1BQNA

Tyr 188 leu hiv-1 rt/hby 097
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPQKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNQQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 114
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqnA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqnA05
1S9FA 3QGIA 4Q44A 1UWBB 5KT2A 1T8EA 1DLOA 3SUPA 4HVJA 3MXJA 4CK2A 1NOYA 3Q8QB 1NK0A 1XC9A 2EC0A 2NUBA 5JS2A 4M3RA 3MFIA 3NH1A 4IG3A 1NJWA 1BHLA 1KVBA 2W8LA 4K4TA 4CGHA 1BQMA 4I2QB 4TYAA 3WNGA 4FM1A 3L3UA 1RTJA 1NKEA 2Z1HA 2W9CA 3OY9A 4KSEB 4J9QA 4FBTA 3CDWA 3AVAA 5FRNA 3GIMA 2XHBA 3H2LA 2QV6A 2G8IA 2YNFB 2FVRA 2P5OA 1R0AB 4NLYA 4DFJA 4KHWA 2AX0A 4TQSA 2QKBA 5KTQA 2Y1JA 1QS4A 3SNNA 1QUVA 4DTNA 4DQIA 3QEVA 2E9ZA 1JLEA 1HJRA 1ZTWA 3M9NB 4JV0A 3QEWA 1Z25A 4ICLA 4OKKA 3QGGA 2HNYB 4MQ3A 1RA6A 3KK1B 3CQ8A 1EP4A 2YKNB 5F8NA 3VQCA 1C1AA 4KFBA 5DQHA 2HVHA 3FDSA 1TK0A 2C22A 4IH6A 1HMVB 1S9EB 4IKFA 4Y1DA 1JXLA 4TLRA 1JX4A 4ZTFA 4FBUA 4AHVA 3AVIA 1HPZA 5T7BA 4MKBA 4ELTA 4O4GA 2BRLA 4K4UA 4B08A 1JLFA 3NF8A 2Y1IA 3DI6A 4C8KA 3CYMA 5DGAA 1ZTTA 2ASDA 1UAXA 1D9DA 1S5JA 4IDKB 3CM6A 2B43A 3AA4A 1K6YA 4ECUA 3NH0A 2RKIA 3DLEB 3QIPB 3GV5B 4CEDA 3NF7A 1JKHA 4GMJB 3H5YA 3OJSA 4J9PA 5KGWA 4CF8A 5HROB 4NLRA 3KMQA 1EX4A 3L8BA 4G1QA 3NE6A 4ED7A 4DS4A 2IMWP 1ASVA 1J53A 5KFEA 3RBEA 4Q43A 5J2MA 1YT3A 2XCPA 3LP1A 1RYRA 4NYNA 3K5NA 4M3UA 4KHUA 2OYQA 3VQ9A 4KB7A 4ECXA 3ZSYA 4CECA 1DLOB 3D0PA 4FJIA 4EBEA 2W9BA 2KTQA 3QNOA 3OVNA 4Z4EA 5DQGA 3LP0A 4IG3B 2R2RA 3B6OA 4FVMA 3KLEB 4F4YA 4TY8A 1UA0A 1JXEA 3VA3A 3AA2A 1RT4B 1RTJB 2W9CB 3CFRA 2AX1A 2D3UA 3TABA 2HB5A 2IA6A 4ECRA 4NLOA 3M8QA 4FW2A 4DLEA 1DTQA 1RYSA 1RT5B 3I5AA 3TWHA 4CJUA 1D5AA 3VQSA 3OL6A 3O4NA 2O5DA 4DMNA 2BRKA 4DU4A 5J2QB 4KTZA 4E7JA 3OYEA 3ULDA 3AO2A 3DRPA 4J2BA 1QE1A 4KREA 3O3GA 3ZT0A 2GIQA 1VSKA 2VWKA 2AGQA 1JLEB 2YNHA 3VQPA 1HQEA 5I42A 3AVJA 4RW6B 4ICLB 4RW7B 1QAIA 1GOCA 3OYFA 4KI6A 4YQWA 4DQRA 4WFXA 4BDPA 1U45A 4KFBB 3U3GA 3UR0A 4DU3A 2ZQBA 3ZSRA 4ECTA 1TV6A 3PW4A 5KRTA 3NMAA 2JEJA 1JXBA 4DTMA 3ZT4A 4ZVEA 3RMCA 3JSMA 2P51A 1RBVA 4H4MA 3DLRA 4ED8A 1SH2A 4RW9A 1JLFB 3H4DA 2XY6A 4Z4IA 4ELUA 2V9WA 4J2DA 2YNGB 4IKAA 3MEDA 3AVGA 2XY5A 5K14A 3H08A 1NKCA 2XCAA 3EZUA 2RKIB 4JRPA 2ZKUA 5FRMA 3KD1E 5DQIA 3NGYA 4DSLA 4OKJA 3RMDA 3CJ0A 3DLBA 3HKWA 3C95A 3VN5A 2AWZA 2IM0A 4C8NA 4G1QB 3GILA 4O55A 2YKMA 3OHBA 3SFUA 5L9XA 3QESA 4FCYA 3ZT1A 5J2MB 3BR9A 3NAEA 1C2PA 3CJ3A 1BCOA 4NCGB 3V4IA 5FROA 3ZSOA 3QZ7A 1JLCA 4NZ0A 4FK4A 3LPTA 3ZT2A 1QAJA 5J2NA 4J2EA 4CGDA 3MR6A 3LP0B 3S3NA 3TAQA 4MFBA 2AGOA 3V1RA 3HP6A 4TY8B 3TARA 5KFKA 4J9OA 3KK3A 5KG3A 4J9KA 3ISND 5KFMA 5L1JA 3HVTA 2OZMA 3DRSA 1KVAA 1S0MA 1B9FA 3N6LA 4DTSA 2WONA 3HM9A 4FM0A 2VG6A 4MKAA 4E7LA 1WSEA 1YTAA 4J9NA 1VRTA 2WHOA 2Z1JA 2OH2A 1RT3A 3B6PA 3ZSVA 2BQ3A 4TSXA 4LSNB 4TN2A 4ED0A 3PR4A 3SUQA 4ED6A 5KFAA 1TK5A 1SL1A 4O0IA 1BL3A 5KFVA 1QE1B 2HAIA 3HHKA 4CJ5A 4AHSA 2XO7A 2G8VA 4MIAA 2YNHB 3V9SA 1WSHA 3C6TA 1HQEB 5I42B 3NFAA 2DTUA 4NLPA 4CJ3A 5KG6A 5KFFA 2FJWA 1S9GA 3QETA 1XWLA 4QWBA 3HJFA 3MEEB 3KJVA 4NLQA 5F8JA 5FDLA 1TV6B 4Q45A 2BE2B 4W5RA 4HKQA 2BR0A 3KHLA 4ZMMA 3L2RA 3JSMB 4FK0A 3VQ6A 4H4MB 1LV5A 2KFNA 3M8SA 1TAQA 4RUAA 1UOCA 3DOKA 4RW9B 3WNFA 4DTPA 2R2UA 4QW9A 4PQUA 3OJUA 4DS5A 1QTMA 4E7HA 1Q8IA 1MU2A 4Q5VA 3MEDB 4HCBA 5K14B 2IJNA 4AH9A 3RRHA 5SZTA 1D8YA 3OYCA 4CK1A 4LH4A 3S9HA 4QOZB 2FBYA 1JLBA 3I0SA 1TKZA 3N6MA 4Z4FA 5KFLA 3ISNC 3KD5E 5C25B 1KCFA 3CJ5A 3CIZA 4HYKA 4F8RA 2HWIA 4FLUA 5EUHA 1RT7A 1IG9A 2FC0A 1N56A 1HQUA 2EHGA 2YKMB 1ITGA 1CZ9A 1RTIA 4KHQA 5F9NA 3KOAA 1QQCA 2FJXA 4TQRA 4LH5A 2WK4A 3KLFA 2IC3A 1GOAA 4G3IA 4KHNA 3WNHA 3RR8A 5J2NB 3VA0A 3DM2A 3FRZA 1ASWA 4F3OA 3LZJA 5KG5A 5KFPA 1N5YA 3SV3A 1ASUA 3IGNA 3KK3B 3HVTB 3H40A 5D3GA 4AHRA 4QWDA 1VSLA 4KV8B 3OYAA 4F50A 4CHYA 5E41A 5J2PA 1SKSA 4RW8B 1C0UA 3AVHA 1SUQA 5CYQB 1WSFA 4UQGA 4KTQA 3I5BA 3ICLA 1X9MA 3VQ8A 2WONB 2FVPA 3V81A 1RCHA 5EWEA 2XI2A 2VG6B 5C5JA 3SPYA 2RN2A 2JLEA 1T7PA 1VRTB 2OPPA 3NH2A 1X9SA 5KG4A 3GYNA 4ZP8A 4ZPBA 4B9LA 4KKOA 5HLFA 3S3MA 4ID5A 3DOLB 4ECQA 3SYZA 5J1EA 4IFVA 3Q8SB 1FKOA 3SV4A 3JYTA 4NLWA 1IH7A 2ILYA 4FJKA 2OPQA 1S1UA 2WCXA 2D0BA 3KJVB 5HP1A 5FDLB 4BE0A 1D9FA 4RNHA 3H5UA 4YP3A 4EP5A 3F9KA 3KKSA 4W5NA 3L2WA 1NHUA 3V6HA 3BGRA 1LW2B 3NL0A 5CYMA 2V4QA 4J9SA 3LZIA 3AA5X 4FYDA 4K50A 2ATLA 3DOKB 1L3VA 1JLGA 4PQUB 2G8KA 3CDUA 2X78A 3KHRA 4NYZA 2JEFA 2QKKA 2IAJA 4WXOA 1MU2B 3E01A 3HYFA 1C0TA 3O4QA 4HCCA 3V6DB 4CF1A 4OL8A 2GIRA 1JLBB 4H8KA 3HPOA 3I0SB 1TKZB 4KHSA 3VQBA 4IFYA 3HVWA 1OS5A 3CFPA 3NHGA 2A1SA 3THVA 4PWDB 2DFEA 4KPYA 2JEIA 2RPIA 4J9MA 1J9AA 3QIOA 1RT7B 1HNIB 4BACA 2A1RA 1HQUB 2KW4A 1RTIB 1A5XA 1BGXT 5KG2A 4HUEA 1ZBHA 2JEGA 2YHAA 2B4JA 1CXQA 4JV1A 3SJJA 3AVFA 3LP3A 2DFFA 3Q8RB 1U4BA 1VRUA 2HHXA 3DM2B 3DDKA 4CERA 3PHEA 4BDYA 3GIIA 3OLBA 2ASJA 4EZ9A 3H5XA 1KFSA 1WSIA 3FQKA 2W7OA 3OYGA 4KRFA 5KFDA 3H4BA 1LWFA 3NCIA 2RDJA 5J2PB 3HP9A 4NLSA 1SUQB 3L2VA 3VQ4A 2E6MA 3ZT3A 3V81B 4GC6A 1CZBA 1TQLA 4EP4A 1NK7A 3OSPA 1SV5A 1KSPA 2OPPB 4N47A 1RT2A 1LWCA 3HPHA 3Q8PB 1RDBA 4ED3A 1C1CB 4KKOB 5HLFB 1Z26A 4ID5B 4FJHA 4CJQA 4NLUA 3TI0A 5J1EB 4JV2A 1I6JA 1XR6A 2WOMA 5KT3A 3P1GA 3I0RA 1K1SA 3RAXA 1RTDB 3ALYA 1T05A 1IKXA 1FKOB 2R2SA 4YFUA 3JYTB 4K4VA 1NJYA 3KHGA 4J9RA 4OGEA 4DG1A 3FFIA 2OPQB 1S1UB 3L2QA 4CFDA 3V9UA 5F8GA 1GX6A 1KLMA 3RB3A 2YNIA 5HP1B 1SKRA 3KTQA 4QW8A 4E1NA 3LWMA 2KZMA 3NKYA 4DQSA 4FJ8A 2RF2A 4Y34A 3OL8A 1TKXA 4KHRA 3KLIA 3BGRB 5KFOA 1L3SA 1IKVA 4EBCA 2BGGA 4FLZA 1JLGB 3G0ZA 4IOBA 4QWCA 2W7PA 4ZP9A 3TR8A 2IAJB 1SH3A 5F8HA 4DSIA 3SQ4A 3E01B 3CM5A 3G10A 3PX0A 1XR5A 4C8OA 1C0TB 1N6QA 2HHSA 5KGXA 5JUMA 3BSCA 1U48A 3PW2A 3RR7A 2VA2A 3MXMA 3RMBA 3PW7A 4DQPA 3D5MA 1ZBFA 3AO5A 2ITGA 2R7YA 1BQMB 4IFYB 2ASLA 3PUFA 1HYSA 1JLAA 4ZPAA 4CJVA 4Z4GA 4C8LA 2WB4A 1L5UA 5KFTA 4DSFA 2V0NA 3ASMA 3O3FA 3NGZA 3P5JA 2FLNA 3IS9A 4DSKA 1XR7A 1LWEA 4BE2A 4QWEA 5KT6A 3BJYA 2PYJA 4ECWA 1HNVA 4O3NA 1VRUB 3G6VA 3ZCMA 2E4LA 4I9LA 3HVRA 4YR3A 3QINA 1Z4UA 4ZHRA 2P5GA 1IKYA 1FKPA 4H4OA 5KFRA 4O3RA 4YNQA 4BWMA 3EPIA 2IOCA 4ZVHA 2VA3A 2FBXA 1EP4B 1TK8A 2DY4A 5KT7A 4MK9A 1LWFB 4DL2A 5KFWA 4OKEA 4AHUA 3C94A 4M3WA 1S6QA 4YMEA 4ZP7A 4RNNA 4B9VA 4CEOA 3HO1A 5KT4A 2ZD1A 3M9MB 1SV5B 1HPZB 4M3TA 2QK9A 4O4GB 1RT2B 1LWCB 4HHTA 4Q8FA 3U6FA 2IGIA 1N4LA 4DL3A 4DL4A 1VSDA 4K4ZA 5KFBA 4AILC 3K57A 4QCLA 3DI6B 4EYIB 2E9RX 4OGCA 3V6KA 2HMIA 4ED1A 3GQCA 5HRNA 2VG7A 4NLTA 2UUTA 2WOMB 3I0RB 1IKWA 3OS1A 1T05B 3C6UA 3OYMA 3KK2A 5KFSA 1I3AA 2D0AA 1JKHB 2CKWA 3V6JA 3K5LA 2E6LA 4EZ6A 4DG1B 3FFIB 5C24A 3DYAA 4FJLA 1KLMB 4FLWA 2YNIB 3F73A 4CCHA 1J5OA 1TKXB 2FLLA 1JL1A 3KLIB 4CHZA 3QERA 4EO8A 4FLVA 2HHVA 1TAUA 3LP1B 4NLXA 2OPRA 4DTUA 1CXUA 4Q0BA 4F4KA 4DEZA 3D45A 4CF9A 4IRDA 1REVA 4IR1A 2ATQA 1S1TA 4LQ9A 1L3UA 4URQU 4IR9A 1N6QB 1W25A 4RZRA 2I5JA 2W9BB 2HW3A 5KFGA 3MXIA 5DG9A 4CJKA 1S10A 4BE1A 3IAYA 5I3UA 4CJEA 5KG1A 3MECA 3OLAA 1RDRA 4N56A 1HYSB 3QLHA 4MK7A 1JLAB 3TAFA 4Y1CA 4W5TA 4DSJA 3AO1A 3V9ZA 1SKWA 3M8QB 2P1JA 2XRIA 4F2RA 4M3YA 1DTQB 3DLGA 3LAMA 2X6NA 1LWEB 5KFIA 4F4ZA 2YV0X 3KLHA 4CIFA 4U6PA 2XGQA 4M94A 3G6XA 4B3OA 4DFMA 3DRPB 1S0OA 3UPFA 4O3OA 4ZHRB 2PZSA 4EEYA 1TVRA 1VSIA 1IKYB 2CJQA 1FKPB 4KE5A 3TAPA 4H4OB 3AVLA 4FS2A 2UVRA 1S1XA 1VK0A 4JRQA 1WNSA 4JS5A 4K8ZA 1WSGA 2XY8A 1ZETA 1XHXA 1S6QB 4NRTA 3T5HA 3OYDA 4QWAA 2ZD1B 4FLYA 1C6VA 3TQ1A 3AO4A 4FJ5A 3S3OA 1TGOA 5C42A 5L1IA 3KMSA 4RW4A 4KTWA 3IN5A 2LSNA 2VG7B 3KNAA 2FVCA 3HXMA 3QGHA 5EU7A 3C6UB 3SQ1A 3KK2B 2XC9A 4E3SA 4ZVFA 4WZMA 1UWBA 1U04A 5JXSA 5C24B 3DYAB 3VQEA 3UDLA 5DLGA 2G8UA 2AQ4A 3LP2A 2XWYA 1C0MA 3V1QA 3T5JA 3CJ2A 3IGVA 2WRMA 4I7FA 4CGIA 4RNOA 1J5OB 2O4GA 3ITHA 2W8KA 2J6UA 3K58A 4CHNA 4B9TA 4FS1A 2C28A 4HUGA 4CIGA 1XI1A 2OPRB 2FBVA 4FK2A 3V4IB 5EDWA 4QAGA 4Q0BB 5EWFA 4OVLA 2ILZA 1RDCA 1REVB 1JLCB 3HL8A 1S1WA 1S1TB 4CJ4A 1S49A 2FVQA 3HT3A 3NBPA 4PA1A 1R0AA 5EWGA 2IM2A 4MFBB 1K1QA 5I3UB 2E9TA 3H5SA 4NLDA 2GC8A 2Q3SA 3MECB 4RG8A 3QLHB 3QIDA 3DRSB 4M95A 3OYNA 3T1AA 1NK5A 4URSA 4K8XA 2IJFA 3SCXA 3VQ5A 3PO5A 4K4YA 4CJPA 2UVWA 3MR3A 4FJNA 3LANA 1WAJA 1NOZA 2W9AA 3IRXA 1RT3B 1B9DA 1BQNA 4E7IA 1NNDA 4DFKA 3KLHB 3BQ0A 4AHCA 4ZVGA 1A5WA 1W0HA 4B3OB 5HBMA 2R2TA 4DL7A 4PY5A 5CZ2A 4KAIA 2IDOA 4Y2AA 3OL9A 4CJFA 3C6TB 1TVRB 2FJVA 3AV9A 4XPCA 4IG0A 1SL2A 3NF6A 2X74A 2DPJA 1S1XB 5DG8A 1S9GB 3L2UA 2D7SA 4J2AA 1RDDA 3MR2A 3OYBA 3KHHA 5HRRA 5CZ1A 4F2SA 4NLVA 3MR5A 1KFDA 2HVIA 3CWJA 2OZSA 1W9HA 4ECVA 5C42B 4XIUA 3DMJA 4RW4B 5KG7A 3QEPA 2HNZA 3G6YA 1FK9A 3NGIA 2AGPA 4WYWA 2D0CA 5KRSA 4O3QA 3HK2A 2EX3A 5HRSA 2QXFA 1KHWA 2HHUA 2G8WA 4C8MA 5DK5A 3KLGA 3IG1A 5KFHA 2JGUA 4R0EA 3NAIA 1QHTA 5JS1A 3DLKA 4DF4A 3LP2B 3SFGA 4DQQA 3P83D 5L1KA 1RT6A 1C1BA 1RBTA 4I7FB 3U3YA 1VSEA 4LQ3A 3ITHB 1TKTA 2W42A 4ZPDA 3NAHA 5T14A 4LSLA 4KB1A 3KLEA 3HPGA 2F8TA 4CE9A 4CHOA 3K2PA 3MTKA 1VSJA 3SQ0A 1NJXA 4ZP6A 3KLFB 4IH7A 1RT4A 3LPUA 2IC3B 4RNMA 4H54A 4Z4HA 3PX4A 1KRPA 3NDKA 3AO3A 1S1WB 4DTXA 4CJRA 4KHYA 4CEBA 1VSFA 3SUOA 3CVKA 3E51A 5DG7A 1SL0A 1IM4A 3NBPB 1G15A 3PR5B 5KFXA 1Q9YA 3SZ2A 1RT5A 2G8FA 1S0NA 3QZ8A 1X9WA 1N5YB 2Z1GA 3QYYA 4AHTA 2R8HA 2C2RA 4KO0A 4FJXA 1B92A 3TAMA 5D3GB 4O0JA 5J2QA 3BSNA 3OYHA 4CHPA 4E1MA 1C0UB 4RU9A 4RW6A 2GBZA 4CK3A 5KI6A 4RW7A 4E7KA 3SQ2A 3CG7A 3OYKA 4FJ7A 3IRXB 3KIOA 1BQNB 3TANA 1YVFA 4ECZA 3GIJA 1Q9XA 3ZSQA 3L3VA 5HBMB 4WYLA 4O4RA 1BISA 1JIHA 4J9LA 4IFVB 4N76A 1RT1A 2UVVA 2IBKA 4XO0A 1NHVA 4IQXA 3MEGA 4IG0B 2C2EA 1U09A 4DTJA 3ZSXA 4B9NA 3BREA 1WAFA 3PO4A 2Z1IA 1YVUA 1D0EA 4EBDA 4DFPA 4WE1A 4KBIA 3DRRA 4ZTJA 1KHVA 3H59A 2YNGA 3T5KA 3RBDA 1IO2A 2D3ZA 2R8KA 3TAEA 4R8UA 1EETA 2R8GA 5CYMB 4IRCA 1RDAA 3EYZA 4JS4A 2BQUA 3EY1A 4CJLA 1RTHA 4FW1A 4YR0A 3DMJB 2RDIA 3OHAA 2HNZB 1FK9B 1RILA 4B8AB 3I8DA 4FZYA 2KQ2A 2JC0A 1TL3A 1LAWA 1YTUA 3LAKA 1F21A 3N6NA 4URGA 5KT5A 3H98A 1T3NA 1S1VA 5KFQA 1BIZA 3KLGB 3IG1B 4F4XA 4NCGA 5KFZA 3CJ4A 1BI4A 4E89A 3DLKB 2WTFA 4Q8EA 2XGPA 3K59A 3PV8A 2VG5A 4XPEA 4CF0A 1KVCA 1RT6B 1C1BB 1EXQA 4FXDA 1LAVA 3G86A 4E19A 3LALA 1TKTB 4DTOA 4LSLB 3K5OA 4M41A 2OA8A 3AVMA 4NRUA 3V9XA 2FBTA 4FJMA 5KFNA 1DTTA 2OPSA 4I9QA 1L3TA 3WNEA 3PZPA 2I1RA 1NJZA 4DL6A 3A2FA 1U47A 1KLNA 4U7CA 4K4XA 3HSTB 5KFJA 4L8RB 3TAGA 3AVKA 2UVUA 4FJJA 3BQ1A 4LSNA 4KO0B 2HNDA 2PYLA 4CJTA 3TAMB 1S48A 4W5QA 3K5MA 3PW0A 2D5RA 4KAZA 1CSJA 1S6PA 3GV7B 4OLBA 4CGFA 2X6SA 4WFZA 1RBSA 4GW6A 1T94A 3FSIA 2HWHA 3PVXA 4BWJA 4HUFA 1HRHA 4IH5A 3NF9A 4TYBA 2FVSA 2IM3A 4FJGA 4QPXA 4K4SA 2GV9A 3M8PA 3MEEA 1NK4A 2DFHA 2BANA 4BDZA 4NYFA 3GIKA 4K4WA 2BE2A 1ZBLA 4W5OA 1RT1B 1GX5A 1FXXA 3QEIA 1NK6A 3MEGB 1IKXB 3RAQA 3RMAA 3SUNA 3T3FA 3T19A 2C2DA 4LD0A 2D41A 1RAJA 1U49A 1VSHA 1BIUA 5KFYA 4CFAA 4WE1B 3V1OA 4B9SA 3DRRB 3PJXA 2QE5A 4M3ZA 2RF2B 5HRPA 4R8UB 3CDEA 1QSLA 1S4FA 1EETB 2ALZA 1IKVB 3M9OB 3VQDA 2F8EX 3AA3A 4OPKA 2HHQA 1RTHB 5C25A 3UQSA 1LW0A 1RA7A 4ID1A 4KI4A 4YR2A 1TP7A 1ZYQA 2DPIA 4GVMA 3TVKA 4Y3CA 3SPZA 2XY7A 4ED2A 1HYZA 1TL3B 4ZPCA 4IBNA 3BSOA 1WSJA 5F8IA 1RBRA 4M42A 2ZE2A 1S1VB 5KFUA 4RUCA 1BI4B 1CLQA 2VG5B 2IM1A 4Y2CA 3LDSA 4FLTA 4R5PA 3DLHA 1NK9A 5DGBA 3OSNA 4M3XA 3M8RA 2F8SA 5CY4A 4ECSA 4FZZA 3IS9B 4DTRA 3I5CA 3OYLA 4OPJA 4OLAA 1DTTB 2OPSB 4KV8A 2V4RA 3BSAA 1HNVB 5DLFA 1N48A 3PX6A 2KZZA 4FM2A 4RW8A 5CYQA 1WLJA 3VQAA 4O3SA 3T5LA 1HARA 5KFCA 1S97A 1XHZA 4DLGA 1QSSA 4FZXC 1NK8A 1X1PA 3MF5A 3MAQA 1A5VA 1J54A 2HNDB 4KHMA 1MMLA 3BDPA 3BQ2A 4CEFA 3DOLA 1D1UA 4CIEA 5DMRA 4HTUA 1S6PB 4DF8A 4CGJA 3QO9A 2B6AA 4TXSA 4EYHB 3KLVA 1T03A 2JC1A 3RB6A 2B5JA 4MIBA 4CFBA 2HHTA 3ZSZA 4M45A 2UUWA 4O44A 2GUIA 4PUOA 4EO6A 4OJRA 4KB0A 2XI3A 3M8PB 2J6TA 3V9WA 4DSEA 3QEXA 2BANB 5F8LA 1JLQA 4CJWA 4X2BA 3QNNA 3UIQA 2HMIB 4I2PA 2AJQA 4CEEA 4WFYA 4CGGA 3CFOA 2HHWA 3EPGA 1TL1A 1LW2A 1IKWB 3OS2A 4CESA 3RB0A 3VQ7A 4LY7A 3LWLA 3OL7A 3PW5A 1SH0A 4NCAA 4B9MA 1VSMA 2PY5A 4B8CA 1TKDA 3PJWA 1ZBIA 3V6DA 3OYJA 2AU0A 3AVCA 2VWJA 2FLPA 1WNEA 4I2QA 1KTQA 4MH8A 1HYVA 4O3PA 1LW0B 4PWDA 5KG0A 4ECYA 4N41A 4DL5A 1HNIA 1RBUA 1UA1A 2I5JB 4IRKA 4JUZA 2J6SA 3RB4A 2BDPA 4F3TA 2YNFA 2R8JA 2IS3A 2ZE2B 1ZBUA 3SI8A 4CEQA 4MK8A 3O3HA 5F8MA 4R5PB 3RTVA 4NLGA 4F4WA 1GOBA 5F9LA 3KKRA 4CEZA 3DLGB 5L1LA 1EKEA 4TY9A 4CF2A 2HNYA 3KK1A 4Z0UA 4DWIA 4RNFA 3OS0A 4CJSA 2YKNA 3RWUA 4CHQA 1I39A 3VQQA 1HMVA 1S9EA 4CEAA 4DU1A 3HVAA 3ZSWA 3GV8B 1BCMA 3EZ5A 4NCBA 1WN7A 4JLHA 4Z4CA 3MFHA 2BQRA 2YHBA 2G8HA 4B9UA 4FJ9A 3SI6A 3AVBA 1C1CA 4N5SA 4E0DA 1NKBA 2O4IA 3NGDA 3PY8A 3QO9B 2B6AB 4IDKA 1O1WA 2KFZA 1Y97A 1RTDA 5SWMA 4CFCA 1T03B 3DLEA 3QIPA 2B5JB 3D28A 3AVNA 1RNHA 3RRGA 2R8IA 4O44B 3FQLA 4O5BA 4GC7A 4PUOB 3OYIA 2ETJA 1JLQB 5HROA 4I2PB 1QSYA 2F96A 4WXWA 4FLXA 1TL1B 4WZQA 4ELVA 3CO9A 1JL2A
chains in the Genus database with same CATH superfamily
5GAGI 2QGFB 3MCOA 1UWBB 5DDPC 4ILLA 2HK3A 4HVJA 2VYPA 2O8FA 1NOYA 1VDHA 3Q8QB 3JQJA 1NK0A 1YZ7A 5H9FJ 3OUYB 1XQSC 4QJVA 3MFIA 1KVBA 3VHQA 1JCGA 1BQMA 4TYAA 5D78A 3ILOA 4FM1A 4DR2J 4A8YA 3W5XA 1WHVA 1U6BA 4JEPA 2DYAA 3OY9A 1VYAA 4J9QA 1RABB 2XHBA 4I1TA 3DC2A 3DU5A 3OA9A 5BN9A 2BXJA 5E3QA 4TNOA 2IRUA 1YJ7A 5KTQA 1KBRA 2Y1JA 3EVOA 3FFKB 3B54A 2P9IB 3VTHA 2V8VA 5THWA 1Z25A 1NM1A 2F4VJ 4BRHA 2C3YA 1T6CA 2EW9A 3VGVA 3KK1B 1EP4A 3T1YK 1LQ9A 1C1AA 5DQHA 2Q31A 4B3TK 4PEOA 2V67A 2C22A 1OIAA 1S9EB 4IKFA 4WFAL 1JXLA 2BUNA 1B70B 3ENQA 1WTFA 4MKBA 3ZEUB 4O4GA 2LLZA 4LBPA 1GLAG 4A8FA 2QMUB 3AOAA 5AFUH 3THWB 1HNZJ 3O08A 2BUPA 2FGCA 4B1ZA 3D1OA 3CD6N 4M5IA 4NXNK 2RKIA 3N4WA 3NF7A 4CO4A 3BBCA 3BEGB 5D0GA 1X5SA 2GX8A 2C1EB 2AYGA 3AY9A 4JI6K 5KGWA 2ZVSA 4A47A 5HROB 4DHYA 1ZBTA 5ITHA 4BLGA 4G1QA 3RSEB 3NE6A 4ED7A 2YWGA 1ASVA 3UW1A 2MQLA 1RWVB 3SEOA 5C12A 1RGVA 5DETA 1CS4B 1YT3A 4A8KA 2AP6A 3LP1A 4CO3A 1SIWB 4NYNA 1OY9A 3VQ9A 2LMIA 1VQ4S 1YJTA 2O8FB 4FWSA 2RQCA 2W9BA 3QNOA 4USVA 1R8BA 2AJ4A 3I56N 4OI0A 4J8FA 4BCAA 2EG2A 4FVMA 5AQXA 3ETMA 2OJ3A 1CJVA 2HS3A 2E88A 2YJEA 2GA7A 3TOQA 3ZNJ1 2HWTA 3RRKA 4DV3J 2AX1A 4USUA 2ZM6F 2WSEC 3TABA 2M7SA 2W6KA 2VJUA 4ECRA 1FTRA 1HHTP 4FW2A 4BBYA 4DR7J 2R7VA 2DK2A 1D5AA 3O4NA 5D0HA 5DZ6A 4DU4A 3DRPA 1QE1A 2VWKA 4OQJA 1D9AA 5AJ3J 2ERRA 2AGQA 2YNHA 2ATCB 4BRCA 4RW7B 1B99A 2NXJA 2EVZA 4AL7A 2QN6B 2D3O1 4BC5A 4WFXA 4LF9F 1U45A 2BM0A 3IAS9 3U3GA 4YORA 3PW4A 3ZZRA 3B78A 2GQCA 2HG4A 3R9LA 3J81O 3CPWM 1RBVA 4H4MA 4RW9A 3H4DA 1KAYA 1RQ0A 2XG8A 3PLAA 3M4XA 4J2DA 2XY5A 3BM7A 1FXRA 3WXLA 1NKCA 1FRMA 1NLKL 3EZUA 4USWA 2RKIB 1SJ4P 5FRMA 5DQIA 3NGYA 1CJTA 3RMDA 2EBEA 4CLWA 3DLBA 2F5GA 3H90A 4G1QB 2HYIB 4PXBA 1D09B 3OHBA 4E1JA 5L9XA 4FCYA 4DR7F 4YHHK 4BR2A 3N0VA 3CETA 1C2PA 3V4IA 2YY3A 2K7KA 1T9XA 5F2RA 2MLYA 3ZT2A 4RL1A 3ZZUA 1ZH5A 4CGDA 2HFVA 3MR6A 3CCQS 3TAQA 2PE8A 3U4LA 2ABYA 4OHXA 4XEIA 4PG7A 1CJVB 5KFKA 1DBDA 1KVAA 3QT6A 3O9QA 2GCFA 3PG9A 2KXFA 2JVOA 4DU8A 1UFKA 2UV8A 3R5CA 4DTSA 4MKAA 4JHDA 4J9NA 2B3TB 1VRTA 2M8HA 2Z1JA 2J8AA 3DXKA 4TN2A 3EX7B 5A6WA 4AE5A 3UCZP 4O0IA 4G1PA 2FJEB 1PAEX 1QE1B 1Q82O 1GLDG 2XMWA 3MCMA 2YNHB 2GJ2A 4MIAA 3O5BA 1WSHA 3C6TA 1OKJA 3CJKA 4I56A 2QLWA 2AJ0A 3LH2S 1S9GA 4LIRA 3QETA 4KYZA 4QWBA 3HJFA 1X5TA 5FDLA 3P49B 5CD4A 4IDHA 2WVCA 2BE2B 5LJ5Y 3QWUA 3CCLS 4WQ5C 2KHOA 3S01A 4FK0A 1U25A 2VFRA 3DFEA 4H4MB 4K41A 1ILYA 3KG0A 4RW9B 4PQUA 1SBRA 4DS5A 1WKKA 1YRUA 4BC7A 2JWNA 2MEWA 3H20A 2KHDA 2Q36A 3CC7S 2VOOA 4HCBA 1FF2A 4AH9A 2M5YA 3C16B 2XWXA 2IIRA 4JI3K 2JWKA 2B9XA 2P6SA 3OYCA 4BG9A 1CJTB 4JK8A 4QOZB 2LDIA 4DV0K 2LU1A 1RBOB 4M63A 4BRDA 2R7WA 3FGUA 1KCFA 4HYKA 4F8RA 4KGKA 4FLUA 3K5PA 2FHMA 3CXCR 1XMBA 5B7WA 2CQ4A 1HQUA 2RUSA 2ASPA 1CZ9A 3VAKA 3GJRB 3CCMN 2NCKL 3P3DA 1HW9A 3KOAA 1RBLA 2ZFHA 4LH5A 3SQGA 3E3XA 5HQMA 2WK4A 1I51B 5KQ8A 2ROEA 2VPXB 1RP5A 3CCRS 4FNHA 4RLEA 1DJ0A 3VESA 2BKOA 4F3OA 4QYZJ 3OQ2A 5H9EJ 2YX4A 2DHGA 4O23A 1ASUA 3QRPA 4OYIA 2OSRA 4F50A 2IDLA 2A6OA 1SKSA 4RW8B 5CYQB 4KTQA 2UXBF 3ICLA 1RCHA 5C5JA 1HUXA 2KKZA 4JHDB 3LGNA 4RU2A 4FWKA 1VRTB 3NH2A 1X9SA 3ZZ0A 1PBUA 3P96A 3GYNA 3DXKB 4ZPBA 4UOFA 4ID5A 4QBUA 5J1EA 3Q8SB 1DQAA 2A18A 2I7NA 3CJKB 3SV4A 4B3RK 2GNKA 4FJKA 2MZTA 2WCXA 4DZDA 5FDLB 4BE0A 3W9JA 4GNIA 6FD1A 4M5LA 4Y00A 3D7SB 1RWWB 2BH1A 3OXLA 2EBGA 1V3RA 1LW2B 3NL0A 4CD3A 4FPBA 2EK1A 4FYDA 2Z30B 2Z57B 4P75A 1JLGA 4PQUB 1Q86T 4P9SA 2G8KA 4OIXA 4C3MA 3KHRA 4NYZA 2JEFA 2EFQA 2QKKA 3TYTA 3MMAA 5SUHA 3O4QA 1URRA 4UZBA 3ENBA 2B8PA 4YY3K 2P9EA 1BG3A 4OL8A 3O8MA 4IFYA 2UUAK 4KY3A 3JSYA 3VF2A 3GG4A 3EICA 2WZ1A 2DGVA 5D15A 1V4SA 2E1ZA 3MM5A 3Q7CA 1N54B 3EM1A 4KQZA 1HQUB 3C65A 2KW4A 4DV7K 3C46A 4DR5J 5HL7L 1YJNS 1BWEA 3SQGB 4WF9L 1FWPA 1ROFA 2NYIA 3NCPA 2JVRA 2BA9A 2XB2D 2YHAA 1CXQA 4JV1A 1HLUA 3ULEB 3AVFA 5CYJA 2HHXA 4G9ZA 3DDKA 3PHEA 3P31A 1RZMA 3OLBA 2E1AA 3NGUA 4DUZK 5CA5A 2W7OA 5KFDA 3GJSB 3KDNA 2GFFA 4CBXA 2J0QD 4OYPA 1FFSB 1CZBA 4M5GA 1TQLA 3T1HF 3OSPA 4LF7J 2W6LA 3R6MA 4N47A 3QFUA 5AQQA 2DNOA 4B1UB 2DNPA 4KGXB 4ZVPB 4ID5B 1RU2A 4FJHA 1S76D 4NLUA 4EWTA 5J1EB 3HSGA 1I6JA 3LQVA 5A76A 1XR6A 2MSTA 3RAXA 3ALYA 3QFPA 1R0CB 4YFUA 2DGTA 3ZXWA 4DG1A 4KH6A 1GX6A 1KR4A 2HF4A 2YNIA 4QW8A 4E1NA 2KZMA 4FJ8A 3I31A 3J7YI 4KHRA 3VQTA 1L3SA 4DR5F 2L9WA 3KG4A 2CPEA 2HHHJ 1JLGB 4QWCA 3QBXA 4GKJK 5B09A 4IQMA 5CH7B 1MW7A 4U7BA 3CHWA 3TR8A 1CC8A 5F8HA 4BC3A 3CM5A 4YDXA 4C8OA 3RU0A 1N6QA 2HQIA 2BW2A 3GJQB 4DV2F 3MMAB 4DX6A 3BSCA 1K8AT 3C66A 2QLFB 3MN5A 1ZBFA 2R7YA 2QLXA 4IFYB 1ESVA 3PUFA 4N8OA 2EWSA 3ZX2A 4A59A 4Z4GA 3MM5B 5C0YA 3J81U 1YQHA 2FLNA 4LFBF 4OHWA 3BS9A 1WG5A 1XR7A 2V68A 3O9TA 1H73A 4KGMA 4WQ4A 3A3OB 4EHUA 1FEHA 3VGMA 4BY9C 2FHJA 2CPYA 5EGYA 1FKPA 3F56A 4H4OA 3EPIA 2H4YB 2IOCA 2VA3A 2FBXA 2DY4A 5KT7A 1M0SA 5GAHU 2VUGA 4M3WA 3PEJA 1S6QA 1VQPN 4B9VA 2CXEA 5D4NA 4DV1J 1GLBG 3M9MB 1HNWJ 1HPZB 2HRYA 1BU6O 2CWKA 3U6FA 2DHSA 3WC2A 2HHHF 4DL3A 1M5HA 5KFBA 2L41A 3K57A 2GHWA 4F0KA 3V6KA 3GQCA 3O44A 3A8YA 1IKWA 3OYMA 4IO1A 2CKWA 3AD8C 2OCEA 2E6LA 4DG1B 2M2BA 3R3TA 3CB4A 4FJLA 4CLFA 3R2DJ 2JOQA 3A0IX 2YNIB 2NRHA 2G2YA 1RSCA 4DV4J 4UQTA 1F5AA 1MLAA 4CCHA 4IJAA 1J5OA 3M6WA 3C3LA 1N5SA 2JFDA 1HWIA 2P9UA 3CMEN 2OPRA 1N52B 1CXUA 1OSDA 5LMUJ 1GLEG 2F9TA 4IRDA 1NSKL 1L3UA 1N6QB 1OVQA 2O3DA 1VQ5N 2CQHA 1IJFB 1S10A 2V34A 2Z56B 2RUGA 3CERA 3GIRA 3FSYA 4DCOB 1Q8KA 1RDRA 2AF6A 3QLHA 4CZIA 1HPMA 2CJAA 1Q78A 1FHTA 3D0GE 2ZDOA 3V9ZA 4MTPA 3AB4B 3JB9k 5ETTA 3M8QB 4F2RA 2UUCJ 5GADP 2IFXA 4X64J 1K0TA 2UXCJ 1YLXA 2CDRB 4U6PA 5IWAK 1SC6A 3MHYA 4QR0A 1UVMA 4YDUA 5HL7Q 4BRLA 3PTWA 4L3NA 1B4SA 1TVRA 2CJQA 1FKPB 4KE5A 4H4OB 2VQFF 3AVLA 1C0FA 1FNOA 1VK0A 1Y00A 4JS5A 5E5NA 1I3OB 2RIJA 4I6MA 2XY8A 1S6QB 2DJWA 4DV4F 2DTJA 3MMBA 2JH3A 2MB0B 4JI7K 1NDPA 1O0PA 1C6VA 2ZGYA 1CC7A 5AR0A 2AMCB 2FHKA 2AT1B 1TFWA 5HANA 2OHDA 2KG0A 3N4QA 3CJCA 4CLSA 4CRJA 2XC9A 4BR5A 3BKFA 2IBOA 4CO2A 3A5MC 1KAXA 1YF5L 4AF1A 2RAQA 3UDLA 1M5OC 4ANEA 1QAYA 4RCHA 4WFBL 4CT9A 4PKGA 3M2RA 4I7FA 4CGIA 4IFEA 3MMVA 4RNOA 1J5OB 3FMWA 1Z2LA 3HI9A 1NB7A 2FB0A 4JV5K 2C28A 2P9UB 2YWKA 1FESA 4CIGA 2HGMA 2OPRB 2FBVA 4QAGA 2QSWA 2W1BA 3A3NB 4MO4A 2ILZA 1RDCA 1JLCB 1S1WA 4F3MA 1OMSA 3M8YA 1F60B 3K8WA 1E6YA 1WC1A 3HT3A 2VIHA 1G7CB 2Q1NA 4WP9A 3SXLA 4A8WA 5EWGA 2U1AA 2V2KA 4JK9A 4JYAK 3KNGA 3QLHB 3D0HE 4U95A 3KUEA 4XH4A 3DU6A 3OYNA 1NK5A 2VV5A 2N4DA 3J7AN 1HBMA 5AQKA 3GFYA 3FJ2A 3CO0P 4OJ3A 4ZLPA 3FZKA 2R7OA 3P5BP 1B9DA 1HWUA 1BQNA 3DRYA 2ZOGA 1FNXH 3TW0A 2ZH3A 4DL7A 4OYZA 3OL9A 4CJFA 1TVRB 3HD1A 4XPCA 1SL2A 2E7XA 2FD2A 2IVYA 3F5TA 5ETMA 3CD6S 3BF3A 2QFJA 3R6GB 1X0PA 2FZGB 4LFCK 1RDDA 1EX8A 3OYBA 3IMXA 5CZ1A 3ENVA 4OZ5A 2KT5A 3P6YC 2VFTA 3K9KA 3NEKA 3CWJA 2HAFA 1W9HA 3KWIA 4ECVA 1HIYA 1IBLJ 1NHKL 3VF4A 3NGIA 4WYWA 2VPYB 3NS5A 4M1KA 1K0VA 1SQKA 3KFWX 4O3QA 3EN9A 5F3TA 5M2UA 2HHUA 1JK9B 5DK5A 4KGVB 4HVZA 3TA0A 2EG1A 3Q22A 5JS1A 3I56S 4DF4A 1WBBA 3LF0A 2OTLN 3SFGA 3AGKA 4DQQA 3P83D 2HQDA 3M2RB 2NPFA 5L1KA 4I7FB 3U3YA 1QVGM 3VAMA 2C3MA 1TKTA 4PYDA 4ZPDA 5T14A 2FZCB 1VQ6N 1HNXK 2F8TA 3QSYB 3UCUP 4C9DA 2JLFA 1VSJA 5D6GA 2CQBA 1FJ7A 3AA9A 1RT4A 3GCXP 3LPUA 3R9PA 4H54A 1H2UX 4Z4HA 4JI5K 1S1WB 2QL7B 3MM6A 4FWMA 4V19S 1TZ0A 2IHR1 2MLZA 3I32A 4OI4A 1G15A 5LSLA 1T95A 1S0NA 4AHTA 2DCLA 1B92A 4O0JA 1HD1A 3BSNA 3OYHA 1HBMB 4CHPA 4RU9A 4ZJLA 4RW6A 5KI6A 3BGFA 3HZGA 3IC1A 4FYWB 2EC2A 2GHPA 4DPOA 3CG7A 4L3QA 4FJ7A 2VDIA 1LOTB 4KH5A 1BQNB 2NNWA 5DS7A 4ECZA 1KC8T 3UNYA 4HDGA 1IBLF 5TKYA 3GYXB 4CP5A 1GQEA 3UD5A 4WYLA 3T1YJ 1EQ0A 1BISA 4B3TJ 3CCUN 4IFVB 4XO0A 2NSCA 3N79A 3D6FB 1P9YA 1MMNA 1U09A 2C2EA 4MLHA 2MZQA 3BREA 2B7CB 1WAFA 3SAGA 2X51A 2ADCA 4QIGA 1U1RA 4EBDA 4WE1A 2RQMA 4ZTJA 3H59A 3T5KA 3P8BB 4R8UA 4AM6A 1KQSR 1NMEB 2FLOA 4LIWA 3SBTA 2R8GA 3W2WA 3A5OC 1RDAA 3EYZA 3TVYA 4ZJOA 2BQUA 2OO4A 4AXIA 3EY1A 4CJLA 4QZVB 1ZAWA 1VQYA 5KOXA 4O0NA 1H3DA 1I1GA 2OLWA 3EE8A 4XK8C 2KQ2A 4JI6J 3M5RA 3BEXA 1WHWA 2I2YA 3VAJA 1TUGB 1RHUB 4URGA 2OAUA 3CIMA 2VB6A 4JKHA 2A0FB 3JAMY 2VG5A 4XPEA 1FCAA 4CF0A 1OWXA 3AQPA 2CG8A 2F4FA 2MYFA 1HR0K 1Y3KA 3G86A 4B3MF 1TKTB 3J7ZT 3FZFA 3J80O 1K73O 1N8RO 3B6BA 4NRUA 3V9XA 1U0SA 5KFNA 3TZYA 5I9EB 1MWKA 1DTTA 1FE0A 4KC5A 1UMJA 1M1KO 5KAKA 3MM6B 4FKXA 4B3TF 3A2FA 2RMLA 4NA1A 2VCPA 4FWPA 4WU3A 3AVKA 2YXLA 5DDOC 5MLCV 3JTOA 2F9DA 4ZIWA 1CSJA 1M5KC 4OLBA 3H0PA 3C6HA 3W1YC 4CGFA 1EZZB 3CPEA 2AJ2A 3TEHB 2RH3A 2XLIA 3N01A 2G0JA 4E8UA 1T94A 5CR4A 3CC2N 2CA9A 4HUFA 1HRHA 3NF9A 1G2EA 4NXNF 2D9PA 4QPXA 1B64A 1QVFR 3HHNB 3QT5A 1NK4A 4BDZA 3PHTA 5AQMA 1RADB 1RE1B 1S12A 4HWIA 1ZM2A 2FHJD 3PRBA 1IKXB 3RAQA 1S77D 3SUNA 1DURA 2M88A 4LF1A 2C2DA 1U49A 1BIUA 3BZCA 4WE1B 4B9SA 4HDHA 2QE5A 1T3VA 1EKSA 4DDFA 5BYSA 2RF2B 4R8UB 4H0VB 2FZKB 3W2WB 4OHVA 4KH1B 3VQDA 1HI8A 1X9JA 1CLFA 2HHQA 3UQSA 3P5TL 1MWMA 3CCMS 3MN7A 4KI4A 3SJHA 2HS4A 2DPIA 4GVMA 4Y3CA 4PXEA 4RBVA 4ED2A 1HYZA 4LF2A 4A48A 7FDRA 4CDIA 4IBNA 1WSJA 4LF8K 2F63A 3GDQA 3HKZD 2YX7A 2DNNA 2Z2LA 4YHHJ 2VG5B 2IM1A 1KAZA 1BMQB 4R5PA 4CZKA 3CMQA 1RTZA 3G4SN 5DGBA 4M3XA 3JSBA 3MCSA 2YTCA 3C8YA 4U9RA 1YJUA 4DTRA 3OYLA 1RWKB 3CQXA 1BHNA 2QL9B 1DTTB 5D0RA 4K59A 4KV8A 2V4RA 2BM1A 3BSAA 4X62K 4WQ4C 2KZZA 4ID8A 2FQQB 3VWSA 2W2QP 3R1HA 2YKAA 2QC3A 4FZXC 1GMWA 4FZVA 1X1PA 1J54A 1B7FA 4PPDA 2DT9A 4C0BA 3UN3A 1MMLA 2LXIA 2PEHA 3RYLA 1NH8A 2MQPA 1UKUA 3DOLA 3HBTA 2VONA 2Z4PA 5DMRA 4HTUA 1FDDA 3QO9A 2A40A 5AZJB 2JC1A 2B5JA 4CFBA 2MY8A 1SJ1A 4O44A 4FWNA 2RE1A 4IO8A 5FLXO 1ZAXA 3EDRB 4A8SA 2NSBA 4DSEA 2VBZA 3QEXA 3OTOK 5F8LA 4CJWA 1FX4A 3NGKA 2GEMA 3C14A 4CZLA 2Y1RI 2V51B 1Q18A 5ETOA 1TL1A 3EPGA 5GAEU 4CESA 3RB0A 1KOHA 5A0YA 1HJOA 1FJGK 4F67A 2VD3A 3OL7A 2P9KA 4ZCIA 4BGAA 3ATUA 3IP0A 1GLFO 4FN5A 4A5BA 1FT8A 2YWHA 4B9MA 3DAWA 4DCPB 5AQLA 4AYBD 1EB0A 3ZYYX 3V6DA 2AU0A 4JI3J 1WNEA 2CH6A 4MH8A 1HYVA 4O3PA 1B0PA 3HRGA 2VWBA 2HQFA 1QHAA 1UA1A 5AQUA 4JUZA 1NBWA 4A62A 3W9IA 3THXA 1N5VA 2DR7A 2N3LA 4CEQA 4DCJB 2W2NP 2CPHA 3D0IE 3O4WA 1DY3A 4R5PB 3RTVA 1N33J 3SDEB 3IWLA 5F9LA 3KHYA 5AQZA 2H9ZA 1PC4A 2CFXA 1P9QC 4CEZA 3DLGB 5IOLA 4B3SJ 4CF2A 2HNYA 4Z0UA 1LFPA 2GMHA 3MPDA 3AXKA 1AROP 5H1SV 2HBJA 1BO5O 4C3LA 3UE2A 2RU9A 4LF6F 4OJGA 4EI2A 4LR7A 3VVUA 2ZWHA 1ZBSA 3CCSN 1SKUB 2DRDA 1JCFA 2YHBA 3WUHA 1C1CA 4JI2K 3E66A 2CQDA 3QO9B 4IDKA 1O1WA 3PYEA 1JXVA 1RTDA 1Q7YO 2H51B 3QIPA 3BO3A 2B5JB 2CPZA 1RNHA 4O44B 4O5BA 1RB0A 1UJ5A 3OYIA 3FZMA 4B3RJ 3CPWR 3QSIA 4CZGA 3GCWP 3C14B 3M30A 4DV0F 5AQFA 1TL1B 2XZDB 3RW6A 3GFXA 3FEYB 1S9FA 3WX4A 1VOMA 1WC3A 2P9KB 5KT2A 1T8EA 1ZA1B 3SUPA 4CK2A 1BA1A 5L39A 2MQMA 4GKKK 3WIUA 2NUBA 2HLUA 2RS2A 1YX2A 1NJWA 1BHLA 2W8LA 5GAGP 2E5IA 4UUXA 4YY3J 3WDOA 1TTHB 2DO0A 3KKFA 1NKEA 2J76E 2QWPA 4HACA 4KSEB 2UUAJ 5K8OA 3GIMA 4CTAA 3M7VA 5DJBA 2ZH1A 5F0WA 3MOZA 4AXJA 3THXB 2V2QA 3TUJC 2QWNA 4TQSA 2QKBA 1SQEA 2XS2A 3G82B 3SNNA 4DQIA 3LM9A 3CJ9A 2MHNA 1N5QA 5HQ8A 3FCWA 1ZTWA 4JV0A 1Q95G 1VQPS 2HNYB 4GO7X 4MQ3A 2ZM6K 1L3KA 2EWHA 2NUUG 4HTJA 1U1LA 3CQ8A 2A6MA 1XNRJ 4KFBA 4DUZJ 2HVHA 4P7VA 1H38A 4B3RF 2VQEK 5M1PA 3ZTRA 4IH6A 4YB1P 3OW2R 2NYHA 4WTOB 3AVIA 2X3GA 2H48B 4MDBA 4F36A 3TO8A 4B08A 1S22A 1F3FA 1DHMA 3NF8A 2A2CA 1AB8A 1IWAA 2HFNA 3JQMA 1GLCG 5DGAA 1UAXA 5L46A 4IDKB 4GV3A 2B43A 2A3ZA 1NCLA 1S6UA 3QIPB 2XBPA 3V4MA 1OPIA 1HBOB 2F3JA 4J9PA 1W26A 1NDCA 2HBKA 3KMQA 3CMES 4WCEL 1EX4A 1H2VZ 2UUAF 3G6EN 2HBRB 2J0WA 3Q24A 2XCPA 1FJCA 2EFPA 4M3UA 4DV7F 4OV1A 3Q7BA 2DO4A 1VQ5S 3ZSYA 4CECA 3D0PA 4GKJJ 2LXFA 4BROA 1T9TA 2B9EA 2OIHA 2KTQA 1WD6A 2ASOA 3OVNA 4Z4EA 4X4QA 4HLBA 2R2RA 3B6OA 3VAGA 3KLEB 2HBYB 5E7OB 4IZ9A 3HOSA 2C2ZB 3AA2A 2Q0UA 5LJ3Y 3C2PA 4DUZF 1U8WA 3P4UB 3CFRA 4HACB 5HI7A 3SAHA 3M2UA 3AD7C 4CTAB 4HT5A 4FNIA 1GLLO 4NX9A 4NLOA 5AQJA 1DTQA 1O51A 1RYSA 3VQSA 3GG0A 4KREA 3O3GA 5AQNA 1RHQB 3DLLL 1HQEA 5AE2A 3T6BA 2CVEA 4CM2A 5IV4A 1GOCA 2HKEA 3A12A 3OYFA 4KI6A 4DQRA 3TA2A 4FYYB 4BDPA 1UEKA 3C15A 2DR9A 4KFBB 4DU3A 2P9LB 2Q3PA 4DR3K 4FXVA 3IWXA 1JXBA 2GQQA 1BY9A 4ZVEA 3RMCA 2P51A 4ZCLA 4DR6J 3DLRA 1P8GA 1KVKA 4Z4IA 5EY4A 3B4MA 4PCQA 3I4HX 1F2HA 4GKJF 3H7HB 4JI8F 2J7KA 3UDEA 4JRPA 2Y8WA 1BUXA 1FWLA 4DSLA 3ZX0A 4OKJA 4A61A 5KPZA 4I6WA 4NI2A 3C95A 2E20A 1K9MT 3VN5A 2AWZA 5BYQA 2ITMA 3AHPA 3LM2A 4C1NK 4W90B 3SFUA 3DDNA 3ZT1A 5M2RA 3NAEA 4L74A 1BCOA 4NCGB 4K0KF 4ED4A 3CJSA 5FROA 1IG8A 5AQPA 2POKA 2CG4A 3P39A 2A10A 1QAJA 3S41A 5A8KA 4F02A 4DCHA 4EHTA 3S3NA 1HHQA 2AYMA 5G4DA 2QSFA 4MFBA 5GADI 3V1RA 2ADBA 1RXOB 4J9KA 3ISND 3ET6A 1S0MA 3UB5A 2KL8A 3Q86A 8RUCA 4QOTA 2R3VA 3N6LA 1IBKK 4JOUA 2WONA 2FGOA 2VG6A 4E7LA 2CQPA 1WSEA 4X4PA 1UZHA 3S8SA 3B6PA 2KRRA 4LSNB 2GVZA 1SCJB 4IUFA 4EFAC 1SL1A 5KFVA 4B17A 2UUBF 3HHKA 5IWAJ 4M7XA 4DOZA 3AODA 2G8VA 1JJ4A 3V9SA 1HQEB 3KVGA 3ZTPA 2DTUA 4CJ3A 5KG6A 1UFWA 2FJWA 1VJQA 1XWLA 2HEKA 4IJNA 3C15B 3A8JA 4OYMA 4NLQA 1ZZNA 5F8JA 1BWFO 1URNA 2C2KB 4Q45A 2C3UA 4F04B 4W5RA 2BR0A 2CQ0A 4NOHA 4HR2A 3WXKA 1LV5A 5HMZA 4LF4K 1TAQA 3US5A 1IVZA 2R2UA 4JI7J 4QW9A 3NWGA 2QA4N 2F9JA 1WOOA 1LKZA 2CJBA 1MU2A 2I9SA 1RCOB 2G4BA 4J9VA 3RUBL 3RRHA 3HHLA 2L9DA 1D8YA 2OTLS 1JLBA 3DJCA 2DNGA 3L7UA 5KFLA 3ISNC 3O6QA 5C25B 4IOXA 3PIPL 2RQKA 2KXHA 3CJ5A 1UZDA 1VQ6S 2ZWOA 3THTA 3I4PA 1U2VA 5IFMA 2EHGA 1ITGA 1RTIA 4ALZA 4KHQA 1RWPB 5F9NA 1M90O 5HSPA 3G25A 4JK7A 1QQCA 1H6KX 1RAEB 1LK5A 2ZNYA 4WCEQ 4JV5J 2G9OA 5GAHI 4ZS6A 2EFNA 4IYQA 4JI1F 2H5JB 3BBBA 5A8KB 3G8TA 1ASWA 1WEYA 4OYOA 5AQIA 5KPTA 3Q8YA 1N5YA 2ZH7A 2RQ4A 3CJBA 1GXTA 3TJAA 3R1LA 5FPDA 1VSLA 5M1QA 4JD2A 4P72A 5E41A 2HBMA 4JYAJ 5J2PA 4GV6A 4FVCA 4UQGA 1C0UA 1X9MA 2WONB 2VG6B 1UWAA 2G1HA 4Z37A 3CCUS 4A8MP 1OQ3A 2GVZB 4JI7F 1RFQA 3DNCA 4B9LA 4ECQA 1H1VA 2R7XA 3SYZA 4DV6F 4A8OA 3MAAA 3HFKA 2QT7A 4ATNA 1FKOA 2E44A 2V4JA 2ZJPQ 2OPQA 3BZKA 1B3TA 5HP1A 4BRPA 2QYCA 1D9FA 3T1HK 3THPA 2RHKA 1NZAA 1MN7A 4W5NA 3L2WA 2DITA 1NHUA 3V6HA 1MROA 4U7UK 4J9SA 4K50A 3VOVA 2PN6A 1N0UA 1YBUA 2DNKA 2QLJB 3EZWA 2V9KA 1MU2B 3E01A 3HYFA 2G2OA 3HHLB 3I6PA 2LQJA 3VEVA 3LA0A 5LOQA 1JLBB 4HTIA 4HEA9 3CFPA 3HLUA 3NHGA 3THVA 4KPYA 2JEIA 3AGRA 1IM6A 1X4HA 1HNIB 4JYAF 4BACA 1U2VB 3EXYA 1RTIB 4GV9A 2AD9A 2ZJRL 2C2MB 1YJRA 2BTFA 4HUEA 5K9FA 4DV2K 4CIOA 4OPHA 1XNQJ 3LP3A 2DFFA 3DGPA 3N28A 3GIIA 4AM7A 3FVYA 2ASJA 3V5RA 2MJUA 3TP2A 3OYGA 4FXWA 3B82A 2ZBCA 3C7NB 3H3OB 4JD2B 3NCIA 4LFBK 3N5BA 3CC2S 5J2PB 1TUVA 4NLSA 3GSDA 5AQOA 3C6AA 3ZT3A 2NRZA 1XTZA 1NK7A 4LFCF 3JAMU 1NGIA 2CGLA 1RT2A 1LWCA 3Q8PB 1RDBA 5GIPA 2IMOA 1NDLA 4FDFA 4H0OA 1Z26A 4BC4A 5GIOA 4PG4A 2E7VA 2Y3YA 3MAAB 1YUWA 1CPZA 1UVNA 1NU4A 1T05A 1FKOB 1SC3B 2IVNA 2R2SA 1NJYA 1A0OB 3DCAA 2YHXA 2V4JB 4OGEA 3FFIA 2OPQB 2HURA 4KHPK 1TUWA 1XK8A 3OTCA 4CJ7A 3RB3A 5HP1B 3KTQA 3HZEA 3LWMA 3NKYA 4DQSA 1GXUA 3OL8A 3ISZA 1XMQK 4Y2KA 4HHJA 1IKVA 2WBNA 2LQ5A 1YTYA 3G0ZA 4IOBA 3I82A 1HNXF 2Y0SD 3E01B 2H4WB 1IQTA 4H5VA 1XR5A 3J7YP 2Q43A 3MGJA 3R5AA 5JUMA 1U48A 4JI5F 3PW2A 5HVHA 1R27B 3IRWP 5E3CA 3RMBA 3PW7A 3D5MA 2Q79A 3G4SS 2CJ9A 4K5RA 1HYSA 4ZPAA 4NEZA 1C4AA 1RWOB 3T41A 2AP1A 3P38A 2J9DA 1L5UA 3MD3A 5KFTA 1CQNA 4V19X 3IS9A 4USTA 1BA0A 4DSKA 3PIPQ 3NGSA 1YVNA 4NO7A 4JP8A 3BJYA 2PYJA 1HNVA 5ETNA 1GH8A 3ZCMA 4I9LA 5B0AA 4YR3A 3DGPB 3UR3C 3QINA 2HPUA 3IWNC 2HFSA 3EGNA 1IKYA 1VRQC 4PQAA 1RUSA 3TQEA 1F6TA 2QMXA 1IJJA 4BWMA 2XS7A 1P1LA 1HKBA 1U1PA 2VBWA 1J5EK 2ZNZA 1D8ZA 2WVEA 4YMEA 4ED5A 3LGMA 4CEOA 3G71N 1FD2A 5KT4A 1FO1A 4RUBA 1VQ8N 2RRBA 1RT2B 1LWCB 2IGIA 3WQUA 1LEOA 3MM7A 1PBAA 3H6EA 4YDDB 1VSDA 4K4ZA 1X4CA 2YCHA 4AILC 2G1DA 3DI6B 4EYIB 2VGNA 1YHQN 2JJ4D 5HRNA 4NLTA 3RG6A 4C8YA 1WUUA 1WWHA 4OI3A 3HT0A 4GMKA 2WW4A 2FIUA 1T05B 4DR1J 4Z2XA 1I3AA 2D0AA 1JKHB 3V6JA 3W0LA 5LM7E 4OI2A 3FFIB 2DHXA 4FLWA 4OMFG 4PHTX 1YKWA 5DM6L 1JL1A 2NXNA 3EE3A 2P9NA 1J2VA 4EO8A 3H8YA 2J5AA 1TAUA 2B0GA 4NLXA 1HR0F 1QJHA 4ZPTR 4DTUA 3I33A 1ICEB 3TRGA 5AQWA 1HKAA 4CF9A 3I55N 2QA4G 5CZXA 4IR1A 3DKDA 3IFEA 3HSCA 2I5JA 4GY2B 2LDYA 4CJKA 2GS8A 2H54B 4IOCQ 2CIMA 4P6QA 1TMMA 4LF8J 4OX9K 4ZPWR 2NRVA 4RX6A 3OLAA 1FDNA 4ZVUB 4N56A 1HYSB 1FERA 1YRXA 3I96A 4Y1CA 4BQLA 5ETKA 4C0OC 4K2XA 4W5TA 3HJVA 2DBBA 2HSTA 4XH5A 4A57A 1N5TA 5LXYA 3DHXA 1Z2ZA 3WIVA 3J8AA 2XGQA 4M94A 1S4EA 4CZMA 3OBIA 1FFWB 2BKNA 5BPNA 3DWLA 3G96A 3CCSS 3EGWB 2ZJRQ 2KI2A 2PZSA 4X62J 5D77A 1YXQA 4EEYA 1IKYB 2BJ1A 4LF5K 5HATA 3TAPA 1F9FA 2ZBRA 4A8QA 4M5MA 2E2PA 2UVRA 3T69A 3L7OA 3NCRA 2DGXA 3SK3A 1VISA 2DH7A 1HBNA 1FDAA 1ZETA 2UYTA 1XBWA 4LC9B 3R8YA 4LREA 3WQTA 3NRBA 4FJ5A 3S3OA 4PYAA 1GAOA 1TGOA 3MM7B 4RWXA 4R25A 1KQSM 3IN5A 2PI4A 4JI0K 2LSNA 2L08A 3OTOJ 3KNAA 3GOIA 5AZIA 3MX5A 2QXLA 2FVCA 4WP8A 3QICA 3LDOA 3ENAA 3UCGA 3SQ1A 2O1PA 5LJWA 4E3SA 2ASMA 1UWBA 4M5NA 2XNRA 2JWLA 5DLGA 4D3GA 2B9WA 1Q16B 3V1QA 3T5JA 3DHWC 2MLXA 3IGVA 3KJNB 1R31A 2E66A 4JKAA 1IWGA 4ZCMA 3OUYA 5IT0A 1G4CA 4J7CA 2J6UA 1O8BA 4B02A 1NPKA 1R43A 4FS1A 4HUGA 3J7Z5 2BACA 1X8DA 2O8DA 4H4KA 2AW0A 3WXIA 4ZCKA 3HL8A 3OVAA 3FRYA 4CJ4A 5ETLA 1RI7A 5G0RB 3HHLD 3TJ8A 1O13A 4GVBA 3NBPA 2YPYA 3DOMB 4NLDA 2KHCA 3V2UC 2ZBQA 3R1XA 4RG8A 3DRSB 1QZ5A 2G2ZA 4XDDA 4M95A 1OVYA 3T1AA 3CCWA 4K8XA 4YOXA 2HIQA 5T7LA 5D0EA 1NB2A 3MR3A 4JKBA 1DEJA 2ZBPA 3FSXA 3MPYA 2J9DE 4TU7A 2W9AA 1RT3B 1NNDA 1UEVA 4AHCA 4ZVGA 2QYGA 1ITPA 1A5WA 1W0HA 3R3LA 4AT1B 5HBMA 2R2TA 3CD5A 1T9WA 4JKDA 3L7PA 4JNEA 5LT5A 1MWZA 4LRBA 4DU7A 3R7BB 3ZEUA 4QU6A 1Q81O 1ZS6A 2W24A 1VCTA 4LBHA 3LW5C 1FE4A 1N0VC 3L2UA 1HBNB 1FJGF 4J2AA 4WU2A 4ES1A 4KIAA 3KHHA 4JI2J 3TNVA 5HRRA 4MIWA 4F2SA 4NLVA 1KFDA 4FWLA 4ZN3A 2HVIA 1XC3A 4USMA 2GELA 3G6ES 4XIUA 1FVQA 1QDUB 4KPCA 4RKUC 2WC9A 2VKZG 5KG7A 3QEPA 2HNZA 3MX2A 2W01A 3G6YA 3I87A 3JS6A 4AQYK 1Y0HA 5AZIB 3HHLC 3O80A 5HRSA 2QXFA 1OJ4A 1OH8A 4DR2K 3KLGA 3IG1A 4R0EA 1TYQA 1HFEL 4CZCA 1YITN 1C1BA 1E4GT 4KB1A 3FBEA 3HPGA 1CZAN 4CE9A 2O8DB 4ZK7M 4MT1A 3SQ0A 1NJXA 4S0MA 3KLFB 4IH7A 5DM6Q 2IC3B 2XQCA 3NDKA 3AO3A 3PFEA 4DTXA 1R8HA 3UE5A 2EKNA 4CEBA 1SL0A 4GVBB 3OR1B 3NBPB 4ZLLA 3PR5B 1Q9YA 3SZ2A 2G8FA 1X9WA 3QYYA 2E2QA 2R8HA 1OQ6A 2C2RA 3WBZA 4C4WA 1AW0A 4OFZA 2GHVC 2DPNA 2CPDA 3TAMA 5D3GB 4IEIA 2NXUA 4B3MK 5BJRA 1WSRA 2Y1LB 3K17A 5T7LB 3WXMB 4E1MA 1GK8A 2GMLA 3FR0A 1WSVA 4JI2F 3FLCO 4V19J 4CK3A 4ZVQB 4RW7A 2QA1A 3L3CA 3TANA 3GIJA 4CD1A 2ZM6J 5T41A 3CJ7A 3CULA 5HBMB 4RJVA 4N76A 2VQEJ 1RT1A 2UVVA 3VR1A 2X1AA 1NHVA 2WB1D 4IQXA 1PYSB 2CQGA 5LXRA 3MM8B 4ISFA 1OH7A 1R8PA 3H1QA 1FX2A 2MQNA 4P2MA 2Z1IA 1YVUA 1FRXA 4YB6A 2CPFA 1IO2A 1H2TZ 3GZ7A 3AAPA 4A8XA 3VVTA 4UUWA 3TAEA 2J4RA 5CYMB 4GKKF 1AFJA 2ZH6A 1P27B 4LF9J 2CZVC 4B9QA 4P10A 3MEKA 4C6AA 3UN2A 1X4GA 4CM0A 3OHAA 4U8VA 2HNZB 2QTDA 2HQ3A 3ETOA 2QWLA 4H5RA 3SBGA 3VETA 2DH8A 4B8AB 4LVOP 1HBUA 2JC0A 3M1VA 5I3QA 4YOVA 4ISGA 3QNWB 1TL3A 1OYEA 3N9UC 1WC6A 3LAKA 2QIFA 1T3NA 5K8PA 1HWJA 3KLGB 3IG1B 1WEZA 1BI4A 4E89A 3RJMB 4AD6A 1TYQB 2XGPA 3K59A 2UP1A 5F1XA 5IXUA 5BR8F 1U1KA 2FJAB 1C1BB 2A6AA 2E7WA 4FXDA 1LAVA 4E19A 3K5OA 3MK6A 4BREA 3U7JA 1RJJA 2XO6A 3AVMA 2VBXA 3AD9C 1ATNA 4I9QA 2BV3A 2M3DA 3TSUA 2KYZA 3D9BA 3F9MA 2DNMA 2VQEF 1KLNA 1PILA 3HSTB 1SI9A 2G0CA 4HH0A 3TAGA 4L8RB 2HNDA 4CJTA 3TAMB 2VF3A 4BRGA 2OD6A 2V8HA 3F2KA 1S6PA 3GV7B 1LCUA 4HI2A 4WFZA 2X6SA 2VFVA 3SMZA 4GW6A 3KG1A 4BWJA 3FSIA 3PVXA 1VFJA 4OX6A 1KVIA 4TYBA 2FVSA 4K4SA 5C7PA 1QQOA 1QLNA 2QWQA 1UW9A 1Q82T 5JICA 4NYFA 3GIKA 2KLAA 3UDVA 2LQBA 2BE2A 4W5OA 1RT1B 2BJDA 2QA4S 3QT7A 2OP5A 3RMAA 1VIXA 3MPVA 3HSDA 2D41A 4YEAA 4CFAA 2PO4A 9RUBA 3UVJB 3PJ9A 2AA4A 3TX8A 1WEXA 3C16A 3QBWA 1QSLA 3KZBA 1S4FA 3Q23A 2FF6A 5DDQC 2F8EX 3IBFB 2NS1B 3SBMA 1LW0A 1T6DA 1OY8A 4YR2A 1RWUA 3X3UA 3TVKA 4JI4K 1HBUB 3M1VB 2HSEB 1TL3B 5F8IA 4OLOA 1RBRA 4IOAL 4USIA 5KFUA 4RUCA 3CJRA 1S79A 1BI4B 1YBTA 3GFHA 1NK9A 3MURP 4FZZA 3BKTA 3VAIA 4C97A 2IRYA 2JLGA 5LSRA 1X4FA 3ZETA 2NRRA 4RW8A 4DI6A 5CYQA 4O3SA 1F3VA 3T5LA 1XHZA 3ADAC 3PEHA 1QSSA 4DR3F 3VALA 2ZEJA 2HLTA 1G1XA 2KJVA 3OW2M 1Y9OA 2HNDB 2E1CA 2YHYA 1Q5YA 1M1HA 1AA1B 3M6XA 4JKEA 5AQGA 3BDPA 1WG1A 3BQ2A 1TL7B 1U1MA 1D1UA 4QIEA 1S6PB 4CGJA 2B6AA 4TXSA 5JMVA 2MPUA 3SCJE 2FSJA 2D1KA 3RB6A 2MTLA 3KUHA 4M45A 2UUWA 2GUIA 3K2YA 4OJRA 2XI3A 2BYCA 4ZVTB 2HFOA 4LF6K 2PA3A 4X2BA 3UIQA 2UXBJ 3TTFA 2HMIB 2AJQA 2WSFC 1LW2A 3OXFA 1IUJA 4WPAA 2GGPA 1NBEB 5E2QA 4WP3A 3LWLA 1DZ5A 1APSA 4JKFA 1SJRA 1SH0A 4LF4J 1Z6RA 4WFAQ 1VSMA 3DLJA 4Y6IA 1UEUA 1WC4A 4M8LA 2FUG9 5HMYA 3OYJA 3AVCA 4TU8A 2FLPA 3SIPB 1IBMK 2ZDPA 4DX8H 3Q8UA 1LW0B 5KG0A 3UKUB 4IWVA 4FF1A 5H9EK 3KJQB 4MO5A 1S3XA 2YNFA 2R8JA 2J7WA 1ZBUA 1DAXA 1F0XA 5FD1A 1IBKF 3TUPA 1BQXA 3A8KA 2MKHA 2ZZMA 2KRBA 1VAZA 5F8MA 4CW7B 3ULEA 1R0BG 1XIQA 2IPOB 2GX9A 4ITSA 1KD1T 2FC8A 2I38A 3HM8A 3LDNA 3HULA 3EWGA 3KKRA 2DNZA 5L1LA 2E5GA 3FE1A 1VQLN 3FCHA 2HF3A 1FVSA 5JJBA 2YKNA 2VL1A 5A2QY 3CD0A 4YOTA 4CHQA 1I39A 3ZETB 5CCMA 3VQQA 1HMVA 5JVGL 3SMPA 3GV8B 3ZSWA 4NCBA 2PFDA 1WN7A 1RWMB 4EFHA 4FWRA 1GFWB 2BQRA 3BO2A 4MDAA 3L4IA 3AVBA 3SI6A 4QIVA 4N5SA 4LF4F 4E0DA 2O4IA 1H72C 2VU5A 4WJBA 2B6AB 1Y97A 2KM8B 3DLEA 3AVNA 2PAVA 4ES2A 5EHHA 3FZHA 2YHWA 3RW7A 3CCJN 3D4JA 1RWXB 4NMXA 2RVJA 5IS2A 5FPNA 4FLXA 4ZVRB 3T1HJ 3A13A 2CWXA 4WZQA 3FEXB 2GGPB 3CO9A 5C15A 4NRTA 3QGIA 4Q44A 4IXCA 2CZ4A 1DLOA 3UDCA 3MXJA 1G3OA 2DXEA 3DGVA 4I64A 5BYRA 2DB1A 3FZLA 1XC9A 1DARA 2MKJA 5JS2A 3TTDA 2RJZA 3NH1A 4IG3A 2DVIA 2LYVA 4DPTA 4CGHA 3WNGA 1KXPA 3L3UA 3O9RA 4FWOA 4H4KC 2Z1HA 2W9CA 4FBTA 2P9GA 2V63A 4Z94A 1KD1O 2UXDF 2YNFB 2P5OA 1R0AB 3U9DA 2XMMA 4KHWA 4QR1A 2ZH4A 3MCAB 2AX0A 3MUTP 3I9ZA 5LMNK 1F9EB 4OZ3A 2B4VA 1DT9A 1TUYA 2XMAA 3IBCB 1QS4A 2FY1A 3W63A 4DTNA 4IOAQ 4DV2J 2CAJA 2DKOB 1WTBA 2E9ZA 1HJRA 3M9NB 4UZCA 1UCNA 2B9YA 2XLKA 4ICLA 4OKKA 3QGGA 3G71S 2YKNB 5F8NA 4KRWA 4O8UA 4BRMA 3H2UB 3FDSA 1VQ8S 4ZPVR 1Y5LB 3CJ8A 1HMVB 2EFGA 2HOEA 4Y1DA 1CEZA 1QM9A 5AQVA 4LFBJ 4TLRA 4BHQA 2FPHX 1VR6A 1YHQS 2F8HA 4FBUA 3W2VA 4CZFA 1HPZA 4WIIA 4ELTA 1MN9A 4UY8O 3GU0A 2BRLA 4K4UA 4MAKA 1JLFA 3BH6B 3GJTB 3Q2TC 4D3HA 4UOGA 3E9LA 4AL5A 2Y1IA 4C8KA 1VHXA 3CYMA 2F65A 4LR8A 2O8EB 1NGHA 1NM2A 1H0HB 1S5JA 3CM6A 1R8AA 2R7RA 3NH0A 3DLEB 3R2CJ 3GV5B 4CEDA 3QMLA 4ENOA 5AE3A 4GMJB 3H5YA 4X4RA 3OJSA 1ZXOA 5RUBA 3EMTA 3VGKA 2FTRA 4NLRA 2D9OA 2VGMA 4KHPJ 1OY6A 4B1XB 2IMWP 3I55S 3RBEA 4RTFD 4Q43A 4X4VA 5J2MA 3VAHA 1XMQJ 3K5NA 4KHUA 2OYQA 4KB7A 4JI8K 3PSIA 1DLOB 2BJ3A 1AZSA 3NNCA 3GWCA 4FJIA 4EBEA 1JNZB 1PKUA 3CMAN 3UNGC 4EK2A 5DQGA 4NYPA 1V3SA 3LP0A 4IG3B 5AQRA 3WT0A 4TY8A 1AUSL 3LTOA 1PCAA 2B4PA 2CJKA 4FO0A 4UOHA 2W9CB 3EKSA 4K0KK 3M8QA 2E1MC 3ONQA 3K0JA 1RT5B 4OPAA 3I5AA 4WIQA 3WHIA 3TWHA 4BR0A 4CJUA 2O5DA 4DMNA 2BRKA 1M5VC 2QM1A 1PSDA 1Y64A 3AH6A 2R7SA 1GXLA 5J2QB 4MLEA 4E7JA 3OYEA 3ULDA 3RGIA 3AO2A 4DV1K 1U1QA 1NWKA 3ZT0A 4M5JA 2GIQA 1NXIA 5B0CA 3VQPA 5I42A 3AVJA 4ICLB 1JMTA 2F8MA 7AT1B 1OYDA 4YQWA 1R6VA 3R5DA 5GVQA 3EO3A 2IDEA 1NLVA 3IR5B 3Q2SC 3ZSRA 1H98A 1TV6A 3NCQA 3NMAA 4KHPF 2JEJA 1SJQA 4FF2A 4DTMA 5AT1B 3IKMA 3UKRA 1H7XA 3ZT4A 4WQ5A 3E8OA 3W2VB 4LSZB 2PEBA 4QIWD 4ED8A 1KQGB 1JLFB 2UUBK 2W41A 1XMQF 1GTEA 1EKRA 4KH4A 4ELUA 6AT1B 5E3RA 2YNGB 3MEDA 2WTUA 3H08A 2XCAA 1VC0A 2VQFJ 2PMWA 2P9SA 1YRTA 2VICA 4DUYK 3QDKA 3CJ0A 2E8AA 2DIUA 2MZJA 3HKWA 1HLWA 5L9NA 1Q4RA 4BRQA 4BRFA 2IM0A 4C8NA 4O55A 2YKMA 2DD8S 3QESA 1Q1KA 5J2MB 3ID6A 3EJMA 1DQ9A 3ZSOA 3QZ7A 1AZSB 4EMDA 2Y8YA 1JLCA 2NPIA 3ZTSA 5J2NA 2V8DA 2UUCK 2YX1A 4GRSA 1WOQA 3GR0A 3LP0B 3OV7A 2V7YA 4ERDA 2AGOA 2XS5A 3HP6A 1I94F 4TY8B 5ETVA 4Y28C 3W66A 3KK3A 5KG3A 3VZHA 5KFMA 4CYUA 2ROPA 3HVTA 4K42A 3A4TA 4CT8A 4DN0A 1B9FA 1UPPA 5D8HB 2HVZA 1J5EF 1VLYA 1YTAA 2CDQA 3OR2A 4L75A 2K2PA 2WHOA 1X31C 4JI1K 1HQ2A 4B1VA 5B08A 4ED0A 4A2AA 3SUQA 1OO0B 5KFAA 1SJFA 3BKUA 1Y11A 2OSQA 3NS6A 2QRRA 2HAIA 4FF4A 4WF9Q 5FPMA 4CJ5A 2XO7A 2DNRA 4ZLNA 2WVFA 2KG1A 5I42B 2EEYA 4BG8A 3NFAA 3D6TB 4NLPA 5KFFA 1K47A 1IN0A 2ZUGA 2E5LF 4LF5J 1T9VA 3MEEB 1RAOA 1TV6B 3H2VE 4KBOA 3CCZA 3UD3P 4ZA1A 4HKQA 3UKRB 4H0XB 2DHAA 4ZMMA 1TL4A 3VQ6A 3M8SA 5ELZA 4DV6K 2RU3A 3OJUA 4ZOSA 1VI7A 1QTMA 3NVKA 2VASA 1Q8IA 2XULA 3GB0A 4X4TA 3MEDB 4Q5VA 1KNZA 2IJNA 2MZRA 4U8YA 5SZTA 4JI0J 4EU0A 4J37A 4CK1A 2JL9A 2P9SB 4LH4A 3S9HA 1YITS 2FBYA 3I0SA 1TKZA 1R6YA 4L72B 1WF0A 4OX9F 4USJC 5AXMA 1D4XA 3CIZA 2PGCA 4NMLA 3U9ZA 2FC0A 1VBZA 2YKMB 2P2CB 1HA1A 2FJXA 4TQRA 1Q79A 2D1CA 3QWPA 1EHWA 2AEFA 4DV5K 2BZ2A 4A2BA 3EZOA 3JS9A 1VQ7N 5HK4A 4F7VA 4PG8A 1X7VA 5J2NB 2P6TA 3IMQJ 5KG5A 5KFPA 2V2ZA 1PYOB 5AQTA 3SV3A 3FCVA 2QMWA 3IGNA 3KK3B 4N77A 1DGKN 1T0TV 3BH7B 5IQ6A 4CYUB 4DN9A 5GAHP 3HVTB 1VQMN 4LF5F 4AHRA 4LR9A 3AVHA 1EQYA 3I5BA 4P52A 4LJMA 3PRVA 3PKYA 3VQ8A 2FVPA 4LBIA 2XLJA 5EWEA 2QG9B 4KT0C 3OR2B 2JLEA 1T7PA 3VEZA 4OZ0A 2PT0A 3BGOP 3D1QA 4A4JA 2CGKA 4ZP8A 1M1GA 5HLFA 5B8HA 4HH1A 2GAGC 1NNEA 1D3WA 3R7SB 4IFVA 3VEYA 3G8QA 4FPAA 1TR0A 4JI0F 4ZJQA 4NLWA 1IH7A 4M5DB 1S1UA 4X66F 3THYA 2X7IA 4ILRA 3QMQA 3H5UA 4Z7CA 4EP5A 3F9KA 5E33A 2N82B 3BYRA 2FJDB 3BGRA 4BGBA 2B51A 4YOYA 1FKAF 2X78A 2DRAA 3OFHA 2RT3A 3M8WA 2JNJA 4ZVOB 3BB5A 1C0TA 1WBDA 3FK4A 1MDUB 4NASA 5JLHA 4AQYJ 4CF1A 3CNQP 4F4AA 3L9ZA 2GIRA 4H8KA 3I0SB 1TKZB 4KHSA 3HVWA 3R7NB 4M63C 3Q8VA 4MYTA 2A1SA 3J81j 2KFYA 4PWDB 2DFEA 4QQBA 4CLYA 2RPIA 4J9MA 1J9AA 4PR6A 3CCTA 2A1RA 4DPWA 4NLBA 2E2NA 1Q7LB 1A5XA 2V8GA 3FUYA 5KG2A 3SSQA 1ZBHA 3VMFB 4DPXA 4CI0B 4I6YA 4X65F 3WXJA 3K9JA 4PKIA 1U4BA 1VRUA 2YWEA 1K73T 4I4BA 1UVJA 1N8RT 5IT9U 1ATRA 4EZ9A 4O5FA 2DIVA 2EFVA 3NLCA 1WSIA 1ZZFA 4KRFA 5L38A 4CQ1A 1LWFA 4NPOA 1M1KT 3L0QA 3HP9A 3G8SA 4B3MJ 3VQ4A 3BN4A 4GC6A 4Q2MA 3MCPA 1FEEA 4B1WB 2DEIA 1SV5A 3TVZA 2M4MA 1S72N 2XMTA 1FD8A 3MXHP 3DXBA 3TSPA 3HPHA 4RWTA 5HLFB 3QPIA 2F40A 5EX5A 3IR7B 4JV2A 3D2EA 3WQPA 2WOMA 1ZPVA 4ILHA 3WEEA 1IKXA 4AQYF 4K4VA 3ZC4A 4A46A 1UP1A 1IJEB 2GJFA 4HTLA 1S1UB 3L2QA 3THYB 3V9UA 2A5XA 3VENA 3WZ0A 3MPWA 3GYGA 4A5AA 1SKRA 3AJ1A 4DR2F 5IZHA 4FPIA 1G99A 2RF2A 3M1FA 1RDWX 2GMJA 3BGRB 4EBCA 3MN6A 2XEXA 3HMJG 4NXNJ 4FYXB 2W7PA 4ZP9A 3AT1B 3GE1A 1WHYA 1SH3A 3SQ4A 3PX0A 4JN4A 1C0TB 2N4CA 3D6MB 1EARA 4EIAA 1PJ6A 3RR7A 2VA2A 3MXMA 4PPZA 3LDPA 1NMNA 1UETA 4DQPA 1Q53A 2F4VF 1KOOA 2ITGA 3AO5A 1TUUA 1P90A 1SS6A 1BQMB 3A5NC 4LT6A 1AUDA 4DXLA 1JLAA 4C8LA 2WB4A 4DSFA 3O3FA 1T02A 2G13A 4K43A 4C1NI 1KTVA 1Y5IB 3ZZZA 2ACYA 2P5VA 3AJDA 5EN1A 3QT8A 4WFBQ 1O6XA 1LWEA 4BE2A 2A3JA 5A6PA 4QWEA 1XERA 3PYDA 3PM9A 1YGYA 4O3NA 1VRUB 3G6VA 2E4LA 1HNZF 1Z4UA 4ZHRA 2P5GA 1QAXA 2VFSA 4YNQA 2KU7A 1TK8A 1EP4B 5ETRA 2W4PA 4MK9A 1LWFB 5BRDA 5KFWA 4OKEA 1VHFA 4PG6A 5HO4A 1J27A 4RUHA 4RNNA 3EE9A 5IC4B 5F41A 4HT7A 2ZD1A 4ZKAA 5AZJA 1KDNA 2OEMA 1XMOK 2Q0RA 2HS0A 1SV5B 2MJNA 1K44A 4M3TA 4O4GB 2QW9A 4Q8FA 2VFUA 4G6VB 2JFKA 3IO1A 2YQ0A 3GLJA 4DL4A 2UV8G 4QCLA 2E9RX 1JJ2M 3D2EB 2UUTA 1NPRA 2WOMB 1JNRB 3WEEB 2GVDA 3D2FA 3K5LA 3KWMA 4G1IA 3DXSX 4EUVA 4N7TA 1KN6A 2D3OR 2BW7A 2HRUA 3F73A 1FRKA 3MWBA 2HZVA 3T9NA 4DV3F 5C2DA 2FLLA 4X4NA 4CHZA 3QJPA 1VMBA 3QERA 2YWFA 4OLPA 4FLVA 1FW6A 3LP1B 3VGUA 2EK6A 4Q0BA 1T9YA 2PI5A 4DEZA 3VZIA 2ATQA 1REVA 3BV8A 4LRCA 1W25A 4RZRA 2W9BB 1QY7A 3OFEA 5KFGA 3MCNA 5U47A 4JI4J 5AJ3F 5DG9A 2R9LA 2V94A 4BE1A 3IAYA 4CJEA 3ZZOA 4JAXA 3MECA 1CULA 1F2GA 3GTYX 1JLAB 2FYXA 2W7AA 2XSFA 2DGQA 3SDEA 1XN9A 2J9CA 2QFIA 4ES3A 4DR4K 1VQLS 5B0FA 3AO1A 1E6VA 1BDGA 5HN0A 2KT2A 2OD4A 2ALYB 3GSIA 2P1JA 5JMNA 2AKWB 3DLGA 3LAMA 1GNKA 1BWVA 2X6NA 2BE9B 3LOUA 1LWEB 4NZ7A 3KLHA 4CIFA 1PO6A 4B3OA 4DFMA 3DRPB 9ATCB 1S0OA 1WDDA 4ZHRB 2C2NA 2ZGZA 1VSIA 1UTAA 3JTPA 1F1BB 2ZH5A 5DZ7A 3FNNA 4JRQA 4W98A 2VODA 1WNSA 1REGX 3QRRA 4I69A 1BXNA 2X1BA 1U0HA 3T5HA 3OYDA 2WBMA 3CCJS 2QI2A 1JWWA 2ZD1B 4FLYA 2MKKA 3TQ1A 4ZVSB 3AXMA 3AO4A 1S0VA 3R8EA 4BQZA 2DRBA 5L1IA 2BJ9A 4KTWA 4LF6J 2M70A 4ISEA 1CQMA 3KXDA 3HXMA 1Q7YT 3SQOP 1YAGA 1W7WA 2I7PA 5A2QU 4JI4F 5LSOA 2GVDB 3D2FB 1WB9A 4ZVFA 1U04A 3TZWA 2QTWA 4OYAA 3VQEA 3UFCX 1BD6A 3VEXA 2AQ4A 2JHEA 2XWYA 1C0MA 3CJ2A 3VPZA 1N88A 2O4GA 3KUGA 3ITHA 1TL5A 3L4QA 1TELA 1HL6A 1SZ2A 3V4IB 2IVPA 5IM0A 1N33K 4Q0BB 4DV0J 3Q83A 2NRWA 1REVB 1IBMJ 3O2IA 1CG2A 5E3AA 4RWWA 1HX1A 2QEXN 4QS9A 2I0XA 2DR8A