1KVCA

E. coli ribonuclease hi d134n mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCNELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE H
total genus 53
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvcA00
2JGUA 1S1UA 2YHBA 3AO5A 2A1SA 1IKWA 1S6QA 3VQCA 3C6TA 3ZSRA 3D0PA 3ZSXA 3HT3A 2OYQA 3SQ4A 3SPYA 4FYDA 2YNIA 3HVTA 4CGDA 3PX4A 3M8PA 3ZT0A 3RWUA 3DMJA 4DTXA 4CJ4A 3OS1A 4KB0A 3ZT1A 1X1PA 4DTJA 1NOZA 3VA0A 4E7HA 1SKSA 4HVJA 1ZBLA 1RCHA 3AVKA 4HUEA 1LWEA 2KZMA 1G15A 4FJ7A 3RRHA 4LSLA 4BWMA 3TAEA 1J53A 1WLJA 1Y97A 3QEXA 3OYCA 4C8KA 4CE9A 3G10A 3DI6A 3SQ2A 4F3OA 4CGFA 4CERA 4BWJA 1C1AA 3OYEA 1SL1A 1NK0A 2HB5A 2VG6A 3LZIA 3V4IA 1A5XA 2HW3A 4RW8A 1ASUA 3CYMA 2Y1IA 4I9LA 1SKRA 2KFNA 1WSGA 4QCLA 1HQEA 4Y1DA 4CEZA 3IS9A 3CFRA 3RMBA 1L3SA 4CJ3A 4DSEA 3PO5A 4J2EA 3LP1A 4CK1A 1RTJA 2ZQBA 3E01A 3K57A 4CJSA 4RG8A 4CIEA 2RKIA 3SNNA 1WAFA 2HHUA 1RT5A 3M8QA 1X9MA 1RTHA 3NF6A 4FLTA 1Z25A 4B8AB 3SZ2A 1RBUA 3QLHA 3TABA 4FK0A 4NCAA 3LP3A 3THVA 3BGRA 4AH9A 3HL8A 1N5YA 1S9GA 3QIOA 4CFAA 2OPPA 3ULDA 1EXQA 2KQ2A 5HRRA 4O5BA 3DM2A 3SUQA 4PY5A 1D5AA 2Q3SA 3KLFA 3NGYA 3F9KA 3ZSWA 4FJKA 4KI6A 4E1MA 2G8IA 1TKTA 1VSIA 2Z1IA 2D5RA 3QETA 3KTQA 2VG7A 3IG1A 3C95A 3T19A 3QNOA 3ITHA 1Q9YA 1YTUA 1KCFA 1NK4A 4E1NA 4FM0A 1TK0A 2B5JA 1GOAA 1WNSA 1DLOA 1BGXT 3JYTA 1LW2A 4B9VA 3KK1A 3SPZA 4Z4GA 1RDCA 3PX6A 4FJ8A 3RMCA 4CJEA 3SQ0A 4Z4CA 2PY5A 2HVIA 4FJLA 2XHBA 3RMDA 1T05A 2Z1GA 3CM5A 1HNIA 1C0MA 3HK2A 3O3GA 4NCBA 3ZSZA 4BDYA 3TAFA 4CIFA 3OS2A 3SJJA 3HPHA 2XY5A 4PUOA 4B9NA 2A1RA 3U3GA 1B9DA 1T7PA 1TKDA 1S5JA 3L2VA 3HVRA 4DQSA 4FJ9A 1O1WA 5J1EA 1VSHA 2B4JA 5KRSA 3L2QA 2G8FA 4CF9A 1W9HA 4Z0UA 3A2FA 1JLCA 5KGXA 2OPRA 4EZ9A 4OLBA 1BI4A 4ID1A 3HPOA 3AVGA 4JLHA 1U04A 5HRPA 4DF4A 4FM2A 1KVBA 1JLFA 1TV6A 3MEEA 3MXIA 1ASWA 1NJWA 4BDZA 1DTQA 4E0DA 4I2PA 3LP0A 3V9WA 4FJJA 1Q9XA 2YV0X 3LAKA 4O0JA 2BGGA 1LAVA 2JLEA 2FBYA 4KB1A 2XY8A 4N76A 4CEQA 2KTQA 4OJRA 2ATQA 3NF8A 4DFJA 3MXMA 3BDPA 5FRMA 3TAGA 4DQPA 4NYNA 4E7KA 4LH4A 2WONA 1WSIA 4FLYA 1CXQA 2HHSA 4Z4IA 4AHSA 3TI0A 3WNHA 3L2UA 2EHGA 4IFVA 1C0UA 4LD0A 2RPIA 4CHOA 4YFUA 1KTQA 3QEIA 1JLAA 4KTZA 4KI4A 2XY7A 4M45A 3ZSQA 4M3XA 4B9LA 3U6FA 4FW2A 2Z1HA 4DQQA 4ICLA 1LV5A 4C8LA 3AVCA 1KFSA 3DLBA 3S3NA 3AVBA 4DF8A 1IKYA 3VQ8A 2R7YA 4CGGA 1NK5A 1VSEA 4FK2A 2QXFA 2Y1JA 4I7FA 1N6QA 4O0IA 4OPJA 3VQEA 4HUGA 1X9SA 2YNHA 3SCXA 4RW9A 3TARA 3TR8A 4KFBA 1NKEA 4KHYA 1A5VA 1KLMA 2IS3A 3WNEA 3DLRA 3VQPA 4AHVA 1L3UA 1HJRA 4DU4A 1TVRA 3V1QA 4DLGA 1T8EA 1XI1A 1RBRA 4FLZA 2DY4A 1RT7A 3AV9A 2IAJA 1KVCA 1WAJA 3AA4A 3KLHA 3FFIA 3OYLA 4KTWA 3H08A 4F8RA 4J2DA 1U48A 3NAEA 3SV4A 4E7IA 1VSFA 3EYZA 2DFFA 4CGJA 3VQQA 3OY9A 1UOCA 4W5RA 1TL1A 3DOLA 4CEOA 2HHXA 3DRPA 1ITGA 5CZ1A 3ZT4A 4Z4HA 4M3WA 2HMIA 3AO1A 3HYFA 1BI4B 4KV8A 3OYNA 5JS2A 3WNFA 4OVLA 3NDKA 3AO3A 4PWDA 1XWLA 1F21A 4C8MA 3QO9A 4CCHA 3LAMA 1RT2A 4B8CA 3VA3A 4AHUA 4ZHRA 2XRIA 1REVA 3V9SA 1BQMA 4PA1A 3LP2A 3VQ6A 4LSNA 3OYFA 4HCCA 3AVIA 4AHRA 4E7JA 4E3SA 4CJTA 3CM6A 3MXJA 4KKOA 1XHZA 4FZZA 3KK2A 4F4KA 4FLUA 3VQAA 1RBSA 2E6LA 3KJVA 1ZYQA 2O4IA 1LWFA 3OYDA 3HJFA 2HHWA 1VSDA 4CJWA 2HHVA 4HHTA 1B9FA 3VQ7A 5HROA 2X6SA 1RBVA 4DLEA 4OPKA 2KW4A 1K6YA 1VSMA 1NKBA 3RR8A 3KIOA 2YNGA 3C6UA 5I3UA 1QTMA 3ASMA 4CK2A 3V9UA 2O4GA 3KKSA 4R5PA 4N56A 3OYHA 3HSTB 1YVUA 1FXXA 4IDKA 3OJSA 4I9QA 3PV8A 1SL0A 1T03A 1NK8A 2HHTA 4DSIA 1TK8A 5KTQA 3NH1A 3SUNA 4OGCA 2OPQA 3C94A 2P5GA 3ALYA 1RT4A 4H4MA 2X74A 4EP4A 4EZ6A 4H8KA 4KHUA 3AVLA 2HNZA 4CHNA 4ELVA 2HNDA 4ZTJA 3F73A 2IGIA 3UIQA 4JRQA 3NF7A 4OKJA 3VQ5A 2PYLA 2F96A 1QE1A 3B6OA 2FC0A 3P1GA 3AVMA 3L2RA 4CHPA 3K5NA 3K5LA 1RDDA 3SYZA 3QEWA 3SUOA 3DLHA 3I0RA 3V1OA 4Q5VA 4FLWA 3ZCMA 1QSSA 4QOZB 4K8XA 1ZBIA 4BACA 4B3OA 3K59A 3KK3A 3LANA 4NCGA 1JLBA 4OKEA 1JL2A 4M3TA 4O55A 4GMJB 5J2QA 1QSYA 4DTMA 4BDPA 1CZ9A 1RT1A 4ELTA 4CHYA 3D45A 2YKNA 3MEDA 1ZBFA 4HTUA 3OS0A 4DU1A 4F3TA 3QESA 1KFDA 3HXMA 4RW7A 1J54A 2FBVA 3ZSOA 3NGIA 3B6PA 4FLVA 2IDOA 1ZBUA 2BE2A 1HYZA 3TAQA 3M8SA 3V9ZA 4DS5A 1SKWA 3AO4A 4FJMA 1VK0A 4FZXC 4CF2A 1UWBA 1ASVA 4FW1A 4M3UA 3L3VA 4E7LA 4FJGA 3V9XA 1QQCA 1TGOA 4IKFA 1VSJA 1LAWA 1IKXA 5T7BA 3QINA 4Q0BA 3HP9A 3LWMA 4KREA 4O44A 4DS4A 4KPYA 1HNVA 3DOKA 3DLGA 3OYKA 3QIPA 1L5UA 1YT3A 3MAQA 1DTTA 4CK3A 3IRXA 3EZ5A 3L8BA 2DTUA 2D0AA 2G8HA 4B9TA 3VN5A 4DTRA 2IOCA 3LPUA 2EX3A 5HP1A 4YNQA 2G8VA 2GUIA 3KD5E 1RDBA 4TSXA 4IG3A 1S1TA 3MECA 3P5JA 5FDLA 3P83D 4NYFA 4CGHA 4DTSA 4GVMA 3O3FA 3TAPA 4KHNA 2W42A 4AHCA 4CFCA 3TANA 4BE1A 1UA1A 4KHQA 4KO0A 2QKBA 1UAXA 3DRSA 5CY4A 4FJXA 4CJ5A 4CF1A 4M3ZA 1D9DA 1J9AA 3T3FA 4OLAA 3O3HA 1RBTA 1JLGA 3HP6A 1VSLA 5EU7A 3CFPA 4J2AA 2G8UA 1HRHA 4CJKA 4J2BA 1RT3A 4CJQA 1WN7A 3I0SA 3QEPA 2G8KA 4DTNA 2HNYA 4FZYA 3L3UA 3PY8A 4FJNA 4MFBA 4N41A 2F8SA 4C8OA 3CQ8A 4W5TA 3OJUA 4CIGA 1NOYA 4K8ZA 1VRTA 3V81A 4DTPA 3JSMA 2YNFA 4CFBA 3IAYA 4ID5A 1BIUA 5KI6A 1B92A 3LZJA 3ISNC 1XHXA 3TWHA 1NKCA 4Y1CA 3AA3A 1U49A 3CG7A 4AILC 5KGWA 3K5MA 2VG5A 1JLQA 3LALA 4CF0A 3RRGA 2BANA 4JRPA 3ZT3A 3HPGA 4CJPA 5HRNA 3NH0A 4B9SA 1C1CA 1IH7A 2ZE2A 1HYVA 4N5SA 2X78A 1C1BA 1LWCA 2OZMA 3TAMA 3DLEA 3U3YA 1HYSA 1JL1A 4W5NA 4OGEA 4IBNA 2VWKA 1U47A 4DMNA 4LY7A 1TAUA 1BCMA 2Z1JA 3AVNA 4DSFA 4FLXA 4DSJA 1QS4A 1A5WA 1W0HA 1WSHA 2FBXA 4KRFA 1XC9A 4C8NA 3RTVA 3AA2A 4DTUA 4DWIA 3NH2A 3KLEA 4CJFA 1S1VA 4KTQA 2B6AA 3QNNA 5DMRA 1QHTA 2RF2A 4CESA 5J2PA 5FRNA 4JS5A 3LDSA 1CXUA 3DLKA 1JXEA 1C6VA 1GOBA 1RTIA 3AVAA 4B08A 4DU3A 3VQ9A 4Z4FA 3T1AA 4H4OA 4FXDA 1I3AA 3AVJA 1EP4A 3LWLA 4L8RB 3NCIA 1D9FA 3RMAA 3NBPA 1FK9A 4DQRA 1Q8IA 3ZSYA 3I8DA 3ZT2A 2OA8A 4CJVA 4W5QA 2PYJA 4RW4A 3K2PA 1R0AA 1S9EA 2YHAA 4DFKA 3AA5X 3S3MA 2QKKA 4BE0A 3OYBA 3S9HA 4BE2A 1JXBA 2OPSA 3AVHA 5SZTA 5JS1A 3K5OA 3VQ4A 3ZSVA 1NJYA 4PQUA 2D0BA 4M41A 1KRPA 4CJLA 1WSEA 1TAQA 1CZBA 1BHLA 2P51A 3LPTA 3O4NA 4CJUA 3M8RA 1IKVA 1BISA 3VQBA 1HMVA 2X6NA 3DRRA 1VSKA 3HM9A 1TKZA 4CEDA 1WSJA 3QEVA 3OVNA 1HPZA 4CHQA 5J2NA 1SL2A 2YKMA 5C42A 4UQGA 3CFOA 3NFAA 1X9WA 5E41A 1RTDA 3RR7A 1YTAA 3L2WA 1NJXA 5D3GA 2LSNA 4LH5A 5C24A 3NHGA 4M3RA 2OZSA 3G0ZA 3OYJA 1GOCA 4IG0A 2I5JA 3PUFA 4Z4EA 4B9MA 4FJIA 1BL3A 3OYMA 5CYQA 3SUPA 1D8YA 1HQUA 1J5OA 3SQ1A 2ETJA 3NF9A 4HUFA 2G8WA 3PX0A 4DSKA 1RILA 4CEBA 4F2SA 1LW0A 4KHWA 1CLQA 4ZTFA 5KRTA 3EY1A 1TK5A 5K14A 1WSFA 4M42A 4CEEA 4FM1A 3O4QA 2PZSA 3SV3A 4N47A 3V6DA 2IC3A 3OYIA 1KSPA 1NK7A 4DFMA 2P5OA 1JLEA 5HRSA 1S1XA 2GBZA 4CEAA 5C25A 1RNHA 3MEGA 1S6PA 1EETA 3KLIA 4CECA 2XO7A 3KD1E 2WOMA 4CHZA 1U45A 1ZBHA 5CYMA 1MU2A 4CFDA 3KLGA 1L3VA 3HO1A 2KFZA 2AJQA 4G1QA 4E89A 4JS4A 1TKXA 2KZZA 4FJHA 4FVMA 4AHTA 1QSLA 1FKOA 4KHSA 1BQNA 3OYAA 1NK9A 5I42A 2E6MA 4GW6A 1VRUA 4E19A 4EP5A 2F8TA 2QK9A 4DTOA 1FKPA 2DFEA 2BDPA 4DQIA 1TL3A 4CGIA 5SWMA 1NK6A 5HBMA 5CZ2A 1IG9A 4W5OA 1BCOA 3KKRA 2GV9A 1UA0A 2D0CA 4CEFA 2E4LA 1IO2A 4DFPA 1EKEA 4FK4A 4MQ3A 4KAZA 4CJRA 1RDAA 2NUBA 1L3TA 1SUQA 2XY6A 4B9UA 3AO2A 4FJ5A 2HVHA 1C0TA 1SV5A 2ITGA 4FCYA 3PO4A 4O4GA 3V1RA 2ZD1A 4WE1A 3SI6A 3S3OA 2HHQA 4DSLA 3WNGA 3K58A 4QAGA 1U4BA 1EX4A 1Z26A 3VQDA 1KVAA 4RW6A 1NJZA 3QERA 3NGZA 5FROA 1KLNA 2VWJA 2P1JA 4XIUA 3NE6A 2DFHA 4CF8A 4ELUA 4HCBA 1BIZA 1RT6A 2FBTA 3OYGA 3DYAA 5DK5A 4OKKA 1S1WA 5J2MA 4I2QA 4DG1A 3AVFA 5HLFA 4F2RA 4M3YA 2RN2A 1I39A 1JKHA 4IFYA
chains in the Genus database with same CATH superfamily
3CCRN 2YHBA 4WQ4C 2A1SA 3ZSRA 2FF3B 3HVTA 3H45C 3PX4A 3W3DA 3DMJA 4KB0A 3VGLA 1X1PA 4CZEA 3VA0A 1Q82O 1ZBLA 1RCHA 3T7ZA 5EX5A 2E2NA 4FJ7A 4MDBA 4EAHD 1KAXA 5JVGL 4JKCA 3FZLA 1J53A 1Y97A 4FWOA 4IFEA 4CERA 4BWJA 1C1AA 1NK0A 1A5XA 3CQXA 4I9LA 3EE9A 4CEZA 3CFRA 1L3SA 1HNXK 4CK1A 4JKBA 3K57A 4CJSA 4RG8A 4CIEA 1QVGM 1GLDG 4FPBA 1RTHA 5M1PA 3NF6A 5BRHA 4FLTA 3LP3A 4YOVA 4BRHA 3BGRA 2KQ2A 5EY4A 5HRRA 4O5BA 3G4SN 2ZJRL 2Q3SA 3ZSWA 2HOEA 4E1MA 5MLCQ 1TKTA 2Z1IA 4DUZK 3C95A 1YTUA 4FM0A 1BGXT 3SPZA 3U4LA 1RDCA 2PAVA 5JLFA 3SQ0A 4FJLA 2YCHA 3ZSZA 3OS2A 4LF8K 2ZJPL 3WXJA 3HPHA 2XY5A 4PUOA 4B9NA 2E2OA 2AP1A 1T7PA 3P31A 5JICA 1VQKN 1VSHA 5KRSA 4JD2A 4M7YA 3J7YP 1JLCA 2OPRA 4EZ9A 3HPOA 4PL8A 4FM2A 4ILJA 3MEEA 4DR6K 3MXIA 4E0DA 3LP0A 1Q9XA 3MK6A 3LAKA 2HF3A 1JCGA 1LAVA 2FBYA 1YVNA 2HHHK 2KTQA 3CCSN 3VOVA 3NF8A 3MXMA 4FWKA 5FRMA 3TAGA 4MO5A 4KHPK 2I7PA 1VQ7N 3W0LA 5BPNA 4FLYA 4FL9A 4AHSA 3VENA 3H1QA 4K43A 4A57A 5LJWA 2BH1A 3MN5A 1C0FA 4WCEL 1KTQA 2XY7A 3ZSQA 2VQEK 1OKJA 4M3XA 3CHWA 3U6FA 1VQNN 4DR2K 3KVGA 3P39A 4DF8A 2NLXA 1NK5A 1VSEA 3F2KA 4I7FA 3VQEA 4RW9A 4KFBA 1A5VA 3KZBA 4ISEA 1WBDA 1L3UA 4GKJK 2OTLN 5BPMA 3TTFA 1YITN 1RT7A 1WUAA 3AA4A 4U7BA 2UXDK 4B1WB 3NAEA 3BP8A 4CGJA 3ATVA 3DRPA 3N4QA 2HMIA 1BI4B 1Z6RA 3SBTA 1GLEG 5I9EB 1RT2A 2XRIA 1REVA 4NO7A 4FOEA 1BQMA 3VQ6A 4LSNA 4E7JA 3MXJA 4LFBK 2Q36A 4FLUA 1RBSA 4DB3A 1LWFA 4FO0A 2QWNA 3OBWA 3CMAN 3H3OB 3K9JA 1K6YA 3ASMA 2O4GA 3KKSA 4R5PA 3OJSA 3HSTB 1YVUA 3PV8A 2HHTA 3NVKA 2QTDA 5KTQA 1TK8A 3SUNA 3AAQA 3SMSA 1IBLK 3CCEN 4CJ7A 2HBLA 3I8BA 3A8YA 4CBXA 3NF7A 1T8EA 1QE1A 3L2RA 4JI1K 4IEIA 4FLWA 4B1YB 3ZCMA 4QOZB 3WXIA 4H0PA 1Q7YO 5ELZA 4M3TA 1NGGA 4DTMA 1BUPA 4A59A 3R6MA 1TUYA 1T3VA 2PBDA 3P38A 3NGIA 2NRTA 4BRIA 2BE2A 3TAQA 4LF6K 1SKWA 4CW7B 4FJMA 2UUAK 3O08A 5M1NA 1ASVA 3QDKA 4FW1A 3L3VA 4E7LA 4FJGA 3A5MC 1XQSC 3GG4A 1HNVA 5GAEP 2CGJA 3DLGA 1L5UA 5IWAK 1DTTA 5F2RA 2A5XA 3MAQA 4B9TA 1BG3A 2IOCA 4AM6A 4YNQA 2G8VA 1RDBA 5ADXA 4H5NA 4NYFA 1Q86O 4FSVA 4AHCA 2QA4N 4BE1A 5CE3A 3DXMA 4CJ5A 4A5BA 1D9DA 2A40A 2V7YA 4BR9A 1VSLA 2YI1A 5EU7A 3THYA 3CPEA 1EO1A 1WN7A 3I0SA 4FJNA 1J6ZA 3PY8A 4OO1J 4MFBA 3CQ8A 3LDOA 5AZJB 1VQ4N 4Y1CA 3AA3A 2E2PA 1SAZA 1U49A 3CI5A 3BY5A 3ZT3A 4CJPA 1IH7A 3GOIA 1HNWK 4N5SA 1LWCA 3U3YA 1FW6A 5C2FA 3AAPA 4IBNA 4NLCA 2VWKA 4I6MB 5AQHA 4DMNA 3WQUA 4QS8A 3AVNA 2Q97A 1WSHA 4MDAA 1XC9A 3RTVA 3NH2A 1S1VA 3QNNA 5E26A 5FRNA 3I33A 1C6VA 1T6DA 3AVAA 4CZGA 3T1AA 4FXDA 3HI0A 2NRWA 3RMAA 4DV1K 4DQRA 4IOCL 3ZSYA 3I8DA 1LOTB 4FWSA 1S3XA 4KH5A 3K2PA 4DV2K 3S3MA 3AA5X 1NGDA 5AQGA 3EEQA 2QKKA 3OYBA 4YOUA 3S9HA 4BE2A 4B3MK 2OPSA 3K5OA 4KH6A 3OW2M 3FR0A 2D0BA 3LM9A 4H0XB 1BHLA 3M8RA 1IKVA 1HMVA 5LMUK 1TKZA 1WSJA 5J2NA 3I56N 4UQGA 2H3GX 1RTDA 2O8BA 3L2WA 1NJXA 5D3GA 2GELA 2E8AA 4M3RA 3G0ZA 1QHAA 1GOCA 3G25A 4IG0A 5M1QA 4LF5K 1VQLN 2VGMA 3OYMA 2QWPA 1HQUA 4HUFA 3KK7A 3T1YK 1CLQA 4CEBA 1LW0A 4B3RK 3O9QA 4ZTFA 5KRTA 3CJ9A 3D2FA 5K14A 4FM1A 3O4QA 5AQMA 3V6DA 2IC3A 1KSPA 1HKGA 1NK7A 4DFMA 4DR1K 1N33K 2D4WA 3AY9A 2XO7A 4DV7K 4XH5A 1MU2A 4UY8O 4G1QA 4E89A 4JS4A 4WQ5C 3G6EN 1QSLA 4B3SK 3DAWA 1NK9A 2E6MA 4YOXA 2DFEA 4CD1A 2BDPA 3PSIA 5AQKA 4JI7K 4BC2A 5CZ2A 4M63C 3KKRA 2GV9A 3UB5A 4JKGB 4CEFA 2E4LA 3BZKA 4FK4A 4MQ3A 4KAZA 4CJRA 3R1XA 2GWJA 3VGKA 4FJ5A 2ITGA 4Z94A 3S3OA 2ZD1A 3SI6A 4XH4A 4G9ZA 4CVNE 2QWRA 2W41A 3QERA 3NGZA 5FROA 3KWIA 2P1JA 4XIUA 4DKWA 2DFHA 1RT6A 5KPTA 3PIPL 2ASOA 5AQIA 4I2QA 3AVFA 4WFAL 4B1XB 1JKHA 2VWBA 3D0PA 3FZKA 5C15A 3HT3A 2OYQA 1YF5L 3SPYA 2YNIA 4A2AA 3B8AX 4CGDA 3WEEA 3ZT0A 3LM2A 4CJ4A 1EWRA 1NOZA 3HOTA 3WEEB 2ASMA 4MLHA 3QEXA 4C8KA 4CE9A 5F0XA 4F3OA 4H0OA 3D2EA 4BRQA 3LZIA 3CYMA 2KFNA 3J8AA 4QCLA 4Y1DA 2P9NA 4CJ3A 3LP1A 2ZQBA 1BA1A 2RKIA 1QQOA 3Q7BA 4B8AB 3QLHA 3O9TA 3TABA 3U9ZA 3THVA 1N5YA 3CXCM 3HL8A 1EXQA 3E9OA 2D1KA 4DV0K 4BRFA 3FZMA 4KI6A 3F9KA 2G8IA 2YX6A 3L6QA 2W6KA 3KTQA 1Q9YA 1KCFA 1NK4A 1YAGA 1TK0A 2B5JA 1WNSA 3JYTA 1LW2A 4B9VA 4FJ8A 5GIPA 5GINA 2XHBA 2Z1GA 3CM5A 1C0MA 2P9UB 1HR0K 2OTJN 4NCBA 4BDYA 4CIFA 2P9KB 3SJJA 1X3MA 1B9DA 2P9PA 2P9SA 2YHYA 1TKDA 4DR7K 4H03B 4FJ9A 1O1WA 2HBJA 4BR0A 3L2QA 2G8FA 4H0YB 5FLXO 4Z0UA 4H5TA 1BI4A 3WUHA 4ID1A 1OVQA 5AZIB 5HRPA 1U04A 2ZM6K 1TV6A 2CGKA 5AJ3K 4DHYA 4FJJA 1TYQA 3F9MA 2BGGA 4O0JA 3ZX0A 1NNEA 2XY8A 3L0QA 1QVFM 4NLBA 2ZGYA 3S41A 1NGAA 4DFJA 3CF5L 3BDPA 4B1UB 5EVZA 4NYNA 1KQSM 3TI0A 1NMDA 2EHGA 3EE8A 3F5TA 1JLAA 4YOYA 4B9LA 4JNEA 1EWQA 4ICLA 3CPWM 3ZLJA 3MCAB 4DV6K 3D7EO 1QQNA 3AVCA 1KFSA 4C8LA 1JCFA 4BRPA 4MO4A 3AVBA 1IKYA 2GWKA 1GLLO 1IG8A 4M7XA 4O0IA 4BRGA 4HUGA 2YNHA 1CZAN 5AQUA 3WNEA 3DLRA 3VQPA 4AHVA 2GX9A 4JEPA 1TVRA 3V1QA 4DLGA 1M90O 3CJ7A 2DY4A 3AV9A 4NXMK 2IAJA 3LL3A 4V19S 1WAJA 3KLHA 5BR8K 3FFIA 1ZC6A 1HKCA 1NG9A 3EZWA 3IUCA 3TPQA 5F1XA 2DFFA 1GLCG 4W5RA 1TL1A 3ZT4A 3IFRA 5CZ1A 2WTUA 4YHHK 2JWKA 3AO1A 4KV8A 4OVLA 1XWLA 3LAMA 5AQWA 4B8CA 4JI4K 3LP2A 1BA0A 4WQ5A 4BQLA 3CCJN 4HCCA 1XHZA 1MWMA 2HBMA 3KJVA 2E6LA 4IDHA 4I6MA 1NLVA 3HJFA 5HROA 4BR5A 1RBVA 4OPKA 3KIOA 1QTMA 3C6UA 4N56A 2UUCK 4IDKA 1SL0A 1T03A 3NH1A 2QWOA 2P5GA 2OPQA 2F4VK 4H4MA 1ATNA 4EP4A 3VEYA 4KHUA 2IIRA 2E1ZA 1N36K 1SS6A 3TSPA 2ZWHA 3DXKB 2PYLA 4JKAA 3AVMA 4YORA 4JK7A 4Q5VA 4K0KK 3VPZA 5C12A 1ZBIA 3I55N 1WB9A 3K59A 1BDGA 4GMJB 1CZ9A 1G99A 2AA4A 2P9UA 3D45A 4DU1A 3OS0A 4F3TA 2DPNA 1KFDA 3HXMA 2ASPA 4RW7A 2FBVA 5AQOA 4IO8A 2FLOA 4HWIA 4HTLA 1UWBA 3CMEN 3V9XA 1QQCA 2D0OA 1TGOA 4IKFA 1QQMA 1LAWA 3LWMA 3ZX2A 5HL7L 4BC5A 3DOKA 2FF6A 3QIPA 4WFBL 4CK3A 3VMFB 3AGKA 1NGCA 4U67L 4BY9C 2DTUA 3H46O 4GV6A 3VN5A 5HP1A 3KD5E 1S1TA 3MECA 3QBWA 1BWFO 4DTSA 3ZEUB 3WXLA 4CFCA 1WBBA 1UA1A 1UAXA 1J9AA 3T3FA 4OLAA 4DCHA 3O3HA 3HP6A 1HNZK 3M1FA 3D2FB 2G8UA 1HRHA 4CJQA 5TKYA 3QEPA 4FZYA 3L3UA 1HPMA 1NOYA 4FVUA 4K8ZA 4JKGA 1VRTA 4EHUA 4ID5A 3TWHA 3LZJA 3ISNC 1XHXA 4CZLA 1Q18A 4AILC 3QB0A 1HKBA 3K5MA 2VG5A 1OH8A 2UXCK 3E1YA 1IV0A 2BANA 3VGMA 5HRNA 1T44A 4B9SA 3HBTA 1C1CA 5AFUA 1HUXA 3L4IA 3O9SA 3DLEA 5BPLA 5A2QO 2YHXA 2KKZA 1U47A 2Z1JA 1VAZA 4DSFA 4DSJA 1QS4A 4C8NA 1KXPA 3AA2A 3KLEA 5KQ8A 4CJFA 3BF1A 4KTQA 2P9LB 4CESA 1X9JA 4JS5A 1JXEA 4DU3A 4B08A 4NXNK 2D0PA 1D9FA 1Z05A 1R0AA 3ID6A 3CC7N 1S9EA 2O8EB 4PKGA 3SAFA 4BG9A 4BE0A 1GLFO 5SZTA 3VQ4A 3ZSVA 1U6ZA 3TSUA 5AQQA 3CCVN 4JI2K 1CZBA 3D2EB 3WT0A 1TUUA 1BISA 3DRRA 1WOQA 3QEVA 4CBWA 1HPZA 1RDWX 4LC9B 2YKMA 1YIJN 3NFAA 4GNIA 3ZETA 3N4PA 4X64K 2LSNA 5C24A 4YDUA 2OZSA 3OYJA 3U9DA 4Z4EA 3PUFA 4FJIA 3THYB 1K8KB 3FZFA 3R8EA 3SUPA 3E9LA 3FFKB 5BR9A 4JI0K 5AFUH 3J7AP 2G8WA 4KHWA 3EY1A 1WSFA 1YXQA 3MN9A 4CEEA 3SV3A 4CI6A 5BN8A 4BRKA 2I7NA 4QS9A 1S1XA 2GBZA 4CEAA 1RNHA 1S6PA 1EETA 3KLIA 1FJGK 5CYMA 4CFDA 2Q1NA 1TKXA 3OYAA 2ZF5O 1VRUA 1OVYA 4DTOA 1YJNN 5SWMA 5HBMA 1IG9A 3THWB 4W5OA 4NB4A 3ENOA 4GV9A 4IXCA 1U2VB 1RDAA 1XUPO 1SUQA 2XY6A 2NRXA 5KQDA 2HVHA 4LF9K 2E20A 4O4GA 3V1RA 2HHQA 1VQ6N 1VQMN 1EX4A 3QMLA 4BRDA 1KVAA 4RW6A 3CCQN 3NE6A 4HCBA 4ELUA 4QS7A 5DK5A 3VEVA 4DG1A 5HLFA 1KD1O 4LFAK 4IFYA 3J81O 3AO5A 3NVMA 1S6QA 3C6TA 1VQ9N 2WUSA 1DGKN 3VETA 3HM8A 3M8PA 3RWUA 5DM7L 4E7HA 2A41A 4ISGA 4IEEA 4HUEA 4IJNA 4JAXA 4C23A 1G15A 1ZXOA 3Q7CA 5GAGP 1BO5O 4BWMA 3TAEA 1WLJA 1P8ZA 3OYCA 2UUBK 1YI2N 3G10A 3FGUA 2V51B 2FSKA 3MX2A 5B8HA 3OYEA 2ITMA 1SL1A 1TYQB 1XC3A 2HB5A 2VG6A 2HW3A 4BRMA 4RW8A 1WSGA 1HQEA 3RMBA 3O9UA 4J2EA 1RTJA 3E01A 3M6GA 1RT5A 5AQXA 2QWLA 1Z25A 3SZ2A 1NBWA 1RBUA 4NCAA 3JS6A 3HOSA 2O8CB 4AH9A 4DR5K 1S9GA 2P9PB 3VEZA 4CFAA 2OPPA 2QI2A 3DM2A 4PY5A 3KLFA 3T1HK 4FJKA 4LF4K 3QETA 2D5RA 2VG7A 4FWNA 5M1FA 3ITHA 3QNOA 2YJFA 2ZJQL 4WYBA 4A62A 1DLOA 3ENBA 4Z4GA 4FWPA 4IWVA 3RMCA 5LMNK 1V4SA 2PY5A 2NRVA 3K9KA 1T05A 2E2QA 1HNIA 4JKEA 3DWLA 3MWPA 2A1RA 3U3GA 3MMVA 1S5JA 3L2VA 1S22A 1BU6O 4DQSA 4CF9A 1W9HA 5IT9O 3JXUA 5KGXA 5BRFA 4B1ZA 4JLHA 4DF4A 1NGEA 3VTHA 1NJWA 3SJHA 1DTQA 3O6WA 2YV0X 1ILYA 4ISFA 4PKIA 2UXBK 4OJRA 2ATQA 3M3ZA 4DQPA 4IJAA 4LH4A 2WONA 1NGFA 1CXQA 2HHSA 4Z4IA 3FZHA 5LJVA 3O1BA 4EHTA 3GL1A 4BR7A 1U2VA 2RPIA 4KI4A 1YUWA 3NMUA 3VEOA 2Z1HA 1GLJO 3UKRB 2EWSA 1LV5A 1GLAG 4K42A 4FPAA 3VQ8A 4BR4A 2R7YA 4CGGA 4CZFA 4CZJA 2QEXN 1N6QA 1YHQN 1NKEA 3SCXA 4KHYA 1HJRA 3CCUN 1E3MA 1W97L 2IVNA 3QBXA 1XI1A 1RBRA 3ULEA 1XMQK 5C10A 4MLEA 4KTWA 3H08A 3BEXA 4F8RA 4J2DA 4IO9L 1U48A 3KHYA 2O8FB 4E7IA 1VSFA 2O8DA 3OY9A 2P9IA 4JK9A 1UOCA 3ULEB 5AQPA 4YOWA 4DR4K 4M3WA 3OYNA 5GIOA 4E7KA 3NDKA 5JS2A 3WNFA 3L4QA 3AO3A 1F21A 1N34K 5JLHA 4CCHA 3R3LA 3UKUA 3CQYA 4H5RA 5AQNA 2V52B 4PA1A 3ZYYX 4LFCK 4B9QA 3AVIA 4CJTA 4KKOA 4FZZA 4F4KA 3TU5A 3C0BA 3VQAA 2O4IA 1ZYQA 3OYDA 2HHWA 1VSDA 4CJWA 3THXA 2HHVA 3VQ7A 3U8XA 2X6SA 3CCLN 3VEWA 4DLEA 3RR8A 1VSMA 1KC8O 4JI5K 2YNGA 5I3UA 4CZHA 5LL6Z 1R59O 3ID8A 4I9QA 3RVCA 1NK8A 3CJ1A 2O8CA 5KPZA 1IBKK 3C94A 5AQLA 1K9MO 1E4FT 1RT4A 4H8KA 1KAZA 3AVLA 2HNZA 4CHNA 2HNDA 4ZTJA 2NRZA 4R79A 3UIQA 2QXLA 1NGBA 3VQ5A 5CR4A 3B6OA 2FC0A 5KPRA 3QEWA 3K5NA 4DV5K 1XNQK 1RDDA 3V1OA 4DQ8A 3CC4N 2VGNA 1K73O 4K8XA 4B3OA 3C65A 3LANA 4OKEA 1JL2A 4A61A 4O55A 5J2QA 2CH6A 3LDQA 1QSYA 1YJWN 4OPAA 4CHYA 4HTUA 1ZBFA 1DKGD 3DLLL 2FXUA 1J54A 4FLVA 4IZ9A 2QWMA 1HYZA 3PSFA 3V9ZA 4DS5A 5JVHL 2P9NB 4M3UA 3DXMB 1IKXA 4CZMA 4B3TK 3HP9A 4Q0BA 4KREA 3BF3A 4DS4A 4J8FA 3GDQA 3OYKA 3O9RA 3EZ5A 4DTRA 3LPUA 4AM7A 1GLBG 2GUIA 1JCEA 5FPDA 4IG3A 4YY3K 3P5JA 4XEIA 4CGHA 4GVMA 3TAPA 4KHNA 3TANA 4KHQA 2QKBA 3CD6N 3DRSA 1JLGA 2NZTA 3CFPA 4J2BA 1RT3A 4RCHA 4XH1A 2G8KA 4N41A 2F8SA 4C8OA 4W5TA 4BVPA 3OBYA 3OJUA 4KBOA 1X3NA 3VF2A 5KI6A 1Q81O 1NKCA 3TTCA 5KGWA 4B1VA 1NU0A 3LALA 3RRGA 4JRPA 3HPGA 3O80A 2ZE2A 1HYVA 4CD3A 1C1BA 2OZMA 1JL1A 4W5NA 4OGEA 1S72N 5AZIA 3C6HA 1MA9B 3OHRA 5C0YA 1TAUA 1BCMA 4FLXA 1A5WA 4KRFA 4DTUA 3AGRA 5DMRA 1QHTA 5J2PA 3LDSA 3O5BA 4L3QA 4Z4FA 3R9PA 4H4OA 1I3AA 3AVJA 5GAHP 3LWLA 5AQTA 3VF4A 4L8RB 1FK9A 3C7NA 1Q8IA 3UKUB 2PYJA 2GEMA 4EIAA 2P9SB 4DR3K 1JXBA 3QFUA 3AVHA 2HF4A 5JS1A 1NJYA 4PQUA 4M41A 1VHXA 4JI3K 3THXB 4CJLA 4CJUA 3O4NA 2OCEA 3VQBA 1BOTO 1VSKA 4X62K 3H3NO 4CEDA 3OVNA 5AZJA 4CHQA 5C42A 3RR7A 1J5EK 4IOXA 1YTAA 1T6CA 1MDUB 1RFQA 3EO3A 2QM1A 5CYQA 2A3ZA 4BVOA 2ETJA 4YDUC 3PX0A 4DSKA 1RILA 4M42A 2PZSA 2NRHA 2GUPA 1N32K 5C25A 3MEGA 3KD1E 4JYAK 2WOMA 3IDHA 4CHZA 1ZBHA 3KLGA 2AJQA 3HO1A 2KZZA 3QFPA 4AHTA 1VQON 1BQNA 3M5RA 4AQYK 5I42A 4EP5A 1FKPA 4DQIA 3A5NC 4CGIA 3ZEUA 2VCPA 5GADP 1BCOA 3SK3A 1UA0A 2VQFK 1ATSA 1NMNA 4DFPA 4BRLA 1L3TA 4B9UA 3AO2A 3GBTA 3FE1A 3H1VX 4WE1A 3HTVA 3CJBA 3WNGA 4DSLA 3MDQA 3VQDA 2CGLA 5AQSA 5CHIA 1K8AO 1KLNA 4H5WA 4BGBA 1BIZA 3OYGA 2NNWA 1S1WA 1E4GT 1OH5A 4RTFD 4DUYK 2Q0UA 4M3YA 3E9PA 1U4BA 1I39A 1N8RO 4KPYA 2HHUA 2Q0RA 2JGUA 1S1UA 1IKWA 3VQCA 4JI8K 4JD2B 3ZSXA 3SQ4A 4FYDA 3K0SA 4JKDA 1NGHA 2E1YA 4DTXA 3OS1A 3ZT1A 5AQZA 4DTJA 1SKSA 4HVJA 3AVKA 1LWEA 2KZMA 5JMVA 1H1VA 3RRHA 4LSLA 4DV3K 3RSEB 3P4IA 5AR0A 4JHDB 3DI6A 3SQ2A 1W7AA 4CGFA 2E88A 4ILGB 3V4IA 1ASUA 1JJ2M 3UKRA 2Y1IA 1SKRA 3RSEA 3ENHA 3IS9A 5FPMA 3PO5A 4DSEA 3IMXA 1XMOK 3H6EA 3D6RA 3SNNA 1WAFA 3M8QA 1X9MA 1HLUA 3MN6A 5EOYA 4FK0A 1XNRK 5H1SQ 3EKUA 3THWA 3QIOA 3VTIA 3ULDA 2RE2A 2FSNA 3SUQA 1D5AA 3NGYA 3VF6A 1D4XA 3IKMA 1VSIA 3IG1A 3T19A 3QICA 2WFBA 3T69A 3CJCA 4E1NA 1LCUA 4PL7A 1GOAA 1IBMK 3KK1A 3C6AA 3PX6A 4E1JA 2CH5A 3E66A 4CJEA 4Z4CA 2HVIA 4DV4K 1DEJA 3RMDA 4FWRA 1QZ6A 2BUPA 3HK2A 3O3GA 3TAFA 4WFNL 4O5FA 3JAMO 4BRAA 3HVRA 5J1EA 4PHTX 2B4JA 4CZKA 3A2FA 4OLBA 5ADXH 2W6LA 3AVGA 4BQZA 3BUZB 1KVBA 1JLFA 2HMPA 1ASWA 1ZBSA 4BDZA 4I2PA 3V9WA 3ATUA 2JLEA 4N76A 4KB1A 4CEQA 3VEXA 4LF7K 3CETA 1YJ9N 2UYTA 1WSIA 3WNHA 4F9OA 4BC3A 2Q2RA 3SLCA 3L2UA 4IFVA 1O13A 1C0UA 4LD0A 4CHOA 4YFUA 3QEIA 4KTZA 4M45A 4FW2A 4DQQA 3J80O 5HOOA 3DLBA 5DM6L 3S3NA 4JKFA 4O8KA 4FK2A 2QXFA 2Y1JA 1C0GA 4OPJA 2E5LK 1X9SA 3HRGA 5AQVA 3TARA 3TR8A 1KLMA 2IS3A 2O8BB 4C1NK 4JK8A 4DU4A 4FLZA 1KVCA 3OYLA 3EL2A 1ATRA 3SV4A 4FWQA 1KAYA 4H0TB 3EYZA 2OANA 3VQQA 3DOLA 4CEOA 2HHXA 1ITGA 3EKSA 3MCPA 4Z4HA 3HYFA 4PWDA 3OTOK 2P9LA 3QO9A 4C8MA 3VA3A 4AHUA 4ZHRA 3V9SA 3A5LC 3A5OC 4JHDA 4BGAA 3OYFA 4AHRA 1RGIA 4E3SA 3CM6A 4OPHA 3KK2A 3WXKA 3SAGA 4HHTA 1B9FA 3TTDA 5LY3A 2KW4A 1NKBA 2F9WA 4CK2A 3V9UA 3OYHA 1NM1A 1FXXA 3A0IX 1I94K 1DT9A 1VQ5N 4OGCA 4GV3A 4EFHA 3ALYA 3AARA 2X74A 1M1KO 4EZ6A 2P9IB 4ELVA 2A42A 3F73A 2QW9A 2IGIA 4JRQA 3CIPA 4OKJA 2F96A 3SYZA 3P1GA 3SUOA 4CHPA 3K5LA 4DSIA 4BC4A 3I0RA 1QSSA 5M1KA 3HSCA 4YOTA 4BACA 2RHKA 3KK3A 4NCGA 1JLBA 4OX9K 4BDPA 1RT1A 4ELTA 2YKNA 3MEDA 3KWGA 4IOAL 5BREA 3QESA 4JN4A 3PLAA 3ZSOA 1OH6A 3B6PA 2IDOA 1ZBUA 2F7TA 3SMPA 3M8SA 2IVPA 2UU9K 3AO4A 2J4RA 2F9TA 1VK0A 1EQYA 4FZXC 4CF2A 2FSJA 1VSJA 5T7BA 3QINA 3LDNA 5EXWA 4O44A 4H0VB 3CC2N 1YT3A 2Q31A 2KHOA 3IRXA 3L8BA 3FLCO 1NWKA 2D0AA 2G8HA 5AQYA 2EX3A 4TSXA 5FDLA 3P83D 3O3FA 2W42A 1QZ5A 2IVOA 2KLAA 4KO0A 4A2BA 5CY4A 2WC9A 4FJXA 4CF1A 4M3ZA 4K41A 1RBTA 4J2AA 4CJKA 3DXKA 4DTNA 2HNYA 3LDPA 4GVEA 4CIGA 3V81A 4DTPA 3JSMA 2YNFA 4CFBA 3IAYA 1BIUA 1B92A 3CERA 5TKWA 2O8FA 4BRCA 3CG7A 3ZETB 3C7NB 4K25A 1JLQA 4CF0A 4FWLA 1NGIA 2ZGZA 3NH0A 2X78A 3TAMA 1HYSA 5E84A 3UE5A 4LY7A 4WF9L 3ZX3A 3O8MA 3SBGA 1NJIO 1W0HA 2FBXA 4X65K 4DWIA 3EN9A 2B6AA 2RF2A 1CXUA 1GOBA 1RTIA 3DLKA 3MN7A 5AQRA 3WXMB 1RDUA 3VQ9A 1EP4A 3VERA 1SZ2A 3DJCA 3NCIA 1HX1A 3NBPA 2OA8A 3ZT2A 4CJVA 4W5QA 2QWQA 4RW4A 3MWTA 2YHAA 4DFKA 4ILHA 4A5AA 3O1WA 1Y64A 1KRPA 1NGJA 4Y0WA 1WSEA 1TAQA 4PKHA 2P51A 3LPTA 3MX5A 2YJEA 2X6NA 3G71N 2WBNA 3HM9A 2NRRA 2HSTA 3SAHA 4CBUA 4BG8A 3OA9A 4FWMA 5C2DA 1ESVA 4BRNA 1VQPN 2O8EA 4FOIA 1SL2A 1VQ8N 1X9WA 3CFOA 5E41A 4JI6K 4LH5A 3NHGA 2V7ZA 2I5JA 4B9MA 4JV5K 3WQTA 1BL3A 1D8YA 1J5OA 3SQ1A 3NF9A 2O8DB 3CJAA 4F2SA 1TK5A 2PFUA 4BREA 1MWKA 4N47A 3OYIA 2P5OA 1V4TA 1JLEA 5HRSA 4CECA 1U45A 5FPEA 3LDLA 3VESA 4KH4A 1L3VA 2KFZA 1HJOA 2GTDA 4AF1A 4FJHA 4WQ4A 4GKKK 4FVMA 1FKOA 4KHSA 4GW6A 2QK9A 4E19A 2F8TA 1P90A 3BZCA 4GY2B 5BRDA 1TL3A 3HZ6A 5AQFA 5M1OA 3GE1A 1NK6A 4RWTA 4O8UA 2BTFA 1W2BM 3O4WA 1OH7A 2W40A 2D0CA 1IO2A 1EKEA 4JKHA 5AQJA 2NUBA 3CCMN 4BROA 1SQKA 1C0TA 1SV5A 4FCYA 3PO4A 4CZIA 3PIOL 5BN9A 4BR2A 2YHWA 3TSQA 3K58A 4H5VA 4QAGA 1Z26A 1NJZA 2HBKA 2VWJA 2A6AA 2JWLA 4CF8A 2P9KA 2VYPA 2FBTA 5FPNA 3DYAA 4OKKA 5J2MA 1K8KA 3J7ZO 4C1NI 1IJJA 4F2RA 4X66K 2RN2A 3DLHA
chains in the Genus database with same CATH topology
2JGUA 1S1UA 2YHBA 3AO5A 2A1SA 1IKWA 1S6QA 3VQCA 3C6TA 3ZSRA 3D0PA 3ZSXA 3HT3A 2OYQA 3SQ4A 3SPYA 4FYDA 2YNIA 3HVTA 4CGDA 3PX4A 3M8PA 3ZT0A 3RWUA 3DMJA 4DTXA 4CJ4A 3OS1A 4KB0A 3ZT1A 1X1PA 4DTJA 1NOZA 3VA0A 4E7HA 1SKSA 4HVJA 1ZBLA 1RCHA 3AVKA 4HUEA 1LWEA 2KZMA 1G15A 4FJ7A 3RRHA 4LSLA 4BWMA 3TAEA 1J53A 1WLJA 1Y97A 3QEXA 3OYCA 4C8KA 4CE9A 3G10A 3DI6A 3SQ2A 4F3OA 4CGFA 4CERA 4BWJA 1C1AA 3OYEA 1SL1A 1NK0A 2HB5A 2VG6A 3LZIA 3V4IA 1A5XA 2HW3A 4RW8A 1ASUA 3CYMA 2Y1IA 4I9LA 1SKRA 2KFNA 1WSGA 4QCLA 1HQEA 4Y1DA 4CEZA 3IS9A 3CFRA 3RMBA 1L3SA 4CJ3A 4DSEA 3PO5A 4J2EA 3LP1A 4CK1A 1RTJA 2ZQBA 3E01A 3K57A 4CJSA 4RG8A 4CIEA 2RKIA 3SNNA 1WAFA 2HHUA 1RT5A 3M8QA 1X9MA 1RTHA 3NF6A 4FLTA 1Z25A 4B8AB 3SZ2A 1RBUA 3QLHA 3TABA 4FK0A 4NCAA 3LP3A 3THVA 3BGRA 4AH9A 3HL8A 1N5YA 1S9GA 3QIOA 4CFAA 2OPPA 3ULDA 1EXQA 2KQ2A 5HRRA 4O5BA 3DM2A 3SUQA 4PY5A 1D5AA 2Q3SA 3KLFA 3NGYA 3F9KA 3ZSWA 4FJKA 4KI6A 4E1MA 2G8IA 1TKTA 1VSIA 2Z1IA 2D5RA 3QETA 3KTQA 2VG7A 3IG1A 3C95A 3T19A 3QNOA 3ITHA 1Q9YA 1YTUA 1KCFA 1NK4A 4E1NA 4FM0A 1TK0A 2B5JA 1GOAA 1WNSA 1DLOA 1BGXT 3JYTA 1LW2A 4B9VA 3KK1A 3SPZA 4Z4GA 1RDCA 3PX6A 4FJ8A 3RMCA 4CJEA 3SQ0A 4Z4CA 2PY5A 2HVIA 4FJLA 2XHBA 3RMDA 1T05A 2Z1GA 3CM5A 1HNIA 1C0MA 3HK2A 3O3GA 4NCBA 3ZSZA 4BDYA 3TAFA 4CIFA 3OS2A 3SJJA 3HPHA 2XY5A 4PUOA 4B9NA 2A1RA 3U3GA 1B9DA 1T7PA 1TKDA 1S5JA 3L2VA 3HVRA 4DQSA 4FJ9A 1O1WA 5J1EA 1VSHA 2B4JA 5KRSA 3L2QA 2G8FA 4CF9A 1W9HA 4Z0UA 3A2FA 1JLCA 5KGXA 2OPRA 4EZ9A 4OLBA 1BI4A 4ID1A 3HPOA 3AVGA 4JLHA 1U04A 5HRPA 4DF4A 4FM2A 1KVBA 1JLFA 1TV6A 3MEEA 3MXIA 1ASWA 1NJWA 4BDZA 1DTQA 4E0DA 4I2PA 3LP0A 3V9WA 4FJJA 1Q9XA 2YV0X 3LAKA 4O0JA 2BGGA 1LAVA 2JLEA 2FBYA 4KB1A 2XY8A 4N76A 4CEQA 2KTQA 4OJRA 2ATQA 3NF8A 4DFJA 3MXMA 3BDPA 5FRMA 3TAGA 4DQPA 4NYNA 4E7KA 4LH4A 2WONA 1WSIA 4FLYA 1CXQA 2HHSA 4Z4IA 4AHSA 3TI0A 3WNHA 3L2UA 2EHGA 4IFVA 1C0UA 4LD0A 2RPIA 4CHOA 4YFUA 1KTQA 3QEIA 1JLAA 4KTZA 4KI4A 2XY7A 4M45A 3ZSQA 4M3XA 4B9LA 3U6FA 4FW2A 2Z1HA 4DQQA 4ICLA 1LV5A 4C8LA 3AVCA 1KFSA 3DLBA 3S3NA 3AVBA 4DF8A 1IKYA 3VQ8A 2R7YA 4CGGA 1NK5A 1VSEA 4FK2A 2QXFA 2Y1JA 4I7FA 1N6QA 4O0IA 4OPJA 3VQEA 4HUGA 1X9SA 2YNHA 3SCXA 4RW9A 3TARA 3TR8A 4KFBA 1NKEA 4KHYA 1A5VA 1KLMA 2IS3A 3WNEA 3DLRA 3VQPA 4AHVA 1L3UA 1HJRA 4DU4A 1TVRA 3V1QA 4DLGA 1T8EA 1XI1A 1RBRA 4FLZA 2DY4A 1RT7A 3AV9A 2IAJA 1KVCA 1WAJA 3AA4A 3KLHA 3FFIA 3OYLA 4KTWA 3H08A 4F8RA 4J2DA 1U48A 3NAEA 3SV4A 4E7IA 1VSFA 3EYZA 2DFFA 4CGJA 3VQQA 3OY9A 1UOCA 4W5RA 1TL1A 3DOLA 4CEOA 2HHXA 3DRPA 1ITGA 5CZ1A 3ZT4A 4Z4HA 4M3WA 2HMIA 3AO1A 3HYFA 1BI4B 4KV8A 3OYNA 5JS2A 3WNFA 4OVLA 3NDKA 3AO3A 4PWDA 1XWLA 1F21A 4C8MA 3QO9A 4CCHA 3LAMA 1RT2A 4B8CA 3VA3A 4AHUA 4ZHRA 2XRIA 1REVA 3V9SA 1BQMA 4PA1A 3LP2A 3VQ6A 4LSNA 3OYFA 4HCCA 3AVIA 4AHRA 4E7JA 4E3SA 4CJTA 3CM6A 3MXJA 4KKOA 1XHZA 4FZZA 3KK2A 4F4KA 4FLUA 3VQAA 1RBSA 2E6LA 3KJVA 1ZYQA 2O4IA 1LWFA 3OYDA 3HJFA 2HHWA 1VSDA 4CJWA 2HHVA 4HHTA 1B9FA 3VQ7A 5HROA 2X6SA 1RBVA 4DLEA 4OPKA 2KW4A 1K6YA 1VSMA 1NKBA 3RR8A 3KIOA 2YNGA 3C6UA 5I3UA 1QTMA 3ASMA 4CK2A 3V9UA 2O4GA 3KKSA 4R5PA 4N56A 3OYHA 3HSTB 1YVUA 1FXXA 4IDKA 3OJSA 4I9QA 3PV8A 1SL0A 1T03A 1NK8A 2HHTA 4DSIA 1TK8A 5KTQA 3NH1A 3SUNA 4OGCA 2OPQA 3C94A 2P5GA 3ALYA 1RT4A 4H4MA 2X74A 4EP4A 4EZ6A 4H8KA 4KHUA 3AVLA 2HNZA 4CHNA 4ELVA 2HNDA 4ZTJA 3F73A 2IGIA 3UIQA 4JRQA 3NF7A 4OKJA 3VQ5A 2PYLA 2F96A 1QE1A 3B6OA 2FC0A 3P1GA 3AVMA 3L2RA 4CHPA 3K5NA 3K5LA 1RDDA 3SYZA 3QEWA 3SUOA 3DLHA 3I0RA 3V1OA 4Q5VA 4FLWA 3ZCMA 1QSSA 4QOZB 4K8XA 1ZBIA 4BACA 4B3OA 3K59A 3KK3A 3LANA 4NCGA 1JLBA 4OKEA 1JL2A 4M3TA 4O55A 4GMJB 5J2QA 1QSYA 4DTMA 4BDPA 1CZ9A 1RT1A 4ELTA 4CHYA 3D45A 2YKNA 3MEDA 1ZBFA 4HTUA 3OS0A 4DU1A 4F3TA 3QESA 1KFDA 3HXMA 4RW7A 1J54A 2FBVA 3ZSOA 3NGIA 3B6PA 4FLVA 2IDOA 1ZBUA 2BE2A 1HYZA 3TAQA 3M8SA 3V9ZA 4DS5A 1SKWA 3AO4A 4FJMA 1VK0A 4FZXC 4CF2A 1UWBA 1ASVA 4FW1A 4M3UA 3L3VA 4E7LA 4FJGA 3V9XA 1QQCA 1TGOA 4IKFA 1VSJA 1LAWA 1IKXA 5T7BA 3QINA 4Q0BA 3HP9A 3LWMA 4KREA 4O44A 4DS4A 4KPYA 1HNVA 3DOKA 3DLGA 3OYKA 3QIPA 1L5UA 1YT3A 3MAQA 1DTTA 4CK3A 3IRXA 3EZ5A 3L8BA 2DTUA 2D0AA 2G8HA 4B9TA 3VN5A 4DTRA 2IOCA 3LPUA 2EX3A 5HP1A 4YNQA 2G8VA 2GUIA 3KD5E 1RDBA 4TSXA 4IG3A 1S1TA 3MECA 3P5JA 5FDLA 3P83D 4NYFA 4CGHA 4DTSA 4GVMA 3O3FA 3TAPA 4KHNA 2W42A 4AHCA 4CFCA 3TANA 4BE1A 1UA1A 4KHQA 4KO0A 2QKBA 1UAXA 3DRSA 5CY4A 4FJXA 4CJ5A 4CF1A 4M3ZA 1D9DA 1J9AA 3T3FA 4OLAA 3O3HA 1RBTA 1JLGA 3HP6A 1VSLA 5EU7A 3CFPA 4J2AA 2G8UA 1HRHA 4CJKA 4J2BA 1RT3A 4CJQA 1WN7A 3I0SA 3QEPA 2G8KA 4DTNA 2HNYA 4FZYA 3L3UA 3PY8A 4FJNA 4MFBA 4N41A 2F8SA 4C8OA 3CQ8A 4W5TA 3OJUA 4CIGA 1NOYA 4K8ZA 1VRTA 3V81A 4DTPA 3JSMA 2YNFA 4CFBA 3IAYA 4ID5A 1BIUA 5KI6A 1B92A 3LZJA 3ISNC 1XHXA 3TWHA 1NKCA 4Y1CA 3AA3A 1U49A 3CG7A 4AILC 5KGWA 3K5MA 2VG5A 1JLQA 3LALA 4CF0A 3RRGA 2BANA 4JRPA 3ZT3A 3HPGA 4CJPA 5HRNA 3NH0A 4B9SA 1C1CA 1IH7A 2ZE2A 1HYVA 4N5SA 2X78A 1C1BA 1LWCA 2OZMA 3TAMA 3DLEA 3U3YA 1HYSA 1JL1A 4W5NA 4OGEA 4IBNA 2VWKA 1U47A 4DMNA 4LY7A 1TAUA 1BCMA 2Z1JA 3AVNA 4DSFA 4FLXA 4DSJA 1QS4A 1A5WA 1W0HA 1WSHA 2FBXA 4KRFA 1XC9A 4C8NA 3RTVA 3AA2A 4DTUA 4DWIA 3NH2A 3KLEA 4CJFA 1S1VA 4KTQA 2B6AA 3QNNA 5DMRA 1QHTA 2RF2A 4CESA 5J2PA 5FRNA 4JS5A 3LDSA 1CXUA 3DLKA 1JXEA 1C6VA 1GOBA 1RTIA 3AVAA 4B08A 4DU3A 3VQ9A 4Z4FA 3T1AA 4H4OA 4FXDA 1I3AA 3AVJA 1EP4A 3LWLA 4L8RB 3NCIA 1D9FA 3RMAA 3NBPA 1FK9A 4DQRA 1Q8IA 3ZSYA 3I8DA 3ZT2A 2OA8A 4CJVA 4W5QA 2PYJA 4RW4A 3K2PA 1R0AA 1S9EA 2YHAA 4DFKA 3AA5X 3S3MA 2QKKA 4BE0A 3OYBA 3S9HA 4BE2A 1JXBA 2OPSA 3AVHA 5SZTA 5JS1A 3K5OA 3VQ4A 3ZSVA 1NJYA 4PQUA 2D0BA 4M41A 1KRPA 4CJLA 1WSEA 1TAQA 1CZBA 1BHLA 2P51A 3LPTA 3O4NA 4CJUA 3M8RA 1IKVA 1BISA 3VQBA 1HMVA 2X6NA 3DRRA 1VSKA 3HM9A 1TKZA 4CEDA 1WSJA 3QEVA 3OVNA 1HPZA 4CHQA 5J2NA 1SL2A 2YKMA 5C42A 4UQGA 3CFOA 3NFAA 1X9WA 5E41A 1RTDA 3RR7A 1YTAA 3L2WA 1NJXA 5D3GA 2LSNA 4LH5A 5C24A 3NHGA 4M3RA 2OZSA 3G0ZA 3OYJA 1GOCA 4IG0A 2I5JA 3PUFA 4Z4EA 4B9MA 4FJIA 1BL3A 3OYMA 5CYQA 3SUPA 1D8YA 1HQUA 1J5OA 3SQ1A 2ETJA 3NF9A 4HUFA 2G8WA 3PX0A 4DSKA 1RILA 4CEBA 4F2SA 1LW0A 4KHWA 1CLQA 4ZTFA 5KRTA 3EY1A 1TK5A 5K14A 1WSFA 4M42A 4CEEA 4FM1A 3O4QA 2PZSA 3SV3A 4N47A 3V6DA 2IC3A 3OYIA 1KSPA 1NK7A 4DFMA 2P5OA 1JLEA 5HRSA 1S1XA 2GBZA 4CEAA 5C25A 1RNHA 3MEGA 1S6PA 1EETA 3KLIA 4CECA 2XO7A 3KD1E 2WOMA 4CHZA 1U45A 1ZBHA 5CYMA 1MU2A 4CFDA 3KLGA 1L3VA 3HO1A 2KFZA 2AJQA 4G1QA 4E89A 4JS4A 1TKXA 2KZZA 4FJHA 4FVMA 4AHTA 1QSLA 1FKOA 4KHSA 1BQNA 3OYAA 1NK9A 5I42A 2E6MA 4GW6A 1VRUA 4E19A 4EP5A 2F8TA 2QK9A 4DTOA 1FKPA 2DFEA 2BDPA 4DQIA 1TL3A 4CGIA 5SWMA 1NK6A 5HBMA 5CZ2A 1IG9A 4W5OA 1BCOA 3KKRA 2GV9A 1UA0A 2D0CA 4CEFA 2E4LA 1IO2A 4DFPA 1EKEA 4FK4A 4MQ3A 4KAZA 4CJRA 1RDAA 2NUBA 1L3TA 1SUQA 2XY6A 4B9UA 3AO2A 4FJ5A 2HVHA 1C0TA 1SV5A 2ITGA 4FCYA 3PO4A 4O4GA 3V1RA 2ZD1A 4WE1A 3SI6A 3S3OA 2HHQA 4DSLA 3WNGA 3K58A 4QAGA 1U4BA 1EX4A 1Z26A 3VQDA 1KVAA 4RW6A 1NJZA 3QERA 3NGZA 5FROA 1KLNA 2VWJA 2P1JA 4XIUA 3NE6A 2DFHA 4CF8A 4ELUA 4HCBA 1BIZA 1RT6A 2FBTA 3OYGA 3DYAA 5DK5A 4OKKA 1S1WA 5J2MA 4I2QA 4DG1A 3AVFA 5HLFA 4F2RA 4M3YA 2RN2A 1I39A 1JKHA 4IFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JGU A;  1S1U A;  2YHB A;  3AO5 A;  2A1S A;  1IKW A;  1S6Q A;  3VQC A;  3C6T A;  3ZSR A;  3D0P A;  3ZSX A;  3HT3 A;  2OYQ A;  3SQ4 A;  3SPY A;  4FYD A;  2YNI A;  3HVT A;  4CGD A;  3PX4 A;  3M8P A;  3ZT0 A;  3RWU A;  3DMJ A;  4DTX A;  4CJ4 A;  3OS1 A;  4KB0 A;  3ZT1 A;  1X1P A;  4DTJ A;  1NOZ A;  3VA0 A;  4E7H A;  1SKS A;  4HVJ A;  1ZBL A;  1RCH A;  3AVK A;  4HUE A;  1LWE A;  2KZM A;  1G15 A;  4FJ7 A;  3RRH A;  4LSL A;  4BWM A;  3TAE A;  1J53 A;  1WLJ A;  1Y97 A;  3QEX A;  3OYC A;  4C8K A;  4CE9 A;  3G10 A;  3DI6 A;  3SQ2 A;  4F3O A;  4CGF A;  4CER A;  4BWJ A;  1C1A A;  3OYE A;  1SL1 A;  1NK0 A;  2HB5 A;  2VG6 A;  3LZI A;  3V4I A;  1A5X A;  2HW3 A;  4RW8 A;  1ASU A;  3CYM A;  2Y1I A;  4I9L A;  1SKR A;  2KFN A;  1WSG A;  4QCL A;  1HQE A;  4Y1D A;  4CEZ A;  3IS9 A;  3CFR A;  3RMB A;  1L3S A;  4CJ3 A;  4DSE A;  3PO5 A;  4J2E A;  3LP1 A;  4CK1 A;  1RTJ A;  2ZQB A;  3E01 A;  3K57 A;  4CJS A;  4RG8 A;  4CIE A;  2RKI A;  3SNN A;  1WAF A;  2HHU A;  1RT5 A;  3M8Q A;  1X9M A;  1RTH A;  3NF6 A;  4FLT A;  1Z25 A;  4B8A B;  3SZ2 A;  1RBU A;  3QLH A;  3TAB A;  4FK0 A;  4NCA A;  3LP3 A;  3THV A;  3BGR A;  4AH9 A;  3HL8 A;  1N5Y A;  1S9G A;  3QIO A;  4CFA A;  2OPP A;  3ULD A;  1EXQ A;  2KQ2 A;  5HRR A;  4O5B A;  3DM2 A;  3SUQ A;  4PY5 A;  1D5A A;  2Q3S A;  3KLF A;  3NGY A;  3F9K A;  3ZSW A;  4FJK A;  4KI6 A;  4E1M A;  2G8I A;  1TKT A;  1VSI A;  2Z1I A;  2D5R A;  3QET A;  3KTQ A;  2VG7 A;  3IG1 A;  3C95 A;  3T19 A;  3QNO A;  3ITH A;  1Q9Y A;  1YTU A;  1KCF A;  1NK4 A;  4E1N A;  4FM0 A;  1TK0 A;  2B5J A;  1GOA A;  1WNS A;  1DLO A;  1BGX T;  3JYT A;  1LW2 A;  4B9V A;  3KK1 A;  3SPZ A;  4Z4G A;  1RDC A;  3PX6 A;  4FJ8 A;  3RMC A;  4CJE A;  3SQ0 A;  4Z4C A;  2PY5 A;  2HVI A;  4FJL A;  2XHB A;  3RMD A;  1T05 A;  2Z1G A;  3CM5 A;  1HNI A;  1C0M A;  3HK2 A;  3O3G A;  4NCB A;  3ZSZ A;  4BDY A;  3TAF A;  4CIF A;  3OS2 A;  3SJJ A;  3HPH A;  2XY5 A;  4PUO A;  4B9N A;  2A1R A;  3U3G A;  1B9D A;  1T7P A;  1TKD A;  1S5J A;  3L2V A;  3HVR A;  4DQS A;  4FJ9 A;  1O1W A;  5J1E A;  1VSH A;  2B4J A;  5KRS A;  3L2Q A;  2G8F A;  4CF9 A;  1W9H A;  4Z0U A;  3A2F A;  1JLC A;  5KGX A;  2OPR A;  4EZ9 A;  4OLB A;  1BI4 A;  4ID1 A;  3HPO A;  3AVG A;  4JLH A;  1U04 A;  5HRP A;  4DF4 A;  4FM2 A;  1KVB A;  1JLF A;  1TV6 A;  3MEE A;  3MXI A;  1ASW A;  1NJW A;  4BDZ A;  1DTQ A;  4E0D A;  4I2P A;  3LP0 A;  3V9W A;  4FJJ A;  1Q9X A;  2YV0 X;  3LAK A;  4O0J A;  2BGG A;  1LAV A;  2JLE A;  2FBY A;  4KB1 A;  2XY8 A;  4N76 A;  4CEQ A;  2KTQ A;  4OJR A;  2ATQ A;  3NF8 A;  4DFJ A;  3MXM A;  3BDP A;  5FRM A;  3TAG A;  4DQP A;  4NYN A;  4E7K A;  4LH4 A;  2WON A;  1WSI A;  4FLY A;  1CXQ A;  2HHS A;  4Z4I A;  4AHS A;  3TI0 A;  3WNH A;  3L2U A;  2EHG A;  4IFV A;  1C0U A;  4LD0 A;  2RPI A;  4CHO A;  4YFU A;  1KTQ A;  3QEI A;  1JLA A;  4KTZ A;  4KI4 A;  2XY7 A;  4M45 A;  3ZSQ A;  4M3X A;  4B9L A;  3U6F A;  4FW2 A;  2Z1H A;  4DQQ A;  4ICL A;  1LV5 A;  4C8L A;  3AVC A;  1KFS A;  3DLB A;  3S3N A;  3AVB A;  4DF8 A;  1IKY A;  3VQ8 A;  2R7Y A;  4CGG A;  1NK5 A;  1VSE A;  4FK2 A;  2QXF A;  2Y1J A;  4I7F A;  1N6Q A;  4O0I A;  4OPJ A;  3VQE A;  4HUG A;  1X9S A;  2YNH A;  3SCX A;  4RW9 A;  3TAR A;  3TR8 A;  4KFB A;  1NKE A;  4KHY A;  1A5V A;  1KLM A;  2IS3 A;  3WNE A;  3DLR A;  3VQP A;  4AHV A;  1L3U A;  1HJR A;  4DU4 A;  1TVR A;  3V1Q A;  4DLG A;  1T8E A;  1XI1 A;  1RBR A;  4FLZ A;  2DY4 A;  1RT7 A;  3AV9 A;  2IAJ A;  1KVC A;  1WAJ A;  3AA4 A;  3KLH A;  3FFI A;  3OYL A;  4KTW A;  3H08 A;  4F8R A;  4J2D A;  1U48 A;  3NAE A;  3SV4 A;  4E7I A;  1VSF A;  3EYZ A;  2DFF A;  4CGJ A;  3VQQ A;  3OY9 A;  1UOC A;  4W5R A;  1TL1 A;  3DOL A;  4CEO A;  2HHX A;  3DRP A;  1ITG A;  5CZ1 A;  3ZT4 A;  4Z4H A;  4M3W A;  2HMI A;  3AO1 A;  3HYF A;  1BI4 B;  4KV8 A;  3OYN A;  5JS2 A;  3WNF A;  4OVL A;  3NDK A;  3AO3 A;  4PWD A;  1XWL A;  1F21 A;  4C8M A;  3QO9 A;  4CCH A;  3LAM A;  1RT2 A;  4B8C A;  3VA3 A;  4AHU A;  4ZHR A;  2XRI A;  1REV A;  3V9S A;  1BQM A;  4PA1 A;  3LP2 A;  3VQ6 A;  4LSN A;  3OYF A;  4HCC A;  3AVI A;  4AHR A;  4E7J A;  4E3S A;  4CJT A;  3CM6 A;  3MXJ A;  4KKO A;  1XHZ A;  4FZZ A;  3KK2 A;  4F4K A;  4FLU A;  3VQA A;  1RBS A;  2E6L A;  3KJV A;  1ZYQ A;  2O4I A;  1LWF A;  3OYD A;  3HJF A;  2HHW A;  1VSD A;  4CJW A;  2HHV A;  4HHT A;  1B9F A;  3VQ7 A;  5HRO A;  2X6S A;  1RBV A;  4DLE A;  4OPK A;  2KW4 A;  1K6Y A;  1VSM A;  1NKB A;  3RR8 A;  3KIO A;  2YNG A;  3C6U A;  5I3U A;  1QTM A;  3ASM A;  4CK2 A;  3V9U A;  2O4G A;  3KKS A;  4R5P A;  4N56 A;  3OYH A;  3HST B;  1YVU A;  1FXX A;  4IDK A;  3OJS A;  4I9Q A;  3PV8 A;  1SL0 A;  1T03 A;  1NK8 A;  2HHT A;  4DSI A;  1TK8 A;  5KTQ A;  3NH1 A;  3SUN A;  4OGC A;  2OPQ A;  3C94 A;  2P5G A;  3ALY A;  1RT4 A;  4H4M A;  2X74 A;  4EP4 A;  4EZ6 A;  4H8K A;  4KHU A;  3AVL A;  2HNZ A;  4CHN A;  4ELV A;  2HND A;  4ZTJ A;  3F73 A;  2IGI A;  3UIQ A;  4JRQ A;  3NF7 A;  4OKJ A;  3VQ5 A;  2PYL A;  2F96 A;  1QE1 A;  3B6O A;  2FC0 A;  3P1G A;  3AVM A;  3L2R A;  4CHP A;  3K5N A;  3K5L A;  1RDD A;  3SYZ A;  3QEW A;  3SUO A;  3DLH A;  3I0R A;  3V1O A;  4Q5V A;  4FLW A;  3ZCM A;  1QSS A;  4QOZ B;  4K8X A;  1ZBI A;  4BAC A;  4B3O A;  3K59 A;  3KK3 A;  3LAN A;  4NCG A;  1JLB A;  4OKE A;  1JL2 A;  4M3T A;  4O55 A;  4GMJ B;  5J2Q A;  1QSY A;  4DTM A;  4BDP A;  1CZ9 A;  1RT1 A;  4ELT A;  4CHY A;  3D45 A;  2YKN A;  3MED A;  1ZBF A;  4HTU A;  3OS0 A;  4DU1 A;  4F3T A;  3QES A;  1KFD A;  3HXM A;  4RW7 A;  1J54 A;  2FBV A;  3ZSO A;  3NGI A;  3B6P A;  4FLV A;  2IDO A;  1ZBU A;  2BE2 A;  1HYZ A;  3TAQ A;  3M8S A;  3V9Z A;  4DS5 A;  1SKW A;  3AO4 A;  4FJM A;  1VK0 A;  4FZX C;  4CF2 A;  1UWB A;  1ASV A;  4FW1 A;  4M3U A;  3L3V A;  4E7L A;  4FJG A;  3V9X A;  1QQC A;  1TGO A;  4IKF A;  1VSJ A;  1LAW A;  1IKX A;  5T7B A;  3QIN A;  4Q0B A;  3HP9 A;  3LWM A;  4KRE A;  4O44 A;  4DS4 A;  4KPY A;  1HNV A;  3DOK A;  3DLG A;  3OYK A;  3QIP A;  1L5U A;  1YT3 A;  3MAQ A;  1DTT A;  4CK3 A;  3IRX A;  3EZ5 A;  3L8B A;  2DTU A;  2D0A A;  2G8H A;  4B9T A;  3VN5 A;  4DTR A;  2IOC A;  3LPU A;  2EX3 A;  5HP1 A;  4YNQ A;  2G8V A;  2GUI A;  3KD5 E;  1RDB A;  4TSX A;  4IG3 A;  1S1T A;  3MEC A;  3P5J A;  5FDL A;  3P83 D;  4NYF A;  4CGH A;  4DTS A;  4GVM A;  3O3F A;  3TAP A;  4KHN A;  2W42 A;  4AHC A;  4CFC A;  3TAN A;  4BE1 A;  1UA1 A;  4KHQ A;  4KO0 A;  2QKB A;  1UAX A;  3DRS A;  5CY4 A;  4FJX A;  4CJ5 A;  4CF1 A;  4M3Z A;  1D9D A;  1J9A A;  3T3F A;  4OLA A;  3O3H A;  1RBT A;  1JLG A;  3HP6 A;  1VSL A;  5EU7 A;  3CFP A;  4J2A A;  2G8U A;  1HRH A;  4CJK A;  4J2B A;  1RT3 A;  4CJQ A;  1WN7 A;  3I0S A;  3QEP A;  2G8K A;  4DTN A;  2HNY A;  4FZY A;  3L3U A;  3PY8 A;  4FJN A;  4MFB A;  4N41 A;  2F8S A;  4C8O A;  3CQ8 A;  4W5T A;  3OJU A;  4CIG A;  1NOY A;  4K8Z A;  1VRT A;  3V81 A;  4DTP A;  3JSM A;  2YNF A;  4CFB A;  3IAY A;  4ID5 A;  1BIU A;  5KI6 A;  1B92 A;  3LZJ A;  3ISN C;  1XHX A;  3TWH A;  1NKC A;  4Y1C A;  3AA3 A;  1U49 A;  3CG7 A;  4AIL C;  5KGW A;  3K5M A;  2VG5 A;  1JLQ A;  3LAL A;  4CF0 A;  3RRG A;  2BAN A;  4JRP A;  3ZT3 A;  3HPG A;  4CJP A;  5HRN A;  3NH0 A;  4B9S A;  1C1C A;  1IH7 A;  2ZE2 A;  1HYV A;  4N5S A;  2X78 A;  1C1B A;  1LWC A;  2OZM A;  3TAM A;  3DLE A;  3U3Y A;  1HYS A;  1JL1 A;  4W5N A;  4OGE A;  4IBN A;  2VWK A;  1U47 A;  4DMN A;  4LY7 A;  1TAU A;  1BCM A;  2Z1J A;  3AVN A;  4DSF A;  4FLX A;  4DSJ A;  1QS4 A;  1A5W A;  1W0H A;  1WSH A;  2FBX A;  4KRF A;  1XC9 A;  4C8N A;  3RTV A;  3AA2 A;  4DTU A;  4DWI A;  3NH2 A;  3KLE A;  4CJF A;  1S1V A;  4KTQ A;  2B6A A;  3QNN A;  5DMR A;  1QHT A;  2RF2 A;  4CES A;  5J2P A;  5FRN A;  4JS5 A;  3LDS A;  1CXU A;  3DLK A;  1JXE A;  1C6V A;  1GOB A;  1RTI A;  3AVA A;  4B08 A;  4DU3 A;  3VQ9 A;  4Z4F A;  3T1A A;  4H4O A;  4FXD A;  1I3A A;  3AVJ A;  1EP4 A;  3LWL A;  4L8R B;  3NCI A;  1D9F A;  3RMA A;  3NBP A;  1FK9 A;  4DQR A;  1Q8I A;  3ZSY A;  3I8D A;  3ZT2 A;  2OA8 A;  4CJV A;  4W5Q A;  2PYJ A;  4RW4 A;  3K2P A;  1R0A A;  1S9E A;  2YHA A;  4DFK A;  3AA5 X;  3S3M A;  2QKK A;  4BE0 A;  3OYB A;  3S9H A;  4BE2 A;  1JXB A;  2OPS A;  3AVH A;  5SZT A;  5JS1 A;  3K5O A;  3VQ4 A;  3ZSV A;  1NJY A;  4PQU A;  2D0B A;  4M41 A;  1KRP A;  4CJL A;  1WSE A;  1TAQ A;  1CZB A;  1BHL A;  2P51 A;  3LPT A;  3O4N A;  4CJU A;  3M8R A;  1IKV A;  1BIS A;  3VQB A;  1HMV A;  2X6N A;  3DRR A;  1VSK A;  3HM9 A;  1TKZ A;  4CED A;  1WSJ A;  3QEV A;  3OVN A;  1HPZ A;  4CHQ A;  5J2N A;  1SL2 A;  2YKM A;  5C42 A;  4UQG A;  3CFO A;  3NFA A;  1X9W A;  5E41 A;  1RTD A;  3RR7 A;  1YTA A;  3L2W A;  1NJX A;  5D3G A;  2LSN A;  4LH5 A;  5C24 A;  3NHG A;  4M3R A;  2OZS A;  3G0Z A;  3OYJ A;  1GOC A;  4IG0 A;  2I5J A;  3PUF A;  4Z4E A;  4B9M A;  4FJI A;  1BL3 A;  3OYM A;  5CYQ A;  3SUP A;  1D8Y A;  1HQU A;  1J5O A;  3SQ1 A;  2ETJ A;  3NF9 A;  4HUF A;  2G8W A;  3PX0 A;  4DSK A;  1RIL A;  4CEB A;  4F2S A;  1LW0 A;  4KHW A;  1CLQ A;  4ZTF A;  5KRT A;  3EY1 A;  1TK5 A;  5K14 A;  1WSF A;  4M42 A;  4CEE A;  4FM1 A;  3O4Q A;  2PZS A;  3SV3 A;  4N47 A;  3V6D A;  2IC3 A;  3OYI A;  1KSP A;  1NK7 A;  4DFM A;  2P5O A;  1JLE A;  5HRS A;  1S1X A;  2GBZ A;  4CEA A;  5C25 A;  1RNH A;  3MEG A;  1S6P A;  1EET A;  3KLI A;  4CEC A;  2XO7 A;  3KD1 E;  2WOM A;  4CHZ A;  1U45 A;  1ZBH A;  5CYM A;  1MU2 A;  4CFD A;  3KLG A;  1L3V A;  3HO1 A;  2KFZ A;  2AJQ A;  4G1Q A;  4E89 A;  4JS4 A;  1TKX A;  2KZZ A;  4FJH A;  4FVM A;  4AHT A;  1QSL A;  1FKO A;  4KHS A;  1BQN A;  3OYA A;  1NK9 A;  5I42 A;  2E6M A;  4GW6 A;  1VRU A;  4E19 A;  4EP5 A;  2F8T A;  2QK9 A;  4DTO A;  1FKP A;  2DFE A;  2BDP A;  4DQI A;  1TL3 A;  4CGI A;  5SWM A;  1NK6 A;  5HBM A;  5CZ2 A;  1IG9 A;  4W5O A;  1BCO A;  3KKR A;  2GV9 A;  1UA0 A;  2D0C A;  4CEF A;  2E4L A;  1IO2 A;  4DFP A;  1EKE A;  4FK4 A;  4MQ3 A;  4KAZ A;  4CJR A;  1RDA A;  2NUB A;  1L3T A;  1SUQ A;  2XY6 A;  4B9U A;  3AO2 A;  4FJ5 A;  2HVH A;  1C0T A;  1SV5 A;  2ITG A;  4FCY A;  3PO4 A;  4O4G A;  3V1R A;  2ZD1 A;  4WE1 A;  3SI6 A;  3S3O A;  2HHQ A;  4DSL A;  3WNG A;  3K58 A;  4QAG A;  1U4B A;  1EX4 A;  1Z26 A;  3VQD A;  1KVA A;  4RW6 A;  1NJZ A;  3QER A;  3NGZ A;  5FRO A;  1KLN A;  2VWJ A;  2P1J A;  4XIU A;  3NE6 A;  2DFH A;  4CF8 A;  4ELU A;  4HCB A;  1BIZ A;  1RT6 A;  2FBT A;  3OYG A;  3DYA A;  5DK5 A;  4OKK A;  1S1W A;  5J2M A;  4I2Q A;  4DG1 A;  3AVF A;  5HLF A;  4F2R A;  4M3Y A;  2RN2 A;  1I39 A;  1JKH A;  4IFY A; 
#chains in the Genus database with same CATH topology
 3CCR N;  2YHB A;  4WQ4 C;  2A1S A;  3ZSR A;  2FF3 B;  3HVT A;  3H45 C;  3PX4 A;  3W3D A;  3DMJ A;  4KB0 A;  3VGL A;  1X1P A;  4CZE A;  3VA0 A;  1Q82 O;  1ZBL A;  1RCH A;  3T7Z A;  5EX5 A;  2E2N A;  4FJ7 A;  4MDB A;  4EAH D;  1KAX A;  5JVG L;  4JKC A;  3FZL A;  1J53 A;  1Y97 A;  4FWO A;  4IFE A;  4CER A;  4BWJ A;  1C1A A;  1NK0 A;  1A5X A;  3CQX A;  4I9L A;  3EE9 A;  4CEZ A;  3CFR A;  1L3S A;  1HNX K;  4CK1 A;  4JKB A;  3K57 A;  4CJS A;  4RG8 A;  4CIE A;  1QVG M;  1GLD G;  4FPB A;  1RTH A;  5M1P A;  3NF6 A;  5BRH A;  4FLT A;  3LP3 A;  4YOV A;  4BRH A;  3BGR A;  2KQ2 A;  5EY4 A;  5HRR A;  4O5B A;  3G4S N;  2ZJR L;  2Q3S A;  3ZSW A;  2HOE A;  4E1M A;  5MLC Q;  1TKT A;  2Z1I A;  4DUZ K;  3C95 A;  1YTU A;  4FM0 A;  1BGX T;  3SPZ A;  3U4L A;  1RDC A;  2PAV A;  5JLF A;  3SQ0 A;  4FJL A;  2YCH A;  3ZSZ A;  3OS2 A;  4LF8 K;  2ZJP L;  3WXJ A;  3HPH A;  2XY5 A;  4PUO A;  4B9N A;  2E2O A;  2AP1 A;  1T7P A;  3P31 A;  5JIC A;  1VQK N;  1VSH A;  5KRS A;  4JD2 A;  4M7Y A;  3J7Y P;  1JLC A;  2OPR A;  4EZ9 A;  3HPO A;  4PL8 A;  4FM2 A;  4ILJ A;  3MEE A;  4DR6 K;  3MXI A;  4E0D A;  3LP0 A;  1Q9X A;  3MK6 A;  3LAK A;  2HF3 A;  1JCG A;  1LAV A;  2FBY A;  1YVN A;  2HHH K;  2KTQ A;  3CCS N;  3VOV A;  3NF8 A;  3MXM A;  4FWK A;  5FRM A;  3TAG A;  4MO5 A;  4KHP K;  2I7P A;  1VQ7 N;  3W0L A;  5BPN A;  4FLY A;  4FL9 A;  4AHS A;  3VEN A;  3H1Q A;  4K43 A;  4A57 A;  5LJW A;  2BH1 A;  3MN5 A;  1C0F A;  4WCE L;  1KTQ A;  2XY7 A;  3ZSQ A;  2VQE K;  1OKJ A;  4M3X A;  3CHW A;  3U6F A;  1VQN N;  4DR2 K;  3KVG A;  3P39 A;  4DF8 A;  2NLX A;  1NK5 A;  1VSE A;  3F2K A;  4I7F A;  3VQE A;  4RW9 A;  4KFB A;  1A5V A;  3KZB A;  4ISE A;  1WBD A;  1L3U A;  4GKJ K;  2OTL N;  5BPM A;  3TTF A;  1YIT N;  1RT7 A;  1WUA A;  3AA4 A;  4U7B A;  2UXD K;  4B1W B;  3NAE A;  3BP8 A;  4CGJ A;  3ATV A;  3DRP A;  3N4Q A;  2HMI A;  1BI4 B;  1Z6R A;  3SBT A;  1GLE G;  5I9E B;  1RT2 A;  2XRI A;  1REV A;  4NO7 A;  4FOE A;  1BQM A;  3VQ6 A;  4LSN A;  4E7J A;  3MXJ A;  4LFB K;  2Q36 A;  4FLU A;  1RBS A;  4DB3 A;  1LWF A;  4FO0 A;  2QWN A;  3OBW A;  3CMA N;  3H3O B;  3K9J A;  1K6Y A;  3ASM A;  2O4G A;  3KKS A;  4R5P A;  3OJS A;  3HST B;  1YVU A;  3PV8 A;  2HHT A;  3NVK A;  2QTD A;  5KTQ A;  1TK8 A;  3SUN A;  3AAQ A;  3SMS A;  1IBL K;  3CCE N;  4CJ7 A;  2HBL A;  3I8B A;  3A8Y A;  4CBX A;  3NF7 A;  1T8E A;  1QE1 A;  3L2R A;  4JI1 K;  4IEI A;  4FLW A;  4B1Y B;  3ZCM A;  4QOZ B;  3WXI A;  4H0P A;  1Q7Y O;  5ELZ A;  4M3T A;  1NGG A;  4DTM A;  1BUP A;  4A59 A;  3R6M A;  1TUY A;  1T3V A;  2PBD A;  3P38 A;  3NGI A;  2NRT A;  4BRI A;  2BE2 A;  3TAQ A;  4LF6 K;  1SKW A;  4CW7 B;  4FJM A;  2UUA K;  3O08 A;  5M1N A;  1ASV A;  3QDK A;  4FW1 A;  3L3V A;  4E7L A;  4FJG A;  3A5M C;  1XQS C;  3GG4 A;  1HNV A;  5GAE P;  2CGJ A;  3DLG A;  1L5U A;  5IWA K;  1DTT A;  5F2R A;  2A5X A;  3MAQ A;  4B9T A;  1BG3 A;  2IOC A;  4AM6 A;  4YNQ A;  2G8V A;  1RDB A;  5ADX A;  4H5N A;  4NYF A;  1Q86 O;  4FSV A;  4AHC A;  2QA4 N;  4BE1 A;  5CE3 A;  3DXM A;  4CJ5 A;  4A5B A;  1D9D A;  2A40 A;  2V7Y A;  4BR9 A;  1VSL A;  2YI1 A;  5EU7 A;  3THY A;  3CPE A;  1EO1 A;  1WN7 A;  3I0S A;  4FJN A;  1J6Z A;  3PY8 A;  4OO1 J;  4MFB A;  3CQ8 A;  3LDO A;  5AZJ B;  1VQ4 N;  4Y1C A;  3AA3 A;  2E2P A;  1SAZ A;  1U49 A;  3CI5 A;  3BY5 A;  3ZT3 A;  4CJP A;  1IH7 A;  3GOI A;  1HNW K;  4N5S A;  1LWC A;  3U3Y A;  1FW6 A;  5C2F A;  3AAP A;  4IBN A;  4NLC A;  2VWK A;  4I6M B;  5AQH A;  4DMN A;  3WQU A;  4QS8 A;  3AVN A;  2Q97 A;  1WSH A;  4MDA A;  1XC9 A;  3RTV A;  3NH2 A;  1S1V A;  3QNN A;  5E26 A;  5FRN A;  3I33 A;  1C6V A;  1T6D A;  3AVA A;  4CZG A;  3T1A A;  4FXD A;  3HI0 A;  2NRW A;  3RMA A;  4DV1 K;  4DQR A;  4IOC L;  3ZSY A;  3I8D A;  1LOT B;  4FWS A;  1S3X A;  4KH5 A;  3K2P A;  4DV2 K;  3S3M A;  3AA5 X;  1NGD A;  5AQG A;  3EEQ A;  2QKK A;  3OYB A;  4YOU A;  3S9H A;  4BE2 A;  4B3M K;  2OPS A;  3K5O A;  4KH6 A;  3OW2 M;  3FR0 A;  2D0B A;  3LM9 A;  4H0X B;  1BHL A;  3M8R A;  1IKV A;  1HMV A;  5LMU K;  1TKZ A;  1WSJ A;  5J2N A;  3I56 N;  4UQG A;  2H3G X;  1RTD A;  2O8B A;  3L2W A;  1NJX A;  5D3G A;  2GEL A;  2E8A A;  4M3R A;  3G0Z A;  1QHA A;  1GOC A;  3G25 A;  4IG0 A;  5M1Q A;  4LF5 K;  1VQL N;  2VGM A;  3OYM A;  2QWP A;  1HQU A;  4HUF A;  3KK7 A;  3T1Y K;  1CLQ A;  4CEB A;  1LW0 A;  4B3R K;  3O9Q A;  4ZTF A;  5KRT A;  3CJ9 A;  3D2F A;  5K14 A;  4FM1 A;  3O4Q A;  5AQM A;  3V6D A;  2IC3 A;  1KSP A;  1HKG A;  1NK7 A;  4DFM A;  4DR1 K;  1N33 K;  2D4W A;  3AY9 A;  2XO7 A;  4DV7 K;  4XH5 A;  1MU2 A;  4UY8 O;  4G1Q A;  4E89 A;  4JS4 A;  4WQ5 C;  3G6E N;  1QSL A;  4B3S K;  3DAW A;  1NK9 A;  2E6M A;  4YOX A;  2DFE A;  4CD1 A;  2BDP A;  3PSI A;  5AQK A;  4JI7 K;  4BC2 A;  5CZ2 A;  4M63 C;  3KKR A;  2GV9 A;  3UB5 A;  4JKG B;  4CEF A;  2E4L A;  3BZK A;  4FK4 A;  4MQ3 A;  4KAZ A;  4CJR A;  3R1X A;  2GWJ A;  3VGK A;  4FJ5 A;  2ITG A;  4Z94 A;  3S3O A;  2ZD1 A;  3SI6 A;  4XH4 A;  4G9Z A;  4CVN E;  2QWR A;  2W41 A;  3QER A;  3NGZ A;  5FRO A;  3KWI A;  2P1J A;  4XIU A;  4DKW A;  2DFH A;  1RT6 A;  5KPT A;  3PIP L;  2ASO A;  5AQI A;  4I2Q A;  3AVF A;  4WFA L;  4B1X B;  1JKH A;  2VWB A;  3D0P A;  3FZK A;  5C15 A;  3HT3 A;  2OYQ A;  1YF5 L;  3SPY A;  2YNI A;  4A2A A;  3B8A X;  4CGD A;  3WEE A;  3ZT0 A;  3LM2 A;  4CJ4 A;  1EWR A;  1NOZ A;  3HOT A;  3WEE B;  2ASM A;  4MLH A;  3QEX A;  4C8K A;  4CE9 A;  5F0X A;  4F3O A;  4H0O A;  3D2E A;  4BRQ A;  3LZI A;  3CYM A;  2KFN A;  3J8A A;  4QCL A;  4Y1D A;  2P9N A;  4CJ3 A;  3LP1 A;  2ZQB A;  1BA1 A;  2RKI A;  1QQO A;  3Q7B A;  4B8A B;  3QLH A;  3O9T A;  3TAB A;  3U9Z A;  3THV A;  1N5Y A;  3CXC M;  3HL8 A;  1EXQ A;  3E9O A;  2D1K A;  4DV0 K;  4BRF A;  3FZM A;  4KI6 A;  3F9K A;  2G8I A;  2YX6 A;  3L6Q A;  2W6K A;  3KTQ A;  1Q9Y A;  1KCF A;  1NK4 A;  1YAG A;  1TK0 A;  2B5J A;  1WNS A;  3JYT A;  1LW2 A;  4B9V A;  4FJ8 A;  5GIP A;  5GIN A;  2XHB A;  2Z1G A;  3CM5 A;  1C0M A;  2P9U B;  1HR0 K;  2OTJ N;  4NCB A;  4BDY A;  4CIF A;  2P9K B;  3SJJ A;  1X3M A;  1B9D A;  2P9P A;  2P9S A;  2YHY A;  1TKD A;  4DR7 K;  4H03 B;  4FJ9 A;  1O1W A;  2HBJ A;  4BR0 A;  3L2Q A;  2G8F A;  4H0Y B;  5FLX O;  4Z0U A;  4H5T A;  1BI4 A;  3WUH A;  4ID1 A;  1OVQ A;  5AZI B;  5HRP A;  1U04 A;  2ZM6 K;  1TV6 A;  2CGK A;  5AJ3 K;  4DHY A;  4FJJ A;  1TYQ A;  3F9M A;  2BGG A;  4O0J A;  3ZX0 A;  1NNE A;  2XY8 A;  3L0Q A;  1QVF M;  4NLB A;  2ZGY A;  3S41 A;  1NGA A;  4DFJ A;  3CF5 L;  3BDP A;  4B1U B;  5EVZ A;  4NYN A;  1KQS M;  3TI0 A;  1NMD A;  2EHG A;  3EE8 A;  3F5T A;  1JLA A;  4YOY A;  4B9L A;  4JNE A;  1EWQ A;  4ICL A;  3CPW M;  3ZLJ A;  3MCA B;  4DV6 K;  3D7E O;  1QQN A;  3AVC A;  1KFS A;  4C8L A;  1JCF A;  4BRP A;  4MO4 A;  3AVB A;  1IKY A;  2GWK A;  1GLL O;  1IG8 A;  4M7X A;  4O0I A;  4BRG A;  4HUG A;  2YNH A;  1CZA N;  5AQU A;  3WNE A;  3DLR A;  3VQP A;  4AHV A;  2GX9 A;  4JEP A;  1TVR A;  3V1Q A;  4DLG A;  1M90 O;  3CJ7 A;  2DY4 A;  3AV9 A;  4NXM K;  2IAJ A;  3LL3 A;  4V19 S;  1WAJ A;  3KLH A;  5BR8 K;  3FFI A;  1ZC6 A;  1HKC A;  1NG9 A;  3EZW A;  3IUC A;  3TPQ A;  5F1X A;  2DFF A;  1GLC G;  4W5R A;  1TL1 A;  3ZT4 A;  3IFR A;  5CZ1 A;  2WTU A;  4YHH K;  2JWK A;  3AO1 A;  4KV8 A;  4OVL A;  1XWL A;  3LAM A;  5AQW A;  4B8C A;  4JI4 K;  3LP2 A;  1BA0 A;  4WQ5 A;  4BQL A;  3CCJ N;  4HCC A;  1XHZ A;  1MWM A;  2HBM A;  3KJV A;  2E6L A;  4IDH A;  4I6M A;  1NLV A;  3HJF A;  5HRO A;  4BR5 A;  1RBV A;  4OPK A;  3KIO A;  1QTM A;  3C6U A;  4N56 A;  2UUC K;  4IDK A;  1SL0 A;  1T03 A;  3NH1 A;  2QWO A;  2P5G A;  2OPQ A;  2F4V K;  4H4M A;  1ATN A;  4EP4 A;  3VEY A;  4KHU A;  2IIR A;  2E1Z A;  1N36 K;  1SS6 A;  3TSP A;  2ZWH A;  3DXK B;  2PYL A;  4JKA A;  3AVM A;  4YOR A;  4JK7 A;  4Q5V A;  4K0K K;  3VPZ A;  5C12 A;  1ZBI A;  3I55 N;  1WB9 A;  3K59 A;  1BDG A;  4GMJ B;  1CZ9 A;  1G99 A;  2AA4 A;  2P9U A;  3D45 A;  4DU1 A;  3OS0 A;  4F3T A;  2DPN A;  1KFD A;  3HXM A;  2ASP A;  4RW7 A;  2FBV A;  5AQO A;  4IO8 A;  2FLO A;  4HWI A;  4HTL A;  1UWB A;  3CME N;  3V9X A;  1QQC A;  2D0O A;  1TGO A;  4IKF A;  1QQM A;  1LAW A;  3LWM A;  3ZX2 A;  5HL7 L;  4BC5 A;  3DOK A;  2FF6 A;  3QIP A;  4WFB L;  4CK3 A;  3VMF B;  3AGK A;  1NGC A;  4U67 L;  4BY9 C;  2DTU A;  3H46 O;  4GV6 A;  3VN5 A;  5HP1 A;  3KD5 E;  1S1T A;  3MEC A;  3QBW A;  1BWF O;  4DTS A;  3ZEU B;  3WXL A;  4CFC A;  1WBB A;  1UA1 A;  1UAX A;  1J9A A;  3T3F A;  4OLA A;  4DCH A;  3O3H A;  3HP6 A;  1HNZ K;  3M1F A;  3D2F B;  2G8U A;  1HRH A;  4CJQ A;  5TKY A;  3QEP A;  4FZY A;  3L3U A;  1HPM A;  1NOY A;  4FVU A;  4K8Z A;  4JKG A;  1VRT A;  4EHU A;  4ID5 A;  3TWH A;  3LZJ A;  3ISN C;  1XHX A;  4CZL A;  1Q18 A;  4AIL C;  3QB0 A;  1HKB A;  3K5M A;  2VG5 A;  1OH8 A;  2UXC K;  3E1Y A;  1IV0 A;  2BAN A;  3VGM A;  5HRN A;  1T44 A;  4B9S A;  3HBT A;  1C1C A;  5AFU A;  1HUX A;  3L4I A;  3O9S A;  3DLE A;  5BPL A;  5A2Q O;  2YHX A;  2KKZ A;  1U47 A;  2Z1J A;  1VAZ A;  4DSF A;  4DSJ A;  1QS4 A;  4C8N A;  1KXP A;  3AA2 A;  3KLE A;  5KQ8 A;  4CJF A;  3BF1 A;  4KTQ A;  2P9L B;  4CES A;  1X9J A;  4JS5 A;  1JXE A;  4DU3 A;  4B08 A;  4NXN K;  2D0P A;  1D9F A;  1Z05 A;  1R0A A;  3ID6 A;  3CC7 N;  1S9E A;  2O8E B;  4PKG A;  3SAF A;  4BG9 A;  4BE0 A;  1GLF O;  5SZT A;  3VQ4 A;  3ZSV A;  1U6Z A;  3TSU A;  5AQQ A;  3CCV N;  4JI2 K;  1CZB A;  3D2E B;  3WT0 A;  1TUU A;  1BIS A;  3DRR A;  1WOQ A;  3QEV A;  4CBW A;  1HPZ A;  1RDW X;  4LC9 B;  2YKM A;  1YIJ N;  3NFA A;  4GNI A;  3ZET A;  3N4P A;  4X64 K;  2LSN A;  5C24 A;  4YDU A;  2OZS A;  3OYJ A;  3U9D A;  4Z4E A;  3PUF A;  4FJI A;  3THY B;  1K8K B;  3FZF A;  3R8E A;  3SUP A;  3E9L A;  3FFK B;  5BR9 A;  4JI0 K;  5AFU H;  3J7A P;  2G8W A;  4KHW A;  3EY1 A;  1WSF A;  1YXQ A;  3MN9 A;  4CEE A;  3SV3 A;  4CI6 A;  5BN8 A;  4BRK A;  2I7N A;  4QS9 A;  1S1X A;  2GBZ A;  4CEA A;  1RNH A;  1S6P A;  1EET A;  3KLI A;  1FJG K;  5CYM A;  4CFD A;  2Q1N A;  1TKX A;  3OYA A;  2ZF5 O;  1VRU A;  1OVY A;  4DTO A;  1YJN N;  5SWM A;  5HBM A;  1IG9 A;  3THW B;  4W5O A;  4NB4 A;  3ENO A;  4GV9 A;  4IXC A;  1U2V B;  1RDA A;  1XUP O;  1SUQ A;  2XY6 A;  2NRX A;  5KQD A;  2HVH A;  4LF9 K;  2E20 A;  4O4G A;  3V1R A;  2HHQ A;  1VQ6 N;  1VQM N;  1EX4 A;  3QML A;  4BRD A;  1KVA A;  4RW6 A;  3CCQ N;  3NE6 A;  4HCB A;  4ELU A;  4QS7 A;  5DK5 A;  3VEV A;  4DG1 A;  5HLF A;  1KD1 O;  4LFA K;  4IFY A;  3J81 O;  3AO5 A;  3NVM A;  1S6Q A;  3C6T A;  1VQ9 N;  2WUS A;  1DGK N;  3VET A;  3HM8 A;  3M8P A;  3RWU A;  5DM7 L;  4E7H A;  2A41 A;  4ISG A;  4IEE A;  4HUE A;  4IJN A;  4JAX A;  4C23 A;  1G15 A;  1ZXO A;  3Q7C A;  5GAG P;  1BO5 O;  4BWM A;  3TAE A;  1WLJ A;  1P8Z A;  3OYC A;  2UUB K;  1YI2 N;  3G10 A;  3FGU A;  2V51 B;  2FSK A;  3MX2 A;  5B8H A;  3OYE A;  2ITM A;  1SL1 A;  1TYQ B;  1XC3 A;  2HB5 A;  2VG6 A;  2HW3 A;  4BRM A;  4RW8 A;  1WSG A;  1HQE A;  3RMB A;  3O9U A;  4J2E A;  1RTJ A;  3E01 A;  3M6G A;  1RT5 A;  5AQX A;  2QWL A;  1Z25 A;  3SZ2 A;  1NBW A;  1RBU A;  4NCA A;  3JS6 A;  3HOS A;  2O8C B;  4AH9 A;  4DR5 K;  1S9G A;  2P9P B;  3VEZ A;  4CFA A;  2OPP A;  2QI2 A;  3DM2 A;  4PY5 A;  3KLF A;  3T1H K;  4FJK A;  4LF4 K;  3QET A;  2D5R A;  2VG7 A;  4FWN A;  5M1F A;  3ITH A;  3QNO A;  2YJF A;  2ZJQ L;  4WYB A;  4A62 A;  1DLO A;  3ENB A;  4Z4G A;  4FWP A;  4IWV A;  3RMC A;  5LMN K;  1V4S A;  2PY5 A;  2NRV A;  3K9K A;  1T05 A;  2E2Q A;  1HNI A;  4JKE A;  3DWL A;  3MWP A;  2A1R A;  3U3G A;  3MMV A;  1S5J A;  3L2V A;  1S22 A;  1BU6 O;  4DQS A;  4CF9 A;  1W9H A;  5IT9 O;  3JXU A;  5KGX A;  5BRF A;  4B1Z A;  4JLH A;  4DF4 A;  1NGE A;  3VTH A;  1NJW A;  3SJH A;  1DTQ A;  3O6W A;  2YV0 X;  1ILY A;  4ISF A;  4PKI A;  2UXB K;  4OJR A;  2ATQ A;  3M3Z A;  4DQP A;  4IJA A;  4LH4 A;  2WON A;  1NGF A;  1CXQ A;  2HHS A;  4Z4I A;  3FZH A;  5LJV A;  3O1B A;  4EHT A;  3GL1 A;  4BR7 A;  1U2V A;  2RPI A;  4KI4 A;  1YUW A;  3NMU A;  3VEO A;  2Z1H A;  1GLJ O;  3UKR B;  2EWS A;  1LV5 A;  1GLA G;  4K42 A;  4FPA A;  3VQ8 A;  4BR4 A;  2R7Y A;  4CGG A;  4CZF A;  4CZJ A;  2QEX N;  1N6Q A;  1YHQ N;  1NKE A;  3SCX A;  4KHY A;  1HJR A;  3CCU N;  1E3M A;  1W97 L;  2IVN A;  3QBX A;  1XI1 A;  1RBR A;  3ULE A;  1XMQ K;  5C10 A;  4MLE A;  4KTW A;  3H08 A;  3BEX A;  4F8R A;  4J2D A;  4IO9 L;  1U48 A;  3KHY A;  2O8F B;  4E7I A;  1VSF A;  2O8D A;  3OY9 A;  2P9I A;  4JK9 A;  1UOC A;  3ULE B;  5AQP A;  4YOW A;  4DR4 K;  4M3W A;  3OYN A;  5GIO A;  4E7K A;  3NDK A;  5JS2 A;  3WNF A;  3L4Q A;  3AO3 A;  1F21 A;  1N34 K;  5JLH A;  4CCH A;  3R3L A;  3UKU A;  3CQY A;  4H5R A;  5AQN A;  2V52 B;  4PA1 A;  3ZYY X;  4LFC K;  4B9Q A;  3AVI A;  4CJT A;  4KKO A;  4FZZ A;  4F4K A;  3TU5 A;  3C0B A;  3VQA A;  2O4I A;  1ZYQ A;  3OYD A;  2HHW A;  1VSD A;  4CJW A;  3THX A;  2HHV A;  3VQ7 A;  3U8X A;  2X6S A;  3CCL N;  3VEW A;  4DLE A;  3RR8 A;  1VSM A;  1KC8 O;  4JI5 K;  2YNG A;  5I3U A;  4CZH A;  5LL6 Z;  1R59 O;  3ID8 A;  4I9Q A;  3RVC A;  1NK8 A;  3CJ1 A;  2O8C A;  5KPZ A;  1IBK K;  3C94 A;  5AQL A;  1K9M O;  1E4F T;  1RT4 A;  4H8K A;  1KAZ A;  3AVL A;  2HNZ A;  4CHN A;  2HND A;  4ZTJ A;  2NRZ A;  4R79 A;  3UIQ A;  2QXL A;  1NGB A;  3VQ5 A;  5CR4 A;  3B6O A;  2FC0 A;  5KPR A;  3QEW A;  3K5N A;  4DV5 K;  1XNQ K;  1RDD A;  3V1O A;  4DQ8 A;  3CC4 N;  2VGN A;  1K73 O;  4K8X A;  4B3O A;  3C65 A;  3LAN A;  4OKE A;  1JL2 A;  4A61 A;  4O55 A;  5J2Q A;  2CH6 A;  3LDQ A;  1QSY A;  1YJW N;  4OPA A;  4CHY A;  4HTU A;  1ZBF A;  1DKG D;  3DLL L;  2FXU A;  1J54 A;  4FLV A;  4IZ9 A;  2QWM A;  1HYZ A;  3PSF A;  3V9Z A;  4DS5 A;  5JVH L;  2P9N B;  4M3U A;  3DXM B;  1IKX A;  4CZM A;  4B3T K;  3HP9 A;  4Q0B A;  4KRE A;  3BF3 A;  4DS4 A;  4J8F A;  3GDQ A;  3OYK A;  3O9R A;  3EZ5 A;  4DTR A;  3LPU A;  4AM7 A;  1GLB G;  2GUI A;  1JCE A;  5FPD A;  4IG3 A;  4YY3 K;  3P5J A;  4XEI A;  4CGH A;  4GVM A;  3TAP A;  4KHN A;  3TAN A;  4KHQ A;  2QKB A;  3CD6 N;  3DRS A;  1JLG A;  2NZT A;  3CFP A;  4J2B A;  1RT3 A;  4RCH A;  4XH1 A;  2G8K A;  4N41 A;  2F8S A;  4C8O A;  4W5T A;  4BVP A;  3OBY A;  3OJU A;  4KBO A;  1X3N A;  3VF2 A;  5KI6 A;  1Q81 O;  1NKC A;  3TTC A;  5KGW A;  4B1V A;  1NU0 A;  3LAL A;  3RRG A;  4JRP A;  3HPG A;  3O80 A;  2ZE2 A;  1HYV A;  4CD3 A;  1C1B A;  2OZM A;  1JL1 A;  4W5N A;  4OGE A;  1S72 N;  5AZI A;  3C6H A;  1MA9 B;  3OHR A;  5C0Y A;  1TAU A;  1BCM A;  4FLX A;  1A5W A;  4KRF A;  4DTU A;  3AGR A;  5DMR A;  1QHT A;  5J2P A;  3LDS A;  3O5B A;  4L3Q A;  4Z4F A;  3R9P A;  4H4O A;  1I3A A;  3AVJ A;  5GAH P;  3LWL A;  5AQT A;  3VF4 A;  4L8R B;  1FK9 A;  3C7N A;  1Q8I A;  3UKU B;  2PYJ A;  2GEM A;  4EIA A;  2P9S B;  4DR3 K;  1JXB A;  3QFU A;  3AVH A;  2HF4 A;  5JS1 A;  1NJY A;  4PQU A;  4M41 A;  1VHX A;  4JI3 K;  3THX B;  4CJL A;  4CJU A;  3O4N A;  2OCE A;  3VQB A;  1BOT O;  1VSK A;  4X62 K;  3H3N O;  4CED A;  3OVN A;  5AZJ A;  4CHQ A;  5C42 A;  3RR7 A;  1J5E K;  4IOX A;  1YTA A;  1T6C A;  1MDU B;  1RFQ A;  3EO3 A;  2QM1 A;  5CYQ A;  2A3Z A;  4BVO A;  2ETJ A;  4YDU C;  3PX0 A;  4DSK A;  1RIL A;  4M42 A;  2PZS A;  2NRH A;  2GUP A;  1N32 K;  5C25 A;  3MEG A;  3KD1 E;  4JYA K;  2WOM A;  3IDH A;  4CHZ A;  1ZBH A;  3KLG A;  2AJQ A;  3HO1 A;  2KZZ A;  3QFP A;  4AHT A;  1VQO N;  1BQN A;  3M5R A;  4AQY K;  5I42 A;  4EP5 A;  1FKP A;  4DQI A;  3A5N C;  4CGI A;  3ZEU A;  2VCP A;  5GAD P;  1BCO A;  3SK3 A;  1UA0 A;  2VQF K;  1ATS A;  1NMN A;  4DFP A;  4BRL A;  1L3T A;  4B9U A;  3AO2 A;  3GBT A;  3FE1 A;  3H1V X;  4WE1 A;  3HTV A;  3CJB A;  3WNG A;  4DSL A;  3MDQ A;  3VQD A;  2CGL A;  5AQS A;  5CHI A;  1K8A O;  1KLN A;  4H5W A;  4BGB A;  1BIZ A;  3OYG A;  2NNW A;  1S1W A;  1E4G T;  1OH5 A;  4RTF D;  4DUY K;  2Q0U A;  4M3Y A;  3E9P A;  1U4B A;  1I39 A;  1N8R O;  4KPY A;  2HHU A;  2Q0R A;  2JGU A;  1S1U A;  1IKW A;  3VQC A;  4JI8 K;  4JD2 B;  3ZSX A;  3SQ4 A;  4FYD A;  3K0S A;  4JKD A;  1NGH A;  2E1Y A;  4DTX A;  3OS1 A;  3ZT1 A;  5AQZ A;  4DTJ A;  1SKS A;  4HVJ A;  3AVK A;  1LWE A;  2KZM A;  5JMV A;  1H1V A;  3RRH A;  4LSL A;  4DV3 K;  3RSE B;  3P4I A;  5AR0 A;  4JHD B;  3DI6 A;  3SQ2 A;  1W7A A;  4CGF A;  2E88 A;  4ILG B;  3V4I A;  1ASU A;  1JJ2 M;  3UKR A;  2Y1I A;  1SKR A;  3RSE A;  3ENH A;  3IS9 A;  5FPM A;  3PO5 A;  4DSE A;  3IMX A;  1XMO K;  3H6E A;  3D6R A;  3SNN A;  1WAF A;  3M8Q A;  1X9M A;  1HLU A;  3MN6 A;  5EOY A;  4FK0 A;  1XNR K;  5H1S Q;  3EKU A;  3THW A;  3QIO A;  3VTI A;  3ULD A;  2RE2 A;  2FSN A;  3SUQ A;  1D5A A;  3NGY A;  3VF6 A;  1D4X A;  3IKM A;  1VSI A;  3IG1 A;  3T19 A;  3QIC A;  2WFB A;  3T69 A;  3CJC A;  4E1N A;  1LCU A;  4PL7 A;  1GOA A;  1IBM K;  3KK1 A;  3C6A A;  3PX6 A;  4E1J A;  2CH5 A;  3E66 A;  4CJE A;  4Z4C A;  2HVI A;  4DV4 K;  1DEJ A;  3RMD A;  4FWR A;  1QZ6 A;  2BUP A;  3HK2 A;  3O3G A;  3TAF A;  4WFN L;  4O5F A;  3JAM O;  4BRA A;  3HVR A;  5J1E A;  4PHT X;  2B4J A;  4CZK A;  3A2F A;  4OLB A;  5ADX H;  2W6L A;  3AVG A;  4BQZ A;  3BUZ B;  1KVB A;  1JLF A;  2HMP A;  1ASW A;  1ZBS A;  4BDZ A;  4I2P A;  3V9W A;  3ATU A;  2JLE A;  4N76 A;  4KB1 A;  4CEQ A;  3VEX A;  4LF7 K;  3CET A;  1YJ9 N;  2UYT A;  1WSI A;  3WNH A;  4F9O A;  4BC3 A;  2Q2R A;  3SLC A;  3L2U A;  4IFV A;  1O13 A;  1C0U A;  4LD0 A;  4CHO A;  4YFU A;  3QEI A;  4KTZ A;  4M45 A;  4FW2 A;  4DQQ A;  3J80 O;  5HOO A;  3DLB A;  5DM6 L;  3S3N A;  4JKF A;  4O8K A;  4FK2 A;  2QXF A;  2Y1J A;  1C0G A;  4OPJ A;  2E5L K;  1X9S A;  3HRG A;  5AQV A;  3TAR A;  3TR8 A;  1KLM A;  2IS3 A;  2O8B B;  4C1N K;  4JK8 A;  4DU4 A;  4FLZ A;  1KVC A;  3OYL A;  3EL2 A;  1ATR A;  3SV4 A;  4FWQ A;  1KAY A;  4H0T B;  3EYZ A;  2OAN A;  3VQQ A;  3DOL A;  4CEO A;  2HHX A;  1ITG A;  3EKS A;  3MCP A;  4Z4H A;  3HYF A;  4PWD A;  3OTO K;  2P9L A;  3QO9 A;  4C8M A;  3VA3 A;  4AHU A;  4ZHR A;  3V9S A;  3A5L C;  3A5O C;  4JHD A;  4BGA A;  3OYF A;  4AHR A;  1RGI A;  4E3S A;  3CM6 A;  4OPH A;  3KK2 A;  3WXK A;  3SAG A;  4HHT A;  1B9F A;  3TTD A;  5LY3 A;  2KW4 A;  1NKB A;  2F9W A;  4CK2 A;  3V9U A;  3OYH A;  1NM1 A;  1FXX A;  3A0I X;  1I94 K;  1DT9 A;  1VQ5 N;  4OGC A;  4GV3 A;  4EFH A;  3ALY A;  3AAR A;  2X74 A;  1M1K O;  4EZ6 A;  2P9I B;  4ELV A;  2A42 A;  3F73 A;  2QW9 A;  2IGI A;  4JRQ A;  3CIP A;  4OKJ A;  2F96 A;  3SYZ A;  3P1G A;  3SUO A;  4CHP A;  3K5L A;  4DSI A;  4BC4 A;  3I0R A;  1QSS A;  5M1K A;  3HSC A;  4YOT A;  4BAC A;  2RHK A;  3KK3 A;  4NCG A;  1JLB A;  4OX9 K;  4BDP A;  1RT1 A;  4ELT A;  2YKN A;  3MED A;  3KWG A;  4IOA L;  5BRE A;  3QES A;  4JN4 A;  3PLA A;  3ZSO A;  1OH6 A;  3B6P A;  2IDO A;  1ZBU A;  2F7T A;  3SMP A;  3M8S A;  2IVP A;  2UU9 K;  3AO4 A;  2J4R A;  2F9T A;  1VK0 A;  1EQY A;  4FZX C;  4CF2 A;  2FSJ A;  1VSJ A;  5T7B A;  3QIN A;  3LDN A;  5EXW A;  4O44 A;  4H0V B;  3CC2 N;  1YT3 A;  2Q31 A;  2KHO A;  3IRX A;  3L8B A;  3FLC O;  1NWK A;  2D0A A;  2G8H A;  5AQY A;  2EX3 A;  4TSX A;  5FDL A;  3P83 D;  3O3F A;  2W42 A;  1QZ5 A;  2IVO A;  2KLA A;  4KO0 A;  4A2B A;  5CY4 A;  2WC9 A;  4FJX A;  4CF1 A;  4M3Z A;  4K41 A;  1RBT A;  4J2A A;  4CJK A;  3DXK A;  4DTN A;  2HNY A;  3LDP A;  4GVE A;  4CIG A;  3V81 A;  4DTP A;  3JSM A;  2YNF A;  4CFB A;  3IAY A;  1BIU A;  1B92 A;  3CER A;  5TKW A;  2O8F A;  4BRC A;  3CG7 A;  3ZET B;  3C7N B;  4K25 A;  1JLQ A;  4CF0 A;  4FWL A;  1NGI A;  2ZGZ A;  3NH0 A;  2X78 A;  3TAM A;  1HYS A;  5E84 A;  3UE5 A;  4LY7 A;  4WF9 L;  3ZX3 A;  3O8M A;  3SBG A;  1NJI O;  1W0H A;  2FBX A;  4X65 K;  4DWI A;  3EN9 A;  2B6A A;  2RF2 A;  1CXU A;  1GOB A;  1RTI A;  3DLK A;  3MN7 A;  5AQR A;  3WXM B;  1RDU A;  3VQ9 A;  1EP4 A;  3VER A;  1SZ2 A;  3DJC A;  3NCI A;  1HX1 A;  3NBP A;  2OA8 A;  3ZT2 A;  4CJV A;  4W5Q A;  2QWQ A;  4RW4 A;  3MWT A;  2YHA A;  4DFK A;  4ILH A;  4A5A A;  3O1W A;  1Y64 A;  1KRP A;  1NGJ A;  4Y0W A;  1WSE A;  1TAQ A;  4PKH A;  2P51 A;  3LPT A;  3MX5 A;  2YJE A;  2X6N A;  3G71 N;  2WBN A;  3HM9 A;  2NRR A;  2HST A;  3SAH A;  4CBU A;  4BG8 A;  3OA9 A;  4FWM A;  5C2D A;  1ESV A;  4BRN A;  1VQP N;  2O8E A;  4FOI A;  1SL2 A;  1VQ8 N;  1X9W A;  3CFO A;  5E41 A;  4JI6 K;  4LH5 A;  3NHG A;  2V7Z A;  2I5J A;  4B9M A;  4JV5 K;  3WQT A;  1BL3 A;  1D8Y A;  1J5O A;  3SQ1 A;  3NF9 A;  2O8D B;  3CJA A;  4F2S A;  1TK5 A;  2PFU A;  4BRE A;  1MWK A;  4N47 A;  3OYI A;  2P5O A;  1V4T A;  1JLE A;  5HRS A;  4CEC A;  1U45 A;  5FPE A;  3LDL A;  3VES A;  4KH4 A;  1L3V A;  2KFZ A;  1HJO A;  2GTD A;  4AF1 A;  4FJH A;  4WQ4 A;  4GKK K;  4FVM A;  1FKO A;  4KHS A;  4GW6 A;  2QK9 A;  4E19 A;  2F8T A;  1P90 A;  3BZC A;  4GY2 B;  5BRD A;  1TL3 A;  3HZ6 A;  5AQF A;  5M1O A;  3GE1 A;  1NK6 A;  4RWT A;  4O8U A;  2BTF A;  1W2B M;  3O4W A;  1OH7 A;  2W40 A;  2D0C A;  1IO2 A;  1EKE A;  4JKH A;  5AQJ A;  2NUB A;  3CCM N;  4BRO A;  1SQK A;  1C0T A;  1SV5 A;  4FCY A;  3PO4 A;  4CZI A;  3PIO L;  5BN9 A;  4BR2 A;  2YHW A;  3TSQ A;  3K58 A;  4H5V A;  4QAG A;  1Z26 A;  1NJZ A;  2HBK A;  2VWJ A;  2A6A A;  2JWL A;  4CF8 A;  2P9K A;  2VYP A;  2FBT A;  5FPN A;  3DYA A;  4OKK A;  5J2M A;  1K8K A;  3J7Z O;  4C1N I;  1IJJ A;  4F2R A;  4X66 K;  2RN2 A;  3DLH A; 
#chains in the Genus database with same CATH homology
 2JGU A;  1S1U A;  2YHB A;  3AO5 A;  2A1S A;  1IKW A;  1S6Q A;  3VQC A;  3C6T A;  3ZSR A;  3D0P A;  3ZSX A;  3HT3 A;  2OYQ A;  3SQ4 A;  3SPY A;  4FYD A;  2YNI A;  3HVT A;  4CGD A;  3PX4 A;  3M8P A;  3ZT0 A;  3RWU A;  3DMJ A;  4DTX A;  4CJ4 A;  3OS1 A;  4KB0 A;  3ZT1 A;  1X1P A;  4DTJ A;  1NOZ A;  3VA0 A;  4E7H A;  1SKS A;  4HVJ A;  1ZBL A;  1RCH A;  3AVK A;  4HUE A;  1LWE A;  2KZM A;  1G15 A;  4FJ7 A;  3RRH A;  4LSL A;  4BWM A;  3TAE A;  1J53 A;  1WLJ A;  1Y97 A;  3QEX A;  3OYC A;  4C8K A;  4CE9 A;  3G10 A;  3DI6 A;  3SQ2 A;  4F3O A;  4CGF A;  4CER A;  4BWJ A;  1C1A A;  3OYE A;  1SL1 A;  1NK0 A;  2HB5 A;  2VG6 A;  3LZI A;  3V4I A;  1A5X A;  2HW3 A;  4RW8 A;  1ASU A;  3CYM A;  2Y1I A;  4I9L A;  1SKR A;  2KFN A;  1WSG A;  4QCL A;  1HQE A;  4Y1D A;  4CEZ A;  3IS9 A;  3CFR A;  3RMB A;  1L3S A;  4CJ3 A;  4DSE A;  3PO5 A;  4J2E A;  3LP1 A;  4CK1 A;  1RTJ A;  2ZQB A;  3E01 A;  3K57 A;  4CJS A;  4RG8 A;  4CIE A;  2RKI A;  3SNN A;  1WAF A;  2HHU A;  1RT5 A;  3M8Q A;  1X9M A;  1RTH A;  3NF6 A;  4FLT A;  1Z25 A;  4B8A B;  3SZ2 A;  1RBU A;  3QLH A;  3TAB A;  4FK0 A;  4NCA A;  3LP3 A;  3THV A;  3BGR A;  4AH9 A;  3HL8 A;  1N5Y A;  1S9G A;  3QIO A;  4CFA A;  2OPP A;  3ULD A;  1EXQ A;  2KQ2 A;  5HRR A;  4O5B A;  3DM2 A;  3SUQ A;  4PY5 A;  1D5A A;  2Q3S A;  3KLF A;  3NGY A;  3F9K A;  3ZSW A;  4FJK A;  4KI6 A;  4E1M A;  2G8I A;  1TKT A;  1VSI A;  2Z1I A;  2D5R A;  3QET A;  3KTQ A;  2VG7 A;  3IG1 A;  3C95 A;  3T19 A;  3QNO A;  3ITH A;  1Q9Y A;  1YTU A;  1KCF A;  1NK4 A;  4E1N A;  4FM0 A;  1TK0 A;  2B5J A;  1GOA A;  1WNS A;  1DLO A;  1BGX T;  3JYT A;  1LW2 A;  4B9V A;  3KK1 A;  3SPZ A;  4Z4G A;  1RDC A;  3PX6 A;  4FJ8 A;  3RMC A;  4CJE A;  3SQ0 A;  4Z4C A;  2PY5 A;  2HVI A;  4FJL A;  2XHB A;  3RMD A;  1T05 A;  2Z1G A;  3CM5 A;  1HNI A;  1C0M A;  3HK2 A;  3O3G A;  4NCB A;  3ZSZ A;  4BDY A;  3TAF A;  4CIF A;  3OS2 A;  3SJJ A;  3HPH A;  2XY5 A;  4PUO A;  4B9N A;  2A1R A;  3U3G A;  1B9D A;  1T7P A;  1TKD A;  1S5J A;  3L2V A;  3HVR A;  4DQS A;  4FJ9 A;  1O1W A;  5J1E A;  1VSH A;  2B4J A;  5KRS A;  3L2Q A;  2G8F A;  4CF9 A;  1W9H A;  4Z0U A;  3A2F A;  1JLC A;  5KGX A;  2OPR A;  4EZ9 A;  4OLB A;  1BI4 A;  4ID1 A;  3HPO A;  3AVG A;  4JLH A;  1U04 A;  5HRP A;  4DF4 A;  4FM2 A;  1KVB A;  1JLF A;  1TV6 A;  3MEE A;  3MXI A;  1ASW A;  1NJW A;  4BDZ A;  1DTQ A;  4E0D A;  4I2P A;  3LP0 A;  3V9W A;  4FJJ A;  1Q9X A;  2YV0 X;  3LAK A;  4O0J A;  2BGG A;  1LAV A;  2JLE A;  2FBY A;  4KB1 A;  2XY8 A;  4N76 A;  4CEQ A;  2KTQ A;  4OJR A;  2ATQ A;  3NF8 A;  4DFJ A;  3MXM A;  3BDP A;  5FRM A;  3TAG A;  4DQP A;  4NYN A;  4E7K A;  4LH4 A;  2WON A;  1WSI A;  4FLY A;  1CXQ A;  2HHS A;  4Z4I A;  4AHS A;  3TI0 A;  3WNH A;  3L2U A;  2EHG A;  4IFV A;  1C0U A;  4LD0 A;  2RPI A;  4CHO A;  4YFU A;  1KTQ A;  3QEI A;  1JLA A;  4KTZ A;  4KI4 A;  2XY7 A;  4M45 A;  3ZSQ A;  4M3X A;  4B9L A;  3U6F A;  4FW2 A;  2Z1H A;  4DQQ A;  4ICL A;  1LV5 A;  4C8L A;  3AVC A;  1KFS A;  3DLB A;  3S3N A;  3AVB A;  4DF8 A;  1IKY A;  3VQ8 A;  2R7Y A;  4CGG A;  1NK5 A;  1VSE A;  4FK2 A;  2QXF A;  2Y1J A;  4I7F A;  1N6Q A;  4O0I A;  4OPJ A;  3VQE A;  4HUG A;  1X9S A;  2YNH A;  3SCX A;  4RW9 A;  3TAR A;  3TR8 A;  4KFB A;  1NKE A;  4KHY A;  1A5V A;  1KLM A;  2IS3 A;  3WNE A;  3DLR A;  3VQP A;  4AHV A;  1L3U A;  1HJR A;  4DU4 A;  1TVR A;  3V1Q A;  4DLG A;  1T8E A;  1XI1 A;  1RBR A;  4FLZ A;  2DY4 A;  1RT7 A;  3AV9 A;  2IAJ A;  1KVC A;  1WAJ A;  3AA4 A;  3KLH A;  3FFI A;  3OYL A;  4KTW A;  3H08 A;  4F8R A;  4J2D A;  1U48 A;  3NAE A;  3SV4 A;  4E7I A;  1VSF A;  3EYZ A;  2DFF A;  4CGJ A;  3VQQ A;  3OY9 A;  1UOC A;  4W5R A;  1TL1 A;  3DOL A;  4CEO A;  2HHX A;  3DRP A;  1ITG A;  5CZ1 A;  3ZT4 A;  4Z4H A;  4M3W A;  2HMI A;  3AO1 A;  3HYF A;  1BI4 B;  4KV8 A;  3OYN A;  5JS2 A;  3WNF A;  4OVL A;  3NDK A;  3AO3 A;  4PWD A;  1XWL A;  1F21 A;  4C8M A;  3QO9 A;  4CCH A;  3LAM A;  1RT2 A;  4B8C A;  3VA3 A;  4AHU A;  4ZHR A;  2XRI A;  1REV A;  3V9S A;  1BQM A;  4PA1 A;  3LP2 A;  3VQ6 A;  4LSN A;  3OYF A;  4HCC A;  3AVI A;  4AHR A;  4E7J A;  4E3S A;  4CJT A;  3CM6 A;  3MXJ A;  4KKO A;  1XHZ A;  4FZZ A;  3KK2 A;  4F4K A;  4FLU A;  3VQA A;  1RBS A;  2E6L A;  3KJV A;  1ZYQ A;  2O4I A;  1LWF A;  3OYD A;  3HJF A;  2HHW A;  1VSD A;  4CJW A;  2HHV A;  4HHT A;  1B9F A;  3VQ7 A;  5HRO A;  2X6S A;  1RBV A;  4DLE A;  4OPK A;  2KW4 A;  1K6Y A;  1VSM A;  1NKB A;  3RR8 A;  3KIO A;  2YNG A;  3C6U A;  5I3U A;  1QTM A;  3ASM A;  4CK2 A;  3V9U A;  2O4G A;  3KKS A;  4R5P A;  4N56 A;  3OYH A;  3HST B;  1YVU A;  1FXX A;  4IDK A;  3OJS A;  4I9Q A;  3PV8 A;  1SL0 A;  1T03 A;  1NK8 A;  2HHT A;  4DSI A;  1TK8 A;  5KTQ A;  3NH1 A;  3SUN A;  4OGC A;  2OPQ A;  3C94 A;  2P5G A;  3ALY A;  1RT4 A;  4H4M A;  2X74 A;  4EP4 A;  4EZ6 A;  4H8K A;  4KHU A;  3AVL A;  2HNZ A;  4CHN A;  4ELV A;  2HND A;  4ZTJ A;  3F73 A;  2IGI A;  3UIQ A;  4JRQ A;  3NF7 A;  4OKJ A;  3VQ5 A;  2PYL A;  2F96 A;  1QE1 A;  3B6O A;  2FC0 A;  3P1G A;  3AVM A;  3L2R A;  4CHP A;  3K5N A;  3K5L A;  1RDD A;  3SYZ A;  3QEW A;  3SUO A;  3DLH A;  3I0R A;  3V1O A;  4Q5V A;  4FLW A;  3ZCM A;  1QSS A;  4QOZ B;  4K8X A;  1ZBI A;  4BAC A;  4B3O A;  3K59 A;  3KK3 A;  3LAN A;  4NCG A;  1JLB A;  4OKE A;  1JL2 A;  4M3T A;  4O55 A;  4GMJ B;  5J2Q A;  1QSY A;  4DTM A;  4BDP A;  1CZ9 A;  1RT1 A;  4ELT A;  4CHY A;  3D45 A;  2YKN A;  3MED A;  1ZBF A;  4HTU A;  3OS0 A;  4DU1 A;  4F3T A;  3QES A;  1KFD A;  3HXM A;  4RW7 A;  1J54 A;  2FBV A;  3ZSO A;  3NGI A;  3B6P A;  4FLV A;  2IDO A;  1ZBU A;  2BE2 A;  1HYZ A;  3TAQ A;  3M8S A;  3V9Z A;  4DS5 A;  1SKW A;  3AO4 A;  4FJM A;  1VK0 A;  4FZX C;  4CF2 A;  1UWB A;  1ASV A;  4FW1 A;  4M3U A;  3L3V A;  4E7L A;  4FJG A;  3V9X A;  1QQC A;  1TGO A;  4IKF A;  1VSJ A;  1LAW A;  1IKX A;  5T7B A;  3QIN A;  4Q0B A;  3HP9 A;  3LWM A;  4KRE A;  4O44 A;  4DS4 A;  4KPY A;  1HNV A;  3DOK A;  3DLG A;  3OYK A;  3QIP A;  1L5U A;  1YT3 A;  3MAQ A;  1DTT A;  4CK3 A;  3IRX A;  3EZ5 A;  3L8B A;  2DTU A;  2D0A A;  2G8H A;  4B9T A;  3VN5 A;  4DTR A;  2IOC A;  3LPU A;  2EX3 A;  5HP1 A;  4YNQ A;  2G8V A;  2GUI A;  3KD5 E;  1RDB A;  4TSX A;  4IG3 A;  1S1T A;  3MEC A;  3P5J A;  5FDL A;  3P83 D;  4NYF A;  4CGH A;  4DTS A;  4GVM A;  3O3F A;  3TAP A;  4KHN A;  2W42 A;  4AHC A;  4CFC A;  3TAN A;  4BE1 A;  1UA1 A;  4KHQ A;  4KO0 A;  2QKB A;  1UAX A;  3DRS A;  5CY4 A;  4FJX A;  4CJ5 A;  4CF1 A;  4M3Z A;  1D9D A;  1J9A A;  3T3F A;  4OLA A;  3O3H A;  1RBT A;  1JLG A;  3HP6 A;  1VSL A;  5EU7 A;  3CFP A;  4J2A A;  2G8U A;  1HRH A;  4CJK A;  4J2B A;  1RT3 A;  4CJQ A;  1WN7 A;  3I0S A;  3QEP A;  2G8K A;  4DTN A;  2HNY A;  4FZY A;  3L3U A;  3PY8 A;  4FJN A;  4MFB A;  4N41 A;  2F8S A;  4C8O A;  3CQ8 A;  4W5T A;  3OJU A;  4CIG A;  1NOY A;  4K8Z A;  1VRT A;  3V81 A;  4DTP A;  3JSM A;  2YNF A;  4CFB A;  3IAY A;  4ID5 A;  1BIU A;  5KI6 A;  1B92 A;  3LZJ A;  3ISN C;  1XHX A;  3TWH A;  1NKC A;  4Y1C A;  3AA3 A;  1U49 A;  3CG7 A;  4AIL C;  5KGW A;  3K5M A;  2VG5 A;  1JLQ A;  3LAL A;  4CF0 A;  3RRG A;  2BAN A;  4JRP A;  3ZT3 A;  3HPG A;  4CJP A;  5HRN A;  3NH0 A;  4B9S A;  1C1C A;  1IH7 A;  2ZE2 A;  1HYV A;  4N5S A;  2X78 A;  1C1B A;  1LWC A;  2OZM A;  3TAM A;  3DLE A;  3U3Y A;  1HYS A;  1JL1 A;  4W5N A;  4OGE A;  4IBN A;  2VWK A;  1U47 A;  4DMN A;  4LY7 A;  1TAU A;  1BCM A;  2Z1J A;  3AVN A;  4DSF A;  4FLX A;  4DSJ A;  1QS4 A;  1A5W A;  1W0H A;  1WSH A;  2FBX A;  4KRF A;  1XC9 A;  4C8N A;  3RTV A;  3AA2 A;  4DTU A;  4DWI A;  3NH2 A;  3KLE A;  4CJF A;  1S1V A;  4KTQ A;  2B6A A;  3QNN A;  5DMR A;  1QHT A;  2RF2 A;  4CES A;  5J2P A;  5FRN A;  4JS5 A;  3LDS A;  1CXU A;  3DLK A;  1JXE A;  1C6V A;  1GOB A;  1RTI A;  3AVA A;  4B08 A;  4DU3 A;  3VQ9 A;  4Z4F A;  3T1A A;  4H4O A;  4FXD A;  1I3A A;  3AVJ A;  1EP4 A;  3LWL A;  4L8R B;  3NCI A;  1D9F A;  3RMA A;  3NBP A;  1FK9 A;  4DQR A;  1Q8I A;  3ZSY A;  3I8D A;  3ZT2 A;  2OA8 A;  4CJV A;  4W5Q A;  2PYJ A;  4RW4 A;  3K2P A;  1R0A A;  1S9E A;  2YHA A;  4DFK A;  3AA5 X;  3S3M A;  2QKK A;  4BE0 A;  3OYB A;  3S9H A;  4BE2 A;  1JXB A;  2OPS A;  3AVH A;  5SZT A;  5JS1 A;  3K5O A;  3VQ4 A;  3ZSV A;  1NJY A;  4PQU A;  2D0B A;  4M41 A;  1KRP A;  4CJL A;  1WSE A;  1TAQ A;  1CZB A;  1BHL A;  2P51 A;  3LPT A;  3O4N A;  4CJU A;  3M8R A;  1IKV A;  1BIS A;  3VQB A;  1HMV A;  2X6N A;  3DRR A;  1VSK A;  3HM9 A;  1TKZ A;  4CED A;  1WSJ A;  3QEV A;  3OVN A;  1HPZ A;  4CHQ A;  5J2N A;  1SL2 A;  2YKM A;  5C42 A;  4UQG A;  3CFO A;  3NFA A;  1X9W A;  5E41 A;  1RTD A;  3RR7 A;  1YTA A;  3L2W A;  1NJX A;  5D3G A;  2LSN A;  4LH5 A;  5C24 A;  3NHG A;  4M3R A;  2OZS A;  3G0Z A;  3OYJ A;  1GOC A;  4IG0 A;  2I5J A;  3PUF A;  4Z4E A;  4B9M A;  4FJI A;  1BL3 A;  3OYM A;  5CYQ A;  3SUP A;  1D8Y A;  1HQU A;  1J5O A;  3SQ1 A;  2ETJ A;  3NF9 A;  4HUF A;  2G8W A;  3PX0 A;  4DSK A;  1RIL A;  4CEB A;  4F2S A;  1LW0 A;  4KHW A;  1CLQ A;  4ZTF A;  5KRT A;  3EY1 A;  1TK5 A;  5K14 A;  1WSF A;  4M42 A;  4CEE A;  4FM1 A;  3O4Q A;  2PZS A;  3SV3 A;  4N47 A;  3V6D A;  2IC3 A;  3OYI A;  1KSP A;  1NK7 A;  4DFM A;  2P5O A;  1JLE A;  5HRS A;  1S1X A;  2GBZ A;  4CEA A;  5C25 A;  1RNH A;  3MEG A;  1S6P A;  1EET A;  3KLI A;  4CEC A;  2XO7 A;  3KD1 E;  2WOM A;  4CHZ A;  1U45 A;  1ZBH A;  5CYM A;  1MU2 A;  4CFD A;  3KLG A;  1L3V A;  3HO1 A;  2KFZ A;  2AJQ A;  4G1Q A;  4E89 A;  4JS4 A;  1TKX A;  2KZZ A;  4FJH A;  4FVM A;  4AHT A;  1QSL A;  1FKO A;  4KHS A;  1BQN A;  3OYA A;  1NK9 A;  5I42 A;  2E6M A;  4GW6 A;  1VRU A;  4E19 A;  4EP5 A;  2F8T A;  2QK9 A;  4DTO A;  1FKP A;  2DFE A;  2BDP A;  4DQI A;  1TL3 A;  4CGI A;  5SWM A;  1NK6 A;  5HBM A;  5CZ2 A;  1IG9 A;  4W5O A;  1BCO A;  3KKR A;  2GV9 A;  1UA0 A;  2D0C A;  4CEF A;  2E4L A;  1IO2 A;  4DFP A;  1EKE A;  4FK4 A;  4MQ3 A;  4KAZ A;  4CJR A;  1RDA A;  2NUB A;  1L3T A;  1SUQ A;  2XY6 A;  4B9U A;  3AO2 A;  4FJ5 A;  2HVH A;  1C0T A;  1SV5 A;  2ITG A;  4FCY A;  3PO4 A;  4O4G A;  3V1R A;  2ZD1 A;  4WE1 A;  3SI6 A;  3S3O A;  2HHQ A;  4DSL A;  3WNG A;  3K58 A;  4QAG A;  1U4B A;  1EX4 A;  1Z26 A;  3VQD A;  1KVA A;  4RW6 A;  1NJZ A;  3QER A;  3NGZ A;  5FRO A;  1KLN A;  2VWJ A;  2P1J A;  4XIU A;  3NE6 A;  2DFH A;  4CF8 A;  4ELU A;  4HCB A;  1BIZ A;  1RT6 A;  2FBT A;  3OYG A;  3DYA A;  5DK5 A;  4OKK A;  1S1W A;  5J2M A;  4I2Q A;  4DG1 A;  3AVF A;  5HLF A;  4F2R A;  4M3Y A;  2RN2 A;  1I39 A;  1JKH A;  4IFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...