4BVOA

Legionella pneumophila ntpdase1 crystal form vi (part-open) in complex with polytungstate pom-1
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
356
structure length
356
Chain Sequence
PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Structures of Legionella Pneumophila Ntpdase1 in Complex with Polyoxometallates.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 112
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bvoA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4bvoA02
2Q36A 1ATNA 1S3XA 4BG8A 4RWTA 1T44A 1WOQA 2F9WA 1NGIA 5BRDA 2VCPA 4A2BA 5AQYA 3O08A 5F0XA 1TYQB 3M6GA 1NBWA 3WQTA 3UKUA 3CIPA 4CBUA 2A5XA 3EKSA 4BQZA 2E8AA 4K41A 4DCHA 4EAHD 2P9LA 3TPQA 3FZMA 3D2EA 4BR2A 2QWNA 3KZBA 1KAYA 3FZLA 3VGKA 3FZHA 2GWJA 3D2FA 3HZ6A 3FGUA 5AQLA 4EHTA 5AQOA 3VF4A 5FPNA 1C0GA 4BVOA 4CZFA 1YXQA 3ID8A 5AZJB 2NLXA 1NWKA 3LM9A 2QWRA 2VWBA 2UYTA 2E2PA 3HSCA 5EX5A 3DAWA 3VERA 4BG9A 3SJHA 5BRHA 1DKGD 5FPDA 5BPLA 1DGKN 3CJAA 4BRNA 1U2VB 2V7ZA 3O6WA 2QW9A 1RGIA 1QQMA 2GTDA 1Y64A 2GUPA 4FPBA 4CD3A 4BROA 3A5LC 2A42A 1S22A 3LDOA 1ESVA 4XH1A 1YUWA 2D1KA 3WXLA 1QHAA 3AAQA 1LCUA 4BRAA 4BRHA 3ENOA 4YDUA 3FE1A 4B1YB 2Q1NA 4CZHA 3UKRB 1QZ5A 4B1WB 2W40A 4F9OA 1SZ2A 4BRQA 2E2QA 2P9IB 3H1VX 2QWPA 3AAPA 1ZBSA 1IJJA 1R59O 3A8YA 1X3NA 4JD2B 2PBDA 1HJOA 2EWSA 5LY3A 1MA9B 1EQYA 1P8ZA 2I7NA 3A5MC 4JAXA 4IWVA 4BR9A 1D4XA 4FWSA 4DHYA 4M7XA 3IUCA 3S41A 5F1XA 4MO4A 3VETA 5AQXA 1Z05A 4PKGA 3VPZA 4BGBA 5AQKA 3RSEA 1MWKA 1ATRA 2P9LB 1TUYA 4GNIA 3VENA 2AA4A 5KPZA 1GLCG 3VF6A 3D2EB 1BA0A 1BU6O 4A62A 3GE1A 4CZIA 3MDQA 5BPNA 3D2FB 1GLLO 1T6DA 4BR5A 5ADXH 5JLHA 2V51B 4FL9A 1JCGA 1E4GT 3LDLA 5AQNA 4RTFD 2D0OA 3DXKA 3P4IA 1MWMA 2Q0UA 3AARA 3SK3A 4L3QA 2Q97A 1YVNA 2E2NA 3H46O 3F9MA 4BR0A 4I6MA 1G99A 3BUZB 1V4TA 4B1VA 2V52B 3VESA 2YI1A 4H5RA 1K8KA 5E84A 4H0XB 3I33A 3DWLA 1HPMA 4B1UB 4K25A 5I9EB 5KQ8A 2WUSA 3IDHA 1HX1A 3HBTA 4BRIA 3M3ZA 1OKJA 4Z94A 2A6AA 3O5BA 4FWRA 5BR9A 1GLBG 1GLEG 3VF2A 3ZX0A 4K42A 5CE3A 5AQSA 3LDNA 2FF6A 2QWQA 3ZEUA 4ISFA 2CH5A 3MMVA 4BC4A 4BQLA 4LC9B 4QS8A 2P9NA 4NB4A 3CJCA 5BRFA 1NGCA 3CETA 3EL2A 2HF4A 3CJBA 4J8FA 4JHDA 4B1ZA 3O80A 2V7YA 3GL1A 2IVPA 4MO5A 5AQJA 4H5NA 1CZAN 4O5FA 3H3NO 3ZX3A 2HF3A 4E1JA 4EHUA 4GY2B 4FSVA 3UE5A 3KVGA 3ZETA 2FLOA 1GLAG 3WXJA 1SAZA 3CJ9A 5AQIA 1JCFA 3C0BA 4FWMA 1NGJA 4YDUC 4B1XB 2ZF5O 3RSEB 3MN9A 1NGGA 2GWKA 5AQHA 4BC2A 1ZC6A 5BPMA 1Q18A 2ITMA 3B8AX 1HUXA 1KAZA 4CZGA 3GBTA 5B8HA 5LJWA 3VEXA 4JNEA 1V4SA 3LL3A 1GLDG 4CJ7A 3DXKB 1E4FT 2QXLA 3FLCO 3VEZA 4HWIA 2GELA 3HM8A 3VEWA 3GDQA 4FO0A 5F2RA 1NGBA 1IG8A 2W41A 3EKUA 3HTVA 5AQMA 2A3ZA 2QM1A 4I6MB 4FWOA 2P9KA 3QMLA 2BTFA 2A41A 3UB5A 1TUUA 3LDPA 3U8XA 1K8KB 3L4IA 4ISEA 4WQ5C 5AFUA 3TU5A 3FFKB 4O8KA 2YHYA 4H0VB 3ATUA 4BRCA 3DJCA 3LDQA 3WUHA 4H5WA 5E26A 2QWLA 4WQ5A 4FWKA 1HKBA 3FR0A 4IXCA 3WEEA 1J6ZA 4H5TA 3ZEUB 3KHYA 3O8MA 1BWFO 2E1ZA 2PAVA 2F9TA 3VGMA 5JMVA 2P9PA 4BVPA 2HMPA 3L0QA 2P9NB 4B9QA 4FOIA 4JN4A 1BDGA 2BUPA 3FZFA 4FPAA 3MN7A 4RCHA 3VEVA 3JS6A 5KPTA 5AQVA 4FOEA 4EFHA 1LOTB 1NGEA 1XUPO 2GEMA 3R6MA 4H0YB 4JHDB 4BRGA 2J4RA 3SLCA 5AQPA 4CZKA 1XC3A 4PL7A 1GLFO 1RFQA 2P9UA 3ZETB 5AZIA 3VOVA 5AFUH 4CD1A 3MCPA 2FSJA 4DB3A 3DXMB 4QS7A 2P9SA 2FF3B 5AQQA 4DQ8A 5AQGA 1C0FA 4NO7A 3WXIA 3SMPA 4Y0WA 1HKGA 1NGDA 3CQYA 3WT0A 4BRFA 2FSKA 5EXWA 5BN8A 3C7NA 1NLVA 5BN9A 3GG4A 3QBXA 3O1WA 2DPNA 3ENHA 4FWLA 2E20A 4AM7A 3H3OB 4H0TB 1NGAA 3WXKA 3CHWA 3ULEA 3H1QA 2YHWA 2OANA 3CERA 1QQNA 3W3DA 5AQUA 2FSNA 3LM2A 2P9KB 1H1VA 1QZ6A 1ZXOA 3A5OC 3CJ7A 4BRPA 1BA1A 4H03B 2YJEA 3OHRA 2Q0RA 1X9JA 3U4LA 3IMXA 4PKHA 4H0PA 3VEOA 2Q2RA 3DXMA 4WYBA 5AR0A 1NM1A 3VGLA 4FWNA 4XH5A 4BRDA 1BOTO 5LJVA 3JXUA 2D0PA 2KHOA 3WEEB 2CGKA 3IFRA 1T6CA 3EO3A 4FWQA 4CBXA 4CZLA 3CQXA 5ELZA 4BRMA 2P9PB 2I7PA 3O4WA 2HOEA 3GOIA 2QWOA 1JCEA 2VYPA 4H0OA 3BEXA 3J8AA 3EZWA 5EY4A 2ZGYA 3AY9A 3BF3A 1MDUB 4PL8A 3I8BA 4M63C 2CGJA 2FXUA 3QBWA 5BREA 5EVZA 1BO5O 1RDWX 4BC5A 2E1YA 3MN6A 3WQUA 2P9UB 5EOYA 3R9PA 4BR4A 5AZIB 4ISGA 4CZJA 5KPRA 3CI5A 5FPMA 4A61A 2P9SB 1YAGA 3QICA 2YCHA 3BP8A 2NZTA 1TYQA 1KXPA 1ATSA 4HTLA 3W0LA 5JICA 4KBOA 4BRLA 3U9DA 2NRHA 3ZX2A 5AQWA 3C7NB 1X3MA 1KAXA 1NMDA 3L6QA 3G25A 2IVNA 2ASOA 1SQKA 4CBWA 3CJ1A 4CZMA 5FPEA 1NGFA 4XH4A 2ZGZA 3U9ZA 5AQRA 5AZJA 3QB0A 3ULEB 3ATVA 2AP1A 3H6EA 1WUAA 2ZWHA 4FWPA 4EIAA 2H3GX 2QWMA 4M7YA 4BRKA 5AQTA 2D4WA 5ADXA 5AQZA 2A40A 4BREA 2YHXA 1Z6RA 1BUPA 1U2VA 4PKIA 4BR7A 3M1FA 3UKUB 1DEJA 2E2OA 3MK6A 3A5NC 2YJFA 3EN9A 3D7EO 5AQFA 1NGHA 4BC3A 4CZEA 2IVOA 3HI0A 2CGLA 4A2AA 5TKYA 1GLJO 2IIRA 4IJNA 3A0IX 3H45C 4MLHA 4IO8A 1BG3A 4H5VA 4C23A 4IJAA 3BF1A 5KQDA 4BGAA 3UKRA 4IZ9A 3FZKA 1HLUA 4WQ4C 1QQOA 3QDKA 1HKCA 2CH6A 3VEYA 1U6ZA 2P9IA 4K43A 3QFUA 2ASMA 3O1BA 4AM6A 4CI6A 1XQSC 4XEIA 3SMSA 4JD2A 4MLEA 5JLFA 2Q31A 4QS9A 2ASPA 3QFPA 3R8EA 4WQ4A 2E88A 3MN5A
chains in the Genus database with same CATH superfamily
1ATNA 4RWTA 1WOQA 2F9WA 1NGIA 5BRDA 5GIOA 4CGIA 3NVMA 1I94K 5JVGL 1NJYA 1NBWA 3RTVA 3WQTA 2QK9A 3CIPA 3SUQA 2Z1IA 3MWTA 4BQZA 4K41A 5M1QA 2ITGA 3NGIA 1CZBA 4DV6K 1T7PA 1EXQA 3VGKA 3AO1A 4G9ZA 5GADP 3HZ6A 3FGUA 5AQLA 3VF4A 1NU0A 4MQ3A 2YHBA 2D0AA 3IAYA 1VSMA 3ISNC 3P83D 4W5NA 3MXIA 1QSSA 3CMAN 3DM2A 3ID8A 1VSLA 3LM9A 1Y97A 2VWBA 2RF2A 3CFRA 4FJHA 4BG9A 3C6UA 3AVBA 1DKGD 1NMNA 4BRNA 3O6WA 1RGIA 1QQMA 1C0MA 2GUPA 5DM6L 4KTZA 1A5XA 2IDOA 4CD3A 3TAGA 2ZD1A 3C6AA 3LDOA 4OX9K 4DSLA 1CXQA 3NAEA 4B3OA 4Y1CA 4M3WA 4OKEA 3CG7A 4QAGA 1QZ5A 1Q86O 3BZKA 2P9IB 3AAPA 5E41A 3OYMA 2Y1JA 3T7ZA 4O0JA 1KCFA 3TSPA 1X3NA 2X6NA 2PBDA 2O4IA 2EWSA 1Q7YO 5DK5A 3LAKA 4Y1DA 4KI4A 4CECA 2X74A 3RMDA 1S6QA 1S1VA 1UWBA 3IUCA 4DTMA 5J2QA 1LV5A 3P5JA 4Z4IA 4PKGA 4JKFA 4FJ9A 1T03A 5D3GA 4KHQA 4BGBA 5AQKA 1T05A 1ATRA 4IBNA 5C12A 1GLCG 3VF6A 3D2EB 2ATQA 1ZBHA 4CZIA 2IAJA 3MDQA 3D2FB 2V51B 1J9AA 1JCGA 4C8KA 3G71N 4RTFD 3F2KA 1VSIA 1MWMA 4HVJA 5CZ1A 4K8ZA 3SK3A 5GAEP 5DM7L 4B9SA 1A5VA 3H46O 1NG9A 2OZMA 1S1UA 1WSHA 4OVLA 3I33A 3ZSVA 3OYDA 2WUSA 3ALYA 4BRIA 4Z94A 4GKJK 1LAWA 2D5RA 3L3UA 3VQBA 4DR6K 1GLEG 4CEFA 1N36K 3E66A 1REVA 4N41A 4K42A 4FLYA 1JKHA 4JKHA 2CH5A 3MMVA 2UXDK 1BL3A 4B9VA 2P9NA 2HVHA 1JL1A 4OGEA 1G15A 1XC9A 1I3AA 4J8FA 4MO5A 2V7YA 3GL1A 2IVPA 5AQJA 4AQYK 2UUBK 3KLEA 4GY2B 2P51A 1HRHA 2FLOA 2ZJQL 2A1RA 3EY1A 1SAZA 1HNVA 3TANA 3CJ9A 1NJWA 3VQDA 1NGJA 4YDUC 3AVAA 4IOXA 3RR7A 4GKKK 1JLFA 1ZC6A 3E9OA 4DG1A 4NXNK 4FXDA 1HUXA 2YNFA 3GBTA 5LJWA 3VEXA 3HM9A 1VQMN 3LL3A 3CCQN 4E7KA 1E4FT 2QXLA 3VEZA 2HW3A 2VQFK 3WXMB 3KD1E 1C1CA 3GDQA 5F2RA 3G0ZA 5AQMA 2OZSA 2P9KA 1X9WA 2BTFA 5SWMA 1YT3A 3FFKB 1FK9A 4LF7K 2YHYA 4H0VB 4DSIA 4BRCA 1IKVA 4CHYA 4CIFA 3KTQA 3DJCA 3LDQA 3WUHA 2YNGA 3SBTA 2KFNA 1QSYA 4IO9L 4E7HA 3KIOA 1XMOK 4CJTA 4IXCA 4DV2K 2XO7A 3V1RA 4AHSA 4BVPA 2HMPA 4FOIA 2IS3A 1BDGA 3LANA 3JS6A 3PX0A 2NUBA 4EFHA 3AVLA 3T3FA 1RTIA 3HK2A 4H0YB 4BRGA 1HNWK 3L2QA 4CZKA 2BGGA 1GLFO 3P39A 4ID5A 3VOVA 4DB3A 3JAMO 2FF3B 3D6RA 1KSPA 4DQ8A 1LWFA 4WE1A 4JK7A 4DSKA 4B3RK 4CGJA 5EXWA 5BN8A 4LD0A 4YNQA 1NLVA 5BN9A 3GG4A 4CJKA 3QBXA 3ENHA 3C95A 4IFVA 4V19S 4ILHA 3SV3A 4H0TB 1LWCA 1NGAA 1O1WA 4JKGA 4CEBA 3KK3A 3ZSXA 4MDAA 3CHWA 3HVRA 4JKAA 1N34K 1KLNA 2OANA 1WBBA 2I5JA 1QQNA 3W3DA 5AQUA 3PIPL 4FK4A 2FSNA 2YX6A 2O8CB 1VQNN 1QZ6A 3A5OC 3CJ7A 4NYNA 1BA1A 4LF6K 4DF8A 1X9JA 3U4LA 2FBTA 4ELVA 1NKEA 3VEOA 3TR8A 1WSFA 3I0SA 1MU2A 1NM1A 4FWNA 3TSQA 4B3SK 4XH5A 1Q9YA 5JS1A 3NH0A 1N5YA 4DU3A 4G1QA 3JXUA 3WEEB 4M3YA 3EO3A 3OYKA 1QVGM 4R79A 3O4WA 3SUNA 1J53A 2NRWA 5C0YA 3DOLA 4CHNA 4H0OA 3EZWA 2EX3A 4CEQA 3AY9A 1IBLK 3ULDA 2B6AA 3J7ZO 3I8BA 4ILJA 4B9UA 3P38A 5BREA 2F7TA 1BO5O 1RDWX 5C2FA 3PO5A 1VQPN 3WQUA 3R9PA 4WF9L 5GAGP 3QICA 2YCHA 2D0BA 5C25A 3HPOA 3OS0A 2LSNA 4YFUA 2O8EB 4JI1K 2NRRA 1VQ9N 3B6OA 3PSFA 3NGYA 3V4IA 1X3MA 3ZT1A 3QLHA 4B9TA 1IBKK 2ZGZA 3HO1A 5AQRA 4DV3K 3ULEB 3ATVA 4FJGA 3M8SA 4DTRA 2VG6A 4O8UA 2HSTA 5ADXA 3ENBA 2A40A 1Z6RA 3VN5A 1U2VA 3S3OA 4BR7A 3M1FA 3A5NC 4BE2A 1VQLN 2DFHA 4KO0A 1QTMA 2PYJA 2ZJRL 2IVOA 3HI0A 2CGLA 4CHQA 3CMEN 1BQMA 4IJNA 3DRSA 4IO8A 4H5VA 2GX9A 3K9JA 1W0HA 2CH6A 2XY8A 4K43A 3THXA 3QFUA 1SKWA 4AM6A 5J2NA 1XQSC 3VQAA 1KQSM 4KH5A 1RDBA 4KI6A 3OYAA 5ADXH 5AQNA 2Q36A 5HOOA 3VTHA 3SZ2A 1S3XA 1JXEA 3V9SA 1ZBFA 3KLIA 3O08A 4OPAA 5F0XA 1GOCA 1RDCA 1OH8A 3EKSA 1L3VA 4ICLA 2G8UA 3FZMA 4BR2A 2QWNA 3NCIA 3KZBA 1KAYA 3DYAA 3FZLA 2UUAK 4OPHA 4PHTX 2GWJA 1OH7A 4EHTA 1RBRA 1W97L 3SQ2A 3ASMA 4BVOA 1TGOA 1YXQA 5AZJB 1HMVA 3I55N 1NWKA 2O8DA 4EP4A 3VQPA 2QWRA 4CERA 4CEEA 2WC9A 3ID6A 4CIEA 4B3TK 3O4NA 3VERA 4RW8A 3SJHA 3AA2A 3THWA 3M8RA 5BPLA 3HOSA 1DGKN 1TV6A 4F3TA 1WSGA 3SAHA 3AVFA 3ZT0A 3V9WA 1Y64A 1BCMA 3BGRA 3KK2A 4E19A 4GVEA 4U7BA 3A5LC 3QEXA 5HP1A 4YOTA 1C0TA 4J2EA 4XH1A 3OYCA 2D1KA 1TKDA 3AAQA 1LCUA 1BI4A 3NVKA 4YDUA 3FE1A 4B1YB 3J7YP 2Q1NA 1GOBA 3UKRB 4WFAL 5M1PA 3AVIA 4W5OA 5JS2A 3SQ1A 3A8YA 4PWDA 1HJOA 4JAXA 3OA9A 4FM0A 4BR9A 4I2QA 1B92A 3H08A 4O44A 4FYDA 2F8TA 5F1XA 3S41A 3VETA 3S3MA 5AQXA 1U48A 4AH9A 5KGXA 3VPZA 4DFJA 1VHXA 3Q7BA 2UU9K 4F3OA 3RSEA 1MWKA 3DLGA 2P9LB 3MEGA 4GNIA 2AA4A 4JS4A 1BA0A 4DTOA 1BU6O 2HNYA 1RCHA 4M3TA 3FFIA 4KV8A 3CCUN 1L3UA 3QO9A 3TTFA 5JLHA 3KLGA 1YVUA 1RBUA 3MEEA 1BISA 3CCMN 2YV0X 3P4IA 1JLGA 2Q97A 3VQCA 4CEOA 3TWHA 3RR8A 4BR0A 3VQ8A 3O9SA 4DLEA 4H5RA 1EETA 1NJZA 4JI0K 1YJ9N 3ZSOA 3DRPA 4YOXA 3HBTA 3M3ZA 1IKWA 2JLEA 1ILYA 4BE1A 1CZ9A 3O5BA 3WNEA 4X64K 2OTLN 3LPUA 3SUOA 5M1FA 3VF2A 4KHNA 4FW2A 4KB1A 1KLMA 1EWRA 2HBKA 1WNSA 2FF6A 4DR5K 2QWQA 3ZEUA 4ISFA 1SL1A 1ASVA 4M42A 4LC9B 5SZTA 3B6PA 5C42A 4FK2A 4AHTA 2XY6A 4E1MA 4CF8A 5H1SQ 4NCBA 1BQNA 1NGCA 3CETA 1HNIA 2HF4A 3CJBA 2FBVA 2UXCK 4JHDA 5LL6Z 1ZYQA 3H3NO 4N5SA 3E9LA 4LFBK 3ZETA 2BDPA 2B5JA 3KK7A 4GVMA 3WXJA 1KC8O 3O9QA 3KJVA 5I42A 1QSLA 3ZCMA 1EP4A 3VTIA 4TSXA 3O9UA 1VSHA 4CEZA 4B1XB 5J2MA 3C94A 1JXBA 2ZF5O 4N76A 3MN9A 1NGGA 4BC2A 4O55A 1ASWA 1KFSA 1Q18A 4UQGA 1ZBIA 2ITMA 3B8AX 4DKWA 1U45A 1KAZA 4CZGA 3MCAB 1GLDG 2OPSA 3DXKB 4JK8A 1RILA 5HL7L 3J81O 1RT2A 4DQPA 4HWIA 4FJ5A 2GELA 3VEWA 3OYHA 4K8XA 1D8YA 3KD5E 3DOKA 3QEVA 3O3HA 5EU7A 1BHLA 2IOCA 4I6MB 1WBDA 3QMLA 1RTJA 1TUUA 1RT4A 3HPHA 1K8KB 4CGHA 3O4QA 3MXMA 3L4IA 4ISEA 4WQ5C 1A5WA 3VA0A 4H4OA 1W7AA 3G6EN 4RW4A 1Z25A 2OPPA 5HRNA 3MECA 3NF7A 2QWLA 4LF5K 4PUOA 3RVCA 1YJNN 4RG8A 2E1ZA 2PAVA 4B9QA 1C1BA 4JN4A 2O8FB 4YOYA 3MN7A 3VEVA 1JJ2M 4W5TA 4FOEA 2WBNA 4CEDA 4CF2A 3OYIA 5KI6A 1TKTA 4A59A 3SLCA 3DLEA 4B9NA 4LY7A 4HUEA 4FZYA 2FBXA 2O8BB 3F9KA 1RFQA 2P9UA 4FM1A 4O4GA 5AZIA 4AHCA 2G8IA 3THYB 1IO2A 2FSJA 2P9SA 4FJMA 3AVNA 4U67L 4F8RA 3OVNA 5AQQA 4Z0UA 5J1EA 4Q0BA 5AQGA 3WXIA 4Y0WA 1NGDA 3WT0A 2KTQA 1K9MO 2KZZA 4IDHA 4DR7K 2FSKA 3CCSN 4F2SA 4BWJA 3A2FA 4X62K 3NH2A 3BY5A 3TAEA 4DTNA 1TKXA 3QINA 3THVA 3K2PA 3AO4A 5HROA 1ZXOA 2XRIA 4H03B 2YJEA 2G8WA 2Q0RA 4LH5A 4NCGA 4CFDA 4H0PA 1NK7A 1TK5A 3DXMA 1X1PA 4WYBA 1KVBA 2KFZA 4JI5K 1VSEA 4BRDA 1BOTO 3LWMA 2G8KA 1T6CA 4FWQA 3V1OA 3WNHA 4A57A 3CQXA 3SUPA 4I7FA 5ELZA 2P9PB 4BRMA 2HOEA 4OKKA 1KVCA 3GOIA 1DT9A 1JCEA 4OPJA 3BEXA 4DQIA 3NE6A 3V9UA 4PL8A 2YHAA 1HYSA 4C1NK 2FXUA 3QBWA 5EVZA 1YJWN 3LALA 5EOYA 4GV6A 3CI5A 4A61A 2HHQA 3SAFA 3ZSQA 1P90A 3LP2A 4WCEL 4KBOA 4RW6A 4JS5A 5FDLA 3MXJA 3C7NB 1NMDA 3G25A 4KHYA 2ASOA 1SQKA 4RW7A 4CBWA 4CZMA 4DSJA 5FPEA 4BACA 3UIQA 4XH4A 4DFMA 2OPRA 3CC4N 5BR8K 1CXUA 3QETA 2Z1GA 4CGFA 1NJXA 2HHXA 4EIAA 1WUAA 2H3GX 3DRRA 2QWMA 1D5AA 3SQ4A 3L3VA 5HRRA 4FJLA 4BREA 2YHXA 1UA1A 4GW6A 4KH6A 2E2OA 4E7IA 2AJQA 2YJFA 2OTJN 1NKCA 5A2QO 3EYZA 1X9MA 1ZBUA 2QKBA 5TKYA 5KRTA 1L5UA 4KREA 4K0KK 4KHSA 4HUFA 4Z4FA 4DS5A 3SNNA 4B9MA 3FZKA 1HJRA 4WQ4C 5C2DA 3TABA 2PFUA 4YY3K 3CPEA 2WTUA 1U6ZA 4FM2A 2P9IA 3HYFA 2Z1JA 3C6TA 3THWB 1NK6A 4CFAA 3QESA 5KRSA 3SMSA 4MLEA 3HRGA 5JLFA 4QS9A 2ASPA 1UAXA 3R8EA 4C8OA 4B8CA 1Q9XA 2HVIA 2X78A 2HNDA 2VCPA 5AQYA 3K5MA 1TYQB 4WFBL 3M6GA 3C6HA 1QE1A 2KZMA 3UKUA 2JWKA 1K8AO 1TL1A 2A5XA 3EE8A 2PZSA 3C65A 2P5OA 4CF0A 1VRUA 4DCHA 5CHIA 4EAHD 2OPQA 1Z26A 3NH1A 5LMUK 3D2EA 4IEIA 3P1GA 3EEQA 3FZHA 3D2FA 1FKOA 5AQOA 1BIUA 4B08A 2HHSA 1C0GA 3PY8A 2NLXA 5C10A 2E2PA 1VQ6N 1YHQN 4ID1A 3AVGA 5BRHA 1IG9A 5FPDA 4GV9A 4CEAA 1VSFA 4CJWA 3TTCA 2GTDA 4OPKA 1I39A 4OJRA 3K59A 3Q7CA 4DSFA 1IBMK 1WN7A 1YITN 1S6PA 3SAGA 1S1XA 1XI1A 4O0IA 3OY9A 2UXBK 4KFBA 1JLEA 3VA3A 2RE2A 4KH4A 4CZHA 1BIZA 3NBPA 3DLHA 3BDPA 2W40A 3TAMA 2FC0A 4DTXA 4F9OA 1LW2A 4DV4K 4IOCL 4FJ7A 4BRQA 3AGRA 5IT9O 2QWPA 3KKRA 1VQ8N 1ZBSA 1R59O 4CVNE 4JRQA 4JD2B 4DU4A 2HBMA 5LY3A 4LFAK 1EQYA 1P8ZA 3HT3A 2I7NA 3K57A 3AV9A 2E4LA 3CCJN 1HQEA 4OKJA 1D4XA 4CK2A 1HPZA 3SI6A 1TL3A 1NKBA 4MO4A 2GV9A 1W9HA 3HP6A 1Z05A 1DTTA 4OLBA 1BCOA 5M1OA 3AVMA 1TUYA 3CXCM 5KPZA 2FBYA 3QEIA 3D45A 3IKMA 3GE1A 1GLLO 4DQSA 4LF4K 3ZYYX 4BR5A 4KRFA 4FL9A 1IKYA 2VWKA 3E9PA 4JI6K 3CF5L 3M5RA 1TAQA 2RKIA 4KKOA 5GINA 2Q0UA 4DLGA 3HOTA 1HR0K 2HHWA 2F8SA 3NMUA 1YVNA 2E2NA 3OW2M 1EKEA 3VQ4A 1G99A 3EZ5A 3CM5A 2YI1A 5AJ3K 3PUFA 3VMFB 1YTUA 3OYJA 4H0XB 4M3RA 3SPYA 4CJ3A 1HPMA 1S9EA 4B1UB 5I9EB 1NNEA 3OBWA 3VQEA 3IDHA 5C24A 3VQ5A 4ZTFA 3DLRA 3HPGA 1TK0A 5BR9A 2PYLA 1GLBG 1VQON 3VQ7A 3SPZA 3RRGA 4BDZA 5CE3A 1VAZA 3HL8A 4BC4A 4BQLA 3K58A 1WAJA 3CJCA 2G8HA 3V1QA 4AHVA 3EL2A 3G10A 1JLAA 2E5LK 2IC3A 4B1ZA 2NRVA 3HSTB 1CZAN 3ZX3A 3I8DA 2DFFA 4EHUA 4AHRA 3UE5A 3KVGA 3I0RA 5M1NA 3NHGA 4CJSA 2G8FA 4CFBA 1JCFA 4CJLA 4CE9A 4J2DA 4FWMA 3LZIA 3D0PA 4ILGB 5DMRA 2GWKA 5AQHA 3AO5A 1LAVA 2F4VK 1S72N 4MDBA 2DTUA 4DR4K 1OH6A 3AO3A 1TK8A 4JNEA 3MAQA 1NK8A 4L8RB 1VSJA 3FLCO 4I9QA 1T3VA 2E6MA 3HM8A 3CCRN 4RW9A 4QOZB 4FO0A 4C8LA 1VSDA 4E0DA 1IG8A 2W41A 2PY5A 3NGZA 2A3ZA 2QM1A 3SV4A 4FWOA 2O8CA 4DTSA 3AO2A 1ASUA 3LDPA 3U8XA 3CD6N 5AFUA 4FCYA 5HBMA 3PX6A 4CJPA 4IOAL 4KB0A 5KGWA 3TAFA 4H5WA 2GUIA 3ITHA 4LSNA 2XY5A 4KTQA 4FWKA 1HKBA 3WEEA 3O3GA 1OH5A 3LAMA 4H5TA 2ZM6K 3KHYA 3O8MA 3OJSA 5JMVA 3VGMA 1RBTA 4KHWA 3L0QA 4CJ5A 2P9NB 1T8EA 4FJ8A 5J2PA 4FVUA 2BUPA 3FZFA 4M3ZA 2Z1HA 5KPTA 3PLAA 5AQVA 5IWAK 2WOMA 4CGDA 4FLTA 1NGEA 2XHBA 3R6MA 3QNNA 1S9GA 4R5PA 2J4RA 5AQPA 4CIGA 4DV7K 5CR4A 1HNZK 2WONA 4FLZA 1NK9A 1S1WA 3T1AA 1N32K 5AFUH 3DXMB 4QS7A 1W2BM 4A5BA 3TI0A 3NF9A 1C0FA 2QTDA 3NF6A 4EZ9A 2O8EA 1HKGA 3LP3A 3CQYA 1Q81O 3K5OA 4DFKA 2NNWA 3NF8A 3LDSA 4YORA 5CY4A 1UOCA 2DPNA 1GOAA 1XNQK 2WFBA 2VWJA 4AM7A 3H3OB 4DR3K 3RRHA 3ULEA 4DFPA 1VQ7N 2YHWA 3NFAA 3OYGA 3HP9A 3SYZA 4N56A 1U47A 4DTUA 3LM2A 2P9KB 1H1VA 3MX5A 1SS6A 3KLFA 2ZQBA 3L2UA 3OHRA 3CFOA 2YNIA 1C6VA 1RT1A 3IMXA 3I56N 1RDAA 3SBGA 3V81A 3L2VA 2Q2RA 3OYNA 1E3MA 1JLQA 2QXFA 2JWLA 4Z4HA 5GAHP 3TAPA 4BDYA 2KHOA 4FLUA 2CGKA 4OGCA 1VQKN 1EWQA 2P1JA 4CZLA 2W42A 2QWOA 1RBSA 4HUGA 1XHZA 2HHTA 3J8AA 3OTOK 1C0UA 3PSIA 1WAFA 3KWIA 3LP1A 4M63C 1KFDA 1RDUA 3V9XA 5I3UA 2E1YA 3TARA 4JK9A 5FPMA 3CCVN 3QNOA 2NZTA 4OLAA 1KXPA 3M8QA 4HTLA 3TAQA 3W0LA 4JI8K 4E3SA 3K5NA 2VG5A 1F21A 3SJJA 1LWEA 4H8KA 4OO1J 1FKPA 2HNZA 3F73A 3ZX2A 4DQRA 1DTQA 5KTQA 3L6QA 3O9TA 5FRMA 4LF9K 2IVNA 3CJ1A 1LW0A 2DFEA 4LF8K 3U3YA 3U9ZA 3T1HK 4HCCA 1RNHA 4JKGB 5AZJA 3QB0A 2F96A 3QERA 1NK5A 1EO1A 4M7YA 3IRXA 3RMCA 2YKNA 5AQTA 4IEEA 2D4WA 2VGNA 1OVQA 4IFEA 5HLFA 2D0CA 3S9HA 3UKUB 1K6YA 1DEJA 4FJXA 4EZ6A 1M1KO 3P31A 4FJKA 3EN9A 4KTWA 4JYAK 3D7EO 1NGHA 1S5JA 4BC3A 4CZEA 3DLLL 4AF1A 4X65K 3LWLA 2VG7A 1SL0A 3CCLN 2IIRA 1NK4A 1VQ4N 1NJIO 3U6FA 3R1XA 3UKRA 4IZ9A 1HLUA 1QQOA 1HKCA 3VEYA 3RMBA 3HJFA 4HCBA 5JVHL 4CI6A 3QEWA 4XEIA 3T19A 3QFPA 2YKMA 3KKSA 2E88A 5FRNA 3ZLJA 1RTHA 2HHVA 4LSLA 3AVJA 2G8VA 3IG1A 4BG8A 1T44A 4A2BA 3DI6A 4BWMA 1IV0A 4O5BA 4CBUA 1Q82O 4FJJA 3CQ8A 2E8AA 1K73O 2NRZA 4Z4EA 2P9LA 3TPQA 4W5RA 4I9LA 4CJQA 2OYQA 2B4JA 3DLKA 5M1KA 4BY9C 4YOWA 1IKXA 2YNHA 1NOYA 5FPNA 1YI2N 3OYEA 5C15A 4CHZA 4CZFA 2BH1A 2UYTA 3HSCA 5EX5A 3CFPA 4M3UA 3DAWA 3OS2A 4IKFA 3O9RA 3CJAA 1U2VB 2V7ZA 3SCXA 3CC7N 2QW9A 4DS4A 1L3TA 4FPBA 3CYMA 1QQCA 3LPTA 4YOUA 1J5OA 5CYQA 4BROA 2KKZA 2A42A 1S22A 5CYMA 4AILC 1ESVA 4JI4K 1XMQK 1YUWA 4JV5K 3WXLA 2Q3SA 1QHAA 4HHTA 3L4QA 4CJFA 4JI2K 4BRAA 4BRHA 3OYBA 4DV0K 3ENOA 3ZT3A 3G4SN 4ZHRA 4ZTJA 4DV5K 4B1WB 1KVAA 3IS9A 4M45A 1SZ2A 2E2QA 2QKKA 3H1VX 2DY4A 3THXB 4DTPA 1IJJA 1EX4A 2KW4A 2XY7A 2HMIA 4B9LA 1MA9B 1M90O 3A5MC 1D9DA 4IWVA 4FLWA 4FWSA 4DHYA 3R3LA 1NK0A 2O4GA 4M7XA 3F5TA 3L8BA 3QIPA 2JGUA 4CHOA 4KHUA 2VQEK 4IG3A 4NLCA 3WNGA 1U04A 1D9FA 1SUQA 4LH4A 3VENA 3TSUA 1JLBA 4A62A 2ETJA 4CGGA 3ZSZA 5BPNA 1WB9A 1T6DA 4Q5VA 1E4GT 1IH7A 3LDLA 3QIOA 3ZSRA 2D0OA 3DXKA 4CK1A 2O8DB 1XHXA 3AARA 1HNXK 4QCLA 4DV1K 4L3QA 3T1YK 3CC2N 1RDDA 1FJGK 3F9MA 3PV8A 1CLQA 4MFBA 4I6MA 3BUZB 4C8NA 1NOZA 1V4TA 4B1VA 2V52B 3PO4A 3VESA 4UY8O 3E1YA 3VQQA 1K8KA 5E84A 3DWLA 2W6KA 3WNFA 2ZE2A 4K25A 4IG0A 5KQ8A 3OS1A 1HX1A 1OKJA 2A6AA 1SV5A 3K0SA 4FWRA 4M3XA 5FROA 4PY5A 1BI4B 3ZX0A 2NRXA 5AQSA 3LDNA 4LFCK 4NLBA 4NYFA 3OYFA 3JSMA 1FW6A 4QS8A 4NB4A 2HBJA 2O8FA 3N4PA 3S3NA 3PX4A 5BRFA 3AGKA 4C1NI 2HBLA 3K9KA 4FLXA 1ZBLA 2W6LA 3O80A 4FVMA 4H5NA 4O5FA 2HF3A 4E1JA 4M41A 2O8BA 4FSVA 4CW7B 4ELUA 3MEDA 4IDKA 1GLAG 3THYA 1DLOA 2RPIA 3MX2A 3L2RA 4E7LA 5AQIA 4CF9A 3C0BA 4JKCA 3RSEB 3OBYA 1VSKA 1J5EK 4B3MK 4YOVA 4FZXC 3AA5X 2RN2A 5BPMA 5CZ2A 2HHHK 5TKWA 3AVCA 5B8HA 3RWUA 1VK0A 1V4SA 4CJ7A 3JYTA 2A1SA 3KK1A 4PA1A 4JI7K 4X66K 1KD1O 3V9ZA 1NGBA 4NXMK 3EKUA 3HTVA 4ELTA 4FLVA 1OVYA 1KTQA 1S1TA 1J54A 4J2AA 4FW1A 4DMNA 1KRPA 1RBVA 3UB5A 2A41A 3BZCA 5HRSA 4A5AA 1SKSA 4CJRA 3OYLA 3MWPA 2UUCK 5GIPA 3TU5A 4AHUA 1N8RO 3O3FA 4O8KA 1VQ5N 3L2WA 1QS4A 2Y1IA 3ATUA 2BANA 2QA4N 4GMJB 4B8AB 4C8MA 2QI2A 5E26A 4GV3A 4WQ5A 1HYZA 4F2RA 3FR0A 4HTUA 2X6SA 4Z4GA 1J6ZA 4E89A 3ZEUB 4Z4CA 1BWFO 2F9TA 2P9PA 3J80O 1O13A 2KQ2A 4BDPA 4FPAA 4FJIA 3N4QA 4RCHA 1XWLA 2GBZA 1LOTB 4DR1K 1RT7A 1XUPO 2GEMA 4JHDB 3AA4A 1C1AA 3EE9A 2R7YA 4YHHK 5LMNK 3RMAA 1XC3A 4JKDA 4PL7A 3QEPA 2P5GA 3ZETB 2OCEA 2VGMA 4JLHA 4CD1A 3MCPA 3AA3A 3V6DA 4CJUA 4WFNL 4NO7A 3SMPA 1B9FA 3NDKA 2NRTA 3DLBA 3KWGA 4BRFA 3C7NA 4PQUA 4DU1A 2EHGA 3O1WA 5HRPA 4FWLA 2E20A 2RHKA 4E7JA 4KAZA 3WXKA 3H1QA 1TAUA 4JI3K 1N6QA 1SL2A 3CERA 3PIOL 3ZT4A 4JEPA 1QVFM 4FK0A 4JRPA 4N47A 4BRPA 3KLHA 4EP5A 4IFYA 3SQ0A 3E01A 3J7AP 4DUYK 3LP0A 4PKHA 3K5LA 1BGXT 1SKRA 1VRTA 2IGIA 5AR0A 4KHPK 3VGLA 1WLJA 1RT5A 4CCHA 5LJVA 2D0PA 3IFRA 4CBXA 3DMJA 1JL2A 1L3SA 2OA8A 4DF4A 2HB5A 2I7PA 4CJVA 2VYPA 1XNRK 4DUZK 3CCEN 1U4BA 1RTDA 5EY4A 2ZGYA 3BF3A 1MDUB 1HQUA 1R0AA 1ITGA 3VQ6A 2CGJA 3M8PA 4BE0A 4DR2K 4BC5A 3MN6A 1WSJA 4CJEA 2P9UB 4BR4A 2HHUA 1JLCA 5AZIB 4ISGA 4CZJA 5KPRA 3ZSYA 2P9SB 1YAGA 1RT3A 3BP8A 1TYQA 1ATSA 3ZSWA 5JICA 3TTDA 4CF1A 4BRLA 1QHTA 3U3GA 4DSEA 3U9DA 2NRHA 3ZT2A 5AQWA 4CFCA 4NCAA 3AVHA 1KAXA 5MLCQ 4DQQA 1NGFA 1FXXA 4H4MA 1HYVA 5FLXO 2AP1A 4E1NA 4J2BA 3OJUA 2BE2A 3CM6A 2ZWHA 3H6EA 4FWPA 3CPWM 3AVKA 4BRKA 1WSIA 4KPYA 5AQZA 1UA0A 4F4KA 1BUPA 4DTJA 4PKIA 5T7BA 4CJ4A 1X9SA 2KLAA 4FJNA 3MK6A 1TKZA 5AQFA 4CESA 4CHPA 4I2PA 1N33K 4JKEA 2ZJPL 1B9DA 4XIUA 4A2AA 4FZZA 2E6LA 3VQ9A 1GLJO 1YIJN 1RT6A 3A0IX 3LZJA 4DWIA 3H45C 4MLHA 3HVTA 1BG3A 4C23A 1TVRA 4IJAA 3BF1A 5KQDA 4BGAA 4W5QA 3T69A 3QDKA 1YF5L 4CK3A 5K14A 1Q8IA 2ASMA 3O1BA 1WSEA 4JD2A 1U49A 3HXMA 2QEXN 2Q31A 4JKBA 1YTAA 4WQ4A 3MN5A
chains in the Genus database with same CATH topology
2Q36A 5HOOA 3VTHA 1ATNA 1S3XA 4BG8A 4RWTA 1T44A 1WOQA 2F9WA 1NGIA 5BRDA 2VCPA 4A2BA 5AQYA 3O08A 4OPAA 5GIOA 5F0XA 3NVMA 5JVGL 1TYQB 4WFBL 3M6GA 1NBWA 3C6HA 3WQTA 3UKUA 2JWKA 3CIPA 4CBUA 1Q82O 2A5XA 3EE8A 3MWTA 3EKSA 4BQZA 3C65A 2E8AA 4K41A 5M1QA 2NRZA 1K73O 4DCHA 5CHIA 4EAHD 2P9LA 3TPQA 3FZMA 3D2EA 4IEIA 4BR2A 2QWNA 3KZBA 1KAYA 3FZLA 3VGKA 3FZHA 4OPHA 4PHTX 2GWJA 4G9ZA 3D2FA 5M1KA 5GADP 3HZ6A 3FGUA 5AQLA 4EHTA 5AQOA 3VF4A 4BY9C 4YOWA 1W97L 5FPNA 1YI2N 5C15A 3CMAN 1C0GA 4BVOA 4CZFA 1YXQA 3ID8A 5AZJB 2NLXA 1NWKA 3I55N 3LM9A 2BH1A 2QWRA 5C10A 2VWBA 2UYTA 2E2PA 1VQ6N 2WC9A 3ID6A 1YHQN 3HSCA 5EX5A 3DAWA 3VERA 4BG9A 3SJHA 5BRHA 1DKGD 5FPDA 4GV9A 5BPLA 3O9RA 1DGKN 3HOSA 3CJAA 4BRNA 3SAHA 1U2VB 2V7ZA 3CC7N 3O6WA 2QW9A 1RGIA 1QQMA 3TTCA 2GTDA 1Y64A 2GUPA 4FPBA 5DM6L 3Q7CA 4GVEA 4YOUA 4CD3A 4U7BA 4BROA 2KKZA 3A5LC 2A42A 1S22A 3C6AA 1YITN 4YOTA 3LDOA 3SAGA 1ESVA 4XH1A 1YUWA 2D1KA 3WXLA 1QHAA 3AAQA 3L4QA 1LCUA 4BRAA 4BRHA 3NVKA 3ENOA 4YDUA 3FE1A 4B1YB 3G4SN 2Q1NA 2RE2A 4KH4A 4CZHA 3UKRB 4WFAL 1QZ5A 4B1WB 1Q86O 5M1PA 2W40A 4F9OA 4IOCL 1SZ2A 4BRQA 2E2QA 2P9IB 3AGRA 3H1VX 2QWPA 3AAPA 1VQ8N 3T7ZA 1ZBSA 1IJJA 1R59O 3A8YA 3TSPA 1X3NA 4JD2B 2PBDA 1HJOA 2HBMA 2EWSA 5LY3A 1Q7YO 1MA9B 1EQYA 1P8ZA 2I7NA 3A5MC 4JAXA 3CCJN 1M90O 3OA9A 4IWVA 4BR9A 1D4XA 4FWSA 4DHYA 3R3LA 4M7XA 3F5TA 3IUCA 3S41A 5F1XA 4MO4A 3VETA 5AQXA 4NLCA 1Z05A 4JKFA 4PKGA 3VPZA 3Q7BA 5M1OA 5AQKA 4BGBA 3RSEA 1MWKA 1ATRA 2P9LB 1TUYA 4GNIA 3VENA 3TSUA 2AA4A 5C12A 5KPZA 3CXCM 1GLCG 3VF6A 1BA0A 3D2EB 1BU6O 4A62A 3IKMA 3GE1A 4CZIA 3MDQA 5BPNA 3D2FB 1GLLO 3CCUN 1T6DA 3ZYYX 4BR5A 5ADXH 3TTFA 5JLHA 2V51B 4FL9A 1JCGA 1E4GT 3LDLA 5AQNA 3G71N 3E9PA 4RTFD 2D0OA 3DXKA 3F2KA 3CCMN 3CF5L 3P4IA 3M5RA 1MWMA 5GINA 2Q0UA 3AARA 3SK3A 3HOTA 5GAEP 3NMUA 4L3QA 2Q97A 5DM7L 1YVNA 2E2NA 3OW2M 3CC2N 3H46O 3F9MA 4BR0A 4I6MA 1G99A 3BUZB 1V4TA 3O9SA 4B1VA 2V52B 3VESA 4UY8O 2YI1A 3E1YA 4H5RA 1K8KA 3VMFB 5E84A 4H0XB 3I33A 1YJ9N 3DWLA 1HPMA 4B1UB 4YOXA 4K25A 5I9EB 5KQ8A 3OBWA 2WUSA 3IDHA 1HX1A 3HBTA 4BRIA 3M3ZA 1OKJA 4Z94A 2A6AA 1ILYA 3O5BA 4FWRA 5BR9A 2OTLN 1GLBG 1GLEG 1VQON 5M1FA 3VF2A 3E66A 3ZX0A 2NRXA 4K42A 2HBKA 1VAZA 2FF6A 3LDNA 4JKHA 5AQSA 2QWQA 5CE3A 3ZEUA 4ISFA 2CH5A 3MMVA 4NLBA 4BC4A 4BQLA 4LC9B 4QS8A 2P9NA 4NB4A 2HBJA 3CJCA 3N4PA 5BRFA 3AGKA 5H1SQ 4C1NI 1NGCA 3CETA 3EL2A 2HF4A 2HBLA 3CJBA 3K9KA 4J8FA 4JHDA 4B1ZA 3O80A 2V7YA 3GL1A 2IVPA 2NRVA 4MO5A 5AQJA 4H5NA 1CZAN 4O5FA 3H3NO 3ZX3A 3E9LA 2HF3A 4E1JA 4EHUA 4GY2B 4FSVA 3UE5A 3KVGA 3ZETA 2FLOA 5M1NA 2ZJQL 1GLAG 3KK7A 3WXJA 1KC8O 3O9QA 1SAZA 3MX2A 3CJ9A 5AQIA 3VTIA 1JCFA 3C0BA 3O9UA 4FWMA 1NGJA 4YDUC 4JKCA 4B1XB 4ILGB 2ZF5O 3RSEB 3OBYA 4IOXA 3MN9A 1NGGA 2GWKA 5AQHA 4BC2A 1ZC6A 3E9OA 4YOVA 1S72N 5BPMA 1Q18A 4MDBA 1K8AO 5TKWA 2ITMA 3B8AX 4DKWA 1HUXA 1KAZA 4CZGA 3GBTA 5B8HA 3MCAB 3VEXA 5LJWA 4JNEA 1VQMN 1V4SA 3LL3A 3CCQN 1GLDG 4JK8A 3DXKB 4CJ7A 1E4FT 2QXLA 3FLCO 3VEZA 5HL7L 1T3VA 4HWIA 2GELA 1KD1O 3WXMB 3HM8A 3VEWA 3CCRN 3GDQA 4FO0A 5F2RA 1NGBA 1IG8A 2W41A 3EKUA 3HTVA 5AQMA 2A3ZA 2QM1A 1OVYA 4I6MB 4FWOA 2P9KA 3QMLA 2BTFA 2A41A 3UB5A 1TUUA 3LDPA 3U8XA 4A5AA 3CD6N 1K8KB 3L4IA 3MWPA 4ISEA 4WQ5C 5AFUA 5GIPA 3TU5A 3FFKB 1N8RO 4O8KA 1VQ5N 2YHYA 4IOAL 4H0VB 3ATUA 4BRCA 2QA4N 3DJCA 3G6EN 3LDQA 3WUHA 3SBTA 2QI2A 4H5WA 5E26A 2QWLA 4GV3A 4WQ5A 4FWKA 4IO9L 1HKBA 3FR0A 3RVCA 1YJNN 4IXCA 3WEEA 1J6ZA 4H5TA 3ZEUB 3KHYA 3O8MA 1BWFO 2E1ZA 2PAVA 2F9TA 3VGMA 5JMVA 2P9PA 4BVPA 2HMPA 3L0QA 2P9NB 4B9QA 4FOIA 4JN4A 1O13A 1BDGA 4FVUA 2BUPA 3FZFA 4FPAA 4YOYA 3N4QA 3MN7A 4RCHA 3VEVA 3JS6A 1JJ2M 5KPTA 3PLAA 5AQVA 4FOEA 4EFHA 1LOTB 2WBNA 1NGEA 1XUPO 2GEMA 3R6MA 4H0YB 4JHDB 4BRGA 3EE9A 2J4RA 4A59A 3SLCA 5AQPA 5CR4A 4CZKA 1XC3A 4JKDA 4PL7A 1GLFO 1RFQA 2P9UA 3P39A 3ZETB 5AZIA 3VOVA 2VGMA 5AFUH 4CD1A 3MCPA 2FSJA 4DB3A 3DXMB 4QS7A 2P9SA 2FF3B 3D6RA 4A5BA 1W2BM 4U67L 4WFNL 5AQQA 4DQ8A 5AQGA 1C0FA 2QTDA 4NO7A 3WXIA 3SMPA 4JK7A 4Y0WA 1HKGA 1NGDA 3CQYA 3WT0A 1Q81O 2NRTA 1K9MO 4IDHA 3KWGA 4BRFA 2FSKA 5EXWA 2NNWA 5BN8A 3CCSN 4YORA 3C7NA 1NLVA 5BN9A 3GG4A 3QBXA 3O1WA 2DPNA 3ENHA 4FWLA 2E20A 2RHKA 2WFBA 4AM7A 4ILHA 3H3OB 4H0TB 1NGAA 4JKGA 3WXKA 4MDAA 3CHWA 3ULEA 3H1QA 1VQ7N 4JKAA 2YHWA 2OANA 3CERA 3PIOL 1QQNA 3W3DA 5AQUA 3PIPL 4JEPA 2FSNA 3LM2A 2P9KB 2YX6A 1H1VA 3MX5A 1QVFM 1VQNN 1QZ6A 1SS6A 1ZXOA 3A5OC 3CJ7A 4BRPA 1BA1A 4H03B 2YJEA 3OHRA 2Q0RA 1X9JA 3U4LA 3IMXA 3I56N 4PKHA 4H0PA 3SBGA 3VEOA 2Q2RA 3DXMA 4WYBA 5AR0A 1NM1A 3VGLA 4FWNA 3TSQA 4XH5A 4BRDA 1BOTO 2JWLA 5GAHP 5LJVA 3JXUA 2D0PA 2KHOA 3WEEB 2CGKA 3IFRA 1T6CA 3EO3A 4FWQA 4CBXA 1VQKN 4A57A 4CZLA 3CQXA 1QVGM 4R79A 5ELZA 4BRMA 2P9PB 2I7PA 3O4WA 2HOEA 2NRWA 3GOIA 2QWOA 1DT9A 1JCEA 5C0YA 2VYPA 4H0OA 3BEXA 3CCEN 3J8AA 3EZWA 5EY4A 2ZGYA 3AY9A 3BF3A 1MDUB 4PL8A 3KWIA 3J7ZO 4C1NK 3I8BA 4ILJA 4M63C 2CGJA 2FXUA 2F7TA 3P38A 3QBWA 5BREA 5EVZA 1BO5O 1RDWX 1RDUA 5C2FA 4BC5A 2E1YA 3MN6A 1VQPN 1YJWN 3WQUA 2P9UB 5EOYA 3R9PA 4BR4A 4WF9L 4GV6A 5AZIB 4ISGA 4JK9A 4CZJA 5KPRA 3CI5A 5FPMA 4A61A 5GAGP 2P9SB 1YAGA 3QICA 3SAFA 2YCHA 3CCVN 3BP8A 2NZTA 1TYQA 1KXPA 1ATSA 4HTLA 1P90A 3W0LA 5JICA 4WCEL 3TTDA 4KBOA 4BRLA 4OO1J 2NRRA 3U9DA 1VQ9N 2NRHA 3ZX2A 5AQWA 3C7NB 1X3MA 1KAXA 1NMDA 3L6QA 3O9TA 5MLCQ 3G25A 2IVNA 2ASOA 1SQKA 4CBWA 3CJ1A 4CZMA 5FPEA 1NGFA 4XH4A 2ZGZA 3U9ZA 3CC4N 5AQRA 4JKGB 5AZJA 3QB0A 3ULEB 3ATVA 2AP1A 3H6EA 1WUAA 2ZWHA 4FWPA 4EIAA 3CPWM 2H3GX 2QWMA 1EO1A 4M7YA 4O8UA 4BRKA 5AQTA 2HSTA 2D4WA 4IEEA 5ADXA 2VGNA 3ENBA 5AQZA 2A40A 4BREA 2YHXA 1Z6RA 4IFEA 1BUPA 1U2VA 4KH6A 4PKIA 4BR7A 3M1FA 3UKUB 2KLAA 1DEJA 2E2OA 3MK6A 3A5NC 1M1KO 2YJFA 3P31A 3EN9A 1VQLN 2OTJN 3D7EO 5AQFA 1NGHA 4BC3A 2ZJRL 4CZEA 4JKEA 3DLLL 4AF1A 2IVOA 3HI0A 2ZJPL 2CGLA 3CMEN 4A2AA 3CCLN 5TKYA 1GLJO 2IIRA 1YIJN 4IJNA 1VQ4N 1NJIO 3A0IX 3H45C 4MLHA 4IO8A 3R1XA 1BG3A 4H5VA 2GX9A 4C23A 4IJAA 3BF1A 3K9JA 4BGAA 5KQDA 3UKRA 4IZ9A 3FZKA 1HLUA 4WQ4C 3T69A 5C2DA 1QQOA 3QDKA 2PFUA 1HKCA 3CPEA 2CH6A 3VEYA 1U6ZA 2P9IA 1YF5L 4K43A 3QFUA 5JVHL 2ASMA 3O1BA 4AM6A 4CI6A 1XQSC 1KQSM 4XEIA 3SMSA 4JD2A 4MLEA 3HRGA 4KH5A 5JLFA 2QEXN 2Q31A 4QS9A 2ASPA 3QFPA 4JKBA 3R8EA 4WQ4A 2E88A 3MN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q36 A;  1ATN A;  1S3X A;  4BG8 A;  4RWT A;  1T44 A;  1WOQ A;  2F9W A;  1NGI A;  5BRD A;  2VCP A;  4A2B A;  5AQY A;  3O08 A;  5F0X A;  1TYQ B;  3M6G A;  1NBW A;  3WQT A;  3UKU A;  3CIP A;  4CBU A;  2A5X A;  3EKS A;  4BQZ A;  2E8A A;  4K41 A;  4DCH A;  4EAH D;  2P9L A;  3TPQ A;  3FZM A;  3D2E A;  4BR2 A;  2QWN A;  3KZB A;  1KAY A;  3FZL A;  3VGK A;  3FZH A;  2GWJ A;  3D2F A;  3HZ6 A;  3FGU A;  5AQL A;  4EHT A;  5AQO A;  3VF4 A;  5FPN A;  1C0G A;  4BVO A;  4CZF A;  1YXQ A;  3ID8 A;  5AZJ B;  2NLX A;  1NWK A;  3LM9 A;  2QWR A;  2VWB A;  2UYT A;  2E2P A;  3HSC A;  5EX5 A;  3DAW A;  3VER A;  4BG9 A;  3SJH A;  5BRH A;  1DKG D;  5FPD A;  5BPL A;  1DGK N;  3CJA A;  4BRN A;  1U2V B;  2V7Z A;  3O6W A;  2QW9 A;  1RGI A;  1QQM A;  2GTD A;  1Y64 A;  2GUP A;  4FPB A;  4CD3 A;  4BRO A;  3A5L C;  2A42 A;  1S22 A;  3LDO A;  1ESV A;  4XH1 A;  1YUW A;  2D1K A;  3WXL A;  1QHA A;  3AAQ A;  1LCU A;  4BRA A;  4BRH A;  3ENO A;  4YDU A;  3FE1 A;  4B1Y B;  2Q1N A;  4CZH A;  3UKR B;  1QZ5 A;  4B1W B;  2W40 A;  4F9O A;  1SZ2 A;  4BRQ A;  2E2Q A;  2P9I B;  3H1V X;  2QWP A;  3AAP A;  1ZBS A;  1IJJ A;  1R59 O;  3A8Y A;  1X3N A;  4JD2 B;  2PBD A;  1HJO A;  2EWS A;  5LY3 A;  1MA9 B;  1EQY A;  1P8Z A;  2I7N A;  3A5M C;  4JAX A;  4IWV A;  4BR9 A;  1D4X A;  4FWS A;  4DHY A;  4M7X A;  3IUC A;  3S41 A;  5F1X A;  4MO4 A;  3VET A;  5AQX A;  1Z05 A;  4PKG A;  3VPZ A;  4BGB A;  5AQK A;  3RSE A;  1MWK A;  1ATR A;  2P9L B;  1TUY A;  4GNI A;  3VEN A;  2AA4 A;  5KPZ A;  1GLC G;  3VF6 A;  3D2E B;  1BA0 A;  1BU6 O;  4A62 A;  3GE1 A;  4CZI A;  3MDQ A;  5BPN A;  3D2F B;  1GLL O;  1T6D A;  4BR5 A;  5ADX H;  5JLH A;  2V51 B;  4FL9 A;  1JCG A;  1E4G T;  3LDL A;  5AQN A;  4RTF D;  2D0O A;  3DXK A;  3P4I A;  1MWM A;  2Q0U A;  3AAR A;  3SK3 A;  4L3Q A;  2Q97 A;  1YVN A;  2E2N A;  3H46 O;  3F9M A;  4BR0 A;  4I6M A;  1G99 A;  3BUZ B;  1V4T A;  4B1V A;  2V52 B;  3VES A;  2YI1 A;  4H5R A;  1K8K A;  5E84 A;  4H0X B;  3I33 A;  3DWL A;  1HPM A;  4B1U B;  4K25 A;  5I9E B;  5KQ8 A;  2WUS A;  3IDH A;  1HX1 A;  3HBT A;  4BRI A;  3M3Z A;  1OKJ A;  4Z94 A;  2A6A A;  3O5B A;  4FWR A;  5BR9 A;  1GLB G;  1GLE G;  3VF2 A;  3ZX0 A;  4K42 A;  5CE3 A;  5AQS A;  3LDN A;  2FF6 A;  2QWQ A;  3ZEU A;  4ISF A;  2CH5 A;  3MMV A;  4BC4 A;  4BQL A;  4LC9 B;  4QS8 A;  2P9N A;  4NB4 A;  3CJC A;  5BRF A;  1NGC A;  3CET A;  3EL2 A;  2HF4 A;  3CJB A;  4J8F A;  4JHD A;  4B1Z A;  3O80 A;  2V7Y A;  3GL1 A;  2IVP A;  4MO5 A;  5AQJ A;  4H5N A;  1CZA N;  4O5F A;  3H3N O;  3ZX3 A;  2HF3 A;  4E1J A;  4EHU A;  4GY2 B;  4FSV A;  3UE5 A;  3KVG A;  3ZET A;  2FLO A;  1GLA G;  3WXJ A;  1SAZ A;  3CJ9 A;  5AQI A;  1JCF A;  3C0B A;  4FWM A;  1NGJ A;  4YDU C;  4B1X B;  2ZF5 O;  3RSE B;  3MN9 A;  1NGG A;  2GWK A;  5AQH A;  4BC2 A;  1ZC6 A;  5BPM A;  1Q18 A;  2ITM A;  3B8A X;  1HUX A;  1KAZ A;  4CZG A;  3GBT A;  5B8H A;  5LJW A;  3VEX A;  4JNE A;  1V4S A;  3LL3 A;  1GLD G;  4CJ7 A;  3DXK B;  1E4F T;  2QXL A;  3FLC O;  3VEZ A;  4HWI A;  2GEL A;  3HM8 A;  3VEW A;  3GDQ A;  4FO0 A;  5F2R A;  1NGB A;  1IG8 A;  2W41 A;  3EKU A;  3HTV A;  5AQM A;  2A3Z A;  2QM1 A;  4I6M B;  4FWO A;  2P9K A;  3QML A;  2BTF A;  2A41 A;  3UB5 A;  1TUU A;  3LDP A;  3U8X A;  1K8K B;  3L4I A;  4ISE A;  4WQ5 C;  5AFU A;  3TU5 A;  3FFK B;  4O8K A;  2YHY A;  4H0V B;  3ATU A;  4BRC A;  3DJC A;  3LDQ A;  3WUH A;  4H5W A;  5E26 A;  2QWL A;  4WQ5 A;  4FWK A;  1HKB A;  3FR0 A;  4IXC A;  3WEE A;  1J6Z A;  4H5T A;  3ZEU B;  3KHY A;  3O8M A;  1BWF O;  2E1Z A;  2PAV A;  2F9T A;  3VGM A;  5JMV A;  2P9P A;  4BVP A;  2HMP A;  3L0Q A;  2P9N B;  4B9Q A;  4FOI A;  4JN4 A;  1BDG A;  2BUP A;  3FZF A;  4FPA A;  3MN7 A;  4RCH A;  3VEV A;  3JS6 A;  5KPT A;  5AQV A;  4FOE A;  4EFH A;  1LOT B;  1NGE A;  1XUP O;  2GEM A;  3R6M A;  4H0Y B;  4JHD B;  4BRG A;  2J4R A;  3SLC A;  5AQP A;  4CZK A;  1XC3 A;  4PL7 A;  1GLF O;  1RFQ A;  2P9U A;  3ZET B;  5AZI A;  3VOV A;  5AFU H;  4CD1 A;  3MCP A;  2FSJ A;  4DB3 A;  3DXM B;  4QS7 A;  2P9S A;  2FF3 B;  5AQQ A;  4DQ8 A;  5AQG A;  1C0F A;  4NO7 A;  3WXI A;  3SMP A;  4Y0W A;  1HKG A;  1NGD A;  3CQY A;  3WT0 A;  4BRF A;  2FSK A;  5EXW A;  5BN8 A;  3C7N A;  1NLV A;  5BN9 A;  3GG4 A;  3QBX A;  3O1W A;  2DPN A;  3ENH A;  4FWL A;  2E20 A;  4AM7 A;  3H3O B;  4H0T B;  1NGA A;  3WXK A;  3CHW A;  3ULE A;  3H1Q A;  2YHW A;  2OAN A;  3CER A;  1QQN A;  3W3D A;  5AQU A;  2FSN A;  3LM2 A;  2P9K B;  1H1V A;  1QZ6 A;  1ZXO A;  3A5O C;  3CJ7 A;  4BRP A;  1BA1 A;  4H03 B;  2YJE A;  3OHR A;  2Q0R A;  1X9J A;  3U4L A;  3IMX A;  4PKH A;  4H0P A;  3VEO A;  2Q2R A;  3DXM A;  4WYB A;  5AR0 A;  1NM1 A;  3VGL A;  4FWN A;  4XH5 A;  4BRD A;  1BOT O;  5LJV A;  3JXU A;  2D0P A;  2KHO A;  3WEE B;  2CGK A;  3IFR A;  1T6C A;  3EO3 A;  4FWQ A;  4CBX A;  4CZL A;  3CQX A;  5ELZ A;  4BRM A;  2P9P B;  2I7P A;  3O4W A;  2HOE A;  3GOI A;  2QWO A;  1JCE A;  2VYP A;  4H0O A;  3BEX A;  3J8A A;  3EZW A;  5EY4 A;  2ZGY A;  3AY9 A;  3BF3 A;  1MDU B;  4PL8 A;  3I8B A;  4M63 C;  2CGJ A;  2FXU A;  3QBW A;  5BRE A;  5EVZ A;  1BO5 O;  1RDW X;  4BC5 A;  2E1Y A;  3MN6 A;  3WQU A;  2P9U B;  5EOY A;  3R9P A;  4BR4 A;  5AZI B;  4ISG A;  4CZJ A;  5KPR A;  3CI5 A;  5FPM A;  4A61 A;  2P9S B;  1YAG A;  3QIC A;  2YCH A;  3BP8 A;  2NZT A;  1TYQ A;  1KXP A;  1ATS A;  4HTL A;  3W0L A;  5JIC A;  4KBO A;  4BRL A;  3U9D A;  2NRH A;  3ZX2 A;  5AQW A;  3C7N B;  1X3M A;  1KAX A;  1NMD A;  3L6Q A;  3G25 A;  2IVN A;  2ASO A;  1SQK A;  4CBW A;  3CJ1 A;  4CZM A;  5FPE A;  1NGF A;  4XH4 A;  2ZGZ A;  3U9Z A;  5AQR A;  5AZJ A;  3QB0 A;  3ULE B;  3ATV A;  2AP1 A;  3H6E A;  1WUA A;  2ZWH A;  4FWP A;  4EIA A;  2H3G X;  2QWM A;  4M7Y A;  4BRK A;  5AQT A;  2D4W A;  5ADX A;  5AQZ A;  2A40 A;  4BRE A;  2YHX A;  1Z6R A;  1BUP A;  1U2V A;  4PKI A;  4BR7 A;  3M1F A;  3UKU B;  1DEJ A;  2E2O A;  3MK6 A;  3A5N C;  2YJF A;  3EN9 A;  3D7E O;  5AQF A;  1NGH A;  4BC3 A;  4CZE A;  2IVO A;  3HI0 A;  2CGL A;  4A2A A;  5TKY A;  1GLJ O;  2IIR A;  4IJN A;  3A0I X;  3H45 C;  4MLH A;  4IO8 A;  1BG3 A;  4H5V A;  4C23 A;  4IJA A;  3BF1 A;  5KQD A;  4BGA A;  3UKR A;  4IZ9 A;  3FZK A;  1HLU A;  4WQ4 C;  1QQO A;  3QDK A;  1HKC A;  2CH6 A;  3VEY A;  1U6Z A;  2P9I A;  4K43 A;  3QFU A;  2ASM A;  3O1B A;  4AM6 A;  4CI6 A;  1XQS C;  4XEI A;  3SMS A;  4JD2 A;  4MLE A;  5JLF A;  2Q31 A;  4QS9 A;  2ASP A;  3QFP A;  3R8E A;  4WQ4 A;  2E88 A;  3MN5 A; 
#chains in the Genus database with same CATH topology
 1ATN A;  4RWT A;  1WOQ A;  2F9W A;  1NGI A;  5BRD A;  5GIO A;  4CGI A;  3NVM A;  1I94 K;  5JVG L;  1NJY A;  1NBW A;  3RTV A;  3WQT A;  2QK9 A;  3CIP A;  3SUQ A;  2Z1I A;  3MWT A;  4BQZ A;  4K41 A;  5M1Q A;  2ITG A;  3NGI A;  1CZB A;  4DV6 K;  1T7P A;  1EXQ A;  3VGK A;  3AO1 A;  4G9Z A;  5GAD P;  3HZ6 A;  3FGU A;  5AQL A;  3VF4 A;  1NU0 A;  4MQ3 A;  2YHB A;  2D0A A;  3IAY A;  1VSM A;  3ISN C;  3P83 D;  4W5N A;  3MXI A;  1QSS A;  3CMA N;  3DM2 A;  3ID8 A;  1VSL A;  3LM9 A;  1Y97 A;  2VWB A;  2RF2 A;  3CFR A;  4FJH A;  4BG9 A;  3C6U A;  3AVB A;  1DKG D;  1NMN A;  4BRN A;  3O6W A;  1RGI A;  1QQM A;  1C0M A;  2GUP A;  5DM6 L;  4KTZ A;  1A5X A;  2IDO A;  4CD3 A;  3TAG A;  2ZD1 A;  3C6A A;  3LDO A;  4OX9 K;  4DSL A;  1CXQ A;  3NAE A;  4B3O A;  4Y1C A;  4M3W A;  4OKE A;  3CG7 A;  4QAG A;  1QZ5 A;  1Q86 O;  3BZK A;  2P9I B;  3AAP A;  5E41 A;  3OYM A;  2Y1J A;  3T7Z A;  4O0J A;  1KCF A;  3TSP A;  1X3N A;  2X6N A;  2PBD A;  2O4I A;  2EWS A;  1Q7Y O;  5DK5 A;  3LAK A;  4Y1D A;  4KI4 A;  4CEC A;  2X74 A;  3RMD A;  1S6Q A;  1S1V A;  1UWB A;  3IUC A;  4DTM A;  5J2Q A;  1LV5 A;  3P5J A;  4Z4I A;  4PKG A;  4JKF A;  4FJ9 A;  1T03 A;  5D3G A;  4KHQ A;  4BGB A;  5AQK A;  1T05 A;  1ATR A;  4IBN A;  5C12 A;  1GLC G;  3VF6 A;  3D2E B;  2ATQ A;  1ZBH A;  4CZI A;  2IAJ A;  3MDQ A;  3D2F B;  2V51 B;  1J9A A;  1JCG A;  4C8K A;  3G71 N;  4RTF D;  3F2K A;  1VSI A;  1MWM A;  4HVJ A;  5CZ1 A;  4K8Z A;  3SK3 A;  5GAE P;  5DM7 L;  4B9S A;  1A5V A;  3H46 O;  1NG9 A;  2OZM A;  1S1U A;  1WSH A;  4OVL A;  3I33 A;  3ZSV A;  3OYD A;  2WUS A;  3ALY A;  4BRI A;  4Z94 A;  4GKJ K;  1LAW A;  2D5R A;  3L3U A;  3VQB A;  4DR6 K;  1GLE G;  4CEF A;  1N36 K;  3E66 A;  1REV A;  4N41 A;  4K42 A;  4FLY A;  1JKH A;  4JKH A;  2CH5 A;  3MMV A;  2UXD K;  1BL3 A;  4B9V A;  2P9N A;  2HVH A;  1JL1 A;  4OGE A;  1G15 A;  1XC9 A;  1I3A A;  4J8F A;  4MO5 A;  2V7Y A;  3GL1 A;  2IVP A;  5AQJ A;  4AQY K;  2UUB K;  3KLE A;  4GY2 B;  2P51 A;  1HRH A;  2FLO A;  2ZJQ L;  2A1R A;  3EY1 A;  1SAZ A;  1HNV A;  3TAN A;  3CJ9 A;  1NJW A;  3VQD A;  1NGJ A;  4YDU C;  3AVA A;  4IOX A;  3RR7 A;  4GKK K;  1JLF A;  1ZC6 A;  3E9O A;  4DG1 A;  4NXN K;  4FXD A;  1HUX A;  2YNF A;  3GBT A;  5LJW A;  3VEX A;  3HM9 A;  1VQM N;  3LL3 A;  3CCQ N;  4E7K A;  1E4F T;  2QXL A;  3VEZ A;  2HW3 A;  2VQF K;  3WXM B;  3KD1 E;  1C1C A;  3GDQ A;  5F2R A;  3G0Z A;  5AQM A;  2OZS A;  2P9K A;  1X9W A;  2BTF A;  5SWM A;  1YT3 A;  3FFK B;  1FK9 A;  4LF7 K;  2YHY A;  4H0V B;  4DSI A;  4BRC A;  1IKV A;  4CHY A;  4CIF A;  3KTQ A;  3DJC A;  3LDQ A;  3WUH A;  2YNG A;  3SBT A;  2KFN A;  1QSY A;  4IO9 L;  4E7H A;  3KIO A;  1XMO K;  4CJT A;  4IXC A;  4DV2 K;  2XO7 A;  3V1R A;  4AHS A;  4BVP A;  2HMP A;  4FOI A;  2IS3 A;  1BDG A;  3LAN A;  3JS6 A;  3PX0 A;  2NUB A;  4EFH A;  3AVL A;  3T3F A;  1RTI A;  3HK2 A;  4H0Y B;  4BRG A;  1HNW K;  3L2Q A;  4CZK A;  2BGG A;  1GLF O;  3P39 A;  4ID5 A;  3VOV A;  4DB3 A;  3JAM O;  2FF3 B;  3D6R A;  1KSP A;  4DQ8 A;  1LWF A;  4WE1 A;  4JK7 A;  4DSK A;  4B3R K;  4CGJ A;  5EXW A;  5BN8 A;  4LD0 A;  4YNQ A;  1NLV A;  5BN9 A;  3GG4 A;  4CJK A;  3QBX A;  3ENH A;  3C95 A;  4IFV A;  4V19 S;  4ILH A;  3SV3 A;  4H0T B;  1LWC A;  1NGA A;  1O1W A;  4JKG A;  4CEB A;  3KK3 A;  3ZSX A;  4MDA A;  3CHW A;  3HVR A;  4JKA A;  1N34 K;  1KLN A;  2OAN A;  1WBB A;  2I5J A;  1QQN A;  3W3D A;  5AQU A;  3PIP L;  4FK4 A;  2FSN A;  2YX6 A;  2O8C B;  1VQN N;  1QZ6 A;  3A5O C;  3CJ7 A;  4NYN A;  1BA1 A;  4LF6 K;  4DF8 A;  1X9J A;  3U4L A;  2FBT A;  4ELV A;  1NKE A;  3VEO A;  3TR8 A;  1WSF A;  3I0S A;  1MU2 A;  1NM1 A;  4FWN A;  3TSQ A;  4B3S K;  4XH5 A;  1Q9Y A;  5JS1 A;  3NH0 A;  1N5Y A;  4DU3 A;  4G1Q A;  3JXU A;  3WEE B;  4M3Y A;  3EO3 A;  3OYK A;  1QVG M;  4R79 A;  3O4W A;  3SUN A;  1J53 A;  2NRW A;  5C0Y A;  3DOL A;  4CHN A;  4H0O A;  3EZW A;  2EX3 A;  4CEQ A;  3AY9 A;  1IBL K;  3ULD A;  2B6A A;  3J7Z O;  3I8B A;  4ILJ A;  4B9U A;  3P38 A;  5BRE A;  2F7T A;  1BO5 O;  1RDW X;  5C2F A;  3PO5 A;  1VQP N;  3WQU A;  3R9P A;  4WF9 L;  5GAG P;  3QIC A;  2YCH A;  2D0B A;  5C25 A;  3HPO A;  3OS0 A;  2LSN A;  4YFU A;  2O8E B;  4JI1 K;  2NRR A;  1VQ9 N;  3B6O A;  3PSF A;  3NGY A;  3V4I A;  1X3M A;  3ZT1 A;  3QLH A;  4B9T A;  1IBK K;  2ZGZ A;  3HO1 A;  5AQR A;  4DV3 K;  3ULE B;  3ATV A;  4FJG A;  3M8S A;  4DTR A;  2VG6 A;  4O8U A;  2HST A;  5ADX A;  3ENB A;  2A40 A;  1Z6R A;  3VN5 A;  1U2V A;  3S3O A;  4BR7 A;  3M1F A;  3A5N C;  4BE2 A;  1VQL N;  2DFH A;  4KO0 A;  1QTM A;  2PYJ A;  2ZJR L;  2IVO A;  3HI0 A;  2CGL A;  4CHQ A;  3CME N;  1BQM A;  4IJN A;  3DRS A;  4IO8 A;  4H5V A;  2GX9 A;  3K9J A;  1W0H A;  2CH6 A;  2XY8 A;  4K43 A;  3THX A;  3QFU A;  1SKW A;  4AM6 A;  5J2N A;  1XQS C;  3VQA A;  1KQS M;  4KH5 A;  1RDB A;  4KI6 A;  3OYA A;  5ADX H;  5AQN A;  2Q36 A;  5HOO A;  3VTH A;  3SZ2 A;  1S3X A;  1JXE A;  3V9S A;  1ZBF A;  3KLI A;  3O08 A;  4OPA A;  5F0X A;  1GOC A;  1RDC A;  1OH8 A;  3EKS A;  1L3V A;  4ICL A;  2G8U A;  3FZM A;  4BR2 A;  2QWN A;  3NCI A;  3KZB A;  1KAY A;  3DYA A;  3FZL A;  2UUA K;  4OPH A;  4PHT X;  2GWJ A;  1OH7 A;  4EHT A;  1RBR A;  1W97 L;  3SQ2 A;  3ASM A;  4BVO A;  1TGO A;  1YXQ A;  5AZJ B;  1HMV A;  3I55 N;  1NWK A;  2O8D A;  4EP4 A;  3VQP A;  2QWR A;  4CER A;  4CEE A;  2WC9 A;  3ID6 A;  4CIE A;  4B3T K;  3O4N A;  3VER A;  4RW8 A;  3SJH A;  3AA2 A;  3THW A;  3M8R A;  5BPL A;  3HOS A;  1DGK N;  1TV6 A;  4F3T A;  1WSG A;  3SAH A;  3AVF A;  3ZT0 A;  3V9W A;  1Y64 A;  1BCM A;  3BGR A;  3KK2 A;  4E19 A;  4GVE A;  4U7B A;  3A5L C;  3QEX A;  5HP1 A;  4YOT A;  1C0T A;  4J2E A;  4XH1 A;  3OYC A;  2D1K A;  1TKD A;  3AAQ A;  1LCU A;  1BI4 A;  3NVK A;  4YDU A;  3FE1 A;  4B1Y B;  3J7Y P;  2Q1N A;  1GOB A;  3UKR B;  4WFA L;  5M1P A;  3AVI A;  4W5O A;  5JS2 A;  3SQ1 A;  3A8Y A;  4PWD A;  1HJO A;  4JAX A;  3OA9 A;  4FM0 A;  4BR9 A;  4I2Q A;  1B92 A;  3H08 A;  4O44 A;  4FYD A;  2F8T A;  5F1X A;  3S41 A;  3VET A;  3S3M A;  5AQX A;  1U48 A;  4AH9 A;  5KGX A;  3VPZ A;  4DFJ A;  1VHX A;  3Q7B A;  2UU9 K;  4F3O A;  3RSE A;  1MWK A;  3DLG A;  2P9L B;  3MEG A;  4GNI A;  2AA4 A;  4JS4 A;  1BA0 A;  4DTO A;  1BU6 O;  2HNY A;  1RCH A;  4M3T A;  3FFI A;  4KV8 A;  3CCU N;  1L3U A;  3QO9 A;  3TTF A;  5JLH A;  3KLG A;  1YVU A;  1RBU A;  3MEE A;  1BIS A;  3CCM N;  2YV0 X;  3P4I A;  1JLG A;  2Q97 A;  3VQC A;  4CEO A;  3TWH A;  3RR8 A;  4BR0 A;  3VQ8 A;  3O9S A;  4DLE A;  4H5R A;  1EET A;  1NJZ A;  4JI0 K;  1YJ9 N;  3ZSO A;  3DRP A;  4YOX A;  3HBT A;  3M3Z A;  1IKW A;  2JLE A;  1ILY A;  4BE1 A;  1CZ9 A;  3O5B A;  3WNE A;  4X64 K;  2OTL N;  3LPU A;  3SUO A;  5M1F A;  3VF2 A;  4KHN A;  4FW2 A;  4KB1 A;  1KLM A;  1EWR A;  2HBK A;  1WNS A;  2FF6 A;  4DR5 K;  2QWQ A;  3ZEU A;  4ISF A;  1SL1 A;  1ASV A;  4M42 A;  4LC9 B;  5SZT A;  3B6P A;  5C42 A;  4FK2 A;  4AHT A;  2XY6 A;  4E1M A;  4CF8 A;  5H1S Q;  4NCB A;  1BQN A;  1NGC A;  3CET A;  1HNI A;  2HF4 A;  3CJB A;  2FBV A;  2UXC K;  4JHD A;  5LL6 Z;  1ZYQ A;  3H3N O;  4N5S A;  3E9L A;  4LFB K;  3ZET A;  2BDP A;  2B5J A;  3KK7 A;  4GVM A;  3WXJ A;  1KC8 O;  3O9Q A;  3KJV A;  5I42 A;  1QSL A;  3ZCM A;  1EP4 A;  3VTI A;  4TSX A;  3O9U A;  1VSH A;  4CEZ A;  4B1X B;  5J2M A;  3C94 A;  1JXB A;  2ZF5 O;  4N76 A;  3MN9 A;  1NGG A;  4BC2 A;  4O55 A;  1ASW A;  1KFS A;  1Q18 A;  4UQG A;  1ZBI A;  2ITM A;  3B8A X;  4DKW A;  1U45 A;  1KAZ A;  4CZG A;  3MCA B;  1GLD G;  2OPS A;  3DXK B;  4JK8 A;  1RIL A;  5HL7 L;  3J81 O;  1RT2 A;  4DQP A;  4HWI A;  4FJ5 A;  2GEL A;  3VEW A;  3OYH A;  4K8X A;  1D8Y A;  3KD5 E;  3DOK A;  3QEV A;  3O3H A;  5EU7 A;  1BHL A;  2IOC A;  4I6M B;  1WBD A;  3QML A;  1RTJ A;  1TUU A;  1RT4 A;  3HPH A;  1K8K B;  4CGH A;  3O4Q A;  3MXM A;  3L4I A;  4ISE A;  4WQ5 C;  1A5W A;  3VA0 A;  4H4O A;  1W7A A;  3G6E N;  4RW4 A;  1Z25 A;  2OPP A;  5HRN A;  3MEC A;  3NF7 A;  2QWL A;  4LF5 K;  4PUO A;  3RVC A;  1YJN N;  4RG8 A;  2E1Z A;  2PAV A;  4B9Q A;  1C1B A;  4JN4 A;  2O8F B;  4YOY A;  3MN7 A;  3VEV A;  1JJ2 M;  4W5T A;  4FOE A;  2WBN A;  4CED A;  4CF2 A;  3OYI A;  5KI6 A;  1TKT A;  4A59 A;  3SLC A;  3DLE A;  4B9N A;  4LY7 A;  4HUE A;  4FZY A;  2FBX A;  2O8B B;  3F9K A;  1RFQ A;  2P9U A;  4FM1 A;  4O4G A;  5AZI A;  4AHC A;  2G8I A;  3THY B;  1IO2 A;  2FSJ A;  2P9S A;  4FJM A;  3AVN A;  4U67 L;  4F8R A;  3OVN A;  5AQQ A;  4Z0U A;  5J1E A;  4Q0B A;  5AQG A;  3WXI A;  4Y0W A;  1NGD A;  3WT0 A;  2KTQ A;  1K9M O;  2KZZ A;  4IDH A;  4DR7 K;  2FSK A;  3CCS N;  4F2S A;  4BWJ A;  3A2F A;  4X62 K;  3NH2 A;  3BY5 A;  3TAE A;  4DTN A;  1TKX A;  3QIN A;  3THV A;  3K2P A;  3AO4 A;  5HRO A;  1ZXO A;  2XRI A;  4H03 B;  2YJE A;  2G8W A;  2Q0R A;  4LH5 A;  4NCG A;  4CFD A;  4H0P A;  1NK7 A;  1TK5 A;  3DXM A;  1X1P A;  4WYB A;  1KVB A;  2KFZ A;  4JI5 K;  1VSE A;  4BRD A;  1BOT O;  3LWM A;  2G8K A;  1T6C A;  4FWQ A;  3V1O A;  3WNH A;  4A57 A;  3CQX A;  3SUP A;  4I7F A;  5ELZ A;  2P9P B;  4BRM A;  2HOE A;  4OKK A;  1KVC A;  3GOI A;  1DT9 A;  1JCE A;  4OPJ A;  3BEX A;  4DQI A;  3NE6 A;  3V9U A;  4PL8 A;  2YHA A;  1HYS A;  4C1N K;  2FXU A;  3QBW A;  5EVZ A;  1YJW N;  3LAL A;  5EOY A;  4GV6 A;  3CI5 A;  4A61 A;  2HHQ A;  3SAF A;  3ZSQ A;  1P90 A;  3LP2 A;  4WCE L;  4KBO A;  4RW6 A;  4JS5 A;  5FDL A;  3MXJ A;  3C7N B;  1NMD A;  3G25 A;  4KHY A;  2ASO A;  1SQK A;  4RW7 A;  4CBW A;  4CZM A;  4DSJ A;  5FPE A;  4BAC A;  3UIQ A;  4XH4 A;  4DFM A;  2OPR A;  3CC4 N;  5BR8 K;  1CXU A;  3QET A;  2Z1G A;  4CGF A;  1NJX A;  2HHX A;  4EIA A;  1WUA A;  2H3G X;  3DRR A;  2QWM A;  1D5A A;  3SQ4 A;  3L3V A;  5HRR A;  4FJL A;  4BRE A;  2YHX A;  1UA1 A;  4GW6 A;  4KH6 A;  2E2O A;  4E7I A;  2AJQ A;  2YJF A;  2OTJ N;  1NKC A;  5A2Q O;  3EYZ A;  1X9M A;  1ZBU A;  2QKB A;  5TKY A;  5KRT A;  1L5U A;  4KRE A;  4K0K K;  4KHS A;  4HUF A;  4Z4F A;  4DS5 A;  3SNN A;  4B9M A;  3FZK A;  1HJR A;  4WQ4 C;  5C2D A;  3TAB A;  2PFU A;  4YY3 K;  3CPE A;  2WTU A;  1U6Z A;  4FM2 A;  2P9I A;  3HYF A;  2Z1J A;  3C6T A;  3THW B;  1NK6 A;  4CFA A;  3QES A;  5KRS A;  3SMS A;  4MLE A;  3HRG A;  5JLF A;  4QS9 A;  2ASP A;  1UAX A;  3R8E A;  4C8O A;  4B8C A;  1Q9X A;  2HVI A;  2X78 A;  2HND A;  2VCP A;  5AQY A;  3K5M A;  1TYQ B;  4WFB L;  3M6G A;  3C6H A;  1QE1 A;  2KZM A;  3UKU A;  2JWK A;  1K8A O;  1TL1 A;  2A5X A;  3EE8 A;  2PZS A;  3C65 A;  2P5O A;  4CF0 A;  1VRU A;  4DCH A;  5CHI A;  4EAH D;  2OPQ A;  1Z26 A;  3NH1 A;  5LMU K;  3D2E A;  4IEI A;  3P1G A;  3EEQ A;  3FZH A;  3D2F A;  1FKO A;  5AQO A;  1BIU A;  4B08 A;  2HHS A;  1C0G A;  3PY8 A;  2NLX A;  5C10 A;  2E2P A;  1VQ6 N;  1YHQ N;  4ID1 A;  3AVG A;  5BRH A;  1IG9 A;  5FPD A;  4GV9 A;  4CEA A;  1VSF A;  4CJW A;  3TTC A;  2GTD A;  4OPK A;  1I39 A;  4OJR A;  3K59 A;  3Q7C A;  4DSF A;  1IBM K;  1WN7 A;  1YIT N;  1S6P A;  3SAG A;  1S1X A;  1XI1 A;  4O0I A;  3OY9 A;  2UXB K;  4KFB A;  1JLE A;  3VA3 A;  2RE2 A;  4KH4 A;  4CZH A;  1BIZ A;  3NBP A;  3DLH A;  3BDP A;  2W40 A;  3TAM A;  2FC0 A;  4DTX A;  4F9O A;  1LW2 A;  4DV4 K;  4IOC L;  4FJ7 A;  4BRQ A;  3AGR A;  5IT9 O;  2QWP A;  3KKR A;  1VQ8 N;  1ZBS A;  1R59 O;  4CVN E;  4JRQ A;  4JD2 B;  4DU4 A;  2HBM A;  5LY3 A;  4LFA K;  1EQY A;  1P8Z A;  3HT3 A;  2I7N A;  3K57 A;  3AV9 A;  2E4L A;  3CCJ N;  1HQE A;  4OKJ A;  1D4X A;  4CK2 A;  1HPZ A;  3SI6 A;  1TL3 A;  1NKB A;  4MO4 A;  2GV9 A;  1W9H A;  3HP6 A;  1Z05 A;  1DTT A;  4OLB A;  1BCO A;  5M1O A;  3AVM A;  1TUY A;  3CXC M;  5KPZ A;  2FBY A;  3QEI A;  3D45 A;  3IKM A;  3GE1 A;  1GLL O;  4DQS A;  4LF4 K;  3ZYY X;  4BR5 A;  4KRF A;  4FL9 A;  1IKY A;  2VWK A;  3E9P A;  4JI6 K;  3CF5 L;  3M5R A;  1TAQ A;  2RKI A;  4KKO A;  5GIN A;  2Q0U A;  4DLG A;  3HOT A;  1HR0 K;  2HHW A;  2F8S A;  3NMU A;  1YVN A;  2E2N A;  3OW2 M;  1EKE A;  3VQ4 A;  1G99 A;  3EZ5 A;  3CM5 A;  2YI1 A;  5AJ3 K;  3PUF A;  3VMF B;  1YTU A;  3OYJ A;  4H0X B;  4M3R A;  3SPY A;  4CJ3 A;  1HPM A;  1S9E A;  4B1U B;  5I9E B;  1NNE A;  3OBW A;  3VQE A;  3IDH A;  5C24 A;  3VQ5 A;  4ZTF A;  3DLR A;  3HPG A;  1TK0 A;  5BR9 A;  2PYL A;  1GLB G;  1VQO N;  3VQ7 A;  3SPZ A;  3RRG A;  4BDZ A;  5CE3 A;  1VAZ A;  3HL8 A;  4BC4 A;  4BQL A;  3K58 A;  1WAJ A;  3CJC A;  2G8H A;  3V1Q A;  4AHV A;  3EL2 A;  3G10 A;  1JLA A;  2E5L K;  2IC3 A;  4B1Z A;  2NRV A;  3HST B;  1CZA N;  3ZX3 A;  3I8D A;  2DFF A;  4EHU A;  4AHR A;  3UE5 A;  3KVG A;  3I0R A;  5M1N A;  3NHG A;  4CJS A;  2G8F A;  4CFB A;  1JCF A;  4CJL A;  4CE9 A;  4J2D A;  4FWM A;  3LZI A;  3D0P A;  4ILG B;  5DMR A;  2GWK A;  5AQH A;  3AO5 A;  1LAV A;  2F4V K;  1S72 N;  4MDB A;  2DTU A;  4DR4 K;  1OH6 A;  3AO3 A;  1TK8 A;  4JNE A;  3MAQ A;  1NK8 A;  4L8R B;  1VSJ A;  3FLC O;  4I9Q A;  1T3V A;  2E6M A;  3HM8 A;  3CCR N;  4RW9 A;  4QOZ B;  4FO0 A;  4C8L A;  1VSD A;  4E0D A;  1IG8 A;  2W41 A;  2PY5 A;  3NGZ A;  2A3Z A;  2QM1 A;  3SV4 A;  4FWO A;  2O8C A;  4DTS A;  3AO2 A;  1ASU A;  3LDP A;  3U8X A;  3CD6 N;  5AFU A;  4FCY A;  5HBM A;  3PX6 A;  4CJP A;  4IOA L;  4KB0 A;  5KGW A;  3TAF A;  4H5W A;  2GUI A;  3ITH A;  4LSN A;  2XY5 A;  4KTQ A;  4FWK A;  1HKB A;  3WEE A;  3O3G A;  1OH5 A;  3LAM A;  4H5T A;  2ZM6 K;  3KHY A;  3O8M A;  3OJS A;  5JMV A;  3VGM A;  1RBT A;  4KHW A;  3L0Q A;  4CJ5 A;  2P9N B;  1T8E A;  4FJ8 A;  5J2P A;  4FVU A;  2BUP A;  3FZF A;  4M3Z A;  2Z1H A;  5KPT A;  3PLA A;  5AQV A;  5IWA K;  2WOM A;  4CGD A;  4FLT A;  1NGE A;  2XHB A;  3R6M A;  3QNN A;  1S9G A;  4R5P A;  2J4R A;  5AQP A;  4CIG A;  4DV7 K;  5CR4 A;  1HNZ K;  2WON A;  4FLZ A;  1NK9 A;  1S1W A;  3T1A A;  1N32 K;  5AFU H;  3DXM B;  4QS7 A;  1W2B M;  4A5B A;  3TI0 A;  3NF9 A;  1C0F A;  2QTD A;  3NF6 A;  4EZ9 A;  2O8E A;  1HKG A;  3LP3 A;  3CQY A;  1Q81 O;  3K5O A;  4DFK A;  2NNW A;  3NF8 A;  3LDS A;  4YOR A;  5CY4 A;  1UOC A;  2DPN A;  1GOA A;  1XNQ K;  2WFB A;  2VWJ A;  4AM7 A;  3H3O B;  4DR3 K;  3RRH A;  3ULE A;  4DFP A;  1VQ7 N;  2YHW A;  3NFA A;  3OYG A;  3HP9 A;  3SYZ A;  4N56 A;  1U47 A;  4DTU A;  3LM2 A;  2P9K B;  1H1V A;  3MX5 A;  1SS6 A;  3KLF A;  2ZQB A;  3L2U A;  3OHR A;  3CFO A;  2YNI A;  1C6V A;  1RT1 A;  3IMX A;  3I56 N;  1RDA A;  3SBG A;  3V81 A;  3L2V A;  2Q2R A;  3OYN A;  1E3M A;  1JLQ A;  2QXF A;  2JWL A;  4Z4H A;  5GAH P;  3TAP A;  4BDY A;  2KHO A;  4FLU A;  2CGK A;  4OGC A;  1VQK N;  1EWQ A;  2P1J A;  4CZL A;  2W42 A;  2QWO A;  1RBS A;  4HUG A;  1XHZ A;  2HHT A;  3J8A A;  3OTO K;  1C0U A;  3PSI A;  1WAF A;  3KWI A;  3LP1 A;  4M63 C;  1KFD A;  1RDU A;  3V9X A;  5I3U A;  2E1Y A;  3TAR A;  4JK9 A;  5FPM A;  3CCV N;  3QNO A;  2NZT A;  4OLA A;  1KXP A;  3M8Q A;  4HTL A;  3TAQ A;  3W0L A;  4JI8 K;  4E3S A;  3K5N A;  2VG5 A;  1F21 A;  3SJJ A;  1LWE A;  4H8K A;  4OO1 J;  1FKP A;  2HNZ A;  3F73 A;  3ZX2 A;  4DQR A;  1DTQ A;  5KTQ A;  3L6Q A;  3O9T A;  5FRM A;  4LF9 K;  2IVN A;  3CJ1 A;  1LW0 A;  2DFE A;  4LF8 K;  3U3Y A;  3U9Z A;  3T1H K;  4HCC A;  1RNH A;  4JKG B;  5AZJ A;  3QB0 A;  2F96 A;  3QER A;  1NK5 A;  1EO1 A;  4M7Y A;  3IRX A;  3RMC A;  2YKN A;  5AQT A;  4IEE A;  2D4W A;  2VGN A;  1OVQ A;  4IFE A;  5HLF A;  2D0C A;  3S9H A;  3UKU B;  1K6Y A;  1DEJ A;  4FJX A;  4EZ6 A;  1M1K O;  3P31 A;  4FJK A;  3EN9 A;  4KTW A;  4JYA K;  3D7E O;  1NGH A;  1S5J A;  4BC3 A;  4CZE A;  3DLL L;  4AF1 A;  4X65 K;  3LWL A;  2VG7 A;  1SL0 A;  3CCL N;  2IIR A;  1NK4 A;  1VQ4 N;  1NJI O;  3U6F A;  3R1X A;  3UKR A;  4IZ9 A;  1HLU A;  1QQO A;  1HKC A;  3VEY A;  3RMB A;  3HJF A;  4HCB A;  5JVH L;  4CI6 A;  3QEW A;  4XEI A;  3T19 A;  3QFP A;  2YKM A;  3KKS A;  2E88 A;  5FRN A;  3ZLJ A;  1RTH A;  2HHV A;  4LSL A;  3AVJ A;  2G8V A;  3IG1 A;  4BG8 A;  1T44 A;  4A2B A;  3DI6 A;  4BWM A;  1IV0 A;  4O5B A;  4CBU A;  1Q82 O;  4FJJ A;  3CQ8 A;  2E8A A;  1K73 O;  2NRZ A;  4Z4E A;  2P9L A;  3TPQ A;  4W5R A;  4I9L A;  4CJQ A;  2OYQ A;  2B4J A;  3DLK A;  5M1K A;  4BY9 C;  4YOW A;  1IKX A;  2YNH A;  1NOY A;  5FPN A;  1YI2 N;  3OYE A;  5C15 A;  4CHZ A;  4CZF A;  2BH1 A;  2UYT A;  3HSC A;  5EX5 A;  3CFP A;  4M3U A;  3DAW A;  3OS2 A;  4IKF A;  3O9R A;  3CJA A;  1U2V B;  2V7Z A;  3SCX A;  3CC7 N;  2QW9 A;  4DS4 A;  1L3T A;  4FPB A;  3CYM A;  1QQC A;  3LPT A;  4YOU A;  1J5O A;  5CYQ A;  4BRO A;  2KKZ A;  2A42 A;  1S22 A;  5CYM A;  4AIL C;  1ESV A;  4JI4 K;  1XMQ K;  1YUW A;  4JV5 K;  3WXL A;  2Q3S A;  1QHA A;  4HHT A;  3L4Q A;  4CJF A;  4JI2 K;  4BRA A;  4BRH A;  3OYB A;  4DV0 K;  3ENO A;  3ZT3 A;  3G4S N;  4ZHR A;  4ZTJ A;  4DV5 K;  4B1W B;  1KVA A;  3IS9 A;  4M45 A;  1SZ2 A;  2E2Q A;  2QKK A;  3H1V X;  2DY4 A;  3THX B;  4DTP A;  1IJJ A;  1EX4 A;  2KW4 A;  2XY7 A;  2HMI A;  4B9L A;  1MA9 B;  1M90 O;  3A5M C;  1D9D A;  4IWV A;  4FLW A;  4FWS A;  4DHY A;  3R3L A;  1NK0 A;  2O4G A;  4M7X A;  3F5T A;  3L8B A;  3QIP A;  2JGU A;  4CHO A;  4KHU A;  2VQE K;  4IG3 A;  4NLC A;  3WNG A;  1U04 A;  1D9F A;  1SUQ A;  4LH4 A;  3VEN A;  3TSU A;  1JLB A;  4A62 A;  2ETJ A;  4CGG A;  3ZSZ A;  5BPN A;  1WB9 A;  1T6D A;  4Q5V A;  1E4G T;  1IH7 A;  3LDL A;  3QIO A;  3ZSR A;  2D0O A;  3DXK A;  4CK1 A;  2O8D B;  1XHX A;  3AAR A;  1HNX K;  4QCL A;  4DV1 K;  4L3Q A;  3T1Y K;  3CC2 N;  1RDD A;  1FJG K;  3F9M A;  3PV8 A;  1CLQ A;  4MFB A;  4I6M A;  3BUZ B;  4C8N A;  1NOZ A;  1V4T A;  4B1V A;  2V52 B;  3PO4 A;  3VES A;  4UY8 O;  3E1Y A;  3VQQ A;  1K8K A;  5E84 A;  3DWL A;  2W6K A;  3WNF A;  2ZE2 A;  4K25 A;  4IG0 A;  5KQ8 A;  3OS1 A;  1HX1 A;  1OKJ A;  2A6A A;  1SV5 A;  3K0S A;  4FWR A;  4M3X A;  5FRO A;  4PY5 A;  1BI4 B;  3ZX0 A;  2NRX A;  5AQS A;  3LDN A;  4LFC K;  4NLB A;  4NYF A;  3OYF A;  3JSM A;  1FW6 A;  4QS8 A;  4NB4 A;  2HBJ A;  2O8F A;  3N4P A;  3S3N A;  3PX4 A;  5BRF A;  3AGK A;  4C1N I;  2HBL A;  3K9K A;  4FLX A;  1ZBL A;  2W6L A;  3O80 A;  4FVM A;  4H5N A;  4O5F A;  2HF3 A;  4E1J A;  4M41 A;  2O8B A;  4FSV A;  4CW7 B;  4ELU A;  3MED A;  4IDK A;  1GLA G;  3THY A;  1DLO A;  2RPI A;  3MX2 A;  3L2R A;  4E7L A;  5AQI A;  4CF9 A;  3C0B A;  4JKC A;  3RSE B;  3OBY A;  1VSK A;  1J5E K;  4B3M K;  4YOV A;  4FZX C;  3AA5 X;  2RN2 A;  5BPM A;  5CZ2 A;  2HHH K;  5TKW A;  3AVC A;  5B8H A;  3RWU A;  1VK0 A;  1V4S A;  4CJ7 A;  3JYT A;  2A1S A;  3KK1 A;  4PA1 A;  4JI7 K;  4X66 K;  1KD1 O;  3V9Z A;  1NGB A;  4NXM K;  3EKU A;  3HTV A;  4ELT A;  4FLV A;  1OVY A;  1KTQ A;  1S1T A;  1J54 A;  4J2A A;  4FW1 A;  4DMN A;  1KRP A;  1RBV A;  3UB5 A;  2A41 A;  3BZC A;  5HRS A;  4A5A A;  1SKS A;  4CJR A;  3OYL A;  3MWP A;  2UUC K;  5GIP A;  3TU5 A;  4AHU A;  1N8R O;  3O3F A;  4O8K A;  1VQ5 N;  3L2W A;  1QS4 A;  2Y1I A;  3ATU A;  2BAN A;  2QA4 N;  4GMJ B;  4B8A B;  4C8M A;  2QI2 A;  5E26 A;  4GV3 A;  4WQ5 A;  1HYZ A;  4F2R A;  3FR0 A;  4HTU A;  2X6S A;  4Z4G A;  1J6Z A;  4E89 A;  3ZEU B;  4Z4C A;  1BWF O;  2F9T A;  2P9P A;  3J80 O;  1O13 A;  2KQ2 A;  4BDP A;  4FPA A;  4FJI A;  3N4Q A;  4RCH A;  1XWL A;  2GBZ A;  1LOT B;  4DR1 K;  1RT7 A;  1XUP O;  2GEM A;  4JHD B;  3AA4 A;  1C1A A;  3EE9 A;  2R7Y A;  4YHH K;  5LMN K;  3RMA A;  1XC3 A;  4JKD A;  4PL7 A;  3QEP A;  2P5G A;  3ZET B;  2OCE A;  2VGM A;  4JLH A;  4CD1 A;  3MCP A;  3AA3 A;  3V6D A;  4CJU A;  4WFN L;  4NO7 A;  3SMP A;  1B9F A;  3NDK A;  2NRT A;  3DLB A;  3KWG A;  4BRF A;  3C7N A;  4PQU A;  4DU1 A;  2EHG A;  3O1W A;  5HRP A;  4FWL A;  2E20 A;  2RHK A;  4E7J A;  4KAZ A;  3WXK A;  3H1Q A;  1TAU A;  4JI3 K;  1N6Q A;  1SL2 A;  3CER A;  3PIO L;  3ZT4 A;  4JEP A;  1QVF M;  4FK0 A;  4JRP A;  4N47 A;  4BRP A;  3KLH A;  4EP5 A;  4IFY A;  3SQ0 A;  3E01 A;  3J7A P;  4DUY K;  3LP0 A;  4PKH A;  3K5L A;  1BGX T;  1SKR A;  1VRT A;  2IGI A;  5AR0 A;  4KHP K;  3VGL A;  1WLJ A;  1RT5 A;  4CCH A;  5LJV A;  2D0P A;  3IFR A;  4CBX A;  3DMJ A;  1JL2 A;  1L3S A;  2OA8 A;  4DF4 A;  2HB5 A;  2I7P A;  4CJV A;  2VYP A;  1XNR K;  4DUZ K;  3CCE N;  1U4B A;  1RTD A;  5EY4 A;  2ZGY A;  3BF3 A;  1MDU B;  1HQU A;  1R0A A;  1ITG A;  3VQ6 A;  2CGJ A;  3M8P A;  4BE0 A;  4DR2 K;  4BC5 A;  3MN6 A;  1WSJ A;  4CJE A;  2P9U B;  4BR4 A;  2HHU A;  1JLC A;  5AZI B;  4ISG A;  4CZJ A;  5KPR A;  3ZSY A;  2P9S B;  1YAG A;  1RT3 A;  3BP8 A;  1TYQ A;  1ATS A;  3ZSW A;  5JIC A;  3TTD A;  4CF1 A;  4BRL A;  1QHT A;  3U3G A;  4DSE A;  3U9D A;  2NRH A;  3ZT2 A;  5AQW A;  4CFC A;  4NCA A;  3AVH A;  1KAX A;  5MLC Q;  4DQQ A;  1NGF A;  1FXX A;  4H4M A;  1HYV A;  5FLX O;  2AP1 A;  4E1N A;  4J2B A;  3OJU A;  2BE2 A;  3CM6 A;  2ZWH A;  3H6E A;  4FWP A;  3CPW M;  3AVK A;  4BRK A;  1WSI A;  4KPY A;  5AQZ A;  1UA0 A;  4F4K A;  1BUP A;  4DTJ A;  4PKI A;  5T7B A;  4CJ4 A;  1X9S A;  2KLA A;  4FJN A;  3MK6 A;  1TKZ A;  5AQF A;  4CES A;  4CHP A;  4I2P A;  1N33 K;  4JKE A;  2ZJP L;  1B9D A;  4XIU A;  4A2A A;  4FZZ A;  2E6L A;  3VQ9 A;  1GLJ O;  1YIJ N;  1RT6 A;  3A0I X;  3LZJ A;  4DWI A;  3H45 C;  4MLH A;  3HVT A;  1BG3 A;  4C23 A;  1TVR A;  4IJA A;  3BF1 A;  5KQD A;  4BGA A;  4W5Q A;  3T69 A;  3QDK A;  1YF5 L;  4CK3 A;  5K14 A;  1Q8I A;  2ASM A;  3O1B A;  1WSE A;  4JD2 A;  1U49 A;  3HXM A;  2QEX N;  2Q31 A;  4JKB A;  1YTA A;  4WQ4 A;  3MN5 A; 
#chains in the Genus database with same CATH homology
 2Q36 A;  5HOO A;  3VTH A;  1ATN A;  1S3X A;  4BG8 A;  4RWT A;  1T44 A;  1WOQ A;  2F9W A;  1NGI A;  5BRD A;  2VCP A;  4A2B A;  5AQY A;  3O08 A;  4OPA A;  5GIO A;  5F0X A;  3NVM A;  5JVG L;  1TYQ B;  4WFB L;  3M6G A;  1NBW A;  3C6H A;  3WQT A;  3UKU A;  2JWK A;  3CIP A;  4CBU A;  1Q82 O;  2A5X A;  3EE8 A;  3MWT A;  3EKS A;  4BQZ A;  3C65 A;  2E8A A;  4K41 A;  5M1Q A;  2NRZ A;  1K73 O;  4DCH A;  5CHI A;  4EAH D;  2P9L A;  3TPQ A;  3FZM A;  3D2E A;  4IEI A;  4BR2 A;  2QWN A;  3KZB A;  1KAY A;  3FZL A;  3VGK A;  3FZH A;  4OPH A;  4PHT X;  2GWJ A;  4G9Z A;  3D2F A;  5M1K A;  5GAD P;  3HZ6 A;  3FGU A;  5AQL A;  4EHT A;  5AQO A;  3VF4 A;  4BY9 C;  4YOW A;  1W97 L;  5FPN A;  1YI2 N;  5C15 A;  3CMA N;  1C0G A;  4BVO A;  4CZF A;  1YXQ A;  3ID8 A;  5AZJ B;  2NLX A;  1NWK A;  3I55 N;  3LM9 A;  2BH1 A;  2QWR A;  5C10 A;  2VWB A;  2UYT A;  2E2P A;  1VQ6 N;  2WC9 A;  3ID6 A;  1YHQ N;  3HSC A;  5EX5 A;  3DAW A;  3VER A;  4BG9 A;  3SJH A;  5BRH A;  1DKG D;  5FPD A;  4GV9 A;  5BPL A;  3O9R A;  1DGK N;  3HOS A;  3CJA A;  4BRN A;  3SAH A;  1U2V B;  2V7Z A;  3CC7 N;  3O6W A;  2QW9 A;  1RGI A;  1QQM A;  3TTC A;  2GTD A;  1Y64 A;  2GUP A;  4FPB A;  5DM6 L;  3Q7C A;  4GVE A;  4YOU A;  4CD3 A;  4U7B A;  4BRO A;  2KKZ A;  3A5L C;  2A42 A;  1S22 A;  3C6A A;  1YIT N;  4YOT A;  3LDO A;  3SAG A;  1ESV A;  4XH1 A;  1YUW A;  2D1K A;  3WXL A;  1QHA A;  3AAQ A;  3L4Q A;  1LCU A;  4BRA A;  4BRH A;  3NVK A;  3ENO A;  4YDU A;  3FE1 A;  4B1Y B;  3G4S N;  2Q1N A;  2RE2 A;  4KH4 A;  4CZH A;  3UKR B;  4WFA L;  1QZ5 A;  4B1W B;  1Q86 O;  5M1P A;  2W40 A;  4F9O A;  4IOC L;  1SZ2 A;  4BRQ A;  2E2Q A;  2P9I B;  3AGR A;  3H1V X;  2QWP A;  3AAP A;  1VQ8 N;  3T7Z A;  1ZBS A;  1IJJ A;  1R59 O;  3A8Y A;  3TSP A;  1X3N A;  4JD2 B;  2PBD A;  1HJO A;  2HBM A;  2EWS A;  5LY3 A;  1Q7Y O;  1MA9 B;  1EQY A;  1P8Z A;  2I7N A;  3A5M C;  4JAX A;  3CCJ N;  1M90 O;  3OA9 A;  4IWV A;  4BR9 A;  1D4X A;  4FWS A;  4DHY A;  3R3L A;  4M7X A;  3F5T A;  3IUC A;  3S41 A;  5F1X A;  4MO4 A;  3VET A;  5AQX A;  4NLC A;  1Z05 A;  4JKF A;  4PKG A;  3VPZ A;  3Q7B A;  5M1O A;  5AQK A;  4BGB A;  3RSE A;  1MWK A;  1ATR A;  2P9L B;  1TUY A;  4GNI A;  3VEN A;  3TSU A;  2AA4 A;  5C12 A;  5KPZ A;  3CXC M;  1GLC G;  3VF6 A;  1BA0 A;  3D2E B;  1BU6 O;  4A62 A;  3IKM A;  3GE1 A;  4CZI A;  3MDQ A;  5BPN A;  3D2F B;  1GLL O;  3CCU N;  1T6D A;  3ZYY X;  4BR5 A;  5ADX H;  3TTF A;  5JLH A;  2V51 B;  4FL9 A;  1JCG A;  1E4G T;  3LDL A;  5AQN A;  3G71 N;  3E9P A;  4RTF D;  2D0O A;  3DXK A;  3F2K A;  3CCM N;  3CF5 L;  3P4I A;  3M5R A;  1MWM A;  5GIN A;  2Q0U A;  3AAR A;  3SK3 A;  3HOT A;  5GAE P;  3NMU A;  4L3Q A;  2Q97 A;  5DM7 L;  1YVN A;  2E2N A;  3OW2 M;  3CC2 N;  3H46 O;  3F9M A;  4BR0 A;  4I6M A;  1G99 A;  3BUZ B;  1V4T A;  3O9S A;  4B1V A;  2V52 B;  3VES A;  4UY8 O;  2YI1 A;  3E1Y A;  4H5R A;  1K8K A;  3VMF B;  5E84 A;  4H0X B;  3I33 A;  1YJ9 N;  3DWL A;  1HPM A;  4B1U B;  4YOX A;  4K25 A;  5I9E B;  5KQ8 A;  3OBW A;  2WUS A;  3IDH A;  1HX1 A;  3HBT A;  4BRI A;  3M3Z A;  1OKJ A;  4Z94 A;  2A6A A;  1ILY A;  3O5B A;  4FWR A;  5BR9 A;  2OTL N;  1GLB G;  1GLE G;  1VQO N;  5M1F A;  3VF2 A;  3E66 A;  3ZX0 A;  2NRX A;  4K42 A;  2HBK A;  1VAZ A;  2FF6 A;  3LDN A;  4JKH A;  5AQS A;  2QWQ A;  5CE3 A;  3ZEU A;  4ISF A;  2CH5 A;  3MMV A;  4NLB A;  4BC4 A;  4BQL A;  4LC9 B;  4QS8 A;  2P9N A;  4NB4 A;  2HBJ A;  3CJC A;  3N4P A;  5BRF A;  3AGK A;  5H1S Q;  4C1N I;  1NGC A;  3CET A;  3EL2 A;  2HF4 A;  2HBL A;  3CJB A;  3K9K A;  4J8F A;  4JHD A;  4B1Z A;  3O80 A;  2V7Y A;  3GL1 A;  2IVP A;  2NRV A;  4MO5 A;  5AQJ A;  4H5N A;  1CZA N;  4O5F A;  3H3N O;  3ZX3 A;  3E9L A;  2HF3 A;  4E1J A;  4EHU A;  4GY2 B;  4FSV A;  3UE5 A;  3KVG A;  3ZET A;  2FLO A;  5M1N A;  2ZJQ L;  1GLA G;  3KK7 A;  3WXJ A;  1KC8 O;  3O9Q A;  1SAZ A;  3MX2 A;  3CJ9 A;  5AQI A;  3VTI A;  1JCF A;  3C0B A;  3O9U A;  4FWM A;  1NGJ A;  4YDU C;  4JKC A;  4B1X B;  4ILG B;  2ZF5 O;  3RSE B;  3OBY A;  4IOX A;  3MN9 A;  1NGG A;  2GWK A;  5AQH A;  4BC2 A;  1ZC6 A;  3E9O A;  4YOV A;  1S72 N;  5BPM A;  1Q18 A;  4MDB A;  1K8A O;  5TKW A;  2ITM A;  3B8A X;  4DKW A;  1HUX A;  1KAZ A;  4CZG A;  3GBT A;  5B8H A;  3MCA B;  3VEX A;  5LJW A;  4JNE A;  1VQM N;  1V4S A;  3LL3 A;  3CCQ N;  1GLD G;  4JK8 A;  3DXK B;  4CJ7 A;  1E4F T;  2QXL A;  3FLC O;  3VEZ A;  5HL7 L;  1T3V A;  4HWI A;  2GEL A;  1KD1 O;  3WXM B;  3HM8 A;  3VEW A;  3CCR N;  3GDQ A;  4FO0 A;  5F2R A;  1NGB A;  1IG8 A;  2W41 A;  3EKU A;  3HTV A;  5AQM A;  2A3Z A;  2QM1 A;  1OVY A;  4I6M B;  4FWO A;  2P9K A;  3QML A;  2BTF A;  2A41 A;  3UB5 A;  1TUU A;  3LDP A;  3U8X A;  4A5A A;  3CD6 N;  1K8K B;  3L4I A;  3MWP A;  4ISE A;  4WQ5 C;  5AFU A;  5GIP A;  3TU5 A;  3FFK B;  1N8R O;  4O8K A;  1VQ5 N;  2YHY A;  4IOA L;  4H0V B;  3ATU A;  4BRC A;  2QA4 N;  3DJC A;  3G6E N;  3LDQ A;  3WUH A;  3SBT A;  2QI2 A;  4H5W A;  5E26 A;  2QWL A;  4GV3 A;  4WQ5 A;  4FWK A;  4IO9 L;  1HKB A;  3FR0 A;  3RVC A;  1YJN N;  4IXC A;  3WEE A;  1J6Z A;  4H5T A;  3ZEU B;  3KHY A;  3O8M A;  1BWF O;  2E1Z A;  2PAV A;  2F9T A;  3VGM A;  5JMV A;  2P9P A;  4BVP A;  2HMP A;  3L0Q A;  2P9N B;  4B9Q A;  4FOI A;  4JN4 A;  1O13 A;  1BDG A;  4FVU A;  2BUP A;  3FZF A;  4FPA A;  4YOY A;  3N4Q A;  3MN7 A;  4RCH A;  3VEV A;  3JS6 A;  1JJ2 M;  5KPT A;  3PLA A;  5AQV A;  4FOE A;  4EFH A;  1LOT B;  2WBN A;  1NGE A;  1XUP O;  2GEM A;  3R6M A;  4H0Y B;  4JHD B;  4BRG A;  3EE9 A;  2J4R A;  4A59 A;  3SLC A;  5AQP A;  5CR4 A;  4CZK A;  1XC3 A;  4JKD A;  4PL7 A;  1GLF O;  1RFQ A;  2P9U A;  3P39 A;  3ZET B;  5AZI A;  3VOV A;  2VGM A;  5AFU H;  4CD1 A;  3MCP A;  2FSJ A;  4DB3 A;  3DXM B;  4QS7 A;  2P9S A;  2FF3 B;  3D6R A;  4A5B A;  1W2B M;  4U67 L;  4WFN L;  5AQQ A;  4DQ8 A;  5AQG A;  1C0F A;  2QTD A;  4NO7 A;  3WXI A;  3SMP A;  4JK7 A;  4Y0W A;  1HKG A;  1NGD A;  3CQY A;  3WT0 A;  1Q81 O;  2NRT A;  1K9M O;  4IDH A;  3KWG A;  4BRF A;  2FSK A;  5EXW A;  2NNW A;  5BN8 A;  3CCS N;  4YOR A;  3C7N A;  1NLV A;  5BN9 A;  3GG4 A;  3QBX A;  3O1W A;  2DPN A;  3ENH A;  4FWL A;  2E20 A;  2RHK A;  2WFB A;  4AM7 A;  4ILH A;  3H3O B;  4H0T B;  1NGA A;  4JKG A;  3WXK A;  4MDA A;  3CHW A;  3ULE A;  3H1Q A;  1VQ7 N;  4JKA A;  2YHW A;  2OAN A;  3CER A;  3PIO L;  1QQN A;  3W3D A;  5AQU A;  3PIP L;  4JEP A;  2FSN A;  3LM2 A;  2P9K B;  2YX6 A;  1H1V A;  3MX5 A;  1QVF M;  1VQN N;  1QZ6 A;  1SS6 A;  1ZXO A;  3A5O C;  3CJ7 A;  4BRP A;  1BA1 A;  4H03 B;  2YJE A;  3OHR A;  2Q0R A;  1X9J A;  3U4L A;  3IMX A;  3I56 N;  4PKH A;  4H0P A;  3SBG A;  3VEO A;  2Q2R A;  3DXM A;  4WYB A;  5AR0 A;  1NM1 A;  3VGL A;  4FWN A;  3TSQ A;  4XH5 A;  4BRD A;  1BOT O;  2JWL A;  5GAH P;  5LJV A;  3JXU A;  2D0P A;  2KHO A;  3WEE B;  2CGK A;  3IFR A;  1T6C A;  3EO3 A;  4FWQ A;  4CBX A;  1VQK N;  4A57 A;  4CZL A;  3CQX A;  1QVG M;  4R79 A;  5ELZ A;  4BRM A;  2P9P B;  2I7P A;  3O4W A;  2HOE A;  2NRW A;  3GOI A;  2QWO A;  1DT9 A;  1JCE A;  5C0Y A;  2VYP A;  4H0O A;  3BEX A;  3CCE N;  3J8A A;  3EZW A;  5EY4 A;  2ZGY A;  3AY9 A;  3BF3 A;  1MDU B;  4PL8 A;  3KWI A;  3J7Z O;  4C1N K;  3I8B A;  4ILJ A;  4M63 C;  2CGJ A;  2FXU A;  2F7T A;  3P38 A;  3QBW A;  5BRE A;  5EVZ A;  1BO5 O;  1RDW X;  1RDU A;  5C2F A;  4BC5 A;  2E1Y A;  3MN6 A;  1VQP N;  1YJW N;  3WQU A;  2P9U B;  5EOY A;  3R9P A;  4BR4 A;  4WF9 L;  4GV6 A;  5AZI B;  4ISG A;  4JK9 A;  4CZJ A;  5KPR A;  3CI5 A;  5FPM A;  4A61 A;  5GAG P;  2P9S B;  1YAG A;  3QIC A;  3SAF A;  2YCH A;  3CCV N;  3BP8 A;  2NZT A;  1TYQ A;  1KXP A;  1ATS A;  4HTL A;  1P90 A;  3W0L A;  5JIC A;  4WCE L;  3TTD A;  4KBO A;  4BRL A;  4OO1 J;  2NRR A;  3U9D A;  1VQ9 N;  2NRH A;  3ZX2 A;  5AQW A;  3C7N B;  1X3M A;  1KAX A;  1NMD A;  3L6Q A;  3O9T A;  5MLC Q;  3G25 A;  2IVN A;  2ASO A;  1SQK A;  4CBW A;  3CJ1 A;  4CZM A;  5FPE A;  1NGF A;  4XH4 A;  2ZGZ A;  3U9Z A;  3CC4 N;  5AQR A;  4JKG B;  5AZJ A;  3QB0 A;  3ULE B;  3ATV A;  2AP1 A;  3H6E A;  1WUA A;  2ZWH A;  4FWP A;  4EIA A;  3CPW M;  2H3G X;  2QWM A;  1EO1 A;  4M7Y A;  4O8U A;  4BRK A;  5AQT A;  2HST A;  2D4W A;  4IEE A;  5ADX A;  2VGN A;  3ENB A;  5AQZ A;  2A40 A;  4BRE A;  2YHX A;  1Z6R A;  4IFE A;  1BUP A;  1U2V A;  4KH6 A;  4PKI A;  4BR7 A;  3M1F A;  3UKU B;  2KLA A;  1DEJ A;  2E2O A;  3MK6 A;  3A5N C;  1M1K O;  2YJF A;  3P31 A;  3EN9 A;  1VQL N;  2OTJ N;  3D7E O;  5AQF A;  1NGH A;  4BC3 A;  2ZJR L;  4CZE A;  4JKE A;  3DLL L;  4AF1 A;  2IVO A;  3HI0 A;  2ZJP L;  2CGL A;  3CME N;  4A2A A;  3CCL N;  5TKY A;  1GLJ O;  2IIR A;  1YIJ N;  4IJN A;  1VQ4 N;  1NJI O;  3A0I X;  3H45 C;  4MLH A;  4IO8 A;  3R1X A;  1BG3 A;  4H5V A;  2GX9 A;  4C23 A;  4IJA A;  3BF1 A;  3K9J A;  4BGA A;  5KQD A;  3UKR A;  4IZ9 A;  3FZK A;  1HLU A;  4WQ4 C;  3T69 A;  5C2D A;  1QQO A;  3QDK A;  2PFU A;  1HKC A;  3CPE A;  2CH6 A;  3VEY A;  1U6Z A;  2P9I A;  1YF5 L;  4K43 A;  3QFU A;  5JVH L;  2ASM A;  3O1B A;  4AM6 A;  4CI6 A;  1XQS C;  1KQS M;  4XEI A;  3SMS A;  4JD2 A;  4MLE A;  3HRG A;  4KH5 A;  5JLF A;  2QEX N;  2Q31 A;  4QS9 A;  2ASP A;  3QFP A;  4JKB A;  3R8E A;  4WQ4 A;  2E88 A;  3MN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...