3SLCA

Crystal structure of apo form of acetate kinase (acka) from salmonella typhimurium
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
401
structure length
401
Chain Sequence
HMSSKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVMGTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTEVTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetate kinase
publication title Structural and mechanistic investigations on Salmonella typhimurium acetate kinase (AckA): identification of a putative ligand binding pocket at the dimeric interface
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 128
structure length 401
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3slcA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3slcA02
2HOEA 4IJNA 1Z6RA 3C7NA 3WEEB 4WQ4A 4BRMA 3ZETA 3AAPA 1YVNA 4O8KA 4IZ9A 5JLHA 3DAWA 4KBOA 5AZIA 3DJCA 3VGKA 4PL7A 3WXJA 4BROA 1WUAA 2E88A 5FPMA 1MDUB 3A8YA 1BU6O 4CBXA 3LM9A 1ATRA 3OHRA 4BRKA 1BDGA 2D1KA 2PBDA 3QB0A 3J8AA 4QS8A 4BRIA 4A2AA 2V52B 3ID8A 5BRFA 2P9SA 3D2EB 3H3OB 4BC4A 3FR0A 3W3DA 1ATNA 5AFUA 4Y0WA 3L4IA 2E2QA 3D2FA 3QBWA 5AQKA 4H5TA 3CERA 3FZHA 4BREA 1YAGA 3H3NO 3IFRA 2BTFA 2YJFA 5FPEA 3HTVA 1HKBA 2V51B 4JAXA 3ENHA 3JXUA 2EWSA 4JN4A 2A42A 4A62A 3DXMB 1U2VA 3LDQA 1JCGA 3FE1A 3R8EA 1OKJA 1BUPA 3MCPA 3R9PA 3D7EO 1QZ6A 3FLCO 4H5VA 5AZJB 4IWVA 3VEWA 4BRGA 4H5WA 5LY3A 5FPDA 5EVZA 4H0PA 5BR9A 3GL1A 1YXQA 2QWOA 3DXKA 2A40A 4ISEA 5LJVA 1WOQA 3HI0A 4PKIA 4BC3A 4QS9A 3LDLA 5AQLA 3TPQA 1YUWA 5AQGA 4F9OA 4BC5A 5E84A 1TUUA 2A6AA 4BR5A 2AA4A 3O08A 4FPAA 4FPBA 4BVOA 4H03B 3CJCA 3WXIA 3HSCA 4MO4A 5I9EB 4RWTA 3GDQA 1ESVA 2A3ZA 1ATSA 2NZTA 3FZLA 2GEMA 5AFUH 1HJOA 5AQSA 2E2OA 2QWRA 3VOVA 2HMPA 1S22A 3A5LC 1S3XA 2YJEA 1SZ2A 3S41A 3SJHA 5ELZA 1HKCA 3O1WA 4FWQA 3VEXA 2GTDA 3O6WA 3L0QA 4O5FA 3ZEUA 3WXKA 4BQLA 4JD2A 4RTFD 4PL8A 5KPZA 3TU5A 5AZJA 3H45C 4M7YA 3KZBA 4YDUC 5BRHA 4HWIA 1X9JA 5BREA 4H0TB 1GLDG 3EZWA 4L3QA 5BPNA 2P9KB 1BA1A 1SQKA 3HM8A 3MMVA 2FSJA 1BO5O 5AQTA 4BG9A 5BPLA 3B8AX 3H46O 4BR7A 2P9UB 2BUPA 3O4WA 4JNEA 5AQVA 3QFUA 3WQTA 4JHDB 2D4WA 5KPTA 1MWMA 4B1YB 3O80A 4Z94A 2I7PA 4GNIA 3M6GA 5AQYA 3CJ9A 2YHWA 3H6EA 3H1VX 2E8AA 1E4FT 3ZX3A 2ZGYA 4EAHD 1T6DA 4BC2A 3CJAA 3W0LA 1NGGA 4FSVA 4FWNA 2W41A 4BRLA 4CZJA 2NRHA 2A41A 4H0YB 4E1JA 3FGUA 4IXCA 1ZXOA 2DPNA 4AM6A 3ENOA 2ASOA 1RFQA 4PKGA 3WXLA 4FWMA 1TYQB 4K25A 3WQUA 3FZMA 5AQWA 5AQMA 4BRNA 2FSNA 4WYBA 4B1WB 4FWOA 3JS6A 4CD3A 5JICA 3AY9A 4K43A 3A5OC 4FL9A 4FOEA 3UB5A 1ZBSA 1QQOA 2D0OA 1QQNA 3C0BA 4EHUA 1KAXA 4M7XA 2QWMA 4DCHA 3IUCA 4CZGA 1ZC6A 3RSEB 1RGIA 3QBXA 3HBTA 2P9UA 3UKUA 5ADXA 1HKGA 3BEXA 5AQZA 2F9WA 3O1BA 3EL2A 3WEEA 4BRDA 2E2PA 5AQNA 1K8KB 4I6MB 3I33A 2P9NB 1NGFA 1H1VA 4RCHA 1HLUA 2Q1NA 1NGBA 2FLOA 3VF2A 5LJWA 5EXWA 3VF6A 3IMXA 2E1YA 3VENA 3IDHA 2FF6A 3LDPA 4BGBA 3D2EA 5AQXA 3VGMA 4J8FA 4CZEA 2QWNA 2CGJA 3U8XA 2A5XA 3ZX2A 4BRQA 1NMDA 5KQ8A 1NGDA 2IVNA 2CGLA 1X3MA 2FXUA 5FPNA 5EOYA 4WQ4C 4MLHA 4BR4A 4DHYA 4BR0A 1EQYA 2Q36A 2I7NA 3UKRB 1NGAA 3QDKA 1DEJA 1MA9B 2F9TA 4H5NA 2CH6A 2P9IB 3A5NC 2NLXA 3DXMA 5AQOA 4DQ8A 2E1ZA 2QM1A 5JLFA 3ZETB 5KPRA 4CZFA 4CBUA 4C23A 3CJ7A 3EKUA 1QZ5A 2KHOA 3O5BA 2HF3A 4H0OA 2ZWHA 3G25A 4FWSA 1NWKA 4B1ZA 1GLEG 1GLLO 3WUHA 5ADXH 1GLJO 3MN5A 1XUPO 2OANA 4DB3A 4LC9B 5EY4A 3CI5A 1V4SA 1G99A 3MN6A 4K41A 3SLCA 3QFPA 1NGCA 3U9ZA 3UE5A 3FZFA 5EX5A 5KQDA 4H0XB 4FO0A 5F2RA 3BF3A 4BRAA 2CH5A 1T6CA 1LCUA 2VCPA 4CZIA 5CE3A 5JMVA 1J6ZA 3VF4A 3AARA 4EHTA 4M63C 1GLAG 1GLCG 2CGKA 2ZF5O 4QS7A 1C0GA 2Q97A 3I8BA 2Q2RA 4BG8A 1U2VB 4PKHA 3FFKB 3M3ZA 4B1XB 2P9IA 4GY2B 2YI1A 2H3GX 2GWJA 1T44A 4WQ5A 1P8ZA 1D4XA 4ISGA 4B1VA 4EFHA 5AQUA 2HF4A 3DXKB 5AQIA 2VYPA 3CJ1A 1XC3A 2D0PA 4CD1A 3SMSA 1E4GT 4FWPA 2P9PB 3A5MC 3VGLA 1MWKA 3U4LA 2P9KA 3AAQA 3SK3A 3LDOA 5F0XA 5BRDA 3CJBA 3KHYA 4BVPA 3FZKA 4CZMA 4YDUA 3ULEB 2V7ZA 5BN8A 4JHDA 3SMPA 4BRCA 2QWPA 1HX1A 3VEZA 1V4TA 3GE1A 2V7YA 1NGEA 5AR0A 5AQQA 3EN9A 3BP8A 3GOIA 2YHYA 3LL3A 2Q0UA 2YCHA 5AQFA 2J4RA 3BF1A 1NGHA 4NB4A 3QICA 1KXPA 1Y64A 3VPZA 1QQMA 3R6MA 1JCFA 2GELA 3MDQA 5E26A 1GLBG 3HZ6A 4B1UB 2P9LB 2UYTA 2E2NA 2IIRA 2GWKA 3ZEUB 3VERA 4BRFA 4CZLA 4JD2B 1Q18A 1R59O 5F1XA 2QWQA 4BR2A 1IG8A 4BRHA 4CI6A 3MN7A 4BGAA 3CIPA 1BA0A 3VEVA 5AQHA 3VEYA 4H0VB 1TYQA 1LOTB 2ASMA 5AQPA 2ZGZA 4XH5A 2YHXA 1BG3A 3LM2A 1Z05A 3CQXA 1NGIA 4XEIA 5TKYA 1TUYA 3A0IX 2FSKA 2P9PA 1RDWX 4CZHA 2GUPA 3DWLA 4BRPA 1DGKN 1IJJA 4FOIA 4CZKA 1XQSC 1NM1A 2IVPA 3C7NB 3CHWA 3RSEA 3ULEA 3MK6A 4IO8A 3ZX0A 4WQ5C 3VETA 2W40A 5AZIB 1BWFO 1X3NA 2WUSA 1HPMA 4BR9A 2QWLA 1QHAA 2E20A 4XH1A 1K8KA 3MN9A 4I6MA 4IJAA 4FWLA 3QMLA 1JCEA 1KAYA 1HUXA 3GG4A 3U9DA 4CJ7A 2P9NA 1GLFO 4AM7A 5BPMA 3H1QA 1NLVA 4FWRA 1DKGD 2P9SB 2QXLA 3EO3A 3F9MA 4MLEA 3LDNA 1CZAN 1U6ZA 2PAVA 4XH4A 2ITMA 2P9LA 1BOTO 3VEOA 4NO7A 3GBTA 1NGJA 5AQJA 3D2FB 5B8HA 3CQYA 2FF3B 4CBWA 2Q0RA 1NBWA 4HTLA 1KAZA 4A61A 2IVOA 1SAZA 2VWBA 3VESA 3BUZB 3ATUA 2ASPA 2QW9A 3CETA 3M1FA 3P4IA 4A2BA 4FWKA 3O8MA 4B9QA 1C0FA 4BQZA 4H5RA 3KVGA 3EKSA 4ISFA 4MO5A 5AQRA 3UKRA 4K42A 5BN9A 3L6QA 3ATVA 2Q31A 3WT0A 4EIAA 3UKUB 2AP1A
chains in the Genus database with same CATH superfamily
1Z6RA 3C7NA 3WEEB 4BRMA 3DLKA 3V9XA 4IZ9A 1HNXK 5FRMA 4KBOA 5J2QA 4G1QA 5DK5A 4HUFA 4R5PA 3HPOA 1M1KO 4CEDA 1QE1A 3DMJA 3A8YA 2HBKA 1BU6O 4CBXA 1EXQA 4Z4EA 4F2SA 4FLTA 4BRKA 3TTFA 1KQSM 2V52B 1BISA 1Z25A 3FR0A 3PIPL 5HRNA 4JI1K 2E2QA 4CK2A 3QBWA 4H5TA 2YX6A 3AVBA 4DWIA 4B9LA 1NK6A 3LPTA 3FZHA 4BREA 1SKRA 3LP0A 1RILA 4B8AB 3NH2A 1ZBHA 3J7ZO 1WBBA 4JAXA 1NK4A 4CHOA 1C6VA 1RTDA 3JXUA 1E3MA 4JN4A 3AA3A 4I2PA 4A62A 4FJ7A 4OKKA 3T1YK 3UIQA 1C0MA 2KZZA 4FK2A 3TANA 3E9LA 1OKJA 1IKYA 3JAMO 1BL3A 4DV4K 3R9PA 4FLWA 3CCUN 4H5VA 5FPDA 4H0PA 3TAEA 1C1CA 3DRPA 2A40A 4OKJA 3HI0A 4PKIA 3TPQA 1JLBA 1TUUA 3KWIA 3EE9A 1N36K 2OA8A 5LMUK 3O08A 1VSKA 4BVOA 1SL2A 1DT9A 3SUOA 3CJCA 5FDLA 4AHVA 3TAFA 4MO4A 1S9GA 1EP4A 3GDQA 4Q5VA 1U49A 2A3ZA 2ATQA 2NZTA 4YOXA 3SAHA 4PQUA 1NMNA 4WE1A 4GMJB 5GAEP 3A5LC 1KFSA 1S3XA 4GW6A 3CG7A 3SJHA 5ELZA 2HBJA 4W5OA 3O1WA 4FWQA 3VEXA 2GTDA 1TKTA 3HP6A 3CXCM 4PL8A 5KPZA 3RMCA 2G8FA 3QINA 3KZBA 4YDUC 3ZSWA 1NOYA 2QEXN 2ETJA 4CF2A 1C1BA 4HWIA 4I7FA 4JKDA 4DTPA 3AO2A 5BREA 1NJXA 5FROA 2B5JA 2VGNA 4J2BA 2FSJA 3CCSN 2G8KA 2QTDA 3EE8A 4AHTA 3QFUA 3CPEA 3WQTA 4HUEA 5KPTA 4B1YB 3AO3A 4DV2K 1S5JA 3O80A 1WSFA 4CJLA 5KTQA 3M6GA 5AQYA 3CJ9A 1LWEA 1HMVA 1RT7A 1LW2A 1VHXA 2YHBA 2ZGYA 1T6DA 4CJ4A 4CGDA 1CXUA 1A5XA 1L3UA 1YTUA 4FSVA 2JGUA 1VQPN 2A41A 1Q86O 2KFNA 2ZE2A 2OPPA 4B8CA 1N5YA 2ASOA 4PKGA 3VTIA 1FKOA 5AQWA 4N47A 1RNHA 4FWOA 1VQON 2RF2A 2HVIA 2KZMA 3A5OC 1Q81O 4FOEA 3UB5A 3ZT3A 1ZBSA 2YNGA 3KJVA 1QQNA 3JYTA 4M7XA 1VSMA 4DCHA 1JLEA 3ID6A 5GIPA 1OVQA 3ZT1A 3RSEB 1RGIA 3PX6A 3E9PA 3V4IA 1DTQA 2F9WA 1LAVA 3V1QA 3VQ7A 3WEEA 2QI2A 4YOTA 4FVMA 5AQNA 4W5QA 2F7TA 4CEZA 1H1VA 3MAQA 4RCHA 2FLOA 4DQSA 3K59A 4JKBA 2E1YA 3VENA 4FK4A 3CMAN 5AQXA 4CF1A 3AVMA 4FJIA 5HL7L 3WNEA 4YOUA 5SWMA 2IVNA 3TTDA 1U48A 2CGLA 3O9UA 3B6OA 5FPNA 2ZD1A 4DHYA 1VQ5N 2FC0A 4BR0A 4YNQA 4FLYA 2IGIA 1S1VA 3UKRB 3KK7A 1DEJA 2RKIA 2CH6A 3MCAB 5CR4A 4DG1A 1RDBA 2XY8A 3ZT2A 2E1ZA 2RN2A 4FJ9A 4MQ3A 2PYJA 3OYEA 2W6KA 1QZ5A 2KHOA 1NK0A 1D8YA 4WFNL 4DQRA 1GLLO 2P5GA 2WOMA 5SZTA 2OANA 3C94A 3AVHA 4LC9B 1V4SA 4FJ5A 3MN6A 3SLCA 4YORA 3UE5A 1NGCA 3FZFA 5KQDA 3O9TA 1KSPA 1ASUA 3I0RA 3SBGA 3RWUA 2VCPA 4CZIA 4KPYA 1VSDA 3TAGA 1NOZA 3AARA 3K9JA 1GLAG 2CGKA 4CHQA 4CIGA 3O3GA 2Q97A 3P83D 4CGFA 2Q2RA 3DLRA 1NKCA 3L2VA 3FFKB 3R1XA 1JKHA 2P9IA 2O8DB 4B9VA 2H3GX 4DR5K 4DTOA 3J80O 4J2AA 1S9EA 1VRUA 1D4XA 1YVUA 4JS4A 3TWHA 2E5LK 3C95A 3IAYA 3TR8A 2VYPA 3CC7N 3SMSA 4FJNA 1KD1O 4Y1CA 3OTOK 3SV4A 1L3SA 1MWKA 4DFKA 3HXMA 3AAQA 3LDOA 4M3WA 3FZKA 1WLJA 2NRWA 4CF9A 2ITGA 3VEZA 3VQ5A 4CEAA 4KHPK 4O55A 2X6NA 3GOIA 4DLEA 2HW3A 4IOAL 4C8NA 2J4RA 3BF1A 1NGHA 1X1PA 3QICA 2X6SA 1CZBA 1M90O 3WNHA 1QQMA 1BHLA 1JCFA 2GELA 3IS9A 1K6YA 3ZSVA 3OYFA 4NCBA 4IG0A 1GLBG 3HZ6A 2UXCK 2E2NA 3VMFB 5C15A 3ZEUB 3LWLA 5F1XA 2QWQA 1IKXA 2OTLN 3CCQN 4DV6K 4BGAA 1BA0A 5AQHA 1ITGA 3SQ0A 5AQPA 1TVRA 2RE2A 3QLHA 3QEIA 1Q82O 1IKWA 1Z05A 3VQ9A 1NGIA 3A0IX 2FSKA 3FFIA 1WBDA 2HHUA 4LFAK 3THXA 4IOXA 1IJJA 3AVKA 2WONA 4CJ5A 1RDUA 3C7NB 3RSEA 1S6QA 3V9WA 1JXEA 5M1OA 2WTUA 1X3NA 2WUSA 3T69A 4OPAA 2E20A 2HMIA 4IJAA 1CXQA 3QMLA 1BIUA 3TSPA 1HUXA 3U9DA 3EY1A 5BPMA 4DR4K 3OJSA 1NLVA 1DKGD 3EO3A 2ITMA 2Q3SA 2BGGA 3DLEA 5AQJA 4HHTA 4ZTJA 1N8RO 4NXMK 3CQYA 2HNDA 4FJMA 1VQ8N 3ATUA 2G8HA 4A2BA 2W42A 1LAWA 4BQZA 3KLFA 4DV7K 1D9DA 4ISFA 3S9HA 5C25A 3P38A 2KQ2A 3UKRA 4K42A 3U6FA 4DSLA 4C1NI 5J2MA 1HYVA 5M1PA 5HROA 1I39A 4ID5A 3MECA 4CJKA 4KHUA 3AVGA 1UWBA 4DR2K 3OW2M 5JLHA 5AZIA 3LZJA 3VGKA 4DKWA 3AVCA 4PY5A 2NUBA 4BROA 4CF0A 2E88A 5FPMA 3LM9A 4KB0A 1BDGA 1LV5A 2PBDA 1TAQA 5GAGP 4A5AA 3J8AA 4BRIA 4BDZA 3ID8A 2P9SA 3VQEA 2Y1JA 3MWTA 3O9SA 1ATNA 4CJWA 2XHBA 3E9OA 4HTUA 4JKEA 4GV6A 4Z4GA 1YAGA 3H3NO 5TKWA 2YJFA 5FPEA 3AVNA 3KLIA 3S3OA 1SUQA 2BANA 3ENHA 2EWSA 1CZ9A 3PSIA 3KK1A 4OJRA 3DM2A 4CFAA 3LDQA 1BCOA 1W97L 3R8EA 1TAUA 2O8DA 3MCPA 3M8RA 1YJ9N 3D7EO 3T1AA 3FLCO 4LY7A 1JJ2M 4BRGA 4H5WA 1J5OA 2O4GA 3KWGA 3S3NA 4IEEA 4ISEA 4JKGB 3DLBA 2Z1GA 3NBPA 5AQLA 5AQGA 3SUQA 2B6AA 4M3ZA 4ILJA 4BACA 4FM2A 4JV5K 2GBZA 2Z1IA 4FPAA 1U04A 1WSEA 5JS1A 1RDAA 3ZLJA 4PA1A 3ZSXA 5FRNA 3K5LA 1ATSA 4CHPA 5BR8K 1T8EA 5J1EA 2AJQA 4GVMA 1N34K 4R79A 4HCBA 2YJEA 1SZ2A 3S41A 3HOSA 2UXBK 4KI4A 3L0QA 1L5UA 4K0KK 2DTUA 3ZEUA 3KIOA 2FBXA 3M8PA 4BQLA 5AZJA 4M7YA 3HPHA 2G8IA 5EU7A 4M3YA 5KGWA 4CK1A 4JI0K 3A2FA 1X9JA 1WAFA 4JKAA 4H0TB 3L2QA 1GLDG 3AV9A 4L3QA 1BIZA 4PHTX 3L8BA 5BPLA 5AQTA 3D0PA 4E7KA 1A5VA 3JSMA 2UUBK 4WF9L 4LH5A 5KRTA 3MX5A 4B3TK 3SUNA 4BR7A 4CFCA 4KTQA 2BUPA 4JNEA 3NE6A 1K73O 1VSLA 3L4QA 4JHDB 1MWMA 4IDHA 3ULDA 2FBYA 3BGRA 4DTRA 4CEQA 1GOCA 2E8AA 4X65K 3M8QA 4C8OA 1KRPA 4EAHD 4BC2A 4CJTA 2IC3A 4OGEA 2KKZA 1VQ6N 2FBVA 2VG7A 5H1SQ 4OPJA 4O8UA 4DF8A 4BRLA 4CZJA 3K5OA 1TGOA 1ZBUA 1HQUA 1IBKK 4KTZA 1RFQA 4DQPA 3WXLA 4E1MA 4FWMA 2QKBA 2FSNA 4NYFA 3JS6A 3MEDA 4CFDA 4M3XA 4KB1A 1W0HA 1HYSA 3OYKA 4RW8A 3L2UA 4M3RA 4FZYA 2QWMA 3IUCA 1ASWA 1ZC6A 3V1OA 4E89A 2YV0X 4DFPA 4FJKA 4JKCA 1YF5L 3EL2A 3QNNA 1K8KB 4I6MB 4CESA 4CJQA 4JI5K 2DFFA 3I33A 4NCAA 1RBUA 1ILYA 2NRXA 3THYA 4W5RA 4ELVA 1HLUA 1NGBA 4AHUA 1EETA 3MEGA 1RBSA 4E7LA 3IMXA 4CHZA 2FF6A 3D6RA 3LDPA 1NK9A 4BGBA 4GV3A 3P1GA 3QETA 1B9DA 3VGMA 2QWNA 4FLXA 3V81A 3U8XA 2A5XA 3ZX2A 3L2WA 1NMDA 1K9MO 3C6HA 1XC9A 1EQYA 1RTIA 3ALYA 4OGCA 3VQPA 1SV5A 1NKEA 1MA9B 2F9TA 5T7BA 2Y1IA 2P9IB 3A5NC 1RTJA 3QO9A 4LF9K 4N76A 5AQOA 3B6PA 5KPRA 2HHHK 3CJ7A 3P39A 2GX9A 2ZWHA 3CYMA 3G25A 2VG5A 4B1ZA 2JWKA 2NRTA 4JKGA 3RVCA 3MN5A 4E7HA 4KHQA 2OPRA 5EY4A 3SZ2A 4KFBA 5EX5A 1FK9A 2XY7A 1W2BM 3BZKA 4OLAA 3BF3A 4BRAA 4F4KA 3M5RA 3O9QA 5GADP 4JI2K 2BH1A 4FW1A 1TL1A 4DTJA 4O44A 4NLBA 4ILHA 4FJLA 4LF4K 4CGGA 3I8BA 4BG8A 1G15A 4JS5A 4DMNA 4B1XB 4NCGA 1GOAA 4AHRA 2YI1A 5HRSA 4LF6K 4WQ5A 3F9KA 4B1VA 4EFHA 3KLEA 3TI0A 3HK2A 4OLBA 5C2DA 2HF4A 1QVFM 3DOKA 4CD1A 1A5WA 3CCRN 3I8DA 3NF9A 4FWPA 3A5MC 3VGLA 4DTMA 1WSGA 3THXB 3KTQA 4Z4FA 4OKEA 3LWMA 2V7ZA 4KHWA 1C1AA 4LFBK 4JHDA 3SMPA 4YHHK 2HVHA 4BRCA 4ZHRA 1HX1A 3AGRA 2V7YA 1WAJA 2XRIA 1NGEA 5AQQA 3CCJN 1RBTA 2YHYA 3LL3A 2Q0UA 3QEPA 3VPZA 3CCMN 5E41A 4FJ8A 4DS4A 2UYTA 4J2EA 2IIRA 3KK3A 1EX4A 1Q18A 2D0AA 4BRHA 4CI6A 3MN7A 3I0SA 2O8EB 3VEVA 3AO1A 3VEYA 4C8KA 4IOCL 1XHXA 5HP1A 1FW6A 1UAXA 4C8MA 3MXJA 3CQXA 1YITN 4EZ6A 4N56A 4XEIA 5TKYA 2P9PA 1RDWX 4CZHA 2GUPA 1BI4B 2PZSA 1DGKN 4DFJA 4DSJA 4H4MA 2O8BB 1XQSC 3CD6N 1NM1A 3R3LA 3C6UA 3BDPA 3MK6A 2OCEA 2QXFA 4WQ5C 5CYQA 2YNFA 5AZIB 1BWFO 1VQKN 3M8SA 1QHAA 1K8KA 4I6MA 4FWLA 4FZZA 4FWRA 2P9SB 3F9MA 3HJFA 3THVA 2HHXA 4XH4A 4B3MK 2P9LA 3VEOA 4NO7A 3GBTA 3RMDA 4CBWA 2XO7A 2Q0RA 3SQ2A 1VQ9N 4HTLA 1KAZA 4A61A 3SPZA 3D45A 1N6QA 3EEQA 3M1FA 2QW9A 1EWRA 4JKHA 2UXDK 3AVLA 4U7BA 3DLHA 4DV0K 4CFBA 1JLQA 4DV5K 1TK8A 3N4PA 1HNZK 3OY9A 1JL2A 5BN9A 4RW7A 4QOZB 1OH7A 3OBWA 4JI6K 4JK8A 3UKUB 3NHGA 5HOOA 4CE9A 3HVRA 2HOEA 4IJNA 2YHAA 3V1RA 4WQ4A 4KAZA 1WSJA 3AAPA 1YVNA 4O8KA 2O8FA 3DAWA 1HRHA 4PL7A 2F4VK 1WUAA 4LFCK 1XNQK 4BWJA 1EKEA 4KTWA 3RR8A 4B3RK 2D1KA 3QB0A 2F8TA 3CCLN 5BRFA 2W6LA 3D2EB 1TL3A 3CFOA 4BC4A 4CJVA 3W3DA 4DUZK 1QSYA 1X9WA 3CERA 3SAFA 4LF7K 1RT2A 3ZT4A 2BTFA 4LD0A 4X66K 1VQLN 4KRFA 3HTVA 3DRSA 4DTXA 1VSIA 2HSTA 3CF5L 3TAPA 5GINA 3G0ZA 1KLNA 4FJJA 4FXDA 3DXMB 4EP5A 1XWLA 4FM1A 3AVAA 3FE1A 3IG1A 3DI6A 2A1RA 3K5NA 4B9TA 4DF4A 1FJGK 4EP4A 1L3TA 3L3VA 5AZJB 1C0TA 4IWVA 4OVLA 3NVKA 4M41A 5EVZA 1XNRK 5BR9A 4DU3A 3GL1A 1YXQA 2QWOA 2P1JA 4MFBA 4IFEA 1WOQA 4BC3A 1GOBA 3OYIA 1IBLK 3LDLA 4B9UA 3L2RA 3SNNA 4M3UA 1N32K 4BC5A 4FLZA 3WXMB 5E84A 4JLHA 4BR5A 4UY8O 1JL1A 3ZYYX 3CFPA 2P5OA 4FPBA 4KV8A 1K8AO 1HNVA 4FJGA 4Z4HA 3EYZA 3HSCA 4F3OA 2X74A 2GUIA 4KH6A 4BWMA 5AFUH 5I42A 5AQSA 2QWRA 3VOVA 2HMPA 3DLGA 3G10A 4JI3K 3HM9A 4TSXA 3T1HK 3U3GA 1XI1A 3N4QA 1DTTA 1RCHA 2OTJN 4OO1J 4W5TA 3VN5A 3E01A 3NGIA 1J5EK 2XY5A 4RW4A 1NJYA 3TU5A 4DFMA 3AVFA 3H45C 2EHGA 4DU1A 3AGKA 1L3VA 2HHWA 5BRHA 2O8EA 1UA0A 3BY5A 4HVJA 3VA0A 3CM5A 3EZWA 4F3TA 1RT4A 4IBNA 3MMVA 1BO5O 4BG9A 3H46O 3CPWM 1LWCA 1BI4A 2VG6A 3ZSYA 2ZJPL 4ELTA 2O8BA 2HHVA 2YNIA 3TTCA 2ZJRL 3P31A 2VGMA 4GNIA 3SYZA 1O13A 4YY3K 3C6AA 3DYAA 3THYB 2YNHA 3ZSRA 1UOCA 3ZX3A 3W0LA 1I3AA 1NGGA 3VQAA 3U3YA 1B92A 4A59A 4BE2A 2W41A 3Q7BA 3LP2A 4E1JA 4KH5A 4BDPA 2RHKA 4IXCA 3P5JA 4AM6A 3ENOA 4DQIA 3SV3A 5K14A 4WFBL 3WQUA 1TYQB 5HRPA 4KKOA 2Z1HA 5AQMA 4BRNA 4B1WB 5GIOA 4DR1K 2Z1JA 3QESA 4CD3A 5JICA 3AY9A 4K43A 2E6LA 4A5BA 4FL9A 4AHSA 3AVIA 2D0OA 4JKFA 3THWA 3O4QA 4IEIA 1KAXA 1HPZA 3TARA 3E1YA 3OYBA 4BE0A 2P9UA 3PO5A 3UKUA 1KLMA 2R7YA 4BRDA 1I94K 1OVYA 2E2PA 4OPHA 5C10A 4CEOA 2P51A 1TV6A 1W7AA 4CCHA 1NGFA 3NFAA 4RG8A 3NF7A 2Q1NA 1JLCA 3QERA 4CEEA 4Y1DA 3VF2A 1ASVA 1BGXT 5EXWA 1XMQK 4CJEA 4LSNA 4FLUA 5KI6A 2DFHA 3SQ1A 3D2EA 1D5AA 1X9MA 2RPIA 2PY5A 2CGJA 5C12A 4FJHA 5KQ8A 1NGDA 2O8CA 1RDCA 2JLEA 3ASMA 5M1NA 1YT3A 4BR4A 1XMOK 2Q36A 2I7NA 2HHQA 1NGAA 1QS4A 3QDKA 1IO2A 2XY6A 4H5NA 3HT3A 1NJZA 2DFEA 3O3HA 4B3OA 2NLXA 3DXMA 3I56N 3K5MA 5JLFA 3ZETB 1VAZA 1QSLA 1YTAA 2KLAA 1T3VA 4DU4A 4C23A 3ZSQA 2HF3A 3KKSA 4FWSA 3QEXA 4FCYA 4B3SK 1GLEG 3WUHA 3MX2A 5ADXH 4IFVA 1SS6A 4O0IA 1KTQA 5JS2A 1XUPO 4DB3A 5KRSA 1VQMN 2HB5A 1W9HA 3E66A 1NJIO 3HRGA 3QFPA 3OYGA 4YOWA 4DTSA 4H0XB 3ENBA 4FO0A 3BZCA 2CH5A 1LCUA 5JMVA 3NAEA 5GAHP 5MLCQ 4BDYA 4EHTA 3HO1A 1WN7A 3OYMA 3KLHA 4KHSA 1U2VB 4PKHA 3M3ZA 5CYMA 3OYNA 2GWJA 1T44A 2QKKA 1FKPA 4DR3K 1P8ZA 5M1KA 2WC9A 3OS0A 3K58A 3DXKB 3WNGA 2OPSA 3VQ4A 4E0DA 3CJ1A 1XC3A 4DSFA 2D0PA 3KD5E 4I9QA 4O0JA 4M3TA 2O4IA 2PFUA 2NRRA 2P9PB 5AJ3K 4CGJA 1TK0A 4ILGB 3I55N 4FK0A 3SK3A 5LL6Z 3F2KA 5BRDA 1VRTA 3H08A 4BVPA 4YFUA 3RTVA 2VQFK 4YDUA 4CGIA 5BN8A 1VK0A 3O9RA 3SCXA 3NH1A 1V4TA 3GE1A 4AQYK 5AR0A 3EN9A 3BP8A 3OYHA 4CW7B 3LANA 1VSEA 5JVGL 1Q9XA 3NH0A 1KXPA 1IKVA 1FXXA 4IO9L 3MDQA 5E26A 4JRPA 4GV9A 2P9LB 4CZLA 1S1XA 4JD2B 1R59O 4CVNE 4CJPA 3OJUA 3SUPA 4BR2A 3QIPA 2PYLA 1QHTA 2D5RA 4H0VB 1TYQA 1LOTB 4CHNA 2KW4A 2ZGZA 4XH5A 3KLGA 1BG3A 3LM2A 4JK7A 5J2PA 4LF8K 2YKNA 3IRXA 1T03A 3DLLL 4I2QA 1Z26A 4ID1A 3HPGA 3DWLA 3NF8A 3ISNC 3LDSA 2HNZA 3MXMA 2ZQBA 3OBYA 3OYCA 4FOIA 3T19A 4DR7K 3CHWA 5C24A 4NLCA 3ULEA 3G4SN 4IO8A 2O8FB 1YHQN 4AILC 4BR9A 2QWLA 3PSFA 1Q7YO 2B4JA 1ZBLA 4DTNA 4XH1A 1OH8A 1NK8A 4JI7K 1JCEA 1KAYA 3GG4A 4CJ7A 1YIJN 3VQDA 4PUOA 4AM7A 4KHNA 3RR7A 3C6TA 4LH4A 5CY4A 3H1QA 2QXLA 3LDNA 1U6ZA 5LMNK 1BOTO 3K57A 3QEWA 4KI6A 2FF3B 1NBWA 4DQQA 2VWBA 1YI2N 2ASPA 2OYQA 3F5TA 4FWKA 3O8MA 4EZ9A 1T05A 1EO1A 1C0FA 4H5RA 3KVGA 3PX0A 3EKSA 4MO5A 5AQRA 2GV9A 4KH4A 3NGZA 4DS5A 3L6QA 4XIUA 4Z0UA 4U67L 3WT0A 1SKSA 2F8SA 3VA3A 3LP3A 1Y97A 4JK9A 1NWKA 3HYFA 1Q8IA 4C8LA 5D3GA 3ZETA 5M1FA 3DJCA 3V9ZA 4M45A 4CGHA 3WXJA 3VQCA 1KCFA 1RT3A 2JWLA 1MDUB 1ATRA 3OHRA 2UUCK 1REVA 4QS8A 4A2AA 1U47A 3OA9A 1P90A 3H3OB 2WBNA 5FLXO 5AFUA 4Y0WA 3L4IA 3D2FA 3V6DA 5AQKA 2A1SA 2I5JA 3SI6A 3IFRA 4F8RA 3TAMA 5CZ2A 3ZT0A 1LWFA 1WNSA 1U45A 1HKBA 2V51B 4Z4CA 1XHZA 1R0AA 3LPUA 3LAMA 4B08A 2A42A 3G6EN 3K2PA 1VSHA 4KHYA 1U2VA 1WSHA 1JCGA 1RBVA 2E6MA 3RRGA 5JVHL 1BUPA 3RMAA 2EX3A 2NRVA 1QZ6A 3VQBA 4M42A 3AA4A 3VEWA 3WNFA 3TAQA 5LY3A 4E19A 4X62K 3K9KA 4CERA 3LP1A 4O5BA 3DXKA 1RT6A 5LJVA 1QTMA 4QS9A 4NXNK 1YUWA 4F9OA 1KVAA 2A6AA 4WCEL 1JXBA 2E4LA 1HNWK 4FZXC 3HOTA 2AA4A 3CC4N 1JLAA 4DSIA 4CF8A 3QNOA 1RTHA 4H03B 4ZTFA 1RT5A 3L3UA 3WXIA 5I9EB 4RWTA 3T7ZA 5I3UA 5J2NA 1ESVA 1HR0K 3VQ8A 2ZJQL 2VWKA 1JLFA 4JI8K 3FZLA 2GEMA 1YJWN 4JI4K 4F2RA 2IAJA 3RMBA 4IKFA 3TSQA 1IBMK 1HJOA 2E2OA 1S22A 3VQ6A 4V19S 4FM0A 2LSNA 3T3FA 3PV8A 1U4BA 3PX4A 1DLOA 2VWJA 1S6PA 1HKCA 1CLQA 1N33K 1S1TA 3HP9A 3O6WA 4O5FA 1QQCA 4CJ3A 5IWAK 3OVNA 3WXKA 4UQGA 3CM6A 4DSKA 4JD2A 4RTFD 4CHYA 3KKRA 4B9SA 3V9UA 5DMRA 4CEFA 3CCEN 1NU0A 4CJSA 3CQ8A 3MEEA 1NK7A 5BPNA 3PIOL 2P9KB 3OYJA 1BA1A 1SQKA 1VSJA 3HM8A 2OZSA 3THWB 4CEBA 3B8AX 1X9SA 3PUFA 1ZBIA 2OPQA 2P9UB 4B9NA 3O4WA 3K0SA 4LF5K 1IV0A 5AQVA 3AA2A 4Q0BA 1Q9YA 2D4WA 4MDBA 4Z94A 2I7PA 3OS2A 4IFYA 3O4NA 1HYZA 2YHWA 3H6EA 3H1VX 4BE1A 1E4FT 4AH9A 4CIEA 2KTQA 1BQMA 3CJAA 1YJNN 5C2FA 5C0YA 2IDOA 5HLFA 4FWNA 4YOYA 2NRHA 1HNIA 4H0YB 3FGUA 3VQQA 1ZXOA 2DPNA 2O8CB 3LALA 4DLGA 3J81O 3SPYA 4K25A 3FZMA 4WYBA 1D9FA 4N5SA 1JLGA 5IT9O 4HUGA 4IG3A 1QQOA 3V9SA 1C0UA 4EHUA 3C0BA 2QK9A 2HBMA 3G71N 3LZIA 4CZGA 3MXIA 3CC2N 3QBXA 3CCVN 3HBTA 4KREA 2YKMA 5ADXA 4CECA 1HKGA 3BEXA 4JEPA 5AQZA 4FLVA 3O1BA 3AO4A 4OPKA 4FYDA 3AO5A 4LSLA 2P9NB 2WFBA 4A57A 4GKJK 5LJWA 3ZCMA 3VF6A 3IDHA 1RBRA 2UUAK 4J8FA 4CZEA 3ITHA 4BRQA 5HRRA 4CIFA 1X3MA 2FXUA 5EOYA 3RRHA 4WQ4C 4MLHA 2NNWA 4B9MA 1RT1A 4WFAL 1WB9A 4CJUA 1TKDA 1EWQA 1KVBA 3NCIA 4AHCA 4DQ8A 4K8ZA 2QM1A 2QA4N 2D0BA 1RDDA 4CZFA 4CBUA 2VQEK 3EKUA 3O5BA 3OS1A 4H0OA 4DR6K 2D0CA 1J54A 3LAKA 1IG9A 3KD1E 1GLJO 4RW6A 2G8VA 1VSFA 2X78A 4DV3K 3CI5A 1G99A 4K41A 1VQNN 3MWPA 3U9ZA 4E3SA 2BE2A 1S72N 1IH7A 3KK2A 5F2RA 3TSUA 4E7IA 4K8XA 3HSTB 1S1WA 3DOLA 1T6CA 5CE3A 4E7JA 1J6ZA 1TKZA 3VF4A 3NGYA 4M63C 1GLCG 2ZF5O 4QS7A 3CMEN 3SAGA 4Z4IA 4W5NA 1QVGM 2FBTA 1C0GA 4ELUA 5CZ1A 4FJXA 3VTHA 4G9ZA 3ZSZA 4GY2B 1BQNA 4PWDA 4GVEA 4ISGA 5A2QO 2DY4A 4H8KA 5AQUA 5AQIA 2UU9K 2HHTA 1LW0A 1BCMA 4FW2A 5KGXA 2ZM6K 3SJJA 1E4GT 3NVMA 3DRRA 3U4LA 2P9KA 4H4OA 5F0XA 3CJBA 3NF6A 3IKMA 4CK3A 3KHYA 1QSSA 3O3FA 3TABA 1MU2A 3HVTA 2HNYA 3ULEB 4CZMA 2IS3A 4JYAK 5DM7L 3QIOA 2OZMA 4GKKK 1WSIA 2QWPA 4YOVA 3AA5X 3PY8A 3OYDA 5AQFA 2YCHA 4NB4A 2BDPA 1Y64A 1OH5A 3R6MA 2HHSA 3AVJA 1F21A 3EZ5A 4B1UB 4CJRA 4L8RB 4RW9A 1SKWA 2GWKA 3VERA 4BRFA 3PO4A 1IG8A 1NG9A 4KO0A 3PLAA 3J7AP 3ZSOA 4X64K 3C65A 1S1UA 3OYAA 5DM6L 5HBMA 4N41A 3CIPA 1NK5A 2ASMA 4AF1A 4MDAA 1HQEA 4C1NK 2YHXA 3F73A 4NYNA 1TUYA 4DTUA 4DV1K 2G8UA 1B9FA 3OYLA 4BRPA 4CZKA 1NKBA 3SQ4A 4HCCA 3SBTA 3J7YP 2IVPA 2G8WA 4IDKA 1OH6A 1NNEA 3ZX0A 3VETA 1HJRA 2W40A 3Q7CA 2NRZA 1HPMA 4O4GA 1SL1A 3CFRA 1T7PA 4J2DA 1UA1A 5C42A 4DUYK 3MN9A 4DSEA 2P9NA 1GLFO 3HL8A 4OX9K 3QEVA 1KVCA 2IOCA 4FVUA 4MLEA 1SL0A 1CZAN 2PAVA 1NJWA 1NGJA 5B8HA 3D2FB 5CHIA 1O1WA 2F96A 2IVOA 4ICLA 3NMUA 1SAZA 1VQ7N 3VESA 3BUZB 3CETA 3P4IA 4E1NA 1VQ4N 1ZBFA 2HBLA 4QCLA 1KC8O 4B9QA 1KFDA 1J53A 5M1QA 3S3MA 4QAGA 1TKXA 4JRQA 1TK5A 3NDKA 3ATVA 2Q31A 4EIAA 4BY9C 4CJFA 4I9LA 1J9AA 2KFZA 2AP1A 1ZYQA
chains in the Genus database with same CATH topology
2HOEA 4IJNA 1Z6RA 3C7NA 3WEEB 4WQ4A 4BRMA 3ZETA 3OW2M 3AAPA 1YVNA 4O8KA 4IZ9A 5JLHA 3DAWA 4KBOA 5AZIA 5M1FA 3DJCA 3VGKA 4DKWA 4PL7A 3WXJA 1M1KO 4BROA 1WUAA 2E88A 2JWLA 5FPMA 1MDUB 3A8YA 2HBKA 1BU6O 4CBXA 3LM9A 1ATRA 3OHRA 4BRKA 1BDGA 2D1KA 3TTFA 2PBDA 3QB0A 5GAGP 4A5AA 1KQSM 3J8AA 4QS8A 4BRIA 4A2AA 2V52B 3CCLN 3ID8A 5BRFA 2P9SA 3OA9A 3MWTA 1P90A 3D2EB 3H3OB 3O9SA 4BC4A 2WBNA 3FR0A 3PIPL 3W3DA 1ATNA 5AFUA 4Y0WA 3L4IA 2E2QA 3D2FA 3QBWA 5AQKA 4H5TA 2YX6A 3E9OA 4JKEA 3CERA 4GV6A 3SAFA 3FZHA 4BREA 1YAGA 3H3NO 3IFRA 5TKWA 2BTFA 1VQLN 2YJFA 5FPEA 3HTVA 1HKBA 2HSTA 2V51B 3J7ZO 3CF5L 4JAXA 3ENHA 3JXUA 2EWSA 4JN4A 2A42A 5GINA 3G6EN 4A62A 3DXMB 1U2VA 3LDQA 1JCGA 3FE1A 1W97L 3E9LA 3R8EA 1OKJA 5JVHL 1BUPA 3MCPA 2NRVA 1YJ9N 3R9PA 3D7EO 3CCUN 1QZ6A 3FLCO 4H5VA 1JJ2M 5AZJB 4IWVA 3VEWA 4BRGA 4H5WA 5LY3A 3NVKA 3K9KA 5FPDA 5EVZA 4H0PA 3KWGA 5BR9A 3GL1A 1YXQA 2QWOA 3DXKA 2A40A 4IEEA 4ISEA 4IFEA 4JKGB 5LJVA 1WOQA 3HI0A 4PKIA 4BC3A 4QS9A 3LDLA 5AQLA 3TPQA 1YUWA 5AQGA 4F9OA 4BC5A 3WXMB 4ILJA 5E84A 1TUUA 2A6AA 3KWIA 4WCEL 4BR5A 4UY8O 3EE9A 3HOTA 2AA4A 3CC4N 3O08A 3ZYYX 4FPAA 4FPBA 4BVOA 4H03B 1DT9A 1K8AO 3CJCA 3WXIA 3HSCA 4MO4A 5I9EB 4RWTA 3T7ZA 3GDQA 1ESVA 2A3ZA 2ZJQL 1ATSA 2NZTA 4KH6A 3FZLA 2GEMA 1YJWN 4YOXA 3SAHA 5AFUH 3TSQA 1HJOA 5AQSA 2E2OA 2QWRA 3VOVA 2HMPA 1S22A 5GAEP 4R79A 3A5LC 1S3XA 3N4QA 2YJEA 1SZ2A 2OTJN 3S41A 3SJHA 5ELZA 2HBJA 3HOSA 1HKCA 4OO1J 3O1WA 4FWQA 3VEXA 2GTDA 3O6WA 3L0QA 4O5FA 3ZEUA 3WXKA 4BQLA 3CXCM 4JD2A 4RTFD 4PL8A 5KPZA 3TU5A 5AZJA 3H45C 4M7YA 3KZBA 4YDUC 2QEXN 3CCEN 3AGKA 5BRHA 4HWIA 4JKDA 1X9JA 5BREA 4JKAA 4H0TB 1GLDG 2VGNA 3EZWA 4L3QA 5BPNA 3PIOL 2P9KB 4PHTX 1BA1A 1SQKA 3HM8A 3MMVA 2FSJA 1BO5O 5AQTA 4BG9A 5BPLA 3CCSN 3B8AX 3H46O 4WF9L 3MX5A 3CPWM 2QTDA 4BR7A 2P9UB 2BUPA 3EE8A 3O4WA 4JNEA 1K73O 5AQVA 3L4QA 3CPEA 3QFUA 3WQTA 4JHDB 2ZJPL 2D4WA 4MDBA 5KPTA 1MWMA 4B1YB 4IDHA 3TTCA 2ZJRL 3O80A 4Z94A 3P31A 2I7PA 2VGMA 3M6GA 4GNIA 5AQYA 3CJ9A 1O13A 2YHWA 3H6EA 3C6AA 3H1VX 2E8AA 1E4FT 3ZX3A 2ZGYA 4EAHD 1T6DA 4BC2A 3CJAA 3W0LA 1NGGA 1YJNN 5C2FA 5C0YA 4FSVA 2KKZA 1VQ6N 4A59A 5H1SQ 4FWNA 4YOYA 2W41A 4O8UA 4BRLA 3Q7BA 4CZJA 1VQPN 2NRHA 2A41A 1Q86O 4H0YB 4E1JA 4KH5A 3FGUA 2RHKA 4IXCA 1ZXOA 2DPNA 4AM6A 3ENOA 2ASOA 1RFQA 4WFBL 4PKGA 3WXLA 3VTIA 4FWMA 1TYQB 4K25A 3WQUA 3FZMA 5AQWA 5AQMA 4BRNA 5GIOA 2FSNA 4WYBA 4B1WB 4FWOA 3JS6A 4CD3A 1VQON 5JICA 3AY9A 4K43A 4A5BA 3A5OC 4FL9A 1Q81O 4FOEA 3UB5A 1ZBSA 1QQOA 2D0OA 4JKFA 1QQNA 3C0BA 4EHUA 4IEIA 1KAXA 2HBMA 2QWMA 4M7XA 3IUCA 4DCHA 3G71N 3ID6A 4CZGA 1ZC6A 5GIPA 3CC2N 3RSEB 1RGIA 3E1YA 3QBXA 3CCVN 3HBTA 2P9UA 3UKUA 5ADXA 1HKGA 3E9PA 3BEXA 4JKCA 4JEPA 5AQZA 2F9WA 3O1BA 1YF5L 3EL2A 2QI2A 4YOTA 3WEEA 4BRDA 1OVYA 2E2PA 5AQNA 1K8KB 2F7TA 4I6MB 4OPHA 5C10A 1ILYA 3I33A 2NRXA 2P9NB 1NGFA 1H1VA 2WFBA 4RCHA 1HLUA 2Q1NA 1NGBA 2FLOA 3VF2A 4A57A 4JKBA 5LJWA 5EXWA 3VF6A 3IMXA 2E1YA 3VENA 3IDHA 2FF6A 3D6RA 3LDPA 3CMAN 4BGBA 4GV3A 3D2EA 5AQXA 5HL7L 3VGMA 4J8FA 4CZEA 2QWNA 2CGJA 4YOUA 5C12A 3U8XA 2A5XA 3ZX2A 4BRQA 1NMDA 5KQ8A 1NGDA 2IVNA 3TTDA 1K9MO 2CGLA 3O9UA 1X3MA 2FXUA 5FPNA 3C6HA 5EOYA 5M1NA 4WQ4C 4MLHA 2NNWA 4BR4A 4DHYA 1VQ5N 4BR0A 1EQYA 4WFAL 2Q36A 2I7NA 3UKRB 1NGAA 3QDKA 3KK7A 1DEJA 1MA9B 2F9TA 4H5NA 2CH6A 3MCAB 2P9IB 5CR4A 3A5NC 2NLXA 5HOOA 3DXMA 3I56N 5AQOA 4DQ8A 2E1ZA 2QM1A 5JLFA 2QA4N 3ZETB 5KPRA 1VAZA 4CZFA 4CBUA 2KLAA 1T3VA 4C23A 3CJ7A 3EKUA 1QZ5A 2KHOA 3P39A 3O5BA 2HF3A 4H0OA 2GX9A 2ZWHA 3G25A 4FWSA 1NWKA 4B1ZA 2JWKA 2NRTA 4WFNL 1GLEG 4JKGA 1GLLO 3MX2A 3RVCA 3WUHA 5ADXH 1GLJO 3MN5A 1SS6A 1XUPO 2OANA 4DB3A 1VQMN 4LC9B 5EY4A 3CI5A 3E66A 1V4SA 1NJIO 1G99A 3MN6A 4K41A 3HRGA 3QFPA 4YORA 3SLCA 1NGCA 3MWPA 3U9ZA 3FZFA 5EX5A 3UE5A 5KQDA 4YOWA 3O9TA 1S72N 1W2BM 4H0XB 3ENBA 4FO0A 3SBGA 5F2RA 3TSUA 3BF3A 4BRAA 2CH5A 3M5RA 3O9QA 5GADP 1T6CA 1LCUA 2VCPA 4CZIA 5CE3A 2BH1A 1J6ZA 3VF4A 5JMVA 5GAHP 5MLCQ 3AARA 4EHTA 3K9JA 4M63C 1GLAG 1GLCG 2CGKA 2ZF5O 4QS7A 3CMEN 3SAGA 4NLBA 1QVGM 1C0GA 2Q97A 4ILHA 3I8BA 3VTHA 2Q2RA 4BG8A 1U2VB 4PKHA 4G9ZA 3FFKB 3M3ZA 3R1XA 4B1XB 2P9IA 4GY2B 2YI1A 2H3GX 2GWJA 1T44A 4WQ5A 1P8ZA 4GVEA 5M1KA 2WC9A 1D4XA 4ISGA 4B1VA 4EFHA 5C2DA 5AQUA 2HF4A 3DXKB 5AQIA 1QVFM 2VYPA 3CJ1A 1XC3A 2D0PA 4CD1A 3CC7N 3CCRN 2PFUA 3SMSA 1KD1O 1E4GT 4FWPA 2NRRA 2P9PB 3A5MC 3NVMA 3VGLA 1MWKA 3U4LA 2P9KA 4ILGB 3I55N 3AAQA 3SK3A 3LDOA 3F2KA 5F0XA 5BRDA 3CJBA 3IKMA 3KHYA 4BVPA 3FZKA 4CZMA 4YDUA 3ULEB 2V7ZA 5DM7L 5BN8A 3O9RA 4JHDA 3SMPA 2NRWA 4BRCA 2QWPA 1HX1A 3VEZA 3AGRA 1V4TA 3GE1A 2V7YA 4YOVA 1NGEA 5AR0A 5AQQA 3EN9A 3BP8A 3GOIA 3CCJN 2YHYA 3LL3A 2Q0UA 2YCHA 5AQFA 4IOAL 2J4RA 3BF1A 1NGHA 4NB4A 5JVGL 3QICA 1KXPA 1Y64A 3VPZA 3CCMN 1M90O 1QQMA 3R6MA 1JCFA 2GELA 4IO9L 3MDQA 5E26A 1GLBG 3HZ6A 4GV9A 4B1UB 2P9LB 2UYTA 2E2NA 3VMFB 2IIRA 5C15A 2GWKA 3ZEUB 3VERA 4BRFA 4CZLA 4JD2B 1Q18A 1R59O 5F1XA 2QWQA 4BR2A 1IG8A 3PLAA 2OTLN 4BRHA 3CCQN 4CI6A 3MN7A 3C65A 5DM6L 4BGAA 3CIPA 1BA0A 3VEVA 5AQHA 3VEYA 4H0VB 1TYQA 1LOTB 2ASMA 4AF1A 4IOCL 5AQPA 2ZGZA 2RE2A 4MDAA 4XH5A 4C1NK 2YHXA 1BG3A 3LM2A 4JK7A 1Q82O 1Z05A 3CQXA 1NGIA 1YITN 4XEIA 5TKYA 1TUYA 3A0IX 2FSKA 2P9PA 1RDWX 4CZHA 3DLLL 2GUPA 3DWLA 4BRPA 1DGKN 4IOXA 1IJJA 3OBYA 4FOIA 4CZKA 1XQSC 1RDUA 3CD6N 3SBTA 1NM1A 3R3LA 2IVPA 3C7NB 3CHWA 3RSEA 4NLCA 3ULEA 3G4SN 3MK6A 4IO8A 3ZX0A 4WQ5C 3VETA 1YHQN 2W40A 3Q7CA 5AZIB 5M1OA 1BWFO 2NRZA 1VQKN 1X3NA 2WUSA 1HPMA 4BR9A 2QWLA 3T69A 1QHAA 1Q7YO 4OPAA 2E20A 4XH1A 1K8KA 3MN9A 4I6MA 4IJAA 4FWLA 3QMLA 1JCEA 1KAYA 3TSPA 1HUXA 3GG4A 3U9DA 4CJ7A 2P9NA 1YIJN 1GLFO 4AM7A 5BPMA 3H1QA 1NLVA 4FWRA 1DKGD 2P9SB 2QXLA 3EO3A 3F9MA 1VQNN 4FVUA 4MLEA 3LDNA 1CZAN 1U6ZA 2PAVA 4XH4A 2ITMA 2P9LA 1BOTO 3VEOA 4NO7A 3GBTA 1NGJA 5AQJA 3D2FB 5B8HA 1N8RO 3CQYA 2FF3B 4CBWA 2Q0RA 5CHIA 1VQ9N 1NBWA 4HTLA 1KAZA 4A61A 2IVOA 3NMUA 1SAZA 2VWBA 1YI2N 1VQ8N 1VQ7N 3VESA 3BUZB 3ATUA 2ASPA 2QW9A 3CETA 3M1FA 3P4IA 1VQ4N 2HBLA 4JKHA 4A2BA 3F5TA 4FWKA 1KC8O 4JK9A 3O8MA 4B9QA 1EO1A 1C0FA 4BQZA 4H5RA 4U7BA 3KVGA 3EKSA 4ISFA 4MO5A 5AQRA 5M1QA 3P38A 3UKRA 4K42A 3N4PA 4C1NI 4KH4A 5BN9A 3L6QA 4U67L 5M1PA 3ATVA 2Q31A 3OBWA 3WT0A 4EIAA 4BY9C 4JK8A 3UKUB 2AP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOE A;  4IJN A;  1Z6R A;  3C7N A;  3WEE B;  4WQ4 A;  4BRM A;  3ZET A;  3AAP A;  1YVN A;  4O8K A;  4IZ9 A;  5JLH A;  3DAW A;  4KBO A;  5AZI A;  3DJC A;  3VGK A;  4PL7 A;  3WXJ A;  4BRO A;  1WUA A;  2E88 A;  5FPM A;  1MDU B;  3A8Y A;  1BU6 O;  4CBX A;  3LM9 A;  1ATR A;  3OHR A;  4BRK A;  1BDG A;  2D1K A;  2PBD A;  3QB0 A;  3J8A A;  4QS8 A;  4BRI A;  4A2A A;  2V52 B;  3ID8 A;  5BRF A;  2P9S A;  3D2E B;  3H3O B;  4BC4 A;  3FR0 A;  3W3D A;  1ATN A;  5AFU A;  4Y0W A;  3L4I A;  2E2Q A;  3D2F A;  3QBW A;  5AQK A;  4H5T A;  3CER A;  3FZH A;  4BRE A;  1YAG A;  3H3N O;  3IFR A;  2BTF A;  2YJF A;  5FPE A;  3HTV A;  1HKB A;  2V51 B;  4JAX A;  3ENH A;  3JXU A;  2EWS A;  4JN4 A;  2A42 A;  4A62 A;  3DXM B;  1U2V A;  3LDQ A;  1JCG A;  3FE1 A;  3R8E A;  1OKJ A;  1BUP A;  3MCP A;  3R9P A;  3D7E O;  1QZ6 A;  3FLC O;  4H5V A;  5AZJ B;  4IWV A;  3VEW A;  4BRG A;  4H5W A;  5LY3 A;  5FPD A;  5EVZ A;  4H0P A;  5BR9 A;  3GL1 A;  1YXQ A;  2QWO A;  3DXK A;  2A40 A;  4ISE A;  5LJV A;  1WOQ A;  3HI0 A;  4PKI A;  4BC3 A;  4QS9 A;  3LDL A;  5AQL A;  3TPQ A;  1YUW A;  5AQG A;  4F9O A;  4BC5 A;  5E84 A;  1TUU A;  2A6A A;  4BR5 A;  2AA4 A;  3O08 A;  4FPA A;  4FPB A;  4BVO A;  4H03 B;  3CJC A;  3WXI A;  3HSC A;  4MO4 A;  5I9E B;  4RWT A;  3GDQ A;  1ESV A;  2A3Z A;  1ATS A;  2NZT A;  3FZL A;  2GEM A;  5AFU H;  1HJO A;  5AQS A;  2E2O A;  2QWR A;  3VOV A;  2HMP A;  1S22 A;  3A5L C;  1S3X A;  2YJE A;  1SZ2 A;  3S41 A;  3SJH A;  5ELZ A;  1HKC A;  3O1W A;  4FWQ A;  3VEX A;  2GTD A;  3O6W A;  3L0Q A;  4O5F A;  3ZEU A;  3WXK A;  4BQL A;  4JD2 A;  4RTF D;  4PL8 A;  5KPZ A;  3TU5 A;  5AZJ A;  3H45 C;  4M7Y A;  3KZB A;  4YDU C;  5BRH A;  4HWI A;  1X9J A;  5BRE A;  4H0T B;  1GLD G;  3EZW A;  4L3Q A;  5BPN A;  2P9K B;  1BA1 A;  1SQK A;  3HM8 A;  3MMV A;  2FSJ A;  1BO5 O;  5AQT A;  4BG9 A;  5BPL A;  3B8A X;  3H46 O;  4BR7 A;  2P9U B;  2BUP A;  3O4W A;  4JNE A;  5AQV A;  3QFU A;  3WQT A;  4JHD B;  2D4W A;  5KPT A;  1MWM A;  4B1Y B;  3O80 A;  4Z94 A;  2I7P A;  4GNI A;  3M6G A;  5AQY A;  3CJ9 A;  2YHW A;  3H6E A;  3H1V X;  2E8A A;  1E4F T;  3ZX3 A;  2ZGY A;  4EAH D;  1T6D A;  4BC2 A;  3CJA A;  3W0L A;  1NGG A;  4FSV A;  4FWN A;  2W41 A;  4BRL A;  4CZJ A;  2NRH A;  2A41 A;  4H0Y B;  4E1J A;  3FGU A;  4IXC A;  1ZXO A;  2DPN A;  4AM6 A;  3ENO A;  2ASO A;  1RFQ A;  4PKG A;  3WXL A;  4FWM A;  1TYQ B;  4K25 A;  3WQU A;  3FZM A;  5AQW A;  5AQM A;  4BRN A;  2FSN A;  4WYB A;  4B1W B;  4FWO A;  3JS6 A;  4CD3 A;  5JIC A;  3AY9 A;  4K43 A;  3A5O C;  4FL9 A;  4FOE A;  3UB5 A;  1ZBS A;  1QQO A;  2D0O A;  1QQN A;  3C0B A;  4EHU A;  1KAX A;  4M7X A;  2QWM A;  4DCH A;  3IUC A;  4CZG A;  1ZC6 A;  3RSE B;  1RGI A;  3QBX A;  3HBT A;  2P9U A;  3UKU A;  5ADX A;  1HKG A;  3BEX A;  5AQZ A;  2F9W A;  3O1B A;  3EL2 A;  3WEE A;  4BRD A;  2E2P A;  5AQN A;  1K8K B;  4I6M B;  3I33 A;  2P9N B;  1NGF A;  1H1V A;  4RCH A;  1HLU A;  2Q1N A;  1NGB A;  2FLO A;  3VF2 A;  5LJW A;  5EXW A;  3VF6 A;  3IMX A;  2E1Y A;  3VEN A;  3IDH A;  2FF6 A;  3LDP A;  4BGB A;  3D2E A;  5AQX A;  3VGM A;  4J8F A;  4CZE A;  2QWN A;  2CGJ A;  3U8X A;  2A5X A;  3ZX2 A;  4BRQ A;  1NMD A;  5KQ8 A;  1NGD A;  2IVN A;  2CGL A;  1X3M A;  2FXU A;  5FPN A;  5EOY A;  4WQ4 C;  4MLH A;  4BR4 A;  4DHY A;  4BR0 A;  1EQY A;  2Q36 A;  2I7N A;  3UKR B;  1NGA A;  3QDK A;  1DEJ A;  1MA9 B;  2F9T A;  4H5N A;  2CH6 A;  2P9I B;  3A5N C;  2NLX A;  3DXM A;  5AQO A;  4DQ8 A;  2E1Z A;  2QM1 A;  5JLF A;  3ZET B;  5KPR A;  4CZF A;  4CBU A;  4C23 A;  3CJ7 A;  3EKU A;  1QZ5 A;  2KHO A;  3O5B A;  2HF3 A;  4H0O A;  2ZWH A;  3G25 A;  4FWS A;  1NWK A;  4B1Z A;  1GLE G;  1GLL O;  3WUH A;  5ADX H;  1GLJ O;  3MN5 A;  1XUP O;  2OAN A;  4DB3 A;  4LC9 B;  5EY4 A;  3CI5 A;  1V4S A;  1G99 A;  3MN6 A;  4K41 A;  3SLC A;  3QFP A;  1NGC A;  3U9Z A;  3UE5 A;  3FZF A;  5EX5 A;  5KQD A;  4H0X B;  4FO0 A;  5F2R A;  3BF3 A;  4BRA A;  2CH5 A;  1T6C A;  1LCU A;  2VCP A;  4CZI A;  5CE3 A;  5JMV A;  1J6Z A;  3VF4 A;  3AAR A;  4EHT A;  4M63 C;  1GLA G;  1GLC G;  2CGK A;  2ZF5 O;  4QS7 A;  1C0G A;  2Q97 A;  3I8B A;  2Q2R A;  4BG8 A;  1U2V B;  4PKH A;  3FFK B;  3M3Z A;  4B1X B;  2P9I A;  4GY2 B;  2YI1 A;  2H3G X;  2GWJ A;  1T44 A;  4WQ5 A;  1P8Z A;  1D4X A;  4ISG A;  4B1V A;  4EFH A;  5AQU A;  2HF4 A;  3DXK B;  5AQI A;  2VYP A;  3CJ1 A;  1XC3 A;  2D0P A;  4CD1 A;  3SMS A;  1E4G T;  4FWP A;  2P9P B;  3A5M C;  3VGL A;  1MWK A;  3U4L A;  2P9K A;  3AAQ A;  3SK3 A;  3LDO A;  5F0X A;  5BRD A;  3CJB A;  3KHY A;  4BVP A;  3FZK A;  4CZM A;  4YDU A;  3ULE B;  2V7Z A;  5BN8 A;  4JHD A;  3SMP A;  4BRC A;  2QWP A;  1HX1 A;  3VEZ A;  1V4T A;  3GE1 A;  2V7Y A;  1NGE A;  5AR0 A;  5AQQ A;  3EN9 A;  3BP8 A;  3GOI A;  2YHY A;  3LL3 A;  2Q0U A;  2YCH A;  5AQF A;  2J4R A;  3BF1 A;  1NGH A;  4NB4 A;  3QIC A;  1KXP A;  1Y64 A;  3VPZ A;  1QQM A;  3R6M A;  1JCF A;  2GEL A;  3MDQ A;  5E26 A;  1GLB G;  3HZ6 A;  4B1U B;  2P9L B;  2UYT A;  2E2N A;  2IIR A;  2GWK A;  3ZEU B;  3VER A;  4BRF A;  4CZL A;  4JD2 B;  1Q18 A;  1R59 O;  5F1X A;  2QWQ A;  4BR2 A;  1IG8 A;  4BRH A;  4CI6 A;  3MN7 A;  4BGA A;  3CIP A;  1BA0 A;  3VEV A;  5AQH A;  3VEY A;  4H0V B;  1TYQ A;  1LOT B;  2ASM A;  5AQP A;  2ZGZ A;  4XH5 A;  2YHX A;  1BG3 A;  3LM2 A;  1Z05 A;  3CQX A;  1NGI A;  4XEI A;  5TKY A;  1TUY A;  3A0I X;  2FSK A;  2P9P A;  1RDW X;  4CZH A;  2GUP A;  3DWL A;  4BRP A;  1DGK N;  1IJJ A;  4FOI A;  4CZK A;  1XQS C;  1NM1 A;  2IVP A;  3C7N B;  3CHW A;  3RSE A;  3ULE A;  3MK6 A;  4IO8 A;  3ZX0 A;  4WQ5 C;  3VET A;  2W40 A;  5AZI B;  1BWF O;  1X3N A;  2WUS A;  1HPM A;  4BR9 A;  2QWL A;  1QHA A;  2E20 A;  4XH1 A;  1K8K A;  3MN9 A;  4I6M A;  4IJA A;  4FWL A;  3QML A;  1JCE A;  1KAY A;  1HUX A;  3GG4 A;  3U9D A;  4CJ7 A;  2P9N A;  1GLF O;  4AM7 A;  5BPM A;  3H1Q A;  1NLV A;  4FWR A;  1DKG D;  2P9S B;  2QXL A;  3EO3 A;  3F9M A;  4MLE A;  3LDN A;  1CZA N;  1U6Z A;  2PAV A;  4XH4 A;  2ITM A;  2P9L A;  1BOT O;  3VEO A;  4NO7 A;  3GBT A;  1NGJ A;  5AQJ A;  3D2F B;  5B8H A;  3CQY A;  2FF3 B;  4CBW A;  2Q0R A;  1NBW A;  4HTL A;  1KAZ A;  4A61 A;  2IVO A;  1SAZ A;  2VWB A;  3VES A;  3BUZ B;  3ATU A;  2ASP A;  2QW9 A;  3CET A;  3M1F A;  3P4I A;  4A2B A;  4FWK A;  3O8M A;  4B9Q A;  1C0F A;  4BQZ A;  4H5R A;  3KVG A;  3EKS A;  4ISF A;  4MO5 A;  5AQR A;  3UKR A;  4K42 A;  5BN9 A;  3L6Q A;  3ATV A;  2Q31 A;  3WT0 A;  4EIA A;  3UKU B;  2AP1 A; 
#chains in the Genus database with same CATH topology
 1Z6R A;  3C7N A;  3WEE B;  4BRM A;  3DLK A;  3V9X A;  4IZ9 A;  1HNX K;  5FRM A;  4KBO A;  5J2Q A;  4G1Q A;  5DK5 A;  4HUF A;  4R5P A;  3HPO A;  1M1K O;  4CED A;  1QE1 A;  3DMJ A;  3A8Y A;  2HBK A;  1BU6 O;  4CBX A;  1EXQ A;  4Z4E A;  4F2S A;  4FLT A;  4BRK A;  3TTF A;  1KQS M;  2V52 B;  1BIS A;  1Z25 A;  3FR0 A;  3PIP L;  5HRN A;  4JI1 K;  2E2Q A;  4CK2 A;  3QBW A;  4H5T A;  2YX6 A;  3AVB A;  4DWI A;  4B9L A;  1NK6 A;  3LPT A;  3FZH A;  4BRE A;  1SKR A;  3LP0 A;  1RIL A;  4B8A B;  3NH2 A;  1ZBH A;  3J7Z O;  1WBB A;  4JAX A;  1NK4 A;  4CHO A;  1C6V A;  1RTD A;  3JXU A;  1E3M A;  4JN4 A;  3AA3 A;  4I2P A;  4A62 A;  4FJ7 A;  4OKK A;  3T1Y K;  3UIQ A;  1C0M A;  2KZZ A;  4FK2 A;  3TAN A;  3E9L A;  1OKJ A;  1IKY A;  3JAM O;  1BL3 A;  4DV4 K;  3R9P A;  4FLW A;  3CCU N;  4H5V A;  5FPD A;  4H0P A;  3TAE A;  1C1C A;  3DRP A;  2A40 A;  4OKJ A;  3HI0 A;  4PKI A;  3TPQ A;  1JLB A;  1TUU A;  3KWI A;  3EE9 A;  1N36 K;  2OA8 A;  5LMU K;  3O08 A;  1VSK A;  4BVO A;  1SL2 A;  1DT9 A;  3SUO A;  3CJC A;  5FDL A;  4AHV A;  3TAF A;  4MO4 A;  1S9G A;  1EP4 A;  3GDQ A;  4Q5V A;  1U49 A;  2A3Z A;  2ATQ A;  2NZT A;  4YOX A;  3SAH A;  4PQU A;  1NMN A;  4WE1 A;  4GMJ B;  5GAE P;  3A5L C;  1KFS A;  1S3X A;  4GW6 A;  3CG7 A;  3SJH A;  5ELZ A;  2HBJ A;  4W5O A;  3O1W A;  4FWQ A;  3VEX A;  2GTD A;  1TKT A;  3HP6 A;  3CXC M;  4PL8 A;  5KPZ A;  3RMC A;  2G8F A;  3QIN A;  3KZB A;  4YDU C;  3ZSW A;  1NOY A;  2QEX N;  2ETJ A;  4CF2 A;  1C1B A;  4HWI A;  4I7F A;  4JKD A;  4DTP A;  3AO2 A;  5BRE A;  1NJX A;  5FRO A;  2B5J A;  2VGN A;  4J2B A;  2FSJ A;  3CCS N;  2G8K A;  2QTD A;  3EE8 A;  4AHT A;  3QFU A;  3CPE A;  3WQT A;  4HUE A;  5KPT A;  4B1Y B;  3AO3 A;  4DV2 K;  1S5J A;  3O80 A;  1WSF A;  4CJL A;  5KTQ A;  3M6G A;  5AQY A;  3CJ9 A;  1LWE A;  1HMV A;  1RT7 A;  1LW2 A;  1VHX A;  2YHB A;  2ZGY A;  1T6D A;  4CJ4 A;  4CGD A;  1CXU A;  1A5X A;  1L3U A;  1YTU A;  4FSV A;  2JGU A;  1VQP N;  2A41 A;  1Q86 O;  2KFN A;  2ZE2 A;  2OPP A;  4B8C A;  1N5Y A;  2ASO A;  4PKG A;  3VTI A;  1FKO A;  5AQW A;  4N47 A;  1RNH A;  4FWO A;  1VQO N;  2RF2 A;  2HVI A;  2KZM A;  3A5O C;  1Q81 O;  4FOE A;  3UB5 A;  3ZT3 A;  1ZBS A;  2YNG A;  3KJV A;  1QQN A;  3JYT A;  4M7X A;  1VSM A;  4DCH A;  1JLE A;  3ID6 A;  5GIP A;  1OVQ A;  3ZT1 A;  3RSE B;  1RGI A;  3PX6 A;  3E9P A;  3V4I A;  1DTQ A;  2F9W A;  1LAV A;  3V1Q A;  3VQ7 A;  3WEE A;  2QI2 A;  4YOT A;  4FVM A;  5AQN A;  4W5Q A;  2F7T A;  4CEZ A;  1H1V A;  3MAQ A;  4RCH A;  2FLO A;  4DQS A;  3K59 A;  4JKB A;  2E1Y A;  3VEN A;  4FK4 A;  3CMA N;  5AQX A;  4CF1 A;  3AVM A;  4FJI A;  5HL7 L;  3WNE A;  4YOU A;  5SWM A;  2IVN A;  3TTD A;  1U48 A;  2CGL A;  3O9U A;  3B6O A;  5FPN A;  2ZD1 A;  4DHY A;  1VQ5 N;  2FC0 A;  4BR0 A;  4YNQ A;  4FLY A;  2IGI A;  1S1V A;  3UKR B;  3KK7 A;  1DEJ A;  2RKI A;  2CH6 A;  3MCA B;  5CR4 A;  4DG1 A;  1RDB A;  2XY8 A;  3ZT2 A;  2E1Z A;  2RN2 A;  4FJ9 A;  4MQ3 A;  2PYJ A;  3OYE A;  2W6K A;  1QZ5 A;  2KHO A;  1NK0 A;  1D8Y A;  4WFN L;  4DQR A;  1GLL O;  2P5G A;  2WOM A;  5SZT A;  2OAN A;  3C94 A;  3AVH A;  4LC9 B;  1V4S A;  4FJ5 A;  3MN6 A;  3SLC A;  4YOR A;  3UE5 A;  1NGC A;  3FZF A;  5KQD A;  3O9T A;  1KSP A;  1ASU A;  3I0R A;  3SBG A;  3RWU A;  2VCP A;  4CZI A;  4KPY A;  1VSD A;  3TAG A;  1NOZ A;  3AAR A;  3K9J A;  1GLA G;  2CGK A;  4CHQ A;  4CIG A;  3O3G A;  2Q97 A;  3P83 D;  4CGF A;  2Q2R A;  3DLR A;  1NKC A;  3L2V A;  3FFK B;  3R1X A;  1JKH A;  2P9I A;  2O8D B;  4B9V A;  2H3G X;  4DR5 K;  4DTO A;  3J80 O;  4J2A A;  1S9E A;  1VRU A;  1D4X A;  1YVU A;  4JS4 A;  3TWH A;  2E5L K;  3C95 A;  3IAY A;  3TR8 A;  2VYP A;  3CC7 N;  3SMS A;  4FJN A;  1KD1 O;  4Y1C A;  3OTO K;  3SV4 A;  1L3S A;  1MWK A;  4DFK A;  3HXM A;  3AAQ A;  3LDO A;  4M3W A;  3FZK A;  1WLJ A;  2NRW A;  4CF9 A;  2ITG A;  3VEZ A;  3VQ5 A;  4CEA A;  4KHP K;  4O55 A;  2X6N A;  3GOI A;  4DLE A;  2HW3 A;  4IOA L;  4C8N A;  2J4R A;  3BF1 A;  1NGH A;  1X1P A;  3QIC A;  2X6S A;  1CZB A;  1M90 O;  3WNH A;  1QQM A;  1BHL A;  1JCF A;  2GEL A;  3IS9 A;  1K6Y A;  3ZSV A;  3OYF A;  4NCB A;  4IG0 A;  1GLB G;  3HZ6 A;  2UXC K;  2E2N A;  3VMF B;  5C15 A;  3ZEU B;  3LWL A;  5F1X A;  2QWQ A;  1IKX A;  2OTL N;  3CCQ N;  4DV6 K;  4BGA A;  1BA0 A;  5AQH A;  1ITG A;  3SQ0 A;  5AQP A;  1TVR A;  2RE2 A;  3QLH A;  3QEI A;  1Q82 O;  1IKW A;  1Z05 A;  3VQ9 A;  1NGI A;  3A0I X;  2FSK A;  3FFI A;  1WBD A;  2HHU A;  4LFA K;  3THX A;  4IOX A;  1IJJ A;  3AVK A;  2WON A;  4CJ5 A;  1RDU A;  3C7N B;  3RSE A;  1S6Q A;  3V9W A;  1JXE A;  5M1O A;  2WTU A;  1X3N A;  2WUS A;  3T69 A;  4OPA A;  2E20 A;  2HMI A;  4IJA A;  1CXQ A;  3QML A;  1BIU A;  3TSP A;  1HUX A;  3U9D A;  3EY1 A;  5BPM A;  4DR4 K;  3OJS A;  1NLV A;  1DKG D;  3EO3 A;  2ITM A;  2Q3S A;  2BGG A;  3DLE A;  5AQJ A;  4HHT A;  4ZTJ A;  1N8R O;  4NXM K;  3CQY A;  2HND A;  4FJM A;  1VQ8 N;  3ATU A;  2G8H A;  4A2B A;  2W42 A;  1LAW A;  4BQZ A;  3KLF A;  4DV7 K;  1D9D A;  4ISF A;  3S9H A;  5C25 A;  3P38 A;  2KQ2 A;  3UKR A;  4K42 A;  3U6F A;  4DSL A;  4C1N I;  5J2M A;  1HYV A;  5M1P A;  5HRO A;  1I39 A;  4ID5 A;  3MEC A;  4CJK A;  4KHU A;  3AVG A;  1UWB A;  4DR2 K;  3OW2 M;  5JLH A;  5AZI A;  3LZJ A;  3VGK A;  4DKW A;  3AVC A;  4PY5 A;  2NUB A;  4BRO A;  4CF0 A;  2E88 A;  5FPM A;  3LM9 A;  4KB0 A;  1BDG A;  1LV5 A;  2PBD A;  1TAQ A;  5GAG P;  4A5A A;  3J8A A;  4BRI A;  4BDZ A;  3ID8 A;  2P9S A;  3VQE A;  2Y1J A;  3MWT A;  3O9S A;  1ATN A;  4CJW A;  2XHB A;  3E9O A;  4HTU A;  4JKE A;  4GV6 A;  4Z4G A;  1YAG A;  3H3N O;  5TKW A;  2YJF A;  5FPE A;  3AVN A;  3KLI A;  3S3O A;  1SUQ A;  2BAN A;  3ENH A;  2EWS A;  1CZ9 A;  3PSI A;  3KK1 A;  4OJR A;  3DM2 A;  4CFA A;  3LDQ A;  1BCO A;  1W97 L;  3R8E A;  1TAU A;  2O8D A;  3MCP A;  3M8R A;  1YJ9 N;  3D7E O;  3T1A A;  3FLC O;  4LY7 A;  1JJ2 M;  4BRG A;  4H5W A;  1J5O A;  2O4G A;  3KWG A;  3S3N A;  4IEE A;  4ISE A;  4JKG B;  3DLB A;  2Z1G A;  3NBP A;  5AQL A;  5AQG A;  3SUQ A;  2B6A A;  4M3Z A;  4ILJ A;  4BAC A;  4FM2 A;  4JV5 K;  2GBZ A;  2Z1I A;  4FPA A;  1U04 A;  1WSE A;  5JS1 A;  1RDA A;  3ZLJ A;  4PA1 A;  3ZSX A;  5FRN A;  3K5L A;  1ATS A;  4CHP A;  5BR8 K;  1T8E A;  5J1E A;  2AJQ A;  4GVM A;  1N34 K;  4R79 A;  4HCB A;  2YJE A;  1SZ2 A;  3S41 A;  3HOS A;  2UXB K;  4KI4 A;  3L0Q A;  1L5U A;  4K0K K;  2DTU A;  3ZEU A;  3KIO A;  2FBX A;  3M8P A;  4BQL A;  5AZJ A;  4M7Y A;  3HPH A;  2G8I A;  5EU7 A;  4M3Y A;  5KGW A;  4CK1 A;  4JI0 K;  3A2F A;  1X9J A;  1WAF A;  4JKA A;  4H0T B;  3L2Q A;  1GLD G;  3AV9 A;  4L3Q A;  1BIZ A;  4PHT X;  3L8B A;  5BPL A;  5AQT A;  3D0P A;  4E7K A;  1A5V A;  3JSM A;  2UUB K;  4WF9 L;  4LH5 A;  5KRT A;  3MX5 A;  4B3T K;  3SUN A;  4BR7 A;  4CFC A;  4KTQ A;  2BUP A;  4JNE A;  3NE6 A;  1K73 O;  1VSL A;  3L4Q A;  4JHD B;  1MWM A;  4IDH A;  3ULD A;  2FBY A;  3BGR A;  4DTR A;  4CEQ A;  1GOC A;  2E8A A;  4X65 K;  3M8Q A;  4C8O A;  1KRP A;  4EAH D;  4BC2 A;  4CJT A;  2IC3 A;  4OGE A;  2KKZ A;  1VQ6 N;  2FBV A;  2VG7 A;  5H1S Q;  4OPJ A;  4O8U A;  4DF8 A;  4BRL A;  4CZJ A;  3K5O A;  1TGO A;  1ZBU A;  1HQU A;  1IBK K;  4KTZ A;  1RFQ A;  4DQP A;  3WXL A;  4E1M A;  4FWM A;  2QKB A;  2FSN A;  4NYF A;  3JS6 A;  3MED A;  4CFD A;  4M3X A;  4KB1 A;  1W0H A;  1HYS A;  3OYK A;  4RW8 A;  3L2U A;  4M3R A;  4FZY A;  2QWM A;  3IUC A;  1ASW A;  1ZC6 A;  3V1O A;  4E89 A;  2YV0 X;  4DFP A;  4FJK A;  4JKC A;  1YF5 L;  3EL2 A;  3QNN A;  1K8K B;  4I6M B;  4CES A;  4CJQ A;  4JI5 K;  2DFF A;  3I33 A;  4NCA A;  1RBU A;  1ILY A;  2NRX A;  3THY A;  4W5R A;  4ELV A;  1HLU A;  1NGB A;  4AHU A;  1EET A;  3MEG A;  1RBS A;  4E7L A;  3IMX A;  4CHZ A;  2FF6 A;  3D6R A;  3LDP A;  1NK9 A;  4BGB A;  4GV3 A;  3P1G A;  3QET A;  1B9D A;  3VGM A;  2QWN A;  4FLX A;  3V81 A;  3U8X A;  2A5X A;  3ZX2 A;  3L2W A;  1NMD A;  1K9M O;  3C6H A;  1XC9 A;  1EQY A;  1RTI A;  3ALY A;  4OGC A;  3VQP A;  1SV5 A;  1NKE A;  1MA9 B;  2F9T A;  5T7B A;  2Y1I A;  2P9I B;  3A5N C;  1RTJ A;  3QO9 A;  4LF9 K;  4N76 A;  5AQO A;  3B6P A;  5KPR A;  2HHH K;  3CJ7 A;  3P39 A;  2GX9 A;  2ZWH A;  3CYM A;  3G25 A;  2VG5 A;  4B1Z A;  2JWK A;  2NRT A;  4JKG A;  3RVC A;  3MN5 A;  4E7H A;  4KHQ A;  2OPR A;  5EY4 A;  3SZ2 A;  4KFB A;  5EX5 A;  1FK9 A;  2XY7 A;  1W2B M;  3BZK A;  4OLA A;  3BF3 A;  4BRA A;  4F4K A;  3M5R A;  3O9Q A;  5GAD P;  4JI2 K;  2BH1 A;  4FW1 A;  1TL1 A;  4DTJ A;  4O44 A;  4NLB A;  4ILH A;  4FJL A;  4LF4 K;  4CGG A;  3I8B A;  4BG8 A;  1G15 A;  4JS5 A;  4DMN A;  4B1X B;  4NCG A;  1GOA A;  4AHR A;  2YI1 A;  5HRS A;  4LF6 K;  4WQ5 A;  3F9K A;  4B1V A;  4EFH A;  3KLE A;  3TI0 A;  3HK2 A;  4OLB A;  5C2D A;  2HF4 A;  1QVF M;  3DOK A;  4CD1 A;  1A5W A;  3CCR N;  3I8D A;  3NF9 A;  4FWP A;  3A5M C;  3VGL A;  4DTM A;  1WSG A;  3THX B;  3KTQ A;  4Z4F A;  4OKE A;  3LWM A;  2V7Z A;  4KHW A;  1C1A A;  4LFB K;  4JHD A;  3SMP A;  4YHH K;  2HVH A;  4BRC A;  4ZHR A;  1HX1 A;  3AGR A;  2V7Y A;  1WAJ A;  2XRI A;  1NGE A;  5AQQ A;  3CCJ N;  1RBT A;  2YHY A;  3LL3 A;  2Q0U A;  3QEP A;  3VPZ A;  3CCM N;  5E41 A;  4FJ8 A;  4DS4 A;  2UYT A;  4J2E A;  2IIR A;  3KK3 A;  1EX4 A;  1Q18 A;  2D0A A;  4BRH A;  4CI6 A;  3MN7 A;  3I0S A;  2O8E B;  3VEV A;  3AO1 A;  3VEY A;  4C8K A;  4IOC L;  1XHX A;  5HP1 A;  1FW6 A;  1UAX A;  4C8M A;  3MXJ A;  3CQX A;  1YIT N;  4EZ6 A;  4N56 A;  4XEI A;  5TKY A;  2P9P A;  1RDW X;  4CZH A;  2GUP A;  1BI4 B;  2PZS A;  1DGK N;  4DFJ A;  4DSJ A;  4H4M A;  2O8B B;  1XQS C;  3CD6 N;  1NM1 A;  3R3L A;  3C6U A;  3BDP A;  3MK6 A;  2OCE A;  2QXF A;  4WQ5 C;  5CYQ A;  2YNF A;  5AZI B;  1BWF O;  1VQK N;  3M8S A;  1QHA A;  1K8K A;  4I6M A;  4FWL A;  4FZZ A;  4FWR A;  2P9S B;  3F9M A;  3HJF A;  3THV A;  2HHX A;  4XH4 A;  4B3M K;  2P9L A;  3VEO A;  4NO7 A;  3GBT A;  3RMD A;  4CBW A;  2XO7 A;  2Q0R A;  3SQ2 A;  1VQ9 N;  4HTL A;  1KAZ A;  4A61 A;  3SPZ A;  3D45 A;  1N6Q A;  3EEQ A;  3M1F A;  2QW9 A;  1EWR A;  4JKH A;  2UXD K;  3AVL A;  4U7B A;  3DLH A;  4DV0 K;  4CFB A;  1JLQ A;  4DV5 K;  1TK8 A;  3N4P A;  1HNZ K;  3OY9 A;  1JL2 A;  5BN9 A;  4RW7 A;  4QOZ B;  1OH7 A;  3OBW A;  4JI6 K;  4JK8 A;  3UKU B;  3NHG A;  5HOO A;  4CE9 A;  3HVR A;  2HOE A;  4IJN A;  2YHA A;  3V1R A;  4WQ4 A;  4KAZ A;  1WSJ A;  3AAP A;  1YVN A;  4O8K A;  2O8F A;  3DAW A;  1HRH A;  4PL7 A;  2F4V K;  1WUA A;  4LFC K;  1XNQ K;  4BWJ A;  1EKE A;  4KTW A;  3RR8 A;  4B3R K;  2D1K A;  3QB0 A;  2F8T A;  3CCL N;  5BRF A;  2W6L A;  3D2E B;  1TL3 A;  3CFO A;  4BC4 A;  4CJV A;  3W3D A;  4DUZ K;  1QSY A;  1X9W A;  3CER A;  3SAF A;  4LF7 K;  1RT2 A;  3ZT4 A;  2BTF A;  4LD0 A;  4X66 K;  1VQL N;  4KRF A;  3HTV A;  3DRS A;  4DTX A;  1VSI A;  2HST A;  3CF5 L;  3TAP A;  5GIN A;  3G0Z A;  1KLN A;  4FJJ A;  4FXD A;  3DXM B;  4EP5 A;  1XWL A;  4FM1 A;  3AVA A;  3FE1 A;  3IG1 A;  3DI6 A;  2A1R A;  3K5N A;  4B9T A;  4DF4 A;  1FJG K;  4EP4 A;  1L3T A;  3L3V A;  5AZJ B;  1C0T A;  4IWV A;  4OVL A;  3NVK A;  4M41 A;  5EVZ A;  1XNR K;  5BR9 A;  4DU3 A;  3GL1 A;  1YXQ A;  2QWO A;  2P1J A;  4MFB A;  4IFE A;  1WOQ A;  4BC3 A;  1GOB A;  3OYI A;  1IBL K;  3LDL A;  4B9U A;  3L2R A;  3SNN A;  4M3U A;  1N32 K;  4BC5 A;  4FLZ A;  3WXM B;  5E84 A;  4JLH A;  4BR5 A;  4UY8 O;  1JL1 A;  3ZYY X;  3CFP A;  2P5O A;  4FPB A;  4KV8 A;  1K8A O;  1HNV A;  4FJG A;  4Z4H A;  3EYZ A;  3HSC A;  4F3O A;  2X74 A;  2GUI A;  4KH6 A;  4BWM A;  5AFU H;  5I42 A;  5AQS A;  2QWR A;  3VOV A;  2HMP A;  3DLG A;  3G10 A;  4JI3 K;  3HM9 A;  4TSX A;  3T1H K;  3U3G A;  1XI1 A;  3N4Q A;  1DTT A;  1RCH A;  2OTJ N;  4OO1 J;  4W5T A;  3VN5 A;  3E01 A;  3NGI A;  1J5E K;  2XY5 A;  4RW4 A;  1NJY A;  3TU5 A;  4DFM A;  3AVF A;  3H45 C;  2EHG A;  4DU1 A;  3AGK A;  1L3V A;  2HHW A;  5BRH A;  2O8E A;  1UA0 A;  3BY5 A;  4HVJ A;  3VA0 A;  3CM5 A;  3EZW A;  4F3T A;  1RT4 A;  4IBN A;  3MMV A;  1BO5 O;  4BG9 A;  3H46 O;  3CPW M;  1LWC A;  1BI4 A;  2VG6 A;  3ZSY A;  2ZJP L;  4ELT A;  2O8B A;  2HHV A;  2YNI A;  3TTC A;  2ZJR L;  3P31 A;  2VGM A;  4GNI A;  3SYZ A;  1O13 A;  4YY3 K;  3C6A A;  3DYA A;  3THY B;  2YNH A;  3ZSR A;  1UOC A;  3ZX3 A;  3W0L A;  1I3A A;  1NGG A;  3VQA A;  3U3Y A;  1B92 A;  4A59 A;  4BE2 A;  2W41 A;  3Q7B A;  3LP2 A;  4E1J A;  4KH5 A;  4BDP A;  2RHK A;  4IXC A;  3P5J A;  4AM6 A;  3ENO A;  4DQI A;  3SV3 A;  5K14 A;  4WFB L;  3WQU A;  1TYQ B;  5HRP A;  4KKO A;  2Z1H A;  5AQM A;  4BRN A;  4B1W B;  5GIO A;  4DR1 K;  2Z1J A;  3QES A;  4CD3 A;  5JIC A;  3AY9 A;  4K43 A;  2E6L A;  4A5B A;  4FL9 A;  4AHS A;  3AVI A;  2D0O A;  4JKF A;  3THW A;  3O4Q A;  4IEI A;  1KAX A;  1HPZ A;  3TAR A;  3E1Y A;  3OYB A;  4BE0 A;  2P9U A;  3PO5 A;  3UKU A;  1KLM A;  2R7Y A;  4BRD A;  1I94 K;  1OVY A;  2E2P A;  4OPH A;  5C10 A;  4CEO A;  2P51 A;  1TV6 A;  1W7A A;  4CCH A;  1NGF A;  3NFA A;  4RG8 A;  3NF7 A;  2Q1N A;  1JLC A;  3QER A;  4CEE A;  4Y1D A;  3VF2 A;  1ASV A;  1BGX T;  5EXW A;  1XMQ K;  4CJE A;  4LSN A;  4FLU A;  5KI6 A;  2DFH A;  3SQ1 A;  3D2E A;  1D5A A;  1X9M A;  2RPI A;  2PY5 A;  2CGJ A;  5C12 A;  4FJH A;  5KQ8 A;  1NGD A;  2O8C A;  1RDC A;  2JLE A;  3ASM A;  5M1N A;  1YT3 A;  4BR4 A;  1XMO K;  2Q36 A;  2I7N A;  2HHQ A;  1NGA A;  1QS4 A;  3QDK A;  1IO2 A;  2XY6 A;  4H5N A;  3HT3 A;  1NJZ A;  2DFE A;  3O3H A;  4B3O A;  2NLX A;  3DXM A;  3I56 N;  3K5M A;  5JLF A;  3ZET B;  1VAZ A;  1QSL A;  1YTA A;  2KLA A;  1T3V A;  4DU4 A;  4C23 A;  3ZSQ A;  2HF3 A;  3KKS A;  4FWS A;  3QEX A;  4FCY A;  4B3S K;  1GLE G;  3WUH A;  3MX2 A;  5ADX H;  4IFV A;  1SS6 A;  4O0I A;  1KTQ A;  5JS2 A;  1XUP O;  4DB3 A;  5KRS A;  1VQM N;  2HB5 A;  1W9H A;  3E66 A;  1NJI O;  3HRG A;  3QFP A;  3OYG A;  4YOW A;  4DTS A;  4H0X B;  3ENB A;  4FO0 A;  3BZC A;  2CH5 A;  1LCU A;  5JMV A;  3NAE A;  5GAH P;  5MLC Q;  4BDY A;  4EHT A;  3HO1 A;  1WN7 A;  3OYM A;  3KLH A;  4KHS A;  1U2V B;  4PKH A;  3M3Z A;  5CYM A;  3OYN A;  2GWJ A;  1T44 A;  2QKK A;  1FKP A;  4DR3 K;  1P8Z A;  5M1K A;  2WC9 A;  3OS0 A;  3K58 A;  3DXK B;  3WNG A;  2OPS A;  3VQ4 A;  4E0D A;  3CJ1 A;  1XC3 A;  4DSF A;  2D0P A;  3KD5 E;  4I9Q A;  4O0J A;  4M3T A;  2O4I A;  2PFU A;  2NRR A;  2P9P B;  5AJ3 K;  4CGJ A;  1TK0 A;  4ILG B;  3I55 N;  4FK0 A;  3SK3 A;  5LL6 Z;  3F2K A;  5BRD A;  1VRT A;  3H08 A;  4BVP A;  4YFU A;  3RTV A;  2VQF K;  4YDU A;  4CGI A;  5BN8 A;  1VK0 A;  3O9R A;  3SCX A;  3NH1 A;  1V4T A;  3GE1 A;  4AQY K;  5AR0 A;  3EN9 A;  3BP8 A;  3OYH A;  4CW7 B;  3LAN A;  1VSE A;  5JVG L;  1Q9X A;  3NH0 A;  1KXP A;  1IKV A;  1FXX A;  4IO9 L;  3MDQ A;  5E26 A;  4JRP A;  4GV9 A;  2P9L B;  4CZL A;  1S1X A;  4JD2 B;  1R59 O;  4CVN E;  4CJP A;  3OJU A;  3SUP A;  4BR2 A;  3QIP A;  2PYL A;  1QHT A;  2D5R A;  4H0V B;  1TYQ A;  1LOT B;  4CHN A;  2KW4 A;  2ZGZ A;  4XH5 A;  3KLG A;  1BG3 A;  3LM2 A;  4JK7 A;  5J2P A;  4LF8 K;  2YKN A;  3IRX A;  1T03 A;  3DLL L;  4I2Q A;  1Z26 A;  4ID1 A;  3HPG A;  3DWL A;  3NF8 A;  3ISN C;  3LDS A;  2HNZ A;  3MXM A;  2ZQB A;  3OBY A;  3OYC A;  4FOI A;  3T19 A;  4DR7 K;  3CHW A;  5C24 A;  4NLC A;  3ULE A;  3G4S N;  4IO8 A;  2O8F B;  1YHQ N;  4AIL C;  4BR9 A;  2QWL A;  3PSF A;  1Q7Y O;  2B4J A;  1ZBL A;  4DTN A;  4XH1 A;  1OH8 A;  1NK8 A;  4JI7 K;  1JCE A;  1KAY A;  3GG4 A;  4CJ7 A;  1YIJ N;  3VQD A;  4PUO A;  4AM7 A;  4KHN A;  3RR7 A;  3C6T A;  4LH4 A;  5CY4 A;  3H1Q A;  2QXL A;  3LDN A;  1U6Z A;  5LMN K;  1BOT O;  3K57 A;  3QEW A;  4KI6 A;  2FF3 B;  1NBW A;  4DQQ A;  2VWB A;  1YI2 N;  2ASP A;  2OYQ A;  3F5T A;  4FWK A;  3O8M A;  4EZ9 A;  1T05 A;  1EO1 A;  1C0F A;  4H5R A;  3KVG A;  3PX0 A;  3EKS A;  4MO5 A;  5AQR A;  2GV9 A;  4KH4 A;  3NGZ A;  4DS5 A;  3L6Q A;  4XIU A;  4Z0U A;  4U67 L;  3WT0 A;  1SKS A;  2F8S A;  3VA3 A;  3LP3 A;  1Y97 A;  4JK9 A;  1NWK A;  3HYF A;  1Q8I A;  4C8L A;  5D3G A;  3ZET A;  5M1F A;  3DJC A;  3V9Z A;  4M45 A;  4CGH A;  3WXJ A;  3VQC A;  1KCF A;  1RT3 A;  2JWL A;  1MDU B;  1ATR A;  3OHR A;  2UUC K;  1REV A;  4QS8 A;  4A2A A;  1U47 A;  3OA9 A;  1P90 A;  3H3O B;  2WBN A;  5FLX O;  5AFU A;  4Y0W A;  3L4I A;  3D2F A;  3V6D A;  5AQK A;  2A1S A;  2I5J A;  3SI6 A;  3IFR A;  4F8R A;  3TAM A;  5CZ2 A;  3ZT0 A;  1LWF A;  1WNS A;  1U45 A;  1HKB A;  2V51 B;  4Z4C A;  1XHZ A;  1R0A A;  3LPU A;  3LAM A;  4B08 A;  2A42 A;  3G6E N;  3K2P A;  1VSH A;  4KHY A;  1U2V A;  1WSH A;  1JCG A;  1RBV A;  2E6M A;  3RRG A;  5JVH L;  1BUP A;  3RMA A;  2EX3 A;  2NRV A;  1QZ6 A;  3VQB A;  4M42 A;  3AA4 A;  3VEW A;  3WNF A;  3TAQ A;  5LY3 A;  4E19 A;  4X62 K;  3K9K A;  4CER A;  3LP1 A;  4O5B A;  3DXK A;  1RT6 A;  5LJV A;  1QTM A;  4QS9 A;  4NXN K;  1YUW A;  4F9O A;  1KVA A;  2A6A A;  4WCE L;  1JXB A;  2E4L A;  1HNW K;  4FZX C;  3HOT A;  2AA4 A;  3CC4 N;  1JLA A;  4DSI A;  4CF8 A;  3QNO A;  1RTH A;  4H03 B;  4ZTF A;  1RT5 A;  3L3U A;  3WXI A;  5I9E B;  4RWT A;  3T7Z A;  5I3U A;  5J2N A;  1ESV A;  1HR0 K;  3VQ8 A;  2ZJQ L;  2VWK A;  1JLF A;  4JI8 K;  3FZL A;  2GEM A;  1YJW N;  4JI4 K;  4F2R A;  2IAJ A;  3RMB A;  4IKF A;  3TSQ A;  1IBM K;  1HJO A;  2E2O A;  1S22 A;  3VQ6 A;  4V19 S;  4FM0 A;  2LSN A;  3T3F A;  3PV8 A;  1U4B A;  3PX4 A;  1DLO A;  2VWJ A;  1S6P A;  1HKC A;  1CLQ A;  1N33 K;  1S1T A;  3HP9 A;  3O6W A;  4O5F A;  1QQC A;  4CJ3 A;  5IWA K;  3OVN A;  3WXK A;  4UQG A;  3CM6 A;  4DSK A;  4JD2 A;  4RTF D;  4CHY A;  3KKR A;  4B9S A;  3V9U A;  5DMR A;  4CEF A;  3CCE N;  1NU0 A;  4CJS A;  3CQ8 A;  3MEE A;  1NK7 A;  5BPN A;  3PIO L;  2P9K B;  3OYJ A;  1BA1 A;  1SQK A;  1VSJ A;  3HM8 A;  2OZS A;  3THW B;  4CEB A;  3B8A X;  1X9S A;  3PUF A;  1ZBI A;  2OPQ A;  2P9U B;  4B9N A;  3O4W A;  3K0S A;  4LF5 K;  1IV0 A;  5AQV A;  3AA2 A;  4Q0B A;  1Q9Y A;  2D4W A;  4MDB A;  4Z94 A;  2I7P A;  3OS2 A;  4IFY A;  3O4N A;  1HYZ A;  2YHW A;  3H6E A;  3H1V X;  4BE1 A;  1E4F T;  4AH9 A;  4CIE A;  2KTQ A;  1BQM A;  3CJA A;  1YJN N;  5C2F A;  5C0Y A;  2IDO A;  5HLF A;  4FWN A;  4YOY A;  2NRH A;  1HNI A;  4H0Y B;  3FGU A;  3VQQ A;  1ZXO A;  2DPN A;  2O8C B;  3LAL A;  4DLG A;  3J81 O;  3SPY A;  4K25 A;  3FZM A;  4WYB A;  1D9F A;  4N5S A;  1JLG A;  5IT9 O;  4HUG A;  4IG3 A;  1QQO A;  3V9S A;  1C0U A;  4EHU A;  3C0B A;  2QK9 A;  2HBM A;  3G71 N;  3LZI A;  4CZG A;  3MXI A;  3CC2 N;  3QBX A;  3CCV N;  3HBT A;  4KRE A;  2YKM A;  5ADX A;  4CEC A;  1HKG A;  3BEX A;  4JEP A;  5AQZ A;  4FLV A;  3O1B A;  3AO4 A;  4OPK A;  4FYD A;  3AO5 A;  4LSL A;  2P9N B;  2WFB A;  4A57 A;  4GKJ K;  5LJW A;  3ZCM A;  3VF6 A;  3IDH A;  1RBR A;  2UUA K;  4J8F A;  4CZE A;  3ITH A;  4BRQ A;  5HRR A;  4CIF A;  1X3M A;  2FXU A;  5EOY A;  3RRH A;  4WQ4 C;  4MLH A;  2NNW A;  4B9M A;  1RT1 A;  4WFA L;  1WB9 A;  4CJU A;  1TKD A;  1EWQ A;  1KVB A;  3NCI A;  4AHC A;  4DQ8 A;  4K8Z A;  2QM1 A;  2QA4 N;  2D0B A;  1RDD A;  4CZF A;  4CBU A;  2VQE K;  3EKU A;  3O5B A;  3OS1 A;  4H0O A;  4DR6 K;  2D0C A;  1J54 A;  3LAK A;  1IG9 A;  3KD1 E;  1GLJ O;  4RW6 A;  2G8V A;  1VSF A;  2X78 A;  4DV3 K;  3CI5 A;  1G99 A;  4K41 A;  1VQN N;  3MWP A;  3U9Z A;  4E3S A;  2BE2 A;  1S72 N;  1IH7 A;  3KK2 A;  5F2R A;  3TSU A;  4E7I A;  4K8X A;  3HST B;  1S1W A;  3DOL A;  1T6C A;  5CE3 A;  4E7J A;  1J6Z A;  1TKZ A;  3VF4 A;  3NGY A;  4M63 C;  1GLC G;  2ZF5 O;  4QS7 A;  3CME N;  3SAG A;  4Z4I A;  4W5N A;  1QVG M;  2FBT A;  1C0G A;  4ELU A;  5CZ1 A;  4FJX A;  3VTH A;  4G9Z A;  3ZSZ A;  4GY2 B;  1BQN A;  4PWD A;  4GVE A;  4ISG A;  5A2Q O;  2DY4 A;  4H8K A;  5AQU A;  5AQI A;  2UU9 K;  2HHT A;  1LW0 A;  1BCM A;  4FW2 A;  5KGX A;  2ZM6 K;  3SJJ A;  1E4G T;  3NVM A;  3DRR A;  3U4L A;  2P9K A;  4H4O A;  5F0X A;  3CJB A;  3NF6 A;  3IKM A;  4CK3 A;  3KHY A;  1QSS A;  3O3F A;  3TAB A;  1MU2 A;  3HVT A;  2HNY A;  3ULE B;  4CZM A;  2IS3 A;  4JYA K;  5DM7 L;  3QIO A;  2OZM A;  4GKK K;  1WSI A;  2QWP A;  4YOV A;  3AA5 X;  3PY8 A;  3OYD A;  5AQF A;  2YCH A;  4NB4 A;  2BDP A;  1Y64 A;  1OH5 A;  3R6M A;  2HHS A;  3AVJ A;  1F21 A;  3EZ5 A;  4B1U B;  4CJR A;  4L8R B;  4RW9 A;  1SKW A;  2GWK A;  3VER A;  4BRF A;  3PO4 A;  1IG8 A;  1NG9 A;  4KO0 A;  3PLA A;  3J7A P;  3ZSO A;  4X64 K;  3C65 A;  1S1U A;  3OYA A;  5DM6 L;  5HBM A;  4N41 A;  3CIP A;  1NK5 A;  2ASM A;  4AF1 A;  4MDA A;  1HQE A;  4C1N K;  2YHX A;  3F73 A;  4NYN A;  1TUY A;  4DTU A;  4DV1 K;  2G8U A;  1B9F A;  3OYL A;  4BRP A;  4CZK A;  1NKB A;  3SQ4 A;  4HCC A;  3SBT A;  3J7Y P;  2IVP A;  2G8W A;  4IDK A;  1OH6 A;  1NNE A;  3ZX0 A;  3VET A;  1HJR A;  2W40 A;  3Q7C A;  2NRZ A;  1HPM A;  4O4G A;  1SL1 A;  3CFR A;  1T7P A;  4J2D A;  1UA1 A;  5C42 A;  4DUY K;  3MN9 A;  4DSE A;  2P9N A;  1GLF O;  3HL8 A;  4OX9 K;  3QEV A;  1KVC A;  2IOC A;  4FVU A;  4MLE A;  1SL0 A;  1CZA N;  2PAV A;  1NJW A;  1NGJ A;  5B8H A;  3D2F B;  5CHI A;  1O1W A;  2F96 A;  2IVO A;  4ICL A;  3NMU A;  1SAZ A;  1VQ7 N;  3VES A;  3BUZ B;  3CET A;  3P4I A;  4E1N A;  1VQ4 N;  1ZBF A;  2HBL A;  4QCL A;  1KC8 O;  4B9Q A;  1KFD A;  1J53 A;  5M1Q A;  3S3M A;  4QAG A;  1TKX A;  4JRQ A;  1TK5 A;  3NDK A;  3ATV A;  2Q31 A;  4EIA A;  4BY9 C;  4CJF A;  4I9L A;  1J9A A;  2KFZ A;  2AP1 A;  1ZYQ A; 
#chains in the Genus database with same CATH homology
 2HOE A;  4IJN A;  1Z6R A;  3C7N A;  3WEE B;  4WQ4 A;  4BRM A;  3ZET A;  3OW2 M;  3AAP A;  1YVN A;  4O8K A;  4IZ9 A;  5JLH A;  3DAW A;  4KBO A;  5AZI A;  5M1F A;  3DJC A;  3VGK A;  4DKW A;  4PL7 A;  3WXJ A;  1M1K O;  4BRO A;  1WUA A;  2E88 A;  2JWL A;  5FPM A;  1MDU B;  3A8Y A;  2HBK A;  1BU6 O;  4CBX A;  3LM9 A;  1ATR A;  3OHR A;  4BRK A;  1BDG A;  2D1K A;  3TTF A;  2PBD A;  3QB0 A;  5GAG P;  4A5A A;  1KQS M;  3J8A A;  4QS8 A;  4BRI A;  4A2A A;  2V52 B;  3CCL N;  3ID8 A;  5BRF A;  2P9S A;  3OA9 A;  3MWT A;  1P90 A;  3D2E B;  3H3O B;  3O9S A;  4BC4 A;  2WBN A;  3FR0 A;  3PIP L;  3W3D A;  1ATN A;  5AFU A;  4Y0W A;  3L4I A;  2E2Q A;  3D2F A;  3QBW A;  5AQK A;  4H5T A;  2YX6 A;  3E9O A;  4JKE A;  3CER A;  4GV6 A;  3SAF A;  3FZH A;  4BRE A;  1YAG A;  3H3N O;  3IFR A;  5TKW A;  2BTF A;  1VQL N;  2YJF A;  5FPE A;  3HTV A;  1HKB A;  2HST A;  2V51 B;  3J7Z O;  3CF5 L;  4JAX A;  3ENH A;  3JXU A;  2EWS A;  4JN4 A;  2A42 A;  5GIN A;  3G6E N;  4A62 A;  3DXM B;  1U2V A;  3LDQ A;  1JCG A;  3FE1 A;  1W97 L;  3E9L A;  3R8E A;  1OKJ A;  5JVH L;  1BUP A;  3MCP A;  2NRV A;  1YJ9 N;  3R9P A;  3D7E O;  3CCU N;  1QZ6 A;  3FLC O;  4H5V A;  1JJ2 M;  5AZJ B;  4IWV A;  3VEW A;  4BRG A;  4H5W A;  5LY3 A;  3NVK A;  3K9K A;  5FPD A;  5EVZ A;  4H0P A;  3KWG A;  5BR9 A;  3GL1 A;  1YXQ A;  2QWO A;  3DXK A;  2A40 A;  4IEE A;  4ISE A;  4IFE A;  4JKG B;  5LJV A;  1WOQ A;  3HI0 A;  4PKI A;  4BC3 A;  4QS9 A;  3LDL A;  5AQL A;  3TPQ A;  1YUW A;  5AQG A;  4F9O A;  4BC5 A;  3WXM B;  4ILJ A;  5E84 A;  1TUU A;  2A6A A;  3KWI A;  4WCE L;  4BR5 A;  4UY8 O;  3EE9 A;  3HOT A;  2AA4 A;  3CC4 N;  3O08 A;  3ZYY X;  4FPA A;  4FPB A;  4BVO A;  4H03 B;  1DT9 A;  1K8A O;  3CJC A;  3WXI A;  3HSC A;  4MO4 A;  5I9E B;  4RWT A;  3T7Z A;  3GDQ A;  1ESV A;  2A3Z A;  2ZJQ L;  1ATS A;  2NZT A;  4KH6 A;  3FZL A;  2GEM A;  1YJW N;  4YOX A;  3SAH A;  5AFU H;  3TSQ A;  1HJO A;  5AQS A;  2E2O A;  2QWR A;  3VOV A;  2HMP A;  1S22 A;  5GAE P;  4R79 A;  3A5L C;  1S3X A;  3N4Q A;  2YJE A;  1SZ2 A;  2OTJ N;  3S41 A;  3SJH A;  5ELZ A;  2HBJ A;  3HOS A;  1HKC A;  4OO1 J;  3O1W A;  4FWQ A;  3VEX A;  2GTD A;  3O6W A;  3L0Q A;  4O5F A;  3ZEU A;  3WXK A;  4BQL A;  3CXC M;  4JD2 A;  4RTF D;  4PL8 A;  5KPZ A;  3TU5 A;  5AZJ A;  3H45 C;  4M7Y A;  3KZB A;  4YDU C;  2QEX N;  3CCE N;  3AGK A;  5BRH A;  4HWI A;  4JKD A;  1X9J A;  5BRE A;  4JKA A;  4H0T B;  1GLD G;  2VGN A;  3EZW A;  4L3Q A;  5BPN A;  3PIO L;  2P9K B;  4PHT X;  1BA1 A;  1SQK A;  3HM8 A;  3MMV A;  2FSJ A;  1BO5 O;  5AQT A;  4BG9 A;  5BPL A;  3CCS N;  3B8A X;  3H46 O;  4WF9 L;  3MX5 A;  3CPW M;  2QTD A;  4BR7 A;  2P9U B;  2BUP A;  3EE8 A;  3O4W A;  4JNE A;  1K73 O;  5AQV A;  3L4Q A;  3CPE A;  3QFU A;  3WQT A;  4JHD B;  2ZJP L;  2D4W A;  4MDB A;  5KPT A;  1MWM A;  4B1Y B;  4IDH A;  3TTC A;  2ZJR L;  3O80 A;  4Z94 A;  3P31 A;  2I7P A;  2VGM A;  3M6G A;  4GNI A;  5AQY A;  3CJ9 A;  1O13 A;  2YHW A;  3H6E A;  3C6A A;  3H1V X;  2E8A A;  1E4F T;  3ZX3 A;  2ZGY A;  4EAH D;  1T6D A;  4BC2 A;  3CJA A;  3W0L A;  1NGG A;  1YJN N;  5C2F A;  5C0Y A;  4FSV A;  2KKZ A;  1VQ6 N;  4A59 A;  5H1S Q;  4FWN A;  4YOY A;  2W41 A;  4O8U A;  4BRL A;  3Q7B A;  4CZJ A;  1VQP N;  2NRH A;  2A41 A;  1Q86 O;  4H0Y B;  4E1J A;  4KH5 A;  3FGU A;  2RHK A;  4IXC A;  1ZXO A;  2DPN A;  4AM6 A;  3ENO A;  2ASO A;  1RFQ A;  4WFB L;  4PKG A;  3WXL A;  3VTI A;  4FWM A;  1TYQ B;  4K25 A;  3WQU A;  3FZM A;  5AQW A;  5AQM A;  4BRN A;  5GIO A;  2FSN A;  4WYB A;  4B1W B;  4FWO A;  3JS6 A;  4CD3 A;  1VQO N;  5JIC A;  3AY9 A;  4K43 A;  4A5B A;  3A5O C;  4FL9 A;  1Q81 O;  4FOE A;  3UB5 A;  1ZBS A;  1QQO A;  2D0O A;  4JKF A;  1QQN A;  3C0B A;  4EHU A;  4IEI A;  1KAX A;  2HBM A;  2QWM A;  4M7X A;  3IUC A;  4DCH A;  3G71 N;  3ID6 A;  4CZG A;  1ZC6 A;  5GIP A;  3CC2 N;  3RSE B;  1RGI A;  3E1Y A;  3QBX A;  3CCV N;  3HBT A;  2P9U A;  3UKU A;  5ADX A;  1HKG A;  3E9P A;  3BEX A;  4JKC A;  4JEP A;  5AQZ A;  2F9W A;  3O1B A;  1YF5 L;  3EL2 A;  2QI2 A;  4YOT A;  3WEE A;  4BRD A;  1OVY A;  2E2P A;  5AQN A;  1K8K B;  2F7T A;  4I6M B;  4OPH A;  5C10 A;  1ILY A;  3I33 A;  2NRX A;  2P9N B;  1NGF A;  1H1V A;  2WFB A;  4RCH A;  1HLU A;  2Q1N A;  1NGB A;  2FLO A;  3VF2 A;  4A57 A;  4JKB A;  5LJW A;  5EXW A;  3VF6 A;  3IMX A;  2E1Y A;  3VEN A;  3IDH A;  2FF6 A;  3D6R A;  3LDP A;  3CMA N;  4BGB A;  4GV3 A;  3D2E A;  5AQX A;  5HL7 L;  3VGM A;  4J8F A;  4CZE A;  2QWN A;  2CGJ A;  4YOU A;  5C12 A;  3U8X A;  2A5X A;  3ZX2 A;  4BRQ A;  1NMD A;  5KQ8 A;  1NGD A;  2IVN A;  3TTD A;  1K9M O;  2CGL A;  3O9U A;  1X3M A;  2FXU A;  5FPN A;  3C6H A;  5EOY A;  5M1N A;  4WQ4 C;  4MLH A;  2NNW A;  4BR4 A;  4DHY A;  1VQ5 N;  4BR0 A;  1EQY A;  4WFA L;  2Q36 A;  2I7N A;  3UKR B;  1NGA A;  3QDK A;  3KK7 A;  1DEJ A;  1MA9 B;  2F9T A;  4H5N A;  2CH6 A;  3MCA B;  2P9I B;  5CR4 A;  3A5N C;  2NLX A;  5HOO A;  3DXM A;  3I56 N;  5AQO A;  4DQ8 A;  2E1Z A;  2QM1 A;  5JLF A;  2QA4 N;  3ZET B;  5KPR A;  1VAZ A;  4CZF A;  4CBU A;  2KLA A;  1T3V A;  4C23 A;  3CJ7 A;  3EKU A;  1QZ5 A;  2KHO A;  3P39 A;  3O5B A;  2HF3 A;  4H0O A;  2GX9 A;  2ZWH A;  3G25 A;  4FWS A;  1NWK A;  4B1Z A;  2JWK A;  2NRT A;  4WFN L;  1GLE G;  4JKG A;  1GLL O;  3MX2 A;  3RVC A;  3WUH A;  5ADX H;  1GLJ O;  3MN5 A;  1SS6 A;  1XUP O;  2OAN A;  4DB3 A;  1VQM N;  4LC9 B;  5EY4 A;  3CI5 A;  3E66 A;  1V4S A;  1NJI O;  1G99 A;  3MN6 A;  4K41 A;  3HRG A;  3QFP A;  4YOR A;  3SLC A;  1NGC A;  3MWP A;  3U9Z A;  3FZF A;  5EX5 A;  3UE5 A;  5KQD A;  4YOW A;  3O9T A;  1S72 N;  1W2B M;  4H0X B;  3ENB A;  4FO0 A;  3SBG A;  5F2R A;  3TSU A;  3BF3 A;  4BRA A;  2CH5 A;  3M5R A;  3O9Q A;  5GAD P;  1T6C A;  1LCU A;  2VCP A;  4CZI A;  5CE3 A;  2BH1 A;  1J6Z A;  3VF4 A;  5JMV A;  5GAH P;  5MLC Q;  3AAR A;  4EHT A;  3K9J A;  4M63 C;  1GLA G;  1GLC G;  2CGK A;  2ZF5 O;  4QS7 A;  3CME N;  3SAG A;  4NLB A;  1QVG M;  1C0G A;  2Q97 A;  4ILH A;  3I8B A;  3VTH A;  2Q2R A;  4BG8 A;  1U2V B;  4PKH A;  4G9Z A;  3FFK B;  3M3Z A;  3R1X A;  4B1X B;  2P9I A;  4GY2 B;  2YI1 A;  2H3G X;  2GWJ A;  1T44 A;  4WQ5 A;  1P8Z A;  4GVE A;  5M1K A;  2WC9 A;  1D4X A;  4ISG A;  4B1V A;  4EFH A;  5C2D A;  5AQU A;  2HF4 A;  3DXK B;  5AQI A;  1QVF M;  2VYP A;  3CJ1 A;  1XC3 A;  2D0P A;  4CD1 A;  3CC7 N;  3CCR N;  2PFU A;  3SMS A;  1KD1 O;  1E4G T;  4FWP A;  2NRR A;  2P9P B;  3A5M C;  3NVM A;  3VGL A;  1MWK A;  3U4L A;  2P9K A;  4ILG B;  3I55 N;  3AAQ A;  3SK3 A;  3LDO A;  3F2K A;  5F0X A;  5BRD A;  3CJB A;  3IKM A;  3KHY A;  4BVP A;  3FZK A;  4CZM A;  4YDU A;  3ULE B;  2V7Z A;  5DM7 L;  5BN8 A;  3O9R A;  4JHD A;  3SMP A;  2NRW A;  4BRC A;  2QWP A;  1HX1 A;  3VEZ A;  3AGR A;  1V4T A;  3GE1 A;  2V7Y A;  4YOV A;  1NGE A;  5AR0 A;  5AQQ A;  3EN9 A;  3BP8 A;  3GOI A;  3CCJ N;  2YHY A;  3LL3 A;  2Q0U A;  2YCH A;  5AQF A;  4IOA L;  2J4R A;  3BF1 A;  1NGH A;  4NB4 A;  5JVG L;  3QIC A;  1KXP A;  1Y64 A;  3VPZ A;  3CCM N;  1M90 O;  1QQM A;  3R6M A;  1JCF A;  2GEL A;  4IO9 L;  3MDQ A;  5E26 A;  1GLB G;  3HZ6 A;  4GV9 A;  4B1U B;  2P9L B;  2UYT A;  2E2N A;  3VMF B;  2IIR A;  5C15 A;  2GWK A;  3ZEU B;  3VER A;  4BRF A;  4CZL A;  4JD2 B;  1Q18 A;  1R59 O;  5F1X A;  2QWQ A;  4BR2 A;  1IG8 A;  3PLA A;  2OTL N;  4BRH A;  3CCQ N;  4CI6 A;  3MN7 A;  3C65 A;  5DM6 L;  4BGA A;  3CIP A;  1BA0 A;  3VEV A;  5AQH A;  3VEY A;  4H0V B;  1TYQ A;  1LOT B;  2ASM A;  4AF1 A;  4IOC L;  5AQP A;  2ZGZ A;  2RE2 A;  4MDA A;  4XH5 A;  4C1N K;  2YHX A;  1BG3 A;  3LM2 A;  4JK7 A;  1Q82 O;  1Z05 A;  3CQX A;  1NGI A;  1YIT N;  4XEI A;  5TKY A;  1TUY A;  3A0I X;  2FSK A;  2P9P A;  1RDW X;  4CZH A;  3DLL L;  2GUP A;  3DWL A;  4BRP A;  1DGK N;  4IOX A;  1IJJ A;  3OBY A;  4FOI A;  4CZK A;  1XQS C;  1RDU A;  3CD6 N;  3SBT A;  1NM1 A;  3R3L A;  2IVP A;  3C7N B;  3CHW A;  3RSE A;  4NLC A;  3ULE A;  3G4S N;  3MK6 A;  4IO8 A;  3ZX0 A;  4WQ5 C;  3VET A;  1YHQ N;  2W40 A;  3Q7C A;  5AZI B;  5M1O A;  1BWF O;  2NRZ A;  1VQK N;  1X3N A;  2WUS A;  1HPM A;  4BR9 A;  2QWL A;  3T69 A;  1QHA A;  1Q7Y O;  4OPA A;  2E20 A;  4XH1 A;  1K8K A;  3MN9 A;  4I6M A;  4IJA A;  4FWL A;  3QML A;  1JCE A;  1KAY A;  3TSP A;  1HUX A;  3GG4 A;  3U9D A;  4CJ7 A;  2P9N A;  1YIJ N;  1GLF O;  4AM7 A;  5BPM A;  3H1Q A;  1NLV A;  4FWR A;  1DKG D;  2P9S B;  2QXL A;  3EO3 A;  3F9M A;  1VQN N;  4FVU A;  4MLE A;  3LDN A;  1CZA N;  1U6Z A;  2PAV A;  4XH4 A;  2ITM A;  2P9L A;  1BOT O;  3VEO A;  4NO7 A;  3GBT A;  1NGJ A;  5AQJ A;  3D2F B;  5B8H A;  1N8R O;  3CQY A;  2FF3 B;  4CBW A;  2Q0R A;  5CHI A;  1VQ9 N;  1NBW A;  4HTL A;  1KAZ A;  4A61 A;  2IVO A;  3NMU A;  1SAZ A;  2VWB A;  1YI2 N;  1VQ8 N;  1VQ7 N;  3VES A;  3BUZ B;  3ATU A;  2ASP A;  2QW9 A;  3CET A;  3M1F A;  3P4I A;  1VQ4 N;  2HBL A;  4JKH A;  4A2B A;  3F5T A;  4FWK A;  1KC8 O;  4JK9 A;  3O8M A;  4B9Q A;  1EO1 A;  1C0F A;  4BQZ A;  4H5R A;  4U7B A;  3KVG A;  3EKS A;  4ISF A;  4MO5 A;  5AQR A;  5M1Q A;  3P38 A;  3UKR A;  4K42 A;  3N4P A;  4C1N I;  4KH4 A;  5BN9 A;  3L6Q A;  4U67 L;  5M1P A;  3ATV A;  2Q31 A;  3OBW A;  3WT0 A;  4EIA A;  4BY9 C;  4JK8 A;  3UKU B;  2AP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...