1BQNA

Tyr 188 leu hiv-1 rt/hby 097
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPQKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNQQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords REVERSE TRANSCRIPTASE
total genus 114
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqnA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqnA05
1Q9YA 3MTKA 1BCMA 4ECUA 4O4RA 1D9DA 1VRUA 3AVMA 3B6PA 4EP4A 2OPRB 2OPQA 3LZIA 5KFGA 5KFDA 1N48A 4YR0A 2AX0A 1OS5A 5KG1A 4RG8A 4QWCA 4ED7A 5HRRA 1XC9A 2G8FA 5KT6A 2PYJA 2QKKA 1JLEB 2JGUA 3V9XA 3KLEB 4DTSA 4Y1CA 1CZBA 4NLGA 4K4SA 4IR9A 4DLEA 4LSNA 4Z0UA 2G8VA 1YTUA 4LQ9A 4PY5A 4MQ3A 2YNHB 1A5WA 5C25B 2OPSB 3K5MA 4E1NA 4DG1A 3AVGA 3AVHA 4J9KA 4M95A 1QAJA 4KKOA 4CJ4A 3V9WA 4EBEA 1BQNA 3QO9A 2WK4A 3VA3A 5SWMA 4DQPA 1YVFA 3NKYA 3QETA 2QXFA 2UVRA 5CYMA 2HNYA 2W9AA 3HPHA 1JLAB 2DTUA 5KFIA 3GV8B 4ICLA 4KI6A 1FK9B 3IN5A 1L3UA 3DLGB 3ZSYA 3V1RA 2VA3A 3KLGA 4DQSA 1GX5A 4ELUA 4WFYA 3RRGA 1IO2A 3KHRA 3B6OA 3SFUA 2F96A 3QEVA 5KFYA 5DQIA 4NLWA 4DSIA 4QWEA 2IA6A 2XRIA 4ZTFA 3OYEA 2HVHA 4OPKA 3QEWA 3OL9A 4Q45A 4KBIA 3OYMA 1J5OB 4CCHA 3IS9B 1GOAA 2KTQA 1NNDA 4RNHA 3ZSVA 1HPZA 1KLNA 4BE0A 5F8JA 3KHGA 2YNFA 4WFZA 1TKTB 3QYYA 1KVAA 3GV5B 1LW2A 4B8AB 4EEYA 3KK1A 3U6FA 1BQNB 3M9NB 3HHKA 1X9MA 5DGBA 4DEZA 1HYZA 4PUOA 3NHGA 4G3IA 3DOLA 3I5CA 3NBPB 3CJ2A 1TV6B 1K1SA 5C25A 4BDZA 2DPIA 4HUGA 3I0SB 2WONB 4CF0A 1RT2A 3LDSA 1NK9A 5KFWA 3BSCA 2DFEA 1RAJA 3RMCA 3OSNA 4B9SA 4ECXA 3EPIA 1L3VA 4GC7A 3KOAA 5HLFB 3NFAA 4OLBA 3RMAA 3MXJA 3KLEA 4Y34A 1JL2A 3JSMB 3GIIA 3TAMA 4CJ3A 3QZ8A 5J2NA 2HNZB 4B8CA 2W9CB 1RDAA 3CYMA 1IKYB 1LAWA 2JEJA 1D5AA 3UPFA 2AGQA 3K5NA 2YNIA 1YVUA 2FBVA 1HYSA 4FVMA 2OPRA 2E9TA 3SCXA 2D0CA 2ASJA 3OS1A 4DQQA 4O3NA 3C6UB 5EWEA 3E51A 2VG7B 4FJXA 2IGIA 4YNQA 4N76A 4IFVB 3I0RA 4NCAA 1HNIA 4CEZA 3QIPB 2XGPA 5EU7A 3RB3A 1D1UA 5KG6A 3S3MA 4EYHB 2O5DA 3MEGB 4TQRA 3V1QA 1D9FA 1R0AB 5KT5A 2G8KA 3V81A 2RPIA 3OYFA 2E4LA 3K59A 4IKFA 3QIDA 1CSJA 3HPOA 4FJMA 1Q9XA 1J5OA 4CF1A 4IRCA 3V6HA 4IH5A 1WAFA 3SI6A 5KFBA 4ID1A 5F8NA 2WB4A 1TAQA 1RT1B 3EZ5A 3TR8A 4EO6A 1X1PA 4IR1A 3NF7A 1RT3A 1B9FA 3ISND 4ZP6A 3WNHA 3TAMB 2LSNA 1N56A 3Q8SB 4Z4CA 3GIJA 1KFDA 1LWCB 3HL8A 4N5SA 5FDLB 1LAVA 3KIOA 1B9DA 2OPPA 2HNYB 2HWHA 2R8JA 2EC0A 4CGIA 4CIGA 1RT7B 5KFLA 3NF9A 2XCAA 2G8HA 3MR2A 4O3RA 1YTAA 4TXSA 4F8RA 5KT3A 3LP0A 4I2QB 3LP3A 4DTRA 4M3UA 4DG1B 3V9SA 1S9EB 4RW8B 2VWKA 4MK9A 3OYCA 2B4JA 3K57A 3V6DA 1CZ9A 3V6DB 1UA0A 1ZTTA 4F2SA 4CEEA 1HPZB 1VSHA 1SUQA 4XPCA 3RMBA 4RNOA 3HT3A 1Y97A 1RNHA 3OLAA 1SL0A 1RILA 1N5YA 4KAZA 3CJ5A 2ZD1B 3CQ8A 1QQCA 1QE1A 4MK7A 3L3UA 3KLHB 3VQ4A 4ED2A 2XI3A 3DRPB 5HRNA 3K5LA 3BSAA 3OYGA 1WLJA 1U45A 5KT7A 4ZVGA 4EP5A 2GC8A 4DL6A 5KG4A 1NK0A 4K4VA 4JS5A 3T3FA 4DU1A 4KFBB 3UR0A 4IG3A 2NUBA 1T05B 1SV5A 3OYAA 3DLRA 4ZVEA 1SH3A 2P51A 3PHEA 1EKEA 3LP1B 3HP9A 1C1BA 4IFVA 1J9AA 3PJXA 4C8LA 5L9XA 3DOKB 4RW7B 4O0IA 1VSKA 3BQ0A 2W9BA 4RW4A 4N41A 2YNIB 2BDPA 1TKDA 5F8MA 1IM4A 3QLHA 1T03A 3QESA 1D8YA 3NE6A 3NAIA 3QZ7A 3E01A 3CJ3A 3OYNA 4Q5VA 3U3YA 4W5QA 4YP3A 1JLBB 2PZSA 2CJQA 3RR7A 2G8UA 1LW0B 4KB7A 3RB4A 5C5JA 4CE9A 1DTQA 4DLGA 1S0OA 4Z4FA 1T3NA 3UIQA 2WOMA 4ECTA 4J9PA 4GMJB 3KHHA 4CHQA 4CERA 4J9NA 4FZZA 4J2EA 1I6JA 3DLEA 3MEDB 2FBXA 1RDDA 3TARA 4BDPA 1Z4UA 5HBMB 5HP1B 3PW0A 4K4YA 3S3OA 5C24A 4PUOB 4KHMA 4C8NA 3AO1A 3T5LA 2AJQA 3QGIA 3GQCA 4I2PA 3RR8A 4LQ3A 3HKWA 4CF8A 1C6VA 4E89A 4CJEA 2HB5A 1TK0A 2QK9A 3SI8A 1U04A 3VQSA 4ZP9A 2E6MA 4DWIA 3PW7A 4GC6A 1NJXA 3CJ0A 4BWJA 3KD5E 1TKXB 4E0DA 4DTXA 3NF8A 2V9WA 1B92A 4CF2A 3LP1A 1QS4A 4OL8A 2YKNA 1S1VB 2F8TA 1HYVA 1S1XA 4JRQA 1G15A 3ZSXA 3FQLA 3AO4A 1C1CA 4BE2A 4M42A 3OJUA 2R8GA 2WRMA 3DLGA 1Z25A 4JRPA 5KFVA 4L8RB 3H98A 3EY1A 4FK4A 3G6XA 2R8IA 4YMEA 1NKEA 3FSIA 1RTDA 4ED1A 3C95A 1X9WA 4RNFA 3KK2B 3LALA 4FJ7A 1ASUA 2RF2B 3L3VA 4DSKA 4R0EA 4CFDA 1KSPA 1JLFB 3O4NA 2OH2A 3HO1A 5J2NB 1S9GB 4ED0A 3NAEA 1L5UA 1JKHA 2WTFA 2R8HA 1GOBA 1TKZA 3DM2A 4ICLB 1ZBUA 4CFAA 3MR6A 2J6SA 4YFUA 3VQ8A 2DPJA 4DSEA 2ILZA 3SUOA 2XY5A 4KTQA 4FM1A 1NJZA 2WONA 3U3GA 4Y3CA 4ZP7A 2V4RA 5T7BA 2X78A 3HK2A 4PWDA 4Q43A 4H4OA 4IKAA 4ZPAA 1S9GA 4IFYB 3H5UA 5J1EB 4B3OB 3GILA 4M94A 4DFPA 1IKXA 1KFSA 3AVLA 4HCBA 2IOCA 4NYZA 4OGCA 4DMNA 5KFRA 4QWBA 2BE2B 4NLXA 5FDLA 2D7SA 3AA5X 3HXMA 2GUIA 1DLOA 1XI1A 5CZ2A 1IG9A 3NAHA 1C2PA 3V9UA 4E7KA 1C1CB 1QUVA 1SKSA 2FVPA 4FZYA 1VSDA 2HAIA 1RT1A 3CM5A 4CGDA 1ZBIA 2OZSA 4CK1A 4FJIA 4FJKA 3CO9A 4N47A 2ZE2B 1TVRB 2VG6B 3ULDA 1WSGA 3MAQA 3VQCA 3M8SA 1VRUB 1ASVA 5CZ1A 4Q8EA 4CEDA 5EUHA 1TGOA 4ID5B 2HW3A 1R0AA 2FLNA 3HYFA 4RNNA 3P83D 2R2UA 4R5PA 4J9SA 3QO9B 1IKXB 3KTQA 5J2MB 3DLHA 3OHAA 3CFOA 2D0BA 4M3XA 2BR0A 3S3NA 4ECQA 5KG7A 1D0EA 4DTOA 4CJQA 1RTJB 1QSYA 4OLAA 4FBUA 4ELTA 4ZVHA 5EDWA 4FJLA 3NGZA 2RKIB 2FVCA 2D0AA 1DTTB 1RT7A 1VSEA 2HHTA 2UVVA 3DRRB 3BREA 1RDRA 1TKZB 4Y2CA 3VQAA 3G86A 3MF5A 3MFIA 3HP6A 1EP4B 1HQUB 1S48A 2IM0A 4ZPCA 5KFNA 5K14A 1RT3B 1BQMA 2ILYA 3H4BA 1JLQA 1ZBLA 1KRPA 5HLFA 3ZT1A 3V9ZA 5KFZA 2UVUA 1C0TB 3PY8A 4KTZA 2O4GA 4O44B 3LZJA 4MH8A 3KKRA 1RTDB 3T1AA 1S4FA 3OYJA 1WSIA 4NLDA 4FK2A 4O4GA 3MECB 3DOKA 3RB6A 1Z26A 5KFAA 4B9UA 4K8ZA 1KLMA 5DQGA 3OJSA 4I7FA 1NK4A 3FFIA 1C0UB 3NH1A 3CWJA 2AGPA 2RN2A 4TN2A 3H40A 3VA0A 3G10A 2XI2A 1KVBA 3I5AA 2YNFB 1FKOB 5C42B 1JIHA 4ID5A 2BRKA 1QHTA 4MFBA 3DMJB 4KFBA 1N4LA 1NJWA 3KKSA 4FJGA 1S6QA 4B08A 4Q0BA 3AVCA 4KI4A 3GIMA 5DG9A 2GIQA 4C8MA 3MXMA 5KFPA 4FJ9A 5F8LA 4RU9A 4IRDA 2DFFA 5KFHA 4DU4A 3AVNA 3AV9A 1EP4A 1FKPB 5CYQA 4BWMA 3GYNA 4QWAA 4GW6A 2X74A 1JLAA 2EHGA 5I3UB 1XR6A 1RT4B 3DRSA 2FJVA 3SNNA 4KO0B 4URGA 1S97A 2IJFA 4F4XA 3ICLA 1GOCA 4LH4A 4ECYA 1VRTA 5KT2A 1IKVB 4E7JA 1S9EA 4DTNA 3NBPA 5KG2A 3K2PA 3JYTA 3ZSZA 2BGGA 2YNGA 3E01B 2DY4A 4IDKB 4NLOA 4IH6A 3L8BA 3AVBA 4HTUA 1K1QA 4WFXA 1VSJA 4Z4GA 4RW4B 4ZHRA 4LSNB 4H4MA 3P5JA 3AVAA 4DFKA 1U49A 3TI0A 3DM2B 3QEIA 2AGOA 4RW7A 2WCXA 3KD1E 5KFUA 2W42A 4FLWA 5KFJA 4WE1A 1S6PA 2OYQA 3OYIA 4M41A 1JLGA 4KV8A 4O3PA 4FJJA 3KK3A 5I42B 4KE5A 3NH0A 2FVQA 1RCHA 2XC9A 4ZVFA 5DMRA 1L3TA 1SV5B 3IGNA 4O3QA 1T05A 5I42A 2RF2A 1SH2A 2QV6A 4CIFA 2HMIB 3VQDA 3PZPA 4Y2AA 4KV8B 1BIZA 4U7CA 4HHTA 1NKCA 1S6QB 4M3TA 1A5VA 2XWYA 4E7IA 3L2VA 3O3GA 3ZCMA 1S0MA 3NF6A 1JXEA 4ECWA 3HVTA 4ZHRB 2B6AB 3T19A 4YR3A 2D5RA 3SQ1A 2W7OA 2HNDA 1S1TB 4MK8A 2HHVA 2IBKA 4IQXA 2V0NA 2KZZA 4ZTJA 3I0RB 1N6QA 2R2TA 4OGEA 3T5KA 2JLEA 2KFNA 5J2PA 5KI6A 2YNHA 2OZMA 1SH0A 4ECZA 3TANA 1RA6A 3PVXA 5KFQA 2W8KA 2YV0X 3ITHB 1W0HA 3PW4A 5L1IA 2QE5A 1J53A 4ED6A 4CHNA 5D3GA 4RNMA 2IC3A 4IH7A 2Y1JA 4QWDA 4CGJA 1TP7A 1KCFA 3RBEA 2ZQBA 3DLKA 4J2DA 2C2DA 1XHXA 2HWIA 3DLBA 2KFZA 5HBMA 5HP1A 4CJSA 3OYBA 3ZT4A 3AO5A 3NGDA 1UOCA 1XR5A 3VQ5A 3MEDA 1IKWB 3SPYA 1JXBA 1HJRA 4EZ6A 5E41A 4OPJA 2OPPB 3PR5B 3HPGA 2F8EX 1NKBA 1BL3A 3OYDA 3AVKA 1LWCA 4DS5A 1J54A 1RBRA 4UQGA 1RTJA 3QGGA 4O55A 4FBTA 1JLBA 2B5JA 1RTIB 3TWHA 3LANA 1RTHB 3EYZA 3MXIA 5FRNA 3LP2A 2YKNB 2C28A 3O3FA 3VN5A 1LW2B 3K58A 4CJRA 3ITHA 4FS2A 4MIBA 5KRTA 5JXSA 4BDYA 3HVAA 4O4GB 3AO2A 3KMSA 2FVRA 3AA3A 2IDOA 3BR9A 5JS2A 4TYBA 2XY6A 3ZT3A 4F4ZA 1JLCA 4KHSA 2FBYA 3DDKA 4NYNA 3M9MB 4WXOA 4BE1A 4NYFA 3SUPA 1VSLA 3KMQA 2RDIA 3M8QB 4I2PB 3CJ4A 2IMWP 1S49A 1SL2A 1RTHA 1WNEA 2C2RA 4I9LA 4ZMMA 4FM2A 2I5JA 3QIOA 4M45A 3VQQA 4CGHA 3AVFA 4JLHA 5KG5A 3C6UA 3O3HA 4RW9A 1WSFA 2ATQA 3BSNA 2RDJA 2V4QA 3GV7B 4Q8FA 1RT6A 1LWFB 3KLIB 4CEBA 4RW6B 3C94A 5KGXA 3M8PA 4B9TA 3KK3B 2JEGA 2ZD1A 1JL1A 4W5NA 2XGQA 1ITGA 4CK2A 1EETA 4M3RA 4FJNA 2OPSA 3NMAA 4ED8A 5D3GB 5DGAA 2R7YA 2HHQA 5KFTA 2C2EA 5EWGA 4FLTA 5KFEA 5DG8A 4E19A 1HQEA 1TL1A 4O5BA 3RBDA 3G6YA 3L2RA 3RRHA 4IRKA 4CEOA 1RYRA 4JS4A 4FLXA 1S1UA 4IDKA 4NZ0A 3OL8A 3SQ0A 1TV6A 3PR4A 1S5JA 2IAJA 3VQ9A 1JKHB 4TY8A 3LAMA 3QEXA 4DL4A 3D28A 2OA8A 4OKJA 4HVJA 2XCPA 2W7PA 5DLFA 5F9NA 1RDCA 1VSFA 2IM1A 4J9QA 4B9NA 1LWFA 2JC0A 4YQWA 4K4TA 3MR3A 1QTMA 2FLLA 1MU2B 3N6NA 2BE2A 3BQ2A 2ZE2A 4TLRA 2JEFA 3HSTB 1L3SA 3MFHA 3H2LA 1SL1A 3UDLA 5F8GA 4JV1A 4NLVA 3ZSQA 4JV2A 4OKKA 1CLQA 1RYSA 1I39A 3OHBA 4H4OB 2FVSA 1WNSA 1N5YB 2IS3A 1S6PB 1W9HA 3VQ6A 2O4IA 3T5HA 3BQ1A 3H5XA 3TAFA 1NJYA 1FK9A 1S1UB 3OS2A 4AH9A 1NOZA 2WHOA 5HROB 1S0NA 3DI6A 4QAGA 1F21A 5J1EA 2A1SA 4FLVA 4G1QA 4IFYA 2KZMA 4K4WA 4KKOB 1KLMB 2VWJA 5J2QA 3JYTB 5JUMA 4ZPDA 4DL5A 2VG7A 4QW8A 3MECA 4I2QA 3T5JA 3G6VA 1VSIA 3OSPA 4B9LA 2IJNA 3BSOA 4FS1A 3GIKA 5EWFA 4K4UA 5KFMA 2YKMB 3SUQA 1SKWA 3FQKA 4LSLA 4NLQA 3DRSB 2B43A 5KTQA 4LSLB 3KLIA 1IKWA 3KK2A 5I3UA 4MKAA 4FW2A 1WSHA 1NHUA 1C0MA 4KHNA 4TY9A 4AHTA 4KHRA 3AVIA 3TAGA 2ASDA 1HNVA 2CKWA 3CDWA 1X9SA 2E9RX 5HRPA 2G8WA 3C6TA 3EPGA 4CF9A 4W5RA 4FXDA 2GV9A 1T7PA 3RAXA 4ECRA 3QERA 3TAQA 1WSEA 2IC3B 4URSA 4ED3A 4U6PA 2X6NA 1DTTA 4PA1A 4CJ5A 1NK7A 3RB0A 3MEEA 2YKMA 4Q0BB 2OPQB 1CXQA 1TKXA 3EZUA 5J2PB 2VG5B 3DMJA 4MFBB 3KLVA 4CHOA 4NLTA 5L1JA 4K8XA 3ZSRA 5L1LA 4M3WA 3IRXB 5J2QB 3OL7A 4DQRA 1I3AA 4FLZA 1BGXT 1VSMA 4CHPA 3L2UA 4NRTA 2Z1GA 4CJKA 1S1TA 4C8KA 3QIPA 3OYKA 3V1OA 4F3OA 4YR2A 1ZETA 3H08A 2E9ZA 2KW4A 4K4ZA 3HVTB 4NRUA 2P5OA 3WNGA 3SFGA 2KQ2A 1IH7A 2FJXA 3SUNA 4KPYA 2BQRA 4AHRA 4PQUA 4CEAA 3MEEB 2EX3A 4W5TA 1EX4A 4CESA 4ZP8A 4FCYA 3DRPA 3CDUA 3Q8QB 2Q3SA 1IKYA 4DFMA 4QCLA 2W9CA 1BHLA 1EXQA 1DTQB 3PUFA 4DL3A 1JLQB 4NLYA 4M3ZA 1BQMB 4WXWA 3PO4A 1JLGB 3M9OB 4CJUA 4FK0A 4K4XA 2UUWA 2DFHA 4CEFA 3JSMA 1HNVB 4IOBA 3V4IA 4FJ5A 3RAQA 2D3UA 1RDBA 1TQLA 2FLPA 2AWZA 3DYAA 1NK6A 1HQEB 1XR7A 1QSSA 2WOMB 3LWMA 4LD0A 1LW0A 3AO3A 1ZTWA 1HMVA 3O4QA 4CECA 4QPXA 4CJWA 3LPUA 4M3YA 3DOLB 1EETB 3HJFA 3CFRA 4IG0B 4CJLA 4HUEA 4O3SA 1VRTB 3IG1B 3QNOA 3M8PB 2XHBA 3QLHB 3SV4A 1XWLA 3OYLA 3DYAB 1T94A 2Z1IA 5JS1A 3H4DA 3AA4A 5HROA 3ZT2A 1RT4A 1REVB 4KHWA 3BJYA 1WAJA 3TAPA 3LWLA 1KHVA 3D5MA 3PW2A 3NDKA 4NLUA 1TVRA 1S1WB 2VG6A 2I5JB 4B9VA 1LWEB 4QW9A 4OKEA 1A5XA 4E1MA 5DK5A 4DSFA 3CFPA 3OVNA 3UQSA 3BGRA 3PW5A 1DLOB 4KREA 1MU2A 4PQUB 1YT3A 4HYKA 5KG0A 5CYMB 2AQ4A 2R2RA 1REVA 5C42A 4CJVA 1VK0A 4H4MB 3NGIA 1WN7A 3CDEA 4DS4A 1Q8IA 4B9MA 1ZYQA 1RBSA 4ELVA 3RWUA 1KVCA 3SJJA 1S1VA 5F9LA 4GVMA 3IG1A 4EZ9A 1UA1A 4RW8A 2YNGB 1JLCB 4R8UB 1U48A 3NH2A 3LPTA 3SQ2A 4RZRA 4WZQA 4AHSA 4FW1A 3LP0B 3TQ1A 1HMVB 1SUQB 3IGVA 1IKVA 1QSLA 3PX4A 3D0PA 4J9MA 1HARA 4W5OA 3F73A 1ZBFA 1TL1B 5KFCA 4DTUA 3PO5A 4CGGA 4CK3A 3SPZA 3PJWA 2XY8A 2GIRA 4EO8A 3V4IB 3ZSOA 4HCCA 3KJVB 2J6TA 3VQ7A 3KNAA 4CGFA 4CJTA 4DTMA 3A2FA 4HKQA 2FJWA 4NCGB 2XY7A 3NL0A 3F9KA 2ZKUA 3KJVA 3N6LA 3OL6A 2VA2A 3FDSA 3RTVA 1O1WA 2BANB 3N6MA 3SQ4A 3QGHA 3TABA 4FM0A 1JLFA 3DLEB 4FJ8A 4ECSA 4C8OA 4Z4HA 2ASLA 1KHWA 4MKBA 3KHLA 1UAXA 4KB0A 2R8KA 4XPEA 4RUCA 5FROA 4RW9B 4OJRA 5DQHA 4E7LA 4QOZB 1FKOA 3SV3A 3DLKB 4R8UA 4NLRA 3RMDA 1ZBHA 4N56A 1JXLA 5J2MA 5KFSA 1S1XB 2D3ZA 2IM3A 4O3OA 4K50A 4F4YA 5DG7A 4E3SA 3FFIB 2YHBA 2Z1JA 4FYDA 2C22A 4F4KA 1TKTA 1W25A 4CHYA 3IRXA 2ETJA 1BISA 1MMLA 1U47A 2GBZA 5KFXA 3VQPA 4CFCA 4AHUA 3AA2A 2VG5A 1JX4A 3KLFB 3OY9A 1NOYA 3S9HA 4KSEB 3V81B 2BQ3A 3NCIA 3IAYA 2ATLA 3SYZA 3BGRB 3ISNC 2HMIA 4E7HA 3LP2B 4URQU 4OVLA 4JV0A 2ITGA 4DL7A 4Y1DA 3HM9A 5K14B 3CG7A 4AILC 1S1WA 4DTJA 3CM6A 3PX0A 2JC1A 1FXXA 5L1KA 3H59A 3L2QA 1HYSB 2FBTA 2BRLA 5KT4A 1RT2B 4Z4EA 1WSJA 4FLYA 1BI4A 3I0SA 2ALZA 4WYWA 4FJHA 4JUZA 2BANA 4DSJA 1QE1B 4RUAA 3ALYA 2HNZA 2UUTA 4KB1A 4TY8B 4XO0A 4WE1B 3TVKA 4WYLA 4G1QB 1S9FA 4DFJA 3HVWA 2XO7A 3QNNA 3Q8RB 1K6YA 3DI6B 1TAUA 4KTWA 2HHSA 3HVRA 5KGWA 4J2AA 2AU0A 4BACA 3H5SA 3TAEA 2W9BB 4DL2A 3IS9A 2UVWA 5T14A 3FRZA 1FKPA 1N6QB 3ASMA 1C1BB 3D45A 1BIUA 4H8KA 2BQUA 4AHVA 3PV8A 5CY4A 2QKBA 4EBCA 4NLPA 4J2BA 4KO0A 3G0ZA 4RW6A 4Z4IA 3KLGB 2X6SA 3ZSWA 4DSLA 5KFFA 1RT6B 2J6UA 1RBTA 2IM2A 5HRSA 1NK5A 3H5YA 2JEIA 5F8HA 2FC0A 4KHUA 2HHXA 3I8DA 3V6JA 5KRSA 4KHYA 4H54A 4LY7A 4CJPA 3M8RA 4FZXC 4LH5A 4CEQA 2PY5A 4O0JA 3KLHA 4CJFA 3CIZA 3M8QA 4B3OA 1XHZA 1UWBB 1LWEA 2PYLA 4F4WA 4Q44A 4PWDB 2IAJB 2D41A 4F50A 1TL3A 5KFOA 1RBUA 1RA7A 2E6LA 3MEGA 4J9OA 1CXUA 4XIUA 4EBDA 4WZMA 5DLGA 1HNIB 3NGYA 4CFBA 1RTIA 1HQUA 3AVJA 3C6TB 4IG0A 5C24B 3K5OA 4KHQA 4F3TA 3L2WA 1TK8A 3CVKA 2P1JA 2R2SA 5KFKA 3OS0A 1BI4B 4TSXA 4KRFA 4O44A 3VQEA 1NHVA 3QINA 4MIAA 2AX1A 4NCBA 1C0TA 2RKIA 4J9RA 1KTQA 4CIEA 2Y1IA 3P1GA 4F2RA 4ZPBA 1S10A 4KAIA 3VQBA 5F8IA 1JLEA 1GX6A 4NCGA 2HHUA 1HRHA 5CYQB 2I1RA 4CHZA 1RBVA 2G8IA 2Z1HA 4FLUA 3MR5A 2YHAA 3DRRA 2W8LA 4AHCA 3BDPA 5SZTA 4TYAA 1T03B 3WNFA 4DF4A 2F8SA 1SKRA 3LAKA 3WNEA 3THVA 4R5PB 2A1RA 1TK5A 3V6KA 4I9QA 4DF8A 3ZT0A 1U4BA 3OLBA 4NLSA 5FRMA 3KLFA 1LV5A 1BCOA 1TL3B 4TQSA 1T8EA 3PX6A 4DQIA 1C1AA 3Q8PB 3QEPA 2HVIA 3I5BA 4DU3A 4ECVA 1UWBA 4DTPA 4HUFA 2P5GA 1NK8A 4X2BA 1RT5B 3OYHA 4EYIB 1RT5A 2HNDB 2HHWA 3KK1B 1QAIA 1U09A 3SZ2A 1ASWA 1C0UA 4J9LA 5KG3A 4IBNA 4I7FB 2B6AA 4IG3B 2B5JB
chains in the Genus database with same CATH superfamily
2FGCA 3JSYA 1BCMA 2M8HA 1D9DA 5KFGA 2FHKA 4UOCA 5GMEA 3C14B 1N48A 3EICA 1RWWB 5CH7B 3IR5B 4NPOA 3EXYA 3NS5A 2QKKA 1JLEB 5D4NA 5HQMA 3V9XA 1YF5L 1GMWD 4K4SA 4DLEA 1Q5YA 1LOUA 1N54B 4JBCA 4EIAA 4MQ3A 3TJ8A 2UU9J 3FBCA 1QAJA 4CJ4A 2ROEA 5SWMA 2JVRA 3SSRA 2WSCC 1WI8A 1FD8A 1YVFA 3B54A 3CMEN 1AROP 1WKLA 2HNYA 3HPHA 4ICLA 1OQ6A 2OMOA 2ZM6F 2W2QP 1BWFO 1L3UA 2EBGA 4DQSA 3GZ7A 3KHRA 1HHTP 1VBXA 2BMBA 2V7ZA 4OLOA 3UKUB 2NSBA 3N0VA 3HHLD 4NA2A 4OPKA 3QEWA 2ROGA 4Q45A 2FPHX 4KBIA 4XK8C 3R97A 2KXHA 1RWKB 3UN3A 3NWRA 1J5OB 3ATUA 2C3OA 2KTQA 4BE0A 5F8JA 2AYMA 1EAYC 3THXA 1Q4RA 3QWPA 1TKTB 1B7FA 1WTBA 4C2MA 2AV5A 4B8AB 3Q0AA 2DPNA 1X9MA 4DEZA 2A5XA 4PUOA 1KVKA 3DOLA 3AOAA 3M2VB 3UD5A 3CJ2A 3OFFA 3E9OA 1RQ0A 4OO1J 1HNWF 2DPIA 4HUGA 1BXNA 3OR1B 1M1HA 3KYLA 3EDRB 1NK9A 5CE3A 4I1TA 3BSCA 3HF5A 2UUAF 1N8RO 1IXKA 3M1FA 1L3VA 4A2BA 4GC7A 3KLEA 5DDOC 4GKKF 2YWFA 3IMXA 3JSMB 4Y2KA 5D0EA 3FZHA 2J9DE 4CJ3A 4RPFA 3TZZA 1HWIA 5J2NA 3EL2A 3W8GA 4LRFA 1SS6A 3O8MA 5AQSA 4L76A 1RDAA 4HHUA 4OHZA 5DM6Q 1R0BG 1D5AA 2AGQA 3H3OB 3K5NA 3KHYA 4CH7A 4B1UB 4JI8F 1HYSA 3SCXA 5GAEU 2D0CA 3OS1A 4DQQA 2YQ1A 2CQCA 2ZH5A 3EDQB 3C6UB 1FDNA 1N36K 4P75A 4FJXA 3MPDA 2IGIA 7FD1A 4YNQA 3MM9A 1RWVB 3M2UB 4NCAA 1QVFM 1HNIA 1Q95G 2MZSA 2VFUA 5KG6A 2NXNA 2DR5A 1K0TA 1E4GT 2CVIA 4C8ZA 4DMZA 2E4LA 5A8KA 4FJMA 1Q9XA 2ZUGA 4ZLJA 1J5EJ 4LFBJ 2CRLA 3V6HA 4LSZB 1OMSA 3CE8A 4AM7A 3PFEA 4ID1A 5F8NA 2WB4A 2ZJQL 1RT1B 1UCNA 2CADA 3EZ5A 3S8SA 2JX2A 3CQXA 2JH3A 4G9ZA 4YOTA 1FT8A 2GO8A 3D6RA 3DU6A 1FJGF 2VU5A 3JTOA 2VJVA 3WNHA 4BC5A 2A18A 4Z4CA 4KHPK 3HL8A 5BPNA 1IBMF 5BYSA 1Y5NB 2EC0A 4KH4A 2G8HA 4UF4A 2CGKA 5KT3A 1UVMA 1IBLJ 5A2QU 2PFDA 3C19A 1T3OA 2XMUA 3OFHA 4CI0B 4OV6A 3DOMA 4M3UA 3V9SA 4DV6F 3N5FA 3CERA 4RW8B 4MK9A 1RBAA 1R8HA 2CA9A 3DGPB 3Q8UA 1CZ9A 2C2KB 1UA0A 5BN9A 4CEEA 3SJHA 3IBFB 4WP3A 1B0TA 3OLAA 1Z1ZA 4TU7A 1N5YA 1XQIA 2FF3B 2H1YA 4DUYJ 5LY3A 1T9TA 2COLA 3NS7B 2N7YA 4B1ZA 3DRPB 3K5LA 4YOYA 1UJ5A 1M90O 1QY7A 1NM1A 1WWHA 3UCZP 4ZVGA 2EWSA 4EP5A 3K7RA 5KG4A 3UVJA 4DPOA 3TJAA 3ENWA 2UXCK 5IWAK 3T3FA 4KFBB 3R1HA 4BC3A 2GTDA 3W66A 2HFZA 3VQTA 1T05B 3OYAA 1HI1A 3CJAA 5AQLA 4P2FA 3U1LA 2B51A 2WB1D 5ETQA 2P51A 2KFYA 4CZMA 4OJHA 4IFVA 2KH9A 5KQ8A 3DOKB 1ZC6A 2W9BA 4ZLNA 3WC0A 2FY8A 2PI5A 4DCOB 1FNXH 2YNIB 1TKDA 4DI6A 1IV0A 3SCJE 3T7ZA 3MAHA 1CJKB 3E2EA 2CFXA 1MNEA 3OYNA 1BDGA 4YP3A 3M6UA 1P6TA 2I7NA 3CB4A 4AXJA 3RR7A 4KB7A 1RGVA 1UVKA 2ITMA 2CPIA 1U1PA 4H5WA 4NASA 4MYUA 2OEKA 3KHHA 4DZDA 3CCQS 4YY3J 1H2UX 2DO0A 3C65A 3MEDB 4ZVPB 4BDPA 4MT1A 3GFXA 1YJ9S 2YI1A 4MLHA 3S3OA 3D6HB 4PUOB 2HBKA 2E88A 1J2VA 1NBWA 4KH5A 3T5LA 2D4WA 1K8AT 2K7JA 1UEUA 2QWPA 1VC5A 4CF8A 3EGNA 3H7HB 3SI8A 2OJ3A 4DWIA 1LXNA 4QZVB 1ZXOA 3CD6S 4BWJA 3NNHA 1ATSA 1KNZA 1VQ8N 2P2CB 1B92A 4CF2A 2P9LA 4DV3F 1H74A 2CXEA 4OL8A 1YDLA 2DGUA 4PR6A 3M30A 3LM9A 1S1VB 2F8TA 3P31A 3MGJA 3AO4A 4BE2A 3FSXA 2WRMA 2HGMA 1OWXA 3I96A 4JRPA 1HD1A 4L8RB 4Z2XA 4FK4A 3G6XA 5HJYA 3QRRA 3FKBA 3C95A 3KK2B 1H7WA 1TYQA 1EARA 2G1DA 4PQAA 1VI7A 1ASUA 1I1GA 4DSKA 4R0EA 2BJEA 1JLFB 1KSPA 4AQYF 4JI7F 3K0JA 1PC5A 2MKJA 4DV5F 2PMZD 2ASYA 3LTOA 2ZZTA 3POTB 2Q66A 1V5IB 1L5UA 2WTFA 3HLUA 2MLXA 3VETA 2A3JA 2YWWA 3JQJA 3VGTA 1CG2A 4F3MA 3SSQA 5ETOA 2J6SA 4RJVA 1UW4A 3VQ8A 4JKDA 4ZITA 3SUOA 4KTQA 4FM1A 2WONA 3FZKA 3SCLE 3U3GA 4FYWB 3EKUA 5DO2A 4Y3CA 3MCAB 2V4RA 1YHQN 2FJAB 2G0CA 1PGZA 1RCOB 4PG6A 3ULEA 4ZPAA 2LP4A 4LVNP 4U8YA 1FKAF 3GILA 3ZETB 2B7CB 4B3TJ 2QA4G 1NEEA 4U67L 3HD2A 4ENOA 4DMNA 4QWBA 4CW7B 4BRKA 5FDLA 1IWGA 1SJ4P 4HDGA 1RHQB 3TX0A 3NAHA 1C1CB 2C3UA 1Y64A 1SKSA 2MGZB 1NGAA 1VSDA 1RT1A 3AJDA 3J80U 1S3XA 2OZSA 4JI3J 5TKWA 4OZ5A 4CZFA 4FJKA 4N47A 2ZE2B 1TVRB 2QFIA 3BUZB 3ULDA 1WSGA 3E9LA 1HR0F 2ZHOA 4Q8EA 4CEDA 4LFBK 2V8VA 2MKCA 4OHYA 3PYEA 1Q79A 4LR9A 3EEQA 5HOOA 3AJ2A 3BO3A 3CFOA 2BR0A 4ECQA 2FIUA 1RDWX 1HA1A 1UJ6A 2OFHX 5JVHQ 4FBUA 4DR2K 3A8IA 2RD5C 3CCVS 4ZVHA 3TQEA 4QIWD 2WW4A 3SDEA 3NGZA 2RKIB 1K73O 2HSEB 3DDIA 2OMLA 1VSEA 3EUNA 2ZM6J 2HHTA 4AUKA 1ZM2A 4H5TA 1X4DA 3PSIA 3MF5A 3CIMA 4MO4A 2F5GA 4IOAQ 3F41A 2IM0A 5K14A 1BQMA 2ILYA 3VR1A 1JLQA 5HLFA 1XNQJ 2UVUA 4I6WA 5HMWA 1KEKA 3PY8A 2O4GA 4DKWA 2MJNA 3LZJA 4CO0A 1B3TA 2V68A 3UI3A 5LJWA 2E7XA 1K73T 4FK2A 1ESVA 2P9UA 1NJIO 4I7FA 1NK4A 3FFIA 2HS0A 3GR1A 2ZC4A 1LCUA 3H40A 2NRZA 5HMZA 5EOYA 3R1XA 3VA0A 4M5DA 2H4WB 1FKOB 2XMVA 2BRKA 4MFBA 1N4LA 2MEWA 3KXDA 3KKSA 4B08A 2P9KA 5E3CA 4JI1K 5D0GA 4KI4A 3GIMA 3JS9A 2RRBA 2ZOGA 3S01A 4UOFA 3RW7A 4IRDA 2DFFA 5KFHA 2P9IA 3L7UA 3R2DJ 2KT3A 5CYQA 1JMTA 4BWMA 5ETRA 4QWAA 2CPZA 3CMAN 5I3UB 1Q7YT 3MM8A 3BKUA 2WAQD 2B9YA 3DRSA 4CBXA 1X4BA 1NPKA 4PRFA 1D9AA 4Q2MA 3ICLA 1IKVB 4EU0A 5KG2A 5CR4A 1VBZA 2VKZG 1X5OA 4IH6A 3M1VA 3N28A 4HTUA 3WT0A 4OYBA 4GY2B 1YJNS 2DK2A 4FSVA 4RW4B 2MQMA 4LFAJ 5KAKA 3PRDA 3MK6A 3IAM9 2RS2A 4RW7A 4I6YA 5KFUA 2W42A 5LXRA 5KFJA 1V4TA 4WE1A 2OYQA 4G6VB 1JLGA 1NMNA 3FZ2A 3KK3A 5CD4H 3R2CJ 3NH0A 1YJWS 3K2YA 2YCHA 5DMRA 3DXMA 2IY5B 1WKKA 5ITHA 3IGNA 4O3QA 1T05A 5I42A 2RF2A 3I56S 3EX7B 1VHIA 3VQDA 3PZPA 3MMBB 4NXNJ 2I8EA 1NKCA 3W62A 4YB7A 1A5VA 4E7IA 2HBLA 3ZCMA 2L08A 4NI2B 4DJBA 4ECWA 4A59A 2N7CA 3PFOA 3WXKA 2D5RA 4YR3A 2Q97A 1EKRA 4OI2A 2MQOA 1OQ3A 2UXDF 4ZTJA 3IBCB 4GKJF 1UTAA 3T5KA 2JLEA 5J2PA 3L7PA 2Y8YA 3IXQA 3BYPA 2OZMA 2V34A 3H6EA 2AF6A 2BJ1A 3R7BB 2ZH7A 5KFQA 4I6AA 2F9WA 4W4MA 2VFSA 1J53A 4CO3A 1QVGM 2ABYA 3M1VB 3ZZRA 4I67A 4QWDA 1NSPA 2HBYB 2YXLA 4YDXA 3DLKA 1LQ9A 2KFZA 4JKGA 2J0WA 5HBMA 5HP1A 4CJSA 2KRBA 3ZT4A 1XUPO 2NSCA 2VC1A 1N36F 3SLCA 4WK1A 1U1KA 4ZVOB 3ZEUB 4EZ6A 5E41A 4F4AA 4A8XA 3TUIC 3OR1A 2OPPB 2KHDA 1BL3A 4LF4K 1Y5LB 2GX9A 3H25A 1RTJA 3QGGA 4O55A 3IWXA 2PA8D 1JLBA 4K2JA 4LMZA 2JNJA 1VHXA 5CQGA 1F2HA 3TWHA 1U1RA 2V8HA 3IWLA 1AFIA 3O3FA 3BN4A 1LW2B 2KM8B 2DJWA 2POKA 2XMTA 3KK7A 2P9UB 4MIBA 2LU2A 4IYQA 3NG8A 5JXSA 4DUTA 5A8KB 2G2OA 3CC2S 5DRKA 2H3GX 4JK9A 4TYBA 3AXKA 4WXOA 1LKZA 1NZAA 4K41A 3SUPA 1TTHB 3GDQA 2CQIA 4KH1B 3WEEA 1SL2A 2MLYA 2C2RA 1X4FA 3MM9B 4ANCA 2AD9A 3VQQA 2DRBA 5AQYA 4CGHA 3AVFA 2R4FA 4L72B 4JLHA 3C6UA 4RUBA 1Q7YO 1WSFA 2ATQA 5AE1A 2RDJA 1RT6A 2Y0SD 1IBLK 3SSSA 1B7YB 3M8PA 1PILA 2QO3A 2DNGA 3CCJS 4GKKJ 4WKRA 2XULA 2NYHA 4ZVQB 2E1PA 2L3MA 2JEGA 2ZD1A 3KG4A 2NRRA 2XGQA 2J7KA 1G99A 4FJNA 1XMQK 4ILGB 1F9HA 2QL9B 3D3BJ 3NMAA 4ED8A 4DUZJ 5DGAA 2C2EA 2FSKA 4R79A 2W24A 2JHEA 2MZRA 5DG8A 4KYZA 4DCPB 1TL1A 1RKIA 5KPRA 4IDHA 4MDBA 3RBDA 4CEOA 2ZHBA 1RYRA 1HJOA 5IC6B 4K0KK 4BRLA 3Q8YA 4K25A 2JZ5A 4W92B 3PR4A 3VQ9A 1GXUA 1VQON 2ZNZA 4TY8A 3LAMA 2E1AA 2R7SA 3L3CA 1RU1A 1FE0A 2XCPA 4LFCK 1IUJA 4PKIA 5F9NA 2O8EB 1RDCA 3IP0A 2M9KA 4C0HA 2UUAJ 3BQ2A 3I87A 4TLRA 4EK2A 3U9ZA 3MFHA 1H3DA 3UB5A 2CQ3A 2DNQA 5E5NA 4JV1A 4NLVA 3RSEA 3GG4A 1CLQA 2BZ2A 5AZJB 2YKOA 1YTYA 1NJYA 4JI1J 4X4OA 1GXLA 4WFNL 4DV3J 3ZNUA 3HM8A 4JYAK 1BUXA 1D8ZA 2EK1A 5C2CA 1FE4A 4LUBA 2IYIA 2IYGA 2UXCF 1URRA 4JAXA 1K0VA 2X3DA 2W2MP 2ZKTA 1K47A 2A1SA 4G1QA 4OHWA 2CJ9A 2VWJA 5JUMA 1HBMB 3C15A 4QW8A 2L48A 3T5JA 4J9VA 4B9LA 1Y5IB 3G6ES 3MN5A 3GL1A 4FS1A 3I8BA 1PCAA 2PAVA 1SKWA 3HHNB 4PL8A 2X7IA 2D9PA 5KTQA 2B43A 4DR3F 4KHNA 4KHRA 2BKOA 3HSGA 3AVIA 3TAGA 3VGSA 3ID6A 3NOCA 2CKWA 4F9OA 2P5VA 4BG8A 2G8WA 2VDIA 4W5RA 3RAXA 2IHR1 3V4MA 4URSA 4F67A 1WC3A 4DR6K 1DTTA 4PA1A 4CVNE 1Q8LA 2G13A 2VBXA 2OPQB 5T7LB 3EZUA 4LFCF 2E1RA 2QL7B 2Q6BA 5DM7Q 4K8XA 5L1LA 2D69A 5J2QB 1IJEB 4XAKA 1I3AA 3GJSB 1DQ8A 5HK4A 1WBBA 1MROB 4NRTA 2ZOMA 2J0QD 2R7WA 4F3OA 3CDBA 3GG0A 2VF3A 2ACMA 2HBQB 5M2PA 1E3MA 3SAGA 4DPWA 1NWKA 2P5OA 2KQ2A 3WIUA 2Z56B 2FJXA 3RGIA 4K7QA 4KPYA 2DYAA 1FFWB 2BQRA 4LC9B 5A6PA 3P45B 4B1XB 2OI2A 4ZP8A 4FCYA 4YB6A 2BOPA 3CDUA 2ADCA 5B7WA 1EXQA 1VOMA 1DTQB 1JLQB 4RBUA 4LRAA 4WXWA 2CPHA 1TL4A 3M9OB 3T1HK 2E1CA 4FK0A 2DFHA 2UUWA 4C0BA 3V4IA 4QYRA 2VFVA 1DAXA 3CC4S 3OBWA 3QRPA 2FLPA 2AWZA 1NK6A 2R7VA 3SQGA 2OTLN 1S77D 4FYVB 4LD0A 5AJ3F 5ADZA 2Y0BB 4HT5A 2M52A 3B6BA 1CS4B 4IG0B 2VPWB 2HHHK 4NXMF 2VHGA 1AZSA 3CC7S 4GV3A 2V8PA 3PIPL 4OHXA 2O01C 1U8SA 1FCAA 1EWRA 3QNOA 3M8PB 3ZZUA 1ITPA 2Z1IA 5JS1A 1HIYA 3VVUA 3AY9A 1N32K 5AQGA 4KHWA 3VEYA 5DDPC 1TVRA 1S1WB 4OKEA 1EQYA 3KUEA 2B8QA 5CCMA 3GCWP 1OY6A 3PG9A 1UZDA 3PTWA 3UQSA 4IO8A 3EVOA 2HVDA 2FHJD 2V50A 3JQMA 1JJHA 2V2QA 3FSYA 4CO4A 1YT3A 2QSWA 2HLUA 5KG0A 5CYMB 2P9CA 2R2RA 5C42A 2A6OA 3J7Z5 3CDEA 1Q8IA 4FWRA 2AIRB 1MSWD 4UZCA 1KVCA 4GVMA 4EZ9A 3IG1A 2XB2D 3LUYA 3DXKA 4BRHA 4CM0A 1RWXB 1QAYA 3ZTRA 4WFBL 3OQ2A 3WIVA 3NH2A 3DKDA 1QSLA 4C48A 4CTAA 1XNRF 3D0PA 1TL1B 4ZA1A 1CJVB 1HBUB 4GKJK 1OSCA 4CK3A 1RE1B 3SPZA 3I33A 1UAWA 4DR5F 4PWUA 2MKSA 3KJVB 4HEA9 5EY4A 4CGFA 2GAHC 3NMUA 4DTMA 2EPIA 2AZ3A 2CNOB 2UP1A 2SXLA 3N6LA 2M3DA 2VA2A 3RTVA 1JCFA 2BANB 3N6MA 3VEZA 2EXUA 3OVAA 3MM7A 3TABA 1JLFA 3KZBA 4HTIA 2GEMA 3NNAA 3KHLA 4X4QA 3ZZ0A 2R8KA 2DHHA 4PEOA 1KQGB 4DV3K 4U95A 5DQHA 4E7LA 5CHIA 3A13A 2R7TA 1FKOA 3QAUA 4X4UA 3IBWA 1ZBHA 4Q2LA 4N56A 4I4BA 3SAHA 4DUYF 3JAMU 3U1NA 1HBOB 2ZH8A 2Q36A 1IBCB 3L7OA 1NDPA 2BM0A 2YHBA 4FYDA 2FSJA 2C22A 1TKTA 4CHYA 2C2MB 1OJ4A 4EWTA 3ILLA 1YUWA 3VQPA 4CFCA 1NOYA 3OY9A 1Q0NA 2FJBB 5D4OA 4KSEB 4KPCA 3TW0A 2M5YA 4EFHA 4DDFA 3HX9A 3LP2B 2DVIA 2LXIA 4JV0A 4Y1DA 1S7IA 1Y00A 5K14B 1UJ4A 3AQOA 2O8FA 1PO6A 1WOSA 3CJ9A 3PX0A 3QSYB 5ADXA 5L1KA 1FTRA 4ZS6A 4LF5J 3PDNA 1W2IA 4P71A 1KD1O 1FRMA 3CGIA 4NXMK 4K2XA 1RT2B 4Z4EA 1BI4A 2ALZA 3RVCA 4FJHA 1EX8A 4DR2F 3EZWA 4RUAA 3ALYA 1VQ6N 1FEEA 2UUTA 1CLFA 1VQ7S 5GINA 3ULEB 5CZXA 2PN6A 2HAFA 5FPDA 3THYA 1T9WA 3HVRA 1S6OA 1GK8A 3H5SA 3TAEA 4JI7J 2V2KA 2IFXA 2UVWA 2XLIA 2QWQA 2MZ1A 2QWRA 3FRZA 1B99A 1BIUA 3OHRA 5C7PA 3VGUA 2QWLA 4AHVA 1YSJA 5CY4A 2AJ1A 2XG8A 2N4DA 4BRMA 1F60B 1T44A 1XIQA 4N7TA 1KC8O 3VZHA 1EQ0A 5HRSA 2DNHA 4WFAL 5KPTA 1U1LA 1U8WA 5LJ3Y 3I8DA 3KDOA 1P9YA 2O8FB 4KHYA 3M8RA 2CDRB 3PIPQ 4ZCLA 1VBYA 2PY5A 4CJFA 2QA1A 2X51A 4B3OA 1UWBB 2CJXB 3CC7N 1LWEA 2PC6A 4GVBA 4PWDB 2DR9A 1VQYA 1GT8A 3TTDA 1DBDA 2C3PA 3R6LB 3B8AX 3Q7BA 1RA7A 2RE1A 1DJ0A 2AZ1A 2NPFA 2PMHA 4DL0C 3MEGA 1XJWB 4WU2A 3N9UC 4EBDA 3A3OB 3W3DA 4ZIWA 5DLGA 2CUYA 5M1KA 1DHMA 4CFBA 1RTIA 2FJEB 1TFYA 1HQUA 2V94A 1X60A 5DZ6A 4IG0A 3K5OA 5K5MA 1K9MT 4KHQA 4F3TA 1T11A 3L2WA 4IUFA 3CVKA 2B4OA 2LEBA 4P2XA 1RZMA 2K06A 4USHA 4TSXA 1FXDA 1BA1A 4FXVA 4H0TB 1FNOA 3WHIA 3LDLA 1KTQA 1RAHB 3SDEB 5B0FA 4CIEA 1S10A 4JKFA 1VQNN 5F8IA 2NQPA 4H0VB 4NCGA 2MKHA 2I1RA 4CHZA 3T69A 3CMAS 1RBVA 1FNMA 1FRKA 4KT0C 3FUYA 2G8IA 1YJ7A 4FLUA 4Y6IA 3MR5A 4QJVA 2HQCA 2W8LA 2HSTA 2DBBA 3O9QA 5IV3A 4QS8A 1TK5A 2CQGA 3SMZA 3ZT0A 5FRMA 3KLFA 1LV5A 3C7NB 4YOEA 1BCOA 1FO1A 5A8WA 3HD1A 5F3TA 1T8EA 3HSDA 2HVIA 3DHWC 1LK7A 1NK8A 2P5GA 1XMOJ 3GFYA 3OYHA 1CBKA 2HNDB 1YJNN 1ASWA 3BPDA 4CZLA 4IBNA 4I7FB 2B6AA 4Y65A 2DH7A 1LOTB 5AQRA 2ZJRQ 2GJ2A 4ECUA 4O4RA 4P73A 3AVMA 1MWYA 2ZH3A 2ZOFA 2HMPA 2OPQA 3LZIA 3W2WA 2YKPA 4JI0F 1X0PA 1N32F 4YR0A 2CIMA 3PM9A 2AX0A 4EI2A 3PYGA 1IJFB 1NAQA 4ED7A 1XC9A 2BA9A 1FD2A 2EFNA 3PRBA 2JFDA 2Q79A 2ZBPA 3CJKB 1SZ2A 5BN8A 1VQSA 2ERRA 1KQSM 3ENBA 4DBQA 1R31A 2LQJA 4RO0A 3DRYA 1K9MO 4LSNA 1P90A 2VGNA 3R6GB 5SUHA 4S0MA 5I3QA 1WB9A 4PY5A 1H6KX 1ZBTA 5IZHA 3HHLA 3K5MA 1NCLA 4HTLA 1RWNB 3OR2B 4M5GA 4KKOA 4M5LA 3L0QA 2WFBA 3V9WA 1NMEB 3QO9A 1X4CA 1Q81T 1DZ5A 4CO1A 4P7VA 5HI7A 2RVJA 3R6MA 3DXSX 2QXFA 2Z2MA 1GAOA 1TUWA 1WHYA 5CYMA 3D3CJ 3J7YP 2U1AA 4PPZA 2Q1NA 4PL7A 5THWA 4J5OA 3W5ZA 2IRYA 4U67Q 1YQHA 3V1RA 1RLDA 2HURA 1GX5A 4ELUA 1NUEA 4WFYA 3RRGA 3SFUA 2F96A 4J37A 1ZPVA 4NLWA 4DSIA 2ASPA 2IA6A 4ZTFA 4LF9J 3Q24A 4A48A 2AYBA 3IS9B 3KHGA 4MYTA 1UVIA 4WFZA 1KVAA 1LW2A 2QLBB 3E9PA 4LF8J 2HG4A 3VPZA 3M9NB 4CJ7A 4DU8A 2VQEF 4XH4A 3MCNA 5DGBA 3EGWB 3R5JB 1WJ9A 3NCQA 2YY3A 2HQGA 2FJDB 4LVOP 4NZ7A 3N5BA 5IOLA 1K1SA 2MQLA 1R0CB 4Y00A 1NB2A 1DURA 2MKIA 3UNGC 3CIPA 3I0SB 2UUCF 4CF0A 2BUPA 1CJUA 5KFWA 1FEHA 1RACB 4ID8A 1RAJA 3RMCA 3OSNA 2KO1A 4B9SA 3NCRA 3EPIA 1YWXA 4QIGA 2HRTA 5B08A 1JL2A 3RU0A 2QEXS 2FY1A 4A8KA 4UY8O 3UDCA 3GWCA 3KWMA 4JKCA 2CNNB 1MN7A 1ATNA 4YB1P 4USTA 1RISA 5HQ8A 1YVUA 5BR9A 1DFDA 1FJGJ 4FVMA 3A5MC 2E9TA 1YVNA 5BJRA 3QBXA 1ZOTA 4MKVA 4IFVB 2QXLA 2ZWOA 3W9IA 3H90A 3WEEB 1HQ2A 1D1UA 4M5MA 1R3NA 4UT4A 3V1QA 4OX7A 5LMNJ 3IWNC 3OYFA 1SC4B 5LMUJ 4IKFA 3HPOA 1J5OA 4FXWA 2H54B 3P39A 4IH5A 4E2FB 1WAFA 1ZZFA 4LRBA 4USIA 2J9CA 3V2UC 4EO6A 1SJFA 5FPMA 1X1PA 3NF7A 1RT3A 1WC6A 3ISND 3ULHA 3TTFA 3TAMB 1N33J 1KD1T 4XDDA 2RAQA 5FDLB 2B56A 4BRNA 3Q86A 1B9DA 2HNYB 4P2SA 3P38A 2IIHA 4CIGA 3UCUP 1OY9A 2XCAA 3MR2A 3CF5L 1YTAA 4ETZA 1VQ9S 4LF4F 2D0OA 3LP0A 3THTA 4I2QB 1HNXK 1IN0A 1H7XA 4H4KC 5KPZA 2EG2A 1NRKA 2QJ3A 2BV3A 5E7OB 1MG7A 5LXYA 4DUZF 4BVPA 3OYCA 2DITA 1SJ3P 1T3VA 2DB1A 2P9SB 3J7YI 4F2SA 4LFAK 4PHTX 1HPZB 1VSHA 2HFVA 2HK3A 1WKJA 1Y97A 4NA3A 3CQ8A 2CWKA 5ETKA 4MK7A 5K8OA 2MLZA 2H65B 2B8PA 1QVGR 2XI3A 5AXLA 1N5TA 2FTRA 5EHHA 1VK8A 2HZVA 3T9NA 1WLJA 5KT7A 5AR0A 5AQKA 4DL6A 1M1GA 3FVYA 1F1BB 4CZGA 4DU1A 1RFQA 3UR0A 1N5VA 3AHPA 4BGBA 2Z30B 4B3MK 2NUBA 4BRQA 4CT8A 1SV5A 3CMES 1N52B 2D3O1 1R8CA 3TOQA 1VJWA 3GJRB 3LP1B 4KH6A 3O5BA 1IBMK 2OEMA 4C8LA 4FOEA 4O0IA 1VSKA 2EFGA 3AAQA 3O80A 5E84A 4A57A 4HVZA 1YZ6A 1OPIA 1TZ0A 1IQTA 2BKPA 3R8YA 4RW4A 3MM5B 1VRQC 1K44A 5F8MA 1IM4A 3FK4A 2IVOA 3QESA 3QZ7A 3E01A 3AT1B 3CD0A 2C2ZB 3U3YA 4AL6A 3G8QA 3DAWA 1XK8A 1ZAWA 1TUVA 2GO9A 2WVDA 2FSNA 2G8UA 2ZJQQ 3RB4A 2AMCB 1T3NA 3UIQA 3FBFA 4Z7CA 2VODA 4GMJB 2CDQA 4CERA 4J9NA 4FZZA 5HMYA 3VTIA 1CJUB 4TU8A 4C4WA 3LM2A 1WHXA 1G2EA 2PEBA 2VB6A 4J8FA 4BR9A 3HMJG 5AT1B 1RDDA 2E2NA 3TARA 1OKJA 1OH7A 4JI0K 3O44A 3BV8A 5AQOA 2HQFA 2YWGA 1RAGB 3AAPA 1RAAB 3MOJB 3OXLA 3QGIA 3RR8A 4LQ3A 4NXNK 1ZA1B 3PACA 1C6VA 4ILJA 2HB5A 5FIIA 5DM7L 3Q22A 3PW7A 5U47A 3CJ0A 1RHUB 3LA0A 2UU9F 3KD5E 3D66A 4DTXA 3BH6B 4GMKA 2MQNA 4OZJA 1APSA 4FN5A 4USKA 4JD2B 1TU0B 2H5EA 1WI6A 1G15A 4MMOA 3FQLA 1P8GA 4DQ8A 4AT1B 2CPEA 3MXHP 2I38A 3PRVA 3OJUA 3DLGA 4M5KA 2DY9A 3GB0A 3H98A 3MOZA 1U2CA 2O1PA 2BJ3A 2R8IA 4DPUA 3FSIA 5F41A 3OTOF 5JVGQ 3L3VA 2IBOA 3O4NA 3BZQA 1D3WA 4H0OA 2OHDA 3HO1A 5J2NB 1XQSC 3AB4B 3T6JA 3C16B 3NAEA 4IZ9A 4BRPA 1JKHA 4ISEA 4ILMA 1KTVA 1TKZA 2K8GA 4RBVA 4DX6A 1VISA 4A8FA 2DPJA 1UVJA 2ILZA 3DGPA 4WFNQ 4IJAA 1VQ5N 4ERDA 3TUZC 4BS2A 3I55S 3GSIA 3PXGa 2KDOA 4CD1A 4OQJA 4DX5A 2QWOA 5AQZA 4IKAA 1S9GA 2HBJA 5J1EB 1CULB 4GNIA 4DN9A 2W4DA 4HCBA 2IRXA 1SJRA 2J8AA 2P9NB 3T6BA 3MUTP 4FPIA 3R9PA 1KS2A 4NLXA 4LF8F 2D7SA 1FWKA 3AA5X 3HXMA 3K9JA 3BGLA 5B0CA 3GTYX 3UFCX 4CLYA 1C2PA 1OY8A 1QUVA 2VWBA 3L95X 5EVZA 1JQGA 1SQGA 3TPQA 1NGEA 3CXCM 3MMJA 3ZTSA 2XMAA 3DC2A 4FJIA 3CO9A 4JNEA 2GQQA 2VG6B 3K9KA 5F0UA 4KR0B 3MAQA 3VQCA 3M8SA 1VRUB 4WK3A 1ASVA 4W90B 5EUHA 1TGOA 4RNNA 2E2QA 1OH8A 2DXEA 1NSQA 3LDPA 2YH0A 1X4AA 3OHAA 1AZSB 2ZH9A 4NLBA 2BJ7A 4CJQA 1FI4A 2XMWA 2BM1A 4DPYA 4OZNA 4ELTA 3DLLQ 4P7TA 3OTBA 1JCGA 2D0AA 2GWJA 1WC0A 3CCES 1RT7A 4L3QA 1YJWN 3D1OA 4CBUA 3QGPA 1RDRA 4Y2CA 5BYQA 3MFIA 1U7LA 2WVFA 4NXNF 3SCKE 1X31C 4ZPCA 2IVFB 1ZBLA 1VCTA 3ZT1A 1U26A 3V9ZA 3P6YC 5KFZA 1HKGA 3R3TA 5C2FA 2VQFK 3VGVA 2BXJA 4O44B 3PSFA 2QTDA 1RTDB 1N34J 3WZ0A 3R7NB 3OYJA 2YX4A 3MECB 4BRFA 1Z26A 5KFAA 3EM1A 5A8RA 4HACB 5DQGA 1X4EA 2WSEC 1HNWJ 2BEFA 3CWJA 2Q3PA 2A2DA 1FHTA 2NPIA 5HL7Q 1UVNA 3M8WA 4HACA 3CJCA 2QGFB 3I5AA 1HKBA 3HZ6A 3FRYA 1QHTA 4KFBA 3HRGA 3QICA 1U1MA 5HVFA 3VEXA 4NB4A 2CQ2A 5GIOA 5DG9A 3Q2SC 1YI2N 3VESA 2Z4PA 5KFPA 1OH6A 3UKUA 2K7KA 2RIJA 1R27B 2B9XA 1YJTA 4LIWA 1FKPB 4U8VA 3FEZA 5FLXY 1VLOA 4GW6A 4HLBA 2X74A 1E6YA 2YPYA 5BRHA 2HWTA 3AH6A 1XR6A 1VQKN 2FJVA 3QT6A 5D6GA 5IS2A 4URGA 1Q5VA 1NO8A 1S97A 3TA0A 1HL6A 4LH4A 1FXRA 2W7AA 5ETTA 4DTNA 1G6BA 3M2VA 1AW0A 3WQTA 3MZIA 3H8YA 3SXLA 2FYXA 2RT3A 3LF0A 3CI5A 4IDKB 3J7A1 3VV2B 2F4VK 2YTCA 1K1QA 3P4UB 4WFXA 3MPUB 4C3MA 1WDTA 4ZHRA 3P5JA 4H4MA 4DFKA 1U49A 3TI0A 1N34K 4FLWA 1NGIA 2ZZNA 4O3PA 3VWSA 4NEZA 3J7AP 2C3YA 4HL9A 4CZEA 1L3TA 2QV6A 4CIFA 3R5BA 4U7CA 2GZOA 2V4JA 3VTHA 1LFWA 2RH3A 5HANA 3PKMA 2DR7A 2C42A 3L2VA 1S0MA 1F6TA 4NMXA 4ZHRB 1ULRA 4FF2A 3T19A 1S1TB 1P1TA 1HNXF 1UKUA 2EFQA 2HBZB 4USUA 4CLZA 2R2TA 3KJNB 3C8YA 1EQMA 4OGEA 1FXLA 3ILIA 2YNHA 1SH0A 4ECZA 1RA6A 5GMKa 2W8KA 1VQMN 1N0VC 5L1IA 2QE5A 4GKJJ 1H1VA 4CBWA 4UY8T 2OGUA 4DCHA 1KCFA 1BMQB 5LJ5Y 2C2DA 4AF1A 2B9EA 2ZDPA 4PCQA 4X84A 1UOCA 2O8BA 1XR5A 1KXPA 3MEDA 3JTPA 3BB5A 2Q0UA 1JXBA 3BP8A 4OPJA 2KI2A 1FWLA 1UFLA 1NKBA 3OYDA 1ACMB 3DCAA 1LWCA 2BBEA 3M05A 1J54A 3F2KA 1V5VA 4UQGA 2QSFA 3CJ1A 3CJSA 4UOGA 5E3AA 2B5JA 3OFGA 1CC8A 4I69A 2YWHA 1RTHB 3EYZA 3MXIA 1WD6A 5FRNA 3VGLA 3CO0P 2C28A 5LMNF 3VN5A 4OJ1A 4ZJQA 3ITHA 3CMQA 1VLYA 1FX2A 4L3NA 1Q81O 4BDYA 4OYZA 1WF1A 4O4GB 2G9OA 3M8YA 2IDOA 3BR9A 1U2VB 1U2FA 5JS2A 3QNWB 4F4ZA 2FBYA 3WBZA 3M9MB 3KDNA 3KMQA 3OVSA 3D67A 3JB9k 3FFKB 4I2PB 2ZJPQ 2IMWP 2RRAA 2MB0B 3DXBA 1NGHA 2MSTA 4IOAL 4I64A 2I5JA 4IWVA 4M45A 1N33K 4WF9Q 1MN9A 5EGYA 4LF7K 2NZCA 3HJVA 2ROPA 2JLFA 1Q78A 4DV1F 2F65A 2HBRB 1LWFB 3P96A 2ZGZA 4JEPA 1U6BA 1FA0A 5KGXA 1OVQA 2O8BB 1H2VZ 2DXFA 4W5NA 4FOIA 4CK2A 4M3RA 1WACA 1OYEA 3CCTA 1S6UA 4PKDB 2GQCA 3CUNA 2HHQA 5KFTA 3UWTA 1FRLA 4FLTA 4LR7A 1HQEA 3G6YA 1HFEL 3L2RA 3RRHA 4IRKA 2MQQA 4V19X 4DR1J 3IM8A 3VAFA 2VFTA 4OI1A 4FLXA 4NZ0A 4IDKA 3ISZA 1JB0C 5F2RA 2XMJA 1VQ4S 3KG0A 3PLAA 4XH5A 4MO5A 5LL6Z 3D28A 3D2EB 4PXEA 3BO2A 1FESA 2E20A 5DLFA 2EWHA 3VF6A 2ZUAA 4K42A 2O8CB 1QZ6A 5M2RA 2BKNA 4K4TA 1U1OA 4M5JA 3ZTPA 3AOBA 1KVIA 5GMDA 3DNCA 4X66F 2JEFA 4BRGA 2HGNA 1T9YA 1NDKA 1Y10A 4BR5A 3UDLA 4DR3J 2A10A 4PG8A 4JV2A 1RYSA 1T9VA 4H4OB 2FVSA 4LF6K 3UO0A 2PI4A 2O4IA 3T5HA 3ELHA 4OZ2A 4K0KJ 4V1Ak 2CJAA 3TAFA 1GLEG 4A62A 5IM0A 1S0VA 3W61A 2FZGB 1DQ9A 4AH9A 2KYXA 2WHOA 1XC3A 2P9SA 5HROB 1WEXA 2M7SA 1S0NA 4JI0J 3FGUA 5T41A 4F26A 2DNNA 5MLCQ 4CD3A 4QPTA 2QZ8A 1U2RA 2JLGA 1HNXJ 5J1EA 1IR1A 4KKOB 3TSPA 3U02A 5J2QA 4ZCMA 2VG7A 4I2QA 3G6VA 1XNRK 2IJNA 3BSOA 1HBNB 3HSZA 5EWFA 3GIKA 1IBKK 3SUQA 2YKMB 3LPYA 4OX9F 4Y28C 1IVZA 3R9LA 4LSLA 4LSLB 4JI4K 2E2PA 5I3UA 5IT4A 1GLJO 1C0MA 2OELA 3MD3A 4B3SK 3GSDA 2IVYA 3LDQA 2V2ZA 2XZTB 2GV9A 3P3DA 1D4XA 4ECRA 3TAQA 1WSEA 4ED3A 1UETA 1FRXA 4U6PA 3EMTA 3K89A 4CJ5A 1NK7A 5BPLA 1DT9A 1CXQA 2DEIA 3B4DA 4MFBB 2HFSA 4NLTA 3C15B 5L1JA 3HZEA 4M3WA 3VALA 3OL7A 2P6TA 1BGXT 3IMQJ 4BR2A 1ILYA 2DIUA 2Z1GA 1S1TA 3QIPA 3OYKA 4LFCJ 1RAOA 3V1OA 3H08A 4QS7A 3KG1A 2KW4A 3MTJA 1X5SA 3HVTB 2YWKA 1QUPA 5CA5A 4NRUA 3WNGA 2E66A 3HHLC 1OSDA 2ZM6K 1TL7A 2XM3A 1Y0HA 3LDOA 2ASMA 1H73A 4A5BA 4A8WA 3C6HA 1BQXA 4DL3A 3ZYYX 3CC2N 3UKRA 2XHWA 4K4XA 4IOBA 1S7HA 2X1FA 4ILHA 3RAQA 3TX8A 2QA4S 1ZA2B 4CZIA 4BRAA 2QC3A 4OZLA 1VIOA 2UV8G 2OTJN 1QSSA 1DRZA 4FWQA 4MKYA 3LWMA 3CCEN 1EB0A 4CECA 1SKUB 4FVCA 1EETB 3DOMB 2CYYA 2QA4N 1ZS6A 1S76D 2IMOA 1QZ5A 1VRTB 1N5QA 3IG1B 2MYFA 2GWKA 3SV4A 3OYLA 1T94A 3IRWP 3ZT2A 2VL1A 1WUAA 1REVB 2BJ8A 3LWLA 4NEYA 4UW2A 1S99A 3NCPA 5K20B 4NLUA 2VG6A 3EE3A 4ZLLA 2QIFA 2I5JB 3HFZB 2J4RA 4QW9A 1A5XA 1RADB 3NRBA 3HSCA 4DSFA 4CLKA 2NREA 3CFPA 3JS6A 2RSQA 2R7RA 4B3RJ 3BGRA 3I9V9 3OXGA 1DLOB 4BC9A 4DV4J 2A0FB 4KREA 1KN6A 1MU2A 2V8DA 3CCSS 4PQUB 3P5TL 1QDUB 2X1BA 8AT1B 2P9NA 2HIQA 4N8NA 1AUSL 3LL3A 4DS4A 4JK7A 3QFWA 2DGWA 2FHOB 3W1YC 4ELVA 5HVHA 3RWUA 5F9LA 2OD6A 4C1NK 1T0TV 5D78A 4DV1K 3ZC4A 1SQKA 1GH8A 5A2QO 2YNGB 1JLCB 2DRDA 3J7ZT 3DLLL 1R8BA 2O66A 3LP0B 1IKVA 2OAUA 2NUUG 2PEHA 4TVAB 4J9MA 5I4MA 4W5OA 2I7PA 5KFCA 1S57A 4C7QA 3PO5A 3CW2C 4DHYA 4EO8A 4WPAA 3UNYA 3V4IB 4Q7AA 1FRIA 4DR6J 2J6TA 4CJTA 4ZJOA 1RLCL 2PSZA 4JYAF 5B09A 1PBAA 2QLWA 3F9KA 2XNQA 2KXNB 4OX6A 3QRQA 4FM0A 3DLEB 4FJ8A 2DY1A 4Z37A 5IT9O 4C8OA 2ASLA 2UUBK 1KHWA 1S5ZA 4C3LA 1UAXA 2GMJA 4JV5F 3NXZA 4LF8K 4XPEA 1HD0A 5FROA 4RW9B 1FERA 3QBWA 4OJRA 2FZKB 1T95A 2HQDA 4FNHA 4QOZB 3SV3A 4DX8H 4R8UA 4NLRA 4ZIVA 1ATRA 5KFSA 1WC5A 2F3JA 1NG9A 2R42A 4O3OA 3IFRA 4F4YA 5DG7A 4E3SA 2Y9HA 3FFIB 3NVKA 4F4KA 4YOWA 2ADBA 5GADI 1XMBA 4U96A 4AHUA 2VG5A 1ZM4A 3AA8A 1YBUA 3BF1A 3TNVA 2BJ9A 3ZLJA 1KOOA 3NCIA 5DM6L 3IAYA 2ATLA 1JJ2M 4GVBB 2J0XA 4URQU 4OVLA 5AQTA 4K0KF 1WG5A 2XQCA 3TEHB 4D3GA 1W7WA 3D6FB 1FJGK 4AILC 1S1WA 4DOZA 4DTJA 3TZWA 3B78A 2JC1A 4G1PA 2GS8A 4U7UK 2MKKA 3FBBA 3L2QA 2Q1LA 2BRLA 5KT4A 2HEKA 3I55N 4P10A 5LMUF 3CETA 4WYWA 2DHAA 4JUZA 4DSJA 1WEZA 2OTLS 2HNZA 4F25A 4XO0A 3EE8A 2EKYA 3TVKA 4OX9J 1KAYA 4G1QB 1S9FA 2XO7A 3Q8RB 3BPSP 2WC9A 4NYOA 2BUNA 4FF3A 2GFFA 3G9CA 3A8YA 3GR0A 2O3DA 2HHSA 4EHTA 4FWSA 2W9BB 3UCGA 2GQ2A 2V2VA 3AAWB 1W2BM 3VEOA 1P9QC 2EKNA 5T14A 2E5LJ 5H9FJ 4TLQA 1N6QB 3ASMA 5ETVA 3UKRB 2FQQB 3LGNA 2AKWB 3PV8A 3HHEA 3OFEA 4YY3K 1Q82O 2RQMA 2IIRA 3G0ZA 4RW6A 2UXBJ 3KLGB 4RX6A 4DSLA 3QB0A 1V3ZA 4GKKK 1XEZA 3L6QA 1NK5A 2JEIA 2HLTA 3V6JA 1Y9OA 4H54A 4AE5A 1JNRB 2IVPA 1D09B 3J80O 3GJQB 4ZVRB 4NLCA 3MPWA 1RBOB 1DQAA 1XHZA 3BBCA 5KOXA 2F1FA 2MY7A 2RRNA 3M2RA 1PYTA 4LBPA 3HSJA 5KFOA 1RBUA 4M8LA 4G65A 1KOHA 1HWJA 4X66J 3TTCA 4J9OA 4XIUA 1HPMA 4PAAA 4RWXA 2GJIA 1R6YA 3P4IA 3QMQA 1GFWB 4ZCKA 1HNIB 3L4QA 2JJ4D 4RUHA 3NGYA 2KJVA 2V9KA 3C6TB 1W26A 1NLKL 2R2SA 2BW7A 4LF5K 3RBXA 1BI4B 1BUPA 4KRFA 4LRCA 3IAS9 1NHVA 4MIAA 4NCBA 1C0TA 4AQYK 1HKCA 2Y1IA 4B1YB 2BACA 4ZPBA 2M8DB 3BF4A 2PMWA 1GX6A 3MDQA 2HHUA 5CYQB 1Q16B 5GAEP 1XTZA 3H3NO 3WX4A 3MI7X 3AD9C 1CPZA 4KQZA 2YHAA 3BDPA 1WSVA 5SZTA 1T03B 3AD8C 5E3QA 2F8SA 1SKRA 3LAKA 1HBUA 1HNZJ 4F04B 3THVA 1K8KA 1RSCA 3GFHA 4N77A 5AJ3J 1U4BA 2LFVA 3CNQP 3QT8A 4X64K 4DV6K 4ISGA 2W25A 1UWBA 2E5HA 5BR8K 2DHSA 4F0KA 2HS4A 1QAIA 1U09A 1C0UA 4J9LA 1SI9A 4LF7J 5HVGA 1Q9YA 3MTKA 3OUYA 2LEAA 1UL3A 1VRUA 5D4PA 1VQKS 3O9RA 3P5BP 3WXIA 4EP4A 5C12A 3W9HA 5KFDA 2WVCA 3VAHA 5EXWA 3GG1A 4JKEA 1OS5A 5KG1A 4RG8A 1IBMJ 3D2FB 5HRRA 3GONA 3QFUA 5KT6A 2E5GA 3G71S 1DGKN 3WXMB 3J7AN 2W1BA 1YZ7A 1CZBA 4Y1CA 4WCEQ 1URNA 2IA0A 4NLGA 4IR9A 1P8ZA 4LQ9A 1BWEA 4RR5A 4CNZA 1YHQS 1RK8A 4B1VA 1A5WA 5C25B 2OPSB 3C6AA 2GX8A 4QR1A 5AE3A 2QWMA 1ZH5A 4DG1A 3AVGA 5M2UA 1X0FA 4Z94A 4M95A 3GPAA 4WU3A 1KONA 1O0PA 4H5NA 2A2CA 3G96A 2EC2A 4EBEA 2WK4A 2LU1A 3VA3A 4DQPA 3TSQA 3CEDA 4FNIA 2HIYA 4JI7K 2W9AA 3PKYA 2DTUA 2CQHA 4KI6A 1FK9B 3UVJB 1MWZA 3A8JA 3DLGB 3ZSYA 2I0XA 2VA3A 3KLGA 1HWKA 1XMQF 2XMMA 3JAMY 1R59O 3O6QA 2H51B 5KFYA 5DQIA 2GIFA 2G1HA 3SCIE 2XRIA 3OYEA 3J81O 2CAJA 2HVHA 2ALYB 4L74A 3OL9A 3A5NC 3Q7CA 4KHPF 3N01A 4WIQA 4QU6A 2O8DB 4CCHA 2UXBK 1GOAA 1NNDA 3I6PA 1VQMS 3ZSVA 1KLNA 2YNFA 3PEHA 3N79A 4PYAA 1Y11A 3QYYA 3A3PB 3GV5B 3NOGA 4Y2MA 4ETXA 2CG8A 2R7OA 4DV0F 5CAAA 4EEYA 3I4HX 3KK1A 3U6FA 3O3LA 1BQNB 2JL9A 2KVQE 2QN6B 3VAGA 1FDDA 1KWMA 2VASA 1KDNA 3HTVA 3NBPB 3O08A 2CNLB 2PO4A 1XNRJ 5C25A 4UUXA 5JMNA 3GFZA 2HFNA 3C66A 2D3OR 1RT2A 4USWA 2FLOA 4QIEA 3ILOA 2DCLA 1IWAA 3KOAA 2HBMA 5HLFB 3NFAA 4OLBA 3RMAA 2GVZB 3MXJA 4Y34A 1A0OB 1C0GA 4JKGB 5GAEI 3TAMA 2RB7A 4ITSA 3QZ8A 3CJKA 1M5VC 3HOTA 3X3UA 2W9CB 4IOCL 1BC6A 2HVEA 3CXCR 2PFFB 2YNIA 2XNRA 3W2WB 3IDHA 2OPRA 3JXOA 4LF2A 5AJ3K 3JTNA 3EZOA 5F3ZA 3W65A 4O3NA 2RQCA 5EWEA 1U24A 5TKYA 2VG7B 2Y1RI 3I0RA 4JN4A 4CEZA 4RCHA 2NLWA 1HLUA 3QIPB 3RB3A 3S3MA 3AD7C 2F9DA 1FJEB 2VD3A 2O5DA 2CPJA 1HI0P 2H5JB 3MDFA 2BE7D 3UR3C 2K3IA 2DISA 1R0AB 2KHOA 2G8KA 2RPIA 3HOSA 3VOVA 5D77A 2KG1A 4IRCA 3J80Y 4JK8A 1UPMB 3SI6A 2AHOB 3TR8A 3BN7A 2JSXA 3MWPA 3G4SN 3RW6A 4LRDA 1N56A 1KFDA 2NXCA 3CJ8A 1LWCB 3WX8A 3BEGB 4DPXA 1LAVA 1MW7A 2HWHA 4F36A 1TR0A 1RT7B 4H4KA 5KFLA 3NF9A 2DTJA 4O3RA 1JXVA 1T6DA 2HF3A 2AP1A 4B3RK 3AXMA 3OBIA 4DG1B 1S9EB 2IVMA 2KHCA 1PYOB 1YIJN 2LDIA 5AZIA 1R6VA 4CYUA 1ZTTA 3K5PA 2YHYA 2VCPA 4FYYB 1SUQA 3HT3A 1UEVA 4HH1A 4K43A 1RILA 5AZJA 4KAZA 4JI5K 3POTA 3CJ5A 1QQCA 3DXKB 1QE1A 3L3UA 3RSEB 3VQ4A 4LF1A 1Q8BA 3QDKA 5L46A 5GAHI 1U45A 3NEKA 4M1KA 3MEKA 4FWKA 4DV4K 1TL7B 1YBAA 1B4SA 4BHQA 4WBFA 3MUVP 2CVEA 4DV6J 4DCJB 4PXBA 1T9XA 4DV1J 3KUGA 3F5TA 3TP2A 4V19S 1BHNA 2PIIA 1VQ7N 5HSPA 3DLRA 4ZVEA 1Q86T 3PHEA 1EKEA 3HP9A 1VAZA 2WTUA 1C1BA 3TA1A 3PJXA 2UXDJ 3BGUA 2XWXA 3BQ0A 2Q31A 1HWUA 2AEFA 1TL5A 4HH0A 2ZDOA 4ER8A 5E3RA 4CZCA 2BDPA 4FWMA 3CCMN 4I0WA 3NE6A 2VQEK 3NAIA 2L41A 3S6EA 1LK5A 3SMSA 4OI4A 1YXQA 4Q5VA 2H9ZA 4W5QA 1JLBB 2Q0RA 2CPDA 2B4UA 1YRTA 4A8QA 2U2FA 2CJQA 1LW0B 5C5JA 1DTQA 4DLGA 1S0OA 2MSSA 4Z4FA 4ECTA 3D7EO 2QL5B 4PYDA 4CHQA 3BKTA 4OJ3A 2BOAA 4J2EA 1S72S 5LOQA 2FBXA 1HBNA 2PFUA 1N0UA 3IO1A 1AXQA 3PW0A 4IFEA 1RWPB 5C24A 2JWNA 1WF2A 1TUGB 4KRWA 4C8NA 3R1LA 4GVLA 4JP8A 2QMWA 1NGBA 3HKWA 5GAGU 2QA2A 4E89A 4CJEA 1TK0A 1U04A 2E6MA 4ZP9A 3CQYA 4ZLPA 4GC6A 1V6HA 4ES2A 3H42A 3NF8A 3FZMA 2NRHA 4B9QA 4LREA 4ZN1A 3JAMO 1Q53A 3LP1A 4K59A 2YKNA 3ZZTA 1S1XA 1Z6RA 3W0LA 5BXIA 4NXMJ 3ZSXA 2LQ9A 1BWVA 4OYWA 4HR2A 3UN5A 1YITN 3BBBA 1NKEA 1RTDA 2OTJS 4ED1A 2BH1A 4X65F 4DR4F 1X9WA 2ZJPL 4RNFA 2GCFA 3LALA 3QJPA 2RF2B 1CQMA 1VQNS 4CFDA 3CF5Q 5M1OA 2I6WA 2OH2A 4WP9A 4BQLA 2NRTA 4X4NA 5E26A 3BDEA 4CZKA 1GOBA 4GVEA 3DM2A 3IA0A 1ZBUA 3CPEA 1SIZA 4YFUA 1WOOA 3PEJA 4YHHF 2GHWA 3A12A 2V52B 4UTGA 4HWIA 4DSEA 2XY5A 1NJZA 4H5VA 5LSRA 4DR2J 1NM2A 1OPZA 4ZP7A 3ZZYA 4CLFA 1M1KT 4K5RA 2X78A 4PWDA 3CD6N 3PIOL 3OTEA 3AJ1A 3H5UA 4B3OB 4M94A 2MHNA 2JVOA 1CZAN 3AVLA 3I31A 1GMVA 2CQPA 2IOCA 3O1LA 4OGCA 1YAGA 3FMBA 4MJKA 2AJFE 2J9DA 2QWNA 2E1YA 2W4PA 2GUIA 2ZFHA 3CCUN 1XI1A 5CZ2A 1IG9A 4OX9K 4FWPA 3V9UA 5JICA 5KQDA 4E7KA 4ZOSA 4FZYA 2YJFA 1X8DA 3W2VA 1U1NA 5BRDA 1ZBIA 4HI1A 2BE9B 2NUHA 4JYAJ 4JI8K 5GADP 2CGJA 2UXDK 3D2WA 1RAIB 3Q8VA 3JXUA 2FDNA 5CZ1A 4ID5B 2RQKA 2FLNA 1B0VA 3P83D 4R5PA 2GW8A 2WBMA 4B3TK 2VQFF 1NGGA 2BW2A 3KJQB 2VQEJ 2DNLA 3R8EA 1IKXB 1HBOA 1P27B 3CPWM 3KTQA 2Q6CA 3DLHA 4ZK7M 3S3NA 1D0EA 4DTOA 1RTJB 1QSYA 4OLAA 3AB2B 2HVZA 3QWUA 5T7LA 1FTCA 1KAXA 5EDWA 4FJLA 2C3MA 5IXUA 5KOWA 1DTTB 4U9RA 2V69A 4JI5J 2UVVA 3CCLS 2CQ4A 1PKUA 3MM7B 3BREA 1TKZB 2P8IA 2KG0A 4DV0K 4CH0S 1I5OB 3HP6A 1NBEB 1VQLN 3W3SA 1LWXA 1S48A 5KFNA 4FDFA 3NWGA 1RT3B 3H4BA 1CJKA 1KRPA 1C0TB 2VZ9A 1FFGB 2C2OB 4DV7J 4MH8A 3KKRA 3T1AA 2LYVA 3RAMA 4BROA 1S4FA 1JJCB 2NNWA 3R27A 3OTDA 3DOKA 3RB6A 5IT9U 1HBMA 3KJFB 1R8AA 1MMNA 1FFSB 3LH2S 2AGPA 2RN2A 1FVSA 3J81j 2YBVA 4GO7X 2KKZA 1C4CA 3MX2A 2W40A 2YNFB 1VYAA 5C42B 4H0YB 3DMJB 3F56A 1NJIT 4JI4J 1SQEA 3BS9A 3UE2A 4B02A 3VMFB 4Q0BA 3MCOA 1S72N 2ZH4A 2GIQA 1XMOK 1F9EB 3U9DA 4L75A 3ZFVA 3MMVA 3DRXA 4FJ9A 5F8LA 3UW1A 5A76A 1VJQA 3U1MA 3J81U 1CVJA 3AVNA 1N33F 1EP4A 1TFWA 4A61A 1KP6A 2KJWA 3GYNA 1BA0A 2HPUA 3AA9A 3WUHA 4AQYJ 1JLAA 2FGOA 2EHGA 1HX1A 2L9WA 1RT4B 2HHHJ 4A2AA 3UN2A 2LVWA 4BCAA 3VF4A 2AJ4A 3HI9A 4P74A 4KO0B 2FHMA 3TA2A 4F4XA 2F40A 4CLPA 5KT2A 2LA6A 2WBRA 1VQ5S 2LDYA 2NS1B 1S9EA 2GHVC 3K2PA 2DRAA 3VZIA 2BGGA 5AQMA 3HT0A 4K8RA 4ES3A 3E01B 2DY4A 1RB0A 1TUUA 4NLOA 3PJ9A 2KN4A 4GRSA 1UFKA 1DARA 1VSJA 2ACYA 2DNKA 2V8GA 2LMIA 4BY9C 2VBYA 2QLFB 3AVAA 1SC1B 3I32A 3DM2B 3QEIA 2AGOA 3NGSA 2MMYA 1Y3JA 1S6PA 3OYIA 4M41A 4KV8A 4ZDNA 5I42B 4KE5A 3RYLA 2FVQA 1X3MA 2XC9A 1NMDA 3MM6B 5LT5A 1SV5B 3ZX0A 1KKHA 1SH2A 5G4DA 4WP8A 3SBTA 3W9JA 4KV8B 2HRUA 3LO3A 1BIZA 4C3KA 1S6QB 4M3TA 5H9EK 1IBKF 3HBTA 2XWYA 3O3GA 1JXEA 2QM1A 1Y3KA 3HVTA 3G87A 2B6AB 1F9FA 3SQ1A 4CNYA 2W7OA 3OA9A 1VQPS 4MK8A 4DX7A 4J9UE 2BX6A 2QRRA 2V0NA 2KZZA 1RXOB 4HDHA 2F8HA 3PYFA 1N6QA 3PYDA 5D4LA 3FCVA 3E1YA 3U7JA 1RHMB 3M7VA 3M5RA 2KFNA 5M1QA 3TWZA 4FF4A 4KGZB 1QVFR 2WZ1A 3TANA 3GE1A 3PVXA 1KBRA 4ZPVR 2CH5A 2FHJA 3ITHB 1W0HA 5AZIB 2AA4A 5AFUA 5D3GA 4O0NA 4D3HA 2IC3A 4IH7A 1IBLF 4C97A 4CO2A 4CGJA 1TP7A 5C10A 3O9UA 3RBEA 1U0HA 2X3GA 2ZH2A 1XHXA 2HWIA 3UD4P 3EGVA 1BLUA 3O9TA 3NGDA 3TSUA 3FNNA 1E4FT 1IKWB 4M5IA 1HJRA 1RWMB 4QIFA 3FJ2A 1YIJS 3PR5B 3HPGA 2F8EX 4P9SA 1KVJA 3AVKA 5K9FA 1RBRA 3EGZA 2G2ZA 2ZGYA 5IWAJ 2NLXA 3H1VX 1Q8KA 3VAMA 3LANA 3A4TA 2DR6A 4JKBA 2CJBA 3LP2A 1MROA 2VBZA 2E5LF 3K58A 4CJRA 1NDCA 4DV7F 3D0IE 1S22A 4I6MA 2GHPA 1HUXA 3HVAA 2VOPA 4YOVA 3N4WA 3AO2A 1F5AA 5M1FA 1WORA 3QJJA 2FVRA 2O8DA 3HI0A 1DKGD 2XY6A 3ZT3A 4OPAA 1JLCA 2KVIA 1HNWK 1CQNA 3KFWX 3DDKA 2F9JA 1V3SA 3ENAA 4NYNA 4BE1A 1VSLA 3BR8A 5JVGL 3MMAA 4CLLA 2MZTA 3CJ4A 1S49A 1WNEA 1RABB 1IM6A 4LJMA 4DV2F 4JI6K 3CSKA 1TUYA<