3ZSOA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsoA00
1KFDA 4W5OA 4CGHA 4CEDA 4CK2A 3LAKA 3ZSVA 5FROA 3V9UA 3MEDA 1K6YA 4PA1A 3U3GA 4CJ3A 3K5NA 1RTDA 4FZXC 3ZSWA 5CY4A 1ZBLA 1RDAA 3TR8A 4DWIA 4NYFA 4C8NA 4I9LA 4DG1A 1RDDA 2JLEA 1CXUA 2D0BA 1REVA 1C1BA 4FZYA 3QEXA 2PY5A 4Z4GA 1WLJA 4OKKA 4FJHA 1NJZA 1XI1A 3IRXA 3AVCA 3NGZA 4BE0A 1BI4A 3QIOA 3L2VA 2HW3A 4M41A 3ZSXA 2G8VA 4AHTA 3RWUA 1UAXA 1BIZA 5HRNA 3OYAA 3DRSA 3JYTA 1CZ9A 2ZD1A 4FK4A 4FLXA 4F8RA 1S1WA 4CHNA 2YKMA 4FJ5A 4IDKA 3JSMA 2P1JA 1BQMA 4B9TA 1JLCA 3QO9A 1KLNA 2OYQA 4N5SA 2OZMA 5KGWA 2Z1HA 4RW6A 1L3TA 1XWLA 4FJMA 4E1MA 4FYDA 1SKRA 2D0CA 3AO1A 2YHBA 1TK0A 4HUFA 1D9DA 4DFMA 4M3YA 3MEGA 1NJWA 3VQ8A 1IKXA 3AA4A 4F3OA 4IFYA 3TANA 4FW1A 3CFOA 3VQCA 3EZ5A 4XIUA 4BE2A 2KZMA 2VG7A 4CJPA 3OS0A 1Z26A 1X9SA 3V9WA 4R5PA 1S9EA 3VQDA 3NHGA 3PO4A 4ELUA 2F8SA 3SPYA 4B3OA 3L2QA 3AVHA 4JRQA 3AA3A 4Z4FA 2DFFA 2ZQBA 4FXDA 1LAVA 1B9FA 1RBVA 4CHZA 1B92A 1KFSA 4CEBA 2XO7A 1T8EA 3DMJA 4C8LA 1LWEA 4KB1A 1VRTA 4KREA 4CHOA 1BCMA 1ZBHA 1SL2A 4BDPA 1QQCA 2XY6A 1WSIA 4C8KA 1S1VA 3VA0A 1NOYA 2A1SA 3OS1A 4AHUA 4DU3A 3LANA 3ZSRA 3PX4A 3MXIA 3LPUA 2XY5A 3HXMA 3HP9A 3V6DA 4HCCA 3PUFA 4B8AB 3OVNA 4KFBA 4Z4HA 5HRPA 5HLFA 4CEOA 4FJKA 4FZZA 3VQ9A 3K2PA 3EY1A 4EZ9A 3KD5E 4AILC 4B9VA 2P51A 4CF8A 2VG5A 1Q9YA 4CGDA 5FRNA 4NYNA 3OYJA 1IKWA 3AO4A 3AVLA 4B9LA 4QOZB 4QCLA 3AO3A 4RG8A 3ALYA 4MFBA 4Y1CA 3O4NA 3OJUA 4IFVA 3L2WA 3OYCA 2O4GA 1S1TA 4DFKA 1LW0A 3FFIA 1WSJA 3VQ5A 2YNGA 1TKDA 2P5OA 4RW9A 3AVAA 4CEZA 4B9MA 1BQNA 5EU7A 4DMNA 5D3GA 3LZIA 4QAGA 1T7PA 1FKOA 3K59A 4JS4A 2FBTA 4W5RA 3NH0A 2JGUA 1IH7A 3PV8A 3OJSA 3LDSA 4CF9A 1RBUA 1NKEA 1KVCA 3RR7A 3OYEA 1NK6A 2RN2A 4JRPA 3BDPA 4OLAA 3ZSOA 3NGYA 1XC9A 2OPQA 3NF8A 3V9ZA 4FJGA 1HQUA 4DU1A 1ZYQA 1U48A 3AA5X 3LWMA 1IKYA 4CFBA 3K57A 4EP5A 3L8BA 4KHNA 1TVRA 1D9FA 1DTQA 4KB0A 4KHQA 2QKKA 4OLBA 4PY5A 2ZE2A 2ETJA 1T03A 1CXQA 3K5LA 5HROA 3RRHA 4W5QA 4Z4IA 1JXEA 1RTJA 3VQEA 4CJRA 1EKEA 4KHYA 1HNIA 2KFNA 3SUOA 2B5JA 1ZBIA 4DTNA 2HHQA 3AO2A 4BWJA 2OZSA 2KFZA 2VWJA 3SI6A 2DFHA 4CHPA 1HYZA 4E0DA 3DRPA 4DSLA 4O5BA 4YFUA 3HYFA 4FJJA 3H08A 3TAMA 4FM2A 4CK3A 4LY7A 4E1NA 1NK4A 1EP4A 3CYMA 3U3YA 4DQIA 4FK0A 2KQ2A 1SL0A 3AVFA 5CYMA 3VQBA 2F96A 4KI6A 2HVIA 4RW4A 1U04A 1UWBA 3PO5A 2HHWA 2YNIA 4OKEA 4M3WA 3C6UA 3WNHA 4HVJA 1VSHA 1X1PA 1XHZA 3RMDA 1KCFA 3PX0A 1JLFA 4O55A 1TL3A 1HQEA 4FVMA 4TSXA 1VSMA 1RT3A 3KKRA 3QEVA 3QNOA 4CERA 2ITGA 4AHCA 4DQSA 2Y1IA 1LAWA 3WNEA 3M8QA 4E3SA 3V9SA 3ASMA 1DTTA 1I3AA 4DTPA 3T3FA 1YT3A 4FLUA 4Q0BA 4CE9A 3ZT0A 1RT1A 2RPIA 1U4BA 4LD0A 3O3FA 1WSHA 2OPRA 3V81A 4IG0A 1J9AA 3ZT4A 3QNNA 5T7BA 1QTMA 1J53A 4FK2A 4OGEA 3HPGA 3HP6A 1RBSA 1QE1A 3ITHA 4CFAA 4E7IA 4J2DA 3SV3A 2PYJA 1CLQA 1GOAA 2BDPA 5J1EA 2RKIA 3HPHA 1NK9A 3AVGA 1HYVA 1S6QA 3ZSYA 4AHVA 1NK0A 4DQRA 3P83D 3CG7A 2DFEA 5C25A 3OYLA 4HUEA 4DLEA 3SV4A 4E7LA 3HK2A 4Z4EA 4DF4A 2OPPA 2HNYA 2X6SA 4B8CA 4J2EA 4JLHA 1N6QA 1RBTA 3E01A 1VSDA 3ZSQA 3IAYA 3AVJA 4KKOA 4DTRA 2YV0X 4CF1A 3D45A 3KIOA 3SNNA 2G8UA 4CJWA 2WONA 4DF8A 3NF7A 3KLFA 4ELVA 3RMAA 2DTUA 2EHGA 1HRHA 4GMJB 2BANA 3RR8A 1FXXA 2X74A 1SKSA 4F3TA 2B4JA 3A2FA 4C8MA 1ZBUA 3RMCA 2HHTA 1BCOA 2E6MA 2FBYA 4O0JA 4OPKA 1T05A 1QSLA 4H4OA 1BGXT 4E89A 3SYZA 2Q3SA 3DLGA 4OVLA 4E7KA 1NKCA 5HRSA 2AJQA 1KTQA 1L3SA 4I9QA 1VSEA 2D0AA 2HMIA 4F4KA 2FC0A 3QETA 1G15A 1LV5A 5KGXA 2HB5A 3DLRA 4Y1DA 3VQPA 1TGOA 5DK5A 4CIFA 2NUBA 4RW7A 4FM1A 3DLHA 2KZZA 3AVBA 1JL2A 4HTUA 4PWDA 1VSFA 3SQ0A 4DSFA 4KTQA 1C0MA 1VSKA 5JS2A 4CFDA 2Y1JA 2IAJA 4FJNA 4I7FA 4ICLA 4F2RA 4E7JA 4DS5A 2G8HA 5I3UA 1S1UA 1C1CA 3DOKA 4N76A 2X6NA 3AVNA 1D5AA 4OGCA 4O0IA 4W5TA 3LAMA 4WE1A 3RTVA 1X9MA 4IKFA 1RTHA 4CHQA 2ATQA 4CEFA 1TL1A 1VSJA 3O3GA 4CGGA 3NDKA 4FJ8A 4CEEA 3ZT3A 4CJSA 4KRFA 3O3HA 1WSFA 4KV8A 3QERA 4FW2A 4W5NA 2G8KA 4NCBA 3NCIA 1B9DA 4E7HA 4CEAA 4KTZA 4BWMA 4DTMA 3DLBA 3WNGA 1KSPA 2Z1JA 4F2SA 4OPJA 1O1WA 3LPTA 5SWMA 2XHBA 1ITGA 1UA1A 3PX6A 2E6LA 3K5MA 1D8YA 3SUQA 3OYFA 3HO1A 3ZT2A 3DOLA 1NJYA 4J2BA 3OYHA 4M42A 4I2QA 1J5OA 3AVIA 3HM9A 4J2AA 3V1RA 4CIEA 1WAFA 3DLKA 1ASVA 5KTQA 1QSYA 1RT5A 4FLVA 1QS4A 3VQQA 1NOZA 3OYMA 2W42A 1JKHA 3HPOA 1SKWA 2YKNA 4KTWA 1S1XA 4RW8A 1WSGA 4CGIA 3M8RA 5HP1A 4Z0UA 3VN5A 3LALA 4B9UA 4MQ3A 4B9SA 4DSIA 4FJ7A 3LP2A 2E4LA 4CJ4A 3SPZA 4AHRA 3C95A 2GBZA 1WN7A 2OA8A 2X78A 3VQ6A 4FJ9A 3KLHA 2QK9A 2IS3A 4N56A 1N5YA 1JLEA 1BL3A 1RDCA 3SZ2A 3I8DA 4M3TA 5I42A 1IO2A 1NK7A 1L3VA 4LH5A 1RILA 4DTSA 1JLAA 4I2PA 3VQ4A 3QIPA 4CJLA 1TAUA 3KJVA 4BDYA 3U6FA 2F8TA 3TAEA 4LSNA 4NCGA 3KLGA 1QSSA 2Z1GA 4OJRA 4N41A 3LP0A 4AHSA 4HCBA 4IG3A 1HNVA 3OYNA 4DS4A 1L5UA 4ZTJA 1A5WA 3MXJA 1RT6A 1U49A 3T19A 3LWLA 3ULDA 1W9HA 4LH4A 1SL1A 3MECA 1IG9A 4FJIA 5K14A 2GUIA 2OPSA 3NF6A 1GOBA 1RT2A 4EP4A 3D0PA 2XY7A 5J2PA 3OYBA 4CEQA 4FM0A 3DYAA 3TABA 3KD1E 4G1QA 3NH1A 4M3RA 3KK2A 2XY8A 3B6OA 3S3MA 5J2MA 5SZTA 3K58A 1HJRA 1VK0A 3M8SA 3KK1A 3P1GA 4IBNA 5C24A 4CK1A 3TAGA 1TK8A 1JLGA 3QINA 1QHTA 3CQ8A 2HHUA 3TAQA 1VSIA 2HNDA 1I39A 3RMBA 2YNHA 4DU4A 3ZSZA 3LZJA 3L2UA 1C0TA 3PY8A 1Q9XA 3S3NA 1Q8IA 1WAJA 1Y97A 1HYSA 4CJQA 3SQ1A 2IOCA 1A5XA 3DM2A 3DRRA 4CFCA 3HL8A 4GVMA 1RDBA 4CJUA 1RCHA 4CJ5A 4H4MA 3L3VA 1VSLA 1FKPA 1LWFA 2Z1IA 3SJJA 4CF2A 1SUQA 1RBRA 3ISNC 2BE2A 2QKBA 3V9XA 1MU2A 5KRSA 1NK8A 4DSKA 4C8OA 3G0ZA 1UOCA 1EETA 1X9WA 3MAQA 3V1QA 1U47A 3DI6A 5HRRA 4ELTA 4L8RB 3KLEA 4CJFA 4KPYA 1W0HA 4OKJA 4LSLA 3OYDA 3S9HA 3LP3A 1NJXA 3CM5A 2PYLA 4KI4A 2PZSA 1BISA 2WOMA 3NH2A 1TKZA 4KO0A 3TARA 3SUNA 3F9KA 4DFJA 3NFAA 4CECA 3UIQA 4FJXA 4E19A 1S9GA 2P5GA 4Z4CA 3HVTA 4CHYA 3F73A 2R7YA 4DTUA 3O4QA 4AH9A 5J2QA 4M3XA 2HHXA 4KHWA 4BE1A 4CJTA 4O44A 3CFPA 5KRTA 1R0AA 1JLQA 4BACA 3M8PA 4FCYA 3G10A 4FLZA 3QESA 2G8WA 3TWHA 1YTAA 1C6VA 1TKXA 3AVMA 4H8KA 4HUGA 4EZ6A 3TAPA 1RT4A 3OYIA 4KAZA 3LP1A 4FJLA 1LW2A 3NF9A 1ASWA 3AO5A 3THVA 4NCAA 5FDLA 1UA0A 4HHTA 2HVHA 2FBXA 4O4GA 4UQGA 3TAFA 3P5JA 3QEPA 3K5OA 4CGFA 4JS5A 1SV5A 4B08A 4M3ZA 1HMVA 3OY9A 4K8XA 4KHUA 3HJFA 3RRGA 1WNSA 4CGJA 2A1RA 3C6TA 1U45A 3B6PA 3KTQA 1ASUA 1KVAA 1RNHA 3L2RA 4ZTFA 2IC3A 1NK5A 1L3UA 2YNFA 4M45A 1FK9A 3C94A 4FLYA 2YHAA 1JL1A 1YVUA 1VRUA 4ID1A 3NAEA 1EXQA 1ZBFA 3S3OA 1KRPA 2RF2A 1C0UA 1TAQA 4N47A 2IGIA 4CJVA 3OYGA 3V4IA 3ZCMA 3IG1A 3SQ4A 4ZHRA 2HNZA 2O4IA 3VA3A 3TI0A 2QXFA 4DTXA 1J54A 3SQ2A 4DQPA 1JXBA 1S5JA 1Z25A 1LWCA 3ZT1A 3HSTB 4YNQA 4DSEA 1WSEA 4CJEA 2EX3A 4GW6A 3OYKA 3KK3A 1CZBA 3QLHA 2HHSA 1TKTA 5C42A 3OS2A 4Q5VA 3KKSA 1RT7A 2HHVA 5KI6A 4PUOA 2G8IA 4ID5A 1A5VA 5E41A 1JLBA 3QEIA 3DLEA 1BIUA 3CFRA 1TV6A 4CF0A 4KHSA 3AVKA 3SUPA 2KW4A 4FLWA 4CESA 4BDZA 3I0SA 5CYQA 1KVBA 3VQAA 3NE6A 5CZ2A 3V1OA 4M3UA 1XHXA 5J2NA 1EX4A 1NKBA 2D5RA 3QEWA 3AA2A 4DSJA 5DMRA 3AV9A 4CIGA 2I5JA 3MXMA 2B6AA 1GOCA 1S6PA 3CM6A 3EYZA 3NBPA 3IS9A 1BI4B 4DQQA 2DY4A 4DTJA 4K8ZA 2VWKA 2XRIA 2IDOA 3BGRA 3L3UA 3HT3A 3SCXA 4PQUA 5CZ1A 1F21A 2G8FA 3WNFA 5HBMA 4DFPA 2BGGA 2GV9A 2FBVA 2LSNA 3KLIA 2VG6A 3T1AA 2KTQA 4B9NA 3VQ7A 1DLOA 1C1AA 3NGIA 1HPZA 1RTIA 3MEEA 1BHLA 1TK5A 3I0RA 4DLGA 4DTOA 5FRMA 5JS1A 4FLTA 3HVRA 1YTUA 1KLMA 4CCHA 4CJKA 1IKVA
chains in the Genus database with same CATH superfamily
1KFDA 4CGHA 2OANA 4FSVA 3V9UA 1K6YA 2E20A 4DR5K 3HZ6A 5H1SQ 4DWIA 3O9SA 1N8RO 2JLEA 1CXUA 3UKRB 2PY5A 1NJZA 5ADXA 3AVCA 4BE0A 4BR2A 3RWUA 4PKIA 1YJ9N 1UAXA 5HRNA 2YKMA 4LF6K 3C0BA 3DXKB 3KVGA 5JVGL 4IDKA 3JSMA 4NXNK 1BQMA 3BEXA 1KLNA 3QO9A 2OYQA 1HJOA 5KGWA 4E1MA 5BRDA 3O5BA 2YHBA 4HUFA 3QFPA 4IDHA 1VQPN 5BPNA 4DFMA 1N36K 4F3OA 1RGIA 2FSKA 1OVYA 4BRCA 1Z26A 1X9SA 4ELUA 3SPYA 4B3OA 3L2QA 4Z4FA 2DFFA 4HTLA 1LAVA 1RBVA 3GBTA 4CEBA 3DMJA 1LWEA 1YUWA 4CHOA 5AQNA 1ZBHA 4YOUA 4X66K 5EY4A 2HSTA 3LANA 3PX4A 2KHOA 1NMDA 2XY5A 3HXMA 4OPAA 2YJEA 3M3ZA 3EY1A 4EZ9A 2PBDA 1S3XA 1IJJA 4CJ7A 4B9VA 5MLCQ 3OYJA 3AO4A 2O8DB 1LW0A 5KQDA 1TKDA 1VHXA 2BUPA 3T1HK 5D3GA 3LZIA 4QAGA 3SMPA 1FKOA 1T7PA 3NH0A 2JGUA 2VGNA 1NKEA 4YORA 3OYEA 3BDPA 4JRPA 5EVZA 3VEZA 3H6EA 3C65A 2HF3A 4KHNA 1M1KO 4BRGA 2QKKA 4DR2K 2CGJA 2ZE2A 2UUBK 5BR8K 4H5TA 1RFQA 5GIOA 4PKHA 1ZBSA 4MLHA 2HHQA 4ILGB 2O8DA 4BWJA 3SI6A 2DFHA 4MDAA 4E0DA 4FOEA 4DSLA 3HYFA 4LY7A 3O80A 1NK4A 3MCAB 1EP4A 3VQBA 4KI6A 2HVIA 2V7YA 3CCQN 1BDGA 1KCFA 4FVMA 3KKRA 3QNOA 1MDUB 4DQSA 2ASMA 1LAWA 3M8QA 4K25A 1J5EK 1I3AA 4JK8A 4Q0BA 3G71N 3ZT0A 3CF5L 1RT1A 3CJ7A 4EHUA 4OX9K 4BR7A 1NGFA 4LD0A 4X62K 2OPRA 3V81A 3ZT4A 4BC2A 5CE3A 4FK2A 3BF3A 3HPGA 3HP6A 3ITHA 4XH4A 4J2DA 2PYJA 2BDPA 2RKIA 3HPHA 4BRPA 3SAHA 3CCEN 3OYLA 3SV4A 3H45C 1VQ7N 3I56N 2KKZA 3A5NC 3IUCA 3CJ9A 3ZSQA 3AVJA 2F9TA 4H0OA 4JK9A 5GAHP 4YOVA 5AFUA 3NF7A 4O8UA 3KLFA 2OTLN 2DTUA 3MN7A 3O9QA 3KK7A 4GMJB 3EO3A 1K8AO 1T05A 2FBYA 5FPNA 4H4OA 4E89A 3SYZA 2Q3SA 1NKCA 1W7AA 1VSEA 3L0QA 4F4KA 2WBNA 4YOYA 3LDNA 4B3TK 2P9LB 2YHWA 3QB0A 4Y1DA 3VQPA 1TGOA 3DLHA 4PL8A 2KZZA 4HTUA 4PWDA 2W41A 4FJNA 2IAJA 4ICLA 1VQ6N 4DS5A 2G8HA 3JAMO 3GE1A 1C1CA 4H03B 4OGCA 3E9PA 4WCEL 5HL7L 4YY3K 4GKKK 3VGKA 5B8HA 3O3GA 2J4RA 4H0TB 3OW2M 1I94K 4CEEA 4KRFA 5DM7L 4KV8A 4FW2A 1QVFM 3NCIA 4E7HA 2FF6A 4F2SA 3LPTA 5SWMA 3PX6A 1D8YA 3OYFA 2P9LA 1NJYA 4J2BA 5JLFA 4IO8A 4JI1K 4CIEA 1WAFA 3VQQA 1Z6RA 3OYMA 2YKNA 4KTWA 4RW8A 5AQSA 4B9SA 2HHHK 1QVGM 3SPZA 2E4LA 3OBYA 4CJ4A 3U4LA 4GY2B 3H3OB 2HF4A 4FJ9A 1GLDG 2QK9A 2F7TA 1BL3A 4M3TA 5I42A 1IO2A 5AQYA 1NK7A 1BOTO 2OCEA 3QIPA 2AP1A 1ATSA 1DEJA 4NCGA 2O8EB 2QWMA 2PFUA 3LP0A 3VEOA 4HCBA 1HNVA 1L5UA 3TTCA 4BC5A 2QWLA 4JI7K 3N4PA 1U49A 3TSUA 3ULDA 2OPSA 2E5LK 3D0PA 3S41A 5J2PA 4WQ4A 4JKHA 3DYAA 3KD1E 3KK2A 2AA4A 1SQKA 5AJ3K 5SZTA 3M8SA 3KK1A 4IBNA 4CK1A 1VQLN 1VSIA 3R6MA 4DU4A 3L2UA 3IKMA 4JI0K 4IOCL 1IBMK 2O8EA 2IOCA 4GVMA 1BO5O 2QWRA 3VEYA 4CJUA 1FKPA 4CI6A 2Q0UA 1SUQA 2BE2A 5KRSA 3FZHA 4DSKA 3BZCA 3HM8A 3ULEB 1X9WA 2QWQA 4AF1A 3WUHA 3WXJA 3BUZB 4ELTA 4CJFA 1W0HA 4OKJA 4WQ4C 2ZJPL 3S9HA 3LP3A 4KI4A 3TARA 3EE8A 4CECA 2A3ZA 3UIQA 5AQTA 1S9GA 4FWRA 3HVTA 4A62A 5M1NA 4M3XA 2HHXA 4BE1A 4H0VB 3ZLJA 2G8WA 4FCYA 3G10A 4HUGA 1YAGA 3TAPA 3OYIA 4KAZA 3M5RA 4FJLA 1LW2A 4FPBA 4B1YB 4YDUA 4HHTA 3P5JA 3C6HA 4CGFA 1SV5A 4NLBA 2ZJQL 2NRRA 2UXBK 2A1RA 1U45A 1WBBA 2WTUA 3P38A 4DQ8A 3L2RA 3TSQA 2IC3A 5AQLA 4U7BA 4M45A 3C94A 4FLYA 2YHAA 1JL1A 1YVUA 1VRUA 3NAEA 1Q18A 1C0UA 1TAQA 2D0PA 5AZIB 4FWOA 4CVNE 2FLOA 3EKSA 5ADXH 2O4IA 4JHDB 1OKJA 3H3NO 1S5JA 1LWCA 3O6WA 5C15A 4YNQA 4CJEA 3KK3A 1Y64A 3CJBA 1CZBA 3KHYA 5AQXA 1TKTA 3CD6N 4Q5VA 3L4IA 3J7ZO 2YI1A 4NXMK 4PUOA 2G8IA 4ID5A 5E41A 3QEIA 1JLBA 1Z05A 3CFRA 1TV6A 3DLLL 1KXPA 4DV2K 3SUPA 2KW4A 5LJVA 1KVBA 4M3UA 1EX4A 3AA2A 5DMRA 5JMVA 4M7YA 3CETA 3LDQA 1IG8A 4FWSA 5AZIA 2NZTA 2VQFK 4JHDA 4K8ZA 2GEMA 3SCXA 4PQUA 4Y0WA 3D2EB 2G8FA 1F21A 3WNFA 2V52B 2IVPA 4XH1A 5C12A 3NGIA 4JAXA 1BHLA 4DCHA 4DTOA 4L3QA 2A40A 3WEEB 1KLMA 4CCHA 2GX9A 1GLEG 4CEDA 5FROA 4FZXC 1VQ5N 1JCFA 3K5NA 1RTDA 3O8MA 5AQVA 4BRAA 5CY4A 1ZBLA 3TR8A 4PL7A 4OKKA 3N4QA 3IRXA 3L2VA 5KPZA 2QWPA 5TKYA 3VOVA 3ZSXA 2G8VA 2HW3A 1BA1A 2PAVA 3D2EA 1CZ9A 1R59O 4JK7A 4LFAK 2OZMA 3WEEA 1XWLA 3IDHA 2BH1A 3C6AA 3CCRN 5E84A 5F0XA 1SKRA 3AO1A 1NMNA 1XMQK 4M3YA 4DV4K 3MEGA 3VQ8A 3TANA 3EZ5A 4XIUA 1H1VA 3AY9A 1KQSM 2VG7A 2VYPA 1ZC6A 3OS0A 3PO4A 3VQDA 3NHGA 2F8SA 3FZFA 3O08A 1ESVA 4DR6K 3AA3A 2ZQBA 4FWMA 2ZWHA 4CHZA 1B92A 2XO7A 1T8EA 2XY6A 3HOTA 1S1VA 4BRQA 3OS1A 4AHUA 5IWAK 3WXKA 3E66A 1GLFO 3PUFA 4Z4HA 5HRPA 4H5NA 3VQ9A 4AILC 1DT9A 2NRXA 1VQ8N 4LF9K 5FRNA 4NYNA 3RVCA 4QOZB 3AO3A 4RG8A 3ALYA 3A0IX 4MFBA 4Y1CA 3OJUA 4LF4K 3CI5A 1EO1A 4IFVA 3L2WA 1EQYA 2O4GA 1ATRA 1WSJA 3VQ5A 2YNGA 3L4QA 3AVAA 1BQNA 1VAZA 4DMNA 5AQIA 3OTOK 3VTHA 4W5RA 1RBUA 4FWLA 4A61A 1HNWK 4OLAA 1XC9A 3NF8A 3V9ZA 4X65K 1ZYQA 2A41A 3E9OA 3LWMA 4EP5A 1Q82O 4KB0A 2P9UA 1HLUA 4OLBA 1CXQA 5HROA 2VWBA 2KFNA 1NGIA 4JKBA 3SUOA 2B5JA 4DTNA 3Q7BA 2VWJA 4O5BA 4YFUA 3H08A 1G99A 4FM2A 1SS6A 4JKDA 4E1NA 5GINA 3CYMA 1MWKA 2KQ2A 2F96A 3O9RA 4RW4A 2HHWA 4DUYK 2YNIA 4OKEA 4M3WA 3VF6A 3WNHA 4HVJA 1GLJO 3I8BA 1JLFA 3J7AP 1TL3A 4TSXA 5F2RA 3VF2A 3B8AX 5E26A 2Y1IA 2D0OA 4E3SA 3G4SN 3V9SA 4G9ZA 3ASMA 4EAHD 4DTPA 4FLUA 4CE9A 2DPNA 1N34K 1U4BA 4H0PA 2D1KA 3OHRA 1QTMA 1J53A 1X9JA 2UYTA 3ZX3A 4DV0K 4CFAA 3SV3A 2WUSA 1NGHA 5J1EA 1NK9A 3AVGA 4JD2A 1S6QA 2HBJA 3ZSYA 2DFEA 4DLEA 4JI5K 4DF4A 2OPPA 2X6SA 2O8FA 3IAYA 4KKOA 2VCPA 4CF1A 3KIOA 2G8UA 1IBLK 4ELVA 4M63C 3R9PA 4CD1A 2W40A 2KLAA 4HWIA 3RMCA 1ZBUA 2HHTA 2Q0RA 2E6MA 3CPWM 1BGXT 3EKUA 4BQZA 5HRSA 1KTQA 3CCMN 4I9QA 2D0AA 3FZKA 1G15A 1LV5A 2NUBA 3ENOA 1VSKA 4CFDA 2Y1JA 4I7FA 5EX5A 4N76A 5I3UA 2P9SB 4PHTX 3O1BA 3E1YA 4IKFA 1RTHA 5AQKA 1VSJA 2VQEK 4H5WA 3NDKA 4FJ8A 3ZT3A 4WQ5A 1YF5L 5GADP 4CBWA 4W5NA 2G8KA 4NCBA 1B9DA 4KTZA 4BWMA 3VGLA 4XH5A 2ZM6K 1KSPA 2Z1JA 3DLBA 4GV6A 5IT9O 2XHBA 3UB5A 2E6LA 2YX6A 3HO1A 3I55N 4KH4A 2YCHA 4I2QA 3OYHA 3AVIA 3QBXA 4DKWA 1RT5A 4FLVA 1NOZA 3QMLA 2W42A 3HPOA 4MO5A 4XEIA 4BR0A 1WSGA 2P9KB 4FJ7A 2P9SA 3DWLA 4AHRA 3C95A 2GBZA 4A5BA 4BVPA 3KLHA 3D6RA 4GV3A 1RDCA 3ATVA 3K9JA 1L3VA 4DTSA 3LDLA 4CJLA 3TAEA 4CZJA 4WQ5C 3WXIA 5BRHA 2ZF5O 1QZ5A 4AHSA 3DAWA 4IEEA 4IG3A 4BRMA 3F2KA 3MXJA 2P9IA 4OO1J 1SL1A 2GUIA 4FO0A 2XY7A 2P9KA 5AQFA 4JI8K 2XY8A 3B6OA 3S3MA 5J2MA 1HJRA 3FE1A 1JLGA 1QHTA 2JWKA 1SZ2A 2A42A 2HNDA 3J8AA 4K43A 1I39A 4IOAL 3RMBA 3ZSZA 3LZJA 1WAJA 4KH5A 1V4SA 5C2FA 1HYSA 1A5XA 4CZKA 3PLAA 4H4MA 5EOYA 1LWFA 2Z1IA 3A5OC 1RBRA 3ISNC 2QKBA 4BC3A 3V9XA 1MU2A 3CMAN 4UY8O 4C8OA 3G0ZA 3FGUA 1EETA 3FZLA 4CZGA 3U9DA 3EEQA 4L8RB 3T1YK 3KLEA 5M1QA 4KPYA 4DUZK 3OYDA 4LSLA 4DV1K 2PZSA 1TKZA 2P9NB 3QICA 3SJHA 3MX5A 4DFJA 2IIRA 3NFAA 3SBGA 3SUNA 4E19A 4Z4CA 3F73A 2R7YA 5J2QA 3FFKB 4KHWA 1HPMA 4CJTA 4O44A 5KRTA 3M8PA 4FLZA 3EL2A 3ID6A 3TWHA 1YTAA 1TKXA 4H8KA 1JJ2M 4BR5A 5AZJB 3LL3A 3LP1A 3RSEB 4ILHA 4KBOA 4NCAA 3SK3A 2FSNA 3QEPA 3K5OA 2P9NA 4H0YB 3OY9A 2QTDA 4ISGA 4K8XA 4KHUA 3RRGA 1WNSA 5FLXO 3C6TA 2P9PB 1ASUA 1KVAA 1K8KB 4DR3K 4B3MK 4RCHA 3S3OA 1KRPA 4B1VA 3H1QA 2IGIA 4CJVA 3ZCMA 5AQZA 3TI0A 2WFBA 3SQ2A 5AZJA 1WB9A 1Z25A 3ZT1A 2UUCK 4JNEA 1MWMA 3HSTB 3RSEA 3OYKA 2Q36A 3QLHA 5C42A 4X64K 2W6LA 2HHVA 5KI6A 4V19S 1A5VA 3VEXA 5BPMA 3DLEA 1NGAA 3GDQA 1X3NA 3UKUA 3ZETB 3NMUA 1NGEA 4FLWA 3EZWA 3UE5A 2P9PA 3PIOL 5CYQA 1K8KA 5J2NA 1NKBA 2D5RA 4DSJA 3CQXA 4YOTA 3CPEA 4H0XB 1GOCA 1S6PA 4JKAA 3IS9A 4DTJA 3VENA 2QWOA 3BGRA 3MX2A 4DFPA 1NGBA 2LSNA 3T1AA 3OA9A 1C1AA 1RTIA 1TK5A 3ZX0A 3I0RA 5JS1A 4ILJA 4FLTA 1P90A 1YTUA 4HCCA 4BVOA 4CJKA 1IKVA 4W5OA 3ZSVA 3ZX2A 4PA1A 3U3GA 3ZETA 4JI3K 4MDBA 3ZSWA 4FVUA 3TTFA 4I9LA 1QQNA 2D0BA 3THYB 1REVA 4Z4GA 1E3MA 3R8EA 3HTVA 4C23A 5F1XA 1X3MA 3MN5A 4FL9A 3W0LA 1BIZA 3JYTA 3DRSA 2QI2A 4F8RA 1S1WA 4FJ5A 4B3SK 2UU9K 1XUPO 5C10A 4B9TA 3KZBA 1JLCA 4GV9A 4FJMA 2D0CA 1K73O 3ZEUB 5LL6Z 1IKXA 3MMVA 4FW1A 3CFOA 4WFNL 3THYA 3ENBA 5BN8A 1NGJA 4BE2A 2KZMA 4BG9A 4CJPA 4R5PA 3MN9A 3SAFA 3HI0A 2CH6A 3AVHA 4FXDA 4DV7K 3I33A 1KFSA 4C8LA 1KAYA 1VRTA 1BCMA 4BDPA 3VESA 4R79A 1OH7A 1OH8A 2A5XA 3BZKA 3U9ZA 4DU3A 3ZSRA 3MXIA 1KAZA 3ZEUA 4B8AB 4YOXA 5HLFA 2IVNA 2BTFA 3MWPA 3K2PA 2RHKA 4IO9L 2P51A 2VG5A 1Q9YA 1VQNN 4CGDA 1IKWA 4B9LA 2FSJA 3OYCA 3FFIA 3WQUA 3VEVA 3CCJN 1O13A 2HBMA 1NU0A 4B9MA 4JS4A 2FBTA 1IH7A 3OJSA 4CF9A 3ZSOA 3NGYA 4FJGA 5BRFA 2QM1A 1U48A 3AA5X 4JEPA 1IKYA 3K57A 1K9MO 1Q81O 2W6KA 5AQMA 2ETJA 1T03A 4Z4IA 3RRHA 4W5QA 3VMFB 1JXEA 1RTJA 3J80O 3VQEA 3CMEN 1NM1A 4KHYA 1ZBIA 1BG3A 4BQLA 2KFZA 2OZSA 3R3LA 4CHPA 1HYZA 3DRPA 3D2FA 4FJJA 4K41A 4M7XA 3TAMA 4WFBL 4CK3A 1WBDA 3U3YA 1SL0A 3G6EN 1XNQK 3THXB 4GKJK 2OTJN 2NRWA 3D7EO 4LFCK 3C6UA 4MLEA 4LFBK 3RMDA 3PX0A 1HQEA 4EHTA 1VSMA 1RT3A 4CERA 4AHCA 2E2OA 3WNEA 3BF1A 1DTTA 3BP8A 4BGBA 3T3FA 1YT3A 1BWFO 5CR4A 4BROA 2RPIA 4WYBA 3ID8A 1WSHA 3QNNA 2FXUA 3M6GA 4JI6K 1CLQA 3LM9A 4BRFA 4WF9L 2NRHA 3THXA 3CG7A 4HUEA 5C25A 3HK2A 4Z4EA 2HNYA 3DJCA 4JLHA 1VSDA 1Q7YO 1CZAN 3D45A 2NLXA 3SNNA 4CJWA 1TUUA 3RMAA 3QBWA 4GNIA 4BRNA 2EHGA 3VPZA 1QQMA 3RR8A 1MA9B 4DR1K 1SKSA 2B4JA 4C8MA 1BCOA 4OPKA 1QSLA 2QEXN 4A2AA 1L3SA 4B1WB 4O8KA 2FC0A 4K0KK 3QETA 5KGXA 2HB5A 1HX1A 3DLRA 2NRTA 4CIFA 3AVBA 1JL2A 1VSFA 4QS8A 1C0MA 5JS2A 3CHWA 3DOKA 5JICA 1D5AA 3AVNA 4O0IA 3SMSA 2P9UB 1HUXA 4CHQA 2ATQA 4CEFA 4BRHA 5AQQA 2NNWA 3CJ1A 3O3HA 1BA0A 3QERA 4PKGA 4GVEA 4CZHA 2E88A 3F5TA 4LF8K 2ASPA 1QZ6A 1ITGA 1UA1A 3FLCO 3DOLA 4M42A 3MCPA 1P8ZA 3HM9A 3V1RA 3DLKA 2YJFA 1ASVA 5M1OA 1GLAG 4E1JA 1JKHA 3MWTA 1SKWA 1S1XA 4CZFA 1C0FA 5HP1A 1YITN 4MQ3A 5AQOA 1VQ9N 1E4GT 2I7NA 1YXQA 1D4XA 1N5YA 4BY9C 3I8DA 4LH5A 1RILA 3CCLN 1BU6O 1T44A 2FF3B 3O9UA 4H5RA 4LSNA 2ITMA 2V51B 4IZ9A 3KLGA 1QSSA 2Z1GA 4N41A 4JD2B 2YHYA 1RT6A 3KWIA 3T19A 3LWLA 2O8FB 2V7ZA 4EP4A 3P4IA 3OYBA 3TABA 4CBUA 4O5FA 3K58A 5I9EB 3P1GA 5C24A 1TK8A 3CQ8A 3QINA 1HKGA 2YNHA 1YI2N 2E1ZA 1C0TA 1Q9XA 3S3NA 1Q8IA 3SQ1A 3HL8A 4F9OA 1RDBA 1RCHA 3SJJA 1GLBG 3J7YP 4BR4A 5AQRA 3K9KA 1NK8A 1UOCA 5LY3A 4EIAA 4CZIA 3DI6A 2CGKA 2PYLA 2F8TA 1E4FT 1BISA 2ASOA 4KO0A 4YOWA 3GL1A 5TKWA 1M90O 3F9KA 3CCSN 2ZJRL 4U67L 3PIPL 5JLHA 2Q1NA 1XMOK 4AH9A 3UKRA 5BREA 5M1FA 3CFPA 1JLQA 3H46O 4BACA 2Q2RA 1C6VA 3SBTA 3AVMA 4EZ6A 4DHYA 4KHPK 2HOEA 3DXKA 3NF9A 3AO5A 3A8YA 2HVHA 2FBXA 3TAFA 2QW9A 3M1FA 2UXCK 4JS5A 1J6ZA 4B08A 1EWRA 1KC8O 1HMVA 3HJFA 4NO7A 4JI2K 2D4WA 3SLCA 1L3UA 1NK5A 1ATNA 2YNFA 4FWNA 1FK9A 1IV0A 3IFRA 3LM2A 5KPRA 1XC3A 4ID1A 1ZBFA 4DB3A 2P9IB 4N47A 3OYGA 3SQ4A 3IG1A 4JN4A 5LJWA 2QXFA 4CD3A 1J54A 3WXLA 3KWGA 4EFHA 1WSEA 4H5VA 4AM6A 3HSCA 3OS2A 3KKSA 1RT7A 3F9MA 3VGMA 3FZMA 1BIUA 4A5AA 3CERA 1WUAA 4CF0A 4KHSA 3AVKA 4QS7A 2GUPA 4CESA 4BDZA 3I0SA 3THWB 3NVKA 3VQAA 5CZ2A 4B9QA 1XHXA 4CZLA 3QEWA 3AV9A 3MXMA 2DY4A 4DQQA 1BI4B 1SAZA 1V4TA 3DXMB 2VWKA 1NGGA 2XRIA 3HRGA 4DV3K 5CZ1A 4I6MB 5HBMA 3O1WA 2FBVA 1NWKA 2KTQA 2VG6A 4B9NA 3VQ7A 1DLOA 3MEEA 4OPHA 3HVRA 3IMXA 3E9LA 4CK2A 3LAKA 3MEDA 4CJ3A 4JKFA 3VF4A 2ZGYA 3THWA 3AARA 1RDAA 3CXCM 4NYFA 4C8NA 4DG1A 1RDDA 4CZMA 4FZYA 1C1BA 3QEXA 1WLJA 5HOOA 4FJHA 1XI1A 3NGZA 1BI4A 3MDQA 3QIOA 4BRLA 3DXMA 4M41A 4AHTA 3T7ZA 3OYAA 4FK4A 2ZD1A 4I6MA 4FLXA 4CBXA 4CHNA 2P1JA 3CC4N 4FPAA 4N5SA 2WC9A 2Z1HA 4RW6A 1L3TA 3R1XA 1VQ4N 4FYDA 1RDUA 1NG9A 1TK0A 1VQMN 1D9DA 4BRDA 1NJWA 4DR7K 3AA4A 3CCUN 5LMUK 4IFYA 3VQCA 5DM6L 2RE2A 3V9WA 1S9EA 4C1NK 4NB4A 4BC4A 4JRQA 1FW6A 1B9FA 4KB1A 4LF5K 4KREA 1SL2A 4NLCA 1QQCA 1WSIA 4C8KA 3AAQA 3VA0A 1NOYA 2A1SA 5BN9A 2NRVA 1W97L 4JYAK 1YJWN 3UKUB 3LPUA 1NBWA 3HP9A 3V6DA 3OVNA 1NGDA 4KFBA 4CEOA 1HR0K 4FJKA 3LDOA 4FZZA 1OH5A 1LOTB 3KD5E 2UXDK 3ATUA 4CF8A 2UUAK 2VGMA 3AVLA 3O9TA 4DR4K 4QCLA 1VQKN 1N33K 3O4NA 4BREA 4DFKA 1DGKN 1S1TA 1JCEA 2IVOA 2P5OA 4RW9A 1NGCA 4CEZA 5EU7A 1U2VB 3K59A 5AQGA 3LDSA 3RR7A 1KVCA 4CW7B 1NK6A 2RN2A 1OVQA 1KD1O 2OPQA 1HQUA 4DU1A 3CC7N 4CFBA 3L8BA 5C0YA 1TVRA 3BY5A 1D9FA 1DTQA 1IBKK 4KHQA 4PY5A 3K5LA 4CJRA 1EKEA 1HNIA 4IJAA 1HKCA 3AO2A 3W3DA 3ZYYX 1C0GA 2F9WA 3CJCA 2E2PA 4FWKA 1S72N 1EWQA 5BPLA 1YVNA 4AM7A 2HMPA 4DQIA 4FK0A 3AVFA 5CYMA 4A2BA 2ZGZA 1U2VA 1U04A 1UWBA 3PO5A 4IWVA 1YJNN 1VSHA 1X1PA 1XHZA 2O8CB 4O55A 3QEVA 1YIJN 3TPQA 2ITGA 1S22A 4BG8A 3ENHA 2Q31A 2F4VK 1GLLO 2QA4N 3CQYA 3VETA 2Q97A 3O3FA 4IG0A 1J9AA 2JWLA 5T7BA 2E1YA 4OGEA 1FJGK 1RBSA 1QE1A 4E7IA 1GOAA 3J81O 1HYVA 2HBKA 4AHVA 1NK0A 4DQRA 3P83D 4E7LA 4B8CA 2O8CA 1OH6A 4J2EA 4BRKA 1N6QA 4RWTA 1RBTA 3E01A 4DTRA 2YV0X 4AQYK 1TYQB 2WONA 4DF8A 1ILYA 1HRHA 1QHAA 2BANA 1FXXA 2X74A 4F3TA 3CIPA 3A2FA 4O0JA 3GOIA 4E7KA 3DLGA 4OVLA 2AJQA 3VERA 2HMIA 4FM1A 5DK5A 4RW7A 4LC9B 3T69A 3SQ0A 4C1NI 4DSFA 4KTQA 4F2RA 1HKBA 4E7JA 1S1UA 1HNZK 3A5LC 5FPDA 4FWPA 2X6NA 1TYQA 3ULEA 4W5TA 1LCUA 3LAMA 4WE1A 3RTVA 4YHHK 1X9MA 1T3VA 1TL1A 1VQON 5AQWA 3TU5A 4CGGA 3JS6A 2EWSA 4CJSA 1RDWX 4WFAL 1WSFA 3Q7CA 3SAGA 4CEAA 3HBTA 3MN6A 3QFUA 4DTMA 3WNGA 3D2FB 4OPJA 1O1WA 5ELZA 3K5MA 3SUQA 3ZT2A 4QS9A 2GWJA 4JKEA 1J5OA 1U6ZA 2GELA 4J2AA 1ZXOA 2CH5A 3OBWA 3K0SA 1QSYA 5KTQA 3H1VX 4BRIA 2QXLA 1QS4A 3L6QA 4CGIA 3M8RA 4B9UA 4ISEA 4DSIA 4Z0UA 3VN5A 3LALA 5AQUA 3LP2A 2GWKA 1BUPA 2OA8A 1WN7A 5M1KA 2X78A 3VQ6A 2IS3A 2E8AA 4N56A 4JKCA 1Q86O 1JLEA 4Z94A 3VTIA 3SZ2A 5KQ8A 1JLAA 4I2PA 3VQ4A 4A57A 1TAUA 3KJVA 4YDUC 4BDYA 3U6FA 4IFEA 3A5MC 4OJRA 3OYNA 4DS4A 5GAEP 4ZTJA 1A5WA 4BR9A 4B1XB 1NJIO 1W9HA 1NLVA 4LH4A 3MECA 1IG9A 4FJIA 5K14A 2I7PA 2QWNA 1GOBA 1RT2A 3NF6A 4K42A 4MO4A 4A59A 3O4WA 3EE9A 4IEIA 4CEQA 1GLCG 4FM0A 4G1QA 4RTFD 4M3RA 3NH1A 1TUYA 1VK0A 1T6DA 3TAGA 3FR0A 2E2QA 2HHUA 3TAQA 5FPEA 3P31A 3PSFA 3PY8A 3VEWA 1Y97A 1XNRK 1XQSC 2GTDA 4CJQA 3LDPA 3DM2A 3DRRA 4CFCA 1T6CA 3NVMA 1WOQA 4CJ5A 3L3VA 1VSLA 4CF2A 4LF7K 4ISFA 3GG4A 4CZEA 3CCVN 5AQPA 4B3RK 1N32K 2YHXA 2HBLA 3MAQA 5GIPA 3V1QA 1U47A 5HRRA 2CGLA 3CJAA 1NJXA 3HOSA 4IOXA 3CM5A 1JCGA 2WOMA 3NH2A 4JI4K 4J8FA 5JVHL 2NRZA 4FJXA 2A6AA 2O8BB 3EN9A 2P5GA 4CHYA 4DTUA 3O4QA 1YHQN 1W2BM 3JXUA 5LMNK 1R0AA 4DV6K 3QESA 2E2NA 1HNXK 5AQHA 1RT4A 3THVA 1ASWA 5FDLA 1UA0A 5AR0A 4UQGA 4O4GA 3TSPA 3PSIA 4KH6A 3C7NB 4M3ZA 3G25A 4CGJA 3B6PA 5A2QO 4IXCA 3KTQA 4JKGB 1RNHA 4ZTFA 2O8BA 4B1ZA 1QQOA 1EXQA 2RF2A 3V4IA 4BGAA 4ZHRA 2HNZA 3WQTA 3VA3A 3P39A 4FWQA 4DTXA 4DQPA 1JXBA 4B1UB 5CHIA 3U8XA 4JV5K 4DSEA 4IJNA 2EX3A 4GW6A 3WXMB 1DKGD 2HHSA 5C2DA 1NNEA 3QDKA 3C7NA 5M1PA 5KPTA 3TTDA 5EXWA 5BR9A 3CC2N 4JKGA 4FOIA 3NE6A 3V1OA 4CIGA 5AFUH 2I5JA 3AGRA 2B6AA 3CM6A 3EYZA 3NBPA 3MK6A 5FPMA 3AGKA 2IDOA 3AAPA 2H3GX 3L3UA 3HT3A 2BGGA 5AQJA 2GV9A 3KLIA 4DV5K 1HPZA 5GAGP 5FRMA 4DLGA 1KAXA 3WT0A 3PV8A
chains in the Genus database with same CATH topology
1KFDA 4W5OA 4CGHA 4CEDA 4CK2A 3LAKA 3ZSVA 5FROA 3V9UA 3MEDA 1K6YA 4PA1A 3U3GA 4CJ3A 3K5NA 1RTDA 4FZXC 3ZSWA 5CY4A 1ZBLA 1RDAA 3TR8A 4DWIA 4NYFA 4C8NA 4I9LA 4DG1A 1RDDA 2JLEA 1CXUA 2D0BA 1REVA 1C1BA 4FZYA 3QEXA 2PY5A 4Z4GA 1WLJA 4OKKA 4FJHA 1NJZA 1XI1A 3IRXA 3AVCA 3NGZA 4BE0A 1BI4A 3QIOA 3L2VA 2HW3A 4M41A 3ZSXA 2G8VA 4AHTA 3RWUA 1UAXA 1BIZA 5HRNA 3OYAA 3DRSA 3JYTA 1CZ9A 2ZD1A 4FK4A 4FLXA 4F8RA 1S1WA 4CHNA 2YKMA 4FJ5A 4IDKA 3JSMA 2P1JA 1BQMA 4B9TA 1JLCA 3QO9A 1KLNA 2OYQA 4N5SA 2OZMA 5KGWA 2Z1HA 4RW6A 1L3TA 1XWLA 4FJMA 4E1MA 4FYDA 1SKRA 2D0CA 3AO1A 2YHBA 1TK0A 4HUFA 1D9DA 4DFMA 4M3YA 3MEGA 1NJWA 3VQ8A 1IKXA 3AA4A 4F3OA 4IFYA 3TANA 4FW1A 3CFOA 3VQCA 3EZ5A 4XIUA 4BE2A 2KZMA 2VG7A 4CJPA 3OS0A 1Z26A 1X9SA 3V9WA 4R5PA 1S9EA 3VQDA 3NHGA 3PO4A 4ELUA 2F8SA 3SPYA 4B3OA 3L2QA 3AVHA 4JRQA 3AA3A 4Z4FA 2DFFA 2ZQBA 4FXDA 1LAVA 1B9FA 1RBVA 4CHZA 1B92A 1KFSA 4CEBA 2XO7A 1T8EA 3DMJA 4C8LA 1LWEA 4KB1A 1VRTA 4KREA 4CHOA 1BCMA 1ZBHA 1SL2A 4BDPA 1QQCA 2XY6A 1WSIA 4C8KA 1S1VA 3VA0A 1NOYA 2A1SA 3OS1A 4AHUA 4DU3A 3LANA 3ZSRA 3PX4A 3MXIA 3LPUA 2XY5A 3HXMA 3HP9A 3V6DA 4HCCA 3PUFA 4B8AB 3OVNA 4KFBA 4Z4HA 5HRPA 5HLFA 4CEOA 4FJKA 4FZZA 3VQ9A 3K2PA 3EY1A 4EZ9A 3KD5E 4AILC 4B9VA 2P51A 4CF8A 2VG5A 1Q9YA 4CGDA 5FRNA 4NYNA 3OYJA 1IKWA 3AO4A 3AVLA 4B9LA 4QOZB 4QCLA 3AO3A 4RG8A 3ALYA 4MFBA 4Y1CA 3O4NA 3OJUA 4IFVA 3L2WA 3OYCA 2O4GA 1S1TA 4DFKA 1LW0A 3FFIA 1WSJA 3VQ5A 2YNGA 1TKDA 2P5OA 4RW9A 3AVAA 4CEZA 4B9MA 1BQNA 5EU7A 4DMNA 5D3GA 3LZIA 4QAGA 1T7PA 1FKOA 3K59A 4JS4A 2FBTA 4W5RA 3NH0A 2JGUA 1IH7A 3PV8A 3OJSA 3LDSA 4CF9A 1RBUA 1NKEA 1KVCA 3RR7A 3OYEA 1NK6A 2RN2A 4JRPA 3BDPA 4OLAA 3ZSOA 3NGYA 1XC9A 2OPQA 3NF8A 3V9ZA 4FJGA 1HQUA 4DU1A 1ZYQA 1U48A 3AA5X 3LWMA 1IKYA 4CFBA 3K57A 4EP5A 3L8BA 4KHNA 1TVRA 1D9FA 1DTQA 4KB0A 4KHQA 2QKKA 4OLBA 4PY5A 2ZE2A 2ETJA 1T03A 1CXQA 3K5LA 5HROA 3RRHA 4W5QA 4Z4IA 1JXEA 1RTJA 3VQEA 4CJRA 1EKEA 4KHYA 1HNIA 2KFNA 3SUOA 2B5JA 1ZBIA 4DTNA 2HHQA 3AO2A 4BWJA 2OZSA 2KFZA 2VWJA 3SI6A 2DFHA 4CHPA 1HYZA 4E0DA 3DRPA 4DSLA 4O5BA 4YFUA 3HYFA 4FJJA 3H08A 3TAMA 4FM2A 4CK3A 4LY7A 4E1NA 1NK4A 1EP4A 3CYMA 3U3YA 4DQIA 4FK0A 2KQ2A 1SL0A 3AVFA 5CYMA 3VQBA 2F96A 4KI6A 2HVIA 4RW4A 1U04A 1UWBA 3PO5A 2HHWA 2YNIA 4OKEA 4M3WA 3C6UA 3WNHA 4HVJA 1VSHA 1X1PA 1XHZA 3RMDA 1KCFA 3PX0A 1JLFA 4O55A 1TL3A 1HQEA 4FVMA 4TSXA 1VSMA 1RT3A 3KKRA 3QEVA 3QNOA 4CERA 2ITGA 4AHCA 4DQSA 2Y1IA 1LAWA 3WNEA 3M8QA 4E3SA 3V9SA 3ASMA 1DTTA 1I3AA 4DTPA 3T3FA 1YT3A 4FLUA 4Q0BA 4CE9A 3ZT0A 1RT1A 2RPIA 1U4BA 4LD0A 3O3FA 1WSHA 2OPRA 3V81A 4IG0A 1J9AA 3ZT4A 3QNNA 5T7BA 1QTMA 1J53A 4FK2A 4OGEA 3HPGA 3HP6A 1RBSA 1QE1A 3ITHA 4CFAA 4E7IA 4J2DA 3SV3A 2PYJA 1CLQA 1GOAA 2BDPA 5J1EA 2RKIA 3HPHA 1NK9A 3AVGA 1HYVA 1S6QA 3ZSYA 4AHVA 1NK0A 4DQRA 3P83D 3CG7A 2DFEA 5C25A 3OYLA 4HUEA 4DLEA 3SV4A 4E7LA 3HK2A 4Z4EA 4DF4A 2OPPA 2HNYA 2X6SA 4B8CA 4J2EA 4JLHA 1N6QA 1RBTA 3E01A 1VSDA 3ZSQA 3IAYA 3AVJA 4KKOA 4DTRA 2YV0X 4CF1A 3D45A 3KIOA 3SNNA 2G8UA 4CJWA 2WONA 4DF8A 3NF7A 3KLFA 4ELVA 3RMAA 2DTUA 2EHGA 1HRHA 4GMJB 2BANA 3RR8A 1FXXA 2X74A 1SKSA 4F3TA 2B4JA 3A2FA 4C8MA 1ZBUA 3RMCA 2HHTA 1BCOA 2E6MA 2FBYA 4O0JA 4OPKA 1T05A 1QSLA 4H4OA 1BGXT 4E89A 3SYZA 2Q3SA 3DLGA 4OVLA 4E7KA 1NKCA 5HRSA 2AJQA 1KTQA 1L3SA 4I9QA 1VSEA 2D0AA 2HMIA 4F4KA 2FC0A 3QETA 1G15A 1LV5A 5KGXA 2HB5A 3DLRA 4Y1DA 3VQPA 1TGOA 5DK5A 4CIFA 2NUBA 4RW7A 4FM1A 3DLHA 2KZZA 3AVBA 1JL2A 4HTUA 4PWDA 1VSFA 3SQ0A 4DSFA 4KTQA 1C0MA 1VSKA 5JS2A 4CFDA 2Y1JA 2IAJA 4FJNA 4I7FA 4ICLA 4F2RA 4E7JA 4DS5A 2G8HA 5I3UA 1S1UA 1C1CA 3DOKA 4N76A 2X6NA 3AVNA 1D5AA 4OGCA 4O0IA 4W5TA 3LAMA 4WE1A 3RTVA 1X9MA 4IKFA 1RTHA 4CHQA 2ATQA 4CEFA 1TL1A 1VSJA 3O3GA 4CGGA 3NDKA 4FJ8A 4CEEA 3ZT3A 4CJSA 4KRFA 3O3HA 1WSFA 4KV8A 3QERA 4FW2A 4W5NA 2G8KA 4NCBA 3NCIA 1B9DA 4E7HA 4CEAA 4KTZA 4BWMA 4DTMA 3DLBA 3WNGA 1KSPA 2Z1JA 4F2SA 4OPJA 1O1WA 3LPTA 5SWMA 2XHBA 1ITGA 1UA1A 3PX6A 2E6LA 3K5MA 1D8YA 3SUQA 3OYFA 3HO1A 3ZT2A 3DOLA 1NJYA 4J2BA 3OYHA 4M42A 4I2QA 1J5OA 3AVIA 3HM9A 4J2AA 3V1RA 4CIEA 1WAFA 3DLKA 1ASVA 5KTQA 1QSYA 1RT5A 4FLVA 1QS4A 3VQQA 1NOZA 3OYMA 2W42A 1JKHA 3HPOA 1SKWA 2YKNA 4KTWA 1S1XA 4RW8A 1WSGA 4CGIA 3M8RA 5HP1A 4Z0UA 3VN5A 3LALA 4B9UA 4MQ3A 4B9SA 4DSIA 4FJ7A 3LP2A 2E4LA 4CJ4A 3SPZA 4AHRA 3C95A 2GBZA 1WN7A 2OA8A 2X78A 3VQ6A 4FJ9A 3KLHA 2QK9A 2IS3A 4N56A 1N5YA 1JLEA 1BL3A 1RDCA 3SZ2A 3I8DA 4M3TA 5I42A 1IO2A 1NK7A 1L3VA 4LH5A 1RILA 4DTSA 1JLAA 4I2PA 3VQ4A 3QIPA 4CJLA 1TAUA 3KJVA 4BDYA 3U6FA 2F8TA 3TAEA 4LSNA 4NCGA 3KLGA 1QSSA 2Z1GA 4OJRA 4N41A 3LP0A 4AHSA 4HCBA 4IG3A 1HNVA 3OYNA 4DS4A 1L5UA 4ZTJA 1A5WA 3MXJA 1RT6A 1U49A 3T19A 3LWLA 3ULDA 1W9HA 4LH4A 1SL1A 3MECA 1IG9A 4FJIA 5K14A 2GUIA 2OPSA 3NF6A 1GOBA 1RT2A 4EP4A 3D0PA 2XY7A 5J2PA 3OYBA 4CEQA 4FM0A 3DYAA 3TABA 3KD1E 4G1QA 3NH1A 4M3RA 3KK2A 2XY8A 3B6OA 3S3MA 5J2MA 5SZTA 3K58A 1HJRA 1VK0A 3M8SA 3KK1A 3P1GA 4IBNA 5C24A 4CK1A 3TAGA 1TK8A 1JLGA 3QINA 1QHTA 3CQ8A 2HHUA 3TAQA 1VSIA 2HNDA 1I39A 3RMBA 2YNHA 4DU4A 3ZSZA 3LZJA 3L2UA 1C0TA 3PY8A 1Q9XA 3S3NA 1Q8IA 1WAJA 1Y97A 1HYSA 4CJQA 3SQ1A 2IOCA 1A5XA 3DM2A 3DRRA 4CFCA 3HL8A 4GVMA 1RDBA 4CJUA 1RCHA 4CJ5A 4H4MA 3L3VA 1VSLA 1FKPA 1LWFA 2Z1IA 3SJJA 4CF2A 1SUQA 1RBRA 3ISNC 2BE2A 2QKBA 3V9XA 1MU2A 5KRSA 1NK8A 4DSKA 4C8OA 3G0ZA 1UOCA 1EETA 1X9WA 3MAQA 3V1QA 1U47A 3DI6A 5HRRA 4ELTA 4L8RB 3KLEA 4CJFA 4KPYA 1W0HA 4OKJA 4LSLA 3OYDA 3S9HA 3LP3A 1NJXA 3CM5A 2PYLA 4KI4A 2PZSA 1BISA 2WOMA 3NH2A 1TKZA 4KO0A 3TARA 3SUNA 3F9KA 4DFJA 3NFAA 4CECA 3UIQA 4FJXA 4E19A 1S9GA 2P5GA 4Z4CA 3HVTA 4CHYA 3F73A 2R7YA 4DTUA 3O4QA 4AH9A 5J2QA 4M3XA 2HHXA 4KHWA 4BE1A 4CJTA 4O44A 3CFPA 5KRTA 1R0AA 1JLQA 4BACA 3M8PA 4FCYA 3G10A 4FLZA 3QESA 2G8WA 3TWHA 1YTAA 1C6VA 1TKXA 3AVMA 4H8KA 4HUGA 4EZ6A 3TAPA 1RT4A 3OYIA 4KAZA 3LP1A 4FJLA 1LW2A 3NF9A 1ASWA 3AO5A 3THVA 4NCAA 5FDLA 1UA0A 4HHTA 2HVHA 2FBXA 4O4GA 4UQGA 3TAFA 3P5JA 3QEPA 3K5OA 4CGFA 4JS5A 1SV5A 4B08A 4M3ZA 1HMVA 3OY9A 4K8XA 4KHUA 3HJFA 3RRGA 1WNSA 4CGJA 2A1RA 3C6TA 1U45A 3B6PA 3KTQA 1ASUA 1KVAA 1RNHA 3L2RA 4ZTFA 2IC3A 1NK5A 1L3UA 2YNFA 4M45A 1FK9A 3C94A 4FLYA 2YHAA 1JL1A 1YVUA 1VRUA 4ID1A 3NAEA 1EXQA 1ZBFA 3S3OA 1KRPA 2RF2A 1C0UA 1TAQA 4N47A 2IGIA 4CJVA 3OYGA 3V4IA 3ZCMA 3IG1A 3SQ4A 4ZHRA 2HNZA 2O4IA 3VA3A 3TI0A 2QXFA 4DTXA 1J54A 3SQ2A 4DQPA 1JXBA 1S5JA 1Z25A 1LWCA 3ZT1A 3HSTB 4YNQA 4DSEA 1WSEA 4CJEA 2EX3A 4GW6A 3OYKA 3KK3A 1CZBA 3QLHA 2HHSA 1TKTA 5C42A 3OS2A 4Q5VA 3KKSA 1RT7A 2HHVA 5KI6A 4PUOA 2G8IA 4ID5A 1A5VA 5E41A 1JLBA 3QEIA 3DLEA 1BIUA 3CFRA 1TV6A 4CF0A 4KHSA 3AVKA 3SUPA 2KW4A 4FLWA 4CESA 4BDZA 3I0SA 5CYQA 1KVBA 3VQAA 3NE6A 5CZ2A 3V1OA 4M3UA 1XHXA 5J2NA 1EX4A 1NKBA 2D5RA 3QEWA 3AA2A 4DSJA 5DMRA 3AV9A 4CIGA 2I5JA 3MXMA 2B6AA 1GOCA 1S6PA 3CM6A 3EYZA 3NBPA 3IS9A 1BI4B 4DQQA 2DY4A 4DTJA 4K8ZA 2VWKA 2XRIA 2IDOA 3BGRA 3L3UA 3HT3A 3SCXA 4PQUA 5CZ1A 1F21A 2G8FA 3WNFA 5HBMA 4DFPA 2BGGA 2GV9A 2FBVA 2LSNA 3KLIA 2VG6A 3T1AA 2KTQA 4B9NA 3VQ7A 1DLOA 1C1AA 3NGIA 1HPZA 1RTIA 3MEEA 1BHLA 1TK5A 3I0RA 4DLGA 4DTOA 5FRMA 5JS1A 4FLTA 3HVRA 1YTUA 1KLMA 4CCHA 4CJKA 1IKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFD A;  4W5O A;  4CGH A;  4CED A;  4CK2 A;  3LAK A;  3ZSV A;  5FRO A;  3V9U A;  3MED A;  1K6Y A;  4PA1 A;  3U3G A;  4CJ3 A;  3K5N A;  1RTD A;  4FZX C;  3ZSW A;  5CY4 A;  1ZBL A;  1RDA A;  3TR8 A;  4DWI A;  4NYF A;  4C8N A;  4I9L A;  4DG1 A;  1RDD A;  2JLE A;  1CXU A;  2D0B A;  1REV A;  1C1B A;  4FZY A;  3QEX A;  2PY5 A;  4Z4G A;  1WLJ A;  4OKK A;  4FJH A;  1NJZ A;  1XI1 A;  3IRX A;  3AVC A;  3NGZ A;  4BE0 A;  1BI4 A;  3QIO A;  3L2V A;  2HW3 A;  4M41 A;  3ZSX A;  2G8V A;  4AHT A;  3RWU A;  1UAX A;  1BIZ A;  5HRN A;  3OYA A;  3DRS A;  3JYT A;  1CZ9 A;  2ZD1 A;  4FK4 A;  4FLX A;  4F8R A;  1S1W A;  4CHN A;  2YKM A;  4FJ5 A;  4IDK A;  3JSM A;  2P1J A;  1BQM A;  4B9T A;  1JLC A;  3QO9 A;  1KLN A;  2OYQ A;  4N5S A;  2OZM A;  5KGW A;  2Z1H A;  4RW6 A;  1L3T A;  1XWL A;  4FJM A;  4E1M A;  4FYD A;  1SKR A;  2D0C A;  3AO1 A;  2YHB A;  1TK0 A;  4HUF A;  1D9D A;  4DFM A;  4M3Y A;  3MEG A;  1NJW A;  3VQ8 A;  1IKX A;  3AA4 A;  4F3O A;  4IFY A;  3TAN A;  4FW1 A;  3CFO A;  3VQC A;  3EZ5 A;  4XIU A;  4BE2 A;  2KZM A;  2VG7 A;  4CJP A;  3OS0 A;  1Z26 A;  1X9S A;  3V9W A;  4R5P A;  1S9E A;  3VQD A;  3NHG A;  3PO4 A;  4ELU A;  2F8S A;  3SPY A;  4B3O A;  3L2Q A;  3AVH A;  4JRQ A;  3AA3 A;  4Z4F A;  2DFF A;  2ZQB A;  4FXD A;  1LAV A;  1B9F A;  1RBV A;  4CHZ A;  1B92 A;  1KFS A;  4CEB A;  2XO7 A;  1T8E A;  3DMJ A;  4C8L A;  1LWE A;  4KB1 A;  1VRT A;  4KRE A;  4CHO A;  1BCM A;  1ZBH A;  1SL2 A;  4BDP A;  1QQC A;  2XY6 A;  1WSI A;  4C8K A;  1S1V A;  3VA0 A;  1NOY A;  2A1S A;  3OS1 A;  4AHU A;  4DU3 A;  3LAN A;  3ZSR A;  3PX4 A;  3MXI A;  3LPU A;  2XY5 A;  3HXM A;  3HP9 A;  3V6D A;  4HCC A;  3PUF A;  4B8A B;  3OVN A;  4KFB A;  4Z4H A;  5HRP A;  5HLF A;  4CEO A;  4FJK A;  4FZZ A;  3VQ9 A;  3K2P A;  3EY1 A;  4EZ9 A;  3KD5 E;  4AIL C;  4B9V A;  2P51 A;  4CF8 A;  2VG5 A;  1Q9Y A;  4CGD A;  5FRN A;  4NYN A;  3OYJ A;  1IKW A;  3AO4 A;  3AVL A;  4B9L A;  4QOZ B;  4QCL A;  3AO3 A;  4RG8 A;  3ALY A;  4MFB A;  4Y1C A;  3O4N A;  3OJU A;  4IFV A;  3L2W A;  3OYC A;  2O4G A;  1S1T A;  4DFK A;  1LW0 A;  3FFI A;  1WSJ A;  3VQ5 A;  2YNG A;  1TKD A;  2P5O A;  4RW9 A;  3AVA A;  4CEZ A;  4B9M A;  1BQN A;  5EU7 A;  4DMN A;  5D3G A;  3LZI A;  4QAG A;  1T7P A;  1FKO A;  3K59 A;  4JS4 A;  2FBT A;  4W5R A;  3NH0 A;  2JGU A;  1IH7 A;  3PV8 A;  3OJS A;  3LDS A;  4CF9 A;  1RBU A;  1NKE A;  1KVC A;  3RR7 A;  3OYE A;  1NK6 A;  2RN2 A;  4JRP A;  3BDP A;  4OLA A;  3ZSO A;  3NGY A;  1XC9 A;  2OPQ A;  3NF8 A;  3V9Z A;  4FJG A;  1HQU A;  4DU1 A;  1ZYQ A;  1U48 A;  3AA5 X;  3LWM A;  1IKY A;  4CFB A;  3K57 A;  4EP5 A;  3L8B A;  4KHN A;  1TVR A;  1D9F A;  1DTQ A;  4KB0 A;  4KHQ A;  2QKK A;  4OLB A;  4PY5 A;  2ZE2 A;  2ETJ A;  1T03 A;  1CXQ A;  3K5L A;  5HRO A;  3RRH A;  4W5Q A;  4Z4I A;  1JXE A;  1RTJ A;  3VQE A;  4CJR A;  1EKE A;  4KHY A;  1HNI A;  2KFN A;  3SUO A;  2B5J A;  1ZBI A;  4DTN A;  2HHQ A;  3AO2 A;  4BWJ A;  2OZS A;  2KFZ A;  2VWJ A;  3SI6 A;  2DFH A;  4CHP A;  1HYZ A;  4E0D A;  3DRP A;  4DSL A;  4O5B A;  4YFU A;  3HYF A;  4FJJ A;  3H08 A;  3TAM A;  4FM2 A;  4CK3 A;  4LY7 A;  4E1N A;  1NK4 A;  1EP4 A;  3CYM A;  3U3Y A;  4DQI A;  4FK0 A;  2KQ2 A;  1SL0 A;  3AVF A;  5CYM A;  3VQB A;  2F96 A;  4KI6 A;  2HVI A;  4RW4 A;  1U04 A;  1UWB A;  3PO5 A;  2HHW A;  2YNI A;  4OKE A;  4M3W A;  3C6U A;  3WNH A;  4HVJ A;  1VSH A;  1X1P A;  1XHZ A;  3RMD A;  1KCF A;  3PX0 A;  1JLF A;  4O55 A;  1TL3 A;  1HQE A;  4FVM A;  4TSX A;  1VSM A;  1RT3 A;  3KKR A;  3QEV A;  3QNO A;  4CER A;  2ITG A;  4AHC A;  4DQS A;  2Y1I A;  1LAW A;  3WNE A;  3M8Q A;  4E3S A;  3V9S A;  3ASM A;  1DTT A;  1I3A A;  4DTP A;  3T3F A;  1YT3 A;  4FLU A;  4Q0B A;  4CE9 A;  3ZT0 A;  1RT1 A;  2RPI A;  1U4B A;  4LD0 A;  3O3F A;  1WSH A;  2OPR A;  3V81 A;  4IG0 A;  1J9A A;  3ZT4 A;  3QNN A;  5T7B A;  1QTM A;  1J53 A;  4FK2 A;  4OGE A;  3HPG A;  3HP6 A;  1RBS A;  1QE1 A;  3ITH A;  4CFA A;  4E7I A;  4J2D A;  3SV3 A;  2PYJ A;  1CLQ A;  1GOA A;  2BDP A;  5J1E A;  2RKI A;  3HPH A;  1NK9 A;  3AVG A;  1HYV A;  1S6Q A;  3ZSY A;  4AHV A;  1NK0 A;  4DQR A;  3P83 D;  3CG7 A;  2DFE A;  5C25 A;  3OYL A;  4HUE A;  4DLE A;  3SV4 A;  4E7L A;  3HK2 A;  4Z4E A;  4DF4 A;  2OPP A;  2HNY A;  2X6S A;  4B8C A;  4J2E A;  4JLH A;  1N6Q A;  1RBT A;  3E01 A;  1VSD A;  3ZSQ A;  3IAY A;  3AVJ A;  4KKO A;  4DTR A;  2YV0 X;  4CF1 A;  3D45 A;  3KIO A;  3SNN A;  2G8U A;  4CJW A;  2WON A;  4DF8 A;  3NF7 A;  3KLF A;  4ELV A;  3RMA A;  2DTU A;  2EHG A;  1HRH A;  4GMJ B;  2BAN A;  3RR8 A;  1FXX A;  2X74 A;  1SKS A;  4F3T A;  2B4J A;  3A2F A;  4C8M A;  1ZBU A;  3RMC A;  2HHT A;  1BCO A;  2E6M A;  2FBY A;  4O0J A;  4OPK A;  1T05 A;  1QSL A;  4H4O A;  1BGX T;  4E89 A;  3SYZ A;  2Q3S A;  3DLG A;  4OVL A;  4E7K A;  1NKC A;  5HRS A;  2AJQ A;  1KTQ A;  1L3S A;  4I9Q A;  1VSE A;  2D0A A;  2HMI A;  4F4K A;  2FC0 A;  3QET A;  1G15 A;  1LV5 A;  5KGX A;  2HB5 A;  3DLR A;  4Y1D A;  3VQP A;  1TGO A;  5DK5 A;  4CIF A;  2NUB A;  4RW7 A;  4FM1 A;  3DLH A;  2KZZ A;  3AVB A;  1JL2 A;  4HTU A;  4PWD A;  1VSF A;  3SQ0 A;  4DSF A;  4KTQ A;  1C0M A;  1VSK A;  5JS2 A;  4CFD A;  2Y1J A;  2IAJ A;  4FJN A;  4I7F A;  4ICL A;  4F2R A;  4E7J A;  4DS5 A;  2G8H A;  5I3U A;  1S1U A;  1C1C A;  3DOK A;  4N76 A;  2X6N A;  3AVN A;  1D5A A;  4OGC A;  4O0I A;  4W5T A;  3LAM A;  4WE1 A;  3RTV A;  1X9M A;  4IKF A;  1RTH A;  4CHQ A;  2ATQ A;  4CEF A;  1TL1 A;  1VSJ A;  3O3G A;  4CGG A;  3NDK A;  4FJ8 A;  4CEE A;  3ZT3 A;  4CJS A;  4KRF A;  3O3H A;  1WSF A;  4KV8 A;  3QER A;  4FW2 A;  4W5N A;  2G8K A;  4NCB A;  3NCI A;  1B9D A;  4E7H A;  4CEA A;  4KTZ A;  4BWM A;  4DTM A;  3DLB A;  3WNG A;  1KSP A;  2Z1J A;  4F2S A;  4OPJ A;  1O1W A;  3LPT A;  5SWM A;  2XHB A;  1ITG A;  1UA1 A;  3PX6 A;  2E6L A;  3K5M A;  1D8Y A;  3SUQ A;  3OYF A;  3HO1 A;  3ZT2 A;  3DOL A;  1NJY A;  4J2B A;  3OYH A;  4M42 A;  4I2Q A;  1J5O A;  3AVI A;  3HM9 A;  4J2A A;  3V1R A;  4CIE A;  1WAF A;  3DLK A;  1ASV A;  5KTQ A;  1QSY A;  1RT5 A;  4FLV A;  1QS4 A;  3VQQ A;  1NOZ A;  3OYM A;  2W42 A;  1JKH A;  3HPO A;  1SKW A;  2YKN A;  4KTW A;  1S1X A;  4RW8 A;  1WSG A;  4CGI A;  3M8R A;  5HP1 A;  4Z0U A;  3VN5 A;  3LAL A;  4B9U A;  4MQ3 A;  4B9S A;  4DSI A;  4FJ7 A;  3LP2 A;  2E4L A;  4CJ4 A;  3SPZ A;  4AHR A;  3C95 A;  2GBZ A;  1WN7 A;  2OA8 A;  2X78 A;  3VQ6 A;  4FJ9 A;  3KLH A;  2QK9 A;  2IS3 A;  4N56 A;  1N5Y A;  1JLE A;  1BL3 A;  1RDC A;  3SZ2 A;  3I8D A;  4M3T A;  5I42 A;  1IO2 A;  1NK7 A;  1L3V A;  4LH5 A;  1RIL A;  4DTS A;  1JLA A;  4I2P A;  3VQ4 A;  3QIP A;  4CJL A;  1TAU A;  3KJV A;  4BDY A;  3U6F A;  2F8T A;  3TAE A;  4LSN A;  4NCG A;  3KLG A;  1QSS A;  2Z1G A;  4OJR A;  4N41 A;  3LP0 A;  4AHS A;  4HCB A;  4IG3 A;  1HNV A;  3OYN A;  4DS4 A;  1L5U A;  4ZTJ A;  1A5W A;  3MXJ A;  1RT6 A;  1U49 A;  3T19 A;  3LWL A;  3ULD A;  1W9H A;  4LH4 A;  1SL1 A;  3MEC A;  1IG9 A;  4FJI A;  5K14 A;  2GUI A;  2OPS A;  3NF6 A;  1GOB A;  1RT2 A;  4EP4 A;  3D0P A;  2XY7 A;  5J2P A;  3OYB A;  4CEQ A;  4FM0 A;  3DYA A;  3TAB A;  3KD1 E;  4G1Q A;  3NH1 A;  4M3R A;  3KK2 A;  2XY8 A;  3B6O A;  3S3M A;  5J2M A;  5SZT A;  3K58 A;  1HJR A;  1VK0 A;  3M8S A;  3KK1 A;  3P1G A;  4IBN A;  5C24 A;  4CK1 A;  3TAG A;  1TK8 A;  1JLG A;  3QIN A;  1QHT A;  3CQ8 A;  2HHU A;  3TAQ A;  1VSI A;  2HND A;  1I39 A;  3RMB A;  2YNH A;  4DU4 A;  3ZSZ A;  3LZJ A;  3L2U A;  1C0T A;  3PY8 A;  1Q9X A;  3S3N A;  1Q8I A;  1WAJ A;  1Y97 A;  1HYS A;  4CJQ A;  3SQ1 A;  2IOC A;  1A5X A;  3DM2 A;  3DRR A;  4CFC A;  3HL8 A;  4GVM A;  1RDB A;  4CJU A;  1RCH A;  4CJ5 A;  4H4M A;  3L3V A;  1VSL A;  1FKP A;  1LWF A;  2Z1I A;  3SJJ A;  4CF2 A;  1SUQ A;  1RBR A;  3ISN C;  2BE2 A;  2QKB A;  3V9X A;  1MU2 A;  5KRS A;  1NK8 A;  4DSK A;  4C8O A;  3G0Z A;  1UOC A;  1EET A;  1X9W A;  3MAQ A;  3V1Q A;  1U47 A;  3DI6 A;  5HRR A;  4ELT A;  4L8R B;  3KLE A;  4CJF A;  4KPY A;  1W0H A;  4OKJ A;  4LSL A;  3OYD A;  3S9H A;  3LP3 A;  1NJX A;  3CM5 A;  2PYL A;  4KI4 A;  2PZS A;  1BIS A;  2WOM A;  3NH2 A;  1TKZ A;  4KO0 A;  3TAR A;  3SUN A;  3F9K A;  4DFJ A;  3NFA A;  4CEC A;  3UIQ A;  4FJX A;  4E19 A;  1S9G A;  2P5G A;  4Z4C A;  3HVT A;  4CHY A;  3F73 A;  2R7Y A;  4DTU A;  3O4Q A;  4AH9 A;  5J2Q A;  4M3X A;  2HHX A;  4KHW A;  4BE1 A;  4CJT A;  4O44 A;  3CFP A;  5KRT A;  1R0A A;  1JLQ A;  4BAC A;  3M8P A;  4FCY A;  3G10 A;  4FLZ A;  3QES A;  2G8W A;  3TWH A;  1YTA A;  1C6V A;  1TKX A;  3AVM A;  4H8K A;  4HUG A;  4EZ6 A;  3TAP A;  1RT4 A;  3OYI A;  4KAZ A;  3LP1 A;  4FJL A;  1LW2 A;  3NF9 A;  1ASW A;  3AO5 A;  3THV A;  4NCA A;  5FDL A;  1UA0 A;  4HHT A;  2HVH A;  2FBX A;  4O4G A;  4UQG A;  3TAF A;  3P5J A;  3QEP A;  3K5O A;  4CGF A;  4JS5 A;  1SV5 A;  4B08 A;  4M3Z A;  1HMV A;  3OY9 A;  4K8X A;  4KHU A;  3HJF A;  3RRG A;  1WNS A;  4CGJ A;  2A1R A;  3C6T A;  1U45 A;  3B6P A;  3KTQ A;  1ASU A;  1KVA A;  1RNH A;  3L2R A;  4ZTF A;  2IC3 A;  1NK5 A;  1L3U A;  2YNF A;  4M45 A;  1FK9 A;  3C94 A;  4FLY A;  2YHA A;  1JL1 A;  1YVU A;  1VRU A;  4ID1 A;  3NAE A;  1EXQ A;  1ZBF A;  3S3O A;  1KRP A;  2RF2 A;  1C0U A;  1TAQ A;  4N47 A;  2IGI A;  4CJV A;  3OYG A;  3V4I A;  3ZCM A;  3IG1 A;  3SQ4 A;  4ZHR A;  2HNZ A;  2O4I A;  3VA3 A;  3TI0 A;  2QXF A;  4DTX A;  1J54 A;  3SQ2 A;  4DQP A;  1JXB A;  1S5J A;  1Z25 A;  1LWC A;  3ZT1 A;  3HST B;  4YNQ A;  4DSE A;  1WSE A;  4CJE A;  2EX3 A;  4GW6 A;  3OYK A;  3KK3 A;  1CZB A;  3QLH A;  2HHS A;  1TKT A;  5C42 A;  3OS2 A;  4Q5V A;  3KKS A;  1RT7 A;  2HHV A;  5KI6 A;  4PUO A;  2G8I A;  4ID5 A;  1A5V A;  5E41 A;  1JLB A;  3QEI A;  3DLE A;  1BIU A;  3CFR A;  1TV6 A;  4CF0 A;  4KHS A;  3AVK A;  3SUP A;  2KW4 A;  4FLW A;  4CES A;  4BDZ A;  3I0S A;  5CYQ A;  1KVB A;  3VQA A;  3NE6 A;  5CZ2 A;  3V1O A;  4M3U A;  1XHX A;  5J2N A;  1EX4 A;  1NKB A;  2D5R A;  3QEW A;  3AA2 A;  4DSJ A;  5DMR A;  3AV9 A;  4CIG A;  2I5J A;  3MXM A;  2B6A A;  1GOC A;  1S6P A;  3CM6 A;  3EYZ A;  3NBP A;  3IS9 A;  1BI4 B;  4DQQ A;  2DY4 A;  4DTJ A;  4K8Z A;  2VWK A;  2XRI A;  2IDO A;  3BGR A;  3L3U A;  3HT3 A;  3SCX A;  4PQU A;  5CZ1 A;  1F21 A;  2G8F A;  3WNF A;  5HBM A;  4DFP A;  2BGG A;  2GV9 A;  2FBV A;  2LSN A;  3KLI A;  2VG6 A;  3T1A A;  2KTQ A;  4B9N A;  3VQ7 A;  1DLO A;  1C1A A;  3NGI A;  1HPZ A;  1RTI A;  3MEE A;  1BHL A;  1TK5 A;  3I0R A;  4DLG A;  4DTO A;  5FRM A;  5JS1 A;  4FLT A;  3HVR A;  1YTU A;  1KLM A;  4CCH A;  4CJK A;  1IKV A; 
#chains in the Genus database with same CATH topology
 1KFD A;  4CGH A;  2OAN A;  4FSV A;  3V9U A;  1K6Y A;  2E20 A;  4DR5 K;  3HZ6 A;  5H1S Q;  4DWI A;  3O9S A;  1N8R O;  2JLE A;  1CXU A;  3UKR B;  2PY5 A;  1NJZ A;  5ADX A;  3AVC A;  4BE0 A;  4BR2 A;  3RWU A;  4PKI A;  1YJ9 N;  1UAX A;  5HRN A;  2YKM A;  4LF6 K;  3C0B A;  3DXK B;  3KVG A;  5JVG L;  4IDK A;  3JSM A;  4NXN K;  1BQM A;  3BEX A;  1KLN A;  3QO9 A;  2OYQ A;  1HJO A;  5KGW A;  4E1M A;  5BRD A;  3O5B A;  2YHB A;  4HUF A;  3QFP A;  4IDH A;  1VQP N;  5BPN A;  4DFM A;  1N36 K;  4F3O A;  1RGI A;  2FSK A;  1OVY A;  4BRC A;  1Z26 A;  1X9S A;  4ELU A;  3SPY A;  4B3O A;  3L2Q A;  4Z4F A;  2DFF A;  4HTL A;  1LAV A;  1RBV A;  3GBT A;  4CEB A;  3DMJ A;  1LWE A;  1YUW A;  4CHO A;  5AQN A;  1ZBH A;  4YOU A;  4X66 K;  5EY4 A;  2HST A;  3LAN A;  3PX4 A;  2KHO A;  1NMD A;  2XY5 A;  3HXM A;  4OPA A;  2YJE A;  3M3Z A;  3EY1 A;  4EZ9 A;  2PBD A;  1S3X A;  1IJJ A;  4CJ7 A;  4B9V A;  5MLC Q;  3OYJ A;  3AO4 A;  2O8D B;  1LW0 A;  5KQD A;  1TKD A;  1VHX A;  2BUP A;  3T1H K;  5D3G A;  3LZI A;  4QAG A;  3SMP A;  1FKO A;  1T7P A;  3NH0 A;  2JGU A;  2VGN A;  1NKE A;  4YOR A;  3OYE A;  3BDP A;  4JRP A;  5EVZ A;  3VEZ A;  3H6E A;  3C65 A;  2HF3 A;  4KHN A;  1M1K O;  4BRG A;  2QKK A;  4DR2 K;  2CGJ A;  2ZE2 A;  2UUB K;  5BR8 K;  4H5T A;  1RFQ A;  5GIO A;  4PKH A;  1ZBS A;  4MLH A;  2HHQ A;  4ILG B;  2O8D A;  4BWJ A;  3SI6 A;  2DFH A;  4MDA A;  4E0D A;  4FOE A;  4DSL A;  3HYF A;  4LY7 A;  3O80 A;  1NK4 A;  3MCA B;  1EP4 A;  3VQB A;  4KI6 A;  2HVI A;  2V7Y A;  3CCQ N;  1BDG A;  1KCF A;  4FVM A;  3KKR A;  3QNO A;  1MDU B;  4DQS A;  2ASM A;  1LAW A;  3M8Q A;  4K25 A;  1J5E K;  1I3A A;  4JK8 A;  4Q0B A;  3G71 N;  3ZT0 A;  3CF5 L;  1RT1 A;  3CJ7 A;  4EHU A;  4OX9 K;  4BR7 A;  1NGF A;  4LD0 A;  4X62 K;  2OPR A;  3V81 A;  3ZT4 A;  4BC2 A;  5CE3 A;  4FK2 A;  3BF3 A;  3HPG A;  3HP6 A;  3ITH A;  4XH4 A;  4J2D A;  2PYJ A;  2BDP A;  2RKI A;  3HPH A;  4BRP A;  3SAH A;  3CCE N;  3OYL A;  3SV4 A;  3H45 C;  1VQ7 N;  3I56 N;  2KKZ A;  3A5N C;  3IUC A;  3CJ9 A;  3ZSQ A;  3AVJ A;  2F9T A;  4H0O A;  4JK9 A;  5GAH P;  4YOV A;  5AFU A;  3NF7 A;  4O8U A;  3KLF A;  2OTL N;  2DTU A;  3MN7 A;  3O9Q A;  3KK7 A;  4GMJ B;  3EO3 A;  1K8A O;  1T05 A;  2FBY A;  5FPN A;  4H4O A;  4E89 A;  3SYZ A;  2Q3S A;  1NKC A;  1W7A A;  1VSE A;  3L0Q A;  4F4K A;  2WBN A;  4YOY A;  3LDN A;  4B3T K;  2P9L B;  2YHW A;  3QB0 A;  4Y1D A;  3VQP A;  1TGO A;  3DLH A;  4PL8 A;  2KZZ A;  4HTU A;  4PWD A;  2W41 A;  4FJN A;  2IAJ A;  4ICL A;  1VQ6 N;  4DS5 A;  2G8H A;  3JAM O;  3GE1 A;  1C1C A;  4H03 B;  4OGC A;  3E9P A;  4WCE L;  5HL7 L;  4YY3 K;  4GKK K;  3VGK A;  5B8H A;  3O3G A;  2J4R A;  4H0T B;  3OW2 M;  1I94 K;  4CEE A;  4KRF A;  5DM7 L;  4KV8 A;  4FW2 A;  1QVF M;  3NCI A;  4E7H A;  2FF6 A;  4F2S A;  3LPT A;  5SWM A;  3PX6 A;  1D8Y A;  3OYF A;  2P9L A;  1NJY A;  4J2B A;  5JLF A;  4IO8 A;  4JI1 K;  4CIE A;  1WAF A;  3VQQ A;  1Z6R A;  3OYM A;  2YKN A;  4KTW A;  4RW8 A;  5AQS A;  4B9S A;  2HHH K;  1QVG M;  3SPZ A;  2E4L A;  3OBY A;  4CJ4 A;  3U4L A;  4GY2 B;  3H3O B;  2HF4 A;  4FJ9 A;  1GLD G;  2QK9 A;  2F7T A;  1BL3 A;  4M3T A;  5I42 A;  1IO2 A;  5AQY A;  1NK7 A;  1BOT O;  2OCE A;  3QIP A;  2AP1 A;  1ATS A;  1DEJ A;  4NCG A;  2O8E B;  2QWM A;  2PFU A;  3LP0 A;  3VEO A;  4HCB A;  1HNV A;  1L5U A;  3TTC A;  4BC5 A;  2QWL A;  4JI7 K;  3N4P A;  1U49 A;  3TSU A;  3ULD A;  2OPS A;  2E5L K;  3D0P A;  3S41 A;  5J2P A;  4WQ4 A;  4JKH A;  3DYA A;  3KD1 E;  3KK2 A;  2AA4 A;  1SQK A;  5AJ3 K;  5SZT A;  3M8S A;  3KK1 A;  4IBN A;  4CK1 A;  1VQL N;  1VSI A;  3R6M A;  4DU4 A;  3L2U A;  3IKM A;  4JI0 K;  4IOC L;  1IBM K;  2O8E A;  2IOC A;  4GVM A;  1BO5 O;  2QWR A;  3VEY A;  4CJU A;  1FKP A;  4CI6 A;  2Q0U A;  1SUQ A;  2BE2 A;  5KRS A;  3FZH A;  4DSK A;  3BZC A;  3HM8 A;  3ULE B;  1X9W A;  2QWQ A;  4AF1 A;  3WUH A;  3WXJ A;  3BUZ B;  4ELT A;  4CJF A;  1W0H A;  4OKJ A;  4WQ4 C;  2ZJP L;  3S9H A;  3LP3 A;  4KI4 A;  3TAR A;  3EE8 A;  4CEC A;  2A3Z A;  3UIQ A;  5AQT A;  1S9G A;  4FWR A;  3HVT A;  4A62 A;  5M1N A;  4M3X A;  2HHX A;  4BE1 A;  4H0V B;  3ZLJ A;  2G8W A;  4FCY A;  3G10 A;  4HUG A;  1YAG A;  3TAP A;  3OYI A;  4KAZ A;  3M5R A;  4FJL A;  1LW2 A;  4FPB A;  4B1Y B;  4YDU A;  4HHT A;  3P5J A;  3C6H A;  4CGF A;  1SV5 A;  4NLB A;  2ZJQ L;  2NRR A;  2UXB K;  2A1R A;  1U45 A;  1WBB A;  2WTU A;  3P38 A;  4DQ8 A;  3L2R A;  3TSQ A;  2IC3 A;  5AQL A;  4U7B A;  4M45 A;  3C94 A;  4FLY A;  2YHA A;  1JL1 A;  1YVU A;  1VRU A;  3NAE A;  1Q18 A;  1C0U A;  1TAQ A;  2D0P A;  5AZI B;  4FWO A;  4CVN E;  2FLO A;  3EKS A;  5ADX H;  2O4I A;  4JHD B;  1OKJ A;  3H3N O;  1S5J A;  1LWC A;  3O6W A;  5C15 A;  4YNQ A;  4CJE A;  3KK3 A;  1Y64 A;  3CJB A;  1CZB A;  3KHY A;  5AQX A;  1TKT A;  3CD6 N;  4Q5V A;  3L4I A;  3J7Z O;  2YI1 A;  4NXM K;  4PUO A;  2G8I A;  4ID5 A;  5E41 A;  3QEI A;  1JLB A;  1Z05 A;  3CFR A;  1TV6 A;  3DLL L;  1KXP A;  4DV2 K;  3SUP A;  2KW4 A;  5LJV A;  1KVB A;  4M3U A;  1EX4 A;  3AA2 A;  5DMR A;  5JMV A;  4M7Y A;  3CET A;  3LDQ A;  1IG8 A;  4FWS A;  5AZI A;  2NZT A;  2VQF K;  4JHD A;  4K8Z A;  2GEM A;  3SCX A;  4PQU A;  4Y0W A;  3D2E B;  2G8F A;  1F21 A;  3WNF A;  2V52 B;  2IVP A;  4XH1 A;  5C12 A;  3NGI A;  4JAX A;  1BHL A;  4DCH A;  4DTO A;  4L3Q A;  2A40 A;  3WEE B;  1KLM A;  4CCH A;  2GX9 A;  1GLE G;  4CED A;  5FRO A;  4FZX C;  1VQ5 N;  1JCF A;  3K5N A;  1RTD A;  3O8M A;  5AQV A;  4BRA A;  5CY4 A;  1ZBL A;  3TR8 A;  4PL7 A;  4OKK A;  3N4Q A;  3IRX A;  3L2V A;  5KPZ A;  2QWP A;  5TKY A;  3VOV A;  3ZSX A;  2G8V A;  2HW3 A;  1BA1 A;  2PAV A;  3D2E A;  1CZ9 A;  1R59 O;  4JK7 A;  4LFA K;  2OZM A;  3WEE A;  1XWL A;  3IDH A;  2BH1 A;  3C6A A;  3CCR N;  5E84 A;  5F0X A;  1SKR A;  3AO1 A;  1NMN A;  1XMQ K;  4M3Y A;  4DV4 K;  3MEG A;  3VQ8 A;  3TAN A;  3EZ5 A;  4XIU A;  1H1V A;  3AY9 A;  1KQS M;  2VG7 A;  2VYP A;  1ZC6 A;  3OS0 A;  3PO4 A;  3VQD A;  3NHG A;  2F8S A;  3FZF A;  3O08 A;  1ESV A;  4DR6 K;  3AA3 A;  2ZQB A;  4FWM A;  2ZWH A;  4CHZ A;  1B92 A;  2XO7 A;  1T8E A;  2XY6 A;  3HOT A;  1S1V A;  4BRQ A;  3OS1 A;  4AHU A;  5IWA K;  3WXK A;  3E66 A;  1GLF O;  3PUF A;  4Z4H A;  5HRP A;  4H5N A;  3VQ9 A;  4AIL C;  1DT9 A;  2NRX A;  1VQ8 N;  4LF9 K;  5FRN A;  4NYN A;  3RVC A;  4QOZ B;  3AO3 A;  4RG8 A;  3ALY A;  3A0I X;  4MFB A;  4Y1C A;  3OJU A;  4LF4 K;  3CI5 A;  1EO1 A;  4IFV A;  3L2W A;  1EQY A;  2O4G A;  1ATR A;  1WSJ A;  3VQ5 A;  2YNG A;  3L4Q A;  3AVA A;  1BQN A;  1VAZ A;  4DMN A;  5AQI A;  3OTO K;  3VTH A;  4W5R A;  1RBU A;  4FWL A;  4A61 A;  1HNW K;  4OLA A;  1XC9 A;  3NF8 A;  3V9Z A;  4X65 K;  1ZYQ A;  2A41 A;  3E9O A;  3LWM A;  4EP5 A;  1Q82 O;  4KB0 A;  2P9U A;  1HLU A;  4OLB A;  1CXQ A;  5HRO A;  2VWB A;  2KFN A;  1NGI A;  4JKB A;  3SUO A;  2B5J A;  4DTN A;  3Q7B A;  2VWJ A;  4O5B A;  4YFU A;  3H08 A;  1G99 A;  4FM2 A;  1SS6 A;  4JKD A;  4E1N A;  5GIN A;  3CYM A;  1MWK A;  2KQ2 A;  2F96 A;  3O9R A;  4RW4 A;  2HHW A;  4DUY K;  2YNI A;  4OKE A;  4M3W A;  3VF6 A;  3WNH A;  4HVJ A;  1GLJ O;  3I8B A;  1JLF A;  3J7A P;  1TL3 A;  4TSX A;  5F2R A;  3VF2 A;  3B8A X;  5E26 A;  2Y1I A;  2D0O A;  4E3S A;  3G4S N;  3V9S A;  4G9Z A;  3ASM A;  4EAH D;  4DTP A;  4FLU A;  4CE9 A;  2DPN A;  1N34 K;  1U4B A;  4H0P A;  2D1K A;  3OHR A;  1QTM A;  1J53 A;  1X9J A;  2UYT A;  3ZX3 A;  4DV0 K;  4CFA A;  3SV3 A;  2WUS A;  1NGH A;  5J1E A;  1NK9 A;  3AVG A;  4JD2 A;  1S6Q A;  2HBJ A;  3ZSY A;  2DFE A;  4DLE A;  4JI5 K;  4DF4 A;  2OPP A;  2X6S A;  2O8F A;  3IAY A;  4KKO A;  2VCP A;  4CF1 A;  3KIO A;  2G8U A;  1IBL K;  4ELV A;  4M63 C;  3R9P A;  4CD1 A;  2W40 A;  2KLA A;  4HWI A;  3RMC A;  1ZBU A;  2HHT A;  2Q0R A;  2E6M A;  3CPW M;  1BGX T;  3EKU A;  4BQZ A;  5HRS A;  1KTQ A;  3CCM N;  4I9Q A;  2D0A A;  3FZK A;  1G15 A;  1LV5 A;  2NUB A;  3ENO A;  1VSK A;  4CFD A;  2Y1J A;  4I7F A;  5EX5 A;  4N76 A;  5I3U A;  2P9S B;  4PHT X;  3O1B A;  3E1Y A;  4IKF A;  1RTH A;  5AQK A;  1VSJ A;  2VQE K;  4H5W A;  3NDK A;  4FJ8 A;  3ZT3 A;  4WQ5 A;  1YF5 L;  5GAD P;  4CBW A;  4W5N A;  2G8K A;  4NCB A;  1B9D A;  4KTZ A;  4BWM A;  3VGL A;  4XH5 A;  2ZM6 K;  1KSP A;  2Z1J A;  3DLB A;  4GV6 A;  5IT9 O;  2XHB A;  3UB5 A;  2E6L A;  2YX6 A;  3HO1 A;  3I55 N;  4KH4 A;  2YCH A;  4I2Q A;  3OYH A;  3AVI A;  3QBX A;  4DKW A;  1RT5 A;  4FLV A;  1NOZ A;  3QML A;  2W42 A;  3HPO A;  4MO5 A;  4XEI A;  4BR0 A;  1WSG A;  2P9K B;  4FJ7 A;  2P9S A;  3DWL A;  4AHR A;  3C95 A;  2GBZ A;  4A5B A;  4BVP A;  3KLH A;  3D6R A;  4GV3 A;  1RDC A;  3ATV A;  3K9J A;  1L3V A;  4DTS A;  3LDL A;  4CJL A;  3TAE A;  4CZJ A;  4WQ5 C;  3WXI A;  5BRH A;  2ZF5 O;  1QZ5 A;  4AHS A;  3DAW A;  4IEE A;  4IG3 A;  4BRM A;  3F2K A;  3MXJ A;  2P9I A;  4OO1 J;  1SL1 A;  2GUI A;  4FO0 A;  2XY7 A;  2P9K A;  5AQF A;  4JI8 K;  2XY8 A;  3B6O A;  3S3M A;  5J2M A;  1HJR A;  3FE1 A;  1JLG A;  1QHT A;  2JWK A;  1SZ2 A;  2A42 A;  2HND A;  3J8A A;  4K43 A;  1I39 A;  4IOA L;  3RMB A;  3ZSZ A;  3LZJ A;  1WAJ A;  4KH5 A;  1V4S A;  5C2F A;  1HYS A;  1A5X A;  4CZK A;  3PLA A;  4H4M A;  5EOY A;  1LWF A;  2Z1I A;  3A5O C;  1RBR A;  3ISN C;  2QKB A;  4BC3 A;  3V9X A;  1MU2 A;  3CMA N;  4UY8 O;  4C8O A;  3G0Z A;  3FGU A;  1EET A;  3FZL A;  4CZG A;  3U9D A;  3EEQ A;  4L8R B;  3T1Y K;  3KLE A;  5M1Q A;  4KPY A;  4DUZ K;  3OYD A;  4LSL A;  4DV1 K;  2PZS A;  1TKZ A;  2P9N B;  3QIC A;  3SJH A;  3MX5 A;  4DFJ A;  2IIR A;  3NFA A;  3SBG A;  3SUN A;  4E19 A;  4Z4C A;  3F73 A;  2R7Y A;  5J2Q A;  3FFK B;  4KHW A;  1HPM A;  4CJT A;  4O44 A;  5KRT A;  3M8P A;  4FLZ A;  3EL2 A;  3ID6 A;  3TWH A;  1YTA A;  1TKX A;  4H8K A;  1JJ2 M;  4BR5 A;  5AZJ B;  3LL3 A;  3LP1 A;  3RSE B;  4ILH A;  4KBO A;  4NCA A;  3SK3 A;  2FSN A;  3QEP A;  3K5O A;  2P9N A;  4H0Y B;  3OY9 A;  2QTD A;  4ISG A;  4K8X A;  4KHU A;  3RRG A;  1WNS A;  5FLX O;  3C6T A;  2P9P B;  1ASU A;  1KVA A;  1K8K B;  4DR3 K;  4B3M K;  4RCH A;  3S3O A;  1KRP A;  4B1V A;  3H1Q A;  2IGI A;  4CJV A;  3ZCM A;  5AQZ A;  3TI0 A;  2WFB A;  3SQ2 A;  5AZJ A;  1WB9 A;  1Z25 A;  3ZT1 A;  2UUC K;  4JNE A;  1MWM A;  3HST B;  3RSE A;  3OYK A;  2Q36 A;  3QLH A;  5C42 A;  4X64 K;  2W6L A;  2HHV A;  5KI6 A;  4V19 S;  1A5V A;  3VEX A;  5BPM A;  3DLE A;  1NGA A;  3GDQ A;  1X3N A;  3UKU A;  3ZET B;  3NMU A;  1NGE A;  4FLW A;  3EZW A;  3UE5 A;  2P9P A;  3PIO L;  5CYQ A;  1K8K A;  5J2N A;  1NKB A;  2D5R A;  4DSJ A;  3CQX A;  4YOT A;  3CPE A;  4H0X B;  1GOC A;  1S6P A;  4JKA A;  3IS9 A;  4DTJ A;  3VEN A;  2QWO A;  3BGR A;  3MX2 A;  4DFP A;  1NGB A;  2LSN A;  3T1A A;  3OA9 A;  1C1A A;  1RTI A;  1TK5 A;  3ZX0 A;  3I0R A;  5JS1 A;  4ILJ A;  4FLT A;  1P90 A;  1YTU A;  4HCC A;  4BVO A;  4CJK A;  1IKV A;  4W5O A;  3ZSV A;  3ZX2 A;  4PA1 A;  3U3G A;  3ZET A;  4JI3 K;  4MDB A;  3ZSW A;  4FVU A;  3TTF A;  4I9L A;  1QQN A;  2D0B A;  3THY B;  1REV A;  4Z4G A;  1E3M A;  3R8E A;  3HTV A;  4C23 A;  5F1X A;  1X3M A;  3MN5 A;  4FL9 A;  3W0L A;  1BIZ A;  3JYT A;  3DRS A;  2QI2 A;  4F8R A;  1S1W A;  4FJ5 A;  4B3S K;  2UU9 K;  1XUP O;  5C10 A;  4B9T A;  3KZB A;  1JLC A;  4GV9 A;  4FJM A;  2D0C A;  1K73 O;  3ZEU B;  5LL6 Z;  1IKX A;  3MMV A;  4FW1 A;  3CFO A;  4WFN L;  3THY A;  3ENB A;  5BN8 A;  1NGJ A;  4BE2 A;  2KZM A;  4BG9 A;  4CJP A;  4R5P A;  3MN9 A;  3SAF A;  3HI0 A;  2CH6 A;  3AVH A;  4FXD A;  4DV7 K;  3I33 A;  1KFS A;  4C8L A;  1KAY A;  1VRT A;  1BCM A;  4BDP A;  3VES A;  4R79 A;  1OH7 A;  1OH8 A;  2A5X A;  3BZK A;  3U9Z A;  4DU3 A;  3ZSR A;  3MXI A;  1KAZ A;  3ZEU A;  4B8A B;  4YOX A;  5HLF A;  2IVN A;  2BTF A;  3MWP A;  3K2P A;  2RHK A;  4IO9 L;  2P51 A;  2VG5 A;  1Q9Y A;  1VQN N;  4CGD A;  1IKW A;  4B9L A;  2FSJ A;  3OYC A;  3FFI A;  3WQU A;  3VEV A;  3CCJ N;  1O13 A;  2HBM A;  1NU0 A;  4B9M A;  4JS4 A;  2FBT A;  1IH7 A;  3OJS A;  4CF9 A;  3ZSO A;  3NGY A;  4FJG A;  5BRF A;  2QM1 A;  1U48 A;  3AA5 X;  4JEP A;  1IKY A;  3K57 A;  1K9M O;  1Q81 O;  2W6K A;  5AQM A;  2ETJ A;  1T03 A;  4Z4I A;  3RRH A;  4W5Q A;  3VMF B;  1JXE A;  1RTJ A;  3J80 O;  3VQE A;  3CME N;  1NM1 A;  4KHY A;  1ZBI A;  1BG3 A;  4BQL A;  2KFZ A;  2OZS A;  3R3L A;  4CHP A;  1HYZ A;  3DRP A;  3D2F A;  4FJJ A;  4K41 A;  4M7X A;  3TAM A;  4WFB L;  4CK3 A;  1WBD A;  3U3Y A;  1SL0 A;  3G6E N;  1XNQ K;  3THX B;  4GKJ K;  2OTJ N;  2NRW A;  3D7E O;  4LFC K;  3C6U A;  4MLE A;  4LFB K;  3RMD A;  3PX0 A;  1HQE A;  4EHT A;  1VSM A;  1RT3 A;  4CER A;  4AHC A;  2E2O A;  3WNE A;  3BF1 A;  1DTT A;  3BP8 A;  4BGB A;  3T3F A;  1YT3 A;  1BWF O;  5CR4 A;  4BRO A;  2RPI A;  4WYB A;  3ID8 A;  1WSH A;  3QNN A;  2FXU A;  3M6G A;  4JI6 K;  1CLQ A;  3LM9 A;  4BRF A;  4WF9 L;  2NRH A;  3THX A;  3CG7 A;  4HUE A;  5C25 A;  3HK2 A;  4Z4E A;  2HNY A;  3DJC A;  4JLH A;  1VSD A;  1Q7Y O;  1CZA N;  3D45 A;  2NLX A;  3SNN A;  4CJW A;  1TUU A;  3RMA A;  3QBW A;  4GNI A;  4BRN A;  2EHG A;  3VPZ A;  1QQM A;  3RR8 A;  1MA9 B;  4DR1 K;  1SKS A;  2B4J A;  4C8M A;  1BCO A;  4OPK A;  1QSL A;  2QEX N;  4A2A A;  1L3S A;  4B1W B;  4O8K A;  2FC0 A;  4K0K K;  3QET A;  5KGX A;  2HB5 A;  1HX1 A;  3DLR A;  2NRT A;  4CIF A;  3AVB A;  1JL2 A;  1VSF A;  4QS8 A;  1C0M A;  5JS2 A;  3CHW A;  3DOK A;  5JIC A;  1D5A A;  3AVN A;  4O0I A;  3SMS A;  2P9U B;  1HUX A;  4CHQ A;  2ATQ A;  4CEF A;  4BRH A;  5AQQ A;  2NNW A;  3CJ1 A;  3O3H A;  1BA0 A;  3QER A;  4PKG A;  4GVE A;  4CZH A;  2E88 A;  3F5T A;  4LF8 K;  2ASP A;  1QZ6 A;  1ITG A;  1UA1 A;  3FLC O;  3DOL A;  4M42 A;  3MCP A;  1P8Z A;  3HM9 A;  3V1R A;  3DLK A;  2YJF A;  1ASV A;  5M1O A;  1GLA G;  4E1J A;  1JKH A;  3MWT A;  1SKW A;  1S1X A;  4CZF A;  1C0F A;  5HP1 A;  1YIT N;  4MQ3 A;  5AQO A;  1VQ9 N;  1E4G T;  2I7N A;  1YXQ A;  1D4X A;  1N5Y A;  4BY9 C;  3I8D A;  4LH5 A;  1RIL A;  3CCL N;  1BU6 O;  1T44 A;  2FF3 B;  3O9U A;  4H5R A;  4LSN A;  2ITM A;  2V51 B;  4IZ9 A;  3KLG A;  1QSS A;  2Z1G A;  4N41 A;  4JD2 B;  2YHY A;  1RT6 A;  3KWI A;  3T19 A;  3LWL A;  2O8F B;  2V7Z A;  4EP4 A;  3P4I A;  3OYB A;  3TAB A;  4CBU A;  4O5F A;  3K58 A;  5I9E B;  3P1G A;  5C24 A;  1TK8 A;  3CQ8 A;  3QIN A;  1HKG A;  2YNH A;  1YI2 N;  2E1Z A;  1C0T A;  1Q9X A;  3S3N A;  1Q8I A;  3SQ1 A;  3HL8 A;  4F9O A;  1RDB A;  1RCH A;  3SJJ A;  1GLB G;  3J7Y P;  4BR4 A;  5AQR A;  3K9K A;  1NK8 A;  1UOC A;  5LY3 A;  4EIA A;  4CZI A;  3DI6 A;  2CGK A;  2PYL A;  2F8T A;  1E4F T;  1BIS A;  2ASO A;  4KO0 A;  4YOW A;  3GL1 A;  5TKW A;  1M90 O;  3F9K A;  3CCS N;  2ZJR L;  4U67 L;  3PIP L;  5JLH A;  2Q1N A;  1XMO K;  4AH9 A;  3UKR A;  5BRE A;  5M1F A;  3CFP A;  1JLQ A;  3H46 O;  4BAC A;  2Q2R A;  1C6V A;  3SBT A;  3AVM A;  4EZ6 A;  4DHY A;  4KHP K;  2HOE A;  3DXK A;  3NF9 A;  3AO5 A;  3A8Y A;  2HVH A;  2FBX A;  3TAF A;  2QW9 A;  3M1F A;  2UXC K;  4JS5 A;  1J6Z A;  4B08 A;  1EWR A;  1KC8 O;  1HMV A;  3HJF A;  4NO7 A;  4JI2 K;  2D4W A;  3SLC A;  1L3U A;  1NK5 A;  1ATN A;  2YNF A;  4FWN A;  1FK9 A;  1IV0 A;  3IFR A;  3LM2 A;  5KPR A;  1XC3 A;  4ID1 A;  1ZBF A;  4DB3 A;  2P9I B;  4N47 A;  3OYG A;  3SQ4 A;  3IG1 A;  4JN4 A;  5LJW A;  2QXF A;  4CD3 A;  1J54 A;  3WXL A;  3KWG A;  4EFH A;  1WSE A;  4H5V A;  4AM6 A;  3HSC A;  3OS2 A;  3KKS A;  1RT7 A;  3F9M A;  3VGM A;  3FZM A;  1BIU A;  4A5A A;  3CER A;  1WUA A;  4CF0 A;  4KHS A;  3AVK A;  4QS7 A;  2GUP A;  4CES A;  4BDZ A;  3I0S A;  3THW B;  3NVK A;  3VQA A;  5CZ2 A;  4B9Q A;  1XHX A;  4CZL A;  3QEW A;  3AV9 A;  3MXM A;  2DY4 A;  4DQQ A;  1BI4 B;  1SAZ A;  1V4T A;  3DXM B;  2VWK A;  1NGG A;  2XRI A;  3HRG A;  4DV3 K;  5CZ1 A;  4I6M B;  5HBM A;  3O1W A;  2FBV A;  1NWK A;  2KTQ A;  2VG6 A;  4B9N A;  3VQ7 A;  1DLO A;  3MEE A;  4OPH A;  3HVR A;  3IMX A;  3E9L A;  4CK2 A;  3LAK A;  3MED A;  4CJ3 A;  4JKF A;  3VF4 A;  2ZGY A;  3THW A;  3AAR A;  1RDA A;  3CXC M;  4NYF A;  4C8N A;  4DG1 A;  1RDD A;  4CZM A;  4FZY A;  1C1B A;  3QEX A;  1WLJ A;  5HOO A;  4FJH A;  1XI1 A;  3NGZ A;  1BI4 A;  3MDQ A;  3QIO A;  4BRL A;  3DXM A;  4M41 A;  4AHT A;  3T7Z A;  3OYA A;  4FK4 A;  2ZD1 A;  4I6M A;  4FLX A;  4CBX A;  4CHN A;  2P1J A;  3CC4 N;  4FPA A;  4N5S A;  2WC9 A;  2Z1H A;  4RW6 A;  1L3T A;  3R1X A;  1VQ4 N;  4FYD A;  1RDU A;  1NG9 A;  1TK0 A;  1VQM N;  1D9D A;  4BRD A;  1NJW A;  4DR7 K;  3AA4 A;  3CCU N;  5LMU K;  4IFY A;  3VQC A;  5DM6 L;  2RE2 A;  3V9W A;  1S9E A;  4C1N K;  4NB4 A;  4BC4 A;  4JRQ A;  1FW6 A;  1B9F A;  4KB1 A;  4LF5 K;  4KRE A;  1SL2 A;  4NLC A;  1QQC A;  1WSI A;  4C8K A;  3AAQ A;  3VA0 A;  1NOY A;  2A1S A;  5BN9 A;  2NRV A;  1W97 L;  4JYA K;  1YJW N;  3UKU B;  3LPU A;  1NBW A;  3HP9 A;  3V6D A;  3OVN A;  1NGD A;  4KFB A;  4CEO A;  1HR0 K;  4FJK A;  3LDO A;  4FZZ A;  1OH5 A;  1LOT B;  3KD5 E;  2UXD K;  3ATU A;  4CF8 A;  2UUA K;  2VGM A;  3AVL A;  3O9T A;  4DR4 K;  4QCL A;  1VQK N;  1N33 K;  3O4N A;  4BRE A;  4DFK A;  1DGK N;  1S1T A;  1JCE A;  2IVO A;  2P5O A;  4RW9 A;  1NGC A;  4CEZ A;  5EU7 A;  1U2V B;  3K59 A;  5AQG A;  3LDS A;  3RR7 A;  1KVC A;  4CW7 B;  1NK6 A;  2RN2 A;  1OVQ A;  1KD1 O;  2OPQ A;  1HQU A;  4DU1 A;  3CC7 N;  4CFB A;  3L8B A;  5C0Y A;  1TVR A;  3BY5 A;  1D9F A;  1DTQ A;  1IBK K;  4KHQ A;  4PY5 A;  3K5L A;  4CJR A;  1EKE A;  1HNI A;  4IJA A;  1HKC A;  3AO2 A;  3W3D A;  3ZYY X;  1C0G A;  2F9W A;  3CJC A;  2E2P A;  4FWK A;  1S72 N;  1EWQ A;  5BPL A;  1YVN A;  4AM7 A;  2HMP A;  4DQI A;  4FK0 A;  3AVF A;  5CYM A;  4A2B A;  2ZGZ A;  1U2V A;  1U04 A;  1UWB A;  3PO5 A;  4IWV A;  1YJN N;  1VSH A;  1X1P A;  1XHZ A;  2O8C B;  4O55 A;  3QEV A;  1YIJ N;  3TPQ A;  2ITG A;  1S22 A;  4BG8 A;  3ENH A;  2Q31 A;  2F4V K;  1GLL O;  2QA4 N;  3CQY A;  3VET A;  2Q97 A;  3O3F A;  4IG0 A;  1J9A A;  2JWL A;  5T7B A;  2E1Y A;  4OGE A;  1FJG K;  1RBS A;  1QE1 A;  4E7I A;  1GOA A;  3J81 O;  1HYV A;  2HBK A;  4AHV A;  1NK0 A;  4DQR A;  3P83 D;  4E7L A;  4B8C A;  2O8C A;  1OH6 A;  4J2E A;  4BRK A;  1N6Q A;  4RWT A;  1RBT A;  3E01 A;  4DTR A;  2YV0 X;  4AQY K;  1TYQ B;  2WON A;  4DF8 A;  1ILY A;  1HRH A;  1QHA A;  2BAN A;  1FXX A;  2X74 A;  4F3T A;  3CIP A;  3A2F A;  4O0J A;  3GOI A;  4E7K A;  3DLG A;  4OVL A;  2AJQ A;  3VER A;  2HMI A;  4FM1 A;  5DK5 A;  4RW7 A;  4LC9 B;  3T69 A;  3SQ0 A;  4C1N I;  4DSF A;  4KTQ A;  4F2R A;  1HKB A;  4E7J A;  1S1U A;  1HNZ K;  3A5L C;  5FPD A;  4FWP A;  2X6N A;  1TYQ A;  3ULE A;  4W5T A;  1LCU A;  3LAM A;  4WE1 A;  3RTV A;  4YHH K;  1X9M A;  1T3V A;  1TL1 A;  1VQO N;  5AQW A;  3TU5 A;  4CGG A;  3JS6 A;  2EWS A;  4CJS A;  1RDW X;  4WFA L;  1WSF A;  3Q7C A;  3SAG A;  4CEA A;  3HBT A;  3MN6 A;  3QFU A;  4DTM A;  3WNG A;  3D2F B;  4OPJ A;  1O1W A;  5ELZ A;  3K5M A;  3SUQ A;  3ZT2 A;  4QS9 A;  2GWJ A;  4JKE A;  1J5O A;  1U6Z A;  2GEL A;  4J2A A;  1ZXO A;  2CH5 A;  3OBW A;  3K0S A;  1QSY A;  5KTQ A;  3H1V X;  4BRI A;  2QXL A;  1QS4 A;  3L6Q A;  4CGI A;  3M8R A;  4B9U A;  4ISE A;  4DSI A;  4Z0U A;  3VN5 A;  3LAL A;  5AQU A;  3LP2 A;  2GWK A;  1BUP A;  2OA8 A;  1WN7 A;  5M1K A;  2X78 A;  3VQ6 A;  2IS3 A;  2E8A A;  4N56 A;  4JKC A;  1Q86 O;  1JLE A;  4Z94 A;  3VTI A;  3SZ2 A;  5KQ8 A;  1JLA A;  4I2P A;  3VQ4 A;  4A57 A;  1TAU A;  3KJV A;  4YDU C;  4BDY A;  3U6F A;  4IFE A;  3A5M C;  4OJR A;  3OYN A;  4DS4 A;  5GAE P;  4ZTJ A;  1A5W A;  4BR9 A;  4B1X B;  1NJI O;  1W9H A;  1NLV A;  4LH4 A;  3MEC A;  1IG9 A;  4FJI A;  5K14 A;  2I7P A;  2QWN A;  1GOB A;  1RT2 A;  3NF6 A;  4K42 A;  4MO4 A;  4A59 A;  3O4W A;  3EE9 A;  4IEI A;  4CEQ A;  1GLC G;  4FM0 A;  4G1Q A;  4RTF D;  4M3R A;  3NH1 A;  1TUY A;  1VK0 A;  1T6D A;  3TAG A;  3FR0 A;  2E2Q A;  2HHU A;  3TAQ A;  5FPE A;  3P31 A;  3PSF A;  3PY8 A;  3VEW A;  1Y97 A;  1XNR K;  1XQS C;  2GTD A;  4CJQ A;  3LDP A;  3DM2 A;  3DRR A;  4CFC A;  1T6C A;  3NVM A;  1WOQ A;  4CJ5 A;  3L3V A;  1VSL A;  4CF2 A;  4LF7 K;  4ISF A;  3GG4 A;  4CZE A;  3CCV N;  5AQP A;  4B3R K;  1N32 K;  2YHX A;  2HBL A;  3MAQ A;  5GIP A;  3V1Q A;  1U47 A;  5HRR A;  2CGL A;  3CJA A;  1NJX A;  3HOS A;  4IOX A;  3CM5 A;  1JCG A;  2WOM A;  3NH2 A;  4JI4 K;  4J8F A;  5JVH L;  2NRZ A;  4FJX A;  2A6A A;  2O8B B;  3EN9 A;  2P5G A;  4CHY A;  4DTU A;  3O4Q A;  1YHQ N;  1W2B M;  3JXU A;  5LMN K;  1R0A A;  4DV6 K;  3QES A;  2E2N A;  1HNX K;  5AQH A;  1RT4 A;  3THV A;  1ASW A;  5FDL A;  1UA0 A;  5AR0 A;  4UQG A;  4O4G A;  3TSP A;  3PSI A;  4KH6 A;  3C7N B;  4M3Z A;  3G25 A;  4CGJ A;  3B6P A;  5A2Q O;  4IXC A;  3KTQ A;  4JKG B;  1RNH A;  4ZTF A;  2O8B A;  4B1Z A;  1QQO A;  1EXQ A;  2RF2 A;  3V4I A;  4BGA A;  4ZHR A;  2HNZ A;  3WQT A;  3VA3 A;  3P39 A;  4FWQ A;  4DTX A;  4DQP A;  1JXB A;  4B1U B;  5CHI A;  3U8X A;  4JV5 K;  4DSE A;  4IJN A;  2EX3 A;  4GW6 A;  3WXM B;  1DKG D;  2HHS A;  5C2D A;  1NNE A;  3QDK A;  3C7N A;  5M1P A;  5KPT A;  3TTD A;  5EXW A;  5BR9 A;  3CC2 N;  4JKG A;  4FOI A;  3NE6 A;  3V1O A;  4CIG A;  5AFU H;  2I5J A;  3AGR A;  2B6A A;  3CM6 A;  3EYZ A;  3NBP A;  3MK6 A;  5FPM A;  3AGK A;  2IDO A;  3AAP A;  2H3G X;  3L3U A;  3HT3 A;  2BGG A;  5AQJ A;  2GV9 A;  3KLI A;  4DV5 K;  1HPZ A;  5GAG P;  5FRM A;  4DLG A;  1KAX A;  3WT0 A;  3PV8 A; 
#chains in the Genus database with same CATH homology
 1KFD A;  4W5O A;  4CGH A;  4CED A;  4CK2 A;  3LAK A;  3ZSV A;  5FRO A;  3V9U A;  3MED A;  1K6Y A;  4PA1 A;  3U3G A;  4CJ3 A;  3K5N A;  1RTD A;  4FZX C;  3ZSW A;  5CY4 A;  1ZBL A;  1RDA A;  3TR8 A;  4DWI A;  4NYF A;  4C8N A;  4I9L A;  4DG1 A;  1RDD A;  2JLE A;  1CXU A;  2D0B A;  1REV A;  1C1B A;  4FZY A;  3QEX A;  2PY5 A;  4Z4G A;  1WLJ A;  4OKK A;  4FJH A;  1NJZ A;  1XI1 A;  3IRX A;  3AVC A;  3NGZ A;  4BE0 A;  1BI4 A;  3QIO A;  3L2V A;  2HW3 A;  4M41 A;  3ZSX A;  2G8V A;  4AHT A;  3RWU A;  1UAX A;  1BIZ A;  5HRN A;  3OYA A;  3DRS A;  3JYT A;  1CZ9 A;  2ZD1 A;  4FK4 A;  4FLX A;  4F8R A;  1S1W A;  4CHN A;  2YKM A;  4FJ5 A;  4IDK A;  3JSM A;  2P1J A;  1BQM A;  4B9T A;  1JLC A;  3QO9 A;  1KLN A;  2OYQ A;  4N5S A;  2OZM A;  5KGW A;  2Z1H A;  4RW6 A;  1L3T A;  1XWL A;  4FJM A;  4E1M A;  4FYD A;  1SKR A;  2D0C A;  3AO1 A;  2YHB A;  1TK0 A;  4HUF A;  1D9D A;  4DFM A;  4M3Y A;  3MEG A;  1NJW A;  3VQ8 A;  1IKX A;  3AA4 A;  4F3O A;  4IFY A;  3TAN A;  4FW1 A;  3CFO A;  3VQC A;  3EZ5 A;  4XIU A;  4BE2 A;  2KZM A;  2VG7 A;  4CJP A;  3OS0 A;  1Z26 A;  1X9S A;  3V9W A;  4R5P A;  1S9E A;  3VQD A;  3NHG A;  3PO4 A;  4ELU A;  2F8S A;  3SPY A;  4B3O A;  3L2Q A;  3AVH A;  4JRQ A;  3AA3 A;  4Z4F A;  2DFF A;  2ZQB A;  4FXD A;  1LAV A;  1B9F A;  1RBV A;  4CHZ A;  1B92 A;  1KFS A;  4CEB A;  2XO7 A;  1T8E A;  3DMJ A;  4C8L A;  1LWE A;  4KB1 A;  1VRT A;  4KRE A;  4CHO A;  1BCM A;  1ZBH A;  1SL2 A;  4BDP A;  1QQC A;  2XY6 A;  1WSI A;  4C8K A;  1S1V A;  3VA0 A;  1NOY A;  2A1S A;  3OS1 A;  4AHU A;  4DU3 A;  3LAN A;  3ZSR A;  3PX4 A;  3MXI A;  3LPU A;  2XY5 A;  3HXM A;  3HP9 A;  3V6D A;  4HCC A;  3PUF A;  4B8A B;  3OVN A;  4KFB A;  4Z4H A;  5HRP A;  5HLF A;  4CEO A;  4FJK A;  4FZZ A;  3VQ9 A;  3K2P A;  3EY1 A;  4EZ9 A;  3KD5 E;  4AIL C;  4B9V A;  2P51 A;  4CF8 A;  2VG5 A;  1Q9Y A;  4CGD A;  5FRN A;  4NYN A;  3OYJ A;  1IKW A;  3AO4 A;  3AVL A;  4B9L A;  4QOZ B;  4QCL A;  3AO3 A;  4RG8 A;  3ALY A;  4MFB A;  4Y1C A;  3O4N A;  3OJU A;  4IFV A;  3L2W A;  3OYC A;  2O4G A;  1S1T A;  4DFK A;  1LW0 A;  3FFI A;  1WSJ A;  3VQ5 A;  2YNG A;  1TKD A;  2P5O A;  4RW9 A;  3AVA A;  4CEZ A;  4B9M A;  1BQN A;  5EU7 A;  4DMN A;  5D3G A;  3LZI A;  4QAG A;  1T7P A;  1FKO A;  3K59 A;  4JS4 A;  2FBT A;  4W5R A;  3NH0 A;  2JGU A;  1IH7 A;  3PV8 A;  3OJS A;  3LDS A;  4CF9 A;  1RBU A;  1NKE A;  1KVC A;  3RR7 A;  3OYE A;  1NK6 A;  2RN2 A;  4JRP A;  3BDP A;  4OLA A;  3ZSO A;  3NGY A;  1XC9 A;  2OPQ A;  3NF8 A;  3V9Z A;  4FJG A;  1HQU A;  4DU1 A;  1ZYQ A;  1U48 A;  3AA5 X;  3LWM A;  1IKY A;  4CFB A;  3K57 A;  4EP5 A;  3L8B A;  4KHN A;  1TVR A;  1D9F A;  1DTQ A;  4KB0 A;  4KHQ A;  2QKK A;  4OLB A;  4PY5 A;  2ZE2 A;  2ETJ A;  1T03 A;  1CXQ A;  3K5L A;  5HRO A;  3RRH A;  4W5Q A;  4Z4I A;  1JXE A;  1RTJ A;  3VQE A;  4CJR A;  1EKE A;  4KHY A;  1HNI A;  2KFN A;  3SUO A;  2B5J A;  1ZBI A;  4DTN A;  2HHQ A;  3AO2 A;  4BWJ A;  2OZS A;  2KFZ A;  2VWJ A;  3SI6 A;  2DFH A;  4CHP A;  1HYZ A;  4E0D A;  3DRP A;  4DSL A;  4O5B A;  4YFU A;  3HYF A;  4FJJ A;  3H08 A;  3TAM A;  4FM2 A;  4CK3 A;  4LY7 A;  4E1N A;  1NK4 A;  1EP4 A;  3CYM A;  3U3Y A;  4DQI A;  4FK0 A;  2KQ2 A;  1SL0 A;  3AVF A;  5CYM A;  3VQB A;  2F96 A;  4KI6 A;  2HVI A;  4RW4 A;  1U04 A;  1UWB A;  3PO5 A;  2HHW A;  2YNI A;  4OKE A;  4M3W A;  3C6U A;  3WNH A;  4HVJ A;  1VSH A;  1X1P A;  1XHZ A;  3RMD A;  1KCF A;  3PX0 A;  1JLF A;  4O55 A;  1TL3 A;  1HQE A;  4FVM A;  4TSX A;  1VSM A;  1RT3 A;  3KKR A;  3QEV A;  3QNO A;  4CER A;  2ITG A;  4AHC A;  4DQS A;  2Y1I A;  1LAW A;  3WNE A;  3M8Q A;  4E3S A;  3V9S A;  3ASM A;  1DTT A;  1I3A A;  4DTP A;  3T3F A;  1YT3 A;  4FLU A;  4Q0B A;  4CE9 A;  3ZT0 A;  1RT1 A;  2RPI A;  1U4B A;  4LD0 A;  3O3F A;  1WSH A;  2OPR A;  3V81 A;  4IG0 A;  1J9A A;  3ZT4 A;  3QNN A;  5T7B A;  1QTM A;  1J53 A;  4FK2 A;  4OGE A;  3HPG A;  3HP6 A;  1RBS A;  1QE1 A;  3ITH A;  4CFA A;  4E7I A;  4J2D A;  3SV3 A;  2PYJ A;  1CLQ A;  1GOA A;  2BDP A;  5J1E A;  2RKI A;  3HPH A;  1NK9 A;  3AVG A;  1HYV A;  1S6Q A;  3ZSY A;  4AHV A;  1NK0 A;  4DQR A;  3P83 D;  3CG7 A;  2DFE A;  5C25 A;  3OYL A;  4HUE A;  4DLE A;  3SV4 A;  4E7L A;  3HK2 A;  4Z4E A;  4DF4 A;  2OPP A;  2HNY A;  2X6S A;  4B8C A;  4J2E A;  4JLH A;  1N6Q A;  1RBT A;  3E01 A;  1VSD A;  3ZSQ A;  3IAY A;  3AVJ A;  4KKO A;  4DTR A;  2YV0 X;  4CF1 A;  3D45 A;  3KIO A;  3SNN A;  2G8U A;  4CJW A;  2WON A;  4DF8 A;  3NF7 A;  3KLF A;  4ELV A;  3RMA A;  2DTU A;  2EHG A;  1HRH A;  4GMJ B;  2BAN A;  3RR8 A;  1FXX A;  2X74 A;  1SKS A;  4F3T A;  2B4J A;  3A2F A;  4C8M A;  1ZBU A;  3RMC A;  2HHT A;  1BCO A;  2E6M A;  2FBY A;  4O0J A;  4OPK A;  1T05 A;  1QSL A;  4H4O A;  1BGX T;  4E89 A;  3SYZ A;  2Q3S A;  3DLG A;  4OVL A;  4E7K A;  1NKC A;  5HRS A;  2AJQ A;  1KTQ A;  1L3S A;  4I9Q A;  1VSE A;  2D0A A;  2HMI A;  4F4K A;  2FC0 A;  3QET A;  1G15 A;  1LV5 A;  5KGX A;  2HB5 A;  3DLR A;  4Y1D A;  3VQP A;  1TGO A;  5DK5 A;  4CIF A;  2NUB A;  4RW7 A;  4FM1 A;  3DLH A;  2KZZ A;  3AVB A;  1JL2 A;  4HTU A;  4PWD A;  1VSF A;  3SQ0 A;  4DSF A;  4KTQ A;  1C0M A;  1VSK A;  5JS2 A;  4CFD A;  2Y1J A;  2IAJ A;  4FJN A;  4I7F A;  4ICL A;  4F2R A;  4E7J A;  4DS5 A;  2G8H A;  5I3U A;  1S1U A;  1C1C A;  3DOK A;  4N76 A;  2X6N A;  3AVN A;  1D5A A;  4OGC A;  4O0I A;  4W5T A;  3LAM A;  4WE1 A;  3RTV A;  1X9M A;  4IKF A;  1RTH A;  4CHQ A;  2ATQ A;  4CEF A;  1TL1 A;  1VSJ A;  3O3G A;  4CGG A;  3NDK A;  4FJ8 A;  4CEE A;  3ZT3 A;  4CJS A;  4KRF A;  3O3H A;  1WSF A;  4KV8 A;  3QER A;  4FW2 A;  4W5N A;  2G8K A;  4NCB A;  3NCI A;  1B9D A;  4E7H A;  4CEA A;  4KTZ A;  4BWM A;  4DTM A;  3DLB A;  3WNG A;  1KSP A;  2Z1J A;  4F2S A;  4OPJ A;  1O1W A;  3LPT A;  5SWM A;  2XHB A;  1ITG A;  1UA1 A;  3PX6 A;  2E6L A;  3K5M A;  1D8Y A;  3SUQ A;  3OYF A;  3HO1 A;  3ZT2 A;  3DOL A;  1NJY A;  4J2B A;  3OYH A;  4M42 A;  4I2Q A;  1J5O A;  3AVI A;  3HM9 A;  4J2A A;  3V1R A;  4CIE A;  1WAF A;  3DLK A;  1ASV A;  5KTQ A;  1QSY A;  1RT5 A;  4FLV A;  1QS4 A;  3VQQ A;  1NOZ A;  3OYM A;  2W42 A;  1JKH A;  3HPO A;  1SKW A;  2YKN A;  4KTW A;  1S1X A;  4RW8 A;  1WSG A;  4CGI A;  3M8R A;  5HP1 A;  4Z0U A;  3VN5 A;  3LAL A;  4B9U A;  4MQ3 A;  4B9S A;  4DSI A;  4FJ7 A;  3LP2 A;  2E4L A;  4CJ4 A;  3SPZ A;  4AHR A;  3C95 A;  2GBZ A;  1WN7 A;  2OA8 A;  2X78 A;  3VQ6 A;  4FJ9 A;  3KLH A;  2QK9 A;  2IS3 A;  4N56 A;  1N5Y A;  1JLE A;  1BL3 A;  1RDC A;  3SZ2 A;  3I8D A;  4M3T A;  5I42 A;  1IO2 A;  1NK7 A;  1L3V A;  4LH5 A;  1RIL A;  4DTS A;  1JLA A;  4I2P A;  3VQ4 A;  3QIP A;  4CJL A;  1TAU A;  3KJV A;  4BDY A;  3U6F A;  2F8T A;  3TAE A;  4LSN A;  4NCG A;  3KLG A;  1QSS A;  2Z1G A;  4OJR A;  4N41 A;  3LP0 A;  4AHS A;  4HCB A;  4IG3 A;  1HNV A;  3OYN A;  4DS4 A;  1L5U A;  4ZTJ A;  1A5W A;  3MXJ A;  1RT6 A;  1U49 A;  3T19 A;  3LWL A;  3ULD A;  1W9H A;  4LH4 A;  1SL1 A;  3MEC A;  1IG9 A;  4FJI A;  5K14 A;  2GUI A;  2OPS A;  3NF6 A;  1GOB A;  1RT2 A;  4EP4 A;  3D0P A;  2XY7 A;  5J2P A;  3OYB A;  4CEQ A;  4FM0 A;  3DYA A;  3TAB A;  3KD1 E;  4G1Q A;  3NH1 A;  4M3R A;  3KK2 A;  2XY8 A;  3B6O A;  3S3M A;  5J2M A;  5SZT A;  3K58 A;  1HJR A;  1VK0 A;  3M8S A;  3KK1 A;  3P1G A;  4IBN A;  5C24 A;  4CK1 A;  3TAG A;  1TK8 A;  1JLG A;  3QIN A;  1QHT A;  3CQ8 A;  2HHU A;  3TAQ A;  1VSI A;  2HND A;  1I39 A;  3RMB A;  2YNH A;  4DU4 A;  3ZSZ A;  3LZJ A;  3L2U A;  1C0T A;  3PY8 A;  1Q9X A;  3S3N A;  1Q8I A;  1WAJ A;  1Y97 A;  1HYS A;  4CJQ A;  3SQ1 A;  2IOC A;  1A5X A;  3DM2 A;  3DRR A;  4CFC A;  3HL8 A;  4GVM A;  1RDB A;  4CJU A;  1RCH A;  4CJ5 A;  4H4M A;  3L3V A;  1VSL A;  1FKP A;  1LWF A;  2Z1I A;  3SJJ A;  4CF2 A;  1SUQ A;  1RBR A;  3ISN C;  2BE2 A;  2QKB A;  3V9X A;  1MU2 A;  5KRS A;  1NK8 A;  4DSK A;  4C8O A;  3G0Z A;  1UOC A;  1EET A;  1X9W A;  3MAQ A;  3V1Q A;  1U47 A;  3DI6 A;  5HRR A;  4ELT A;  4L8R B;  3KLE A;  4CJF A;  4KPY A;  1W0H A;  4OKJ A;  4LSL A;  3OYD A;  3S9H A;  3LP3 A;  1NJX A;  3CM5 A;  2PYL A;  4KI4 A;  2PZS A;  1BIS A;  2WOM A;  3NH2 A;  1TKZ A;  4KO0 A;  3TAR A;  3SUN A;  3F9K A;  4DFJ A;  3NFA A;  4CEC A;  3UIQ A;  4FJX A;  4E19 A;  1S9G A;  2P5G A;  4Z4C A;  3HVT A;  4CHY A;  3F73 A;  2R7Y A;  4DTU A;  3O4Q A;  4AH9 A;  5J2Q A;  4M3X A;  2HHX A;  4KHW A;  4BE1 A;  4CJT A;  4O44 A;  3CFP A;  5KRT A;  1R0A A;  1JLQ A;  4BAC A;  3M8P A;  4FCY A;  3G10 A;  4FLZ A;  3QES A;  2G8W A;  3TWH A;  1YTA A;  1C6V A;  1TKX A;  3AVM A;  4H8K A;  4HUG A;  4EZ6 A;  3TAP A;  1RT4 A;  3OYI A;  4KAZ A;  3LP1 A;  4FJL A;  1LW2 A;  3NF9 A;  1ASW A;  3AO5 A;  3THV A;  4NCA A;  5FDL A;  1UA0 A;  4HHT A;  2HVH A;  2FBX A;  4O4G A;  4UQG A;  3TAF A;  3P5J A;  3QEP A;  3K5O A;  4CGF A;  4JS5 A;  1SV5 A;  4B08 A;  4M3Z A;  1HMV A;  3OY9 A;  4K8X A;  4KHU A;  3HJF A;  3RRG A;  1WNS A;  4CGJ A;  2A1R A;  3C6T A;  1U45 A;  3B6P A;  3KTQ A;  1ASU A;  1KVA A;  1RNH A;  3L2R A;  4ZTF A;  2IC3 A;  1NK5 A;  1L3U A;  2YNF A;  4M45 A;  1FK9 A;  3C94 A;  4FLY A;  2YHA A;  1JL1 A;  1YVU A;  1VRU A;  4ID1 A;  3NAE A;  1EXQ A;  1ZBF A;  3S3O A;  1KRP A;  2RF2 A;  1C0U A;  1TAQ A;  4N47 A;  2IGI A;  4CJV A;  3OYG A;  3V4I A;  3ZCM A;  3IG1 A;  3SQ4 A;  4ZHR A;  2HNZ A;  2O4I A;  3VA3 A;  3TI0 A;  2QXF A;  4DTX A;  1J54 A;  3SQ2 A;  4DQP A;  1JXB A;  1S5J A;  1Z25 A;  1LWC A;  3ZT1 A;  3HST B;  4YNQ A;  4DSE A;  1WSE A;  4CJE A;  2EX3 A;  4GW6 A;  3OYK A;  3KK3 A;  1CZB A;  3QLH A;  2HHS A;  1TKT A;  5C42 A;  3OS2 A;  4Q5V A;  3KKS A;  1RT7 A;  2HHV A;  5KI6 A;  4PUO A;  2G8I A;  4ID5 A;  1A5V A;  5E41 A;  1JLB A;  3QEI A;  3DLE A;  1BIU A;  3CFR A;  1TV6 A;  4CF0 A;  4KHS A;  3AVK A;  3SUP A;  2KW4 A;  4FLW A;  4CES A;  4BDZ A;  3I0S A;  5CYQ A;  1KVB A;  3VQA A;  3NE6 A;  5CZ2 A;  3V1O A;  4M3U A;  1XHX A;  5J2N A;  1EX4 A;  1NKB A;  2D5R A;  3QEW A;  3AA2 A;  4DSJ A;  5DMR A;  3AV9 A;  4CIG A;  2I5J A;  3MXM A;  2B6A A;  1GOC A;  1S6P A;  3CM6 A;  3EYZ A;  3NBP A;  3IS9 A;  1BI4 B;  4DQQ A;  2DY4 A;  4DTJ A;  4K8Z A;  2VWK A;  2XRI A;  2IDO A;  3BGR A;  3L3U A;  3HT3 A;  3SCX A;  4PQU A;  5CZ1 A;  1F21 A;  2G8F A;  3WNF A;  5HBM A;  4DFP A;  2BGG A;  2GV9 A;  2FBV A;  2LSN A;  3KLI A;  2VG6 A;  3T1A A;  2KTQ A;  4B9N A;  3VQ7 A;  1DLO A;  1C1A A;  3NGI A;  1HPZ A;  1RTI A;  3MEE A;  1BHL A;  1TK5 A;  3I0R A;  4DLG A;  4DTO A;  5FRM A;  5JS1 A;  4FLT A;  3HVR A;  1YTU A;  1KLM A;  4CCH A;  4CJK A;  1IKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...