4BRHA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg and thiamine phosphovanadate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
361
structure length
361
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic snapshots along the reaction pathway of nucleoside triphosphate diphosphohydrolases.
pubmed doi rcsb
source organism Legionella pneumophila
total genus 121
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brhA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brhA02
3LDNA 4JAXA 5EX5A 2CH5A 4NB4A 1SZ2A 3VF2A 5AZJB 4Y0WA 2F9TA 1JCEA 3VESA 5LY3A 3HBTA 4BRNA 1KXPA 3MMVA 4LC9B 1G99A 2P9LB 2QWNA 5KPZA 3QDKA 3A5OC 2QXLA 2QWRA 5BPNA 3VENA 1DGKN 4BGBA 3VF6A 2H3GX 5E26A 3VEXA 2D1KA 3WQTA 4H0XB 3LM2A 3VEOA 1YXQA 4K42A 3EN9A 4CZLA 4RCHA 3QB0A 5AQHA 4H5TA 4BRMA 3GG4A 2GWKA 2E2NA 4BC5A 3CI5A 4WQ4C 3IFRA 1TUYA 3AY9A 1RFQA 1K8KB 3UKUB 3EO3A 2UYTA 2PAVA 5LJWA 3W0LA 2V7ZA 4XH4A 4FWLA 4H5WA 2QWQA 1NGAA 4B1UB 3IUCA 2A41A 1MA9B 3VPZA 3DAWA 3ATUA 5AQLA 2GEMA 1IJJA 2V52B 2OANA 4IZ9A 1U2VA 2ZGYA 4A2AA 5KPRA 1QQMA 1HPMA 5KQDA 2P9LA 3D7EO 3C0BA 1Z05A 3UKRA 2I7NA 2P9NB 3JXUA 4CZHA 3WEEB 3BF3A 1C0GA 3A5NC 4BC4A 3R9PA 2IIRA 2P9SA 4JD2B 3UE5A 3CJ1A 3H6EA 3O08A 2FSKA 4BRPA 5BRHA 4FSVA 4FPBA 4IXCA 3UKUA 2F9WA 4BRKA 3DXKA 4CBWA 1MWMA 4H5RA 1ZBSA 1HKBA 3A0IX 3MCPA 5EXWA 4EHTA 4MLHA 4BRQA 2A6AA 1BOTO 2IVPA 3WXKA 2ITMA 1CZAN 2GELA 1P8ZA 4H0TB 5FPEA 1DEJA 2Q0RA 4WYBA 4PKHA 5F0XA 3CJCA 3H3NO 3WEEA 4H0OA 1ATNA 4FWMA 4JHDB 5FPDA 1HUXA 3MN5A 4FO0A 3M3ZA 4B1ZA 3GL1A 1MWKA 4F9OA 4KBOA 4CBXA 2YHWA 3O1BA 1NBWA 2D0OA 5JICA 4B1VA 3D2EA 3H46O 2P9UB 2A3ZA 4EAHD 2QWOA 2ASMA 3O80A 4XH5A 1HLUA 4BQLA 1BA0A 3KVGA 2QW9A 3D2FB 2A5XA 4I6MA 3GOIA 1LCUA 4PKIA 1GLEG 2E20A 4CI6A 5AZIB 4YDUC 4HTLA 4CJ7A 4RWTA 5ADXA 1HJOA 4IWVA 4FWKA 4H0PA 4JHDA 4PKGA 3WXJA 1X3MA 2QWPA 4EFHA 1Q18A 1T6CA 3HSCA 1GLLO 3QFUA 3CERA 3WXIA 2FLOA 2P9UA 5AQNA 3HM8A 1U2VB 5AQYA 3U9ZA 3VOVA 4BVPA 1NGDA 1XUPO 1NMDA 2VCPA 4MO5A 3UB5A 3UKRB 4O8KA 3IMXA 2ZWHA 3D2FA 3LL3A 4H5NA 5EVZA 4A61A 2CH6A 5CE3A 1QQNA 2P9SB 3BUZB 4BR5A 4BG8A 3SK3A 3A5LC 5AZIA 1BG3A 2Q0UA 3GE1A 3LDPA 4WQ4A 4BG9A 1SQKA 1MDUB 1RDWX 1QHAA 2VYPA 3I8BA 3RSEB 3R6MA 2P9IB 2QM1A 3DXKB 1NLVA 1NGIA 3OHRA 4CZGA 2GWJA 4IJNA 4DQ8A 1NGFA 4BRDA 3LDQA 1LOTB 4IO8A 4JN4A 3VERA 3CIPA 3KHYA 2FSJA 3MK6A 4B9QA 3FGUA 3VGLA 1ATRA 1ZC6A 2W41A 4JNEA 4L3QA 3U4LA 5BPMA 3M6GA 2P9KA 1BA1A 1NGJA 5AQZA 3J8AA 2VWBA 4PL8A 5AQTA 3FR0A 2YJEA 5FPMA 1KAYA 3LDOA 4XH1A 2QWMA 5F1XA 3D2EB 4E1JA 4BC2A 4QS7A 3SJHA 1NGGA 2YJFA 1RGIA 3RSEA 2P9IA 3QMLA 3O8MA 1J6ZA 1NWKA 2E88A 4BRAA 3ENHA 3HI0A 1HKGA 4I6MB 5AQFA 3L6QA 1S22A 3WT0A 2EWSA 1YVNA 4EHUA 3BF1A 4BR4A 1NM1A 3ZX3A 3CQYA 1BUPA 2HF4A 3WUHA 4AM6A 5KPTA 3GBTA 1XQSC 5AR0A 5BRFA 3MN7A 2GUPA 1KAZA 5ADXH 1TYQB 1X9JA 4FPAA 5JLHA 5AQVA 5AQOA 3ZEUA 2Q97A 4BREA 1Z6RA 3KZBA 2V7YA 2BTFA 4FOEA 3VEZA 1ATSA 1T6DA 4RTFD 4CZMA 2A40A 4FWOA 4PL7A 3AAQA 3L0QA 1R59O 5KQ8A 2A42A 3LM9A 4BR7A 5TKYA 1D4XA 3AARA 4BRFA 4B1XB 4BR0A 3H3OB 1QZ6A 2HF3A 1EQYA 3IDHA 3DXMB 4YDUA 3L4IA 1OKJA 4CD3A 3U9DA 1GLJO 4K43A 3ZETB 3ZX2A 3BEXA 2E2QA 5F2RA 3H1QA 3M1FA 4K41A 2IVNA 2Q36A 4CD1A 2NLXA 3ZX0A 1QZ5A 3HZ6A 2WUSA 4H0VB 3O5BA 4WQ5A 1TYQA 2D4WA 4WQ5C 4O5FA 5AQMA 5AFUA 3B8AX 3FFKB 1BDGA 4ISFA 2J4RA 3QFPA 4FWNA 2ASOA 2KHOA 3ATVA 4NO7A 4B1YB 3FZHA 5AQJA 4H0YB 5AQQA 2P9KB 3I33A 3O4WA 4ISEA 3H1VX 1NGHA 3JS6A 4BRHA 1ESVA 4XEIA 3VEYA 5AQRA 4CZEA 2Q31A 3TU5A 3CJAA 3H45C 3DXMA 5EOYA 1H1VA 4BRIA 1JCGA 2E2PA 3QBWA 3GDQA 1X3NA 5AQWA 4GY2B 2Q2RA 5EY4A 3ZETA 3ULEB 5JMVA 3CETA 1E4FT 4FWQA 4BRLA 3VGMA 1C0FA 1JCFA 4FWPA 1NGCA 4M7XA 4FOIA 5AQSA 4C23A 2Q1NA 4CZIA 3C7NB 3MN9A 1GLBG 5B8HA 3O6WA 3EZWA 3LDLA 5LJVA 2FSNA 1WOQA 2V51B 2QWLA 2DPNA 4HWIA 4BR9A 3FZLA 3CQXA 3VEWA 1S3XA 4BQZA 3O1WA 2YHYA 2CGLA 5BN8A 4BGAA 2BUPA 4A2BA 4FWRA 3ZEUB 4B1WB 3CJBA 3HTVA 2NRHA 3ULEA 3ENOA 5AZJA 1GLFO 4MLEA 3FLCO 5FPNA 3EKUA 3QICA 3AAPA 1BWFO 1NGBA 1XC3A 2YI1A 2D0PA 1GLCG 1TUUA 3F9MA 2YHXA 3G25A 2PBDA 3C7NA 4DB3A 2E8AA 1GLAG 4BR2A 2ZGZA 3FZFA 1QQOA 5I9EB 3TPQA 5AQKA 4A62A 1V4SA 3VETA 1WUAA 4IJAA 4DCHA 4H03B 1T44A 4EIAA 1YUWA 5BR9A 4BROA 3CJ7A 3CHWA 1YAGA 1K8KA 1BU6O 2NZTA 2IVOA 2HOEA 4BC3A 2I7PA 3FZMA 3R8EA 1E4GT 1IG8A 3DWLA 3EKSA 3ID8A 4K25A 5AFUH 3VGKA 3U8XA 1DKGD 1HKCA 5AQXA 2HMPA 4FWSA 1KAXA 3CJ9A 2P9PB 4M63C 5ELZA 1V4TA 2P9NA 4CZFA 2E1ZA 4Z94A 4BRCA 5JLFA 3FE1A 1U6ZA 4CZJA 4J8FA 5BRDA 4JD2A 5AQGA 3A8YA 4QS8A 1BO5O 3S41A 2E1YA 3SMSA 2ASPA 4BRGA 2E2OA 2W40A 2FF6A 5AQIA 2AP1A 4GNIA 2ZF5O 5BREA 4H5VA 4FL9A 1Y64A 4M7YA 3W3DA 3VF4A 1NGEA 3WXLA 5E84A 5BPLA 3FZKA 3SLCA 2CGJA 2CGKA 2YCHA 3P4IA 3A5MC 4MO4A 3QBXA 4DHYA 4CZKA 3EL2A 1HX1A 3BP8A 1SAZA 5AQUA 3VEVA 4CBUA 1ZXOA 2P9PA 4BVOA 3MN6A 4ISGA 3SMPA 4QS9A 2AA4A 2FXUA 2GTDA 5BN9A 5AQPA 4AM7A 1GLDG 3WQUA 3DJCA 2FF3B 3MDQA
chains in the Genus database with same CATH superfamily
4JAXA 5EX5A 4DQIA 1C0UA 3HBTA 3MMVA 4IOCL 2HB5A 4AHRA 2P9LB 2QWNA 4CGFA 2BANA 4CEEA 3AVCA 3DLBA 3TR8A 3U6FA 1SL1A 3AVIA 1QSSA 2D1KA 4GKJK 4H0XB 4CK1A 1YXQA 2VGMA 4RCHA 3PIOL 4BRMA 3SQ2A 4HUEA 4BC5A 4B3SK 3CI5A 1TUYA 3UKUB 2O4GA 4U7BA 1X1PA 4FWLA 1NGAA 3THWB 1KTQA 3IUCA 2G8HA 2A41A 5C15A 3OYGA 4FZXC 2WONA 1IJJA 5KPRA 2OANA 4GVEA 2ZGYA 3K0SA 3THXB 4CZHA 4CJEA 1S6PA 3O3GA 4BE2A 2O8DB 4BC4A 1U47A 5HL7L 2P9SA 3UE5A 1A5VA 3H6EA 4M3WA 1UA1A 3O08A 1RBSA 2G8UA 5MLCQ 1IBMK 4FYDA 1LWCA 2FC0A 4CF9A 2IS3A 3IG1A 2KQ2A 1NOZA 3NH0A 1NK0A 3L2WA 2A6AA 1BOTO 3OYJA 3VQEA 4LFBK 3WXMB 4B9SA 1YF5L 3V81A 4WYBA 2R7YA 3K5OA 4H0OA 1BISA 3MN5A 4R5PA 3CFRA 3VQCA 3PSIA 1FW6A 4KBOA 4CBXA 4DQPA 1NBWA 2DFHA 3VTIA 3SAGA 2P9UB 3OBWA 2A3ZA 4HTUA 2IGIA 4CHYA 2QWOA 1B92A 4H4OA 3O80A 4CK3A 1X9SA 4BQLA 1NJZA 1BA0A 1QTMA 3KVGA 4X64K 3OY9A 1GLEG 2E20A 3AA2A 4JKBA 1IKVA 1TKTA 3LAMA 1CLQA 4M3YA 4PKGA 1NK5A 3RRHA 3LALA 2BDPA 3EEQA 4FK4A 1RDBA 4Z4GA 4UQGA 3E9LA 4JKCA 4Z4FA 4CFBA 1XUPO 1XHXA 1NMDA 2VCPA 4HUFA 4DV1K 4MDBA 2ZWHA 1ASWA 4YOVA 2QI2A 5EVZA 5DM6L 3KLHA 4A61A 4K8XA 1EXQA 1IH7A 1QQNA 2P9SB 4YY3K 1VSIA 1RT1A 1RTJA 1BG3A 4KH5A 1ZYQA 2Q0UA 4RW4A 3LDPA 1NK9A 4WQ4A 3HPHA 1SQKA 1MU2A 2W6KA 2P9IB 4CHZA 4KHSA 1ILYA 1LOTB 5C0YA 3PSFA 4IO8A 4Z0UA 3CFPA 3TAPA 3VERA 3PLAA 4M3UA 5CZ2A 4I7FA 3ZYYX 3FGUA 4E7LA 4JNEA 2W41A 4L3QA 3K9KA 3V9ZA 3SPZA 2VWJA 3SUOA 1A5WA 3J8AA 1VQ9N 5CY4A 5AQTA 5FPMA 5C24A 3LP2A 1KAYA 3V1RA 5CZ1A 1KVCA 2PYLA 2RF2A 4QS7A 2HHVA 1GOBA 4B08A 3MXMA 3O8MA 3CQ8A 1HPZA 3WNFA 3KD5E 2E88A 4BRAA 1HKGA 2DFFA 3DOLA 4EHUA 5KGWA 1M1KO 2G8IA 1BHLA 3BGRA 3OS0A 2HF4A 3WUHA 3C94A 3GBTA 1XQSC 4KB0A 3MN7A 3MAQA 2VQEK 4OPKA 1FKOA 1TV6A 5AQOA 3ZEUA 4BREA 3MXIA 3KTQA 2BTFA 4CJLA 1T6DA 4CZMA 3T1YK 3Q7BA 2A40A 3L0QA 3CC4N 1D8YA 2OPSA 1R59O 4FLVA 4KFBA 1D4XA 4JEPA 1NKEA 3MWPA 4BRFA 4B8AB 4BR0A 3LANA 3H3OB 4J2AA 4JKFA 1EQYA 4PHTX 4X66K 4DG1A 2GV9A 3ZX2A 4K43A 1Z25A 3ZETB 3H1QA 1GOCA 1ZBLA 3M1FA 4K41A 1T8EA 4IOXA 1BCMA 2IVNA 4CD1A 4JI3K 1QZ5A 3HZ6A 4H0VB 4OPAA 5DMRA 4CF1A 3E66A 3BZKA 4WQ5C 3MWTA 3VN5A 3SI6A 4KI6A 4FWNA 4E1NA 4LFCK 3KK7A 5C2FA 4FJ8A 5AQQA 3O4WA 2RKIA 3CCVN 3JS6A 3VEYA 2XY7A 3CJAA 3DXMA 3ZSQA 5EOYA 4IDKA 3GDQA 5AQWA 5JMVA 3HP9A 4DFPA 4FWQA 1HNVA 3V1QA 4DS4A 4DMNA 4FLYA 2X6SA 5B8HA 1S72N 4FM2A 3A2FA 3EZWA 3AGRA 4DS5A 5M1KA 2DPNA 4HWIA 2HHXA 4DSIA 2HNDA 3I0SA 3NVMA 4BQZA 5FLXO 3G10A 1ZBHA 3AVLA 3WNHA 2OYQA 1YVUA 4FWRA 4CCHA 3ZEUB 1KQSM 2Z1JA 4YOXA 3HTVA 3ENOA 3M8SA 3P1GA 1X9WA 4MLEA 3FLCO 4DR2K 1Q82O 4DR3K 3AAPA 1NGBA 4FJIA 2O8FA 1IKWA 3JAMO 2YHBA 5CR4A 1FJGK 3F9MA 3DYAA 3K5LA 4RW8A 3PV8A 1GLAG 4PWDA 4BR2A 3VQ8A 5LMNK 3KD1E 4OPJA 2PYJA 2UUAK 1NOYA 1T44A 3CPWM 3ZT0A 4O55A 4F2RA 3P5JA 1TGOA 4QCLA 4BROA 1YAGA 3HM9A 3QO9A 3NE6A 5DK5A 1BU6O 5SZTA 4JRQA 2IVOA 1VQON 4KTZA 1IG8A 3DWLA 3HOTA 1L5UA 5HOOA 1G15A 1KAXA 3CJ9A 1WAFA 3QNOA 1V4TA 2P9NA 4CZFA 3J7YP 4Z94A 3AVAA 4BRCA 5JLFA 4KTQA 2YKMA 5I3UA 1XNQK 1Q7YO 4CF0A 2O8CA 1M90O 2HBMA 3E9OA 5FDLA 4AHTA 3BZCA 5J2NA 1XNRK 3SMSA 2OCEA 4DLGA 2E2OA 1N5YA 1JXEA 3SUQA 5AQIA 3RR7A 1SV5A 2AP1A 4GNIA 3M5RA 1JLAA 4H5VA 1Y64A 3DLRA 2ETJA 4F2SA 5E84A 2NRTA 2KLAA 1QHTA 3NAEA 4MO4A 3NGZA 3RMDA 3TAGA 1WBBA 4DHYA 3M8RA 3O3FA 1JXBA 4ILGB 3BP8A 1SAZA 4DTPA 3TABA 3LWMA 1ZXOA 2P9PA 4BVOA 4I2QA 3MN6A 1I94K 4A5BA 4NCAA 3L3VA 1TK8A 4AM7A 5AQPA 4CIGA 3DLKA 3DJCA 4OPHA 1TKZA 4H0YB 3OYKA 3SQ0A 2CH5A 3VF2A 4ID5A 5LL6Z 3ZT2A 4Y0WA 1RTHA 1JCEA 3VESA 3ZSXA 5LY3A 4KREA 4BRNA 3CC7N 4FJLA 1G99A 4LF7K 2G8WA 2F4VK 4Y1CA 2QWRA 4C8KA 3THVA 2X6NA 3VEXA 3ZSOA 2VQFK 2VG7A 2Z1HA 4H5TA 3MEGA 2GWKA 2E2NA 4RW9A 1KVBA 2GUIA 4B3RK 4DR4K 4WQ4C 3VA0A 3IFRA 1Q9XA 2FBVA 4CHQA 4KHYA 4DQSA 1VHXA 2QWQA 1S1UA 4FLWA 1S6QA 3F9KA 1MA9B 1E3MA 4OGEA 5GAEP 3B6PA 4C8MA 5AQLA 3AV9A 1KD1O 4A2AA 4OGCA 4OJRA 1HPMA 3RTVA 3VA3A 2P9LA 3D7EO 2YV0X 3C0BA 1VSJA 1Z05A 2I7NA 2P9NB 3UKRA 3ZCMA 4ELVA 1I3AA 2ZE2A 3L4QA 4CIEA 2O8CB 5KRTA 5GIPA 3WNEA 4JS5A 2HBKA 2XY6A 3HT3A 3QEVA 3NCIA 1NK7A 2FSKA 3R1XA 1QE1A 3ZSWA 3UKUA 4CJUA 5GIOA 3THYB 1YJNN 2ATQA 4B3MK 3DXKA 1EWRA 1HKBA 3THWA 1K8AO 5J2PA 3NGIA 2HSTA 4CJSA 3CM5A 4KHNA 1F21A 2KFNA 4DQQA 2GELA 4CJ5A 5FPEA 4H0TB 3THXA 3HXMA 2Z1GA 1IKXA 4KPYA 3HOSA 2O8DA 1T7PA 1VSHA 1WSJA 4FWMA 4JHDB 2BGGA 1HR0K 3TI0A 4FO0A 3M3ZA 4B1ZA 1RILA 3HYFA 4DV2K 2PZSA 4KHWA 2VGNA 2F8SA 1L3TA 4F9OA 4E1MA 3L2UA 4DR7K 2AJQA 4A59A 1VSLA 1RDAA 2YNHA 4B1VA 3CPEA 3SCXA 3H46O 1VQPN 4FW1A 4XH5A 1HLUA 1JLGA 4E7KA 3D2FB 4LSLA 4I6MA 1WSEA 3GOIA 4DF4A 4PKIA 4A5AA 3SPYA 3NFAA 4HCCA 3T3FA 3HPGA 2UXBK 3OJSA 3ZSYA 3TSQA 4CJ7A 3V1OA 3ULDA 4RWTA 4FJGA 2P5OA 5C10A 4Z4EA 4IWVA 1IV0A 4H0PA 4BY9C 3R3LA 2XRIA 3AVKA 3WXJA 2OA8A 1X3MA 4IDHA 5K14A 2QKKA 4X62K 1T6CA 3OBYA 4E7JA 2YHAA 1Q9YA 1LW2A 1NKCA 2VG6A 3J81O 3CERA 4IG0A 1NG9A 3WXIA 2P9UA 5AQNA 3LZIA 3V9WA 5AQYA 3U9ZA 4V19S 3QIOA 4O0IA 3Q7CA 3UKRB 4CJTA 3PX0A 3ZSRA 4CEFA 3LL3A 4H5NA 3KWGA 1WN7A 4DQRA 3BUZB 3SK3A 3A5LC 1IG9A 3AVGA 4RW6A 3NGYA 4WCEL 4DUZK 4TSXA 4ZTJA 5T7BA 2P51A 3NF9A 4XIUA 1QHAA 2VYPA 3I8BA 3VQPA 3R6MA 3DXKB 4CK2A 3OHRA 4CZGA 1NK4A 1NGFA 4BRDA 1KFDA 3V4IA 3FFIA 1RT3A 5M1PA 3KHYA 4DFMA 2FSJA 3MK6A 4B9QA 2WTUA 1LAVA 1ATRA 3J80O 1WNSA 2WBNA 3N4QA 2P9KA 4FLXA 1S5JA 1W97L 3KK2A 4B9VA 4AQYK 3NF7A 3LWLA 3S3MA 3AA4A 4NYNA 1ZBUA 4HHTA 4DTMA 3HL8A 5F1XA 1J53A 3T7ZA 1NGGA 3MXJA 2P9IA 1HQEA 3QMLA 4AH9A 4CJPA 3CCJN 1K73O 1Z26A 4HVJA 4QOZB 3ENHA 3TTDA 4I6MB 1HRHA 1S22A 2G8KA 2XHBA 2P1JA 3O9SA 2O8BB 1RT2A 1BUPA 5KPTA 3KLGA 5BRFA 1L3UA 1BQNA 2GUPA 1TYQB 1X9JA 1VQ5N 4FPAA 2NRXA 1C1BA 2Q97A 2WOMA 3KZBA 4ID1A 4A57A 3VEZA 4WFAL 3CCQN 4O5BA 3KLIA 3KK3A 3AAQA 4YNQA 1W2BM 4BR7A 5TKYA 1SKSA 4DSKA 3CXCM 1LV5A 1Q86O 1W7AA 4B1XB 1QZ6A 2HF3A 1YT3A 1SKWA 3L4IA 4KHQA 1OKJA 4CD3A 1GLJO 3BEXA 5GINA 4ELTA 1O1WA 4KHPK 3HP6A 1Q8IA 4BDYA 1LW0A 4DFJA 4O5FA 3FFKB 1L3SA 1BDGA 4I2PA 3PO5A 1IBKK 3PY8A 3QFPA 3PX4A 1XI1A 3P83D 4YOTA 4IKFA 4ZTFA 2P9KB 3ZT4A 2HHWA 3M8QA 4KI4A 2OPQA 1N34K 1JL1A 3F73A 4DTUA 3TAFA 1S1TA 1EETA 4CZEA 2FBXA 1VRUA 4F3OA 4IG3A 4BRIA 3OS1A 1X3NA 1HNXK 4GY2B 3ZETA 2A1SA 1D9DA 1E4FT 1W9HA 4KH4A 4BRLA 4CJ4A 3VGMA 1C0FA 4FWPA 4FVMA 4JI1K 4M7XA 2NRWA 3IRXA 3QESA 1VQ6N 3C7NB 3MN9A 1GLBG 4GV3A 3ZSVA 3G4SN 3LDLA 2B4JA 5LJVA 1C0TA 3CC2N 4BR9A 3CFOA 4ILJA 1S3XA 3O1WA 3DLGA 4AHSA 1HNWK 2BUPA 3VQBA 3CJBA 3SZ2A 1VSEA 3LP1A 4JKDA 5AZJA 5FPNA 2HHSA 1ZBIA 3QICA 4MDAA 4KB1A 1SL0A 1K6YA 2JLEA 1VQMN 3ID6A 4DB3A 2E8AA 3HO1A 5I9EB 1IO2A 3TPQA 3TWHA 4FJHA 1HNIA 3LDSA 2PY5A 2OPRA 3VETA 2HHUA 1TL1A 4EIAA 1YUWA 3O3HA 2UU9K 2G8FA 3CHWA 1K8KA 1L3VA 3B6OA 5HLFA 4W5NA 1P90A 2NZTA 3EZ5A 2GBZA 4OLBA 3EKSA 1BCOA 3QEWA 1NKBA 3U8XA 1HKCA 1RBTA 1C1AA 4FWSA 4M63C 5ELZA 4X65K 3KIOA 3PIPL 4CJWA 1U6ZA 4FJKA 4IO9L 3SV3A 3MEEA 5BRDA 4DF8A 4DWIA 4JI2K 1BO5O 2FF6A 1S1VA 2ZF5O 5BREA 3VF4A 4DU3A 1NGEA 3FZKA 1LAWA 2YCHA 1YIJN 4CZKA 5I42A 1CXQA 4LH4A 5CHIA 2NNWA 4LF6K 2O4IA 5AQUA 1RBRA 4C8OA 1VQLN 4ISGA 1HJRA 3AO1A 1VSKA 5FROA 2ZJPL 4QS9A 2Y1IA 2GTDA 4UY8O 4J2EA 3H08A 1WSGA 3WNGA 5HRPA 2KKZA 3CG7A 3LDNA 4CERA 1SZ2A 3ZT3A 5AZJB 4DV7K 4I9QA 1VQ7N 3LPTA 2F9TA 4OO1J 3C6UA 1EX4A 3SBTA 1HYSA 2W42A 2OZMA 3L2QA 1RBUA 4DTSA 3A5OC 2QXLA 4IFEA 3CCRN 5A2QO 4NYFA 1DGKN 3T1HK 4BGBA 2H3GX 5E26A 1IBLK 4FJNA 2FBYA 3VEOA 3WQTA 3CCSN 3EN9A 4CZLA 3QB0A 5DM7L 3GG4A 3MX2A 3P31A 4CGGA 3G6EN 2IAJA 4CEOA 4C1NI 4U67L 3CD6N 3AY9A 1RFQA 1K8KB 3DMJA 1JL2A 2UUBK 2UYTA 2PAVA 5LJWA 3W0LA 4H5WA 4WFNL 4BDZA 3VPZA 4DFKA 1U04A 2KTQA 1YTUA 2GEMA 4IZ9A 1U2VA 4IFYA 2A1RA 4B9NA 2NRRA 5JVHL 1U4BA 3VQ6A 4OLAA 3WEEB 3BF3A 4YOWA 2IIRA 4GW6A 4JKAA 3CJ1A 1BI4A 4NXMK 3D0PA 3CCLN 1KLMA 1TKXA 1B9DA 3O9QA 4OVLA 4BRPA 5BRHA 4M3TA 4FSVA 3VQ5A 4IXCA 1TAUA 2F9WA 1ZBFA 3SAHA 4CBWA 4F3TA 4FLUA 3MCPA 5EXWA 4EHTA 4MLHA 4BRQA 4BACA 3ALYA 2IVPA 4BE1A 3WXKA 2GX9A 2ITMA 1CZAN 4DV6K 1P8ZA 3HRGA 3VQAA 1DEJA 3C95A 5F0XA 3CJCA 3G0ZA 1ATNA 5FPDA 5IWAK 4YHHK 1HUXA 4KO0A 3HSTB 1WAJA 1QS4A 1MWKA 2OTLN 3O1BA 3OYHA 2HNZA 5JICA 4HCBA 4EAHD 3THYA 3DOKA 3C6AA 1WB9A 3AGKA 1YJ9N 2QW9A 2YNGA 2A5XA 1DLOA 1C1CA 4CI6A 5AZIB 3KWIA 4HTLA 4CHNA 2IC3A 4FJXA 1HJOA 2HNYA 5FRMA 2F8TA 3AVBA 4FWKA 2G8VA 2NRZA 4L8RB 3K59A 1UWBA 4JHDA 1KRPA 2YNIA 4FJ5A 1OH6A 1SS6A 2E6MA 1CZ9A 4FK0A 1OH8A 4NCBA 1ITGA 2FLOA 1R0AA 3HM8A 4DSJA 1DT9A 1FXXA 1U2VB 1XHZA 4N76A 3VOVA 3DRPA 2KZZA 4BWMA 1RT7A 3UB5A 4Z4CA 4LSNA 3IMXA 3NMUA 3D2FA 3V6DA 4DTNA 3BDPA 2CH6A 3O4NA 1BI4B 3AO2A 4LF8K 4JK9A 4KHUA 2HBJA 1NJYA 4BG9A 2I5JA 4EP4A 1MDUB 1QQCA 1RDWX 3RSEB 5HRSA 2F96A 1NLVA 1NGIA 2WFBA 4DU1A 4OKKA 4DQ8A 4CJRA 3LDQA 4B9UA 3SJJA 3CIPA 1SL2A 3PUFA 1YI2N 3VGLA 1ZC6A 3U4LA 5BPMA 5AJ3K 5FRNA 4DUYK 1BA1A 2QEXN 1NGJA 2RHKA 2HHQA 4BDPA 2YJEA 4M3XA 5KRSA 4JI8K 4GV6A 5GAGP 3TAQA 3L2VA 3LDOA 4XH1A 3SAFA 3F5TA 1LWEA 4M42A 2O8EB 3SJHA 1RCHA 1CZBA 4B3TK 1RGIA 3D6RA 4R79A 4G9ZA 1NWKA 3KKRA 4YFUA 3HI0A 3I8DA 3WT0A 2EWSA 3BF1A 1JLQA 4PQUA 3DLHA 3CF5L 4CE9A 4AM6A 3CCUN 5AR0A 4AF1A 3AVHA 3HVTA 4BE0A 2NRVA 2VWKA 3TARA 1TKDA 5JLHA 5AQVA 4FVUA 4FJMA 1Z6RA 1VQ8N 2V7YA 3OYLA 4I9LA 4FOEA 4FM1A 4RTFD 4FWOA 4PL7A 2D0AA 3OTOK 5KQ8A 3C6HA 3QETA 4ELUA 3EE8A 4PY5A 1I39A 4OKEA 4NXNK 3IDHA 2O8BA 1S9GA 4YDUA 4QAGA 3DRSA 1DTQA 1RTIA 1W0HA 2E2QA 4GVMA 4FJ7A 2VG5A 2Q36A 2NLXA 5HRRA 4WQ5A 4CECA 5M1FA 1TYQA 2D4WA 5CYMA 3L3UA 4H4MA 3U3GA 4JV5K 5AFUA 1TVRA 4FCYA 4DTRA 1Q81O 4NCGA 4CGHA 1Y97A 3ATVA 4LF4K 3AA3A 4B1YB 1J9AA 3FZHA 3NVKA 3K9JA 2DTUA 4JI5K 1JLCA 3EE9A 1VSDA 4N5SA 3P39A 3ASMA 1SUQA 4BRHA 1ESVA 4XEIA 2Q31A 3TU5A 1H1VA 4RW7A 1EWQA 3QBWA 3M8PA 2Q2RA 5EY4A 1FKPA 3ULEB 4JI0K 3CETA 3E01A 1EKEA 3CMEN 4CFCA 1JCFA 2OPPA 3LP0A 1NGCA 3KLEA 4FOIA 4C23A 2Q1NA 1A5XA 4CZIA 1BGXT 3RMAA 2QTDA 1J5OA 3MEDA 1VRTA 2XY5A 3IS9A 2FSNA 4CEAA 1WOQA 2V51B 2QWLA 4DSLA 4JKEA 1VK0A 3VQQA 4Q5VA 3VEWA 4W5OA 4CW7B 1KCFA 4JK8A 3AO3A 2CGLA 2QA4N 4JS4A 4EZ6A 1QVGM 4A2BA 2Y1JA 2OTJN 4WE1A 4OKJA 4DV5K 2NRHA 3O9TA 4FXDA 4AHVA 1OVYA 2F7TA 1KSPA 4KAZA 3EKUA 3L8BA 1BWFO 1ASUA 3KLFA 2D0PA 3S9HA 1TUUA 2YHXA 5J2QA 4CJVA 1BIZA 2PBDA 3C7NA 3G25A 4JI6K 1N33K 3KJVA 2YKNA 1QQOA 2B5JA 5AQKA 4ZHRA 4Z4HA 4A62A 2X74A 3NHGA 3PO4A 4IEIA 2HVIA 4DCHA 2JGUA 1C0MA 1EP4A 1VQKN 3CJ7A 3AVMA 2QKBA 1WSIA 1TAQA 4FLZA 1BIUA 3T69A 2BH1A 1VSFA 2HOEA 4BC3A 3N4PA 2ZJQL 3FZMA 4FW2A 4K25A 5AFUH 5AQXA 2HMPA 3TAMA 4C1NK 1C6VA 1JLFA 5GADP 3VQDA 5IT9O 1TK0A 3FE1A 3CCEN 3AVFA 3HJFA 4Z4IA 3JSMA 4JD2A 1BQMA 3V9XA 5AQGA 2IOCA 1OH7A 4IEEA 5D3GA 3K2PA 4BRGA 3C6TA 4CGDA 3E9PA 4AILC 4E7IA 3MX5A 1VSMA 1YJWN 2E5LK 4FZZA 3W3DA 2CGJA 2CGKA 3ENBA 1HQUA 3P4IA 4KRFA 2HVHA 3QBXA 2PFUA 1HX1A 4KV8A 3VEVA 4CBUA 3QEIA 1N6QA 4Y1DA 1XMOK 1YHQN 1J54A 3SMPA 2FXUA 1T03A 5BN9A 3SBGA 3J7ZO 2FBTA 1GLDG 1RT4A 2FF3B 2QXFA 4NB4A 3F2KA 3OJUA 3OVNA 4E89A 3HVRA 1KXPA 3DRRA 2ZD1A 4LC9B 3ITHA 5KPZA 4EZ9A 3QDKA 4LF5K 5BPNA 4M3ZA 3LPUA 1NJXA 3VENA 3HPOA 1K9MO 3VF6A 4CF2A 5LMUK 3LM2A 4ICLA 4K42A 3OYAA 5AQHA 1LWFA 3IAYA 4M45A 3OW2M 3RMBA 1T3VA 3EO3A 4CF8A 1EO1A 4CJQA 2W6LA 2V7ZA 4XH4A 4B1UB 2DFEA 4JRPA 3IKMA 5GAHP 3DAWA 3ATUA 3RR8A 2V52B 3KKSA 1QQMA 5KQDA 4O0JA 1NK8A 5KI6A 4NLBA 3JXUA 3O4QA 4B9MA 1SKRA 1C0GA 3A5NC 3R9PA 1YITN 2RPIA 5JS2A 5J2MA 4JD2B 3I55N 3RVCA 5E41A 4CGJA 5M1OA 4FPBA 4DSEA 4BRKA 1MWMA 4H5RA 1ZBSA 4N41A 4CEBA 2YX6A 3A0IX 3OYIA 3VQ4A 4CEDA 1JJ2M 1O13A 2D5RA 2Q0RA 1RT5A 4PKHA 4DTXA 4LY7A 4CEQA 3H3NO 3WEEA 4JI7K 3NF8A 4DTOA 3DI6A 1TK5A 4DSFA 1WBDA 3GL1A 1RBVA 3OYFA 2YHWA 2HHHK 1D9FA 2D0OA 2JWLA 4C8NA 3D2EA 3S3NA 1XC9A 4IOAL 2ASMA 2WC9A 4JKHA 4CGIA 1FK9A 4J2BA 3G71N 5M1QA 4B8CA 1S1XA 2OZSA 1B9FA 1LCUA 4DR5K 3ZLJA 3CMAN 3EY1A 4M41A 4YDUC 4HUGA 1RDCA 4MQ3A 4GV9A 5HBMA 3LZJA 1KFSA 1KLNA 3OYEA 5ADXA 3KK1A 1BL3A 3VMFB 3RRGA 4FLTA 2QWPA 4EFHA 1ASVA 1Q18A 1VAZA 3HSCA 3TTCA 1IKYA 4JI4K 1GLLO 1HYZA 1D5AA 3QFUA 2XO7A 4WF9L 1WLJA 5TKWA 1KVAA 5HP1A 3J7AP 4BVPA 1NGDA 4MO5A 2X78A 4EP5A 4O8KA 4E3SA 2HW3A 1GOAA 1OVQA 1JLBA 3VQ9A 5C25A 5CE3A 4BR5A 4BG8A 1DTTA 1REVA 3K57A 5AZIA 2UXDK 4FJ9A 3GE1A 2UXCK 4LH5A 5C12A 1RNHA 4DU4A 1U49A 2E6LA 1OH5A 2QM1A 2GWJA 3CCMN 4IJNA 4IFVA 3K5MA 4K8ZA 4JN4A 1RDDA 3E1YA 3M6GA 4LF9K 1RTDA 5AQZA 4KH6A 4J2DA 2VWBA 4PL8A 3UIQA 3FR0A 1VQ4N 4M3RA 3AA5X 3SQ1A 4DKWA 2QWMA 4CFAA 4CJFA 2E4LA 3D2EB 4E1JA 4BC2A 3D45A 5KTQA 3NBPA 2YJFA 3NH1A 3RSEA 1XMQK 3V9SA 2ZM6K 4Q0BA 3LP3A 4GMJB 3SQ4A 1J6ZA 3SYZA 4FK2A 4LFAK 5AQFA 3SV4A 3L6QA 4JKGA 1YVNA 1QVFM 3OA9A 4DLEA 4BR4A 1NM1A 1XWLA 4CHOA 3ZX3A 4AHCA 3CQYA 5HRNA 1VQNN 1UAXA 3SUPA 4LD0A 4PUOA 3TTFA 4W5TA 1KAZA 3BY5A 5ADXH 3QNNA 3S3OA 1WSHA 3RMCA 1X9MA 4W5QA 1RDUA 2D0BA 1U45A 3JYTA 2O8EA 5CYQA 4DV3K 1ATSA 3OYCA 2NUBA 3LAKA 1TL3A 4YOUA 1HYVA 2Z1IA 2A42A 3LM9A 3OYBA 4K0KK 3AARA 3DLLL 2D0CA 3HK2A 4DR6K 1QSLA 4C8LA 3DXMB 3TSPA 3CM6A 3U9DA 2RE2A 5F2RA 1YTAA 4CIFA 5H1SQ 3SNNA 3ZX0A 2WUSA 3O5BA 5AQMA 4FJJA 3ZT1A 3V9UA 2LSNA 3OYDA 3B8AX 1NU0A 4N56A 4ISFA 2J4RA 2EHGA 2ASOA 2YNFA 2KHOA 4NO7A 5C2DA 5AQJA 4CJ3A 1RT6A 4JK7A 1T05A 3I33A 1J5EK 3VQ7A 4FM0A 4ISEA 4WFBL 3H1VX 3OS2A 1NGHA 4DV0K 3QIPA 5M1NA 5AQRA 3H45C 3TANA 1JCGA 2ZJRL 2E2PA 3NDKA 4RG8A 2RN2A 4CVNE 3AO4A 3NH2A 4IBNA 2O8FB 2ZQBA 2DY4A 3T19A 4G1QA 5AQSA 4CEZA 4DR1K 2HBLA 3O6WA 3I56N 3EYZA 1S1WA 1NNEA 4JKGB 3DM2A 3QEPA 5J1EA 4YORA 3AVNA 2XY8A 3CQXA 1HMVA 1NMNA 3FZLA 4MFBA 2YHYA 2UUCK 2EX3A 3NF6A 5BN8A 2ITGA 4BGAA 3AO5A 2IDOA 4H8KA 2KW4A 4FZYA 2P5GA 4B1WB 1U48A 1JLEA 3ULEA 2QK9A 4W5RA 1GLFO 4PA1A 4JLHA 4O44A 4DV4K 4B9TA 3AVJA 3SUNA 3O9UA 1XC3A 2YI1A 1S9EA 1GLCG 5HROA 3TSUA 1WSFA 2Q3SA 2ZGZA 3FZFA 1V4SA 2B6AA 1WUAA 4IJAA 1NJWA 1UOCA 3K5NA 4H03B 1CXUA 3QERA 5BR9A 5JS1A 5SWMA 3OYMA 1HNZK 3I0RA 1NJIO 2I7PA 4O8UA 3L2RA 4CESA 4CFDA 3R8EA 3QLHA 1E4GT 1KC8O 4KKOA 3ID8A 3VGKA 3QINA 3ISNC 3C65A 3RWUA 5KGXA 1JKHA 1DKGD 4CJKA 1N8RO 4CHPA 2P9PB 3T1AA 3K58A 4JYAK 1QSYA 2E1ZA 5JVGL 2BE2A 1N32K 4CZJA 3CYMA 4J8FA 3P38A 2HHTA 1N36K 2HMIA 3A8YA 4QS8A 3OYNA 3S41A 2E1YA 1NK6A 4F4KA 2ASPA 4B3OA 4OX9K 4KTWA 2W40A 4N47A 4NLCA 2KZMA 3QEXA 5BR8K 4E7HA 4FL9A 4M7YA 5EU7A 4AHUA 3DLEA 4E19A 4YOYA 3ZSZA 3WXLA 5BPLA 3SLCA 4E0DA 3MECA 4DTJA 3A5MC 3U3YA 3VTHA 3EL2A 1UA0A 3PX6A 4ILHA 4F8RA 3O9RA 4BWJA 5C42A 2KFZA 2JWKA 3MCAB 2AA4A 4GKKK 3TAEA 3WQUA 4O4GA 4B9LA 3MDQA
chains in the Genus database with same CATH topology
3LDNA 4JAXA 5EX5A 2CH5A 4NB4A 1SZ2A 3VF2A 3F2KA 5AZJB 4Y0WA 1VQ7N 2F9TA 1JCEA 4OO1J 3VESA 5LY3A 3HBTA 3SBTA 4BRNA 3CC7N 1KXPA 3MMVA 4IOCL 4LC9B 1G99A 2P9LB 2QWNA 5KPZA 3QDKA 3A5OC 2QXLA 2QWRA 4IFEA 5BPNA 3CCRN 3VENA 1K9MO 1DGKN 4BGBA 3VF6A 2H3GX 5E26A 3VEXA 2D1KA 3WQTA 4H0XB 3LM2A 3VEOA 1YXQA 4K42A 3EN9A 3CCSN 2VGMA 4CZLA 4RCHA 3QB0A 5DM7L 5AQHA 4H5TA 4BRMA 3GG4A 3MX2A 2GWKA 2E2NA 3P31A 3PIOL 3G6EN 4BC5A 3OW2M 3CI5A 4WQ4C 1T3VA 3IFRA 4C1NI 4U67L 1TUYA 3AY9A 1RFQA 1K8KB 3UKUB 3CD6N 3EO3A 2UYTA 4U7BA 1EO1A 2PAVA 5LJWA 3W0LA 2V7ZA 4XH4A 4FWLA 4H5WA 2QWQA 1NGAA 4B1UB 3IKMA 3IUCA 4WFNL 2A41A 5GAHP 1MA9B 5C15A 3VPZA 5GAEP 3DAWA 3ATUA 5AQLA 2GEMA 1IJJA 2V52B 2OANA 4IZ9A 1U2VA 2ZGYA 4GVEA 4A2AA 5KPRA 1KD1O 1QQMA 1HPMA 5KQDA 2P9LA 3D7EO 3C0BA 4NLBA 1Z05A 2NRRA 2I7NA 2P9NB 3JXUA 3UKRA 4CZHA 5JVHL 3WEEB 3BF3A 1C0GA 3A5NC 4YOWA 4BC4A 3R9PA 1YITN 5HL7L 2IIRA 2P9SA 3L4QA 4JKAA 4JD2B 3UE5A 5GIPA 3I55N 3CJ1A 3H6EA 2HBKA 3RVCA 3O08A 3CCLN 3O9QA 2FSKA 4BRPA 5MLCQ 5BRHA 3R1XA 4FSVA 5M1OA 4FPBA 4IXCA 3UKUA 2F9WA 4BRKA 5GIOA 1YJNN 3SAHA 3DXKA 4CBWA 1MWMA 4H5RA 1ZBSA 1HKBA 2YX6A 3A0IX 3MCPA 1K8AO 5EXWA 4EHTA 4MLHA 4BRQA 2A6AA 1BOTO 1JJ2M 1O13A 2IVPA 2HSTA 3WXKA 2GX9A 2ITMA 3WXMB 1CZAN 2GELA 1P8ZA 4H0TB 3HRGA 1YF5L 5FPEA 1DEJA 2Q0RA 4WYBA 4PKHA 5F0XA 3HOSA 3CJCA 3H3NO 3WEEA 4H0OA 1ATNA 4FWMA 4JHDB 5FPDA 1HUXA 3MN5A 4FO0A 3M3ZA 4B1ZA 2VGNA 3GL1A 1MWKA 2OTLN 4F9OA 4KBOA 4CBXA 2YHWA 3O1BA 1NBWA 3VTIA 4A59A 2D0OA 5JICA 4B1VA 3CPEA 3SAGA 2JWLA 3D2EA 3H46O 2P9UB 3OBWA 2A3ZA 4EAHD 1VQPN 4IOAL 2QWOA 2ASMA 3O80A 2WC9A 4XH5A 1HLUA 3C6AA 4JKHA 4BQLA 1BA0A 3KVGA 3AGKA 3G71N 1YJ9N 2QW9A 3D2FB 2A5XA 5M1QA 4I6MA 3GOIA 1LCUA 4PKIA 4A5AA 1GLEG 2E20A 4JKBA 4CI6A 3CMAN 5AZIB 3KWIA 4YDUC 4HTLA 3TSQA 4CJ7A 4GV9A 4RWTA 5ADXA 1HJOA 5C10A 4IWVA 4FWKA 2NRZA 4H0PA 4BY9C 4JHDA 3R3LA 4PKGA 3VMFB 3WXJA 1X3MA 1SS6A 4IDHA 2QWPA 4EFHA 1Q18A 1T6CA 1VAZA 3OBYA 3HSCA 3TTCA 1GLLO 3QFUA 3CERA 3WXIA 3E9LA 2FLOA 2P9UA 4JKCA 3HM8A 5AQNA 4WF9L 1DT9A 1U2VB 5AQYA 5TKWA 3U9ZA 3VOVA 4BVPA 1NGDA 1XUPO 1NMDA 2VCPA 4MO5A 3UB5A 3Q7CA 3UKRB 4O8KA 3IMXA 3NMUA 4MDBA 2ZWHA 3D2FA 3LL3A 4H5NA 2QI2A 5EVZA 5DM6L 4YOVA 3KWGA 4A61A 2CH6A 5CE3A 1QQNA 2P9SB 3BUZB 4BR5A 4BG8A 3SK3A 3A5LC 5AZIA 4KH5A 1BG3A 4JK9A 4WCEL 2Q0UA 3GE1A 3LDPA 2HBJA 4WQ4A 4BG9A 1SQKA 5C12A 1MDUB 1RDWX 1QHAA 2VYPA 3I8BA 3RSEB 3R6MA 2P9IB 2QM1A 3DXKB 1NLVA 1NGIA 2WFBA 3OHRA 4CZGA 2GWJA 3CCMN 4IJNA 4DQ8A 1NGFA 4BRDA 3LDQA 1ILYA 1LOTB 5C0YA 4IO8A 3PLAA 4JN4A 3VERA 5M1PA 3CIPA 3KHYA 2FSJA 3E1YA 3MK6A 3ZYYX 4B9QA 1YI2N 3FGUA 3VGLA 1ATRA 1ZC6A 2W41A 4JNEA 3K9KA 4L3QA 2WBNA 3U4LA 5BPMA 3N4QA 3M6GA 2P9KA 1BA1A 2QEXN 1W97L 1NGJA 5AQZA 3J8AA 4KH6A 1VQ9N 2RHKA 2VWBA 4PL8A 5AQTA 3FR0A 1VQ4N 2YJEA 5FPMA 4GV6A 1KAYA 5GAGP 4DKWA 3LDOA 4XH1A 2QWMA 3SAFA 3F5TA 5F1XA 3D2EB 3T7ZA 4E1JA 4BC2A 4QS7A 3SJHA 1NGGA 2YJFA 1RGIA 3RSEA 2P9IA 3D6RA 3QMLA 4R79A 4G9ZA 3O8MA 3CCJN 1J6ZA 1K73O 1NWKA 2E88A 4BRAA 3ENHA 3TTDA 3HI0A 1HKGA 4I6MB 5AQFA 3L6QA 1S22A 3WT0A 2EWSA 4JKGA 1YVNA 4EHUA 3O9SA 3BF1A 1QVFM 3OA9A 4BR4A 1M1KO 1NM1A 3ZX3A 3CF5L 3CQYA 1BUPA 2HF4A 3WUHA 4AM6A 3CCUN 5KPTA 3GBTA 1VQNN 1XQSC 5AR0A 4AF1A 3TTFA 5BRFA 2NRVA 3MN7A 2GUPA 1KAZA 5ADXH 1TYQB 1X9JA 1VQ5N 4FPAA 5JLHA 5AQVA 2NRXA 5AQOA 4FVUA 3ZEUA 2Q97A 4BREA 1Z6RA 3KZBA 1RDUA 1VQ8N 2V7YA 4A57A 2BTFA 4FOEA 3VEZA 4WFAL 3CCQN 1ATSA 1T6DA 4RTFD 4CZMA 3Q7BA 2A40A 4FWOA 4PL7A 4YOUA 3AAQA 3L0QA 3CC4N 1W2BM 1R59O 5KQ8A 2A42A 3C6HA 3LM9A 4BR7A 5TKYA 1D4XA 4JEPA 3AARA 3EE8A 3MWPA 4BRFA 3CXCM 1Q86O 3DLLL 4B1XB 4BR0A 3H3OB 1QZ6A 2HF3A 1EQYA 4JKFA 4PHTX 3IDHA 3DXMB 4YDUA 3L4IA 3TSPA 1OKJA 4CD3A 3U9DA 1GLJO 2RE2A 4K43A 3ZETB 3BEXA 2E2QA 3ZX2A 5F2RA 3H1QA 5GINA 3M1FA 5H1SQ 4K41A 4IOXA 2IVNA 2Q36A 4CD1A 2NLXA 3ZX0A 1QZ5A 3HZ6A 2WUSA 4H0VB 3O5BA 4OPAA 4WQ5A 5M1FA 1TYQA 2D4WA 3E66A 4O5FA 4WQ5C 5AQMA 3MWTA 5AFUA 3B8AX 3FFKB 1BDGA 4ISFA 1Q81O 2J4RA 3QFPA 4FWNA 2ASOA 3KK7A 2KHOA 3ATVA 4NO7A 5C2DA 4B1YB 5C2FA 3FZHA 4OPHA 3NVKA 4YOTA 5AQJA 3K9JA 4H0YB 5AQQA 4JK7A 2P9KB 3EE9A 3I33A 3O4WA 4ISEA 4WFBL 3H1VX 3P39A 1NGHA 3CCVN 3JS6A 4BRHA 5M1NA 1ESVA 4XEIA 3VEYA 5AQRA 4CZEA 2Q31A 3TU5A 3CJAA 3H45C 3DXMA 5EOYA 1H1VA 4BRIA 1JCGA 2ZJRL 2E2PA 3QBWA 3GDQA 1X3NA 5AQWA 4GY2B 2Q2RA 5EY4A 3ZETA 3ULEB 5JMVA 3CETA 1E4FT 4FWQA 4KH4A 4BRLA 3VGMA 3CMEN 1C0FA 1JCFA 4FWPA 1NGCA 4M7XA 4FOIA 2NRWA 5AQSA 4C23A 1VQ6N 2Q1NA 4CZIA 3C7NB 3MN9A 1GLBG 2HBLA 5B8HA 4GV3A 3O6WA 2QTDA 3I56N 1S72N 3EZWA 4JKGB 3G4SN 3AGRA 3LDLA 5LJVA 2FSNA 3CC2N 2V51B 1WOQA 2QWLA 2DPNA 4HWIA 4YORA 4BR9A 5M1KA 4JKEA 3FZLA 3CQXA 4ILJA 3VEWA 1S3XA 3NVMA 4BQZA 3O1WA 2YHYA 4JK8A 2CGLA 5BN8A 2QA4N 4BGAA 2BUPA 1QVGM 4A2BA 4FWRA 3ZEUB 1KQSM 2OTJN 4B1WB 3CJBA 4YOXA 3HTVA 2NRHA 3O9TA 4JKDA 3ENOA 1OVYA 3ULEA 1GLFO 2F7TA 5AZJA 4MLEA 3FLCO 5FPNA 1Q82O 3EKUA 3QICA 4MDAA 3AAPA 1BWFO 1NGBA 3O9UA 1XC3A 2YI1A 2D0PA 5CR4A 1VQMN 1GLCG 1TUUA 3F9MA 3TSUA 2YHXA 3G25A 2PBDA 3C7NA 3ID6A 2E8AA 4DB3A 1GLAG 4BR2A 2ZGZA 3FZFA 1QQOA 5I9EB 3TPQA 5AQKA 4A62A 1V4SA 3VETA 1WUAA 4IJAA 4IEIA 4DCHA 4H03B 1T44A 4EIAA 3CPWM 1YUWA 5BR9A 1VQKN 4BROA 3CJ7A 3CHWA 1YAGA 1K8KA 3T69A 1BU6O 1P90A 2NZTA 2IVOA 2BH1A 2HOEA 1NJIO 4BC3A 2I7PA 4O8UA 3N4PA 1VQON 2ZJQL 3FZMA 3R8EA 1E4GT 1IG8A 3DWLA 3EKSA 1KC8O 3HOTA 3ID8A 4K25A 5AFUH 3VGKA 3C65A 5HOOA 3U8XA 1DKGD 1HKCA 5AQXA 1N8RO 2HMPA 4FWSA 4C1NK 1KAXA 3CJ9A 2P9PB 4M63C 5ELZA 1V4TA 2P9NA 5GADP 4CZFA 2E1ZA 4Z94A 4BRCA 5JLFA 3PIPL 5JVGL 3FE1A 3CCEN 1U6ZA 4CZJA 4IO9L 1Q7YO 4J8FA 3P38A 5BRDA 2HBMA 1M90O 4JD2A 3E9OA 5AQGA 3A8YA 4QS8A 1BO5O 3S41A 2E1YA 4IEEA 3SMSA 2ASPA 4BRGA 2E2OA 2W40A 2FF6A 4NLCA 5AQIA 3E9PA 1YJWN 2AP1A 3MX5A 4GNIA 2ZF5O 3M5RA 5BREA 4H5VA 4FL9A 1Y64A 4M7YA 3W3DA 4YOYA 3VF4A 1NGEA 3WXLA 5E84A 5BPLA 3FZKA 2NRTA 2KLAA 3SLCA 2CGJA 2CGKA 2YCHA 3ENBA 3P4IA 3A5MC 4MO4A 3VTHA 3QBXA 4DHYA 1YIJN 4CZKA 2PFUA 3EL2A 1HX1A 5CHIA 4ILGB 2NNWA 3BP8A 4ILHA 1SAZA 5AQUA 3VEVA 4CBUA 1ZXOA 2P9PA 3O9RA 4BVOA 1VQLN 3MN6A 1YHQN 4ISGA 3SMPA 4A5BA 2JWKA 2ZJPL 3MCAB 4QS9A 2AA4A 2FXUA 2GTDA 4UY8O 5BN9A 5AQPA 3SBGA 4AM7A 3J7ZO 1GLDG 3WQUA 2KKZA 3DJCA 2FF3B 3MDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDN A;  4JAX A;  5EX5 A;  2CH5 A;  4NB4 A;  1SZ2 A;  3VF2 A;  5AZJ B;  4Y0W A;  2F9T A;  1JCE A;  3VES A;  5LY3 A;  3HBT A;  4BRN A;  1KXP A;  3MMV A;  4LC9 B;  1G99 A;  2P9L B;  2QWN A;  5KPZ A;  3QDK A;  3A5O C;  2QXL A;  2QWR A;  5BPN A;  3VEN A;  1DGK N;  4BGB A;  3VF6 A;  2H3G X;  5E26 A;  3VEX A;  2D1K A;  3WQT A;  4H0X B;  3LM2 A;  3VEO A;  1YXQ A;  4K42 A;  3EN9 A;  4CZL A;  4RCH A;  3QB0 A;  5AQH A;  4H5T A;  4BRM A;  3GG4 A;  2GWK A;  2E2N A;  4BC5 A;  3CI5 A;  4WQ4 C;  3IFR A;  1TUY A;  3AY9 A;  1RFQ A;  1K8K B;  3UKU B;  3EO3 A;  2UYT A;  2PAV A;  5LJW A;  3W0L A;  2V7Z A;  4XH4 A;  4FWL A;  4H5W A;  2QWQ A;  1NGA A;  4B1U B;  3IUC A;  2A41 A;  1MA9 B;  3VPZ A;  3DAW A;  3ATU A;  5AQL A;  2GEM A;  1IJJ A;  2V52 B;  2OAN A;  4IZ9 A;  1U2V A;  2ZGY A;  4A2A A;  5KPR A;  1QQM A;  1HPM A;  5KQD A;  2P9L A;  3D7E O;  3C0B A;  1Z05 A;  3UKR A;  2I7N A;  2P9N B;  3JXU A;  4CZH A;  3WEE B;  3BF3 A;  1C0G A;  3A5N C;  4BC4 A;  3R9P A;  2IIR A;  2P9S A;  4JD2 B;  3UE5 A;  3CJ1 A;  3H6E A;  3O08 A;  2FSK A;  4BRP A;  5BRH A;  4FSV A;  4FPB A;  4IXC A;  3UKU A;  2F9W A;  4BRK A;  3DXK A;  4CBW A;  1MWM A;  4H5R A;  1ZBS A;  1HKB A;  3A0I X;  3MCP A;  5EXW A;  4EHT A;  4MLH A;  4BRQ A;  2A6A A;  1BOT O;  2IVP A;  3WXK A;  2ITM A;  1CZA N;  2GEL A;  1P8Z A;  4H0T B;  5FPE A;  1DEJ A;  2Q0R A;  4WYB A;  4PKH A;  5F0X A;  3CJC A;  3H3N O;  3WEE A;  4H0O A;  1ATN A;  4FWM A;  4JHD B;  5FPD A;  1HUX A;  3MN5 A;  4FO0 A;  3M3Z A;  4B1Z A;  3GL1 A;  1MWK A;  4F9O A;  4KBO A;  4CBX A;  2YHW A;  3O1B A;  1NBW A;  2D0O A;  5JIC A;  4B1V A;  3D2E A;  3H46 O;  2P9U B;  2A3Z A;  4EAH D;  2QWO A;  2ASM A;  3O80 A;  4XH5 A;  1HLU A;  4BQL A;  1BA0 A;  3KVG A;  2QW9 A;  3D2F B;  2A5X A;  4I6M A;  3GOI A;  1LCU A;  4PKI A;  1GLE G;  2E20 A;  4CI6 A;  5AZI B;  4YDU C;  4HTL A;  4CJ7 A;  4RWT A;  5ADX A;  1HJO A;  4IWV A;  4FWK A;  4H0P A;  4JHD A;  4PKG A;  3WXJ A;  1X3M A;  2QWP A;  4EFH A;  1Q18 A;  1T6C A;  3HSC A;  1GLL O;  3QFU A;  3CER A;  3WXI A;  2FLO A;  2P9U A;  5AQN A;  3HM8 A;  1U2V B;  5AQY A;  3U9Z A;  3VOV A;  4BVP A;  1NGD A;  1XUP O;  1NMD A;  2VCP A;  4MO5 A;  3UB5 A;  3UKR B;  4O8K A;  3IMX A;  2ZWH A;  3D2F A;  3LL3 A;  4H5N A;  5EVZ A;  4A61 A;  2CH6 A;  5CE3 A;  1QQN A;  2P9S B;  3BUZ B;  4BR5 A;  4BG8 A;  3SK3 A;  3A5L C;  5AZI A;  1BG3 A;  2Q0U A;  3GE1 A;  3LDP A;  4WQ4 A;  4BG9 A;  1SQK A;  1MDU B;  1RDW X;  1QHA A;  2VYP A;  3I8B A;  3RSE B;  3R6M A;  2P9I B;  2QM1 A;  3DXK B;  1NLV A;  1NGI A;  3OHR A;  4CZG A;  2GWJ A;  4IJN A;  4DQ8 A;  1NGF A;  4BRD A;  3LDQ A;  1LOT B;  4IO8 A;  4JN4 A;  3VER A;  3CIP A;  3KHY A;  2FSJ A;  3MK6 A;  4B9Q A;  3FGU A;  3VGL A;  1ATR A;  1ZC6 A;  2W41 A;  4JNE A;  4L3Q A;  3U4L A;  5BPM A;  3M6G A;  2P9K A;  1BA1 A;  1NGJ A;  5AQZ A;  3J8A A;  2VWB A;  4PL8 A;  5AQT A;  3FR0 A;  2YJE A;  5FPM A;  1KAY A;  3LDO A;  4XH1 A;  2QWM A;  5F1X A;  3D2E B;  4E1J A;  4BC2 A;  4QS7 A;  3SJH A;  1NGG A;  2YJF A;  1RGI A;  3RSE A;  2P9I A;  3QML A;  3O8M A;  1J6Z A;  1NWK A;  2E88 A;  4BRA A;  3ENH A;  3HI0 A;  1HKG A;  4I6M B;  5AQF A;  3L6Q A;  1S22 A;  3WT0 A;  2EWS A;  1YVN A;  4EHU A;  3BF1 A;  4BR4 A;  1NM1 A;  3ZX3 A;  3CQY A;  1BUP A;  2HF4 A;  3WUH A;  4AM6 A;  5KPT A;  3GBT A;  1XQS C;  5AR0 A;  5BRF A;  3MN7 A;  2GUP A;  1KAZ A;  5ADX H;  1TYQ B;  1X9J A;  4FPA A;  5JLH A;  5AQV A;  5AQO A;  3ZEU A;  2Q97 A;  4BRE A;  1Z6R A;  3KZB A;  2V7Y A;  2BTF A;  4FOE A;  3VEZ A;  1ATS A;  1T6D A;  4RTF D;  4CZM A;  2A40 A;  4FWO A;  4PL7 A;  3AAQ A;  3L0Q A;  1R59 O;  5KQ8 A;  2A42 A;  3LM9 A;  4BR7 A;  5TKY A;  1D4X A;  3AAR A;  4BRF A;  4B1X B;  4BR0 A;  3H3O B;  1QZ6 A;  2HF3 A;  1EQY A;  3IDH A;  3DXM B;  4YDU A;  3L4I A;  1OKJ A;  4CD3 A;  3U9D A;  1GLJ O;  4K43 A;  3ZET B;  3ZX2 A;  3BEX A;  2E2Q A;  5F2R A;  3H1Q A;  3M1F A;  4K41 A;  2IVN A;  2Q36 A;  4CD1 A;  2NLX A;  3ZX0 A;  1QZ5 A;  3HZ6 A;  2WUS A;  4H0V B;  3O5B A;  4WQ5 A;  1TYQ A;  2D4W A;  4WQ5 C;  4O5F A;  5AQM A;  5AFU A;  3B8A X;  3FFK B;  1BDG A;  4ISF A;  2J4R A;  3QFP A;  4FWN A;  2ASO A;  2KHO A;  3ATV A;  4NO7 A;  4B1Y B;  3FZH A;  5AQJ A;  4H0Y B;  5AQQ A;  2P9K B;  3I33 A;  3O4W A;  4ISE A;  3H1V X;  1NGH A;  3JS6 A;  4BRH A;  1ESV A;  4XEI A;  3VEY A;  5AQR A;  4CZE A;  2Q31 A;  3TU5 A;  3CJA A;  3H45 C;  3DXM A;  5EOY A;  1H1V A;  4BRI A;  1JCG A;  2E2P A;  3QBW A;  3GDQ A;  1X3N A;  5AQW A;  4GY2 B;  2Q2R A;  5EY4 A;  3ZET A;  3ULE B;  5JMV A;  3CET A;  1E4F T;  4FWQ A;  4BRL A;  3VGM A;  1C0F A;  1JCF A;  4FWP A;  1NGC A;  4M7X A;  4FOI A;  5AQS A;  4C23 A;  2Q1N A;  4CZI A;  3C7N B;  3MN9 A;  1GLB G;  5B8H A;  3O6W A;  3EZW A;  3LDL A;  5LJV A;  2FSN A;  1WOQ A;  2V51 B;  2QWL A;  2DPN A;  4HWI A;  4BR9 A;  3FZL A;  3CQX A;  3VEW A;  1S3X A;  4BQZ A;  3O1W A;  2YHY A;  2CGL A;  5BN8 A;  4BGA A;  2BUP A;  4A2B A;  4FWR A;  3ZEU B;  4B1W B;  3CJB A;  3HTV A;  2NRH A;  3ULE A;  3ENO A;  5AZJ A;  1GLF O;  4MLE A;  3FLC O;  5FPN A;  3EKU A;  3QIC A;  3AAP A;  1BWF O;  1NGB A;  1XC3 A;  2YI1 A;  2D0P A;  1GLC G;  1TUU A;  3F9M A;  2YHX A;  3G25 A;  2PBD A;  3C7N A;  4DB3 A;  2E8A A;  1GLA G;  4BR2 A;  2ZGZ A;  3FZF A;  1QQO A;  5I9E B;  3TPQ A;  5AQK A;  4A62 A;  1V4S A;  3VET A;  1WUA A;  4IJA A;  4DCH A;  4H03 B;  1T44 A;  4EIA A;  1YUW A;  5BR9 A;  4BRO A;  3CJ7 A;  3CHW A;  1YAG A;  1K8K A;  1BU6 O;  2NZT A;  2IVO A;  2HOE A;  4BC3 A;  2I7P A;  3FZM A;  3R8E A;  1E4G T;  1IG8 A;  3DWL A;  3EKS A;  3ID8 A;  4K25 A;  5AFU H;  3VGK A;  3U8X A;  1DKG D;  1HKC A;  5AQX A;  2HMP A;  4FWS A;  1KAX A;  3CJ9 A;  2P9P B;  4M63 C;  5ELZ A;  1V4T A;  2P9N A;  4CZF A;  2E1Z A;  4Z94 A;  4BRC A;  5JLF A;  3FE1 A;  1U6Z A;  4CZJ A;  4J8F A;  5BRD A;  4JD2 A;  5AQG A;  3A8Y A;  4QS8 A;  1BO5 O;  3S41 A;  2E1Y A;  3SMS A;  2ASP A;  4BRG A;  2E2O A;  2W40 A;  2FF6 A;  5AQI A;  2AP1 A;  4GNI A;  2ZF5 O;  5BRE A;  4H5V A;  4FL9 A;  1Y64 A;  4M7Y A;  3W3D A;  3VF4 A;  1NGE A;  3WXL A;  5E84 A;  5BPL A;  3FZK A;  3SLC A;  2CGJ A;  2CGK A;  2YCH A;  3P4I A;  3A5M C;  4MO4 A;  3QBX A;  4DHY A;  4CZK A;  3EL2 A;  1HX1 A;  3BP8 A;  1SAZ A;  5AQU A;  3VEV A;  4CBU A;  1ZXO A;  2P9P A;  4BVO A;  3MN6 A;  4ISG A;  3SMP A;  4QS9 A;  2AA4 A;  2FXU A;  2GTD A;  5BN9 A;  5AQP A;  4AM7 A;  1GLD G;  3WQU A;  3DJC A;  2FF3 B;  3MDQ A; 
#chains in the Genus database with same CATH topology
 4JAX A;  5EX5 A;  4DQI A;  1C0U A;  3HBT A;  3MMV A;  4IOC L;  2HB5 A;  4AHR A;  2P9L B;  2QWN A;  4CGF A;  2BAN A;  4CEE A;  3AVC A;  3DLB A;  3TR8 A;  3U6F A;  1SL1 A;  3AVI A;  1QSS A;  2D1K A;  4GKJ K;  4H0X B;  4CK1 A;  1YXQ A;  2VGM A;  4RCH A;  3PIO L;  4BRM A;  3SQ2 A;  4HUE A;  4BC5 A;  4B3S K;  3CI5 A;  1TUY A;  3UKU B;  2O4G A;  4U7B A;  1X1P A;  4FWL A;  1NGA A;  3THW B;  1KTQ A;  3IUC A;  2G8H A;  2A41 A;  5C15 A;  3OYG A;  4FZX C;  2WON A;  1IJJ A;  5KPR A;  2OAN A;  4GVE A;  2ZGY A;  3K0S A;  3THX B;  4CZH A;  4CJE A;  1S6P A;  3O3G A;  4BE2 A;  2O8D B;  4BC4 A;  1U47 A;  5HL7 L;  2P9S A;  3UE5 A;  1A5V A;  3H6E A;  4M3W A;  1UA1 A;  3O08 A;  1RBS A;  2G8U A;  5MLC Q;  1IBM K;  4FYD A;  1LWC A;  2FC0 A;  4CF9 A;  2IS3 A;  3IG1 A;  2KQ2 A;  1NOZ A;  3NH0 A;  1NK0 A;  3L2W A;  2A6A A;  1BOT O;  3OYJ A;  3VQE A;  4LFB K;  3WXM B;  4B9S A;  1YF5 L;  3V81 A;  4WYB A;  2R7Y A;  3K5O A;  4H0O A;  1BIS A;  3MN5 A;  4R5P A;  3CFR A;  3VQC A;  3PSI A;  1FW6 A;  4KBO A;  4CBX A;  4DQP A;  1NBW A;  2DFH A;  3VTI A;  3SAG A;  2P9U B;  3OBW A;  2A3Z A;  4HTU A;  2IGI A;  4CHY A;  2QWO A;  1B92 A;  4H4O A;  3O80 A;  4CK3 A;  1X9S A;  4BQL A;  1NJZ A;  1BA0 A;  1QTM A;  3KVG A;  4X64 K;  3OY9 A;  1GLE G;  2E20 A;  3AA2 A;  4JKB A;  1IKV A;  1TKT A;  3LAM A;  1CLQ A;  4M3Y A;  4PKG A;  1NK5 A;  3RRH A;  3LAL A;  2BDP A;  3EEQ A;  4FK4 A;  1RDB A;  4Z4G A;  4UQG A;  3E9L A;  4JKC A;  4Z4F A;  4CFB A;  1XUP O;  1XHX A;  1NMD A;  2VCP A;  4HUF A;  4DV1 K;  4MDB A;  2ZWH A;  1ASW A;  4YOV A;  2QI2 A;  5EVZ A;  5DM6 L;  3KLH A;  4A61 A;  4K8X A;  1EXQ A;  1IH7 A;  1QQN A;  2P9S B;  4YY3 K;  1VSI A;  1RT1 A;  1RTJ A;  1BG3 A;  4KH5 A;  1ZYQ A;  2Q0U A;  4RW4 A;  3LDP A;  1NK9 A;  4WQ4 A;  3HPH A;  1SQK A;  1MU2 A;  2W6K A;  2P9I B;  4CHZ A;  4KHS A;  1ILY A;  1LOT B;  5C0Y A;  3PSF A;  4IO8 A;  4Z0U A;  3CFP A;  3TAP A;  3VER A;  3PLA A;  4M3U A;  5CZ2 A;  4I7F A;  3ZYY X;  3FGU A;  4E7L A;  4JNE A;  2W41 A;  4L3Q A;  3K9K A;  3V9Z A;  3SPZ A;  2VWJ A;  3SUO A;  1A5W A;  3J8A A;  1VQ9 N;  5CY4 A;  5AQT A;  5FPM A;  5C24 A;  3LP2 A;  1KAY A;  3V1R A;  5CZ1 A;  1KVC A;  2PYL A;  2RF2 A;  4QS7 A;  2HHV A;  1GOB A;  4B08 A;  3MXM A;  3O8M A;  3CQ8 A;  1HPZ A;  3WNF A;  3KD5 E;  2E88 A;  4BRA A;  1HKG A;  2DFF A;  3DOL A;  4EHU A;  5KGW A;  1M1K O;  2G8I A;  1BHL A;  3BGR A;  3OS0 A;  2HF4 A;  3WUH A;  3C94 A;  3GBT A;  1XQS C;  4KB0 A;  3MN7 A;  3MAQ A;  2VQE K;  4OPK A;  1FKO A;  1TV6 A;  5AQO A;  3ZEU A;  4BRE A;  3MXI A;  3KTQ A;  2BTF A;  4CJL A;  1T6D A;  4CZM A;  3T1Y K;  3Q7B A;  2A40 A;  3L0Q A;  3CC4 N;  1D8Y A;  2OPS A;  1R59 O;  4FLV A;  4KFB A;  1D4X A;  4JEP A;  1NKE A;  3MWP A;  4BRF A;  4B8A B;  4BR0 A;  3LAN A;  3H3O B;  4J2A A;  4JKF A;  1EQY A;  4PHT X;  4X66 K;  4DG1 A;  2GV9 A;  3ZX2 A;  4K43 A;  1Z25 A;  3ZET B;  3H1Q A;  1GOC A;  1ZBL A;  3M1F A;  4K41 A;  1T8E A;  4IOX A;  1BCM A;  2IVN A;  4CD1 A;  4JI3 K;  1QZ5 A;  3HZ6 A;  4H0V B;  4OPA A;  5DMR A;  4CF1 A;  3E66 A;  3BZK A;  4WQ5 C;  3MWT A;  3VN5 A;  3SI6 A;  4KI6 A;  4FWN A;  4E1N A;  4LFC K;  3KK7 A;  5C2F A;  4FJ8 A;  5AQQ A;  3O4W A;  2RKI A;  3CCV N;  3JS6 A;  3VEY A;  2XY7 A;  3CJA A;  3DXM A;  3ZSQ A;  5EOY A;  4IDK A;  3GDQ A;  5AQW A;  5JMV A;  3HP9 A;  4DFP A;  4FWQ A;  1HNV A;  3V1Q A;  4DS4 A;  4DMN A;  4FLY A;  2X6S A;  5B8H A;  1S72 N;  4FM2 A;  3A2F A;  3EZW A;  3AGR A;  4DS5 A;  5M1K A;  2DPN A;  4HWI A;  2HHX A;  4DSI A;  2HND A;  3I0S A;  3NVM A;  4BQZ A;  5FLX O;  3G10 A;  1ZBH A;  3AVL A;  3WNH A;  2OYQ A;  1YVU A;  4FWR A;  4CCH A;  3ZEU B;  1KQS M;  2Z1J A;  4YOX A;  3HTV A;  3ENO A;  3M8S A;  3P1G A;  1X9W A;  4MLE A;  3FLC O;  4DR2 K;  1Q82 O;  4DR3 K;  3AAP A;  1NGB A;  4FJI A;  2O8F A;  1IKW A;  3JAM O;  2YHB A;  5CR4 A;  1FJG K;  3F9M A;  3DYA A;  3K5L A;  4RW8 A;  3PV8 A;  1GLA G;  4PWD A;  4BR2 A;  3VQ8 A;  5LMN K;  3KD1 E;  4OPJ A;  2PYJ A;  2UUA K;  1NOY A;  1T44 A;  3CPW M;  3ZT0 A;  4O55 A;  4F2R A;  3P5J A;  1TGO A;  4QCL A;  4BRO A;  1YAG A;  3HM9 A;  3QO9 A;  3NE6 A;  5DK5 A;  1BU6 O;  5SZT A;  4JRQ A;  2IVO A;  1VQO N;  4KTZ A;  1IG8 A;  3DWL A;  3HOT A;  1L5U A;  5HOO A;  1G15 A;  1KAX A;  3CJ9 A;  1WAF A;  3QNO A;  1V4T A;  2P9N A;  4CZF A;  3J7Y P;  4Z94 A;  3AVA A;  4BRC A;  5JLF A;  4KTQ A;  2YKM A;  5I3U A;  1XNQ K;  1Q7Y O;  4CF0 A;  2O8C A;  1M90 O;  2HBM A;  3E9O A;  5FDL A;  4AHT A;  3BZC A;  5J2N A;  1XNR K;  3SMS A;  2OCE A;  4DLG A;  2E2O A;  1N5Y A;  1JXE A;  3SUQ A;  5AQI A;  3RR7 A;  1SV5 A;  2AP1 A;  4GNI A;  3M5R A;  1JLA A;  4H5V A;  1Y64 A;  3DLR A;  2ETJ A;  4F2S A;  5E84 A;  2NRT A;  2KLA A;  1QHT A;  3NAE A;  4MO4 A;  3NGZ A;  3RMD A;  3TAG A;  1WBB A;  4DHY A;  3M8R A;  3O3F A;  1JXB A;  4ILG B;  3BP8 A;  1SAZ A;  4DTP A;  3TAB A;  3LWM A;  1ZXO A;  2P9P A;  4BVO A;  4I2Q A;  3MN6 A;  1I94 K;  4A5B A;  4NCA A;  3L3V A;  1TK8 A;  4AM7 A;  5AQP A;  4CIG A;  3DLK A;  3DJC A;  4OPH A;  1TKZ A;  4H0Y B;  3OYK A;  3SQ0 A;  2CH5 A;  3VF2 A;  4ID5 A;  5LL6 Z;  3ZT2 A;  4Y0W A;  1RTH A;  1JCE A;  3VES A;  3ZSX A;  5LY3 A;  4KRE A;  4BRN A;  3CC7 N;  4FJL A;  1G99 A;  4LF7 K;  2G8W A;  2F4V K;  4Y1C A;  2QWR A;  4C8K A;  3THV A;  2X6N A;  3VEX A;  3ZSO A;  2VQF K;  2VG7 A;  2Z1H A;  4H5T A;  3MEG A;  2GWK A;  2E2N A;  4RW9 A;  1KVB A;  2GUI A;  4B3R K;  4DR4 K;  4WQ4 C;  3VA0 A;  3IFR A;  1Q9X A;  2FBV A;  4CHQ A;  4KHY A;  4DQS A;  1VHX A;  2QWQ A;  1S1U A;  4FLW A;  1S6Q A;  3F9K A;  1MA9 B;  1E3M A;  4OGE A;  5GAE P;  3B6P A;  4C8M A;  5AQL A;  3AV9 A;  1KD1 O;  4A2A A;  4OGC A;  4OJR A;  1HPM A;  3RTV A;  3VA3 A;  2P9L A;  3D7E O;  2YV0 X;  3C0B A;  1VSJ A;  1Z05 A;  2I7N A;  2P9N B;  3UKR A;  3ZCM A;  4ELV A;  1I3A A;  2ZE2 A;  3L4Q A;  4CIE A;  2O8C B;  5KRT A;  5GIP A;  3WNE A;  4JS5 A;  2HBK A;  2XY6 A;  3HT3 A;  3QEV A;  3NCI A;  1NK7 A;  2FSK A;  3R1X A;  1QE1 A;  3ZSW A;  3UKU A;  4CJU A;  5GIO A;  3THY B;  1YJN N;  2ATQ A;  4B3M K;  3DXK A;  1EWR A;  1HKB A;  3THW A;  1K8A O;  5J2P A;  3NGI A;  2HST A;  4CJS A;  3CM5 A;  4KHN A;  1F21 A;  2KFN A;  4DQQ A;  2GEL A;  4CJ5 A;  5FPE A;  4H0T B;  3THX A;  3HXM A;  2Z1G A;  1IKX A;  4KPY A;  3HOS A;  2O8D A;  1T7P A;  1VSH A;  1WSJ A;  4FWM A;  4JHD B;  2BGG A;  1HR0 K;  3TI0 A;  4FO0 A;  3M3Z A;  4B1Z A;  1RIL A;  3HYF A;  4DV2 K;  2PZS A;  4KHW A;  2VGN A;  2F8S A;  1L3T A;  4F9O A;  4E1M A;  3L2U A;  4DR7 K;  2AJQ A;  4A59 A;  1VSL A;  1RDA A;  2YNH A;  4B1V A;  3CPE A;  3SCX A;  3H46 O;  1VQP N;  4FW1 A;  4XH5 A;  1HLU A;  1JLG A;  4E7K A;  3D2F B;  4LSL A;  4I6M A;  1WSE A;  3GOI A;  4DF4 A;  4PKI A;  4A5A A;  3SPY A;  3NFA A;  4HCC A;  3T3F A;  3HPG A;  2UXB K;  3OJS A;  3ZSY A;  3TSQ A;  4CJ7 A;  3V1O A;  3ULD A;  4RWT A;  4FJG A;  2P5O A;  5C10 A;  4Z4E A;  4IWV A;  1IV0 A;  4H0P A;  4BY9 C;  3R3L A;  2XRI A;  3AVK A;  3WXJ A;  2OA8 A;  1X3M A;  4IDH A;  5K14 A;  2QKK A;  4X62 K;  1T6C A;  3OBY A;  4E7J A;  2YHA A;  1Q9Y A;  1LW2 A;  1NKC A;  2VG6 A;  3J81 O;  3CER A;  4IG0 A;  1NG9 A;  3WXI A;  2P9U A;  5AQN A;  3LZI A;  3V9W A;  5AQY A;  3U9Z A;  4V19 S;  3QIO A;  4O0I A;  3Q7C A;  3UKR B;  4CJT A;  3PX0 A;  3ZSR A;  4CEF A;  3LL3 A;  4H5N A;  3KWG A;  1WN7 A;  4DQR A;  3BUZ B;  3SK3 A;  3A5L C;  1IG9 A;  3AVG A;  4RW6 A;  3NGY A;  4WCE L;  4DUZ K;  4TSX A;  4ZTJ A;  5T7B A;  2P51 A;  3NF9 A;  4XIU A;  1QHA A;  2VYP A;  3I8B A;  3VQP A;  3R6M A;  3DXK B;  4CK2 A;  3OHR A;  4CZG A;  1NK4 A;  1NGF A;  4BRD A;  1KFD A;  3V4I A;  3FFI A;  1RT3 A;  5M1P A;  3KHY A;  4DFM A;  2FSJ A;  3MK6 A;  4B9Q A;  2WTU A;  1LAV A;  1ATR A;  3J80 O;  1WNS A;  2WBN A;  3N4Q A;  2P9K A;  4FLX A;  1S5J A;  1W97 L;  3KK2 A;  4B9V A;  4AQY K;  3NF7 A;  3LWL A;  3S3M A;  3AA4 A;  4NYN A;  1ZBU A;  4HHT A;  4DTM A;  3HL8 A;  5F1X A;  1J53 A;  3T7Z A;  1NGG A;  3MXJ A;  2P9I A;  1HQE A;  3QML A;  4AH9 A;  4CJP A;  3CCJ N;  1K73 O;  1Z26 A;  4HVJ A;  4QOZ B;  3ENH A;  3TTD A;  4I6M B;  1HRH A;  1S22 A;  2G8K A;  2XHB A;  2P1J A;  3O9S A;  2O8B B;  1RT2 A;  1BUP A;  5KPT A;  3KLG A;  5BRF A;  1L3U A;  1BQN A;  2GUP A;  1TYQ B;  1X9J A;  1VQ5 N;  4FPA A;  2NRX A;  1C1B A;  2Q97 A;  2WOM A;  3KZB A;  4ID1 A;  4A57 A;  3VEZ A;  4WFA L;  3CCQ N;  4O5B A;  3KLI A;  3KK3 A;  3AAQ A;  4YNQ A;  1W2B M;  4BR7 A;  5TKY A;  1SKS A;  4DSK A;  3CXC M;  1LV5 A;  1Q86 O;  1W7A A;  4B1X B;  1QZ6 A;  2HF3 A;  1YT3 A;  1SKW A;  3L4I A;  4KHQ A;  1OKJ A;  4CD3 A;  1GLJ O;  3BEX A;  5GIN A;  4ELT A;  1O1W A;  4KHP K;  3HP6 A;  1Q8I A;  4BDY A;  1LW0 A;  4DFJ A;  4O5F A;  3FFK B;  1L3S A;  1BDG A;  4I2P A;  3PO5 A;  1IBK K;  3PY8 A;  3QFP A;  3PX4 A;  1XI1 A;  3P83 D;  4YOT A;  4IKF A;  4ZTF A;  2P9K B;  3ZT4 A;  2HHW A;  3M8Q A;  4KI4 A;  2OPQ A;  1N34 K;  1JL1 A;  3F73 A;  4DTU A;  3TAF A;  1S1T A;  1EET A;  4CZE A;  2FBX A;  1VRU A;  4F3O A;  4IG3 A;  4BRI A;  3OS1 A;  1X3N A;  1HNX K;  4GY2 B;  3ZET A;  2A1S A;  1D9D A;  1E4F T;  1W9H A;  4KH4 A;  4BRL A;  4CJ4 A;  3VGM A;  1C0F A;  4FWP A;  4FVM A;  4JI1 K;  4M7X A;  2NRW A;  3IRX A;  3QES A;  1VQ6 N;  3C7N B;  3MN9 A;  1GLB G;  4GV3 A;  3ZSV A;  3G4S N;  3LDL A;  2B4J A;  5LJV A;  1C0T A;  3CC2 N;  4BR9 A;  3CFO A;  4ILJ A;  1S3X A;  3O1W A;  3DLG A;  4AHS A;  1HNW K;  2BUP A;  3VQB A;  3CJB A;  3SZ2 A;  1VSE A;  3LP1 A;  4JKD A;  5AZJ A;  5FPN A;  2HHS A;  1ZBI A;  3QIC A;  4MDA A;  4KB1 A;  1SL0 A;  1K6Y A;  2JLE A;  1VQM N;  3ID6 A;  4DB3 A;  2E8A A;  3HO1 A;  5I9E B;  1IO2 A;  3TPQ A;  3TWH A;  4FJH A;  1HNI A;  3LDS A;  2PY5 A;  2OPR A;  3VET A;  2HHU A;  1TL1 A;  4EIA A;  1YUW A;  3O3H A;  2UU9 K;  2G8F A;  3CHW A;  1K8K A;  1L3V A;  3B6O A;  5HLF A;  4W5N A;  1P90 A;  2NZT A;  3EZ5 A;  2GBZ A;  4OLB A;  3EKS A;  1BCO A;  3QEW A;  1NKB A;  3U8X A;  1HKC A;  1RBT A;  1C1A A;  4FWS A;  4M63 C;  5ELZ A;  4X65 K;  3KIO A;  3PIP L;  4CJW A;  1U6Z A;  4FJK A;  4IO9 L;  3SV3 A;  3MEE A;  5BRD A;  4DF8 A;  4DWI A;  4JI2 K;  1BO5 O;  2FF6 A;  1S1V A;  2ZF5 O;  5BRE A;  3VF4 A;  4DU3 A;  1NGE A;  3FZK A;  1LAW A;  2YCH A;  1YIJ N;  4CZK A;  5I42 A;  1CXQ A;  4LH4 A;  5CHI A;  2NNW A;  4LF6 K;  2O4I A;  5AQU A;  1RBR A;  4C8O A;  1VQL N;  4ISG A;  1HJR A;  3AO1 A;  1VSK A;  5FRO A;  2ZJP L;  4QS9 A;  2Y1I A;  2GTD A;  4UY8 O;  4J2E A;  3H08 A;  1WSG A;  3WNG A;  5HRP A;  2KKZ A;  3CG7 A;  3LDN A;  4CER A;  1SZ2 A;  3ZT3 A;  5AZJ B;  4DV7 K;  4I9Q A;  1VQ7 N;  3LPT A;  2F9T A;  4OO1 J;  3C6U A;  1EX4 A;  3SBT A;  1HYS A;  2W42 A;  2OZM A;  3L2Q A;  1RBU A;  4DTS A;  3A5O C;  2QXL A;  4IFE A;  3CCR N;  5A2Q O;  4NYF A;  1DGK N;  3T1H K;  4BGB A;  2H3G X;  5E26 A;  1IBL K;  4FJN A;  2FBY A;  3VEO A;  3WQT A;  3CCS N;  3EN9 A;  4CZL A;  3QB0 A;  5DM7 L;  3GG4 A;  3MX2 A;  3P31 A;  4CGG A;  3G6E N;  2IAJ A;  4CEO A;  4C1N I;  4U67 L;  3CD6 N;  3AY9 A;  1RFQ A;  1K8K B;  3DMJ A;  1JL2 A;  2UUB K;  2UYT A;  2PAV A;  5LJW A;  3W0L A;  4H5W A;  4WFN L;  4BDZ A;  3VPZ A;  4DFK A;  1U04 A;  2KTQ A;  1YTU A;  2GEM A;  4IZ9 A;  1U2V A;  4IFY A;  2A1R A;  4B9N A;  2NRR A;  5JVH L;  1U4B A;  3VQ6 A;  4OLA A;  3WEE B;  3BF3 A;  4YOW A;  2IIR A;  4GW6 A;  4JKA A;  3CJ1 A;  1BI4 A;  4NXM K;  3D0P A;  3CCL N;  1KLM A;  1TKX A;  1B9D A;  3O9Q A;  4OVL A;  4BRP A;  5BRH A;  4M3T A;  4FSV A;  3VQ5 A;  4IXC A;  1TAU A;  2F9W A;  1ZBF A;  3SAH A;  4CBW A;  4F3T A;  4FLU A;  3MCP A;  5EXW A;  4EHT A;  4MLH A;  4BRQ A;  4BAC A;  3ALY A;  2IVP A;  4BE1 A;  3WXK A;  2GX9 A;  2ITM A;  1CZA N;  4DV6 K;  1P8Z A;  3HRG A;  3VQA A;  1DEJ A;  3C95 A;  5F0X A;  3CJC A;  3G0Z A;  1ATN A;  5FPD A;  5IWA K;  4YHH K;  1HUX A;  4KO0 A;  3HST B;  1WAJ A;  1QS4 A;  1MWK A;  2OTL N;  3O1B A;  3OYH A;  2HNZ A;  5JIC A;  4HCB A;  4EAH D;  3THY A;  3DOK A;  3C6A A;  1WB9 A;  3AGK A;  1YJ9 N;  2QW9 A;  2YNG A;  2A5X A;  1DLO A;  1C1C A;  4CI6 A;  5AZI B;  3KWI A;  4HTL A;  4CHN A;  2IC3 A;  4FJX A;  1HJO A;  2HNY A;  5FRM A;  2F8T A;  3AVB A;  4FWK A;  2G8V A;  2NRZ A;  4L8R B;  3K59 A;  1UWB A;  4JHD A;  1KRP A;  2YNI A;  4FJ5 A;  1OH6 A;  1SS6 A;  2E6M A;  1CZ9 A;  4FK0 A;  1OH8 A;  4NCB A;  1ITG A;  2FLO A;  1R0A A;  3HM8 A;  4DSJ A;  1DT9 A;  1FXX A;  1U2V B;  1XHZ A;  4N76 A;  3VOV A;  3DRP A;  2KZZ A;  4BWM A;  1RT7 A;  3UB5 A;  4Z4C A;  4LSN A;  3IMX A;  3NMU A;  3D2F A;  3V6D A;  4DTN A;  3BDP A;  2CH6 A;  3O4N A;  1BI4 B;  3AO2 A;  4LF8 K;  4JK9 A;  4KHU A;  2HBJ A;  1NJY A;  4BG9 A;  2I5J A;  4EP4 A;  1MDU B;  1QQC A;  1RDW X;  3RSE B;  5HRS A;  2F96 A;  1NLV A;  1NGI A;  2WFB A;  4DU1 A;  4OKK A;  4DQ8 A;  4CJR A;  3LDQ A;  4B9U A;  3SJJ A;  3CIP A;  1SL2 A;  3PUF A;  1YI2 N;  3VGL A;  1ZC6 A;  3U4L A;  5BPM A;  5AJ3 K;  5FRN A;  4DUY K;  1BA1 A;  2QEX N;  1NGJ A;  2RHK A;  2HHQ A;  4BDP A;  2YJE A;  4M3X A;  5KRS A;  4JI8 K;  4GV6 A;  5GAG P;  3TAQ A;  3L2V A;  3LDO A;  4XH1 A;  3SAF A;  3F5T A;  1LWE A;  4M42 A;  2O8E B;  3SJH A;  1RCH A;  1CZB A;  4B3T K;  1RGI A;  3D6R A;  4R79 A;  4G9Z A;  1NWK A;  3KKR A;  4YFU A;  3HI0 A;  3I8D A;  3WT0 A;  2EWS A;  3BF1 A;  1JLQ A;  4PQU A;  3DLH A;  3CF5 L;  4CE9 A;  4AM6 A;  3CCU N;  5AR0 A;  4AF1 A;  3AVH A;  3HVT A;  4BE0 A;  2NRV A;  2VWK A;  3TAR A;  1TKD A;  5JLH A;  5AQV A;  4FVU A;  4FJM A;  1Z6R A;  1VQ8 N;  2V7Y A;  3OYL A;  4I9L A;  4FOE A;  4FM1 A;  4RTF D;  4FWO A;  4PL7 A;  2D0A A;  3OTO K;  5KQ8 A;  3C6H A;  3QET A;  4ELU A;  3EE8 A;  4PY5 A;  1I39 A;  4OKE A;  4NXN K;  3IDH A;  2O8B A;  1S9G A;  4YDU A;  4QAG A;  3DRS A;  1DTQ A;  1RTI A;  1W0H A;  2E2Q A;  4GVM A;  4FJ7 A;  2VG5 A;  2Q36 A;  2NLX A;  5HRR A;  4WQ5 A;  4CEC A;  5M1F A;  1TYQ A;  2D4W A;  5CYM A;  3L3U A;  4H4M A;  3U3G A;  4JV5 K;  5AFU A;  1TVR A;  4FCY A;  4DTR A;  1Q81 O;  4NCG A;  4CGH A;  1Y97 A;  3ATV A;  4LF4 K;  3AA3 A;  4B1Y B;  1J9A A;  3FZH A;  3NVK A;  3K9J A;  2DTU A;  4JI5 K;  1JLC A;  3EE9 A;  1VSD A;  4N5S A;  3P39 A;  3ASM A;  1SUQ A;  4BRH A;  1ESV A;  4XEI A;  2Q31 A;  3TU5 A;  1H1V A;  4RW7 A;  1EWQ A;  3QBW A;  3M8P A;  2Q2R A;  5EY4 A;  1FKP A;  3ULE B;  4JI0 K;  3CET A;  3E01 A;  1EKE A;  3CME N;  4CFC A;  1JCF A;  2OPP A;  3LP0 A;  1NGC A;  3KLE A;  4FOI A;  4C23 A;  2Q1N A;  1A5X A;  4CZI A;  1BGX T;  3RMA A;  2QTD A;  1J5O A;  3MED A;  1VRT A;  2XY5 A;  3IS9 A;  2FSN A;  4CEA A;  1WOQ A;  2V51 B;  2QWL A;  4DSL A;  4JKE A;  1VK0 A;  3VQQ A;  4Q5V A;  3VEW A;  4W5O A;  4CW7 B;  1KCF A;  4JK8 A;  3AO3 A;  2CGL A;  2QA4 N;  4JS4 A;  4EZ6 A;  1QVG M;  4A2B A;  2Y1J A;  2OTJ N;  4WE1 A;  4OKJ A;  4DV5 K;  2NRH A;  3O9T A;  4FXD A;  4AHV A;  1OVY A;  2F7T A;  1KSP A;  4KAZ A;  3EKU A;  3L8B A;  1BWF O;  1ASU A;  3KLF A;  2D0P A;  3S9H A;  1TUU A;  2YHX A;  5J2Q A;  4CJV A;  1BIZ A;  2PBD A;  3C7N A;  3G25 A;  4JI6 K;  1N33 K;  3KJV A;  2YKN A;  1QQO A;  2B5J A;  5AQK A;  4ZHR A;  4Z4H A;  4A62 A;  2X74 A;  3NHG A;  3PO4 A;  4IEI A;  2HVI A;  4DCH A;  2JGU A;  1C0M A;  1EP4 A;  1VQK N;  3CJ7 A;  3AVM A;  2QKB A;  1WSI A;  1TAQ A;  4FLZ A;  1BIU A;  3T69 A;  2BH1 A;  1VSF A;  2HOE A;  4BC3 A;  3N4P A;  2ZJQ L;  3FZM A;  4FW2 A;  4K25 A;  5AFU H;  5AQX A;  2HMP A;  3TAM A;  4C1N K;  1C6V A;  1JLF A;  5GAD P;  3VQD A;  5IT9 O;  1TK0 A;  3FE1 A;  3CCE N;  3AVF A;  3HJF A;  4Z4I A;  3JSM A;  4JD2 A;  1BQM A;  3V9X A;  5AQG A;  2IOC A;  1OH7 A;  4IEE A;  5D3G A;  3K2P A;  4BRG A;  3C6T A;  4CGD A;  3E9P A;  4AIL C;  4E7I A;  3MX5 A;  1VSM A;  1YJW N;  2E5L K;  4FZZ A;  3W3D A;  2CGJ A;  2CGK A;  3ENB A;  1HQU A;  3P4I A;  4KRF A;  2HVH A;  3QBX A;  2PFU A;  1HX1 A;  4KV8 A;  3VEV A;  4CBU A;  3QEI A;  1N6Q A;  4Y1D A;  1XMO K;  1YHQ N;  1J54 A;  3SMP A;  2FXU A;  1T03 A;  5BN9 A;  3SBG A;  3J7Z O;  2FBT A;  1GLD G;  1RT4 A;  2FF3 B;  2QXF A;  4NB4 A;  3F2K A;  3OJU A;  3OVN A;  4E89 A;  3HVR A;  1KXP A;  3DRR A;  2ZD1 A;  4LC9 B;  3ITH A;  5KPZ A;  4EZ9 A;  3QDK A;  4LF5 K;  5BPN A;  4M3Z A;  3LPU A;  1NJX A;  3VEN A;  3HPO A;  1K9M O;  3VF6 A;  4CF2 A;  5LMU K;  3LM2 A;  4ICL A;  4K42 A;  3OYA A;  5AQH A;  1LWF A;  3IAY A;  4M45 A;  3OW2 M;  3RMB A;  1T3V A;  3EO3 A;  4CF8 A;  1EO1 A;  4CJQ A;  2W6L A;  2V7Z A;  4XH4 A;  4B1U B;  2DFE A;  4JRP A;  3IKM A;  5GAH P;  3DAW A;  3ATU A;  3RR8 A;  2V52 B;  3KKS A;  1QQM A;  5KQD A;  4O0J A;  1NK8 A;  5KI6 A;  4NLB A;  3JXU A;  3O4Q A;  4B9M A;  1SKR A;  1C0G A;  3A5N C;  3R9P A;  1YIT N;  2RPI A;  5JS2 A;  5J2M A;  4JD2 B;  3I55 N;  3RVC A;  5E41 A;  4CGJ A;  5M1O A;  4FPB A;  4DSE A;  4BRK A;  1MWM A;  4H5R A;  1ZBS A;  4N41 A;  4CEB A;  2YX6 A;  3A0I X;  3OYI A;  3VQ4 A;  4CED A;  1JJ2 M;  1O13 A;  2D5R A;  2Q0R A;  1RT5 A;  4PKH A;  4DTX A;  4LY7 A;  4CEQ A;  3H3N O;  3WEE A;  4JI7 K;  3NF8 A;  4DTO A;  3DI6 A;  1TK5 A;  4DSF A;  1WBD A;  3GL1 A;  1RBV A;  3OYF A;  2YHW A;  2HHH K;  1D9F A;  2D0O A;  2JWL A;  4C8N A;  3D2E A;  3S3N A;  1XC9 A;  4IOA L;  2ASM A;  2WC9 A;  4JKH A;  4CGI A;  1FK9 A;  4J2B A;  3G71 N;  5M1Q A;  4B8C A;  1S1X A;  2OZS A;  1B9F A;  1LCU A;  4DR5 K;  3ZLJ A;  3CMA N;  3EY1 A;  4M41 A;  4YDU C;  4HUG A;  1RDC A;  4MQ3 A;  4GV9 A;  5HBM A;  3LZJ A;  1KFS A;  1KLN A;  3OYE A;  5ADX A;  3KK1 A;  1BL3 A;  3VMF B;  3RRG A;  4FLT A;  2QWP A;  4EFH A;  1ASV A;  1Q18 A;  1VAZ A;  3HSC A;  3TTC A;  1IKY A;  4JI4 K;  1GLL O;  1HYZ A;  1D5A A;  3QFU A;  2XO7 A;  4WF9 L;  1WLJ A;  5TKW A;  1KVA A;  5HP1 A;  3J7A P;  4BVP A;  1NGD A;  4MO5 A;  2X78 A;  4EP5 A;  4O8K A;  4E3S A;  2HW3 A;  1GOA A;  1OVQ A;  1JLB A;  3VQ9 A;  5C25 A;  5CE3 A;  4BR5 A;  4BG8 A;  1DTT A;  1REV A;  3K57 A;  5AZI A;  2UXD K;  4FJ9 A;  3GE1 A;  2UXC K;  4LH5 A;  5C12 A;  1RNH A;  4DU4 A;  1U49 A;  2E6L A;  1OH5 A;  2QM1 A;  2GWJ A;  3CCM N;  4IJN A;  4IFV A;  3K5M A;  4K8Z A;  4JN4 A;  1RDD A;  3E1Y A;  3M6G A;  4LF9 K;  1RTD A;  5AQZ A;  4KH6 A;  4J2D A;  2VWB A;  4PL8 A;  3UIQ A;  3FR0 A;  1VQ4 N;  4M3R A;  3AA5 X;  3SQ1 A;  4DKW A;  2QWM A;  4CFA A;  4CJF A;  2E4L A;  3D2E B;  4E1J A;  4BC2 A;  3D45 A;  5KTQ A;  3NBP A;  2YJF A;  3NH1 A;  3RSE A;  1XMQ K;  3V9S A;  2ZM6 K;  4Q0B A;  3LP3 A;  4GMJ B;  3SQ4 A;  1J6Z A;  3SYZ A;  4FK2 A;  4LFA K;  5AQF A;  3SV4 A;  3L6Q A;  4JKG A;  1YVN A;  1QVF M;  3OA9 A;  4DLE A;  4BR4 A;  1NM1 A;  1XWL A;  4CHO A;  3ZX3 A;  4AHC A;  3CQY A;  5HRN A;  1VQN N;  1UAX A;  3SUP A;  4LD0 A;  4PUO A;  3TTF A;  4W5T A;  1KAZ A;  3BY5 A;  5ADX H;  3QNN A;  3S3O A;  1WSH A;  3RMC A;  1X9M A;  4W5Q A;  1RDU A;  2D0B A;  1U45 A;  3JYT A;  2O8E A;  5CYQ A;  4DV3 K;  1ATS A;  3OYC A;  2NUB A;  3LAK A;  1TL3 A;  4YOU A;  1HYV A;  2Z1I A;  2A42 A;  3LM9 A;  3OYB A;  4K0K K;  3AAR A;  3DLL L;  2D0C A;  3HK2 A;  4DR6 K;  1QSL A;  4C8L A;  3DXM B;  3TSP A;  3CM6 A;  3U9D A;  2RE2 A;  5F2R A;  1YTA A;  4CIF A;  5H1S Q;  3SNN A;  3ZX0 A;  2WUS A;  3O5B A;  5AQM A;  4FJJ A;  3ZT1 A;  3V9U A;  2LSN A;  3OYD A;  3B8A X;  1NU0 A;  4N56 A;  4ISF A;  2J4R A;  2EHG A;  2ASO A;  2YNF A;  2KHO A;  4NO7 A;  5C2D A;  5AQJ A;  4CJ3 A;  1RT6 A;  4JK7 A;  1T05 A;  3I33 A;  1J5E K;  3VQ7 A;  4FM0 A;  4ISE A;  4WFB L;  3H1V X;  3OS2 A;  1NGH A;  4DV0 K;  3QIP A;  5M1N A;  5AQR A;  3H45 C;  3TAN A;  1JCG A;  2ZJR L;  2E2P A;  3NDK A;  4RG8 A;  2RN2 A;  4CVN E;  3AO4 A;  3NH2 A;  4IBN A;  2O8F B;  2ZQB A;  2DY4 A;  3T19 A;  4G1Q A;  5AQS A;  4CEZ A;  4DR1 K;  2HBL A;  3O6W A;  3I56 N;  3EYZ A;  1S1W A;  1NNE A;  4JKG B;  3DM2 A;  3QEP A;  5J1E A;  4YOR A;  3AVN A;  2XY8 A;  3CQX A;  1HMV A;  1NMN A;  3FZL A;  4MFB A;  2YHY A;  2UUC K;  2EX3 A;  3NF6 A;  5BN8 A;  2ITG A;  4BGA A;  3AO5 A;  2IDO A;  4H8K A;  2KW4 A;  4FZY A;  2P5G A;  4B1W B;  1U48 A;  1JLE A;  3ULE A;  2QK9 A;  4W5R A;  1GLF O;  4PA1 A;  4JLH A;  4O44 A;  4DV4 K;  4B9T A;  3AVJ A;  3SUN A;  3O9U A;  1XC3 A;  2YI1 A;  1S9E A;  1GLC G;  5HRO A;  3TSU A;  1WSF A;  2Q3S A;  2ZGZ A;  3FZF A;  1V4S A;  2B6A A;  1WUA A;  4IJA A;  1NJW A;  1UOC A;  3K5N A;  4H03 B;  1CXU A;  3QER A;  5BR9 A;  5JS1 A;  5SWM A;  3OYM A;  1HNZ K;  3I0R A;  1NJI O;  2I7P A;  4O8U A;  3L2R A;  4CES A;  4CFD A;  3R8E A;  3QLH A;  1E4G T;  1KC8 O;  4KKO A;  3ID8 A;  3VGK A;  3QIN A;  3ISN C;  3C65 A;  3RWU A;  5KGX A;  1JKH A;  1DKG D;  4CJK A;  1N8R O;  4CHP A;  2P9P B;  3T1A A;  3K58 A;  4JYA K;  1QSY A;  2E1Z A;  5JVG L;  2BE2 A;  1N32 K;  4CZJ A;  3CYM A;  4J8F A;  3P38 A;  2HHT A;  1N36 K;  2HMI A;  3A8Y A;  4QS8 A;  3OYN A;  3S41 A;  2E1Y A;  1NK6 A;  4F4K A;  2ASP A;  4B3O A;  4OX9 K;  4KTW A;  2W40 A;  4N47 A;  4NLC A;  2KZM A;  3QEX A;  5BR8 K;  4E7H A;  4FL9 A;  4M7Y A;  5EU7 A;  4AHU A;  3DLE A;  4E19 A;  4YOY A;  3ZSZ A;  3WXL A;  5BPL A;  3SLC A;  4E0D A;  3MEC A;  4DTJ A;  3A5M C;  3U3Y A;  3VTH A;  3EL2 A;  1UA0 A;  3PX6 A;  4ILH A;  4F8R A;  3O9R A;  4BWJ A;  5C42 A;  2KFZ A;  2JWK A;  3MCA B;  2AA4 A;  4GKK K;  3TAE A;  3WQU A;  4O4G A;  4B9L A;  3MDQ A; 
#chains in the Genus database with same CATH homology
 3LDN A;  4JAX A;  5EX5 A;  2CH5 A;  4NB4 A;  1SZ2 A;  3VF2 A;  3F2K A;  5AZJ B;  4Y0W A;  1VQ7 N;  2F9T A;  1JCE A;  4OO1 J;  3VES A;  5LY3 A;  3HBT A;  3SBT A;  4BRN A;  3CC7 N;  1KXP A;  3MMV A;  4IOC L;  4LC9 B;  1G99 A;  2P9L B;  2QWN A;  5KPZ A;  3QDK A;  3A5O C;  2QXL A;  2QWR A;  4IFE A;  5BPN A;  3CCR N;  3VEN A;  1K9M O;  1DGK N;  4BGB A;  3VF6 A;  2H3G X;  5E26 A;  3VEX A;  2D1K A;  3WQT A;  4H0X B;  3LM2 A;  3VEO A;  1YXQ A;  4K42 A;  3EN9 A;  3CCS N;  2VGM A;  4CZL A;  4RCH A;  3QB0 A;  5DM7 L;  5AQH A;  4H5T A;  4BRM A;  3GG4 A;  3MX2 A;  2GWK A;  2E2N A;  3P31 A;  3PIO L;  3G6E N;  4BC5 A;  3OW2 M;  3CI5 A;  4WQ4 C;  1T3V A;  3IFR A;  4C1N I;  4U67 L;  1TUY A;  3AY9 A;  1RFQ A;  1K8K B;  3UKU B;  3CD6 N;  3EO3 A;  2UYT A;  4U7B A;  1EO1 A;  2PAV A;  5LJW A;  3W0L A;  2V7Z A;  4XH4 A;  4FWL A;  4H5W A;  2QWQ A;  1NGA A;  4B1U B;  3IKM A;  3IUC A;  4WFN L;  2A41 A;  5GAH P;  1MA9 B;  5C15 A;  3VPZ A;  5GAE P;  3DAW A;  3ATU A;  5AQL A;  2GEM A;  1IJJ A;  2V52 B;  2OAN A;  4IZ9 A;  1U2V A;  2ZGY A;  4GVE A;  4A2A A;  5KPR A;  1KD1 O;  1QQM A;  1HPM A;  5KQD A;  2P9L A;  3D7E O;  3C0B A;  4NLB A;  1Z05 A;  2NRR A;  2I7N A;  2P9N B;  3JXU A;  3UKR A;  4CZH A;  5JVH L;  3WEE B;  3BF3 A;  1C0G A;  3A5N C;  4YOW A;  4BC4 A;  3R9P A;  1YIT N;  5HL7 L;  2IIR A;  2P9S A;  3L4Q A;  4JKA A;  4JD2 B;  3UE5 A;  5GIP A;  3I55 N;  3CJ1 A;  3H6E A;  2HBK A;  3RVC A;  3O08 A;  3CCL N;  3O9Q A;  2FSK A;  4BRP A;  5MLC Q;  5BRH A;  3R1X A;  4FSV A;  5M1O A;  4FPB A;  4IXC A;  3UKU A;  2F9W A;  4BRK A;  5GIO A;  1YJN N;  3SAH A;  3DXK A;  4CBW A;  1MWM A;  4H5R A;  1ZBS A;  1HKB A;  2YX6 A;  3A0I X;  3MCP A;  1K8A O;  5EXW A;  4EHT A;  4MLH A;  4BRQ A;  2A6A A;  1BOT O;  1JJ2 M;  1O13 A;  2IVP A;  2HST A;  3WXK A;  2GX9 A;  2ITM A;  3WXM B;  1CZA N;  2GEL A;  1P8Z A;  4H0T B;  3HRG A;  1YF5 L;  5FPE A;  1DEJ A;  2Q0R A;  4WYB A;  4PKH A;  5F0X A;  3HOS A;  3CJC A;  3H3N O;  3WEE A;  4H0O A;  1ATN A;  4FWM A;  4JHD B;  5FPD A;  1HUX A;  3MN5 A;  4FO0 A;  3M3Z A;  4B1Z A;  2VGN A;  3GL1 A;  1MWK A;  2OTL N;  4F9O A;  4KBO A;  4CBX A;  2YHW A;  3O1B A;  1NBW A;  3VTI A;  4A59 A;  2D0O A;  5JIC A;  4B1V A;  3CPE A;  3SAG A;  2JWL A;  3D2E A;  3H46 O;  2P9U B;  3OBW A;  2A3Z A;  4EAH D;  1VQP N;  4IOA L;  2QWO A;  2ASM A;  3O80 A;  2WC9 A;  4XH5 A;  1HLU A;  3C6A A;  4JKH A;  4BQL A;  1BA0 A;  3KVG A;  3AGK A;  3G71 N;  1YJ9 N;  2QW9 A;  3D2F B;  2A5X A;  5M1Q A;  4I6M A;  3GOI A;  1LCU A;  4PKI A;  4A5A A;  1GLE G;  2E20 A;  4JKB A;  4CI6 A;  3CMA N;  5AZI B;  3KWI A;  4YDU C;  4HTL A;  3TSQ A;  4CJ7 A;  4GV9 A;  4RWT A;  5ADX A;  1HJO A;  5C10 A;  4IWV A;  4FWK A;  2NRZ A;  4H0P A;  4BY9 C;  4JHD A;  3R3L A;  4PKG A;  3VMF B;  3WXJ A;  1X3M A;  1SS6 A;  4IDH A;  2QWP A;  4EFH A;  1Q18 A;  1T6C A;  1VAZ A;  3OBY A;  3HSC A;  3TTC A;  1GLL O;  3QFU A;  3CER A;  3WXI A;  3E9L A;  2FLO A;  2P9U A;  4JKC A;  3HM8 A;  5AQN A;  4WF9 L;  1DT9 A;  1U2V B;  5AQY A;  5TKW A;  3U9Z A;  3VOV A;  4BVP A;  1NGD A;  1XUP O;  1NMD A;  2VCP A;  4MO5 A;  3UB5 A;  3Q7C A;  3UKR B;  4O8K A;  3IMX A;  3NMU A;  4MDB A;  2ZWH A;  3D2F A;  3LL3 A;  4H5N A;  2QI2 A;  5EVZ A;  5DM6 L;  4YOV A;  3KWG A;  4A61 A;  2CH6 A;  5CE3 A;  1QQN A;  2P9S B;  3BUZ B;  4BR5 A;  4BG8 A;  3SK3 A;  3A5L C;  5AZI A;  4KH5 A;  1BG3 A;  4JK9 A;  4WCE L;  2Q0U A;  3GE1 A;  3LDP A;  2HBJ A;  4WQ4 A;  4BG9 A;  1SQK A;  5C12 A;  1MDU B;  1RDW X;  1QHA A;  2VYP A;  3I8B A;  3RSE B;  3R6M A;  2P9I B;  2QM1 A;  3DXK B;  1NLV A;  1NGI A;  2WFB A;  3OHR A;  4CZG A;  2GWJ A;  3CCM N;  4IJN A;  4DQ8 A;  1NGF A;  4BRD A;  3LDQ A;  1ILY A;  1LOT B;  5C0Y A;  4IO8 A;  3PLA A;  4JN4 A;  3VER A;  5M1P A;  3CIP A;  3KHY A;  2FSJ A;  3E1Y A;  3MK6 A;  3ZYY X;  4B9Q A;  1YI2 N;  3FGU A;  3VGL A;  1ATR A;  1ZC6 A;  2W41 A;  4JNE A;  3K9K A;  4L3Q A;  2WBN A;  3U4L A;  5BPM A;  3N4Q A;  3M6G A;  2P9K A;  1BA1 A;  2QEX N;  1W97 L;  1NGJ A;  5AQZ A;  3J8A A;  4KH6 A;  1VQ9 N;  2RHK A;  2VWB A;  4PL8 A;  5AQT A;  3FR0 A;  1VQ4 N;  2YJE A;  5FPM A;  4GV6 A;  1KAY A;  5GAG P;  4DKW A;  3LDO A;  4XH1 A;  2QWM A;  3SAF A;  3F5T A;  5F1X A;  3D2E B;  3T7Z A;  4E1J A;  4BC2 A;  4QS7 A;  3SJH A;  1NGG A;  2YJF A;  1RGI A;  3RSE A;  2P9I A;  3D6R A;  3QML A;  4R79 A;  4G9Z A;  3O8M A;  3CCJ N;  1J6Z A;  1K73 O;  1NWK A;  2E88 A;  4BRA A;  3ENH A;  3TTD A;  3HI0 A;  1HKG A;  4I6M B;  5AQF A;  3L6Q A;  1S22 A;  3WT0 A;  2EWS A;  4JKG A;  1YVN A;  4EHU A;  3O9S A;  3BF1 A;  1QVF M;  3OA9 A;  4BR4 A;  1M1K O;  1NM1 A;  3ZX3 A;  3CF5 L;  3CQY A;  1BUP A;  2HF4 A;  3WUH A;  4AM6 A;  3CCU N;  5KPT A;  3GBT A;  1VQN N;  1XQS C;  5AR0 A;  4AF1 A;  3TTF A;  5BRF A;  2NRV A;  3MN7 A;  2GUP A;  1KAZ A;  5ADX H;  1TYQ B;  1X9J A;  1VQ5 N;  4FPA A;  5JLH A;  5AQV A;  2NRX A;  5AQO A;  4FVU A;  3ZEU A;  2Q97 A;  4BRE A;  1Z6R A;  3KZB A;  1RDU A;  1VQ8 N;  2V7Y A;  4A57 A;  2BTF A;  4FOE A;  3VEZ A;  4WFA L;  3CCQ N;  1ATS A;  1T6D A;  4RTF D;  4CZM A;  3Q7B A;  2A40 A;  4FWO A;  4PL7 A;  4YOU A;  3AAQ A;  3L0Q A;  3CC4 N;  1W2B M;  1R59 O;  5KQ8 A;  2A42 A;  3C6H A;  3LM9 A;  4BR7 A;  5TKY A;  1D4X A;  4JEP A;  3AAR A;  3EE8 A;  3MWP A;  4BRF A;  3CXC M;  1Q86 O;  3DLL L;  4B1X B;  4BR0 A;  3H3O B;  1QZ6 A;  2HF3 A;  1EQY A;  4JKF A;  4PHT X;  3IDH A;  3DXM B;  4YDU A;  3L4I A;  3TSP A;  1OKJ A;  4CD3 A;  3U9D A;  1GLJ O;  2RE2 A;  4K43 A;  3ZET B;  3BEX A;  2E2Q A;  3ZX2 A;  5F2R A;  3H1Q A;  5GIN A;  3M1F A;  5H1S Q;  4K41 A;  4IOX A;  2IVN A;  2Q36 A;  4CD1 A;  2NLX A;  3ZX0 A;  1QZ5 A;  3HZ6 A;  2WUS A;  4H0V B;  3O5B A;  4OPA A;  4WQ5 A;  5M1F A;  1TYQ A;  2D4W A;  3E66 A;  4O5F A;  4WQ5 C;  5AQM A;  3MWT A;  5AFU A;  3B8A X;  3FFK B;  1BDG A;  4ISF A;  1Q81 O;  2J4R A;  3QFP A;  4FWN A;  2ASO A;  3KK7 A;  2KHO A;  3ATV A;  4NO7 A;  5C2D A;  4B1Y B;  5C2F A;  3FZH A;  4OPH A;  3NVK A;  4YOT A;  5AQJ A;  3K9J A;  4H0Y B;  5AQQ A;  4JK7 A;  2P9K B;  3EE9 A;  3I33 A;  3O4W A;  4ISE A;  4WFB L;  3H1V X;  3P39 A;  1NGH A;  3CCV N;  3JS6 A;  4BRH A;  5M1N A;  1ESV A;  4XEI A;  3VEY A;  5AQR A;  4CZE A;  2Q31 A;  3TU5 A;  3CJA A;  3H45 C;  3DXM A;  5EOY A;  1H1V A;  4BRI A;  1JCG A;  2ZJR L;  2E2P A;  3QBW A;  3GDQ A;  1X3N A;  5AQW A;  4GY2 B;  2Q2R A;  5EY4 A;  3ZET A;  3ULE B;  5JMV A;  3CET A;  1E4F T;  4FWQ A;  4KH4 A;  4BRL A;  3VGM A;  3CME N;  1C0F A;  1JCF A;  4FWP A;  1NGC A;  4M7X A;  4FOI A;  2NRW A;  5AQS A;  4C23 A;  1VQ6 N;  2Q1N A;  4CZI A;  3C7N B;  3MN9 A;  1GLB G;  2HBL A;  5B8H A;  4GV3 A;  3O6W A;  2QTD A;  3I56 N;  1S72 N;  3EZW A;  4JKG B;  3G4S N;  3AGR A;  3LDL A;  5LJV A;  2FSN A;  3CC2 N;  2V51 B;  1WOQ A;  2QWL A;  2DPN A;  4HWI A;  4YOR A;  4BR9 A;  5M1K A;  4JKE A;  3FZL A;  3CQX A;  4ILJ A;  3VEW A;  1S3X A;  3NVM A;  4BQZ A;  3O1W A;  2YHY A;  4JK8 A;  2CGL A;  5BN8 A;  2QA4 N;  4BGA A;  2BUP A;  1QVG M;  4A2B A;  4FWR A;  3ZEU B;  1KQS M;  2OTJ N;  4B1W B;  3CJB A;  4YOX A;  3HTV A;  2NRH A;  3O9T A;  4JKD A;  3ENO A;  1OVY A;  3ULE A;  1GLF O;  2F7T A;  5AZJ A;  4MLE A;  3FLC O;  5FPN A;  1Q82 O;  3EKU A;  3QIC A;  4MDA A;  3AAP A;  1BWF O;  1NGB A;  3O9U A;  1XC3 A;  2YI1 A;  2D0P A;  5CR4 A;  1VQM N;  1GLC G;  1TUU A;  3F9M A;  3TSU A;  2YHX A;  3G25 A;  2PBD A;  3C7N A;  3ID6 A;  2E8A A;  4DB3 A;  1GLA G;  4BR2 A;  2ZGZ A;  3FZF A;  1QQO A;  5I9E B;  3TPQ A;  5AQK A;  4A62 A;  1V4S A;  3VET A;  1WUA A;  4IJA A;  4IEI A;  4DCH A;  4H03 B;  1T44 A;  4EIA A;  3CPW M;  1YUW A;  5BR9 A;  1VQK N;  4BRO A;  3CJ7 A;  3CHW A;  1YAG A;  1K8K A;  3T69 A;  1BU6 O;  1P90 A;  2NZT A;  2IVO A;  2BH1 A;  2HOE A;  1NJI O;  4BC3 A;  2I7P A;  4O8U A;  3N4P A;  1VQO N;  2ZJQ L;  3FZM A;  3R8E A;  1E4G T;  1IG8 A;  3DWL A;  3EKS A;  1KC8 O;  3HOT A;  3ID8 A;  4K25 A;  5AFU H;  3VGK A;  3C65 A;  5HOO A;  3U8X A;  1DKG D;  1HKC A;  5AQX A;  1N8R O;  2HMP A;  4FWS A;  4C1N K;  1KAX A;  3CJ9 A;  2P9P B;  4M63 C;  5ELZ A;  1V4T A;  2P9N A;  5GAD P;  4CZF A;  2E1Z A;  4Z94 A;  4BRC A;  5JLF A;  3PIP L;  5JVG L;  3FE1 A;  3CCE N;  1U6Z A;  4CZJ A;  4IO9 L;  1Q7Y O;  4J8F A;  3P38 A;  5BRD A;  2HBM A;  1M90 O;  4JD2 A;  3E9O A;  5AQG A;  3A8Y A;  4QS8 A;  1BO5 O;  3S41 A;  2E1Y A;  4IEE A;  3SMS A;  2ASP A;  4BRG A;  2E2O A;  2W40 A;  2FF6 A;  4NLC A;  5AQI A;  3E9P A;  1YJW N;  2AP1 A;  3MX5 A;  4GNI A;  2ZF5 O;  3M5R A;  5BRE A;  4H5V A;  4FL9 A;  1Y64 A;  4M7Y A;  3W3D A;  4YOY A;  3VF4 A;  1NGE A;  3WXL A;  5E84 A;  5BPL A;  3FZK A;  2NRT A;  2KLA A;  3SLC A;  2CGJ A;  2CGK A;  2YCH A;  3ENB A;  3P4I A;  3A5M C;  4MO4 A;  3VTH A;  3QBX A;  4DHY A;  1YIJ N;  4CZK A;  2PFU A;  3EL2 A;  1HX1 A;  5CHI A;  4ILG B;  2NNW A;  3BP8 A;  4ILH A;  1SAZ A;  5AQU A;  3VEV A;  4CBU A;  1ZXO A;  2P9P A;  3O9R A;  4BVO A;  1VQL N;  3MN6 A;  1YHQ N;  4ISG A;  3SMP A;  4A5B A;  2JWK A;  2ZJP L;  3MCA B;  4QS9 A;  2AA4 A;  2FXU A;  2GTD A;  4UY8 O;  5BN9 A;  5AQP A;  3SBG A;  4AM7 A;  3J7Z O;  1GLD G;  3WQU A;  2KKZ A;  3DJC A;  2FF3 B;  3MDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...