2VQFK

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2vqfK00
4CW7B 5AJ3K 4YY3K 5A2QO 4LF9K 2UXDK 4K0KK 1HNZK 4DV5K 1N33K 4X65K 3T1YK 4NXMK 2ZM6K 4X62K 1FJGK 4GKKK 2HHHK 4DV4K 1XMQK 4LFBK 4LF8K 5IT9O 4CVNE 4B3MK 3J7AP 3T1HK 4NXNK 4DUZK 4JI6K 2VQFK 3J80O 1XNQK 1XNRK 4JI5K 2F4VK 3JAMO 5FLXO 2UUAK 5IWAK 4DR5K 4LF6K 4JI4K 4DV7K 2UU9K 5LL6Z 1I94K 4DV6K 4KHPK 4LFCK 4DUYK 4GKJK 5LMNK 3J7YP 4LFAK 4V19S 2UUCK 4DR1K 4JI0K 2UXCK 4YHHK 4DR7K 1IBLK 2UXBK 1N36K 4DV2K 1HNXK 4JI8K 4DR2K 4OX9K 4B3TK 4B3RK 4DR3K 2VQEK 4JI2K 5LMUK 4JI1K 1N32K 3OTOK 4JI7K 1N34K 4X64K 4DR4K 4DV1K 4JYAK 4JV5K 1IBKK 3J81O 4DV3K 4AQYK 4LF7K 2E5LK 4DV0K 4X66K 4JI3K 1HNWK 4B3SK 4LF4K 1XMOK 1J5EK 4DR6K 1HR0K 2UUBK 5BR8K 1IBMK 4LF5K
chains in the Genus database with same CATH superfamily
3BGRA 3RMBA 4GVEA 4H4OA 5B8HA 2A42A 4JK9A 4E1NA 5HROA 1ZBHA 1VHXA 2E1ZA 4QCLA 5BRHA 2HHUA 2ASPA 3G10A 5KQ8A 2G8UA 2QXLA 4K0KK 4RWTA 4A5BA 4FJJA 4MLEA 1EXQA 3VMFB 3CJ9A 2XHBA 2QK9A 3V1OA 3E9LA 3ATVA 4A61A 4DF4A 1RTDA 2A40A 4F2RA 3CJ1A 3KIOA 1RT1A 5ADXH 3PV8A 2VWJA 1C1BA 4CJTA 1NK6A 3NH2A 1IO2A 4CVNE 4CF2A 4A57A 4OPJA 1NKEA 1SV5A 1NGGA 3KWGA 1RFQA 4IFEA 4CZGA 3EZWA 1YAGA 2GWKA 5CZ1A 4CGIA 2VQFK 1ZYQA 1U47A 3CCRN 4B1VA 4BWJA 3I8BA 3LDNA 2WOMA 4LH5A 3FGUA 4DV7K 4C8OA 3ZCMA 1BI4A 1WSHA 1BCMA 4B9LA 3J8AA 2IOCA 2PY5A 1QZ6A 1X9JA 2YHBA 1T05A 2OZSA 4Z4GA 4FLTA 3SAFA 3LP3A 5GAEP 4IO9L 1HNXK 3FZLA 3DXMA 3L8BA 1NM1A 2HBKA 2VQEK 2WTUA 3C0BA 1RT6A 3AO3A 4EIAA 3ULDA 3DLRA 2A3ZA 4KRFA 1L5UA 3H3NO 4LY7A 2I7PA 1JLQA 3ZETA 1ILYA 4FOEA 5AQLA 1ZBSA 4Z4CA 1HNWK 3H6EA 3QNOA 4IJNA 1XMOK 4CJ7A 2KHOA 1MU2A 1VRTA 1DT9A 3IUCA 1KAZA 5GINA 2W42A 4LF5K 2HHTA 3FZKA 2VG6A 1JXEA 1TUYA 2P1JA 3QO9A 5BN9A 5CE3A 4FJLA 3BP8A 2NRWA 4CF9A 1GOBA 3AGRA 2VG7A 4CJSA 1J6ZA 4K43A 3WT0A 3ZEUA 3SUOA 4A2AA 4JKGB 3OYFA 4E1JA 1KAYA 4FJKA 1YI2N 1OH7A 1IV0A 1YITN 1Z6RA 3DLBA 4MFBA 1HMVA 3QBWA 4GKKK 1Z26A 5HP1A 1Z05A 4KB1A 3WNHA 3AVKA 2HHQA 4FW2A 1D9FA 1ATRA 4BE2A 3VEWA 1OH6A 4DCHA 5AZIB 1BIUA 3FFIA 3JAMO 2G8IA 5KPRA 4DHYA 3P5JA 3NF9A 5DK5A 1K8KA 1HPZA 3U6FA 4PY5A 2X6SA 2UUCK 3MN5A 1EO1A 4CHPA 2P9SA 3K9KA 4BGAA 3PIPL 3O8MA 1G99A 5FPNA 3ALYA 2Y1JA 3AA4A 4LH4A 3THWB 4DQQA 5FROA 1WB9A 3CQXA 2QWPA 4M3RA 3MCAB 3TSPA 2F8TA 3NH0A 3OTOK 4F8RA 4HWIA 4DWIA 1QVFM 5C15A 5J2PA 1C6VA 2E2NA 1GLFO 3PUFA 4CEEA 3AVAA 4FSVA 1SKRA 4WQ4C 1X3MA 1WAFA 2ZF5O 4E7HA 5EX5A 3H1VX 4CEQA 4UQGA 1NJZA 4BGBA 1U04A 1VSHA 3C95A 3GG4A 3VQEA 1NK9A 1RCHA 2HHXA 1VQLN 3O4QA 4BR2A 1ZC6A 3THYB 4DTUA 2XY7A 4XH4A 4K8XA 2QWQA 4JKAA 1B9FA 3BY5A 2E88A 2KTQA 1TK5A 1IKVA 1HNZK 4PQUA 3K2PA 4H8KA 1G15A 4BR9A 4TSXA 3N4PA 1QTMA 2OPPA 1GLAG 3SLCA 2WONA 4W5TA 1Q81O 3QINA 3QETA 4F2SA 4NCBA 3VF6A 5C10A 1U6ZA 3TTFA 4FWOA 3OYLA 4BWMA 4JAXA 1VQ4N 4FJMA 5BN8A 2P9KA 1MA9B 1JLFA 4BC4A 4FM0A 4CK2A 3WNFA 3PX0A 1XNRK 1EQYA 1QHAA 4CEOA 1BDGA 3WQUA 3GBTA 2UU9K 1TUUA 3AV9A 1S1VA 1UA0A 3O1WA 3P39A 3CCMN 1S1WA 4IG3A 3PX6A 1SL1A 3FR0A 4YHHK 3JSMA 4IDKA 1WUAA 2OTLN 4CJUA 3KD1E 3SNNA 4RTFD 2KQ2A 2IVOA 3UB5A 3VENA 1VQPN 2P9PB 4C1NI 3S3NA 3RR8A 2NRXA 4CEAA 2O8BB 3E66A 5LMUK 4CFBA 1VQ8N 2PYLA 3THXA 2Z1GA 4LSLA 1C1AA 3G4SN 2P9LB 1S1TA 3RVCA 3KKRA 1L3SA 3ZSRA 1KVCA 4LF7K 5AQSA 5JVGL 1NK7A 4MO4A 4IWVA 3TAMA 4CFCA 5AZJB 4GV3A 3NDKA 4KFBA 2ZWHA 1ASUA 3WEEB 4K8ZA 3AVNA 4CZHA 2W41A 1HR0K 3R8EA 4AM7A 3SK3A 3G25A 3DLKA 2BTFA 3SJJA 5HL7L 4CGHA 4KHSA 1S3XA 3DLHA 1RTJA 1RT3A 2YNGA 5E41A 4BVPA 4E19A 4FK0A 3ZLJA 4IXCA 2HW3A 3E01A 2E8AA 1JLBA 3OBWA 4ISEA 3ZSZA 1Q82O 4CESA 1REVA 2FSNA 1YVUA 4U67L 3MAQA 3ZT4A 4CD1A 2A1SA 3QIOA 3U3YA 4Q5VA 4KHWA 3OS0A 1ATNA 3TTCA 4I2PA 4DV4K 4BRGA 4BG8A 4FJ9A 5HOOA 5AQYA 4DSJA 3D2FA 2QKKA 1LV5A 3OJUA 4OKJA 4C8MA 3HYFA 3S3MA 3OA9A 2XRIA 4XEIA 1CXUA 4H0OA 2HB5A 3KHYA 4DFJA 4JI5K 5BRDA 4C23A 4CZMA 1RDDA 1M90O 4WYBA 1U48A 4B9QA 1K73O 3CJAA 4EZ6A 2OPSA 5J2NA 5AQPA 4DR1K 4FVMA 3G6EN 4LC9B 1NGAA 3CD6N 1RDUA 2RN2A 1IBLK 1U2VB 1FK9A 2YHXA 4FM1A 3EE9A 4K25A 3AAPA 1RNHA 3THYA 2Q1NA 3SMSA 2CGJA 4CFAA 3AA3A 3AARA 3U3GA 4I6MA 4DTSA 2VWKA 4UY8O 4MLHA 4B9MA 1NGIA 3ULEA 4YOUA 5LJVA 3HBTA 4L8RB 4JI7K 1GLDG 2ATQA 3IRXA 2X74A 4F3OA 3AVIA 1Y64A 3VN5A 4CI6A 3SQ0A 3I0SA 4HUFA 4FJHA 3L4QA 4BC5A 1SL2A 2KZZA 4JI3K 2QM1A 1Q86O 1NGJA 3H45C 2FF3B 3F73A 4BRLA 1VAZA 4WQ5C 1KC8O 2B6AA 1IBMK 1FW6A 4RG8A 4CW7B 3VETA 2IGIA 4L3QA 4Y1DA 4CIFA 2IIRA 4MQ3A 3LWLA 4K41A 1UA1A 1YVNA 1XI1A 1S6QA 3CM5A 3HPGA 2GUIA 2V7ZA 3K59A 1SUQA 2VWBA 1SQKA 4LSNA 3VTHA 4YDUA 4JKCA 3LANA 1I3AA 3QEPA 1W9HA 3NCIA 1VQ5N 4J2BA 2HHHK 2GUPA 3CJCA 1XMQK 3HM8A 2NLXA 3ZSOA 5ADXA 3MEDA 4CEZA 2O8DA 4M63C 4ICLA 3D2EA 4B1ZA 4ISFA 5I3UA 1F21A 1QSYA 4NXNK 4JI6K 4PA1A 1XNQK 3C7NB 1VSKA 4DTJA 3C6HA 4B1UB 3PSIA 5M1FA 3NF8A 1WSIA 3ZX0A 1BHLA 2P9NA 3K58A 1D9DA 1DGKN 1NGFA 3SPYA 4BRFA 4LFCK 1S9EA 4NCGA 1QQNA 3RWUA 1TAUA 2A5XA 4N76A 5KPZA 3CIPA 4ZHRA 1KD1O 3HTVA 3VF4A 3RTVA 4CJQA 4DF8A 2GBZA 1B92A 1OH8A 4FL9A 4AH9A 1RBVA 4CD3A 5I9EB 4IOAL 5AQVA 4DKWA 1OH5A 4FK4A 4DSIA 4FWPA 4JI1K 4FWQA 1EWQA 3SV3A 4BRNA 4Z4FA 4PL7A 4CJEA 1YJ9N 1N34K 3C6TA 3O08A 3SBTA 3O9QA 3OYBA 2Q31A 3AO2A 4FO0A 3CM6A 3K5NA 4O8KA 1H1VA 2YV0X 1NJWA 3ID6A 3QICA 2G8HA 4CF1A 2CGLA 2O8CA 4AHUA 2NNWA 2QWOA 3TAFA 1CZAN 3RR7A 3S3OA 3SUQA 4O4GA 1TK0A 3MN9A 3L2WA 4NYNA 3V1RA 1NGEA 1GLLO 1NBWA 1S5JA 4DFMA 1EKEA 3TAEA 1WBDA 1J5OA 3M1FA 1RBUA 1TKZA 1YTAA 1QVGM 3L0QA 5DMRA 1IG9A 5AQUA 1RDBA 3WXJA 4MO5A 3T1YK 2I7NA 5DM7L 3D0PA 3LALA 2ZGZA 2YX6A 4DQIA 2NRHA 4BACA 4OPKA 4JEPA 3UKUA 2O8EB 4O55A 1X9MA 4WE1A 4OPAA 1IH7A 2R7YA 4GV6A 4Z4EA 1EX4A 1U2VA 2YNIA 3TWHA 2D5RA 4IOXA 3D6RA 3VQBA 1N8RO 4FWKA 1NNEA 1HYVA 1CZBA 3QERA 3KLFA 5C25A 2P9UB 3O4WA 4G9ZA 1I94K 5CHIA 3I8DA 3CERA 3DXKB 2WFBA 3EZ5A 3V6DA 4CGJA 4FW1A 3EKUA 4KO0A 3S9HA 3M3ZA 4B9NA 4RW8A 3CFPA 2D0BA 4A2BA 2NRZA 5GAGP 4DV2K 2YHAA 1WNSA 1VQ6N 4CECA 4DTPA 4J2EA 5HLFA 3UE5A 3O3FA 1X1PA 5TKWA 5K14A 3BF3A 1LAWA 3CF5L 2BH1A 2E4LA 1V4SA 3K9JA 3U4LA 4FZYA 2E2QA 1RT2A 1TKXA 3GDQA 3P1GA 4BRKA 5BPMA 4DV0K 4B9VA 1LAVA 1A5XA 1NU0A 4RW7A 1YXQA 3NBPA 3CHWA 4B3SK 3K5LA 2OCEA 4M3XA 4Z4HA 1YJNN 3LZJA 4BREA 5M1KA 3LPUA 4YY3K 3HO1A 1TGOA 4AHRA 1IKXA 3I0RA 1ITGA 2O8FB 1HKGA 4B9UA 1NGCA 4W5RA 3B6PA 3O4NA 4HVJA 1SS6A 1UAXA 3CYMA 3TSQA 1S1UA 1J53A 1T3VA 3L4IA 3ATUA 2RE2A 4O8UA 2P9IB 3L2UA 2HBLA 3G71N 1WLJA 3V9XA 4CJRA 1TKTA 4FWNA 4BR5A 4RW4A 1FKPA 4LD0A 4BRQA 2G8FA 3BF1A 4N56A 3NF7A 3V4IA 4HCCA 3HOTA 5FPDA 3LDPA 2CGKA 3DAWA 4A5AA 3VEOA 3PIOL 3MEEA 3QBXA 1KRPA 3H3OB 3CCUN 2ZQBA 3WNGA 4DR5K 3OVNA 3MX2A 4GKJK 3QMLA 5JLHA 2GWJA 3MCPA 3SAHA 1WSFA 5JS1A 4R79A 3SJHA 1S72N 3LDQA 3DOLA 3V1QA 1VSLA 3A5MC 3QNNA 3E1YA 1WSEA 2V52B 1RBRA 4DS5A 1XHXA 1GOCA 4QS8A 1S1XA 1T6CA 3O9SA 2KLAA 3WXKA 4IFVA 4KKOA 4YOXA 3UKRA 4NYFA 3P4IA 3LDOA 3BDPA 5HRPA 2X78A 2DFFA 1BQMA 1NK4A 3AAQA 1TAQA 2YJEA 3EN9A 2NRTA 2QWRA 5BRFA 4YNQA 3UIQA 3LDSA 2IDOA 3VA3A 3Q7BA 1C0GA 3NMUA 3VQ5A 4C8KA 4DR6K 2HMIA 4KH5A 1KVAA 3ZX3A 3AO5A 1Q9XA 2XY6A 4NB4A 2BDPA 3K0SA 4FJ5A 2YI1A 3VPZA 4JKDA 2BE2A 5AQHA 1LCUA 5AQWA 4J8FA 4BRHA 1QS4A 4WCEL 1D5AA 4PKHA 3L2RA 4U7BA 2D0PA 4OKKA 4DSLA 2NZTA 4H0XB 5AQTA 4JK8A 3BZCA 4KBOA 3G0ZA 2QWMA 3W0LA 4W5NA 3NGZA 3V81A 3WXMB 2CH5A 3F9MA 3HP9A 4CERA 1Q18A 1KXPA 4B9SA 5ELZA 4KV8A 4FPAA 4CJVA 3U9DA 4CBXA 2D4WA 4CF0A 4JD2B 1RILA 4CK1A 1Q7YO 1HYZA 4BRAA 2RF2A 4H5RA 5C0YA 3SI6A 4XH5A 3CPWM 2W6KA 4CJWA 3KK7A 3LM9A 3CC4N 3VEZA 1XWLA 5J2QA 1TYQB 2X6NA 1SL0A 3CJ7A 2DPNA 4ZTJA 3DWLA 2HVIA 2DFEA 1TL3A 2UYTA 2JLEA 3MK6A 1KTQA 1SAZA 3CCLN 5F0XA 1HRHA 3PX4A 1OVYA 4Y0WA 4I9LA 3OY9A 3HRGA 1IJJA 3ZT3A 4B3RK 4FJXA 3ASMA 4JN4A 2O8FA 3IDHA 3AVGA 4DV1K 2KKZA 2QA4N 1BUPA 3PO4A 3HM9A 3LL3A 4DB3A 2GX9A 2NUBA 2FBVA 4CJ5A 5JVHL 4IJAA 3LP0A 2QKBA 3PO5A 4IEIA 1JKHA 3HZ6A 4B9TA 1BG3A 3A8YA 3MXMA 1TKDA 1J5EK 3SUPA 4HTUA 4DU4A 3CXCM 4H5VA 1CLQA 3JXUA 5KI6A 3F9KA 4CHNA 3VERA 1QSLA 4CHQA 3O9RA 3CCSN 4EAHD 3DLGA 4FJNA 3MEGA 4JKGA 1HJRA 3AVHA 4ELVA 1OVQA 2HHWA 3ITHA 4DLEA 3KD5E 3CMEN 1X9WA 1QE1A 1HKCA 1JLAA 1T44A 4KTQA 4OO1J 3A5OC 4OKEA 5M1PA 3KVGA 3SV4A 3J7AP 1JLCA 3M8QA 4NCAA 3QEVA 1KFSA 5AZIA 3ZSWA 2EWSA 4DFPA 3QFPA 4AHTA 2ZD1A 1N6QA 1W0HA 5FLXO 3M8PA 5IWAK 3CETA 3KK3A 3NE6A 2CH6A 3LP1A 4IKFA 3T7ZA 1R59O 4AHSA 1VSDA 4DG1A 4IFYA 4WFAL 4JK7A 5H1SQ 1NOYA 2KFNA 3NFAA 4E7IA 1LWEA 1NMNA 4A62A 4DR7K 3ZSYA 1E4GT 1QHTA 3TI0A 3CCVN 3THWA 4AF1A 4E0DA 1NGBA 2WBNA 4CZKA 5HRSA 4B3TK 4H03B 1IG8A 2Q0UA 1DTQA 3EE8A 2V7YA 1LW0A 3DRRA 3OYKA 3V9ZA 3SQ4A 1S22A 2YNFA 1L3TA 3VEXA 3MMVA 4HHTA 1KSPA 3BEXA 2JWLA 3F5TA 2VGNA 3W3DA 3I56N 2ETJA 3VQQA 3VQ4A 3HPHA 4CK3A 4C8NA 1HPMA 3FFKB 4CEDA 3SMPA 4M42A 4WFNL 3CI5A 1ZBIA 4CFDA 4O44A 1A5WA 3VF2A 4JHDB 3O3HA 2UUBK 4JI2K 3M5RA 3WQTA 1GLEG 3GOIA 2AP1A 5LY3A 1T6DA 5AFUH 2XO7A 3BUZB 3VGKA 1O1WA 5CZ2A 3QEXA 3CFRA 3VQAA 5SZTA 4E89A 5D3GA 2ZGYA 4C1NK 3SQ1A 4JD2A 1HQEA 4FLYA 3TR8A 3VQ9A 4BDZA 4DTMA 1YJWN 4DSKA 4DV5K 3OS1A 1N33K 5AQQA 1Y97A 3P38A 3TABA 2HVHA 4EZ9A 3JYTA 3F2KA 2FF6A 3H08A 4BRMA 4DLGA 5F2RA 4PHTX 4JLHA 5IT9O 4JKEA 3AGKA 1KLMA 3O1BA 4BE0A 5GIPA 3AVLA 3CQ8A 2F4VK 1C0MA 2AA4A 2XY8A 2F9WA 1WSGA 4H0YB 1VQNN 1UWBA 1I39A 4H0PA 4YORA 1BA1A 1XUPO 4H5TA 4B1WB 3E9PA 1XQSC 1ESVA 2YKNA 4B3OA 3HP6A 3HPOA 1BI4B 1WN7A 3J7YP 2HNDA 4XH1A 4Z0UA 3HT3A 4CJ4A 4DTXA 4ILJA 3U8XA 5EY4A 3L6QA 1RT4A 3B8AX 2P9PA 3L3UA 3VGLA 5KGXA 4OX9K 3O3GA 4BC3A 3HSCA 3M6GA 2IS3A 4N41A 4Y1CA 2O8BA 1JXBA 1C0UA 3DXMB 4FWSA 4K42A 4FOIA 3VQ7A 4M41A 3GL1A 3CG7A 3SQ2A 2P9LA 2ASMA 2EHGA 3KWIA 4C8LA 3ZT2A 4MDAA 4N47A 4CJLA 3KK1A 5BREA 1QZ5A 3NVMA 3MECA 5AZJA 1NMDA 2QWNA 3RSEB 3WEEA 1V4TA 4JRPA 2O4IA 3O80A 3TAQA 3ZSQA 4FM2A 4OPHA 1LWFA 4HUGA 3PSFA 1WAJA 1JJ2M 2VCPA 3AVCA 3C65A 3QLHA 3IKMA 5AJ3K 4W5OA 3QDKA 1U4BA 4DS4A 3R6MA 4ILHA 2PFUA 3VA0A 3V9WA 1L3UA 4BR0A 3LP2A 1QSSA 3NHGA 2P51A 5EU7A 3ZEUB 3AO4A 3O9TA 3JS6A 1SKWA 2H3GX 4KAZA 3TAPA 1RDAA 1XC3A 1YF5L 3OYHA 4CJPA 2NRVA 3TARA 1VSMA 1YTUA 4JKHA 3VEVA 3S41A 2B4JA 3RMDA 1DTTA 3SUNA 3A5LC 3EYZA 4CCHA 3HOSA 3D7EO 2A6AA 4WFBL 1NKBA 2VG5A 4BDYA 4DQ8A 5HRRA 3T1HK 4NO7A 2GV9A 4KHQA 1NJIO 2HOEA 4DU3A 4DU1A 4FLZA 2J4RA 4PL8A 1NGHA 1X3NA 4YDUC 4OVLA 3KZBA 5JICA 4JRQA 4DV6K 1K8KB 1NK8A 3OYAA 1NK5A 5LMNK 2Q36A 5AQIA 4V19S 3K5OA 3SYZA 5BPNA 5AQKA 5KTQA 4FJ7A 3EO3A 4F4KA 4ID1A 2P9SB 5DM6L 4YOTA 1VQ7N 3ISNC 4I2QA 1HKBA 1NLVA 4BG9A 4GV9A 4DMNA 5C24A 3VQPA 3J7ZO 2FBTA 5J1EA 1BO5O 3R9PA 1O13A 3OYMA 5AQJA 4AHCA 3HK2A 3A2FA 1N32K 3N4QA 2IC3A 1SKSA 1E3MA 2BANA 1JCGA 4KHYA 1CZ9A 1TK8A 1EETA 4JV5K 3ZT1A 3V9SA 3KKSA 5KPTA 1KLNA 3CCEN 4BRCA 3EEQA 5FRMA 5E26A 1VQON 3MDQA 2E2OA 4M3UA 4CJFA 4ELUA 5F1XA 1VQKN 4KPYA 2Q0RA 4ELTA 1JL1A 4XIUA 4CHOA 3MN7A 3LAMA 1ATSA 3TANA 2UXDK 3AA2A 5FPMA 1VSFA 3MXIA 1S9GA 3C6AA 3VOVA 1JCEA 1MWKA 3VQ6A 5AQGA 5LJWA 4X65K 4JS5A 3DYAA 3DLLL 2P5GA 4J2DA 3TU5A 3VQDA 4FPBA 2ZM6K 1GLBG 3U9ZA 3OBYA 3KJVA 1VQ9N 2FXUA 2E2PA 3VGMA 4CGGA 2QW9A 4CJ3A 4EHUA 1FXXA 4M7YA 2ITMA 3T1AA 1K6YA 3VTIA 4B3MK 3IMXA 2YNHA 5TKYA 4KH6A 3CJBA 4FJ8A 4NLBA 3J80O 3C7NA 2P9KB 4EFHA 3KK2A 2W6LA 5JLFA 2RHKA 3QB0A 3IG1A 3OYEA 4CIEA 4AM6A 2F96A 5E84A 4OLAA 1BGXT 2DY4A 4DTNA 4RW6A 3HJFA 2KW4A 4WQ4A 4FLUA 3NGIA 2HNZA 3SPZA 4KTZA 4B8AB 1VQMN 1NGDA 3OYNA 3RSEA 1RGIA 4E7KA 4I9QA 3AVJA 1HYSA 3IFRA 3K5MA 3LAKA 1S6PA 4FVUA 3AY9A 1E4FT 3HL8A 2HHVA 3LPTA 4CHZA 2ZJRL 1BA0A 2G8VA 3L2VA 4EHTA 4DSEA 3THXB 2AJQA 2F7TA 2I5JA 1CXQA 4GW6A 3SCXA 4MDBA 2YKMA 4H5NA 3FLCO 3VQCA 1K8AO 4CEBA 5EVZA 4BRPA 3NH1A 4FZXC 4DQPA 1T7PA 3QEWA 2GTDA 4CBWA 2Q97A 4BVOA 3LM2A 4RW9A 2HHSA 1WSJA 2BUPA 4E3SA 2OZMA 1M1KO 1HUXA 2YCHA 1VSIA 3MX5A 5AR0A 3H46O 1T8EA 2PYJA 3IAYA 5AQNA 1JL2A 2W40A 5CYMA 3BZKA 1Z25A 3ENOA 3T19A 3C94A 2HF3A 5M1QA 4CZEA 5M1NA 3O9UA 3FZHA 5GAHP 3NVKA 2O8EA 3ID8A 4BRDA 1W2BM 5J2MA 3SAGA 2E6LA 2FSJA 2F8SA 4KH4A 3NF6A 4BC2A 3ENBA 2KZMA 3D2FB 5KGWA 2QI2A 4FWRA 4Z94A 4KTWA 2E6MA 1EP4A 1C1CA 2P9UA 3K57A 1IKWA 4DFKA 3VESA 4M3TA 4JI4K 1IKYA 2QEXN 2D1KA 3DXKA 2IVPA 3H1QA 5T7BA 2O4GA 4LFAK 4O5BA 4F9OA 1NG9A 2UXCK 4R5PA 4IOCL 2UXBK 3EL2A 1NJXA 4NLCA 3WUHA 2WC9A 3OJSA 3VQ8A 3CCQN 4YOVA 3LWMA 1XHZA 2G8WA 3OS2A 4BR4A 5KRSA 5SWMA 4FLVA 3ZYYX 1U45A 4I6MB 5C42A 3SBGA 3EY1A 3ULEB 1C0TA 3CMAN 3DLEA 5HBMA 3WXIA 1ZXOA 4X64K 2XY5A 2V51B 3I33A 4H0VB 4JYAK 1BU6O 1KVBA 4W5QA 3J81O 4DV3K 1WBBA 1YT3A 4O0IA 3O5BA 4GMJB 3CFOA 1L3VA 1VRUA 1J9AA 4KREA 1ZBUA 1W97L 4JKBA 4LF4K 3AVBA 3HXMA 4B08A 4BY9C 2Z1JA 3P31A 3QFUA 3KTQA 1P8ZA 3OYCA 5AFUA 1N5YA 2Z1HA 4O0JA 3DOKA 4IG0A 3P83D 4CGDA 2E1YA 3WXLA 2P9IA 2OPQA 4H5WA 4NXMK 5CR4A 4X62K 2OANA 3L3VA 1VSEA 2D0OA 1BISA 1HLUA 2HSTA 4BQLA 2WUSA 5C2DA 1X9SA 4LF8K 3KLHA 1RTIA 4QS7A 2O8DB 4JKFA 1GLCG 1VSJA 2B5JA 4EP5A 4BQZA 1HNIA 2YHYA 4ISGA 3Q7CA 3D2EB 3AO1A 3AA5X 3DMJA 2QWLA 1BWFO 3LZIA 1NKCA 4OJRA 5AQFA 3MWPA 3EKSA 4LF6K 4CEFA 4QAGA 4FYDA 1OKJA 2P9NB 3AVFA 4CHYA 4DTRA 4CJKA 3OW2M 3AVMA 1P90A 3T69A 2FC0A 2A1RA 2IVNA 3RMCA 4WQ5A 2VYPA 2ITGA 2OYQA 3HVRA 1HNVA 4ID5A 4FLWA 5BR9A 4N5SA 3DRPA 5BPLA 3FZFA 4WF9L 5EOYA 4DR3K 1UOCA 1YIJN 3R3LA 2FBXA 5FRNA 2GEMA 4IZ9A 2G8KA 3CPEA 4AILC 2D0AA 5M1OA 3KLEA 1TV6A 4PKGA 2E5LK 2YHWA 3FE1A 4KHNA 4OGEA 4OGCA 3KLIA 4X66K 4PWDA 2LSNA 1HX1A 2O8CB 5GADP 5AQZA 2ZE2A 4CE9A 4FJGA 4CIGA 4HUEA 2P5OA 5CYQA 4B1YB 2HF4A 2FBYA 5BR8K 3OYGA 4FJIA 3LDLA 2OA8A 5A2QO 4JNEA 5FDLA 5AQOA 4M45A 4FXDA 4CZJA 3CCJN 3KLGA 3CC7N 1W7AA 4CZFA 3THVA 4M3YA 1BCOA 4GNIA 4M3WA 4Z4IA 2QTDA 3CQYA 5GIOA 3A0IX 1DLOA 1FJGK 4E7LA 2HNYA 3UKUB 4B8CA 1ASWA 4CF8A 3PLAA 5C12A 1WOQA 1D8YA 1LWCA 1HJOA 2PAVA 3L2QA 3E9OA 1KCFA 1BQNA 4BE1A 3DI6A 3RRGA 1KFDA 4B1XB 4DUZK 2HBMA 2PBDA 4H4MA 2Z1IA 4BR7A 2Q3SA 4CBUA 2ZJQL 2YJFA 2UUAK 4IBNA 1MWMA 4I7FA 3HVTA 5LL6Z 3T3FA 4F3TA 3HI0A 3WNEA 4CZIA 1RBSA 1NOZA 4QS9A 4IDHA 1JCFA 1Q8IA 2RKIA 4QOZB 1ZBLA 1TYQA 1K9MO 2ASOA 1LOTB 1Q9YA 4YFUA 4ILGB 2NRRA 3C6UA 2DTUA 1YHQN 4PKIA 1N36K 1QQMA 2OPRA 4DR2K 1B9DA 1RTHA 3M8SA 4RCHA 1RBTA 3GE1A 3TAGA 3IS9A 4DQSA 5C2FA 3ZT0A 3ZX2A 4HCBA 4DR4K 1KAXA 4E1MA 3I55N 2RPIA 3MWTA 3TTDA 2FSKA 5EXWA 3QESA 5I42A 1HQUA 4CZLA 4AQYK 3TSUA 4BRIA 3RMAA 4JS4A 1KQSM 4OLBA 1SZ2A 4FCYA 4BDPA 2GELA 3NAEA 2FLOA 1D4XA 3O6WA 4YOWA 4FWMA 4GY2B 1TVRA 1J54A 2DFHA 5AQMA 3OHRA 1DEJA 4A59A 4HTLA 5JMVA 4LF9K 1YUWA 4DTOA 1QQCA 3MN6A 1NWKA 1JLGA 2ZJPL 3QIPA 1TL1A 1R0AA 1ZBFA 2QXFA 2HMPA 1NK0A 3ZETB 3PY8A 1BL3A 5CY4A 1C0FA 1NJYA 2BGGA 4IEEA 2VGMA 3V9UA 1JLEA 3OYJA 2KFZA 1U49A 4E7JA 5FPEA 4EP4A 1RDCA 4LFBK 2F9TA 2OTJN 2A41A 3ZSVA 4FK2A 1QQOA 4ZTFA 5MLCQ 4FWLA 4KI4A 3TPQA 5AQRA 4FLXA 1DKGD 3DRSA 1RDWX 3DM2A 2Y1IA 4PUOA 1LW2A 4AHVA 3HSTB 1BOTO 4O5FA 4KHPK 1ASVA 4DUYK 1BIZA 3ZSXA 1GOAA 4GVMA 1FKOA 4JI0K 3SZ2A 3DJCA 4H0TB 4M3ZA 5JS2A 4DQRA 1MDUB 4KHUA 2IAJA 4G1QA 2JGUA 4JI8K 2D0CA 3QEIA 4IO8A 1RT7A 4KB0A 4DSFA 3UKRB 2E20A 3B6OA 4FZZA 3D45A 4M7XA 1VK0A 2EX3A 3MXJA 3R1XA 1GLJO 2JWKA 1XC9A 5AQXA 1IBKK 2Q2RA 3OYDA 4CGFA 3FZMA 2PZSA 3RRHA 3VEYA 5HRNA 4KI6A 1A5VA 4Q0BA 5KRTA 4YOYA 3CC2N 4BROA 5KQDA 1RT5A 1EWRA 3M8RA 3ENHA 4JHDA 1T03A 3NGYA 4J2AA 3A5NC 2HBJA 3OYIA
chains in the Genus database with same CATH topology
4CW7B 5AJ3K 4YY3K 5A2QO 4LF9K 2UXDK 4K0KK 1HNZK 4DV5K 1N33K 4X65K 3T1YK 4NXMK 2ZM6K 4X62K 1FJGK 4GKKK 2HHHK 4DV4K 1XMQK 4LFBK 4LF8K 5IT9O 4CVNE 4B3MK 3J7AP 3T1HK 4NXNK 4DUZK 4JI6K 2VQFK 3J80O 1XNQK 1XNRK 4JI5K 2F4VK 3JAMO 5FLXO 2UUAK 5IWAK 4DR5K 4LF6K 4JI4K 4DV7K 2UU9K 5LL6Z 1I94K 4DV6K 4KHPK 4LFCK 4DUYK 4GKJK 5LMNK 3J7YP 4LFAK 4V19S 2UUCK 4DR1K 4JI0K 2UXCK 4YHHK 4DR7K 1IBLK 2UXBK 1N36K 4DV2K 1HNXK 4JI8K 4DR2K 4OX9K 4B3TK 4B3RK 4DR3K 2VQEK 4JI2K 5LMUK 4JI1K 1N32K 3OTOK 4JI7K 1N34K 4X64K 4DR4K 4DV1K 4JYAK 4JV5K 1IBKK 3J81O 4DV3K 4AQYK 4LF7K 2E5LK 4DV0K 4X66K 4JI3K 1HNWK 4B3SK 4LF4K 1XMOK 1J5EK 4DR6K 1HR0K 2UUBK 5BR8K 1IBMK 4LF5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CW7 B;  5AJ3 K;  4YY3 K;  5A2Q O;  4LF9 K;  2UXD K;  4K0K K;  1HNZ K;  4DV5 K;  1N33 K;  4X65 K;  3T1Y K;  4NXM K;  2ZM6 K;  4X62 K;  1FJG K;  4GKK K;  2HHH K;  4DV4 K;  1XMQ K;  4LFB K;  4LF8 K;  5IT9 O;  4CVN E;  4B3M K;  3J7A P;  3T1H K;  4NXN K;  4DUZ K;  4JI6 K;  2VQF K;  3J80 O;  1XNQ K;  1XNR K;  4JI5 K;  2F4V K;  3JAM O;  5FLX O;  2UUA K;  5IWA K;  4DR5 K;  4LF6 K;  4JI4 K;  4DV7 K;  2UU9 K;  5LL6 Z;  1I94 K;  4DV6 K;  4KHP K;  4LFC K;  4DUY K;  4GKJ K;  5LMN K;  3J7Y P;  4LFA K;  4V19 S;  2UUC K;  4DR1 K;  4JI0 K;  2UXC K;  4YHH K;  4DR7 K;  1IBL K;  2UXB K;  1N36 K;  4DV2 K;  1HNX K;  4JI8 K;  4DR2 K;  4OX9 K;  4B3T K;  4B3R K;  4DR3 K;  2VQE K;  4JI2 K;  5LMU K;  4JI1 K;  1N32 K;  3OTO K;  4JI7 K;  1N34 K;  4X64 K;  4DR4 K;  4DV1 K;  4JYA K;  4JV5 K;  1IBK K;  3J81 O;  4DV3 K;  4AQY K;  4LF7 K;  2E5L K;  4DV0 K;  4X66 K;  4JI3 K;  1HNW K;  4B3S K;  4LF4 K;  1XMO K;  1J5E K;  4DR6 K;  1HR0 K;  2UUB K;  5BR8 K;  1IBM K;  4LF5 K; 
#chains in the Genus database with same CATH topology
 3BGR A;  3RMB A;  4GVE A;  4H4O A;  5B8H A;  2A42 A;  4JK9 A;  4E1N A;  5HRO A;  1ZBH A;  1VHX A;  2E1Z A;  4QCL A;  5BRH A;  2HHU A;  2ASP A;  3G10 A;  5KQ8 A;  2G8U A;  2QXL A;  4K0K K;  4RWT A;  4A5B A;  4FJJ A;  4MLE A;  1EXQ A;  3VMF B;  3CJ9 A;  2XHB A;  2QK9 A;  3V1O A;  3E9L A;  3ATV A;  4A61 A;  4DF4 A;  1RTD A;  2A40 A;  4F2R A;  3CJ1 A;  3KIO A;  1RT1 A;  5ADX H;  3PV8 A;  2VWJ A;  1C1B A;  4CJT A;  1NK6 A;  3NH2 A;  1IO2 A;  4CVN E;  4CF2 A;  4A57 A;  4OPJ A;  1NKE A;  1SV5 A;  1NGG A;  3KWG A;  1RFQ A;  4IFE A;  4CZG A;  3EZW A;  1YAG A;  2GWK A;  5CZ1 A;  4CGI A;  2VQF K;  1ZYQ A;  1U47 A;  3CCR N;  4B1V A;  4BWJ A;  3I8B A;  3LDN A;  2WOM A;  4LH5 A;  3FGU A;  4DV7 K;  4C8O A;  3ZCM A;  1BI4 A;  1WSH A;  1BCM A;  4B9L A;  3J8A A;  2IOC A;  2PY5 A;  1QZ6 A;  1X9J A;  2YHB A;  1T05 A;  2OZS A;  4Z4G A;  4FLT A;  3SAF A;  3LP3 A;  5GAE P;  4IO9 L;  1HNX K;  3FZL A;  3DXM A;  3L8B A;  1NM1 A;  2HBK A;  2VQE K;  2WTU A;  3C0B A;  1RT6 A;  3AO3 A;  4EIA A;  3ULD A;  3DLR A;  2A3Z A;  4KRF A;  1L5U A;  3H3N O;  4LY7 A;  2I7P A;  1JLQ A;  3ZET A;  1ILY A;  4FOE A;  5AQL A;  1ZBS A;  4Z4C A;  1HNW K;  3H6E A;  3QNO A;  4IJN A;  1XMO K;  4CJ7 A;  2KHO A;  1MU2 A;  1VRT A;  1DT9 A;  3IUC A;  1KAZ A;  5GIN A;  2W42 A;  4LF5 K;  2HHT A;  3FZK A;  2VG6 A;  1JXE A;  1TUY A;  2P1J A;  3QO9 A;  5BN9 A;  5CE3 A;  4FJL A;  3BP8 A;  2NRW A;  4CF9 A;  1GOB A;  3AGR A;  2VG7 A;  4CJS A;  1J6Z A;  4K43 A;  3WT0 A;  3ZEU A;  3SUO A;  4A2A A;  4JKG B;  3OYF A;  4E1J A;  1KAY A;  4FJK A;  1YI2 N;  1OH7 A;  1IV0 A;  1YIT N;  1Z6R A;  3DLB A;  4MFB A;  1HMV A;  3QBW A;  4GKK K;  1Z26 A;  5HP1 A;  1Z05 A;  4KB1 A;  3WNH A;  3AVK A;  2HHQ A;  4FW2 A;  1D9F A;  1ATR A;  4BE2 A;  3VEW A;  1OH6 A;  4DCH A;  5AZI B;  1BIU A;  3FFI A;  3JAM O;  2G8I A;  5KPR A;  4DHY A;  3P5J A;  3NF9 A;  5DK5 A;  1K8K A;  1HPZ A;  3U6F A;  4PY5 A;  2X6S A;  2UUC K;  3MN5 A;  1EO1 A;  4CHP A;  2P9S A;  3K9K A;  4BGA A;  3PIP L;  3O8M A;  1G99 A;  5FPN A;  3ALY A;  2Y1J A;  3AA4 A;  4LH4 A;  3THW B;  4DQQ A;  5FRO A;  1WB9 A;  3CQX A;  2QWP A;  4M3R A;  3MCA B;  3TSP A;  2F8T A;  3NH0 A;  3OTO K;  4F8R A;  4HWI A;  4DWI A;  1QVF M;  5C15 A;  5J2P A;  1C6V A;  2E2N A;  1GLF O;  3PUF A;  4CEE A;  3AVA A;  4FSV A;  1SKR A;  4WQ4 C;  1X3M A;  1WAF A;  2ZF5 O;  4E7H A;  5EX5 A;  3H1V X;  4CEQ A;  4UQG A;  1NJZ A;  4BGB A;  1U04 A;  1VSH A;  3C95 A;  3GG4 A;  3VQE A;  1NK9 A;  1RCH A;  2HHX A;  1VQL N;  3O4Q A;  4BR2 A;  1ZC6 A;  3THY B;  4DTU A;  2XY7 A;  4XH4 A;  4K8X A;  2QWQ A;  4JKA A;  1B9F A;  3BY5 A;  2E88 A;  2KTQ A;  1TK5 A;  1IKV A;  1HNZ K;  4PQU A;  3K2P A;  4H8K A;  1G15 A;  4BR9 A;  4TSX A;  3N4P A;  1QTM A;  2OPP A;  1GLA G;  3SLC A;  2WON A;  4W5T A;  1Q81 O;  3QIN A;  3QET A;  4F2S A;  4NCB A;  3VF6 A;  5C10 A;  1U6Z A;  3TTF A;  4FWO A;  3OYL A;  4BWM A;  4JAX A;  1VQ4 N;  4FJM A;  5BN8 A;  2P9K A;  1MA9 B;  1JLF A;  4BC4 A;  4FM0 A;  4CK2 A;  3WNF A;  3PX0 A;  1XNR K;  1EQY A;  1QHA A;  4CEO A;  1BDG A;  3WQU A;  3GBT A;  2UU9 K;  1TUU A;  3AV9 A;  1S1V A;  1UA0 A;  3O1W A;  3P39 A;  3CCM N;  1S1W A;  4IG3 A;  3PX6 A;  1SL1 A;  3FR0 A;  4YHH K;  3JSM A;  4IDK A;  1WUA A;  2OTL N;  4CJU A;  3KD1 E;  3SNN A;  4RTF D;  2KQ2 A;  2IVO A;  3UB5 A;  3VEN A;  1VQP N;  2P9P B;  4C1N I;  3S3N A;  3RR8 A;  2NRX A;  4CEA A;  2O8B B;  3E66 A;  5LMU K;  4CFB A;  1VQ8 N;  2PYL A;  3THX A;  2Z1G A;  4LSL A;  1C1A A;  3G4S N;  2P9L B;  1S1T A;  3RVC A;  3KKR A;  1L3S A;  3ZSR A;  1KVC A;  4LF7 K;  5AQS A;  5JVG L;  1NK7 A;  4MO4 A;  4IWV A;  3TAM A;  4CFC A;  5AZJ B;  4GV3 A;  3NDK A;  4KFB A;  2ZWH A;  1ASU A;  3WEE B;  4K8Z A;  3AVN A;  4CZH A;  2W41 A;  1HR0 K;  3R8E A;  4AM7 A;  3SK3 A;  3G25 A;  3DLK A;  2BTF A;  3SJJ A;  5HL7 L;  4CGH A;  4KHS A;  1S3X A;  3DLH A;  1RTJ A;  1RT3 A;  2YNG A;  5E41 A;  4BVP A;  4E19 A;  4FK0 A;  3ZLJ A;  4IXC A;  2HW3 A;  3E01 A;  2E8A A;  1JLB A;  3OBW A;  4ISE A;  3ZSZ A;  1Q82 O;  4CES A;  1REV A;  2FSN A;  1YVU A;  4U67 L;  3MAQ A;  3ZT4 A;  4CD1 A;  2A1S A;  3QIO A;  3U3Y A;  4Q5V A;  4KHW A;  3OS0 A;  1ATN A;  3TTC A;  4I2P A;  4DV4 K;  4BRG A;  4BG8 A;  4FJ9 A;  5HOO A;  5AQY A;  4DSJ A;  3D2F A;  2QKK A;  1LV5 A;  3OJU A;  4OKJ A;  4C8M A;  3HYF A;  3S3M A;  3OA9 A;  2XRI A;  4XEI A;  1CXU A;  4H0O A;  2HB5 A;  3KHY A;  4DFJ A;  4JI5 K;  5BRD A;  4C23 A;  4CZM A;  1RDD A;  1M90 O;  4WYB A;  1U48 A;  4B9Q A;  1K73 O;  3CJA A;  4EZ6 A;  2OPS A;  5J2N A;  5AQP A;  4DR1 K;  4FVM A;  3G6E N;  4LC9 B;  1NGA A;  3CD6 N;  1RDU A;  2RN2 A;  1IBL K;  1U2V B;  1FK9 A;  2YHX A;  4FM1 A;  3EE9 A;  4K25 A;  3AAP A;  1RNH A;  3THY A;  2Q1N A;  3SMS A;  2CGJ A;  4CFA A;  3AA3 A;  3AAR A;  3U3G A;  4I6M A;  4DTS A;  2VWK A;  4UY8 O;  4MLH A;  4B9M A;  1NGI A;  3ULE A;  4YOU A;  5LJV A;  3HBT A;  4L8R B;  4JI7 K;  1GLD G;  2ATQ A;  3IRX A;  2X74 A;  4F3O A;  3AVI A;  1Y64 A;  3VN5 A;  4CI6 A;  3SQ0 A;  3I0S A;  4HUF A;  4FJH A;  3L4Q A;  4BC5 A;  1SL2 A;  2KZZ A;  4JI3 K;  2QM1 A;  1Q86 O;  1NGJ A;  3H45 C;  2FF3 B;  3F73 A;  4BRL A;  1VAZ A;  4WQ5 C;  1KC8 O;  2B6A A;  1IBM K;  1FW6 A;  4RG8 A;  4CW7 B;  3VET A;  2IGI A;  4L3Q A;  4Y1D A;  4CIF A;  2IIR A;  4MQ3 A;  3LWL A;  4K41 A;  1UA1 A;  1YVN A;  1XI1 A;  1S6Q A;  3CM5 A;  3HPG A;  2GUI A;  2V7Z A;  3K59 A;  1SUQ A;  2VWB A;  1SQK A;  4LSN A;  3VTH A;  4YDU A;  4JKC A;  3LAN A;  1I3A A;  3QEP A;  1W9H A;  3NCI A;  1VQ5 N;  4J2B A;  2HHH K;  2GUP A;  3CJC A;  1XMQ K;  3HM8 A;  2NLX A;  3ZSO A;  5ADX A;  3MED A;  4CEZ A;  2O8D A;  4M63 C;  4ICL A;  3D2E A;  4B1Z A;  4ISF A;  5I3U A;  1F21 A;  1QSY A;  4NXN K;  4JI6 K;  4PA1 A;  1XNQ K;  3C7N B;  1VSK A;  4DTJ A;  3C6H A;  4B1U B;  3PSI A;  5M1F A;  3NF8 A;  1WSI A;  3ZX0 A;  1BHL A;  2P9N A;  3K58 A;  1D9D A;  1DGK N;  1NGF A;  3SPY A;  4BRF A;  4LFC K;  1S9E A;  4NCG A;  1QQN A;  3RWU A;  1TAU A;  2A5X A;  4N76 A;  5KPZ A;  3CIP A;  4ZHR A;  1KD1 O;  3HTV A;  3VF4 A;  3RTV A;  4CJQ A;  4DF8 A;  2GBZ A;  1B92 A;  1OH8 A;  4FL9 A;  4AH9 A;  1RBV A;  4CD3 A;  5I9E B;  4IOA L;  5AQV A;  4DKW A;  1OH5 A;  4FK4 A;  4DSI A;  4FWP A;  4JI1 K;  4FWQ A;  1EWQ A;  3SV3 A;  4BRN A;  4Z4F A;  4PL7 A;  4CJE A;  1YJ9 N;  1N34 K;  3C6T A;  3O08 A;  3SBT A;  3O9Q A;  3OYB A;  2Q31 A;  3AO2 A;  4FO0 A;  3CM6 A;  3K5N A;  4O8K A;  1H1V A;  2YV0 X;  1NJW A;  3ID6 A;  3QIC A;  2G8H A;  4CF1 A;  2CGL A;  2O8C A;  4AHU A;  2NNW A;  2QWO A;  3TAF A;  1CZA N;  3RR7 A;  3S3O A;  3SUQ A;  4O4G A;  1TK0 A;  3MN9 A;  3L2W A;  4NYN A;  3V1R A;  1NGE A;  1GLL O;  1NBW A;  1S5J A;  4DFM A;  1EKE A;  3TAE A;  1WBD A;  1J5O A;  3M1F A;  1RBU A;  1TKZ A;  1YTA A;  1QVG M;  3L0Q A;  5DMR A;  1IG9 A;  5AQU A;  1RDB A;  3WXJ A;  4MO5 A;  3T1Y K;  2I7N A;  5DM7 L;  3D0P A;  3LAL A;  2ZGZ A;  2YX6 A;  4DQI A;  2NRH A;  4BAC A;  4OPK A;  4JEP A;  3UKU A;  2O8E B;  4O55 A;  1X9M A;  4WE1 A;  4OPA A;  1IH7 A;  2R7Y A;  4GV6 A;  4Z4E A;  1EX4 A;  1U2V A;  2YNI A;  3TWH A;  2D5R A;  4IOX A;  3D6R A;  3VQB A;  1N8R O;  4FWK A;  1NNE A;  1HYV A;  1CZB A;  3QER A;  3KLF A;  5C25 A;  2P9U B;  3O4W A;  4G9Z A;  1I94 K;  5CHI A;  3I8D A;  3CER A;  3DXK B;  2WFB A;  3EZ5 A;  3V6D A;  4CGJ A;  4FW1 A;  3EKU A;  4KO0 A;  3S9H A;  3M3Z A;  4B9N A;  4RW8 A;  3CFP A;  2D0B A;  4A2B A;  2NRZ A;  5GAG P;  4DV2 K;  2YHA A;  1WNS A;  1VQ6 N;  4CEC A;  4DTP A;  4J2E A;  5HLF A;  3UE5 A;  3O3F A;  1X1P A;  5TKW A;  5K14 A;  3BF3 A;  1LAW A;  3CF5 L;  2BH1 A;  2E4L A;  1V4S A;  3K9J A;  3U4L A;  4FZY A;  2E2Q A;  1RT2 A;  1TKX A;  3GDQ A;  3P1G A;  4BRK A;  5BPM A;  4DV0 K;  4B9V A;  1LAV A;  1A5X A;  1NU0 A;  4RW7 A;  1YXQ A;  3NBP A;  3CHW A;  4B3S K;  3K5L A;  2OCE A;  4M3X A;  4Z4H A;  1YJN N;  3LZJ A;  4BRE A;  5M1K A;  3LPU A;  4YY3 K;  3HO1 A;  1TGO A;  4AHR A;  1IKX A;  3I0R A;  1ITG A;  2O8F B;  1HKG A;  4B9U A;  1NGC A;  4W5R A;  3B6P A;  3O4N A;  4HVJ A;  1SS6 A;  1UAX A;  3CYM A;  3TSQ A;  1S1U A;  1J53 A;  1T3V A;  3L4I A;  3ATU A;  2RE2 A;  4O8U A;  2P9I B;  3L2U A;  2HBL A;  3G71 N;  1WLJ A;  3V9X A;  4CJR A;  1TKT A;  4FWN A;  4BR5 A;  4RW4 A;  1FKP A;  4LD0 A;  4BRQ A;  2G8F A;  3BF1 A;  4N56 A;  3NF7 A;  3V4I A;  4HCC A;  3HOT A;  5FPD A;  3LDP A;  2CGK A;  3DAW A;  4A5A A;  3VEO A;  3PIO L;  3MEE A;  3QBX A;  1KRP A;  3H3O B;  3CCU N;  2ZQB A;  3WNG A;  4DR5 K;  3OVN A;  3MX2 A;  4GKJ K;  3QML A;  5JLH A;  2GWJ A;  3MCP A;  3SAH A;  1WSF A;  5JS1 A;  4R79 A;  3SJH A;  1S72 N;  3LDQ A;  3DOL A;  3V1Q A;  1VSL A;  3A5M C;  3QNN A;  3E1Y A;  1WSE A;  2V52 B;  1RBR A;  4DS5 A;  1XHX A;  1GOC A;  4QS8 A;  1S1X A;  1T6C A;  3O9S A;  2KLA A;  3WXK A;  4IFV A;  4KKO A;  4YOX A;  3UKR A;  4NYF A;  3P4I A;  3LDO A;  3BDP A;  5HRP A;  2X78 A;  2DFF A;  1BQM A;  1NK4 A;  3AAQ A;  1TAQ A;  2YJE A;  3EN9 A;  2NRT A;  2QWR A;  5BRF A;  4YNQ A;  3UIQ A;  3LDS A;  2IDO A;  3VA3 A;  3Q7B A;  1C0G A;  3NMU A;  3VQ5 A;  4C8K A;  4DR6 K;  2HMI A;  4KH5 A;  1KVA A;  3ZX3 A;  3AO5 A;  1Q9X A;  2XY6 A;  4NB4 A;  2BDP A;  3K0S A;  4FJ5 A;  2YI1 A;  3VPZ A;  4JKD A;  2BE2 A;  5AQH A;  1LCU A;  5AQW A;  4J8F A;  4BRH A;  1QS4 A;  4WCE L;  1D5A A;  4PKH A;  3L2R A;  4U7B A;  2D0P A;  4OKK A;  4DSL A;  2NZT A;  4H0X B;  5AQT A;  4JK8 A;  3BZC A;  4KBO A;  3G0Z A;  2QWM A;  3W0L A;  4W5N A;  3NGZ A;  3V81 A;  3WXM B;  2CH5 A;  3F9M A;  3HP9 A;  4CER A;  1Q18 A;  1KXP A;  4B9S A;  5ELZ A;  4KV8 A;  4FPA A;  4CJV A;  3U9D A;  4CBX A;  2D4W A;  4CF0 A;  4JD2 B;  1RIL A;  4CK1 A;  1Q7Y O;  1HYZ A;  4BRA A;  2RF2 A;  4H5R A;  5C0Y A;  3SI6 A;  4XH5 A;  3CPW M;  2W6K A;  4CJW A;  3KK7 A;  3LM9 A;  3CC4 N;  3VEZ A;  1XWL A;  5J2Q A;  1TYQ B;  2X6N A;  1SL0 A;  3CJ7 A;  2DPN A;  4ZTJ A;  3DWL A;  2HVI A;  2DFE A;  1TL3 A;  2UYT A;  2JLE A;  3MK6 A;  1KTQ A;  1SAZ A;  3CCL N;  5F0X A;  1HRH A;  3PX4 A;  1OVY A;  4Y0W A;  4I9L A;  3OY9 A;  3HRG A;  1IJJ A;  3ZT3 A;  4B3R K;  4FJX A;  3ASM A;  4JN4 A;  2O8F A;  3IDH A;  3AVG A;  4DV1 K;  2KKZ A;  2QA4 N;  1BUP A;  3PO4 A;  3HM9 A;  3LL3 A;  4DB3 A;  2GX9 A;  2NUB A;  2FBV A;  4CJ5 A;  5JVH L;  4IJA A;  3LP0 A;  2QKB A;  3PO5 A;  4IEI A;  1JKH A;  3HZ6 A;  4B9T A;  1BG3 A;  3A8Y A;  3MXM A;  1TKD A;  1J5E K;  3SUP A;  4HTU A;  4DU4 A;  3CXC M;  4H5V A;  1CLQ A;  3JXU A;  5KI6 A;  3F9K A;  4CHN A;  3VER A;  1QSL A;  4CHQ A;  3O9R A;  3CCS N;  4EAH D;  3DLG A;  4FJN A;  3MEG A;  4JKG A;  1HJR A;  3AVH A;  4ELV A;  1OVQ A;  2HHW A;  3ITH A;  4DLE A;  3KD5 E;  3CME N;  1X9W A;  1QE1 A;  1HKC A;  1JLA A;  1T44 A;  4KTQ A;  4OO1 J;  3A5O C;  4OKE A;  5M1P A;  3KVG A;  3SV4 A;  3J7A P;  1JLC A;  3M8Q A;  4NCA A;  3QEV A;  1KFS A;  5AZI A;  3ZSW A;  2EWS A;  4DFP A;  3QFP A;  4AHT A;  2ZD1 A;  1N6Q A;  1W0H A;  5FLX O;  3M8P A;  5IWA K;  3CET A;  3KK3 A;  3NE6 A;  2CH6 A;  3LP1 A;  4IKF A;  3T7Z A;  1R59 O;  4AHS A;  1VSD A;  4DG1 A;  4IFY A;  4WFA L;  4JK7 A;  5H1S Q;  1NOY A;  2KFN A;  3NFA A;  4E7I A;  1LWE A;  1NMN A;  4A62 A;  4DR7 K;  3ZSY A;  1E4G T;  1QHT A;  3TI0 A;  3CCV N;  3THW A;  4AF1 A;  4E0D A;  1NGB A;  2WBN A;  4CZK A;  5HRS A;  4B3T K;  4H03 B;  1IG8 A;  2Q0U A;  1DTQ A;  3EE8 A;  2V7Y A;  1LW0 A;  3DRR A;  3OYK A;  3V9Z A;  3SQ4 A;  1S22 A;  2YNF A;  1L3T A;  3VEX A;  3MMV A;  4HHT A;  1KSP A;  3BEX A;  2JWL A;  3F5T A;  2VGN A;  3W3D A;  3I56 N;  2ETJ A;  3VQQ A;  3VQ4 A;  3HPH A;  4CK3 A;  4C8N A;  1HPM A;  3FFK B;  4CED A;  3SMP A;  4M42 A;  4WFN L;  3CI5 A;  1ZBI A;  4CFD A;  4O44 A;  1A5W A;  3VF2 A;  4JHD B;  3O3H A;  2UUB K;  4JI2 K;  3M5R A;  3WQT A;  1GLE G;  3GOI A;  2AP1 A;  5LY3 A;  1T6D A;  5AFU H;  2XO7 A;  3BUZ B;  3VGK A;  1O1W A;  5CZ2 A;  3QEX A;  3CFR A;  3VQA A;  5SZT A;  4E89 A;  5D3G A;  2ZGY A;  4C1N K;  3SQ1 A;  4JD2 A;  1HQE A;  4FLY A;  3TR8 A;  3VQ9 A;  4BDZ A;  4DTM A;  1YJW N;  4DSK A;  4DV5 K;  3OS1 A;  1N33 K;  5AQQ A;  1Y97 A;  3P38 A;  3TAB A;  2HVH A;  4EZ9 A;  3JYT A;  3F2K A;  2FF6 A;  3H08 A;  4BRM A;  4DLG A;  5F2R A;  4PHT X;  4JLH A;  5IT9 O;  4JKE A;  3AGK A;  1KLM A;  3O1B A;  4BE0 A;  5GIP A;  3AVL A;  3CQ8 A;  2F4V K;  1C0M A;  2AA4 A;  2XY8 A;  2F9W A;  1WSG A;  4H0Y B;  1VQN N;  1UWB A;  1I39 A;  4H0P A;  4YOR A;  1BA1 A;  1XUP O;  4H5T A;  4B1W B;  3E9P A;  1XQS C;  1ESV A;  2YKN A;  4B3O A;  3HP6 A;  3HPO A;  1BI4 B;  1WN7 A;  3J7Y P;  2HND A;  4XH1 A;  4Z0U A;  3HT3 A;  4CJ4 A;  4DTX A;  4ILJ A;  3U8X A;  5EY4 A;  3L6Q A;  1RT4 A;  3B8A X;  2P9P A;  3L3U A;  3VGL A;  5KGX A;  4OX9 K;  3O3G A;  4BC3 A;  3HSC A;  3M6G A;  2IS3 A;  4N41 A;  4Y1C A;  2O8B A;  1JXB A;  1C0U A;  3DXM B;  4FWS A;  4K42 A;  4FOI A;  3VQ7 A;  4M41 A;  3GL1 A;  3CG7 A;  3SQ2 A;  2P9L A;  2ASM A;  2EHG A;  3KWI A;  4C8L A;  3ZT2 A;  4MDA A;  4N47 A;  4CJL A;  3KK1 A;  5BRE A;  1QZ5 A;  3NVM A;  3MEC A;  5AZJ A;  1NMD A;  2QWN A;  3RSE B;  3WEE A;  1V4T A;  4JRP A;  2O4I A;  3O80 A;  3TAQ A;  3ZSQ A;  4FM2 A;  4OPH A;  1LWF A;  4HUG A;  3PSF A;  1WAJ A;  1JJ2 M;  2VCP A;  3AVC A;  3C65 A;  3QLH A;  3IKM A;  5AJ3 K;  4W5O A;  3QDK A;  1U4B A;  4DS4 A;  3R6M A;  4ILH A;  2PFU A;  3VA0 A;  3V9W A;  1L3U A;  4BR0 A;  3LP2 A;  1QSS A;  3NHG A;  2P51 A;  5EU7 A;  3ZEU B;  3AO4 A;  3O9T A;  3JS6 A;  1SKW A;  2H3G X;  4KAZ A;  3TAP A;  1RDA A;  1XC3 A;  1YF5 L;  3OYH A;  4CJP A;  2NRV A;  3TAR A;  1VSM A;  1YTU A;  4JKH A;  3VEV A;  3S41 A;  2B4J A;  3RMD A;  1DTT A;  3SUN A;  3A5L C;  3EYZ A;  4CCH A;  3HOS A;  3D7E O;  2A6A A;  4WFB L;  1NKB A;  2VG5 A;  4BDY A;  4DQ8 A;  5HRR A;  3T1H K;  4NO7 A;  2GV9 A;  4KHQ A;  1NJI O;  2HOE A;  4DU3 A;  4DU1 A;  4FLZ A;  2J4R A;  4PL8 A;  1NGH A;  1X3N A;  4YDU C;  4OVL A;  3KZB A;  5JIC A;  4JRQ A;  4DV6 K;  1K8K B;  1NK8 A;  3OYA A;  1NK5 A;  5LMN K;  2Q36 A;  5AQI A;  4V19 S;  3K5O A;  3SYZ A;  5BPN A;  5AQK A;  5KTQ A;  4FJ7 A;  3EO3 A;  4F4K A;  4ID1 A;  2P9S B;  5DM6 L;  4YOT A;  1VQ7 N;  3ISN C;  4I2Q A;  1HKB A;  1NLV A;  4BG9 A;  4GV9 A;  4DMN A;  5C24 A;  3VQP A;  3J7Z O;  2FBT A;  5J1E A;  1BO5 O;  3R9P A;  1O13 A;  3OYM A;  5AQJ A;  4AHC A;  3HK2 A;  3A2F A;  1N32 K;  3N4Q A;  2IC3 A;  1SKS A;  1E3M A;  2BAN A;  1JCG A;  4KHY A;  1CZ9 A;  1TK8 A;  1EET A;  4JV5 K;  3ZT1 A;  3V9S A;  3KKS A;  5KPT A;  1KLN A;  3CCE N;  4BRC A;  3EEQ A;  5FRM A;  5E26 A;  1VQO N;  3MDQ A;  2E2O A;  4M3U A;  4CJF A;  4ELU A;  5F1X A;  1VQK N;  4KPY A;  2Q0R A;  4ELT A;  1JL1 A;  4XIU A;  4CHO A;  3MN7 A;  3LAM A;  1ATS A;  3TAN A;  2UXD K;  3AA2 A;  5FPM A;  1VSF A;  3MXI A;  1S9G A;  3C6A A;  3VOV A;  1JCE A;  1MWK A;  3VQ6 A;  5AQG A;  5LJW A;  4X65 K;  4JS5 A;  3DYA A;  3DLL L;  2P5G A;  4J2D A;  3TU5 A;  3VQD A;  4FPB A;  2ZM6 K;  1GLB G;  3U9Z A;  3OBY A;  3KJV A;  1VQ9 N;  2FXU A;  2E2P A;  3VGM A;  4CGG A;  2QW9 A;  4CJ3 A;  4EHU A;  1FXX A;  4M7Y A;  2ITM A;  3T1A A;  1K6Y A;  3VTI A;  4B3M K;  3IMX A;  2YNH A;  5TKY A;  4KH6 A;  3CJB A;  4FJ8 A;  4NLB A;  3J80 O;  3C7N A;  2P9K B;  4EFH A;  3KK2 A;  2W6L A;  5JLF A;  2RHK A;  3QB0 A;  3IG1 A;  3OYE A;  4CIE A;  4AM6 A;  2F96 A;  5E84 A;  4OLA A;  1BGX T;  2DY4 A;  4DTN A;  4RW6 A;  3HJF A;  2KW4 A;  4WQ4 A;  4FLU A;  3NGI A;  2HNZ A;  3SPZ A;  4KTZ A;  4B8A B;  1VQM N;  1NGD A;  3OYN A;  3RSE A;  1RGI A;  4E7K A;  4I9Q A;  3AVJ A;  1HYS A;  3IFR A;  3K5M A;  3LAK A;  1S6P A;  4FVU A;  3AY9 A;  1E4F T;  3HL8 A;  2HHV A;  3LPT A;  4CHZ A;  2ZJR L;  1BA0 A;  2G8V A;  3L2V A;  4EHT A;  4DSE A;  3THX B;  2AJQ A;  2F7T A;  2I5J A;  1CXQ A;  4GW6 A;  3SCX A;  4MDB A;  2YKM A;  4H5N A;  3FLC O;  3VQC A;  1K8A O;  4CEB A;  5EVZ A;  4BRP A;  3NH1 A;  4FZX C;  4DQP A;  1T7P A;  3QEW A;  2GTD A;  4CBW A;  2Q97 A;  4BVO A;  3LM2 A;  4RW9 A;  2HHS A;  1WSJ A;  2BUP A;  4E3S A;  2OZM A;  1M1K O;  1HUX A;  2YCH A;  1VSI A;  3MX5 A;  5AR0 A;  3H46 O;  1T8E A;  2PYJ A;  3IAY A;  5AQN A;  1JL2 A;  2W40 A;  5CYM A;  3BZK A;  1Z25 A;  3ENO A;  3T19 A;  3C94 A;  2HF3 A;  5M1Q A;  4CZE A;  5M1N A;  3O9U A;  3FZH A;  5GAH P;  3NVK A;  2O8E A;  3ID8 A;  4BRD A;  1W2B M;  5J2M A;  3SAG A;  2E6L A;  2FSJ A;  2F8S A;  4KH4 A;  3NF6 A;  4BC2 A;  3ENB A;  2KZM A;  3D2F B;  5KGW A;  2QI2 A;  4FWR A;  4Z94 A;  4KTW A;  2E6M A;  1EP4 A;  1C1C A;  2P9U A;  3K57 A;  1IKW A;  4DFK A;  3VES A;  4M3T A;  4JI4 K;  1IKY A;  2QEX N;  2D1K A;  3DXK A;  2IVP A;  3H1Q A;  5T7B A;  2O4G A;  4LFA K;  4O5B A;  4F9O A;  1NG9 A;  2UXC K;  4R5P A;  4IOC L;  2UXB K;  3EL2 A;  1NJX A;  4NLC A;  3WUH A;  2WC9 A;  3OJS A;  3VQ8 A;  3CCQ N;  4YOV A;  3LWM A;  1XHZ A;  2G8W A;  3OS2 A;  4BR4 A;  5KRS A;  5SWM A;  4FLV A;  3ZYY X;  1U45 A;  4I6M B;  5C42 A;  3SBG A;  3EY1 A;  3ULE B;  1C0T A;  3CMA N;  3DLE A;  5HBM A;  3WXI A;  1ZXO A;  4X64 K;  2XY5 A;  2V51 B;  3I33 A;  4H0V B;  4JYA K;  1BU6 O;  1KVB A;  4W5Q A;  3J81 O;  4DV3 K;  1WBB A;  1YT3 A;  4O0I A;  3O5B A;  4GMJ B;  3CFO A;  1L3V A;  1VRU A;  1J9A A;  4KRE A;  1ZBU A;  1W97 L;  4JKB A;  4LF4 K;  3AVB A;  3HXM A;  4B08 A;  4BY9 C;  2Z1J A;  3P31 A;  3QFU A;  3KTQ A;  1P8Z A;  3OYC A;  5AFU A;  1N5Y A;  2Z1H A;  4O0J A;  3DOK A;  4IG0 A;  3P83 D;  4CGD A;  2E1Y A;  3WXL A;  2P9I A;  2OPQ A;  4H5W A;  4NXM K;  5CR4 A;  4X62 K;  2OAN A;  3L3V A;  1VSE A;  2D0O A;  1BIS A;  1HLU A;  2HST A;  4BQL A;  2WUS A;  5C2D A;  1X9S A;  4LF8 K;  3KLH A;  1RTI A;  4QS7 A;  2O8D B;  4JKF A;  1GLC G;  1VSJ A;  2B5J A;  4EP5 A;  4BQZ A;  1HNI A;  2YHY A;  4ISG A;  3Q7C A;  3D2E B;  3AO1 A;  3AA5 X;  3DMJ A;  2QWL A;  1BWF O;  3LZI A;  1NKC A;  4OJR A;  5AQF A;  3MWP A;  3EKS A;  4LF6 K;  4CEF A;  4QAG A;  4FYD A;  1OKJ A;  2P9N B;  3AVF A;  4CHY A;  4DTR A;  4CJK A;  3OW2 M;  3AVM A;  1P90 A;  3T69 A;  2FC0 A;  2A1R A;  2IVN A;  3RMC A;  4WQ5 A;  2VYP A;  2ITG A;  2OYQ A;  3HVR A;  1HNV A;  4ID5 A;  4FLW A;  5BR9 A;  4N5S A;  3DRP A;  5BPL A;  3FZF A;  4WF9 L;  5EOY A;  4DR3 K;  1UOC A;  1YIJ N;  3R3L A;  2FBX A;  5FRN A;  2GEM A;  4IZ9 A;  2G8K A;  3CPE A;  4AIL C;  2D0A A;  5M1O A;  3KLE A;  1TV6 A;  4PKG A;  2E5L K;  2YHW A;  3FE1 A;  4KHN A;  4OGE A;  4OGC A;  3KLI A;  4X66 K;  4PWD A;  2LSN A;  1HX1 A;  2O8C B;  5GAD P;  5AQZ A;  2ZE2 A;  4CE9 A;  4FJG A;  4CIG A;  4HUE A;  2P5O A;  5CYQ A;  4B1Y B;  2HF4 A;  2FBY A;  5BR8 K;  3OYG A;  4FJI A;  3LDL A;  2OA8 A;  5A2Q O;  4JNE A;  5FDL A;  5AQO A;  4M45 A;  4FXD A;  4CZJ A;  3CCJ N;  3KLG A;  3CC7 N;  1W7A A;  4CZF A;  3THV A;  4M3Y A;  1BCO A;  4GNI A;  4M3W A;  4Z4I A;  2QTD A;  3CQY A;  5GIO A;  3A0I X;  1DLO A;  1FJG K;  4E7L A;  2HNY A;  3UKU B;  4B8C A;  1ASW A;  4CF8 A;  3PLA A;  5C12 A;  1WOQ A;  1D8Y A;  1LWC A;  1HJO A;  2PAV A;  3L2Q A;  3E9O A;  1KCF A;  1BQN A;  4BE1 A;  3DI6 A;  3RRG A;  1KFD A;  4B1X B;  4DUZ K;  2HBM A;  2PBD A;  4H4M A;  2Z1I A;  4BR7 A;  2Q3S A;  4CBU A;  2ZJQ L;  2YJF A;  2UUA K;  4IBN A;  1MWM A;  4I7F A;  3HVT A;  5LL6 Z;  3T3F A;  4F3T A;  3HI0 A;  3WNE A;  4CZI A;  1RBS A;  1NOZ A;  4QS9 A;  4IDH A;  1JCF A;  1Q8I A;  2RKI A;  4QOZ B;  1ZBL A;  1TYQ A;  1K9M O;  2ASO A;  1LOT B;  1Q9Y A;  4YFU A;  4ILG B;  2NRR A;  3C6U A;  2DTU A;  1YHQ N;  4PKI A;  1N36 K;  1QQM A;  2OPR A;  4DR2 K;  1B9D A;  1RTH A;  3M8S A;  4RCH A;  1RBT A;  3GE1 A;  3TAG A;  3IS9 A;  4DQS A;  5C2F A;  3ZT0 A;  3ZX2 A;  4HCB A;  4DR4 K;  1KAX A;  4E1M A;  3I55 N;  2RPI A;  3MWT A;  3TTD A;  2FSK A;  5EXW A;  3QES A;  5I42 A;  1HQU A;  4CZL A;  4AQY K;  3TSU A;  4BRI A;  3RMA A;  4JS4 A;  1KQS M;  4OLB A;  1SZ2 A;  4FCY A;  4BDP A;  2GEL A;  3NAE A;  2FLO A;  1D4X A;  3O6W A;  4YOW A;  4FWM A;  4GY2 B;  1TVR A;  1J54 A;  2DFH A;  5AQM A;  3OHR A;  1DEJ A;  4A59 A;  4HTL A;  5JMV A;  4LF9 K;  1YUW A;  4DTO A;  1QQC A;  3MN6 A;  1NWK A;  1JLG A;  2ZJP L;  3QIP A;  1TL1 A;  1R0A A;  1ZBF A;  2QXF A;  2HMP A;  1NK0 A;  3ZET B;  3PY8 A;  1BL3 A;  5CY4 A;  1C0F A;  1NJY A;  2BGG A;  4IEE A;  2VGM A;  3V9U A;  1JLE A;  3OYJ A;  2KFZ A;  1U49 A;  4E7J A;  5FPE A;  4EP4 A;  1RDC A;  4LFB K;  2F9T A;  2OTJ N;  2A41 A;  3ZSV A;  4FK2 A;  1QQO A;  4ZTF A;  5MLC Q;  4FWL A;  4KI4 A;  3TPQ A;  5AQR A;  4FLX A;  1DKG D;  3DRS A;  1RDW X;  3DM2 A;  2Y1I A;  4PUO A;  1LW2 A;  4AHV A;  3HST B;  1BOT O;  4O5F A;  4KHP K;  1ASV A;  4DUY K;  1BIZ A;  3ZSX A;  1GOA A;  4GVM A;  1FKO A;  4JI0 K;  3SZ2 A;  3DJC A;  4H0T B;  4M3Z A;  5JS2 A;  4DQR A;  1MDU B;  4KHU A;  2IAJ A;  4G1Q A;  2JGU A;  4JI8 K;  2D0C A;  3QEI A;  4IO8 A;  1RT7 A;  4KB0 A;  4DSF A;  3UKR B;  2E20 A;  3B6O A;  4FZZ A;  3D45 A;  4M7X A;  1VK0 A;  2EX3 A;  3MXJ A;  3R1X A;  1GLJ O;  2JWK A;  1XC9 A;  5AQX A;  1IBK K;  2Q2R A;  3OYD A;  4CGF A;  3FZM A;  2PZS A;  3RRH A;  3VEY A;  5HRN A;  4KI6 A;  1A5V A;  4Q0B A;  5KRT A;  4YOY A;  3CC2 N;  4BRO A;  5KQD A;  1RT5 A;  1EWR A;  3M8R A;  3ENH A;  4JHD A;  1T03 A;  3NGY A;  4J2A A;  3A5N C;  2HBJ A;  3OYI A; 
#chains in the Genus database with same CATH homology
 4CW7 B;  5AJ3 K;  4YY3 K;  5A2Q O;  4LF9 K;  2UXD K;  4K0K K;  1HNZ K;  4DV5 K;  1N33 K;  4X65 K;  3T1Y K;  4NXM K;  2ZM6 K;  4X62 K;  1FJG K;  4GKK K;  2HHH K;  4DV4 K;  1XMQ K;  4LFB K;  4LF8 K;  5IT9 O;  4CVN E;  4B3M K;  3J7A P;  3T1H K;  4NXN K;  4DUZ K;  4JI6 K;  2VQF K;  3J80 O;  1XNQ K;  1XNR K;  4JI5 K;  2F4V K;  3JAM O;  5FLX O;  2UUA K;  5IWA K;  4DR5 K;  4LF6 K;  4JI4 K;  4DV7 K;  2UU9 K;  5LL6 Z;  1I94 K;  4DV6 K;  4KHP K;  4LFC K;  4DUY K;  4GKJ K;  5LMN K;  3J7Y P;  4LFA K;  4V19 S;  2UUC K;  4DR1 K;  4JI0 K;  2UXC K;  4YHH K;  4DR7 K;  1IBL K;  2UXB K;  1N36 K;  4DV2 K;  1HNX K;  4JI8 K;  4DR2 K;  4OX9 K;  4B3T K;  4B3R K;  4DR3 K;  2VQE K;  4JI2 K;  5LMU K;  4JI1 K;  1N32 K;  3OTO K;  4JI7 K;  1N34 K;  4X64 K;  4DR4 K;  4DV1 K;  4JYA K;  4JV5 K;  1IBK K;  3J81 O;  4DV3 K;  4AQY K;  4LF7 K;  2E5L K;  4DV0 K;  4X66 K;  4JI3 K;  1HNW K;  4B3S K;  4LF4 K;  1XMO K;  1J5E K;  4DR6 K;  1HR0 K;  2UUB K;  5BR8 K;  1IBM K;  4LF5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...