2VQFK

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2vqfK00
1N36K 4DUYK 4JI4K 5AJ3K 4LF6K 1FJGK 1XMQK 2ZM6K 4GKKK 1HNXK 4DUZK 1HNZK 4LF4K 2VQFK 4JI5K 5LMNK 4LF9K 2UUBK 5BR8K 2F4VK 1N32K 1J5EK 1I94K 4B3TK 4JI0K 2E5LK 4DV7K 4X65K 4X66K 4JI8K 4DR5K 4JI3K 4JI2K 4YHHK 4AQYK 2UXCK 4V19S 4JI1K 4DV6K 3JAMO 2UXDK 2UUAK 4DV3K 4JYAK 5FLXO 4DR6K 1XMOK 4JI6K 4DV4K 1N33K 4NXNK 3T1YK 3T1HK 4LF8K 4JV5K 5IWAK 1IBMK 1N34K 3OTOK 4JI7K 2VQEK 3J7AP 5A2QO 4LFAK 4YY3K 3J7YP 4DR1K 4NXMK 4CW7B 4DV2K 4B3MK 1XNRK 1HR0K 4B3SK 4X62K 4LFBK 4CVNE 1HNWK 4DV1K 4OX9K 5LMUK 1IBLK 1IBKK 4DV5K 4K0KK 4DR4K 2UUCK 4B3RK 3J80O 4DR7K 4GKJK 3J81O 2HHHK 4DR2K 4X64K 5LL6Z 4DV0K 4LF7K 4LFCK 4LF5K 2UU9K 2UXBK 4DR3K 5IT9O 4KHPK 1XNQK
chains in the Genus database with same CATH superfamily
2FBVA 1NK0A 1VQ5N 4M3YA 1EQYA 1N36K 3CC2N 4GW6A 1GLLO 4WQ5C 1NGCA 3RWUA 1RGIA 3B6OA 4DQRA 1NGDA 3AO5A 4H4OA 4FWQA 5C2FA 1BQMA 5HP1A 1DGKN 3G4SN 1VQ6N 3VEVA 3L2QA 3D2FB 4RW9A 1C1AA 4JKDA 3C6HA 4B1WB 4JRQA 3ZSOA 2GUIA 4I6MB 1VQKN 3LP2A 1TUUA 3OYMA 4A2BA 3A5OC 5FPMA 3H3OB 5LY3A 3ATVA 3OYCA 4AHUA 5F0XA 3QBXA 3R3LA 2AP1A 4YOYA 1LW0A 4EHTA 1GLBG 2VCPA 1VQLN 4B9MA 4WFBL 1OKJA 2KTQA 3ZT4A 4KHSA 4BGBA 2X74A 3RVCA 3BZCA 3FZMA 5KRTA 3RR8A 3WT0A 5BN8A 1HNVA 3BY5A 1NNEA 3CCVN 3I33A 4C23A 3DLRA 5FLXO 2HHUA 3HK2A 3AA5X 4EZ9A 3THYB 4YOVA 1NM1A 4R79A 4C8MA 4JV5K 4BRNA 2UYTA 3M1FA 5ADXA 3J7YP 2CGLA 4RTFD 3VENA 1YT3A 3ZSWA 4CW7B 4CHPA 4E0DA 4CBUA 4K0KK 4Y1CA 5C10A 4DTUA 2ETJA 5AZJB 4H8KA 3WNGA 2NRWA 1QE1A 3AO3A 3FZLA 2OYQA 4E7IA 3C6UA 3ZX0A 1NK5A 3LM2A 3NH1A 1SL2A 2EHGA 1KVCA 3IMXA 1TV6A 3Q7CA 2NZTA 4KTQA 3LZIA 3R9PA 3GBTA 1BIZA 3PO4A 2GWJA 3KLGA 1RDUA 4FVMA 4DTSA 2PY5A 3PX6A 3BZKA 3QFPA 3U3GA 4M3RA 3E1YA 3V1QA 2RKIA 1NK7A 4F2SA 2HNDA 3IKMA 3PIPL 3CJCA 4IOXA 1HNZK 3I56N 3OYAA 1O1WA 3CI5A 2VQFK 4BG9A 3P4IA 2UUBK 5DK5A 1KAZA 4W5RA 2E5LK 1EO1A 2G8KA 1TKXA 4CJUA 3CERA 4ISFA 4HWIA 3SK3A 5J2NA 4BRGA 2O8EB 1BA0A 3OJUA 4B9NA 1T6CA 4CD1A 2A41A 3OYLA 2O8DA 4O4GA 3THXB 2UUAK 2W6LA 4KHQA 2P9UB 2OA8A 4BACA 1VSDA 4E1NA 4K8ZA 4NXNK 3CXCM 1VQ7N 3G25A 3VQAA 4LF8K 4CEBA 4CGFA 2V52B 3SAHA 3L3UA 1TYQB 3CQ8A 3ZSVA 3PX0A 4DMNA 3DLBA 2P9KA 3V9XA 2VG6A 5M1KA 4BDZA 3SZ2A 4FWNA 4JS5A 4CZGA 4N56A 1S3XA 1MWKA 3VEZA 4JKEA 4X62K 4G1QA 3G6EN 3TU5A 1X9MA 1OH7A 5LMUK 5J2QA 1ESVA 3CJ9A 4CJ3A 4U7BA 3KLFA 1N5YA 1XHXA 2VWJA 3LP0A 5AQSA 2QWRA 1D9FA 4JN4A 2RE2A 2DY4A 1GLAG 3L4QA 1SL0A 1HNIA 5JVGL 3FR0A 4FW2A 1BI4A 5BR9A 3QDKA 2UU9K 3WEEA 5M1PA 1VSJA 1Z25A 1I39A 4DSKA 5DM6L 3EKUA 4LF6K 4CEDA 2HNYA 3QEWA 4DF8A 5EU7A 4HHTA 1WOQA 2DFFA 4CJKA 3AGKA 1S1TA 1XHZA 4JI5K 4O44A 3CG7A 3SV4A 5LMNK 1JLCA 4LF9K 3MEEA 1NGHA 3NGZA 2XRIA 1Z05A 5AQOA 4ZTJA 4A62A 1WBDA 3E9OA 1NGGA 5TKWA 3CHWA 3H08A 4OKJA 1W97L 4JD2B 2B4JA 4DS5A 2HW3A 3OYHA 3U8XA 1MU2A 4EAHD 1Z6RA 3PX4A 1U2VB 2YKMA 2IS3A 3O3HA 3OYJA 2P9KB 1CLQA 1RBUA 4JK7A 5AQYA 2FSNA 1VSHA 3CYMA 1YI2N 1C1CA 3PY8A 3ZYYX 4CZHA 4FLYA 3QETA 3O08A 4F3OA 3C6AA 3NVKA 4AM7A 1RT2A 4KHUA 3KK7A 1T3VA 2GX9A 2GTDA 4NO7A 4YOUA 4ELVA 1X9WA 4C8KA 3LDPA 3SBGA 4DU1A 2CH6A 3HYFA 3WEEB 3VEXA 4DTNA 3CPEA 1VSFA 4LFAK 4OPKA 2Q0UA 3U6FA 5AZIA 1TAUA 4OX9K 3OS2A 3JSMA 3VQEA 4FVUA 1CZ9A 4I2PA 4CZJA 1ZBFA 3O3GA 2HHQA 4NCGA 4CECA 4CJSA 4CK1A 4Z4EA 4H5NA 1IG8A 4OVLA 5J2PA 2F9TA 1NOYA 4I9QA 4NYFA 4JKGB 3DXMA 3CD6N 1JCGA 3ZSZA 4CZMA 3F73A 4CEFA 3WNFA 3V9ZA 5HRPA 4LF5K 3OBYA 3DRPA 3C65A 5KGXA 5M1QA 1IJJA 4CE9A 1KVBA 1A5WA 4CEZA 5GIPA 3F5TA 4CZLA 1D9DA 1QS4A 3TAFA 1GOCA 3H45C 3ASMA 3V1OA 1IKVA 3WUHA 4O5FA 1L3TA 2Y1JA 1RILA 1TUYA 3LL3A 5AQVA 1JL2A 1QHAA 5KPZA 2O8CA 1UAXA 1WUAA 2Z1JA 2PFUA 1WSEA 4KV8A 4DF4A 4WF9L 4B1XB 1JXEA 4X65K 4O8UA 3PLAA 4YHHK 4RWTA 3FGUA 4FLXA 3NCIA 3M8SA 3NFAA 4FWMA 2BUPA 3HZ6A 4IFYA 1QVGM 2UXDK 1T7PA 2I5JA 4OLBA 2E6MA 1TL1A 4FWSA 1T8EA 4QOZB 1R59O 4E3SA 4OPAA 3AVMA 4DV3K 1KSPA 1QQNA 3AARA 5DMRA 4JK8A 5AQNA 4F9OA 3KK1A 3CCEN 1XWLA 4CFBA 2J4RA 4FYDA 2I7PA 1BU6O 2CGKA 2BH1A 1UA0A 2QW9A 3LP1A 3HO1A 4ILGB 2F7TA 1NJZA 4DV2K 3TWHA 3VQCA 4L8RB 2D0AA 4IO8A 4E7KA 2OPSA 3LPTA 3V9SA 1X9SA 2ITMA 4FM2A 1BIUA 4FWOA 4AH9A 3KJVA 5C42A 2P5GA 2HHHK 1VQPN 3DOLA 2YJEA 5LL6Z 3OVNA 2KFNA 5FPNA 3C7NA 4CF9A 1K8KA 3OYBA 5BRDA 3ZX2A 3HVTA 4CHYA 3ZSYA 5C2DA 1VQMN 1WSHA 5AQZA 4IJNA 2P9IA 4BRPA 3RMCA 4JKFA 1RTJA 3LDQA 3NBPA 2FBTA 4KTZA 4WQ5A 4B1VA 3ENBA 2HF3A 3CCQN 1S6PA 3OYKA 2A6AA 1LAVA 1V4TA 3LAKA 2P9SA 2D1KA 5AQKA 4BRDA 2VWKA 3J8AA 1W0HA 5GAEP 2A1SA 2OTLN 3QNOA 3SUPA 4FJIA 3HTVA 3AV9A 3C95A 1TK8A 5BRHA 1YTUA 2G8WA 3OS0A 1NWKA 3K5OA 4JKBA 1HMVA 1EP4A 4RW4A 4KH4A 2BE2A 2HHSA 4JI1K 4DSFA 2WC9A 1W7AA 1HQUA 1SQKA 4B8CA 2JWKA 4YOTA 4YDUC 1VSIA 1N6QA 2QM1A 4BE1A 3OYFA 3C0BA 3LZJA 2W6KA 4JS4A 1KLMA 1U45A 4H03B 5JVHL 1DKGD 3AAQA 2P51A 4CJVA 2PYLA 3D7EO 4M63C 2D0CA 3SAGA 1EXQA 3KVGA 3QB0A 4E1JA 4CBWA 4FCYA 4PKGA 3TTDA 3NF6A 4CCHA 1EX4A 1XNRK 1S9GA 2E8AA 1BWFO 4IKFA 4AM6A 3AVIA 3C94A 3MCAB 5LJVA 2P5OA 4DR4K 3ENOA 4KFBA 3U9ZA 3CQYA 3TSQA 5LJWA 2P9SB 4GKJK 3UB5A 3L6QA 4IOAL 2VWBA 3S3NA 2IVOA 1BG3A 2KZZA 1D4XA 1ZBLA 2E2NA 4R5PA 3HI0A 5E84A 4DSLA 4CGJA 1ASWA 3FZKA 3HOTA 1S1UA 2F9WA 3QFUA 3ZT2A 3CJ7A 4H5WA 4B1ZA 3QIOA 4N5SA 2ZGYA 2ZM6K 1IKYA 1NGFA 1HNXK 3FFKB 3MXJA 3PSIA 3ATUA 4XH5A 3TR8A 2KLAA 3LM9A 2KZMA 3TSPA 4H4MA 1I94K 4F3TA 1NKEA 1E4FT 3F9KA 5EX5A 4YORA 1YJNN 5EOYA 2E6LA 1C0UA 2PYJA 3CFPA 2W41A 3WQUA 1VSEA 1NKBA 3G0ZA 4CIEA 1NOZA 2ZJQL 1RBSA 3QICA 3THWA 4CFCA 3OW2M 3O1WA 3AA4A 3BEXA 5JMVA 2NRRA 5FDLA 5C25A 3SNNA 1J9AA 3D2EB 1O13A 1VRTA 1NJIO 4ELTA 4O55A 3WNEA 4YOWA 1SZ2A 2IVPA 3P38A 5AQUA 1WSFA 1BOTO 2HHTA 3VOVA 1HQEA 2JLEA 3BP8A 4CFDA 2O8BA 3VEWA 4DQQA 4J2AA 1BUPA 2YHBA 2E88A 4DR1K 1DTTA 3M5RA 4H0XB 1HNWK 3HVRA 4DV1K 4DSJA 3K2PA 3MN7A 1Q7YO 1C0MA 3U9DA 3RRHA 4IEIA 3J80O 1ITGA 1QSSA 4DR7K 1HPMA 2P9LB 3WXMB 3L2UA 3S9HA 3DLKA 4M42A 1YXQA 4JEPA 3VETA 2XY8A 3EE9A 1CXQA 2JGUA 4LSLA 3AVGA 3HBTA 4K25A 3NHGA 2FC0A 1NK9A 4EIAA 1RBTA 1G15A 2YNFA 1NK8A 1XNQK 2A40A 3VMFB 4KB0A 3SI6A 1QQMA 3UIQA 2YI1A 3LWMA 2V7ZA 1T6DA 1BDGA 4CIGA 5GAGP 4M3ZA 4DTRA 3MWPA 2I7NA 1RTDA 4KHWA 3ULEA 3K57A 3CETA 4E7LA 3QO9A 1NJXA 1XC9A 4FK2A 1RFQA 4JKCA 5M1OA 3VEYA 4X66K 2A5XA 1QVFM 4DTMA 1G99A 4DQPA 3WQTA 4JAXA 3O9TA 3CMEN 3NE6A 3SUOA 4HTLA 1GOBA 4CJQA 5CE3A 1I3AA 2DFEA 3JAMO 3MEGA 3M8RA 2NLXA 3MAQA 1NBWA 4N41A 4FM1A 1XQSC 3TTCA 4DB3A 2FSJA 4BC5A 4KH5A 3AGRA 2E4LA 3MXMA 4C8LA 3ZCMA 5AQHA 1N8RO 1Q18A 2VGNA 3AY9A 3KZBA 4RG8A 3R1XA 1DTQA 1OVQA 3B8AX 5F2RA 3ZSXA 1TK0A 2ZJPL 4PKHA 1TL3A 3NH0A 2H3GX 3KK3A 1U48A 1Q86O 4M3TA 4BY9C 3V1RA 3J7AP 4OGCA 3M8PA 1D5AA 5CY4A 5J1EA 3CJ1A 4QS9A 3E01A 1UA1A 1XI1A 4BQLA 3PSFA 2HBKA 2QXFA 2E2OA 4IO9L 4EP5A 4K8XA 4B3RK 4BRIA 4DG1A 3TARA 1S9EA 2X6NA 1GLEG 3QBWA 4WE1A 3HPOA 2KHOA 3W3DA 4WYBA 4FJ9A 2X78A 4Y0WA 3Q7BA 3AA3A 3CM6A 3K58A 3K59A 2QI2A 3T7ZA 3NVMA 4LFCK 3VQ8A 1YAGA 4DR3K 5IT9O 1EKEA 3QEPA 3O6WA 4KHPK 2QWOA 2WONA 4FL9A 4FJKA 3ZSRA 2E1YA 3TAEA 1NKCA 1A5XA 2NUBA 3KLHA 3FE1A 4XIUA 5KTQA 2OCEA 4CI6A 2RF2A 2YX6A 1S5JA 4F2RA 2F4VK 2IDOA 3NF7A 5JLFA 1GLCG 3KIOA 4BC2A 1RT1A 3TSUA 1BL3A 3KKSA 4Z4IA 1D8YA 4JI8K 2Q1NA 4Z4HA 4M7YA 3DWLA 3O3FA 1F21A 4BRQA 2ZQBA 5AQWA 4A2AA 3W0LA 5FRNA 3VQDA 4FXDA 1MA9B 2WOMA 4OKKA 2A42A 3VGLA 2O8DB 1JLEA 3FZFA 4H5RA 4Z0UA 5CZ2A 1J5OA 1S6QA 5EY4A 4LH4A 2Q36A 4DR6K 3A0IX 4B1UB 4CZFA 1XMOK 4DV4K 2HMIA 4M3UA 4W5OA 2EX3A 4CF0A 1S22A 5HRNA 2D0BA 2OPRA 4W5TA 1KCFA 3CCLN 1BQNA 4WFNL 3MCPA 4CFAA 1N34K 4OPHA 5C24A 3H46O 2HSTA 2JWLA 3AAPA 5KQDA 1ZBSA 2Z1IA 5JLHA 3LDLA 4U67L 4CZKA 3LPUA 3WNHA 3TABA 4RCHA 2IC3A 3SCXA 4KPYA 3EN9A 1ATNA 1LCUA 3DLEA 3EZ5A 3CMAN 3EYZA 4KI6A 2QTDA 1KAYA 3WXIA 2XY6A 3DLLL 4F8RA 1WLJA 4I2QA 2HBLA 3H1VX 4OO1J 3ZT1A 4N47A 5GINA 1BCOA 1BI4B 2YHXA 1VSMA 4DSIA 5BREA 1NK4A 3AVNA 4PL8A 3OYIA 5AQTA 1TKDA 3THVA 4NCBA 3KWIA 3NH2A 4FPBA 4CJRA 3LANA 1P8ZA 2P9PA 3VQBA 3T3FA 3E9PA 3AVHA 3HM8A 3VA3A 3EE8A 3GL1A 4BR0A 4ELUA 3PIOL 1YITN 2YHWA 3VQPA 3JS6A 5E41A 3CF5L 1S1XA 3QEIA 4MLEA 4KH6A 4DHYA 3CM5A 1RT7A 3JYTA 2IOCA 4NB4A 4FPAA 4A57A 1JKHA 3UKRA 3VTHA 2HF4A 3P1GA 2NRTA 3LWLA 1KFSA 4FWRA 3D0PA 3VQ6A 4E89A 3J7ZO 4GV3A 5ELZA 1JL1A 5JS1A 3DAWA 2Q97A 3QIPA 4YDUA 1JLFA 4CHQA 3T19A 3SQ4A 2O8FA 2ASOA 2FLOA 3M6GA 4E19A 4Z4GA 3OYEA 2R7YA 4AHSA 3AVBA 2LSNA 3ID8A 1U4BA 1VQNN 1ZC6A 4FLZA 3RRGA 1OH5A 3BF3A 3IG1A 3UKUA 3G71N 4B9SA 5A2QO 3ZLJA 4FZZA 4XH1A 3ENHA 2YNIA 3PUFA 2B5JA 3LDNA 2QEXN 2Z1GA 5AZIB 4RW7A 3V6DA 4QAGA 1FKPA 3ITHA 1J53A 1IBKK 3VF2A 4DTPA 3DLHA 3L2WA 3CC7N 2CGJA 4H5VA 1Q9YA 4KBOA 5KI6A 5CYQA 3DXMB 1KVAA 4ZTFA 4X64K 4O8KA 3MK6A 1DLOA 4FLWA 4E7JA 2O4IA 4LC9B 3LAMA 4M41A 4UQGA 1HKBA 2HB5A 3R8EA 1U49A 4QCLA 3WXLA 2FF6A 2YNHA 3SQ1A 1IH7A 2V7YA 1L3VA 2VGMA 3VERA 4WQ4C 5AQXA 3P31A 2QWPA 2GUPA 1KC8O 4EZ6A 3QEXA 4BR5A 4FZYA 3OS1A 4ISEA 1JLAA 2V51B 4NLBA 3HOSA 4WFAL 3ZT0A 3O1BA 4W5NA 2O8CB 3G10A 4IWVA 1IKXA 1W2BM 3CPWM 2YV0X 4CJEA 2O8FB 4MLHA 3TAPA 1M90O 2PZSA 3O4QA 2HNZA 4C8NA 3N4QA 5K14A 1KTQA 4CJ5A 3O4WA 1S1VA 2ATQA 5AQMA 4HUEA 1Q82O 4B8AB 4L3QA 4AILC 1WAJA 2QXLA 3O4NA 3O9QA 4AHTA 1YVNA 3B6PA 5KPTA 4Z4CA 4YNQA 1E4GT 1VQ8N 1IO2A 3EL2A 4CK3A 3QMLA 1FW6A 1RT3A 2ITGA 2ASPA 3L3VA 2RPIA 4GVEA 3H6EA 5AQJA 4NYNA 1RDCA 1ASVA 4H0PA 3DXKA 3ZEUA 4MFBA 3RMBA 3EY1A 4K43A 3RMDA 1IBMK 5JICA 2QKBA 3VN5A 4CHZA 5D3GA 4BR9A 4ZHRA 3BGRA 2FSKA 1K73O 1RBVA 1VAZA 2QKKA 1HR0K 4ID5A 3VEOA 3V9WA 4JHDA 1IBLK 4YFUA 4KREA 2A3ZA 3QNNA 3EKSA 4QS7A 1HKGA 4J2DA 4W5QA 3AVFA 1OVYA 3P5JA 3KTQA 4FK0A 3C7NB 1K8KB 2YKNA 1NJWA 2QWNA 5HROA 1WAFA 5GADP 4CJ4A 2P9IB 3O9UA 4AHCA 1TAQA 3MXIA 4CHNA 4CGHA 4DTJA 1C6VA 4DUYK 1QQCA 5DM7L 4DU3A 5AJ3K 1VK0A 3HL8A 1XMQK 4IZ9A 3T1AA 4LF4K 1EWQA 4BDYA 3HP9A 1ZBIA 1B92A 4XH4A 3ZX3A 1N32K 5AQFA 4QS8A 4B3OA 1SUQA 2D0OA 1KLNA 2ASMA 1HYZA 4K42A 3M8QA 1JCFA 3NGIA 4I6MA 4DR5K 3IRXA 3PO5A 5GIOA 3SMPA 3QINA 3RR7A 2G8VA 1X3NA 4IEEA 4BROA 4IFVA 4KKOA 4AQYK 4OPJA 3ZT3A 2UXCK 1RDBA 3BF1A 5AR0A 4OJRA 1YVUA 3SPYA 3AVCA 3AVKA 5FPEA 1K9MO 4KHYA 3MECA 1HKCA 1YIJN 4B9TA 4FM0A 1GLDG 1QZ6A 3OBWA 5BPLA 5HL7L 5AQIA 4HUFA 2VG7A 3TAMA 5BPMA 3MMVA 4MDAA 5AQQA 1WBBA 2WBNA 4PUOA 4ICLA 4H0VB 3AVAA 1SL1A 4DFKA 4FJNA 1RT6A 1RDDA 2GELA 4B3MK 1JLGA 4Q5VA 2ZD1A 4LFBK 4C1NK 2OZMA 5F1XA 3L4IA 3TPQA 1DEJA 1HX1A 2DFHA 4CERA 4CJTA 4FSVA 4CEOA 5AZJA 3R6MA 5CR4A 2QA4N 3CQXA 3KWGA 3DJCA 4DR2K 4DFMA 2RN2A 1EETA 4PQUA 3P83D 4AHVA 1JXBA 1L3UA 5EXWA 2W42A 1WNSA 5BN9A 1ZBUA 3N4PA 2UXBK 4CHOA 4B08A 4IDKA 3VGKA 5AFUH 2AJQA 1ATSA 1Y97A 2PBDA 3DRRA 4FLUA 1RDAA 3VPZA 2Q3SA 1ZYQA 3UE5A 2Y1IA 1P90A 3QLHA 4GKKK 4DUZK 4HCBA 4EP4A 4DU4A 1Q9XA 3EO3A 4BC4A 4FWKA 4N76A 1JLQA 2P1JA 1HYSA 4BVPA 3LP3A 1SV5A 4BWMA 1RTHA 4FLVA 3DMJA 1VRUA 1H1VA 4IDHA 1IG9A 3AA2A 4JI3K 3NGYA 1SKWA 4PL7A 4JKAA 4FJJA 4OGEA 4BRHA 2BTFA 4Q0BA 1UWBA 4ILJA 3NMUA 3OA9A 5HLFA 4FOEA 3THWB 2X6SA 2GBZA 2KKZA 1HPZA 4AHRA 3WXJA 2O8EA 1ATRA 1LWCA 3VQQA 1QQOA 1MWMA 3D45A 4C8OA 5JS2A 1VQ4N 3AVLA 3MWTA 3H1QA 1VHXA 3THXA 3S3OA 2P9UA 1X9JA 4FJLA 4JYAK 2AA4A 3NDKA 3AO1A 2HVIA 4A5BA 4KI4A 3OY9A 2OPQA 4GNIA 1N33K 3MEDA 2E20A 3T1HK 2NNWA 3SUQA 3T69A 3OTOK 4JI7K 3FFIA 2O8BB 4Y1DA 1TYQA 3SAFA 5H1SQ 1VQ9N 4JLHA 3QERA 4J2BA 4NCAA 1QZ5A 1KD1O 3A5MC 1BCMA 4PY5A 3SQ0A 3SQ2A 3FLCO 3H3NO 2FF3B 4CESA 4LH5A 4IBNA 2CH5A 1WSJA 1NGJA 2GWKA 4IG3A 4B1YB 1RT5A 4GY2B 4E7HA 3SJHA 3VF6A 3CCMN 4MO4A 3E9LA 1SS6A 2G8FA 2VG5A 3VESA 5AQGA 3ISNC 4DKWA 3SYZA 3A5NC 2WFBA 2G8IA 4HCCA 1BISA 3EZWA 2E2QA 4M7XA 4FJ8A 3KKRA 4BC3A 3CIPA 1FJGK 1CZAN 4BRCA 3DOKA 4JRPA 3ULEB 1QSYA 2XHBA 1RCHA 5CYMA 1J54A 4FJGA 3P39A 1X3MA 1HRHA 3DM2A 1YF5L 3C6TA 4DV7K 3LALA 3NAEA 4JD2A 4JI2K 2KFZA 3I0RA 4B9QA 3KLIA 3TTFA 3SLCA 3ZSQA 2HHXA 3RSEA 2B6AA 2EWSA 1LWFA 4V19S 1U2VA 1NMDA 4H0OA 1IV0A 4GMJB 3PV8A 1RNHA 4KHNA 4DV6K 4DLEA 4OKEA 5EVZA 2YCHA 4DS4A 4DFJA 2ZE2A 2HBMA 4DQIA 1RT4A 4BRKA 3MDQA 4BR7A 5T7BA 1GLJO 1T44A 3QEVA 2O4GA 4CJPA 3CFRA 1TKZA 3SPZA 4F4KA 1A5VA 1S1WA 4B9VA 3CJBA 4JK9A 4LY7A 3T1YK 3CCUN 1T05A 1KFDA 4FO0A 4IFEA 5IWAK 3V9UA 1M1KO 1QSLA 4K41A 1ZXOA 1LOTB 3SV3A 4A59A 4DWIA 2IVNA 3WXKA 3IAYA 4IG0A 4OLAA 4CGIA 2F8TA 1NGAA 1NK6A 3VTIA 3IS9A 4CIFA 2XO7A 2Q2RA 4A61A 2OPPA 5AQRA 4DQ8A 5FPDA 2HMPA 1HJRA 2FBYA 2OTJN 3K5MA 3EEQA 4DV5K 4GV9A 1R0AA 3KHYA 4RW8A 2DPNA 4FJ5A 4BE0A 4PWDA 4IXCA 3J81O 3CC4N 1YJ9N 5KGWA 2QWMA 4J8FA 1S72N 2QK9A 3SJJA 4O0IA 2G8UA 3VQ7A 4JKGA 2VYPA 4BRLA 2D0PA 2ZGZA 5HRSA 4IOCL 1FXXA 4WQ4A 1W9HA 2XY5A 3CCSN 1KRPA 3O5BA 2ZF5O 1NU0A 3RSEB 2Z1HA 5I42A 4CJFA 1K8AO 5KPRA 3I8BA 1YJWN 4CK2A 3GE1A 2FBXA 4TSXA 3RMAA 3V81A 5M1FA 3KK2A 5I3UA 4M45A 4B9UA 1QTMA 4PA1A 4H5TA 1X1PA 2A1RA 1SKSA 1U47A 4KB1A 2G8HA 3CJAA 3S41A 4FWPA 5ADXH 2XY7A 3MN5A 4CF2A 4CJ7A 4NLCA 2GEMA 3ALYA 4FJXA 4EHUA 4CJLA 3I55N 1REVA 4BRAA 3AO2A 3KD5E 1CXUA 4I7FA 3M3ZA 4CF1A 1SAZA 3IFRA 1HJOA 1OH6A 2IIRA 5C12A 2WUSA 1C1BA 4B9LA 5CHIA 4BVOA 2RHKA 4ILHA 4BE2A 4O5BA 3FZHA 4PKIA 1DT9A 3D6RA 4DQSA 3HSTB 3U4LA 5E26A 1YHQN 4JNEA 4A5AA 3MX5A 1GOAA 3I8DA 1BGXT 1TGOA 4FZXC 3DLGA 4FJMA 4KTWA 5FROA 1HYVA 3TAGA 2HOEA 4FOIA 5M1NA 4YY3K 1ILYA 2OANA 1WSGA 4CEAA 2YNGA 1LWEA 3O8MA 1GLFO 3VGMA 4CVNE 3K0SA 4BRFA 4CEEA 1KQSM 1QHTA 1YUWA 1VQON 1HLUA 2HHVA 4BR2A 3I0SA 1Z26A 1WN7A 4BGAA 1MDUB 2Q31A 3HRGA 5KQ8A 3ID6A 4IJAA 1FK9A 1RTIA 4HTUA 5HRRA 3MN9A 2QWQA 1JJ2M 3DYAA 2P9PB 4CJWA 1HUXA 3DI6A 4MO5A 4JI4K 2IGIA 3U3YA 3LDSA 3HP6A 4E1MA 1NGEA 1LAWA 3E66A 4CEQA 3ZETA 5KRSA 4J2EA 2BDPA 1NLVA 2DTUA 2YHAA 4CF8A 1J5EK 4BDPA 3IDHA 5SZTA 4DSEA 4B3TK 2E1ZA 4JKHA 3CCJN 2HBJA 3AO4A 4KAZA 3UKRB 4LD0A 3K9KA 2NRXA 4I9LA 3KLEA 2FXUA 3BDPA 4GV6A 4AF1A 1Y64A 5AQLA 4CGGA 2BANA 5BRFA 3SBTA 4CZIA 1NGBA 2F96A 2Q0RA 2NRZA 1NMNA 4KO0A 4BR4A 1OH8A 3DRSA 4CGDA 5C0YA 1B9DA 4FW1A 3GOIA 3OHRA 3A8YA 3A5LC 5AFUA 3L0QA 3QESA 4JI6K 4Z4FA 4FLTA 1WB9A 5I9EB 4BREA 3O9SA 1KAXA 4CBXA 5FRMA 3HT3A 1CZBA 4DFPA 3UKUB 1RDWX 5HOOA 2VQEK 3HPHA 4MQ3A 1EWRA 1SKRA 4WCEL 3HJFA 3VF4A 5J2MA 2NRVA 3F2KA 3ULDA 4FK4A 3TAQA 3LDOA 1TVRA 2UUCK 3ZETB 1B9FA 1C0GA 5B8HA 1XC3A 4HVJA 1YTAA 4H0YB 4C1NI 4DLGA 1LV5A 2YHYA 2KW4A 4ID1A 3HXMA 4UY8O 1ZBHA 4LF7K 5MLCQ 1U6ZA 4H0TB 4HUGA 1Q8IA 2ZWHA 1JLBA 5TKYA 3K5NA 1NJYA 5CZ1A 5AQPA 2P9NA 2F8SA 1FKOA 3L8BA 1T03A 1C0TA 4G9ZA 4FJ7A 2D5RA 3TANA 3CCRN 1U04A 1VSLA 3K5LA 3L2VA 3OYGA 4M3XA 3RTVA 5BR8K 1C0FA 2HVHA 1K6YA 1J6ZA 4YOXA 2GV9A 4CZEA 1UOCA 3GDQA 4JI0K 4KRFA 3O9RA 2D4WA 3A2FA 4LSNA 4BG8A 4FJHA 3AVJA 2IAJA 3IUCA 3V4IA 5C15A 4ISGA 2OZSA 3SMSA 1VSKA 3HM9A 4GVMA 3OYNA 1WSIA 1TK5A 5BPNA 1E3MA 1IKWA 3KD1E 4FWLA 2BGGA 3HPGA 4BRMA 3VQ5A 1LW2A 4DTXA 3JXUA 4BWJA 3HSCA 3BUZB 3D2FA 2ZJRL 3D2EA 3OJSA 2PAVA 1L3SA 4M3WA 2WTUA 3VQ4A 4EFHA 4PHTX 3DXKB 3ZEUB 1L5UA 2KQ2A 1XUPO 2HHWA 4O0JA 3L2RA 3MX2A 3VQ9A 3TI0A 3VA0A 4RW6A 3O80A 1RBRA 1JCEA 3MN6A 3K9JA 3NF8A 1ASUA 3S3MA 4BQZA 5GAHP 1BHLA 4NXMK 2W40A 1BA1A 4JHDB 4B3SK 2P9NB 4CD3A 3F9MA 3SUNA 3NF9A 2E2PA 4DTOA 5HBMA 3GG4A 4XEIA 1Q81O 2YJFA 3OYDA 3THYA 4DV0K 4DCHA 2P9LA 1TKTA 4Z94A 1NG9A 4MDBA 1NGIA 3CFOA 1V4SA 2NRHA 1KXPA 5SWMA 2QWLA 1BO5O
chains in the Genus database with same CATH topology
1N36K 4DUYK 4JI4K 5AJ3K 4LF6K 1FJGK 1XMQK 2ZM6K 4GKKK 1HNXK 4DUZK 1HNZK 4LF4K 2VQFK 4JI5K 5LMNK 4LF9K 2UUBK 5BR8K 2F4VK 1N32K 1J5EK 1I94K 4B3TK 4JI0K 2E5LK 4DV7K 4X65K 4X66K 4JI8K 4DR5K 4JI3K 4JI2K 4YHHK 4AQYK 2UXCK 4V19S 4JI1K 4DV6K 3JAMO 2UXDK 2UUAK 4DV3K 4JYAK 5FLXO 4DR6K 1XMOK 4JI6K 4DV4K 1N33K 4NXNK 3T1YK 3T1HK 4LF8K 4JV5K 5IWAK 1IBMK 1N34K 3OTOK 4JI7K 2VQEK 3J7AP 5A2QO 4LFAK 4YY3K 3J7YP 4DR1K 4NXMK 4CW7B 4DV2K 4B3MK 1XNRK 1HR0K 4B3SK 4X62K 4LFBK 4CVNE 1HNWK 4DV1K 4OX9K 5LMUK 1IBLK 1IBKK 4DV5K 4K0KK 4DR4K 2UUCK 4B3RK 3J80O 4DR7K 4GKJK 3J81O 2HHHK 4DR2K 4X64K 5LL6Z 4DV0K 4LF7K 4LFCK 4LF5K 2UU9K 2UXBK 4DR3K 5IT9O 4KHPK 1XNQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 K;  4DUY K;  4JI4 K;  5AJ3 K;  4LF6 K;  1FJG K;  1XMQ K;  2ZM6 K;  4GKK K;  1HNX K;  4DUZ K;  1HNZ K;  4LF4 K;  2VQF K;  4JI5 K;  5LMN K;  4LF9 K;  2UUB K;  5BR8 K;  2F4V K;  1N32 K;  1J5E K;  1I94 K;  4B3T K;  4JI0 K;  2E5L K;  4DV7 K;  4X65 K;  4X66 K;  4JI8 K;  4DR5 K;  4JI3 K;  4JI2 K;  4YHH K;  4AQY K;  2UXC K;  4V19 S;  4JI1 K;  4DV6 K;  3JAM O;  2UXD K;  2UUA K;  4DV3 K;  4JYA K;  5FLX O;  4DR6 K;  1XMO K;  4JI6 K;  4DV4 K;  1N33 K;  4NXN K;  3T1Y K;  3T1H K;  4LF8 K;  4JV5 K;  5IWA K;  1IBM K;  1N34 K;  3OTO K;  4JI7 K;  2VQE K;  3J7A P;  5A2Q O;  4LFA K;  4YY3 K;  3J7Y P;  4DR1 K;  4NXM K;  4CW7 B;  4DV2 K;  4B3M K;  1XNR K;  1HR0 K;  4B3S K;  4X62 K;  4LFB K;  4CVN E;  1HNW K;  4DV1 K;  4OX9 K;  5LMU K;  1IBL K;  1IBK K;  4DV5 K;  4K0K K;  4DR4 K;  2UUC K;  4B3R K;  3J80 O;  4DR7 K;  4GKJ K;  3J81 O;  2HHH K;  4DR2 K;  4X64 K;  5LL6 Z;  4DV0 K;  4LF7 K;  4LFC K;  4LF5 K;  2UU9 K;  2UXB K;  4DR3 K;  5IT9 O;  4KHP K;  1XNQ K; 
#chains in the Genus database with same CATH topology
 2FBV A;  1NK0 A;  1VQ5 N;  4M3Y A;  1EQY A;  1N36 K;  3CC2 N;  4GW6 A;  1GLL O;  4WQ5 C;  1NGC A;  3RWU A;  1RGI A;  3B6O A;  4DQR A;  1NGD A;  3AO5 A;  4H4O A;  4FWQ A;  5C2F A;  1BQM A;  5HP1 A;  1DGK N;  3G4S N;  1VQ6 N;  3VEV A;  3L2Q A;  3D2F B;  4RW9 A;  1C1A A;  4JKD A;  3C6H A;  4B1W B;  4JRQ A;  3ZSO A;  2GUI A;  4I6M B;  1VQK N;  3LP2 A;  1TUU A;  3OYM A;  4A2B A;  3A5O C;  5FPM A;  3H3O B;  5LY3 A;  3ATV A;  3OYC A;  4AHU A;  5F0X A;  3QBX A;  3R3L A;  2AP1 A;  4YOY A;  1LW0 A;  4EHT A;  1GLB G;  2VCP A;  1VQL N;  4B9M A;  4WFB L;  1OKJ A;  2KTQ A;  3ZT4 A;  4KHS A;  4BGB A;  2X74 A;  3RVC A;  3BZC A;  3FZM A;  5KRT A;  3RR8 A;  3WT0 A;  5BN8 A;  1HNV A;  3BY5 A;  1NNE A;  3CCV N;  3I33 A;  4C23 A;  3DLR A;  5FLX O;  2HHU A;  3HK2 A;  3AA5 X;  4EZ9 A;  3THY B;  4YOV A;  1NM1 A;  4R79 A;  4C8M A;  4JV5 K;  4BRN A;  2UYT A;  3M1F A;  5ADX A;  3J7Y P;  2CGL A;  4RTF D;  3VEN A;  1YT3 A;  3ZSW A;  4CW7 B;  4CHP A;  4E0D A;  4CBU A;  4K0K K;  4Y1C A;  5C10 A;  4DTU A;  2ETJ A;  5AZJ B;  4H8K A;  3WNG A;  2NRW A;  1QE1 A;  3AO3 A;  3FZL A;  2OYQ A;  4E7I A;  3C6U A;  3ZX0 A;  1NK5 A;  3LM2 A;  3NH1 A;  1SL2 A;  2EHG A;  1KVC A;  3IMX A;  1TV6 A;  3Q7C A;  2NZT A;  4KTQ A;  3LZI A;  3R9P A;  3GBT A;  1BIZ A;  3PO4 A;  2GWJ A;  3KLG A;  1RDU A;  4FVM A;  4DTS A;  2PY5 A;  3PX6 A;  3BZK A;  3QFP A;  3U3G A;  4M3R A;  3E1Y A;  3V1Q A;  2RKI A;  1NK7 A;  4F2S A;  2HND A;  3IKM A;  3PIP L;  3CJC A;  4IOX A;  1HNZ K;  3I56 N;  3OYA A;  1O1W A;  3CI5 A;  2VQF K;  4BG9 A;  3P4I A;  2UUB K;  5DK5 A;  1KAZ A;  4W5R A;  2E5L K;  1EO1 A;  2G8K A;  1TKX A;  4CJU A;  3CER A;  4ISF A;  4HWI A;  3SK3 A;  5J2N A;  4BRG A;  2O8E B;  1BA0 A;  3OJU A;  4B9N A;  1T6C A;  4CD1 A;  2A41 A;  3OYL A;  2O8D A;  4O4G A;  3THX B;  2UUA K;  2W6L A;  4KHQ A;  2P9U B;  2OA8 A;  4BAC A;  1VSD A;  4E1N A;  4K8Z A;  4NXN K;  3CXC M;  1VQ7 N;  3G25 A;  3VQA A;  4LF8 K;  4CEB A;  4CGF A;  2V52 B;  3SAH A;  3L3U A;  1TYQ B;  3CQ8 A;  3ZSV A;  3PX0 A;  4DMN A;  3DLB A;  2P9K A;  3V9X A;  2VG6 A;  5M1K A;  4BDZ A;  3SZ2 A;  4FWN A;  4JS5 A;  4CZG A;  4N56 A;  1S3X A;  1MWK A;  3VEZ A;  4JKE A;  4X62 K;  4G1Q A;  3G6E N;  3TU5 A;  1X9M A;  1OH7 A;  5LMU K;  5J2Q A;  1ESV A;  3CJ9 A;  4CJ3 A;  4U7B A;  3KLF A;  1N5Y A;  1XHX A;  2VWJ A;  3LP0 A;  5AQS A;  2QWR A;  1D9F A;  4JN4 A;  2RE2 A;  2DY4 A;  1GLA G;  3L4Q A;  1SL0 A;  1HNI A;  5JVG L;  3FR0 A;  4FW2 A;  1BI4 A;  5BR9 A;  3QDK A;  2UU9 K;  3WEE A;  5M1P A;  1VSJ A;  1Z25 A;  1I39 A;  4DSK A;  5DM6 L;  3EKU A;  4LF6 K;  4CED A;  2HNY A;  3QEW A;  4DF8 A;  5EU7 A;  4HHT A;  1WOQ A;  2DFF A;  4CJK A;  3AGK A;  1S1T A;  1XHZ A;  4JI5 K;  4O44 A;  3CG7 A;  3SV4 A;  5LMN K;  1JLC A;  4LF9 K;  3MEE A;  1NGH A;  3NGZ A;  2XRI A;  1Z05 A;  5AQO A;  4ZTJ A;  4A62 A;  1WBD A;  3E9O A;  1NGG A;  5TKW A;  3CHW A;  3H08 A;  4OKJ A;  1W97 L;  4JD2 B;  2B4J A;  4DS5 A;  2HW3 A;  3OYH A;  3U8X A;  1MU2 A;  4EAH D;  1Z6R A;  3PX4 A;  1U2V B;  2YKM A;  2IS3 A;  3O3H A;  3OYJ A;  2P9K B;  1CLQ A;  1RBU A;  4JK7 A;  5AQY A;  2FSN A;  1VSH A;  3CYM A;  1YI2 N;  1C1C A;  3PY8 A;  3ZYY X;  4CZH A;  4FLY A;  3QET A;  3O08 A;  4F3O A;  3C6A A;  3NVK A;  4AM7 A;  1RT2 A;  4KHU A;  3KK7 A;  1T3V A;  2GX9 A;  2GTD A;  4NO7 A;  4YOU A;  4ELV A;  1X9W A;  4C8K A;  3LDP A;  3SBG A;  4DU1 A;  2CH6 A;  3HYF A;  3WEE B;  3VEX A;  4DTN A;  3CPE A;  1VSF A;  4LFA K;  4OPK A;  2Q0U A;  3U6F A;  5AZI A;  1TAU A;  4OX9 K;  3OS2 A;  3JSM A;  3VQE A;  4FVU A;  1CZ9 A;  4I2P A;  4CZJ A;  1ZBF A;  3O3G A;  2HHQ A;  4NCG A;  4CEC A;  4CJS A;  4CK1 A;  4Z4E A;  4H5N A;  1IG8 A;  4OVL A;  5J2P A;  2F9T A;  1NOY A;  4I9Q A;  4NYF A;  4JKG B;  3DXM A;  3CD6 N;  1JCG A;  3ZSZ A;  4CZM A;  3F73 A;  4CEF A;  3WNF A;  3V9Z A;  5HRP A;  4LF5 K;  3OBY A;  3DRP A;  3C65 A;  5KGX A;  5M1Q A;  1IJJ A;  4CE9 A;  1KVB A;  1A5W A;  4CEZ A;  5GIP A;  3F5T A;  4CZL A;  1D9D A;  1QS4 A;  3TAF A;  1GOC A;  3H45 C;  3ASM A;  3V1O A;  1IKV A;  3WUH A;  4O5F A;  1L3T A;  2Y1J A;  1RIL A;  1TUY A;  3LL3 A;  5AQV A;  1JL2 A;  1QHA A;  5KPZ A;  2O8C A;  1UAX A;  1WUA A;  2Z1J A;  2PFU A;  1WSE A;  4KV8 A;  4DF4 A;  4WF9 L;  4B1X B;  1JXE A;  4X65 K;  4O8U A;  3PLA A;  4YHH K;  4RWT A;  3FGU A;  4FLX A;  3NCI A;  3M8S A;  3NFA A;  4FWM A;  2BUP A;  3HZ6 A;  4IFY A;  1QVG M;  2UXD K;  1T7P A;  2I5J A;  4OLB A;  2E6M A;  1TL1 A;  4FWS A;  1T8E A;  4QOZ B;  1R59 O;  4E3S A;  4OPA A;  3AVM A;  4DV3 K;  1KSP A;  1QQN A;  3AAR A;  5DMR A;  4JK8 A;  5AQN A;  4F9O A;  3KK1 A;  3CCE N;  1XWL A;  4CFB A;  2J4R A;  4FYD A;  2I7P A;  1BU6 O;  2CGK A;  2BH1 A;  1UA0 A;  2QW9 A;  3LP1 A;  3HO1 A;  4ILG B;  2F7T A;  1NJZ A;  4DV2 K;  3TWH A;  3VQC A;  4L8R B;  2D0A A;  4IO8 A;  4E7K A;  2OPS A;  3LPT A;  3V9S A;  1X9S A;  2ITM A;  4FM2 A;  1BIU A;  4FWO A;  4AH9 A;  3KJV A;  5C42 A;  2P5G A;  2HHH K;  1VQP N;  3DOL A;  2YJE A;  5LL6 Z;  3OVN A;  2KFN A;  5FPN A;  3C7N A;  4CF9 A;  1K8K A;  3OYB A;  5BRD A;  3ZX2 A;  3HVT A;  4CHY A;  3ZSY A;  5C2D A;  1VQM N;  1WSH A;  5AQZ A;  4IJN A;  2P9I A;  4BRP A;  3RMC A;  4JKF A;  1RTJ A;  3LDQ A;  3NBP A;  2FBT A;  4KTZ A;  4WQ5 A;  4B1V A;  3ENB A;  2HF3 A;  3CCQ N;  1S6P A;  3OYK A;  2A6A A;  1LAV A;  1V4T A;  3LAK A;  2P9S A;  2D1K A;  5AQK A;  4BRD A;  2VWK A;  3J8A A;  1W0H A;  5GAE P;  2A1S A;  2OTL N;  3QNO A;  3SUP A;  4FJI A;  3HTV A;  3AV9 A;  3C95 A;  1TK8 A;  5BRH A;  1YTU A;  2G8W A;  3OS0 A;  1NWK A;  3K5O A;  4JKB A;  1HMV A;  1EP4 A;  4RW4 A;  4KH4 A;  2BE2 A;  2HHS A;  4JI1 K;  4DSF A;  2WC9 A;  1W7A A;  1HQU A;  1SQK A;  4B8C A;  2JWK A;  4YOT A;  4YDU C;  1VSI A;  1N6Q A;  2QM1 A;  4BE1 A;  3OYF A;  3C0B A;  3LZJ A;  2W6K A;  4JS4 A;  1KLM A;  1U45 A;  4H03 B;  5JVH L;  1DKG D;  3AAQ A;  2P51 A;  4CJV A;  2PYL A;  3D7E O;  4M63 C;  2D0C A;  3SAG A;  1EXQ A;  3KVG A;  3QB0 A;  4E1J A;  4CBW A;  4FCY A;  4PKG A;  3TTD A;  3NF6 A;  4CCH A;  1EX4 A;  1XNR K;  1S9G A;  2E8A A;  1BWF O;  4IKF A;  4AM6 A;  3AVI A;  3C94 A;  3MCA B;  5LJV A;  2P5O A;  4DR4 K;  3ENO A;  4KFB A;  3U9Z A;  3CQY A;  3TSQ A;  5LJW A;  2P9S B;  4GKJ K;  3UB5 A;  3L6Q A;  4IOA L;  2VWB A;  3S3N A;  2IVO A;  1BG3 A;  2KZZ A;  1D4X A;  1ZBL A;  2E2N A;  4R5P A;  3HI0 A;  5E84 A;  4DSL A;  4CGJ A;  1ASW A;  3FZK A;  3HOT A;  1S1U A;  2F9W A;  3QFU A;  3ZT2 A;  3CJ7 A;  4H5W A;  4B1Z A;  3QIO A;  4N5S A;  2ZGY A;  2ZM6 K;  1IKY A;  1NGF A;  1HNX K;  3FFK B;  3MXJ A;  3PSI A;  3ATU A;  4XH5 A;  3TR8 A;  2KLA A;  3LM9 A;  2KZM A;  3TSP A;  4H4M A;  1I94 K;  4F3T A;  1NKE A;  1E4F T;  3F9K A;  5EX5 A;  4YOR A;  1YJN N;  5EOY A;  2E6L A;  1C0U A;  2PYJ A;  3CFP A;  2W41 A;  3WQU A;  1VSE A;  1NKB A;  3G0Z A;  4CIE A;  1NOZ A;  2ZJQ L;  1RBS A;  3QIC A;  3THW A;  4CFC A;  3OW2 M;  3O1W A;  3AA4 A;  3BEX A;  5JMV A;  2NRR A;  5FDL A;  5C25 A;  3SNN A;  1J9A A;  3D2E B;  1O13 A;  1VRT A;  1NJI O;  4ELT A;  4O55 A;  3WNE A;  4YOW A;  1SZ2 A;  2IVP A;  3P38 A;  5AQU A;  1WSF A;  1BOT O;  2HHT A;  3VOV A;  1HQE A;  2JLE A;  3BP8 A;  4CFD A;  2O8B A;  3VEW A;  4DQQ A;  4J2A A;  1BUP A;  2YHB A;  2E88 A;  4DR1 K;  1DTT A;  3M5R A;  4H0X B;  1HNW K;  3HVR A;  4DV1 K;  4DSJ A;  3K2P A;  3MN7 A;  1Q7Y O;  1C0M A;  3U9D A;  3RRH A;  4IEI A;  3J80 O;  1ITG A;  1QSS A;  4DR7 K;  1HPM A;  2P9L B;  3WXM B;  3L2U A;  3S9H A;  3DLK A;  4M42 A;  1YXQ A;  4JEP A;  3VET A;  2XY8 A;  3EE9 A;  1CXQ A;  2JGU A;  4LSL A;  3AVG A;  3HBT A;  4K25 A;  3NHG A;  2FC0 A;  1NK9 A;  4EIA A;  1RBT A;  1G15 A;  2YNF A;  1NK8 A;  1XNQ K;  2A40 A;  3VMF B;  4KB0 A;  3SI6 A;  1QQM A;  3UIQ A;  2YI1 A;  3LWM A;  2V7Z A;  1T6D A;  1BDG A;  4CIG A;  5GAG P;  4M3Z A;  4DTR A;  3MWP A;  2I7N A;  1RTD A;  4KHW A;  3ULE A;  3K57 A;  3CET A;  4E7L A;  3QO9 A;  1NJX A;  1XC9 A;  4FK2 A;  1RFQ A;  4JKC A;  5M1O A;  3VEY A;  4X66 K;  2A5X A;  1QVF M;  4DTM A;  1G99 A;  4DQP A;  3WQT A;  4JAX A;  3O9T A;  3CME N;  3NE6 A;  3SUO A;  4HTL A;  1GOB A;  4CJQ A;  5CE3 A;  1I3A A;  2DFE A;  3JAM O;  3MEG A;  3M8R A;  2NLX A;  3MAQ A;  1NBW A;  4N41 A;  4FM1 A;  1XQS C;  3TTC A;  4DB3 A;  2FSJ A;  4BC5 A;  4KH5 A;  3AGR A;  2E4L A;  3MXM A;  4C8L A;  3ZCM A;  5AQH A;  1N8R O;  1Q18 A;  2VGN A;  3AY9 A;  3KZB A;  4RG8 A;  3R1X A;  1DTQ A;  1OVQ A;  3B8A X;  5F2R A;  3ZSX A;  1TK0 A;  2ZJP L;  4PKH A;  1TL3 A;  3NH0 A;  2H3G X;  3KK3 A;  1U48 A;  1Q86 O;  4M3T A;  4BY9 C;  3V1R A;  3J7A P;  4OGC A;  3M8P A;  1D5A A;  5CY4 A;  5J1E A;  3CJ1 A;  4QS9 A;  3E01 A;  1UA1 A;  1XI1 A;  4BQL A;  3PSF A;  2HBK A;  2QXF A;  2E2O A;  4IO9 L;  4EP5 A;  4K8X A;  4B3R K;  4BRI A;  4DG1 A;  3TAR A;  1S9E A;  2X6N A;  1GLE G;  3QBW A;  4WE1 A;  3HPO A;  2KHO A;  3W3D A;  4WYB A;  4FJ9 A;  2X78 A;  4Y0W A;  3Q7B A;  3AA3 A;  3CM6 A;  3K58 A;  3K59 A;  2QI2 A;  3T7Z A;  3NVM A;  4LFC K;  3VQ8 A;  1YAG A;  4DR3 K;  5IT9 O;  1EKE A;  3QEP A;  3O6W A;  4KHP K;  2QWO A;  2WON A;  4FL9 A;  4FJK A;  3ZSR A;  2E1Y A;  3TAE A;  1NKC A;  1A5X A;  2NUB A;  3KLH A;  3FE1 A;  4XIU A;  5KTQ A;  2OCE A;  4CI6 A;  2RF2 A;  2YX6 A;  1S5J A;  4F2R A;  2F4V K;  2IDO A;  3NF7 A;  5JLF A;  1GLC G;  3KIO A;  4BC2 A;  1RT1 A;  3TSU A;  1BL3 A;  3KKS A;  4Z4I A;  1D8Y A;  4JI8 K;  2Q1N A;  4Z4H A;  4M7Y A;  3DWL A;  3O3F A;  1F21 A;  4BRQ A;  2ZQB A;  5AQW A;  4A2A A;  3W0L A;  5FRN A;  3VQD A;  4FXD A;  1MA9 B;  2WOM A;  4OKK A;  2A42 A;  3VGL A;  2O8D B;  1JLE A;  3FZF A;  4H5R A;  4Z0U A;  5CZ2 A;  1J5O A;  1S6Q A;  5EY4 A;  4LH4 A;  2Q36 A;  4DR6 K;  3A0I X;  4B1U B;  4CZF A;  1XMO K;  4DV4 K;  2HMI A;  4M3U A;  4W5O A;  2EX3 A;  4CF0 A;  1S22 A;  5HRN A;  2D0B A;  2OPR A;  4W5T A;  1KCF A;  3CCL N;  1BQN A;  4WFN L;  3MCP A;  4CFA A;  1N34 K;  4OPH A;  5C24 A;  3H46 O;  2HST A;  2JWL A;  3AAP A;  5KQD A;  1ZBS A;  2Z1I A;  5JLH A;  3LDL A;  4U67 L;  4CZK A;  3LPU A;  3WNH A;  3TAB A;  4RCH A;  2IC3 A;  3SCX A;  4KPY A;  3EN9 A;  1ATN A;  1LCU A;  3DLE A;  3EZ5 A;  3CMA N;  3EYZ A;  4KI6 A;  2QTD A;  1KAY A;  3WXI A;  2XY6 A;  3DLL L;  4F8R A;  1WLJ A;  4I2Q A;  2HBL A;  3H1V X;  4OO1 J;  3ZT1 A;  4N47 A;  5GIN A;  1BCO A;  1BI4 B;  2YHX A;  1VSM A;  4DSI A;  5BRE A;  1NK4 A;  3AVN A;  4PL8 A;  3OYI A;  5AQT A;  1TKD A;  3THV A;  4NCB A;  3KWI A;  3NH2 A;  4FPB A;  4CJR A;  3LAN A;  1P8Z A;  2P9P A;  3VQB A;  3T3F A;  3E9P A;  3AVH A;  3HM8 A;  3VA3 A;  3EE8 A;  3GL1 A;  4BR0 A;  4ELU A;  3PIO L;  1YIT N;  2YHW A;  3VQP A;  3JS6 A;  5E41 A;  3CF5 L;  1S1X A;  3QEI A;  4MLE A;  4KH6 A;  4DHY A;  3CM5 A;  1RT7 A;  3JYT A;  2IOC A;  4NB4 A;  4FPA A;  4A57 A;  1JKH A;  3UKR A;  3VTH A;  2HF4 A;  3P1G A;  2NRT A;  3LWL A;  1KFS A;  4FWR A;  3D0P A;  3VQ6 A;  4E89 A;  3J7Z O;  4GV3 A;  5ELZ A;  1JL1 A;  5JS1 A;  3DAW A;  2Q97 A;  3QIP A;  4YDU A;  1JLF A;  4CHQ A;  3T19 A;  3SQ4 A;  2O8F A;  2ASO A;  2FLO A;  3M6G A;  4E19 A;  4Z4G A;  3OYE A;  2R7Y A;  4AHS A;  3AVB A;  2LSN A;  3ID8 A;  1U4B A;  1VQN N;  1ZC6 A;  4FLZ A;  3RRG A;  1OH5 A;  3BF3 A;  3IG1 A;  3UKU A;  3G71 N;  4B9S A;  5A2Q O;  3ZLJ A;  4FZZ A;  4XH1 A;  3ENH A;  2YNI A;  3PUF A;  2B5J A;  3LDN A;  2QEX N;  2Z1G A;  5AZI B;  4RW7 A;  3V6D A;  4QAG A;  1FKP A;  3ITH A;  1J53 A;  1IBK K;  3VF2 A;  4DTP A;  3DLH A;  3L2W A;  3CC7 N;  2CGJ A;  4H5V A;  1Q9Y A;  4KBO A;  5KI6 A;  5CYQ A;  3DXM B;  1KVA A;  4ZTF A;  4X64 K;  4O8K A;  3MK6 A;  1DLO A;  4FLW A;  4E7J A;  2O4I A;  4LC9 B;  3LAM A;  4M41 A;  4UQG A;  1HKB A;  2HB5 A;  3R8E A;  1U49 A;  4QCL A;  3WXL A;  2FF6 A;  2YNH A;  3SQ1 A;  1IH7 A;  2V7Y A;  1L3V A;  2VGM A;  3VER A;  4WQ4 C;  5AQX A;  3P31 A;  2QWP A;  2GUP A;  1KC8 O;  4EZ6 A;  3QEX A;  4BR5 A;  4FZY A;  3OS1 A;  4ISE A;  1JLA A;  2V51 B;  4NLB A;  3HOS A;  4WFA L;  3ZT0 A;  3O1B A;  4W5N A;  2O8C B;  3G10 A;  4IWV A;  1IKX A;  1W2B M;  3CPW M;  2YV0 X;  4CJE A;  2O8F B;  4MLH A;  3TAP A;  1M90 O;  2PZS A;  3O4Q A;  2HNZ A;  4C8N A;  3N4Q A;  5K14 A;  1KTQ A;  4CJ5 A;  3O4W A;  1S1V A;  2ATQ A;  5AQM A;  4HUE A;  1Q82 O;  4B8A B;  4L3Q A;  4AIL C;  1WAJ A;  2QXL A;  3O4N A;  3O9Q A;  4AHT A;  1YVN A;  3B6P A;  5KPT A;  4Z4C A;  4YNQ A;  1E4G T;  1VQ8 N;  1IO2 A;  3EL2 A;  4CK3 A;  3QML A;  1FW6 A;  1RT3 A;  2ITG A;  2ASP A;  3L3V A;  2RPI A;  4GVE A;  3H6E A;  5AQJ A;  4NYN A;  1RDC A;  1ASV A;  4H0P A;  3DXK A;  3ZEU A;  4MFB A;  3RMB A;  3EY1 A;  4K43 A;  3RMD A;  1IBM K;  5JIC A;  2QKB A;  3VN5 A;  4CHZ A;  5D3G A;  4BR9 A;  4ZHR A;  3BGR A;  2FSK A;  1K73 O;  1RBV A;  1VAZ A;  2QKK A;  1HR0 K;  4ID5 A;  3VEO A;  3V9W A;  4JHD A;  1IBL K;  4YFU A;  4KRE A;  2A3Z A;  3QNN A;  3EKS A;  4QS7 A;  1HKG A;  4J2D A;  4W5Q A;  3AVF A;  1OVY A;  3P5J A;  3KTQ A;  4FK0 A;  3C7N B;  1K8K B;  2YKN A;  1NJW A;  2QWN A;  5HRO A;  1WAF A;  5GAD P;  4CJ4 A;  2P9I B;  3O9U A;  4AHC A;  1TAQ A;  3MXI A;  4CHN A;  4CGH A;  4DTJ A;  1C6V A;  4DUY K;  1QQC A;  5DM7 L;  4DU3 A;  5AJ3 K;  1VK0 A;  3HL8 A;  1XMQ K;  4IZ9 A;  3T1A A;  4LF4 K;  1EWQ A;  4BDY A;  3HP9 A;  1ZBI A;  1B92 A;  4XH4 A;  3ZX3 A;  1N32 K;  5AQF A;  4QS8 A;  4B3O A;  1SUQ A;  2D0O A;  1KLN A;  2ASM A;  1HYZ A;  4K42 A;  3M8Q A;  1JCF A;  3NGI A;  4I6M A;  4DR5 K;  3IRX A;  3PO5 A;  5GIO A;  3SMP A;  3QIN A;  3RR7 A;  2G8V A;  1X3N A;  4IEE A;  4BRO A;  4IFV A;  4KKO A;  4AQY K;  4OPJ A;  3ZT3 A;  2UXC K;  1RDB A;  3BF1 A;  5AR0 A;  4OJR A;  1YVU A;  3SPY A;  3AVC A;  3AVK A;  5FPE A;  1K9M O;  4KHY A;  3MEC A;  1HKC A;  1YIJ N;  4B9T A;  4FM0 A;  1GLD G;  1QZ6 A;  3OBW A;  5BPL A;  5HL7 L;  5AQI A;  4HUF A;  2VG7 A;  3TAM A;  5BPM A;  3MMV A;  4MDA A;  5AQQ A;  1WBB A;  2WBN A;  4PUO A;  4ICL A;  4H0V B;  3AVA A;  1SL1 A;  4DFK A;  4FJN A;  1RT6 A;  1RDD A;  2GEL A;  4B3M K;  1JLG A;  4Q5V A;  2ZD1 A;  4LFB K;  4C1N K;  2OZM A;  5F1X A;  3L4I A;  3TPQ A;  1DEJ A;  1HX1 A;  2DFH A;  4CER A;  4CJT A;  4FSV A;  4CEO A;  5AZJ A;  3R6M A;  5CR4 A;  2QA4 N;  3CQX A;  3KWG A;  3DJC A;  4DR2 K;  4DFM A;  2RN2 A;  1EET A;  4PQU A;  3P83 D;  4AHV A;  1JXB A;  1L3U A;  5EXW A;  2W42 A;  1WNS A;  5BN9 A;  1ZBU A;  3N4P A;  2UXB K;  4CHO A;  4B08 A;  4IDK A;  3VGK A;  5AFU H;  2AJQ A;  1ATS A;  1Y97 A;  2PBD A;  3DRR A;  4FLU A;  1RDA A;  3VPZ A;  2Q3S A;  1ZYQ A;  3UE5 A;  2Y1I A;  1P90 A;  3QLH A;  4GKK K;  4DUZ K;  4HCB A;  4EP4 A;  4DU4 A;  1Q9X A;  3EO3 A;  4BC4 A;  4FWK A;  4N76 A;  1JLQ A;  2P1J A;  1HYS A;  4BVP A;  3LP3 A;  1SV5 A;  4BWM A;  1RTH A;  4FLV A;  3DMJ A;  1VRU A;  1H1V A;  4IDH A;  1IG9 A;  3AA2 A;  4JI3 K;  3NGY A;  1SKW A;  4PL7 A;  4JKA A;  4FJJ A;  4OGE A;  4BRH A;  2BTF A;  4Q0B A;  1UWB A;  4ILJ A;  3NMU A;  3OA9 A;  5HLF A;  4FOE A;  3THW B;  2X6S A;  2GBZ A;  2KKZ A;  1HPZ A;  4AHR A;  3WXJ A;  2O8E A;  1ATR A;  1LWC A;  3VQQ A;  1QQO A;  1MWM A;  3D45 A;  4C8O A;  5JS2 A;  1VQ4 N;  3AVL A;  3MWT A;  3H1Q A;  1VHX A;  3THX A;  3S3O A;  2P9U A;  1X9J A;  4FJL A;  4JYA K;  2AA4 A;  3NDK A;  3AO1 A;  2HVI A;  4A5B A;  4KI4 A;  3OY9 A;  2OPQ A;  4GNI A;  1N33 K;  3MED A;  2E20 A;  3T1H K;  2NNW A;  3SUQ A;  3T69 A;  3OTO K;  4JI7 K;  3FFI A;  2O8B B;  4Y1D A;  1TYQ A;  3SAF A;  5H1S Q;  1VQ9 N;  4JLH A;  3QER A;  4J2B A;  4NCA A;  1QZ5 A;  1KD1 O;  3A5M C;  1BCM A;  4PY5 A;  3SQ0 A;  3SQ2 A;  3FLC O;  3H3N O;  2FF3 B;  4CES A;  4LH5 A;  4IBN A;  2CH5 A;  1WSJ A;  1NGJ A;  2GWK A;  4IG3 A;  4B1Y B;  1RT5 A;  4GY2 B;  4E7H A;  3SJH A;  3VF6 A;  3CCM N;  4MO4 A;  3E9L A;  1SS6 A;  2G8F A;  2VG5 A;  3VES A;  5AQG A;  3ISN C;  4DKW A;  3SYZ A;  3A5N C;  2WFB A;  2G8I A;  4HCC A;  1BIS A;  3EZW A;  2E2Q A;  4M7X A;  4FJ8 A;  3KKR A;  4BC3 A;  3CIP A;  1FJG K;  1CZA N;  4BRC A;  3DOK A;  4JRP A;  3ULE B;  1QSY A;  2XHB A;  1RCH A;  5CYM A;  1J54 A;  4FJG A;  3P39 A;  1X3M A;  1HRH A;  3DM2 A;  1YF5 L;  3C6T A;  4DV7 K;  3LAL A;  3NAE A;  4JD2 A;  4JI2 K;  2KFZ A;  3I0R A;  4B9Q A;  3KLI A;  3TTF A;  3SLC A;  3ZSQ A;  2HHX A;  3RSE A;  2B6A A;  2EWS A;  1LWF A;  4V19 S;  1U2V A;  1NMD A;  4H0O A;  1IV0 A;  4GMJ B;  3PV8 A;  1RNH A;  4KHN A;  4DV6 K;  4DLE A;  4OKE A;  5EVZ A;  2YCH A;  4DS4 A;  4DFJ A;  2ZE2 A;  2HBM A;  4DQI A;  1RT4 A;  4BRK A;  3MDQ A;  4BR7 A;  5T7B A;  1GLJ O;  1T44 A;  3QEV A;  2O4G A;  4CJP A;  3CFR A;  1TKZ A;  3SPZ A;  4F4K A;  1A5V A;  1S1W A;  4B9V A;  3CJB A;  4JK9 A;  4LY7 A;  3T1Y K;  3CCU N;  1T05 A;  1KFD A;  4FO0 A;  4IFE A;  5IWA K;  3V9U A;  1M1K O;  1QSL A;  4K41 A;  1ZXO A;  1LOT B;  3SV3 A;  4A59 A;  4DWI A;  2IVN A;  3WXK A;  3IAY A;  4IG0 A;  4OLA A;  4CGI A;  2F8T A;  1NGA A;  1NK6 A;  3VTI A;  3IS9 A;  4CIF A;  2XO7 A;  2Q2R A;  4A61 A;  2OPP A;  5AQR A;  4DQ8 A;  5FPD A;  2HMP A;  1HJR A;  2FBY A;  2OTJ N;  3K5M A;  3EEQ A;  4DV5 K;  4GV9 A;  1R0A A;  3KHY A;  4RW8 A;  2DPN A;  4FJ5 A;  4BE0 A;  4PWD A;  4IXC A;  3J81 O;  3CC4 N;  1YJ9 N;  5KGW A;  2QWM A;  4J8F A;  1S72 N;  2QK9 A;  3SJJ A;  4O0I A;  2G8U A;  3VQ7 A;  4JKG A;  2VYP A;  4BRL A;  2D0P A;  2ZGZ A;  5HRS A;  4IOC L;  1FXX A;  4WQ4 A;  1W9H A;  2XY5 A;  3CCS N;  1KRP A;  3O5B A;  2ZF5 O;  1NU0 A;  3RSE B;  2Z1H A;  5I42 A;  4CJF A;  1K8A O;  5KPR A;  3I8B A;  1YJW N;  4CK2 A;  3GE1 A;  2FBX A;  4TSX A;  3RMA A;  3V81 A;  5M1F A;  3KK2 A;  5I3U A;  4M45 A;  4B9U A;  1QTM A;  4PA1 A;  4H5T A;  1X1P A;  2A1R A;  1SKS A;  1U47 A;  4KB1 A;  2G8H A;  3CJA A;  3S41 A;  4FWP A;  5ADX H;  2XY7 A;  3MN5 A;  4CF2 A;  4CJ7 A;  4NLC A;  2GEM A;  3ALY A;  4FJX A;  4EHU A;  4CJL A;  3I55 N;  1REV A;  4BRA A;  3AO2 A;  3KD5 E;  1CXU A;  4I7F A;  3M3Z A;  4CF1 A;  1SAZ A;  3IFR A;  1HJO A;  1OH6 A;  2IIR A;  5C12 A;  2WUS A;  1C1B A;  4B9L A;  5CHI A;  4BVO A;  2RHK A;  4ILH A;  4BE2 A;  4O5B A;  3FZH A;  4PKI A;  1DT9 A;  3D6R A;  4DQS A;  3HST B;  3U4L A;  5E26 A;  1YHQ N;  4JNE A;  4A5A A;  3MX5 A;  1GOA A;  3I8D A;  1BGX T;  1TGO A;  4FZX C;  3DLG A;  4FJM A;  4KTW A;  5FRO A;  1HYV A;  3TAG A;  2HOE A;  4FOI A;  5M1N A;  4YY3 K;  1ILY A;  2OAN A;  1WSG A;  4CEA A;  2YNG A;  1LWE A;  3O8M A;  1GLF O;  3VGM A;  4CVN E;  3K0S A;  4BRF A;  4CEE A;  1KQS M;  1QHT A;  1YUW A;  1VQO N;  1HLU A;  2HHV A;  4BR2 A;  3I0S A;  1Z26 A;  1WN7 A;  4BGA A;  1MDU B;  2Q31 A;  3HRG A;  5KQ8 A;  3ID6 A;  4IJA A;  1FK9 A;  1RTI A;  4HTU A;  5HRR A;  3MN9 A;  2QWQ A;  1JJ2 M;  3DYA A;  2P9P B;  4CJW A;  1HUX A;  3DI6 A;  4MO5 A;  4JI4 K;  2IGI A;  3U3Y A;  3LDS A;  3HP6 A;  4E1M A;  1NGE A;  1LAW A;  3E66 A;  4CEQ A;  3ZET A;  5KRS A;  4J2E A;  2BDP A;  1NLV A;  2DTU A;  2YHA A;  4CF8 A;  1J5E K;  4BDP A;  3IDH A;  5SZT A;  4DSE A;  4B3T K;  2E1Z A;  4JKH A;  3CCJ N;  2HBJ A;  3AO4 A;  4KAZ A;  3UKR B;  4LD0 A;  3K9K A;  2NRX A;  4I9L A;  3KLE A;  2FXU A;  3BDP A;  4GV6 A;  4AF1 A;  1Y64 A;  5AQL A;  4CGG A;  2BAN A;  5BRF A;  3SBT A;  4CZI A;  1NGB A;  2F96 A;  2Q0R A;  2NRZ A;  1NMN A;  4KO0 A;  4BR4 A;  1OH8 A;  3DRS A;  4CGD A;  5C0Y A;  1B9D A;  4FW1 A;  3GOI A;  3OHR A;  3A8Y A;  3A5L C;  5AFU A;  3L0Q A;  3QES A;  4JI6 K;  4Z4F A;  4FLT A;  1WB9 A;  5I9E B;  4BRE A;  3O9S A;  1KAX A;  4CBX A;  5FRM A;  3HT3 A;  1CZB A;  4DFP A;  3UKU B;  1RDW X;  5HOO A;  2VQE K;  3HPH A;  4MQ3 A;  1EWR A;  1SKR A;  4WCE L;  3HJF A;  3VF4 A;  5J2M A;  2NRV A;  3F2K A;  3ULD A;  4FK4 A;  3TAQ A;  3LDO A;  1TVR A;  2UUC K;  3ZET B;  1B9F A;  1C0G A;  5B8H A;  1XC3 A;  4HVJ A;  1YTA A;  4H0Y B;  4C1N I;  4DLG A;  1LV5 A;  2YHY A;  2KW4 A;  4ID1 A;  3HXM A;  4UY8 O;  1ZBH A;  4LF7 K;  5MLC Q;  1U6Z A;  4H0T B;  4HUG A;  1Q8I A;  2ZWH A;  1JLB A;  5TKY A;  3K5N A;  1NJY A;  5CZ1 A;  5AQP A;  2P9N A;  2F8S A;  1FKO A;  3L8B A;  1T03 A;  1C0T A;  4G9Z A;  4FJ7 A;  2D5R A;  3TAN A;  3CCR N;  1U04 A;  1VSL A;  3K5L A;  3L2V A;  3OYG A;  4M3X A;  3RTV A;  5BR8 K;  1C0F A;  2HVH A;  1K6Y A;  1J6Z A;  4YOX A;  2GV9 A;  4CZE A;  1UOC A;  3GDQ A;  4JI0 K;  4KRF A;  3O9R A;  2D4W A;  3A2F A;  4LSN A;  4BG8 A;  4FJH A;  3AVJ A;  2IAJ A;  3IUC A;  3V4I A;  5C15 A;  4ISG A;  2OZS A;  3SMS A;  1VSK A;  3HM9 A;  4GVM A;  3OYN A;  1WSI A;  1TK5 A;  5BPN A;  1E3M A;  1IKW A;  3KD1 E;  4FWL A;  2BGG A;  3HPG A;  4BRM A;  3VQ5 A;  1LW2 A;  4DTX A;  3JXU A;  4BWJ A;  3HSC A;  3BUZ B;  3D2F A;  2ZJR L;  3D2E A;  3OJS A;  2PAV A;  1L3S A;  4M3W A;  2WTU A;  3VQ4 A;  4EFH A;  4PHT X;  3DXK B;  3ZEU B;  1L5U A;  2KQ2 A;  1XUP O;  2HHW A;  4O0J A;  3L2R A;  3MX2 A;  3VQ9 A;  3TI0 A;  3VA0 A;  4RW6 A;  3O80 A;  1RBR A;  1JCE A;  3MN6 A;  3K9J A;  3NF8 A;  1ASU A;  3S3M A;  4BQZ A;  5GAH P;  1BHL A;  4NXM K;  2W40 A;  1BA1 A;  4JHD B;  4B3S K;  2P9N B;  4CD3 A;  3F9M A;  3SUN A;  3NF9 A;  2E2P A;  4DTO A;  5HBM A;  3GG4 A;  4XEI A;  1Q81 O;  2YJF A;  3OYD A;  3THY A;  4DV0 K;  4DCH A;  2P9L A;  1TKT A;  4Z94 A;  1NG9 A;  4MDB A;  1NGI A;  3CFO A;  1V4S A;  2NRH A;  1KXP A;  5SWM A;  2QWL A;  1BO5 O; 
#chains in the Genus database with same CATH homology
 1N36 K;  4DUY K;  4JI4 K;  5AJ3 K;  4LF6 K;  1FJG K;  1XMQ K;  2ZM6 K;  4GKK K;  1HNX K;  4DUZ K;  1HNZ K;  4LF4 K;  2VQF K;  4JI5 K;  5LMN K;  4LF9 K;  2UUB K;  5BR8 K;  2F4V K;  1N32 K;  1J5E K;  1I94 K;  4B3T K;  4JI0 K;  2E5L K;  4DV7 K;  4X65 K;  4X66 K;  4JI8 K;  4DR5 K;  4JI3 K;  4JI2 K;  4YHH K;  4AQY K;  2UXC K;  4V19 S;  4JI1 K;  4DV6 K;  3JAM O;  2UXD K;  2UUA K;  4DV3 K;  4JYA K;  5FLX O;  4DR6 K;  1XMO K;  4JI6 K;  4DV4 K;  1N33 K;  4NXN K;  3T1Y K;  3T1H K;  4LF8 K;  4JV5 K;  5IWA K;  1IBM K;  1N34 K;  3OTO K;  4JI7 K;  2VQE K;  3J7A P;  5A2Q O;  4LFA K;  4YY3 K;  3J7Y P;  4DR1 K;  4NXM K;  4CW7 B;  4DV2 K;  4B3M K;  1XNR K;  1HR0 K;  4B3S K;  4X62 K;  4LFB K;  4CVN E;  1HNW K;  4DV1 K;  4OX9 K;  5LMU K;  1IBL K;  1IBK K;  4DV5 K;  4K0K K;  4DR4 K;  2UUC K;  4B3R K;  3J80 O;  4DR7 K;  4GKJ K;  3J81 O;  2HHH K;  4DR2 K;  4X64 K;  5LL6 Z;  4DV0 K;  4LF7 K;  4LFC K;  4LF5 K;  2UU9 K;  2UXB K;  4DR3 K;  5IT9 O;  4KHP K;  1XNQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...