1BQNA

Tyr 188 leu hiv-1 rt/hby 097
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPQKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNQQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Structures of Tyr188Leu mutant and wild-type HIV-1 reverse transcriptase complexed with the non-nucleoside inhibitor HBY 097: inhibitor flexibility is a useful design feature for reducing drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 114
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1bqnA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bqnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bqnA05
4IKAA 3QNOA 1ASUA 1RTIA 1SH2A 3LP2B 1JIHA 4CJRA 3BGRA 3SYZA 2IJFA 5KG7A 4WE1A 3HVTA 3QO9A 1C0TB 4CJPA 3AO4A 1I39A 4GC7A 4JS4A 3BSAA 3NAHA 3OSNA 3NBPA 3MXJA 5C25B 3CQ8A 4B9UA 2G8KA 1TK5A 1RT5B 1HYSB 3RTVA 4ECSA 5I42B 4K8XA 1HQEA 3H4BA 3PZPA 1N5YB 3OYHA 5FRNA 3VQ4A 3VQ9A 4AHSA 3L2UA 3CG7A 3RR8A 1FKPB 3AVFA 4DMNA 5HRPA 3M9OB 4JUZA 2IM2A 1RTDA 2HNYB 5KFUA 4DTNA 1EKEA 2G8FA 4EBDA 3RAQA 4DWIA 2D7SA 4C8KA 4CJFA 3GV5B 3IG1A 1JL2A 2IC3A 3SQ1A 4O3SA 4B9SA 4M45A 4EZ6A 4K8ZA 4CGGA 4FJMA 3BSOA 4OKEA 4DG1B 1RT7A 2BE2B 1HNVB 2YNIB 1VRUB 1VSJA 1NK5A 3AA3A 3NFAA 3QGGA 3K58A 1U49A 3L2RA 4HTUA 2B6AA 3RMCA 2F8TA 4EZ9A 2GIQA 1RT3A 3HVWA 3ZSRA 5F8GA 4M41A 1EX4A 4LQ9A 4BE2A 5F8IA 3ZSWA 2OZMA 5J2QA 4DTJA 4KI6A 3E01B 4HUFA 4YQWA 4DL4A 3CIZA 3MR3A 2HHSA 2KW4A 3MEGA 3RRHA 1CSJA 3WNGA 3M8SA 3AA5X 4FM2A 1SV5A 1IKVB 2BQ3A 3HM9A 5KGXA 2DY4A 3DRPA 3V9XA 3EPIA 2V4QA 3P1GA 3P83D 1NOYA 4MQ3A 1S1XA 4KHYA 4FBUA 4YMEA 3OJUA 1UWBA 4JS5A 4QCLA 3KIOA 3O4QA 1TQLA 4O3RA 4FJ8A 2ZKUA 3H98A 1A5VA 3AO5A 3ALYA 4IG3B 4WYLA 3QLHA 5J2MA 2FVCA 2F8EX 3AVKA 4N41A 2E9RX 2X74A 3H59A 1LWCB 1T05B 2UVUA 4Q8FA 1BGXT 5F8JA 3MEEB 3OYFA 3OYEA 2LSNA 2YHBA 1ZBHA 3N6NA 1C1CB 1KSPA 5KFGA 4GMJB 5KFDA 2C2DA 3TAMB 4CF1A 1VSFA 3PHEA 4JV1A 1NK9A 2PYLA 1DLOA 2G8UA 1RDCA 1WNEA 1XR7A 1RT6A 3PX4A 1KLNA 1TAUA 1S6PB 3DM2A 4FLYA 3VQ6A 4F8RA 1Q9XA 1TKTA 4DQIA 2AGQA 3ZSXA 2R8HA 3G10A 4FS2A 3AVGA 1XHXA 4QWAA 1JLGA 4LSNB 4NRUA 4ED2A 4B3OB 4PUOB 1Q9YA 1D1UA 3V9WA 1FKOB 4JV0A 4Q43A 1TKXB 2O4GA 3ZT4A 1ZTTA 4ECQA 2WONA 2IBKA 2GBZA 3BQ1A 4DFJA 1JKHA 3QETA 1RYRA 3BREA 3I5BA 5HP1B 2ZD1A 4K4UA 3F73A 1GOAA 3AVIA 5KFRA 3T3FA 3ZSOA 2R2UA 1S9EA 3LAMA 3HHKA 4ZP7A 4QW9A 3LP3A 2C2EA 4I2PA 1IKWB 3KLVA 4CK1A 2B5JB 5L1KA 2WRMA 1WAFA 3RB4A 4ZVHA 3HVRA 3OYBA 4O44A 1R0AB 2IM1A 4IFYB 3OS2A 3KKRA 1NJXA 2YNFA 1F21A 4BDZA 4H8KA 4CFCA 3V6HA 1MMLA 2W9CA 5DG7A 2RPIA 5HLFA 3KHHA 2XWYA 4TXSA 3RMAA 1XHZA 4R0EA 2E6MA 3KLGB 3H08A 2X6NA 3AVHA 4NCGA 4NLOA 1RBSA 2OPQA 1C1BB 2WOMA 4KBIA 3L3VA 2UVRA 2G8VA 1CZBA 5KT2A 1C0UA 3EY1A 3SPYA 4B9LA 3ASMA 3C6TA 4HUGA 4YR3A 3G6VA 2P1JA 2JC1A 1IO2A 2RN2A 2HHWA 4CFAA 1Z26A 5KFFA 4FLTA 4LSLB 1KCFA 3LP1B 3ZT2A 4DFPA 1EETB 3MXIA 1VSKA 4KREA 5EUHA 3TAEA 4C8NA 3IGVA 3UIQA 4DSKA 1L3VA 2YKMB 4G1QB 1SUQB 3V9UA 4N76A 4DEZA 1JLEA 3QZ8A 2AQ4A 1GX5A 2FJWA 5F8HA 1IKYA 5T7BA 4RW6B 5F8NA 4IRKA 1KLMA 4MFBA 4M3WA 1S1TA 4ID1A 4Z4FA 4RW4A 1YTUA 3DMJB 2VWJA 3V9SA 2OZSA 3G0ZA 1RT4B 3DRSB 3SJJA 4J9RA 5F8LA 5F9LA 4HHTA 4CE9A 1S10A 2FBTA 3QYYA 1ZTWA 5I3UB 4KTZA 3PX6A 2IA6A 4CIFA 4Q8EA 4DTXA 1EXQA 4DU1A 1X9WA 1HJRA 2XY5A 3CDEA 3BQ2A 2IAJA 3S3NA 2RF2A 3DLKA 2J6SA 2OH2A 4Y2AA 1BQMA 4DTSA 4TSXA 1NJZA 1IH7A 4N47A 3I0RA 3AA4A 4DF4A 2RDIA 4TY9A 3DLEA 2BGGA 1VSEA 4W5NA 1RTIB 1FK9A 3L2VA 4J9NA 4KTQA 3BGRB 1SKSA 3K5NA 2GV9A 2HHVA 4WE1B 3HVTB 3QO9B 4KFBA 3DRRA 3PO4A 5F8MA 3TABA 2RDJA 4C8OA 4E7LA 3ZSQA 5KFKA 3NBPB 1O1WA 3QEWA 2XGQA 1HMVA 1JLBA 1HQEB 3L2QA 4J2BA 1WSJA 2KTQA 3HPGA 3RB6A 1S1UA 1S1WA 4CK3A 4ZTJA 1RTDB 4EEYA 1RT2A 4CEFA 3H5XA 4DL2A 4LH4A 4BWJA 2BQRA 5DGAA 3AVJA 2DFFA 4URQU 4YR0A 4TYBA 2HHQA 3IG1B 3OYNA 2IC3B 4IRDA 4B9NA 4W5QA 1JLAA 4OPKA 3T5KA 1RT7B 2QK9A 1JL1A 3ZSVA 3KHLA 2B6AB 2A1RA 5T14A 1VSHA 2WB4A 1RT3B 4KO0B 3AO3A 3K5LA 4R8UA 5J2QB 3VQ8A 3I0SA 3QEXA 4WFZA 1BHLA 3N6MA 3FDSA 4FJNA 2A1SA 5KFZA 5F9NA 3TARA 4H4OA 3OHAA 2W7OA 3PW5A 1LAVA 1SV5B 3NKYA 1RILA 2Y1JA 2JEJA 3ITHA 1HNIA 5KFWA 1RBRA 4BE0A 2Z1IA 4I7FA 1BISA 4NLWA 1UWBB 4NYZA 2HW3A 4QWBA 2E9ZA 2VG5A 3CDWA 4E7HA 4IFVA 1NK7A 1RDAA 3QINA 1L3UA 3SQ4A 5HRNA 4RNNA 1NK4A 5DG8A 3CM5A 4DQQA 2PY5A 4ELVA 1S97A 4EYIB 4HCCA 3QLHB 4ED3A 3KJVA 5J2MB 1RDDA 1Z25A 1S0OA 4FZXC 4CHPA 1JLFA 1NKEA 4O5BA 4W5RA 3NF6A 3SCXA 3QEIA 1UOCA 1VSIA 4YFUA 3PJXA 4M3RA 4IBNA 4FM0A 1KVAA 3FQLA 4BE1A 3V1OA 4F4KA 5KGWA 4B8AB 3V1RA 5EDWA 3QIPA 4MK8A 2BRKA 4MK9A 3OYMA 4OL8A 2XGPA 4OGEA 3OYIA 2DPIA 1A5WA 1RT6B 4ID5A 1TV6A 2C28A 3DM2B 3K57A 2KFNA 1YTAA 1QE1B 1TKTB 3T5JA 4CEAA 2I1RA 1JLGB 2J6UA 2OPPA 1T8EA 3PR4A 1MU2A 2FBVA 1BCOA 3K2PA 2ETJA 2BRLA 3HP6A 3KK1A 3IAYA 1RBVA 3VA3A 4ED0A 2WONB 2HB5A 5JUMA 5FRMA 3VA0A 4ED6A 5KFIA 3EZ5A 4WZMA 1RA6A 3RR7A 4WZQA 3MR6A 1DTTA 4HYKA 1BIZA 3H4DA 4DFKA 1S9EB 5KG4A 2W9BA 4DL5A 2X6SA 4E7JA 3KD1E 2UVVA 2IM0A 3HJFA 1U4BA 3QESA 3PW4A 3LP0A 4O44B 1N56A 4FM1A 3H5YA 4CHYA 4QWDA 3GYNA 1U48A 2YNFB 2VG7A 3BR9A 4NLDA 1EP4A 3LAKA 2W9CB 4AHTA 3U3YA 2CJQA 5HLFB 5KG5A 4RW9A 4M94A 4FJKA 3H5UA 3BQ0A 2R7YA 3KMQA 3OLAA 3MF5A 3TVKA 3AO2A 4CF9A 2OPQB 4ZPDA 4KHQA 1CXUA 3IRXA 2XRIA 2JGUA 1C0UB 2D0BA 4FLWA 4B9VA 4DTUA 3MR5A 1REVA 1HRHA 1SH0A 1IKXA 3C6TB 2YNGA 4FJHA 1VSLA 2ASJA 4BDYA 4RUAA 3OS1A 3GV7B 3VQAA 1JLQA 4ZHRA 3L3UA 3PUFA 3SI6A 4OVLA 4RNMA 1D0EA 4NLPA 3VQBA 1W25A 3AVMA 4EYHB 2QXFA 4KV8A 3AVLA 1JXBA 4E19A 4ZTFA 2G8WA 3KTQA 3K5OA 3V4IA 3CO9A 1JLEB 4FJJA 1S9GA 4CJQA 3PO5A 3MEDB 4IRCA 1U09A 4L8RB 1RDBA 4RW8A 3CJ0A 4MFBB 4RG8A 4I9LA 1S1TB 3M8QA 4IOBA 1J5OA 4EO6A 4MK7A 4CIGA 3DLGA 4F3OA 4H54A 3B6PA 2I5JA 2FJXA 3CFOA 2XY8A 1B9DA 2P5GA 2FBXA 4KRFA 2HVIA 4E1NA 4O3OA 1CXQA 3NH2A 1D8YA 2BQUA 4DFMA 3UR0A 3M9MB 1BQNA 2XO7A 3KLHA 3V6DA 5DG9A 5KTQA 3QERA 4DTPA 2VA3A 3V6KA 3CJ3A 2OA8A 3KLEA 1N6QA 4CESA 1K1QA 1ITGA 4I2QA 1JXLA 2E9TA 5C42A 3DLKB 1J53A 1BQMB 5K14B 2X78A 2P51A 4Z4EA 2YNHA 2F8SA 4MKBA 4FS1A 3UQSA 1LWFA 3I0RB 4FCYA 3SUPA 3KLFB 3MFHA 3KD5E 2D0CA 1T7PA 4KB7A 3AA2A 2HHXA 1B9FA 3N6LA 3DLEB 5KFTA 3DYAA 4TQRA 2HVHA 1YT3A 3CJ5A 1C2PA 5KFOA 3DRRB 1ZBUA 4WXWA 1S1VA 4U6PA 3SZ2A 2G8IA 4Y34A 1S0MA 4IQXA 4ECVA 1NOZA 4CJUA 5KFJA 1KFSA 1OS5A 1HMVB 3Q8RB 4M3XA 4CERA 3S3OA 3ZT0A 2VA2A 1DTQA 5FDLA 4FZYA 4CIEA 3OL7A 1S1UB 1S1WB 2V0NA 4FVMA 2VG6B 3RAXA 2GUIA 1RTHA 3BJYA 1RT2B 3LALA 5KT4A 2PZSA 4FXDA 5KFAA 1QAIA 4EBEA 4K4ZA 5CYMA 3V81A 4HVJA 3Q8QB 2FLNA 4O0IA 1HYVA 4CHNA 4N56A 1UA0A 3OYKA 3KKSA 3MFIA 3D28A 1JLAB 3JSMA 2EHGA 2KQ2A 1X1PA 3ZSZA 3LP2A 4YR2A 4RNOA 4ZMMA 1RCHA 4J9OA 5D3GA 1XR6A 1SL2A 3SFUA 3OS0A 4R8UB 3EZUA 4LD0A 3NAEA 2R2SA 1SL0A 4M95A 3I0SB 5C25A 4DSFA 2KZMA 1JLCB 3VQSA 5SZTA 3VQQA 1WLJA 1U04A 4H4OB 1BL3A 4ECRA 2QV6A 2ILYA 3M9NB 1ZYQA 3ICLA 1FKPA 4O4GA 4CCHA 3GIIA 2HNYA 3ITHB 2FLLA 1HNIB 2O4IA 5HBMA 3Q8PB 4I7FB 4K4YA 4OGCA 3QGIA 4ECWA 1ZBFA 2VG5B 2HMIA 3VQ5A 2WTFA 4IFVB 3QEVA 1BCMA 3O3HA 4PWDB 4F2RA 2UUTA 1K6YA 4ED1A 4K4WA 3D45A 4BWMA 2B43A 1JLFB 1VRUA 3TAQA 3V9ZA 1TL1B 4FLZA 4E7KA 4CEDA 3L2WA 3GILA 4R5PB 3CDUA 4WYWA 3P5JA 3OYAA 3QIPB 2V4RA 3RBDA 2ZE2A 4K4XA 3NGDA 4ED7A 4OPJA 5KFLA 2YKNB 4ID5B 3F9KA 1TV6B 4KI4A 2Q3SA 4FJ5A 4Q45A 4RW7A 3WNHA 2OPPB 3C6UA 4E3SA 3S9HA 3PY8A 2ASDA 2O5DA 4KB1A 3KK3B 2WK4A 1KVCA 3KK1B 4JLHA 4WFXA 4CGIA 4RU9A 4J9PA 4NRTA 3SI8A 1WNSA 2YV0X 5HROA 1WAJA 1XR5A 1NK0A 3NGIA 1QTMA 2AGOA 5KFXA 1DTTB 3ZT1A 4CJWA 4XPCA 1ZETA 2QKKA 4CJ3A 1UA1A 1LWCA 3PW7A 3NGYA 1RNHA 2HHTA 4F4XA 2XCPA 5KFYA 5FROA 2ILZA 5CY4A 3JYTA 4AHRA 3LP0B 3BSCA 4FJ7A 2JEGA 2FVRA 2VG7B 1RDRA 2FVPA 4QAGA 1EP4B 1NJYA 1NK8A 2HHUA 4MKAA 2P5OA 3DLRA 4CJLA 2W7PA 3PJWA 1TK0A 4KHWA 3SUQA 3DOKA 4FJXA 3KHRA 4IR9A 3WNEA 3IRXB 1N4LA 1NJWA 4CHZA 1FKOA 4NLUA 2IMWP 1YVFA 3VQDA 1IKXB 3U3GA 4J2AA 2XHBA 4ZPAA 4M3ZA 3SV4A 3NMAA 3RB3A 4CJEA 5KFNA 2PYJA 2BR0A 3TAPA 5J2PA 3O3FA 4F4ZA 4TY8A 5E41A 3NAIA 1TAQA 4ECYA 4JRQA 4RUCA 4DLGA 4KV8B 4LH5A 4U7CA 3IS9A 1S49A 4RZRA 4OKJA 3OYLA 4X2BA 3GIKA 3V1QA 2FBYA 1R0AA 1ZBIA 3PX0A 1S9GB 4MIBA 1S9FA 2XC9A 3TAFA 3QIOA 4CJVA 2IM3A 1XI1A 4O4RA 4K4TA 4RW8B 2GIRA 4B08A 5KFCA 4HCBA 3MEGB 4FLVA 3O4NA 3T19A 4KHNA 2XY6A 3M8QB 1QHTA 2Z1HA 3DOLA 5J2NA 1J5OB 3DRPB 3TR8A 4KAIA 3DLGB 2HNDA 3SPZA 3RBEA 4K4SA 1C1BA 1QQCA 4M42A 1S1XB 3GIMA 3KHGA 1XC9A 1QAJA 1NHVA 3NL0A 1KFDA 3THVA 1BQNB 1T94A 2AWZA 2OPRA 3KLHB 2D3ZA 4ZVEA 3V6DB 4CEZA 4ZPBA 3KNAA 1KHVA 1HPZA 3CFRA 2BDPA 2E6LA 4KPYA 2Z1GA 1VRTA 1N6QB 4LSLA 3UDLA 2AGPA 3OYCA 2OPSA 5C42B 3PW0A 3HL8A 2IS3A 3HXMA 4CEEA 1LW2A 3TAGA 1S48A 4FJ9A 4BDPA 3VQCA 3RWUA 2D5RA 4NLSA 3CYMA 5KG3A 4K4VA 3GQCA 3NF7A 3NF8A 3DYAB 5L1LA 4FW1A 1BI4A 3OYJA 3QGHA 3LWLA 3TANA 4EBCA 1DLOB 3DI6A 4OLAA 3EPGA 5L1IA 3HP9A 4ECTA 1RT1A 4QOZB 3SNNA 4I9QA 3H40A 2D3UA 2HWIA 3HYFA 4FK0A 1S0NA 1S1VB 1U47A 3FQKA 3PVXA 2YHAA 4DQRA 1SKRA 4WFYA 5DLFA 5C24A 4UQGA 3LPTA 2V9WA 3HT3A 2RKIA 3OL9A 2DFEA 4FLUA 1KTQA 2HAIA 4DQSA 1DTQB 3KK2A 5FDLB 3K59A 3NH1A 4DL7A 5KFVA 3ZT3A 1JKHB 4KE5A 3OYGA 2ZD1B 1HYZA 3V6JA 4J9KA 1S6QA 5CYMB 4CJKA 3V81B 2FJVA 4B8CA 5HRRA 2AU0A 1QSLA 4I2PB 3U6FA 3AO1A 3OYDA 5J1EA 3VQPA 3JSMB 4KHUA 2OYQA 3VN5A 4FYDA 5KG1A 4FJIA 1WSHA 3S3MA 3OJSA 3FFIA 3MECA 4MH8A 3CM6A 1QSYA 3D0PA 5D3GB 3SFGA 4CJTA 4DF8A 1D5AA 1ASWA 2ZQBA 5KG6A 4FK4A 4NLXA 4CJ4A 3K5MA 4NCGB 5DMRA 4Y3CA 4AILC 2WOMB 4FW2A 1LW0A 5CZ1A 5KT6A 5DQIA 4FLXA 1CZ9A 3NH0A 3HPHA 1G15A 2R2TA 3OSPA 4ICLA 1KRPA 1RBTA 4F3TA 4O4GB 4AH9A 1L5UA 4NCAA 4NLTA 5HBMB 1QUVA 4OLBA 3NGZA 5KT7A 5KFMA 4ZP8A 4TQSA 1K1SA 4XIUA 4H4MA 2HMIB 4ZP6A 5KFQA 2JEIA 3SQ2A 1C0MA 1LWEA 1RTJA 3HKWA 1ZBLA 4PQUA 1JX4A 4IG0A 3RB0A 2WHOA 3VQ7A 1IKYB 3PR5B 2HWHA 1UAXA 4ELTA 1KLMB 4AHVA 3QEPA 2Z1JA 4CF2A 4RW4B 4KO0A 4DL3A 1X9SA 4PA1A 4KKOA 4DL6A 2JC0A 1FXXA 1S5JA 4KB0A 4JRPA 2ZE2B 4B9MA 1T03A 4DSJA 4RNFA 4DS5A 1TGOA 5KT5A 1HQUA 1SKWA 3B6OA 4C8LA 2W9AA 3DDKA 1VK0A 3HPOA 5CYQA 4ECUA 4RW7B 1TKZA 3TQ1A 3C6UB 2KFZA 2IAJB 4ECXA 2RF2B 3HSTB 1BIUA 3KLIA 3NHGA 5KFEA 1SH3A 4F4YA 4IDKA 3O3GA 1C6VA 5HROB 2QE5A 4J9MA 1JXEA 5EWEA 1TK8A 4E89A 4W5TA 1FK9B 3KOAA 2ATQA 1T3NA 1WSIA 4KSEB 3LWMA 4AHCA 4J9QA 4NLGA 1YVUA 2FC0A 2C22A 4KFBB 4ED8A 5KRSA 3JYTB 4DTMA 4CGHA 4YNQA 1IG9A 3NCIA 5EU7A 4IR1A 4DSEA 2R8JA 3OL6A 4GC6A 1A5XA 2IJNA 1JLBB 2BANA 4QW8A 1CLQA 2WCXA 1KVBA 1Y97A 2QKBA 5HRSA 1TVRA 3PW2A 1QE1A 3HO1A 5KG2A 3NDKA 3DOKB 4Q0BA 4M3TA 1TL3A 4IH6A 1GX6A 2IOCA 3AVBA 3A2FA 4NLYA 3SQ0A 3C95A 4FZZA 2R8KA 4DU3A 5KRTA 1WN7A 1L3SA 3BDPA 4OJRA 2HNZA 4EP5A 3QZ7A 4IKFA 3M8PA 3CFPA 5J2PB 3RMDA 5KFPA 3MTKA 2W42A 1TP7A 4TY8B 2EC0A 4CJ5A 4DLEA 4IH7A 1RYSA 4F4WA 2R8IA 1C0TA 3IS9B 1KHWA 3FRZA 1J54A 3G6XA 3OL8A 4E1MA 4DTOA 1RT5A 1HYSA 5I42A 2XI2A 4ELUA 4QWCA 1N5YA 4RNHA 5KI6A 4AHUA 3DOLB 5J2NB 3FSIA 3AVAA 2HNDB 3T1AA 2AX0A 1HARA 1TKDA 4LQ3A 4CEOA 3ISND 1L3TA 3L8BA 1U45A 4DQPA 1RBUA 5JS2A 2OPRB 4CFDA 5KG0A 1GOCA 4E0DA 1HPZB 3SUNA 1VRTB 3KJVB 4NYFA 4DG1A 2OPSB 3M8RA 2BE2A 4O55A 2JEFA 1HNVA 3GIJA 2YNIA 3T5HA 1LW2B 3HVAA 3OLBA 3LZIA 3VQEA 4ZVGA 3TWHA 1B92A 3MEDA 3E01A 1BI4B 3I5CA 4BACA 4M3UA 1VSMA 3DI6B 4F50A 4EO8A 4Y1CA 1RT1B 3TI0A 5JXSA 1IKVA 5KFHA 2E4LA 4NLRA 5KFSA 4E7IA 1S4FA 1MU2B 4CFBA 2VWKA 5C24B 4F2SA 1I3AA 4O0JA 3AVCA 1NHUA 2RKIB 5KT3A 4J9SA 4O3PA 3ISNC 3QIDA 3KK2B 4GW6A 4Z4HA 3H5SA 3H2LA 2D0AA 3T5LA 4NLQA 3BSNA 4IG3A 4CGJA 2NUBA 1S6QB 2C2RA 4O3QA 3RMBA 3QNNA 4C8MA 1T05A 3G6YA 2W9BB 4KHSA 5K14A 4QWEA 3MEEA 4Q44A 4TYAA 1NNDA 4KHRA 3KLFA 4Z0UA 4FJGA 1GOBA 4LY7A 1C1CA 5J1EB 4ECZA 1J9AA 3OY9A 2XY7A 1XWLA 3TAMA 2ASLA 3GV8B 3FFIB 3MECB 4HKQA 3ZCMA 4CF8A 3IN5A 1NKCA 2W8LA 4Y2CA 4OKKA 2KZZA 4XO0A 1S6PA 4RW9B 4FBTA 4K50A 3OVNA 3LANA 2R8GA 4DSIA 3C94A 2AJQA 2XI3A 4ZVFA 4Z4GA 4LSNA 1LW0B 2AX1A 4J2DA 3G86A 2W8KA 1LAWA 4B3OA 4PUOA 3CJ4A 2CKWA 3KMSA 1TKXA 1D9FA 1REVB 1WSFA 1X9MA 3MXMA 4CHOA 3AVNA 3I8DA 4ICLB 2YNGB 3ZSYA 2VG6A 2Y1IA 4KHMA 4CEQA 2ITGA 3CWJA 3PV8A 5HP1A 1Z4UA 4W5OA 1JLQB 4ZHRB 1N48A 1C1AA 4URSA 3SV3A 4H4MB 4PY5A 5DGBA 3MR2A 1VSDA 4TLRA 1IKWA 2B5JA 1LWEB 3V4IB 4O3NA 3NE6A 1RTJB 4J2EA 4PQUB 1ASVA 3OHBA 4IFYA 1Q8IA 4IG0B 2XCAA 3RRGA 4YP3A 4NLVA 2UVWA 4CJSA 4ZP9A 1WSEA 1W9HA 4MIAA 3MAQA 2B4JA 1NKBA 3DLHA 3ULDA 4CECA 2IDOA 4KKOB 3KLGA 4CEBA 2I5JB 2R2RA 5SWMA 5DK5A 3SUOA 2FVQA 4WXOA 1JLCA 2ALZA 1T03B 5L9XA 1HQUB 2DPJA 4DTRA 3IGNA 4Z4CA 4B9TA 5EWFA 5KFBA 5CYQB 4CHQA 1TKZB 4Z4IA 1QSSA 4Q5VA 3KLEB 1RA7A 4I2QB 4KTWA 3LP1A 3KLIB 3D5MA 1SL1A 1EETA 1IM4A 4QPXA 4IDKB 4CGFA 2YNHB 4NCBA 2FLPA 1LWFB 2G8HA 2YKMA 4G1QA 2ATLA 1SUQA 5CZ2A 2JLEA 3E51A 2J6TA 5DQHA 2DFHA 4PWDA 2IGIA 3LPUA 3HK2A 1I6JA 5DQGA 3LDSA 3LZJA 4RW6A 5L1JA 1TL1A 3I5AA 3CVKA 4EP4A 3NF9A 5JS1A 3DMJA 4R5PA 2D41A 4NZ0A 3Q8SB 4XPEA 1RT4A 5C5JA 4KAZA 3DRSA 3EYZA 2BANB 1LV5A 2GC8A 2YKNA 1D9DA 2EX3A 2DTUA 3WNFA 5I3UA 1TVRB 4DU4A 4JV2A 1NK6A 4FK2A 4CK2A 4TN2A 1WSGA 3DLBA 1RTHB 4URGA 4HUEA 4Q0BB 4DS4A 3CJ2A 1TL3B 1W0HA 4NYNA 4M3YA 4N5SA 3KK3A 2UUWA 4GVMA 4CGDA 4CF0A 2F96A 4FJLA 5EWGA 3UPFA 4G3IA 3AV9A 4J9LA 4Y1DA 5DLGA 4IH5A 2HNZB 4ZPCA 1QS4A 4DSLA 2FVSA 1RAJA 3M8PB
chains in the Genus database with same CATH superfamily
4CIOA 1T9UA 1SQFA 1JIHA 3GWCA 2LXUA 3SYZA 2IJFA 3C6HA 4WE1A 3AO4A 2BM1A 4GC7A 4JS4A 3E9LA 4H03B 5IQQA 3NAHA 3THWA 1K8AT 3NBPA 2G8KA 1TK5A 1RT5B 1HYSB 1X4GA 3RTVA 4K8XA 4X66J 1WUUA 1HQEA 2B7CB 2VWBA 2A18A 2VZ9A 3JAMO 3VQ4A 3AODA 3VQ9A 4BRFA 2I8EA 1MROA 4DMNA 3M9OB 4ETXA 2I9SA 1CLFA 3IXQA 2G8FA 4B9QA 3CD7A 5AXKA 3JXOA 4B3SF 1LFPA 1YITN 3WHIA 2IC3A 1VQ8S 4O3SA 4M45A 1JNZB 3THXB 1HL6A 4CGGA 2G0IA 5K9FA 5EN1A 2NR0A 3UN3A 1HNVB 2YNIB 4I56A 3AA3A 3WXJA 4Q7AA 4DUZJ 1GLFO 4HTUA 2B6AA 4K5RA 2GIQA 4CD1A 4PG7A 2ZH3A 3SDEB 2OZMA 3GJQB 2XSJA 5JLHA 4HUFA 3CUNA 4YOWA 2N4CA 3QBXA 4PXCA 1F2GA 1ZM9A 3M32B 3MEGA 3U1LA 2X1BA 3M8SA 4Q2MA 4FM2A 2DY4A 2A41A 4UY8O 2FY1A 4LBHA 3V9XA 3P83D 1S1XA 4KHYA 2O8BA 3OJUA 3PRBA 3ADAC 3WIUA 3O4QA 1JK9B 2DISA 4JV5J 1FXDA 2ZKUA 1NCLA 2VFSA 5J2MA 4PKDB 5AQTA 4GVBB 1T05B 4Q8FA 3BF4A 3QDKA 1DQAA 1OVQA 3OYFA 3ATVA 5AFUH 2KHCA 2RIJA 1W2BR 2P9EA 2NRWA 1KSPA 1VJQA 4DV5F 2WVBA 2UV8A 3T6BA 4NMLA 4DUZK 5AJ3J 1QVFM 5CYJA 2PYLA 1EIYB 3I56S 3CDAA 2HSTA 1RT6A 2Z0GA 2ZBCA 1TAUA 2D69A 1P9YA 4F8RA 2EBGA 3VQ6A 1TKTA 3TU5A 2A6MA 2R8HA 4FS2A 4JI8J 4IZ9A 3R2DJ 4NRUA 2KXNB 3WT0A 1D1UA 3UWTA 4Q43A 2DNGA 2R7UA 3M30A 4X62F 3AA8A 1BD6A 3C7NA 2RQ4A 4A4JA 3UKRB 3HZGA 2IVFB 1JKHA 2DCLA 3QETA 5IT9Y 1GOAA 3AVIA 1NMDA 2XYGB 4PXDA 3CJQA 3A4TA 3L3CA 1S9EA 2FQQB 2RSQA 4ZP7A 4QW9A 2C2EA 3KLVA 4CK1A 5HMWA 2B5JB 2WRMA 2YKAA 5F2RA 3FVYA 3T7ZA 3N01A 2YNFA 2D1CA 1NJIO 2MZQA 5B8HA 4WU3A 4DZDA 3O8WA 2RPIA 5HLFA 2CPEA 4JI0J 2E6MA 4DV3F 1PBUA 4NLOA 4JKFA 2OPQA 1FRJA 4KBIA 3NP5A 5EX3A 2VJUA 3BP8A 5AJ3K 5KT2A 3EY1A 3SPYA 4B9LA 2GWKA 2P1JA 4OI0A 1MMDA 1QLNA 3CC4S 2DNKA 3O1LA 1Z26A 1M90T 2LDYA 4CLTA 5HL7L 4KH5A 1VSKA 4KREA 1W97L 5EUHA 3VAGA 2Z2YB 3AFGA 1VS3A 4CLZA 3UIQA 1P8ZA 1F3VA 4G1QB 4IOCQ 2MB0B 2ZFHA 4N76A 4JNEA 1WC1A 2QGFB 3EE8A 2YWKA 5F8HA 5T7BA 5ADZA 2B7BB 4IRKA 4J9UE 2JFDA 1VC5A 4B1YB 4W90B 3AQOA 3EN9A 2W4DA 2C2NA 2KJVA 2YCHA 2XMUA 3G0ZA 4NLBA 1RT4B 2GVZB 2Z58B 2J0WA 4TU7A 3SJJA 4J9RA 1YWXA 4BGAA 5F9LA 3ZZOA 5D0RA 3IR7B 3W7BA 2CWXA 4H5NA 3TJ9A 1WC0A 3JTOA 3HSZA 3ZTQA 2E7VA 2KDOA 3OHRA 5B08A 3VAFA 4J90A 4CZJA 2EI5A 4WTYA 3VVUA 5HVFA 4TSXA 2X3GA 3KUHA 5EXWA 1DRZA 4BRAA 1FJGF 4DF4A 4LUBA 3FZLA 4TY9A 4AL6A 2BGGA 4MLEA 3VAIA 2P9GA 4H0YB 1MN9A 2V7YA 4J9NA 1SKSA 5KOXA 2HHVA 4WCEL 4C11B 2HFNA 1KTVA 2RDJA 1M5KC 4ZIWA 2XLJA 4E7LA 4RX6A 2DGQA 2M2BA 1FD8A 3C16A 2DNNA 2QLXA 2XGQA 4R0JA 3EGZA 2KTQA 1NGFA 3AJ2A 1S1UA 5IM0B 2HMPA 1X3NA 3HZEA 4EEYA 1RT2A 3P8BB 2NNWA 2LEAA 1U1LA 2GVDB 2BQRA 5AQHA 4AL7A 1MWMA 3LDNA 1XJWB 4YR0A 1WKLA 4TYBA 4XAKA 2PEHA 5JJBA 1U24A 2G0JA 2Z57B 4W5QA 1SBRA 3H46O 4HEA9 3T5KA 1JJCB 2FHMA 1RT7B 2RB7A 1H7WA 3GG1A 3E9OA 3R9LA 3ZSVA 2KM8B 1OSCA 1VSHA 9RUBA 3K5LA 1ZZNA 2OLWA 2HVDA 3VQ8A 4YB5A 1R8HA 2VODA 2HF3A 1LAVA 2CQ3A 2XHCA 2Z4PA 4LIRA 4FNIA 3BB5A 4F9OA 4LRDA 2LEPA 1NGGA 4W98A 1FCAA 4Y2IA 1HNIA 1NO8A 4OZLA 4ZCLA 3FRYA 1FDBA 4NLWA 1UWBB 1WB9A 2DCUB 2MZTA 2VG5A 4X64F 5HRNA 4H5WA 5GMKa 3CM5A 2E7XA 2PY5A 1S97A 2CQ2A 1WC4A 3FZKA 5TKYA 4ED3A 1RDDA 2ZOFA 1S0OA 3P45B 1JB0C 1Q78A 1RXOB 1NKEA 3SCLE 2O8CB 3QEIA 1UOCA 1VSIA 2JFKA 3PJXA 3I4HX 4M3RA 3KHYA 3SCIE 2GJ2A 1KVAA 3DC2A 4F4KA 3OVAA 2ZH1A 2AA4A 4IO1A 2QWNA 5KGWA 4B8AB 4MK8A 4MK9A 2OEKA 3OYMA 4CYUB 2YJEA 3OYIA 3PKYA 2B9EA 3QICA 3O3LA 3GFYA 2QFJA 1S59A 1A5WA 5E7OB 2C28A 3K57A 2VC1A 1QE1B 1ULRA 4L3NA 2OPPA 2AP1A 3DRXA 3HP6A 3Q24A 4ZK7M 3KUEA 5IS2A 4LF9F 3NEKA 3IAYA 1HNXF 1RBVA 2WONB 2WC9A 1X5OA 2VKRA 3VF6A 1KAZA 3EZ5A 4WZMA 1PKUA 1YJ9N 4WZQA 2Q2RA 4A8YA 4WF9L 2ZBPA 3NVMA 2KRBA 3H4DA 4P2XA 1HNZF 3KD1E 1UCNA 2Z30B 3KXDA 4JYAF 1RHKB 3QESA 2VD3A 4JI3F 4C3MA 2RHQB 4DOZA 4CO1A 1LFWA 3H5YA 2OFHX 2MEWA 1I3OB 1S72N 3AQPA 1MDUB 2FXUA 4FJKA 2Q66A 2MGZB 4H5VA 2R7YA 5IZHA 3I8BA 3AO2A 4CQ1A 2HBMA 4ZPDA 5A6PA 4B3RK 3IRXA 1FE0A 2RRNA 1C0UB 2QA4S 2V7ZA 1W2BM 3CJBA 3MR5A 1REVA 3TRGA 2HGLA 4O8UA 4FJHA 1JMTA 1YBTA 2QWMA 5ETVA 1L3KA 3VQAA 3VESA 1JLQA 2JHEA 4NLPA 2F8MA 3AVMA 2JX2A 4KV8A 4A8XA 3KTQA 4YOUA 1JLEB 4FJJA 4CJQA 1K8KB 3TQEA 3FNNA 5HMYA 1U02A 1WEXA 1FFSB 4NA2A 4I9LA 4HH0A 4IOBA 4EO6A 2V68A 3TX8A 3EZWA 3DLGA 4H54A 2I5JA 1JCGA 3RSEB 1FNXH 4E1NA 3SAFA 3QJPA 1CXQA 1D8YA 1BDGA 3DU6A 4CLFA 1N5TA 3R5CA 1BQNA 4Z2XA 2OMLA 4FWQA 3CT9A 2DR5A 4CESA 1ITGA 1JXLA 4BY9C 4JD2A 5K14B 1EZZB 2LEBA 4Z4EA 5H1SQ 4LT6A 4L73A 3M1FA 2HHHK 1LWFA 4FCYA 3SUPA 3KLFB 4RO0A 4IOXA 3TYTA 1SIWB 1VQNN 2C1EB 3PACA 1I94F 4USVA 2CVIA 1UKUA 3CJKA 4TQRA 4B1VA 1EAYC 3CJ5A 4U6PA 1N54B 4ANEA 3J80U 4Y34A 4CJUA 5KFJA 1HMVB 3VTIA 4M3XA 4DR2F 1DTQA 1B7FA 4FZYA 4CIEA 5DZ7A 1S1WB 1WF2A 1RAHB 2EFQA 1QZ6A 1RJJA 5KFAA 4CBUA 4Y2MA 4HVJA 1BOTO 2W6KA 1VHIA 2CGKA 4CHNA 3BN7A 1JLAB 4OZ1A 4ZA1A 2KQ2A 3RBZA 3ZSZA 2VKZG 1K0VA 3BO3A 3CETA 2P9IA 2WW8A 1VIXA 1TUGB 1XR6A 4ZLPA 3LL3A 3OS0A 2QA1A 3EZUA 2P9KA 4OJ3A 4CRJA 5C25A 1OWXA 4FN5A 4O5FA 2KZMA 3VQSA 1D3WA 2IRYA 2M0GB 3VQQA 1GLDG 1BL3A 1WUAA 1SKUB 2V8GA 3FMBA 3MMVA 4NA1A 1FKPA 4FYVB 4A57A 3M1VA 4O4GA 1M5PC 3ITHB 1K73T 4BRKA 1T9TA 4DR7K 4PQAA 5LMNK 4OGCA 3PLAA 5H9EJ 1ZBFA 3RJMB 4F0MA 5A2QU 2E1RA 5J1NA 1AZSA 1VHXA 3QEVA 3NS6A 1NB2A 3C8YA 4PWDB 2DPNA 1I5OB 2W6LA 5EX0A 3D45A 3J7YU 3VGKA 4HWIA 1XEZA 1T11A 1S77D 4DB3A 1ELOA 2UYTA 4DV2F 4C0HA 5JICA 3G87A 2JLFA 4CLLA 2PMZD 2UU9J 4R5PB 3N9UC 3R7BB 1U6FA 4NXMF 3MUMP 5AQVA 3DHXA 1YJVA 3NGDA 4ED7A 1EJ7L 2YKNB 4DV6J 2EFVA 4AYBD 2XO6A 3GR1A 1TV6B 3WXKA 5HQLA 4FJ5A 3VEVA 3WNHA 3M2RA 1FA0A 3R5DA 3PY8A 2O5DA 5AQOA 2R4FA 3M2VB 1KVCA 3D6RA 1WWHA 5LMUF 5DDRC 3MPYA 1XR5A 4HT7A 2AGOA 2O8EB 2A10A 1DTTB 3ZT1A 3OTOF 3UVJA 4H5RA 3R5AA 1LWCA 3CCTA 3PW7A 5H9EK 4OYOA 3CCVS 4F4XA 2XCPA 1HBUA 5FROA 1YRUA 5CY4A 2P6SA 4AHRA 3LP0B 2FHJA 2QLFB 2D4WA 2VG7B 2VDIA 3UNYA 4QAGA 4KJIA 2NS1B 1NK8A 4MIWA 1SPBP 1H2UX 1UZDA 4BC5A 3DLRA 2UU9K 4DV1F 3LDQA 1TK0A 4Y2KA 3O6WA 3PKMA 1HQ2A 1N4LA 3UE5A 1FKOA 4DV6K 3JS6A 2J9CA 3BY5A 5HATA 4F02A 1WI8A 3MAHA 4X65J 1U26A 4M3ZA 1ATNA 2NSBA 2NXCA 4HTLA 1YUWA 1T9WA 4LF7K 3O3FA 1FFGB 4TY8A 4LFCF 3MPDA 4CLKA 4QJVA 3AGKA 4OKJA 4U96A 1FD2A 2GGPA 2H5IB 1UEKA 2NRVA 3HMJG 3ZXWA 2XC9A 3TAFA 3C46A 3LOUA 4RW8B 3BGFA 4DR5F 4RBVA 3MD1A 3MEGB 3O4NA 2ATCB 4KHNA 1XN9A 1QHTA 2AYEA 5J2NA 4DR6K 3W3DA 1RCXB 2HNDA 1TL7B 3HRGA 1S1XB 3GIMA 4QBUA 3E66A 2FSNA 4Y65A 1QAJA 2AP6A 1Q82O 5HL7Q 3L9ZA 2QTWA 2OPRA 4CEZA 2D3ZA 2RT3A 3HOTA 1ILYA 5K8OA 1N6QB 4LSLA 2POKA 2BA9A 3GG4A 3PW0A 3CCEN 1CJVB 3OFGA 4AE5A 4CEEA 2MLXA 3EWGA 4KGKA 5BR8F 4WP8A 4FJ9A 2FJEB 2KB2A 2ZH4A 5KG3A 1EHWA 2M88A 1ZAXA 3T1YF 3LWLA 5CD4A 3DI6A 2ZBIA 2JWLA 4B3SK 4QOZB 3SNNA 4I9QA 2JDJA 3ZTRA 5GAHI 2EK6A 1S0VA 3D6HB 2YHAA 4P7TA 5C24A 4UQGA 4DV0J 4PKHA 3LPTA 2GW8A 1Z2LA 2ASMA 3OL9A 2RKIA 3CD0A 2DFEA 2E2QA 4C3KA 4DV4F 2E44A 4RBUA 1XMBA 1GT8A 1SVDA 2AV5A 1CZAN 1N88A 3ZYYX 2E88A 1JKHB 3E3XA 3WDOA 5D4PA 4KE5A 3D0HE 2VPWB 3OYGA 4J9KA 3CQYA 1K9MT 3MM7A 2AU0A 1X5TA 3MWBA 2ITMA 3RVCA 3OYDA 2DNRA 5JVGL 3VR1A 5BXIA 2RUGA 2UP1A 2OYQA 2UUBJ 5LSOA 4CZMA 3DN9A 4ITSA 4LFAF 4EHUA 4FJIA 4IOAL 1DZ5A 3CM6A 4TU9A 2ZJPL 4DF8A 3D9BA 5KG6A 3ZLJA 4NLXA 4BRNA 2CJAA 1D4XA 4Y3CA 2WTUA 2V8PA 5CZ1A 2OTLN 5DQIA 2CNLB 3TPQA 2AJ1A 3OSPA 4CP5A 3VAMA 4ICLA 3QFWA 1O13A 2ZHOA 3QT5A 1L5UA 1U8WA 4HI2A 3M6VA 4M5IA 3VAKA 4H4MA 1F0XA 1Q16B 2A2CA 4JI6F 2QEXS 2CH6A 3PIOQ 5AQMA 3A8JA 1IR1A 4YOXA 2W4CA 2L41A 4YY3J 5LOQA 4GKJJ 3HKWA 4PQUA 1SC3B 2VBXA 3MM5A 3RB0A 3VQ7A 2M70A 4ILLA 3PEJA 1AROP 3EO3A 4NO7A 4ELTA 5A8WA 4CF2A 3MCAB 1VQPS 4PAAA 1EB0A 4DL3A 1MG7A 1IUJA 1WOPA 2DNQA 1RSCA 4DL6A 3HI0A 2UUBK 1S5JA 1RDUA 2P9PB 4F67A 1HI8A 3E1YA 4H5TA 4DSJA 4CTAB 1GLAG 2PDAA 1WC3A 4M5LA 1VQLN 1HPMA 4HHJA 3B6OA 4BR7A 4HI1A 1VK0A 3TQ1A 3NS5A 2N3LA 3VAHA 1MWQA 4UUWA 4ILRA 2GQCA 4GNIA 1OSDA 3KWGA 1TUUA 4DBQA 1YJUA 1C6VA 2UXDF 4FXVA 3CI5A 1QDUB 1WBBA 1UJ4A 5EWEA 2R7QA 2PA8D 4GKKF 3TUZC 2HZCA 4CI6A 4P72A 1WSIA 4KSEB 3ZTPA 1U2CA 4J9QA 2FC0A 3QAUA 2ZZTA 2A40A 5KRSA 1ATSA 2ADCA 4DSEA 2FF6A 1HBNA 3C16B 4JI7J 2IRUA 8ATCB 2BANA 1RWPB 2FTRA 3TVZA 2WCXA 3NWGA 1Y97A 5HRSA 4AL5A 3PW2A 1PBAA 5AQYA 3ZZZA 5KG2A 3P38A 2VU5A 1U25A 3EUNA 3CCLS 1SI9A 3AB4B 4XEIA 5M1PA 1YDLA 1FRIA 2IOCA 3R5GA 1QD1A 4WF9Q 2X3DA 3SEOA 2R8KA 4JOUA 5KRTA 5CABA 3OUYA 2K3KA 4OJRA 3JAMU 4IO9L 4IKFA 1BA1A 3L4QA 4KHPJ 1TP7A 3CCRN 4CJ5A 4IH7A 1B0PA 2NCKL 1KVJA 1YJ7A 3R7SB 4DL0C 3CJ1A 2VC0A 3NRBA 1NBWA 4PEOA 3RG6A 3HTVA 5H1SV 3Q23A 1NHKL 3FRZA 4E1MA 2KG1A 3B78A 3HZ6A 5E3PA 3HHLB 4TU8A 4ELUA 4QWCA 1N5YA 3QJLA 4CH7A 5HN0A 1U8SA 2L9NA 3PJ9A 2XBPA 4OHZA 3DOLB 4BRMA 1X4FA 4MTPA 1MWZA 3AVAA 1DEJA 3OTEA 2D0PA 2DTJA 4CEOA 4LREA 5CXTA 1L3TA 4DQPA 1MA9B 5KG0A 3VGLA 1GOCA 1E3MA 3CCMN 3UNGC 3BGLA 2XMAA 4TVAB 4O55A 2PC6A 4ZJQA 1M1HA 1LW2B 4PG6A 5HJXA 3BEXA 4CT8A 2HAFA 1YJWS 4LVNP 3MEDA 3J7Z5 2WVDA 4X64J 1BI4B 4QOTA 4C23A 2O01C 2JVRA 2PI4A 4U7UK 4CZIA 3TI0A 1IKVA 2CQ0A 4J8FA 5KFSA 4E7IA 3ZX3A 1S4FA 2VWKA 2MKSA 4O0JA 3AVCA 4BC4A 2Q79A 5KT3A 4J9SA 3KK2B 3TZWA 1S3XA 3H5SA 4F0HA 1OO0B 1KN6A 4IG3A 2PE8A 3UN5A 1S6QB 3RMBA 1CVJA 3QNNA 2PT0A 4C8MA 3G6YA 4RUBA 3MEEA 1NNDA 4MYTA 3NG8A 4BROA 2CQHA 3ZNUA 4Z0UA 1D9AA 4XK8C 2O67A 5J1EB 3KDNA 2ZH8A 5AE1A 3IRWP 2VQFF 4LF4J 3GV8B 5D4LA 3D4JA 1M1KT 2CWKA 3ZCMA 3IN5A 3NXZA 4XO0A 4LBPA 2WVFA 2XI3A 2MQQA 1WG1A 4X64K 4JP8A 5M1OA 3O08A 2RHSB 1LW0B 1H74A 2AX1A 3G86A 2W8KA 4PUOA 1P90A 3G2XA 3KMSA 1TYQA 4A61A 1D9FA 1SQEA 1REVB 7FD1A 1GMWA 2ZC3A 2HSEB 3LM9A 1FRLA 2DXEA 3CWJA 3PV8A 2VFUA 4CI0B 1FDAA 3ID8A 1JLQB 2HS3A 3FR0A 2J9EA 3SV3A 3QRRA 2MQNA 4FOEA 2ZBRA 4PY5A 5DGBA 4TLRA 1Q79A 1U6BA 1LWEB 3T9ZA 3NE6A 1NDCA 1RTJB 3PDNA 1ASVA 3OHBA 1Q8IA 1JJ2R 3RRGA 4I4BA 1RKIA 4NLVA 2UVWA 2OGUA 5ETMA 1W9HA 5C12A 2G4BA 4LF9K 2N7CA 4WKYA 1HNXK 4CECA 4KKOB 4L6V3 4CEBA 2I5JB 2W2MP 1U1PA 1IQTA 2NPFA 2DVIA 4C0BA 2ALZA 4LF8F 2Q31A 4OYAA 1Y3KA 2DPJA 4DTRA 2MQOA 4PKGA 4Z4CA 2OHDA 4FDFA 2LU2A 2EEYA 2HGMA 1TKZB 3DLJA 4Z4IA 1P1LA 1S76D 4Q5VA 4ZLNA 2CZ9A 3UKUA 4JI3K 4KTWA 3LP1A 3MMCA 3D5MA 5JVHQ 4YB7A 1EETA 3D2EB 4IDHA 2VPZB 3DAWA 4IDKB 1U1NA 1LWFB 2G8HA 2DH7A 3MURP 3DLLL 1YXQA 2YY3A 4HTIA 2DR7A 4G6VB 2DFHA 3JTNA 3CJKB 2IGIA 3GDQA 3TNVA 2O8FA 3CC2N 2XZDB 4RW6A 3NF9A 3FE1A 3IM9A 4S0MA 3SSSA 3Q8SB 5DS7A 2QLWA 1TELA 2AW0A 5C5JA 1HWUA 3I33A 3DRSA 4A8OA 5CR4A 5L9NA 1D9DA 1I94J 1V5VA 2DTUA 3WNFA 1VQ9N 3WXMB 2XZTB 2P9LA 1NK6A 4FK2A 1UVIA 3ZZUA 4NYNA 2NZTA 4AXIA 2ZJQQ 1T6CA 4GVMA 2NXEA 2F96A 4CO2A 4P2SA 1Q18A 5EWGA 3RYLA 1RGIA 3AV9A 5DLGA 1U0HB 2NXUA 4IH5A 1H98A 1ESVA 2GJIA 1OY6A 4FXWA 2XYHB 1RTIA 1HW9A 2OCEA 2OKQA 2P9IB 1SS6A 3W60A 5KG7A 1WD6A 1C0TB 5C2CA 1DT9A 3OSNA 4RWWA 3HM8A 5C25B 4NL5A 2K7KA 4ECSA 5I42B 2WVEA 3CF5L 3OYHA 1FKPB 2FUG9 2ZH9A 5EGYA 4JUZA 2IM2A 1F9HA 5KFUA 5F3TA 4DTNA 1KQFB 1HW8A 2CAJA 4BQZA 1X4DA 2DNYA 3J80Y 3GSDA 1I94K 2ZOGA 3IG1A 1Z6RA 1GLBG 4B9SA 4LF5F 4EZ6A 1Y64A 3BSOA 5AZJB 1AFJA 3MK6A 1ZC6A 2BE2B 3OW2R 5L46A 3J7YP 1EKSA 4JI4F 3C19A 2OSQA 3S8SA 1U49A 3L2RA 3RMCA 2F8TA 3ZSRA 4B3MF 4DR2K 2M8HA 3A5LC 1URRA 4LQ9A 1MWKA 4DTJA 2X51A 1RKJA 4KI6A 2OTJS 2HBJA 3E01B 4JKEA 5ITHA 4YQWA 1PJ6A 5FPEA 2HBLA 2F7VA 1CSJA 5BJRA 2DRAA 3CCJN 1SV5A 2LCWA 3HM9A 5KGXA 2KFYA 4P2MA 4MYUA 3EPIA 2V4QA 4YUDA 4YMEA 1FTRA 2MYFA 3U1NA 4JS5A 2D3OR 4OYXA 2RE2A 2CQBA 3OR2A 4O3RA 3DGPA 2Z2MA 4FJ8A 3ALYA 1GXTA 2YWEA 3KZBA 3QLHA 4G9ZA 3DJCA 4FP9A 3GFXA 3W2VA 2HQ3A 2F9TA 2E9RX 1V6HA 1LWCB 1ZM2A 2X7IA 4B02A 5F8JA 5KQ8A 3CB4A 1KD1O 2YHBA 2CJXB 4FF3A 3N6NA 4ZN1A 1AW0A 4N7TA 5A2QY 2JJ4D 1BG3A 3NOCA 1IBMJ 3TAMB 2DR6A 1WNEA 3PX4A 2ZOMA 1S6PB 2Y1LB 3DM2A 4NXNJ 3ID6A 1KBRA 4K0KJ 2AGQA 3GP9A 4IXCA 1NXIA 1VLYA 3G10A 2FYXA 4LSNB 4QWAA 5JLFA 5MAOA 3QFUA 1B99A 2DRDA 1FKOB 1HBOB 3EVWA 4F7VA 1ZTTA 1O51A 3BQ1A 2IVMA 2FIUA 5HP1B 3F73A 3F2KA 5T7LA 5KAKA 3CD6N 4NXMK 3E2EA 1AB8A 1ZPVA 4AQYJ 3LAMA 3BKFA 4I2PA 1CEZA 4ZVHA 4X66F 1WOSA 3HVRA 2RHKA 1V3RA 2ALYB 4I64A 2ZJPQ 1R8PA 4CM2A 1IVZA 4BDZA 3HULA 4CFCA 3A12A 1QM9A 2W9CA 3KHHA 2XWYA 3RUBL 5AQXA 1XHZA 2P9SB 2WBMA 3AVHA 2D9PA 3NLCA 1IBMK 1VDHA 3ZO7A 4C8ZA 1CZBA 4X4RA 4LRCA 4NXNK 3ASMA 1R7IA 1UW4A 5IV3A 4K0KK 1S79A 2MKHA 1YJNS 2OI2A 2JC1A 2RN2A 3BBFA 2DITA 4DUZF 4LSLB 4C2MA 4QS9A 3UI3A 4DFPA 3ZT2A 3MXIA 3I55N 3OTCA 3ZZRA 1HBMB 3D0GE 2FZKB 4ZVTB 1LK5A 1KONA 2UV8G 2YKMB 3VETA 1SUQB 1UW9A 3V9UA 1OPIA 5G0RA 4DV1K 1QQMA 4EUVA 2J7WA 1S12A 2DNMA 5F8NA 4PCQA 5B0FA 4Z4FA 2DR8A 2OZSA 1YSJA 1FEEA 2X1FA 5AQFA 2QT7A 4JV5F 5F8LA 3OV7A 3ENOA 4CE9A 2FBTA 3RAMA 5I3UB 4ZDNA 4LFCK 1PCAA 3QWPA 2FD2A 5DRKA 3PX6A 5CCMA 1JJ2M 3DXKA 4DTXA 1EXQA 3ENVA 3PYDA 5FD1A 1X9WA 3LDOA 1HJRA 2E20A 3ZX0A 1J27A 3DLKA 2J6SA 3MM7B 4C8YA 4IQMA 3KVGA 4QQBA 1ZPWX 3M8YA 4DR5K 3I0RA 3S7RA 3T6JA 5C2GA 1SQGA 2HBQB 3MMAA 3M4XA 3HKZD 5AJ3F 5T41A 3AJDA 4JI5J 4W5NA 4LRAA 4CO5A 3F0NA 3L2VA 4KTQA 3BGRB 2JVOA 3GLJA 3HVTB 3QO9B 4JI8F 4OYMA 4YB1P 3KWMA 3VVTA 3PO4A 2DGTA 2W40A 1UVKA 4F4AA 3ULEB 4NEYA 2VBYA 2ASYA 1RFQA 3P31A 2WUSA 3G25A 1WHXA 3HPGA 2EWSA 1GLCG 4J91A 2E7WA 3RRKA 5BR8K 1RTDB 2V34A 1CULB 2E1ZA 5DGAA 1VQ5N 3T1YK 3IC1A 4URQU 2QRRA 2HHQA 1HHTP 4IRDA 2BXJA 1VQMN 2H4WB 2Q6CA 2FZCB 5CZXA 4O23A 1G7CB 4U95A 1N8RT 4LVOP 4JI0F 2W2NP 1FRHA 1JL1A 2GELA 3VTHA 5DM7L 5A8WB 3EGNA 1RT3B 5AFUA 2PMHA 2HFSA 3POTB 1HNWJ 4R8UA 5J2QB 2IDLA 2W25A 5JMVA 1BHLA 3FDSA 2YXLA 3CEDA 3AAQA 3OA9A 2A1SA 1E6YA 3CERA 1H3DA 2Q36A 4H4OA 3OHAA 3PW5A 2H3EB 3EVMA 3D2FA 4YEAA 4DN9A 3NKYA 2CUYA 1RILA 7FDRA 2CQGA 1VIOA 1RWOB 1RBRA 5F0WA 2Z1IA 4KGXB 1RB0A 4I7FA 4GO7X 1BISA 2W7AA 5EHHA 3HSCA 2HW3A 4QWBA 2E9ZA 4ZITA 2M52A 2J76E 4IFVA 3R6LB 4CLYA 3SQ4A 3IAS9 3J8AA 1YITS 5GAEI 1NK4A 3FEYB 1C4CA 4DQQA 3O1BA 5A0YB 1IBLJ 4WP3A 4EYIB 4HCCA 2J9DE 2MJNA 2XB2D 4UTGA 1SJFA 3H1QA 5HI7A 4FWMA 1M90O 5E33A 1JLFA 1U6ZA 2G9OA 1Q81T 3SCXA 3B82A 3JQJA 4X4TA 2UUCJ 2GO9A 4HHUA 6AT1B 4BE1A 4DPTA 4ILHA 1CC8A 5F41A 2E2PA 3CC7N 1T95A 4EK2A 2BRKA 4OL8A 1M0SA 3SMPA 1GH8A 4OGEA 3EM1A 1N52B 4HR2A 5A8KB 5C15A 2KFNA 5FLXY 1RACB 3RU0A 3T5JA 3OW2M 5ETPA 3NWRA 3MOJB 4KQZA 2I1RA 1JLGB 1SIZA 1NBEB 2J6UA 5IC4B 3K2PA 2BRLA 3E9PA 3KK1A 3OVBA 3HFVA 3D7EO 3AOCA 3J81U 5F0XA 3VA0A 3OUYB 2IRXA 3H45C 3C3LA 1NJIT 1HHSA 4HYKA 1GMWD 4OX8A 1PYSB 2W9BA 2KYXA 2XS7A 3HJFA 4MLHA 2YX6A 1AFIA 4GY2B 5DJBA 4O44B 1N56A 4FM1A 1IBLK 1FFWB 1IM6A 1YJRA 3OTDA 5LY3A 3BR9A 3GR0A 4M5JA 1IBCB 3U3YA 2CJQA 2UUCK 1SXLA 5E5NA 3HHLD 4JHDB 8RUCA 4B1ZA 2H65B 2C3PA 4HDHA 5I3QA 2JGUA 2D0BA 3W61A 4B9VA 4FLWA 3VEOA 4GKKK 1SH0A 3QBCA 1IKXA 2IMOA 3C6TB 2YNGA 5GAGP 3OBIA 2ASJA 3FCVA 3PM9A 2A5XA 3OS1A 1SJ4P 5AZIB 4ZHRA 3SI6A 2Y1RI 1FX2A 1W25A 5BRFA 4H0OA 4EYHB 2QXFA 4WK3A 3QFHA 2NYIA 3X3UA 3D6FB 4EFAC 2KT3A 1S9GA 3PO5A 3MEDB 2FGOA 1U2RA 1N34J 1RDBA 3JAMY 3WXIA 4IOCL 1QAXA 3HOSA 1FNOA 4MFBB 1S1TB 3M8QA 1VK8A 3BKTA 1Q5YA 3QRPA 4X84A 4R79A 4UZCA 2FJXA 2XY8A 2ZEJA 2P5GA 3P3DA 4B1WB 3OT9A 2HVIA 1X4CA 1NMNA 2AJFE 4Z37A 5RUBA 2BQUA 4DFMA 3AOBA 1WF0A 3TVYA 3KLHA 2P9NA 5KTQA 2KU7A 2OA8A 3N5BA 2DK2A 4I2QA 2E9TA 5C42A 1J53A 1BQMB 1G2EA 2YNHA 3PHTA 2CIMA 3UQSA 5HMXA 1HUXA 2D0CA 4EU0A 3AA2A 2DHHA 3DLEB 5KFTA 3TTCA 3CHWA 3DYAA 2LA4A 4ILMA 1YT3A 1RWWB 1X8DA 4TNOA 3O9UA 1WHVA 5B0BA 1WJ9A 5K5MA 5CAAA 5GAHU 3TZZA 1TFYA 5KFOA 3DRRB 4OFZA 2B0GA 1Q0NA 3SZ2A 2G8IA 5HJYA 1NOZA 5EX5A 4ECVA 3F41A 1N34K 3RW7A 2XMTA 4J7CA 4XH5A 3S3OA 1VYAA 3ZT0A 2VA2A 1T3OA 5FDLA 4JI1J 3MM8A 1UZHA 3G96A 3PNIA 3OR1A 4F3QA 2VUGA 2PZSA 4FXDA 4EBEA 1RDWX 2QZ8A 2CYYA 1KEKA 5CYMA 3V81A 2F9JA 2NPIA 1HYVA 1SZ2A 2E1CA 3BGUA 2NXNA 3MN6A 3OBYA 2F3JA 1BO5O 4A8KA 4FPRA 1Q86T 3JSMA 4OI1A 3KJNB 1OQ3A 2C2ZB 1CG2A 3LP2A 2E1PA 5D3GA 3VF2A 1G3OA 3U27A 1SL2A 3SFUA 2WZ1A 2R2SA 1FHTA 4E98A 3I0SB 5AQJA 4DSFA 4FZVA 2ZKTA 2EFNA 2MQPA 4ZS6A 3I87A 4KH1B 1N36J 4ECRA 2MZSA 1WF1A 4CCHA 1NM1A 4OO1J 1W7AA 1Q5VA 1HR0J 5HBMA 3Q8PB 3MMCB 3UB5A 2VQFK 4JI1K 3VQ5A 1UVJA 4KC5A 1W7WA 4X4OA 4CBXA 2OIHA 4F26A 3WUHA 1QVFR 3GJTB 3LGHA 2C3UA 2XLIA 2GEMA 4X4VA 1UEUA 3OTBA 3O3HA 1K6YA 3I9ZA 2B43A 1VRUA 2DGSA 4FLZA 1F1BB 3MM6B 4E7KA 2HIQA 4CEDA 3L2WA 3GILA 5CQGA 2EKYA 4WYWA 3QIPB 3CO0P 2E5JA 3TWZA 2IVYA 2C42A 3RBDA 3LQVA 2ZE2A 2MKJA 4KBOA 2BEFA 1FTCA 5GVQA 4OPJA 5L38A 4ID5B 2CXEA 2CQIA 2I7NA 2P9LB 1Q7YO 4RW7A 4P9SA 3C6UA 4F36A 4E3SA 5E3RA 3D1HA 3LM2A 3R6MA 1N36K 5AXNA 4JLHA 4PHTX 5I9EB 2ROEA 3QAEA 1N33J 3CJ9A 4FWNA 1WNSA 5HROA 3DGVA 1NK0A 2CADA 1HR0K 2H5JB 3EVOA 5KFXA 1WBDA 3H0PA 2B4PA 2QKKA 3CXCR 2AJ4A 2YPZA 4CJ3A 1RNHA 4LF8K 4ZN3A 2ILZA 3VCDA 5LSLA 3SMSA 3BUZB 3BSCA 2OJ3A 4FJ7A 2FVRA 1FJEB 2OELA 4ZVRB 4OZ0A 1EP4B 2K1RA 5LJ5Y 4MKAA 2HHUA 2LU1A 3UDVA 2ZWPA 5B0DA 2JRSA 1PG5B 2MLZA 3PJWA 1REGX 2AT1B 2WSEC 1CJKA 2VF3A 4M5DA 2QO3A 2I0XA 4ED4A 2IMWP 1VQON 1XMQJ 4J2AA 1BC6A 1ZM3A 4ZPAA 1YTYA 4P52A 2VQEJ 3G82A 5B09A 3SV4A 3CJSA 1NG9A 4QPTA 2BR0A 3TAPA 4FVCA 1YJ9S 2YHWA 3JQKA 3VGSA 3NAIA 4DLGA 4RUCA 4CZFA 1D09B 1N33K 4EI2A 1Y5IB 3UN2A 4RZRA 4L3KA 5ETKA 2CQDA 3GIKA 3V1QA 2FBYA 1R0AA 4CZKA 4MIBA 1S9FA 4XDCA 2IM3A 3SQOP 4O4RA 2Q1NA 3CMEN 4CD3A 5KFCA 1S72S 3T19A 1J5OB 2H48B 5BRDA 3SPZA 4FF2A 4NI2A 1RHJB 3RBEA 2UXBJ 4K4SA 1XC9A 3VEYA 3X1LB 2XLKA 3THVA 1ZXOA 2KT5A 3W2WA 3OR2B 2UUAJ 1TFWA 1T94A 3M2UB 4ZVEA 3ELHA 3V6DB 1VFJA 1B70B 1HPZA 3CFRA 2BDPA 1VRTA 4LFBJ 4I0WA 3UDLA 2AGPA 2F7TA 3W2VB 3B4MA 2D74B 5GINA 3HXMA 2UU9F 1GEHA 2GX8A 1KQKA 1S48A 4M63A 4FKXA 1XMQK 2VQEK 4CNZA 3IUCA 3RWUA 2FF3B 3GJSB 3BN4A 4CJ7A 3RGIA 5HQMA 2LFVA 3NF7A 3AD7C 1C0FA 4DV6F 4FW1A 3TANA 4MAKA 3KWIA 3MPWA 5I4MA 4OLAA 3OPKA 3H40A 1B3TA 3RW6A 1S1VB 5IXUA 1U47A 3FQKA 2CNKB 5DLFA 4G65A 2DNLA 1KTQA 2HAIA 4U67Q 3BPSP 3I6PA 4DL7A 2Y8WA 5D0GA 2VFTA 4RTFD 2UXBK 3D0IE 4B3MK 1KVIA 5T7LB 3V6JA 4CJKA 2FJVA 4B8CA 5HRRA 4I2PB 2VFVA 2QWOA 4OI6A 3OFEA 1H0HB 1RHMB 4DXLA 3TEGA 5AE2A 3VV2B 2AEMA 4LIWA 1VQNS 1S22A 1S7HA 4K7QA 3ZETA 1QSYA 3D0PA 4IFEA 1C0GA 4CJTA 2R7VA 4DDFA 3IBFB 4OI4A 4CBWA 4CJ4A 1G6BA 3PFEA 3AARA 4AF1A 1UFKA 2NUUG 4X65F 1X4BA 1E6VA 3HPHA 1G15A 3R1HA 3R9PA 2J0XA 1KRPA 2ZJRL 1GNKA 3LO3A 4F3TA 1BY9A 3C15B 3TZXA 2VOPA 1XMOJ 3U8XA 3GJRB 1QUVA 3SQGA 3NCPA 5KFMA 4ZP8A 1Z1ZA 3VENA 1Y5LB 1NNEA 1K1SA 3IMQJ 1X4HA 1GMUA 2HMIB 1XK8A 4ZP6A 3SQ2A 1VQYA 4WFBQ 5GAGI 2ASOA 5DM7Q 4C1NK 5CCLA 4IG0A 1XC3A 2YH1A 2I6WA 1UAXA 4FWKA 3PTWA 3BGOP 4Y28C 2LLZA 5BYQA 4PA1A 1RAEB 2JC0A 4KB0A 3FZMA 2BW2A 2ZDPA 4OPAA 4B9MA 2HBZB 2MPUA 1VR6A 4USMA 5CHIA 3D1QA 1Y0HA 4DS5A 2PFFB 3HDSA 1CQNA 3KG0A 3W9JA 4C8LA 3BO4A 3HPOA 2V52B 3M8ZA 4PZVA 1RGVA 2V8HA 4QR1A 1H38A 2KFZA 1MW7A 4X66K 2KVQE 4ECXA 1WG5A 3HSTB 3EGVA 4FOIA 1H72C 2V63A 3B6BA 3MMAB 4J9MA 1JXEA 1R89A 3HI9A 4OYBA 3K7RA 2IVNA 2ATQA 2QL5B 4BGBA 2W1BA 4ED8A 3JYTB 4DTMA 1YK9A 4DV0F 4CGHA 1HWKA 2L3MA 2DIUA 2R8JA 3QT8A 2IJNA 2KXFA 3HHEA 2O8DB 2APOA 2COLA 1KVBA 1IWGA 1VGYA 4NB4A 2MQ8A 4UOFA 3DOKB 4YOVA 3K89A 1TL3A 4IH6A 3A3NB 1TR0A 2VPXB 2YWGA 1TMJA 4ER8A 1GX6A 3AAWB 1WC5A 1OH8A 2OSRA 4QYZJ 4BRCA 3HCXA 3BZQA 1IXKA 2UUBF 1L3SA 3BDPA 3D66A 2HNZA 5IT0A 4RJVA 1RLDA 4V19S 2ZGZA 3ZZYA 2KT2A 2GZOA 5J2PB 3RMDA 5KFPA 1MMNA 2GJFA 3AGRA 1S57A 4F4WA 4JV5K 2R8IA 1K9MO 1QQOA 1HA1A 2BJ1A 3IS9B 2N82B 4YHHJ 4ZVUB 2OO4A 1SC4B 4V19J 3G6XA 3OL8A 2PD1A 1BUPA 4DTOA 1RT5A 1HYSA 1X5PA 3UD4P 3NGRA 2PGCA 1M5VC 4RNHA 2MXYA 4DHYA 5CA5A 3D2FB 1DURA 1X0PA 1LEOA 5KI6A 4GV9A 1T6DA 4QU7A 4A8WA 3FSIA 3IAM9 3TW0A 3CXCM 3T1AA 2HURA 2AX0A 1HARA 5K20B 1Z2ZA 2HBYB 2Q43A 1YHQN 3P4IA 2QMUB 4NZ6A 2V9KA 3MR7A 4YY3F 4GKJF 3ZEUB 4BRPA 1U45A 5U47A 1RTZA 5DO2A 1I1GA 4CFDA 4E0DA 3A8IA 4JI8K 2ERRA 1R6YA 4WQ5A 2PAVA 1WI6A 1X31C 2CPYA 2OPSB 1HNVA 3THYA 4K43A 2YNIA 3T5HA 4DR4J 1DKGD 2GHPA 4FPAA 4A8QA 3HVAA 4CZLA 2O3DA 1NRKA 2WVCA 3TWHA 2OUGA 1S7IA 4BRGA 3T1HJ 2PO4A 4BACA 1S6UA 2IFXA 3M32A 4EO8A 3HD2A 1RT1B 2OD6A 5IT9U 2VCPA 1BQXA 2E4LA 4NLRA 3DKDA 1YZ7A 1WOQA 3TSPA 1ACMB 2NLXA 1I3AA 3QIDA 3AAPA 5EY4A 4GW6A 4JI0K 4KRWA 3BDEA 4AD6A 4CH1A 3FKBA 3BSNA 2HRYA 1NLVA 4JBCA 3MM9A 4BVPA 1WELA 4CGJA 2RQCA 4QZVB 1XTZA 1Y11A 8AT1B 2GTDA 1T05A 2W9BB 3SBMA 4ZVSB 3CCES 4TYAA 1S99A 4JI7F 4WWSA 1RAFB 2GUPA 5AQUA 3N79A 2XY7A 4TKTA 3H2VE 1G1XA 4DR4K 2ASPA 4CNYA 3FFIB 3MECB 1ZBTA 4CF8A 3M8WA 5CHCB 1T9VA 5FIIA 1NKCA 2W8LA 4OKKA 1VRQC 1CS4B 2KZZA 4FWRA 3LANA 2HKEA 2RMLA 1FEHA 3T1HK 2ZWOA 1LAWA 1AUSL 3MCNA 1X9MA 3MXMA 4CHOA 3UKRA 2YNGB 4UOHA 4N8OA 4WPAA 4OJGA 4KHPF 2Z8QA 2XWXA 1RI7A 4ZHRB 1HX1A 2RS8A 3P5BP 4URSA 4NA3A 5M1FA 2W01A 3W5XA 2ZM6J 5E3AA 3MR2A 2G0CA 4HVZA 3FBBA 2B5JA 2IVOA 1HKGA 4J2EA 3R3LA 2HLUA 2NQPA 2NRXA 3PIOL 1CPZA 2CA9A 1WSEA 1PJ7A 4WKRA 4ZVQB 1XNQJ 4DX7A 2FY8A 1NKBA 4A5AA 1JJHA 1F2HA 3DLHA 1RWVB 4KGVB 5M1QA 5DK5A 2FVQA 3H20A 4WXOA 1X60A 4DHVA 2BE7D 1T03B 5L9XA 1ROFA 2OTLS 1HQUB 2ZZMA 5EWFA 5KFBA 5CYQB 5M1KA 2I7PA 2KHOA 3SBGA 4L76A 3J7ZT 4CZGA 3ZNJ1 3NCRA 4I2QB 4C48A 2RU3A 3KLIB 3EX7B 4PKIA 2I2YA 3SCJE 3O4WA 2WB1D 1U2VB 2YNHB 2DHAA 2FLPA 5BYRA 2E8AA 3Q83A 4PWUA 4G1QA 2LQ8A 2ATLA 5DQHA 3B4DA 1I6JA 4USTA 3LZJA 1MLAA 3I5AA 3ZTSA 4EP4A 5GAHP 1NZAA 5C0YA 1WTBA 1UJ5A 2D41A 4NZ0A 3FZHA 5M2PA 1RT4A 3JSYA 3FGUA 1WHYA 2GVZA 2FC8A 2EBEA 1XNQK 2MSSA 1TVRB 3DOMB 4JV2A 1KOOA 3BKUA 2ZUAA 3L09A 5GMDA 1WSGA 4URGA 4Q0BB 4DS4A 1P6TA 1W0HA 1ZAVA 1T9YA 4N5SA 1O0PA 2GO8A 3KK3A 2L48A 3QNWB 1OYEA 3MMJA 2QG9B 3SIPB 4LF4F 4J9LA 3CCQN 2HHPA 2VGMA 1UPPA 3CIPA 3EJMA 3M8PB 4IKAA 3MTJA 1ASUA 4C6AA 3LP2B 4CJRA 1R8BA 2P8IA 3ZTOA 1FO1A 4WQ4A 4U7UD 4C11A 1I39A 3FCWA 2KRRA 3U02A 2Q0UA 3BSAA 2ROGA 4BCAA 3MXJA 4B9UA 2YPYA 2ZNYA 3H4BA 5FRNA 4HH1A 2E5HA 3CE8A 2DEIA 1J5EJ 3L2UA 5IM0A 1FXRA 3OQ2A 3AVFA 5HRPA 2ZITA 2VH7A 1EKEA 2GVDA 3M05A 2JL9A 2D7SA 3FMWA 2KI2A 3WBZA 3GV5B 3SQ1A 1IWAA 4DR3J 2YKQA 3CJ7A 2YJFA 2F8HA 1FX4A 4DG1B 3FSYA 4P73A 1RT7A 2XMVA 1VRUB 1VSJA 1QTNB 3QGGA 2EWHA 4JI2J 3CCRS 3W66A 4EZ9A 2XS2A 4M41A 1VQ4N 1EX4A 3EZOA 2Q3PA 4BRDA 4ISEA 3H1VX 4UT4A 3Q2SC 3MR3A 1EQ0A 2HHSA 2KW4A 3RRHA 3WNGA 5K8NA 3AA5X 4DI6A 3MDQA 4P71A 4A59A 3DRPA 2HEKA 3P1GA 1NOYA 4MQ3A 4FPBA 2V4JB 4ZVOB 4FBUA 2FZGB 2EFGA 1UWBA 4QCLA 2HFZA 2BJ7A 2Y0SD 1H73A 1J5EK 2ZBQA 2DNZA 5GAEU 4F3MA 2HVEA 2HS4A 5BPMA 5M2RA 3IWNC 1A5VA 3AO5A 4WYLA 2FVCA 3CCMS 3DWLA 2F8EX 4N41A 2X74A 2UVUA 4OHYA 5C2DA 3V4MA 4K8RA 2VJVA 3OYEA 5ETNA 4I6MB 1C1CB 5KFGA 4M63C 3VERA 1N5QA 4JV1A 2K1RB 1NK9A 4JI2K 1U0SA 4OYZA 1XR7A 3VGTA 4FLYA 1RWMB 1W2IA 1Q9XA 3O5TB 1Y00A 4MDBA 3AVGA 2HS0A 4ED2A 1SJQA 4B3OB 1Q9YA 1KQGB 4JV0A 1TKXB 5DM6L 4B3TJ 2O4GA 5KPTA 4ECQA 2WONA 4Z7YA 2GBZA 3BZCA 4DFJA 1TUYA 2C3MA 2P6TA 1RYRA 3I5BA 4DZ6A 5M1NA 1FERA 3O9TA 5KFRA 3T3FA 3ZSOA 2MZRA 2CPJA 3MCOA 4HT5A 2H51B 2B8QA 4OHXA 3LP3A 1IKWB 1CJUA 3VZIA 3MAAB 1WAFA 3RB4A 3OYBA 1R0AB 2IM1A 3WXLA 4IFYB 3KKRA 1NJXA 1F21A 5HAOA 5D4NA 5EOYA 1MMLA 3GYGA 5DG7A 3ENQA 2E2OA 4TXSA 3TSUA 3WEEB 4H4KA 4RWTA 3B8AX 2MGZA 3KLGB 5E0OA 5CH7B 4HDGA 3CJAA 2C2MB 1RBSA 1CJTB 2ZJRQ 2G8VA 4ZLJA 3K8VA 1C0UA 2V2QA 3O2IA 4HUGA 4YR3A 3G6VA 1IO2A 3GBTA 5HSPA 3IM8A 4CFAA 5KFFA 4FLTA 2RVJA 1AT1B 3MMBB 5B0CA 4B3TK 2JWKA 3TAEA 1HKAA 3IGVA 2OAUA 4XTTA 4DSKA 1L3VA 4DPWA 3DDIA 3KJQB 1NM2A 5JVHL 4DMZA 1JLEA 1K8KA 1NGIA 2MQMA 1GX5A 1YIJN 2FJWA 1IKYA 1KR4A 3U7JA 1R43A 2A1BA 4K42A 4M3WA 1UMJA 3OXLA 3W8GA 1YTUA 3DMJB 2VWJA 1HKCA 3HT0A 4AFFA 3NNAA 1ZA1B 3BO2A 2KLAA 2CPDA 3RSEA 1KWMA 2W41A 1S10A 1U1MA 1ZTWA 5HK4A 4N77A 3DXMA 4CIFA 4KYZA 3R8YA 2PMWA 5AE3A 4F0KA 3O1WA 1RP5A 2G2OA 2BUPA 4DU1A 2MSTA 3L4BC 3BQ2A 3S3NA 4K2XA 2RF2A 2LVWA 1KAYA 4DTSA 1NJZA 2BKOA 1RBOB 2ZJQL 1IBMF 1KDNA 4E2FB 1HFEL 2RD5C 2HK3A 3TTFA 2QJ3A 3UDEA 4PPDA 2A42A 5KPRA 1FK9A 2ZNZA 4NXNF 2XSFA 3ZETB 2P5VA 4K0KF 3K5NA 3CC2S 2GV9A 1RHRB 4WE1B 4FWOA 2J7KA 2VICA 4XH4A 2M8DB 2AMCB 3D6MB 3THWB 2B4UA 3NBPB 1O1WA 1Q8BA 1OVYA 3QEWA 2KKZA 3J81O 4QIEA 1HMVA 1HQEB 1E6VB 1WSJA 1V9OA 2QYCA 1R31A 2QMWA 2C2KB 1S1WA 4DR1J 4CK3A 2CNNB 1MROB 4RKUC 4ZTJA 3KG1A 2Y0BB 3P4UB 1VQ9S 2YVSA 3T9NA 1R27B 4AQYF 3HFKA 4UOGA 3SQGB 4BWJA 4C1NI 4Z7CA 1D8ZA 3AVJA 4MO4A 1YG0A 5MLCV 5HANA 2NZCA 2K2PA 3OYNA 2IC3B 2E5LJ 4YDXA 1VK3A 2JLGA 1R8CA 1JLAA 2QK9A 1B4SA 1NGAA 2DGVA 5IWAJ 1VBXA 2B6AB 2A1RA 5T14A 2R7XA 1T3VA 5AT1B 5FPMA 2CDRB 1N32J 2XSJB 3QEXA 4WFZA 3N6MA 4J9VA 5KFZA 5F9NA 3TARA 3D7SB 2UZAA 2W7OA 2VYPA 3A5OC 2Y1JA 1Y5NB 2V2ZA 1FKAF 2HVZA 2JEJA 3ITHA 1DY3A 5KFWA 2ZUGA 4DX5A 1EO1A 3TTDA 2FDNA 2O8BB 1EQYA 2MJUA 3CDWA 1RDAA 1L3UA 3QINA 1SC1B 2L08A 2AHOB 4ZJOA 2PFUA 1P9QC 3W1YC 3KJVA 5J2MB 3ETMA 3FZFA 4FZXC 1VCTA 4CHPA 3N4QA 4O5BA 4W5RA 4RLEA 2AEJA 2H4YB 1WC6A 3R5BA 4X65K 1NSPA 2E5LK 4WQ5C 3CMAN 2LQJA 3FQLA 2LQBA 2GCFA 3J7A1 5EDWA 2BM0A 2VHGA 2CQ1A 2XGPA 1OY8A 3K5PA 4F25A 2DPIA 1RT6B 1TV6A 3VEXA 1N32K 2NZ4A 1TKTB 2RNEA 3CCJS 4CEAA 4W92B 3O44A 3PR4A 1MU2A 2ETJA 2DH9A 2SXLA 3M2VA 4AM6A 4HHHA 3A5NC 4E1JA 4KH6A 3M30B 3GPAA 3C7NB 2HB5A 5JUMA 4L3QA 4JI5F 5FRMA 5B7WA 5KFIA 1GTHA 3A5MC 3ILOA 5E2QA 3P96A 3Q22A 3MR6A 2O8EA 1DTTA 1S9EB 5KG4A 1EARA 3SSRA 4DL5A 3VWSA 2X6SA 2UVVA 5GADI 2IM0A 2KO1A 5ETSA 2HYIB 3LP0A 1OQ6A 2QIFA 2HG4A 3GYNA 3ULHA 2YNFB 1WOOA 3LW5C 2VG7A 3GU0A 4NLDA 2QSFA 3LAKA 1NSQA 5HLFB 3EMTA 5KG5A 4RW9A 4O8KA 2HQIA 1GAOA 4CLUA 3BQ0A 3KMQA 3MF5A 3TEHB 1GMVA 4CF9A 2OPQB 2BJ3A 4KHQA 1VHFA 3V5RA 1WACA 2LXIA 4DTUA 3UCZP 3FCHA 3J7AN 1VSLA 1OH6A 4BDYA 1VLOA 4FWPA 3AY9A 4DV0K 3L3UA 3PUFA 4OVLA 4RNMA 1D0EA 1G4CA 2CQCA 3THYB 3VQBA 3TR5A 4R25A 1HNWF 3Q7CA 3CD6S 2H9ZA 3VHQA 2LYVA 3MUTP 4ZTFA 3V4IA 3G4SN 3CO9A 1O6XA 1ZS6A 2BH1A 4IRCA 3WQPA 1U09A 4L8RB 2IJRA 4RW8A 1M5SA 1N8RO 1OIAA 4I6YA 4WIQA 2DYAA 2DY1A 3G6EN 4DCPB 1HIYA 4USUA 4F3OA 3B6PA 1DBDA 1TL7A 3HSDA 1S4EA 1B9DA 3ZZPA 2QW9A 4O3OA 3NH2A 4DCHA 1IBLF 2XM3A 4DCOB 3UE2A 2XO7A 1W26A 3ENWA 1LWXA 2CJYB 3QERA 4DTPA 2VA3A 3CJ3A 1LK7A 2FLOA 3MM9B 3VOVA 1N6QA 1XNRF 1K1QA 5LM7E 1QVGR 2UUCF 1PJ5A 3VEWA 2E29A 1CJVA 5E3CA 2X78A 3EDRB 1YBUA 4OMFG 3I55S 4MKBA 4FS1A 3KD5E 2ROPA 1T7PA 2G1DA 1F60B 2HHXA 1B9FA 3EDQB 4QS7A 3N6LA 2YKOA 4Z94A 2HVHA 4PG8A 1C2PA 4HL9A 1ZBUA 2YI1A 1Q81O 4WXWA 4YY3K 4QU6A 3CCUN 4GKJK 2AZ3A 3M7VA 3AOAA 3Q8RB 2Z2LA 4UUXA 3J81j 5E84A 3R3TA 1S1UB 4FVMA 3RAXA 1UFLA 5C2FA 1RTHA 4CVNE 3CIMA 1RT2B 4AXJA 3LALA 5KT4A 1YJTA 3DXBA 4C98A 4K4ZA 3W62A 3FBFA 3P39A 4YORA 5G4DA 2DT9A 1UA0A 4ILJA 4YDUA 1KQSR 3KKSA 2BJ9A 1APSA 2EHGA 2KHDA 5BREA 3EXYA 4YR2A 3H2UB 1A6LA 4ZKAA 4J9OA 1FVQA 1HJOA 3F56A 4LD0A 2QTDA 3CTRA 4M95A 4A8MP 1OY9A 4WQ4C 1WLJA 2MZ1A 2QV6A 2ILYA 1RAIB 1ZYQA 3ICLA 1U1QA 3UCGA 2HBKA 4ZCMA 5D78A 1UWAA 3MPVA 2HNYA 3MHYA 2FLLA 3LPYA 4JB8B 1HNIB 4JI7K 2J0QD 4PXBA 4K4YA 4H0PA 2HQFA 4ECWA 2VG5B 1VQ5S 3ETOA 3PIPQ 5GAGU 1N34F 4AM7A 1VQ6N 5BPNA 3FEZA 1BCMA 1FF2A 3H25A 4F2RA 4FSVA 1VQMS 4ED1A 4MDAA 3GTYX 5LJVA 4Y0WA 4YOYA 4PG5A 1BMQB 3TAQA 3H3NO 3D3CJ 1AA1B 1FDNA 4CO3A 3VGVA 3FFKB 2DBBA 1WHWA 3NY0A 1FI4A 4KHPK 2DXFA 1VQ7N 2P9PA 2KM8C 1OPZA 2DO4A 3CCSN 5KFLA 3NNHA 5BPLA 4CTAA 2BACA 1LXJA 2NLWA 4KI4A 5AQLA 3EXCX 4Q45A 5BYSA 2MKCA 2CGLA 4OIXA 5K8MA 4YB6A 2OPPB 3S9HA 2ASDA 3KK3B 3QT6A 2EG1A 4WFXA 4FYWB 1QZ5A 1YQHA 4CGIA 3H8YA 1WAJA 5DETA 4NX9A 1V5IB 2LXFA 2D3O1 3LGNA 3NMUA 1LOUA 1KOHA 4P75A 3QWUA 2FB0A 1ZETA 2NXJA 3BYRA 2XQCA 1FRXA 3HJVA 3W9IA 3MN5A 2QM1A 4ZVPB 4NWBA 3W5ZA 2JEGA 3G71N 4JI1F 1V3SA 3CC7S 1RE1B 3M6WA 5KPZA 2P5OA 3Q2TC 1WDDA 4CJLA 3H90A 3EE9A 2W7PA 3MGJA 4M5NA 4KHWA 5DM6Q 1KXPA 4K25A 2F65A 2HIYA 1GQEA 4IJNA 3WNEA 1DGKN 3IRXB 4CHZA 4CWBA 4NLUA 4PPZA 1FWPA 1YVFA 5ADXH 2CH5A 3U3GA 2XHBA 4OV1A 1V4TA 3NMAA 3RB3A 3BR8A 2HFOA 2PYJA 4DCJB 1X4EA 3PXGa 1PYOB 4N8NA 4OZ3A 2KL8A 5DDPC 3AJ1A 5D4OA 4KV8B 2DR9A 2V94A 3IP0A 4H0XB 1F6TA 4LF1A 2AEFA 2CQPA 1NDKA 2DGWA 1NH7A 3GYXB 1N36F 5FJ4A 3HHLA 3QIOA 4CJVA 1R3NA 5HQ8A 3Q8VA 3VALA 2G2YA 4K4TA 2GIRA 1Q86O 3VQTA 4HCBA 4FLVA 2D9OA 1Q1KA 1TL5A 2YHYA 1NDLA 1HR0F 1ZAWA 3AXMA 3DOLA 1VQSA 1RK8A 2XYPB 3DRPB 2YWHA 4KAIA 3DLGB 2AIRB 1UP1A 2JNJA 4LF4K 1NGCA 1C1BA 1XQIA 5FPDA 2PIIA 3GB0A 4M42A 2EK1A 3KHGA 2AYGA 4H4KC 4ZPWR 3WC2A 3O9SA 1NHVA 2HQDA 3NL0A 1KFDA 3SK3A 5GAEP 1RAAB 1BQNB 2AWZA 4ZPBA 4FVUA 1MSWD 3QSYB 2E6LA 3MOZA 2Z1GA 4BQLA 1IJEB 1E4GT 3CNQP 2QWRA 4JD2B 4DUYF 2YQ0A 3L7PA 2KN4A 1JQGA 2JZ5A 2DGOA 1LW2A 3U9DA 3TAGA 4DV7J 2DJWA