3ZSOA

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
150
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 56
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zsoA00
3PX6A 3AA3A 1BHLA 3ZSQA 1TKZA 4KREA 3AA4A 2X6SA 1ASVA 2D0CA 1NK9A 4E7LA 3DMJA 5J2QA 3KKSA 4CJQA 1S9EA 1L3UA 3OYBA 4M3XA 4DU3A 4PY5A 4RW8A 4GMJB 5CZ2A 1S1WA 1NK8A 4Z4IA 1XWLA 1T7PA 3B6PA 4CK1A 1YVUA 3ITHA 3OYAA 2IGIA 2G8KA 2YNHA 2FBYA 4KHYA 3VQAA 3SQ0A 2D0BA 1RCHA 3VQ7A 4IBNA 3C6TA 4DLGA 4F2SA 1WLJA 1BL3A 2KW4A 4B8CA 3TARA 1BQNA 1RTJA 5E41A 1D5AA 4FCYA 5CYQA 1NKCA 2HHSA 4Z4CA 5KGXA 1LAVA 4DTOA 4DQQA 1IH7A 3HT3A 3CFPA 4NCGA 2OPSA 4H4OA 3SPZA 5C25A 4B9NA 4DQSA 4N76A 4FZXC 3VQ5A 3RR8A 4I2QA 1UAXA 3BDPA 4EP5A 1QSSA 4CEEA 3ZT2A 4J2DA 1S9GA 1VSDA 3BGRA 3G0ZA 5EU7A 4CF1A 3SPYA 4BDPA 4FK2A 4KHWA 1A5XA 4ELVA 4F3OA 3QNOA 1WAJA 3OYKA 4CK2A 3OYIA 3ULDA 2BE2A 1KLMA 3VQ6A 3KK2A 2YKNA 4ZTFA 4B9VA 5FDLA 4QOZB 3DRSA 4DF4A 4GW6A 2OPPA 4AHVA 4DSKA 1CLQA 1KCFA 3TWHA 4O44A 2LSNA 5HBMA 4FM0A 4C8LA 1KTQA 4ZHRA 1KVBA 3KKRA 2B5JA 2E6MA 3NF9A 1NOYA 1KRPA 4FZYA 5CY4A 2Z1GA 3HM9A 2R7YA 4BE1A 4DTUA 1BI4B 3QESA 2X6NA 3OJUA 1L3VA 2ETJA 3WNFA 4ELUA 2ITGA 4CE9A 4Z4FA 3EYZA 4FLYA 4O4GA 3L8BA 1EXQA 4CJTA 1U04A 4CGFA 4FVMA 1DLOA 3SYZA 4JLHA 2YNIA 1BCMA 4AH9A 4N5SA 1BQMA 4DG1A 4E1NA 3U3GA 3V4IA 4DSFA 4CF0A 4CJ4A 4HUGA 3TANA 3V6DA 1RTDA 4UQGA 4DTSA 1VSIA 3P5JA 4CJWA 3VQ8A 5K14A 1X9WA 1SL2A 2JLEA 4Q0BA 2DFEA 4PWDA 1RTIA 2KQ2A 3LAMA 4CEFA 4DQIA 1CXQA 3V9ZA 3AVCA 4HVJA 4M3YA 3H08A 5JS1A 1NJZA 4C8NA 4KI4A 4FLWA 5FRMA 1HYZA 1I39A 4CEAA 1IKXA 4E89A 3AO4A 1U47A 3TAMA 1HNIA 4O0JA 1S6PA 1B9DA 3V9SA 1LWCA 3NH2A 3LPUA 3MEGA 4NYFA 4CEDA 2PY5A 4W5TA 2P1JA 3U6FA 2OZSA 1NJXA 3AVIA 2DFHA 1UA0A 3QEVA 4DWIA 3IAYA 2HHTA 4W5RA 3ZT4A 1J53A 2KFNA 2X78A 3L3VA 1QQCA 4TSXA 1JL2A 1SL1A 1R0AA 4LY7A 3DLHA 1GOCA 4M3UA 1J54A 5KI6A 3B6OA 4DTRA 3RMCA 4B9TA 3K2PA 4E7KA 3RRGA 4M41A 3V1RA 3D0PA 4BE0A 4RW9A 4E7IA 1B92A 1ZBUA 3MEDA 1EX4A 4H4MA 4LH4A 1TAUA 3I0RA 1Q9XA 3NF8A 4Z4HA 3HXMA 1WSFA 1WSHA 4RW6A 3RWUA 4J2EA 3M8QA 3WNGA 2A1SA 4KHNA 4QAGA 4HCBA 2VWJA 4CHOA 5HROA 1SKRA 2O4IA 1FK9A 2P51A 1ITGA 1U49A 4O0IA 4O55A 2ZE2A 4N47A 1TK5A 4KPYA 5HLFA 1XI1A 2YHAA 1BISA 1JLEA 3KK3A 3F73A 3AO5A 1BI4A 4CJFA 3K5LA 4E7JA 2EX3A 1FKPA 3IS9A 4CF2A 4OPKA 2D5RA 2KZMA 3THVA 4MFBA 3DLGA 1QTMA 1SKSA 3RRHA 1NK4A 4DTXA 1I3AA 5J2NA 3MXIA 3V1QA 3CFRA 3M8SA 3K58A 1Q9YA 4JRQA 1QSLA 5HRRA 4N56A 2IAJA 3HVRA 1KVCA 4M42A 3HSTB 3E01A 4XIUA 1RILA 4OGCA 4JS4A 1RBVA 1HYVA 1C6VA 3LANA 2XHBA 2YNFA 3ALYA 4B9SA 3K59A 1YTUA 1YT3A 3LAKA 4IFVA 5C24A 4W5QA 4FYDA 2HVIA 3VQEA 2Z1IA 4J2BA 3ZT1A 3NFAA 3S9HA 2QK9A 3HJFA 3DLRA 3O4NA 4B08A 3NH1A 3OJSA 1TL3A 3OYFA 4G1QA 4HUEA 4OLBA 1K6YA 3D45A 3KIOA 4I7FA 3VA3A 3FFIA 4CK3A 4LH5A 4DFPA 1LWEA 1EKEA 5I42A 4FXDA 1S1UA 3RMDA 4EP4A 3SNNA 4B9UA 2OYQA 2X74A 2HHQA 2KZZA 3ASMA 1F21A 4Q5VA 3TAPA 4DTNA 1SKWA 4W5NA 1CXUA 5KTQA 2IC3A 4IKFA 3VQDA 4DU1A 3DM2A 1WNSA 4ICLA 4CJLA 5HRPA 2VWKA 2ZQBA 3ZT3A 4CJVA 2WOMA 4DQRA 1N6QA 3NBPA 5FROA 4CJ5A 4M3RA 3NDKA 2VG5A 1TVRA 1BIUA 3ISNC 4CERA 1D9DA 2RF2A 4KTQA 5J1EA 3MXJA 4IG3A 4RW4A 4CJRA 4BDYA 3S3NA 1T8EA 4DFMA 3NCIA 2PYLA 3V9UA 4FJNA 4JS5A 2G8HA 3KD1E 4CGIA 1W0HA 1QS4A 1LV5A 4KKOA 3EY1A 4ID5A 3ZSXA 1J9AA 2B4JA 3OS2A 3DLEA 3HK2A 4MQ3A 4EZ6A 4C8KA 4FLUA 4O5BA 1RBUA 2P5GA 1YTAA 4NYNA 3HL8A 3JSMA 3QIPA 1RDBA 4DSJA 4DF8A 1X9SA 1RT2A 4CHQA 3LP2A 2Q3SA 3CG7A 3TAQA 1RBSA 4PQUA 3LDSA 2VG6A 4KV8A 3VQBA 3AVNA 1IKYA 4AHUA 2NUBA 2OA8A 4CIFA 2HB5A 1TV6A 1D9FA 1DTTA 1SV5A 2FBXA 1RNHA 3L2RA 2E4LA 4LSLA 3HP6A 2GUIA 4GVMA 1VSFA 1C0MA 2RPIA 3KLHA 4DTMA 2Y1JA 3RR7A 4BDZA 2BDPA 3LZIA 3SQ2A 5C42A 3ZCMA 5J2MA 1S5JA 1SUQA 3HP9A 3AVJA 3DRRA 4CGHA 4OKEA 1TAQA 3LWLA 1VRUA 3AVKA 1RT3A 3OYGA 1NK0A 3RTVA 4IDKA 5T7BA 3QEIA 3V9WA 4ELTA 4W5OA 1D8YA 3AVFA 4AHRA 1LW2A 2GV9A 3T19A 3PX4A 1Z26A 1TKDA 2QKKA 2F8TA 4AILC 1JLGA 2OZMA 3V1OA 3LALA 3NHGA 3NGIA 2P5OA 2QXFA 2QKBA 1ZBHA 1HQUA 4DSIA 2D0AA 1XHXA 3KLIA 2HHXA 3SZ2A 3O3HA 3CM6A 3QLHA 1TGOA 4YNQA 5CZ1A 1KFSA 4E3SA 1RBRA 4CFCA 3SI6A 3TAEA 3VA0A 1VSJA 2KFZA 2G8UA 4OVLA 5D3GA 1G15A 4CJPA 1L3TA 3O3GA 3CYMA 1NKEA 1KVAA 3AVHA 3AVBA 4FZZA 3KD5E 4CF8A 4DS5A 2DY4A 3ZSVA 4FJJA 1XHZA 3HPHA 2I5JA 3SQ1A 1CZ9A 4I2PA 3LP1A 1NJWA 3O4QA 4I9QA 1VSHA 4ZTJA 3AVGA 4BE2A 4Y1DA 4Y1CA 3AA2A 3KK1A 4M45A 2JGUA 2A1RA 3VQCA 4BACA 1JLQA 1NK7A 3DYAA 1S1XA 3CFOA 4AHSA 3OYNA 5SWMA 4B3OA 1C1BA 3M8PA 1WSEA 4OLAA 1RT7A 5DMRA 3SUQA 1LW0A 3RMAA 3QEWA 2DFFA 4FLTA 3K5NA 4IG0A 2GBZA 4HUFA 4BWJA 4KFBA 1VSLA 1J5OA 5DK5A 4N41A 3AV9A 4C8MA 2G8VA 1HMVA 3ZSYA 1ZBLA 3LZJA 4AHTA 4FM2A 3S3MA 4F8RA 4J2AA 4FM1A 3VN5A 4FK0A 1Q8IA 4NCAA 4KTWA 4QCLA 1VSKA 4Z4EA 3LPTA 3SUNA 3L3UA 1S6QA 4CECA 3TAFA 4KB0A 4NCBA 4RG8A 4CJ3A 2HNYA 1TL1A 3OYJA 3TABA 3SV3A 1A5WA 1W9HA 3ZSRA 1C1AA 3CQ8A 1WN7A 3AVAA 3G10A 1IKVA 3WNHA 2XY6A 2FBVA 4KTZA 5I3UA 1C1CA 1KLNA 4FW1A 4CGJA 4CF9A 1IKWA 4OJRA 5KRTA 1N5YA 2DTUA 1O1WA 2Z1HA 2RKIA 2OPRA 3HPGA 4HTUA 3F9KA 1NK6A 1JLCA 3KLGA 3OYHA 1RBTA 1LAWA 3SUPA 3MXMA 2XY8A 1Z25A 1GOAA 1BGXT 3C6UA 3ZSZA 1T05A 1NKBA 3NF7A 3ZSWA 4OKKA 2W42A 3HO1A 4JRPA 1WSJA 4IFYA 2EHGA 4OKJA 3OYLA 3RMBA 3PY8A 4FJIA 4HHTA 1UOCA 3EZ5A 4DQPA 4F4KA 4FJGA 3V9XA 3JYTA 3KJVA 4DU4A 1EETA 2HNDA 1VSEA 2YNGA 1NOZA 2WONA 3HPOA 1HYSA 2IOCA 3OVNA 4CJSA 5HRSA 4FLVA 1Y97A 4CHYA 2PZSA 1ASUA 4FJHA 3OYMA 2O4GA 4CESA 1REVA 3SCXA 4K8XA 4FJMA 3A2FA 4CEOA 2B6AA 3DOLA 4Z0UA 4M3WA 4FJ8A 2F8SA 1L5UA 3LWMA 4C8OA 4CHZA 4KAZA 4DLEA 3PX0A 1A5VA 3HVTA 3SV4A 4F3TA 3LP3A 5J2PA 2Y1IA 4Z4GA 1WSIA 4PA1A 2ZD1A 4CIEA 4KHUA 2PYJA 2VG7A 3ZSOA 3PO5A 4FJ9A 3V81A 1ZBFA 2FC0A 1S1TA 3AVLA 3ZT0A 1DTQA 3SQ4A 1RTHA 1TK8A 3K5MA 3K5OA 1FKOA 3VQQA 1JLFA 1HQEA 3I8DA 3DI6A 3KTQA 2ATQA 3PV8A 1JXEA 1BIZA 1U48A 1QSYA 3QO9A 4CIGA 3L2WA 4CEQA 3NGYA 4DS4A 2AJQA 1LWFA 2Z1JA 3QEPA 1T03A 4HCCA 3T3FA 4WE1A 3VQPA 4CHNA 4LD0A 2HHWA 3AO3A 1TK0A 3DOKA 1SL0A 4M3ZA 4I9LA 2HHVA 1WSGA 1HRHA 4E19A 1FXXA 1QHTA 1RT1A 5JS2A 3OY9A 1XC9A 3PUFA 1NJYA 4F2RA 3S3OA 1VRTA 2KTQA 2YV0X 4DSEA 4DSLA 1QE1A 1RT6A 3VQ9A 1HPZA 4CCHA 3IRXA 5FRNA 4KRFA 4L8RB 3OYDA 3C95A 3MECA 4OGEA 4LSNA 3NH0A 3QIOA 3L2VA 4E1MA 1EP4A 4ID1A 3DLKA 3I0SA 4EZ9A 4RW7A 1UWBA 2G8WA 3T1AA 3KLFA 3QERA 1TKTA 1C0TA 1S1VA 3AO2A 4AHCA 3NGZA 1RDDA 1JKHA 3AA5X 4FLZA 1X9MA 2XO7A 5SZTA 1RT4A 2HNZA 1HNVA 3PO4A 2IDOA 4KO0A 4OPJA 4KB1A 3IG1A 1BCOA 3SUOA 5HRNA 3WNEA 3OYCA 1NK5A 4CJKA 2F96A 4CJEA 2OPQA 3CM5A 4CGDA 3P83D 1JLAA 4FJLA 4K8ZA 4BWMA 2HHUA 4CFBA 4B9LA 4KHQA 3AO1A 3LP0A 4E0DA 3U3YA 1UA1A 4FJKA 4DFKA 4PUOA 2YHBA 3NE6A 3TI0A 2G8IA 3QNNA 1ZYQA 3C94A 1HJRA 1RDCA 2E6LA 1JXBA 4FW2A 1JL1A 3OS0A 1IG9A 1VK0A 1ZBIA 2YKMA 3VQ4A 2HVHA 3AVMA 4R5PA 3TR8A 4CGGA 4DTPA 3UIQA 1ASWA 3NF6A 4FLXA 4FJ7A 3QINA 4CHPA 2XY7A 4CEBA 1JLBA 1L3SA 5HP1A 4FK4A 3DLBA 4B9MA 1TKXA 1B9FA 1WAFA 4CFAA 3OYEA 4FJXA 3MEEA 4KHSA 2HW3A 3O3FA 3M8RA 2G8FA 4YFUA 3K57A 4DFJA 5CYMA 4DTJA 3P1GA 4FJ5A 3QEXA 3QETA 1KFDA 2BANA 1RT5A 1MU2A 3KLEA 1C0UA 5KGWA 3L2UA 3TAGA 1X1PA 3HYFA 4M3TA 4DMNA 4E7HA 1RDAA 3SJJA 2RN2A 2FBTA 2IS3A 4H8KA 5KRSA 3OS1A 3L2QA 4B8AB 1CZBA 4CFDA 2HMIA 1KSPA 2BGGA 3MAQA 1GOBA 1U45A 3DRPA 4CEZA 2XY5A 2XRIA 3NAEA 1VSMA 4CJUA 1IO2A 1U4BA 4KI6A
chains in the Genus database with same CATH superfamily
4KREA 2I7NA 3AA4A 3DMJA 1NNEA 4H0YB 4M3XA 3OYBA 4DU3A 3ULEA 4JKGB 3GL1A 3A8YA 1XWLA 2G8KA 3C7NB 2YNHA 4YHHK 4KHYA 1YHQN 4DV6K 3SQ0A 2W6KA 4DLGA 4F2SA 1WLJA 5AJ3K 5E41A 4FCYA 1NKCA 1NBWA 3EN9A 5KGXA 1LAVA 4DTOA 3HT3A 3O1WA 1DKGD 1HNWK 4B9NA 4DQSA 4N76A 4FZXC 4I2QA 3BEXA 4EFHA 3G0ZA 3SPYA 4FK2A 4JAXA 1YIJN 3LDPA 3VTHA 4CI6A 4BC3A 3ULDA 1H1VA 4I6MB 4DSKA 3CJAA 4OO1J 1NGBA 4WFAL 1KVBA 3G6EN 5C2FA 4PL8A 5CY4A 5AQQA 2X6NA 3PIPL 2ETJA 3WNFA 3J80O 3E9OA 4O4GA 4BRIA 1EXQA 2QWNA 4FVMA 1IG8A 3P31A 5AQFA 4JLHA 3C65A 2P9LA 4NLCA 3V4IA 4DSFA 2P9KA 4CF0A 4CJ4A 5GADP 2P9UB 5TKYA 4HUGA 3CCLN 3TANA 4UY8O 2IVNA 1RTDA 3THXA 5K14A 4A2AA 1SL2A 1RTIA 5AQIA 1NGIA 3E9PA 3LAMA 4CEFA 5C0YA 4M3YA 4FPBA 4HVJA 1NJZA 4C8NA 5FRMA 5IT9O 3AO4A 3TAMA 4O0JA 1B9DA 5HOOA 4NYFA 4KH5A 3VESA 3AVIA 1UA0A 2O8EA 3ZT4A 3BY5A 4TSXA 4DR5K 4LY7A 4A5AA 3ID8A 1GOCA 3QBXA 3DLHA 1T6CA 2CGJA 1U2VB 3B6OA 3RMCA 4B9TA 4E7KA 4BC5A 3M6GA 1EX4A 2P9SB 4WFBL 4H5NA 4JKCA 2E2OA 4Z4HA 3HXMA 1WSHA 3M8QA 4JI4K 4QAGA 1ILYA 4IJAA 4CHOA 5HROA 1SKRA 3SAGA 4O55A 1Q82O 1BISA 4E7JA 3AO5A 4BRAA 1X9JA 3WT0A 4CF2A 2KZMA 2V7ZA 4MFBA 2BH1A 3A5OC 4XH1A 1I3AA 3MXIA 4DV5K 5HRRA 4N56A 3E01A 1RILA 3O9SA 1RBVA 1HYVA 3LANA 2O8FB 2YNFA 3ALYA 3JS6A 1JJ2M 1YTUA 1JCFA 4RWTA 3D2EA 5AQHA 2Z1IA 3NFAA 1ZBSA 2IVOA 3O4NA 3NH1A 3OYFA 3KIOA 2ZGYA 4DFPA 3O9UA 4LH5A 4FXDA 4BG8A 1S1UA 3MMVA 5MLCQ 3ASMA 1SKWA 3LM2A 2IC3A 3VQDA 4DU1A 3EO3A 1WNSA 5HRPA 2VWKA 3ZT3A 4DQRA 5FROA 4CJ5A 4KTQA 4CERA 2A40A 4RW4A 2KZZA 4JS5A 4JKHA 1LCUA 4ID5A 1J9AA 3DLEA 4MQ3A 1ATRA 4FL9A 4NYNA 1BWFO 1RDBA 3QICA 2O8BA 4PHTX 1IKYA 3CPEA 2HB5A 5ADXA 1D9FA 1SV5A 1TYQA 3L2RA 4IJNA 4LSLA 2GUIA 1C0MA 4BDZA 4IWVA 4H03B 2O8EB 3P39A 1HX1A 2ZGZA 4A59A 1VQPN 3V9WA 3AVFA 4FPAA 1KD1O 1TUYA 4IOCL 2F8TA 3FZHA 2O8CB 3TSUA 4BR2A 4B1VA 4DSIA 2D0AA 3KLIA 4ILJA 3SZ2A 1TGOA 1YI2N 1RBRA 3EE8A 4H0TB 2E5LK 1XNQK 2G8UA 5D3GA 3O3GA 1KVAA 4FZZA 1Y64A 3T1YK 2DY4A 3ZSVA 2AA4A 4CZHA 3RSEB 3SQ1A 1CZ9A 4I2PA 4BE2A 4JK7A 3G25A 4Y1CA 2QA4N 2O8FA 1JLQA 2RHKA 3HTVA 1S1XA 3CFOA 3OYNA 4B3OA 2NRXA 3AAPA 3SUQA 4IG0A 4N41A 4MDBA 2G8VA 1ZBLA 2FF3B 3IUCA 1NMNA 3R1XA 4GV3A 3CERA 5AQWA 1N36K 3O08A 1WB9A 4QCLA 4ISEA 2GELA 5FPNA 3F5TA 4CECA 3HSCA 1RDWX 2HNYA 4RG8A 3OYJA 3ENOA 3ZYYX 3BUZB 4J8FA 4PL7A 3C7NA 3G71N 4QS7A 3ZETB 2O8DB 1KLNA 4DB3A 3DAWA 5KRTA 1N5YA 1NK6A 3L4IA 3OYHA 1LAWA 1KQSM 2XY8A 5GAEP 4XH5A 3C6UA 4BRPA 1T05A 1NKBA 3ZSWA 2W42A 4J2BA 3RMBA 3PY8A 1UOCA 3EZ5A 4DQPA 3KJVA 3DXMA 3MN6A 4K42A 2VQEK 4DV2K 2YNGA 2WONA 3HPOA 5HL7L 2IOCA 1Y97A 4CHYA 4M63C 4CESA 1REVA 4Z0UA 1LOTB 3WQUA 1L5UA 4C8OA 2ZF5O 5AQUA 4F3TA 1RDUA 2Y1IA 4Z4GA 1WSIA 2WBNA 4PA1A 2VG7A 1ZBFA 1DTQA 3SQ4A 1TK8A 4DCHA 4DKWA 3AAQA 3VQQA 3I8DA 1HQEA 2ATQA 2YJEA 1JXEA 1BIZA 3U9DA 3L2WA 5CR4A 4CEQA 1LWFA 2Z1JA 4YOTA 1T03A 3T3FA 4CHNA 2HHWA 4LD0A 1EQYA 1SL0A 2BUPA 4M3ZA 2HHVA 3P4IA 1JCGA 1FXXA 1NGCA 1QHTA 3OA9A 5JS2A 3OY9A 1XC9A 2KTQA 3QDKA 4DSLA 5AZIB 3VQ9A 4JKEA 3OYDA 3PLAA 4ID1A 4EZ9A 1UWBA 3QERA 1C0TA 3AO2A 4DUYK 1X9MA 3AA5X 1SAZA 5SZTA 4HTLA 1HNVA 3CCEN 4KO0A 3WNEA 4A57A 2F96A 4CJEA 3P83D 1JLAA 1HKCA 2W40A 2UUCK 4B9LA 4A62A 2V7YA 4PUOA 3QNNA 3H3OB 1HJRA 2E6LA 1NG9A 3UKUA 1IBLK 3SAFA 2YKMA 2HVHA 4DTPA 1FJGK 2D1KA 4BGBA 3PIOL 4FLXA 3QINA 3VEVA 4B9MA 5CE3A 4CFAA 3OYEA 2HW3A 4KHSA 2G8FA 4B1ZA 4YFUA 3M5RA 3SMSA 3L6QA 2BANA 3KLEA 1MU2A 3TAGA 4DUZK 4H0VB 2QWQA 4DHYA 1OH8A 2RN2A 2IS3A 5KQDA 4AQYK 4JI1K 4FWLA 3HM8A 4CFDA 3FGUA 1KSPA 3MN7A 4JI0K 4V19S 1OH5A 1IO2A 4WF9L 4KI6A 1XMQK 3ZSQA 1BHLA 2P9IB 4YY3K 2X6SA 1ASVA 4E7LA 5J2QA 1L3UA 1S9EA 1NM1A 3THXB 3WXKA 4GMJB 1NK8A 2D4WA 3B6PA 2IGIA 3PSIA 5M1FA 2FBYA 3DXMB 3EKUA 1RCHA 4IBNA 2GEMA 4FWKA 1RTJA 2HHSA 3ATVA 1NGGA 4MLHA 2GTDA 4JEPA 4H4OA 3SPZA 3Q7BA 4BRLA 3BDPA 1GLFO 4CEEA 1S9GA 1VSDA 4CF1A 5GIPA 1YVNA 3OHRA 2P9NA 1WAJA 4RCHA 4CK2A 1QVFM 2P9PA 1IV0A 3VQ6A 3KK2A 3CJ7A 2YKNA 2IIRA 5FDLA 3DRSA 4GW6A 5JLFA 4C8LA 1KTQA 3KKRA 3QFUA 2O8CA 1NOYA 3NF9A 2Z1GA 4KH6A 2R7YA 4BE1A 4DTUA 1OVQA 1L3VA 3C6AA 4CE9A 4CJTA 4BRDA 4JYAK 4CGFA 4H0PA 1GLAG 5GIOA 4FSVA 1G99A 5C10A 1BCMA 5AQMA 4N5SA 4WFNL 4E1NA 1S3XA 2YCHA 2NRZA 3P38A 3V6DA 4UQGA 4DTSA 2E2NA 1VSIA 5FLXO 4MO5A 1GLDG 1X9WA 3AGRA 3TPQA 5LL6Z 4MO4A 5JS1A 4IFEA 4K43A 4FLWA 4X66K 3FE1A 4CEAA 1IKXA 4E89A 3MN5A 1LWCA 3NH2A 5JLHA 2PY5A 1XC3A 4CEDA 4W5TA 4EHUA 1R59O 5LJWA 4DWIA 4DR3K 3IAYA 1BA1A 2X78A 3L3VA 1J54A 1RGIA 3ZX0A 2QEXN 1B92A 3MEDA 4DR4K 2A41A 3G4SN 3ZX3A 1Q9XA 3CPWM 3NF8A 2NZTA 3WNGA 3CXCM 2P51A 1ITGA 4CZIA 1TK5A 4N47A 2Q36A 5AQVA 2WC9A 3KK3A 1BI4A 2EX3A 1FKPA 4OPKA 2UUAK 3QBWA 1QTMA 3RRHA 5E26A 5J2NA 3M8SA 1VQ6N 1QSLA 3HVRA 4XIUA 2GWJA 2HBMA 1NU0A 4Z94A 1C6VA 4B9SA 3LAKA 5C24A 4IFVA 3VQEA 3ZT1A 1VQ8N 2QK9A 4JD2B 3FR0A 5AQJA 1K6YA 5F2RA 4B3TK 1LWEA 2HHQA 3SNNA 2X74A 3TSQA 3TAPA 4W5NA 3O5BA 1MWMA 3CC4N 3DM2A 4ICLA 4CJLA 2ZQBA 2P9KB 4GVEA 4CJVA 3ZX2A 2VG5A 1GLEG 5J1EA 4IG3A 4JK9A 3FZKA 3V9UA 4IZ9A 4LF8K 3WXJA 4YOWA 3EY1A 1QZ5A 3HK2A 4K25A 4C8KA 1YTAA 4DSJA 4BRCA 1RT2A 1VQNN 1KXPA 3M1FA 4KV8A 1TV6A 4LC9B 5DM6L 3QFPA 1NGFA 3HP6A 4JI3K 3RR7A 5FPEA 4BC4A 3VF6A 3LZIA 3SQ2A 5J2MA 1S5JA 5JVGL 3LWLA 3AVKA 3KHYA 1NK0A 4FWOA 4IDKA 3QEIA 4ELTA 2CGKA 2YI1A 1JLGA 3NGIA 2P5OA 4FWMA 1HQUA 2UXBK 2HHXA 1XMOK 3U8XA 5CZ1A 4CZGA 3SI6A 4GKJK 4JN4A 2VYPA 4O5FA 2NRWA 4CJPA 1L3TA 3CYMA 3VMFB 4BR5A 5LY3A 3AVHA 5BN8A 4OPAA 3KD5E 5KPTA 3TTFA 1XHZA 1WBBA 4NLBA 1HR0K 3U4LA 1VSHA 2RE2A 4Y1DA 3VQCA 1K8KA 4FO0A 5DMRA 3FZLA 3QEWA 3SLCA 4KFBA 1J5OA 2VCPA 3AV9A 4C8MA 1HMVA 4ILGB 4JI7K 4AHTA 2BTFA 4J2AA 2E8AA 3VN5A 3GBTA 1Q8IA 4NCAA 2QWMA 4KTWA 4Z4EA 3L3UA 4KB0A 4BGAA 4CJ3A 3A5MC 3TABA 1A5WA 5AQNA 2HMPA 2AP1A 3ZSRA 3CQ8A 1K8AO 1NGEA 4CGJA 4CF9A 1IKWA 3BZCA 4WQ5C 4X62K 1JLCA 3T7ZA 1RBTA 3SUPA 1Z25A 1GOAA 1BGXT 5GAGP 4OKJA 2QKBA 4FJIA 4FJGA 3CF5L 3V9XA 4DU4A 1NOZA 3DXKA 1HYSA 1OH7A 4K0KK 4CJSA 5HRSA 1ASUA 3OYMA 2O4GA 3LDNA 2QI2A 3A2FA 4H5RA 2F8SA 1HJOA 4CHZA 1XNRK 2FXUA 3HVTA 3LP3A 5J2PA 2FF6A 3CIPA 3ZSOA 3PO5A 4FJ9A 3JXUA 2FC0A 3AVLA 3CCVN 3K5OA 1HLUA 4YOUA 5EY4A 3J7AP 4IOAL 1QSYA 4CIGA 4H0OA 4WYBA 2VQFK 2D0OA 3CMEN 1VQMN 5I9EB 2QXLA 5JICA 3K9KA 4E19A 1E4GT 3PUFA 1NJYA 3S3OA 4JI5K 4FWSA 5FRNA 3EEQA 4L8RB 3C95A 4OGEA 4LSNA 3QIOA 2HBLA 1EP4A 1O13A 3I0SA 1NMDA 3KLFA 4BRFA 3E1YA 4HWIA 3NGZA 1RDDA 3EL2A 2XO7A 3HOTA 4O8KA 1RT4A 2HNZA 5KQ8A 2IDOA 2Q2RA 2ZJPL 1BG3A 3IG1A 1BCOA 4IO8A 5HRNA 1K8KB 4LFBK 4CGDA 3CM5A 4JKBA 4FJLA 4QS9A 3ZETA 1UA1A 4IEIA 4JKDA 3TI0A 1VQ4N 3OS0A 1ZBIA 3HBTA 3VQ4A 1HKBA 3IMXA 3UIQA 1HUXA 3NF6A 1Q81O 4FJ7A 2ASPA 4CEBA 3CCRN 1YJ9N 1L3SA 4BVOA 3DLBA 1TKXA 4DV1K 4I6MA 4QS8A 4BRHA 4DFJA 4C23A 3THYB 3BP8A 1QZ6A 5LMNK 3L2UA 3LDLA 1X1PA 3DLLL 3ZEUB 1QQNA 3SJJA 5AR0A 4GKKK 5LJVA 4CBWA 3CCUN 3MAQA 1GOBA 3DRPA 1GLBG 2XY5A 4H5WA 3GG4A 3CQXA 3CCMN 3KKSA 4CJQA 4KBOA 4PY5A 5M1KA 5CZ2A 1S1WA 5AQSA 4Z4IA 1ATNA 4JI2K 4WQ5A 4CK1A 4M7YA 1YVUA 3ITHA 3OYAA 5TKWA 4O8UA 3TSPA 3VQAA 2D0BA 3ENHA 3C6TA 3MDQA 1ZC6A 2KW4A 4LF4K 1D5AA 5CYQA 3O4WA 2FLOA 1IH7A 4NB4A 2OPSA 3A5NC 4AF1A 1BOTO 3VQ5A 5AZIA 1QSSA 4H5TA 3D2EB 3HZ6A 2A42A 1A5XA 3K9JA 4ELVA 2ASMA 3QNOA 4F3OA 3OYKA 3QMLA 2BE2A 1KLMA 4IO9L 3VOVA 4QOZB 3U9ZA 1KCFA 5M1NA 4O44A 5HBMA 4FM0A 4ZHRA 3WEEB 2GUPA 2W6LA 1KRPA 3VGLA 4FZYA 2QW9A 2GX9A 3QESA 3OJUA 1C0GA 4ELUA 2ITGA 1YJWN 3M3ZA 4FLYA 3L8BA 2J4RA 3FZFA 4LF5K 4FWQA 4GNIA 1DLOA 2YNIA 1MA9B 1M90O 4DG1A 1GLLO 3U3GA 4CD1A 2CGLA 2ZJQL 3P5JA 3R9PA 3VQ8A 4CJWA 3WUHA 4LF6K 2JLEA 5AZJB 2VGNA 2ITMA 3V9ZA 3H08A 4KI4A 3I33A 4XEIA 1I39A 3J8AA 4OX9K 1HNIA 1S6PA 1EO1A 3OTOK 4GV6A 3U6FA 2OZSA 2DFHA 2HHTA 4W5RA 5ELZA 1QQCA 4LFAK 4B3MK 1JL2A 4DR2K 1R0AA 4U67L 4CJ7A 3K2PA 3RRGA 4M41A 3D0PA 2O8BB 4NO7A 4LH4A 1TAUA 3I0RA 4B9QA 1WSFA 4RW6A 3RWUA 1VQON 2A1SA 4KHNA 2O4IA 4HCBA 2VWJA 1FK9A 4XH4A 2ZE2A 3AY9A 4KPYA 1YAGA 1QVGM 5GAHP 1XI1A 2HBKA 4CJFA 3CJ1A 2WUSA 4X65K 2D5RA 3DLGA 3SMPA 4CZJA 1SKSA 3VTIA 2P9PB 3V1QA 3CFRA 1Q9YA 1MWKA 2P9LB 3WQTA 3J81O 4JS4A 1TYQB 2W41A 2XHBA 4BR0A 4CBXA 3K59A 2CH6A 2F7TA 5JMVA 3S9HA 2I7PA 4WQ4A 3OJSA 1TL3A 1P90A 4HUEA 1J6ZA 3VA3A 1EKEA 5I42A 3RMDA 4EP4A 2OYQA 2UYTA 4EIAA 4Q5VA 5FPMA 3VEZA 1CXUA 4YDUA 5AQPA 2YX6A 3RVCA 3J7ZO 3NDKA 1BIUA 4BDYA 4CJRA 4KH4A 1T8EA 2PYLA 3NCIA 4L3QA 3TTDA 3RSEA 4JKGA 4B3RK 1QS4A 5C2DA 1LV5A 1W2BM 3ZSXA 2B4JA 5CHIA 1RBUA 3CC2N 2P5GA 2QWRA 5AFUH 1X9SA 3SK3A 4IXCA 4JK8A 3LP2A 3VGMA 3CG7A 1RBSA 2UUBK 3LDSA 3VQBA 4AHUA 2NUBA 4BREA 4CIFA 3LDQA 2FBXA 3CCQN 3CCJN 1NGJA 1U2VA 4CBUA 3VEOA 2YJFA 2A3ZA 4GVMA 3KLHA 3TU5A 2BDPA 5C42A 1SUQA 3HP9A 3DRRA 1TAQA 3OYGA 3IKMA 3RTVA 4EHTA 5DM7L 4W5OA 1D8YA 1LW2A 2GV9A 3T19A 1Z26A 1TKDA 2OZMA 2Q0RA 3V1OA 3NHGA 1NGHA 1HNXK 4BG9A 1ZBHA 1XHXA 1ZXOA 3O1BA 4BRNA 1NWKA 3SJHA 1YUWA 2WTUA 4E3SA 3TAEA 1VSJA 1G15A 1GLCG 3VEXA 4KHPK 4M7XA 4DS5A 3GE1A 4FVUA 3ATUA 3CC7N 2I5JA 1VHXA 3LP1A 3VGKA 4ZTJA 1D4XA 4BQLA 3KK1A 2NRRA 4BACA 1QQOA 1YJNN 4C1NK 4CZEA 3DYAA 4OLAA 5SWMA 3C0BA 1WSEA 2HBJA 1RT7A 4E1JA 4BWJA 1GLJO 5DK5A 1XUPO 1HPMA 3O6WA 3ZSYA 3LZJA 3S3MA 4FM2A 2A5XA 3NVKA 1N34K 1VSKA 2NRTA 1S6QA 3O80A 1TL1A 4IDHA 1W9HA 3Q7CA 3VERA 1WN7A 2Q1NA 3AVAA 1IKVA 3G10A 3WNHA 2FBVA 5AFUA 4JI6K 5AQZA 4B3SK 2RKIA 2OPRA 3HPGA 2A6AA 2DPNA 4CW7B 3KLGA 3A5LC 3ZSZA 2CH5A 3NF7A 3HO1A 4JRPA 4IFYA 4HHTA 1VAZA 4F4KA 2JWLA 3JYTA 2QWLA 3D7EO 3ENBA 1HNZK 1EETA 2HNDA 1VSEA 4FOIA 5JVHL 3OVNA 3S41A 2OTJN 4Y0WA 4PKIA 3R6MA 4FJHA 4K8XA 4FJMA 2E1YA 1P8ZA 4CEOA 2B6AA 4H0XB 5EX5A 4FJ8A 2PBDA 3T69A 3LWMA 3IFRA 4KAZA 1QHAA 3PX0A 1A5VA 3SV4A 5EOYA 4DV3K 3SBGA 4KHUA 2UXDK 2HOEA 1YITN 1S1TA 3HOSA 2ZM6K 3ULEB 4JKAA 4CZLA 3PV8A 1U48A 1IBKK 3QO9A 3NGYA 4DS4A 2AJQA 3OBYA 5BRHA 4HCCA 4WE1A 1E3MA 3THYA 3D2FB 1NGAA 3AO3A 3WXLA 4WQ4C 4MLEA 1TK0A 3DOKA 5BREA 1S22A 4BROA 1WSGA 1HRHA 3BZKA 4CZMA 4F2RA 4YDUC 2YV0X 4DSEA 1IBMK 1QE1A 1RT6A 4CCHA 1HPZA 3B8AX 3IRXA 3H46O 3JAMO 2VGMA 1JCEA 1EWRA 3MECA 5BPLA 3NH0A 1KAZA 4E1MA 4DR7K 3H45C 2PAVA 3GDQA 4RW7A 1SQKA 2G8WA 4JI8K 1TKTA 3O9TA 4AHCA 4JKFA 4FLZA 3PO4A 4GY2B 4OPHA 1WBDA 4OPJA 3SUOA 3FLCO 4FWRA 1BA0A 3OYCA 4CJKA 4CVNE 3H1VX 4K8ZA 3H3NO 2GWKA 2E1ZA 4KHQA 3AO1A 3LP0A 3U3YA 4FJKA 5AZJA 4DFKA 2YHBA 3NE6A 1RDCA 1JXBA 4FW2A 1JL1A 1VK0A 4R5PA 3TR8A 4CGGA 4BY9C 1ASWA 2XY7A 2P9UA 5HP1A 1B9FA 3GOIA 1Z6RA 1C0FA 1WAFA 2NLXA 4FJXA 2KHOA 3O3FA 5M1PA 3I8BA 1NLVA 5CYMA 1X3MA 3NVMA 3QEXA 3QETA 1KFDA 1W97L 2QM1A 3F2KA 5KGWA 5KPRA 4IEEA 1M1KO 3HYFA 4DMNA 4E7HA 1RDAA 1ATSA 4DV4K 4H8KA 2P9NB 2YHWA 3MN9A 5KRSA 1KAXA 4B8AB 3L2QA 2HMIA 2BGGA 3NAEA 1EWQA 2ASOA 3R3LA 4JHDA 3PX6A 3AA3A 5M1OA 1TKZA 2D0CA 1NK9A 2QWPA 5AQKA 1Q86O 4RW8A 3KWGA 5AQLA 1K73O 1OH6A 3NMUA 2D0PA 1T7PA 3D2FA 3R8EA 5B8HA 1RFQA 3VQ7A 5M1QA 1OVYA 1BL3A 4B8CA 3TARA 1BQNA 4LF7K 2JWKA 4AM6A 4Z4CA 4DQQA 3CFPA 4NCGA 4B1YB 5C25A 1XQSC 2KKZA 3RR8A 1UAXA 4EP5A 4BRGA 3ZT2A 4J2DA 1NJIO 3BGRA 5EU7A 4BDPA 4KHWA 3OYIA 3MX2A 4B9VA 4ZTFA 3FZMA 1T3VA 4DF4A 2OPPA 4AHVA 2E2PA 4X64K 3VENA 2HHHK 4GV9A 3TWHA 1CLQA 2LSNA 3THWA 2B5JA 2E6MA 3H1QA 1NGDA 3MWTA 3HM9A 1BI4B 1E4FT 3UKRA 4Z4FA 2Q97A 4LFCK 3EYZA 3E66A 3UB5A 4U7BA 1U04A 3N4QA 3HRGA 5AQGA 3SYZA 3WXMB 4AH9A 3T1HK 3FFKB 1BQMA 3ID6A 4YORA 4EAHD 1VQ9N 3UE5A 2PFUA 4JV5K 4DV0K 3CJCA 2YHYA 4Q0BA 2DFEA 3EZWA 3CD6N 4PWDA 2KQ2A 4DQIA 4BQZA 1CXQA 4ISGA 3AVCA 1I94K 1HYZA 5AQTA 1U47A 3V9SA 1DEJA 5H1SQ 3LPUA 3MEGA 2NRVA 2P1JA 1NJXA 3QEVA 1J53A 2KFNA 3W3DA 1SS6A 1SL1A 4JHDB 3MCPA 4RTFD 4M3UA 4C1NI 5KI6A 4DTRA 3E9LA 4YOXA 3V1RA 4PKGA 4BE0A 4RW9A 4K41A 5BRFA 4E7IA 1ZBUA 3QB0A 4H4MA 4LF9K 1Z05A 2E20A 3BF1A 4J2EA 4DR6K 3EKSA 1U49A 4O0IA 3O9RA 2V52B 2NRHA 5AQOA 3OW2M 5HLFA 2YHAA 1JLEA 3F73A 3K5LA 1KAYA 3K0SA 3IS9A 5FPDA 3THVA 1BO5O 3C6HA 1NK4A 4DTXA 2NNWA 3N4PA 2FSJA 3K58A 4JRQA 2IAJA 1KVCA 5BR8K 4M42A 1FW6A 3HSTB 1YXQA 4CZFA 4OGCA 1ESVA 4FYDA 2HF4A 1YT3A 4W5QA 4BR9A 2WFBA 2HVIA 3CCSN 2UU9K 3HJFA 3DLRA 4B08A 1U6ZA 4OLBA 4G1QA 3D45A 4I7FA 2ZJRL 3FFIA 4CK3A 3WEEA 4B9UA 5F1XA 1F21A 4DTNA 4BR7A 2F9WA 5EVZA 5KTQA 4IKFA 2ZWHA 3VF2A 3KVGA 1N6QA 2WOMA 2FSNA 2UXCK 3NBPA 4M3RA 3CMAN 1TVRA 4BRQA 3ISNC 1D9DA 2RF2A 3LM9A 1TUUA 3MXJA 4FJNA 3S3NA 4B1UB 4DFMA 3W0LA 2G8HA 3KD1E 4CGIA 1W0HA 4PKHA 3CETA 3ZLJA 4KKOA 4A2BA 3L0QA 1VQKN 3OS2A 3VF4A 4EZ6A 4FLUA 4ILHA 4O5BA 1DGKN 3HL8A 3QIPA 3JSMA 4DF8A 1Q18A 4CHQA 3KZBA 2Q3SA 3TAQA 4PQUA 2VG6A 5C15A 3AVNA 2OA8A 1DTTA 3CJBA 1VQ7N 1RNHA 5A2QO 2E4LA 1VSFA 2RPIA 4DTMA 5F0XA 3KK7A 3I55N 5IWAK 2Y1JA 3A0IX 2EWSA 3O9QA 3ZCMA 5C12A 4CGHA 3AVJA 3F9MA 4OKEA 2E88A 1VRUA 1QQMA 5AQRA 1RT3A 1S72N 4F9OA 5T7BA 4AHRA 2KLAA 3PX4A 2Q31A 2QKKA 4AILC 3LALA 3OBWA 3MCAB 2QXFA 3J7YP 3EE9A 4JD2A 4IOXA 2F9TA 2QTDA 3O3HA 3CM6A 3QLHA 4YNQA 4CD3A 1KFSA 4CFCA 3VEYA 4AM7A 3VA0A 1DT9A 2KFZA 4OVLA 1N32K 1NKEA 3AVBA 2FSKA 2P9SA 3DJCA 5GINA 4CF8A 4FJJA 3HPHA 1NJWA 3MX5A 3O4QA 4I9QA 3VPZA 3AVGA 1HKGA 3AA2A 4M45A 1MDUB 2JGUA 2A1RA 1NK7A 1N8RO 4AHSA 1V4SA 1C1BA 3M8PA 4DR1K 1LW0A 3RMAA 2DFFA 4FLTA 3K5NA 2GBZA 4HUFA 1VSLA 4F8RA 4DQ8A 4JNEA 4FM1A 4BRKA 4A61A 4FK0A 3TTCA 3LPTA 3SUNA 3TAFA 4ISFA 4NCBA 3PSFA 3SV3A 4BVPA 2HF3A 1K9MO 1C1AA 4BR4A 2XY6A 3UKUB 4KTZA 5I3UA 1C1CA 1YF5L 4FW1A 4OJRA 5AQYA 4DV7K 2DTUA 1O1WA 2Z1HA 4HTUA 3L4QA 4H5VA 3F9KA 5KPZA 1W7AA 3MXMA 5EXWA 4CZKA 4OKKA 1WSJA 2EHGA 3OYLA 3LL3A 4FOEA 3VEWA 1BDGA 4FLVA 2PZSA 3SCXA 1T44A 3SBTA 4M3WA 3DOLA 3BF3A 3DWLA 4A5BA 3THWB 4DLEA 2V51B 4WCEL 1BUPA 2ZD1A 4CIEA 4YOVA 2PYJA 1N33K 3V81A 3ZEUA 3ZT0A 4G9ZA 1SZ2A 1RTHA 3CHWA 3H6EA 3K5MA 1J5EK 1FKOA 1JLFA 3KTQA 3DI6A 5BN9A 2O8DA 5LMUK 3QEPA 4NXMK 4MDAA 3VQPA 2P9IA 4FWPA 4BC2A 1IJJA 3AGKA 4I9LA 3KWIA 1RT1A 2H3GX 2VWBA 3WXIA 3CI5A 1VRTA 1WOQA 3MK6A 4KRFA 1VQ5N 5ADXH 5BPMA 3L2VA 3DLKA 4R79A 4FWNA 3T1AA 1S1VA 3AARA 3IDHA 1JKHA 4BRMA 1X3NA 4KB1A 3DXKB 1NK5A 5BPNA 2OPQA 4B1WB 2E2QA 4BWMA 2HHUA 3MWPA 4CFBA 2F4VK 4E0DA 3D6RA 2G8IA 1ZYQA 3C94A 2QWOA 1WUAA 2OANA 2IVPA 1IG9A 3AVMA 1BU6O 2OCEA 1CZAN 2HSTA 4CHPA 1JLBA 4YOYA 4B1XB 4FK4A 2Q0UA 3CQYA 3HI0A 1T6DA 3MEEA 3CJ9A 3M8RA 3VETA 3K57A 1V4TA 4DTJA 3P1GA 5BR9A 4FJ5A 2YHXA 3LDOA 5E84A 1OKJA 1RT5A 3I56N 1C0UA 5AQXA 4M3TA 5BRDA 4NXNK 3UKRB 2FBTA 1Q7YO 1KC8O 3SAHA 3OS1A 1CZBA 3O8MA 1U45A 4CEZA 2OTLN 2XRIA 1VQLN 1VSMA 4CJUA 1U4BA
chains in the Genus database with same CATH topology
3PX6A 3AA3A 1BHLA 3ZSQA 1TKZA 4KREA 3AA4A 2X6SA 1ASVA 2D0CA 1NK9A 4E7LA 3DMJA 5J2QA 3KKSA 4CJQA 1S9EA 1L3UA 3OYBA 4M3XA 4DU3A 4PY5A 4RW8A 4GMJB 5CZ2A 1S1WA 1NK8A 4Z4IA 1XWLA 1T7PA 3B6PA 4CK1A 1YVUA 3ITHA 3OYAA 2IGIA 2G8KA 2YNHA 2FBYA 4KHYA 3VQAA 3SQ0A 2D0BA 1RCHA 3VQ7A 4IBNA 3C6TA 4DLGA 4F2SA 1WLJA 1BL3A 2KW4A 4B8CA 3TARA 1BQNA 1RTJA 5E41A 1D5AA 4FCYA 5CYQA 1NKCA 2HHSA 4Z4CA 5KGXA 1LAVA 4DTOA 4DQQA 1IH7A 3HT3A 3CFPA 4NCGA 2OPSA 4H4OA 3SPZA 5C25A 4B9NA 4DQSA 4N76A 4FZXC 3VQ5A 3RR8A 4I2QA 1UAXA 3BDPA 4EP5A 1QSSA 4CEEA 3ZT2A 4J2DA 1S9GA 1VSDA 3BGRA 3G0ZA 5EU7A 4CF1A 3SPYA 4BDPA 4FK2A 4KHWA 1A5XA 4ELVA 4F3OA 3QNOA 1WAJA 3OYKA 4CK2A 3OYIA 3ULDA 2BE2A 1KLMA 3VQ6A 3KK2A 2YKNA 4ZTFA 4B9VA 5FDLA 4QOZB 3DRSA 4DF4A 4GW6A 2OPPA 4AHVA 4DSKA 1CLQA 1KCFA 3TWHA 4O44A 2LSNA 5HBMA 4FM0A 4C8LA 1KTQA 4ZHRA 1KVBA 3KKRA 2B5JA 2E6MA 3NF9A 1NOYA 1KRPA 4FZYA 5CY4A 2Z1GA 3HM9A 2R7YA 4BE1A 4DTUA 1BI4B 3QESA 2X6NA 3OJUA 1L3VA 2ETJA 3WNFA 4ELUA 2ITGA 4CE9A 4Z4FA 3EYZA 4FLYA 4O4GA 3L8BA 1EXQA 4CJTA 1U04A 4CGFA 4FVMA 1DLOA 3SYZA 4JLHA 2YNIA 1BCMA 4AH9A 4N5SA 1BQMA 4DG1A 4E1NA 3U3GA 3V4IA 4DSFA 4CF0A 4CJ4A 4HUGA 3TANA 3V6DA 1RTDA 4UQGA 4DTSA 1VSIA 3P5JA 4CJWA 3VQ8A 5K14A 1X9WA 1SL2A 2JLEA 4Q0BA 2DFEA 4PWDA 1RTIA 2KQ2A 3LAMA 4CEFA 4DQIA 1CXQA 3V9ZA 3AVCA 4HVJA 4M3YA 3H08A 5JS1A 1NJZA 4C8NA 4KI4A 4FLWA 5FRMA 1HYZA 1I39A 4CEAA 1IKXA 4E89A 3AO4A 1U47A 3TAMA 1HNIA 4O0JA 1S6PA 1B9DA 3V9SA 1LWCA 3NH2A 3LPUA 3MEGA 4NYFA 4CEDA 2PY5A 4W5TA 2P1JA 3U6FA 2OZSA 1NJXA 3AVIA 2DFHA 1UA0A 3QEVA 4DWIA 3IAYA 2HHTA 4W5RA 3ZT4A 1J53A 2KFNA 2X78A 3L3VA 1QQCA 4TSXA 1JL2A 1SL1A 1R0AA 4LY7A 3DLHA 1GOCA 4M3UA 1J54A 5KI6A 3B6OA 4DTRA 3RMCA 4B9TA 3K2PA 4E7KA 3RRGA 4M41A 3V1RA 3D0PA 4BE0A 4RW9A 4E7IA 1B92A 1ZBUA 3MEDA 1EX4A 4H4MA 4LH4A 1TAUA 3I0RA 1Q9XA 3NF8A 4Z4HA 3HXMA 1WSFA 1WSHA 4RW6A 3RWUA 4J2EA 3M8QA 3WNGA 2A1SA 4KHNA 4QAGA 4HCBA 2VWJA 4CHOA 5HROA 1SKRA 2O4IA 1FK9A 2P51A 1ITGA 1U49A 4O0IA 4O55A 2ZE2A 4N47A 1TK5A 4KPYA 5HLFA 1XI1A 2YHAA 1BISA 1JLEA 3KK3A 3F73A 3AO5A 1BI4A 4CJFA 3K5LA 4E7JA 2EX3A 1FKPA 3IS9A 4CF2A 4OPKA 2D5RA 2KZMA 3THVA 4MFBA 3DLGA 1QTMA 1SKSA 3RRHA 1NK4A 4DTXA 1I3AA 5J2NA 3MXIA 3V1QA 3CFRA 3M8SA 3K58A 1Q9YA 4JRQA 1QSLA 5HRRA 4N56A 2IAJA 3HVRA 1KVCA 4M42A 3HSTB 3E01A 4XIUA 1RILA 4OGCA 4JS4A 1RBVA 1HYVA 1C6VA 3LANA 2XHBA 2YNFA 3ALYA 4B9SA 3K59A 1YTUA 1YT3A 3LAKA 4IFVA 5C24A 4W5QA 4FYDA 2HVIA 3VQEA 2Z1IA 4J2BA 3ZT1A 3NFAA 3S9HA 2QK9A 3HJFA 3DLRA 3O4NA 4B08A 3NH1A 3OJSA 1TL3A 3OYFA 4G1QA 4HUEA 4OLBA 1K6YA 3D45A 3KIOA 4I7FA 3VA3A 3FFIA 4CK3A 4LH5A 4DFPA 1LWEA 1EKEA 5I42A 4FXDA 1S1UA 3RMDA 4EP4A 3SNNA 4B9UA 2OYQA 2X74A 2HHQA 2KZZA 3ASMA 1F21A 4Q5VA 3TAPA 4DTNA 1SKWA 4W5NA 1CXUA 5KTQA 2IC3A 4IKFA 3VQDA 4DU1A 3DM2A 1WNSA 4ICLA 4CJLA 5HRPA 2VWKA 2ZQBA 3ZT3A 4CJVA 2WOMA 4DQRA 1N6QA 3NBPA 5FROA 4CJ5A 4M3RA 3NDKA 2VG5A 1TVRA 1BIUA 3ISNC 4CERA 1D9DA 2RF2A 4KTQA 5J1EA 3MXJA 4IG3A 4RW4A 4CJRA 4BDYA 3S3NA 1T8EA 4DFMA 3NCIA 2PYLA 3V9UA 4FJNA 4JS5A 2G8HA 3KD1E 4CGIA 1W0HA 1QS4A 1LV5A 4KKOA 3EY1A 4ID5A 3ZSXA 1J9AA 2B4JA 3OS2A 3DLEA 3HK2A 4MQ3A 4EZ6A 4C8KA 4FLUA 4O5BA 1RBUA 2P5GA 1YTAA 4NYNA 3HL8A 3JSMA 3QIPA 1RDBA 4DSJA 4DF8A 1X9SA 1RT2A 4CHQA 3LP2A 2Q3SA 3CG7A 3TAQA 1RBSA 4PQUA 3LDSA 2VG6A 4KV8A 3VQBA 3AVNA 1IKYA 4AHUA 2NUBA 2OA8A 4CIFA 2HB5A 1TV6A 1D9FA 1DTTA 1SV5A 2FBXA 1RNHA 3L2RA 2E4LA 4LSLA 3HP6A 2GUIA 4GVMA 1VSFA 1C0MA 2RPIA 3KLHA 4DTMA 2Y1JA 3RR7A 4BDZA 2BDPA 3LZIA 3SQ2A 5C42A 3ZCMA 5J2MA 1S5JA 1SUQA 3HP9A 3AVJA 3DRRA 4CGHA 4OKEA 1TAQA 3LWLA 1VRUA 3AVKA 1RT3A 3OYGA 1NK0A 3RTVA 4IDKA 5T7BA 3QEIA 3V9WA 4ELTA 4W5OA 1D8YA 3AVFA 4AHRA 1LW2A 2GV9A 3T19A 3PX4A 1Z26A 1TKDA 2QKKA 2F8TA 4AILC 1JLGA 2OZMA 3V1OA 3LALA 3NHGA 3NGIA 2P5OA 2QXFA 2QKBA 1ZBHA 1HQUA 4DSIA 2D0AA 1XHXA 3KLIA 2HHXA 3SZ2A 3O3HA 3CM6A 3QLHA 1TGOA 4YNQA 5CZ1A 1KFSA 4E3SA 1RBRA 4CFCA 3SI6A 3TAEA 3VA0A 1VSJA 2KFZA 2G8UA 4OVLA 5D3GA 1G15A 4CJPA 1L3TA 3O3GA 3CYMA 1NKEA 1KVAA 3AVHA 3AVBA 4FZZA 3KD5E 4CF8A 4DS5A 2DY4A 3ZSVA 4FJJA 1XHZA 3HPHA 2I5JA 3SQ1A 1CZ9A 4I2PA 3LP1A 1NJWA 3O4QA 4I9QA 1VSHA 4ZTJA 3AVGA 4BE2A 4Y1DA 4Y1CA 3AA2A 3KK1A 4M45A 2JGUA 2A1RA 3VQCA 4BACA 1JLQA 1NK7A 3DYAA 1S1XA 3CFOA 4AHSA 3OYNA 5SWMA 4B3OA 1C1BA 3M8PA 1WSEA 4OLAA 1RT7A 5DMRA 3SUQA 1LW0A 3RMAA 3QEWA 2DFFA 4FLTA 3K5NA 4IG0A 2GBZA 4HUFA 4BWJA 4KFBA 1VSLA 1J5OA 5DK5A 4N41A 3AV9A 4C8MA 2G8VA 1HMVA 3ZSYA 1ZBLA 3LZJA 4AHTA 4FM2A 3S3MA 4F8RA 4J2AA 4FM1A 3VN5A 4FK0A 1Q8IA 4NCAA 4KTWA 4QCLA 1VSKA 4Z4EA 3LPTA 3SUNA 3L3UA 1S6QA 4CECA 3TAFA 4KB0A 4NCBA 4RG8A 4CJ3A 2HNYA 1TL1A 3OYJA 3TABA 3SV3A 1A5WA 1W9HA 3ZSRA 1C1AA 3CQ8A 1WN7A 3AVAA 3G10A 1IKVA 3WNHA 2XY6A 2FBVA 4KTZA 5I3UA 1C1CA 1KLNA 4FW1A 4CGJA 4CF9A 1IKWA 4OJRA 5KRTA 1N5YA 2DTUA 1O1WA 2Z1HA 2RKIA 2OPRA 3HPGA 4HTUA 3F9KA 1NK6A 1JLCA 3KLGA 3OYHA 1RBTA 1LAWA 3SUPA 3MXMA 2XY8A 1Z25A 1GOAA 1BGXT 3C6UA 3ZSZA 1T05A 1NKBA 3NF7A 3ZSWA 4OKKA 2W42A 3HO1A 4JRPA 1WSJA 4IFYA 2EHGA 4OKJA 3OYLA 3RMBA 3PY8A 4FJIA 4HHTA 1UOCA 3EZ5A 4DQPA 4F4KA 4FJGA 3V9XA 3JYTA 3KJVA 4DU4A 1EETA 2HNDA 1VSEA 2YNGA 1NOZA 2WONA 3HPOA 1HYSA 2IOCA 3OVNA 4CJSA 5HRSA 4FLVA 1Y97A 4CHYA 2PZSA 1ASUA 4FJHA 3OYMA 2O4GA 4CESA 1REVA 3SCXA 4K8XA 4FJMA 3A2FA 4CEOA 2B6AA 3DOLA 4Z0UA 4M3WA 4FJ8A 2F8SA 1L5UA 3LWMA 4C8OA 4CHZA 4KAZA 4DLEA 3PX0A 1A5VA 3HVTA 3SV4A 4F3TA 3LP3A 5J2PA 2Y1IA 4Z4GA 1WSIA 4PA1A 2ZD1A 4CIEA 4KHUA 2PYJA 2VG7A 3ZSOA 3PO5A 4FJ9A 3V81A 1ZBFA 2FC0A 1S1TA 3AVLA 3ZT0A 1DTQA 3SQ4A 1RTHA 1TK8A 3K5MA 3K5OA 1FKOA 3VQQA 1JLFA 1HQEA 3I8DA 3DI6A 3KTQA 2ATQA 3PV8A 1JXEA 1BIZA 1U48A 1QSYA 3QO9A 4CIGA 3L2WA 4CEQA 3NGYA 4DS4A 2AJQA 1LWFA 2Z1JA 3QEPA 1T03A 4HCCA 3T3FA 4WE1A 3VQPA 4CHNA 4LD0A 2HHWA 3AO3A 1TK0A 3DOKA 1SL0A 4M3ZA 4I9LA 2HHVA 1WSGA 1HRHA 4E19A 1FXXA 1QHTA 1RT1A 5JS2A 3OY9A 1XC9A 3PUFA 1NJYA 4F2RA 3S3OA 1VRTA 2KTQA 2YV0X 4DSEA 4DSLA 1QE1A 1RT6A 3VQ9A 1HPZA 4CCHA 3IRXA 5FRNA 4KRFA 4L8RB 3OYDA 3C95A 3MECA 4OGEA 4LSNA 3NH0A 3QIOA 3L2VA 4E1MA 1EP4A 4ID1A 3DLKA 3I0SA 4EZ9A 4RW7A 1UWBA 2G8WA 3T1AA 3KLFA 3QERA 1TKTA 1C0TA 1S1VA 3AO2A 4AHCA 3NGZA 1RDDA 1JKHA 3AA5X 4FLZA 1X9MA 2XO7A 5SZTA 1RT4A 2HNZA 1HNVA 3PO4A 2IDOA 4KO0A 4OPJA 4KB1A 3IG1A 1BCOA 3SUOA 5HRNA 3WNEA 3OYCA 1NK5A 4CJKA 2F96A 4CJEA 2OPQA 3CM5A 4CGDA 3P83D 1JLAA 4FJLA 4K8ZA 4BWMA 2HHUA 4CFBA 4B9LA 4KHQA 3AO1A 3LP0A 4E0DA 3U3YA 1UA1A 4FJKA 4DFKA 4PUOA 2YHBA 3NE6A 3TI0A 2G8IA 3QNNA 1ZYQA 3C94A 1HJRA 1RDCA 2E6LA 1JXBA 4FW2A 1JL1A 3OS0A 1IG9A 1VK0A 1ZBIA 2YKMA 3VQ4A 2HVHA 3AVMA 4R5PA 3TR8A 4CGGA 4DTPA 3UIQA 1ASWA 3NF6A 4FLXA 4FJ7A 3QINA 4CHPA 2XY7A 4CEBA 1JLBA 1L3SA 5HP1A 4FK4A 3DLBA 4B9MA 1TKXA 1B9FA 1WAFA 4CFAA 3OYEA 4FJXA 3MEEA 4KHSA 2HW3A 3O3FA 3M8RA 2G8FA 4YFUA 3K57A 4DFJA 5CYMA 4DTJA 3P1GA 4FJ5A 3QEXA 3QETA 1KFDA 2BANA 1RT5A 1MU2A 3KLEA 1C0UA 5KGWA 3L2UA 3TAGA 1X1PA 3HYFA 4M3TA 4DMNA 4E7HA 1RDAA 3SJJA 2RN2A 2FBTA 2IS3A 4H8KA 5KRSA 3OS1A 3L2QA 4B8AB 1CZBA 4CFDA 2HMIA 1KSPA 2BGGA 3MAQA 1GOBA 1U45A 3DRPA 4CEZA 2XY5A 2XRIA 3NAEA 1VSMA 4CJUA 1IO2A 1U4BA 4KI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PX6 A;  3AA3 A;  1BHL A;  3ZSQ A;  1TKZ A;  4KRE A;  3AA4 A;  2X6S A;  1ASV A;  2D0C A;  1NK9 A;  4E7L A;  3DMJ A;  5J2Q A;  3KKS A;  4CJQ A;  1S9E A;  1L3U A;  3OYB A;  4M3X A;  4DU3 A;  4PY5 A;  4RW8 A;  4GMJ B;  5CZ2 A;  1S1W A;  1NK8 A;  4Z4I A;  1XWL A;  1T7P A;  3B6P A;  4CK1 A;  1YVU A;  3ITH A;  3OYA A;  2IGI A;  2G8K A;  2YNH A;  2FBY A;  4KHY A;  3VQA A;  3SQ0 A;  2D0B A;  1RCH A;  3VQ7 A;  4IBN A;  3C6T A;  4DLG A;  4F2S A;  1WLJ A;  1BL3 A;  2KW4 A;  4B8C A;  3TAR A;  1BQN A;  1RTJ A;  5E41 A;  1D5A A;  4FCY A;  5CYQ A;  1NKC A;  2HHS A;  4Z4C A;  5KGX A;  1LAV A;  4DTO A;  4DQQ A;  1IH7 A;  3HT3 A;  3CFP A;  4NCG A;  2OPS A;  4H4O A;  3SPZ A;  5C25 A;  4B9N A;  4DQS A;  4N76 A;  4FZX C;  3VQ5 A;  3RR8 A;  4I2Q A;  1UAX A;  3BDP A;  4EP5 A;  1QSS A;  4CEE A;  3ZT2 A;  4J2D A;  1S9G A;  1VSD A;  3BGR A;  3G0Z A;  5EU7 A;  4CF1 A;  3SPY A;  4BDP A;  4FK2 A;  4KHW A;  1A5X A;  4ELV A;  4F3O A;  3QNO A;  1WAJ A;  3OYK A;  4CK2 A;  3OYI A;  3ULD A;  2BE2 A;  1KLM A;  3VQ6 A;  3KK2 A;  2YKN A;  4ZTF A;  4B9V A;  5FDL A;  4QOZ B;  3DRS A;  4DF4 A;  4GW6 A;  2OPP A;  4AHV A;  4DSK A;  1CLQ A;  1KCF A;  3TWH A;  4O44 A;  2LSN A;  5HBM A;  4FM0 A;  4C8L A;  1KTQ A;  4ZHR A;  1KVB A;  3KKR A;  2B5J A;  2E6M A;  3NF9 A;  1NOY A;  1KRP A;  4FZY A;  5CY4 A;  2Z1G A;  3HM9 A;  2R7Y A;  4BE1 A;  4DTU A;  1BI4 B;  3QES A;  2X6N A;  3OJU A;  1L3V A;  2ETJ A;  3WNF A;  4ELU A;  2ITG A;  4CE9 A;  4Z4F A;  3EYZ A;  4FLY A;  4O4G A;  3L8B A;  1EXQ A;  4CJT A;  1U04 A;  4CGF A;  4FVM A;  1DLO A;  3SYZ A;  4JLH A;  2YNI A;  1BCM A;  4AH9 A;  4N5S A;  1BQM A;  4DG1 A;  4E1N A;  3U3G A;  3V4I A;  4DSF A;  4CF0 A;  4CJ4 A;  4HUG A;  3TAN A;  3V6D A;  1RTD A;  4UQG A;  4DTS A;  1VSI A;  3P5J A;  4CJW A;  3VQ8 A;  5K14 A;  1X9W A;  1SL2 A;  2JLE A;  4Q0B A;  2DFE A;  4PWD A;  1RTI A;  2KQ2 A;  3LAM A;  4CEF A;  4DQI A;  1CXQ A;  3V9Z A;  3AVC A;  4HVJ A;  4M3Y A;  3H08 A;  5JS1 A;  1NJZ A;  4C8N A;  4KI4 A;  4FLW A;  5FRM A;  1HYZ A;  1I39 A;  4CEA A;  1IKX A;  4E89 A;  3AO4 A;  1U47 A;  3TAM A;  1HNI A;  4O0J A;  1S6P A;  1B9D A;  3V9S A;  1LWC A;  3NH2 A;  3LPU A;  3MEG A;  4NYF A;  4CED A;  2PY5 A;  4W5T A;  2P1J A;  3U6F A;  2OZS A;  1NJX A;  3AVI A;  2DFH A;  1UA0 A;  3QEV A;  4DWI A;  3IAY A;  2HHT A;  4W5R A;  3ZT4 A;  1J53 A;  2KFN A;  2X78 A;  3L3V A;  1QQC A;  4TSX A;  1JL2 A;  1SL1 A;  1R0A A;  4LY7 A;  3DLH A;  1GOC A;  4M3U A;  1J54 A;  5KI6 A;  3B6O A;  4DTR A;  3RMC A;  4B9T A;  3K2P A;  4E7K A;  3RRG A;  4M41 A;  3V1R A;  3D0P A;  4BE0 A;  4RW9 A;  4E7I A;  1B92 A;  1ZBU A;  3MED A;  1EX4 A;  4H4M A;  4LH4 A;  1TAU A;  3I0R A;  1Q9X A;  3NF8 A;  4Z4H A;  3HXM A;  1WSF A;  1WSH A;  4RW6 A;  3RWU A;  4J2E A;  3M8Q A;  3WNG A;  2A1S A;  4KHN A;  4QAG A;  4HCB A;  2VWJ A;  4CHO A;  5HRO A;  1SKR A;  2O4I A;  1FK9 A;  2P51 A;  1ITG A;  1U49 A;  4O0I A;  4O55 A;  2ZE2 A;  4N47 A;  1TK5 A;  4KPY A;  5HLF A;  1XI1 A;  2YHA A;  1BIS A;  1JLE A;  3KK3 A;  3F73 A;  3AO5 A;  1BI4 A;  4CJF A;  3K5L A;  4E7J A;  2EX3 A;  1FKP A;  3IS9 A;  4CF2 A;  4OPK A;  2D5R A;  2KZM A;  3THV A;  4MFB A;  3DLG A;  1QTM A;  1SKS A;  3RRH A;  1NK4 A;  4DTX A;  1I3A A;  5J2N A;  3MXI A;  3V1Q A;  3CFR A;  3M8S A;  3K58 A;  1Q9Y A;  4JRQ A;  1QSL A;  5HRR A;  4N56 A;  2IAJ A;  3HVR A;  1KVC A;  4M42 A;  3HST B;  3E01 A;  4XIU A;  1RIL A;  4OGC A;  4JS4 A;  1RBV A;  1HYV A;  1C6V A;  3LAN A;  2XHB A;  2YNF A;  3ALY A;  4B9S A;  3K59 A;  1YTU A;  1YT3 A;  3LAK A;  4IFV A;  5C24 A;  4W5Q A;  4FYD A;  2HVI A;  3VQE A;  2Z1I A;  4J2B A;  3ZT1 A;  3NFA A;  3S9H A;  2QK9 A;  3HJF A;  3DLR A;  3O4N A;  4B08 A;  3NH1 A;  3OJS A;  1TL3 A;  3OYF A;  4G1Q A;  4HUE A;  4OLB A;  1K6Y A;  3D45 A;  3KIO A;  4I7F A;  3VA3 A;  3FFI A;  4CK3 A;  4LH5 A;  4DFP A;  1LWE A;  1EKE A;  5I42 A;  4FXD A;  1S1U A;  3RMD A;  4EP4 A;  3SNN A;  4B9U A;  2OYQ A;  2X74 A;  2HHQ A;  2KZZ A;  3ASM A;  1F21 A;  4Q5V A;  3TAP A;  4DTN A;  1SKW A;  4W5N A;  1CXU A;  5KTQ A;  2IC3 A;  4IKF A;  3VQD A;  4DU1 A;  3DM2 A;  1WNS A;  4ICL A;  4CJL A;  5HRP A;  2VWK A;  2ZQB A;  3ZT3 A;  4CJV A;  2WOM A;  4DQR A;  1N6Q A;  3NBP A;  5FRO A;  4CJ5 A;  4M3R A;  3NDK A;  2VG5 A;  1TVR A;  1BIU A;  3ISN C;  4CER A;  1D9D A;  2RF2 A;  4KTQ A;  5J1E A;  3MXJ A;  4IG3 A;  4RW4 A;  4CJR A;  4BDY A;  3S3N A;  1T8E A;  4DFM A;  3NCI A;  2PYL A;  3V9U A;  4FJN A;  4JS5 A;  2G8H A;  3KD1 E;  4CGI A;  1W0H A;  1QS4 A;  1LV5 A;  4KKO A;  3EY1 A;  4ID5 A;  3ZSX A;  1J9A A;  2B4J A;  3OS2 A;  3DLE A;  3HK2 A;  4MQ3 A;  4EZ6 A;  4C8K A;  4FLU A;  4O5B A;  1RBU A;  2P5G A;  1YTA A;  4NYN A;  3HL8 A;  3JSM A;  3QIP A;  1RDB A;  4DSJ A;  4DF8 A;  1X9S A;  1RT2 A;  4CHQ A;  3LP2 A;  2Q3S A;  3CG7 A;  3TAQ A;  1RBS A;  4PQU A;  3LDS A;  2VG6 A;  4KV8 A;  3VQB A;  3AVN A;  1IKY A;  4AHU A;  2NUB A;  2OA8 A;  4CIF A;  2HB5 A;  1TV6 A;  1D9F A;  1DTT A;  1SV5 A;  2FBX A;  1RNH A;  3L2R A;  2E4L A;  4LSL A;  3HP6 A;  2GUI A;  4GVM A;  1VSF A;  1C0M A;  2RPI A;  3KLH A;  4DTM A;  2Y1J A;  3RR7 A;  4BDZ A;  2BDP A;  3LZI A;  3SQ2 A;  5C42 A;  3ZCM A;  5J2M A;  1S5J A;  1SUQ A;  3HP9 A;  3AVJ A;  3DRR A;  4CGH A;  4OKE A;  1TAQ A;  3LWL A;  1VRU A;  3AVK A;  1RT3 A;  3OYG A;  1NK0 A;  3RTV A;  4IDK A;  5T7B A;  3QEI A;  3V9W A;  4ELT A;  4W5O A;  1D8Y A;  3AVF A;  4AHR A;  1LW2 A;  2GV9 A;  3T19 A;  3PX4 A;  1Z26 A;  1TKD A;  2QKK A;  2F8T A;  4AIL C;  1JLG A;  2OZM A;  3V1O A;  3LAL A;  3NHG A;  3NGI A;  2P5O A;  2QXF A;  2QKB A;  1ZBH A;  1HQU A;  4DSI A;  2D0A A;  1XHX A;  3KLI A;  2HHX A;  3SZ2 A;  3O3H A;  3CM6 A;  3QLH A;  1TGO A;  4YNQ A;  5CZ1 A;  1KFS A;  4E3S A;  1RBR A;  4CFC A;  3SI6 A;  3TAE A;  3VA0 A;  1VSJ A;  2KFZ A;  2G8U A;  4OVL A;  5D3G A;  1G15 A;  4CJP A;  1L3T A;  3O3G A;  3CYM A;  1NKE A;  1KVA A;  3AVH A;  3AVB A;  4FZZ A;  3KD5 E;  4CF8 A;  4DS5 A;  2DY4 A;  3ZSV A;  4FJJ A;  1XHZ A;  3HPH A;  2I5J A;  3SQ1 A;  1CZ9 A;  4I2P A;  3LP1 A;  1NJW A;  3O4Q A;  4I9Q A;  1VSH A;  4ZTJ A;  3AVG A;  4BE2 A;  4Y1D A;  4Y1C A;  3AA2 A;  3KK1 A;  4M45 A;  2JGU A;  2A1R A;  3VQC A;  4BAC A;  1JLQ A;  1NK7 A;  3DYA A;  1S1X A;  3CFO A;  4AHS A;  3OYN A;  5SWM A;  4B3O A;  1C1B A;  3M8P A;  1WSE A;  4OLA A;  1RT7 A;  5DMR A;  3SUQ A;  1LW0 A;  3RMA A;  3QEW A;  2DFF A;  4FLT A;  3K5N A;  4IG0 A;  2GBZ A;  4HUF A;  4BWJ A;  4KFB A;  1VSL A;  1J5O A;  5DK5 A;  4N41 A;  3AV9 A;  4C8M A;  2G8V A;  1HMV A;  3ZSY A;  1ZBL A;  3LZJ A;  4AHT A;  4FM2 A;  3S3M A;  4F8R A;  4J2A A;  4FM1 A;  3VN5 A;  4FK0 A;  1Q8I A;  4NCA A;  4KTW A;  4QCL A;  1VSK A;  4Z4E A;  3LPT A;  3SUN A;  3L3U A;  1S6Q A;  4CEC A;  3TAF A;  4KB0 A;  4NCB A;  4RG8 A;  4CJ3 A;  2HNY A;  1TL1 A;  3OYJ A;  3TAB A;  3SV3 A;  1A5W A;  1W9H A;  3ZSR A;  1C1A A;  3CQ8 A;  1WN7 A;  3AVA A;  3G10 A;  1IKV A;  3WNH A;  2XY6 A;  2FBV A;  4KTZ A;  5I3U A;  1C1C A;  1KLN A;  4FW1 A;  4CGJ A;  4CF9 A;  1IKW A;  4OJR A;  5KRT A;  1N5Y A;  2DTU A;  1O1W A;  2Z1H A;  2RKI A;  2OPR A;  3HPG A;  4HTU A;  3F9K A;  1NK6 A;  1JLC A;  3KLG A;  3OYH A;  1RBT A;  1LAW A;  3SUP A;  3MXM A;  2XY8 A;  1Z25 A;  1GOA A;  1BGX T;  3C6U A;  3ZSZ A;  1T05 A;  1NKB A;  3NF7 A;  3ZSW A;  4OKK A;  2W42 A;  3HO1 A;  4JRP A;  1WSJ A;  4IFY A;  2EHG A;  4OKJ A;  3OYL A;  3RMB A;  3PY8 A;  4FJI A;  4HHT A;  1UOC A;  3EZ5 A;  4DQP A;  4F4K A;  4FJG A;  3V9X A;  3JYT A;  3KJV A;  4DU4 A;  1EET A;  2HND A;  1VSE A;  2YNG A;  1NOZ A;  2WON A;  3HPO A;  1HYS A;  2IOC A;  3OVN A;  4CJS A;  5HRS A;  4FLV A;  1Y97 A;  4CHY A;  2PZS A;  1ASU A;  4FJH A;  3OYM A;  2O4G A;  4CES A;  1REV A;  3SCX A;  4K8X A;  4FJM A;  3A2F A;  4CEO A;  2B6A A;  3DOL A;  4Z0U A;  4M3W A;  4FJ8 A;  2F8S A;  1L5U A;  3LWM A;  4C8O A;  4CHZ A;  4KAZ A;  4DLE A;  3PX0 A;  1A5V A;  3HVT A;  3SV4 A;  4F3T A;  3LP3 A;  5J2P A;  2Y1I A;  4Z4G A;  1WSI A;  4PA1 A;  2ZD1 A;  4CIE A;  4KHU A;  2PYJ A;  2VG7 A;  3ZSO A;  3PO5 A;  4FJ9 A;  3V81 A;  1ZBF A;  2FC0 A;  1S1T A;  3AVL A;  3ZT0 A;  1DTQ A;  3SQ4 A;  1RTH A;  1TK8 A;  3K5M A;  3K5O A;  1FKO A;  3VQQ A;  1JLF A;  1HQE A;  3I8D A;  3DI6 A;  3KTQ A;  2ATQ A;  3PV8 A;  1JXE A;  1BIZ A;  1U48 A;  1QSY A;  3QO9 A;  4CIG A;  3L2W A;  4CEQ A;  3NGY A;  4DS4 A;  2AJQ A;  1LWF A;  2Z1J A;  3QEP A;  1T03 A;  4HCC A;  3T3F A;  4WE1 A;  3VQP A;  4CHN A;  4LD0 A;  2HHW A;  3AO3 A;  1TK0 A;  3DOK A;  1SL0 A;  4M3Z A;  4I9L A;  2HHV A;  1WSG A;  1HRH A;  4E19 A;  1FXX A;  1QHT A;  1RT1 A;  5JS2 A;  3OY9 A;  1XC9 A;  3PUF A;  1NJY A;  4F2R A;  3S3O A;  1VRT A;  2KTQ A;  2YV0 X;  4DSE A;  4DSL A;  1QE1 A;  1RT6 A;  3VQ9 A;  1HPZ A;  4CCH A;  3IRX A;  5FRN A;  4KRF A;  4L8R B;  3OYD A;  3C95 A;  3MEC A;  4OGE A;  4LSN A;  3NH0 A;  3QIO A;  3L2V A;  4E1M A;  1EP4 A;  4ID1 A;  3DLK A;  3I0S A;  4EZ9 A;  4RW7 A;  1UWB A;  2G8W A;  3T1A A;  3KLF A;  3QER A;  1TKT A;  1C0T A;  1S1V A;  3AO2 A;  4AHC A;  3NGZ A;  1RDD A;  1JKH A;  3AA5 X;  4FLZ A;  1X9M A;  2XO7 A;  5SZT A;  1RT4 A;  2HNZ A;  1HNV A;  3PO4 A;  2IDO A;  4KO0 A;  4OPJ A;  4KB1 A;  3IG1 A;  1BCO A;  3SUO A;  5HRN A;  3WNE A;  3OYC A;  1NK5 A;  4CJK A;  2F96 A;  4CJE A;  2OPQ A;  3CM5 A;  4CGD A;  3P83 D;  1JLA A;  4FJL A;  4K8Z A;  4BWM A;  2HHU A;  4CFB A;  4B9L A;  4KHQ A;  3AO1 A;  3LP0 A;  4E0D A;  3U3Y A;  1UA1 A;  4FJK A;  4DFK A;  4PUO A;  2YHB A;  3NE6 A;  3TI0 A;  2G8I A;  3QNN A;  1ZYQ A;  3C94 A;  1HJR A;  1RDC A;  2E6L A;  1JXB A;  4FW2 A;  1JL1 A;  3OS0 A;  1IG9 A;  1VK0 A;  1ZBI A;  2YKM A;  3VQ4 A;  2HVH A;  3AVM A;  4R5P A;  3TR8 A;  4CGG A;  4DTP A;  3UIQ A;  1ASW A;  3NF6 A;  4FLX A;  4FJ7 A;  3QIN A;  4CHP A;  2XY7 A;  4CEB A;  1JLB A;  1L3S A;  5HP1 A;  4FK4 A;  3DLB A;  4B9M A;  1TKX A;  1B9F A;  1WAF A;  4CFA A;  3OYE A;  4FJX A;  3MEE A;  4KHS A;  2HW3 A;  3O3F A;  3M8R A;  2G8F A;  4YFU A;  3K57 A;  4DFJ A;  5CYM A;  4DTJ A;  3P1G A;  4FJ5 A;  3QEX A;  3QET A;  1KFD A;  2BAN A;  1RT5 A;  1MU2 A;  3KLE A;  1C0U A;  5KGW A;  3L2U A;  3TAG A;  1X1P A;  3HYF A;  4M3T A;  4DMN A;  4E7H A;  1RDA A;  3SJJ A;  2RN2 A;  2FBT A;  2IS3 A;  4H8K A;  5KRS A;  3OS1 A;  3L2Q A;  4B8A B;  1CZB A;  4CFD A;  2HMI A;  1KSP A;  2BGG A;  3MAQ A;  1GOB A;  1U45 A;  3DRP A;  4CEZ A;  2XY5 A;  2XRI A;  3NAE A;  1VSM A;  4CJU A;  1IO2 A;  1U4B A;  4KI6 A; 
#chains in the Genus database with same CATH topology
 4KRE A;  2I7N A;  3AA4 A;  3DMJ A;  1NNE A;  4H0Y B;  4M3X A;  3OYB A;  4DU3 A;  3ULE A;  4JKG B;  3GL1 A;  3A8Y A;  1XWL A;  2G8K A;  3C7N B;  2YNH A;  4YHH K;  4KHY A;  1YHQ N;  4DV6 K;  3SQ0 A;  2W6K A;  4DLG A;  4F2S A;  1WLJ A;  5AJ3 K;  5E41 A;  4FCY A;  1NKC A;  1NBW A;  3EN9 A;  5KGX A;  1LAV A;  4DTO A;  3HT3 A;  3O1W A;  1DKG D;  1HNW K;  4B9N A;  4DQS A;  4N76 A;  4FZX C;  4I2Q A;  3BEX A;  4EFH A;  3G0Z A;  3SPY A;  4FK2 A;  4JAX A;  1YIJ N;  3LDP A;  3VTH A;  4CI6 A;  4BC3 A;  3ULD A;  1H1V A;  4I6M B;  4DSK A;  3CJA A;  4OO1 J;  1NGB A;  4WFA L;  1KVB A;  3G6E N;  5C2F A;  4PL8 A;  5CY4 A;  5AQQ A;  2X6N A;  3PIP L;  2ETJ A;  3WNF A;  3J80 O;  3E9O A;  4O4G A;  4BRI A;  1EXQ A;  2QWN A;  4FVM A;  1IG8 A;  3P31 A;  5AQF A;  4JLH A;  3C65 A;  2P9L A;  4NLC A;  3V4I A;  4DSF A;  2P9K A;  4CF0 A;  4CJ4 A;  5GAD P;  2P9U B;  5TKY A;  4HUG A;  3CCL N;  3TAN A;  4UY8 O;  2IVN A;  1RTD A;  3THX A;  5K14 A;  4A2A A;  1SL2 A;  1RTI A;  5AQI A;  1NGI A;  3E9P A;  3LAM A;  4CEF A;  5C0Y A;  4M3Y A;  4FPB A;  4HVJ A;  1NJZ A;  4C8N A;  5FRM A;  5IT9 O;  3AO4 A;  3TAM A;  4O0J A;  1B9D A;  5HOO A;  4NYF A;  4KH5 A;  3VES A;  3AVI A;  1UA0 A;  2O8E A;  3ZT4 A;  3BY5 A;  4TSX A;  4DR5 K;  4LY7 A;  4A5A A;  3ID8 A;  1GOC A;  3QBX A;  3DLH A;  1T6C A;  2CGJ A;  1U2V B;  3B6O A;  3RMC A;  4B9T A;  4E7K A;  4BC5 A;  3M6G A;  1EX4 A;  2P9S B;  4WFB L;  4H5N A;  4JKC A;  2E2O A;  4Z4H A;  3HXM A;  1WSH A;  3M8Q A;  4JI4 K;  4QAG A;  1ILY A;  4IJA A;  4CHO A;  5HRO A;  1SKR A;  3SAG A;  4O55 A;  1Q82 O;  1BIS A;  4E7J A;  3AO5 A;  4BRA A;  1X9J A;  3WT0 A;  4CF2 A;  2KZM A;  2V7Z A;  4MFB A;  2BH1 A;  3A5O C;  4XH1 A;  1I3A A;  3MXI A;  4DV5 K;  5HRR A;  4N56 A;  3E01 A;  1RIL A;  3O9S A;  1RBV A;  1HYV A;  3LAN A;  2O8F B;  2YNF A;  3ALY A;  3JS6 A;  1JJ2 M;  1YTU A;  1JCF A;  4RWT A;  3D2E A;  5AQH A;  2Z1I A;  3NFA A;  1ZBS A;  2IVO A;  3O4N A;  3NH1 A;  3OYF A;  3KIO A;  2ZGY A;  4DFP A;  3O9U A;  4LH5 A;  4FXD A;  4BG8 A;  1S1U A;  3MMV A;  5MLC Q;  3ASM A;  1SKW A;  3LM2 A;  2IC3 A;  3VQD A;  4DU1 A;  3EO3 A;  1WNS A;  5HRP A;  2VWK A;  3ZT3 A;  4DQR A;  5FRO A;  4CJ5 A;  4KTQ A;  4CER A;  2A40 A;  4RW4 A;  2KZZ A;  4JS5 A;  4JKH A;  1LCU A;  4ID5 A;  1J9A A;  3DLE A;  4MQ3 A;  1ATR A;  4FL9 A;  4NYN A;  1BWF O;  1RDB A;  3QIC A;  2O8B A;  4PHT X;  1IKY A;  3CPE A;  2HB5 A;  5ADX A;  1D9F A;  1SV5 A;  1TYQ A;  3L2R A;  4IJN A;  4LSL A;  2GUI A;  1C0M A;  4BDZ A;  4IWV A;  4H03 B;  2O8E B;  3P39 A;  1HX1 A;  2ZGZ A;  4A59 A;  1VQP N;  3V9W A;  3AVF A;  4FPA A;  1KD1 O;  1TUY A;  4IOC L;  2F8T A;  3FZH A;  2O8C B;  3TSU A;  4BR2 A;  4B1V A;  4DSI A;  2D0A A;  3KLI A;  4ILJ A;  3SZ2 A;  1TGO A;  1YI2 N;  1RBR A;  3EE8 A;  4H0T B;  2E5L K;  1XNQ K;  2G8U A;  5D3G A;  3O3G A;  1KVA A;  4FZZ A;  1Y64 A;  3T1Y K;  2DY4 A;  3ZSV A;  2AA4 A;  4CZH A;  3RSE B;  3SQ1 A;  1CZ9 A;  4I2P A;  4BE2 A;  4JK7 A;  3G25 A;  4Y1C A;  2QA4 N;  2O8F A;  1JLQ A;  2RHK A;  3HTV A;  1S1X A;  3CFO A;  3OYN A;  4B3O A;  2NRX A;  3AAP A;  3SUQ A;  4IG0 A;  4N41 A;  4MDB A;  2G8V A;  1ZBL A;  2FF3 B;  3IUC A;  1NMN A;  3R1X A;  4GV3 A;  3CER A;  5AQW A;  1N36 K;  3O08 A;  1WB9 A;  4QCL A;  4ISE A;  2GEL A;  5FPN A;  3F5T A;  4CEC A;  3HSC A;  1RDW X;  2HNY A;  4RG8 A;  3OYJ A;  3ENO A;  3ZYY X;  3BUZ B;  4J8F A;  4PL7 A;  3C7N A;  3G71 N;  4QS7 A;  3ZET B;  2O8D B;  1KLN A;  4DB3 A;  3DAW A;  5KRT A;  1N5Y A;  1NK6 A;  3L4I A;  3OYH A;  1LAW A;  1KQS M;  2XY8 A;  5GAE P;  4XH5 A;  3C6U A;  4BRP A;  1T05 A;  1NKB A;  3ZSW A;  2W42 A;  4J2B A;  3RMB A;  3PY8 A;  1UOC A;  3EZ5 A;  4DQP A;  3KJV A;  3DXM A;  3MN6 A;  4K42 A;  2VQE K;  4DV2 K;  2YNG A;  2WON A;  3HPO A;  5HL7 L;  2IOC A;  1Y97 A;  4CHY A;  4M63 C;  4CES A;  1REV A;  4Z0U A;  1LOT B;  3WQU A;  1L5U A;  4C8O A;  2ZF5 O;  5AQU A;  4F3T A;  1RDU A;  2Y1I A;  4Z4G A;  1WSI A;  2WBN A;  4PA1 A;  2VG7 A;  1ZBF A;  1DTQ A;  3SQ4 A;  1TK8 A;  4DCH A;  4DKW A;  3AAQ A;  3VQQ A;  3I8D A;  1HQE A;  2ATQ A;  2YJE A;  1JXE A;  1BIZ A;  3U9D A;  3L2W A;  5CR4 A;  4CEQ A;  1LWF A;  2Z1J A;  4YOT A;  1T03 A;  3T3F A;  4CHN A;  2HHW A;  4LD0 A;  1EQY A;  1SL0 A;  2BUP A;  4M3Z A;  2HHV A;  3P4I A;  1JCG A;  1FXX A;  1NGC A;  1QHT A;  3OA9 A;  5JS2 A;  3OY9 A;  1XC9 A;  2KTQ A;  3QDK A;  4DSL A;  5AZI B;  3VQ9 A;  4JKE A;  3OYD A;  3PLA A;  4ID1 A;  4EZ9 A;  1UWB A;  3QER A;  1C0T A;  3AO2 A;  4DUY K;  1X9M A;  3AA5 X;  1SAZ A;  5SZT A;  4HTL A;  1HNV A;  3CCE N;  4KO0 A;  3WNE A;  4A57 A;  2F96 A;  4CJE A;  3P83 D;  1JLA A;  1HKC A;  2W40 A;  2UUC K;  4B9L A;  4A62 A;  2V7Y A;  4PUO A;  3QNN A;  3H3O B;  1HJR A;  2E6L A;  1NG9 A;  3UKU A;  1IBL K;  3SAF A;  2YKM A;  2HVH A;  4DTP A;  1FJG K;  2D1K A;  4BGB A;  3PIO L;  4FLX A;  3QIN A;  3VEV A;  4B9M A;  5CE3 A;  4CFA A;  3OYE A;  2HW3 A;  4KHS A;  2G8F A;  4B1Z A;  4YFU A;  3M5R A;  3SMS A;  3L6Q A;  2BAN A;  3KLE A;  1MU2 A;  3TAG A;  4DUZ K;  4H0V B;  2QWQ A;  4DHY A;  1OH8 A;  2RN2 A;  2IS3 A;  5KQD A;  4AQY K;  4JI1 K;  4FWL A;  3HM8 A;  4CFD A;  3FGU A;  1KSP A;  3MN7 A;  4JI0 K;  4V19 S;  1OH5 A;  1IO2 A;  4WF9 L;  4KI6 A;  1XMQ K;  3ZSQ A;  1BHL A;  2P9I B;  4YY3 K;  2X6S A;  1ASV A;  4E7L A;  5J2Q A;  1L3U A;  1S9E A;  1NM1 A;  3THX B;  3WXK A;  4GMJ B;  1NK8 A;  2D4W A;  3B6P A;  2IGI A;  3PSI A;  5M1F A;  2FBY A;  3DXM B;  3EKU A;  1RCH A;  4IBN A;  2GEM A;  4FWK A;  1RTJ A;  2HHS A;  3ATV A;  1NGG A;  4MLH A;  2GTD A;  4JEP A;  4H4O A;  3SPZ A;  3Q7B A;  4BRL A;  3BDP A;  1GLF O;  4CEE A;  1S9G A;  1VSD A;  4CF1 A;  5GIP A;  1YVN A;  3OHR A;  2P9N A;  1WAJ A;  4RCH A;  4CK2 A;  1QVF M;  2P9P A;  1IV0 A;  3VQ6 A;  3KK2 A;  3CJ7 A;  2YKN A;  2IIR A;  5FDL A;  3DRS A;  4GW6 A;  5JLF A;  4C8L A;  1KTQ A;  3KKR A;  3QFU A;  2O8C A;  1NOY A;  3NF9 A;  2Z1G A;  4KH6 A;  2R7Y A;  4BE1 A;  4DTU A;  1OVQ A;  1L3V A;  3C6A A;  4CE9 A;  4CJT A;  4BRD A;  4JYA K;  4CGF A;  4H0P A;  1GLA G;  5GIO A;  4FSV A;  1G99 A;  5C10 A;  1BCM A;  5AQM A;  4N5S A;  4WFN L;  4E1N A;  1S3X A;  2YCH A;  2NRZ A;  3P38 A;  3V6D A;  4UQG A;  4DTS A;  2E2N A;  1VSI A;  5FLX O;  4MO5 A;  1GLD G;  1X9W A;  3AGR A;  3TPQ A;  5LL6 Z;  4MO4 A;  5JS1 A;  4IFE A;  4K43 A;  4FLW A;  4X66 K;  3FE1 A;  4CEA A;  1IKX A;  4E89 A;  3MN5 A;  1LWC A;  3NH2 A;  5JLH A;  2PY5 A;  1XC3 A;  4CED A;  4W5T A;  4EHU A;  1R59 O;  5LJW A;  4DWI A;  4DR3 K;  3IAY A;  1BA1 A;  2X78 A;  3L3V A;  1J54 A;  1RGI A;  3ZX0 A;  2QEX N;  1B92 A;  3MED A;  4DR4 K;  2A41 A;  3G4S N;  3ZX3 A;  1Q9X A;  3CPW M;  3NF8 A;  2NZT A;  3WNG A;  3CXC M;  2P51 A;  1ITG A;  4CZI A;  1TK5 A;  4N47 A;  2Q36 A;  5AQV A;  2WC9 A;  3KK3 A;  1BI4 A;  2EX3 A;  1FKP A;  4OPK A;  2UUA K;  3QBW A;  1QTM A;  3RRH A;  5E26 A;  5J2N A;  3M8S A;  1VQ6 N;  1QSL A;  3HVR A;  4XIU A;  2GWJ A;  2HBM A;  1NU0 A;  4Z94 A;  1C6V A;  4B9S A;  3LAK A;  5C24 A;  4IFV A;  3VQE A;  3ZT1 A;  1VQ8 N;  2QK9 A;  4JD2 B;  3FR0 A;  5AQJ A;  1K6Y A;  5F2R A;  4B3T K;  1LWE A;  2HHQ A;  3SNN A;  2X74 A;  3TSQ A;  3TAP A;  4W5N A;  3O5B A;  1MWM A;  3CC4 N;  3DM2 A;  4ICL A;  4CJL A;  2ZQB A;  2P9K B;  4GVE A;  4CJV A;  3ZX2 A;  2VG5 A;  1GLE G;  5J1E A;  4IG3 A;  4JK9 A;  3FZK A;  3V9U A;  4IZ9 A;  4LF8 K;  3WXJ A;  4YOW A;  3EY1 A;  1QZ5 A;  3HK2 A;  4K25 A;  4C8K A;  1YTA A;  4DSJ A;  4BRC A;  1RT2 A;  1VQN N;  1KXP A;  3M1F A;  4KV8 A;  1TV6 A;  4LC9 B;  5DM6 L;  3QFP A;  1NGF A;  3HP6 A;  4JI3 K;  3RR7 A;  5FPE A;  4BC4 A;  3VF6 A;  3LZI A;  3SQ2 A;  5J2M A;  1S5J A;  5JVG L;  3LWL A;  3AVK A;  3KHY A;  1NK0 A;  4FWO A;  4IDK A;  3QEI A;  4ELT A;  2CGK A;  2YI1 A;  1JLG A;  3NGI A;  2P5O A;  4FWM A;  1HQU A;  2UXB K;  2HHX A;  1XMO K;  3U8X A;  5CZ1 A;  4CZG A;  3SI6 A;  4GKJ K;  4JN4 A;  2VYP A;  4O5F A;  2NRW A;  4CJP A;  1L3T A;  3CYM A;  3VMF B;  4BR5 A;  5LY3 A;  3AVH A;  5BN8 A;  4OPA A;  3KD5 E;  5KPT A;  3TTF A;  1XHZ A;  1WBB A;  4NLB A;  1HR0 K;  3U4L A;  1VSH A;  2RE2 A;  4Y1D A;  3VQC A;  1K8K A;  4FO0 A;  5DMR A;  3FZL A;  3QEW A;  3SLC A;  4KFB A;  1J5O A;  2VCP A;  3AV9 A;  4C8M A;  1HMV A;  4ILG B;  4JI7 K;  4AHT A;  2BTF A;  4J2A A;  2E8A A;  3VN5 A;  3GBT A;  1Q8I A;  4NCA A;  2QWM A;  4KTW A;  4Z4E A;  3L3U A;  4KB0 A;  4BGA A;  4CJ3 A;  3A5M C;  3TAB A;  1A5W A;  5AQN A;  2HMP A;  2AP1 A;  3ZSR A;  3CQ8 A;  1K8A O;  1NGE A;  4CGJ A;  4CF9 A;  1IKW A;  3BZC A;  4WQ5 C;  4X62 K;  1JLC A;  3T7Z A;  1RBT A;  3SUP A;  1Z25 A;  1GOA A;  1BGX T;  5GAG P;  4OKJ A;  2QKB A;  4FJI A;  4FJG A;  3CF5 L;  3V9X A;  4DU4 A;  1NOZ A;  3DXK A;  1HYS A;  1OH7 A;  4K0K K;  4CJS A;  5HRS A;  1ASU A;  3OYM A;  2O4G A;  3LDN A;  2QI2 A;  3A2F A;  4H5R A;  2F8S A;  1HJO A;  4CHZ A;  1XNR K;  2FXU A;  3HVT A;  3LP3 A;  5J2P A;  2FF6 A;  3CIP A;  3ZSO A;  3PO5 A;  4FJ9 A;  3JXU A;  2FC0 A;  3AVL A;  3CCV N;  3K5O A;  1HLU A;  4YOU A;  5EY4 A;  3J7A P;  4IOA L;  1QSY A;  4CIG A;  4H0O A;  4WYB A;  2VQF K;  2D0O A;  3CME N;  1VQM N;  5I9E B;  2QXL A;  5JIC A;  3K9K A;  4E19 A;  1E4G T;  3PUF A;  1NJY A;  3S3O A;  4JI5 K;  4FWS A;  5FRN A;  3EEQ A;  4L8R B;  3C95 A;  4OGE A;  4LSN A;  3QIO A;  2HBL A;  1EP4 A;  1O13 A;  3I0S A;  1NMD A;  3KLF A;  4BRF A;  3E1Y A;  4HWI A;  3NGZ A;  1RDD A;  3EL2 A;  2XO7 A;  3HOT A;  4O8K A;  1RT4 A;  2HNZ A;  5KQ8 A;  2IDO A;  2Q2R A;  2ZJP L;  1BG3 A;  3IG1 A;  1BCO A;  4IO8 A;  5HRN A;  1K8K B;  4LFB K;  4CGD A;  3CM5 A;  4JKB A;  4FJL A;  4QS9 A;  3ZET A;  1UA1 A;  4IEI A;  4JKD A;  3TI0 A;  1VQ4 N;  3OS0 A;  1ZBI A;  3HBT A;  3VQ4 A;  1HKB A;  3IMX A;  3UIQ A;  1HUX A;  3NF6 A;  1Q81 O;  4FJ7 A;  2ASP A;  4CEB A;  3CCR N;  1YJ9 N;  1L3S A;  4BVO A;  3DLB A;  1TKX A;  4DV1 K;  4I6M A;  4QS8 A;  4BRH A;  4DFJ A;  4C23 A;  3THY B;  3BP8 A;  1QZ6 A;  5LMN K;  3L2U A;  3LDL A;  1X1P A;  3DLL L;  3ZEU B;  1QQN A;  3SJJ A;  5AR0 A;  4GKK K;  5LJV A;  4CBW A;  3CCU N;  3MAQ A;  1GOB A;  3DRP A;  1GLB G;  2XY5 A;  4H5W A;  3GG4 A;  3CQX A;  3CCM N;  3KKS A;  4CJQ A;  4KBO A;  4PY5 A;  5M1K A;  5CZ2 A;  1S1W A;  5AQS A;  4Z4I A;  1ATN A;  4JI2 K;  4WQ5 A;  4CK1 A;  4M7Y A;  1YVU A;  3ITH A;  3OYA A;  5TKW A;  4O8U A;  3TSP A;  3VQA A;  2D0B A;  3ENH A;  3C6T A;  3MDQ A;  1ZC6 A;  2KW4 A;  4LF4 K;  1D5A A;  5CYQ A;  3O4W A;  2FLO A;  1IH7 A;  4NB4 A;  2OPS A;  3A5N C;  4AF1 A;  1BOT O;  3VQ5 A;  5AZI A;  1QSS A;  4H5T A;  3D2E B;  3HZ6 A;  2A42 A;  1A5X A;  3K9J A;  4ELV A;  2ASM A;  3QNO A;  4F3O A;  3OYK A;  3QML A;  2BE2 A;  1KLM A;  4IO9 L;  3VOV A;  4QOZ B;  3U9Z A;  1KCF A;  5M1N A;  4O44 A;  5HBM A;  4FM0 A;  4ZHR A;  3WEE B;  2GUP A;  2W6L A;  1KRP A;  3VGL A;  4FZY A;  2QW9 A;  2GX9 A;  3QES A;  3OJU A;  1C0G A;  4ELU A;  2ITG A;  1YJW N;  3M3Z A;  4FLY A;  3L8B A;  2J4R A;  3FZF A;  4LF5 K;  4FWQ A;  4GNI A;  1DLO A;  2YNI A;  1MA9 B;  1M90 O;  4DG1 A;  1GLL O;  3U3G A;  4CD1 A;  2CGL A;  2ZJQ L;  3P5J A;  3R9P A;  3VQ8 A;  4CJW A;  3WUH A;  4LF6 K;  2JLE A;  5AZJ B;  2VGN A;  2ITM A;  3V9Z A;  3H08 A;  4KI4 A;  3I33 A;  4XEI A;  1I39 A;  3J8A A;  4OX9 K;  1HNI A;  1S6P A;  1EO1 A;  3OTO K;  4GV6 A;  3U6F A;  2OZS A;  2DFH A;  2HHT A;  4W5R A;  5ELZ A;  1QQC A;  4LFA K;  4B3M K;  1JL2 A;  4DR2 K;  1R0A A;  4U67 L;  4CJ7 A;  3K2P A;  3RRG A;  4M41 A;  3D0P A;  2O8B B;  4NO7 A;  4LH4 A;  1TAU A;  3I0R A;  4B9Q A;  1WSF A;  4RW6 A;  3RWU A;  1VQO N;  2A1S A;  4KHN A;  2O4I A;  4HCB A;  2VWJ A;  1FK9 A;  4XH4 A;  2ZE2 A;  3AY9 A;  4KPY A;  1YAG A;  1QVG M;  5GAH P;  1XI1 A;  2HBK A;  4CJF A;  3CJ1 A;  2WUS A;  4X65 K;  2D5R A;  3DLG A;  3SMP A;  4CZJ A;  1SKS A;  3VTI A;  2P9P B;  3V1Q A;  3CFR A;  1Q9Y A;  1MWK A;  2P9L B;  3WQT A;  3J81 O;  4JS4 A;  1TYQ B;  2W41 A;  2XHB A;  4BR0 A;  4CBX A;  3K59 A;  2CH6 A;  2F7T A;  5JMV A;  3S9H A;  2I7P A;  4WQ4 A;  3OJS A;  1TL3 A;  1P90 A;  4HUE A;  1J6Z A;  3VA3 A;  1EKE A;  5I42 A;  3RMD A;  4EP4 A;  2OYQ A;  2UYT A;  4EIA A;  4Q5V A;  5FPM A;  3VEZ A;  1CXU A;  4YDU A;  5AQP A;  2YX6 A;  3RVC A;  3J7Z O;  3NDK A;  1BIU A;  4BDY A;  4CJR A;  4KH4 A;  1T8E A;  2PYL A;  3NCI A;  4L3Q A;  3TTD A;  3RSE A;  4JKG A;  4B3R K;  1QS4 A;  5C2D A;  1LV5 A;  1W2B M;  3ZSX A;  2B4J A;  5CHI A;  1RBU A;  3CC2 N;  2P5G A;  2QWR A;  5AFU H;  1X9S A;  3SK3 A;  4IXC A;  4JK8 A;  3LP2 A;  3VGM A;  3CG7 A;  1RBS A;  2UUB K;  3LDS A;  3VQB A;  4AHU A;  2NUB A;  4BRE A;  4CIF A;  3LDQ A;  2FBX A;  3CCQ N;  3CCJ N;  1NGJ A;  1U2V A;  4CBU A;  3VEO A;  2YJF A;  2A3Z A;  4GVM A;  3KLH A;  3TU5 A;  2BDP A;  5C42 A;  1SUQ A;  3HP9 A;  3DRR A;  1TAQ A;  3OYG A;  3IKM A;  3RTV A;  4EHT A;  5DM7 L;  4W5O A;  1D8Y A;  1LW2 A;  2GV9 A;  3T19 A;  1Z26 A;  1TKD A;  2OZM A;  2Q0R A;  3V1O A;  3NHG A;  1NGH A;  1HNX K;  4BG9 A;  1ZBH A;  1XHX A;  1ZXO A;  3O1B A;  4BRN A;  1NWK A;  3SJH A;  1YUW A;  2WTU A;  4E3S A;  3TAE A;  1VSJ A;  1G15 A;  1GLC G;  3VEX A;  4KHP K;  4M7X A;  4DS5 A;  3GE1 A;  4FVU A;  3ATU A;  3CC7 N;  2I5J A;  1VHX A;  3LP1 A;  3VGK A;  4ZTJ A;  1D4X A;  4BQL A;  3KK1 A;  2NRR A;  4BAC A;  1QQO A;  1YJN N;  4C1N K;  4CZE A;  3DYA A;  4OLA A;  5SWM A;  3C0B A;  1WSE A;  2HBJ A;  1RT7 A;  4E1J A;  4BWJ A;  1GLJ O;  5DK5 A;  1XUP O;  1HPM A;  3O6W A;  3ZSY A;  3LZJ A;  3S3M A;  4FM2 A;  2A5X A;  3NVK A;  1N34 K;  1VSK A;  2NRT A;  1S6Q A;  3O80 A;  1TL1 A;  4IDH A;  1W9H A;  3Q7C A;  3VER A;  1WN7 A;  2Q1N A;  3AVA A;  1IKV A;  3G10 A;  3WNH A;  2FBV A;  5AFU A;  4JI6 K;  5AQZ A;  4B3S K;  2RKI A;  2OPR A;  3HPG A;  2A6A A;  2DPN A;  4CW7 B;  3KLG A;  3A5L C;  3ZSZ A;  2CH5 A;  3NF7 A;  3HO1 A;  4JRP A;  4IFY A;  4HHT A;  1VAZ A;  4F4K A;  2JWL A;  3JYT A;  2QWL A;  3D7E O;  3ENB A;  1HNZ K;  1EET A;  2HND A;  1VSE A;  4FOI A;  5JVH L;  3OVN A;  3S41 A;  2OTJ N;  4Y0W A;  4PKI A;  3R6M A;  4FJH A;  4K8X A;  4FJM A;  2E1Y A;  1P8Z A;  4CEO A;  2B6A A;  4H0X B;  5EX5 A;  4FJ8 A;  2PBD A;  3T69 A;  3LWM A;  3IFR A;  4KAZ A;  1QHA A;  3PX0 A;  1A5V A;  3SV4 A;  5EOY A;  4DV3 K;  3SBG A;  4KHU A;  2UXD K;  2HOE A;  1YIT N;  1S1T A;  3HOS A;  2ZM6 K;  3ULE B;  4JKA A;  4CZL A;  3PV8 A;  1U48 A;  1IBK K;  3QO9 A;  3NGY A;  4DS4 A;  2AJQ A;  3OBY A;  5BRH A;  4HCC A;  4WE1 A;  1E3M A;  3THY A;  3D2F B;  1NGA A;  3AO3 A;  3WXL A;  4WQ4 C;  4MLE A;  1TK0 A;  3DOK A;  5BRE A;  1S22 A;  4BRO A;  1WSG A;  1HRH A;  3BZK A;  4CZM A;  4F2R A;  4YDU C;  2YV0 X;  4DSE A;  1IBM K;  1QE1 A;  1RT6 A;  4CCH A;  1HPZ A;  3B8A X;  3IRX A;  3H46 O;  3JAM O;  2VGM A;  1JCE A;  1EWR A;  3MEC A;  5BPL A;  3NH0 A;  1KAZ A;  4E1M A;  4DR7 K;  3H45 C;  2PAV A;  3GDQ A;  4RW7 A;  1SQK A;  2G8W A;  4JI8 K;  1TKT A;  3O9T A;  4AHC A;  4JKF A;  4FLZ A;  3PO4 A;  4GY2 B;  4OPH A;  1WBD A;  4OPJ A;  3SUO A;  3FLC O;  4FWR A;  1BA0 A;  3OYC A;  4CJK A;  4CVN E;  3H1V X;  4K8Z A;  3H3N O;  2GWK A;  2E1Z A;  4KHQ A;  3AO1 A;  3LP0 A;  3U3Y A;  4FJK A;  5AZJ A;  4DFK A;  2YHB A;  3NE6 A;  1RDC A;  1JXB A;  4FW2 A;  1JL1 A;  1VK0 A;  4R5P A;  3TR8 A;  4CGG A;  4BY9 C;  1ASW A;  2XY7 A;  2P9U A;  5HP1 A;  1B9F A;  3GOI A;  1Z6R A;  1C0F A;  1WAF A;  2NLX A;  4FJX A;  2KHO A;  3O3F A;  5M1P A;  3I8B A;  1NLV A;  5CYM A;  1X3M A;  3NVM A;  3QEX A;  3QET A;  1KFD A;  1W97 L;  2QM1 A;  3F2K A;  5KGW A;  5KPR A;  4IEE A;  1M1K O;  3HYF A;  4DMN A;  4E7H A;  1RDA A;  1ATS A;  4DV4 K;  4H8K A;  2P9N B;  2YHW A;  3MN9 A;  5KRS A;  1KAX A;  4B8A B;  3L2Q A;  2HMI A;  2BGG A;  3NAE A;  1EWQ A;  2ASO A;  3R3L A;  4JHD A;  3PX6 A;  3AA3 A;  5M1O A;  1TKZ A;  2D0C A;  1NK9 A;  2QWP A;  5AQK A;  1Q86 O;  4RW8 A;  3KWG A;  5AQL A;  1K73 O;  1OH6 A;  3NMU A;  2D0P A;  1T7P A;  3D2F A;  3R8E A;  5B8H A;  1RFQ A;  3VQ7 A;  5M1Q A;  1OVY A;  1BL3 A;  4B8C A;  3TAR A;  1BQN A;  4LF7 K;  2JWK A;  4AM6 A;  4Z4C A;  4DQQ A;  3CFP A;  4NCG A;  4B1Y B;  5C25 A;  1XQS C;  2KKZ A;  3RR8 A;  1UAX A;  4EP5 A;  4BRG A;  3ZT2 A;  4J2D A;  1NJI O;  3BGR A;  5EU7 A;  4BDP A;  4KHW A;  3OYI A;  3MX2 A;  4B9V A;  4ZTF A;  3FZM A;  1T3V A;  4DF4 A;  2OPP A;  4AHV A;  2E2P A;  4X64 K;  3VEN A;  2HHH K;  4GV9 A;  3TWH A;  1CLQ A;  2LSN A;  3THW A;  2B5J A;  2E6M A;  3H1Q A;  1NGD A;  3MWT A;  3HM9 A;  1BI4 B;  1E4F T;  3UKR A;  4Z4F A;  2Q97 A;  4LFC K;  3EYZ A;  3E66 A;  3UB5 A;  4U7B A;  1U04 A;  3N4Q A;  3HRG A;  5AQG A;  3SYZ A;  3WXM B;  4AH9 A;  3T1H K;  3FFK B;  1BQM A;  3ID6 A;  4YOR A;  4EAH D;  1VQ9 N;  3UE5 A;  2PFU A;  4JV5 K;  4DV0 K;  3CJC A;  2YHY A;  4Q0B A;  2DFE A;  3EZW A;  3CD6 N;  4PWD A;  2KQ2 A;  4DQI A;  4BQZ A;  1CXQ A;  4ISG A;  3AVC A;  1I94 K;  1HYZ A;  5AQT A;  1U47 A;  3V9S A;  1DEJ A;  5H1S Q;  3LPU A;  3MEG A;  2NRV A;  2P1J A;  1NJX A;  3QEV A;  1J53 A;  2KFN A;  3W3D A;  1SS6 A;  1SL1 A;  4JHD B;  3MCP A;  4RTF D;  4M3U A;  4C1N I;  5KI6 A;  4DTR A;  3E9L A;  4YOX A;  3V1R A;  4PKG A;  4BE0 A;  4RW9 A;  4K41 A;  5BRF A;  4E7I A;  1ZBU A;  3QB0 A;  4H4M A;  4LF9 K;  1Z05 A;  2E20 A;  3BF1 A;  4J2E A;  4DR6 K;  3EKS A;  1U49 A;  4O0I A;  3O9R A;  2V52 B;  2NRH A;  5AQO A;  3OW2 M;  5HLF A;  2YHA A;  1JLE A;  3F73 A;  3K5L A;  1KAY A;  3K0S A;  3IS9 A;  5FPD A;  3THV A;  1BO5 O;  3C6H A;  1NK4 A;  4DTX A;  2NNW A;  3N4P A;  2FSJ A;  3K58 A;  4JRQ A;  2IAJ A;  1KVC A;  5BR8 K;  4M42 A;  1FW6 A;  3HST B;  1YXQ A;  4CZF A;  4OGC A;  1ESV A;  4FYD A;  2HF4 A;  1YT3 A;  4W5Q A;  4BR9 A;  2WFB A;  2HVI A;  3CCS N;  2UU9 K;  3HJF A;  3DLR A;  4B08 A;  1U6Z A;  4OLB A;  4G1Q A;  3D45 A;  4I7F A;  2ZJR L;  3FFI A;  4CK3 A;  3WEE A;  4B9U A;  5F1X A;  1F21 A;  4DTN A;  4BR7 A;  2F9W A;  5EVZ A;  5KTQ A;  4IKF A;  2ZWH A;  3VF2 A;  3KVG A;  1N6Q A;  2WOM A;  2FSN A;  2UXC K;  3NBP A;  4M3R A;  3CMA N;  1TVR A;  4BRQ A;  3ISN C;  1D9D A;  2RF2 A;  3LM9 A;  1TUU A;  3MXJ A;  4FJN A;  3S3N A;  4B1U B;  4DFM A;  3W0L A;  2G8H A;  3KD1 E;  4CGI A;  1W0H A;  4PKH A;  3CET A;  3ZLJ A;  4KKO A;  4A2B A;  3L0Q A;  1VQK N;  3OS2 A;  3VF4 A;  4EZ6 A;  4FLU A;  4ILH A;  4O5B A;  1DGK N;  3HL8 A;  3QIP A;  3JSM A;  4DF8 A;  1Q18 A;  4CHQ A;  3KZB A;  2Q3S A;  3TAQ A;  4PQU A;  2VG6 A;  5C15 A;  3AVN A;  2OA8 A;  1DTT A;  3CJB A;  1VQ7 N;  1RNH A;  5A2Q O;  2E4L A;  1VSF A;  2RPI A;  4DTM A;  5F0X A;  3KK7 A;  3I55 N;  5IWA K;  2Y1J A;  3A0I X;  2EWS A;  3O9Q A;  3ZCM A;  5C12 A;  4CGH A;  3AVJ A;  3F9M A;  4OKE A;  2E88 A;  1VRU A;  1QQM A;  5AQR A;  1RT3 A;  1S72 N;  4F9O A;  5T7B A;  4AHR A;  2KLA A;  3PX4 A;  2Q31 A;  2QKK A;  4AIL C;  3LAL A;  3OBW A;  3MCA B;  2QXF A;  3J7Y P;  3EE9 A;  4JD2 A;  4IOX A;  2F9T A;  2QTD A;  3O3H A;  3CM6 A;  3QLH A;  4YNQ A;  4CD3 A;  1KFS A;  4CFC A;  3VEY A;  4AM7 A;  3VA0 A;  1DT9 A;  2KFZ A;  4OVL A;  1N32 K;  1NKE A;  3AVB A;  2FSK A;  2P9S A;  3DJC A;  5GIN A;  4CF8 A;  4FJJ A;  3HPH A;  1NJW A;  3MX5 A;  3O4Q A;  4I9Q A;  3VPZ A;  3AVG A;  1HKG A;  3AA2 A;  4M45 A;  1MDU B;  2JGU A;  2A1R A;  1NK7 A;  1N8R O;  4AHS A;  1V4S A;  1C1B A;  3M8P A;  4DR1 K;  1LW0 A;  3RMA A;  2DFF A;  4FLT A;  3K5N A;  2GBZ A;  4HUF A;  1VSL A;  4F8R A;  4DQ8 A;  4JNE A;  4FM1 A;  4BRK A;  4A61 A;  4FK0 A;  3TTC A;  3LPT A;  3SUN A;  3TAF A;  4ISF A;  4NCB A;  3PSF A;  3SV3 A;  4BVP A;  2HF3 A;  1K9M O;  1C1A A;  4BR4 A;  2XY6 A;  3UKU B;  4KTZ A;  5I3U A;  1C1C A;  1YF5 L;  4FW1 A;  4OJR A;  5AQY A;  4DV7 K;  2DTU A;  1O1W A;  2Z1H A;  4HTU A;  3L4Q A;  4H5V A;  3F9K A;  5KPZ A;  1W7A A;  3MXM A;  5EXW A;  4CZK A;  4OKK A;  1WSJ A;  2EHG A;  3OYL A;  3LL3 A;  4FOE A;  3VEW A;  1BDG A;  4FLV A;  2PZS A;  3SCX A;  1T44 A;  3SBT A;  4M3W A;  3DOL A;  3BF3 A;  3DWL A;  4A5B A;  3THW B;  4DLE A;  2V51 B;  4WCE L;  1BUP A;  2ZD1 A;  4CIE A;  4YOV A;  2PYJ A;  1N33 K;  3V81 A;  3ZEU A;  3ZT0 A;  4G9Z A;  1SZ2 A;  1RTH A;  3CHW A;  3H6E A;  3K5M A;  1J5E K;  1FKO A;  1JLF A;  3KTQ A;  3DI6 A;  5BN9 A;  2O8D A;  5LMU K;  3QEP A;  4NXM K;  4MDA A;  3VQP A;  2P9I A;  4FWP A;  4BC2 A;  1IJJ A;  3AGK A;  4I9L A;  3KWI A;  1RT1 A;  2H3G X;  2VWB A;  3WXI A;  3CI5 A;  1VRT A;  1WOQ A;  3MK6 A;  4KRF A;  1VQ5 N;  5ADX H;  5BPM A;  3L2V A;  3DLK A;  4R79 A;  4FWN A;  3T1A A;  1S1V A;  3AAR A;  3IDH A;  1JKH A;  4BRM A;  1X3N A;  4KB1 A;  3DXK B;  1NK5 A;  5BPN A;  2OPQ A;  4B1W B;  2E2Q A;  4BWM A;  2HHU A;  3MWP A;  4CFB A;  2F4V K;  4E0D A;  3D6R A;  2G8I A;  1ZYQ A;  3C94 A;  2QWO A;  1WUA A;  2OAN A;  2IVP A;  1IG9 A;  3AVM A;  1BU6 O;  2OCE A;  1CZA N;  2HST A;  4CHP A;  1JLB A;  4YOY A;  4B1X B;  4FK4 A;  2Q0U A;  3CQY A;  3HI0 A;  1T6D A;  3MEE A;  3CJ9 A;  3M8R A;  3VET A;  3K57 A;  1V4T A;  4DTJ A;  3P1G A;  5BR9 A;  4FJ5 A;  2YHX A;  3LDO A;  5E84 A;  1OKJ A;  1RT5 A;  3I56 N;  1C0U A;  5AQX A;  4M3T A;  5BRD A;  4NXN K;  3UKR B;  2FBT A;  1Q7Y O;  1KC8 O;  3SAH A;  3OS1 A;  1CZB A;  3O8M A;  1U45 A;  4CEZ A;  2OTL N;  2XRI A;  1VQL N;  1VSM A;  4CJU A;  1U4B A; 
#chains in the Genus database with same CATH homology
 3PX6 A;  3AA3 A;  1BHL A;  3ZSQ A;  1TKZ A;  4KRE A;  3AA4 A;  2X6S A;  1ASV A;  2D0C A;  1NK9 A;  4E7L A;  3DMJ A;  5J2Q A;  3KKS A;  4CJQ A;  1S9E A;  1L3U A;  3OYB A;  4M3X A;  4DU3 A;  4PY5 A;  4RW8 A;  4GMJ B;  5CZ2 A;  1S1W A;  1NK8 A;  4Z4I A;  1XWL A;  1T7P A;  3B6P A;  4CK1 A;  1YVU A;  3ITH A;  3OYA A;  2IGI A;  2G8K A;  2YNH A;  2FBY A;  4KHY A;  3VQA A;  3SQ0 A;  2D0B A;  1RCH A;  3VQ7 A;  4IBN A;  3C6T A;  4DLG A;  4F2S A;  1WLJ A;  1BL3 A;  2KW4 A;  4B8C A;  3TAR A;  1BQN A;  1RTJ A;  5E41 A;  1D5A A;  4FCY A;  5CYQ A;  1NKC A;  2HHS A;  4Z4C A;  5KGX A;  1LAV A;  4DTO A;  4DQQ A;  1IH7 A;  3HT3 A;  3CFP A;  4NCG A;  2OPS A;  4H4O A;  3SPZ A;  5C25 A;  4B9N A;  4DQS A;  4N76 A;  4FZX C;  3VQ5 A;  3RR8 A;  4I2Q A;  1UAX A;  3BDP A;  4EP5 A;  1QSS A;  4CEE A;  3ZT2 A;  4J2D A;  1S9G A;  1VSD A;  3BGR A;  3G0Z A;  5EU7 A;  4CF1 A;  3SPY A;  4BDP A;  4FK2 A;  4KHW A;  1A5X A;  4ELV A;  4F3O A;  3QNO A;  1WAJ A;  3OYK A;  4CK2 A;  3OYI A;  3ULD A;  2BE2 A;  1KLM A;  3VQ6 A;  3KK2 A;  2YKN A;  4ZTF A;  4B9V A;  5FDL A;  4QOZ B;  3DRS A;  4DF4 A;  4GW6 A;  2OPP A;  4AHV A;  4DSK A;  1CLQ A;  1KCF A;  3TWH A;  4O44 A;  2LSN A;  5HBM A;  4FM0 A;  4C8L A;  1KTQ A;  4ZHR A;  1KVB A;  3KKR A;  2B5J A;  2E6M A;  3NF9 A;  1NOY A;  1KRP A;  4FZY A;  5CY4 A;  2Z1G A;  3HM9 A;  2R7Y A;  4BE1 A;  4DTU A;  1BI4 B;  3QES A;  2X6N A;  3OJU A;  1L3V A;  2ETJ A;  3WNF A;  4ELU A;  2ITG A;  4CE9 A;  4Z4F A;  3EYZ A;  4FLY A;  4O4G A;  3L8B A;  1EXQ A;  4CJT A;  1U04 A;  4CGF A;  4FVM A;  1DLO A;  3SYZ A;  4JLH A;  2YNI A;  1BCM A;  4AH9 A;  4N5S A;  1BQM A;  4DG1 A;  4E1N A;  3U3G A;  3V4I A;  4DSF A;  4CF0 A;  4CJ4 A;  4HUG A;  3TAN A;  3V6D A;  1RTD A;  4UQG A;  4DTS A;  1VSI A;  3P5J A;  4CJW A;  3VQ8 A;  5K14 A;  1X9W A;  1SL2 A;  2JLE A;  4Q0B A;  2DFE A;  4PWD A;  1RTI A;  2KQ2 A;  3LAM A;  4CEF A;  4DQI A;  1CXQ A;  3V9Z A;  3AVC A;  4HVJ A;  4M3Y A;  3H08 A;  5JS1 A;  1NJZ A;  4C8N A;  4KI4 A;  4FLW A;  5FRM A;  1HYZ A;  1I39 A;  4CEA A;  1IKX A;  4E89 A;  3AO4 A;  1U47 A;  3TAM A;  1HNI A;  4O0J A;  1S6P A;  1B9D A;  3V9S A;  1LWC A;  3NH2 A;  3LPU A;  3MEG A;  4NYF A;  4CED A;  2PY5 A;  4W5T A;  2P1J A;  3U6F A;  2OZS A;  1NJX A;  3AVI A;  2DFH A;  1UA0 A;  3QEV A;  4DWI A;  3IAY A;  2HHT A;  4W5R A;  3ZT4 A;  1J53 A;  2KFN A;  2X78 A;  3L3V A;  1QQC A;  4TSX A;  1JL2 A;  1SL1 A;  1R0A A;  4LY7 A;  3DLH A;  1GOC A;  4M3U A;  1J54 A;  5KI6 A;  3B6O A;  4DTR A;  3RMC A;  4B9T A;  3K2P A;  4E7K A;  3RRG A;  4M41 A;  3V1R A;  3D0P A;  4BE0 A;  4RW9 A;  4E7I A;  1B92 A;  1ZBU A;  3MED A;  1EX4 A;  4H4M A;  4LH4 A;  1TAU A;  3I0R A;  1Q9X A;  3NF8 A;  4Z4H A;  3HXM A;  1WSF A;  1WSH A;  4RW6 A;  3RWU A;  4J2E A;  3M8Q A;  3WNG A;  2A1S A;  4KHN A;  4QAG A;  4HCB A;  2VWJ A;  4CHO A;  5HRO A;  1SKR A;  2O4I A;  1FK9 A;  2P51 A;  1ITG A;  1U49 A;  4O0I A;  4O55 A;  2ZE2 A;  4N47 A;  1TK5 A;  4KPY A;  5HLF A;  1XI1 A;  2YHA A;  1BIS A;  1JLE A;  3KK3 A;  3F73 A;  3AO5 A;  1BI4 A;  4CJF A;  3K5L A;  4E7J A;  2EX3 A;  1FKP A;  3IS9 A;  4CF2 A;  4OPK A;  2D5R A;  2KZM A;  3THV A;  4MFB A;  3DLG A;  1QTM A;  1SKS A;  3RRH A;  1NK4 A;  4DTX A;  1I3A A;  5J2N A;  3MXI A;  3V1Q A;  3CFR A;  3M8S A;  3K58 A;  1Q9Y A;  4JRQ A;  1QSL A;  5HRR A;  4N56 A;  2IAJ A;  3HVR A;  1KVC A;  4M42 A;  3HST B;  3E01 A;  4XIU A;  1RIL A;  4OGC A;  4JS4 A;  1RBV A;  1HYV A;  1C6V A;  3LAN A;  2XHB A;  2YNF A;  3ALY A;  4B9S A;  3K59 A;  1YTU A;  1YT3 A;  3LAK A;  4IFV A;  5C24 A;  4W5Q A;  4FYD A;  2HVI A;  3VQE A;  2Z1I A;  4J2B A;  3ZT1 A;  3NFA A;  3S9H A;  2QK9 A;  3HJF A;  3DLR A;  3O4N A;  4B08 A;  3NH1 A;  3OJS A;  1TL3 A;  3OYF A;  4G1Q A;  4HUE A;  4OLB A;  1K6Y A;  3D45 A;  3KIO A;  4I7F A;  3VA3 A;  3FFI A;  4CK3 A;  4LH5 A;  4DFP A;  1LWE A;  1EKE A;  5I42 A;  4FXD A;  1S1U A;  3RMD A;  4EP4 A;  3SNN A;  4B9U A;  2OYQ A;  2X74 A;  2HHQ A;  2KZZ A;  3ASM A;  1F21 A;  4Q5V A;  3TAP A;  4DTN A;  1SKW A;  4W5N A;  1CXU A;  5KTQ A;  2IC3 A;  4IKF A;  3VQD A;  4DU1 A;  3DM2 A;  1WNS A;  4ICL A;  4CJL A;  5HRP A;  2VWK A;  2ZQB A;  3ZT3 A;  4CJV A;  2WOM A;  4DQR A;  1N6Q A;  3NBP A;  5FRO A;  4CJ5 A;  4M3R A;  3NDK A;  2VG5 A;  1TVR A;  1BIU A;  3ISN C;  4CER A;  1D9D A;  2RF2 A;  4KTQ A;  5J1E A;  3MXJ A;  4IG3 A;  4RW4 A;  4CJR A;  4BDY A;  3S3N A;  1T8E A;  4DFM A;  3NCI A;  2PYL A;  3V9U A;  4FJN A;  4JS5 A;  2G8H A;  3KD1 E;  4CGI A;  1W0H A;  1QS4 A;  1LV5 A;  4KKO A;  3EY1 A;  4ID5 A;  3ZSX A;  1J9A A;  2B4J A;  3OS2 A;  3DLE A;  3HK2 A;  4MQ3 A;  4EZ6 A;  4C8K A;  4FLU A;  4O5B A;  1RBU A;  2P5G A;  1YTA A;  4NYN A;  3HL8 A;  3JSM A;  3QIP A;  1RDB A;  4DSJ A;  4DF8 A;  1X9S A;  1RT2 A;  4CHQ A;  3LP2 A;  2Q3S A;  3CG7 A;  3TAQ A;  1RBS A;  4PQU A;  3LDS A;  2VG6 A;  4KV8 A;  3VQB A;  3AVN A;  1IKY A;  4AHU A;  2NUB A;  2OA8 A;  4CIF A;  2HB5 A;  1TV6 A;  1D9F A;  1DTT A;  1SV5 A;  2FBX A;  1RNH A;  3L2R A;  2E4L A;  4LSL A;  3HP6 A;  2GUI A;  4GVM A;  1VSF A;  1C0M A;  2RPI A;  3KLH A;  4DTM A;  2Y1J A;  3RR7 A;  4BDZ A;  2BDP A;  3LZI A;  3SQ2 A;  5C42 A;  3ZCM A;  5J2M A;  1S5J A;  1SUQ A;  3HP9 A;  3AVJ A;  3DRR A;  4CGH A;  4OKE A;  1TAQ A;  3LWL A;  1VRU A;  3AVK A;  1RT3 A;  3OYG A;  1NK0 A;  3RTV A;  4IDK A;  5T7B A;  3QEI A;  3V9W A;  4ELT A;  4W5O A;  1D8Y A;  3AVF A;  4AHR A;  1LW2 A;  2GV9 A;  3T19 A;  3PX4 A;  1Z26 A;  1TKD A;  2QKK A;  2F8T A;  4AIL C;  1JLG A;  2OZM A;  3V1O A;  3LAL A;  3NHG A;  3NGI A;  2P5O A;  2QXF A;  2QKB A;  1ZBH A;  1HQU A;  4DSI A;  2D0A A;  1XHX A;  3KLI A;  2HHX A;  3SZ2 A;  3O3H A;  3CM6 A;  3QLH A;  1TGO A;  4YNQ A;  5CZ1 A;  1KFS A;  4E3S A;  1RBR A;  4CFC A;  3SI6 A;  3TAE A;  3VA0 A;  1VSJ A;  2KFZ A;  2G8U A;  4OVL A;  5D3G A;  1G15 A;  4CJP A;  1L3T A;  3O3G A;  3CYM A;  1NKE A;  1KVA A;  3AVH A;  3AVB A;  4FZZ A;  3KD5 E;  4CF8 A;  4DS5 A;  2DY4 A;  3ZSV A;  4FJJ A;  1XHZ A;  3HPH A;  2I5J A;  3SQ1 A;  1CZ9 A;  4I2P A;  3LP1 A;  1NJW A;  3O4Q A;  4I9Q A;  1VSH A;  4ZTJ A;  3AVG A;  4BE2 A;  4Y1D A;  4Y1C A;  3AA2 A;  3KK1 A;  4M45 A;  2JGU A;  2A1R A;  3VQC A;  4BAC A;  1JLQ A;  1NK7 A;  3DYA A;  1S1X A;  3CFO A;  4AHS A;  3OYN A;  5SWM A;  4B3O A;  1C1B A;  3M8P A;  1WSE A;  4OLA A;  1RT7 A;  5DMR A;  3SUQ A;  1LW0 A;  3RMA A;  3QEW A;  2DFF A;  4FLT A;  3K5N A;  4IG0 A;  2GBZ A;  4HUF A;  4BWJ A;  4KFB A;  1VSL A;  1J5O A;  5DK5 A;  4N41 A;  3AV9 A;  4C8M A;  2G8V A;  1HMV A;  3ZSY A;  1ZBL A;  3LZJ A;  4AHT A;  4FM2 A;  3S3M A;  4F8R A;  4J2A A;  4FM1 A;  3VN5 A;  4FK0 A;  1Q8I A;  4NCA A;  4KTW A;  4QCL A;  1VSK A;  4Z4E A;  3LPT A;  3SUN A;  3L3U A;  1S6Q A;  4CEC A;  3TAF A;  4KB0 A;  4NCB A;  4RG8 A;  4CJ3 A;  2HNY A;  1TL1 A;  3OYJ A;  3TAB A;  3SV3 A;  1A5W A;  1W9H A;  3ZSR A;  1C1A A;  3CQ8 A;  1WN7 A;  3AVA A;  3G10 A;  1IKV A;  3WNH A;  2XY6 A;  2FBV A;  4KTZ A;  5I3U A;  1C1C A;  1KLN A;  4FW1 A;  4CGJ A;  4CF9 A;  1IKW A;  4OJR A;  5KRT A;  1N5Y A;  2DTU A;  1O1W A;  2Z1H A;  2RKI A;  2OPR A;  3HPG A;  4HTU A;  3F9K A;  1NK6 A;  1JLC A;  3KLG A;  3OYH A;  1RBT A;  1LAW A;  3SUP A;  3MXM A;  2XY8 A;  1Z25 A;  1GOA A;  1BGX T;  3C6U A;  3ZSZ A;  1T05 A;  1NKB A;  3NF7 A;  3ZSW A;  4OKK A;  2W42 A;  3HO1 A;  4JRP A;  1WSJ A;  4IFY A;  2EHG A;  4OKJ A;  3OYL A;  3RMB A;  3PY8 A;  4FJI A;  4HHT A;  1UOC A;  3EZ5 A;  4DQP A;  4F4K A;  4FJG A;  3V9X A;  3JYT A;  3KJV A;  4DU4 A;  1EET A;  2HND A;  1VSE A;  2YNG A;  1NOZ A;  2WON A;  3HPO A;  1HYS A;  2IOC A;  3OVN A;  4CJS A;  5HRS A;  4FLV A;  1Y97 A;  4CHY A;  2PZS A;  1ASU A;  4FJH A;  3OYM A;  2O4G A;  4CES A;  1REV A;  3SCX A;  4K8X A;  4FJM A;  3A2F A;  4CEO A;  2B6A A;  3DOL A;  4Z0U A;  4M3W A;  4FJ8 A;  2F8S A;  1L5U A;  3LWM A;  4C8O A;  4CHZ A;  4KAZ A;  4DLE A;  3PX0 A;  1A5V A;  3HVT A;  3SV4 A;  4F3T A;  3LP3 A;  5J2P A;  2Y1I A;  4Z4G A;  1WSI A;  4PA1 A;  2ZD1 A;  4CIE A;  4KHU A;  2PYJ A;  2VG7 A;  3ZSO A;  3PO5 A;  4FJ9 A;  3V81 A;  1ZBF A;  2FC0 A;  1S1T A;  3AVL A;  3ZT0 A;  1DTQ A;  3SQ4 A;  1RTH A;  1TK8 A;  3K5M A;  3K5O A;  1FKO A;  3VQQ A;  1JLF A;  1HQE A;  3I8D A;  3DI6 A;  3KTQ A;  2ATQ A;  3PV8 A;  1JXE A;  1BIZ A;  1U48 A;  1QSY A;  3QO9 A;  4CIG A;  3L2W A;  4CEQ A;  3NGY A;  4DS4 A;  2AJQ A;  1LWF A;  2Z1J A;  3QEP A;  1T03 A;  4HCC A;  3T3F A;  4WE1 A;  3VQP A;  4CHN A;  4LD0 A;  2HHW A;  3AO3 A;  1TK0 A;  3DOK A;  1SL0 A;  4M3Z A;  4I9L A;  2HHV A;  1WSG A;  1HRH A;  4E19 A;  1FXX A;  1QHT A;  1RT1 A;  5JS2 A;  3OY9 A;  1XC9 A;  3PUF A;  1NJY A;  4F2R A;  3S3O A;  1VRT A;  2KTQ A;  2YV0 X;  4DSE A;  4DSL A;  1QE1 A;  1RT6 A;  3VQ9 A;  1HPZ A;  4CCH A;  3IRX A;  5FRN A;  4KRF A;  4L8R B;  3OYD A;  3C95 A;  3MEC A;  4OGE A;  4LSN A;  3NH0 A;  3QIO A;  3L2V A;  4E1M A;  1EP4 A;  4ID1 A;  3DLK A;  3I0S A;  4EZ9 A;  4RW7 A;  1UWB A;  2G8W A;  3T1A A;  3KLF A;  3QER A;  1TKT A;  1C0T A;  1S1V A;  3AO2 A;  4AHC A;  3NGZ A;  1RDD A;  1JKH A;  3AA5 X;  4FLZ A;  1X9M A;  2XO7 A;  5SZT A;  1RT4 A;  2HNZ A;  1HNV A;  3PO4 A;  2IDO A;  4KO0 A;  4OPJ A;  4KB1 A;  3IG1 A;  1BCO A;  3SUO A;  5HRN A;  3WNE A;  3OYC A;  1NK5 A;  4CJK A;  2F96 A;  4CJE A;  2OPQ A;  3CM5 A;  4CGD A;  3P83 D;  1JLA A;  4FJL A;  4K8Z A;  4BWM A;  2HHU A;  4CFB A;  4B9L A;  4KHQ A;  3AO1 A;  3LP0 A;  4E0D A;  3U3Y A;  1UA1 A;  4FJK A;  4DFK A;  4PUO A;  2YHB A;  3NE6 A;  3TI0 A;  2G8I A;  3QNN A;  1ZYQ A;  3C94 A;  1HJR A;  1RDC A;  2E6L A;  1JXB A;  4FW2 A;  1JL1 A;  3OS0 A;  1IG9 A;  1VK0 A;  1ZBI A;  2YKM A;  3VQ4 A;  2HVH A;  3AVM A;  4R5P A;  3TR8 A;  4CGG A;  4DTP A;  3UIQ A;  1ASW A;  3NF6 A;  4FLX A;  4FJ7 A;  3QIN A;  4CHP A;  2XY7 A;  4CEB A;  1JLB A;  1L3S A;  5HP1 A;  4FK4 A;  3DLB A;  4B9M A;  1TKX A;  1B9F A;  1WAF A;  4CFA A;  3OYE A;  4FJX A;  3MEE A;  4KHS A;  2HW3 A;  3O3F A;  3M8R A;  2G8F A;  4YFU A;  3K57 A;  4DFJ A;  5CYM A;  4DTJ A;  3P1G A;  4FJ5 A;  3QEX A;  3QET A;  1KFD A;  2BAN A;  1RT5 A;  1MU2 A;  3KLE A;  1C0U A;  5KGW A;  3L2U A;  3TAG A;  1X1P A;  3HYF A;  4M3T A;  4DMN A;  4E7H A;  1RDA A;  3SJJ A;  2RN2 A;  2FBT A;  2IS3 A;  4H8K A;  5KRS A;  3OS1 A;  3L2Q A;  4B8A B;  1CZB A;  4CFD A;  2HMI A;  1KSP A;  2BGG A;  3MAQ A;  1GOB A;  1U45 A;  3DRP A;  4CEZ A;  2XY5 A;  2XRI A;  3NAE A;  1VSM A;  4CJU A;  1IO2 A;  1U4B A;  4KI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...