1KVCA

E. coli ribonuclease hi d134n mutant
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCNELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Proposal for new catalytic roles for two invariant residues in Escherichia coli ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Endoribonuclease
total genus 53
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1996-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1kvcA00
4UQGA 1U4BA 1U49A 4C8OA 4FM1A 4CIEA 1I3AA 4CIGA 3VA0A 4DTUA 5J2PA 4CEZA 1CZBA 4HHTA 1N6QA 1NKCA 4C8LA 4DSIA 2QK9A 3D0PA 2FBTA 5FDLA 3VQ5A 1JLFA 2BANA 4Y1CA 1BIZA 1MU2A 1VSEA 2YNHA 4WE1A 3VN5A 2Z1IA 4AH9A 3CFRA 3O4QA 4M3ZA 3IG1A 4HVJA 2HHXA 5CYQA 3C94A 4G1QA 2P1JA 1C1BA 2ZD1A 2X74A 3C95A 1YTAA 3HPGA 5HBMA 4GMJB 4AHCA 1IKYA 1EKEA 4CJUA 5I42A 4IDKA 4DMNA 1TGOA 4BWJA 1YTUA 1RTHA 4OKJA 1NJYA 1KVCA 2OPQA 4CEAA 4M41A 1Z25A 3HP9A 3L3VA 1RDCA 2KZMA 2HVIA 5J2NA 1ZBIA 4LSNA 3RR8A 4KHWA 2HHVA 3HPHA 4E7KA 4IFVA 4CGIA 3AVHA 3M8QA 3S3MA 1LAVA 4BDZA 1ZBUA 4IBNA 2YKMA 2HB5A 3V9XA 4DQIA 3VQBA 4CHQA 1UWBA 3KTQA 2VWJA 4CHPA 1C0MA 1CXUA 4J2EA 3EZ5A 3SUNA 4LSLA 4DTNA 3F73A 3DOLA 3NGIA 1IH7A 1CXQA 4N76A 3MXJA 1SKRA 3VQEA 3MAQA 1NOYA 3LP3A 3TAGA 1VSFA 5C24A 2A1RA 4DSLA 1F21A 2YHAA 3CM5A 3V81A 4CJKA 1X9SA 2GUIA 4CK2A 4FJIA 4NCBA 3DYAA 1VSLA 4CEOA 1BI4A 4B8CA 1HNVA 3G10A 2YNGA 1I39A 4E7IA 3NH0A 1LV5A 4XIUA 4CK1A 1L3TA 1RNHA 1D8YA 2I5JA 5SZTA 1KVBA 3IS9A 4RW6A 4CJ3A 3K57A 1RCHA 2E4LA 4DWIA 5FRNA 1QE1A 4DSJA 4CHOA 3NF8A 4K8ZA 3KIOA 3AA4A 4Y1DA 4CJWA 2A1SA 3VQ8A 3KK2A 4OKEA 1LWEA 2B4JA 3V1RA 1JXBA 4CJSA 1D9FA 4EZ6A 3CFOA 4KB0A 3K5LA 3V1QA 4CEDA 3EYZA 1VSHA 4FZZA 3QEPA 5D3GA 1QS4A 2FBXA 3OS0A 4B8AB 1NK0A 4KB1A 3K5OA 3SQ0A 1IKVA 2HMIA 3OVNA 4AHUA 1D9DA 2OYQA 4FJNA 1HYVA 4M3TA 4C8MA 3K2PA 1GOCA 4OPKA 4CGGA 4DQRA 4DU3A 1B92A 1NK9A 1NK6A 3TAMA 2F8TA 1KRPA 4OLAA 3ZSQA 1RDAA 4E19A 2B5JA 2D5RA 2RKIA 4RG8A 4TSXA 4F8RA 1G15A 4EZ9A 1D5AA 4FK4A 3AVLA 4LH5A 1EXQA 2IS3A 3NE6A 2KFZA 3DLBA 1Z26A 2LSNA 1JLAA 4IKFA 1A5XA 1RDDA 4O4GA 1BL3A 2O4GA 4CJPA 2Y1IA 1J9AA 2QXFA 1JLEA 3AO5A 3QINA 3NCIA 4CJVA 3K5MA 1KVAA 3ASMA 3HM9A 3SQ1A 1TAUA 4DQQA 1K6YA 4BE0A 4FCYA 3OYBA 4DTXA 4JS5A 4CJ5A 5I3UA 1J5OA 4Z0UA 3NGYA 3ALYA 1QHTA 1TV6A 3MEEA 3VQAA 4FZXC 3QNOA 3LDSA 4LY7A 4H8KA 1UAXA 4I2QA 3OYCA 2RPIA 4CECA 3KKSA 1ASVA 3P5JA 4M3XA 4FW2A 1WSJA 3NGZA 2FBYA 1T05A 1ASUA 1RBRA 2JGUA 3MEGA 4JS4A 1CZ9A 2KQ2A 3KJVA 1LAWA 2G8IA 4PY5A 1QSSA 3L2QA 3H08A 4RW7A 3SUPA 1EP4A 3TAPA 4DU1A 1DTQA 1VSJA 1NKEA 1TL1A 3TI0A 4DU4A 1Y97A 2EHGA 1C6VA 2VWKA 3HVTA 3RTVA 3MXMA 1BQMA 3KK3A 4K8XA 4EP5A 1IG9A 2IAJA 3NF7A 1C1CA 3ZT3A 4DFMA 3NH1A 1NKBA 3M8PA 3SUOA 1RILA 3O3GA 3DLKA 2B6AA 3AA5X 4DFPA 3EY1A 3HJFA 3QIPA 4CHYA 3SV3A 3SQ2A 1SL0A 2ETJA 4J2BA 3OYDA 4B9NA 3PUFA 3NDKA 4FLXA 3IAYA 4KTZA 1WLJA 3NHGA 1WSEA 4N56A 1TKXA 3TANA 3A2FA 3V9WA 4KAZA 3AO4A 5K14A 4B9MA 2VG6A 1X1PA 3G0ZA 3L2UA 4CEBA 3SV4A 4B9UA 2P51A 3ZSZA 3QIOA 5HRPA 5FRMA 2GBZA 3OYMA 2X78A 1ZYQA 4DTJA 3S9HA 4L8RB 1U47A 4FJ8A 3HO1A 4CHNA 2OPPA 1NOZA 4GW6A 4AHTA 4KHSA 4FK2A 3L2VA 3V4IA 3QEXA 3SUQA 1JLBA 3LZIA 4M3YA 3FFIA 1TKDA 4ZTJA 4I9QA 3SCXA 4CERA 1WAJA 1HJRA 3SPYA 2KFNA 3TABA 4DQPA 3KLGA 4BWMA 2VG5A 1XC9A 4FXDA 1HYZA 2E6LA 1XI1A 3HP6A 4B08A 1S5JA 4ELVA 1DLOA 3WNFA 1DTTA 4DLEA 4FLWA 4DF4A 4E7JA 3ZSXA 4FZYA 4CESA 4IFYA 1IKXA 2ZQBA 3HYFA 1WSGA 3PY8A 2ZE2A 4OVLA 5HRNA 1SKSA 1TKTA 1L3SA 4Z4EA 4N5SA 2PYLA 3HT3A 2XRIA 4NYFA 4OLBA 4C8NA 4Z4GA 1BCOA 3RMDA 1B9FA 2IDOA 4Z4HA 5KRSA 1FK9A 2XY7A 1ZBFA 1T7PA 4ELUA 4BE2A 4KREA 1NJZA 2BGGA 3VA3A 2XY8A 2F96A 4CFCA 2OZSA 4FJJA 1LW2A 5KGWA 1RT3A 2ATQA 4B3OA 1RTDA 2DTUA 3OYEA 1Q9YA 1Q9XA 1WSHA 1VRUA 4ID5A 2QKBA 3VQ7A 2HW3A 3S3NA 4HTUA 4KTWA 1XHZA 1VSDA 1NK8A 1TVRA 4OGCA 3JYTA 4JRQA 4FJ9A 3LPUA 3LP1A 3O3FA 3U6FA 1BI4B 4Z4CA 3AVIA 3WNHA 2OPSA 4FJ5A 3LP2A 5C25A 5HLFA 4DTMA 1A5WA 2F8SA 2GV9A 4DSFA 4KV8A 3AA2A 1KFSA 3KD5E 2HNDA 2YNIA 3LAKA 4DFKA 3PX0A 1ITGA 3ZT4A 1TK0A 4CJTA 4ICLA 2KTQA 3E01A 3QO9A 3SZ2A 1RDBA 3HSTB 3PO4A 3C6UA 3VQPA 2G8KA 2RF2A 5T7BA 1UA1A 3MXIA 2YNFA 4Q5VA 1NK5A 1EX4A 3IRXA 4CF8A 2R7YA 3NF6A 1TKZA 4LD0A 3PO5A 2HVHA 1XWLA 1HQUA 4M3RA 1JXEA 4PA1A 4KTQA 4DF8A 3M8SA 1S9EA 5CYMA 4H4MA 3RMAA 1RBUA 4DS4A 3VQ9A 4MQ3A 5DK5A 4OKKA 3I8DA 4B9LA 3OYKA 2IGIA 3DRSA 3OJSA 4KHUA 1GOBA 2YV0X 4CGFA 4C8KA 1Q8IA 3WNGA 3SQ4A 1BHLA 3ZSOA 3O4NA 4FM2A 2G8WA 4FJXA 4N47A 3M8RA 3ZT2A 3L2WA 2KW4A 3NFAA 3ZSYA 3TAFA 3PX6A 3JSMA 3OYHA 3AVKA 1ZBLA 1VSMA 1J54A 1JLCA 4B9TA 3O3HA 4FJ7A 4HCCA 4CGHA 4DFJA 1SV5A 1RT1A 1C0UA 1JLQA 3LAMA 4I2PA 4FJLA 3HL8A 4CJ4A 4CEFA 3OS2A 4CCHA 5KRTA 3SI6A 1QTMA 4CFBA 3ZT0A 3OS1A 2G8UA 4F2SA 4LH4A 4J2DA 4KHYA 4AHSA 3OYAA 4CK3A 3LWLA 4QCLA 1WNSA 2D0AA 3C6TA 2AJQA 2VG7A 4E3SA 1HYSA 2O4IA 4FW1A 5J2MA 3D45A 3VQCA 4ELTA 1VSIA 1KSPA 3KLFA 2Z1GA 1VRTA 4KO0A 4CF1A 1KLNA 4M3UA 3AVJA 1QSLA 4FLUA 2EX3A 3ZCMA 4DLGA 1JKHA 3LWMA 5C42A 4HCBA 4FJHA 4FYDA 3ITHA 1RT7A 3DLGA 3RRHA 3VQ6A 3BGRA 4E7LA 2G8FA 1X9MA 4DG1A 4RW8A 3B6PA 4MFBA 1KTQA 1O1WA 3THVA 2JLEA 3KKRA 4EP4A 2G8HA 3CG7A 1LWFA 4CGJA 1BGXT 4DTPA 4FLZA 3DOKA 1L3VA 2X6SA 4CHZA 3UIQA 2PY5A 4DTOA 1WSFA 4W5TA 5CZ2A 3V6DA 2WOMA 4KHQA 3CYMA 5HP1A 2Z1JA 2W42A 1S6QA 4NYNA 4M45A 4CF9A 3OYJA 4ZTFA 1TK8A 1QSYA 2HHWA 1B9DA 3B6OA 4I7FA 4E1MA 3CFPA 4KKOA 5JS1A 4FLTA 2G8VA 4CGDA 2WONA 5CZ1A 5HRSA 3OYLA 4W5RA 4RW4A 1GOAA 1S9GA 3LANA 3L2RA 1U45A 1SKWA 2OA8A 1UOCA 4O0IA 1KLMA 1U48A 3K5NA 3ULDA 3RWUA 3PX4A 3NH2A 2HNZA 2Y1JA 4DSKA 3HVRA 2IOCA 5EU7A 1S1UA 1IKWA 4N41A 2HHQA 4AILC 1FKPA 4ID1A 4PWDA 1RBSA 4JLHA 1RT6A 3AVGA 3OYGA 4BACA 5DMRA 2E6MA 4YFUA 4Z4FA 4CF2A 1HNIA 3OYNA 3DI6A 5KI6A 3AVAA 4FLYA 4Q0BA 2HHSA 3MEDA 4CE9A 1RBVA 3AVBA 5JS2A 4F4KA 3U3GA 4CJRA 2ITGA 2DY4A 1EETA 1WN7A 3DLHA 1L3UA 4AHRA 3DM2A 3AO3A 3QLHA 4FJMA 1C0TA 4ZHRA 3AA3A 5KGXA 4OJRA 4R5PA 1NJXA 5HROA 4FVMA 5J1EA 1S1VA 4GVMA 2YHBA 1S1TA 1QQCA 4E1NA 4DS5A 4NCAA 1KFDA 1SL2A 3KLHA 4B9SA 1U04A 4O0JA 3SNNA 3NAEA 1RT4A 1RTJA 4PUOA 4Z4IA 1HPZA 2DFHA 4DTRA 1VSKA 1SL1A 3VQDA 1JL1A 3QETA 1S1WA 2X6NA 4YNQA 1R0AA 3SYZA 3LPTA 3KLIA 1TAQA 3ZSVA 2XHBA 2FBVA 4OGEA 1WAFA 2D0CA 3SPZA 3S3OA 3L3UA 1C1AA 4QAGA 3KK1A 3NBPA 1W0HA 2RN2A 4CJLA 4CEEA 3TAEA 2OPRA 4HUEA 4FJGA 4M42A 3V9SA 3AVMA 2HHTA 1HRHA 5E41A 3ZSWA 3PV8A 1HMVA 4RW9A 3HPOA 4KI6A 1T03A 2YKNA 3T19A 3LZJA 3ISNC 1REVA 3NF9A 1IO2A 1LW0A 4FLVA 4B9VA 4F3OA 3F9KA 3VQQA 1J53A 3V1OA 4FM0A 3KLEA 2NUBA 1XHXA 1T8EA 1VK0A 4CJFA 4CJEA 1BQNA 3RRGA 1BIUA 3QEVA 1SUQA 3AO2A 3AO1A 1YVUA 3CM6A 4CFDA 3P83D 3RR7A 3QERA 3CQ8A 3MECA 3TWHA 3P1GA 2P5OA 4O5BA 2HNYA 2IC3A 1N5YA 1S1XA 4W5NA 4BDPA 4KRFA 1CLQA 1RT2A 4E0DA 1HQEA 4CFAA 1NK4A 4O44A 2XY6A 3AVCA 3OJUA 3QEWA 4I9LA 3ZT1A 2OZMA 3I0RA 3TARA 2Q3SA 4O55A 2HHUA 1JLGA 1BISA 4PQUA 1S6PA 3I0SA 1ASWA 4OPJA 1BCMA 3OYIA 4DTSA 3KD1E 2DFEA 3WNEA 3DMJA 5FROA 1RT5A 4CEQA 4FJKA 3T1AA 3ZSRA 3SJJA 4F2RA 4QOZB 4NCGA 3V9UA 4J2AA 3DLEA 1FXXA 2Z1HA 2XO7A 4HUFA 3VQ4A 3DLRA 5CY4A 2XY5A 2FC0A 3HK2A 1JL2A 4JRPA 1A5VA 3LALA 4CJQA 4DQSA 4CIFA 4DSEA 3TAQA 1LWCA 1UA0A 1X9WA 1TL3A 4CF0A 3RMCA 4BE1A 2BE2A 3U3YA 3LP0A 4KHNA 1W9HA 1NJWA 4AHVA 4KPYA 3QESA 4IG3A 4IG0A 5HRRA 4W5QA 3QNNA 3K58A 1L5UA 2BDPA 3QEIA 3OYFA 1TK5A 5KTQA 3OY9A 5SWMA 2PZSA 3AVFA 4FK0A 4M3WA 1RTIA 4BDYA 3V9ZA 4HUGA 5J2QA 4F3TA 3AVNA 4H4OA 1KCFA 3RMBA 2D0BA 2KZZA 3DRRA 3L8BA 3AV9A 2PYJA 1FKOA 4E89A 2P5GA 4KI4A 4KFBA 3TR8A 1YT3A 2QKKA 3HXMA 3K59A 1RBTA 1ZBHA 1WSIA 3T3FA 4E7HA 3DRPA 3BDPA 4W5OA 1NK7A 2DFFA
chains in the Genus database with same CATH superfamily
4ISFA 1U49A 1Q7YO 4H0VB 4IZ9A 1I3AA 5J2PA 2QK9A 5BRDA 3PSIA 5FPMA 1NKCA 3A5OC 4DSIA 1N33K 1NJIO 1JCEA 4Y1CA 1BIZA 3IG1A 4G1QA 2P1JA 4BROA 3HPGA 4GMJB 1RTHA 4OKJA 4ILGB 4CEAA 1RDCA 1ZBIA 4KHWA 1NGDA 2CH5A 4IFVA 3M8QA 4A5AA 2I7PA 1LAVA 4IBNA 3RVCA 2YKMA 2BH1A 3LDQA 4Z94A 3LL3A 3VQBA 4PKGA 3M3ZA 4CHQA 1C0MA 5E26A 4J2EA 3SUNA 4JKAA 2D4WA 3F73A 3NGIA 3J8AA 1FJGK 1IH7A 4X62K 4N76A 1SKRA 3MAQA 4DV7K 2YHAA 3CM5A 2UUBK 2F4VK 3DYAA 4CEOA 2YNGA 1I39A 4RW6A 4JK8A 5EXWA 1NNEA 4JYAK 5AZIB 4EIAA 3MWPA 4K8ZA 4Y1DA 4CJWA 1NMNA 2A1SA 4FSVA 3CFOA 4LF6K 3K0SA 4H5NA 3O08A 4FWKA 5EY4A 3QEPA 5D3GA 4B8AB 4KB1A 1VQPN 1QHAA 2Q0RA 4AHUA 4FJNA 5BR9A 2IVPA 4CGGA 4DQRA 1B92A 5F1XA 4OLAA 1RDAA 4E19A 1GLAG 1YF5L 4RG8A 4F8RA 2E20A 1G15A 4EZ9A 3HOSA 1EXQA 4H5WA 2CGJA 4IO9L 1A5XA 1RDDA 3J80O 4DV6K 3TU5A 3NCIA 2O8BA 1KVAA 4DQQA 3J7AP 1J5OA 4DHYA 4CJ5A 3BUZB 4FZXC 2HBMA 3VEZA 3AGKA 3LDSA 5JICA 2RPIA 1ASVA 4UY8O 1WSJA 3NGZA 3C0BA 2IIRA 3CJCA 2P9NB 3KJVA 1QSSA 4PL7A 2ASMA 3L2QA 5M1QA 4RW7A 1BOTO 3SUPA 3F2KA 3TAPA 5KPRA 1NLVA 1VSJA 4EHUA 1KXPA 2VQEK 4IFEA 1Y97A 3JAMO 4EHTA 2EWSA 1GLDG 4K8XA 3CC2N 2VGNA 2IAJA 2GELA 3NF7A 4DFPA 1P90A 2FSNA 3EY1A 3HJFA 4BRFA 3SV3A 1V4TA 3R1XA 5LMNK 4MDAA 4FLXA 1RGIA 1WSEA 4GKJK 1VAZA 1HKGA 1X1PA 3G0ZA 3L2UA 3ZSZA 2ZGZA 5FRMA 2GBZA 2X78A 4CHNA 1NOZA 4OO1J 4BC3A 3CIPA 4KHSA 3QEXA 5AQJA 2ZM6K 3E9PA 3SCXA 1HJRA 4JKEA 4DQPA 3KLGA 1S5JA 3DLLL 4ELVA 4LFCK 3WNFA 4JI5K 3PIOL 1HLUA 4FZYA 4IFYA 1BCOA 3MK6A 3WUHA 4BR4A 1B9FA 2IDOA 2XY7A 1FK9A 4KREA 5AQRA 2OCEA 4FJJA 3SAFA 1XQSC 2F9TA 5KGWA 3HBTA 2P9SB 5BPLA 4QS7A 1RTDA 4O5FA 4ILJA 4JK9A 1WSHA 4IOCL 1DKGD 3VPZA 1VSDA 4JKFA 4M7YA 3O80A 1BI4B 4Z4CA 1HPMA 5FPEA 5HLFA 3R9PA 2GV9A 4DSFA 3THYA 1KFSA 4BG9A 1N36K 3KD5E 4DFKA 1IBMK 1ITGA 2P9IB 3O9TA 1RDBA 4A57A 4BRAA 2RF2A 5T7BA 4NB4A 1TKZA 2HVHA 1HX1A 5GAGP 1JXEA 4DF8A 4CBXA 5CYMA 4H4MA 3RMAA 3CPEA 2AA4A 5DK5A 3CCQN 3I8DA 3ZX3A 4K43A 2YV0X 4C8KA 1MWMA 4IEEA 1BHLA 3ZSOA 3O4NA 3CXCM 3M8RA 3TAFA 3L2WA 3PX6A 4LF5K 3JSMA 3OYHA 5GADP 1IV0A 4FWRA 1BU6O 4B9TA 3VETA 5JLFA 1SV5A 3OS2A 2YJFA 1QTMA 4J2DA 4AHSA 3LWLA 1WNSA 3MCAB 2E1ZA 4E3SA 2O4IA 4AQYK 5J2MA 4ELTA 3CI5A 2YJEA 1KLNA 1VRTA 4CF1A 3WQTA 2HF4A 3AVJA 4FLUA 5C42A 4PHTX 1XMQK 3RRHA 4BR5A 4E7LA 2G8FA 2NRTA 2O8CB 3SMPA 2VQFK 3A5MC 3CG7A 4BGBA 5LY3A 3SJHA 4CGJA 4FLZA 3DOKA 4CHZA 3UIQA 4JD2A 5HP1A 1BA0A 3HSCA 1B9DA 2YHYA 3B6OA 3CFPA 3JS6A 1OH6A 4B1WB 3H1QA 1N32K 5CZ1A 1S9GA 2P9UB 3H3NO 5TKYA 1U48A 1YUWA 1VQ4N 3ULDA 3PX4A 4DSKA 3BZKA 2HOEA 4CD3A 1S1UA 1IKWA 4WFBL 5GIPA 4IJNA 5KQDA 1RBSA 2ZJRL 1BUPA 1NU0A 4BACA 4CF2A 5KI6A 3AVAA 4Q0BA 4CE9A 1RBVA 3AVBA 3DXMB 3U3GA 3OBYA 4CJRA 1WN7A 1L3UA 3ZEUA 3DM2A 4BR0A 4YOXA 4FJMA 3O9RA 3T7ZA 5KGXA 5AQYA 4DS5A 3CHWA 4BRIA 4NCAA 1NGGA 2Q31A 3VGKA 1KFDA 4HTLA 4DR1K 4O0JA 4FPAA 2DPNA 3NAEA 3CPWM 2PBDA 3WXMB 4WQ5C 1DT9A 1WBDA 3ZEUB 4M7XA 3QBXA 3S3OA 4OGEA 3BP8A 3SPZA 1C1AA 4B3SK 3I33A 3NBPA 4M42A 4HUEA 5C15A 3C7NB 2FSJA 4RW9A 2V7ZA 4A2BA 3NF9A 1IO2A 5E84A 3MN7A 1J53A 4FM0A 4A62A 4DB3A 4NO7A 1VK0A 4CJEA 1BIUA 3AO1A 3CM6A 3WT0A 5EVZA 2HNYA 4W5NA 1K8KA 2JWKA 4BDPA 1CLQA 4BRKA 1RT2A 4CFAA 1NK4A 4O44A 2OZMA 3WEEA 4BR2A 3PLAA 4PQUA 4OPJA 1VQ8N 2DFEA 3WNEA 4JEPA 3ZSRA 4F2RA 1RFQA 3V9UA 3DLEA 4HUFA 2XY5A 4CZIA 1NMDA 3CD6N 3LALA 1UA0A 5AZJA 3RMCA 3NVKA 4BE1A 1EO1A 3CJ9A 4IG3A 2P9KA 1L5UA 2ZF5O 2HHHK 4O8KA 1U2VB 1TK5A 3OY9A 5SWMA 2PZSA 3AVFA 1KD1O 3C65A 5M1PA 5AQHA 1M1KO 3RMBA 4A2AA 4DR7K 2PYJA 4E89A 5H1SQ 4KFBA 3TR8A 3O9SA 1HNXK 1KAXA 3CC4N 1ZBHA 4E7HA 4W5OA 2O8DA 1YJWN 1U4BA 4YDUA 1T3VA 4FM1A 3CJAA 3HM8A 4R79A 2WFBA 4CZMA 4DTUA 1N6QA 2OTJN 1CZBA 3VMFB 4FWPA 3SBGA 2FBTA 4BR7A 1JLFA 2BANA 4BC2A 1MU2A 1VSEA 2YNHA 3CFRA 2GEMA 2NRZA 3CQYA 4HVJA 4B1YB 3C94A 2HHXA 2ZD1A 3ZX2A 5HBMA 4AHCA 3THXB 1EKEA 1S22A 5TKWA 3IMXA 4BRQA 2E2QA 4M41A 3HP9A 3L3VA 5CHIA 3CCLN 2HVIA 3RR8A 2HHVA 4E7KA 3F9MA 3SMSA 4GV3A 2HB5A 2Q36A 3V9XA 1C0FA 2QWNA 3L6QA 5A2QO 4CHPA 1CXUA 4FWQA 4LSLA 1NGIA 3FZFA 1VQKN 3DOLA 2E2PA 4J8FA 3TAGA 4JHDB 5C24A 4LF8K 4ILHA 3V81A 4CK2A 1NGEA 5AQZA 4MLEA 3G10A 4CK1A 5AJ3K 5SZTA 3IS9A 5AQKA 4DWIA 5FRNA 2Q1NA 1QE1A 4CZFA 3KK2A 3AA4A 1LWEA 1WB9A 3J7ZO 3V1RA 4EZ6A 1VHXA 3CJBA 3V1QA 5AQXA 4IO8A 1VSHA 4FZZA 3NVMA 3KWIA 2UUCK 1XNQK 4JI2K 1D9DA 1HYVA 4M3TA 1GOCA 3T1YK 3TAMA 1X3MA 2F8TA 2D5RA 2RKIA 4TSXA 4HWIA 1D5AA 3AAPA 2KFZA 3CJ7A 3SLCA 4DR2K 4CJPA 4OX9K 3ASMA 3HM9A 3SQ1A 4BE0A 3OYBA 4JS5A 5M1NA 3VQAA 4LY7A 3OYCA 2PAVA 3KKSA 3P5JA 4FW2A 3VOVA 5AQOA 1IJJA 1IBLK 5EX5A 3RSEA 5AQMA 1CZ9A 4PY5A 1DGKN 1EP4A 2A5XA 4BRLA 2O8EA 1TL1A 3LDPA 3O9UA 3ENBA 2VWKA 4BQLA 2A3ZA 4BQZA 3U9ZA 1C1CA 1K9MO 3NH1A 1NKBA 3M8PA 3SUOA 3GDQA 3O3GA 5JVGL 2B6AA 1SL0A 2ZWHA 3GBTA 4JI1K 3MN9A 3IAYA 1RDWX 4KTZA 2QXLA 4N56A 1TKXA 3CMEN 3SAHA 3THWA 4B9MA 2VG6A 3MN6A 3CMAN 2ASOA 3AARA 5HRPA 4RTFD 1ZYQA 3A0IX 4DTJA 4DUYK 1U47A 3HO1A 2IVOA 2OPPA 1YJ9N 4FK2A 1YHQN 3V4IA 3VERA 3CQXA 3FFIA 2A6AA 4I9QA 1ATRA 3C6HA 2KFNA 2VG5A 1ESVA 2H3GX 5AQVA 1XI1A 1M90O 4LF9K 4CD1A 4LF7K 1DTTA 4FLWA 4DF4A 5AQLA 2FXUA 1IKXA 3HYFA 2QWPA 4DV4K 4NXMK 2XRIA 4Z4GA 3RMDA 5KRSA 3KHYA 1T7PA 4ELUA 4BE2A 2F96A 4CFCA 3CCEN 1LW2A 1RT3A 4B3OA 1Q9XA 1SQKA 1VRUA 4ID5A 3S3NA 1HNZK 4OGCA 4JRQA 3LPUA 3U6FA 3AVIA 4FJ5A 4X65K 3L4IA 1A5WA 3VGMA 4WYBA 5GAHP 2YNIA 3LAKA 4BRPA 2YX6A 3MX2A 4ICLA 4LC9B 4EFHA 1FW6A 3SZ2A 3VQPA 2G8KA 3UB5A 2UXDK 1JCFA 4NLCA 4CBWA 1EX4A 3IRXA 4CF8A 2R7YA 3T1HK 4FL9A 1QZ5A 4JV5K 1XWLA 3SK3A 2P9LA 4KTQA 1S9EA 1N8RO 2VGMA 4MQ3A 4GVEA 4OKKA 3DRSA 2V52B 3Q7BA 2YI1A 3ZT2A 2V51B 3NFAA 3QFUA 4CVNE 2D1KA 3AVKA 2A41A 2O8BB 4PL8A 1VSMA 1JLCA 4FJ7A 3OHRA 1EWRA 4HCCA 4JKDA 3HL8A 4CJ4A 4CFBA 3ZT0A 1K8AO 4LH4A 4KHYA 5F0XA 4CK3A 4QCLA 4LFBK 3U9DA 3C6TA 3QBWA 3LM9A 3A5LC 2PFUA 4E1JA 3VQCA 3D2FA 2Z1GA 4KO0A 4YOTA 4HCBA 4QS8A 2W6LA 1OH7A 3E1YA 1NWKA 3VQ6A 4YOYA 1O1WA 2JLEA 4EP4A 1XNRK 3H3OB 1LWFA 1BGXT 3A5NC 2X6SA 2PY5A 1WSFA 4B1XB 4H5TA 4CF9A 1TK8A 4E1MA 1HR0K 5JS1A 1BO5O 2P9PA 2G8VA 4CGDA 4H0OA 4FWNA 3L0QA 4RW4A 3L2RA 1Q81O 4O0IA 4DR3K 1P8ZA 4YORA 2Y1JA 4FPBA 2HHQA 1FKPA 4ID1A 3I8BA 3O1BA 3W3DA 5M1FA 4BRCA 3E66A 2E6MA 4YFUA 4MDBA 3OYNA 4GV6A 3EN9A 5JS2A 4CI6A 3EL2A 3ULEA 3DLHA 4JI3K 3QLHA 4AM6A 4ZHRA 4OJRA 1NJXA 5HROA 1I94K 5J1EA 3CCRN 3G71N 4GVMA 1S1TA 4E1NA 4JI8K 1NBWA 3SNNA 1RT4A 1RTJA 4BVPA 2FF6A 5AQNA 3QETA 1NGBA 1S1WA 4YNQA 5KQ8A 1TAQA 2XHBA 2D0CA 5ADXA 3IUCA 3L3UA 4QAGA 5AQTA 2OTLN 1W0HA 2RN2A 4JKGA 3H1VX 2OPRA 4DV1K 3TAEA 2HHTA 3FZHA 2GX9A 4FOEA 4FVUA 1T03A 2YKNA 4CBUA 1G99A 4FLVA 3LDOA 4F3OA 3THYB 3VQQA 3VGLA 3KLEA 1T8EA 1BQNA 3RRGA 3AO2A 1SAZA 4CFDA 2AP1A 1HKCA 3CQ8A 1N5YA 4KRFA 4YDUC 1H1VA 1QVGM 5M1OA 2Q97A 3QEWA 4GNIA 4I9LA 2HHUA 3E9LA 4MO4A 4MO5A 4DTSA 2F7TA 3KD1E 4FJKA 3DMJA 3HI0A 1RT5A 3VEYA 3O9QA 3KK7A 4IDHA 1GLFO 3DLRA 3VQ4A 3HK2A 2FC0A 1JL2A 5ADXH 1A5VA 1X9WA 1YI2N 1LWCA 3QDKA 4BRDA 4CF0A 1YAGA 2BE2A 1Q18A 4AHVA 4CJ7A 4KPYA 3OYFA 5KTQA 1X3NA 1T44A 4FK0A 4BDYA 4CZGA 4F3TA 4H4OA 4CZKA 1HJOA 2GTDA 4A59A 3AV9A 1FKOA 4KI4A 1YT3A 1RBTA 3FZMA 5AQGA 4BRGA 3DRPA 3BDPA 2DFFA 1LCUA 4B1UB 3KVGA 2QWRA 1KAYA 4H5RA 4CIEA 3N4PA 3VA0A 4C8LA 4HHTA 3VF6A 1QVFM 1VQMN 3VF4A 3H46O 3VN5A 3TSQA 3VESA 4M3ZA 3O4QA 5CYQA 1OH8A 1C1BA 2ITMA 4JD2B 3EE9A 3BZCA 3C95A 5I42A 2VCPA 4IDKA 4QS9A 1TGOA 2GUPA 4BWJA 4BRHA 1W2BM 1NJYA 2W40A 4CW7B 3ENOA 5AR0A 2KZMA 3G25A 4LSNA 5KPTA 3S3MA 4BDZA 4JN4A 4DQIA 4EAHD 5FLXO 2WUSA 3M5RA 1KAZA 1UWBA 2VWJA 2O8FA 3WXIA 2OANA 5AQUA 1NOYA 3LP3A 4CZHA 1VSFA 3SBTA 3W0LA 4DSLA 1X9SA 2GUIA 4FWLA 4KH6A 4FJIA 2WC9A 4XH4A 3MCPA 1VSLA 4AM7A 1HNVA 1OVQA 1HKBA 3TSUA 5C10A 4XIUA 1RNHA 4IWVA 2I5JA 1WUAA 1RCHA 2E4LA 4L3QA 1V4SA 4DSJA 4CHOA 3P39A 3NF8A 3KIOA 3LDNA 3M1FA 2B4JA 2F9WA 1VQ9N 3BY5A 4CJSA 3ID6A 1D9FA 4KB0A 4CEDA 2FBXA 3SAGA 2I7NA 1NK0A 4OPHA 1IKVA 2HMIA 3OVNA 5FPNA 2QWMA 2NRHA 3K2PA 4OPKA 4DU3A 2IVNA 2CGKA 1KRPA 2VYPA 3D7EO 2B5JA 1J6ZA 3AVLA 4FK4A 4LH5A 2IS3A 2D0OA 1Z26A 2LSNA 4O4GA 3D6RA 3AO5A 3QINA 4CJVA 3K5MA 1TAUA 1BWFO 4BVOA 2A40A 4FCYA 3CETA 1K8KB 3NGYA 1QHTA 1TV6A 3MEEA 1UAXA 4I2QA 3WEEB 5BPMA 4M3XA 2FBYA 1T05A 1ASUA 1RBRA 3MEGA 4JS4A 2KQ2A 1LAWA 2G8IA 4U67L 4H0XB 4DU1A 3GOIA 3IFRA 3IKMA 3FZLA 3TI0A 3P4IA 5AZJB 4DU4A 1Z6RA 3KK3A 1IG9A 5JVHL 2P9KB 4DFMA 1RILA 3NMUA 3CJ1A 3DLKA 5BN8A 3SQ2A 2ETJA 4WFAL 5C2DA 4B9NA 3PUFA 4LF4K 1E4GT 5LJWA 4CZLA 3TANA 3A2FA 4KAZA 5K14A 1S3XA 3DXKA 5IT9O 2O8DB 4CEBA 4B9UA 2P51A 3P31A 3OYMA 5BR8K 5BPNA 3K9KA 4FJ8A 5AQFA 4GW6A 4AHTA 2D0PA 3N4QA 1GLBG 3FGUA 1JLBA 1TKDA 4ZTJA 4CERA 1WAJA 4M63C 1XUPO 3TABA 3SPYA 4BWMA 5DM6L 4I6MA 4DV3K 1XC9A 1VQ6N 1HYZA 3UKRA 4B08A 3P38A 4E7JA 5MLCQ 4YOWA 4DV0K 4CESA 3PY8A 2ZQBA 3E9OA 4OVLA 1SKSA 1TKTA 1L3SA 1VQ5N 4N5SA 3HT3A 4NYFA 3QICA 4C8NA 4Z4HA 4G9ZA 1ZBFA 1NJZA 2BGGA 3GG4A 5BRFA 3K9JA 3ATVA 2ATQA 3OYEA 3ZYYX 3VQ7A 4HTUA 1XHZA 3ZLJA 1YIJN 1NK8A 1TVRA 1IBKK 3JYTA 1CZAN 4FJ9A 3LP1A 3O3FA 3WNHA 3ZETA 4H5VA 4C1NK 2FSKA 3LDLA 5EOYA 2HNDA 1TYQA 3PX0A 3ZT4A 4CJTA 5F2RA 4A61A 3VTIA 3QO9A 1UA1A 3MXIA 3HRGA 4LD0A 5GINA 3CCJN 1SS6A 4DR5K 3ID8A 3M8SA 4AF1A 3CCUN 4DS4A 3VQ9A 3TTFA 5HOOA 4BC5A 4YHHK 1GOBA 4C1NI 4CGFA 1Q8IA 1JJ2M 1YITN 4N47A 2KW4A 3ZSYA 3EE8A 3IDHA 1DEJA 2QM1A 1J54A 1T6DA 4CGHA 1RT1A 4Y0WA 4FJLA 4KI6A 4BY9C 4CCHA 4H0PA 5KRTA 3SI6A 2G8UA 3FZKA 1BDGA 3OYAA 1NGJA 4OPAA 2YCHA 3OTOK 4BRNA 3RSEB 4FW1A 5AQIA 3D45A 2GWKA 1VSIA 1S72N 1KSPA 3KLFA 4BR9A 2O8EB 3ZCMA 4DLGA 3D2EA 3KZBA 3MDQA 4FJHA 3ITHA 1RT7A 3DLGA 3BGRA 3CF5L 1X9MA 1C0GA 4RW8A 3VF2A 3CCSN 2UXCK 4MFBA 1KTQA 1WBBA 3THVA 5GIOA 2G8HA 1VQNN 1L3VA 3VEWA 2HF3A 4W5TA 4DTOA 5CZ2A 3V6DA 3CYMA 2Z1JA 2W42A 1S6QA 4NYNA 3D2EB 3OYJA 4ZTFA 2WTUA 4I7FA 4FLTA 5AQPA 2WONA 3O4WA 3THWB 3OYLA 4W5RA 1GOAA 3LANA 1U45A 2OA8A 1KLMA 2WBNA 3RWUA 3NH2A 2HNZA 2BUPA 4X66K 4N41A 4PWDA 1RT6A 5DMRA 3I56N 4Z4FA 4JAXA 4FLYA 2HHSA 3MEDA 1LOTB 4F4KA 3TTCA 2ITGA 2DY4A 4XH5A 1EETA 2NRXA 1HUXA 4AHRA 3MMVA 4YY3K 2KLAA 1JCGA 3AAQA 4FVMA 2QWQA 1S1VA 2YHBA 1QQCA 1W97L 4RWTA 3KLHA 3I55N 4B9SA 4BC4A 2HBJA 5AZIA 4PUOA 2NRWA 1SL1A 3VQDA 4FO0A 1JL1A 1R0AA 3LPTA 2ZGYA 3KLIA 3OW2M 3QFPA 2QW9A 2FBVA 4DR6K 1WAFA 5GAEP 1ZBSA 4CJLA 4CEEA 4FJGA 3V9SA 3AVMA 1RDUA 3ZSWA 3PV8A 4DR4K 1YJNN 3LZJA 2BTFA 3ISNC 1REVA 2RE2A 2FF3B 4IOXA 2E1YA 1NGFA 4KBOA 4CJFA 3QEVA 4B1ZA 3P83D 4FOIA 5M1KA 2A42A 3MECA 3P1GA 5AFUA 4IOAL 4O5BA 2IC3A 1S1XA 4E0DA 2P9LB 4NLBA 3OJUA 4RCHA 3I0RA 3G6EN 2Q3SA 3GE1A 3TARA 1KQSM 5HL7L 1BISA 3OYIA 4CEQA 5FROA 2P9NA 3H6EA 3SJJA 4QOZB 3G4SN 4J2AA 1FXXA 2Z1HA 1XMOK 1YXQA 4CJQA 4DSEA 3UE5A 3TAQA 3T69A 3QMLA 1NG9A 3LP0A 4KHNA 1W9HA 2QA4N 5AQQA 5HRRA 4W5QA 3K58A 3FFKB 3O1WA 4LFAK 2VWBA 4M3WA 4X64K 2Q2RA 1RTIA 3AVNA 1KC8O 1KCFA 3DRRA 3CCMN 4WQ4C 2QKKA 4BRMA 3GL1A 3Q7CA 3K59A 3WQUA 1WSIA 3D2FB 1NK7A 4UQGA 4XEIA 4C8OA 3MWTA 5AFUH 2UU9K 4CIGA 4CEZA 4MLHA 3D0PA 3BEXA 5FDLA 3VQ5A 4AH9A 4WE1A 2Z1IA 4K42A 1O13A 5KPZA 2X74A 1YTAA 1IKYA 4CJUA 4DMNA 1YTUA 4JK7A 1D4XA 1KVCA 4YOUA 2OPQA 3F5TA 1Z25A 2P9PB 5J2NA 3HPHA 3VENA 4CGIA 3AVHA 1ZBUA 5BREA 1ATNA 2YHXA 1VQLN 1K73O 3FR0A 3KTQA 3MN5A 3EZ5A 4DTNA 3ZX0A 2P9SA 1CXQA 3AY9A 3MXJA 3VQEA 2Q0UA 2A1RA 1F21A 4CJKA 3ULEB 4NCBA 4FWOA 1BI4A 4B8CA 4E7IA 3NH0A 1LV5A 1L3TA 1D8YA 1KVBA 4CJ3A 3K57A 4WFNL 1U6ZA 2NZTA 3CC7N 3ENHA 2P9IA 3VQ8A 4OKEA 3R6MA 5C2FA 1JXBA 2E88A 1Q82O 3O5BA 1NGAA 5FPDA 3K5LA 1IG8A 3EYZA 3U8XA 1QS4A 3OS0A 4DV5K 3K5OA 3SQ0A 4JKGB 2OYQA 3BF1A 4C8MA 1NK9A 1Q86O 3AGRA 2E2OA 1NK6A 3ZSQA 1R59O 3O6WA 5C12A 3PSFA 3CERA 1OKJA 5LMUK 3OA9A 3NE6A 3DLBA 3LM2A 1JLAA 2HMPA 4IKFA 2UUAK 1BL3A 2O4GA 2Y1IA 1J9AA 2QXFA 1JLEA 3HOTA 3EO3A 1K6YA 4DTXA 2CGLA 5I3UA 4Z0UA 3ALYA 2ASPA 1MWKA 3QNOA 4H8KA 1X9JA 4CECA 1NGHA 3TSPA 2NRRA 3ATUA 3L4QA 2JGUA 1GLEG 1NGCA 4CZEA 4B3TK 2RHKA 3H08A 1QZ6A 1DTQA 1NKEA 1HNWK 1OH5A 2EHGA 3RTVA 1C6VA 3HVTA 3MXMA 1BQMA 2O8CA 4EP5A 2QI2A 4WCEL 1QQNA 3ZT3A 3VEVA 4GKKK 3A8YA 1MA9B 1WOQA 1GLLO 3AA5X 1BG3A 3QIPA 4JI6K 4CHYA 3R3LA 4IEIA 4J2BA 3R8EA 4BG8A 1Y64A 3OYDA 3NDKA 3EKSA 1WLJA 3NHGA 2UXBK 3V9WA 3AO4A 1ATSA 2W6KA 5LJVA 3SV4A 2P9UA 3QIOA 1E3MA 2CH6A 4KH5A 3S9HA 4B9QA 4L8RB 2ZJQL 4C23A 3L2VA 3EKUA 3SUQA 4JKCA 3LZIA 4M3YA 4B1VA 3DXMA 1BA1A 1ZC6A 4F9OA 4FXDA 2E6LA 3HP6A 2NNWA 5JMVA 1TUYA 1DLOA 2QWLA 4WQ4A 4DLEA 4H0TB 3ZSXA 1WSGA 4CZJA 2ZE2A 5HRNA 4Z4EA 5I9EB 2PYLA 4OLBA 4B3MK 4YOVA 2XY8A 3VA3A 2OZSA 2O8FB 5BRHA 3J7YP 2DTUA 4XH1A 1Q9YA 5AQSA 3TTDA 2QKBA 2HW3A 4DCHA 4KTWA 1ILYA 4K0KK 5CE3A 3C7NA 2OPSA 2W41A 3LP2A 5C25A 4DTMA 3TPQA 2F8SA 5LL6Z 3EEQA 3AA2A 4ISEA 4KV8A 3J81O 3DJCA 4DUZK 1TK0A 2GWJA 2JWLA 3UKUA 2KTQA 3E01A 2V7YA 3S41A 2UYTA 3HSTB 3PO4A 3C6UA 3WXJA 2YNFA 4Q5VA 1NK5A 3HTVA 3NF6A 3FLCO 3PO5A 3CCVN 1HQUA 4M3RA 4PA1A 4BREA 3WXKA 1RBUA 3UKUB 1YVNA 5AQWA 1SZ2A 4B9LA 3OYKA 2IGIA 3OJSA 3C6AA 4KHUA 3WNGA 3EZWA 3SQ4A 4DKWA 1Z05A 4FM2A 2KKZA 2G8WA 4FJXA 4GY2B 2QEXN 1MDUB 1ZBLA 3HZ6A 3O3HA 4DFJA 3M6GA 1C0UA 1JLQA 3LAMA 4I2PA 2QTDA 4CEFA 4JI0K 1U2VA 4F2SA 3OS1A 2HSTA 2YHWA 2KHOA 1VQON 3U4LA 1OVYA 2D0AA 5BN9A 2AJQA 2VG7A 1HYSA 2E8AA 4FWMA 4M3UA 5DM7L 1N34K 1QSLA 2EX3A 1JKHA 3LWMA 1EWQA 4FYDA 2NRVA 3O8MA 4V19S 4DG1A 3B6PA 4U7BA 3KKRA 2NLXA 4BGAA 3OBWA 4DTPA 5ELZA 1J5EK 2WOMA 3THXA 4KHQA 1XC3A 2HBKA 4M45A 1QSYA 2HHWA 3WXLA 4KKOA 4A5BA 3DWLA 2QWOA 2E2NA 3MX5A 5HRSA 3DXKB 1SKWA 1QQOA 1UOCA 3K5NA 5IWAK 3H45C 4DQ8A 3HVRA 2IOCA 5EU7A 4AILC 4O8UA 4JLHA 1W7AA 3AVGA 3OYGA 3VTHA 4ISGA 1HNIA 4PKHA 3DI6A 4JKBA 2E5LK 4JHDA 4I6MB 3VEXA 3UKRB 3AO3A 1C0TA 3AA3A 4R5PA 2FLOA 4H03B 2ZJPL 1SL2A 1U04A 4KHPK 4Z4IA 1HPZA 1ZXOA 2DFHA 4DTRA 1VSKA 2X6NA 3KWGA 3SYZA 1GLCG 3ZSVA 4JKHA 3KK1A 3QB0A 1NM1A 4H0YB 1HRHA 4FWSA 5JLHA 5E41A 1HMVA 3HPOA 3ZETB 3T19A 4NXNK 1LW0A 4B9VA 4IXCA 3F9KA 3V1OA 1TYQB 1TUUA 2NUBA 1XHXA 1SUQA 1YVUA 3RR7A 3QERA 3TWHA 2P5OA 4JI7K 1QQMA 4JI4K 1HQEA 2XY6A 3AVCA 3ZT1A 4O55A 4WQ5A 4PKIA 1JLGA 1EQYA 1S6PA 3I0SA 1ASWA 1BCMA 3DAWA 3T1AA 3VEOA 4KH4A 4IJAA 3BF3A 4NCGA 1VQ7N 2XO7A 1E4FT 5CY4A 5B8HA 3PIPL 3B8AX 4JRPA 4JNEA 4DQSA 4B3RK 4CIFA 1TL3A 4WF9L 4K25A 3U3YA 1NJWA 3QESA 4IG0A 3JXUA 2HBLA 2J4RA 3QNNA 2BDPA 3QEIA 5C0YA 4K41A 4DV2K 3V9ZA 4GV9A 4HUGA 5J2QA 1GLJO 2D0BA 3L8BA 2KZZA 3FE1A 2P5GA 3HXMA 5CR4A 3T3FA 1T6CA
chains in the Genus database with same CATH topology
4UQGA 1U4BA 1U49A 4C8OA 4FM1A 4CIEA 1I3AA 4CIGA 3VA0A 4DTUA 5J2PA 4CEZA 1CZBA 4HHTA 1N6QA 1NKCA 4C8LA 4DSIA 2QK9A 3D0PA 2FBTA 5FDLA 3VQ5A 1JLFA 2BANA 4Y1CA 1BIZA 1MU2A 1VSEA 2YNHA 4WE1A 3VN5A 2Z1IA 4AH9A 3CFRA 3O4QA 4M3ZA 3IG1A 4HVJA 2HHXA 5CYQA 3C94A 4G1QA 2P1JA 1C1BA 2ZD1A 2X74A 3C95A 1YTAA 3HPGA 5HBMA 4GMJB 4AHCA 1IKYA 1EKEA 4CJUA 5I42A 4IDKA 4DMNA 1TGOA 4BWJA 1YTUA 1RTHA 4OKJA 1NJYA 1KVCA 2OPQA 4CEAA 4M41A 1Z25A 3HP9A 3L3VA 1RDCA 2KZMA 2HVIA 5J2NA 1ZBIA 4LSNA 3RR8A 4KHWA 2HHVA 3HPHA 4E7KA 4IFVA 4CGIA 3AVHA 3M8QA 3S3MA 1LAVA 4BDZA 1ZBUA 4IBNA 2YKMA 2HB5A 3V9XA 4DQIA 3VQBA 4CHQA 1UWBA 3KTQA 2VWJA 4CHPA 1C0MA 1CXUA 4J2EA 3EZ5A 3SUNA 4LSLA 4DTNA 3F73A 3DOLA 3NGIA 1IH7A 1CXQA 4N76A 3MXJA 1SKRA 3VQEA 3MAQA 1NOYA 3LP3A 3TAGA 1VSFA 5C24A 2A1RA 4DSLA 1F21A 2YHAA 3CM5A 3V81A 4CJKA 1X9SA 2GUIA 4CK2A 4FJIA 4NCBA 3DYAA 1VSLA 4CEOA 1BI4A 4B8CA 1HNVA 3G10A 2YNGA 1I39A 4E7IA 3NH0A 1LV5A 4XIUA 4CK1A 1L3TA 1RNHA 1D8YA 2I5JA 5SZTA 1KVBA 3IS9A 4RW6A 4CJ3A 3K57A 1RCHA 2E4LA 4DWIA 5FRNA 1QE1A 4DSJA 4CHOA 3NF8A 4K8ZA 3KIOA 3AA4A 4Y1DA 4CJWA 2A1SA 3VQ8A 3KK2A 4OKEA 1LWEA 2B4JA 3V1RA 1JXBA 4CJSA 1D9FA 4EZ6A 3CFOA 4KB0A 3K5LA 3V1QA 4CEDA 3EYZA 1VSHA 4FZZA 3QEPA 5D3GA 1QS4A 2FBXA 3OS0A 4B8AB 1NK0A 4KB1A 3K5OA 3SQ0A 1IKVA 2HMIA 3OVNA 4AHUA 1D9DA 2OYQA 4FJNA 1HYVA 4M3TA 4C8MA 3K2PA 1GOCA 4OPKA 4CGGA 4DQRA 4DU3A 1B92A 1NK9A 1NK6A 3TAMA 2F8TA 1KRPA 4OLAA 3ZSQA 1RDAA 4E19A 2B5JA 2D5RA 2RKIA 4RG8A 4TSXA 4F8RA 1G15A 4EZ9A 1D5AA 4FK4A 3AVLA 4LH5A 1EXQA 2IS3A 3NE6A 2KFZA 3DLBA 1Z26A 2LSNA 1JLAA 4IKFA 1A5XA 1RDDA 4O4GA 1BL3A 2O4GA 4CJPA 2Y1IA 1J9AA 2QXFA 1JLEA 3AO5A 3QINA 3NCIA 4CJVA 3K5MA 1KVAA 3ASMA 3HM9A 3SQ1A 1TAUA 4DQQA 1K6YA 4BE0A 4FCYA 3OYBA 4DTXA 4JS5A 4CJ5A 5I3UA 1J5OA 4Z0UA 3NGYA 3ALYA 1QHTA 1TV6A 3MEEA 3VQAA 4FZXC 3QNOA 3LDSA 4LY7A 4H8KA 1UAXA 4I2QA 3OYCA 2RPIA 4CECA 3KKSA 1ASVA 3P5JA 4M3XA 4FW2A 1WSJA 3NGZA 2FBYA 1T05A 1ASUA 1RBRA 2JGUA 3MEGA 4JS4A 1CZ9A 2KQ2A 3KJVA 1LAWA 2G8IA 4PY5A 1QSSA 3L2QA 3H08A 4RW7A 3SUPA 1EP4A 3TAPA 4DU1A 1DTQA 1VSJA 1NKEA 1TL1A 3TI0A 4DU4A 1Y97A 2EHGA 1C6VA 2VWKA 3HVTA 3RTVA 3MXMA 1BQMA 3KK3A 4K8XA 4EP5A 1IG9A 2IAJA 3NF7A 1C1CA 3ZT3A 4DFMA 3NH1A 1NKBA 3M8PA 3SUOA 1RILA 3O3GA 3DLKA 2B6AA 3AA5X 4DFPA 3EY1A 3HJFA 3QIPA 4CHYA 3SV3A 3SQ2A 1SL0A 2ETJA 4J2BA 3OYDA 4B9NA 3PUFA 3NDKA 4FLXA 3IAYA 4KTZA 1WLJA 3NHGA 1WSEA 4N56A 1TKXA 3TANA 3A2FA 3V9WA 4KAZA 3AO4A 5K14A 4B9MA 2VG6A 1X1PA 3G0ZA 3L2UA 4CEBA 3SV4A 4B9UA 2P51A 3ZSZA 3QIOA 5HRPA 5FRMA 2GBZA 3OYMA 2X78A 1ZYQA 4DTJA 3S9HA 4L8RB 1U47A 4FJ8A 3HO1A 4CHNA 2OPPA 1NOZA 4GW6A 4AHTA 4KHSA 4FK2A 3L2VA 3V4IA 3QEXA 3SUQA 1JLBA 3LZIA 4M3YA 3FFIA 1TKDA 4ZTJA 4I9QA 3SCXA 4CERA 1WAJA 1HJRA 3SPYA 2KFNA 3TABA 4DQPA 3KLGA 4BWMA 2VG5A 1XC9A 4FXDA 1HYZA 2E6LA 1XI1A 3HP6A 4B08A 1S5JA 4ELVA 1DLOA 3WNFA 1DTTA 4DLEA 4FLWA 4DF4A 4E7JA 3ZSXA 4FZYA 4CESA 4IFYA 1IKXA 2ZQBA 3HYFA 1WSGA 3PY8A 2ZE2A 4OVLA 5HRNA 1SKSA 1TKTA 1L3SA 4Z4EA 4N5SA 2PYLA 3HT3A 2XRIA 4NYFA 4OLBA 4C8NA 4Z4GA 1BCOA 3RMDA 1B9FA 2IDOA 4Z4HA 5KRSA 1FK9A 2XY7A 1ZBFA 1T7PA 4ELUA 4BE2A 4KREA 1NJZA 2BGGA 3VA3A 2XY8A 2F96A 4CFCA 2OZSA 4FJJA 1LW2A 5KGWA 1RT3A 2ATQA 4B3OA 1RTDA 2DTUA 3OYEA 1Q9YA 1Q9XA 1WSHA 1VRUA 4ID5A 2QKBA 3VQ7A 2HW3A 3S3NA 4HTUA 4KTWA 1XHZA 1VSDA 1NK8A 1TVRA 4OGCA 3JYTA 4JRQA 4FJ9A 3LPUA 3LP1A 3O3FA 3U6FA 1BI4B 4Z4CA 3AVIA 3WNHA 2OPSA 4FJ5A 3LP2A 5C25A 5HLFA 4DTMA 1A5WA 2F8SA 2GV9A 4DSFA 4KV8A 3AA2A 1KFSA 3KD5E 2HNDA 2YNIA 3LAKA 4DFKA 3PX0A 1ITGA 3ZT4A 1TK0A 4CJTA 4ICLA 2KTQA 3E01A 3QO9A 3SZ2A 1RDBA 3HSTB 3PO4A 3C6UA 3VQPA 2G8KA 2RF2A 5T7BA 1UA1A 3MXIA 2YNFA 4Q5VA 1NK5A 1EX4A 3IRXA 4CF8A 2R7YA 3NF6A 1TKZA 4LD0A 3PO5A 2HVHA 1XWLA 1HQUA 4M3RA 1JXEA 4PA1A 4KTQA 4DF8A 3M8SA 1S9EA 5CYMA 4H4MA 3RMAA 1RBUA 4DS4A 3VQ9A 4MQ3A 5DK5A 4OKKA 3I8DA 4B9LA 3OYKA 2IGIA 3DRSA 3OJSA 4KHUA 1GOBA 2YV0X 4CGFA 4C8KA 1Q8IA 3WNGA 3SQ4A 1BHLA 3ZSOA 3O4NA 4FM2A 2G8WA 4FJXA 4N47A 3M8RA 3ZT2A 3L2WA 2KW4A 3NFAA 3ZSYA 3TAFA 3PX6A 3JSMA 3OYHA 3AVKA 1ZBLA 1VSMA 1J54A 1JLCA 4B9TA 3O3HA 4FJ7A 4HCCA 4CGHA 4DFJA 1SV5A 1RT1A 1C0UA 1JLQA 3LAMA 4I2PA 4FJLA 3HL8A 4CJ4A 4CEFA 3OS2A 4CCHA 5KRTA 3SI6A 1QTMA 4CFBA 3ZT0A 3OS1A 2G8UA 4F2SA 4LH4A 4J2DA 4KHYA 4AHSA 3OYAA 4CK3A 3LWLA 4QCLA 1WNSA 2D0AA 3C6TA 2AJQA 2VG7A 4E3SA 1HYSA 2O4IA 4FW1A 5J2MA 3D45A 3VQCA 4ELTA 1VSIA 1KSPA 3KLFA 2Z1GA 1VRTA 4KO0A 4CF1A 1KLNA 4M3UA 3AVJA 1QSLA 4FLUA 2EX3A 3ZCMA 4DLGA 1JKHA 3LWMA 5C42A 4HCBA 4FJHA 4FYDA 3ITHA 1RT7A 3DLGA 3RRHA 3VQ6A 3BGRA 4E7LA 2G8FA 1X9MA 4DG1A 4RW8A 3B6PA 4MFBA 1KTQA 1O1WA 3THVA 2JLEA 3KKRA 4EP4A 2G8HA 3CG7A 1LWFA 4CGJA 1BGXT 4DTPA 4FLZA 3DOKA 1L3VA 2X6SA 4CHZA 3UIQA 2PY5A 4DTOA 1WSFA 4W5TA 5CZ2A 3V6DA 2WOMA 4KHQA 3CYMA 5HP1A 2Z1JA 2W42A 1S6QA 4NYNA 4M45A 4CF9A 3OYJA 4ZTFA 1TK8A 1QSYA 2HHWA 1B9DA 3B6OA 4I7FA 4E1MA 3CFPA 4KKOA 5JS1A 4FLTA 2G8VA 4CGDA 2WONA 5CZ1A 5HRSA 3OYLA 4W5RA 4RW4A 1GOAA 1S9GA 3LANA 3L2RA 1U45A 1SKWA 2OA8A 1UOCA 4O0IA 1KLMA 1U48A 3K5NA 3ULDA 3RWUA 3PX4A 3NH2A 2HNZA 2Y1JA 4DSKA 3HVRA 2IOCA 5EU7A 1S1UA 1IKWA 4N41A 2HHQA 4AILC 1FKPA 4ID1A 4PWDA 1RBSA 4JLHA 1RT6A 3AVGA 3OYGA 4BACA 5DMRA 2E6MA 4YFUA 4Z4FA 4CF2A 1HNIA 3OYNA 3DI6A 5KI6A 3AVAA 4FLYA 4Q0BA 2HHSA 3MEDA 4CE9A 1RBVA 3AVBA 5JS2A 4F4KA 3U3GA 4CJRA 2ITGA 2DY4A 1EETA 1WN7A 3DLHA 1L3UA 4AHRA 3DM2A 3AO3A 3QLHA 4FJMA 1C0TA 4ZHRA 3AA3A 5KGXA 4OJRA 4R5PA 1NJXA 5HROA 4FVMA 5J1EA 1S1VA 4GVMA 2YHBA 1S1TA 1QQCA 4E1NA 4DS5A 4NCAA 1KFDA 1SL2A 3KLHA 4B9SA 1U04A 4O0JA 3SNNA 3NAEA 1RT4A 1RTJA 4PUOA 4Z4IA 1HPZA 2DFHA 4DTRA 1VSKA 1SL1A 3VQDA 1JL1A 3QETA 1S1WA 2X6NA 4YNQA 1R0AA 3SYZA 3LPTA 3KLIA 1TAQA 3ZSVA 2XHBA 2FBVA 4OGEA 1WAFA 2D0CA 3SPZA 3S3OA 3L3UA 1C1AA 4QAGA 3KK1A 3NBPA 1W0HA 2RN2A 4CJLA 4CEEA 3TAEA 2OPRA 4HUEA 4FJGA 4M42A 3V9SA 3AVMA 2HHTA 1HRHA 5E41A 3ZSWA 3PV8A 1HMVA 4RW9A 3HPOA 4KI6A 1T03A 2YKNA 3T19A 3LZJA 3ISNC 1REVA 3NF9A 1IO2A 1LW0A 4FLVA 4B9VA 4F3OA 3F9KA 3VQQA 1J53A 3V1OA 4FM0A 3KLEA 2NUBA 1XHXA 1T8EA 1VK0A 4CJFA 4CJEA 1BQNA 3RRGA 1BIUA 3QEVA 1SUQA 3AO2A 3AO1A 1YVUA 3CM6A 4CFDA 3P83D 3RR7A 3QERA 3CQ8A 3MECA 3TWHA 3P1GA 2P5OA 4O5BA 2HNYA 2IC3A 1N5YA 1S1XA 4W5NA 4BDPA 4KRFA 1CLQA 1RT2A 4E0DA 1HQEA 4CFAA 1NK4A 4O44A 2XY6A 3AVCA 3OJUA 3QEWA 4I9LA 3ZT1A 2OZMA 3I0RA 3TARA 2Q3SA 4O55A 2HHUA 1JLGA 1BISA 4PQUA 1S6PA 3I0SA 1ASWA 4OPJA 1BCMA 3OYIA 4DTSA 3KD1E 2DFEA 3WNEA 3DMJA 5FROA 1RT5A 4CEQA 4FJKA 3T1AA 3ZSRA 3SJJA 4F2RA 4QOZB 4NCGA 3V9UA 4J2AA 3DLEA 1FXXA 2Z1HA 2XO7A 4HUFA 3VQ4A 3DLRA 5CY4A 2XY5A 2FC0A 3HK2A 1JL2A 4JRPA 1A5VA 3LALA 4CJQA 4DQSA 4CIFA 4DSEA 3TAQA 1LWCA 1UA0A 1X9WA 1TL3A 4CF0A 3RMCA 4BE1A 2BE2A 3U3YA 3LP0A 4KHNA 1W9HA 1NJWA 4AHVA 4KPYA 3QESA 4IG3A 4IG0A 5HRRA 4W5QA 3QNNA 3K58A 1L5UA 2BDPA 3QEIA 3OYFA 1TK5A 5KTQA 3OY9A 5SWMA 2PZSA 3AVFA 4FK0A 4M3WA 1RTIA 4BDYA 3V9ZA 4HUGA 5J2QA 4F3TA 3AVNA 4H4OA 1KCFA 3RMBA 2D0BA 2KZZA 3DRRA 3L8BA 3AV9A 2PYJA 1FKOA 4E89A 2P5GA 4KI4A 4KFBA 3TR8A 1YT3A 2QKKA 3HXMA 3K59A 1RBTA 1ZBHA 1WSIA 3T3FA 4E7HA 3DRPA 3BDPA 4W5OA 1NK7A 2DFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UQG A;  1U4B A;  1U49 A;  4C8O A;  4FM1 A;  4CIE A;  1I3A A;  4CIG A;  3VA0 A;  4DTU A;  5J2P A;  4CEZ A;  1CZB A;  4HHT A;  1N6Q A;  1NKC A;  4C8L A;  4DSI A;  2QK9 A;  3D0P A;  2FBT A;  5FDL A;  3VQ5 A;  1JLF A;  2BAN A;  4Y1C A;  1BIZ A;  1MU2 A;  1VSE A;  2YNH A;  4WE1 A;  3VN5 A;  2Z1I A;  4AH9 A;  3CFR A;  3O4Q A;  4M3Z A;  3IG1 A;  4HVJ A;  2HHX A;  5CYQ A;  3C94 A;  4G1Q A;  2P1J A;  1C1B A;  2ZD1 A;  2X74 A;  3C95 A;  1YTA A;  3HPG A;  5HBM A;  4GMJ B;  4AHC A;  1IKY A;  1EKE A;  4CJU A;  5I42 A;  4IDK A;  4DMN A;  1TGO A;  4BWJ A;  1YTU A;  1RTH A;  4OKJ A;  1NJY A;  1KVC A;  2OPQ A;  4CEA A;  4M41 A;  1Z25 A;  3HP9 A;  3L3V A;  1RDC A;  2KZM A;  2HVI A;  5J2N A;  1ZBI A;  4LSN A;  3RR8 A;  4KHW A;  2HHV A;  3HPH A;  4E7K A;  4IFV A;  4CGI A;  3AVH A;  3M8Q A;  3S3M A;  1LAV A;  4BDZ A;  1ZBU A;  4IBN A;  2YKM A;  2HB5 A;  3V9X A;  4DQI A;  3VQB A;  4CHQ A;  1UWB A;  3KTQ A;  2VWJ A;  4CHP A;  1C0M A;  1CXU A;  4J2E A;  3EZ5 A;  3SUN A;  4LSL A;  4DTN A;  3F73 A;  3DOL A;  3NGI A;  1IH7 A;  1CXQ A;  4N76 A;  3MXJ A;  1SKR A;  3VQE A;  3MAQ A;  1NOY A;  3LP3 A;  3TAG A;  1VSF A;  5C24 A;  2A1R A;  4DSL A;  1F21 A;  2YHA A;  3CM5 A;  3V81 A;  4CJK A;  1X9S A;  2GUI A;  4CK2 A;  4FJI A;  4NCB A;  3DYA A;  1VSL A;  4CEO A;  1BI4 A;  4B8C A;  1HNV A;  3G10 A;  2YNG A;  1I39 A;  4E7I A;  3NH0 A;  1LV5 A;  4XIU A;  4CK1 A;  1L3T A;  1RNH A;  1D8Y A;  2I5J A;  5SZT A;  1KVB A;  3IS9 A;  4RW6 A;  4CJ3 A;  3K57 A;  1RCH A;  2E4L A;  4DWI A;  5FRN A;  1QE1 A;  4DSJ A;  4CHO A;  3NF8 A;  4K8Z A;  3KIO A;  3AA4 A;  4Y1D A;  4CJW A;  2A1S A;  3VQ8 A;  3KK2 A;  4OKE A;  1LWE A;  2B4J A;  3V1R A;  1JXB A;  4CJS A;  1D9F A;  4EZ6 A;  3CFO A;  4KB0 A;  3K5L A;  3V1Q A;  4CED A;  3EYZ A;  1VSH A;  4FZZ A;  3QEP A;  5D3G A;  1QS4 A;  2FBX A;  3OS0 A;  4B8A B;  1NK0 A;  4KB1 A;  3K5O A;  3SQ0 A;  1IKV A;  2HMI A;  3OVN A;  4AHU A;  1D9D A;  2OYQ A;  4FJN A;  1HYV A;  4M3T A;  4C8M A;  3K2P A;  1GOC A;  4OPK A;  4CGG A;  4DQR A;  4DU3 A;  1B92 A;  1NK9 A;  1NK6 A;  3TAM A;  2F8T A;  1KRP A;  4OLA A;  3ZSQ A;  1RDA A;  4E19 A;  2B5J A;  2D5R A;  2RKI A;  4RG8 A;  4TSX A;  4F8R A;  1G15 A;  4EZ9 A;  1D5A A;  4FK4 A;  3AVL A;  4LH5 A;  1EXQ A;  2IS3 A;  3NE6 A;  2KFZ A;  3DLB A;  1Z26 A;  2LSN A;  1JLA A;  4IKF A;  1A5X A;  1RDD A;  4O4G A;  1BL3 A;  2O4G A;  4CJP A;  2Y1I A;  1J9A A;  2QXF A;  1JLE A;  3AO5 A;  3QIN A;  3NCI A;  4CJV A;  3K5M A;  1KVA A;  3ASM A;  3HM9 A;  3SQ1 A;  1TAU A;  4DQQ A;  1K6Y A;  4BE0 A;  4FCY A;  3OYB A;  4DTX A;  4JS5 A;  4CJ5 A;  5I3U A;  1J5O A;  4Z0U A;  3NGY A;  3ALY A;  1QHT A;  1TV6 A;  3MEE A;  3VQA A;  4FZX C;  3QNO A;  3LDS A;  4LY7 A;  4H8K A;  1UAX A;  4I2Q A;  3OYC A;  2RPI A;  4CEC A;  3KKS A;  1ASV A;  3P5J A;  4M3X A;  4FW2 A;  1WSJ A;  3NGZ A;  2FBY A;  1T05 A;  1ASU A;  1RBR A;  2JGU A;  3MEG A;  4JS4 A;  1CZ9 A;  2KQ2 A;  3KJV A;  1LAW A;  2G8I A;  4PY5 A;  1QSS A;  3L2Q A;  3H08 A;  4RW7 A;  3SUP A;  1EP4 A;  3TAP A;  4DU1 A;  1DTQ A;  1VSJ A;  1NKE A;  1TL1 A;  3TI0 A;  4DU4 A;  1Y97 A;  2EHG A;  1C6V A;  2VWK A;  3HVT A;  3RTV A;  3MXM A;  1BQM A;  3KK3 A;  4K8X A;  4EP5 A;  1IG9 A;  2IAJ A;  3NF7 A;  1C1C A;  3ZT3 A;  4DFM A;  3NH1 A;  1NKB A;  3M8P A;  3SUO A;  1RIL A;  3O3G A;  3DLK A;  2B6A A;  3AA5 X;  4DFP A;  3EY1 A;  3HJF A;  3QIP A;  4CHY A;  3SV3 A;  3SQ2 A;  1SL0 A;  2ETJ A;  4J2B A;  3OYD A;  4B9N A;  3PUF A;  3NDK A;  4FLX A;  3IAY A;  4KTZ A;  1WLJ A;  3NHG A;  1WSE A;  4N56 A;  1TKX A;  3TAN A;  3A2F A;  3V9W A;  4KAZ A;  3AO4 A;  5K14 A;  4B9M A;  2VG6 A;  1X1P A;  3G0Z A;  3L2U A;  4CEB A;  3SV4 A;  4B9U A;  2P51 A;  3ZSZ A;  3QIO A;  5HRP A;  5FRM A;  2GBZ A;  3OYM A;  2X78 A;  1ZYQ A;  4DTJ A;  3S9H A;  4L8R B;  1U47 A;  4FJ8 A;  3HO1 A;  4CHN A;  2OPP A;  1NOZ A;  4GW6 A;  4AHT A;  4KHS A;  4FK2 A;  3L2V A;  3V4I A;  3QEX A;  3SUQ A;  1JLB A;  3LZI A;  4M3Y A;  3FFI A;  1TKD A;  4ZTJ A;  4I9Q A;  3SCX A;  4CER A;  1WAJ A;  1HJR A;  3SPY A;  2KFN A;  3TAB A;  4DQP A;  3KLG A;  4BWM A;  2VG5 A;  1XC9 A;  4FXD A;  1HYZ A;  2E6L A;  1XI1 A;  3HP6 A;  4B08 A;  1S5J A;  4ELV A;  1DLO A;  3WNF A;  1DTT A;  4DLE A;  4FLW A;  4DF4 A;  4E7J A;  3ZSX A;  4FZY A;  4CES A;  4IFY A;  1IKX A;  2ZQB A;  3HYF A;  1WSG A;  3PY8 A;  2ZE2 A;  4OVL A;  5HRN A;  1SKS A;  1TKT A;  1L3S A;  4Z4E A;  4N5S A;  2PYL A;  3HT3 A;  2XRI A;  4NYF A;  4OLB A;  4C8N A;  4Z4G A;  1BCO A;  3RMD A;  1B9F A;  2IDO A;  4Z4H A;  5KRS A;  1FK9 A;  2XY7 A;  1ZBF A;  1T7P A;  4ELU A;  4BE2 A;  4KRE A;  1NJZ A;  2BGG A;  3VA3 A;  2XY8 A;  2F96 A;  4CFC A;  2OZS A;  4FJJ A;  1LW2 A;  5KGW A;  1RT3 A;  2ATQ A;  4B3O A;  1RTD A;  2DTU A;  3OYE A;  1Q9Y A;  1Q9X A;  1WSH A;  1VRU A;  4ID5 A;  2QKB A;  3VQ7 A;  2HW3 A;  3S3N A;  4HTU A;  4KTW A;  1XHZ A;  1VSD A;  1NK8 A;  1TVR A;  4OGC A;  3JYT A;  4JRQ A;  4FJ9 A;  3LPU A;  3LP1 A;  3O3F A;  3U6F A;  1BI4 B;  4Z4C A;  3AVI A;  3WNH A;  2OPS A;  4FJ5 A;  3LP2 A;  5C25 A;  5HLF A;  4DTM A;  1A5W A;  2F8S A;  2GV9 A;  4DSF A;  4KV8 A;  3AA2 A;  1KFS A;  3KD5 E;  2HND A;  2YNI A;  3LAK A;  4DFK A;  3PX0 A;  1ITG A;  3ZT4 A;  1TK0 A;  4CJT A;  4ICL A;  2KTQ A;  3E01 A;  3QO9 A;  3SZ2 A;  1RDB A;  3HST B;  3PO4 A;  3C6U A;  3VQP A;  2G8K A;  2RF2 A;  5T7B A;  1UA1 A;  3MXI A;  2YNF A;  4Q5V A;  1NK5 A;  1EX4 A;  3IRX A;  4CF8 A;  2R7Y A;  3NF6 A;  1TKZ A;  4LD0 A;  3PO5 A;  2HVH A;  1XWL A;  1HQU A;  4M3R A;  1JXE A;  4PA1 A;  4KTQ A;  4DF8 A;  3M8S A;  1S9E A;  5CYM A;  4H4M A;  3RMA A;  1RBU A;  4DS4 A;  3VQ9 A;  4MQ3 A;  5DK5 A;  4OKK A;  3I8D A;  4B9L A;  3OYK A;  2IGI A;  3DRS A;  3OJS A;  4KHU A;  1GOB A;  2YV0 X;  4CGF A;  4C8K A;  1Q8I A;  3WNG A;  3SQ4 A;  1BHL A;  3ZSO A;  3O4N A;  4FM2 A;  2G8W A;  4FJX A;  4N47 A;  3M8R A;  3ZT2 A;  3L2W A;  2KW4 A;  3NFA A;  3ZSY A;  3TAF A;  3PX6 A;  3JSM A;  3OYH A;  3AVK A;  1ZBL A;  1VSM A;  1J54 A;  1JLC A;  4B9T A;  3O3H A;  4FJ7 A;  4HCC A;  4CGH A;  4DFJ A;  1SV5 A;  1RT1 A;  1C0U A;  1JLQ A;  3LAM A;  4I2P A;  4FJL A;  3HL8 A;  4CJ4 A;  4CEF A;  3OS2 A;  4CCH A;  5KRT A;  3SI6 A;  1QTM A;  4CFB A;  3ZT0 A;  3OS1 A;  2G8U A;  4F2S A;  4LH4 A;  4J2D A;  4KHY A;  4AHS A;  3OYA A;  4CK3 A;  3LWL A;  4QCL A;  1WNS A;  2D0A A;  3C6T A;  2AJQ A;  2VG7 A;  4E3S A;  1HYS A;  2O4I A;  4FW1 A;  5J2M A;  3D45 A;  3VQC A;  4ELT A;  1VSI A;  1KSP A;  3KLF A;  2Z1G A;  1VRT A;  4KO0 A;  4CF1 A;  1KLN A;  4M3U A;  3AVJ A;  1QSL A;  4FLU A;  2EX3 A;  3ZCM A;  4DLG A;  1JKH A;  3LWM A;  5C42 A;  4HCB A;  4FJH A;  4FYD A;  3ITH A;  1RT7 A;  3DLG A;  3RRH A;  3VQ6 A;  3BGR A;  4E7L A;  2G8F A;  1X9M A;  4DG1 A;  4RW8 A;  3B6P A;  4MFB A;  1KTQ A;  1O1W A;  3THV A;  2JLE A;  3KKR A;  4EP4 A;  2G8H A;  3CG7 A;  1LWF A;  4CGJ A;  1BGX T;  4DTP A;  4FLZ A;  3DOK A;  1L3V A;  2X6S A;  4CHZ A;  3UIQ A;  2PY5 A;  4DTO A;  1WSF A;  4W5T A;  5CZ2 A;  3V6D A;  2WOM A;  4KHQ A;  3CYM A;  5HP1 A;  2Z1J A;  2W42 A;  1S6Q A;  4NYN A;  4M45 A;  4CF9 A;  3OYJ A;  4ZTF A;  1TK8 A;  1QSY A;  2HHW A;  1B9D A;  3B6O A;  4I7F A;  4E1M A;  3CFP A;  4KKO A;  5JS1 A;  4FLT A;  2G8V A;  4CGD A;  2WON A;  5CZ1 A;  5HRS A;  3OYL A;  4W5R A;  4RW4 A;  1GOA A;  1S9G A;  3LAN A;  3L2R A;  1U45 A;  1SKW A;  2OA8 A;  1UOC A;  4O0I A;  1KLM A;  1U48 A;  3K5N A;  3ULD A;  3RWU A;  3PX4 A;  3NH2 A;  2HNZ A;  2Y1J A;  4DSK A;  3HVR A;  2IOC A;  5EU7 A;  1S1U A;  1IKW A;  4N41 A;  2HHQ A;  4AIL C;  1FKP A;  4ID1 A;  4PWD A;  1RBS A;  4JLH A;  1RT6 A;  3AVG A;  3OYG A;  4BAC A;  5DMR A;  2E6M A;  4YFU A;  4Z4F A;  4CF2 A;  1HNI A;  3OYN A;  3DI6 A;  5KI6 A;  3AVA A;  4FLY A;  4Q0B A;  2HHS A;  3MED A;  4CE9 A;  1RBV A;  3AVB A;  5JS2 A;  4F4K A;  3U3G A;  4CJR A;  2ITG A;  2DY4 A;  1EET A;  1WN7 A;  3DLH A;  1L3U A;  4AHR A;  3DM2 A;  3AO3 A;  3QLH A;  4FJM A;  1C0T A;  4ZHR A;  3AA3 A;  5KGX A;  4OJR A;  4R5P A;  1NJX A;  5HRO A;  4FVM A;  5J1E A;  1S1V A;  4GVM A;  2YHB A;  1S1T A;  1QQC A;  4E1N A;  4DS5 A;  4NCA A;  1KFD A;  1SL2 A;  3KLH A;  4B9S A;  1U04 A;  4O0J A;  3SNN A;  3NAE A;  1RT4 A;  1RTJ A;  4PUO A;  4Z4I A;  1HPZ A;  2DFH A;  4DTR A;  1VSK A;  1SL1 A;  3VQD A;  1JL1 A;  3QET A;  1S1W A;  2X6N A;  4YNQ A;  1R0A A;  3SYZ A;  3LPT A;  3KLI A;  1TAQ A;  3ZSV A;  2XHB A;  2FBV A;  4OGE A;  1WAF A;  2D0C A;  3SPZ A;  3S3O A;  3L3U A;  1C1A A;  4QAG A;  3KK1 A;  3NBP A;  1W0H A;  2RN2 A;  4CJL A;  4CEE A;  3TAE A;  2OPR A;  4HUE A;  4FJG A;  4M42 A;  3V9S A;  3AVM A;  2HHT A;  1HRH A;  5E41 A;  3ZSW A;  3PV8 A;  1HMV A;  4RW9 A;  3HPO A;  4KI6 A;  1T03 A;  2YKN A;  3T19 A;  3LZJ A;  3ISN C;  1REV A;  3NF9 A;  1IO2 A;  1LW0 A;  4FLV A;  4B9V A;  4F3O A;  3F9K A;  3VQQ A;  1J53 A;  3V1O A;  4FM0 A;  3KLE A;  2NUB A;  1XHX A;  1T8E A;  1VK0 A;  4CJF A;  4CJE A;  1BQN A;  3RRG A;  1BIU A;  3QEV A;  1SUQ A;  3AO2 A;  3AO1 A;  1YVU A;  3CM6 A;  4CFD A;  3P83 D;  3RR7 A;  3QER A;  3CQ8 A;  3MEC A;  3TWH A;  3P1G A;  2P5O A;  4O5B A;  2HNY A;  2IC3 A;  1N5Y A;  1S1X A;  4W5N A;  4BDP A;  4KRF A;  1CLQ A;  1RT2 A;  4E0D A;  1HQE A;  4CFA A;  1NK4 A;  4O44 A;  2XY6 A;  3AVC A;  3OJU A;  3QEW A;  4I9L A;  3ZT1 A;  2OZM A;  3I0R A;  3TAR A;  2Q3S A;  4O55 A;  2HHU A;  1JLG A;  1BIS A;  4PQU A;  1S6P A;  3I0S A;  1ASW A;  4OPJ A;  1BCM A;  3OYI A;  4DTS A;  3KD1 E;  2DFE A;  3WNE A;  3DMJ A;  5FRO A;  1RT5 A;  4CEQ A;  4FJK A;  3T1A A;  3ZSR A;  3SJJ A;  4F2R A;  4QOZ B;  4NCG A;  3V9U A;  4J2A A;  3DLE A;  1FXX A;  2Z1H A;  2XO7 A;  4HUF A;  3VQ4 A;  3DLR A;  5CY4 A;  2XY5 A;  2FC0 A;  3HK2 A;  1JL2 A;  4JRP A;  1A5V A;  3LAL A;  4CJQ A;  4DQS A;  4CIF A;  4DSE A;  3TAQ A;  1LWC A;  1UA0 A;  1X9W A;  1TL3 A;  4CF0 A;  3RMC A;  4BE1 A;  2BE2 A;  3U3Y A;  3LP0 A;  4KHN A;  1W9H A;  1NJW A;  4AHV A;  4KPY A;  3QES A;  4IG3 A;  4IG0 A;  5HRR A;  4W5Q A;  3QNN A;  3K58 A;  1L5U A;  2BDP A;  3QEI A;  3OYF A;  1TK5 A;  5KTQ A;  3OY9 A;  5SWM A;  2PZS A;  3AVF A;  4FK0 A;  4M3W A;  1RTI A;  4BDY A;  3V9Z A;  4HUG A;  5J2Q A;  4F3T A;  3AVN A;  4H4O A;  1KCF A;  3RMB A;  2D0B A;  2KZZ A;  3DRR A;  3L8B A;  3AV9 A;  2PYJ A;  1FKO A;  4E89 A;  2P5G A;  4KI4 A;  4KFB A;  3TR8 A;  1YT3 A;  2QKK A;  3HXM A;  3K59 A;  1RBT A;  1ZBH A;  1WSI A;  3T3F A;  4E7H A;  3DRP A;  3BDP A;  4W5O A;  1NK7 A;  2DFF A; 
#chains in the Genus database with same CATH topology
 4ISF A;  1U49 A;  1Q7Y O;  4H0V B;  4IZ9 A;  1I3A A;  5J2P A;  2QK9 A;  5BRD A;  3PSI A;  5FPM A;  1NKC A;  3A5O C;  4DSI A;  1N33 K;  1NJI O;  1JCE A;  4Y1C A;  1BIZ A;  3IG1 A;  4G1Q A;  2P1J A;  4BRO A;  3HPG A;  4GMJ B;  1RTH A;  4OKJ A;  4ILG B;  4CEA A;  1RDC A;  1ZBI A;  4KHW A;  1NGD A;  2CH5 A;  4IFV A;  3M8Q A;  4A5A A;  2I7P A;  1LAV A;  4IBN A;  3RVC A;  2YKM A;  2BH1 A;  3LDQ A;  4Z94 A;  3LL3 A;  3VQB A;  4PKG A;  3M3Z A;  4CHQ A;  1C0M A;  5E26 A;  4J2E A;  3SUN A;  4JKA A;  2D4W A;  3F73 A;  3NGI A;  3J8A A;  1FJG K;  1IH7 A;  4X62 K;  4N76 A;  1SKR A;  3MAQ A;  4DV7 K;  2YHA A;  3CM5 A;  2UUB K;  2F4V K;  3DYA A;  4CEO A;  2YNG A;  1I39 A;  4RW6 A;  4JK8 A;  5EXW A;  1NNE A;  4JYA K;  5AZI B;  4EIA A;  3MWP A;  4K8Z A;  4Y1D A;  4CJW A;  1NMN A;  2A1S A;  4FSV A;  3CFO A;  4LF6 K;  3K0S A;  4H5N A;  3O08 A;  4FWK A;  5EY4 A;  3QEP A;  5D3G A;  4B8A B;  4KB1 A;  1VQP N;  1QHA A;  2Q0R A;  4AHU A;  4FJN A;  5BR9 A;  2IVP A;  4CGG A;  4DQR A;  1B92 A;  5F1X A;  4OLA A;  1RDA A;  4E19 A;  1GLA G;  1YF5 L;  4RG8 A;  4F8R A;  2E20 A;  1G15 A;  4EZ9 A;  3HOS A;  1EXQ A;  4H5W A;  2CGJ A;  4IO9 L;  1A5X A;  1RDD A;  3J80 O;  4DV6 K;  3TU5 A;  3NCI A;  2O8B A;  1KVA A;  4DQQ A;  3J7A P;  1J5O A;  4DHY A;  4CJ5 A;  3BUZ B;  4FZX C;  2HBM A;  3VEZ A;  3AGK A;  3LDS A;  5JIC A;  2RPI A;  1ASV A;  4UY8 O;  1WSJ A;  3NGZ A;  3C0B A;  2IIR A;  3CJC A;  2P9N B;  3KJV A;  1QSS A;  4PL7 A;  2ASM A;  3L2Q A;  5M1Q A;  4RW7 A;  1BOT O;  3SUP A;  3F2K A;  3TAP A;  5KPR A;  1NLV A;  1VSJ A;  4EHU A;  1KXP A;  2VQE K;  4IFE A;  1Y97 A;  3JAM O;  4EHT A;  2EWS A;  1GLD G;  4K8X A;  3CC2 N;  2VGN A;  2IAJ A;  2GEL A;  3NF7 A;  4DFP A;  1P90 A;  2FSN A;  3EY1 A;  3HJF A;  4BRF A;  3SV3 A;  1V4T A;  3R1X A;  5LMN K;  4MDA A;  4FLX A;  1RGI A;  1WSE A;  4GKJ K;  1VAZ A;  1HKG A;  1X1P A;  3G0Z A;  3L2U A;  3ZSZ A;  2ZGZ A;  5FRM A;  2GBZ A;  2X78 A;  4CHN A;  1NOZ A;  4OO1 J;  4BC3 A;  3CIP A;  4KHS A;  3QEX A;  5AQJ A;  2ZM6 K;  3E9P A;  3SCX A;  1HJR A;  4JKE A;  4DQP A;  3KLG A;  1S5J A;  3DLL L;  4ELV A;  4LFC K;  3WNF A;  4JI5 K;  3PIO L;  1HLU A;  4FZY A;  4IFY A;  1BCO A;  3MK6 A;  3WUH A;  4BR4 A;  1B9F A;  2IDO A;  2XY7 A;  1FK9 A;  4KRE A;  5AQR A;  2OCE A;  4FJJ A;  3SAF A;  1XQS C;  2F9T A;  5KGW A;  3HBT A;  2P9S B;  5BPL A;  4QS7 A;  1RTD A;  4O5F A;  4ILJ A;  4JK9 A;  1WSH A;  4IOC L;  1DKG D;  3VPZ A;  1VSD A;  4JKF A;  4M7Y A;  3O80 A;  1BI4 B;  4Z4C A;  1HPM A;  5FPE A;  5HLF A;  3R9P A;  2GV9 A;  4DSF A;  3THY A;  1KFS A;  4BG9 A;  1N36 K;  3KD5 E;  4DFK A;  1IBM K;  1ITG A;  2P9I B;  3O9T A;  1RDB A;  4A57 A;  4BRA A;  2RF2 A;  5T7B A;  4NB4 A;  1TKZ A;  2HVH A;  1HX1 A;  5GAG P;  1JXE A;  4DF8 A;  4CBX A;  5CYM A;  4H4M A;  3RMA A;  3CPE A;  2AA4 A;  5DK5 A;  3CCQ N;  3I8D A;  3ZX3 A;  4K43 A;  2YV0 X;  4C8K A;  1MWM A;  4IEE A;  1BHL A;  3ZSO A;  3O4N A;  3CXC M;  3M8R A;  3TAF A;  3L2W A;  3PX6 A;  4LF5 K;  3JSM A;  3OYH A;  5GAD P;  1IV0 A;  4FWR A;  1BU6 O;  4B9T A;  3VET A;  5JLF A;  1SV5 A;  3OS2 A;  2YJF A;  1QTM A;  4J2D A;  4AHS A;  3LWL A;  1WNS A;  3MCA B;  2E1Z A;  4E3S A;  2O4I A;  4AQY K;  5J2M A;  4ELT A;  3CI5 A;  2YJE A;  1KLN A;  1VRT A;  4CF1 A;  3WQT A;  2HF4 A;  3AVJ A;  4FLU A;  5C42 A;  4PHT X;  1XMQ K;  3RRH A;  4BR5 A;  4E7L A;  2G8F A;  2NRT A;  2O8C B;  3SMP A;  2VQF K;  3A5M C;  3CG7 A;  4BGB A;  5LY3 A;  3SJH A;  4CGJ A;  4FLZ A;  3DOK A;  4CHZ A;  3UIQ A;  4JD2 A;  5HP1 A;  1BA0 A;  3HSC A;  1B9D A;  2YHY A;  3B6O A;  3CFP A;  3JS6 A;  1OH6 A;  4B1W B;  3H1Q A;  1N32 K;  5CZ1 A;  1S9G A;  2P9U B;  3H3N O;  5TKY A;  1U48 A;  1YUW A;  1VQ4 N;  3ULD A;  3PX4 A;  4DSK A;  3BZK A;  2HOE A;  4CD3 A;  1S1U A;  1IKW A;  4WFB L;  5GIP A;  4IJN A;  5KQD A;  1RBS A;  2ZJR L;  1BUP A;  1NU0 A;  4BAC A;  4CF2 A;  5KI6 A;  3AVA A;  4Q0B A;  4CE9 A;  1RBV A;  3AVB A;  3DXM B;  3U3G A;  3OBY A;  4CJR A;  1WN7 A;  1L3U A;  3ZEU A;  3DM2 A;  4BR0 A;  4YOX A;  4FJM A;  3O9R A;  3T7Z A;  5KGX A;  5AQY A;  4DS5 A;  3CHW A;  4BRI A;  4NCA A;  1NGG A;  2Q31 A;  3VGK A;  1KFD A;  4HTL A;  4DR1 K;  4O0J A;  4FPA A;  2DPN A;  3NAE A;  3CPW M;  2PBD A;  3WXM B;  4WQ5 C;  1DT9 A;  1WBD A;  3ZEU B;  4M7X A;  3QBX A;  3S3O A;  4OGE A;  3BP8 A;  3SPZ A;  1C1A A;  4B3S K;  3I33 A;  3NBP A;  4M42 A;  4HUE A;  5C15 A;  3C7N B;  2FSJ A;  4RW9 A;  2V7Z A;  4A2B A;  3NF9 A;  1IO2 A;  5E84 A;  3MN7 A;  1J53 A;  4FM0 A;  4A62 A;  4DB3 A;  4NO7 A;  1VK0 A;  4CJE A;  1BIU A;  3AO1 A;  3CM6 A;  3WT0 A;  5EVZ A;  2HNY A;  4W5N A;  1K8K A;  2JWK A;  4BDP A;  1CLQ A;  4BRK A;  1RT2 A;  4CFA A;  1NK4 A;  4O44 A;  2OZM A;  3WEE A;  4BR2 A;  3PLA A;  4PQU A;  4OPJ A;  1VQ8 N;  2DFE A;  3WNE A;  4JEP A;  3ZSR A;  4F2R A;  1RFQ A;  3V9U A;  3DLE A;  4HUF A;  2XY5 A;  4CZI A;  1NMD A;  3CD6 N;  3LAL A;  1UA0 A;  5AZJ A;  3RMC A;  3NVK A;  4BE1 A;  1EO1 A;  3CJ9 A;  4IG3 A;  2P9K A;  1L5U A;  2ZF5 O;  2HHH K;  4O8K A;  1U2V B;  1TK5 A;  3OY9 A;  5SWM A;  2PZS A;  3AVF A;  1KD1 O;  3C65 A;  5M1P A;  5AQH A;  1M1K O;  3RMB A;  4A2A A;  4DR7 K;  2PYJ A;  4E89 A;  5H1S Q;  4KFB A;  3TR8 A;  3O9S A;  1HNX K;  1KAX A;  3CC4 N;  1ZBH A;  4E7H A;  4W5O A;  2O8D A;  1YJW N;  1U4B A;  4YDU A;  1T3V A;  4FM1 A;  3CJA A;  3HM8 A;  4R79 A;  2WFB A;  4CZM A;  4DTU A;  1N6Q A;  2OTJ N;  1CZB A;  3VMF B;  4FWP A;  3SBG A;  2FBT A;  4BR7 A;  1JLF A;  2BAN A;  4BC2 A;  1MU2 A;  1VSE A;  2YNH A;  3CFR A;  2GEM A;  2NRZ A;  3CQY A;  4HVJ A;  4B1Y B;  3C94 A;  2HHX A;  2ZD1 A;  3ZX2 A;  5HBM A;  4AHC A;  3THX B;  1EKE A;  1S22 A;  5TKW A;  3IMX A;  4BRQ A;  2E2Q A;  4M41 A;  3HP9 A;  3L3V A;  5CHI A;  3CCL N;  2HVI A;  3RR8 A;  2HHV A;  4E7K A;  3F9M A;  3SMS A;  4GV3 A;  2HB5 A;  2Q36 A;  3V9X A;  1C0F A;  2QWN A;  3L6Q A;  5A2Q O;  4CHP A;  1CXU A;  4FWQ A;  4LSL A;  1NGI A;  3FZF A;  1VQK N;  3DOL A;  2E2P A;  4J8F A;  3TAG A;  4JHD B;  5C24 A;  4LF8 K;  4ILH A;  3V81 A;  4CK2 A;  1NGE A;  5AQZ A;  4MLE A;  3G10 A;  4CK1 A;  5AJ3 K;  5SZT A;  3IS9 A;  5AQK A;  4DWI A;  5FRN A;  2Q1N A;  1QE1 A;  4CZF A;  3KK2 A;  3AA4 A;  1LWE A;  1WB9 A;  3J7Z O;  3V1R A;  4EZ6 A;  1VHX A;  3CJB A;  3V1Q A;  5AQX A;  4IO8 A;  1VSH A;  4FZZ A;  3NVM A;  3KWI A;  2UUC K;  1XNQ K;  4JI2 K;  1D9D A;  1HYV A;  4M3T A;  1GOC A;  3T1Y K;  3TAM A;  1X3M A;  2F8T A;  2D5R A;  2RKI A;  4TSX A;  4HWI A;  1D5A A;  3AAP A;  2KFZ A;  3CJ7 A;  3SLC A;  4DR2 K;  4CJP A;  4OX9 K;  3ASM A;  3HM9 A;  3SQ1 A;  4BE0 A;  3OYB A;  4JS5 A;  5M1N A;  3VQA A;  4LY7 A;  3OYC A;  2PAV A;  3KKS A;  3P5J A;  4FW2 A;  3VOV A;  5AQO A;  1IJJ A;  1IBL K;  5EX5 A;  3RSE A;  5AQM A;  1CZ9 A;  4PY5 A;  1DGK N;  1EP4 A;  2A5X A;  4BRL A;  2O8E A;  1TL1 A;  3LDP A;  3O9U A;  3ENB A;  2VWK A;  4BQL A;  2A3Z A;  4BQZ A;  3U9Z A;  1C1C A;  1K9M O;  3NH1 A;  1NKB A;  3M8P A;  3SUO A;  3GDQ A;  3O3G A;  5JVG L;  2B6A A;  1SL0 A;  2ZWH A;  3GBT A;  4JI1 K;  3MN9 A;  3IAY A;  1RDW X;  4KTZ A;  2QXL A;  4N56 A;  1TKX A;  3CME N;  3SAH A;  3THW A;  4B9M A;  2VG6 A;  3MN6 A;  3CMA N;  2ASO A;  3AAR A;  5HRP A;  4RTF D;  1ZYQ A;  3A0I X;  4DTJ A;  4DUY K;  1U47 A;  3HO1 A;  2IVO A;  2OPP A;  1YJ9 N;  4FK2 A;  1YHQ N;  3V4I A;  3VER A;  3CQX A;  3FFI A;  2A6A A;  4I9Q A;  1ATR A;  3C6H A;  2KFN A;  2VG5 A;  1ESV A;  2H3G X;  5AQV A;  1XI1 A;  1M90 O;  4LF9 K;  4CD1 A;  4LF7 K;  1DTT A;  4FLW A;  4DF4 A;  5AQL A;  2FXU A;  1IKX A;  3HYF A;  2QWP A;  4DV4 K;  4NXM K;  2XRI A;  4Z4G A;  3RMD A;  5KRS A;  3KHY A;  1T7P A;  4ELU A;  4BE2 A;  2F96 A;  4CFC A;  3CCE N;  1LW2 A;  1RT3 A;  4B3O A;  1Q9X A;  1SQK A;  1VRU A;  4ID5 A;  3S3N A;  1HNZ K;  4OGC A;  4JRQ A;  3LPU A;  3U6F A;  3AVI A;  4FJ5 A;  4X65 K;  3L4I A;  1A5W A;  3VGM A;  4WYB A;  5GAH P;  2YNI A;  3LAK A;  4BRP A;  2YX6 A;  3MX2 A;  4ICL A;  4LC9 B;  4EFH A;  1FW6 A;  3SZ2 A;  3VQP A;  2G8K A;  3UB5 A;  2UXD K;  1JCF A;  4NLC A;  4CBW A;  1EX4 A;  3IRX A;  4CF8 A;  2R7Y A;  3T1H K;  4FL9 A;  1QZ5 A;  4JV5 K;  1XWL A;  3SK3 A;  2P9L A;  4KTQ A;  1S9E A;  1N8R O;  2VGM A;  4MQ3 A;  4GVE A;  4OKK A;  3DRS A;  2V52 B;  3Q7B A;  2YI1 A;  3ZT2 A;  2V51 B;  3NFA A;  3QFU A;  4CVN E;  2D1K A;  3AVK A;  2A41 A;  2O8B B;  4PL8 A;  1VSM A;  1JLC A;  4FJ7 A;  3OHR A;  1EWR A;  4HCC A;  4JKD A;  3HL8 A;  4CJ4 A;  4CFB A;  3ZT0 A;  1K8A O;  4LH4 A;  4KHY A;  5F0X A;  4CK3 A;  4QCL A;  4LFB K;  3U9D A;  3C6T A;  3QBW A;  3LM9 A;  3A5L C;  2PFU A;  4E1J A;  3VQC A;  3D2F A;  2Z1G A;  4KO0 A;  4YOT A;  4HCB A;  4QS8 A;  2W6L A;  1OH7 A;  3E1Y A;  1NWK A;  3VQ6 A;  4YOY A;  1O1W A;  2JLE A;  4EP4 A;  1XNR K;  3H3O B;  1LWF A;  1BGX T;  3A5N C;  2X6S A;  2PY5 A;  1WSF A;  4B1X B;  4H5T A;  4CF9 A;  1TK8 A;  4E1M A;  1HR0 K;  5JS1 A;  1BO5 O;  2P9P A;  2G8V A;  4CGD A;  4H0O A;  4FWN A;  3L0Q A;  4RW4 A;  3L2R A;  1Q81 O;  4O0I A;  4DR3 K;  1P8Z A;  4YOR A;  2Y1J A;  4FPB A;  2HHQ A;  1FKP A;  4ID1 A;  3I8B A;  3O1B A;  3W3D A;  5M1F A;  4BRC A;  3E66 A;  2E6M A;  4YFU A;  4MDB A;  3OYN A;  4GV6 A;  3EN9 A;  5JS2 A;  4CI6 A;  3EL2 A;  3ULE A;  3DLH A;  4JI3 K;  3QLH A;  4AM6 A;  4ZHR A;  4OJR A;  1NJX A;  5HRO A;  1I94 K;  5J1E A;  3CCR N;  3G71 N;  4GVM A;  1S1T A;  4E1N A;  4JI8 K;  1NBW A;  3SNN A;  1RT4 A;  1RTJ A;  4BVP A;  2FF6 A;  5AQN A;  3QET A;  1NGB A;  1S1W A;  4YNQ A;  5KQ8 A;  1TAQ A;  2XHB A;  2D0C A;  5ADX A;  3IUC A;  3L3U A;  4QAG A;  5AQT A;  2OTL N;  1W0H A;  2RN2 A;  4JKG A;  3H1V X;  2OPR A;  4DV1 K;  3TAE A;  2HHT A;  3FZH A;  2GX9 A;  4FOE A;  4FVU A;  1T03 A;  2YKN A;  4CBU A;  1G99 A;  4FLV A;  3LDO A;  4F3O A;  3THY B;  3VQQ A;  3VGL A;  3KLE A;  1T8E A;  1BQN A;  3RRG A;  3AO2 A;  1SAZ A;  4CFD A;  2AP1 A;  1HKC A;  3CQ8 A;  1N5Y A;  4KRF A;  4YDU C;  1H1V A;  1QVG M;  5M1O A;  2Q97 A;  3QEW A;  4GNI A;  4I9L A;  2HHU A;  3E9L A;  4MO4 A;  4MO5 A;  4DTS A;  2F7T A;  3KD1 E;  4FJK A;  3DMJ A;  3HI0 A;  1RT5 A;  3VEY A;  3O9Q A;  3KK7 A;  4IDH A;  1GLF O;  3DLR A;  3VQ4 A;  3HK2 A;  2FC0 A;  1JL2 A;  5ADX H;  1A5V A;  1X9W A;  1YI2 N;  1LWC A;  3QDK A;  4BRD A;  4CF0 A;  1YAG A;  2BE2 A;  1Q18 A;  4AHV A;  4CJ7 A;  4KPY A;  3OYF A;  5KTQ A;  1X3N A;  1T44 A;  4FK0 A;  4BDY A;  4CZG A;  4F3T A;  4H4O A;  4CZK A;  1HJO A;  2GTD A;  4A59 A;  3AV9 A;  1FKO A;  4KI4 A;  1YT3 A;  1RBT A;  3FZM A;  5AQG A;  4BRG A;  3DRP A;  3BDP A;  2DFF A;  1LCU A;  4B1U B;  3KVG A;  2QWR A;  1KAY A;  4H5R A;  4CIE A;  3N4P A;  3VA0 A;  4C8L A;  4HHT A;  3VF6 A;  1QVF M;  1VQM N;  3VF4 A;  3H46 O;  3VN5 A;  3TSQ A;  3VES A;  4M3Z A;  3O4Q A;  5CYQ A;  1OH8 A;  1C1B A;  2ITM A;  4JD2 B;  3EE9 A;  3BZC A;  3C95 A;  5I42 A;  2VCP A;  4IDK A;  4QS9 A;  1TGO A;  2GUP A;  4BWJ A;  4BRH A;  1W2B M;  1NJY A;  2W40 A;  4CW7 B;  3ENO A;  5AR0 A;  2KZM A;  3G25 A;  4LSN A;  5KPT A;  3S3M A;  4BDZ A;  4JN4 A;  4DQI A;  4EAH D;  5FLX O;  2WUS A;  3M5R A;  1KAZ A;  1UWB A;  2VWJ A;  2O8F A;  3WXI A;  2OAN A;  5AQU A;  1NOY A;  3LP3 A;  4CZH A;  1VSF A;  3SBT A;  3W0L A;  4DSL A;  1X9S A;  2GUI A;  4FWL A;  4KH6 A;  4FJI A;  2WC9 A;  4XH4 A;  3MCP A;  1VSL A;  4AM7 A;  1HNV A;  1OVQ A;  1HKB A;  3TSU A;  5C10 A;  4XIU A;  1RNH A;  4IWV A;  2I5J A;  1WUA A;  1RCH A;  2E4L A;  4L3Q A;  1V4S A;  4DSJ A;  4CHO A;  3P39 A;  3NF8 A;  3KIO A;  3LDN A;  3M1F A;  2B4J A;  2F9W A;  1VQ9 N;  3BY5 A;  4CJS A;  3ID6 A;  1D9F A;  4KB0 A;  4CED A;  2FBX A;  3SAG A;  2I7N A;  1NK0 A;  4OPH A;  1IKV A;  2HMI A;  3OVN A;  5FPN A;  2QWM A;  2NRH A;  3K2P A;  4OPK A;  4DU3 A;  2IVN A;  2CGK A;  1KRP A;  2VYP A;  3D7E O;  2B5J A;  1J6Z A;  3AVL A;  4FK4 A;  4LH5 A;  2IS3 A;  2D0O A;  1Z26 A;  2LSN A;  4O4G A;  3D6R A;  3AO5 A;  3QIN A;  4CJV A;  3K5M A;  1TAU A;  1BWF O;  4BVO A;  2A40 A;  4FCY A;  3CET A;  1K8K B;  3NGY A;  1QHT A;  1TV6 A;  3MEE A;  1UAX A;  4I2Q A;  3WEE B;  5BPM A;  4M3X A;  2FBY A;  1T05 A;  1ASU A;  1RBR A;  3MEG A;  4JS4 A;  2KQ2 A;  1LAW A;  2G8I A;  4U67 L;  4H0X B;  4DU1 A;  3GOI A;  3IFR A;  3IKM A;  3FZL A;  3TI0 A;  3P4I A;  5AZJ B;  4DU4 A;  1Z6R A;  3KK3 A;  1IG9 A;  5JVH L;  2P9K B;  4DFM A;  1RIL A;  3NMU A;  3CJ1 A;  3DLK A;  5BN8 A;  3SQ2 A;  2ETJ A;  4WFA L;  5C2D A;  4B9N A;  3PUF A;  4LF4 K;  1E4G T;  5LJW A;  4CZL A;  3TAN A;  3A2F A;  4KAZ A;  5K14 A;  1S3X A;  3DXK A;  5IT9 O;  2O8D B;  4CEB A;  4B9U A;  2P51 A;  3P31 A;  3OYM A;  5BR8 K;  5BPN A;  3K9K A;  4FJ8 A;  5AQF A;  4GW6 A;  4AHT A;  2D0P A;  3N4Q A;  1GLB G;  3FGU A;  1JLB A;  1TKD A;  4ZTJ A;  4CER A;  1WAJ A;  4M63 C;  1XUP O;  3TAB A;  3SPY A;  4BWM A;  5DM6 L;  4I6M A;  4DV3 K;  1XC9 A;  1VQ6 N;  1HYZ A;  3UKR A;  4B08 A;  3P38 A;  4E7J A;  5MLC Q;  4YOW A;  4DV0 K;  4CES A;  3PY8 A;  2ZQB A;  3E9O A;  4OVL A;  1SKS A;  1TKT A;  1L3S A;  1VQ5 N;  4N5S A;  3HT3 A;  4NYF A;  3QIC A;  4C8N A;  4Z4H A;  4G9Z A;  1ZBF A;  1NJZ A;  2BGG A;  3GG4 A;  5BRF A;  3K9J A;  3ATV A;  2ATQ A;  3OYE A;  3ZYY X;  3VQ7 A;  4HTU A;  1XHZ A;  3ZLJ A;  1YIJ N;  1NK8 A;  1TVR A;  1IBK K;  3JYT A;  1CZA N;  4FJ9 A;  3LP1 A;  3O3F A;  3WNH A;  3ZET A;  4H5V A;  4C1N K;  2FSK A;  3LDL A;  5EOY A;  2HND A;  1TYQ A;  3PX0 A;  3ZT4 A;  4CJT A;  5F2R A;  4A61 A;  3VTI A;  3QO9 A;  1UA1 A;  3MXI A;  3HRG A;  4LD0 A;  5GIN A;  3CCJ N;  1SS6 A;  4DR5 K;  3ID8 A;  3M8S A;  4AF1 A;  3CCU N;  4DS4 A;  3VQ9 A;  3TTF A;  5HOO A;  4BC5 A;  4YHH K;  1GOB A;  4C1N I;  4CGF A;  1Q8I A;  1JJ2 M;  1YIT N;  4N47 A;  2KW4 A;  3ZSY A;  3EE8 A;  3IDH A;  1DEJ A;  2QM1 A;  1J54 A;  1T6D A;  4CGH A;  1RT1 A;  4Y0W A;  4FJL A;  4KI6 A;  4BY9 C;  4CCH A;  4H0P A;  5KRT A;  3SI6 A;  2G8U A;  3FZK A;  1BDG A;  3OYA A;  1NGJ A;  4OPA A;  2YCH A;  3OTO K;  4BRN A;  3RSE B;  4FW1 A;  5AQI A;  3D45 A;  2GWK A;  1VSI A;  1S72 N;  1KSP A;  3KLF A;  4BR9 A;  2O8E B;  3ZCM A;  4DLG A;  3D2E A;  3KZB A;  3MDQ A;  4FJH A;  3ITH A;  1RT7 A;  3DLG A;  3BGR A;  3CF5 L;  1X9M A;  1C0G A;  4RW8 A;  3VF2 A;  3CCS N;  2UXC K;  4MFB A;  1KTQ A;  1WBB A;  3THV A;  5GIO A;  2G8H A;  1VQN N;  1L3V A;  3VEW A;  2HF3 A;  4W5T A;  4DTO A;  5CZ2 A;  3V6D A;  3CYM A;  2Z1J A;  2W42 A;  1S6Q A;  4NYN A;  3D2E B;  3OYJ A;  4ZTF A;  2WTU A;  4I7F A;  4FLT A;  5AQP A;  2WON A;  3O4W A;  3THW B;  3OYL A;  4W5R A;  1GOA A;  3LAN A;  1U45 A;  2OA8 A;  1KLM A;  2WBN A;  3RWU A;  3NH2 A;  2HNZ A;  2BUP A;  4X66 K;  4N41 A;  4PWD A;  1RT6 A;  5DMR A;  3I56 N;  4Z4F A;  4JAX A;  4FLY A;  2HHS A;  3MED A;  1LOT B;  4F4K A;  3TTC A;  2ITG A;  2DY4 A;  4XH5 A;  1EET A;  2NRX A;  1HUX A;  4AHR A;  3MMV A;  4YY3 K;  2KLA A;  1JCG A;  3AAQ A;  4FVM A;  2QWQ A;  1S1V A;  2YHB A;  1QQC A;  1W97 L;  4RWT A;  3KLH A;  3I55 N;  4B9S A;  4BC4 A;  2HBJ A;  5AZI A;  4PUO A;  2NRW A;  1SL1 A;  3VQD A;  4FO0 A;  1JL1 A;  1R0A A;  3LPT A;  2ZGY A;  3KLI A;  3OW2 M;  3QFP A;  2QW9 A;  2FBV A;  4DR6 K;  1WAF A;  5GAE P;  1ZBS A;  4CJL A;  4CEE A;  4FJG A;  3V9S A;  3AVM A;  1RDU A;  3ZSW A;  3PV8 A;  4DR4 K;  1YJN N;  3LZJ A;  2BTF A;  3ISN C;  1REV A;  2RE2 A;  2FF3 B;  4IOX A;  2E1Y A;  1NGF A;  4KBO A;  4CJF A;  3QEV A;  4B1Z A;  3P83 D;  4FOI A;  5M1K A;  2A42 A;  3MEC A;  3P1G A;  5AFU A;  4IOA L;  4O5B A;  2IC3 A;  1S1X A;  4E0D A;  2P9L B;  4NLB A;  3OJU A;  4RCH A;  3I0R A;  3G6E N;  2Q3S A;  3GE1 A;  3TAR A;  1KQS M;  5HL7 L;  1BIS A;  3OYI A;  4CEQ A;  5FRO A;  2P9N A;  3H6E A;  3SJJ A;  4QOZ B;  3G4S N;  4J2A A;  1FXX A;  2Z1H A;  1XMO K;  1YXQ A;  4CJQ A;  4DSE A;  3UE5 A;  3TAQ A;  3T69 A;  3QML A;  1NG9 A;  3LP0 A;  4KHN A;  1W9H A;  2QA4 N;  5AQQ A;  5HRR A;  4W5Q A;  3K58 A;  3FFK B;  3O1W A;  4LFA K;  2VWB A;  4M3W A;  4X64 K;  2Q2R A;  1RTI A;  3AVN A;  1KC8 O;  1KCF A;  3DRR A;  3CCM N;  4WQ4 C;  2QKK A;  4BRM A;  3GL1 A;  3Q7C A;  3K59 A;  3WQU A;  1WSI A;  3D2F B;  1NK7 A;  4UQG A;  4XEI A;  4C8O A;  3MWT A;  5AFU H;  2UU9 K;  4CIG A;  4CEZ A;  4MLH A;  3D0P A;  3BEX A;  5FDL A;  3VQ5 A;  4AH9 A;  4WE1 A;  2Z1I A;  4K42 A;  1O13 A;  5KPZ A;  2X74 A;  1YTA A;  1IKY A;  4CJU A;  4DMN A;  1YTU A;  4JK7 A;  1D4X A;  1KVC A;  4YOU A;  2OPQ A;  3F5T A;  1Z25 A;  2P9P B;  5J2N A;  3HPH A;  3VEN A;  4CGI A;  3AVH A;  1ZBU A;  5BRE A;  1ATN A;  2YHX A;  1VQL N;  1K73 O;  3FR0 A;  3KTQ A;  3MN5 A;  3EZ5 A;  4DTN A;  3ZX0 A;  2P9S A;  1CXQ A;  3AY9 A;  3MXJ A;  3VQE A;  2Q0U A;  2A1R A;  1F21 A;  4CJK A;  3ULE B;  4NCB A;  4FWO A;  1BI4 A;  4B8C A;  4E7I A;  3NH0 A;  1LV5 A;  1L3T A;  1D8Y A;  1KVB A;  4CJ3 A;  3K57 A;  4WFN L;  1U6Z A;  2NZT A;  3CC7 N;  3ENH A;  2P9I A;  3VQ8 A;  4OKE A;  3R6M A;  5C2F A;  1JXB A;  2E88 A;  1Q82 O;  3O5B A;  1NGA A;  5FPD A;  3K5L A;  1IG8 A;  3EYZ A;  3U8X A;  1QS4 A;  3OS0 A;  4DV5 K;  3K5O A;  3SQ0 A;  4JKG B;  2OYQ A;  3BF1 A;  4C8M A;  1NK9 A;  1Q86 O;  3AGR A;  2E2O A;  1NK6 A;  3ZSQ A;  1R59 O;  3O6W A;  5C12 A;  3PSF A;  3CER A;  1OKJ A;  5LMU K;  3OA9 A;  3NE6 A;  3DLB A;  3LM2 A;  1JLA A;  2HMP A;  4IKF A;  2UUA K;  1BL3 A;  2O4G A;  2Y1I A;  1J9A A;  2QXF A;  1JLE A;  3HOT A;  3EO3 A;  1K6Y A;  4DTX A;  2CGL A;  5I3U A;  4Z0U A;  3ALY A;  2ASP A;  1MWK A;  3QNO A;  4H8K A;  1X9J A;  4CEC A;  1NGH A;  3TSP A;  2NRR A;  3ATU A;  3L4Q A;  2JGU A;  1GLE G;  1NGC A;  4CZE A;  4B3T K;  2RHK A;  3H08 A;  1QZ6 A;  1DTQ A;  1NKE A;  1HNW K;  1OH5 A;  2EHG A;  3RTV A;  1C6V A;  3HVT A;  3MXM A;  1BQM A;  2O8C A;  4EP5 A;  2QI2 A;  4WCE L;  1QQN A;  3ZT3 A;  3VEV A;  4GKK K;  3A8Y A;  1MA9 B;  1WOQ A;  1GLL O;  3AA5 X;  1BG3 A;  3QIP A;  4JI6 K;  4CHY A;  3R3L A;  4IEI A;  4J2B A;  3R8E A;  4BG8 A;  1Y64 A;  3OYD A;  3NDK A;  3EKS A;  1WLJ A;  3NHG A;  2UXB K;  3V9W A;  3AO4 A;  1ATS A;  2W6K A;  5LJV A;  3SV4 A;  2P9U A;  3QIO A;  1E3M A;  2CH6 A;  4KH5 A;  3S9H A;  4B9Q A;  4L8R B;  2ZJQ L;  4C23 A;  3L2V A;  3EKU A;  3SUQ A;  4JKC A;  3LZI A;  4M3Y A;  4B1V A;  3DXM A;  1BA1 A;  1ZC6 A;  4F9O A;  4FXD A;  2E6L A;  3HP6 A;  2NNW A;  5JMV A;  1TUY A;  1DLO A;  2QWL A;  4WQ4 A;  4DLE A;  4H0T B;  3ZSX A;  1WSG A;  4CZJ A;  2ZE2 A;  5HRN A;  4Z4E A;  5I9E B;  2PYL A;  4OLB A;  4B3M K;  4YOV A;  2XY8 A;  3VA3 A;  2OZS A;  2O8F B;  5BRH A;  3J7Y P;  2DTU A;  4XH1 A;  1Q9Y A;  5AQS A;  3TTD A;  2QKB A;  2HW3 A;  4DCH A;  4KTW A;  1ILY A;  4K0K K;  5CE3 A;  3C7N A;  2OPS A;  2W41 A;  3LP2 A;  5C25 A;  4DTM A;  3TPQ A;  2F8S A;  5LL6 Z;  3EEQ A;  3AA2 A;  4ISE A;  4KV8 A;  3J81 O;  3DJC A;  4DUZ K;  1TK0 A;  2GWJ A;  2JWL A;  3UKU A;  2KTQ A;  3E01 A;  2V7Y A;  3S41 A;  2UYT A;  3HST B;  3PO4 A;  3C6U A;  3WXJ A;  2YNF A;  4Q5V A;  1NK5 A;  3HTV A;  3NF6 A;  3FLC O;  3PO5 A;  3CCV N;  1HQU A;  4M3R A;  4PA1 A;  4BRE A;  3WXK A;  1RBU A;  3UKU B;  1YVN A;  5AQW A;  1SZ2 A;  4B9L A;  3OYK A;  2IGI A;  3OJS A;  3C6A A;  4KHU A;  3WNG A;  3EZW A;  3SQ4 A;  4DKW A;  1Z05 A;  4FM2 A;  2KKZ A;  2G8W A;  4FJX A;  4GY2 B;  2QEX N;  1MDU B;  1ZBL A;  3HZ6 A;  3O3H A;  4DFJ A;  3M6G A;  1C0U A;  1JLQ A;  3LAM A;  4I2P A;  2QTD A;  4CEF A;  4JI0 K;  1U2V A;  4F2S A;  3OS1 A;  2HST A;  2YHW A;  2KHO A;  1VQO N;  3U4L A;  1OVY A;  2D0A A;  5BN9 A;  2AJQ A;  2VG7 A;  1HYS A;  2E8A A;  4FWM A;  4M3U A;  5DM7 L;  1N34 K;  1QSL A;  2EX3 A;  1JKH A;  3LWM A;  1EWQ A;  4FYD A;  2NRV A;  3O8M A;  4V19 S;  4DG1 A;  3B6P A;  4U7B A;  3KKR A;  2NLX A;  4BGA A;  3OBW A;  4DTP A;  5ELZ A;  1J5E K;  2WOM A;  3THX A;  4KHQ A;  1XC3 A;  2HBK A;  4M45 A;  1QSY A;  2HHW A;  3WXL A;  4KKO A;  4A5B A;  3DWL A;  2QWO A;  2E2N A;  3MX5 A;  5HRS A;  3DXK B;  1SKW A;  1QQO A;  1UOC A;  3K5N A;  5IWA K;  3H45 C;  4DQ8 A;  3HVR A;  2IOC A;  5EU7 A;  4AIL C;  4O8U A;  4JLH A;  1W7A A;  3AVG A;  3OYG A;  3VTH A;  4ISG A;  1HNI A;  4PKH A;  3DI6 A;  4JKB A;  2E5L K;  4JHD A;  4I6M B;  3VEX A;  3UKR B;  3AO3 A;  1C0T A;  3AA3 A;  4R5P A;  2FLO A;  4H03 B;  2ZJP L;  1SL2 A;  1U04 A;  4KHP K;  4Z4I A;  1HPZ A;  1ZXO A;  2DFH A;  4DTR A;  1VSK A;  2X6N A;  3KWG A;  3SYZ A;  1GLC G;  3ZSV A;  4JKH A;  3KK1 A;  3QB0 A;  1NM1 A;  4H0Y B;  1HRH A;  4FWS A;  5JLH A;  5E41 A;  1HMV A;  3HPO A;  3ZET B;  3T19 A;  4NXN K;  1LW0 A;  4B9V A;  4IXC A;  3F9K A;  3V1O A;  1TYQ B;  1TUU A;  2NUB A;  1XHX A;  1SUQ A;  1YVU A;  3RR7 A;  3QER A;  3TWH A;  2P5O A;  4JI7 K;  1QQM A;  4JI4 K;  1HQE A;  2XY6 A;  3AVC A;  3ZT1 A;  4O55 A;  4WQ5 A;  4PKI A;  1JLG A;  1EQY A;  1S6P A;  3I0S A;  1ASW A;  1BCM A;  3DAW A;  3T1A A;  3VEO A;  4KH4 A;  4IJA A;  3BF3 A;  4NCG A;  1VQ7 N;  2XO7 A;  1E4F T;  5CY4 A;  5B8H A;  3PIP L;  3B8A X;  4JRP A;  4JNE A;  4DQS A;  4B3R K;  4CIF A;  1TL3 A;  4WF9 L;  4K25 A;  3U3Y A;  1NJW A;  3QES A;  4IG0 A;  3JXU A;  2HBL A;  2J4R A;  3QNN A;  2BDP A;  3QEI A;  5C0Y A;  4K41 A;  4DV2 K;  3V9Z A;  4GV9 A;  4HUG A;  5J2Q A;  1GLJ O;  2D0B A;  3L8B A;  2KZZ A;  3FE1 A;  2P5G A;  3HXM A;  5CR4 A;  3T3F A;  1T6C A; 
#chains in the Genus database with same CATH homology
 4UQG A;  1U4B A;  1U49 A;  4C8O A;  4FM1 A;  4CIE A;  1I3A A;  4CIG A;  3VA0 A;  4DTU A;  5J2P A;  4CEZ A;  1CZB A;  4HHT A;  1N6Q A;  1NKC A;  4C8L A;  4DSI A;  2QK9 A;  3D0P A;  2FBT A;  5FDL A;  3VQ5 A;  1JLF A;  2BAN A;  4Y1C A;  1BIZ A;  1MU2 A;  1VSE A;  2YNH A;  4WE1 A;  3VN5 A;  2Z1I A;  4AH9 A;  3CFR A;  3O4Q A;  4M3Z A;  3IG1 A;  4HVJ A;  2HHX A;  5CYQ A;  3C94 A;  4G1Q A;  2P1J A;  1C1B A;  2ZD1 A;  2X74 A;  3C95 A;  1YTA A;  3HPG A;  5HBM A;  4GMJ B;  4AHC A;  1IKY A;  1EKE A;  4CJU A;  5I42 A;  4IDK A;  4DMN A;  1TGO A;  4BWJ A;  1YTU A;  1RTH A;  4OKJ A;  1NJY A;  1KVC A;  2OPQ A;  4CEA A;  4M41 A;  1Z25 A;  3HP9 A;  3L3V A;  1RDC A;  2KZM A;  2HVI A;  5J2N A;  1ZBI A;  4LSN A;  3RR8 A;  4KHW A;  2HHV A;  3HPH A;  4E7K A;  4IFV A;  4CGI A;  3AVH A;  3M8Q A;  3S3M A;  1LAV A;  4BDZ A;  1ZBU A;  4IBN A;  2YKM A;  2HB5 A;  3V9X A;  4DQI A;  3VQB A;  4CHQ A;  1UWB A;  3KTQ A;  2VWJ A;  4CHP A;  1C0M A;  1CXU A;  4J2E A;  3EZ5 A;  3SUN A;  4LSL A;  4DTN A;  3F73 A;  3DOL A;  3NGI A;  1IH7 A;  1CXQ A;  4N76 A;  3MXJ A;  1SKR A;  3VQE A;  3MAQ A;  1NOY A;  3LP3 A;  3TAG A;  1VSF A;  5C24 A;  2A1R A;  4DSL A;  1F21 A;  2YHA A;  3CM5 A;  3V81 A;  4CJK A;  1X9S A;  2GUI A;  4CK2 A;  4FJI A;  4NCB A;  3DYA A;  1VSL A;  4CEO A;  1BI4 A;  4B8C A;  1HNV A;  3G10 A;  2YNG A;  1I39 A;  4E7I A;  3NH0 A;  1LV5 A;  4XIU A;  4CK1 A;  1L3T A;  1RNH A;  1D8Y A;  2I5J A;  5SZT A;  1KVB A;  3IS9 A;  4RW6 A;  4CJ3 A;  3K57 A;  1RCH A;  2E4L A;  4DWI A;  5FRN A;  1QE1 A;  4DSJ A;  4CHO A;  3NF8 A;  4K8Z A;  3KIO A;  3AA4 A;  4Y1D A;  4CJW A;  2A1S A;  3VQ8 A;  3KK2 A;  4OKE A;  1LWE A;  2B4J A;  3V1R A;  1JXB A;  4CJS A;  1D9F A;  4EZ6 A;  3CFO A;  4KB0 A;  3K5L A;  3V1Q A;  4CED A;  3EYZ A;  1VSH A;  4FZZ A;  3QEP A;  5D3G A;  1QS4 A;  2FBX A;  3OS0 A;  4B8A B;  1NK0 A;  4KB1 A;  3K5O A;  3SQ0 A;  1IKV A;  2HMI A;  3OVN A;  4AHU A;  1D9D A;  2OYQ A;  4FJN A;  1HYV A;  4M3T A;  4C8M A;  3K2P A;  1GOC A;  4OPK A;  4CGG A;  4DQR A;  4DU3 A;  1B92 A;  1NK9 A;  1NK6 A;  3TAM A;  2F8T A;  1KRP A;  4OLA A;  3ZSQ A;  1RDA A;  4E19 A;  2B5J A;  2D5R A;  2RKI A;  4RG8 A;  4TSX A;  4F8R A;  1G15 A;  4EZ9 A;  1D5A A;  4FK4 A;  3AVL A;  4LH5 A;  1EXQ A;  2IS3 A;  3NE6 A;  2KFZ A;  3DLB A;  1Z26 A;  2LSN A;  1JLA A;  4IKF A;  1A5X A;  1RDD A;  4O4G A;  1BL3 A;  2O4G A;  4CJP A;  2Y1I A;  1J9A A;  2QXF A;  1JLE A;  3AO5 A;  3QIN A;  3NCI A;  4CJV A;  3K5M A;  1KVA A;  3ASM A;  3HM9 A;  3SQ1 A;  1TAU A;  4DQQ A;  1K6Y A;  4BE0 A;  4FCY A;  3OYB A;  4DTX A;  4JS5 A;  4CJ5 A;  5I3U A;  1J5O A;  4Z0U A;  3NGY A;  3ALY A;  1QHT A;  1TV6 A;  3MEE A;  3VQA A;  4FZX C;  3QNO A;  3LDS A;  4LY7 A;  4H8K A;  1UAX A;  4I2Q A;  3OYC A;  2RPI A;  4CEC A;  3KKS A;  1ASV A;  3P5J A;  4M3X A;  4FW2 A;  1WSJ A;  3NGZ A;  2FBY A;  1T05 A;  1ASU A;  1RBR A;  2JGU A;  3MEG A;  4JS4 A;  1CZ9 A;  2KQ2 A;  3KJV A;  1LAW A;  2G8I A;  4PY5 A;  1QSS A;  3L2Q A;  3H08 A;  4RW7 A;  3SUP A;  1EP4 A;  3TAP A;  4DU1 A;  1DTQ A;  1VSJ A;  1NKE A;  1TL1 A;  3TI0 A;  4DU4 A;  1Y97 A;  2EHG A;  1C6V A;  2VWK A;  3HVT A;  3RTV A;  3MXM A;  1BQM A;  3KK3 A;  4K8X A;  4EP5 A;  1IG9 A;  2IAJ A;  3NF7 A;  1C1C A;  3ZT3 A;  4DFM A;  3NH1 A;  1NKB A;  3M8P A;  3SUO A;  1RIL A;  3O3G A;  3DLK A;  2B6A A;  3AA5 X;  4DFP A;  3EY1 A;  3HJF A;  3QIP A;  4CHY A;  3SV3 A;  3SQ2 A;  1SL0 A;  2ETJ A;  4J2B A;  3OYD A;  4B9N A;  3PUF A;  3NDK A;  4FLX A;  3IAY A;  4KTZ A;  1WLJ A;  3NHG A;  1WSE A;  4N56 A;  1TKX A;  3TAN A;  3A2F A;  3V9W A;  4KAZ A;  3AO4 A;  5K14 A;  4B9M A;  2VG6 A;  1X1P A;  3G0Z A;  3L2U A;  4CEB A;  3SV4 A;  4B9U A;  2P51 A;  3ZSZ A;  3QIO A;  5HRP A;  5FRM A;  2GBZ A;  3OYM A;  2X78 A;  1ZYQ A;  4DTJ A;  3S9H A;  4L8R B;  1U47 A;  4FJ8 A;  3HO1 A;  4CHN A;  2OPP A;  1NOZ A;  4GW6 A;  4AHT A;  4KHS A;  4FK2 A;  3L2V A;  3V4I A;  3QEX A;  3SUQ A;  1JLB A;  3LZI A;  4M3Y A;  3FFI A;  1TKD A;  4ZTJ A;  4I9Q A;  3SCX A;  4CER A;  1WAJ A;  1HJR A;  3SPY A;  2KFN A;  3TAB A;  4DQP A;  3KLG A;  4BWM A;  2VG5 A;  1XC9 A;  4FXD A;  1HYZ A;  2E6L A;  1XI1 A;  3HP6 A;  4B08 A;  1S5J A;  4ELV A;  1DLO A;  3WNF A;  1DTT A;  4DLE A;  4FLW A;  4DF4 A;  4E7J A;  3ZSX A;  4FZY A;  4CES A;  4IFY A;  1IKX A;  2ZQB A;  3HYF A;  1WSG A;  3PY8 A;  2ZE2 A;  4OVL A;  5HRN A;  1SKS A;  1TKT A;  1L3S A;  4Z4E A;  4N5S A;  2PYL A;  3HT3 A;  2XRI A;  4NYF A;  4OLB A;  4C8N A;  4Z4G A;  1BCO A;  3RMD A;  1B9F A;  2IDO A;  4Z4H A;  5KRS A;  1FK9 A;  2XY7 A;  1ZBF A;  1T7P A;  4ELU A;  4BE2 A;  4KRE A;  1NJZ A;  2BGG A;  3VA3 A;  2XY8 A;  2F96 A;  4CFC A;  2OZS A;  4FJJ A;  1LW2 A;  5KGW A;  1RT3 A;  2ATQ A;  4B3O A;  1RTD A;  2DTU A;  3OYE A;  1Q9Y A;  1Q9X A;  1WSH A;  1VRU A;  4ID5 A;  2QKB A;  3VQ7 A;  2HW3 A;  3S3N A;  4HTU A;  4KTW A;  1XHZ A;  1VSD A;  1NK8 A;  1TVR A;  4OGC A;  3JYT A;  4JRQ A;  4FJ9 A;  3LPU A;  3LP1 A;  3O3F A;  3U6F A;  1BI4 B;  4Z4C A;  3AVI A;  3WNH A;  2OPS A;  4FJ5 A;  3LP2 A;  5C25 A;  5HLF A;  4DTM A;  1A5W A;  2F8S A;  2GV9 A;  4DSF A;  4KV8 A;  3AA2 A;  1KFS A;  3KD5 E;  2HND A;  2YNI A;  3LAK A;  4DFK A;  3PX0 A;  1ITG A;  3ZT4 A;  1TK0 A;  4CJT A;  4ICL A;  2KTQ A;  3E01 A;  3QO9 A;  3SZ2 A;  1RDB A;  3HST B;  3PO4 A;  3C6U A;  3VQP A;  2G8K A;  2RF2 A;  5T7B A;  1UA1 A;  3MXI A;  2YNF A;  4Q5V A;  1NK5 A;  1EX4 A;  3IRX A;  4CF8 A;  2R7Y A;  3NF6 A;  1TKZ A;  4LD0 A;  3PO5 A;  2HVH A;  1XWL A;  1HQU A;  4M3R A;  1JXE A;  4PA1 A;  4KTQ A;  4DF8 A;  3M8S A;  1S9E A;  5CYM A;  4H4M A;  3RMA A;  1RBU A;  4DS4 A;  3VQ9 A;  4MQ3 A;  5DK5 A;  4OKK A;  3I8D A;  4B9L A;  3OYK A;  2IGI A;  3DRS A;  3OJS A;  4KHU A;  1GOB A;  2YV0 X;  4CGF A;  4C8K A;  1Q8I A;  3WNG A;  3SQ4 A;  1BHL A;  3ZSO A;  3O4N A;  4FM2 A;  2G8W A;  4FJX A;  4N47 A;  3M8R A;  3ZT2 A;  3L2W A;  2KW4 A;  3NFA A;  3ZSY A;  3TAF A;  3PX6 A;  3JSM A;  3OYH A;  3AVK A;  1ZBL A;  1VSM A;  1J54 A;  1JLC A;  4B9T A;  3O3H A;  4FJ7 A;  4HCC A;  4CGH A;  4DFJ A;  1SV5 A;  1RT1 A;  1C0U A;  1JLQ A;  3LAM A;  4I2P A;  4FJL A;  3HL8 A;  4CJ4 A;  4CEF A;  3OS2 A;  4CCH A;  5KRT A;  3SI6 A;  1QTM A;  4CFB A;  3ZT0 A;  3OS1 A;  2G8U A;  4F2S A;  4LH4 A;  4J2D A;  4KHY A;  4AHS A;  3OYA A;  4CK3 A;  3LWL A;  4QCL A;  1WNS A;  2D0A A;  3C6T A;  2AJQ A;  2VG7 A;  4E3S A;  1HYS A;  2O4I A;  4FW1 A;  5J2M A;  3D45 A;  3VQC A;  4ELT A;  1VSI A;  1KSP A;  3KLF A;  2Z1G A;  1VRT A;  4KO0 A;  4CF1 A;  1KLN A;  4M3U A;  3AVJ A;  1QSL A;  4FLU A;  2EX3 A;  3ZCM A;  4DLG A;  1JKH A;  3LWM A;  5C42 A;  4HCB A;  4FJH A;  4FYD A;  3ITH A;  1RT7 A;  3DLG A;  3RRH A;  3VQ6 A;  3BGR A;  4E7L A;  2G8F A;  1X9M A;  4DG1 A;  4RW8 A;  3B6P A;  4MFB A;  1KTQ A;  1O1W A;  3THV A;  2JLE A;  3KKR A;  4EP4 A;  2G8H A;  3CG7 A;  1LWF A;  4CGJ A;  1BGX T;  4DTP A;  4FLZ A;  3DOK A;  1L3V A;  2X6S A;  4CHZ A;  3UIQ A;  2PY5 A;  4DTO A;  1WSF A;  4W5T A;  5CZ2 A;  3V6D A;  2WOM A;  4KHQ A;  3CYM A;  5HP1 A;  2Z1J A;  2W42 A;  1S6Q A;  4NYN A;  4M45 A;  4CF9 A;  3OYJ A;  4ZTF A;  1TK8 A;  1QSY A;  2HHW A;  1B9D A;  3B6O A;  4I7F A;  4E1M A;  3CFP A;  4KKO A;  5JS1 A;  4FLT A;  2G8V A;  4CGD A;  2WON A;  5CZ1 A;  5HRS A;  3OYL A;  4W5R A;  4RW4 A;  1GOA A;  1S9G A;  3LAN A;  3L2R A;  1U45 A;  1SKW A;  2OA8 A;  1UOC A;  4O0I A;  1KLM A;  1U48 A;  3K5N A;  3ULD A;  3RWU A;  3PX4 A;  3NH2 A;  2HNZ A;  2Y1J A;  4DSK A;  3HVR A;  2IOC A;  5EU7 A;  1S1U A;  1IKW A;  4N41 A;  2HHQ A;  4AIL C;  1FKP A;  4ID1 A;  4PWD A;  1RBS A;  4JLH A;  1RT6 A;  3AVG A;  3OYG A;  4BAC A;  5DMR A;  2E6M A;  4YFU A;  4Z4F A;  4CF2 A;  1HNI A;  3OYN A;  3DI6 A;  5KI6 A;  3AVA A;  4FLY A;  4Q0B A;  2HHS A;  3MED A;  4CE9 A;  1RBV A;  3AVB A;  5JS2 A;  4F4K A;  3U3G A;  4CJR A;  2ITG A;  2DY4 A;  1EET A;  1WN7 A;  3DLH A;  1L3U A;  4AHR A;  3DM2 A;  3AO3 A;  3QLH A;  4FJM A;  1C0T A;  4ZHR A;  3AA3 A;  5KGX A;  4OJR A;  4R5P A;  1NJX A;  5HRO A;  4FVM A;  5J1E A;  1S1V A;  4GVM A;  2YHB A;  1S1T A;  1QQC A;  4E1N A;  4DS5 A;  4NCA A;  1KFD A;  1SL2 A;  3KLH A;  4B9S A;  1U04 A;  4O0J A;  3SNN A;  3NAE A;  1RT4 A;  1RTJ A;  4PUO A;  4Z4I A;  1HPZ A;  2DFH A;  4DTR A;  1VSK A;  1SL1 A;  3VQD A;  1JL1 A;  3QET A;  1S1W A;  2X6N A;  4YNQ A;  1R0A A;  3SYZ A;  3LPT A;  3KLI A;  1TAQ A;  3ZSV A;  2XHB A;  2FBV A;  4OGE A;  1WAF A;  2D0C A;  3SPZ A;  3S3O A;  3L3U A;  1C1A A;  4QAG A;  3KK1 A;  3NBP A;  1W0H A;  2RN2 A;  4CJL A;  4CEE A;  3TAE A;  2OPR A;  4HUE A;  4FJG A;  4M42 A;  3V9S A;  3AVM A;  2HHT A;  1HRH A;  5E41 A;  3ZSW A;  3PV8 A;  1HMV A;  4RW9 A;  3HPO A;  4KI6 A;  1T03 A;  2YKN A;  3T19 A;  3LZJ A;  3ISN C;  1REV A;  3NF9 A;  1IO2 A;  1LW0 A;  4FLV A;  4B9V A;  4F3O A;  3F9K A;  3VQQ A;  1J53 A;  3V1O A;  4FM0 A;  3KLE A;  2NUB A;  1XHX A;  1T8E A;  1VK0 A;  4CJF A;  4CJE A;  1BQN A;  3RRG A;  1BIU A;  3QEV A;  1SUQ A;  3AO2 A;  3AO1 A;  1YVU A;  3CM6 A;  4CFD A;  3P83 D;  3RR7 A;  3QER A;  3CQ8 A;  3MEC A;  3TWH A;  3P1G A;  2P5O A;  4O5B A;  2HNY A;  2IC3 A;  1N5Y A;  1S1X A;  4W5N A;  4BDP A;  4KRF A;  1CLQ A;  1RT2 A;  4E0D A;  1HQE A;  4CFA A;  1NK4 A;  4O44 A;  2XY6 A;  3AVC A;  3OJU A;  3QEW A;  4I9L A;  3ZT1 A;  2OZM A;  3I0R A;  3TAR A;  2Q3S A;  4O55 A;  2HHU A;  1JLG A;  1BIS A;  4PQU A;  1S6P A;  3I0S A;  1ASW A;  4OPJ A;  1BCM A;  3OYI A;  4DTS A;  3KD1 E;  2DFE A;  3WNE A;  3DMJ A;  5FRO A;  1RT5 A;  4CEQ A;  4FJK A;  3T1A A;  3ZSR A;  3SJJ A;  4F2R A;  4QOZ B;  4NCG A;  3V9U A;  4J2A A;  3DLE A;  1FXX A;  2Z1H A;  2XO7 A;  4HUF A;  3VQ4 A;  3DLR A;  5CY4 A;  2XY5 A;  2FC0 A;  3HK2 A;  1JL2 A;  4JRP A;  1A5V A;  3LAL A;  4CJQ A;  4DQS A;  4CIF A;  4DSE A;  3TAQ A;  1LWC A;  1UA0 A;  1X9W A;  1TL3 A;  4CF0 A;  3RMC A;  4BE1 A;  2BE2 A;  3U3Y A;  3LP0 A;  4KHN A;  1W9H A;  1NJW A;  4AHV A;  4KPY A;  3QES A;  4IG3 A;  4IG0 A;  5HRR A;  4W5Q A;  3QNN A;  3K58 A;  1L5U A;  2BDP A;  3QEI A;  3OYF A;  1TK5 A;  5KTQ A;  3OY9 A;  5SWM A;  2PZS A;  3AVF A;  4FK0 A;  4M3W A;  1RTI A;  4BDY A;  3V9Z A;  4HUG A;  5J2Q A;  4F3T A;  3AVN A;  4H4O A;  1KCF A;  3RMB A;  2D0B A;  2KZZ A;  3DRR A;  3L8B A;  3AV9 A;  2PYJ A;  1FKO A;  4E89 A;  2P5G A;  4KI4 A;  4KFB A;  3TR8 A;  1YT3 A;  2QKK A;  3HXM A;  3K59 A;  1RBT A;  1ZBH A;  1WSI A;  3T3F A;  4E7H A;  3DRP A;  3BDP A;  4W5O A;  1NK7 A;  2DFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...