF4A 3THVA 1TK5A 2XO7A 4I2QA 3RR7A 2ZE2A 5J2QA 1BISA 3SUPA 4DU4A 1S1XA 4DSEA 3NDKA 4AHVA 4PQUA 1S6QA 1QHTA 4CK1A 1XC9A 4BE2A 1SKSA 1RT5A 4CFDA 3SCXA 3KK1A 4DFMA 3V9SA 3SI6A 4FYDA 4XIUA 2B6AA 4FLUA 1B9FA 4RW4A 4CEAA 1ZBHA 5I3UA 4IFVA 2R7YA 4IKFA 3DM2A 1JL2A 2KW4A 3O4QA 3DYAA 2IC3A 3SPZA 2ETJA 2FBTA 3NCIA 3OY9A 4E7LA 3V9WA 4NYNA 4OKEA 1MU2A 4OVLA 2G8KA 1EP4A 4NCGA 1XHXA 3HXMA 3P5JA 1D8YA 3NF9A 4W5RA 3VQCA 3V9UA 2DFFA 3RMDA 1KSPA 3QO9A 1ZBLA 1SL0A 4FW2A 4ZTJA 1EXQA 3ITHA 3SQ4A 4KAZA 3OYEA 3EZ5A 3HPGA 4KV8A 4HTUA 4DWIA 4CK3A 4KTWA 1ZBIA 4OLAA 4CJRA 4ELTA 2JGUA 3ISNC 4E0DA 4CJPA 3DLKA 4AHCA 4FJLA 4KI6A 4KHWA 5JS2A 5CY4A 4M3ZA 3T19A 3NH0A 4CGIA 1Z26A 3VA3A 2EX3A 2OPQA 4UQGA 4O0IA 3L8BA 2OYQA 1TKZA 3QINA 1HQUA 4M3TA 4FW1A 3AA4A 1YTUA 4E19A 4NCAA 4F2RA 4H4MA 3U3GA 1L3SA 4W5NA 4PWDA 1A5VA 4KHYA 4ZHRA 1SV5A 1BQNA 3AVJA 4FZZA 2DTUA 3QEVA 3I0SA 3NHGA 4AHSA 4E7JA 5J2MA 1Z25A 1C6VA 3S3OA 3L2RA 1T7PA 1RTDA 2PY5A 4I9LA 3JYTA 1DTQA 2XY5A 4Z4HA 1S5JA 3OYBA 4AHUA 1U04A 3MEEA 1WSGA 4WE1A 3QERA 1KLMA 3LAMA 3KLGA 3TANA 1SL1A 1UA1A 1U4BA 2HNDA 3AVCA 4BDYA 1NJWA 2G8WA 1B92A 1D5AA 1HJRA 1HNVA 1GOAA 5CYQA 4CJLA 2XHBA 4I9QA 3LWLA 1BIZA 5CZ2A 4O55A 3NH1A 3I0RA 1UOCA 1DTTA 3CM6A 3DMJA 3S9HA 3NGYA 3KK3A 1FK9A 5T7BA 3I8DA 4J2EA 5HP1A 3FFIA 1LWFA 2IAJA 3M8RA 3SZ2A 3TAEA 4JRPA 4C8LA 3ZSRA 1YTAA 3PUFA 3U3YA 4AH9A 3PV8A 3MEGA 4CF2A 4B9TA 2X6NA 3KKSA 3VQAA 4DS4A 4Q0BA 3DRSA 3M8SA 4DTNA 3HJFA 2XY7A 4DSJA 3T1AA 1KVBA 3HP9A 4DTUA 3TABA 3NF6A 3KK2A 3MXJA 1VSDA 3CG7A 3DOKA 3QETA 2YNIA 1NOYA 1C0TA 1D9DA 4HCCA 5J1EA 2P51A 3AVNA 3TAQA 1VSFA 4OPKA 2P5OA 1QE1A 3L2WA 1S1WA 4FJ9A 4DQSA 4CIEA 2F8SA 4CF0A 3SUNA 4OPJA 3QLHA 4AHTA 3NH2A 3QNNA 3OYNA 1NK9A 2YHBA 4FM0A 1W0HA 3PO5A 3SQ2A 2G8IA 3L2UA 3AVIA 1RT1A 3PO4A 4ZTFA 4FLYA 1FXXA 2HHXA 3LZJA 3D45A 1VSMA 4KTQA 4CJVA 3PY8A 2GBZA 4ID1A 3OJUA 1RDDA 2AJQA 3LP0A 5KGXA 4CGGA 2JLEA 2OPSA 4W5QA 1UA0A 3CQ8A 3CM5A 4C8KA 4CHQA 3LDSA 1CLQA 2E4LA 3RMCA 1X9WA 2IS3A 4KPYA 1HQEA 1S9GA 1NOZA 4F4KA 3MEDA 3HP6A 3C94A 4CGHA 3AVAA 2HVHA 2HHQA 4N47A 4HUFA 3MXMA 3CFRA 3MXIA 4RW6A 1N6QA 2RKIA 4C8MA 4CIGA 3RR8A 4FK2A 3SUOA 3A2FA 1TGOA 4FJNA 3E01A 2P5GA 4DSFA 3K5MA 1IG9A 4DFKA 1S6PA 4JLHA 3O4NA 4O4GA 3OYCA 1KCFA 3AO1A 3V6DA 2HHSA 3OYHA 5CYMA 1I39A 1D9FA 1C1AA 3AO3A 1RBVA 1LWEA 3AVMA 4CERA 4W5TA 1Q9XA 3QIPA 1L3TA 1VSIA 1VK0A 2ZQBA 4DTSA 4DS5A 1HRHA 4CEOA 4LH5A 1UWBA 3HPHA 3V1OA 3OS1A 3RTVA 4EZ9A 5C42A 4CCHA 4DG1A 4O44A 4J2DA 2WONA 4YFUA 3S3MA 4FZYA 3WNGA 4EZ6A 1S1TA 1G15A 4DMNA 2G8HA 1O1WA 1RT4A 4GVMA 3D0PA 4M3YA 2X74A 3TAMA 1TK0A 3QIOA 3KLFA 1NKBA 1IKXA 4FM1A 4Z4FA 2I5JA 3NAEA 3AA5X 4IDKA 4HVJA 2QK9A 5C24A 4EP4A 2X78A 5E41A 1NK7A 3L3VA 4RW7A 3EYZA 3SV3A 2GUIA 4ID5A 4HUGA 1JLFA 3LZIA 3HVRA 1X9MA 4OJRA 1JXEA 1BI4B 2P1JA 4CEFA 4B9SA 4CECA 2A1SA 3CFOA 3LP1A 3K5NA 1EETA 1RILA 5HRRA 5I42A 2VG7A 3PX0A 4BDPA 2HHTA 4CIFA 5DK5A 4IG3A 1X9SA 3NFAA 1RT2A 4YNQA 3QEIA 2OA8A 4ELUA 4CJKA 3AVGA 1WLJA 1NKEA 1IKYA 1FKOA 3C95A 4K8ZA 2FBXA 1JKHA 2HMIA 2YNGA 1WSIA 3CYMA 5HBMA 4CFAA 3KIOA 1WSHA 4CE9A 1ASVA 3HT3A 4BACA 4B3OA 1CXUA 3RWUA 2YNFA 4B9LA 1XHZA 4N41A 4DTPA 3G10A 1T05A 2QKBA 4DTOA 2VG5A 5J2NA 4E3SA 3KJVA 3G0ZA 2OPPA 5EU7A 1S9EA 3K5OA 4CESA 4OLBA 4E1MA 1U48A 4IBNA 1K6YA 3HPOA 4CF9A 4FJHA 1U45A 2B5JA 1X1PA 5KRTA 4FJ7A 2O4GA 4FLWA 3LALA 1SL2A 4FJXA 3AA2A 4CFBA 5HRPA 4F3OA 4E7KA 3K58A 3TARA 4FK0A 1WN7A 1A5WA 3RMAA 3S3NA 2O4IA 4H4OA 3HVTA 3SPYA 4Z4IA 1EKEA 3OYKA 1KRPA 4I7FA 1SUQA 3VQEA 2BE2A 1KVCA 2XY6A 3LANA 4O0JA 1HMVA 3AA3A 3HO1A 1RTIA 1BI4A 1VRUA 4CGFA 3OS2A 4J2BA 3MECA 4CJ4A 2Y1JA 2G8FA 2Q3SA 1SKRA 4Z4GA 1LW0A 3AVBA 3BGRA 3DLGA 3LPTA 3CFPA 4DSKA 2BANA 2YV0X 3SJJA 2OZSA 4N56A 4CHPA 1CZ9A 1Q8IA 4CEZA 1ITGA 1J9AA 3RMBA 1TKDA 1NJZA 4M42A 1TKTA 1QQCA 1RDAA 3AVHA 2KZMA 3C6UA 1KTQA 3DI6A 4BWJA 4K8XA 3OYLA 3T3FA 2OPRA 3DRPA 4DTRA 3KD1E 2XY8A 4OGEA 3O3HA 1RT3A 3ZSVA 3LWMA 4NCBA 5KGWA 2RN2A 4QAGA 2KQ2A 3O3GA 1ASWA 1NJYA 1J5OA 4DQIA 4FK4A 3ALYA 2EHGA 1IO2A 3VA0A 1VSLA 3ZT2A 4CJEA 5SWMA 3QEXA 4CFCA 4DTJA 1R0AA 3V1QA 2WOMA 2FBVA 1RCHA 3M8QA 4Z0UA 4I2PA 3ULDA 2QXFA 2YHAA 4HUEA 3BDPA 4LH4A 4Q5VA 3ASMA 4KO0A 3WNEA 1YT3A 2DFHA 4R5PA 3K59A 1KFSA 4FXDA 3VQPA 3OYJA 4DFJA 1JLGA 2B4JA 5SZTA 1IKVA 3AO2A 1RT6A 3HSTB 4B9MA 1RBSA 4CF1A 4NYFA 2HHUA 1REVA 2Z1JA 2ITGA 1I3AA 4KFBA 2F8TA 2PZSA 1C0UA 2OZMA 1LW2A 4DU1A 1YVUA 2KFZA 4CJ3A 3MAQA 4B9NA 1HPZA 4KREA 4BWMA 1NK6A 1L3UA 2Z1GA 5KRSA 4Y1DA 3OYAA 4FM2A 1XI1A 4LY7A 1TL3A 2W42A 4FJKA 1QSLA 4C8OA 4CHZA 1GOCA 1KFDA 3VQQA 3DLEA 2QKKA 2HNZA 3EY1A 4FLTA 1KLNA 4RG8A 3VQ8A 4DLEA 5JS1A 4FLVA 4Z4EA 1HNIA 1TKXA 1RDCA 4ICLA 4W5OA 1F21A 1Y97A 2E6MA 3OS0A 3V9ZA 3DOLA 4CEQA 4B9UA 1VSKA 4DTMA 3NGZA 1Q9YA 3ZSQA 4M41A 3K2PA 3VQ5A 4M3XA 4DTXA 1RTHA 1BCOA 1QSSA 4CHNA 4Y1CA 4FJ8A 4L8RB 2IOCA 2BGGA 1CXQA 1U49A 3ZT3A 3SUQA 2PYJA 4LD0A 3HK2A 3AVLA 2BDPA 1WAJA 2VG6A 4CJSA 1JXBA 3C6TA 3DRRA 3OVNA 2HHWA 4FCYA 3QESA 4FJIA 1BQMA 2KTQA 3PX4A 2YKMA 2HHVA 1KVAA 1XWLA 1S1VA 3K5LA 1ZBFA 3VQ4A 1J54A 3KLEA 3F73A 2Y1IA 4HCBA 1C1CA 1VRTA 1WAFA 4E1NA 4OGCA 2VWJA 1QSYA 4CF8A 3QEPA 1TAUA 1BGXT 5DMRA 1CZBA 5FDLA 3SQ1A 3ZT1A 2DFEA 4M3WA 1LWCA 3IG1A 4KHQA 1UAXA 3QEWA 4E7HA 2KFNA 4PA1A 2D0AA 4KHSA 4JS5A 2D0BA 3OYIA 3O3FA 3SYZA 3KLHA 4QOZB 1DLOA 2ZD1A 1HYVA 4FLZA 4LSNA 5FRMA 4DSLA 4DU3A 4JS4A 4RW8A 4ELVA 1TAQA 2YKNA 4FVMA 4CEDA 1JLAA 3ZCMA 4DSIA 2Z1IA 3NF7A 2IGIA 3IS9A 3V81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MQ3 A;  1ZYQ A;  3LAK A;  3L2Q A;  5C25 A;  5HRO A;  4CJQ A;  4DQP A;  3NF8 A;  4KRF A;  1WNS A;  3WNH A;  3HM9 A;  3HL8 A;  3SV4 A;  2HB5 A;  2LSN A;  4FJ5 A;  4FLX A;  4CJT A;  2FBY A;  3VQ9 A;  3V1R A;  3NE6 A;  3TWH A;  4KB1 A;  1BL3 A;  3ZSZ A;  2ATQ A;  1GOB A;  4G1Q A;  4GMJ B;  3VQ7 A;  1LV5 A;  3QNO A;  4FZX C;  4HHT A;  1RBT A;  2D5R A;  3IRX A;  1NJX A;  4PUO A;  1JLQ A;  1QS4 A;  3AVF A;  3P83 D;  4MFB A;  3SQ0 A;  1L5U A;  2E6L A;  4N76 A;  4DFP A;  2G8V A;  1T8E A;  1L3V A;  5HRN A;  4IG0 A;  1W9H A;  4C8N A;  4DQQ A;  1FKP A;  3VQ6 A;  2GV9 A;  3AO5 A;  4Z4C A;  4DF8 A;  1TVR A;  4AHR A;  4DQR A;  3SNN A;  2HNY A;  1HYS A;  1RBR A;  4CJ5 A;  4EP5 A;  1TK8 A;  2VWK A;  3KKR A;  4CJF A;  5FRN A;  4E7I A;  4CEE A;  3TAF A;  3B6P A;  5FRO A;  2RPI A;  1BIU A;  2IDO A;  3ZSY A;  4F8R A;  3LPU A;  4M3U A;  5J2P A;  3V4I A;  3VQD A;  3H08 A;  3TAG A;  1VSJ A;  4BE1 A;  1TL1 A;  3DLH A;  3ZSO A;  2HW3 A;  1IH7 A;  1RNH A;  1TV6 A;  3AVK A;  1C1B A;  3WNF A;  2NUB A;  3OJS A;  3TI0 A;  2G8U A;  3L3U A;  2PYL A;  4KHN A;  1NK0 A;  4CGJ A;  3UIQ A;  3NBP A;  4OKJ A;  4BE0 A;  1HYZ A;  3KTQ A;  4M3R A;  4AIL C;  5HRS A;  1VSE A;  1IKW A;  3F9K A;  3K57 A;  1RDB A;  3KLI A;  4F3T A;  4DLG A;  2RF2 A;  4B9V A;  3NGI A;  4FJJ A;  3V9X A;  1NK4 A;  4J2A A;  1RTJ A;  2Z1H A;  1WSJ A;  5CZ1 A;  3AV9 A;  4FJM A;  2FC0 A;  4KB0 A;  4LSL A;  2YNH A;  3OYG A;  4JRQ A;  4KI4 A;  2XRI A;  4CEB A;  4E89 A;  1NKC A;  3RRH A;  3RRG A;  1JLE A;  4M45 A;  4PY5 A;  1B9D A;  1T03 A;  4B08 A;  3M8P A;  1JLB A;  3JSM A;  1NK8 A;  5KTQ A;  3DLR A;  4IFY A;  3B6O A;  4QCL A;  4CK2 A;  3ZT4 A;  4KTZ A;  2X6S A;  1WSE A;  3AO4 A;  3KD5 E;  4KKO A;  2A1R A;  4F2S A;  1N5Y A;  3DLB A;  1RT7 A;  4CJW A;  4KHU A;  1ZBU A;  1LAW A;  4OKK A;  3P1G A;  1SKW A;  1EX4 A;  3VN5 A;  1LAV A;  3L2V A;  1RBU A;  4CGD A;  1J53 A;  1VSH A;  3LP3 A;  4B8C A;  4B8A B;  1QTM A;  2KZZ A;  1NK5 A;  1ASU A;  4CHO A;  3PX6 A;  2D0C A;  1S1U A;  3IAY A;  4H8K A;  1U47 A;  3OYD A;  1C0M A;  1WSF A;  4N5S A;  4BDZ A;  4FJG A;  2DY4 A;  1JL1 A;  3TR8 A;  5D3G A;  1A5X A;  5KI6 A;  3ZSW A;  5HLF A;  1JLC A;  3HYF A;  4O5B A;  3U6F A;  3TAP A;  2F96 A;  3LP2 A;  1BHL A;  2HVI A;  3OYM A;  4CHY A;  5K14 A;  4TSX A;  4GW6 A;  3OYF A;  1BCM A;  3ZSX A;  3VQB A;  3ZT0 A;  4RW9 A;  4CJU A;  4DF4 A;  3THV A;  1TK5 A;  2XO7 A;  4I2Q A;  3RR7 A;  2ZE2 A;  5J2Q A;  1BIS A;  3SUP A;  4DU4 A;  1S1X A;  4DSE A;  3NDK A;  4AHV A;  4PQU A;  1S6Q A;  1QHT A;  4CK1 A;  1XC9 A;  4BE2 A;  1SKS A;  1RT5 A;  4CFD A;  3SCX A;  3KK1 A;  4DFM A;  3V9S A;  3SI6 A;  4FYD A;  4XIU A;  2B6A A;  4FLU A;  1B9F A;  4RW4 A;  4CEA A;  1ZBH A;  5I3U A;  4IFV A;  2R7Y A;  4IKF A;  3DM2 A;  1JL2 A;  2KW4 A;  3O4Q A;  3DYA A;  2IC3 A;  3SPZ A;  2ETJ A;  2FBT A;  3NCI A;  3OY9 A;  4E7L A;  3V9W A;  4NYN A;  4OKE A;  1MU2 A;  4OVL A;  2G8K A;  1EP4 A;  4NCG A;  1XHX A;  3HXM A;  3P5J A;  1D8Y A;  3NF9 A;  4W5R A;  3VQC A;  3V9U A;  2DFF A;  3RMD A;  1KSP A;  3QO9 A;  1ZBL A;  1SL0 A;  4FW2 A;  4ZTJ A;  1EXQ A;  3ITH A;  3SQ4 A;  4KAZ A;  3OYE A;  3EZ5 A;  3HPG A;  4KV8 A;  4HTU A;  4DWI A;  4CK3 A;  4KTW A;  1ZBI A;  4OLA A;  4CJR A;  4ELT A;  2JGU A;  3ISN C;  4E0D A;  4CJP A;  3DLK A;  4AHC A;  4FJL A;  4KI6 A;  4KHW A;  5JS2 A;  5CY4 A;  4M3Z A;  3T19 A;  3NH0 A;  4CGI A;  1Z26 A;  3VA3 A;  2EX3 A;  2OPQ A;  4UQG A;  4O0I A;  3L8B A;  2OYQ A;  1TKZ A;  3QIN A;  1HQU A;  4M3T A;  4FW1 A;  3AA4 A;  1YTU A;  4E19 A;  4NCA A;  4F2R A;  4H4M A;  3U3G A;  1L3S A;  4W5N A;  4PWD A;  1A5V A;  4KHY A;  4ZHR A;  1SV5 A;  1BQN A;  3AVJ A;  4FZZ A;  2DTU A;  3QEV A;  3I0S A;  3NHG A;  4AHS A;  4E7J A;  5J2M A;  1Z25 A;  1C6V A;  3S3O A;  3L2R A;  1T7P A;  1RTD A;  2PY5 A;  4I9L A;  3JYT A;  1DTQ A;  2XY5 A;  4Z4H A;  1S5J A;  3OYB A;  4AHU A;  1U04 A;  3MEE A;  1WSG A;  4WE1 A;  3QER A;  1KLM A;  3LAM A;  3KLG A;  3TAN A;  1SL1 A;  1UA1 A;  1U4B A;  2HND A;  3AVC A;  4BDY A;  1NJW A;  2G8W A;  1B92 A;  1D5A A;  1HJR A;  1HNV A;  1GOA A;  5CYQ A;  4CJL A;  2XHB A;  4I9Q A;  3LWL A;  1BIZ A;  5CZ2 A;  4O55 A;  3NH1 A;  3I0R A;  1UOC A;  1DTT A;  3CM6 A;  3DMJ A;  3S9H A;  3NGY A;  3KK3 A;  1FK9 A;  5T7B A;  3I8D A;  4J2E A;  5HP1 A;  3FFI A;  1LWF A;  2IAJ A;  3M8R A;  3SZ2 A;  3TAE A;  4JRP A;  4C8L A;  3ZSR A;  1YTA A;  3PUF A;  3U3Y A;  4AH9 A;  3PV8 A;  3MEG A;  4CF2 A;  4B9T A;  2X6N A;  3KKS A;  3VQA A;  4DS4 A;  4Q0B A;  3DRS A;  3M8S A;  4DTN A;  3HJF A;  2XY7 A;  4DSJ A;  3T1A A;  1KVB A;  3HP9 A;  4DTU A;  3TAB A;  3NF6 A;  3KK2 A;  3MXJ A;  1VSD A;  3CG7 A;  3DOK A;  3QET A;  2YNI A;  1NOY A;  1C0T A;  1D9D A;  4HCC A;  5J1E A;  2P51 A;  3AVN A;  3TAQ A;  1VSF A;  4OPK A;  2P5O A;  1QE1 A;  3L2W A;  1S1W A;  4FJ9 A;  4DQS A;  4CIE A;  2F8S A;  4CF0 A;  3SUN A;  4OPJ A;  3QLH A;  4AHT A;  3NH2 A;  3QNN A;  3OYN A;  1NK9 A;  2YHB A;  4FM0 A;  1W0H A;  3PO5 A;  3SQ2 A;  2G8I A;  3L2U A;  3AVI A;  1RT1 A;  3PO4 A;  4ZTF A;  4FLY A;  1FXX A;  2HHX A;  3LZJ A;  3D45 A;  1VSM A;  4KTQ A;  4CJV A;  3PY8 A;  2GBZ A;  4ID1 A;  3OJU A;  1RDD A;  2AJQ A;  3LP0 A;  5KGX A;  4CGG A;  2JLE A;  2OPS A;  4W5Q A;  1UA0 A;  3CQ8 A;  3CM5 A;  4C8K A;  4CHQ A;  3LDS A;  1CLQ A;  2E4L A;  3RMC A;  1X9W A;  2IS3 A;  4KPY A;  1HQE A;  1S9G A;  1NOZ A;  4F4K A;  3MED A;  3HP6 A;  3C94 A;  4CGH A;  3AVA A;  2HVH A;  2HHQ A;  4N47 A;  4HUF A;  3MXM A;  3CFR A;  3MXI A;  4RW6 A;  1N6Q A;  2RKI A;  4C8M A;  4CIG A;  3RR8 A;  4FK2 A;  3SUO A;  3A2F A;  1TGO A;  4FJN A;  3E01 A;  2P5G A;  4DSF A;  3K5M A;  1IG9 A;  4DFK A;  1S6P A;  4JLH A;  3O4N A;  4O4G A;  3OYC A;  1KCF A;  3AO1 A;  3V6D A;  2HHS A;  3OYH A;  5CYM A;  1I39 A;  1D9F A;  1C1A A;  3AO3 A;  1RBV A;  1LWE A;  3AVM A;  4CER A;  4W5T A;  1Q9X A;  3QIP A;  1L3T A;  1VSI A;  1VK0 A;  2ZQB A;  4DTS A;  4DS5 A;  1HRH A;  4CEO A;  4LH5 A;  1UWB A;  3HPH A;  3V1O A;  3OS1 A;  3RTV A;  4EZ9 A;  5C42 A;  4CCH A;  4DG1 A;  4O44 A;  4J2D A;  2WON A;  4YFU A;  3S3M A;  4FZY A;  3WNG A;  4EZ6 A;  1S1T A;  1G15 A;  4DMN A;  2G8H A;  1O1W A;  1RT4 A;  4GVM A;  3D0P A;  4M3Y A;  2X74 A;  3TAM A;  1TK0 A;  3QIO A;  3KLF A;  1NKB A;  1IKX A;  4FM1 A;  4Z4F A;  2I5J A;  3NAE A;  3AA5 X;  4IDK A;  4HVJ A;  2QK9 A;  5C24 A;  4EP4 A;  2X78 A;  5E41 A;  1NK7 A;  3L3V A;  4RW7 A;  3EYZ A;  3SV3 A;  2GUI A;  4ID5 A;  4HUG A;  1JLF A;  3LZI A;  3HVR A;  1X9M A;  4OJR A;  1JXE A;  1BI4 B;  2P1J A;  4CEF A;  4B9S A;  4CEC A;  2A1S A;  3CFO A;  3LP1 A;  3K5N A;  1EET A;  1RIL A;  5HRR A;  5I42 A;  2VG7 A;  3PX0 A;  4BDP A;  2HHT A;  4CIF A;  5DK5 A;  4IG3 A;  1X9S A;  3NFA A;  1RT2 A;  4YNQ A;  3QEI A;  2OA8 A;  4ELU A;  4CJK A;  3AVG A;  1WLJ A;  1NKE A;  1IKY A;  1FKO A;  3C95 A;  4K8Z A;  2FBX A;  1JKH A;  2HMI A;  2YNG A;  1WSI A;  3CYM A;  5HBM A;  4CFA A;  3KIO A;  1WSH A;  4CE9 A;  1ASV A;  3HT3 A;  4BAC A;  4B3O A;  1CXU A;  3RWU A;  2YNF A;  4B9L A;  1XHZ A;  4N41 A;  4DTP A;  3G10 A;  1T05 A;  2QKB A;  4DTO A;  2VG5 A;  5J2N A;  4E3S A;  3KJV A;  3G0Z A;  2OPP A;  5EU7 A;  1S9E A;  3K5O A;  4CES A;  4OLB A;  4E1M A;  1U48 A;  4IBN A;  1K6Y A;  3HPO A;  4CF9 A;  4FJH A;  1U45 A;  2B5J A;  1X1P A;  5KRT A;  4FJ7 A;  2O4G A;  4FLW A;  3LAL A;  1SL2 A;  4FJX A;  3AA2 A;  4CFB A;  5HRP A;  4F3O A;  4E7K A;  3K58 A;  3TAR A;  4FK0 A;  1WN7 A;  1A5W A;  3RMA A;  3S3N A;  2O4I A;  4H4O A;  3HVT A;  3SPY A;  4Z4I A;  1EKE A;  3OYK A;  1KRP A;  4I7F A;  1SUQ A;  3VQE A;  2BE2 A;  1KVC A;  2XY6 A;  3LAN A;  4O0J A;  1HMV A;  3AA3 A;  3HO1 A;  1RTI A;  1BI4 A;  1VRU A;  4CGF A;  3OS2 A;  4J2B A;  3MEC A;  4CJ4 A;  2Y1J A;  2G8F A;  2Q3S A;  1SKR A;  4Z4G A;  1LW0 A;  3AVB A;  3BGR A;  3DLG A;  3LPT A;  3CFP A;  4DSK A;  2BAN A;  2YV0 X;  3SJJ A;  2OZS A;  4N56 A;  4CHP A;  1CZ9 A;  1Q8I A;  4CEZ A;  1ITG A;  1J9A A;  3RMB A;  1TKD A;  1NJZ A;  4M42 A;  1TKT A;  1QQC A;  1RDA A;  3AVH A;  2KZM A;  3C6U A;  1KTQ A;  3DI6 A;  4BWJ A;  4K8X A;  3OYL A;  3T3F A;  2OPR A;  3DRP A;  4DTR A;  3KD1 E;  2XY8 A;  4OGE A;  3O3H A;  1RT3 A;  3ZSV A;  3LWM A;  4NCB A;  5KGW A;  2RN2 A;  4QAG A;  2KQ2 A;  3O3G A;  1ASW A;  1NJY A;  1J5O A;  4DQI A;  4FK4 A;  3ALY A;  2EHG A;  1IO2 A;  3VA0 A;  1VSL A;  3ZT2 A;  4CJE A;  5SWM A;  3QEX A;  4CFC A;  4DTJ A;  1R0A A;  3V1Q A;  2WOM A;  2FBV A;  1RCH A;  3M8Q A;  4Z0U A;  4I2P A;  3ULD A;  2QXF A;  2YHA A;  4HUE A;  3BDP A;  4LH4 A;  4Q5V A;  3ASM A;  4KO0 A;  3WNE A;  1YT3 A;  2DFH A;  4R5P A;  3K59 A;  1KFS A;  4FXD A;  3VQP A;  3OYJ A;  4DFJ A;  1JLG A;  2B4J A;  5SZT A;  1IKV A;  3AO2 A;  1RT6 A;  3HST B;  4B9M A;  1RBS A;  4CF1 A;  4NYF A;  2HHU A;  1REV A;  2Z1J A;  2ITG A;  1I3A A;  4KFB A;  2F8T A;  2PZS A;  1C0U A;  2OZM A;  1LW2 A;  4DU1 A;  1YVU A;  2KFZ A;  4CJ3 A;  3MAQ A;  4B9N A;  1HPZ A;  4KRE A;  4BWM A;  1NK6 A;  1L3U A;  2Z1G A;  5KRS A;  4Y1D A;  3OYA A;  4FM2 A;  1XI1 A;  4LY7 A;  1TL3 A;  2W42 A;  4FJK A;  1QSL A;  4C8O A;  4CHZ A;  1GOC A;  1KFD A;  3VQQ A;  3DLE A;  2QKK A;  2HNZ A;  3EY1 A;  4FLT A;  1KLN A;  4RG8 A;  3VQ8 A;  4DLE A;  5JS1 A;  4FLV A;  4Z4E A;  1HNI A;  1TKX A;  1RDC A;  4ICL A;  4W5O A;  1F21 A;  1Y97 A;  2E6M A;  3OS0 A;  3V9Z A;  3DOL A;  4CEQ A;  4B9U A;  1VSK A;  4DTM A;  3NGZ A;  1Q9Y A;  3ZSQ A;  4M41 A;  3K2P A;  3VQ5 A;  4M3X A;  4DTX A;  1RTH A;  1BCO A;  1QSS A;  4CHN A;  4Y1C A;  4FJ8 A;  4L8R B;  2IOC A;  2BGG A;  1CXQ A;  1U49 A;  3ZT3 A;  3SUQ A;  2PYJ A;  4LD0 A;  3HK2 A;  3AVL A;  2BDP A;  1WAJ A;  2VG6 A;  4CJS A;  1JXB A;  3C6T A;  3DRR A;  3OVN A;  2HHW A;  4FCY A;  3QES A;  4FJI A;  1BQM A;  2KTQ A;  3PX4 A;  2YKM A;  2HHV A;  1KVA A;  1XWL A;  1S1V A;  3K5L A;  1ZBF A;  3VQ4 A;  1J54 A;  3KLE A;  3F73 A;  2Y1I A;  4HCB A;  1C1C A;  1VRT A;  1WAF A;  4E1N A;  4OGC A;  2VWJ A;  1QSY A;  4CF8 A;  3QEP A;  1TAU A;  1BGX T;  5DMR A;  1CZB A;  5FDL A;  3SQ1 A;  3ZT1 A;  2DFE A;  4M3W A;  1LWC A;  3IG1 A;  4KHQ A;  1UAX A;  3QEW A;  4E7H A;  2KFN A;  4PA1 A;  2D0A A;  4KHS A;  4JS5 A;  2D0B A;  3OYI A;  3O3F A;  3SYZ A;  3KLH A;  4QOZ B;  1DLO A;  2ZD1 A;  1HYV A;  4FLZ A;  4LSN A;  5FRM A;  4DSL A;  4DU3 A;  4JS4 A;  4RW8 A;  4ELV A;  1TAQ A;  2YKN A;  4FVM A;  4CED A;  1JLA A;  3ZCM A;  4DSI A;  2Z1I A;  3NF7 A;  2IGI A;  3IS9 A;  3V81 A; 
#chains in the Genus database with same CATH topology
 1W2B M;  1ZYQ A;  5BRE A;  3HM9 A;  3HL8 A;  2HB5 A;  4DUY K;  2HBK A;  3TWH A;  1BL3 A;  3ZSZ A;  2ATQ A;  3IUC A;  4ILH A;  2UUA K;  4BR7 A;  3QNO A;  5TKW A;  4HHT A;  2D5R A;  1U6Z A;  3SQ0 A;  4N76 A;  4DFP A;  1T8E A;  1VHX A;  3CCM N;  1W9H A;  4DF8 A;  1TVR A;  1TK8 A;  2ZWH A;  3KKR A;  5FRN A;  1XNR K;  4E7I A;  1VQ7 N;  4BQL A;  4CEE A;  3B6P A;  3F2K A;  3J7A P;  3LPU A;  4AQY K;  3VQD A;  4BE1 A;  3VTI A;  2HW3 A;  3J8A A;  3AVK A;  2PFU A;  3UB5 A;  5EXW A;  1Q82 O;  1VQ5 N;  4DR7 K;  4NO7 A;  4KHN A;  3PIO L;  4CGJ A;  3UIQ A;  5M1K A;  4NLC A;  4BE0 A;  1VSE A;  1IKW A;  3KLI A;  2RF2 A;  2ZJP L;  4FJJ A;  3V9X A;  4J2A A;  1RTJ A;  1Q18 A;  3HBT A;  2FC0 A;  3VF4 A;  4CEB A;  4M45 A;  4PY5 A;  1JLB A;  5KTQ A;  3RVC A;  4CK2 A;  4KTZ A;  2X6S A;  5BRH A;  4F2S A;  4DV4 K;  4BRL A;  4KHU A;  1LAW A;  1OH5 A;  4DV7 K;  1EX4 A;  1S22 A;  4LF6 K;  4DQ8 A;  2YHX A;  5AQP A;  4NXM K;  4CHO A;  4FPB A;  4WQ5 A;  1YAG A;  2UUC K;  1U47 A;  3BF3 A;  3DWL A;  3OYD A;  2DY4 A;  3TR8 A;  4BG8 A;  5HLF A;  1JLC A;  1MDU B;  2CGJ A;  5CHI A;  5AFU H;  2F96 A;  3C6A A;  2P9S B;  3OYM A;  4GW6 A;  5HOO A;  1BCM A;  1KXP A;  3VQB A;  3ZT0 A;  4CJU A;  3THV A;  2XO7 A;  4FL9 A;  3GL1 A;  4BQZ A;  4U67 L;  1X9J A;  3JXU A;  5J2Q A;  4AHV A;  2FSK A;  3VEZ A;  1XC9 A;  1SKS A;  4BE2 A;  1RT5 A;  4AM6 A;  3SCX A;  4FYD A;  4EHU A;  4LC9 B;  1ZBH A;  4FLU A;  1B9F A;  1GLC G;  4JI0 K;  3IMX A;  4IFV A;  3L4Q A;  2P9P B;  2KW4 A;  3NVK A;  4PL8 A;  2ETJ A;  3OY9 A;  4OKE A;  1QQN A;  4NCG A;  1XHX A;  3HXM A;  3RMD A;  2DFF A;  3SAH A;  5LMN K;  4FW2 A;  4ZTJ A;  3ITH A;  3EZ5 A;  4RWT A;  3THY A;  4B1V A;  4ELT A;  1R59 O;  2P9U B;  3ISN C;  2AA4 A;  2IVO A;  4KHW A;  3T19 A;  3VA3 A;  2YX6 A;  4MLH A;  4MDB A;  4K0K K;  2P9S A;  1VQO N;  4E19 A;  4IOC L;  4NCA A;  4CI6 A;  2F4V K;  2QWN A;  4KHY A;  1SV5 A;  1BQN A;  3AVJ A;  2FF3 B;  1MWM A;  4KH4 A;  1OH6 A;  3CXC M;  1T7P A;  4EIA A;  3A5O C;  4AHU A;  4ISG A;  4WE1 A;  3QER A;  1KLM A;  3KLG A;  1U4B A;  2QWM A;  3AVC A;  1NJW A;  1RGI A;  2P9P A;  1HJR A;  3LWL A;  4UY8 O;  3H1V X;  1EWR A;  1DTT A;  3ZX2 A;  3VGM A;  1FK9 A;  4IXC A;  3HTV A;  2IAJ A;  3M8R A;  3PUF A;  3PV8 A;  1E4G T;  4BRQ A;  3KKS A;  3W3D A;  3M8S A;  2P9U A;  4OO1 J;  3HJF A;  4YHH K;  3NF6 A;  4O8K A;  3CCJ N;  3QB0 A;  5J1E A;  3IDH A;  1VSF A;  1QE1 A;  3L2W A;  1HKB A;  4LF9 K;  1S1W A;  4FJ9 A;  4CIE A;  2HBJ A;  4AHT A;  2VQF K;  3OYN A;  3AVI A;  4FLY A;  1KAY A;  2HHX A;  1JJ2 M;  3OJU A;  5KGX A;  4JI7 K;  1CLQ A;  2E4L A;  4KPY A;  4ISE A;  1S9G A;  1NOZ A;  4F4K A;  3HP6 A;  1E3M A;  3AVA A;  4N47 A;  3DLL L;  3MXI A;  1N6Q A;  3CER A;  4DR1 K;  2W6K A;  3T1H K;  4DSF A;  4DFK A;  4CBX A;  3O4N A;  4O4G A;  1KCF A;  3AO1 A;  3D2E B;  3OYH A;  1QQO A;  1C1A A;  3AO3 A;  3AVM A;  1VSI A;  4H5N A;  4CEO A;  2UXB K;  3NMU A;  4J2D A;  4B3T K;  1J6Z A;  1G15 A;  4QS9 A;  4CJ7 A;  1ILY A;  4EAH D;  4JKF A;  2Q0U A;  4FM1 A;  4RTF D;  3AA5 X;  4IDK A;  2Q2R A;  3I8B A;  3G6E N;  3L3V A;  2E2O A;  4RW7 A;  3EYZ A;  2IIR A;  3SV3 A;  3LZI A;  3CHW A;  3H6E A;  2NRH A;  1X9M A;  5GAE P;  1RFQ A;  4OJR A;  3P4I A;  4CEC A;  3UE5 A;  3SMP A;  5I42 A;  1RT2 A;  2JWL A;  4YNQ A;  3WQT A;  1WLJ A;  1NKE A;  1FKO A;  3C95 A;  3CPW M;  2FBX A;  4K8Z A;  4CFA A;  3KIO A;  4BAC A;  4B3O A;  1NGG A;  3D2E A;  2YNF A;  4A5B A;  5B8H A;  4EHT A;  2Q97 A;  3G10 A;  1M90 O;  4DTO A;  3G0Z A;  1YJN N;  4KH6 A;  1U48 A;  4IBN A;  4FJH A;  3RSE B;  4IO9 L;  2O4G A;  4FLW A;  1SL2 A;  4FWO A;  5AQS A;  3GOI A;  4H4O A;  1EKE A;  3BEX A;  3LAN A;  3QBW A;  1HMV A;  4BGA A;  3TSQ A;  3HO1 A;  2A3Z A;  1RTI A;  4JAX A;  1LW0 A;  3AVB A;  4BRA A;  1J9A A;  2NRW A;  4M42 A;  1T6C A;  3DI6 A;  4BWJ A;  3OYL A;  3BP8 A;  3KD1 E;  2EWS A;  3O3H A;  3A5L C;  3F5T A;  3LWM A;  2RN2 A;  4QAG A;  1ASW A;  1J5O A;  4H5W A;  4DQI A;  4IDH A;  2EHG A;  2V7Y A;  3R6M A;  3O5B A;  1N34 K;  3RSE A;  3V1Q A;  2FBV A;  4DB3 A;  4I2P A;  1NGH A;  3WT0 A;  2W40 A;  3WNE A;  1VQ4 N;  2DFH A;  5AR0 A;  3AO2 A;  5AQY A;  4CF1 A;  1REV A;  2F8T A;  4B9N A;  1HPZ A;  1HNW K;  5C0Y A;  1L3U A;  3ULE B;  4FM2 A;  2W42 A;  4DHY A;  3FFK B;  4CHZ A;  3D2F B;  1KFD A;  4BGB A;  1KLN A;  1RDU A;  4W5O A;  4HWI A;  3VER A;  3V9Z A;  4BRE A;  3UKR B;  3TU5 A;  3ZSQ A;  4H0Y B;  1NJI O;  3O9Q A;  4BRC A;  3SMS A;  2AP1 A;  1QSS A;  2KHO A;  1CXQ A;  1T6D A;  2IVP A;  3HK2 A;  1WAJ A;  2VG6 A;  1JXB A;  2HHW A;  4FCY A;  4FJI A;  3QML A;  1NG9 A;  3K5L A;  3CET A;  4CF8 A;  3QEP A;  4H03 B;  5DMR A;  3KHY A;  3SQ1 A;  4F9O A;  3AAP A;  1LWC A;  5LMU K;  4KHS A;  3O3F A;  1HLU A;  3U9D A;  2ZGZ A;  3ULE A;  4DSL A;  4NLB A;  3OW2 M;  3D2F A;  2DPN A;  2V7Z A;  3R1X A;  3NF7 A;  5HP1 A;  3V81 A;  4MQ3 A;  3L2Q A;  5HRO A;  5C25 A;  4BRN A;  4FLX A;  4CJT A;  3UKR A;  4K43 A;  3NE6 A;  4KB1 A;  4JKC A;  1RDW X;  4G1Q A;  3U9Z A;  1N32 K;  1LV5 A;  3IRX A;  4AF1 A;  4BRG A;  3AVF A;  4CW7 B;  1P90 A;  3P83 D;  4IOX A;  2E6L A;  2G8V A;  1L3V A;  3GE1 A;  4IG0 A;  4JV5 K;  4DQQ A;  4C8N A;  1FKP A;  1CZA N;  1BWF O;  2GV9 A;  2QTD A;  4AHR A;  4JD2 B;  4DQR A;  1HYS A;  1RBR A;  2W6L A;  4GNI A;  3TAF A;  5FRO A;  1BIU A;  4F8R A;  4JI5 K;  3E9P A;  5J2P A;  3V4I A;  3K9J A;  4M3U A;  3DLH A;  1TL1 A;  1IH7 A;  1TV6 A;  3OJS A;  2YHY A;  3TI0 A;  2G8U A;  2PYL A;  3L3U A;  2O8B B;  1NK0 A;  4JKD A;  4B3M K;  3ZX0 A;  3KTQ A;  3SJH A;  5HRS A;  3CCQ N;  3F9K A;  1RDB A;  4M7Y A;  3CJB A;  5M1F A;  2Z1H A;  5CZ1 A;  3FZF A;  4JK8 A;  3AV9 A;  1NBW A;  1SZ2 A;  4FJM A;  4LSL A;  2YNH A;  1MA9 B;  1YJ9 N;  5HL7 L;  4CZK A;  3M8P A;  4IFY A;  5AQG A;  3MWP A;  2IVN A;  1WSE A;  3KD5 E;  2A1R A;  2HF3 A;  1N5Y A;  1ZBU A;  3P1G A;  4XEI A;  1LAV A;  5BRF A;  4IO8 A;  4B8C A;  4B8A B;  4JI4 K;  4CZG A;  4JD2 A;  4BC3 A;  4JKB A;  2FXU A;  2RHK A;  3BZC A;  1S1U A;  3T69 A;  5TKY A;  3M3Z A;  4BDZ A;  3A0I X;  4J8F A;  1A5X A;  4C1N I;  4X66 K;  3HYF A;  1Q7Y O;  4GKK K;  4IJN A;  2E5L K;  4O5B A;  3TAP A;  2O8B A;  3LP2 A;  2HVI A;  3RR7 A;  2NNW A;  3VMF B;  1BIS A;  2I7P A;  4DU4 A;  3SUP A;  4PKG A;  5BR8 K;  4BRK A;  1QHT A;  3SK3 A;  1DGK N;  4CK1 A;  1KAX A;  4CFD A;  3SI6 A;  3N4Q A;  4DFM A;  5AQZ A;  4XIU A;  2B6A A;  4RW4 A;  4JI6 K;  4IOA L;  3J7Y P;  2R7Y A;  3CCL N;  4IKF A;  3DM2 A;  1JL2 A;  3SPZ A;  3DYA A;  2A6A A;  3WXK A;  3NCI A;  4E7L A;  4BC2 A;  4NYN A;  1JCE A;  1HX1 A;  2KLA A;  2G8K A;  1EP4 A;  1D8Y A;  1KSP A;  2YCH A;  4W5R A;  3VQC A;  3T1Y K;  5M1O A;  2VCP A;  3QO9 A;  1SL0 A;  3C6H A;  1EXQ A;  3SQ4 A;  3OYE A;  2HBM A;  4DWI A;  4KTW A;  2VYP A;  4OLA A;  2JGU A;  1YXQ A;  1NGA A;  4E0D A;  2A40 A;  5AQH A;  3LDN A;  5BN9 A;  3HOS A;  1Z26 A;  2EX3 A;  4UQG A;  3L8B A;  1TKZ A;  3THW B;  3AA4 A;  3FZL A;  1YTU A;  1QHA A;  1VQ8 N;  4PWD A;  2DTU A;  3QEV A;  3NHG A;  4AHS A;  5J2M A;  2HOE A;  2PY5 A;  2XY5 A;  1S5J A;  1U04 A;  4BDY A;  2G8W A;  1GOA A;  1BIZ A;  2YHW A;  3AGR A;  3I0R A;  1UOC A;  4BRH A;  1YHQ N;  3R3L A;  3CM6 A;  3DMJ A;  4YOR A;  3NGY A;  3I8D A;  3A8Y A;  1NWK A;  3MX5 A;  3MK6 A;  4FVU A;  1LWF A;  3SZ2 A;  3TAE A;  3H1Q A;  3EO3 A;  4AH9 A;  3WEE B;  4B9T A;  1YI2 N;  3VQA A;  4Q0B A;  5AQK A;  3DRS A;  4DTN A;  1NGE A;  4H0V B;  1KVB A;  2E88 A;  4DTU A;  4FOI A;  1VSD A;  3DOK A;  1NOY A;  3K9K A;  2P9N B;  2P51 A;  4FWQ A;  3THW A;  4DQS A;  2F8S A;  1XMO K;  4KBO A;  3QLH A;  3NH2 A;  4FOE A;  3SQ2 A;  2OCE A;  1RT1 A;  4ZTF A;  1FXX A;  2PBD A;  1XUP O;  4KTQ A;  1IJJ A;  4CJV A;  1S72 N;  3FLC O;  4ID1 A;  3LP0 A;  4CGG A;  3Q7B A;  3LDP A;  3A5N C;  4C8K A;  4JI8 K;  4JHD B;  3RMC A;  2IS3 A;  1HQE A;  4XH5 A;  4BC5 A;  5I9E B;  3SAF A;  3MED A;  3O1W A;  3C94 A;  2WBN A;  4X65 K;  3MXM A;  3OHR A;  4C8M A;  4CIG A;  3SUO A;  4FWN A;  1EQY A;  1S6P A;  4Y0W A;  3WEE A;  2HHS A;  2E1Y A;  5CYM A;  1D9F A;  1Q9X A;  3KWG A;  3CF5 L;  1KD1 O;  4LH5 A;  3HPH A;  3RTV A;  3ZLJ A;  4EZ9 A;  3THX B;  2P9N A;  4EZ6 A;  1S1T A;  3WUH A;  2G8H A;  3CCV N;  1YUW A;  3D0P A;  1K9M O;  4M3Y A;  2X74 A;  3SBG A;  3TAM A;  4BR4 A;  4ILG B;  1NKB A;  4KHP K;  1IKX A;  4JI2 K;  4Z4F A;  1TYQ B;  4HVJ A;  5C24 A;  3ENB A;  3JS6 A;  3HVR A;  1JXE A;  2P1J A;  4IEI A;  4CEF A;  4GY2 B;  4JHD A;  3LM9 A;  1EET A;  1RIL A;  2VG7 A;  3TTC A;  4BDP A;  2HHT A;  4IG3 A;  3CJ1 A;  3W0L A;  3AVG A;  3MCA B;  4XH4 A;  3VF2 A;  5GAH P;  3ZX3 A;  2YNG A;  1ASV A;  5FPE A;  2E1Z A;  5AQR A;  1T05 A;  4DR3 K;  3KK7 A;  4E3S A;  3KJV A;  2OPP A;  5EU7 A;  4E1M A;  3THX A;  1K6Y A;  3HPO A;  1X1P A;  4LF4 K;  2QI2 A;  4FJX A;  3QFP A;  4CFB A;  4F3O A;  5AQW A;  1A5W A;  1NGJ A;  1TYQ A;  3CQY A;  3RMA A;  3S3N A;  2QEX N;  3CCU N;  3HVT A;  4I7F A;  1SUQ A;  2O8D B;  4H0P A;  3AA3 A;  3OS2 A;  1EWQ A;  2Y1J A;  3BGR A;  3DLG A;  3LPT A;  3CFP A;  2E8A A;  3AY9 A;  5M1Q A;  3CME N;  2BAN A;  5AFU A;  4N56 A;  1VQL N;  1Q8I A;  4CEZ A;  1TKD A;  1NJZ A;  3IKM A;  3K0S A;  1RDA A;  2KZM A;  3EEQ A;  4JKE A;  4DTR A;  2QM1 A;  3WXL A;  3JAM O;  5KPZ A;  5KGW A;  3SLC A;  3ZYY X;  1YF5 L;  4FK4 A;  4AM7 A;  3ALY A;  2ZJQ L;  1IO2 A;  5SWM A;  4WQ4 C;  3QEX A;  4CFC A;  4DTJ A;  1OKJ A;  4CZL A;  1VQP N;  2E20 A;  3PIP L;  3I55 N;  3CIP A;  3K59 A;  3ASM A;  4KO0 A;  4R5P A;  4CZF A;  4BC4 A;  3VQP A;  2Q0R A;  1N8R O;  4BRF A;  5M1P A;  5DM7 L;  3FE1 A;  3LM2 A;  1IKV A;  2I7N A;  2O8D A;  2HHU A;  4KFB A;  1C0U A;  4H0X B;  4DU1 A;  2V51 B;  2H3G X;  1X3M A;  4BWM A;  1TL3 A;  4HTL A;  3CJ9 A;  1QSL A;  1ATR A;  3DLE A;  2HNZ A;  5BPL A;  4DLE A;  1M1K O;  1TKX A;  4YOY A;  3EKS A;  1F21 A;  1Y97 A;  3OS0 A;  4CEQ A;  2WUS A;  4DTM A;  3NGZ A;  2CH6 A;  4K41 A;  5AQX A;  2UXD K;  1HJO A;  1ATS A;  4M41 A;  4M3X A;  1NGF A;  1RTH A;  4MLE A;  4BRD A;  4FJ8 A;  5KPR A;  2ZM6 K;  4LD0 A;  2BDP A;  4CJS A;  3DRR A;  3OVN A;  2P9I B;  4LF7 K;  2HBL A;  2KTQ A;  4WFB L;  1KVA A;  1ZBF A;  3VQ4 A;  1J54 A;  3KLE A;  4Z4E A;  4E1N A;  1WAF A;  2VWJ A;  4OGC A;  1VQM N;  4C23 A;  1WB9 A;  1BGX T;  1QZ5 A;  4M3W A;  3E9O A;  1XNQ K;  3DXM B;  3IG1 A;  3CC7 N;  5AZJ B;  2QA4 N;  3I56 N;  2KFN A;  1NGI A;  4JS5 A;  1GLD G;  2D0B A;  3KLH A;  3ENH A;  4FLZ A;  4LSN A;  3CMA N;  1X3N A;  1JCG A;  1TAQ A;  3WQU A;  3PSI A;  4DSI A;  3IS9 A;  4CJQ A;  3WNH A;  3SV4 A;  1NNE A;  4FJ5 A;  2LSN A;  2W41 A;  3MDQ A;  2FBY A;  3V1R A;  4FZX C;  1VQN N;  3O4W A;  1JLQ A;  5GIP A;  4YOW A;  4LF8 K;  1L5U A;  4O5F A;  2NRR A;  4WCE L;  5DM6 L;  2P9I A;  3AO5 A;  4Z4C A;  4OPA A;  4CJ5 A;  3WXJ A;  4EP5 A;  2VWK A;  4CJF A;  3HOT A;  4O8U A;  2RPI A;  2IDO A;  3ZSY A;  4LFB K;  3TAG A;  4JK9 A;  4B1Z A;  1VSJ A;  5GIN A;  1RNH A;  3WNF A;  1C1B A;  2NUB A;  3DXM A;  3NBP A;  4OKJ A;  1Z05 A;  3TSP A;  4M3R A;  4DLG A;  4A59 A;  5JIC A;  5H1S Q;  1NK4 A;  2PAV A;  1WSJ A;  1V4T A;  1XC3 A;  4KI4 A;  2XRI A;  4E89 A;  2F9W A;  1NKC A;  4DV1 K;  3RRG A;  2D1K A;  3JSM A;  4B3S K;  1NK8 A;  4OX9 K;  3U4L A;  2QXL A;  3OTO K;  3VEX A;  5BRD A;  3B6O A;  2QW9 A;  4KKO A;  1ESV A;  3DLB A;  4K25 A;  4DCH A;  1SKW A;  4CGD A;  1J53 A;  1QTM A;  2KZZ A;  1NK5 A;  3R8E A;  3FGU A;  2D0C A;  3IAY A;  4H8K A;  3M1F A;  2NRX A;  1WSF A;  4N5S A;  2ZJR L;  1TUU A;  4FJG A;  1JL1 A;  3ZSW A;  3VGK A;  2WC9 A;  3MN7 A;  3U6F A;  5GAG P;  4CHY A;  5K14 A;  4CBW A;  3OYF A;  3CCS N;  3ZSX A;  3TTF A;  1TK5 A;  1NU0 A;  3TPQ A;  4KH5 A;  4XH1 A;  4DSE A;  3P39 A;  4PQU A;  4C1N K;  3VEV A;  4LF5 K;  4B1W B;  4JKA A;  3ZEU B;  4CEA A;  1HPM A;  5I3U A;  4GV6 A;  4A5A A;  5LY3 A;  1QZ6 A;  3O4Q A;  3VPZ A;  2FBT A;  1NMD A;  5BPN A;  3V9W A;  1MU2 A;  4OVL A;  2P5O A;  3P5J A;  1IG8 A;  4JEP A;  3GBT A;  3O9R A;  1ZBL A;  1KAZ A;  4KAZ A;  4CD1 A;  4HTU A;  1N33 K;  4CK3 A;  1ZBI A;  4A61 A;  4CJR A;  1U2V B;  4FJL A;  1YJW N;  4KI6 A;  2O8E B;  1SS6 A;  3NH0 A;  4CGI A;  5LL6 Z;  2GEL A;  3QIN A;  4PL7 A;  3CJA A;  4QS7 A;  4W5N A;  3EE9 A;  4H4M A;  1L3S A;  4YDU A;  1WBB A;  1A5V A;  2HHH K;  3R9P A;  1QQM A;  3I0S A;  4E7J A;  5BR9 A;  3M6G A;  3L2R A;  5JVG L;  1RTD A;  1BDG A;  2GTD A;  4B1X B;  3JYT A;  1DTQ A;  3OYB A;  1DT9 A;  4OPH A;  2WFB A;  1WSG A;  3ZEU A;  3LAM A;  1SL1 A;  1UA1 A;  2HND A;  1B92 A;  1D5A A;  3H3N O;  4I9Q A;  4CJL A;  5AQU A;  3O1B A;  3NH1 A;  2D0O A;  3T7Z A;  3S9H A;  3AGK A;  1ZC6 A;  5T7B A;  4J2E A;  2HMP A;  4CVN E;  4DR5 K;  4A2A A;  3FFI A;  4C8L A;  4IWV A;  1YTA A;  3ZSR A;  3U3Y A;  3MEG A;  4M63 C;  4CF2 A;  2X6N A;  3VEY A;  1U2V A;  2XY7 A;  4DSJ A;  3HP9 A;  5M1N A;  3TAB A;  2O8E A;  5AQM A;  1C0T A;  3L4I A;  2WTU A;  4HCC A;  1SQK A;  2NRT A;  4BY9 C;  4OPK A;  3O6W A;  1Q86 O;  3SUN A;  3BY5 A;  3QNN A;  1NK9 A;  4FM0 A;  3PO5 A;  3D45 A;  2GBZ A;  4BR5 A;  4GV9 A;  2JLE A;  3OA9 A;  1UA0 A;  3CM5 A;  4CHQ A;  3G25 A;  3LDS A;  1X9W A;  2D4W A;  2NZT A;  3H45 C;  5C2D A;  4CGH A;  3HI0 A;  2HVH A;  4RW6 A;  2RKI A;  1TGO A;  4M7X A;  4FJN A;  3E01 A;  5FLX O;  4JLH A;  3FZK A;  3OYC A;  3V6D A;  1I39 A;  4W5T A;  2GWJ A;  5FPD A;  2GX9 A;  4DS5 A;  1GLA G;  3C7N B;  1UWB A;  3V1O A;  2V52 B;  3OS1 A;  2BH1 A;  4DG1 A;  4YFU A;  5AQJ A;  1DKG D;  3UKU B;  1O1W A;  5AQI A;  4DMN A;  5F2R A;  4L3Q A;  3QIO A;  3KLF A;  3NAE A;  4BRO A;  1BG3 A;  4EP4 A;  2RE2 A;  1Y64 A;  4MO4 A;  4FWP A;  1KQS M;  4ID5 A;  4JK7 A;  3FZM A;  1GLE G;  3EN9 A;  1BI4 B;  4BR0 A;  4IZ9 A;  5F0X A;  4B9S A;  2A1S A;  2YJE A;  4CZH A;  3CFO A;  3LP1 A;  3K5N A;  5HRR A;  4YY3 K;  3PX0 A;  4CIF A;  3NFA A;  5AQV A;  1TUY A;  3QIC A;  3VTH A;  1DEJ A;  3SBT A;  5AQF A;  4LFC K;  4GVE A;  3ATU A;  3MMV A;  2HMI A;  2ITM A;  3CYM A;  1WSI A;  1XMQ K;  4CE9 A;  4A2B A;  2F9T A;  4B9L A;  5KQD A;  3D7E O;  4N41 A;  4FSV A;  4BVO A;  3C7N A;  3G4S N;  1S9E A;  3K5O A;  4CES A;  4OLB A;  2QWR A;  4CF9 A;  4Z94 A;  3B8A X;  1NM1 A;  3UKU A;  1O13 A;  5BN8 A;  2UXC K;  5HRP A;  4E7K A;  3K58 A;  4FK0 A;  5KPT A;  4R79 A;  4Z4I A;  1NGD A;  1KRP A;  4BRI A;  3VQE A;  1KVC A;  3C0B A;  1C0F A;  4ISF A;  1BI4 A;  1BOT O;  2GWK A;  5AQL A;  1V4S A;  4J2B A;  3MEC A;  2G8F A;  2OAN A;  2Q3S A;  4B9Q A;  1SKR A;  4Z4G A;  2YV0 X;  1CZ9 A;  5C2F A;  3RMB A;  5JMV A;  3TSU A;  4FWK A;  3C6U A;  3CJ7 A;  2OPR A;  3DRP A;  2A41 A;  4H0T B;  1KC8 O;  1RT3 A;  3ZSV A;  4NCB A;  5E26 A;  5ADX H;  3CCE N;  2KQ2 A;  3CC4 N;  3HRG A;  3O3G A;  1NJY A;  4BR9 A;  4CJE A;  4K42 A;  4WQ5 C;  2WOM A;  3E66 A;  2YHA A;  2QWO A;  4HUE A;  4LH4 A;  1KFS A;  1YT3 A;  3HZ6 A;  4GKJ K;  1JLG A;  3KVG A;  2B4J A;  4NB4 A;  2UU9 K;  3OBW A;  3HST B;  4B9M A;  1RBS A;  3BUZ B;  4NYF A;  2ITG A;  4CZI A;  3VOV A;  2OZM A;  1LW2 A;  5JLH A;  2KFZ A;  4CJ3 A;  3QFU A;  4KRE A;  3THY B;  2Z1G A;  5KRS A;  4QS8 A;  4LY7 A;  3C65 A;  3MX2 A;  2QKK A;  3EY1 A;  2BTF A;  4RG8 A;  5JS1 A;  3HM8 A;  1HNI A;  2KKZ A;  1RDC A;  4ICL A;  4G9Z A;  2E6M A;  3DOL A;  4B9U A;  3O80 A;  2VGN A;  4DTX A;  3DJC A;  4FPA A;  4CHN A;  4GV3 A;  4L8R B;  2IOC A;  2BGG A;  4JI3 K;  2PYJ A;  2A42 A;  3AVL A;  2O8F B;  2ZF5 O;  4CZJ A;  1H1V A;  3PX4 A;  2YKM A;  2Y1I A;  5C12 A;  5FPM A;  4FWM A;  1C1C A;  1VRT A;  3A5M C;  1HKG A;  4E1J A;  3I33 A;  1TAU A;  1JCF A;  3EL2 A;  5FDL A;  4DKW A;  3J80 O;  4KHQ A;  1UAX A;  3DAW A;  2D0A A;  5EY4 A;  3OYI A;  4QOZ B;  1ATN A;  1DLO A;  4CZE A;  3DXK B;  1HYV A;  4DU3 A;  5AQO A;  4ELV A;  1JLA A;  3ZCM A;  5ADX A;  4DV3 K;  4LFA K;  2Z1I A;  2IGI A;  1VQK N;  3FR0 A;  3LAK A;  4DQP A;  3NF8 A;  4KRF A;  1WNS A;  1P8Z A;  3OBY A;  1K8A O;  3VQ9 A;  4A62 A;  5JLF A;  2UUB K;  1GOB A;  4GMJ B;  3VQ7 A;  4B1U B;  1NJX A;  1RBT A;  4PUO A;  4B3R K;  3AAQ A;  1QS4 A;  4MFB A;  5HRN A;  2O8F A;  3VQ6 A;  1WBD A;  3SNN A;  2HNY A;  2ZGY A;  1QVG M;  4MO5 A;  1BA0 A;  5F1X A;  3KZB A;  3H08 A;  1GLL O;  3ZSO A;  1HNZ K;  3CPE A;  1YVN A;  1HYZ A;  4AIL C;  1MWK A;  3K57 A;  5EVZ A;  3DXK A;  4F3T A;  4YOT A;  5AJ3 K;  3NGI A;  3PLA A;  2OTL N;  4KB0 A;  3OYG A;  4JRQ A;  3RRH A;  1JLE A;  1B9D A;  1T03 A;  4B08 A;  3MN6 A;  4DV5 K;  3DLR A;  4FWS A;  4BG9 A;  2CGK A;  2F7T A;  4QCL A;  3ZT4 A;  4CBU A;  1BO5 O;  3AO4 A;  4IEE A;  4I6M B;  1RT7 A;  4MDA A;  4CJW A;  1NLV A;  4OKK A;  2UYT A;  3CQX A;  1I94 K;  1GLB G;  3VN5 A;  3CD6 N;  1XQS C;  3E1Y A;  3L2V A;  1RBU A;  5AQN A;  2A5X A;  3ID8 A;  1VSH A;  1NGB A;  3LP3 A;  4YOX A;  4JI1 K;  4CZM A;  1ASU A;  3PX6 A;  4WQ4 A;  2OTJ N;  1C0M A;  4DR4 K;  4BRP A;  5D3G A;  1ZBS A;  5KI6 A;  1J5E K;  4YOV A;  1BUP A;  3QBX A;  4JN4 A;  1BHL A;  4TSX A;  3VGL A;  4RW9 A;  4DF4 A;  4I2Q A;  2ZE2 A;  2E2Q A;  1S1X A;  3VF6 A;  3NDK A;  2GEM A;  1S6Q A;  1OH7 A;  3MWT A;  1QVF M;  2FLO A;  3KK1 A;  3V9S A;  5IT9 O;  1LOT B;  4ILJ A;  3J7Z O;  3O08 A;  2IC3 A;  4DR2 K;  3IFR A;  3WXM B;  2CGL A;  4I6M A;  5C10 A;  3VEW A;  4B9V A;  5MLC Q;  4EFH A;  3NF9 A;  4H5V A;  3V9U A;  3HPG A;  4KV8 A;  3H46 O;  5EX5 A;  2Q36 A;  4CJP A;  3DLK A;  4AHC A;  3KWI A;  5JS2 A;  5CY4 A;  4M3Z A;  3ID6 A;  3GG4 A;  2OPQ A;  4X62 K;  4O0I A;  2OYQ A;  1HQU A;  4M3T A;  4FW1 A;  3H3O B;  3VEO A;  5LJW A;  1OVY A;  1BU6 O;  4F2R A;  3U3G A;  4A57 A;  4ZHR A;  4FZZ A;  3BZK A;  3S3O A;  1Z25 A;  1C6V A;  2QWP A;  1K8K B;  4I9L A;  4Z4H A;  5A2Q O;  3MEE A;  4X64 K;  3TAN A;  2FF6 A;  5ELZ A;  5CYQ A;  1HNV A;  2XHB A;  4FWL A;  5CZ2 A;  4O55 A;  2YJF A;  3VET A;  3G71 N;  4WF9 L;  3O9U A;  3KK3 A;  2P9K B;  1K73 O;  3LL3 A;  2E2N A;  1HKC A;  5AZJ A;  4JRP A;  4PKI A;  5AQQ A;  2P9L B;  4H5R A;  1S3X A;  4DS4 A;  4CD3 A;  1NMN A;  3T1A A;  4DUZ K;  3KK2 A;  3MXJ A;  3CG7 A;  2J4R A;  3QET A;  2YNI A;  1D9D A;  3MN5 A;  3AVN A;  3TAQ A;  1C0G A;  2GUP A;  1EO1 A;  4CF0 A;  4OPJ A;  2G8I A;  2YHB A;  1W0H A;  3L2U A;  3PO4 A;  4YOU A;  3LZJ A;  1VSM A;  3O9T A;  1K8K A;  2VQE K;  5C15 A;  3PY8 A;  1VQ6 N;  2QWQ A;  1RDD A;  2AJQ A;  1YIJ N;  2OPS A;  4W5Q A;  1VAZ A;  3CQ8 A;  2Q1N A;  4DV6 K;  1IBK K;  2FSN A;  3LDL A;  1IV0 A;  3EZW A;  2HHQ A;  3P38 A;  4HUF A;  3CFR A;  3RR8 A;  3Q7C A;  4FK2 A;  2P9K A;  3A2F A;  4NXN K;  4IJA A;  2P5G A;  3K5M A;  2E2P A;  4BR2 A;  1IG9 A;  3WXI A;  2JWK A;  2P9L A;  4CER A;  2QWL A;  1RBV A;  1LWE A;  3QIP A;  1L3T A;  1VK0 A;  2BUP A;  2ZQB A;  4DTS A;  1HRH A;  3EE8 A;  5C42 A;  4CCH A;  4O44 A;  3J81 O;  2WON A;  3S3M A;  4FZY A;  3WNG A;  3FZH A;  1RT4 A;  1WUA A;  4GVM A;  5JVH L;  1TK0 A;  1HR0 K;  2QK9 A;  2I5J A;  3L0Q A;  3F9M A;  4IFE A;  2X78 A;  5E41 A;  1NK7 A;  4DR6 K;  2GUI A;  4HUG A;  1JLF A;  1NGC A;  4WFN L;  1BA1 A;  1OVQ A;  1Z6R A;  3LDQ A;  5DK5 A;  1X9S A;  3LDO A;  4BRM A;  2OA8 A;  3QEI A;  4ELU A;  3AAR A;  4CJK A;  1SAZ A;  1IKY A;  5KQ8 A;  1JKH A;  4YDU C;  5HBM A;  3CCR N;  1WSH A;  3HT3 A;  1CXU A;  3RWU A;  1XHZ A;  2NRV A;  3O9S A;  2QKB A;  4DTP A;  2VG5 A;  4JKG B;  5J2N A;  3QDK A;  4JKH A;  4H0O A;  2D0P A;  3EKU A;  1U45 A;  2B5J A;  5KRT A;  5AZI B;  4FJ7 A;  3VES A;  4DV0 K;  3LAL A;  2HST A;  3ATV A;  3AA2 A;  3TAR A;  1WN7 A;  1HUX A;  2O4I A;  3S41 A;  3SPY A;  1FJG K;  3OYK A;  3N4P A;  2XY6 A;  2BE2 A;  4O0J A;  1VRU A;  3NVM A;  4CGF A;  4PHT X;  4JNE A;  4CJ4 A;  1GLJ O;  4DSK A;  2OZS A;  3SJJ A;  4H5T A;  4CHP A;  1ITG A;  1LCU A;  4RCH A;  1TKT A;  1QQC A;  2NLX A;  3AVH A;  4V19 S;  1KTQ A;  4K8X A;  3T3F A;  2XY8 A;  1ZXO A;  4OGE A;  4B1Y B;  2HF4 A;  3VEN A;  5GIO A;  1YIT N;  5FPN A;  2ASP A;  3ZET B;  4JKG A;  3L6Q A;  1T44 A;  3CC2 N;  3P31 A;  3VA0 A;  1VSL A;  3ZT2 A;  1R0A A;  1RCH A;  3M8Q A;  3D6R A;  3M5R A;  4Z0U A;  5AZI A;  3ULD A;  2QXF A;  2ASO A;  3ENO A;  3BDP A;  1GLF O;  4Q5V A;  4FXD A;  1T3V A;  3OYJ A;  4DFJ A;  3BF1 A;  3CJC A;  5EOY A;  5SZT A;  2O8C B;  1RT6 A;  2VGM A;  2Z1J A;  1I3A A;  3E9L A;  5CR4 A;  1HNX K;  5E84 A;  2PZS A;  1VQ9 N;  1W7A A;  1YVU A;  3MAQ A;  1NK6 A;  4WFA L;  4Y1D A;  2VWB A;  3OYA A;  2ASM A;  4FJK A;  4C8O A;  1GOC A;  3VQQ A;  4FLT A;  4U7B A;  3VQ8 A;  4FLV A;  4DV2 K;  4FO0 A;  2NRZ A;  3O8M A;  1D4X A;  5BPM A;  2YI1 A;  1VSK A;  2Q31 A;  3PSF A;  3MN9 A;  1Q81 O;  1Q9Y A;  1WOQ A;  3VQ5 A;  3K2P A;  3ZET A;  3GDQ A;  3TTD A;  5CE3 A;  3MCP A;  1BCO A;  4Y1C A;  1G99 A;  3SAG A;  1U49 A;  3ZT3 A;  3SUQ A;  5LJV A;  5AQT A;  3C6T A;  4BVP A;  3QES A;  1OH8 A;  5GAD P;  1BQM A;  1FW6 A;  2HHV A;  1XWL A;  3F73 A;  1S1V A;  2CH5 A;  4HCB A;  1IBL K;  1QSY A;  2O8C A;  4WYB A;  1CZB A;  3ZT1 A;  1E4F T;  1W97 L;  2DFE A;  2FSJ A;  3HSC A;  3QEW A;  1N36 K;  4E7H A;  4JYA K;  5IWA K;  4PA1 A;  4FWR A;  3SYZ A;  3CI5 A;  2ZD1 A;  3U8X A;  4PKH A;  5FRM A;  1IBM K;  4JS4 A;  4RW8 A;  2YKN A;  4FVM A;  4CED A;  1XI1 A; 
#chains in the Genus database with same CATH homology
 4MQ3 A;  1ZYQ A;  3LAK A;  3L2Q A;  5C25 A;  5HRO A;  4CJQ A;  4DQP A;  3NF8 A;  4KRF A;  1WNS A;  3WNH A;  3HM9 A;  3HL8 A;  3SV4 A;  2HB5 A;  2LSN A;  4FJ5 A;  4FLX A;  4CJT A;  2FBY A;  3VQ9 A;  3V1R A;  3NE6 A;  3TWH A;  4KB1 A;  1BL3 A;  3ZSZ A;  2ATQ A;  1GOB A;  4G1Q A;  4GMJ B;  3VQ7 A;  1LV5 A;  3QNO A;  4FZX C;  4HHT A;  1RBT A;  2D5R A;  3IRX A;  1NJX A;  4PUO A;  1JLQ A;  1QS4 A;  3AVF A;  3P83 D;  4MFB A;  3SQ0 A;  1L5U A;  2E6L A;  4N76 A;  4DFP A;  2G8V A;  1T8E A;  1L3V A;  5HRN A;  4IG0 A;  1W9H A;  4C8N A;  4DQQ A;  1FKP A;  3VQ6 A;  2GV9 A;  3AO5 A;  4Z4C A;  4DF8 A;  1TVR A;  4AHR A;  4DQR A;  3SNN A;  2HNY A;  1HYS A;  1RBR A;  4CJ5 A;  4EP5 A;  1TK8 A;  2VWK A;  3KKR A;  4CJF A;  5FRN A;  4E7I A;  4CEE A;  3TAF A;  3B6P A;  5FRO A;  2RPI A;  1BIU A;  2IDO A;  3ZSY A;  4F8R A;  3LPU A;  4M3U A;  5J2P A;  3V4I A;  3VQD A;  3H08 A;  3TAG A;  1VSJ A;  4BE1 A;  1TL1 A;  3DLH A;  3ZSO A;  2HW3 A;  1IH7 A;  1RNH A;  1TV6 A;  3AVK A;  1C1B A;  3WNF A;  2NUB A;  3OJS A;  3TI0 A;  2G8U A;  3L3U A;  2PYL A;  4KHN A;  1NK0 A;  4CGJ A;  3UIQ A;  3NBP A;  4OKJ A;  4BE0 A;  1HYZ A;  3KTQ A;  4M3R A;  4AIL C;  5HRS A;  1VSE A;  1IKW A;  3F9K A;  3K57 A;  1RDB A;  3KLI A;  4F3T A;  4DLG A;  2RF2 A;  4B9V A;  3NGI A;  4FJJ A;  3V9X A;  1NK4 A;  4J2A A;  1RTJ A;  2Z1H A;  1WSJ A;  5CZ1 A;  3AV9 A;  4FJM A;  2FC0 A;  4KB0 A;  4LSL A;  2YNH A;  3OYG A;  4JRQ A;  4KI4 A;  2XRI A;  4CEB A;  4E89 A;  1NKC A;  3RRH A;  3RRG A;  1JLE A;  4M45 A;  4PY5 A;  1B9D A;  1T03 A;  4B08 A;  3M8P A;  1JLB A;  3JSM A;  1NK8 A;  5KTQ A;  3DLR A;  4IFY A;  3B6O A;  4QCL A;  4CK2 A;  3ZT4 A;  4KTZ A;  2X6S A;  1WSE A;  3AO4 A;  3KD5 E;  4KKO A;  2A1R A;  4F2S A;  1N5Y A;  3DLB A;  1RT7 A;  4CJW A;  4KHU A;  1ZBU A;  1LAW A;  4OKK A;  3P1G A;  1SKW A;  1EX4 A;  3VN5 A;  1LAV A;  3L2V A;  1RBU A;  4CGD A;  1J53 A;  1VSH A;  3LP3 A;  4B8C A;  4B8A B;  1QTM A;  2KZZ A;  1NK5 A;  1ASU A;  4CHO A;  3PX6 A;  2D0C A;  1S1U A;  3IAY A;  4H8K A;  1U47 A;  3OYD A;  1C0M A;  1WSF A;  4N5S A;  4BDZ A;  4FJG A;  2DY4 A;  1JL1 A;  3TR8 A;  5D3G A;  1A5X A;  5KI6 A;  3ZSW A;  5HLF A;  1JLC A;  3HYF A;  4O5B A;  3U6F A;  3TAP A;  2F96 A;  3LP2 A;  1BHL A;  2HVI A;  3OYM A;  4CHY A;  5K14 A;  4TSX A;  4GW6 A;  3OYF A;  1BCM A;  3ZSX A;  3VQB A;  3ZT0 A;  4RW9 A;  4CJU A;  4DF4 A;  3THV A;  1TK5 A;  2XO7 A;  4I2Q A;  3RR7 A;  2ZE2 A;  5J2Q A;  1BIS A;  3SUP A;  4DU4 A;  1S1X A;  4DSE A;  3NDK A;  4AHV A;  4PQU A;  1S6Q A;  1QHT A;  4CK1 A;  1XC9 A;  4BE2 A;  1SKS A;  1RT5 A;  4CFD A;  3SCX A;  3KK1 A;  4DFM A;  3V9S A;  3SI6 A;  4FYD A;  4XIU A;  2B6A A;  4FLU A;  1B9F A;  4RW4 A;  4CEA A;  1ZBH A;  5I3U A;  4IFV A;  2R7Y A;  4IKF A;  3DM2 A;  1JL2 A;  2KW4 A;  3O4Q A;  3DYA A;  2IC3 A;  3SPZ A;  2ETJ A;  2FBT A;  3NCI A;  3OY9 A;  4E7L A;  3V9W A;  4NYN A;  4OKE A;  1MU2 A;  4OVL A;  2G8K A;  1EP4 A;  4NCG A;  1XHX A;  3HXM A;  3P5J A;  1D8Y A;  3NF9 A;  4W5R A;  3VQC A;  3V9U A;  2DFF A;  3RMD A;  1KSP A;  3QO9 A;  1ZBL A;  1SL0 A;  4FW2 A;  4ZTJ A;  1EXQ A;  3ITH A;  3SQ4 A;  4KAZ A;  3OYE A;  3EZ5 A;  3HPG A;  4KV8 A;  4HTU A;  4DWI A;  4CK3 A;  4KTW A;  1ZBI A;  4OLA A;  4CJR A;  4ELT A;  2JGU A;  3ISN C;  4E0D A;  4CJP A;  3DLK A;  4AHC A;  4FJL A;  4KI6 A;  4KHW A;  5JS2 A;  5CY4 A;  4M3Z A;  3T19 A;  3NH0 A;  4CGI A;  1Z26 A;  3VA3 A;  2EX3 A;  2OPQ A;  4UQG A;  4O0I A;  3L8B A;  2OYQ A;  1TKZ A;  3QIN A;  1HQU A;  4M3T A;  4FW1 A;  3AA4 A;  1YTU A;  4E19 A;  4NCA A;  4F2R A;  4H4M A;  3U3G A;  1L3S A;  4W5N A;  4PWD A;  1A5V A;  4KHY A;  4ZHR A;  1SV5 A;  1BQN A;  3AVJ A;  4FZZ A;  2DTU A;  3QEV A;  3I0S A;  3NHG A;  4AHS A;  4E7J A;  5J2M A;  1Z25 A;  1C6V A;  3S3O A;  3L2R A;  1T7P A;  1RTD A;  2PY5 A;  4I9L A;  3JYT A;  1DTQ A;  2XY5 A;  4Z4H A;  1S5J A;  3OYB A;  4AHU A;  1U04 A;  3MEE A;  1WSG A;  4WE1 A;  3QER A;  1KLM A;  3LAM A;  3KLG A;  3TAN A;  1SL1 A;  1UA1 A;  1U4B A;  2HND A;  3AVC A;  4BDY A;  1NJW A;  2G8W A;  1B92 A;  1D5A A;  1HJR A;  1HNV A;  1GOA A;  5CYQ A;  4CJL A;  2XHB A;  4I9Q A;  3LWL A;  1BIZ A;  5CZ2 A;  4O55 A;  3NH1 A;  3I0R A;  1UOC A;  1DTT A;  3CM6 A;  3DMJ A;  3S9H A;  3NGY A;  3KK3 A;  1FK9 A;  5T7B A;  3I8D A;  4J2E A;  5HP1 A;  3FFI A;  1LWF A;  2IAJ A;  3M8R A;  3SZ2 A;  3TAE A;  4JRP A;  4C8L A;  3ZSR A;  1YTA A;  3PUF A;  3U3Y A;  4AH9 A;  3PV8 A;  3MEG A;  4CF2 A;  4B9T A;  2X6N A;  3KKS A;  3VQA A;  4DS4 A;  4Q0B A;  3DRS A;  3M8S A;  4DTN A;  3HJF A;  2XY7 A;  4DSJ A;  3T1A A;  1KVB A;  3HP9 A;  4DTU A;  3TAB A;  3NF6 A;  3KK2 A;  3MXJ A;  1VSD A;  3CG7 A;  3DOK A;  3QET A;  2YNI A;  1NOY A;  1C0T A;  1D9D A;  4HCC A;  5J1E A;  2P51 A;  3AVN A;  3TAQ A;  1VSF A;  4OPK A;  2P5O A;  1QE1 A;  3L2W A;  1S1W A;  4FJ9 A;  4DQS A;  4CIE A;  2F8S A;  4CF0 A;  3SUN A;  4OPJ A;  3QLH A;  4AHT A;  3NH2 A;  3QNN A;  3OYN A;  1NK9 A;  2YHB A;  4FM0 A;  1W0H A;  3PO5 A;  3SQ2 A;  2G8I A;  3L2U A;  3AVI A;  1RT1 A;  3PO4 A;  4ZTF A;  4FLY A;  1FXX A;  2HHX A;  3LZJ A;  3D45 A;  1VSM A;  4KTQ A;  4CJV A;  3PY8 A;  2GBZ A;  4ID1 A;  3OJU A;  1RDD A;  2AJQ A;  3LP0 A;  5KGX A;  4CGG A;  2JLE A;  2OPS A;  4W5Q A;  1UA0 A;  3CQ8 A;  3CM5 A;  4C8K A;  4CHQ A;  3LDS A;  1CLQ A;  2E4L A;  3RMC A;  1X9W A;  2IS3 A;  4KPY A;  1HQE A;  1S9G A;  1NOZ A;  4F4K A;  3MED A;  3HP6 A;  3C94 A;  4CGH A;  3AVA A;  2HVH A;  2HHQ A;  4N47 A;  4HUF A;  3MXM A;  3CFR A;  3MXI A;  4RW6 A;  1N6Q A;  2RKI A;  4C8M A;  4CIG A;  3RR8 A;  4FK2 A;  3SUO A;  3A2F A;  1TGO A;  4FJN A;  3E01 A;  2P5G A;  4DSF A;  3K5M A;  1IG9 A;  4DFK A;  1S6P A;  4JLH A;  3O4N A;  4O4G A;  3OYC A;  1KCF A;  3AO1 A;  3V6D A;  2HHS A;  3OYH A;  5CYM A;  1I39 A;  1D9F A;  1C1A A;  3AO3 A;  1RBV A;  1LWE A;  3AVM A;  4CER A;  4W5T A;  1Q9X A;  3QIP A;  1L3T A;  1VSI A;  1VK0 A;  2ZQB A;  4DTS A;  4DS5 A;  1HRH A;  4CEO A;  4LH5 A;  1UWB A;  3HPH A;  3V1O A;  3OS1 A;  3RTV A;  4EZ9 A;  5C42 A;  4CCH A;  4DG1 A;  4O44 A;  4J2D A;  2WON A;  4YFU A;  3S3M A;  4FZY A;  3WNG A;  4EZ6 A;  1S1T A;  1G15 A;  4DMN A;  2G8H A;  1O1W A;  1RT4 A;  4GVM A;  3D0P A;  4M3Y A;  2X74 A;  3TAM A;  1TK0 A;  3QIO A;  3KLF A;  1NKB A;  1IKX A;  4FM1 A;  4Z4F A;  2I5J A;  3NAE A;  3AA5 X;  4IDK A;  4HVJ A;  2QK9 A;  5C24 A;  4EP4 A;  2X78 A;  5E41 A;  1NK7 A;  3L3V A;  4RW7 A;  3EYZ A;  3SV3 A;  2GUI A;  4ID5 A;  4HUG A;  1JLF A;  3LZI A;  3HVR A;  1X9M A;  4OJR A;  1JXE A;  1BI4 B;  2P1J A;  4CEF A;  4B9S A;  4CEC A;  2A1S A;  3CFO A;  3LP1 A;  3K5N A;  1EET A;  1RIL A;  5HRR A;  5I42 A;  2VG7 A;  3PX0 A;  4BDP A;  2HHT A;  4CIF A;  5DK5 A;  4IG3 A;  1X9S A;  3NFA A;  1RT2 A;  4YNQ A;  3QEI A;  2OA8 A;  4ELU A;  4CJK A;  3AVG A;  1WLJ A;  1NKE A;  1IKY A;  1FKO A;  3C95 A;  4K8Z A;  2FBX A;  1JKH A;  2HMI A;  2YNG A;  1WSI A;  3CYM A;  5HBM A;  4CFA A;  3KIO A;  1WSH A;  4CE9 A;  1ASV A;  3HT3 A;  4BAC A;  4B3O A;  1CXU A;  3RWU A;  2YNF A;  4B9L A;  1XHZ A;  4N41 A;  4DTP A;  3G10 A;  1T05 A;  2QKB A;  4DTO A;  2VG5 A;  5J2N A;  4E3S A;  3KJV A;  3G0Z A;  2OPP A;  5EU7 A;  1S9E A;  3K5O A;  4CES A;  4OLB A;  4E1M A;  1U48 A;  4IBN A;  1K6Y A;  3HPO A;  4CF9 A;  4FJH A;  1U45 A;  2B5J A;  1X1P A;  5KRT A;  4FJ7 A;  2O4G A;  4FLW A;  3LAL A;  1SL2 A;  4FJX A;  3AA2 A;  4CFB A;  5HRP A;  4F3O A;  4E7K A;  3K58 A;  3TAR A;  4FK0 A;  1WN7 A;  1A5W A;  3RMA A;  3S3N A;  2O4I A;  4H4O A;  3HVT A;  3SPY A;  4Z4I A;  1EKE A;  3OYK A;  1KRP A;  4I7F A;  1SUQ A;  3VQE A;  2BE2 A;  1KVC A;  2XY6 A;  3LAN A;  4O0J A;  1HMV A;  3AA3 A;  3HO1 A;  1RTI A;  1BI4 A;  1VRU A;  4CGF A;  3OS2 A;  4J2B A;  3MEC A;  4CJ4 A;  2Y1J A;  2G8F A;  2Q3S A;  1SKR A;  4Z4G A;  1LW0 A;  3AVB A;  3BGR A;  3DLG A;  3LPT A;  3CFP A;  4DSK A;  2BAN A;  2YV0 X;  3SJJ A;  2OZS A;  4N56 A;  4CHP A;  1CZ9 A;  1Q8I A;  4CEZ A;  1ITG A;  1J9A A;  3RMB A;  1TKD A;  1NJZ A;  4M42 A;  1TKT A;  1QQC A;  1RDA A;  3AVH A;  2KZM A;  3C6U A;  1KTQ A;  3DI6 A;  4BWJ A;  4K8X A;  3OYL A;  3T3F A;  2OPR A;  3DRP A;  4DTR A;  3KD1 E;  2XY8 A;  4OGE A;  3O3H A;  1RT3 A;  3ZSV A;  3LWM A;  4NCB A;  5KGW A;  2RN2 A;  4QAG A;  2KQ2 A;  3O3G A;  1ASW A;  1NJY A;  1J5O A;  4DQI A;  4FK4 A;  3ALY A;  2EHG A;  1IO2 A;  3VA0 A;  1VSL A;  3ZT2 A;  4CJE A;  5SWM A;  3QEX A;  4CFC A;  4DTJ A;  1R0A A;  3V1Q A;  2WOM A;  2FBV A;  1RCH A;  3M8Q A;  4Z0U A;  4I2P A;  3ULD A;  2QXF A;  2YHA A;  4HUE A;  3BDP A;  4LH4 A;  4Q5V A;  3ASM A;  4KO0 A;  3WNE A;  1YT3 A;  2DFH A;  4R5P A;  3K59 A;  1KFS A;  4FXD A;  3VQP A;  3OYJ A;  4DFJ A;  1JLG A;  2B4J A;  5SZT A;  1IKV A;  3AO2 A;  1RT6 A;  3HST B;  4B9M A;  1RBS A;  4CF1 A;  4NYF A;  2HHU A;  1REV A;  2Z1J A;  2ITG A;  1I3A A;  4KFB A;  2F8T A;  2PZS A;  1C0U A;  2OZM A;  1LW2 A;  4DU1 A;  1YVU A;  2KFZ A;  4CJ3 A;  3MAQ A;  4B9N A;  1HPZ A;  4KRE A;  4BWM A;  1NK6 A;  1L3U A;  2Z1G A;  5KRS A;  4Y1D A;  3OYA A;  4FM2 A;  1XI1 A;  4LY7 A;  1TL3 A;  2W42 A;  4FJK A;  1QSL A;  4C8O A;  4CHZ A;  1GOC A;  1KFD A;  3VQQ A;  3DLE A;  2QKK A;  2HNZ A;  3EY1 A;  4FLT A;  1KLN A;  4RG8 A;  3VQ8 A;  4DLE A;  5JS1 A;  4FLV A;  4Z4E A;  1HNI A;  1TKX A;  1RDC A;  4ICL A;  4W5O A;  1F21 A;  1Y97 A;  2E6M A;  3OS0 A;  3V9Z A;  3DOL A;  4CEQ A;  4B9U A;  1VSK A;  4DTM A;  3NGZ A;  1Q9Y A;  3ZSQ A;  4M41 A;  3K2P A;  3VQ5 A;  4M3X A;  4DTX A;  1RTH A;  1BCO A;  1QSS A;  4CHN A;  4Y1C A;  4FJ8 A;  4L8R B;  2IOC A;  2BGG A;  1CXQ A;  1U49 A;  3ZT3 A;  3SUQ A;  2PYJ A;  4LD0 A;  3HK2 A;  3AVL A;  2BDP A;  1WAJ A;  2VG6 A;  4CJS A;  1JXB A;  3C6T A;  3DRR A;  3OVN A;  2HHW A;  4FCY A;  3QES A;  4FJI A;  1BQM A;  2KTQ A;  3PX4 A;  2YKM A;  2HHV A;  1KVA A;  1XWL A;  1S1V A;  3K5L A;  1ZBF A;  3VQ4 A;  1J54 A;  3KLE A;  3F73 A;  2Y1I A;  4HCB A;  1C1C A;  1VRT A;  1WAF A;  4E1N A;  4OGC A;  2VWJ A;  1QSY A;  4CF8 A;  3QEP A;  1TAU A;  1BGX T;  5DMR A;  1CZB A;  5FDL A;  3SQ1 A;  3ZT1 A;  2DFE A;  4M3W A;  1LWC A;  3IG1 A;  4KHQ A;  1UAX A;  3QEW A;  4E7H A;  2KFN A;  4PA1 A;  2D0A A;  4KHS A;  4JS5 A;  2D0B A;  3OYI A;  3O3F A;  3SYZ A;  3KLH A;  4QOZ B;  1DLO A;  2ZD1 A;  1HYV A;  4FLZ A;  4LSN A;  5FRM A;  4DSL A;  4DU3 A;  4JS4 A;  4RW8 A;  4ELV A;  1TAQ A;  2YKN A;  4FVM A;  4CED A;  1JLA A;  3ZCM A;  4DSI A;  2Z1I A;  3NF7 A;  2IGI A;  3IS9 A;  3V81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...