4BVOA

Legionella pneumophila ntpdase1 crystal form vi (part-open) in complex with polytungstate pom-1
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
356
structure length
356
Chain Sequence
PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Legionella Pneumophila Ntpdase1 in Complex with Polyoxometallates.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 112
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bvoA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4bvoA02
3VPZA 5BRHA 3GBTA 3LDQA 1D4XA 3WT0A 1NGHA 4IJNA 2YHXA 4BR4A 3I33A 3LL3A 1C0FA 4BRKA 4WQ4C 4BRHA 4AM6A 2F9TA 4RTFD 3ZX3A 3MN5A 4BR9A 3BP8A 2A6AA 4IXCA 4CZHA 2BTFA 2P9SA 4BRLA 4EAHD 4FWRA 3J8AA 3L0QA 3OHRA 4FO0A 1NMDA 1K8KA 3CJ1A 4IZ9A 2CGJA 1NLVA 3H6EA 5FPNA 1MDUB 2E8AA 3CETA 2UYTA 4FWKA 5AZIA 2V7ZA 2FXUA 2ZGYA 3O6WA 2HMPA 5FPDA 3AY9A 2AA4A 3SLCA 1J6ZA 5F0XA 5AQUA 2W41A 3ENOA 5KPZA 4XEIA 2QWPA 3CQYA 5EX5A 5BRDA 2OANA 2ASOA 1S22A 2CGLA 3HBTA 1JCEA 1Z05A 3QDKA 4B1YB 4CZJA 4B9QA 2YCHA 2GEMA 4IWVA 2CGKA 2QWQA 3QFUA 4L3QA 4BVOA 1T44A 1KAXA 5AQTA 1DGKN 4HWIA 1GLBG 3EZWA 1HX1A 3D2EB 4F9OA 3O08A 2Q1NA 4FPAA 5BRFA 4WQ4A 4M7XA 1Z6RA 1P8ZA 3AAPA 4CJ7A 3FFKB 1C0GA 3RSEA 1NGFA 4WQ5C 1BO5O 5JICA 3BUZB 5BPNA 1H1VA 2YJEA 5EXWA 4CBXA 2Q2RA 5ADXH 4FWLA 3L6QA 5BN9A 2P9UB 3KHYA 1CZAN 3G25A 4RWTA 3R6MA 5AQSA 1E4FT 2FSJA 1G99A 1QQNA 3MN7A 2D0OA 4BRGA 5JLHA 4O5FA 3MK6A 5AQGA 2WUSA 3ENHA 1YXQA 1NGIA 1GLJO 4ISFA 2W40A 3VEXA 4FWNA 3GDQA 4FSVA 4WYBA 2P9SB 3SK3A 2QWOA 1ESVA 4BG8A 3QBXA 3O1WA 1TUYA 3R8EA 1X9JA 4CI6A 5AQFA 3LDLA 5AQKA 3CERA 3H1VX 3EKSA 4K41A 1DEJA 1U2VB 3LDNA 3WXKA 4YDUC 4H0XB 4EFHA 4H5NA 3CIPA 3VESA 2D1KA 3D2FB 4PL7A 3DXMA 5E84A 3HI0A 3IMXA 4BRIA 4AM7A 1MWKA 5AQYA 2EWSA 3D2EA 4B1XB 3VETA 1X3MA 3W3DA 2P9IA 1BOTO 3F9MA 4BC3A 2P9NB 1JCFA 1XQSC 3MCPA 3O8MA 5FPEA 3UKUA 1QQOA 2Q36A 2QXLA 4XH1A 3QMLA 3ZX0A 4BVPA 5JMVA 3FZKA 3HM8A 1DKGD 2GELA 2P9KA 3AARA 3VGKA 4JHDA 4M7YA 4CZIA 3TPQA 4RCHA 4CZGA 3WXIA 5KQ8A 4B1VA 4PL8A 2P9IB 4QS7A 5AQHA 1YVNA 1Q18A 3WEEB 5AQWA 5EY4A 2D4WA 3BEXA 5I9EB 4H0OA 3MDQA 3A5MC 5LJWA 3ZETB 5FPMA 1GLAG 3VEVA 5AQRA 4C23A 5KPRA 4CZKA 4BRNA 3GG4A 2A3ZA 1XUPO 3ID8A 2Q0RA 4JD2A 1U6ZA 3FE1A 3IUCA 3ZETA 2DPNA 5F2RA 5EOYA 4CZEA 2V51B 2GWKA 4BR5A 2P9PB 3QB0A 1BA0A 4FWQA 4H0PA 4I6MB 2NLXA 4ISGA 1HPMA 1LCUA 4CZMA 2QWRA 4BRCA 1BU6O 3IDHA 2GUPA 1HJOA 2CH5A 4BRFA 4BREA 3BF3A 4MO4A 1RGIA 1GLLO 3WXLA 2FF3B 3C7NA 1NGDA 3EO3A 4BQZA 2P9PA 1GLEG 4BR2A 1YAGA 4MLEA 1NM1A 5ELZA 3A5OC 4PKHA 3RSEB 1T6DA 5AQJA 2IVOA 5E26A 4WQ5A 3DXKB 3LM9A 1TUUA 5AR0A 2E2NA 2A42A 3GOIA 4JAXA 3FZFA 1V4TA 3CJ9A 4H0VB 3CJAA 3GE1A 3VEWA 1K8KB 3VERA 3C0BA 3QFPA 1ZC6A 4K43A 4BROA 2YHWA 4B1UB 3M6GA 2IIRA 3FGUA 1MWMA 1TYQA 3JXUA 5AQIA 2F9WA 1QHAA 3ZEUA 3FR0A 3U4LA 3U8XA 5F1XA 4CBWA 5ADXA 4EHTA 4IO8A 5AZJB 1ATSA 2VYPA 1OKJA 3H3OB 4K25A 4Z94A 2A40A 2P9LB 1QZ5A 1BDGA 5AQQA 4ISEA 1KAYA 3S41A 4BR7A 4YDUA 3C7NB 2ZGZA 3ZX2A 4QS9A 3LDPA 1S3XA 5AZIB 2E2QA 3SMPA 2QW9A 4H5VA 5AQPA 3M1FA 3WEEA 1RFQA 2ZWHA 2FSKA 3CHWA 2NZTA 3HSCA 3AAQA 4FWOA 4H5WA 1EQYA 2YI1A 3VEOA 1JCGA 1U2VA 4H5TA 3WXJA 1KXPA 1IG8A 1T6CA 2E2OA 3O5BA 3WUHA 4A61A 2QWNA 4DQ8A 2ITMA 4BGBA 5LJVA 4HTLA 2GWJA 1HKGA 3EL2A 3EN9A 3UKUB 1TYQB 1BG3A 1ATRA 3SJHA 4BRQA 3CJBA 2FLOA 4MO5A 4NB4A 3IFRA 4A62A 2GTDA 3B8AX 3VF2A 3W0LA 3TU5A 1GLFO 2H3GX 3DWLA 2NRHA 4JD2B 1SZ2A 3H3NO 3H45C 3DXMB 4H0YB 4BG9A 4EIAA 2QM1A 3A5NC 4H03B 3UB5A 2E1ZA 4FWSA 4FOEA 5AQOA 3LDOA 3R9PA 3CJCA 2HOEA 3ATVA 4IJAA 3VF4A 2A41A 2J4RA 3U9DA 1GLCG 1YUWA 1QZ6A 2ASMA 4M63C 4PKIA 5BPMA 4A2BA 1NGAA 3ULEA 1Y64A 4CD3A 5KPTA 2P9KB 4FPBA 2QWLA 2AP1A 2P9LA 4MLHA 4EHUA 2YJFA 1NGCA 4LC9B 4QS8A 5AQVA 1BA1A 5BPLA 3QICA 3WQUA 2QWMA 1WUAA 1V4SA 2ASPA 3D7EO 3A8YA 4BR0A 3ZEUB 2FSNA 3FZHA 3H46O 4FL9A 3WQTA 4BRDA 3HZ6A 3MMVA 5B8HA 1NGGA 3JS6A 1RDWX 2ZF5O 1HKBA 3FZMA 3EKUA 3CI5A 2HF3A 3VEZA 3VOVA 4CD1A 4XH4A 5AFUH 1X3NA 2BUPA 3LM2A 2E88A 4FWPA 5EVZA 4H0TB 3GL1A 3DXKA 3VENA 4FOIA 5TKYA 2VCPA 4BRAA 3FLCO 4B1WB 3UE5A 2D0PA 1NGJA 3H1QA 3HTVA 5AFUA 4H5RA 3CQXA 3L4IA 2FF6A 3MN6A 4DCHA 4JN4A 3VF6A 3BF1A 1WOQA 1SAZA 3U9ZA 1ATNA 3MN9A 3VGLA 5BREA 4DB3A 2IVNA 2I7PA 1ZXOA 2KHOA 1NGBA 1NWKA 3A5LC 3DJCA 2P9NA 1ZBSA 3O80A 3KZBA 1SQKA 1HUXA 3O4WA 1XC3A 2V52B 4NO7A 2A5XA 4BRPA 4CZLA 2I7NA 4I6MA 3VGMA 3UKRB 2CH6A 5AQMA 4BGAA 1BUPA 4BC4A 2Q31A 2V7YA 1IJJA 2E20A 4GY2B 3CJ7A 2Q0UA 4O8KA 3KVGA 5AQNA 1NGEA 1NBWA 3D2FA 1KAZA 4KBOA 3O1BA 5BR9A 4BC5A 4BQLA 5AQZA 4A2AA 1R59O 1MA9B 4CBUA 3UKRA 4B1ZA 3P4IA 2E2PA 1HLUA 4JHDB 4JNEA 5AQLA 3VEYA 1LOTB 4PKGA 4BRMA 2E1YA 4J8FA 3DAWA 4CZFA 2P9UA 3ATUA 4K42A 5BN8A 4GNIA 5KQDA 4XH5A 3ULEB 5LY3A 2IVPA 2PBDA 1QQMA 2YHYA 4BC2A 1HKCA 1E4GT 1GLDG 2HF4A 3SMSA 3M3ZA 2VWBA 3I8BA 4E1JA 2Q97A 3QBWA 5CE3A 5AQXA 4FWMA 1BWFO 3A0IX 3FZLA 2PAVA 4DHYA 5JLFA 5AZJA 4Y0WA
chains in the Genus database with same CATH superfamily
5BRHA 3LWLA 3WT0A 4FLVA 1NGHA 4WQ4C 2WC9A 4FW2A 4BR9A 2UUCK 1HYVA 2NNWA 1DLOA 4CEBA 3SUNA 4C8LA 1A5WA 1JL2A 1OVQA 2O8FA 3J8AA 1BIUA 4FO0A 3SV4A 1K8KA 3CJ1A 1VQ6N 4CHNA 4GW6A 5C24A 3ZT1A 4DLGA 4M45A 3ISNC 2GX9A 3EE9A 2HMPA 5FPDA 3AY9A 1J6ZA 4DQSA 4DTSA 2W41A 5FRNA 3IKMA 4B8CA 4XEIA 1X1PA 1YJ9N 2HNDA 2QWPA 5BRDA 2HHQA 2ASOA 1B9DA 3C65A 1KQSM 4OKJA 2ETJA 4EP5A 4I9LA 2BE2A 4BVOA 4DR3K 3P38A 3NH2A 1NMNA 5AQTA 4F2RA 3HVRA 2BANA 1RBRA 1GLBG 2X6SA 3D2EB 3J7YP 4J2EA 1J53A 2Q1NA 1SV5A 3NAEA 1HMVA 4HUFA 1VQNN 1C0TA 2PFUA 1VQ4N 2G8KA 1QS4A 1K8AO 4KKOA 1K73O 3E9LA 4X64K 3R3LA 4CBXA 2Q2RA 1W97L 5ADXH 4LF7K 3KHYA 1CZAN 2GV9A 3R6MA 2XY7A 1QE1A 3HM9A 4CK2A 1E4FT 2D0OA 4BRGA 4JRPA 4DF4A 5K14A 2B6AA 3CM5A 4LFCK 4FWNA 4KRFA 4WYBA 1KLNA 1RDAA 3SAFA 4A59A 5AQFA 4DV7K 1WAJA 3HPHA 1NJIO 1U2VB 2EHGA 4E89A 2FBYA 4H4MA 1VQMN 5CR4A 3M8SA 1X3MA 2VG5A 1BOTO 3CCSN 2P9NB 5C10A 1Q8IA 4FLTA 1XQSC 3O8MA 1NNEA 2Q36A 1WSGA 4NYFA 3P5JA 5HRRA 1TK5A 4Z4GA 4F4KA 3HM8A 4CF1A 3OS2A 2W42A 3VGKA 4FJXA 4CGGA 3O4NA 3HXMA 3FFIA 2P9IB 3MX2A 1YVNA 4IEIA 4LH5A 3NDKA 1S1VA 3BEXA 2X78A 4N5SA 2O8BB 4I9QA 4H0OA 3MDQA 2KFNA 4RG8A 1HNVA 3IS9A 4E7JA 3VEVA 2GUIA 4NCBA 3CCUN 1KTQA 2YHAA 3GG4A 2A3ZA 1ASWA 4U7BA 3ID8A 3VQ9A 4DTOA 4ILGB 5HOOA 1RTHA 3SQ4A 5F2RA 4LF4K 3KJVA 5D3GA 2FBVA 4B08A 3OYJA 1C1CA 3C94A 4BR5A 2P9PB 4ZTFA 3TAEA 1M1KO 1LWCA 1LCUA 4CZMA 2PZSA 3C6TA 1BU6O 4JLHA 3CCJN 3BF3A 2HSTA 1LAVA 1WLJA 1Z25A 3C7NA 3EO3A 4MLEA 4CJUA 1NM1A 1SL0A 3E9OA 3A5OC 3SUOA 1RT1A 2UXBK 4O4GA 4WQ5A 1WAFA 1TUUA 1YJWN 5FRMA 3QETA 1ITGA 4JAXA 1N36K 4DFMA 5LMUK 2HBLA 3RVCA 3TTFA 1K8KB 4JI3K 2VWKA 3QFPA 4K43A 3WNHA 4BROA 3HL8A 4K8ZA 3G10A 1TYQA 3KD5E 1QHAA 3WNGA 3ZEUA 1GOAA 3LZJA 1RT4A 3U8XA 2D5RA 1QVFM 5ADXA 4DR5K 2YV0X 1VQON 1X9SA 4JI0K 2P9LB 1RCHA 4DS5A 3C6HA 3RRGA 4ISEA 4U67L 2Y1JA 4DF8A 1QSYA 1RT2A 1S3XA 5AZIB 2E2QA 2IOCA 4JYAK 3M1FA 4AHRA 3ZSWA 2NZTA 1TVRA 4H5WA 3M8PA 1CZ9A 3AA3A 2YI1A 3VEOA 4E0DA 2HHXA 1KXPA 1LV5A 3ZSQA 4CJSA 4W5NA 1W9HA 3AVMA 3UKUB 3DI6A 4BRQA 1TYQB 4Q0BA 4MO5A 4NB4A 3IFRA 4A62A 5C12A 3W0LA 4CEOA 3LWMA 2QTDA 3ZSVA 1Q86O 1KD1O 4JD2B 2E5LK 4F3OA 4R79A 3H3NO 2A1RA 1XHZA 3RR7A 4Z4EA 3AVNA 4OKEA 3SYZA 4CF9A 4H03B 3UB5A 3ULDA 2E1ZA 3OYEA 2IAJA 5AQOA 3R9PA 2HOEA 4NLBA 4DMNA 3VQAA 2A41A 4C8MA 3DLKA 1W2BM 5J2PA 4PKIA 5CY4A 1Y64A 4O44A 5KPTA 3VQDA 4ZHRA 4MLHA 1CXQA 4B9MA 4CEDA 4QS8A 4W5OA 1BA1A 3QICA 4RW8A 3PX6A 5HROA 4A5AA 1WSEA 4B9SA 3OY9A 4QAGA 2W6KA 4KHPK 3ZSXA 3A8YA 4OGEA 1RBVA 2FSNA 1ZBIA 4CJEA 4LFAK 5B8HA 3SZ2A 1RDWX 2ZF5O 2HF3A 3K57A 3PV8A 2NRRA 5EVZA 4M3WA 5JVGL 3T1AA 4B3SK 2Z1IA 5TKYA 3E1YA 2VCPA 3CC4N 4H8KA 3T3FA 3CYMA 4B1WB 1UOCA 4JKHA 3UE5A 2D0PA 1TK8A 3PIOL 1L3UA 1VK0A 3HYFA 4DKWA 3AVLA 4JKGB 1X9WA 1BCMA 4C8OA 2IVNA 1YVUA 2I7PA 5HRPA 2ZM6K 3R1XA 4DFJA 5GAEP 5DK5A 2PY5A 1NKCA 4O55A 1ZBSA 1HUXA 3O4WA 1TKXA 4CZLA 5C0YA 3O9SA 4PWDA 4GVMA 4FJ7A 2CH6A 4CJ3A 5DM7L 4BC4A 4B3OA 1NKBA 1KC8O 5HL7L 3N4PA 2VQEK 4YFUA 3ZSRA 4E7KA 4O0JA 5LMNK 3O1BA 4FJKA 5BR9A 4A2AA 4DV4K 1MA9B 4JKBA 4CBUA 4CESA 1JLAA 2KLAA 2UUBK 3P83D 3K5NA 3QERA 3VMFB 4DTXA 4CE9A 3SUPA 3ZYYX 4J8FA 4AF1A 3EE8A 2D0AA 4CZFA 3L2VA 4DU4A 5BN8A 4NXNK 4DU1A 5LY3A 4JKCA 1QQMA 5LL6Z 3NH0A 3C6AA 1JLQA 4FJMA 4JKGA 1XMOK 4EZ6A 1Q81O 4E1JA 3I8BA 3MWTA 5AQXA 4FWMA 2OPRA 3ASMA 1U45A 4K0KK 1RTIA 4DHYA 5JLFA 3S3OA 4CGIA 5JS2A 3G6EN 4IKFA 4CEFA 4YNQA 4BR4A 4IJNA 2YHXA 2VQFK 4YHHK 4BDPA 3LL3A 1C0FA 4BRKA 4W5QA 3CFPA 2O8FB 4RTFD 3MN5A 2Q3SA 1NK5A 4CJLA 3KTQA 1IO2A 3CQ8A 4OVLA 2XO7A 1VSMA 1NK4A 3KLGA 1LW0A 3L0QA 4CEZA 1NMDA 4N56A 4CF8A 1KVCA 1IKWA 2CGJA 3DLEA 3AVFA 3LP0A 3CFRA 4IDHA 4BY9C 3KLIA 4CW7B 2ZGYA 3OTOK 2AA4A 3TTDA 1C6VA 4BE1A 3T19A 3KK3A 5AQUA 4DLEA 3CQYA 4C8NA 1QSLA 3B6OA 1JXBA 1S22A 4IFYA 2CGLA 4DWIA 3HBTA 1JCEA 1VQ5N 3QDKA 4B1YB 3VQ5A 1U4BA 3BDPA 2GEMA 4FM2A 3A2FA 3NHGA 3QFUA 1Q82O 3DRPA 4HUEA 3O9UA 3TAMA 3CM6A 2D0BA 3AO1A 2HBKA 2FBTA 2NRZA 4F9OA 4O0IA 2NRXA 4CJFA 3MEDA 3QEVA 1P8ZA 3AAPA 4FVMA 2HVHA 4MDBA 4KH4A 4JS4A 1VHXA 3VQPA 1NGFA 1BO5O 4HCBA 1HNWK 3TARA 3IAYA 3SAGA 5EU7A 3SI6A 1H1VA 5EXWA 3AVCA 3V9UA 3L6QA 2P9UB 4Z0UA 2P5OA 5AQSA 4F8RA 2FSJA 3THXA 3H08A 5JLHA 4PQUA 4OPJA 5HBMA 4Z4CA 5AQGA 3BZCA 2WUSA 4BE0A 2YHBA 3THWB 1YXQA 4N41A 1KFSA 1GLJO 1ZBFA 3MX5A 4BWJA 2KFZA 3VEXA 4CJQA 1VSLA 4DSEA 3CFOA 2P9SB 3OBWA 3SK3A 3PY8A 3QBXA 3R8EA 4HUGA 1X9JA 3RWUA 5AQKA 4FZYA 4AILC 3ZSYA 3LDNA 4H0XB 4H5NA 3VESA 3D2FB 2PYJA 2GBZA 3DXMA 3ITHA 3HI0A 5E84A 3PX4A 1SL2A 1SKRA 1KVAA 5AQYA 3D2EA 3OS1A 3OYCA 4B1XB 3VETA 3K5LA 3NF8A 3N4QA 3VQEA 4BC3A 3F9MA 3QNNA 4JI6K 1JCFA 3PX0A 5GAGP 3MCPA 3DLGA 1JLBA 2DY4A 4E7HA 3NVKA 2QXLA 3QMLA 3U6FA 1S9EA 4OX9K 2P9KA 3CCLN 4IDKA 2EX3A 1J9AA 3SBTA 4CZGA 5KQ8A 4N76A 1YT3A 4QS7A 3L2RA 1Q18A 4DQIA 4V19S 4DR4K 4IG0A 1NJXA 3AVJA 2D0CA 3J81O 2E6MA 4DV1K 4IOXA 1GLAG 3DOKA 3DLLL 3HP6A 5AQRA 4DSIA 1OVYA 4CZKA 1XUPO 4JD2A 1U6ZA 2NUBA 4DSKA 5EOYA 3HOSA 3RTVA 4E7LA 4NCGA 4KFBA 1WB9A 3RMAA 4Y1CA 2O8CB 1RNHA 1I3AA 1B9FA 1NOZA 3V81A 2GUPA 2CH5A 4BRFA 4DG1A 4BREA 2JWKA 2P5GA 3SBGA 3JAMO 1GLLO 3WXLA 2FF3B 4I2PA 1REVA 3G0ZA 3L2UA 5KI6A 4KHSA 3B6PA 4RW7A 1U48A 1HYZA 1T6DA 5KRTA 5GIOA 1A5VA 1J54A 5AR0A 1ZBUA 2E2NA 2A42A 1XNRK 1VQ7N 2KQ2A 4CECA 3KLHA 4H0VB 3GE1A 3VEWA 3VERA 3CCMN 1KLMA 1HQEA 4OJRA 3M6GA 2IIRA 3J7AP 3FGUA 1MWMA 3JXUA 3VQ8A 3NGIA 5AQIA 2F9WA 4BDYA 4O8UA 3OYDA 3U4LA 1EXQA 1NJYA 2WONA 1O1WA 3RMBA 5AZJB 1E3MA 4B9VA 4KTWA 3EEQA 2A40A 4GKJK 2G8IA 3VQCA 5AQQA 1BDGA 2WTUA 3K0SA 1L3VA 4FLWA 3OBYA 4KREA 3AVGA 2ZGZA 3C7NB 4CHOA 4QS9A 4YOWA 4AHCA 3WNFA 1QSSA 4CVNE 2QW9A 3WEEA 4RW6A 5CZ1A 4KHNA 2ZWHA 5JS1A 5KGWA 2DTUA 3HSCA 3WXJA 3OYHA 1T6CA 4KV8A 4DQ8A 2ITMA 3AA2A 1T3VA 4HTLA 4M3YA 2GWJA 3ZT3A 4FW1A 1ATRA 2FLOA 3VF2A 2JLEA 3V9WA 4O5BA 3DWLA 4QOZB 4KB1A 1SZ2A 3MAQA 3LANA 1XI1A 3DXMB 4EIAA 4CEAA 1EKEA 2VWJA 3ALYA 4FWSA 4FZXC 3CJCA 3ATVA 3I8DA 3CPWM 4HCCA 4FK2A 5GAHP 1RDUA 4FJ5A 4E1NA 4X65K 1NGAA 2OZMA 2P9KB 5J1EA 3L2WA 2AP1A 2RN2A 3V1OA 1C1AA 1IKYA 2YJFA 2IGIA 1M90O 4LC9B 3OYLA 5BPLA 1WUAA 3OYNA 1F21A 3ZSOA 4CJWA 3QEXA 1BHLA 4CCHA 4FJHA 2VG7A 1K6YA 1LAWA 3ZEUB 4KHUA 2Z1GA 3H46O 2DFEA 4DR2K 4BRDA 1VAZA 3SNNA 5IT9O 3VEZA 1HKBA 2HBMA 2ZE2A 3CI5A 3EKUA 5AFUH 3CD6N 4BE2A 3F5TA 4CEEA 4ELVA 5M1KA 4BWMA 3U3GA 3VENA 3PSIA 1Q9XA 2WOMA 2NRVA 4AHVA 3HTVA 3MWPA 4H4OA 3AO4A 5AFUA 3CQXA 3AVAA 3L4IA 2FF6A 4CFCA 4CEQA 4JN4A 3MN9A 4B9TA 5BREA 1WBDA 2KZMA 4DB3A 3OYGA 4DSJA 1ZXOA 3VQ6A 1NWKA 5T7BA 3OJUA 2HHTA 1NK7A 3O80A 4G1QA 3F9KA 2V52B 2A5XA 4GMJB 1Y97A 2I7NA 5J2NA 1EETA 3VGMA 2B5JA 3AVKA 3UKRB 4E3SA 4M3TA 2Z1JA 3M5RA 3TABA 5AQMA 1TV6A 3J80O 2Q0UA 4O8KA 4HHTA 2G8WA 1NGEA 4DSLA 4PY5A 1SS6A 4OPAA 4BQLA 4ICLA 5TKWA 5M1FA 3LALA 4WF9L 4GV3A 2YNFA 3P4IA 2E2PA 4JHDB 4FCYA 1LOTB 3SV3A 1RT5A 4B8AB 4E19A 2ZQBA 4CFBA 1YHQN 1VSFA 3ATUA 4GNIA 4OPKA 3MXIA 2IVPA 4BC2A 4KH6A 1MU2A 1S6QA 3HT3A 1D9DA 1NK9A 3SMSA 4FYDA 2Q97A 3DYAA 5A2QO 3RMDA 4WE1A 1S6PA 4FLXA 3AV9A 1JLCA 3M8RA 3ZT2A 3GBTA 3OJSA 3SUQA 3LDQA 2F8TA 2OTLN 3I33A 4A57A 2F9TA 1T05A 4A5BA 1FK9A 3ZX3A 3BP8A 2X74A 4IXCA 4CZHA 3U3YA 2BTFA 4LF9K 4M3XA 2P9SA 4BRLA 4FWRA 3TANA 4CHPA 4IZ9A 2QK9A 3H6EA 1S5JA 5FPNA 1T03A 4KHYA 2E8AA 3CETA 3LAMA 2UYTA 3THXB 4FWKA 4FVUA 1ZBHA 3O6WA 4CGFA 1D9FA 3KKSA 3SLCA 4JI4K 3ENOA 5KPZA 5EX5A 4DR1K 2XY5A 1N5YA 2PYLA 2OYQA 3CC7N 1Z05A 3OYMA 4CZJA 3KIOA 4B9QA 3OYAA 1UA0A 3ZT4A 3HRGA 2YKNA 3AO3A 2QWQA 1NG9A 1JLGA 1BCOA 1KVBA 1UWBA 4L3QA 1S1TA 1J5EK 1T44A 1KAXA 3QEIA 4FM0A 3EZWA 1HX1A 4DFKA 3O08A 5M1NA 1OH5A 1OH7A 4M7XA 4CJ7A 4IG3A 4DTMA 4GV6A 3FFKB 2ZJPL 1CLQA 3DRSA 4WQ5C 3BUZB 2W6LA 5CHIA 5BPNA 2HB5A 4ILJA 2YJEA 4NLCA 3AGRA 3TWHA 3NMUA 3NF6A 5BN9A 4BDZA 3SAHA 3G25A 1EP4A 1QQNA 4B3RK 5SWMA 4X66K 3MK6A 3ENHA 2OPSA 1NGIA 4C1NI 1SUQA 4DTUA 4ISFA 2QWOA 1TKTA 4YOUA 3SPYA 1TUYA 4JKEA 4KAZA 3LDLA 2UUAK 3CERA 3H1VX 4RW9A 1L5UA 3EKSA 4K8XA 4Z4IA 1DEJA 3WXKA 4YDUC 5IWAK 1TGOA 2HHHK 3DLRA 4PL7A 2Z1HA 4CF2A 1HNXK 4DTPA 1LW2A 4AM7A 4NCAA 4Z4FA 2EWSA 3W3DA 3BGRA 5J2MA 4FJIA 1G15A 4CIEA 5FPEA 5GINA 2VG6A 1I39A 2QA4N 4XH1A 4BVPA 3ZX0A 1U04A 3FZKA 2GELA 4JHDA 4M7YA 3K58A 3TPQA 4RCHA 3ID6A 1RDCA 4B1VA 2YNHA 4OKKA 3RR8A 4MQ3A 3WEEB 1HRHA 1VRTA 1W7AA 1WSFA 1N33K 5I9EB 4IOCL 2RE2A 2F96A 5LJWA 1N8RO 5FPMA 3SJJA 4CHQA 3C95A 4C23A 2BGGA 3D0PA 5KPRA 4AHUA 3VA3A 2UXCK 4FJNA 4Z4HA 5HLFA 3HOTA 1BIZA 2Q0RA 3IUCA 3ZETA 2IDOA 1YITN 4CZEA 2V51B 2GWKA 3QB0A 1BA0A 2HHVA 4DV5K 2NRTA 1XMQK 2NLXA 4ISGA 3RMCA 1L3SA 2QWRA 2VGMA 1NK0A 4C8KA 4W5RA 4CIGA 4OLBA 2O8DB 3IDHA 4PHTX 5J2QA 4MO4A 3O4QA 5M1QA 5HRSA 3NF7A 1NGDA 4BQZA 4JS5A 4OPHA 1ZYQA 3CCRN 5ELZA 3CXCM 5KRSA 3V6DA 1S1WA 2IVOA 1ASVA 3CCQN 2F4VK 3GOIA 4EZ9A 3CCEN 3FZFA 3KWIA 3TAGA 4LSNA 5C42A 1RBSA 5I3UA 1SKSA 3C0BA 3S9HA 4B1UB 4JKFA 4FJ9A 2KZZA 1CZBA 4AQYK 3NBPA 1S72N 3ZLJA 4IO9L 5F1XA 1Z26A 2QEXN 4CBWA 1RTDA 4WCEL 4K25A 3H3OB 1DTQA 4DFPA 4GVEA 3LPTA 4I7FA 4YDUA 4CGHA 1VQKN 3LDPA 1HPZA 4GV9A 3LP2A 1RFQA 4PA1A 2VGNA 4FWOA 1EQYA 3VQBA 1JCGA 2HHWA 4FJJA 3MEEA 3TSUA 3Q7BA 4FJ8A 1IG8A 2E2OA 3O5BA 4DV2K 3WUHA 1TL3A 4BGBA 4JI7K 2FBXA 1NU0A 3EN9A 3HO1A 1BG3A 4JRQA 4CGJA 3B8AX 3I0SA 2H3GX 4FXDA 2HHUA 3QIOA 3OS0A 1JXEA 4JKAA 3H45C 1IBMK 2QM1A 4CF0A 3QEPA 1DT9A 2ZD1A 4FOEA 3LZIA 4CJVA 4J2AA 2RPIA 3TAPA 3VF4A 4LSLA 3PUFA 3NF9A 1QTMA 1WBBA 2JWLA 3V1QA 1GLCG 4MDAA 1YUWA 2ASMA 3NFAA 2X6NA 1RBUA 5FDLA 3ZT0A 3JYTA 2O4IA 1RT3A 4DU3A 4JI5K 3PSFA 2P9LA 4EHUA 1NGCA 4WFNL 4B9UA 3HP9A 2ZJRL 2Y1IA 1NK6A 1RILA 1FKPA 4N47A 1V4SA 4ZTJA 2O8CA 2OPQA 3D45A 4Q5VA 3CC2N 1IBKK 4OO1J 3I55N 5GADP 2O8EB 1XWLA 2OA8A 3WQTA 3HZ6A 3MMVA 3VOVA 4CD1A 3HJFA 2BDPA 4JK9A 4XH4A 2BUPA 3AO2A 3LM2A 1C0UA 3BY5A 2HMIA 4H0TB 4ID1A 3CG7A 4ID5A 5FLXO 4FOIA 4BRAA 3QO9A 1TAQA 2RKIA 1NGJA 3IRXA 4E1MA 1EWQA 5CYQA 1S9GA 3MN6A 5MLCQ 4JI2K 1IV0A 4FK0A 3BF1A 2BH1A 1WOQA 4DV6K 1NJWA 4KHQA 4FK4A 3P1GA 3AA5X 2UU9K 4LY7A 1TK0A 5GIPA 4CERA 4NXMK 3MXMA 4JKDA 3KZBA 3O9RA 1SQKA 1XC3A 3EYZA 3T1HK 4BRPA 3LPUA 4M42A 4J2DA 4I6MA 5KGXA 1JLFA 3QEWA 4BGAA 1BUPA 1WN7A 2Q31A 1T8EA 2ITGA 2E20A 3CJ7A 5AQNA 3D2FA 5CZ2A 1KAZA 4IFEA 2DFFA 4KBOA 1R0AA 2OPPA 4X62K 1VQ9N 5AQZA 3IG1A 1R59O 1Q9YA 4FLUA 1VQ8N 3UKRA 2HVIA 4B1ZA 1FKOA 3SQ0A 3THVA 4KI4A 3LAKA 4JNEA 1HLUA 4M3RA 3T7ZA 1Q7YO 4LF6K 3MECA 4PKGA 5M1OA 4BRMA 3QNOA 3OYKA 3DAWA 3TTCA 5KQDA 4M3ZA 3ULEB 4F3TA 2PBDA 1WSIA 4B3MK 4GKKK 1HKCA 1E4GT 3AGKA 2HF4A 2VWBA 4WFAL 3QBWA 3O9QA 3A0IX 3FZLA 4XIUA 5AZJA 1IBLK 3TI0A 4Y0WA 1TKZA 2YX6A 3SCXA 3VPZA 3HPOA 1D4XA 2FC0A 3NH1A 3SPZA 1EO1A 2I5JA 4OLAA 4BRHA 2A1SA 4AM6A 1J5OA 2F8SA 1A5XA 3WXMB 3L4QA 3L8BA 3O9TA 2A6AA 3LP1A 4DTNA 3D6RA 4EAHD 4E7IA 4FM1A 3OHRA 1VSEA 3AVHA 4CJRA 4M3UA 1NLVA 3V9ZA 1MDUB 2OCEA 2G8VA 3T69A 3V9SA 5AZIA 3TAQA 3L3UA 2V7ZA 2FXUA 3OYFA 1JLEA 5FROA 4I2QA 4LFBK 1RBTA 1YI2N 4LD0A 5F0XA 4PUOA 4DS4A 3NVMA 2OANA 4DR7K 1YF5L 3HVTA 1DTTA 3G71N 1TAUA 2YCHA 4IWVA 2CGKA 1JJ2M 4G9ZA 1VSKA 1S1XA 4BACA 1WSHA 3NGYA 4DUZK 4ILHA 4KO0A 1DGKN 3AVBA 4HWIA 1HJRA 4DR6K 1UAXA 1KSPA 2O4GA 3M8QA 4FPAA 3KKRA 2HNZA 5BRFA 4WQ4A 1C1BA 4CGDA 1Z6RA 1ZBLA 1BI4A 1C0GA 1LWFA 3RSEA 1HYSA 5JICA 3V1RA 4DSFA 3KD1E 3E9PA 4ELUA 5C2DA 1YTUA 2XHBA 3S3MA 1XNQK 4FWLA 3KK7A 1UA1A 3P31A 2E6LA 4RWTA 1P90A 1HNIA 2ZJQL 3NCIA 3MN7A 1G99A 4B3TK 2HW3A 4O5FA 3E01A 4CHYA 5KTQA 3OYIA 1SL1A 2R7YA 3HPGA 1VSHA 4KB0A 4FLYA 2W40A 1U47A 2KW4A 3MXJA 3GDQA 4FSVA 4MFBA 3TR8A 1ESVA 4BG8A 3O1WA 4JI8K 4CI6A 3K9JA 4K41A 4AHTA 4EFHA 1HNZK 3CIPA 2D1KA 1JKHA 3VTIA 1VQLN 4CHZA 2HBJA 3IMXA 2O8BA 5HRNA 4BRIA 2DFHA 1MWKA 3ZSZA 4CIFA 3TSQA 4YOVA 2P9IA 3JSMA 4ELTA 2YNIA 1SKWA 4DQRA 2E4LA 3T1YK 4DTJA 3UKUA 1QQOA 2RF2A 4JK8A 1OH8A 5JMVA 5SZTA 3THWA 1DKGD 3AARA 3NGZA 3SQ2A 4CZIA 4R5PA 3EZ5A 4KH5A 3WXIA 1RDBA 4LH4A 4PL8A 5AQHA 5AQWA 5EY4A 2D4WA 3CCVN 5C25A 3DM2A 3A5MC 3ZETB 4CJ5A 3EY1A 4J2BA 1FW6A 4BRNA 2YKMA 3VTHA 3E66A 3FE1A 2DPNA 1L3TA 2QI2A 2P51A 2WFBA 4YOTA 1VSIA 1VRUA 2WBNA 1VSJA 3VQQA 1BQMA 4FWQA 4H0PA 4Y1DA 4DV0K 4DQPA 4F2SA 4I6MB 3BZKA 1HPMA 2G8UA 4C1NK 4BRCA 5BR8K 5C15A 2KTQA 2XY8A 1HJOA 3S3NA 1RTJA 3THYA 1RGIA 4IBNA 4CK1A 2OZSA 1KRPA 3O3HA 4LF8K 3K59A 2P9PA 1FXXA 1GLEG 4BR2A 1YAGA 2AJQA 2P1JA 4PKHA 3AA4A 3RSEB 1W0HA 5AQJA 1YJNN 5E26A 3DXKB 2LSNA 1BGXT 3LM9A 2HNYA 2KKZA 2NRWA 2UXDK 1V4TA 3CJ9A 4EP4A 3CJAA 3HSTB 1C0MA 1ZC6A 3AVIA 1N34K 4WFBL 3O3GA 2YHWA 3LDSA 3OA9A 3QESA 1XC9A 3P39A 1IH7A 3FR0A 3KWGA 1BQNA 1QQCA 3HK2A 1QVGM 4EHTA 3WNEA 4FJLA 4IO8A 4CK3A 3KK1A 1ATSA 2VYPA 1XHXA 1D8YA 1OKJA 4Z94A 5I42A 4FLZA 4UQGA 4KPYA 2JGUA 5JVHL 4QCLA 1QZ5A 5E41A 1KAYA 4YOYA 3S41A 1YIJN 4BR7A 1GOBA 3K2PA 3ZX2A 3L2QA 3SMPA 5CYMA 4H5VA 5AQPA 2IS3A 2FSKA 2IC3A 3CHWA 2O8DA 3VN5A 2RHKA 3AAQA 3ENBA 1QHTA 3RRHA 1U2VA 4H5TA 4CJTA 1EWRA 4AHSA 4A61A 2QWNA 5LJVA 3K5OA 5AJ3K 4IFVA 1HKGA 3EL2A 4KHWA 3SJHA 3CJBA 3LP3A 2O8EA 2GTDA 3TU5A 1GLFO 2QKBA 2NRHA 3F2KA 4IOAL 2ATQA 1NJZA 4H0YB 4BG9A 3A5NC 5DM6L 4UY8O 3LDOA 1U49A 4IJAA 2G8FA 1IKVA 4FZZA 2J4RA 3CF5L 3U9DA 5DMRA 5BPMA 1QZ6A 4M63C 4A2BA 1RT7A 2F7TA 3ULEA 3CPEA 4CD3A 4DUYK 4DV3K 4FPBA 2QWLA 1NOYA 1GOCA 3J7ZO 1WSJA 3OYBA 5HP1A 1N32K 4RW4A 1TL1A 3UIQA 5AQVA 4W5TA 3I56N 3WQUA 2QWMA 1WNSA 1EX4A 1X9MA 4LF5K 2XY6A 3QIPA 2ASPA 4DQQA 3D7EO 4BR0A 3TSPA 3KK2A 2XRIA 3FZHA 2QKKA 2G8HA 4FL9A 1KFDA 1IG9A 1NGGA 3JS6A 3FZMA 1IKXA 3NE6A 1BI4B 1D5AA 1X3NA 3VQ7A 2E88A 4FWPA 3O3FA 3QINA 5M1PA 3GL1A 3MCAB 3DXKA 4HTUA 2HHSA 4OGCA 3FLCO 3K9KA 3PO4A 1ILYA 3H1QA 4NYNA 3ZCMA 4CJ4A 4H5RA 3MEGA 3K5MA 1JL1A 3G4SN 3V4IA 4DCHA 3KLEA 3THYB 3VF6A 3U9ZA 1SAZA 3VGLA 1ATNA 4CJPA 4L8RB 3I0RA 1LWEA 4JEPA 3DOLA 1K9MO 2KHOA 4JK7A 1NGBA 4JI1K 3PLAA 3A5LC 3DJCA 4FJGA 2P9NA 1YTAA 3F73A 4JV5K 3DLBA 4M41A 1CXUA 4NO7A 1BL3A 4CFAA 1O13A 2OTJN 1NK8A 2B4JA 1HQUA 2QXFA 3DRRA 3DMJA 3KLFA 5H1SQ 1I94K 1KCFA 4B9LA 3VQ4A 2V7YA 1IJJA 4GY2B 3KVGA 3Q7CA 4IEEA 1NBWA 4YORA 1S1UA 4DTRA 3C6UA 4KTZA 3TAFA 3PIPL 4BC5A 1TKDA 3DLHA 3V9XA 4KTQA 1BISA 4YOXA 2YNGA 3CMEN 5AQLA 3L3VA 3VA0A 4TSXA 3VEYA 3OW2M 1OH6A 2E1YA 4YY3K 1FJGK 1NKEA 4CJKA 2P9UA 3SQ1A 4K42A 4HVJA 1T7PA 1ASUA 4CFDA 4XH5A 4AH9A 2YHYA 4B9NA 3OVNA 1GLDG 1RT6A 3M3ZA 3QLHA 5CE3A 4KI6A 3PO5A 1BWFO 5C2FA 2PAVA 1N6QA 1VSDA 3AO5A 1B92A 1HR0K 3CMAN 1RDDA 1VQPN
chains in the Genus database with same CATH topology
2YX6A 3VPZA 5BRHA 3GBTA 3LDQA 1D4XA 3WT0A 1EO1A 1NGHA 4IJNA 2YHXA 4BR4A 2OTLN 3I33A 3LL3A 1C0FA 4BRKA 4WQ4C 4BRHA 4A57A 2WC9A 2F9TA 4RTFD 4AM6A 3WXMB 4A5BA 3ZX3A 3MN5A 3L4QA 4BR9A 3BP8A 3O9TA 2A6AA 4IXCA 4CZHA 2BTFA 2P9SA 2NNWA 4BRLA 3D6RA 4EAHD 4FWRA 3J8AA 3L0QA 3OHRA 4FO0A 1NMDA 1K8KA 3CJ1A 1VQ6N 4IZ9A 2CGJA 1NLVA 3H6EA 5FPNA 1MDUB 2E8AA 3CETA 2UYTA 3T69A 4FWKA 4IDHA 5AZIA 4BY9C 4FVUA 2V7ZA 2FXUA 2ZGYA 2GX9A 3EE9A 3O6WA 2HMPA 5FPDA 3AY9A 2AA4A 3SLCA 3TTDA 1YI2N 1J6ZA 5F0XA 5AQUA 2W41A 3ENOA 3IKMA 5KPZA 4XEIA 1YJ9N 2QWPA 3CQYA 5EX5A 3NVMA 2OANA 5BRDA 2ASOA 1S22A 3CC7N 2CGLA 1YF5L 3HBTA 1JCEA 1Z05A 1VQ5N 3QDKA 4B1YB 3C65A 1KQSM 3G71N 4CZJA 4B9QA 2YCHA 2GEMA 4IWVA 2CGKA 3HRGA 1JJ2M 4G9ZA 2QWQA 3QFUA 1Q82O 4L3QA 3O9UA 4BVOA 1T44A 3P38A 1KAXA 4ILHA 5AQTA 1DGKN 4HWIA 2HBKA 1GLBG 3EZWA 1HX1A 2NRZA 3D2EB 4F9OA 2NRXA 3O08A 5M1NA 2Q1NA 4FPAA 5BRFA 4WQ4A 4M7XA 1Z6RA 1P8ZA 3AAPA 1VQNN 4CJ7A 4GV6A 3FFKB 2ZJPL 1C0GA 4MDBA 4KH4A 3RSEA 1NGFA 4WQ5C 1BO5O 2PFUA 5JICA 1VQ4N 3BUZB 5CHIA 5BPNA 1K8AO 1K73O 3SAGA 3E9LA 3E9PA 4ILJA 1H1VA 2YJEA 4NLCA 5C2DA 3R3LA 5EXWA 4CBXA 2Q2RA 1W97L 3AGRA 5ADXH 3NMUA 4FWLA 3L6QA 3KK7A 5BN9A 2P9UB 3SAHA 3KHYA 3P31A 1CZAN 3G25A 4RWTA 3R6MA 1P90A 2ZJQL 5AQSA 1E4FT 2FSJA 1G99A 1QQNA 3MN7A 2D0OA 4BRGA 5JLHA 4O5FA 3MK6A 5AQGA 2WUSA 3ENHA 1YXQA 1NGIA 1GLJO 4C1NI 3MX5A 4ISFA 2W40A 3VEXA 4FWNA 3GDQA 4FSVA 4WYBA 2P9SB 3OBWA 3SK3A 2QWOA 4YOUA 1ESVA 4BG8A 3QBXA 3O1WA 1TUYA 4JKEA 3R8EA 1X9JA 3SAFA 4A59A 4CI6A 5AQFA 3LDLA 5AQKA 3CERA 3H1VX 3K9JA 3EKSA 4K41A 1DEJA 1U2VB 3LDNA 3WXKA 4YDUC 4H0XB 4EFHA 1NJIO 4H5NA 3CIPA 3VESA 1VQMN 2D1KA 3D2FB 3VTIA 4PL7A 1VQLN 1Q81O 3DXMA 5E84A 2HBJA 3HI0A 3IMXA 5CR4A 4BRIA 4AM7A 1MWKA 5AQYA 2EWSA 3D2EA 4B1XB 3VETA 1X3MA 3W3DA 3TSQA 4YOVA 2P9IA 3N4QA 1BOTO 3F9MA 4BC3A 2P9NB 3CCSN 5C10A 1JCFA 1XQSC 5GAGP 3MCPA 3O8MA 5FPEA 3UKUA 5GINA 2QA4N 3NVKA 1QQOA 2Q36A 2QXLA 4XH1A 3QMLA 4JK8A 3ZX0A 4BVPA 5JMVA 3FZKA 3HM8A 1DKGD 3CF5L 2GELA 2P9KA 3AARA 3CCLN 3VGKA 4JHDA 4M7YA 4CZIA 3TPQA 4RCHA 3SBTA 4KH5A 3ID6A 3WXIA 4CZGA 5KQ8A 4B1VA 4PL8A 2P9IB 3MX2A 4QS7A 1YVNA 5AQHA 1Q18A 3WEEB 4IEIA 5AQWA 5EY4A 2D4WA 3BEXA 3CCVN 5I9EB 4H0OA 3MDQA 3A5MC 4IOCL 2RE2A 5LJWA 1N8RO 3ZETB 5FPMA 4IOXA 1GLAG 3VEVA 3DLLL 5AQRA 4C23A 5KPRA 1OVYA 3CCUN 4CZKA 4BRNA 3GG4A 2A3ZA 1XUPO 4U7BA 3VTHA 3HOTA 3E66A 2Q0RA 3ID8A 4JD2A 1U6ZA 3FE1A 3IUCA 4ILGB 3ZETA 2DPNA 5HOOA 1YITN 5F2RA 2QI2A 2WFBA 5EOYA 4CZEA 3HOSA 2V51B 2GWKA 4BR5A 4YOTA 2P9PB 3QB0A 2WBNA 1BA0A 4FWQA 4H0PA 2NRTA 4I6MB 2NLXA 4ISGA 1M1KO 1HPMA 1LCUA 4CZMA 2QWRA 2VGMA 4C1NK 4BRCA 5C15A 1BU6O 3IDHA 2GUPA 1HJOA 2CH5A 4PHTX 4BRFA 4BREA 2JWKA 3CCJN 3BF3A 4MO4A 1RGIA 2HSTA 3SBGA 1GLLO 3WXLA 5M1QA 2FF3B 3C7NA 1NGDA 3EO3A 4BQZA 2P9PA 1GLEG 4OPHA 4BR2A 1YAGA 4MLEA 3CCRN 1NM1A 5ELZA 3E9OA 3CXCM 3A5OC 4PKHA 3RSEB 1T6DA 5AQJA 1YJNN 2IVOA 5E26A 5GIOA 4WQ5A 3DXKB 3LM9A 1TUUA 5AR0A 3CCQN 1YJWN 2E2NA 2A42A 3GOIA 2NRWA 2KKZA 4JAXA 1VQ7N 3CCEN 3FZFA 3KWIA 1V4TA 3CJ9A 2HBLA 3CJAA 4H0VB 3RVCA 3TTFA 3GE1A 3VEWA 1K8KB 3VERA 3CCMN 3C0BA 3QFPA 1ZC6A 4K43A 4BROA 4WFBL 2YHWA 4B1UB 3M6GA 3OA9A 2IIRA 4JKFA 3FGUA 1MWMA 1TYQA 3JXUA 5AQIA 2F9WA 1QHAA 4O8UA 1S72N 3P39A 3ZEUA 3FR0A 3U4LA 4IO9L 3KWGA 3U8XA 5F1XA 2QEXN 1QVFM 4CBWA 5ADXA 1QVGM 4EHTA 4IO8A 4WCEL 5AZJB 1ATSA 2VYPA 1VQON 1OKJA 3H3OB 4K25A 4Z94A 2A40A 2P9LB 5JVHL 5AQNA 1QZ5A 1BDGA 3C6HA 5AQQA 4ISEA 4U67L 1KAYA 4GVEA 4YOYA 3S41A 1YIJN 3OBYA 4YDUA 4BR7A 3C7NB 2ZGZA 3ZX2A 4QS9A 4YOWA 1VQKN 3LDPA 1S3XA 5AZIB 2E2QA 3SMPA 2QW9A 4H5VA 5AQPA 3M1FA 3WEEA 4GV9A 1RFQA 2ZWHA 2FSKA 3CHWA 2NZTA 3HSCA 2RHKA 3AAQA 2VGNA 4FWOA 1EQYA 2YI1A 3ENBA 4H5WA 1JCGA 3VEOA 1U2VA 4H5TA 3WXJA 1KXPA 3TSUA 3Q7BA 1IG8A 1T6CA 2E2OA 3O5BA 3WUHA 4A61A 2QWNA 4DQ8A 2ITMA 4BGBA 1T3VA 4HTLA 5LJVA 2GWJA 1HKGA 3EL2A 3EN9A 3UKUB 1TYQB 1BG3A 1ATRA 3SJHA 4BRQA 3CJBA 2FLOA 4MO5A 4NB4A 3IFRA 4A62A 5C12A 2GTDA 3B8AX 3VF2A 2QTDA 3W0LA 3TU5A 1GLFO 2H3GX 3DWLA 1Q86O 2NRHA 1KD1O 4JD2B 1SZ2A 3F2KA 3H3NO 4JKAA 4R79A 4IOAL 3H45C 3DXMB 4H0YB 4BG9A 4EIAA 2QM1A 3A5NC 4H03B 3UB5A 2E1ZA 1DT9A 5DM6L 4FWSA 4UY8O 4FOEA 5AQOA 3LDOA 3R9PA 3CJCA 2HOEA 3ATVA 4IJAA 3VF4A 4NLBA 3CPWM 5GAHP 1RDUA 2A41A 2J4RA 1W2BM 2JWLA 3U9DA 1GLCG 4MDAA 1YUWA 1QZ6A 2ASMA 4M63C 4PKIA 5BPMA 4A2BA 2F7TA 1NGAA 3ULEA 1Y64A 3CPEA 4CD3A 5KPTA 2P9KB 4FPBA 2QWLA 2AP1A 2P9LA 4MLHA 3J7ZO 4EHUA 2YJFA 1NGCA 4WFNL 2ZJRL 1M90O 4LC9B 4QS8A 5AQVA 1BA1A 5BPLA 3QICA 3I56N 3WQUA 2QWMA 1WUAA 4A5AA 1V4SA 3CC2N 4OO1J 3I55N 2ASPA 3D7EO 5GADP 3A8YA 4BR0A 3ZEUB 3TSPA 2FSNA 3FZHA 3H46O 4FL9A 3WQTA 4BRDA 3HZ6A 1VAZA 3MMVA 1NGGA 3JS6A 5B8HA 1RDWX 2ZF5O 1HKBA 2HBMA 3EKUA 3CI5A 2HF3A 3FZMA 3VEZA 4JK9A 3VOVA 4XH4A 5AFUH 4CD1A 3CD6N 1X3NA 3F5TA 2BUPA 2NRRA 3LM2A 2E88A 4FWPA 5EVZA 5M1PA 4H0TB 5M1KA 3GL1A 3MCAB 5JVGL 3DXKA 3VENA 4FOIA 3E1YA 2VCPA 5TKYA 4BRAA 3CC4N 3FLCO 3K9KA 4B1WB 4JKHA 2NRVA 2D0PA 3UE5A 1ILYA 1NGJA 3H1QA 3PIOL 3HTVA 3MWPA 5AFUA 4H5RA 4DKWA 3CQXA 3L4IA 3G4SN 2FF6A 3MN6A 4JKGB 4DCHA 5MLCQ 4JN4A 3VF6A 3BF1A 2BH1A 1WOQA 1SAZA 3U9ZA 1ATNA 3MN9A 3VGLA 5BREA 4DB3A 2IVNA 2I7PA 4JEPA 1ZXOA 1K9MO 2KHOA 4JK7A 1NGBA 1NWKA 3R1XA 5GAEP 5GIPA 3A5LC 3DJCA 3PLAA 2P9NA 1ZBSA 3O80A 3KZBA 3O9RA 4JKDA 1SQKA 1HUXA 3O4WA 1XC3A 2V52B 4NO7A 2A5XA 4BRPA 4CZLA 1O13A 2OTJN 2I7NA 5C0YA 4I6MA 3VGMA 3UKRB 3O9SA 2CH6A 3M5RA 5DM7L 5AQMA 5H1SQ 4BGAA 1BUPA 4BC4A 2Q31A 2V7YA 1IJJA 1KC8O 2E20A 4GY2B 3CJ7A 5HL7L 2Q0UA 4O8KA 3KVGA 3Q7CA 1NGEA 1NBWA 3D2FA 1KAZA 3N4PA 4IEEA 4IFEA 4KBOA 4YORA 1VQ9N 3O1BA 5BR9A 4BC5A 3PIPL 1SS6A 4OPAA 4BQLA 5AQZA 4A2AA 1R59O 1MA9B 4JKBA 5TKWA 5M1FA 1VQ8N 4CBUA 3UKRA 4WF9L 2KLAA 4B1ZA 4GV3A 4YOXA 3P4IA 3CMEN 2E2PA 1HLUA 4JHDB 4JNEA 5AQLA 3VEYA 1LOTB 3VMFB 3T7ZA 3OW2M 1Q7YO 4PKGA 5M1OA 4BRMA 2E1YA 3ZYYX 4J8FA 3DAWA 4AF1A 3EE8A 4CZFA 3TTCA 1YHQN 2P9UA 3ATUA 4K42A 5BN8A 4GNIA 5KQDA 4XH5A 3ULEB 5LY3A 2IVPA 2PBDA 1QQMA 2YHYA 4JKCA 4BC2A 3C6AA 4KH6A 1HKCA 1E4GT 3AGKA 4JKGA 1GLDG 2HF4A 3SMSA 3M3ZA 2VWBA 3I8BA 4E1JA 4WFAL 2Q97A 3MWTA 3QBWA 5AQXA 3O9QA 5CE3A 4FWMA 1BWFO 3A0IX 3FZLA 5C2FA 2PAVA 4DHYA 5JLFA 5AZJA 3CMAN 3G6EN 1VQPN 4Y0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VPZ A;  5BRH A;  3GBT A;  3LDQ A;  1D4X A;  3WT0 A;  1NGH A;  4IJN A;  2YHX A;  4BR4 A;  3I33 A;  3LL3 A;  1C0F A;  4BRK A;  4WQ4 C;  4BRH A;  4AM6 A;  2F9T A;  4RTF D;  3ZX3 A;  3MN5 A;  4BR9 A;  3BP8 A;  2A6A A;  4IXC A;  4CZH A;  2BTF A;  2P9S A;  4BRL A;  4EAH D;  4FWR A;  3J8A A;  3L0Q A;  3OHR A;  4FO0 A;  1NMD A;  1K8K A;  3CJ1 A;  4IZ9 A;  2CGJ A;  1NLV A;  3H6E A;  5FPN A;  1MDU B;  2E8A A;  3CET A;  2UYT A;  4FWK A;  5AZI A;  2V7Z A;  2FXU A;  2ZGY A;  3O6W A;  2HMP A;  5FPD A;  3AY9 A;  2AA4 A;  3SLC A;  1J6Z A;  5F0X A;  5AQU A;  2W41 A;  3ENO A;  5KPZ A;  4XEI A;  2QWP A;  3CQY A;  5EX5 A;  5BRD A;  2OAN A;  2ASO A;  1S22 A;  2CGL A;  3HBT A;  1JCE A;  1Z05 A;  3QDK A;  4B1Y B;  4CZJ A;  4B9Q A;  2YCH A;  2GEM A;  4IWV A;  2CGK A;  2QWQ A;  3QFU A;  4L3Q A;  4BVO A;  1T44 A;  1KAX A;  5AQT A;  1DGK N;  4HWI A;  1GLB G;  3EZW A;  1HX1 A;  3D2E B;  4F9O A;  3O08 A;  2Q1N A;  4FPA A;  5BRF A;  4WQ4 A;  4M7X A;  1Z6R A;  1P8Z A;  3AAP A;  4CJ7 A;  3FFK B;  1C0G A;  3RSE A;  1NGF A;  4WQ5 C;  1BO5 O;  5JIC A;  3BUZ B;  5BPN A;  1H1V A;  2YJE A;  5EXW A;  4CBX A;  2Q2R A;  5ADX H;  4FWL A;  3L6Q A;  5BN9 A;  2P9U B;  3KHY A;  1CZA N;  3G25 A;  4RWT A;  3R6M A;  5AQS A;  1E4F T;  2FSJ A;  1G99 A;  1QQN A;  3MN7 A;  2D0O A;  4BRG A;  5JLH A;  4O5F A;  3MK6 A;  5AQG A;  2WUS A;  3ENH A;  1YXQ A;  1NGI A;  1GLJ O;  4ISF A;  2W40 A;  3VEX A;  4FWN A;  3GDQ A;  4FSV A;  4WYB A;  2P9S B;  3SK3 A;  2QWO A;  1ESV A;  4BG8 A;  3QBX A;  3O1W A;  1TUY A;  3R8E A;  1X9J A;  4CI6 A;  5AQF A;  3LDL A;  5AQK A;  3CER A;  3H1V X;  3EKS A;  4K41 A;  1DEJ A;  1U2V B;  3LDN A;  3WXK A;  4YDU C;  4H0X B;  4EFH A;  4H5N A;  3CIP A;  3VES A;  2D1K A;  3D2F B;  4PL7 A;  3DXM A;  5E84 A;  3HI0 A;  3IMX A;  4BRI A;  4AM7 A;  1MWK A;  5AQY A;  2EWS A;  3D2E A;  4B1X B;  3VET A;  1X3M A;  3W3D A;  2P9I A;  1BOT O;  3F9M A;  4BC3 A;  2P9N B;  1JCF A;  1XQS C;  3MCP A;  3O8M A;  5FPE A;  3UKU A;  1QQO A;  2Q36 A;  2QXL A;  4XH1 A;  3QML A;  3ZX0 A;  4BVP A;  5JMV A;  3FZK A;  3HM8 A;  1DKG D;  2GEL A;  2P9K A;  3AAR A;  3VGK A;  4JHD A;  4M7Y A;  4CZI A;  3TPQ A;  4RCH A;  4CZG A;  3WXI A;  5KQ8 A;  4B1V A;  4PL8 A;  2P9I B;  4QS7 A;  5AQH A;  1YVN A;  1Q18 A;  3WEE B;  5AQW A;  5EY4 A;  2D4W A;  3BEX A;  5I9E B;  4H0O A;  3MDQ A;  3A5M C;  5LJW A;  3ZET B;  5FPM A;  1GLA G;  3VEV A;  5AQR A;  4C23 A;  5KPR A;  4CZK A;  4BRN A;  3GG4 A;  2A3Z A;  1XUP O;  3ID8 A;  2Q0R A;  4JD2 A;  1U6Z A;  3FE1 A;  3IUC A;  3ZET A;  2DPN A;  5F2R A;  5EOY A;  4CZE A;  2V51 B;  2GWK A;  4BR5 A;  2P9P B;  3QB0 A;  1BA0 A;  4FWQ A;  4H0P A;  4I6M B;  2NLX A;  4ISG A;  1HPM A;  1LCU A;  4CZM A;  2QWR A;  4BRC A;  1BU6 O;  3IDH A;  2GUP A;  1HJO A;  2CH5 A;  4BRF A;  4BRE A;  3BF3 A;  4MO4 A;  1RGI A;  1GLL O;  3WXL A;  2FF3 B;  3C7N A;  1NGD A;  3EO3 A;  4BQZ A;  2P9P A;  1GLE G;  4BR2 A;  1YAG A;  4MLE A;  1NM1 A;  5ELZ A;  3A5O C;  4PKH A;  3RSE B;  1T6D A;  5AQJ A;  2IVO A;  5E26 A;  4WQ5 A;  3DXK B;  3LM9 A;  1TUU A;  5AR0 A;  2E2N A;  2A42 A;  3GOI A;  4JAX A;  3FZF A;  1V4T A;  3CJ9 A;  4H0V B;  3CJA A;  3GE1 A;  3VEW A;  1K8K B;  3VER A;  3C0B A;  3QFP A;  1ZC6 A;  4K43 A;  4BRO A;  2YHW A;  4B1U B;  3M6G A;  2IIR A;  3FGU A;  1MWM A;  1TYQ A;  3JXU A;  5AQI A;  2F9W A;  1QHA A;  3ZEU A;  3FR0 A;  3U4L A;  3U8X A;  5F1X A;  4CBW A;  5ADX A;  4EHT A;  4IO8 A;  5AZJ B;  1ATS A;  2VYP A;  1OKJ A;  3H3O B;  4K25 A;  4Z94 A;  2A40 A;  2P9L B;  1QZ5 A;  1BDG A;  5AQQ A;  4ISE A;  1KAY A;  3S41 A;  4BR7 A;  4YDU A;  3C7N B;  2ZGZ A;  3ZX2 A;  4QS9 A;  3LDP A;  1S3X A;  5AZI B;  2E2Q A;  3SMP A;  2QW9 A;  4H5V A;  5AQP A;  3M1F A;  3WEE A;  1RFQ A;  2ZWH A;  2FSK A;  3CHW A;  2NZT A;  3HSC A;  3AAQ A;  4FWO A;  4H5W A;  1EQY A;  2YI1 A;  3VEO A;  1JCG A;  1U2V A;  4H5T A;  3WXJ A;  1KXP A;  1IG8 A;  1T6C A;  2E2O A;  3O5B A;  3WUH A;  4A61 A;  2QWN A;  4DQ8 A;  2ITM A;  4BGB A;  5LJV A;  4HTL A;  2GWJ A;  1HKG A;  3EL2 A;  3EN9 A;  3UKU B;  1TYQ B;  1BG3 A;  1ATR A;  3SJH A;  4BRQ A;  3CJB A;  2FLO A;  4MO5 A;  4NB4 A;  3IFR A;  4A62 A;  2GTD A;  3B8A X;  3VF2 A;  3W0L A;  3TU5 A;  1GLF O;  2H3G X;  3DWL A;  2NRH A;  4JD2 B;  1SZ2 A;  3H3N O;  3H45 C;  3DXM B;  4H0Y B;  4BG9 A;  4EIA A;  2QM1 A;  3A5N C;  4H03 B;  3UB5 A;  2E1Z A;  4FWS A;  4FOE A;  5AQO A;  3LDO A;  3R9P A;  3CJC A;  2HOE A;  3ATV A;  4IJA A;  3VF4 A;  2A41 A;  2J4R A;  3U9D A;  1GLC G;  1YUW A;  1QZ6 A;  2ASM A;  4M63 C;  4PKI A;  5BPM A;  4A2B A;  1NGA A;  3ULE A;  1Y64 A;  4CD3 A;  5KPT A;  2P9K B;  4FPB A;  2QWL A;  2AP1 A;  2P9L A;  4MLH A;  4EHU A;  2YJF A;  1NGC A;  4LC9 B;  4QS8 A;  5AQV A;  1BA1 A;  5BPL A;  3QIC A;  3WQU A;  2QWM A;  1WUA A;  1V4S A;  2ASP A;  3D7E O;  3A8Y A;  4BR0 A;  3ZEU B;  2FSN A;  3FZH A;  3H46 O;  4FL9 A;  3WQT A;  4BRD A;  3HZ6 A;  3MMV A;  5B8H A;  1NGG A;  3JS6 A;  1RDW X;  2ZF5 O;  1HKB A;  3FZM A;  3EKU A;  3CI5 A;  2HF3 A;  3VEZ A;  3VOV A;  4CD1 A;  4XH4 A;  5AFU H;  1X3N A;  2BUP A;  3LM2 A;  2E88 A;  4FWP A;  5EVZ A;  4H0T B;  3GL1 A;  3DXK A;  3VEN A;  4FOI A;  5TKY A;  2VCP A;  4BRA A;  3FLC O;  4B1W B;  3UE5 A;  2D0P A;  1NGJ A;  3H1Q A;  3HTV A;  5AFU A;  4H5R A;  3CQX A;  3L4I A;  2FF6 A;  3MN6 A;  4DCH A;  4JN4 A;  3VF6 A;  3BF1 A;  1WOQ A;  1SAZ A;  3U9Z A;  1ATN A;  3MN9 A;  3VGL A;  5BRE A;  4DB3 A;  2IVN A;  2I7P A;  1ZXO A;  2KHO A;  1NGB A;  1NWK A;  3A5L C;  3DJC A;  2P9N A;  1ZBS A;  3O80 A;  3KZB A;  1SQK A;  1HUX A;  3O4W A;  1XC3 A;  2V52 B;  4NO7 A;  2A5X A;  4BRP A;  4CZL A;  2I7N A;  4I6M A;  3VGM A;  3UKR B;  2CH6 A;  5AQM A;  4BGA A;  1BUP A;  4BC4 A;  2Q31 A;  2V7Y A;  1IJJ A;  2E20 A;  4GY2 B;  3CJ7 A;  2Q0U A;  4O8K A;  3KVG A;  5AQN A;  1NGE A;  1NBW A;  3D2F A;  1KAZ A;  4KBO A;  3O1B A;  5BR9 A;  4BC5 A;  4BQL A;  5AQZ A;  4A2A A;  1R59 O;  1MA9 B;  4CBU A;  3UKR A;  4B1Z A;  3P4I A;  2E2P A;  1HLU A;  4JHD B;  4JNE A;  5AQL A;  3VEY A;  1LOT B;  4PKG A;  4BRM A;  2E1Y A;  4J8F A;  3DAW A;  4CZF A;  2P9U A;  3ATU A;  4K42 A;  5BN8 A;  4GNI A;  5KQD A;  4XH5 A;  3ULE B;  5LY3 A;  2IVP A;  2PBD A;  1QQM A;  2YHY A;  4BC2 A;  1HKC A;  1E4G T;  1GLD G;  2HF4 A;  3SMS A;  3M3Z A;  2VWB A;  3I8B A;  4E1J A;  2Q97 A;  3QBW A;  5CE3 A;  5AQX A;  4FWM A;  1BWF O;  3A0I X;  3FZL A;  2PAV A;  4DHY A;  5JLF A;  5AZJ A;  4Y0W A; 
#chains in the Genus database with same CATH topology
 5BRH A;  3LWL A;  3WT0 A;  4FLV A;  1NGH A;  4WQ4 C;  2WC9 A;  4FW2 A;  4BR9 A;  2UUC K;  1HYV A;  2NNW A;  1DLO A;  4CEB A;  3SUN A;  4C8L A;  1A5W A;  1JL2 A;  1OVQ A;  2O8F A;  3J8A A;  1BIU A;  4FO0 A;  3SV4 A;  1K8K A;  3CJ1 A;  1VQ6 N;  4CHN A;  4GW6 A;  5C24 A;  3ZT1 A;  4DLG A;  4M45 A;  3ISN C;  2GX9 A;  3EE9 A;  2HMP A;  5FPD A;  3AY9 A;  1J6Z A;  4DQS A;  4DTS A;  2W41 A;  5FRN A;  3IKM A;  4B8C A;  4XEI A;  1X1P A;  1YJ9 N;  2HND A;  2QWP A;  5BRD A;  2HHQ A;  2ASO A;  1B9D A;  3C65 A;  1KQS M;  4OKJ A;  2ETJ A;  4EP5 A;  4I9L A;  2BE2 A;  4BVO A;  4DR3 K;  3P38 A;  3NH2 A;  1NMN A;  5AQT A;  4F2R A;  3HVR A;  2BAN A;  1RBR A;  1GLB G;  2X6S A;  3D2E B;  3J7Y P;  4J2E A;  1J53 A;  2Q1N A;  1SV5 A;  3NAE A;  1HMV A;  4HUF A;  1VQN N;  1C0T A;  2PFU A;  1VQ4 N;  2G8K A;  1QS4 A;  1K8A O;  4KKO A;  1K73 O;  3E9L A;  4X64 K;  3R3L A;  4CBX A;  2Q2R A;  1W97 L;  5ADX H;  4LF7 K;  3KHY A;  1CZA N;  2GV9 A;  3R6M A;  2XY7 A;  1QE1 A;  3HM9 A;  4CK2 A;  1E4F T;  2D0O A;  4BRG A;  4JRP A;  4DF4 A;  5K14 A;  2B6A A;  3CM5 A;  4LFC K;  4FWN A;  4KRF A;  4WYB A;  1KLN A;  1RDA A;  3SAF A;  4A59 A;  5AQF A;  4DV7 K;  1WAJ A;  3HPH A;  1NJI O;  1U2V B;  2EHG A;  4E89 A;  2FBY A;  4H4M A;  1VQM N;  5CR4 A;  3M8S A;  1X3M A;  2VG5 A;  1BOT O;  3CCS N;  2P9N B;  5C10 A;  1Q8I A;  4FLT A;  1XQS C;  3O8M A;  1NNE A;  2Q36 A;  1WSG A;  4NYF A;  3P5J A;  5HRR A;  1TK5 A;  4Z4G A;  4F4K A;  3HM8 A;  4CF1 A;  3OS2 A;  2W42 A;  3VGK A;  4FJX A;  4CGG A;  3O4N A;  3HXM A;  3FFI A;  2P9I B;  3MX2 A;  1YVN A;  4IEI A;  4LH5 A;  3NDK A;  1S1V A;  3BEX A;  2X78 A;  4N5S A;  2O8B B;  4I9Q A;  4H0O A;  3MDQ A;  2KFN A;  4RG8 A;  1HNV A;  3IS9 A;  4E7J A;  3VEV A;  2GUI A;  4NCB A;  3CCU N;  1KTQ A;  2YHA A;  3GG4 A;  2A3Z A;  1ASW A;  4U7B A;  3ID8 A;  3VQ9 A;  4DTO A;  4ILG B;  5HOO A;  1RTH A;  3SQ4 A;  5F2R A;  4LF4 K;  3KJV A;  5D3G A;  2FBV A;  4B08 A;  3OYJ A;  1C1C A;  3C94 A;  4BR5 A;  2P9P B;  4ZTF A;  3TAE A;  1M1K O;  1LWC A;  1LCU A;  4CZM A;  2PZS A;  3C6T A;  1BU6 O;  4JLH A;  3CCJ N;  3BF3 A;  2HST A;  1LAV A;  1WLJ A;  1Z25 A;  3C7N A;  3EO3 A;  4MLE A;  4CJU A;  1NM1 A;  1SL0 A;  3E9O A;  3A5O C;  3SUO A;  1RT1 A;  2UXB K;  4O4G A;  4WQ5 A;  1WAF A;  1TUU A;  1YJW N;  5FRM A;  3QET A;  1ITG A;  4JAX A;  1N36 K;  4DFM A;  5LMU K;  2HBL A;  3RVC A;  3TTF A;  1K8K B;  4JI3 K;  2VWK A;  3QFP A;  4K43 A;  3WNH A;  4BRO A;  3HL8 A;  4K8Z A;  3G10 A;  1TYQ A;  3KD5 E;  1QHA A;  3WNG A;  3ZEU A;  1GOA A;  3LZJ A;  1RT4 A;  3U8X A;  2D5R A;  1QVF M;  5ADX A;  4DR5 K;  2YV0 X;  1VQO N;  1X9S A;  4JI0 K;  2P9L B;  1RCH A;  4DS5 A;  3C6H A;  3RRG A;  4ISE A;  4U67 L;  2Y1J A;  4DF8 A;  1QSY A;  1RT2 A;  1S3X A;  5AZI B;  2E2Q A;  2IOC A;  4JYA K;  3M1F A;  4AHR A;  3ZSW A;  2NZT A;  1TVR A;  4H5W A;  3M8P A;  1CZ9 A;  3AA3 A;  2YI1 A;  3VEO A;  4E0D A;  2HHX A;  1KXP A;  1LV5 A;  3ZSQ A;  4CJS A;  4W5N A;  1W9H A;  3AVM A;  3UKU B;  3DI6 A;  4BRQ A;  1TYQ B;  4Q0B A;  4MO5 A;  4NB4 A;  3IFR A;  4A62 A;  5C12 A;  3W0L A;  4CEO A;  3LWM A;  2QTD A;  3ZSV A;  1Q86 O;  1KD1 O;  4JD2 B;  2E5L K;  4F3O A;  4R79 A;  3H3N O;  2A1R A;  1XHZ A;  3RR7 A;  4Z4E A;  3AVN A;  4OKE A;  3SYZ A;  4CF9 A;  4H03 B;  3UB5 A;  3ULD A;  2E1Z A;  3OYE A;  2IAJ A;  5AQO A;  3R9P A;  2HOE A;  4NLB A;  4DMN A;  3VQA A;  2A41 A;  4C8M A;  3DLK A;  1W2B M;  5J2P A;  4PKI A;  5CY4 A;  1Y64 A;  4O44 A;  5KPT A;  3VQD A;  4ZHR A;  4MLH A;  1CXQ A;  4B9M A;  4CED A;  4QS8 A;  4W5O A;  1BA1 A;  3QIC A;  4RW8 A;  3PX6 A;  5HRO A;  4A5A A;  1WSE A;  4B9S A;  3OY9 A;  4QAG A;  2W6K A;  4KHP K;  3ZSX A;  3A8Y A;  4OGE A;  1RBV A;  2FSN A;  1ZBI A;  4CJE A;  4LFA K;  5B8H A;  3SZ2 A;  1RDW X;  2ZF5 O;  2HF3 A;  3K57 A;  3PV8 A;  2NRR A;  5EVZ A;  4M3W A;  5JVG L;  3T1A A;  4B3S K;  2Z1I A;  5TKY A;  3E1Y A;  2VCP A;  3CC4 N;  4H8K A;  3T3F A;  3CYM A;  4B1W B;  1UOC A;  4JKH A;  3UE5 A;  2D0P A;  1TK8 A;  3PIO L;  1L3U A;  1VK0 A;  3HYF A;  4DKW A;  3AVL A;  4JKG B;  1X9W A;  1BCM A;  4C8O A;  2IVN A;  1YVU A;  2I7P A;  5HRP A;  2ZM6 K;  3R1X A;  4DFJ A;  5GAE P;  5DK5 A;  2PY5 A;  1NKC A;  4O55 A;  1ZBS A;  1HUX A;  3O4W A;  1TKX A;  4CZL A;  5C0Y A;  3O9S A;  4PWD A;  4GVM A;  4FJ7 A;  2CH6 A;  4CJ3 A;  5DM7 L;  4BC4 A;  4B3O A;  1NKB A;  1KC8 O;  5HL7 L;  3N4P A;  2VQE K;  4YFU A;  3ZSR A;  4E7K A;  4O0J A;  5LMN K;  3O1B A;  4FJK A;  5BR9 A;  4A2A A;  4DV4 K;  1MA9 B;  4JKB A;  4CBU A;  4CES A;  1JLA A;  2KLA A;  2UUB K;  3P83 D;  3K5N A;  3QER A;  3VMF B;  4DTX A;  4CE9 A;  3SUP A;  3ZYY X;  4J8F A;  4AF1 A;  3EE8 A;  2D0A A;  4CZF A;  3L2V A;  4DU4 A;  5BN8 A;  4NXN K;  4DU1 A;  5LY3 A;  4JKC A;  1QQM A;  5LL6 Z;  3NH0 A;  3C6A A;  1JLQ A;  4FJM A;  4JKG A;  1XMO K;  4EZ6 A;  1Q81 O;  4E1J A;  3I8B A;  3MWT A;  5AQX A;  4FWM A;  2OPR A;  3ASM A;  1U45 A;  4K0K K;  1RTI A;  4DHY A;  5JLF A;  3S3O A;  4CGI A;  5JS2 A;  3G6E N;  4IKF A;  4CEF A;  4YNQ A;  4BR4 A;  4IJN A;  2YHX A;  2VQF K;  4YHH K;  4BDP A;  3LL3 A;  1C0F A;  4BRK A;  4W5Q A;  3CFP A;  2O8F B;  4RTF D;  3MN5 A;  2Q3S A;  1NK5 A;  4CJL A;  3KTQ A;  1IO2 A;  3CQ8 A;  4OVL A;  2XO7 A;  1VSM A;  1NK4 A;  3KLG A;  1LW0 A;  3L0Q A;  4CEZ A;  1NMD A;  4N56 A;  4CF8 A;  1KVC A;  1IKW A;  2CGJ A;  3DLE A;  3AVF A;  3LP0 A;  3CFR A;  4IDH A;  4BY9 C;  3KLI A;  4CW7 B;  2ZGY A;  3OTO K;  2AA4 A;  3TTD A;  1C6V A;  4BE1 A;  3T19 A;  3KK3 A;  5AQU A;  4DLE A;  3CQY A;  4C8N A;  1QSL A;  3B6O A;  1JXB A;  1S22 A;  4IFY A;  2CGL A;  4DWI A;  3HBT A;  1JCE A;  1VQ5 N;  3QDK A;  4B1Y B;  3VQ5 A;  1U4B A;  3BDP A;  2GEM A;  4FM2 A;  3A2F A;  3NHG A;  3QFU A;  1Q82 O;  3DRP A;  4HUE A;  3O9U A;  3TAM A;  3CM6 A;  2D0B A;  3AO1 A;  2HBK A;  2FBT A;  2NRZ A;  4F9O A;  4O0I A;  2NRX A;  4CJF A;  3MED A;  3QEV A;  1P8Z A;  3AAP A;  4FVM A;  2HVH A;  4MDB A;  4KH4 A;  4JS4 A;  1VHX A;  3VQP A;  1NGF A;  1BO5 O;  4HCB A;  1HNW K;  3TAR A;  3IAY A;  3SAG A;  5EU7 A;  3SI6 A;  1H1V A;  5EXW A;  3AVC A;  3V9U A;  3L6Q A;  2P9U B;  4Z0U A;  2P5O A;  5AQS A;  4F8R A;  2FSJ A;  3THX A;  3H08 A;  5JLH A;  4PQU A;  4OPJ A;  5HBM A;  4Z4C A;  5AQG A;  3BZC A;  2WUS A;  4BE0 A;  2YHB A;  3THW B;  1YXQ A;  4N41 A;  1KFS A;  1GLJ O;  1ZBF A;  3MX5 A;  4BWJ A;  2KFZ A;  3VEX A;  4CJQ A;  1VSL A;  4DSE A;  3CFO A;  2P9S B;  3OBW A;  3SK3 A;  3PY8 A;  3QBX A;  3R8E A;  4HUG A;  1X9J A;  3RWU A;  5AQK A;  4FZY A;  4AIL C;  3ZSY A;  3LDN A;  4H0X B;  4H5N A;  3VES A;  3D2F B;  2PYJ A;  2GBZ A;  3DXM A;  3ITH A;  3HI0 A;  5E84 A;  3PX4 A;  1SL2 A;  1SKR A;  1KVA A;  5AQY A;  3D2E A;  3OS1 A;  3OYC A;  4B1X B;  3VET A;  3K5L A;  3NF8 A;  3N4Q A;  3VQE A;  4BC3 A;  3F9M A;  3QNN A;  4JI6 K;  1JCF A;  3PX0 A;  5GAG P;  3MCP A;  3DLG A;  1JLB A;  2DY4 A;  4E7H A;  3NVK A;  2QXL A;  3QML A;  3U6F A;  1S9E A;  4OX9 K;  2P9K A;  3CCL N;  4IDK A;  2EX3 A;  1J9A A;  3SBT A;  4CZG A;  5KQ8 A;  4N76 A;  1YT3 A;  4QS7 A;  3L2R A;  1Q18 A;  4DQI A;  4V19 S;  4DR4 K;  4IG0 A;  1NJX A;  3AVJ A;  2D0C A;  3J81 O;  2E6M A;  4DV1 K;  4IOX A;  1GLA G;  3DOK A;  3DLL L;  3HP6 A;  5AQR A;  4DSI A;  1OVY A;  4CZK A;  1XUP O;  4JD2 A;  1U6Z A;  2NUB A;  4DSK A;  5EOY A;  3HOS A;  3RTV A;  4E7L A;  4NCG A;  4KFB A;  1WB9 A;  3RMA A;  4Y1C A;  2O8C B;  1RNH A;  1I3A A;  1B9F A;  1NOZ A;  3V81 A;  2GUP A;  2CH5 A;  4BRF A;  4DG1 A;  4BRE A;  2JWK A;  2P5G A;  3SBG A;  3JAM O;  1GLL O;  3WXL A;  2FF3 B;  4I2P A;  1REV A;  3G0Z A;  3L2U A;  5KI6 A;  4KHS A;  3B6P A;  4RW7 A;  1U48 A;  1HYZ A;  1T6D A;  5KRT A;  5GIO A;  1A5V A;  1J54 A;  5AR0 A;  1ZBU A;  2E2N A;  2A42 A;  1XNR K;  1VQ7 N;  2KQ2 A;  4CEC A;  3KLH A;  4H0V B;  3GE1 A;  3VEW A;  3VER A;  3CCM N;  1KLM A;  1HQE A;  4OJR A;  3M6G A;  2IIR A;  3J7A P;  3FGU A;  1MWM A;  3JXU A;  3VQ8 A;  3NGI A;  5AQI A;  2F9W A;  4BDY A;  4O8U A;  3OYD A;  3U4L A;  1EXQ A;  1NJY A;  2WON A;  1O1W A;  3RMB A;  5AZJ B;  1E3M A;  4B9V A;  4KTW A;  3EEQ A;  2A40 A;  4GKJ K;  2G8I A;  3VQC A;  5AQQ A;  1BDG A;  2WTU A;  3K0S A;  1L3V A;  4FLW A;  3OBY A;  4KRE A;  3AVG A;  2ZGZ A;  3C7N B;  4CHO A;  4QS9 A;  4YOW A;  4AHC A;  3WNF A;  1QSS A;  4CVN E;  2QW9 A;  3WEE A;  4RW6 A;  5CZ1 A;  4KHN A;  2ZWH A;  5JS1 A;  5KGW A;  2DTU A;  3HSC A;  3WXJ A;  3OYH A;  1T6C A;  4KV8 A;  4DQ8 A;  2ITM A;  3AA2 A;  1T3V A;  4HTL A;  4M3Y A;  2GWJ A;  3ZT3 A;  4FW1 A;  1ATR A;  2FLO A;  3VF2 A;  2JLE A;  3V9W A;  4O5B A;  3DWL A;  4QOZ B;  4KB1 A;  1SZ2 A;  3MAQ A;  3LAN A;  1XI1 A;  3DXM B;  4EIA A;  4CEA A;  1EKE A;  2VWJ A;  3ALY A;  4FWS A;  4FZX C;  3CJC A;  3ATV A;  3I8D A;  3CPW M;  4HCC A;  4FK2 A;  5GAH P;  1RDU A;  4FJ5 A;  4E1N A;  4X65 K;  1NGA A;  2OZM A;  2P9K B;  5J1E A;  3L2W A;  2AP1 A;  2RN2 A;  3V1O A;  1C1A A;  1IKY A;  2YJF A;  2IGI A;  1M90 O;  4LC9 B;  3OYL A;  5BPL A;  1WUA A;  3OYN A;  1F21 A;  3ZSO A;  4CJW A;  3QEX A;  1BHL A;  4CCH A;  4FJH A;  2VG7 A;  1K6Y A;  1LAW A;  3ZEU B;  4KHU A;  2Z1G A;  3H46 O;  2DFE A;  4DR2 K;  4BRD A;  1VAZ A;  3SNN A;  5IT9 O;  3VEZ A;  1HKB A;  2HBM A;  2ZE2 A;  3CI5 A;  3EKU A;  5AFU H;  3CD6 N;  4BE2 A;  3F5T A;  4CEE A;  4ELV A;  5M1K A;  4BWM A;  3U3G A;  3VEN A;  3PSI A;  1Q9X A;  2WOM A;  2NRV A;  4AHV A;  3HTV A;  3MWP A;  4H4O A;  3AO4 A;  5AFU A;  3CQX A;  3AVA A;  3L4I A;  2FF6 A;  4CFC A;  4CEQ A;  4JN4 A;  3MN9 A;  4B9T A;  5BRE A;  1WBD A;  2KZM A;  4DB3 A;  3OYG A;  4DSJ A;  1ZXO A;  3VQ6 A;  1NWK A;  5T7B A;  3OJU A;  2HHT A;  1NK7 A;  3O80 A;  4G1Q A;  3F9K A;  2V52 B;  2A5X A;  4GMJ B;  1Y97 A;  2I7N A;  5J2N A;  1EET A;  3VGM A;  2B5J A;  3AVK A;  3UKR B;  4E3S A;  4M3T A;  2Z1J A;  3M5R A;  3TAB A;  5AQM A;  1TV6 A;  3J80 O;  2Q0U A;  4O8K A;  4HHT A;  2G8W A;  1NGE A;  4DSL A;  4PY5 A;  1SS6 A;  4OPA A;  4BQL A;  4ICL A;  5TKW A;  5M1F A;  3LAL A;  4WF9 L;  4GV3 A;  2YNF A;  3P4I A;  2E2P A;  4JHD B;  4FCY A;  1LOT B;  3SV3 A;  1RT5 A;  4B8A B;  4E19 A;  2ZQB A;  4CFB A;  1YHQ N;  1VSF A;  3ATU A;  4GNI A;  4OPK A;  3MXI A;  2IVP A;  4BC2 A;  4KH6 A;  1MU2 A;  1S6Q A;  3HT3 A;  1D9D A;  1NK9 A;  3SMS A;  4FYD A;  2Q97 A;  3DYA A;  5A2Q O;  3RMD A;  4WE1 A;  1S6P A;  4FLX A;  3AV9 A;  1JLC A;  3M8R A;  3ZT2 A;  3GBT A;  3OJS A;  3SUQ A;  3LDQ A;  2F8T A;  2OTL N;  3I33 A;  4A57 A;  2F9T A;  1T05 A;  4A5B A;  1FK9 A;  3ZX3 A;  3BP8 A;  2X74 A;  4IXC A;  4CZH A;  3U3Y A;  2BTF A;  4LF9 K;  4M3X A;  2P9S A;  4BRL A;  4FWR A;  3TAN A;  4CHP A;  4IZ9 A;  2QK9 A;  3H6E A;  1S5J A;  5FPN A;  1T03 A;  4KHY A;  2E8A A;  3CET A;  3LAM A;  2UYT A;  3THX B;  4FWK A;  4FVU A;  1ZBH A;  3O6W A;  4CGF A;  1D9F A;  3KKS A;  3SLC A;  4JI4 K;  3ENO A;  5KPZ A;  5EX5 A;  4DR1 K;  2XY5 A;  1N5Y A;  2PYL A;  2OYQ A;  3CC7 N;  1Z05 A;  3OYM A;  4CZJ A;  3KIO A;  4B9Q A;  3OYA A;  1UA0 A;  3ZT4 A;  3HRG A;  2YKN A;  3AO3 A;  2QWQ A;  1NG9 A;  1JLG A;  1BCO A;  1KVB A;  1UWB A;  4L3Q A;  1S1T A;  1J5E K;  1T44 A;  1KAX A;  3QEI A;  4FM0 A;  3EZW A;  1HX1 A;  4DFK A;  3O08 A;  5M1N A;  1OH5 A;  1OH7 A;  4M7X A;  4CJ7 A;  4IG3 A;  4DTM A;  4GV6 A;  3FFK B;  2ZJP L;  1CLQ A;  3DRS A;  4WQ5 C;  3BUZ B;  2W6L A;  5CHI A;  5BPN A;  2HB5 A;  4ILJ A;  2YJE A;  4NLC A;  3AGR A;  3TWH A;  3NMU A;  3NF6 A;  5BN9 A;  4BDZ A;  3SAH A;  3G25 A;  1EP4 A;  1QQN A;  4B3R K;  5SWM A;  4X66 K;  3MK6 A;  3ENH A;  2OPS A;  1NGI A;  4C1N I;  1SUQ A;  4DTU A;  4ISF A;  2QWO A;  1TKT A;  4YOU A;  3SPY A;  1TUY A;  4JKE A;  4KAZ A;  3LDL A;  2UUA K;  3CER A;  3H1V X;  4RW9 A;  1L5U A;  3EKS A;  4K8X A;  4Z4I A;  1DEJ A;  3WXK A;  4YDU C;  5IWA K;  1TGO A;  2HHH K;  3DLR A;  4PL7 A;  2Z1H A;  4CF2 A;  1HNX K;  4DTP A;  1LW2 A;  4AM7 A;  4NCA A;  4Z4F A;  2EWS A;  3W3D A;  3BGR A;  5J2M A;  4FJI A;  1G15 A;  4CIE A;  5FPE A;  5GIN A;  2VG6 A;  1I39 A;  2QA4 N;  4XH1 A;  4BVP A;  3ZX0 A;  1U04 A;  3FZK A;  2GEL A;  4JHD A;  4M7Y A;  3K58 A;  3TPQ A;  4RCH A;  3ID6 A;  1RDC A;  4B1V A;  2YNH A;  4OKK A;  3RR8 A;  4MQ3 A;  3WEE B;  1HRH A;  1VRT A;  1W7A A;  1WSF A;  1N33 K;  5I9E B;  4IOC L;  2RE2 A;  2F96 A;  5LJW A;  1N8R O;  5FPM A;  3SJJ A;  4CHQ A;  3C95 A;  4C23 A;  2BGG A;  3D0P A;  5KPR A;  4AHU A;  3VA3 A;  2UXC K;  4FJN A;  4Z4H A;  5HLF A;  3HOT A;  1BIZ A;  2Q0R A;  3IUC A;  3ZET A;  2IDO A;  1YIT N;  4CZE A;  2V51 B;  2GWK A;  3QB0 A;  1BA0 A;  2HHV A;  4DV5 K;  2NRT A;  1XMQ K;  2NLX A;  4ISG A;  3RMC A;  1L3S A;  2QWR A;  2VGM A;  1NK0 A;  4C8K A;  4W5R A;  4CIG A;  4OLB A;  2O8D B;  3IDH A;  4PHT X;  5J2Q A;  4MO4 A;  3O4Q A;  5M1Q A;  5HRS A;  3NF7 A;  1NGD A;  4BQZ A;  4JS5 A;  4OPH A;  1ZYQ A;  3CCR N;  5ELZ A;  3CXC M;  5KRS A;  3V6D A;  1S1W A;  2IVO A;  1ASV A;  3CCQ N;  2F4V K;  3GOI A;  4EZ9 A;  3CCE N;  3FZF A;  3KWI A;  3TAG A;  4LSN A;  5C42 A;  1RBS A;  5I3U A;  1SKS A;  3C0B A;  3S9H A;  4B1U B;  4JKF A;  4FJ9 A;  2KZZ A;  1CZB A;  4AQY K;  3NBP A;  1S72 N;  3ZLJ A;  4IO9 L;  5F1X A;  1Z26 A;  2QEX N;  4CBW A;  1RTD A;  4WCE L;  4K25 A;  3H3O B;  1DTQ A;  4DFP A;  4GVE A;  3LPT A;  4I7F A;  4YDU A;  4CGH A;  1VQK N;  3LDP A;  1HPZ A;  4GV9 A;  3LP2 A;  1RFQ A;  4PA1 A;  2VGN A;  4FWO A;  1EQY A;  3VQB A;  1JCG A;  2HHW A;  4FJJ A;  3MEE A;  3TSU A;  3Q7B A;  4FJ8 A;  1IG8 A;  2E2O A;  3O5B A;  4DV2 K;  3WUH A;  1TL3 A;  4BGB A;  4JI7 K;  2FBX A;  1NU0 A;  3EN9 A;  3HO1 A;  1BG3 A;  4JRQ A;  4CGJ A;  3B8A X;  3I0S A;  2H3G X;  4FXD A;  2HHU A;  3QIO A;  3OS0 A;  1JXE A;  4JKA A;  3H45 C;  1IBM K;  2QM1 A;  4CF0 A;  3QEP A;  1DT9 A;  2ZD1 A;  4FOE A;  3LZI A;  4CJV A;  4J2A A;  2RPI A;  3TAP A;  3VF4 A;  4LSL A;  3PUF A;  3NF9 A;  1QTM A;  1WBB A;  2JWL A;  3V1Q A;  1GLC G;  4MDA A;  1YUW A;  2ASM A;  3NFA A;  2X6N A;  1RBU A;  5FDL A;  3ZT0 A;  3JYT A;  2O4I A;  1RT3 A;  4DU3 A;  4JI5 K;  3PSF A;  2P9L A;  4EHU A;  1NGC A;  4WFN L;  4B9U A;  3HP9 A;  2ZJR L;  2Y1I A;  1NK6 A;  1RIL A;  1FKP A;  4N47 A;  1V4S A;  4ZTJ A;  2O8C A;  2OPQ A;  3D45 A;  4Q5V A;  3CC2 N;  1IBK K;  4OO1 J;  3I55 N;  5GAD P;  2O8E B;  1XWL A;  2OA8 A;  3WQT A;  3HZ6 A;  3MMV A;  3VOV A;  4CD1 A;  3HJF A;  2BDP A;  4JK9 A;  4XH4 A;  2BUP A;  3AO2 A;  3LM2 A;  1C0U A;  3BY5 A;  2HMI A;  4H0T B;  4ID1 A;  3CG7 A;  4ID5 A;  5FLX O;  4FOI A;  4BRA A;  3QO9 A;  1TAQ A;  2RKI A;  1NGJ A;  3IRX A;  4E1M A;  1EWQ A;  5CYQ A;  1S9G A;  3MN6 A;  5MLC Q;  4JI2 K;  1IV0 A;  4FK0 A;  3BF1 A;  2BH1 A;  1WOQ A;  4DV6 K;  1NJW A;  4KHQ A;  4FK4 A;  3P1G A;  3AA5 X;  2UU9 K;  4LY7 A;  1TK0 A;  5GIP A;  4CER A;  4NXM K;  3MXM A;  4JKD A;  3KZB A;  3O9R A;  1SQK A;  1XC3 A;  3EYZ A;  3T1H K;  4BRP A;  3LPU A;  4M42 A;  4J2D A;  4I6M A;  5KGX A;  1JLF A;  3QEW A;  4BGA A;  1BUP A;  1WN7 A;  2Q31 A;  1T8E A;  2ITG A;  2E20 A;  3CJ7 A;  5AQN A;  3D2F A;  5CZ2 A;  1KAZ A;  4IFE A;  2DFF A;  4KBO A;  1R0A A;  2OPP A;  4X62 K;  1VQ9 N;  5AQZ A;  3IG1 A;  1R59 O;  1Q9Y A;  4FLU A;  1VQ8 N;  3UKR A;  2HVI A;  4B1Z A;  1FKO A;  3SQ0 A;  3THV A;  4KI4 A;  3LAK A;  4JNE A;  1HLU A;  4M3R A;  3T7Z A;  1Q7Y O;  4LF6 K;  3MEC A;  4PKG A;  5M1O A;  4BRM A;  3QNO A;  3OYK A;  3DAW A;  3TTC A;  5KQD A;  4M3Z A;  3ULE B;  4F3T A;  2PBD A;  1WSI A;  4B3M K;  4GKK K;  1HKC A;  1E4G T;  3AGK A;  2HF4 A;  2VWB A;  4WFA L;  3QBW A;  3O9Q A;  3A0I X;  3FZL A;  4XIU A;  5AZJ A;  1IBL K;  3TI0 A;  4Y0W A;  1TKZ A;  2YX6 A;  3SCX A;  3VPZ A;  3HPO A;  1D4X A;  2FC0 A;  3NH1 A;  3SPZ A;  1EO1 A;  2I5J A;  4OLA A;  4BRH A;  2A1S A;  4AM6 A;  1J5O A;  2F8S A;  1A5X A;  3WXM B;  3L4Q A;  3L8B A;  3O9T A;  2A6A A;  3LP1 A;  4DTN A;  3D6R A;  4EAH D;  4E7I A;  4FM1 A;  3OHR A;  1VSE A;  3AVH A;  4CJR A;  4M3U A;  1NLV A;  3V9Z A;  1MDU B;  2OCE A;  2G8V A;  3T69 A;  3V9S A;  5AZI A;  3TAQ A;  3L3U A;  2V7Z A;  2FXU A;  3OYF A;  1JLE A;  5FRO A;  4I2Q A;  4LFB K;  1RBT A;  1YI2 N;  4LD0 A;  5F0X A;  4PUO A;  4DS4 A;  3NVM A;  2OAN A;  4DR7 K;  1YF5 L;  3HVT A;  1DTT A;  3G71 N;  1TAU A;  2YCH A;  4IWV A;  2CGK A;  1JJ2 M;  4G9Z A;  1VSK A;  1S1X A;  4BAC A;  1WSH A;  3NGY A;  4DUZ K;  4ILH A;  4KO0 A;  1DGK N;  3AVB A;  4HWI A;  1HJR A;  4DR6 K;  1UAX A;  1KSP A;  2O4G A;  3M8Q A;  4FPA A;  3KKR A;  2HNZ A;  5BRF A;  4WQ4 A;  1C1B A;  4CGD A;  1Z6R A;  1ZBL A;  1BI4 A;  1C0G A;  1LWF A;  3RSE A;  1HYS A;  5JIC A;  3V1R A;  4DSF A;  3KD1 E;  3E9P A;  4ELU A;  5C2D A;  1YTU A;  2XHB A;  3S3M A;  1XNQ K;  4FWL A;  3KK7 A;  1UA1 A;  3P31 A;  2E6L A;  4RWT A;  1P90 A;  1HNI A;  2ZJQ L;  3NCI A;  3MN7 A;  1G99 A;  4B3T K;  2HW3 A;  4O5F A;  3E01 A;  4CHY A;  5KTQ A;  3OYI A;  1SL1 A;  2R7Y A;  3HPG A;  1VSH A;  4KB0 A;  4FLY A;  2W40 A;  1U47 A;  2KW4 A;  3MXJ A;  3GDQ A;  4FSV A;  4MFB A;  3TR8 A;  1ESV A;  4BG8 A;  3O1W A;  4JI8 K;  4CI6 A;  3K9J A;  4K41 A;  4AHT A;  4EFH A;  1HNZ K;  3CIP A;  2D1K A;  1JKH A;  3VTI A;  1VQL N;  4CHZ A;  2HBJ A;  3IMX A;  2O8B A;  5HRN A;  4BRI A;  2DFH A;  1MWK A;  3ZSZ A;  4CIF A;  3TSQ A;  4YOV A;  2P9I A;  3JSM A;  4ELT A;  2YNI A;  1SKW A;  4DQR A;  2E4L A;  3T1Y K;  4DTJ A;  3UKU A;  1QQO A;  2RF2 A;  4JK8 A;  1OH8 A;  5JMV A;  5SZT A;  3THW A;  1DKG D;  3AAR A;  3NGZ A;  3SQ2 A;  4CZI A;  4R5P A;  3EZ5 A;  4KH5 A;  3WXI A;  1RDB A;  4LH4 A;  4PL8 A;  5AQH A;  5AQW A;  5EY4 A;  2D4W A;  3CCV N;  5C25 A;  3DM2 A;  3A5M C;  3ZET B;  4CJ5 A;  3EY1 A;  4J2B A;  1FW6 A;  4BRN A;  2YKM A;  3VTH A;  3E66 A;  3FE1 A;  2DPN A;  1L3T A;  2QI2 A;  2P51 A;  2WFB A;  4YOT A;  1VSI A;  1VRU A;  2WBN A;  1VSJ A;  3VQQ A;  1BQM A;  4FWQ A;  4H0P A;  4Y1D A;  4DV0 K;  4DQP A;  4F2S A;  4I6M B;  3BZK A;  1HPM A;  2G8U A;  4C1N K;  4BRC A;  5BR8 K;  5C15 A;  2KTQ A;  2XY8 A;  1HJO A;  3S3N A;  1RTJ A;  3THY A;  1RGI A;  4IBN A;  4CK1 A;  2OZS A;  1KRP A;  3O3H A;  4LF8 K;  3K59 A;  2P9P A;  1FXX A;  1GLE G;  4BR2 A;  1YAG A;  2AJQ A;  2P1J A;  4PKH A;  3AA4 A;  3RSE B;  1W0H A;  5AQJ A;  1YJN N;  5E26 A;  3DXK B;  2LSN A;  1BGX T;  3LM9 A;  2HNY A;  2KKZ A;  2NRW A;  2UXD K;  1V4T A;  3CJ9 A;  4EP4 A;  3CJA A;  3HST B;  1C0M A;  1ZC6 A;  3AVI A;  1N34 K;  4WFB L;  3O3G A;  2YHW A;  3LDS A;  3OA9 A;  3QES A;  1XC9 A;  3P39 A;  1IH7 A;  3FR0 A;  3KWG A;  1BQN A;  1QQC A;  3HK2 A;  1QVG M;  4EHT A;  3WNE A;  4FJL A;  4IO8 A;  4CK3 A;  3KK1 A;  1ATS A;  2VYP A;  1XHX A;  1D8Y A;  1OKJ A;  4Z94 A;  5I42 A;  4FLZ A;  4UQG A;  4KPY A;  2JGU A;  5JVH L;  4QCL A;  1QZ5 A;  5E41 A;  1KAY A;  4YOY A;  3S41 A;  1YIJ N;  4BR7 A;  1GOB A;  3K2P A;  3ZX2 A;  3L2Q A;  3SMP A;  5CYM A;  4H5V A;  5AQP A;  2IS3 A;  2FSK A;  2IC3 A;  3CHW A;  2O8D A;  3VN5 A;  2RHK A;  3AAQ A;  3ENB A;  1QHT A;  3RRH A;  1U2V A;  4H5T A;  4CJT A;  1EWR A;  4AHS A;  4A61 A;  2QWN A;  5LJV A;  3K5O A;  5AJ3 K;  4IFV A;  1HKG A;  3EL2 A;  4KHW A;  3SJH A;  3CJB A;  3LP3 A;  2O8E A;  2GTD A;  3TU5 A;  1GLF O;  2QKB A;  2NRH A;  3F2K A;  4IOA L;  2ATQ A;  1NJZ A;  4H0Y B;  4BG9 A;  3A5N C;  5DM6 L;  4UY8 O;  3LDO A;  1U49 A;  4IJA A;  2G8F A;  1IKV A;  4FZZ A;  2J4R A;  3CF5 L;  3U9D A;  5DMR A;  5BPM A;  1QZ6 A;  4M63 C;  4A2B A;  1RT7 A;  2F7T A;  3ULE A;  3CPE A;  4CD3 A;  4DUY K;  4DV3 K;  4FPB A;  2QWL A;  1NOY A;  1GOC A;  3J7Z O;  1WSJ A;  3OYB A;  5HP1 A;  1N32 K;  4RW4 A;  1TL1 A;  3UIQ A;  5AQV A;  4W5T A;  3I56 N;  3WQU A;  2QWM A;  1WNS A;  1EX4 A;  1X9M A;  4LF5 K;  2XY6 A;  3QIP A;  2ASP A;  4DQQ A;  3D7E O;  4BR0 A;  3TSP A;  3KK2 A;  2XRI A;  3FZH A;  2QKK A;  2G8H A;  4FL9 A;  1KFD A;  1IG9 A;  1NGG A;  3JS6 A;  3FZM A;  1IKX A;  3NE6 A;  1BI4 B;  1D5A A;  1X3N A;  3VQ7 A;  2E88 A;  4FWP A;  3O3F A;  3QIN A;  5M1P A;  3GL1 A;  3MCA B;  3DXK A;  4HTU A;  2HHS A;  4OGC A;  3FLC O;  3K9K A;  3PO4 A;  1ILY A;  3H1Q A;  4NYN A;  3ZCM A;  4CJ4 A;  4H5R A;  3MEG A;  3K5M A;  1JL1 A;  3G4S N;  3V4I A;  4DCH A;  3KLE A;  3THY B;  3VF6 A;  3U9Z A;  1SAZ A;  3VGL A;  1ATN A;  4CJP A;  4L8R B;  3I0R A;  1LWE A;  4JEP A;  3DOL A;  1K9M O;  2KHO A;  4JK7 A;  1NGB A;  4JI1 K;  3PLA A;  3A5L C;  3DJC A;  4FJG A;  2P9N A;  1YTA A;  3F73 A;  4JV5 K;  3DLB A;  4M41 A;  1CXU A;  4NO7 A;  1BL3 A;  4CFA A;  1O13 A;  2OTJ N;  1NK8 A;  2B4J A;  1HQU A;  2QXF A;  3DRR A;  3DMJ A;  3KLF A;  5H1S Q;  1I94 K;  1KCF A;  4B9L A;  3VQ4 A;  2V7Y A;  1IJJ A;  4GY2 B;  3KVG A;  3Q7C A;  4IEE A;  1NBW A;  4YOR A;  1S1U A;  4DTR A;  3C6U A;  4KTZ A;  3TAF A;  3PIP L;  4BC5 A;  1TKD A;  3DLH A;  3V9X A;  4KTQ A;  1BIS A;  4YOX A;  2YNG A;  3CME N;  5AQL A;  3L3V A;  3VA0 A;  4TSX A;  3VEY A;  3OW2 M;  1OH6 A;  2E1Y A;  4YY3 K;  1FJG K;  1NKE A;  4CJK A;  2P9U A;  3SQ1 A;  4K42 A;  4HVJ A;  1T7P A;  1ASU A;  4CFD A;  4XH5 A;  4AH9 A;  2YHY A;  4B9N A;  3OVN A;  1GLD G;  1RT6 A;  3M3Z A;  3QLH A;  5CE3 A;  4KI6 A;  3PO5 A;  1BWF O;  5C2F A;  2PAV A;  1N6Q A;  1VSD A;  3AO5 A;  1B92 A;  1HR0 K;  3CMA N;  1RDD A;  1VQP N; 
#chains in the Genus database with same CATH homology
 2YX6 A;  3VPZ A;  5BRH A;  3GBT A;  3LDQ A;  1D4X A;  3WT0 A;  1EO1 A;  1NGH A;  4IJN A;  2YHX A;  4BR4 A;  2OTL N;  3I33 A;  3LL3 A;  1C0F A;  4BRK A;  4WQ4 C;  4BRH A;  4A57 A;  2WC9 A;  2F9T A;  4RTF D;  4AM6 A;  3WXM B;  4A5B A;  3ZX3 A;  3MN5 A;  3L4Q A;  4BR9 A;  3BP8 A;  3O9T A;  2A6A A;  4IXC A;  4CZH A;  2BTF A;  2P9S A;  2NNW A;  4BRL A;  3D6R A;  4EAH D;  4FWR A;  3J8A A;  3L0Q A;  3OHR A;  4FO0 A;  1NMD A;  1K8K A;  3CJ1 A;  1VQ6 N;  4IZ9 A;  2CGJ A;  1NLV A;  3H6E A;  5FPN A;  1MDU B;  2E8A A;  3CET A;  2UYT A;  3T69 A;  4FWK A;  4IDH A;  5AZI A;  4BY9 C;  4FVU A;  2V7Z A;  2FXU A;  2ZGY A;  2GX9 A;  3EE9 A;  3O6W A;  2HMP A;  5FPD A;  3AY9 A;  2AA4 A;  3SLC A;  3TTD A;  1YI2 N;  1J6Z A;  5F0X A;  5AQU A;  2W41 A;  3ENO A;  3IKM A;  5KPZ A;  4XEI A;  1YJ9 N;  2QWP A;  3CQY A;  5EX5 A;  3NVM A;  2OAN A;  5BRD A;  2ASO A;  1S22 A;  3CC7 N;  2CGL A;  1YF5 L;  3HBT A;  1JCE A;  1Z05 A;  1VQ5 N;  3QDK A;  4B1Y B;  3C65 A;  1KQS M;  3G71 N;  4CZJ A;  4B9Q A;  2YCH A;  2GEM A;  4IWV A;  2CGK A;  3HRG A;  1JJ2 M;  4G9Z A;  2QWQ A;  3QFU A;  1Q82 O;  4L3Q A;  3O9U A;  4BVO A;  1T44 A;  3P38 A;  1KAX A;  4ILH A;  5AQT A;  1DGK N;  4HWI A;  2HBK A;  1GLB G;  3EZW A;  1HX1 A;  2NRZ A;  3D2E B;  4F9O A;  2NRX A;  3O08 A;  5M1N A;  2Q1N A;  4FPA A;  5BRF A;  4WQ4 A;  4M7X A;  1Z6R A;  1P8Z A;  3AAP A;  1VQN N;  4CJ7 A;  4GV6 A;  3FFK B;  2ZJP L;  1C0G A;  4MDB A;  4KH4 A;  3RSE A;  1NGF A;  4WQ5 C;  1BO5 O;  2PFU A;  5JIC A;  1VQ4 N;  3BUZ B;  5CHI A;  5BPN A;  1K8A O;  1K73 O;  3SAG A;  3E9L A;  3E9P A;  4ILJ A;  1H1V A;  2YJE A;  4NLC A;  5C2D A;  3R3L A;  5EXW A;  4CBX A;  2Q2R A;  1W97 L;  3AGR A;  5ADX H;  3NMU A;  4FWL A;  3L6Q A;  3KK7 A;  5BN9 A;  2P9U B;  3SAH A;  3KHY A;  3P31 A;  1CZA N;  3G25 A;  4RWT A;  3R6M A;  1P90 A;  2ZJQ L;  5AQS A;  1E4F T;  2FSJ A;  1G99 A;  1QQN A;  3MN7 A;  2D0O A;  4BRG A;  5JLH A;  4O5F A;  3MK6 A;  5AQG A;  2WUS A;  3ENH A;  1YXQ A;  1NGI A;  1GLJ O;  4C1N I;  3MX5 A;  4ISF A;  2W40 A;  3VEX A;  4FWN A;  3GDQ A;  4FSV A;  4WYB A;  2P9S B;  3OBW A;  3SK3 A;  2QWO A;  4YOU A;  1ESV A;  4BG8 A;  3QBX A;  3O1W A;  1TUY A;  4JKE A;  3R8E A;  1X9J A;  3SAF A;  4A59 A;  4CI6 A;  5AQF A;  3LDL A;  5AQK A;  3CER A;  3H1V X;  3K9J A;  3EKS A;  4K41 A;  1DEJ A;  1U2V B;  3LDN A;  3WXK A;  4YDU C;  4H0X B;  4EFH A;  1NJI O;  4H5N A;  3CIP A;  3VES A;  1VQM N;  2D1K A;  3D2F B;  3VTI A;  4PL7 A;  1VQL N;  1Q81 O;  3DXM A;  5E84 A;  2HBJ A;  3HI0 A;  3IMX A;  5CR4 A;  4BRI A;  4AM7 A;  1MWK A;  5AQY A;  2EWS A;  3D2E A;  4B1X B;  3VET A;  1X3M A;  3W3D A;  3TSQ A;  4YOV A;  2P9I A;  3N4Q A;  1BOT O;  3F9M A;  4BC3 A;  2P9N B;  3CCS N;  5C10 A;  1JCF A;  1XQS C;  5GAG P;  3MCP A;  3O8M A;  5FPE A;  3UKU A;  5GIN A;  2QA4 N;  3NVK A;  1QQO A;  2Q36 A;  2QXL A;  4XH1 A;  3QML A;  4JK8 A;  3ZX0 A;  4BVP A;  5JMV A;  3FZK A;  3HM8 A;  1DKG D;  3CF5 L;  2GEL A;  2P9K A;  3AAR A;  3CCL N;  3VGK A;  4JHD A;  4M7Y A;  4CZI A;  3TPQ A;  4RCH A;  3SBT A;  4KH5 A;  3ID6 A;  3WXI A;  4CZG A;  5KQ8 A;  4B1V A;  4PL8 A;  2P9I B;  3MX2 A;  4QS7 A;  1YVN A;  5AQH A;  1Q18 A;  3WEE B;  4IEI A;  5AQW A;  5EY4 A;  2D4W A;  3BEX A;  3CCV N;  5I9E B;  4H0O A;  3MDQ A;  3A5M C;  4IOC L;  2RE2 A;  5LJW A;  1N8R O;  3ZET B;  5FPM A;  4IOX A;  1GLA G;  3VEV A;  3DLL L;  5AQR A;  4C23 A;  5KPR A;  1OVY A;  3CCU N;  4CZK A;  4BRN A;  3GG4 A;  2A3Z A;  1XUP O;  4U7B A;  3VTH A;  3HOT A;  3E66 A;  2Q0R A;  3ID8 A;  4JD2 A;  1U6Z A;  3FE1 A;  3IUC A;  4ILG B;  3ZET A;  2DPN A;  5HOO A;  1YIT N;  5F2R A;  2QI2 A;  2WFB A;  5EOY A;  4CZE A;  3HOS A;  2V51 B;  2GWK A;  4BR5 A;  4YOT A;  2P9P B;  3QB0 A;  2WBN A;  1BA0 A;  4FWQ A;  4H0P A;  2NRT A;  4I6M B;  2NLX A;  4ISG A;  1M1K O;  1HPM A;  1LCU A;  4CZM A;  2QWR A;  2VGM A;  4C1N K;  4BRC A;  5C15 A;  1BU6 O;  3IDH A;  2GUP A;  1HJO A;  2CH5 A;  4PHT X;  4BRF A;  4BRE A;  2JWK A;  3CCJ N;  3BF3 A;  4MO4 A;  1RGI A;  2HST A;  3SBG A;  1GLL O;  3WXL A;  5M1Q A;  2FF3 B;  3C7N A;  1NGD A;  3EO3 A;  4BQZ A;  2P9P A;  1GLE G;  4OPH A;  4BR2 A;  1YAG A;  4MLE A;  3CCR N;  1NM1 A;  5ELZ A;  3E9O A;  3CXC M;  3A5O C;  4PKH A;  3RSE B;  1T6D A;  5AQJ A;  1YJN N;  2IVO A;  5E26 A;  5GIO A;  4WQ5 A;  3DXK B;  3LM9 A;  1TUU A;  5AR0 A;  3CCQ N;  1YJW N;  2E2N A;  2A42 A;  3GOI A;  2NRW A;  2KKZ A;  4JAX A;  1VQ7 N;  3CCE N;  3FZF A;  3KWI A;  1V4T A;  3CJ9 A;  2HBL A;  3CJA A;  4H0V B;  3RVC A;  3TTF A;  3GE1 A;  3VEW A;  1K8K B;  3VER A;  3CCM N;  3C0B A;  3QFP A;  1ZC6 A;  4K43 A;  4BRO A;  4WFB L;  2YHW A;  4B1U B;  3M6G A;  3OA9 A;  2IIR A;  4JKF A;  3FGU A;  1MWM A;  1TYQ A;  3JXU A;  5AQI A;  2F9W A;  1QHA A;  4O8U A;  1S72 N;  3P39 A;  3ZEU A;  3FR0 A;  3U4L A;  4IO9 L;  3KWG A;  3U8X A;  5F1X A;  2QEX N;  1QVF M;  4CBW A;  5ADX A;  1QVG M;  4EHT A;  4IO8 A;  4WCE L;  5AZJ B;  1ATS A;  2VYP A;  1VQO N;  1OKJ A;  3H3O B;  4K25 A;  4Z94 A;  2A40 A;  2P9L B;  5JVH L;  5AQN A;  1QZ5 A;  1BDG A;  3C6H A;  5AQQ A;  4ISE A;  4U67 L;  1KAY A;  4GVE A;  4YOY A;  3S41 A;  1YIJ N;  3OBY A;  4YDU A;  4BR7 A;  3C7N B;  2ZGZ A;  3ZX2 A;  4QS9 A;  4YOW A;  1VQK N;  3LDP A;  1S3X A;  5AZI B;  2E2Q A;  3SMP A;  2QW9 A;  4H5V A;  5AQP A;  3M1F A;  3WEE A;  4GV9 A;  1RFQ A;  2ZWH A;  2FSK A;  3CHW A;  2NZT A;  3HSC A;  2RHK A;  3AAQ A;  2VGN A;  4FWO A;  1EQY A;  2YI1 A;  3ENB A;  4H5W A;  1JCG A;  3VEO A;  1U2V A;  4H5T A;  3WXJ A;  1KXP A;  3TSU A;  3Q7B A;  1IG8 A;  1T6C A;  2E2O A;  3O5B A;  3WUH A;  4A61 A;  2QWN A;  4DQ8 A;  2ITM A;  4BGB A;  1T3V A;  4HTL A;  5LJV A;  2GWJ A;  1HKG A;  3EL2 A;  3EN9 A;  3UKU B;  1TYQ B;  1BG3 A;  1ATR A;  3SJH A;  4BRQ A;  3CJB A;  2FLO A;  4MO5 A;  4NB4 A;  3IFR A;  4A62 A;  5C12 A;  2GTD A;  3B8A X;  3VF2 A;  2QTD A;  3W0L A;  3TU5 A;  1GLF O;  2H3G X;  3DWL A;  1Q86 O;  2NRH A;  1KD1 O;  4JD2 B;  1SZ2 A;  3F2K A;  3H3N O;  4JKA A;  4R79 A;  4IOA L;  3H45 C;  3DXM B;  4H0Y B;  4BG9 A;  4EIA A;  2QM1 A;  3A5N C;  4H03 B;  3UB5 A;  2E1Z A;  1DT9 A;  5DM6 L;  4FWS A;  4UY8 O;  4FOE A;  5AQO A;  3LDO A;  3R9P A;  3CJC A;  2HOE A;  3ATV A;  4IJA A;  3VF4 A;  4NLB A;  3CPW M;  5GAH P;  1RDU A;  2A41 A;  2J4R A;  1W2B M;  2JWL A;  3U9D A;  1GLC G;  4MDA A;  1YUW A;  1QZ6 A;  2ASM A;  4M63 C;  4PKI A;  5BPM A;  4A2B A;  2F7T A;  1NGA A;  3ULE A;  1Y64 A;  3CPE A;  4CD3 A;  5KPT A;  2P9K B;  4FPB A;  2QWL A;  2AP1 A;  2P9L A;  4MLH A;  3J7Z O;  4EHU A;  2YJF A;  1NGC A;  4WFN L;  2ZJR L;  1M90 O;  4LC9 B;  4QS8 A;  5AQV A;  1BA1 A;  5BPL A;  3QIC A;  3I56 N;  3WQU A;  2QWM A;  1WUA A;  4A5A A;  1V4S A;  3CC2 N;  4OO1 J;  3I55 N;  2ASP A;  3D7E O;  5GAD P;  3A8Y A;  4BR0 A;  3ZEU B;  3TSP A;  2FSN A;  3FZH A;  3H46 O;  4FL9 A;  3WQT A;  4BRD A;  3HZ6 A;  1VAZ A;  3MMV A;  1NGG A;  3JS6 A;  5B8H A;  1RDW X;  2ZF5 O;  1HKB A;  2HBM A;  3EKU A;  3CI5 A;  2HF3 A;  3FZM A;  3VEZ A;  4JK9 A;  3VOV A;  4XH4 A;  5AFU H;  4CD1 A;  3CD6 N;  1X3N A;  3F5T A;  2BUP A;  2NRR A;  3LM2 A;  2E88 A;  4FWP A;  5EVZ A;  5M1P A;  4H0T B;  5M1K A;  3GL1 A;  3MCA B;  5JVG L;  3DXK A;  3VEN A;  4FOI A;  3E1Y A;  2VCP A;  5TKY A;  4BRA A;  3CC4 N;  3FLC O;  3K9K A;  4B1W B;  4JKH A;  2NRV A;  2D0P A;  3UE5 A;  1ILY A;  1NGJ A;  3H1Q A;  3PIO L;  3HTV A;  3MWP A;  5AFU A;  4H5R A;  4DKW A;  3CQX A;  3L4I A;  3G4S N;  2FF6 A;  3MN6 A;  4JKG B;  4DCH A;  5MLC Q;  4JN4 A;  3VF6 A;  3BF1 A;  2BH1 A;  1WOQ A;  1SAZ A;  3U9Z A;  1ATN A;  3MN9 A;  3VGL A;  5BRE A;  4DB3 A;  2IVN A;  2I7P A;  4JEP A;  1ZXO A;  1K9M O;  2KHO A;  4JK7 A;  1NGB A;  1NWK A;  3R1X A;  5GAE P;  5GIP A;  3A5L C;  3DJC A;  3PLA A;  2P9N A;  1ZBS A;  3O80 A;  3KZB A;  3O9R A;  4JKD A;  1SQK A;  1HUX A;  3O4W A;  1XC3 A;  2V52 B;  4NO7 A;  2A5X A;  4BRP A;  4CZL A;  1O13 A;  2OTJ N;  2I7N A;  5C0Y A;  4I6M A;  3VGM A;  3UKR B;  3O9S A;  2CH6 A;  3M5R A;  5DM7 L;  5AQM A;  5H1S Q;  4BGA A;  1BUP A;  4BC4 A;  2Q31 A;  2V7Y A;  1IJJ A;  1KC8 O;  2E20 A;  4GY2 B;  3CJ7 A;  5HL7 L;  2Q0U A;  4O8K A;  3KVG A;  3Q7C A;  1NGE A;  1NBW A;  3D2F A;  1KAZ A;  3N4P A;  4IEE A;  4IFE A;  4KBO A;  4YOR A;  1VQ9 N;  3O1B A;  5BR9 A;  4BC5 A;  3PIP L;  1SS6 A;  4OPA A;  4BQL A;  5AQZ A;  4A2A A;  1R59 O;  1MA9 B;  4JKB A;  5TKW A;  5M1F A;  1VQ8 N;  4CBU A;  3UKR A;  4WF9 L;  2KLA A;  4B1Z A;  4GV3 A;  4YOX A;  3P4I A;  3CME N;  2E2P A;  1HLU A;  4JHD B;  4JNE A;  5AQL A;  3VEY A;  1LOT B;  3VMF B;  3T7Z A;  3OW2 M;  1Q7Y O;  4PKG A;  5M1O A;  4BRM A;  2E1Y A;  3ZYY X;  4J8F A;  3DAW A;  4AF1 A;  3EE8 A;  4CZF A;  3TTC A;  1YHQ N;  2P9U A;  3ATU A;  4K42 A;  5BN8 A;  4GNI A;  5KQD A;  4XH5 A;  3ULE B;  5LY3 A;  2IVP A;  2PBD A;  1QQM A;  2YHY A;  4JKC A;  4BC2 A;  3C6A A;  4KH6 A;  1HKC A;  1E4G T;  3AGK A;  4JKG A;  1GLD G;  2HF4 A;  3SMS A;  3M3Z A;  2VWB A;  3I8B A;  4E1J A;  4WFA L;  2Q97 A;  3MWT A;  3QBW A;  5AQX A;  3O9Q A;  5CE3 A;  4FWM A;  1BWF O;  3A0I X;  3FZL A;  5C2F A;  2PAV A;  4DHY A;  5JLF A;  5AZJ A;  3CMA N;  3G6E N;  1VQP N;  4Y0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...