4BRHA

Legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg and thiamine phosphovanadate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
361
structure length
361
Chain Sequence
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic snapshots along the reaction pathway of nucleoside triphosphate diphosphohydrolases.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 121
structure length 361
sequence length 361
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brhA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brhA02
5FPEA 1MWMA 1XUPO 3MMVA 3IDHA 3DWLA 3WXKA 4K41A 5LY3A 5F0XA 4PKIA 3MN9A 4CZMA 4GNIA 1LOTB 3R8EA 4WYBA 1NLVA 5ADXA 5ADXH 3LDPA 1BA1A 3HI0A 4FWQA 3CJ7A 3O1BA 3RSEA 3ENOA 4A61A 1TUYA 1JCFA 3BF1A 1QZ6A 4BVOA 2ASPA 3CQXA 3W0LA 3LDNA 2CGKA 4BR4A 2E2NA 2H3GX 2A5XA 4BC5A 1GLLO 4BRLA 3CERA 5AQRA 2A6AA 3ZETA 4H5WA 4CBUA 4RWTA 2ITMA 2E88A 2HOEA 3LDLA 1KAXA 3QFUA 2YHXA 4JD2B 4JD2A 1KAYA 4K42A 2AA4A 4Y0WA 3JS6A 3EKSA 2NLXA 4BQZA 1H1VA 3ZEUA 1QZ5A 4ISFA 4FWPA 3D2FA 4BRDA 2IIRA 3HBTA 2FLOA 1SAZA 4H0PA 1MA9B 3I33A 4JHDB 3QDKA 1DKGD 3LL3A 5AQHA 5AQTA 3WEEB 4CD3A 3GE1A 3H3NO 2J4RA 5BRHA 4IXCA 4PL7A 1WUAA 3VGMA 4PKHA 3A5MC 3QBXA 5BPNA 1ATRA 1NGBA 2P9KA 5KPZA 3H46O 2FF6A 5JICA 4BQLA 3VPZA 3HSCA 3L4IA 1ZXOA 2QW9A 4FPBA 1NGHA 2CGLA 2VWBA 4BR7A 3BF3A 1MWKA 2E8AA 2QWRA 5TKYA 1NGDA 1BUPA 1S22A 1QQMA 3S41A 4JAXA 3TU5A 1ESVA 4K43A 3CQYA 5E26A 1T6CA 4NO7A 5AZJA 1G99A 3WXJA 4EIAA 4IJNA 1CZAN 4EAHD 1XC3A 1V4SA 3O1WA 2CH5A 1S3XA 5AQMA 4IO8A 4JHDA 2BTFA 2A41A 3BP8A 1IG8A 3DJCA 4H5RA 5AQSA 5AQWA 2CH6A 3VESA 2BUPA 3L0QA 4FPAA 5BRFA 3QB0A 3LDOA 4BROA 4ISGA 3UKRB 2HF4A 2ZGYA 4DHYA 3A5OC 5BR9A 5JLFA 4L3QA 1ATNA 4FSVA 1NGIA 2E20A 3ENHA 3SMPA 3UKUB 1QQNA 3R9PA 3ATVA 1R59O 3VETA 4B1VA 3LM9A 1U6ZA 4CJ7A 2E1YA 2Q36A 2YJEA 4M7XA 3VEVA 3ZX2A 2P9NB 4BR2A 3J8AA 4BRMA 4BRFA 1SQKA 4H5VA 3A0IX 2Q0RA 4AM6A 5B8HA 4BRPA 5EXWA 1HUXA 3FLCO 4DB3A 3GDQA 3QBWA 4FWKA 5KQDA 2D0PA 3IMXA 5E84A 4YDUA 3F9MA 1OKJA 3UKUA 4DQ8A 2IVPA 2WUSA 3R6MA 1K8KB 1K8KA 3MN6A 3CJ1A 1NGFA 2Q2RA 1SZ2A 2E2QA 1EQYA 1HPMA 3CHWA 1GLJO 3SMSA 3GG4A 1MDUB 3C0BA 3LM2A 3JXUA 2A42A 2NZTA 4CZHA 4XEIA 5EX5A 1Y64A 1GLAG 3QFPA 4BRHA 2EWSA 3FZHA 3VF2A 1NBWA 4YDUC 4NB4A 3VEWA 2V51B 4QS8A 3LDQA 5F2RA 4CZLA 4PL8A 2YHWA 5AQGA 1E4FT 3WUHA 3H45C 3VEZA 2Q31A 5BPMA 3OHRA 2CGJA 4EHTA 5AR0A 3SK3A 4BVPA 4XH4A 4M63C 5KQ8A 3L6QA 3AARA 1HKBA 3M6GA 3AY9A 4ISEA 5AQIA 5AZIA 5EOYA 1BWFO 4BC3A 2YJFA 4PKGA 1GLDG 4H0YB 1NMDA 1QHAA 3EO3A 1HKGA 4K25A 1GLBG 1YVNA 5AQXA 3WT0A 2AP1A 2Q97A 4BRQA 2HMPA 1Q18A 1V4TA 4WQ4A 3VEYA 1BO5O 3MN7A 1NGCA 1TYQB 4H5TA 1BU6O 1NGEA 4CD1A 3UB5A 4M7YA 2I7NA 1IJJA 5AQVA 4F9OA 1ATSA 5FPDA 3C7NB 5AQLA 3H6EA 5BRDA 1NM1A 5CE3A 2QWMA 1YAGA 5EY4A 3B8AX 5AQUA 3WEEA 2QWLA 3MCPA 1ZC6A 2QWPA 4B1YB 4HWIA 3RSEB 4BRIA 5F1XA 2P9UA 4I6MA 1C0GA 1YUWA 3EL2A 2ZF5O 3G25A 3VOVA 3D7EO 4EHUA 1HX1A 5JMVA 4O8KA 3ZETB 3CJAA 1BG3A 4BRAA 5AQZA 4DCHA 3VGKA 2UYTA 4MLHA 3O4WA 4E1JA 2P9IB 4WQ5C 3HZ6A 3VEOA 2F9WA 5AZIB 4BG8A 2GUPA 4CZJA 1HJOA 3UE5A 4B9QA 3KZBA 3QMLA 4QS7A 1RFQA 2QM1A 1C0FA 4XH5A 4CZIA 1Z6RA 2HF3A 3I8BA 3TPQA 1NGGA 3VGLA 4B1UB 3O08A 4HTLA 4RTFD 3MDQA 4BG9A 3O6WA 1GLFO 3IFRA 1GLCG 3P4IA 2F9TA 2A3ZA 4FWSA 3U8XA 4CZGA 1T44A 4BRGA 3UKRA 5FPMA 3SJHA 4FO0A 4CBXA 5LJWA 5AQNA 2D4WA 2P9PA 3HTVA 4H0XB 3GL1A 4WQ4C 2GELA 3H3OB 3CETA 3FZKA 4BR5A 3IUCA 5JLHA 4A2AA 5ELZA 4BR9A 3A5NC 2PAVA 5KPRA 4FOIA 1Z05A 4CZEA 5AQJA 1E4GT 3O5BA 4MLEA 4IJAA 2P9LB 3ULEA 2GWJA 3H1QA 4A62A 5BREA 3FE1A 2V7YA 4IZ9A 2PBDA 3FGUA 5EVZA 1U2VB 1U2VA 5FPNA 3U9ZA 3KVGA 2DPNA 3A5LC 4B1XB 3ZX3A 4IWVA 2FSNA 1NWKA 2W40A 3CIPA 3FZFA 1LCUA 2ZGZA 2D1KA 3ATUA 4A2BA 2VYPA 5BN8A 1DGKN 2QWQA 2YCHA 3DXKB 3CJ9A 1GLEG 3O8MA 3FFKB 2P9IA 5AQFA 4B1WB 4Z94A 2E2PA 3W3DA 2GWKA 1KAZA 3AAQA 3FZMA 2D0OA 3GBTA 3CI5A 2QWOA 3C7NA 2Q1NA 1JCEA 2ZWHA 4BC4A 1T6DA 1WOQA 3H1VX 4FWLA 5AQYA 5LJVA 1TUUA 2FF3B 1P8ZA 3KHYA 2E1ZA 3BEXA 4H5NA 3A8YA 2FXUA 3MK6A 4I6MB 4C23A 5AFUA 4FL9A 2QWNA 2P9SB 3DXMA 2FSKA 3WXIA 4GY2B 2IVNA 3VERA 3AAPA 4J8FA 1QQOA 1J6ZA 3EKUA 4FWOA 1X3NA 2QXLA 3EN9A 4BC2A 3WQTA 2YHYA 3BUZB 4BRNA 1BDGA 1YXQA 2V52B 3DXKA 5BN9A 2P9NA 3D2EB 5BPLA 3QICA 1NGJA 3VEXA 1BA0A 5I9EB 3DAWA 5AZJB 4CBWA 4BRCA 1HLUA 2V7ZA 4FWNA 5AFUH 2W41A 2GEMA 4EFHA 1DEJA 4MO5A 1XQSC 1NGAA 1ZBSA 2P9SA 3DXMB 3D2FB 5AQKA 2VCPA 3CJBA 4BR0A 1BOTO 2I7PA 2A40A 4BRKA 2ASMA 2GTDA 3VF6A 3O80A 1X3MA 2Q0UA 2P9UB 3FZLA 3CJCA 4AM7A 4CZKA 3M1FA 3GOIA 3VF4A 1RGIA 3U9DA 3SLCA 2ASOA 3D2EA 4FWMA 2YI1A 4H0VB 4WQ5A 4B1ZA 3HM8A 5KPTA 4CZFA 1KXPA 1JCGA 3WXLA 2IVOA 2FSJA 4BGBA 4MO4A 4FWRA 4BREA 2P9PB 4QS9A 3ZEUB 1HKCA 3FR0A 3U4LA 1TYQA 3ZX0A 4H0OA 4H0TB 4LC9B 4JNEA 5AQOA 4RCHA 2E2OA 3WQUA 3MN5A 3VENA 2P9LA 3ULEB 1RDWX 4O5FA 2P9KB 4JN4A 3EZWA 2KHOA 4CI6A 2NRHA 4BGAA 3M3ZA 1D4XA 5AQQA 5AQPA 3ID8A 4FOEA 2OANA 1X9JA 4XH1A 4KBOA 4H03B
chains in the Genus database with same CATH superfamily
3ZT3A 1MWMA 4FLWA 2ITGA 4DR4K 3MMVA 1LAVA 3DWLA 5LY3A 1JXEA 4FK2A 4CZMA 1XMQK 1VQ6N 1LOTB 4LSNA 1VSMA 4LY7A 3DRRA 1BA1A 3HI0A 4FWQA 4CJWA 1TKDA 4KB1A 4A61A 1JCFA 3BF1A 3J81O 4LSLA 3MAQA 1T3VA 3MWPA 4AHVA 1YVUA 1EO1A 2ZQBA 3M8QA 1KSPA 3OJUA 4CJPA 4DV0K 5AQRA 1S1VA 4H5WA 4RWTA 5LMNK 3RMBA 1KAXA 3QFUA 3QINA 4YOWA 3OY9A 4OKEA 4DTNA 4Y0WA 3OS1A 3DLRA 4AF1A 3EKSA 2HHUA 1H1VA 3JSMA 4N47A 4JI6K 4CJUA 4FWPA 2IIRA 4CFAA 1SAZA 3WEEB 5AQHA 2UUBK 2WC9A 3GE1A 2J4RA 5DMRA 3SAFA 4YFUA 2F4VK 1WUAA 3VGMA 4CJKA 1VQ4N 2P9KA 2YKNA 5C2DA 3H46O 5JICA 4DV4K 4KAZA 1ZXOA 5SZTA 3VQ7A 2VWBA 4ZHRA 4I9LA 3OJSA 4F3TA 3BF3A 4BY9C 2E6LA 2KZZA 3TAEA 2Q3SA 1NGDA 1TVRA 2JWLA 3JYTA 4KKOA 1QQMA 3AVNA 3CFPA 4HUFA 3TU5A 3ZSOA 1FW6A 4NO7A 1REVA 4EIAA 1NJYA 2E5LK 4FJXA 4BDZA 1YIJN 4EZ6A 1Q81O 4EAHD 5FROA 4DQRA 2CH5A 1S3XA 3AV9A 2A41A 4EZ9A 4FK0A 4DR2K 1Q7YO 3NH0A 2CH6A 4E7LA 3KK2A 3VQEA 3AO5A 4BROA 3VQAA 3S3NA 4ISGA 2HBMA 3CM5A 4WE1A 5C0YA 3UKRB 1TK0A 1ATNA 3LAMA 3UKUB 1D5AA 3R9PA 3ATVA 1R59O 2W6LA 3ID6A 4CJ7A 1WLJA 3G10A 4BRMA 1T03A 1QSLA 2O8BB 1SQKA 3A0IX 3PX4A 3E9LA 4DFJA 3SUOA 5EXWA 4M3UA 3QBWA 4FWKA 2D0PA 3F9MA 1OKJA 3NGYA 4CJEA 2IVPA 4IDKA 2BDPA 4Z4FA 1DT9A 3MN6A 2Q2RA 2D0CA 3N4QA 3PO4A 4QOZB 1J54A 3OA9A 4A5BA 1SS6A 4RW8A 4E3SA 4FLYA 4CZHA 1Y64A 3QFPA 4BRHA 3FZHA 3L2UA 3VF2A 1LWCA 3L2WA 3VEWA 4NB4A 1D8YA 4FM1A 1TKZA 3TSPA 3OYGA 1GOBA 2YHWA 4GKKK 3M5RA 4JI4K 4C1NK 3O9RA 3WUHA 4O8UA 4JKGA 3P83D 3M8RA 4EHTA 4BVPA 3CMAN 3HRGA 3AARA 5M1NA 1RBRA 1HKBA 3O4NA 3THVA 3TI0A 5AQIA 4RW4A 3HXMA 4GV3A 2FC0A 1RBTA 3P39A 4PKGA 4H0YB 3CD6N 3AVCA 4K25A 3HM9A 4I7FA 3NE6A 5AQXA 2AP1A 4BRQA 2HMPA 4DTJA 1Q18A 1V4TA 4LD0A 3VEYA 1BO5O 3SBGA 3ASMA 3N4PA 4DQPA 2FBVA 2O8EB 4E7KA 2O8DA 4M7YA 3DOLA 3CQ8A 3ZSRA 2ZE2A 2BGGA 2WFBA 1HNIA 5BRDA 2VG5A 3QEVA 1I3AA 2B4JA 2QWMA 4ELVA 4JKFA 4OPJA 5JVHL 4CF8A 4CW7B 4OKKA 4GW6A 4B1YB 4BRIA 1VSDA 3BDPA 3V9UA 1RT3A 3EL2A 4KHSA 1C0MA 1KLMA 3G25A 1VQ9N 3MEGA 3VOVA 4UQGA 1L3VA 3CFRA 3D7EO 3CCJN 4O8KA 3CJAA 4JI2K 3VGKA 2UYTA 1O13A 1RT6A 1LW2A 3HZ6A 1JLFA 4BG8A 3IKMA 3LP1A 3C6AA 4CZJA 3UIQA 2HHSA 1HYVA 4CCHA 3QMLA 3DLKA 4H4OA 3RMDA 3PX6A 1C0FA 4XH5A 1HMVA 4CJTA 4CZIA 2ZD1A 4HTLA 1KQSM 1GLFO 3QIPA 1GLCG 2OTJN 4CZGA 1T44A 3UKRA 5FPMA 3WNGA 2OZSA 1VK0A 4CJ5A 3LZIA 3CC7N 4CEZA 4G1QA 4WQ4C 4LF9K 3OYKA 1KRPA 1N32K 4BR5A 5ELZA 3RMAA 1HNZK 1VSEA 1UAXA 2Z1GA 1E4GT 1HRHA 1WN7A 3T1AA 5E41A 3HP6A 2RF2A 4A62A 4AHSA 5C25A 2WOMA 2NRRA 5EVZA 4JKBA 4V19S 4B1XB 1YI2N 3FZFA 2ZGZA 3ZSQA 3D0PA 4CGJA 2RN2A 5BN8A 1OVQA 4W5NA 1DGKN 2QWQA 3LZJA 1BI4B 2HHQA 3FFKB 3CC4N 4Z94A 2KQ2A 2JLEA 1QSSA 2NRTA 3C6HA 4AHUA 1YF5L 1VQLN 2Q1NA 1JCEA 4BC4A 3C65A 1QHTA 3CXCM 3PV8A 3O3HA 4HVJA 5K14A 5KGXA 3NVMA 2FXUA 2QWNA 5HROA 3DXMA 4DV3K 3CPEA 5EU7A 1ZBUA 1JLAA 1UA0A 5GINA 1A5VA 2QXLA 3EN9A 4JKDA 4BE1A 1U4BA 2UU9K 3BUZB 4BRNA 4FM0A 3KKRA 3SPYA 3KWGA 3CCSN 1NKCA 3DM2A 5CY4A 1NGJA 3VEXA 2O8BA 3RMCA 3DAWA 1VSFA 1HQEA 1GOCA 4FJ8A 2V7ZA 3ZSZA 5AFUH 4LF4K 4BDYA 4PUOA 2W41A 4EFHA 1DEJA 1WBDA 4MO5A 1XQSC 4WFBL 1NGAA 3K57A 1NU0A 4BR0A 3V6DA 4B3OA 4DTSA 1M90O 4B3RK 2A40A 1RCHA 2ASMA 3TANA 4JV5K 1WNSA 3O80A 3VQ9A 1HNWK 4CHZA 1WAJA 2P9UB 1HYSA 3OVNA 3GOIA 2ASOA 1BI4A 1W2BM 3CC2N 4B1ZA 2KTQA 3HM8A 1QTMA 5KPTA 3TSUA 5JVGL 1VAZA 3D45A 5GAEP 4GVEA 4FYDA 2IVOA 5HP1A 4MO4A 3SI6A 3FR0A 4R79A 1TYQA 3ZX0A 4H0TB 3T19A 5KRSA 3J7YP 3AVJA 4RCHA 3MXJA 2E2OA 4FJHA 4F2SA 2P9LA 4CK3A 1RDDA 3CM6A 3O9TA 2VG6A 2GBZA 2YX6A 3TARA 1L3UA 2NRHA 1BGXT 1TGOA 4FOEA 4YY3K 4XH1A 5HL7L 4KB0A 1HQUA 3WXKA 2QA4N 4J2EA 4PKIA 1K6YA 3VTHA 1Q9YA 3QETA 4CGHA 4FVUA 1NKBA 1LWEA 1DLOA 3SV3A 1U48A 3O1BA 1TUYA 2ASPA 3CQXA 4IKFA 2UXCK 4Q5VA 5CZ1A 4JRPA 3W0LA 3AVHA 1X9SA 4OPKA 2CGKA 4BR4A 1X9MA 3U3GA 1A5WA 2H3GX 4DUYK 3PUFA 3TAGA 4GV9A 4FVMA 3CERA 2A6AA 1IKVA 3ZETA 2NRWA 4KH5A 2ITMA 3AO4A 2HMIA 2HOEA 3LDLA 1RTHA 3DMJA 4JD2B 3NGZA 3JS6A 1W9HA 1T7PA 1IBLK 1EKEA 4BQZA 2PZSA 1QZ5A 5I42A 3HBTA 3SUPA 3HYFA 3LL3A 4CD3A 3DLBA 2WTUA 5BRHA 1ZYQA 1YJ9N 4IXCA 3HK2A 4DS5A 5BPNA 1KTQA 1ATRA 3ALYA 5KPZA 5A2QO 5KI6A 4DS4A 1XHXA 2E6MA 4PQUA 3M8SA 2G8KA 2QWRA 3DI6A 3VTIA 3KLGA 2QKBA 4K43A 3CQYA 3WXJA 1LWFA 3P5JA 5LL6Z 3SCXA 2DFHA 4CGIA 4JHDA 1S6PA 3V1QA 3VESA 3THYA 3L0QA 3Q7CA 3NH1A 3QB0A 3LDOA 4CEBA 1ZBHA 4OO1J 4A57A 4B9TA 1NJWA 1NGIA 3ENHA 2KLAA 5DM6L 5J2NA 3DLGA 4CJSA 4DV2K 1QQNA 4OVLA 4OGCA 3VETA 3CCUN 4FM2A 1KFDA 2E1YA 2Q36A 2P9NB 4BR2A 3P1GA 4BRFA 3SQ4A 3AVFA 3O9QA 3SZ2A 1C1CA 4OJRA 4H5VA 5B8HA 4AM6A 4BRPA 3R3LA 4JS5A 1OH8A 4DFPA 1HUXA 3GDQA 1HNVA 4ID1A 4CHPA 4LF8K 3LPUA 5KQDA 3OYAA 4IG3A 3H08A 1I39A 3NF6A 4DQ8A 1EXQA 4F2RA 1BIZA 4F4KA 4J2BA 1TK8A 1LAWA 2DFFA 3AVBA 2O4IA 3J80O 1SZ2A 3VA3A 3CHWA 2HBLA 3MCAB 3RWUA 2A42A 4N5SA 1EETA 1RTIA 4XEIA 4NCAA 3MWTA 3KK3A 3CCLN 4LH5A 4NYNA 3VQ4A 2V51B 3VQ5A 1J53A 3NAEA 1OH7A 1YHQN 4KREA 4QAGA 3G4SN 1C1BA 2CGJA 2EX3A 4CF1A 3OYIA 5AR0A 3KLEA 2DTUA 1TAUA 3OYBA 4HUEA 1W97L 1U47A 3NCIA 3I0SA 5JS2A 2OPRA 4FW2A 1BQMA 3J7AP 5C15A 3NF7A 3TR8A 1NOZA 2RHKA 3AVGA 1NMDA 1QHAA 1VQON 3V81A 1UWBA 4JRQA 1GLBG 3WT0A 4ELTA 3O4QA 3PY8A 4FW1A 4KV8A 2ZJPL 4G9ZA 1NOYA 1N34K 1NGCA 3O9UA 2F8SA 4CD1A 3UB5A 1KD1O 1SKSA 5AQVA 4F9OA 3E01A 1ATSA 4B9SA 3C7NB 2BANA 3OYCA 1NM1A 1XWLA 4A59A 5EY4A 3B8AX 4DWIA 3ULDA 3ZSXA 3MCPA 4N41A 1ZC6A 1B9FA 4HWIA 5F1XA 4I6MA 3L3UA 1C0GA 3OYJA 3KK7A 4KTZA 3HVTA 3CYMA 1NK5A 2ZF5O 1OH5A 3FFIA 5M1PA 1UA1A 4DTUA 1L3SA 1IKWA 1HX1A 1KCFA 4DU3A 4YNQA 4BRAA 4DCHA 3TAQA 4BWMA 4YOXA 2P9IB 3VEOA 2F9WA 5AZIB 4L8RB 2GUPA 4B9QA 3SPZA 4QS7A 1N6QA 5J2MA 4DR5K 2HF3A 5HLFA 1KVBA 3V9XA 1N8RO 1O1WA 4Z4CA 4RTFD 3MDQA 3MEEA 4BG9A 4CHOA 1U49A 3IFRA 1JLBA 2Z1HA 2A3ZA 3U8XA 3F5TA 3SJHA 4CFDA 4E0DA 3EE9A 5LJWA 3DLHA 3HO1A 4JK8A 3OYFA 4YOUA 2GELA 2RE2A 3U3YA 1W7AA 3H3OB 3AO3A 4YOTA 3CETA 3T69A 3IUCA 3HPGA 4M3YA 3A5NC 2PFUA 4DQSA 2O8CB 4U7BA 1Z05A 1HJRA 5AQJA 4LH4A 3O5BA 4MLEA 4IJAA 4W5TA 2YV0X 4C8OA 3H1QA 2QXFA 1CZ9A 2ZJRL 4DR1K 4OPHA 3U9ZA 2VG7A 5FPNA 3A5LC 4IEEA 2FSNA 4WFAL 2W40A 3CIPA 3AO2A 4KFBA 2D1KA 2KZMA 3ATUA 4A2BA 4NXNK 1GLEG 3O8MA 4CHQA 2P9IA 5KRTA 1NK0A 1QVGM 2E2PA 4CHNA 5C42A 3LP3A 3ZLJA 4FJJA 2QWOA 3C7NA 4FJGA 4MDAA 3H1VX 5AQYA 4CJVA 3NVKA 2FF3B 1C0TA 3L3VA 4FLUA 3MK6A 2OYQA 4I6MB 4FL9A 2P9SB 4CEQA 3LALA 1C6VA 3VERA 3AAPA 4CJ3A 4M3RA 1J6ZA 1X3NA 4GKJK 3E66A 3TTDA 4DMNA 2NRXA 4YHHK 2VGNA 4FJLA 2YKMA 4JLHA 2P9NA 3D2EB 4PY5A 4DSLA 4CJLA 4CBWA 3CCMN 2O8DB 3DRSA 4FWNA 3TWHA 4FLZA 1WB9A 2HHTA 2GEMA 1ZBSA 3KWIA 5AQKA 1BOTO 1MU2A 5C2FA 2HBJA 3CCVN 4E7HA 2O8FA 4BRKA 3OBYA 2GTDA 3VF6A 3WXMB 1J9AA 1X3MA 3K5LA 3MXMA 2Q0UA 5J2QA 3MEDA 3CJCA 3TSQA 3M1FA 3BY5A 3U9DA 2WONA 4FWMA 2YI1A 4ILGB 1T8EA 5IWAK 1S1XA 1YTAA 4CZFA 1NJIO 1JL2A 5CYMA 1OH6A 2FSJA 1KFSA 4BREA 1HKCA 1NK4A 3R1XA 3ISNC 2G8UA 4DQIA 4DV1K 3D6RA 2O8FB 4FLTA 1IBMK 4H8KA 4HCBA 2P1JA 1RT1A 3MN5A 3NF9A 4KH6A 1KLNA 3ULEB 4CGDA 5H1SQ 4DV5K 1VSHA 4DFMA 4CHYA 2P9KB 4JN4A 3KLFA 3BZCA 3G0ZA 3M3ZA 3ZCMA 1A5XA 2D0BA 1D4XA 4FCYA 3ID8A 1S72N 4KHPK 4CIGA 4FXDA 3KLHA 4H03B 1XUPO 1RDUA 3IDHA 4PHTX 4JI5K 3MN9A 4GNIA 3K5MA 3THXA 2Y1JA 4WYBA 3LPTA 5ADXA 5J1EA 5ADXH 4DTXA 4I2PA 5DK5A 3THWA 3CJ7A 1VQKN 4HCCA 3ZT4A 3ENOA 1SV5A 2OCEA 1QZ6A 5DM7L 2XO7A 1XNRK 4BVOA 3AA4A 1SUQA 3I55N 2X78A 3LDNA 4ICLA 3J7ZO 1KVAA 3CCQN 3DOKA 4DR6K 2IGIA 1L3TA 2A5XA 4BC5A 1CXQA 4CBUA 2OA8A 3DRPA 3KKSA 3ENBA 2NRVA 2E88A 3CG7A 1KAYA 3LP2A 4K42A 2AA4A 4JI3K 3HT3A 3V9WA 2D0AA 3ZEUA 3WNEA 4CK1A 2OPPA 3D2FA 4BRDA 4FK4A 2FLOA 1MA9B 2IAJA 4JHDB 3QDKA 4FZYA 5AQTA 1QS4A 3TAPA 3RR7A 1U45A 4PL7A 4PKHA 4IDHA 4OGEA 3QBXA 4AHTA 1NGBA 3C6TA 3RTVA 1TAQA 3RR8A 1VQPN 4A5AA 4BE0A 1RT4A 3HSCA 4BR7A 2CGLA 3L2VA 5GAGP 4R5PA 1MWKA 1ZBLA 2G8WA 1S1TA 3K9KA 2P5GA 3DLEA 5HOOA 1BUPA 1S22A 4DR3K 3S41A 4CEAA 4JAXA 4FJNA 4RG8A 3TAFA 5AZJA 4JYAK 1T6CA 3F73A 4X66K 1CZAN 1BCMA 3KD5E 1XC3A 1D9FA 1V4SA 4CIFA 4K8XA 2X74A 4CVNE 2GV9A 3M8PA 3BP8A 1IG8A 3DJCA 4H5RA 4FZZA 5AQSA 5AQWA 4M3XA 4FPAA 3PSFA 4KO0A 4PWDA 3K2PA 3AVKA 4C8KA 2OTLN 2ZGYA 4DHYA 5BR9A 5JLFA 3VQ6A 4NLCA 4FSVA 2BH1A 4AHRA 1JKHA 2Z1JA 4CFCA 3KD1E 1U6ZA 3VEVA 3ZX2A 3NFAA 1D9DA 1K8AO 3AVAA 2FBTA 3C94A 1QQCA 2HVIA 4DSFA 4M41A 1NNEA 4JK9A 4C1NI 4DB3A 1RT5A 4O5BA 2XRIA 3VA0A 1XI1A 1NK8A 2HHWA 5E84A 3IMXA 4YDUA 3UKUA 4IFEA 2HB5A 2WUSA 2XHBA 1VRUA 1SKWA 2OPQA 2FBXA 1OVYA 2LSNA 2B5JA 1EQYA 5FRNA 3GG4A 1MDUB 3JXUA 1XNQK 4B3TK 2W42A 5EX5A 1GLAG 4CFBA 4HTUA 4WF9L 2EWSA 3K0SA 5I3UA 1NBWA 1U04A 1RNHA 4QS8A 3LDQA 1FJGK 3SJJA 1S5JA 3B6PA 1WSFA 5AQGA 1SKRA 5M1OA 4O55A 1DTTA 1XHZA 1RTDA 3VEZA 3V9SA 2Q31A 5BPMA 1S1WA 1Y97A 2DFEA 2HNDA 3VQ8A 3L6QA 1BCOA 4DTPA 2G8IA 3AA5X 4ISEA 3ZSWA 3HJFA 3VQCA 1JL1A 3CF5L 4QCLA 5CHIA 1YTUA 2RPIA 5EOYA 3HPHA 4DSEA 1BWFO 3KJVA 4KTQA 1CXUA 1GLDG 4H4MA 3EO3A 1VQMN 3MECA 4JKHA 1HKGA 3AVLA 1Q9XA 4Z4IA 4EP4A 4OLBA 2VGMA 4CK2A 2HBKA 4K8ZA 3S3OA 1EX4A 1VSJA 3AVIA 5GADP 1RT2A 3L4QA 1TKTA 1BU6O 4CGGA 1ASWA 5LMUK 5M1FA 1Z25A 2I7NA 1E3MA 4M3WA 5M1QA 5JS1A 3H6EA 5MLCQ 5CE3A 1YAGA 4WCEL 2IOCA 1LV5A 3QEPA 2QWLA 4HHTA 1VQ5N 1TKXA 1NMNA 1RTJA 2F7TA 5SWMA 2BE2A 4NLBA 4DF4A 4B8CA 2HNZA 1FKPA 4OPAA 3MXIA 4E89A 1N36K 3HOSA 3TAMA 3U6FA 4EHUA 3EE8A 1VQNN 1BG3A 1FKOA 1RDBA 4W5RA 5IT9O 3SAHA 4E1JA 1QE1A 4O0IA 2O8CA 4ID5A 2VQEK 5CZ2A 3E9OA 2HVHA 1HJOA 4IEIA 3KZBA 2G8VA 1RFQA 4MQ3A 3SUNA 1Z6RA 4WFNL 3HVRA 4M3TA 4KTWA 3I8BA 4MFBA 3TPQA 4YOYA 3EZ5A 3VGLA 1IH7A 4W5OA 4CGFA 3O6WA 4B08A 3QNOA 4UY8O 3AO1A 2YNFA 4ILJA 4BRGA 3NGIA 4DTRA 4CBXA 5M1KA 5AQNA 3DYAA 3HTVA 4CESA 4H0XB 4DLGA 2QK9A 3K9JA 3FZKA 3LDSA 4DSJA 4A2AA 1TL3A 3B6OA 2AJQA 4BR9A 3CCEN 4Z0UA 5C24A 2IDOA 2DY4A 4FLVA 3ULEA 1JLGA 1WSJA 2GWJA 3BZKA 1XC9A 2V7YA 3FE1A 4IZ9A 2ETJA 4RW9A 3Q7BA 3HL8A 3KVGA 2DPNA 4AHCA 3KK1A 1YT3A 3ZX3A 1M1KO 1BQNA 3ZT1A 4IOCL 4DSIA 1K73O 4GV6A 4NXMK 3CJ9A 3DXKB 3OBWA 4B1WB 1RDCA 3C95A 4IFYA 3GBTA 1C1AA 5T7BA 1NK9A 2ZWHA 3TTCA 1WOQA 4C8NA 3SAGA 5LJVA 2O4GA 4E7JA 4O0JA 4FJIA 4H5NA 3A8YA 4X65K 4C8LA 2HHVA 4C23A 1JJ2M 5AFUA 3I8DA 2IVNA 4E1MA 4KRFA 4J8FA 1QQOA 1K9MO 4JI1K 3THYB 4MDBA 3ZYYX 4DU4A 4LFCK 4KH4A 1BIUA 5C12A 2F96A 2G8FA 1NK6A 1BDGA 1NJXA 3QEWA 3QICA 1UOCA 5I9EB 2O8EA 4DSKA 1B92A 1HLUA 1B9DA 4FJ7A 3DXMB 2RKIA 2ATQA 3PIOL 3CJBA 3OYEA 1YJWN 1G15A 3I56N 2I7PA 3WNFA 3A2FA 3OYHA 5FLXO 1BHLA 5GAHP 3KLIA 3FZLA 1SL2A 4CZKA 3VF4A 3SLCA 1HYZA 4H0VB 4B9MA 3P31A 4DV7K 1S6QA 3VQQA 2NRZA 1JCGA 2XY8A 4Y1DA 4GMJB 4EP5A 2HW3A 2P9PB 2B6AA 1GOAA 3U4LA 2EHGA 1IKYA 4H0OA 4LC9B 4JNEA 2KW4A 2YNGA 4XIUA 3OS2A 3THWB 5AJ3K 1VSKA 4JKEA 3O3FA 3ZSYA 4IOXA 1RDWX 4O5FA 3CCRN 3EZWA 4IG0A 4BGAA 5HRRA 1RBVA 4FZXC 1FXXA 4RW7A 5AQQA 3NHGA 5AQPA 3OYMA 1EWRA 1RBSA 4CJFA 3QESA 2F8TA 2FBYA 1X9JA 4KBOA 3V1OA 5FPEA 1ZBFA 4CECA 4K41A 5F0XA 3RRGA 3R8EA 3ITHA 1NLVA 4JI7K 4U67L 1JXBA 3LDPA 2NUBA 3RSEA 4CF2A 1WSEA 1ZBIA 4BACA 4J2DA 4DV6K 2E2NA 5TKWA 3ZT0A 4KHUA 3RRHA 1YITN 1GLLO 4YORA 4BRLA 1Q8IA 1TL1A 4B9NA 1T05A 4KPYA 2WBNA 4JKAA 3KTQA 2YHXA 2A1RA 4JD2A 2QEXN 4I2QA 2G8HA 2W6KA 5FDLA 2NLXA 4B3MK 5D3GA 5HRPA 1P90A 4ISFA 4CIEA 2YHBA 3K5NA 4ZTFA 4H0PA 3I33A 1C0UA 2KFNA 1DKGD 1VSIA 1QSYA 2JGUA 3H3NO 3SV4A 3K5OA 5CYQA 2ZM6K 2Z1IA 3A5MC 4M42A 1WSHA 3V9ZA 1W0HA 4AILC 2HHHK 2FF6A 4BQLA 3VPZA 3L4IA 1NKEA 2VWJA 2QW9A 4FPBA 1NGHA 4DFKA 2E8AA 5TKYA 3JAMO 4KHQA 5KTQA 4LFAK 3EYZA 1Z26A 1ESVA 1BL3A 3G6EN 5E26A 1VQ7N 3L2RA 1G99A 2OPSA 4BDPA 4Z4GA 4TSXA 4IJNA 1NG9A 3MX5A 3O1WA 5AQMA 3T3FA 4IO8A 2PY5A 2BTFA 4KHYA 4X64K 4FJMA 4NYFA 1N5YA 4X62K 2BUPA 3NDKA 5BRFA 4BE2A 3VN5A 2GUIA 2QTDA 4FLXA 4LFBK 3K59A 3T1HK 2KFZA 3VQBA 2HF4A 3QEXA 3A5OC 4L3QA 1VRTA 1WBBA 2E20A 3L2QA 4KI4A 3SMPA 4DU1A 3THXB 3S9HA 4DF8A 4B1VA 3LM9A 1S1UA 4CJQA 2YJEA 4M7XA 3OYDA 3J8AA 2P51A 1I94K 3OYLA 3SQ0A 4F3OA 1IV0A 2PYLA 1QVFM 3LP0A 3OTOK 2Q0RA 1J5EK 5HBMA 3FLCO 1XMOK 1RT7A 4JEPA 1RBUA 3MX2A 1HNXK 5FRMA 1CZBA 4JKCA 4JKGB 4FJ9A 2NNWA 3K58A 3QO9A 4DQQA 2XY5A 2KKZA 3R6MA 3OS0A 1K8KB 4N56A 1K8KA 3CJ1A 1NGFA 4CEEA 1J5OA 2E2QA 2IS3A 4CERA 1HPMA 1GLJO 3SMSA 3E1YA 3C0BA 3LM2A 4YOVA 2NZTA 3E9PA 1ITGA 1IKXA 3IG1A 1RILA 2I5JA 3PIPL 5GIPA 4YDUC 5F2RA 1VQ8N 4CZLA 4PL8A 3QERA 4NCGA 4Z4HA 1L5UA 4E1NA 1E4FT 2HSTA 3H45C 1S9GA 3OHRA 4KHWA 5J2PA 3OYNA 4CF9A 3SK3A 4XH4A 4M63C 5KQ8A 3T1YK 1KVCA 1IBKK 3M6GA 3AY9A 1F21A 4FJ5A 1BISA 3S3MA 5AZIA 3IS9A 4M3ZA 1JLCA 4DKWA 4GVMA 1CLQA 4BC3A 2YJFA 4DTMA 2VWKA 4DUZK 4K0KK 3V4IA 1YVNA 3PX0A 2UUAK 4W5QA 4NCBA 4IFVA 2Q97A 1SL0A 1KC8O 4B3SK 4WQ4A 1ILYA 3MN7A 1TYQB 4H5TA 1TK5A 1NGEA 1ASUA 4AQYK 3SNNA 3QLHA 1IJJA 3ZT2A 4DTOA 4DG1A 5FPDA 4J2AA 5AQLA 2JWKA 1RDAA 3CFOA 5AQUA 3WEEA 2QWPA 3RSEB 4ILHA 1Q82O 2IC3A 2HNYA 2P9UA 3SBTA 4F8RA 1YUWA 1IG9A 4JI0K 1EP4A 3PO5A 2XY7A 5C10A 2Y1IA 4FJKA 1JLEA 5JMVA 3ZETB 1VHXA 3RVCA 5AQZA 4MLHA 3IAYA 3O4WA 2X6SA 4WQ5C 2D5RA 2PYJA 2UXDK 1FK9A 3UE5A 4LF7K 3O3GA 1S9EA 3NMUA 4IO9L 2QM1A 4OX9K 3SQ1A 3VQDA 1HR0K 1NGGA 1TV6A 3I0RA 4B1UB 4CF0A 3LANA 3O08A 3V1RA 1NJZA 1X9WA 2VQFK 5HRSA 3P4IA 2F9TA 4FWSA 1NK7A 2YHAA 3HP9A 4CEFA 4B9UA 3SQ2A 3PSIA 4FO0A 5CR4A 5KGWA 4M45A 2D4WA 2P9PA 3GL1A 4CEOA 1WAFA 3F2KA 5JLHA 1SL1A 2XY6A 1YJNN 2PAVA 5KPRA 4FOIA 4CZEA 2R7YA 4HUGA 1EWQA 4CJ4A 4Q0BA 3AA2A 1X1PA 3T7ZA 3LWMA 2P9LB 3CMEN 3P38A 5BREA 2YNHA 4B8AB 2PBDA 4KHNA 3FGUA 1U2VB 1U2VA 3ZSVA 2QI2A 4IWVA 2X6NA 1NWKA 4JI8K 1LCUA 4DLEA 4ELUA 2VYPA 2YCHA 5AQFA 3NBPA 3AGRA 3W3DA 4IBNA 2GWKA 1KAZA 3AAQA 3FZMA 3WNHA 2D0OA 3HSTB 3CI5A 4CE9A 4KI6A 1N33K 1T6DA 4ZTJA 3VQPA 4FWLA 3QNNA 4Y1CA 1TUUA 1WSIA 4E7IA 1P8ZA 3KHYA 3IRXA 2E1ZA 3BEXA 4B9VA 3AVMA 2P5OA 2ZJQL 2UUCK 1ASVA 2QKKA 2A1SA 2FSKA 3WXIA 4GY2B 4IOAL 4OKJA 3F9KA 4LF6K 3EKUA 4FWOA 4BC2A 3WQTA 3LAKA 2YHYA 1IO2A 1YXQA 4JK7A 1LW0A 2V52B 3DXKA 5BN9A 5BPLA 2GX9A 1BA0A 3DLLL 5AZJB 3AGKA 4BRCA 3VMFB 3CPWM 3BGRA 3AA3A 3TABA 4CJRA 2P9SA 4Z4EA 3TTFA 5GIOA 3G71N 4B9LA 4AH9A 3D2FB 2VCPA 3L8BA 3LWLA 4E19A 2OZMA 3PLAA 1WSGA 3NH2A 3QEIA 4AM7A 2E4LA 1RGIA 1Q86O 3C6UA 3D2EA 4RW6A 4WQ5A 1JLQA 4OLAA 1KXPA 3WXLA 4PA1A 4C8MA 4BGBA 4FWRA 3SUQA 4QS9A 3ZEUB 1R0AA 3HOTA 3O9SA 4CEDA 3OW2M 5BR8K 5AQOA 4LF5K 1HPZA 3WQUA 3NF8A 4N76A 2HHXA 3QIOA 3VENA 4O44A 2UXBK 1VSLA 3KIOA 2KHOA 4CI6A 4BWJA 4JS4A 2YNIA 4O4GA 3HPOA 4DR7K 5HRNA 4I9QA 3SYZA 3EY1A 3EEQA 1DTQA 2OANA
chains in the Genus database with same CATH topology
5HL7L 5FPEA 1MWMA 1XUPO 3MMVA 1RDUA 3IDHA 4PHTX 3DWLA 3WXKA 4K41A 5LY3A 5F0XA 2QA4N 4PKIA 3VTHA 3MN9A 4CZMA 4GNIA 1VQ6N 1LOTB 3R8EA 4WYBA 1NLVA 5ADXA 4FVUA 5ADXH 4U67L 3LDPA 1BA1A 3HI0A 4FWQA 3CJ7A 1VQKN 3O1BA 3RSEA 3ENOA 4A61A 1TUYA 1JCFA 3BF1A 1QZ6A 1T3VA 5DM7L 4BVOA 2ASPA 3CQXA 3MWPA 1EO1A 3I55N 3W0LA 3LDNA 3J7ZO 3CCQN 2CGKA 4BR4A 2E2NA 5TKWA 2H3GX 2A5XA 1YITN 4BC5A 1GLLO 4YORA 4BRLA 4GV9A 3CERA 5AQRA 2A6AA 1K9MO 3ZETA 4H5WA 4CBUA 2NRWA 4RWTA 3ENBA 2NRVA 4KH5A 2ITMA 2E88A 2WBNA 2HOEA 3LDLA 1KAXA 4JKAA 3QFUA 4YOWA 2YHXA 4JD2B 4JD2A 2QEXN 1KAYA 4K42A 2AA4A 4Y0WA 3JS6A 4AF1A 3EKSA 2NLXA 4BQZA 1H1VA 3ZEUA 1P90A 1QZ5A 4FWPA 4ISFA 3D2FA 4BRDA 2IIRA 3HBTA 2FLOA 1SAZA 4H0PA 1MA9B 3I33A 4JHDB 3QDKA 1DKGD 3LL3A 5AQHA 5AQTA 2WC9A 3WEEB 3GE1A 3H3NO 2J4RA 4CD3A 5BRHA 3SAFA 1YJ9N 4IXCA 4PL7A 1WUAA 3VGMA 4PKHA 4IDHA 3A5MC 3QBXA 5BPNA 1VQ4N 1ATRA 1NGBA 1VQPN 2P9KA 5KPZA 5C2DA 4A5AA 3H46O 2FF6A 5JICA 4BQLA 3VPZA 3HSCA 3L4IA 1ZXOA 2QW9A 4FPBA 1NGHA 2CGLA 2VWBA 4BR7A 3BF3A 5GAGP 1MWKA 4BY9C 2E8AA 2QWRA 3K9KA 5HOOA 5TKYA 1NGDA 2JWLA 1BUPA 1S22A 1QQMA 3S41A 3VTIA 4JAXA 3TU5A 1ESVA 4K43A 3G6EN 3CQYA 5E26A 1T6CA 4NO7A 5AZJA 1G99A 3WXJA 4EIAA 1VQ7N 1YIJN 4IJNA 1CZAN 1Q81O 4EAHD 3MX5A 1XC3A 1V4SA 3O1WA 2CH5A 1S3XA 5AQMA 4IO8A 4JHDA 2BTFA 2A41A 3BP8A 1IG8A 3DJCA 4H5RA 1Q7YO 5AQSA 5AQWA 2CH6A 3VESA 2BUPA 3L0QA 4FPAA 3Q7CA 5BRFA 3QB0A 3LDOA 4BROA 2QTDA 4ISGA 2HBMA 5C0YA 2OTLN 4OO1J 3UKRB 2HF4A 2ZGYA 4A57A 3A5OC 4DHYA 5BR9A 4L3QA 5JLFA 1ATNA 4NLCA 4FSVA 1NGIA 2E20A 2KLAA 3ENHA 5DM6L 3SMPA 3UKUB 2BH1A 1QQNA 3R9PA 3ATVA 1R59O 3VETA 4B1VA 3LM9A 3ID6A 3CCUN 1U6ZA 4CJ7A 2E1YA 2Q36A 2YJEA 4M7XA 3VEVA 3ZX2A 2P9NB 4BR2A 3J8AA 4BRMA 2OTJN 4BRFA 1K8AO 3O9QA 1QVFM 1SQKA 4H5VA 3A0IX 2Q0RA 4AM6A 5B8HA 4JK9A 4BRPA 3R3LA 3E9LA 5EXWA 1HUXA 3FLCO 4C1NI 3GDQA 4DB3A 4JEPA 3MX2A 3QBWA 4FWKA 5KQDA 4JKCA 4JKGB 2D0PA 3IMXA 5E84A 4YDUA 2NNWA 1OKJA 3F9MA 3UKUA 4DQ8A 4IFEA 2IVPA 2WUSA 2KKZA 3R6MA 1DT9A 1K8KB 1K8KA 3MN6A 3CJ1A 1NGFA 2Q2RA 3N4QA 1SZ2A 2E2QA 1OVYA 1EQYA 1HPMA 3CHWA 1GLJO 3OA9A 3SMSA 3E1YA 1MDUB 3GG4A 3C0BA 3LM2A 2HBLA 4A5BA 1SS6A 3MCAB 3JXUA 4YOVA 2A42A 2NZTA 3E9PA 4CZHA 4XEIA 5EX5A 1Y64A 1GLAG 3QFPA 3MWTA 4BRHA 4WF9L 2EWSA 1VQLN 3CCLN 3FZHA 3VF2A 3PIPL 1NBWA 5GIPA 4YDUC 4NB4A 3VEWA 2V51B 4QS8A 3LDQA 3TSPA 5F2RA 1VQ8N 4CZLA 4PL8A 2YHWA 5AQGA 3M5RA 5M1OA 4C1NK 3O9RA 1E4FT 3WUHA 1YHQN 2HSTA 3H45C 4O8UA 4JKGA 3VEZA 2Q31A 3G4SN 5BPMA 3OHRA 2CGJA 4EHTA 5AR0A 3SK3A 4BVPA 3CMAN 4XH4A 4M63C 3HRGA 3L6QA 5KQ8A 3AARA 5M1NA 1HKBA 1W97L 3M6GA 3AY9A 4ISEA 3CF5L 5AQIA 5CHIA 5AZIA 4GV3A 5EOYA 4DKWA 1BWFO 4BC3A 5C15A 2YJFA 2RHKA 3P39A 4PKGA 1GLDG 4H0YB 1NMDA 1QHAA 3EO3A 1VQON 3CD6N 1VQMN 4JKHA 1HKGA 4K25A 1GLBG 1YVNA 5AQXA 2VGMA 3WT0A 2AP1A 2HBKA 2Q97A 2HMPA 4BRQA 1KC8O 1Q18A 1V4TA 2ZJPL 4G9ZA 4WQ4A 1ILYA 3VEYA 1BO5O 3MN7A 5GADP 1NGCA 1TYQB 3SBGA 4H5TA 3L4QA 3O9UA 1BU6O 3N4PA 1NGEA 4CD1A 3UB5A 1KD1O 5M1FA 4M7YA 2I7NA 1IJJA 5AQVA 5M1QA 4F9OA 1ATSA 5FPDA 3C7NB 5AQLA 2WFBA 3H6EA 2JWKA 5BRDA 5MLCQ 1NM1A 4A59A 5CE3A 2QWMA 1YAGA 5EY4A 4WCEL 3B8AX 4JKFA 5AQUA 5JVHL 3WEEA 2QWLA 1VQ5N 3MCPA 1ZC6A 2QWPA 4B1YB 4HWIA 3RSEB 2F7TA 4ILHA 4BRIA 5F1XA 1Q82O 2P9UA 4I6MA 3SBTA 1C0GA 4NLBA 3KK7A 1YUWA 3EL2A 4OPAA 2ZF5O 3G25A 5M1PA 5C10A 3HOSA 1VQ9N 3VOVA 3D7EO 3CCJN 4EHUA 3EE8A 1HX1A 5JMVA 4O8KA 3ZETB 1VQNN 3RVCA 3CJAA 1BG3A 4BRAA 5AQZA 4DCHA 3VGKA 2UYTA 4MLHA 3O4WA 4E1JA 2P9IB 1O13A 4WQ5C 3SAHA 4YOXA 3HZ6A 3VEOA 2F9WA 5AZIB 3E9OA 4BG8A 3IKMA 2GUPA 4CZJA 3C6AA 1HJOA 3UE5A 4B9QA 3NMUA 4IEIA 3KZBA 3QMLA 4IO9L 4QS7A 1RFQA 2QM1A 1C0FA 4XH5A 4CZIA 1Z6RA 2HF3A 4WFNL 3I8BA 4YOYA 3TPQA 1NGGA 3VGLA 4B1UB 1N8RO 3O08A 4HTLA 1KQSM 4RTFD 3MDQA 4BG9A 3O6WA 1GLFO 3IFRA 1GLCG 3P4IA 2F9TA 2A3ZA 4FWSA 3U8XA 4CZGA 1T44A 4UY8O 3F5TA 4ILJA 3UKRA 4BRGA 5FPMA 3SJHA 4FO0A 5CR4A 3EE9A 3CC7N 4CBXA 5M1KA 5LJWA 5AQNA 2D4WA 2P9PA 3HTVA 4H0XB 3GL1A 4JK8A 4WQ4C 4YOUA 2GELA 2RE2A 3K9JA 3H3OB 4YOTA 3CETA 3FZKA 3T69A 3F2KA 3IUCA 4BR5A 5JLHA 4A2AA 5ELZA 4BR9A 3A5NC 2PFUA 1YJNN 2PAVA 3CCEN 5KPRA 4FOIA 1Z05A 4CZEA 4U7BA 3T7ZA 5AQJA 1E4GT 3O5BA 4MLEA 4IJAA 2P9LB 3ULEA 2GWJA 3CMEN 3H1QA 3P38A 4A62A 5BREA 2V7YA 3FE1A 4IZ9A 2PBDA 2NRRA 3FGUA 5EVZA 1U2VB 2ZJRL 1U2VA 4OPHA 5FPNA 3Q7BA 3KVGA 4JKBA 2DPNA 3U9ZA 3A5LC 4IEEA 2QI2A 3ZX3A 4B1XB 1M1KO 4IWVA 2FSNA 4WFAL 4IOCL 1NWKA 2W40A 3CIPA 1YI2N 3FZFA 1K73O 1LCUA 2ZGZA 2D1KA 3ATUA 4A2BA 2VYPA 5BN8A 1DGKN 2QWQA 2YCHA 4GV6A 3DXKB 3CJ9A 1GLEG 3O8MA 3FFKB 2P9IA 3OBWA 5AQFA 4B1WB 3CC4N 4Z94A 2E2PA 3AGRA 3W3DA 1QVGM 2GWKA 1KAZA 3AAQA 3FZMA 2D0OA 3GBTA 2NRTA 3C6HA 3CI5A 1YF5L 2QWOA 3C7NA 2Q1NA 1JCEA 2ZWHA 4MDAA 1T6DA 3C65A 1WOQA 3H1VX 3TTCA 4BC4A 4FWLA 5AQYA 5LJVA 3SAGA 1TUUA 3NVKA 2FF3B 3CXCM 1P8ZA 3KHYA 2E1ZA 3BEXA 4H5NA 3A8YA 3NVMA 2FXUA 3MK6A 4I6MB 4C23A 2ZJQL 5AFUA 4FL9A 1JJ2M 2QWNA 2P9SB 3CCMN 3DXMA 2FSKA 3WXIA 3CPEA 4GY2B 2IVNA 3VERA 4IOAL 3AAPA 5GINA 4J8FA 1QQOA 1J6ZA 3EKUA 4FWOA 1X3NA 2QXLA 3EN9A 4JKDA 3WQTA 3E66A 4MDBA 3ZYYX 3TTDA 4BC2A 2YHYA 3BUZB 4KH4A 5C12A 4BRNA 2NRXA 1BDGA 2VGNA 1YXQA 3KWGA 4JK7A 3CCSN 2V52B 3DXKA 5BN9A 2P9NA 3D2EB 5BPLA 3QICA 1NGJA 2GX9A 1BA0A 3VEXA 5I9EB 3DAWA 3AGKA 5AZJB 4BRCA 1HLUA 4CBWA 3VMFB 3DLLL 2V7ZA 4FWNA 3CPWM 5AFUH 2W41A 2GEMA 4EFHA 1DEJA 4MO5A 1XQSC 4WFBL 1NGAA 1ZBSA 2P9SA 3DXMB 3TTFA 5GIOA 3G71N 3PIOL 3D2FB 3KWIA 2VCPA 5AQKA 3CJBA 1YJWN 4BR0A 3I56N 1BOTO 2I7PA 5C2FA 2HBJA 3CCVN 1M90O 2A40A 4BRKA 2ASMA 3OBYA 3PLAA 2GTDA 3VF6A 3WXMB 3O80A 1X3MA 2Q0UA 5GAHP 2P9UB 3FZLA 3CJCA 4AM7A 4CZKA 3M1FA 3GOIA 3TSQA 3VF4A 1RGIA 3U9DA 3SLCA 2ASOA 3D2EA 4FWMA 1Q86O 2YI1A 4H0VB 4ILGB 1W2BM 4WQ5A 4B1ZA 3P31A 3CC2N 3HM8A 5KPTA 3TSUA 2NRZA 1KXPA 1JCGA 3WXLA 4CZFA 5JVGL 1NJIO 1VAZA 5GAEP 4GVEA 2IVOA 2FSJA 4BGBA 4MO4A 4FWRA 4BREA 2P9PB 4QS9A 3ZEUB 1HKCA 3FR0A 3R1XA 3U4LA 4R79A 1TYQA 3HOTA 3ZX0A 3O9SA 3D6RA 4H0TB 4H0OA 4LC9B 4JNEA 3OW2M 5AQOA 4RCHA 2E2OA 3WQUA 3MN5A 3VENA 4KH6A 2P9LA 4JKEA 3ULEB 5H1SQ 4IOXA 1RDWX 3O9TA 4O5FA 2YX6A 2P9KB 3CCRN 4JN4A 3EZWA 2KHOA 4CI6A 2NRHA 4BGAA 3M3ZA 1D4XA 5AQQA 5AQPA 3ID8A 1S72N 4FOEA 2OANA 1X9JA 4XH1A 4KBOA 4H03B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPE A;  1MWM A;  1XUP O;  3MMV A;  3IDH A;  3DWL A;  3WXK A;  4K41 A;  5LY3 A;  5F0X A;  4PKI A;  3MN9 A;  4CZM A;  4GNI A;  1LOT B;  3R8E A;  4WYB A;  1NLV A;  5ADX A;  5ADX H;  3LDP A;  1BA1 A;  3HI0 A;  4FWQ A;  3CJ7 A;  3O1B A;  3RSE A;  3ENO A;  4A61 A;  1TUY A;  1JCF A;  3BF1 A;  1QZ6 A;  4BVO A;  2ASP A;  3CQX A;  3W0L A;  3LDN A;  2CGK A;  4BR4 A;  2E2N A;  2H3G X;  2A5X A;  4BC5 A;  1GLL O;  4BRL A;  3CER A;  5AQR A;  2A6A A;  3ZET A;  4H5W A;  4CBU A;  4RWT A;  2ITM A;  2E88 A;  2HOE A;  3LDL A;  1KAX A;  3QFU A;  2YHX A;  4JD2 B;  4JD2 A;  1KAY A;  4K42 A;  2AA4 A;  4Y0W A;  3JS6 A;  3EKS A;  2NLX A;  4BQZ A;  1H1V A;  3ZEU A;  1QZ5 A;  4ISF A;  4FWP A;  3D2F A;  4BRD A;  2IIR A;  3HBT A;  2FLO A;  1SAZ A;  4H0P A;  1MA9 B;  3I33 A;  4JHD B;  3QDK A;  1DKG D;  3LL3 A;  5AQH A;  5AQT A;  3WEE B;  4CD3 A;  3GE1 A;  3H3N O;  2J4R A;  5BRH A;  4IXC A;  4PL7 A;  1WUA A;  3VGM A;  4PKH A;  3A5M C;  3QBX A;  5BPN A;  1ATR A;  1NGB A;  2P9K A;  5KPZ A;  3H46 O;  2FF6 A;  5JIC A;  4BQL A;  3VPZ A;  3HSC A;  3L4I A;  1ZXO A;  2QW9 A;  4FPB A;  1NGH A;  2CGL A;  2VWB A;  4BR7 A;  3BF3 A;  1MWK A;  2E8A A;  2QWR A;  5TKY A;  1NGD A;  1BUP A;  1S22 A;  1QQM A;  3S41 A;  4JAX A;  3TU5 A;  1ESV A;  4K43 A;  3CQY A;  5E26 A;  1T6C A;  4NO7 A;  5AZJ A;  1G99 A;  3WXJ A;  4EIA A;  4IJN A;  1CZA N;  4EAH D;  1XC3 A;  1V4S A;  3O1W A;  2CH5 A;  1S3X A;  5AQM A;  4IO8 A;  4JHD A;  2BTF A;  2A41 A;  3BP8 A;  1IG8 A;  3DJC A;  4H5R A;  5AQS A;  5AQW A;  2CH6 A;  3VES A;  2BUP A;  3L0Q A;  4FPA A;  5BRF A;  3QB0 A;  3LDO A;  4BRO A;  4ISG A;  3UKR B;  2HF4 A;  2ZGY A;  4DHY A;  3A5O C;  5BR9 A;  5JLF A;  4L3Q A;  1ATN A;  4FSV A;  1NGI A;  2E20 A;  3ENH A;  3SMP A;  3UKU B;  1QQN A;  3R9P A;  3ATV A;  1R59 O;  3VET A;  4B1V A;  3LM9 A;  1U6Z A;  4CJ7 A;  2E1Y A;  2Q36 A;  2YJE A;  4M7X A;  3VEV A;  3ZX2 A;  2P9N B;  4BR2 A;  3J8A A;  4BRM A;  4BRF A;  1SQK A;  4H5V A;  3A0I X;  2Q0R A;  4AM6 A;  5B8H A;  4BRP A;  5EXW A;  1HUX A;  3FLC O;  4DB3 A;  3GDQ A;  3QBW A;  4FWK A;  5KQD A;  2D0P A;  3IMX A;  5E84 A;  4YDU A;  3F9M A;  1OKJ A;  3UKU A;  4DQ8 A;  2IVP A;  2WUS A;  3R6M A;  1K8K B;  1K8K A;  3MN6 A;  3CJ1 A;  1NGF A;  2Q2R A;  1SZ2 A;  2E2Q A;  1EQY A;  1HPM A;  3CHW A;  1GLJ O;  3SMS A;  3GG4 A;  1MDU B;  3C0B A;  3LM2 A;  3JXU A;  2A42 A;  2NZT A;  4CZH A;  4XEI A;  5EX5 A;  1Y64 A;  1GLA G;  3QFP A;  4BRH A;  2EWS A;  3FZH A;  3VF2 A;  1NBW A;  4YDU C;  4NB4 A;  3VEW A;  2V51 B;  4QS8 A;  3LDQ A;  5F2R A;  4CZL A;  4PL8 A;  2YHW A;  5AQG A;  1E4F T;  3WUH A;  3H45 C;  3VEZ A;  2Q31 A;  5BPM A;  3OHR A;  2CGJ A;  4EHT A;  5AR0 A;  3SK3 A;  4BVP A;  4XH4 A;  4M63 C;  5KQ8 A;  3L6Q A;  3AAR A;  1HKB A;  3M6G A;  3AY9 A;  4ISE A;  5AQI A;  5AZI A;  5EOY A;  1BWF O;  4BC3 A;  2YJF A;  4PKG A;  1GLD G;  4H0Y B;  1NMD A;  1QHA A;  3EO3 A;  1HKG A;  4K25 A;  1GLB G;  1YVN A;  5AQX A;  3WT0 A;  2AP1 A;  2Q97 A;  4BRQ A;  2HMP A;  1Q18 A;  1V4T A;  4WQ4 A;  3VEY A;  1BO5 O;  3MN7 A;  1NGC A;  1TYQ B;  4H5T A;  1BU6 O;  1NGE A;  4CD1 A;  3UB5 A;  4M7Y A;  2I7N A;  1IJJ A;  5AQV A;  4F9O A;  1ATS A;  5FPD A;  3C7N B;  5AQL A;  3H6E A;  5BRD A;  1NM1 A;  5CE3 A;  2QWM A;  1YAG A;  5EY4 A;  3B8A X;  5AQU A;  3WEE A;  2QWL A;  3MCP A;  1ZC6 A;  2QWP A;  4B1Y B;  4HWI A;  3RSE B;  4BRI A;  5F1X A;  2P9U A;  4I6M A;  1C0G A;  1YUW A;  3EL2 A;  2ZF5 O;  3G25 A;  3VOV A;  3D7E O;  4EHU A;  1HX1 A;  5JMV A;  4O8K A;  3ZET B;  3CJA A;  1BG3 A;  4BRA A;  5AQZ A;  4DCH A;  3VGK A;  2UYT A;  4MLH A;  3O4W A;  4E1J A;  2P9I B;  4WQ5 C;  3HZ6 A;  3VEO A;  2F9W A;  5AZI B;  4BG8 A;  2GUP A;  4CZJ A;  1HJO A;  3UE5 A;  4B9Q A;  3KZB A;  3QML A;  4QS7 A;  1RFQ A;  2QM1 A;  1C0F A;  4XH5 A;  4CZI A;  1Z6R A;  2HF3 A;  3I8B A;  3TPQ A;  1NGG A;  3VGL A;  4B1U B;  3O08 A;  4HTL A;  4RTF D;  3MDQ A;  4BG9 A;  3O6W A;  1GLF O;  3IFR A;  1GLC G;  3P4I A;  2F9T A;  2A3Z A;  4FWS A;  3U8X A;  4CZG A;  1T44 A;  4BRG A;  3UKR A;  5FPM A;  3SJH A;  4FO0 A;  4CBX A;  5LJW A;  5AQN A;  2D4W A;  2P9P A;  3HTV A;  4H0X B;  3GL1 A;  4WQ4 C;  2GEL A;  3H3O B;  3CET A;  3FZK A;  4BR5 A;  3IUC A;  5JLH A;  4A2A A;  5ELZ A;  4BR9 A;  3A5N C;  2PAV A;  5KPR A;  4FOI A;  1Z05 A;  4CZE A;  5AQJ A;  1E4G T;  3O5B A;  4MLE A;  4IJA A;  2P9L B;  3ULE A;  2GWJ A;  3H1Q A;  4A62 A;  5BRE A;  3FE1 A;  2V7Y A;  4IZ9 A;  2PBD A;  3FGU A;  5EVZ A;  1U2V B;  1U2V A;  5FPN A;  3U9Z A;  3KVG A;  2DPN A;  3A5L C;  4B1X B;  3ZX3 A;  4IWV A;  2FSN A;  1NWK A;  2W40 A;  3CIP A;  3FZF A;  1LCU A;  2ZGZ A;  2D1K A;  3ATU A;  4A2B A;  2VYP A;  5BN8 A;  1DGK N;  2QWQ A;  2YCH A;  3DXK B;  3CJ9 A;  1GLE G;  3O8M A;  3FFK B;  2P9I A;  5AQF A;  4B1W B;  4Z94 A;  2E2P A;  3W3D A;  2GWK A;  1KAZ A;  3AAQ A;  3FZM A;  2D0O A;  3GBT A;  3CI5 A;  2QWO A;  3C7N A;  2Q1N A;  1JCE A;  2ZWH A;  4BC4 A;  1T6D A;  1WOQ A;  3H1V X;  4FWL A;  5AQY A;  5LJV A;  1TUU A;  2FF3 B;  1P8Z A;  3KHY A;  2E1Z A;  3BEX A;  4H5N A;  3A8Y A;  2FXU A;  3MK6 A;  4I6M B;  4C23 A;  5AFU A;  4FL9 A;  2QWN A;  2P9S B;  3DXM A;  2FSK A;  3WXI A;  4GY2 B;  2IVN A;  3VER A;  3AAP A;  4J8F A;  1QQO A;  1J6Z A;  3EKU A;  4FWO A;  1X3N A;  2QXL A;  3EN9 A;  4BC2 A;  3WQT A;  2YHY A;  3BUZ B;  4BRN A;  1BDG A;  1YXQ A;  2V52 B;  3DXK A;  5BN9 A;  2P9N A;  3D2E B;  5BPL A;  3QIC A;  1NGJ A;  3VEX A;  1BA0 A;  5I9E B;  3DAW A;  5AZJ B;  4CBW A;  4BRC A;  1HLU A;  2V7Z A;  4FWN A;  5AFU H;  2W41 A;  2GEM A;  4EFH A;  1DEJ A;  4MO5 A;  1XQS C;  1NGA A;  1ZBS A;  2P9S A;  3DXM B;  3D2F B;  5AQK A;  2VCP A;  3CJB A;  4BR0 A;  1BOT O;  2I7P A;  2A40 A;  4BRK A;  2ASM A;  2GTD A;  3VF6 A;  3O80 A;  1X3M A;  2Q0U A;  2P9U B;  3FZL A;  3CJC A;  4AM7 A;  4CZK A;  3M1F A;  3GOI A;  3VF4 A;  1RGI A;  3U9D A;  3SLC A;  2ASO A;  3D2E A;  4FWM A;  2YI1 A;  4H0V B;  4WQ5 A;  4B1Z A;  3HM8 A;  5KPT A;  4CZF A;  1KXP A;  1JCG A;  3WXL A;  2IVO A;  2FSJ A;  4BGB A;  4MO4 A;  4FWR A;  4BRE A;  2P9P B;  4QS9 A;  3ZEU B;  1HKC A;  3FR0 A;  3U4L A;  1TYQ A;  3ZX0 A;  4H0O A;  4H0T B;  4LC9 B;  4JNE A;  5AQO A;  4RCH A;  2E2O A;  3WQU A;  3MN5 A;  3VEN A;  2P9L A;  3ULE B;  1RDW X;  4O5F A;  2P9K B;  4JN4 A;  3EZW A;  2KHO A;  4CI6 A;  2NRH A;  4BGA A;  3M3Z A;  1D4X A;  5AQQ A;  5AQP A;  3ID8 A;  4FOE A;  2OAN A;  1X9J A;  4XH1 A;  4KBO A;  4H03 B; 
#chains in the Genus database with same CATH topology
 3ZT3 A;  1MWM A;  4FLW A;  2ITG A;  4DR4 K;  3MMV A;  1LAV A;  3DWL A;  5LY3 A;  1JXE A;  4FK2 A;  4CZM A;  1XMQ K;  1VQ6 N;  1LOT B;  4LSN A;  1VSM A;  4LY7 A;  3DRR A;  1BA1 A;  3HI0 A;  4FWQ A;  4CJW A;  1TKD A;  4KB1 A;  4A61 A;  1JCF A;  3BF1 A;  3J81 O;  4LSL A;  3MAQ A;  1T3V A;  3MWP A;  4AHV A;  1YVU A;  1EO1 A;  2ZQB A;  3M8Q A;  1KSP A;  3OJU A;  4CJP A;  4DV0 K;  5AQR A;  1S1V A;  4H5W A;  4RWT A;  5LMN K;  3RMB A;  1KAX A;  3QFU A;  3QIN A;  4YOW A;  3OY9 A;  4OKE A;  4DTN A;  4Y0W A;  3OS1 A;  3DLR A;  4AF1 A;  3EKS A;  2HHU A;  1H1V A;  3JSM A;  4N47 A;  4JI6 K;  4CJU A;  4FWP A;  2IIR A;  4CFA A;  1SAZ A;  3WEE B;  5AQH A;  2UUB K;  2WC9 A;  3GE1 A;  2J4R A;  5DMR A;  3SAF A;  4YFU A;  2F4V K;  1WUA A;  3VGM A;  4CJK A;  1VQ4 N;  2P9K A;  2YKN A;  5C2D A;  3H46 O;  5JIC A;  4DV4 K;  4KAZ A;  1ZXO A;  5SZT A;  3VQ7 A;  2VWB A;  4ZHR A;  4I9L A;  3OJS A;  4F3T A;  3BF3 A;  4BY9 C;  2E6L A;  2KZZ A;  3TAE A;  2Q3S A;  1NGD A;  1TVR A;  2JWL A;  3JYT A;  4KKO A;  1QQM A;  3AVN A;  3CFP A;  4HUF A;  3TU5 A;  3ZSO A;  1FW6 A;  4NO7 A;  1REV A;  4EIA A;  1NJY A;  2E5L K;  4FJX A;  4BDZ A;  1YIJ N;  4EZ6 A;  1Q81 O;  4EAH D;  5FRO A;  4DQR A;  2CH5 A;  1S3X A;  3AV9 A;  2A41 A;  4EZ9 A;  4FK0 A;  4DR2 K;  1Q7Y O;  3NH0 A;  2CH6 A;  4E7L A;  3KK2 A;  3VQE A;  3AO5 A;  4BRO A;  3VQA A;  3S3N A;  4ISG A;  2HBM A;  3CM5 A;  4WE1 A;  5C0Y A;  3UKR B;  1TK0 A;  1ATN A;  3LAM A;  3UKU B;  1D5A A;  3R9P A;  3ATV A;  1R59 O;  2W6L A;  3ID6 A;  4CJ7 A;  1WLJ A;  3G10 A;  4BRM A;  1T03 A;  1QSL A;  2O8B B;  1SQK A;  3A0I X;  3PX4 A;  3E9L A;  4DFJ A;  3SUO A;  5EXW A;  4M3U A;  3QBW A;  4FWK A;  2D0P A;  3F9M A;  1OKJ A;  3NGY A;  4CJE A;  2IVP A;  4IDK A;  2BDP A;  4Z4F A;  1DT9 A;  3MN6 A;  2Q2R A;  2D0C A;  3N4Q A;  3PO4 A;  4QOZ B;  1J54 A;  3OA9 A;  4A5B A;  1SS6 A;  4RW8 A;  4E3S A;  4FLY A;  4CZH A;  1Y64 A;  3QFP A;  4BRH A;  3FZH A;  3L2U A;  3VF2 A;  1LWC A;  3L2W A;  3VEW A;  4NB4 A;  1D8Y A;  4FM1 A;  1TKZ A;  3TSP A;  3OYG A;  1GOB A;  2YHW A;  4GKK K;  3M5R A;  4JI4 K;  4C1N K;  3O9R A;  3WUH A;  4O8U A;  4JKG A;  3P83 D;  3M8R A;  4EHT A;  4BVP A;  3CMA N;  3HRG A;  3AAR A;  5M1N A;  1RBR A;  1HKB A;  3O4N A;  3THV A;  3TI0 A;  5AQI A;  4RW4 A;  3HXM A;  4GV3 A;  2FC0 A;  1RBT A;  3P39 A;  4PKG A;  4H0Y B;  3CD6 N;  3AVC A;  4K25 A;  3HM9 A;  4I7F A;  3NE6 A;  5AQX A;  2AP1 A;  4BRQ A;  2HMP A;  4DTJ A;  1Q18 A;  1V4T A;  4LD0 A;  3VEY A;  1BO5 O;  3SBG A;  3ASM A;  3N4P A;  4DQP A;  2FBV A;  2O8E B;  4E7K A;  2O8D A;  4M7Y A;  3DOL A;  3CQ8 A;  3ZSR A;  2ZE2 A;  2BGG A;  2WFB A;  1HNI A;  5BRD A;  2VG5 A;  3QEV A;  1I3A A;  2B4J A;  2QWM A;  4ELV A;  4JKF A;  4OPJ A;  5JVH L;  4CF8 A;  4CW7 B;  4OKK A;  4GW6 A;  4B1Y B;  4BRI A;  1VSD A;  3BDP A;  3V9U A;  1RT3 A;  3EL2 A;  4KHS A;  1C0M A;  1KLM A;  3G25 A;  1VQ9 N;  3MEG A;  3VOV A;  4UQG A;  1L3V A;  3CFR A;  3D7E O;  3CCJ N;  4O8K A;  3CJA A;  4JI2 K;  3VGK A;  2UYT A;  1O13 A;  1RT6 A;  1LW2 A;  3HZ6 A;  1JLF A;  4BG8 A;  3IKM A;  3LP1 A;  3C6A A;  4CZJ A;  3UIQ A;  2HHS A;  1HYV A;  4CCH A;  3QML A;  3DLK A;  4H4O A;  3RMD A;  3PX6 A;  1C0F A;  4XH5 A;  1HMV A;  4CJT A;  4CZI A;  2ZD1 A;  4HTL A;  1KQS M;  1GLF O;  3QIP A;  1GLC G;  2OTJ N;  4CZG A;  1T44 A;  3UKR A;  5FPM A;  3WNG A;  2OZS A;  1VK0 A;  4CJ5 A;  3LZI A;  3CC7 N;  4CEZ A;  4G1Q A;  4WQ4 C;  4LF9 K;  3OYK A;  1KRP A;  1N32 K;  4BR5 A;  5ELZ A;  3RMA A;  1HNZ K;  1VSE A;  1UAX A;  2Z1G A;  1E4G T;  1HRH A;  1WN7 A;  3T1A A;  5E41 A;  3HP6 A;  2RF2 A;  4A62 A;  4AHS A;  5C25 A;  2WOM A;  2NRR A;  5EVZ A;  4JKB A;  4V19 S;  4B1X B;  1YI2 N;  3FZF A;  2ZGZ A;  3ZSQ A;  3D0P A;  4CGJ A;  2RN2 A;  5BN8 A;  1OVQ A;  4W5N A;  1DGK N;  2QWQ A;  3LZJ A;  1BI4 B;  2HHQ A;  3FFK B;  3CC4 N;  4Z94 A;  2KQ2 A;  2JLE A;  1QSS A;  2NRT A;  3C6H A;  4AHU A;  1YF5 L;  1VQL N;  2Q1N A;  1JCE A;  4BC4 A;  3C65 A;  1QHT A;  3CXC M;  3PV8 A;  3O3H A;  4HVJ A;  5K14 A;  5KGX A;  3NVM A;  2FXU A;  2QWN A;  5HRO A;  3DXM A;  4DV3 K;  3CPE A;  5EU7 A;  1ZBU A;  1JLA A;  1UA0 A;  5GIN A;  1A5V A;  2QXL A;  3EN9 A;  4JKD A;  4BE1 A;  1U4B A;  2UU9 K;  3BUZ B;  4BRN A;  4FM0 A;  3KKR A;  3SPY A;  3KWG A;  3CCS N;  1NKC A;  3DM2 A;  5CY4 A;  1NGJ A;  3VEX A;  2O8B A;  3RMC A;  3DAW A;  1VSF A;  1HQE A;  1GOC A;  4FJ8 A;  2V7Z A;  3ZSZ A;  5AFU H;  4LF4 K;  4BDY A;  4PUO A;  2W41 A;  4EFH A;  1DEJ A;  1WBD A;  4MO5 A;  1XQS C;  4WFB L;  1NGA A;  3K57 A;  1NU0 A;  4BR0 A;  3V6D A;  4B3O A;  4DTS A;  1M90 O;  4B3R K;  2A40 A;  1RCH A;  2ASM A;  3TAN A;  4JV5 K;  1WNS A;  3O80 A;  3VQ9 A;  1HNW K;  4CHZ A;  1WAJ A;  2P9U B;  1HYS A;  3OVN A;  3GOI A;  2ASO A;  1BI4 A;  1W2B M;  3CC2 N;  4B1Z A;  2KTQ A;  3HM8 A;  1QTM A;  5KPT A;  3TSU A;  5JVG L;  1VAZ A;  3D45 A;  5GAE P;  4GVE A;  4FYD A;  2IVO A;  5HP1 A;  4MO4 A;  3SI6 A;  3FR0 A;  4R79 A;  1TYQ A;  3ZX0 A;  4H0T B;  3T19 A;  5KRS A;  3J7Y P;  3AVJ A;  4RCH A;  3MXJ A;  2E2O A;  4FJH A;  4F2S A;  2P9L A;  4CK3 A;  1RDD A;  3CM6 A;  3O9T A;  2VG6 A;  2GBZ A;  2YX6 A;  3TAR A;  1L3U A;  2NRH A;  1BGX T;  1TGO A;  4FOE A;  4YY3 K;  4XH1 A;  5HL7 L;  4KB0 A;  1HQU A;  3WXK A;  2QA4 N;  4J2E A;  4PKI A;  1K6Y A;  3VTH A;  1Q9Y A;  3QET A;  4CGH A;  4FVU A;  1NKB A;  1LWE A;  1DLO A;  3SV3 A;  1U48 A;  3O1B A;  1TUY A;  2ASP A;  3CQX A;  4IKF A;  2UXC K;  4Q5V A;  5CZ1 A;  4JRP A;  3W0L A;  3AVH A;  1X9S A;  4OPK A;  2CGK A;  4BR4 A;  1X9M A;  3U3G A;  1A5W A;  2H3G X;  4DUY K;  3PUF A;  3TAG A;  4GV9 A;  4FVM A;  3CER A;  2A6A A;  1IKV A;  3ZET A;  2NRW A;  4KH5 A;  2ITM A;  3AO4 A;  2HMI A;  2HOE A;  3LDL A;  1RTH A;  3DMJ A;  4JD2 B;  3NGZ A;  3JS6 A;  1W9H A;  1T7P A;  1IBL K;  1EKE A;  4BQZ A;  2PZS A;  1QZ5 A;  5I42 A;  3HBT A;  3SUP A;  3HYF A;  3LL3 A;  4CD3 A;  3DLB A;  2WTU A;  5BRH A;  1ZYQ A;  1YJ9 N;  4IXC A;  3HK2 A;  4DS5 A;  5BPN A;  1KTQ A;  1ATR A;  3ALY A;  5KPZ A;  5A2Q O;  5KI6 A;  4DS4 A;  1XHX A;  2E6M A;  4PQU A;  3M8S A;  2G8K A;  2QWR A;  3DI6 A;  3VTI A;  3KLG A;  2QKB A;  4K43 A;  3CQY A;  3WXJ A;  1LWF A;  3P5J A;  5LL6 Z;  3SCX A;  2DFH A;  4CGI A;  4JHD A;  1S6P A;  3V1Q A;  3VES A;  3THY A;  3L0Q A;  3Q7C A;  3NH1 A;  3QB0 A;  3LDO A;  4CEB A;  1ZBH A;  4OO1 J;  4A57 A;  4B9T A;  1NJW A;  1NGI A;  3ENH A;  2KLA A;  5DM6 L;  5J2N A;  3DLG A;  4CJS A;  4DV2 K;  1QQN A;  4OVL A;  4OGC A;  3VET A;  3CCU N;  4FM2 A;  1KFD A;  2E1Y A;  2Q36 A;  2P9N B;  4BR2 A;  3P1G A;  4BRF A;  3SQ4 A;  3AVF A;  3O9Q A;  3SZ2 A;  1C1C A;  4OJR A;  4H5V A;  5B8H A;  4AM6 A;  4BRP A;  3R3L A;  4JS5 A;  1OH8 A;  4DFP A;  1HUX A;  3GDQ A;  1HNV A;  4ID1 A;  4CHP A;  4LF8 K;  3LPU A;  5KQD A;  3OYA A;  4IG3 A;  3H08 A;  1I39 A;  3NF6 A;  4DQ8 A;  1EXQ A;  4F2R A;  1BIZ A;  4F4K A;  4J2B A;  1TK8 A;  1LAW A;  2DFF A;  3AVB A;  2O4I A;  3J80 O;  1SZ2 A;  3VA3 A;  3CHW A;  2HBL A;  3MCA B;  3RWU A;  2A42 A;  4N5S A;  1EET A;  1RTI A;  4XEI A;  4NCA A;  3MWT A;  3KK3 A;  3CCL N;  4LH5 A;  4NYN A;  3VQ4 A;  2V51 B;  3VQ5 A;  1J53 A;  3NAE A;  1OH7 A;  1YHQ N;  4KRE A;  4QAG A;  3G4S N;  1C1B A;  2CGJ A;  2EX3 A;  4CF1 A;  3OYI A;  5AR0 A;  3KLE A;  2DTU A;  1TAU A;  3OYB A;  4HUE A;  1W97 L;  1U47 A;  3NCI A;  3I0S A;  5JS2 A;  2OPR A;  4FW2 A;  1BQM A;  3J7A P;  5C15 A;  3NF7 A;  3TR8 A;  1NOZ A;  2RHK A;  3AVG A;  1NMD A;  1QHA A;  1VQO N;  3V81 A;  1UWB A;  4JRQ A;  1GLB G;  3WT0 A;  4ELT A;  3O4Q A;  3PY8 A;  4FW1 A;  4KV8 A;  2ZJP L;  4G9Z A;  1NOY A;  1N34 K;  1NGC A;  3O9U A;  2F8S A;  4CD1 A;  3UB5 A;  1KD1 O;  1SKS A;  5AQV A;  4F9O A;  3E01 A;  1ATS A;  4B9S A;  3C7N B;  2BAN A;  3OYC A;  1NM1 A;  1XWL A;  4A59 A;  5EY4 A;  3B8A X;  4DWI A;  3ULD A;  3ZSX A;  3MCP A;  4N41 A;  1ZC6 A;  1B9F A;  4HWI A;  5F1X A;  4I6M A;  3L3U A;  1C0G A;  3OYJ A;  3KK7 A;  4KTZ A;  3HVT A;  3CYM A;  1NK5 A;  2ZF5 O;  1OH5 A;  3FFI A;  5M1P A;  1UA1 A;  4DTU A;  1L3S A;  1IKW A;  1HX1 A;  1KCF A;  4DU3 A;  4YNQ A;  4BRA A;  4DCH A;  3TAQ A;  4BWM A;  4YOX A;  2P9I B;  3VEO A;  2F9W A;  5AZI B;  4L8R B;  2GUP A;  4B9Q A;  3SPZ A;  4QS7 A;  1N6Q A;  5J2M A;  4DR5 K;  2HF3 A;  5HLF A;  1KVB A;  3V9X A;  1N8R O;  1O1W A;  4Z4C A;  4RTF D;  3MDQ A;  3MEE A;  4BG9 A;  4CHO A;  1U49 A;  3IFR A;  1JLB A;  2Z1H A;  2A3Z A;  3U8X A;  3F5T A;  3SJH A;  4CFD A;  4E0D A;  3EE9 A;  5LJW A;  3DLH A;  3HO1 A;  4JK8 A;  3OYF A;  4YOU A;  2GEL A;  2RE2 A;  3U3Y A;  1W7A A;  3H3O B;  3AO3 A;  4YOT A;  3CET A;  3T69 A;  3IUC A;  3HPG A;  4M3Y A;  3A5N C;  2PFU A;  4DQS A;  2O8C B;  4U7B A;  1Z05 A;  1HJR A;  5AQJ A;  4LH4 A;  3O5B A;  4MLE A;  4IJA A;  4W5T A;  2YV0 X;  4C8O A;  3H1Q A;  2QXF A;  1CZ9 A;  2ZJR L;  4DR1 K;  4OPH A;  3U9Z A;  2VG7 A;  5FPN A;  3A5L C;  4IEE A;  2FSN A;  4WFA L;  2W40 A;  3CIP A;  3AO2 A;  4KFB A;  2D1K A;  2KZM A;  3ATU A;  4A2B A;  4NXN K;  1GLE G;  3O8M A;  4CHQ A;  2P9I A;  5KRT A;  1NK0 A;  1QVG M;  2E2P A;  4CHN A;  5C42 A;  3LP3 A;  3ZLJ A;  4FJJ A;  2QWO A;  3C7N A;  4FJG A;  4MDA A;  3H1V X;  5AQY A;  4CJV A;  3NVK A;  2FF3 B;  1C0T A;  3L3V A;  4FLU A;  3MK6 A;  2OYQ A;  4I6M B;  4FL9 A;  2P9S B;  4CEQ A;  3LAL A;  1C6V A;  3VER A;  3AAP A;  4CJ3 A;  4M3R A;  1J6Z A;  1X3N A;  4GKJ K;  3E66 A;  3TTD A;  4DMN A;  2NRX A;  4YHH K;  2VGN A;  4FJL A;  2YKM A;  4JLH A;  2P9N A;  3D2E B;  4PY5 A;  4DSL A;  4CJL A;  4CBW A;  3CCM N;  2O8D B;  3DRS A;  4FWN A;  3TWH A;  4FLZ A;  1WB9 A;  2HHT A;  2GEM A;  1ZBS A;  3KWI A;  5AQK A;  1BOT O;  1MU2 A;  5C2F A;  2HBJ A;  3CCV N;  4E7H A;  2O8F A;  4BRK A;  3OBY A;  2GTD A;  3VF6 A;  3WXM B;  1J9A A;  1X3M A;  3K5L A;  3MXM A;  2Q0U A;  5J2Q A;  3MED A;  3CJC A;  3TSQ A;  3M1F A;  3BY5 A;  3U9D A;  2WON A;  4FWM A;  2YI1 A;  4ILG B;  1T8E A;  5IWA K;  1S1X A;  1YTA A;  4CZF A;  1NJI O;  1JL2 A;  5CYM A;  1OH6 A;  2FSJ A;  1KFS A;  4BRE A;  1HKC A;  1NK4 A;  3R1X A;  3ISN C;  2G8U A;  4DQI A;  4DV1 K;  3D6R A;  2O8F B;  4FLT A;  1IBM K;  4H8K A;  4HCB A;  2P1J A;  1RT1 A;  3MN5 A;  3NF9 A;  4KH6 A;  1KLN A;  3ULE B;  4CGD A;  5H1S Q;  4DV5 K;  1VSH A;  4DFM A;  4CHY A;  2P9K B;  4JN4 A;  3KLF A;  3BZC A;  3G0Z A;  3M3Z A;  3ZCM A;  1A5X A;  2D0B A;  1D4X A;  4FCY A;  3ID8 A;  1S72 N;  4KHP K;  4CIG A;  4FXD A;  3KLH A;  4H03 B;  1XUP O;  1RDU A;  3IDH A;  4PHT X;  4JI5 K;  3MN9 A;  4GNI A;  3K5M A;  3THX A;  2Y1J A;  4WYB A;  3LPT A;  5ADX A;  5J1E A;  5ADX H;  4DTX A;  4I2P A;  5DK5 A;  3THW A;  3CJ7 A;  1VQK N;  4HCC A;  3ZT4 A;  3ENO A;  1SV5 A;  2OCE A;  1QZ6 A;  5DM7 L;  2XO7 A;  1XNR K;  4BVO A;  3AA4 A;  1SUQ A;  3I55 N;  2X78 A;  3LDN A;  4ICL A;  3J7Z O;  1KVA A;  3CCQ N;  3DOK A;  4DR6 K;  2IGI A;  1L3T A;  2A5X A;  4BC5 A;  1CXQ A;  4CBU A;  2OA8 A;  3DRP A;  3KKS A;  3ENB A;  2NRV A;  2E88 A;  3CG7 A;  1KAY A;  3LP2 A;  4K42 A;  2AA4 A;  4JI3 K;  3HT3 A;  3V9W A;  2D0A A;  3ZEU A;  3WNE A;  4CK1 A;  2OPP A;  3D2F A;  4BRD A;  4FK4 A;  2FLO A;  1MA9 B;  2IAJ A;  4JHD B;  3QDK A;  4FZY A;  5AQT A;  1QS4 A;  3TAP A;  3RR7 A;  1U45 A;  4PL7 A;  4PKH A;  4IDH A;  4OGE A;  3QBX A;  4AHT A;  1NGB A;  3C6T A;  3RTV A;  1TAQ A;  3RR8 A;  1VQP N;  4A5A A;  4BE0 A;  1RT4 A;  3HSC A;  4BR7 A;  2CGL A;  3L2V A;  5GAG P;  4R5P A;  1MWK A;  1ZBL A;  2G8W A;  1S1T A;  3K9K A;  2P5G A;  3DLE A;  5HOO A;  1BUP A;  1S22 A;  4DR3 K;  3S41 A;  4CEA A;  4JAX A;  4FJN A;  4RG8 A;  3TAF A;  5AZJ A;  4JYA K;  1T6C A;  3F73 A;  4X66 K;  1CZA N;  1BCM A;  3KD5 E;  1XC3 A;  1D9F A;  1V4S A;  4CIF A;  4K8X A;  2X74 A;  4CVN E;  2GV9 A;  3M8P A;  3BP8 A;  1IG8 A;  3DJC A;  4H5R A;  4FZZ A;  5AQS A;  5AQW A;  4M3X A;  4FPA A;  3PSF A;  4KO0 A;  4PWD A;  3K2P A;  3AVK A;  4C8K A;  2OTL N;  2ZGY A;  4DHY A;  5BR9 A;  5JLF A;  3VQ6 A;  4NLC A;  4FSV A;  2BH1 A;  4AHR A;  1JKH A;  2Z1J A;  4CFC A;  3KD1 E;  1U6Z A;  3VEV A;  3ZX2 A;  3NFA A;  1D9D A;  1K8A O;  3AVA A;  2FBT A;  3C94 A;  1QQC A;  2HVI A;  4DSF A;  4M41 A;  1NNE A;  4JK9 A;  4C1N I;  4DB3 A;  1RT5 A;  4O5B A;  2XRI A;  3VA0 A;  1XI1 A;  1NK8 A;  2HHW A;  5E84 A;  3IMX A;  4YDU A;  3UKU A;  4IFE A;  2HB5 A;  2WUS A;  2XHB A;  1VRU A;  1SKW A;  2OPQ A;  2FBX A;  1OVY A;  2LSN A;  2B5J A;  1EQY A;  5FRN A;  3GG4 A;  1MDU B;  3JXU A;  1XNQ K;  4B3T K;  2W42 A;  5EX5 A;  1GLA G;  4CFB A;  4HTU A;  4WF9 L;  2EWS A;  3K0S A;  5I3U A;  1NBW A;  1U04 A;  1RNH A;  4QS8 A;  3LDQ A;  1FJG K;  3SJJ A;  1S5J A;  3B6P A;  1WSF A;  5AQG A;  1SKR A;  5M1O A;  4O55 A;  1DTT A;  1XHZ A;  1RTD A;  3VEZ A;  3V9S A;  2Q31 A;  5BPM A;  1S1W A;  1Y97 A;  2DFE A;  2HND A;  3VQ8 A;  3L6Q A;  1BCO A;  4DTP A;  2G8I A;  3AA5 X;  4ISE A;  3ZSW A;  3HJF A;  3VQC A;  1JL1 A;  3CF5 L;  4QCL A;  5CHI A;  1YTU A;  2RPI A;  5EOY A;  3HPH A;  4DSE A;  1BWF O;  3KJV A;  4KTQ A;  1CXU A;  1GLD G;  4H4M A;  3EO3 A;  1VQM N;  3MEC A;  4JKH A;  1HKG A;  3AVL A;  1Q9X A;  4Z4I A;  4EP4 A;  4OLB A;  2VGM A;  4CK2 A;  2HBK A;  4K8Z A;  3S3O A;  1EX4 A;  1VSJ A;  3AVI A;  5GAD P;  1RT2 A;  3L4Q A;  1TKT A;  1BU6 O;  4CGG A;  1ASW A;  5LMU K;  5M1F A;  1Z25 A;  2I7N A;  1E3M A;  4M3W A;  5M1Q A;  5JS1 A;  3H6E A;  5MLC Q;  5CE3 A;  1YAG A;  4WCE L;  2IOC A;  1LV5 A;  3QEP A;  2QWL A;  4HHT A;  1VQ5 N;  1TKX A;  1NMN A;  1RTJ A;  2F7T A;  5SWM A;  2BE2 A;  4NLB A;  4DF4 A;  4B8C A;  2HNZ A;  1FKP A;  4OPA A;  3MXI A;  4E89 A;  1N36 K;  3HOS A;  3TAM A;  3U6F A;  4EHU A;  3EE8 A;  1VQN N;  1BG3 A;  1FKO A;  1RDB A;  4W5R A;  5IT9 O;  3SAH A;  4E1J A;  1QE1 A;  4O0I A;  2O8C A;  4ID5 A;  2VQE K;  5CZ2 A;  3E9O A;  2HVH A;  1HJO A;  4IEI A;  3KZB A;  2G8V A;  1RFQ A;  4MQ3 A;  3SUN A;  1Z6R A;  4WFN L;  3HVR A;  4M3T A;  4KTW A;  3I8B A;  4MFB A;  3TPQ A;  4YOY A;  3EZ5 A;  3VGL A;  1IH7 A;  4W5O A;  4CGF A;  3O6W A;  4B08 A;  3QNO A;  4UY8 O;  3AO1 A;  2YNF A;  4ILJ A;  4BRG A;  3NGI A;  4DTR A;  4CBX A;  5M1K A;  5AQN A;  3DYA A;  3HTV A;  4CES A;  4H0X B;  4DLG A;  2QK9 A;  3K9J A;  3FZK A;  3LDS A;  4DSJ A;  4A2A A;  1TL3 A;  3B6O A;  2AJQ A;  4BR9 A;  3CCE N;  4Z0U A;  5C24 A;  2IDO A;  2DY4 A;  4FLV A;  3ULE A;  1JLG A;  1WSJ A;  2GWJ A;  3BZK A;  1XC9 A;  2V7Y A;  3FE1 A;  4IZ9 A;  2ETJ A;  4RW9 A;  3Q7B A;  3HL8 A;  3KVG A;  2DPN A;  4AHC A;  3KK1 A;  1YT3 A;  3ZX3 A;  1M1K O;  1BQN A;  3ZT1 A;  4IOC L;  4DSI A;  1K73 O;  4GV6 A;  4NXM K;  3CJ9 A;  3DXK B;  3OBW A;  4B1W B;  1RDC A;  3C95 A;  4IFY A;  3GBT A;  1C1A A;  5T7B A;  1NK9 A;  2ZWH A;  3TTC A;  1WOQ A;  4C8N A;  3SAG A;  5LJV A;  2O4G A;  4E7J A;  4O0J A;  4FJI A;  4H5N A;  3A8Y A;  4X65 K;  4C8L A;  2HHV A;  4C23 A;  1JJ2 M;  5AFU A;  3I8D A;  2IVN A;  4E1M A;  4KRF A;  4J8F A;  1QQO A;  1K9M O;  4JI1 K;  3THY B;  4MDB A;  3ZYY X;  4DU4 A;  4LFC K;  4KH4 A;  1BIU A;  5C12 A;  2F96 A;  2G8F A;  1NK6 A;  1BDG A;  1NJX A;  3QEW A;  3QIC A;  1UOC A;  5I9E B;  2O8E A;  4DSK A;  1B92 A;  1HLU A;  1B9D A;  4FJ7 A;  3DXM B;  2RKI A;  2ATQ A;  3PIO L;  3CJB A;  3OYE A;  1YJW N;  1G15 A;  3I56 N;  2I7P A;  3WNF A;  3A2F A;  3OYH A;  5FLX O;  1BHL A;  5GAH P;  3KLI A;  3FZL A;  1SL2 A;  4CZK A;  3VF4 A;  3SLC A;  1HYZ A;  4H0V B;  4B9M A;  3P31 A;  4DV7 K;  1S6Q A;  3VQQ A;  2NRZ A;  1JCG A;  2XY8 A;  4Y1D A;  4GMJ B;  4EP5 A;  2HW3 A;  2P9P B;  2B6A A;  1GOA A;  3U4L A;  2EHG A;  1IKY A;  4H0O A;  4LC9 B;  4JNE A;  2KW4 A;  2YNG A;  4XIU A;  3OS2 A;  3THW B;  5AJ3 K;  1VSK A;  4JKE A;  3O3F A;  3ZSY A;  4IOX A;  1RDW X;  4O5F A;  3CCR N;  3EZW A;  4IG0 A;  4BGA A;  5HRR A;  1RBV A;  4FZX C;  1FXX A;  4RW7 A;  5AQQ A;  3NHG A;  5AQP A;  3OYM A;  1EWR A;  1RBS A;  4CJF A;  3QES A;  2F8T A;  2FBY A;  1X9J A;  4KBO A;  3V1O A;  5FPE A;  1ZBF A;  4CEC A;  4K41 A;  5F0X A;  3RRG A;  3R8E A;  3ITH A;  1NLV A;  4JI7 K;  4U67 L;  1JXB A;  3LDP A;  2NUB A;  3RSE A;  4CF2 A;  1WSE A;  1ZBI A;  4BAC A;  4J2D A;  4DV6 K;  2E2N A;  5TKW A;  3ZT0 A;  4KHU A;  3RRH A;  1YIT N;  1GLL O;  4YOR A;  4BRL A;  1Q8I A;  1TL1 A;  4B9N A;  1T05 A;  4KPY A;  2WBN A;  4JKA A;  3KTQ A;  2YHX A;  2A1R A;  4JD2 A;  2QEX N;  4I2Q A;  2G8H A;  2W6K A;  5FDL A;  2NLX A;  4B3M K;  5D3G A;  5HRP A;  1P90 A;  4ISF A;  4CIE A;  2YHB A;  3K5N A;  4ZTF A;  4H0P A;  3I33 A;  1C0U A;  2KFN A;  1DKG D;  1VSI A;  1QSY A;  2JGU A;  3H3N O;  3SV4 A;  3K5O A;  5CYQ A;  2ZM6 K;  2Z1I A;  3A5M C;  4M42 A;  1WSH A;  3V9Z A;  1W0H A;  4AIL C;  2HHH K;  2FF6 A;  4BQL A;  3VPZ A;  3L4I A;  1NKE A;  2VWJ A;  2QW9 A;  4FPB A;  1NGH A;  4DFK A;  2E8A A;  5TKY A;  3JAM O;  4KHQ A;  5KTQ A;  4LFA K;  3EYZ A;  1Z26 A;  1ESV A;  1BL3 A;  3G6E N;  5E26 A;  1VQ7 N;  3L2R A;  1G99 A;  2OPS A;  4BDP A;  4Z4G A;  4TSX A;  4IJN A;  1NG9 A;  3MX5 A;  3O1W A;  5AQM A;  3T3F A;  4IO8 A;  2PY5 A;  2BTF A;  4KHY A;  4X64 K;  4FJM A;  4NYF A;  1N5Y A;  4X62 K;  2BUP A;  3NDK A;  5BRF A;  4BE2 A;  3VN5 A;  2GUI A;  2QTD A;  4FLX A;  4LFB K;  3K59 A;  3T1H K;  2KFZ A;  3VQB A;  2HF4 A;  3QEX A;  3A5O C;  4L3Q A;  1VRT A;  1WBB A;  2E20 A;  3L2Q A;  4KI4 A;  3SMP A;  4DU1 A;  3THX B;  3S9H A;  4DF8 A;  4B1V A;  3LM9 A;  1S1U A;  4CJQ A;  2YJE A;  4M7X A;  3OYD A;  3J8A A;  2P51 A;  1I94 K;  3OYL A;  3SQ0 A;  4F3O A;  1IV0 A;  2PYL A;  1QVF M;  3LP0 A;  3OTO K;  2Q0R A;  1J5E K;  5HBM A;  3FLC O;  1XMO K;  1RT7 A;  4JEP A;  1RBU A;  3MX2 A;  1HNX K;  5FRM A;  1CZB A;  4JKC A;  4JKG B;  4FJ9 A;  2NNW A;  3K58 A;  3QO9 A;  4DQQ A;  2XY5 A;  2KKZ A;  3R6M A;  3OS0 A;  1K8K B;  4N56 A;  1K8K A;  3CJ1 A;  1NGF A;  4CEE A;  1J5O A;  2E2Q A;  2IS3 A;  4CER A;  1HPM A;  1GLJ O;  3SMS A;  3E1Y A;  3C0B A;  3LM2 A;  4YOV A;  2NZT A;  3E9P A;  1ITG A;  1IKX A;  3IG1 A;  1RIL A;  2I5J A;  3PIP L;  5GIP A;  4YDU C;  5F2R A;  1VQ8 N;  4CZL A;  4PL8 A;  3QER A;  4NCG A;  4Z4H A;  1L5U A;  4E1N A;  1E4F T;  2HST A;  3H45 C;  1S9G A;  3OHR A;  4KHW A;  5J2P A;  3OYN A;  4CF9 A;  3SK3 A;  4XH4 A;  4M63 C;  5KQ8 A;  3T1Y K;  1KVC A;  1IBK K;  3M6G A;  3AY9 A;  1F21 A;  4FJ5 A;  1BIS A;  3S3M A;  5AZI A;  3IS9 A;  4M3Z A;  1JLC A;  4DKW A;  4GVM A;  1CLQ A;  4BC3 A;  2YJF A;  4DTM A;  2VWK A;  4DUZ K;  4K0K K;  3V4I A;  1YVN A;  3PX0 A;  2UUA K;  4W5Q A;  4NCB A;  4IFV A;  2Q97 A;  1SL0 A;  1KC8 O;  4B3S K;  4WQ4 A;  1ILY A;  3MN7 A;  1TYQ B;  4H5T A;  1TK5 A;  1NGE A;  1ASU A;  4AQY K;  3SNN A;  3QLH A;  1IJJ A;  3ZT2 A;  4DTO A;  4DG1 A;  5FPD A;  4J2A A;  5AQL A;  2JWK A;  1RDA A;  3CFO A;  5AQU A;  3WEE A;  2QWP A;  3RSE B;  4ILH A;  1Q82 O;  2IC3 A;  2HNY A;  2P9U A;  3SBT A;  4F8R A;  1YUW A;  1IG9 A;  4JI0 K;  1EP4 A;  3PO5 A;  2XY7 A;  5C10 A;  2Y1I A;  4FJK A;  1JLE A;  5JMV A;  3ZET B;  1VHX A;  3RVC A;  5AQZ A;  4MLH A;  3IAY A;  3O4W A;  2X6S A;  4WQ5 C;  2D5R A;  2PYJ A;  2UXD K;  1FK9 A;  3UE5 A;  4LF7 K;  3O3G A;  1S9E A;  3NMU A;  4IO9 L;  2QM1 A;  4OX9 K;  3SQ1 A;  3VQD A;  1HR0 K;  1NGG A;  1TV6 A;  3I0R A;  4B1U B;  4CF0 A;  3LAN A;  3O08 A;  3V1R A;  1NJZ A;  1X9W A;  2VQF K;  5HRS A;  3P4I A;  2F9T A;  4FWS A;  1NK7 A;  2YHA A;  3HP9 A;  4CEF A;  4B9U A;  3SQ2 A;  3PSI A;  4FO0 A;  5CR4 A;  5KGW A;  4M45 A;  2D4W A;  2P9P A;  3GL1 A;  4CEO A;  1WAF A;  3F2K A;  5JLH A;  1SL1 A;  2XY6 A;  1YJN N;  2PAV A;  5KPR A;  4FOI A;  4CZE A;  2R7Y A;  4HUG A;  1EWQ A;  4CJ4 A;  4Q0B A;  3AA2 A;  1X1P A;  3T7Z A;  3LWM A;  2P9L B;  3CME N;  3P38 A;  5BRE A;  2YNH A;  4B8A B;  2PBD A;  4KHN A;  3FGU A;  1U2V B;  1U2V A;  3ZSV A;  2QI2 A;  4IWV A;  2X6N A;  1NWK A;  4JI8 K;  1LCU A;  4DLE A;  4ELU A;  2VYP A;  2YCH A;  5AQF A;  3NBP A;  3AGR A;  3W3D A;  4IBN A;  2GWK A;  1KAZ A;  3AAQ A;  3FZM A;  3WNH A;  2D0O A;  3HST B;  3CI5 A;  4CE9 A;  4KI6 A;  1N33 K;  1T6D A;  4ZTJ A;  3VQP A;  4FWL A;  3QNN A;  4Y1C A;  1TUU A;  1WSI A;  4E7I A;  1P8Z A;  3KHY A;  3IRX A;  2E1Z A;  3BEX A;  4B9V A;  3AVM A;  2P5O A;  2ZJQ L;  2UUC K;  1ASV A;  2QKK A;  2A1S A;  2FSK A;  3WXI A;  4GY2 B;  4IOA L;  4OKJ A;  3F9K A;  4LF6 K;  3EKU A;  4FWO A;  4BC2 A;  3WQT A;  3LAK A;  2YHY A;  1IO2 A;  1YXQ A;  4JK7 A;  1LW0 A;  2V52 B;  3DXK A;  5BN9 A;  5BPL A;  2GX9 A;  1BA0 A;  3DLL L;  5AZJ B;  3AGK A;  4BRC A;  3VMF B;  3CPW M;  3BGR A;  3AA3 A;  3TAB A;  4CJR A;  2P9S A;  4Z4E A;  3TTF A;  5GIO A;  3G71 N;  4B9L A;  4AH9 A;  3D2F B;  2VCP A;  3L8B A;  3LWL A;  4E19 A;  2OZM A;  3PLA A;  1WSG A;  3NH2 A;  3QEI A;  4AM7 A;  2E4L A;  1RGI A;  1Q86 O;  3C6U A;  3D2E A;  4RW6 A;  4WQ5 A;  1JLQ A;  4OLA A;  1KXP A;  3WXL A;  4PA1 A;  4C8M A;  4BGB A;  4FWR A;  3SUQ A;  4QS9 A;  3ZEU B;  1R0A A;  3HOT A;  3O9S A;  4CED A;  3OW2 M;  5BR8 K;  5AQO A;  4LF5 K;  1HPZ A;  3WQU A;  3NF8 A;  4N76 A;  2HHX A;  3QIO A;  3VEN A;  4O44 A;  2UXB K;  1VSL A;  3KIO A;  2KHO A;  4CI6 A;  4BWJ A;  4JS4 A;  2YNI A;  4O4G A;  3HPO A;  4DR7 K;  5HRN A;  4I9Q A;  3SYZ A;  3EY1 A;  3EEQ A;  1DTQ A;  2OAN A; 
#chains in the Genus database with same CATH homology
 5HL7 L;  5FPE A;  1MWM A;  1XUP O;  3MMV A;  1RDU A;  3IDH A;  4PHT X;  3DWL A;  3WXK A;  4K41 A;  5LY3 A;  5F0X A;  2QA4 N;  4PKI A;  3VTH A;  3MN9 A;  4CZM A;  4GNI A;  1VQ6 N;  1LOT B;  3R8E A;  4WYB A;  1NLV A;  5ADX A;  4FVU A;  5ADX H;  4U67 L;  3LDP A;  1BA1 A;  3HI0 A;  4FWQ A;  3CJ7 A;  1VQK N;  3O1B A;  3RSE A;  3ENO A;  4A61 A;  1TUY A;  1JCF A;  3BF1 A;  1QZ6 A;  1T3V A;  5DM7 L;  4BVO A;  2ASP A;  3CQX A;  3MWP A;  1EO1 A;  3I55 N;  3W0L A;  3LDN A;  3J7Z O;  3CCQ N;  2CGK A;  4BR4 A;  2E2N A;  5TKW A;  2H3G X;  2A5X A;  1YIT N;  4BC5 A;  1GLL O;  4YOR A;  4BRL A;  4GV9 A;  3CER A;  5AQR A;  2A6A A;  1K9M O;  3ZET A;  4H5W A;  4CBU A;  2NRW A;  4RWT A;  3ENB A;  2NRV A;  4KH5 A;  2ITM A;  2E88 A;  2WBN A;  2HOE A;  3LDL A;  1KAX A;  4JKA A;  3QFU A;  4YOW A;  2YHX A;  4JD2 B;  4JD2 A;  2QEX N;  1KAY A;  4K42 A;  2AA4 A;  4Y0W A;  3JS6 A;  4AF1 A;  3EKS A;  2NLX A;  4BQZ A;  1H1V A;  3ZEU A;  1P90 A;  1QZ5 A;  4FWP A;  4ISF A;  3D2F A;  4BRD A;  2IIR A;  3HBT A;  2FLO A;  1SAZ A;  4H0P A;  1MA9 B;  3I33 A;  4JHD B;  3QDK A;  1DKG D;  3LL3 A;  5AQH A;  5AQT A;  2WC9 A;  3WEE B;  3GE1 A;  3H3N O;  2J4R A;  4CD3 A;  5BRH A;  3SAF A;  1YJ9 N;  4IXC A;  4PL7 A;  1WUA A;  3VGM A;  4PKH A;  4IDH A;  3A5M C;  3QBX A;  5BPN A;  1VQ4 N;  1ATR A;  1NGB A;  1VQP N;  2P9K A;  5KPZ A;  5C2D A;  4A5A A;  3H46 O;  2FF6 A;  5JIC A;  4BQL A;  3VPZ A;  3HSC A;  3L4I A;  1ZXO A;  2QW9 A;  4FPB A;  1NGH A;  2CGL A;  2VWB A;  4BR7 A;  3BF3 A;  5GAG P;  1MWK A;  4BY9 C;  2E8A A;  2QWR A;  3K9K A;  5HOO A;  5TKY A;  1NGD A;  2JWL A;  1BUP A;  1S22 A;  1QQM A;  3S41 A;  3VTI A;  4JAX A;  3TU5 A;  1ESV A;  4K43 A;  3G6E N;  3CQY A;  5E26 A;  1T6C A;  4NO7 A;  5AZJ A;  1G99 A;  3WXJ A;  4EIA A;  1VQ7 N;  1YIJ N;  4IJN A;  1CZA N;  1Q81 O;  4EAH D;  3MX5 A;  1XC3 A;  1V4S A;  3O1W A;  2CH5 A;  1S3X A;  5AQM A;  4IO8 A;  4JHD A;  2BTF A;  2A41 A;  3BP8 A;  1IG8 A;  3DJC A;  4H5R A;  1Q7Y O;  5AQS A;  5AQW A;  2CH6 A;  3VES A;  2BUP A;  3L0Q A;  4FPA A;  3Q7C A;  5BRF A;  3QB0 A;  3LDO A;  4BRO A;  2QTD A;  4ISG A;  2HBM A;  5C0Y A;  2OTL N;  4OO1 J;  3UKR B;  2HF4 A;  2ZGY A;  4A57 A;  3A5O C;  4DHY A;  5BR9 A;  4L3Q A;  5JLF A;  1ATN A;  4NLC A;  4FSV A;  1NGI A;  2E20 A;  2KLA A;  3ENH A;  5DM6 L;  3SMP A;  3UKU B;  2BH1 A;  1QQN A;  3R9P A;  3ATV A;  1R59 O;  3VET A;  4B1V A;  3LM9 A;  3ID6 A;  3CCU N;  1U6Z A;  4CJ7 A;  2E1Y A;  2Q36 A;  2YJE A;  4M7X A;  3VEV A;  3ZX2 A;  2P9N B;  4BR2 A;  3J8A A;  4BRM A;  2OTJ N;  4BRF A;  1K8A O;  3O9Q A;  1QVF M;  1SQK A;  4H5V A;  3A0I X;  2Q0R A;  4AM6 A;  5B8H A;  4JK9 A;  4BRP A;  3R3L A;  3E9L A;  5EXW A;  1HUX A;  3FLC O;  4C1N I;  3GDQ A;  4DB3 A;  4JEP A;  3MX2 A;  3QBW A;  4FWK A;  5KQD A;  4JKC A;  4JKG B;  2D0P A;  3IMX A;  5E84 A;  4YDU A;  2NNW A;  1OKJ A;  3F9M A;  3UKU A;  4DQ8 A;  4IFE A;  2IVP A;  2WUS A;  2KKZ A;  3R6M A;  1DT9 A;  1K8K B;  1K8K A;  3MN6 A;  3CJ1 A;  1NGF A;  2Q2R A;  3N4Q A;  1SZ2 A;  2E2Q A;  1OVY A;  1EQY A;  1HPM A;  3CHW A;  1GLJ O;  3OA9 A;  3SMS A;  3E1Y A;  1MDU B;  3GG4 A;  3C0B A;  3LM2 A;  2HBL A;  4A5B A;  1SS6 A;  3MCA B;  3JXU A;  4YOV A;  2A42 A;  2NZT A;  3E9P A;  4CZH A;  4XEI A;  5EX5 A;  1Y64 A;  1GLA G;  3QFP A;  3MWT A;  4BRH A;  4WF9 L;  2EWS A;  1VQL N;  3CCL N;  3FZH A;  3VF2 A;  3PIP L;  1NBW A;  5GIP A;  4YDU C;  4NB4 A;  3VEW A;  2V51 B;  4QS8 A;  3LDQ A;  3TSP A;  5F2R A;  1VQ8 N;  4CZL A;  4PL8 A;  2YHW A;  5AQG A;  3M5R A;  5M1O A;  4C1N K;  3O9R A;  1E4F T;  3WUH A;  1YHQ N;  2HST A;  3H45 C;  4O8U A;  4JKG A;  3VEZ A;  2Q31 A;  3G4S N;  5BPM A;  3OHR A;  2CGJ A;  4EHT A;  5AR0 A;  3SK3 A;  4BVP A;  3CMA N;  4XH4 A;  4M63 C;  3HRG A;  3L6Q A;  5KQ8 A;  3AAR A;  5M1N A;  1HKB A;  1W97 L;  3M6G A;  3AY9 A;  4ISE A;  3CF5 L;  5AQI A;  5CHI A;  5AZI A;  4GV3 A;  5EOY A;  4DKW A;  1BWF O;  4BC3 A;  5C15 A;  2YJF A;  2RHK A;  3P39 A;  4PKG A;  1GLD G;  4H0Y B;  1NMD A;  1QHA A;  3EO3 A;  1VQO N;  3CD6 N;  1VQM N;  4JKH A;  1HKG A;  4K25 A;  1GLB G;  1YVN A;  5AQX A;  2VGM A;  3WT0 A;  2AP1 A;  2HBK A;  2Q97 A;  2HMP A;  4BRQ A;  1KC8 O;  1Q18 A;  1V4T A;  2ZJP L;  4G9Z A;  4WQ4 A;  1ILY A;  3VEY A;  1BO5 O;  3MN7 A;  5GAD P;  1NGC A;  1TYQ B;  3SBG A;  4H5T A;  3L4Q A;  3O9U A;  1BU6 O;  3N4P A;  1NGE A;  4CD1 A;  3UB5 A;  1KD1 O;  5M1F A;  4M7Y A;  2I7N A;  1IJJ A;  5AQV A;  5M1Q A;  4F9O A;  1ATS A;  5FPD A;  3C7N B;  5AQL A;  2WFB A;  3H6E A;  2JWK A;  5BRD A;  5MLC Q;  1NM1 A;  4A59 A;  5CE3 A;  2QWM A;  1YAG A;  5EY4 A;  4WCE L;  3B8A X;  4JKF A;  5AQU A;  5JVH L;  3WEE A;  2QWL A;  1VQ5 N;  3MCP A;  1ZC6 A;  2QWP A;  4B1Y B;  4HWI A;  3RSE B;  2F7T A;  4ILH A;  4BRI A;  5F1X A;  1Q82 O;  2P9U A;  4I6M A;  3SBT A;  1C0G A;  4NLB A;  3KK7 A;  1YUW A;  3EL2 A;  4OPA A;  2ZF5 O;  3G25 A;  5M1P A;  5C10 A;  3HOS A;  1VQ9 N;  3VOV A;  3D7E O;  3CCJ N;  4EHU A;  3EE8 A;  1HX1 A;  5JMV A;  4O8K A;  3ZET B;  1VQN N;  3RVC A;  3CJA A;  1BG3 A;  4BRA A;  5AQZ A;  4DCH A;  3VGK A;  2UYT A;  4MLH A;  3O4W A;  4E1J A;  2P9I B;  1O13 A;  4WQ5 C;  3SAH A;  4YOX A;  3HZ6 A;  3VEO A;  2F9W A;  5AZI B;  3E9O A;  4BG8 A;  3IKM A;  2GUP A;  4CZJ A;  3C6A A;  1HJO A;  3UE5 A;  4B9Q A;  3NMU A;  4IEI A;  3KZB A;  3QML A;  4IO9 L;  4QS7 A;  1RFQ A;  2QM1 A;  1C0F A;  4XH5 A;  4CZI A;  1Z6R A;  2HF3 A;  4WFN L;  3I8B A;  4YOY A;  3TPQ A;  1NGG A;  3VGL A;  4B1U B;  1N8R O;  3O08 A;  4HTL A;  1KQS M;  4RTF D;  3MDQ A;  4BG9 A;  3O6W A;  1GLF O;  3IFR A;  1GLC G;  3P4I A;  2F9T A;  2A3Z A;  4FWS A;  3U8X A;  4CZG A;  1T44 A;  4UY8 O;  3F5T A;  4ILJ A;  3UKR A;  4BRG A;  5FPM A;  3SJH A;  4FO0 A;  5CR4 A;  3EE9 A;  3CC7 N;  4CBX A;  5M1K A;  5LJW A;  5AQN A;  2D4W A;  2P9P A;  3HTV A;  4H0X B;  3GL1 A;  4JK8 A;  4WQ4 C;  4YOU A;  2GEL A;  2RE2 A;  3K9J A;  3H3O B;  4YOT A;  3CET A;  3FZK A;  3T69 A;  3F2K A;  3IUC A;  4BR5 A;  5JLH A;  4A2A A;  5ELZ A;  4BR9 A;  3A5N C;  2PFU A;  1YJN N;  2PAV A;  3CCE N;  5KPR A;  4FOI A;  1Z05 A;  4CZE A;  4U7B A;  3T7Z A;  5AQJ A;  1E4G T;  3O5B A;  4MLE A;  4IJA A;  2P9L B;  3ULE A;  2GWJ A;  3CME N;  3H1Q A;  3P38 A;  4A62 A;  5BRE A;  2V7Y A;  3FE1 A;  4IZ9 A;  2PBD A;  2NRR A;  3FGU A;  5EVZ A;  1U2V B;  2ZJR L;  1U2V A;  4OPH A;  5FPN A;  3Q7B A;  3KVG A;  4JKB A;  2DPN A;  3U9Z A;  3A5L C;  4IEE A;  2QI2 A;  3ZX3 A;  4B1X B;  1M1K O;  4IWV A;  2FSN A;  4WFA L;  4IOC L;  1NWK A;  2W40 A;  3CIP A;  1YI2 N;  3FZF A;  1K73 O;  1LCU A;  2ZGZ A;  2D1K A;  3ATU A;  4A2B A;  2VYP A;  5BN8 A;  1DGK N;  2QWQ A;  2YCH A;  4GV6 A;  3DXK B;  3CJ9 A;  1GLE G;  3O8M A;  3FFK B;  2P9I A;  3OBW A;  5AQF A;  4B1W B;  3CC4 N;  4Z94 A;  2E2P A;  3AGR A;  3W3D A;  1QVG M;  2GWK A;  1KAZ A;  3AAQ A;  3FZM A;  2D0O A;  3GBT A;  2NRT A;  3C6H A;  3CI5 A;  1YF5 L;  2QWO A;  3C7N A;  2Q1N A;  1JCE A;  2ZWH A;  4MDA A;  1T6D A;  3C65 A;  1WOQ A;  3H1V X;  3TTC A;  4BC4 A;  4FWL A;  5AQY A;  5LJV A;  3SAG A;  1TUU A;  3NVK A;  2FF3 B;  3CXC M;  1P8Z A;  3KHY A;  2E1Z A;  3BEX A;  4H5N A;  3A8Y A;  3NVM A;  2FXU A;  3MK6 A;  4I6M B;  4C23 A;  2ZJQ L;  5AFU A;  4FL9 A;  1JJ2 M;  2QWN A;  2P9S B;  3CCM N;  3DXM A;  2FSK A;  3WXI A;  3CPE A;  4GY2 B;  2IVN A;  3VER A;  4IOA L;  3AAP A;  5GIN A;  4J8F A;  1QQO A;  1J6Z A;  3EKU A;  4FWO A;  1X3N A;  2QXL A;  3EN9 A;  4JKD A;  3WQT A;  3E66 A;  4MDB A;  3ZYY X;  3TTD A;  4BC2 A;  2YHY A;  3BUZ B;  4KH4 A;  5C12 A;  4BRN A;  2NRX A;  1BDG A;  2VGN A;  1YXQ A;  3KWG A;  4JK7 A;  3CCS N;  2V52 B;  3DXK A;  5BN9 A;  2P9N A;  3D2E B;  5BPL A;  3QIC A;  1NGJ A;  2GX9 A;  1BA0 A;  3VEX A;  5I9E B;  3DAW A;  3AGK A;  5AZJ B;  4BRC A;  1HLU A;  4CBW A;  3VMF B;  3DLL L;  2V7Z A;  4FWN A;  3CPW M;  5AFU H;  2W41 A;  2GEM A;  4EFH A;  1DEJ A;  4MO5 A;  1XQS C;  4WFB L;  1NGA A;  1ZBS A;  2P9S A;  3DXM B;  3TTF A;  5GIO A;  3G71 N;  3PIO L;  3D2F B;  3KWI A;  2VCP A;  5AQK A;  3CJB A;  1YJW N;  4BR0 A;  3I56 N;  1BOT O;  2I7P A;  5C2F A;  2HBJ A;  3CCV N;  1M90 O;  2A40 A;  4BRK A;  2ASM A;  3OBY A;  3PLA A;  2GTD A;  3VF6 A;  3WXM B;  3O80 A;  1X3M A;  2Q0U A;  5GAH P;  2P9U B;  3FZL A;  3CJC A;  4AM7 A;  4CZK A;  3M1F A;  3GOI A;  3TSQ A;  3VF4 A;  1RGI A;  3U9D A;  3SLC A;  2ASO A;  3D2E A;  4FWM A;  1Q86 O;  2YI1 A;  4H0V B;  4ILG B;  1W2B M;  4WQ5 A;  4B1Z A;  3P31 A;  3CC2 N;  3HM8 A;  5KPT A;  3TSU A;  2NRZ A;  1KXP A;  1JCG A;  3WXL A;  4CZF A;  5JVG L;  1NJI O;  1VAZ A;  5GAE P;  4GVE A;  2IVO A;  2FSJ A;  4BGB A;  4MO4 A;  4FWR A;  4BRE A;  2P9P B;  4QS9 A;  3ZEU B;  1HKC A;  3FR0 A;  3R1X A;  3U4L A;  4R79 A;  1TYQ A;  3HOT A;  3ZX0 A;  3O9S A;  3D6R A;  4H0T B;  4H0O A;  4LC9 B;  4JNE A;  3OW2 M;  5AQO A;  4RCH A;  2E2O A;  3WQU A;  3MN5 A;  3VEN A;  4KH6 A;  2P9L A;  4JKE A;  3ULE B;  5H1S Q;  4IOX A;  1RDW X;  3O9T A;  4O5F A;  2YX6 A;  2P9K B;  3CCR N;  4JN4 A;  3EZW A;  2KHO A;  4CI6 A;  2NRH A;  4BGA A;  3M3Z A;  1D4X A;  5AQQ A;  5AQP A;  3ID8 A;  1S72 N;  4FOE A;  2OAN A;  1X9J A;  4XH1 A;  4KBO A;  4H03 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...