1BQNA

Tyr 188 leu hiv-1 rt/hby 097
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
558
structure length
558
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPQKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNQQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 114
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqnA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqnA05
4IG0A 4RNFA 2I5JB 2E4LA 1RTJA 2WB4A 4B3OA 4IBNA 4RW9A 4WFYA 4O3RA 4ZMMA 3NDKA 3KK3B 4KHUA 1S1UB 3JYTB 3VQAA 4ZPBA 2WONA 2XO7A 2R8HA 1S0NA 4EBCA 2YV0X 4FJHA 1KLMB 2WOMA 5C5JA 4DFKA 3LP1A 5HLFB 4O5BA 2JEIA 3C6UB 1C1CB 4EBDA 4QOZB 4TYAA 4FK0A 5KTQA 2AGPA 1DTQA 4I7FA 2PY5A 5C25B 3FFIA 3G86A 4CERA 4Q44A 4KSEB 3CVKA 5HP1A 2W9BA 4IFYA 3ZSQA 3RMDA 1EP4B 4KB1A 1TKTB 4DSFA 2YNIB 4LY7A 3VQEA 3LZIA 3MR2A 3SUPA 5JXSA 4M3TA 1RT3A 3H59A 2IBKA 4LQ3A 2CJQA 2W9CA 4FJ5A 2YNFA 3MEEB 4RW4B 4TN2A 4CHQA 1UWBB 4CHZA 4Z4EA 1NHVA 5HRNA 4ELTA 5KFKA 3IRXB 4DG1A 5D3GB 3S3NA 4DQPA 5KFMA 4Y2CA 2DPIA 2HHQA 3UQSA 2Z1GA 4CF9A 4OGCA 3HL8A 2OPSB 1TL3A 2D7SA 1HRHA 3PX0A 1NK9A 5F8MA 4EP5A 4IH7A 3OYIA 2R8JA 3RMBA 4KB0A 1B9FA 1J9AA 4Z0UA 1D9DA 1RTIA 5J2NA 4EZ6A 3HVTB 2YNHA 3SQ4A 3CDWA 1S97A 4OPJA 3KLEB 4IKAA 4PWDA 2ASLA 4KTZA 4LD0A 3WNFA 3PR4A 5L1KA 5C24A 4I9QA 3KHRA 4ZVFA 5J2QA 4B8CA 4CJ5A 1JLGB 1RT5A 1GOBA 3VQCA 2D41A 3GV8B 5HROA 5C42B 3IS9A 1CSJA 2X74A 3NGIA 3BQ1A 3TANA 4M3YA 3OHAA 1RYRA 4LSNB 4ZP9A 3S9HA 1HPZB 3V4IA 1NK0A 3DRSB 1C0TA 4CEDA 1GX6A 1N6QB 4NRTA 2GV9A 2XY6A 3MXMA 3QZ8A 2YHAA 3RBDA 5KG4A 1KCFA 3C94A 4W5TA 1S1WA 3LANA 4CJWA 1TK0A 3DLEA 5F8HA 4ZTFA 2HHXA 3LWMA 4ZP6A 3AVJA 3V6KA 4ECQA 3TAPA 3NHGA 2E9RX 4J9QA 3L2RA 2QV6A 3PVXA 3KMSA 3RRHA 1REVB 4DSEA 1KSPA 5DMRA 4CFDA 1NNDA 1U48A 3M8SA 1TV6A 3QLHA 1RDCA 1RTHB 1JXBA 4ZHRB 4YP3A 4Q43A 3AVMA 3P5JA 3OYKA 4IOBA 4JS5A 4XIUA 2UUWA 4O55A 5KI6A 1WSHA 4RW7B 4G1QA 3L2VA 2IC3B 1IKYA 1C2PA 1KTQA 1WSIA 1TKXB 4NYFA 1RT1B 1KVAA 1EETA 4F4WA 3PV8A 4WXWA 4FM2A 2W8KA 4NLTA 2OZMA 1ZBLA 3BDPA 4MQ3A 4F2RA 4M3UA 1SUQB 1EKEA 3H08A 3SQ0A 1SKSA 4KHNA 4OLBA 1HNVB 4MK8A 1U45A 2YKNA 3KLHB 2V4QA 1XHXA 4CE9A 3ZSXA 1EX4A 1I6JA 4BDYA 3N6LA 4E7LA 5KT5A 1UOCA 2HNYB 1RYSA 4J9SA 1VSDA 3M8QB 1T03A 3T5LA 3NH0A 3DLHA 3I0SB 1B92A 3IN5A 1SH2A 2ATLA 3GIKA 1S9GA 4K8ZA 4PY5A 4KRFA 1XWLA 1A5WA 3OYEA 2AGQA 3TAMB 5L1JA 3K2PA 1VSLA 3MEDA 4F4YA 4ID1A 5KRTA 4E0DA 4DL5A 4CJVA 3PY8A 4EYIB 3ZT0A 1Z4UA 1F21A 2FC0A 4IDKB 2ZKUA 4RNMA 4H4OA 4DTNA 1S49A 1SL0A 1TKZB 2C2RA 2F8SA 1LW2A 4E7HA 5KRSA 2WHOA 3OS2A 1IKWA 1BQMB 3D28A 2E9TA 3I5BA 5KG0A 3Q8RB 3CG7A 5DLGA 4OKKA 1VRTB 1HMVB 3KKSA 1ASVA 1KHVA 3DOKA 4NLOA 1RBSA 4R8UA 4IH6A 1C0UA 4ED1A 1U04A 1ZBIA 4URSA 1JLBA 3SUOA 4E7JA 2J6UA 3ZT3A 4BWJA 3WNHA 3L3UA 3AA2A 4ZVHA 4I2PA 2VWKA 1YTAA 3SZ2A 3KK2A 4NLWA 3TAQA 3MECB 4FBUA 5EDWA 3V9XA 2WRMA 4ECZA 5J2PB 4URGA 4F4ZA 3MEGB 1LWFB 3RB3A 1VSFA 1JKHA 4CEFA 4YR0A 3NCIA 4WFZA 3GIJA 1HQEB 4K4SA 3HYFA 4KHQA 5HRPA 2B43A 1QUVA 3F9KA 2W8LA 1FXXA 3V6DB 4ED2A 2FBTA 1TVRA 1QAIA 1RNHA 3KKRA 4O3QA 4J2EA 1IKVB 3WNGA 4DMNA 3E51A 1N5YA 3ISNC 4Q8EA 4F4KA 1RT7B 5KFBA 1LAWA 3EZUA 4EP4A 3SQ1A 3DLGA 1JLQB 3L2WA 2O4GA 3SJJA 3ZSWA 5K14B 3OJUA 4WZMA 4FJNA 3OL9A 5KG1A 3IAYA 3T3FA 2D0AA 3DDKA 3H5SA 3HT3A 4WZQA 2HNDA 4QWAA 4ECWA 2UVWA 1VSIA 4J9OA 1QAJA 4CHYA 3DMJB 3AO4A 1MU2A 1KVBA 3LAMA 3PJWA 2OPQA 1BL3A 5DG7A 3RR8A 1S6PB 2KFNA 2FJXA 3DRRB 3T5HA 5KFDA 1NJZA 2Y1IA 1QE1B 1QQCA 2HVHA 4C8KA 3QNNA 4TQSA 4CGDA 1Y97A 1XHZA 3HVRA 4ZTJA 3PW2A 3DOLA 3UIQA 4NLSA 3TARA 5KG7A 3HVAA 4H54A 5KFUA 3CJ2A 3O3GA 3LZJA 3VQ7A 4CFBA 1LW0B 4GVMA 4Y1CA 4O3OA 1T3NA 4AHVA 2FVPA 4O3SA 1VSJA 2HWIA 4CEOA 1WNEA 2R2UA 1TAQA 4XPCA 1T05A 3PO5A 1CXQA 4GW6A 3H4DA 5I42B 3JSMA 2VG5B 4ED3A 2C28A 4O0JA 3SNNA 3DRPA 4CGJA 1VRUB 5DG8A 3DI6A 4ZPAA 2XY5A 2BANA 4KBIA 4BE1A 1DTTA 4HKQA 2OPRB 4TY8B 1FK9B 4H8KA 3T5KA 3OLAA 4DSLA 4CEBA 3LPTA 1RT2B 4B9TA 3KK1A 5KFJA 4FJXA 3D45A 4HYKA 4NLQA 3LP2B 5FDLB 1J53A 4KHRA 3KLFA 4FM0A 4N5SA 1NK7A 3HK2A 3GV7B 4IRKA 3LAKA 4RZRA 4MIBA 3OL8A 3LP3A 1YT3A 3NGDA 4CEEA 4DLGA 1CZBA 4Q0BB 3NH1A 3BSAA 4C8NA 5F8GA 3D0PA 1MMLA 3LP0B 5DGBA 4DSKA 4O4RA 1UA0A 4TXSA 4F50A 1RILA 1Z25A 4B08A 4KHMA 1BGXT 2R2RA 4R0EA 2R7YA 2BQRA 4FJ9A 1JLEB 4L8RB 5CY4A 3QESA 2RF2A 3KHHA 3NGZA 3CFOA 1TGOA 1I3AA 4RW6A 3OY9A 5KFQA 2A1RA 4CF2A 1BI4B 2ZD1B 1JLAB 1RDDA 4RW8A 4K50A 3U3YA 4IQXA 4KKOA 1X9SA 1FKOA 5J1EA 3HVWA 4RUCA 4LSLB 4RU9A 3VQBA 3DM2A 1R0AA 4IG3B 4DL3A 4R5PA 2IMWP 3QETA 2IAJA 2V4RA 3AO1A 1HQUB 2JEFA 4FJMA 1SL1A 3ZSYA 5F8JA 3QEPA 1HNIB 3VQ9A 4TSXA 3HSTB 4CEQA 2FLNA 4EZ9A 3VQSA 4F4XA 1TL1B 4CJFA 4F2SA 4ECVA 4IG0B 3AO5A 4CEZA 1RTJB 4B3OB 2HNZA 1YVFA 1JXLA 4CCHA 4RW9B 2RN2A 2BE2B 1VSKA 1HARA 2W9AA 2G8UA 4KTQA 4DQIA 1RDBA 1L5UA 1SKRA 4J9MA 3ASMA 2WONB 4CK3A 2F96A 3ZT4A 2BRLA 3B6OA 2WOMB 2ILZA 4DSJA 1W25A 3A2FA 1ZBFA 2HHTA 3E01A 4RNNA 2B6AA 1G15A 2XGPA 4Q8FA 1X1PA 4NCBA 1EP4A 5KG2A 1U4BA 1SL2A 1S48A 1TKTA 2VG7A 1XR7A 1HYSA 1NHUA 5I3UA 3I0RA 4NLYA 1BISA 1DTQB 1S5JA 5KFFA 4KI6A 3OYCA 4I7FB 1WAFA 1LWCB 3FFIB 5SZTA 2ZE2A 2P51A 1WNSA 4IKFA 4AHRA 2AQ4A 3AA3A 4FW1A 4BDPA 5HP1B 2W9BB 5D3GA 4IFYB 3CM5A 3CYMA 2P5GA 3CJ5A 4J9KA 1BIUA 3QEIA 3NAHA 4HHTA 3OYBA 3HJFA 3KD5E 4ECSA 4FS1A 3H4BA 1WSJA 1D1UA 3PW0A 2G8VA 3OL6A 2NUBA 1S1XA 2XCPA 3PW5A 5KT2A 2W9CB 1RDAA 4HUFA 2P5OA 2YNFB 4E7IA 3EY1A 2RDJA 4B8AB 4M42A 2D0CA 3D5MA 3IGNA 1RCHA 4KFBA 4FLVA 4DG1B 2HMIA 1KLNA 3GIMA 5CYQA 3Q8SB 2FJWA 1WN7A 3C6TA 4BWMA 1TL3B 4NCGA 1S9EA 5DLFA 4FYDA 4CJ3A 1JLGA 2W42A 4ED8A 4F3TA 2JGUA 1HYZA 2UVRA 1RDRA 2XC9A 4KE5A 3QERA 3AVFA 4CGFA 3F73A 3QIPA 3HP9A 4FJ7A 4B9MA 1RTIB 2JEJA 3KTQA 2YNHB 3G6VA 3OLBA 1U47A 4TQRA 2LSNA 3NF6A 4Y34A 2X6SA 3OSPA 1QTMA 3CJ4A 5C24B 3AVHA 1RTDA 4KO0A 5J2QB 4RNOA 1RT5B 3NFAA 1ASUA 3S3MA 2YKMA 5HROB 2UUTA 4LH5A 3U6FA 4M3WA 2G8HA 4YNQA 3IS9B 4O0IA 4O4GB 2BRKA 3BQ2A 3V4IB 3QYYA 3VN5A 3PJXA 2HHWA 4K4ZA 1C0TB 1D9FA 2OYQA 3AVIA 1BQNA 4CEAA 1DLOB 3NKYA 3KLIA 2AWZA 1S1WB 4J9RA 1RTHA 4NZ0A 4ZHRA 3DLEB 4ED0A 2JC1A 3RRGA 2BGGA 2RKIB 2B5JB 5KFNA 3PO4A 3BSCA 2KZMA 1RT6A 3AVKA 4IRDA 2E9ZA 2YNGA 3OVNA 2XY8A 5KG3A 1TKXA 3KJVA 3LDSA 4YFUA 2HAIA 1TV6B 3QLHB 4CECA 2Z1HA 1ZYQA 3AV9A 2IA6A 4U6PA 4CJUA 3FRZA 3KLHA 3DYAA 4FVMA 4G1QB 1SV5A 2ALZA 4FJLA 3H40A 3V9SA 1IKYB 1S1VA 4BE0A 1A5XA 3VQ4A 5KFRA 4DU4A 3M8QA 2GBZA 1JXEA 3PUFA 1J5OA 4CGGA 2X78A 1CZ9A 4MFBA 4JV1A 4CK2A 5T14A 2IGIA 5J2MA 3Q8PB 5CYMA 4OL8A 5KFYA 4O44A 2YKNB 1JL1A 4FJ8A 4RUAA 3SV3A 3M8PA 3I5CA 1WAJA 5KFEA 3CFRA 1XC9A 3TWHA 4AILC 3EPIA 4C8OA 4Z4IA 2QXFA 1L3VA 4J9NA 3RR7A 3VQ8A 4PUOB 4IDKA 5CZ2A 3MF5A 1D8YA 4J9PA 3ZCMA 4ID5A 1S9GB 3V9WA 4DSIA 4JRQA 3PR5B 1JX4A 5DQIA 2O5DA 1BIZA 1IKXA 3MEDB 1VRTA 2DY4A 5F8LA 2GUIA 5F8NA 2B4JA 4Z4FA 2C2EA 4K4VA 3VQ5A 3SV4A 4ZVGA 3BJYA 4H4OB 4DTJA 1UAXA 4IFVA 2C2DA 4OVLA 5HBMA 1XR5A 3HPGA 4QW8A 3SUNA 3H5UA 1IKWB 4NLVA 2FVQA 4BACA 1JLFA 1GX5A 1RT4A 1C1BA 4CJLA 4JRPA 2FVRA 3DOKB 3ZT1A 5KFOA 5CZ1A 2OH2A 4R8UB 4Y1DA 4M3RA 1C0UB 4ICLB 4NYZA 1SKWA 4MKAA 3DLKB 1HYVA 3VQPA 2XWYA 3KHLA 3QEVA 4RG8A 4I2PB 2AJQA 4H4MA 3KLGB 3AO3A 3KK2B 2R2TA 4BE2A 4FZXC 1WLJA 1SH0A 2Z1IA 1KRPA 3QIOA 4OJRA 1IKVA 3HPHA 1L3SA 4CJSA 4XPEA 2OPPB 3HPOA 2CKWA 1LAVA 4KI4A 4CJKA 1S0MA 2DFEA 1JKHB 2D5RA 3CWJA 5EWEA 2IJFA 2R8GA 4CIGA 3VA3A 4DS5A 4MK7A 1TKDA 1SH3A 3VQ6A 4BDZA 4M45A 2ETJA 4NYNA 4M41A 2QK9A 1TVRB 1U49A 5KFIA 4FLTA 1Q8IA 3IG1A 5HRRA 4ECUA 3ALYA 1N5YB 2FBXA 2VG6B 1D0EA 4M95A 3ICLA 4PQUB 3KNAA 2XY7A 3O4QA 3U3GA 4M3XA 4FXDA 3DLGB 2FVSA 4J2DA 2XCAA 1ZBHA 4FLXA 1ITGA 1ASWA 3EPGA 1S6PA 4TY9A 4HCBA 2R2SA 2VA2A 3DRRA 4FJKA 2ILYA 2EX3A 3RMAA 4FLUA 3QEXA 2OZSA 1QE1A 3Q8QB 1FKPB 5JUMA 4DF8A 3QO9A 3CDEA 2HNDB 4IR1A 4GC6A 3KD1E 3PW7A 3O3FA 3V81A 3KOAA 3TAEA 1LWEB 3OYMA 2DFFA 4KHYA 2OPQB 2DFHA 3ITHA 1S0OA 2DPJA 1ZETA 3L8BA 2JEGA 4QWEA 2IS3A 3MTKA 3HO1A 4FJJA 3DOLB 4FBTA 1VRUA 2AU0A 2AGOA 5DG9A 4FCYA 4TY8A 4X2BA 1YVUA 3TR8A 3SI6A 2IJNA 3TI0A 1S6QA 3CO9A 4IRCA 3NGYA 4DL6A 1K1SA 1RT2A 4J2AA 4LH4A 1T05B 4CFAA 3NBPA 4B9UA 5KT4A 3OS1A 4CIEA 3BGRA 4QWCA 3JSMB 3TABA 3DRPB 3CIZA 3DI6B 2BANB 1K6YA 3OS0A 4E3SA 4NLDA 2QKBA 4WE1A 4QWBA 5SWMA 3T1AA 5KFZA 2PZSA 1J54A 3VQQA 4DL4A 1NK6A 2Y1JA 4E7KA 3TAFA 2EHGA 3BQ0A 3M9OB 3M9NB 4ZPDA 3O3HA 4ELVA 2FLPA 1NJYA 4I2QA 4FLYA 1XI1A 1S1TA 4KAZA 1JLCB 2D0BA 4DU1A 3KLFB 1N4LA 1NKCA 2WK4A 1RA6A 2FBVA 4K4YA 2ITGA 1T8EA 4DTXA 2KFZA 1RBTA 4QW9A 4Z4CA 4N56A 2GIQA 4CFCA 3QIDA 4MIAA 2IM3A 4KV8A 1BI4A 4HTUA 4KHWA 4E1MA 4OLAA 3RBEA 1QSSA 4KTWA 4LSLA 5KFSA 4DL7A 4IG3A 2I5JA 2IM0A 3GYNA 1U09A 4QPXA 2WTFA 2RF2B 3HP6A 3KK3A 2VWJA 4IH5A 1S1UA 3JYTA 4FJIA 3BR9A 2KW4A 4RW6B 5KG5A 4DQQA 1QSLA 3QNOA 3V6HA 4DF4A 4RW8B 3H98A 1KLMA 3UPFA 4ECRA 1W0HA 3ISND 4KKOB 1FKOB 5J1EB 4Q45A 2F8TA 4CESA 5HLFA 3DM2B 1R0AB 1RAJA 4R5PB 2BE2A 3C6UA 5T7BA 1C1CA 4W5OA 2IAJB 1LV5A 2XI3A 1CLQA 2HHSA 3OJSA 1HJRA 1Q9YA 5C25A 4Z4HA 1S4FA 4U7CA 3N6NA 1XR6A 4E19A 5L1IA 4WYWA 3THVA 2XRIA 2G8WA 2JLEA 1RA7A 2YHBA 3LP1B 2HNZB 3RWUA 2YNIA 1N48A 4CHNA 2HHVA 1LWCA 2WCXA 3MEEA 4RW4A 4UQGA 3AVBA 4DTPA 4ECYA 2V9WA 1KVCA 1TK5A 1UWBA 4K4WA 3OSNA 1QSYA 3E01B 2B6AB 1D5AA 3OL7A 3RB4A 4CF1A 3IRXA 4CHPA 2VG7B 4ECTA 4C8LA 1O1WA 1HYSB 3G0ZA 3NH2A 5I3UB 3I0RB 5KFGA 2OPSA 2KQ2A 2JC0A 4ED6A 4CJPA 1RT3B 4DTUA 2IDOA 3HM9A 4QCLA 2ZE2B 3N6MA 3I8DA 4DS4A 1VSMA 1BCOA 4JS4A 1IM4A 4E89A 1NK4A 2HW3A 4O3PA 2J6SA 1CXUA 3HVTA 4K4XA 3RB6A 3SUQA 2G8KA 4WFXA 3T5JA 5JS1A 4J9LA 2ATQA 3KLEA 3ULDA 4CJTA 1X9WA 3VQDA 1S1XB 1VSEA 1JL2A 5KGWA 3RB0A 4ZVEA 3ZT2A 4K4UA 3NL0A 3K5OA 2ASJA 4KFBB 2XI2A 4WYLA 5C42A 3DLBA 2HMIB 1ZTTA 4B9NA 5CYQB 5J2NB 4FK2A 5KFAA 4LSNA 4G3IA 3C6TB 1NKEA 4QAGA 3RMCA 1HPZA 2F8EX 5L1LA 3DRSA 4NCGB 1S9EB 3EZ5A 1N6QA 4ZP8A 4PWDB 4ZP7A 3OHBA 3OYLA 5EU7A 4KB7A 3AVLA 1JIHA 5EWFA 2G8FA 3PW4A 2Z1JA 2XHBA 3SPYA 2G8IA 3QIPB 4DU3A 3OYAA 4O4GA 3V1RA 3K57A 3OYNA 3CQ8A 3SYZA 2PYLA 2FLLA 2RPIA 2X6NA 3MXIA 5KFWA 4JV2A 3MXJA 4KHSA 3L2UA 1REVA 3MR3A 2D3UA 1K1QA 1BCMA 1DLOA 4HVJA 4HUEA 3H5XA 1RTDB 4KO0B 4EEYA 5KGXA 3QGGA 2W7PA 3H2LA 2YKMB 1VK0A 5DQGA 3SCXA 3P1GA 2RKIA 4K4TA 2B5JA 4GC7A 2R8IA 4ZPCA 2HB5A 3GV5B 3QGIA 2W7OA 4RW7A 2ASDA 4NCAA 2IC3A 1BQNB 1IH7A 3O4NA 2XGQA 2D3ZA 5KFLA 3KLIB 3UR0A 2E6MA 4CIFA 1RT1A 1TP7A 3BSOA 2VA3A 5KFXA 1L3UA 5KFVA 2V0NA 1N56A 4OGEA 4KPYA 3NAIA 2R8KA 4K8XA 3AVCA 3AVAA 1SUQA 4URQU 1HNVA 1RT6B 2YNGB 4CJEA 4RNHA 3NF8A 2BQUA 3SI8A 3KJVB 4XO0A 4MKBA 2HNYA 4DTRA 3GILA 3OYDA 4YR2A 1EETB 4CGIA 4Z4GA 2GIRA 4DFMA 3SFGA 3P83D 2J6TA 3I0SA 1NJXA 4PA1A 3DYAB 5KT6A 2KZZA 4FS2A 1SV5B 3ZSZA 3QGHA 4JLHA 3TAMA 3K59A 5E41A 1S1VB 1VSHA 4AHUA 1KFSA 1KFDA 3B6PA 1TQLA 3GQCA 4EBEA 4IR9A 4MH8A 2HHUA 4EYHB 1T03B 1J5OB 2I1RA 4PUOA 4HCCA 5F9LA 5KFHA 4FW2A 4MFBB 1S9FA 1NOYA 5J2MB 5CYMB 4O44B 4DL2A 1TKZA 1NK5A 4GMJB 4JUZA 1RBRA 3M8PB 3G6XA 3HXMA 2QKKA 1BQMA 4B9SA 4CJQA 3TAGA 3RTVA 3MAQA 1HMVA 3VA0A 2BQ3A 3G6YA 1WSEA 5DK5A 2HVIA 4ID5B 1IO2A 4DFPA 3PX4A 4DTSA 3M8RA 3EYZA 4KAIA 4Y3CA 1I39A 3L3VA 2IM2A 1LW2B 1IKXB 4M94A 3MECA 3TVKA 2AX1A 3I5AA 1GOCA 4N47A 5EUHA 2ZQBA 2HWHA 2UVUA 3LPUA 1WSFA 3SQ2A 2FVCA 5DGAA 2UVVA 3CFPA 5J2PA 4ICLA 3MEGA 4O3NA 3DLKA 1LWFA 1JLBB 4IFVB 5HBMB 3CDUA 4CJRA 1HQEA 3MFIA 3KLGA 4DTMA 2AX0A 2IOCA 4KREA 1JLFB 3HKWA 1RT4B 3V6DA 1C1BB 4W5QA 1QS4A 3AO2A 3K58A 4Q5VA 4EO6A 3PX6A 4DQRA 3QEWA 4NRUA 3AVNA 4CHOA 5KG6A 2PYJA 2OPPA 1IG9A 4YR3A 1RT7A 3K5NA 3MR6A 3MFHA 4AHCA 4ELUA 5DQHA 4F8RA 1JLQA 2OA8A 2BR0A 4H4MB 3K5MA 4OPKA 4DFJA 5K14A 1T7PA 4TYBA 1W9HA 3CJ0A 3UDLA 5L9XA 4I9LA 3V1OA 4CF8A 1S10A 2VG6A 2EC0A 4FJGA 4PQUA 2DTUA 4LQ9A 3V6JA 3RAQA 4MK9A 4ED7A 4FLZA 1C0MA 3TQ1A 1ZBUA 4AHSA 3DMJA 3CJ3A 3WNEA 2O4IA 3NF9A 2GC8A 1QHTA 3OYHA 2P1JA 1B9DA 3IG1B 1GOAA 1FKPA 4FK4A 4W5RA 4Y2AA 4F3OA 3FQLA 4C8MA 3NE6A 3LALA 4FZYA 2QE5A 4NLRA 1Z26A 4M3ZA 3AA5X 4E1NA 2BDPA 1LWEA 3H5YA 4N76A 4QWDA 1MU2B 3C95A 4HUGA 1C1AA 5KFCA 4DLEA 2IM1A 1LW0A 4W5NA 4ECXA 4OKEA 3OYFA 1NKBA 3ZSOA 3T19A 4DWIA 3QO9B 2Q3SA 4B9LA 4NLPA 4CK1A 5FRMA 3V81B 2FJVA 4CF0A 5F8IA 4DTOA 5I42A 2VG5A 4FZZA 3FSIA 3NMAA 4FLWA 1OS5A 3ZSRA 2RDIA 3KHGA 3ITHB 3S3OA 2OPRA 1FK9A 3KMQA 3IGVA 3HHKA 1NOZA 3OYGA 3M9MB 4B9VA 5KT3A 3QZ7A 2KTQA 3PZPA 1A5VA 4YMEA 3SFUA 3OYJA 1T94A 1NJWA 4YQWA 1YTUA 3LP2A 5FDLA 1DTTB 5FROA 4CJ4A 3AVGA 5KT7A 1S6QB 3ZSVA 1C6VA 1Q9XA 1UA1A 4N41A 4JV0A 4NLUA 4WXOA 3NBPB 3FDSA 3KK1B 3BGRB 4OKJA 4Q0BA 1TAUA 4AH9A 4EO8A 1RBUA 3LP0A 4NLGA 1JLCA 3AA4A 1WSGA 4WE1B 3BREA 3PHEA 1EXQA 1ZTWA 3NAEA 4AHTA 4TLRA 4DQSA 1X9MA 5F9NA 1JLEA 1L3TA 3KLVA 2E6LA 1NK8A 3CM6A 3L2QA 3QINA 3BSNA 4NLXA 3KIOA 2ZD1A 1JLAA 4CGHA 4I2QB 1S1TB 3V9ZA 3K5LA 1RBVA 2C22A 4FM1A 4DEZA 3GIIA 5FRNA 3MR5A 5HRSA 5KFTA 3FQKA 3RAXA 3SPZA 3V9UA 2A1SA 4J2BA 1BHLA 3NF7A 5EWGA 3V1QA 1HQUA 3LWLA 1KHWA 5KFPA 2FBYA 4KV8B 5JS2A 1HNIA 1TK8A 3DLRA 3G10A 1TL1A
chains in the Genus database with same CATH superfamily
2E4LA 1RTJA 4B3OA 1PAEX 4ZMMA 3KK3B 3VQAA 1RWWB 4JYAF 2R7RA 2R8HA 2M9KA 3AJ2A 4OX7A 2HQFA 4UZCA 1LOTB 2LA6A 4FJHA 1F2GA 4DFKA 2NRVA 1W2BR 4CZFA 1RHUB 2KM8C 2R7SA 2JEIA 3C6UB 4OI0A 3HDSA 4LFCF 4FK0A 4LF8F 1NGHA 4IXCA 4KHPJ 2AGPA 5AQYA 4OJGA 4JI2F 3US5A 1S12A 2QLWA 3D2EB 2OANA 3ET6A 4CERA 4Q44A 2QWNA 3KUGA 3M6UA 2V8PA 5HP1A 4ZIVA 2W9BA 3ZSQA 1EP4B 3E8OA 4IUFA 4WQ4A 3CGIA 5JXSA 2MSTA 2H65B 4K25A 1RT3A 3H59A 2ZOMA 5MAOA 3A0IX 3KWIA 4OLPA 1NHVA 4DL0C 5HRNA 1WBDA 3AXKA 5D3GB 4P52A 2D0PA 4DQPA 5KFMA 1EQ0A 2CJBA 4Y2CA 2HHQA 1H2TZ 2MKJA 1BWVA 2Z1GA 1EJ7L 4BC4A 3HZ6A 2A3JA 3S01A 3GCWP 4ZOSA 4OZ5A 3IWNC 2FY1A 4ZVQB 3IR6B 2D7SA 3LM9A 3VZIA 5AQGA 1QAXA 4BG9A 3H7HB 4IH7A 2M7SA 3RMBA 4DR1F 3R27A 1VQ4S 4EZ6A 3HVTB 2IVFB 3OQ2A 3Q8YA 1GLFO 3SQ4A 3CDWA 1Q7YT 4OPJA 3SIPB 4IKAA 2ASLA 4AQYF 2KRBA 4LD0A 4CBXA 3MUTP 2CVEA 4F04B 4DV6K 1RT5A 1VQPS 3M3ZA 3C6HA 5HROA 4X64F 3HSCA 4BRFA 2UXCK 4M3YA 3OHAA 5E3RA 1WC3A 1RWMB 3R8EA 2Z58B 3DRSB 1VAZA 5AJ3K 2YHAA 1R8AA 1S1WA 3W61A 3LANA 1VK3A 3TJ8A 4CW7B 1S6OA 3DRYA 5F8HA 3BH6B 2HHXA 3LWMA 3V6KA 4ECQA 4A8WA 1KAZA 2E9RX 3NHGA 1VLOA 4KHPF 3CD6S 2AP6A 1NZ8A 2W25A 3D1HA 4DSEA 3C19A 1KVJA 5DMRA 4CFDA 2KM8B 1VMBA 1FERA 3M8SA 1TV6A 4OYOA 1RDCA 2VFRA 1H98A 3OFFA 3PYFA 4Q43A 3FCVA 4DPYA 3AVMA 1R59O 3P5JA 3OYKA 4IOBA 4WK3A 4O55A 2W4DA 4MT1A 1D4XA 4DR4K 1M1GA 2DH9A 2JFKA 2JWKA 2G4BA 2NPIA 1TKXB 1WSIA 1KVAA 2NRWA 4I4BA 5CA5A 2MY8A 1RBOB 3M7VA 3X3UA 2OZMA 2E44A 2QLJB 1SKSA 1HNVB 4MK8A 2V4QA 1XHXA 1I6JA 1K8AO 1RYSA 2XZTB 2KXNB 1YHQN 1T03A 2PT0A 4P7VA 3T5LA 3EZWA 3I82A 3I0SB 3LH2S 1VQ6S 3G2XA 3TOQA 5GAHU 4I64A 1XWLA 2F4VF 5L1JA 1VSLA 4F4YA 3B6BA 4CJVA 3PY8A 1HIYA 5EX0A 5GMKa 3ZT0A 3IO1A 1IWAA 2FC0A 2JJ4D 2ZKUA 5BRFA 2VV5A 3NGRA 3NNHA 1SL0A 2LXUA 1NPPA 2F8SA 3GTYX 1U6FA 5EGYA 3LDLA 4E7HA 2BV3A 1IKWA 2E9TA 1VISA 2CFXA 2J4RA 1HMVB 1ASVA 3DOKA 2ZGZA 4R8UA 2V51B 4DV7J 4KIAA 4URSA 2J6UA 4EUVA 2XSJB 2QYGA 4BWJA 3L3UA 3FC9A 4ZJOA 4ZVHA 2UXBK 5D4NA 2VWKA 2Y0SD 1YTAA 3SZ2A 3CD0A 4GRSA 1X4BA 1NSAA 3TAQA 3MECB 4BRMA 3OTOJ 3CSKA 5EDWA 4JN4A 3N79A 2V8HA 4ECZA 2KJWA 2WSFC 2WSEC 2RS8A 4RO0A 2J7WA 3BR8A 3RB3A 3QRQA 1VSFA 4CEFA 4YR0A 4QR1A 2P9KB 1MW7A 5HRPA 1HNWJ 2B43A 2DHSA 2AEJA 4B3SJ 3V6DB 3IMXA 1R8HA 1QAIA 3KKRA 3M2VA 1TL7B 3ZEUA 3PACA 3E51A 1N5YA 4F4KA 3IBCB 5KFBA 2GV1A 1WI8A 2DPNA 3NEKA 4CNYA 4C3LA 1SIWB 4UF4A 3MX2A 1WC0A 4FJNA 1K8KB 3FRYA 2HLTA 2VBWA 3C7NB 4JI4K 5HVFA 2X3DA 2HNDA 2HGLA 3MN9A 3L4BC 4ZCMA 5M1FA 1RSCA 2ZH4A 4J9OA 3HLUA 4OPHA 1KVBA 2J7KA 3JXUA 4P72A 1JJ2M 3PJWA 1UFLA 2AT1B 5IM0A 5DG7A 2KFNA 2FJXA 1NGFA 2KKZA 4U96A 3F44A 1NJZA 1HBNA 2OTLS 1NMNA 2N3LA 4BGAA 2JX2A 4PG7A 3QNNA 4FNHA 4Z7YA 4ZTJA 1VQ9N 1RFQA 3CJ7A 4NLSA 3PDNA 3CJKB 3TARA 5KG7A 2DCLA 4LVNP 4LFBJ 4BG8A 2FZGB 3W7BA 2VOOA 1LW0B 1ZAXA 2VASA 3AXMA 1V3RA 4GVMA 4AHVA 3H1QA 2HWIA 4CEOA 1OH5A 1LKZA 5B8HA 3PO5A 4ATNA 1CXQA 4GW6A 1S4EA 1BLUA 2F9TA 4ED3A 1AZSB 2HG4A 3DRPA 1GMWA 1VRUB 5DG8A 3DI6A 2BANA 2V7YA 4KBIA 4L3QA 1DTTA 3WQTA 1W7WA 1NPRA 4QBUA 4B9QA 4DBQA 2VGNA 2XYHB 4F25A 1EX8A 1HUXA 1M5KC 1VC5A 3W9IA 1NGCA 3U9DA 5B08A 4CYUB 2GAHC 1AYEA 2PFFB 4FM0A 1NK7A 3HK2A 4YOXA 4FN5A 3LAKA 4RZRA 4MIBA 1W97L 2WB1D 1M1KO 2BABA 2U2FA 1YT3A 3QSYB 4G9ZA 4X4TA 2VYPA 4Q0BB 1TUYA 3HOSA 4C8NA 1JQGA 3D0PA 2F40A 3CCMN 3QNWB 3CCJS 1CJTA 1N36F 4W98A 1HI8A 3R7NB 4KHMA 4NLBA 4R0EA 5C2GA 3D0IE 1JLEB 3GP9A 4NOHA 3OTEA 4J9UE 1GMVA 5AQQA 4RW6A 1AUDA 4ILGB 1RDDA 2MQNA 2V4JB 4PXDA 3OUYB 2QYCA 4IQXA 5J1EA 1NHKL 1X7VA 4YOVA 4I67A 4IG3B 4JI1K 3CCSN 3AO1A 1HQUB 2JEFA 1RGIA 1VQYA 3DJCA 4IQMA 2JLGA 1XNQJ 2M3DA 2Q1LA 4R0JA 1DJ0A 5GAGI 3PYEA 5GADI 4CJFA 4PKGA 4CEZA 4CTAA 2QMWA 2HNZA 1JXLA 2E2PA 2RHQB 4RW9B 4M63A 1VSKA 1HARA 3SAGA 3MX5A 1L5UA 4J9MA 3CULA 1R7IA 4CK3A 2Z2LA 3F0NA 4JI0K 1ZOTA 2WOMB 3D0HE 4RU2A 1W25A 3A2FA 5B09A 3E01A 1OH6A 2MPUA 4Q8FA 3D2FB 4NCBA 1U4BA 1S48A 1TKTA 1P8GA 1HYSA 5KQDA 3MM9A 5I3UA 3I0RA 2DY1A 1BISA 2H5IB 2MJUA 4M5HA 3FFIB 2MZTA 2MKCA 3UDEA 3EE8A 1GLDG 4JHDB 1WNSA 4IKFA 3AA3A 5H1SV 1LWXA 2IDEA 1F60B 2F65A 4YORA 1BE4A 1BIUA 3I56S 3NAHA 1R8BA 2G0CA 3HJFA 4JV5K 4ECSA 5M1PA 5EVZA 2XLIA 5KT2A 2P5OA 3P38A 2YNFB 4HT5A 5ADZA 1X5PA 4M42A 4MAKA 3W65A 4WFBL 3AHPA 1UVLA 1WC6A 3Q8SB 2FJWA 3C6TA 1G1XA 1KVIA 1S9EA 1DY3A 3SCJE 1RLCL 4AD6A 1BHNA 5MLCV 1EO1A 2W42A 4ED8A 2JGUA 1PJ7A 3QERA 3CB4A 3QIPA 1KQGB 2Z8QA 2MZRA 4B9MA 1RTIB 4IOCQ 2JEJA 1Q4RA 2GHWA 2XSFA 2YNHB 4A46A 3G6VA 3OLBA 4HI2A 1U47A 1CJKB 4Y28C 4Y34A 1E6VB 1KC8T 1QUPA 4OZNA 1WHYA 2QA4S 3OT9A 3R97A 5I3PA 4EHUA 5GVQA 4H0PA 1U24A 5HMZA 2X1BA 2RSQA 3L7PA 4RNOA 5J2QB 3M30B 1XNQF 1ASUA 4CM0A 4M3WA 3N5BA 3SCLE 3IS9B 4O0IA 4O4GB 4C0BA 2BRKA 2ZJRL 3BQ2A 2RQ4A 3QYYA 2ASYA 5T7LA 1D9FA 4ETXA 3AVIA 1BQNA 4CEAA 4CLZA 4J9RA 1NJIO 3ZYYX 2EI5A 2BKOA 1RTHA 4DV3K 5HQLA 1XNRK 3CE8A 4KRWA 4ED0A 4L76A 2R7WA 3RRGA 2NYIA 1GTHA 2HK2A 3PO4A 3BSCA 1JCEA 4C97A 1J5EJ 3QB0A 3LDSA 4YFUA 2Z1HA 1B7YB 5CCLA 2VWBA 4CJUA 1UZHA 4DV6J 2Q97A 4OZJA 2E7XA 2FYXA 1ROFA 4FVMA 2O01C 4BRCA 4G1QB 1SV5A 2ALZA 2UXCJ 4IOXA 2GX8A 3V9SA 2LXFA 2LQJA 1A5XA 3KWMA 3VQ4A 2HBRB 1JXEA 2V8DA 3TJAA 2CA9A 2GJFA 5AJ3J 1HHQA 1JNZB 4MFBA 4CK2A 2D9PA 2DR7A 4BR7A 2FD2A 5J2MA 3Q8PB 1CULA 2MLXA 2NPFA 3UDCA 2YKNB 4FJ8A 4A62A 3M8PA 4RLEA 2XMKA 3L09A 1PYSB 4C7QA 2HQIA 4OI1A 1XC9A 2OD4A 2F3JA 2QXFA 4Z4IA 4CI6A 4J9NA 4EIAA 4K0KK 5DM7L 4IDKA 3JAMO 1D8YA 5CR4A 1AA1B 4DSIA 3PR5B 3ZNJ1 3G8TA 1VQSA 2O5DA 2FGOA 1VRTA 2V68A 5F8LA 2HVZA 1WC1A 2NXUA 4LSZB 4Z4FA 2C2EA 2GO8A 5THWA 4K4VA 1IXKA 4ZVGA 1OVQA 3Q8VA 4IFVA 3SBTA 4QW8A 1UEKA 2YWWA 2JHEA 1PBAA 2HS3A 1SJ3P 4MTPA 3O4WA 1RHQB 2MKKA 1VQMS 2EFQA 2QEXN 2CNKB 1C0UB 1GQEA 4ICLB 2JVOA 4B3RJ 3SBGA 4MKAA 5FPEA 3DLLL 2VFVA 2VZ9A 3KHLA 3JQKA 4I2PB 3TUIC 3AO3A 5IV4A 3KK2B 2MLYA 1HPMA 1WUAA 2DNMA 1SH0A 4P2FA 4M5DB 4OYIA 2Z1IA 2OFGX 3QIOA 4DB3A 1IKVA 3HPHA 4LFAK 2VQFJ 4CJSA 1W2BM 1U1OA 3RBZA 3L0QA 3HPOA 3GJRB 5GAEI 3UNGC 1LAVA 4CJKA 4KI4A 1S0MA 4DV6F 4CJ7A 5EWEA 2IJFA 2R8GA 1WHWA 4CIGA 4YY3K 1PC5A 1SH3A 2VJVA 2CG4A 2UXCF 2EG1A 1VQNN 1NRKA 2QK9A 1OPIA 1DZ5A 3ZTOA 1U49A 1UVJA 4FLTA 1W7AA 2YXLA 1VQKN 2MJNA 3EUNA 5T41A 3BO3A 4M95A 2XY7A 4PQUB 3KNAA 1M5OC 4M3XA 2IA0A 4J2DA 4ZVUB 2EPIA 1ZBHA 1DT9A 1S6PA 4MDAA 3GBTA 2RT3A 4FJKA 4FLUA 2OZSA 1QE1A 5JUMA 4PG5A 5BR8K 3ULHA 2Q6BA 4GC6A 4F9OA 1PYTA 2J9CA 2YX1A 4ZLPA 1ATNA 2XBPA 2DFFA 2DFHA 3U02A 2KHDA 4DR4F 3ATUA 1S0OA 1U6ZA 1ZETA 2A6AA 1R27B 3F2KA 1YI2N 2N4DA 4KR0B 4WFNQ 3C0BA 5AZIB 2NLWA 3QICA 2AU0A 2AGOA 4DV0K 3TJ9A 3C15A 3HSDA 2IJNA 1S6QA 4IRCA 1X5OA 2P8IA 1S72N 4LH4A 3GSIA 4Z7CA 2IVMA 5B0CA 2QC3A 4E3SA 1SI9A 2OSRA 4NLDA 1Y5LB 5J1PA 3N4PA 3VENA 4WE1A 4LREA 3T1AA 2E5GA 1NK6A 1KP6A 4YDUA 3M9NB 5A2QU 3O3HA 1Q5YA 2HURA 3HTVA 4YB5A 4C11B 3DXKB 3D2WA 5M2PA 3U1NA 1JLCB 1YZ7A 3E9OA 2D0BA 3KLFB 1N0UA 2WK4A 1RA6A 3PM9A 3MURP 2H54B 4K4YA 9RUBA 1WD6A 1B4SA 1BA1A 1K9MO 4HL9A 1DQ8A 1JMTA 2AJ0A 4KV8A 2BTFA 4OLAA 1WBBA 2FJEB 1OY8A 4WP9A 3CMAS 2WFBA 3A8JA 2UXBF 1M1HA 2I5JA 4AF1A 2E1AA 3CQXA 2R7XA 4WQ5A 4FZVA 2DD8S 1EARA 4LBHA 2RF2B 2V8VA 3HP6A 1S1UA 4GKJK 3HFKA 4YDDB 3QJLA 4RW8B 4O23A 3MD1A 1OY6A 2X1GA 1IBLJ 3A5LC 3VEYA 1HLUA 5HLFA 2Q0RA 1R0AB 2UXDJ 1RAJA 2BE2A 3QAUA 3H20A 1C1CA 2QT7A 3GYGA 1LV5A 2XI3A 4PYDA 3KDNA 3OJSA 5C25A 3NOCA 1S4FA 2KT3A 3N6NA 2GGPB 3J7ZO 3BGUA 4DI6A 2XS7A 3THVA 1R43A 2ZKTA 2QMXA 3G6EN 3DXMB 3MAHA 3RWUA 2YNIA 3SXLA 2PI4A 4ILMA 3MI7X 2HPUA 5ETSA 2ZC4A 4ZVRB 2MHEA 2CNLB 2WCXA 4JI4F 3AVBA 4DTPA 4ECYA 1NGAA 3OSNA 1VQ4N 2B6AB 3POTA 5HN0A 3MM7A 1HW9A 5FJ4A 5F0UA 3MGJA 2OIHA 4IEEA 2QA4G 4V19X 4ECTA 2VG7B 2ZC3A 4TKTA 2CJYB 4C8LA 1CG2A 1O1WA 1LQ9A 3NH2A 2DNQA 4JNEA 4ED6A 4JI1J 4CJPA 1RT3B 3O9UA 1CZAN 2QG9B 1WC4A 1FESA 1VQPN 2ZE2B 2AJFE 2XHWA 2SXLA 4N8OA 1JJHA 1BCOA 4J5OA 5LM7E 4IWVA 1NK4A 1VJWA 2G8KA 1P9YA 1X9JA 2AZ3A 3CCRN 4UOCA 3KLEA 1X9WA 4KGMA 1S1XB 1JL2A 1PO6A 1S5ZA 3ZT2A 1U0HB 3QT5A 4XTTA 3K5OA 2X1FA 2HBQB 3P49B 2DNZA 1QQMA 2ASJA 5IT0A 1NB7A 4JI0J 5GAEU 5CYQB 4FK2A 1FCAA 5M2RA 5KFAA 5JMVA 1NKEA 2CZVC 2ZH2A 3RMCA 5L1LA 1NSQA 3EZ5A 1N6QA 3WC2A 2XEXA 3R9PA 2DR9A 1IWGA 5EWFA 2UP1A 3SPYA 1R0BG 1FTCA 4WFAQ 3AQOA 1HX1A 3V1RA 3MMAB 1NEEA 3CQ8A 3CO0P 2ZJPQ 2PYLA 4C0OC 3M32A 2VC0A 5KFWA 3MXJA 2D3UA 4DX6A 1K1QA 1BCMA 4HVJA 3NY0A 1FJCA 1TU0B 1RTDB 4JV5J 4BRIA 3G8QA 3T1YK 3J7YP 3HFVA 2YKMB 4OYAA 2F8HA 2R7VA 2D4WA 4K4TA 4CBUA 2R8IA 2ZJQQ 4ZPCA 3VTIA 3GV5B 2ASDA 1XMQJ 3ILLA 2IC3A 2J5AA 2UU9K 5KFLA 2V2QA 2EG2A 2B9WA 2E6MA 4CIFA 2KLAA 1TP7A 3AJ1A 5KFXA 2PMWA 2KO1A 1WF1A 2P9UB 5K8PA 2HKEA 3CDAA 5KFVA 2BYCA 3C65A 1N32K 3EGZA 3NAIA 3VETA 4Z37A 1CC8A 1VGYA 4URQU 2LVWA 1RT6B 3AA9A 5EOYA 4RNHA 5HATA 3KJVB 4JI1F 2HNYA 4DTRA 1N52B 2DHHA 3ZZOA 4UZBA 4DFMA 3SFGA 4NLCA 4OPAA 1IV0A 3CJ8A 2XLJA 1GAOA 3Q22A 1PJ5A 3DYAB 2KZZA 4IJNA 1Y4ZB 1GK8A 3TAMA 4WCEQ 5E41A 4FWLA 1KFSA 3W3DA 3GQCA 3TTDA 1U0SA 1T03B 4A8FA 4HCCA 2M8HA 1ATSA 3UKRA 1S9FA 3R3TA 3IAS9 3UKUB 3NG8A 1NOYA 4JI0F 4DV3J 2DCUB 3NP5A 4O44B 2LQ8A 1TKZA 4OZ0A 1QTNB 2QKKA 2CQHA 4CJQA 3UVJB 1OH8A 2H51B 3CERA 4K59A 3QMLA 2BQ3A 4L3KA 3G6YA 5DK5A 4ID5B 3AD9C 5G4DA 4DTSA 4Y3CA 4IO9L 1BWFO 4KH6A 3FEZA 4OI6A 3BZCA 1YDLA 3IP0A 4M5KA 4JV5F 4CO1A 3OFGA 4N47A 4CI0B 4MLEA 1Z1ZA 3W64A 2D1KA 3MEGA 4W92B 3GG0A 3L4QA 2ZVIA 2Z4PA 3BF4A 1JLFB 4LR7A 2OD6A 1RT4B 4GMKA 4WKRA 1QS4A 1M5SA 4Q5VA 1T6CA 2E5LK 5A76A 3QFWA 4CHOA 3EX7B 4FPBA 5KG6A 2ZGYA 4XDCA 2BXJA 3CCES 1RT7A 3P3DA 1VCTA 1QJHA 4K0KJ 1X4AA 1KEKA 2OA8A 3GPAA 1VBXA 2F9DA 3W2WA 4TYBA 2XMAA 5AFUH 1VJQA 1MROA 3THWA 1QVFR 4BCAA 4CF8A 2EC2A 1S10A 2VG6A 2UUCJ 4LQ9A 3E9PA 3ZX3A 2QIFA 3FZLA 1C0MA 3MM5B 3U1MA 2AKWB 4CH7A 4BRGA 3RZAA 2Z2ZA 4KYZA 2RHKA 4DCJB 2BBEA 4XEIA 3Q89A 3MPVA 1B9DA 4J7CA 3IWXA 1H1VA 4GV9A 4G6VB 1FKPA 3TUPA 2XMMA 4Y2AA 4F3OA 4MYTA 3GFYA 1MSWD 2IRUA 3D6FB 2EKYA 2FB0A 4DV3F 1XNRF 1VS3A 1FXRA 2GQCA 3H5YA 3QJPA 2YHXA 4IO8A 1VQ7S 2DIVA 1VHXA 2E1YA 1YXQA 1UJ5A 1NKBA 3OYFA 1IJFB 4HWIA 2PD1A 4DWIA 2CPHA 4MKYA 3VESA 2BX6A 3QO9B 4B9LA 2QZ8A 3AY0A 4NX9A 4LFAJ 3V81B 3JSRA 4CF0A 1S76D 1RTZA 4C6AA 4HACB 2QO3A 1SQEA 1DFDA 1WEYA 5CXTA 3KHGA 3S3OA 2MQQA 2OPRA 5U47A 4V19S 2RUGA 3IGVA 3IM8A 3HHKA 3OYGA 1MWYA 2E5JA 3GONA 5ADXH 1LXNA 3AOBA 3ULEB 2A5XA 3PRDA 3CCJN 4EAHD 1AFJA 1N8RO 1YTUA 1XJWB 3CEDA 2XYGB 4NMXA 1DTTB 3AY9A 2FSJA 1KOOA 5E84A 3AVGA 5KT7A 2A42A 1RWOB 3AQPA 1SIZA 1Q9XA 4IJAA 3A5NC 1WOSA 4NLUA 4BRDA 4WXOA 3HSZA 1TMMA 4K0KF 4OKJA 5BR8J 3CJAA 3D66A 3W62A 4EO8A 4NLGA 3AODA 4O8UA 3FR0A 3BREA 3GYXB 2LQ9A 2EFPA 3NAEA 1FJEB 4HHUA 5AQUA 2FC9A 1NK8A 5IT9U 4A8XA 2BJEA 1JCGA 3QINA 2J7UA 3VF6A 2DXEA 4CGHA 3VGLA 4I2QB 4UUXA 3EICA 5JVGQ 1RBVA 2C22A 1UVIA 2YX4A 3NWGA 1YWXA 4OZ1A 3CUNA 3MPYA 3DC2A 2D1CA 4DV0J 4WYBA 3R3LA 4GV6A 3D3BJ 1NAQA 3J80Y 3V1QA 3LWLA 2FBYA 4M5LA 3FBFA 4ED5A 4R25A 5CABA 2C2OB 1WDTA 4TU7A 3AB4B 1TL1A 4IG0A 1YZ6A 4RNFA 4GVLA 4IBNA 1YVNA 2DB1A 3ENOA 2C3PA 4BY9C 4O3RA 1FE4A 3NDKA 2HGNA 3JYTB 1Y9OA 1RE1B 5C15A 3QAEA 4LFAF 2H4YB 2E1RA 2YV0X 1T9UA 4LBPA 2RQKA 4LRCA 3SDEA 3BP8A 3I56N 4YY3F 2QMUB 2E7VA 3W8PA 1RADB 3S7RA 1UVNA 4EBDA 2VC1A 1KWMA 1J6ZA 1X8DA 4CZHA 3JS9A 4I7FA 3KFWX 4L75A 4OJ1A 4OQJA 1OKJA 1EWRA 1QDUB 1OQ3A 4NZ7A 3E66A 1NBEB 4KSEB 2B4OA 3CVKA 3KKFA 4O8KA 2Y1LB 4IFYA 1FWPA 3D54A 3EZOA 4BLGA 4KB1A 1TKTB 4G65A 5AE3A 4DSFA 3UE2A 3I9V9 3MR2A 3SUPA 3K5PA 1Q95G 2IBKA 2CJQA 3IWLA 1YUWA 3M6WA 3R5BA 3MEEB 4RW4B 5BR8F 1PSDA 4JKBA 4GKJJ 4FPAA 4PG8A 2CVIA 3PIOQ 1AUSL 2ZH9A 4DG1A 3UQSA 4YS2A 4QPTA 4CF9A 3QFUA 3W1YC 3TTCA 3HL8A 2OPSB 3C16B 1TL3A 5D4LA 2XZDB 3D1QA 2ZM6F 3SK3A 2VPWB 3PX0A 3BKTA 3WHIA 4C3MA 2VGMA 1UMJA 4P71A 1ACMB 2JNJA 3OYIA 4PXEA 3VMFB 1CQMA 4KB0A 4HLBA 1J9AA 4Z0UA 5ETNA 1D9DA 4G1PA 2ADCA 3Q2SC 4KPCA 2I7PA 3BEXA 1S97A 3OR1A 3L7OA 3IR7B 4PWDA 4KTZA 3K89A 5L1KA 3M8ZA 2QJ3A 4CZJA 3IRWP 3GV8B 1K73T 2AYEA 2X74A 4JOUA 3BQ1A 3R5GA 3TANA 4B1XB 5HQMA 3EVOA 1HPZB 3R5DA 2BW7A 1C0TA 4CEDA 4AXJA 3BF1A 4X4OA 1X31C 2ALYB 3ZNUA 1GXUA 3RBDA 5KG4A 4W5TA 3ZZPA 5B0DA 1Q79A 2V7ZA 2DNLA 4ZLLA 3EGVA 4P73A 2VKRA 2GUPA 1BMQB 4ZP6A 4ANCA 3AVJA 3C14B 4ED4A 4J9QA 4Q7AA 5ETKA 3KMSA 1REVB 3GJTB 5ETTA 1WB9A 1G2EA 3A8IA 2VH7A 2R7OA 2DR5A 3QLHA 1RTHB 2E2OA 2HZVA 4HTJA 1IBKF 2MQPA 4JS5A 4WPAA 4XIUA 4RW7B 3CCVN 3L2VA 2H4WB 3PHTA 4U7BA 1IKYA 1C2PA 5F41A 3TR5A 1NGDA 4NYFA 5D78A 2GAGC 3PXGa 4WXWA 3MMCB 3D6TB 4BC2A 4GKJF 4PQAA 4HVZA 1QY7A 5L46A 4MQ3A 2FJAB 1SUQB 1EKEA 3SQ0A 4OLBA 4BHQA 4LRAA 1U2FA 1TL4A 4CE9A 3UNYA 1EX4A 1N5SA 5AQJA 1KVKA 5M2UA 3T1YJ 4OV6A 1SH2A 3AD8C 2IRYA 2V50A 1FVQA 1H6KX 5KOXA 3A3PB 2HFVA 2D74B 2MMYA 3THYA 2AGQA 2WSCC 1HD1A 4L72B 4DL5A 4ANDA 5LJ3Y 2UU9J 1F21A 3D67A 2D9OA 4FNIA 5F3TA 4IDKB 4NEZA 4USMA 4BRQA 3MPDA 4OZLA 2FTRA 1LW2A 1N32J 3AB2B 1BQMB 1GLEG 4H5VA 3Q8RB 5ETQA 3GZ7A 1IN0A 1VRTB 4P74A 3X1LB 1FFWB 2AHOB 3B4MA 3O1BA 4DV1K 4CLSA 4NLOA 1YHQS 2MGZA 1Q1KA 3SAFA 1UFWA 4ED1A 3LTOA 5D6GA 1JLBA 3L4IA 1VQON 2AJ1A 2NREA 2QTWA 2IHR1 5KAKA 3DOMA 4ZJLA 1WF0A 3BO2A 4X84A 3UR3C 1U1PA 2AYBA 5J2PB 4X4RA 3BY5A 4RBUA 1SB6A 1LWFB 2IY5B 1M90O 1R8CA 1JKHA 4WFZA 2C2MB 4X4SA 3WXIA 1NSKL 1U1NA 4Y0WA 1BWEA 1QUVA 4L3NA 2W8LA 2KHCA 4ED2A 1TVRA 1SAZA 2QGFB 2OJ3A 2J8SA 1IKVB 3PEJA 2PMZD 2MLZA 3EZUA 4WFBQ 3QSIA 2VPXB 3DLGA 1JLQB 3T6JA 5GMEA 3ISZA 2O4GA 5H1SQ 1WG5A 5E7OB 4WZMA 4LUBA 4USWA 4C1NI 1VQLN 3T3FA 2D0AA 1IQZA 3H5SA 3ZFVA 4WZQA 3T1YF 4GV3A 1P1LA 4A8YA 1BXNA 4ECWA 2AYMA 5A0YB 2Z57B 4YDXA 1QAJA 4OYWA 3HHLC 4XH1A 3EWGA 2OPQA 2JL9A 1S6PB 3O5BA 5KFDA 2UU9F 2M52A 4A2AA 3TU5A 1QE1B 2W2QP 3TEHB 2DRAA 1CLFA 5MLCQ 1V5IB 1Q8BA 2BKNA 3DOLA 2RB7A 3VAFA 3UIQA 2DNPA 1N32F 1IQTA 4IOCL 5LOQA 3HVAA 3NNAA 3CNQP 2YHYA 4JI3K 1W26A 2RE1A 4AUKA 4PCQA 2CQCA 1T3NA 2H48B 2RQMA 4O3SA 2AA4A 2R2UA 1TAQA 3PG9A 4P2MA 3H4DA 5I42B 3JSMA 4A4JA 3SNNA 1Y00A 2ROEA 2E2NA 4ZPAA 2G2OA 1FDDA 1U7LA 1U1KA 4LF6K 3ID6A 5CE3A 1FK9B 3ZZTA 3C15B 3ENHA 2RH3A 2QFIA 1RABB 3OLAA 1KS2A 3LPTA 7AT1B 1XQIA 1Y5NB 3DDNA 1V3SA 3D45A 4HYKA 1RAEB 5FDLB 3F41A 4USJC 2IRXA 3OVSA 3QJJA 2GVZA 4OFZA 1IUJA 3FE1A 4NXMK 3OL8A 3UCUP 3ZX2A 1VYAA 4PPZA 3MN7A 2M88A 2MTLA 3BGLA 4CEEA 4DLGA 4WKYA 4C2MA 3NH1A 2K06A 1KTVA 1MMLA 5DGBA 1VC0A 4DSKA 1CBKA 1UA0A 1HQ2A 3NOGA 1RILA 1FDAA 2YI1A 3I96A 3THPA 1BGXT 5LSLA 1ICEB 2BQRA 5CY4A 1S57A 3NGZA 2V6AA 2LDIA 4PXCA 1NU4A 5KFQA 2A1RA 2DR6A 1RAOA 4M5MA 3TEGA 4CF2A 1JLAB 2I2YA 3H45C 1T9WA 2YPZA 3S41A 4KKOA 4QYZK 1FKOA 5AZJB 3HVWA 3TSPA 4RU9A 1ZXOA 2ACYA 1XC3A 3IBFB 4DL3A 4R5PA 2OAUA 3SJHA 3Q0AA 2IMWP 3QETA 2MZSA 2IAJA 2V4RA 3HHLB 2E5LF 2R9LA 4FJMA 3QEPA 4USUA 3VQ9A 2K1RB 4TSXA 2GFFA 2FLNA 4EZ9A 1RLDA 1VK8A 2Q43A 2WC9A 2HRUA 2N82B 2KN4A 3CF5Q 4CCHA 3M5RA 2BE2B 1M0SA 4ALZA 2W9AA 4DQIA 1RB0A 1RDBA 3DNCA 3ASMA 2WONB 3ZT4A 5IOLA 2BOAA 2DT9A 2O8CA 5EN1A 1MN7A 4CWBA 1VBKA 4DSJA 3KJFB 1HL6A 1G15A 1X1PA 1A0OB 2B8QA 2F4FA 5KG2A 1UVMA 3VEXA 1NHUA 4CNZA 4NLYA 1DTQB 4PZVA 4CM2A 5KFFA 1S5JA 2AV5A 4BDPA 4RPFA 3CYMA 3RU0A 3C3LA 3CJ5A 2APOA 2GTDA 4FS1A 2LXIA 1D09B 2G8VA 2NUBA 3Q24A 2YCHA 4HUFA 2W9CB 1RDAA 1MWZA 4A5AA 2BE9B 4E7IA 3GR0A 3HI9A 4B8AB 1NDCA 5B0GA 4DMZA 1H7WA 1RJJA 3R6GB 4DR7K 3D5MA 3OBYA 2VODA 4FLVA 3GIMA 3FLCO 2J0QD 3LQVA 1WN7A 1AFIA 5C2DA 4WIQA 2C42A 1P90A 4BWMA 5D0HA 1U1MA 1ZBTA 5DLFA 3ZETA 4QS8A 1Z2LA 3FZMA 2UVRA 3L7UA 4KE5A 5AQKA 3H6EA 3F73A 3AVFA 1QVFM 3O9RA 2E66A 3JTPA 3I8BA 3IC1A 3RW7A 3EN9A 4JKGB 2C2NA 2DH8A 3CJ4A 5C24B 3AVHA 1SPBP 4HTIA 1P8ZA 1XUPO 4FWQA 3NFAA 2E1PA 3I32A 1GT8A 3S3MA 2AJ4A 4LH5A 1ZZFA 2HLUA 2HK3A 2FIUA 3THXB 2OSQA 3V4IB 2HHWA 3ZC4A 4K4ZA 2B4VA 1B0TA 3JQJA 1RWPB 2IPOB 2HVDA 2V8GA 3NKYA 6FD1A 2FZKB 2O67A 4ETZA 4JEPA 4E2FB 4NZ0A 4ZHRA 5AQSA 3DLEB 1FFGB 3FGUA 1U8SA 4OI3A 4H0XB 2KZMA 4FOEA 4IRDA 2E9ZA 2YNGA 1X60A 1UJ4A 1YSJA 1CJVB 2HAIA 3M2UA 3J7A1 4CECA 1OO0B 5FLXU 1WKLA 2IA6A 2MZJA 1NO8A 3GFZA 4U6PA 1D3WA 1B99A 5IZHA 1Z05A 3P39A 4EK2A 1HBUA 2RDDA 3KZBA 1C4AA 4JAXA 4DV7K 2IYGA 4JI5K 2XWXA 2QSWA 3MM8A 5BYQA 1J5OA 3BZKA 5E3PA 2X78A 1CZ9A 5T14A 2IGIA 4PRFA 2UUBK 5CYMA 3OTOK 2D3OR 4KH0B 5KPRA 3SV3A 4OIXA 1Q5VA 3I5CA 3IM9A 4CZCA 3PKYA 3UW1A 3TWHA 4AILC 4I6YA 2Q1NA 3U9ZA 2J9EA 5JLHA 3EE3A 4DR2K 3VQ8A 5HOOA 5CZ2A 1DQAA 4J9PA 3UKRB 1HNXK 1HNWK 1S9GB 4FF2A 4B3SK 4WJBA 1IM6A 2WAQD 3EVWA 1BD6A 1IKXA 4OJ3A 4K2JA 3MEDB 3DHWC 2GUIA 3MMBA 1SJ4P 3BDEA 3CCEN 1X3MA 4R79A 1ZM2A 4ZPWR 3CD7A 4H4OB 2YTCA 5A8WA 1UAXA 3IKMA 2C2DA 4A61A 5HBMA 1XR5A 4GVBA 1WORA 3FFKB 4FVUA 4NPOA 4JRPA 4CH0S 2FVRA 1FX4A 2AW0A 4K42A 3ZT1A 2DGXA 2OH2A 4Y1DA 3ENAA 2CZ4A 3UD3P 1SQGA 4C8ZA 4OYBA 3SMZA 3PYDA 4DPOA 4WP3A 2XWYA 2P5VA 5C2FA 3ENWA 1QHAA 3QEVA 4H4MA 4YHHJ 5EXWA 3RYLA 3C8YA 3DLJA 2R2TA 1KQSM 4M5IA 4F0HA 1WLJA 2XO6A 3D9BA 1KRPA 4ENOA 4DR5J 4XPEA 1U2VB 5C10A 4JI7F 3VF0B 3HF5A 4LFBK 5ETVA 2DFEA 1OYDA 2MYFA 3VA3A 4DS5A 4PABA 2B9YA 1VQ7N 3VF2A 4BDZA 4M45A 3J7YU 4H5WA 3CMQA 4M41A 5E26A 2H9ZA 3IG1A 3MN6A 5HRRA 4PYAA 4X4QA 2VG6B 1D0EA 2QWLA 2QEXS 4DV1J 5A8RA 1BUPA 1ZAVA 2HS0A 4FXDA 4B3TK 4CT9A 3V4MA 1ASWA 3CJBA 4HCBA 2VA2A 2PMHA 4J37A 3DRRA 3BEGB 3RMAA 1IJEB 4DPTA 4DF8A 1FKPB 3ZO7A 1FD2A 1UZDA 4QZVB 3CDEA 1KAYA 3KD1E 2Q79A 3KOAA 1U25A 4LT6A 4EFHA 1FXDA 3TAEA 1WC5A 3OYMA 3CJ9A 4KGKA 3H46O 1VQNS 3FBBA 3ITHA 3L8BA 2JEGA 4QWEA 2ZNYA 1VQKS 2OP5A 5E33A 2E5IA 4ZDNA 4WFAL 3P8BB 2DKOB 4USHA 2BE7D 3RJMB 4FBTA 1RK8A 4DOZA 5AQFA 4UY8T 2VBYA 1R8PA 4FCYA 5G0RA 2ZJPL 4TY8A 1NMDA 4X2BA 1H2UX 4A8QA 3DAWA 2F7TA 5AXMA 1WDDA 4DL6A 1NCLA 1OIAA 1RT2A 2VBZA 1EWQA 2ZUAA 1T05B 4CFAA 3NBPA 3BYRA 4DU8A 4DZDA 3WEEA 3TP2A 2LQBA 1T44A 3ATVA 2KG1A 1K6YA 4DX7A 2EK6A 2ZJQL 3WBZA 3MM6B 3Q8UA 3N4WA 4PKHA 1K47A 3TAFA 3ENBA 5HL7Q 1FKAF 2EHGA 5A8KA 3M9OB 3VF4A 4ZPDA 2NRTA 2XS2A 4I6MA 3HM8A 1YI2S 1NJYA 4FYWB 3A3NB 4M1KA 3QPIA 1S1TA 2WTUA 2IYIA 2EFGA 1NKCA 2ZBIA 2DGSA 1N0VC 4Z4CA 3AD7C 4DV1F 2BOPA 4NXNK 1PG5B 3V5RA 1X3NA 1BI4A 5GMDA 3V2UC 4HTUA 1OPZA 3RBEA 4A8SA 1YBTA 4LSLA 2RU3A 2MQMA 4K2XA 3EMTA 4DL7A 2HFNA 3QFPA 4WCEL 2MEWA 2IM0A 4XH4A 3GYNA 2B3TB 4LF6J 3KK3A 3WDOA 2O8FB 3BR9A 2KW4A 1Q81O 4OI2A 5KG5A 1BA0A 1QSLA 3QNOA 3AOAA 4DF4A 3H98A 4ISFA 1WG1A 3UPFA 1W0HA 5K8MA 3R6MA 3ZTPA 4Q45A 2XG8A 2F8TA 1IBMJ 3DM2B 3VALA 3C6UA 2JWLA 1FA0A 2M4MA 5HAOA 3SSSA 4OHYA 1TYQA 1UPPA 5CD4H 4NXMJ 1Q9YA 3E3XA 4Z4HA 3D2EA 5DJBA 1HR0K 1K8AT 1NLKL 2POKA 4E19A 3SDEB 5L1IA 4LF9F 2P9PB 4QS7A 2B4PA 4O5FA 1UAWA 1N48A 3EVMA 5AXNA 1KR4A 1LCUA 1JJ4A 4TLQA 4UQGA 3HMJG 1QSYA 3BKFA 3FNNA 1HHTP 3RB4A 3BF3A 4CF1A 2CWXA 3S1TA 1B70B 3HX9A 2I0XA 3B8AX 1YJ7A 1HKAA 4QYZJ 3KJQB 3PSIA 5KFGA 2KQ2A 2A40A 5JJBA 4NWBA 1FRKA 2ZWPA 4MDBA 2IDLA 3CXCR 3VERA 3ZTSA 3I8DA 4NI2A 3I55N 4C98A 3LOUA 5DDQC 2FF3B 2VKZG 1ZBSA 4JS4A 3VAJA 4C0HA 4MJKA 2B56A 4OHZA 1T02A 1CXUA 3HVTA 4K4XA 4DKWA 4PWWA 1ZH5A 3HZEA 3G6ES 3ILOA 4JI3F 4A8KA 1VSEA 5KGWA 4B3MJ 3NL0A 2LECA 3LDQA 3MPUB 4YB1P 3I31A 4KFBB 3J81j 2HMIB 2RU9A 4B9NA 1FE0A 1DEJA 3GFHA 1J5EK 1YRXA 4G3IA 2ZH5A 1Q82T 3DRSA 4NCGB 1KOHA 4PWDB 2FHJD 3OHBA 2ZNZA 2NQPA 3OYLA 2CPIA 1PC4A 5EU7A 1T0TV 4CD3A 4KB7A 3AVLA 2G8IA 2GHVC 3TA0A 3FMWA 2K7JA 5IC6B 2QWQA 4RBVA 1UCNA 2J9DA 3SYZA 2DNOA 2FLLA 3UN5A 2RPIA 2X6NA 3CCRS 3ILJA 4JV2A 4HUEA 1DLOA 3CJRA 3I87A 3H5XA 4F36A 4KO0B 1XMOK 4FWSA 4Z94A 2YPYA 4BC9A 1VK0A 5DQGA 2W2NP 4JI8K 2RRNA 4N77A 2RKIA 2ADBA 5E3QA 4FF1A 4DR7J 3QGIA 2W7OA 4ZKAA 4NCAA 3OR2B 3O4NA 3KLIB 4MO4A 4H0VB 5IQQA 3UCZP 3BSOA 2VA3A 5AQHA 3SAHA 2V2KA 5F0XA 4JK9A 2C3UA 3H8YA 2Q31A 4K8XA 3WXJA 4ZCKA 1HNVA 4BRPA 4YOTA 1CEZA 1NWKA 4ZK7M 2AP1A 2BQUA 1T3OA 5BYSA 3SI8A 2Q66A 1FNOA 3EDRB 4YR2A 1WKJA 3GSDA 2DRDA 3OFEA 3P83D 2J6TA 3I0SA 3QBCA 4ANEA 4IDHA 1NJXA 2C1EB 1WI6A 2GCFA 3LGMA 3FZKA 2CQBA 5KT6A 3AH6A 1S1VB 4AHUA 4OLOA 2XQCA 4NA3A 1TQLA 4B3RK 4IR9A 1X4HA 3Q7CA 1C0GA 4EYHB 2YKOA 2V94A 2I1RA 5CHCB 4U7UD 1RAAB 1RWVB 2W4CA 4WK1A 5F9LA 2G0JA 2CJ9A 3LO3A 4DL2A 4GNIA 4FWKA 2Q2RA 4GMJB 5JVGL 4ZVPB 3HXMA 4B9SA 3THYB 4WF9L 2VQFK 1MLAA 1E3MA 3MAQA 1HMVA 4CLKA 5IWAJ 3VA0A 3O1LA 1QLNA 1FX2A 2ATCB 4KY3A 1IO2A 4KAIA 2XSJA 1M1KT 3L3VA 2DBBA 1HW8A 1LW2B 3DGVA 4M94A 3MECA 3TVKA 4EMDA 2AX1A 2C2ZB 5EUHA 3MHYA 4LF5K 2ZOFA 1IJJA 2AMCB 1WSFA 2FVCA 3L3CA 1JNRB 4JI5J 1VHFA 3VGUA 1JLBB 3CDUA 4DR7F 2ZFHA 2H3EB 3KLGA 2P9KA 2UUBJ 1RAHB 4HDGA 2IOCA 4KREA 4PKDB 3TPQA 3V6DA 1C1BB 1DQ9A 2OEMA 4CP5A 4EO6A 4DQRA 3QEWA 1NNEA 3BBFA 3T1HK 4JYAK 1TL7A 3AVNA 1QD1A 4YR3A 3K9KA 1M5VC 3K5NA 3R1XA 4DR2J 3MFHA 4QIFA 4KGVB 4ELUA 3KJNB 1F3FA 1HNXJ 1S77D 2HWTA 1T7PA 1K8KA 1W9HA 3UDLA 1UKUA 3MXHP 2A6MA 2VFSA 3NXZA 4I9LA 2I8EA 3KG0A 3WZ0A 2EBEA 5LT5A 3V1OA 1J2VA 4CLYA 4JI2K 1Q86O 2V9KA 1CC7A 4FJGA 3U8XA 3DGPB 5B0EA 4MK9A 4ED7A 4FLZA 5GIOA 1ATRA 2FC8A 3PIOL 1Y11A 3CJ3A 3TZXA 2FJBB 2QA2A 3VAKA 2XMUA 4AE5A 3TQEA 4ZITA 1GOAA 5B0AA 2COLA 3D6HB 3WC0A 2BJDA 1BC6A 4C8MA 3KXDA 3ZZRA 2QE5A 4NLRA 1Z26A 2HYIB 3N0VA 4DUTA 2FLOA 1LWEA 4QWDA 3CJKA 2QL7B 1V5VA 5KPZA 1UVKA 3C95A 5I9EB 2B4UA 1LW0A 5AT1B 1YBAA 2Q3SA 5F1XA 2XZWA 3FBCA 5FRMA 5F8IA 2VIHA 3EXCX 2YWHA 3C46A 1AZSA 3A8EA 1NG9A 4ZPTR 4IZ9A 1YQHA 1N34K 1FDBA 3KMQA 2HF3A 4DV7F 4LR8A 1YJTA 5H9FK 4JI5F 2GWKA 3PZPA 2W40A 1A5VA 2P9LB 4GY2B 3FEXB 2UUBF 4USIA 1FTRA 2NSBA 2L41A 5IQ6A 3OTOF 4X62K 4CYUA 4B3TJ 1HKGA 1HNZK 2V69A 5CZXA 3ZSVA 1N5VA 3G82B 3OTBA 1UA1A 3UE5A 1HBMB 4E1JA 4DR2F 1IBLK 3BGRB 2CXEA 3MCAB 4Q0BA 4A48A 2UXDK 1HNXF 1RBUA 1HNWF 2WW4A 4B3SF 1X4FA 2A6OA 1WSGA 2ACMA 4K41A 3PHEA 3BM7A 2CUYA 1TTHB 4DUYK 1NXIA 4AHTA 4TLRA 2E2QA 1YJ9N 5F9NA 1JLEA 1LXJA 1L3TA 3NCQA 4DJBA 4CRJA 3DN9A 2A10A 3KIOA 2K3KA 2MQ8A 1SQFA 2HBZB 3OUYA 3K5LA 4FM1A 3GE9A 1NJIT 3GIIA 3FZHA 4GVEA 5HRSA 3FQKA 3H1VX 2A1SA 4J2BA 1I94K 3UCGA 3IMQJ 3FJ2A 6AT1B 3GOIA 1WJ9A 1HQUA 3T7ZA 5KFPA 4H4KC 3K0SA 2O8BB 1SCJB 1S6UA 3FZ2A 5JS2A 4BRAA 3DLRA 3P31A 4CVNE 3G10A 4UOGA 3O08A 2WB4A 3DU6A 4RW9A 4WFYA 4DR6K 1GXLA 1F1BB 4KHUA 4WU2A 5DM6Q 1S0NA 4EBCA 2DNRA 1KLMB 2WOMA 1EQMA 4LFBF 2Q0UA 2P9SB 3BN4A 3O6QA 2F4VK 3D2FA 4O5BA 4QOZB 2IFXA 5KTQA 2HFUA 5AQPA 2J9DE 2QW9A 3MWTA 2MKIA 4OYMA 2PY5A 2DTJA 3FFIA 1SC1B 1TMJA 3GG4A 1LOUA 3VEZA 3ZZYA 1U02A 4NXNJ 3OBWA 4BRHA 2YH1A 4B3TF 4I56A 3AGRA 3RMDA 2Z56B 2HS4A 4BR0A 4LY7A 2GJ2A 3VQEA 2NXNA 3LZIA 1DRZA 3TZYA 3MN5A 2DHAA 2R3VA 4RX6A 3R6LB 4LQ3A 2FHJA 3PRVA 3CI5A 2GMJA 3A4TA 2YNFA 4LC9B 4TN2A 3MCNA 1UWBB 3J81O 4CHZA 4Z4EA 4LRDA 5BRHA 5KFKA 3J7AN 3W66A 3IRXB 3ETOA 2KJVA 1P6TA 2DPIA 5M1OA 3AARA 3QMQA 2HSTA 2ZF5O 4PG6A 4LF4J 4U8YA 4OGCA 3SQOP 2FY8A 1HRHA 1NK9A 1WWHA 1TUVA 2HBKA 2DGWA 3NGKA 3HHDA 4EHTA 1XMQK 1B9FA 1E4FT 1NH8A 1RTIA 3OD2A 1HR0J 2YNHA 5BJRA 1CJKA 4H4KA 4FO0A 1E6VA 1TUUA 4I6AA 2QRRA 3CCLS 3WNFA 3PR4A 2BJ7A 2K3IA 4I9QA 1YRTA 3KHRA 3ZETB 5J2QA 4B8CA 2O8DA 4CJ5A 3GG1A 1GOBA 3M30A 3TSUA 3J7Z5 3VQCA 5HVGA 5F3ZA 5C42B 3IS9A 2JOQA 5GADP 2JZ5A 3NGIA 5AQXA 3WXKA 2XTJP 3QDKA 1RYRA 4LSNB 3QT6A 2OUGA 4ZP9A 3S9HA 1GX6A 2XY6A 3MXMA 1S7IA 3C94A 4CLFA 3PFEA 4UTGA 3QRRA 4Y0FA 4ZTFA 3DXBA 4KGXB 4I0WA 4M7YA 4RCHA 3K2YA 4WBFA 2QV6A 2B8PA 1KSPA 2CQGA 2KL8A 3CHWA 5AQOA 1NNDA 3R2DJ 3CJCA 4ZHRB 4NXNF 4AL6A 5AQVA 3D68A 2F5GA 2UUWA 5KI6A 2CJXB 4G1QA 1KTQA 5CAAA 3KK7A 2N3OA 1RT1B 1RBLA 3PV8A 2VBXA 3M2UB 2W01A 2W8KA 4OX9J 4NLTA 1RACB 3BDPA 4BGBA 1D9AA 4M3UA 4KHNA 2VOPA 1U45A 3KNGA 3MZIA 4LMZA 2YKNA 4USVA 3ZSXA 3HI0A 4OYZA 4DPWA 3GWCA 3N6LA 4E7LA 2C3OA 4KT0C 2HAFA 1UOCA 1OMSA 4J9SA 1WG4A 1GXTA 2L9DA 1VSDA 5TKWA 2YKAA 2VU5A 3DLHA 3W8GA 3HD1A 3PRBA 3HT0A 3IN5A 1XMOJ 3VAIA 3GIKA 1HR0F 3CJ1A 3T9NA 1BDGA 4B17A 4JI8J 2Y8WA 2YHWA 4LRFA 3N9UC 1YBUA 2B51A 3CCVS 3K2PA 3PFOA 5KRTA 2CZ9A 3GFXA 2G2ZA 3NLCA 1XTZA 1V4TA 2O3DA 5KRSA 2WHOA 4UUWA 2YX6A 3I5BA 4U67Q 5KG0A 2KT2A 4OKKA 4DCOB 2UUCK 2DGOA 4BC7A 1WHVA 4JK7A 4IH6A 1C0UA 1P1TA 1WOPA 3Q86A 1ZBIA 3SUOA 4E7JA 5A8WB 1VBZA 3WNHA 2YWEA 4I2PA 4ITSA 5B0BA 1K9MT 3CF5L 3KK2A 2QLBB 4NLWA 2WBNA 4FBUA 3TA1A 4M5DA 2V67A 3V9XA 2GX9A 3CQYA 4DUZJ 4M5JA 1QM9A 2OKQA 2CIMA 4URGA 3ZLJA 2CG8A 3MWPA 4F4ZA 4DDFA 3BZQA 2ZUGA 3NCIA 1Y10A 3A12A 2W6LA 1HQEB 4K4SA 4KHQA 3F9KA 4H0YB 1C4CA 1FXXA 1J5EF 1LFPA 4ZVTB 3IDHA 3BN7A 2IIHA 3OFHA 1RNHA 4J2EA 2D69A 3ISNC 4Q8EA 3WXLA 5C7PA 1LAWA 2Y3YA 5EY4A 3RVCA 4EP4A 3SQ1A 1O6XA 2B9XA 1NGIA 1VQOS 3OPKA 3IXQA 3ENQA 5K14B 5ETPA 3OL9A 4ZCIA 3M2RB 4BVPA 3IAYA 5AJ3F 4H03B 4FYYB 1RWXB 3VGKA 1HA1A 3HT3A 5E3CA 1NUEA 4CZLA 2X7IA 4LRBA 5TKYA 4LF5J 5A8RB 3DCAA 4JI8F 1VSIA 3CCWA 4PG4A 3DMJB 2OEKA 2R7QA 9ATCB 1BL3A 3LDNA 3CXCM 1I3OB 3ZTRA 3DRRB 1U6BA 4AFFA 4P2XA 1KXPA 3K17A 1FNMA 2OHDA 2GS8A 3T1HJ 4JYAJ 1Y97A 1XHZA 5AZIA 3WUHA 4RTFD 1CS4B 2CGKA 3BPDA 2E1ZA 5DETA 4IO1A 2YJFA 5L38A 1KD1O 4H54A 5KFUA 2FZCB 3CJ2A 4AYBD 3LZJA 3VQ7A 3K8VA 1Y0HA 4Y00A 4CFBA 3L9ZA 1VQLS 2VCPA 2CQ4A 4P9SA 4LF8J 1EHWA 3H2UB 4F67A 2HFOA 1PAUB 4J90A 4JI2J 1HBOB 4O0JA 2VG5B 4WP8A 3NCRA 1ESVA 2NSCA 2E5HA 2Y1RI 3W63A 4BE1A 4V19J 5G0RB 4HKQA 4TY8B 1UL3A 4H8KA 3T5KA 2W24A 3R5AA 1LK5A 1YG0A 4CEBA 3JS6A 2HFSA 3I33A 2OI2A 4B02A 4B3RF 1RT2B 4B9TA 3B78A 4DV4K 2AYGA 5KFJA 4FJXA 4WQ4C 3SBMA 2PN6A 5B7WA 2CH6A 4NLQA 3LP2B 2GJIA 3A5MC 4L73A 3KLFA 2FPHX 4N5SA 5IT4A 3GV7B 4IRKA 4BR9A 2VQFF 2N4CA 3LP3A 1SJQA 4DU7A 4IYQA 1YKWA 4A2BA 5BRDA 3NGDA 1M5HA 2HHHK 1CZBA 4GKKK 2P9EA 3MR7A 1AW0A 3LP0B 4YEAA 2VONA 3O80A 4F50A 2YWFA 4DR1J 2GZOA 4FKYA 1KKHA 5DDPC 4FJ9A 3QESA 2RF2A 4BRLA 4BRKA 2Q36A 3KHHA 1N34J 2NXEA 1REGX 1TGOA 1I3AA 4LF5F 2BH1A 2DY9A 3CJSA 1BI4B 2ZD1B 5H9FJ 4RW8A 2N7YA 3U3YA 2GHPA 3CC7N 3WIVA 4LSLB 3PLAA 1R0AA 2VFTA 4UW2A 4X62J 1NLVA 4HR2A 1HNZJ 1EB0A 4JKDA 3JAMU 3MUMP 3PNIA 1SL1A 3T1HF 5HQ8A 3J80O 5DZ6A 1ZZNA 1HNIB 3FEYB 3A8YA 2G1DA 1MA9B 4CEQA 2GGPA 5CD4A 4F2SA 3AO5A 1RTJB 3E2EA 4B3OB 4F3QA 2RN2A 5JMNA 3DXMA 4Y2IA 1S7HA 2HIYA 2G8UA 2BJ8A 5BREA 5M1QA 4DUYJ 2EWSA 2CQ3A 1TYQB 4JD2A 2MXYA 3B6OA 2ERRA 1VBYA 3R7BB 3O9QA 2ILZA 4CO0A 2NRXA 1ZBFA 2HHTA 5BN9A 2B6AA 3N4QA 4I6WA 2VG7A 2MDAA 2V63A 1F9EB 1FWKA 4LF1A 4KI6A 3OYCA 3J81Y 5SZTA 2ZE2A 1KAXA 1I94J 2P51A 4PKIA 1WSRA 1F6TA 3ET6B 4J91A 1MWQA 3W9JA 5HP1B 2W9BB 4ES1A 3W5YA 1J27A 2JDJA 4J9KA 3QEIA 1T11A 4HHTA 3OYBA 2BEFA 2J0XA 5ITHA 1PGZA 1I5OB 1WSJA 2UUAK 3OL6A 3TWZA 4OX6A 1S1XA 2XCPA 2NXCA 4DR6J 2CDQA 3EY1A 4UY8O 1U0HA 2IIRA 3P5BP 4NI2B 1SS6A 5CYQA 5I4MA 3CC2N 3GMGA 3LPEA 2F4VJ 4JB8B 3ZX0A 2IVOA 3CCQN 1N34F 1R89A 4KC5A 1JLGA 3SSQA 1RDRA 4OHWA 1Q53A 3M6GA 1EZZB 2BW2A 5CQGA 3O2IA 4FJ7A 1TFWA 1U8WA 3MMAA 1BO5O 4ILHA 2LSNA 3NF6A 4X62F 1GTEA 1HNZF 2X6SA 2WBMA 1EAYC 2FSNA 1QTMA 4TVAB 1YITS 2DNKA 2RHSB 2VF3A 1RTDA 1MDUB 4DZ6A 1RT5B 2L08A 2YKMA 5HROB 2UUTA 3U6FA 1IBLF 2G8HA 1HKCA 4YNQA 3VV2B 2UXDF 2BMBA 3BBBA 2ROGA 5CHIA 2GWJA 5FPMA 2IMOA 3PJXA 3G71S 2OYQA 2L9WA 4DUYF 1DLOB 1E6YA 1S1WB 2HFZA 2DH7A 4P7TA 1VQ5N 4Y65A 2CH5A 2P9UA 2ZBPA 2JC1A 1RZMA 1CPZA 2RKIB 2DXDA 3UWTA 1BU6O 1RT6A 3LA0A 4IOAQ 4IEIA 3GR1A 1GLLO 1EKRA 1SVDA 2XY8A 3KJVA 2PEHA 1I94F 2ZBQA 2XHCA 1TV6B 3VAHA 2RNEA 3P45B 3B8HA 1OSDA 2HMPA 4K5RA 3RBXA 5JVHL 3KLHA 2ZBRA 3DYAA 2ZH7A 2DNGA 2M5YA 4FJLA 1S22A 3H40A 2WUSA 1XIQA 3IUCA 1RAIB 4BE0A 4EI2A 5KFRA 1ZA1B 4DR6F 4IFEA 3M8QA 5HL7L 3A3OB 5CZVA 4CGGA 1O0PA 1Q78A 4PEOA 3CPWR 3JTNA 4JV1A 3UKUA 2QFJA 2G2YA 5KFYA 4O44A 1JL1A 2P2CB 3CT9A 3ILIA 4X65K 5BR9A 1K44A 5K8NA 1OSCA 2HBYB 5KFEA 3UVJA 4DHVA 1N8RT 1URNA 3B4DA 4OO1J 2KDOA 3D7SB 4QIGA 3ZCMA 4ID5A 1UP1A 4HH1A 5LJWA 1KBRA 3HULA 4JRQA 1FDNA 1JX4A 5DQIA 1NGBA 3CC4N 4HDHA 3TSQA 3LL3A 2Y0BB 4HTLA 4CZEA 4NL5A 4FF3A 2DY4A 2FHKA 5F8NA 2B4JA 2HQGA 3EJMA 3VQ5A 3SV4A 4OZ2A 3J80U 1AT1B 3BJYA 4DTJA 1SBRA 3QBXA 2XS5A 1UEUA 1OJ4A 3AJDA 1NZAA 3SUNA 1IKWB 2FVQA 1JLFA 2HOEA 2PA8D 1RT4A 3OW2R 3DOKB 5KFOA 5CZ1A 4R8UB 1NBWA 1Q7YO 1Q82O 4NYZA 1SKWA 1HYVA 3TW0A 3VQPA 3GDQA 1T95A 1XMQF 3DRXA 5JLFA 3KLGB 3LM2A 1NGJA 4Z2XA 4ZCLA 1N88A 3FUYA 3H3OB 4RUHA 2ASPA 3LDPA 2DK2A 4YOYA 3E9LA 4FXWA 2VDIA 2CKWA 2W4PA 2ZHOA 3MM5A 3QRPA 1Y3KA 1TKDA 3OV7A 1VQ8N 4LIWA 2ETJA 4ZN1A 2G0IA 1ZM3A 4NYNA 2M2BA 1N36J 2UV8A 3OHRA 3M2VB 1Q8IA 2F7VA 3KVGA 3ZEUB 2DHGA 4ECUA 3ALYA 1N5YB 2FBXA 2ZOGA 3ICLA 4K8RA 3O4QA 2KVIA 3QT8A 2XCAA 3DU5A 4FLXA 1NB2A 3C66A 4DCHA 1QVGR