1KVCA

E. coli ribonuclease hi d134n mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCNELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE H
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvcA00
3QLHA 2F8TA 3LAMA 3NDKA 4E1MA 3OY9A 3VA3A 1DLOA 1C1AA 1NK4A 2YV0X 3HPOA 4IG3A 3WNFA 5J1EA 2BDPA 1D8YA 4ICLA 4C8MA 3ZT4A 2DY4A 3AVGA 4O55A 3SPZA 2HHVA 2Z1IA 2EX3A 4CHQA 1WN7A 1JL1A 2VWJA 1QSYA 3NF8A 1IKXA 1U04A 2VG5A 4CEEA 4FLYA 3LANA 3V9SA 1VSFA 1ZBHA 4JLHA 4OLAA 4CJ4A 2Y1IA 1RTDA 1RDBA 4UQGA 1RT5A 1NK6A 5I42A 4IKFA 2Y1JA 4I9LA 3NE6A 2XRIA 1HPZA 3UIQA 3VQ7A 3KK3A 3VQEA 1BQNA 5KGXA 4CJSA 4DSKA 4DQQA 4H8KA 4FJGA 2KQ2A 3LP3A 4Z4FA 1LAVA 1HYSA 4CJ5A 1RTIA 5SZTA 3OYLA 3V9UA 2XY5A 1TKTA 3TAQA 1SL0A 1Z26A 2RN2A 2RPIA 4M3YA 1LWFA 1HYZA 3DOLA 3V1RA 1J53A 4CJRA 2G8KA 2FBVA 4KKOA 3MXIA 1SL1A 4EP5A 2OPPA 3DM2A 2WONA 3P5JA 4CGDA 4K8ZA 4KRFA 3IG1A 4FZZA 3OS0A 1A5WA 3JSMA 4DU4A 3S3MA 1QTMA 3QEXA 4Z4GA 3DOKA 4R5PA 4LSNA 3CQ8A 4CEZA 3SI6A 4DTJA 3ASMA 1KSPA 1KTQA 3SUPA 3AA2A 4M3XA 1RT4A 4CEQA 4W5QA 4CJ3A 3LP1A 4DSFA 4CERA 3DLRA 2GV9A 1XC9A 4FYDA 1BCOA 3HO1A 3LPUA 1IG9A 3U3GA 3OYAA 4B9NA 4DWIA 3ZCMA 3BDPA 4MQ3A 5HRPA 3SJJA 4JS4A 2A1SA 1LW0A 4CGHA 4KPYA 4DTUA 3VQ6A 1JLAA 4KTZA 4J2EA 3FFIA 3DLKA 4FLVA 1XHXA 3QO9A 4Q5VA 4LY7A 1NJWA 3DLGA 1KVCA 1RDDA 1WLJA 3AVCA 3SUOA 5J2PA 3CFRA 3S3NA 3NGZA 4RW6A 4FJNA 4M3RA 4B8CA 4HHTA 1F21A 1JLQA 3NCIA 1L3SA 3PX6A 3OYNA 3I0SA 1KVBA 3K2PA 4DFPA 3LAKA 3B6OA 4G1QA 3KIOA 4FJJA 4K8XA 1VSHA 3T3FA 3V6DA 3QNNA 1UOCA 3TARA 3RR8A 4CJWA 1IO2A 4O0IA 2XY7A 4HCBA 3EY1A 3VQ9A 3CM5A 4CF1A 3LWLA 3AV9A 4OKJA 5E41A 2KZMA 5C42A 1JLCA 5EU7A 3P83D 4E3SA 3F9KA 2ZQBA 3AVIA 3K57A 1CZ9A 4JS5A 1Z25A 2IS3A 3T19A 1C1CA 2P1JA 5HP1A 1NJYA 3OYDA 4RG8A 4ZHRA 1NK0A 5J2MA 4F2RA 3K5LA 2DFEA 4CEAA 4DS4A 2R7YA 1RT1A 3LP2A 3VA0A 3K58A 1BIZA 3AVKA 4PY5A 3V9XA 4DSEA 5T7BA 4FM0A 3MECA 4N56A 3MAQA 4DS5A 1BI4B 1I39A 4MFBA 4FK4A 1T03A 2X6NA 4IBNA 4NYNA 4BE0A 2IC3A 4AHVA 2E6MA 4CHOA 1B92A 1KLNA 2JLEA 4FJLA 3VQ5A 3OYJA 1GOBA 1C0MA 2D0BA 4DTOA 3OYFA 1S1XA 4JRPA 1ZYQA 4DU1A 3M8QA 2D0CA 4GW6A 1KRPA 1TKZA 4E19A 4C8KA 3P1GA 4FLXA 3WNEA 4M3WA 3AO5A 3ZSVA 3DYAA 4AHTA 2XO7A 3WNHA 1I3AA 1RILA 3HXMA 3DI6A 2B4JA 3VN5A 1KFDA 4FW1A 4KTQA 3MEDA 3RMBA 3CFPA 1TAUA 2P5OA 1EP4A 1UWBA 1JLEA 3ZT0A 4E1NA 4W5TA 3ZT1A 1JXBA 2QKBA 5CY4A 3KD5E 4HUGA 4C8LA 4CEOA 3HP9A 2XY8A 5FRNA 3B6PA 3TAMA 4FJXA 4KHQA 1KCFA 1U48A 3L3UA 2ATQA 4L8RB 1TL1A 4Z4CA 3VQQA 4OVLA 2HHTA 1CZBA 4DSJA 5CZ1A 1T8EA 3NFAA 3KK1A 1WSJA 1S1TA 4LSLA 1J9AA 3SUQA 1S1VA 1N6QA 2EHGA 2JGUA 3SQ4A 4O4GA 3OJSA 1EX4A 4RW7A 4B08A 2DFHA 3L8BA 3LZIA 3ISNC 4O44A 4YFUA 2KFNA 4DG1A 1MU2A 2BE2A 5JS2A 3PV8A 5JS1A 3AVBA 4LD0A 3AO2A 3MEGA 2X78A 4RW8A 4DQPA 3OYGA 3VQ8A 3A2FA 2IDOA 1RDAA 3ZSRA 1TK0A 4KHSA 4PWDA 3TAGA 1TK5A 1WSEA 4CIGA 3KLFA 2QKKA 4QOZB 1KLMA 3LDSA 4FJHA 4N76A 4DQIA 3NH0A 3L2UA 1TKDA 1IKWA 4H4OA 4E7LA 4O5BA 3K5MA 3G0ZA 4CJKA 3TANA 2B5JA 4B9TA 4J2BA 1YTUA 1RBSA 4GVMA 4KO0A 2RKIA 1L3VA 4KI4A 4F3OA 4DMNA 4KHYA 2F8SA 3OJUA 2FBYA 3PUFA 4Y1DA 1L5UA 2HMIA 3LZJA 1DTTA 2GBZA 3K5OA 4BDYA 3VQ4A 1ZBLA 1U47A 2FBXA 1RT6A 4H4MA 4B9LA 3HSTB 1YTAA 4KV8A 4OLBA 3VQPA 1QQCA 3HVTA 4F4KA 1K6YA 4GMJB 1S9EA 5CYMA 1N5YA 4HUFA 1NK7A 4DFKA 1J54A 4CEDA 2OPRA 2B6AA 4ZTJA 3ALYA 1J5OA 3AO3A 4DF8A 1SKRA 1NKEA 3QESA 4I9QA 2DTUA 2NUBA 4DTPA 3V81A 1TK8A 3AO1A 2PYJA 3OYKA 1HRHA 2OPQA 2ETJA 5HRSA 1HQEA 5KGWA 1G15A 4CFCA 1D9FA 4DFMA 3I8DA 3ZSXA 4CFBA 4DLEA 1DTQA 3C95A 4HCCA 4I2PA 1UAXA 1XHZA 2D0AA 4WE1A 2IGIA 4EZ9A 2X6SA 2E6LA 1ASUA 4FM1A 3RMCA 1ZBFA 3U3YA 3RRGA 3L2QA 4BDPA 4FJ7A 4OGCA 1VRTA 4FLWA 1U4BA 3ZT2A 2IOCA 3D0PA 1RBUA 5J2QA 2PZSA 2BGGA 3OS1A 3AVLA 4E7HA 3ZSZA 4FLZA 3PO4A 1QS4A 4FJ5A 5KTQA 3HPHA 1L3TA 3LPTA 4OJRA 2HHSA 3SYZA 3LALA 4DU3A 4Z4IA 1X1PA 1A5VA 3VQDA 3RTVA 2IAJA 4F3TA 2HVIA 3L2VA 4E89A 4FW2A 2HW3A 2KTQA 3HPGA 4IDKA 2ZE2A 4FM2A 2G8FA 1Q9YA 4IFYA 5HRRA 5CZ2A 1JKHA 3RR7A 2G8VA 3O3HA 1FK9A 4PA1A 1TKXA 3EYZA 3V1OA 1S6QA 3KJVA 4AILC 2VWKA 4CIEA 1XWLA 1NK8A 2F96A 3C6TA 4M3TA 3HP6A 1VSEA 1ASVA 3TI0A 4HUEA 4KTWA 2ITGA 1S1WA 1ITGA 1C0UA 4CEBA 2G8IA 2AJQA 5HROA 3K59A 4CFDA 3NAEA 4CF8A 4KB1A 2YHAA 1S5JA 3M8PA 1VK0A 2LSNA 1QSLA 4EP4A 3KLIA 3NGIA 1W0HA 3SUNA 3NH1A 1RDCA 1RNHA 3SV3A 1VSKA 3V9WA 4DTRA 3KTQA 4F8RA 4B9VA 3OYEA 3C94A 4M42A 1NKBA 3QEPA 4C8NA 3LWMA 1NJXA 1R0AA 4CJVA 3QIPA 4CGFA 4CF0A 3TWHA 4W5RA 3NBPA 2BANA 3ZSQA 4DTMA 2OZSA 3HYFA 1SKSA 3RWUA 4CHZA 3IS9A 4EZ6A 4OKEA 1LAWA 4FZYA 4C8OA 1WAFA 1NOZA 3HT3A 1IKVA 3DLEA 1LWCA 3HK2A 2GUIA 2YNIA 3C6UA 2FC0A 4KFBA 3PX0A 4FJ9A 2YKMA 3ZSYA 3DRSA 5FDLA 3PO5A 4Z0UA 4LH5A 1A5XA 3K5NA 1TL3A 3SV4A 1ZBIA 4NCBA 1U45A 3NF9A 4KI6A 4KB0A 1REVA 1NJZA 1RBTA 1X9MA 4DQRA 1B9FA 1O1WA 2E4LA 1ASWA 3AVHA 3L2RA 3TABA 1C6VA 4B8AB 4Q0BA 1ZBUA 4ID1A 4DTSA 2ZD1A 3G10A 3NH2A 5C25A 3PY8A 4DSIA 4CK2A 2YKNA 4ELVA 3O3FA 3RRHA 5DMRA 3E01A 3L3VA 1YVUA 3BGRA 4FCYA 1HNIA 3D45A 2DFFA 1T7PA 1FXXA 4CK3A 4DFJA 3QEIA 1CLQA 5SWMA 5CYQA 3SPYA 1XI1A 4RW9A 4DF4A 5I3UA 1RBRA 1VSMA 1VSIA 3O4NA 4FLUA 2G8HA 3QEVA 4FJ8A 4B3OA 4B9SA 1HQUA 2W42A 5HBMA 5K14A 4CGJA 1SUQA 3EZ5A 4E7JA 1T05A 3H08A 1CXQA 4KHWA 1BGXT 3HVRA 4CJQA 4ELTA 1BI4A 3QINA 4PQUA 4ZTFA 3DLHA 1QHTA 4KHNA 4BACA 2XY6A 2Z1GA 1JLFA 2P5GA 3VQCA 1UA1A 4Z4EA 5DK5A 5FROA 3S9HA 1KVAA 4CGGA 3OVNA 3AVNA 3AO4A 3AVAA 3CG7A 3KD1E 3L2WA 3KKSA 2HVHA 3VQBA 3KLEA 3T1AA 3TAFA 1U49A 4FK2A 2HHXA 3HL8A 4QAGA 4BE2A 3V4IA 4OPJA 3OYCA 5C24A 2VG6A 1VSDA 2KW4A 3TR8A 3KKRA 4BE1A 4AHCA 4OPKA 1VRUA 1WAJA 3VQAA 4CJUA 3F73A 4AHRA 4CIFA 4E7IA 3AA4A 3TAPA 4AH9A 2KZZA 1NKCA 1Q8IA 4CHNA 4J2AA 5D3GA 1WNSA 4BWJA 4FJIA 4KHUA 1IKYA 3V1QA 4IFVA 3IRXA 4NYFA 1X9SA 4W5NA 4CFAA 1JLGA 2A1RA 3ZSOA 4OGEA 2Z1HA 3I0RA 4FLTA 2QXFA 3MXMA 4AHUA 2YNFA 4CHYA 1BIUA 1VSLA 3CFOA 4TSXA 4XIUA 4DQSA 2I5JA 4ID5A 4CJLA 4CK1A 2YNGA 3WNGA 2D5RA 4BDZA 3QIOA 3S3OA 3ULDA 2YNHA 4E0DA 1B9DA 1BCMA 4B9UA 2HNYA 1JLBA 5KRSA 1RBVA 1WSGA 4F2SA 4CHPA 3OS2A 4E7KA 4NCGA 4BWMA 4CCHA 5J2NA 1LV5A 2OYQA 1S9GA 2Q3SA 3NF6A 1C1BA 4CJEA 1WSFA 3LP0A 5HLFA 4IG0A 3OYBA 1X9WA 2KFZA 4HVJA 4DSLA 4CGIA 1IH7A 3AVMA 1SKWA 1D9DA 3PX4A 3HM9A 2HNZA 3JYTA 4HTUA 3HJFA 1TGOA 2QK9A 4CF9A 3MEEA 5KRTA 1YT3A 5KI6A 1EETA 3M8SA 4FZXC 1D5AA 4CJPA 3DMJA 3AVFA 1WSHA 3SQ1A 4ELUA 4KREA 1NOYA 1BISA 3DRRA 1GOAA 4Y1CA 2Z1JA 3DRPA 4O0JA 4DTNA 3CM6A 4YNQA 1VSJA 4KAZA 3MXJA 1Q9XA 3NF7A 4N47A 2G8UA 1FKPA 1HJRA 1RT3A 3O4QA 2HHUA 4FXDA 4FJMA 2OZMA 4M3UA 1L3UA 1BHLA 1RTHA 1KFSA 1CXUA 2O4GA 1HYVA 3SZ2A 1TV6A 3AVJA 1SL2A 3ZSWA 3NHGA 4CESA 1TAQA 3RMAA 3THVA 3RMDA 4CJTA 3O3GA 4CF2A 2PY5A 2FBTA 1RCHA 3OYIA 2G8WA 5FRMA 4LH4A 2HHWA 4I2QA 1QSSA 2YHBA 3M8RA 3AA5X 2VG7A 4N5SA 3KLHA 4M41A 3OYMA 1JXEA 4FVMA 2P51A 2RF2A 4B9MA 4M45A 2HNDA 4RW4A 4AHSA 3IAYA 4JRQA 1UA0A 2O4IA 3U6FA 3SQ0A 4Z4HA 3KLGA 1FKOA 3V9ZA 2WOMA 1RT7A 2PYLA 3OYHA 4CEFA 3ZT3A 5HRNA 2X74A 1HMVA 1SV5A 1NK5A 1LW2A 4FJKA 1S6PA 1Y97A 1GOCA 2HB5A 1WSIA 4QCLA 4CE9A 1BQMA 2OA8A 3KK2A 4M3ZA 4DLGA 3QNOA 3AA3A 4FK0A 3SCXA 3SNNA 3QERA 1S1UA 2HHQA 1RTJA 3TAEA 3DLBA 4NCAA 1W9HA 4CJFA 1TVRA 2XHBA 1LWEA 1RT2A 3ITHA 3NGYA 1NK9A 4PUOA 3SQ2A 4OKKA 1EXQA 2OPSA 3QEWA 4W5OA 3QETA 1BL3A 3CYMA 1JL2A 1EKEA 4I7FA 4DTXA 1C0TA 4J2DA 1HNVA 4N41A 1QE1A 4CECA
chains in the Genus database with same CATH superfamily
1P8ZA 3Q7CA 4E1MA 2O8BB 2IVNA 3U9ZA 3VETA 1J5EK 4NXNK 1KD1O 4C1NK 3MX5A 2QWPA 3SPZA 2Z1IA 2EX3A 1GLEG 3VF4A 1HX1A 4OLAA 2IIRA 5GINA 4EHUA 4IKFA 3QICA 3UIQA 3VQEA 5KGXA 4CJSA 3BF3A 4JI1K 4ILHA 4JYAK 5CHIA 1SL0A 2RPIA 4CD3A 2FBVA 3THWA 1SL1A 4FWMA 4EP5A 1NNEA 2WONA 4K8ZA 4KRFA 2AP1A 1QTMA 3OBWA 3CQ8A 2YJFA 4JHDA 1QQMA 5AFUA 4FYDA 3LP1A 4DSFA 2GV9A 1G99A 1OH7A 3OYAA 4B9NA 5HRPA 3ULEB 4KPYA 4DTUA 3VQ6A 1JLAA 3DLKA 1XHXA 4JD2B 1QZ6A 3DLGA 1KVCA 1WLJA 1TYQB 3SUOA 3CFRA 2IVOA 4RW6A 4GV9A 4FJNA 3MN6A 4M3RA 1F21A 1JLQA 3IFRA 3NCIA 3PX6A 3I0SA 4DFPA 3LAKA 3QNNA 1UOCA 2XY7A 3UKUB 2F4VK 4E3SA 3O9SA 3P83D 1Z25A 3T19A 5TKWA 4FPBA 2Q36A 2R7YA 2UUBK 3K58A 3AVKA 1JJ2M 3V9XA 4PY5A 4YORA 4BR4A 2HF4A 3ZETA 4A5AA 4A2AA 3T69A 4FPAA 4H5TA 4NYNA 2IC3A 4AHVA 1D4XA 4GV3A 4JI3K 2E6MA 1EWRA 4JRPA 4DU1A 3M8QA 3FZMA 4GW6A 1V4TA 4E19A 3P1GA 2OANA 4ILJA 3ZSVA 3DYAA 3SMPA 1RILA 3VN5A 3O8MA 4IWVA 5KPTA 1KXPA 3RMBA 2VGMA 1FJGK 1JLEA 4W5TA 2GEMA 3ZT1A 5JICA 2UUCK 5C15A 4CEOA 1OVQA 3E66A 1U48A 3BF1A 3QFPA 3R9PA 1CZBA 2PBDA 3VQQA 3TTDA 1WSJA 3PIOL 1S1TA 1S1VA 2EHGA 2NRWA 5B8HA 2VWBA 4O44A 2GWKA 2I7NA 3PV8A 2UXDK 3AVBA 5AQNA 4BVPA 3J7YP 3A2FA 2IDOA 5GAGP 4DR3K 1TK0A 1RDWX 4QOZB 1KLMA 3CQYA 3NH0A 1IKWA 3VGKA 4H4OA 4E7LA 4O5BA 4CJKA 4BC3A 2B5JA 1YUWA 2F8SA 2P9LA 3PUFA 2HBLA 3JS6A 5FLXO 2KKZA 4IDHA 1HNZK 1S22A 1ZBLA 4FWSA 1RT6A 4B9LA 4OLBA 1QQCA 3RVCA 3WXMB 3P39A 1NMNA 1X3MA 3FFKB 1VQ4N 1NK7A 5GADP 2OPRA 2B6AA 3LDOA 3AO3A 1SKRA 3D7EO 1NKEA 4YOVA 3QESA 4I9QA 3THYA 4PL7A 2VYPA 5KGWA 1ILYA 1G15A 4CFCA 2Q0RA 4DFMA 1V4SA 1X3NA 4LF9K 4CFBA 4HCCA 3C95A 1UAXA 2IGIA 2O8BA 1ASUA 4FM1A 3RMCA 1ZBFA 4BDPA 3RRGA 1Q86O 2IOCA 2EWSA 3QBXA 3OS1A 1KQSM 4FLZA 3PO4A 1QS4A 5AJ3K 2HHSA 3LALA 4Z4IA 2IAJA 1E3MA 5EX5A 5AZIB 1ESVA 3T7ZA 4IDKA 4BROA 1HNWK 2KTQA 2ZE2A 4IFYA 2NLXA 1JKHA 4H5VA 3FGUA 3EE8A 5KPZA 4AILC 2QWOA 2F96A 1VSEA 3SAHA 2CH5A 3M3ZA 1NBWA 1C0UA 2G8IA 2AJQA 1I94K 4FWOA 4KH4A 4CFDA 1W7AA 1QSLA 1VK0A 2LSNA 4GNIA 4GY2B 4WFAL 4YOYA 4CZKA 3SUNA 3OYEA 1EQYA 1DEJA 3QEPA 3LWMA 1NKBA 1R0AA 4CJVA 3ULEA 4W5RA 5ADXH 3RWUA 1J6ZA 3CPWM 3IS9A 3DWLA 4EZ6A 3EZWA 4JI2K 5KPRA 4JD2A 3DLLL 1NGEA 3TU5A 1TYQA 2YKMA 4Z0UA 4LH5A 1EO1A 1TL3A 4MLHA 3GG4A 3G4SN 5GIPA 1RBTA 1NJZA 5DM7L 1O1WA 1ASWA 3WXJA 3UKUA 4B8AB 5AQTA 2ZD1A 3P4IA 2A41A 2YHXA 4CK2A 3RRHA 3E01A 4M7YA 5BRFA 3QEIA 5SWMA 1K73O 5FPMA 1VQON 4FLUA 1GLAG 1C0GA 1XUPO 2G8HA 3F9MA 1T05A 5AQPA 3ATVA 3IDHA 1SUQA 3HVRA 4CJQA 2E1YA 3R8EA 3UB5A 3CIPA 1N34K 4BR2A 2P5GA 3VQCA 5DK5A 1GLDG 4AQYK 1BO5O 1KVAA 4CGGA 1NJIO 3AVNA 5BREA 3VEZA 3VQBA 3KLEA 3TAFA 3MK6A 4BG8A 3HL8A 2BTFA 1NGGA 4OPJA 4FWPA 3KKRA 4AHCA 3F73A 1VRUA 1WAJA 4E7IA 3AA4A 4AH9A 1NKCA 2A5XA 4J2AA 3UE5A 3SLCA 4DV6K 4KHUA 4IO8A 4W5NA 1JLGA 1VHXA 2A1RA 2VQEK 4K25A 2ZJQL 1MA9B 1FW6A 2Z1HA 3KVGA 2A42A 1BIUA 1VSLA 3CJBA 4TSXA 3A5MC 4DQSA 4YOTA 2YNGA 4FO0A 2ZJPL 3CMEN 1T3VA 3DAWA 4JK7A 3JAMO 2QEXN 4CHPA 3OS2A 4E7KA 4BWMA 4FWNA 4MDBA 4CCHA 1LV5A 1S9GA 3FE1A 4NLBA 2WUSA 3OYBA 2YHYA 1Z05A 5JLHA 3A5NC 2KFZA 4NO7A 4DSLA 4CGIA 1IH7A 4YOWA 3PX4A 3I33A 2I7PA 2F9WA 5TKYA 1EETA 3ENOA 4FZXC 4CJPA 2E20A 4ELUA 4KREA 2V7YA 1NOYA 1BISA 3CHWA 3DRRA 1K8KB 2Z1JA 3DRPA 4V19S 2JWLA 3OA9A 4HTLA 5E26A 4DUYK 1Q9XA 2G8UA 1RT3A 1HJRA 4M63C 1BHLA 4LFBK 4JI7K 3I55N 3ZSWA 4CJTA 1RCHA 3ATUA 3L6QA 2G8WA 1YJNN 4LH4A 2ZJRL 1N8RO 3M8RA 3AA5X 3KLHA 1OH6A 1JXEA 2P51A 4O8KA 4AHSA 4JRQA 3WT0A 1HPMA 3KLGA 3V9ZA 4A59A 2PYLA 3U9DA 4CEFA 5HRNA 4FJKA 4CE9A 1BQMA 4DV3K 1M90O 4DLGA 1NGAA 3SNNA 3TAEA 3N4PA 1RT2A 3M6GA 5AZIA 3THXB 4PUOA 5C10A 4OKKA 1EXQA 1BL3A 4FOEA 2P9PB 1P90A 1JL2A 2F7TA 4CZMA 2YI1A 4H0PA 1QE1A 4CBUA 1ZYQA 4CECA 3QLHA 3HSCA 2F8TA 3LAMA 3NDKA 1C1AA 2WC9A 1D8YA 3ZT4A 4O55A 2HHVA 4CHQA 4PKHA 4CVNE 2VWJA 3AARA 1IKXA 1U04A 1T44A 2VG5A 4CEEA 3V9SA 1ZBHA 1VSFA 2QI2A 2Y1IA 2E5LK 4UQGA 1RT5A 1NK6A 4JI5K 3TSUA 1NGHA 4DSKA 4H8KA 4FJGA 3LP3A 1S72N 2H3GX 1HYSA 4JK8A 1RTIA 1Q18A 1MDUB 1TKTA 3SBTA 5AR0A 3MXIA 3IG1A 1U6ZA 4DU4A 3S3MA 4BRQA 4Z4GA 4DV7K 3DOKA 4R5PA 3SI6A 4DTJA 1KSPA 3SUPA 3LDLA 4CEQA 1TUUA 4CJ3A 3DLRA 3OHRA 3LPUA 3U3GA 4MDAA 1K8AO 3SJJA 5CE3A 3O5BA 2YJEA 3LDPA 4FLVA 3QO9A 4LY7A 5KQDA 1HUXA 1RDDA 1NWKA 3S3NA 3R6MA 1IBMK 1L3SA 5LMNK 3OYNA 4JI0K 3K2PA 3VTIA 3B6OA 4K8XA 1VSHA 3T3FA 1IBLK 2CGLA 3RR8A 1W97L 4H0YB 5LMUK 3JXUA 2FSJA 1JLCA 2KHOA 3F9KA 4U67L 4JS5A 2IS3A 1C1CA 1GLJO 2P1JA 5HP1A 4RG8A 1NK0A 5J2MA 1W2BM 3MX2A 3MCAB 4CEAA 3I56N 1RT1A 2DPNA 1BIZA 2GUPA 4DSEA 4FM0A 4B1YB 4Y0WA 4BRCA 4DS5A 3VGMA 1BI4B 1I39A 3UKRB 4A61A 5JMVA 1NLVA 1OVYA 3FR0A 4BE0A 3J7AP 4BRMA 4WFNL 1KLNA 2JLEA 4B1WB 3OYJA 1GOBA 1C0MA 4YDUA 3U8XA 3EO3A 4CZGA 4R79A 4C8KA 3C6HA 4AHTA 3WNHA 1I3AA 3MEDA 4JKGB 2P5OA 1JXBA 2QKBA 4KHQA 2ATQA 2CGKA 4L8RB 2ASMA 4H5WA 1WUAA 5CZ1A 1J9AA 1K8KA 1XQSC 3SQ4A 4RW7A 4B08A 3LZIA 3FZKA 5EOYA 4MLEA 5JS2A 3MEGA 3H46O 1XMQK 3ZSRA 4MO5A 3AY9A 1TK5A 1WSEA 2WFBA 3LDSA 4FJHA 4DQIA 3L2UA 1BG3A 3CERA 3WQTA 4CBWA 1YTUA 3SBGA 4B9TA 3SMSA 5GIOA 3HOSA 1NMDA 3CCRN 4DR6K 4F3OA 4K42A 4YDUC 3D2EB 3FZHA 1XC3A 2QWMA 3LZJA 1DTTA 2NRRA 3O08A 1OH5A 1U47A 2FBXA 3HSTB 1YTAA 3VQPA 3HVTA 1K6YA 4GMJB 1BWFO 5CYMA 1N5YA 4HUFA 4DFKA 1VQLN 4RCHA 4YY3K 3THXA 4ZTJA 5AQWA 1J5OA 4DF8A 4BRDA 3OBYA 3V81A 4DTPA 2P9PA 2ETJA 5AQOA 4IOAL 1Q82O 1VQKN 1VQNN 1DTQA 4C23A 4RWTA 2W6LA 2X6SA 2E6LA 4FJ7A 4FOIA 5BR8K 3L2QA 1U4BA 2PZSA 1RBUA 3RSEB 3ZSZA 4E7HA 3HPHA 1L3TA 3LPTA 4E1JA 4DU3A 1X1PA 3RTVA 3VQDA 3O9RA 1BOTO 3GL1A 4FW2A 2FF3B 1ATRA 5AQVA 3MCPA 3GE1A 2FLOA 2G8FA 5CZ2A 2G8VA 1BA0A 3GDQA 4PA1A 5AQUA 1TKXA 1S6QA 3KZBA 4CIEA 2HHHK 3HP6A 4HUEA 1NGJA 4BR7A 1RDUA 3NAEA 4KB1A 3M8PA 3KLIA 1HLUA 3NH1A 1VSKA 3C94A 4LF7K 2ZGZA 4IXCA 3A0IX 2BANA 3WUHA 3ZSQA 4DTMA 2OZSA 1SKSA 2P9KA 4CHZA 3CI5A 1HR0K 4WQ4A 1NOZA 4L3QA 2GUIA 2YNIA 2NRXA 5FDLA 1A5XA 3MWTA 4WFBL 4BQLA 4NCBA 1U45A 4XH1A 4KI6A 4KB0A 1REVA 1X9MA 2QWLA 1B9FA 2D1KA 3AVHA 3E9LA 3L2RA 1GLBG 3G10A 4BRAA 3NH2A 2YKNA 5LY3A 3O3FA 3O80A 3VEWA 1YVUA 3BGRA 1HNIA 2DFFA 3HM8A 4CK3A 4GVEA 3CJ7A 5CYQA 3SPYA 4LF4K 3C7NB 1KC8O 5K14A 3EZ5A 4BY9C 3CJCA 4ELTA 1BI4A 3UKRA 1NGIA 3QINA 1K9MO 3CCMN 2PAVA 4CZEA 2XY6A 1YAGA 4JNEA 2HMPA 1UA1A 3OVNA 1O13A 4OPHA 3AO4A 3CG7A 2UU9K 3KD1E 2VGNA 3L2WA 4QAGA 4XH5A 3V4IA 2NRHA 4B1XB 3OYCA 5C24A 2KW4A 4OPKA 4CJUA 4CIFA 3TAPA 3NVKA 4FJIA 4O5FA 4JKGA 3V1QA 5CR4A 2AA4A 3I0RA 3HI0A 3TSPA 5AQQA 2I5JA 3O4WA 3WNGA 2D5RA 4EAHD 3S3OA 4X65K 4E0DA 1B9DA 1BCMA 4B9UA 2HNYA 3NMUA 4F2SA 4NCGA 5J2NA 2OYQA 3NF6A 4CJEA 3LP0A 5EXWA 3ID6A 4HVJA 3AVMA 3FLCO 1D9DA 4CW7B 3EL2A 2HNZA 3J81O 4AM6A 4HTUA 3HJFA 3MEEA 4X64K 3DMJA 3AVFA 1WSHA 3SQ1A 3PIPL 2P9NB 3D2EA 3CM6A 1MWMA 5M1NA 1FKPA 3L0QA 3O4QA 4FXDA 3P31A 5HOOA 1HYVA 1SL2A 3CXCM 4JI4K 4J8FA 3RMAA 3CPEA 3O3GA 4BREA 4JKBA 3LDQA 5FRMA 2UXBK 4I2QA 1GLLO 4A62A 5ELZA 4M41A 3HOTA 2RF2A 5AQMA 3O1BA 4RW4A 4M45A 3VERA 3U6FA 4Z4HA 1FKOA 1RT7A 1ZXOA 2Q0UA 3OYHA 2E2PA 1NK5A 2V7ZA 2HB5A 3KK2A 5F0XA 3RSEA 4M3ZA 4FK0A 3WEEB 1S1UA 1RTJA 1W9HA 3ITHA 2QTDA 5M1FA 3QEWA 4W5OA 5BRDA 4MO4A 3P38A 4DTXA 1HNVA 4X62K 1YJ9N 1XNQK 3O1WA 3VA3A 4OO1J 1DLOA 4DV0K 2YV0X 4B9QA 4IG3A 5J1EA 2BDPA 4QS8A 4ICLA 2P9IB 3AVGA 3G6EN 1WN7A 1QSYA 3NF8A 4FLYA 3CC2N 1RTDA 2Y1JA 4I9LA 2XRIA 1HPZA 4IFEA 3VEYA 3VQ7A 4PKIA 3KK3A 2QM1A 1BQNA 4BC4A 4DQQA 1T6CA 2KQ2A 1NGCA 2VQFK 2XY5A 4M3YA 3E1YA 1HYZA 3DOLA 4GKKK 4PL8A 2G8KA 3PSFA 3GBTA 1WB9A 4FZZA 5LL6Z 1A5WA 3JSMA 2OTJN 4FJ8A 4KH5A 3ASMA 3MN5A 1IBKK 1RT4A 1ATNA 4K43A 1XC9A 1WOQA 4BRFA 4DWIA 3BDPA 2E2OA 4MQ3A 4A5BA 2A1SA 1LW0A 2HSTA 4CGHA 3GOIA 4KTZA 4B1VA 3FFIA 2O8FB 2QA4N 1NJWA 3CETA 4EFHA 1VQ8N 1RGIA 3C7NA 4B8CA 1KVBA 5IWAK 4M7XA 3HRGA 2P9SB 3H1QA 3V6DA 4A2BA 4CJWA 3EY1A 2OCEA 4CF1A 3ZYYX 2FSNA 3AVIA 3K57A 4DR1K 1H1VA 4CZHA 1CZ9A 5E84A 2V51B 5ADXA 3OYDA 1GLCG 4CZLA 4ZHRA 4WQ5A 4F2RA 3K5LA 2DFEA 2W40A 4H5RA 2NNWA 5BN8A 3MECA 3QBWA 4FK4A 2YCHA 1JCGA 3W3DA 4CBXA 3ZX0A 4CHOA 1B92A 3ZX3A 4FJLA 3VQ5A 2ZM6K 3OYFA 5HL7L 2D0CA 2WTUA 4CD1A 1TKZA 4AM7A 3WNEA 4M3WA 3DI6A 1KFDA 4FW1A 2JWKA 3CFPA 1TAUA 1EP4A 1UWBA 3ZT0A 5CY4A 4C8LA 3HP9A 1GLFO 2XY8A 5DM6L 3EKSA 3B6PA 3TAMA 4AF1A 4FJXA 3L3UA 2KLAA 2HHTA 4OVLA 5JVHL 1T8EA 2P9NA 1QHAA 4O4GA 5EVZA 4DV1K 3ID8A 3OJSA 5GAHP 1EX4A 3L8BA 3CJ1A 3ISNC 4WQ5C 5AQSA 4DG1A 3QFUA 5JS1A 4PHTX 1QVFM 4LD0A 3MMVA 3QMLA 4CZIA 4DQPA 3HZ6A 1MWKA 3VQ8A 3BY5A 2V52B 3TAGA 3O9TA 5LJVA 3PLAA 3IMXA 4IO9L 1TKDA 4JK9A 3K5MA 3G0ZA 4J2BA 3CC4N 1SZ2A 4GVMA 5M1OA 4DMNA 4KHYA 4QS7A 2FBYA 3L4IA 1L5UA 3H1VX 2HMIA 2BUPA 5JVGL 5AQRA 2GBZA 2W41A 3SJHA 4KV8A 2RE2A 5AQZA 1C0FA 2QW9A 4F4KA 3WEEA 4UY8O 1ZC6A 1J54A 4CEDA 2FF6A 3FZFA 2PYJA 2P9KB 3AO1A 3OYKA 1VAZA 2OPQA 5HRSA 1D9FA 3CCSN 2IVPA 2ZF5O 3F2KA 3HTVA 4LC9B 1NGDA 4OGCA 1VRTA 4FLWA 4B3TK 3D0PA 2BGGA 4JV5K 2P9IA 2F9TA 4H0VB 3SYZA 4F3TA 4FM2A 3DXMA 1Q9YA 4RTFD 5HRRA 3EYZA 3V1OA 1YJWN 3VGLA 3KJVA 1NK8A 4LF8K 1XWLA 4M3TA 1ASVA 3TI0A 2ITGA 1S1WA 2QXLA 4ILGB 4CEBA 3K59A 1OH8A 3KWIA 4EP4A 3EE9A 5AQKA 4DTRA 4F8RA 4B9VA 1BU6O 4M42A 1NJXA 4CGFA 4CF0A 5FPDA 3CD6N 2E1ZA 1VQPN 2O8FA 3VOVA 4GV6A 4EHTA 4K0KK 1WAFA 3HT3A 3DLEA 3HK2A 3C6UA 3G25A 4IJNA 4BRLA 4FJ9A 4Z94A 2YX6A 5M1PA 3K5NA 1ZBIA 2UXCK 1NGBA 2P9SA 4DQRA 4BVOA 3TABA 3ZX2A 1C6VA 4Q0BA 2O8CB 3BP8A 5C25A 4NB4A 3PY8A 5DMRA 3CJAA 3D45A 2A40A 1FXXA 1IV0A 4DFJA 1HNXK 1HKCA 1XI1A 5C2DA 4DF4A 3O4NA 3QEVA 4B3OA 4B9SA 1HQUA 4CGJA 4E7JA 4DV2K 2CH6A 1XNRK 4DKWA 3H45C 2GTDA 1YVNA 1VQ6N 1QHTA 4BACA 4Z4EA 2FXUA 4FWLA 5FROA 3AVAA 3KKSA 4CZJA 1U49A 4FK2A 3CCLN 4BC2A 2VG6A 1VSDA 1VQMN 3TR8A 5J2PA 4BE1A 4AHRA 2KZZA 4BRPA 3C6AA 1Q8IA 4CHNA 5D3GA 4BWJA 1XMOK 4IFVA 1X9SA 4CFAA 4JKHA 3VF2A 5AZJB 3DXKB 4OGEA 4FLTA 2QXFA 3MXMA 4AHUA 5BPNA 1RFQA 1QQOA 3M5RA 4CJLA 2NRVA 4BDZA 3QIOA 2YNHA 1JLBA 5KRSA 1RBVA 1WSGA 1YHQN 3WXIA 3TTCA 5A2QO 3NVMA 4BGAA 5EY4A 1X9WA 5AQIA 3R1XA 4OPAA 4DV4K 1TGOA 2QK9A 3EKUA 1YT3A 1Q7YO 4LF6K 4DQ8A 4Y1CA 3E9OA 3LDNA 4O0JA 4GKJK 4YNQA 3O6WA 3MXJA 4KAZA 3NF7A 2HHUA 1U2VB 1L3UA 1RTHA 1KFSA 1ZBSA 4H03B 1LCUA 1TV6A 3AGKA 2A3ZA 4CESA 4IOCL 2PFUA 3RMDA 2FBTA 1VQ9N 2HHWA 5C2FA 4H0OA 1QSSA 2YHBA 1KAXA 2VG7A 1YF5L 5C0YA 4B9MA 2HNDA 3IAYA 1DT9A 4NXMK 1TUYA 2WOMA 3H3NO 1BA1A 3ZT3A 1SV5A 4H0TB 1S6PA 1GOCA 4QCLA 4CJ7A 2OA8A 3QNOA 1IG8A 3SCXA 2HHQA 3E9PA 3HBTA 1X9JA 4IOXA 2XHBA 4DR7K 1LWEA 3NGYA 4B1UB 3EN9A 3SQ2A 2OPSA 4O8UA 3QETA 3CYMA 3K9JA 3WXLA 3CMAN 4I7FA 2D4WA 5M1QA 3OY9A 3TTFA 1NK4A 3HPOA 3DJCA 3WNFA 2CGJA 4BRKA 3VMFB 2DY4A 4C8MA 3ZLJA 4YOXA 1JL1A 5KQ8A 2VCPA 2E8AA 4FVUA 3LANA 4JLHA 4F9OA 3SAGA 2GWJA 4CJ4A 1RDBA 4WQ4C 5I42A 3NE6A 3O9QA 4JKEA 2E2QA 3R3LA 1LAVA 4Z4FA 4CJ5A 3D2FB 5FPNA 5SZTA 1HKBA 3OYLA 5MLCQ 3V9UA 3TAQA 1Z26A 2RN2A 1LWFA 3V1RA 1J53A 4CJRA 4KKOA 3S41A 2OPPA 3DM2A 3P5JA 4CGDA 5LJWA 3OS0A 3QEXA 1SS6A 1NGFA 4LSNA 4CEZA 1KTQA 1Y64A 3AA2A 4M3XA 4W5QA 2O8CA 4CERA 1BCOA 3HO1A 1IG9A 3ZCMA 4JS4A 3AAPA 2O8EB 4J2EA 2ASOA 4Q5VA 4C1NI 3AVCA 5C12A 3ENBA 3NGZA 2Q97A 4HHTA 4G1QA 4FJJA 3KIOA 4WCEL 3TARA 1IO2A 4U7BA 4IJAA 3TPQA 3J80O 4O0IA 4HCBA 4ISGA 3VQ9A 3CM5A 3LWLA 3AV9A 4KH6A 5BR9A 1DGKN 4OKJA 5E41A 2KZMA 4CI6A 5C42A 5EU7A 3BUZB 2ZQBA 5JLFA 1NJYA 1N33K 4FWQA 3VF6A 3C0BA 4DS4A 3LP2A 3VA0A 3VEVA 5T7BA 1QZ5A 1QQNA 4N56A 3F5TA 4DV5K 5AZJA 3DXKA 3BEXA 3MAQA 4MFBA 3PSIA 1T03A 2X6NA 4IBNA 1BDGA 2QWQA 3CCVN 4BR0A 4I6MB 4DTOA 2D0BA 1S1XA 1KRPA 3VEXA 3T1YK 1KAYA 3M1FA 4FLXA 3AO5A 4H5NA 1NG9A 3SK3A 2XO7A 3HXMA 2B4JA 2HF3A 4JEPA 4KTQA 3I8BA 4E1NA 3BZKA 4IZ9A 2GELA 4HUGA 3KD5E 5FRNA 1KCFA 4JKCA 4NLCA 1TL1A 4DHYA 4Z4CA 4DSJA 3L4QA 3NFAA 3KK1A 3SUQA 4LSLA 1N6QA 2JGUA 2O8DB 2DFHA 3H3OB 4YFUA 1U2VA 2KFNA 1MU2A 2BE2A 1YIJN 1HJOA 3AO2A 4RW8A 2X78A 3VTHA 5FPEA 3OYGA 1KAZA 2QWNA 1RDAA 4KBOA 4G9ZA 4WF9L 4KHSA 4PWDA 4CIGA 3KLFA 1E4GT 2QKKA 4JAXA 4B1ZA 4N76A 3DXMB 2QWRA 4JKDA 3A5OC 3TANA 3TSQA 1RBSA 4BRHA 4DB3A 3VPZA 4KO0A 2RKIA 1L3VA 3QDKA 4KI4A 2NZTA 3OJUA 1IJJA 4Y1DA 4YHHK 3AGRA 4WYBA 3C65A 3K5OA 4BDYA 4KHPK 3VQ4A 2Q2RA 4H4MA 4LFCK 1S9EA 1WBDA 5AQJA 3ALYA 3MN9A 4IEIA 2DTUA 2NUBA 1TK8A 3J8AA 4B3MK 5AQFA 4DR5K 4JKFA 4FWKA 1HRHA 2HBMA 1WBBA 1HQEA 4BRGA 2ASPA 3I8DA 2NRTA 3ZSXA 4DLEA 2RHKA 4FSVA 4I2PA 4BC5A 1XHZA 2D0AA 4WE1A 3T1HK 3ZEUB 1M1KO 4EZ9A 3U3YA 2Q31A 3K0SA 3ZT2A 3SAFA 4K41A 5J2QA 5AQLA 4LF5K 3AVLA 1CLQA 3J7ZO 3CCUN 5KTQA 4FJ5A 2P9UB 4OJRA 5IT9O 3D6RA 1A5VA 5I9EB 2HVIA 2ZGYA 3B8AX 3L2VA 4E89A 2HW3A 3HPGA 4CZFA 3KK7A 4X66K 4LFAK 3RR7A 3O3HA 1FK9A 3D2FA 1N36K 4B3SK 2VWKA 3C6TA 4KTWA 1BUPA 1ITGA 2HBJA 5HROA 4CF8A 2YHAA 1S5JA 1JCFA 3NGIA 1E4FT 1W0HA 3AAQA 1RDCA 1RNHA 3SV3A 3V9WA 3KTQA 4C8NA 3MN7A 3QIPA 2YHWA 3TWHA 4ISFA 3NBPA 3EEQA 1N32K 2O8EA 3HYFA 5BPLA 4OKEA 1LAWA 4BRNA 5AQXA 4C8OA 4FZYA 1IKVA 1LWCA 3PX0A 2FC0A 4KFBA 1VQ7N 3WQUA 3ZSYA 3DRSA 3N4QA 3VEOA 4DCHA 3PO5A 3H6EA 3THWB 3SV4A 1NM1A 1QVGM 3NF9A 2E4LA 2D0OA 4JHDB 3G71N 1SAZA 1ZBUA 4ID1A 4DTSA 1HKGA 4DUZK 4DSIA 4ELVA 1Z6RA 3L3VA 1DKGD 2A6AA 4FCYA 4PKGA 3W0LA 1T7PA 2HBKA 3IUCA 5H1SQ 4DR2K 4IEEA 1LOTB 4DR4K 3ENHA 4RW9A 5I3UA 1RBRA 1VSMA 1VSIA 2W42A 5HBMA 3H08A 1CXQA 4KHWA 1BGXT 3O9UA 4BRIA 4PQUA 4BQZA 4ZTFA 3FZLA 3DLHA 3CC7N 4KHNA 2Z1GA 5AQGA 1JLFA 1EWQA 3VESA 3S9HA 5F2RA 3K9KA 2ITMA 4I6MA 1NU0A 1R59O 2D0PA 2HVHA 3T1AA 2HHXA 4XH4A 4BE2A 3LL3A 2Q1NA 3KWGA 3VQAA 1YXQA 3MWPA 5BRHA 1WNSA 4JI6K 1IKYA 3IRXA 4NYFA 3MDQA 2J4RA 3ZSOA 1Q81O 3VENA 3CQXA 5F1XA 3ZETB 2YNFA 4EIAA 5BPMA 3CFOA 5AQHA 4CHYA 4XIUA 4ID5A 4BR9A 4CK1A 3CCJN 2E88A 2O8DA 3ULDA 3CJ9A 4B3RK 1ATSA 3A5LC 1YITN 2UUAK 3CCQN 4FL9A 4YOUA 5AFUH 2Q3SA 1C1BA 4XEIA 1WSFA 5HLFA 4IG0A 2HOEA 4JN4A 2FSKA 3U4LA 1SKWA 3HM9A 5GAEP 3JYTA 4CF9A 3WXKA 3A8YA 5KRTA 3M8SA 5KI6A 4H0XB 2ZWHA 1D5AA 1GOAA 1S3XA 4DTNA 2OTLN 1VSJA 4BGBA 4N47A 3LM9A 1T6DA 4OX9K 2W6KA 2E2NA 4FJMA 4QS9A 2OZMA 4M3UA 3KHYA 4ISEA 3CCEN 1CXUA 2O4GA 3SZ2A 3AVJA 2GX9A 3NHGA 3LM2A 3CF5L 1TAQA 3THVA 5M1KA 4CF2A 2PY5A 3OYIA 4JKAA 5BN9A 4N5SA 4BR5A 2UYTA 3OYMA 1JCEA 4FVMA 1SQKA 4FWRA 1UA0A 2P9LB 2O4IA 3SQ0A 3BZCA 2NRZA 5AQYA 3ZEUA 1HMVA 2X74A 3OTOK 1LW2A 1Y97A 4JI8K 1VQ5N 1WSIA 4A57A 2BH1A 3OW2M 2P9UA 3AA3A 3QERA 3DLBA 4NCAA 4CJFA 1TVRA 3Q7BA 1NK9A 1CZAN 3IKMA 2WBNA 4BG9A 3QB0A 3THYB 1EKEA 1C0TA 4J2DA 4N41A 4HWIA 1OKJA 1YI2N
chains in the Genus database with same CATH topology
3QLHA 2F8TA 3LAMA 3NDKA 4E1MA 3OY9A 3VA3A 1DLOA 1C1AA 1NK4A 2YV0X 3HPOA 4IG3A 3WNFA 5J1EA 2BDPA 1D8YA 4ICLA 4C8MA 3ZT4A 2DY4A 3AVGA 4O55A 3SPZA 2HHVA 2Z1IA 2EX3A 4CHQA 1WN7A 1JL1A 2VWJA 1QSYA 3NF8A 1IKXA 1U04A 2VG5A 4CEEA 4FLYA 3LANA 3V9SA 1VSFA 1ZBHA 4JLHA 4OLAA 4CJ4A 2Y1IA 1RTDA 1RDBA 4UQGA 1RT5A 1NK6A 5I42A 4IKFA 2Y1JA 4I9LA 3NE6A 2XRIA 1HPZA 3UIQA 3VQ7A 3KK3A 3VQEA 1BQNA 5KGXA 4CJSA 4DSKA 4DQQA 4H8KA 4FJGA 2KQ2A 3LP3A 4Z4FA 1LAVA 1HYSA 4CJ5A 1RTIA 5SZTA 3OYLA 3V9UA 2XY5A 1TKTA 3TAQA 1SL0A 1Z26A 2RN2A 2RPIA 4M3YA 1LWFA 1HYZA 3DOLA 3V1RA 1J53A 4CJRA 2G8KA 2FBVA 4KKOA 3MXIA 1SL1A 4EP5A 2OPPA 3DM2A 2WONA 3P5JA 4CGDA 4K8ZA 4KRFA 3IG1A 4FZZA 3OS0A 1A5WA 3JSMA 4DU4A 3S3MA 1QTMA 3QEXA 4Z4GA 3DOKA 4R5PA 4LSNA 3CQ8A 4CEZA 3SI6A 4DTJA 3ASMA 1KSPA 1KTQA 3SUPA 3AA2A 4M3XA 1RT4A 4CEQA 4W5QA 4CJ3A 3LP1A 4DSFA 4CERA 3DLRA 2GV9A 1XC9A 4FYDA 1BCOA 3HO1A 3LPUA 1IG9A 3U3GA 3OYAA 4B9NA 4DWIA 3ZCMA 3BDPA 4MQ3A 5HRPA 3SJJA 4JS4A 2A1SA 1LW0A 4CGHA 4KPYA 4DTUA 3VQ6A 1JLAA 4KTZA 4J2EA 3FFIA 3DLKA 4FLVA 1XHXA 3QO9A 4Q5VA 4LY7A 1NJWA 3DLGA 1KVCA 1RDDA 1WLJA 3AVCA 3SUOA 5J2PA 3CFRA 3S3NA 3NGZA 4RW6A 4FJNA 4M3RA 4B8CA 4HHTA 1F21A 1JLQA 3NCIA 1L3SA 3PX6A 3OYNA 3I0SA 1KVBA 3K2PA 4DFPA 3LAKA 3B6OA 4G1QA 3KIOA 4FJJA 4K8XA 1VSHA 3T3FA 3V6DA 3QNNA 1UOCA 3TARA 3RR8A 4CJWA 1IO2A 4O0IA 2XY7A 4HCBA 3EY1A 3VQ9A 3CM5A 4CF1A 3LWLA 3AV9A 4OKJA 5E41A 2KZMA 5C42A 1JLCA 5EU7A 3P83D 4E3SA 3F9KA 2ZQBA 3AVIA 3K57A 1CZ9A 4JS5A 1Z25A 2IS3A 3T19A 1C1CA 2P1JA 5HP1A 1NJYA 3OYDA 4RG8A 4ZHRA 1NK0A 5J2MA 4F2RA 3K5LA 2DFEA 4CEAA 4DS4A 2R7YA 1RT1A 3LP2A 3VA0A 3K58A 1BIZA 3AVKA 4PY5A 3V9XA 4DSEA 5T7BA 4FM0A 3MECA 4N56A 3MAQA 4DS5A 1BI4B 1I39A 4MFBA 4FK4A 1T03A 2X6NA 4IBNA 4NYNA 4BE0A 2IC3A 4AHVA 2E6MA 4CHOA 1B92A 1KLNA 2JLEA 4FJLA 3VQ5A 3OYJA 1GOBA 1C0MA 2D0BA 4DTOA 3OYFA 1S1XA 4JRPA 1ZYQA 4DU1A 3M8QA 2D0CA 4GW6A 1KRPA 1TKZA 4E19A 4C8KA 3P1GA 4FLXA 3WNEA 4M3WA 3AO5A 3ZSVA 3DYAA 4AHTA 2XO7A 3WNHA 1I3AA 1RILA 3HXMA 3DI6A 2B4JA 3VN5A 1KFDA 4FW1A 4KTQA 3MEDA 3RMBA 3CFPA 1TAUA 2P5OA 1EP4A 1UWBA 1JLEA 3ZT0A 4E1NA 4W5TA 3ZT1A 1JXBA 2QKBA 5CY4A 3KD5E 4HUGA 4C8LA 4CEOA 3HP9A 2XY8A 5FRNA 3B6PA 3TAMA 4FJXA 4KHQA 1KCFA 1U48A 3L3UA 2ATQA 4L8RB 1TL1A 4Z4CA 3VQQA 4OVLA 2HHTA 1CZBA 4DSJA 5CZ1A 1T8EA 3NFAA 3KK1A 1WSJA 1S1TA 4LSLA 1J9AA 3SUQA 1S1VA 1N6QA 2EHGA 2JGUA 3SQ4A 4O4GA 3OJSA 1EX4A 4RW7A 4B08A 2DFHA 3L8BA 3LZIA 3ISNC 4O44A 4YFUA 2KFNA 4DG1A 1MU2A 2BE2A 5JS2A 3PV8A 5JS1A 3AVBA 4LD0A 3AO2A 3MEGA 2X78A 4RW8A 4DQPA 3OYGA 3VQ8A 3A2FA 2IDOA 1RDAA 3ZSRA 1TK0A 4KHSA 4PWDA 3TAGA 1TK5A 1WSEA 4CIGA 3KLFA 2QKKA 4QOZB 1KLMA 3LDSA 4FJHA 4N76A 4DQIA 3NH0A 3L2UA 1TKDA 1IKWA 4H4OA 4E7LA 4O5BA 3K5MA 3G0ZA 4CJKA 3TANA 2B5JA 4B9TA 4J2BA 1YTUA 1RBSA 4GVMA 4KO0A 2RKIA 1L3VA 4KI4A 4F3OA 4DMNA 4KHYA 2F8SA 3OJUA 2FBYA 3PUFA 4Y1DA 1L5UA 2HMIA 3LZJA 1DTTA 2GBZA 3K5OA 4BDYA 3VQ4A 1ZBLA 1U47A 2FBXA 1RT6A 4H4MA 4B9LA 3HSTB 1YTAA 4KV8A 4OLBA 3VQPA 1QQCA 3HVTA 4F4KA 1K6YA 4GMJB 1S9EA 5CYMA 1N5YA 4HUFA 1NK7A 4DFKA 1J54A 4CEDA 2OPRA 2B6AA 4ZTJA 3ALYA 1J5OA 3AO3A 4DF8A 1SKRA 1NKEA 3QESA 4I9QA 2DTUA 2NUBA 4DTPA 3V81A 1TK8A 3AO1A 2PYJA 3OYKA 1HRHA 2OPQA 2ETJA 5HRSA 1HQEA 5KGWA 1G15A 4CFCA 1D9FA 4DFMA 3I8DA 3ZSXA 4CFBA 4DLEA 1DTQA 3C95A 4HCCA 4I2PA 1UAXA 1XHZA 2D0AA 4WE1A 2IGIA 4EZ9A 2X6SA 2E6LA 1ASUA 4FM1A 3RMCA 1ZBFA 3U3YA 3RRGA 3L2QA 4BDPA 4FJ7A 4OGCA 1VRTA 4FLWA 1U4BA 3ZT2A 2IOCA 3D0PA 1RBUA 5J2QA 2PZSA 2BGGA 3OS1A 3AVLA 4E7HA 3ZSZA 4FLZA 3PO4A 1QS4A 4FJ5A 5KTQA 3HPHA 1L3TA 3LPTA 4OJRA 2HHSA 3SYZA 3LALA 4DU3A 4Z4IA 1X1PA 1A5VA 3VQDA 3RTVA 2IAJA 4F3TA 2HVIA 3L2VA 4E89A 4FW2A 2HW3A 2KTQA 3HPGA 4IDKA 2ZE2A 4FM2A 2G8FA 1Q9YA 4IFYA 5HRRA 5CZ2A 1JKHA 3RR7A 2G8VA 3O3HA 1FK9A 4PA1A 1TKXA 3EYZA 3V1OA 1S6QA 3KJVA 4AILC 2VWKA 4CIEA 1XWLA 1NK8A 2F96A 3C6TA 4M3TA 3HP6A 1VSEA 1ASVA 3TI0A 4HUEA 4KTWA 2ITGA 1S1WA 1ITGA 1C0UA 4CEBA 2G8IA 2AJQA 5HROA 3K59A 4CFDA 3NAEA 4CF8A 4KB1A 2YHAA 1S5JA 3M8PA 1VK0A 2LSNA 1QSLA 4EP4A 3KLIA 3NGIA 1W0HA 3SUNA 3NH1A 1RDCA 1RNHA 3SV3A 1VSKA 3V9WA 4DTRA 3KTQA 4F8RA 4B9VA 3OYEA 3C94A 4M42A 1NKBA 3QEPA 4C8NA 3LWMA 1NJXA 1R0AA 4CJVA 3QIPA 4CGFA 4CF0A 3TWHA 4W5RA 3NBPA 2BANA 3ZSQA 4DTMA 2OZSA 3HYFA 1SKSA 3RWUA 4CHZA 3IS9A 4EZ6A 4OKEA 1LAWA 4FZYA 4C8OA 1WAFA 1NOZA 3HT3A 1IKVA 3DLEA 1LWCA 3HK2A 2GUIA 2YNIA 3C6UA 2FC0A 4KFBA 3PX0A 4FJ9A 2YKMA 3ZSYA 3DRSA 5FDLA 3PO5A 4Z0UA 4LH5A 1A5XA 3K5NA 1TL3A 3SV4A 1ZBIA 4NCBA 1U45A 3NF9A 4KI6A 4KB0A 1REVA 1NJZA 1RBTA 1X9MA 4DQRA 1B9FA 1O1WA 2E4LA 1ASWA 3AVHA 3L2RA 3TABA 1C6VA 4B8AB 4Q0BA 1ZBUA 4ID1A 4DTSA 2ZD1A 3G10A 3NH2A 5C25A 3PY8A 4DSIA 4CK2A 2YKNA 4ELVA 3O3FA 3RRHA 5DMRA 3E01A 3L3VA 1YVUA 3BGRA 4FCYA 1HNIA 3D45A 2DFFA 1T7PA 1FXXA 4CK3A 4DFJA 3QEIA 1CLQA 5SWMA 5CYQA 3SPYA 1XI1A 4RW9A 4DF4A 5I3UA 1RBRA 1VSMA 1VSIA 3O4NA 4FLUA 2G8HA 3QEVA 4FJ8A 4B3OA 4B9SA 1HQUA 2W42A 5HBMA 5K14A 4CGJA 1SUQA 3EZ5A 4E7JA 1T05A 3H08A 1CXQA 4KHWA 1BGXT 3HVRA 4CJQA 4ELTA 1BI4A 3QINA 4PQUA 4ZTFA 3DLHA 1QHTA 4KHNA 4BACA 2XY6A 2Z1GA 1JLFA 2P5GA 3VQCA 1UA1A 4Z4EA 5DK5A 5FROA 3S9HA 1KVAA 4CGGA 3OVNA 3AVNA 3AO4A 3AVAA 3CG7A 3KD1E 3L2WA 3KKSA 2HVHA 3VQBA 3KLEA 3T1AA 3TAFA 1U49A 4FK2A 2HHXA 3HL8A 4QAGA 4BE2A 3V4IA 4OPJA 3OYCA 5C24A 2VG6A 1VSDA 2KW4A 3TR8A 3KKRA 4BE1A 4AHCA 4OPKA 1VRUA 1WAJA 3VQAA 4CJUA 3F73A 4AHRA 4CIFA 4E7IA 3AA4A 3TAPA 4AH9A 2KZZA 1NKCA 1Q8IA 4CHNA 4J2AA 5D3GA 1WNSA 4BWJA 4FJIA 4KHUA 1IKYA 3V1QA 4IFVA 3IRXA 4NYFA 1X9SA 4W5NA 4CFAA 1JLGA 2A1RA 3ZSOA 4OGEA 2Z1HA 3I0RA 4FLTA 2QXFA 3MXMA 4AHUA 2YNFA 4CHYA 1BIUA 1VSLA 3CFOA 4TSXA 4XIUA 4DQSA 2I5JA 4ID5A 4CJLA 4CK1A 2YNGA 3WNGA 2D5RA 4BDZA 3QIOA 3S3OA 3ULDA 2YNHA 4E0DA 1B9DA 1BCMA 4B9UA 2HNYA 1JLBA 5KRSA 1RBVA 1WSGA 4F2SA 4CHPA 3OS2A 4E7KA 4NCGA 4BWMA 4CCHA 5J2NA 1LV5A 2OYQA 1S9GA 2Q3SA 3NF6A 1C1BA 4CJEA 1WSFA 3LP0A 5HLFA 4IG0A 3OYBA 1X9WA 2KFZA 4HVJA 4DSLA 4CGIA 1IH7A 3AVMA 1SKWA 1D9DA 3PX4A 3HM9A 2HNZA 3JYTA 4HTUA 3HJFA 1TGOA 2QK9A 4CF9A 3MEEA 5KRTA 1YT3A 5KI6A 1EETA 3M8SA 4FZXC 1D5AA 4CJPA 3DMJA 3AVFA 1WSHA 3SQ1A 4ELUA 4KREA 1NOYA 1BISA 3DRRA 1GOAA 4Y1CA 2Z1JA 3DRPA 4O0JA 4DTNA 3CM6A 4YNQA 1VSJA 4KAZA 3MXJA 1Q9XA 3NF7A 4N47A 2G8UA 1FKPA 1HJRA 1RT3A 3O4QA 2HHUA 4FXDA 4FJMA 2OZMA 4M3UA 1L3UA 1BHLA 1RTHA 1KFSA 1CXUA 2O4GA 1HYVA 3SZ2A 1TV6A 3AVJA 1SL2A 3ZSWA 3NHGA 4CESA 1TAQA 3RMAA 3THVA 3RMDA 4CJTA 3O3GA 4CF2A 2PY5A 2FBTA 1RCHA 3OYIA 2G8WA 5FRMA 4LH4A 2HHWA 4I2QA 1QSSA 2YHBA 3M8RA 3AA5X 2VG7A 4N5SA 3KLHA 4M41A 3OYMA 1JXEA 4FVMA 2P51A 2RF2A 4B9MA 4M45A 2HNDA 4RW4A 4AHSA 3IAYA 4JRQA 1UA0A 2O4IA 3U6FA 3SQ0A 4Z4HA 3KLGA 1FKOA 3V9ZA 2WOMA 1RT7A 2PYLA 3OYHA 4CEFA 3ZT3A 5HRNA 2X74A 1HMVA 1SV5A 1NK5A 1LW2A 4FJKA 1S6PA 1Y97A 1GOCA 2HB5A 1WSIA 4QCLA 4CE9A 1BQMA 2OA8A 3KK2A 4M3ZA 4DLGA 3QNOA 3AA3A 4FK0A 3SCXA 3SNNA 3QERA 1S1UA 2HHQA 1RTJA 3TAEA 3DLBA 4NCAA 1W9HA 4CJFA 1TVRA 2XHBA 1LWEA 1RT2A 3ITHA 3NGYA 1NK9A 4PUOA 3SQ2A 4OKKA 1EXQA 2OPSA 3QEWA 4W5OA 3QETA 1BL3A 3CYMA 1JL2A 1EKEA 4I7FA 4DTXA 1C0TA 4J2DA 1HNVA 4N41A 1QE1A 4CECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QLH A;  2F8T A;  3LAM A;  3NDK A;  4E1M A;  3OY9 A;  3VA3 A;  1DLO A;  1C1A A;  1NK4 A;  2YV0 X;  3HPO A;  4IG3 A;  3WNF A;  5J1E A;  2BDP A;  1D8Y A;  4ICL A;  4C8M A;  3ZT4 A;  2DY4 A;  3AVG A;  4O55 A;  3SPZ A;  2HHV A;  2Z1I A;  2EX3 A;  4CHQ A;  1WN7 A;  1JL1 A;  2VWJ A;  1QSY A;  3NF8 A;  1IKX A;  1U04 A;  2VG5 A;  4CEE A;  4FLY A;  3LAN A;  3V9S A;  1VSF A;  1ZBH A;  4JLH A;  4OLA A;  4CJ4 A;  2Y1I A;  1RTD A;  1RDB A;  4UQG A;  1RT5 A;  1NK6 A;  5I42 A;  4IKF A;  2Y1J A;  4I9L A;  3NE6 A;  2XRI A;  1HPZ A;  3UIQ A;  3VQ7 A;  3KK3 A;  3VQE A;  1BQN A;  5KGX A;  4CJS A;  4DSK A;  4DQQ A;  4H8K A;  4FJG A;  2KQ2 A;  3LP3 A;  4Z4F A;  1LAV A;  1HYS A;  4CJ5 A;  1RTI A;  5SZT A;  3OYL A;  3V9U A;  2XY5 A;  1TKT A;  3TAQ A;  1SL0 A;  1Z26 A;  2RN2 A;  2RPI A;  4M3Y A;  1LWF A;  1HYZ A;  3DOL A;  3V1R A;  1J53 A;  4CJR A;  2G8K A;  2FBV A;  4KKO A;  3MXI A;  1SL1 A;  4EP5 A;  2OPP A;  3DM2 A;  2WON A;  3P5J A;  4CGD A;  4K8Z A;  4KRF A;  3IG1 A;  4FZZ A;  3OS0 A;  1A5W A;  3JSM A;  4DU4 A;  3S3M A;  1QTM A;  3QEX A;  4Z4G A;  3DOK A;  4R5P A;  4LSN A;  3CQ8 A;  4CEZ A;  3SI6 A;  4DTJ A;  3ASM A;  1KSP A;  1KTQ A;  3SUP A;  3AA2 A;  4M3X A;  1RT4 A;  4CEQ A;  4W5Q A;  4CJ3 A;  3LP1 A;  4DSF A;  4CER A;  3DLR A;  2GV9 A;  1XC9 A;  4FYD A;  1BCO A;  3HO1 A;  3LPU A;  1IG9 A;  3U3G A;  3OYA A;  4B9N A;  4DWI A;  3ZCM A;  3BDP A;  4MQ3 A;  5HRP A;  3SJJ A;  4JS4 A;  2A1S A;  1LW0 A;  4CGH A;  4KPY A;  4DTU A;  3VQ6 A;  1JLA A;  4KTZ A;  4J2E A;  3FFI A;  3DLK A;  4FLV A;  1XHX A;  3QO9 A;  4Q5V A;  4LY7 A;  1NJW A;  3DLG A;  1KVC A;  1RDD A;  1WLJ A;  3AVC A;  3SUO A;  5J2P A;  3CFR A;  3S3N A;  3NGZ A;  4RW6 A;  4FJN A;  4M3R A;  4B8C A;  4HHT A;  1F21 A;  1JLQ A;  3NCI A;  1L3S A;  3PX6 A;  3OYN A;  3I0S A;  1KVB A;  3K2P A;  4DFP A;  3LAK A;  3B6O A;  4G1Q A;  3KIO A;  4FJJ A;  4K8X A;  1VSH A;  3T3F A;  3V6D A;  3QNN A;  1UOC A;  3TAR A;  3RR8 A;  4CJW A;  1IO2 A;  4O0I A;  2XY7 A;  4HCB A;  3EY1 A;  3VQ9 A;  3CM5 A;  4CF1 A;  3LWL A;  3AV9 A;  4OKJ A;  5E41 A;  2KZM A;  5C42 A;  1JLC A;  5EU7 A;  3P83 D;  4E3S A;  3F9K A;  2ZQB A;  3AVI A;  3K57 A;  1CZ9 A;  4JS5 A;  1Z25 A;  2IS3 A;  3T19 A;  1C1C A;  2P1J A;  5HP1 A;  1NJY A;  3OYD A;  4RG8 A;  4ZHR A;  1NK0 A;  5J2M A;  4F2R A;  3K5L A;  2DFE A;  4CEA A;  4DS4 A;  2R7Y A;  1RT1 A;  3LP2 A;  3VA0 A;  3K58 A;  1BIZ A;  3AVK A;  4PY5 A;  3V9X A;  4DSE A;  5T7B A;  4FM0 A;  3MEC A;  4N56 A;  3MAQ A;  4DS5 A;  1BI4 B;  1I39 A;  4MFB A;  4FK4 A;  1T03 A;  2X6N A;  4IBN A;  4NYN A;  4BE0 A;  2IC3 A;  4AHV A;  2E6M A;  4CHO A;  1B92 A;  1KLN A;  2JLE A;  4FJL A;  3VQ5 A;  3OYJ A;  1GOB A;  1C0M A;  2D0B A;  4DTO A;  3OYF A;  1S1X A;  4JRP A;  1ZYQ A;  4DU1 A;  3M8Q A;  2D0C A;  4GW6 A;  1KRP A;  1TKZ A;  4E19 A;  4C8K A;  3P1G A;  4FLX A;  3WNE A;  4M3W A;  3AO5 A;  3ZSV A;  3DYA A;  4AHT A;  2XO7 A;  3WNH A;  1I3A A;  1RIL A;  3HXM A;  3DI6 A;  2B4J A;  3VN5 A;  1KFD A;  4FW1 A;  4KTQ A;  3MED A;  3RMB A;  3CFP A;  1TAU A;  2P5O A;  1EP4 A;  1UWB A;  1JLE A;  3ZT0 A;  4E1N A;  4W5T A;  3ZT1 A;  1JXB A;  2QKB A;  5CY4 A;  3KD5 E;  4HUG A;  4C8L A;  4CEO A;  3HP9 A;  2XY8 A;  5FRN A;  3B6P A;  3TAM A;  4FJX A;  4KHQ A;  1KCF A;  1U48 A;  3L3U A;  2ATQ A;  4L8R B;  1TL1 A;  4Z4C A;  3VQQ A;  4OVL A;  2HHT A;  1CZB A;  4DSJ A;  5CZ1 A;  1T8E A;  3NFA A;  3KK1 A;  1WSJ A;  1S1T A;  4LSL A;  1J9A A;  3SUQ A;  1S1V A;  1N6Q A;  2EHG A;  2JGU A;  3SQ4 A;  4O4G A;  3OJS A;  1EX4 A;  4RW7 A;  4B08 A;  2DFH A;  3L8B A;  3LZI A;  3ISN C;  4O44 A;  4YFU A;  2KFN A;  4DG1 A;  1MU2 A;  2BE2 A;  5JS2 A;  3PV8 A;  5JS1 A;  3AVB A;  4LD0 A;  3AO2 A;  3MEG A;  2X78 A;  4RW8 A;  4DQP A;  3OYG A;  3VQ8 A;  3A2F A;  2IDO A;  1RDA A;  3ZSR A;  1TK0 A;  4KHS A;  4PWD A;  3TAG A;  1TK5 A;  1WSE A;  4CIG A;  3KLF A;  2QKK A;  4QOZ B;  1KLM A;  3LDS A;  4FJH A;  4N76 A;  4DQI A;  3NH0 A;  3L2U A;  1TKD A;  1IKW A;  4H4O A;  4E7L A;  4O5B A;  3K5M A;  3G0Z A;  4CJK A;  3TAN A;  2B5J A;  4B9T A;  4J2B A;  1YTU A;  1RBS A;  4GVM A;  4KO0 A;  2RKI A;  1L3V A;  4KI4 A;  4F3O A;  4DMN A;  4KHY A;  2F8S A;  3OJU A;  2FBY A;  3PUF A;  4Y1D A;  1L5U A;  2HMI A;  3LZJ A;  1DTT A;  2GBZ A;  3K5O A;  4BDY A;  3VQ4 A;  1ZBL A;  1U47 A;  2FBX A;  1RT6 A;  4H4M A;  4B9L A;  3HST B;  1YTA A;  4KV8 A;  4OLB A;  3VQP A;  1QQC A;  3HVT A;  4F4K A;  1K6Y A;  4GMJ B;  1S9E A;  5CYM A;  1N5Y A;  4HUF A;  1NK7 A;  4DFK A;  1J54 A;  4CED A;  2OPR A;  2B6A A;  4ZTJ A;  3ALY A;  1J5O A;  3AO3 A;  4DF8 A;  1SKR A;  1NKE A;  3QES A;  4I9Q A;  2DTU A;  2NUB A;  4DTP A;  3V81 A;  1TK8 A;  3AO1 A;  2PYJ A;  3OYK A;  1HRH A;  2OPQ A;  2ETJ A;  5HRS A;  1HQE A;  5KGW A;  1G15 A;  4CFC A;  1D9F A;  4DFM A;  3I8D A;  3ZSX A;  4CFB A;  4DLE A;  1DTQ A;  3C95 A;  4HCC A;  4I2P A;  1UAX A;  1XHZ A;  2D0A A;  4WE1 A;  2IGI A;  4EZ9 A;  2X6S A;  2E6L A;  1ASU A;  4FM1 A;  3RMC A;  1ZBF A;  3U3Y A;  3RRG A;  3L2Q A;  4BDP A;  4FJ7 A;  4OGC A;  1VRT A;  4FLW A;  1U4B A;  3ZT2 A;  2IOC A;  3D0P A;  1RBU A;  5J2Q A;  2PZS A;  2BGG A;  3OS1 A;  3AVL A;  4E7H A;  3ZSZ A;  4FLZ A;  3PO4 A;  1QS4 A;  4FJ5 A;  5KTQ A;  3HPH A;  1L3T A;  3LPT A;  4OJR A;  2HHS A;  3SYZ A;  3LAL A;  4DU3 A;  4Z4I A;  1X1P A;  1A5V A;  3VQD A;  3RTV A;  2IAJ A;  4F3T A;  2HVI A;  3L2V A;  4E89 A;  4FW2 A;  2HW3 A;  2KTQ A;  3HPG A;  4IDK A;  2ZE2 A;  4FM2 A;  2G8F A;  1Q9Y A;  4IFY A;  5HRR A;  5CZ2 A;  1JKH A;  3RR7 A;  2G8V A;  3O3H A;  1FK9 A;  4PA1 A;  1TKX A;  3EYZ A;  3V1O A;  1S6Q A;  3KJV A;  4AIL C;  2VWK A;  4CIE A;  1XWL A;  1NK8 A;  2F96 A;  3C6T A;  4M3T A;  3HP6 A;  1VSE A;  1ASV A;  3TI0 A;  4HUE A;  4KTW A;  2ITG A;  1S1W A;  1ITG A;  1C0U A;  4CEB A;  2G8I A;  2AJQ A;  5HRO A;  3K59 A;  4CFD A;  3NAE A;  4CF8 A;  4KB1 A;  2YHA A;  1S5J A;  3M8P A;  1VK0 A;  2LSN A;  1QSL A;  4EP4 A;  3KLI A;  3NGI A;  1W0H A;  3SUN A;  3NH1 A;  1RDC A;  1RNH A;  3SV3 A;  1VSK A;  3V9W A;  4DTR A;  3KTQ A;  4F8R A;  4B9V A;  3OYE A;  3C94 A;  4M42 A;  1NKB A;  3QEP A;  4C8N A;  3LWM A;  1NJX A;  1R0A A;  4CJV A;  3QIP A;  4CGF A;  4CF0 A;  3TWH A;  4W5R A;  3NBP A;  2BAN A;  3ZSQ A;  4DTM A;  2OZS A;  3HYF A;  1SKS A;  3RWU A;  4CHZ A;  3IS9 A;  4EZ6 A;  4OKE A;  1LAW A;  4FZY A;  4C8O A;  1WAF A;  1NOZ A;  3HT3 A;  1IKV A;  3DLE A;  1LWC A;  3HK2 A;  2GUI A;  2YNI A;  3C6U A;  2FC0 A;  4KFB A;  3PX0 A;  4FJ9 A;  2YKM A;  3ZSY A;  3DRS A;  5FDL A;  3PO5 A;  4Z0U A;  4LH5 A;  1A5X A;  3K5N A;  1TL3 A;  3SV4 A;  1ZBI A;  4NCB A;  1U45 A;  3NF9 A;  4KI6 A;  4KB0 A;  1REV A;  1NJZ A;  1RBT A;  1X9M A;  4DQR A;  1B9F A;  1O1W A;  2E4L A;  1ASW A;  3AVH A;  3L2R A;  3TAB A;  1C6V A;  4B8A B;  4Q0B A;  1ZBU A;  4ID1 A;  4DTS A;  2ZD1 A;  3G10 A;  3NH2 A;  5C25 A;  3PY8 A;  4DSI A;  4CK2 A;  2YKN A;  4ELV A;  3O3F A;  3RRH A;  5DMR A;  3E01 A;  3L3V A;  1YVU A;  3BGR A;  4FCY A;  1HNI A;  3D45 A;  2DFF A;  1T7P A;  1FXX A;  4CK3 A;  4DFJ A;  3QEI A;  1CLQ A;  5SWM A;  5CYQ A;  3SPY A;  1XI1 A;  4RW9 A;  4DF4 A;  5I3U A;  1RBR A;  1VSM A;  1VSI A;  3O4N A;  4FLU A;  2G8H A;  3QEV A;  4FJ8 A;  4B3O A;  4B9S A;  1HQU A;  2W42 A;  5HBM A;  5K14 A;  4CGJ A;  1SUQ A;  3EZ5 A;  4E7J A;  1T05 A;  3H08 A;  1CXQ A;  4KHW A;  1BGX T;  3HVR A;  4CJQ A;  4ELT A;  1BI4 A;  3QIN A;  4PQU A;  4ZTF A;  3DLH A;  1QHT A;  4KHN A;  4BAC A;  2XY6 A;  2Z1G A;  1JLF A;  2P5G A;  3VQC A;  1UA1 A;  4Z4E A;  5DK5 A;  5FRO A;  3S9H A;  1KVA A;  4CGG A;  3OVN A;  3AVN A;  3AO4 A;  3AVA A;  3CG7 A;  3KD1 E;  3L2W A;  3KKS A;  2HVH A;  3VQB A;  3KLE A;  3T1A A;  3TAF A;  1U49 A;  4FK2 A;  2HHX A;  3HL8 A;  4QAG A;  4BE2 A;  3V4I A;  4OPJ A;  3OYC A;  5C24 A;  2VG6 A;  1VSD A;  2KW4 A;  3TR8 A;  3KKR A;  4BE1 A;  4AHC A;  4OPK A;  1VRU A;  1WAJ A;  3VQA A;  4CJU A;  3F73 A;  4AHR A;  4CIF A;  4E7I A;  3AA4 A;  3TAP A;  4AH9 A;  2KZZ A;  1NKC A;  1Q8I A;  4CHN A;  4J2A A;  5D3G A;  1WNS A;  4BWJ A;  4FJI A;  4KHU A;  1IKY A;  3V1Q A;  4IFV A;  3IRX A;  4NYF A;  1X9S A;  4W5N A;  4CFA A;  1JLG A;  2A1R A;  3ZSO A;  4OGE A;  2Z1H A;  3I0R A;  4FLT A;  2QXF A;  3MXM A;  4AHU A;  2YNF A;  4CHY A;  1BIU A;  1VSL A;  3CFO A;  4TSX A;  4XIU A;  4DQS A;  2I5J A;  4ID5 A;  4CJL A;  4CK1 A;  2YNG A;  3WNG A;  2D5R A;  4BDZ A;  3QIO A;  3S3O A;  3ULD A;  2YNH A;  4E0D A;  1B9D A;  1BCM A;  4B9U A;  2HNY A;  1JLB A;  5KRS A;  1RBV A;  1WSG A;  4F2S A;  4CHP A;  3OS2 A;  4E7K A;  4NCG A;  4BWM A;  4CCH A;  5J2N A;  1LV5 A;  2OYQ A;  1S9G A;  2Q3S A;  3NF6 A;  1C1B A;  4CJE A;  1WSF A;  3LP0 A;  5HLF A;  4IG0 A;  3OYB A;  1X9W A;  2KFZ A;  4HVJ A;  4DSL A;  4CGI A;  1IH7 A;  3AVM A;  1SKW A;  1D9D A;  3PX4 A;  3HM9 A;  2HNZ A;  3JYT A;  4HTU A;  3HJF A;  1TGO A;  2QK9 A;  4CF9 A;  3MEE A;  5KRT A;  1YT3 A;  5KI6 A;  1EET A;  3M8S A;  4FZX C;  1D5A A;  4CJP A;  3DMJ A;  3AVF A;  1WSH A;  3SQ1 A;  4ELU A;  4KRE A;  1NOY A;  1BIS A;  3DRR A;  1GOA A;  4Y1C A;  2Z1J A;  3DRP A;  4O0J A;  4DTN A;  3CM6 A;  4YNQ A;  1VSJ A;  4KAZ A;  3MXJ A;  1Q9X A;  3NF7 A;  4N47 A;  2G8U A;  1FKP A;  1HJR A;  1RT3 A;  3O4Q A;  2HHU A;  4FXD A;  4FJM A;  2OZM A;  4M3U A;  1L3U A;  1BHL A;  1RTH A;  1KFS A;  1CXU A;  2O4G A;  1HYV A;  3SZ2 A;  1TV6 A;  3AVJ A;  1SL2 A;  3ZSW A;  3NHG A;  4CES A;  1TAQ A;  3RMA A;  3THV A;  3RMD A;  4CJT A;  3O3G A;  4CF2 A;  2PY5 A;  2FBT A;  1RCH A;  3OYI A;  2G8W A;  5FRM A;  4LH4 A;  2HHW A;  4I2Q A;  1QSS A;  2YHB A;  3M8R A;  3AA5 X;  2VG7 A;  4N5S A;  3KLH A;  4M41 A;  3OYM A;  1JXE A;  4FVM A;  2P51 A;  2RF2 A;  4B9M A;  4M45 A;  2HND A;  4RW4 A;  4AHS A;  3IAY A;  4JRQ A;  1UA0 A;  2O4I A;  3U6F A;  3SQ0 A;  4Z4H A;  3KLG A;  1FKO A;  3V9Z A;  2WOM A;  1RT7 A;  2PYL A;  3OYH A;  4CEF A;  3ZT3 A;  5HRN A;  2X74 A;  1HMV A;  1SV5 A;  1NK5 A;  1LW2 A;  4FJK A;  1S6P A;  1Y97 A;  1GOC A;  2HB5 A;  1WSI A;  4QCL A;  4CE9 A;  1BQM A;  2OA8 A;  3KK2 A;  4M3Z A;  4DLG A;  3QNO A;  3AA3 A;  4FK0 A;  3SCX A;  3SNN A;  3QER A;  1S1U A;  2HHQ A;  1RTJ A;  3TAE A;  3DLB A;  4NCA A;  1W9H A;  4CJF A;  1TVR A;  2XHB A;  1LWE A;  1RT2 A;  3ITH A;  3NGY A;  1NK9 A;  4PUO A;  3SQ2 A;  4OKK A;  1EXQ A;  2OPS A;  3QEW A;  4W5O A;  3QET A;  1BL3 A;  3CYM A;  1JL2 A;  1EKE A;  4I7F A;  4DTX A;  1C0T A;  4J2D A;  1HNV A;  4N41 A;  1QE1 A;  4CEC A; 
#chains in the Genus database with same CATH topology
 1P8Z A;  3Q7C A;  4E1M A;  2O8B B;  2IVN A;  3U9Z A;  3VET A;  1J5E K;  4NXN K;  1KD1 O;  4C1N K;  3MX5 A;  2QWP A;  3SPZ A;  2Z1I A;  2EX3 A;  1GLE G;  3VF4 A;  1HX1 A;  4OLA A;  2IIR A;  5GIN A;  4EHU A;  4IKF A;  3QIC A;  3UIQ A;  3VQE A;  5KGX A;  4CJS A;  3BF3 A;  4JI1 K;  4ILH A;  4JYA K;  5CHI A;  1SL0 A;  2RPI A;  4CD3 A;  2FBV A;  3THW A;  1SL1 A;  4FWM A;  4EP5 A;  1NNE A;  2WON A;  4K8Z A;  4KRF A;  2AP1 A;  1QTM A;  3OBW A;  3CQ8 A;  2YJF A;  4JHD A;  1QQM A;  5AFU A;  4FYD A;  3LP1 A;  4DSF A;  2GV9 A;  1G99 A;  1OH7 A;  3OYA A;  4B9N A;  5HRP A;  3ULE B;  4KPY A;  4DTU A;  3VQ6 A;  1JLA A;  3DLK A;  1XHX A;  4JD2 B;  1QZ6 A;  3DLG A;  1KVC A;  1WLJ A;  1TYQ B;  3SUO A;  3CFR A;  2IVO A;  4RW6 A;  4GV9 A;  4FJN A;  3MN6 A;  4M3R A;  1F21 A;  1JLQ A;  3IFR A;  3NCI A;  3PX6 A;  3I0S A;  4DFP A;  3LAK A;  3QNN A;  1UOC A;  2XY7 A;  3UKU B;  2F4V K;  4E3S A;  3O9S A;  3P83 D;  1Z25 A;  3T19 A;  5TKW A;  4FPB A;  2Q36 A;  2R7Y A;  2UUB K;  3K58 A;  3AVK A;  1JJ2 M;  3V9X A;  4PY5 A;  4YOR A;  4BR4 A;  2HF4 A;  3ZET A;  4A5A A;  4A2A A;  3T69 A;  4FPA A;  4H5T A;  4NYN A;  2IC3 A;  4AHV A;  1D4X A;  4GV3 A;  4JI3 K;  2E6M A;  1EWR A;  4JRP A;  4DU1 A;  3M8Q A;  3FZM A;  4GW6 A;  1V4T A;  4E19 A;  3P1G A;  2OAN A;  4ILJ A;  3ZSV A;  3DYA A;  3SMP A;  1RIL A;  3VN5 A;  3O8M A;  4IWV A;  5KPT A;  1KXP A;  3RMB A;  2VGM A;  1FJG K;  1JLE A;  4W5T A;  2GEM A;  3ZT1 A;  5JIC A;  2UUC K;  5C15 A;  4CEO A;  1OVQ A;  3E66 A;  1U48 A;  3BF1 A;  3QFP A;  3R9P A;  1CZB A;  2PBD A;  3VQQ A;  3TTD A;  1WSJ A;  3PIO L;  1S1T A;  1S1V A;  2EHG A;  2NRW A;  5B8H A;  2VWB A;  4O44 A;  2GWK A;  2I7N A;  3PV8 A;  2UXD K;  3AVB A;  5AQN A;  4BVP A;  3J7Y P;  3A2F A;  2IDO A;  5GAG P;  4DR3 K;  1TK0 A;  1RDW X;  4QOZ B;  1KLM A;  3CQY A;  3NH0 A;  1IKW A;  3VGK A;  4H4O A;  4E7L A;  4O5B A;  4CJK A;  4BC3 A;  2B5J A;  1YUW A;  2F8S A;  2P9L A;  3PUF A;  2HBL A;  3JS6 A;  5FLX O;  2KKZ A;  4IDH A;  1HNZ K;  1S22 A;  1ZBL A;  4FWS A;  1RT6 A;  4B9L A;  4OLB A;  1QQC A;  3RVC A;  3WXM B;  3P39 A;  1NMN A;  1X3M A;  3FFK B;  1VQ4 N;  1NK7 A;  5GAD P;  2OPR A;  2B6A A;  3LDO A;  3AO3 A;  1SKR A;  3D7E O;  1NKE A;  4YOV A;  3QES A;  4I9Q A;  3THY A;  4PL7 A;  2VYP A;  5KGW A;  1ILY A;  1G15 A;  4CFC A;  2Q0R A;  4DFM A;  1V4S A;  1X3N A;  4LF9 K;  4CFB A;  4HCC A;  3C95 A;  1UAX A;  2IGI A;  2O8B A;  1ASU A;  4FM1 A;  3RMC A;  1ZBF A;  4BDP A;  3RRG A;  1Q86 O;  2IOC A;  2EWS A;  3QBX A;  3OS1 A;  1KQS M;  4FLZ A;  3PO4 A;  1QS4 A;  5AJ3 K;  2HHS A;  3LAL A;  4Z4I A;  2IAJ A;  1E3M A;  5EX5 A;  5AZI B;  1ESV A;  3T7Z A;  4IDK A;  4BRO A;  1HNW K;  2KTQ A;  2ZE2 A;  4IFY A;  2NLX A;  1JKH A;  4H5V A;  3FGU A;  3EE8 A;  5KPZ A;  4AIL C;  2QWO A;  2F96 A;  1VSE A;  3SAH A;  2CH5 A;  3M3Z A;  1NBW A;  1C0U A;  2G8I A;  2AJQ A;  1I94 K;  4FWO A;  4KH4 A;  4CFD A;  1W7A A;  1QSL A;  1VK0 A;  2LSN A;  4GNI A;  4GY2 B;  4WFA L;  4YOY A;  4CZK A;  3SUN A;  3OYE A;  1EQY A;  1DEJ A;  3QEP A;  3LWM A;  1NKB A;  1R0A A;  4CJV A;  3ULE A;  4W5R A;  5ADX H;  3RWU A;  1J6Z A;  3CPW M;  3IS9 A;  3DWL A;  4EZ6 A;  3EZW A;  4JI2 K;  5KPR A;  4JD2 A;  3DLL L;  1NGE A;  3TU5 A;  1TYQ A;  2YKM A;  4Z0U A;  4LH5 A;  1EO1 A;  1TL3 A;  4MLH A;  3GG4 A;  3G4S N;  5GIP A;  1RBT A;  1NJZ A;  5DM7 L;  1O1W A;  1ASW A;  3WXJ A;  3UKU A;  4B8A B;  5AQT A;  2ZD1 A;  3P4I A;  2A41 A;  2YHX A;  4CK2 A;  3RRH A;  3E01 A;  4M7Y A;  5BRF A;  3QEI A;  5SWM A;  1K73 O;  5FPM A;  1VQO N;  4FLU A;  1GLA G;  1C0G A;  1XUP O;  2G8H A;  3F9M A;  1T05 A;  5AQP A;  3ATV A;  3IDH A;  1SUQ A;  3HVR A;  4CJQ A;  2E1Y A;  3R8E A;  3UB5 A;  3CIP A;  1N34 K;  4BR2 A;  2P5G A;  3VQC A;  5DK5 A;  1GLD G;  4AQY K;  1BO5 O;  1KVA A;  4CGG A;  1NJI O;  3AVN A;  5BRE A;  3VEZ A;  3VQB A;  3KLE A;  3TAF A;  3MK6 A;  4BG8 A;  3HL8 A;  2BTF A;  1NGG A;  4OPJ A;  4FWP A;  3KKR A;  4AHC A;  3F73 A;  1VRU A;  1WAJ A;  4E7I A;  3AA4 A;  4AH9 A;  1NKC A;  2A5X A;  4J2A A;  3UE5 A;  3SLC A;  4DV6 K;  4KHU A;  4IO8 A;  4W5N A;  1JLG A;  1VHX A;  2A1R A;  2VQE K;  4K25 A;  2ZJQ L;  1MA9 B;  1FW6 A;  2Z1H A;  3KVG A;  2A42 A;  1BIU A;  1VSL A;  3CJB A;  4TSX A;  3A5M C;  4DQS A;  4YOT A;  2YNG A;  4FO0 A;  2ZJP L;  3CME N;  1T3V A;  3DAW A;  4JK7 A;  3JAM O;  2QEX N;  4CHP A;  3OS2 A;  4E7K A;  4BWM A;  4FWN A;  4MDB A;  4CCH A;  1LV5 A;  1S9G A;  3FE1 A;  4NLB A;  2WUS A;  3OYB A;  2YHY A;  1Z05 A;  5JLH A;  3A5N C;  2KFZ A;  4NO7 A;  4DSL A;  4CGI A;  1IH7 A;  4YOW A;  3PX4 A;  3I33 A;  2I7P A;  2F9W A;  5TKY A;  1EET A;  3ENO A;  4FZX C;  4CJP A;  2E20 A;  4ELU A;  4KRE A;  2V7Y A;  1NOY A;  1BIS A;  3CHW A;  3DRR A;  1K8K B;  2Z1J A;  3DRP A;  4V19 S;  2JWL A;  3OA9 A;  4HTL A;  5E26 A;  4DUY K;  1Q9X A;  2G8U A;  1RT3 A;  1HJR A;  4M63 C;  1BHL A;  4LFB K;  4JI7 K;  3I55 N;  3ZSW A;  4CJT A;  1RCH A;  3ATU A;  3L6Q A;  2G8W A;  1YJN N;  4LH4 A;  2ZJR L;  1N8R O;  3M8R A;  3AA5 X;  3KLH A;  1OH6 A;  1JXE A;  2P51 A;  4O8K A;  4AHS A;  4JRQ A;  3WT0 A;  1HPM A;  3KLG A;  3V9Z A;  4A59 A;  2PYL A;  3U9D A;  4CEF A;  5HRN A;  4FJK A;  4CE9 A;  1BQM A;  4DV3 K;  1M90 O;  4DLG A;  1NGA A;  3SNN A;  3TAE A;  3N4P A;  1RT2 A;  3M6G A;  5AZI A;  3THX B;  4PUO A;  5C10 A;  4OKK A;  1EXQ A;  1BL3 A;  4FOE A;  2P9P B;  1P90 A;  1JL2 A;  2F7T A;  4CZM A;  2YI1 A;  4H0P A;  1QE1 A;  4CBU A;  1ZYQ A;  4CEC A;  3QLH A;  3HSC A;  2F8T A;  3LAM A;  3NDK A;  1C1A A;  2WC9 A;  1D8Y A;  3ZT4 A;  4O55 A;  2HHV A;  4CHQ A;  4PKH A;  4CVN E;  2VWJ A;  3AAR A;  1IKX A;  1U04 A;  1T44 A;  2VG5 A;  4CEE A;  3V9S A;  1ZBH A;  1VSF A;  2QI2 A;  2Y1I A;  2E5L K;  4UQG A;  1RT5 A;  1NK6 A;  4JI5 K;  3TSU A;  1NGH A;  4DSK A;  4H8K A;  4FJG A;  3LP3 A;  1S72 N;  2H3G X;  1HYS A;  4JK8 A;  1RTI A;  1Q18 A;  1MDU B;  1TKT A;  3SBT A;  5AR0 A;  3MXI A;  3IG1 A;  1U6Z A;  4DU4 A;  3S3M A;  4BRQ A;  4Z4G A;  4DV7 K;  3DOK A;  4R5P A;  3SI6 A;  4DTJ A;  1KSP A;  3SUP A;  3LDL A;  4CEQ A;  1TUU A;  4CJ3 A;  3DLR A;  3OHR A;  3LPU A;  3U3G A;  4MDA A;  1K8A O;  3SJJ A;  5CE3 A;  3O5B A;  2YJE A;  3LDP A;  4FLV A;  3QO9 A;  4LY7 A;  5KQD A;  1HUX A;  1RDD A;  1NWK A;  3S3N A;  3R6M A;  1IBM K;  1L3S A;  5LMN K;  3OYN A;  4JI0 K;  3K2P A;  3VTI A;  3B6O A;  4K8X A;  1VSH A;  3T3F A;  1IBL K;  2CGL A;  3RR8 A;  1W97 L;  4H0Y B;  5LMU K;  3JXU A;  2FSJ A;  1JLC A;  2KHO A;  3F9K A;  4U67 L;  4JS5 A;  2IS3 A;  1C1C A;  1GLJ O;  2P1J A;  5HP1 A;  4RG8 A;  1NK0 A;  5J2M A;  1W2B M;  3MX2 A;  3MCA B;  4CEA A;  3I56 N;  1RT1 A;  2DPN A;  1BIZ A;  2GUP A;  4DSE A;  4FM0 A;  4B1Y B;  4Y0W A;  4BRC A;  4DS5 A;  3VGM A;  1BI4 B;  1I39 A;  3UKR B;  4A61 A;  5JMV A;  1NLV A;  1OVY A;  3FR0 A;  4BE0 A;  3J7A P;  4BRM A;  4WFN L;  1KLN A;  2JLE A;  4B1W B;  3OYJ A;  1GOB A;  1C0M A;  4YDU A;  3U8X A;  3EO3 A;  4CZG A;  4R79 A;  4C8K A;  3C6H A;  4AHT A;  3WNH A;  1I3A A;  3MED A;  4JKG B;  2P5O A;  1JXB A;  2QKB A;  4KHQ A;  2ATQ A;  2CGK A;  4L8R B;  2ASM A;  4H5W A;  1WUA A;  5CZ1 A;  1J9A A;  1K8K A;  1XQS C;  3SQ4 A;  4RW7 A;  4B08 A;  3LZI A;  3FZK A;  5EOY A;  4MLE A;  5JS2 A;  3MEG A;  3H46 O;  1XMQ K;  3ZSR A;  4MO5 A;  3AY9 A;  1TK5 A;  1WSE A;  2WFB A;  3LDS A;  4FJH A;  4DQI A;  3L2U A;  1BG3 A;  3CER A;  3WQT A;  4CBW A;  1YTU A;  3SBG A;  4B9T A;  3SMS A;  5GIO A;  3HOS A;  1NMD A;  3CCR N;  4DR6 K;  4F3O A;  4K42 A;  4YDU C;  3D2E B;  3FZH A;  1XC3 A;  2QWM A;  3LZJ A;  1DTT A;  2NRR A;  3O08 A;  1OH5 A;  1U47 A;  2FBX A;  3HST B;  1YTA A;  3VQP A;  3HVT A;  1K6Y A;  4GMJ B;  1BWF O;  5CYM A;  1N5Y A;  4HUF A;  4DFK A;  1VQL N;  4RCH A;  4YY3 K;  3THX A;  4ZTJ A;  5AQW A;  1J5O A;  4DF8 A;  4BRD A;  3OBY A;  3V81 A;  4DTP A;  2P9P A;  2ETJ A;  5AQO A;  4IOA L;  1Q82 O;  1VQK N;  1VQN N;  1DTQ A;  4C23 A;  4RWT A;  2W6L A;  2X6S A;  2E6L A;  4FJ7 A;  4FOI A;  5BR8 K;  3L2Q A;  1U4B A;  2PZS A;  1RBU A;  3RSE B;  3ZSZ A;  4E7H A;  3HPH A;  1L3T A;  3LPT A;  4E1J A;  4DU3 A;  1X1P A;  3RTV A;  3VQD A;  3O9R A;  1BOT O;  3GL1 A;  4FW2 A;  2FF3 B;  1ATR A;  5AQV A;  3MCP A;  3GE1 A;  2FLO A;  2G8F A;  5CZ2 A;  2G8V A;  1BA0 A;  3GDQ A;  4PA1 A;  5AQU A;  1TKX A;  1S6Q A;  3KZB A;  4CIE A;  2HHH K;  3HP6 A;  4HUE A;  1NGJ A;  4BR7 A;  1RDU A;  3NAE A;  4KB1 A;  3M8P A;  3KLI A;  1HLU A;  3NH1 A;  1VSK A;  3C94 A;  4LF7 K;  2ZGZ A;  4IXC A;  3A0I X;  2BAN A;  3WUH A;  3ZSQ A;  4DTM A;  2OZS A;  1SKS A;  2P9K A;  4CHZ A;  3CI5 A;  1HR0 K;  4WQ4 A;  1NOZ A;  4L3Q A;  2GUI A;  2YNI A;  2NRX A;  5FDL A;  1A5X A;  3MWT A;  4WFB L;  4BQL A;  4NCB A;  1U45 A;  4XH1 A;  4KI6 A;  4KB0 A;  1REV A;  1X9M A;  2QWL A;  1B9F A;  2D1K A;  3AVH A;  3E9L A;  3L2R A;  1GLB G;  3G10 A;  4BRA A;  3NH2 A;  2YKN A;  5LY3 A;  3O3F A;  3O80 A;  3VEW A;  1YVU A;  3BGR A;  1HNI A;  2DFF A;  3HM8 A;  4CK3 A;  4GVE A;  3CJ7 A;  5CYQ A;  3SPY A;  4LF4 K;  3C7N B;  1KC8 O;  5K14 A;  3EZ5 A;  4BY9 C;  3CJC A;  4ELT A;  1BI4 A;  3UKR A;  1NGI A;  3QIN A;  1K9M O;  3CCM N;  2PAV A;  4CZE A;  2XY6 A;  1YAG A;  4JNE A;  2HMP A;  1UA1 A;  3OVN A;  1O13 A;  4OPH A;  3AO4 A;  3CG7 A;  2UU9 K;  3KD1 E;  2VGN A;  3L2W A;  4QAG A;  4XH5 A;  3V4I A;  2NRH A;  4B1X B;  3OYC A;  5C24 A;  2KW4 A;  4OPK A;  4CJU A;  4CIF A;  3TAP A;  3NVK A;  4FJI A;  4O5F A;  4JKG A;  3V1Q A;  5CR4 A;  2AA4 A;  3I0R A;  3HI0 A;  3TSP A;  5AQQ A;  2I5J A;  3O4W A;  3WNG A;  2D5R A;  4EAH D;  3S3O A;  4X65 K;  4E0D A;  1B9D A;  1BCM A;  4B9U A;  2HNY A;  3NMU A;  4F2S A;  4NCG A;  5J2N A;  2OYQ A;  3NF6 A;  4CJE A;  3LP0 A;  5EXW A;  3ID6 A;  4HVJ A;  3AVM A;  3FLC O;  1D9D A;  4CW7 B;  3EL2 A;  2HNZ A;  3J81 O;  4AM6 A;  4HTU A;  3HJF A;  3MEE A;  4X64 K;  3DMJ A;  3AVF A;  1WSH A;  3SQ1 A;  3PIP L;  2P9N B;  3D2E A;  3CM6 A;  1MWM A;  5M1N A;  1FKP A;  3L0Q A;  3O4Q A;  4FXD A;  3P31 A;  5HOO A;  1HYV A;  1SL2 A;  3CXC M;  4JI4 K;  4J8F A;  3RMA A;  3CPE A;  3O3G A;  4BRE A;  4JKB A;  3LDQ A;  5FRM A;  2UXB K;  4I2Q A;  1GLL O;  4A62 A;  5ELZ A;  4M41 A;  3HOT A;  2RF2 A;  5AQM A;  3O1B A;  4RW4 A;  4M45 A;  3VER A;  3U6F A;  4Z4H A;  1FKO A;  1RT7 A;  1ZXO A;  2Q0U A;  3OYH A;  2E2P A;  1NK5 A;  2V7Z A;  2HB5 A;  3KK2 A;  5F0X A;  3RSE A;  4M3Z A;  4FK0 A;  3WEE B;  1S1U A;  1RTJ A;  1W9H A;  3ITH A;  2QTD A;  5M1F A;  3QEW A;  4W5O A;  5BRD A;  4MO4 A;  3P38 A;  4DTX A;  1HNV A;  4X62 K;  1YJ9 N;  1XNQ K;  3O1W A;  3VA3 A;  4OO1 J;  1DLO A;  4DV0 K;  2YV0 X;  4B9Q A;  4IG3 A;  5J1E A;  2BDP A;  4QS8 A;  4ICL A;  2P9I B;  3AVG A;  3G6E N;  1WN7 A;  1QSY A;  3NF8 A;  4FLY A;  3CC2 N;  1RTD A;  2Y1J A;  4I9L A;  2XRI A;  1HPZ A;  4IFE A;  3VEY A;  3VQ7 A;  4PKI A;  3KK3 A;  2QM1 A;  1BQN A;  4BC4 A;  4DQQ A;  1T6C A;  2KQ2 A;  1NGC A;  2VQF K;  2XY5 A;  4M3Y A;  3E1Y A;  1HYZ A;  3DOL A;  4GKK K;  4PL8 A;  2G8K A;  3PSF A;  3GBT A;  1WB9 A;  4FZZ A;  5LL6 Z;  1A5W A;  3JSM A;  2OTJ N;  4FJ8 A;  4KH5 A;  3ASM A;  3MN5 A;  1IBK K;  1RT4 A;  1ATN A;  4K43 A;  1XC9 A;  1WOQ A;  4BRF A;  4DWI A;  3BDP A;  2E2O A;  4MQ3 A;  4A5B A;  2A1S A;  1LW0 A;  2HST A;  4CGH A;  3GOI A;  4KTZ A;  4B1V A;  3FFI A;  2O8F B;  2QA4 N;  1NJW A;  3CET A;  4EFH A;  1VQ8 N;  1RGI A;  3C7N A;  4B8C A;  1KVB A;  5IWA K;  4M7X A;  3HRG A;  2P9S B;  3H1Q A;  3V6D A;  4A2B A;  4CJW A;  3EY1 A;  2OCE A;  4CF1 A;  3ZYY X;  2FSN A;  3AVI A;  3K57 A;  4DR1 K;  1H1V A;  4CZH A;  1CZ9 A;  5E84 A;  2V51 B;  5ADX A;  3OYD A;  1GLC G;  4CZL A;  4ZHR A;  4WQ5 A;  4F2R A;  3K5L A;  2DFE A;  2W40 A;  4H5R A;  2NNW A;  5BN8 A;  3MEC A;  3QBW A;  4FK4 A;  2YCH A;  1JCG A;  3W3D A;  4CBX A;  3ZX0 A;  4CHO A;  1B92 A;  3ZX3 A;  4FJL A;  3VQ5 A;  2ZM6 K;  3OYF A;  5HL7 L;  2D0C A;  2WTU A;  4CD1 A;  1TKZ A;  4AM7 A;  3WNE A;  4M3W A;  3DI6 A;  1KFD A;  4FW1 A;  2JWK A;  3CFP A;  1TAU A;  1EP4 A;  1UWB A;  3ZT0 A;  5CY4 A;  4C8L A;  3HP9 A;  1GLF O;  2XY8 A;  5DM6 L;  3EKS A;  3B6P A;  3TAM A;  4AF1 A;  4FJX A;  3L3U A;  2KLA A;  2HHT A;  4OVL A;  5JVH L;  1T8E A;  2P9N A;  1QHA A;  4O4G A;  5EVZ A;  4DV1 K;  3ID8 A;  3OJS A;  5GAH P;  1EX4 A;  3L8B A;  3CJ1 A;  3ISN C;  4WQ5 C;  5AQS A;  4DG1 A;  3QFU A;  5JS1 A;  4PHT X;  1QVF M;  4LD0 A;  3MMV A;  3QML A;  4CZI A;  4DQP A;  3HZ6 A;  1MWK A;  3VQ8 A;  3BY5 A;  2V52 B;  3TAG A;  3O9T A;  5LJV A;  3PLA A;  3IMX A;  4IO9 L;  1TKD A;  4JK9 A;  3K5M A;  3G0Z A;  4J2B A;  3CC4 N;  1SZ2 A;  4GVM A;  5M1O A;  4DMN A;  4KHY A;  4QS7 A;  2FBY A;  3L4I A;  1L5U A;  3H1V X;  2HMI A;  2BUP A;  5JVG L;  5AQR A;  2GBZ A;  2W41 A;  3SJH A;  4KV8 A;  2RE2 A;  5AQZ A;  1C0F A;  2QW9 A;  4F4K A;  3WEE A;  4UY8 O;  1ZC6 A;  1J54 A;  4CED A;  2FF6 A;  3FZF A;  2PYJ A;  2P9K B;  3AO1 A;  3OYK A;  1VAZ A;  2OPQ A;  5HRS A;  1D9F A;  3CCS N;  2IVP A;  2ZF5 O;  3F2K A;  3HTV A;  4LC9 B;  1NGD A;  4OGC A;  1VRT A;  4FLW A;  4B3T K;  3D0P A;  2BGG A;  4JV5 K;  2P9I A;  2F9T A;  4H0V B;  3SYZ A;  4F3T A;  4FM2 A;  3DXM A;  1Q9Y A;  4RTF D;  5HRR A;  3EYZ A;  3V1O A;  1YJW N;  3VGL A;  3KJV A;  1NK8 A;  4LF8 K;  1XWL A;  4M3T A;  1ASV A;  3TI0 A;  2ITG A;  1S1W A;  2QXL A;  4ILG B;  4CEB A;  3K59 A;  1OH8 A;  3KWI A;  4EP4 A;  3EE9 A;  5AQK A;  4DTR A;  4F8R A;  4B9V A;  1BU6 O;  4M42 A;  1NJX A;  4CGF A;  4CF0 A;  5FPD A;  3CD6 N;  2E1Z A;  1VQP N;  2O8F A;  3VOV A;  4GV6 A;  4EHT A;  4K0K K;  1WAF A;  3HT3 A;  3DLE A;  3HK2 A;  3C6U A;  3G25 A;  4IJN A;  4BRL A;  4FJ9 A;  4Z94 A;  2YX6 A;  5M1P A;  3K5N A;  1ZBI A;  2UXC K;  1NGB A;  2P9S A;  4DQR A;  4BVO A;  3TAB A;  3ZX2 A;  1C6V A;  4Q0B A;  2O8C B;  3BP8 A;  5C25 A;  4NB4 A;  3PY8 A;  5DMR A;  3CJA A;  3D45 A;  2A40 A;  1FXX A;  1IV0 A;  4DFJ A;  1HNX K;  1HKC A;  1XI1 A;  5C2D A;  4DF4 A;  3O4N A;  3QEV A;  4B3O A;  4B9S A;  1HQU A;  4CGJ A;  4E7J A;  4DV2 K;  2CH6 A;  1XNR K;  4DKW A;  3H45 C;  2GTD A;  1YVN A;  1VQ6 N;  1QHT A;  4BAC A;  4Z4E A;  2FXU A;  4FWL A;  5FRO A;  3AVA A;  3KKS A;  4CZJ A;  1U49 A;  4FK2 A;  3CCL N;  4BC2 A;  2VG6 A;  1VSD A;  1VQM N;  3TR8 A;  5J2P A;  4BE1 A;  4AHR A;  2KZZ A;  4BRP A;  3C6A A;  1Q8I A;  4CHN A;  5D3G A;  4BWJ A;  1XMO K;  4IFV A;  1X9S A;  4CFA A;  4JKH A;  3VF2 A;  5AZJ B;  3DXK B;  4OGE A;  4FLT A;  2QXF A;  3MXM A;  4AHU A;  5BPN A;  1RFQ A;  1QQO A;  3M5R A;  4CJL A;  2NRV A;  4BDZ A;  3QIO A;  2YNH A;  1JLB A;  5KRS A;  1RBV A;  1WSG A;  1YHQ N;  3WXI A;  3TTC A;  5A2Q O;  3NVM A;  4BGA A;  5EY4 A;  1X9W A;  5AQI A;  3R1X A;  4OPA A;  4DV4 K;  1TGO A;  2QK9 A;  3EKU A;  1YT3 A;  1Q7Y O;  4LF6 K;  4DQ8 A;  4Y1C A;  3E9O A;  3LDN A;  4O0J A;  4GKJ K;  4YNQ A;  3O6W A;  3MXJ A;  4KAZ A;  3NF7 A;  2HHU A;  1U2V B;  1L3U A;  1RTH A;  1KFS A;  1ZBS A;  4H03 B;  1LCU A;  1TV6 A;  3AGK A;  2A3Z A;  4CES A;  4IOC L;  2PFU A;  3RMD A;  2FBT A;  1VQ9 N;  2HHW A;  5C2F A;  4H0O A;  1QSS A;  2YHB A;  1KAX A;  2VG7 A;  1YF5 L;  5C0Y A;  4B9M A;  2HND A;  3IAY A;  1DT9 A;  4NXM K;  1TUY A;  2WOM A;  3H3N O;  1BA1 A;  3ZT3 A;  1SV5 A;  4H0T B;  1S6P A;  1GOC A;  4QCL A;  4CJ7 A;  2OA8 A;  3QNO A;  1IG8 A;  3SCX A;  2HHQ A;  3E9P A;  3HBT A;  1X9J A;  4IOX A;  2XHB A;  4DR7 K;  1LWE A;  3NGY A;  4B1U B;  3EN9 A;  3SQ2 A;  2OPS A;  4O8U A;  3QET A;  3CYM A;  3K9J A;  3WXL A;  3CMA N;  4I7F A;  2D4W A;  5M1Q A;  3OY9 A;  3TTF A;  1NK4 A;  3HPO A;  3DJC A;  3WNF A;  2CGJ A;  4BRK A;  3VMF B;  2DY4 A;  4C8M A;  3ZLJ A;  4YOX A;  1JL1 A;  5KQ8 A;  2VCP A;  2E8A A;  4FVU A;  3LAN A;  4JLH A;  4F9O A;  3SAG A;  2GWJ A;  4CJ4 A;  1RDB A;  4WQ4 C;  5I42 A;  3NE6 A;  3O9Q A;  4JKE A;  2E2Q A;  3R3L A;  1LAV A;  4Z4F A;  4CJ5 A;  3D2F B;  5FPN A;  5SZT A;  1HKB A;  3OYL A;  5MLC Q;  3V9U A;  3TAQ A;  1Z26 A;  2RN2 A;  1LWF A;  3V1R A;  1J53 A;  4CJR A;  4KKO A;  3S41 A;  2OPP A;  3DM2 A;  3P5J A;  4CGD A;  5LJW A;  3OS0 A;  3QEX A;  1SS6 A;  1NGF A;  4LSN A;  4CEZ A;  1KTQ A;  1Y64 A;  3AA2 A;  4M3X A;  4W5Q A;  2O8C A;  4CER A;  1BCO A;  3HO1 A;  1IG9 A;  3ZCM A;  4JS4 A;  3AAP A;  2O8E B;  4J2E A;  2ASO A;  4Q5V A;  4C1N I;  3AVC A;  5C12 A;  3ENB A;  3NGZ A;  2Q97 A;  4HHT A;  4G1Q A;  4FJJ A;  3KIO A;  4WCE L;  3TAR A;  1IO2 A;  4U7B A;  4IJA A;  3TPQ A;  3J80 O;  4O0I A;  4HCB A;  4ISG A;  3VQ9 A;  3CM5 A;  3LWL A;  3AV9 A;  4KH6 A;  5BR9 A;  1DGK N;  4OKJ A;  5E41 A;  2KZM A;  4CI6 A;  5C42 A;  5EU7 A;  3BUZ B;  2ZQB A;  5JLF A;  1NJY A;  1N33 K;  4FWQ A;  3VF6 A;  3C0B A;  4DS4 A;  3LP2 A;  3VA0 A;  3VEV A;  5T7B A;  1QZ5 A;  1QQN A;  4N56 A;  3F5T A;  4DV5 K;  5AZJ A;  3DXK A;  3BEX A;  3MAQ A;  4MFB A;  3PSI A;  1T03 A;  2X6N A;  4IBN A;  1BDG A;  2QWQ A;  3CCV N;  4BR0 A;  4I6M B;  4DTO A;  2D0B A;  1S1X A;  1KRP A;  3VEX A;  3T1Y K;  1KAY A;  3M1F A;  4FLX A;  3AO5 A;  4H5N A;  1NG9 A;  3SK3 A;  2XO7 A;  3HXM A;  2B4J A;  2HF3 A;  4JEP A;  4KTQ A;  3I8B A;  4E1N A;  3BZK A;  4IZ9 A;  2GEL A;  4HUG A;  3KD5 E;  5FRN A;  1KCF A;  4JKC A;  4NLC A;  1TL1 A;  4DHY A;  4Z4C A;  4DSJ A;  3L4Q A;  3NFA A;  3KK1 A;  3SUQ A;  4LSL A;  1N6Q A;  2JGU A;  2O8D B;  2DFH A;  3H3O B;  4YFU A;  1U2V A;  2KFN A;  1MU2 A;  2BE2 A;  1YIJ N;  1HJO A;  3AO2 A;  4RW8 A;  2X78 A;  3VTH A;  5FPE A;  3OYG A;  1KAZ A;  2QWN A;  1RDA A;  4KBO A;  4G9Z A;  4WF9 L;  4KHS A;  4PWD A;  4CIG A;  3KLF A;  1E4G T;  2QKK A;  4JAX A;  4B1Z A;  4N76 A;  3DXM B;  2QWR A;  4JKD A;  3A5O C;  3TAN A;  3TSQ A;  1RBS A;  4BRH A;  4DB3 A;  3VPZ A;  4KO0 A;  2RKI A;  1L3V A;  3QDK A;  4KI4 A;  2NZT A;  3OJU A;  1IJJ A;  4Y1D A;  4YHH K;  3AGR A;  4WYB A;  3C65 A;  3K5O A;  4BDY A;  4KHP K;  3VQ4 A;  2Q2R A;  4H4M A;  4LFC K;  1S9E A;  1WBD A;  5AQJ A;  3ALY A;  3MN9 A;  4IEI A;  2DTU A;  2NUB A;  1TK8 A;  3J8A A;  4B3M K;  5AQF A;  4DR5 K;  4JKF A;  4FWK A;  1HRH A;  2HBM A;  1WBB A;  1HQE A;  4BRG A;  2ASP A;  3I8D A;  2NRT A;  3ZSX A;  4DLE A;  2RHK A;  4FSV A;  4I2P A;  4BC5 A;  1XHZ A;  2D0A A;  4WE1 A;  3T1H K;  3ZEU B;  1M1K O;  4EZ9 A;  3U3Y A;  2Q31 A;  3K0S A;  3ZT2 A;  3SAF A;  4K41 A;  5J2Q A;  5AQL A;  4LF5 K;  3AVL A;  1CLQ A;  3J7Z O;  3CCU N;  5KTQ A;  4FJ5 A;  2P9U B;  4OJR A;  5IT9 O;  3D6R A;  1A5V A;  5I9E B;  2HVI A;  2ZGY A;  3B8A X;  3L2V A;  4E89 A;  2HW3 A;  3HPG A;  4CZF A;  3KK7 A;  4X66 K;  4LFA K;  3RR7 A;  3O3H A;  1FK9 A;  3D2F A;  1N36 K;  4B3S K;  2VWK A;  3C6T A;  4KTW A;  1BUP A;  1ITG A;  2HBJ A;  5HRO A;  4CF8 A;  2YHA A;  1S5J A;  1JCF A;  3NGI A;  1E4F T;  1W0H A;  3AAQ A;  1RDC A;  1RNH A;  3SV3 A;  3V9W A;  3KTQ A;  4C8N A;  3MN7 A;  3QIP A;  2YHW A;  3TWH A;  4ISF A;  3NBP A;  3EEQ A;  1N32 K;  2O8E A;  3HYF A;  5BPL A;  4OKE A;  1LAW A;  4BRN A;  5AQX A;  4C8O A;  4FZY A;  1IKV A;  1LWC A;  3PX0 A;  2FC0 A;  4KFB A;  1VQ7 N;  3WQU A;  3ZSY A;  3DRS A;  3N4Q A;  3VEO A;  4DCH A;  3PO5 A;  3H6E A;  3THW B;  3SV4 A;  1NM1 A;  1QVG M;  3NF9 A;  2E4L A;  2D0O A;  4JHD B;  3G71 N;  1SAZ A;  1ZBU A;  4ID1 A;  4DTS A;  1HKG A;  4DUZ K;  4DSI A;  4ELV A;  1Z6R A;  3L3V A;  1DKG D;  2A6A A;  4FCY A;  4PKG A;  3W0L A;  1T7P A;  2HBK A;  3IUC A;  5H1S Q;  4DR2 K;  4IEE A;  1LOT B;  4DR4 K;  3ENH A;  4RW9 A;  5I3U A;  1RBR A;  1VSM A;  1VSI A;  2W42 A;  5HBM A;  3H08 A;  1CXQ A;  4KHW A;  1BGX T;  3O9U A;  4BRI A;  4PQU A;  4BQZ A;  4ZTF A;  3FZL A;  3DLH A;  3CC7 N;  4KHN A;  2Z1G A;  5AQG A;  1JLF A;  1EWQ A;  3VES A;  3S9H A;  5F2R A;  3K9K A;  2ITM A;  4I6M A;  1NU0 A;  1R59 O;  2D0P A;  2HVH A;  3T1A A;  2HHX A;  4XH4 A;  4BE2 A;  3LL3 A;  2Q1N A;  3KWG A;  3VQA A;  1YXQ A;  3MWP A;  5BRH A;  1WNS A;  4JI6 K;  1IKY A;  3IRX A;  4NYF A;  3MDQ A;  2J4R A;  3ZSO A;  1Q81 O;  3VEN A;  3CQX A;  5F1X A;  3ZET B;  2YNF A;  4EIA A;  5BPM A;  3CFO A;  5AQH A;  4CHY A;  4XIU A;  4ID5 A;  4BR9 A;  4CK1 A;  3CCJ N;  2E88 A;  2O8D A;  3ULD A;  3CJ9 A;  4B3R K;  1ATS A;  3A5L C;  1YIT N;  2UUA K;  3CCQ N;  4FL9 A;  4YOU A;  5AFU H;  2Q3S A;  1C1B A;  4XEI A;  1WSF A;  5HLF A;  4IG0 A;  2HOE A;  4JN4 A;  2FSK A;  3U4L A;  1SKW A;  3HM9 A;  5GAE P;  3JYT A;  4CF9 A;  3WXK A;  3A8Y A;  5KRT A;  3M8S A;  5KI6 A;  4H0X B;  2ZWH A;  1D5A A;  1GOA A;  1S3X A;  4DTN A;  2OTL N;  1VSJ A;  4BGB A;  4N47 A;  3LM9 A;  1T6D A;  4OX9 K;  2W6K A;  2E2N A;  4FJM A;  4QS9 A;  2OZM A;  4M3U A;  3KHY A;  4ISE A;  3CCE N;  1CXU A;  2O4G A;  3SZ2 A;  3AVJ A;  2GX9 A;  3NHG A;  3LM2 A;  3CF5 L;  1TAQ A;  3THV A;  5M1K A;  4CF2 A;  2PY5 A;  3OYI A;  4JKA A;  5BN9 A;  4N5S A;  4BR5 A;  2UYT A;  3OYM A;  1JCE A;  4FVM A;  1SQK A;  4FWR A;  1UA0 A;  2P9L B;  2O4I A;  3SQ0 A;  3BZC A;  2NRZ A;  5AQY A;  3ZEU A;  1HMV A;  2X74 A;  3OTO K;  1LW2 A;  1Y97 A;  4JI8 K;  1VQ5 N;  1WSI A;  4A57 A;  2BH1 A;  3OW2 M;  2P9U A;  3AA3 A;  3QER A;  3DLB A;  4NCA A;  4CJF A;  1TVR A;  3Q7B A;  1NK9 A;  1CZA N;  3IKM A;  2WBN A;  4BG9 A;  3QB0 A;  3THY B;  1EKE A;  1C0T A;  4J2D A;  4N41 A;  4HWI A;  1OKJ A;  1YI2 N; 
#chains in the Genus database with same CATH homology
 3QLH A;  2F8T A;  3LAM A;  3NDK A;  4E1M A;  3OY9 A;  3VA3 A;  1DLO A;  1C1A A;  1NK4 A;  2YV0 X;  3HPO A;  4IG3 A;  3WNF A;  5J1E A;  2BDP A;  1D8Y A;  4ICL A;  4C8M A;  3ZT4 A;  2DY4 A;  3AVG A;  4O55 A;  3SPZ A;  2HHV A;  2Z1I A;  2EX3 A;  4CHQ A;  1WN7 A;  1JL1 A;  2VWJ A;  1QSY A;  3NF8 A;  1IKX A;  1U04 A;  2VG5 A;  4CEE A;  4FLY A;  3LAN A;  3V9S A;  1VSF A;  1ZBH A;  4JLH A;  4OLA A;  4CJ4 A;  2Y1I A;  1RTD A;  1RDB A;  4UQG A;  1RT5 A;  1NK6 A;  5I42 A;  4IKF A;  2Y1J A;  4I9L A;  3NE6 A;  2XRI A;  1HPZ A;  3UIQ A;  3VQ7 A;  3KK3 A;  3VQE A;  1BQN A;  5KGX A;  4CJS A;  4DSK A;  4DQQ A;  4H8K A;  4FJG A;  2KQ2 A;  3LP3 A;  4Z4F A;  1LAV A;  1HYS A;  4CJ5 A;  1RTI A;  5SZT A;  3OYL A;  3V9U A;  2XY5 A;  1TKT A;  3TAQ A;  1SL0 A;  1Z26 A;  2RN2 A;  2RPI A;  4M3Y A;  1LWF A;  1HYZ A;  3DOL A;  3V1R A;  1J53 A;  4CJR A;  2G8K A;  2FBV A;  4KKO A;  3MXI A;  1SL1 A;  4EP5 A;  2OPP A;  3DM2 A;  2WON A;  3P5J A;  4CGD A;  4K8Z A;  4KRF A;  3IG1 A;  4FZZ A;  3OS0 A;  1A5W A;  3JSM A;  4DU4 A;  3S3M A;  1QTM A;  3QEX A;  4Z4G A;  3DOK A;  4R5P A;  4LSN A;  3CQ8 A;  4CEZ A;  3SI6 A;  4DTJ A;  3ASM A;  1KSP A;  1KTQ A;  3SUP A;  3AA2 A;  4M3X A;  1RT4 A;  4CEQ A;  4W5Q A;  4CJ3 A;  3LP1 A;  4DSF A;  4CER A;  3DLR A;  2GV9 A;  1XC9 A;  4FYD A;  1BCO A;  3HO1 A;  3LPU A;  1IG9 A;  3U3G A;  3OYA A;  4B9N A;  4DWI A;  3ZCM A;  3BDP A;  4MQ3 A;  5HRP A;  3SJJ A;  4JS4 A;  2A1S A;  1LW0 A;  4CGH A;  4KPY A;  4DTU A;  3VQ6 A;  1JLA A;  4KTZ A;  4J2E A;  3FFI A;  3DLK A;  4FLV A;  1XHX A;  3QO9 A;  4Q5V A;  4LY7 A;  1NJW A;  3DLG A;  1KVC A;  1RDD A;  1WLJ A;  3AVC A;  3SUO A;  5J2P A;  3CFR A;  3S3N A;  3NGZ A;  4RW6 A;  4FJN A;  4M3R A;  4B8C A;  4HHT A;  1F21 A;  1JLQ A;  3NCI A;  1L3S A;  3PX6 A;  3OYN A;  3I0S A;  1KVB A;  3K2P A;  4DFP A;  3LAK A;  3B6O A;  4G1Q A;  3KIO A;  4FJJ A;  4K8X A;  1VSH A;  3T3F A;  3V6D A;  3QNN A;  1UOC A;  3TAR A;  3RR8 A;  4CJW A;  1IO2 A;  4O0I A;  2XY7 A;  4HCB A;  3EY1 A;  3VQ9 A;  3CM5 A;  4CF1 A;  3LWL A;  3AV9 A;  4OKJ A;  5E41 A;  2KZM A;  5C42 A;  1JLC A;  5EU7 A;  3P83 D;  4E3S A;  3F9K A;  2ZQB A;  3AVI A;  3K57 A;  1CZ9 A;  4JS5 A;  1Z25 A;  2IS3 A;  3T19 A;  1C1C A;  2P1J A;  5HP1 A;  1NJY A;  3OYD A;  4RG8 A;  4ZHR A;  1NK0 A;  5J2M A;  4F2R A;  3K5L A;  2DFE A;  4CEA A;  4DS4 A;  2R7Y A;  1RT1 A;  3LP2 A;  3VA0 A;  3K58 A;  1BIZ A;  3AVK A;  4PY5 A;  3V9X A;  4DSE A;  5T7B A;  4FM0 A;  3MEC A;  4N56 A;  3MAQ A;  4DS5 A;  1BI4 B;  1I39 A;  4MFB A;  4FK4 A;  1T03 A;  2X6N A;  4IBN A;  4NYN A;  4BE0 A;  2IC3 A;  4AHV A;  2E6M A;  4CHO A;  1B92 A;  1KLN A;  2JLE A;  4FJL A;  3VQ5 A;  3OYJ A;  1GOB A;  1C0M A;  2D0B A;  4DTO A;  3OYF A;  1S1X A;  4JRP A;  1ZYQ A;  4DU1 A;  3M8Q A;  2D0C A;  4GW6 A;  1KRP A;  1TKZ A;  4E19 A;  4C8K A;  3P1G A;  4FLX A;  3WNE A;  4M3W A;  3AO5 A;  3ZSV A;  3DYA A;  4AHT A;  2XO7 A;  3WNH A;  1I3A A;  1RIL A;  3HXM A;  3DI6 A;  2B4J A;  3VN5 A;  1KFD A;  4FW1 A;  4KTQ A;  3MED A;  3RMB A;  3CFP A;  1TAU A;  2P5O A;  1EP4 A;  1UWB A;  1JLE A;  3ZT0 A;  4E1N A;  4W5T A;  3ZT1 A;  1JXB A;  2QKB A;  5CY4 A;  3KD5 E;  4HUG A;  4C8L A;  4CEO A;  3HP9 A;  2XY8 A;  5FRN A;  3B6P A;  3TAM A;  4FJX A;  4KHQ A;  1KCF A;  1U48 A;  3L3U A;  2ATQ A;  4L8R B;  1TL1 A;  4Z4C A;  3VQQ A;  4OVL A;  2HHT A;  1CZB A;  4DSJ A;  5CZ1 A;  1T8E A;  3NFA A;  3KK1 A;  1WSJ A;  1S1T A;  4LSL A;  1J9A A;  3SUQ A;  1S1V A;  1N6Q A;  2EHG A;  2JGU A;  3SQ4 A;  4O4G A;  3OJS A;  1EX4 A;  4RW7 A;  4B08 A;  2DFH A;  3L8B A;  3LZI A;  3ISN C;  4O44 A;  4YFU A;  2KFN A;  4DG1 A;  1MU2 A;  2BE2 A;  5JS2 A;  3PV8 A;  5JS1 A;  3AVB A;  4LD0 A;  3AO2 A;  3MEG A;  2X78 A;  4RW8 A;  4DQP A;  3OYG A;  3VQ8 A;  3A2F A;  2IDO A;  1RDA A;  3ZSR A;  1TK0 A;  4KHS A;  4PWD A;  3TAG A;  1TK5 A;  1WSE A;  4CIG A;  3KLF A;  2QKK A;  4QOZ B;  1KLM A;  3LDS A;  4FJH A;  4N76 A;  4DQI A;  3NH0 A;  3L2U A;  1TKD A;  1IKW A;  4H4O A;  4E7L A;  4O5B A;  3K5M A;  3G0Z A;  4CJK A;  3TAN A;  2B5J A;  4B9T A;  4J2B A;  1YTU A;  1RBS A;  4GVM A;  4KO0 A;  2RKI A;  1L3V A;  4KI4 A;  4F3O A;  4DMN A;  4KHY A;  2F8S A;  3OJU A;  2FBY A;  3PUF A;  4Y1D A;  1L5U A;  2HMI A;  3LZJ A;  1DTT A;  2GBZ A;  3K5O A;  4BDY A;  3VQ4 A;  1ZBL A;  1U47 A;  2FBX A;  1RT6 A;  4H4M A;  4B9L A;  3HST B;  1YTA A;  4KV8 A;  4OLB A;  3VQP A;  1QQC A;  3HVT A;  4F4K A;  1K6Y A;  4GMJ B;  1S9E A;  5CYM A;  1N5Y A;  4HUF A;  1NK7 A;  4DFK A;  1J54 A;  4CED A;  2OPR A;  2B6A A;  4ZTJ A;  3ALY A;  1J5O A;  3AO3 A;  4DF8 A;  1SKR A;  1NKE A;  3QES A;  4I9Q A;  2DTU A;  2NUB A;  4DTP A;  3V81 A;  1TK8 A;  3AO1 A;  2PYJ A;  3OYK A;  1HRH A;  2OPQ A;  2ETJ A;  5HRS A;  1HQE A;  5KGW A;  1G15 A;  4CFC A;  1D9F A;  4DFM A;  3I8D A;  3ZSX A;  4CFB A;  4DLE A;  1DTQ A;  3C95 A;  4HCC A;  4I2P A;  1UAX A;  1XHZ A;  2D0A A;  4WE1 A;  2IGI A;  4EZ9 A;  2X6S A;  2E6L A;  1ASU A;  4FM1 A;  3RMC A;  1ZBF A;  3U3Y A;  3RRG A;  3L2Q A;  4BDP A;  4FJ7 A;  4OGC A;  1VRT A;  4FLW A;  1U4B A;  3ZT2 A;  2IOC A;  3D0P A;  1RBU A;  5J2Q A;  2PZS A;  2BGG A;  3OS1 A;  3AVL A;  4E7H A;  3ZSZ A;  4FLZ A;  3PO4 A;  1QS4 A;  4FJ5 A;  5KTQ A;  3HPH A;  1L3T A;  3LPT A;  4OJR A;  2HHS A;  3SYZ A;  3LAL A;  4DU3 A;  4Z4I A;  1X1P A;  1A5V A;  3VQD A;  3RTV A;  2IAJ A;  4F3T A;  2HVI A;  3L2V A;  4E89 A;  4FW2 A;  2HW3 A;  2KTQ A;  3HPG A;  4IDK A;  2ZE2 A;  4FM2 A;  2G8F A;  1Q9Y A;  4IFY A;  5HRR A;  5CZ2 A;  1JKH A;  3RR7 A;  2G8V A;  3O3H A;  1FK9 A;  4PA1 A;  1TKX A;  3EYZ A;  3V1O A;  1S6Q A;  3KJV A;  4AIL C;  2VWK A;  4CIE A;  1XWL A;  1NK8 A;  2F96 A;  3C6T A;  4M3T A;  3HP6 A;  1VSE A;  1ASV A;  3TI0 A;  4HUE A;  4KTW A;  2ITG A;  1S1W A;  1ITG A;  1C0U A;  4CEB A;  2G8I A;  2AJQ A;  5HRO A;  3K59 A;  4CFD A;  3NAE A;  4CF8 A;  4KB1 A;  2YHA A;  1S5J A;  3M8P A;  1VK0 A;  2LSN A;  1QSL A;  4EP4 A;  3KLI A;  3NGI A;  1W0H A;  3SUN A;  3NH1 A;  1RDC A;  1RNH A;  3SV3 A;  1VSK A;  3V9W A;  4DTR A;  3KTQ A;  4F8R A;  4B9V A;  3OYE A;  3C94 A;  4M42 A;  1NKB A;  3QEP A;  4C8N A;  3LWM A;  1NJX A;  1R0A A;  4CJV A;  3QIP A;  4CGF A;  4CF0 A;  3TWH A;  4W5R A;  3NBP A;  2BAN A;  3ZSQ A;  4DTM A;  2OZS A;  3HYF A;  1SKS A;  3RWU A;  4CHZ A;  3IS9 A;  4EZ6 A;  4OKE A;  1LAW A;  4FZY A;  4C8O A;  1WAF A;  1NOZ A;  3HT3 A;  1IKV A;  3DLE A;  1LWC A;  3HK2 A;  2GUI A;  2YNI A;  3C6U A;  2FC0 A;  4KFB A;  3PX0 A;  4FJ9 A;  2YKM A;  3ZSY A;  3DRS A;  5FDL A;  3PO5 A;  4Z0U A;  4LH5 A;  1A5X A;  3K5N A;  1TL3 A;  3SV4 A;  1ZBI A;  4NCB A;  1U45 A;  3NF9 A;  4KI6 A;  4KB0 A;  1REV A;  1NJZ A;  1RBT A;  1X9M A;  4DQR A;  1B9F A;  1O1W A;  2E4L A;  1ASW A;  3AVH A;  3L2R A;  3TAB A;  1C6V A;  4B8A B;  4Q0B A;  1ZBU A;  4ID1 A;  4DTS A;  2ZD1 A;  3G10 A;  3NH2 A;  5C25 A;  3PY8 A;  4DSI A;  4CK2 A;  2YKN A;  4ELV A;  3O3F A;  3RRH A;  5DMR A;  3E01 A;  3L3V A;  1YVU A;  3BGR A;  4FCY A;  1HNI A;  3D45 A;  2DFF A;  1T7P A;  1FXX A;  4CK3 A;  4DFJ A;  3QEI A;  1CLQ A;  5SWM A;  5CYQ A;  3SPY A;  1XI1 A;  4RW9 A;  4DF4 A;  5I3U A;  1RBR A;  1VSM A;  1VSI A;  3O4N A;  4FLU A;  2G8H A;  3QEV A;  4FJ8 A;  4B3O A;  4B9S A;  1HQU A;  2W42 A;  5HBM A;  5K14 A;  4CGJ A;  1SUQ A;  3EZ5 A;  4E7J A;  1T05 A;  3H08 A;  1CXQ A;  4KHW A;  1BGX T;  3HVR A;  4CJQ A;  4ELT A;  1BI4 A;  3QIN A;  4PQU A;  4ZTF A;  3DLH A;  1QHT A;  4KHN A;  4BAC A;  2XY6 A;  2Z1G A;  1JLF A;  2P5G A;  3VQC A;  1UA1 A;  4Z4E A;  5DK5 A;  5FRO A;  3S9H A;  1KVA A;  4CGG A;  3OVN A;  3AVN A;  3AO4 A;  3AVA A;  3CG7 A;  3KD1 E;  3L2W A;  3KKS A;  2HVH A;  3VQB A;  3KLE A;  3T1A A;  3TAF A;  1U49 A;  4FK2 A;  2HHX A;  3HL8 A;  4QAG A;  4BE2 A;  3V4I A;  4OPJ A;  3OYC A;  5C24 A;  2VG6 A;  1VSD A;  2KW4 A;  3TR8 A;  3KKR A;  4BE1 A;  4AHC A;  4OPK A;  1VRU A;  1WAJ A;  3VQA A;  4CJU A;  3F73 A;  4AHR A;  4CIF A;  4E7I A;  3AA4 A;  3TAP A;  4AH9 A;  2KZZ A;  1NKC A;  1Q8I A;  4CHN A;  4J2A A;  5D3G A;  1WNS A;  4BWJ A;  4FJI A;  4KHU A;  1IKY A;  3V1Q A;  4IFV A;  3IRX A;  4NYF A;  1X9S A;  4W5N A;  4CFA A;  1JLG A;  2A1R A;  3ZSO A;  4OGE A;  2Z1H A;  3I0R A;  4FLT A;  2QXF A;  3MXM A;  4AHU A;  2YNF A;  4CHY A;  1BIU A;  1VSL A;  3CFO A;  4TSX A;  4XIU A;  4DQS A;  2I5J A;  4ID5 A;  4CJL A;  4CK1 A;  2YNG A;  3WNG A;  2D5R A;  4BDZ A;  3QIO A;  3S3O A;  3ULD A;  2YNH A;  4E0D A;  1B9D A;  1BCM A;  4B9U A;  2HNY A;  1JLB A;  5KRS A;  1RBV A;  1WSG A;  4F2S A;  4CHP A;  3OS2 A;  4E7K A;  4NCG A;  4BWM A;  4CCH A;  5J2N A;  1LV5 A;  2OYQ A;  1S9G A;  2Q3S A;  3NF6 A;  1C1B A;  4CJE A;  1WSF A;  3LP0 A;  5HLF A;  4IG0 A;  3OYB A;  1X9W A;  2KFZ A;  4HVJ A;  4DSL A;  4CGI A;  1IH7 A;  3AVM A;  1SKW A;  1D9D A;  3PX4 A;  3HM9 A;  2HNZ A;  3JYT A;  4HTU A;  3HJF A;  1TGO A;  2QK9 A;  4CF9 A;  3MEE A;  5KRT A;  1YT3 A;  5KI6 A;  1EET A;  3M8S A;  4FZX C;  1D5A A;  4CJP A;  3DMJ A;  3AVF A;  1WSH A;  3SQ1 A;  4ELU A;  4KRE A;  1NOY A;  1BIS A;  3DRR A;  1GOA A;  4Y1C A;  2Z1J A;  3DRP A;  4O0J A;  4DTN A;  3CM6 A;  4YNQ A;  1VSJ A;  4KAZ A;  3MXJ A;  1Q9X A;  3NF7 A;  4N47 A;  2G8U A;  1FKP A;  1HJR A;  1RT3 A;  3O4Q A;  2HHU A;  4FXD A;  4FJM A;  2OZM A;  4M3U A;  1L3U A;  1BHL A;  1RTH A;  1KFS A;  1CXU A;  2O4G A;  1HYV A;  3SZ2 A;  1TV6 A;  3AVJ A;  1SL2 A;  3ZSW A;  3NHG A;  4CES A;  1TAQ A;  3RMA A;  3THV A;  3RMD A;  4CJT A;  3O3G A;  4CF2 A;  2PY5 A;  2FBT A;  1RCH A;  3OYI A;  2G8W A;  5FRM A;  4LH4 A;  2HHW A;  4I2Q A;  1QSS A;  2YHB A;  3M8R A;  3AA5 X;  2VG7 A;  4N5S A;  3KLH A;  4M41 A;  3OYM A;  1JXE A;  4FVM A;  2P51 A;  2RF2 A;  4B9M A;  4M45 A;  2HND A;  4RW4 A;  4AHS A;  3IAY A;  4JRQ A;  1UA0 A;  2O4I A;  3U6F A;  3SQ0 A;  4Z4H A;  3KLG A;  1FKO A;  3V9Z A;  2WOM A;  1RT7 A;  2PYL A;  3OYH A;  4CEF A;  3ZT3 A;  5HRN A;  2X74 A;  1HMV A;  1SV5 A;  1NK5 A;  1LW2 A;  4FJK A;  1S6P A;  1Y97 A;  1GOC A;  2HB5 A;  1WSI A;  4QCL A;  4CE9 A;  1BQM A;  2OA8 A;  3KK2 A;  4M3Z A;  4DLG A;  3QNO A;  3AA3 A;  4FK0 A;  3SCX A;  3SNN A;  3QER A;  1S1U A;  2HHQ A;  1RTJ A;  3TAE A;  3DLB A;  4NCA A;  1W9H A;  4CJF A;  1TVR A;  2XHB A;  1LWE A;  1RT2 A;  3ITH A;  3NGY A;  1NK9 A;  4PUO A;  3SQ2 A;  4OKK A;  1EXQ A;  2OPS A;  3QEW A;  4W5O A;  3QET A;  1BL3 A;  3CYM A;  1JL2 A;  1EKE A;  4I7F A;  4DTX A;  1C0T A;  4J2D A;  1HNV A;  4N41 A;  1QE1 A;  4CEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...