2VQFK

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2vqfK00
4DV1K 4DV2K 5IT9O 3OTOK 4JI8K 5IWAK 4JI6K 4YHHK 4DR7K 1N32K 1IBKK 5A2QO 4DV7K 4DR5K 4B3RK 4DUYK 4DR4K 1HNZK 4DR6K 4JI3K 1I94K 4DV4K 4DV3K 4X65K 4LF8K 1IBMK 2UUCK 4CVNE 4V19S 4JI2K 4JI4K 1XNQK 1IBLK 4NXMK 4LF9K 4CW7B 4LF5K 4LF6K 4X64K 1XNRK 4GKJK 4YY3K 2ZM6K 4DV5K 3J7AP 3J7YP 5LMNK 2UXDK 5LL6Z 4X66K 1XMOK 1N33K 4DV0K 4DR2K 2F4VK 1HR0K 2UXCK 5FLXO 4X62K 3T1HK 1FJGK 4LF4K 5AJ3K 1HNWK 4LF7K 4B3SK 4DR3K 2HHHK 3J80O 4AQYK 5BR8K 4LFAK 4OX9K 3T1YK 4JYAK 4JI1K 4JI0K 2UU9K 4NXNK 2UUBK 1J5EK 1XMQK 4DUZK 3JAMO 4JV5K 2VQFK 4KHPK 4LFBK 4JI7K 4LFCK 2UUAK 4GKKK 4K0KK 1N34K 1N36K 4DR1K 1HNXK 3J81O 2UXBK 2E5LK 2VQEK 4JI5K 4DV6K 5LMUK 4B3TK 4B3MK
chains in the Genus database with same CATH superfamily
3D7EO 1IJJA 4BRHA 3OJSA 3AVFA 3FFKB 4CEDA 1OH7A 3NE6A 1BIZA 1KTQA 2P9NA 4CBXA 2O8EA 5BPNA 1REVA 3CYMA 4CZIA 4PKIA 4DR5K 5GIPA 4JKEA 5E84A 1JLQA 1LAVA 2NRZA 3LDNA 3T7ZA 4J2BA 1LWEA 2B6AA 1RDUA 4NO7A 1QQCA 2Q1NA 3UKRB 1WSJA 4CZJA 4FW1A 4A2AA 1OH6A 1G99A 3ID6A 1K6YA 4CVNE 3AARA 2HW3A 3SPYA 4IKFA 4FZYA 1WAJA 2QI2A 4CW7B 3R8EA 2A42A 5ELZA 1XC3A 2IC3A 5AQVA 5AQZA 2FSJA 4CZLA 1YIJN 1Q81O 1IG9A 4NLBA 4M3YA 1MA9B 4DTXA 1J9AA 3TSPA 2P5OA 4KI6A 2FSKA 2I7NA 3CCLN 4IDHA 3ID8A 4B1VA 4M3UA 4KFBA 4O5BA 1VQMN 3WXKA 1FJGK 3JXUA 1HPMA 1JJ2M 1NKEA 4H0TB 2PYJA 3AO3A 4IEEA 5JS2A 1HPZA 3CM5A 3AA4A 1NGJA 3D45A 3ENBA 1DKGD 3S3MA 2OTLN 2Z1IA 3KK1A 3HRGA 4OKJA 2P9PA 3DJCA 4FL9A 4J2DA 3PV8A 3IMXA 3NVKA 3H3NO 1A5WA 4BRMA 1NGFA 3HL8A 3QICA 1VQNN 3HTVA 3DLLL 1YF5L 3L2VA 3NGIA 1U49A 5HROA 1NJXA 3KKRA 4ID5A 3MXIA 3EKUA 2GUPA 2A5XA 1BO5O 2HSTA 4DSJA 3V9SA 3H1VX 2G8UA 3WXJA 3FZKA 2HNZA 4JKGB 3J81O 3KK3A 3LP1A 3JS6A 5FRMA 4K8XA 4DFMA 3A8YA 4DQPA 5BRDA 3M5RA 2XO7A 1IO2A 4BE1A 4KH4A 5CYMA 2Q36A 3V9UA 1YTUA 4I7FA 3V9WA 4DTJA 4FZZA 2RE2A 4MLHA 1D8YA 2X74A 3NVMA 1RTHA 4FK2A 4PL8A 1KVAA 4FLWA 2BGGA 2O8DA 3AO2A 4ZTJA 2P9LA 4MO5A 3AV9A 4AH9A 1NOYA 1VQ9N 4I2PA 2E1ZA 1TL3A 4DQ8A 5DMRA 2A1SA 1NWKA 5KPRA 2O8FA 2RN2A 1I39A 4AHTA 2BH1A 3KLGA 1UOCA 4CEQA 4AHSA 1J54A 4CHZA 4BDYA 4GVEA 2QW9A 5K14A 4E7KA 1WSGA 4DTSA 3KZBA 3HK2A 1S1TA 4RW6A 2NUBA 3GDQA 1B92A 4JN4A 2KLAA 2VG7A 4CI6A 1S9GA 5J2NA 1IKYA 4JK9A 3T1HK 4PHTX 2P9UA 2O4GA 1JCGA 2ZWHA 2ITMA 5AQRA 4BQZA 2P5GA 1CXUA 1W2BM 1BQMA 2UYTA 3R1XA 4ICLA 4HCBA 4CGDA 4RW4A 3NH1A 4LFAK 4IOXA 3LDSA 4BRAA 4GV3A 2E88A 1RDBA 1JLBA 3C0BA 3H6EA 3VQ6A 3CPWM 3B8AX 5HP1A 2X78A 3SUQA 2UUBK 5H1SQ 4BRNA 1G15A 4H5TA 1GLAG 4JKBA 1KFSA 1JKHA 3AVHA 1XUPO 1YI2N 4WQ5A 3G0ZA 2CGLA 5CZ2A 4FLVA 4A5BA 3B6PA 4BGBA 3U3YA 3T3FA 4U67L 2DFFA 1C0MA 5FROA 2JLEA 2FF3B 3CQXA 3P4IA 2I7PA 1N32K 3KWGA 4RW7A 4GW6A 4A59A 4ILHA 4UY8O 1V4SA 1U2VA 3M1FA 1HYSA 4K8ZA 3L6QA 5AQIA 2X6NA 3I8DA 3PX4A 1NK0A 1RBTA 3VEVA 2QM1A 4KKOA 5JVHL 4WFBL 4KH5A 1R0AA 2OTJN 1BDGA 3O80A 3LP2A 3N4QA 3GOIA 1EWQA 1HQUA 2FBYA 4CGFA 3M3ZA 4W5NA 4CEFA 1U6ZA 3RSEA 4H0VB 4L8RB 3MWPA 4YOUA 5KPZA 1JLEA 1U48A 2BE2A 2WFBA 4M3WA 1YJNN 3UIQA 2HBMA 4FXDA 2OPRA 4EHTA 3VQ5A 3P5JA 4KH6A 4BC5A 2HHVA 1NKCA 3VETA 4CZFA 3AA3A 4CZHA 2RF2A 4M42A 4LF4K 3U8XA 5BREA 1CLQA 1XHZA 4DR3K 1EQYA 4UQGA 4AQYK 5M1KA 4LSNA 3K5NA 2HNDA 1TAUA 2GBZA 4BWJA 1JCEA 4HUFA 3OY9A 4BRPA 4CK1A 2CH5A 5EY4A 4DUZK 3OBYA 1B9FA 2Q2RA 4BRLA 3D2EB 5M1QA 1BL3A 2HF4A 2ZF5O 4CJKA 1GLLO 4DMNA 1N36K 1WB9A 1CZ9A 3KHYA 4A62A 3THYB 5J2QA 4IO8A 1X9SA 4B3MK 4DSKA 3O5BA 4IFVA 2HHQA 4ILJA 3H1QA 4BROA 3HVTA 1TKDA 4HUGA 1NGDA 1JL1A 4FWKA 3VTHA 4YFUA 2V7ZA 3VQBA 1ZBHA 3SUPA 2GTDA 3QINA 5DM6L 2YV0X 3T69A 4B1ZA 4XH1A 4ELVA 2O4IA 3PUFA 1NJYA 3E9OA 3I0SA 2ZGYA 3VGLA 3THXB 3O4NA 1QTMA 3ZETA 1TUUA 3F73A 4CIEA 4V19S 1LW2A 2HOEA 4DTMA 4C8KA 1GLEG 1D4XA 3OYEA 4WQ4C 1JLGA 3OYAA 3LDOA 4F3OA 2KHOA 4H4OA 3FZMA 2FXUA 3OW2M 1KVBA 4B08A 3PY8A 3O4QA 3CCEN 5BN8A 4DV0K 4KV8A 2CGJA 2VCPA 1TK8A 2HBJA 3OYDA 4OKEA 1XC9A 4DFPA 4CZKA 1ATNA 1BI4A 3CHWA 1TV6A 2HHHK 2VWJA 4CEOA 3PIOL 2ASMA 3H45C 4DTNA 3ZT2A 3G4SN 4KTWA 2NRVA 3VQ8A 3HOSA 1LWFA 4QS8A 5EXWA 1Z6RA 1WBBA 1E3MA 4H4MA 1J5EK 4W5QA 2Z1GA 5CR4A 2YNGA 1SKSA 1IKWA 1BISA 2D0PA 3P1GA 2OZMA 4NCAA 3TANA 3ZSVA 3DXKB 1LOTB 4OVLA 3CC7N 3CJ9A 3NBPA 1L3SA 3KK7A 3P38A 3BZCA 1RDCA 3O1WA 4DQSA 4B8CA 3K2PA 3NF9A 1T6DA 2CGKA 3SBGA 3PX6A 3RMBA 4EHUA 3DOLA 4JRPA 2E2QA 4FWLA 4Z4CA 3OS1A 2GEMA 4DV1K 4IOCL 4KHSA 4KREA 4OPJA 5TKYA 3VQQA 3UE5A 1U04A 1DT9A 3E1YA 1JLAA 3LM9A 3M8SA 1S3XA 1NGBA 3VESA 4KO0A 1C0UA 1T6CA 4DFJA 3ZX0A 3WNHA 3THVA 3C65A 3C6AA 4H5RA 4BR4A 1Y64A 4BRDA 4X65K 1OH5A 2IVPA 4KPYA 4G1QA 3ZT0A 3CFRA 5C2FA 3A2FA 4HUEA 2PY5A 4JI2K 4FWNA 5SZTA 3CCVN 1SKWA 1WNSA 2DFHA 3WQTA 2H3GX 3HBTA 3S3NA 4JS5A 5LL6Z 2WTUA 3VEOA 1QQNA 1VSKA 4B9TA 4DG1A 2PBDA 4DSEA 4EP4A 4G9ZA 3UKUB 1RTJA 3SZ2A 4X62K 4MQ3A 3ZLJA 4Z94A 4CHOA 1O1WA 1X3MA 2O8CA 4BR5A 1S5JA 4WF9L 2E2OA 2YJFA 2YHYA 4OGEA 4CF1A 3C6TA 4CFDA 4O0IA 1ZC6A 3SCXA 2ASOA 5HRSA 3SAGA 4FSVA 1KC8O 3K0SA 1C0GA 4IG0A 4CJRA 1UWBA 5KGXA 3K57A 4N76A 3FZHA 4HVJA 4N47A 3MN7A 5M1OA 4DLGA 1FKPA 2KZZA 3WEEA 2W40A 3SUOA 3EKSA 2HHSA 3EO3A 1WSEA 4FYDA 2F9TA 2D1KA 1QVGM 4C8OA 5BRHA 1T05A 1Z25A 4A5AA 1C1BA 2ZJQL 4FLZA 4Z4HA 4FO0A 2QWQA 1HMVA 4Y1CA 2HMPA 1LV5A 4KHWA 5MLCQ 3A5MC 4ILGB 1TYQB 1SUQA 3LDPA 4H8KA 3ENOA 4CD1A 5C25A 5AQLA 4W5TA 2E4LA 4FJHA 2OYQA 1VSEA 5C10A 5SWMA 3FZLA 2I5JA 3L4QA 3UKRA 3VTIA 3ZEUA 4FK4A 2NRRA 3CC4N 4JEPA 3DYAA 3TAMA 1GLCG 3VQDA 5GADP 4N5SA 3AVCA 3TAQA 2GUIA 2GV9A 1K8KB 1NK7A 2HVHA 4LF5K 3E01A 4OPHA 4CECA 5KRTA 4LF6K 2O8BB 3CERA 5HRNA 2QWPA 4NYFA 2P1JA 1BOTO 3LZJA 4E19A 1XMOK 3CJBA 4DS5A 3TTDA 2FBVA 3K59A 1SZ2A 4CFCA 1N6QA 4Z4FA 4LY7A 1D9DA 3RMAA 4ELTA 3DAWA 4I9LA 3HP6A 3AO1A 4I9QA 5BPLA 4WQ4A 3MCPA 2YNHA 3AVJA 3SMPA 1RDWX 3VPZA 3VGKA 3R6MA 4OLAA 3BF1A 1IG8A 1L3TA 2QWOA 3EE9A 2P9NB 2BDPA 4NCGA 2FSNA 1FXXA 2Y1JA 3NGZA 1L5UA 4C1NI 4O55A 4E1MA 4BREA 1S1UA 1NJWA 2ZE2A 1TKZA 1NM1A 4YDUC 3QNOA 5KQ8A 4CGJA 2E5LK 3F2KA 3RMCA 4Z4GA 3ZSZA 2OPQA 2Z1JA 5IT9O 3A5NC 5HBMA 3OTOK 3O9TA 1C0TA 5J1EA 3QEXA 3SLCA 4Z4EA 5A2QO 2G8IA 3O3GA 3HSCA 1LW0A 3VENA 4YNQA 4KTZA 3DRRA 3NMUA 3FE1A 5C42A 1CZAN 2FLOA 3LAKA 4BRGA 1YT3A 1RT6A 3QIPA 1BU6O 5AQXA 4N41A 4CJUA 4LF8K 3L2WA 3JYTA 3AVMA 3V9XA 2QEXN 3DRSA 5AQGA 4A2BA 4FJ5A 4FK0A 4HCCA 1OH8A 4DF8A 3C6UA 1VK0A 2XHBA 2RHKA 3CFOA 4QS9A 3SI6A 4DV5K 3NF8A 5ADXH 1N8RO 5AR0A 5FDLA 1WSHA 1X9JA 1RDDA 1Z26A 4Y1DA 5D3GA 2V52B 1QSLA 4IFEA 3QO9A 1VQ5N 2DY4A 2F4VK 4MLEA 5FPDA 3DXMB 1VSFA 3L3VA 1KXPA 5CY4A 3AVKA 2UXCK 1W9HA 4TSXA 1IKXA 4JHDA 2YKMA 4CJ7A 2Q31A 3O9RA 2V7YA 1ATSA 3WXMB 4H03B 4K43A 1LCUA 2AJQA 2NNWA 2JWKA 5EU7A 3TAFA 2OPPA 1ILYA 3TI0A 1I3AA 3ZX3A 5BPMA 3DM2A 4EIAA 3QBWA 3VOVA 1VQ4N 5LJWA 1NK5A 3ATVA 5AQHA 4B9LA 2P9IB 1HQEA 2NLXA 1FKOA 4BVOA 3HM8A 3SMSA 2PAVA 5HLFA 1HJRA 5CZ1A 4CZEA 3JAMO 4BACA 1QE1A 2G8WA 4KHPK 5J2PA 3I33A 2F8SA 3SBTA 4OJRA 3L2RA 2YKNA 1M1KO 4AHCA 3HPGA 1BCOA 3SV4A 3LDLA 4ID1A 3E9LA 2P9LB 2BANA 1HRHA 4FWQA 3EZ5A 3MMVA 4K41A 5KPTA 3QEWA 3HP9A 4OLBA 4EZ6A 3F9MA 3S41A 4JI6K 4OO1J 3OBWA 2O8FB 4HWIA 1KAXA 3CI5A 2HHUA 1QHAA 3U3GA 3KWIA 4IJAA 2ZD1A 4CCHA 2FF6A 3AGKA 4IG3A 4I6MA 4AF1A 4DUYK 4DR4K 4BDPA 3D2FB 4JI3K 3CD6N 1EKEA 3BF3A 4C8MA 2F7TA 2E8AA 4BVPA 1VQ6N 3OYIA 3ZSYA 5FRNA 3QFUA 1HJOA 5KQDA 3RTVA 3HT3A 3PX0A 2V51B 4MO4A 3ZT4A 4FM2A 1VSLA 4CHYA 2P9SB 3AVGA 5LMNK 3ATUA 4BRIA 4W5RA 4B1UB 4PKHA 4FJIA 3CQ8A 4HTUA 3VN5A 4U7BA 4F8RA 5EOYA 4DU4A 2Z1HA 1RTIA 3CETA 3PIPL 4E3SA 2QTDA 3SJJA 2OA8A 5GINA 4CZMA 4FM0A 2EWSA 3HPHA 3DI6A 5CYQA 3EY1A 3AVLA 1NGAA 1Q82O 1ASVA 1BGXT 5AQNA 3L2UA 3L3UA 3QFPA 1HLUA 3ITHA 4LD0A 1JLFA 3RR8A 4JYAK 4CEBA 3OS0A 2HBKA 3ZSWA 3OYKA 1EO1A 3DLRA 3IDHA 2IVOA 4LSLA 1ASUA 1YAGA 4H5WA 4CJEA 2NRWA 3LPUA 2KZMA 1C1AA 4JKFA 1U2VB 4F2SA 4K0KK 3EN9A 1HKGA 3VEYA 4DR1K 5HOOA 2OZSA 1YXQA 5C12A 3O8MA 4CJFA 5BN9A 4XEIA 1WLJA 3BZKA 4PL7A 3O1BA 1J6ZA 1JLCA 3V1QA 4KI4A 1DLOA 2HMIA 4MFBA 4YHHK 2WOMA 4EAHD 3TTFA 4IFYA 4E0DA 3RSEB 1WSFA 4PY5A 1T3VA 5T7BA 2PFUA 2XY6A 4E89A 3SQ0A 3G6EN 4CBWA 3OYGA 4WE1A 3WQUA 4CESA 3THXA 3FZFA 5AQUA 4FJMA 4YDUA 3SUNA 5AQWA 3QEIA 4BRQA 1GLDG 4BR0A 1EXQA 2D5RA 2Q0RA 1EX4A 3CPEA 3HXMA 1RNHA 2A41A 1NOZA 3M8QA 1RCHA 3A5LC 3LWMA 1TAQA 4E7IA 2QWMA 1S22A 2YI1A 2GWJA 4DR2K 3SAFA 3VQCA 1E4FT 2FBTA 3SNNA 4JK8A 3RR7A 3MEDA 3TAGA 1OVQA 1WSIA 4K42A 2ZJPL 1QSSA 1BA0A 1NGIA 3J7ZO 4AHRA 1GOBA 4DTPA 1HNWK 2DTUA 3DOKA 2Q3SA 3MEEA 4LF7K 3IKMA 2J4RA 1BG3A 5C2DA 1VSDA 2WONA 1MU2A 1ZBSA 3WXIA 4FZXC 1HYZA 2P9KB 3TAEA 3T1YK 3K5MA 5B8HA 2JGUA 3EE8A 3O9QA 4DTOA 3M6GA 1RT7A 3QBXA 4I2QA 5AZIA 3RVCA 3DXKA 2OCEA 3TTCA 4DQQA 4FVUA 3G25A 1NK8A 3PSIA 1NGHA 1OVYA 4QS7A 3LDQA 1BA1A 1N34K 1RTDA 4CHNA 2QXLA 4ELUA 1NK6A 4AHVA 4JI5K 3MN9A 5AZJA 4DV2K 1NGGA 1NG9A 4KHQA 2WC9A 1U4BA 2W42A 5FPEA 4FVMA 1VHXA 3L8BA 1K8AO 1YVNA 2YNFA 3P31A 5F0XA 3THWA 2RPIA 4CF2A 1S72N 4E7LA 4CEAA 1HNZK 4B9UA 1V4TA 1RT1A 4DR6K 3KJVA 4JKDA 2ATQA 2KTQA 2VG5A 1KFDA 3ULDA 4J8FA 4CERA 4DHYA 3GG4A 2UUCK 3KLHA 5AQQA 4KTQA 4R79A 1NJIO 2Q0UA 3DLHA 3V1RA 4IOAL 3MXJA 1H1VA 3QEPA 5EVZA 1VSMA 3J7AP 3TSUA 1NLVA 1RT5A 2B5JA 1HNIA 3VF4A 1RT3A 4DB3A 2FBXA 2A6AA 5C0YA 1VQ7N 1HR0K 3OA9A 5AQYA 4AM6A 5FLXO 4CBUA 1S1VA 4BG8A 1RBSA 3AY9A 3V81A 4GV9A 3W0LA 1Y97A 5AJ3K 1RGIA 4C23A 4CFAA 1VSIA 3NDKA 4EZ9A 3AVNA 3J80O 2XY5A 4LH5A 3ULEA 4ZTFA 1K9MO 3G10A 1VSHA 4PUOA 3HJFA 5KI6A 3OYNA 2QA4N 1UA0A 4CFBA 3ENHA 3H08A 3QEVA 4CJLA 3O9SA 4WFNL 1MWMA 1MDUB 2W41A 3NFAA 3BP8A 4ISGA 1EWRA 3VQEA 3PLAA 5AQFA 4CJPA 3FFIA 1Q9YA 4FPBA 1M90O 2NRTA 3KVGA 4CK2A 3BY5A 4LH4A 1VSJA 2HNYA 3SAHA 4C1NK 3QB0A 1FW6A 3CJ7A 4GMJB 1ASWA 1QVFM 4JKAA 1Z05A 3CJ1A 3GL1A 4ISEA 1VQKN 1XQSC 3O9UA 1LWCA 3VQPA 5IWAK 3LALA 5JLFA 1XHXA 2P51A 1ZBIA 4DR7K 2G8HA 2X6SA 4B3OA 2GELA 1IKVA 2DPNA 1KQSM 2QXFA 4BE2A 1QZ5A 2KKZA 2ZJRL 3AA2A 4CGIA 4FLYA 4IEIA 3QNNA 3R9PA 1CXQA 3VQ7A 3C7NA 1UAXA 1BWFO 3C6HA 2D0CA 5JMVA 5BR9A 4WQ5C 3MN6A 4FWMA 4YOWA 3IFRA 1K8KA 1XNQK 4JAXA 1NK4A 4JS4A 2D0BA 3JSMA 1JL2A 4FWOA 5AQOA 4DWIA 2O8BA 3CCSN 3J7YP 3AVAA 5JLHA 4KBOA 3HSTB 5F1XA 1T8EA 4F9OA 3AAPA 2YHBA 1VRTA 4CJ4A 3CCJN 1KCFA 3FLCO 4FJJA 3U6FA 4BR2A 4BRKA 3QLHA 3O6WA 4AILC 3NCIA 3TAPA 4KRFA 4JD2B 3NGYA 1SL2A 3I0RA 1IH7A 3V6DA 2QWNA 1SQKA 1A5VA 4DQIA 2E20A 5LJVA 5JVGL 4B9VA 1YJWN 4WYBA 3H3OB 4NYNA 5E26A 3TPQA 3WEEB 1GLBG 4BC3A 2QWRA 4M7YA 4B9QA 3CCMN 4OX9K 3ZYYX 4JI1K 3T1AA 2G8VA 1RDAA 1RT4A 5TKWA 4EP5A 2A40A 3I55N 4M7XA 4H0OA 4YOYA 4FCYA 4H0XB 2HBLA 3WT0A 1P90A 4FOEA 1S1XA 3WNFA 4OPKA 2ZGZA 3MK6A 4GKKK 2G8KA 3O3HA 4F4KA 4DSIA 3DLBA 3MECA 4FOIA 1YVUA 5ADXA 3L4IA 1NK9A 3D0PA 3KKSA 3ZEUB 3OYMA 4B8AB 2A1RA 5I3UA 1ZBFA 4BWMA 1KRPA 1ZBLA 4H0YB 4GY2B 2O8EB 2IOCA 1WAFA 4FLUA 5HRPA 3E9PA 3RRHA 3ZCMA 1B9DA 2YNIA 1VQON 4CIGA 4JKGA 4O0JA 1C1CA 3PO5A 2VG6A 3TABA 4DV3K 1UA1A 3QIOA 1VRUA 4RWTA 1IBMK 1SL1A 3S9HA 3O3FA 4NLCA 5AQMA 4YOTA 3LM2A 4LF9K 4M45A 4GKJK 2E6LA 5AFUH 3CCRN 3PO4A 4AM7A 3BEXA 2R7YA 4BC4A 5AQSA 5HRRA 3NH2A 3DXMA 4FM1A 5FPMA 3OS2A 5JICA 5GAGP 2QWLA 3LZIA 1DEJA 4CJWA 1WBDA 4O8KA 1S6QA 1W97L 4O44A 3KIOA 2NZTA 1ESVA 3QERA 4M3RA 3NF7A 2W6LA 3E66A 1W0HA 3OYFA 3MX2A 5I9EB 2KFZA 2P9IA 1W7AA 4CZGA 4M3ZA 4H0PA 2PZSA 4IBNA 1J53A 2IIRA 1EETA 2P9PB 1HKCA 3NF6A 3C95A 4RG8A 4B1XB 4DSFA 1BCMA 2HB5A 4O5FA 5C24A 3K58A 3Q7BA 5EX5A 3CQYA 4Q0BA 4CHQA 1BIUA 3H46O 3LP3A 4KAZA 3LP0A 3S3OA 3KLEA 3OVNA 4WFAL 2VQEK 2ITGA 4FWSA 3CMEN 2RKIA 3EZWA 4BRFA 1K73O 3IRXA 3IS9A 3MX5A 3MAQA 4BY9C 3AO5A 3WXLA 3KLIA 1TL1A 3R3LA 1HYVA 1Q18A 3RRGA 1WN7A 3U9ZA 1D9FA 1KAYA 3D2FA 1XI1A 3MDQA 1R59O 1GOAA 1OKJA 3TSQA 1D5AA 4L3QA 4BQLA 2O8DB 2ASPA 4FW2A 4O8UA 3PSFA 4H5VA 3KD5E 2KQ2A 3GE1A 3AVIA 3J8AA 1ATRA 4JKCA 4ZHRA 4JHDB 1QSYA 5F2RA 1X9WA 3MCAB 4CEEA 4ISFA 4J2AA 2VGNA 4RTFD 3IAYA 4KB1A 1QZ6A 4X64K 3AGRA 2P9SA 4YY3K 1RT2A 4JLHA 4CJSA 1L3UA 2VGMA 2UXDK 4JRQA 3SPZA 4IJNA 3K9KA 4KHYA 4BR7A 1KAZA 2OANA 3UB5A 3NH0A 5HL7L 1N5YA 3CIPA 3CG7A 5GAEP 3ZT3A 4DKWA 3O08A 5GIOA 2IGIA 2G8FA 4KB0A 4HTLA 3WNGA 3VA3A 2P9UB 1LAWA 4CK3A 1T44A 3TR8A 2QKBA 1KD1O 2HVIA 1BUPA 4CEZA 3TWHA 1HX1A 1U47A 1Q7YO 3F5TA 2PYLA 3EL2A 4JI0K 2UU9K 2GX9A 5FPNA 3ZSRA 4B1YB 3ZSQA 3HI0A 2QK9A 1S9EA 1RBVA 3M8PA 4JI7K 2UUAK 3ISNC 1SKRA 3SQ1A 1S6PA 1TVRA 1Q9XA 3MWTA 4I6MB 2VYPA 4AHUA 5DK5A 3IG1A 3SQ2A 4FJGA 1HNXK 3KTQA 4H5NA 4FLXA 1BQNA 1RBUA 4M3XA 4RW9A 4A57A 2HHTA 3D6RA 4CJTA 1KLNA 4DCHA 1VAZA 3VF6A 3LWLA 3CCUN 4JI8K 1XWLA 4K25A 2F8TA 2E2PA 4Y0WA 3D2EA 4W5OA 1T03A 1GOCA 3LPTA 3VF2A 1TGOA 4CF0A 2D4WA 2F96A 4B3RK 4CD3A 3OYJA 2E6MA 4DU1A 3THYA 3ZSOA 1QS4A 3OYBA 4LC9B 3N4PA 5KTQA 3MN5A 4NCBA 2HHWA 4IZ9A 2A3ZA 4NB4A 3VMFB 3ZSXA 1X1PA 4FPAA 1IV0A 1T7PA 3QDKA 4YORA 1NMNA 1VQPN 1HUXA 1F21A 3KK2A 1MWKA 4OGCA 4X66K 4FWRA 4CJQA 3QETA 2ETJA 4RCHA 3VGMA 3P39A 4BE0A 1YJ9N 3OHRA 3ZX2A 4B3SK 4BRCA 3TARA 4FJ9A 1SAZA 2E1YA 4KHNA 1KLMA 2P9KA 1E4GT 3KD1E 3AAQA 4DTUA 1DGKN 4IWVA 3FGUA 4CJVA 4CGHA 1ZYQA 4RW8A 2XY8A 4CE9A 4NXNK 4DLEA 1XMQK 3VQAA 2Q97A 3RWUA 4JNEA 3L0QA 2IVNA 5DM7L 1S1WA 3DRPA 1ZXOA 4M3TA 2GWKA 4BDZA 1NMDA 4CJ3A 3FR0A 3WNEA 4IO9L 3RMDA 1YITN 2W6KA 5KRSA 2AP1A 1KVCA 3M8RA 4CGGA 3I56N 3I8BA 4E7JA 4B3TK 3SJHA 3OJUA 2QKKA 1GLFO 3MXMA 4DFKA 3VA0A 1BHLA 2JWLA 5AQJA 2HHXA 4FJXA 1VQLN 2NRXA 4BR9A 1SV5A 3NHGA 3CC2N 4BG9A 4F3TA 4GNIA 1X9MA 1JCFA 2CH6A 1HNVA 3DLKA 4IDKA 4O4GA 1GLJO 3CFPA 2XY7A 3SQ4A 2BTFA 2BUPA 4E1NA 4XH4A 1I94K 4DTRA 4B9NA 4DV4K 3CCQN 3U4LA 1Q86O 2DFEA 1RBRA 3AA5X 1NJZA 4QCLA 3ZETB 5M1FA 1L3VA 4JI4K 1NGCA 1IBLK 4NXMK 3T19A 4DQRA 4HHTA 1C6VA 3HYFA 1NGEA 2EX3A 2ZM6K 4YOVA 4WCEL 3O4WA 4FJNA 1X3NA 4CJ5A 3CMAN 5GAHP 2WUSA 4A61A 4C8LA 3EYZA 1N33K 5AQTA 4PKGA 5C15A 4FJ7A 1O13A 3HVRA 3A5OC 4B9MA 1FK9A 3AVBA 1SS6A 3ALYA 5AZIB 1ZBUA 2YCHA 5KGWA 4FLTA 3V1OA 4FJLA 4DSLA 4GVMA 3HO1A 1YTAA 2HF3A 1BI4B 2LSNA 3QMLA 3HZ6A 4CF9A 5BR8K 1NNEA 1ITGA 1TUYA 2Y1IA 4OKKA 2D0AA 4IXCA 5AZJB 3UKUA 1CZBA 1JXEA 1NBWA 3HOTA 4PQUA 1SL0A 3HPOA 4DF4A 3CM6A 5M1NA 2VQFK 3LL3A 3G71N 4DU3A 3ZT1A 3V9ZA 5I42A 4LFBK 3ASMA 3CF5L 3OYLA 3SV3A 3THWB 3TU5A 3EEQA 1YUWA 1WOQA 4MDAA 3VEZA 3CXCM 4QOZB 3SYZA 3DLGA 5LMUK 1HKBA 2KW4A 1NKBA 2XRIA 1QQMA 3KLFA 2AA4A 4F2RA 4JKHA 3WUHA 3VEWA 3LAMA 2IS3A 3DLEA 1IBKK 3IUCA 4CHPA 4DV7K 4BC2A 3VERA 2F9WA 1TK5A 2KFNA 4M63C 5LY3A 3GBTA 4OPAA 4CIFA 4JK7A 3W3DA 3NAEA 1TK0A 4KHUA 1YHQN 4PA1A 1WUAA 4E7HA 1JXBA 1DTTA 3AO4A 1NU0A 1RFQA 3CJAA 4N56A 2B4JA 1TYQA 2YX6A 5E41A 4CF8A 4XIUA 4Z4IA 3K5LA 3CJCA 1XNRK 1J5OA 2EHGA 1C0FA 4GV6A 4M41A 5JS1A 3OYHA 2VWKA 4Z0UA 3ULEB 4EFHA 3QESA 4FJ8A 4FJKA 3BUZB 2VWBA 1U45A 3K9JA 3BDPA 1Q8IA 2WBNA 4Q5VA 5M1PA 4JD2A 3DWLA 4B9SA 4YOXA 4MDBA 3A0IX 4DS4A 4PWDA 3C94A 3MEGA 3Q7CA 2YHAA 4QAGA 2D0OA 3SK3A 4J2EA 3LANA 3VEXA 1DTQA 2OPSA 3P83D 2NRHA 1P8ZA 4E1JA 3L2QA 1QHTA 3HM9A 2O8CB 1RILA 4B1WB 1A5XA 2ZQBA 5AQKA 1EP4A 1TKXA 4BGAA 4XH5A 3V4IA 5AQPA 5CHIA 4R5PA 3OYCA 1KSPA 4FWPA 4JV5K 3DMJA 3K5OA 2YHWA 1TKTA 4LFCK 3B6OA 2E2NA 3F9KA 2IAJA 5CE3A 5BRFA 3VQ4A 2IDOA 4C8NA 2UXBK 3VQ9A 3BGRA 1QQOA 2YHXA 4DV6K 5J2MA 5AFUA 2YJEA 3C7NB 3U9DA 2FC0A 1VQ8N
chains in the Genus database with same CATH topology
4DV1K 4DV2K 5IT9O 3OTOK 4JI8K 5IWAK 4JI6K 4YHHK 4DR7K 1N32K 1IBKK 5A2QO 4DV7K 4DR5K 4B3RK 4DUYK 4DR4K 1HNZK 4DR6K 4JI3K 1I94K 4DV4K 4DV3K 4X65K 4LF8K 1IBMK 2UUCK 4CVNE 4V19S 4JI2K 4JI4K 1XNQK 1IBLK 4NXMK 4LF9K 4CW7B 4LF5K 4LF6K 4X64K 1XNRK 4GKJK 4YY3K 2ZM6K 4DV5K 3J7AP 3J7YP 5LMNK 2UXDK 5LL6Z 4X66K 1XMOK 1N33K 4DV0K 4DR2K 2F4VK 1HR0K 2UXCK 5FLXO 4X62K 3T1HK 1FJGK 4LF4K 5AJ3K 1HNWK 4LF7K 4B3SK 4DR3K 2HHHK 3J80O 4AQYK 5BR8K 4LFAK 4OX9K 3T1YK 4JYAK 4JI1K 4JI0K 2UU9K 4NXNK 2UUBK 1J5EK 1XMQK 4DUZK 3JAMO 4JV5K 2VQFK 4KHPK 4LFBK 4JI7K 4LFCK 2UUAK 4GKKK 4K0KK 1N34K 1N36K 4DR1K 1HNXK 3J81O 2UXBK 2E5LK 2VQEK 4JI5K 4DV6K 5LMUK 4B3TK 4B3MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 K;  4DV2 K;  5IT9 O;  3OTO K;  4JI8 K;  5IWA K;  4JI6 K;  4YHH K;  4DR7 K;  1N32 K;  1IBK K;  5A2Q O;  4DV7 K;  4DR5 K;  4B3R K;  4DUY K;  4DR4 K;  1HNZ K;  4DR6 K;  4JI3 K;  1I94 K;  4DV4 K;  4DV3 K;  4X65 K;  4LF8 K;  1IBM K;  2UUC K;  4CVN E;  4V19 S;  4JI2 K;  4JI4 K;  1XNQ K;  1IBL K;  4NXM K;  4LF9 K;  4CW7 B;  4LF5 K;  4LF6 K;  4X64 K;  1XNR K;  4GKJ K;  4YY3 K;  2ZM6 K;  4DV5 K;  3J7A P;  3J7Y P;  5LMN K;  2UXD K;  5LL6 Z;  4X66 K;  1XMO K;  1N33 K;  4DV0 K;  4DR2 K;  2F4V K;  1HR0 K;  2UXC K;  5FLX O;  4X62 K;  3T1H K;  1FJG K;  4LF4 K;  5AJ3 K;  1HNW K;  4LF7 K;  4B3S K;  4DR3 K;  2HHH K;  3J80 O;  4AQY K;  5BR8 K;  4LFA K;  4OX9 K;  3T1Y K;  4JYA K;  4JI1 K;  4JI0 K;  2UU9 K;  4NXN K;  2UUB K;  1J5E K;  1XMQ K;  4DUZ K;  3JAM O;  4JV5 K;  2VQF K;  4KHP K;  4LFB K;  4JI7 K;  4LFC K;  2UUA K;  4GKK K;  4K0K K;  1N34 K;  1N36 K;  4DR1 K;  1HNX K;  3J81 O;  2UXB K;  2E5L K;  2VQE K;  4JI5 K;  4DV6 K;  5LMU K;  4B3T K;  4B3M K; 
#chains in the Genus database with same CATH topology
 3D7E O;  1IJJ A;  4BRH A;  3OJS A;  3AVF A;  3FFK B;  4CED A;  1OH7 A;  3NE6 A;  1BIZ A;  1KTQ A;  2P9N A;  4CBX A;  2O8E A;  5BPN A;  1REV A;  3CYM A;  4CZI A;  4PKI A;  4DR5 K;  5GIP A;  4JKE A;  5E84 A;  1JLQ A;  1LAV A;  2NRZ A;  3LDN A;  3T7Z A;  4J2B A;  1LWE A;  2B6A A;  1RDU A;  4NO7 A;  1QQC A;  2Q1N A;  3UKR B;  1WSJ A;  4CZJ A;  4FW1 A;  4A2A A;  1OH6 A;  1G99 A;  3ID6 A;  1K6Y A;  4CVN E;  3AAR A;  2HW3 A;  3SPY A;  4IKF A;  4FZY A;  1WAJ A;  2QI2 A;  4CW7 B;  3R8E A;  2A42 A;  5ELZ A;  1XC3 A;  2IC3 A;  5AQV A;  5AQZ A;  2FSJ A;  4CZL A;  1YIJ N;  1Q81 O;  1IG9 A;  4NLB A;  4M3Y A;  1MA9 B;  4DTX A;  1J9A A;  3TSP A;  2P5O A;  4KI6 A;  2FSK A;  2I7N A;  3CCL N;  4IDH A;  3ID8 A;  4B1V A;  4M3U A;  4KFB A;  4O5B A;  1VQM N;  3WXK A;  1FJG K;  3JXU A;  1HPM A;  1JJ2 M;  1NKE A;  4H0T B;  2PYJ A;  3AO3 A;  4IEE A;  5JS2 A;  1HPZ A;  3CM5 A;  3AA4 A;  1NGJ A;  3D45 A;  3ENB A;  1DKG D;  3S3M A;  2OTL N;  2Z1I A;  3KK1 A;  3HRG A;  4OKJ A;  2P9P A;  3DJC A;  4FL9 A;  4J2D A;  3PV8 A;  3IMX A;  3NVK A;  3H3N O;  1A5W A;  4BRM A;  1NGF A;  3HL8 A;  3QIC A;  1VQN N;  3HTV A;  3DLL L;  1YF5 L;  3L2V A;  3NGI A;  1U49 A;  5HRO A;  1NJX A;  3KKR A;  4ID5 A;  3MXI A;  3EKU A;  2GUP A;  2A5X A;  1BO5 O;  2HST A;  4DSJ A;  3V9S A;  3H1V X;  2G8U A;  3WXJ A;  3FZK A;  2HNZ A;  4JKG B;  3J81 O;  3KK3 A;  3LP1 A;  3JS6 A;  5FRM A;  4K8X A;  4DFM A;  3A8Y A;  4DQP A;  5BRD A;  3M5R A;  2XO7 A;  1IO2 A;  4BE1 A;  4KH4 A;  5CYM A;  2Q36 A;  3V9U A;  1YTU A;  4I7F A;  3V9W A;  4DTJ A;  4FZZ A;  2RE2 A;  4MLH A;  1D8Y A;  2X74 A;  3NVM A;  1RTH A;  4FK2 A;  4PL8 A;  1KVA A;  4FLW A;  2BGG A;  2O8D A;  3AO2 A;  4ZTJ A;  2P9L A;  4MO5 A;  3AV9 A;  4AH9 A;  1NOY A;  1VQ9 N;  4I2P A;  2E1Z A;  1TL3 A;  4DQ8 A;  5DMR A;  2A1S A;  1NWK A;  5KPR A;  2O8F A;  2RN2 A;  1I39 A;  4AHT A;  2BH1 A;  3KLG A;  1UOC A;  4CEQ A;  4AHS A;  1J54 A;  4CHZ A;  4BDY A;  4GVE A;  2QW9 A;  5K14 A;  4E7K A;  1WSG A;  4DTS A;  3KZB A;  3HK2 A;  1S1T A;  4RW6 A;  2NUB A;  3GDQ A;  1B92 A;  4JN4 A;  2KLA A;  2VG7 A;  4CI6 A;  1S9G A;  5J2N A;  1IKY A;  4JK9 A;  3T1H K;  4PHT X;  2P9U A;  2O4G A;  1JCG A;  2ZWH A;  2ITM A;  5AQR A;  4BQZ A;  2P5G A;  1CXU A;  1W2B M;  1BQM A;  2UYT A;  3R1X A;  4ICL A;  4HCB A;  4CGD A;  4RW4 A;  3NH1 A;  4LFA K;  4IOX A;  3LDS A;  4BRA A;  4GV3 A;  2E88 A;  1RDB A;  1JLB A;  3C0B A;  3H6E A;  3VQ6 A;  3CPW M;  3B8A X;  5HP1 A;  2X78 A;  3SUQ A;  2UUB K;  5H1S Q;  4BRN A;  1G15 A;  4H5T A;  1GLA G;  4JKB A;  1KFS A;  1JKH A;  3AVH A;  1XUP O;  1YI2 N;  4WQ5 A;  3G0Z A;  2CGL A;  5CZ2 A;  4FLV A;  4A5B A;  3B6P A;  4BGB A;  3U3Y A;  3T3F A;  4U67 L;  2DFF A;  1C0M A;  5FRO A;  2JLE A;  2FF3 B;  3CQX A;  3P4I A;  2I7P A;  1N32 K;  3KWG A;  4RW7 A;  4GW6 A;  4A59 A;  4ILH A;  4UY8 O;  1V4S A;  1U2V A;  3M1F A;  1HYS A;  4K8Z A;  3L6Q A;  5AQI A;  2X6N A;  3I8D A;  3PX4 A;  1NK0 A;  1RBT A;  3VEV A;  2QM1 A;  4KKO A;  5JVH L;  4WFB L;  4KH5 A;  1R0A A;  2OTJ N;  1BDG A;  3O80 A;  3LP2 A;  3N4Q A;  3GOI A;  1EWQ A;  1HQU A;  2FBY A;  4CGF A;  3M3Z A;  4W5N A;  4CEF A;  1U6Z A;  3RSE A;  4H0V B;  4L8R B;  3MWP A;  4YOU A;  5KPZ A;  1JLE A;  1U48 A;  2BE2 A;  2WFB A;  4M3W A;  1YJN N;  3UIQ A;  2HBM A;  4FXD A;  2OPR A;  4EHT A;  3VQ5 A;  3P5J A;  4KH6 A;  4BC5 A;  2HHV A;  1NKC A;  3VET A;  4CZF A;  3AA3 A;  4CZH A;  2RF2 A;  4M42 A;  4LF4 K;  3U8X A;  5BRE A;  1CLQ A;  1XHZ A;  4DR3 K;  1EQY A;  4UQG A;  4AQY K;  5M1K A;  4LSN A;  3K5N A;  2HND A;  1TAU A;  2GBZ A;  4BWJ A;  1JCE A;  4HUF A;  3OY9 A;  4BRP A;  4CK1 A;  2CH5 A;  5EY4 A;  4DUZ K;  3OBY A;  1B9F A;  2Q2R A;  4BRL A;  3D2E B;  5M1Q A;  1BL3 A;  2HF4 A;  2ZF5 O;  4CJK A;  1GLL O;  4DMN A;  1N36 K;  1WB9 A;  1CZ9 A;  3KHY A;  4A62 A;  3THY B;  5J2Q A;  4IO8 A;  1X9S A;  4B3M K;  4DSK A;  3O5B A;  4IFV A;  2HHQ A;  4ILJ A;  3H1Q A;  4BRO A;  3HVT A;  1TKD A;  4HUG A;  1NGD A;  1JL1 A;  4FWK A;  3VTH A;  4YFU A;  2V7Z A;  3VQB A;  1ZBH A;  3SUP A;  2GTD A;  3QIN A;  5DM6 L;  2YV0 X;  3T69 A;  4B1Z A;  4XH1 A;  4ELV A;  2O4I A;  3PUF A;  1NJY A;  3E9O A;  3I0S A;  2ZGY A;  3VGL A;  3THX B;  3O4N A;  1QTM A;  3ZET A;  1TUU A;  3F73 A;  4CIE A;  4V19 S;  1LW2 A;  2HOE A;  4DTM A;  4C8K A;  1GLE G;  1D4X A;  3OYE A;  4WQ4 C;  1JLG A;  3OYA A;  3LDO A;  4F3O A;  2KHO A;  4H4O A;  3FZM A;  2FXU A;  3OW2 M;  1KVB A;  4B08 A;  3PY8 A;  3O4Q A;  3CCE N;  5BN8 A;  4DV0 K;  4KV8 A;  2CGJ A;  2VCP A;  1TK8 A;  2HBJ A;  3OYD A;  4OKE A;  1XC9 A;  4DFP A;  4CZK A;  1ATN A;  1BI4 A;  3CHW A;  1TV6 A;  2HHH K;  2VWJ A;  4CEO A;  3PIO L;  2ASM A;  3H45 C;  4DTN A;  3ZT2 A;  3G4S N;  4KTW A;  2NRV A;  3VQ8 A;  3HOS A;  1LWF A;  4QS8 A;  5EXW A;  1Z6R A;  1WBB A;  1E3M A;  4H4M A;  1J5E K;  4W5Q A;  2Z1G A;  5CR4 A;  2YNG A;  1SKS A;  1IKW A;  1BIS A;  2D0P A;  3P1G A;  2OZM A;  4NCA A;  3TAN A;  3ZSV A;  3DXK B;  1LOT B;  4OVL A;  3CC7 N;  3CJ9 A;  3NBP A;  1L3S A;  3KK7 A;  3P38 A;  3BZC A;  1RDC A;  3O1W A;  4DQS A;  4B8C A;  3K2P A;  3NF9 A;  1T6D A;  2CGK A;  3SBG A;  3PX6 A;  3RMB A;  4EHU A;  3DOL A;  4JRP A;  2E2Q A;  4FWL A;  4Z4C A;  3OS1 A;  2GEM A;  4DV1 K;  4IOC L;  4KHS A;  4KRE A;  4OPJ A;  5TKY A;  3VQQ A;  3UE5 A;  1U04 A;  1DT9 A;  3E1Y A;  1JLA A;  3LM9 A;  3M8S A;  1S3X A;  1NGB A;  3VES A;  4KO0 A;  1C0U A;  1T6C A;  4DFJ A;  3ZX0 A;  3WNH A;  3THV A;  3C65 A;  3C6A A;  4H5R A;  4BR4 A;  1Y64 A;  4BRD A;  4X65 K;  1OH5 A;  2IVP A;  4KPY A;  4G1Q A;  3ZT0 A;  3CFR A;  5C2F A;  3A2F A;  4HUE A;  2PY5 A;  4JI2 K;  4FWN A;  5SZT A;  3CCV N;  1SKW A;  1WNS A;  2DFH A;  3WQT A;  2H3G X;  3HBT A;  3S3N A;  4JS5 A;  5LL6 Z;  2WTU A;  3VEO A;  1QQN A;  1VSK A;  4B9T A;  4DG1 A;  2PBD A;  4DSE A;  4EP4 A;  4G9Z A;  3UKU B;  1RTJ A;  3SZ2 A;  4X62 K;  4MQ3 A;  3ZLJ A;  4Z94 A;  4CHO A;  1O1W A;  1X3M A;  2O8C A;  4BR5 A;  1S5J A;  4WF9 L;  2E2O A;  2YJF A;  2YHY A;  4OGE A;  4CF1 A;  3C6T A;  4CFD A;  4O0I A;  1ZC6 A;  3SCX A;  2ASO A;  5HRS A;  3SAG A;  4FSV A;  1KC8 O;  3K0S A;  1C0G A;  4IG0 A;  4CJR A;  1UWB A;  5KGX A;  3K57 A;  4N76 A;  3FZH A;  4HVJ A;  4N47 A;  3MN7 A;  5M1O A;  4DLG A;  1FKP A;  2KZZ A;  3WEE A;  2W40 A;  3SUO A;  3EKS A;  2HHS A;  3EO3 A;  1WSE A;  4FYD A;  2F9T A;  2D1K A;  1QVG M;  4C8O A;  5BRH A;  1T05 A;  1Z25 A;  4A5A A;  1C1B A;  2ZJQ L;  4FLZ A;  4Z4H A;  4FO0 A;  2QWQ A;  1HMV A;  4Y1C A;  2HMP A;  1LV5 A;  4KHW A;  5MLC Q;  3A5M C;  4ILG B;  1TYQ B;  1SUQ A;  3LDP A;  4H8K A;  3ENO A;  4CD1 A;  5C25 A;  5AQL A;  4W5T A;  2E4L A;  4FJH A;  2OYQ A;  1VSE A;  5C10 A;  5SWM A;  3FZL A;  2I5J A;  3L4Q A;  3UKR A;  3VTI A;  3ZEU A;  4FK4 A;  2NRR A;  3CC4 N;  4JEP A;  3DYA A;  3TAM A;  1GLC G;  3VQD A;  5GAD P;  4N5S A;  3AVC A;  3TAQ A;  2GUI A;  2GV9 A;  1K8K B;  1NK7 A;  2HVH A;  4LF5 K;  3E01 A;  4OPH A;  4CEC A;  5KRT A;  4LF6 K;  2O8B B;  3CER A;  5HRN A;  2QWP A;  4NYF A;  2P1J A;  1BOT O;  3LZJ A;  4E19 A;  1XMO K;  3CJB A;  4DS5 A;  3TTD A;  2FBV A;  3K59 A;  1SZ2 A;  4CFC A;  1N6Q A;  4Z4F A;  4LY7 A;  1D9D A;  3RMA A;  4ELT A;  3DAW A;  4I9L A;  3HP6 A;  3AO1 A;  4I9Q A;  5BPL A;  4WQ4 A;  3MCP A;  2YNH A;  3AVJ A;  3SMP A;  1RDW X;  3VPZ A;  3VGK A;  3R6M A;  4OLA A;  3BF1 A;  1IG8 A;  1L3T A;  2QWO A;  3EE9 A;  2P9N B;  2BDP A;  4NCG A;  2FSN A;  1FXX A;  2Y1J A;  3NGZ A;  1L5U A;  4C1N I;  4O55 A;  4E1M A;  4BRE A;  1S1U A;  1NJW A;  2ZE2 A;  1TKZ A;  1NM1 A;  4YDU C;  3QNO A;  5KQ8 A;  4CGJ A;  2E5L K;  3F2K A;  3RMC A;  4Z4G A;  3ZSZ A;  2OPQ A;  2Z1J A;  5IT9 O;  3A5N C;  5HBM A;  3OTO K;  3O9T A;  1C0T A;  5J1E A;  3QEX A;  3SLC A;  4Z4E A;  5A2Q O;  2G8I A;  3O3G A;  3HSC A;  1LW0 A;  3VEN A;  4YNQ A;  4KTZ A;  3DRR A;  3NMU A;  3FE1 A;  5C42 A;  1CZA N;  2FLO A;  3LAK A;  4BRG A;  1YT3 A;  1RT6 A;  3QIP A;  1BU6 O;  5AQX A;  4N41 A;  4CJU A;  4LF8 K;  3L2W A;  3JYT A;  3AVM A;  3V9X A;  2QEX N;  3DRS A;  5AQG A;  4A2B A;  4FJ5 A;  4FK0 A;  4HCC A;  1OH8 A;  4DF8 A;  3C6U A;  1VK0 A;  2XHB A;  2RHK A;  3CFO A;  4QS9 A;  3SI6 A;  4DV5 K;  3NF8 A;  5ADX H;  1N8R O;  5AR0 A;  5FDL A;  1WSH A;  1X9J A;  1RDD A;  1Z26 A;  4Y1D A;  5D3G A;  2V52 B;  1QSL A;  4IFE A;  3QO9 A;  1VQ5 N;  2DY4 A;  2F4V K;  4MLE A;  5FPD A;  3DXM B;  1VSF A;  3L3V A;  1KXP A;  5CY4 A;  3AVK A;  2UXC K;  1W9H A;  4TSX A;  1IKX A;  4JHD A;  2YKM A;  4CJ7 A;  2Q31 A;  3O9R A;  2V7Y A;  1ATS A;  3WXM B;  4H03 B;  4K43 A;  1LCU A;  2AJQ A;  2NNW A;  2JWK A;  5EU7 A;  3TAF A;  2OPP A;  1ILY A;  3TI0 A;  1I3A A;  3ZX3 A;  5BPM A;  3DM2 A;  4EIA A;  3QBW A;  3VOV A;  1VQ4 N;  5LJW A;  1NK5 A;  3ATV A;  5AQH A;  4B9L A;  2P9I B;  1HQE A;  2NLX A;  1FKO A;  4BVO A;  3HM8 A;  3SMS A;  2PAV A;  5HLF A;  1HJR A;  5CZ1 A;  4CZE A;  3JAM O;  4BAC A;  1QE1 A;  2G8W A;  4KHP K;  5J2P A;  3I33 A;  2F8S A;  3SBT A;  4OJR A;  3L2R A;  2YKN A;  1M1K O;  4AHC A;  3HPG A;  1BCO A;  3SV4 A;  3LDL A;  4ID1 A;  3E9L A;  2P9L B;  2BAN A;  1HRH A;  4FWQ A;  3EZ5 A;  3MMV A;  4K41 A;  5KPT A;  3QEW A;  3HP9 A;  4OLB A;  4EZ6 A;  3F9M A;  3S41 A;  4JI6 K;  4OO1 J;  3OBW A;  2O8F B;  4HWI A;  1KAX A;  3CI5 A;  2HHU A;  1QHA A;  3U3G A;  3KWI A;  4IJA A;  2ZD1 A;  4CCH A;  2FF6 A;  3AGK A;  4IG3 A;  4I6M A;  4AF1 A;  4DUY K;  4DR4 K;  4BDP A;  3D2F B;  4JI3 K;  3CD6 N;  1EKE A;  3BF3 A;  4C8M A;  2F7T A;  2E8A A;  4BVP A;  1VQ6 N;  3OYI A;  3ZSY A;  5FRN A;  3QFU A;  1HJO A;  5KQD A;  3RTV A;  3HT3 A;  3PX0 A;  2V51 B;  4MO4 A;  3ZT4 A;  4FM2 A;  1VSL A;  4CHY A;  2P9S B;  3AVG A;  5LMN K;  3ATU A;  4BRI A;  4W5R A;  4B1U B;  4PKH A;  4FJI A;  3CQ8 A;  4HTU A;  3VN5 A;  4U7B A;  4F8R A;  5EOY A;  4DU4 A;  2Z1H A;  1RTI A;  3CET A;  3PIP L;  4E3S A;  2QTD A;  3SJJ A;  2OA8 A;  5GIN A;  4CZM A;  4FM0 A;  2EWS A;  3HPH A;  3DI6 A;  5CYQ A;  3EY1 A;  3AVL A;  1NGA A;  1Q82 O;  1ASV A;  1BGX T;  5AQN A;  3L2U A;  3L3U A;  3QFP A;  1HLU A;  3ITH A;  4LD0 A;  1JLF A;  3RR8 A;  4JYA K;  4CEB A;  3OS0 A;  2HBK A;  3ZSW A;  3OYK A;  1EO1 A;  3DLR A;  3IDH A;  2IVO A;  4LSL A;  1ASU A;  1YAG A;  4H5W A;  4CJE A;  2NRW A;  3LPU A;  2KZM A;  1C1A A;  4JKF A;  1U2V B;  4F2S A;  4K0K K;  3EN9 A;  1HKG A;  3VEY A;  4DR1 K;  5HOO A;  2OZS A;  1YXQ A;  5C12 A;  3O8M A;  4CJF A;  5BN9 A;  4XEI A;  1WLJ A;  3BZK A;  4PL7 A;  3O1B A;  1J6Z A;  1JLC A;  3V1Q A;  4KI4 A;  1DLO A;  2HMI A;  4MFB A;  4YHH K;  2WOM A;  4EAH D;  3TTF A;  4IFY A;  4E0D A;  3RSE B;  1WSF A;  4PY5 A;  1T3V A;  5T7B A;  2PFU A;  2XY6 A;  4E89 A;  3SQ0 A;  3G6E N;  4CBW A;  3OYG A;  4WE1 A;  3WQU A;  4CES A;  3THX A;  3FZF A;  5AQU A;  4FJM A;  4YDU A;  3SUN A;  5AQW A;  3QEI A;  4BRQ A;  1GLD G;  4BR0 A;  1EXQ A;  2D5R A;  2Q0R A;  1EX4 A;  3CPE A;  3HXM A;  1RNH A;  2A41 A;  1NOZ A;  3M8Q A;  1RCH A;  3A5L C;  3LWM A;  1TAQ A;  4E7I A;  2QWM A;  1S22 A;  2YI1 A;  2GWJ A;  4DR2 K;  3SAF A;  3VQC A;  1E4F T;  2FBT A;  3SNN A;  4JK8 A;  3RR7 A;  3MED A;  3TAG A;  1OVQ A;  1WSI A;  4K42 A;  2ZJP L;  1QSS A;  1BA0 A;  1NGI A;  3J7Z O;  4AHR A;  1GOB A;  4DTP A;  1HNW K;  2DTU A;  3DOK A;  2Q3S A;  3MEE A;  4LF7 K;  3IKM A;  2J4R A;  1BG3 A;  5C2D A;  1VSD A;  2WON A;  1MU2 A;  1ZBS A;  3WXI A;  4FZX C;  1HYZ A;  2P9K B;  3TAE A;  3T1Y K;  3K5M A;  5B8H A;  2JGU A;  3EE8 A;  3O9Q A;  4DTO A;  3M6G A;  1RT7 A;  3QBX A;  4I2Q A;  5AZI A;  3RVC A;  3DXK A;  2OCE A;  3TTC A;  4DQQ A;  4FVU A;  3G25 A;  1NK8 A;  3PSI A;  1NGH A;  1OVY A;  4QS7 A;  3LDQ A;  1BA1 A;  1N34 K;  1RTD A;  4CHN A;  2QXL A;  4ELU A;  1NK6 A;  4AHV A;  4JI5 K;  3MN9 A;  5AZJ A;  4DV2 K;  1NGG A;  1NG9 A;  4KHQ A;  2WC9 A;  1U4B A;  2W42 A;  5FPE A;  4FVM A;  1VHX A;  3L8B A;  1K8A O;  1YVN A;  2YNF A;  3P31 A;  5F0X A;  3THW A;  2RPI A;  4CF2 A;  1S72 N;  4E7L A;  4CEA A;  1HNZ K;  4B9U A;  1V4T A;  1RT1 A;  4DR6 K;  3KJV A;  4JKD A;  2ATQ A;  2KTQ A;  2VG5 A;  1KFD A;  3ULD A;  4J8F A;  4CER A;  4DHY A;  3GG4 A;  2UUC K;  3KLH A;  5AQQ A;  4KTQ A;  4R79 A;  1NJI O;  2Q0U A;  3DLH A;  3V1R A;  4IOA L;  3MXJ A;  1H1V A;  3QEP A;  5EVZ A;  1VSM A;  3J7A P;  3TSU A;  1NLV A;  1RT5 A;  2B5J A;  1HNI A;  3VF4 A;  1RT3 A;  4DB3 A;  2FBX A;  2A6A A;  5C0Y A;  1VQ7 N;  1HR0 K;  3OA9 A;  5AQY A;  4AM6 A;  5FLX O;  4CBU A;  1S1V A;  4BG8 A;  1RBS A;  3AY9 A;  3V81 A;  4GV9 A;  3W0L A;  1Y97 A;  5AJ3 K;  1RGI A;  4C23 A;  4CFA A;  1VSI A;  3NDK A;  4EZ9 A;  3AVN A;  3J80 O;  2XY5 A;  4LH5 A;  3ULE A;  4ZTF A;  1K9M O;  3G10 A;  1VSH A;  4PUO A;  3HJF A;  5KI6 A;  3OYN A;  2QA4 N;  1UA0 A;  4CFB A;  3ENH A;  3H08 A;  3QEV A;  4CJL A;  3O9S A;  4WFN L;  1MWM A;  1MDU B;  2W41 A;  3NFA A;  3BP8 A;  4ISG A;  1EWR A;  3VQE A;  3PLA A;  5AQF A;  4CJP A;  3FFI A;  1Q9Y A;  4FPB A;  1M90 O;  2NRT A;  3KVG A;  4CK2 A;  3BY5 A;  4LH4 A;  1VSJ A;  2HNY A;  3SAH A;  4C1N K;  3QB0 A;  1FW6 A;  3CJ7 A;  4GMJ B;  1ASW A;  1QVF M;  4JKA A;  1Z05 A;  3CJ1 A;  3GL1 A;  4ISE A;  1VQK N;  1XQS C;  3O9U A;  1LWC A;  3VQP A;  5IWA K;  3LAL A;  5JLF A;  1XHX A;  2P51 A;  1ZBI A;  4DR7 K;  2G8H A;  2X6S A;  4B3O A;  2GEL A;  1IKV A;  2DPN A;  1KQS M;  2QXF A;  4BE2 A;  1QZ5 A;  2KKZ A;  2ZJR L;  3AA2 A;  4CGI A;  4FLY A;  4IEI A;  3QNN A;  3R9P A;  1CXQ A;  3VQ7 A;  3C7N A;  1UAX A;  1BWF O;  3C6H A;  2D0C A;  5JMV A;  5BR9 A;  4WQ5 C;  3MN6 A;  4FWM A;  4YOW A;  3IFR A;  1K8K A;  1XNQ K;  4JAX A;  1NK4 A;  4JS4 A;  2D0B A;  3JSM A;  1JL2 A;  4FWO A;  5AQO A;  4DWI A;  2O8B A;  3CCS N;  3J7Y P;  3AVA A;  5JLH A;  4KBO A;  3HST B;  5F1X A;  1T8E A;  4F9O A;  3AAP A;  2YHB A;  1VRT A;  4CJ4 A;  3CCJ N;  1KCF A;  3FLC O;  4FJJ A;  3U6F A;  4BR2 A;  4BRK A;  3QLH A;  3O6W A;  4AIL C;  3NCI A;  3TAP A;  4KRF A;  4JD2 B;  3NGY A;  1SL2 A;  3I0R A;  1IH7 A;  3V6D A;  2QWN A;  1SQK A;  1A5V A;  4DQI A;  2E20 A;  5LJV A;  5JVG L;  4B9V A;  1YJW N;  4WYB A;  3H3O B;  4NYN A;  5E26 A;  3TPQ A;  3WEE B;  1GLB G;  4BC3 A;  2QWR A;  4M7Y A;  4B9Q A;  3CCM N;  4OX9 K;  3ZYY X;  4JI1 K;  3T1A A;  2G8V A;  1RDA A;  1RT4 A;  5TKW A;  4EP5 A;  2A40 A;  3I55 N;  4M7X A;  4H0O A;  4YOY A;  4FCY A;  4H0X B;  2HBL A;  3WT0 A;  1P90 A;  4FOE A;  1S1X A;  3WNF A;  4OPK A;  2ZGZ A;  3MK6 A;  4GKK K;  2G8K A;  3O3H A;  4F4K A;  4DSI A;  3DLB A;  3MEC A;  4FOI A;  1YVU A;  5ADX A;  3L4I A;  1NK9 A;  3D0P A;  3KKS A;  3ZEU B;  3OYM A;  4B8A B;  2A1R A;  5I3U A;  1ZBF A;  4BWM A;  1KRP A;  1ZBL A;  4H0Y B;  4GY2 B;  2O8E B;  2IOC A;  1WAF A;  4FLU A;  5HRP A;  3E9P A;  3RRH A;  3ZCM A;  1B9D A;  2YNI A;  1VQO N;  4CIG A;  4JKG A;  4O0J A;  1C1C A;  3PO5 A;  2VG6 A;  3TAB A;  4DV3 K;  1UA1 A;  3QIO A;  1VRU A;  4RWT A;  1IBM K;  1SL1 A;  3S9H A;  3O3F A;  4NLC A;  5AQM A;  4YOT A;  3LM2 A;  4LF9 K;  4M45 A;  4GKJ K;  2E6L A;  5AFU H;  3CCR N;  3PO4 A;  4AM7 A;  3BEX A;  2R7Y A;  4BC4 A;  5AQS A;  5HRR A;  3NH2 A;  3DXM A;  4FM1 A;  5FPM A;  3OS2 A;  5JIC A;  5GAG P;  2QWL A;  3LZI A;  1DEJ A;  4CJW A;  1WBD A;  4O8K A;  1S6Q A;  1W97 L;  4O44 A;  3KIO A;  2NZT A;  1ESV A;  3QER A;  4M3R A;  3NF7 A;  2W6L A;  3E66 A;  1W0H A;  3OYF A;  3MX2 A;  5I9E B;  2KFZ A;  2P9I A;  1W7A A;  4CZG A;  4M3Z A;  4H0P A;  2PZS A;  4IBN A;  1J53 A;  2IIR A;  1EET A;  2P9P B;  1HKC A;  3NF6 A;  3C95 A;  4RG8 A;  4B1X B;  4DSF A;  1BCM A;  2HB5 A;  4O5F A;  5C24 A;  3K58 A;  3Q7B A;  5EX5 A;  3CQY A;  4Q0B A;  4CHQ A;  1BIU A;  3H46 O;  3LP3 A;  4KAZ A;  3LP0 A;  3S3O A;  3KLE A;  3OVN A;  4WFA L;  2VQE K;  2ITG A;  4FWS A;  3CME N;  2RKI A;  3EZW A;  4BRF A;  1K73 O;  3IRX A;  3IS9 A;  3MX5 A;  3MAQ A;  4BY9 C;  3AO5 A;  3WXL A;  3KLI A;  1TL1 A;  3R3L A;  1HYV A;  1Q18 A;  3RRG A;  1WN7 A;  3U9Z A;  1D9F A;  1KAY A;  3D2F A;  1XI1 A;  3MDQ A;  1R59 O;  1GOA A;  1OKJ A;  3TSQ A;  1D5A A;  4L3Q A;  4BQL A;  2O8D B;  2ASP A;  4FW2 A;  4O8U A;  3PSF A;  4H5V A;  3KD5 E;  2KQ2 A;  3GE1 A;  3AVI A;  3J8A A;  1ATR A;  4JKC A;  4ZHR A;  4JHD B;  1QSY A;  5F2R A;  1X9W A;  3MCA B;  4CEE A;  4ISF A;  4J2A A;  2VGN A;  4RTF D;  3IAY A;  4KB1 A;  1QZ6 A;  4X64 K;  3AGR A;  2P9S A;  4YY3 K;  1RT2 A;  4JLH A;  4CJS A;  1L3U A;  2VGM A;  2UXD K;  4JRQ A;  3SPZ A;  4IJN A;  3K9K A;  4KHY A;  4BR7 A;  1KAZ A;  2OAN A;  3UB5 A;  3NH0 A;  5HL7 L;  1N5Y A;  3CIP A;  3CG7 A;  5GAE P;  3ZT3 A;  4DKW A;  3O08 A;  5GIO A;  2IGI A;  2G8F A;  4KB0 A;  4HTL A;  3WNG A;  3VA3 A;  2P9U B;  1LAW A;  4CK3 A;  1T44 A;  3TR8 A;  2QKB A;  1KD1 O;  2HVI A;  1BUP A;  4CEZ A;  3TWH A;  1HX1 A;  1U47 A;  1Q7Y O;  3F5T A;  2PYL A;  3EL2 A;  4JI0 K;  2UU9 K;  2GX9 A;  5FPN A;  3ZSR A;  4B1Y B;  3ZSQ A;  3HI0 A;  2QK9 A;  1S9E A;  1RBV A;  3M8P A;  4JI7 K;  2UUA K;  3ISN C;  1SKR A;  3SQ1 A;  1S6P A;  1TVR A;  1Q9X A;  3MWT A;  4I6M B;  2VYP A;  4AHU A;  5DK5 A;  3IG1 A;  3SQ2 A;  4FJG A;  1HNX K;  3KTQ A;  4H5N A;  4FLX A;  1BQN A;  1RBU A;  4M3X A;  4RW9 A;  4A57 A;  2HHT A;  3D6R A;  4CJT A;  1KLN A;  4DCH A;  1VAZ A;  3VF6 A;  3LWL A;  3CCU N;  4JI8 K;  1XWL A;  4K25 A;  2F8T A;  2E2P A;  4Y0W A;  3D2E A;  4W5O A;  1T03 A;  1GOC A;  3LPT A;  3VF2 A;  1TGO A;  4CF0 A;  2D4W A;  2F96 A;  4B3R K;  4CD3 A;  3OYJ A;  2E6M A;  4DU1 A;  3THY A;  3ZSO A;  1QS4 A;  3OYB A;  4LC9 B;  3N4P A;  5KTQ A;  3MN5 A;  4NCB A;  2HHW A;  4IZ9 A;  2A3Z A;  4NB4 A;  3VMF B;  3ZSX A;  1X1P A;  4FPA A;  1IV0 A;  1T7P A;  3QDK A;  4YOR A;  1NMN A;  1VQP N;  1HUX A;  1F21 A;  3KK2 A;  1MWK A;  4OGC A;  4X66 K;  4FWR A;  4CJQ A;  3QET A;  2ETJ A;  4RCH A;  3VGM A;  3P39 A;  4BE0 A;  1YJ9 N;  3OHR A;  3ZX2 A;  4B3S K;  4BRC A;  3TAR A;  4FJ9 A;  1SAZ A;  2E1Y A;  4KHN A;  1KLM A;  2P9K A;  1E4G T;  3KD1 E;  3AAQ A;  4DTU A;  1DGK N;  4IWV A;  3FGU A;  4CJV A;  4CGH A;  1ZYQ A;  4RW8 A;  2XY8 A;  4CE9 A;  4NXN K;  4DLE A;  1XMQ K;  3VQA A;  2Q97 A;  3RWU A;  4JNE A;  3L0Q A;  2IVN A;  5DM7 L;  1S1W A;  3DRP A;  1ZXO A;  4M3T A;  2GWK A;  4BDZ A;  1NMD A;  4CJ3 A;  3FR0 A;  3WNE A;  4IO9 L;  3RMD A;  1YIT N;  2W6K A;  5KRS A;  2AP1 A;  1KVC A;  3M8R A;  4CGG A;  3I56 N;  3I8B A;  4E7J A;  4B3T K;  3SJH A;  3OJU A;  2QKK A;  1GLF O;  3MXM A;  4DFK A;  3VA0 A;  1BHL A;  2JWL A;  5AQJ A;  2HHX A;  4FJX A;  1VQL N;  2NRX A;  4BR9 A;  1SV5 A;  3NHG A;  3CC2 N;  4BG9 A;  4F3T A;  4GNI A;  1X9M A;  1JCF A;  2CH6 A;  1HNV A;  3DLK A;  4IDK A;  4O4G A;  1GLJ O;  3CFP A;  2XY7 A;  3SQ4 A;  2BTF A;  2BUP A;  4E1N A;  4XH4 A;  1I94 K;  4DTR A;  4B9N A;  4DV4 K;  3CCQ N;  3U4L A;  1Q86 O;  2DFE A;  1RBR A;  3AA5 X;  1NJZ A;  4QCL A;  3ZET B;  5M1F A;  1L3V A;  4JI4 K;  1NGC A;  1IBL K;  4NXM K;  3T19 A;  4DQR A;  4HHT A;  1C6V A;  3HYF A;  1NGE A;  2EX3 A;  2ZM6 K;  4YOV A;  4WCE L;  3O4W A;  4FJN A;  1X3N A;  4CJ5 A;  3CMA N;  5GAH P;  2WUS A;  4A61 A;  4C8L A;  3EYZ A;  1N33 K;  5AQT A;  4PKG A;  5C15 A;  4FJ7 A;  1O13 A;  3HVR A;  3A5O C;  4B9M A;  1FK9 A;  3AVB A;  1SS6 A;  3ALY A;  5AZI B;  1ZBU A;  2YCH A;  5KGW A;  4FLT A;  3V1O A;  4FJL A;  4DSL A;  4GVM A;  3HO1 A;  1YTA A;  2HF3 A;  1BI4 B;  2LSN A;  3QML A;  3HZ6 A;  4CF9 A;  5BR8 K;  1NNE A;  1ITG A;  1TUY A;  2Y1I A;  4OKK A;  2D0A A;  4IXC A;  5AZJ B;  3UKU A;  1CZB A;  1JXE A;  1NBW A;  3HOT A;  4PQU A;  1SL0 A;  3HPO A;  4DF4 A;  3CM6 A;  5M1N A;  2VQF K;  3LL3 A;  3G71 N;  4DU3 A;  3ZT1 A;  3V9Z A;  5I42 A;  4LFB K;  3ASM A;  3CF5 L;  3OYL A;  3SV3 A;  3THW B;  3TU5 A;  3EEQ A;  1YUW A;  1WOQ A;  4MDA A;  3VEZ A;  3CXC M;  4QOZ B;  3SYZ A;  3DLG A;  5LMU K;  1HKB A;  2KW4 A;  1NKB A;  2XRI A;  1QQM A;  3KLF A;  2AA4 A;  4F2R A;  4JKH A;  3WUH A;  3VEW A;  3LAM A;  2IS3 A;  3DLE A;  1IBK K;  3IUC A;  4CHP A;  4DV7 K;  4BC2 A;  3VER A;  2F9W A;  1TK5 A;  2KFN A;  4M63 C;  5LY3 A;  3GBT A;  4OPA A;  4CIF A;  4JK7 A;  3W3D A;  3NAE A;  1TK0 A;  4KHU A;  1YHQ N;  4PA1 A;  1WUA A;  4E7H A;  1JXB A;  1DTT A;  3AO4 A;  1NU0 A;  1RFQ A;  3CJA A;  4N56 A;  2B4J A;  1TYQ A;  2YX6 A;  5E41 A;  4CF8 A;  4XIU A;  4Z4I A;  3K5L A;  3CJC A;  1XNR K;  1J5O A;  2EHG A;  1C0F A;  4GV6 A;  4M41 A;  5JS1 A;  3OYH A;  2VWK A;  4Z0U A;  3ULE B;  4EFH A;  3QES A;  4FJ8 A;  4FJK A;  3BUZ B;  2VWB A;  1U45 A;  3K9J A;  3BDP A;  1Q8I A;  2WBN A;  4Q5V A;  5M1P A;  4JD2 A;  3DWL A;  4B9S A;  4YOX A;  4MDB A;  3A0I X;  4DS4 A;  4PWD A;  3C94 A;  3MEG A;  3Q7C A;  2YHA A;  4QAG A;  2D0O A;  3SK3 A;  4J2E A;  3LAN A;  3VEX A;  1DTQ A;  2OPS A;  3P83 D;  2NRH A;  1P8Z A;  4E1J A;  3L2Q A;  1QHT A;  3HM9 A;  2O8C B;  1RIL A;  4B1W B;  1A5X A;  2ZQB A;  5AQK A;  1EP4 A;  1TKX A;  4BGA A;  4XH5 A;  3V4I A;  5AQP A;  5CHI A;  4R5P A;  3OYC A;  1KSP A;  4FWP A;  4JV5 K;  3DMJ A;  3K5O A;  2YHW A;  1TKT A;  4LFC K;  3B6O A;  2E2N A;  3F9K A;  2IAJ A;  5CE3 A;  5BRF A;  3VQ4 A;  2IDO A;  4C8N A;  2UXB K;  3VQ9 A;  3BGR A;  1QQO A;  2YHX A;  4DV6 K;  5J2M A;  5AFU A;  2YJE A;  3C7N B;  3U9D A;  2FC0 A;  1VQ8 N; 
#chains in the Genus database with same CATH homology
 4DV1 K;  4DV2 K;  5IT9 O;  3OTO K;  4JI8 K;  5IWA K;  4JI6 K;  4YHH K;  4DR7 K;  1N32 K;  1IBK K;  5A2Q O;  4DV7 K;  4DR5 K;  4B3R K;  4DUY K;  4DR4 K;  1HNZ K;  4DR6 K;  4JI3 K;  1I94 K;  4DV4 K;  4DV3 K;  4X65 K;  4LF8 K;  1IBM K;  2UUC K;  4CVN E;  4V19 S;  4JI2 K;  4JI4 K;  1XNQ K;  1IBL K;  4NXM K;  4LF9 K;  4CW7 B;  4LF5 K;  4LF6 K;  4X64 K;  1XNR K;  4GKJ K;  4YY3 K;  2ZM6 K;  4DV5 K;  3J7A P;  3J7Y P;  5LMN K;  2UXD K;  5LL6 Z;  4X66 K;  1XMO K;  1N33 K;  4DV0 K;  4DR2 K;  2F4V K;  1HR0 K;  2UXC K;  5FLX O;  4X62 K;  3T1H K;  1FJG K;  4LF4 K;  5AJ3 K;  1HNW K;  4LF7 K;  4B3S K;  4DR3 K;  2HHH K;  3J80 O;  4AQY K;  5BR8 K;  4LFA K;  4OX9 K;  3T1Y K;  4JYA K;  4JI1 K;  4JI0 K;  2UU9 K;  4NXN K;  2UUB K;  1J5E K;  1XMQ K;  4DUZ K;  3JAM O;  4JV5 K;  2VQF K;  4KHP K;  4LFB K;  4JI7 K;  4LFC K;  2UUA K;  4GKK K;  4K0K K;  1N34 K;  1N36 K;  4DR1 K;  1HNX K;  3J81 O;  2UXB K;  2E5L K;  2VQE K;  4JI5 K;  4DV6 K;  5LMU K;  4B3T K;  4B3M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...