1BQNA

Tyr 188 leu hiv-1 rt/hby 097
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPQKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNQQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords REVERSE TRANSCRIPTASE
total genus 114
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqnA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqnA05
2R8IA 1TAUA 5HROB 1CZBA 4J9OA 1N48A 2NUBA 1WSHA 2D3ZA 2D0BA 3K58A 1L3TA 2ATLA 3ZSZA 5DGAA 1LW2B 4G3IA 2OPQA 3MEGB 4ECRA 3NH1A 4KKOB 5EU7A 4AHUA 3QIPB 3C6UB 3H5UA 2XHBA 3HPHA 1IM4A 1KLMB 3DOLB 2W8LA 3JYTB 3GILA 1T7PA 2G8VA 4O3QA 5KRSA 1NOZA 5FRMA 1RBVA 1FXXA 3PW4A 4TYAA 4KSEB 4Y2CA 1ASWA 5KT7A 1LWFA 1F21A 3SUPA 3KLFA 3I8DA 4ZHRB 1C6VA 5KTQA 3OYGA 3G6VA 1LWFB 2WB4A 4F50A 3LANA 3DOKA 5DG7A 4DMNA 4MFBA 1IH7A 3SYZA 2ZD1A 1JL1A 1C1BA 3OS1A 1QQCA 2D0CA 4OGEA 1U45A 4E19A 3BR9A 3RBEA 2R2SA 4AHSA 4DQSA 2ASJA 4FLZA 3AVLA 2OPQB 2AX1A 2P1JA 3RMDA 2R8HA 4DQRA 2IOCA 4IDKB 3OYJA 1JXBA 3WNGA 1RT6B 4MK9A 4FJ9A 3SI8A 1I6JA 1JLBA 5HRRA 3HKWA 4DTXA 5KFHA 1U04A 3QGIA 1VRUA 3SJJA 2XWYA 1HYSB 3MXJA 2FC0A 5K14B 3HP9A 1J53A 2YNGB 3HVAA 2HB5A 4WYLA 5KFUA 2C2RA 1S9FA 2DFHA 1KSPA 3AA4A 4FK0A 3QGHA 2UVWA 3IAYA 3MEEB 4QWDA 5KGWA 2IJNA 4NLTA 1NJYA 3E01A 3BDPA 2W8KA 5DK5A 4R8UA 2AGOA 4B9TA 2HNDB 4IFYB 4CF1A 2IAJB 1SH3A 2YNFA 2XY5A 4DEZA 4QWCA 3ZSQA 3T1AA 1VSFA 3V6KA 4IR9A 4DFKA 3RB4A 3OHAA 3M8RA 3KNAA 2BQ3A 5F8JA 2VG5A 3RTVA 3H5SA 5KFCA 4BDZA 1NNDA 4ICLA 3B6PA 1NJWA 2XGPA 3AO5A 4W5QA 4EZ9A 4GMJB 3DMJA 4DG1A 3KMSA 5CYMB 3HVTB 3OYFA 4FJ8A 1SH0A 2IA6A 5CYQB 4NCGB 1RBRA 3CJ5A 3K59A 4KHNA 4H4MA 3H98A 5KT5A 2OZSA 3PZPA 4BWJA 5KFSA 2O5DA 5CYQA 3E51A 1T3NA 4MFBB 4YR0A 5J2NA 2ILYA 1YVUA 4CIFA 1LWEA 2VWJA 3ITHB 4IG0B 5I3UA 4TYBA 5HROA 2RDIA 4H54A 4ECTA 3NHGA 2XRIA 4PUOA 1B92A 1Z26A 4J2EA 4ECUA 2OPRB 2Z1IA 3HK2A 2VA2A 5KT3A 4CFAA 3OSPA 2UVVA 4Y1DA 4RW8B 3K5OA 3ZSVA 1QE1A 5JUMA 2J6SA 5KGXA 4ZP6A 1RTHB 4CK1A 4LSLB 3PW7A 1FKOA 1RT5B 4O4GB 2WOMA 3DYAA 5C25B 4O55A 1QE1B 4NLPA 4DSEA 3SNNA 3SZ2A 2D0AA 3NGZA 5I42A 2ZD1B 4DL7A 3OS0A 4DLEA 3M8PB 5F8GA 1TKTB 4MH8A 2YHBA 4ID1A 2B4JA 4FJ5A 4ICLB 4MIBA 3HVRA 2XCPA 2HNYA 3PJXA 3PHEA 1SKRA 3OJSA 4F8RA 3N6NA 3QYYA 4O3PA 3OYBA 1S1XB 3MECB 4F4YA 1TGOA 1S1UB 3SFGA 1VRTB 3K5MA 3VA3A 1RYSA 3G0ZA 5KFRA 2IAJA 2P5OA 3KLGB 3KMQA 3B6OA 5L9XA 3ZCMA 3EPGA 1NKCA 2WK4A 4ECYA 1S1TB 3RB6A 4EYHB 2HHWA 5C42B 4O4RA 3GIJA 4HCBA 4CEOA 5KFMA 4NYNA 3MTKA 1S1TA 3L2UA 4PA1A 3G6XA 4IKFA 2IC3A 3SUNA 1I3AA 4ZP8A 1T05A 4DQIA 3BQ0A 1GOCA 3NGYA 4CESA 4FZXC 4CJLA 5FROA 4F3OA 1YTUA 1X9SA 4KAZA 4KHMA 4J9MA 3T5JA 4NLQA 4RW4A 4CJPA 2BE2A 4H8KA 3ZSYA 4NLGA 3EYZA 3QETA 3PJWA 5E41A 4ZMMA 3ISNC 1ZBLA 3LP0A 3G6YA 1HMVB 1LWCB 4TN2A 3ZT0A 4KHUA 4M3UA 4E89A 2BRKA 4XO0A 1VRTA 4BE1A 3NGIA 4ECWA 4NLDA 1RAJA 4ZP7A 5DQHA 3N6LA 4JV0A 2JLEA 2V4RA 3TAPA 1U48A 4OVLA 2KFNA 3KLVA 1TV6A 4IG3A 1N6QB 2FBXA 2YNGA 4RW7A 3VQ6A 4CJWA 4FVMA 1TK5A 4QWBA 1K1QA 4CF2A 5EWEA 1C1AA 4DFJA 1DTQB 4CIEA 4U7CA 3T5HA 2W9BA 1WNEA 4M3WA 3WNEA 3KKSA 3HT3A 3BREA 1RA7A 3OYNA 4IG0A 3NDKA 3NMAA 3I5CA 3IG1B 2YNIA 2C28A 4CJ5A 2YKMA 1T8EA 3VQCA 3DLEA 1RDBA 1RDAA 1BQNB 1UOCA 5L1IA 2OZMA 3CQ8A 4FJLA 1S6QB 2XI3A 2G8IA 3FDSA 3VQ7A 1HPZB 1S49A 4DU1A 5F9NA 4CK2A 1S1XA 4Q44A 4B9UA 2JEJA 1NK6A 4QW8A 2BR0A 2JC1A 3TANA 1XR6A 2FVRA 3MXMA 3KLHA 4KFBA 4KBIA 4NRTA 4M94A 2HNZA 4O3NA 3D0PA 3AVIA 3OYIA 3Q8QB 4FJNA 3AVFA 2OPRA 2QKKA 2KQ2A 3DYAB 3HXMA 1REVB 5KFFA 1XC9A 1A5VA 3NFAA 4J9KA 2DPJA 2YNHB 3DM2B 1SKWA 2O4IA 2X6NA 3PUFA 3CYMA 1JLEB 4F4XA 4CJVA 1S9GB 2BANA 1TAQA 4LD0A 3BJYA 4C8OA 5KFXA 4CGHA 3TAFA 4BE0A 3LPTA 4NZ0A 3TQ1A 4DQPA 4KHSA 3G86A 3OHBA 4ECVA 4CK3A 4CF9A 4FZZA 4RW8A 3CDUA 4CJTA 3HPGA 4IFYA 2YNHA 3DM2A 1NOYA 2BGGA 3RB3A 1NK4A 4DFMA 1X9MA 2QXFA 4NYFA 4HUGA 1D9DA 4JLHA 2JGUA 5KG3A 3MEEA 4G1QA 1S6QA 4M41A 2UUTA 3PW5A 4HUFA 3DRPA 2HNDA 4EEYA 4QOZB 1QUVA 2OA8A 3BQ1A 3UDLA 1JLGB 4F4ZA 4F3TA 3CDWA 1X9WA 5KFLA 3O4NA 3L2VA 5J1EA 4OKEA 4FLUA 3VQDA 3I5BA 2RDJA 2EHGA 4KB7A 1SV5A 3BGRA 1W25A 3LALA 5HBMA 1RT7B 3KJVB 2D5RA 2DY4A 4Q43A 3ISND 1DTQA 1BQNA 2KW4A 4ID5B 2YNFB 1QAJA 1FKPB 4J9LA 1KTQA 1TP7A 2G8HA 3AVAA 4MK7A 4RUAA 3RMAA 4FLVA 3CFRA 4EP4A 1VSHA 2VG5B 4AILC 2FJWA 1KVCA 2Z1HA 3U3YA 3IGVA 4BDPA 4DF4A 1SL2A 3KK3B 1TVRB 3FFIB 1HPZA 1HNVB 3DLEB 2GIRA 4FS2A 2ETJA 4KI4A 2EX3A 4LSNB 1WSEA 4CJ4A 4CFBA 2BE2B 3RMBA 1RDRA 1U49A 2FLPA 1JLBB 2R2TA 3CJ4A 1SL1A 3PR5B 4OPKA 1JLCA 1RILA 3ULDA 1LWCA 2B6AA 4O44B 2WRMA 3GQCA 1U4BA 4IDKA 3M8QA 1A5WA 1VSMA 3H5XA 2UVUA 2VG6A 1WLJA 1VSDA 4N41A 2AJQA 4UQGA 2Z1JA 3TAQA 3BSCA 2YKNB 5DQIA 4PY5A 4FYDA 1W0HA 3LP2B 3RAXA 2WHOA 5J1EB 5KG5A 2F8EX 4CHQA 3S3OA 2AX0A 4YMEA 3KD1E 3M9NB 1JLQA 3V4IA 3UPFA 4DTJA 2FBTA 4F4WA 2G8WA 4BE2A 4WYWA 1KHWA 1L3VA 2GBZA 4OLBA 4FLYA 1IO2A 2Z1GA 4AHVA 4ZHRA 1CXQA 2CKWA 2I1RA 4IRCA 4KHRA 3CJ3A 4CFDA 1S0OA 5DG8A 3PV8A 5KFEA 1C1CA 5J2PB 2O4GA 4DTMA 4CJ3A 2PYLA 4OGCA 4U6PA 3JSMB 4I7FB 4X2BA 3NH2A 2WOMB 4DS5A 1KCFA 4OL8A 4KV8A 3CJ2A 4DQQA 5FDLB 4ZP9A 4DTRA 4NLWA 4LSNA 3H4DA 1YVFA 4E1MA 3LWLA 4FM2A 4ELVA 1IKWB 2JEIA 3WNHA 3OSNA 2P5GA 3DLRA 4CJUA 3AO1A 4JV2A 3CM6A 1S0MA 3GV8B 4HHTA 4CIGA 2ZQBA 3V9XA 4O5BA 4RNFA 3MECA 2QE5A 2ZKUA 1NHUA 1EP4A 4E7JA 3CG7A 4I2QB 5J2QB 3AO3A 1X1PA 1J5OA 1S9EA 2OPPB 4CGFA 4F4KA 2X78A 4WFYA 3KK1A 1ZYQA 4Q8FA 3LPUA 3EZUA 4Z4HA 4JV1A 4XPEA 3L8BA 1ZTWA 5F8NA 2ALZA 3TAGA 4IG3B 1N6QA 3T5KA 1EP4B 1WN7A 4DLGA 5HP1A 4KTWA 3SI6A 4JRQA 4K8XA 4HYKA 1L3UA 5KFQA 3QINA 1TL3A 3RMCA 2PYJA 1BGXT 1VSLA 4WZMA 4MKBA 2RPIA 1TVRA 5FDLA 1TL3B 2OPPA 4CEBA 3H08A 4W5TA 4PQUA 4BDYA 4H4MB 3TAMA 3QESA 1LAWA 4J9QA 3HVTA 4PUOB 4ZPBA 3H4BA 1RTJA 1HNIA 4B8CA 1UA0A 4N56A 1ASVA 4GC6A 4KB0A 1LWEB 2W9CA 3ZSWA 4CHNA 3HO1A 2X74A 4R5PA 2VWKA 3AVJA 2CJQA 5KFPA 4DU4A 1G15A 3G10A 4LSLA 2RF2B 1RTHA 4Q0BA 5DLFA 5KT6A 1R0AA 3MR2A 3U3GA 3EY1A 3V1QA 1S9GA 3FRZA 4DSKA 4RW9A 4CF0A 1RBSA 1LAVA 2HHVA 1ZBIA 2WCXA 1S0NA 1RDCA 1TL1B 1W9HA 3AVGA 3NGDA 2DFEA 2FJXA 4RW4B 3QIOA 4H4OA 2ASDA 3KHHA 2Y1IA 3NKYA 1NK7A 1WAJA 4WXWA 4I9QA 3L2WA 3QO9A 4KO0A 3I0SB 3HL8A 4M3YA 3H5YA 3DDKA 1S1VA 3E01B 5F8MA 4ECZA 3VQ5A 4K4TA 4NRUA 4KI6A 3VQ8A 3SUQA 1IG9A 1VSJA 4E3SA 1JX4A 4CGGA 4B08A 1Q8IA 5T14A 3VQ4A 3FSIA 4KTQA 1FKOB 4O4GA 4FW1A 1HYVA 5SWMA 3OL9A 4J9RA 3AA3A 1WSFA 3SV3A 4BWMA 3A2FA 1WSGA 3QEWA 3KLGA 4KO0B 5KT2A 4FJMA 1NKBA 5KFWA 4RW6A 3UIQA 3GIIA 1REVA 5KFZA 3AVMA 4K50A 1EX4A 1IKXB 4FJHA 3AVBA 2QKBA 3NF6A 1NHVA 4Y34A 1TL1A 4IH5A 5C24B 4EP5A 3V1OA 4ED2A 3PW0A 4DTNA 4FS1A 4HVJA 3C6TA 1CSJA 4YNQA 4EZ6A 4MKAA 4DWIA 5HLFA 1HRHA 1J9AA 2IMWP 1KFDA 4RW6B 4KHYA 1Z4UA 1JLGA 3KD5E 2YKMB 1HMVA 1FK9B 3C6TB 5KG7A 3VQBA 3HYFA 2YNIB 2ASLA 1LV5A 4B9NA 4FCYA 5KFGA 1DTTB 3OLAA 1RT7A 2V4QA 2E9RX 5J2MB 2G8UA 3C94A 3SPYA 1MMLA 1HQEB 4KPYA 1T03A 3ZT4A 1XR7A 4E7IA 3LAMA 4JS5A 4CJKA 2HHUA 1D1UA 3QIPA 4QWEA 3TAMB 3TAEA 1N56A 2IJFA 1ZBUA 3KIOA 1KRPA 1RTIB 1LW2A 4ECQA 5KFOA 1HQUA 3RRHA 2W9CB 4C8LA 1SL0A 3NAIA 3O4QA 4F2SA 2KZZA 2A1SA 4FK2A 3IS9B 4CERA 5EWGA 4CE9A 4FBTA 4TY9A 3O3FA 4DTPA 1HYSA 3KHLA 3U6FA 4EBCA 4H4OB 2IM3A 1YTAA 3IS9A 4N47A 3VN5A 3PO5A 1XI1A 4RNOA 3LZJA 4CEAA 4CGJA 1QTMA 1S4FA 2HNZB 3M8PA 3PW2A 5DMRA 3V6DA 4E7LA 2R8JA 4OKKA 4E7HA 4QAGA 5DQGA 4FW2A 4FLWA 4YQWA 3NL0A 4HCCA 4B9VA 4DTUA 3QIDA 4KRFA 3S3NA 1A5XA 2XCAA 4PWDB 3CFOA 4DL3A 4CJQA 1IKYA 4RNHA 3AV9A 3V6DB 4O0JA 2IM2A 4ECSA 4IH7A 1KLNA 3PO4A 4ZTFA 4Z4IA 3L2RA 4LQ9A 3DLGB 4I2QA 1RTDA 3CM5A 3HSTB 4URSA 3ZT2A 1WSJA 3CIZA 5KRTA 3DRSB 4IOBA 1CZ9A 4B8AB 4I7FA 4TY8A 4B9MA 3ZSOA 2ATQA 3RWUA 3V9SA 2JEGA 5KFJA 4YFUA 3NBPB 2D3UA 3V9UA 3T19A 3OYDA 4O3RA 4KHQA 3PY8A 1JLFB 1QHTA 2R7YA 1ZBFA 5HLFB 2UVRA 1DLOB 3K2PA 3DOLA 3K5LA 4GVMA 1BISA 5KG0A 5C42A 2FVCA 4XIUA 3SCXA 3VQPA 5KG1A 3MR5A 3MR6A 2V9WA 2B5JB 3DMJB 3WNFA 3DRRA 1OS5A 2QV6A 2J6TA 4K4YA 4R0EA 3NF8A 4FK4A 3TABA 3MXIA 2GIQA 3RRGA 4RUCA 5EDWA 2HW3A 4NLOA 4FLXA 3MFIA 4ED3A 4WFZA 2HHQA 1LW0A 2F96A 2IM1A 4AHRA 4AHCA 4CCHA 3FQKA 4NLXA 4CEFA 4MK8A 1BCMA 1WNSA 3VQAA 1JXLA 3LDSA 4QWAA 4RW9B 3MAQA 3NAHA 1HNVA 5HRPA 4TSXA 2ZE2A 3S3MA 1GX6A 2WONA 3SUOA 4PWDA 1R0AB 1KLMA 5KFIA 1N4LA 5C5JA 4N76A 5EWFA 5HRSA 1BL3A 3KLIB 3V81B 4B9LA 1QS4A 1SUQA 3QZ8A 2AQ4A 4CHZA 4Z4EA 4KE5A 1TKZA 3D45A 3OYEA 1TQLA 1C1CB 5J2PA 3M9OB 1U47A 3FFIA 4ED0A 2AGPA 5FRNA 4CHOA 4Y2AA 1O1WA 2D41A 4Q5VA 5KFBA 1C0MA 4URQU 4DF8A 4W5NA 4ECXA 5KFKA 4WXOA 3CVKA 1RBUA 1TKZB 1XR5A 1RYRA 3AO4A 3VA0A 2BRLA 4ED8A 4Q45A 3SV4A 1TKXA 3KHRA 4CJRA 5CZ1A 3M9MB 3AA5X 4JUZA 5I42B 2B5JA 4DFPA 3MF5A 4M3ZA 2HHXA 2IM0A 2HMIA 4E7KA 2GC8A 4CHPA 2YKNA 4J9SA 4KAIA 1D8YA 4FJJA 4TXSA 1I39A 1K1SA 3T5LA 2G8FA 3SQ2A 3ZT1A 1S1VB 1JLFA 1HARA 3F73A 3AVCA 3OYKA 3C95A 1RNHA 5EUHA 2BDPA 5HRNA 1VSKA 4LH5A 3KLEB 3QEXA 4ED1A 4Z4CA 4YR3A 5L1KA 1ZTTA 2I5JA 3KK2B 3D5MA 4IH6A 4E1NA 4W5OA 2RKIA 2E6LA 1D5AA 1C0TA 4CEQA 3QEVA 3OYAA 4CJEA 1RT2A 3OL8A 3UQSA 1FK9A 3Q8RB 1JLEA 3KJVA 4KTZA 3CWJA 1TK0A 1XWLA 5JS1A 1NJXA 4Z4FA 3H2LA 3I5AA 2E9ZA 1K6YA 4KV8B 4Y3CA 4YP3A 3NAEA 2XY7A 2KZMA 4DG1B 4M3TA 1Q9YA 4NCGA 3NBPA 3OS2A 4ZVHA 1KVAA 4M45A 4MQ3A 4FM0A 3AVHA 2C22A 4CGIA 4C8MA 4IQXA 1S5JA 1FKPA 2XC9A 1NK0A 1WSIA 3TARA 3BQ2A 3RB0A 4Z0UA 2XGQA 2HWIA 4NCAA 1TK8A 2BQRA 3MR3A 1GX5A 4OPJA 3ZSRA 3LWMA 4FZYA 3THVA 3P1GA 3BSNA 4EBDA 4IR1A 4JS4A 4ED7A 1J54A 5KT4A 5I3UB 4FJIA 2IGIA 1NK8A 4ZPCA 1EETA 1BI4A 4DU3A 3KLHB 2HVIA 1C0TB 2JEFA 3DI6A 2OH2A 2LSNA 4DS4A 1C2PA 4O3OA 3NCIA 3QNOA 5HP1B 3OYLA 1C0UB 3QZ7A 2ZE2B 4LQ3A 1C1BB 2ILZA 2R2RA 3S9HA 1NKEA 5CYMA 2W7PA 3OY9A 4K4UA 3DOKB 3KK1B 3OJUA 1S1WA 2R2UA 3I0SA 4WE1A 1JXEA 1Z25A 2Y1JA 3QEPA 4RW7B 3MFHA 3DLHA 4F2RA 1RT3A 3KLFB 4CEEA 1VRUB 4I2PB 3LZIA 3NF9A 5KG6A 4C8NA 1XHXA 3L3VA 4IRKA 4I9LA 3AVKA 4FM1A 4DL4A 2BQUA 4M42A 1VSIA 1SKSA 3HJFA 1BQMA 3MEDB 3V81A 3KLIA 3C6UA 2XO7A 2KTQA 2W42A 4M3XA 2W9AA 5KFDA 1HJRA 3HM9A 3DLKA 1SH2A 1TKXB 1N5YB 1T03B 4DTOA 2D7SA 1L3SA 3F9KA 4K4ZA 1JIHA 1S9EB 1JLCB 3QO9B 3DLKB 3QGGA 4CF8A 4DL6A 1UWBB 2HHTA 4QPXA 2DFFA 4KFBB 2GUIA 4LY7A 1QAIA 5D3GB 2VG7A 3I0RA 3H59A 1RCHA 1IKXA 3RAQA 1YT3A 1RT4A 4CFCA 3BSAA 3V9ZA 2F8TA 4FLTA 1RT4B 4IRDA 4TLRA 1IKVB 3CFPA 2QK9A 3LP1B 5F9LA 5D3GA 1JKHB 2V0NA 3MEGA 4RNMA 4FXDA 3DLBA 3SQ4A 5KG4A 4EO6A 2IBKA 3OYMA 4KKOA 2HWHA 1VSEA 2B43A 3O3GA 2X6SA 3DLGA 1RTDB 3HVWA 4ID5A 4ZVGA 1J5OB 3LP3A 2AU0A 3BGRB 2G8KA 1SV5B 3HP6A 4NCBA 3QLHB 5KFVA 3CDEA 1JKHA 1NJZA 3HHKA 4DSFA 5T7BA 3OL7A 1S1WB 3V1RA 2YV0X 3NE6A 1HQUB 4CEDA 3IRXB 4E0DA 3DRRB 2FBVA 4CJFA 2FVPA 2W7OA 4DL5A 3EPIA 3LP2A 3SFUA 2A1RA 3GV7B 1S48A 5C25A 4DSJA 5L1LA 4TY8B 4M3RA 4CJSA 1JLAB 3M8SA 3K5NA 1UWBA 3EZ5A 1RT3B 4ZPAA 2WTFA 4WE1B 4O44A 1Q9XA 4M95A 5J2NB 2C2DA 1RT1B 3GIKA 3N6MA 5HBMB 1S10A 2JC0A 5KFYA 3IN5A 5L1JA 1BI4B 3Q8SB 3MEDA 3VQQA 3ITHA 4KREA 3LP1A 3D28A 4O3SA 3ZSXA 1GOBA 3OYCA 1ZBHA 4TQRA 1IKYB 2E9TA 4HKQA 4IBNA 1RA6A 3VQ9A 3KK3A 1UA1A 1S1UA 2FVQA 2I5JB 1RT5A 4K4SA 3TVKA 4OJRA 2ITGA 5J2MA 1WAFA 2PY5A 3RR7A 4RZRA 4B3OA 4B9SA 3PX4A 3RBDA 4FJGA 3RR8A 2F8SA 4KHWA 4QCLA 2B6AB 4FJKA 3PX6A 2OPSB 1N5YA 3TR8A 1ITGA 2XY6A 2HMIB 3HPOA 1QSYA 4NLVA 4DL2A 4EO8A 4ELUA 1U09A 4J2BA 3GV5B 1B9DA 1IKVA 4LH4A 1BHLA 4K8ZA 1BQMB 1RT2B 4HTUA 2FJVA 3OL6A 1XHZA 1BCOA 3P83D 4MIAA 3AVNA 1TKDA 1NK5A 1GOAA 1ZETA 4DSLA 4EYIB 2RKIB 1KVBA 2VG6B 1RT1A 1RT6A 3JSMA 4RG8A 4WZQA 3KLEA 3FQLA 3L3UA 3P5JA 5F8HA 2R8KA 3NH0A 1S6PA 1BIZA 2IC3B 4DTSA 1C0UA 2VA3A 2GV9A 1DTTA 4CHYA 4Z4GA 3DI6B 4K4VA 1IKWA 5F8IA 2E6MA 3LP0B 5F8LA 4R8UB 5KFNA 1B9FA 1CLQA 1EETB 4ELTA 3CO9A 5C24A 2RF2A 4Q0BB 3IG1A 3CJ0A 3ZT3A 4G1QB 4JRPA 4HUEA 3KK2A 4O0IA 1EKEA 5JS2A 1S6PB 2WONB 4IFVB 4R5PB 4ZPDA 4XPCA 2E4LA 2KFZA 4CEZA 1T05B 3KOAA 1NK9A 3V6JA 3VQEA 4N5SA 3QNNA 3L2QA 4DSIA 4GW6A 3T3FA 4FBUA 4NYZA 2PZSA 1JLAA 3JYTA 3PVXA 5DGBA 3GYNA 1S97A 1TV6B 4FJ7A 4W5RA 4IFVA 2OYQA 3OLBA 2FLLA 5KI6A 3KKRA 4RNNA 3BSOA 1KFSA 3TI0A 1QSSA 4NLUA 3V4IB 1CXUA 4AHTA 4Y1CA 2DTUA 3ASMA 4NLSA 2HVHA 5KFTA 4FJXA 3PX0A 5DLGA 2C2EA 4L8RB 2HNYB 2YHAA 2FLNA 3OYHA 4PQUB 3LAKA 1Y97A 3M8QB 1TKTA 1D9FA 2OPSA 1UAXA 3OVNA 4CGDA 3SQ1A 4B3OB 4J2AA 1SUQB 2HHSA 1HNIB 2FBYA 4J2DA 3H40A 5DG9A 3Q8PB 4ZVFA 4ZVEA 4BACA 3VQSA 3ICLA 1RBTA 2AGQA 2EC0A 3SPZA 5SZTA 2BANB 1L5UA 1D0EA 3QEIA 4NLYA 1QSLA 1ASUA 3AA2A 4J9PA 1KHVA 3V6HA 3PR4A 5J2QA 4I2PA 4AH9A 1JL2A 2HAIA 1LW0B 3DRSA 1MU2A 4OKJA 1RDDA 1BIUA 2Q3SA 3V9WA 4K4XA 3KTQA 5CY4A 2XI2A 4Q8EA 5CZ2A 2P51A 3AO2A 2J6UA 1VK0A 1RTJB 2FVSA 4J9NA 4GC7A 3QERA 3O3HA 3SQ0A 4RU9A 4ZTJA 4OLAA 1HYZA 1EXQA 3TWHA 1DLOA 4YR2A 3ALYA 4NLRA 3IGNA 4ED6A 4KB1A 2R8GA 2DPIA 4C8KA 2RN2A 1JLQB 1T94A 3DRPB 2AWZA 3KHGA 5JXSA 4CECA 2IDOA 4QW9A 4K4WA 3UR0A 3K57A 4URGA 4EBEA 3IRXA 2IS3A 2UUWA 5K14A 1HQEA 1RTIA 1MU2B 4WFXA 2XY8A 3QLHA 3GIMA 4TQSA 4IKAA 5KFAA 2VG7B 3I0RB 5KG2A 3NF7A 2W9BB
chains in the Genus database with same CATH superfamily
2R8IA 5HROB 1CZBA 1FVQA 2LVWA 2CQHA 1EKSA 2D3ZA 1L3TA 2ZHBA 1AUSL 4JAXA 3VEOA 4G3IA 2F65A 2OPQA 1VQ7S 4HL9A 3HSJA 3MX5A 2J9DE 2HQFA 3C6UB 4USUA 3CCQS 1IN0A 3DOLB 2IVYA 4LR7A 3M1VA 3GILA 2GELA 5KRSA 4LF6K 1RBVA 4Y2CA 3W9HA 2PSZA 1IR1A 1WTBA 2PGCA 2VV5A 1HWIA 3FGVA 1LWFA 3W2VA 3KLFA 3I8DA 4R25A 5KTQA 4M8LA 2WB4A 3NCQA 1YG0A 2A18A 2ZJRL 3MWPA 3DOKA 5DG7A 4I68A 3FVYA 4OX9J 2ZD1A 1C1BA 3OS1A 5HI7A 1FWKA 1DT9A 1RWUA 3BR9A 4AHSA 1DZ5A 3T6JA 1RZMA 2KG0A 4FLZA 4P9SA 2OPQB 4MLEA 3KUEA 4DQRA 2WVEA 2CVEA 1JXBA 1OH8A 5LL6Z 1F9HA 4I6MA 1X5OA 1IBKF 1NDKA 3G4SS 3FNNA 3LGHA 3QT7A 3HKWA 2IBOA 4C3LA 3QGIA 1VRUA 3M6UA 4OYZA 3SJJA 1OY9A 1T9VA 5K14B 1VK3A 1WG1A 2F3JA 3TR5A 1J53A 3HVAA 2HB5A 1ESVA 4K42A 2L3MA 2ZH1A 2DFHA 4PKHA 3MXHP 2H5EA 4ANEA 4AQYJ 2D9PA 4CYUA 2CAJA 3BDPA 1KP6A 4DX5A 2W8KA 3GJRB 1VHXA 3O8MA 4IFYB 4CF1A 1SH3A 4KC5A 1RADB 1RKIA 3GU0A 4XH5A 2QEXS 3QJLA 1VSFA 3I8BA 4DFKA 3OHAA 4CH1A 3M8RA 2VG5A 1HBMB 5E0OA 1NJWA 4JI6K 5GMKa 2M7SA 1OPZA 4WTOB 4EZ9A 4A8SA 4JI0J 3TUZC 3OYFA 3MM6B 1FVSA 5CYQB 3ONQA 4ZN1A 4RUBA 3PZPA 3UKUA 4I0WA 5CYQA 5LSRA 4OPAA 1HI1A 1T3NA 1S5ZA 2GMHA 4K2JA 2ILYA 1IBLJ 4DR6J 1YVUA 4OHYA 4B1YB 4CIFA 3DU6A 1BG3A 4TYBA 5EX3A 1D9AA 3SQOP 2M52A 1D8ZA 4DMZA 2C42A 5ETTA 1Z26A 4M5GA 1GH8A 3RSEA 2PAVA 4ECUA 2Z1IA 3ZZOA 1IBMJ 2QMWA 1H0HB 3MPVA 2KT3A 1QE1A 2YWFA 2J6SA 5KGXA 3CDBA 4CK1A 2YJEA 4LFCK 2RSQA 1RT5B 1EWRA 4U9RA 3DYAA 4J91A 1QE1B 3C6AA 5GAHP 2EC2A 3THPA 4NLPA 4DSEA 1KAZA 2D0AA 1GMVA 1VQ8N 3GR1A 3M8PB 1JNRB 2ZKTA 2YHBA 4ICLB 4MIBA 2Y9HA 3HVRA 4X4VA 1SKRA 3OTBA 2C3MA 4ANDA 3N6NA 3G6ES 3TTFA 7FD1A 3O9RA 5LJ3Y 2P6SA 2KDOA 3SFGA 3K5MA 2I8EA 2ZH9A 4MDAA 2ZFHA 5AXNA 2LMIA 3CMAN 4ECYA 4EYHB 2RRBA 4O4RA 3GIJA 4OHXA 2RILA 5KFMA 4CBUA 5F0XA 3M2RB 1W97L 4F9OA 4IKFA 3SUNA 1I3AA 3DWLA 2XNRA 2N3OA 4S0MA 2O8EB 1UJ5A 3AT1B 4NXMK 4CESA 3G82B 2VQFK 4JB8B 2XLIA 2XMUA 3Q24A 2UXCK 4KHMA 1F0XA 4NLQA 2MTLA 1TL7A 2G1DA 3ZSYA 3BN4A 1IQZA 2DGQA 3PJWA 3SBTA 4NI2B 4ZMMA 1N32J 3LP0A 1P1LA 5IC6B 3U02A 1HR0K 4KHUA 4E89A 2V2QA 2FD2A 2BRKA 1H74A 4BE1A 4PPDA 4ECWA 4ZP7A 2ZH2A 3N6LA 4JV0A 2KFNA 2ZC3A 4IG3A 2FBXA 3VAJA 4YOWA 2YNGA 1FDAA 2RNEA 4LF4K 4CZKA 3BPSP 4CIEA 3N28A 2W9BA 3BF1A 3OTCA 1KQSM 3BBBA 4KHPK 4XH4A 3CCVN 3I6PA 2G2OA 4FYYB 2O8BB 4AF1A 4B3TJ 2LA4A 1RDBA 3KUHA 1BQNB 1N8RO 2QEXN 4QS9A 2U2FA 3ZTOA 2G8IA 1XMOK 4Y0WA 3WXIA 4U7UD 3DJCA 4CK2A 1S1XA 2ZJQL 4Q44A 1FJGF 1P27B 4B9UA 4HI2A 4FO0A 1P90A 3TANA 2YCHA 2HMPA 2DHHA 5H9FJ 3R7BB 1MMDA 3MXMA 4NRTA 2NRVA 3KJNB 5IFMA 4OHVA 3LO3A 2V8VA 4KRWA 3CSKA 4B3SK 4ZS6A 3JS9A 4FJNA 2AP1A 1URNA 2KQ2A 3DYAB 1REVB 3BV8A 3PEHA 4DHYA 5KFFA 1HQ2A 3BYPA 2DPJA 2B9WA 3B4DA 3F56A 1UZHA 1SKWA 3UDVA 2X6NA 4CJVA 3Q89A 4QU7A 1S9GB 2BANA 3BJYA 5KFXA 2LEPA 5LM7E 5K8OA 3TAFA 4U7BA 3FC9A 2E2PA 1RWOB 3CQYA 4KHSA 3G86A 3TZXA 2D4WA 1SJ3P 2O3DA 3JB9k 5BR9A 4CF9A 4FZZA 4RW8A 4LF6F 3H46O 4NLCA 4DV4K 3R6LB 1NSQA 3BGUA 5T7LB 1X9JA 2WZ1A 4H0OA 2Z56B 1NK4A 1ATRA 1X9MA 2QWMA 2BE9B 4JLHA 2ADBA 2CJ9A 2AA4A 3PW5A 4HUFA 4EEYA 1QUVA 3BQ1A 3UDLA 1XMQF 4Z37A 3CDWA 5CXTA 1RTZA 2QLJB 4F67A 3L2VA 4OKEA 3TJ9A 4FLUA 1QD1A 4OYIA 4FVUA 4USTA 1PSDA 3T1YJ 1W25A 5AQIA 3H6EA 1N5SA 4CTAB 2KW4A 4ID5B 1QAJA 2HIYA 2EKNA 4MK7A 3NCRA 4RUAA 4YOTA 3CFRA 4EP4A 3KKFA 2FJWA 2F9TA 3U3YA 3KK3B 5IT9O 1HNVB 4L72B 3B54A 1LOTB 2EX3A 4LSNB 3O08A 4B3TK 2A5XA 3RMBA 4U7UK 4I4BA 1JLBB 4OZJA 2PA3A 2HZCA 1N8RT 1NRKA 1YGYA 2XB2D 3R8EA 3ETOA 1UVKA 3FJ2A 1Z2LA 5E3QA 2CFXA 3D6FB 1YRTA 4N41A 1WLJA 4B9QA 1VQ6S 2I9SA 4PY5A 1XNRJ 3MAAA 2WHOA 5J1EB 2VIHA 5KG5A 4LF8J 3UN5A 2MGZA 1IM6A 2VPWB 4YMEA 5K5MA 1IBKJ 3QMLA 4DTJA 3KNGA 2POKA 4WYWA 1Y10A 1CXQA 3GE1A 1WHXA 3O9QA 4IRCA 4KHRA 4DU7A 2P9SA 1ZM9A 2F7VA 3CJ3A 1RKJA 4PKIA 4CFDA 3PV8A 1C1CA 5J2PB 1AW0A 4AM6A 2O4GA 2PYLA 2E1YA 4OGCA 3VGLA 4X2BA 1NPRA 1E6VA 1NDPA 4C98A 1U1MA 2RUSA 3ZO7A 5FDLB 3Q83A 1ATSA 4E1MA 1QTNB 3EE8A 1Y7PA 3OSNA 4LRBA 4JV2A 1S0MA 1K44A 4H5VA 4BS2A 3GV8B 1UZDA 3NGTA 4O5BA 3CD6N 2ZKUA 1FNXH 4DX8H 1EP4A 5LMUF 4CLPA 2HHHF 2FSKA 3TVZA 1UVJA 4CGFA 4BRKA 4V19X 2VBXA 4H5TA 3EZUA 2H48B 4PKDB 1AROP 3BUZB 3EICA 2UXBK 2ALZA 1T9XA 3TAGA 5DZ7A 1WN7A 3WUHA 5HP1A 5C0YA 3I55S 4JRQA 2IFXA 5G0RA 3QINA 2P9GA 1T6CA 2PYJA 1F60B 3GMGA 1VSLA 1X4BA 2RPIA 5A8RA 5FDLA 2MEWA 5GMDA 3H08A 3FZBA 3T9ZA 2MKYA 4BDYA 4H4MB 2N7CA 2QTWA 1ATNA 1LAWA 3DKDA 3W7BA 3H4BA 2R3VA 4DHVA 3HZ6A 4B8CA 2A3ZA 2C2MB 2LFVA 4ILMA 4CHNA 3HO1A 5EVZA 3CTRA 5C7PA 5KFPA 2RIJA 3OR1B 3G10A 4BC9A 2ZH4A 1M5VC 4LF5K 4K5SA 2NS1B 3IWLA 4ENOA 1FTRA 2OCEA 3QT8A 4RL1A 1NUEA 4O23A 3V1QA 3FRZA 2Z30B 3G8SA 1NHKL 2HBZB 3WQUA 1LAVA 2HHVA 3UCUP 3MMCB 1NMEB 3L0QA 1RDCA 1G4CA 3E66A 3AVGA 2WVCA 3NGDA 3ZX2A 5BPNA 4CO4A 1NGFA 3CC4S 3W2WB 1BUPA 3NKYA 2W2OP 4PG8A 1CLFA 4PRFA 3HL8A 2DJWA 1S1VA 4RBTA 3L4IA 3OUYA 3CCZA 1IG9A 1VSJA 2K2PA 1JX4A 2DH8A 3I87A 2QG9B 4JI6F 5T14A 4RCHA 4X62F 3HTVA 3FCHA 5CZVA 5IS2A 2BJEA 1HYVA 8ATCB 4FW1A 3OL9A 5SWMA 2EK6A 5M1FA 1QUPA 3SV3A 4BWMA 1WSGA 2B9YA 2QA2A 4KO0B 3OTEA 2A2DA 4XTTA 5B0CA 4RW6A 3UIQA 3GIIA 1REVA 2BH1A 2M2BA 1FJGK 3HHEA 3OT9A 2H54B 3VGUA 2H4YB 1FF2A 1KBRA 1NHVA 2M0GB 4Y34A 1KTVA 4U8VA 2ZOFA 5C24B 3VGKA 5AR0A 3B82A 4DV2F 2ZBQA 4ED2A 3PW0A 1U02A 4HVJA 3PRVA 3FBFA 3R3LA 2DBBA 1SS6A 1P9QC 3TVYA 3OXGA 3BZKA 3GFYA 5A8KA 3CW2C 4LFBK 5FPNA 3C6TB 2C3YA 2J0XA 4JYAJ 2HQ3A 3HYFA 2ASLA 1LV5A 2O8BA 1T3VA 2JLGA 3VENA 1WBDA 1BOTO 5JJBA 1TL7B 5AQWA 1I1GA 4UY85 2E9RX 3TYTA 2XS5A 1SKUB 3QBXA 4A2BA 1Q7LB 1IQTA 3X1LB 2HHUA 2MSTA 4QWEA 3TAMB 1LK7A 3O9TA 1LOUA 4WPAA 1OY8A 1ZZNA 1N33K 1UMJA 2HSTA 4OLPA 1KRPA 1RTIB 3OW2R 4GKJF 3ETMA 4CVNE 3TX8A 2Q79A 4B3MJ 4JI0K 4F0KA 1SL0A 1UFLA 4F36A 3QJJA 2CNNB 2E1AA 2GA7A 3SMSA 2HSEB 4FBTA 3O3FA 4PCQA 1U0HA 1IJFB 3NGKA 5BPMA 1MN7A 4PEOA 3LGNA 1RXOB 4WFBL 1EQMA 1ITPA 4PG6A 1QTMA 4DR1F 2FXUA 3J7AN 4L76A 2V8DA 1XTZA 4B3RF 2NRWA 2GS8A 4ES2A 2R8JA 4E7HA 1XN9A 4NB4A 2EWHA 2O8DB 4YQWA 3NL0A 4QQBA 2AIRB 3JQKA 3HSCA 2G0JA 4MO4A 2XMTA 1A5XA 4YHHK 4OQJA 1DGKN 5H1SQ 2CDQA 4RNHA 3AV9A 2IM2A 2BJ1A 3J7ZT 4DV5J 4ECSA 3PO4A 5HL7Q 4BR9A 4Z4IA 2RUGA 1OH5A 1QZ6A 4URSA 3FZLA 2IHR1 2MY7A 5GAEP 1N0UA 3ZSOA 5AQVA 1SQKA 3Q7CA 1KQFB 1TZ0A 1FFGB 3V9SA 2GVZA 1XMQJ 2OAUA 2WAQD 3UKRA 3NBPB 3V9UA 2IDLA 4TNOA 3J7AP 3HSDA 2R7XA 3MPYA 2UVRA 1DLOB 3DOLA 4P2FA 1BISA 4FWQA 5C42A 3MR5A 1SQGA 1X31C 3M05A 3IFRA 1XMOF 1OS5A 3EMTA 3UWTA 4R0EA 4I6WA 1T9WA 3TABA 3HKZD 1YJWS 4UUWA 2HG4A 4XH1A 2V63A 1R6VA 2I2YA 4FLXA 4I56A 4F7VA 2QYGA 2D69A 2IM1A 1CS4B 4JI5K 2QL5B 1N34F 3FQKA 4C1NI 4NXMJ 2VODA 1KN6A 3K8VA 1HNZJ 4CEFA 1E4GT 2W1BA 2MGZB 3GWCA 4QWAA 3NAHA 1KOOA 4TSXA 4DV6J 1GX6A 4AL6A 4DR5K 1N4LA 3HFVA 4JI2J 2SXLA 3D2FA 1F2HA 1EAYC 4Z4EA 1TKZA 4ZITA 3D45A 1HBUB 3HDSA 4ALZA 1TQLA 1C1CB 5J2PA 3M9OB 4IOCQ 3FFIA 2XLKA 4AUKA 5FRNA 2OTJS 5KFBA 2XMMA 4ECXA 4J9VA 1B4SA 5LMUK 2R9LA 2HHHK 1R8BA 3A5LC 2Q97A 2AKWB 3UCZP 2BM0A 3ZNJ1 3VA0A 5E33A 2IVPA 2ZDOA 4X66K 2HLTA 3KHRA 3M9MB 5I42B 3QGPA 2B5JA 1GLJO 2HMIA 4E7KA 5ETSA 2NRZA 2YKNA 4CHPA 1XMQK 4KAIA 1D8YA 4TXSA 1RISA 1I39A 1K1SA 3T5LA 3I82A 3SQ2A 1S1VB 1JLFA 3HULA 5CAAA 3I4PA 5FPMA 5BPLA 3ENWA 3NGUA 3ZFVA 4LH5A 3KLEB 3CCES 2LLZA 4RJVA 4AXIA 4ED1A 4RKUC 4UY8O 3F2KA 1VC5A 2P9NB 1S76D 2O8FB 1NM2A 1KKHA 3D5MA 1NM1A 4W5OA 2ZOGA 2NXUA 1C0TA 1CC7A 1RABB 1IBLK 3Q22A 2Q36A 3QEVA 4ILGB 3OYAA 2HHHJ 1RT2A 2DD8S 1Y5IB 2Y8YA 1JLEA 1RACB 3W63A 1Q7YO 2Z2ZA 1VQKS 3IO1A 3FEXB 1OYDA 3G71S 2UUCJ 3H25A 4Y3CA 4NWBA 2KZMA 1FJGJ 3CXCM 5C12A 3HHLB 4B3TF 3UNYA 4NCGA 1PJ6A 4PPZA 4M45A 4MQ3A 2P9UA 4AM7A 4CGIA 5D0HA 4C8MA 4M5KA 3ZTRA 2E5JA 1WSIA 3TARA 3HFZB 1YJRA 3VZHA 3MR3A 2GVDA 1UVNA 1GX5A 3A5OC 4KH1B 4FJIA 1UJ4A 4A8YA 1VQPN 4DR7K 4ZPCA 3BH6B 3MMBA 4DU3A 2PI4A 2HVDA 1C0TB 2YKQA 1HJOA 5B0AA 1J5EJ 2MLZA 2MQ8A 4EWTA 4OV6A 2CZVC 1QY7A 1NKEA 5I3QA 3A8YA 3EXCX 1SCJB 3DLHA 1ZOTA 2QL7B 3KLFB 1FEEA 3UDCA 4I2PB 2Q43A 2FIUA 4FWRA 2W40A 1VOMA 3W5XA 3R1HA 1XHXA 3L3VA 4I9LA 4ETZA 3KJFB 3M30A 2BQUA 5ETPA 2K8GA 1BQMA 4LF7J 2ZJPQ 4N8NA 2GX8A 4M3XA 5D8HB 3UN2A 3OUYB 2EFNA 3BKFA 5K8NA 1HJRA 3UI3A 4DTOA 3T6BA 4K4ZA 2Q6BA 1JIHA 1JLCB 2Z0GA 3A3NB 3QGGA 2ZH5A 2W24A 4QPXA 5I3PA 2GUIA 1X4GA 3A3PB 3EKUA 1Q86O 2ASPA 2FSNA 2P9LB 2K3IA 1RT4A 1CJKA 4PXBA 2R7RA 3MM9B 2UXDJ 4U67L 2HGNA 2M5YA 2VUGA 2JOQA 5F9LA 1ILYA 3MEGA 2GQCA 2WC9A 3SQ4A 2IBKA 1JJ4A 3OYMA 4KKOA 2XSJB 3GONA 4YB7A 2B43A 3O3GA 2NLXA 2X6SA 4NXNF 3DLGA 1WI6A 1YJ7A 3IDHA 4CZCA 4JYAF 1X4EA 2AU0A 1BU6O 1T95A 3WT0A 2YWWA 2Z2LA 3HOSA 5KFVA 1RB0A 3DAWA 5F3TA 2FHOB 3HHKA 4DR1K 5T7BA 3FCWA 1S1WB 3V1RA 2RRAA 3NE6A 3B4MA 1HQUB 4E0DA 3AY9A 4UZBA 2EWSA 2FVPA 2W7OA 4AE5A 3P3DA 3SFUA 1I5OB 3TZWA 2L9NA 4EMDA 3EDRB 5GAEI 2GVDB 5L1LA 4CJSA 3GG0A 3GFZA 3DLLQ 4OZLA 4YHHF 5LY3A 1UWBA 2DXEA 4EU0A 4WIQA 1Q4RA 4LREA 1FO1A 5AZIB 3HM8A 2V67A 4WCEQ 4DR3F 4O44A 2IIHA 1R0BG 3N6MA 4FSVA 1GXTA 2F9DA 2V2KA 1S10A 3JTNA 2JC0A 2W2NP 3VGMA 1MROB 2MKSA 5L1JA 2ZITA 1H3DA 2RS2A 4OZ5A 2OTLS 3TEHB 1GOBA 5AQFA 1HNWF 1SQEA 4DV3F 5DM6L 2ZH8A 3CCEN 4B3RJ 1YITN 4X66J 3NOGA 3KK3A 5ETNA 1GLCG 2FVQA 2I5JB 1RT5A 4K4SA 4BQZA 4RWXA 1WDTA 3C2PA 2JVOA 4USKA 1CJUA 4YORA 3SCIE 1KQKA 1HWJA 1VQOS 4I69A 3PX6A 4OIXA 1ITGA 3CJSA 3E9OA 2VYPA 2V5HG 4DL2A 1WHVA 1U09A 3NNCA 2LU1A 2FJVA 3U27A 3OL6A 2HRTA 3P83D 5HVFA 3AVNA 1WC4A 1UJ6A 2WSEC 4BVPA 3CD7A 4EYIB 5D4OA 4LR8A 4GKKJ 1HD1A 2Z4PA 4DV7K 4H5WA 4YOUA 3JSMA 4P2SA 4WZQA 2DB1A 1SC4B 3AA8A 2CWXA 3L3UA 3P5JA 1WELA 3ULHA 4K5RA 5GAHU 4IJNA 2O8EA 4X4UA 1XQSC 4CHYA 1DTTA 3WIVA 4K4VA 3LP0B 1N33F 2AJ4A 3CO9A 3KG0A 4DR2F 3CJ0A 3AOBA 3ZT3A 2J9DA 4JRPA 3PIPQ 1S6PB 4IFVB 4R5PB 4ZPDA 2E4LA 3KVGA 4YB5A 3UVJB 2E2NA 2VPXB 3DHXA 4RWTA 3W62A 2VF3A 4ZIVA 2X7IA 1TUGB 4DSIA 3KHYA 4GW6A 1GMUA 3RGIA 4OYBA 3PVXA 2VH7A 3BGFA 1K8AT 3R97A 2FLLA 1B7YB 3G8TA 3D2EB 3ZETB 1J5EK 1SBRA 3ZC4A 1PBUA 2RMLA 4OYAA 3CCTA 4AHTA 2FDNA 3SDEA 3M6WA 2HVHA 2PI5A 4H4KA 2Y8WA 4FJXA 5DLGA 2C2EA 5H9FK 2I7NA 2YHAA 3L6QA 4R0JA 1SJ4P 1G7CB 5B8HA 1NGGA 3M8QB 4OZ3A 1TUUA 1OIAA 1VQ5S 4LF1A 2VHGA 1FXLA 9ATCB 2GAGC 2DIVA 4RBVA 4NEYA 1Q8KA 3H40A 4K25A 3OQ2A 3Q8PB 3TUIC 3J7A1 2EFOA 4ZVEA 3VQSA 3ICLA 3D3CJ 3DGPB 4TU8A 1MW7A 3OXFA 3CE8A 2A3JA 2EC0A 3ZTPA 1VK8A 2CQIA 2I38A 3US5A 2BANB 3JSYA 5BRHA 1D0EA 4G1IA 3QEIA 2JL9A 4FWLA 1ASUA 3AA2A 1NGIA 1KHVA 4YDDB 3NVKA 4AH9A 3SQGA 1DRZA 3RUBL 1BUXA 1WC6A 2FC9A 2HAIA 1LW0B 3DRSA 4Q2LA 2MB0B 4UF4A 2Q3SA 2F8HA 2HURA 3V9WA 3KTQA 2E1CA 2ATCB 2JFDA 1JWWA 4Q8EA 3NVMA 4X4QA 2RDDA 4HTJA 5AXLA 2J6UA 2PT0A 3KWMA 4PQAA 1LFWA 3O3HA 3QERA 1M1KO 1R27B 4WWSA 4RPFA 3ALYA 4DR4F 2YWEA 3J7ZO 3T1HF 3IGNA 5RUBA 3GFXA 5MLCQ 1T94A 4IOAQ 4B1ZA 1RWVB 1FNOA 3O1LA 5IWAJ 3AOCA 5B0DA 1HQEA 2DTJA 1RUSA 3DGPA 3QT6A 2P9PB 4WFXA 2YHYA 2XY8A 3GIMA 2COLA 2VG7B 1YITS 2PDAA 5KG2A 4RX6A 3K0JA 3CCVS 1TAUA 2N4CA 1QVGM 2NUBA 1RAEB 1WSHA 5IT9U 4LRCA 2D0BA 2ATLA 1LW2B 2RS8A 1RAAB 1ZA1B 1NZAA 1OH7A 2QWRA 4JI2K 4ECRA 4KKOB 3QIPB 2XHBA 3H5UA 3PEJA 1IM4A 3VETA 3LDQA 5EX5A 2KFYA 2W8LA 1T7PA 2LCWA 2G8VA 1V5IB 2CQ1A 2CDRB 2YKAA 5FRMA 1FW6A 3T69A 4RLEA 2W2MP 1GMWD 1YJNS 1ASWA 1ZA2B 2EBEA 3CJKB 1F21A 1VQ9S 2QI2A 3G6VA 2MJNA 1YUWA 4NYPA 2ACMA 3O3LA 4CLKA 4G9ZA 1JL1A 2OEMA 3B8HA 3VMFB 1QQCA 2BX6A 4DQSA 3CC4N 3I96A 3AVLA 3EX7B 3EL2A 2IOCA 4IDKB 3OYJA 5FJ4A 2NLWA 2YKOA 2UXCJ 3DXSX 1U1LA 1NPPA 2V69A 4WK1A 1NBWA 2FZKB 2KJVA 3NY0A 2XWYA 4HH1A 1F5CA 4BRLA 2FC0A 2A41A 4LIRA 5HJXA 3MUVP 3EEQA 2QWPA 4DR3K 1RK8A 5THWA 2CQ0A 2KN4A 4WYLA 1BA0A 3MWBA 1S9FA 2JZ5A 4CYUB 3AA4A 4FK0A 2UVWA 2XYHB 4DV6F 2IJNA 3BYRA 4WK3A 3TW0A 1AUDA 1NJYA 3BP8A 3L7PA 4PABA 5F0UA 1HNZF 4YOEA 3M2UB 4EHUA 2IY5B 5E3PA 1SIZA 2XY5A 4DEZA 4I6AA 1UW4A 4QWCA 3PIOQ 4NPOA 2RHQB 4MYTA 3KNAA 5F8JA 1IR2A 3H5SA 2B56A 4ICLA 1U1NA 2Q2RA 1Z1ZA 2OLWA 3AO5A 1FERA 3BO3A 4W5QA 4CO3A 4DR3J 5CYMB 3RU0A 2RU9A 1SH0A 2DR5A 3M32B 2IA6A 4NCGB 1RBRA 3IKMA 3TEGA 3K59A 4FYXB 4KHNA 3M7VA 2R7UA 1ZM3A 1FT8A 5I4MA 2DXFA 3M32A 1HNXK 3E51A 2HPUA 4CO0A 2F4VF 2B4VA 2WVDA 3CD6S 4KHPJ 4MFBB 1F1BB 3PNIA 5AT1B 1MSWD 2HBLA 7AT1B 5HROA 2VDIA 5C10A 2XRIA 4PUOA 3R5GA 5B7WA 3SSQA 5KT3A 3O44A 3OSPA 4ISFA 2UUAK 4BG9A 1GFWB 1EZZB 3S7RA 1KVKA 3THYA 3ZSVA 3OVAA 1WACA 4QBUA 2GJIA 4LSLB 3D6TB 4O4GB 1GXLA 1RBLA 1QDUB 1HKGA 4ILJA 2FPHX 2XSFA 5BJRA 3QFUA 2A1BA 1NB2A 3EUNA 3NGZA 1Q0NA 2DNYA 4DL7A 3C66A 3DRXA 4P6QA 5F8GA 1TKTB 2CH6A 4MH8A 3MURP 2B4JA 4P7VA 4ISEA 2V68A 1UVLA 3PJXA 3MWTA 2AEFA 1D09B 2CQ2A 3MECB 4F4YA 3CB4A 3LW5C 1S1UB 2UXDK 4JV5F 2IAJA 3B6OA 1A6LA 2J7UA 2QW9A 5L9XA 1MWKA 3ZCMA 3EPGA 4PG7A 1IBCB 4FWNA 3PDNA 1HFEL 4NYNA 5EOYA 2ZF5O 3H90A 2W25A 4OHZA 1S1TA 4C8YA 4F3MA 1JJCB 1J5EF 2MQPA 1VQ5N 1FRMA 3G6XA 2B8QA 4ZP8A 4OI3A 3CCSS 4DQIA 2QT7A 1KC8O 3A5NC 2P9IB 1N33J 4CJ7A 1UAWA 3LUYA 4FNIA 1X9SA 2ZGYA 4KAZA 1L3KA 4FF1A 4CJPA 2BE2A 2QWQA 2J8SA 3QETA 5E41A 1X0PA 1ZBLA 2XM3A 4GKJJ 1HMVB 1LWCB 4M3UA 3R5CA 2VPYB 4LF4J 3A8JA 2HHPA 2ASYA 2PMZD 4XO0A 4NLDA 1RAJA 3RBZA 2P9EA 1U48A 5AJ3F 4OVLA 3KLVA 4DB3A 4DR6F 2OFHX 4CJWA 1QAXA 1ZAWA 1TK5A 2DNOA 3TOQA 4QWBA 1K1QA 3AJDA 1C1AA 3BO4A 1DTQB 1Q16B 1WNEA 2H3EB 1X4FA 3PHTA 3BREA 3R5AA 1NPKA 4EGLA 3AHPA 1VQSA 2NSCA 1FX4A 3NDKA 3MCPA 3I5CA 3IG1B 2YNIA 2C28A 1HL6A 4CJ5A 1Z6RA 2GMLA 3FR0A 5LSLA 3QICA 1T8EA 3VQCA 1JQGA 3SCJE 3L4QA 4UW2A 3KJQB 4FJLA 3BY5A 2XI3A 2MHNA 3OBIA 2DNKA 4DV5F 3VQ7A 3OHRA 3CCUN 2NRRA 5F9NA 5D4LA 2RQ4A 4C6AA 1NK6A 2ZEJA 3G96A 2JC1A 2FVRA 2ZWHA 3CERA 4M94A 2BBEA 3N4WA 1C4CA 3D0PA 3AVIA 3LPEA 3AVFA 2OPRA 5M1NA 2P2CB 2CVIA 4PR6A 1TFWA 4C97A 5AXMA 1Q82T 3NFAA 2YNHB 3DM2B 3D68A 3OPKA 2NYHA 2ZDPA 5AQQA 3CYMA 1JLEB 3CJ8A 5DM7L 2VU5A 1W2BM 1YLXA 3LM2A 2EVZA 5GADP 3QWUA 5F1XA 1R8HA 1BA1A 4ZVOB 3TQ1A 1QVGR 3P8BB 4CK3A 3T1HJ 2PMWA 3CDUA 2XULA 3N0VA 3F0NA 3WQTA 2DHSA 3QJPA 4DR5F 4NOHA 5IT9Y 2QXFA 2BYCA 2PC6A 4HUGA 4DPUA 1D9DA 2JGUA 3MEEA 4CWBA 1AA1B 1IR0A 1TR0A 3HT0A 2OTLN 2N3LA 4ED4A 2UUTA 3DRPA 2HNDA 2Y0SD 4QOZB 2OA8A 4F3TA 1WUAA 3ZNUA 1X9WA 3O4NA 5J1EA 2CA9A 4HDHA 3UO0A 1S57A 3IA0A 4TKTA 2DNQA 1R0CB 2RB7A 1A9NB 4IQMA 2QN6B 2UXBJ 1RT7B 2D5RA 3W5YA 3HZGA 3TJAA 1DTQA 2YNFB 2CG8A 1KQSR 3CJ9A 4X66F 3AVAA 2Z57B 1CJVB 3ID6A 2QO3A 3KG4A 1XMBA 5BR8J 2RQCA 4AILC 5AFUA 2VKZG 1I94J 5E3RA 1QM9A 2MQLA 1LXNA 2GIRA 2DR8A 2MMYA 4LRFA 2P9LA 1WSEA 3CO0P 1U1QA 1JJ2R 2HFUA 3CCSN 4BR0A 3LDPA 3IMQJ 5AQMA 2UU9J 4HHJA 1RDRA 3NCPA 1R8PA 2IYGA 3D7EO 1SL1A 4OPKA 1NBEB 1HNZK 1UFKA 1RILA 4BR2A 3ULDA 2EEYA 1K8KA 1FXRA 1QQNA 2WRMA 2VICA 1U4BA 4IDKA 3MPDA 1RHRB 3R5JB 5EGYA 4C1NK 1OY6A 2UXCF 4MLHA 3TAQA 2Z1JA 3BSCA 1TYQB 3IWNC 5MLCV 4LF2A 4FYDA 1XNQJ 2ZVIA 4HACB 3RAXA 3F5TA 2AX0A 3G9CA 3ZZTA 3K7RA 3KD1E 1JLQA 2GGPA 4CZHA 3V4IA 4HACA 1X5PA 2QXLA 4DR2J 2BM1A 2AEJA 2I1RA 1TL4A 1N5TA 3GG1A 5ETQA 2YPYA 4H0YB 3DDIA 1O0PA 4CM2A 4FF3A 2P8IA 2RHKA 4DTMA 2MZJA 3NH2A 2DYAA 2JX2A 4YS2A 4DS5A 1N5VA 1KCFA 4DPYA 4KV8A 4ZDNA 4ZP9A 3R5BA 2CZ4A 3CXCR 1VQ9N 3PRBA 4XEIA 4FM2A 1DFDA 4ELVA 4CZEA 4A4JA 1O8BA 2RU3A 1N36F 3CM6A 1VJQA 3S6EA 4CZLA 4HHTA 4BRCA 3MECA 2EXUA 1S59A 3CC7N 2YH1A 3CG7A 5J2QB 2CXEA 4BR4A 3AO3A 1N52B 1X1PA 2V4JB 5C2FA 2OD6A 2YX6A 1WSRA 3TZYA 4WFYA 1VMBA 2FJEB 1KOHA 3L8BA 1NG9A 1N6QA 2M8DB 3TSPA 5FIIA 5BR8K 4DLGA 4KTWA 4K8XA 1L3UA 3EDQB 5KFQA 3C19A 3EGWB 3MMBB 1RP5A 3CCMS 1MLAA 2KB2A 4ERDA 1HBMA 2OPPA 1HA1A 4CEBA 4NEZA 4PQUA 2E1PA 3ISZA 3O6QA 4P7TA 4TVAB 4LMZA 2JNJA 4J9QA 4KR0B 4ZPBA 1HNIA 3TUJC 4QS7A 2DR6A 3CJQA 3W8PA 2V7YA 3W1YC 3O1BA 5HN0A 2NZ4A 2X74A 4OX8A 4R5PA 2VWKA 4M5MA 2PEHA 4FKYA 1RGVA 5AQHA 4V19S 3VEVA 1G15A 4WFNQ 2XMAA 3Q8VA 4Q0BA 1RTHA 5DLFA 1GLEG 3UB5A 2XEXA 4G6VB 2V8HA 1OMSA 1EIYB 3FZMA 1NWKA 1ZBIA 3TO8A 1WG4A 4OFZA 2MQOA 1W9HA 2CYYA 4LBHA 1DAXA 1KC8T 1F3VA 2B9EA 1X4DA 4CZIA 3KDNA 1TYQA 3QIOA 4KGVB 3HHLC 2L08A 2A6AA 2Q0RA 3SBMA 4WF9L 4NA1A 1WF1A 3I0SB 3SBGA 3LPYA 4K59A 2MZRA 4IOXA 4M3YA 1SC3B 3DDKA 4ECZA 2R7TA 3L3CA 4U95A 4NRUA 3VQ8A 4Y00A 3SUQA 5CHIA 3J81U 4CGGA 2Q0UA 3MM7B 4O4GA 1UCNA 2YH0A 1ZH5A 3NMRA 3DU5A 4OI6A 3KLGA 4C3KA 3DC2A 4CLWA 3EZWA 1NKBA 5IV3A 5AQPA 4K50A 3CJCA 1F9EB 1KONA 4LF9J 4FJHA 4DV1F 3UDEA 1Q8LA 2E2QA 3SMZA 1S72N 4C11A 4H03B 5AFUH 2KM8B 4GMKA 4FS1A 2GO9A 5DS7A 3C6TA 1CSJA 4OPHA 2P9CA 4YNQA 2EKYA 3J7YI 1VC0A 4MKAA 2CQCA 5AJ3J 4F26A 3MI7X 1LCUA 1KFDA 3TUPA 3EM1A 2QL9B 1JLGA 2C3OA 3MMAB 1FK9B 2PBDA 3VQBA 2YNIB 3C7NA 3IBWA 1DTTB 4ZCKA 3R27A 1CJTB 4A5AA 1YJWN 2XQCA 1RGIA 2AMCB 4N77A 4OZ1A 1FTCA 4D3HA 3W64A 3C94A 4JI3J 1MMLA 1HQEB 2HS4A 5HQLA 3P5BP 1T03A 5IC4B 3T41A 3BGLA 1Q5YA 5CD4A 2EFPA 4JS5A 2V34A 3PKYA 4CJKA 3R6MA 5G0RB 3QSYB 3I32A 4DCJB 5GADU 3BZQA 1N56A 1ZBUA 2G1HA 4EHTA 4C23A 1LW2A 3H2UB 3OW2M 4ILHA 4ECQA 2ADCA 2W9CB 2APOA 1YSJA 3NAIA 2MQMA 4DV0F 2YI1A 3IS9B 4P73A 1WC0A 5EWGA 4CE9A 4TY9A 2W4CA 4DTPA 2GQQA 5LSOA 3JAMU 3IUCA 3IS9A 4KH4A 4H0XB 2J9EA 1XI1A 1XC3A 3LZJA 4CGJA 2CQPA 1LFPA 3EKSA 1AZSA 1CJUB 2HNZB 3M8PA 1RU2A 3J81O 4FPAA 2NZCA 1U1OA 2FHKA 4E7LA 2MLXA 4JHDA 4WFBQ 1APSA 4QAGA 2BW7A 4OX7A 2P5VA 4BGAA 4FLWA 4HCCA 1YRXA 4LIWA 4JKAA 1E6VB 5B0BA 4DTUA 3H2VE 3MM9A 3THXB 4CJQA 1IKYA 5H9EK 3V6DB 1Q81O 4CP5A 1VYAA 3TRGA 4IH7A 4DDFA 3D1QA 5ADXH 1VC6A 1RTDA 2MYFA 3CM5A 5GINA 5HOOA 3ZT2A 5KRTA 1CZ9A 4B8AB 4O5FA 4B9MA 4DV2J 1XK8A 3SXLA 3DXMB 2JEGA 4C0OC 2D3UA 3ZZYA 3HHLA 3LDNA 4O3RA 1QHTA 2R7YA 4CLYA 1ZBFA 1HBNA 3LL3A 3W9IA 1ZPWX 1FA0A 4K0KK 4MTPA 3ADAC 4ID8A 3K2PA 4GVMA 2NXEA 2JLFA 4FWKA 4BRDA 3MGJA 4XIUA 3VQPA 3MR6A 3R7NB 2B5JB 4ZJLA 4DV5K 3RW6A 2QV6A 3NF8A 2ZBCA 3RRGA 4RUCA 5HANA 3LA0A 5DETA 4USMA 3MFIA 4ED3A 2RD5C 4JKGB 4LJMA 1MNEA 5LL6d 4IO9Q 1AYEA 3N4PA 4NLXA 4CZMA 1YKWA 3IFEA 1JXLA 2D9OA 3MAQA 5E26A 4LRDA 1REGX 3CDAA 5HRPA 2C3UA 2FLOA 1XEZA 4PWDA 4DCPB 2RAQA 3D2EA 1KVJA 4C0HA 1H7XA 2VFUA 3V81B 4QR2A 3OBYA 1XNQF 3QZ8A 1XMOJ 4QU6A 2V8GA 1U47A 1AFIA 2V50A 1O1WA 3C0BA 1YX2A 1PG5B 3H45C 4C0BA 4K2XA 1C0MA 4LC9B 4DF8A 3PSFA 5KFKA 4CT8A 1RAOA 4X4NA 4GVLA 1XR5A 2AHOB 2BRLA 5A8RB 4Q45A 3SV4A 2F4VK 3AA5X 1UPMB 4JUZA 3OFFA 4LF4F 4DFPA 2GW8A 4M3ZA 4MJKA 1GLLO 1V3SA 3HRGA 1S6UA 3IAM9 4DZDA 1CULB 1FKAF 2AJFE 2C2KB 1W7AA 2IPOB 1IJJA 1H73A 3BZCA 5HRNA 1VSKA 1X3NA 5L1KA 4C8ZA 1ZTTA 2GFFA 5DJBA 3KK2B 4IH6A 4E1NA 2HGMA 1ZBTA 4DN9A 4M5HA 4JV5J 4CEQA 3H7HB 3Q8RB 4X4RA 3E9PA 3U1MA 3CWJA 2WW4A 1TK0A 3NWGA 5TKWA 4MDBA 4Z4FA 3H2LA 2HFVA 2DNLA 3M2VB 4PWWA 4DG1B 3GYXB 3K17A 4ZVHA 1KVAA 1WEZA 2AZ3A 2CRLA 2QTDA 4FM0A 3AVHA 1CPZA 1KXPA 2HBQB 2HGLA 3ZXWA 2LXFA 1FKPA 2B4PA 2XC9A 1Q95G 1X4CA 3BQ2A 4Z0UA 5CCLA 4NCAA 1WEXA 1TK8A 2BQRA 4OI2A 1VQNS 1C4AA 5B0FA 1HUXA 4WQ4A 3P1GA 1YDLA 4EBDA 4IR1A 2E5IA 1J54A 3LDOA 3EWGA 2IGIA 1NK8A 1PJ5A 1N5QA 4B3RK 2AV5A 2V52B 3I4HX 4CLTA 3KLHB 2VFSA 1J27A 4DUYF 5IWAK 3DI6A 2OH2A 2LSNA 2ZH6A 4W90B 3BEXA 3TNVA 4DS4A 3HSZA 5HP1B 3FSXA 2MKHA 2ZE2B 4YOXA 2E7VA 4LQ3A 4DU8A 5M1PA 4CQ1A 5CYMA 1OH6A 2KT2A 4IDHA 3DOKB 3OJUA 3GJSB 3I0SA 4OYPA 3QEPA 2UUCF 1RT3A 3M6GA 3J81j 1JCGA 5AQJA 4CEEA 4X62J 3AGRA 3OR2A 1FD8A 2OI2A 5KG6A 3PYDA 4C8NA 1M5OC 2BKNA 3C14A 1HWLA 4Y2KA 4G65A 4DL4A 3CF5L 1SJQA 3TZZA 1SKSA 2CQBA 4DR6K 2DIUA 3MEDB 3C6UA 1YBTA 4LF8K 1W7WA 3HM9A 1TKXB 1Q1KA 2VPZB 3F9KA 5IT4A 2ZJPL 5ADZA 3QO9B 4G1PA 3M3ZA 1UWBB 5GAGU 1IUJA 2DR9A 1Y64A 1PAUB 5EHHA 2XMJA 1QAIA 1N34K 1K73T 2YX1A 1YT3A 3BSAA 2BKOA 1ELOA 4FLTA 4ZIWA 5A2QY 5BR8F 2ASMA 4YB1P 4IRDA 1CBKA 1LEOA 3HMJG 5EN1A 2HVZA 2BVZA 2KG1A 4FXDA 2Z58B 3DLBA 4EO6A 2HWHA 1NNEA 2UUAF 3BBFA 3A1YG 4EK2A 1J5OB 3LP3A 2A0FB 2G8KA 1SV5B 2CGKA 5ITHA 5B09A 4ZA1A 2R7QA 3CDEA 4O8UA 1JKHA 3D1OA 3OL7A 2NUHA 3D7SB 2H3GX 1VQYA 3SAFA 3IRXB 1P6TA 3ATVA 1YQHA 1PCAA 1EO1A 5C25A 1NJIO 4F04B 4M3RA 4HHHA 1F2GA 3VERA 3M8SA 1KEKA 2J7WA 2UXDF 2WTFA 1Z2ZA 3CC2N 4GV3A 1R43A 2ZHOA 1N32K 2G4BA 4X64J 2P9SB 1A0OB 3MN6A 2K06A 2UZAA 3IN5A 3HHDA 3O2IA 1BI4B 2DGVA 3Q8SB 3VQQA 4QIEA 5LJWA 1T02A 3D28A 2M88A 1UETA 1U7LA 2NYIA 3OYCA 4JI7F 4CLSA 4HKQA 2GWKA 1M5HA 2KI2A 3VQ9A 3AAPA 4OJRA 3TVKA 2QFIA 2ITGA 1HIYA 3EZOA 3R2CJ 2R4FA 1HR0F 3QSIA 4RZRA 4OV1A 4FJGA 3NS6A 3RR8A 2E7XA 2OO4A 4DKWA 4QIWD 1K8KB 1WOPA 4DV1K 2ZJQQ 2EI5A 1HKAA 2XY6A 2X1GA 3D66A 1QSYA 3C15A 5AQUA 2EPIA 3HFKA 4EO8A 4ELUA 5BXIA 1B9DA 1YVNA 4DR7F 2XMVA 4K8ZA 2PE8A 2KYZA 3QRQA 3BGOP 4LT6A 4DV3J 4ILLA 4JD2B 1G99A 2HOEA 1Y5LB 1ZETA 4DSLA 2RKIB 2F40A 4WFAL 4OX6A 2VG6B 4PAAA 1FEHA 4PWUA 1RT1A 4RG8A 3POTB 4LFAF 1H2TZ 4JI8K 5F8HA 2R8KA 3VF6A 1U2VA 3NH0A 1YRUA 4A8OA 2IC3B 1NSAA 3HI0A 3MN5A 3UKUB 4Z4GA 3J80U 3DXKB 5AE3A 1T44A 1TMMA 1RDUA 1VQ4S 3DI6B 2DVIA 5KFNA 1B9FA 4GNIA 1EETB 2D0OA 4ELTA 1ULRA 1ZC6A 3EVMA 5C24A 1MROA 3J7YP 4HUEA 3KK2A 2XO6A 3EVOA 3WBZA 3QDKA 3IMXA 3MEKA 3JXOA 4CEZA 3U4LA 4N5SA 1UEUA 3PIPL 3L2QA 3QNNA 1WKJA 2DNZA 4WP9A 3IBCB 3T3FA 2FF6A 3QBWA 4FJ7A 3WXJA 4W5RA 1DBDA 4OZ0A 2OYQA 5KPRA 3KKRA 4CO5A 4RNNA 3QPIA 3CC7S 3V4IB 2E29A 3S1TA 1NH8A 4Y1CA 3THYB 4OMFG 5F41A 1ZBSA 3PRDA 4NLSA 1T9UA 1E4FT 2C1EB 5KFTA 4L8RB 1DQAA 5CH7B 4H0PA 2RT3A 2PA8D 1YJ9S 4B3MK 2FLNA 1LQ9A 1BWFO 3HD2A 4PQUB 1Y97A 1FDBA 5E3CA 4LF9F 1TKTA 1S12A 3ZEUA 2XTJP 2C3PA 2GVZB 3OVNA 3UKRB 1WKLA 2DKOB 4B3OB 4E1JA 1H7WA 4JI1K 3D2FB 1OQ6A 2L41A 3FZKA 2HHSA 1HNIB 2FBYA 4USVA 4ZCLA 3TP2A 4J2DA 1RQ0A 1V3RA 3MDFA 3GB0A 4M5JA 2UUBF 1RBTA 2AGQA 1JNZB 3R6GB 1QLNA 3FZFA 4QIGA 5M1KA 4DUYK 3ELHA 3V6HA 1QJHA 5A6WA 4I2PA 4OYMA 2O8DA 1JL2A 7FDRA 1TELA 1RLDA 5BN9A 1RDDA 2BXJA 3CJKA 1SC6A 2DGOA 2VONA 4X65J 4A5BA 3WZ0A 3PFEA 1HKCA 2LQBA 3ENAA 4GKJK 2FZCB 1FJ7A 2NSBA 1NEEA 4J9NA 1U26A 4GC7A 3SQ0A 4ZTJA 4OLAA 1R7IA 2B4OA 1EXQA 1G2EA 4JEPA 4ED6A 3JSRA 4CT9A 1V4SA 2RN2A 3DRPB 2A42A 4DV3K 2IDOA 4QW9A 3K57A 4URGA 4HT7A 3QQCD 4NI2A 1D4XA 5K14A 1RTIA 1JJ2M 1WHWA 1MU2B 4AXJA 3GJQB 5CD4H 4IKAA 4DV1J 5JVGL 2WW8A 3UFCX 2R7OA 2DNPA 2W9BB 2HYIB 1SJ1A 5AQKA 3RG6A 4ZLJA 4J9OA 1N48A 3LM9A 4A8MP 1SXLA 4WIIA 5DGAA 3MTJA 2C2NA 3MEGB 1E6YA 5EU7A 2V2ZA 2FYXA 2DK2A 2HBKA 2H51B 3JYTB 3HZEA 4O3QA 1F5BA 5CHCB 1NOZA 1R8AA 3PW4A 4FF2A 3OXLA 4P2MA 8AT1B 3FMWA 5KT7A 4X84A 1IG8A 2VC0A 5M2PA 3PLAA 1YAGA 2DY1A 2EFQA 4QOTA 4M7YA 1C6VA 2VCPA 3WDOA 1UP1A 3OYGA 1NSKL 2OMLA 2BE7D 5GADI 2X3DA 3N9UC 4CLUA 4C4WA 2D74B 2M3DA 2RE1A 1IBMK 3HHLD 1IH7A 3WX8A 2HBRB 2D0CA 4OGEA 1N36K 1ZM4A 3GFHA 1U45A 3VR1A 1YBUA 3I33A 4JKDA 2AX1A 5A8WA 2KM8C 2DGXA 2R8HA 3N01A 2F4FA 5ELZA 5A2QU 3SEOA 2XBPA 1GLBG 4DV7J 4FJ9A 2ROEA 1JLBA 2PN6A 2VWBA 1P8GA 3OR2B 1DURA 5KFHA 1U04A 4FN5A 4KH5A 4AQYF 3WIUA 3WQPA 4BC3A 1QHAA 4BQLA 1YK9A 2AJ2A 3HP9A 2OMOA 3M2UA 2ZUGA 5KFUA 2C2RA 1XQIA 5IM0B 2MKKA 1KSPA 1BMQB 1H2VZ 3V5RA 3QGHA 3IAYA 3MEEB 4QWDA 5KGWA 2BW2A 4F25A 4NLTA 3E01A 3BF3A 4JHDB 4LRAA 5IWAF 4WTYA 1T6DA 4R8UA 3MPUB 1X60A 2AZ1A 2VKRA 2AGOA 1UTAA 4B9TA 3CCUS 2HNDB 3AQOA 3ZSQA 3T1AA 3JSBA 3V6KA 2OEKA 4IR9A 3RB4A 1QQOA 2YPZA 3AGKA 3ILIA 2NPFA 3MHYA 2BQ3A 4KY3A 5KFCA 5HVHA 2XGPA 1C0FA 3DCAA 4GMJB 4DG1A 3KMSA 3HVTB 3CJ5A 1GXUA 4H4MA 3IM8A 5AQNA 3QFWA 3H98A 4USJC 2OZSA 9RUBA 2NXNA 3EXYA 1TU0B 2O5DA 2IVFB 5KFSA 5D6GA 5KAKA 5J2NA 2I7PA 1LWEA 2VWJA 3HLUA 3SAHA 4X62K 2J8AA 1EB0A 4A8QA 4LBIA 4FWOA 2PFFB 1B92A 2R7SA 2OPRB 4EUVA 1PYTA 4CFAA 3TWZA 3C65A 1RJJA 2FTRA 2WVFA 1U25A 5I9EB 1YIJN 4UOCA 1Z05A 2BJ3A 4GKKF 5JUMA 5GVQA 2LDYA 2QX0A 1RTHB 2NRHA 1WOSA 3PW7A 4HDGA 1FKOA 2WOMA 4H0VB 5C25B 3C15B 5KPTA 1SC1B 3TTCA 3SNNA 3FLCO 1VRQC 4ZVQB 5I42A 4DLEA 4USWA 1EQYA 2LKZA 4JKBA 4ID1A 2E8AA 2HNYA 1X4AA 3PHEA 4LFBF 2NPIA 1U8SA 2M8HA 3CJRA 4O3PA 2MZQA 1EARA 4KHPF 1S1XB 1BY9A 4DR7J 3EE9A 3W60A 3H1QA 3C3LA 3G82A 2AYGA 4Z7CA 2UP1A 2PFDA 4CLZA 1NKCA 2WK4A 1M1GA 1H1VA 1OKJA 2HHWA 1S1TB 1U6FA 5C2CA 3NP5A 1QVFM 2E5GA 3L2UA 1EQ0A 1VBKA 4O0NA 2IC3A 4N7TA 1UPPA 1GOCA 3NGYA 3K5PA 4V19J 2F5GA 4BRNA 3P49B 1Q8BA 5D77A 2MSSA 5FROA 1YTUA 2ALYB 3T5JA 3UE2A 3PYGA 2J9CA 1S77D 1KDNA 4H8KA 4NLGA 2K1RA 1WHYA 1FESA 2DNHA 4FPRA 3E2EA 4GV6A 3ISNC 3AOAA 1UVIA 2RJZA 3ZT0A 4NXNJ 1CQNA 3C16B 4YDUA 2W41A 3FEYB 1FWPA 1LNQA 4LFCF 5DQHA 2BKPA 3H20A 4QIVA 4C7QA 2JLEA 3TAPA 3AXMA 1SJRA 3J81Y 5DRKA 1HPMA 4RW7A 3VQ6A 2E5HA 4FVMA 3POTA 4CF2A 2HVEA 5EWEA 4DFJA 1CZAN 3X3UA 3THTA 5LJVA 4KH0B 4M3WA 2DCLA 3CI5A 1RA7A 3NNHA 4IG0A 3NMAA 2QM1A 1HBOA 2QA4G 2YKMA 1VIXA 4M1KA 3C46A 2OIHA 1RDAA 1SQFA 4FXVA 2OZMA 3FDSA 4WKYA 1HPZB 1V9OA 2HQDA 4DU1A 1MWYA 1YJVA 1P1TA 2CNOB 4LSZB 2BR0A 1XR6A 3KLHA 4KFBA 3JAMO 1R3NA 3KWIA 4W98A 1ZZFA 2VBZA 4BREA 2VQFF 3RJMB 2D3OR 2ROPA 4KH6A 2ZWOA 5AZIA 1TFYA 1O5JA 1FI4A 4JBCA 4Y28C 2KXFA 2QKKA 3DN9A 4ZLNA 1TUYA 3AJ2A 1XC9A 2MHEA 1BC6A 4A8KA 1PAEX 1FX2A 4J9KA 5T7LA 3G6EN 4P52A 3PUFA 4F4XA 4BR5A 3I9V9 1TAQA 2DO4A 2Y1RI 3W9JA 1EKRA 4DOZA 4JI5F 3H3NO 2Q66A 4PYDA 3C14B 1R6YA 2ZHAA 4BE0A 4NZ0A 4CZGA 1T11A 2F7TA 4NE9C 4RO0A 2JVRA 4DQPA 3OHBA 4ECVA 3CPWR 2BOPA 1ZS6A 4CJTA 3HPGA 1HW8A 3NOCA 3TJ8A 5AQLA 2ZC4A 1NOYA 2RH3A 4L6V3 4IFEA 1FRHA 3HJVA 4BG8A 2GJ2A 3CD0A 5KG3A 3TTDA 4G1QA 4GRSA 1S6QA 4LR9A 4M41A 3T7ZA 5HJYA 1XNQK 4NL5A 4E8UA 1IBMF 5KFLA 2NRXA 3R3TA 1AXQA 4NZ7A 2NR0A 3I5BA 3IAS9 1SV5A 2OFGX 3BGRA 3LALA 5HBMA 4Q43A 1BQNA 4IEIA 3VESA 2ZBPA 1KTQA 5AQXA 4B3SF 2QA4N 3RMAA 4FLVA 1FJCA 1JCFA 1VSHA 2VG5B 2GIFA 4LF9K 3BPDA 2Z1HA 4DR5J 1GEHA 5F0WA 4BRPA 4DF4A 1S7IA 1HHTP 1SL2A 1MG7A 4JI1F 2Z2MA 3A8IA 2ZZNA 3AA9A 2ETJA 2JWNA 4KI4A 1DARA 4CJ4A 4DN0A 2BE2B 3F41A 3JXUA 1VQ4N 2R2TA 4J5OA 4LVOP 2IA0A 2CJYB 2VOPA 1LWCA 2B6AA 4O44B 2ZOMA 4OLOA 4ZK7M 2CPYA 1VSMA 3H5XA 3O5TB 2UVUA 3TU5A 1AFJA 2AJQA 4RTFD 2UXBF 1CS4A 4UQGA 2V2VA 3RYLA 1F6TA 1VLOA 5DQIA 1W0HA 3LP2B 4CO1A 5HMZA 3FBEA 3DRYA 4JI4F 2F8EX 3M30B 1CC8A 3UPFA 1D3WA 3VF2A 4BE2A 4OLBA 5T41A 1IO2A 1U24A 3B6BA 2HBYB 3QT5A 2DY9A 2YX4A 1S0OA 5DG8A 4K41A 3H8YA 2UU9F 1Q5VA 4U6PA 4GVBA 3JSMB 2WOMB 1VI7A 4QS8A 3CCLN 4OL8A 5EXWA 3CJ2A 4LF5F 3NLCA 1VR6A 1YJ9N 2HQIA 2H5JB 4WJBA 4QYZJ 1GMWA 1IKWB 2JEIA 3WNHA 3DLRA 4CJUA 4MMOA 1X7VA 3I56S 2KU7A 3GBTA 4CIGA 2ZQBA 4RNFA 4HEA9 4BC5A 1P9YA 2BV3A 3OD2A 2F9JA 1U2VB 4WP3A 4ZPWR 4E7JA 4I2QB 2QLXA 2FHJA 3PXGa 1S9EA 3NMUA 2R7WA 1ZYQA 3OTOF 2CPXA 2P6TA 2K7JA 3JQJA 4V1Ak 3LPUA 2KRBA 4Z4HA 1FCAA 1RWKB 1ZTWA 5F8NA 3CC2S 4IG3B 1JMTA 3T5KA 2QC3A 3SI6A 2LXIA 2J0WA 2XS2A 3UD4P 1E3MA 2DRAA 4WZMA 1B0TA 5K8MA 4MKBA 1TVRA 1TL3B 4C3MA 4K0KJ 3ZETA 1LWXA 4W5TA 4DBQA 3TAMA 1WC5A 3FZ2A 2RQKA 1RTJA 5B0EA 2R7VA 1KD1O 5GMEA 4HH0A 2HRYA 1ASVA 4DV2K 4GC6A 3R8YA 4DR4K 1DKGD 3ZSWA 3T1HK 4M63C 1VQKN 3AVJA 2KYXA 4PG4A 1XNRK 4RU2A 4DU4A 1YI2N 2RF2B 1S72S 2BOAA 2YHWA 1R0AA 4I6YA 3U3GA 2ZNZA 3EY1A 3GTYX 3SDEB 1Q53A 4BGBA 2XZDB 3LF0A 4RW9A 4CF0A 4B1XB 3ID8A 3ZEUB 1AZSB 2WCXA 2GQ2A 1IXKA 2E44A 2VB6A 2J0SD 3FE1A 2WUSA 5FPDA 2X1FA 5IOLA 4H4OA 2ASDA 3BKTA 3KHHA 2Y1IA 1U2FA 2DGTA 1NK7A 1WAJA 3CJ7A 4KO0A 1FJEB 2XZWA 1T9TA 4MT1A 4IOAL 2ZBRA 5H1SV 3E01B 3DNCA 1BXNA 4WF9Q 4E3SA 1CG2A 5AZJB 4B08A 3CJAA 3VQ4A 3FSIA 1FKOB 4ZVPB 2W4PA 3QEWA 1W2IA 4JKEA 1Y11A 4QYZK 4FYVB 5KFWA 3AVMA 2JDJA 1WF2A 2BTFA 4B1VA 3AVBA 4YOVA 2XHWA 3Q2TC 4OJHA 2KRRA 4IH5A 3CCQN 3WC0A 4X65F 1URRA 2DNMA 1EJ7L 1KNZA 4EP5A 4JD2A 3V1OA 3MCNA 4CBWA 5FLXY 1G3OA 1YI2S 4DTNA 4LFCJ 4JI7J 2HF3A 3OFGA 2MQQA 3VOVA 3VV2B 1DEJA 5HLFA 1HRHA 1H6KX 3BM7A 3M2VA 4RW6B 4N8OA 4KHYA 2OD4A 1Z4UA 3KD5E 3VGSA 1HR0J 2YKMB 1HMVA 5KG7A 4B9NA 4FCYA 5KFGA 5L9NA 2CADA 4DCOB 3TA1A 1BWVA 4X4SA 2CIMA 3BKUA 1K0TA 1S3XA 2V4QA 1RAHB 1FNMA 2HK2A 3W2VB 1Y3KA 3AB4B 4ZJOA 1FFWB 1G1XA 4KPYA 2F4VJ 2E5LJ 3B78A 4B17A 5KPZA 3MN7A 1XR7A 4DV7F 4ZVSB 2DR7A 1D1UA 3QIPA 2B9XA 2IJFA 3Q23A 2KH9A 3KIOA 2VJVA 1I3OB 1HBNB 1HQUA 3RRHA 4C8LA 1LK5A 4OZ2A 3CMES 1WB9A 3O8WA 5D78A 2KZZA 4ZVUB 2A1SA 4JI8F 1YXQA 1S79A 1VBZA 1HYSA 3K89A 3KHLA 5GAHI 3I56N 4BY9C 1LXJA 4BLGA 4EBCA 4H4OB 5LXRA 1Q7YT 4N47A 4BBYA 5CCMA 4RNOA 1LKZA 5K20B 1S4FA 3WXKA 1VFJA 2CG4A 3MMCA 2VJUA 3PW2A 3E8OA 3V6DA 3LH2S 3E9LA 1VQON 5A8WB 1NDLA 2H9ZA 2W6KA 1PJ7A 5DQGA 2CQ3A 2V7ZA 4FW2A 3A12A 3N5BA 2G9OA 2U1AA 3L95X 4P10A 1Q81T 1CVJA 5AQGA 4PWDB 2E1ZA 2E20A 3KK7A 3LTOA 4H5RA 2A10A 1KLNA 2KXHA 2F1FA 4L3NA 3L2RA 3DLGB 4I2QA 4FWPA 1MMNA 3HSTB 2M70A 4MKYA 3DRSB 4IOBA 3EO3A 4M5DA 4I7FA 4TY8A 5JLHA 3GZ7A 3MMVA 1OWXA 4YFUA 2E88A 3T19A 2BUNA<