1BQNA

Tyr 188 leu hiv-1 rt/hby 097
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPQKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNQQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords REVERSE TRANSCRIPTASE
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 114
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqnA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqnA05
4E7HA 3QLHB 3SQ2A 1T03A 2I5JA 1VSFA 4FYDA 3RAQA 1GOBA 3QEPA 2XWYA 1YT3A 4KFBB 4KO0A 4XPEA 3HK2A 2R8IA 4K50A 1SL1A 2J6UA 3DOLA 3ZSXA 4I2PB 3O3HA 3I5AA 1VSJA 2XI2A 4DFPA 5EDWA 3AVNA 3ASMA 4BDZA 2B6AB 4F4WA 2AQ4A 1WSGA 4F2RA 3CQ8A 3QZ8A 5HRSA 4YR0A 4WXWA 2EHGA 1S48A 3NL0A 1U45A 5KFSA 3LP2B 3SPYA 1BQMA 5J2NB 2V0NA 4O3OA 3DLKB 4MIAA 1IKYA 4ELVA 1RT2A 4L8RB 4ZPBA 3LALA 4WXOA 3DRSB 4DTRA 2E9ZA 4YMEA 4ECRA 2CJQA 3H5XA 1IKWA 3NAEA 3BQ1A 2HVIA 4DLGA 4MK8A 4K4SA 4Q8EA 4RNHA 4N5SA 3HP6A 2YNGA 4B9UA 3PZPA 3L8BA 3KLHB 4IRCA 4B9LA 2UVRA 4O4GB 3CYMA 3VQPA 4DL7A 2JEIA 1RAJA 3KK3A 3I5CA 3QNOA 4J9NA 3PO5A 1JLCA 3VQBA 4FZZA 1RYSA 1S49A 3HVWA 2Z1IA 3EZUA 1O1WA 3CJ0A 3SV3A 4CGDA 1Z26A 4KI6A 2AX0A 4RW6B 1IKVA 4RUAA 3HSTB 4MKAA 3IRXA 3OL8A 4FM0A 3O4QA 2OPPB 1EKEA 1ZBFA 1RBUA 1IKXB 4FS2A 3HHKA 2ASDA 4M41A 1T8EA 2YHAA 3L3VA 1S5JA 4DF8A 3HL8A 2UVWA 4M45A 4DU4A 3NDKA 1DTTB 3DRPA 1UA0A 4NZ0A 3H40A 4M95A 1SKSA 1LW0A 3OLBA 1KTQA 2HNZB 2XY8A 5F8NA 5KFQA 5CZ1A 2IC3B 4ZP9A 3SYZA 4N41A 2HWIA 3U6FA 2R8KA 1S9EB 2HHWA 5J1EA 2XY7A 1ZTTA 4KREA 3V9ZA 1HJRA 1LWCA 3V81A 3NGDA 1EXQA 2OZSA 4TY9A 2WRMA 3EZ5A 1S0MA 3RB6A 2QKKA 2Z1HA 1LAVA 3M9OB 1VSDA 2RDIA 2PZSA 1RBRA 1HNIB 1ZYQA 2GC8A 4MH8A 4ICLA 4AH9A 3KK2B 4C8KA 5L1KA 4NLDA 3OHAA 2ZE2B 3DI6A 4QPXA 1D8YA 4ECWA 5KT4A 3QO9A 3IG1A 4E7JA 5L9XA 4QOZB 2OPRB 3KLFB 3SZ2A 2HHXA 1JXBA 5KFEA 4Y3CA 4W5TA 4FW1A 3H59A 4CECA 4PUOA 3NF9A 1DTQA 5F8IA 3RRHA 3E01A 5FRNA 4DTJA 4FJGA 4TY8A 4CJFA 2PYLA 1RT7B 4ED8A 5L1LA 3ZT3A 1B92A 3OYHA 3K5MA 1TKTB 2YNFA 2E4LA 1QS4A 3PJWA 5HRNA 2ASJA 2HNYA 3RAXA 4OPJA 4OLBA 2IDOA 4F50A 5C25A 3OYJA 3FFIA 3SI8A 1VRUB 2R2RA 4ECYA 2FLPA 2AWZA 2G8WA 4XIUA 3TVKA 4EZ9A 3LWMA 1K1SA 2XI3A 1K6YA 4Z0UA 3MR2A 3KMSA 3LP0A 4Y34A 3CJ4A 1WAJA 3LPTA 2FVSA 1NOZA 2BANB 3ZT4A 3OL6A 1NK6A 1S1XA 4M3WA 3AVBA 2WK4A 4Q8FA 3GIMA 1BI4B 4QWBA 2O4GA 2XY6A 3TQ1A 2ETJA 4CHNA 1WSFA 4AHSA 4J2EA 5F8GA 4E7LA 4YFUA 4DS4A 4MQ3A 3RR8A 4MFBB 3AVMA 5FDLA 4M3TA 4M94A 3NCIA 1NK9A 5EWFA 2YNHA 3V6JA 3TABA 1EETA 1ASUA 3QZ7A 4EZ6A 3I0RA 1WN7A 4XPCA 4KTQA 4WE1B 4KKOA 4E1NA 3SUNA 5HROB 3MR5A 1C0TA 4DL4A 3MECA 4CF2A 3CDWA 1SKWA 1D5AA 1B9DA 2HNDA 4C8OA 4DQPA 2OH2A 4F4YA 4HTUA 4IKFA 4E3SA 3SUOA 4PQUB 5KFUA 1XHZA 3PVXA 2W8LA 4O3RA 5KRSA 3JSMA 5KT2A 3G86A 5KG7A 4TQRA 1RBVA 2O4IA 3QLHA 4FS1A 5FRMA 1C1CA 3QIOA 1JLFB 2XY5A 4KFBA 3QEXA 2IJNA 4HHTA 3RMDA 4I2QB 4DSKA 4EP4A 4TXSA 5KG3A 4DFMA 1KHVA 3OSPA 4F8RA 4DQQA 5KG2A 1IG9A 3ZSVA 4ID5B 1Z4UA 2HHUA 3K5LA 2B6AA 2W42A 3G10A 3V6DB 1RYRA 1X1PA 1YVFA 4DQSA 4GC7A 4K8XA 2VG6A 4YR3A 5CYQB 2HAIA 3LP2A 5EWGA 5J2PB 3L2QA 2EX3A 5J2NA 1RBSA 4FVMA 3DLKA 4KHNA 4B8CA 4WYLA 1A5VA 3DRSA 3BSAA 4WZQA 4NLRA 1VSEA 3T1AA 4IFVB 4CCHA 4LY7A 3C6TB 3GV5B 4M3RA 5CYMB 3ZSQA 4RW7B 4O5BA 3ICLA 4NCGB 5KFCA 2ZD1B 3FDSA 3RMBA 4EBDA 1BHLA 4TQSA 3LAMA 1BCOA 1RTHB 1JLBB 3KLHA 4IDKB 4O4GA 1NKCA 2FBYA 3V9UA 2UUWA 4URQU 3PHEA 1FK9B 1RDRA 3HO1A 3Q8RB 4DL2A 2EC0A 3AVIA 1HMVB 2UVUA 3ALYA 2DFEA 4ZTFA 3WNEA 1TGOA 4FM2A 4B9VA 2V9WA 4RW6A 4DSLA 4FLTA 2HHQA 4KE5A 3AA5X 5DQGA 3DM2B 1TV6B 2W8KA 4J9QA 3SQ4A 4RW4B 4IG0B 2KQ2A 1CLQA 3VQEA 2OPPA 3IGVA 4Y1CA 3K5OA 4CJSA 1IKXA 2OA8A 2BRKA 2C28A 3G0ZA 4O44B 1S1TB 5KFIA 3T5HA 1WSEA 4KB0A 2WCXA 4KAIA 5KFOA 2AJQA 1SUQB 5KT3A 1DTTA 5J2QB 5KRTA 4FLXA 4RW8B 2AGQA 2HNZA 4ZVFA 1TKDA 4C8NA 4ID1A 4JRQA 2FBTA 1Q9YA 1S9EA 3IN5A 4W5RA 5CZ2A 3BJYA 3SV4A 4LH4A 3SFUA 3KMQA 3ISND 4OGEA 4AHCA 4Q43A 3F73A 4G1QB 4O3PA 2Q3SA 4C8LA 4IFYB 1ZETA 5EUHA 2GIRA 4ZVGA 3OSNA 4CJWA 4CF9A 2R8HA 1HNIA 2CKWA 1J9AA 1S1UA 4QWAA 3KK2A 3OYGA 2XO7A 2X6SA 1EX4A 5JUMA 2WTFA 3NAIA 4YP3A 1HQEB 4ED1A 2OPRA 3KLFA 1JKHA 4HCCA 4GMJB 1L5UA 4H4MB 2G8VA 2YHBA 3UR0A 4URGA 2HWHA 1ZBUA 3CWJA 1TVRA 4CHYA 3M8PB 2F8SA 2OPQB 1BCMA 4FZYA 3TANA 4G3IA 1RT7A 1EP4A 3LZJA 4ZHRB 1TKTA 1ITGA 4N56A 4ZPCA 4RNOA 3BQ2A 2BQ3A 3HVTB 1T7PA 2W7PA 3NE6A 3PW7A 1X9MA 5KFZA 4IQXA 2IAJA 3MAQA 1VRUA 1NK0A 2PY5A 4ECQA 1KRPA 1IH7A 3DYAB 3PW0A 3MFIA 3B6PA 2GUIA 2YV0X 4JS5A 4B9TA 5KFFA 1HYZA 1RT3B 3VQQA 1YVUA 4DL6A 2GBZA 2YNIB 3MF5A 1F21A 3LANA 2BANA 3AVFA 1D1UA 1UAXA 1C1AA 3OJSA 5KFXA 3OJUA 3H5SA 4O0JA 1BI4A 1TL3B 1C0UB 4R5PB 3MXJA 1WSHA 3CO9A 1BQNB 1NK5A 3MEDB 1CZBA 1RBTA 5JS2A 4KSEB 2GIQA 5KFKA 1HYSB 4EO6A 1RDAA 3ZSYA 4WFXA 4MFBA 4DSIA 1JLQB 3C95A 5I3UB 1ZTWA 5KTQA 4OKEA 1JXEA 4ED2A 2Z1GA 3AVKA 3NGIA 3RWUA 3ISNC 1J5OB 3T5JA 4FJ9A 1TP7A 1WNEA 1WLJA 2JEFA 5HP1B 4CJPA 1FKPB 1RT4B 3V4IA 4WE1A 1RA7A 3HT3A 2BE2B 5HROA 5F8JA 3BDPA 1JLEB 1SH2A 4PWDB 1C1BB 3QNNA 1T05A 2JGUA 1XHXA 4OVLA 3OHBA 1KFSA 2HHSA 5CY4A 4CK2A 3BQ0A 5K14A 4IOBA 4ECUA 3PV8A 5KFJA 4ECSA 4QWCA 3KJVB 3OYKA 3SFGA 3ZSRA 2RDJA 4DTNA 1JLFA 2F8TA 4FK2A 1S6PA 3U3YA 3QGGA 3UQSA 2JEGA 3AVHA 1IM4A 4FBUA 4I2QA 4O55A 3CVKA 3GIIA 3QESA 4CK3A 1RA6A 3M8RA 4ID5A 4B8AB 1NOYA 3I0SB 1OS5A 4J9MA 3V6DA 4CERA 1XWLA 1QAIA 3PX6A 1D9DA 4MK7A 4RU9A 5CYQA 1WSIA 3LP3A 3CM5A 1VSHA 1VSLA 3DMJB 3RMAA 3TAQA 3VQDA 5KFWA 1CZ9A 3RRGA 3OYMA 3HVRA 5DK5A 3H98A 3HJFA 3WNGA 1UOCA 3DLRA 4EP5A 1XC9A 4IFVA 1RCHA 2VWJA 3C6TA 5CYMA 2FBXA 3LPUA 3LP1B 3ZT1A 4RW7A 4NCGA 2ZD1A 3SJJA 4K4YA 4JRPA 3KHGA 4O3SA 4FW2A 1RTHA 1JLBA 4IDKA 3MEGB 2VA3A 4CF8A 2BGGA 1LW2B 1HNVB 3GQCA 4EEYA 1FK9A 1DLOB 1VSKA 4KB7A 4F4KA 5DLGA 2AU0A 3KTQA 3H5YA 1HMVA 4JV1A 4FJXA 2KTQA 1JIHA 1L3TA 3JYTB 3PO4A 4MKBA 2G8IA 4IKAA 4AHUA 1RDCA 5F9LA 5HRRA 3DM2A 4QWEA 4FK0A 4RW4A 4IG0A 3V6KA 1RT1B 1S1WB 2KW4A 4BE1A 5KT6A 3KHRA 2VA2A 1G15A 4DLEA 4O0IA 2HB5A 4ZTJA 1S6QB 4O44A 1S1TA 3LAKA 1S0OA 1U49A 4J2BA 4ZVEA 4NLQA 4ELTA 4OJRA 4NCAA 3HM9A 3S3OA 1SUQA 5J2QA 1HQUB 4BWJA 3DLHA 4RG8A 4RW8A 3UIQA 2RKIB 4FJLA 1QQCA 1ZBHA 4NLYA 3CIZA 2LSNA 1QAJA 3PY8A 3AVLA 4CHPA 1I6JA 3NGZA 2NUBA 2E6MA 2A1RA 4Y2CA 4ED6A 2IBKA 4XO0A 4CIFA 3V1QA 3I8DA 1BGXT 1QE1B 4G1QA 3AVAA 1YTUA 3L2VA 5KI6A 3NF7A 4CGHA 4TYAA 1RT5A 3GV8B 5C42A 4KHUA 3KLIB 4YQWA 1JLGA 1VSMA 4EBEA 2VG5B 5KFRA 3O3GA 2I5JB 2GV9A 1X9SA 3UPFA 4NLSA 1MU2A 4O4RA 1HQEA 5KFDA 3KKSA 2RN2A 4H4OB 5F9NA 4CGJA 2R2SA 2F8EX 4JLHA 3N6MA 5DG8A 5C5JA 3CG7A 4H4MA 3B6OA 3KLEA 2WHOA 4DFKA 4TYBA 4NRTA 5KFAA 4OL8A 3CDUA 4CFDA 1J54A 4IRDA 1RTIA 3QIDA 3M8PA 2OPQA 1QTMA 4F4ZA 1NK7A 4KBIA 4ZHRA 4FJJA 3KD5E 1NHUA 4EBCA 5DLFA 4I9LA 2ALZA 4CE9A 2W9CB 1WNSA 5KFPA 1K1QA 1HPZB 1IKYB 1SV5B 4DG1B 3HVTA 4DWIA 4DMNA 5KFTA 3NF6A 4E1MA 3D0PA 4CHQA 3PR4A 3KK1B 3SPZA 4CGGA 2BRLA 4F3OA 4FLWA 3S3NA 4W5NA 3WNFA 5KG1A 4ELUA 3DYAA 3VQSA 1KVBA 1VK0A 2JC0A 2FVPA 2IM1A 4J9SA 3NMAA 3QEVA 1RT3A 1N56A 1ASWA 2B43A 3VA3A 1LWFB 2YNIA 1JLCB 2WB4A 3MFHA 1GX5A 4FJHA 4ZPDA 4B08A 3SNNA 4Q44A 4JUZA 4I2PA 1TL3A 1C0UA 4R5PA 4CIEA 2O5DA 2KFNA 1BQNA 4M3XA 3MEDA 4WZMA 2VG7B 3ZSZA 3QINA 1QSYA 2ATQA 1HYSA 2YKMB 5F8HA 3DLBA 2FLNA 3NBPB 4TN2A 3IS9B 1JLQA 1LWEB 1N5YB 1BISA 5I3UA 3OL7A 4Z4HA 4KPYA 3QETA 3CDEA 4DTUA 2OZMA 4QWDA 1J5OA 3O4NA 2IOCA 2ZKUA 3GIKA 3HKWA 4KI4A 3N6NA 1FKPA 1RT4A 3PUFA 2BE2A 2XC9A 4CESA 3NH2A 4R0EA 2IM3A 4E7IA 3THVA 4CEFA 4BDPA 4F4XA 1JLEA 1TKZB 2ILZA 3TAMB 5KT5A 1TK5A 4PWDA 3QERA 1C1BA 3C6UB 4NRUA 2C22A 3IAYA 4ECXA 4RW9B 1NJZA 4LH5A 1ASVA 2Z1JA 1LWCB 1RTDB 1CSJA 3P5JA 1X9WA 1ZBIA 4IH6A 2IMWP 4E89A 3NHGA 4FJMA 3EPGA 3Q8PB 3MXIA 4WFYA 3MR3A 4ICLB 3CFOA 3KJVA 4EYHB 4ZVHA 1UA1A 1FKOB 4I9QA 4N47A 1N4LA 4HUFA 3QIPB 3ZT2A 1RDDA 3CFRA 3OYLA 1GX6A 3HP9A 2WOMB 3L2WA 3H4DA 3CJ2A 5KG0A 4NCBA 4O3QA 4Z4CA 4LSNB 1A5WA 1C0MA 4ECVA 1Y97A 4CEBA 3TAGA 2DPIA 3DMJA 1NK8A 1KLMB 4E0DA 4PY5A 2YNFB 5SZTA 2IC3A 5DG7A 4CFAA 4CF1A 3HPOA 1YTAA 1RTJB 4DEZA 4CEAA 4PA1A 4FLVA 3LP1A 4B9NA 5KFGA 4CJ4A 4DTXA 3OYCA 4RNFA 1S9GB 3DLEB 2IM2A 4IBNA 3KKRA 4CGIA 4OLAA 3MEGA 3F9KA 3DOKB 3VQCA 3M9NB 1LW2A 1HNVA 4CK1A 1DLOA 2ZE2A 3LP0B 3EPIA 1QSSA 2G8UA 2OYQA 4TLRA 2IA6A 2HMIB 4AHTA 3QEIA 3KLGB 4IG3B 4HCBA 4DL5A 1S1XB 3JYTA 4Q5VA 1BIUA 3VQAA 3GV7B 2HHTA 1RT1A 3NH0A 1LV5A 1S1WA 4NYNA 2IM0A 1S6QA 2KZZA 2HHVA 3PX4A 2OPSB 1HQUA 4GW6A 4WFZA 2P1JA 3OYBA 2IS3A 2WONB 3AA3A 4KV8B 3ZSWA 5I42B 4Q0BB 2RKIA 2RF2B 3AO2A 4KKOB 4KHSA 1C0TB 1KHWA 4NLXA 5HBMB 1N6QB 1U09A 5KGWA 5KFYA 4NLPA 3T5KA 2J6SA 2G8KA 3OS0A 3RBDA 2UUTA 1QE1A 1QHTA 3AO1A 5KFMA 4U6PA 2W9AA 4DQIA 3JSMB 3SQ0A 1RT6B 4LSLB 1CXQA 2R8JA 3KLIA 2W9BB 3Q8QB 4U7CA 4ECTA 2VG5A 4JV2A 1KVCA 4K4WA 3ZCMA 1C1CB 4KHQA 4J9OA 1TK0A 4CJ5A 4N76A 4DS5A 2DFFA 4H4OA 3P83D 3U3GA 4BE0A 1SL2A 5KGXA 3KNAA 1C6VA 3V6HA 5D3GB 2FBVA 4B9SA 2B4JA 3MEEB 2I1RA 2C2DA 4RUCA 3NFAA 2VG6B 4BWMA 3AVCA 4EO8A 2R7YA 4GC6A 4CEQA 1HRHA 4CJKA 4E19A 4CEEA 2W9CA 4CJRA 3AVGA 3SQ1A 1HPZA 1SV5A 4DG1A 4DTOA 1KLNA 4DU3A 1NK4A 4ZMMA 4KHMA 2BQUA 5HLFB 1XR7A 4R8UB 3KK1A 4PQUA 4J9PA 3OS2A 4LQ9A 4KTWA 3FSIA 1TQLA 4J2AA 4HKQA 4IR9A 3ITHB 2QKBA 3OYFA 1NJXA 4NLVA 1VRTB 4K4XA 4B3OB 3SUQA 3M8QB 4BE2A 1Q8IA 3VQ9A 1LWFA 1REVB 4IR1A 3TI0A 4HUGA 4EYIB 1S4FA 3K57A 3G6XA 1U4BA 2IJFA 2YKNB 2R2TA 2VG7A 1L3VA 2FC0A 1NKEA 1TK8A 1Z25A 4DF4A 4QAGA 2YKMA 3L2UA 3V9SA 1NJWA 4RNMA 4J9KA 3ULDA 3NBPA 3K59A 3LDSA 3IS9A 3TARA 4MK9A 2PYJA 1LWEA 1N5YA 3D28A 5J2PA 1U47A 3AO4A 3LWLA 4YR2A 3AO5A 5JS1A 4LD0A 2FJXA 3BGRB 2X6NA 3CFPA 1TAUA 1WAFA 1L3SA 4CEDA 1S1VB 3TAEA 3SCXA 2XGQA 5KFVA 5KT7A 3WNHA 2E6LA 4DTMA 1TKZA 3TAMA 3C6UA 1JX4A 4Z4FA 4RW9A 4ZPAA 4TSXA 5C24B 5J2MB 2V4RA 3L3UA 1NHVA 1R0AB 3PX0A 1RTDA 5SWMA 3DRRB 4ZP7A 3OYDA 3HVAA 1J53A 2B5JB 1S1UB 5F8LA 2A1SA 3T5LA 2QXFA 1FKOA 2XGPA 2Y1JA 2D3ZA 1TKXB 1TV6A 1I39A 4DTPA 4FJIA 2KZMA 5DQHA 3QIPA 4IRKA 2DPJA 5DGAA 1XR6A 3G6YA 4CJVA 1T3NA 4AHVA 3M9MB 1Q9XA 1JKHB 3N6LA 2FVCA 4YNQA 2WOMA 1RDBA 4OKKA 3SUPA 2XRIA 1B9FA 1W0HA 4CFCA 1TL1B 3PW2A 1KFDA 3GYNA 3G6VA 4FK4A 4KHWA 4I7FB 1TVRB 3DDKA 4LSNA 3OL9A 3PJXA 4C8MA 2AGOA 3CJ3A 4FJ7A 2HVHA 4CFBA 1EP4B 1W25A 1KSPA 1KLMA 5KG5A 4RNNA 1S10A 1IO2A 1RTJA 5KFNA 4AHRA 5HRPA 1UWBB 1QSLA 2R2UA 3VQ4A 2IAJB 1JLAB 2C2RA 1C2PA 4K4TA 4IFYA 3K5NA 1D0EA 1S9GA 3VN5A 2E9RX 1GOAA 3VQ7A 3DLEA 5KFBA 3TAFA 2D0BA 1NJYA 3DOKA 3EY1A 4UQGA 4ZP8A 3DLGB 4NYZA 3FRZA 3KHLA 1U48A 1T03B 5T7BA 2D7SA 1FXXA 3CM6A 3HXMA 2HMIA 3OYEA 1MMLA 4KO0B 1KCFA 4NYFA 2HW3A 3KLGA 4IG3A 4J9LA 3BSOA 5FROA 4J2DA 3DOLB 2FJVA 4W5OA 3PR5B 4GVMA 3KD1E 2QK9A 2BR0A 3TWHA 3OY9A 4KHYA 4FLUA 3QGHA 4ED7A 3NAHA 5DMRA 1QUVA 3BSNA 4Z4EA 1BQMB 2OPSA 3HPGA 1RT2B 4OGCA 2WONA 4KV8A 5I42A 4Q0BA 2RF2A 3V4IB 1S0NA 3QGIA 3HYFA 1IKWB 3BREA 4KRFA 1NKBA 5HBMA 1N6QA 4Z4IA 1RILA 3O3FA 4CJ3A 2QE5A 2YNGB 4MIBA 3C94A 1T05B 3OS1A 3KK3B 2FVRA 4FM1A 2DFHA 4NLTA 1SKRA 1SH0A 2XHBA 2XCPA 3V1OA 3Q8SB 4KAZA 2V4QA 4CEZA 4M42A 3EYZA 3GILA 1BL3A 1RT6A 4LSLA 3KIOA 3VQ5A 1S97A 2W9BA 5K14B 3E51A 1N48A 1HYVA 1IKVB 1JL1A 4KHRA 1HARA 5T14A 2ASLA 4OPKA 4QW9A 4QW8A 4K4ZA 3IRXB 1S6PB 3OYAA 1SL0A 2JLEA 3OVNA 4KB1A 4Q45A 5D3GA 4DFJA 1JXLA 4CHZA 3MEEA 3OLAA 1LAWA 3DRPB 4O3NA 4B9MA 3GIJA 5HP1A 5DQIA 5KFHA 3NF8A 2BDPA 1LW0B 3D5MA 4Z4GA 5KG6A 5DG9A 3V1RA 1XR5A 3VA0A 5J1EB 2FLLA 4CJEA 3AVJA 5HLFA 2P5OA 4R8UA 3V81B 3BR9A 3V9XA 3H08A 1TAQA 4HVJA 3ITHA 1KVAA 4FJ5A 2RPIA 3PW4A 4Y1DA 4CF0A 1VRTA 3IGNA 3VQ8A 4B3OA 1D9FA 4RZRA 3M8QA 3K2PA 1WSJA 2FJWA 4HYKA 5KFLA 3DI6B 1REVA 4IH7A 4HUEA 3QO9B 3IG1B 3A2FA 4DU1A 4FXDA 2YKNA 3QEWA 3CJ5A 2VWKA 2JC1A 5KG4A 5EWEA 3I0SA 3RB3A 3FQLA 4IH5A 4Y2AA 3S9HA 4PUOB 1DTQB 4DQRA 3RB4A 2R8GA 3E01B 4H54A 3UDLA 4X2BA 1L3UA 2D5RA 4TY8B 4BACA 4FZXC 3K58A 5DGBA 4ECZA 5F8MA 4FLYA 4QCLA 3BSCA 3T19A 4NLGA 5L1IA 4CJTA 3BGRA 4M3YA 2D41A 4K4VA 4FJKA 3V9WA 3L2RA 2X78A 4JS4A 2HNYB 2G8FA 1S9FA 1S1VA 5C25B 3KOAA 3RMCA 4OKJA 2C2EA 3FFIB 4K8ZA 4URSA 3H5UA 1JL2A 2E9TA 4CEOA 4NLOA 1SH3A 3S3MA 4CJQA 1GOCA 3TR8A 5C24A 5J2MA 2AX1A 1T94A 3MR6A 2IGIA 4ZP6A 3FQKA 4E7KA 4AILC 1R0AA 2DY4A 3AO3A 3RR7A 3P1GA 3RB0A 3QYYA 2DTUA 4F3TA 4CHOA 3DRRA 4K4UA 4ED3A 2UVVA 4CJLA 4DSFA 4H8KA 3ZSOA 3MTKA 2ILYA 1RT5B 2B5JA 2X74A 5L1JA 2KFZA 5C42B 3LZIA 1JLGB 1RNHA 3RTVA 1TKXA 3D45A 2Y1IA 4WYWA 4CJUA 4FJ8A 3I5BA 3NKYA 3KLVA 1MU2B 3ZT0A 3AV9A 2AGPA 3NH1A 5JXSA 1A5XA 2BQRA 5FDLB 2D3UA 2F96A 4M3UA 4ED0A 3KLEB 1TL1A 3AA2A 4FCYA 4NLUA 2YNHB 4DL3A 3H4BA 5E41A 4I7FA 2D0AA 1EETB 3OYNA 1RTIB 2JEJA 4F2SA 3I0RB 1BIZA 2XCAA 3OYIA 2ZQBA 2D0CA 3AA4A 1I3AA 1NNDA 3MECB 3PW5A 2J6TA 4W5QA 1VSIA 4DTSA 5EU7A 1UWBA 1CXUA 4FLZA 2HNDB 3T3FA 2ATLA 2P51A 4DSEA 1XI1A 1JLAA 4M3ZA 2QV6A 2FVQA 3RBEA 2G8HA 4J9RA 3MXMA 4JV0A 3SI6A 3TAPA 2W7OA 4DSJA 4FJNA 4FBTA 3H2LA 3KHHA 3NGYA 4CGFA 2P5GA 3HPHA 3M8SA 2ITGA 4BDYA 1W9HA 4CIGA 1ZBLA 4NLWA 1U04A 3VQ6A 3DLGA 4KTZA 4LQ3A
chains in the Genus database with same CATH superfamily
4E7HA 5GAGI 1KR4A 2I5JA 3GYGA 4GV6A 2GVZA 4FYDA 1GOBA 3QEPA 1APSA 2DRAA 5IWAK 3HK2A 4WTYA 1KS2A 2R8IA 3ZSXA 2CPFA 3I5AA 1VSJA 4DFPA 1MG7A 1U8SA 2DYAA 4L3KA 3ASMA 2F9JA 3O6WA 1WSGA 3TJ8A 3C14B 4F2RA 3QZ8A 5J1PA 2O8BA 4FNIA 4YR0A 4WXWA 2EHGA 5CXTA 1HNWF 5EXWA 2WAQD 4LRAA 1RCOB 1B4SA 2ZF5O 3SPYA 1VI7A 1TFWA 4MIAA 2DGXA 2OD4A 1Q82O 3MUMP 1NRKA 4ZPBA 4ENOA 3DRSB 5DM7Q 4D3HA 2BZ2A 5D78A 2NPFA 3DXBA 2EVZA 1HKBA 2F3JA 1RWKB 2HVIA 4DLGA 3NXZA 4MK8A 4N5SA 3HP6A 4V19X 4O4GB 5DZ6A 3PCOB 2JEIA 4MLHA 1GLEG 1N88A 4DOZA 2KG1A 2XNQA 2E1AA 3GTYX 2HGNA 4J9NA 1RKIA 1CJKA 3VQBA 2GFFA 1RYSA 3I55S 1S49A 3GJQB 1SJFA 4F67A 5LMUF 1OH8A 4RUAA 3KG0A 2XZTB 3O1WA 2MSTA 3ZZRA 4C3LA 2Q1LA 2E1RA 4FM0A 3O4QA 3FEYB 1EKEA 2LQBA 4EMDA 2YHAA 5F1XA 2HSTA 3R5DA 3M32A 1F5AA 5I3QA 1DTTB 3ZLJA 1MN7A 1P90A 4NZ0A 3H40A 3AOAA 2CNLB 3HT0A 3MAHA 3OLBA 1KTQA 2HNZB 3JXUA 3NGRA 5KFQA 5CZ1A 1U1LA 3JTOA 3U6FA 2F40A 2LXFA 3PEHA 4KREA 3K2YA 3QRRA 2EPIA 2ZZMA 3V81A 3NGDA 2OZSA 1S0MA 3RB6A 4FWNA 1GXTA 1L3KA 2HHHJ 3M9OB 1VSDA 3FEZA 2RDIA 4LF8F 2PZSA 3W5XA 3CTRA 4ICLA 4DR7F 4C8KA 2P9NA 5AQHA 3CT9A 3DI6A 3H1VX 5HJXA 5ETRA 4C48A 2H5EA 3IG1A 4J91A 1OVYA 1DKGD 3B8AX 1OQ3A 4MDAA 4JI3K 1HWIA 1O13A 3NF9A 2KRRA 5F8IA 3OFHA 4QS8A 2MZRA 1N32F 4DTJA 3F2KA 1YHQS 1V3SA 2XO6A 1KC8O 5DJBA 1RT7B 3OYHA 3C15B 3K5MA 2VKRA 3AFGA 1GXLA 3NP5A 2OTLN 4TU8A 4CWBA 3Q0AA 5HRNA 4PCQA 4YOYA 4BRMA 4OPJA 4F50A 2NRZA 4NWBA 1YZ6A 2E8AA 2ASOA 2LEPA 4ECYA 4XIUA 2HFNA 4U8VA 1DQ8A 4CLPA 4C0OC 2KJWA 1K1SA 4Z0UA 1JQGA 5MLCQ 4YOEA 5ADXH 3LP0A 1GLJO 4JI1F 4IFEA 3DHXA 2DCUB 1WAJA 3LPTA 4IO9Q 3A5LC 3PRBA 1NOZA 2D4WA 4QIWD 2BANB 1F2GA 1NK6A 3POTB 5EVZA 4QOTA 3LOUA 5ETOA 1VHIA 5AQRA 4A8FA 3TQ1A 3R6MA 3KDOA 1PBAA 4F25A 3MX5A 4MFBB 2VIHA 4BC9A 4C0HA 1ZM9A 3W61A 1F9EB 1HBMA 2LEBA 1ASUA 3QZ7A 3CMQA 2E7XA 3I0RA 3D3CJ 2ROGA 3SUNA 3FZLA 5HROB 3MR5A 2XMJA 1C0TA 2QC3A 4WPAA 1B9DA 2HNDA 4CP5A 4C8OA 4H4KA 1VQ4S 4MDBA 4IKFA 1WG5A 2JSXA 3SUOA 4PQUB 1JJHA 3PVXA 3FGVA 3FZFA 1RXOB 4O3RA 4QS9A 5AZJB 2QSFA 4OPHA 4OZ1A 5E3CA 2CAJA 3N4QA 5FRMA 1ULRA 1YITS 2XY5A 1Q8LA 2V34A 2P9KB 4WQ4A 3MAAB 3WC2A 3RMDA 4DSKA 1BWFO 4CZIA 2E1PA 5KG2A 1IG9A 3UCUP 1X0PA 4ID5B 3K5LA 2B6AA 3Q22A 2QM1A 1X60A 4ZCLA 4DX6A 3WXKA 4LFAJ 3CC4N 1EB0A 4X4TA 3MM9A 1H2UX 1CULB 4P9SA 2KKZA 4ID8A 3LP2A 5EWGA 3EZOA 1HBOB 3UDVA 3I56N 1RBSA 4FVMA 1N5TA 4ANDA 5HATA 3GYXB 1KD1T 4X4UA 4DV4F 3BSAA 3SQGB 4BVPA 1Z2LA 4IFVB 4UOFA 4CCHA 5CYMB 5D0HA 5LXRA 4P73A 2LP4A 3FDSA 3VGLA 4Y28C 4JBCA 1YUWA 1FRMA 4TQSA 3LAMA 2WUSA 2NSCA 1W7AA 4IDKB 4RUHA 3A8EA 2JJ4D 2UUWA 1N33K 3J7YU 1AFJA 2R7SA 2OO4A 3HO1A 4GV9A 1UVJA 2R42A 4DL2A 3MM5B 5HVHA 2DFEA 4DQ8A 4BS2A 2P9LA 1M5KC 4B9VA 3G71N 4GVBA 4RW6A 4X64K 2ZM6J 4FLTA 1IG8A 4ETZA 5BPMA 2HHQA 5DQGA 5DZ7A 2H54B 4J9QA 4RW4B 4IG0B 2BYCA 1CLQA 4OHVA 1D9AA 3VQEA 3K5OA 3QMQA 2BRKA 2QFJA 4O44B 1S1TB 3TA0A 3T7ZA 4I6AA 2D69A 3GCWP 3L4IA 3LM9A 1ITPA 1SUQB 3N5BA 4FLXA 2XB2D 4RUBA 2FQQB 2CDRB 1VR6A 4CLFA 3IAS9 2E2QA 3W3DA 2BUPA 3HOTA 1SC4B 3TPQA 1OSDA 3KHYA 3CCQS 4ES1A 3BJYA 4KH6A 3SV4A 4LH4A 4CZCA 3SFUA 4XTTA 3MGJA 5M2PA 4AHCA 4LF5F 3P5TL 2MXYA 2B51A 1ZETA 1MWQA 2EFVA 5HL7Q 2Y3YA 2OMLA 2GIRA 4LF4J 4CJWA 2GIFA 1HNIA 2CQGA 2CKWA 2R8HA 2KHCA 1SIZA 1G7CB 3EE3A 3KK2A 5IC4B 4JI4F 4NXNK 4C7QA 2HSEB 4WU3A 4DHYA 4MKYA 4ED1A 1NEEA 3W2WB 2PE8A 4BR0A 4KPCA 4JV5J 1J6ZA 3EM1A 1OKJA 2FSNA 2FF3B 5LSLA 2F8MA 2HRYA 3CWJA 4HEA9 5K8NA 5FLXU 3TANA 2ZJRQ 4PXDA 2QW9A 2EG2A 4FDFA 5GVQA 4CQ1A 5M1OA 1ZAWA 1KDNA 2CPYA 1UVLA 2JZ5A 4DI6A 1HBNA 3PW7A 5KFZA 4IQXA 3ADAC 3HHLB 4Y2MA 3KDNA 2CYYA 1VRUA 3SSQA 4K5RA 1AW0A 4O5FA 3DYAB 3B6PA 2YV0X 5K9FA 2GW8A 1S57A 1B0VA 2BVZA 1IBLF 2J8AA 2NRTA 1C1AA 2QWMA 4C3MA 3PKMA 4X65F 2DHAA 1TL3B 3GU0A 4R5PB 1WSHA 4DUTA 3ENAA 1FNXH 1FVQA 1CZBA 1H3DA 5JS2A 1Q86O 3GR1A 2VYPA 4DV0F 1AUSL 2HHHK 2G0IA 5BN8A 4WFXA 3TP2A 2ZC3A 4B02A 1JLQB 3C95A 1VQMS 1IJFB 2V52B 5I3UB 4B3TJ 3A5OC 3ISNC 3MPDA 2ALYB 1R3NA 3X1LB 1JJCB 4WBFA 3BUZB 4CJPA 4WE1A 1C0GA 3MM6A 5AQQA 4CO0A 4A47A 3QBXA 1T02A 5F8JA 5E84A 2F7TA 1B99A 5GIOA 2DGWA 1FTRA 1T05A 4RBTA 3OW2M 1KWMA 4X62J 4A5AA 1WJ9A 1IV0A 5E5NA 2K7JA 3IMXA 5F3TA 3QPIA 3BP8A 1X5TA 3BQ0A 5K14A 2CFXA 4QWCA 4B1VA 3VEVA 2RDJA 3E8OA 4DTNA 2XMVA 1RADB 1VQ8S 3DLJA 1RLCL 3QGGA 5T7LB 3M2RB 1MW7A 3ID6A 2WBRA 3GIIA 3NY0A 1PJ7A 3SMZA 1TR0A 3SEOA 4AQYF 3TTFA 2HS4A 1TFYA 4ATNA 3PIPQ 1UWAA 3DMJB 3TAQA 3R5JB 1CZ9A 3OYMA 2F4VJ 4U67Q 3GG0A 2LA6A 1UOCA 1YVNA 3DLRA 2KM8B 4Y65A 2ZUGA 1XC9A 1JK9B 3Q8UA 2ZOMA 3J7A1 3W9HA 2HIYA 4EFAC 2ZD1A 1YSJA 3IR5B 4OJGA 3KHGA 2G1DA 4TU7A 1RTHA 2IMOA 2VQEF 1HNVB 3E66A 1FK9A 1VSKA 4F4KA 3HD2A 4WQ5A 1IBMK 3WQTA 3PM9A 1A0OB 3CIPA 1HMVA 4WP8A 2KTQA 4LF2A 1JIHA 1L3TA 4EWTA 5HJYA 3PO4A 3H8YA 3FCVA 4IKAA 1NSPA 3L4BC 4HWIA 4BGAA 3THXA 5F9LA 5HRRA 5GADU 1QAXA 2VASA 3U9ZA 3TSQA 2MJUA 1S1WB 4CBUA 3LAKA 2ZC4A 1S0OA 4BLGA 1SQEA 5IT4A 4KT0C 4NCAA 3TEGA 1RGIA 1HQUB 4DV3J 3DLHA 3MPUB 2AKWB 1S22A 4RW8A 3P6YC 2DNMA 2DNRA 3T6JA 4PG4A 3S1TA 4NLYA 2DGUA 1RWPB 2LSNA 1EWQA 3AVLA 3CXCM 1H6KX 1QQNA 4NMLA 1TUUA 4LFAK 4Y2CA 2IBKA 5AZIB 3UD5A 4CIFA 3V1QA 2OUGA 3J8AA 3I8DA 3M30B 4YB6A 1FJGF 1UETA 1QE1B 4G1QA 3AVAA 4ISFA 1HWLA 2HBQB 4CO2A 3CETA 3S7RA 2BABA 5D8HB 5KFRA 3VTHA 4DR1J 3O3GA 1ZZFA 2M7SA 4NLSA 3UPFA 2H3GX 1NGHA 4B1YB 1FA0A 2VD3A 2D9OA 5DG8A 2XYGB 4L3QA 3VVUA 3B6OA 2WHOA 4DFKA 1AZSB 5KFAA 2PFUA 4CFDA 2FGCA 3GBTA 3UWTA 3CJKA 2OPQA 3FBFA 2R7OA 3MWTA 4NA2A 2I0XA 1KAXA 4OLPA 4F4ZA 4U7UK 4ZHRA 1RBLA 1ZXOA 4EBCA 4P71A 4CE9A 1JXVA 4AYBD 3DHWC 1K1QA 2QWQA 1IKYB 1SV5B 2HQIA 3HVTA 4IJAA 3VEOA 5KFTA 2RS2A 2KO1A 4E1MA 1VLYA 4WTOB 1HKGA 4OYMA 4DR5F 1FD2A 2XLJA 1UFWA 1Q4RA 2PD1A 1WOSA 3NMAA 1FT8A 1RT3A 1UPMB 2RH3A 4Z94A 4OYWA 1NGFA 2HF3A 3BGFA 4C97A 2E1ZA 2YNIA 2WB4A 3G6EN 4ZPDA 4B08A 2PDAA 2B8PA 1N34K 2KFNA 1BQNA 3MEDA 2B8QA 2VPYB 1ATRA 2VG7B 3ZSZA 3OVSA 2GQ2A 1HYSA 2PI5A 2YKMB 1HHSA 3HHEA 3WXIA 2ADBA 4CBXA 1NG9A 1U1MA 3AAWB 1KNZA 4CLSA 3OL7A 4KPYA 4MYTA 2F9DA 3CCMN 1P1LA 2QRRA 2ZGZA 4KI4A 4FPBA 3N6NA 2P9SB 2BE2A 5DM7L 3B8HA 4F3MA 4NX9A 2GMHA 3CULA 2HBRB 4CEFA 4JV5K 4MTPA 1LQ9A 4ZVQB 3TAMB 3QERA 4IJNA 1C1BA 3IAYA 4PYDA 1KQFB 3WXJA 2GMJA 2QLJB 2NQPA 3G82A 1LWCB 1RTDB 1X9WA 1VQ9S 2GGPA 2XMKA 2IMWP 5C12A 3NHGA 4FJMA 3EPGA 2C2ZB 3Q8PB 3MR3A 4IO1A 4ZCMA 1VQ5S 4EYHB 4S0MA 2UUAF 3JS9A 1FKOB 4PRFA 4QR2A 3O9UA 5A6WA 2Y1LB 4IYQA 1EARA 5JMVA 1RDDA 1H7XA 3FRYA 3L2WA 4UZBA 4DX7A 4LFBF 4ZCIA 3W9JA 2CGKA 1WD6A 2B0GA 1C0MA 3AD8C 1YJVA 1Y97A 4RKUC 1XNRJ 3TAGA 1J5EJ 2W41A 4YB7A 5L39A 2YNFB 4W92B 3SBGA 2ZBIA 2J9EA 3DJCA 1YTAA 4DMZA 5A6PA 5H1SQ 3MOZA 4YHHJ 4CEAA 5KFGA 4B3TK 2VBWA 1S9GB 3EKSA 3D3BJ 3MZIA 3ZZTA 2RILA 1NM1A 3MEGA 3TOQA 2XMWA 3M9NB 3F0NA 1LW2A 4EUVA 2HFVA 1NZAA 2G8UA 2ACMA 2CADA 1BU6O 1X4DA 2QA4G 4IG3B 4DL5A 4JOUA 5E2QA 2Z2ZA 1NMEB 4Q5VA 3J81O 4LMZA 1BIUA 1GLCG 3N28A 4OQJA 4X62K 1EWRA 1Y0HA 2FC9A 5LXYA 4OZNA 1S6QA 1R6VA 3O44A 2KZZA 3UD4P 2FF6A 4X4OA 2MLXA 1RHQB 3OYBA 5ETTA 4KV8B 1Y11A 4DKWA 2RKIA 2X51A 1VQ6S 4KKOB 3O08A 2FSJA 2ASMA 1UTAA 3I9ZA 3G9CA 2B9YA 2DBBA 1U09A 5B0DA 1NXIA 4NLPA 3T5KA 4CI0B 3R7NB 3OS0A 1WF0A 2UUTA 3FMBA 2G1HA 1KVIA 1WC0A 5KFMA 1RWXB 5IT9O 4IO9L 1PJ6A 2P6TA 2AV5A 1RT6B 4LSLB 3D0IE 3KLIA 2W9BB 3Q8QB 3RSEB 2VG5A 5GAHP 3QFUA 4DV5F 4K4WA 3ZCMA 3TA1A 1X0FA 2ABYA 1Z6RA 1A9NB 1VQNS 3D1OA 3U3GA 2UUCJ 3OBIA 2RDDA 3OTOJ 3ID8A 5D3GB 4BC4A 2FBVA 2A6MA 1KQSR 3I6PA 1E6VA 4RUCA 3UKUB 3NFAA 3H3OB 1PIEA 2IVOA 4CEQA 1HRHA 4E19A 4YS2A 4USMA 3LTOA 4DG1A 3A5NC 4DTOA 1FXRA 2O8FB 4DU3A 1S3XA 2J0WA 4FNHA 1NK4A 1FF2A 4ZMMA 2XS2A 2DGOA 4KHMA 2QSWA 1N36J 2IIRA 4R8UB 3KK1A 1HFEL 4LQ9A 2XYPB 4CW7B 1CC8A 1FW6A 5KPZA 3TYTA 3ITHB 2FZKB 4BC5A 3TJAA 4W4MA 4K4XA 2E2OA 3M8QB 4ZKAA 3BGUA 1Q8IA 1QZ6A 1REVB 1V9OA 1RWUA 2HG4A 5ETKA 1J2VA 4EYIB 3G6XA 2JHEA 2NXJA 2IJFA 2ZEJA 3QT6A 4J5OA 4X4SA 4Y2KA 2RU9A 3AJ2A 2NR0A 2FHOB 2KT2A 3IXQA 2FC0A 1NKEA 1TK8A 4QAGA 2DH9A 4K2XA 1VQYA 1FTCA 3ISZA 1NJWA 3ULDA 3NBPA 1LWEA 3W5YA 1N5YA 3PSFA 5J2PA 1TL4A 3CHWA 4JD2A 4PXBA 3BKFA 3M1VB 4DR1K 2QEXN 1ZBTA 3FJ2A 1WAFA 2AA4A 4CEDA 4WFNL 2AEFA 1S1VB 3TAEA 3MCNA 1S99A 2YVSA 5KT7A 4HDGA 1TKZA 1P1TA 3PACA 3T1HF 4BC2A 3HX9A 2RS8A 4A8OA 2NS1B 3CIMA 2R4FA 4ZPAA 4A8KA 5J2MB 2Q0UA 4X84A 4NZ7A 1QQMA 2PEBA 3CCTA 1NHVA 1R0AB 2KDOA 3THYB 3O9TA 1VK8A 5CAAA 2AYBA 4R0JA 3HVAA 2B9EA 3ET6A 1YGYA 4BRAA 1CC7A 2YH1A 2QXFA 2XGPA 4JYAJ 4P10A 2DPJA 2Y1RI 4AHVA 2XQCA 2WOMA 1RDBA 2XRIA 4CFCA 2UXCK 1TL1B 3C66A 3C65A 5AQSA 4C1NK 4KHWA 4I7FB 1HLUA 5DDQC 3OL9A 3UVJA 2WSCC 1X5SA 3CJ3A 2HVHA 4FJ7A 2YBVA 5FIIA 1KLMA 5KG5A 1IBKJ 3UFCX 1UWBB 1NM2A 3HMJG 1JLAB 3ENHA 3EJMA 4IFYA 1D0EA 4MJKA 3VN5A 1GOAA 3CPWM 2JDJA 4NXMF 5HL7L 3DOKA 3PEJA 2E2PA 1X4EA 4JI0J 1CBKA 3VAJA 1U48A 2WW8A 4FSVA 3CM6A 2GVZB 3HXMA 2FC8A 2HMIA 4NYFA 4JI8F 3BSOA 3LDPA 2HEKA 3AB4B 2GVDA 4W5OA 1W7WA 4JKHA 3I4HX 2O8BB 3H25A 1FESA 4E2FB 1G99A 3JQMA 2A42A 1QUVA 5JMNA 1P8ZA 2E29A 2ZHAA 2BACA 2WB1D 3HPGA 2WFBA 5KPRA 4OGCA 1Z2ZA 2NPIA 2BJ3A 3EMTA 2RF2A 3ZNJ1 3V4IB 4JI2F 2WVEA 3BREA 2LMIA 3W66A 3DXMA 3LO3A 1UW9A 4KGXB 3I82A 3P4IA 1NKBA 2DR9A 1TZ0A 5HBMA 4CH0S 1RILA 3TUIC 4B17A 4CJ3A 3ZZOA 1NMDA 3C94A 3P45B 1BD6A 2NLWA 3IDHA 2ZWOA 1XNRK 2ZJQL 3RBZA 2ZH1A 1J5EK 4OZ3A 4NLTA 2CQ3A 1CJKB 4KAZA 5AQNA 3MOJB 3L3CA 4CEZA 1VQLN 1BL3A 3KIOA 3VQ5A 1S97A 3E51A 4ILHA 3SK3A 5LMNF 4M5NA 1HARA 5T14A 2O8DA 2Q79A 4OPKA 4K4ZA 1S6PB 3OYAA 4PG6A 4M63A 3TUPA 4KB1A 4GO7X 3M8YA 4DFJA 2HK3A 1JXLA 2HVEA 3M32B 4O3NA 3CCZA 5DQIA 3IFEA 3CCSS 4KH4A 5KFHA 3NF8A 4Z4GA 2ZBQA 4B3SF 1RHRB 3CO0P 1HI1A 4X4NA 1XMQJ 1RAIB 3VA0A 3SXLA 4PL7A 2HFZA 3V81B 3BR9A 3BPDA 3AJDA 2RE2A 4NYOA 1OIAA 1HR0J 3QB0A 3H08A 3RUBL 3CDBA 5HOOA 1KVAA 3AXMA 4CF0A 1XJWB 1DHMA 2P9NB 3K2PA 4RCHA 2BJ7A 5CD4H 3O6QA 4ZLLA 3DI6B 3IG1B 1GLLO 4Y00A 4DU1A 4FF3A 2V4JA 3J7YP 4NEZA 1JJ2R 2JC1A 4OFZA 1VYAA 5KG4A 4FWRA 3FQLA 3S9HA 1KQKA 2ZH2A 4UOGA 1G3OA 5AFUA 4G1PA 4Y0WA 4FZXC 3WIVA 3GL1A 2E5IA 2K3IA 4NLGA 2ZBRA 2RRAA 4C6AA 2ZUAA 2ZGYA 2KI2A 1NGAA 2D41A 4RO0A 2C42A 3I55N 2G8FA 2MKYA 3RMCA 2UUCK 2DHGA 3OTOK 1F3FA 4K8ZA 5LY3A 2E9TA 3HSCA 5CZVA 4CEOA 3VAKA 3ULEA 2CVIA 2DR8A 3TVYA 4AM6A 2V2KA 1W2BM 3NGSA 1F3VA 2X1BA 4DR6F 2IGIA 4PG8A 4E7KA 2DY4A 3AO3A 4OX9K 3QYYA 4BRFA 3CE8A 4K4UA 4ED3A 1NGDA 1YRTA 3MTKA 4BRLA 3GR0A 1OJ4A 2NYIA 1H72C 2V8VA 2AD9A 3MCPA 5L1JA 1N36K 1JLGB 3CC2S 1RNHA 2NCKL 2Y1IA 4WYWA 4E8UA 1VS3A 2XLKA 3I5BA 3NKYA 3IR6B 3QAEA 2XULA 3ZT0A 3VCDA 3KJFB 1A5XA 3U1MA 2ZITA 1I1GA 2F96A 3KLEB 4FCYA 4UQTA 4NLBA 1FWKA 3WEEA 1A6LA 1HBMB 2V5HG 4F2SA 4LF6J 3I0RB 3FEXB 2JX2A 1BIZA 1F1BB 2R7XA 2ZQBA 2D0CA 3AA4A 1NNDA 5CCMA 3PW5A 1OQ6A 2MEWA 4W5QA 4MAKA 3HHDA 4DTSA 2HZAA 1NU0A 4P52A 4RWWA 4FLZA 2HNDB 3GLJA 1XI1A 1RJJA 5LSRA 1NGBA 2NXUA 4OZLA 2QJ3A 4CGFA 3M8SA 4B1UB 1YHQN 1W9HA 3UCZP 4KTZA 1MN9A 1B70B 3D4JA 3CJ8A 2OCEA 1TUYA 3BEXA 1XNQJ 4MT1A 4N8NA 1SL1A 1YQHA 2J6UA 2A6AA 5A8WA 3O3HA 2XI2A 2GS8A 6FDRA 2B6AB 2AQ4A 4WWSA 3OVBA 3VGUA 1PKUA 1RHUB 3Q83A 5AQIA 4BVOA 2CIMA 3LP2B 4LREA 4DV7J 2BM0A 1ZM2A 2OAUA 1Q82T 1RT2A 2MLZA 4UTGA 4JYAK 3H2UB 3BN4A 1OPIA 2CJAA 2E9ZA 4YMEA 4ECRA 9RUBA 3NAEA 1U02A 2DEIA 4M5DA 3BQ1A 3R8EA 2Q66A 2BUNA 1XTZA 2UVRA 1OH7A 2HWTA 2UXDJ 3I5CA 3AARA 4WK3A 3PO5A 1JLCA 1T3VA 3GB0A 3ZO7A 4B3MF 4BC3A 2VFRA 2QL5B 3AXKA 1X5PA 4GVBB 2AX0A 2B4UA 4RW6B 1IKVA 1WHWA 2D1KA 2VGMA 2J9DE 4A8SA 1FDAA 4DV6F 5LJWA 3AODA 1ZBFA 3W5ZA 3CJBA 3HHKA 5HMZA 2ASDA 2P9EA 1T8EA 1VQ4N 4C1NI 1S5JA 3IP0A 5JVHQ 2IFXA 2YWWA 2UVWA 4ZN3A 3LGHA 4QIGA 3HRGA 2Q31A 1LW0A 5B0CA 1WI8A 1X4FA 3OTBA 2IC3B 1YITN 3SYZA 4JKCA 2HWIA 1RWWB 2HHWA 3R8YA 2CJ9A 4BRHA 4CBWA 4NLCA 4GKJJ 1M5VC 4TY9A 2WRMA 3BKTA 3MR7A 1LAVA 4WF9L 2IPOB 1FERA 4LFCJ 1HNIB 1ZYQA 2GC8A 3EDRB 3KK2B 5L1KA 4DXLA 1GH8A 2DNZA 4NLDA 3WQUA 4QPXA 4ECWA 5KT4A 1PAEX 4E7JA 3VAGA 4QOZB 3CCES 2E5LJ 1U2CA 2XMTA 3UCGA 3BPSP 1VHFA 2HRUA 1OYDA 5KFEA 4Y3CA 4W5TA 1R8HA 4GNIA 3H59A 4NZ6A 3DU6A 3F5TA 3E01A 3Q8VA 3U9DA 3BZQA 3FVYA 4FJGA 2PYLA 4LRBA 2C3MA 4ZN1A 1B92A 2E5HA 5GADP 2QMUB 9ATCB 3LPYA 4OX6A 4CH7A 3HFZB 3R5BA 2AIRB 3NRBA 2ASJA 4JI5F 2HK2A 4GKKK 2FSKA 2J9CA 1VRUB 5D4NA 2R2RA 5AE1A 1HA1A 2FLPA 1O5JA 2Z56B 2HIQA 2VJUA 1X7VA 3TVKA 1V5VA 1HNWJ 4FWPA 1NH7A 1CLFA 2P9CA 4HH1A 4Y34A 1Q18A 2CZ4A 4JI7F 4L6V3 1QAYA 1WUAA 5AQKA 3FMWA 2WK4A 4Q8FA 2WZ1A 3CJ1A 5AQXA 2O4GA 5AJ3K 1M1HA 1HR0K 4DCPB 1H2TZ 1WSFA 4AHSA 1FXDA 3VESA 1HD0A 3RR8A 3CCQN 3VF6A 4ZIWA 3AVMA 3NCIA 3CCVS 4C2MA 5EWFA 4ZS6A 3TABA 3V6JA 2HMPA 4USIA 4EZ6A 3TQEA 5A8KA 1CPZA 4I56A 1U0SA 2P2CB 3CQYA 4WE1B 3MM6B 4CO1A 2HFOA 2PSZA 5AQLA 4QS7A 4DL4A 3E9LA 4U96A 4ZCKA 4CF2A 1SIWB 3EWGA 4FZVA 1C4CA 2OH2A 4DUZJ 3J80Y 2IBOA 5AQMA 3BF3A 2K1RB 4E3SA 3FK4A 3BO2A 4H0XB 3MWPA 4RX6A 3JSMA 2HQ3A 4U9RA 4N7TA 3QLHA 1Q8KA 2V69A 4FS1A 3LL3A 2HZCA 1C1CA 3TTDA 4KFBA 3QEXA 2JL9A 2HLTA 2DIUA 5IXUA 4JK8A 4EP4A 4TXSA 5KG3A 4DFMA 3BO3A 3OSPA 3CCRS 5GAEU 3ZSVA 1Z4UA 2RHKA 5CH7B 2KVQE 2FHJA 2OEKA 3BV8A 4IXCA 2PA3A 2ADCA 4CI6A 3SSRA 2HAIA 4DR7J 1NDKA 3IMQJ 1XC3A 2EXUA 4G6VB 4NO7A 3OPKA 1JCGA 3DLKA 1Z05A 4KHNA 1YIJS 3GP9A 4NLRA 1VSEA 1FRHA 1U2FA 5KPTA 4M3RA 1KAYA 3THPA 4OI0A 3ICLA 2ZD1B 1UJ5A 4EBDA 1O8BA 2PT0A 1RTHB 2Z4PA 3ELHA 4LF6K 2FBYA 1GLBG 3KJQB 3V9UA 1VQSA 4URQU 3PHEA 1FK9B 1VQMN 3J81U 1EIYB 5L8RC 2EC0A 4CD1A 1PBUA 1HMVB 3OTEA 2F4FA 3MMVA 1QHAA 2YQ0A 4FVCA 3DRXA 2XHWA 4KE5A 3AA5X 3WBZA 3SQ4A 3QAUA 3E9OA 4AXJA 3Q89A 2ZH7A 2OPPA 1IKXA 3SMSA 2V7ZA 4JI1J 5KFIA 1WSEA 2BMBA 3PYDA 4KB0A 5C2CA 1XK8A 3VGTA 4CT9A 5KRTA 3VENA 1XNQK 5ADZA 1LK5A 4RW8B 3D6HB 4F26A 1FRJA 1U25A 4QU6A 3DRYA 2FBTA 4YOVA 1VQ8N 5IT9U 3DC2A 3KMQA 3ISND 4BGBA 2IDLA 4JKGA 4G1QB 2BKOA 2Q3SA 2IY5B 1FE0A 4DV7K 2VDIA 3J81j 4BR5A 4CF9A 4LF9K 1H7WA 3IO1A 4OJHA 3NLCA 4LR9A 2XO7A 3FFKB 3UN2A 5D77A 2RRBA 3R1LA 2WTFA 3VGMA 4ZPTR 2DR6A 2CXEA 1F2HA 1RWNB 2OPRA 3KLFA 1JKHA 2HZVA 4HCCA 2DNGA 2UXDK 2MQOA 3THWA 2YHBA 3UR0A 2HWHA 4DUYF 1ZBUA 5HVFA 5K20B 4XH4A 3GFXA 3SMPA 3CJKB 2OPQB 4G3IA 1EP4A 3TSPA 4ZHRB 2W01A 2XZDB 3HCXA 1TKTA 4ZPCA 2W24A 4X66F 2YWKA 2XWXA 4RNOA 2BQ3A 3CSKA 4A61A 3HVTB 4RJVA 4F3QA 1X9MA 2VFTA 2IAJA 1KEKA 1HW8A 3MN6A 3MAQA 2WSEC 1NK0A 2PY5A 5LSOA 3PG9A 5M2UA 3VAFA 2DNPA 3PW0A 5HO4A 2I2YA 4JS5A 5KFFA 2YPYA 1BWEA 1RT3B 3VQQA 1FWLA 1YVUA 4KQZA 4USTA 2H3EB 2YNIB 3MF5A 4DV4J 1O6XA 3ZTPA 3UN5A 2QO3A 3OJUA 3H5SA 2W1BA 1BI4A 4GKJK 1EX8A 3MXJA 3CO9A 1BQNB 1NK5A 3MEDB 3FZBA 1RBTA 2VC0A 2A0FB 1HI8A 2GIQA 2Y0SD 2J0QD 4H5VA 1HYSB 4EO6A 3ZSYA 1WSVA 4LFCK 5SUHA 3BYPA 2PMZD 3CJQA 2QMWA 3CD0A 1K73O 2L9NA 3A8IA 3VR1A 3B78A 2OELA 4YB5A 1TP7A 1F9HA 1YX2A 3QGPA 1FX2A 2JEFA 4QIVA 2E5LK 3HT3A 2BE2B 4LUBA 2B9WA 3BDPA 5FLXO 1C1BB 3QNNA 1ATSA 2JGUA 3G82B 3AH6A 1ATNA 4CD3A 1NH8A 2PBDA 2GGPB 2EWHA 3G8TA 2NNWA 2P9GA 2YI1A 2LVWA 3EEQA 1UVKA 4IOBA 4ECSA 1VGYA 3SFGA 3ZSRA 1VQPS 2F8TA 1JWWA 3U3YA 3VGSA 1IM4A 3SAGA 4O55A 2XMUA 1HNWK 1DY3A 1EKSA 2Z0GA 1LFWA 3QESA 3ZTQA 4LF5J 1T0TV 4NA1A 1RAHB 1NOYA 3HFKA 4CERA 1XWLA 4LJMA 4AM7A 3ETMA 3R6LB 2Y0BB 3K8VA 4KHPJ 3LP3A 1VSHA 2LU1A 2EI5A 4JI4J 3RMAA 3NVMA 4A57A 5KFWA 1I51B 4YORA 5BR8J 2DNYA 3LGNA 3ATVA 2NXCA 2V6AA 4EP5A 5AQGA 2KKHA 2MQQA 3WT0A 1QLNA 3LPUA 4PKDB 4RW7A 1S59A 5F0XA 3SJJA 4K4YA 2BW2A 3HD1A 5D15A 1JLBA 1CEZA 2DISA 2CRLA 3MEGB 5LMUK 2LYVA 2BGGA 1LW2B 1UKUA 1CJUA 3LDLA 3D2EA 4FYXB 5CZXA 4CNYA 2E1CA 3KTQA 5AQYA 3H5YA 4FJXA 2JVOA 5I3PA 1RU1A 3O1BA 2HURA 3QRPA 4MKBA 1P9YA 3TA2A 3MM7A 4AHUA 2QGFB 2F9TA 2HBJA 3O5TB 2FHJD 2W2QP 3A4TA 4FK0A 3FE1A 3ILIA 1TELA 2CG4A 3UD3P 2KW4A 4BE1A 2M5YA 3KHRA 2HB5A 4ZTJA 1S6QB 5M1KA 1DBDA 1Y3KA 1S4EA 3AD7C 1FRXA 1IBLJ 1KP6A 2UYTA 1VQ9N 3S3OA 3CDAA 4DZ6A 5J2QA 2DY9A 1U26A 4BWJA 4X65J 1U1QA 1RTZA 1SZ2A 1U6ZA 5CA5A 2RKIB 3ZETA 3NOCA 3RYLA 1QQCA 4FJLA 1ZBHA 5AQJA 2ZM6F 1VQ5N 3CIZA 1QAJA 3QWPA 1RQ0A 1I6JA 5L46A 3T1YF 2NUBA 4LF8K 1X4BA 4ED6A 3C6AA 4DR7K 1LXJA 4HHUA 2KYZA 1BGXT 1YTUA 2NZCA 2QT7A 1IWAA 5U47A 5BPNA 3H0PA 3WHIA 2XMMA 2W2NP 3KLIB 2M8DB 4FP9A 4IOCQ 3WX8A 2VG5B 2B4VA 2RJZA 4UOHA 1PILA 1X9SA 4X4VA 1RDWX 2NRRA 1NUEA 1N32K 1HQEA 4M5IA 5KFDA 1B64A 3KKSA 1BUPA 2RN2A 2BJ1A 2R2SA 1OWXA 5C5JA 3CG7A 1PGZA 2PO4A 3DOMA 4P2XA 4OX7A 4NRTA 2AEMA 4PEOA 3MXHP 3CDUA 4IRDA 1KAZA 2DR7A 1Y64A 4LF4F 1E6VB 3FBCA 3ZX3A 4OI3A 1HD1A 2PMHA 4KBIA 2DRBA 1NHUA 2ALZA 2IVYA 1WNSA 3N5FA 4DG1B 2E7WA 1WDDA 1H73A 1VQOS 4DMNA 3NF6A 4AQYJ 3CD5A 4MIWA 3PR4A 4HT7A 4JI1K 3KK1B 4F3OA 4QPTA 1P6TA 3WNFA 1GK8A 3VF2A 2M4MA 4NPOA 1VK0A 2IM1A 4J9SA 2AJ4A 4J8FA 1HBUA 3JQKA 3VHQA 2HAFA 3VA3A 1FEEA 1QJHA 2IVMA 4Q44A 1TU0B 3O3LA 4JUZA 1C0UA 4CIEA 2UUBF 1DT9A 4M3XA 1VQ6N 1KONA 3QINA 1HLWA 3RG6A 3GE9A 3S41A 5CHCB 7FD1A 5F8HA 4QBUA 3DLBA 2FLNA 5HQ8A 1FX4A 3NBPB 3EGNA 4NA3A 4TN2A 4A62A 2VQEJ 1LWEB 1N5YB 1BISA 5DDOC 2A10A 1PYOB 3QETA 3CDEA 4DTUA 4PWUA 2KXHA 5G4DA 3K17A 5L38A 2UP1A 2OZMA 2O66A 1K9MO 2IOCA 2HKEA 5HAOA 1WDTA 4I4BA 1FKPA 2YQ3A 3QT8A 2F9WA 4MO4A 2CQ0A 4OYAA 1Q81O 1TKZB 4USVA 4PWDA 4NRUA 3GSDA 4ECXA 5M1PA 1VQNN 3MEKA 2HRTA 1MWMA 4AL5A 4WIQA 1SB6A 3CCLS 3KWGA 3WIUA 3X3UA 2DH8A 2FB0A 3VOVA 4Z37A 1LFPA 1FXLA 3ET6B 4DR2F 3L09A 2VF3A 1UA1A 2MZSA 5BYSA 1EHWA 3C16A 4I9QA 3J7ZT 3ZC4A 3EDQB 4HUFA 2P9PA 3ZT2A 5AXKA 4FOEA 5KQ8A 3OYLA 1GX6A 2DT9A 2WOMB 3H4DA 1NDPA 3CJ2A 2QZ8A 4USHA 5KG0A 4NCBA 4DV4K 3OBYA 3UVJB 4CEBA 2DPIA 2VFSA 3RVCA 1KLMB 5M1FA 3OXGA 1HKAA 5JLFA 3DKDA 5DRKA 4DEZA 3ENWA 2CJYB 4KR0B 4PA1A 4FLVA 3LP1A 4DTXA 2DRDA 1RHMB 2CQHA 5H1SV 1RBAA 1WG1A 5IFMA 3KKRA 2DNQA 1YK9A 3DOKB 4CK1A 3A13A 4OI1A 1DLOA 3EPIA 3MMBA 1DJ0A 4ZVOB 2AP6A 3W1YC 2OYQA 2IA6A 2HMIB 2F4VF 4AHTA 1KBRA 4LVNP 1FJEB 1S1XB 2KB2A 2GVDB 1S76D 3GV7B 3D6RA 4IDHA 2MZ1A 2CNKB 2HHTA 2PEHA 4DR5J 4I64A 1BC6A 3MMAA 4NYNA 5KAKA 2JWKA 4KIAA 2UV8G 3HSZA 3N9UC 3Q2SC 1SI9A 2QIFA 3OBWA 2IS3A 2DHXA 4YY3F 1VQKS 1J27A 2RF2B 3AO2A 1WBBA 4LF5K 3DXMB 4HACA 1RCXB 5HBMB 5KGWA 5KFYA 4YB1P 3AA9A 2J6SA 4KHPK 3RBDA 4JI4K 2VBZA 1GLAG 3TNVA 1YWXA 2EC2A 3L0QA 4OMFG 4U6PA 2CZ9A 4DV3F 2W9AA 3POTA 3J7AP 5IQ6A 2Y8WA 1SAZA 4JV2A 1KVCA 4IOAL 2O8DB 2NUUG 1VMBA 3J7YI 2DFFA 3P83D 2HS0A 2CZVC 3P39A 4Z2XA 2DR5A 3V6HA 2B4JA 4KGZB 1IUJA 4CLUA 2VG6B 2WVDA 1SCJB 4BWMA 3N0VA 4A8XA 4YOWA 1LXNA 2UUAJ 2W9CA 2HQDA 2GHVC 3SQ1A 4A2BA 4QZVB 3ZZYA 2A2DA 4OZ2A 3PFEA 1VQ7S 2BQUA 1AT1B 3B4DA 4NXNJ 1XR7A 4PQUA 1ZPWX 2DHHA 6FD1A 3NWGA 4LFBJ 1IBLK 4W90B 3FSIA 1TQLA 2O1PA 2CQ2A 3OYFA 4X65K 4QIEA 4NLVA 4G1IA 4BE2A 1LWFA 1WUUA 4IR1A 2HQGA 2P9KA 4DV0K 3MAAA 4HUGA 1U4BA 1BOTO 5D4OA 4PAAA 1L3VA 4KH1B 4BQZA 1WSRA 3QT5A 1Z25A 3GJSB 4DF4A 1K8KA 1TYQA 4B3RF 5AQUA 3V9SA 3IS9A 3TARA 3NCPA 1PC4A 2IIHA 1U47A 3AO4A 3QJLA 4JKBA 4A2AA 5JS1A 3OFGA 2R9LA 2FJXA 2NREA 2D74B 2X6NA 2QA2A 3CFPA 1TAUA 3SQGA 1L3SA 3L7OA 1WI6A 4XEIA 4Q2LA 3ZEUA 1QVGR 4QR1A 3ULEB 4R79A 3C6UA 2FPHX 4Z4FA 1B7YB 4TSXA 2V4RA 3PKYA 5AQWA 2KRBA 4PG7A 2LKZA 2OD6A 2P9UA 1RWVB 4BG8A 3OYDA 3KKFA 3BH7B 3CCSN 3G4SS 1S1UB 4AQYK 4RLEA 2C3YA 1WELA 4UUXA 4HHJA 2D3ZA 1I39A 4FO0A 5CABA 2KZMA 4FJIA 4JNEA 5DGAA 1XR6A 3G6YA 1GFWB 3QRQA 4DU8A 2FVCA 3OA9A 1W0HA 3Q2TC 1ZC6A 3MMJA 5L9NA 1BXNA 3GFHA 1TVRB 2EK1A 3NEKA 3WEEB 4LSNA 3OR1A 5B08A 2C2NA 1W25A 3Q23A 2NRVA 1KSPA 3K89A 4RNNA 5IM0A 1M5SA 1NGEA 3LM2A 3CMAS 1NGIA 1NSQA 3HI9A 2VODA 1HW9A 2B4OA 3BS9A 5KFNA 5HRPA 4OHWA 3MMCA 5JVGL 2C2RA 2VQEK 3AY9A 4HTIA 4K4TA 3K5NA 4BHQA 2H4WB 3C8YA 1GTHA 1HHQA 5KFBA 4H0VB 2D0BA 1NJYA 4LIRA 3VZHA 3P96A 3EY1A 4UQGA 4ZP8A 4CO5A 4NYZA 4DR4F 2CQIA 4ZVTB 5T7BA 2D7SA 2QWRA 4JKFA 2HVDA 2VCPA 1MMLA 3FKBA 1KCFA 3KLGA 4J9LA 2EBEA 3VALA 3W2WA 5EN1A 4YHHF 4A46A 5FROA 2H5IB 5A8WB 4GV3A 4BREA 3HI0A 3TWHA 3I87A 4KHYA 2QLWA 2FHMA 3QGHA 3G2XA 5DMRA 1UJ6A 2AP1A 1G1XA 2YX1A 5LJ5Y 1M90O 1VHXA 4C11A 5B7WA 3VAMA 3IBFB 4ILGB 1RT2B 2MKCA 4H0YB 5I42A 4Q0BA 1M1KO 1GT8A 1FJGK 4K0KF 5D0EA 2YHYA 4TU9A 1P8GA 1IBMJ 3CC2N 4M5DB 4PXCA 1N6QA 1WEXA 4L73A 2QE5A 4ISGA 4MIBA 2PAVA 3AAQA 1QD1A 2QYGA 1Q0NA 4FM1A 1EJ7L 2XHBA 4M63C 1RDUA 4PPDA 3EYZA 5AE3A 3GILA 2UXBF 2GZOA 5M1QA 1RE1B 2CPEA 4HT5A 1N48A 1IKVB 1BE4A 4DPOA 2ASLA 4QW8A 3A3NB 2HPUA 2FY8A 2JLEA 3EGWB 4GMKA 2RQKA 2DO0A 2KHDA 4ED5A 1OPZA 2NXEA 4CHZA 3MEEA 4H0TB 4B9MA 3GIJA 5GAEP 1WF1A 5GADI 3E2EA 2BDPA 1LW0B 3D5MA 4NASA 1GEHA 5KG6A 2KG0A 3H6EA 5KOXA 3M7VA 3V1RA 4DR5K 3K9KA 2QN6B 4WFNQ 4CJEA 1YRUA 5HLFA 2P5OA 1BQXA 2Z8QA 4KH5A 4RWXA 2OFGX 2VONA 1T9WA 2WVFA 1VAZA 1TAQA 2ZVSA 4FJ5A 4Y1DA 1VRTA 4B3OA 4ZJOA 1WSJA 2ZWHA 3O4WA 4IH7A 4HUEA 2AYGA 1W97L 2XS7A 4FXDA 2J7KA 2F5GA 2MZJA 2Y9HA 2IRXA 3BM7A 2LDYA 4DQRA 3E01B 1OO0B 4H54A 4JI6F 4NXMJ 4H03B 2V8GA 4FL9A 2DHSA 2A41A 4BACA 4UT4A 4OI6A 2HHPA 3RAMA 3BSCA 3D66A 2AW0A 1W26A 4CJTA 2J0SD 3HM8A 4PQAA 3DXKA 4K4VA 4FJKA 4JI8J 3AHPA 3V9WA 3L2RA 1S9FA 1WC4A 3PLAA 1JL2A 5B8HA 1SH3A 3OV7A 3JAMY 3LGMA 1TL7A 4H5RA 4CJQA 1RK8A 5C24A 2AX1A 3O8WA 1N34J 3MR6A 4ZP6A 2KXNB 3RR7A 2UUAK 1FRLA 4C4WA 3H1QA 2GMLA 2DTUA 2QLXA 2GAHC 1NNEA 1Q1KA 2JNJA 2UVVA 3ZTSA 4DSFA 2ILYA 1CJVA 1RT5B 2B5JA 2X74A 4BRCA 5C42B 4JI2J 1JB0C 1S7HA 1V3ZA 2J4RA 2IDEA 4NYPA 4LFBK 2L48A 1MU2B 1VIXA 3BYRA 2AGPA 3KUHA 4AF1A 3K5PA 1UEKA 1SJRA 2YXLA 3O80A 3OYNA 1RTIB 2V7YA 3IWXA 2JEJA 3O1LA 5A8KB 1ZPVA 3OR2A 4CNZA 2CPJA 3L95X 4AE5A 2BJEA 5A2QY 1PJ5A 4LIWA 3A1YG 3HOSA 5EU7A 1MROA 1YAGA 4FPRA 1JJ2M 3T3FA 1CS4A 3CCEN 4DSEA 2FVQA 2RU3A 3NG8A 3MXMA 3HJVA 4JV0A 3SI6A 2W7OA 2UU9F 1YI2S 2YX7A 3KWIA 4P7VA 3NGYA 4I6MB 3HPHA 2IVFB 2ITGA 4BDYA 4CIGA 1U04A 2ZJQQ 1E4FT 3DLGA 4B3SJ 3QLHB 5FPEA 2LCWA 5D4PA 1AA1B 1IBKF 1VSFA 4IOCL 5C2GA 2XWYA 3NCQA 3VAHA 4KFBB 3M8WA 2GTDA 5IQQA 5H9FJ 3DOLA 4I2PB 2VQFF 2E5GA 2IA0A 5EDWA 4EK2A 2G4BA 4BDZA 3CQ8A 5HRSA 2IVNA 3U27A 4F4AA 1QZ5A 3DLLL 3GG1A 2AYEA 1MNEA 1WHXA 1BO5O 1WB9A 4CZEA 5KFSA 4JI0F 1BQMA 2VOPA 1Y7PA 2VDHA 4O3OA 3DLKB 1IKYA 1WEZA 4ELVA 2YJFA 4L8RB 5FD1A 3LALA 3GOIA 2GWKA 4L74A 1AFIA 1SJ1A 2FD2A 1FFGB 1IKWA 1VBKA 4UZCA 3D6FB 3RW7A 4Q8EA 4HR2A 2M70A 2YNGA 4B9UA 3PZPA 3G25A 3L8BA 2MB0B 3CYMA 4ES2A 3VQPA 4DL7A 1GQEA 1RAJA 3KK3A 3UI3A 2QA4S 1NHKL 3CCVN 1O0PA 3OD2A 3HSDA 3D68A 3FZKA 3HVWA 2Z1IA 1O1WA 2F63A 2E44A 4CGDA 1Z26A 4L76A 2EG1A 3HSTB 2HYIB 3FZHA 4MKAA 1NJIO 3OL8A 1HNXF 2OPPB 3BZCA 4DR6J 1IKXB 3FC9A 3L3VA 3A3PB 3HF5A 4DF8A 3HL8A 2EFOA 4DU4A 3DRPA 4BRPA 3VZIA 1SKSA 2EFPA 1UFKA 2LA4A 2OKQA 4RBVA 3JTPA 2XY8A 4CIOA 2JRSA 4CTAA 5J1EA 2XY7A 1ZTTA 3R9PA 3CCRN 1LWCA 1EXQA 1Y3JA 3OVAA 3EZ5A 5DM6L 3NCRA 1I94F 2QKKA 2RQ4A 2D1CA 3MD1A 4AH9A 2IYIA 2RRNA 3CI5A 4FVUA 1FI4A 2L9WA 3D0GE 3OHAA 2ZE2B 3OUYA 5F0WA 2MYFA 5L9XA 4IO8A 1YIJN 1XMQF 2G2YA 1Q53A 2OPRB 3KLFB 4CRJA 3SZ2A 2HHXA 2W40A 1JXBA 4FW1A 4FPIA 3THWB 4PUOA 2MTLA 1DTQA 1HR0F 3RRHA 2XLIA 2DXFA 4GRSA 4CJFA 2C3UA 3P4UB 1V3RA 4ED8A 1GMUA 1FFSB 2ASYA 1TKTB 2YNFA 5LJVA 4O8UA 4J7CA 1QS4A 4RWTA 2KLAA 1NPPA 3FNNA 4WK1A 3PJWA 3T1HK 2AT1B 3B6BA 1LK7A 4WFBL 3RAXA 2IDOA 5C25A 3IAM9 2AEJA 3J80O 4OYXA 3FFIA 3SI8A 4F9OA 4YUDA 1PYSB 3CF5L 1DFDA 2M9KA 4QR0A 1RABB 2K2PA 4EZ9A 3ULHA 2HBMA 2VPWB 3LWMA 2XI3A 1K6YA 1RHKB 4FF4A 3MR2A 2N4DA 3DDNA 3CJ4A 1H2VZ 2R7TA 1XMOF 4F7VA 4H5WA 3ZT4A 3DDIA 3W3SA 3AVBA 2YTCA 4ZK7M 3GIMA 1BI4B 1WG4A 4BRDA 4QWBA 3EE9A 3PYFA 2XY6A 3M4XA 2WTUA 3QFHA 2ETJA 3G87A 4J2EA 2P8IA 1Q7YO 4YFUA 4DS4A 4MQ3A 4LBIA 1FEHA 3SSSA 5FDLA 1UEUA 1RKJA 4M94A 3GZ7A 3W9IA 4ZVUB 1BHNA 2E20A 2CQCA 5LM7E 4B3MJ 2YNHA 4I6YA 4CLYA 2EFNA 4K41A 1N0VC 1YG0A 4XPCA 2QI2A 2YCHA 4KTQA 4KKOA 3MECA 2DGTA 4M7YA 4KY3A 1SKWA 1D5AA 3MI7X 1NO8A 4U8YA 4NXMK 3UB5A 4DQPA 4NMXA 3TJ9A 3HZEA 2YKPA 1XHZA 2LQ9A 2HBLA 3OTCA 2W8LA 2GWJA 5KRSA 4CYUA 3TWZA 3GDQA 3H3NO 4JI8K 3G86A 1BA1A 2O4IA 2ZOFA 4AL6A 2HQCA 2UXCJ 3QIOA 3UE2A 4K25A 2OEJA 2IJNA 4ZIVA 3TR5A 4HHTA 2ZNZA 1W2BR 4F8RA 4U95A 4CVNE 1Q95G 3PXGa 2HHUA 5HMXA 3BEGB 3RU0A 1RYRA 1HIYA 1YVFA 4DQSA 4GC7A 4AL7A 4K8XA 4YR3A 4JI2K 3L2QA 2EX3A 5J2NA 2CJBA 3N79A 1NBEB 2ZH4A 4WYLA 1A5VA 2O8FA 2ROPA 3T1AA 3AA8A 4RW7B 5KFCA 3WX4A 3ZTOA 1NLVA 1QVFR 1JLBB 3KLHA 4HLBA 1KVJA 1NKCA 2NUHA 1CJUB 1OY8A 1RDRA 3DGPA 3D2EB 2KYXA 2FY1A 4K2JA 4WF9Q 3AVIA 1RB0A 2BKPA 1FRIA 3ETOA 4JI5J 3ALYA 1YBUA 4ZTFA 3THTA 4L3NA 3WNEA 1IXKA 2DGVA 3R7BB 4UUWA 4DSLA 3MM7B 5BYQA 1S72S 1TV6B 2W8KA 2KQ2A 2XNRA 2H51B 3IGVA 4Y1CA 2QMXA 3W62A 3G0ZA 3T5HA 4B3SK 3FZ2A 5GMDA 4KAIA 2ZHBA 2QLBB 3CJCA 2W7AA 5J2QB 3TO8A 2ZDPA 3TTCA 3BBFA 2KU7A 3HHNB 2AGQA 5H9FK 2G0JA 3ZETB 1TKDA 4OV1A 1RGVA 4ID1A 1VQPN 3PIOL 2GQCA 2K8GA 1Q9YA 1S9EA 3IN5A 3P8BB 4W5RA 1ZAXA 2KFYA 1IQZA 4DV2F 4XH1A 3F73A 1RAFB 3US5A 4BR7A 3THYA 1Q7LB 1T3OA 2RUGA 3M3ZA 3OSNA 3R3LA 2JLFA 1VOMA 5A0YA 2D3OR 1KQGB 1J9AA 1IR2A 5CR4A 3OYGA 2AHOB 3GFYA 2X6SA 5JUMA 3NAIA 4YP3A 1HQEB 2C2KB 1M5PC 4GMJB 3DOMB 2HFUA 2GEMA 5AQZA 4CHYA 2F8SA 1TMMA 4FZYA 4PYAA 1TUGB 3LZJA 3VPZA 3M2UA 3I32A 1HI0P 4DN0A 3NNCA 3BH6B 2AMCB 2DITA 3KXDA 4C8YA 3P38A 5GINA 2O8CA 2W7PA 3ENQA 2E5LF 4DR6K 3RW6A 4JKAA 5K8OA 2VBYA 3H90A 1YJ9S 1DAXA 4MYUA 3FLCO 3BR8A 5CE3A 1KTVA 1HYZA 2BXJA 1RAOA 3PYEA 1HBUB 4CLWA 4DL6A 4FPAA 2GBZA 1RU2A 3W7BA 3AD9C 3LANA 2N3LA 3AVFA 2P9IA 1UAXA 3CD7A 3OJSA 2MJNA 5KFXA 2AJ2A 1BMQB 1C0UB 3D2WA 1S0VA 3KG1A 3R5AA 3AOBA 3KK7A 3CJ7A 4KSEB 5KFKA 3MD3A 1E4GT 4WCEL 4WFAL 4C8ZA 3UR3C 1XBWA 3LQVA 4DSIA 4PZVA 1ZTWA 2O3DA 2YWHA 4OKEA 2Z1GA 1K73T 3NGIA 3RWUA 3MX2A 1R7IA 2J9DA 3PRDA 2ZH3A 5HP1B 1FKPB 3V4IA 4A59A 4B1ZA 4ZVPB 1JNZB 4ZOSA 5M1NA 4OX9J 2Z2LA 1VFJA 3TUJC 1TUWA 5BR9A 1SH2A 4PWDB 3E1YA 1UPPA 2GV1A 2RNEA 2BE9B 1UL3A 3JTNA 5CCLA 1K8AO 1XHXA 3HSGA 4DHVA 4LR7A 1ZOTA 4O0NA 3UO0A 4P74A 4BCAA 2A3ZA 3TUZC 1SPBP 4CK2A 5RUBA 1CG2A 2KVIA 3PV8A 5KFJA 8RUCA 4TVAB 1VBXA 3C16B 1JLFA 1S6PA 3UQSA 2JEGA 3RJMB 4FBUA 4I2QA 2VHGA 3CVKA 2P9PB 2WVCA 1VQON 4DUZF 1RWOB 3WQPA 2E1YA 5E3AA 3I0SB 4BRIA 1OS5A 4J9MA 3V6DA 3D1QA 5AXLA 4WKRA 3KUEA 3PX6A 5C0YA 2GO8A 2NXNA 4MK7A 3BF4A 1R0BG 4RU9A 5CYQA 3EGZA 3KUGA 4QYZJ 2DXEA 2V63A 2O01C 3ILLA 5DK5A 3DU5A 3HJFA 1T9VA 2WBNA 3WNGA 5FJ4A 2QYCA 1RCHA 3PRVA 8AT1B 3C6TA 3R3TA 2EBGA 4ZLNA 3LP1B 3ENVA 4NCGA 4DUYJ 2CQ4A 2F8HA 2AYMA 2LXUA 4JRPA 4B3MK 1RBOB 2O8EA 4O3SA 3MDFA 4OHYA 2MHEA 4CF8A 3BY5A 1DLOB 1BY9A 3MMBB 4X66J 5DLGA 2AU0A 2OJ3A 4KGVB 3K0JA 4DV6K 5B0GA 1HWJA 1RACB 1UZDA 1FDNA 4RBUA 2DD8S 2G8IA 2XEXA 5AR0A 3DM2A 2X1GA 4QWEA 3V6KA 5F3ZA 3MMAB 1G15A 4GY2B 4DLEA 3C0BA 4J2BA 4NLQA 2POKA 5C10A 3HM9A 2ZNYA 1YRXA 3CCLN 3MN5A 3OXLA 1CQMA 3HTVA 4KBOA 5EY4A 3H7HB 3BBCA 1EQYA 4HACB 4CHPA 2BBEA 2Q97A 3FBEA 2E6MA 2A1RA 4ITSA 3GG4A 2PGCA 5DO2A 2ZDOA 3L2VA 2YX4A 3MK6A 4BRGA 5ETVA 3NF7A 3IM9A 4CGHA 4BR9A 1NAQA 4TYAA 3ZYYX 2DNLA 3LDQA 3QDKA 5AXNA 4KHUA 4YQWA 1JLGA 1TUVA 5DETA 4RR5A 3RGIA 2I5JB 4A5BA 2CG8A 4Y6IA 3QT7A 2Z2YB 1MLAA 1RFQA 1WKJA 2F8EX 4JLHA 3N6MA 1NPRA 4H4MA 5A8RA 3KLEA 4TYBA 1U2VA 1Q8BA 5EOYA 2JFKA 1J54A 3M8PA 5HVGA 4K7QA 4OYOA 1EZZB 1P27B 4JI5K 3TU5A 3AY0A 4DV1F 1JCFA 4FJJA 3KD5E 5B0FA 4I9LA 2W9CB 3P5BP 1HWKA 3H45C 2A5XA 3UNYA 4OJ1A 2COLA 2MKKA 4AXIA 3D0PA 3GONA 5AFUH 4CHQA 2HFSA 4CGGA 2BRLA 4JI7K 4FLWA 4W5NA 4K8RA 1R59O 1K47A 1S6UA 2H5JB 2YHXA 2DNOA 3O5BA 3W2VA 2FVPA 1T9XA 3EICA 3P3DA 3QEVA 2RHQB 3RZAA 1A7GE 1N56A 1ASWA 2B43A 1KOOA 2XSJA 1LWFB 3EZWA 3FCHA 4FJHA 3MFHA 2Y8YA 1IQTA 3W0LA 3SNNA 4ISEA 1Q5VA 2W4CA 3DCAA 1JJ4A 1VQKN 3EX7B 4FWQA 2XG8A 4WZMA 3Q7BA 2ATQA 1K8KB 1TYQB 4LF7F 3C2PA 5LL6d 4GKKJ 2EFQA 2X7IA 3IS9B 4YN3B 2KN4A 4H0PA 5IZHA 3LUYA 1NPKA 3JS6A 2L3MA 1Y4ZB 1B3TA 3IWLA 1J5OA 1K9MT 3IR7B 5ADXA 2JFDA 3GIKA 3FR0A 2WBMA 2DNHA 1RT4A 3PUFA 4XAKA 3ZEUB 2XC9A 4CESA 3NH2A 2ZJPL 1PC5A 2IM3A 4E7IA 3K0SA 3THVA 4F4XA 1JLEA 1Q81T 3SCLE 1FFWB 1TK5A 5HN0A 5GAGU 3C6UB 3TZYA 2C22A 3KG4A 4Q2MA 4P75A 3BN7A 2Z1JA 1X9JA 1CSJA 5IT0A 1U1KA 3P5JA 5AJ3J 2BOAA 4DR3F 4JAXA 4LSZB 5DDRC 4E89A 1VC0A 2P9UB 4QQBA 2ZZTA 2BV3A 1NGGA 4ERDA 2B4PA 1RI7A 4ICLB 3SAFA 5MAOA 3MXIA 3KJVA 3VGVA 4ZVHA 4YOTA 2AJFE 1HKCA 3T1YJ 1PO6A 1YJTA 1N4LA 1X5OA 4K42A 4OYBA 2QG9B 3T9ZA 2BOPA 2B9XA 1R8BA 5DDPC 4K43A 1VQ7N 3HP9A 3M8ZA 4V19S 3CD6S 2PN6A 4O3QA 4Z4CA 1HNZF 3CJSA 4LSNB 1A5WA 3OR1B 3QNWB 1S6OA 5K8MA 2NYHA 4CO4A 3NMRA