4BVOA

Legionella pneumophila ntpdase1 crystal form vi (part-open) in complex with polytungstate pom-1
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
356
structure length
356
Chain Sequence
PCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Structures of Legionella Pneumophila Ntpdase1 in Complex with Polyoxometallates.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 112
structure length 356
sequence length 356
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4bvoA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4bvoA02
1T6CA 3O6WA 3VENA 3KVGA 3VOVA 5AZJB 4BGAA 5FPMA 1YXQA 1SZ2A 2QWQA 4IZ9A 4QS9A 5KPZA 2GWKA 4FWQA 4WQ4C 2QW9A 2A41A 4JNEA 2WUSA 3JS6A 5BPLA 1HLUA 2NLXA 3M3ZA 2HF4A 4E1JA 1NM1A 2GEMA 3A8YA 2J4RA 5AQKA 3MMVA 1BDGA 5AQSA 4B1YB 2A6AA 3H1QA 3WXKA 2I7PA 5LJVA 4ISGA 3VEYA 3CJBA 1X9JA 3MN6A 3VF4A 4BR5A 1GLEG 3CERA 3VGMA 4B9QA 3EKSA 4H5VA 4BVPA 4IXCA 3I33A 4CZKA 3CQYA 4PKIA 3MN5A 1GLLO 4BG9A 3LM9A 4AM6A 2CGKA 3L6QA 2QWOA 3I8BA 2P9SA 4RTFD 1SAZA 3WEEB 1Y64A 4BR9A 4CD1A 2V51B 1BU6O 3U9DA 3DJCA 2P9LB 1K8KB 4FWSA 3W0LA 1NGIA 3WT0A 4WQ5C 2E2QA 1KAXA 1IG8A 4ISFA 1NGJA 4JHDA 5BREA 5F0XA 3LDNA 1GLDG 4H0YB 1ZBSA 2E2OA 3ENOA 4H5WA 4IJNA 3UKRB 4BR4A 1KAYA 1GLAG 1XC3A 2GUPA 1U2VB 4M7YA 1EQYA 3ULEA 2ASMA 4IWVA 3A5MC 3MN7A 2E88A 4JD2B 3WXJA 4I6MA 1GLFO 4PL8A 3VPZA 3FZLA 1Q18A 2GELA 2P9NA 4BRKA 1BO5O 5LJWA 1HJOA 4CZMA 3C7NA 3M6GA 3DAWA 4LC9B 3VERA 3DXKB 3O1BA 3P4IA 3B8AX 4F9OA 5AZJA 4M7XA 3LL3A 4H0TB 4BRCA 3FZHA 4CZGA 3A0IX 5EXWA 4BC4A 1ATRA 3GDQA 3ZX0A 4BRIA 5ELZA 4EHTA 5CE3A 3VESA 4Z94A 4BRFA 5KQDA 4BRNA 3HI0A 4DB3A 3UE5A 1HKBA 2HF3A 1JCFA 2QWPA 1QHAA 2D0OA 4K43A 1QZ5A 5AQJA 1E4GT 1ZXOA 1NGFA 5E84A 1BOTO 1QQOA 4BRAA 1R59O 1TYQB 3BF1A 5BPNA 1BA0A 3MN9A 1GLCG 4IJAA 4ISEA 3U8XA 3CJ1A 3L4IA 1HX1A 3LDLA 3R8EA 2FF6A 3EL2A 1NGEA 3EO3A 1Z05A 1BG3A 5AQOA 2P9UB 3AAQA 4B1UB 1OKJA 2E1ZA 2QWNA 5FPNA 4H5TA 5JLFA 2FSKA 3ATUA 2QWMA 5AQYA 3WEEA 1ESVA 3DXMB 4A61A 4CZHA 4FL9A 2P9LA 4EIAA 1K8KA 1TUYA 2A40A 1IJJA 2A42A 3UB5A 2UYTA 5LY3A 5AQWA 2E2PA 4CBXA 4BRHA 3ID8A 2FSJA 5FPEA 3CJ9A 3UKRA 1KXPA 2FXUA 3MK6A 3FZMA 3RSEB 3FLCO 1U2VA 1H1VA 1BWFO 2YI1A 3W3DA 1V4SA 4DCHA 2FLOA 1ATNA 2QWRA 3CI5A 4JD2A 3WXIA 2BTFA 3AARA 3CJAA 4K25A 5KPTA 2V7YA 3VGKA 3EKUA 5AFUA 4BQLA 3AAPA 1T6DA 3GOIA 4CD3A 3GG4A 4JN4A 3VEZA 4BC5A 2DPNA 3MDQA 2P9KB 2Q97A 3DXKA 1MWKA 1D4XA 3F9MA 4B1VA 5KPRA 3JXUA 1LCUA 5AQRA 2QM1A 2VWBA 4CBWA 1S22A 1YUWA 1V4TA 4A2AA 3G25A 2OANA 3O8MA 3A5LC 3UKUB 4XH4A 3IUCA 5AQXA 4FWLA 4DQ8A 1BUPA 3VEWA 2ASOA 4BR2A 4YDUC 3WQTA 2Q1NA 5E26A 3HZ6A 4H0VB 3H45C 3L0QA 4CBUA 1HKCA 3SMPA 3O80A 3HM8A 5AZIB 2ITMA 1TYQA 2NRHA 2F9WA 4BREA 5BRFA 3EN9A 5B8HA 2QXLA 5ADXA 1NGGA 3CQXA 4CZEA 4K41A 4FWMA 1G99A 5AFUH 4BRPA 1RDWX 2P9UA 2W41A 3TU5A 3WQUA 1GLJO 3O08A 4MLHA 2A5XA 3SJHA 1BA1A 2V52B 2ZGZA 4NO7A 4FO0A 3SLCA 3FFKB 5KQ8A 3DXMA 4RCHA 5F2RA 3BP8A 3LM2A 2CH5A 3FGUA 4H03B 2YCHA 3D2FB 4XH1A 4GNIA 3SMSA 4FPAA 5AQLA 3LDQA 2YHXA 4WQ4A 5BN9A 4BRMA 3U9ZA 1SQKA 4K42A 4FOEA 2Q36A 4M63C 1NGCA 2P9IB 2EWSA 4BC3A 3HBTA 3RSEA 3ENHA 1NGAA 1NWKA 4H0PA 2CH6A 1C0FA 5EVZA 3GBTA 1NGDA 2IIRA 4FWPA 3O5BA 4DHYA 3BEXA 2YHWA 3ZEUB 3A5OC 3CJCA 3QFUA 4EFHA 1HUXA 1J6ZA 4IO8A 5ADXH 3BF3A 4HWIA 1LOTB 4FSVA 5EX5A 1E4FT 3D2EB 3QICA 2AP1A 4CI6A 2ASPA 3GE1A 2P9KA 4BRGA 2ZGYA 4BC2A 4BGBA 1C0GA 1X3NA 1XUPO 3H1VX 5TKYA 5BN8A 5F1XA 3U4LA 2Q31A 4NB4A 2VCPA 1HKGA 3J8AA 1QZ6A 2Q2RA 5AQFA 1NLVA 5AQHA 5BRHA 3CHWA 1JCEA 4WQ5A 4B1WB 3ZETB 4A2BA 1ZC6A 4CZIA 3UKUA 3QBWA 2I7NA 3AY9A 4KBOA 1YVNA 3TPQA 4H5RA 4BRQA 5AR0A 4XH5A 1U6ZA 1YAGA 3KZBA 5BR9A 2VYPA 5AQZA 5AZIA 3H46O 5AQGA 2Q0RA 3QFPA 4MO4A 4EHUA 4L3QA 1X3MA 3ATVA 4JAXA 4CJ7A 2YHYA 3FE1A 3FR0A 3FZFA 4B1ZA 2YJFA 1NBWA 4J8FA 5AQVA 1QQNA 3BUZB 1HPMA 4CZLA 1RGIA 4PKHA 1NGBA 3VF6A 4CZJA 4FWNA 2FSNA 3QBXA 4H0XB 2HOEA 3D2FA 2P9PB 4FWOA 1WOQA 1WUAA 2YJEA 3R6MA 4GY2B 2IVOA 3QDKA 2ZF5O 4O8KA 4XEIA 4RWTA 3OHRA 3H6EA 5I9EB 4H0OA 2P9IA 2F9TA 4B1XB 2PBDA 3LDPA 3O1WA 2D0PA 2E1YA 1ATSA 3GL1A 5FPDA 2ZWHA 3QB0A 4EAHD 2PAVA 4FPBA 1QQMA 3QMLA 5AQQA 3ZEUA 1MWMA 4MLEA 1T44A 2D4WA 2CGLA 3S41A 4BR0A 4QS8A 3DWLA 3D7EO 1DKGD 4BRDA 1GLBG 3VGLA 2NZTA 2W40A 3D2EA 1DGKN 5JMVA 1NMDA 3CIPA 1MA9B 3IFRA 5AQTA 3FZKA 4BRLA 4FWRA 1CZAN 5AQIA 5BRDA 2E8AA 1DEJA 1TUUA 4AM7A 4PKGA 2BUPA 3LDOA 3MCPA 3KHYA 3IDHA 3CETA 4Y0WA 3ZETA 3A5NC 2E2NA 3VEVA 1JCGA 1MDUB 3WXLA 2IVPA 3HTVA 4CZFA 2P9SB 1RFQA 1NGHA 1S3XA 2A3ZA 3VEXA 3H3OB 2Q0UA 3SK3A 4BR7A 3M1FA 4QS7A 4BVOA 4FOIA 4BQZA 4HTLA 4WYBA 3C0BA 4BROA 4A62A 5JLHA 3ZX3A 2D1KA 2QWLA 5EY4A 4JHDB 4BG8A 2GWJA 4MO5A 5AQNA 2GTDA 3VEOA 3ZX2A 2H3GX 3IMXA 2CGJA 4FWKA 2IVNA 1P8ZA 5EOYA 3VETA 3O4WA 1Z6RA 2V7ZA 3ULEB 3WUHA 5JICA 2HMPA 2AA4A 1XQSC 4O5FA 4C23A 1KAZA 3EZWA 2E20A 2P9PA 4I6MB 2KHOA 5AQPA 4H5NA 3CJ7A 2P9NB 3HSCA 5AQMA 5AQUA 3R9PA 3VF2A 5BPMA 3C7NB 3H3NO 4YDUA 4PL7A 2FF3B
chains in the Genus database with same CATH superfamily
1B9FA 3IS9A 4BGAA 2VGMA 5AZJB 5FPMA 3VTHA 1SZ2A 5KPZA 3C6HA 4E1NA 2GWKA 4LD0A 3THWB 1LV5A 1JLBA 2QW9A 1OH8A 2PY5A 4DWIA 3EYZA 3DRSA 4JNEA 1UOCA 5C42A 1XHZA 3JS6A 1TL1A 2NLXA 1IG9A 4E1JA 3OS2A 3C94A 4CJWA 3NFAA 4KREA 1KFDA 1GOCA 3AO5A 3HSTB 4JKHA 5FDLA 3H1QA 5LJVA 5GAHP 3VF4A 4BR5A 4C1NK 4WCEL 4J2DA 1CZBA 1BI4A 4ELTA 1S72N 3OYMA 3EKSA 3NF8A 3CQYA 3MN5A 4OKJA 4JI3K 4RTFD 2JLEA 4FJXA 3P1GA 4CD1A 1TK8A 1T3VA 1BCOA 4FWSA 1KSPA 1C1CA 3WNFA 1NGIA 1FK9A 4JKEA 4YOUA 1EWRA 4CEBA 4JI1K 3LDNA 4JI8K 4AQYK 2HB5A 4JKFA 3ZSWA 2E2OA 1REVA 3ENOA 3UKRB 3OYGA 1EKEA 2F7TA 2GUPA 4M7YA 2ASMA 1JXBA 2HBKA 2E88A 5IWAK 3V4IA 4I6MA 3AA3A 1WSEA 3HM9A 1O1WA 4PL8A 4DR6K 3SJJA 3VPZA 2GELA 1UWBA 3QNOA 2F8SA 3M6GA 1IKYA 2F8TA 3DAWA 3VERA 4DSJA 4B9UA 4OGCA 3T7ZA 1C0UA 4FJHA 5AZJA 4H0TB 4BRCA 3FZHA 4JKBA 4CZGA 3THWA 2UUCK 4N47A 1WSIA 4BRIA 4EHTA 3QIPA 3K5MA 4BRFA 1FXXA 2QKKA 5FRMA 5GINA 1Q82O 1HKBA 4O55A 5DM6L 2HHUA 4KHWA 1JCFA 3OBWA 2HHTA 1C1BA 1RBTA 2ZE2A 5HRNA 4DTPA 3I0SA 3V6DA 3ZT4A 3DLGA 4BDZA 4BRAA 1R59O 1TYQB 4O8UA 5BPNA 1BA0A 4WE1A 3L4IA 1HX1A 2FF6A 2X6NA 3EL2A 3SQ0A 3L2VA 3EO3A 2HVHA 2P9UB 2JWLA 5JLFA 3CFPA 4OX9K 2NRVA 2FSKA 4LF9K 3MECA 5DM7L 3DM2A 2ZJRL 3HO1A 4CZHA 1IH7A 1TUYA 2A40A 1IJJA 2YNHA 1FKOA 2A42A 3C6UA 3UB5A 5LY3A 3PLAA 2E2PA 3OA9A 4BRHA 3ID8A 3E9PA 3V1RA 2FSJA 4HHTA 4C8LA 4JYAK 4M3RA 4FLXA 3G10A 2HMIA 2BE2A 3UKRA 4JI7K 1P90A 3VQ4A 2G8VA 4DTNA 4ZHRA 3KWIA 4DSKA 1NJZA 1V4SA 4MDAA 3RMAA 4FW1A 3CJAA 4K25A 2V7YA 1W2BM 3TTDA 1LAVA 4BC5A 4B3MK 3CMEN 1TKTA 1KQSM 1QS4A 1N8RO 3DMJA 1BISA 4FCYA 1LW0A 5KPRA 1LCUA 5AQRA 2QM1A 4JI6K 4C1NI 4CIEA 4G9ZA 1V4TA 1W97L 3O8MA 3A5LC 3OYHA 1L3UA 4JK9A 4XH4A 4CJLA 1RDAA 1TAQA 4JK8A 2ASOA 2YV0X 1M90O 2Q1NA 5E26A 3HZ6A 1BHLA 3AO2A 1N6QA 1DTTA 3QEWA 4AHCA 4KTQA 3HM8A 4B9TA 2ITMA 4DQQA 4C8OA 4DR7K 1TYQA 3LPUA 2F9WA 4BREA 2QXLA 4CZEA 4YFUA 1OH5A 4BE2A 4EZ9A 1RDWX 2P9UA 3CCRN 2O4IA 3O9UA 1GLJO 2X78A 3IAYA 4KKOA 4DV0K 3KK2A 5CZ1A 4KHSA 2V52B 3DLBA 4K8ZA 1HPZA 2Z1JA 1L3SA 4LSLA 3QEXA 4DFMA 1ZBFA 4CIGA 1D5AA 2FBVA 3D2FB 2DTUA 4GNIA 4IO9L 5AQLA 2G8UA 2Q3SA 2YHXA 2VG7A 5BN9A 4DV2K 4BRMA 5C2FA 3U9ZA 5J1EA 4K42A 4FOEA 1D8YA 3K2PA 4M41A 4M63C 4HUGA 4YORA 1WNSA 4YOTA 1NWKA 3RRHA 2CH6A 1C0FA 5EVZA 3GBTA 1HMVA 1YHQN 3O5BA 3A5OC 4OKEA 3QFUA 2XY8A 5ADXH 3ZCMA 1LOTB 4ID1A 3C95A 3PO4A 4H8KA 2O8BB 4CI6A 3CCLN 2HW3A 5BR8K 3VTIA 3PSFA 3SV4A 1C0GA 1XUPO 3O9TA 3J8AA 1QZ6A 2GBZA 5AQFA 1RT5A 5AQHA 1SS6A 3TAEA 4DTJA 3LPTA 3NVKA 1VQ5N 4BRQA 4B9NA 4FW2A 4EHUA 3ATVA 4CJVA 4YOWA 4CJ7A 2YHYA 3FE1A 3FZFA 1HNXK 4B1ZA 2YJFA 4OPKA 3OW2M 2XY6A 3SAHA 4B9LA 3OBYA 3V9XA 1JLQA 3OYNA 5GAEP 3QBXA 3NGIA 1R0AA 1E3MA 2HOEA 3D2FA 2P9PB 1Q9XA 1WSJA 4CHNA 3OY9A 4ZTJA 4XEIA 4RWTA 1RT6A 2OPQA 4CHOA 4DV7K 1NKBA 4CEAA 1Q9YA 2O4GA 4H0OA 3SUNA 2PBDA 1ATSA 1C0TA 2KW4A 4DR5K 3S9HA 4U7BA 4EAHD 1UAXA 5C12A 1LWEA 4OO1J 1UA1A 4B3RK 1T44A 3KJVA 4OPJA 5I3UA 2GV9A 3C65A 4DFPA 4RG8A 1QTMA 1M1KO 1D9DA 2O8BA 2NZTA 2W40A 4FZZA 1JXEA 3HL8A 1S1VA 1VSKA 3IFRA 3L2WA 5AQTA 3FZKA 4BRLA 2NRRA 2KQ2A 5AQIA 2WOMA 1VAZA 2E8AA 1TUUA 1LW2A 3MCPA 1XMQK 3CETA 3LALA 3VEVA 2E2NA 3DLRA 3K9JA 3R3LA 5J2NA 3CC7N 1TGOA 2JGUA 4KAZA 3AVJA 4A57A 2IVPA 3HTVA 2P9SB 1ASUA 2UUAK 1RFQA 1S3XA 2A3ZA 5C2DA 1NK8A 3OYFA 3OVNA 4BR7A 1C1AA 3M1FA 3KD5E 2ZQBA 4FOIA 4HTLA 3TTFA 4ELUA 4NCAA 4PUOA 2G8IA 4A62A 4CEQA 4CEEA 2D1KA 2QWLA 4CJQA 4CJSA 2GWJA 2KFNA 4MO5A 1NNEA 3MXIA 3U3YA 1HRHA 3O4QA 2P5GA 3TABA 4UY8O 3ZYYX 3VETA 5GADP 3RVCA 3HT3A 3V9WA 3ZSXA 1XQSC 4C23A 2E20A 2P9PA 3NDKA 1RDDA 3ZLJA 4Z4IA 4NYNA 3PV8A 4K0KK 2JWKA 4H5NA 3ZSOA 2WBNA 1KFSA 1EP4A 5HOOA 3TSPA 5AQMA 1BL3A 3U3GA 1NK5A 3NE6A 3R9PA 4DSLA 3C7NB 2F4VK 3LZIA 4KH4A 3KIOA 3CPWM 1T6CA 1RBUA 3O6WA 3VOVA 1TK5A 1YXQA 4IG3A 3CCQN 4QS9A 4I9QA 4FWQA 3EEQA 5J2MA 1OVQA 3J80O 1OH6A 3ZSQA 4E3SA 3O9QA 5AJ3K 5JVGL 4IEEA 4OKKA 4AHVA 1OVYA 3L2RA 1WAFA 3QEIA 1NM1A 2KZZA 4FZXC 1KTQA 1BDGA 2YHAA 2A6AA 4PHTX 4DV3K 4CJTA 1WN7A 2I7PA 3CJBA 4DFJA 5GAGP 3VQQA 4M3ZA 4B9QA 4JI4K 3MWTA 2G8FA 3I33A 4PKIA 3OYAA 1GLLO 1WSHA 3LM9A 4AM6A 2QEXN 1KC8O 4KI4A 3I8BA 2P9SA 1SAZA 3NH1A 4NXMK 3CFOA 2V51B 1BU6O 1JKHA 3DJCA 3U9DA 2HHQA 2DY4A 1K8KB 4R5PA 3W0LA 3WT0A 3DYAA 4WQ5C 4NLCA 3THVA 4Y1CA 1KAXA 4HTUA 4ISFA 1W7AA 5F0XA 4YNQA 4H0YB 1ZBSA 5C25A 4H5WA 4BR4A 1KAYA 4ID5A 1U2VB 1IBMK 3HXMA 3MN7A 1HJRA 3WXJA 1YJNN 2PYJA 4JLHA 3SPZA 3QLHA 3BZCA 2A1RA 4BRKA 2XO7A 5FROA 4NYFA 3C7NA 2E6LA 4BE0A 5HROA 1HYSA 3B8AX 4QCLA 1CLQA 4FJ7A 2G8KA 3LL3A 4KH6A 3NVMA 3HPHA 5EXWA 3E9LA 3GDQA 5CE3A 2RN2A 3MXMA 1YI2N 3AVMA 4CHPA 2F96A 4BRNA 4DB3A 1KVAA 2HF3A 2GUIA 1NK7A 2D0OA 2PZSA 2DFFA 5I42A 4EZ6A 4FJJA 1E4GT 1ZXOA 4HCBA 5E84A 1NJIO 1QQOA 1N5YA 4IKFA 3BF1A 1IV0A 2HNDA 1GLCG 3MN9A 4ISEA 2I5JA 2IC3A 1D9FA 1QE1A 3VMFB 4KHPK 1NGEA 2WC9A 5AQOA 3AAQA 4MFBA 4B1UB 3CC4N 3QEPA 1TK0A 2QWMA 4F8RA 1QSLA 1SL2A 1T7PA 1ESVA 3DXMB 4DG1A 4A61A 4EIAA 1K8KA 3TAPA 4B3TK 3DLKA 1S9GA 3I0RA 1KLMA 2UYTA 2D5RA 4DTOA 1VQPN 4AILC 5AQWA 3WNEA 3CCJN 4JI0K 5M1NA 3PIOL 3CJ9A 1RDBA 3FZMA 4JEPA 3G4SN 3RSEB 1U2VA 4LH4A 2UXBK 3NGZA 1VQON 4CEZA 2FLOA 1SKRA 1ATNA 3CI5A 2BTFA 4FLYA 4UQGA 1HNVA 3JYTA 5AFUA 3NH2A 3HP6A 3AAPA 1CZ9A 1JLAA 3VEZA 1XMOK 4W5NA 4AHRA 3NH0A 2P9KB 1JLGA 4FLZA 3TAGA 4Q0BA 4B8AB 4WFBL 3CC2N 4B1VA 3TTCA 3LP2A 4DU1A 3V1OA 4YOVA 4CBWA 1S22A 1YUWA 3F5TA 4WFNL 4Z4GA 3G25A 2OANA 2P1JA 4K8XA 4WFAL 3KD1E 1YT3A 1U4BA 1WBBA 4DQ8A 4PY5A 3F9KA 2HHSA 2D0CA 3VEWA 4BR2A 4YDUC 3WQTA 4JKDA 5DK5A 2HVIA 3H45C 4LF4K 4GVEA 3CQ8A 2DFHA 2W6LA 5AZIB 3D6RA 4CEFA 3P39A 2YHBA 5BRFA 1S6PA 1S1WA 4KPYA 1K73O 4E7LA 3LP1A 3WQUA 5T7BA 4MLHA 4A5BA 3OYJA 3DRRA 1VQ4N 2HBJA 2ZGZA 3ISNC 4EP4A 4ILJA 4FM2A 5KQ8A 3NHGA 3DXMA 3JSMA 4M3UA 4KRFA 1XHXA 2CH5A 1EX4A 4FLTA 1QSYA 1JL1A 3LDQA 4FLVA 4DR2K 3CCUN 1SQKA 1NK6A 1TVRA 4H4MA 3LP3A 3O9RA 1NGCA 2FBYA 3N4QA 4BC3A 4GW6A 3I55N 3RSEA 4CGJA 4LFAK 4H0PA 5M1OA 4A5AA 2BH1A 3BEXA 4ICLA 5CR4A 5M1FA 1HUXA 4FJMA 1J6ZA 3AVAA 4IO8A 3K59A 4CERA 5JS1A 3T1YK 1E4FT 5KGWA 4CF0A 2ASPA 2P9KA 4CFCA 1X9MA 3QETA 4BC2A 1WLJA 1NU0A 5TKYA 5F1XA 3H1VX 3EE9A 4EP5A 4GKJK 3HOSA 4IOCL 1DLOA 3T69A 2ATQA 4KH5A 5BRHA 1JCEA 4WQ5A 3KLIA 4B1WB 3Q7CA 4A2BA 1CXUA 4AH9A 1ZC6A 1RBVA 4FK0A 4CZIA 3CM5A 3O9SA 4ELVA 2G8HA 4KBOA 4DR3K 3TPQA 5MLCQ 1VSIA 3KLHA 4CJUA 1Z26A 4CESA 1U6ZA 2VYPA 5AZIA 3AGRA 5HRPA 3QFPA 3K5NA 4AHTA 4U67L 1F21A 1HYVA 2WFBA 1T05A 4N76A 3SV3A 4FJ9A 5AQVA 1NBWA 3CMAN 2B5JA 3BUZB 1VSJA 4W5QA 5HL7L 1HPMA 4CZLA 3K9KA 1NGBA 4CZJA 4FWNA 4H0XB 3K5LA 3D45A 4E89A 1HQUA 5C10A 4CGGA 4CJFA 4BDYA 2ZF5O 2KTQA 1IKVA 3OHRA 4GKKK 4X62K 4Y1DA 4X65K 3CCMN 4FJ5A 4B1XB 3CCEN 3LDPA 3MEGA 4Z4HA 3VQEA 3VQBA 3AVNA 1NKCA 3QB0A 2AJQA 1W9HA 2VWKA 5J2QA 3QMLA 2QXFA 1ILYA 4CF2A 2KFZA 3ITHA 4BR0A 4E19A 3QERA 1NK9A 1GLBG 3L8BA 3VGLA 3VQ5A 1IKXA 1YVUA 1BGXT 4DMNA 2W6KA 3VQPA 2NRXA 3CIPA 3VQ6A 1MA9B 1RT1A 2HHXA 2P5OA 1SV5A 4FWRA 2NRTA 1DEJA 3VQ7A 4DV5K 2VG5A 4BACA 3LDOA 4FJKA 3WNGA 3A5NC 3T1HK 2EX3A 5DMRA 5LL6Z 3VA3A 1VSFA 3WXLA 2O8DB 3Q7BA 4B3SK 4DSFA 3M8QA 3LAKA 3VN5A 2ZD1A 3H3OB 4OPHA 2Q0UA 2BGGA 4BQZA 3T3FA 4DR1K 3C0BA 5JLHA 3KTQA 1JJ2M 2UU9K 4BG8A 4KHUA 4L8RB 3TR8A 3S3OA 3IMXA 2X74A 4FWKA 2IVNA 4LF6K 1P8ZA 3QO9A 4YY3K 1XWLA 1K9MO 3WUHA 4LSNA 2AA4A 4CEDA 3RTVA 2ITGA 3EZWA 2W42A 1DT9A 2KHOA 2PFUA 2E4LA 3NBPA 4MDBA 1TKDA 2P9NB 5FLXO 3TWHA 3LAMA 4B8CA 3SUPA 4LF8K 3RMBA 4X66K 3UIQA 4YDUA 4IFEA 4PL7A 3WXMB 4NLBA 3VENA 3KVGA 5LMUK 4DV1K 1TL3A 4BY9C 5E41A 4DR4K 2WUSA 5BPLA 5CY4A 1HLUA 4O44A 4YOXA 3M3ZA 2GEMA 4CCHA 3LWLA 5AQKA 3MMVA 2Y1IA 5AQSA 1N32K 4B1YB 4CK2A 4OVLA 2XHBA 3KKSA 3K5OA 4F2RA 4ISGA 2QA4N 1X9JA 1K8AO 1VSDA 4DU3A 1GLEG 3S3MA 3VGMA 4GV3A 4H5VA 3LDSA 4JKCA 4BVPA 2NNWA 4O4GA 2O8DA 4DV4K 3L6QA 3AVGA 2QWOA 3DLEA 3OS1A 1N34K 4BR9A 3OYDA 2EHGA 2P9LB 3CPEA 4CGFA 3B6OA 3J7YP 2E2QA 2KZMA 1NGJA 4OGEA 1ITGA 4IG0A 1GLDG 4F2SA 3MX2A 3QIOA 4X64K 4PWDA 4KTZA 2KLAA 3AO4A 3KK7A 1XC3A 1EQYA 4IWVA 3A5MC 4A59A 2OZMA 1BQNA 1S1TA 1X1PA 4QAGA 2HBLA 3SBGA 2B6AA 3P38A 2P9NA 2YNFA 4FJIA 4CZMA 4FK4A 3DXKB 3QEVA 4I2PA 3O1BA 3P4IA 4F9OA 4M7XA 3SQ2A 1SKWA 3RR8A 3NCIA 4CGHA 1LWCA 4DLEA 4J2BA 3ENBA 1ATRA 5ELZA 3VESA 3KKRA 4KB0A 1L3VA 4Z94A 3HYFA 5KQDA 3HI0A 4LY7A 4FJ8A 1RT4A 2B4JA 2HNZA 3UE5A 3CCSN 1QHAA 3OJUA 3T1AA 4DQIA 2FBTA 5AQJA 3U6FA 3E66A 1JL2A 1NGFA 3AO1A 1TKXA 3DOKA 4AHSA 4AF1A 4JI2K 3F2KA 3U8XA 3CJ1A 4W5OA 4H4OA 4B9VA 3LDLA 1BG3A 4RW4A 1OKJA 4CJ5A 3E9OA 1YTUA 3MX5A 3ATUA 1SKSA 3R1XA 2NUBA 2YKMA 4LFCK 3CG7A 3OYLA 3AA5X 5HRRA 2P9LA 4Q5VA 3J81O 4FK2A 3SBTA 3CFRA 3ALYA 4CBXA 3AGKA 5FPEA 2YNIA 1Q8IA 3TAMA 1KXPA 1ZYQA 3IKMA 4B9SA 2ZJPL 4CGIA 2G8WA 1KVBA 1NMNA 1ZBLA 3FLCO 3VQDA 4E0DA 1QHTA 4CGDA 3W3DA 1BWFO 3OYBA 4DCHA 4FYDA 4CIFA 1YJ9N 3AARA 4IOXA 3AV9A 1MU2A 4DUYK 2HHWA 3EKUA 3QINA 3GOIA 3L4QA 3MCAB 4DSIA 2DPNA 3MDQA 3DXKA 5HP1A 1MWKA 3F9MA 4B9MA 3OS0A 3JXUA 1J5OA 1T03A 2VWBA 2WONA 4A2AA 2Z1IA 5KGXA 3PX4A 3DI6A 4O0IA 3UKUB 3IUCA 1I94K 5TKWA 4H0VB 3A2FA 4RW6A 4WF9L 1HKCA 3SMPA 3LANA 1ASWA 1NOZA 3C6TA 1U48A 4CJRA 5SWMA 3K57A 4B3OA 2IS3A 5SZTA 2NRHA 1O13A 2O8EB 3EN9A 5B8HA 4K41A 3P31A 1ASVA 4DTXA 4FWMA 1G99A 5AFUH 3NF9A 4BRPA 1A5WA 2W41A 3TU5A 3O08A 1YF5L 2A5XA 3SJHA 1BA1A 1QQCA 2D0AA 2XY7A 3KWGA 4NO7A 3SLCA 3FFKB 3ZSVA 3DLHA 2BANA 3LM2A 3SMSA 3FGUA 2YCHA 1HR0K 4FPAA 2HSTA 3NAEA 3PUFA 2QK9A 1YTAA 3NF7A 3TANA 3AVBA 1VQ9N 1HNIA 4Z4CA 3HBTA 1NGAA 3SAGA 2X6SA 2IIRA 2XRIA 4FWPA 4M45A 4DHYA 1QVFM 4CJ3A 3ZEUB 3CJCA 2YNGA 4EFHA 4KTWA 3AVKA 3OYKA 4KO0A 4YHHK 4HWIA 4KB1A 3TSUA 1RBRA 1JLEA 4O0JA 2AP1A 3AA4A 5J2PA 3GE1A 1KD1O 4BWMA 4J2AA 2D0BA 3ZSYA 4CHZA 3OTOK 4NXNK 4QOZB 3U4LA 1HKGA 1RTIA 4E1MA 2NRZA 4M3TA 3LZJA 3MXJA 3I8DA 3AO3A 1NLVA 2FC0A 3CHWA 4XIUA 3THXB 1VQMN 1LWFA 4M3YA 2VWJA 3UKUA 3QBWA 2I7NA 4DSEA 3E01A 1TKZA 2VG6A 4CW7B 1Z25A 4IFYA 3MWPA 3KZBA 3L3UA 1SUQA 5BR9A 5CHIA 1X9SA 5AQZA 2OYQA 2Q0RA 3SPYA 4L3QA 2O8EA 1EO1A 4R79A 4JAXA 3FR0A 4J8FA 3J7AP 2YX6A 4B08A 5HBMA 3HJFA 1RGIA 2IOCA 2RHKA 3VF6A 4CK3A 1VQNN 3SAFA 2FSNA 3I56N 3ASMA 4FWOA 1WOQA 1WUAA 2YJEA 4GY2B 2IVOA 3AVLA 4O8KA 4DTUA 4HUEA 3H6EA 5I9EB 1U45A 2F9TA 3NF6A 2D0PA 2OCEA 3HP9A 2E1YA 3GL1A 1RTDA 3EE8A 3L2QA 2IDOA 1J53A 4IDKA 2ZWHA 3M5RA 4FPBA 1QQMA 1VQ8N 1RT7A 3ZEUA 1MWMA 3K58A 3RRGA 2D4WA 4JV5K 1B92A 2CGLA 4C8NA 3S41A 3CF5L 4FM0A 2OPRA 4QS8A 4BRDA 2HBMA 1W0HA 1GOBA 5JMVA 3SI6A 4BE1A 3SYZA 4IEIA 1NMDA 3VQ9A 3AVIA 1FW6A 5BRDA 4KV8A 4AM7A 1U04A 4CFAA 4PKGA 3S3NA 3VQCA 3KHYA 3THXA 4Y0WA 1BIUA 1JCGA 5HLFA 1KLNA 3CXCM 1RBSA 4FZYA 3NMUA 4N56A 4FLWA 3ZT1A 5JS2A 2IGIA 1NGHA 1WSGA 5C24A 3VEXA 1SL0A 4C8MA 3KK3A 1CXQA 3OYCA 4JRQA 3M8RA 4QS7A 4DU4A 4BVOA 1Q86O 4WYBA 4OJRA 4KI6A 4N5SA 3ZX3A 1VRUA 4IOAL 3OYIA 4JHDB 2GTDA 3ZX2A 3PX6A 1X9WA 2OTJN 4Z4EA 3HK2A 1RT3A 4FM1A 3O4WA 5H1SQ 1Z6RA 3ULEB 4E7KA 3BZKA 1VQLN 1U47A 1Q81O 5KI6A 4DTRA 4DQRA 1YJWN 4CJ4A 4W5TA 3CJ7A 3HRGA 3KLFA 3N4PA 4Z4FA 3HSCA 3O3HA 5AQUA 3VF2A 5BPMA 1S1UA 2OTLN 1QSSA 3VA0A 3PIPL 4OLAA 5CYQA 1NK4A 1C0MA 3M8PA 2QWQA 4IZ9A 3DLLL 2PYLA 4WQ4C 1RILA 3ZT2A 4DUZK 2A41A 3T19A 1IBKK 2RKIA 4ILGB 1XC9A 3DOLA 2HF4A 1J54A 3QESA 4CF1A 3A8YA 2J4RA 4CJPA 1WBDA 1XNRK 5IT9O 3M8SA 2IAJA 3WXKA 3VEYA 3MN6A 4N41A 2VQEK 2O8FB 3CERA 1XNQK 3FFIA 2OPSA 1C6VA 4F4KA 4IXCA 4RW9A 4CZKA 2UUBK 4BG9A 4PA1A 2CGKA 1HQEA 3KLEA 1RDUA 2VQFK 3SZ2A 3WEEB 3G0ZA 1Y64A 3TARA 1VQKN 4F3OA 4MQ3A 5JVHL 4CE9A 1IG8A 1YIJN 1EXQA 3BDPA 1A5VA 4JHDA 5BREA 4IDHA 3CCVN 4IJNA 4JKAA 4FVUA 1NJXA 3P5JA 2BDPA 1J5EK 1GLAG 1IBLK 4DTSA 1KVCA 3ULEA 4HUFA 2QI2A 1WAJA 1IO2A 4JD2B 4FJNA 1FJGK 4DTMA 1GLFO 5HRSA 4CHYA 1RTHA 2RE2A 3MEEA 3THYB 3SQ4A 3FZLA 1Q18A 3TSQA 1BO5O 1J9AA 5LJWA 1HJOA 1WB9A 4DQPA 1HNZK 2E5LK 4LC9B 3TAQA 3V1QA 2HHVA 4FJLA 4I7FA 5KTQA 1VQ6N 3A0IX 4BC4A 3ZX0A 1ZBIA 5M1KA 1I39A 4CHQA 1NG9A 4DF4A 5CZ2A 2YKNA 2QWPA 3O3GA 2Z1GA 4K43A 2OA8A 3ULDA 1QZ5A 1NOYA 5C0YA 1BOTO 1K6YA 3ZSZA 2UXCK 4DS5A 4TSXA 4IJAA 4GV9A 4DV6K 2O8FA 4GV6A 2A1SA 1KCFA 3R8EA 3RMCA 5EU7A 4M3WA 3ZT0A 3VQ8A 1Z05A 1BCMA 2E1ZA 2QWNA 5FPNA 3KK1A 4LF5K 4Z0UA 4H5TA 4JI5K 5AQYA 3WEEA 4DS4A 2NRWA 4FL9A 4G1QA 3CD6N 4GMJB 3EZ5A 1VK0A 3EY1A 3MK6A 2FXUA 3OYEA 4LH5A 3HPOA 4JKGB 1BQMA 1NK0A 1H1VA 2YI1A 3D0PA 5GIPA 1HNWK 1QVGM 2QWRA 4DFKA 4JD2A 1ZBHA 3WXIA 3V9ZA 3BY5A 5KPTA 3HVRA 3VGKA 3THYA 4BQLA 4M3XA 4F3TA 2P51A 1T6DA 2VGNA 4RW7A 4CD3A 5LMNK 3AA2A 3GG4A 4JN4A 4RW8A 5D3GA 3PO5A 4OPAA 1VSLA 2Q97A 3VQAA 4LF7K 5FRNA 1D4XA 3G6EN 1EETA 3V9SA 3TI0A 4JRPA 1VRTA 4E7JA 5GIOA 3AVFA 1NKEA 2GX9A 3SUQA 1GOAA 5AQXA 4FWLA 1BUPA 1RDCA 3JAMO 1S1XA 1UA0A 2O8CB 1L3TA 3L0QA 4CBUA 4C8KA 3O80A 2FBXA 1U49A 4ILHA 5K14A 2Z1HA 2QKBA 4PQUA 4CEOA 3HOTA 3V9UA 1IKWA 5ADXA 1NGGA 3OJSA 3CQXA 3ZSRA 4J2EA 3SNNA 3AVHA 4OLBA 4IFVA 4FO0A 4DKWA 4W5RA 5F2RA 3P83D 4RCHA 3BP8A 4XH1A 4H03B 1VHXA 4WQ4A 3CM6A 2R7YA 3DRPA 1HYZA 1BIZA 2Q36A 4LFBK 1Y97A 4CFDA 1I3AA 4JS5A 2P9IB 2OZSA 1Q7YO 2EWSA 3WNHA 3J7ZO 4JKGA 3ENHA 1NGDA 2WTUA 1JLFA 2YHWA 3L2UA 1XI1A 1ZBUA 3ZT3A 4DLGA 1RTJA 3BF3A 4FXDA 3NGYA 1RT2A 4FSVA 5EX5A 2HNYA 2E6MA 1FKPA 3D2EB 3QICA 2RPIA 1VSEA 2ETJA 4BRGA 2ZGYA 4BGBA 1X3NA 5BN8A 3IG1A 2ZJQL 2Q31A 4NB4A 2VCPA 3QNNA 4BDPA 2UXDK 1RNHA 1VQ7N 2Q2RA 4AHUA 3SQ1A 1JLCA 4CFBA 3ZETB 1LAWA 3BGRA 3AY9A 1NJYA 3F73A 1YVNA 4H5RA 2OPPA 4GVMA 5KRTA 2O8CA 4FJGA 1A5XA 5AR0A 4XH5A 1TV6A 4NCBA 1YAGA 2XY5A 1KRPA 1VSMA 4DQSA 3H46O 5AQGA 4MO4A 1X3MA 1WSFA 2QTDA 4I2QA 2KKZA 3SCXA 1DTQA 4KHYA 1QQNA 3AVCA 4V19S 5KRSA 3L3VA 4PKHA 3K0SA 3TAFA 4I9LA 1YITN 4CF9A 2HHHK 1RCHA 4CECA 3R6MA 3QDKA 1EWQA 2DFEA 3MAQA 4CK1A 3RR7A 3ID6A 3V81A 4FVMA 3LWMA 3HVTA 2Y1JA 2P9IA 4HVJA 3O1WA 5FPDA 3PY8A 3RMDA 2PAVA 3CYMA 5AQQA 4MLEA 4NCGA 4BWJA 1OH7A 1NJWA 5M1PA 3SUOA 3RWUA 3DWLA 1VSHA 3D7EO 1DKGD 4M42A 3D2EA 3H08A 1DGKN 3O3FA 4YOYA 1N33K 3MEDA 3E1YA 1CZAN 4KHNA 5C15A 1BI4B 3C6AA 2BUPA 3IDHA 3O4NA 3ZETA 1S9EA 1S6QA 1TAUA 4ZTFA 1MDUB 1N36K 4E7HA 4DF8A 4CZFA 3IRXA 4CVNE 4IBNA 3SK3A 4CF8A 3KLGA 4JS4A 2LSNA 3PSIA 3G71N 2ZM6K 4BROA 1S5JA 4O5BA 5EY4A 4HCCA 5CYMA 1SL1A 5AQNA 3VEOA 1T8EA 2H3GX 2CGJA 3PX0A 3LP0A 2RF2A 3HPGA 5EOYA 4FLUA 2V7ZA 5JICA 4CJEA 2HMPA 3B6PA 5A2QO 5M1QA 4O5FA 1B9DA 1KAZA 4I6MB 4KHQA 4KFBA 4CJKA 5AQPA 4E7IA 4JK7A 1G15A 3H3NO 1L5UA 2FF3B
chains in the Genus database with same CATH topology
3CPWM 1T6CA 3WXMB 3O6WA 4NLBA 3KVGA 2VGMA 5AZJB 3VENA 5FPMA 1YXQA 3VOVA 4BGAA 4BY9C 3VTHA 1SZ2A 3DLLL 2QWQA 4IZ9A 3C6HA 4QS9A 2GWKA 5KPZA 4FWQA 3CCQN 4WQ4C 2QW9A 2A41A 4JNEA 3O9QA 5JVGL 4IEEA 2WUSA 3JS6A 4ILGB 5BPLA 1HLUA 2NLXA 4YOXA 3M3ZA 1OVYA 2HF4A 4E1JA 1NM1A 2GEMA 3A8YA 2J4RA 5AQKA 3MMVA 1BDGA 5AQSA 4B1YB 2A6AA 4PHTX 4JKHA 3H1QA 3WXKA 2I7PA 5LJVA 4ISGA 5GAHP 3VEYA 3CJBA 2QA4N 1X9JA 3MN6A 1K8AO 3VF4A 4BR5A 4C1NK 5GAGP 1GLEG 4WCEL 3CERA 3VGMA 1S72N 4GV3A 4B9QA 3EKSA 4H5VA 3MWTA 4JKCA 4BVPA 4IXCA 3I33A 4CZKA 2NNWA 3CQYA 4PKIA 3MN5A 4G9ZA 1GLLO 4BG9A 3LM9A 4AM6A 2QEXN 2CGKA 3L6QA 1KC8O 1RDUA 2QWOA 3I8BA 2P9SA 4RTFD 1SAZA 3WEEB 1Y64A 4BR9A 4CD1A 2V51B 1BU6O 1T3VA 3DJCA 3U9DA 2P9LB 3CPEA 1K8KB 4FWSA 1VQKN 3W0LA 1NGIA 3WT0A 5JVHL 4WQ5C 4NLCA 2E2QA 4JKEA 4YOUA 1KAXA 1IG8A 1YIJN 4ISFA 1NGJA 4JHDA 5BREA 5F0XA 3LDNA 1GLDG 3MX2A 4H0YB 1ZBSA 4IDHA 4JKFA 3CCVN 2E2OA 3ENOA 4H5WA 4IJNA 4JKAA 3UKRB 4BR4A 4FVUA 2KLAA 1KAYA 2F7TA 1GLAG 3KK7A 1XC3A 2GUPA 1U2VB 4M7YA 1EQYA 3ULEA 2ASMA 4IWVA 2QI2A 3A5MC 3MN7A 2HBKA 2E88A 4JD2B 4A59A 3WXJA 1YJNN 4I6MA 1GLFO 2HBLA 2RE2A 3SBGA 4PL8A 3VPZA 3FZLA 1Q18A 2GELA 2P9NA 3P38A 3TSQA 4BRKA 1BO5O 5LJWA 1HJOA 4CZMA 3C7NA 3M6GA 3DAWA 4LC9B 3VERA 3DXKB 3O1BA 3P4IA 3B8AX 3T7ZA 4F9OA 5AZJA 4M7XA 3LL3A 4H0TB 4KH6A 4BRCA 3NVMA 3FZHA 4JKBA 4CZGA 1VQ6N 3A0IX 5EXWA 3ENBA 1ATRA 3E9LA 3GDQA 3ZX0A 5ELZA 4BC4A 4BRIA 4EHTA 3VESA 5CE3A 1YI2N 4Z94A 4BRFA 5M1KA 5KQDA 4BRNA 3HI0A 4DB3A 5GINA 1Q82O 3CCSN 3UE5A 1HKBA 2HF3A 5DM6L 1JCFA 2QWPA 3OBWA 1QHAA 2D0OA 4K43A 1QZ5A 5AQJA 1E4GT 5C0YA 3E66A 1ZXOA 1NGFA 5E84A 1NJIO 1BOTO 1QQOA 4BRAA 1R59O 1TYQB 3BF1A 4O8UA 4AF1A 5BPNA 1BA0A 3F2KA 1GLCG 3MN9A 4IJAA 4ISEA 3U8XA 4GV9A 4GV6A 3CJ1A 3L4IA 1HX1A 3LDLA 3VMFB 3R8EA 2FF6A 3EL2A 1NGEA 3EO3A 2WC9A 1Z05A 1BG3A 5AQOA 2P9UB 3AAQA 4B1UB 1OKJA 2E1ZA 2QWNA 5FPNA 2JWLA 4H5TA 3E9OA 5JLFA 3CC4N 2NRVA 2FSKA 3MX5A 3ATUA 3R1XA 2QWMA 5DM7L 5AQYA 2ZJRL 3WEEA 2NRWA 1ESVA 3DXMB 4A61A 4CZHA 4FL9A 2P9LA 4EIAA 1K8KA 1TUYA 2A40A 1IJJA 3CD6N 3SBTA 2A42A 3UB5A 2UYTA 5LY3A 1VQPN 3PLAA 5AQWA 3CCJN 2E2PA 4CBXA 3OA9A 4BRHA 3ID8A 3E9PA 3AGKA 5M1NA 2FSJA 5FPEA 3PIOL 3CJ9A 3UKRA 1KXPA 1P90A 2FXUA 3MK6A 3FZMA 3IKMA 4JEPA 2ZJPL 3G4SN 4JKGB 3RSEB 3FLCO 1U2VA 3KWIA 1H1VA 1BWFO 2YI1A 3W3DA 1V4SA 4MDAA 5GIPA 1VQON 4DCHA 2FLOA 1QVGM 1ATNA 2QWRA 3CI5A 4JD2A 1YJ9N 3WXIA 2BTFA 3AARA 4IOXA 3CJAA 4K25A 5KPTA 2V7YA 3VGKA 3EKUA 5AFUA 4BQLA 3AAPA 1W2BM 1T6DA 2VGNA 3GOIA 3TTDA 4CD3A 3L4QA 3MCAB 3GG4A 4JN4A 3VEZA 4BC5A 3CMEN 2DPNA 3MDQA 1KQSM 4OPAA 2P9KB 2Q97A 3DXKA 1N8RO 1MWKA 1D4XA 4WFBL 3G6EN 3CC2N 3F9MA 4B1VA 3TTCA 5KPRA 3JXUA 1LCUA 5AQRA 2QM1A 5GIOA 4YOVA 2VWBA 4C1NI 4CBWA 1S22A 1YUWA 1V4TA 1W97L 3F5TA 2GX9A 4A2AA 4WFNL 3G25A 2OANA 3O8MA 3A5LC 4WFAL 3UKUB 4JK9A 4XH4A 3IUCA 5AQXA 4FWLA 4DQ8A 1BUPA 4JK8A 3VEWA 5TKWA 2ASOA 4BR2A 4YDUC 3WQTA 1M90O 4JKDA 2Q1NA 5E26A 3HZ6A 4H0VB 3H45C 3L0QA 4CBUA 4WF9L 1HKCA 3SMPA 4GVEA 3O80A 3HM8A 5AZIB 4ILHA 3D6RA 2ITMA 3P39A 1TYQA 2NRHA 1O13A 2F9WA 4BREA 3HOTA 5BRFA 3EN9A 5B8HA 2QXLA 5ADXA 1NGGA 3CQXA 4CZEA 4K41A 3P31A 4FWMA 1G99A 5AFUH 4BRPA 1K73O 1RDWX 2P9UA 2W41A 3TU5A 3CCRN 3O9UA 3WQUA 1GLJO 3O08A 4MLHA 4A5BA 1YF5L 2A5XA 1VQ4N 2HBJA 3SJHA 1BA1A 2V52B 2ZGZA 3KWGA 4NO7A 4FO0A 3SLCA 4DKWA 3FFKB 4ILJA 5KQ8A 3DXMA 4RCHA 5F2RA 3BP8A 3LM2A 2CH5A 3FGUA 4H03B 2YCHA 3D2FB 4XH1A 4GNIA 3SMSA 4FPAA 5AQLA 3LDQA 4IO9L 2HSTA 2YHXA 4WQ4A 5BN9A 3CCUN 4BRMA 5C2FA 3U9ZA 1SQKA 4K42A 4FOEA 2Q36A 3O9RA 4M63C 1NGCA 2P9IB 3N4QA 1Q7YO 2EWSA 4BC3A 4YORA 3J7ZO 1VQ9N 4YOTA 4JKGA 3I55N 3HBTA 3RSEA 3ENHA 1NGAA 1NWKA 4H0PA 2CH6A 1C0FA 5EVZA 3SAGA 3GBTA 1YHQN 1NGDA 2IIRA 4FWPA 3O5BA 5M1OA 4A5AA 4DHYA 2BH1A 3BEXA 2YHWA 1QVFM 3ZEUB 3A5OC 3CJCA 3QFUA 5CR4A 4EFHA 5M1FA 1HUXA 1J6ZA 4IO8A 5ADXH 3BF3A 4HWIA 3TSUA 1LOTB 4FSVA 5EX5A 1E4FT 3D2EB 3QICA 2AP1A 4CI6A 3CCLN 2ASPA 3GE1A 1KD1O 2P9KA 4BRGA 2ZGYA 4BC2A 3VTIA 4BGBA 1C0GA 1X3NA 1XUPO 3H1VX 5TKYA 3EE9A 5BN8A 5F1XA 2ZJQL 3U4LA 2Q31A 4NB4A 2VCPA 1HKGA 3J8AA 3O9TA 1QZ6A 2NRZA 3HOSA 4IOCL 1VQ7N 2Q2RA 5AQFA 3T69A 1NLVA 4KH5A 5AQHA 5BRHA 3CHWA 1JCEA 4WQ5A 1VQMN 4B1WB 3Q7CA 3ZETB 4A2BA 1ZC6A 4CZIA 3UKUA 3O9SA 3QBWA 1SS6A 2I7NA 3AY9A 3NVKA 4KBOA 1YVNA 3TPQA 4H5RA 5MLCQ 1VQ5N 4BRQA 5AR0A 4XH5A 1U6ZA 1YAGA 3MWPA 3KZBA 5BR9A 2VYPA 5CHIA 5AQZA 5AZIA 3H46O 5AQGA 2Q0RA 3AGRA 3QFPA 4MO4A 4EHUA 4L3QA 4U67L 1X3MA 2WFBA 3ATVA 4R79A 1EO1A 4JAXA 2QTDA 4YOWA 4CJ7A 2KKZA 2YHYA 3FE1A 3FR0A 3FZFA 4B1ZA 2YJFA 1NBWA 4J8FA 5AQVA 3CMAN 1QQNA 3BUZB 2YX6A 3OW2M 5HL7L 1HPMA 4CZLA 1RGIA 4PKHA 3SAHA 3K9KA 2RHKA 1NGBA 3OBYA 3VF6A 1VQNN 4CZJA 3SAFA 1YITN 4FWNA 2FSNA 3QBXA 4H0XB 5GAEP 2HOEA 3I56N 3D2FA 2P9PB 5C10A 4FWOA 1WOQA 1WUAA 2YJEA 3R6MA 4GY2B 2IVOA 3QDKA 2ZF5O 4O8KA 4XEIA 4RWTA 3OHRA 3ID6A 3H6EA 5I9EB 3CCMN 4H0OA 2P9IA 2F9TA 4B1XB 3CCEN 2PBDA 3LDPA 3O1WA 2D0PA 2E1YA 1ATSA 3GL1A 5FPDA 3EE8A 4YDUA 2ZWHA 4U7BA 3QB0A 4EAHD 2PAVA 3M5RA 4FPBA 1QQMA 3QMLA 5C12A 1VQ8N 1ILYA 5AQQA 3ZEUA 1MWMA 4MLEA 4OO1J 1T44A 2D4WA 5M1PA 2CGLA 3S41A 4BR0A 3CF5L 3C65A 4QS8A 3DWLA 3D7EO 1DKGD 4BRDA 1M1KO 1GLBG 2HBMA 3VGLA 2NZTA 2W40A 3D2EA 1DGKN 5JMVA 4YOYA 2NRXA 4IEIA 1NMDA 3CIPA 1MA9B 3IFRA 5AQTA 3FZKA 4BRLA 2NRRA 4FWRA 3E1YA 1CZAN 2NRTA 5AQIA 5BRDA 5C15A 1VAZA 2E8AA 1DEJA 1TUUA 4AM7A 3C6AA 4PKGA 2BUPA 3LDOA 3MCPA 3KHYA 3IDHA 3CETA 4Y0WA 3ZETA 3A5NC 2E2NA 3R3LA 3K9JA 1JCGA 1MDUB 3VEVA 3CC7N 3WXLA 3Q7BA 3CXCM 3NMUA 4A57A 2IVPA 3HTVA 4CZFA 2P9SB 1RFQA 1NGHA 1S3XA 2A3ZA 5C2DA 3VEXA 3H3OB 4OPHA 2Q0UA 3SK3A 4BR7A 3M1FA 4QS7A 4BVOA 3G71N 4FOIA 4BQZA 4HTLA 4WYBA 3C0BA 3TTFA 4BROA 1Q86O 4A62A 5JLHA 3ZX3A 1JJ2M 2D1KA 4IOAL 2QWLA 5EY4A 4JHDB 4BG8A 2GWJA 4MO5A 5AQNA 2GTDA 3VEOA 3ZX2A 2H3GX 3IMXA 2CGJA 4FWKA 2IVNA 2OTJN 4UY8O 1P8ZA 3ZYYX 5EOYA 3VETA 5GADP 3O4WA 3RVCA 1Z6RA 2V7ZA 3ULEB 3WUHA 5JICA 5H1SQ 1K9MO 2HMPA 2AA4A 1XQSC 5M1QA 4O5FA 1VQLN 4C23A 1KAZA 3EZWA 1Q81O 1DT9A 2E20A 2P9PA 4I6MB 1YJWN 2KHOA 5AQPA 2PFUA 2JWKA 4H5NA 3CJ7A 4MDBA 4JK7A 2WBNA 3HRGA 2P9NB 3N4PA 3HSCA 5HOOA 3TSPA 5AQMA 5AQUA 3R9PA 3VF2A 5BPMA 2OTLN 3C7NB 3H3NO 3PIPL 4IFEA 4KH4A 4PL7A 2FF3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6C A;  3O6W A;  3VEN A;  3KVG A;  3VOV A;  5AZJ B;  4BGA A;  5FPM A;  1YXQ A;  1SZ2 A;  2QWQ A;  4IZ9 A;  4QS9 A;  5KPZ A;  2GWK A;  4FWQ A;  4WQ4 C;  2QW9 A;  2A41 A;  4JNE A;  2WUS A;  3JS6 A;  5BPL A;  1HLU A;  2NLX A;  3M3Z A;  2HF4 A;  4E1J A;  1NM1 A;  2GEM A;  3A8Y A;  2J4R A;  5AQK A;  3MMV A;  1BDG A;  5AQS A;  4B1Y B;  2A6A A;  3H1Q A;  3WXK A;  2I7P A;  5LJV A;  4ISG A;  3VEY A;  3CJB A;  1X9J A;  3MN6 A;  3VF4 A;  4BR5 A;  1GLE G;  3CER A;  3VGM A;  4B9Q A;  3EKS A;  4H5V A;  4BVP A;  4IXC A;  3I33 A;  4CZK A;  3CQY A;  4PKI A;  3MN5 A;  1GLL O;  4BG9 A;  3LM9 A;  4AM6 A;  2CGK A;  3L6Q A;  2QWO A;  3I8B A;  2P9S A;  4RTF D;  1SAZ A;  3WEE B;  1Y64 A;  4BR9 A;  4CD1 A;  2V51 B;  1BU6 O;  3U9D A;  3DJC A;  2P9L B;  1K8K B;  4FWS A;  3W0L A;  1NGI A;  3WT0 A;  4WQ5 C;  2E2Q A;  1KAX A;  1IG8 A;  4ISF A;  1NGJ A;  4JHD A;  5BRE A;  5F0X A;  3LDN A;  1GLD G;  4H0Y B;  1ZBS A;  2E2O A;  3ENO A;  4H5W A;  4IJN A;  3UKR B;  4BR4 A;  1KAY A;  1GLA G;  1XC3 A;  2GUP A;  1U2V B;  4M7Y A;  1EQY A;  3ULE A;  2ASM A;  4IWV A;  3A5M C;  3MN7 A;  2E88 A;  4JD2 B;  3WXJ A;  4I6M A;  1GLF O;  4PL8 A;  3VPZ A;  3FZL A;  1Q18 A;  2GEL A;  2P9N A;  4BRK A;  1BO5 O;  5LJW A;  1HJO A;  4CZM A;  3C7N A;  3M6G A;  3DAW A;  4LC9 B;  3VER A;  3DXK B;  3O1B A;  3P4I A;  3B8A X;  4F9O A;  5AZJ A;  4M7X A;  3LL3 A;  4H0T B;  4BRC A;  3FZH A;  4CZG A;  3A0I X;  5EXW A;  4BC4 A;  1ATR A;  3GDQ A;  3ZX0 A;  4BRI A;  5ELZ A;  4EHT A;  5CE3 A;  3VES A;  4Z94 A;  4BRF A;  5KQD A;  4BRN A;  3HI0 A;  4DB3 A;  3UE5 A;  1HKB A;  2HF3 A;  1JCF A;  2QWP A;  1QHA A;  2D0O A;  4K43 A;  1QZ5 A;  5AQJ A;  1E4G T;  1ZXO A;  1NGF A;  5E84 A;  1BOT O;  1QQO A;  4BRA A;  1R59 O;  1TYQ B;  3BF1 A;  5BPN A;  1BA0 A;  3MN9 A;  1GLC G;  4IJA A;  4ISE A;  3U8X A;  3CJ1 A;  3L4I A;  1HX1 A;  3LDL A;  3R8E A;  2FF6 A;  3EL2 A;  1NGE A;  3EO3 A;  1Z05 A;  1BG3 A;  5AQO A;  2P9U B;  3AAQ A;  4B1U B;  1OKJ A;  2E1Z A;  2QWN A;  5FPN A;  4H5T A;  5JLF A;  2FSK A;  3ATU A;  2QWM A;  5AQY A;  3WEE A;  1ESV A;  3DXM B;  4A61 A;  4CZH A;  4FL9 A;  2P9L A;  4EIA A;  1K8K A;  1TUY A;  2A40 A;  1IJJ A;  2A42 A;  3UB5 A;  2UYT A;  5LY3 A;  5AQW A;  2E2P A;  4CBX A;  4BRH A;  3ID8 A;  2FSJ A;  5FPE A;  3CJ9 A;  3UKR A;  1KXP A;  2FXU A;  3MK6 A;  3FZM A;  3RSE B;  3FLC O;  1U2V A;  1H1V A;  1BWF O;  2YI1 A;  3W3D A;  1V4S A;  4DCH A;  2FLO A;  1ATN A;  2QWR A;  3CI5 A;  4JD2 A;  3WXI A;  2BTF A;  3AAR A;  3CJA A;  4K25 A;  5KPT A;  2V7Y A;  3VGK A;  3EKU A;  5AFU A;  4BQL A;  3AAP A;  1T6D A;  3GOI A;  4CD3 A;  3GG4 A;  4JN4 A;  3VEZ A;  4BC5 A;  2DPN A;  3MDQ A;  2P9K B;  2Q97 A;  3DXK A;  1MWK A;  1D4X A;  3F9M A;  4B1V A;  5KPR A;  3JXU A;  1LCU A;  5AQR A;  2QM1 A;  2VWB A;  4CBW A;  1S22 A;  1YUW A;  1V4T A;  4A2A A;  3G25 A;  2OAN A;  3O8M A;  3A5L C;  3UKU B;  4XH4 A;  3IUC A;  5AQX A;  4FWL A;  4DQ8 A;  1BUP A;  3VEW A;  2ASO A;  4BR2 A;  4YDU C;  3WQT A;  2Q1N A;  5E26 A;  3HZ6 A;  4H0V B;  3H45 C;  3L0Q A;  4CBU A;  1HKC A;  3SMP A;  3O80 A;  3HM8 A;  5AZI B;  2ITM A;  1TYQ A;  2NRH A;  2F9W A;  4BRE A;  5BRF A;  3EN9 A;  5B8H A;  2QXL A;  5ADX A;  1NGG A;  3CQX A;  4CZE A;  4K41 A;  4FWM A;  1G99 A;  5AFU H;  4BRP A;  1RDW X;  2P9U A;  2W41 A;  3TU5 A;  3WQU A;  1GLJ O;  3O08 A;  4MLH A;  2A5X A;  3SJH A;  1BA1 A;  2V52 B;  2ZGZ A;  4NO7 A;  4FO0 A;  3SLC A;  3FFK B;  5KQ8 A;  3DXM A;  4RCH A;  5F2R A;  3BP8 A;  3LM2 A;  2CH5 A;  3FGU A;  4H03 B;  2YCH A;  3D2F B;  4XH1 A;  4GNI A;  3SMS A;  4FPA A;  5AQL A;  3LDQ A;  2YHX A;  4WQ4 A;  5BN9 A;  4BRM A;  3U9Z A;  1SQK A;  4K42 A;  4FOE A;  2Q36 A;  4M63 C;  1NGC A;  2P9I B;  2EWS A;  4BC3 A;  3HBT A;  3RSE A;  3ENH A;  1NGA A;  1NWK A;  4H0P A;  2CH6 A;  1C0F A;  5EVZ A;  3GBT A;  1NGD A;  2IIR A;  4FWP A;  3O5B A;  4DHY A;  3BEX A;  2YHW A;  3ZEU B;  3A5O C;  3CJC A;  3QFU A;  4EFH A;  1HUX A;  1J6Z A;  4IO8 A;  5ADX H;  3BF3 A;  4HWI A;  1LOT B;  4FSV A;  5EX5 A;  1E4F T;  3D2E B;  3QIC A;  2AP1 A;  4CI6 A;  2ASP A;  3GE1 A;  2P9K A;  4BRG A;  2ZGY A;  4BC2 A;  4BGB A;  1C0G A;  1X3N A;  1XUP O;  3H1V X;  5TKY A;  5BN8 A;  5F1X A;  3U4L A;  2Q31 A;  4NB4 A;  2VCP A;  1HKG A;  3J8A A;  1QZ6 A;  2Q2R A;  5AQF A;  1NLV A;  5AQH A;  5BRH A;  3CHW A;  1JCE A;  4WQ5 A;  4B1W B;  3ZET B;  4A2B A;  1ZC6 A;  4CZI A;  3UKU A;  3QBW A;  2I7N A;  3AY9 A;  4KBO A;  1YVN A;  3TPQ A;  4H5R A;  4BRQ A;  5AR0 A;  4XH5 A;  1U6Z A;  1YAG A;  3KZB A;  5BR9 A;  2VYP A;  5AQZ A;  5AZI A;  3H46 O;  5AQG A;  2Q0R A;  3QFP A;  4MO4 A;  4EHU A;  4L3Q A;  1X3M A;  3ATV A;  4JAX A;  4CJ7 A;  2YHY A;  3FE1 A;  3FR0 A;  3FZF A;  4B1Z A;  2YJF A;  1NBW A;  4J8F A;  5AQV A;  1QQN A;  3BUZ B;  1HPM A;  4CZL A;  1RGI A;  4PKH A;  1NGB A;  3VF6 A;  4CZJ A;  4FWN A;  2FSN A;  3QBX A;  4H0X B;  2HOE A;  3D2F A;  2P9P B;  4FWO A;  1WOQ A;  1WUA A;  2YJE A;  3R6M A;  4GY2 B;  2IVO A;  3QDK A;  2ZF5 O;  4O8K A;  4XEI A;  4RWT A;  3OHR A;  3H6E A;  5I9E B;  4H0O A;  2P9I A;  2F9T A;  4B1X B;  2PBD A;  3LDP A;  3O1W A;  2D0P A;  2E1Y A;  1ATS A;  3GL1 A;  5FPD A;  2ZWH A;  3QB0 A;  4EAH D;  2PAV A;  4FPB A;  1QQM A;  3QML A;  5AQQ A;  3ZEU A;  1MWM A;  4MLE A;  1T44 A;  2D4W A;  2CGL A;  3S41 A;  4BR0 A;  4QS8 A;  3DWL A;  3D7E O;  1DKG D;  4BRD A;  1GLB G;  3VGL A;  2NZT A;  2W40 A;  3D2E A;  1DGK N;  5JMV A;  1NMD A;  3CIP A;  1MA9 B;  3IFR A;  5AQT A;  3FZK A;  4BRL A;  4FWR A;  1CZA N;  5AQI A;  5BRD A;  2E8A A;  1DEJ A;  1TUU A;  4AM7 A;  4PKG A;  2BUP A;  3LDO A;  3MCP A;  3KHY A;  3IDH A;  3CET A;  4Y0W A;  3ZET A;  3A5N C;  2E2N A;  3VEV A;  1JCG A;  1MDU B;  3WXL A;  2IVP A;  3HTV A;  4CZF A;  2P9S B;  1RFQ A;  1NGH A;  1S3X A;  2A3Z A;  3VEX A;  3H3O B;  2Q0U A;  3SK3 A;  4BR7 A;  3M1F A;  4QS7 A;  4BVO A;  4FOI A;  4BQZ A;  4HTL A;  4WYB A;  3C0B A;  4BRO A;  4A62 A;  5JLH A;  3ZX3 A;  2D1K A;  2QWL A;  5EY4 A;  4JHD B;  4BG8 A;  2GWJ A;  4MO5 A;  5AQN A;  2GTD A;  3VEO A;  3ZX2 A;  2H3G X;  3IMX A;  2CGJ A;  4FWK A;  2IVN A;  1P8Z A;  5EOY A;  3VET A;  3O4W A;  1Z6R A;  2V7Z A;  3ULE B;  3WUH A;  5JIC A;  2HMP A;  2AA4 A;  1XQS C;  4O5F A;  4C23 A;  1KAZ A;  3EZW A;  2E20 A;  2P9P A;  4I6M B;  2KHO A;  5AQP A;  4H5N A;  3CJ7 A;  2P9N B;  3HSC A;  5AQM A;  5AQU A;  3R9P A;  3VF2 A;  5BPM A;  3C7N B;  3H3N O;  4YDU A;  4PL7 A;  2FF3 B; 
#chains in the Genus database with same CATH topology
 1B9F A;  3IS9 A;  4BGA A;  2VGM A;  5AZJ B;  5FPM A;  3VTH A;  1SZ2 A;  5KPZ A;  3C6H A;  4E1N A;  2GWK A;  4LD0 A;  3THW B;  1LV5 A;  1JLB A;  2QW9 A;  1OH8 A;  2PY5 A;  4DWI A;  3EYZ A;  3DRS A;  4JNE A;  1UOC A;  5C42 A;  1XHZ A;  3JS6 A;  1TL1 A;  2NLX A;  1IG9 A;  4E1J A;  3OS2 A;  3C94 A;  4CJW A;  3NFA A;  4KRE A;  1KFD A;  1GOC A;  3AO5 A;  3HST B;  4JKH A;  5FDL A;  3H1Q A;  5LJV A;  5GAH P;  3VF4 A;  4BR5 A;  4C1N K;  4WCE L;  4J2D A;  1CZB A;  1BI4 A;  4ELT A;  1S72 N;  3OYM A;  3EKS A;  3NF8 A;  3CQY A;  3MN5 A;  4OKJ A;  4JI3 K;  4RTF D;  2JLE A;  4FJX A;  3P1G A;  4CD1 A;  1TK8 A;  1T3V A;  1BCO A;  4FWS A;  1KSP A;  1C1C A;  3WNF A;  1NGI A;  1FK9 A;  4JKE A;  4YOU A;  1EWR A;  4CEB A;  4JI1 K;  3LDN A;  4JI8 K;  4AQY K;  2HB5 A;  4JKF A;  3ZSW A;  2E2O A;  1REV A;  3ENO A;  3UKR B;  3OYG A;  1EKE A;  2F7T A;  2GUP A;  4M7Y A;  2ASM A;  1JXB A;  2HBK A;  2E88 A;  5IWA K;  3V4I A;  4I6M A;  3AA3 A;  1WSE A;  3HM9 A;  1O1W A;  4PL8 A;  4DR6 K;  3SJJ A;  3VPZ A;  2GEL A;  1UWB A;  3QNO A;  2F8S A;  3M6G A;  1IKY A;  2F8T A;  3DAW A;  3VER A;  4DSJ A;  4B9U A;  4OGC A;  3T7Z A;  1C0U A;  4FJH A;  5AZJ A;  4H0T B;  4BRC A;  3FZH A;  4JKB A;  4CZG A;  3THW A;  2UUC K;  4N47 A;  1WSI A;  4BRI A;  4EHT A;  3QIP A;  3K5M A;  4BRF A;  1FXX A;  2QKK A;  5FRM A;  5GIN A;  1Q82 O;  1HKB A;  4O55 A;  5DM6 L;  2HHU A;  4KHW A;  1JCF A;  3OBW A;  2HHT A;  1C1B A;  1RBT A;  2ZE2 A;  5HRN A;  4DTP A;  3I0S A;  3V6D A;  3ZT4 A;  3DLG A;  4BDZ A;  4BRA A;  1R59 O;  1TYQ B;  4O8U A;  5BPN A;  1BA0 A;  4WE1 A;  3L4I A;  1HX1 A;  2FF6 A;  2X6N A;  3EL2 A;  3SQ0 A;  3L2V A;  3EO3 A;  2HVH A;  2P9U B;  2JWL A;  5JLF A;  3CFP A;  4OX9 K;  2NRV A;  2FSK A;  4LF9 K;  3MEC A;  5DM7 L;  3DM2 A;  2ZJR L;  3HO1 A;  4CZH A;  1IH7 A;  1TUY A;  2A40 A;  1IJJ A;  2YNH A;  1FKO A;  2A42 A;  3C6U A;  3UB5 A;  5LY3 A;  3PLA A;  2E2P A;  3OA9 A;  4BRH A;  3ID8 A;  3E9P A;  3V1R A;  2FSJ A;  4HHT A;  4C8L A;  4JYA K;  4M3R A;  4FLX A;  3G10 A;  2HMI A;  2BE2 A;  3UKR A;  4JI7 K;  1P90 A;  3VQ4 A;  2G8V A;  4DTN A;  4ZHR A;  3KWI A;  4DSK A;  1NJZ A;  1V4S A;  4MDA A;  3RMA A;  4FW1 A;  3CJA A;  4K25 A;  2V7Y A;  1W2B M;  3TTD A;  1LAV A;  4BC5 A;  4B3M K;  3CME N;  1TKT A;  1KQS M;  1QS4 A;  1N8R O;  3DMJ A;  1BIS A;  4FCY A;  1LW0 A;  5KPR A;  1LCU A;  5AQR A;  2QM1 A;  4JI6 K;  4C1N I;  4CIE A;  4G9Z A;  1V4T A;  1W97 L;  3O8M A;  3A5L C;  3OYH A;  1L3U A;  4JK9 A;  4XH4 A;  4CJL A;  1RDA A;  1TAQ A;  4JK8 A;  2ASO A;  2YV0 X;  1M90 O;  2Q1N A;  5E26 A;  3HZ6 A;  1BHL A;  3AO2 A;  1N6Q A;  1DTT A;  3QEW A;  4AHC A;  4KTQ A;  3HM8 A;  4B9T A;  2ITM A;  4DQQ A;  4C8O A;  4DR7 K;  1TYQ A;  3LPU A;  2F9W A;  4BRE A;  2QXL A;  4CZE A;  4YFU A;  1OH5 A;  4BE2 A;  4EZ9 A;  1RDW X;  2P9U A;  3CCR N;  2O4I A;  3O9U A;  1GLJ O;  2X78 A;  3IAY A;  4KKO A;  4DV0 K;  3KK2 A;  5CZ1 A;  4KHS A;  2V52 B;  3DLB A;  4K8Z A;  1HPZ A;  2Z1J A;  1L3S A;  4LSL A;  3QEX A;  4DFM A;  1ZBF A;  4CIG A;  1D5A A;  2FBV A;  3D2F B;  2DTU A;  4GNI A;  4IO9 L;  5AQL A;  2G8U A;  2Q3S A;  2YHX A;  2VG7 A;  5BN9 A;  4DV2 K;  4BRM A;  5C2F A;  3U9Z A;  5J1E A;  4K42 A;  4FOE A;  1D8Y A;  3K2P A;  4M41 A;  4M63 C;  4HUG A;  4YOR A;  1WNS A;  4YOT A;  1NWK A;  3RRH A;  2CH6 A;  1C0F A;  5EVZ A;  3GBT A;  1HMV A;  1YHQ N;  3O5B A;  3A5O C;  4OKE A;  3QFU A;  2XY8 A;  5ADX H;  3ZCM A;  1LOT B;  4ID1 A;  3C95 A;  3PO4 A;  4H8K A;  2O8B B;  4CI6 A;  3CCL N;  2HW3 A;  5BR8 K;  3VTI A;  3PSF A;  3SV4 A;  1C0G A;  1XUP O;  3O9T A;  3J8A A;  1QZ6 A;  2GBZ A;  5AQF A;  1RT5 A;  5AQH A;  1SS6 A;  3TAE A;  4DTJ A;  3LPT A;  3NVK A;  1VQ5 N;  4BRQ A;  4B9N A;  4FW2 A;  4EHU A;  3ATV A;  4CJV A;  4YOW A;  4CJ7 A;  2YHY A;  3FE1 A;  3FZF A;  1HNX K;  4B1Z A;  2YJF A;  4OPK A;  3OW2 M;  2XY6 A;  3SAH A;  4B9L A;  3OBY A;  3V9X A;  1JLQ A;  3OYN A;  5GAE P;  3QBX A;  3NGI A;  1R0A A;  1E3M A;  2HOE A;  3D2F A;  2P9P B;  1Q9X A;  1WSJ A;  4CHN A;  3OY9 A;  4ZTJ A;  4XEI A;  4RWT A;  1RT6 A;  2OPQ A;  4CHO A;  4DV7 K;  1NKB A;  4CEA A;  1Q9Y A;  2O4G A;  4H0O A;  3SUN A;  2PBD A;  1ATS A;  1C0T A;  2KW4 A;  4DR5 K;  3S9H A;  4U7B A;  4EAH D;  1UAX A;  5C12 A;  1LWE A;  4OO1 J;  1UA1 A;  4B3R K;  1T44 A;  3KJV A;  4OPJ A;  5I3U A;  2GV9 A;  3C65 A;  4DFP A;  4RG8 A;  1QTM A;  1M1K O;  1D9D A;  2O8B A;  2NZT A;  2W40 A;  4FZZ A;  1JXE A;  3HL8 A;  1S1V A;  1VSK A;  3IFR A;  3L2W A;  5AQT A;  3FZK A;  4BRL A;  2NRR A;  2KQ2 A;  5AQI A;  2WOM A;  1VAZ A;  2E8A A;  1TUU A;  1LW2 A;  3MCP A;  1XMQ K;  3CET A;  3LAL A;  3VEV A;  2E2N A;  3DLR A;  3K9J A;  3R3L A;  5J2N A;  3CC7 N;  1TGO A;  2JGU A;  4KAZ A;  3AVJ A;  4A57 A;  2IVP A;  3HTV A;  2P9S B;  1ASU A;  2UUA K;  1RFQ A;  1S3X A;  2A3Z A;  5C2D A;  1NK8 A;  3OYF A;  3OVN A;  4BR7 A;  1C1A A;  3M1F A;  3KD5 E;  2ZQB A;  4FOI A;  4HTL A;  3TTF A;  4ELU A;  4NCA A;  4PUO A;  2G8I A;  4A62 A;  4CEQ A;  4CEE A;  2D1K A;  2QWL A;  4CJQ A;  4CJS A;  2GWJ A;  2KFN A;  4MO5 A;  1NNE A;  3MXI A;  3U3Y A;  1HRH A;  3O4Q A;  2P5G A;  3TAB A;  4UY8 O;  3ZYY X;  3VET A;  5GAD P;  3RVC A;  3HT3 A;  3V9W A;  3ZSX A;  1XQS C;  4C23 A;  2E20 A;  2P9P A;  3NDK A;  1RDD A;  3ZLJ A;  4Z4I A;  4NYN A;  3PV8 A;  4K0K K;  2JWK A;  4H5N A;  3ZSO A;  2WBN A;  1KFS A;  1EP4 A;  5HOO A;  3TSP A;  5AQM A;  1BL3 A;  3U3G A;  1NK5 A;  3NE6 A;  3R9P A;  4DSL A;  3C7N B;  2F4V K;  3LZI A;  4KH4 A;  3KIO A;  3CPW M;  1T6C A;  1RBU A;  3O6W A;  3VOV A;  1TK5 A;  1YXQ A;  4IG3 A;  3CCQ N;  4QS9 A;  4I9Q A;  4FWQ A;  3EEQ A;  5J2M A;  1OVQ A;  3J80 O;  1OH6 A;  3ZSQ A;  4E3S A;  3O9Q A;  5AJ3 K;  5JVG L;  4IEE A;  4OKK A;  4AHV A;  1OVY A;  3L2R A;  1WAF A;  3QEI A;  1NM1 A;  2KZZ A;  4FZX C;  1KTQ A;  1BDG A;  2YHA A;  2A6A A;  4PHT X;  4DV3 K;  4CJT A;  1WN7 A;  2I7P A;  3CJB A;  4DFJ A;  5GAG P;  3VQQ A;  4M3Z A;  4B9Q A;  4JI4 K;  3MWT A;  2G8F A;  3I33 A;  4PKI A;  3OYA A;  1GLL O;  1WSH A;  3LM9 A;  4AM6 A;  2QEX N;  1KC8 O;  4KI4 A;  3I8B A;  2P9S A;  1SAZ A;  3NH1 A;  4NXM K;  3CFO A;  2V51 B;  1BU6 O;  1JKH A;  3DJC A;  3U9D A;  2HHQ A;  2DY4 A;  1K8K B;  4R5P A;  3W0L A;  3WT0 A;  3DYA A;  4WQ5 C;  4NLC A;  3THV A;  4Y1C A;  1KAX A;  4HTU A;  4ISF A;  1W7A A;  5F0X A;  4YNQ A;  4H0Y B;  1ZBS A;  5C25 A;  4H5W A;  4BR4 A;  1KAY A;  4ID5 A;  1U2V B;  1IBM K;  3HXM A;  3MN7 A;  1HJR A;  3WXJ A;  1YJN N;  2PYJ A;  4JLH A;  3SPZ A;  3QLH A;  3BZC A;  2A1R A;  4BRK A;  2XO7 A;  5FRO A;  4NYF A;  3C7N A;  2E6L A;  4BE0 A;  5HRO A;  1HYS A;  3B8A X;  4QCL A;  1CLQ A;  4FJ7 A;  2G8K A;  3LL3 A;  4KH6 A;  3NVM A;  3HPH A;  5EXW A;  3E9L A;  3GDQ A;  5CE3 A;  2RN2 A;  3MXM A;  1YI2 N;  3AVM A;  4CHP A;  2F96 A;  4BRN A;  4DB3 A;  1KVA A;  2HF3 A;  2GUI A;  1NK7 A;  2D0O A;  2PZS A;  2DFF A;  5I42 A;  4EZ6 A;  4FJJ A;  1E4G T;  1ZXO A;  4HCB A;  5E84 A;  1NJI O;  1QQO A;  1N5Y A;  4IKF A;  3BF1 A;  1IV0 A;  2HND A;  1GLC G;  3MN9 A;  4ISE A;  2I5J A;  2IC3 A;  1D9F A;  1QE1 A;  3VMF B;  4KHP K;  1NGE A;  2WC9 A;  5AQO A;  3AAQ A;  4MFB A;  4B1U B;  3CC4 N;  3QEP A;  1TK0 A;  2QWM A;  4F8R A;  1QSL A;  1SL2 A;  1T7P A;  1ESV A;  3DXM B;  4DG1 A;  4A61 A;  4EIA A;  1K8K A;  3TAP A;  4B3T K;  3DLK A;  1S9G A;  3I0R A;  1KLM A;  2UYT A;  2D5R A;  4DTO A;  1VQP N;  4AIL C;  5AQW A;  3WNE A;  3CCJ N;  4JI0 K;  5M1N A;  3PIO L;  3CJ9 A;  1RDB A;  3FZM A;  4JEP A;  3G4S N;  3RSE B;  1U2V A;  4LH4 A;  2UXB K;  3NGZ A;  1VQO N;  4CEZ A;  2FLO A;  1SKR A;  1ATN A;  3CI5 A;  2BTF A;  4FLY A;  4UQG A;  1HNV A;  3JYT A;  5AFU A;  3NH2 A;  3HP6 A;  3AAP A;  1CZ9 A;  1JLA A;  3VEZ A;  1XMO K;  4W5N A;  4AHR A;  3NH0 A;  2P9K B;  1JLG A;  4FLZ A;  3TAG A;  4Q0B A;  4B8A B;  4WFB L;  3CC2 N;  4B1V A;  3TTC A;  3LP2 A;  4DU1 A;  3V1O A;  4YOV A;  4CBW A;  1S22 A;  1YUW A;  3F5T A;  4WFN L;  4Z4G A;  3G25 A;  2OAN A;  2P1J A;  4K8X A;  4WFA L;  3KD1 E;  1YT3 A;  1U4B A;  1WBB A;  4DQ8 A;  4PY5 A;  3F9K A;  2HHS A;  2D0C A;  3VEW A;  4BR2 A;  4YDU C;  3WQT A;  4JKD A;  5DK5 A;  2HVI A;  3H45 C;  4LF4 K;  4GVE A;  3CQ8 A;  2DFH A;  2W6L A;  5AZI B;  3D6R A;  4CEF A;  3P39 A;  2YHB A;  5BRF A;  1S6P A;  1S1W A;  4KPY A;  1K73 O;  4E7L A;  3LP1 A;  3WQU A;  5T7B A;  4MLH A;  4A5B A;  3OYJ A;  3DRR A;  1VQ4 N;  2HBJ A;  2ZGZ A;  3ISN C;  4EP4 A;  4ILJ A;  4FM2 A;  5KQ8 A;  3NHG A;  3DXM A;  3JSM A;  4M3U A;  4KRF A;  1XHX A;  2CH5 A;  1EX4 A;  4FLT A;  1QSY A;  1JL1 A;  3LDQ A;  4FLV A;  4DR2 K;  3CCU N;  1SQK A;  1NK6 A;  1TVR A;  4H4M A;  3LP3 A;  3O9R A;  1NGC A;  2FBY A;  3N4Q A;  4BC3 A;  4GW6 A;  3I55 N;  3RSE A;  4CGJ A;  4LFA K;  4H0P A;  5M1O A;  4A5A A;  2BH1 A;  3BEX A;  4ICL A;  5CR4 A;  5M1F A;  1HUX A;  4FJM A;  1J6Z A;  3AVA A;  4IO8 A;  3K59 A;  4CER A;  5JS1 A;  3T1Y K;  1E4F T;  5KGW A;  4CF0 A;  2ASP A;  2P9K A;  4CFC A;  1X9M A;  3QET A;  4BC2 A;  1WLJ A;  1NU0 A;  5TKY A;  5F1X A;  3H1V X;  3EE9 A;  4EP5 A;  4GKJ K;  3HOS A;  4IOC L;  1DLO A;  3T69 A;  2ATQ A;  4KH5 A;  5BRH A;  1JCE A;  4WQ5 A;  3KLI A;  4B1W B;  3Q7C A;  4A2B A;  1CXU A;  4AH9 A;  1ZC6 A;  1RBV A;  4FK0 A;  4CZI A;  3CM5 A;  3O9S A;  4ELV A;  2G8H A;  4KBO A;  4DR3 K;  3TPQ A;  5MLC Q;  1VSI A;  3KLH A;  4CJU A;  1Z26 A;  4CES A;  1U6Z A;  2VYP A;  5AZI A;  3AGR A;  5HRP A;  3QFP A;  3K5N A;  4AHT A;  4U67 L;  1F21 A;  1HYV A;  2WFB A;  1T05 A;  4N76 A;  3SV3 A;  4FJ9 A;  5AQV A;  1NBW A;  3CMA N;  2B5J A;  3BUZ B;  1VSJ A;  4W5Q A;  5HL7 L;  1HPM A;  4CZL A;  3K9K A;  1NGB A;  4CZJ A;  4FWN A;  4H0X B;  3K5L A;  3D45 A;  4E89 A;  1HQU A;  5C10 A;  4CGG A;  4CJF A;  4BDY A;  2ZF5 O;  2KTQ A;  1IKV A;  3OHR A;  4GKK K;  4X62 K;  4Y1D A;  4X65 K;  3CCM N;  4FJ5 A;  4B1X B;  3CCE N;  3LDP A;  3MEG A;  4Z4H A;  3VQE A;  3VQB A;  3AVN A;  1NKC A;  3QB0 A;  2AJQ A;  1W9H A;  2VWK A;  5J2Q A;  3QML A;  2QXF A;  1ILY A;  4CF2 A;  2KFZ A;  3ITH A;  4BR0 A;  4E19 A;  3QER A;  1NK9 A;  1GLB G;  3L8B A;  3VGL A;  3VQ5 A;  1IKX A;  1YVU A;  1BGX T;  4DMN A;  2W6K A;  3VQP A;  2NRX A;  3CIP A;  3VQ6 A;  1MA9 B;  1RT1 A;  2HHX A;  2P5O A;  1SV5 A;  4FWR A;  2NRT A;  1DEJ A;  3VQ7 A;  4DV5 K;  2VG5 A;  4BAC A;  3LDO A;  4FJK A;  3WNG A;  3A5N C;  3T1H K;  2EX3 A;  5DMR A;  5LL6 Z;  3VA3 A;  1VSF A;  3WXL A;  2O8D B;  3Q7B A;  4B3S K;  4DSF A;  3M8Q A;  3LAK A;  3VN5 A;  2ZD1 A;  3H3O B;  4OPH A;  2Q0U A;  2BGG A;  4BQZ A;  3T3F A;  4DR1 K;  3C0B A;  5JLH A;  3KTQ A;  1JJ2 M;  2UU9 K;  4BG8 A;  4KHU A;  4L8R B;  3TR8 A;  3S3O A;  3IMX A;  2X74 A;  4FWK A;  2IVN A;  4LF6 K;  1P8Z A;  3QO9 A;  4YY3 K;  1XWL A;  1K9M O;  3WUH A;  4LSN A;  2AA4 A;  4CED A;  3RTV A;  2ITG A;  3EZW A;  2W42 A;  1DT9 A;  2KHO A;  2PFU A;  2E4L A;  3NBP A;  4MDB A;  1TKD A;  2P9N B;  5FLX O;  3TWH A;  3LAM A;  4B8C A;  3SUP A;  4LF8 K;  3RMB A;  4X66 K;  3UIQ A;  4YDU A;  4IFE A;  4PL7 A;  3WXM B;  4NLB A;  3VEN A;  3KVG A;  5LMU K;  4DV1 K;  1TL3 A;  4BY9 C;  5E41 A;  4DR4 K;  2WUS A;  5BPL A;  5CY4 A;  1HLU A;  4O44 A;  4YOX A;  3M3Z A;  2GEM A;  4CCH A;  3LWL A;  5AQK A;  3MMV A;  2Y1I A;  5AQS A;  1N32 K;  4B1Y B;  4CK2 A;  4OVL A;  2XHB A;  3KKS A;  3K5O A;  4F2R A;  4ISG A;  2QA4 N;  1X9J A;  1K8A O;  1VSD A;  4DU3 A;  1GLE G;  3S3M A;  3VGM A;  4GV3 A;  4H5V A;  3LDS A;  4JKC A;  4BVP A;  2NNW A;  4O4G A;  2O8D A;  4DV4 K;  3L6Q A;  3AVG A;  2QWO A;  3DLE A;  3OS1 A;  1N34 K;  4BR9 A;  3OYD A;  2EHG A;  2P9L B;  3CPE A;  4CGF A;  3B6O A;  3J7Y P;  2E2Q A;  2KZM A;  1NGJ A;  4OGE A;  1ITG A;  4IG0 A;  1GLD G;  4F2S A;  3MX2 A;  3QIO A;  4X64 K;  4PWD A;  4KTZ A;  2KLA A;  3AO4 A;  3KK7 A;  1XC3 A;  1EQY A;  4IWV A;  3A5M C;  4A59 A;  2OZM A;  1BQN A;  1S1T A;  1X1P A;  4QAG A;  2HBL A;  3SBG A;  2B6A A;  3P38 A;  2P9N A;  2YNF A;  4FJI A;  4CZM A;  4FK4 A;  3DXK B;  3QEV A;  4I2P A;  3O1B A;  3P4I A;  4F9O A;  4M7X A;  3SQ2 A;  1SKW A;  3RR8 A;  3NCI A;  4CGH A;  1LWC A;  4DLE A;  4J2B A;  3ENB A;  1ATR A;  5ELZ A;  3VES A;  3KKR A;  4KB0 A;  1L3V A;  4Z94 A;  3HYF A;  5KQD A;  3HI0 A;  4LY7 A;  4FJ8 A;  1RT4 A;  2B4J A;  2HNZ A;  3UE5 A;  3CCS N;  1QHA A;  3OJU A;  3T1A A;  4DQI A;  2FBT A;  5AQJ A;  3U6F A;  3E66 A;  1JL2 A;  1NGF A;  3AO1 A;  1TKX A;  3DOK A;  4AHS A;  4AF1 A;  4JI2 K;  3F2K A;  3U8X A;  3CJ1 A;  4W5O A;  4H4O A;  4B9V A;  3LDL A;  1BG3 A;  4RW4 A;  1OKJ A;  4CJ5 A;  3E9O A;  1YTU A;  3MX5 A;  3ATU A;  1SKS A;  3R1X A;  2NUB A;  2YKM A;  4LFC K;  3CG7 A;  3OYL A;  3AA5 X;  5HRR A;  2P9L A;  4Q5V A;  3J81 O;  4FK2 A;  3SBT A;  3CFR A;  3ALY A;  4CBX A;  3AGK A;  5FPE A;  2YNI A;  1Q8I A;  3TAM A;  1KXP A;  1ZYQ A;  3IKM A;  4B9S A;  2ZJP L;  4CGI A;  2G8W A;  1KVB A;  1NMN A;  1ZBL A;  3FLC O;  3VQD A;  4E0D A;  1QHT A;  4CGD A;  3W3D A;  1BWF O;  3OYB A;  4DCH A;  4FYD A;  4CIF A;  1YJ9 N;  3AAR A;  4IOX A;  3AV9 A;  1MU2 A;  4DUY K;  2HHW A;  3EKU A;  3QIN A;  3GOI A;  3L4Q A;  3MCA B;  4DSI A;  2DPN A;  3MDQ A;  3DXK A;  5HP1 A;  1MWK A;  3F9M A;  4B9M A;  3OS0 A;  3JXU A;  1J5O A;  1T03 A;  2VWB A;  2WON A;  4A2A A;  2Z1I A;  5KGX A;  3PX4 A;  3DI6 A;  4O0I A;  3UKU B;  3IUC A;  1I94 K;  5TKW A;  4H0V B;  3A2F A;  4RW6 A;  4WF9 L;  1HKC A;  3SMP A;  3LAN A;  1ASW A;  1NOZ A;  3C6T A;  1U48 A;  4CJR A;  5SWM A;  3K57 A;  4B3O A;  2IS3 A;  5SZT A;  2NRH A;  1O13 A;  2O8E B;  3EN9 A;  5B8H A;  4K41 A;  3P31 A;  1ASV A;  4DTX A;  4FWM A;  1G99 A;  5AFU H;  3NF9 A;  4BRP A;  1A5W A;  2W41 A;  3TU5 A;  3O08 A;  1YF5 L;  2A5X A;  3SJH A;  1BA1 A;  1QQC A;  2D0A A;  2XY7 A;  3KWG A;  4NO7 A;  3SLC A;  3FFK B;  3ZSV A;  3DLH A;  2BAN A;  3LM2 A;  3SMS A;  3FGU A;  2YCH A;  1HR0 K;  4FPA A;  2HST A;  3NAE A;  3PUF A;  2QK9 A;  1YTA A;  3NF7 A;  3TAN A;  3AVB A;  1VQ9 N;  1HNI A;  4Z4C A;  3HBT A;  1NGA A;  3SAG A;  2X6S A;  2IIR A;  2XRI A;  4FWP A;  4M45 A;  4DHY A;  1QVF M;  4CJ3 A;  3ZEU B;  3CJC A;  2YNG A;  4EFH A;  4KTW A;  3AVK A;  3OYK A;  4KO0 A;  4YHH K;  4HWI A;  4KB1 A;  3TSU A;  1RBR A;  1JLE A;  4O0J A;  2AP1 A;  3AA4 A;  5J2P A;  3GE1 A;  1KD1 O;  4BWM A;  4J2A A;  2D0B A;  3ZSY A;  4CHZ A;  3OTO K;  4NXN K;  4QOZ B;  3U4L A;  1HKG A;  1RTI A;  4E1M A;  2NRZ A;  4M3T A;  3LZJ A;  3MXJ A;  3I8D A;  3AO3 A;  1NLV A;  2FC0 A;  3CHW A;  4XIU A;  3THX B;  1VQM N;  1LWF A;  4M3Y A;  2VWJ A;  3UKU A;  3QBW A;  2I7N A;  4DSE A;  3E01 A;  1TKZ A;  2VG6 A;  4CW7 B;  1Z25 A;  4IFY A;  3MWP A;  3KZB A;  3L3U A;  1SUQ A;  5BR9 A;  5CHI A;  1X9S A;  5AQZ A;  2OYQ A;  2Q0R A;  3SPY A;  4L3Q A;  2O8E A;  1EO1 A;  4R79 A;  4JAX A;  3FR0 A;  4J8F A;  3J7A P;  2YX6 A;  4B08 A;  5HBM A;  3HJF A;  1RGI A;  2IOC A;  2RHK A;  3VF6 A;  4CK3 A;  1VQN N;  3SAF A;  2FSN A;  3I56 N;  3ASM A;  4FWO A;  1WOQ A;  1WUA A;  2YJE A;  4GY2 B;  2IVO A;  3AVL A;  4O8K A;  4DTU A;  4HUE A;  3H6E A;  5I9E B;  1U45 A;  2F9T A;  3NF6 A;  2D0P A;  2OCE A;  3HP9 A;  2E1Y A;  3GL1 A;  1RTD A;  3EE8 A;  3L2Q A;  2IDO A;  1J53 A;  4IDK A;  2ZWH A;  3M5R A;  4FPB A;  1QQM A;  1VQ8 N;  1RT7 A;  3ZEU A;  1MWM A;  3K58 A;  3RRG A;  2D4W A;  4JV5 K;  1B92 A;  2CGL A;  4C8N A;  3S41 A;  3CF5 L;  4FM0 A;  2OPR A;  4QS8 A;  4BRD A;  2HBM A;  1W0H A;  1GOB A;  5JMV A;  3SI6 A;  4BE1 A;  3SYZ A;  4IEI A;  1NMD A;  3VQ9 A;  3AVI A;  1FW6 A;  5BRD A;  4KV8 A;  4AM7 A;  1U04 A;  4CFA A;  4PKG A;  3S3N A;  3VQC A;  3KHY A;  3THX A;  4Y0W A;  1BIU A;  1JCG A;  5HLF A;  1KLN A;  3CXC M;  1RBS A;  4FZY A;  3NMU A;  4N56 A;  4FLW A;  3ZT1 A;  5JS2 A;  2IGI A;  1NGH A;  1WSG A;  5C24 A;  3VEX A;  1SL0 A;  4C8M A;  3KK3 A;  1CXQ A;  3OYC A;  4JRQ A;  3M8R A;  4QS7 A;  4DU4 A;  4BVO A;  1Q86 O;  4WYB A;  4OJR A;  4KI6 A;  4N5S A;  3ZX3 A;  1VRU A;  4IOA L;  3OYI A;  4JHD B;  2GTD A;  3ZX2 A;  3PX6 A;  1X9W A;  2OTJ N;  4Z4E A;  3HK2 A;  1RT3 A;  4FM1 A;  3O4W A;  5H1S Q;  1Z6R A;  3ULE B;  4E7K A;  3BZK A;  1VQL N;  1U47 A;  1Q81 O;  5KI6 A;  4DTR A;  4DQR A;  1YJW N;  4CJ4 A;  4W5T A;  3CJ7 A;  3HRG A;  3KLF A;  3N4P A;  4Z4F A;  3HSC A;  3O3H A;  5AQU A;  3VF2 A;  5BPM A;  1S1U A;  2OTL N;  1QSS A;  3VA0 A;  3PIP L;  4OLA A;  5CYQ A;  1NK4 A;  1C0M A;  3M8P A;  2QWQ A;  4IZ9 A;  3DLL L;  2PYL A;  4WQ4 C;  1RIL A;  3ZT2 A;  4DUZ K;  2A41 A;  3T19 A;  1IBK K;  2RKI A;  4ILG B;  1XC9 A;  3DOL A;  2HF4 A;  1J54 A;  3QES A;  4CF1 A;  3A8Y A;  2J4R A;  4CJP A;  1WBD A;  1XNR K;  5IT9 O;  3M8S A;  2IAJ A;  3WXK A;  3VEY A;  3MN6 A;  4N41 A;  2VQE K;  2O8F B;  3CER A;  1XNQ K;  3FFI A;  2OPS A;  1C6V A;  4F4K A;  4IXC A;  4RW9 A;  4CZK A;  2UUB K;  4BG9 A;  4PA1 A;  2CGK A;  1HQE A;  3KLE A;  1RDU A;  2VQF K;  3SZ2 A;  3WEE B;  3G0Z A;  1Y64 A;  3TAR A;  1VQK N;  4F3O A;  4MQ3 A;  5JVH L;  4CE9 A;  1IG8 A;  1YIJ N;  1EXQ A;  3BDP A;  1A5V A;  4JHD A;  5BRE A;  4IDH A;  3CCV N;  4IJN A;  4JKA A;  4FVU A;  1NJX A;  3P5J A;  2BDP A;  1J5E K;  1GLA G;  1IBL K;  4DTS A;  1KVC A;  3ULE A;  4HUF A;  2QI2 A;  1WAJ A;  1IO2 A;  4JD2 B;  4FJN A;  1FJG K;  4DTM A;  1GLF O;  5HRS A;  4CHY A;  1RTH A;  2RE2 A;  3MEE A;  3THY B;  3SQ4 A;  3FZL A;  1Q18 A;  3TSQ A;  1BO5 O;  1J9A A;  5LJW A;  1HJO A;  1WB9 A;  4DQP A;  1HNZ K;  2E5L K;  4LC9 B;  3TAQ A;  3V1Q A;  2HHV A;  4FJL A;  4I7F A;  5KTQ A;  1VQ6 N;  3A0I X;  4BC4 A;  3ZX0 A;  1ZBI A;  5M1K A;  1I39 A;  4CHQ A;  1NG9 A;  4DF4 A;  5CZ2 A;  2YKN A;  2QWP A;  3O3G A;  2Z1G A;  4K43 A;  2OA8 A;  3ULD A;  1QZ5 A;  1NOY A;  5C0Y A;  1BOT O;  1K6Y A;  3ZSZ A;  2UXC K;  4DS5 A;  4TSX A;  4IJA A;  4GV9 A;  4DV6 K;  2O8F A;  4GV6 A;  2A1S A;  1KCF A;  3R8E A;  3RMC A;  5EU7 A;  4M3W A;  3ZT0 A;  3VQ8 A;  1Z05 A;  1BCM A;  2E1Z A;  2QWN A;  5FPN A;  3KK1 A;  4LF5 K;  4Z0U A;  4H5T A;  4JI5 K;  5AQY A;  3WEE A;  4DS4 A;  2NRW A;  4FL9 A;  4G1Q A;  3CD6 N;  4GMJ B;  3EZ5 A;  1VK0 A;  3EY1 A;  3MK6 A;  2FXU A;  3OYE A;  4LH5 A;  3HPO A;  4JKG B;  1BQM A;  1NK0 A;  1H1V A;  2YI1 A;  3D0P A;  5GIP A;  1HNW K;  1QVG M;  2QWR A;  4DFK A;  4JD2 A;  1ZBH A;  3WXI A;  3V9Z A;  3BY5 A;  5KPT A;  3HVR A;  3VGK A;  3THY A;  4BQL A;  4M3X A;  4F3T A;  2P51 A;  1T6D A;  2VGN A;  4RW7 A;  4CD3 A;  5LMN K;  3AA2 A;  3GG4 A;  4JN4 A;  4RW8 A;  5D3G A;  3PO5 A;  4OPA A;  1VSL A;  2Q97 A;  3VQA A;  4LF7 K;  5FRN A;  1D4X A;  3G6E N;  1EET A;  3V9S A;  3TI0 A;  4JRP A;  1VRT A;  4E7J A;  5GIO A;  3AVF A;  1NKE A;  2GX9 A;  3SUQ A;  1GOA A;  5AQX A;  4FWL A;  1BUP A;  1RDC A;  3JAM O;  1S1X A;  1UA0 A;  2O8C B;  1L3T A;  3L0Q A;  4CBU A;  4C8K A;  3O80 A;  2FBX A;  1U49 A;  4ILH A;  5K14 A;  2Z1H A;  2QKB A;  4PQU A;  4CEO A;  3HOT A;  3V9U A;  1IKW A;  5ADX A;  1NGG A;  3OJS A;  3CQX A;  3ZSR A;  4J2E A;  3SNN A;  3AVH A;  4OLB A;  4IFV A;  4FO0 A;  4DKW A;  4W5R A;  5F2R A;  3P83 D;  4RCH A;  3BP8 A;  4XH1 A;  4H03 B;  1VHX A;  4WQ4 A;  3CM6 A;  2R7Y A;  3DRP A;  1HYZ A;  1BIZ A;  2Q36 A;  4LFB K;  1Y97 A;  4CFD A;  1I3A A;  4JS5 A;  2P9I B;  2OZS A;  1Q7Y O;  2EWS A;  3WNH A;  3J7Z O;  4JKG A;  3ENH A;  1NGD A;  2WTU A;  1JLF A;  2YHW A;  3L2U A;  1XI1 A;  1ZBU A;  3ZT3 A;  4DLG A;  1RTJ A;  3BF3 A;  4FXD A;  3NGY A;  1RT2 A;  4FSV A;  5EX5 A;  2HNY A;  2E6M A;  1FKP A;  3D2E B;  3QIC A;  2RPI A;  1VSE A;  2ETJ A;  4BRG A;  2ZGY A;  4BGB A;  1X3N A;  5BN8 A;  3IG1 A;  2ZJQ L;  2Q31 A;  4NB4 A;  2VCP A;  3QNN A;  4BDP A;  2UXD K;  1RNH A;  1VQ7 N;  2Q2R A;  4AHU A;  3SQ1 A;  1JLC A;  4CFB A;  3ZET B;  1LAW A;  3BGR A;  3AY9 A;  1NJY A;  3F73 A;  1YVN A;  4H5R A;  2OPP A;  4GVM A;  5KRT A;  2O8C A;  4FJG A;  1A5X A;  5AR0 A;  4XH5 A;  1TV6 A;  4NCB A;  1YAG A;  2XY5 A;  1KRP A;  1VSM A;  4DQS A;  3H46 O;  5AQG A;  4MO4 A;  1X3M A;  1WSF A;  2QTD A;  4I2Q A;  2KKZ A;  3SCX A;  1DTQ A;  4KHY A;  1QQN A;  3AVC A;  4V19 S;  5KRS A;  3L3V A;  4PKH A;  3K0S A;  3TAF A;  4I9L A;  1YIT N;  4CF9 A;  2HHH K;  1RCH A;  4CEC A;  3R6M A;  3QDK A;  1EWQ A;  2DFE A;  3MAQ A;  4CK1 A;  3RR7 A;  3ID6 A;  3V81 A;  4FVM A;  3LWM A;  3HVT A;  2Y1J A;  2P9I A;  4HVJ A;  3O1W A;  5FPD A;  3PY8 A;  3RMD A;  2PAV A;  3CYM A;  5AQQ A;  4MLE A;  4NCG A;  4BWJ A;  1OH7 A;  1NJW A;  5M1P A;  3SUO A;  3RWU A;  3DWL A;  1VSH A;  3D7E O;  1DKG D;  4M42 A;  3D2E A;  3H08 A;  1DGK N;  3O3F A;  4YOY A;  1N33 K;  3MED A;  3E1Y A;  1CZA N;  4KHN A;  5C15 A;  1BI4 B;  3C6A A;  2BUP A;  3IDH A;  3O4N A;  3ZET A;  1S9E A;  1S6Q A;  1TAU A;  4ZTF A;  1MDU B;  1N36 K;  4E7H A;  4DF8 A;  4CZF A;  3IRX A;  4CVN E;  4IBN A;  3SK3 A;  4CF8 A;  3KLG A;  4JS4 A;  2LSN A;  3PSI A;  3G71 N;  2ZM6 K;  4BRO A;  1S5J A;  4O5B A;  5EY4 A;  4HCC A;  5CYM A;  1SL1 A;  5AQN A;  3VEO A;  1T8E A;  2H3G X;  2CGJ A;  3PX0 A;  3LP0 A;  2RF2 A;  3HPG A;  5EOY A;  4FLU A;  2V7Z A;  5JIC A;  4CJE A;  2HMP A;  3B6P A;  5A2Q O;  5M1Q A;  4O5F A;  1B9D A;  1KAZ A;  4I6M B;  4KHQ A;  4KFB A;  4CJK A;  5AQP A;  4E7I A;  4JK7 A;  1G15 A;  3H3N O;  1L5U A;  2FF3 B; 
#chains in the Genus database with same CATH homology
 3CPW M;  1T6C A;  3WXM B;  3O6W A;  4NLB A;  3KVG A;  2VGM A;  5AZJ B;  3VEN A;  5FPM A;  1YXQ A;  3VOV A;  4BGA A;  4BY9 C;  3VTH A;  1SZ2 A;  3DLL L;  2QWQ A;  4IZ9 A;  3C6H A;  4QS9 A;  2GWK A;  5KPZ A;  4FWQ A;  3CCQ N;  4WQ4 C;  2QW9 A;  2A41 A;  4JNE A;  3O9Q A;  5JVG L;  4IEE A;  2WUS A;  3JS6 A;  4ILG B;  5BPL A;  1HLU A;  2NLX A;  4YOX A;  3M3Z A;  1OVY A;  2HF4 A;  4E1J A;  1NM1 A;  2GEM A;  3A8Y A;  2J4R A;  5AQK A;  3MMV A;  1BDG A;  5AQS A;  4B1Y B;  2A6A A;  4PHT X;  4JKH A;  3H1Q A;  3WXK A;  2I7P A;  5LJV A;  4ISG A;  5GAH P;  3VEY A;  3CJB A;  2QA4 N;  1X9J A;  3MN6 A;  1K8A O;  3VF4 A;  4BR5 A;  4C1N K;  5GAG P;  1GLE G;  4WCE L;  3CER A;  3VGM A;  1S72 N;  4GV3 A;  4B9Q A;  3EKS A;  4H5V A;  3MWT A;  4JKC A;  4BVP A;  4IXC A;  3I33 A;  4CZK A;  2NNW A;  3CQY A;  4PKI A;  3MN5 A;  4G9Z A;  1GLL O;  4BG9 A;  3LM9 A;  4AM6 A;  2QEX N;  2CGK A;  3L6Q A;  1KC8 O;  1RDU A;  2QWO A;  3I8B A;  2P9S A;  4RTF D;  1SAZ A;  3WEE B;  1Y64 A;  4BR9 A;  4CD1 A;  2V51 B;  1BU6 O;  1T3V A;  3DJC A;  3U9D A;  2P9L B;  3CPE A;  1K8K B;  4FWS A;  1VQK N;  3W0L A;  1NGI A;  3WT0 A;  5JVH L;  4WQ5 C;  4NLC A;  2E2Q A;  4JKE A;  4YOU A;  1KAX A;  1IG8 A;  1YIJ N;  4ISF A;  1NGJ A;  4JHD A;  5BRE A;  5F0X A;  3LDN A;  1GLD G;  3MX2 A;  4H0Y B;  1ZBS A;  4IDH A;  4JKF A;  3CCV N;  2E2O A;  3ENO A;  4H5W A;  4IJN A;  4JKA A;  3UKR B;  4BR4 A;  4FVU A;  2KLA A;  1KAY A;  2F7T A;  1GLA G;  3KK7 A;  1XC3 A;  2GUP A;  1U2V B;  4M7Y A;  1EQY A;  3ULE A;  2ASM A;  4IWV A;  2QI2 A;  3A5M C;  3MN7 A;  2HBK A;  2E88 A;  4JD2 B;  4A59 A;  3WXJ A;  1YJN N;  4I6M A;  1GLF O;  2HBL A;  2RE2 A;  3SBG A;  4PL8 A;  3VPZ A;  3FZL A;  1Q18 A;  2GEL A;  2P9N A;  3P38 A;  3TSQ A;  4BRK A;  1BO5 O;  5LJW A;  1HJO A;  4CZM A;  3C7N A;  3M6G A;  3DAW A;  4LC9 B;  3VER A;  3DXK B;  3O1B A;  3P4I A;  3B8A X;  3T7Z A;  4F9O A;  5AZJ A;  4M7X A;  3LL3 A;  4H0T B;  4KH6 A;  4BRC A;  3NVM A;  3FZH A;  4JKB A;  4CZG A;  1VQ6 N;  3A0I X;  5EXW A;  3ENB A;  1ATR A;  3E9L A;  3GDQ A;  3ZX0 A;  5ELZ A;  4BC4 A;  4BRI A;  4EHT A;  3VES A;  5CE3 A;  1YI2 N;  4Z94 A;  4BRF A;  5M1K A;  5KQD A;  4BRN A;  3HI0 A;  4DB3 A;  5GIN A;  1Q82 O;  3CCS N;  3UE5 A;  1HKB A;  2HF3 A;  5DM6 L;  1JCF A;  2QWP A;  3OBW A;  1QHA A;  2D0O A;  4K43 A;  1QZ5 A;  5AQJ A;  1E4G T;  5C0Y A;  3E66 A;  1ZXO A;  1NGF A;  5E84 A;  1NJI O;  1BOT O;  1QQO A;  4BRA A;  1R59 O;  1TYQ B;  3BF1 A;  4O8U A;  4AF1 A;  5BPN A;  1BA0 A;  3F2K A;  1GLC G;  3MN9 A;  4IJA A;  4ISE A;  3U8X A;  4GV9 A;  4GV6 A;  3CJ1 A;  3L4I A;  1HX1 A;  3LDL A;  3VMF B;  3R8E A;  2FF6 A;  3EL2 A;  1NGE A;  3EO3 A;  2WC9 A;  1Z05 A;  1BG3 A;  5AQO A;  2P9U B;  3AAQ A;  4B1U B;  1OKJ A;  2E1Z A;  2QWN A;  5FPN A;  2JWL A;  4H5T A;  3E9O A;  5JLF A;  3CC4 N;  2NRV A;  2FSK A;  3MX5 A;  3ATU A;  3R1X A;  2QWM A;  5DM7 L;  5AQY A;  2ZJR L;  3WEE A;  2NRW A;  1ESV A;  3DXM B;  4A61 A;  4CZH A;  4FL9 A;  2P9L A;  4EIA A;  1K8K A;  1TUY A;  2A40 A;  1IJJ A;  3CD6 N;  3SBT A;  2A42 A;  3UB5 A;  2UYT A;  5LY3 A;  1VQP N;  3PLA A;  5AQW A;  3CCJ N;  2E2P A;  4CBX A;  3OA9 A;  4BRH A;  3ID8 A;  3E9P A;  3AGK A;  5M1N A;  2FSJ A;  5FPE A;  3PIO L;  3CJ9 A;  3UKR A;  1KXP A;  1P90 A;  2FXU A;  3MK6 A;  3FZM A;  3IKM A;  4JEP A;  2ZJP L;  3G4S N;  4JKG B;  3RSE B;  3FLC O;  1U2V A;  3KWI A;  1H1V A;  1BWF O;  2YI1 A;  3W3D A;  1V4S A;  4MDA A;  5GIP A;  1VQO N;  4DCH A;  2FLO A;  1QVG M;  1ATN A;  2QWR A;  3CI5 A;  4JD2 A;  1YJ9 N;  3WXI A;  2BTF A;  3AAR A;  4IOX A;  3CJA A;  4K25 A;  5KPT A;  2V7Y A;  3VGK A;  3EKU A;  5AFU A;  4BQL A;  3AAP A;  1W2B M;  1T6D A;  2VGN A;  3GOI A;  3TTD A;  4CD3 A;  3L4Q A;  3MCA B;  3GG4 A;  4JN4 A;  3VEZ A;  4BC5 A;  3CME N;  2DPN A;  3MDQ A;  1KQS M;  4OPA A;  2P9K B;  2Q97 A;  3DXK A;  1N8R O;  1MWK A;  1D4X A;  4WFB L;  3G6E N;  3CC2 N;  3F9M A;  4B1V A;  3TTC A;  5KPR A;  3JXU A;  1LCU A;  5AQR A;  2QM1 A;  5GIO A;  4YOV A;  2VWB A;  4C1N I;  4CBW A;  1S22 A;  1YUW A;  1V4T A;  1W97 L;  3F5T A;  2GX9 A;  4A2A A;  4WFN L;  3G25 A;  2OAN A;  3O8M A;  3A5L C;  4WFA L;  3UKU B;  4JK9 A;  4XH4 A;  3IUC A;  5AQX A;  4FWL A;  4DQ8 A;  1BUP A;  4JK8 A;  3VEW A;  5TKW A;  2ASO A;  4BR2 A;  4YDU C;  3WQT A;  1M90 O;  4JKD A;  2Q1N A;  5E26 A;  3HZ6 A;  4H0V B;  3H45 C;  3L0Q A;  4CBU A;  4WF9 L;  1HKC A;  3SMP A;  4GVE A;  3O80 A;  3HM8 A;  5AZI B;  4ILH A;  3D6R A;  2ITM A;  3P39 A;  1TYQ A;  2NRH A;  1O13 A;  2F9W A;  4BRE A;  3HOT A;  5BRF A;  3EN9 A;  5B8H A;  2QXL A;  5ADX A;  1NGG A;  3CQX A;  4CZE A;  4K41 A;  3P31 A;  4FWM A;  1G99 A;  5AFU H;  4BRP A;  1K73 O;  1RDW X;  2P9U A;  2W41 A;  3TU5 A;  3CCR N;  3O9U A;  3WQU A;  1GLJ O;  3O08 A;  4MLH A;  4A5B A;  1YF5 L;  2A5X A;  1VQ4 N;  2HBJ A;  3SJH A;  1BA1 A;  2V52 B;  2ZGZ A;  3KWG A;  4NO7 A;  4FO0 A;  3SLC A;  4DKW A;  3FFK B;  4ILJ A;  5KQ8 A;  3DXM A;  4RCH A;  5F2R A;  3BP8 A;  3LM2 A;  2CH5 A;  3FGU A;  4H03 B;  2YCH A;  3D2F B;  4XH1 A;  4GNI A;  3SMS A;  4FPA A;  5AQL A;  3LDQ A;  4IO9 L;  2HST A;  2YHX A;  4WQ4 A;  5BN9 A;  3CCU N;  4BRM A;  5C2F A;  3U9Z A;  1SQK A;  4K42 A;  4FOE A;  2Q36 A;  3O9R A;  4M63 C;  1NGC A;  2P9I B;  3N4Q A;  1Q7Y O;  2EWS A;  4BC3 A;  4YOR A;  3J7Z O;  1VQ9 N;  4YOT A;  4JKG A;  3I55 N;  3HBT A;  3RSE A;  3ENH A;  1NGA A;  1NWK A;  4H0P A;  2CH6 A;  1C0F A;  5EVZ A;  3SAG A;  3GBT A;  1YHQ N;  1NGD A;  2IIR A;  4FWP A;  3O5B A;  5M1O A;  4A5A A;  4DHY A;  2BH1 A;  3BEX A;  2YHW A;  1QVF M;  3ZEU B;  3A5O C;  3CJC A;  3QFU A;  5CR4 A;  4EFH A;  5M1F A;  1HUX A;  1J6Z A;  4IO8 A;  5ADX H;  3BF3 A;  4HWI A;  3TSU A;  1LOT B;  4FSV A;  5EX5 A;  1E4F T;  3D2E B;  3QIC A;  2AP1 A;  4CI6 A;  3CCL N;  2ASP A;  3GE1 A;  1KD1 O;  2P9K A;  4BRG A;  2ZGY A;  4BC2 A;  3VTI A;  4BGB A;  1C0G A;  1X3N A;  1XUP O;  3H1V X;  5TKY A;  3EE9 A;  5BN8 A;  5F1X A;  2ZJQ L;  3U4L A;  2Q31 A;  4NB4 A;  2VCP A;  1HKG A;  3J8A A;  3O9T A;  1QZ6 A;  2NRZ A;  3HOS A;  4IOC L;  1VQ7 N;  2Q2R A;  5AQF A;  3T69 A;  1NLV A;  4KH5 A;  5AQH A;  5BRH A;  3CHW A;  1JCE A;  4WQ5 A;  1VQM N;  4B1W B;  3Q7C A;  3ZET B;  4A2B A;  1ZC6 A;  4CZI A;  3UKU A;  3O9S A;  3QBW A;  1SS6 A;  2I7N A;  3AY9 A;  3NVK A;  4KBO A;  1YVN A;  3TPQ A;  4H5R A;  5MLC Q;  1VQ5 N;  4BRQ A;  5AR0 A;  4XH5 A;  1U6Z A;  1YAG A;  3MWP A;  3KZB A;  5BR9 A;  2VYP A;  5CHI A;  5AQZ A;  5AZI A;  3H46 O;  5AQG A;  2Q0R A;  3AGR A;  3QFP A;  4MO4 A;  4EHU A;  4L3Q A;  4U67 L;  1X3M A;  2WFB A;  3ATV A;  4R79 A;  1EO1 A;  4JAX A;  2QTD A;  4YOW A;  4CJ7 A;  2KKZ A;  2YHY A;  3FE1 A;  3FR0 A;  3FZF A;  4B1Z A;  2YJF A;  1NBW A;  4J8F A;  5AQV A;  3CMA N;  1QQN A;  3BUZ B;  2YX6 A;  3OW2 M;  5HL7 L;  1HPM A;  4CZL A;  1RGI A;  4PKH A;  3SAH A;  3K9K A;  2RHK A;  1NGB A;  3OBY A;  3VF6 A;  1VQN N;  4CZJ A;  3SAF A;  1YIT N;  4FWN A;  2FSN A;  3QBX A;  4H0X B;  5GAE P;  2HOE A;  3I56 N;  3D2F A;  2P9P B;  5C10 A;  4FWO A;  1WOQ A;  1WUA A;  2YJE A;  3R6M A;  4GY2 B;  2IVO A;  3QDK A;  2ZF5 O;  4O8K A;  4XEI A;  4RWT A;  3OHR A;  3ID6 A;  3H6E A;  5I9E B;  3CCM N;  4H0O A;  2P9I A;  2F9T A;  4B1X B;  3CCE N;  2PBD A;  3LDP A;  3O1W A;  2D0P A;  2E1Y A;  1ATS A;  3GL1 A;  5FPD A;  3EE8 A;  4YDU A;  2ZWH A;  4U7B A;  3QB0 A;  4EAH D;  2PAV A;  3M5R A;  4FPB A;  1QQM A;  3QML A;  5C12 A;  1VQ8 N;  1ILY A;  5AQQ A;  3ZEU A;  1MWM A;  4MLE A;  4OO1 J;  1T44 A;  2D4W A;  5M1P A;  2CGL A;  3S41 A;  4BR0 A;  3CF5 L;  3C65 A;  4QS8 A;  3DWL A;  3D7E O;  1DKG D;  4BRD A;  1M1K O;  1GLB G;  2HBM A;  3VGL A;  2NZT A;  2W40 A;  3D2E A;  1DGK N;  5JMV A;  4YOY A;  2NRX A;  4IEI A;  1NMD A;  3CIP A;  1MA9 B;  3IFR A;  5AQT A;  3FZK A;  4BRL A;  2NRR A;  4FWR A;  3E1Y A;  1CZA N;  2NRT A;  5AQI A;  5BRD A;  5C15 A;  1VAZ A;  2E8A A;  1DEJ A;  1TUU A;  4AM7 A;  3C6A A;  4PKG A;  2BUP A;  3LDO A;  3MCP A;  3KHY A;  3IDH A;  3CET A;  4Y0W A;  3ZET A;  3A5N C;  2E2N A;  3R3L A;  3K9J A;  1JCG A;  1MDU B;  3VEV A;  3CC7 N;  3WXL A;  3Q7B A;  3CXC M;  3NMU A;  4A57 A;  2IVP A;  3HTV A;  4CZF A;  2P9S B;  1RFQ A;  1NGH A;  1S3X A;  2A3Z A;  5C2D A;  3VEX A;  3H3O B;  4OPH A;  2Q0U A;  3SK3 A;  4BR7 A;  3M1F A;  4QS7 A;  4BVO A;  3G71 N;  4FOI A;  4BQZ A;  4HTL A;  4WYB A;  3C0B A;  3TTF A;  4BRO A;  1Q86 O;  4A62 A;  5JLH A;  3ZX3 A;  1JJ2 M;  2D1K A;  4IOA L;  2QWL A;  5EY4 A;  4JHD B;  4BG8 A;  2GWJ A;  4MO5 A;  5AQN A;  2GTD A;  3VEO A;  3ZX2 A;  2H3G X;  3IMX A;  2CGJ A;  4FWK A;  2IVN A;  2OTJ N;  4UY8 O;  1P8Z A;  3ZYY X;  5EOY A;  3VET A;  5GAD P;  3O4W A;  3RVC A;  1Z6R A;  2V7Z A;  3ULE B;  3WUH A;  5JIC A;  5H1S Q;  1K9M O;  2HMP A;  2AA4 A;  1XQS C;  5M1Q A;  4O5F A;  1VQL N;  4C23 A;  1KAZ A;  3EZW A;  1Q81 O;  1DT9 A;  2E20 A;  2P9P A;  4I6M B;  1YJW N;  2KHO A;  5AQP A;  2PFU A;  2JWK A;  4H5N A;  3CJ7 A;  4MDB A;  4JK7 A;  2WBN A;  3HRG A;  2P9N B;  3N4P A;  3HSC A;  5HOO A;  3TSP A;  5AQM A;  5AQU A;  3R9P A;  3VF2 A;  5BPM A;  2OTL N;  3C7N B;  3H3N O;  3PIP L;  4IFE A;  4KH4 A;  4PL7 A;  2FF3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...