1KVCA

E. coli ribonuclease hi d134n mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCNELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Endoribonuclease
total genus 53
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvcA00
1RNHA 4DSEA 4KHUA 4KI6A 1HPZA 1VSJA 3ITHA 1CXQA 3NF7A 5KGXA 4E89A 3CFRA 4BDYA 3VA3A 2WONA 4B9TA 4BDZA 3QNNA 2HHWA 2VG6A 1DTTA 4GW6A 5HRRA 1LAVA 4HUFA 1NK0A 3DRSA 2HHVA 1S6QA 3ALYA 4DQPA 3SYZA 4DTRA 2KTQA 1U45A 1BQMA 1TKTA 1VSIA 1S1UA 2DFEA 4AHRA 4PA1A 4DF8A 3RWUA 5FRNA 2BE2A 3OYJA 5SZTA 4IBNA 2OYQA 3OJUA 4KFBA 3DOKA 2VWJA 1C1AA 4CEZA 3KLFA 3K5LA 2JGUA 3TAMA 3F9KA 3QETA 1RT6A 5KGWA 3VQ5A 3KK3A 4B08A 3LDSA 3PX0A 3LWMA 1ZBIA 2YHAA 3SPYA 4FJ8A 1QE1A 1JLEA 2VG5A 3VQPA 3AA5X 1ZYQA 3KLGA 4LSLA 3DM2A 3O4QA 2FBTA 2HNDA 2LSNA 3V1OA 4Z4FA 2X78A 1VSFA 1RDCA 3OYKA 4DTJA 2G8UA 4KV8A 1TKZA 1HNIA 4BWJA 1TK0A 4FJHA 3MEGA 1HQUA 4M3WA 4CEAA 5HRNA 2E6MA 1WSEA 2XY5A 3VQBA 4N56A 2G8HA 1XHXA 4LY7A 3SPZA 2HHQA 1RBRA 3DYAA 1XI1A 3ZSZA 4M3TA 1QS4A 3LP3A 2YNFA 4CFBA 1TV6A 2AJQA 1D9FA 1QSSA 4FJKA 1VSLA 4PUOA 3NHGA 1WSHA 4TSXA 1T8EA 4I7FA 1Z26A 2ATQA 1NJZA 2XHBA 4FJJA 2YNIA 5KRSA 5E41A 1NOYA 1NK6A 3AO2A 4RW7A 3QERA 3NFAA 4OPKA 3NE6A 2QKBA 1VSEA 2HVIA 4CEDA 5HROA 4OKJA 3AO1A 4FCYA 4BE1A 4RW6A 3ZT4A 2Y1IA 3T3FA 4DS4A 4JRPA 2F96A 1LAWA 4KRFA 4DTNA 5FROA 2RN2A 4C8KA 4O55A 3ZT2A 4FZXC 2G8FA 4KB0A 3RMCA 2P5GA 2RPIA 4I9QA 2RKIA 4CHOA 3TARA 1NK5A 3U6FA 3OYFA 3HPOA 4CHYA 2Z1HA 4KHYA 4CJPA 3SQ4A 2I5JA 4CJRA 1HRHA 1S9GA 4N76A 1FK9A 4DTXA 4ZTJA 2YNGA 2R7YA 4CJUA 2ZD1A 3P5JA 4FZZA 2A1RA 3AVBA 5DMRA 3HVRA 1GOCA 4CF2A 3ULDA 4DSFA 4KHWA 4E7IA 4J2BA 2KZZA 3V9WA 3TABA 3QEPA 4H4MA 4KHQA 4RG8A 5T7BA 4CJKA 4M3RA 4YNQA 1L5UA 3DI6A 1JXBA 3BDPA 4HUEA 5CYQA 4DU4A 1T7PA 1LWFA 4KTQA 1S1VA 3VQ7A 3BGRA 3LALA 3AVNA 3MAQA 2IC3A 2ITGA 4FW1A 4AHUA 3A2FA 2KFZA 1BGXT 1SKRA 3ZT1A 4Q0BA 1J53A 3ZSQA 4CJ3A 3L2UA 1LW2A 1G15A 1RBVA 4Y1CA 4MQ3A 4FVMA 3HYFA 5J2QA 3JSMA 1RTIA 4CFDA 3TAEA 1CLQA 4CJEA 3M8PA 4CEQA 3MEDA 4J2DA 4B9VA 1RBSA 1X9SA 4NCBA 3SNNA 3SJJA 1NJWA 4IG3A 1DTQA 3OYEA 3CM6A 2YNHA 3I8DA 2FBXA 3ASMA 4UQGA 3M8QA 4CE9A 4JS4A 4ELUA 2GUIA 3VQDA 3DLRA 3DLKA 4FJ7A 5CY4A 4Z4IA 1T03A 1RT2A 1UA1A 1RT4A 2F8SA 1GOBA 4ICLA 3NGZA 5D3GA 3AVLA 4GMJB 5K14A 3C6UA 3QEIA 2PZSA 1TVRA 4FK2A 1A5XA 1UOCA 4FM2A 3TAPA 4CJSA 1CZBA 4O5BA 4CIEA 4FLXA 2X74A 3LWLA 5HLFA 1BCOA 2D0CA 3LP1A 3CFOA 4FLUA 3RMDA 5KI6A 4DWIA 3PX6A 1RBTA 5C25A 3NF9A 3AVCA 4E7LA 2P1JA 2HHSA 1ASWA 3O3FA 1RT5A 4CEOA 4W5RA 4NCAA 3OYCA 4M45A 3QINA 3QLHA 4KHSA 1K6YA 2JLEA 2YHBA 3DLGA 4FJ9A 4CF9A 4RW4A 4DMNA 1TAUA 2WOMA 1KCFA 2G8KA 2IGIA 3DLBA 3MEEA 4DFMA 4C8OA 1RCHA 4CHNA 4HCBA 4I2QA 3AVJA 2A1SA 1ZBUA 3AVGA 1F21A 4EP5A 4Q5VA 4GVMA 3RRHA 4KAZA 4Y1DA 4OLAA 3EZ5A 1TK5A 3TAQA 4ID5A 3SV3A 4DS5A 4DSLA 4HCCA 3NH1A 2KQ2A 3V1QA 3K58A 2X6SA 3FFIA 4W5TA 3PO4A 1IO2A 4IFYA 3MECA 3D45A 2HHXA 1U04A 4BWMA 4KO0A 2DY4A 1JL2A 2QKKA 3HO1A 4AH9A 4BDPA 1YVUA 3KK2A 3VQ6A 1VSMA 1JKHA 2ETJA 1XC9A 3NAEA 1XHZA 4E1NA 1Z25A 3B6OA 3PX4A 3RRGA 4C8LA 4FZYA 4PQUA 1ASUA 4KPYA 4OGEA 4DQQA 3G0ZA 1U48A 3AO3A 3AVAA 4Z4GA 1KVBA 1S6PA 2FC0A 1LW0A 4OKEA 4HHTA 4NYFA 4I9LA 3NGIA 1TK8A 3OS2A 3K5NA 4JLHA 2F8TA 3LPTA 4CGJA 4B9UA 1IKWA 4CGHA 1JXEA 4DG1A 3VQCA 1HQEA 3OYLA 1W9HA 3VQ9A 4CHQA 3IAYA 1KLNA 4AHCA 3VN5A 4J2EA 1Y97A 3HM9A 3CFPA 1NK9A 2E4LA 1RTHA 2RF2A 4M3ZA 1FKOA 3LANA 1QSLA 3RR7A 3QEVA 1LWCA 1A5VA 3QO9A 4AHTA 3OS1A 1WSGA 3HPHA 1U47A 3KD5E 4LH5A 4RW9A 2OPSA 4NYNA 3QESA 3NF6A 2DFHA 4CF8A 4E7JA 4CGIA 3HPGA 1J9AA 1KVAA 4I2PA 4IFVA 4LD0A 4FK4A 1BHLA 2D0AA 1RILA 3DMJA 3NDKA 4FLVA 2Q3SA 5HRPA 4ZTFA 4ELVA 3MXJA 2NUBA 1IG9A 2X6NA 3PO5A 4CERA 4HVJA 3SQ1A 4KTWA 3V9XA 4DQSA 4CEEA 3EYZA 3KK1A 2VG7A 1C1CA 1RTJA 1EP4A 4EP4A 5KRTA 3NCIA 3L8BA 4JS5A 3V9UA 3QNOA 3P1GA 4E0DA 1BIUA 1D9DA 5FDLA 4M3XA 4L8RB 4CJQA 1C0MA 4O44A 3ZSOA 1REVA 4C8MA 1VRTA 3ISNC 1WAJA 1QTMA 3DRPA 4KB1A 5J2MA 3LAMA 4E3SA 3T19A 3OYDA 1WSFA 2VWKA 4DSIA 1JLQA 4FLZA 3AVKA 4H8KA 2HMIA 1L3VA 1N6QA 2HHTA 1RDAA 3DRRA 3P83D 2E6LA 3HXMA 3PY8A 3OYNA 3KD1E 4K8XA 3D0PA 3KTQA 1IKYA 4DF4A 4K8ZA 3L3UA 3K57A 4CF0A 4B9MA 4CCHA 1KTQA 2Z1JA 4FJNA 2G8IA 4QCLA 4CEBA 2D5RA 3ZCMA 4B8AB 2KFNA 4DTSA 1LWEA 4O4GA 2XO7A 3DLEA 3SUNA 2G8WA 3LPUA 3U3GA 3V1RA 4F8RA 1CXUA 4DFPA 3ZSRA 3SI6A 3MXIA 4Z4EA 3OVNA 3SV4A 4FJXA 3U3YA 4ZHRA 4W5NA 3AVMA 3LAKA 2OA8A 3AVHA 4E1MA 3HL8A 1HYVA 3NF8A 4CGDA 1KFSA 4CGGA 5J2PA 4B3OA 2B6AA 1S5JA 3L2RA 3S3MA 4M3UA 3S9HA 1NK7A 4E19A 3K59A 3OS0A 2BDPA 1TAQA 3VQAA 1I3AA 1WAFA 1FXXA 2IOCA 3AA2A 4W5OA 4AHSA 4F4KA 1VRUA 2ZE2A 1B9FA 3SQ2A 5CZ1A 4EZ6A 3H08A 3CM5A 1ZBLA 2QK9A 2OPPA 3HP9A 1J54A 1U4BA 1NJYA 4OJRA 3HJFA 1X9MA 4CF1A 1HMVA 2B4JA 3OYAA 2BANA 3ZT0A 4KTZA 1WSJA 1Q9XA 4KKOA 3WNGA 2YKNA 1ASVA 2IS3A 3OYMA 1RBUA 2O4IA 1SL2A 2HHUA 4G1QA 1NKEA 1KVCA 3UIQA 3TI0A 3VQ4A 3ZSVA 3C6TA 1X9WA 2OZSA 1WNSA 4CJFA 2XY8A 1JLFA 3NH2A 3VA0A 4FJGA 4N47A 1IKVA 3K2PA 2PY5A 4FYDA 1C6VA 4YFUA 4IDKA 4OKKA 3WNFA 5C42A 4E7HA 4DFKA 2XY6A 5CZ2A 1QSYA 3RR8A 4CGFA 1NK4A 4NCGA 4XIUA 4FJ5A 4F2RA 1TKDA 4C8NA 1KRPA 2GBZA 4KHNA 3LP2A 4CJLA 1B92A 1JLBA 2HNYA 3AVIA 2B5JA 4F2SA 3MXMA 1BISA 3HP6A 3E01A 3TR8A 1XWLA 3SUPA 3O3GA 3HSTB 3AV9A 4KI4A 4FK0A 4DLGA 3IS9A 4F3OA 4N41A 3C94A 2PYJA 4DQIA 1RT7A 1RT1A 3LZIA 4WE1A 1JLAA 3JYTA 4DU1A 4LSNA 3TAFA 5I42A 1SL1A 3OYGA 4R5PA 3L2QA 3L2VA 3V6DA 1L3UA 1C0UA 2OZMA 3QIOA 4O0IA 3IG1A 3V9SA 3KLHA 1SUQA 4B9LA 2Z1IA 1IKXA 1W0HA 4OVLA 2Z1GA 4Z4CA 3NH0A 4CEFA 1S1WA 3HT3A 3TANA 4CJ4A 3F73A 3LP0A 1UWBA 3WNHA 1O1WA 3C95A 3RMAA 4FJLA 1A5WA 3O4NA 2EHGA 3AO5A 3KKRA 5HP1A 3WNEA 1S9EA 3DOLA 3TAGA 2DFFA 4E7KA 1X1PA 1B9DA 4CJVA 3OYHA 1D8YA 3ZT3A 2ZQBA 4CJWA 2KW4A 3SUQA 3S3NA 1JLGA 2EX3A 2HB5A 1J5OA 4ID1A 4HTUA 1EKEA 3VQQA 3PV8A 1JLCA 2QXFA 1I39A 2YKMA 4O0JA 5CYMA 4M3YA 4OLBA 3OJSA 4DFJA 1EXQA 1GOAA 1S1TA 4DTPA 3S3OA 2DTUA 1JL1A 4CIGA 4BE0A 4DTMA 4CK2A 4MFBA 4B8CA 5C24A 2GV9A 5J1EA 3CQ8A 1R0AA 1RDDA 1BQNA 1ZBHA 3SZ2A 3AA4A 4DTUA 2FBVA 4EZ9A 4FXDA 3IRXA 3CYMA 5HBMA 1QHTA 3L2WA 4AILC 3G10A 4IG0A 2OPQA 1S1XA 4CJ5A 1HYSA 1HNVA 4CECA 1SKWA 4FJMA 1C0TA 4J2AA 4AHVA 4CFAA 4FLYA 3L3VA 3ZSXA 3DLHA 5HRSA 5J2NA 4ELTA 4FM1A 4OPJA 4DQRA 4M42A 1SV5A 3NGYA 3V9ZA 2P51A 3KIOA 4B9NA 1YT3A 4FW2A 3K5MA 1KSPA 4BACA 1N5YA 4IKFA 1UAXA 1MU2A 1BL3A 1VSHA 1QQCA 3HVTA 4CK1A 3OY9A 2W42A 3AA3A 2YV0X 3B6PA 1CZ9A 3KKSA 3OYBA 4CK3A 4FM0A 1NJXA 2XY7A 2Y1JA 3SQ0A 3QEXA 1UA0A 4DU3A 1D5AA 1NKCA 4FLTA 2HW3A 1KFDA 3EY1A 1YTAA 1LV5A 1YTUA 4KREA 1BCMA 1RDBA 1Q9YA 3ZSYA 4B9SA 4CJTA 3M8SA 1C1BA 2IDOA 1BI4B 2BGGA 4H4OA 1L3SA 4N5SA 4M41A 1TL1A 3TWHA 1WLJA 5FRMA 5JS2A 3KLEA 1ITGA 4CFCA 2FBYA 2KZMA 1VSKA 4HUGA 3OYIA 1BI4A 4W5QA 4LH4A 1HJRA 1TL3A 4DLEA 1NKBA 3KLIA 3LZJA 5JS1A 3V81A 4FLWA 3M8RA 2D0BA 1SL0A 3VQEA 2HVHA 2P5OA 3K5OA 4RW8A 5SWMA 1TKXA 3KJVA 2IAJA 1EX4A 1RT3A 2HNZA 3RTVA 1L3TA 4CESA 2PYLA 1BIZA 4CHPA 3I0RA 3V4IA 4F3TA 3O3HA 4Z0UA 1TGOA 3PUFA 3AVFA 1WN7A 4CIFA 5EU7A 3QIPA 3VQ8A 4PY5A 3THVA 1NK8A 2G8VA 4OGCA 4CHZA 3RMBA 1U49A 4QAGA 1EETA 1SKSA 5KTQA 3SCXA 1NOZA 1IH7A 3SUOA 1ZBFA 2OPRA 1VSDA 5I3UA 4JRQA 1WSIA 1FKPA 2XRIA 1DLOA 1KLMA 3I0SA 3QEWA 2O4GA 4Z4HA 4QOZB 1Q8IA 4DSKA 1VK0A 4FJIA 3HK2A 4BE2A 5DK5A 1RTDA 1T05A 3AO4A 3NBPA 3T1AA 4DTOA 4DSJA 1HYZA 3ZSWA 4PWDA 3CG7A
chains in the Genus database with same CATH superfamily
4DSEA 3DXMB 2V51B 4KI6A 1HPZA 3NF7A 4E89A 4JKEA 2WONA 2HHWA 1LAVA 4BRGA 5FPMA 1BOTO 5M1OA 4JEPA 1VSIA 1S1UA 4DKWA 1BA1A 1BUPA 5KPRA 3OYJA 5SZTA 4IBNA 1K73O 3E9OA 5BRFA 3F9KA 1RT6A 4B08A 3A5NC 3PX0A 4M7YA 1BDGA 3AA5X 5GADP 4LSLA 5AR0A 2A41A 2Q1NA 3GOIA 3BF1A 3H46O 4BWJA 4FJHA 2XY5A 4N56A 1NMDA 1XHXA 4LY7A 1Z6RA 1XI1A 1U6ZA 2YNFA 3ULEA 4JV5K 4PUOA 4OPHA 4M7XA 2QWLA 2XHBA 4FJJA 4RWTA 3GL1A 2NRRA 4OPKA 3ENOA 2PAVA 5DM7L 3BP8A 2O8FB 3AO1A 2V7ZA 4FCYA 4RW6A 3ZT4A 3VF6A 4GV6A 2F96A 2E88A 3FZHA 4LFBK 4JI4K 4U67L 2ZGYA 3ZT2A 3RMCA 2P5GA 1X3NA 4KHYA 2HMPA 1HRHA 3TTDA 5AZIA 1FK9A 4DTXA 4H5TA 1RFQA 3P5JA 2KKZA 3AVBA 3AAPA 5DMRA 5EX5A 4E7IA 5HOOA 4J2BA 2DPNA 1VQKN 4KHQA 3CCLN 5M1FA 3DI6A 4DU4A 3O9QA 3VQ7A 4O8KA 5EOYA 2IC3A 4DR1K 2KFZA 1BGXT 3CJ7A 3O80A 4WFAL 4Q0BA 1G15A 1RBVA 4ISEA 4BRMA 5M1NA 3HI0A 3HYFA 1RTIA 4CFDA 1VAZA 3IMXA 4JKAA 3A5OC 1CLQA 4MO4A 4CEQA 1E4GT 5AQPA 2A40A 1NJWA 4H03B 1Z05A 3T69A 3GG4A 3ASMA 5KPZA 4UQGA 3M8QA 3C6AA 4ELUA 2QWOA 3DLKA 4H0TB 3VGKA 3R6MA 3NGZA 2O8BA 4DV3K 4FL9A 5K14A 2PZSA 3D6RA 3LWLA 2D0CA 3CFOA 1BA0A 1RBTA 2QI2A 2HHSA 2P9IA 1HLUA 1RT5A 1E4FT 1K6YA 4BRDA 1TAUA 4C8OA 4I2QA 2E2QA 2E1ZA 3WUHA 1NGEA 4JKBA 4Y1DA 4BR7A 1FW6A 3EZ5A 3WQTA 1TK5A 4ID5A 3NH1A 1S22A 3K58A 3FFIA 4W5TA 1W7AA 3PIPL 3O1WA 2HHXA 3CF5L 3CCVN 4LF4K 3KK2A 2P9NA 1VSMA 3NAEA 3RRGA 1U48A 1N32K 4YOXA 3DJCA 1S6PA 4HHTA 4BRQA 3K5NA 1YF5L 3LPTA 3G6EN 4DR5K 4JHDA 1KD1O 4B9UA 4IO8A 1ZBSA 3P31A 4H5RA 4CHQA 3VN5A 3U8XA 3CFPA 3HOTA 1RTHA 3QEVA 4BRLA 2OPSA 4NYNA 1ATRA 4QS7A 2DFHA 3HPGA 3OBWA 4J2EA 4ELVA 4IJNA 5C10A 5HRPA 4FLVA 2CGLA 1IG9A 4KTWA 3T1YK 3WXJA 4DV0K 4BGBA 4EP4A 1WB9A 4V19S 4M3XA 5FDLA 4L8RB 5M1QA 1C0MA 3ZSOA 1REVA 3O5BA 3OYDA 3L4IA 4FLZA 1N6QA 3O9SA 1OH6A 3KTQA 3L3UA 3K57A 4CF0A 4CCHA 4QCLA 4DTSA 4F8RA 1CXUA 3KWGA 3MXIA 3LAKA 3L6QA 3D2FA 4FPAA 2YCHA 3L2RA 3S3MA 4E19A 3U9ZA 3K59A 1Y64A 4DR2K 4X66K 4BRKA 4W5OA 1MDUB 2ZE2A 3BY5A 3H08A 1N36K 1NGAA 2OPPA 3HP9A 1NJYA 3HJFA 4CF1A 2B4JA 2BANA 4KTZA 5AQTA 2O4IA 1RBUA 4G1QA 3PSIA 3WEEB 1X9WA 2OZSA 2XY8A 1JLFA 4BR9A 3WXKA 1OH8A 4FYDA 1YJ9N 1C6VA 2XY6A 2QWRA 1NJIO 3O9RA 4C8NA 2GBZA 1TYQB 5LMUK 3A5MC 4F2SA 2UYTA 1TUYA 3M3ZA 3AV9A 3I55N 4DV4K 4N41A 2PYJA 3I56N 2A3ZA 3UKUA 3SJHA 4XH5A 3JYTA 4LSNA 3OYGA 3L2VA 5LJWA 3QIOA 3IG1A 3G4SN 3VEWA 3VETA 1XNRK 1IKXA 1L3VA 3ID6A 3LP0A 2KLAA 1O1WA 3MDQA 4XEIA 3C7NB 4FJLA 1U2VA 2EHGA 3KKRA 5HP1A 3DOLA 4WF9L 3TAGA 2DFFA 1D8YA 3OYHA 4IOAL 1NGHA 4DCHA 3N4QA 3S3NA 4KH5A 1JLGA 1J6ZA 2P9UB 4ID1A 3VEXA 4HTUA 3THWA 3TSQA 5B8HA 2QXFA 2ZJRL 4OLBA 3OJSA 3S3OA 2DTUA 3IFRA 1XUPO 1JL1A 3AARA 4BE0A 4CK2A 3CQ8A 2GV9A 1R0AA 3DLLL 4EZ9A 4JKFA 3T1HK 2NRZA 4J2AA 4CFAA 4B1UB 4B3MK 2UUCK 5HRSA 3EKSA 4FM1A 4M42A 1SV5A 3NGYA 2P51A 1EQYA 1T6DA 4BRNA 1HNZK 4B9NA 4I6MB 5AFUA 4LF6K 1UAXA 1DGKN 1MU2A 1NGDA 1X3MA 1BL3A 3VEZA 4CK1A 4BRAA 2YV0X 3B6PA 1CZ9A 4ILJA 3OYBA 1NJXA 1KAXA 3QEXA 4DU3A 4FLTA 4NLCA 3EY1A 1YTUA 2NRVA 2W41A 4JKGA 4B9SA 4CJTA 3M8SA 3CXCM 4H4OA 3CQXA 5E84A 4B9QA 3F9MA 4CZIA 5AQFA 2FBYA 3LDPA 4FWNA 4LH4A 3BUZB 3KLIA 4WYBA 3V81A 4JI7K 1SL0A 2HVHA 2P9SB 1YJWN 1GLLO 1L3TA 3O3HA 3EKUA 1WN7A 3ATVA 4CIFA 5EU7A 3VQ8A 4GY2B 2O8DB 1IH7A 3SUOA 2VGMA 1WSIA 3P38A 1FKPA 1DLOA 3I0SA 1Q8IA 1GLBG 3G71N 3AO4A 3NBPA 3T1AA 4DTOA 1HYZA 1CZAN 5CHIA 4IWVA 1VSJA 1CXQA 1RDWX 3LL3A 4BDZA 2CGJA 2HBJA 3B8AX 1V4TA 2F9WA 1NK0A 3DRSA 1G99A 4FWKA 2VWBA 3SYZA 3DXMA 1U45A 1BQMA 1WOQA 1P90A 3SAFA 3RWUA 2QWPA 1GLEG 2W6LA 3WXMB 4DV6K 3OJUA 4KFBA 2VWJA 1QZ6A 4CEZA 3KLFA 4QS9A 3QETA 5KGWA 1NU0A 4CZKA 3GDQA 3CJBA 4BRPA 1DKGD 3LWMA 2UU9K 1ZBIA 3QICA 1GLAG 3SPYA 4FJ8A 1OH7A 3KLGA 1K8AO 4AQYK 4Z4FA 2X78A 4DTJA 1RDCA 5JLHA 2G8UA 1TKZA 4M3WA 1TK0A 3OA9A 5AZJB 2E6MA 3EN9A 5HRNA 3SBGA 2P9KB 4BRFA 1C0FA 1QS4A 4CZEA 5JVHL 4BC3A 1D9FA 1VSLA 3ENBA 1NGBA 3Q7CA 2QWMA 1WSHA 3I33A 5AQSA 4CZHA 3CCSN 2YNIA 5KRSA 5AQXA 3AO2A 4RW7A 3VEOA 2VCPA 5GAHP 3NE6A 2HVIA 3CPEA 4DUYK 5HROA 4OKJA 3PSFA 4JRPA 4KRFA 1LAWA 5C2FA 4DTNA 4A57A 5F0XA 4FZXC 2G8FA 3NMUA 3DWLA 4YOTA 2O8FA 5DM6L 4JKCA 3U6FA 4CHYA 2Z1HA 3VERA 4CJRA 1S9GA 4N76A 2E20A 5FPEA 4AF1A 2ZD1A 3ULDA 1GOCA 4CF2A 3BZCA 2P9LA 2KZZA 3V9WA 3VF2A 3QEPA 1GLJO 4BR5A 4M3RA 5AQJA 1L5UA 1JXBA 4HUEA 1LWFA 4KTQA 3FZLA 3LALA 3AVNA 3UB5A 4A2BA 4LFCK 3A2FA 1BG3A 1J53A 5GINA 4CJ3A 4FVMA 5CR4A 3JS6A 3CMEN 4CJEA 3MEDA 4B9VA 1RBSA 3SNNA 5AQNA 3CM6A 4NXMK 4KH6A 4UY8O 3C65A 2A5XA 2NRTA 3VQDA 5KQDA 4Z94A 4FJ7A 5CY4A 5ADXH 3HOSA 4K43A 3AVLA 4GMJB 4FM2A 3QMLA 4CJSA 1CZBA 3TTFA 3D2EB 4YOUA 1XC3A 3E1YA 4WQ4A 4FLXA 1NGCA 2X74A 4JI8K 1BCOA 4DV2K 5C25A 3TU5A 2FXUA 4B1ZA 2IVOA 3QINA 4FWRA 4KHSA 2YHBA 4DMNA 1KCFA 2IGIA 3MEEA 3CC4N 4DFMA 1BWFO 1QQOA 1RCHA 4HCBA 3BEXA 3MMVA 4DQ8A 4E1JA 4BC2A 2A1SA 3AVJA 1ZBUA 5JLFA 1F21A 4Q5VA 1VQLN 4GVMA 2A42A 4BRCA 3SAGA 3SV3A 4DS5A 4DSLA 2KQ2A 1WBDA 2X6SA 4FWSA 2A6AA 2KHOA 5LJVA 3D45A 2GX9A 4WFNL 3VF4A 5IWAK 4BWMA 4KO0A 2QKKA 1T3VA 1E3MA 1JKHA 3ZX2A 4FZYA 1Z25A 3B6OA 2WBNA 4PL8A 4C8LA 4BQLA 4KPYA 4DQQA 3AVAA 1MWMA 1S72N 5M1KA 4HTLA 1Q81O 3OS2A 3FZMA 3TSPA 4CGJA 1W2BM 3A0IX 1JXEA 1HQEA 2JWKA 3HM9A 4RTFD 1NK9A 2E4LA 1MA9B 3H1VX 1FKOA 3RR7A 1LWCA 1A5VA 3OS1A 1WSGA 3HPHA 5AQZA 1U47A 3NF6A 3LDLA 4CF8A 4E7JA 4LD0A 1KVAA 4EAHD 4FK4A 1BHLA 3ZX3A 3NDKA 5C15A 4K0KK 3PLAA 4DV5K 3PO5A 3MX5A 3SQ1A 3C0BA 4CEEA 3KK1A 4L3QA 2H3GX 3L8BA 4IXCA 3QNOA 3CERA 3J81O 5JVGL 4O44A 3SK3A 1VRTA 3ISNC 3VTIA 2ZM6K 3DRPA 1M1KO 3U9DA 5J2MA 1WSFA 3AVKA 3Q7BA 3MN6A 1Q82O 3FFKB 4X62K 3P83D 3PY8A 3HXMA 4Y0WA 1JCFA 3D0PA 4K8ZA 4KHPK 1KTQA 3O9UA 3ZCMA 4B8AB 2KFNA 2XO7A 4O4GA 3UKRB 2G8WA 2D0OA 3U3GA 2ZWHA 1GLFO 4JKHA 4DFPA 2Q36A 3SV4A 2OA8A 1ESVA 3AVHA 4O8UA 4CGDA 1KFSA 4K25A 2B6AA 4B3TK 1QQNA 3S9HA 2VQFK 2BDPA 3VQAA 1I3AA 1FXXA 4NLBA 3S41A 4AHSA 1B9FA 2ITMA 2HSTA 5CZ1A 4IOXA 4EZ6A 1ZBLA 1J54A 3I8BA 5GAGP 4EHUA 3ZT0A 1Q9XA 4FWMA 3LDQA 4KKOA 3WNGA 3KWIA 3WQUA 1KVCA 3UIQA 2P9PB 4WQ5C 4LFAK 5F1XA 3K2PA 2GELA 4DFKA 5C42A 1VQPN 5CZ2A 5C12A 3WEEA 1NK4A 1OH5A 4B1XB 1TKDA 4KHNA 2HF3A 3LP2A 3AVIA 1JLBA 1HKCA 4YOVA 3VEYA 1BISA 1QVGM 3HP6A 1I94K 2E5LK 4G9ZA 1XWLA 3SUPA 3O3GA 1RT7A 4B1YB 1VQ6N 3CCMN 1TYQA 4LC9B 2ASMA 4A5AA 4R5PA 3CCQN 2HOEA 1C0UA 4CI6A 2OZMA 3V9SA 3SMSA 1SUQA 1W0HA 3NH0A 3ZEUB 3TANA 4CJ4A 3VMFB 1UWBA 3RMAA 3O4NA 5MLCQ 2OTLN 2FSKA 1O13A 3HBTA 2QXLA 4CZLA 4CJVA 1K9MO 1YI2N 2Q0UA 2EX3A 1EKEA 3C7NA 4C1NI 5BPMA 1JLCA 4O0JA 3ULEB 3HTVA 3E9PA 1NGFA 4M3YA 1EXQA 4B8CA 3OBYA 3SZ2A 2P9UA 4DTUA 2FBVA 3CYMA 1QHTA 4AILC 1N33K 1HNVA 3H6EA 4FJMA 1C0TA 1VQON 3DLHA 3W0LA 2O8CB 1YT3A 4FW2A 1JCEA 3T7ZA 4CBXA 1SAZA 1W97L 3OY9A 1NNEA 3AA3A 4IOCL 2V52B 4FM0A 1YIJN 1UA0A 3KZBA 2HW3A 1YTAA 1LV5A 2PFUA 4KREA 5AJ3K 1BI4B 3CCRN 5BRHA 1Q86O 2I7PA 1L3SA 1KAYA 4M41A 1TL1A 3TWHA 5FRMA 3KLEA 5AQMA 1ITGA 2KZMA 1VSKA 4HUGA 4W5QA 1TL3A 3CETA 3QDKA 1NKBA 3QFPA 3H3OB 2IIRA 5JS1A 3VQEA 4A62A 4CZJA 3K5OA 1JJ2M 1TKXA 4BGAA 1RT3A 3WXIA 2E1YA 3I0RA 4JK8A 4Z0UA 3PUFA 3AVFA 3QIPA 4O5FA 4PY5A 1NK8A 2G8VA 2P9SA 4CHZA 3RMBA 1IBLK 5A2QO 1P8ZA 1SKSA 5KTQA 1NOZA 4BROA 5BR8K 1ZBFA 4JK9A 2O4GA 4Z4HA 4DSKA 3EO3A 1VK0A 2O8DA 2WC9A 4DSJA 3H1QA 1XNQK 4FOIA 3ZSWA 4FWLA 4YDUC 2FLOA 3H3NO 3VA3A 4BDYA 4B9TA 3LM2A 3QNNA 2YX6A 2VG6A 1DTTA 3MN5A 4GW6A 2OCEA 4HUFA 2HHVA 2HF4A 1LCUA 2E2PA 2ZJQL 2AA4A 3F5TA 4DTRA 2DFEA 2W40A 4PA1A 4AHRA 5FRNA 2BE2A 3E66A 4CZGA 3J7YP 3OHRA 4JI6K 5BPLA 3KK3A 1BO5O 3LDSA 4NXNK 4DR4K 1QE1A 3VQPA 4BRIA 1RDUA 3O4QA 2HNDA 2LSNA 3OYKA 4K42A 1HNIA 3WT0A 5AQIA 1WSEA 4JHDB 3VQBA 2G8HA 2HHQA 3ZSZA 2QWQA 3LP3A 4CFBA 5GIOA 2AJQA 3NHGA 4I7FA 5AZJA 1Z26A 2ATQA 1NJZA 3THXB 5E41A 2P9KA 1NOYA 3QERA 3NFAA 1VSEA 4CD3A 1NMNA 3DXKB 4A61A 4WCEL 4K41A 3MWTA 4GKKK 4C8KA 4O55A 4C23A 3AY9A 4I9QA 2RKIA 1NK5A 3OYFA 3G25A 2I5JA 5AQOA 3IDHA 2YNGA 4JAXA 1M90O 3JAMO 4OX9K 4H4MA 4YNQA 5BR9A 4XH1A 5CYQA 3CC2N 2ITGA 4A59A 4AHUA 1BU6O 5AQWA 3ZT1A 3L2UA 5ADXA 2CH6A 1LW2A 4BRHA 2QWNA 4Y1CA 3JSMA 3VGMA 4H5NA 4J2DA 1X9SA 4JD2B 3SJJA 3HSCA 2QW9A 5KQ8A 3OYEA 1S3XA 3I8DA 2FBXA 1T6CA 4FOEA 4JS4A 2GUIA 3DLRA 3EE9A 4QS8A 2YI1A 1GOBA 4ICLA 5D3GA 4C1NK 3QEIA 3C6UA 3J7ZO 1TVRA 3RSEB 1UOCA 4FK2A 3CJAA 4O5BA 5AQGA 4X65K 4AM6A 4FLUA 2NRHA 1XQSC 2PBDA 4DR6K 4E7LA 2P1JA 1ASWA 3O3FA 3D2EA 4CEOA 3OYCA 4M45A 3OTOK 2JLEA 4JI3K 3DLGA 3VEVA 4FJ9A 2ASOA 3MCPA 4JKDA 3UKUB 4PKHA 4CHNA 5C2DA 4KAZA 4EP5A 4MLEA 3TAQA 3ZYYX 4LF5K 4HCCA 4EHTA 3AAQA 1IO2A 2DY4A 3HO1A 3M1FA 4AH9A 1DT9A 4FO0A 3VQ6A 1XC9A 4PQUA 4E1NA 3PX4A 1ZXOA 5EVZA 4F9OA 1OVQA 4YHHK 4OGEA 3G0ZA 3AO3A 1KVBA 2FC0A 1LW0A 3U4LA 4NYFA 4I9LA 1TK8A 3THYB 4JLHA 2F8TA 1IKWA 3CIPA 4CGHA 3VQCA 3OYLA 4RCHA 3VQ9A 4AHCA 2WUSA 2RF2A 4M3ZA 4LF9K 3DAWA 3QO9A 4FWOA 3QESA 3MN9A 4I2PA 1J9AA 1ILYA 4XH4A 2Q3SA 4BG8A 4FSVA 3FR0A 3QB0A 4CERA 2QTDA 3V9XA 2UUBK 3EYZA 1C1CA 3V9UA 4E0DA 1D9DA 3EEQA 4JNEA 4CJQA 1LOTB 1QTMA 4KB1A 1EWRA 1VQMN 3T19A 2VWKA 1WBBA 2J4RA 4H8KA 2HMIA 2HHTA 3DRRA 2E6LA 3OYNA 2AP1A 4DF4A 3KK7A 2ASPA 4FJNA 1VQ5N 3MWPA 4IZ9A 4CEBA 2D5RA 1LWEA 3O1BA 3SUNA 3DLEA 3O6WA 3LPUA 3V1RA 3ATUA 4Z4EA 4ZHRA 3NVMA 4DR3K 4GVEA 2FSJA 5J2PA 3UKRA 4M3UA 1HNXK 3RVCA 2IOCA 1K8KB 4F4KA 1VRUA 4ILGB 3SQ2A 3CM5A 4OJRA 4X64K 4FVUA 3OYAA 1WSJA 1SQKA 2YKNA 1ASVA 2IS3A 1SL2A 2D0PA 3AGRA 1KAZA 3TI0A 3ZSVA 3C6TA 1QVFM 1WNSA 4CJFA 2W6KA 3VA0A 1SZ2A 4FJGA 4JN4A 1HPMA 1IKVA 2HBMA 1HX1A 2UXCK 4IDKA 3WNFA 2P9PA 1J5EK 5AQVA 4NCGA 4XIUA 4FJ5A 4F2RA 3WXLA 1B92A 2HNYA 2B5JA 1QHAA 3MXMA 3EL2A 3VENA 4B3RK 5IT9O 4CBWA 2GUPA 3IS9A 3CCJN 3C94A 4DQIA 1RT1A 3LZIA 4WE1A 4DU1A 5I42A 3LDNA 3AGKA 4H0OA 4DV7K 3E9LA 4Z4CA 1S1WA 3F73A 3WNHA 3VPZA 4KBOA 1VHXA 1ATNA 3AO5A 3WNEA 1S9EA 1FJGK 1B9DA 3ZT3A 4ISGA 3ZEUA 3SBTA 2KW4A 4YOYA 2HB5A 2GEMA 2Q31A 2RE2A 5C0YA 4BVOA 3H45C 3IKMA 2E2OA 1IBKK 3BZKA 3TSUA 1GOAA 4DFJA 5J1EA 4MFBA 4OPAA 5C24A 1ZBHA 4DV1K 3IRXA 3ZETB 3L2WA 3G10A 4H0YB 1S1XA 5TKWA 3CJCA 4CJ5A 1HYSA 1SKWA 4GV3A 5BN8A 3L3VA 4H0PA 3ZSXA 5GIPA 4FWQA 2UXBK 1IV0A 3GBTA 4OPJA 4IFEA 3KIOA 2BTFA 3K5MA 3J8AA 1KSPA 1QQMA 4CZFA 4IKFA 3QFUA 4MDBA 1VSHA 2O8CA 3HVTA 2W42A 3FLCO 4CW7B 3KKSA 2WTUA 4CK3A 1SS6A 2Y1JA 2P9LB 2F7TA 3ZLJA 1NKCA 4BC5A 4EFHA 1RDBA 4AM7A 1VQ4N 5LY3A 5EY4A 2BGGA 5AQQA 2O8EB 4N5SA 2UXDK 3CJ9A 2EWSA 1BI4A 4DLEA 1HJRA 3CJ1A 3LZJA 4FLWA 3M8RA 2D0BA 2P5OA 2HNZA 3KVGA 4CESA 2PYLA 1BIZA 4CHPA 3V4IA 4F3TA 5BPNA 1TGOA 3THVA 4OGCA 1EETA 1Q7YO 3SCXA 2HHHK 1VSDA 1XMOK 4JRQA 1KLMA 1KQSM 5AQHA 4FJIA 1HKGA 3HK2A 4PHTX 4BE2A 5DK5A 3CCEN 4GKJK 1T05A 1KXPA 2IVNA 2FF3B 1RNHA 4MO5A 4NO7A 4KHUA 3ITHA 5KGXA 3CFRA 1OVYA 5BRDA 2BH1A 1YHQN 5HRRA 4KH4A 2E8AA 1S6QA 3ALYA 4DQPA 2V7YA 4H0XB 2KTQA 1TKTA 4DF8A 1YUWA 5FPDA 4PKIA 2NRXA 2OYQA 4CJ7A 3O08A 3DOKA 1C1AA 2QEXN 3K5LA 4PL7A 5HL7L 2JGUA 3TAMA 3VQ5A 2Q2RA 2RHKA 2YHAA 1JLEA 1HKBA 2VG5A 1IJJA 2YJFA 1ZYQA 5AQYA 1ATSA 3DM2A 1IBMK 2FBTA 3V1OA 1VSFA 4KV8A 3K9KA 3MEGA 1HQUA 4CEAA 3QBWA 3SPZA 1RBRA 3DYAA 1QZ5A 2F9TA 4M3TA 1TV6A 4DHYA 2ZJPL 1QSSA 4FJKA 3L0QA 4YY3K 4TSXA 1T8EA 5KPTA 1NK6A 1NGGA 2QKBA 4CEDA 1NWKA 4BE1A 2Y1IA 3T3FA 4DS4A 3THXA 4J8FA 3CI5A 5AZIB 5FROA 2RN2A 3K0SA 4KB0A 2RPIA 1YJNN 4CHOA 3TARA 4FWPA 4JI5K 3HPOA 3DXKA 1Q18A 4CJPA 2OANA 4I6MA 3SQ4A 2QA4N 3R1XA 1MWKA 4ZTJA 3MCAB 2R7YA 4CJUA 4FZZA 2A1RA 4DSFA 3HVRA 4KHWA 3TABA 3LM9A 2Q97A 4RG8A 5T7BA 4CJKA 3BDPA 2I7NA 1T7PA 1S1VA 3BGRA 3MAQA 4FW1A 4JI0K 4WQ5A 1SKRA 3ZSQA 1VQ7N 4MQ3A 5J2QA 2YHWA 2NLXA 3TAEA 3M8PA 4IEIA 4YOWA 4NCBA 5ELZA 4BY9C 4IG3A 1DTQA 4IJAA 3CHWA 5BREA 1X9JA 4BVPA 2O8BB 2YNHA 3HM8A 2QM1A 2IVPA 4CE9A 4Z4IA 1T03A 1RT2A 2HBLA 1UA1A 1RT4A 4FPBA 4JD2A 2F8SA 4LF7K 2P9IB 1A5XA 5AQRA 3TAPA 3SLCA 4JI1K 3HZ6A 4CIEA 5HLFA 4GV9A 3LP1A 4HWIA 2VQEK 2OTJN 1J5OA 3RMDA 5KI6A 4DWIA 3PX6A 3VGLA 5FPNA 2NRWA 3AVCA 3NF9A 1RGIA 4H0VB 5F2RA 4GNIA 3VOVA 3RSEA 1XMQK 4W5RA 4NCAA 3QLHA 4BC4A 2FF6A 3TTCA 4CF9A 4RW4A 2WOMA 2G8KA 3DLBA 3IUCA 1NGIA 3CD6N 3CQYA 4R79A 3AVGA 4OLAA 3RRHA 4BR4A 2P9NB 3V1QA 4B1WB 3PO4A 4IFYA 3MECA 3N4PA 1NM1A 1U04A 1JL2A 4CZMA 2NNWA 1YVUA 4B1VA 4BDPA 2ETJA 1XHZA 2D4WA 3GE1A 1ASUA 4Z4GA 2GTDA 4OKEA 5LMNK 4DB3A 1DEJA 3NGIA 4DG1A 2E2NA 1W9HA 3IAYA 1KLNA 1Y97A 3ENHA 3O9TA 5BN9A 3LANA 1QSLA 3THYA 3FGUA 3JXUA 4AHTA 3KHYA 3M6GA 3KD5E 4LH5A 4RW9A 3D7EO 3P39A 4CGIA 4IFVA 5I9EB 2ZF5O 2D0AA 1RILA 3DMJA 4YORA 5M1PA 4ZTFA 2ZGZA 3MXJA 2NUBA 2X6NA 3L4QA 4HVJA 3CPWM 3OW2M 4DQSA 3EE8A 2VG7A 3FZFA 1RTJA 1EP4A 5KRTA 3NCIA 4JS5A 3P1GA 1BIUA 3W3DA 4C8MA 1WAJA 3LAMA 1OKJA 4E3SA 4DSIA 1JLQA 4BREA 3ZX0A 5TKYA 1RDAA 4K8XA 3KD1E 5H1SQ 1IKYA 3A5LC 5AQKA 4B9MA 2G8IA 3CCUN 3NVKA 3LDOA 2Z1JA 3D2FB 3O4WA 5AQUA 4A2AA 3SI6A 3ZSRA 2VYPA 3OVNA 4U7BA 4FJXA 3U3YA 2HBKA 4W5NA 3AVMA 4M63C 4IEEA 1VQNN 1YAGA 4E1MA 3HL8A 1HYVA 3NF8A 4IO9L 4CGGA 3TPQA 5FLXO 4CBUA 4B3OA 1S5JA 1NK7A 3J80O 3QBXA 3OS0A 4YDUA 1TAQA 1WAFA 3R8EA 3AA2A 3BF3A 4A5BA 4ISFA 4BG9A 1YXQA 2QK9A 2YHXA 2CH5A 4LF8K 4H5WA 1U4BA 1X9MA 1HMVA 1K8KA 1C0GA 3OYMA 4B3SK 2FSNA 2HHUA 1NKEA 3J7AP 3VQ4A 3HRGA 1JCGA 3ID8A 1YITN 3NH2A 3MX2A 3M5RA 4N47A 3EZWA 2PY5A 1D4XA 1R59O 4YFUA 4E7HA 1QSYA 4OKKA 1HR0K 3RR8A 4MDAA 4BR0A 4MLHA 4CGFA 2YHYA 1KRPA 4CJLA 1N8RO 3E01A 3TR8A 2UUAK 1EWQA 3HSTB 4KI4A 4FK0A 4DLGA 3A8YA 4F3OA 1WUAA 1SL1A 1JLAA 3TAFA 1U2VB 3L2QA 3V6DA 1L3UA 4O0IA 3UE5A 1H1VA 3KLHA 4B9LA 2Z1IA 4OVLA 1NBWA 2Z1GA 5E26A 4WQ4C 3K9JA 4CEFA 3PIOL 3HT3A 3THWB 3C95A 1VQ9N 1A5WA 1NLVA 3CC7N 1V4SA 4E7KA 1IG8A 1X1PA 2F4VK 2YJEA 2ZQBA 4CJWA 2JWLA 1NG9A 3SUQA 1GLDG 3VQQA 3PV8A 1T44A 1I39A 2YKMA 5CYMA 4PKGA 4DTPA 1S1TA 4CIGA 4DTMA 1RDDA 1BQNA 3AA4A 3C6HA 4FXDA 2NZTA 5HBMA 4IG0A 1VQ8N 2OPQA 4IDHA 4CECA 4AHVA 4CD1A 4FLYA 2WFBA 4JI2K 4EIAA 4H5VA 4CVNE 3ZETA 5J2NA 4ELTA 4DQRA 3R3LA 2BUPA 3V9ZA 1HJOA 2D1KA 1KC8O 3SMPA 4BACA 1N5YA 4JYAK 4NB4A 1QQCA 4JK7A 3MN7A 4JKGB 1HUXA 2XY7A 3SQ0A 1D5AA 3F2KA 3SAHA 1KFDA 4ILHA 1BCMA 1Q9YA 3ZSYA 1C1BA 2IDOA 4OO1J 3O8MA 2GWJA 5AFUH 5JICA 5LL6Z 3R9PA 5GAEP 1WLJA 3P4IA 5JS2A 3VTHA 2GWKA 4CFCA 1HNWK 3CMAN 3OYIA 1TUUA 2O8EA 2Q0RA 3FZKA 4WFBL 5SWMA 4RW8A 1GLCG 3KJVA 2IAJA 1EX4A 3RTVA 5JMVA 4BR2A 2CGKA 3FE1A 3MK6A 1YVNA 4DR7K 3VESA 2VGNA 1U49A 1ZC6A 4QAGA 5AQLA 2OPRA 5I3UA 1EO1A 4BQZA 1NGJA 4DUZK 2XRIA 5EXWA 3QEWA 4QOZB 1N34K 1RTDA 5CE3A 4PWDA 3CG7A
chains in the Genus database with same CATH topology
1RNHA 4DSEA 4KHUA 4KI6A 1HPZA 1VSJA 3ITHA 1CXQA 3NF7A 5KGXA 4E89A 3CFRA 4BDYA 3VA3A 2WONA 4B9TA 4BDZA 3QNNA 2HHWA 2VG6A 1DTTA 4GW6A 5HRRA 1LAVA 4HUFA 1NK0A 3DRSA 2HHVA 1S6QA 3ALYA 4DQPA 3SYZA 4DTRA 2KTQA 1U45A 1BQMA 1TKTA 1VSIA 1S1UA 2DFEA 4AHRA 4PA1A 4DF8A 3RWUA 5FRNA 2BE2A 3OYJA 5SZTA 4IBNA 2OYQA 3OJUA 4KFBA 3DOKA 2VWJA 1C1AA 4CEZA 3KLFA 3K5LA 2JGUA 3TAMA 3F9KA 3QETA 1RT6A 5KGWA 3VQ5A 3KK3A 4B08A 3LDSA 3PX0A 3LWMA 1ZBIA 2YHAA 3SPYA 4FJ8A 1QE1A 1JLEA 2VG5A 3VQPA 3AA5X 1ZYQA 3KLGA 4LSLA 3DM2A 3O4QA 2FBTA 2HNDA 2LSNA 3V1OA 4Z4FA 2X78A 1VSFA 1RDCA 3OYKA 4DTJA 2G8UA 4KV8A 1TKZA 1HNIA 4BWJA 1TK0A 4FJHA 3MEGA 1HQUA 4M3WA 4CEAA 5HRNA 2E6MA 1WSEA 2XY5A 3VQBA 4N56A 2G8HA 1XHXA 4LY7A 3SPZA 2HHQA 1RBRA 3DYAA 1XI1A 3ZSZA 4M3TA 1QS4A 3LP3A 2YNFA 4CFBA 1TV6A 2AJQA 1D9FA 1QSSA 4FJKA 1VSLA 4PUOA 3NHGA 1WSHA 4TSXA 1T8EA 4I7FA 1Z26A 2ATQA 1NJZA 2XHBA 4FJJA 2YNIA 5KRSA 5E41A 1NOYA 1NK6A 3AO2A 4RW7A 3QERA 3NFAA 4OPKA 3NE6A 2QKBA 1VSEA 2HVIA 4CEDA 5HROA 4OKJA 3AO1A 4FCYA 4BE1A 4RW6A 3ZT4A 2Y1IA 3T3FA 4DS4A 4JRPA 2F96A 1LAWA 4KRFA 4DTNA 5FROA 2RN2A 4C8KA 4O55A 3ZT2A 4FZXC 2G8FA 4KB0A 3RMCA 2P5GA 2RPIA 4I9QA 2RKIA 4CHOA 3TARA 1NK5A 3U6FA 3OYFA 3HPOA 4CHYA 2Z1HA 4KHYA 4CJPA 3SQ4A 2I5JA 4CJRA 1HRHA 1S9GA 4N76A 1FK9A 4DTXA 4ZTJA 2YNGA 2R7YA 4CJUA 2ZD1A 3P5JA 4FZZA 2A1RA 3AVBA 5DMRA 3HVRA 1GOCA 4CF2A 3ULDA 4DSFA 4KHWA 4E7IA 4J2BA 2KZZA 3V9WA 3TABA 3QEPA 4H4MA 4KHQA 4RG8A 5T7BA 4CJKA 4M3RA 4YNQA 1L5UA 3DI6A 1JXBA 3BDPA 4HUEA 5CYQA 4DU4A 1T7PA 1LWFA 4KTQA 1S1VA 3VQ7A 3BGRA 3LALA 3AVNA 3MAQA 2IC3A 2ITGA 4FW1A 4AHUA 3A2FA 2KFZA 1BGXT 1SKRA 3ZT1A 4Q0BA 1J53A 3ZSQA 4CJ3A 3L2UA 1LW2A 1G15A 1RBVA 4Y1CA 4MQ3A 4FVMA 3HYFA 5J2QA 3JSMA 1RTIA 4CFDA 3TAEA 1CLQA 4CJEA 3M8PA 4CEQA 3MEDA 4J2DA 4B9VA 1RBSA 1X9SA 4NCBA 3SNNA 3SJJA 1NJWA 4IG3A 1DTQA 3OYEA 3CM6A 2YNHA 3I8DA 2FBXA 3ASMA 4UQGA 3M8QA 4CE9A 4JS4A 4ELUA 2GUIA 3VQDA 3DLRA 3DLKA 4FJ7A 5CY4A 4Z4IA 1T03A 1RT2A 1UA1A 1RT4A 2F8SA 1GOBA 4ICLA 3NGZA 5D3GA 3AVLA 4GMJB 5K14A 3C6UA 3QEIA 2PZSA 1TVRA 4FK2A 1A5XA 1UOCA 4FM2A 3TAPA 4CJSA 1CZBA 4O5BA 4CIEA 4FLXA 2X74A 3LWLA 5HLFA 1BCOA 2D0CA 3LP1A 3CFOA 4FLUA 3RMDA 5KI6A 4DWIA 3PX6A 1RBTA 5C25A 3NF9A 3AVCA 4E7LA 2P1JA 2HHSA 1ASWA 3O3FA 1RT5A 4CEOA 4W5RA 4NCAA 3OYCA 4M45A 3QINA 3QLHA 4KHSA 1K6YA 2JLEA 2YHBA 3DLGA 4FJ9A 4CF9A 4RW4A 4DMNA 1TAUA 2WOMA 1KCFA 2G8KA 2IGIA 3DLBA 3MEEA 4DFMA 4C8OA 1RCHA 4CHNA 4HCBA 4I2QA 3AVJA 2A1SA 1ZBUA 3AVGA 1F21A 4EP5A 4Q5VA 4GVMA 3RRHA 4KAZA 4Y1DA 4OLAA 3EZ5A 1TK5A 3TAQA 4ID5A 3SV3A 4DS5A 4DSLA 4HCCA 3NH1A 2KQ2A 3V1QA 3K58A 2X6SA 3FFIA 4W5TA 3PO4A 1IO2A 4IFYA 3MECA 3D45A 2HHXA 1U04A 4BWMA 4KO0A 2DY4A 1JL2A 2QKKA 3HO1A 4AH9A 4BDPA 1YVUA 3KK2A 3VQ6A 1VSMA 1JKHA 2ETJA 1XC9A 3NAEA 1XHZA 4E1NA 1Z25A 3B6OA 3PX4A 3RRGA 4C8LA 4FZYA 4PQUA 1ASUA 4KPYA 4OGEA 4DQQA 3G0ZA 1U48A 3AO3A 3AVAA 4Z4GA 1KVBA 1S6PA 2FC0A 1LW0A 4OKEA 4HHTA 4NYFA 4I9LA 3NGIA 1TK8A 3OS2A 3K5NA 4JLHA 2F8TA 3LPTA 4CGJA 4B9UA 1IKWA 4CGHA 1JXEA 4DG1A 3VQCA 1HQEA 3OYLA 1W9HA 3VQ9A 4CHQA 3IAYA 1KLNA 4AHCA 3VN5A 4J2EA 1Y97A 3HM9A 3CFPA 1NK9A 2E4LA 1RTHA 2RF2A 4M3ZA 1FKOA 3LANA 1QSLA 3RR7A 3QEVA 1LWCA 1A5VA 3QO9A 4AHTA 3OS1A 1WSGA 3HPHA 1U47A 3KD5E 4LH5A 4RW9A 2OPSA 4NYNA 3QESA 3NF6A 2DFHA 4CF8A 4E7JA 4CGIA 3HPGA 1J9AA 1KVAA 4I2PA 4IFVA 4LD0A 4FK4A 1BHLA 2D0AA 1RILA 3DMJA 3NDKA 4FLVA 2Q3SA 5HRPA 4ZTFA 4ELVA 3MXJA 2NUBA 1IG9A 2X6NA 3PO5A 4CERA 4HVJA 3SQ1A 4KTWA 3V9XA 4DQSA 4CEEA 3EYZA 3KK1A 2VG7A 1C1CA 1RTJA 1EP4A 4EP4A 5KRTA 3NCIA 3L8BA 4JS5A 3V9UA 3QNOA 3P1GA 4E0DA 1BIUA 1D9DA 5FDLA 4M3XA 4L8RB 4CJQA 1C0MA 4O44A 3ZSOA 1REVA 4C8MA 1VRTA 3ISNC 1WAJA 1QTMA 3DRPA 4KB1A 5J2MA 3LAMA 4E3SA 3T19A 3OYDA 1WSFA 2VWKA 4DSIA 1JLQA 4FLZA 3AVKA 4H8KA 2HMIA 1L3VA 1N6QA 2HHTA 1RDAA 3DRRA 3P83D 2E6LA 3HXMA 3PY8A 3OYNA 3KD1E 4K8XA 3D0PA 3KTQA 1IKYA 4DF4A 4K8ZA 3L3UA 3K57A 4CF0A 4B9MA 4CCHA 1KTQA 2Z1JA 4FJNA 2G8IA 4QCLA 4CEBA 2D5RA 3ZCMA 4B8AB 2KFNA 4DTSA 1LWEA 4O4GA 2XO7A 3DLEA 3SUNA 2G8WA 3LPUA 3U3GA 3V1RA 4F8RA 1CXUA 4DFPA 3ZSRA 3SI6A 3MXIA 4Z4EA 3OVNA 3SV4A 4FJXA 3U3YA 4ZHRA 4W5NA 3AVMA 3LAKA 2OA8A 3AVHA 4E1MA 3HL8A 1HYVA 3NF8A 4CGDA 1KFSA 4CGGA 5J2PA 4B3OA 2B6AA 1S5JA 3L2RA 3S3MA 4M3UA 3S9HA 1NK7A 4E19A 3K59A 3OS0A 2BDPA 1TAQA 3VQAA 1I3AA 1WAFA 1FXXA 2IOCA 3AA2A 4W5OA 4AHSA 4F4KA 1VRUA 2ZE2A 1B9FA 3SQ2A 5CZ1A 4EZ6A 3H08A 3CM5A 1ZBLA 2QK9A 2OPPA 3HP9A 1J54A 1U4BA 1NJYA 4OJRA 3HJFA 1X9MA 4CF1A 1HMVA 2B4JA 3OYAA 2BANA 3ZT0A 4KTZA 1WSJA 1Q9XA 4KKOA 3WNGA 2YKNA 1ASVA 2IS3A 3OYMA 1RBUA 2O4IA 1SL2A 2HHUA 4G1QA 1NKEA 1KVCA 3UIQA 3TI0A 3VQ4A 3ZSVA 3C6TA 1X9WA 2OZSA 1WNSA 4CJFA 2XY8A 1JLFA 3NH2A 3VA0A 4FJGA 4N47A 1IKVA 3K2PA 2PY5A 4FYDA 1C6VA 4YFUA 4IDKA 4OKKA 3WNFA 5C42A 4E7HA 4DFKA 2XY6A 5CZ2A 1QSYA 3RR8A 4CGFA 1NK4A 4NCGA 4XIUA 4FJ5A 4F2RA 1TKDA 4C8NA 1KRPA 2GBZA 4KHNA 3LP2A 4CJLA 1B92A 1JLBA 2HNYA 3AVIA 2B5JA 4F2SA 3MXMA 1BISA 3HP6A 3E01A 3TR8A 1XWLA 3SUPA 3O3GA 3HSTB 3AV9A 4KI4A 4FK0A 4DLGA 3IS9A 4F3OA 4N41A 3C94A 2PYJA 4DQIA 1RT7A 1RT1A 3LZIA 4WE1A 1JLAA 3JYTA 4DU1A 4LSNA 3TAFA 5I42A 1SL1A 3OYGA 4R5PA 3L2QA 3L2VA 3V6DA 1L3UA 1C0UA 2OZMA 3QIOA 4O0IA 3IG1A 3V9SA 3KLHA 1SUQA 4B9LA 2Z1IA 1IKXA 1W0HA 4OVLA 2Z1GA 4Z4CA 3NH0A 4CEFA 1S1WA 3HT3A 3TANA 4CJ4A 3F73A 3LP0A 1UWBA 3WNHA 1O1WA 3C95A 3RMAA 4FJLA 1A5WA 3O4NA 2EHGA 3AO5A 3KKRA 5HP1A 3WNEA 1S9EA 3DOLA 3TAGA 2DFFA 4E7KA 1X1PA 1B9DA 4CJVA 3OYHA 1D8YA 3ZT3A 2ZQBA 4CJWA 2KW4A 3SUQA 3S3NA 1JLGA 2EX3A 2HB5A 1J5OA 4ID1A 4HTUA 1EKEA 3VQQA 3PV8A 1JLCA 2QXFA 1I39A 2YKMA 4O0JA 5CYMA 4M3YA 4OLBA 3OJSA 4DFJA 1EXQA 1GOAA 1S1TA 4DTPA 3S3OA 2DTUA 1JL1A 4CIGA 4BE0A 4DTMA 4CK2A 4MFBA 4B8CA 5C24A 2GV9A 5J1EA 3CQ8A 1R0AA 1RDDA 1BQNA 1ZBHA 3SZ2A 3AA4A 4DTUA 2FBVA 4EZ9A 4FXDA 3IRXA 3CYMA 5HBMA 1QHTA 3L2WA 4AILC 3G10A 4IG0A 2OPQA 1S1XA 4CJ5A 1HYSA 1HNVA 4CECA 1SKWA 4FJMA 1C0TA 4J2AA 4AHVA 4CFAA 4FLYA 3L3VA 3ZSXA 3DLHA 5HRSA 5J2NA 4ELTA 4FM1A 4OPJA 4DQRA 4M42A 1SV5A 3NGYA 3V9ZA 2P51A 3KIOA 4B9NA 1YT3A 4FW2A 3K5MA 1KSPA 4BACA 1N5YA 4IKFA 1UAXA 1MU2A 1BL3A 1VSHA 1QQCA 3HVTA 4CK1A 3OY9A 2W42A 3AA3A 2YV0X 3B6PA 1CZ9A 3KKSA 3OYBA 4CK3A 4FM0A 1NJXA 2XY7A 2Y1JA 3SQ0A 3QEXA 1UA0A 4DU3A 1D5AA 1NKCA 4FLTA 2HW3A 1KFDA 3EY1A 1YTAA 1LV5A 1YTUA 4KREA 1BCMA 1RDBA 1Q9YA 3ZSYA 4B9SA 4CJTA 3M8SA 1C1BA 2IDOA 1BI4B 2BGGA 4H4OA 1L3SA 4N5SA 4M41A 1TL1A 3TWHA 1WLJA 5FRMA 5JS2A 3KLEA 1ITGA 4CFCA 2FBYA 2KZMA 1VSKA 4HUGA 3OYIA 1BI4A 4W5QA 4LH4A 1HJRA 1TL3A 4DLEA 1NKBA 3KLIA 3LZJA 5JS1A 3V81A 4FLWA 3M8RA 2D0BA 1SL0A 3VQEA 2HVHA 2P5OA 3K5OA 4RW8A 5SWMA 1TKXA 3KJVA 2IAJA 1EX4A 1RT3A 2HNZA 3RTVA 1L3TA 4CESA 2PYLA 1BIZA 4CHPA 3I0RA 3V4IA 4F3TA 3O3HA 4Z0UA 1TGOA 3PUFA 3AVFA 1WN7A 4CIFA 5EU7A 3QIPA 3VQ8A 4PY5A 3THVA 1NK8A 2G8VA 4OGCA 4CHZA 3RMBA 1U49A 4QAGA 1EETA 1SKSA 5KTQA 3SCXA 1NOZA 1IH7A 3SUOA 1ZBFA 2OPRA 1VSDA 5I3UA 4JRQA 1WSIA 1FKPA 2XRIA 1DLOA 1KLMA 3I0SA 3QEWA 2O4GA 4Z4HA 4QOZB 1Q8IA 4DSKA 1VK0A 4FJIA 3HK2A 4BE2A 5DK5A 1RTDA 1T05A 3AO4A 3NBPA 3T1AA 4DTOA 4DSJA 1HYZA 3ZSWA 4PWDA 3CG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNH A;  4DSE A;  4KHU A;  4KI6 A;  1HPZ A;  1VSJ A;  3ITH A;  1CXQ A;  3NF7 A;  5KGX A;  4E89 A;  3CFR A;  4BDY A;  3VA3 A;  2WON A;  4B9T A;  4BDZ A;  3QNN A;  2HHW A;  2VG6 A;  1DTT A;  4GW6 A;  5HRR A;  1LAV A;  4HUF A;  1NK0 A;  3DRS A;  2HHV A;  1S6Q A;  3ALY A;  4DQP A;  3SYZ A;  4DTR A;  2KTQ A;  1U45 A;  1BQM A;  1TKT A;  1VSI A;  1S1U A;  2DFE A;  4AHR A;  4PA1 A;  4DF8 A;  3RWU A;  5FRN A;  2BE2 A;  3OYJ A;  5SZT A;  4IBN A;  2OYQ A;  3OJU A;  4KFB A;  3DOK A;  2VWJ A;  1C1A A;  4CEZ A;  3KLF A;  3K5L A;  2JGU A;  3TAM A;  3F9K A;  3QET A;  1RT6 A;  5KGW A;  3VQ5 A;  3KK3 A;  4B08 A;  3LDS A;  3PX0 A;  3LWM A;  1ZBI A;  2YHA A;  3SPY A;  4FJ8 A;  1QE1 A;  1JLE A;  2VG5 A;  3VQP A;  3AA5 X;  1ZYQ A;  3KLG A;  4LSL A;  3DM2 A;  3O4Q A;  2FBT A;  2HND A;  2LSN A;  3V1O A;  4Z4F A;  2X78 A;  1VSF A;  1RDC A;  3OYK A;  4DTJ A;  2G8U A;  4KV8 A;  1TKZ A;  1HNI A;  4BWJ A;  1TK0 A;  4FJH A;  3MEG A;  1HQU A;  4M3W A;  4CEA A;  5HRN A;  2E6M A;  1WSE A;  2XY5 A;  3VQB A;  4N56 A;  2G8H A;  1XHX A;  4LY7 A;  3SPZ A;  2HHQ A;  1RBR A;  3DYA A;  1XI1 A;  3ZSZ A;  4M3T A;  1QS4 A;  3LP3 A;  2YNF A;  4CFB A;  1TV6 A;  2AJQ A;  1D9F A;  1QSS A;  4FJK A;  1VSL A;  4PUO A;  3NHG A;  1WSH A;  4TSX A;  1T8E A;  4I7F A;  1Z26 A;  2ATQ A;  1NJZ A;  2XHB A;  4FJJ A;  2YNI A;  5KRS A;  5E41 A;  1NOY A;  1NK6 A;  3AO2 A;  4RW7 A;  3QER A;  3NFA A;  4OPK A;  3NE6 A;  2QKB A;  1VSE A;  2HVI A;  4CED A;  5HRO A;  4OKJ A;  3AO1 A;  4FCY A;  4BE1 A;  4RW6 A;  3ZT4 A;  2Y1I A;  3T3F A;  4DS4 A;  4JRP A;  2F96 A;  1LAW A;  4KRF A;  4DTN A;  5FRO A;  2RN2 A;  4C8K A;  4O55 A;  3ZT2 A;  4FZX C;  2G8F A;  4KB0 A;  3RMC A;  2P5G A;  2RPI A;  4I9Q A;  2RKI A;  4CHO A;  3TAR A;  1NK5 A;  3U6F A;  3OYF A;  3HPO A;  4CHY A;  2Z1H A;  4KHY A;  4CJP A;  3SQ4 A;  2I5J A;  4CJR A;  1HRH A;  1S9G A;  4N76 A;  1FK9 A;  4DTX A;  4ZTJ A;  2YNG A;  2R7Y A;  4CJU A;  2ZD1 A;  3P5J A;  4FZZ A;  2A1R A;  3AVB A;  5DMR A;  3HVR A;  1GOC A;  4CF2 A;  3ULD A;  4DSF A;  4KHW A;  4E7I A;  4J2B A;  2KZZ A;  3V9W A;  3TAB A;  3QEP A;  4H4M A;  4KHQ A;  4RG8 A;  5T7B A;  4CJK A;  4M3R A;  4YNQ A;  1L5U A;  3DI6 A;  1JXB A;  3BDP A;  4HUE A;  5CYQ A;  4DU4 A;  1T7P A;  1LWF A;  4KTQ A;  1S1V A;  3VQ7 A;  3BGR A;  3LAL A;  3AVN A;  3MAQ A;  2IC3 A;  2ITG A;  4FW1 A;  4AHU A;  3A2F A;  2KFZ A;  1BGX T;  1SKR A;  3ZT1 A;  4Q0B A;  1J53 A;  3ZSQ A;  4CJ3 A;  3L2U A;  1LW2 A;  1G15 A;  1RBV A;  4Y1C A;  4MQ3 A;  4FVM A;  3HYF A;  5J2Q A;  3JSM A;  1RTI A;  4CFD A;  3TAE A;  1CLQ A;  4CJE A;  3M8P A;  4CEQ A;  3MED A;  4J2D A;  4B9V A;  1RBS A;  1X9S A;  4NCB A;  3SNN A;  3SJJ A;  1NJW A;  4IG3 A;  1DTQ A;  3OYE A;  3CM6 A;  2YNH A;  3I8D A;  2FBX A;  3ASM A;  4UQG A;  3M8Q A;  4CE9 A;  4JS4 A;  4ELU A;  2GUI A;  3VQD A;  3DLR A;  3DLK A;  4FJ7 A;  5CY4 A;  4Z4I A;  1T03 A;  1RT2 A;  1UA1 A;  1RT4 A;  2F8S A;  1GOB A;  4ICL A;  3NGZ A;  5D3G A;  3AVL A;  4GMJ B;  5K14 A;  3C6U A;  3QEI A;  2PZS A;  1TVR A;  4FK2 A;  1A5X A;  1UOC A;  4FM2 A;  3TAP A;  4CJS A;  1CZB A;  4O5B A;  4CIE A;  4FLX A;  2X74 A;  3LWL A;  5HLF A;  1BCO A;  2D0C A;  3LP1 A;  3CFO A;  4FLU A;  3RMD A;  5KI6 A;  4DWI A;  3PX6 A;  1RBT A;  5C25 A;  3NF9 A;  3AVC A;  4E7L A;  2P1J A;  2HHS A;  1ASW A;  3O3F A;  1RT5 A;  4CEO A;  4W5R A;  4NCA A;  3OYC A;  4M45 A;  3QIN A;  3QLH A;  4KHS A;  1K6Y A;  2JLE A;  2YHB A;  3DLG A;  4FJ9 A;  4CF9 A;  4RW4 A;  4DMN A;  1TAU A;  2WOM A;  1KCF A;  2G8K A;  2IGI A;  3DLB A;  3MEE A;  4DFM A;  4C8O A;  1RCH A;  4CHN A;  4HCB A;  4I2Q A;  3AVJ A;  2A1S A;  1ZBU A;  3AVG A;  1F21 A;  4EP5 A;  4Q5V A;  4GVM A;  3RRH A;  4KAZ A;  4Y1D A;  4OLA A;  3EZ5 A;  1TK5 A;  3TAQ A;  4ID5 A;  3SV3 A;  4DS5 A;  4DSL A;  4HCC A;  3NH1 A;  2KQ2 A;  3V1Q A;  3K58 A;  2X6S A;  3FFI A;  4W5T A;  3PO4 A;  1IO2 A;  4IFY A;  3MEC A;  3D45 A;  2HHX A;  1U04 A;  4BWM A;  4KO0 A;  2DY4 A;  1JL2 A;  2QKK A;  3HO1 A;  4AH9 A;  4BDP A;  1YVU A;  3KK2 A;  3VQ6 A;  1VSM A;  1JKH A;  2ETJ A;  1XC9 A;  3NAE A;  1XHZ A;  4E1N A;  1Z25 A;  3B6O A;  3PX4 A;  3RRG A;  4C8L A;  4FZY A;  4PQU A;  1ASU A;  4KPY A;  4OGE A;  4DQQ A;  3G0Z A;  1U48 A;  3AO3 A;  3AVA A;  4Z4G A;  1KVB A;  1S6P A;  2FC0 A;  1LW0 A;  4OKE A;  4HHT A;  4NYF A;  4I9L A;  3NGI A;  1TK8 A;  3OS2 A;  3K5N A;  4JLH A;  2F8T A;  3LPT A;  4CGJ A;  4B9U A;  1IKW A;  4CGH A;  1JXE A;  4DG1 A;  3VQC A;  1HQE A;  3OYL A;  1W9H A;  3VQ9 A;  4CHQ A;  3IAY A;  1KLN A;  4AHC A;  3VN5 A;  4J2E A;  1Y97 A;  3HM9 A;  3CFP A;  1NK9 A;  2E4L A;  1RTH A;  2RF2 A;  4M3Z A;  1FKO A;  3LAN A;  1QSL A;  3RR7 A;  3QEV A;  1LWC A;  1A5V A;  3QO9 A;  4AHT A;  3OS1 A;  1WSG A;  3HPH A;  1U47 A;  3KD5 E;  4LH5 A;  4RW9 A;  2OPS A;  4NYN A;  3QES A;  3NF6 A;  2DFH A;  4CF8 A;  4E7J A;  4CGI A;  3HPG A;  1J9A A;  1KVA A;  4I2P A;  4IFV A;  4LD0 A;  4FK4 A;  1BHL A;  2D0A A;  1RIL A;  3DMJ A;  3NDK A;  4FLV A;  2Q3S A;  5HRP A;  4ZTF A;  4ELV A;  3MXJ A;  2NUB A;  1IG9 A;  2X6N A;  3PO5 A;  4CER A;  4HVJ A;  3SQ1 A;  4KTW A;  3V9X A;  4DQS A;  4CEE A;  3EYZ A;  3KK1 A;  2VG7 A;  1C1C A;  1RTJ A;  1EP4 A;  4EP4 A;  5KRT A;  3NCI A;  3L8B A;  4JS5 A;  3V9U A;  3QNO A;  3P1G A;  4E0D A;  1BIU A;  1D9D A;  5FDL A;  4M3X A;  4L8R B;  4CJQ A;  1C0M A;  4O44 A;  3ZSO A;  1REV A;  4C8M A;  1VRT A;  3ISN C;  1WAJ A;  1QTM A;  3DRP A;  4KB1 A;  5J2M A;  3LAM A;  4E3S A;  3T19 A;  3OYD A;  1WSF A;  2VWK A;  4DSI A;  1JLQ A;  4FLZ A;  3AVK A;  4H8K A;  2HMI A;  1L3V A;  1N6Q A;  2HHT A;  1RDA A;  3DRR A;  3P83 D;  2E6L A;  3HXM A;  3PY8 A;  3OYN A;  3KD1 E;  4K8X A;  3D0P A;  3KTQ A;  1IKY A;  4DF4 A;  4K8Z A;  3L3U A;  3K57 A;  4CF0 A;  4B9M A;  4CCH A;  1KTQ A;  2Z1J A;  4FJN A;  2G8I A;  4QCL A;  4CEB A;  2D5R A;  3ZCM A;  4B8A B;  2KFN A;  4DTS A;  1LWE A;  4O4G A;  2XO7 A;  3DLE A;  3SUN A;  2G8W A;  3LPU A;  3U3G A;  3V1R A;  4F8R A;  1CXU A;  4DFP A;  3ZSR A;  3SI6 A;  3MXI A;  4Z4E A;  3OVN A;  3SV4 A;  4FJX A;  3U3Y A;  4ZHR A;  4W5N A;  3AVM A;  3LAK A;  2OA8 A;  3AVH A;  4E1M A;  3HL8 A;  1HYV A;  3NF8 A;  4CGD A;  1KFS A;  4CGG A;  5J2P A;  4B3O A;  2B6A A;  1S5J A;  3L2R A;  3S3M A;  4M3U A;  3S9H A;  1NK7 A;  4E19 A;  3K59 A;  3OS0 A;  2BDP A;  1TAQ A;  3VQA A;  1I3A A;  1WAF A;  1FXX A;  2IOC A;  3AA2 A;  4W5O A;  4AHS A;  4F4K A;  1VRU A;  2ZE2 A;  1B9F A;  3SQ2 A;  5CZ1 A;  4EZ6 A;  3H08 A;  3CM5 A;  1ZBL A;  2QK9 A;  2OPP A;  3HP9 A;  1J54 A;  1U4B A;  1NJY A;  4OJR A;  3HJF A;  1X9M A;  4CF1 A;  1HMV A;  2B4J A;  3OYA A;  2BAN A;  3ZT0 A;  4KTZ A;  1WSJ A;  1Q9X A;  4KKO A;  3WNG A;  2YKN A;  1ASV A;  2IS3 A;  3OYM A;  1RBU A;  2O4I A;  1SL2 A;  2HHU A;  4G1Q A;  1NKE A;  1KVC A;  3UIQ A;  3TI0 A;  3VQ4 A;  3ZSV A;  3C6T A;  1X9W A;  2OZS A;  1WNS A;  4CJF A;  2XY8 A;  1JLF A;  3NH2 A;  3VA0 A;  4FJG A;  4N47 A;  1IKV A;  3K2P A;  2PY5 A;  4FYD A;  1C6V A;  4YFU A;  4IDK A;  4OKK A;  3WNF A;  5C42 A;  4E7H A;  4DFK A;  2XY6 A;  5CZ2 A;  1QSY A;  3RR8 A;  4CGF A;  1NK4 A;  4NCG A;  4XIU A;  4FJ5 A;  4F2R A;  1TKD A;  4C8N A;  1KRP A;  2GBZ A;  4KHN A;  3LP2 A;  4CJL A;  1B92 A;  1JLB A;  2HNY A;  3AVI A;  2B5J A;  4F2S A;  3MXM A;  1BIS A;  3HP6 A;  3E01 A;  3TR8 A;  1XWL A;  3SUP A;  3O3G A;  3HST B;  3AV9 A;  4KI4 A;  4FK0 A;  4DLG A;  3IS9 A;  4F3O A;  4N41 A;  3C94 A;  2PYJ A;  4DQI A;  1RT7 A;  1RT1 A;  3LZI A;  4WE1 A;  1JLA A;  3JYT A;  4DU1 A;  4LSN A;  3TAF A;  5I42 A;  1SL1 A;  3OYG A;  4R5P A;  3L2Q A;  3L2V A;  3V6D A;  1L3U A;  1C0U A;  2OZM A;  3QIO A;  4O0I A;  3IG1 A;  3V9S A;  3KLH A;  1SUQ A;  4B9L A;  2Z1I A;  1IKX A;  1W0H A;  4OVL A;  2Z1G A;  4Z4C A;  3NH0 A;  4CEF A;  1S1W A;  3HT3 A;  3TAN A;  4CJ4 A;  3F73 A;  3LP0 A;  1UWB A;  3WNH A;  1O1W A;  3C95 A;  3RMA A;  4FJL A;  1A5W A;  3O4N A;  2EHG A;  3AO5 A;  3KKR A;  5HP1 A;  3WNE A;  1S9E A;  3DOL A;  3TAG A;  2DFF A;  4E7K A;  1X1P A;  1B9D A;  4CJV A;  3OYH A;  1D8Y A;  3ZT3 A;  2ZQB A;  4CJW A;  2KW4 A;  3SUQ A;  3S3N A;  1JLG A;  2EX3 A;  2HB5 A;  1J5O A;  4ID1 A;  4HTU A;  1EKE A;  3VQQ A;  3PV8 A;  1JLC A;  2QXF A;  1I39 A;  2YKM A;  4O0J A;  5CYM A;  4M3Y A;  4OLB A;  3OJS A;  4DFJ A;  1EXQ A;  1GOA A;  1S1T A;  4DTP A;  3S3O A;  2DTU A;  1JL1 A;  4CIG A;  4BE0 A;  4DTM A;  4CK2 A;  4MFB A;  4B8C A;  5C24 A;  2GV9 A;  5J1E A;  3CQ8 A;  1R0A A;  1RDD A;  1BQN A;  1ZBH A;  3SZ2 A;  3AA4 A;  4DTU A;  2FBV A;  4EZ9 A;  4FXD A;  3IRX A;  3CYM A;  5HBM A;  1QHT A;  3L2W A;  4AIL C;  3G10 A;  4IG0 A;  2OPQ A;  1S1X A;  4CJ5 A;  1HYS A;  1HNV A;  4CEC A;  1SKW A;  4FJM A;  1C0T A;  4J2A A;  4AHV A;  4CFA A;  4FLY A;  3L3V A;  3ZSX A;  3DLH A;  5HRS A;  5J2N A;  4ELT A;  4FM1 A;  4OPJ A;  4DQR A;  4M42 A;  1SV5 A;  3NGY A;  3V9Z A;  2P51 A;  3KIO A;  4B9N A;  1YT3 A;  4FW2 A;  3K5M A;  1KSP A;  4BAC A;  1N5Y A;  4IKF A;  1UAX A;  1MU2 A;  1BL3 A;  1VSH A;  1QQC A;  3HVT A;  4CK1 A;  3OY9 A;  2W42 A;  3AA3 A;  2YV0 X;  3B6P A;  1CZ9 A;  3KKS A;  3OYB A;  4CK3 A;  4FM0 A;  1NJX A;  2XY7 A;  2Y1J A;  3SQ0 A;  3QEX A;  1UA0 A;  4DU3 A;  1D5A A;  1NKC A;  4FLT A;  2HW3 A;  1KFD A;  3EY1 A;  1YTA A;  1LV5 A;  1YTU A;  4KRE A;  1BCM A;  1RDB A;  1Q9Y A;  3ZSY A;  4B9S A;  4CJT A;  3M8S A;  1C1B A;  2IDO A;  1BI4 B;  2BGG A;  4H4O A;  1L3S A;  4N5S A;  4M41 A;  1TL1 A;  3TWH A;  1WLJ A;  5FRM A;  5JS2 A;  3KLE A;  1ITG A;  4CFC A;  2FBY A;  2KZM A;  1VSK A;  4HUG A;  3OYI A;  1BI4 A;  4W5Q A;  4LH4 A;  1HJR A;  1TL3 A;  4DLE A;  1NKB A;  3KLI A;  3LZJ A;  5JS1 A;  3V81 A;  4FLW A;  3M8R A;  2D0B A;  1SL0 A;  3VQE A;  2HVH A;  2P5O A;  3K5O A;  4RW8 A;  5SWM A;  1TKX A;  3KJV A;  2IAJ A;  1EX4 A;  1RT3 A;  2HNZ A;  3RTV A;  1L3T A;  4CES A;  2PYL A;  1BIZ A;  4CHP A;  3I0R A;  3V4I A;  4F3T A;  3O3H A;  4Z0U A;  1TGO A;  3PUF A;  3AVF A;  1WN7 A;  4CIF A;  5EU7 A;  3QIP A;  3VQ8 A;  4PY5 A;  3THV A;  1NK8 A;  2G8V A;  4OGC A;  4CHZ A;  3RMB A;  1U49 A;  4QAG A;  1EET A;  1SKS A;  5KTQ A;  3SCX A;  1NOZ A;  1IH7 A;  3SUO A;  1ZBF A;  2OPR A;  1VSD A;  5I3U A;  4JRQ A;  1WSI A;  1FKP A;  2XRI A;  1DLO A;  1KLM A;  3I0S A;  3QEW A;  2O4G A;  4Z4H A;  4QOZ B;  1Q8I A;  4DSK A;  1VK0 A;  4FJI A;  3HK2 A;  4BE2 A;  5DK5 A;  1RTD A;  1T05 A;  3AO4 A;  3NBP A;  3T1A A;  4DTO A;  4DSJ A;  1HYZ A;  3ZSW A;  4PWD A;  3CG7 A; 
#chains in the Genus database with same CATH topology
 4DSE A;  3DXM B;  2V51 B;  4KI6 A;  1HPZ A;  3NF7 A;  4E89 A;  4JKE A;  2WON A;  2HHW A;  1LAV A;  4BRG A;  5FPM A;  1BOT O;  5M1O A;  4JEP A;  1VSI A;  1S1U A;  4DKW A;  1BA1 A;  1BUP A;  5KPR A;  3OYJ A;  5SZT A;  4IBN A;  1K73 O;  3E9O A;  5BRF A;  3F9K A;  1RT6 A;  4B08 A;  3A5N C;  3PX0 A;  4M7Y A;  1BDG A;  3AA5 X;  5GAD P;  4LSL A;  5AR0 A;  2A41 A;  2Q1N A;  3GOI A;  3BF1 A;  3H46 O;  4BWJ A;  4FJH A;  2XY5 A;  4N56 A;  1NMD A;  1XHX A;  4LY7 A;  1Z6R A;  1XI1 A;  1U6Z A;  2YNF A;  3ULE A;  4JV5 K;  4PUO A;  4OPH A;  4M7X A;  2QWL A;  2XHB A;  4FJJ A;  4RWT A;  3GL1 A;  2NRR A;  4OPK A;  3ENO A;  2PAV A;  5DM7 L;  3BP8 A;  2O8F B;  3AO1 A;  2V7Z A;  4FCY A;  4RW6 A;  3ZT4 A;  3VF6 A;  4GV6 A;  2F96 A;  2E88 A;  3FZH A;  4LFB K;  4JI4 K;  4U67 L;  2ZGY A;  3ZT2 A;  3RMC A;  2P5G A;  1X3N A;  4KHY A;  2HMP A;  1HRH A;  3TTD A;  5AZI A;  1FK9 A;  4DTX A;  4H5T A;  1RFQ A;  3P5J A;  2KKZ A;  3AVB A;  3AAP A;  5DMR A;  5EX5 A;  4E7I A;  5HOO A;  4J2B A;  2DPN A;  1VQK N;  4KHQ A;  3CCL N;  5M1F A;  3DI6 A;  4DU4 A;  3O9Q A;  3VQ7 A;  4O8K A;  5EOY A;  2IC3 A;  4DR1 K;  2KFZ A;  1BGX T;  3CJ7 A;  3O80 A;  4WFA L;  4Q0B A;  1G15 A;  1RBV A;  4ISE A;  4BRM A;  5M1N A;  3HI0 A;  3HYF A;  1RTI A;  4CFD A;  1VAZ A;  3IMX A;  4JKA A;  3A5O C;  1CLQ A;  4MO4 A;  4CEQ A;  1E4G T;  5AQP A;  2A40 A;  1NJW A;  4H03 B;  1Z05 A;  3T69 A;  3GG4 A;  3ASM A;  5KPZ A;  4UQG A;  3M8Q A;  3C6A A;  4ELU A;  2QWO A;  3DLK A;  4H0T B;  3VGK A;  3R6M A;  3NGZ A;  2O8B A;  4DV3 K;  4FL9 A;  5K14 A;  2PZS A;  3D6R A;  3LWL A;  2D0C A;  3CFO A;  1BA0 A;  1RBT A;  2QI2 A;  2HHS A;  2P9I A;  1HLU A;  1RT5 A;  1E4F T;  1K6Y A;  4BRD A;  1TAU A;  4C8O A;  4I2Q A;  2E2Q A;  2E1Z A;  3WUH A;  1NGE A;  4JKB A;  4Y1D A;  4BR7 A;  1FW6 A;  3EZ5 A;  3WQT A;  1TK5 A;  4ID5 A;  3NH1 A;  1S22 A;  3K58 A;  3FFI A;  4W5T A;  1W7A A;  3PIP L;  3O1W A;  2HHX A;  3CF5 L;  3CCV N;  4LF4 K;  3KK2 A;  2P9N A;  1VSM A;  3NAE A;  3RRG A;  1U48 A;  1N32 K;  4YOX A;  3DJC A;  1S6P A;  4HHT A;  4BRQ A;  3K5N A;  1YF5 L;  3LPT A;  3G6E N;  4DR5 K;  4JHD A;  1KD1 O;  4B9U A;  4IO8 A;  1ZBS A;  3P31 A;  4H5R A;  4CHQ A;  3VN5 A;  3U8X A;  3CFP A;  3HOT A;  1RTH A;  3QEV A;  4BRL A;  2OPS A;  4NYN A;  1ATR A;  4QS7 A;  2DFH A;  3HPG A;  3OBW A;  4J2E A;  4ELV A;  4IJN A;  5C10 A;  5HRP A;  4FLV A;  2CGL A;  1IG9 A;  4KTW A;  3T1Y K;  3WXJ A;  4DV0 K;  4BGB A;  4EP4 A;  1WB9 A;  4V19 S;  4M3X A;  5FDL A;  4L8R B;  5M1Q A;  1C0M A;  3ZSO A;  1REV A;  3O5B A;  3OYD A;  3L4I A;  4FLZ A;  1N6Q A;  3O9S A;  1OH6 A;  3KTQ A;  3L3U A;  3K57 A;  4CF0 A;  4CCH A;  4QCL A;  4DTS A;  4F8R A;  1CXU A;  3KWG A;  3MXI A;  3LAK A;  3L6Q A;  3D2F A;  4FPA A;  2YCH A;  3L2R A;  3S3M A;  4E19 A;  3U9Z A;  3K59 A;  1Y64 A;  4DR2 K;  4X66 K;  4BRK A;  4W5O A;  1MDU B;  2ZE2 A;  3BY5 A;  3H08 A;  1N36 K;  1NGA A;  2OPP A;  3HP9 A;  1NJY A;  3HJF A;  4CF1 A;  2B4J A;  2BAN A;  4KTZ A;  5AQT A;  2O4I A;  1RBU A;  4G1Q A;  3PSI A;  3WEE B;  1X9W A;  2OZS A;  2XY8 A;  1JLF A;  4BR9 A;  3WXK A;  1OH8 A;  4FYD A;  1YJ9 N;  1C6V A;  2XY6 A;  2QWR A;  1NJI O;  3O9R A;  4C8N A;  2GBZ A;  1TYQ B;  5LMU K;  3A5M C;  4F2S A;  2UYT A;  1TUY A;  3M3Z A;  3AV9 A;  3I55 N;  4DV4 K;  4N41 A;  2PYJ A;  3I56 N;  2A3Z A;  3UKU A;  3SJH A;  4XH5 A;  3JYT A;  4LSN A;  3OYG A;  3L2V A;  5LJW A;  3QIO A;  3IG1 A;  3G4S N;  3VEW A;  3VET A;  1XNR K;  1IKX A;  1L3V A;  3ID6 A;  3LP0 A;  2KLA A;  1O1W A;  3MDQ A;  4XEI A;  3C7N B;  4FJL A;  1U2V A;  2EHG A;  3KKR A;  5HP1 A;  3DOL A;  4WF9 L;  3TAG A;  2DFF A;  1D8Y A;  3OYH A;  4IOA L;  1NGH A;  4DCH A;  3N4Q A;  3S3N A;  4KH5 A;  1JLG A;  1J6Z A;  2P9U B;  4ID1 A;  3VEX A;  4HTU A;  3THW A;  3TSQ A;  5B8H A;  2QXF A;  2ZJR L;  4OLB A;  3OJS A;  3S3O A;  2DTU A;  3IFR A;  1XUP O;  1JL1 A;  3AAR A;  4BE0 A;  4CK2 A;  3CQ8 A;  2GV9 A;  1R0A A;  3DLL L;  4EZ9 A;  4JKF A;  3T1H K;  2NRZ A;  4J2A A;  4CFA A;  4B1U B;  4B3M K;  2UUC K;  5HRS A;  3EKS A;  4FM1 A;  4M42 A;  1SV5 A;  3NGY A;  2P51 A;  1EQY A;  1T6D A;  4BRN A;  1HNZ K;  4B9N A;  4I6M B;  5AFU A;  4LF6 K;  1UAX A;  1DGK N;  1MU2 A;  1NGD A;  1X3M A;  1BL3 A;  3VEZ A;  4CK1 A;  4BRA A;  2YV0 X;  3B6P A;  1CZ9 A;  4ILJ A;  3OYB A;  1NJX A;  1KAX A;  3QEX A;  4DU3 A;  4FLT A;  4NLC A;  3EY1 A;  1YTU A;  2NRV A;  2W41 A;  4JKG A;  4B9S A;  4CJT A;  3M8S A;  3CXC M;  4H4O A;  3CQX A;  5E84 A;  4B9Q A;  3F9M A;  4CZI A;  5AQF A;  2FBY A;  3LDP A;  4FWN A;  4LH4 A;  3BUZ B;  3KLI A;  4WYB A;  3V81 A;  4JI7 K;  1SL0 A;  2HVH A;  2P9S B;  1YJW N;  1GLL O;  1L3T A;  3O3H A;  3EKU A;  1WN7 A;  3ATV A;  4CIF A;  5EU7 A;  3VQ8 A;  4GY2 B;  2O8D B;  1IH7 A;  3SUO A;  2VGM A;  1WSI A;  3P38 A;  1FKP A;  1DLO A;  3I0S A;  1Q8I A;  1GLB G;  3G71 N;  3AO4 A;  3NBP A;  3T1A A;  4DTO A;  1HYZ A;  1CZA N;  5CHI A;  4IWV A;  1VSJ A;  1CXQ A;  1RDW X;  3LL3 A;  4BDZ A;  2CGJ A;  2HBJ A;  3B8A X;  1V4T A;  2F9W A;  1NK0 A;  3DRS A;  1G99 A;  4FWK A;  2VWB A;  3SYZ A;  3DXM A;  1U45 A;  1BQM A;  1WOQ A;  1P90 A;  3SAF A;  3RWU A;  2QWP A;  1GLE G;  2W6L A;  3WXM B;  4DV6 K;  3OJU A;  4KFB A;  2VWJ A;  1QZ6 A;  4CEZ A;  3KLF A;  4QS9 A;  3QET A;  5KGW A;  1NU0 A;  4CZK A;  3GDQ A;  3CJB A;  4BRP A;  1DKG D;  3LWM A;  2UU9 K;  1ZBI A;  3QIC A;  1GLA G;  3SPY A;  4FJ8 A;  1OH7 A;  3KLG A;  1K8A O;  4AQY K;  4Z4F A;  2X78 A;  4DTJ A;  1RDC A;  5JLH A;  2G8U A;  1TKZ A;  4M3W A;  1TK0 A;  3OA9 A;  5AZJ B;  2E6M A;  3EN9 A;  5HRN A;  3SBG A;  2P9K B;  4BRF A;  1C0F A;  1QS4 A;  4CZE A;  5JVH L;  4BC3 A;  1D9F A;  1VSL A;  3ENB A;  1NGB A;  3Q7C A;  2QWM A;  1WSH A;  3I33 A;  5AQS A;  4CZH A;  3CCS N;  2YNI A;  5KRS A;  5AQX A;  3AO2 A;  4RW7 A;  3VEO A;  2VCP A;  5GAH P;  3NE6 A;  2HVI A;  3CPE A;  4DUY K;  5HRO A;  4OKJ A;  3PSF A;  4JRP A;  4KRF A;  1LAW A;  5C2F A;  4DTN A;  4A57 A;  5F0X A;  4FZX C;  2G8F A;  3NMU A;  3DWL A;  4YOT A;  2O8F A;  5DM6 L;  4JKC A;  3U6F A;  4CHY A;  2Z1H A;  3VER A;  4CJR A;  1S9G A;  4N76 A;  2E20 A;  5FPE A;  4AF1 A;  2ZD1 A;  3ULD A;  1GOC A;  4CF2 A;  3BZC A;  2P9L A;  2KZZ A;  3V9W A;  3VF2 A;  3QEP A;  1GLJ O;  4BR5 A;  4M3R A;  5AQJ A;  1L5U A;  1JXB A;  4HUE A;  1LWF A;  4KTQ A;  3FZL A;  3LAL A;  3AVN A;  3UB5 A;  4A2B A;  4LFC K;  3A2F A;  1BG3 A;  1J53 A;  5GIN A;  4CJ3 A;  4FVM A;  5CR4 A;  3JS6 A;  3CME N;  4CJE A;  3MED A;  4B9V A;  1RBS A;  3SNN A;  5AQN A;  3CM6 A;  4NXM K;  4KH6 A;  4UY8 O;  3C65 A;  2A5X A;  2NRT A;  3VQD A;  5KQD A;  4Z94 A;  4FJ7 A;  5CY4 A;  5ADX H;  3HOS A;  4K43 A;  3AVL A;  4GMJ B;  4FM2 A;  3QML A;  4CJS A;  1CZB A;  3TTF A;  3D2E B;  4YOU A;  1XC3 A;  3E1Y A;  4WQ4 A;  4FLX A;  1NGC A;  2X74 A;  4JI8 K;  1BCO A;  4DV2 K;  5C25 A;  3TU5 A;  2FXU A;  4B1Z A;  2IVO A;  3QIN A;  4FWR A;  4KHS A;  2YHB A;  4DMN A;  1KCF A;  2IGI A;  3MEE A;  3CC4 N;  4DFM A;  1BWF O;  1QQO A;  1RCH A;  4HCB A;  3BEX A;  3MMV A;  4DQ8 A;  4E1J A;  4BC2 A;  2A1S A;  3AVJ A;  1ZBU A;  5JLF A;  1F21 A;  4Q5V A;  1VQL N;  4GVM A;  2A42 A;  4BRC A;  3SAG A;  3SV3 A;  4DS5 A;  4DSL A;  2KQ2 A;  1WBD A;  2X6S A;  4FWS A;  2A6A A;  2KHO A;  5LJV A;  3D45 A;  2GX9 A;  4WFN L;  3VF4 A;  5IWA K;  4BWM A;  4KO0 A;  2QKK A;  1T3V A;  1E3M A;  1JKH A;  3ZX2 A;  4FZY A;  1Z25 A;  3B6O A;  2WBN A;  4PL8 A;  4C8L A;  4BQL A;  4KPY A;  4DQQ A;  3AVA A;  1MWM A;  1S72 N;  5M1K A;  4HTL A;  1Q81 O;  3OS2 A;  3FZM A;  3TSP A;  4CGJ A;  1W2B M;  3A0I X;  1JXE A;  1HQE A;  2JWK A;  3HM9 A;  4RTF D;  1NK9 A;  2E4L A;  1MA9 B;  3H1V X;  1FKO A;  3RR7 A;  1LWC A;  1A5V A;  3OS1 A;  1WSG A;  3HPH A;  5AQZ A;  1U47 A;  3NF6 A;  3LDL A;  4CF8 A;  4E7J A;  4LD0 A;  1KVA A;  4EAH D;  4FK4 A;  1BHL A;  3ZX3 A;  3NDK A;  5C15 A;  4K0K K;  3PLA A;  4DV5 K;  3PO5 A;  3MX5 A;  3SQ1 A;  3C0B A;  4CEE A;  3KK1 A;  4L3Q A;  2H3G X;  3L8B A;  4IXC A;  3QNO A;  3CER A;  3J81 O;  5JVG L;  4O44 A;  3SK3 A;  1VRT A;  3ISN C;  3VTI A;  2ZM6 K;  3DRP A;  1M1K O;  3U9D A;  5J2M A;  1WSF A;  3AVK A;  3Q7B A;  3MN6 A;  1Q82 O;  3FFK B;  4X62 K;  3P83 D;  3PY8 A;  3HXM A;  4Y0W A;  1JCF A;  3D0P A;  4K8Z A;  4KHP K;  1KTQ A;  3O9U A;  3ZCM A;  4B8A B;  2KFN A;  2XO7 A;  4O4G A;  3UKR B;  2G8W A;  2D0O A;  3U3G A;  2ZWH A;  1GLF O;  4JKH A;  4DFP A;  2Q36 A;  3SV4 A;  2OA8 A;  1ESV A;  3AVH A;  4O8U A;  4CGD A;  1KFS A;  4K25 A;  2B6A A;  4B3T K;  1QQN A;  3S9H A;  2VQF K;  2BDP A;  3VQA A;  1I3A A;  1FXX A;  4NLB A;  3S41 A;  4AHS A;  1B9F A;  2ITM A;  2HST A;  5CZ1 A;  4IOX A;  4EZ6 A;  1ZBL A;  1J54 A;  3I8B A;  5GAG P;  4EHU A;  3ZT0 A;  1Q9X A;  4FWM A;  3LDQ A;  4KKO A;  3WNG A;  3KWI A;  3WQU A;  1KVC A;  3UIQ A;  2P9P B;  4WQ5 C;  4LFA K;  5F1X A;  3K2P A;  2GEL A;  4DFK A;  5C42 A;  1VQP N;  5CZ2 A;  5C12 A;  3WEE A;  1NK4 A;  1OH5 A;  4B1X B;  1TKD A;  4KHN A;  2HF3 A;  3LP2 A;  3AVI A;  1JLB A;  1HKC A;  4YOV A;  3VEY A;  1BIS A;  1QVG M;  3HP6 A;  1I94 K;  2E5L K;  4G9Z A;  1XWL A;  3SUP A;  3O3G A;  1RT7 A;  4B1Y B;  1VQ6 N;  3CCM N;  1TYQ A;  4LC9 B;  2ASM A;  4A5A A;  4R5P A;  3CCQ N;  2HOE A;  1C0U A;  4CI6 A;  2OZM A;  3V9S A;  3SMS A;  1SUQ A;  1W0H A;  3NH0 A;  3ZEU B;  3TAN A;  4CJ4 A;  3VMF B;  1UWB A;  3RMA A;  3O4N A;  5MLC Q;  2OTL N;  2FSK A;  1O13 A;  3HBT A;  2QXL A;  4CZL A;  4CJV A;  1K9M O;  1YI2 N;  2Q0U A;  2EX3 A;  1EKE A;  3C7N A;  4C1N I;  5BPM A;  1JLC A;  4O0J A;  3ULE B;  3HTV A;  3E9P A;  1NGF A;  4M3Y A;  1EXQ A;  4B8C A;  3OBY A;  3SZ2 A;  2P9U A;  4DTU A;  2FBV A;  3CYM A;  1QHT A;  4AIL C;  1N33 K;  1HNV A;  3H6E A;  4FJM A;  1C0T A;  1VQO N;  3DLH A;  3W0L A;  2O8C B;  1YT3 A;  4FW2 A;  1JCE A;  3T7Z A;  4CBX A;  1SAZ A;  1W97 L;  3OY9 A;  1NNE A;  3AA3 A;  4IOC L;  2V52 B;  4FM0 A;  1YIJ N;  1UA0 A;  3KZB A;  2HW3 A;  1YTA A;  1LV5 A;  2PFU A;  4KRE A;  5AJ3 K;  1BI4 B;  3CCR N;  5BRH A;  1Q86 O;  2I7P A;  1L3S A;  1KAY A;  4M41 A;  1TL1 A;  3TWH A;  5FRM A;  3KLE A;  5AQM A;  1ITG A;  2KZM A;  1VSK A;  4HUG A;  4W5Q A;  1TL3 A;  3CET A;  3QDK A;  1NKB A;  3QFP A;  3H3O B;  2IIR A;  5JS1 A;  3VQE A;  4A62 A;  4CZJ A;  3K5O A;  1JJ2 M;  1TKX A;  4BGA A;  1RT3 A;  3WXI A;  2E1Y A;  3I0R A;  4JK8 A;  4Z0U A;  3PUF A;  3AVF A;  3QIP A;  4O5F A;  4PY5 A;  1NK8 A;  2G8V A;  2P9S A;  4CHZ A;  3RMB A;  1IBL K;  5A2Q O;  1P8Z A;  1SKS A;  5KTQ A;  1NOZ A;  4BRO A;  5BR8 K;  1ZBF A;  4JK9 A;  2O4G A;  4Z4H A;  4DSK A;  3EO3 A;  1VK0 A;  2O8D A;  2WC9 A;  4DSJ A;  3H1Q A;  1XNQ K;  4FOI A;  3ZSW A;  4FWL A;  4YDU C;  2FLO A;  3H3N O;  3VA3 A;  4BDY A;  4B9T A;  3LM2 A;  3QNN A;  2YX6 A;  2VG6 A;  1DTT A;  3MN5 A;  4GW6 A;  2OCE A;  4HUF A;  2HHV A;  2HF4 A;  1LCU A;  2E2P A;  2ZJQ L;  2AA4 A;  3F5T A;  4DTR A;  2DFE A;  2W40 A;  4PA1 A;  4AHR A;  5FRN A;  2BE2 A;  3E66 A;  4CZG A;  3J7Y P;  3OHR A;  4JI6 K;  5BPL A;  3KK3 A;  1BO5 O;  3LDS A;  4NXN K;  4DR4 K;  1QE1 A;  3VQP A;  4BRI A;  1RDU A;  3O4Q A;  2HND A;  2LSN A;  3OYK A;  4K42 A;  1HNI A;  3WT0 A;  5AQI A;  1WSE A;  4JHD B;  3VQB A;  2G8H A;  2HHQ A;  3ZSZ A;  2QWQ A;  3LP3 A;  4CFB A;  5GIO A;  2AJQ A;  3NHG A;  4I7F A;  5AZJ A;  1Z26 A;  2ATQ A;  1NJZ A;  3THX B;  5E41 A;  2P9K A;  1NOY A;  3QER A;  3NFA A;  1VSE A;  4CD3 A;  1NMN A;  3DXK B;  4A61 A;  4WCE L;  4K41 A;  3MWT A;  4GKK K;  4C8K A;  4O55 A;  4C23 A;  3AY9 A;  4I9Q A;  2RKI A;  1NK5 A;  3OYF A;  3G25 A;  2I5J A;  5AQO A;  3IDH A;  2YNG A;  4JAX A;  1M90 O;  3JAM O;  4OX9 K;  4H4M A;  4YNQ A;  5BR9 A;  4XH1 A;  5CYQ A;  3CC2 N;  2ITG A;  4A59 A;  4AHU A;  1BU6 O;  5AQW A;  3ZT1 A;  3L2U A;  5ADX A;  2CH6 A;  1LW2 A;  4BRH A;  2QWN A;  4Y1C A;  3JSM A;  3VGM A;  4H5N A;  4J2D A;  1X9S A;  4JD2 B;  3SJJ A;  3HSC A;  2QW9 A;  5KQ8 A;  3OYE A;  1S3X A;  3I8D A;  2FBX A;  1T6C A;  4FOE A;  4JS4 A;  2GUI A;  3DLR A;  3EE9 A;  4QS8 A;  2YI1 A;  1GOB A;  4ICL A;  5D3G A;  4C1N K;  3QEI A;  3C6U A;  3J7Z O;  1TVR A;  3RSE B;  1UOC A;  4FK2 A;  3CJA A;  4O5B A;  5AQG A;  4X65 K;  4AM6 A;  4FLU A;  2NRH A;  1XQS C;  2PBD A;  4DR6 K;  4E7L A;  2P1J A;  1ASW A;  3O3F A;  3D2E A;  4CEO A;  3OYC A;  4M45 A;  3OTO K;  2JLE A;  4JI3 K;  3DLG A;  3VEV A;  4FJ9 A;  2ASO A;  3MCP A;  4JKD A;  3UKU B;  4PKH A;  4CHN A;  5C2D A;  4KAZ A;  4EP5 A;  4MLE A;  3TAQ A;  3ZYY X;  4LF5 K;  4HCC A;  4EHT A;  3AAQ A;  1IO2 A;  2DY4 A;  3HO1 A;  3M1F A;  4AH9 A;  1DT9 A;  4FO0 A;  3VQ6 A;  1XC9 A;  4PQU A;  4E1N A;  3PX4 A;  1ZXO A;  5EVZ A;  4F9O A;  1OVQ A;  4YHH K;  4OGE A;  3G0Z A;  3AO3 A;  1KVB A;  2FC0 A;  1LW0 A;  3U4L A;  4NYF A;  4I9L A;  1TK8 A;  3THY B;  4JLH A;  2F8T A;  1IKW A;  3CIP A;  4CGH A;  3VQC A;  3OYL A;  4RCH A;  3VQ9 A;  4AHC A;  2WUS A;  2RF2 A;  4M3Z A;  4LF9 K;  3DAW A;  3QO9 A;  4FWO A;  3QES A;  3MN9 A;  4I2P A;  1J9A A;  1ILY A;  4XH4 A;  2Q3S A;  4BG8 A;  4FSV A;  3FR0 A;  3QB0 A;  4CER A;  2QTD A;  3V9X A;  2UUB K;  3EYZ A;  1C1C A;  3V9U A;  4E0D A;  1D9D A;  3EEQ A;  4JNE A;  4CJQ A;  1LOT B;  1QTM A;  4KB1 A;  1EWR A;  1VQM N;  3T19 A;  2VWK A;  1WBB A;  2J4R A;  4H8K A;  2HMI A;  2HHT A;  3DRR A;  2E6L A;  3OYN A;  2AP1 A;  4DF4 A;  3KK7 A;  2ASP A;  4FJN A;  1VQ5 N;  3MWP A;  4IZ9 A;  4CEB A;  2D5R A;  1LWE A;  3O1B A;  3SUN A;  3DLE A;  3O6W A;  3LPU A;  3V1R A;  3ATU A;  4Z4E A;  4ZHR A;  3NVM A;  4DR3 K;  4GVE A;  2FSJ A;  5J2P A;  3UKR A;  4M3U A;  1HNX K;  3RVC A;  2IOC A;  1K8K B;  4F4K A;  1VRU A;  4ILG B;  3SQ2 A;  3CM5 A;  4OJR A;  4X64 K;  4FVU A;  3OYA A;  1WSJ A;  1SQK A;  2YKN A;  1ASV A;  2IS3 A;  1SL2 A;  2D0P A;  3AGR A;  1KAZ A;  3TI0 A;  3ZSV A;  3C6T A;  1QVF M;  1WNS A;  4CJF A;  2W6K A;  3VA0 A;  1SZ2 A;  4FJG A;  4JN4 A;  1HPM A;  1IKV A;  2HBM A;  1HX1 A;  2UXC K;  4IDK A;  3WNF A;  2P9P A;  1J5E K;  5AQV A;  4NCG A;  4XIU A;  4FJ5 A;  4F2R A;  3WXL A;  1B92 A;  2HNY A;  2B5J A;  1QHA A;  3MXM A;  3EL2 A;  3VEN A;  4B3R K;  5IT9 O;  4CBW A;  2GUP A;  3IS9 A;  3CCJ N;  3C94 A;  4DQI A;  1RT1 A;  3LZI A;  4WE1 A;  4DU1 A;  5I42 A;  3LDN A;  3AGK A;  4H0O A;  4DV7 K;  3E9L A;  4Z4C A;  1S1W A;  3F73 A;  3WNH A;  3VPZ A;  4KBO A;  1VHX A;  1ATN A;  3AO5 A;  3WNE A;  1S9E A;  1FJG K;  1B9D A;  3ZT3 A;  4ISG A;  3ZEU A;  3SBT A;  2KW4 A;  4YOY A;  2HB5 A;  2GEM A;  2Q31 A;  2RE2 A;  5C0Y A;  4BVO A;  3H45 C;  3IKM A;  2E2O A;  1IBK K;  3BZK A;  3TSU A;  1GOA A;  4DFJ A;  5J1E A;  4MFB A;  4OPA A;  5C24 A;  1ZBH A;  4DV1 K;  3IRX A;  3ZET B;  3L2W A;  3G10 A;  4H0Y B;  1S1X A;  5TKW A;  3CJC A;  4CJ5 A;  1HYS A;  1SKW A;  4GV3 A;  5BN8 A;  3L3V A;  4H0P A;  3ZSX A;  5GIP A;  4FWQ A;  2UXB K;  1IV0 A;  3GBT A;  4OPJ A;  4IFE A;  3KIO A;  2BTF A;  3K5M A;  3J8A A;  1KSP A;  1QQM A;  4CZF A;  4IKF A;  3QFU A;  4MDB A;  1VSH A;  2O8C A;  3HVT A;  2W42 A;  3FLC O;  4CW7 B;  3KKS A;  2WTU A;  4CK3 A;  1SS6 A;  2Y1J A;  2P9L B;  2F7T A;  3ZLJ A;  1NKC A;  4BC5 A;  4EFH A;  1RDB A;  4AM7 A;  1VQ4 N;  5LY3 A;  5EY4 A;  2BGG A;  5AQQ A;  2O8E B;  4N5S A;  2UXD K;  3CJ9 A;  2EWS A;  1BI4 A;  4DLE A;  1HJR A;  3CJ1 A;  3LZJ A;  4FLW A;  3M8R A;  2D0B A;  2P5O A;  2HNZ A;  3KVG A;  4CES A;  2PYL A;  1BIZ A;  4CHP A;  3V4I A;  4F3T A;  5BPN A;  1TGO A;  3THV A;  4OGC A;  1EET A;  1Q7Y O;  3SCX A;  2HHH K;  1VSD A;  1XMO K;  4JRQ A;  1KLM A;  1KQS M;  5AQH A;  4FJI A;  1HKG A;  3HK2 A;  4PHT X;  4BE2 A;  5DK5 A;  3CCE N;  4GKJ K;  1T05 A;  1KXP A;  2IVN A;  2FF3 B;  1RNH A;  4MO5 A;  4NO7 A;  4KHU A;  3ITH A;  5KGX A;  3CFR A;  1OVY A;  5BRD A;  2BH1 A;  1YHQ N;  5HRR A;  4KH4 A;  2E8A A;  1S6Q A;  3ALY A;  4DQP A;  2V7Y A;  4H0X B;  2KTQ A;  1TKT A;  4DF8 A;  1YUW A;  5FPD A;  4PKI A;  2NRX A;  2OYQ A;  4CJ7 A;  3O08 A;  3DOK A;  1C1A A;  2QEX N;  3K5L A;  4PL7 A;  5HL7 L;  2JGU A;  3TAM A;  3VQ5 A;  2Q2R A;  2RHK A;  2YHA A;  1JLE A;  1HKB A;  2VG5 A;  1IJJ A;  2YJF A;  1ZYQ A;  5AQY A;  1ATS A;  3DM2 A;  1IBM K;  2FBT A;  3V1O A;  1VSF A;  4KV8 A;  3K9K A;  3MEG A;  1HQU A;  4CEA A;  3QBW A;  3SPZ A;  1RBR A;  3DYA A;  1QZ5 A;  2F9T A;  4M3T A;  1TV6 A;  4DHY A;  2ZJP L;  1QSS A;  4FJK A;  3L0Q A;  4YY3 K;  4TSX A;  1T8E A;  5KPT A;  1NK6 A;  1NGG A;  2QKB A;  4CED A;  1NWK A;  4BE1 A;  2Y1I A;  3T3F A;  4DS4 A;  3THX A;  4J8F A;  3CI5 A;  5AZI B;  5FRO A;  2RN2 A;  3K0S A;  4KB0 A;  2RPI A;  1YJN N;  4CHO A;  3TAR A;  4FWP A;  4JI5 K;  3HPO A;  3DXK A;  1Q18 A;  4CJP A;  2OAN A;  4I6M A;  3SQ4 A;  2QA4 N;  3R1X A;  1MWK A;  4ZTJ A;  3MCA B;  2R7Y A;  4CJU A;  4FZZ A;  2A1R A;  4DSF A;  3HVR A;  4KHW A;  3TAB A;  3LM9 A;  2Q97 A;  4RG8 A;  5T7B A;  4CJK A;  3BDP A;  2I7N A;  1T7P A;  1S1V A;  3BGR A;  3MAQ A;  4FW1 A;  4JI0 K;  4WQ5 A;  1SKR A;  3ZSQ A;  1VQ7 N;  4MQ3 A;  5J2Q A;  2YHW A;  2NLX A;  3TAE A;  3M8P A;  4IEI A;  4YOW A;  4NCB A;  5ELZ A;  4BY9 C;  4IG3 A;  1DTQ A;  4IJA A;  3CHW A;  5BRE A;  1X9J A;  4BVP A;  2O8B B;  2YNH A;  3HM8 A;  2QM1 A;  2IVP A;  4CE9 A;  4Z4I A;  1T03 A;  1RT2 A;  2HBL A;  1UA1 A;  1RT4 A;  4FPB A;  4JD2 A;  2F8S A;  4LF7 K;  2P9I B;  1A5X A;  5AQR A;  3TAP A;  3SLC A;  4JI1 K;  3HZ6 A;  4CIE A;  5HLF A;  4GV9 A;  3LP1 A;  4HWI A;  2VQE K;  2OTJ N;  1J5O A;  3RMD A;  5KI6 A;  4DWI A;  3PX6 A;  3VGL A;  5FPN A;  2NRW A;  3AVC A;  3NF9 A;  1RGI A;  4H0V B;  5F2R A;  4GNI A;  3VOV A;  3RSE A;  1XMQ K;  4W5R A;  4NCA A;  3QLH A;  4BC4 A;  2FF6 A;  3TTC A;  4CF9 A;  4RW4 A;  2WOM A;  2G8K A;  3DLB A;  3IUC A;  1NGI A;  3CD6 N;  3CQY A;  4R79 A;  3AVG A;  4OLA A;  3RRH A;  4BR4 A;  2P9N B;  3V1Q A;  4B1W B;  3PO4 A;  4IFY A;  3MEC A;  3N4P A;  1NM1 A;  1U04 A;  1JL2 A;  4CZM A;  2NNW A;  1YVU A;  4B1V A;  4BDP A;  2ETJ A;  1XHZ A;  2D4W A;  3GE1 A;  1ASU A;  4Z4G A;  2GTD A;  4OKE A;  5LMN K;  4DB3 A;  1DEJ A;  3NGI A;  4DG1 A;  2E2N A;  1W9H A;  3IAY A;  1KLN A;  1Y97 A;  3ENH A;  3O9T A;  5BN9 A;  3LAN A;  1QSL A;  3THY A;  3FGU A;  3JXU A;  4AHT A;  3KHY A;  3M6G A;  3KD5 E;  4LH5 A;  4RW9 A;  3D7E O;  3P39 A;  4CGI A;  4IFV A;  5I9E B;  2ZF5 O;  2D0A A;  1RIL A;  3DMJ A;  4YOR A;  5M1P A;  4ZTF A;  2ZGZ A;  3MXJ A;  2NUB A;  2X6N A;  3L4Q A;  4HVJ A;  3CPW M;  3OW2 M;  4DQS A;  3EE8 A;  2VG7 A;  3FZF A;  1RTJ A;  1EP4 A;  5KRT A;  3NCI A;  4JS5 A;  3P1G A;  1BIU A;  3W3D A;  4C8M A;  1WAJ A;  3LAM A;  1OKJ A;  4E3S A;  4DSI A;  1JLQ A;  4BRE A;  3ZX0 A;  5TKY A;  1RDA A;  4K8X A;  3KD1 E;  5H1S Q;  1IKY A;  3A5L C;  5AQK A;  4B9M A;  2G8I A;  3CCU N;  3NVK A;  3LDO A;  2Z1J A;  3D2F B;  3O4W A;  5AQU A;  4A2A A;  3SI6 A;  3ZSR A;  2VYP A;  3OVN A;  4U7B A;  4FJX A;  3U3Y A;  2HBK A;  4W5N A;  3AVM A;  4M63 C;  4IEE A;  1VQN N;  1YAG A;  4E1M A;  3HL8 A;  1HYV A;  3NF8 A;  4IO9 L;  4CGG A;  3TPQ A;  5FLX O;  4CBU A;  4B3O A;  1S5J A;  1NK7 A;  3J80 O;  3QBX A;  3OS0 A;  4YDU A;  1TAQ A;  1WAF A;  3R8E A;  3AA2 A;  3BF3 A;  4A5B A;  4ISF A;  4BG9 A;  1YXQ A;  2QK9 A;  2YHX A;  2CH5 A;  4LF8 K;  4H5W A;  1U4B A;  1X9M A;  1HMV A;  1K8K A;  1C0G A;  3OYM A;  4B3S K;  2FSN A;  2HHU A;  1NKE A;  3J7A P;  3VQ4 A;  3HRG A;  1JCG A;  3ID8 A;  1YIT N;  3NH2 A;  3MX2 A;  3M5R A;  4N47 A;  3EZW A;  2PY5 A;  1D4X A;  1R59 O;  4YFU A;  4E7H A;  1QSY A;  4OKK A;  1HR0 K;  3RR8 A;  4MDA A;  4BR0 A;  4MLH A;  4CGF A;  2YHY A;  1KRP A;  4CJL A;  1N8R O;  3E01 A;  3TR8 A;  2UUA K;  1EWQ A;  3HST B;  4KI4 A;  4FK0 A;  4DLG A;  3A8Y A;  4F3O A;  1WUA A;  1SL1 A;  1JLA A;  3TAF A;  1U2V B;  3L2Q A;  3V6D A;  1L3U A;  4O0I A;  3UE5 A;  1H1V A;  3KLH A;  4B9L A;  2Z1I A;  4OVL A;  1NBW A;  2Z1G A;  5E26 A;  4WQ4 C;  3K9J A;  4CEF A;  3PIO L;  3HT3 A;  3THW B;  3C95 A;  1VQ9 N;  1A5W A;  1NLV A;  3CC7 N;  1V4S A;  4E7K A;  1IG8 A;  1X1P A;  2F4V K;  2YJE A;  2ZQB A;  4CJW A;  2JWL A;  1NG9 A;  3SUQ A;  1GLD G;  3VQQ A;  3PV8 A;  1T44 A;  1I39 A;  2YKM A;  5CYM A;  4PKG A;  4DTP A;  1S1T A;  4CIG A;  4DTM A;  1RDD A;  1BQN A;  3AA4 A;  3C6H A;  4FXD A;  2NZT A;  5HBM A;  4IG0 A;  1VQ8 N;  2OPQ A;  4IDH A;  4CEC A;  4AHV A;  4CD1 A;  4FLY A;  2WFB A;  4JI2 K;  4EIA A;  4H5V A;  4CVN E;  3ZET A;  5J2N A;  4ELT A;  4DQR A;  3R3L A;  2BUP A;  3V9Z A;  1HJO A;  2D1K A;  1KC8 O;  3SMP A;  4BAC A;  1N5Y A;  4JYA K;  4NB4 A;  1QQC A;  4JK7 A;  3MN7 A;  4JKG B;  1HUX A;  2XY7 A;  3SQ0 A;  1D5A A;  3F2K A;  3SAH A;  1KFD A;  4ILH A;  1BCM A;  1Q9Y A;  3ZSY A;  1C1B A;  2IDO A;  4OO1 J;  3O8M A;  2GWJ A;  5AFU H;  5JIC A;  5LL6 Z;  3R9P A;  5GAE P;  1WLJ A;  3P4I A;  5JS2 A;  3VTH A;  2GWK A;  4CFC A;  1HNW K;  3CMA N;  3OYI A;  1TUU A;  2O8E A;  2Q0R A;  3FZK A;  4WFB L;  5SWM A;  4RW8 A;  1GLC G;  3KJV A;  2IAJ A;  1EX4 A;  3RTV A;  5JMV A;  4BR2 A;  2CGK A;  3FE1 A;  3MK6 A;  1YVN A;  4DR7 K;  3VES A;  2VGN A;  1U49 A;  1ZC6 A;  4QAG A;  5AQL A;  2OPR A;  5I3U A;  1EO1 A;  4BQZ A;  1NGJ A;  4DUZ K;  2XRI A;  5EXW A;  3QEW A;  4QOZ B;  1N34 K;  1RTD A;  5CE3 A;  4PWD A;  3CG7 A; 
#chains in the Genus database with same CATH homology
 1RNH A;  4DSE A;  4KHU A;  4KI6 A;  1HPZ A;  1VSJ A;  3ITH A;  1CXQ A;  3NF7 A;  5KGX A;  4E89 A;  3CFR A;  4BDY A;  3VA3 A;  2WON A;  4B9T A;  4BDZ A;  3QNN A;  2HHW A;  2VG6 A;  1DTT A;  4GW6 A;  5HRR A;  1LAV A;  4HUF A;  1NK0 A;  3DRS A;  2HHV A;  1S6Q A;  3ALY A;  4DQP A;  3SYZ A;  4DTR A;  2KTQ A;  1U45 A;  1BQM A;  1TKT A;  1VSI A;  1S1U A;  2DFE A;  4AHR A;  4PA1 A;  4DF8 A;  3RWU A;  5FRN A;  2BE2 A;  3OYJ A;  5SZT A;  4IBN A;  2OYQ A;  3OJU A;  4KFB A;  3DOK A;  2VWJ A;  1C1A A;  4CEZ A;  3KLF A;  3K5L A;  2JGU A;  3TAM A;  3F9K A;  3QET A;  1RT6 A;  5KGW A;  3VQ5 A;  3KK3 A;  4B08 A;  3LDS A;  3PX0 A;  3LWM A;  1ZBI A;  2YHA A;  3SPY A;  4FJ8 A;  1QE1 A;  1JLE A;  2VG5 A;  3VQP A;  3AA5 X;  1ZYQ A;  3KLG A;  4LSL A;  3DM2 A;  3O4Q A;  2FBT A;  2HND A;  2LSN A;  3V1O A;  4Z4F A;  2X78 A;  1VSF A;  1RDC A;  3OYK A;  4DTJ A;  2G8U A;  4KV8 A;  1TKZ A;  1HNI A;  4BWJ A;  1TK0 A;  4FJH A;  3MEG A;  1HQU A;  4M3W A;  4CEA A;  5HRN A;  2E6M A;  1WSE A;  2XY5 A;  3VQB A;  4N56 A;  2G8H A;  1XHX A;  4LY7 A;  3SPZ A;  2HHQ A;  1RBR A;  3DYA A;  1XI1 A;  3ZSZ A;  4M3T A;  1QS4 A;  3LP3 A;  2YNF A;  4CFB A;  1TV6 A;  2AJQ A;  1D9F A;  1QSS A;  4FJK A;  1VSL A;  4PUO A;  3NHG A;  1WSH A;  4TSX A;  1T8E A;  4I7F A;  1Z26 A;  2ATQ A;  1NJZ A;  2XHB A;  4FJJ A;  2YNI A;  5KRS A;  5E41 A;  1NOY A;  1NK6 A;  3AO2 A;  4RW7 A;  3QER A;  3NFA A;  4OPK A;  3NE6 A;  2QKB A;  1VSE A;  2HVI A;  4CED A;  5HRO A;  4OKJ A;  3AO1 A;  4FCY A;  4BE1 A;  4RW6 A;  3ZT4 A;  2Y1I A;  3T3F A;  4DS4 A;  4JRP A;  2F96 A;  1LAW A;  4KRF A;  4DTN A;  5FRO A;  2RN2 A;  4C8K A;  4O55 A;  3ZT2 A;  4FZX C;  2G8F A;  4KB0 A;  3RMC A;  2P5G A;  2RPI A;  4I9Q A;  2RKI A;  4CHO A;  3TAR A;  1NK5 A;  3U6F A;  3OYF A;  3HPO A;  4CHY A;  2Z1H A;  4KHY A;  4CJP A;  3SQ4 A;  2I5J A;  4CJR A;  1HRH A;  1S9G A;  4N76 A;  1FK9 A;  4DTX A;  4ZTJ A;  2YNG A;  2R7Y A;  4CJU A;  2ZD1 A;  3P5J A;  4FZZ A;  2A1R A;  3AVB A;  5DMR A;  3HVR A;  1GOC A;  4CF2 A;  3ULD A;  4DSF A;  4KHW A;  4E7I A;  4J2B A;  2KZZ A;  3V9W A;  3TAB A;  3QEP A;  4H4M A;  4KHQ A;  4RG8 A;  5T7B A;  4CJK A;  4M3R A;  4YNQ A;  1L5U A;  3DI6 A;  1JXB A;  3BDP A;  4HUE A;  5CYQ A;  4DU4 A;  1T7P A;  1LWF A;  4KTQ A;  1S1V A;  3VQ7 A;  3BGR A;  3LAL A;  3AVN A;  3MAQ A;  2IC3 A;  2ITG A;  4FW1 A;  4AHU A;  3A2F A;  2KFZ A;  1BGX T;  1SKR A;  3ZT1 A;  4Q0B A;  1J53 A;  3ZSQ A;  4CJ3 A;  3L2U A;  1LW2 A;  1G15 A;  1RBV A;  4Y1C A;  4MQ3 A;  4FVM A;  3HYF A;  5J2Q A;  3JSM A;  1RTI A;  4CFD A;  3TAE A;  1CLQ A;  4CJE A;  3M8P A;  4CEQ A;  3MED A;  4J2D A;  4B9V A;  1RBS A;  1X9S A;  4NCB A;  3SNN A;  3SJJ A;  1NJW A;  4IG3 A;  1DTQ A;  3OYE A;  3CM6 A;  2YNH A;  3I8D A;  2FBX A;  3ASM A;  4UQG A;  3M8Q A;  4CE9 A;  4JS4 A;  4ELU A;  2GUI A;  3VQD A;  3DLR A;  3DLK A;  4FJ7 A;  5CY4 A;  4Z4I A;  1T03 A;  1RT2 A;  1UA1 A;  1RT4 A;  2F8S A;  1GOB A;  4ICL A;  3NGZ A;  5D3G A;  3AVL A;  4GMJ B;  5K14 A;  3C6U A;  3QEI A;  2PZS A;  1TVR A;  4FK2 A;  1A5X A;  1UOC A;  4FM2 A;  3TAP A;  4CJS A;  1CZB A;  4O5B A;  4CIE A;  4FLX A;  2X74 A;  3LWL A;  5HLF A;  1BCO A;  2D0C A;  3LP1 A;  3CFO A;  4FLU A;  3RMD A;  5KI6 A;  4DWI A;  3PX6 A;  1RBT A;  5C25 A;  3NF9 A;  3AVC A;  4E7L A;  2P1J A;  2HHS A;  1ASW A;  3O3F A;  1RT5 A;  4CEO A;  4W5R A;  4NCA A;  3OYC A;  4M45 A;  3QIN A;  3QLH A;  4KHS A;  1K6Y A;  2JLE A;  2YHB A;  3DLG A;  4FJ9 A;  4CF9 A;  4RW4 A;  4DMN A;  1TAU A;  2WOM A;  1KCF A;  2G8K A;  2IGI A;  3DLB A;  3MEE A;  4DFM A;  4C8O A;  1RCH A;  4CHN A;  4HCB A;  4I2Q A;  3AVJ A;  2A1S A;  1ZBU A;  3AVG A;  1F21 A;  4EP5 A;  4Q5V A;  4GVM A;  3RRH A;  4KAZ A;  4Y1D A;  4OLA A;  3EZ5 A;  1TK5 A;  3TAQ A;  4ID5 A;  3SV3 A;  4DS5 A;  4DSL A;  4HCC A;  3NH1 A;  2KQ2 A;  3V1Q A;  3K58 A;  2X6S A;  3FFI A;  4W5T A;  3PO4 A;  1IO2 A;  4IFY A;  3MEC A;  3D45 A;  2HHX A;  1U04 A;  4BWM A;  4KO0 A;  2DY4 A;  1JL2 A;  2QKK A;  3HO1 A;  4AH9 A;  4BDP A;  1YVU A;  3KK2 A;  3VQ6 A;  1VSM A;  1JKH A;  2ETJ A;  1XC9 A;  3NAE A;  1XHZ A;  4E1N A;  1Z25 A;  3B6O A;  3PX4 A;  3RRG A;  4C8L A;  4FZY A;  4PQU A;  1ASU A;  4KPY A;  4OGE A;  4DQQ A;  3G0Z A;  1U48 A;  3AO3 A;  3AVA A;  4Z4G A;  1KVB A;  1S6P A;  2FC0 A;  1LW0 A;  4OKE A;  4HHT A;  4NYF A;  4I9L A;  3NGI A;  1TK8 A;  3OS2 A;  3K5N A;  4JLH A;  2F8T A;  3LPT A;  4CGJ A;  4B9U A;  1IKW A;  4CGH A;  1JXE A;  4DG1 A;  3VQC A;  1HQE A;  3OYL A;  1W9H A;  3VQ9 A;  4CHQ A;  3IAY A;  1KLN A;  4AHC A;  3VN5 A;  4J2E A;  1Y97 A;  3HM9 A;  3CFP A;  1NK9 A;  2E4L A;  1RTH A;  2RF2 A;  4M3Z A;  1FKO A;  3LAN A;  1QSL A;  3RR7 A;  3QEV A;  1LWC A;  1A5V A;  3QO9 A;  4AHT A;  3OS1 A;  1WSG A;  3HPH A;  1U47 A;  3KD5 E;  4LH5 A;  4RW9 A;  2OPS A;  4NYN A;  3QES A;  3NF6 A;  2DFH A;  4CF8 A;  4E7J A;  4CGI A;  3HPG A;  1J9A A;  1KVA A;  4I2P A;  4IFV A;  4LD0 A;  4FK4 A;  1BHL A;  2D0A A;  1RIL A;  3DMJ A;  3NDK A;  4FLV A;  2Q3S A;  5HRP A;  4ZTF A;  4ELV A;  3MXJ A;  2NUB A;  1IG9 A;  2X6N A;  3PO5 A;  4CER A;  4HVJ A;  3SQ1 A;  4KTW A;  3V9X A;  4DQS A;  4CEE A;  3EYZ A;  3KK1 A;  2VG7 A;  1C1C A;  1RTJ A;  1EP4 A;  4EP4 A;  5KRT A;  3NCI A;  3L8B A;  4JS5 A;  3V9U A;  3QNO A;  3P1G A;  4E0D A;  1BIU A;  1D9D A;  5FDL A;  4M3X A;  4L8R B;  4CJQ A;  1C0M A;  4O44 A;  3ZSO A;  1REV A;  4C8M A;  1VRT A;  3ISN C;  1WAJ A;  1QTM A;  3DRP A;  4KB1 A;  5J2M A;  3LAM A;  4E3S A;  3T19 A;  3OYD A;  1WSF A;  2VWK A;  4DSI A;  1JLQ A;  4FLZ A;  3AVK A;  4H8K A;  2HMI A;  1L3V A;  1N6Q A;  2HHT A;  1RDA A;  3DRR A;  3P83 D;  2E6L A;  3HXM A;  3PY8 A;  3OYN A;  3KD1 E;  4K8X A;  3D0P A;  3KTQ A;  1IKY A;  4DF4 A;  4K8Z A;  3L3U A;  3K57 A;  4CF0 A;  4B9M A;  4CCH A;  1KTQ A;  2Z1J A;  4FJN A;  2G8I A;  4QCL A;  4CEB A;  2D5R A;  3ZCM A;  4B8A B;  2KFN A;  4DTS A;  1LWE A;  4O4G A;  2XO7 A;  3DLE A;  3SUN A;  2G8W A;  3LPU A;  3U3G A;  3V1R A;  4F8R A;  1CXU A;  4DFP A;  3ZSR A;  3SI6 A;  3MXI A;  4Z4E A;  3OVN A;  3SV4 A;  4FJX A;  3U3Y A;  4ZHR A;  4W5N A;  3AVM A;  3LAK A;  2OA8 A;  3AVH A;  4E1M A;  3HL8 A;  1HYV A;  3NF8 A;  4CGD A;  1KFS A;  4CGG A;  5J2P A;  4B3O A;  2B6A A;  1S5J A;  3L2R A;  3S3M A;  4M3U A;  3S9H A;  1NK7 A;  4E19 A;  3K59 A;  3OS0 A;  2BDP A;  1TAQ A;  3VQA A;  1I3A A;  1WAF A;  1FXX A;  2IOC A;  3AA2 A;  4W5O A;  4AHS A;  4F4K A;  1VRU A;  2ZE2 A;  1B9F A;  3SQ2 A;  5CZ1 A;  4EZ6 A;  3H08 A;  3CM5 A;  1ZBL A;  2QK9 A;  2OPP A;  3HP9 A;  1J54 A;  1U4B A;  1NJY A;  4OJR A;  3HJF A;  1X9M A;  4CF1 A;  1HMV A;  2B4J A;  3OYA A;  2BAN A;  3ZT0 A;  4KTZ A;  1WSJ A;  1Q9X A;  4KKO A;  3WNG A;  2YKN A;  1ASV A;  2IS3 A;  3OYM A;  1RBU A;  2O4I A;  1SL2 A;  2HHU A;  4G1Q A;  1NKE A;  1KVC A;  3UIQ A;  3TI0 A;  3VQ4 A;  3ZSV A;  3C6T A;  1X9W A;  2OZS A;  1WNS A;  4CJF A;  2XY8 A;  1JLF A;  3NH2 A;  3VA0 A;  4FJG A;  4N47 A;  1IKV A;  3K2P A;  2PY5 A;  4FYD A;  1C6V A;  4YFU A;  4IDK A;  4OKK A;  3WNF A;  5C42 A;  4E7H A;  4DFK A;  2XY6 A;  5CZ2 A;  1QSY A;  3RR8 A;  4CGF A;  1NK4 A;  4NCG A;  4XIU A;  4FJ5 A;  4F2R A;  1TKD A;  4C8N A;  1KRP A;  2GBZ A;  4KHN A;  3LP2 A;  4CJL A;  1B92 A;  1JLB A;  2HNY A;  3AVI A;  2B5J A;  4F2S A;  3MXM A;  1BIS A;  3HP6 A;  3E01 A;  3TR8 A;  1XWL A;  3SUP A;  3O3G A;  3HST B;  3AV9 A;  4KI4 A;  4FK0 A;  4DLG A;  3IS9 A;  4F3O A;  4N41 A;  3C94 A;  2PYJ A;  4DQI A;  1RT7 A;  1RT1 A;  3LZI A;  4WE1 A;  1JLA A;  3JYT A;  4DU1 A;  4LSN A;  3TAF A;  5I42 A;  1SL1 A;  3OYG A;  4R5P A;  3L2Q A;  3L2V A;  3V6D A;  1L3U A;  1C0U A;  2OZM A;  3QIO A;  4O0I A;  3IG1 A;  3V9S A;  3KLH A;  1SUQ A;  4B9L A;  2Z1I A;  1IKX A;  1W0H A;  4OVL A;  2Z1G A;  4Z4C A;  3NH0 A;  4CEF A;  1S1W A;  3HT3 A;  3TAN A;  4CJ4 A;  3F73 A;  3LP0 A;  1UWB A;  3WNH A;  1O1W A;  3C95 A;  3RMA A;  4FJL A;  1A5W A;  3O4N A;  2EHG A;  3AO5 A;  3KKR A;  5HP1 A;  3WNE A;  1S9E A;  3DOL A;  3TAG A;  2DFF A;  4E7K A;  1X1P A;  1B9D A;  4CJV A;  3OYH A;  1D8Y A;  3ZT3 A;  2ZQB A;  4CJW A;  2KW4 A;  3SUQ A;  3S3N A;  1JLG A;  2EX3 A;  2HB5 A;  1J5O A;  4ID1 A;  4HTU A;  1EKE A;  3VQQ A;  3PV8 A;  1JLC A;  2QXF A;  1I39 A;  2YKM A;  4O0J A;  5CYM A;  4M3Y A;  4OLB A;  3OJS A;  4DFJ A;  1EXQ A;  1GOA A;  1S1T A;  4DTP A;  3S3O A;  2DTU A;  1JL1 A;  4CIG A;  4BE0 A;  4DTM A;  4CK2 A;  4MFB A;  4B8C A;  5C24 A;  2GV9 A;  5J1E A;  3CQ8 A;  1R0A A;  1RDD A;  1BQN A;  1ZBH A;  3SZ2 A;  3AA4 A;  4DTU A;  2FBV A;  4EZ9 A;  4FXD A;  3IRX A;  3CYM A;  5HBM A;  1QHT A;  3L2W A;  4AIL C;  3G10 A;  4IG0 A;  2OPQ A;  1S1X A;  4CJ5 A;  1HYS A;  1HNV A;  4CEC A;  1SKW A;  4FJM A;  1C0T A;  4J2A A;  4AHV A;  4CFA A;  4FLY A;  3L3V A;  3ZSX A;  3DLH A;  5HRS A;  5J2N A;  4ELT A;  4FM1 A;  4OPJ A;  4DQR A;  4M42 A;  1SV5 A;  3NGY A;  3V9Z A;  2P51 A;  3KIO A;  4B9N A;  1YT3 A;  4FW2 A;  3K5M A;  1KSP A;  4BAC A;  1N5Y A;  4IKF A;  1UAX A;  1MU2 A;  1BL3 A;  1VSH A;  1QQC A;  3HVT A;  4CK1 A;  3OY9 A;  2W42 A;  3AA3 A;  2YV0 X;  3B6P A;  1CZ9 A;  3KKS A;  3OYB A;  4CK3 A;  4FM0 A;  1NJX A;  2XY7 A;  2Y1J A;  3SQ0 A;  3QEX A;  1UA0 A;  4DU3 A;  1D5A A;  1NKC A;  4FLT A;  2HW3 A;  1KFD A;  3EY1 A;  1YTA A;  1LV5 A;  1YTU A;  4KRE A;  1BCM A;  1RDB A;  1Q9Y A;  3ZSY A;  4B9S A;  4CJT A;  3M8S A;  1C1B A;  2IDO A;  1BI4 B;  2BGG A;  4H4O A;  1L3S A;  4N5S A;  4M41 A;  1TL1 A;  3TWH A;  1WLJ A;  5FRM A;  5JS2 A;  3KLE A;  1ITG A;  4CFC A;  2FBY A;  2KZM A;  1VSK A;  4HUG A;  3OYI A;  1BI4 A;  4W5Q A;  4LH4 A;  1HJR A;  1TL3 A;  4DLE A;  1NKB A;  3KLI A;  3LZJ A;  5JS1 A;  3V81 A;  4FLW A;  3M8R A;  2D0B A;  1SL0 A;  3VQE A;  2HVH A;  2P5O A;  3K5O A;  4RW8 A;  5SWM A;  1TKX A;  3KJV A;  2IAJ A;  1EX4 A;  1RT3 A;  2HNZ A;  3RTV A;  1L3T A;  4CES A;  2PYL A;  1BIZ A;  4CHP A;  3I0R A;  3V4I A;  4F3T A;  3O3H A;  4Z0U A;  1TGO A;  3PUF A;  3AVF A;  1WN7 A;  4CIF A;  5EU7 A;  3QIP A;  3VQ8 A;  4PY5 A;  3THV A;  1NK8 A;  2G8V A;  4OGC A;  4CHZ A;  3RMB A;  1U49 A;  4QAG A;  1EET A;  1SKS A;  5KTQ A;  3SCX A;  1NOZ A;  1IH7 A;  3SUO A;  1ZBF A;  2OPR A;  1VSD A;  5I3U A;  4JRQ A;  1WSI A;  1FKP A;  2XRI A;  1DLO A;  1KLM A;  3I0S A;  3QEW A;  2O4G A;  4Z4H A;  4QOZ B;  1Q8I A;  4DSK A;  1VK0 A;  4FJI A;  3HK2 A;  4BE2 A;  5DK5 A;  1RTD A;  1T05 A;  3AO4 A;  3NBP A;  3T1A A;  4DTO A;  4DSJ A;  1HYZ A;  3ZSW A;  4PWD A;  3CG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...