2VQFK

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2vqfK00
4JYAK 4CVNE 4DR6K 4B3MK 4JI4K 4LFCK 4KHPK 4LF6K 2UXCK 1XNQK 3T1YK 3T1HK 4JI8K 4LF9K 4B3SK 4LF5K 4DR4K 4DV1K 4DV4K 1N34K 4YHHK 4JI1K 1HNWK 4AQYK 4DUZK 2ZM6K 4LF4K 2UUAK 4DV7K 4X64K 5FLXO 4B3RK 4JI0K 4YY3K 4DV6K 1J5EK 2UXDK 5BR8K 2UUBK 4JV5K 4JI3K 4JI6K 1XMOK 4DR7K 2VQEK 4DV0K 4V19S 4OX9K 2UUCK 5IT9O 4JI2K 1HR0K 1IBMK 1N36K 2VQFK 1XMQK 4DV5K 4JI5K 5AJ3K 4JI7K 4K0KK 5LMNK 4B3TK 5LMUK 1N33K 3J81O 1FJGK 1I94K 1IBLK 2UU9K 4NXNK 4LF8K 3OTOK 2HHHK 4GKKK 3J7YP 4LFAK 1HNZK 3J7AP 4DR5K 4DR1K 4GKJK 4LFBK 4DV2K 4DUYK 4X65K 4X66K 4NXMK 5A2QO 4LF7K 1N32K 2F4VK 3JAMO 1XNRK 5IWAK 2UXBK 4DV3K 4DR3K 2E5LK 1HNXK 4CW7B 3J80O 4X62K 1IBKK 5LL6Z 4DR2K
chains in the Genus database with same CATH superfamily
1WAJA 3AO4A 3LM2A 1TL3A 1DT9A 3NH2A 1K9MO 4C8NA 4BRCA 4Y1DA 3GOIA 1ZBHA 5SZTA 3L2UA 3DXKB 4JKFA 2HVHA 3R8EA 1D4XA 4Z0UA 1WUAA 3QNOA 3HOTA 4BQLA 4DSEA 5HL7L 3IDHA 4LF4K 4CZIA 2BH1A 3OYFA 2Q31A 4Q0BA 4FYDA 3AVKA 2YNGA 4DMNA 3DRSA 5GAEP 2KLAA 3KKSA 4JKBA 4J2BA 3UIQA 1KFDA 1RTDA 3TR8A 5EX5A 4DCHA 4A59A 3D2FB 3CI5A 3KIOA 4CE9A 2VQFK 3UE5A 4FLZA 4RWTA 4AHSA 4MDAA 1HUXA 2P9PB 2D0BA 3QEIA 1NMDA 4EP5A 5AQHA 4E1MA 4PWDA 1L3SA 4CZGA 3H3NO 4KBOA 4CJLA 4C8KA 4CZFA 4M3TA 4NB4A 3TAPA 4Z94A 5JICA 4U7BA 4KHSA 4FZXC 3SNNA 4OKEA 2QI2A 5A2QO 3D6RA 1BU6O 4CHZA 4Z4EA 5C0YA 4CZLA 5AZIB 3B6OA 1WSJA 4B08A 4WFNL 4FJGA 1C1BA 4FZYA 1VSMA 1XC3A 5T7BA 3EZWA 3K9JA 3EZ5A 1T7PA 2HHXA 1HKBA 3MEEA 4QAGA 3M3ZA 3VEOA 1BISA 4MLEA 2YNHA 2PYJA 2P9LA 1S1XA 4DQ8A 2HOEA 2Z1HA 4DV4K 1DLOA 3CYMA 2QWQA 3AVCA 1DTTA 4IO8A 1WN7A 3LZJA 4FLYA 4EP4A 3V9WA 4DUZK 4J2EA 3MCPA 3HI0A 4CEAA 1BG3A 3ATVA 5J2NA 1J6ZA 2HNYA 4CBXA 3TARA 4UQGA 1ATRA 4BDYA 5AQLA 4CHPA 5FLXO 3OYLA 3GG4A 1RT1A 4CF8A 3WXKA 4DV6K 4GVMA 3EL2A 4I7FA 4JI6K 2HMPA 3T19A 3QINA 1S3XA 4DV0K 4MFBA 4F2RA 3DLLL 5AZJB 3ZYYX 1RTIA 3LDLA 3L3VA 4PY5A 3O4WA 3AA5X 3MECA 3NFAA 2HF3A 5BRDA 4GV9A 2QWMA 5M1KA 4B3TK 3ALYA 3TTCA 1FJGK 3ZSZA 2KFZA 3DXMA 2YKMA 3VTHA 2QXLA 1ESVA 5TKWA 4DHYA 1RTHA 4CJ5A 4WQ5C 4B9VA 3MK6A 2ASPA 3MEGA 2HHTA 3MWPA 1VQ7N 3ZT3A 4C8MA 3F2KA 3IFRA 4HTUA 1A5VA 1RT5A 4E1NA 1TKXA 3E9PA 3ULEA 3M8PA 5FPEA 1KLMA 1QSYA 3VF4A 3LWLA 1H1VA 2FXUA 3CCQN 2HB5A 1MA9B 4DF8A 1C0FA 2ZGZA 3VA3A 4YOUA 4A62A 5H1SQ 5CYMA 1OKJA 3U9ZA 1OVQA 2IS3A 5C24A 3G25A 1JXBA 3OBWA 1VSJA 4W5TA 4NLCA 1N5YA 2V7ZA 4CJTA 3BF3A 3PX6A 4CJFA 3T1HK 5GIPA 3T1AA 3VENA 4DR4K 4F3OA 2W40A 4IEIA 4Z4CA 3VQBA 2PFUA 5I9EB 4YOYA 4HCBA 1G15A 4RG8A 4ICLA 1FXXA 1WSFA 1X9JA 3F9MA 5C2DA 1NK0A 4KB0A 1NJZA 3ZSXA 2QKKA 1HNVA 2F7TA 4BGBA 1J5EK 4CI6A 2QWNA 1YAGA 1NJWA 2IIRA 3AO1A 4FWOA 5I42A 1NK8A 3BDPA 4KRFA 3VQ4A 4FCYA 4EHTA 3PSFA 3DLKA 2VGMA 1BO5O 2A41A 4FWPA 1GLFO 4KHNA 4Y1CA 4L3QA 4DTXA 2PYLA 1HQUA 4JK8A 3O4NA 3WT0A 3B6PA 3CQYA 3WXMB 2V52B 5KGWA 3TWHA 2HNDA 2OPSA 3I8DA 4FK2A 2P9LB 3D2EA 3BEXA 3AGRA 3S3NA 3V81A 4B9SA 3O9RA 1T6CA 1HKCA 3VEWA 4B9QA 3L2VA 4CJEA 1VQ9N 2WUSA 3A2FA 3QO9A 2HBMA 5E41A 4C1NK 5AQXA 4PQUA 1JXEA 4W5NA 3C6AA 1CZ9A 2Q2RA 1REVA 4B1VA 3ENHA 4RCHA 2V51B 2FF6A 3U8XA 3CJBA 2P1JA 5TKYA 3VQAA 5IWAK 4CHOA 2A3ZA 4C8LA 3M5RA 2CH5A 4K8ZA 3A5MC 4FWQA 4H4MA 4BVOA 1EKEA 2G8KA 4BRNA 3NGIA 2DFFA 3SQ1A 3CM5A 4F3TA 2F9WA 4FK4A 3EE9A 2P5OA 3ENOA 2QWLA 3LP2A 4ILGB 3I0RA 5KQ8A 3NCIA 1VQON 4CJUA 1RBVA 3O1WA 1U47A 2HSTA 1LCUA 3LAMA 4I9QA 4ZTFA 1RDDA 1XC9A 2Q36A 4CEEA 3OY9A 4PL7A 4BRHA 3CHWA 2ZM6K 3VQEA 1JL2A 4AHUA 3LDQA 3CC4N 3VPZA 1P8ZA 3BY5A 3V1QA 3RMDA 5EXWA 4CCHA 1WSGA 3WXIA 4JKAA 3AY9A 4WFBL 3NH1A 4CK2A 3ULEB 4JI3K 5HRRA 2RE2A 4ELUA 3OS2A 1VSHA 2CGJA 4G9ZA 1L3VA 3OYDA 4BRDA 3E66A 3ZT2A 4A57A 5ADXA 2E2OA 1IKYA 1VSFA 4K0KK 3LP0A 3Q7BA 2YHYA 1S9EA 1IKWA 1DEJA 4A61A 4BACA 3OYNA 4DTUA 5AR0A 1L3TA 1RT6A 4DS4A 1KD1O 4PKHA 4IFEA 2FBVA 3FZMA 4LSNA 2OA8A 4ELTA 2O4GA 3AVBA 4CHNA 1TK5A 2ZWHA 4FJMA 4DR5K 1NJIO 4IJNA 3OYEA 3VA0A 2B5JA 4GW6A 4MDBA 3PX0A 4O5BA 3L2QA 1C0TA 2DFEA 4DFKA 3ZEUB 5CY4A 2EWSA 3JYTA 4CK3A 1T3VA 5BR9A 1TK0A 4KHYA 3MAQA 1LW0A 2Q3SA 3O9UA 3SUNA 2A40A 1X9WA 4I2QA 3SCXA 4IBNA 1XHXA 3KKRA 4KTWA 2V7YA 2G8FA 2JLEA 1D9FA 2YNFA 4IOAL 1WLJA 5EY4A 1EWRA 5GADP 4XH1A 4CJ7A 3L6QA 2CH6A 3DI6A 4CJWA 2NRRA 4CVNE 3WNFA 2O8EA 2A1SA 4OPHA 4BR4A 1RDWX 2GELA 1KAYA 2ZGYA 4JD2B 4DU1A 1C1CA 5HRPA 3K9KA 4H4OA 3IG1A 3T1YK 3P38A 4H5VA 4CEQA 1NK9A 4QS9A 4LH4A 4WQ4A 2G8UA 1RT7A 4E1JA 3OYIA 1VQLN 4F2SA 4NCBA 4XEIA 3D2EB 2OZMA 3ID6A 3Q7CA 5FPDA 5BN9A 1XWLA 3TU5A 2FBYA 3AVJA 1GLEG 1U48A 2KZZA 3HL8A 1KCFA 4OPKA 3V9SA 3RR8A 4RW7A 2P9UA 2QWRA 1Q7YO 4DSLA 4JI0K 1UAXA 4WCEL 1B9DA 4YY3K 4DFMA 4G1QA 2PBDA 2YJEA 4K25A 3RVCA 3N4QA 4CBUA 1U4BA 1RT4A 2BGGA 3AVNA 1KAXA 4F8RA 1NK7A 4O8KA 3HT3A 1SKRA 4JKHA 4FJ7A 4LD0A 4W5QA 2ZJPL 5GAHP 4E89A 3A5NC 1E3MA 5AQJA 1HQEA 5AJ3K 3ZSOA 1S1UA 4OLAA 3VERA 3THWA 3ZT0A 1NGEA 3CQ8A 3RRHA 2O8CA 3CCUN 3VQCA 1N33K 4O4GA 3KLEA 3NMUA 2Y1JA 4CGGA 3QICA 4AM6A 5I3UA 2E4LA 1VQMN 2A5XA 4BRKA 1Z6RA 3CM6A 2ZJRL 1ZC6A 1NKEA 2ASOA 4E0DA 4AM7A 2NZTA 4AHRA 3VGLA 4WQ4C 4N47A 1YVUA 2FSNA 1ZBFA 1GLBG 4BRAA 3MN7A 3OJSA 2A1RA 3L3UA 2D5RA 1RDBA 3SUPA 3PLAA 2XY8A 3BZCA 3VGMA 3CCSN 4BE2A 1NK5A 4R5PA 3MX2A 2E20A 4X62K 4BR7A 3JSMA 1WOQA 3D45A 2D0PA 2OTLN 3WNEA 2D0AA 1KSPA 1SL0A 3T3FA 3WUHA 1SKWA 2GTDA 1WB9A 3AVHA 1N34K 4DS5A 3CPWM 1BCOA 1YF5L 1A5XA 3ZSQA 3PO4A 3MXIA 1NGAA 3OS1A 4I6MB 4YOWA 1GLDG 1RCHA 4DV7K 1VK0A 4IKFA 3QBXA 5C25A 3QNNA 3DMJA 5SWMA 2A6AA 3MMVA 4Z4GA 2NLXA 2P9NA 1XMOK 1YHQN 2ZF5O 4CJPA 3VEVA 4KHQA 3BZKA 1O1WA 3C6UA 3LWMA 1N36K 3K57A 4XH5A 3MN9A 4M7XA 2BANA 3VQPA 4DTRA 4JI7K 3OYMA 4J2DA 2GX9A 1YIJN 2O8EB 1CLQA 1E4GT 4B1WB 1OH5A 4CJVA 2HHSA 2KTQA 4YDUA 3K5NA 3HVTA 3IAYA 3THYA 3OTOK 4DFPA 3QEXA 1DKGD 4YOXA 5KPTA 1NGJA 3J7AP 2W6LA 3A0IX 4GKJK 3N4PA 2FLOA 2QWPA 4J2AA 1ZXOA 1GOBA 3FZFA 2IGIA 1TKZA 1QVFM 2F4VK 3HJFA 1BA0A 1IV0A 4FJHA 4MO4A 2P9UB 3HVRA 4FLWA 5GAGP 4JKEA 3U6FA 3CCMN 3TI0A 2IAJA 3KLIA 5FRNA 4FJLA 3ATUA 1WNSA 1RBSA 4CZHA 5LL6Z 3SPZA 5HRNA 1QE1A 2F96A 2YKNA 5AQQA 2W41A 2E2PA 4U67L 2WOMA 1LAWA 4ID1A 2O8BA 3DAWA 3KD5E 4KHPK 3NVMA 1ASUA 1TK8A 2UXCK 3FR0A 1VSEA 4FJXA 4FJ5A 3NDKA 2OYQA 4BQZA 2IVPA 5AQMA 4FM0A 3SV3A 4O55A 2DTUA 4CZKA 3ISNC 4YHHK 3IS9A 3EY1A 4CFBA 1VRUA 2O8DA 4FO0A 4M45A 3SQ4A 2UUAK 4H5RA 3ID8A 1S72N 4WQ5A 3SLCA 4DTSA 1QSSA 4YDUC 4DSJA 2Q0RA 5CZ1A 1HYSA 3U3YA 5BR8K 4FJIA 1IH7A 4DWIA 5BRFA 2A42A 2QK9A 3KK1A 5JS2A 4KHUA 4Q5VA 3D0PA 4IO9L 3L2WA 3RMCA 2YHAA 4FJ8A 3V9ZA 3SJHA 3QDKA 3UKUA 2F8TA 2DY4A 5BRHA 3LP3A 4N76A 4PHTX 2I7PA 1EP4A 5BPMA 5KTQA 1S5JA 4N5SA 3VGKA 1N8RO 4KKOA 2KFNA 3AGKA 2D1KA 3L0QA 4KPYA 1HYZA 3CQXA 3I56N 2NRZA 1I94K 4BR2A 4CZMA 3CCRN 1YI2N 4RW8A 3O1BA 1JLAA 3IKMA 3FZHA 4BC3A 3WXJA 3SUOA 4FWMA 4H0PA 2VYPA 1SV5A 3O9TA 3S3OA 1HYVA 1CZAN 2P9KA 4NXMK 3KTQA 3KK3A 4E7LA 1N32K 1IG8A 3WQTA 4BREA 1BUPA 4FPBA 4BY9C 2VWBA 3TPQA 1RDCA 3CFRA 2ZQBA 3BUZB 4M3XA 3G71N 4E7KA 4CZEA 4KH4A 5AQSA 1SKSA 5F2RA 1BDGA 2GUIA 2P9NB 3J80O 5F1XA 1WBDA 2VCPA 2YHXA 4JN4A 4C1NI 3WQUA 3V1OA 2EX3A 1JCEA 2VGNA 3SUQA 3ULDA 1OH6A 4CHQA 3AVLA 3LL3A 4BE0A 3W3DA 5C15A 3E1YA 4KI4A 2F9TA 1RDUA 4BG8A 1K6YA 1ASVA 3ZX3A 2QW9A 3THYB 3IRXA 4Z4HA 3QBWA 1WSEA 4H8KA 4CF0A 1IKXA 4CK1A 1SL1A 2B4JA 1K73O 4CGDA 3ZX2A 3U3GA 3TSUA 1NWKA 5C2FA 3LPUA 4LY7A 2VQEK 3E01A 2E1YA 2VG5A 4FLXA 1SS6A 3KZBA 1BQMA 1RBUA 3AA3A 3B8AX 4JI2K 2YI1A 1NGBA 1S6PA 2JWLA 3HM9A 1HLUA 4DV5K 4IOXA 4IWVA 4BVPA 2F8SA 4JNEA 4DLEA 3OYAA 3E9LA 3KK2A 2O8BB 5LMUK 4FPAA 3CFOA 1LOTB 1HPMA 2EHGA 4BE1A 3CCLN 4RTFD 4GKKK 5CR4A 3QIOA 3PX4A 3CC2N 3NGYA 2HNZA 4B9TA 4HUGA 3EEQA 4DUYK 2O8DB 4HWIA 4GNIA 1VSLA 1XHZA 2KKZA 2O8FA 3TAEA 4CF9A 4GV3A 3O08A 4FLVA 1IG9A 4DQIA 1DTQA 3ZSWA 4A2BA 3J7ZO 3WEEA 4DV3K 5CZ2A 2E5LK 3CJ1A 1FKPA 4XIUA 1BL3A 2E2QA 4FJKA 1I3AA 5AQOA 3OBYA 4OVLA 1S1WA 2OANA 4CGJA 5HP1A 1JCGA 4AHCA 1YJ9N 2YHBA 4BROA 3NH0A 3PO5A 5EVZA 4KH5A 5C12A 4M3ZA 1SQKA 3CD6N 3UKUB 3QERA 3VEZA 5FPMA 4LF6K 4DB3A 3M8QA 4ZTJA 4H03B 4DLGA 4LF9K 4W5RA 4KTQA 1QQOA 3T7ZA 4QS8A 3CMEN 3K5LA 3CETA 1JLFA 3VQ8A 1QHTA 4JK9A 1GLLO 4FL9A 1JL1A 3H1QA 4FWSA 4B3OA 3AVIA 1O13A 3R1XA 5AQYA 3HBTA 1L3UA 3SK3A 3DOKA 3WNGA 5ELZA 4CHYA 4FWNA 2YCHA 4E7IA 1Y97A 1BCMA 2E6MA 3SBTA 4BRQA 3DLHA 4UY8O 4JKGA 4MQ3A 3MXMA 2D0CA 1HKGA 2QM1A 4PUOA 2IVOA 3VOVA 3DXMB 4B8CA 4H5WA 1BI4A 1CXQA 3PSIA 3KJVA 4ISEA 3HM8A 3VQ5A 5GIOA 1D9DA 4DQQA 1EQYA 3TSPA 2XO7A 4FLTA 1I39A 1JJ2M 5JS1A 1YT3A 3UKRA 1TUUA 2Q1NA 3A5OC 2RKIA 4MO5A 3SI6A 5CYQA 4OKKA 1S9GA 3V4IA 1IBLK 1TVRA 4WYBA 5HROA 4HCCA 3DLGA 1ZBLA 4LFAK 3CPEA 3O9SA 5AQNA 3UB5A 2ITMA 4H0TB 4DR1K 1BQNA 4PL8A 5K14A 3FLCO 5M1QA 3O9QA 1E4FT 3VF2A 3FFIA 2IDOA 1GOAA 3OYHA 3CCVN 5HBMA 3A8YA 1K8AO 5FROA 4DG1A 5DK5A 4I9LA 3SQ0A 4Z4IA 2BUPA 4M3UA 5ADXH 3IMXA 3S41A 3SAFA 1QQCA 2IVNA 3AVAA 1IO2A 3JS6A 5J2MA 4KH6A 3S9HA 3I55N 1Q9YA 3MX5A 1QTMA 3M6GA 4B9LA 3R3LA 3VF6A 5J2QA 3O6WA 4GV6A 4CD3A 1OH7A 2QWOA 4JI8K 3ZT4A 5AQZA 3HRGA 4LC9B 3I33A 2YNIA 1U6ZA 5AQPA 4YOVA 4IG0A 1YVNA 1Q82O 1HNWK 3LPTA 2D0OA 4M3YA 4FW2A 5C42A 4YOTA 4HUFA 3TANA 4CZJA 4CERA 3RTVA 3CC7N 1NOYA 2Q97A 1HX1A 2E6LA 4JAXA 1JCFA 3DOLA 1BIUA 1JKHA 2O8FB 2R7YA 4FOIA 1NOZA 3DYAA 4IG3A 3FZKA 5AQKA 4JLHA 1NKBA 1VQ6N 4DR7K 3H1VX 4OX9K 3WEEB 3VEXA 2HHVA 5IT9O 1YTUA 5KRTA 3NAEA 3M1FA 4FM1A 4BR9A 1BHLA 4DTMA 1IBMK 3PUFA 3TABA 1MWMA 5LJVA 3NBPA 4FWKA 5HOOA 3K58A 3O80A 4JKCA 3VN5A 1LWEA 3HK2A 1KRPA 1A5WA 4C8OA 5D3GA 1KXPA 1W97L 1NK4A 4IZ9A 4FM2A 4K43A 1V4SA 1S1TA 3OYJA 3SJJA 3GL1A 2G8WA 2UYTA 4CIEA 3HPOA 1S22A 3WXLA 1EO1A 2QTDA 4BRPA 3DJCA 3GE1A 1J9AA 1TKDA 4B1UB 5AQTA 2GEMA 4FZZA 1GLJO 1EXQA 4CJ3A 5J1EA 3KK7A 1QHAA 1CZBA 4M3WA 3NE6A 1DGKN 4AHVA 1BGXT 3AO3A 3VQDA 1HNXK 5DM6L 2NRXA 1TKTA 4B9UA 4JKGB 3NGZA 4CGIA 4OLBA 5AFUA 5MLCQ 3OA9A 1VQ5N 1BI4B 3TAGA 4DSIA 5C10A 4CF2A 4AF1A 3AO2A 4BRFA 4DV1K 4NO7A 1XI1A 4BRIA 5KGXA 3UKRB 3K0SA 4M3RA 4NCAA 5AFUH 4CGHA 1XUPO 1WAFA 4IFVA 4AQYK 4KB1A 2KHOA 4JKDA 3KD1E 1GLAG 3V9UA 1Z26A 3CJ9A 4DTNA 3OYBA 3CMAN 3V6DA 2O4IA 1C0MA 4JEPA 1RILA 3AVGA 3P31A 1KAZA 1P90A 4IDKA 5M1NA 3OVNA 4V19S 1T03A 4NCGA 1T8EA 3HSTB 1EETA 4DQPA 1EX4A 3FGUA 5AQRA 3G0ZA 3P5JA 3HPGA 2AP1A 4DQRA 5FPNA 2HBKA 1RFQA 3QETA 1D5AA 4HUEA 1RNHA 2FF3B 3O8MA 3HTVA 2QA4N 1GLCG 3MXJA 3T69A 1VQ8N 2HHHK 4ELVA 5B8HA 1TUYA 1RDAA 3DM2A 4LH5A 2JWKA 1KTQA 4O0JA 2VG7A 2HVIA 3I0SA 5KPRA 3HP6A 3K2PA 4OPAA 3AV9A 1JLQA 3TAFA 2OCEA 1U04A 4F4KA 5GINA 4FWRA 4DF4A 3O4QA 3L8BA 3VEYA 1NJXA 2UXBK 1XQSC 2I5JA 1U2VA 1VQNN 3KWGA 5AQIA 4K41A 1NJYA 1HNIA 1VQPN 1KQSM 1X3MA 4KTZA 1J54A 3BGRA 4DR2K 4CJ4A 3ITHA 4DR6K 5KI6A 2YX6A 1QZ5A 1RBRA 3SMSA 2Y1IA 4FOEA 4QS7A 5BREA 3OYGA 4ISGA 1ZYQA 2DFHA 3S3MA 4M42A 2X6NA 1ATNA 1NGFA 5KRSA 3C94A 4CFAA 2E88A 4E19A 1ITGA 2RN2A 4LF5K 5AQWA 4FVUA 4CFCA 2FBTA 4K8XA 4KAZA 2GWJA 4K42A 3ZLJA 4CF1A 4FJJA 3AA4A 4IDHA 2WBNA 1NGDA 4B8AB 4CBWA 1SAZA 3F5TA 2GV9A 2AJQA 3O3HA 3KVGA 3RSEA 3TTFA 3THWB 4CEDA 3AA2A 1OH8A 2O8CB 4BRGA 3AARA 3LANA 2JGUA 4CJKA 3BP8A 3ZETA 1W0HA 1NM1A 1MDUB 2W6KA 4A5BA 2ZD1A 3HP9A 3VESA 1V4TA 1S1VA 4GMJB 1QZ6A 4HVJA 2B6AA 1Q9XA 4ID5A 4JRPA 1QS4A 2OPRA 3DRPA 3C7NA 1Z25A 3HOSA 3U4LA 5CE3A 2NRVA 2ETJA 4EHUA 1X9SA 3H6EA 4QOZB 3QFPA 4JHDA 3SAGA 3MWTA 5BPLA 3QIPA 2P9IA 3ZCMA 2P9SA 4CEFA 1HRHA 5BPNA 1VQKN 1YITN 3F9KA 1Z05A 2PAVA 2FC0A 4X65K 4AH9A 3HO1A 3DWLA 1SL2A 3QMLA 1JLCA 1C6VA 1Y64A 2G8HA 4HTLA 3LM9A 1NMNA 5LJWA 3RMAA 3H45C 3ZSRA 1NGHA 5KQDA 4FWLA 4O5FA 3G4SN 3SMPA 4E3SA 4IEEA 5FDLA 4OGCA 3ZX0A 3CERA 3O5BA 4DKWA 4B3MK 2E1ZA 4WFAL 3VQ6A 4EFHA 4LFCK 3CG7A 1T44A 3GDQA 4LSLA 1NLVA 3K59A 4KO0A 2LSNA 3SZ2A 4CJQA 4ISFA 3W0LA 3TTDA 4JI1K 1LV5A 1KVAA 4JRQA 4CGFA 3RR7A 2QKBA 3JXUA 1HMVA 4CEZA 2HBLA 1TAUA 3NF7A 4YORA 2IC3A 4R79A 3LDSA 2P51A 3MN5A 3OYCA 3F73A 1J53A 1S6QA 4BWMA 1ZBSA 2PY5A 2OTJN 4JV5K 3KHYA 4CIFA 1ZBUA 3AVFA 1JLGA 3ASMA 1VSDA 3PV8A 1NGCA 4Z4FA 2Z1IA 2GUPA 1U2VB 3QEWA 3NVKA 4H0YB 1HJOA 4E7JA 3HYFA 1YJWN 2RF2A 4W5OA 1UWBA 4CESA 4MLHA 1N6QA 5LMNK 4FJ9A 2OPQA 4CEOA 1T6DA 3P1GA 2ASMA 3HSCA 3QLHA 4H0OA 3J81O 4JS4A 4DSFA 2XY6A 4O0IA 4LF8K 3CIPA 1LAVA 2X78A 3EO3A 3C0BA 3L4QA 2GWKA 1HNZK 1YUWA 3QEPA 4DV2K 1TYQA 1IKVA 4DU3A 1X1PA 3QB0A 4NYFA 1NGIA 3VETA 4GVEA 4BRMA 3O3GA 4IOCL 1NBWA 1M90O 1XNRK 2ZJQL 3C95A 3L4IA 3RSEB 2KW4A 5JVHL 3C6HA 3K5OA 2VWJA 1TAQA 3ZSYA 2YV0X 3ZEUA 3ZETB 4XH4A 5AQGA 2Z1JA 1WBBA 2G8IA 4B1XB 1D8YA 2VWKA 4JI4K 1BOTO 3QESA 1M1KO 3NF8A 1K8KA 3TAQA 2HW3A 3U9DA 1GOCA 1UOCA 4BRLA 1RT3A 4H0VB 4KREA 4IXCA 1QSLA 5CHIA 3CCEN 3C7NB 5JMVA 4C23A 3CF5L 4H0XB 1EWQA 4F9OA 3LDNA 3RWUA 3C6TA 4JD2A 1SZ2A 4FSVA 3SYZA 4M7YA 4M63C 2D4WA 4JHDB 1ZBIA 2HHUA 3LDPA 2P9IB 2Z1GA 2P9SB 4GY2B 3CCJN 3K5MA 3GBTA 1NKCA 4CFDA 4KV8A 2OZSA 2GBZA 4CJSA 5EOYA 4BDZA 1FKOA 1MU2A 2OPPA 3VTIA 1C1AA 3OYKA 2UUCK 3THVA 2FBXA 4O8UA 3A5LC 2G8VA 3RRGA 3M8SA 1ATSA 2CGLA 5JLHA 4FXDA 4AILC 4FJNA 3EYZA 5J2PA 2X74A 3HZ6A 2P9KB 4BR0A 2XY7A 1Q81O 3C65A 3THXA 2HF4A 2NUBA 4B9MA 4N56A 4DTPA 3SV4A 4JS5A 1LWCA 4OPJA 1WSHA 1HPZA 4FLUA 1VRTA 3J7YP 3ZT1A 3VQ7A 2E2NA 3OJUA 3EKUA 2HMIA 1VSKA 5M1PA 4LF7K 1KVBA 3LDOA 4PKIA 5EU7A 3DLRA 1LW2A 4TSXA 5E84A 4BG9A 4IJAA 4PKGA 3R9PA 1YJNN 2ITGA 4RW9A 4DFJA 4DR3K 2BDPA 3CXCM 4CW7B 1FW6A 4YFUA 5HLFA 1VQ4N 3HXMA 2I7NA 4DSKA 1W2BM 3MCAB 1G99A 3H08A 5LY3A 4JYAK 5AQFA 3PY8A 3MDQA 5JVGL 2NRTA 1C0UA 1VHXA 1UA0A 3QFUA 1RGIA 2NRHA 1B92A 3NF6A 3P83D 1KLNA 1XNQK 2ATQA 3V1RA 4B3SK 1TV6A 3KLFA 2DPNA 4EIAA 4RW6A 5BN8A 3NF9A 5F0XA 4OKJA 4EZ6A 4N41A 1TGOA 5JLFA 2NRWA 3G10A 3TAMA 2XY5A 2YJFA 1NNEA 3I8BA 5DMRA 1QQNA 2HBJA 4ILJA 1LWFA 4DTJA 4CIGA 3AO5A 4IFYA 3PIOL 1BIZA 4BWJA 3OS0A 4BC5A 4FVMA 1TYQB 3KLHA 4B3RK 1NGGA 1R59O 3KWIA 3P4IA 3V9XA 1SUQA 1RT2A 4A2AA 4EZ9A 2HHWA 3L2RA 1IJJA 5DM7L 3CFPA 1NU0A 5E26A 1TL1A 4I6MA 3P39A 3OHRA 1U45A 3H46O 4CECA 3VMFB 1BA1A 4J8FA 3MEDA 4L8RB 1W9HA 3MN6A 4EAHD 1Q86O 3DXKA 3AAQA 2P5GA 1X3NA 4KHWA 3SQ2A 3WNHA 4OO1J 1K8KB 1WSIA 1BWFO 3O3FA 2NNWA 4NXNK 2FSJA 2XHBA 1QQMA 3QEVA 4BDPA 4NLBA 4ZHRA 4PA1A 2WC9A 3CJCA 3NHGA 4LFBK 1JLBA 4I2PA 3LALA 2QEXN 4H5TA 4BC2A 4JK7A 3RMBA 3OW2M 4DU4A 2RHKA 4M41A 2WONA 4FK0A 3AVMA 3D2FA 2PZSA 4BGAA 3EE8A 3E9OA 2P9PA 5AQUA 3BF1A 5KPZA 4DQSA 3TSQA 1KC8O 1ILYA 1X9MA 4BR5A 1UA1A 5FRMA 2FSKA 3ENBA 2AA4A 3DLBA 1YTAA 2XRIA 2VG6A 3VQ9A 5HRSA 2WFBA 1RBTA 3THXB 1KVCA 3LAKA 4O44A 3VQQA 3FE1A 1T05A 3KLGA 1KFSA 3AAPA 3R6MA 4DTOA 4B9NA 4YNQA 1MWKA 3IUCA 2QXFA 4KI6A 3DLEA 2KQ2A 5AZIA 4X64K 2Q0UA 1C0GA 4OGEA 3PIPL 2UXDK 2UUBK 2YHWA 1FK9A 3SPYA 1W7AA 1Q18A 4HHTA 1QVGM 1CXUA 1VSIA 4B1ZA 2J4RA 3J8AA 3LZIA 2RPIA 1F21A 1HR0K 2WTUA 1XMQK 4QCLA 1J5OA 4CD1A 4JI5K 4NYNA 3SBGA 2BE2A 4CEBA 1HJRA 3G6EN 5M1FA 4FW1A 3HPHA 4AHTA 1NG9A 1RTJA 4B1YB 1VAZA 3H3OB 4BC4A 4ILHA 3SAHA 3LP1A 3CJAA 2W42A 2IOCA 3DRRA 4RW4A 2UU9K 3CJ7A 2X6SA 1R0AA 3ZSVA 1ASWA 2E8AA 1B9FA 3M8RA 2ZE2A 1L5UA 4X66K 4WF9L 5AQVA 3FZLA 4WE1A 1Q8IA 1JLEA 2KZMA 4CJRA 2CGKA 3JAMO 3EKSA 4H5NA 5M1OA 4OJRA 3D7EO 2BTFA 4E7HA 5AZJA 1OVYA 1U49A 3FFKB 4Y0WA 1YXQA 2H3GX 1IBKK 3EN9A 2HHQA 1NK6A 4A5AA 4KFBA
chains in the Genus database with same CATH topology
4JYAK 4CVNE 4DR6K 4B3MK 4JI4K 4LFCK 4KHPK 4LF6K 2UXCK 1XNQK 3T1YK 3T1HK 4JI8K 4LF9K 4B3SK 4LF5K 4DR4K 4DV1K 4DV4K 1N34K 4YHHK 4JI1K 1HNWK 4AQYK 4DUZK 2ZM6K 4LF4K 2UUAK 4DV7K 4X64K 5FLXO 4B3RK 4JI0K 4YY3K 4DV6K 1J5EK 2UXDK 5BR8K 2UUBK 4JV5K 4JI3K 4JI6K 1XMOK 4DR7K 2VQEK 4DV0K 4V19S 4OX9K 2UUCK 5IT9O 4JI2K 1HR0K 1IBMK 1N36K 2VQFK 1XMQK 4DV5K 4JI5K 5AJ3K 4JI7K 4K0KK 5LMNK 4B3TK 5LMUK 1N33K 3J81O 1FJGK 1I94K 1IBLK 2UU9K 4NXNK 4LF8K 3OTOK 2HHHK 4GKKK 3J7YP 4LFAK 1HNZK 3J7AP 4DR5K 4DR1K 4GKJK 4LFBK 4DV2K 4DUYK 4X65K 4X66K 4NXMK 5A2QO 4LF7K 1N32K 2F4VK 3JAMO 1XNRK 5IWAK 2UXBK 4DV3K 4DR3K 2E5LK 1HNXK 4CW7B 3J80O 4X62K 1IBKK 5LL6Z 4DR2K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA K;  4CVN E;  4DR6 K;  4B3M K;  4JI4 K;  4LFC K;  4KHP K;  4LF6 K;  2UXC K;  1XNQ K;  3T1Y K;  3T1H K;  4JI8 K;  4LF9 K;  4B3S K;  4LF5 K;  4DR4 K;  4DV1 K;  4DV4 K;  1N34 K;  4YHH K;  4JI1 K;  1HNW K;  4AQY K;  4DUZ K;  2ZM6 K;  4LF4 K;  2UUA K;  4DV7 K;  4X64 K;  5FLX O;  4B3R K;  4JI0 K;  4YY3 K;  4DV6 K;  1J5E K;  2UXD K;  5BR8 K;  2UUB K;  4JV5 K;  4JI3 K;  4JI6 K;  1XMO K;  4DR7 K;  2VQE K;  4DV0 K;  4V19 S;  4OX9 K;  2UUC K;  5IT9 O;  4JI2 K;  1HR0 K;  1IBM K;  1N36 K;  2VQF K;  1XMQ K;  4DV5 K;  4JI5 K;  5AJ3 K;  4JI7 K;  4K0K K;  5LMN K;  4B3T K;  5LMU K;  1N33 K;  3J81 O;  1FJG K;  1I94 K;  1IBL K;  2UU9 K;  4NXN K;  4LF8 K;  3OTO K;  2HHH K;  4GKK K;  3J7Y P;  4LFA K;  1HNZ K;  3J7A P;  4DR5 K;  4DR1 K;  4GKJ K;  4LFB K;  4DV2 K;  4DUY K;  4X65 K;  4X66 K;  4NXM K;  5A2Q O;  4LF7 K;  1N32 K;  2F4V K;  3JAM O;  1XNR K;  5IWA K;  2UXB K;  4DV3 K;  4DR3 K;  2E5L K;  1HNX K;  4CW7 B;  3J80 O;  4X62 K;  1IBK K;  5LL6 Z;  4DR2 K; 
#chains in the Genus database with same CATH topology
 1WAJ A;  3AO4 A;  3LM2 A;  1TL3 A;  1DT9 A;  3NH2 A;  1K9M O;  4C8N A;  4BRC A;  4Y1D A;  3GOI A;  1ZBH A;  5SZT A;  3L2U A;  3DXK B;  4JKF A;  2HVH A;  3R8E A;  1D4X A;  4Z0U A;  1WUA A;  3QNO A;  3HOT A;  4BQL A;  4DSE A;  5HL7 L;  3IDH A;  4LF4 K;  4CZI A;  2BH1 A;  3OYF A;  2Q31 A;  4Q0B A;  4FYD A;  3AVK A;  2YNG A;  4DMN A;  3DRS A;  5GAE P;  2KLA A;  3KKS A;  4JKB A;  4J2B A;  3UIQ A;  1KFD A;  1RTD A;  3TR8 A;  5EX5 A;  4DCH A;  4A59 A;  3D2F B;  3CI5 A;  3KIO A;  4CE9 A;  2VQF K;  3UE5 A;  4FLZ A;  4RWT A;  4AHS A;  4MDA A;  1HUX A;  2P9P B;  2D0B A;  3QEI A;  1NMD A;  4EP5 A;  5AQH A;  4E1M A;  4PWD A;  1L3S A;  4CZG A;  3H3N O;  4KBO A;  4CJL A;  4C8K A;  4CZF A;  4M3T A;  4NB4 A;  3TAP A;  4Z94 A;  5JIC A;  4U7B A;  4KHS A;  4FZX C;  3SNN A;  4OKE A;  2QI2 A;  5A2Q O;  3D6R A;  1BU6 O;  4CHZ A;  4Z4E A;  5C0Y A;  4CZL A;  5AZI B;  3B6O A;  1WSJ A;  4B08 A;  4WFN L;  4FJG A;  1C1B A;  4FZY A;  1VSM A;  1XC3 A;  5T7B A;  3EZW A;  3K9J A;  3EZ5 A;  1T7P A;  2HHX A;  1HKB A;  3MEE A;  4QAG A;  3M3Z A;  3VEO A;  1BIS A;  4MLE A;  2YNH A;  2PYJ A;  2P9L A;  1S1X A;  4DQ8 A;  2HOE A;  2Z1H A;  4DV4 K;  1DLO A;  3CYM A;  2QWQ A;  3AVC A;  1DTT A;  4IO8 A;  1WN7 A;  3LZJ A;  4FLY A;  4EP4 A;  3V9W A;  4DUZ K;  4J2E A;  3MCP A;  3HI0 A;  4CEA A;  1BG3 A;  3ATV A;  5J2N A;  1J6Z A;  2HNY A;  4CBX A;  3TAR A;  4UQG A;  1ATR A;  4BDY A;  5AQL A;  4CHP A;  5FLX O;  3OYL A;  3GG4 A;  1RT1 A;  4CF8 A;  3WXK A;  4DV6 K;  4GVM A;  3EL2 A;  4I7F A;  4JI6 K;  2HMP A;  3T19 A;  3QIN A;  1S3X A;  4DV0 K;  4MFB A;  4F2R A;  3DLL L;  5AZJ B;  3ZYY X;  1RTI A;  3LDL A;  3L3V A;  4PY5 A;  3O4W A;  3AA5 X;  3MEC A;  3NFA A;  2HF3 A;  5BRD A;  4GV9 A;  2QWM A;  5M1K A;  4B3T K;  3ALY A;  3TTC A;  1FJG K;  3ZSZ A;  2KFZ A;  3DXM A;  2YKM A;  3VTH A;  2QXL A;  1ESV A;  5TKW A;  4DHY A;  1RTH A;  4CJ5 A;  4WQ5 C;  4B9V A;  3MK6 A;  2ASP A;  3MEG A;  2HHT A;  3MWP A;  1VQ7 N;  3ZT3 A;  4C8M A;  3F2K A;  3IFR A;  4HTU A;  1A5V A;  1RT5 A;  4E1N A;  1TKX A;  3E9P A;  3ULE A;  3M8P A;  5FPE A;  1KLM A;  1QSY A;  3VF4 A;  3LWL A;  1H1V A;  2FXU A;  3CCQ N;  2HB5 A;  1MA9 B;  4DF8 A;  1C0F A;  2ZGZ A;  3VA3 A;  4YOU A;  4A62 A;  5H1S Q;  5CYM A;  1OKJ A;  3U9Z A;  1OVQ A;  2IS3 A;  5C24 A;  3G25 A;  1JXB A;  3OBW A;  1VSJ A;  4W5T A;  4NLC A;  1N5Y A;  2V7Z A;  4CJT A;  3BF3 A;  3PX6 A;  4CJF A;  3T1H K;  5GIP A;  3T1A A;  3VEN A;  4DR4 K;  4F3O A;  2W40 A;  4IEI A;  4Z4C A;  3VQB A;  2PFU A;  5I9E B;  4YOY A;  4HCB A;  1G15 A;  4RG8 A;  4ICL A;  1FXX A;  1WSF A;  1X9J A;  3F9M A;  5C2D A;  1NK0 A;  4KB0 A;  1NJZ A;  3ZSX A;  2QKK A;  1HNV A;  2F7T A;  4BGB A;  1J5E K;  4CI6 A;  2QWN A;  1YAG A;  1NJW A;  2IIR A;  3AO1 A;  4FWO A;  5I42 A;  1NK8 A;  3BDP A;  4KRF A;  3VQ4 A;  4FCY A;  4EHT A;  3PSF A;  3DLK A;  2VGM A;  1BO5 O;  2A41 A;  4FWP A;  1GLF O;  4KHN A;  4Y1C A;  4L3Q A;  4DTX A;  2PYL A;  1HQU A;  4JK8 A;  3O4N A;  3WT0 A;  3B6P A;  3CQY A;  3WXM B;  2V52 B;  5KGW A;  3TWH A;  2HND A;  2OPS A;  3I8D A;  4FK2 A;  2P9L B;  3D2E A;  3BEX A;  3AGR A;  3S3N A;  3V81 A;  4B9S A;  3O9R A;  1T6C A;  1HKC A;  3VEW A;  4B9Q A;  3L2V A;  4CJE A;  1VQ9 N;  2WUS A;  3A2F A;  3QO9 A;  2HBM A;  5E41 A;  4C1N K;  5AQX A;  4PQU A;  1JXE A;  4W5N A;  3C6A A;  1CZ9 A;  2Q2R A;  1REV A;  4B1V A;  3ENH A;  4RCH A;  2V51 B;  2FF6 A;  3U8X A;  3CJB A;  2P1J A;  5TKY A;  3VQA A;  5IWA K;  4CHO A;  2A3Z A;  4C8L A;  3M5R A;  2CH5 A;  4K8Z A;  3A5M C;  4FWQ A;  4H4M A;  4BVO A;  1EKE A;  2G8K A;  4BRN A;  3NGI A;  2DFF A;  3SQ1 A;  3CM5 A;  4F3T A;  2F9W A;  4FK4 A;  3EE9 A;  2P5O A;  3ENO A;  2QWL A;  3LP2 A;  4ILG B;  3I0R A;  5KQ8 A;  3NCI A;  1VQO N;  4CJU A;  1RBV A;  3O1W A;  1U47 A;  2HST A;  1LCU A;  3LAM A;  4I9Q A;  4ZTF A;  1RDD A;  1XC9 A;  2Q36 A;  4CEE A;  3OY9 A;  4PL7 A;  4BRH A;  3CHW A;  2ZM6 K;  3VQE A;  1JL2 A;  4AHU A;  3LDQ A;  3CC4 N;  3VPZ A;  1P8Z A;  3BY5 A;  3V1Q A;  3RMD A;  5EXW A;  4CCH A;  1WSG A;  3WXI A;  4JKA A;  3AY9 A;  4WFB L;  3NH1 A;  4CK2 A;  3ULE B;  4JI3 K;  5HRR A;  2RE2 A;  4ELU A;  3OS2 A;  1VSH A;  2CGJ A;  4G9Z A;  1L3V A;  3OYD A;  4BRD A;  3E66 A;  3ZT2 A;  4A57 A;  5ADX A;  2E2O A;  1IKY A;  1VSF A;  4K0K K;  3LP0 A;  3Q7B A;  2YHY A;  1S9E A;  1IKW A;  1DEJ A;  4A61 A;  4BAC A;  3OYN A;  4DTU A;  5AR0 A;  1L3T A;  1RT6 A;  4DS4 A;  1KD1 O;  4PKH A;  4IFE A;  2FBV A;  3FZM A;  4LSN A;  2OA8 A;  4ELT A;  2O4G A;  3AVB A;  4CHN A;  1TK5 A;  2ZWH A;  4FJM A;  4DR5 K;  1NJI O;  4IJN A;  3OYE A;  3VA0 A;  2B5J A;  4GW6 A;  4MDB A;  3PX0 A;  4O5B A;  3L2Q A;  1C0T A;  2DFE A;  4DFK A;  3ZEU B;  5CY4 A;  2EWS A;  3JYT A;  4CK3 A;  1T3V A;  5BR9 A;  1TK0 A;  4KHY A;  3MAQ A;  1LW0 A;  2Q3S A;  3O9U A;  3SUN A;  2A40 A;  1X9W A;  4I2Q A;  3SCX A;  4IBN A;  1XHX A;  3KKR A;  4KTW A;  2V7Y A;  2G8F A;  2JLE A;  1D9F A;  2YNF A;  4IOA L;  1WLJ A;  5EY4 A;  1EWR A;  5GAD P;  4XH1 A;  4CJ7 A;  3L6Q A;  2CH6 A;  3DI6 A;  4CJW A;  2NRR A;  4CVN E;  3WNF A;  2O8E A;  2A1S A;  4OPH A;  4BR4 A;  1RDW X;  2GEL A;  1KAY A;  2ZGY A;  4JD2 B;  4DU1 A;  1C1C A;  5HRP A;  3K9K A;  4H4O A;  3IG1 A;  3T1Y K;  3P38 A;  4H5V A;  4CEQ A;  1NK9 A;  4QS9 A;  4LH4 A;  4WQ4 A;  2G8U A;  1RT7 A;  4E1J A;  3OYI A;  1VQL N;  4F2S A;  4NCB A;  4XEI A;  3D2E B;  2OZM A;  3ID6 A;  3Q7C A;  5FPD A;  5BN9 A;  1XWL A;  3TU5 A;  2FBY A;  3AVJ A;  1GLE G;  1U48 A;  2KZZ A;  3HL8 A;  1KCF A;  4OPK A;  3V9S A;  3RR8 A;  4RW7 A;  2P9U A;  2QWR A;  1Q7Y O;  4DSL A;  4JI0 K;  1UAX A;  4WCE L;  1B9D A;  4YY3 K;  4DFM A;  4G1Q A;  2PBD A;  2YJE A;  4K25 A;  3RVC A;  3N4Q A;  4CBU A;  1U4B A;  1RT4 A;  2BGG A;  3AVN A;  1KAX A;  4F8R A;  1NK7 A;  4O8K A;  3HT3 A;  1SKR A;  4JKH A;  4FJ7 A;  4LD0 A;  4W5Q A;  2ZJP L;  5GAH P;  4E89 A;  3A5N C;  1E3M A;  5AQJ A;  1HQE A;  5AJ3 K;  3ZSO A;  1S1U A;  4OLA A;  3VER A;  3THW A;  3ZT0 A;  1NGE A;  3CQ8 A;  3RRH A;  2O8C A;  3CCU N;  3VQC A;  1N33 K;  4O4G A;  3KLE A;  3NMU A;  2Y1J A;  4CGG A;  3QIC A;  4AM6 A;  5I3U A;  2E4L A;  1VQM N;  2A5X A;  4BRK A;  1Z6R A;  3CM6 A;  2ZJR L;  1ZC6 A;  1NKE A;  2ASO A;  4E0D A;  4AM7 A;  2NZT A;  4AHR A;  3VGL A;  4WQ4 C;  4N47 A;  1YVU A;  2FSN A;  1ZBF A;  1GLB G;  4BRA A;  3MN7 A;  3OJS A;  2A1R A;  3L3U A;  2D5R A;  1RDB A;  3SUP A;  3PLA A;  2XY8 A;  3BZC A;  3VGM A;  3CCS N;  4BE2 A;  1NK5 A;  4R5P A;  3MX2 A;  2E20 A;  4X62 K;  4BR7 A;  3JSM A;  1WOQ A;  3D45 A;  2D0P A;  2OTL N;  3WNE A;  2D0A A;  1KSP A;  1SL0 A;  3T3F A;  3WUH A;  1SKW A;  2GTD A;  1WB9 A;  3AVH A;  1N34 K;  4DS5 A;  3CPW M;  1BCO A;  1YF5 L;  1A5X A;  3ZSQ A;  3PO4 A;  3MXI A;  1NGA A;  3OS1 A;  4I6M B;  4YOW A;  1GLD G;  1RCH A;  4DV7 K;  1VK0 A;  4IKF A;  3QBX A;  5C25 A;  3QNN A;  3DMJ A;  5SWM A;  2A6A A;  3MMV A;  4Z4G A;  2NLX A;  2P9N A;  1XMO K;  1YHQ N;  2ZF5 O;  4CJP A;  3VEV A;  4KHQ A;  3BZK A;  1O1W A;  3C6U A;  3LWM A;  1N36 K;  3K57 A;  4XH5 A;  3MN9 A;  4M7X A;  2BAN A;  3VQP A;  4DTR A;  4JI7 K;  3OYM A;  4J2D A;  2GX9 A;  1YIJ N;  2O8E B;  1CLQ A;  1E4G T;  4B1W B;  1OH5 A;  4CJV A;  2HHS A;  2KTQ A;  4YDU A;  3K5N A;  3HVT A;  3IAY A;  3THY A;  3OTO K;  4DFP A;  3QEX A;  1DKG D;  4YOX A;  5KPT A;  1NGJ A;  3J7A P;  2W6L A;  3A0I X;  4GKJ K;  3N4P A;  2FLO A;  2QWP A;  4J2A A;  1ZXO A;  1GOB A;  3FZF A;  2IGI A;  1TKZ A;  1QVF M;  2F4V K;  3HJF A;  1BA0 A;  1IV0 A;  4FJH A;  4MO4 A;  2P9U B;  3HVR A;  4FLW A;  5GAG P;  4JKE A;  3U6F A;  3CCM N;  3TI0 A;  2IAJ A;  3KLI A;  5FRN A;  4FJL A;  3ATU A;  1WNS A;  1RBS A;  4CZH A;  5LL6 Z;  3SPZ A;  5HRN A;  1QE1 A;  2F96 A;  2YKN A;  5AQQ A;  2W41 A;  2E2P A;  4U67 L;  2WOM A;  1LAW A;  4ID1 A;  2O8B A;  3DAW A;  3KD5 E;  4KHP K;  3NVM A;  1ASU A;  1TK8 A;  2UXC K;  3FR0 A;  1VSE A;  4FJX A;  4FJ5 A;  3NDK A;  2OYQ A;  4BQZ A;  2IVP A;  5AQM A;  4FM0 A;  3SV3 A;  4O55 A;  2DTU A;  4CZK A;  3ISN C;  4YHH K;  3IS9 A;  3EY1 A;  4CFB A;  1VRU A;  2O8D A;  4FO0 A;  4M45 A;  3SQ4 A;  2UUA K;  4H5R A;  3ID8 A;  1S72 N;  4WQ5 A;  3SLC A;  4DTS A;  1QSS A;  4YDU C;  4DSJ A;  2Q0R A;  5CZ1 A;  1HYS A;  3U3Y A;  5BR8 K;  4FJI A;  1IH7 A;  4DWI A;  5BRF A;  2A42 A;  2QK9 A;  3KK1 A;  5JS2 A;  4KHU A;  4Q5V A;  3D0P A;  4IO9 L;  3L2W A;  3RMC A;  2YHA A;  4FJ8 A;  3V9Z A;  3SJH A;  3QDK A;  3UKU A;  2F8T A;  2DY4 A;  5BRH A;  3LP3 A;  4N76 A;  4PHT X;  2I7P A;  1EP4 A;  5BPM A;  5KTQ A;  1S5J A;  4N5S A;  3VGK A;  1N8R O;  4KKO A;  2KFN A;  3AGK A;  2D1K A;  3L0Q A;  4KPY A;  1HYZ A;  3CQX A;  3I56 N;  2NRZ A;  1I94 K;  4BR2 A;  4CZM A;  3CCR N;  1YI2 N;  4RW8 A;  3O1B A;  1JLA A;  3IKM A;  3FZH A;  4BC3 A;  3WXJ A;  3SUO A;  4FWM A;  4H0P A;  2VYP A;  1SV5 A;  3O9T A;  3S3O A;  1HYV A;  1CZA N;  2P9K A;  4NXM K;  3KTQ A;  3KK3 A;  4E7L A;  1N32 K;  1IG8 A;  3WQT A;  4BRE A;  1BUP A;  4FPB A;  4BY9 C;  2VWB A;  3TPQ A;  1RDC A;  3CFR A;  2ZQB A;  3BUZ B;  4M3X A;  3G71 N;  4E7K A;  4CZE A;  4KH4 A;  5AQS A;  1SKS A;  5F2R A;  1BDG A;  2GUI A;  2P9N B;  3J80 O;  5F1X A;  1WBD A;  2VCP A;  2YHX A;  4JN4 A;  4C1N I;  3WQU A;  3V1O A;  2EX3 A;  1JCE A;  2VGN A;  3SUQ A;  3ULD A;  1OH6 A;  4CHQ A;  3AVL A;  3LL3 A;  4BE0 A;  3W3D A;  5C15 A;  3E1Y A;  4KI4 A;  2F9T A;  1RDU A;  4BG8 A;  1K6Y A;  1ASV A;  3ZX3 A;  2QW9 A;  3THY B;  3IRX A;  4Z4H A;  3QBW A;  1WSE A;  4H8K A;  4CF0 A;  1IKX A;  4CK1 A;  1SL1 A;  2B4J A;  1K73 O;  4CGD A;  3ZX2 A;  3U3G A;  3TSU A;  1NWK A;  5C2F A;  3LPU A;  4LY7 A;  2VQE K;  3E01 A;  2E1Y A;  2VG5 A;  4FLX A;  1SS6 A;  3KZB A;  1BQM A;  1RBU A;  3AA3 A;  3B8A X;  4JI2 K;  2YI1 A;  1NGB A;  1S6P A;  2JWL A;  3HM9 A;  1HLU A;  4DV5 K;  4IOX A;  4IWV A;  4BVP A;  2F8S A;  4JNE A;  4DLE A;  3OYA A;  3E9L A;  3KK2 A;  2O8B B;  5LMU K;  4FPA A;  3CFO A;  1LOT B;  1HPM A;  2EHG A;  4BE1 A;  3CCL N;  4RTF D;  4GKK K;  5CR4 A;  3QIO A;  3PX4 A;  3CC2 N;  3NGY A;  2HNZ A;  4B9T A;  4HUG A;  3EEQ A;  4DUY K;  2O8D B;  4HWI A;  4GNI A;  1VSL A;  1XHZ A;  2KKZ A;  2O8F A;  3TAE A;  4CF9 A;  4GV3 A;  3O08 A;  4FLV A;  1IG9 A;  4DQI A;  1DTQ A;  3ZSW A;  4A2B A;  3J7Z O;  3WEE A;  4DV3 K;  5CZ2 A;  2E5L K;  3CJ1 A;  1FKP A;  4XIU A;  1BL3 A;  2E2Q A;  4FJK A;  1I3A A;  5AQO A;  3OBY A;  4OVL A;  1S1W A;  2OAN A;  4CGJ A;  5HP1 A;  1JCG A;  4AHC A;  1YJ9 N;  2YHB A;  4BRO A;  3NH0 A;  3PO5 A;  5EVZ A;  4KH5 A;  5C12 A;  4M3Z A;  1SQK A;  3CD6 N;  3UKU B;  3QER A;  3VEZ A;  5FPM A;  4LF6 K;  4DB3 A;  3M8Q A;  4ZTJ A;  4H03 B;  4DLG A;  4LF9 K;  4W5R A;  4KTQ A;  1QQO A;  3T7Z A;  4QS8 A;  3CME N;  3K5L A;  3CET A;  1JLF A;  3VQ8 A;  1QHT A;  4JK9 A;  1GLL O;  4FL9 A;  1JL1 A;  3H1Q A;  4FWS A;  4B3O A;  3AVI A;  1O13 A;  3R1X A;  5AQY A;  3HBT A;  1L3U A;  3SK3 A;  3DOK A;  3WNG A;  5ELZ A;  4CHY A;  4FWN A;  2YCH A;  4E7I A;  1Y97 A;  1BCM A;  2E6M A;  3SBT A;  4BRQ A;  3DLH A;  4UY8 O;  4JKG A;  4MQ3 A;  3MXM A;  2D0C A;  1HKG A;  2QM1 A;  4PUO A;  2IVO A;  3VOV A;  3DXM B;  4B8C A;  4H5W A;  1BI4 A;  1CXQ A;  3PSI A;  3KJV A;  4ISE A;  3HM8 A;  3VQ5 A;  5GIO A;  1D9D A;  4DQQ A;  1EQY A;  3TSP A;  2XO7 A;  4FLT A;  1I39 A;  1JJ2 M;  5JS1 A;  1YT3 A;  3UKR A;  1TUU A;  2Q1N A;  3A5O C;  2RKI A;  4MO5 A;  3SI6 A;  5CYQ A;  4OKK A;  1S9G A;  3V4I A;  1IBL K;  1TVR A;  4WYB A;  5HRO A;  4HCC A;  3DLG A;  1ZBL A;  4LFA K;  3CPE A;  3O9S A;  5AQN A;  3UB5 A;  2ITM A;  4H0T B;  4DR1 K;  1BQN A;  4PL8 A;  5K14 A;  3FLC O;  5M1Q A;  3O9Q A;  1E4F T;  3VF2 A;  3FFI A;  2IDO A;  1GOA A;  3OYH A;  3CCV N;  5HBM A;  3A8Y A;  1K8A O;  5FRO A;  4DG1 A;  5DK5 A;  4I9L A;  3SQ0 A;  4Z4I A;  2BUP A;  4M3U A;  5ADX H;  3IMX A;  3S41 A;  3SAF A;  1QQC A;  2IVN A;  3AVA A;  1IO2 A;  3JS6 A;  5J2M A;  4KH6 A;  3S9H A;  3I55 N;  1Q9Y A;  3MX5 A;  1QTM A;  3M6G A;  4B9L A;  3R3L A;  3VF6 A;  5J2Q A;  3O6W A;  4GV6 A;  4CD3 A;  1OH7 A;  2QWO A;  4JI8 K;  3ZT4 A;  5AQZ A;  3HRG A;  4LC9 B;  3I33 A;  2YNI A;  1U6Z A;  5AQP A;  4YOV A;  4IG0 A;  1YVN A;  1Q82 O;  1HNW K;  3LPT A;  2D0O A;  4M3Y A;  4FW2 A;  5C42 A;  4YOT A;  4HUF A;  3TAN A;  4CZJ A;  4CER A;  3RTV A;  3CC7 N;  1NOY A;  2Q97 A;  1HX1 A;  2E6L A;  4JAX A;  1JCF A;  3DOL A;  1BIU A;  1JKH A;  2O8F B;  2R7Y A;  4FOI A;  1NOZ A;  3DYA A;  4IG3 A;  3FZK A;  5AQK A;  4JLH A;  1NKB A;  1VQ6 N;  4DR7 K;  3H1V X;  4OX9 K;  3WEE B;  3VEX A;  2HHV A;  5IT9 O;  1YTU A;  5KRT A;  3NAE A;  3M1F A;  4FM1 A;  4BR9 A;  1BHL A;  4DTM A;  1IBM K;  3PUF A;  3TAB A;  1MWM A;  5LJV A;  3NBP A;  4FWK A;  5HOO A;  3K58 A;  3O80 A;  4JKC A;  3VN5 A;  1LWE A;  3HK2 A;  1KRP A;  1A5W A;  4C8O A;  5D3G A;  1KXP A;  1W97 L;  1NK4 A;  4IZ9 A;  4FM2 A;  4K43 A;  1V4S A;  1S1T A;  3OYJ A;  3SJJ A;  3GL1 A;  2G8W A;  2UYT A;  4CIE A;  3HPO A;  1S22 A;  3WXL A;  1EO1 A;  2QTD A;  4BRP A;  3DJC A;  3GE1 A;  1J9A A;  1TKD A;  4B1U B;  5AQT A;  2GEM A;  4FZZ A;  1GLJ O;  1EXQ A;  4CJ3 A;  5J1E A;  3KK7 A;  1QHA A;  1CZB A;  4M3W A;  3NE6 A;  1DGK N;  4AHV A;  1BGX T;  3AO3 A;  3VQD A;  1HNX K;  5DM6 L;  2NRX A;  1TKT A;  4B9U A;  4JKG B;  3NGZ A;  4CGI A;  4OLB A;  5AFU A;  5MLC Q;  3OA9 A;  1VQ5 N;  1BI4 B;  3TAG A;  4DSI A;  5C10 A;  4CF2 A;  4AF1 A;  3AO2 A;  4BRF A;  4DV1 K;  4NO7 A;  1XI1 A;  4BRI A;  5KGX A;  3UKR B;  3K0S A;  4M3R A;  4NCA A;  5AFU H;  4CGH A;  1XUP O;  1WAF A;  4IFV A;  4AQY K;  4KB1 A;  2KHO A;  4JKD A;  3KD1 E;  1GLA G;  3V9U A;  1Z26 A;  3CJ9 A;  4DTN A;  3OYB A;  3CMA N;  3V6D A;  2O4I A;  1C0M A;  4JEP A;  1RIL A;  3AVG A;  3P31 A;  1KAZ A;  1P90 A;  4IDK A;  5M1N A;  3OVN A;  4V19 S;  1T03 A;  4NCG A;  1T8E A;  3HST B;  1EET A;  4DQP A;  1EX4 A;  3FGU A;  5AQR A;  3G0Z A;  3P5J A;  3HPG A;  2AP1 A;  4DQR A;  5FPN A;  2HBK A;  1RFQ A;  3QET A;  1D5A A;  4HUE A;  1RNH A;  2FF3 B;  3O8M A;  3HTV A;  2QA4 N;  1GLC G;  3MXJ A;  3T69 A;  1VQ8 N;  2HHH K;  4ELV A;  5B8H A;  1TUY A;  1RDA A;  3DM2 A;  4LH5 A;  2JWK A;  1KTQ A;  4O0J A;  2VG7 A;  2HVI A;  3I0S A;  5KPR A;  3HP6 A;  3K2P A;  4OPA A;  3AV9 A;  1JLQ A;  3TAF A;  2OCE A;  1U04 A;  4F4K A;  5GIN A;  4FWR A;  4DF4 A;  3O4Q A;  3L8B A;  3VEY A;  1NJX A;  2UXB K;  1XQS C;  2I5J A;  1U2V A;  1VQN N;  3KWG A;  5AQI A;  4K41 A;  1NJY A;  1HNI A;  1VQP N;  1KQS M;  1X3M A;  4KTZ A;  1J54 A;  3BGR A;  4DR2 K;  4CJ4 A;  3ITH A;  4DR6 K;  5KI6 A;  2YX6 A;  1QZ5 A;  1RBR A;  3SMS A;  2Y1I A;  4FOE A;  4QS7 A;  5BRE A;  3OYG A;  4ISG A;  1ZYQ A;  2DFH A;  3S3M A;  4M42 A;  2X6N A;  1ATN A;  1NGF A;  5KRS A;  3C94 A;  4CFA A;  2E88 A;  4E19 A;  1ITG A;  2RN2 A;  4LF5 K;  5AQW A;  4FVU A;  4CFC A;  2FBT A;  4K8X A;  4KAZ A;  2GWJ A;  4K42 A;  3ZLJ A;  4CF1 A;  4FJJ A;  3AA4 A;  4IDH A;  2WBN A;  1NGD A;  4B8A B;  4CBW A;  1SAZ A;  3F5T A;  2GV9 A;  2AJQ A;  3O3H A;  3KVG A;  3RSE A;  3TTF A;  3THW B;  4CED A;  3AA2 A;  1OH8 A;  2O8C B;  4BRG A;  3AAR A;  3LAN A;  2JGU A;  4CJK A;  3BP8 A;  3ZET A;  1W0H A;  1NM1 A;  1MDU B;  2W6K A;  4A5B A;  2ZD1 A;  3HP9 A;  3VES A;  1V4T A;  1S1V A;  4GMJ B;  1QZ6 A;  4HVJ A;  2B6A A;  1Q9X A;  4ID5 A;  4JRP A;  1QS4 A;  2OPR A;  3DRP A;  3C7N A;  1Z25 A;  3HOS A;  3U4L A;  5CE3 A;  2NRV A;  2ETJ A;  4EHU A;  1X9S A;  3H6E A;  4QOZ B;  3QFP A;  4JHD A;  3SAG A;  3MWT A;  5BPL A;  3QIP A;  2P9I A;  3ZCM A;  2P9S A;  4CEF A;  1HRH A;  5BPN A;  1VQK N;  1YIT N;  3F9K A;  1Z05 A;  2PAV A;  2FC0 A;  4X65 K;  4AH9 A;  3HO1 A;  3DWL A;  1SL2 A;  3QML A;  1JLC A;  1C6V A;  1Y64 A;  2G8H A;  4HTL A;  3LM9 A;  1NMN A;  5LJW A;  3RMA A;  3H45 C;  3ZSR A;  1NGH A;  5KQD A;  4FWL A;  4O5F A;  3G4S N;  3SMP A;  4E3S A;  4IEE A;  5FDL A;  4OGC A;  3ZX0 A;  3CER A;  3O5B A;  4DKW A;  4B3M K;  2E1Z A;  4WFA L;  3VQ6 A;  4EFH A;  4LFC K;  3CG7 A;  1T44 A;  3GDQ A;  4LSL A;  1NLV A;  3K59 A;  4KO0 A;  2LSN A;  3SZ2 A;  4CJQ A;  4ISF A;  3W0L A;  3TTD A;  4JI1 K;  1LV5 A;  1KVA A;  4JRQ A;  4CGF A;  3RR7 A;  2QKB A;  3JXU A;  1HMV A;  4CEZ A;  2HBL A;  1TAU A;  3NF7 A;  4YOR A;  2IC3 A;  4R79 A;  3LDS A;  2P51 A;  3MN5 A;  3OYC A;  3F73 A;  1J53 A;  1S6Q A;  4BWM A;  1ZBS A;  2PY5 A;  2OTJ N;  4JV5 K;  3KHY A;  4CIF A;  1ZBU A;  3AVF A;  1JLG A;  3ASM A;  1VSD A;  3PV8 A;  1NGC A;  4Z4F A;  2Z1I A;  2GUP A;  1U2V B;  3QEW A;  3NVK A;  4H0Y B;  1HJO A;  4E7J A;  3HYF A;  1YJW N;  2RF2 A;  4W5O A;  1UWB A;  4CES A;  4MLH A;  1N6Q A;  5LMN K;  4FJ9 A;  2OPQ A;  4CEO A;  1T6D A;  3P1G A;  2ASM A;  3HSC A;  3QLH A;  4H0O A;  3J81 O;  4JS4 A;  4DSF A;  2XY6 A;  4O0I A;  4LF8 K;  3CIP A;  1LAV A;  2X78 A;  3EO3 A;  3C0B A;  3L4Q A;  2GWK A;  1HNZ K;  1YUW A;  3QEP A;  4DV2 K;  1TYQ A;  1IKV A;  4DU3 A;  1X1P A;  3QB0 A;  4NYF A;  1NGI A;  3VET A;  4GVE A;  4BRM A;  3O3G A;  4IOC L;  1NBW A;  1M90 O;  1XNR K;  2ZJQ L;  3C95 A;  3L4I A;  3RSE B;  2KW4 A;  5JVH L;  3C6H A;  3K5O A;  2VWJ A;  1TAQ A;  3ZSY A;  2YV0 X;  3ZEU A;  3ZET B;  4XH4 A;  5AQG A;  2Z1J A;  1WBB A;  2G8I A;  4B1X B;  1D8Y A;  2VWK A;  4JI4 K;  1BOT O;  3QES A;  1M1K O;  3NF8 A;  1K8K A;  3TAQ A;  2HW3 A;  3U9D A;  1GOC A;  1UOC A;  4BRL A;  1RT3 A;  4H0V B;  4KRE A;  4IXC A;  1QSL A;  5CHI A;  3CCE N;  3C7N B;  5JMV A;  4C23 A;  3CF5 L;  4H0X B;  1EWQ A;  4F9O A;  3LDN A;  3RWU A;  3C6T A;  4JD2 A;  1SZ2 A;  4FSV A;  3SYZ A;  4M7Y A;  4M63 C;  2D4W A;  4JHD B;  1ZBI A;  2HHU A;  3LDP A;  2P9I B;  2Z1G A;  2P9S B;  4GY2 B;  3CCJ N;  3K5M A;  3GBT A;  1NKC A;  4CFD A;  4KV8 A;  2OZS A;  2GBZ A;  4CJS A;  5EOY A;  4BDZ A;  1FKO A;  1MU2 A;  2OPP A;  3VTI A;  1C1A A;  3OYK A;  2UUC K;  3THV A;  2FBX A;  4O8U A;  3A5L C;  2G8V A;  3RRG A;  3M8S A;  1ATS A;  2CGL A;  5JLH A;  4FXD A;  4AIL C;  4FJN A;  3EYZ A;  5J2P A;  2X74 A;  3HZ6 A;  2P9K B;  4BR0 A;  2XY7 A;  1Q81 O;  3C65 A;  3THX A;  2HF4 A;  2NUB A;  4B9M A;  4N56 A;  4DTP A;  3SV4 A;  4JS5 A;  1LWC A;  4OPJ A;  1WSH A;  1HPZ A;  4FLU A;  1VRT A;  3J7Y P;  3ZT1 A;  3VQ7 A;  2E2N A;  3OJU A;  3EKU A;  2HMI A;  1VSK A;  5M1P A;  4LF7 K;  1KVB A;  3LDO A;  4PKI A;  5EU7 A;  3DLR A;  1LW2 A;  4TSX A;  5E84 A;  4BG9 A;  4IJA A;  4PKG A;  3R9P A;  1YJN N;  2ITG A;  4RW9 A;  4DFJ A;  4DR3 K;  2BDP A;  3CXC M;  4CW7 B;  1FW6 A;  4YFU A;  5HLF A;  1VQ4 N;  3HXM A;  2I7N A;  4DSK A;  1W2B M;  3MCA B;  1G99 A;  3H08 A;  5LY3 A;  4JYA K;  5AQF A;  3PY8 A;  3MDQ A;  5JVG L;  2NRT A;  1C0U A;  1VHX A;  1UA0 A;  3QFU A;  1RGI A;  2NRH A;  1B92 A;  3NF6 A;  3P83 D;  1KLN A;  1XNQ K;  2ATQ A;  3V1R A;  4B3S K;  1TV6 A;  3KLF A;  2DPN A;  4EIA A;  4RW6 A;  5BN8 A;  3NF9 A;  5F0X A;  4OKJ A;  4EZ6 A;  4N41 A;  1TGO A;  5JLF A;  2NRW A;  3G10 A;  3TAM A;  2XY5 A;  2YJF A;  1NNE A;  3I8B A;  5DMR A;  1QQN A;  2HBJ A;  4ILJ A;  1LWF A;  4DTJ A;  4CIG A;  3AO5 A;  4IFY A;  3PIO L;  1BIZ A;  4BWJ A;  3OS0 A;  4BC5 A;  4FVM A;  1TYQ B;  3KLH A;  4B3R K;  1NGG A;  1R59 O;  3KWI A;  3P4I A;  3V9X A;  1SUQ A;  1RT2 A;  4A2A A;  4EZ9 A;  2HHW A;  3L2R A;  1IJJ A;  5DM7 L;  3CFP A;  1NU0 A;  5E26 A;  1TL1 A;  4I6M A;  3P39 A;  3OHR A;  1U45 A;  3H46 O;  4CEC A;  3VMF B;  1BA1 A;  4J8F A;  3MED A;  4L8R B;  1W9H A;  3MN6 A;  4EAH D;  1Q86 O;  3DXK A;  3AAQ A;  2P5G A;  1X3N A;  4KHW A;  3SQ2 A;  3WNH A;  4OO1 J;  1K8K B;  1WSI A;  1BWF O;  3O3F A;  2NNW A;  4NXN K;  2FSJ A;  2XHB A;  1QQM A;  3QEV A;  4BDP A;  4NLB A;  4ZHR A;  4PA1 A;  2WC9 A;  3CJC A;  3NHG A;  4LFB K;  1JLB A;  4I2P A;  3LAL A;  2QEX N;  4H5T A;  4BC2 A;  4JK7 A;  3RMB A;  3OW2 M;  4DU4 A;  2RHK A;  4M41 A;  2WON A;  4FK0 A;  3AVM A;  3D2F A;  2PZS A;  4BGA A;  3EE8 A;  3E9O A;  2P9P A;  5AQU A;  3BF1 A;  5KPZ A;  4DQS A;  3TSQ A;  1KC8 O;  1ILY A;  1X9M A;  4BR5 A;  1UA1 A;  5FRM A;  2FSK A;  3ENB A;  2AA4 A;  3DLB A;  1YTA A;  2XRI A;  2VG6 A;  3VQ9 A;  5HRS A;  2WFB A;  1RBT A;  3THX B;  1KVC A;  3LAK A;  4O44 A;  3VQQ A;  3FE1 A;  1T05 A;  3KLG A;  1KFS A;  3AAP A;  3R6M A;  4DTO A;  4B9N A;  4YNQ A;  1MWK A;  3IUC A;  2QXF A;  4KI6 A;  3DLE A;  2KQ2 A;  5AZI A;  4X64 K;  2Q0U A;  1C0G A;  4OGE A;  3PIP L;  2UXD K;  2UUB K;  2YHW A;  1FK9 A;  3SPY A;  1W7A A;  1Q18 A;  4HHT A;  1QVG M;  1CXU A;  1VSI A;  4B1Z A;  2J4R A;  3J8A A;  3LZI A;  2RPI A;  1F21 A;  1HR0 K;  2WTU A;  1XMQ K;  4QCL A;  1J5O A;  4CD1 A;  4JI5 K;  4NYN A;  3SBG A;  2BE2 A;  4CEB A;  1HJR A;  3G6E N;  5M1F A;  4FW1 A;  3HPH A;  4AHT A;  1NG9 A;  1RTJ A;  4B1Y B;  1VAZ A;  3H3O B;  4BC4 A;  4ILH A;  3SAH A;  3LP1 A;  3CJA A;  2W42 A;  2IOC A;  3DRR A;  4RW4 A;  2UU9 K;  3CJ7 A;  2X6S A;  1R0A A;  3ZSV A;  1ASW A;  2E8A A;  1B9F A;  3M8R A;  2ZE2 A;  1L5U A;  4X66 K;  4WF9 L;  5AQV A;  3FZL A;  4WE1 A;  1Q8I A;  1JLE A;  2KZM A;  4CJR A;  2CGK A;  3JAM O;  3EKS A;  4H5N A;  5M1O A;  4OJR A;  3D7E O;  2BTF A;  4E7H A;  5AZJ A;  1OVY A;  1U49 A;  3FFK B;  4Y0W A;  1YXQ A;  2H3G X;  1IBK K;  3EN9 A;  2HHQ A;  1NK6 A;  4A5A A;  4KFB A; 
#chains in the Genus database with same CATH homology
 4JYA K;  4CVN E;  4DR6 K;  4B3M K;  4JI4 K;  4LFC K;  4KHP K;  4LF6 K;  2UXC K;  1XNQ K;  3T1Y K;  3T1H K;  4JI8 K;  4LF9 K;  4B3S K;  4LF5 K;  4DR4 K;  4DV1 K;  4DV4 K;  1N34 K;  4YHH K;  4JI1 K;  1HNW K;  4AQY K;  4DUZ K;  2ZM6 K;  4LF4 K;  2UUA K;  4DV7 K;  4X64 K;  5FLX O;  4B3R K;  4JI0 K;  4YY3 K;  4DV6 K;  1J5E K;  2UXD K;  5BR8 K;  2UUB K;  4JV5 K;  4JI3 K;  4JI6 K;  1XMO K;  4DR7 K;  2VQE K;  4DV0 K;  4V19 S;  4OX9 K;  2UUC K;  5IT9 O;  4JI2 K;  1HR0 K;  1IBM K;  1N36 K;  2VQF K;  1XMQ K;  4DV5 K;  4JI5 K;  5AJ3 K;  4JI7 K;  4K0K K;  5LMN K;  4B3T K;  5LMU K;  1N33 K;  3J81 O;  1FJG K;  1I94 K;  1IBL K;  2UU9 K;  4NXN K;  4LF8 K;  3OTO K;  2HHH K;  4GKK K;  3J7Y P;  4LFA K;  1HNZ K;  3J7A P;  4DR5 K;  4DR1 K;  4GKJ K;  4LFB K;  4DV2 K;  4DUY K;  4X65 K;  4X66 K;  4NXM K;  5A2Q O;  4LF7 K;  1N32 K;  2F4V K;  3JAM O;  1XNR K;  5IWA K;  2UXB K;  4DV3 K;  4DR3 K;  2E5L K;  1HNX K;  4CW7 B;  3J80 O;  4X62 K;  1IBK K;  5LL6 Z;  4DR2 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...