4BRHA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg and thiamine phosphovanadate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
361
structure length
361
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic snapshots along the reaction pathway of nucleoside triphosphate diphosphohydrolases.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 121
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brhA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brhA02
3FLCO 4H0XB 5KPRA 3WXLA 5EVZA 4H0PA 4EIAA 3SLCA 2GUPA 2E2PA 3VGKA 4PKIA 2V7ZA 1S22A 3FZKA 5AQTA 4FWLA 5AQRA 2YCHA 2IVOA 3DWLA 3WUHA 1EQYA 4FOIA 2E88A 4FPBA 3HI0A 2W40A 3R8EA 5AQFA 4BQLA 5E26A 5EX5A 1WOQA 2QWPA 3UB5A 4CI6A 4WQ5C 3O5BA 4CZMA 1R59O 3MN7A 2Q97A 3UKRB 3UKRA 1ZXOA 4H5RA 5BPLA 3U9ZA 1MA9B 4RCHA 3QFPA 2FSKA 5KPTA 2E1YA 3MN6A 3DAWA 1TUUA 3TU5A 2Q36A 3EL2A 4K25A 1GLBG 3R6MA 3D2FB 3D2FA 3O08A 4H0YB 2I7NA 4CZFA 4RWTA 4BQZA 1XUPO 3OHRA 4FSVA 3VEOA 3FGUA 5BPMA 3VF6A 4B1VA 3A8YA 5AQGA 1NGHA 4MO5A 2F9WA 3QICA 3VESA 3WQUA 1X3MA 3UKUB 1NGAA 1JCEA 3UKUA 3GOIA 5ADXA 5KQ8A 4FWOA 3C0BA 3LL3A 5JICA 3O4WA 4BRHA 4B1WB 2A3ZA 3SMPA 4DB3A 3A0IX 4CD1A 2HF4A 1T6CA 3G25A 2AP1A 4H5NA 3VPZA 4H5VA 1NGBA 5E84A 2OANA 3WXKA 4KBOA 2GTDA 3AY9A 1KXPA 3ULEB 3ULEA 1ATRA 3O8MA 1Q18A 4QS9A 2GWKA 3KVGA 2PAVA 2QWOA 2CGJA 2QWMA 2V51B 3ZEUA 3ZEUB 3CQYA 3CJ7A 1BDGA 4BC5A 3CETA 5TKYA 3W3DA 4O8KA 2E8AA 3DXKB 3DXKA 3F9MA 3L0QA 4MLHA 4QS7A 1ZBSA 4FL9A 1MWMA 3FE1A 4FWMA 3R9PA 3DJCA 3VEYA 2Q31A 1GLAG 1YAGA 4BRGA 2BUPA 2P9PA 1E4GT 2P9KB 2P9PB 2P9KA 3CI5A 1GLEG 4Y0WA 4H03B 4CZGA 5AQOA 3D2EB 3D2EA 2IVPA 5AQNA 5JMVA 3MN5A 3ATVA 4FOEA 3JXUA 3CHWA 3VGMA 1DKGD 4HWIA 1V4TA 3UE5A 4IJNA 4H5WA 5FPNA 1QZ6A 3P4IA 2AA4A 1KAZA 4BROA 4DHYA 3O1WA 4QS8A 4IWVA 1RFQA 5BRDA 2Q0RA 2YHXA 3QMLA 1XQSC 4I6MB 4I6MA 1BA0A 2QW9A 4ISFA 5AZIB 5AZIA 1OKJA 4CZIA 1TUYA 3H3OB 1IJJA 3LDOA 4F9OA 5AFUH 3BF3A 3O6WA 4BRCA 3WEEB 2D0OA 2W41A 3WEEA 1U2VA 1U2VB 2NRHA 4WQ4C 3C7NB 3C7NA 3W0LA 3ZETA 3ZETB 1HKBA 2CGLA 3VF2A 1HKCA 4JAXA 3VEXA 5BPNA 4YDUA 3IDHA 1JCFA 2PBDA 3QBXA 3HTVA 1XC3A 1HKGA 1QQMA 3CJBA 4BRAA 4FWSA 1E4FT 5FPMA 4FWRA 4JHDA 4JHDB 5AQWA 4AM6A 4B1UB 1NGGA 5AQKA 5BN8A 3VETA 2CGKA 3QFUA 3WQTA 2ZF5O 1NBWA 4XH5A 3EN9A 3ENHA 4B1YB 4H0OA 1NLVA 5AQPA 1P8ZA 2WUSA 4CJ7A 4BVPA 5LJWA 5ELZA 4CZHA 2FF6A 2YJFA 4A61A 1SZ2A 4JNEA 5F0XA 4RTFD 4IJAA 1QQOA 2HMPA 4BRFA 3QDKA 2YHWA 3CERA 4H0TB 2VYPA 2FF3B 4WQ5A 4M7YA 1ATSA 2V7YA 5EXWA 1GLCG 4EHUA 4BRKA 3A5OC 3A5MC 4H5TA 3WXJA 3A5LC 2Q2RA 3CJAA 1SAZA 3AAQA 1YUWA 4E1JA 4PL7A 1HUXA 4WYBA 2FSJA 5AQLA 3ZX3A 2FXUA 3H45C 2GELA 4FPAA 4BC2A 1GLJO 3M6GA 4M7XA 1HLUA 3H1QA 4CD3A 1G99A 2NZTA 2E2OA 4B1ZA 3IUCA 2HF3A 3KHYA 5ADXH 4GNIA 1BUPA 5F2RA 4BG8A 4H0VB 3SJHA 2A6AA 1NGDA 1BO5O 2ASPA 5FPEA 4BGBA 2QWQA 2YHYA 3ZX0A 3GL1A 3QB0A 3GE1A 3ENOA 4XEIA 3WXIA 1BWFO 1T44A 1C0FA 3MK6A 1NGCA 4B9QA 1ZC6A 3FFKB 3EZWA 2ITMA 4JN4A 3QBWA 2H3GX 4AM7A 1BOTO 1MWKA 4Z94A 3VF4A 4BRQA 4MLEA 1LCUA 4JD2A 4JD2B 1WUAA 2A41A 3CJ1A 1DGKN 3MDQA 3LM9A 2YJEA 4K43A 2FLOA 5AZJB 5AZJA 4L3QA 2GEMA 4O5FA 3U9DA 4BR9A 1HJOA 4CZJA 3H6EA 3EKSA 3VEZA 2QWRA 3ATUA 1QQNA 3AARA 4HTLA 1S3XA 4BRMA 4BC4A 3HM8A 4IO8A 4A62A 3HZ6A 5AQJA 4CZEA 2QWLA 4XH1A 4FWPA 2I7PA 3I33A 5LY3A 3HSCA 4PKHA 3MN9A 4CZLA 4A2AA 3FZMA 1NGFA 1U6ZA 1Z6RA 4IXCA 5EOYA 4BR0A 2QWNA 3LDNA 4LC9B 3IMXA 5AQHA 4CBUA 3ZX2A 3FZHA 3ID8A 4IZ9A 1BA1A 2YI1A 1CZAN 5B8HA 4XH4A 1K8KB 1K8KA 2GWJA 1C0GA 3EKUA 1RGIA 3LDLA 2IVNA 4WQ4A 2CH5A 2P9SB 1NWKA 2P9SA 1H1VA 2E1ZA 4BC3A 2A5XA 3M1FA 4BGAA 4FWQA 4K42A 4BG9A 2QXLA 1J6ZA 4EHTA 5KQDA 2KHOA 2P9NB 2P9NA 4K41A 2EWSA 5AQVA 4CBWA 1QHAA 3BEXA 4C23A 4FWKA 3TPQA 5AQUA 4BRNA 4BR2A 3VEVA 1NGIA 3MMVA 4DCHA 2D0PA 4FWNA 5JLHA 4BRPA 2HOEA 3H1VX 5AR0A 2V52B 4B1XB 4GY2B 3U8XA 4NB4A 4J8FA 2ZGZA 3VERA 5BRFA 2ASMA 2CH6A 3VGLA 1KAXA 5I9EB 1YVNA 3GBTA 2P9UA 2P9UB 4BR5A 4M63C 1NGJA 3BP8A 5FPDA 3FZFA 3FR0A 1HX1A 2E2QA 1Y64A 3L6QA 3SMSA 3LM2A 2VWBA 3H46O 1QZ5A 3RSEA 3RSEB 5BREA 2D1KA 5AQMA 4DQ8A 3SK3A 3U4LA 4BRLA 4BR4A 3VEWA 5AQSA 5EY4A 1RDWX 5BR9A 3A5NC 3BUZB 1GLDG 2NLXA 3VOVA 2A40A 3JS6A 5AQIA 3LDQA 5AQXA 4ISGA 1BG3A 1NGEA 3IFRA 3B8AX 3CJ9A 1KAYA 3CJCA 2QM1A 3GG4A 4A2BA 2Q1NA 1LOTB 2E2NA 1SQKA 4ISEA 4BRDA 2ZWHA 3FZLA 1TYQB 1TYQA 3DXMB 3DXMA 1GLFO 1GLLO 1DEJA 3EO3A 3L4IA 3S41A 2UYTA 3GDQA 4BREA 3BF1A 5LJVA 5JLFA 2A42A 4NO7A 3WT0A 2ASOA 3CIPA 2Q0UA 1JCGA 1D4XA 2D4WA 2J4RA 3M3ZA 4BR7A 1ATNA 5AQYA 5F1XA 1MDUB 5AFUA 4CBXA 3CQXA 3H3NO 2IIRA 1Z05A 3J8AA 4FO0A 5BN9A 2VCPA 1X3NA 4CZKA 2ZGYA 5BRHA 2F9TA 4BRIA 4EFHA 4MO4A 3AAPA 1NM1A 4EAHD 3LDPA 4BVOA 4YDUC 2P9LB 2P9LA 1V4SA 5CE3A 3D7EO 4PL8A 2E20A 1T6DA 4PKGA 2DPNA 1HPMA 5AQZA 1BU6O 1X9JA 5AQQA 3O1BA 3MCPA 1YXQA 1NMDA 2FSNA 1IG8A 3O80A 3VENA 3KZBA 5KPZA 2P9IB 2P9IA 3I8BA 3HBTA 2BTFA 1ESVA
chains in the Genus database with same CATH superfamily
1TAUA 3FLCO 4K8XA 1RT2A 2HNZA 3WXLA 5EVZA 2GUPA 1VK0A 1RBVA 4DR6K 3NHGA 4GV6A 1P90A 3THWB 3KLFA 4FOIA 2OPPA 2W42A 4FPBA 1RT3A 4DFKA 1JLFA 2W40A 5AQFA 4Z4EA 1EO1A 1WOQA 2QWPA 4JKCA 4WQ5C 4EZ6A 4YNQA 3T1AA 4E0DA 1UAXA 2Q97A 3UKRA 4H5RA 4FW1A 1MA9B 1QE1A 1D8YA 3MN6A 1RDCA 4FW2A 2W6LA 5FLXO 2Q36A 1VQ8N 4K25A 4CHYA 3L8BA 3R6MA 2G8WA 4JKAA 3RRHA 1NK7A 2VGNA 1S9GA 4OLAA 1J5EK 2HNYA 2W6KA 5AQGA 1K8AO 1HNZK 4E7LA 4LF4K 1NGAA 5ADXA 2P51A 4FWOA 5JICA 4DQSA 2G8VA 4DV2K 1NK9A 1EKEA 3O4QA 3AO3A 2PZSA 3P31A 3TTDA 1T6CA 2ZJRL 4NCGA 4CJWA 4DSJA 4B08A 3HRGA 3HP6A 4EZ9A 3U3GA 1YVUA 3AY9A 3VQCA 1K6YA 3ULEB 1ATRA 4CJRA 2UUAK 3KTQA 1BQMA 1VQ7N 3CJ7A 4IBNA 4BC5A 3L2QA 3F9MA 3AVFA 3HJFA 3LANA 4B9SA 1YJNN 1JL2A 3VEYA 2Q31A 4JS5A 2BUPA 2P9PB 2FBXA 3CI5A 3BZKA 4DSIA 2O8FA 1RDAA 2JWKA 5AQOA 3HSTB 1TV6A 2Q3SA 3JXUA 3CHWA 3OJUA 3LALA 4H5WA 4EP5A 5FPNA 1SV5A 5LL6Z 4H8KA 4IWVA 4CESA 2O8DB 2YHXA 3E1YA 1XQSC 4I6MB 5AZIA 2QW9A 4N41A 4IDHA 1S1XA 1KLMA 4DFPA 2W41A 5C25A 4Z4FA 3T19A 3U3YA 1WSEA 4B3SK 3SNNA 3M5RA 1Q81O 1VQ6N 3WNEA 3ZETB 4FLYA 2CGLA 5DK5A 3CC7N 3QBXA 1YJWN 3RMDA 4B9UA 2X6SA 3O3GA 4DTOA 1E4FT 3OYEA 4JHDB 5AQWA 2ZJQL 5AQKA 5BN8A 3VETA 3DLLL 2ITGA 3TR8A 3WQTA 1NBWA 3KJVA 3EN9A 4B1YB 4W5TA 4DV3K 1P8ZA 4CJ7A 1BI4B 3M8PA 2Z1JA 4YOWA 3M8RA 3DLKA 4PUOA 1UWBA 4CJKA 2WONA 4QAGA 1QQOA 2HMPA 1EETA 1RBUA 3DRSA 3FFIA 1TK8A 4WQ5A 1HYSA 1ATSA 1B9FA 5T7BA 3D0PA 4U7BA 3CYMA 3KLIA 4JI4K 1C6VA 2F8TA 4PY5A 1YUWA 3SQ1A 4OPHA 1HMVA 2FSJA 2VGMA 2VQEK 1TK5A 1GLJO 1Q9XA 4JS4A 1HLUA 3KK1A 3CCEN 3ASMA 1G99A 2NZTA 3OYNA 3SCXA 2E2OA 4IFEA 3C6TA 1W7AA 2HF3A 1RT7A 4FJNA 1VSFA 2E4LA 5HP1A 4AHTA 4F3TA 4AHRA 1W2BM 1T03A 4OJRA 3K59A 4DS4A 1XI1A 2YHYA 3QB0A 4FZZA 4DQPA 5M1PA 1C0FA 3RMBA 1NGCA 4B9QA 3V1QA 4KPYA 4JN4A 2H3GX 1MWKA 1ZBIA 1VSMA 4BRQA 3K5NA 4FJMA 3MECA 3LP0A 1DGKN 3LM9A 4K43A 4FM2A 1RTDA 2NUBA 3IAYA 2GEMA 1HJOA 3O9UA 4CZJA 3VEZA 1QQNA 4V19S 1NK8A 2E5LK 4BRMA 1A5VA 1QS4A 4QCLA 4AH9A 4XH1A 3P5JA 1JLCA 1YF5L 2I7PA 4CHQA 3I33A 2NRXA 4CGHA 1SKRA 4X65K 1NGFA 5CZ2A 5EOYA 4CJSA 2QWNA 4CJ3A 3LDNA 1NJYA 5AQHA 4CBUA 5HROA 4CK3A 3FZHA 2YI1A 4J2DA 4FVMA 2QXFA 5B8HA 3LDSA 4B9LA 3KLEA 1K8KB 4HUGA 2UUBK 1KVCA 2P9SB 3KK3A 3OS2A 1ILYA 3I8DA 1H1VA 3AO1A 4FLZA 1X9MA 2HHQA 1WSJA 2OZMA 3LP2A 4R79A 5KQDA 2G8UA 2KHOA 4CBWA 4KH4A 2NRWA 3T3FA 4WE1A 3NVMA 4BRNA 4BR2A 3NF8A 4CHZA 3DLBA 4OPKA 5JLHA 3G4SN 3NFAA 3SV3A 4F2SA 1WAJA 2VG7A 4B1XB 3ZYYX 4N5SA 3CC4N 4OGEA 4PHTX 1ZBUA 1JJ2M 5I9EB 1NOZA 4OPJA 1YVNA 3GBTA 2P9UB 3L4QA 5FPDA 3PO5A 4CFCA 3FZFA 5M1FA 5C2FA 5LMNK 4LSNA 3SMSA 3CPWM 1NJXA 3DMJA 4M42A 2UU9K 3WNFA 1IKYA 3RMCA 1QSSA 3RSEA 4AF1A 1RBTA 2D1KA 4CJEA 4DQ8A 3SK3A 3U4LA 4E1MA 1FXXA 5D3GA 2D0BA 1GLDG 3ULDA 3SJJA 2NLXA 5CYQA 5AQIA 5BR8K 3LDQA 3PO4A 2F7TA 4Z4GA 3IFRA 4A2BA 3CJCA 2HSTA 2E6MA 3I55N 2OPRA 2ZWHA 1TYQB 3EO3A 3NMUA 2UYTA 3GDQA 2KKZA 3BF1A 3LPUA 3MWPA 2PYLA 3AA2A 4JK9A 3WT0A 3QEPA 4KHQA 2HBMA 3WNHA 1QHTA 3AGRA 1J5OA 3PY8A 1TAQA 1VQMN 4ILGB 1JCGA 2D4WA 4CJ4A 2J4RA 3M3ZA 4BR7A 4LFCK 5F1XA 2IS3A 4M3ZA 3SAFA 2KW4A 4X62K 2A1RA 3H3NO 2E6LA 4FO0A 5BN9A 2VCPA 3RMAA 1X3NA 3C6HA 2F9TA 3F5TA 3SAGA 3AAPA 1QSLA 4EAHD 4FLTA 4FJ9A 4YDUC 1XHXA 4DTSA 4DF8A 3SUPA 2P9LA 5CE3A 1V4SA 5EU7A 4WFAL 5FRNA 2DY4A 3K9KA 2RE2A 2DPNA 1QSYA 1X9JA 3O1BA 2FBYA 3MCPA 4O0IA 4JKBA 3CCMN 3O80A 4DTPA 3VENA 1NOYA 3TAMA 5KPZA 4JI8K 3TSQA 2P9IB 1EWQA 2XY6A 3QEIA 4CF0A 4X66K 1NJWA 2IOCA 1REVA 4H0XB 4CF8A 1IBKK 5HRSA 2BH1A 3SLCA 4YFUA 4Z4IA 1LW2A 4O8UA 1S22A 2BE2A 3FZKA 4JRPA 3VQAA 1XHZA 1Q86O 2E88A 4DLGA 5I3UA 1RCHA 3HI0A 1S5JA 3VQPA 3NH2A 4CVNE 3H08A 3KK7A 5BPLA 3U9ZA 2VG5A 4J2BA 4BACA 1YTAA 3QFPA 1T7PA 3AVLA 2E1YA 2EHGA 1TUUA 1L3UA 3EL2A 1GLBG 2RN2A 5HRNA 3LWMA 3D2FA 3O08A 2I7NA 4Y1CA 4IKFA 3QETA 1XUPO 3O9SA 3LZIA 3OHRA 4FSVA 4E7IA 5BPMA 3VF6A 3NH1A 1VQKN 3KKSA 3V9WA 4MO5A 4LF5K 2F9WA 3QICA 3VESA 4NCAA 3UKUA 3ZSZA 1JCEA 3GOIA 3K2PA 5KQ8A 3C0BA 3CXCM 1LWCA 3OS0A 2NRTA 3EE9A 3MXIA 1RTHA 1TKDA 4B9MA 2HF4A 2YHBA 2YV0X 3VQ8A 2O8CA 3EY1A 4E7HA 1KFDA 4H5NA 3VPZA 4H5VA 3E9LA 1X9SA 1NKCA 1NGBA 4JV5K 3HP9A 3VQ6A 2OTJN 3WXKA 2GTDA 1IKXA 1KXPA 4IFYA 3O8MA 3B6PA 3SUQA 4IEIA 3SPYA 2PAVA 2CGJA 3ZEUB 3ZT0A 4M45A 4O44A 3PX0A 4A5BA 1LWFA 1RTIA 3TAFA 4Y1DA 1RBRA 3DXKB 3L0QA 1ZBSA 4FL9A 1MWMA 4KI4A 1Z25A 4NXNK 3MEEA 1GLAG 1HJRA 3TTFA 2P9KB 4Y0WA 2NNWA 3QLHA 3HVTA 3D2EB 2IVPA 3V6DA 1Z26A 5JMVA 4FOEA 1XC9A 4HWIA 4DV0K 3UE5A 1QZ6A 2AA4A 4B3OA 4BROA 1RBSA 1BIUA 1NNEA 4QS8A 3TSUA 1RFQA 2Q0RA 4IEEA 3BGRA 1BA0A 4YOXA 3JSMA 4CZIA 1TUYA 1IJJA 3LDOA 4F9OA 5AFUH 4CJUA 2B6AA 3O6WA 4RW9A 2G8HA 4ZTFA 4BRCA 4A5AA 3WEEB 2D0OA 1KD1O 1U2VB 2NRHA 4KTWA 3AA5X 2QK9A 4BWMA 3I0RA 3C7NA 1WN7A 3L2UA 2ATQA 3Q7CA 1HKCA 4YDUA 4CECA 4B3MK 2KZMA 1IV0A 3HTVA 1GOCA 3CJBA 4DTRA 3S9HA 1TK0A 1E3MA 4FWSA 4CGFA 3F73A 3RR7A 4JI1K 1CZBA 1JLBA 1OH7A 2OZSA 2I5JA 4DR4K 1NG9A 4GV3A 3F9KA 3L3VA 1NLVA 5AQPA 4QOZB 2WUSA 3PX4A 3AVHA 5LJWA 3HK2A 4C8KA 5I42A 1HQUA 4CZHA 1J53A 2YJFA 4DQRA 3CCRN 5J1EA 4JNEA 1HPZA 2DFHA 3CCQN 4CEFA 1M90O 4DV1K 4JKGB 3TAGA 3SQ0A 3HPOA 1UA1A 4GVEA 2KTQA 4JKDA 4CERA 1WAFA 4ZTJA 5J2QA 4BE0A 4CGJA 4EHUA 3A5OC 2ZQBA 3E9PA 3NH0A 3WXJA 4NYNA 5GAGP 3THYB 4E1JA 4PL7A 3SPZA 1UA0A 4WYBA 3AO4A 3V81A 3QERA 1J9AA 4FK0A 3C65A 4YOUA 4CJTA 4M3UA 3ALYA 4M7XA 4FLUA 2HHXA 3ZLJA 2EX3A 4YOTA 3E9OA 3MX5A 4B1ZA 1B9DA 4IG3A 1N6QA 5ADXH 4BG8A 4LD0A 4KHWA 4H0VB 3QNOA 3RWUA 1FKOA 1NGDA 2A6AA 4BDYA 4FYDA 4FVUA 3EE8A 2ASPA 3OS1A 3VQ9A 4DF4A 4BGBA 3J7AP 4CFDA 1T44A 4IDKA 3V9ZA 1YITN 3CMAN 4AM7A 4OLBA 5FDLA 3VF4A 3AVGA 4KO0A 1LCUA 4JD2A 3MDQA 5AZJB 2YJEA 2FLOA 4O5FA 3U9DA 2F4VK 4BR9A 3CC2N 3K57A 1C0UA 4L8RB 3AARA 2O8EA 4N76A 2OYQA 4BC4A 4IO8A 1RT6A 2QWLA 4FWPA 4M3WA 4PKHA 1RDBA 3MN9A 4CHOA 3OYJA 1KC8O 3VQ4A 4IG0A 4A2AA 3VQ7A 3NAEA 1D9DA 1HNWK 1U6ZA 1VSJA 4BR0A 4LC9B 3IMXA 4W5OA 3HVRA 3ZX2A 3ID8A 5KGWA 1OVQA 3OYIA 3RRGA 4G9ZA 2X6NA 2GWJA 3NGIA 3DLHA 5C42A 2XY8A 3QIOA 4C1NI 1FJGK 1NJZA 5JS2A 2WOMA 1YTUA 2E1ZA 4BC3A 1BQNA 4NYFA 4CF1A 4FWQA 4Q0BA 4JRQA 2QXLA 1J6ZA 2PY5A 5AQVA 2P9NB 3IS9A 3K5MA 2EWSA 1JLEA 3BEXA 3NGYA 3TPQA 2A1SA 3THVA 3K5LA 1WSIA 4OKJA 4K0KK 4FWNA 1T3VA 3N4PA 4C1NK 4FJXA 3CFPA 2HB5A 3K5OA 3LP1A 3U8XA 3THXA 4NB4A 4BDZA 3AO5A 2ZGZA 2XY7A 2ASMA 1WBDA 4FJKA 1LV5A 2CH6A 1KAXA 4BR5A 4E7JA 4M63C 1NGJA 5CHIA 3P39A 4FM0A 2O8BB 3PX6A 3ZSWA 3NE6A 3FR0A 3PIOL 4LF6K 1QTMA 2E2QA 3L6QA 3EYZA 4JYAK 1VQ5N 1I39A 3PUFA 4CE9A 4XIUA 3AA3A 4ILHA 1YIJN 2B5JA 2Z1IA 5C0YA 4JKHA 3HXMA 2RF2A 1NGEA 4FK4A 4ISEA 2Y1IA 1Q7YO 1EP4A 3DXMB 3B6OA 1GLLO 2QI2A 4BREA 2KLAA 5LJVA 1XMOK 3P1GA 4NCBA 3NCIA 3MAQA 3CIPA 4RG8A 3O3FA 4FJJA 3J7ZO 3EZ5A 3TARA 3OBWA 4DSEA 1ATNA 5KRTA 4FJHA 5HLFA 1MDUB 1U04A 4CBXA 5KRSA 1VQ9N 3R3LA 1XWLA 5BRHA 4AILC 5C10A 2WFBA 3KD5E 2RPIA 3V9UA 2YNGA 3G6EN 4M3RA 4Q5VA 1C1CA 3D7EO 3OYFA 3CCUN 2E20A 4BDPA 1HPMA 4B8AB 4DTXA 1WLJA 5AQQA 5GIPA 3RTVA 1YXQA 1BISA 1IG8A 4FLVA 4KHUA 1O1WA 3AVMA 4LSLA 4CJQA 1VQ4N 3OA9A 4RW6A 3C94A 4GKKK 4BY9C 4OKEA 3MXJA 3I8BA 4DWIA 2BTFA 3O9RA 5SWMA 3J81O 5KPRA 4DR2K 3DOLA 3TWHA 3OYCA 4KKOA 5M1KA 4PKIA 3CMEN 2V7ZA 3VA3A 2HW3A 3M8SA 4DQQA 1TGOA 4ZHRA 3P38A 4FWLA 5AQRA 3DLRA 1HYZA 3THWA 3LAKA 2VWKA 3R8EA 5E26A 1FKPA 5EX5A 4U67L 3UB5A 1U4BA 3O5BA 3CCVN 1VSEA 3UKRB 1ZXOA 3OBYA 1ZYQA 5CR4A 2Y1JA 4RCHA 2FSKA 5GADP 3DAWA 1T8EA 3TU5A 1ITGA 1NMNA 1Y97A 4H0YB 4NLBA 1FW6A 2G8KA 3NVKA 3CM6A 4EP4A 4RWTA 4CK1A 4BQZA 4MQ3A 4B1VA 4KHSA 2HHHK 4OVLA 1WBBA 4I9LA 3T7ZA 4BE1A 3I56N 4CF9A 3OW2M 2KFZA 1RT1A 3O4WA 4Z4CA 4BRHA 2A3ZA 3A0IX 3MCAB 4E7KA 2GX9A 3P83D 3G25A 2AP1A 3SBGA 3E01A 4DR1K 2NRVA 4C8NA 5E84A 2HHWA 4KV8A 2OANA 1SS6A 2YNHA 2P5OA 1SKSA 3ULEA 3ZSQA 2GWKA 3KVGA 3DRRA 2QWOA 2QWMA 2V51B 4DSFA 1Q8IA 4KAZA 4I9QA 3SAHA 1BDGA 3LWLA 3J7YP 1CXUA 2OPQA 3CETA 4CIFA 4O8KA 3C95A 1EXQA 1NU0A 2KQ2A 1VQPN 4CEBA 4MLHA 4DV7K 4NXMK 3SYZA 1VSDA 4DU1A 3DJCA 3BY5A 3G71N 1YAGA 4BRGA 3KWGA 4B8CA 4DTNA 3M8QA 3PV8A 2P9PA 1E4GT 2O8FB 3S3OA 3OYLA 4DU4A 4H03B 5C15A 1WSGA 3MN5A 3ATVA 3OYAA 1V4TA 4IJNA 1L5UA 3P4IA 4DHYA 2R7YA 3K0SA 2O8DA 1VSIA 1QVFM 3QMLA 4JI7K 4I6MA 4FLWA 5AZIB 4MDAA 1IH7A 4I2QA 4CEZA 1OKJA 5M1QA 5TKWA 4W5NA 4PQUA 2P1JA 2WTUA 4H4OA 1SL1A 1R0AA 3QEWA 2OTLN 3MWTA 4WQ4C 3ZETA 2IGIA 1FK9A 1HKBA 2Z1HA 4LH5A 4LFAK 3VF2A 3CM5A 4JAXA 3VEXA 5BPNA 3IDHA 4C8OA 1IBLK 1JCFA 3DOKA 2PBDA 1XC3A 1HKGA 1QQMA 3O4NA 4FWRA 4JHDA 4IO9L 1JLQA 4FZYA 4FJ5A 2ZE2A 4B1UB 3Q7BA 4DTJA 2QTDA 4DKWA 4HUEA 2ZF5O 1Q9YA 4KH6A 4XH5A 1CLQA 3V1RA 1BI4A 4CJPA 5ELZA 4X64K 3PSIA 2F96A 2FF6A 1TKTA 1SZ2A 1BGXT 4RTFD 4BRFA 3OYBA 3QNNA 1Q82O 2YHWA 3AA4A 4H0TB 4N47A 1S1UA 2FF3B 5GAEP 3IG1A 4CJVA 1X1PA 2V7YA 4CHNA 5EXWA 4TSXA 1BIZA 1KVBA 4W5QA 4BRKA 2OA8A 1RILA 3PSFA 1BHLA 3A5LC 2Q2RA 1SAZA 3AAQA 3JAMO 5AQLA 3ZX3A 1K73O 4FK2A 4DQIA 2FXUA 3H45C 2Z1GA 3HYFA 3D45A 1TL1A 1S72N 1WB9A 3H1QA 3S3NA 3DRPA 2JWLA 4CD3A 1U45A 1L3VA 4JEPA 1ZBHA 3OTOK 4GNIA 1JLAA 3LP3A 5F2RA 5KI6A 2YHAA 3SJHA 3RR8A 3DI6A 5H1SQ 2D0AA 3D6RA 1HYVA 2QWQA 3GL1A 2IC3A 3GE1A 3ZT3A 4DTMA 4XEIA 1DTQA 4CGIA 3MK6A 1J54A 4ILJA 2ITMA 4AQYK 3QBWA 3HPGA 1BOTO 4CEDA 3CF5L 4Z94A 4O4GA 3AVCA 2QA4N 3DLEA 1KRPA 1JKHA 1EWRA 2RHKA 3CD6N 5JVGL 3H6EA 3SQ4A 3ATUA 4FZXC 3CG7A 1S3XA 3HM8A 1NJIO 3VQEA 5AQJA 3AVKA 1RTJA 1N8RO 2FBTA 2NRZA 3VQ5A 4FJGA 1I3AA 3LAMA 4DV5K 2HHTA 3FZMA 5JS1A 4IXCA 3KD1E 3AGKA 1KCFA 1F21A 1NK4A 3OY9A 5J2MA 4CJLA 1N32K 1JXBA 4IZ9A 3G0ZA 1XNQK 4PWDA 2DFFA 4JKFA 4A57A 1VSKA 3VN5A 1K8KA 3KKRA 2BDPA 3EKUA 1IO2A 1TL3A 1RGIA 2IDOA 1LAWA 4WQ4A 2P9SA 1NWKA 4M41A 4CFAA 4FJLA 3QESA 3ZSVA 4JKEA 3M1FA 4BGAA 5DM7L 1HQEA 4K42A 4BG9A 4EHTA 4K41A 4OPAA 4CIEA 4B9NA 1NKBA 3LZJA 3ZSYA 5AQUA 4WCEL 5DM6L 3I0SA 4JI5K 3A2FA 3VEVA 5DMRA 1KLNA 3J80O 4DCHA 2D0PA 3L2VA 5CZ1A 4BRPA 3OYMA 4IOCL 4AHVA 1C0TA 3H1VX 3ZT4A 2V52B 4KRFA 4GY2B 1TKZA 1GOAA 2VG6A 2IAJA 3OJSA 2DTUA 5BRFA 5A2QO 4AHCA 4M3XA 3QEXA 2P9UA 1RT5A 3HL8A 1IKWA 2OPSA 3ZT1A 4LF8K 4UY8O 4CIGA 2BGGA 2VWBA 3H46O 4E89A 4YOYA 4F2RA 3RSEB 5BREA 2HNDA 1YHQN 1ASUA 3T69A 3VEWA 3HT3A 2HMIA 5BR9A 1RDWX 3BUZB 5AJ3K 4KHYA 3KIOA 1VQON 3VOVA 2A40A 5HBMA 1ASVA 4YHHK 3NGZA 4ISGA 1W9HA 4W5RA 1KQSM 2GUIA 3GG4A 2Q1NA 4JK8A 1SQKA 4HUFA 2PFUA 3PLAA 1TYQA 5KGXA 4KTQA 4DFJA 3QO9A 1N5YA 3L4IA 3S41A 1GLFO 3AO2A 2WBNA 5JLFA 3CFRA 3OYGA 3S3MA 2A42A 4NO7A 2X74A 4OO1J 4B9VA 1RT4A 1T05A 1SL0A 5AQYA 4ID5A 3CQXA 2IIRA 1Z05A 3J8AA 3VMFB 4CZKA 2ZGYA 1SKWA 4LFBK 4GMJB 4MFBA 5GIOA 3LDPA 4BVOA 4IOAL 2HBJA 2P9LB 1VRUA 1IBMK 2O4GA 3TI0A 1T6DA 1BU6O 1W0HA 4JK7A 2FSNA 1YT3A 4JI2K 4K8ZA 4C8MA 2P9IA 4M3TA 4J2EA 3HBTA 2HVHA 3HPHA 1KFSA 3E66A 4DS5A 1SL2A 4H0PA 4EIAA 2E2PA 3VGKA 1JXEA 4JI6K 4RW7A 1GOBA 5AQTA 4M3YA 2YCHA 2IVOA 3DWLA 4H4MA 4YORA 3WUHA 1EQYA 2HVIA 2HHSA 4O55A 2JLEA 3AVBA 5JVHL 5HL7L 1OH8A 3KLHA 4BQLA 4CI6A 4CZMA 1R59O 3MN7A 4CFBA 2YNIA 4GKJK 5KPTA 4O5BA 3TAQA 4HCBA 4NLCA 5HOOA 4FM1A 3D2FB 4B3RK 2QEXN 4LY7A 4CZFA 2BANA 3DLGA 1U48A 3VTHA 3VEOA 4FLXA 3FGUA 4YY3K 3A8YA 2KZZA 1NGHA 1U49A 3WQUA 1X3MA 1C0MA 3UKUB 1HR0K 1CZ9A 3LL3A 4FJ8A 4B1WB 2YKMA 2FBVA 3SMPA 4CEOA 4DB3A 3NF6A 4CD1A 4ELTA 3G10A 3QIPA 2O8CB 5E41A 1TVRA 4KB0A 3L3UA 4WFBL 4KBOA 3R1XA 1XMQK 4CEAA 4KFBA 5GAHP 1Q18A 4QS9A 4FJ7A 3RVCA 1JL1A 4MDBA 1XNRK 2QKKA 4F4KA 3ZEUA 5IT9O 3V9SA 3CQYA 1ZBFA 5TKYA 3W3DA 3VA0A 2G8FA 4ELUA 5FRMA 1OVYA 2E8AA 3DXKA 4QS7A 1LWEA 3AVJA 3FE1A 4FWMA 3R9PA 1G15A 4UQGA 3IRXA 3OYKA 2P9KA 3TTCA 4KHNA 3DM2A 1GLEG 4CZGA 3ID6A 3D2EA 5AQNA 3MEGA 3VGMA 4DU3A 1DKGD 1YI2N 4GW6A 1KAZA 3SI6A 5J2PA 1L3TA 4CK2A 3O1WA 5HRRA 1LAVA 4DTUA 5BRDA 1UOCA 4GVMA 3V9XA 4ISFA 5K14A 2RKIA 4CW7B 2GBZA 2XO7A 1CXQA 3H3OB 4DR7K 3BF3A 2XY5A 3WEEA 3ZT2A 3VTIA 1S9EA 4F8RA 1U2VA 3C7NB 1KTQA 3W0LA 4DV4K 3ITHA 3V1OA 5HRPA 4CGGA 2D5RA 4DSLA 1D5AA 3TABA 1B92A 3CCJN 3NF7A 4BRAA 5FPMA 4WFNL 4AM6A 3SZ2A 1NGGA 5SZTA 4I7FA 4FCYA 2LSNA 2CGKA 3QFUA 5MLCQ 3MXMA 3WXMB 4OX9K 3NBPA 3ENHA 4CJFA 4H0OA 1IG9A 1N33K 4BVPA 1ZBLA 1NKEA 1YJ9N 3VQQA 3TAPA 2O4IA 4A61A 1X9WA 1U47A 1I94K 5F0XA 1RDDA 1KVAA 4IJAA 4JKGA 3QDKA 3CERA 1VRTA 2OCEA 1N34K 3UIQA 2VYPA 4LH4A 2FC0A 4JI0K 1MU2A 1TKXA 4O0JA 3SBTA 2ZD1A 1VSLA 4M7YA 4CHPA 4CCHA 1GLCG 3A5MC 4H5TA 3ENBA 4DR5K 3CJAA 5KTQA 3THYA 4N56A 4CEEA 1HUXA 5C2DA 2YNFA 3QINA 3TSPA 4DMNA 4GV9A 2GELA 4FPAA 4BC2A 3M6GA 3OYHA 5CYMA 1LW0A 3TAEA 4C8LA 3CFOA 3F2KA 2F8SA 1NK6A 3IUCA 1RDUA 3KHYA 2PYJA 3SQ2A 1BUPA 4DSKA 4FJIA 4OKKA 3K58A 1BO5O 1S1VA 5FPEA 1NK0A 4KI6A 3NF9A 4CEQA 3OVNA 3IKMA 3ZX0A 4DUZK 1VSHA 3ENOA 3WXIA 2QKBA 1BWFO 3CQ8A 1RNHA 2G8IA 4DLEA 1ZC6A 3FFKB 3EZWA 3KLGA 3T1HK 5C24A 1OH6A 3O9QA 4MLEA 3HOTA 4JD2B 1DLOA 1WUAA 2A41A 3VQDA 3CJ1A 5AZJA 3KWIA 4L3QA 4LF7K 3HO1A 3CCLN 4ELVA 3EKSA 5GINA 4ICLA 2QWRA 1W97L 4DUYK 2O8EB 4HTLA 2WC9A 2HHVA 3QEVA 4A62A 2JGUA 4IOXA 4DR3K 3HZ6A 4CZEA 4HVJA 2ETJA 2ZJPL 1C1AA 3AVIA 5LY3A 3HSCA 1IKVA 1S6PA 4CZLA 2VQFK 1VQNN 2D0CA 3BZCA 1Z6RA 4CF2A 1WSFA 3C6AA 1SUQA 3DYAA 4OGCA 1BA1A 4AHUA 5M1NA 3EEQA 1NK5A 1CZAN 3KK2A 2DFEA 2HBLA 1EX4A 3T1YK 3ISNC 2KFNA 3SV4A 4BWJA 4XH4A 3V4IA 4R5PA 1BCOA 1HNXK 1C0GA 3VQBA 3LDLA 1D9FA 2IVNA 3NDKA 2CH5A 3O3HA 1BL3A 2HBKA 1ASWA 2A5XA 1O13A 4JLHA 2P9NA 3HM9A 3AVAA 3K9JA 1QHAA 1VQLN 4CGDA 4C23A 4FWKA 1BCMA 2UXBK 1DTTA 4IFVA 5CY4A 1NGIA 1A5XA 3U6FA 3MMVA 1HRHA 4G1QA 2HOEA 4YOVA 1WNSA 1VAZA 5AR0A 1S1WA 5M1OA 4DG1A 4KH5A 3THXB 3CPEA 3LPTA 4ID1A 4J8FA 4RW8A 1K9MO 3VERA 3ZSRA 3TANA 4CJ5A 3VGLA 4B3TK 4J2AA 3PIPL 4WF9L 3BP8A 2O8BA 2B4JA 4Z4HA 1OH5A 3L2WA 2UXDK 1HX1A 3L2RA 1Y64A 3LM2A 4HTUA 3JYTA 1QZ5A 2ZM6K 3C6UA 5AQMA 5J2NA 2HHUA 1VHXA 4AHSA 4BRLA 4BR4A 5AQSA 5EY4A 3A5NC 4HCCA 4E3SA 3HOSA 1QVGM 3SUNA 3JS6A 2GV9A 5AQXA 3MEDA 4E1NA 1BG3A 3AVNA 4F3OA 2P5GA 3B8AX 3CJ9A 1KAYA 2QM1A 1LOTB 2E2NA 4A59A 2X78A 4BRDA 3FZLA 3DXMA 1HNVA 1DEJA 2XRIA 1HNIA 3MX2A 4JI3K 3CCSN 3AV9A 5LMUK 1N36K 4LF9K 2ASOA 4KREA 2Q0UA 3N4QA 4DFMA 1D4XA 4B9TA 4KHPK 3ZSXA 4KB1A 4FXDA 5AFUA 2XHBA 3WNGA 3OYDA 2UXCK 3BDPA 1WSHA 2YX6A 4KTZA 1KSPA 1A5WA 2YKNA 4BRIA 4EFHA 4MO4A 1M1KO 2NRRA 1JLGA 1S1TA 1DT9A 1NM1A 3O9TA 1C1BA 4I2PA 4HHTA 1S6QA 4PL8A 4PA1A 5C12A 4PKGA 2AJQA 5AQZA 5FROA 4RW4A 5IWAK 4DV6K 1NMDA 3ZCMA 4Z0UA 4BE2A 3KZBA 2VWJA 1QQCA 3ZSOA 1ESVA 3SUOA 4E19A 1L3SA 2UUCK
chains in the Genus database with same CATH topology
3FLCO 3E66A 4H0XB 5KPRA 3WXLA 5EVZA 4H0PA 4EIAA 2BH1A 4CBWA 3SLCA 2GUPA 2E2PA 3VGKA 5M1KA 4PKIA 3CMEN 2V7ZA 4O8UA 1S22A 3FZKA 4GV6A 1P90A 3P38A 4FWLA 5AQTA 2YCHA 2IVOA 3DWLA 4YORA 5AQRA 3WUHA 1EQYA 4FOIA 1Q86O 2E88A 4FPBA 3HI0A 5JVHL 2W40A 3R8EA 5HL7L 5AQFA 4BQLA 5E26A 5EX5A 1EO1A 1WOQA 2QWPA 3UB5A 4U67L 4CI6A 4JKCA 4WQ5C 3O5BA 4CZMA 1R59O 3CCVN 3MN7A 2Q97A 3UKRB 3UKRA 1ZXOA 3KK7A 3OBYA 4H5RA 5BPLA 3U9ZA 5CR4A 1MA9B 4RCHA 3QFPA 2FSKA 5KPTA 5GADP 2E1YA 3MN6A 3DAWA 1TUUA 1VQ8N 3TU5A 2Q36A 4NLCA 3EL2A 4K25A 5HOOA 1GLBG 3R6MA 3D2FB 3D2FA 3O08A 4H0YB 4NLBA 2QEXN 4JKAA 2I7NA 3NVKA 2VGNA 4CZFA 4RWTA 4BQZA 1XUPO 3O9SA 3OHRA 4FSVA 3VTHA 3VEOA 3FGUA 5BPMA 3VF6A 4B1VA 3A8YA 1VQKN 5AQGA 1NGHA 1K8AO 4MO5A 2F9WA 3QICA 3T7ZA 3VESA 3WQUA 1X3MA 3UKUB 1NGAA 1JCEA 3UKUA 3GOIA 3I56N 5ADXA 5KQ8A 3OW2M 4FWOA 3C0BA 3LL3A 5JICA 3CXCM 3O4WA 2NRTA 4BRHA 3EE9A 4B1WB 2A3ZA 3SMPA 4DB3A 3P31A 3A0IX 4CD1A 3MCAB 3TTDA 2HF4A 2GX9A 1T6CA 3G25A 2AP1A 3SBGA 2ZJRL 4H5NA 3VPZA 4H5VA 4WFBL 2NRVA 3E9LA 3HRGA 1NGBA 5E84A 2OTJN 2OANA 3WXKA 4KBOA 1SS6A 3R1XA 2GTDA 3AY9A 1KXPA 5GAHP 3ULEB 3ULEA 1ATRA 3O8MA 1Q18A 4QS9A 2GWKA 3RVCA 4MDBA 3KVGA 4IEIA 2PAVA 2QWOA 2CGJA 2QWMA 2V51B 3ZEUA 3ZEUB 3CQYA 3SAHA 1VQ7N 3CJ7A 1BDGA 4A5BA 4BC5A 3CETA 5TKYA 3W3DA 4O8KA 1OVYA 2E8AA 3DXKB 3DXKA 3F9MA 3L0QA 1VQPN 4MLHA 4QS7A 1ZBSA 4FL9A 1MWMA 3FE1A 4FWMA 3R9PA 3DJCA 1YJNN 3G71N 3VEYA 2Q31A 1GLAG 1YAGA 4BRGA 3KWGA 2BUPA 2P9PA 1E4GT 2P9KB 2P9PB 2P9KA 3CI5A 3TTCA 3TTFA 1GLEG 4Y0WA 4H03B 2JWKA 2NNWA 4CZGA 3ID6A 5AQOA 3D2EB 3D2EA 2IVPA 5AQNA 5C15A 5JMVA 3MN5A 3ATVA 4FOEA 3JXUA 3CHWA 3VGMA 1DKGD 4HWIA 1V4TA 3UE5A 4IJNA 1YI2N 4H5WA 5FPNA 1QZ6A 3P4IA 2AA4A 1KAZA 4BROA 4DHYA 3O1WA 4QS8A 3TSUA 4IWVA 1RFQA 5BRDA 2Q0RA 1QVFM 2YHXA 3E1YA 3QMLA 4IEEA 1XQSC 4I6MB 4I6MA 1BA0A 2QW9A 4ISFA 4MDAA 5AZIB 5AZIA 4YOXA 1OKJA 5M1QA 4CZIA 5TKWA 1TUYA 4IDHA 3H3OB 1IJJA 3LDOA 4F9OA 5AFUH 3BF3A 3O6WA 4BRCA 4A5AA 3WEEB 2D0OA 2W41A 3VTIA 3WEEA 1KD1O 2OTLN 1U2VA 1U2VB 2NRHA 3MWTA 4WQ4C 1Q81O 3M5RA 1VQ6N 3C7NB 3C7NA 3W0LA 3ZETA 3ZETB 1HKBA 2CGLA 3Q7CA 3VF2A 1HKCA 4JAXA 3VEXA 5BPNA 3CC7N 4YDUA 3IDHA 1JCFA 2PBDA 3QBXA 3HTVA 1XC3A 1HKGA 1QQMA 1YJWN 3CJBA 3CCJN 4BRAA 4FWSA 1E4FT 5FPMA 4WFNL 4FWRA 4JHDA 4JHDB 5AQWA 4IO9L 4AM6A 2ZJQL 4B1UB 3Q7BA 1NGGA 5AQKA 5BN8A 3VETA 2QTDA 4DKWA 3DLLL 2CGKA 3NMUA 3QFUA 3WQTA 5MLCQ 2ZF5O 4KH6A 1NBWA 4XH5A 3WXMB 3EN9A 3ENHA 4B1YB 4GV3A 4H0OA 1NLVA 5AQPA 1P8ZA 2WUSA 4CJ7A 4BVPA 5LJWA 5ELZA 4YOWA 1YJ9N 4CZHA 2FF6A 2YJFA 4A61A 3CCRN 1SZ2A 4JNEA 5F0XA 4RTFD 3CCQN 4IJAA 1M90O 1QQOA 2HMPA 4BRFA 4JKGA 3QDKA 2YHWA 3CERA 4H0TB 4JKGB 1Q82O 4GVEA 2VYPA 2FF3B 4JKDA 5GAEP 4WQ5A 4M7YA 3SBTA 1ATSA 2V7YA 5EXWA 4U7BA 1GLCG 4EHUA 4BRKA 3A5OC 3A5MC 4H5TA 3ENBA 3E9PA 3WXJA 3A5LC 2Q2RA 5GAGP 3CJAA 1SAZA 3AAQA 1YUWA 4E1JA 4PL7A 1HUXA 4OPHA 5C2DA 4WYBA 2FSJA 5AQLA 3ZX3A 1K73O 2VGMA 3TSPA 2FXUA 3C65A 4YOUA 3H45C 4GV9A 2GELA 4FPAA 4BC2A 1GLJO 3M6GA 1S72N 4M7XA 1HLUA 3CCEN 3F2KA 3H1QA 2JWLA 4YOTA 1G99A 2NZTA 4CD3A 3E9OA 3MX5A 4JEPA 2E2OA 4IFEA 4B1ZA 3IUCA 1RDUA 2HF3A 3KHYA 5ADXH 4GNIA 1BUPA 5F2RA 4BG8A 4H0VB 3SJHA 2A6AA 1NGDA 1W2BM 5H1SQ 1BO5O 3EE8A 2ASPA 4FVUA 5FPEA 4BGBA 3D6RA 3IKMA 2QWQA 2YHYA 3ZX0A 3GL1A 3QB0A 3GE1A 3ENOA 4XEIA 3WXIA 1BWFO 1T44A 5M1PA 1C0FA 3MK6A 1NGCA 4ILJA 1ZC6A 3FFKB 3EZWA 2ITMA 4B9QA 1YITN 3CMAN 4JN4A 3QBWA 2H3GX 4AM7A 1BOTO 1MWKA 3O9QA 3CF5L 4Z94A 3VF4A 4BRQA 4MLEA 3HOTA 1LCUA 4JD2A 4JD2B 1WUAA 2A41A 3CJ1A 1DGKN 3MDQA 3LM9A 2YJEA 3KWIA 2FLOA 4K43A 5AZJB 5AZJA 2QA4N 4L3QA 2GEMA 4O5FA 3U9DA 3CD6N 2RHKA 4BR9A 1HJOA 3O9UA 3CC2N 3CCLN 4CZJA 5JVGL 3H6EA 3EKSA 5GINA 3VEZA 2QWRA 3ATUA 1QQNA 1W97L 3AARA 4HTLA 1S3XA 2WC9A 4BRMA 4BC4A 3HM8A 4IO8A 4A62A 1NJIO 4IOXA 3HZ6A 5AQJA 4CZEA 2QWLA 4XH1A 4FWPA 2ZJPL 1YF5L 2I7PA 1N8RO 3I33A 5LY3A 2NRZA 2NRXA 3HSCA 4PKHA 3MN9A 4CZLA 1VQNN 1KC8O 4A2AA 3FZMA 1NGFA 1U6ZA 1Z6RA 4IXCA 3AGKA 5EOYA 2QWNA 4BR0A 3LDNA 3C6AA 3IMXA 4LC9B 5AQHA 4CBUA 3ZX2A 3FZHA 3ID8A 4IZ9A 1BA1A 5M1NA 2YI1A 1CZAN 2HBLA 5B8HA 4JKFA 4XH4A 4A57A 4G9ZA 1K8KB 1K8KA 2GWJA 1C0GA 3EKUA 1RGIA 3LDLA 4C1NI 2IVNA 4WQ4A 2CH5A 2P9SB 1NWKA 2P9SA 1ILYA 1H1VA 2HBKA 2E1ZA 4BC3A 2A5XA 4JKEA 4R79A 3M1FA 4BGAA 5DM7L 1O13A 4FWQA 4K42A 4BG9A 2QXLA 1J6ZA 4EHTA 5KQDA 2KHOA 2P9NB 2P9NA 4K41A 2EWSA 3K9JA 4KH4A 4OPAA 5AQVA 1QHAA 3BEXA 2NRWA 1VQLN 4C23A 4FWKA 3TPQA 5AQUA 4WCEL 3NVMA 5DM6L 4BRNA 4BR2A 3VEVA 1NGIA 3MMVA 4DCHA 2D0PA 4FWNA 5JLHA 4BRPA 2HOEA 4YOVA 1T3VA 4IOCL 1VAZA 3G4SN 3N4PA 4C1NK 3H1VX 5AR0A 2V52B 4B1XB 3ZYYX 5M1OA 4GY2B 4KH5A 3U8XA 3CPEA 4NB4A 4J8FA 2ZGZA 1K9MO 3VERA 5BRFA 2ASMA 3CC4N 4PHTX 2CH6A 1JJ2M 3VGLA 1KAXA 5I9EB 1YVNA 3GBTA 2P9UA 2P9UB 4BR5A 3PIPL 3L4QA 4M63C 1NGJA 5CHIA 4WF9L 3P39A 3BP8A 5FPDA 5M1FA 3FZFA 3FR0A 3PIOL 5C2FA 1HX1A 2E2QA 1Y64A 3L6QA 3S41A 3SMSA 3CPWM 4UY8O 3LM2A 2VWBA 3H46O 4YOYA 1QZ5A 3RSEA 3RSEB 4AF1A 5BREA 2D1KA 5AQMA 1VQ5N 4DQ8A 3SK3A 3U4LA 4BRLA 1YHQN 3T69A 4BR4A 3VEWA 5AQSA 5EY4A 1RDWX 4ILHA 3A5NC 3BUZB 5BR9A 1YIJN 1GLDG 3HOSA 1QVGM 1VQON 2NLXA 3VOVA 2A40A 3JS6A 5C0YA 5AQIA 3LDQA 4JKHA 5AQXA 2F7TA 4ISGA 1BG3A 1KQSM 1NGEA 3IFRA 3B8AX 3CJ9A 1KAYA 3CJCA 2QM1A 3GG4A 4A2BA 2HSTA 2Q1NA 1LOTB 2E2NA 4JK8A 3I55N 1SQKA 4A59A 3PLAA 2PFUA 4ISEA 4BRDA 2ZWHA 3FZLA 1TYQB 1TYQA 1Q7YO 3DXMB 3DXMA 1GLFO 1GLLO 1DEJA 2QI2A 3EO3A 3L4IA 2UYTA 3GDQA 3MX2A 2KLAA 4BREA 2KKZA 3CCSN 2WBNA 3BF1A 5LJVA 5JLFA 3MWPA 2A42A 4JK9A 4NO7A 3WT0A 2HBMA 4OO1J 2ASOA 3AGRA 3CIPA 1VQMN 4ILGB 2Q0UA 1JCGA 3N4QA 1D4XA 3J7ZO 3OBWA 2D4WA 2J4RA 3M3ZA 4BR7A 1ATNA 5AQYA 5F1XA 1MDUB 5AFUA 3SAFA 4CBXA 3CQXA 3H3NO 2IIRA 1Z05A 2YX6A 3J8AA 4FO0A 3VMFB 1VQ9N 5BN9A 2VCPA 1X3NA 4CZKA 3C6HA 3R3LA 2ZGYA 5BRHA 2F9TA 4BRIA 3F5TA 4EFHA 4MO4A 1M1KO 5C10A 2WFBA 2NRRA 3SAGA 1DT9A 3AAPA 1NM1A 3O9TA 4EAHD 3G6EN 5GIOA 3LDPA 4BVOA 4IOAL 4YDUC 2HBJA 2P9LB 2P9LA 1V4SA 5CE3A 4WFAL 3CCUN 3D7EO 3K9KA 4PL8A 2E20A 5C12A 1T6DA 2RE2A 2DPNA 4PKGA 1HPMA 5AQZA 1BU6O 1X9JA 5AQQA 3O1BA 3MCPA 4JK7A 1YXQA 5GIPA 1NMDA 2FSNA 1IG8A 4JKBA 3CCMN 3O80A 3VENA 1VQ4N 3KZBA 3OA9A 5KPZA 3TSQA 4BY9C 2P9IB 2P9IA 3I8BA 3HBTA 2BTFA 3O9RA 1ESVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FLC O;  4H0X B;  5KPR A;  3WXL A;  5EVZ A;  4H0P A;  4EIA A;  3SLC A;  2GUP A;  2E2P A;  3VGK A;  4PKI A;  2V7Z A;  1S22 A;  3FZK A;  5AQT A;  4FWL A;  5AQR A;  2YCH A;  2IVO A;  3DWL A;  3WUH A;  1EQY A;  4FOI A;  2E88 A;  4FPB A;  3HI0 A;  2W40 A;  3R8E A;  5AQF A;  4BQL A;  5E26 A;  5EX5 A;  1WOQ A;  2QWP A;  3UB5 A;  4CI6 A;  4WQ5 C;  3O5B A;  4CZM A;  1R59 O;  3MN7 A;  2Q97 A;  3UKR B;  3UKR A;  1ZXO A;  4H5R A;  5BPL A;  3U9Z A;  1MA9 B;  4RCH A;  3QFP A;  2FSK A;  5KPT A;  2E1Y A;  3MN6 A;  3DAW A;  1TUU A;  3TU5 A;  2Q36 A;  3EL2 A;  4K25 A;  1GLB G;  3R6M A;  3D2F B;  3D2F A;  3O08 A;  4H0Y B;  2I7N A;  4CZF A;  4RWT A;  4BQZ A;  1XUP O;  3OHR A;  4FSV A;  3VEO A;  3FGU A;  5BPM A;  3VF6 A;  4B1V A;  3A8Y A;  5AQG A;  1NGH A;  4MO5 A;  2F9W A;  3QIC A;  3VES A;  3WQU A;  1X3M A;  3UKU B;  1NGA A;  1JCE A;  3UKU A;  3GOI A;  5ADX A;  5KQ8 A;  4FWO A;  3C0B A;  3LL3 A;  5JIC A;  3O4W A;  4BRH A;  4B1W B;  2A3Z A;  3SMP A;  4DB3 A;  3A0I X;  4CD1 A;  2HF4 A;  1T6C A;  3G25 A;  2AP1 A;  4H5N A;  3VPZ A;  4H5V A;  1NGB A;  5E84 A;  2OAN A;  3WXK A;  4KBO A;  2GTD A;  3AY9 A;  1KXP A;  3ULE B;  3ULE A;  1ATR A;  3O8M A;  1Q18 A;  4QS9 A;  2GWK A;  3KVG A;  2PAV A;  2QWO A;  2CGJ A;  2QWM A;  2V51 B;  3ZEU A;  3ZEU B;  3CQY A;  3CJ7 A;  1BDG A;  4BC5 A;  3CET A;  5TKY A;  3W3D A;  4O8K A;  2E8A A;  3DXK B;  3DXK A;  3F9M A;  3L0Q A;  4MLH A;  4QS7 A;  1ZBS A;  4FL9 A;  1MWM A;  3FE1 A;  4FWM A;  3R9P A;  3DJC A;  3VEY A;  2Q31 A;  1GLA G;  1YAG A;  4BRG A;  2BUP A;  2P9P A;  1E4G T;  2P9K B;  2P9P B;  2P9K A;  3CI5 A;  1GLE G;  4Y0W A;  4H03 B;  4CZG A;  5AQO A;  3D2E B;  3D2E A;  2IVP A;  5AQN A;  5JMV A;  3MN5 A;  3ATV A;  4FOE A;  3JXU A;  3CHW A;  3VGM A;  1DKG D;  4HWI A;  1V4T A;  3UE5 A;  4IJN A;  4H5W A;  5FPN A;  1QZ6 A;  3P4I A;  2AA4 A;  1KAZ A;  4BRO A;  4DHY A;  3O1W A;  4QS8 A;  4IWV A;  1RFQ A;  5BRD A;  2Q0R A;  2YHX A;  3QML A;  1XQS C;  4I6M B;  4I6M A;  1BA0 A;  2QW9 A;  4ISF A;  5AZI B;  5AZI A;  1OKJ A;  4CZI A;  1TUY A;  3H3O B;  1IJJ A;  3LDO A;  4F9O A;  5AFU H;  3BF3 A;  3O6W A;  4BRC A;  3WEE B;  2D0O A;  2W41 A;  3WEE A;  1U2V A;  1U2V B;  2NRH A;  4WQ4 C;  3C7N B;  3C7N A;  3W0L A;  3ZET A;  3ZET B;  1HKB A;  2CGL A;  3VF2 A;  1HKC A;  4JAX A;  3VEX A;  5BPN A;  4YDU A;  3IDH A;  1JCF A;  2PBD A;  3QBX A;  3HTV A;  1XC3 A;  1HKG A;  1QQM A;  3CJB A;  4BRA A;  4FWS A;  1E4F T;  5FPM A;  4FWR A;  4JHD A;  4JHD B;  5AQW A;  4AM6 A;  4B1U B;  1NGG A;  5AQK A;  5BN8 A;  3VET A;  2CGK A;  3QFU A;  3WQT A;  2ZF5 O;  1NBW A;  4XH5 A;  3EN9 A;  3ENH A;  4B1Y B;  4H0O A;  1NLV A;  5AQP A;  1P8Z A;  2WUS A;  4CJ7 A;  4BVP A;  5LJW A;  5ELZ A;  4CZH A;  2FF6 A;  2YJF A;  4A61 A;  1SZ2 A;  4JNE A;  5F0X A;  4RTF D;  4IJA A;  1QQO A;  2HMP A;  4BRF A;  3QDK A;  2YHW A;  3CER A;  4H0T B;  2VYP A;  2FF3 B;  4WQ5 A;  4M7Y A;  1ATS A;  2V7Y A;  5EXW A;  1GLC G;  4EHU A;  4BRK A;  3A5O C;  3A5M C;  4H5T A;  3WXJ A;  3A5L C;  2Q2R A;  3CJA A;  1SAZ A;  3AAQ A;  1YUW A;  4E1J A;  4PL7 A;  1HUX A;  4WYB A;  2FSJ A;  5AQL A;  3ZX3 A;  2FXU A;  3H45 C;  2GEL A;  4FPA A;  4BC2 A;  1GLJ O;  3M6G A;  4M7X A;  1HLU A;  3H1Q A;  4CD3 A;  1G99 A;  2NZT A;  2E2O A;  4B1Z A;  3IUC A;  2HF3 A;  3KHY A;  5ADX H;  4GNI A;  1BUP A;  5F2R A;  4BG8 A;  4H0V B;  3SJH A;  2A6A A;  1NGD A;  1BO5 O;  2ASP A;  5FPE A;  4BGB A;  2QWQ A;  2YHY A;  3ZX0 A;  3GL1 A;  3QB0 A;  3GE1 A;  3ENO A;  4XEI A;  3WXI A;  1BWF O;  1T44 A;  1C0F A;  3MK6 A;  1NGC A;  4B9Q A;  1ZC6 A;  3FFK B;  3EZW A;  2ITM A;  4JN4 A;  3QBW A;  2H3G X;  4AM7 A;  1BOT O;  1MWK A;  4Z94 A;  3VF4 A;  4BRQ A;  4MLE A;  1LCU A;  4JD2 A;  4JD2 B;  1WUA A;  2A41 A;  3CJ1 A;  1DGK N;  3MDQ A;  3LM9 A;  2YJE A;  4K43 A;  2FLO A;  5AZJ B;  5AZJ A;  4L3Q A;  2GEM A;  4O5F A;  3U9D A;  4BR9 A;  1HJO A;  4CZJ A;  3H6E A;  3EKS A;  3VEZ A;  2QWR A;  3ATU A;  1QQN A;  3AAR A;  4HTL A;  1S3X A;  4BRM A;  4BC4 A;  3HM8 A;  4IO8 A;  4A62 A;  3HZ6 A;  5AQJ A;  4CZE A;  2QWL A;  4XH1 A;  4FWP A;  2I7P A;  3I33 A;  5LY3 A;  3HSC A;  4PKH A;  3MN9 A;  4CZL A;  4A2A A;  3FZM A;  1NGF A;  1U6Z A;  1Z6R A;  4IXC A;  5EOY A;  4BR0 A;  2QWN A;  3LDN A;  4LC9 B;  3IMX A;  5AQH A;  4CBU A;  3ZX2 A;  3FZH A;  3ID8 A;  4IZ9 A;  1BA1 A;  2YI1 A;  1CZA N;  5B8H A;  4XH4 A;  1K8K B;  1K8K A;  2GWJ A;  1C0G A;  3EKU A;  1RGI A;  3LDL A;  2IVN A;  4WQ4 A;  2CH5 A;  2P9S B;  1NWK A;  2P9S A;  1H1V A;  2E1Z A;  4BC3 A;  2A5X A;  3M1F A;  4BGA A;  4FWQ A;  4K42 A;  4BG9 A;  2QXL A;  1J6Z A;  4EHT A;  5KQD A;  2KHO A;  2P9N B;  2P9N A;  4K41 A;  2EWS A;  5AQV A;  4CBW A;  1QHA A;  3BEX A;  4C23 A;  4FWK A;  3TPQ A;  5AQU A;  4BRN A;  4BR2 A;  3VEV A;  1NGI A;  3MMV A;  4DCH A;  2D0P A;  4FWN A;  5JLH A;  4BRP A;  2HOE A;  3H1V X;  5AR0 A;  2V52 B;  4B1X B;  4GY2 B;  3U8X A;  4NB4 A;  4J8F A;  2ZGZ A;  3VER A;  5BRF A;  2ASM A;  2CH6 A;  3VGL A;  1KAX A;  5I9E B;  1YVN A;  3GBT A;  2P9U A;  2P9U B;  4BR5 A;  4M63 C;  1NGJ A;  3BP8 A;  5FPD A;  3FZF A;  3FR0 A;  1HX1 A;  2E2Q A;  1Y64 A;  3L6Q A;  3SMS A;  3LM2 A;  2VWB A;  3H46 O;  1QZ5 A;  3RSE A;  3RSE B;  5BRE A;  2D1K A;  5AQM A;  4DQ8 A;  3SK3 A;  3U4L A;  4BRL A;  4BR4 A;  3VEW A;  5AQS A;  5EY4 A;  1RDW X;  5BR9 A;  3A5N C;  3BUZ B;  1GLD G;  2NLX A;  3VOV A;  2A40 A;  3JS6 A;  5AQI A;  3LDQ A;  5AQX A;  4ISG A;  1BG3 A;  1NGE A;  3IFR A;  3B8A X;  3CJ9 A;  1KAY A;  3CJC A;  2QM1 A;  3GG4 A;  4A2B A;  2Q1N A;  1LOT B;  2E2N A;  1SQK A;  4ISE A;  4BRD A;  2ZWH A;  3FZL A;  1TYQ B;  1TYQ A;  3DXM B;  3DXM A;  1GLF O;  1GLL O;  1DEJ A;  3EO3 A;  3L4I A;  3S41 A;  2UYT A;  3GDQ A;  4BRE A;  3BF1 A;  5LJV A;  5JLF A;  2A42 A;  4NO7 A;  3WT0 A;  2ASO A;  3CIP A;  2Q0U A;  1JCG A;  1D4X A;  2D4W A;  2J4R A;  3M3Z A;  4BR7 A;  1ATN A;  5AQY A;  5F1X A;  1MDU B;  5AFU A;  4CBX A;  3CQX A;  3H3N O;  2IIR A;  1Z05 A;  3J8A A;  4FO0 A;  5BN9 A;  2VCP A;  1X3N A;  4CZK A;  2ZGY A;  5BRH A;  2F9T A;  4BRI A;  4EFH A;  4MO4 A;  3AAP A;  1NM1 A;  4EAH D;  3LDP A;  4BVO A;  4YDU C;  2P9L B;  2P9L A;  1V4S A;  5CE3 A;  3D7E O;  4PL8 A;  2E20 A;  1T6D A;  4PKG A;  2DPN A;  1HPM A;  5AQZ A;  1BU6 O;  1X9J A;  5AQQ A;  3O1B A;  3MCP A;  1YXQ A;  1NMD A;  2FSN A;  1IG8 A;  3O80 A;  3VEN A;  3KZB A;  5KPZ A;  2P9I B;  2P9I A;  3I8B A;  3HBT A;  2BTF A;  1ESV A; 
#chains in the Genus database with same CATH topology
 1TAU A;  3FLC O;  4K8X A;  1RT2 A;  2HNZ A;  3WXL A;  5EVZ A;  2GUP A;  1VK0 A;  1RBV A;  4DR6 K;  3NHG A;  4GV6 A;  1P90 A;  3THW B;  3KLF A;  4FOI A;  2OPP A;  2W42 A;  4FPB A;  1RT3 A;  4DFK A;  1JLF A;  2W40 A;  5AQF A;  4Z4E A;  1EO1 A;  1WOQ A;  2QWP A;  4JKC A;  4WQ5 C;  4EZ6 A;  4YNQ A;  3T1A A;  4E0D A;  1UAX A;  2Q97 A;  3UKR A;  4H5R A;  4FW1 A;  1MA9 B;  1QE1 A;  1D8Y A;  3MN6 A;  1RDC A;  4FW2 A;  2W6L A;  5FLX O;  2Q36 A;  1VQ8 N;  4K25 A;  4CHY A;  3L8B A;  3R6M A;  2G8W A;  4JKA A;  3RRH A;  1NK7 A;  2VGN A;  1S9G A;  4OLA A;  1J5E K;  2HNY A;  2W6K A;  5AQG A;  1K8A O;  1HNZ K;  4E7L A;  4LF4 K;  1NGA A;  5ADX A;  2P51 A;  4FWO A;  5JIC A;  4DQS A;  2G8V A;  4DV2 K;  1NK9 A;  1EKE A;  3O4Q A;  3AO3 A;  2PZS A;  3P31 A;  3TTD A;  1T6C A;  2ZJR L;  4NCG A;  4CJW A;  4DSJ A;  4B08 A;  3HRG A;  3HP6 A;  4EZ9 A;  3U3G A;  1YVU A;  3AY9 A;  3VQC A;  1K6Y A;  3ULE B;  1ATR A;  4CJR A;  2UUA K;  3KTQ A;  1BQM A;  1VQ7 N;  3CJ7 A;  4IBN A;  4BC5 A;  3L2Q A;  3F9M A;  3AVF A;  3HJF A;  3LAN A;  4B9S A;  1YJN N;  1JL2 A;  3VEY A;  2Q31 A;  4JS5 A;  2BUP A;  2P9P B;  2FBX A;  3CI5 A;  3BZK A;  4DSI A;  2O8F A;  1RDA A;  2JWK A;  5AQO A;  3HST B;  1TV6 A;  2Q3S A;  3JXU A;  3CHW A;  3OJU A;  3LAL A;  4H5W A;  4EP5 A;  5FPN A;  1SV5 A;  5LL6 Z;  4H8K A;  4IWV A;  4CES A;  2O8D B;  2YHX A;  3E1Y A;  1XQS C;  4I6M B;  5AZI A;  2QW9 A;  4N41 A;  4IDH A;  1S1X A;  1KLM A;  4DFP A;  2W41 A;  5C25 A;  4Z4F A;  3T19 A;  3U3Y A;  1WSE A;  4B3S K;  3SNN A;  3M5R A;  1Q81 O;  1VQ6 N;  3WNE A;  3ZET B;  4FLY A;  2CGL A;  5DK5 A;  3CC7 N;  3QBX A;  1YJW N;  3RMD A;  4B9U A;  2X6S A;  3O3G A;  4DTO A;  1E4F T;  3OYE A;  4JHD B;  5AQW A;  2ZJQ L;  5AQK A;  5BN8 A;  3VET A;  3DLL L;  2ITG A;  3TR8 A;  3WQT A;  1NBW A;  3KJV A;  3EN9 A;  4B1Y B;  4W5T A;  4DV3 K;  1P8Z A;  4CJ7 A;  1BI4 B;  3M8P A;  2Z1J A;  4YOW A;  3M8R A;  3DLK A;  4PUO A;  1UWB A;  4CJK A;  2WON A;  4QAG A;  1QQO A;  2HMP A;  1EET A;  1RBU A;  3DRS A;  3FFI A;  1TK8 A;  4WQ5 A;  1HYS A;  1ATS A;  1B9F A;  5T7B A;  3D0P A;  4U7B A;  3CYM A;  3KLI A;  4JI4 K;  1C6V A;  2F8T A;  4PY5 A;  1YUW A;  3SQ1 A;  4OPH A;  1HMV A;  2FSJ A;  2VGM A;  2VQE K;  1TK5 A;  1GLJ O;  1Q9X A;  4JS4 A;  1HLU A;  3KK1 A;  3CCE N;  3ASM A;  1G99 A;  2NZT A;  3OYN A;  3SCX A;  2E2O A;  4IFE A;  3C6T A;  1W7A A;  2HF3 A;  1RT7 A;  4FJN A;  1VSF A;  2E4L A;  5HP1 A;  4AHT A;  4F3T A;  4AHR A;  1W2B M;  1T03 A;  4OJR A;  3K59 A;  4DS4 A;  1XI1 A;  2YHY A;  3QB0 A;  4FZZ A;  4DQP A;  5M1P A;  1C0F A;  3RMB A;  1NGC A;  4B9Q A;  3V1Q A;  4KPY A;  4JN4 A;  2H3G X;  1MWK A;  1ZBI A;  1VSM A;  4BRQ A;  3K5N A;  4FJM A;  3MEC A;  3LP0 A;  1DGK N;  3LM9 A;  4K43 A;  4FM2 A;  1RTD A;  2NUB A;  3IAY A;  2GEM A;  1HJO A;  3O9U A;  4CZJ A;  3VEZ A;  1QQN A;  4V19 S;  1NK8 A;  2E5L K;  4BRM A;  1A5V A;  1QS4 A;  4QCL A;  4AH9 A;  4XH1 A;  3P5J A;  1JLC A;  1YF5 L;  2I7P A;  4CHQ A;  3I33 A;  2NRX A;  4CGH A;  1SKR A;  4X65 K;  1NGF A;  5CZ2 A;  5EOY A;  4CJS A;  2QWN A;  4CJ3 A;  3LDN A;  1NJY A;  5AQH A;  4CBU A;  5HRO A;  4CK3 A;  3FZH A;  2YI1 A;  4J2D A;  4FVM A;  2QXF A;  5B8H A;  3LDS A;  4B9L A;  3KLE A;  1K8K B;  4HUG A;  2UUB K;  1KVC A;  2P9S B;  3KK3 A;  3OS2 A;  1ILY A;  3I8D A;  1H1V A;  3AO1 A;  4FLZ A;  1X9M A;  2HHQ A;  1WSJ A;  2OZM A;  3LP2 A;  4R79 A;  5KQD A;  2G8U A;  2KHO A;  4CBW A;  4KH4 A;  2NRW A;  3T3F A;  4WE1 A;  3NVM A;  4BRN A;  4BR2 A;  3NF8 A;  4CHZ A;  3DLB A;  4OPK A;  5JLH A;  3G4S N;  3NFA A;  3SV3 A;  4F2S A;  1WAJ A;  2VG7 A;  4B1X B;  3ZYY X;  4N5S A;  3CC4 N;  4OGE A;  4PHT X;  1ZBU A;  1JJ2 M;  5I9E B;  1NOZ A;  4OPJ A;  1YVN A;  3GBT A;  2P9U B;  3L4Q A;  5FPD A;  3PO5 A;  4CFC A;  3FZF A;  5M1F A;  5C2F A;  5LMN K;  4LSN A;  3SMS A;  3CPW M;  1NJX A;  3DMJ A;  4M42 A;  2UU9 K;  3WNF A;  1IKY A;  3RMC A;  1QSS A;  3RSE A;  4AF1 A;  1RBT A;  2D1K A;  4CJE A;  4DQ8 A;  3SK3 A;  3U4L A;  4E1M A;  1FXX A;  5D3G A;  2D0B A;  1GLD G;  3ULD A;  3SJJ A;  2NLX A;  5CYQ A;  5AQI A;  5BR8 K;  3LDQ A;  3PO4 A;  2F7T A;  4Z4G A;  3IFR A;  4A2B A;  3CJC A;  2HST A;  2E6M A;  3I55 N;  2OPR A;  2ZWH A;  1TYQ B;  3EO3 A;  3NMU A;  2UYT A;  3GDQ A;  2KKZ A;  3BF1 A;  3LPU A;  3MWP A;  2PYL A;  3AA2 A;  4JK9 A;  3WT0 A;  3QEP A;  4KHQ A;  2HBM A;  3WNH A;  1QHT A;  3AGR A;  1J5O A;  3PY8 A;  1TAQ A;  1VQM N;  4ILG B;  1JCG A;  2D4W A;  4CJ4 A;  2J4R A;  3M3Z A;  4BR7 A;  4LFC K;  5F1X A;  2IS3 A;  4M3Z A;  3SAF A;  2KW4 A;  4X62 K;  2A1R A;  3H3N O;  2E6L A;  4FO0 A;  5BN9 A;  2VCP A;  3RMA A;  1X3N A;  3C6H A;  2F9T A;  3F5T A;  3SAG A;  3AAP A;  1QSL A;  4EAH D;  4FLT A;  4FJ9 A;  4YDU C;  1XHX A;  4DTS A;  4DF8 A;  3SUP A;  2P9L A;  5CE3 A;  1V4S A;  5EU7 A;  4WFA L;  5FRN A;  2DY4 A;  3K9K A;  2RE2 A;  2DPN A;  1QSY A;  1X9J A;  3O1B A;  2FBY A;  3MCP A;  4O0I A;  4JKB A;  3CCM N;  3O80 A;  4DTP A;  3VEN A;  1NOY A;  3TAM A;  5KPZ A;  4JI8 K;  3TSQ A;  2P9I B;  1EWQ A;  2XY6 A;  3QEI A;  4CF0 A;  4X66 K;  1NJW A;  2IOC A;  1REV A;  4H0X B;  4CF8 A;  1IBK K;  5HRS A;  2BH1 A;  3SLC A;  4YFU A;  4Z4I A;  1LW2 A;  4O8U A;  1S22 A;  2BE2 A;  3FZK A;  4JRP A;  3VQA A;  1XHZ A;  1Q86 O;  2E88 A;  4DLG A;  5I3U A;  1RCH A;  3HI0 A;  1S5J A;  3VQP A;  3NH2 A;  4CVN E;  3H08 A;  3KK7 A;  5BPL A;  3U9Z A;  2VG5 A;  4J2B A;  4BAC A;  1YTA A;  3QFP A;  1T7P A;  3AVL A;  2E1Y A;  2EHG A;  1TUU A;  1L3U A;  3EL2 A;  1GLB G;  2RN2 A;  5HRN A;  3LWM A;  3D2F A;  3O08 A;  2I7N A;  4Y1C A;  4IKF A;  3QET A;  1XUP O;  3O9S A;  3LZI A;  3OHR A;  4FSV A;  4E7I A;  5BPM A;  3VF6 A;  3NH1 A;  1VQK N;  3KKS A;  3V9W A;  4MO5 A;  4LF5 K;  2F9W A;  3QIC A;  3VES A;  4NCA A;  3UKU A;  3ZSZ A;  1JCE A;  3GOI A;  3K2P A;  5KQ8 A;  3C0B A;  3CXC M;  1LWC A;  3OS0 A;  2NRT A;  3EE9 A;  3MXI A;  1RTH A;  1TKD A;  4B9M A;  2HF4 A;  2YHB A;  2YV0 X;  3VQ8 A;  2O8C A;  3EY1 A;  4E7H A;  1KFD A;  4H5N A;  3VPZ A;  4H5V A;  3E9L A;  1X9S A;  1NKC A;  1NGB A;  4JV5 K;  3HP9 A;  3VQ6 A;  2OTJ N;  3WXK A;  2GTD A;  1IKX A;  1KXP A;  4IFY A;  3O8M A;  3B6P A;  3SUQ A;  4IEI A;  3SPY A;  2PAV A;  2CGJ A;  3ZEU B;  3ZT0 A;  4M45 A;  4O44 A;  3PX0 A;  4A5B A;  1LWF A;  1RTI A;  3TAF A;  4Y1D A;  1RBR A;  3DXK B;  3L0Q A;  1ZBS A;  4FL9 A;  1MWM A;  4KI4 A;  1Z25 A;  4NXN K;  3MEE A;  1GLA G;  1HJR A;  3TTF A;  2P9K B;  4Y0W A;  2NNW A;  3QLH A;  3HVT A;  3D2E B;  2IVP A;  3V6D A;  1Z26 A;  5JMV A;  4FOE A;  1XC9 A;  4HWI A;  4DV0 K;  3UE5 A;  1QZ6 A;  2AA4 A;  4B3O A;  4BRO A;  1RBS A;  1BIU A;  1NNE A;  4QS8 A;  3TSU A;  1RFQ A;  2Q0R A;  4IEE A;  3BGR A;  1BA0 A;  4YOX A;  3JSM A;  4CZI A;  1TUY A;  1IJJ A;  3LDO A;  4F9O A;  5AFU H;  4CJU A;  2B6A A;  3O6W A;  4RW9 A;  2G8H A;  4ZTF A;  4BRC A;  4A5A A;  3WEE B;  2D0O A;  1KD1 O;  1U2V B;  2NRH A;  4KTW A;  3AA5 X;  2QK9 A;  4BWM A;  3I0R A;  3C7N A;  1WN7 A;  3L2U A;  2ATQ A;  3Q7C A;  1HKC A;  4YDU A;  4CEC A;  4B3M K;  2KZM A;  1IV0 A;  3HTV A;  1GOC A;  3CJB A;  4DTR A;  3S9H A;  1TK0 A;  1E3M A;  4FWS A;  4CGF A;  3F73 A;  3RR7 A;  4JI1 K;  1CZB A;  1JLB A;  1OH7 A;  2OZS A;  2I5J A;  4DR4 K;  1NG9 A;  4GV3 A;  3F9K A;  3L3V A;  1NLV A;  5AQP A;  4QOZ B;  2WUS A;  3PX4 A;  3AVH A;  5LJW A;  3HK2 A;  4C8K A;  5I42 A;  1HQU A;  4CZH A;  1J53 A;  2YJF A;  4DQR A;  3CCR N;  5J1E A;  4JNE A;  1HPZ A;  2DFH A;  3CCQ N;  4CEF A;  1M90 O;  4DV1 K;  4JKG B;  3TAG A;  3SQ0 A;  3HPO A;  1UA1 A;  4GVE A;  2KTQ A;  4JKD A;  4CER A;  1WAF A;  4ZTJ A;  5J2Q A;  4BE0 A;  4CGJ A;  4EHU A;  3A5O C;  2ZQB A;  3E9P A;  3NH0 A;  3WXJ A;  4NYN A;  5GAG P;  3THY B;  4E1J A;  4PL7 A;  3SPZ A;  1UA0 A;  4WYB A;  3AO4 A;  3V81 A;  3QER A;  1J9A A;  4FK0 A;  3C65 A;  4YOU A;  4CJT A;  4M3U A;  3ALY A;  4M7X A;  4FLU A;  2HHX A;  3ZLJ A;  2EX3 A;  4YOT A;  3E9O A;  3MX5 A;  4B1Z A;  1B9D A;  4IG3 A;  1N6Q A;  5ADX H;  4BG8 A;  4LD0 A;  4KHW A;  4H0V B;  3QNO A;  3RWU A;  1FKO A;  1NGD A;  2A6A A;  4BDY A;  4FYD A;  4FVU A;  3EE8 A;  2ASP A;  3OS1 A;  3VQ9 A;  4DF4 A;  4BGB A;  3J7A P;  4CFD A;  1T44 A;  4IDK A;  3V9Z A;  1YIT N;  3CMA N;  4AM7 A;  4OLB A;  5FDL A;  3VF4 A;  3AVG A;  4KO0 A;  1LCU A;  4JD2 A;  3MDQ A;  5AZJ B;  2YJE A;  2FLO A;  4O5F A;  3U9D A;  2F4V K;  4BR9 A;  3CC2 N;  3K57 A;  1C0U A;  4L8R B;  3AAR A;  2O8E A;  4N76 A;  2OYQ A;  4BC4 A;  4IO8 A;  1RT6 A;  2QWL A;  4FWP A;  4M3W A;  4PKH A;  1RDB A;  3MN9 A;  4CHO A;  3OYJ A;  1KC8 O;  3VQ4 A;  4IG0 A;  4A2A A;  3VQ7 A;  3NAE A;  1D9D A;  1HNW K;  1U6Z A;  1VSJ A;  4BR0 A;  4LC9 B;  3IMX A;  4W5O A;  3HVR A;  3ZX2 A;  3ID8 A;  5KGW A;  1OVQ A;  3OYI A;  3RRG A;  4G9Z A;  2X6N A;  2GWJ A;  3NGI A;  3DLH A;  5C42 A;  2XY8 A;  3QIO A;  4C1N I;  1FJG K;  1NJZ A;  5JS2 A;  2WOM A;  1YTU A;  2E1Z A;  4BC3 A;  1BQN A;  4NYF A;  4CF1 A;  4FWQ A;  4Q0B A;  4JRQ A;  2QXL A;  1J6Z A;  2PY5 A;  5AQV A;  2P9N B;  3IS9 A;  3K5M A;  2EWS A;  1JLE A;  3BEX A;  3NGY A;  3TPQ A;  2A1S A;  3THV A;  3K5L A;  1WSI A;  4OKJ A;  4K0K K;  4FWN A;  1T3V A;  3N4P A;  4C1N K;  4FJX A;  3CFP A;  2HB5 A;  3K5O A;  3LP1 A;  3U8X A;  3THX A;  4NB4 A;  4BDZ A;  3AO5 A;  2ZGZ A;  2XY7 A;  2ASM A;  1WBD A;  4FJK A;  1LV5 A;  2CH6 A;  1KAX A;  4BR5 A;  4E7J A;  4M63 C;  1NGJ A;  5CHI A;  3P39 A;  4FM0 A;  2O8B B;  3PX6 A;  3ZSW A;  3NE6 A;  3FR0 A;  3PIO L;  4LF6 K;  1QTM A;  2E2Q A;  3L6Q A;  3EYZ A;  4JYA K;  1VQ5 N;  1I39 A;  3PUF A;  4CE9 A;  4XIU A;  3AA3 A;  4ILH A;  1YIJ N;  2B5J A;  2Z1I A;  5C0Y A;  4JKH A;  3HXM A;  2RF2 A;  1NGE A;  4FK4 A;  4ISE A;  2Y1I A;  1Q7Y O;  1EP4 A;  3DXM B;  3B6O A;  1GLL O;  2QI2 A;  4BRE A;  2KLA A;  5LJV A;  1XMO K;  3P1G A;  4NCB A;  3NCI A;  3MAQ A;  3CIP A;  4RG8 A;  3O3F A;  4FJJ A;  3J7Z O;  3EZ5 A;  3TAR A;  3OBW A;  4DSE A;  1ATN A;  5KRT A;  4FJH A;  5HLF A;  1MDU B;  1U04 A;  4CBX A;  5KRS A;  1VQ9 N;  3R3L A;  1XWL A;  5BRH A;  4AIL C;  5C10 A;  2WFB A;  3KD5 E;  2RPI A;  3V9U A;  2YNG A;  3G6E N;  4M3R A;  4Q5V A;  1C1C A;  3D7E O;  3OYF A;  3CCU N;  2E20 A;  4BDP A;  1HPM A;  4B8A B;  4DTX A;  1WLJ A;  5AQQ A;  5GIP A;  3RTV A;  1YXQ A;  1BIS A;  1IG8 A;  4FLV A;  4KHU A;  1O1W A;  3AVM A;  4LSL A;  4CJQ A;  1VQ4 N;  3OA9 A;  4RW6 A;  3C94 A;  4GKK K;  4BY9 C;  4OKE A;  3MXJ A;  3I8B A;  4DWI A;  2BTF A;  3O9R A;  5SWM A;  3J81 O;  5KPR A;  4DR2 K;  3DOL A;  3TWH A;  3OYC A;  4KKO A;  5M1K A;  4PKI A;  3CME N;  2V7Z A;  3VA3 A;  2HW3 A;  3M8S A;  4DQQ A;  1TGO A;  4ZHR A;  3P38 A;  4FWL A;  5AQR A;  3DLR A;  1HYZ A;  3THW A;  3LAK A;  2VWK A;  3R8E A;  5E26 A;  1FKP A;  5EX5 A;  4U67 L;  3UB5 A;  1U4B A;  3O5B A;  3CCV N;  1VSE A;  3UKR B;  1ZXO A;  3OBY A;  1ZYQ A;  5CR4 A;  2Y1J A;  4RCH A;  2FSK A;  5GAD P;  3DAW A;  1T8E A;  3TU5 A;  1ITG A;  1NMN A;  1Y97 A;  4H0Y B;  4NLB A;  1FW6 A;  2G8K A;  3NVK A;  3CM6 A;  4EP4 A;  4RWT A;  4CK1 A;  4BQZ A;  4MQ3 A;  4B1V A;  4KHS A;  2HHH K;  4OVL A;  1WBB A;  4I9L A;  3T7Z A;  4BE1 A;  3I56 N;  4CF9 A;  3OW2 M;  2KFZ A;  1RT1 A;  3O4W A;  4Z4C A;  4BRH A;  2A3Z A;  3A0I X;  3MCA B;  4E7K A;  2GX9 A;  3P83 D;  3G25 A;  2AP1 A;  3SBG A;  3E01 A;  4DR1 K;  2NRV A;  4C8N A;  5E84 A;  2HHW A;  4KV8 A;  2OAN A;  1SS6 A;  2YNH A;  2P5O A;  1SKS A;  3ULE A;  3ZSQ A;  2GWK A;  3KVG A;  3DRR A;  2QWO A;  2QWM A;  2V51 B;  4DSF A;  1Q8I A;  4KAZ A;  4I9Q A;  3SAH A;  1BDG A;  3LWL A;  3J7Y P;  1CXU A;  2OPQ A;  3CET A;  4CIF A;  4O8K A;  3C95 A;  1EXQ A;  1NU0 A;  2KQ2 A;  1VQP N;  4CEB A;  4MLH A;  4DV7 K;  4NXM K;  3SYZ A;  1VSD A;  4DU1 A;  3DJC A;  3BY5 A;  3G71 N;  1YAG A;  4BRG A;  3KWG A;  4B8C A;  4DTN A;  3M8Q A;  3PV8 A;  2P9P A;  1E4G T;  2O8F B;  3S3O A;  3OYL A;  4DU4 A;  4H03 B;  5C15 A;  1WSG A;  3MN5 A;  3ATV A;  3OYA A;  1V4T A;  4IJN A;  1L5U A;  3P4I A;  4DHY A;  2R7Y A;  3K0S A;  2O8D A;  1VSI A;  1QVF M;  3QML A;  4JI7 K;  4I6M A;  4FLW A;  5AZI B;  4MDA A;  1IH7 A;  4I2Q A;  4CEZ A;  1OKJ A;  5M1Q A;  5TKW A;  4W5N A;  4PQU A;  2P1J A;  2WTU A;  4H4O A;  1SL1 A;  1R0A A;  3QEW A;  2OTL N;  3MWT A;  4WQ4 C;  3ZET A;  2IGI A;  1FK9 A;  1HKB A;  2Z1H A;  4LH5 A;  4LFA K;  3VF2 A;  3CM5 A;  4JAX A;  3VEX A;  5BPN A;  3IDH A;  4C8O A;  1IBL K;  1JCF A;  3DOK A;  2PBD A;  1XC3 A;  1HKG A;  1QQM A;  3O4N A;  4FWR A;  4JHD A;  4IO9 L;  1JLQ A;  4FZY A;  4FJ5 A;  2ZE2 A;  4B1U B;  3Q7B A;  4DTJ A;  2QTD A;  4DKW A;  4HUE A;  2ZF5 O;  1Q9Y A;  4KH6 A;  4XH5 A;  1CLQ A;  3V1R A;  1BI4 A;  4CJP A;  5ELZ A;  4X64 K;  3PSI A;  2F96 A;  2FF6 A;  1TKT A;  1SZ2 A;  1BGX T;  4RTF D;  4BRF A;  3OYB A;  3QNN A;  1Q82 O;  2YHW A;  3AA4 A;  4H0T B;  4N47 A;  1S1U A;  2FF3 B;  5GAE P;  3IG1 A;  4CJV A;  1X1P A;  2V7Y A;  4CHN A;  5EXW A;  4TSX A;  1BIZ A;  1KVB A;  4W5Q A;  4BRK A;  2OA8 A;  1RIL A;  3PSF A;  1BHL A;  3A5L C;  2Q2R A;  1SAZ A;  3AAQ A;  3JAM O;  5AQL A;  3ZX3 A;  1K73 O;  4FK2 A;  4DQI A;  2FXU A;  3H45 C;  2Z1G A;  3HYF A;  3D45 A;  1TL1 A;  1S72 N;  1WB9 A;  3H1Q A;  3S3N A;  3DRP A;  2JWL A;  4CD3 A;  1U45 A;  1L3V A;  4JEP A;  1ZBH A;  3OTO K;  4GNI A;  1JLA A;  3LP3 A;  5F2R A;  5KI6 A;  2YHA A;  3SJH A;  3RR8 A;  3DI6 A;  5H1S Q;  2D0A A;  3D6R A;  1HYV A;  2QWQ A;  3GL1 A;  2IC3 A;  3GE1 A;  3ZT3 A;  4DTM A;  4XEI A;  1DTQ A;  4CGI A;  3MK6 A;  1J54 A;  4ILJ A;  2ITM A;  4AQY K;  3QBW A;  3HPG A;  1BOT O;  4CED A;  3CF5 L;  4Z94 A;  4O4G A;  3AVC A;  2QA4 N;  3DLE A;  1KRP A;  1JKH A;  1EWR A;  2RHK A;  3CD6 N;  5JVG L;  3H6E A;  3SQ4 A;  3ATU A;  4FZX C;  3CG7 A;  1S3X A;  3HM8 A;  1NJI O;  3VQE A;  5AQJ A;  3AVK A;  1RTJ A;  1N8R O;  2FBT A;  2NRZ A;  3VQ5 A;  4FJG A;  1I3A A;  3LAM A;  4DV5 K;  2HHT A;  3FZM A;  5JS1 A;  4IXC A;  3KD1 E;  3AGK A;  1KCF A;  1F21 A;  1NK4 A;  3OY9 A;  5J2M A;  4CJL A;  1N32 K;  1JXB A;  4IZ9 A;  3G0Z A;  1XNQ K;  4PWD A;  2DFF A;  4JKF A;  4A57 A;  1VSK A;  3VN5 A;  1K8K A;  3KKR A;  2BDP A;  3EKU A;  1IO2 A;  1TL3 A;  1RGI A;  2IDO A;  1LAW A;  4WQ4 A;  2P9S A;  1NWK A;  4M41 A;  4CFA A;  4FJL A;  3QES A;  3ZSV A;  4JKE A;  3M1F A;  4BGA A;  5DM7 L;  1HQE A;  4K42 A;  4BG9 A;  4EHT A;  4K41 A;  4OPA A;  4CIE A;  4B9N A;  1NKB A;  3LZJ A;  3ZSY A;  5AQU A;  4WCE L;  5DM6 L;  3I0S A;  4JI5 K;  3A2F A;  3VEV A;  5DMR A;  1KLN A;  3J80 O;  4DCH A;  2D0P A;  3L2V A;  5CZ1 A;  4BRP A;  3OYM A;  4IOC L;  4AHV A;  1C0T A;  3H1V X;  3ZT4 A;  2V52 B;  4KRF A;  4GY2 B;  1TKZ A;  1GOA A;  2VG6 A;  2IAJ A;  3OJS A;  2DTU A;  5BRF A;  5A2Q O;  4AHC A;  4M3X A;  3QEX A;  2P9U A;  1RT5 A;  3HL8 A;  1IKW A;  2OPS A;  3ZT1 A;  4LF8 K;  4UY8 O;  4CIG A;  2BGG A;  2VWB A;  3H46 O;  4E89 A;  4YOY A;  4F2R A;  3RSE B;  5BRE A;  2HND A;  1YHQ N;  1ASU A;  3T69 A;  3VEW A;  3HT3 A;  2HMI A;  5BR9 A;  1RDW X;  3BUZ B;  5AJ3 K;  4KHY A;  3KIO A;  1VQO N;  3VOV A;  2A40 A;  5HBM A;  1ASV A;  4YHH K;  3NGZ A;  4ISG A;  1W9H A;  4W5R A;  1KQS M;  2GUI A;  3GG4 A;  2Q1N A;  4JK8 A;  1SQK A;  4HUF A;  2PFU A;  3PLA A;  1TYQ A;  5KGX A;  4KTQ A;  4DFJ A;  3QO9 A;  1N5Y A;  3L4I A;  3S41 A;  1GLF O;  3AO2 A;  2WBN A;  5JLF A;  3CFR A;  3OYG A;  3S3M A;  2A42 A;  4NO7 A;  2X74 A;  4OO1 J;  4B9V A;  1RT4 A;  1T05 A;  1SL0 A;  5AQY A;  4ID5 A;  3CQX A;  2IIR A;  1Z05 A;  3J8A A;  3VMF B;  4CZK A;  2ZGY A;  1SKW A;  4LFB K;  4GMJ B;  4MFB A;  5GIO A;  3LDP A;  4BVO A;  4IOA L;  2HBJ A;  2P9L B;  1VRU A;  1IBM K;  2O4G A;  3TI0 A;  1T6D A;  1BU6 O;  1W0H A;  4JK7 A;  2FSN A;  1YT3 A;  4JI2 K;  4K8Z A;  4C8M A;  2P9I A;  4M3T A;  4J2E A;  3HBT A;  2HVH A;  3HPH A;  1KFS A;  3E66 A;  4DS5 A;  1SL2 A;  4H0P A;  4EIA A;  2E2P A;  3VGK A;  1JXE A;  4JI6 K;  4RW7 A;  1GOB A;  5AQT A;  4M3Y A;  2YCH A;  2IVO A;  3DWL A;  4H4M A;  4YOR A;  3WUH A;  1EQY A;  2HVI A;  2HHS A;  4O55 A;  2JLE A;  3AVB A;  5JVH L;  5HL7 L;  1OH8 A;  3KLH A;  4BQL A;  4CI6 A;  4CZM A;  1R59 O;  3MN7 A;  4CFB A;  2YNI A;  4GKJ K;  5KPT A;  4O5B A;  3TAQ A;  4HCB A;  4NLC A;  5HOO A;  4FM1 A;  3D2F B;  4B3R K;  2QEX N;  4LY7 A;  4CZF A;  2BAN A;  3DLG A;  1U48 A;  3VTH A;  3VEO A;  4FLX A;  3FGU A;  4YY3 K;  3A8Y A;  2KZZ A;  1NGH A;  1U49 A;  3WQU A;  1X3M A;  1C0M A;  3UKU B;  1HR0 K;  1CZ9 A;  3LL3 A;  4FJ8 A;  4B1W B;  2YKM A;  2FBV A;  3SMP A;  4CEO A;  4DB3 A;  3NF6 A;  4CD1 A;  4ELT A;  3G10 A;  3QIP A;  2O8C B;  5E41 A;  1TVR A;  4KB0 A;  3L3U A;  4WFB L;  4KBO A;  3R1X A;  1XMQ K;  4CEA A;  4KFB A;  5GAH P;  1Q18 A;  4QS9 A;  4FJ7 A;  3RVC A;  1JL1 A;  4MDB A;  1XNR K;  2QKK A;  4F4K A;  3ZEU A;  5IT9 O;  3V9S A;  3CQY A;  1ZBF A;  5TKY A;  3W3D A;  3VA0 A;  2G8F A;  4ELU A;  5FRM A;  1OVY A;  2E8A A;  3DXK A;  4QS7 A;  1LWE A;  3AVJ A;  3FE1 A;  4FWM A;  3R9P A;  1G15 A;  4UQG A;  3IRX A;  3OYK A;  2P9K A;  3TTC A;  4KHN A;  3DM2 A;  1GLE G;  4CZG A;  3ID6 A;  3D2E A;  5AQN A;  3MEG A;  3VGM A;  4DU3 A;  1DKG D;  1YI2 N;  4GW6 A;  1KAZ A;  3SI6 A;  5J2P A;  1L3T A;  4CK2 A;  3O1W A;  5HRR A;  1LAV A;  4DTU A;  5BRD A;  1UOC A;  4GVM A;  3V9X A;  4ISF A;  5K14 A;  2RKI A;  4CW7 B;  2GBZ A;  2XO7 A;  1CXQ A;  3H3O B;  4DR7 K;  3BF3 A;  2XY5 A;  3WEE A;  3ZT2 A;  3VTI A;  1S9E A;  4F8R A;  1U2V A;  3C7N B;  1KTQ A;  3W0L A;  4DV4 K;  3ITH A;  3V1O A;  5HRP A;  4CGG A;  2D5R A;  4DSL A;  1D5A A;  3TAB A;  1B92 A;  3CCJ N;  3NF7 A;  4BRA A;  5FPM A;  4WFN L;  4AM6 A;  3SZ2 A;  1NGG A;  5SZT A;  4I7F A;  4FCY A;  2LSN A;  2CGK A;  3QFU A;  5MLC Q;  3MXM A;  3WXM B;  4OX9 K;  3NBP A;  3ENH A;  4CJF A;  4H0O A;  1IG9 A;  1N33 K;  4BVP A;  1ZBL A;  1NKE A;  1YJ9 N;  3VQQ A;  3TAP A;  2O4I A;  4A61 A;  1X9W A;  1U47 A;  1I94 K;  5F0X A;  1RDD A;  1KVA A;  4IJA A;  4JKG A;  3QDK A;  3CER A;  1VRT A;  2OCE A;  1N34 K;  3UIQ A;  2VYP A;  4LH4 A;  2FC0 A;  4JI0 K;  1MU2 A;  1TKX A;  4O0J A;  3SBT A;  2ZD1 A;  1VSL A;  4M7Y A;  4CHP A;  4CCH A;  1GLC G;  3A5M C;  4H5T A;  3ENB A;  4DR5 K;  3CJA A;  5KTQ A;  3THY A;  4N56 A;  4CEE A;  1HUX A;  5C2D A;  2YNF A;  3QIN A;  3TSP A;  4DMN A;  4GV9 A;  2GEL A;  4FPA A;  4BC2 A;  3M6G A;  3OYH A;  5CYM A;  1LW0 A;  3TAE A;  4C8L A;  3CFO A;  3F2K A;  2F8S A;  1NK6 A;  3IUC A;  1RDU A;  3KHY A;  2PYJ A;  3SQ2 A;  1BUP A;  4DSK A;  4FJI A;  4OKK A;  3K58 A;  1BO5 O;  1S1V A;  5FPE A;  1NK0 A;  4KI6 A;  3NF9 A;  4CEQ A;  3OVN A;  3IKM A;  3ZX0 A;  4DUZ K;  1VSH A;  3ENO A;  3WXI A;  2QKB A;  1BWF O;  3CQ8 A;  1RNH A;  2G8I A;  4DLE A;  1ZC6 A;  3FFK B;  3EZW A;  3KLG A;  3T1H K;  5C24 A;  1OH6 A;  3O9Q A;  4MLE A;  3HOT A;  4JD2 B;  1DLO A;  1WUA A;  2A41 A;  3VQD A;  3CJ1 A;  5AZJ A;  3KWI A;  4L3Q A;  4LF7 K;  3HO1 A;  3CCL N;  4ELV A;  3EKS A;  5GIN A;  4ICL A;  2QWR A;  1W97 L;  4DUY K;  2O8E B;  4HTL A;  2WC9 A;  2HHV A;  3QEV A;  4A62 A;  2JGU A;  4IOX A;  4DR3 K;  3HZ6 A;  4CZE A;  4HVJ A;  2ETJ A;  2ZJP L;  1C1A A;  3AVI A;  5LY3 A;  3HSC A;  1IKV A;  1S6P A;  4CZL A;  2VQF K;  1VQN N;  2D0C A;  3BZC A;  1Z6R A;  4CF2 A;  1WSF A;  3C6A A;  1SUQ A;  3DYA A;  4OGC A;  1BA1 A;  4AHU A;  5M1N A;  3EEQ A;  1NK5 A;  1CZA N;  3KK2 A;  2DFE A;  2HBL A;  1EX4 A;  3T1Y K;  3ISN C;  2KFN A;  3SV4 A;  4BWJ A;  4XH4 A;  3V4I A;  4R5P A;  1BCO A;  1HNX K;  1C0G A;  3VQB A;  3LDL A;  1D9F A;  2IVN A;  3NDK A;  2CH5 A;  3O3H A;  1BL3 A;  2HBK A;  1ASW A;  2A5X A;  1O13 A;  4JLH A;  2P9N A;  3HM9 A;  3AVA A;  3K9J A;  1QHA A;  1VQL N;  4CGD A;  4C23 A;  4FWK A;  1BCM A;  2UXB K;  1DTT A;  4IFV A;  5CY4 A;  1NGI A;  1A5X A;  3U6F A;  3MMV A;  1HRH A;  4G1Q A;  2HOE A;  4YOV A;  1WNS A;  1VAZ A;  5AR0 A;  1S1W A;  5M1O A;  4DG1 A;  4KH5 A;  3THX B;  3CPE A;  3LPT A;  4ID1 A;  4J8F A;  4RW8 A;  1K9M O;  3VER A;  3ZSR A;  3TAN A;  4CJ5 A;  3VGL A;  4B3T K;  4J2A A;  3PIP L;  4WF9 L;  3BP8 A;  2O8B A;  2B4J A;  4Z4H A;  1OH5 A;  3L2W A;  2UXD K;  1HX1 A;  3L2R A;  1Y64 A;  3LM2 A;  4HTU A;  3JYT A;  1QZ5 A;  2ZM6 K;  3C6U A;  5AQM A;  5J2N A;  2HHU A;  1VHX A;  4AHS A;  4BRL A;  4BR4 A;  5AQS A;  5EY4 A;  3A5N C;  4HCC A;  4E3S A;  3HOS A;  1QVG M;  3SUN A;  3JS6 A;  2GV9 A;  5AQX A;  3MED A;  4E1N A;  1BG3 A;  3AVN A;  4F3O A;  2P5G A;  3B8A X;  3CJ9 A;  1KAY A;  2QM1 A;  1LOT B;  2E2N A;  4A59 A;  2X78 A;  4BRD A;  3FZL A;  3DXM A;  1HNV A;  1DEJ A;  2XRI A;  1HNI A;  3MX2 A;  4JI3 K;  3CCS N;  3AV9 A;  5LMU K;  1N36 K;  4LF9 K;  2ASO A;  4KRE A;  2Q0U A;  3N4Q A;  4DFM A;  1D4X A;  4B9T A;  4KHP K;  3ZSX A;  4KB1 A;  4FXD A;  5AFU A;  2XHB A;  3WNG A;  3OYD A;  2UXC K;  3BDP A;  1WSH A;  2YX6 A;  4KTZ A;  1KSP A;  1A5W A;  2YKN A;  4BRI A;  4EFH A;  4MO4 A;  1M1K O;  2NRR A;  1JLG A;  1S1T A;  1DT9 A;  1NM1 A;  3O9T A;  1C1B A;  4I2P A;  4HHT A;  1S6Q A;  4PL8 A;  4PA1 A;  5C12 A;  4PKG A;  2AJQ A;  5AQZ A;  5FRO A;  4RW4 A;  5IWA K;  4DV6 K;  1NMD A;  3ZCM A;  4Z0U A;  4BE2 A;  3KZB A;  2VWJ A;  1QQC A;  3ZSO A;  1ESV A;  3SUO A;  4E19 A;  1L3S A;  2UUC K; 
#chains in the Genus database with same CATH homology
 3FLC O;  3E66 A;  4H0X B;  5KPR A;  3WXL A;  5EVZ A;  4H0P A;  4EIA A;  2BH1 A;  4CBW A;  3SLC A;  2GUP A;  2E2P A;  3VGK A;  5M1K A;  4PKI A;  3CME N;  2V7Z A;  4O8U A;  1S22 A;  3FZK A;  4GV6 A;  1P90 A;  3P38 A;  4FWL A;  5AQT A;  2YCH A;  2IVO A;  3DWL A;  4YOR A;  5AQR A;  3WUH A;  1EQY A;  4FOI A;  1Q86 O;  2E88 A;  4FPB A;  3HI0 A;  5JVH L;  2W40 A;  3R8E A;  5HL7 L;  5AQF A;  4BQL A;  5E26 A;  5EX5 A;  1EO1 A;  1WOQ A;  2QWP A;  3UB5 A;  4U67 L;  4CI6 A;  4JKC A;  4WQ5 C;  3O5B A;  4CZM A;  1R59 O;  3CCV N;  3MN7 A;  2Q97 A;  3UKR B;  3UKR A;  1ZXO A;  3KK7 A;  3OBY A;  4H5R A;  5BPL A;  3U9Z A;  5CR4 A;  1MA9 B;  4RCH A;  3QFP A;  2FSK A;  5KPT A;  5GAD P;  2E1Y A;  3MN6 A;  3DAW A;  1TUU A;  1VQ8 N;  3TU5 A;  2Q36 A;  4NLC A;  3EL2 A;  4K25 A;  5HOO A;  1GLB G;  3R6M A;  3D2F B;  3D2F A;  3O08 A;  4H0Y B;  4NLB A;  2QEX N;  4JKA A;  2I7N A;  3NVK A;  2VGN A;  4CZF A;  4RWT A;  4BQZ A;  1XUP O;  3O9S A;  3OHR A;  4FSV A;  3VTH A;  3VEO A;  3FGU A;  5BPM A;  3VF6 A;  4B1V A;  3A8Y A;  1VQK N;  5AQG A;  1NGH A;  1K8A O;  4MO5 A;  2F9W A;  3QIC A;  3T7Z A;  3VES A;  3WQU A;  1X3M A;  3UKU B;  1NGA A;  1JCE A;  3UKU A;  3GOI A;  3I56 N;  5ADX A;  5KQ8 A;  3OW2 M;  4FWO A;  3C0B A;  3LL3 A;  5JIC A;  3CXC M;  3O4W A;  2NRT A;  4BRH A;  3EE9 A;  4B1W B;  2A3Z A;  3SMP A;  4DB3 A;  3P31 A;  3A0I X;  4CD1 A;  3MCA B;  3TTD A;  2HF4 A;  2GX9 A;  1T6C A;  3G25 A;  2AP1 A;  3SBG A;  2ZJR L;  4H5N A;  3VPZ A;  4H5V A;  4WFB L;  2NRV A;  3E9L A;  3HRG A;  1NGB A;  5E84 A;  2OTJ N;  2OAN A;  3WXK A;  4KBO A;  1SS6 A;  3R1X A;  2GTD A;  3AY9 A;  1KXP A;  5GAH P;  3ULE B;  3ULE A;  1ATR A;  3O8M A;  1Q18 A;  4QS9 A;  2GWK A;  3RVC A;  4MDB A;  3KVG A;  4IEI A;  2PAV A;  2QWO A;  2CGJ A;  2QWM A;  2V51 B;  3ZEU A;  3ZEU B;  3CQY A;  3SAH A;  1VQ7 N;  3CJ7 A;  1BDG A;  4A5B A;  4BC5 A;  3CET A;  5TKY A;  3W3D A;  4O8K A;  1OVY A;  2E8A A;  3DXK B;  3DXK A;  3F9M A;  3L0Q A;  1VQP N;  4MLH A;  4QS7 A;  1ZBS A;  4FL9 A;  1MWM A;  3FE1 A;  4FWM A;  3R9P A;  3DJC A;  1YJN N;  3G71 N;  3VEY A;  2Q31 A;  1GLA G;  1YAG A;  4BRG A;  3KWG A;  2BUP A;  2P9P A;  1E4G T;  2P9K B;  2P9P B;  2P9K A;  3CI5 A;  3TTC A;  3TTF A;  1GLE G;  4Y0W A;  4H03 B;  2JWK A;  2NNW A;  4CZG A;  3ID6 A;  5AQO A;  3D2E B;  3D2E A;  2IVP A;  5AQN A;  5C15 A;  5JMV A;  3MN5 A;  3ATV A;  4FOE A;  3JXU A;  3CHW A;  3VGM A;  1DKG D;  4HWI A;  1V4T A;  3UE5 A;  4IJN A;  1YI2 N;  4H5W A;  5FPN A;  1QZ6 A;  3P4I A;  2AA4 A;  1KAZ A;  4BRO A;  4DHY A;  3O1W A;  4QS8 A;  3TSU A;  4IWV A;  1RFQ A;  5BRD A;  2Q0R A;  1QVF M;  2YHX A;  3E1Y A;  3QML A;  4IEE A;  1XQS C;  4I6M B;  4I6M A;  1BA0 A;  2QW9 A;  4ISF A;  4MDA A;  5AZI B;  5AZI A;  4YOX A;  1OKJ A;  5M1Q A;  4CZI A;  5TKW A;  1TUY A;  4IDH A;  3H3O B;  1IJJ A;  3LDO A;  4F9O A;  5AFU H;  3BF3 A;  3O6W A;  4BRC A;  4A5A A;  3WEE B;  2D0O A;  2W41 A;  3VTI A;  3WEE A;  1KD1 O;  2OTL N;  1U2V A;  1U2V B;  2NRH A;  3MWT A;  4WQ4 C;  1Q81 O;  3M5R A;  1VQ6 N;  3C7N B;  3C7N A;  3W0L A;  3ZET A;  3ZET B;  1HKB A;  2CGL A;  3Q7C A;  3VF2 A;  1HKC A;  4JAX A;  3VEX A;  5BPN A;  3CC7 N;  4YDU A;  3IDH A;  1JCF A;  2PBD A;  3QBX A;  3HTV A;  1XC3 A;  1HKG A;  1QQM A;  1YJW N;  3CJB A;  3CCJ N;  4BRA A;  4FWS A;  1E4F T;  5FPM A;  4WFN L;  4FWR A;  4JHD A;  4JHD B;  5AQW A;  4IO9 L;  4AM6 A;  2ZJQ L;  4B1U B;  3Q7B A;  1NGG A;  5AQK A;  5BN8 A;  3VET A;  2QTD A;  4DKW A;  3DLL L;  2CGK A;  3NMU A;  3QFU A;  3WQT A;  5MLC Q;  2ZF5 O;  4KH6 A;  1NBW A;  4XH5 A;  3WXM B;  3EN9 A;  3ENH A;  4B1Y B;  4GV3 A;  4H0O A;  1NLV A;  5AQP A;  1P8Z A;  2WUS A;  4CJ7 A;  4BVP A;  5LJW A;  5ELZ A;  4YOW A;  1YJ9 N;  4CZH A;  2FF6 A;  2YJF A;  4A61 A;  3CCR N;  1SZ2 A;  4JNE A;  5F0X A;  4RTF D;  3CCQ N;  4IJA A;  1M90 O;  1QQO A;  2HMP A;  4BRF A;  4JKG A;  3QDK A;  2YHW A;  3CER A;  4H0T B;  4JKG B;  1Q82 O;  4GVE A;  2VYP A;  2FF3 B;  4JKD A;  5GAE P;  4WQ5 A;  4M7Y A;  3SBT A;  1ATS A;  2V7Y A;  5EXW A;  4U7B A;  1GLC G;  4EHU A;  4BRK A;  3A5O C;  3A5M C;  4H5T A;  3ENB A;  3E9P A;  3WXJ A;  3A5L C;  2Q2R A;  5GAG P;  3CJA A;  1SAZ A;  3AAQ A;  1YUW A;  4E1J A;  4PL7 A;  1HUX A;  4OPH A;  5C2D A;  4WYB A;  2FSJ A;  5AQL A;  3ZX3 A;  1K73 O;  2VGM A;  3TSP A;  2FXU A;  3C65 A;  4YOU A;  3H45 C;  4GV9 A;  2GEL A;  4FPA A;  4BC2 A;  1GLJ O;  3M6G A;  1S72 N;  4M7X A;  1HLU A;  3CCE N;  3F2K A;  3H1Q A;  2JWL A;  4YOT A;  1G99 A;  2NZT A;  4CD3 A;  3E9O A;  3MX5 A;  4JEP A;  2E2O A;  4IFE A;  4B1Z A;  3IUC A;  1RDU A;  2HF3 A;  3KHY A;  5ADX H;  4GNI A;  1BUP A;  5F2R A;  4BG8 A;  4H0V B;  3SJH A;  2A6A A;  1NGD A;  1W2B M;  5H1S Q;  1BO5 O;  3EE8 A;  2ASP A;  4FVU A;  5FPE A;  4BGB A;  3D6R A;  3IKM A;  2QWQ A;  2YHY A;  3ZX0 A;  3GL1 A;  3QB0 A;  3GE1 A;  3ENO A;  4XEI A;  3WXI A;  1BWF O;  1T44 A;  5M1P A;  1C0F A;  3MK6 A;  1NGC A;  4ILJ A;  1ZC6 A;  3FFK B;  3EZW A;  2ITM A;  4B9Q A;  1YIT N;  3CMA N;  4JN4 A;  3QBW A;  2H3G X;  4AM7 A;  1BOT O;  1MWK A;  3O9Q A;  3CF5 L;  4Z94 A;  3VF4 A;  4BRQ A;  4MLE A;  3HOT A;  1LCU A;  4JD2 A;  4JD2 B;  1WUA A;  2A41 A;  3CJ1 A;  1DGK N;  3MDQ A;  3LM9 A;  2YJE A;  3KWI A;  2FLO A;  4K43 A;  5AZJ B;  5AZJ A;  2QA4 N;  4L3Q A;  2GEM A;  4O5F A;  3U9D A;  3CD6 N;  2RHK A;  4BR9 A;  1HJO A;  3O9U A;  3CC2 N;  3CCL N;  4CZJ A;  5JVG L;  3H6E A;  3EKS A;  5GIN A;  3VEZ A;  2QWR A;  3ATU A;  1QQN A;  1W97 L;  3AAR A;  4HTL A;  1S3X A;  2WC9 A;  4BRM A;  4BC4 A;  3HM8 A;  4IO8 A;  4A62 A;  1NJI O;  4IOX A;  3HZ6 A;  5AQJ A;  4CZE A;  2QWL A;  4XH1 A;  4FWP A;  2ZJP L;  1YF5 L;  2I7P A;  1N8R O;  3I33 A;  5LY3 A;  2NRZ A;  2NRX A;  3HSC A;  4PKH A;  3MN9 A;  4CZL A;  1VQN N;  1KC8 O;  4A2A A;  3FZM A;  1NGF A;  1U6Z A;  1Z6R A;  4IXC A;  3AGK A;  5EOY A;  2QWN A;  4BR0 A;  3LDN A;  3C6A A;  3IMX A;  4LC9 B;  5AQH A;  4CBU A;  3ZX2 A;  3FZH A;  3ID8 A;  4IZ9 A;  1BA1 A;  5M1N A;  2YI1 A;  1CZA N;  2HBL A;  5B8H A;  4JKF A;  4XH4 A;  4A57 A;  4G9Z A;  1K8K B;  1K8K A;  2GWJ A;  1C0G A;  3EKU A;  1RGI A;  3LDL A;  4C1N I;  2IVN A;  4WQ4 A;  2CH5 A;  2P9S B;  1NWK A;  2P9S A;  1ILY A;  1H1V A;  2HBK A;  2E1Z A;  4BC3 A;  2A5X A;  4JKE A;  4R79 A;  3M1F A;  4BGA A;  5DM7 L;  1O13 A;  4FWQ A;  4K42 A;  4BG9 A;  2QXL A;  1J6Z A;  4EHT A;  5KQD A;  2KHO A;  2P9N B;  2P9N A;  4K41 A;  2EWS A;  3K9J A;  4KH4 A;  4OPA A;  5AQV A;  1QHA A;  3BEX A;  2NRW A;  1VQL N;  4C23 A;  4FWK A;  3TPQ A;  5AQU A;  4WCE L;  3NVM A;  5DM6 L;  4BRN A;  4BR2 A;  3VEV A;  1NGI A;  3MMV A;  4DCH A;  2D0P A;  4FWN A;  5JLH A;  4BRP A;  2HOE A;  4YOV A;  1T3V A;  4IOC L;  1VAZ A;  3G4S N;  3N4P A;  4C1N K;  3H1V X;  5AR0 A;  2V52 B;  4B1X B;  3ZYY X;  5M1O A;  4GY2 B;  4KH5 A;  3U8X A;  3CPE A;  4NB4 A;  4J8F A;  2ZGZ A;  1K9M O;  3VER A;  5BRF A;  2ASM A;  3CC4 N;  4PHT X;  2CH6 A;  1JJ2 M;  3VGL A;  1KAX A;  5I9E B;  1YVN A;  3GBT A;  2P9U A;  2P9U B;  4BR5 A;  3PIP L;  3L4Q A;  4M63 C;  1NGJ A;  5CHI A;  4WF9 L;  3P39 A;  3BP8 A;  5FPD A;  5M1F A;  3FZF A;  3FR0 A;  3PIO L;  5C2F A;  1HX1 A;  2E2Q A;  1Y64 A;  3L6Q A;  3S41 A;  3SMS A;  3CPW M;  4UY8 O;  3LM2 A;  2VWB A;  3H46 O;  4YOY A;  1QZ5 A;  3RSE A;  3RSE B;  4AF1 A;  5BRE A;  2D1K A;  5AQM A;  1VQ5 N;  4DQ8 A;  3SK3 A;  3U4L A;  4BRL A;  1YHQ N;  3T69 A;  4BR4 A;  3VEW A;  5AQS A;  5EY4 A;  1RDW X;  4ILH A;  3A5N C;  3BUZ B;  5BR9 A;  1YIJ N;  1GLD G;  3HOS A;  1QVG M;  1VQO N;  2NLX A;  3VOV A;  2A40 A;  3JS6 A;  5C0Y A;  5AQI A;  3LDQ A;  4JKH A;  5AQX A;  2F7T A;  4ISG A;  1BG3 A;  1KQS M;  1NGE A;  3IFR A;  3B8A X;  3CJ9 A;  1KAY A;  3CJC A;  2QM1 A;  3GG4 A;  4A2B A;  2HST A;  2Q1N A;  1LOT B;  2E2N A;  4JK8 A;  3I55 N;  1SQK A;  4A59 A;  3PLA A;  2PFU A;  4ISE A;  4BRD A;  2ZWH A;  3FZL A;  1TYQ B;  1TYQ A;  1Q7Y O;  3DXM B;  3DXM A;  1GLF O;  1GLL O;  1DEJ A;  2QI2 A;  3EO3 A;  3L4I A;  2UYT A;  3GDQ A;  3MX2 A;  2KLA A;  4BRE A;  2KKZ A;  3CCS N;  2WBN A;  3BF1 A;  5LJV A;  5JLF A;  3MWP A;  2A42 A;  4JK9 A;  4NO7 A;  3WT0 A;  2HBM A;  4OO1 J;  2ASO A;  3AGR A;  3CIP A;  1VQM N;  4ILG B;  2Q0U A;  1JCG A;  3N4Q A;  1D4X A;  3J7Z O;  3OBW A;  2D4W A;  2J4R A;  3M3Z A;  4BR7 A;  1ATN A;  5AQY A;  5F1X A;  1MDU B;  5AFU A;  3SAF A;  4CBX A;  3CQX A;  3H3N O;  2IIR A;  1Z05 A;  2YX6 A;  3J8A A;  4FO0 A;  3VMF B;  1VQ9 N;  5BN9 A;  2VCP A;  1X3N A;  4CZK A;  3C6H A;  3R3L A;  2ZGY A;  5BRH A;  2F9T A;  4BRI A;  3F5T A;  4EFH A;  4MO4 A;  1M1K O;  5C10 A;  2WFB A;  2NRR A;  3SAG A;  1DT9 A;  3AAP A;  1NM1 A;  3O9T A;  4EAH D;  3G6E N;  5GIO A;  3LDP A;  4BVO A;  4IOA L;  4YDU C;  2HBJ A;  2P9L B;  2P9L A;  1V4S A;  5CE3 A;  4WFA L;  3CCU N;  3D7E O;  3K9K A;  4PL8 A;  2E20 A;  5C12 A;  1T6D A;  2RE2 A;  2DPN A;  4PKG A;  1HPM A;  5AQZ A;  1BU6 O;  1X9J A;  5AQQ A;  3O1B A;  3MCP A;  4JK7 A;  1YXQ A;  5GIP A;  1NMD A;  2FSN A;  1IG8 A;  4JKB A;  3CCM N;  3O80 A;  3VEN A;  1VQ4 N;  3KZB A;  3OA9 A;  5KPZ A;  3TSQ A;  4BY9 C;  2P9I B;  2P9I A;  3I8B A;  3HBT A;  2BTF A;  3O9R A;  1ESV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...