1KVCA

E. coli ribonuclease hi d134n mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCNELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE H
total genus 53
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvcA00
3L2VA 4Z4HA 2E4LA 3MAQA 4J2BA 1SL1A 1JXBA 3HP9A 3PY8A 3KLEA 1C1CA 4FK0A 2G8WA 4FK4A 1T03A 3V4IA 3EYZA 4OKKA 1IH7A 2RKIA 1S1TA 2RPIA 4AILC 3JYTA 4NCBA 2HVHA 1RBUA 3ASMA 4M3ZA 3DLKA 1UWBA 3F9KA 1CZ9A 4BDZA 3RTVA 5KRSA 4FYDA 2DY4A 4L8RB 1BIZA 1I39A 2QKBA 1ASVA 4RW9A 1I3AA 1Q9YA 1N6QA 1C0TA 2RN2A 2BE2A 3ZT3A 1A5XA 4FJ7A 1FKPA 2Q3SA 4CHNA 3QETA 4HUEA 3DRRA 1VRUA 2FBYA 4KO0A 4R5PA 3VQ9A 3PO5A 4DFMA 2E6MA 1RTIA 1HNVA 4ELVA 2XY8A 5DK5A 3KD1E 3VN5A 2KFNA 3ZT4A 4FXDA 1KFDA 3ZSZA 4B08A 3QERA 2XY7A 5JS1A 2KQ2A 5CYQA 5C25A 1WSGA 2VG6A 1YTUA 2JGUA 4BWMA 1JKHA 3T19A 4W5RA 4FLZA 3TAGA 3V9ZA 5JS2A 4DTOA 2IC3A 3AVHA 3AVGA 3HVTA 5KRTA 3V9SA 1TK0A 4DQIA 4FCYA 3C6UA 4CJVA 2G8IA 1HYZA 3V1OA 4DFKA 4HHTA 5I42A 4DF8A 2XY5A 3U6FA 1D9FA 3LP1A 3HJFA 4O4GA 3CM5A 1IKVA 2PYJA 3UIQA 4FJIA 5EU7A 3ALYA 1U4BA 3SYZA 1EKEA 3DI6A 3WNGA 4CJFA 4CJSA 3HXMA 5HROA 1ASWA 3LWLA 1NJZA 4O5BA 2HMIA 1JLGA 4PUOA 2YHBA 3M8QA 4HTUA 4DSJA 1C0UA 1NKBA 5J2PA 5J2NA 1WSHA 4KHUA 4QOZB 4CEZA 1WNSA 3AVCA 3AVFA 1BQNA 3L2RA 3OYMA 1JXEA 4BACA 4DSFA 1NOYA 2F8TA 3KD5E 5KGWA 3AVAA 4KHQA 4CK2A 4CGJA 3HP6A 4F2RA 1L3VA 1RDDA 2ATQA 3KKRA 4OVLA 3V1RA 3WNFA 1HNIA 3NF9A 4CFBA 3QEWA 2G8VA 5J2MA 1A5WA 3DYAA 4AHUA 4B9LA 2G8FA 4DTJA 1RT4A 1DTTA 2D0CA 4H4OA 1DLOA 2D0AA 4Z0UA 4CE9A 4E3SA 1ITGA 1IO2A 1RNHA 1C6VA 5FROA 4N41A 4FK2A 4PQUA 3QEVA 1A5VA 3ZT1A 3KK1A 3RR8A 4CJUA 1RCHA 4KV8A 4DG1A 2AJQA 4CIGA 1VSDA 2RF2A 3K2PA 3THVA 3BDPA 2KZMA 4PY5A 4CCHA 3AO3A 3SPZA 1D9DA 4K8ZA 2BANA 2VG7A 1LAWA 3U3YA 1TVRA 3AV9A 3NFAA 1VRTA 3SPYA 1J54A 1C1AA 2HNDA 3HPHA 5HRPA 2ZD1A 1U45A 1Q9XA 3K5OA 3LPTA 1K6YA 3AVNA 2QK9A 1UA0A 1YVUA 4O0IA 1NKEA 4FZXC 4C8NA 4G1QA 4W5OA 3RRHA 4CIFA 3VA3A 4CERA 3VQPA 1L5UA 4B9TA 1S5JA 1Z26A 1T7PA 4FJGA 3V6DA 2HW3A 3AVIA 4KHWA 4DSKA 3TANA 4CJQA 3C6TA 4DS4A 4DTXA 4FJNA 1JLAA 4W5QA 1WAFA 3OYDA 3KJVA 2LSNA 4O44A 3NHGA 4DSEA 2Y1JA 3OYAA 4K8XA 1TK8A 4QCLA 3LPUA 1Z25A 5KTQA 2BGGA 4NCAA 4DQQA 4M41A 3PX0A 3LP3A 1U47A 5HRRA 3KLHA 4OPKA 4KREA 3VQBA 3O3HA 3LAKA 3L2WA 1NK8A 4E1NA 3EY1A 5HLFA 1SKRA 4CEBA 4FJXA 2QXFA 2G8UA 4OLAA 2G8HA 1QHTA 4TSXA 3HM9A 5HRNA 1B92A 4RW7A 2X78A 3O4NA 4B8AB 3SQ2A 3RMAA 5E41A 3SUNA 2YKMA 1TKDA 1TV6A 4DTMA 1BCOA 4MFBA 4F3OA 3DLHA 1ZBHA 2OPQA 3V9UA 2X6SA 4DSIA 1NK5A 1YT3A 1EX4A 4I9QA 3MXMA 1XI1A 1WSJA 3LWMA 1RT6A 1T8EA 2GV9A 4JS5A 3DLGA 4I7FA 1L3UA 4CIEA 2OPPA 2XHBA 2PZSA 4M3YA 2X6NA 2P51A 2KZZA 1J9AA 1KVCA 2IDOA 3PX4A 3AA5X 3K5LA 2HHWA 3TWHA 3AO1A 4CHOA 1LWFA 4MQ3A 1G15A 1BHLA 4LD0A 1B9FA 4CGFA 3K5MA 1WSIA 4FM1A 4DTUA 1X1PA 3TABA 1IG9A 4I9LA 2XY6A 3T1AA 3QINA 4I2PA 2GUIA 4HVJA 1Y97A 3P1GA 4CJPA 1TKXA 3V9WA 1RDCA 3TARA 1J5OA 3D0PA 1TAUA 2D5RA 2YHAA 2YNFA 3HPOA 4DQSA 3HL8A 4FLXA 3DM2A 2B4JA 1ZYQA 1QSLA 3SQ0A 1BIUA 3D45A 3NGYA 1TK5A 3HK2A 3QIPA 2F96A 2IGIA 4IG0A 3VQAA 4AHSA 4CFCA 3QEIA 1ZBUA 3RMDA 3TAEA 4CHPA 4FJHA 4DTSA 3OS2A 4N5SA 3SJJA 2Z1GA 1RBRA 5HBMA 4OPJA 2PY5A 4CEOA 3VQ6A 5K14A 3S3OA 4Z4EA 4CJRA 4LH4A 4FJ9A 2F8SA 3L2UA 2HNZA 3ZSYA 3O3FA 3B6PA 2EX3A 4JS4A 4B9MA 5FRMA 3PUFA 3HYFA 5J2QA 4LH5A 5CY4A 2OZSA 1UA1A 4M3XA 1JLCA 1VSKA 4CJ3A 4E1MA 4E19A 1NK4A 4IFYA 3VQ4A 4FLTA 4YNQA 3OYFA 3KLGA 4HCCA 4J2DA 3OS1A 2FBVA 3FFIA 4EZ6A 4Q5VA 1VSLA 4PWDA 3OJUA 3KK2A 4NYNA 3CFPA 1SUQA 3AO4A 4CEEA 1S6PA 2QKKA 4B3OA 3AVLA 3H08A 1L3TA 3AA4A 3C94A 4CHZA 1R0AA 3I0RA 4EP5A 4F8RA 4O55A 1JLEA 3QO9A 1IKWA 4CJTA 4J2EA 4DMNA 4EP4A 1BCMA 3IS9A 3AVBA 3LZIA 4Z4IA 3HT3A 2HB5A 1JLFA 1TKTA 2O4IA 4FJ5A 3MEEA 1SKWA 2BDPA 1U49A 1T05A 3M8PA 4BE2A 3KIOA 3SQ4A 1RTHA 4FJJA 1HMVA 3SNNA 4CECA 1TL1A 3MEDA 1RBVA 3LZJA 3K58A 3MXIA 1X9WA 1L3SA 1KCFA 4CGDA 4CGIA 4KTWA 1JLQA 1TGOA 3OYCA 1TL3A 1YTAA 1U04A 2DFFA 3VQ5A 4CGHA 3VA0A 3OYGA 3QNOA 3PV8A 4KB0A 4KI6A 1S6QA 4CJWA 4DTPA 4KRFA 2PYLA 2DTUA 3LDSA 2IOCA 2P5GA 1S9EA 2YV0X 3K59A 5KGXA 1KSPA 3IRXA 2VG5A 1NK9A 4KAZA 4BE1A 4I2QA 1EXQA 2JLEA 1ZBFA 4GVMA 4FM0A 1RT7A 1KRPA 1NJWA 3O4QA 1BISA 1QSYA 1QS4A 1RT3A 1KLNA 2XO7A 3DLEA 3QEXA 5T7BA 4DU4A 3VQ8A 3K5NA 5D3GA 2WONA 2I5JA 4IKFA 4M42A 4M45A 3NH1A 2X74A 4E0DA 4NCGA 4DSLA 3AVKA 4HUFA 1B9DA 4DLEA 4RW4A 1BQMA 1NK6A 4FW2A 4HUGA 1XWLA 3SCXA 4E7LA 1VSFA 2Z1JA 4B9UA 2HHUA 1UAXA 4KKOA 4ICLA 4BWJA 1IKXA 1NKCA 1HPZA 3AO5A 3VQEA 4GW6A 3NGIA 2HHTA 1SV5A 3SUPA 4OGCA 1RT1A 2OYQA 3ZSVA 1BI4B 4UQGA 3TI0A 3ISNC 1SKSA 4OLBA 3AA2A 3AA3A 3M8SA 4DTNA 4E7JA 3OYNA 5HRSA 3QESA 4E7IA 1JL2A 3SUQA 4FJMA 4M3TA 4F4KA 2HHXA 3OJSA 4WE1A 3ITHA 2IS3A 5C42A 5SZTA 4KPYA 3DMJA 4KTZA 1LW0A 1BI4A 3CFRA 4F2SA 4LSNA 3SZ2A 1GOCA 1EP4A 5I3UA 3IG1A 1FK9A 3U3GA 2YNHA 5CZ2A 3G0ZA 4CJLA 3SV4A 2Y1IA 4FJLA 2NUBA 2YNGA 4Y1DA 4BDPA 1O1WA 1DTQA 4Z4FA 4IBNA 3ZSXA 3CQ8A 3KLFA 3QEPA 4CHQA 1LW2A 3HSTB 1GOAA 4B9SA 4NYFA 1VK0A 3I0SA 3V1QA 1VSHA 3QNNA 3S9HA 1EETA 4KHNA 4GMJB 1KVBA 5KI6A 4FJKA 1RT5A 3ZT2A 4IFVA 1NK0A 1W0HA 4CEFA 4CF0A 2HNYA 1VSJA 5FDLA 4Z4CA 4CK3A 1SL0A 1FKOA 3VQCA 3HVRA 4YFUA 3OYBA 4AHRA 1NJYA 1JLBA 1KVAA 4CK1A 5CZ1A 3TAFA 4C8OA 3QLHA 3KK3A 3SQ1A 3E01A 4KTQA 3VQ7A 2KTQA 1X9SA 1NK7A 4W5NA 3AVMA 1LV5A 1RDAA 5C24A 3LALA 4CEQA 3O3GA 4B9NA 4DU3A 2ITGA 4E7HA 2VWKA 3RMCA 3NF7A 3HO1A 3K57A 2FBXA 4HCBA 3AVJA 4DF4A 3TAMA 2D0BA 4CHYA 1RBTA 1VSEA 1S9GA 3I8DA 4PA1A 1KFSA 5SWMA 2OA8A 4C8LA 4CJEA 3NCIA 3WNHA 3KKSA 4E89A 2ZQBA 1HQEA 1XC9A 2FBTA 2O4GA 4CEAA 1XHXA 1BGXT 4RG8A 1NJXA 1HYVA 4CJKA 4CEDA 3M8RA 3OVNA 1MU2A 4C8MA 2KW4A 3DLRA 3MXJA 4W5TA 3VQQA 1LWCA 1J53A 2P1JA 4KB1A 2EHGA 2FC0A 3L3VA 3OYHA 2KFZA 2HVIA 1RILA 4RW8A 3ZSRA 4IDKA 2G8KA 3BGRA 1HQUA 1WN7A 3DOKA 1S1XA 2Z1IA 4O0JA 4ZTJA 4F3TA 4Z4GA 4EZ9A 3CYMA 3L8BA 1HYSA 2HHSA 4KHYA 3NH2A 4AH9A 3LAMA 2W42A 3NH0A 4CGGA 1HRHA 1NOZA 4CFDA 2OZMA 5FRNA 3NDKA 3OYEA 2DFEA 4AHVA 4FLYA 1RTJA 4AHTA 3DLBA 1N5YA 4N76A 3NAEA 4H4MA 1QE1A 4QAGA 4M3UA 3G10A 1KLMA 4ID1A 4CJ4A 4DS5A 3ULDA 4M3RA 5J1EA 3DRSA 3PO4A 4B9VA 1WAJA 3F73A 3WNEA 4CF9A 4Y1CA 3CG7A 2B6AA 3OYIA 4E7KA 1U48A 4KFBA 3MEGA 3NF8A 2HHVA 2DFHA 1RT2A 1RDBA 2Z1HA 1QQCA 4XIUA 4JRQA 4ID5A 3JSMA 3RWUA 1F21A 3NBPA 3OS0A 2HHQA 2XRIA 3B6OA 3RR7A 4FZYA 1RBSA 4FZZA 3EZ5A 3C95A 4CF2A 1IKYA 1LAVA 5CYMA 3S3NA 4IG3A 2GBZA 1VSMA 4OJRA 4ELTA 3NE6A 3L2QA 4OKJA 1UOCA 4FVMA 4JRPA 2OPSA 5DMRA 3S3MA 1D5AA 3LANA 2E6LA 3T3FA 1ZBIA 2IAJA 4DLGA 4OGEA 3RMBA 1S1UA 4DQPA 1RTDA 4OKEA 1TAQA 4FLVA 4LY7A 3OYKA 1SL2A 1QSSA 2WOMA 3A2FA 3CFOA 1C1BA 1LWEA 1WLJA 1CXUA 1HJRA 3HPGA 4FW1A 4JLHA 3SUOA 4Q0BA 1ASUA 3DOLA 1Q8IA 3IAYA 4M3WA 3LP2A 3OY9A 4J2AA 3VQDA 3ZCMA 4CF8A 1S1WA 1TKZA 4AHCA 4DTRA 3ZSWA 4DQRA 4N56A 3QIOA 3ZT0A 4DWIA 4KI4A 1CXQA 3CM6A 4H8KA 3KTQA 4CFAA 4FJ8A 1KTQA 2ZE2A 1D8YA 3OYLA 1JL1A 1WSFA 2ETJA 3SI6A 4RW6A 1X9MA 5HP1A 2YKNA 4BDYA 3P83D 4LSLA 2R7YA 3PX6A 3MECA 3DRPA 1FXXA 4DFPA 3AO2A 1BL3A 1C0MA 1VSIA 3V81A 3RRGA 3TAPA 3ZSQA 2B5JA 4ELUA 3NF6A 4BE0A 1ZBLA 4DFJA 3OYJA 4C8KA 4KHSA 3KLIA 2OPRA 1CLQA 3V9XA 4DU1A 1XHZA 4CJ5A 3SV3A 1QTMA 4FM2A 1CZBA 3NGZA 4ZTFA 4FLWA 4CESA 3ZSOA 2A1SA 2YNIA 3TAQA 4FLUA 1WSEA 3TR8A 1REVA 1W9HA 4CF1A 2A1RA 1GOBA 2P5OA 3L3UA 4B8CA 2VWJA 4ZHRA 1S1VA 3P5JA 3LP0A 4N47A
chains in the Genus database with same CATH superfamily
3L2VA 3JS6A 1VHXA 1JXBA 3HP9A 4BC3A 3PY8A 4J2BA 1YJWN 1T03A 3NVKA 2OTLN 4JN4A 3F9MA 2O8BA 4M3ZA 1UWBA 3VF4A 1ZXOA 1BIZA 4ILJA 3EEQA 4RW9A 1Q9YA 1C0TA 2RN2A 3ZT3A 1FKPA 1T6CA 3QMLA 3GG4A 3I56N 4KO0A 3VQ9A 3PO5A 3MDQA 1RTIA 2HHHK 4JI2K 1NGFA 3QERA 5JS1A 4B08A 2KQ2A 1YTUA 2JGUA 3A5NC 1JKHA 3R8EA 3TAGA 4DTOA 5KRTA 3AVHA 1TK0A 3O9UA 4FCYA 4DQIA 4BQZA 1VQMN 4WQ4C 3HJFA 2E1ZA 4EAHD 5EU7A 3ULEB 3SYZA 3WT0A 4GY2B 4IOXA 4CJSA 4MO5A 3HXMA 4GV6A 3LWLA 3J7AP 1JLGA 3T1YK 4HTUA 4DSJA 3K9KA 3ULEA 4B3MK 4QOZB 4ISGA 4CEZA 5E26A 3OYMA 1JXEA 4BACA 5KGWA 4AQYK 2HBJA 3EKSA 3SMPA 4CGJA 1L3VA 3CPWM 4CFBA 4AHUA 1DTTA 2D0CA 1G99A 2Q0UA 2Q97A 2F7TA 3WEEA 3ZT1A 3U9ZA 4CJUA 2V51B 2AJQA 1HNZK 4B3SK 2RF2A 3K2PA 3U4LA 4PY5A 4JAXA 3ENOA 3AO3A 4JKBA 3WEEB 1LAWA 3U3YA 4FWSA 1VRTA 2E20A 1U45A 3CQXA 3SBTA 2QK9A 1YVUA 2UXDK 2V7ZA 4FZXC 4W5OA 3J80O 1S5JA 3AVIA 4KHWA 4DSKA 3O1WA 3Q7CA 4H5RA 4W5QA 3MN7A 4WF9L 3KJVA 4O44A 3NHGA 3ID8A 1K8AO 3KWGA 4DQQA 4M41A 4BG8A 5HRRA 4OPKA 1EWRA 3VQBA 3SAFA 3LAKA 4H0OA 3VGKA 3L2WA 4E1NA 3EY1A 5JLHA 3T1HK 4FJXA 4IOAL 5E84A 5EXWA 2X78A 2Q36A 1Q82O 1BCOA 3ID6A 4HWIA 4GKKK 2P9UB 1XI1A 1U2VB 1RT6A 1T8EA 2GV9A 5AQXA 1MA9B 4CIEA 2PZSA 2X6NA 5AQYA 1SS6A 3TWHA 1LWFA 3T3FA 3D2EB 4AILC 1B9FA 1X1PA 5I9EB 3E1YA 3TARA 3V9WA 2WTUA 3HPOA 1ZYQA 3E9OA 4YOWA 2F96A 3VQAA 1ZBUA 3P39A 3RMDA 3C6AA 4N5SA 1RBRA 4A2AA 2QWNA 3FZHA 4RWTA 3VQ6A 3L2UA 3ZSYA 3O3FA 4JS4A 4FOEA 5CY4A 3KWIA 4CJ3A 4IFYA 4BR0A 3VPZA 2D0PA 2QTDA 4YNQA 3CPEA 3GBTA 3OS1A 2FBVA 3FFIA 4Q5VA 3OJUA 3CFPA 1SUQA 1GLJO 3AVLA 1N8RO 3AA4A 3C94A 2O8EA 3WXLA 2P9PA 3QO9A 1IKWA 3F5TA 4DMNA 4EP4A 2E2OA 3HT3A 5JLFA 1JLFA 1OVQA 3WQTA 1GLCG 3M8PA 3CC2N 3LDNA 1HMVA 4CECA 1L3SA 1J5EK 4KTWA 3R9PA 4FJJA 1X3MA 3VA0A 4CJWA 4DTPA 1NGEA 5ADXH 1NGJA 4XH4A 4JNEA 5AQSA 4DV5K 2O8FA 3K59A 3OTOK 5GAHP 1ZBFA 3CQYA 4WFAL 1IV0A 1QS4A 1RT3A 3G6EN 1KLNA 2ZJQL 3K5NA 5A2QO 2WONA 1W2BM 4M45A 3NH1A 2NRVA 2ZM6K 2P9IA 1BQMA 4FW2A 3CJAA 2P9LB 1VSFA 4BWJA 1TUYA 2P9IB 1IKXA 5LJWA 1GLLO 3NGIA 3VGMA 3ZSVA 1H1VA 4DR5K 4OLBA 3AA2A 3M8SA 4LF8K 3OYNA 5HRSA 4O8KA 1JL2A 3SUQA 4M3TA 2WFBA 5C2FA 4BR2A 3DMJA 4KTZA 1LW0A 2BUPA 4FWMA 4BREA 3IG1A 3HOTA 2EWSA 1OH6A 1VQ4N 3SV4A 5FPNA 4WFBL 2YNGA 4Y1DA 3KLFA 2HBKA 3EZWA 1YIJN 4B9SA 4NYFA 1HKGA 1FJGK 4NLCA 3VMFB 4JKAA 1EETA 4O5FA 4IDHA 1VSJA 5LMNK 3W3DA 2AP1A 1JLBA 3THYB 4C8OA 3QLHA 5AQPA 4EHUA 3LALA 2ASOA 4B9NA 4E7HA 2VWKA 3NF7A 1NGIA 2FBXA 4MDAA 1S9GA 3CJ9A 5AR0A 1XUPO 4PA1A 4CJEA 5AFUH 1HQEA 2FBTA 1HNXK 2WBNA 4K25A 1NJXA 2GX9A 3OVNA 1MU2A 4W5TA 3DLRA 4YOTA 4BRKA 3GL1A 1J53A 2HMPA 2EHGA 2GELA 2HVIA 4RW8A 3B8AX 1WN7A 4O0JA 1JCEA 5C2DA 4EZ9A 3LDQA 5H1SQ 4KHYA 3A5MC 3NH0A 4BROA 4CFDA 5FRNA 2DFEA 1E3MA 1RTJA 5BN9A 4QAGA 1NMDA 3G10A 4CVNE 3PO4A 2D1KA 1KAXA 4Y1CA 3CG7A 4BRFA 5BR9A 3OYIA 2NNWA 4GKJK 3MEGA 1QQCA 3M3ZA 2D0OA 4BRIA 2QXLA 3BF1A 4JKEA 3B6OA 4FZYA 3C95A 3CCMN 4NB4A 2UUCK 4IG3A 1VSMA 4U67L 3R3LA 1IBLK 3RVCA 5FPDA 1JCGA 3L2QA 1UOCA 1XQSC 1OH5A 1K9MO 1ZBIA 4OGEA 2D4WA 4FLVA 1TAQA 4CBXA 4AF1A 5JICA 1CXUA 3HPGA 1Q8IA 3LP2A 3OY9A 4J2AA 1NWKA 4DTRA 3SLCA 2UYTA 4BRMA 3ZT0A 4N56A 4H8KA 4FJ8A 1HKBA 2ZE2A 3OYLA 3MWTA 1X9MA 2YKNA 3PX6A 4LSLA 1EQYA 3A8YA 3MECA 3THXB 4DFPA 3TPQA 2B5JA 3I55N 4ELUA 3MMVA 4DFJA 4DV2K 3KLIA 4FWPA 3SV3A 4FM2A 3I33A 5AQFA 2YNIA 4BGAA 1ZBSA 2VQFK 4JK9A 2A1RA 4FVUA 1LCUA 5EVZA 4ZHRA 4PKIA 3P5JA 4Z4HA 2E4LA 2O8BB 2JWKA 3MX5A 1C1CA 2V7YA 4FK4A 2RKIA 5AQTA 2P9KB 2HVHA 3JYTA 4BQLA 3CC7N 3ASMA 5AQWA 3F9KA 4FYDA 2DY4A 4BDZA 1RGIA 5KRSA 4IO8A 4L8RB 4H0XB 2P9KA 1K73O 3MCAB 3D6RA 2Q3SA 2YCHA 2FBYA 4NLBA 5AQRA 1HNVA 2XY8A 3VN5A 1HR0K 1KFDA 5AQGA 3K0SA 1WSGA 4XH1A 3D2FB 4FOIA 4W5RA 3V9ZA 2O8CB 4JYAK 5JS2A 3AVGA 2P9NB 2G8IA 4CJVA 1HYZA 4HHTA 4JHDA 2XY5A 1D9FA 3CM5A 1GLBG 4CJFA 3TSPA 2KKZA 5HROA 1ASWA 4JI5K 2A6AA 2YHBA 2YHWA 1P8ZA 1NKBA 5J2NA 4KHUA 3AVFA 3J8AA 1VQKN 3AVAA 4KHQA 1VQ5N 3W0LA 5LMUK 5C0YA 4JKFA 3NF9A 2HSTA 4I6MB 2J4RA 5J2MA 3DYAA 4B9LA 4DTJA 1RT4A 1ATRA 4YDUC 4JD2A 1ITGA 4N41A 5FROA 1C6VA 1IBMK 4PQUA 1A5VA 2YHYA 3KK1A 2FLOA 5GIOA 3R1XA 3THVA 3SPZA 2VG7A 1Q9XA 3M6GA 3AVNA 4WQ5C 1UA0A 1QQNA 4FWKA 4C8NA 4G1QA 1EO1A 2VQEK 1KQSM 3VQPA 1C0GA 5M1QA 1V4SA 4IXCA 4DS4A 3C6TA 4DTXA 3UE5A 3OYDA 4JI0K 5EOYA 2Y1JA 2A41A 4K8XA 1TK8A 1Z25A 3MN9A 4CD1A 3SMSA 4DB3A 1U47A 3KLHA 2NRRA 3CERA 1SKRA 4OLAA 2G8HA 3NVMA 1QHTA 4F9OA 3CD6N 1HNWK 1YXQA 1HKCA 4MFBA 3DLHA 4FWRA 3O5BA 4CZLA 4X64K 5LL6Z 1VQPN 4R79A 4DUZK 2XHBA 4FSVA 2P51A 2KZZA 1J9AA 1KVCA 1JCFA 3VERA 4CHOA 3K5MA 5J2QA 4FM1A 1G15A 1BHLA 3SUNA 1IG9A 4GV9A 3FR0A 4XH5A 4CZFA 1K8KA 4YY3K 4CJPA 1TKXA 1RDCA 3D7EO 3OHRA 1J5OA 3H1QA 1TAUA 2YHAA 3UKRB 1QSLA 1K8KB 3QIPA 2IGIA 4IG0A 3VENA 4AHSA 3OS2A 3DXMA 1TUUA 2PY5A 5HBMA 2IVPA 4CEOA 4Z4EA 4M7XA 4IWVA 5KQDA 4LH4A 2F8SA 4LF9K 3H6EA 2HNZA 4B9MA 5FRMA 2IVOA 3PUFA 1VAZA 1NK4A 2YHXA 3CMEN 3FZMA 1DT9A 4J2DA 4BRHA 3OYFA 3KLGA 3CHWA 3KK2A 4DR4K 4CEEA 1S6PA 1L3TA 2UUAK 1R0AA 3O9RA 4F8RA 4O55A 3VF6A 4CZEA 2YX6A 3ZYYX 2E2QA 2E5LK 4DR6K 1BCMA 3CJBA 2A42A 1P90A 3AVBA 4A57A 3FGUA 1D4XA 3LDPA 1FW6A 2H3GX 3G71N 2QEXN 2F9WA 3KIOA 2NRHA 3SQ4A 3TSQA 3ZEUA 3SNNA 4AM7A 1NM1A 4MO4A 1TL1A 3MEDA 1RBVA 3MXIA 1X9WA 1TYQB 1KCFA 4JKGB 4CGDA 4GVEA 3O1BA 1U04A 2ASPA 1VQNN 3L6QA 1IG8A 2DTUA 1ESVA 4E1JA 2FF6A 4EHTA 4KAZA 2IVNA 5CR4A 5AQOA 4BR5A 4GVMA 4FM0A 1RT7A 1WB9A 3O4QA 1BISA 2XO7A 3DLEA 3QEXA 4DU4A 4IKFA 4M42A 4E0DA 4DLEA 3C7NA 4RW4A 3L4QA 1YAGA 1XWLA 4IFEA 4KKOA 1NKCA 4IJNA 3AO5A 1BOTO 2HHTA 3TTCA 4OGCA 1SKSA 3CXCM 3AGKA 3AA3A 4E7JA 4BRPA 3SBGA 2HHXA 5SZTA 3CFRA 4F2SA 1YUWA 1GOCA 5I3UA 5IT9O 4CJLA 4WQ4A 2Y1IA 5GIPA 2NUBA 4Z4FA 1DTQA 5BRHA 3HSTB 1GOAA 5ELZA 3AARA 3ZLJA 2QWRA 5GAGP 5M1OA 4DV4K 3QNNA 3S9HA 1KVBA 3A5OC 4HTLA 1RT5A 4IFVA 1NK0A 1W0HA 4CK3A 2HNYA 2UU9K 3SK3A 3KK7A 1SL0A 4LC9B 4AHRA 1KVAA 3TAFA 3SQ1A 3KK3A 3VQ7A 3CCSN 1RDAA 1BA1A 1LV5A 2O8DB 3O3GA 1X3NA 2GEMA 3HO1A 3VGLA 3AVJA 3TAMA 2D0BA 4CHYA 1RBTA 1KFSA 2O8DA 4C8LA 4XEIA 4E89A 2O4GA 1XHXA 3VEYA 1HYVA 3M8RA 2V52B 3MXJA 1MWMA 2P1JA 3MCPA 5DM6L 4KB1A 2FC0A 3OYHA 4PHTX 2P9SB 1NGBA 4YOVA 2G8KA 1M90O 3DOKA 4ZTJA 4OPAA 2HHSA 2FSJA 1QQOA 2GWJA 1HX1A 2P9SA 2W42A 4CGGA 1HRHA 3H3OB 2P9UA 2VGMA 3NDKA 4FLYA 4AHTA 4BR7A 3PIOL 1N5YA 3NAEA 4H4MA 1QE1A 2HF3A 3ULDA 3P38A 4M3RA 4B9VA 1SZ2A 3KZBA 4EIAA 1WAJA 3G25A 3F73A 3LL3A 3WXMB 3D2EA 4KFBA 5AJ3K 4CZIA 2DFHA 2KLAA 1RT2A 5BN8A 4XIUA 4JRQA 3RWUA 1YI2N 1RDWX 2XRIA 4FZZA 2ITMA 3EZ5A 5AQZA 2CGLA 4LFCK 4CI6A 3UKUA 3DJCA 5BREA 1XMQK 3FFKB 1NNEA 4OKJA 4FVMA 4WCEL 3PIPL 2E6LA 3O9TA 3RMBA 4JV5K 3LM9A 1GLDG 2WOMA 3A2FA 3CFOA 1C1BA 1LWEA 1WLJA 4O8UA 3GOIA 4JLHA 4Q0BA 3T69A 4A61A 4K41A 3IAYA 3CCQN 4CF8A 1NJIO 1XNQK 1CXQA 3CJ1A 3CM6A 5DM7L 1D8YA 1JL1A 4A59A 3SI6A 4JI6K 2NRXA 3P83D 2JWLA 3CCEN 4X62K 3G4SN 3DRPA 3AO2A 1VSIA 3V81A 3RRGA 1BDGA 3NF6A 4BE0A 1QTMA 1CZBA 1O13A 2UUBK 2A1SA 2HBMA 3TAQA 1SQKA 1WSEA 1REVA 1ATNA 3H1VX 2P9PB 2VWJA 4N47A 5CE3A 3MAQA 3CJ7A 4FK0A 1IH7A 1S1TA 2RPIA 3QFUA 4H0PA 3DLKA 3RTVA 1CZ9A 5BRDA 1I39A 1QZ5A 4A5BA 2KHOA 1N6QA 2BE2A 1A5XA 4CHNA 3QETA 4HUEA 3K9JA 4R5PA 1U6ZA 4DFMA 2E6MA 2OCEA 3CJCA 2KFNA 2FXUA 3ZT4A 3QICA 2QI2A 1IBKK 5CYQA 4ISEA 3BZCA 3T19A 5LJVA 5HOOA 2IC3A 3H45C 3V9SA 2PAVA 3WXJA 4RTFD 3V1OA 3CMAN 4DFKA 1QVGM 4DF8A 3U6FA 3LP1A 1IKVA 2PYJA 3UIQA 3QFPA 5JVHL 1U4BA 2P9LA 4H5TA 3WNGA 2W40A 4B1YB 5AQIA 1NJZA 2HMIA 4PUOA 1CZAN 3M8QA 1DGKN 1C0UA 5J2PA 4BRLA 3AVCA 3U8XA 3L2RA 4DSFA 1NOYA 2F8TA 3KD5E 3VEVA 4CK2A 2OTJN 4F2RA 4WQ5A 1RDDA 2ATQA 4OVLA 3WNFA 3MN5A 1HNIA 3QEWA 2DPNA 4IEIA 3S41A 2AA4A 4CE9A 2CGJA 4E3SA 1IO2A 1RNHA 4FK2A 5HL7L 3QEVA 4NO7A 4DV7K 1RCHA 4DG1A 1VSDA 3BDPA 1HJOA 4JI1K 3IUCA 2KZMA 4CCHA 3N4QA 5M1FA 4ILGB 2ZJRL 1WBBA 3HTVA 4K8ZA 2BANA 1TVRA 3NFAA 3SPYA 1J54A 2HNDA 1BUPA 3K5OA 4BC4A 1BU6O 1BG3A 3LPTA 1K6YA 1T3VA 5GADP 4O0IA 1NKEA 4BVOA 1L5UA 4CIFA 4CERA 1M1KO 4B9TA 3THWB 1Z26A 1T7PA 3V6DA 4LFAK 4KH6A 2HW3A 4FJNA 1WAFA 4CZJA 4DSEA 2LSNA 3LPUA 3THWA 5KTQA 2GTDA 2BGGA 1RFQA 4H0VB 1NK8A 3PSIA 1XC3A 5HLFA 3L0QA 4CEBA 2G8UA 2I7PA 4BRCA 3IDHA 4TSXA 3HM9A 5HRNA 4RW7A 5KQ8A 3AAQA 2YKMA 1TKDA 4F3OA 1ZBHA 2OPQA 5C15A 5BPMA 5AQMA 4DSIA 1NK5A 1ILYA 4I9QA 3MXMA 1WSJA 3WQUA 4K43A 1NGGA 4JS5A 3EN9A 3DLGA 2E88A 1NU0A 3LDOA 1RDUA 4C1NI 2IDOA 3K5LA 3AO1A 3HI0A 4LD0A 3TABA 1WSIA 4DTUA 1HPMA 3T1AA 4I2PA 1Y97A 3E9PA 3L4IA 3D0PA 2D5RA 1W97L 4DQSA 3DM2A 2B4JA 1N32K 3D45A 3NGYA 5TKYA 4CFCA 4CHPA 3E9LA 3FZLA 3EE8A 3SJJA 2Z1GA 4OPJA 5K14A 3S3OA 1VQON 1KAZA 2Q2RA 2FSNA 3VEXA 3B6PA 1NGHA 4NXNK 4M3XA 4LH5A 3THXA 1JLCA 1VSKA 4E1MA 3QDKA 4FLTA 4HCCA 2NRWA 1IJJA 5GINA 4NYNA 3AO4A 4B1UB 3VOVA 4B3OA 2ZF5O 3H08A 3CC4N 1YJ9N 3I0RA 4A62A 1JLEA 3TSUA 3PLAA 4J2EA 2ZGZA 4IZ9A 3LZIA 3OBWA 2HB5A 1TKTA 2O4IA 4FJ5A 3MEEA 1SKWA 2BDPA 5AFUA 4BE2A 1DEJA 1W7AA 4MLEA 3K58A 1JLQA 3OYCA 2DFFA 4CGHA 4FXDA 3VQ5A 2BTFA 3PV8A 4KI6A 4KRFA 2PYLA 3DXKA 3DWLA 1S9EA 5AZJB 2YV0X 2NRZA 3P4IA 1KSPA 4FWLA 1EXQA 2JLEA 3CCJN 4DV3K 4BRGA 1NJWA 1KRPA 1V4TA 3DXKB 5EY4A 2QWPA 3VQ8A 5D3GA 3TTDA 2X74A 4ISFA 4NCGA 4DSLA 3AVKA 4YOUA 4DV0K 1S22A 4H5VA 3WUHA 3IMXA 4OX9K 2GUPA 2HHUA 4ICLA 1HPZA 1Z6RA 1SV5A 5AQVA 3SUPA 1KAYA 4DQ8A 3TI0A 4UQGA 4B3RK 3ISNC 3PSFA 4E7IA 4JEPA 3LDLA 4FJMA 4WE1A 3ITHA 2IS3A 1VQ6N 4LSNA 4BRAA 2QWLA 2YNHA 3G0ZA 4JI4K 4FJLA 1OH8A 4BDPA 1O1WA 4IBNA 3ZSXA 3VEWA 3VTIA 2W41A 3CQ8A 2Q31A 4PKHA 4CHQA 3QEPA 3ZX2A 1VQLN 1VK0A 3I0SA 3V1QA 4Z94A 2VCPA 2QW9A 4JKDA 4JK7A 3O08A 4FJKA 3ZT2A 3OA9A 4CEFA 4A2BA 4CF0A 5FDLA 1FKOA 3VQCA 4YFUA 4CK1A 5CZ1A 1QVFM 2KTQA 4DKWA 2WC9A 3OBYA 4C1NK 5C24A 3VTHA 4JD2B 4CEQA 4DU3A 3T7ZA 3RMCA 5B8HA 3K57A 4HCBA 4FPBA 1NBWA 1WOQA 3I8DA 4RCHA 5SWMA 4DR2K 3MX2A 3NCIA 3WNHA 1GLEG 4DCHA 1XC9A 4CEAA 4LF7K 4L3QA 5KPZA 3GDQA 1BGXT 3VEZA 4LF4K 3C0BA 5IWAK 5FLXO 4CEDA 4CJKA 4C8MA 2HBLA 3VQQA 1LWCA 3L3VA 4DR7K 1RILA 5ADXA 3ZSRA 3BGRA 1HQUA 4F3TA 3CYMA 4ILHA 4AH9A 4AM6A 5BPNA 2OZMA 4OO1J 3DLBA 5BR8K 1YVNA 1U2VA 4M3UA 3HBTA 4ID1A 4DS5A 4CF9A 2HF4A 3LM2A 4E7KA 1U48A 3NF8A 4B1ZA 5TKWA 4GNIA 2Z1HA 3MWPA 1F21A 3UKUB 4LFBK 3AY9A 4CZHA 1RBSA 4CF2A 1LAVA 5CYMA 3S3NA 2GBZA 4LF5K 4OJRA 1GLFO 4IO9L 4BY9C 3NE6A 2OPSA 5DMRA 3QBXA 4DLGA 3O4WA 1RTDA 4OKEA 1SL2A 4FW1A 1HJRA 1YJNN 4B9QA 4CZGA 1WUAA 3ZCMA 2QWMA 1TKZA 1T44A 2ZGYA 3R6MA 1KTQA 3KVGA 2O8EB 2FF3B 3O8MA 4C23A 4BDYA 2R7YA 2IIRA 5C10A 2PBDA 4YDUA 4IEEA 3FE1A 4QS8A 1ZBLA 3SAGA 3OYJA 2ASMA 1GLAG 3TU5A 2OPRA 3ZX0A 4C8KA 3V9XA 2RHKA 3NGZA 4FLWA 4CESA 3EO3A 3ZSOA 4DR3K 4FLUA 4CF1A 4BRNA 1GOBA 3L3UA 4B8CA 5EX5A 1Z05A 3LP0A 5M1PA 1SL1A 3KLEA 1YHQN 2G8WA 3V4IA 3WXKA 3EYZA 5LY3A 4OKKA 4NCBA 2RE2A 1RBUA 3ZEUB 1XNRK 3AAPA 5MLCQ 4B1VA 5KPTA 2QKBA 1ASVA 1I3AA 4JKGA 1C0FA 4FJ7A 2YI1A 3ENHA 3DRRA 3BP8A 3C6HA 1VRUA 2ZWHA 1VQ8N 3C7NB 3HSCA 3VF2A 2YJFA 4ELVA 3KD1E 5DK5A 2VYPA 3ZSZA 2W6KA 2XY7A 5C25A 3A0IX 1Q18A 2VG6A 4BWMA 4FLZA 4BC5A 3HVTA 4OPHA 4J8FA 4K0KK 3C6UA 5I42A 1MWKA 4O4GA 3FZKA 4H5NA 1N36K 4FJIA 3ALYA 2VWBA 1EKEA 3DI6A 3CCUN 3IFRA 1NMNA 4O5BA 1E4FT 5M1KA 4DHYA 1WSHA 4FWQA 1WNSA 2A40A 1BQNA 4PL8A 4CW7B 2QWQA 4FO0A 4B3TK 1BA0A 3HP6A 1BWFO 3KKRA 3V1RA 3CETA 2G8VA 1XMOK 1A5WA 3THYA 2G8FA 3ZETA 4H4OA 4Z0UA 1DLOA 2D0AA 3WXIA 1NGCA 1NGAA 3Q7BA 3DAWA 4CZKA 5AQLA 3RR8A 5BRFA 4QS7A 4KV8A 4Y0WA 4CIGA 3ZETB 1D9DA 3CIPA 4M63C 4FWOA 3AV9A 2HOEA 4BRDA 1C1AA 3HPHA 5HRPA 2ZD1A 3BZKA 3J81O 4MLHA 4CD3A 5F2RA 4NXMK 4WYBA 3RRHA 3VA3A 4DUYK 1OKJA 4FJGA 1SAZA 3TANA 4CJQA 2UXCK 1JLAA 3J7YP 4QCLA 3OYAA 3P31A 4NCAA 4PKGA 3PX0A 3LP3A 4KREA 1Q86O 1KD1O 3O3HA 5CHIA 4GV3A 4MDBA 2QXFA 3SJHA 2QA4N 1B92A 4B8AB 3O4NA 3SQ2A 3RMAA 5E41A 1TV6A 4DTMA 2GWKA 3EL2A 5F1XA 3V9UA 2E1YA 2X6SA 1YT3A 1EX4A 4JI7K 3LWMA 3ENBA 5C12A 4IOCL 4I7FA 1L3UA 2OPPA 4M3YA 5JVGL 3ATVA 2HHWA 3PX4A 3AA5X 4MQ3A 4CGFA 4I9LA 2XY6A 4HVJA 3QINA 2GUIA 3P1GA 4BGBA 2A5XA 3VETA 2YNFA 3QB0A 3BUZB 3HL8A 4FLXA 1I94K 4JI8K 3SQ0A 1BIUA 3F2KA 1TK5A 3HK2A 1NGDA 3QEIA 3TAEA 3RSEB 4FJHA 1OVYA 4DTSA 3JAMO 3C65A 1HLUA 1Q7YO 4EFHA 4CJRA 4FJ9A 3RSEA 2EX3A 3HYFA 2OZSA 1UA1A 3UB5A 4E19A 3QBWA 2FSKA 1R59O 2NLXA 3VQ4A 1DKGD 5GAEP 5F0XA 1EWQA 4EZ6A 1VSLA 5AZIA 4PWDA 1NLVA 4BR9A 1HUXA 4H0TB 1VQ9N 2QKKA 2F4VK 2E2NA 3O80A 3OW2M 4CHZA 4EP5A 1N34K 5AZIB 4A5AA 4CJTA 4B1WB 4YOXA 3IS9A 4Z4IA 3ATUA 1KC8O 4KBOA 4BRQA 1ATSA 4CBWA 1U49A 3GE1A 1T05A 4DV6K 3MK6A 3N4PA 5AQQA 3FZFA 3VESA 4PL7A 5JMVA 4DV1K 1RTHA 5KPRA 1JJ2M 5AQUA 3LZJA 5AZJA 4DR1K 4CGIA 1TGOA 1TL3A 1T6DA 1YTAA 3M1FA 3QNOA 4KB0A 3OYGA 4KHPK 1S6QA 3TTFA 3MN6A 3LDSA 2IOCA 2P5GA 3DLLL 3E66A 5KGXA 4KH5A 2NRTA 3IRXA 4X66K 2VG5A 1NK9A 4BE1A 4I2QA 3SAHA 3BEXA 4CBUA 1QHAA 2O8FB 1QSYA 1KXPA 5T7BA 2I5JA 4BR4A 5AQHA 4HUFA 3NMUA 1B9DA 1Q81O 1NK6A 3IKMA 4HUGA 2OANA 3SCXA 4E7LA 2Z1JA 4B9UA 1UAXA 3VQEA 4GW6A 3D2FA 2OYQA 1RT1A 1BI4B 2O8CA 4YOYA 2P9NA 4DTNA 3QESA 4LF6K 5AQKA 4F4KA 4H5WA 3OJSA 1YF5L 5C42A 4JHDB 4WFNL 4KPYA 1BI4A 1QQMA 3SZ2A 1EP4A 4FL9A 1FK9A 2E2PA 4I6MA 3U3GA 5CZ2A 4IJAA 1LW2A 4YHHK 1VSHA 3O9SA 3VEOA 4KHNA 4GMJB 5KI6A 4Z4CA 3O9QA 3HVRA 3OYBA 1NJYA 4KTQA 3O6WA 2YJEA 3E01A 4W5NA 1X9SA 5M1NA 1NK7A 3AVMA 3CI5A 5BPLA 2ITGA 1ZC6A 4CZMA 4DF4A 2NZTA 1VSEA 1BO5O 1MDUB 2OA8A 5FPMA 2CGKA 3KKSA 2ZQBA 4V19S 3HM8A 3HOSA 1WBDA 4B1XB 2A3ZA 4RG8A 1OH7A 2UXBK 2PFUA 1Y64A 4CJ7A 4X65K 2KW4A 4JKCA 2BH1A 2W6LA 2QM1A 4IDKA 4U7BA 1S1XA 2Z1IA 4Z4GA 4QS9A 3L8BA 1HYSA 4YORA 3NH2A 3LAMA 1NOZA 3EKUA 3KHYA 2QWOA 3OYEA 4AHVA 4JK8A 4N76A 1NG9A 1KLMA 4CJ4A 4M7YA 5J1EA 3DRSA 3JXUA 2CH6A 4BC2A 3WNEA 3H46O 2B6AA 2HHVA 3ZX3A 2F9TA 3HRGA 1RDBA 4ID5A 3JSMA 2E8AA 3CF5L 1J6ZA 3NBPA 3OS0A 2HHQA 3RR7A 4BVPA 3U9DA 1IKYA 3FLCO 3EE9A 3H3NO 3DXMB 3CCRN 4ELTA 2VGNA 4BG9A 3CCVN 4JRPA 3S3MA 1VQ7N 1D5AA 3LANA 1S3XA 2IAJA 5FPEA 4DQPA 1S1UA 1QSSA 4LY7A 3OYKA 1LOTB 3UKRA 2KFZA 2I7NA 3SUOA 4FPAA 3I8BA 1ASUA 3DOLA 4M3WA 2Q0RA 3A5LC 3VQDA 3CCLN 1N33K 1S1WA 3BY5A 4AHCA 3HZ6A 4FWNA 3ZSWA 4DQRA 3BF3A 4DWIA 3QIOA 4KI4A 3KTQA 4CFAA 1WSFA 1YITN 2ETJA 4H0YB 4RW6A 3AGRA 1X9JA 2Q1NA 5HP1A 4G9ZA 4K42A 4H03B 2CH5A 1FXXA 1BL3A 1C0MA 3TAPA 5AQNA 3ZSQA 4UY8O 4KHSA 1CLQA 4DU1A 1XHZA 1S72N 3M5RA 4CJ5A 4JKHA 4KH4A 4ZTFA 5AQJA 1QZ6A 1E4GT 3TR8A 1W9HA 1TYQA 2WUSA 2P5OA 4JI3K 2ZJPL 1S1VA 3J7ZO
chains in the Genus database with same CATH topology
3L2VA 4Z4HA 2E4LA 3MAQA 4J2BA 1SL1A 1JXBA 3HP9A 3PY8A 3KLEA 1C1CA 4FK0A 2G8WA 4FK4A 1T03A 3V4IA 3EYZA 4OKKA 1IH7A 2RKIA 1S1TA 2RPIA 4AILC 3JYTA 4NCBA 2HVHA 1RBUA 3ASMA 4M3ZA 3DLKA 1UWBA 3F9KA 1CZ9A 4BDZA 3RTVA 5KRSA 4FYDA 2DY4A 4L8RB 1BIZA 1I39A 2QKBA 1ASVA 4RW9A 1I3AA 1Q9YA 1N6QA 1C0TA 2RN2A 2BE2A 3ZT3A 1A5XA 4FJ7A 1FKPA 2Q3SA 4CHNA 3QETA 4HUEA 3DRRA 1VRUA 2FBYA 4KO0A 4R5PA 3VQ9A 3PO5A 4DFMA 2E6MA 1RTIA 1HNVA 4ELVA 2XY8A 5DK5A 3KD1E 3VN5A 2KFNA 3ZT4A 4FXDA 1KFDA 3ZSZA 4B08A 3QERA 2XY7A 5JS1A 2KQ2A 5CYQA 5C25A 1WSGA 2VG6A 1YTUA 2JGUA 4BWMA 1JKHA 3T19A 4W5RA 4FLZA 3TAGA 3V9ZA 5JS2A 4DTOA 2IC3A 3AVHA 3AVGA 3HVTA 5KRTA 3V9SA 1TK0A 4DQIA 4FCYA 3C6UA 4CJVA 2G8IA 1HYZA 3V1OA 4DFKA 4HHTA 5I42A 4DF8A 2XY5A 3U6FA 1D9FA 3LP1A 3HJFA 4O4GA 3CM5A 1IKVA 2PYJA 3UIQA 4FJIA 5EU7A 3ALYA 1U4BA 3SYZA 1EKEA 3DI6A 3WNGA 4CJFA 4CJSA 3HXMA 5HROA 1ASWA 3LWLA 1NJZA 4O5BA 2HMIA 1JLGA 4PUOA 2YHBA 3M8QA 4HTUA 4DSJA 1C0UA 1NKBA 5J2PA 5J2NA 1WSHA 4KHUA 4QOZB 4CEZA 1WNSA 3AVCA 3AVFA 1BQNA 3L2RA 3OYMA 1JXEA 4BACA 4DSFA 1NOYA 2F8TA 3KD5E 5KGWA 3AVAA 4KHQA 4CK2A 4CGJA 3HP6A 4F2RA 1L3VA 1RDDA 2ATQA 3KKRA 4OVLA 3V1RA 3WNFA 1HNIA 3NF9A 4CFBA 3QEWA 2G8VA 5J2MA 1A5WA 3DYAA 4AHUA 4B9LA 2G8FA 4DTJA 1RT4A 1DTTA 2D0CA 4H4OA 1DLOA 2D0AA 4Z0UA 4CE9A 4E3SA 1ITGA 1IO2A 1RNHA 1C6VA 5FROA 4N41A 4FK2A 4PQUA 3QEVA 1A5VA 3ZT1A 3KK1A 3RR8A 4CJUA 1RCHA 4KV8A 4DG1A 2AJQA 4CIGA 1VSDA 2RF2A 3K2PA 3THVA 3BDPA 2KZMA 4PY5A 4CCHA 3AO3A 3SPZA 1D9DA 4K8ZA 2BANA 2VG7A 1LAWA 3U3YA 1TVRA 3AV9A 3NFAA 1VRTA 3SPYA 1J54A 1C1AA 2HNDA 3HPHA 5HRPA 2ZD1A 1U45A 1Q9XA 3K5OA 3LPTA 1K6YA 3AVNA 2QK9A 1UA0A 1YVUA 4O0IA 1NKEA 4FZXC 4C8NA 4G1QA 4W5OA 3RRHA 4CIFA 3VA3A 4CERA 3VQPA 1L5UA 4B9TA 1S5JA 1Z26A 1T7PA 4FJGA 3V6DA 2HW3A 3AVIA 4KHWA 4DSKA 3TANA 4CJQA 3C6TA 4DS4A 4DTXA 4FJNA 1JLAA 4W5QA 1WAFA 3OYDA 3KJVA 2LSNA 4O44A 3NHGA 4DSEA 2Y1JA 3OYAA 4K8XA 1TK8A 4QCLA 3LPUA 1Z25A 5KTQA 2BGGA 4NCAA 4DQQA 4M41A 3PX0A 3LP3A 1U47A 5HRRA 3KLHA 4OPKA 4KREA 3VQBA 3O3HA 3LAKA 3L2WA 1NK8A 4E1NA 3EY1A 5HLFA 1SKRA 4CEBA 4FJXA 2QXFA 2G8UA 4OLAA 2G8HA 1QHTA 4TSXA 3HM9A 5HRNA 1B92A 4RW7A 2X78A 3O4NA 4B8AB 3SQ2A 3RMAA 5E41A 3SUNA 2YKMA 1TKDA 1TV6A 4DTMA 1BCOA 4MFBA 4F3OA 3DLHA 1ZBHA 2OPQA 3V9UA 2X6SA 4DSIA 1NK5A 1YT3A 1EX4A 4I9QA 3MXMA 1XI1A 1WSJA 3LWMA 1RT6A 1T8EA 2GV9A 4JS5A 3DLGA 4I7FA 1L3UA 4CIEA 2OPPA 2XHBA 2PZSA 4M3YA 2X6NA 2P51A 2KZZA 1J9AA 1KVCA 2IDOA 3PX4A 3AA5X 3K5LA 2HHWA 3TWHA 3AO1A 4CHOA 1LWFA 4MQ3A 1G15A 1BHLA 4LD0A 1B9FA 4CGFA 3K5MA 1WSIA 4FM1A 4DTUA 1X1PA 3TABA 1IG9A 4I9LA 2XY6A 3T1AA 3QINA 4I2PA 2GUIA 4HVJA 1Y97A 3P1GA 4CJPA 1TKXA 3V9WA 1RDCA 3TARA 1J5OA 3D0PA 1TAUA 2D5RA 2YHAA 2YNFA 3HPOA 4DQSA 3HL8A 4FLXA 3DM2A 2B4JA 1ZYQA 1QSLA 3SQ0A 1BIUA 3D45A 3NGYA 1TK5A 3HK2A 3QIPA 2F96A 2IGIA 4IG0A 3VQAA 4AHSA 4CFCA 3QEIA 1ZBUA 3RMDA 3TAEA 4CHPA 4FJHA 4DTSA 3OS2A 4N5SA 3SJJA 2Z1GA 1RBRA 5HBMA 4OPJA 2PY5A 4CEOA 3VQ6A 5K14A 3S3OA 4Z4EA 4CJRA 4LH4A 4FJ9A 2F8SA 3L2UA 2HNZA 3ZSYA 3O3FA 3B6PA 2EX3A 4JS4A 4B9MA 5FRMA 3PUFA 3HYFA 5J2QA 4LH5A 5CY4A 2OZSA 1UA1A 4M3XA 1JLCA 1VSKA 4CJ3A 4E1MA 4E19A 1NK4A 4IFYA 3VQ4A 4FLTA 4YNQA 3OYFA 3KLGA 4HCCA 4J2DA 3OS1A 2FBVA 3FFIA 4EZ6A 4Q5VA 1VSLA 4PWDA 3OJUA 3KK2A 4NYNA 3CFPA 1SUQA 3AO4A 4CEEA 1S6PA 2QKKA 4B3OA 3AVLA 3H08A 1L3TA 3AA4A 3C94A 4CHZA 1R0AA 3I0RA 4EP5A 4F8RA 4O55A 1JLEA 3QO9A 1IKWA 4CJTA 4J2EA 4DMNA 4EP4A 1BCMA 3IS9A 3AVBA 3LZIA 4Z4IA 3HT3A 2HB5A 1JLFA 1TKTA 2O4IA 4FJ5A 3MEEA 1SKWA 2BDPA 1U49A 1T05A 3M8PA 4BE2A 3KIOA 3SQ4A 1RTHA 4FJJA 1HMVA 3SNNA 4CECA 1TL1A 3MEDA 1RBVA 3LZJA 3K58A 3MXIA 1X9WA 1L3SA 1KCFA 4CGDA 4CGIA 4KTWA 1JLQA 1TGOA 3OYCA 1TL3A 1YTAA 1U04A 2DFFA 3VQ5A 4CGHA 3VA0A 3OYGA 3QNOA 3PV8A 4KB0A 4KI6A 1S6QA 4CJWA 4DTPA 4KRFA 2PYLA 2DTUA 3LDSA 2IOCA 2P5GA 1S9EA 2YV0X 3K59A 5KGXA 1KSPA 3IRXA 2VG5A 1NK9A 4KAZA 4BE1A 4I2QA 1EXQA 2JLEA 1ZBFA 4GVMA 4FM0A 1RT7A 1KRPA 1NJWA 3O4QA 1BISA 1QSYA 1QS4A 1RT3A 1KLNA 2XO7A 3DLEA 3QEXA 5T7BA 4DU4A 3VQ8A 3K5NA 5D3GA 2WONA 2I5JA 4IKFA 4M42A 4M45A 3NH1A 2X74A 4E0DA 4NCGA 4DSLA 3AVKA 4HUFA 1B9DA 4DLEA 4RW4A 1BQMA 1NK6A 4FW2A 4HUGA 1XWLA 3SCXA 4E7LA 1VSFA 2Z1JA 4B9UA 2HHUA 1UAXA 4KKOA 4ICLA 4BWJA 1IKXA 1NKCA 1HPZA 3AO5A 3VQEA 4GW6A 3NGIA 2HHTA 1SV5A 3SUPA 4OGCA 1RT1A 2OYQA 3ZSVA 1BI4B 4UQGA 3TI0A 3ISNC 1SKSA 4OLBA 3AA2A 3AA3A 3M8SA 4DTNA 4E7JA 3OYNA 5HRSA 3QESA 4E7IA 1JL2A 3SUQA 4FJMA 4M3TA 4F4KA 2HHXA 3OJSA 4WE1A 3ITHA 2IS3A 5C42A 5SZTA 4KPYA 3DMJA 4KTZA 1LW0A 1BI4A 3CFRA 4F2SA 4LSNA 3SZ2A 1GOCA 1EP4A 5I3UA 3IG1A 1FK9A 3U3GA 2YNHA 5CZ2A 3G0ZA 4CJLA 3SV4A 2Y1IA 4FJLA 2NUBA 2YNGA 4Y1DA 4BDPA 1O1WA 1DTQA 4Z4FA 4IBNA 3ZSXA 3CQ8A 3KLFA 3QEPA 4CHQA 1LW2A 3HSTB 1GOAA 4B9SA 4NYFA 1VK0A 3I0SA 3V1QA 1VSHA 3QNNA 3S9HA 1EETA 4KHNA 4GMJB 1KVBA 5KI6A 4FJKA 1RT5A 3ZT2A 4IFVA 1NK0A 1W0HA 4CEFA 4CF0A 2HNYA 1VSJA 5FDLA 4Z4CA 4CK3A 1SL0A 1FKOA 3VQCA 3HVRA 4YFUA 3OYBA 4AHRA 1NJYA 1JLBA 1KVAA 4CK1A 5CZ1A 3TAFA 4C8OA 3QLHA 3KK3A 3SQ1A 3E01A 4KTQA 3VQ7A 2KTQA 1X9SA 1NK7A 4W5NA 3AVMA 1LV5A 1RDAA 5C24A 3LALA 4CEQA 3O3GA 4B9NA 4DU3A 2ITGA 4E7HA 2VWKA 3RMCA 3NF7A 3HO1A 3K57A 2FBXA 4HCBA 3AVJA 4DF4A 3TAMA 2D0BA 4CHYA 1RBTA 1VSEA 1S9GA 3I8DA 4PA1A 1KFSA 5SWMA 2OA8A 4C8LA 4CJEA 3NCIA 3WNHA 3KKSA 4E89A 2ZQBA 1HQEA 1XC9A 2FBTA 2O4GA 4CEAA 1XHXA 1BGXT 4RG8A 1NJXA 1HYVA 4CJKA 4CEDA 3M8RA 3OVNA 1MU2A 4C8MA 2KW4A 3DLRA 3MXJA 4W5TA 3VQQA 1LWCA 1J53A 2P1JA 4KB1A 2EHGA 2FC0A 3L3VA 3OYHA 2KFZA 2HVIA 1RILA 4RW8A 3ZSRA 4IDKA 2G8KA 3BGRA 1HQUA 1WN7A 3DOKA 1S1XA 2Z1IA 4O0JA 4ZTJA 4F3TA 4Z4GA 4EZ9A 3CYMA 3L8BA 1HYSA 2HHSA 4KHYA 3NH2A 4AH9A 3LAMA 2W42A 3NH0A 4CGGA 1HRHA 1NOZA 4CFDA 2OZMA 5FRNA 3NDKA 3OYEA 2DFEA 4AHVA 4FLYA 1RTJA 4AHTA 3DLBA 1N5YA 4N76A 3NAEA 4H4MA 1QE1A 4QAGA 4M3UA 3G10A 1KLMA 4ID1A 4CJ4A 4DS5A 3ULDA 4M3RA 5J1EA 3DRSA 3PO4A 4B9VA 1WAJA 3F73A 3WNEA 4CF9A 4Y1CA 3CG7A 2B6AA 3OYIA 4E7KA 1U48A 4KFBA 3MEGA 3NF8A 2HHVA 2DFHA 1RT2A 1RDBA 2Z1HA 1QQCA 4XIUA 4JRQA 4ID5A 3JSMA 3RWUA 1F21A 3NBPA 3OS0A 2HHQA 2XRIA 3B6OA 3RR7A 4FZYA 1RBSA 4FZZA 3EZ5A 3C95A 4CF2A 1IKYA 1LAVA 5CYMA 3S3NA 4IG3A 2GBZA 1VSMA 4OJRA 4ELTA 3NE6A 3L2QA 4OKJA 1UOCA 4FVMA 4JRPA 2OPSA 5DMRA 3S3MA 1D5AA 3LANA 2E6LA 3T3FA 1ZBIA 2IAJA 4DLGA 4OGEA 3RMBA 1S1UA 4DQPA 1RTDA 4OKEA 1TAQA 4FLVA 4LY7A 3OYKA 1SL2A 1QSSA 2WOMA 3A2FA 3CFOA 1C1BA 1LWEA 1WLJA 1CXUA 1HJRA 3HPGA 4FW1A 4JLHA 3SUOA 4Q0BA 1ASUA 3DOLA 1Q8IA 3IAYA 4M3WA 3LP2A 3OY9A 4J2AA 3VQDA 3ZCMA 4CF8A 1S1WA 1TKZA 4AHCA 4DTRA 3ZSWA 4DQRA 4N56A 3QIOA 3ZT0A 4DWIA 4KI4A 1CXQA 3CM6A 4H8KA 3KTQA 4CFAA 4FJ8A 1KTQA 2ZE2A 1D8YA 3OYLA 1JL1A 1WSFA 2ETJA 3SI6A 4RW6A 1X9MA 5HP1A 2YKNA 4BDYA 3P83D 4LSLA 2R7YA 3PX6A 3MECA 3DRPA 1FXXA 4DFPA 3AO2A 1BL3A 1C0MA 1VSIA 3V81A 3RRGA 3TAPA 3ZSQA 2B5JA 4ELUA 3NF6A 4BE0A 1ZBLA 4DFJA 3OYJA 4C8KA 4KHSA 3KLIA 2OPRA 1CLQA 3V9XA 4DU1A 1XHZA 4CJ5A 3SV3A 1QTMA 4FM2A 1CZBA 3NGZA 4ZTFA 4FLWA 4CESA 3ZSOA 2A1SA 2YNIA 3TAQA 4FLUA 1WSEA 3TR8A 1REVA 1W9HA 4CF1A 2A1RA 1GOBA 2P5OA 3L3UA 4B8CA 2VWJA 4ZHRA 1S1VA 3P5JA 3LP0A 4N47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2V A;  4Z4H A;  2E4L A;  3MAQ A;  4J2B A;  1SL1 A;  1JXB A;  3HP9 A;  3PY8 A;  3KLE A;  1C1C A;  4FK0 A;  2G8W A;  4FK4 A;  1T03 A;  3V4I A;  3EYZ A;  4OKK A;  1IH7 A;  2RKI A;  1S1T A;  2RPI A;  4AIL C;  3JYT A;  4NCB A;  2HVH A;  1RBU A;  3ASM A;  4M3Z A;  3DLK A;  1UWB A;  3F9K A;  1CZ9 A;  4BDZ A;  3RTV A;  5KRS A;  4FYD A;  2DY4 A;  4L8R B;  1BIZ A;  1I39 A;  2QKB A;  1ASV A;  4RW9 A;  1I3A A;  1Q9Y A;  1N6Q A;  1C0T A;  2RN2 A;  2BE2 A;  3ZT3 A;  1A5X A;  4FJ7 A;  1FKP A;  2Q3S A;  4CHN A;  3QET A;  4HUE A;  3DRR A;  1VRU A;  2FBY A;  4KO0 A;  4R5P A;  3VQ9 A;  3PO5 A;  4DFM A;  2E6M A;  1RTI A;  1HNV A;  4ELV A;  2XY8 A;  5DK5 A;  3KD1 E;  3VN5 A;  2KFN A;  3ZT4 A;  4FXD A;  1KFD A;  3ZSZ A;  4B08 A;  3QER A;  2XY7 A;  5JS1 A;  2KQ2 A;  5CYQ A;  5C25 A;  1WSG A;  2VG6 A;  1YTU A;  2JGU A;  4BWM A;  1JKH A;  3T19 A;  4W5R A;  4FLZ A;  3TAG A;  3V9Z A;  5JS2 A;  4DTO A;  2IC3 A;  3AVH A;  3AVG A;  3HVT A;  5KRT A;  3V9S A;  1TK0 A;  4DQI A;  4FCY A;  3C6U A;  4CJV A;  2G8I A;  1HYZ A;  3V1O A;  4DFK A;  4HHT A;  5I42 A;  4DF8 A;  2XY5 A;  3U6F A;  1D9F A;  3LP1 A;  3HJF A;  4O4G A;  3CM5 A;  1IKV A;  2PYJ A;  3UIQ A;  4FJI A;  5EU7 A;  3ALY A;  1U4B A;  3SYZ A;  1EKE A;  3DI6 A;  3WNG A;  4CJF A;  4CJS A;  3HXM A;  5HRO A;  1ASW A;  3LWL A;  1NJZ A;  4O5B A;  2HMI A;  1JLG A;  4PUO A;  2YHB A;  3M8Q A;  4HTU A;  4DSJ A;  1C0U A;  1NKB A;  5J2P A;  5J2N A;  1WSH A;  4KHU A;  4QOZ B;  4CEZ A;  1WNS A;  3AVC A;  3AVF A;  1BQN A;  3L2R A;  3OYM A;  1JXE A;  4BAC A;  4DSF A;  1NOY A;  2F8T A;  3KD5 E;  5KGW A;  3AVA A;  4KHQ A;  4CK2 A;  4CGJ A;  3HP6 A;  4F2R A;  1L3V A;  1RDD A;  2ATQ A;  3KKR A;  4OVL A;  3V1R A;  3WNF A;  1HNI A;  3NF9 A;  4CFB A;  3QEW A;  2G8V A;  5J2M A;  1A5W A;  3DYA A;  4AHU A;  4B9L A;  2G8F A;  4DTJ A;  1RT4 A;  1DTT A;  2D0C A;  4H4O A;  1DLO A;  2D0A A;  4Z0U A;  4CE9 A;  4E3S A;  1ITG A;  1IO2 A;  1RNH A;  1C6V A;  5FRO A;  4N41 A;  4FK2 A;  4PQU A;  3QEV A;  1A5V A;  3ZT1 A;  3KK1 A;  3RR8 A;  4CJU A;  1RCH A;  4KV8 A;  4DG1 A;  2AJQ A;  4CIG A;  1VSD A;  2RF2 A;  3K2P A;  3THV A;  3BDP A;  2KZM A;  4PY5 A;  4CCH A;  3AO3 A;  3SPZ A;  1D9D A;  4K8Z A;  2BAN A;  2VG7 A;  1LAW A;  3U3Y A;  1TVR A;  3AV9 A;  3NFA A;  1VRT A;  3SPY A;  1J54 A;  1C1A A;  2HND A;  3HPH A;  5HRP A;  2ZD1 A;  1U45 A;  1Q9X A;  3K5O A;  3LPT A;  1K6Y A;  3AVN A;  2QK9 A;  1UA0 A;  1YVU A;  4O0I A;  1NKE A;  4FZX C;  4C8N A;  4G1Q A;  4W5O A;  3RRH A;  4CIF A;  3VA3 A;  4CER A;  3VQP A;  1L5U A;  4B9T A;  1S5J A;  1Z26 A;  1T7P A;  4FJG A;  3V6D A;  2HW3 A;  3AVI A;  4KHW A;  4DSK A;  3TAN A;  4CJQ A;  3C6T A;  4DS4 A;  4DTX A;  4FJN A;  1JLA A;  4W5Q A;  1WAF A;  3OYD A;  3KJV A;  2LSN A;  4O44 A;  3NHG A;  4DSE A;  2Y1J A;  3OYA A;  4K8X A;  1TK8 A;  4QCL A;  3LPU A;  1Z25 A;  5KTQ A;  2BGG A;  4NCA A;  4DQQ A;  4M41 A;  3PX0 A;  3LP3 A;  1U47 A;  5HRR A;  3KLH A;  4OPK A;  4KRE A;  3VQB A;  3O3H A;  3LAK A;  3L2W A;  1NK8 A;  4E1N A;  3EY1 A;  5HLF A;  1SKR A;  4CEB A;  4FJX A;  2QXF A;  2G8U A;  4OLA A;  2G8H A;  1QHT A;  4TSX A;  3HM9 A;  5HRN A;  1B92 A;  4RW7 A;  2X78 A;  3O4N A;  4B8A B;  3SQ2 A;  3RMA A;  5E41 A;  3SUN A;  2YKM A;  1TKD A;  1TV6 A;  4DTM A;  1BCO A;  4MFB A;  4F3O A;  3DLH A;  1ZBH A;  2OPQ A;  3V9U A;  2X6S A;  4DSI A;  1NK5 A;  1YT3 A;  1EX4 A;  4I9Q A;  3MXM A;  1XI1 A;  1WSJ A;  3LWM A;  1RT6 A;  1T8E A;  2GV9 A;  4JS5 A;  3DLG A;  4I7F A;  1L3U A;  4CIE A;  2OPP A;  2XHB A;  2PZS A;  4M3Y A;  2X6N A;  2P51 A;  2KZZ A;  1J9A A;  1KVC A;  2IDO A;  3PX4 A;  3AA5 X;  3K5L A;  2HHW A;  3TWH A;  3AO1 A;  4CHO A;  1LWF A;  4MQ3 A;  1G15 A;  1BHL A;  4LD0 A;  1B9F A;  4CGF A;  3K5M A;  1WSI A;  4FM1 A;  4DTU A;  1X1P A;  3TAB A;  1IG9 A;  4I9L A;  2XY6 A;  3T1A A;  3QIN A;  4I2P A;  2GUI A;  4HVJ A;  1Y97 A;  3P1G A;  4CJP A;  1TKX A;  3V9W A;  1RDC A;  3TAR A;  1J5O A;  3D0P A;  1TAU A;  2D5R A;  2YHA A;  2YNF A;  3HPO A;  4DQS A;  3HL8 A;  4FLX A;  3DM2 A;  2B4J A;  1ZYQ A;  1QSL A;  3SQ0 A;  1BIU A;  3D45 A;  3NGY A;  1TK5 A;  3HK2 A;  3QIP A;  2F96 A;  2IGI A;  4IG0 A;  3VQA A;  4AHS A;  4CFC A;  3QEI A;  1ZBU A;  3RMD A;  3TAE A;  4CHP A;  4FJH A;  4DTS A;  3OS2 A;  4N5S A;  3SJJ A;  2Z1G A;  1RBR A;  5HBM A;  4OPJ A;  2PY5 A;  4CEO A;  3VQ6 A;  5K14 A;  3S3O A;  4Z4E A;  4CJR A;  4LH4 A;  4FJ9 A;  2F8S A;  3L2U A;  2HNZ A;  3ZSY A;  3O3F A;  3B6P A;  2EX3 A;  4JS4 A;  4B9M A;  5FRM A;  3PUF A;  3HYF A;  5J2Q A;  4LH5 A;  5CY4 A;  2OZS A;  1UA1 A;  4M3X A;  1JLC A;  1VSK A;  4CJ3 A;  4E1M A;  4E19 A;  1NK4 A;  4IFY A;  3VQ4 A;  4FLT A;  4YNQ A;  3OYF A;  3KLG A;  4HCC A;  4J2D A;  3OS1 A;  2FBV A;  3FFI A;  4EZ6 A;  4Q5V A;  1VSL A;  4PWD A;  3OJU A;  3KK2 A;  4NYN A;  3CFP A;  1SUQ A;  3AO4 A;  4CEE A;  1S6P A;  2QKK A;  4B3O A;  3AVL A;  3H08 A;  1L3T A;  3AA4 A;  3C94 A;  4CHZ A;  1R0A A;  3I0R A;  4EP5 A;  4F8R A;  4O55 A;  1JLE A;  3QO9 A;  1IKW A;  4CJT A;  4J2E A;  4DMN A;  4EP4 A;  1BCM A;  3IS9 A;  3AVB A;  3LZI A;  4Z4I A;  3HT3 A;  2HB5 A;  1JLF A;  1TKT A;  2O4I A;  4FJ5 A;  3MEE A;  1SKW A;  2BDP A;  1U49 A;  1T05 A;  3M8P A;  4BE2 A;  3KIO A;  3SQ4 A;  1RTH A;  4FJJ A;  1HMV A;  3SNN A;  4CEC A;  1TL1 A;  3MED A;  1RBV A;  3LZJ A;  3K58 A;  3MXI A;  1X9W A;  1L3S A;  1KCF A;  4CGD A;  4CGI A;  4KTW A;  1JLQ A;  1TGO A;  3OYC A;  1TL3 A;  1YTA A;  1U04 A;  2DFF A;  3VQ5 A;  4CGH A;  3VA0 A;  3OYG A;  3QNO A;  3PV8 A;  4KB0 A;  4KI6 A;  1S6Q A;  4CJW A;  4DTP A;  4KRF A;  2PYL A;  2DTU A;  3LDS A;  2IOC A;  2P5G A;  1S9E A;  2YV0 X;  3K59 A;  5KGX A;  1KSP A;  3IRX A;  2VG5 A;  1NK9 A;  4KAZ A;  4BE1 A;  4I2Q A;  1EXQ A;  2JLE A;  1ZBF A;  4GVM A;  4FM0 A;  1RT7 A;  1KRP A;  1NJW A;  3O4Q A;  1BIS A;  1QSY A;  1QS4 A;  1RT3 A;  1KLN A;  2XO7 A;  3DLE A;  3QEX A;  5T7B A;  4DU4 A;  3VQ8 A;  3K5N A;  5D3G A;  2WON A;  2I5J A;  4IKF A;  4M42 A;  4M45 A;  3NH1 A;  2X74 A;  4E0D A;  4NCG A;  4DSL A;  3AVK A;  4HUF A;  1B9D A;  4DLE A;  4RW4 A;  1BQM A;  1NK6 A;  4FW2 A;  4HUG A;  1XWL A;  3SCX A;  4E7L A;  1VSF A;  2Z1J A;  4B9U A;  2HHU A;  1UAX A;  4KKO A;  4ICL A;  4BWJ A;  1IKX A;  1NKC A;  1HPZ A;  3AO5 A;  3VQE A;  4GW6 A;  3NGI A;  2HHT A;  1SV5 A;  3SUP A;  4OGC A;  1RT1 A;  2OYQ A;  3ZSV A;  1BI4 B;  4UQG A;  3TI0 A;  3ISN C;  1SKS A;  4OLB A;  3AA2 A;  3AA3 A;  3M8S A;  4DTN A;  4E7J A;  3OYN A;  5HRS A;  3QES A;  4E7I A;  1JL2 A;  3SUQ A;  4FJM A;  4M3T A;  4F4K A;  2HHX A;  3OJS A;  4WE1 A;  3ITH A;  2IS3 A;  5C42 A;  5SZT A;  4KPY A;  3DMJ A;  4KTZ A;  1LW0 A;  1BI4 A;  3CFR A;  4F2S A;  4LSN A;  3SZ2 A;  1GOC A;  1EP4 A;  5I3U A;  3IG1 A;  1FK9 A;  3U3G A;  2YNH A;  5CZ2 A;  3G0Z A;  4CJL A;  3SV4 A;  2Y1I A;  4FJL A;  2NUB A;  2YNG A;  4Y1D A;  4BDP A;  1O1W A;  1DTQ A;  4Z4F A;  4IBN A;  3ZSX A;  3CQ8 A;  3KLF A;  3QEP A;  4CHQ A;  1LW2 A;  3HST B;  1GOA A;  4B9S A;  4NYF A;  1VK0 A;  3I0S A;  3V1Q A;  1VSH A;  3QNN A;  3S9H A;  1EET A;  4KHN A;  4GMJ B;  1KVB A;  5KI6 A;  4FJK A;  1RT5 A;  3ZT2 A;  4IFV A;  1NK0 A;  1W0H A;  4CEF A;  4CF0 A;  2HNY A;  1VSJ A;  5FDL A;  4Z4C A;  4CK3 A;  1SL0 A;  1FKO A;  3VQC A;  3HVR A;  4YFU A;  3OYB A;  4AHR A;  1NJY A;  1JLB A;  1KVA A;  4CK1 A;  5CZ1 A;  3TAF A;  4C8O A;  3QLH A;  3KK3 A;  3SQ1 A;  3E01 A;  4KTQ A;  3VQ7 A;  2KTQ A;  1X9S A;  1NK7 A;  4W5N A;  3AVM A;  1LV5 A;  1RDA A;  5C24 A;  3LAL A;  4CEQ A;  3O3G A;  4B9N A;  4DU3 A;  2ITG A;  4E7H A;  2VWK A;  3RMC A;  3NF7 A;  3HO1 A;  3K57 A;  2FBX A;  4HCB A;  3AVJ A;  4DF4 A;  3TAM A;  2D0B A;  4CHY A;  1RBT A;  1VSE A;  1S9G A;  3I8D A;  4PA1 A;  1KFS A;  5SWM A;  2OA8 A;  4C8L A;  4CJE A;  3NCI A;  3WNH A;  3KKS A;  4E89 A;  2ZQB A;  1HQE A;  1XC9 A;  2FBT A;  2O4G A;  4CEA A;  1XHX A;  1BGX T;  4RG8 A;  1NJX A;  1HYV A;  4CJK A;  4CED A;  3M8R A;  3OVN A;  1MU2 A;  4C8M A;  2KW4 A;  3DLR A;  3MXJ A;  4W5T A;  3VQQ A;  1LWC A;  1J53 A;  2P1J A;  4KB1 A;  2EHG A;  2FC0 A;  3L3V A;  3OYH A;  2KFZ A;  2HVI A;  1RIL A;  4RW8 A;  3ZSR A;  4IDK A;  2G8K A;  3BGR A;  1HQU A;  1WN7 A;  3DOK A;  1S1X A;  2Z1I A;  4O0J A;  4ZTJ A;  4F3T A;  4Z4G A;  4EZ9 A;  3CYM A;  3L8B A;  1HYS A;  2HHS A;  4KHY A;  3NH2 A;  4AH9 A;  3LAM A;  2W42 A;  3NH0 A;  4CGG A;  1HRH A;  1NOZ A;  4CFD A;  2OZM A;  5FRN A;  3NDK A;  3OYE A;  2DFE A;  4AHV A;  4FLY A;  1RTJ A;  4AHT A;  3DLB A;  1N5Y A;  4N76 A;  3NAE A;  4H4M A;  1QE1 A;  4QAG A;  4M3U A;  3G10 A;  1KLM A;  4ID1 A;  4CJ4 A;  4DS5 A;  3ULD A;  4M3R A;  5J1E A;  3DRS A;  3PO4 A;  4B9V A;  1WAJ A;  3F73 A;  3WNE A;  4CF9 A;  4Y1C A;  3CG7 A;  2B6A A;  3OYI A;  4E7K A;  1U48 A;  4KFB A;  3MEG A;  3NF8 A;  2HHV A;  2DFH A;  1RT2 A;  1RDB A;  2Z1H A;  1QQC A;  4XIU A;  4JRQ A;  4ID5 A;  3JSM A;  3RWU A;  1F21 A;  3NBP A;  3OS0 A;  2HHQ A;  2XRI A;  3B6O A;  3RR7 A;  4FZY A;  1RBS A;  4FZZ A;  3EZ5 A;  3C95 A;  4CF2 A;  1IKY A;  1LAV A;  5CYM A;  3S3N A;  4IG3 A;  2GBZ A;  1VSM A;  4OJR A;  4ELT A;  3NE6 A;  3L2Q A;  4OKJ A;  1UOC A;  4FVM A;  4JRP A;  2OPS A;  5DMR A;  3S3M A;  1D5A A;  3LAN A;  2E6L A;  3T3F A;  1ZBI A;  2IAJ A;  4DLG A;  4OGE A;  3RMB A;  1S1U A;  4DQP A;  1RTD A;  4OKE A;  1TAQ A;  4FLV A;  4LY7 A;  3OYK A;  1SL2 A;  1QSS A;  2WOM A;  3A2F A;  3CFO A;  1C1B A;  1LWE A;  1WLJ A;  1CXU A;  1HJR A;  3HPG A;  4FW1 A;  4JLH A;  3SUO A;  4Q0B A;  1ASU A;  3DOL A;  1Q8I A;  3IAY A;  4M3W A;  3LP2 A;  3OY9 A;  4J2A A;  3VQD A;  3ZCM A;  4CF8 A;  1S1W A;  1TKZ A;  4AHC A;  4DTR A;  3ZSW A;  4DQR A;  4N56 A;  3QIO A;  3ZT0 A;  4DWI A;  4KI4 A;  1CXQ A;  3CM6 A;  4H8K A;  3KTQ A;  4CFA A;  4FJ8 A;  1KTQ A;  2ZE2 A;  1D8Y A;  3OYL A;  1JL1 A;  1WSF A;  2ETJ A;  3SI6 A;  4RW6 A;  1X9M A;  5HP1 A;  2YKN A;  4BDY A;  3P83 D;  4LSL A;  2R7Y A;  3PX6 A;  3MEC A;  3DRP A;  1FXX A;  4DFP A;  3AO2 A;  1BL3 A;  1C0M A;  1VSI A;  3V81 A;  3RRG A;  3TAP A;  3ZSQ A;  2B5J A;  4ELU A;  3NF6 A;  4BE0 A;  1ZBL A;  4DFJ A;  3OYJ A;  4C8K A;  4KHS A;  3KLI A;  2OPR A;  1CLQ A;  3V9X A;  4DU1 A;  1XHZ A;  4CJ5 A;  3SV3 A;  1QTM A;  4FM2 A;  1CZB A;  3NGZ A;  4ZTF A;  4FLW A;  4CES A;  3ZSO A;  2A1S A;  2YNI A;  3TAQ A;  4FLU A;  1WSE A;  3TR8 A;  1REV A;  1W9H A;  4CF1 A;  2A1R A;  1GOB A;  2P5O A;  3L3U A;  4B8C A;  2VWJ A;  4ZHR A;  1S1V A;  3P5J A;  3LP0 A;  4N47 A; 
#chains in the Genus database with same CATH topology
 3L2V A;  3JS6 A;  1VHX A;  1JXB A;  3HP9 A;  4BC3 A;  3PY8 A;  4J2B A;  1YJW N;  1T03 A;  3NVK A;  2OTL N;  4JN4 A;  3F9M A;  2O8B A;  4M3Z A;  1UWB A;  3VF4 A;  1ZXO A;  1BIZ A;  4ILJ A;  3EEQ A;  4RW9 A;  1Q9Y A;  1C0T A;  2RN2 A;  3ZT3 A;  1FKP A;  1T6C A;  3QML A;  3GG4 A;  3I56 N;  4KO0 A;  3VQ9 A;  3PO5 A;  3MDQ A;  1RTI A;  2HHH K;  4JI2 K;  1NGF A;  3QER A;  5JS1 A;  4B08 A;  2KQ2 A;  1YTU A;  2JGU A;  3A5N C;  1JKH A;  3R8E A;  3TAG A;  4DTO A;  5KRT A;  3AVH A;  1TK0 A;  3O9U A;  4FCY A;  4DQI A;  4BQZ A;  1VQM N;  4WQ4 C;  3HJF A;  2E1Z A;  4EAH D;  5EU7 A;  3ULE B;  3SYZ A;  3WT0 A;  4GY2 B;  4IOX A;  4CJS A;  4MO5 A;  3HXM A;  4GV6 A;  3LWL A;  3J7A P;  1JLG A;  3T1Y K;  4HTU A;  4DSJ A;  3K9K A;  3ULE A;  4B3M K;  4QOZ B;  4ISG A;  4CEZ A;  5E26 A;  3OYM A;  1JXE A;  4BAC A;  5KGW A;  4AQY K;  2HBJ A;  3EKS A;  3SMP A;  4CGJ A;  1L3V A;  3CPW M;  4CFB A;  4AHU A;  1DTT A;  2D0C A;  1G99 A;  2Q0U A;  2Q97 A;  2F7T A;  3WEE A;  3ZT1 A;  3U9Z A;  4CJU A;  2V51 B;  2AJQ A;  1HNZ K;  4B3S K;  2RF2 A;  3K2P A;  3U4L A;  4PY5 A;  4JAX A;  3ENO A;  3AO3 A;  4JKB A;  3WEE B;  1LAW A;  3U3Y A;  4FWS A;  1VRT A;  2E20 A;  1U45 A;  3CQX A;  3SBT A;  2QK9 A;  1YVU A;  2UXD K;  2V7Z A;  4FZX C;  4W5O A;  3J80 O;  1S5J A;  3AVI A;  4KHW A;  4DSK A;  3O1W A;  3Q7C A;  4H5R A;  4W5Q A;  3MN7 A;  4WF9 L;  3KJV A;  4O44 A;  3NHG A;  3ID8 A;  1K8A O;  3KWG A;  4DQQ A;  4M41 A;  4BG8 A;  5HRR A;  4OPK A;  1EWR A;  3VQB A;  3SAF A;  3LAK A;  4H0O A;  3VGK A;  3L2W A;  4E1N A;  3EY1 A;  5JLH A;  3T1H K;  4FJX A;  4IOA L;  5E84 A;  5EXW A;  2X78 A;  2Q36 A;  1Q82 O;  1BCO A;  3ID6 A;  4HWI A;  4GKK K;  2P9U B;  1XI1 A;  1U2V B;  1RT6 A;  1T8E A;  2GV9 A;  5AQX A;  1MA9 B;  4CIE A;  2PZS A;  2X6N A;  5AQY A;  1SS6 A;  3TWH A;  1LWF A;  3T3F A;  3D2E B;  4AIL C;  1B9F A;  1X1P A;  5I9E B;  3E1Y A;  3TAR A;  3V9W A;  2WTU A;  3HPO A;  1ZYQ A;  3E9O A;  4YOW A;  2F96 A;  3VQA A;  1ZBU A;  3P39 A;  3RMD A;  3C6A A;  4N5S A;  1RBR A;  4A2A A;  2QWN A;  3FZH A;  4RWT A;  3VQ6 A;  3L2U A;  3ZSY A;  3O3F A;  4JS4 A;  4FOE A;  5CY4 A;  3KWI A;  4CJ3 A;  4IFY A;  4BR0 A;  3VPZ A;  2D0P A;  2QTD A;  4YNQ A;  3CPE A;  3GBT A;  3OS1 A;  2FBV A;  3FFI A;  4Q5V A;  3OJU A;  3CFP A;  1SUQ A;  1GLJ O;  3AVL A;  1N8R O;  3AA4 A;  3C94 A;  2O8E A;  3WXL A;  2P9P A;  3QO9 A;  1IKW A;  3F5T A;  4DMN A;  4EP4 A;  2E2O A;  3HT3 A;  5JLF A;  1JLF A;  1OVQ A;  3WQT A;  1GLC G;  3M8P A;  3CC2 N;  3LDN A;  1HMV A;  4CEC A;  1L3S A;  1J5E K;  4KTW A;  3R9P A;  4FJJ A;  1X3M A;  3VA0 A;  4CJW A;  4DTP A;  1NGE A;  5ADX H;  1NGJ A;  4XH4 A;  4JNE A;  5AQS A;  4DV5 K;  2O8F A;  3K59 A;  3OTO K;  5GAH P;  1ZBF A;  3CQY A;  4WFA L;  1IV0 A;  1QS4 A;  1RT3 A;  3G6E N;  1KLN A;  2ZJQ L;  3K5N A;  5A2Q O;  2WON A;  1W2B M;  4M45 A;  3NH1 A;  2NRV A;  2ZM6 K;  2P9I A;  1BQM A;  4FW2 A;  3CJA A;  2P9L B;  1VSF A;  4BWJ A;  1TUY A;  2P9I B;  1IKX A;  5LJW A;  1GLL O;  3NGI A;  3VGM A;  3ZSV A;  1H1V A;  4DR5 K;  4OLB A;  3AA2 A;  3M8S A;  4LF8 K;  3OYN A;  5HRS A;  4O8K A;  1JL2 A;  3SUQ A;  4M3T A;  2WFB A;  5C2F A;  4BR2 A;  3DMJ A;  4KTZ A;  1LW0 A;  2BUP A;  4FWM A;  4BRE A;  3IG1 A;  3HOT A;  2EWS A;  1OH6 A;  1VQ4 N;  3SV4 A;  5FPN A;  4WFB L;  2YNG A;  4Y1D A;  3KLF A;  2HBK A;  3EZW A;  1YIJ N;  4B9S A;  4NYF A;  1HKG A;  1FJG K;  4NLC A;  3VMF B;  4JKA A;  1EET A;  4O5F A;  4IDH A;  1VSJ A;  5LMN K;  3W3D A;  2AP1 A;  1JLB A;  3THY B;  4C8O A;  3QLH A;  5AQP A;  4EHU A;  3LAL A;  2ASO A;  4B9N A;  4E7H A;  2VWK A;  3NF7 A;  1NGI A;  2FBX A;  4MDA A;  1S9G A;  3CJ9 A;  5AR0 A;  1XUP O;  4PA1 A;  4CJE A;  5AFU H;  1HQE A;  2FBT A;  1HNX K;  2WBN A;  4K25 A;  1NJX A;  2GX9 A;  3OVN A;  1MU2 A;  4W5T A;  3DLR A;  4YOT A;  4BRK A;  3GL1 A;  1J53 A;  2HMP A;  2EHG A;  2GEL A;  2HVI A;  4RW8 A;  3B8A X;  1WN7 A;  4O0J A;  1JCE A;  5C2D A;  4EZ9 A;  3LDQ A;  5H1S Q;  4KHY A;  3A5M C;  3NH0 A;  4BRO A;  4CFD A;  5FRN A;  2DFE A;  1E3M A;  1RTJ A;  5BN9 A;  4QAG A;  1NMD A;  3G10 A;  4CVN E;  3PO4 A;  2D1K A;  1KAX A;  4Y1C A;  3CG7 A;  4BRF A;  5BR9 A;  3OYI A;  2NNW A;  4GKJ K;  3MEG A;  1QQC A;  3M3Z A;  2D0O A;  4BRI A;  2QXL A;  3BF1 A;  4JKE A;  3B6O A;  4FZY A;  3C95 A;  3CCM N;  4NB4 A;  2UUC K;  4IG3 A;  1VSM A;  4U67 L;  3R3L A;  1IBL K;  3RVC A;  5FPD A;  1JCG A;  3L2Q A;  1UOC A;  1XQS C;  1OH5 A;  1K9M O;  1ZBI A;  4OGE A;  2D4W A;  4FLV A;  1TAQ A;  4CBX A;  4AF1 A;  5JIC A;  1CXU A;  3HPG A;  1Q8I A;  3LP2 A;  3OY9 A;  4J2A A;  1NWK A;  4DTR A;  3SLC A;  2UYT A;  4BRM A;  3ZT0 A;  4N56 A;  4H8K A;  4FJ8 A;  1HKB A;  2ZE2 A;  3OYL A;  3MWT A;  1X9M A;  2YKN A;  3PX6 A;  4LSL A;  1EQY A;  3A8Y A;  3MEC A;  3THX B;  4DFP A;  3TPQ A;  2B5J A;  3I55 N;  4ELU A;  3MMV A;  4DFJ A;  4DV2 K;  3KLI A;  4FWP A;  3SV3 A;  4FM2 A;  3I33 A;  5AQF A;  2YNI A;  4BGA A;  1ZBS A;  2VQF K;  4JK9 A;  2A1R A;  4FVU A;  1LCU A;  5EVZ A;  4ZHR A;  4PKI A;  3P5J A;  4Z4H A;  2E4L A;  2O8B B;  2JWK A;  3MX5 A;  1C1C A;  2V7Y A;  4FK4 A;  2RKI A;  5AQT A;  2P9K B;  2HVH A;  3JYT A;  4BQL A;  3CC7 N;  3ASM A;  5AQW A;  3F9K A;  4FYD A;  2DY4 A;  4BDZ A;  1RGI A;  5KRS A;  4IO8 A;  4L8R B;  4H0X B;  2P9K A;  1K73 O;  3MCA B;  3D6R A;  2Q3S A;  2YCH A;  2FBY A;  4NLB A;  5AQR A;  1HNV A;  2XY8 A;  3VN5 A;  1HR0 K;  1KFD A;  5AQG A;  3K0S A;  1WSG A;  4XH1 A;  3D2F B;  4FOI A;  4W5R A;  3V9Z A;  2O8C B;  4JYA K;  5JS2 A;  3AVG A;  2P9N B;  2G8I A;  4CJV A;  1HYZ A;  4HHT A;  4JHD A;  2XY5 A;  1D9F A;  3CM5 A;  1GLB G;  4CJF A;  3TSP A;  2KKZ A;  5HRO A;  1ASW A;  4JI5 K;  2A6A A;  2YHB A;  2YHW A;  1P8Z A;  1NKB A;  5J2N A;  4KHU A;  3AVF A;  3J8A A;  1VQK N;  3AVA A;  4KHQ A;  1VQ5 N;  3W0L A;  5LMU K;  5C0Y A;  4JKF A;  3NF9 A;  2HST A;  4I6M B;  2J4R A;  5J2M A;  3DYA A;  4B9L A;  4DTJ A;  1RT4 A;  1ATR A;  4YDU C;  4JD2 A;  1ITG A;  4N41 A;  5FRO A;  1C6V A;  1IBM K;  4PQU A;  1A5V A;  2YHY A;  3KK1 A;  2FLO A;  5GIO A;  3R1X A;  3THV A;  3SPZ A;  2VG7 A;  1Q9X A;  3M6G A;  3AVN A;  4WQ5 C;  1UA0 A;  1QQN A;  4FWK A;  4C8N A;  4G1Q A;  1EO1 A;  2VQE K;  1KQS M;  3VQP A;  1C0G A;  5M1Q A;  1V4S A;  4IXC A;  4DS4 A;  3C6T A;  4DTX A;  3UE5 A;  3OYD A;  4JI0 K;  5EOY A;  2Y1J A;  2A41 A;  4K8X A;  1TK8 A;  1Z25 A;  3MN9 A;  4CD1 A;  3SMS A;  4DB3 A;  1U47 A;  3KLH A;  2NRR A;  3CER A;  1SKR A;  4OLA A;  2G8H A;  3NVM A;  1QHT A;  4F9O A;  3CD6 N;  1HNW K;  1YXQ A;  1HKC A;  4MFB A;  3DLH A;  4FWR A;  3O5B A;  4CZL A;  4X64 K;  5LL6 Z;  1VQP N;  4R79 A;  4DUZ K;  2XHB A;  4FSV A;  2P51 A;  2KZZ A;  1J9A A;  1KVC A;  1JCF A;  3VER A;  4CHO A;  3K5M A;  5J2Q A;  4FM1 A;  1G15 A;  1BHL A;  3SUN A;  1IG9 A;  4GV9 A;  3FR0 A;  4XH5 A;  4CZF A;  1K8K A;  4YY3 K;  4CJP A;  1TKX A;  1RDC A;  3D7E O;  3OHR A;  1J5O A;  3H1Q A;  1TAU A;  2YHA A;  3UKR B;  1QSL A;  1K8K B;  3QIP A;  2IGI A;  4IG0 A;  3VEN A;  4AHS A;  3OS2 A;  3DXM A;  1TUU A;  2PY5 A;  5HBM A;  2IVP A;  4CEO A;  4Z4E A;  4M7X A;  4IWV A;  5KQD A;  4LH4 A;  2F8S A;  4LF9 K;  3H6E A;  2HNZ A;  4B9M A;  5FRM A;  2IVO A;  3PUF A;  1VAZ A;  1NK4 A;  2YHX A;  3CME N;  3FZM A;  1DT9 A;  4J2D A;  4BRH A;  3OYF A;  3KLG A;  3CHW A;  3KK2 A;  4DR4 K;  4CEE A;  1S6P A;  1L3T A;  2UUA K;  1R0A A;  3O9R A;  4F8R A;  4O55 A;  3VF6 A;  4CZE A;  2YX6 A;  3ZYY X;  2E2Q A;  2E5L K;  4DR6 K;  1BCM A;  3CJB A;  2A42 A;  1P90 A;  3AVB A;  4A57 A;  3FGU A;  1D4X A;  3LDP A;  1FW6 A;  2H3G X;  3G71 N;  2QEX N;  2F9W A;  3KIO A;  2NRH A;  3SQ4 A;  3TSQ A;  3ZEU A;  3SNN A;  4AM7 A;  1NM1 A;  4MO4 A;  1TL1 A;  3MED A;  1RBV A;  3MXI A;  1X9W A;  1TYQ B;  1KCF A;  4JKG B;  4CGD A;  4GVE A;  3O1B A;  1U04 A;  2ASP A;  1VQN N;  3L6Q A;  1IG8 A;  2DTU A;  1ESV A;  4E1J A;  2FF6 A;  4EHT A;  4KAZ A;  2IVN A;  5CR4 A;  5AQO A;  4BR5 A;  4GVM A;  4FM0 A;  1RT7 A;  1WB9 A;  3O4Q A;  1BIS A;  2XO7 A;  3DLE A;  3QEX A;  4DU4 A;  4IKF A;  4M42 A;  4E0D A;  4DLE A;  3C7N A;  4RW4 A;  3L4Q A;  1YAG A;  1XWL A;  4IFE A;  4KKO A;  1NKC A;  4IJN A;  3AO5 A;  1BOT O;  2HHT A;  3TTC A;  4OGC A;  1SKS A;  3CXC M;  3AGK A;  3AA3 A;  4E7J A;  4BRP A;  3SBG A;  2HHX A;  5SZT A;  3CFR A;  4F2S A;  1YUW A;  1GOC A;  5I3U A;  5IT9 O;  4CJL A;  4WQ4 A;  2Y1I A;  5GIP A;  2NUB A;  4Z4F A;  1DTQ A;  5BRH A;  3HST B;  1GOA A;  5ELZ A;  3AAR A;  3ZLJ A;  2QWR A;  5GAG P;  5M1O A;  4DV4 K;  3QNN A;  3S9H A;  1KVB A;  3A5O C;  4HTL A;  1RT5 A;  4IFV A;  1NK0 A;  1W0H A;  4CK3 A;  2HNY A;  2UU9 K;  3SK3 A;  3KK7 A;  1SL0 A;  4LC9 B;  4AHR A;  1KVA A;  3TAF A;  3SQ1 A;  3KK3 A;  3VQ7 A;  3CCS N;  1RDA A;  1BA1 A;  1LV5 A;  2O8D B;  3O3G A;  1X3N A;  2GEM A;  3HO1 A;  3VGL A;  3AVJ A;  3TAM A;  2D0B A;  4CHY A;  1RBT A;  1KFS A;  2O8D A;  4C8L A;  4XEI A;  4E89 A;  2O4G A;  1XHX A;  3VEY A;  1HYV A;  3M8R A;  2V52 B;  3MXJ A;  1MWM A;  2P1J A;  3MCP A;  5DM6 L;  4KB1 A;  2FC0 A;  3OYH A;  4PHT X;  2P9S B;  1NGB A;  4YOV A;  2G8K A;  1M90 O;  3DOK A;  4ZTJ A;  4OPA A;  2HHS A;  2FSJ A;  1QQO A;  2GWJ A;  1HX1 A;  2P9S A;  2W42 A;  4CGG A;  1HRH A;  3H3O B;  2P9U A;  2VGM A;  3NDK A;  4FLY A;  4AHT A;  4BR7 A;  3PIO L;  1N5Y A;  3NAE A;  4H4M A;  1QE1 A;  2HF3 A;  3ULD A;  3P38 A;  4M3R A;  4B9V A;  1SZ2 A;  3KZB A;  4EIA A;  1WAJ A;  3G25 A;  3F73 A;  3LL3 A;  3WXM B;  3D2E A;  4KFB A;  5AJ3 K;  4CZI A;  2DFH A;  2KLA A;  1RT2 A;  5BN8 A;  4XIU A;  4JRQ A;  3RWU A;  1YI2 N;  1RDW X;  2XRI A;  4FZZ A;  2ITM A;  3EZ5 A;  5AQZ A;  2CGL A;  4LFC K;  4CI6 A;  3UKU A;  3DJC A;  5BRE A;  1XMQ K;  3FFK B;  1NNE A;  4OKJ A;  4FVM A;  4WCE L;  3PIP L;  2E6L A;  3O9T A;  3RMB A;  4JV5 K;  3LM9 A;  1GLD G;  2WOM A;  3A2F A;  3CFO A;  1C1B A;  1LWE A;  1WLJ A;  4O8U A;  3GOI A;  4JLH A;  4Q0B A;  3T69 A;  4A61 A;  4K41 A;  3IAY A;  3CCQ N;  4CF8 A;  1NJI O;  1XNQ K;  1CXQ A;  3CJ1 A;  3CM6 A;  5DM7 L;  1D8Y A;  1JL1 A;  4A59 A;  3SI6 A;  4JI6 K;  2NRX A;  3P83 D;  2JWL A;  3CCE N;  4X62 K;  3G4S N;  3DRP A;  3AO2 A;  1VSI A;  3V81 A;  3RRG A;  1BDG A;  3NF6 A;  4BE0 A;  1QTM A;  1CZB A;  1O13 A;  2UUB K;  2A1S A;  2HBM A;  3TAQ A;  1SQK A;  1WSE A;  1REV A;  1ATN A;  3H1V X;  2P9P B;  2VWJ A;  4N47 A;  5CE3 A;  3MAQ A;  3CJ7 A;  4FK0 A;  1IH7 A;  1S1T A;  2RPI A;  3QFU A;  4H0P A;  3DLK A;  3RTV A;  1CZ9 A;  5BRD A;  1I39 A;  1QZ5 A;  4A5B A;  2KHO A;  1N6Q A;  2BE2 A;  1A5X A;  4CHN A;  3QET A;  4HUE A;  3K9J A;  4R5P A;  1U6Z A;  4DFM A;  2E6M A;  2OCE A;  3CJC A;  2KFN A;  2FXU A;  3ZT4 A;  3QIC A;  2QI2 A;  1IBK K;  5CYQ A;  4ISE A;  3BZC A;  3T19 A;  5LJV A;  5HOO A;  2IC3 A;  3H45 C;  3V9S A;  2PAV A;  3WXJ A;  4RTF D;  3V1O A;  3CMA N;  4DFK A;  1QVG M;  4DF8 A;  3U6F A;  3LP1 A;  1IKV A;  2PYJ A;  3UIQ A;  3QFP A;  5JVH L;  1U4B A;  2P9L A;  4H5T A;  3WNG A;  2W40 A;  4B1Y B;  5AQI A;  1NJZ A;  2HMI A;  4PUO A;  1CZA N;  3M8Q A;  1DGK N;  1C0U A;  5J2P A;  4BRL A;  3AVC A;  3U8X A;  3L2R A;  4DSF A;  1NOY A;  2F8T A;  3KD5 E;  3VEV A;  4CK2 A;  2OTJ N;  4F2R A;  4WQ5 A;  1RDD A;  2ATQ A;  4OVL A;  3WNF A;  3MN5 A;  1HNI A;  3QEW A;  2DPN A;  4IEI A;  3S41 A;  2AA4 A;  4CE9 A;  2CGJ A;  4E3S A;  1IO2 A;  1RNH A;  4FK2 A;  5HL7 L;  3QEV A;  4NO7 A;  4DV7 K;  1RCH A;  4DG1 A;  1VSD A;  3BDP A;  1HJO A;  4JI1 K;  3IUC A;  2KZM A;  4CCH A;  3N4Q A;  5M1F A;  4ILG B;  2ZJR L;  1WBB A;  3HTV A;  4K8Z A;  2BAN A;  1TVR A;  3NFA A;  3SPY A;  1J54 A;  2HND A;  1BUP A;  3K5O A;  4BC4 A;  1BU6 O;  1BG3 A;  3LPT A;  1K6Y A;  1T3V A;  5GAD P;  4O0I A;  1NKE A;  4BVO A;  1L5U A;  4CIF A;  4CER A;  1M1K O;  4B9T A;  3THW B;  1Z26 A;  1T7P A;  3V6D A;  4LFA K;  4KH6 A;  2HW3 A;  4FJN A;  1WAF A;  4CZJ A;  4DSE A;  2LSN A;  3LPU A;  3THW A;  5KTQ A;  2GTD A;  2BGG A;  1RFQ A;  4H0V B;  1NK8 A;  3PSI A;  1XC3 A;  5HLF A;  3L0Q A;  4CEB A;  2G8U A;  2I7P A;  4BRC A;  3IDH A;  4TSX A;  3HM9 A;  5HRN A;  4RW7 A;  5KQ8 A;  3AAQ A;  2YKM A;  1TKD A;  4F3O A;  1ZBH A;  2OPQ A;  5C15 A;  5BPM A;  5AQM A;  4DSI A;  1NK5 A;  1ILY A;  4I9Q A;  3MXM A;  1WSJ A;  3WQU A;  4K43 A;  1NGG A;  4JS5 A;  3EN9 A;  3DLG A;  2E88 A;  1NU0 A;  3LDO A;  1RDU A;  4C1N I;  2IDO A;  3K5L A;  3AO1 A;  3HI0 A;  4LD0 A;  3TAB A;  1WSI A;  4DTU A;  1HPM A;  3T1A A;  4I2P A;  1Y97 A;  3E9P A;  3L4I A;  3D0P A;  2D5R A;  1W97 L;  4DQS A;  3DM2 A;  2B4J A;  1N32 K;  3D45 A;  3NGY A;  5TKY A;  4CFC A;  4CHP A;  3E9L A;  3FZL A;  3EE8 A;  3SJJ A;  2Z1G A;  4OPJ A;  5K14 A;  3S3O A;  1VQO N;  1KAZ A;  2Q2R A;  2FSN A;  3VEX A;  3B6P A;  1NGH A;  4NXN K;  4M3X A;  4LH5 A;  3THX A;  1JLC A;  1VSK A;  4E1M A;  3QDK A;  4FLT A;  4HCC A;  2NRW A;  1IJJ A;  5GIN A;  4NYN A;  3AO4 A;  4B1U B;  3VOV A;  4B3O A;  2ZF5 O;  3H08 A;  3CC4 N;  1YJ9 N;  3I0R A;  4A62 A;  1JLE A;  3TSU A;  3PLA A;  4J2E A;  2ZGZ A;  4IZ9 A;  3LZI A;  3OBW A;  2HB5 A;  1TKT A;  2O4I A;  4FJ5 A;  3MEE A;  1SKW A;  2BDP A;  5AFU A;  4BE2 A;  1DEJ A;  1W7A A;  4MLE A;  3K58 A;  1JLQ A;  3OYC A;  2DFF A;  4CGH A;  4FXD A;  3VQ5 A;  2BTF A;  3PV8 A;  4KI6 A;  4KRF A;  2PYL A;  3DXK A;  3DWL A;  1S9E A;  5AZJ B;  2YV0 X;  2NRZ A;  3P4I A;  1KSP A;  4FWL A;  1EXQ A;  2JLE A;  3CCJ N;  4DV3 K;  4BRG A;  1NJW A;  1KRP A;  1V4T A;  3DXK B;  5EY4 A;  2QWP A;  3VQ8 A;  5D3G A;  3TTD A;  2X74 A;  4ISF A;  4NCG A;  4DSL A;  3AVK A;  4YOU A;  4DV0 K;  1S22 A;  4H5V A;  3WUH A;  3IMX A;  4OX9 K;  2GUP A;  2HHU A;  4ICL A;  1HPZ A;  1Z6R A;  1SV5 A;  5AQV A;  3SUP A;  1KAY A;  4DQ8 A;  3TI0 A;  4UQG A;  4B3R K;  3ISN C;  3PSF A;  4E7I A;  4JEP A;  3LDL A;  4FJM A;  4WE1 A;  3ITH A;  2IS3 A;  1VQ6 N;  4LSN A;  4BRA A;  2QWL A;  2YNH A;  3G0Z A;  4JI4 K;  4FJL A;  1OH8 A;  4BDP A;  1O1W A;  4IBN A;  3ZSX A;  3VEW A;  3VTI A;  2W41 A;  3CQ8 A;  2Q31 A;  4PKH A;  4CHQ A;  3QEP A;  3ZX2 A;  1VQL N;  1VK0 A;  3I0S A;  3V1Q A;  4Z94 A;  2VCP A;  2QW9 A;  4JKD A;  4JK7 A;  3O08 A;  4FJK A;  3ZT2 A;  3OA9 A;  4CEF A;  4A2B A;  4CF0 A;  5FDL A;  1FKO A;  3VQC A;  4YFU A;  4CK1 A;  5CZ1 A;  1QVF M;  2KTQ A;  4DKW A;  2WC9 A;  3OBY A;  4C1N K;  5C24 A;  3VTH A;  4JD2 B;  4CEQ A;  4DU3 A;  3T7Z A;  3RMC A;  5B8H A;  3K57 A;  4HCB A;  4FPB A;  1NBW A;  1WOQ A;  3I8D A;  4RCH A;  5SWM A;  4DR2 K;  3MX2 A;  3NCI A;  3WNH A;  1GLE G;  4DCH A;  1XC9 A;  4CEA A;  4LF7 K;  4L3Q A;  5KPZ A;  3GDQ A;  1BGX T;  3VEZ A;  4LF4 K;  3C0B A;  5IWA K;  5FLX O;  4CED A;  4CJK A;  4C8M A;  2HBL A;  3VQQ A;  1LWC A;  3L3V A;  4DR7 K;  1RIL A;  5ADX A;  3ZSR A;  3BGR A;  1HQU A;  4F3T A;  3CYM A;  4ILH A;  4AH9 A;  4AM6 A;  5BPN A;  2OZM A;  4OO1 J;  3DLB A;  5BR8 K;  1YVN A;  1U2V A;  4M3U A;  3HBT A;  4ID1 A;  4DS5 A;  4CF9 A;  2HF4 A;  3LM2 A;  4E7K A;  1U48 A;  3NF8 A;  4B1Z A;  5TKW A;  4GNI A;  2Z1H A;  3MWP A;  1F21 A;  3UKU B;  4LFB K;  3AY9 A;  4CZH A;  1RBS A;  4CF2 A;  1LAV A;  5CYM A;  3S3N A;  2GBZ A;  4LF5 K;  4OJR A;  1GLF O;  4IO9 L;  4BY9 C;  3NE6 A;  2OPS A;  5DMR A;  3QBX A;  4DLG A;  3O4W A;  1RTD A;  4OKE A;  1SL2 A;  4FW1 A;  1HJR A;  1YJN N;  4B9Q A;  4CZG A;  1WUA A;  3ZCM A;  2QWM A;  1TKZ A;  1T44 A;  2ZGY A;  3R6M A;  1KTQ A;  3KVG A;  2O8E B;  2FF3 B;  3O8M A;  4C23 A;  4BDY A;  2R7Y A;  2IIR A;  5C10 A;  2PBD A;  4YDU A;  4IEE A;  3FE1 A;  4QS8 A;  1ZBL A;  3SAG A;  3OYJ A;  2ASM A;  1GLA G;  3TU5 A;  2OPR A;  3ZX0 A;  4C8K A;  3V9X A;  2RHK A;  3NGZ A;  4FLW A;  4CES A;  3EO3 A;  3ZSO A;  4DR3 K;  4FLU A;  4CF1 A;  4BRN A;  1GOB A;  3L3U A;  4B8C A;  5EX5 A;  1Z05 A;  3LP0 A;  5M1P A;  1SL1 A;  3KLE A;  1YHQ N;  2G8W A;  3V4I A;  3WXK A;  3EYZ A;  5LY3 A;  4OKK A;  4NCB A;  2RE2 A;  1RBU A;  3ZEU B;  1XNR K;  3AAP A;  5MLC Q;  4B1V A;  5KPT A;  2QKB A;  1ASV A;  1I3A A;  4JKG A;  1C0F A;  4FJ7 A;  2YI1 A;  3ENH A;  3DRR A;  3BP8 A;  3C6H A;  1VRU A;  2ZWH A;  1VQ8 N;  3C7N B;  3HSC A;  3VF2 A;  2YJF A;  4ELV A;  3KD1 E;  5DK5 A;  2VYP A;  3ZSZ A;  2W6K A;  2XY7 A;  5C25 A;  3A0I X;  1Q18 A;  2VG6 A;  4BWM A;  4FLZ A;  4BC5 A;  3HVT A;  4OPH A;  4J8F A;  4K0K K;  3C6U A;  5I42 A;  1MWK A;  4O4G A;  3FZK A;  4H5N A;  1N36 K;  4FJI A;  3ALY A;  2VWB A;  1EKE A;  3DI6 A;  3CCU N;  3IFR A;  1NMN A;  4O5B A;  1E4F T;  5M1K A;  4DHY A;  1WSH A;  4FWQ A;  1WNS A;  2A40 A;  1BQN A;  4PL8 A;  4CW7 B;  2QWQ A;  4FO0 A;  4B3T K;  1BA0 A;  3HP6 A;  1BWF O;  3KKR A;  3V1R A;  3CET A;  2G8V A;  1XMO K;  1A5W A;  3THY A;  2G8F A;  3ZET A;  4H4O A;  4Z0U A;  1DLO A;  2D0A A;  3WXI A;  1NGC A;  1NGA A;  3Q7B A;  3DAW A;  4CZK A;  5AQL A;  3RR8 A;  5BRF A;  4QS7 A;  4KV8 A;  4Y0W A;  4CIG A;  3ZET B;  1D9D A;  3CIP A;  4M63 C;  4FWO A;  3AV9 A;  2HOE A;  4BRD A;  1C1A A;  3HPH A;  5HRP A;  2ZD1 A;  3BZK A;  3J81 O;  4MLH A;  4CD3 A;  5F2R A;  4NXM K;  4WYB A;  3RRH A;  3VA3 A;  4DUY K;  1OKJ A;  4FJG A;  1SAZ A;  3TAN A;  4CJQ A;  2UXC K;  1JLA A;  3J7Y P;  4QCL A;  3OYA A;  3P31 A;  4NCA A;  4PKG A;  3PX0 A;  3LP3 A;  4KRE A;  1Q86 O;  1KD1 O;  3O3H A;  5CHI A;  4GV3 A;  4MDB A;  2QXF A;  3SJH A;  2QA4 N;  1B92 A;  4B8A B;  3O4N A;  3SQ2 A;  3RMA A;  5E41 A;  1TV6 A;  4DTM A;  2GWK A;  3EL2 A;  5F1X A;  3V9U A;  2E1Y A;  2X6S A;  1YT3 A;  1EX4 A;  4JI7 K;  3LWM A;  3ENB A;  5C12 A;  4IOC L;  4I7F A;  1L3U A;  2OPP A;  4M3Y A;  5JVG L;  3ATV A;  2HHW A;  3PX4 A;  3AA5 X;  4MQ3 A;  4CGF A;  4I9L A;  2XY6 A;  4HVJ A;  3QIN A;  2GUI A;  3P1G A;  4BGB A;  2A5X A;  3VET A;  2YNF A;  3QB0 A;  3BUZ B;  3HL8 A;  4FLX A;  1I94 K;  4JI8 K;  3SQ0 A;  1BIU A;  3F2K A;  1TK5 A;  3HK2 A;  1NGD A;  3QEI A;  3TAE A;  3RSE B;  4FJH A;  1OVY A;  4DTS A;  3JAM O;  3C65 A;  1HLU A;  1Q7Y O;  4EFH A;  4CJR A;  4FJ9 A;  3RSE A;  2EX3 A;  3HYF A;  2OZS A;  1UA1 A;  3UB5 A;  4E19 A;  3QBW A;  2FSK A;  1R59 O;  2NLX A;  3VQ4 A;  1DKG D;  5GAE P;  5F0X A;  1EWQ A;  4EZ6 A;  1VSL A;  5AZI A;  4PWD A;  1NLV A;  4BR9 A;  1HUX A;  4H0T B;  1VQ9 N;  2QKK A;  2F4V K;  2E2N A;  3O80 A;  3OW2 M;  4CHZ A;  4EP5 A;  1N34 K;  5AZI B;  4A5A A;  4CJT A;  4B1W B;  4YOX A;  3IS9 A;  4Z4I A;  3ATU A;  1KC8 O;  4KBO A;  4BRQ A;  1ATS A;  4CBW A;  1U49 A;  3GE1 A;  1T05 A;  4DV6 K;  3MK6 A;  3N4P A;  5AQQ A;  3FZF A;  3VES A;  4PL7 A;  5JMV A;  4DV1 K;  1RTH A;  5KPR A;  1JJ2 M;  5AQU A;  3LZJ A;  5AZJ A;  4DR1 K;  4CGI A;  1TGO A;  1TL3 A;  1T6D A;  1YTA A;  3M1F A;  3QNO A;  4KB0 A;  3OYG A;  4KHP K;  1S6Q A;  3TTF A;  3MN6 A;  3LDS A;  2IOC A;  2P5G A;  3DLL L;  3E66 A;  5KGX A;  4KH5 A;  2NRT A;  3IRX A;  4X66 K;  2VG5 A;  1NK9 A;  4BE1 A;  4I2Q A;  3SAH A;  3BEX A;  4CBU A;  1QHA A;  2O8F B;  1QSY A;  1KXP A;  5T7B A;  2I5J A;  4BR4 A;  5AQH A;  4HUF A;  3NMU A;  1B9D A;  1Q81 O;  1NK6 A;  3IKM A;  4HUG A;  2OAN A;  3SCX A;  4E7L A;  2Z1J A;  4B9U A;  1UAX A;  3VQE A;  4GW6 A;  3D2F A;  2OYQ A;  1RT1 A;  1BI4 B;  2O8C A;  4YOY A;  2P9N A;  4DTN A;  3QES A;  4LF6 K;  5AQK A;  4F4K A;  4H5W A;  3OJS A;  1YF5 L;  5C42 A;  4JHD B;  4WFN L;  4KPY A;  1BI4 A;  1QQM A;  3SZ2 A;  1EP4 A;  4FL9 A;  1FK9 A;  2E2P A;  4I6M A;  3U3G A;  5CZ2 A;  4IJA A;  1LW2 A;  4YHH K;  1VSH A;  3O9S A;  3VEO A;  4KHN A;  4GMJ B;  5KI6 A;  4Z4C A;  3O9Q A;  3HVR A;  3OYB A;  1NJY A;  4KTQ A;  3O6W A;  2YJE A;  3E01 A;  4W5N A;  1X9S A;  5M1N A;  1NK7 A;  3AVM A;  3CI5 A;  5BPL A;  2ITG A;  1ZC6 A;  4CZM A;  4DF4 A;  2NZT A;  1VSE A;  1BO5 O;  1MDU B;  2OA8 A;  5FPM A;  2CGK A;  3KKS A;  2ZQB A;  4V19 S;  3HM8 A;  3HOS A;  1WBD A;  4B1X B;  2A3Z A;  4RG8 A;  1OH7 A;  2UXB K;  2PFU A;  1Y64 A;  4CJ7 A;  4X65 K;  2KW4 A;  4JKC A;  2BH1 A;  2W6L A;  2QM1 A;  4IDK A;  4U7B A;  1S1X A;  2Z1I A;  4Z4G A;  4QS9 A;  3L8B A;  1HYS A;  4YOR A;  3NH2 A;  3LAM A;  1NOZ A;  3EKU A;  3KHY A;  2QWO A;  3OYE A;  4AHV A;  4JK8 A;  4N76 A;  1NG9 A;  1KLM A;  4CJ4 A;  4M7Y A;  5J1E A;  3DRS A;  3JXU A;  2CH6 A;  4BC2 A;  3WNE A;  3H46 O;  2B6A A;  2HHV A;  3ZX3 A;  2F9T A;  3HRG A;  1RDB A;  4ID5 A;  3JSM A;  2E8A A;  3CF5 L;  1J6Z A;  3NBP A;  3OS0 A;  2HHQ A;  3RR7 A;  4BVP A;  3U9D A;  1IKY A;  3FLC O;  3EE9 A;  3H3N O;  3DXM B;  3CCR N;  4ELT A;  2VGN A;  4BG9 A;  3CCV N;  4JRP A;  3S3M A;  1VQ7 N;  1D5A A;  3LAN A;  1S3X A;  2IAJ A;  5FPE A;  4DQP A;  1S1U A;  1QSS A;  4LY7 A;  3OYK A;  1LOT B;  3UKR A;  2KFZ A;  2I7N A;  3SUO A;  4FPA A;  3I8B A;  1ASU A;  3DOL A;  4M3W A;  2Q0R A;  3A5L C;  3VQD A;  3CCL N;  1N33 K;  1S1W A;  3BY5 A;  4AHC A;  3HZ6 A;  4FWN A;  3ZSW A;  4DQR A;  3BF3 A;  4DWI A;  3QIO A;  4KI4 A;  3KTQ A;  4CFA A;  1WSF A;  1YIT N;  2ETJ A;  4H0Y B;  4RW6 A;  3AGR A;  1X9J A;  2Q1N A;  5HP1 A;  4G9Z A;  4K42 A;  4H03 B;  2CH5 A;  1FXX A;  1BL3 A;  1C0M A;  3TAP A;  5AQN A;  3ZSQ A;  4UY8 O;  4KHS A;  1CLQ A;  4DU1 A;  1XHZ A;  1S72 N;  3M5R A;  4CJ5 A;  4JKH A;  4KH4 A;  4ZTF A;  5AQJ A;  1QZ6 A;  1E4G T;  3TR8 A;  1W9H A;  1TYQ A;  2WUS A;  2P5O A;  4JI3 K;  2ZJP L;  1S1V A;  3J7Z O; 
#chains in the Genus database with same CATH homology
 3L2V A;  4Z4H A;  2E4L A;  3MAQ A;  4J2B A;  1SL1 A;  1JXB A;  3HP9 A;  3PY8 A;  3KLE A;  1C1C A;  4FK0 A;  2G8W A;  4FK4 A;  1T03 A;  3V4I A;  3EYZ A;  4OKK A;  1IH7 A;  2RKI A;  1S1T A;  2RPI A;  4AIL C;  3JYT A;  4NCB A;  2HVH A;  1RBU A;  3ASM A;  4M3Z A;  3DLK A;  1UWB A;  3F9K A;  1CZ9 A;  4BDZ A;  3RTV A;  5KRS A;  4FYD A;  2DY4 A;  4L8R B;  1BIZ A;  1I39 A;  2QKB A;  1ASV A;  4RW9 A;  1I3A A;  1Q9Y A;  1N6Q A;  1C0T A;  2RN2 A;  2BE2 A;  3ZT3 A;  1A5X A;  4FJ7 A;  1FKP A;  2Q3S A;  4CHN A;  3QET A;  4HUE A;  3DRR A;  1VRU A;  2FBY A;  4KO0 A;  4R5P A;  3VQ9 A;  3PO5 A;  4DFM A;  2E6M A;  1RTI A;  1HNV A;  4ELV A;  2XY8 A;  5DK5 A;  3KD1 E;  3VN5 A;  2KFN A;  3ZT4 A;  4FXD A;  1KFD A;  3ZSZ A;  4B08 A;  3QER A;  2XY7 A;  5JS1 A;  2KQ2 A;  5CYQ A;  5C25 A;  1WSG A;  2VG6 A;  1YTU A;  2JGU A;  4BWM A;  1JKH A;  3T19 A;  4W5R A;  4FLZ A;  3TAG A;  3V9Z A;  5JS2 A;  4DTO A;  2IC3 A;  3AVH A;  3AVG A;  3HVT A;  5KRT A;  3V9S A;  1TK0 A;  4DQI A;  4FCY A;  3C6U A;  4CJV A;  2G8I A;  1HYZ A;  3V1O A;  4DFK A;  4HHT A;  5I42 A;  4DF8 A;  2XY5 A;  3U6F A;  1D9F A;  3LP1 A;  3HJF A;  4O4G A;  3CM5 A;  1IKV A;  2PYJ A;  3UIQ A;  4FJI A;  5EU7 A;  3ALY A;  1U4B A;  3SYZ A;  1EKE A;  3DI6 A;  3WNG A;  4CJF A;  4CJS A;  3HXM A;  5HRO A;  1ASW A;  3LWL A;  1NJZ A;  4O5B A;  2HMI A;  1JLG A;  4PUO A;  2YHB A;  3M8Q A;  4HTU A;  4DSJ A;  1C0U A;  1NKB A;  5J2P A;  5J2N A;  1WSH A;  4KHU A;  4QOZ B;  4CEZ A;  1WNS A;  3AVC A;  3AVF A;  1BQN A;  3L2R A;  3OYM A;  1JXE A;  4BAC A;  4DSF A;  1NOY A;  2F8T A;  3KD5 E;  5KGW A;  3AVA A;  4KHQ A;  4CK2 A;  4CGJ A;  3HP6 A;  4F2R A;  1L3V A;  1RDD A;  2ATQ A;  3KKR A;  4OVL A;  3V1R A;  3WNF A;  1HNI A;  3NF9 A;  4CFB A;  3QEW A;  2G8V A;  5J2M A;  1A5W A;  3DYA A;  4AHU A;  4B9L A;  2G8F A;  4DTJ A;  1RT4 A;  1DTT A;  2D0C A;  4H4O A;  1DLO A;  2D0A A;  4Z0U A;  4CE9 A;  4E3S A;  1ITG A;  1IO2 A;  1RNH A;  1C6V A;  5FRO A;  4N41 A;  4FK2 A;  4PQU A;  3QEV A;  1A5V A;  3ZT1 A;  3KK1 A;  3RR8 A;  4CJU A;  1RCH A;  4KV8 A;  4DG1 A;  2AJQ A;  4CIG A;  1VSD A;  2RF2 A;  3K2P A;  3THV A;  3BDP A;  2KZM A;  4PY5 A;  4CCH A;  3AO3 A;  3SPZ A;  1D9D A;  4K8Z A;  2BAN A;  2VG7 A;  1LAW A;  3U3Y A;  1TVR A;  3AV9 A;  3NFA A;  1VRT A;  3SPY A;  1J54 A;  1C1A A;  2HND A;  3HPH A;  5HRP A;  2ZD1 A;  1U45 A;  1Q9X A;  3K5O A;  3LPT A;  1K6Y A;  3AVN A;  2QK9 A;  1UA0 A;  1YVU A;  4O0I A;  1NKE A;  4FZX C;  4C8N A;  4G1Q A;  4W5O A;  3RRH A;  4CIF A;  3VA3 A;  4CER A;  3VQP A;  1L5U A;  4B9T A;  1S5J A;  1Z26 A;  1T7P A;  4FJG A;  3V6D A;  2HW3 A;  3AVI A;  4KHW A;  4DSK A;  3TAN A;  4CJQ A;  3C6T A;  4DS4 A;  4DTX A;  4FJN A;  1JLA A;  4W5Q A;  1WAF A;  3OYD A;  3KJV A;  2LSN A;  4O44 A;  3NHG A;  4DSE A;  2Y1J A;  3OYA A;  4K8X A;  1TK8 A;  4QCL A;  3LPU A;  1Z25 A;  5KTQ A;  2BGG A;  4NCA A;  4DQQ A;  4M41 A;  3PX0 A;  3LP3 A;  1U47 A;  5HRR A;  3KLH A;  4OPK A;  4KRE A;  3VQB A;  3O3H A;  3LAK A;  3L2W A;  1NK8 A;  4E1N A;  3EY1 A;  5HLF A;  1SKR A;  4CEB A;  4FJX A;  2QXF A;  2G8U A;  4OLA A;  2G8H A;  1QHT A;  4TSX A;  3HM9 A;  5HRN A;  1B92 A;  4RW7 A;  2X78 A;  3O4N A;  4B8A B;  3SQ2 A;  3RMA A;  5E41 A;  3SUN A;  2YKM A;  1TKD A;  1TV6 A;  4DTM A;  1BCO A;  4MFB A;  4F3O A;  3DLH A;  1ZBH A;  2OPQ A;  3V9U A;  2X6S A;  4DSI A;  1NK5 A;  1YT3 A;  1EX4 A;  4I9Q A;  3MXM A;  1XI1 A;  1WSJ A;  3LWM A;  1RT6 A;  1T8E A;  2GV9 A;  4JS5 A;  3DLG A;  4I7F A;  1L3U A;  4CIE A;  2OPP A;  2XHB A;  2PZS A;  4M3Y A;  2X6N A;  2P51 A;  2KZZ A;  1J9A A;  1KVC A;  2IDO A;  3PX4 A;  3AA5 X;  3K5L A;  2HHW A;  3TWH A;  3AO1 A;  4CHO A;  1LWF A;  4MQ3 A;  1G15 A;  1BHL A;  4LD0 A;  1B9F A;  4CGF A;  3K5M A;  1WSI A;  4FM1 A;  4DTU A;  1X1P A;  3TAB A;  1IG9 A;  4I9L A;  2XY6 A;  3T1A A;  3QIN A;  4I2P A;  2GUI A;  4HVJ A;  1Y97 A;  3P1G A;  4CJP A;  1TKX A;  3V9W A;  1RDC A;  3TAR A;  1J5O A;  3D0P A;  1TAU A;  2D5R A;  2YHA A;  2YNF A;  3HPO A;  4DQS A;  3HL8 A;  4FLX A;  3DM2 A;  2B4J A;  1ZYQ A;  1QSL A;  3SQ0 A;  1BIU A;  3D45 A;  3NGY A;  1TK5 A;  3HK2 A;  3QIP A;  2F96 A;  2IGI A;  4IG0 A;  3VQA A;  4AHS A;  4CFC A;  3QEI A;  1ZBU A;  3RMD A;  3TAE A;  4CHP A;  4FJH A;  4DTS A;  3OS2 A;  4N5S A;  3SJJ A;  2Z1G A;  1RBR A;  5HBM A;  4OPJ A;  2PY5 A;  4CEO A;  3VQ6 A;  5K14 A;  3S3O A;  4Z4E A;  4CJR A;  4LH4 A;  4FJ9 A;  2F8S A;  3L2U A;  2HNZ A;  3ZSY A;  3O3F A;  3B6P A;  2EX3 A;  4JS4 A;  4B9M A;  5FRM A;  3PUF A;  3HYF A;  5J2Q A;  4LH5 A;  5CY4 A;  2OZS A;  1UA1 A;  4M3X A;  1JLC A;  1VSK A;  4CJ3 A;  4E1M A;  4E19 A;  1NK4 A;  4IFY A;  3VQ4 A;  4FLT A;  4YNQ A;  3OYF A;  3KLG A;  4HCC A;  4J2D A;  3OS1 A;  2FBV A;  3FFI A;  4EZ6 A;  4Q5V A;  1VSL A;  4PWD A;  3OJU A;  3KK2 A;  4NYN A;  3CFP A;  1SUQ A;  3AO4 A;  4CEE A;  1S6P A;  2QKK A;  4B3O A;  3AVL A;  3H08 A;  1L3T A;  3AA4 A;  3C94 A;  4CHZ A;  1R0A A;  3I0R A;  4EP5 A;  4F8R A;  4O55 A;  1JLE A;  3QO9 A;  1IKW A;  4CJT A;  4J2E A;  4DMN A;  4EP4 A;  1BCM A;  3IS9 A;  3AVB A;  3LZI A;  4Z4I A;  3HT3 A;  2HB5 A;  1JLF A;  1TKT A;  2O4I A;  4FJ5 A;  3MEE A;  1SKW A;  2BDP A;  1U49 A;  1T05 A;  3M8P A;  4BE2 A;  3KIO A;  3SQ4 A;  1RTH A;  4FJJ A;  1HMV A;  3SNN A;  4CEC A;  1TL1 A;  3MED A;  1RBV A;  3LZJ A;  3K58 A;  3MXI A;  1X9W A;  1L3S A;  1KCF A;  4CGD A;  4CGI A;  4KTW A;  1JLQ A;  1TGO A;  3OYC A;  1TL3 A;  1YTA A;  1U04 A;  2DFF A;  3VQ5 A;  4CGH A;  3VA0 A;  3OYG A;  3QNO A;  3PV8 A;  4KB0 A;  4KI6 A;  1S6Q A;  4CJW A;  4DTP A;  4KRF A;  2PYL A;  2DTU A;  3LDS A;  2IOC A;  2P5G A;  1S9E A;  2YV0 X;  3K59 A;  5KGX A;  1KSP A;  3IRX A;  2VG5 A;  1NK9 A;  4KAZ A;  4BE1 A;  4I2Q A;  1EXQ A;  2JLE A;  1ZBF A;  4GVM A;  4FM0 A;  1RT7 A;  1KRP A;  1NJW A;  3O4Q A;  1BIS A;  1QSY A;  1QS4 A;  1RT3 A;  1KLN A;  2XO7 A;  3DLE A;  3QEX A;  5T7B A;  4DU4 A;  3VQ8 A;  3K5N A;  5D3G A;  2WON A;  2I5J A;  4IKF A;  4M42 A;  4M45 A;  3NH1 A;  2X74 A;  4E0D A;  4NCG A;  4DSL A;  3AVK A;  4HUF A;  1B9D A;  4DLE A;  4RW4 A;  1BQM A;  1NK6 A;  4FW2 A;  4HUG A;  1XWL A;  3SCX A;  4E7L A;  1VSF A;  2Z1J A;  4B9U A;  2HHU A;  1UAX A;  4KKO A;  4ICL A;  4BWJ A;  1IKX A;  1NKC A;  1HPZ A;  3AO5 A;  3VQE A;  4GW6 A;  3NGI A;  2HHT A;  1SV5 A;  3SUP A;  4OGC A;  1RT1 A;  2OYQ A;  3ZSV A;  1BI4 B;  4UQG A;  3TI0 A;  3ISN C;  1SKS A;  4OLB A;  3AA2 A;  3AA3 A;  3M8S A;  4DTN A;  4E7J A;  3OYN A;  5HRS A;  3QES A;  4E7I A;  1JL2 A;  3SUQ A;  4FJM A;  4M3T A;  4F4K A;  2HHX A;  3OJS A;  4WE1 A;  3ITH A;  2IS3 A;  5C42 A;  5SZT A;  4KPY A;  3DMJ A;  4KTZ A;  1LW0 A;  1BI4 A;  3CFR A;  4F2S A;  4LSN A;  3SZ2 A;  1GOC A;  1EP4 A;  5I3U A;  3IG1 A;  1FK9 A;  3U3G A;  2YNH A;  5CZ2 A;  3G0Z A;  4CJL A;  3SV4 A;  2Y1I A;  4FJL A;  2NUB A;  2YNG A;  4Y1D A;  4BDP A;  1O1W A;  1DTQ A;  4Z4F A;  4IBN A;  3ZSX A;  3CQ8 A;  3KLF A;  3QEP A;  4CHQ A;  1LW2 A;  3HST B;  1GOA A;  4B9S A;  4NYF A;  1VK0 A;  3I0S A;  3V1Q A;  1VSH A;  3QNN A;  3S9H A;  1EET A;  4KHN A;  4GMJ B;  1KVB A;  5KI6 A;  4FJK A;  1RT5 A;  3ZT2 A;  4IFV A;  1NK0 A;  1W0H A;  4CEF A;  4CF0 A;  2HNY A;  1VSJ A;  5FDL A;  4Z4C A;  4CK3 A;  1SL0 A;  1FKO A;  3VQC A;  3HVR A;  4YFU A;  3OYB A;  4AHR A;  1NJY A;  1JLB A;  1KVA A;  4CK1 A;  5CZ1 A;  3TAF A;  4C8O A;  3QLH A;  3KK3 A;  3SQ1 A;  3E01 A;  4KTQ A;  3VQ7 A;  2KTQ A;  1X9S A;  1NK7 A;  4W5N A;  3AVM A;  1LV5 A;  1RDA A;  5C24 A;  3LAL A;  4CEQ A;  3O3G A;  4B9N A;  4DU3 A;  2ITG A;  4E7H A;  2VWK A;  3RMC A;  3NF7 A;  3HO1 A;  3K57 A;  2FBX A;  4HCB A;  3AVJ A;  4DF4 A;  3TAM A;  2D0B A;  4CHY A;  1RBT A;  1VSE A;  1S9G A;  3I8D A;  4PA1 A;  1KFS A;  5SWM A;  2OA8 A;  4C8L A;  4CJE A;  3NCI A;  3WNH A;  3KKS A;  4E89 A;  2ZQB A;  1HQE A;  1XC9 A;  2FBT A;  2O4G A;  4CEA A;  1XHX A;  1BGX T;  4RG8 A;  1NJX A;  1HYV A;  4CJK A;  4CED A;  3M8R A;  3OVN A;  1MU2 A;  4C8M A;  2KW4 A;  3DLR A;  3MXJ A;  4W5T A;  3VQQ A;  1LWC A;  1J53 A;  2P1J A;  4KB1 A;  2EHG A;  2FC0 A;  3L3V A;  3OYH A;  2KFZ A;  2HVI A;  1RIL A;  4RW8 A;  3ZSR A;  4IDK A;  2G8K A;  3BGR A;  1HQU A;  1WN7 A;  3DOK A;  1S1X A;  2Z1I A;  4O0J A;  4ZTJ A;  4F3T A;  4Z4G A;  4EZ9 A;  3CYM A;  3L8B A;  1HYS A;  2HHS A;  4KHY A;  3NH2 A;  4AH9 A;  3LAM A;  2W42 A;  3NH0 A;  4CGG A;  1HRH A;  1NOZ A;  4CFD A;  2OZM A;  5FRN A;  3NDK A;  3OYE A;  2DFE A;  4AHV A;  4FLY A;  1RTJ A;  4AHT A;  3DLB A;  1N5Y A;  4N76 A;  3NAE A;  4H4M A;  1QE1 A;  4QAG A;  4M3U A;  3G10 A;  1KLM A;  4ID1 A;  4CJ4 A;  4DS5 A;  3ULD A;  4M3R A;  5J1E A;  3DRS A;  3PO4 A;  4B9V A;  1WAJ A;  3F73 A;  3WNE A;  4CF9 A;  4Y1C A;  3CG7 A;  2B6A A;  3OYI A;  4E7K A;  1U48 A;  4KFB A;  3MEG A;  3NF8 A;  2HHV A;  2DFH A;  1RT2 A;  1RDB A;  2Z1H A;  1QQC A;  4XIU A;  4JRQ A;  4ID5 A;  3JSM A;  3RWU A;  1F21 A;  3NBP A;  3OS0 A;  2HHQ A;  2XRI A;  3B6O A;  3RR7 A;  4FZY A;  1RBS A;  4FZZ A;  3EZ5 A;  3C95 A;  4CF2 A;  1IKY A;  1LAV A;  5CYM A;  3S3N A;  4IG3 A;  2GBZ A;  1VSM A;  4OJR A;  4ELT A;  3NE6 A;  3L2Q A;  4OKJ A;  1UOC A;  4FVM A;  4JRP A;  2OPS A;  5DMR A;  3S3M A;  1D5A A;  3LAN A;  2E6L A;  3T3F A;  1ZBI A;  2IAJ A;  4DLG A;  4OGE A;  3RMB A;  1S1U A;  4DQP A;  1RTD A;  4OKE A;  1TAQ A;  4FLV A;  4LY7 A;  3OYK A;  1SL2 A;  1QSS A;  2WOM A;  3A2F A;  3CFO A;  1C1B A;  1LWE A;  1WLJ A;  1CXU A;  1HJR A;  3HPG A;  4FW1 A;  4JLH A;  3SUO A;  4Q0B A;  1ASU A;  3DOL A;  1Q8I A;  3IAY A;  4M3W A;  3LP2 A;  3OY9 A;  4J2A A;  3VQD A;  3ZCM A;  4CF8 A;  1S1W A;  1TKZ A;  4AHC A;  4DTR A;  3ZSW A;  4DQR A;  4N56 A;  3QIO A;  3ZT0 A;  4DWI A;  4KI4 A;  1CXQ A;  3CM6 A;  4H8K A;  3KTQ A;  4CFA A;  4FJ8 A;  1KTQ A;  2ZE2 A;  1D8Y A;  3OYL A;  1JL1 A;  1WSF A;  2ETJ A;  3SI6 A;  4RW6 A;  1X9M A;  5HP1 A;  2YKN A;  4BDY A;  3P83 D;  4LSL A;  2R7Y A;  3PX6 A;  3MEC A;  3DRP A;  1FXX A;  4DFP A;  3AO2 A;  1BL3 A;  1C0M A;  1VSI A;  3V81 A;  3RRG A;  3TAP A;  3ZSQ A;  2B5J A;  4ELU A;  3NF6 A;  4BE0 A;  1ZBL A;  4DFJ A;  3OYJ A;  4C8K A;  4KHS A;  3KLI A;  2OPR A;  1CLQ A;  3V9X A;  4DU1 A;  1XHZ A;  4CJ5 A;  3SV3 A;  1QTM A;  4FM2 A;  1CZB A;  3NGZ A;  4ZTF A;  4FLW A;  4CES A;  3ZSO A;  2A1S A;  2YNI A;  3TAQ A;  4FLU A;  1WSE A;  3TR8 A;  1REV A;  1W9H A;  4CF1 A;  2A1R A;  1GOB A;  2P5O A;  3L3U A;  4B8C A;  2VWJ A;  4ZHR A;  1S1V A;  3P5J A;  3LP0 A;  4N47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...