3SLCA

Crystal structure of apo form of acetate kinase (acka) from salmonella typhimurium
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
401
structure length
401
Chain Sequence
b'HMSSKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVMGTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTEVTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetate kinase
publication title Structural and mechanistic investigations on Salmonella typhimurium acetate kinase (AckA): identification of a putative ligand binding pocket at the dimeric interface
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
total genus 128
structure length 401
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3slcA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3slcA02
1KXPA 3ULEB 1GLLO 3VEWA 4C23A 2IVPA 2QM1A 5BPNA 1GLJO 1EQYA 4Z94A 5EY4A 4BR5A 2J4RA 3C0BA 4JD2A 2P9IA 5B8HA 1YUWA 3D2EB 1JCGA 2E2QA 1TYQA 2D1KA 4BC5A 2PAVA 4O8KA 4RTFD 2D4WA 2QWNA 4FWLA 3GL1A 3ZX3A 5AZJA 2FSJA 5AQZA 1QZ6A 2A3ZA 3H3NO 4EHTA 2FSKA 4HTLA 2Q2RA 3FZHA 3H45C 5FPMA 1ATNA 3GG4A 1TUUA 2YCHA 2Q1NA 4BC2A 4CZMA 1Q18A 1ESVA 3JS6A 1ZC6A 3VEYA 3QFPA 3R9PA 1DGKN 3SMSA 4RWTA 3FR0A 2P9LB 1S22A 4WQ4A 3GBTA 4H0XB 5F1XA 3R8EA 1BUPA 4IWVA 4CBXA 2P9PB 3ULEA 1BO5O 1KAXA 3G25A 3M3ZA 4BRIA 3ZETA 1T6DA 4BRLA 4BQZA 3LM2A 3O08A 3A5MC 2IVOA 3SK3A 1T6CA 3O6WA 1HKCA 4QS9A 2CH6A 3AY9A 1IJJA 4HWIA 1V4SA 3BF1A 2PBDA 2GEMA 2FSNA 5KQ8A 4IJAA 4H5RA 4BRFA 2QW9A 3VEXA 3O4WA 1BDGA 3VF4A 3AAQA 4CZGA 2I7PA 4A2BA 3FE1A 5E26A 2ASOA 1NGAA 3HI0A 3W3DA 5BRFA 1R59O 3O5BA 3J8AA 4AM6A 5AQJA 3BF3A 3CI5A 4B1UB 3UB5A 4Y0WA 5AQUA 3BP8A 3VEOA 2P9LA 2HMPA 5AQMA 3KZBA 5AQXA 3MDQA 1LOTB 4NB4A 3S41A 4A2AA 4BC3A 1D4XA 1MDUB 3OHRA 4H03B 1NGCA 1TYQB 1BA0A 1TUYA 3VENA 1S3XA 4XH4A 3ENOA 3BEXA 5FPEA 4BRPA 3AAPA 1GLEG 1QQOA 5AQOA 5EX5A 2DPNA 5BR9A 2QWLA 5ADXA 2E88A 4FPAA 4BQLA 4EHUA 1ZBSA 5EVZA 4WYBA 3FLCO 2A6AA 3M6GA 4BRQA 4BRAA 1NGDA 4ISGA 5AQQA 3HZ6A 3F9MA 4EAHD 1U6ZA 4H5WA 3A5NC 2E8AA 2QWPA 4FOIA 3MCPA 3QDKA 3EZWA 4MO5A 4FWQA 2FXUA 2YHYA 1NGFA 3HTVA 3JXUA 3MN9A 4A62A 4BGBA 5BPMA 2ZGZA 2W41A 5AQTA 1GLDG 1X9JA 2BTFA 3ZETB 2A41A 2BUPA 3IMXA 2V7YA 2FF6A 3CJ9A 3EN9A 3H1QA 4IXCA 2EWSA 5AQKA 1Z05A 2ZGYA 3RSEB 3A8YA 4JAXA 1MWMA 2V51B 2D0PA 4I6MA 4EFHA 2NZTA 4BR7A 3WXKA 3UKRB 3I33A 2QWQA 3IDHA 3VPZA 4JNEA 1Z6RA 1KAYA 1RFQA 5LJWA 2GWJA 3LDOA 2A40A 4CBWA 4PKHA 4JN4A 5AQSA 5BN8A 1XQSC 2QXLA 1MWKA 2HOEA 4M63C 4E1JA 4K43A 5JMVA 1GLFO 3CHWA 3L6QA 4WQ4C 5TKYA 4BRHA 1ATSA 3SJHA 5F0XA 3H6EA 3QFUA 3C7NB 3M1FA 4A61A 4DHYA 4FOEA 2YI1A 3VESA 1C0FA 3CERA 4H5TA 4MLHA 5AFUH 4FPBA 2GELA 3O1BA 2QWMA 3GOIA 5KQDA 5KPTA 5LJVA 3RSEA 1NLVA 3D7EO 4BRCA 3W0LA 4BR4A 1QQMA 3KHYA 5AZIA 3UKRA 2GUPA 3DXMB 2CH5A 1IG8A 5ELZA 2NLXA 4CZFA 3LDNA 3IUCA 4PL8A 1NGEA 3IFRA 1NM1A 5EXWA 4BROA 5AQFA 4FWMA 3QICA 4BRNA 2E2NA 4H0TB 4K42A 4LC9B 3I8BA 4B1YB 5KPRA 5JLFA 2GWKA 3U4LA 2ASPA 2ZWHA 2HF4A 2VWBA 3FGUA 4QS7A 3TPQA 3LDQA 2V7ZA 1GLAG 2QWRA 3O80A 3FZLA 4CZLA 4XH1A 3C7NA 3KVGA 1LCUA 2P9KA 2E1ZA 1GLCG 1SZ2A 1NGHA 3DAWA 5AQVA 4CI6A 2UYTA 3WQUA 5BRHA 1QQNA 2YHXA 4I6MB 5I9EB 1NGJA 4JHDA 3WXIA 1WUAA 3UKUA 3EKUA 1DKGD 1YXQA 4M7YA 3SLCA 3H46O 1J6ZA 4FWSA 1KAZA 4PKIA 3MN6A 3CJAA 2ITMA 3AARA 3L4IA 4XH5A 3ZX2A 3ATUA 3DXMA 5AQLA 3SMPA 4GY2B 4FWKA 2E2PA 4DCHA 1XUPO 4WQ5C 2I7NA 2F9WA 4WQ5A 4FWRA 4CD3A 2Q0RA 1NGIA 5AQHA 1XC3A 2CGJA 3CJCA 1HX1A 2A5XA 3U8XA 4CZJA 5AQIA 4QS8A 4B1VA 2FF3B 5LY3A 1WOQA 2OANA 2KHOA 5BN9A 1QHAA 4DB3A 2A42A 1GLBG 2HF3A 3GE1A 3A5OC 3ID8A 4O5FA 4H0VB 3CQYA 1U2VA 4CZKA 4MO4A 1BOTO 1T44A 2Q36A 4B1ZA 5AZIB 2WUSA 2P9SA 3TU5A 1NGBA 1G99A 4PL7A 4BC4A 3CIPA 1RDWX 2F9TA 1CZAN 1ATRA 5BRDA 2CGKA 3LDPA 3QBXA 3U9DA 5CE3A 2D0OA 1X3MA 2ZF5O 4K41A 4CD1A 1QZ5A 3LDLA 1HKBA 3CJ1A 3L0QA 5JICA 3VOVA 3U9ZA 1HLUA 5BREA 4F9OA 1HUXA 3HSCA 5FPDA 3MN7A 1ZXOA 4H5NA 2P9KB 4BR9A 3MMVA 5BPLA 2Q0UA 2P9UA 3VERA 1BWFO 3CJBA 2H3GX 4IO8A 3HM8A 4EIAA 4JHDB 4NO7A 2AP1A 1YAGA 3VGMA 4J8FA 2ASMA 3VEZA 5FPNA 5AR0A 5AQNA 3UKUB 1HJOA 3D2FA 1YVNA 4B1WB 3B8AX 4YDUC 2YJFA 3LM9A 3WQTA 4YDUA 3ZEUB 4GNIA 3R6MA 3ATVA 2E1YA 4B9QA 3P4IA 3DXKB 1OKJA 1H1VA 3VF2A 2AA4A 2IIRA 3MK6A 4FSVA 3CJ7A 5AQYA 1NBWA 2FLOA 4KBOA 4M7XA 5JLHA 5KPZA 4BG8A 3DJCA 4CZIA 3VGLA 4BR2A 3H1VX 4BRDA 1Y64A 4FWNA 3VEVA 4AM7A 5AQWA 4H0PA 1K8KB 5F2RA 3FZKA 4RCHA 3D2EA 1JCEA 3FZMA 5ADXH 3HBTA 5AQPA 5EOYA 3MN5A 3QMLA 4FO0A 3UE5A 1BG3A 3WEEB 1NGGA 2NRHA 1V4TA 2W40A 1NMDA 2Q97A 1X3NA 2YJEA 3DWLA 4FWPA 4PKGA 2P9NB 4XEIA 3GDQA 4DQ8A 4BREA 5AQRA 3O1WA 1U2VB 4ISFA 2VYPA 3A5LC 1C0GA 3VGKA 3WT0A 3EL2A 4FL9A 1RGIA 4IJNA 1BA1A 3H3OB 3EO3A 1BU6O 2P9SB 5AFUA 2YHWA 4CZHA 4BRKA 3QB0A 3WXLA 3QBWA 3ZEUA 3VF6A 1JCFA 4JD2B 4H0OA 4BRMA 1MA9B 3DXKA 2P9IB 3CETA 3WXJA 2IVNA 4B1XB 3ENHA 4CJ7A 4H0YB 3BUZB 3WUHA 4L3QA 2P9PA 1NWKA 3LL3A 4K25A 4H5VA 1SQKA 1E4FT 2GTDA 3EKSA 4IZ9A 5AQGA 3VETA 5AZJB 4CBUA 3O8MA 3ZX0A 4BVPA 2CGLA 1K8KA 4CZEA 4BRGA 2V52B 3A0IX 4BR0A 1HPMA 2P9UB 2Q31A 4BVOA 3WEEA 4FWOA 4MLEA 4ISEA 1DEJA 4BG9A 2E20A 3CQXA 2P9NA 4BGAA 3D2FB 3FFKB 1P8ZA 3FZFA 2QWOA 1SAZA 1HKGA 1E4GT 2VCPA 5E84A 2E2OA
chains in the Genus database with same CATH superfamily
4KTWA 3VEWA 4C23A 1K73O 5BPNA 2EHGA 3RVCA 4BR5A 4MDBA 2P9IA 3S3OA 4BC5A 1KVCA 2PAVA 4O8KA 4JRPA 2FSJA 3HVRA 4EHTA 2FSKA 3K9JA 3FZHA 2NRXA 1RILA 5DK5A 1ATNA 5GAGP 2Q1NA 1YIJN 3AVKA 1Q18A 1VQ8N 2IGIA 3ZSYA 5HRNA 1WSFA 3QFPA 3OYKA 1S22A 4WQ4A 3GBTA 3Q7BA 3O9QA 1FJGK 2HNZA 4FZXC 1W9HA 2GV9A 4LH5A 2UUCK 3C94A 1HNVA 4ZHRA 4BQZA 4CEBA 3O08A 2IVOA 1IKXA 3DLEA 3DRRA 3P5JA 1RT5A 3O6WA 3SUNA 1Z26A 4HWIA 3VMFB 4YFUA 2PBDA 2IC3A 4CJPA 4FLXA 3N4QA 1O1WA 1BDGA 4F2RA 4IOAL 2I7PA 1KD1O 4E7HA 3W3DA 1NGAA 2FBYA 3QNOA 1R59O 3O5BA 3L2UA 3J8AA 4B1UB 4ILGB 3TAQA 1YJ9N 5AQMA 1HPZA 2Y1JA 3KZBA 4NB4A 3NH2A 3OHRA 4H03B 4U7BA 3HVTA 1HMVA 1FK9A 1S3XA 3BEXA 5FPEA 1GLEG 1QQOA 4M3WA 5C15A 1QSSA 4DR5K 1Q8IA 1U47A 2E88A 3V81A 2PZSA 1GOAA 3AVBA 1KLNA 1VQNN 1BIZA 1NGDA 1BQMA 3DI6A 4ISGA 4FJ5A 4H5WA 4FJXA 1X1PA 4N76A 4O8UA 4Z4CA 3QDKA 4A5BA 4WF9L 4ILHA 3ZT0A 4DV0K 3MWPA 4BGBA 1MU2A 3OY9A 3SYZA 1VSHA 4IDKA 1W2BM 5AQTA 3THWB 3BY5A 2QKKA 1RBTA 1RTIA 2D0BA 3MAQA 3SZ2A 1C0UA 4JAXA 5MLCQ 3K0SA 2O8EB 2NZTA 1DLOA 1S1UA 1HR0K 4FK0A 4B8AB 4FJKA 1Q82O 3E1YA 4JNEA 3LZIA 4C8LA 1KAYA 3QETA 1RFQA 1VQPN 4CBWA 4PKHA 3SQ2A 5AQSA 2XHBA 2HOEA 2IAJA 4CJ5A 3R1XA 1NK7A 1GLFO 3AA5X 4AHUA 3QEVA 4WQ4C 1D9DA 2NRVA 4DSEA 3WNFA 1ATSA 4DU1A 3QFUA 3C7NB 3M1FA 1NK4A 2O8DB 4CJ4A 3VQ9A 4FOEA 2YHBA 3THWA 4LFCK 2HNYA 2DFEA 3VQ7A 3CCEN 4BE0A 1RDDA 1WAJA 4LY7A 3NGIA 4YORA 3RRHA 3N4PA 5AFUH 4FPBA 3LP0A 1SUQA 3KLFA 3W0LA 1NK0A 3IS9A 2RPIA 4JKGB 2CH5A 3CF5L 1VQ9N 1IG8A 5ELZA 2NLXA 4CZFA 3LDNA 1IBLK 4BE1A 4TSXA 1NM1A 5EXWA 4BROA 4JK7A 1D5AA 3EE9A 2BH1A 4YOTA 5HBMA 1X9WA 4K42A 4KHSA 2AJQA 4B1YB 3L8BA 5JLFA 2YKNA 4OLAA 3QIOA 2ASPA 2ZWHA 2HF4A 3V9SA 2NNWA 3FGUA 4JKCA 4B9VA 3LDQA 2V7ZA 3AVMA 4BDPA 1CZBA 4XH1A 2VQFK 3C7NA 2O8DA 3OYIA 1GLCG 4CJKA 1NGHA 4Z4GA 3WQUA 1QQNA 1HNIA 4O4GA 4FYDA 4E7LA 5HROA 1VQON 4CGDA 4LSNA 4W5QA 1QQCA 4DR3K 1D9FA 3L2RA 1A5VA 4YOXA 3SLCA 3H46O 3MN6A 3T1HK 3L4IA 2QTDA 3ZX2A 1QS4A 3NGYA 5AQLA 4JKGA 3SMPA 5I42A 4LF5K 5M1OA 5GAEP 5FDLA 2GUIA 3AO4A 4JI1K 1U49A 2BDPA 3DRSA 4WQ5A 3VQQA 4C1NK 3SUPA 4LH4A 4DFKA 2Q0RA 1T3VA 4CFAA 4F4KA 4DTJA 3E9OA 1FW6A 5KTQA 3TABA 2A5XA 2ZM6K 4DTRA 4B9SA 3HOSA 1QHAA 2A42A 4JYAK 4O5FA 2WC9A 1U2VA 4B3MK 4CESA 4LFAK 3AVAA 2RF2A 4YY3K 4NXNK 1T44A 3AA3A 3DM2A 1WSEA 4B1ZA 1KCFA 4CVNE 3RMCA 2HSTA 3G71N 4MFBA 1XHZA 1ZBHA 4Z4IA 1RT7A 3CIPA 3SAHA 4HCBA 3LDPA 3MXIA 2Z1IA 1HYSA 4BACA 4K41A 3IKMA 3LDLA 3OYHA 4IOXA 3CJ1A 4X64K 3VQ8A 5JICA 4NLBA 3VOVA 3QIPA 1HLUA 3KK7A 3U3GA 4F9OA 3NF6A 3SNNA 4X65K 4Q0BA 2H3GX 4CEFA 4EIAA 4NO7A 2AP1A 3ZSQA 3PIPL 5AR0A 1HJOA 4CJSA 3V1RA 1XWLA 1RTDA 3R6MA 4IG3A 4DF8A 3AO5A 4PUOA 4E3SA 3SCXA 2IIRA 4WFAL 2KFNA 3AO3A 1JLCA 2OPSA 1XNQK 3KTQA 4BR2A 2QA4N 4FZYA 1Y64A 1RTHA 2G8WA 3VEVA 4OO1J 1ZBUA 1K8KB 4RCHA 3LPUA 1KVAA 4YOVA 3HXMA 3D2EA 1IKWA 1JCEA 1T8EA 3E9PA 1JL1A 4EP5A 3UE5A 3U6FA 1OH7A 2NRHA 4DSJA 2KTQA 3HP9A 2WFBA 1X3NA 2YJEA 3DLHA 4PKGA 4B9TA 4FLUA 4DQRA 3RMBA 3DLKA 4DR7K 4IDHA 3SI6A 1NOYA 3A5LC 3WT0A 3EL2A 4FL9A 4IJNA 1BA1A 3KK1A 1M1KO 4RW4A 3VQEA 2ZD1A 3LDSA 3QBWA 2F8TA 3K9KA 4CJFA 4BRMA 3M8RA 1C0MA 1N34K 3I0SA 4CJ7A 1NJIO 1EO1A 4DV7K 3VQCA 2IS3A 3OBYA 5SWMA 4KTQA 3JYTA 1RT2A 4K25A 1EXQA 4AHVA 2ATQA 1E4FT 2GTDA 4IZ9A 2F4VK 3MEGA 3NGZA 5AZJB 2UXDK 2CGLA 2XY6A 4FJIA 1K8KA 2I5JA 4I9LA 3KD5E 2V52B 1QE1A 3CC2N 2HHXA 4M42A 1HPMA 2P9UB 4I2QA 3QO9A 2O8BB 1TK8A 2VQEK 3O9UA 2WTUA 1U45A 4JI7K 3KLEA 4LFBK 4FJHA 1B9DA 4FK2A 5KI6A 2QWOA 1HKGA 1E4GT 1YI2N 4FM0A 1CZ9A 2E2OA 3DMJA 4HUEA 1NK8A 2W42A 3ZSWA 2IDOA 2IVPA 5SZTA 2Z1HA 1GLJO 4MDAA 1NJWA 2J4RA 4WFNL 1JCGA 2RE2A 1TYQA 2WOMA 4CFBA 3K57A 4FJ8A 2D4WA 2QWNA 3GL1A 1T03A 5AZJA 4DU4A 3V9WA 1QZ6A 1RDCA 3TTDA 2JGUA 1K9MO 4CF8A 4Z4FA 4HTLA 3RWUA 2Q2RA 2NRTA 3M8QA 2QK9A 2O8BA 4DV1K 1BIUA 4DV5K 1TUUA 2YCHA 1B92A 1UA1A 4KH5A 3ZT3A 2G8HA 4BC2A 4CZMA 3C65A 4C8OA 3JS6A 3CMEN 5HLFA 4O0JA 2KW4A 1DGKN 4UQGA 1RDBA 4RWTA 3FR0A 4DTUA 3HO1A 1SKWA 1BUPA 3E66A 3PY8A 2P9PB 1BO5O 1KAXA 4FCYA 3ZETA 5FRMA 4N56A 4LF6K 3OW2M 3LM2A 2VWKA 5HL7L 3SK3A 4KHQA 1CXQA 3CM5A 2F7TA 4JKFA 4K8ZA 2CH6A 4RG8A 2G8UA 4ID1A 3K5LA 1ZBIA 3BF1A 3CCLN 2FSNA 5I3UA 2ITGA 4IJAA 5GAHP 2PY5A 3VEXA 1S1XA 1J53A 3TARA 3CD6N 4DS5A 3VF4A 4FJLA 4CZGA 1TGOA 1IKVA 3VQ6A 1HYZA 3HI0A 2G8IA 5BRFA 2X78A 5LMUK 1NK9A 4DUZK 1XMQK 3RR7A 2DY4A 2QI2A 5AQUA 3BP8A 4ELUA 2HMPA 1VSFA 1D4XA 4RW7A 1XMOK 2HHVA 1TUYA 4CGFA 4IBNA 4A59A 3ENOA 3TSQA 4CHYA 3EE8A 1TAQA 2KZMA 4GKJK 4B9NA 5ADXA 5C25A 3DOLA 4V19S 1VSMA 3QINA 3FFIA 5EVZA 4BRQA 3M6GA 4DKWA 4AILC 5GINA 2UUBK 3F9MA 4EAHD 3OS0A 1KTQA 1U6ZA 2JWLA 1XNRK 2OTJN 3J7YP 3MX5A 3MCPA 3QEPA 4MO5A 3VQAA 1T7PA 3S3NA 1BISA 4NXMK 3DYAA 4LF7K 2ZGZA 2W41A 2X6NA 3LP1A 3WNGA 4CF1A 4F3OA 3JAMO 3I55N 3SUQA 1X9JA 2B5JA 2A41A 3AVLA 2BUPA 1JXEA 3OJUA 3IMXA 3CCUN 5FRNA 2IOCA 2XY8A 4Z4HA 2EWSA 1Z05A 1S1WA 1MWMA 2V51B 4I6MA 4EFHA 4JK9A 1RDUA 1SL1A 4PY5A 1T05A 3I33A 5C10A 1WSHA 2GX9A 3J7AP 1QTMA 4B9LA 3WXMB 4C8KA 4LF8K 2HHSA 5LJWA 2GWJA 4ID5A 3LDOA 1LAWA 4FVMA 4JN4A 2D0CA 1WAFA 3OBWA 1NK6A 1XQSC 4KHNA 4NYNA 2QXLA 1NKBA 4M3XA 4K43A 1OH6A 1C1CA 1ZBFA 1J9AA 3OJSA 4BRHA 3SJHA 3SBTA 3I0RA 1WBDA 5J2PA 1RBUA 4CHNA 1HQEA 3OYMA 2GELA 2G8FA 3CCRN 3GOIA 4KHWA 4Y1CA 1SL2A 5AZIA 4M3YA 2GUPA 2E4LA 3P39A 3NFAA 3KK2A 5KGWA 4FWMA 4BRNA 2E2NA 5KGXA 3CPEA 1NK5A 2PFUA 3AVNA 4JI3K 5KPRA 2GWKA 3KWGA 4QS7A 3SPYA 2OTLN 4CZLA 1UWBA 4NYFA 3V1QA 1LCUA 2P9KA 2E1ZA 4KO0A 1TKTA 4K8XA 5AQVA 4CI6A 4G9ZA 1KLMA 2YHXA 4JKAA 2P5GA 4L8RB 3ZSXA 3WXIA 1WUAA 1J5OA 3KKSA 3I8DA 4FXDA 4CK3A 5CR4A 4UY8O 1YXQA 4M7YA 4R79A 1BGXT 3CC4N 4FWSA 4PKIA 1D8YA 3KJVA 1IG9A 1EWQA 4CGGA 1G15A 3HOTA 3B6PA 3ITHA 3L3VA 4DCHA 1XUPO 4W5TA 3SQ1A 2I7NA 2F9WA 4FWRA 4CD3A 4RW8A 5AQHA 2Z1GA 4E19A 2CGJA 3TWHA 4CJLA 5C0YA 3HPGA 2QXFA 3RRGA 3ZYYX 5AQIA 4OLBA 4B1VA 4DSIA 1A5WA 3NH1A 3MXJA 4H4MA 4DB3A 3HYFA 1GLBG 2OPRA 2HF3A 3A5OC 1NJXA 3U3YA 4H0VB 4CZKA 1BCMA 2EX3A 1YVUA 4X66K 2P9SA 1Q81O 3TU5A 2JLEA 2WONA 1JKHA 2ETJA 3RTVA 4DQPA 2P1JA 1REVA 1RDWX 3ZSVA 1CZAN 4CFCA 3OYAA 1ATRA 3G6EN 4E7KA 4FW1A 3V9UA 5FROA 5IWAK 1KSPA 2ZQBA 4DMNA 1TVRA 2ZF5O 4IEIA 4CD1A 1R0AA 1YJWN 1UAXA 2FC0A 5CYQA 2GBZA 1HKBA 2UUAK 4F8RA 4DTOA 5CZ2A 2OYQA 4HTUA 3IAYA 3U9ZA 1HUXA 3OYNA 5AJ3K 1ZXOA 4IG0A 4DSLA 4H5NA 2OZSA 3MX2A 1B9FA 3VERA 4IO8A 4CJTA 4E0DA 4CE9A 4E7IA 1X9SA 3UIQA 3VEZA 4J8FA 4FK4A 1VAZA 2RKIA 3BGRA 2O8CB 2O8FB 3F9KA 3D2FA 1YVNA 4B08A 2BE2A 3ZEUB 3K5NA 1W0HA 2XY7A 2B4JA 3VF2A 3MK6A 5AQYA 3G10A 3CJ7A 5C24A 3V9ZA 3V4IA 1NBWA 5KPZA 4KBOA 5JLHA 1VQ6N 4GV6A 1RBRA 4DR2K 2ZJPL 4CZIA 4FWNA 4H0PA 4CJQA 1K6YA 3FZMA 5ADXH 3HBTA 5AQPA 5DMRA 2UXBK 3CYMA 3QMLA 4O5BA 3KK3A 1V4TA 4FWPA 4XEIA 3CCVN 3L2QA 1LW0A 1U2VB 2VYPA 3VGKA 4BY9C 1RGIA 4ELTA 3EO3A 1BU6O 4YOWA 4DTPA 3NE6A 4I7FA 2O8CA 4X62K 1NNEA 4BRKA 2O8FA 4ELVA 3ZEUA 1ILYA 1SKSA 1JLEA 4JD2B 4DV2K 1S1VA 4PWDA 4E1MA 4OKJA 3LL3A 1J54A 4JI6K 3T1AA 3O8MA 3ZX0A 3THXA 3THYB 4A5AA 3TAFA 3A0IX 4BR0A 4OPAA 4BVOA 3CCMN 2HBMA 4ISEA 3F73A 1A5XA 4GVMA 3O9SA 3KD1E 4KB0A 3K5MA 1L3UA 3SJJA 3G4SN 3AA4A 3MECA 3FFKB 4KAZA 3FZFA 1VSJA 2FBXA 3THVA 2VCPA 1KXPA 1M90O 1GLLO 4Z4EA 1OVQA 2QM1A 1EQYA 2P51A 3C0BA 4JD2A 5M1QA 5B8HA 1YUWA 3D2EB 3CPWM 1YTUA 1VQ7N 4AHSA 2YX6A 3CG7A 3CC7N 5AQZA 4B3OA 2A3ZA 4OKEA 3THYA 3OYJA 3AO2A 4OGCA 4F3TA 3VQDA 4F2SA 4KH6A 2QKBA 3H45C 5FPMA 3GG4A 3NF8A 1GOBA 3PIOL 5HP1A 4KHPK 4JEPA 4I2PA 1ZC6A 4NLCA 4FJGA 2YNGA 3EY1A 1HQUA 3R9PA 3SMSA 2P9LB 3ISNC 3SAGA 4H0XB 1RBSA 4FW2A 3R8EA 3O3GA 1JJ2M 1OH5A 4Y1DA 3G25A 3M3ZA 1HNWK 4BRLA 1YHQN 4B3RK 3C6UA 4RW6A 4HUFA 4KKOA 4LF4K 4DSFA 1VSLA 3ALYA 1HKCA 2A1SA 1SV5A 4QS9A 3LWMA 3C6TA 4DV4K 2D0AA 2GEMA 5KQ8A 4BRFA 4HHTA 2QW9A 3T3FA 3ASMA 3O4WA 3T1YK 4W5NA 4IFEA 3AAQA 3K59A 2HNDA 3FE1A 2ASOA 2DFFA 4GV9A 3O9TA 2HBJA 4E7JA 3BF3A 3LPTA 1JLFA 2E6MA 4Y0WA 3QEWA 2P9LA 5AQXA 3S41A 3MDQA 3K2PA 4DLGA 4BC3A 1QVGM 3OYGA 1RNHA 1NGCA 1TYQB 4E89A 2HW3A 1BA0A 4YOYA 4XH4A 2ZE2A 1WLJA 5CY4A 2QWLA 4JKDA 1KRPA 1FXXA 1EKEA 4EHUA 2X74A 2A6AA 4N41A 4BRAA 1K8AO 3KWIA 3HZ6A 2YV0X 3RMAA 4OPKA 2E8AA 2QWPA 1I3AA 4FOIA 5M1NA 3LWLA 1O13A 3EZWA 2YHYA 3CFRA 1NGFA 3HTVA 3MN9A 4A62A 5BPMA 2D5RA 4JK8A 2BTFA 4CJUA 3ZETB 2V7YA 3LZJA 2HBLA 1FKOA 4CEDA 4OPHA 3QEIA 4CIGA 4CW7B 5AQKA 2ZGYA 3RSEB 2VG7A 4XIUA 3OS1A 1DTTA 1ASWA 2D0PA 3VQ5A 1YTAA 4BR7A 3B6OA 4JKBA 1L3VA 3UKRB 2QWQA 4YOUA 3NMUA 4CF9A 3IDHA 4CCHA 1Z6RA 3QNNA 4BE2A 1TL1A 3AVFA 3O4NA 5BN8A 4KV8A 1NOZA 4GV3A 4M63C 3MEEA 4E1JA 3KLGA 3CHWA 4CJWA 1SKRA 3BDPA 3L6QA 5TKYA 3OTOK 5F0XA 2F96A 3OYCA 3CM6A 4JI5K 3TR8A 4DHYA 1BQNA 1C0FA 1RDAA 3TANA 2KZZA 3OYDA 3OYEA 3CERA 4DFMA 4MLHA 3DLBA 4KPYA 3O1BA 3RSEA 1N32K 3D7EO 5IT9O 4BR4A 1QQMA 4B9UA 3UKRA 1NJZA 4JLHA 4DG1A 3PV8A 3HJFA 1IH7A 1TKZA 4PL8A 1NGEA 3IFRA 5FLXO 5HRPA 4BDYA 3J7ZO 3QICA 2Q3SA 5DM6L 4H0TB 4LC9B 1VQKN 1BL3A 1TK5A 2RN2A 2VG5A 3U4LA 2OZMA 4N5SA 1VK0A 5D3GA 3P1GA 2VWBA 4DFPA 3QLHA 3TPQA 1TK0A 1VQMN 2QWRA 3FZLA 3MWTA 1QSYA 3ZSOA 1XHXA 1SZ2A 3DAWA 4DTMA 1IBKK 5BRHA 2UYTA 4OPJA 4I6MB 4JHDA 1TKDA 1YT3A 3UKUA 3EKUA 1KQSM 3V1OA 1J6ZA 2ITMA 3CCSN 2A1RA 2FBVA 4CEEA 3DRPA 3AARA 4XH5A 3VQ4A 3NCIA 4GW6A 3ATUA 2G8VA 2KFZA 3QESA 1S5JA 4CIEA 2E2PA 2W6KA 4CEQA 1RBVA 4CHZA 4KI4A 4AH9A 4LSLA 4Q5VA 1JLQA 4WFBL 3D0PA 4QS8A 2FF3B 2KHOA 4CEOA 3CCQN 3SV3A 3GE1A 3ID8A 3CQYA 4OGEA 2KLAA 1JLBA 2Q36A 5AZIB 2WUSA 4IFVA 2QEXN 1G99A 3CCJN 1FKPA 2OPQA 4FVUA 4J2DA 4BC4A 1IV0A 5BRDA 5KRTA 3QBXA 2HHUA 3U9DA 3HRGA 3AGKA 3ZT1A 5J2MA 1XI1A 1QZ5A 4BWJA 3Q7CA 3D6RA 5T7BA 3L0QA 5HRSA 4PQUA 5BREA 2HHHK 1QVFM 3HSCA 5FPDA 3MN7A 2O4GA 3HL8A 2P9KB 4BR9A 4CHPA 3MMVA 1N36K 2Q0UA 3M5RA 2YNHA 2Z1JA 3L2WA 4CJ3A 3AV9A 2ASMA 1VSIA 2W6LA 1EWRA 4JKHA 4OJRA 5AQNA 3CFPA 4FJ9A 1ZBLA 4YDUC 2NRWA 2YJFA 4CF2A 1VSKA 3WQTA 3HP6A 3JSMA 3ATVA 2E1YA 1CLQA 1OKJA 4FJ7A 4GKKK 3TAPA 2FLOA 1IKYA 4CFDA 1L5UA 3DJCA 3T7ZA 1VQ5N 4BRDA 4OKKA 4J2BA 2DTUA 3IRXA 1QHTA 4JI2K 1I39A 4JS4A 4GVEA 4FJNA 3MN5A 1VSEA 4DQQA 5H1SQ 4HUGA 1BG3A 4YNQA 2W40A 1Q9YA 1X9MA 2P9NB 3GDQA 4DQ8A 3VQPA 4BREA 5AQRA 4FLVA 1L3TA 3TTFA 4KB1A 3A2FA 4ISFA 2E6LA 4CK1A 1C0GA 4CGJA 4IKFA 2JWKA 2P9SB 4DSKA 2HMIA 2YHWA 3ENBA 3OA9A 1WSIA 4CIFA 3QB0A 3WXLA 4KFBA 4J2AA 3VF6A 1JCFA 1HJRA 3NF9A 1MA9B 5J1EA 3ENHA 4FLWA 1N6QA 4IO9L 3BUZB 4L3QA 3PSIA 1ZYQA 5JS2A 1C1BA 4DR1K 3BZCA 5AQGA 3VETA 3TAEA 2VWJA 3NDKA 3NAEA 4FJJA 2NUBA 4B3SK 4BRGA 4NCGA 2Q31A 3L3UA 5GIPA 2KQ2A 4MLEA 1VSDA 1DEJA 4BG9A 4GMJB 3M8PA 2VGNA 1VQ4N 2P9NA 3VTHA 1UA0A 4BGAA 1TAUA 2VGMA 3D2FB 3PX4A 2E5LK 2XO7A 3AVCA 4A57A 1P8ZA 4CJVA 4DV6K 3C95A 3AVHA 1S6QA 3VN5A 1U04A 4IXCA 4JI8K 2OA8A 3ULEB 4KREA 1KC8O 4HVJA 4Z94A 5EY4A 4H4OA 3E9LA 4CHOA 1S9EA 1VRTA 1JLGA 2E2QA 3NF7A 3OYLA 2D1KA 4KHYA 3K58A 4RTFD 3VA3A 4FWLA 3ZX3A 3DOKA 3QERA 3HK2A 4JI0K 3H3NO 3P31A 3O9RA 4EZ6A 3AVJA 2PYLA 3SPZA 4BWMA 5HOOA 1WN7A 5HRRA 1DT9A 1HNZK 3AGRA 1ESVA 3CXCM 3VEYA 1JXBA 5BR8K 2X6SA 4JI4K 4JV5K 2G8KA 2XRIA 4E1NA 1DTQA 1EP4A 5F1XA 4IOCL 1KFSA 4IWVA 3KKRA 4WE1A 4CBXA 3ULEA 1GOCA 3D45A 2PYJA 3ID6A 4BRIA 1T6DA 4CERA 5CHIA 3A5MC 3OS2A 1ITGA 3AVGA 1RT4A 1T6CA 3THXB 2XY5A 3J80O 4B3TK 1HYVA 3AY9A 3KIOA 1IJJA 2O8EA 1NG9A 1V4SA 4CJRA 4CJEA 5JS1A 5TKWA 4U67L 4H5RA 2HHTA 3F2KA 3ZT4A 1LV5A 3VTIA 1BCOA 3MXMA 3DLGA 4DU3A 4A2BA 1NU0A 4JS5A 4C1NI 2R7YA 5KRSA 5E26A 3LP3A 3MCAB 5AQJA 4AM6A 3CI5A 3PX6A 3UB5A 2YHAA 3LALA 3VEOA 3LP2A 3H08A 4A2AA 1Q7YO 1LOTB 1MDUB 2YNIA 4ICLA 1JLAA 4OVLA 3VENA 3ZLJA 2HB5A 1SL0A 3T19A 4CGHA 4BRPA 4DTXA 3AAPA 3HSTB 3OYBA 5AQOA 5EX5A 2DPNA 5BR9A 1LWEA 5J2NA 1NJYA 4LF9K 2HVHA 4FPAA 1CXUA 3ZT2A 4BQLA 3CFOA 1ZBSA 4DR4K 4WYBA 1RCHA 3FLCO 1NMNA 2OCEA 5AQQA 5GADP 3A5NC 1C1AA 1LW2A 1WBBA 4M3RA 1E3MA 4FWQA 2FXUA 3PO5A 5EU7A 4CF0A 2HVIA 3JXUA 3ZSZA 4DFJA 1WNSA 5C12A 1GLDG 3V9XA 1KFDA 3PLAA 3PX0A 4IFYA 3OYFA 2FF6A 3CJ9A 2WBNA 3EN9A 4FM2A 2LSNA 3H1QA 3V6DA 4OX9K 1W97L 1ASVA 4CEZA 4FZZA 2YKMA 3A8YA 3PO4A 4EP4A 1UOCA 3WXKA 1RT3A 1JL2A 3E01A 1SS6A 1KVBA 2OPPA 4DTNA 3VPZA 3PUFA 2NRRA 1NKCA 2KKZA 2A40A 4FLYA 1MWKA 4FJMA 3TSPA 5JMVA 4O0IA 4AQYK 1RT6A 3SAFA 4PA1A 3I56N 3TAMA 3VA0A 3L4QA 3H6EA 4A61A 4J2EA 3VQBA 4JRQA 3PSFA 5M1PA 2YI1A 3BZKA 3VESA 5A2QO 3M8SA 1S6PA 3ZCMA 3EZ5A 4H5TA 1RT1A 4DV3K 4DLEA 1C6VA 4EZ9A 3EEQA 1VHXA 2QWMA 5KQDA 1OVYA 5KPTA 5LJVA 1NLVA 4CK2A 4BRCA 1BHLA 5DM7L 1WB9A 3KHYA 4R5PA 3DXMB 3O3FA 3IUCA 3DLLL 1C0TA 2DFHA 5AQFA 1BI4B 5M1FA 3KLIA 1S72N 3I8BA 3NVKA 1YF5L 4QAGA 2RHKA 4HCCA 1LWCA 4O55A 3ULDA 1GLAG 3O80A 3KVGA 4O44A 2UXCK 4DWIA 5I9EB 4KTZA 1NGJA 3TI0A 1TKXA 1IO2A 1QSLA 1DKGD 3S3MA 3CMAN 1WSJA 1N5YA 1KAZA 1LAVA 3C6HA 3CJAA 4QOZB 4M3UA 3DXMA 3IG1A 4B9MA 4GY2B 1Z25A 1Y97A 3P38A 4FWKA 5K14A 1J5EK 2ZJQL 4JKEA 1VQLN 4WQ5C 1BI4A 5C2DA 5M1KA 3L2VA 4K0KK 1NGIA 1XC3A 3WNHA 3HM9A 1Q86O 3CJCA 4ZTFA 1HX1A 1XC9A 3U8XA 2NRZA 4H8KA 4CZJA 4BDZA 4AHTA 4FLZA 1NKEA 5LY3A 1WOQA 2OANA 3RR8A 5BN9A 3KLHA 4M3TA 3QEXA 3TAGA 1OH8A 1TL3A 4MO4A 3AVIA 2F8SA 1BOTO 4Z0UA 4AF1A 4AHRA 1NGBA 4CEAA 4PL7A 2FBTA 2O4IA 1I94K 3O4QA 2HHQA 4FM1A 2F9TA 4DUYK 2CGKA 1IBMK 3SV4A 4CHQA 3SQ4A 5CE3A 2D0OA 1X3MA 3SQ0A 1S9GA 3P83D 4RW9A 1HNXK 3OVNA 2B6AA 5GIOA 4KH4A 3WNEA 1ASUA 2BGGA 4M45A 3NHGA 4DS4A 1YITN 2UU9K 1L3SA 4KRFA 5BPLA 2P9UA 1BWFO 3CJBA 1EX4A 3HM8A 4JHDB 4NCBA 1YAGA 4M41A 3HT3A 3VGMA 3T69A 4QCLA 5FPNA 3UKUB 2HHWA 4CGIA 5LMNK 5J2QA 4ZTJA 4B1WB 3B8AX 3LM9A 4YDUA 4GNIA 2YNFA 3TTCA 4B9QA 3LAKA 4G1QA 3P4IA 4IEEA 1VRUA 3DXKB 1W7AA 1H1VA 3EYZA 2AA4A 5CYMA 4FSVA 3NBPA 1WSGA 4M7XA 3S9HA 4DQIA 4WCEL 1S1TA 4W5OA 5LL6Z 4BG8A 2P5OA 3VGLA 3H1VX 4AM7A 4M3ZA 5AQWA 1EETA 3NH0A 5F2RA 3FZKA 4B8CA 3RMDA 1Q9XA 3NVMA 4DTSA 5EOYA 4FO0A 1TV6A 2Y1IA 3WEEB 1NGGA 2VG6A 5C42A 3LAMA 5JVHL 1NMDA 2Q97A 3DWLA 4C8MA 4DR6K 1P90A 4PHTX 3TSUA 3J81O 4NCAA 3O1WA 1U4BA 4C8NA 3HPHA 3MEDA 2HBKA 3H3OB 3SUOA 5JVGL 3DLRA 5AFUA 3C6AA 4CZHA 2ZJRL 3HPOA 1F21A 4H0OA 2P9IB 3CETA 3DXKA 3WXJA 4DQSA 4YHHK 2IVNA 4B1XB 4H0YB 5CZ1A 3LANA 4I9QA 3WUHA 5C2FA 3AA2A 4AHCA 2P9PA 1NWKA 1RTJA 4W5RA 4CECA 3F5TA 4H5VA 5E41A 1SQKA 1N8RO 3EKSA 1YJNN 4CBUA 4LD0A 4BVPA 2BANA 3CQ8A 1HRHA 3R3LA 4CZEA 1U48A 4KI6A 3K5OA 4ILJA 4N47A 3AO1A 3WEEA 4FWOA 4MQ3A 3SBGA 2E20A 1LWFA 3G0ZA 1N33K 3CQXA 4KHUA 4FLTA 1SAZA 3ZSRA 3O3HA 4DF4A 5E84A
chains in the Genus database with same CATH topology
1KXPA 1M90O 3ULEB 1GLLO 3VEWA 4C23A 2IVPA 1K73O 2QM1A 5BPNA 1KC8O 1GLJO 1EQYA 4MDAA 4Z94A 5EY4A 3RVCA 2J4RA 3C0BA 4JD2A 3E9LA 4MDBA 5M1QA 4BR5A 2P9IA 5B8HA 4WFNL 1YUWA 3D2EB 1JCGA 2RE2A 2E2QA 1TYQA 3CPWM 2D1KA 4BC5A 2PAVA 4O8KA 1VQ7N 4RTFD 2D4WA 2QWNA 2YX6A 4FWLA 3GL1A 3ZX3A 3CC7N 5AZJA 2FSJA 5AQZA 1QZ6A 2A3ZA 3H3NO 3TTDA 4EHTA 2FSKA 1K9MO 3K9JA 3O9RA 3P31A 2Q2RA 4HTLA 2NRTA 3FZHA 4KH6A 2NRXA 3H45C 5FPMA 1ATNA 3GG4A 1TUUA 2YCHA 5HOOA 5GAGP 1DT9A 2Q1NA 4KH5A 1YIJN 3PIOL 3AGRA 4BC2A 4CZMA 3C65A 1Q18A 4JEPA 1ESVA 1VQ8N 3JS6A 1ZC6A 3CXCM 4NLCA 3VEYA 3CMEN 3QFPA 3R9PA 1DGKN 3SMSA 4RWTA 3FR0A 2P9LB 1S22A 4WQ4A 3GBTA 3Q7BA 3SAGA 4H0XB 5F1XA 4IOCL 3R8EA 3O9QA 1BUPA 1JJ2M 4IWVA 3E66A 4CBXA 2P9PB 3ULEA 1BO5O 1KAXA 3G25A 3ID6A 3M3ZA 4BRIA 3ZETA 1T6DA 4BRLA 1YHQN 4BQZA 3OW2M 5CHIA 3LM2A 3O08A 3A5MC 2IVOA 5HL7L 3SK3A 1T6CA 3O6WA 1HKCA 2F7TA 4JKFA 2CH6A 4QS9A 3AY9A 1IJJA 4HWIA 3VMFB 1V4SA 3BF1A 2PBDA 5TKWA 2GEMA 3CCLN 2FSNA 5KQ8A 4U67L 4IJAA 4H5RA 4BRFA 5GAHP 2QW9A 3VEXA 3F2KA 3N4QA 3O4WA 3CD6N 3VTIA 1BDGA 4IFEA 3VF4A 3AAQA 4CZGA 4IOAL 2I7PA 4A2BA 4C1NI 3FE1A 1KD1O 5E26A 2ASOA 1NGAA 3HI0A 3W3DA 5BRFA 4GV9A 3O9TA 1R59O 2HBJA 3O5BA 3J8AA 3MCAB 5AQJA 4AM6A 3BF3A 3CI5A 4B1UB 3UB5A 2QI2A 4ILGB 4Y0WA 5AQUA 3BP8A 3VEOA 1YJ9N 2P9LA 2HMPA 5AQMA 3KZBA 5AQXA 3MDQA 1LOTB 4NB4A 3S41A 4A2AA 1Q7YO 1QVGM 4BC3A 1D4XA 1MDUB 3OHRA 4H03B 1NGCA 1TYQB 4U7BA 1BA0A 1TUYA 3VENA 4YOYA 1S3XA 4XH4A 4A59A 3ENOA 3BEXA 3TSQA 5FPEA 4BRPA 3AAPA 1GLEG 3EE8A 1QQOA 5C15A 5AQOA 5EX5A 2DPNA 5BR9A 2QWLA 4JKDA 5ADXA 2E88A 4FPAA 4BQLA 4EHUA 1ZBSA 1VQNN 5EVZA 4WYBA 3FLCO 2A6AA 3M6GA 4BRQA 4BRAA 4DKWA 3KWIA 1NGDA 4ISGA 5GINA 1K8AO 5AQQA 3HZ6A 3F9MA 4EAHD 1U6ZA 2JWLA 5GADP 4H5WA 3A5NC 2E8AA 2QWPA 2OTJN 4FOIA 5M1NA 3MX5A 3MCPA 4O8UA 1O13A 3QDKA 3EZWA 4MO5A 4FWQA 4A5BA 4WF9L 2FXUA 2YHYA 4ILHA 1NGFA 3HTVA 3JXUA 3MN9A 3MWPA 4A62A 4BGBA 5BPMA 2ZGZA 2W41A 1W2BM 5C12A 5AQTA 1GLDG 3I55N 1X9JA 2BTFA 4JK8A 3ZETB 2A41A 2BUPA 3PLAA 3IMXA 2V7YA 2HBLA 3CCUN 2FF6A 3CJ9A 2WBNA 3EN9A 3H1QA 4OPHA 1W97L 4IXCA 2EWSA 5AQKA 1Z05A 2ZGYA 3RSEB 3A8YA 4JAXA 1MWMA 2V51B 5MLCQ 2D0PA 4I6MA 4JK9A 4EFHA 1RDUA 2NZTA 4JKBA 4BR7A 3WXKA 3UKRB 3I33A 5C10A 2QWQA 4YOUA 1Q82O 2GX9A 3NMUA 3E1YA 1SS6A 3IDHA 3VPZA 4JNEA 3WXMB 1Z6RA 2NRRA 1KAYA 1RFQA 1VQPN 5LJWA 2KKZA 2GWJA 3LDOA 2A40A 4CBWA 4PKHA 4JN4A 5AQSA 5BN8A 3OBWA 1XQSC 2QXLA 1MWKA 2HOEA 4GV3A 4M63C 3TSPA 4E1JA 4K43A 3R1XA 5JMVA 1GLFO 3CHWA 3L6QA 4WQ4C 5TKYA 3SAFA 4BRHA 2NRVA 3I56N 1ATSA 3SJHA 3L4QA 5F0XA 3H6EA 3QFUA 3C7NB 3M1FA 3SBTA 4A61A 4DHYA 4FOEA 5M1PA 2YI1A 3VESA 1C0FA 3CCEN 3CERA 4H5TA 4MLHA 4YORA 3N4PA 5AFUH 4FPBA 2GELA 3O1BA 3CCRN 2QWMA 3GOIA 5KQDA 1OVYA 5KPTA 5LJVA 3RSEA 1NLVA 3D7EO 4BRCA 3W0LA 5DM7L 4BR4A 1QQMA 3KHYA 5AZIA 3UKRA 2GUPA 3DXMB 4JKGB 2CH5A 3P39A 3CF5L 1IG8A 5ELZA 2NLXA 4CZFA 3LDNA 1VQ9N 3IUCA 3DLLL 4PL8A 1NGEA 3IFRA 1NM1A 5EXWA 4BROA 5AQFA 3J7ZO 4JK7A 4FWMA 3QICA 3EE9A 2BH1A 2E2NA 4BRNA 4YOTA 5M1FA 3CPEA 5DM6L 4H0TB 4K42A 2PFUA 1S72N 4LC9B 1VQKN 3I8BA 4B1YB 5KPRA 1YF5L 2GWKA 5JLFA 3NVKA 2RHKA 3U4LA 2ASPA 2ZWHA 2HF4A 2VWBA 3KWGA 2NNWA 3FGUA 4JKCA 4QS7A 3TPQA 3LDQA 2V7ZA 1GLAG 1VQMN 2OTLN 2QWRA 3O80A 3FZLA 4CZLA 4XH1A 3C7NA 3KVGA 3MWTA 1LCUA 2P9KA 2E1ZA 1GLCG 1SZ2A 1NGHA 3DAWA 5AQVA 4CI6A 2UYTA 3WQUA 5BRHA 4G9ZA 1QQNA 2YHXA 4I6MB 5I9EB 1NGJA 4JHDA 4JKAA 3WXIA 1WUAA 1VQON 3UKUA 3EKUA 1DKGD 1KQSM 5CR4A 4UY8O 4YOXA 1YXQA 4M7YA 3SLCA 4R79A 3CMAN 3H46O 3CC4N 1J6ZA 4FWSA 1KAZA 4PKIA 3C6HA 3CJAA 3MN6A 2ITMA 3CCSN 3AARA 2QTDA 3L4IA 4XH5A 3ZX2A 3ATUA 3HOTA 3DXMA 5AQLA 4JKGA 3SMPA 5M1OA 5GAEP 4GY2B 3P38A 4FWKA 2E2PA 4DCHA 1XUPO 1VQLN 2ZJQL 4JKEA 4WQ5C 2I7NA 2F9WA 4WQ5A 5C2DA 4FWRA 5M1KA 4C1NK 4CD3A 2Q0RA 1T3VA 1NGIA 5AQHA 1XC3A 2CGJA 1Q86O 3E9OA 5C0YA 3CJCA 1HX1A 2A5XA 3U8XA 2NRZA 3ZYYX 4CZJA 5AQIA 4WFBL 4QS8A 4B1VA 2FF3B 5LY3A 1WOQA 2OANA 3HOSA 2KHOA 5BN9A 1QHAA 3CCQN 4DB3A 2A42A 1GLBG 4BY9C 2HF3A 3GE1A 3A5OC 3ID8A 4O5FA 4H0VB 3CQYA 2WC9A 1U2VA 4CZKA 2KLAA 4MO4A 1BOTO 1T44A 2Q36A 4AF1A 5AZIB 2WUSA 4B1ZA 2QEXN 2HSTA 2P9SA 1Q81O 3TU5A 3G71N 1NGBA 1G99A 3CCJN 4PL7A 4FVUA 4BC4A 1RDWX 2F9TA 3CIPA 1CZAN 3SAHA 1ATRA 5BRDA 3G6EN 2CGKA 3LDPA 3QBXA 3U9DA 5CE3A 2D0OA 1X3MA 3HRGA 3AGKA 2ZF5O 4IEIA 4K41A 3IKMA 4CD1A 1QZ5A 3LDLA 1YJWN 3Q7CA 1HKBA 3D6RA 4IOXA 4KH4A 5GIOA 3CJ1A 3L0QA 5JICA 4NLBA 3VOVA 3U9ZA 1HLUA 5BREA 3KK7A 4F9OA 1HUXA 1QVFM 3HSCA 5FPDA 3MN7A 1ZXOA 4H5NA 1YITN 3MX2A 2P9KB 4BR9A 3MMVA 5BPLA 2Q0UA 2P9UA 3M5RA 3VERA 1BWFO 3CJBA 2H3GX 4IO8A 3HM8A 4EIAA 4JHDB 4NO7A 2AP1A 1YAGA 3VGMA 4J8FA 2ASMA 3T69A 3VEZA 5FPNA 3PIPL 5AR0A 4JKHA 5AQNA 1VAZA 3UKUB 1HJOA 3D2FA 1YVNA 4B1WB 2NRWA 3B8AX 2YJFA 3LM9A 4YDUC 3WQTA 4YDUA 3ZEUB 4GNIA 3R6MA 3ATVA 2E1YA 3TTCA 4B9QA 3P4IA 4IEEA 3DXKB 1OKJA 1H1VA 3VF2A 2AA4A 2IIRA 3MK6A 4FSVA 3CJ7A 5AQYA 4WFAL 1NBWA 2FLOA 4KBOA 4M7XA 5JLHA 5KPZA 4WCEL 1VQ6N 4GV6A 4BG8A 2ZJPL 3DJCA 4CZIA 3VGLA 3T7ZA 4BR2A 1VQ5N 3H1VX 4BRDA 2QA4N 1Y64A 4FWNA 3VEVA 4AM7A 5AQWA 4H0PA 4OO1J 1K8KB 5F2RA 3FZKA 4RCHA 4YOVA 3D2EA 1JCEA 3FZMA 3NVMA 3HBTA 5ADXH 5AQPA 3E9PA 4GVEA 5EOYA 3MN5A 3QMLA 4FO0A 3UE5A 5H1SQ 1BG3A 3WEEB 1NGGA 2NRHA 1V4TA 5JVHL 2W40A 1NMDA 2WFBA 2Q97A 1X3NA 2YJEA 3DWLA 4FWPA 1P90A 4PKGA 2P9NB 4XEIA 3TSUA 3GDQA 4DQ8A 4PHTX 3CCVN 4BREA 5AQRA 3O1WA 3TTFA 1U2VB 4IDHA 4ISFA 2VYPA 3A5LC 1C0GA 3VGKA 3WT0A 3EL2A 4FL9A 1RGIA 4IJNA 1BA1A 2HBKA 3H3OB 3EO3A 1BU6O 4YOWA 5JVGL 1M1KO 2JWKA 2P9SB 5AFUA 3C6AA 2YHWA 3ENBA 3OA9A 4CZHA 4BRKA 3QB0A 3WXLA 2ZJRL 3QBWA 3ZEUA 1ILYA 3VF6A 3K9KA 1JCFA 4JD2B 4H0OA 4BRMA 1MA9B 2P9IB 3CETA 3DXKA 3WXJA 2IVNA 4B1XB 3ENHA 4CJ7A 4H0YB 1NJIO 1EO1A 4IO9L 3BUZB 3WUHA 5C2FA 4L3QA 3OBYA 2P9PA 1NWKA 3LL3A 4K25A 3F5TA 4H5VA 1SQKA 1E4FT 2GTDA 3EKSA 4IZ9A 5AQGA 3VETA 1N8RO 5AZJB 4CBUA 1YJNN 3O8MA 3ZX0A 4BVPA 2CGLA 1K8KA 3R3LA 4A5AA 4CZEA 4BRGA 2V52B 3CC2N 3A0IX 4ILJA 4BR0A 1HPMA 2P9UB 4OPAA 2Q31A 5GIPA 4BVOA 3WEEA 4FWOA 3CCMN 2HBMA 4ISEA 1DEJA 4MLEA 3SBGA 4BG9A 2E20A 3O9UA 3O9SA 2VGNA 3CQXA 1VQ4N 2P9NA 3VTHA 4BGAA 2VGMA 3G4SN 3D2FB 3FFKB 4A57A 1P8ZA 3FZFA 2QWOA 1SAZA 1HKGA 1E4GT 2VCPA 1YI2N 5E84A 2E2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KXP A;  3ULE B;  1GLL O;  3VEW A;  4C23 A;  2IVP A;  2QM1 A;  5BPN A;  1GLJ O;  1EQY A;  4Z94 A;  5EY4 A;  4BR5 A;  2J4R A;  3C0B A;  4JD2 A;  2P9I A;  5B8H A;  1YUW A;  3D2E B;  1JCG A;  2E2Q A;  1TYQ A;  2D1K A;  4BC5 A;  2PAV A;  4O8K A;  4RTF D;  2D4W A;  2QWN A;  4FWL A;  3GL1 A;  3ZX3 A;  5AZJ A;  2FSJ A;  5AQZ A;  1QZ6 A;  2A3Z A;  3H3N O;  4EHT A;  2FSK A;  4HTL A;  2Q2R A;  3FZH A;  3H45 C;  5FPM A;  1ATN A;  3GG4 A;  1TUU A;  2YCH A;  2Q1N A;  4BC2 A;  4CZM A;  1Q18 A;  1ESV A;  3JS6 A;  1ZC6 A;  3VEY A;  3QFP A;  3R9P A;  1DGK N;  3SMS A;  4RWT A;  3FR0 A;  2P9L B;  1S22 A;  4WQ4 A;  3GBT A;  4H0X B;  5F1X A;  3R8E A;  1BUP A;  4IWV A;  4CBX A;  2P9P B;  3ULE A;  1BO5 O;  1KAX A;  3G25 A;  3M3Z A;  4BRI A;  3ZET A;  1T6D A;  4BRL A;  4BQZ A;  3LM2 A;  3O08 A;  3A5M C;  2IVO A;  3SK3 A;  1T6C A;  3O6W A;  1HKC A;  4QS9 A;  2CH6 A;  3AY9 A;  1IJJ A;  4HWI A;  1V4S A;  3BF1 A;  2PBD A;  2GEM A;  2FSN A;  5KQ8 A;  4IJA A;  4H5R A;  4BRF A;  2QW9 A;  3VEX A;  3O4W A;  1BDG A;  3VF4 A;  3AAQ A;  4CZG A;  2I7P A;  4A2B A;  3FE1 A;  5E26 A;  2ASO A;  1NGA A;  3HI0 A;  3W3D A;  5BRF A;  1R59 O;  3O5B A;  3J8A A;  4AM6 A;  5AQJ A;  3BF3 A;  3CI5 A;  4B1U B;  3UB5 A;  4Y0W A;  5AQU A;  3BP8 A;  3VEO A;  2P9L A;  2HMP A;  5AQM A;  3KZB A;  5AQX A;  3MDQ A;  1LOT B;  4NB4 A;  3S41 A;  4A2A A;  4BC3 A;  1D4X A;  1MDU B;  3OHR A;  4H03 B;  1NGC A;  1TYQ B;  1BA0 A;  1TUY A;  3VEN A;  1S3X A;  4XH4 A;  3ENO A;  3BEX A;  5FPE A;  4BRP A;  3AAP A;  1GLE G;  1QQO A;  5AQO A;  5EX5 A;  2DPN A;  5BR9 A;  2QWL A;  5ADX A;  2E88 A;  4FPA A;  4BQL A;  4EHU A;  1ZBS A;  5EVZ A;  4WYB A;  3FLC O;  2A6A A;  3M6G A;  4BRQ A;  4BRA A;  1NGD A;  4ISG A;  5AQQ A;  3HZ6 A;  3F9M A;  4EAH D;  1U6Z A;  4H5W A;  3A5N C;  2E8A A;  2QWP A;  4FOI A;  3MCP A;  3QDK A;  3EZW A;  4MO5 A;  4FWQ A;  2FXU A;  2YHY A;  1NGF A;  3HTV A;  3JXU A;  3MN9 A;  4A62 A;  4BGB A;  5BPM A;  2ZGZ A;  2W41 A;  5AQT A;  1GLD G;  1X9J A;  2BTF A;  3ZET B;  2A41 A;  2BUP A;  3IMX A;  2V7Y A;  2FF6 A;  3CJ9 A;  3EN9 A;  3H1Q A;  4IXC A;  2EWS A;  5AQK A;  1Z05 A;  2ZGY A;  3RSE B;  3A8Y A;  4JAX A;  1MWM A;  2V51 B;  2D0P A;  4I6M A;  4EFH A;  2NZT A;  4BR7 A;  3WXK A;  3UKR B;  3I33 A;  2QWQ A;  3IDH A;  3VPZ A;  4JNE A;  1Z6R A;  1KAY A;  1RFQ A;  5LJW A;  2GWJ A;  3LDO A;  2A40 A;  4CBW A;  4PKH A;  4JN4 A;  5AQS A;  5BN8 A;  1XQS C;  2QXL A;  1MWK A;  2HOE A;  4M63 C;  4E1J A;  4K43 A;  5JMV A;  1GLF O;  3CHW A;  3L6Q A;  4WQ4 C;  5TKY A;  4BRH A;  1ATS A;  3SJH A;  5F0X A;  3H6E A;  3QFU A;  3C7N B;  3M1F A;  4A61 A;  4DHY A;  4FOE A;  2YI1 A;  3VES A;  1C0F A;  3CER A;  4H5T A;  4MLH A;  5AFU H;  4FPB A;  2GEL A;  3O1B A;  2QWM A;  3GOI A;  5KQD A;  5KPT A;  5LJV A;  3RSE A;  1NLV A;  3D7E O;  4BRC A;  3W0L A;  4BR4 A;  1QQM A;  3KHY A;  5AZI A;  3UKR A;  2GUP A;  3DXM B;  2CH5 A;  1IG8 A;  5ELZ A;  2NLX A;  4CZF A;  3LDN A;  3IUC A;  4PL8 A;  1NGE A;  3IFR A;  1NM1 A;  5EXW A;  4BRO A;  5AQF A;  4FWM A;  3QIC A;  4BRN A;  2E2N A;  4H0T B;  4K42 A;  4LC9 B;  3I8B A;  4B1Y B;  5KPR A;  5JLF A;  2GWK A;  3U4L A;  2ASP A;  2ZWH A;  2HF4 A;  2VWB A;  3FGU A;  4QS7 A;  3TPQ A;  3LDQ A;  2V7Z A;  1GLA G;  2QWR A;  3O80 A;  3FZL A;  4CZL A;  4XH1 A;  3C7N A;  3KVG A;  1LCU A;  2P9K A;  2E1Z A;  1GLC G;  1SZ2 A;  1NGH A;  3DAW A;  5AQV A;  4CI6 A;  2UYT A;  3WQU A;  5BRH A;  1QQN A;  2YHX A;  4I6M B;  5I9E B;  1NGJ A;  4JHD A;  3WXI A;  1WUA A;  3UKU A;  3EKU A;  1DKG D;  1YXQ A;  4M7Y A;  3SLC A;  3H46 O;  1J6Z A;  4FWS A;  1KAZ A;  4PKI A;  3MN6 A;  3CJA A;  2ITM A;  3AAR A;  3L4I A;  4XH5 A;  3ZX2 A;  3ATU A;  3DXM A;  5AQL A;  3SMP A;  4GY2 B;  4FWK A;  2E2P A;  4DCH A;  1XUP O;  4WQ5 C;  2I7N A;  2F9W A;  4WQ5 A;  4FWR A;  4CD3 A;  2Q0R A;  1NGI A;  5AQH A;  1XC3 A;  2CGJ A;  3CJC A;  1HX1 A;  2A5X A;  3U8X A;  4CZJ A;  5AQI A;  4QS8 A;  4B1V A;  2FF3 B;  5LY3 A;  1WOQ A;  2OAN A;  2KHO A;  5BN9 A;  1QHA A;  4DB3 A;  2A42 A;  1GLB G;  2HF3 A;  3GE1 A;  3A5O C;  3ID8 A;  4O5F A;  4H0V B;  3CQY A;  1U2V A;  4CZK A;  4MO4 A;  1BOT O;  1T44 A;  2Q36 A;  4B1Z A;  5AZI B;  2WUS A;  2P9S A;  3TU5 A;  1NGB A;  1G99 A;  4PL7 A;  4BC4 A;  3CIP A;  1RDW X;  2F9T A;  1CZA N;  1ATR A;  5BRD A;  2CGK A;  3LDP A;  3QBX A;  3U9D A;  5CE3 A;  2D0O A;  1X3M A;  2ZF5 O;  4K41 A;  4CD1 A;  1QZ5 A;  3LDL A;  1HKB A;  3CJ1 A;  3L0Q A;  5JIC A;  3VOV A;  3U9Z A;  1HLU A;  5BRE A;  4F9O A;  1HUX A;  3HSC A;  5FPD A;  3MN7 A;  1ZXO A;  4H5N A;  2P9K B;  4BR9 A;  3MMV A;  5BPL A;  2Q0U A;  2P9U A;  3VER A;  1BWF O;  3CJB A;  2H3G X;  4IO8 A;  3HM8 A;  4EIA A;  4JHD B;  4NO7 A;  2AP1 A;  1YAG A;  3VGM A;  4J8F A;  2ASM A;  3VEZ A;  5FPN A;  5AR0 A;  5AQN A;  3UKU B;  1HJO A;  3D2F A;  1YVN A;  4B1W B;  3B8A X;  4YDU C;  2YJF A;  3LM9 A;  3WQT A;  4YDU A;  3ZEU B;  4GNI A;  3R6M A;  3ATV A;  2E1Y A;  4B9Q A;  3P4I A;  3DXK B;  1OKJ A;  1H1V A;  3VF2 A;  2AA4 A;  2IIR A;  3MK6 A;  4FSV A;  3CJ7 A;  5AQY A;  1NBW A;  2FLO A;  4KBO A;  4M7X A;  5JLH A;  5KPZ A;  4BG8 A;  3DJC A;  4CZI A;  3VGL A;  4BR2 A;  3H1V X;  4BRD A;  1Y64 A;  4FWN A;  3VEV A;  4AM7 A;  5AQW A;  4H0P A;  1K8K B;  5F2R A;  3FZK A;  4RCH A;  3D2E A;  1JCE A;  3FZM A;  5ADX H;  3HBT A;  5AQP A;  5EOY A;  3MN5 A;  3QML A;  4FO0 A;  3UE5 A;  1BG3 A;  3WEE B;  1NGG A;  2NRH A;  1V4T A;  2W40 A;  1NMD A;  2Q97 A;  1X3N A;  2YJE A;  3DWL A;  4FWP A;  4PKG A;  2P9N B;  4XEI A;  3GDQ A;  4DQ8 A;  4BRE A;  5AQR A;  3O1W A;  1U2V B;  4ISF A;  2VYP A;  3A5L C;  1C0G A;  3VGK A;  3WT0 A;  3EL2 A;  4FL9 A;  1RGI A;  4IJN A;  1BA1 A;  3H3O B;  3EO3 A;  1BU6 O;  2P9S B;  5AFU A;  2YHW A;  4CZH A;  4BRK A;  3QB0 A;  3WXL A;  3QBW A;  3ZEU A;  3VF6 A;  1JCF A;  4JD2 B;  4H0O A;  4BRM A;  1MA9 B;  3DXK A;  2P9I B;  3CET A;  3WXJ A;  2IVN A;  4B1X B;  3ENH A;  4CJ7 A;  4H0Y B;  3BUZ B;  3WUH A;  4L3Q A;  2P9P A;  1NWK A;  3LL3 A;  4K25 A;  4H5V A;  1SQK A;  1E4F T;  2GTD A;  3EKS A;  4IZ9 A;  5AQG A;  3VET A;  5AZJ B;  4CBU A;  3O8M A;  3ZX0 A;  4BVP A;  2CGL A;  1K8K A;  4CZE A;  4BRG A;  2V52 B;  3A0I X;  4BR0 A;  1HPM A;  2P9U B;  2Q31 A;  4BVO A;  3WEE A;  4FWO A;  4MLE A;  4ISE A;  1DEJ A;  4BG9 A;  2E20 A;  3CQX A;  2P9N A;  4BGA A;  3D2F B;  3FFK B;  1P8Z A;  3FZF A;  2QWO A;  1SAZ A;  1HKG A;  1E4G T;  2VCP A;  5E84 A;  2E2O A; 
#chains in the Genus database with same CATH topology
 4KTW A;  3VEW A;  4C23 A;  1K73 O;  5BPN A;  2EHG A;  3RVC A;  4BR5 A;  4MDB A;  2P9I A;  3S3O A;  4BC5 A;  1KVC A;  2PAV A;  4O8K A;  4JRP A;  2FSJ A;  3HVR A;  4EHT A;  2FSK A;  3K9J A;  3FZH A;  2NRX A;  1RIL A;  5DK5 A;  1ATN A;  5GAG P;  2Q1N A;  1YIJ N;  3AVK A;  1Q18 A;  1VQ8 N;  2IGI A;  3ZSY A;  5HRN A;  1WSF A;  3QFP A;  3OYK A;  1S22 A;  4WQ4 A;  3GBT A;  3Q7B A;  3O9Q A;  1FJG K;  2HNZ A;  4FZX C;  1W9H A;  2GV9 A;  4LH5 A;  2UUC K;  3C94 A;  1HNV A;  4ZHR A;  4BQZ A;  4CEB A;  3O08 A;  2IVO A;  1IKX A;  3DLE A;  3DRR A;  3P5J A;  1RT5 A;  3O6W A;  3SUN A;  1Z26 A;  4HWI A;  3VMF B;  4YFU A;  2PBD A;  2IC3 A;  4CJP A;  4FLX A;  3N4Q A;  1O1W A;  1BDG A;  4F2R A;  4IOA L;  2I7P A;  1KD1 O;  4E7H A;  3W3D A;  1NGA A;  2FBY A;  3QNO A;  1R59 O;  3O5B A;  3L2U A;  3J8A A;  4B1U B;  4ILG B;  3TAQ A;  1YJ9 N;  5AQM A;  1HPZ A;  2Y1J A;  3KZB A;  4NB4 A;  3NH2 A;  3OHR A;  4H03 B;  4U7B A;  3HVT A;  1HMV A;  1FK9 A;  1S3X A;  3BEX A;  5FPE A;  1GLE G;  1QQO A;  4M3W A;  5C15 A;  1QSS A;  4DR5 K;  1Q8I A;  1U47 A;  2E88 A;  3V81 A;  2PZS A;  1GOA A;  3AVB A;  1KLN A;  1VQN N;  1BIZ A;  1NGD A;  1BQM A;  3DI6 A;  4ISG A;  4FJ5 A;  4H5W A;  4FJX A;  1X1P A;  4N76 A;  4O8U A;  4Z4C A;  3QDK A;  4A5B A;  4WF9 L;  4ILH A;  3ZT0 A;  4DV0 K;  3MWP A;  4BGB A;  1MU2 A;  3OY9 A;  3SYZ A;  1VSH A;  4IDK A;  1W2B M;  5AQT A;  3THW B;  3BY5 A;  2QKK A;  1RBT A;  1RTI A;  2D0B A;  3MAQ A;  3SZ2 A;  1C0U A;  4JAX A;  5MLC Q;  3K0S A;  2O8E B;  2NZT A;  1DLO A;  1S1U A;  1HR0 K;  4FK0 A;  4B8A B;  4FJK A;  1Q82 O;  3E1Y A;  4JNE A;  3LZI A;  4C8L A;  1KAY A;  3QET A;  1RFQ A;  1VQP N;  4CBW A;  4PKH A;  3SQ2 A;  5AQS A;  2XHB A;  2HOE A;  2IAJ A;  4CJ5 A;  3R1X A;  1NK7 A;  1GLF O;  3AA5 X;  4AHU A;  3QEV A;  4WQ4 C;  1D9D A;  2NRV A;  4DSE A;  3WNF A;  1ATS A;  4DU1 A;  3QFU A;  3C7N B;  3M1F A;  1NK4 A;  2O8D B;  4CJ4 A;  3VQ9 A;  4FOE A;  2YHB A;  3THW A;  4LFC K;  2HNY A;  2DFE A;  3VQ7 A;  3CCE N;  4BE0 A;  1RDD A;  1WAJ A;  4LY7 A;  3NGI A;  4YOR A;  3RRH A;  3N4P A;  5AFU H;  4FPB A;  3LP0 A;  1SUQ A;  3KLF A;  3W0L A;  1NK0 A;  3IS9 A;  2RPI A;  4JKG B;  2CH5 A;  3CF5 L;  1VQ9 N;  1IG8 A;  5ELZ A;  2NLX A;  4CZF A;  3LDN A;  1IBL K;  4BE1 A;  4TSX A;  1NM1 A;  5EXW A;  4BRO A;  4JK7 A;  1D5A A;  3EE9 A;  2BH1 A;  4YOT A;  5HBM A;  1X9W A;  4K42 A;  4KHS A;  2AJQ A;  4B1Y B;  3L8B A;  5JLF A;  2YKN A;  4OLA A;  3QIO A;  2ASP A;  2ZWH A;  2HF4 A;  3V9S A;  2NNW A;  3FGU A;  4JKC A;  4B9V A;  3LDQ A;  2V7Z A;  3AVM A;  4BDP A;  1CZB A;  4XH1 A;  2VQF K;  3C7N A;  2O8D A;  3OYI A;  1GLC G;  4CJK A;  1NGH A;  4Z4G A;  3WQU A;  1QQN A;  1HNI A;  4O4G A;  4FYD A;  4E7L A;  5HRO A;  1VQO N;  4CGD A;  4LSN A;  4W5Q A;  1QQC A;  4DR3 K;  1D9F A;  3L2R A;  1A5V A;  4YOX A;  3SLC A;  3H46 O;  3MN6 A;  3T1H K;  3L4I A;  2QTD A;  3ZX2 A;  1QS4 A;  3NGY A;  5AQL A;  4JKG A;  3SMP A;  5I42 A;  4LF5 K;  5M1O A;  5GAE P;  5FDL A;  2GUI A;  3AO4 A;  4JI1 K;  1U49 A;  2BDP A;  3DRS A;  4WQ5 A;  3VQQ A;  4C1N K;  3SUP A;  4LH4 A;  4DFK A;  2Q0R A;  1T3V A;  4CFA A;  4F4K A;  4DTJ A;  3E9O A;  1FW6 A;  5KTQ A;  3TAB A;  2A5X A;  2ZM6 K;  4DTR A;  4B9S A;  3HOS A;  1QHA A;  2A42 A;  4JYA K;  4O5F A;  2WC9 A;  1U2V A;  4B3M K;  4CES A;  4LFA K;  3AVA A;  2RF2 A;  4YY3 K;  4NXN K;  1T44 A;  3AA3 A;  3DM2 A;  1WSE A;  4B1Z A;  1KCF A;  4CVN E;  3RMC A;  2HST A;  3G71 N;  4MFB A;  1XHZ A;  1ZBH A;  4Z4I A;  1RT7 A;  3CIP A;  3SAH A;  4HCB A;  3LDP A;  3MXI A;  2Z1I A;  1HYS A;  4BAC A;  4K41 A;  3IKM A;  3LDL A;  3OYH A;  4IOX A;  3CJ1 A;  4X64 K;  3VQ8 A;  5JIC A;  4NLB A;  3VOV A;  3QIP A;  1HLU A;  3KK7 A;  3U3G A;  4F9O A;  3NF6 A;  3SNN A;  4X65 K;  4Q0B A;  2H3G X;  4CEF A;  4EIA A;  4NO7 A;  2AP1 A;  3ZSQ A;  3PIP L;  5AR0 A;  1HJO A;  4CJS A;  3V1R A;  1XWL A;  1RTD A;  3R6M A;  4IG3 A;  4DF8 A;  3AO5 A;  4PUO A;  4E3S A;  3SCX A;  2IIR A;  4WFA L;  2KFN A;  3AO3 A;  1JLC A;  2OPS A;  1XNQ K;  3KTQ A;  4BR2 A;  2QA4 N;  4FZY A;  1Y64 A;  1RTH A;  2G8W A;  3VEV A;  4OO1 J;  1ZBU A;  1K8K B;  4RCH A;  3LPU A;  1KVA A;  4YOV A;  3HXM A;  3D2E A;  1IKW A;  1JCE A;  1T8E A;  3E9P A;  1JL1 A;  4EP5 A;  3UE5 A;  3U6F A;  1OH7 A;  2NRH A;  4DSJ A;  2KTQ A;  3HP9 A;  2WFB A;  1X3N A;  2YJE A;  3DLH A;  4PKG A;  4B9T A;  4FLU A;  4DQR A;  3RMB A;  3DLK A;  4DR7 K;  4IDH A;  3SI6 A;  1NOY A;  3A5L C;  3WT0 A;  3EL2 A;  4FL9 A;  4IJN A;  1BA1 A;  3KK1 A;  1M1K O;  4RW4 A;  3VQE A;  2ZD1 A;  3LDS A;  3QBW A;  2F8T A;  3K9K A;  4CJF A;  4BRM A;  3M8R A;  1C0M A;  1N34 K;  3I0S A;  4CJ7 A;  1NJI O;  1EO1 A;  4DV7 K;  3VQC A;  2IS3 A;  3OBY A;  5SWM A;  4KTQ A;  3JYT A;  1RT2 A;  4K25 A;  1EXQ A;  4AHV A;  2ATQ A;  1E4F T;  2GTD A;  4IZ9 A;  2F4V K;  3MEG A;  3NGZ A;  5AZJ B;  2UXD K;  2CGL A;  2XY6 A;  4FJI A;  1K8K A;  2I5J A;  4I9L A;  3KD5 E;  2V52 B;  1QE1 A;  3CC2 N;  2HHX A;  4M42 A;  1HPM A;  2P9U B;  4I2Q A;  3QO9 A;  2O8B B;  1TK8 A;  2VQE K;  3O9U A;  2WTU A;  1U45 A;  4JI7 K;  3KLE A;  4LFB K;  4FJH A;  1B9D A;  4FK2 A;  5KI6 A;  2QWO A;  1HKG A;  1E4G T;  1YI2 N;  4FM0 A;  1CZ9 A;  2E2O A;  3DMJ A;  4HUE A;  1NK8 A;  2W42 A;  3ZSW A;  2IDO A;  2IVP A;  5SZT A;  2Z1H A;  1GLJ O;  4MDA A;  1NJW A;  2J4R A;  4WFN L;  1JCG A;  2RE2 A;  1TYQ A;  2WOM A;  4CFB A;  3K57 A;  4FJ8 A;  2D4W A;  2QWN A;  3GL1 A;  1T03 A;  5AZJ A;  4DU4 A;  3V9W A;  1QZ6 A;  1RDC A;  3TTD A;  2JGU A;  1K9M O;  4CF8 A;  4Z4F A;  4HTL A;  3RWU A;  2Q2R A;  2NRT A;  3M8Q A;  2QK9 A;  2O8B A;  4DV1 K;  1BIU A;  4DV5 K;  1TUU A;  2YCH A;  1B92 A;  1UA1 A;  4KH5 A;  3ZT3 A;  2G8H A;  4BC2 A;  4CZM A;  3C65 A;  4C8O A;  3JS6 A;  3CME N;  5HLF A;  4O0J A;  2KW4 A;  1DGK N;  4UQG A;  1RDB A;  4RWT A;  3FR0 A;  4DTU A;  3HO1 A;  1SKW A;  1BUP A;  3E66 A;  3PY8 A;  2P9P B;  1BO5 O;  1KAX A;  4FCY A;  3ZET A;  5FRM A;  4N56 A;  4LF6 K;  3OW2 M;  3LM2 A;  2VWK A;  5HL7 L;  3SK3 A;  4KHQ A;  1CXQ A;  3CM5 A;  2F7T A;  4JKF A;  4K8Z A;  2CH6 A;  4RG8 A;  2G8U A;  4ID1 A;  3K5L A;  1ZBI A;  3BF1 A;  3CCL N;  2FSN A;  5I3U A;  2ITG A;  4IJA A;  5GAH P;  2PY5 A;  3VEX A;  1S1X A;  1J53 A;  3TAR A;  3CD6 N;  4DS5 A;  3VF4 A;  4FJL A;  4CZG A;  1TGO A;  1IKV A;  3VQ6 A;  1HYZ A;  3HI0 A;  2G8I A;  5BRF A;  2X78 A;  5LMU K;  1NK9 A;  4DUZ K;  1XMQ K;  3RR7 A;  2DY4 A;  2QI2 A;  5AQU A;  3BP8 A;  4ELU A;  2HMP A;  1VSF A;  1D4X A;  4RW7 A;  1XMO K;  2HHV A;  1TUY A;  4CGF A;  4IBN A;  4A59 A;  3ENO A;  3TSQ A;  4CHY A;  3EE8 A;  1TAQ A;  2KZM A;  4GKJ K;  4B9N A;  5ADX A;  5C25 A;  3DOL A;  4V19 S;  1VSM A;  3QIN A;  3FFI A;  5EVZ A;  4BRQ A;  3M6G A;  4DKW A;  4AIL C;  5GIN A;  2UUB K;  3F9M A;  4EAH D;  3OS0 A;  1KTQ A;  1U6Z A;  2JWL A;  1XNR K;  2OTJ N;  3J7Y P;  3MX5 A;  3MCP A;  3QEP A;  4MO5 A;  3VQA A;  1T7P A;  3S3N A;  1BIS A;  4NXM K;  3DYA A;  4LF7 K;  2ZGZ A;  2W41 A;  2X6N A;  3LP1 A;  3WNG A;  4CF1 A;  4F3O A;  3JAM O;  3I55 N;  3SUQ A;  1X9J A;  2B5J A;  2A41 A;  3AVL A;  2BUP A;  1JXE A;  3OJU A;  3IMX A;  3CCU N;  5FRN A;  2IOC A;  2XY8 A;  4Z4H A;  2EWS A;  1Z05 A;  1S1W A;  1MWM A;  2V51 B;  4I6M A;  4EFH A;  4JK9 A;  1RDU A;  1SL1 A;  4PY5 A;  1T05 A;  3I33 A;  5C10 A;  1WSH A;  2GX9 A;  3J7A P;  1QTM A;  4B9L A;  3WXM B;  4C8K A;  4LF8 K;  2HHS A;  5LJW A;  2GWJ A;  4ID5 A;  3LDO A;  1LAW A;  4FVM A;  4JN4 A;  2D0C A;  1WAF A;  3OBW A;  1NK6 A;  1XQS C;  4KHN A;  4NYN A;  2QXL A;  1NKB A;  4M3X A;  4K43 A;  1OH6 A;  1C1C A;  1ZBF A;  1J9A A;  3OJS A;  4BRH A;  3SJH A;  3SBT A;  3I0R A;  1WBD A;  5J2P A;  1RBU A;  4CHN A;  1HQE A;  3OYM A;  2GEL A;  2G8F A;  3CCR N;  3GOI A;  4KHW A;  4Y1C A;  1SL2 A;  5AZI A;  4M3Y A;  2GUP A;  2E4L A;  3P39 A;  3NFA A;  3KK2 A;  5KGW A;  4FWM A;  4BRN A;  2E2N A;  5KGX A;  3CPE A;  1NK5 A;  2PFU A;  3AVN A;  4JI3 K;  5KPR A;  2GWK A;  3KWG A;  4QS7 A;  3SPY A;  2OTL N;  4CZL A;  1UWB A;  4NYF A;  3V1Q A;  1LCU A;  2P9K A;  2E1Z A;  4KO0 A;  1TKT A;  4K8X A;  5AQV A;  4CI6 A;  4G9Z A;  1KLM A;  2YHX A;  4JKA A;  2P5G A;  4L8R B;  3ZSX A;  3WXI A;  1WUA A;  1J5O A;  3KKS A;  3I8D A;  4FXD A;  4CK3 A;  5CR4 A;  4UY8 O;  1YXQ A;  4M7Y A;  4R79 A;  1BGX T;  3CC4 N;  4FWS A;  4PKI A;  1D8Y A;  3KJV A;  1IG9 A;  1EWQ A;  4CGG A;  1G15 A;  3HOT A;  3B6P A;  3ITH A;  3L3V A;  4DCH A;  1XUP O;  4W5T A;  3SQ1 A;  2I7N A;  2F9W A;  4FWR A;  4CD3 A;  4RW8 A;  5AQH A;  2Z1G A;  4E19 A;  2CGJ A;  3TWH A;  4CJL A;  5C0Y A;  3HPG A;  2QXF A;  3RRG A;  3ZYY X;  5AQI A;  4OLB A;  4B1V A;  4DSI A;  1A5W A;  3NH1 A;  3MXJ A;  4H4M A;  4DB3 A;  3HYF A;  1GLB G;  2OPR A;  2HF3 A;  3A5O C;  1NJX A;  3U3Y A;  4H0V B;  4CZK A;  1BCM A;  2EX3 A;  1YVU A;  4X66 K;  2P9S A;  1Q81 O;  3TU5 A;  2JLE A;  2WON A;  1JKH A;  2ETJ A;  3RTV A;  4DQP A;  2P1J A;  1REV A;  1RDW X;  3ZSV A;  1CZA N;  4CFC A;  3OYA A;  1ATR A;  3G6E N;  4E7K A;  4FW1 A;  3V9U A;  5FRO A;  5IWA K;  1KSP A;  2ZQB A;  4DMN A;  1TVR A;  2ZF5 O;  4IEI A;  4CD1 A;  1R0A A;  1YJW N;  1UAX A;  2FC0 A;  5CYQ A;  2GBZ A;  1HKB A;  2UUA K;  4F8R A;  4DTO A;  5CZ2 A;  2OYQ A;  4HTU A;  3IAY A;  3U9Z A;  1HUX A;  3OYN A;  5AJ3 K;  1ZXO A;  4IG0 A;  4DSL A;  4H5N A;  2OZS A;  3MX2 A;  1B9F A;  3VER A;  4IO8 A;  4CJT A;  4E0D A;  4CE9 A;  4E7I A;  1X9S A;  3UIQ A;  3VEZ A;  4J8F A;  4FK4 A;  1VAZ A;  2RKI A;  3BGR A;  2O8C B;  2O8F B;  3F9K A;  3D2F A;  1YVN A;  4B08 A;  2BE2 A;  3ZEU B;  3K5N A;  1W0H A;  2XY7 A;  2B4J A;  3VF2 A;  3MK6 A;  5AQY A;  3G10 A;  3CJ7 A;  5C24 A;  3V9Z A;  3V4I A;  1NBW A;  5KPZ A;  4KBO A;  5JLH A;  1VQ6 N;  4GV6 A;  1RBR A;  4DR2 K;  2ZJP L;  4CZI A;  4FWN A;  4H0P A;  4CJQ A;  1K6Y A;  3FZM A;  5ADX H;  3HBT A;  5AQP A;  5DMR A;  2UXB K;  3CYM A;  3QML A;  4O5B A;  3KK3 A;  1V4T A;  4FWP A;  4XEI A;  3CCV N;  3L2Q A;  1LW0 A;  1U2V B;  2VYP A;  3VGK A;  4BY9 C;  1RGI A;  4ELT A;  3EO3 A;  1BU6 O;  4YOW A;  4DTP A;  3NE6 A;  4I7F A;  2O8C A;  4X62 K;  1NNE A;  4BRK A;  2O8F A;  4ELV A;  3ZEU A;  1ILY A;  1SKS A;  1JLE A;  4JD2 B;  4DV2 K;  1S1V A;  4PWD A;  4E1M A;  4OKJ A;  3LL3 A;  1J54 A;  4JI6 K;  3T1A A;  3O8M A;  3ZX0 A;  3THX A;  3THY B;  4A5A A;  3TAF A;  3A0I X;  4BR0 A;  4OPA A;  4BVO A;  3CCM N;  2HBM A;  4ISE A;  3F73 A;  1A5X A;  4GVM A;  3O9S A;  3KD1 E;  4KB0 A;  3K5M A;  1L3U A;  3SJJ A;  3G4S N;  3AA4 A;  3MEC A;  3FFK B;  4KAZ A;  3FZF A;  1VSJ A;  2FBX A;  3THV A;  2VCP A;  1KXP A;  1M90 O;  1GLL O;  4Z4E A;  1OVQ A;  2QM1 A;  1EQY A;  2P51 A;  3C0B A;  4JD2 A;  5M1Q A;  5B8H A;  1YUW A;  3D2E B;  3CPW M;  1YTU A;  1VQ7 N;  4AHS A;  2YX6 A;  3CG7 A;  3CC7 N;  5AQZ A;  4B3O A;  2A3Z A;  4OKE A;  3THY A;  3OYJ A;  3AO2 A;  4OGC A;  4F3T A;  3VQD A;  4F2S A;  4KH6 A;  2QKB A;  3H45 C;  5FPM A;  3GG4 A;  3NF8 A;  1GOB A;  3PIO L;  5HP1 A;  4KHP K;  4JEP A;  4I2P A;  1ZC6 A;  4NLC A;  4FJG A;  2YNG A;  3EY1 A;  1HQU A;  3R9P A;  3SMS A;  2P9L B;  3ISN C;  3SAG A;  4H0X B;  1RBS A;  4FW2 A;  3R8E A;  3O3G A;  1JJ2 M;  1OH5 A;  4Y1D A;  3G25 A;  3M3Z A;  1HNW K;  4BRL A;  1YHQ N;  4B3R K;  3C6U A;  4RW6 A;  4HUF A;  4KKO A;  4LF4 K;  4DSF A;  1VSL A;  3ALY A;  1HKC A;  2A1S A;  1SV5 A;  4QS9 A;  3LWM A;  3C6T A;  4DV4 K;  2D0A A;  2GEM A;  5KQ8 A;  4BRF A;  4HHT A;  2QW9 A;  3T3F A;  3ASM A;  3O4W A;  3T1Y K;  4W5N A;  4IFE A;  3AAQ A;  3K59 A;  2HND A;  3FE1 A;  2ASO A;  2DFF A;  4GV9 A;  3O9T A;  2HBJ A;  4E7J A;  3BF3 A;  3LPT A;  1JLF A;  2E6M A;  4Y0W A;  3QEW A;  2P9L A;  5AQX A;  3S41 A;  3MDQ A;  3K2P A;  4DLG A;  4BC3 A;  1QVG M;  3OYG A;  1RNH A;  1NGC A;  1TYQ B;  4E89 A;  2HW3 A;  1BA0 A;  4YOY A;  4XH4 A;  2ZE2 A;  1WLJ A;  5CY4 A;  2QWL A;  4JKD A;  1KRP A;  1FXX A;  1EKE A;  4EHU A;  2X74 A;  2A6A A;  4N41 A;  4BRA A;  1K8A O;  3KWI A;  3HZ6 A;  2YV0 X;  3RMA A;  4OPK A;  2E8A A;  2QWP A;  1I3A A;  4FOI A;  5M1N A;  3LWL A;  1O13 A;  3EZW A;  2YHY A;  3CFR A;  1NGF A;  3HTV A;  3MN9 A;  4A62 A;  5BPM A;  2D5R A;  4JK8 A;  2BTF A;  4CJU A;  3ZET B;  2V7Y A;  3LZJ A;  2HBL A;  1FKO A;  4CED A;  4OPH A;  3QEI A;  4CIG A;  4CW7 B;  5AQK A;  2ZGY A;  3RSE B;  2VG7 A;  4XIU A;  3OS1 A;  1DTT A;  1ASW A;  2D0P A;  3VQ5 A;  1YTA A;  4BR7 A;  3B6O A;  4JKB A;  1L3V A;  3UKR B;  2QWQ A;  4YOU A;  3NMU A;  4CF9 A;  3IDH A;  4CCH A;  1Z6R A;  3QNN A;  4BE2 A;  1TL1 A;  3AVF A;  3O4N A;  5BN8 A;  4KV8 A;  1NOZ A;  4GV3 A;  4M63 C;  3MEE A;  4E1J A;  3KLG A;  3CHW A;  4CJW A;  1SKR A;  3BDP A;  3L6Q A;  5TKY A;  3OTO K;  5F0X A;  2F96 A;  3OYC A;  3CM6 A;  4JI5 K;  3TR8 A;  4DHY A;  1BQN A;  1C0F A;  1RDA A;  3TAN A;  2KZZ A;  3OYD A;  3OYE A;  3CER A;  4DFM A;  4MLH A;  3DLB A;  4KPY A;  3O1B A;  3RSE A;  1N32 K;  3D7E O;  5IT9 O;  4BR4 A;  1QQM A;  4B9U A;  3UKR A;  1NJZ A;  4JLH A;  4DG1 A;  3PV8 A;  3HJF A;  1IH7 A;  1TKZ A;  4PL8 A;  1NGE A;  3IFR A;  5FLX O;  5HRP A;  4BDY A;  3J7Z O;  3QIC A;  2Q3S A;  5DM6 L;  4H0T B;  4LC9 B;  1VQK N;  1BL3 A;  1TK5 A;  2RN2 A;  2VG5 A;  3U4L A;  2OZM A;  4N5S A;  1VK0 A;  5D3G A;  3P1G A;  2VWB A;  4DFP A;  3QLH A;  3TPQ A;  1TK0 A;  1VQM N;  2QWR A;  3FZL A;  3MWT A;  1QSY A;  3ZSO A;  1XHX A;  1SZ2 A;  3DAW A;  4DTM A;  1IBK K;  5BRH A;  2UYT A;  4OPJ A;  4I6M B;  4JHD A;  1TKD A;  1YT3 A;  3UKU A;  3EKU A;  1KQS M;  3V1O A;  1J6Z A;  2ITM A;  3CCS N;  2A1R A;  2FBV A;  4CEE A;  3DRP A;  3AAR A;  4XH5 A;  3VQ4 A;  3NCI A;  4GW6 A;  3ATU A;  2G8V A;  2KFZ A;  3QES A;  1S5J A;  4CIE A;  2E2P A;  2W6K A;  4CEQ A;  1RBV A;  4CHZ A;  4KI4 A;  4AH9 A;  4LSL A;  4Q5V A;  1JLQ A;  4WFB L;  3D0P A;  4QS8 A;  2FF3 B;  2KHO A;  4CEO A;  3CCQ N;  3SV3 A;  3GE1 A;  3ID8 A;  3CQY A;  4OGE A;  2KLA A;  1JLB A;  2Q36 A;  5AZI B;  2WUS A;  4IFV A;  2QEX N;  1G99 A;  3CCJ N;  1FKP A;  2OPQ A;  4FVU A;  4J2D A;  4BC4 A;  1IV0 A;  5BRD A;  5KRT A;  3QBX A;  2HHU A;  3U9D A;  3HRG A;  3AGK A;  3ZT1 A;  5J2M A;  1XI1 A;  1QZ5 A;  4BWJ A;  3Q7C A;  3D6R A;  5T7B A;  3L0Q A;  5HRS A;  4PQU A;  5BRE A;  2HHH K;  1QVF M;  3HSC A;  5FPD A;  3MN7 A;  2O4G A;  3HL8 A;  2P9K B;  4BR9 A;  4CHP A;  3MMV A;  1N36 K;  2Q0U A;  3M5R A;  2YNH A;  2Z1J A;  3L2W A;  4CJ3 A;  3AV9 A;  2ASM A;  1VSI A;  2W6L A;  1EWR A;  4JKH A;  4OJR A;  5AQN A;  3CFP A;  4FJ9 A;  1ZBL A;  4YDU C;  2NRW A;  2YJF A;  4CF2 A;  1VSK A;  3WQT A;  3HP6 A;  3JSM A;  3ATV A;  2E1Y A;  1CLQ A;  1OKJ A;  4FJ7 A;  4GKK K;  3TAP A;  2FLO A;  1IKY A;  4CFD A;  1L5U A;  3DJC A;  3T7Z A;  1VQ5 N;  4BRD A;  4OKK A;  4J2B A;  2DTU A;  3IRX A;  1QHT A;  4JI2 K;  1I39 A;  4JS4 A;  4GVE A;  4FJN A;  3MN5 A;  1VSE A;  4DQQ A;  5H1S Q;  4HUG A;  1BG3 A;  4YNQ A;  2W40 A;  1Q9Y A;  1X9M A;  2P9N B;  3GDQ A;  4DQ8 A;  3VQP A;  4BRE A;  5AQR A;  4FLV A;  1L3T A;  3TTF A;  4KB1 A;  3A2F A;  4ISF A;  2E6L A;  4CK1 A;  1C0G A;  4CGJ A;  4IKF A;  2JWK A;  2P9S B;  4DSK A;  2HMI A;  2YHW A;  3ENB A;  3OA9 A;  1WSI A;  4CIF A;  3QB0 A;  3WXL A;  4KFB A;  4J2A A;  3VF6 A;  1JCF A;  1HJR A;  3NF9 A;  1MA9 B;  5J1E A;  3ENH A;  4FLW A;  1N6Q A;  4IO9 L;  3BUZ B;  4L3Q A;  3PSI A;  1ZYQ A;  5JS2 A;  1C1B A;  4DR1 K;  3BZC A;  5AQG A;  3VET A;  3TAE A;  2VWJ A;  3NDK A;  3NAE A;  4FJJ A;  2NUB A;  4B3S K;  4BRG A;  4NCG A;  2Q31 A;  3L3U A;  5GIP A;  2KQ2 A;  4MLE A;  1VSD A;  1DEJ A;  4BG9 A;  4GMJ B;  3M8P A;  2VGN A;  1VQ4 N;  2P9N A;  3VTH A;  1UA0 A;  4BGA A;  1TAU A;  2VGM A;  3D2F B;  3PX4 A;  2E5L K;  2XO7 A;  3AVC A;  4A57 A;  1P8Z A;  4CJV A;  4DV6 K;  3C95 A;  3AVH A;  1S6Q A;  3VN5 A;  1U04 A;  4IXC A;  4JI8 K;  2OA8 A;  3ULE B;  4KRE A;  1KC8 O;  4HVJ A;  4Z94 A;  5EY4 A;  4H4O A;  3E9L A;  4CHO A;  1S9E A;  1VRT A;  1JLG A;  2E2Q A;  3NF7 A;  3OYL A;  2D1K A;  4KHY A;  3K58 A;  4RTF D;  3VA3 A;  4FWL A;  3ZX3 A;  3DOK A;  3QER A;  3HK2 A;  4JI0 K;  3H3N O;  3P31 A;  3O9R A;  4EZ6 A;  3AVJ A;  2PYL A;  3SPZ A;  4BWM A;  5HOO A;  1WN7 A;  5HRR A;  1DT9 A;  1HNZ K;  3AGR A;  1ESV A;  3CXC M;  3VEY A;  1JXB A;  5BR8 K;  2X6S A;  4JI4 K;  4JV5 K;  2G8K A;  2XRI A;  4E1N A;  1DTQ A;  1EP4 A;  5F1X A;  4IOC L;  1KFS A;  4IWV A;  3KKR A;  4WE1 A;  4CBX A;  3ULE A;  1GOC A;  3D45 A;  2PYJ A;  3ID6 A;  4BRI A;  1T6D A;  4CER A;  5CHI A;  3A5M C;  3OS2 A;  1ITG A;  3AVG A;  1RT4 A;  1T6C A;  3THX B;  2XY5 A;  3J80 O;  4B3T K;  1HYV A;  3AY9 A;  3KIO A;  1IJJ A;  2O8E A;  1NG9 A;  1V4S A;  4CJR A;  4CJE A;  5JS1 A;  5TKW A;  4U67 L;  4H5R A;  2HHT A;  3F2K A;  3ZT4 A;  1LV5 A;  3VTI A;  1BCO A;  3MXM A;  3DLG A;  4DU3 A;  4A2B A;  1NU0 A;  4JS5 A;  4C1N I;  2R7Y A;  5KRS A;  5E26 A;  3LP3 A;  3MCA B;  5AQJ A;  4AM6 A;  3CI5 A;  3PX6 A;  3UB5 A;  2YHA A;  3LAL A;  3VEO A;  3LP2 A;  3H08 A;  4A2A A;  1Q7Y O;  1LOT B;  1MDU B;  2YNI A;  4ICL A;  1JLA A;  4OVL A;  3VEN A;  3ZLJ A;  2HB5 A;  1SL0 A;  3T19 A;  4CGH A;  4BRP A;  4DTX A;  3AAP A;  3HST B;  3OYB A;  5AQO A;  5EX5 A;  2DPN A;  5BR9 A;  1LWE A;  5J2N A;  1NJY A;  4LF9 K;  2HVH A;  4FPA A;  1CXU A;  3ZT2 A;  4BQL A;  3CFO A;  1ZBS A;  4DR4 K;  4WYB A;  1RCH A;  3FLC O;  1NMN A;  2OCE A;  5AQQ A;  5GAD P;  3A5N C;  1C1A A;  1LW2 A;  1WBB A;  4M3R A;  1E3M A;  4FWQ A;  2FXU A;  3PO5 A;  5EU7 A;  4CF0 A;  2HVI A;  3JXU A;  3ZSZ A;  4DFJ A;  1WNS A;  5C12 A;  1GLD G;  3V9X A;  1KFD A;  3PLA A;  3PX0 A;  4IFY A;  3OYF A;  2FF6 A;  3CJ9 A;  2WBN A;  3EN9 A;  4FM2 A;  2LSN A;  3H1Q A;  3V6D A;  4OX9 K;  1W97 L;  1ASV A;  4CEZ A;  4FZZ A;  2YKM A;  3A8Y A;  3PO4 A;  4EP4 A;  1UOC A;  3WXK A;  1RT3 A;  1JL2 A;  3E01 A;  1SS6 A;  1KVB A;  2OPP A;  4DTN A;  3VPZ A;  3PUF A;  2NRR A;  1NKC A;  2KKZ A;  2A40 A;  4FLY A;  1MWK A;  4FJM A;  3TSP A;  5JMV A;  4O0I A;  4AQY K;  1RT6 A;  3SAF A;  4PA1 A;  3I56 N;  3TAM A;  3VA0 A;  3L4Q A;  3H6E A;  4A61 A;  4J2E A;  3VQB A;  4JRQ A;  3PSF A;  5M1P A;  2YI1 A;  3BZK A;  3VES A;  5A2Q O;  3M8S A;  1S6P A;  3ZCM A;  3EZ5 A;  4H5T A;  1RT1 A;  4DV3 K;  4DLE A;  1C6V A;  4EZ9 A;  3EEQ A;  1VHX A;  2QWM A;  5KQD A;  1OVY A;  5KPT A;  5LJV A;  1NLV A;  4CK2 A;  4BRC A;  1BHL A;  5DM7 L;  1WB9 A;  3KHY A;  4R5P A;  3DXM B;  3O3F A;  3IUC A;  3DLL L;  1C0T A;  2DFH A;  5AQF A;  1BI4 B;  5M1F A;  3KLI A;  1S72 N;  3I8B A;  3NVK A;  1YF5 L;  4QAG A;  2RHK A;  4HCC A;  1LWC A;  4O55 A;  3ULD A;  1GLA G;  3O80 A;  3KVG A;  4O44 A;  2UXC K;  4DWI A;  5I9E B;  4KTZ A;  1NGJ A;  3TI0 A;  1TKX A;  1IO2 A;  1QSL A;  1DKG D;  3S3M A;  3CMA N;  1WSJ A;  1N5Y A;  1KAZ A;  1LAV A;  3C6H A;  3CJA A;  4QOZ B;  4M3U A;  3DXM A;  3IG1 A;  4B9M A;  4GY2 B;  1Z25 A;  1Y97 A;  3P38 A;  4FWK A;  5K14 A;  1J5E K;  2ZJQ L;  4JKE A;  1VQL N;  4WQ5 C;  1BI4 A;  5C2D A;  5M1K A;  3L2V A;  4K0K K;  1NGI A;  1XC3 A;  3WNH A;  3HM9 A;  1Q86 O;  3CJC A;  4ZTF A;  1HX1 A;  1XC9 A;  3U8X A;  2NRZ A;  4H8K A;  4CZJ A;  4BDZ A;  4AHT A;  4FLZ A;  1NKE A;  5LY3 A;  1WOQ A;  2OAN A;  3RR8 A;  5BN9 A;  3KLH A;  4M3T A;  3QEX A;  3TAG A;  1OH8 A;  1TL3 A;  4MO4 A;  3AVI A;  2F8S A;  1BOT O;  4Z0U A;  4AF1 A;  4AHR A;  1NGB A;  4CEA A;  4PL7 A;  2FBT A;  2O4I A;  1I94 K;  3O4Q A;  2HHQ A;  4FM1 A;  2F9T A;  4DUY K;  2CGK A;  1IBM K;  3SV4 A;  4CHQ A;  3SQ4 A;  5CE3 A;  2D0O A;  1X3M A;  3SQ0 A;  1S9G A;  3P83 D;  4RW9 A;  1HNX K;  3OVN A;  2B6A A;  5GIO A;  4KH4 A;  3WNE A;  1ASU A;  2BGG A;  4M45 A;  3NHG A;  4DS4 A;  1YIT N;  2UU9 K;  1L3S A;  4KRF A;  5BPL A;  2P9U A;  1BWF O;  3CJB A;  1EX4 A;  3HM8 A;  4JHD B;  4NCB A;  1YAG A;  4M41 A;  3HT3 A;  3VGM A;  3T69 A;  4QCL A;  5FPN A;  3UKU B;  2HHW A;  4CGI A;  5LMN K;  5J2Q A;  4ZTJ A;  4B1W B;  3B8A X;  3LM9 A;  4YDU A;  4GNI A;  2YNF A;  3TTC A;  4B9Q A;  3LAK A;  4G1Q A;  3P4I A;  4IEE A;  1VRU A;  3DXK B;  1W7A A;  1H1V A;  3EYZ A;  2AA4 A;  5CYM A;  4FSV A;  3NBP A;  1WSG A;  4M7X A;  3S9H A;  4DQI A;  4WCE L;  1S1T A;  4W5O A;  5LL6 Z;  4BG8 A;  2P5O A;  3VGL A;  3H1V X;  4AM7 A;  4M3Z A;  5AQW A;  1EET A;  3NH0 A;  5F2R A;  3FZK A;  4B8C A;  3RMD A;  1Q9X A;  3NVM A;  4DTS A;  5EOY A;  4FO0 A;  1TV6 A;  2Y1I A;  3WEE B;  1NGG A;  2VG6 A;  5C42 A;  3LAM A;  5JVH L;  1NMD A;  2Q97 A;  3DWL A;  4C8M A;  4DR6 K;  1P90 A;  4PHT X;  3TSU A;  3J81 O;  4NCA A;  3O1W A;  1U4B A;  4C8N A;  3HPH A;  3MED A;  2HBK A;  3H3O B;  3SUO A;  5JVG L;  3DLR A;  5AFU A;  3C6A A;  4CZH A;  2ZJR L;  3HPO A;  1F21 A;  4H0O A;  2P9I B;  3CET A;  3DXK A;  3WXJ A;  4DQS A;  4YHH K;  2IVN A;  4B1X B;  4H0Y B;  5CZ1 A;  3LAN A;  4I9Q A;  3WUH A;  5C2F A;  3AA2 A;  4AHC A;  2P9P A;  1NWK A;  1RTJ A;  4W5R A;  4CEC A;  3F5T A;  4H5V A;  5E41 A;  1SQK A;  1N8R O;  3EKS A;  1YJN N;  4CBU A;  4LD0 A;  4BVP A;  2BAN A;  3CQ8 A;  1HRH A;  3R3L A;  4CZE A;  1U48 A;  4KI6 A;  3K5O A;  4ILJ A;  4N47 A;  3AO1 A;  3WEE A;  4FWO A;  4MQ3 A;  3SBG A;  2E20 A;  1LWF A;  3G0Z A;  1N33 K;  3CQX A;  4KHU A;  4FLT A;  1SAZ A;  3ZSR A;  3O3H A;  4DF4 A;  5E84 A; 
#chains in the Genus database with same CATH homology
 1KXP A;  1M90 O;  3ULE B;  1GLL O;  3VEW A;  4C23 A;  2IVP A;  1K73 O;  2QM1 A;  5BPN A;  1KC8 O;  1GLJ O;  1EQY A;  4MDA A;  4Z94 A;  5EY4 A;  3RVC A;  2J4R A;  3C0B A;  4JD2 A;  3E9L A;  4MDB A;  5M1Q A;  4BR5 A;  2P9I A;  5B8H A;  4WFN L;  1YUW A;  3D2E B;  1JCG A;  2RE2 A;  2E2Q A;  1TYQ A;  3CPW M;  2D1K A;  4BC5 A;  2PAV A;  4O8K A;  1VQ7 N;  4RTF D;  2D4W A;  2QWN A;  2YX6 A;  4FWL A;  3GL1 A;  3ZX3 A;  3CC7 N;  5AZJ A;  2FSJ A;  5AQZ A;  1QZ6 A;  2A3Z A;  3H3N O;  3TTD A;  4EHT A;  2FSK A;  1K9M O;  3K9J A;  3O9R A;  3P31 A;  2Q2R A;  4HTL A;  2NRT A;  3FZH A;  4KH6 A;  2NRX A;  3H45 C;  5FPM A;  1ATN A;  3GG4 A;  1TUU A;  2YCH A;  5HOO A;  5GAG P;  1DT9 A;  2Q1N A;  4KH5 A;  1YIJ N;  3PIO L;  3AGR A;  4BC2 A;  4CZM A;  3C65 A;  1Q18 A;  4JEP A;  1ESV A;  1VQ8 N;  3JS6 A;  1ZC6 A;  3CXC M;  4NLC A;  3VEY A;  3CME N;  3QFP A;  3R9P A;  1DGK N;  3SMS A;  4RWT A;  3FR0 A;  2P9L B;  1S22 A;  4WQ4 A;  3GBT A;  3Q7B A;  3SAG A;  4H0X B;  5F1X A;  4IOC L;  3R8E A;  3O9Q A;  1BUP A;  1JJ2 M;  4IWV A;  3E66 A;  4CBX A;  2P9P B;  3ULE A;  1BO5 O;  1KAX A;  3G25 A;  3ID6 A;  3M3Z A;  4BRI A;  3ZET A;  1T6D A;  4BRL A;  1YHQ N;  4BQZ A;  3OW2 M;  5CHI A;  3LM2 A;  3O08 A;  3A5M C;  2IVO A;  5HL7 L;  3SK3 A;  1T6C A;  3O6W A;  1HKC A;  2F7T A;  4JKF A;  2CH6 A;  4QS9 A;  3AY9 A;  1IJJ A;  4HWI A;  3VMF B;  1V4S A;  3BF1 A;  2PBD A;  5TKW A;  2GEM A;  3CCL N;  2FSN A;  5KQ8 A;  4U67 L;  4IJA A;  4H5R A;  4BRF A;  5GAH P;  2QW9 A;  3VEX A;  3F2K A;  3N4Q A;  3O4W A;  3CD6 N;  3VTI A;  1BDG A;  4IFE A;  3VF4 A;  3AAQ A;  4CZG A;  4IOA L;  2I7P A;  4A2B A;  4C1N I;  3FE1 A;  1KD1 O;  5E26 A;  2ASO A;  1NGA A;  3HI0 A;  3W3D A;  5BRF A;  4GV9 A;  3O9T A;  1R59 O;  2HBJ A;  3O5B A;  3J8A A;  3MCA B;  5AQJ A;  4AM6 A;  3BF3 A;  3CI5 A;  4B1U B;  3UB5 A;  2QI2 A;  4ILG B;  4Y0W A;  5AQU A;  3BP8 A;  3VEO A;  1YJ9 N;  2P9L A;  2HMP A;  5AQM A;  3KZB A;  5AQX A;  3MDQ A;  1LOT B;  4NB4 A;  3S41 A;  4A2A A;  1Q7Y O;  1QVG M;  4BC3 A;  1D4X A;  1MDU B;  3OHR A;  4H03 B;  1NGC A;  1TYQ B;  4U7B A;  1BA0 A;  1TUY A;  3VEN A;  4YOY A;  1S3X A;  4XH4 A;  4A59 A;  3ENO A;  3BEX A;  3TSQ A;  5FPE A;  4BRP A;  3AAP A;  1GLE G;  3EE8 A;  1QQO A;  5C15 A;  5AQO A;  5EX5 A;  2DPN A;  5BR9 A;  2QWL A;  4JKD A;  5ADX A;  2E88 A;  4FPA A;  4BQL A;  4EHU A;  1ZBS A;  1VQN N;  5EVZ A;  4WYB A;  3FLC O;  2A6A A;  3M6G A;  4BRQ A;  4BRA A;  4DKW A;  3KWI A;  1NGD A;  4ISG A;  5GIN A;  1K8A O;  5AQQ A;  3HZ6 A;  3F9M A;  4EAH D;  1U6Z A;  2JWL A;  5GAD P;  4H5W A;  3A5N C;  2E8A A;  2QWP A;  2OTJ N;  4FOI A;  5M1N A;  3MX5 A;  3MCP A;  4O8U A;  1O13 A;  3QDK A;  3EZW A;  4MO5 A;  4FWQ A;  4A5B A;  4WF9 L;  2FXU A;  2YHY A;  4ILH A;  1NGF A;  3HTV A;  3JXU A;  3MN9 A;  3MWP A;  4A62 A;  4BGB A;  5BPM A;  2ZGZ A;  2W41 A;  1W2B M;  5C12 A;  5AQT A;  1GLD G;  3I55 N;  1X9J A;  2BTF A;  4JK8 A;  3ZET B;  2A41 A;  2BUP A;  3PLA A;  3IMX A;  2V7Y A;  2HBL A;  3CCU N;  2FF6 A;  3CJ9 A;  2WBN A;  3EN9 A;  3H1Q A;  4OPH A;  1W97 L;  4IXC A;  2EWS A;  5AQK A;  1Z05 A;  2ZGY A;  3RSE B;  3A8Y A;  4JAX A;  1MWM A;  2V51 B;  5MLC Q;  2D0P A;  4I6M A;  4JK9 A;  4EFH A;  1RDU A;  2NZT A;  4JKB A;  4BR7 A;  3WXK A;  3UKR B;  3I33 A;  5C10 A;  2QWQ A;  4YOU A;  1Q82 O;  2GX9 A;  3NMU A;  3E1Y A;  1SS6 A;  3IDH A;  3VPZ A;  4JNE A;  3WXM B;  1Z6R A;  2NRR A;  1KAY A;  1RFQ A;  1VQP N;  5LJW A;  2KKZ A;  2GWJ A;  3LDO A;  2A40 A;  4CBW A;  4PKH A;  4JN4 A;  5AQS A;  5BN8 A;  3OBW A;  1XQS C;  2QXL A;  1MWK A;  2HOE A;  4GV3 A;  4M63 C;  3TSP A;  4E1J A;  4K43 A;  3R1X A;  5JMV A;  1GLF O;  3CHW A;  3L6Q A;  4WQ4 C;  5TKY A;  3SAF A;  4BRH A;  2NRV A;  3I56 N;  1ATS A;  3SJH A;  3L4Q A;  5F0X A;  3H6E A;  3QFU A;  3C7N B;  3M1F A;  3SBT A;  4A61 A;  4DHY A;  4FOE A;  5M1P A;  2YI1 A;  3VES A;  1C0F A;  3CCE N;  3CER A;  4H5T A;  4MLH A;  4YOR A;  3N4P A;  5AFU H;  4FPB A;  2GEL A;  3O1B A;  3CCR N;  2QWM A;  3GOI A;  5KQD A;  1OVY A;  5KPT A;  5LJV A;  3RSE A;  1NLV A;  3D7E O;  4BRC A;  3W0L A;  5DM7 L;  4BR4 A;  1QQM A;  3KHY A;  5AZI A;  3UKR A;  2GUP A;  3DXM B;  4JKG B;  2CH5 A;  3P39 A;  3CF5 L;  1IG8 A;  5ELZ A;  2NLX A;  4CZF A;  3LDN A;  1VQ9 N;  3IUC A;  3DLL L;  4PL8 A;  1NGE A;  3IFR A;  1NM1 A;  5EXW A;  4BRO A;  5AQF A;  3J7Z O;  4JK7 A;  4FWM A;  3QIC A;  3EE9 A;  2BH1 A;  2E2N A;  4BRN A;  4YOT A;  5M1F A;  3CPE A;  5DM6 L;  4H0T B;  4K42 A;  2PFU A;  1S72 N;  4LC9 B;  1VQK N;  3I8B A;  4B1Y B;  5KPR A;  1YF5 L;  2GWK A;  5JLF A;  3NVK A;  2RHK A;  3U4L A;  2ASP A;  2ZWH A;  2HF4 A;  2VWB A;  3KWG A;  2NNW A;  3FGU A;  4JKC A;  4QS7 A;  3TPQ A;  3LDQ A;  2V7Z A;  1GLA G;  1VQM N;  2OTL N;  2QWR A;  3O80 A;  3FZL A;  4CZL A;  4XH1 A;  3C7N A;  3KVG A;  3MWT A;  1LCU A;  2P9K A;  2E1Z A;  1GLC G;  1SZ2 A;  1NGH A;  3DAW A;  5AQV A;  4CI6 A;  2UYT A;  3WQU A;  5BRH A;  4G9Z A;  1QQN A;  2YHX A;  4I6M B;  5I9E B;  1NGJ A;  4JHD A;  4JKA A;  3WXI A;  1WUA A;  1VQO N;  3UKU A;  3EKU A;  1DKG D;  1KQS M;  5CR4 A;  4UY8 O;  4YOX A;  1YXQ A;  4M7Y A;  3SLC A;  4R79 A;  3CMA N;  3H46 O;  3CC4 N;  1J6Z A;  4FWS A;  1KAZ A;  4PKI A;  3C6H A;  3CJA A;  3MN6 A;  2ITM A;  3CCS N;  3AAR A;  2QTD A;  3L4I A;  4XH5 A;  3ZX2 A;  3ATU A;  3HOT A;  3DXM A;  5AQL A;  4JKG A;  3SMP A;  5M1O A;  5GAE P;  4GY2 B;  3P38 A;  4FWK A;  2E2P A;  4DCH A;  1XUP O;  1VQL N;  2ZJQ L;  4JKE A;  4WQ5 C;  2I7N A;  2F9W A;  4WQ5 A;  5C2D A;  4FWR A;  5M1K A;  4C1N K;  4CD3 A;  2Q0R A;  1T3V A;  1NGI A;  5AQH A;  1XC3 A;  2CGJ A;  1Q86 O;  3E9O A;  5C0Y A;  3CJC A;  1HX1 A;  2A5X A;  3U8X A;  2NRZ A;  3ZYY X;  4CZJ A;  5AQI A;  4WFB L;  4QS8 A;  4B1V A;  2FF3 B;  5LY3 A;  1WOQ A;  2OAN A;  3HOS A;  2KHO A;  5BN9 A;  1QHA A;  3CCQ N;  4DB3 A;  2A42 A;  1GLB G;  4BY9 C;  2HF3 A;  3GE1 A;  3A5O C;  3ID8 A;  4O5F A;  4H0V B;  3CQY A;  2WC9 A;  1U2V A;  4CZK A;  2KLA A;  4MO4 A;  1BOT O;  1T44 A;  2Q36 A;  4AF1 A;  5AZI B;  2WUS A;  4B1Z A;  2QEX N;  2HST A;  2P9S A;  1Q81 O;  3TU5 A;  3G71 N;  1NGB A;  1G99 A;  3CCJ N;  4PL7 A;  4FVU A;  4BC4 A;  1RDW X;  2F9T A;  3CIP A;  1CZA N;  3SAH A;  1ATR A;  5BRD A;  3G6E N;  2CGK A;  3LDP A;  3QBX A;  3U9D A;  5CE3 A;  2D0O A;  1X3M A;  3HRG A;  3AGK A;  2ZF5 O;  4IEI A;  4K41 A;  3IKM A;  4CD1 A;  1QZ5 A;  3LDL A;  1YJW N;  3Q7C A;  1HKB A;  3D6R A;  4IOX A;  4KH4 A;  5GIO A;  3CJ1 A;  3L0Q A;  5JIC A;  4NLB A;  3VOV A;  3U9Z A;  1HLU A;  5BRE A;  3KK7 A;  4F9O A;  1HUX A;  1QVF M;  3HSC A;  5FPD A;  3MN7 A;  1ZXO A;  4H5N A;  1YIT N;  3MX2 A;  2P9K B;  4BR9 A;  3MMV A;  5BPL A;  2Q0U A;  2P9U A;  3M5R A;  3VER A;  1BWF O;  3CJB A;  2H3G X;  4IO8 A;  3HM8 A;  4EIA A;  4JHD B;  4NO7 A;  2AP1 A;  1YAG A;  3VGM A;  4J8F A;  2ASM A;  3T69 A;  3VEZ A;  5FPN A;  3PIP L;  5AR0 A;  4JKH A;  5AQN A;  1VAZ A;  3UKU B;  1HJO A;  3D2F A;  1YVN A;  4B1W B;  2NRW A;  3B8A X;  2YJF A;  3LM9 A;  4YDU C;  3WQT A;  4YDU A;  3ZEU B;  4GNI A;  3R6M A;  3ATV A;  2E1Y A;  3TTC A;  4B9Q A;  3P4I A;  4IEE A;  3DXK B;  1OKJ A;  1H1V A;  3VF2 A;  2AA4 A;  2IIR A;  3MK6 A;  4FSV A;  3CJ7 A;  5AQY A;  4WFA L;  1NBW A;  2FLO A;  4KBO A;  4M7X A;  5JLH A;  5KPZ A;  4WCE L;  1VQ6 N;  4GV6 A;  4BG8 A;  2ZJP L;  3DJC A;  4CZI A;  3VGL A;  3T7Z A;  4BR2 A;  1VQ5 N;  3H1V X;  4BRD A;  2QA4 N;  1Y64 A;  4FWN A;  3VEV A;  4AM7 A;  5AQW A;  4H0P A;  4OO1 J;  1K8K B;  5F2R A;  3FZK A;  4RCH A;  4YOV A;  3D2E A;  1JCE A;  3FZM A;  3NVM A;  3HBT A;  5ADX H;  5AQP A;  3E9P A;  4GVE A;  5EOY A;  3MN5 A;  3QML A;  4FO0 A;  3UE5 A;  5H1S Q;  1BG3 A;  3WEE B;  1NGG A;  2NRH A;  1V4T A;  5JVH L;  2W40 A;  1NMD A;  2WFB A;  2Q97 A;  1X3N A;  2YJE A;  3DWL A;  4FWP A;  1P90 A;  4PKG A;  2P9N B;  4XEI A;  3TSU A;  3GDQ A;  4DQ8 A;  4PHT X;  3CCV N;  4BRE A;  5AQR A;  3O1W A;  3TTF A;  1U2V B;  4IDH A;  4ISF A;  2VYP A;  3A5L C;  1C0G A;  3VGK A;  3WT0 A;  3EL2 A;  4FL9 A;  1RGI A;  4IJN A;  1BA1 A;  2HBK A;  3H3O B;  3EO3 A;  1BU6 O;  4YOW A;  5JVG L;  1M1K O;  2JWK A;  2P9S B;  5AFU A;  3C6A A;  2YHW A;  3ENB A;  3OA9 A;  4CZH A;  4BRK A;  3QB0 A;  3WXL A;  2ZJR L;  3QBW A;  3ZEU A;  1ILY A;  3VF6 A;  3K9K A;  1JCF A;  4JD2 B;  4H0O A;  4BRM A;  1MA9 B;  2P9I B;  3CET A;  3DXK A;  3WXJ A;  2IVN A;  4B1X B;  3ENH A;  4CJ7 A;  4H0Y B;  1NJI O;  1EO1 A;  4IO9 L;  3BUZ B;  3WUH A;  5C2F A;  4L3Q A;  3OBY A;  2P9P A;  1NWK A;  3LL3 A;  4K25 A;  3F5T A;  4H5V A;  1SQK A;  1E4F T;  2GTD A;  3EKS A;  4IZ9 A;  5AQG A;  3VET A;  1N8R O;  5AZJ B;  4CBU A;  1YJN N;  3O8M A;  3ZX0 A;  4BVP A;  2CGL A;  1K8K A;  3R3L A;  4A5A A;  4CZE A;  4BRG A;  2V52 B;  3CC2 N;  3A0I X;  4ILJ A;  4BR0 A;  1HPM A;  2P9U B;  4OPA A;  2Q31 A;  5GIP A;  4BVO A;  3WEE A;  4FWO A;  3CCM N;  2HBM A;  4ISE A;  1DEJ A;  4MLE A;  3SBG A;  4BG9 A;  2E20 A;  3O9U A;  3O9S A;  2VGN A;  3CQX A;  1VQ4 N;  2P9N A;  3VTH A;  4BGA A;  2VGM A;  3G4S N;  3D2F B;  3FFK B;  4A57 A;  1P8Z A;  3FZF A;  2QWO A;  1SAZ A;  1HKG A;  1E4G T;  2VCP A;  1YI2 N;  5E84 A;  2E2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...