3SLCA

Crystal structure of apo form of acetate kinase (acka) from salmonella typhimurium
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
401
structure length
401
Chain Sequence
HMSSKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVMGTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTEVTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetate kinase
publication title Structural and mechanistic investigations on Salmonella typhimurium acetate kinase (AckA): identification of a putative ligand binding pocket at the dimeric interface
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
total genus 128
structure length 401
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3slcA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3slcA02
5KPRA 4MO5A 3WQUA 4NB4A 2E2OA 1GLDG 4JHDB 5AFUH 3ENHA 4XH4A 4FWKA 4FPAA 3FFKB 1YAGA 2A6AA 4BR4A 3VEWA 2YJEA 4BR0A 4H0YB 2ASOA 4FO0A 2P9SA 5BN9A 5ADXH 3H1QA 2QWNA 4BRQA 1XC3A 2QWOA 1TYQB 1MWKA 1ATRA 3L4IA 4IWVA 1J6ZA 4K25A 5AQXA 1IJJA 2AP1A 3A5OC 4JHDA 5AQSA 4WQ4C 4IJAA 1LCUA 4M7XA 5FPDA 3UKRB 1ATSA 1NGFA 2E1ZA 2IIRA 4CZHA 2IVOA 3GBTA 3AAQA 4AM6A 3QICA 2VCPA 2GEMA 2FLOA 3LDLA 4BVPA 2NZTA 5BPMA 2P9UB 5KPTA 4BR7A 1RGIA 2A40A 3CJ9A 3UKUB 1G99A 2CGKA 3R8EA 3A0IX 2ZWHA 2YHYA 1NGHA 2FSJA 2QWMA 4H5NA 1CZAN 2YCHA 5BPLA 4CZMA 3HZ6A 3QBXA 4C23A 3UKRA 1V4SA 2Q2RA 3D2FB 4B1XB 1NGDA 3FGUA 1U6ZA 2HF4A 2GTDA 3ATVA 2P9UA 3C0BA 4EHUA 3CJCA 4FWOA 4K42A 4MLEA 3VEOA 3CJ7A 4RWTA 3CIPA 1H1VA 1HX1A 4PKHA 4H0TB 3UKUA 4CZLA 5AQUA 1NLVA 2YHXA 2CGLA 1QZ6A 4M63C 3O1WA 4BRGA 1ZXOA 2UYTA 1LOTB 1DGKN 2WUSA 4CJ7A 1NGEA 5BRHA 3O80A 3BUZB 4EIAA 4H5RA 5AQRA 3AAPA 1T6CA 3DXKB 4FOEA 5AQLA 3D2FA 3WQTA 3W3DA 4EHTA 4BC3A 1JCEA 3AARA 3P4IA 2P9LA 3MMVA 3O08A 3W0LA 4BR2A 1HKCA 4FOIA 2E88A 2FF3B 5AQFA 3F9MA 3BF1A 3WXLA 3UB5A 2ZGYA 5TKYA 1P8ZA 1NGJA 2GWKA 1ZBSA 2HF3A 3WXIA 4CD3A 2YHWA 3HSCA 4BRIA 2PAVA 4BR5A 1TUYA 4H5VA 5AQPA 1X3NA 3CQYA 2GWJA 3IUCA 4IXCA 4NO7A 4A2BA 5F2RA 4PKGA 3DXKA 4J8FA 5BR9A 1ATNA 3CJ1A 2W41A 5AFUA 4BRHA 4LC9B 3RSEB 5EVZA 3D7EO 3FZFA 5AZIB 3U9DA 4BVOA 3BF3A 4WYBA 3M6GA 4BR9A 2QWQA 3AY9A 3WXKA 3VETA 2D0PA 1NGAA 1SQKA 4L3QA 3MN5A 1GLEG 4B1VA 2W40A 3VGLA 5AQTA 4Z94A 3ZETB 4BRCA 5AZJB 3MN9A 4BGAA 2DPNA 3CETA 4KBOA 3GL1A 3CHWA 5KQ8A 2A41A 2Q1NA 4BRPA 3RSEA 1DKGD 1GLBG 4BC4A 2A3ZA 3ZX0A 5AZIA 2E2NA 5AQHA 1S22A 1XUPO 4FPBA 4BRNA 1DEJA 4FWNA 3ZX2A 1TUUA 4DCHA 3WEEB 1BUPA 1NBWA 3O6WA 3VENA 3ZETA 4CBWA 5AZJA 1BDGA 3FR0A 1YXQA 3KHYA 2QXLA 2PBDA 3VEYA 4BRLA 1QHAA 2GELA 3GG4A 1HKBA 3VOVA 4EFHA 3FZLA 1BO5O 3A5LC 1E4FT 4WQ4A 3S41A 2ASMA 3LM9A 4A2AA 5I9EB 3LDQA 4PL8A 3M1FA 1ESVA 2D0OA 3VEXA 1EQYA 2NLXA 3WEEA 4CZGA 1ZC6A 5AQVA 3O5BA 4ISFA 3A5MC 4WQ5C 1GLAG 3H3OB 2I7PA 4GY2B 3A8YA 3HI0A 4B1WB 1T6DA 4F9OA 4BQLA 3U8XA 3ULEB 1IG8A 2P9LB 1NMDA 2VWBA 4WQ5A 4BRAA 1KXPA 5AQYA 3JS6A 1E4GT 2CGJA 2D1KA 4XH5A 2E8AA 3HBTA 1K8KB 4BRMA 3FZKA 5JICA 4JD2B 1YVNA 4FL9A 4B1YB 5BRDA 2P9KB 3MN6A 3ZX3A 1C0GA 4K43A 1SZ2A 4BRFA 5ELZA 3EL2A 3GDQA 4FWLA 1WOQA 5KQDA 3H3NO 4CBUA 4BG9A 3JXUA 4A61A 1BA1A 2F9WA 2P9PB 5AQNA 1RDWX 3O1BA 4CZFA 4AM7A 1HPMA 1HJOA 2E20A 2F9TA 3FZHA 2FF6A 2AA4A 4JNEA 2Q0UA 3G25A 1SAZA 3ULEA 5EOYA 4A62A 5BN8A 1GLCG 4IJNA 3GE1A 1K8KA 4O8KA 5AQJA 4GNIA 4JD2A 4M7YA 2P9KA 4HTLA 2H3GX 1Q18A 2GUPA 3LL3A 3SJHA 2QWPA 3WT0A 3M3ZA 4CD1A 1GLLO 3ATUA 1MDUB 3EN9A 3MDQA 5KPZA 4YDUC 2P9PA 4BRKA 4FWRA 5BREA 1BG3A 2P9NB 3DAWA 3HTVA 5B8HA 3ID8A 3GOIA 3L6QA 1NGCA 2V51B 4MO4A 1T44A 4IZ9A 3ENOA 1HKGA 4YDUA 3VPZA 3KZBA 3I8BA 1BU6O 2CH5A 3O4WA 1KAYA 3B8AX 4FWMA 2ZGZA 1WUAA 2ITMA 1C0FA 5AQGA 3WXJA 4H0OA 5ADXA 4EAHD 1QQMA 5AR0A 4CZIA 5JLFA 1HUXA 3H45C 3DWLA 3C7NB 5EY4A 4ISGA 2P9NA 4ISEA 4BC2A 1GLJO 2V52B 3KVGA 1XQSC 3U9ZA 3SLCA 3QB0A 4I6MA 3MK6A 3EKSA 4H5WA 4CZJA 4CZEA 3R6MA 2NRHA 2E2QA 1JCGA 5BPNA 1GLFO 3HM8A 5LY3A 2KHOA 1BOTO 3QMLA 3LDPA 2E2PA 3CJAA 5EXWA 5E26A 4B1UB 4XH1A 1V4TA 3LM2A 2HOEA 3VF2A 3H46O 4H0XB 3DXMB 1YUWA 5FPEA 2YJFA 3QFUA 4Y0WA 5AQMA 3LDNA 5F1XA 4BQZA 5AQZA 3C7NA 3CJBA 1R59O 4K41A 2IVNA 3D2EB 2A42A 3FZMA 2ZF5O 1BA0A 2YI1A 2IVPA 1D4XA 3EKUA 4BRDA 2CH6A 2ASPA 4H5TA 2A5XA 2Q36A 2QW9A 4FWSA 3TU5A 1Y64A 5AQOA 2FSKA 3BP8A 3EO3A 4E1JA 3LDOA 3FE1A 3CERA 3DXMA 3SMPA 5LJVA 1HLUA 5LJWA 4QS8A 2V7YA 5EX5A 2QM1A 1QQNA 3D2EA 3U4LA 1TYQA 3VGMA 4H0PA 3VEZA 2P9IB 2Q0RA 4H03B 4IO8A 3VEVA 4FWPA 5CE3A 2QWRA 2QWLA 3SK3A 4CZKA 4DHYA 3WUHA 1X3MA 4JAXA 3EZWA 4FSVA 3L0QA 3UE5A 4BG8A 2FXUA 4XEIA 4MLHA 3MCPA 1BWFO 4PL7A 2V7ZA 3IDHA 2E1YA 1NM1A 1MWMA 3O8MA 4BC5A 1QZ5A 3CI5A 3H6EA 3J8AA 1JCFA 1OKJA 5AQQA 1NGBA 2P9IA 4QS7A 1RFQA 3MN7A 4CI6A 3FLCO 5BRFA 3VF6A 3SMSA 3VESA 4B1ZA 3A5NC 1Z6RA 2Q31A 3DJCA 5JMVA 1MA9B 4BROA 5FPMA 1U2VB 4JN4A 1QQOA 3VERA 3QFPA 4QS9A 2OANA 1S3XA 3IMXA 3TPQA 3ZEUB 5JLHA 1NGGA 4H0VB 4HWIA 1KAXA 4O5FA 5AQWA 4BREA 1Z05A 4PKIA 3IFRA 2VYPA 4I6MB 4B9QA 4RCHA 3QBWA 1X9JA 4FWQA 5AQIA 2EWSA 1NWKA 3CQXA 3I33A 4CBXA 5FPNA 2BUPA 3BEXA 5E84A 1KAZA 4RTFD 2BTFA 4DQ8A 1U2VA 3QDKA 2D4WA 2Q97A 4DB3A 3H1VX 2J4RA 2HMPA 2P9SB 3OHRA 3ZEUA 3VF4A 3R9PA 1NGIA 5AQKA 5F0XA 3VGKA 4BGBA 2I7NA 2FSNA
chains in the Genus database with same CATH superfamily
3AVNA 4I2QA 3WQUA 2DY4A 5C10A 1GLDG 5AFUH 4CEOA 4FWKA 4FPAA 1NOZA 2F8TA 1YAGA 2HHQA 3MECA 2YJEA 1NMNA 3ZSOA 2YX6A 2P9SA 4KV8A 5C2FA 3H1QA 5A2QO 4HTUA 1J5OA 2QWNA 3F5TA 1J6ZA 4N76A 1IJJA 5LMUK 3T19A 2GX9A 5AQSA 4WQ4C 4IJAA 2KQ2A 4M7XA 5TKWA 4DV0K 3UKRB 4YORA 4DFJA 3GBTA 1KLNA 4AM6A 1OVYA 1KVBA 4CHPA 4X62K 4OGCA 1FKOA 4A5BA 4GV6A 1QS4A 2NZTA 4DSKA 2A40A 1C1BA 1NK4A 3PX6A 4ZTFA 4UQGA 3R8EA 1XC9A 1NGHA 4BDYA 3AA4A 5SWMA 3D0PA 4B08A 2HW3A 3TI0A 1TL3A 4PA1A 5JVGL 2BH1A 3D2FB 4IFEA 1WSGA 1SS6A 3FGUA 4J2DA 1U6ZA 4AHRA 3CMAN 3C0BA 3HYFA 5CHIA 4DFKA 4LF8K 4JKCA 3CIPA 4KO0A 3RMAA 4AHCA 2G8KA 1QZ6A 4FM1A 3O1WA 4LFCK 4DV4K 1ZXOA 2UYTA 1IBMK 4DR5K 1DGKN 5HRPA 3SUPA 2A1SA 1NGEA 2ZD1A 4EIAA 3KK2A 3T3FA 4H5RA 5AQRA 1J5EK 4E1MA 4JS4A 3WQTA 4YOUA 1O1WA 4DSJA 4JI0K 3W0LA 1HKCA 3HL8A 1OH7A 1Q9YA 2E88A 3NHGA 2ZJPL 3WXLA 3BF1A 3VQ6A 2ZGYA 5TKYA 1NGJA 2GWKA 2HF3A 4KHWA 3IAYA 1HPZA 2YHWA 3HSCA 4M3UA 1HNVA 2YNIA 3CYMA 4H5VA 5AQPA 2HHSA 3Q7CA 4NO7A 1S9EA 4JI1K 3M8SA 4KRFA 5AFUA 4BRHA 3P1GA 1NK7A 1WBBA 3C6AA 3SJJA 1YTAA 3QLHA 4WYBA 3VQ5A 2QWQA 5M1QA 1BISA 2D0PA 3DI6A 4DSFA 3AGRA 1S6PA 3K9KA 1S9GA 4GW6A 3VGLA 4E7HA 1NK9A 3QO9A 1KCFA 3DLHA 4IDKA 4BGAA 3LP3A 1VK0A 3NF6A 4KBOA 3LDSA 3ID6A 4C8KA 3SZ2A 3KK7A 2A41A 5DK5A 3TSUA 1HMVA 4BC4A 1S1XA 2A3ZA 1WAFA 4OO1J 5AQHA 4MDBA 3OYGA 4FPBA 3P5JA 4KB0A 3HO1A 5C0YA 3G10A 3G71N 3NVKA 1EWRA 1Q7YO 3L2VA 3OYBA 3DRSA 4CJFA 3VMFB 1NBWA 3ZETA 1KVCA 2KTQA 4KKOA 5AZJA 2GELA 1HKBA 3VOVA 4FYDA 3FZLA 1C6VA 5LL6Z 4FJXA 2O8EA 3V9SA 4AQYK 3CMEN 3RRHA 2PYJA 3SV4A 4N47A 2W6KA 2KFZA 4DTRA 3VEXA 1ASVA 2UXCK 3JYTA 4CZGA 1WSIA 4I9QA 5C24A 3TAQA 5FROA 2OPRA 1VSHA 1C0UA 5AQVA 5T7BA 1RNHA 4FJ8A 4WQ5C 4CJUA 4X65K 3ZT0A 4KHUA 1WLJA 1GLAG 3A8YA 3HI0A 3QEWA 4U7BA 4BQLA 3U8XA 1IG8A 3S3NA 4FVUA 4IOCL 1NMDA 3SI6A 4WQ5A 5AQYA 2FBXA 2KW4A 4C1NI 4XH5A 4BRMA 4M3WA 3VQBA 2JLEA 3MN6A 4LSNA 2XY8A 2WTUA 4JKFA 3V4IA 5I42A 1NJXA 3GDQA 5GAGP 1SUQA 1RCHA 3H3NO 4CBUA 2PZSA 4BG9A 3LWMA 3MXMA 2P9PB 1RDWX 2KZZA 4CZFA 1HJOA 3FZHA 1IKYA 3IKMA 4JRPA 4DQSA 3EYZA 4A62A 5BN8A 4JS5A 4FJMA 1G15A 5FRNA 4IJNA 1IKXA 3GE1A 4O8KA 4CGGA 5AQJA 3TABA 4GNIA 5HOOA 4FJHA 2OPQA 2QWPA 3E1YA 1L5UA 3EN9A 1JLGA 4FWRA 5BREA 1KC8O 3EEQA 1VQ6N 3NCIA 2HBMA 1NGCA 1XNQK 1CXUA 4Z4FA 3BY5A 3THXB 4H0OA 4FJIA 1VRUA 3O4NA 1KQSM 3AVCA 4CZIA 4O44A 2AJQA 3AVMA 3LP1A 2W6LA 1VHXA 3I8DA 1W97L 3P83D 4JKBA 4KH4A 3C7NB 3OYEA 4KI4A 2P9NA 4ISEA 4BC2A 1GLJO 2V52B 3U9ZA 4FJGA 3LP2A 3AVAA 3SLCA 3SQ0A 4CE9A 4I6MA 3MK6A 2NRXA 3V1OA 2E4LA 4DSEA 3ZT4A 5BPNA 4AHVA 1IKWA 3CD6N 1ITGA 4JRQA 5IT9O 3CJAA 5EXWA 3NF9A 5E26A 3KJVA 3LM2A 3BZKA 3DXMB 4JEPA 4GKJK 1VSFA 4FLYA 4CGHA 1DT9A 1S6QA 1NKCA 5AQZA 3D2EB 2G8WA 4LF9K 2IGIA 2YI1A 1D4XA 3SBGA 3T1HK 1UWBA 3HRGA 4FJKA 3OJSA 4H5TA 2A5XA 2Q36A 1RTDA 4PY5A 2B4JA 5JVHL 1JXEA 2FSKA 4CFDA 4CHNA 4DF4A 3P39A 3UIQA 3EO3A 4AILC 5GIPA 1GOBA 4RW4A 3T1AA 3LDOA 3J80O 3CERA 2HHUA 1BI4A 4Q0BA 2F96A 4KH6A 5LJVA 4IFVA 4OKEA 3NH1A 2ETJA 2QM1A 1QQNA 1KFDA 2XHBA 2EX3A 3NAEA 4YOXA 1Q8IA 2Q0RA 1YTUA 4GKKK 4DMNA 5CE3A 4JKGA 3SK3A 3MX2A 1RT5A 3I55N 2UXBK 4FSVA 3R1XA 1LW0A 5HRRA 3L0QA 4W5QA 2FXUA 4FLUA 4MLHA 1NM1A 1MWMA 3O8MA 4CEFA 1OKJA 3PIOL 3AGKA 1BQMA 4BWMA 2VQFK 4H4MA 2HB5A 2WOMA 4FLWA 5BRFA 1HNWK 3TAEA 4B1ZA 3JSMA 1S5JA 4JI3K 4CJEA 3DJCA 1K73O 4RW7A 4JN4A 1C0MA 1VQLN 1YT3A 3TPQA 1LWEA 5JLHA 1NGGA 1W9HA 1REVA 1HYZA 3V9WA 2VG7A 5AQWA 4PKIA 4FWQA 3PX0A 3QNNA 4X64K 1NWKA 3CQXA 3SQ1A 2O8FA 4M3ZA 4FJNA 3KD5E 4RTFD 2BTFA 4G1QA 4BY9C 1NNEA 4OLBA 4BE0A 4PHTX 2J4RA 3OHRA 4LFBK 2HHHK 4EZ6A 3VQ8A 5CYMA 1TK0A 4Z4HA 5F0XA 3AVHA 3OYNA 3O3GA 1UAXA 2E2OA 4JHDB 5JS2A 3ZYYX 2HVIA 4R79A 4B9LA 3VQDA 3C65A 4XIUA 3AV9A 1RILA 2WBNA 4BR0A 3EY1A 4YOVA 4H0YB 4KB1A 2ASOA 4FO0A 4CJ4A 5ADXH 5BN9A 5CY4A 4KFBA 4F8RA 2OPSA 1BQNA 4QCLA 1QQCA 1SL0A 3L4IA 2IOCA 2AP1A 3EE8A 3A5OC 3QERA 3EE9A 3NF7A 1X9SA 3TSPA 2IIRA 4CZHA 1BGXT 3QICA 3HPHA 4U67L 2GEMA 3LDLA 1HNZK 4KTWA 3LWLA 3CJ9A 3SUNA 3UKUB 3CPWM 2XY5A 4IFYA 2RE2A 1WAJA 2YHYA 3CFRA 4DUYK 4LSLA 4OJRA 4I9LA 5GINA 3OW2M 2QWMA 3S9HA 4B9UA 4ZTJA 1N36K 1CZAN 2Z1IA 3KLGA 2KKZA 3HZ6A 4C23A 3NGZA 2BGGA 1S1WA 4MFBA 3PO5A 3DLKA 4CFBA 1M1KO 1V4SA 3VQAA 1NGDA 4YOWA 4LH5A 1EO1A 4MQ3A 2P9UA 3C6TA 1OH6A 3VEOA 4PKHA 1H1VA 4H0TB 4CZLA 5AQUA 5MLCQ 2YHXA 1EX4A 3SYZA 4B8CA 3HM9A 1IBLK 2Z1GA 1JJ2M 3OJUA 2HHVA 4CJ7A 1S72N 2WFBA 3O80A 4F4KA 4C8OA 1SKWA 1WSJA 4FOEA 3V1QA 4DS4A 2NRZA 3J7YP 3W3DA 3HVTA 4CJ5A 3HPOA 3J7AP 4ICLA 3MMVA 3O08A 3JAMO 3CCRN 3O9QA 2P51A 3WXIA 4BRIA 1RDDA 4BR5A 4DF8A 4DQQA 1FJGK 2B5JA 1ZBFA 4IG3A 2B6AA 3DXKA 3QNOA 4J8FA 1ATNA 3CJ1A 3RSEB 3FZFA 3SAFA 3HOTA 3SAHA 2HMIA 3U9DA 4F2RA 3WXKA 1SQKA 1NJWA 1GLEG 1DLOA 3OY9A 3OA9A 3KD1E 5AQTA 4BRCA 3CFPA 3ZT3A 3R3LA 4KHPK 1MU2A 2VG6A 3CHWA 5KQ8A 4DR3K 4FK2A 3CC7N 1GLBG 5AZIA 4B9VA 2E2NA 1XUPO 2O8DB 5GIOA 4BRNA 4G9ZA 4FWNA 2G8UA 1BUPA 4C8MA 3DM2A 1K9MO 1BDGA 4QAGA 2UUBK 4BRLA 4WFBL 4EFHA 3SCXA 5FDLA 4FJ9A 4WQ4A 3S41A 5KTQA 3HP6A 1YJWN 4CF0A 4KTQA 3CCQN 2ASMA 1T8EA 4DR4K 4OX9K 3LDQA 1U48A 4HUGA 3M1FA 1ESVA 2D0OA 2NLXA 3RWUA 1VQ8N 3WEEA 3THYB 4LF6K 3K57A 5KGWA 3B6OA 4DV6K 1X1PA 3AO1A 3AA2A 2G8FA 4DFPA 4DFMA 1TGOA 4KHQA 1M90O 4CJ3A 5GAEP 4DS5A 3ULEB 2P9LB 3OYDA 4DQRA 4OVLA 1RTJA 4NYFA 1VQ7N 3NDKA 2D1KA 3HBTA 1K8KB 2QKKA 1YVNA 5BRDA 3TSQA 5D3GA 1C0GA 4B8AB 1SZ2A 3Q7BA 4BRFA 2G8VA 3EL2A 3NH0A 5KQDA 3CCJN 5HBMA 4NLCA 3JXUA 1SL1A 2F9WA 3A2FA 3QINA 4O4GA 3CM5A 3DLBA 4AM7A 2F9TA 2FF6A 1U4BA 4NCBA 4CVNE 5J1EA 2AA4A 2Q0UA 1SAZA 1Y97A 4DR2K 2DFHA 1EETA 4JD2A 4C8LA 2P9KA 1Q18A 3SJHA 4DV7K 4DSIA 3WT0A 4AH9A 4CD1A 4BE1A 1MDUB 3MDQA 5KPZA 1NKBA 1RTIA 2ZE2A 4YDUC 4J2BA 4M3XA 3O3HA 3RVCA 4RW8A 3HTVA 3L6QA 3ENOA 1OH8A 3I56N 3LPTA 4YDUA 4E7KA 1HR0K 3KZBA 3I8BA 2ITGA 3SV3A 2XY6A 4CERA 2OTJN 4FWMA 2ZGZA 3NVMA 1WUAA 4CHQA 5AR0A 3OYCA 3K5MA 1N5YA 3VA0A 5I3UA 3O9UA 1HUXA 2QEXN 3RMCA 3DWLA 3AVFA 4CGDA 2IC3A 1D9FA 3TTDA 5HL7L 3EKSA 4BACA 1S1UA 2HSTA 3BGRA 1GLFO 3HM8A 3B6PA 3CCEN 4B1UB 4GV3A 4XH1A 1V4TA 2OCEA 4OLAA 3KKSA 4H0XB 1T7PA 2YJFA 4Y0WA 3AVBA 1EKEA 4BQZA 1RT2A 1R59O 4K41A 2IVNA 2A42A 4M3YA 2VGNA 1RBTA 2ZF5O 3FZMA 3CPEA 3OBWA 4WFNL 1TK5A 4DWIA 2IVPA 3ITHA 4L8RB 2DFFA 1WSEA 4BRDA 1S1TA 3J7ZO 2CH6A 4TSXA 2HNZA 5AQOA 2HHTA 4IOXA 2O8CB 3G0ZA 3FE1A 3SMPA 4LF4K 3O4QA 4N56A 3DOLA 4QS8A 2V7YA 3VQ9A 4Z4CA 3ZSZA 1R0AA 2O8BB 4DV5K 3SPZA 2PFUA 5LMNK 2PYLA 4K8XA 3MEGA 4C8NA 3TAFA 1L3TA 3ZSRA 2QWRA 3I0SA 4DHYA 3G4SN 2DTUA 4CFCA 3UE5A 4BG8A 4DUZK 3TAGA 4DU3A 2V7ZA 3P31A 1KTQA 1QZ5A 1JCFA 3I0RA 5AQQA 1NGBA 1ASUA 1VSKA 1HJRA 2P9IA 2NRTA 4FZYA 2P1JA 3SAGA 5E41A 1ZBUA 3K2PA 3VESA 3OTOK 1Z6RA 3WXMB 4W5TA 5JMVA 4O0JA 3V9XA 1S3XA 3IMXA 2QK9A 3ZEUB 4JK7A 3C6UA 2HBJA 1NG9A 4ID1A 1JLCA 1KAXA 4IKFA 4CFAA 4B9QA 1IBKK 3QBWA 1X9JA 5HRSA 4FJJA 5AQIA 3CF5L 1W2BM 3AVIA 4FLZA 4IEIA 4M42A 4JKDA 1JLBA 3AA3A 3BZCA 3E9PA 3I33A 3NGYA 3CXCM 1JLFA 3THWA 5E84A 3BEXA 1JKHA 1N32K 4B9SA 4DQ8A 1U2VA 2RN2A 4CIEA 4FW2A 4DB3A 1RT7A 1BCOA 1JLQA 3SBTA 3H1VX 4CGIA 3THVA 2P9SB 4IG0A 1EP4A 3R9PA 1NGIA 4FLTA 2RHKA 2HNYA 3MX5A 4BGBA 3PLAA 2I7NA 4ILGB 3NH2A 4LH4A 5KPRA 4MO5A 1N6QA 1UA1A 1RT6A 4FLXA 3ZSWA 4DTUA 1ASWA 1I39A 4JI8K 4CJRA 2A6AA 4BR4A 3VEWA 4JKHA 3L2QA 2UXDK 4CJKA 3RMBA 2UU9K 3KLEA 2Z1JA 4CJSA 1XC3A 1MWKA 3OYLA 1ATRA 4IWVA 1NKEA 2EHGA 3ZCMA 1RT3A 3ISNC 2OPPA 3DLGA 4FK0A 5FPDA 2IVOA 4JK9A 4HCBA 1QSLA 1T05A 2VCPA 2FLOA 4GVMA 5BPMA 5KPTA 4BR7A 4YHHK 3AVJA 3HVRA 4JI6K 1G99A 1RTHA 2CGKA 4B3TK 4IDHA 1C1CA 4CF8A 4CEZA 4FCYA 1YJNN 4EZ9A 1N33K 1ZBIA 3OBYA 1C1AA 4H5NA 2X78A 4WF9L 5BPLA 2VWJA 4PQUA 3UKRA 4F3TA 3KTQA 2Q2RA 1K8AO 3ATVA 5CR4A 2QA4N 4EHUA 3CJCA 3DRPA 4FWOA 4MLEA 4WE1A 1HX1A 3ASMA 1VSIA 2D5RA 2YKMA 1NLVA 4IBNA 2CGLA 2OZSA 3VQ4A 4RG8A 4E3SA 3SNNA 3VQ7A 3OVNA 4LD0A 4NCGA 2G8IA 4EP4A 5BRHA 3BUZB 3EZ5A 2XY7A 1VAZA 3AAPA 2G8HA 2Q3SA 3D2FA 1NK0A 1U47A 4EHTA 4O5BA 3SQ2A 3CCVN 1QSSA 3AARA 3P4IA 1RDAA 3OS0A 2P9LA 2FBVA 1HRHA 1QHTA 3E01A 2FF3B 5AQFA 1XI1A 1RDCA 1WSFA 1CZBA 5H1SQ 3J81O 4E7LA 3F2KA 3OYJA 1QSYA 4HCCA 3CQ8A 4CD3A 2PAVA 3K58A 1TUYA 1X3NA 4PUOA 2RF2A 3CQYA 3IUCA 4MDAA 3OYMA 3O9TA 5F2RA 1S1VA 3PV8A 3QIPA 3VQEA 4LC9B 5EVZA 3H08A 4OGEA 4BVOA 3IRXA 3BF3A 3MXJA 3CCLN 4YNQA 3VETA 1NGAA 4L3QA 3MN5A 2W40A 3OS1A 2E6MA 5J2MA 1N34K 4Z94A 3ZETB 5AZJB 2DPNA 4PWDA 3CETA 3LPUA 3GL1A 3IG1A 3PX4A 3CCUN 2O8EB 4FK4A 2LSNA 2Q1NA 4BRPA 3ZX0A 4DTOA 2ZJQL 3LP0A 1JLAA 5K14A 1DEJA 1LAWA 3C6HA 3ZX2A 1TUUA 4BDPA 2D0AA 1Z26A 3VENA 4CBWA 3KHYA 5FLXO 1YXQA 2NUBA 2QXLA 3VEYA 2HBLA 1QHAA 5C12A 3HOSA 1RBVA 1LAVA 3NMUA 1I94K 4DV3K 1RT4A 4J2EA 3LM9A 2UUAK 4NXNK 5I9EB 3LAKA 4Z4GA 4DLGA 1EQYA 1LW2A 3FFIA 2QKBA 4N41A 4M3TA 3DLRA 1ZC6A 3KK1A 4FVMA 1ZYQA 4ISFA 1BIUA 4X66K 1LWCA 2KZMA 3K5NA 4B1WB 4B3SK 5BR8K 4M45A 4B9TA 4FLVA 4BRAA 3V9UA 3JS6A 4CEAA 3T7ZA 2E8AA 4FZXC 4FM2A 2RPIA 4FL9A 4B1YB 4GV9A 3DOKA 3SQ4A 1RDBA 5ELZA 4NCAA 1IH7A 4FWLA 1BA1A 3O1BA 1WB9A 2I5JA 1HPMA 1SV5A 4JNEA 3G25A 3SUOA 4H8KA 4I7FA 3M8QA 5EOYA 1VQPN 4FJ7A 3AVLA 3C94A 1ZBLA 4B3MK 3DRRA 3PO4A 4HTLA 4FXDA 2GUPA 5IWAK 3T1YK 2FC0A 4JLHA 1OH5A 4ID5A 5C15A 2P9PA 2A1RA 4Z4IA 2GUIA 2P9NB 1JL1A 3DAWA 4A59A 3ID8A 3GOIA 5B8HA 4F2SA 2V51B 3TWHA 4IZ9A 5CZ2A 1Z25A 3VPZA 1BU6O 3PSIA 3VA3A 2HVHA 2CH5A 3AVGA 3TAMA 2D0BA 2ITMA 5ADXA 5AQGA 1QVGM 1CXQA 3MEEA 4CHOA 4DQIA 4EAHD 1WSHA 1I3AA 3MCAB 3AO4A 1NK5A 4DQPA 5CZ1A 3PUFA 3N4PA 2YHAA 5JLFA 1KSPA 3BDPA 4DTJA 1NK8A 3PY8A 1X9WA 4FZZA 3KVGA 1U45A 3U3YA 1XQSC 3KLIA 3QB0A 1VSLA 4H5WA 1KVAA 4CZJA 2VGMA 2KFNA 4CZEA 3R6MA 3VTIA 4KPYA 2E2QA 1JCGA 4CIFA 3QEXA 3THXA 4Q5VA 5LY3A 5SZTA 4GVEA 1VQNN 1BOTO 3M8PA 3OYHA 2E2PA 3VQQA 4W5NA 3VF2A 2HOEA 5HLFA 1YUWA 1BI4B 4R5PA 3MWPA 5AQMA 3LDNA 5F1XA 3C7NA 3RR7A 3CJBA 1E3MA 1J9AA 1W7AA 1XWLA 2Y1JA 1BA0A 4OKKA 4CF2A 2W42A 4DU1A 2ATQA 1VRTA 2QW9A 3QESA 3TTFA 4JKGB 1WNSA 2D0CA 4CEDA 3NFAA 4WFAL 2NNWA 4LF5K 1ILYA 3NBPA 4AHTA 3DXMA 4DLEA 4DTXA 1HLUA 5LJWA 2UUCK 1DTQA 4CJVA 3D2EA 3TAPA 3VEZA 4HVJA 1KFSA 1GOAA 2BANA 3K5OA 3P38A 1HYSA 4H03B 1SKRA 3VEVA 4F3OA 2HHXA 2QWLA 4CZKA 3KK3A 3EZWA 3LALA 3T69A 3ALYA 4XEIA 3L3VA 1XMQK 4IOAL 3MCPA 5GAHP 1BWFO 3U3GA 4PL7A 3AO3A 2E1YA 3K0SA 2XRIA 4BC5A 4NYNA 3H6EA 3PIPL 3RRGA 1VQ5N 4EP5A 4KHNA 3MN7A 1TAQA 2RKIA 4CHZA 5HROA 5HP1A 2E6LA 3ZT1A 4DTSA 3A5NC 3WNFA 4DG1A 4KAZA 2O8FB 2Q31A 4B9MA 1MA9B 4BROA 5FPMA 4Z4EA 1EWQA 3MEDA 1QQOA 3VERA 4QS9A 5C25A 2X6SA 4ILJA 4E0DA 4H0VB 4CJPA 4HWIA 1FK9A 4W5OA 2X74A 4BREA 2BDPA 3MAQA 2VYPA 5KGXA 4OPJA 4RCHA 1JLEA 1TKXA 1TKTA 1J53A 4CEQA 3DLEA 5DM7L 3G6EN 3LAMA 1KRPA 4Y1DA 5FPNA 1RBUA 3CM6A 1KAZA 3QDKA 3WNHA 2D4WA 4JV5K 3KLHA 1VSEA 3V6DA 4KI6A 2HMPA 3CG7A 3M5RA 3VF4A 1SL2A 1P90A 5AQKA 2Y1IA 2Z1HA 2FSNA 5KRSA 1NJZA 4BE2A 3HP9A 4NB4A 2YV0X 3ENHA 4XH4A 1LV5A 4UY8O 1RBRA 2YNGA 3FFKB 4FM0A 4YFUA 3O9RA 5M1FA 1VQMN 4E19A 2WONA 4JYAK 1FKPA 3L3UA 4KH5A 3MXIA 4V19S 1IV0A 4B9NA 5M1OA 3F9KA 3CCSN 4BRQA 3HPGA 2QWOA 1TYQB 5CYQA 4W5RA 3ZSVA 3TTCA 4K25A 5AQXA 2HNDA 3D6RA 1D9DA 4JHDA 4A5AA 5KRTA 1LCUA 3NF8A 1HQUA 4KTZA 1ATSA 1NGFA 2E1ZA 5HRNA 2JWKA 3AAQA 5J2QA 5FRMA 5J2NA 2OYQA 3V1RA 1U49A 4BVPA 4ZHRA 5M1PA 1WN7A 4NLBA 1VSJA 2P9UB 1RGIA 3RTVA 1TKZA 4WCEL 3OYIA 2GV9A 3OYKA 3A0IX 2ZWHA 4NXMK 2NRWA 2FSJA 1BCMA 1QVFM 2FBTA 2YCHA 2VQEK 3L2WA 3ZSXA 4CZMA 3QBXA 3VN5A 4AF1A 4E89A 5C2DA 4FJ5A 4B1XB 3DMJA 3S3MA 2X6NA 2HF4A 3AO2A 3E9OA 2GTDA 4CJWA 1VQ4N 4OPKA 4QOZB 3DYAA 4K42A 4OKJA 1FXXA 3CJ7A 4RWTA 1YI2N 3UKUA 4DV2K 1F21A 4M63C 3TANA 4N5SA 4BRGA 1BIZA 4YOTA 3ZT2A 1LOTB 2WUSA 4BWJA 1W0HA 2VG5A 3WNEA 1T6CA 2KLAA 3DXKB 5AQLA 2HBKA 4BC3A 1JCEA 4J2AA 4E7IA 4BR2A 1HNIA 4O55A 4FOIA 3VTHA 1YJ9N 5C42A 3F9MA 3UB5A 2JGUA 1J54A 4E1NA 1P8ZA 3ULDA 3QEPA 1ZBSA 3IS9A 3KWGA 1B9DA 3LANA 4YOYA 3S3OA 4IXCA 2GWJA 4A2BA 3L2UA 4JI4K 4PKGA 5JS1A 4JI7K 5BR9A 1NJYA 3CCMN 1QE1A 2W41A 4JI2K 3HK2A 5M1KA 3D7EO 1YHQN 5AZIB 3E66A 3M6GA 4BR9A 3AY9A 4Z0UA 1U04A 4B1VA 4LFAK 4LF7K 3L8BA 3KKRA 3WNGA 4C1NK 3MN9A 4H4OA 1C0TA 4CGFA 4DTMA 4DR7K 2QXFA 1A5VA 4KREA 1XHXA 1X9MA 3RSEA 1DKGD 4Y1CA 4K0KK 3K5LA 1ZBHA 1S22A 3SPYA 1VQKN 1RDUA 2IDOA 2OZMA 3OYAA 2ZQBA 4DCHA 3WEEB 1T3VA 3O6WA 3FR0A 2PBDA 2XO7A 3GG4A 4DR1K 4JKEA 4IEEA 2R7YA 3U6FA 4DR6K 2O4GA 1BO5O 3A5LC 3D45A 1E4FT 4ELVA 1XHZA 5M1NA 3LZJA 2YNFA 4A2AA 4DKWA 1NOYA 2O8DA 4PL8A 1NU0A 1L3SA 1SKSA 4HUFA 1CZ9A 5AJ3K 3O5BA 2PY5A 4KHYA 4DU4A 3A5MC 3HJFA 3H3OB 2VWKA 2YKNA 2QTDA 2I7PA 2IS3A 4GY2B 4O8UA 1XMOK 3QIOA 1T6DA 4F9OA 5GADP 1TL1A 1D5AA 1KLMA 2VWBA 1YVUA 1KXPA 1E4GT 4CECA 2CGJA 1FW6A 1A5WA 3FZKA 5JICA 1L3UA 4JD2B 2P9KB 3O3FA 1BL3A 4B3RK 3ZX3A 3THYA 4K43A 4RW9A 1WOQA 2F4VK 1OVQA 4A61A 1YF5L 1TKDA 5AQNA 3CC2N 2E20A 3OS2A 3RMDA 1N8RO 1B92A 3ULEA 1B9FA 2GBZA 1TVRA 4JK8A 3LZIA 4CHYA 3DLLL 1GLCG 4CESA 4OPHA 1Q81O 1K8KA 1YIJN 4M7YA 3ENBA 1K6YA 2H3GX 2OTLN 1RT1A 1UA0A 3O9SA 4B3OA 3LL3A 4HUEA 1VQ9N 1HQEA 3CFOA 3M3ZA 1GLLO 3ATUA 1NK6A 4CK1A 2F7TA 4BRKA 4CCHA 1BG3A 2E5LK 1LWFA 4JI5K 4CJLA 4CK3A 4MO4A 1T44A 3VQPA 1HKGA 2YHBA 3NGIA 2ZJRL 2ZM6K 3O4WA 5DM6L 1KAYA 4CGJA 3B8AX 3ZSYA 3WXJA 1C0FA 2JWLA 3K59A 2QI2A 3OYFA 3QEIA 1QQMA 3F73A 3VQCA 3NE6A 4JKAA 3H45C 4E7JA 5EY4A 4ISGA 1XNRK 4DSLA 1IKVA 3AVKA 2NRHA 2FBYA 4ELUA 3L4QA 2KHOA 3C95A 3QMLA 4AHSA 4CJQA 3ZLJA 3LDPA 2DFEA 3SUQA 3H46O 4O0IA 5FPEA 3V81A 3QFUA 1YITN 1DTTA 1VSMA 5J2PA 4M41A 4RW6A 4ILHA 4FJLA 4DTPA 1NJIO 1VSDA 3EKUA 4BDZA 2ASPA 4KHSA 4CW7B 4FWSA 3TU5A 1Y64A 4LY7A 2HHWA 3BP8A 3K9JA 4IO9L 1GOCA 4E1JA 3QEVA 4I2PA 1D8YA 1L3VA 4M3RA 1KD1O 1EXQA 5EX5A 3RR8A 3U4LA 1Q86O 1TYQA 3PSFA 3VGMA 4H0PA 2P9IB 4CF1A 3HT3A 4IO8A 2NRVA 3V9ZA 2O4IA 4FWPA 3WUHA 2O8CA 1X3MA 4JAXA 4K8ZA 1HNXK 1CLQA 3KIOA 4A57A 3ZSQA 1QTMA 1T03A 3IDHA 4CF9A 1VQON 2YNHA 2F8SA 3J8AA 3CI5A 3M8RA 4CJTA 1Q9XA 3HXMA 3L2RA 2O8BA 4QS7A 1RFQA 3KLFA 3CC4N 4CI6A 1A5XA 3TARA 3FLCO 2IAJA 3VF6A 3AO5A 1WBDA 3SMSA 3TR8A 1TV6A 3THWB 4CK2A 1BHLA 1U2VB 2WC9A 3E9LA 4YY3K 3QFPA 2OANA 1IO2A 4ELTA 2P5OA 4O5FA 1Z05A 4OPAA 3N4QA 3HSTB 3IFRA 4AHUA 4CEBA 4I6MB 4CEEA 4CIGA 5DMRA 4DV1K 2NRRA 4HHTA 4FW1A 2EWSA 3QETA 2OA8A 3KWIA 2BE2A 4CBXA 1JXBA 2BUPA 1UOCA 3MWTA 2Q97A 1JL2A 2P5GA 4DTNA 5EU7A 5KI6A 3ZEUA 3AA5X 1HYVA 1TAUA 1RBSA 1IG9A 4GMJB 3VGKA 1O13A 1Q82O 1TK8A
chains in the Genus database with same CATH topology
5KPRA 4MO5A 3WQUA 5C10A 4NB4A 2E2OA 1GLDG 4JHDB 5AFUH 3ENHA 4XH4A 4FWKA 4UY8O 4FPAA 3ZYYX 3FFKB 4R79A 1YAGA 2A6AA 3C65A 4BR4A 3VEWA 4JKHA 3O9RA 5M1FA 1VQMN 2YJEA 2WBNA 4BR0A 4YOVA 2YX6A 4H0YB 4KH5A 2ASOA 4FO0A 2P9SA 5BN9A 5ADXH 3H1QA 5C2FA 5M1OA 3CCSN 2QWNA 4BRQA 1XC3A 2QWOA 1TYQB 1MWKA 3F5TA 1ATRA 3L4IA 4IWVA 1J6ZA 3TTCA 4K25A 5AQXA 1IJJA 2AP1A 3EE8A 2GX9A 3A5OC 3D6RA 4JHDA 5AQSA 4WQ4C 4IJAA 4A5AA 3EE9A 1LCUA 4M7XA 5TKWA 5FPDA 3TSPA 3UKRB 1ATSA 1NGFA 2E1ZA 2IIRA 4CZHA 4YORA 2IVOA 4JK9A 3GBTA 2JWKA 3AAQA 4AM6A 1OVYA 3QICA 4U67L 2VCPA 2GEMA 2FLOA 3LDLA 4BVPA 4A5BA 5M1PA 4NLBA 4GV6A 2NZTA 5BPMA 2P9UB 5KPTA 4BR7A 1RGIA 2A40A 3CJ9A 3UKUB 1G99A 3CPWM 2CGKA 4WCEL 4IDHA 3R8EA 3A0IX 2ZWHA 2RE2A 2NRWA 2YHYA 1YJNN 5GINA 1NGHA 2FSJA 3OW2M 2QWMA 3OBYA 4H5NA 4WF9L 1QVFM 1CZAN 2YCHA 5BPLA 2KKZA 3HZ6A 3QBXA 4AF1A 4C23A 4CZMA 3UKRA 5C2DA 5JVGL 1M1KO 1V4SA 2Q2RA 2BH1A 3D2FB 4IFEA 4B1XB 1NGDA 4YOWA 1SS6A 3FGUA 1K8AO 1U6ZA 1EO1A 3CMAN 2HF4A 3E9OA 2GTDA 1VQ4N 3ATVA 5CR4A 2P9UA 3C0BA 4EHUA 3CJCA 4FWOA 4K42A 4MLEA 3VEOA 5CHIA 2QA4N 3CJ7A 4JKCA 3CIPA 1H1VA 1HX1A 4PKHA 4RWTA 1YI2N 4H0TB 3UKUA 4CZLA 5AQUA 1NLVA 2YHXA 2CGLA 5MLCQ 1QZ6A 4M63C 3O1WA 1JJ2M 4BRGA 1ZXOA 4YOTA 2UYTA 1LOTB 1DGKN 2WUSA 4CJ7A 1NGEA 2WFBA 5BRHA 1S72N 3O80A 3BUZB 4EIAA 4H5RA 1VAZA 5AQRA 3AAPA 1T6CA 2KLAA 3DXKB 4FOEA 2NRZA 5AQLA 3D2FA 3WQTA 3W3DA 2HBKA 4EHTA 4BC3A 3CCVN 4YOUA 1JCEA 3AARA 3P4IA 2P9LA 3MMVA 3O08A 3W0LA 4BR2A 1HKCA 4FOIA 3VTHA 1YJ9N 2E88A 2FF3B 5AQFA 2ZJPL 3F9MA 3BF1A 3WXLA 3UB5A 3CCRN 2ZGYA 5H1SQ 3F2KA 3O9QA 5TKYA 1P8ZA 1NGJA 2GWKA 1ZBSA 2HF3A 3KWGA 3WXIA 4CD3A 2YHWA 3HSCA 4BRIA 2PAVA 4BR5A 1TUYA 4H5VA 4YOYA 5AQPA 3Q7CA 1X3NA 3CQYA 2GWJA 3IUCA 4IXCA 4MDAA 4NO7A 4A2BA 3O9TA 5F2RA 4PKGA 3DXKA 4J8FA 5BR9A 1ATNA 3CJ1A 3CCMN 2W41A 5AFUA 4BRHA 4LC9B 3RSEB 5EVZA 3D7EO 3FZFA 3C6AA 5M1KA 3SAFA 3HOTA 1YHQN 5AZIB 3SAHA 3U9DA 4BVOA 3BF3A 4WYBA 3E66A 3M6GA 3CCLN 4BR9A 2QWQA 3AY9A 5M1QA 3WXKA 3VETA 2D0PA 1NGAA 1SQKA 4L3QA 3AGRA 3MN5A 3K9KA 1GLEG 4B1VA 2W40A 3OA9A 3VGLA 5AQTA 4Z94A 3ZETB 4BRCA 4C1NK 5AZJB 3MN9A 4BGAA 2DPNA 3CETA 4KBOA 3R3LA 3GL1A 3ID6A 3KK7A 3CHWA 5KQ8A 2A41A 3CC7N 3CCUN 3TSUA 2Q1NA 4BRPA 3RSEA 1DKGD 1GLBG 4BC4A 2A3ZA 3ZX0A 5AZIA 4OO1J 2E2NA 5AQHA 1S22A 4MDBA 1XUPO 4FPBA 2ZJQL 5C0YA 5GIOA 3G71N 4BRNA 1DEJA 4FWNA 1RDUA 1VQKN 3NVKA 4G9ZA 1Q7YO 3C6HA 3ZX2A 1TUUA 4DCHA 3VMFB 3WEEB 1BUPA 1T3VA 1NBWA 3O6WA 3VENA 3ZETA 4CBWA 5AZJA 1K9MO 1BDGA 3FR0A 1YXQA 3KHYA 2QXLA 2PBDA 2HBLA 3VEYA 1QHAA 2GELA 4BRLA 3GG4A 5C12A 1HKBA 3VOVA 4EFHA 4WFBL 3FZLA 3HOSA 4JKEA 4IEEA 1BO5O 3A5LC 3NMUA 1E4FT 4WQ4A 3S41A 3CMEN 1YJWN 5M1NA 3CCQN 2ASMA 3LM9A 4A2AA 4DKWA 5I9EB 3LDQA 4PL8A 3M1FA 1ESVA 2D0OA 3VEXA 1EQYA 2NLXA 1VQ8N 3WEEA 4CZGA 1ZC6A 5AQVA 3O5BA 4ISFA 3A5MC 4WQ5C 1GLAG 3H3OB 2QTDA 2I7PA 4GY2B 4O8UA 3A8YA 3HI0A 4B1WB 1T6DA 4U7BA 1M90O 4F9OA 5GADP 4BQLA 3U8XA 5GAEP 3ULEB 1IG8A 2P9LB 4FVUA 4IOCL 1NMDA 2VWBA 4WQ5A 4BRAA 1KXPA 5AQYA 3JS6A 1E4GT 1VQ7N 2CGJA 2D1KA 3T7ZA 4XH5A 2E8AA 4C1NI 3HBTA 1K8KB 4BRMA 3FZKA 5JICA 4JD2B 1YVNA 4FL9A 3TSQA 4B1YB 2P9KB 5BRDA 4GV9A 3MN6A 3ZX3A 1C0GA 4K43A 1SZ2A 3Q7BA 4JKFA 5ELZA 4BRFA 3EL2A 3GDQA 4FWLA 1WOQA 5GAGP 5KQDA 3H3NO 4CBUA 3CCJN 4NLCA 4BG9A 3JXUA 4A61A 1BA1A 1YF5L 2F9WA 2P9PB 5AQNA 1RDWX 3CC2N 3O1BA 4CZFA 4AM7A 1HPMA 1HJOA 2E20A 2F9TA 3FZHA 2FF6A 2AA4A 4JNEA 2Q0UA 1N8RO 3G25A 1SAZA 3ULEA 3IKMA 1VQPN 5EOYA 4JK8A 4A62A 5BN8A 3DLLL 1GLCG 4IJNA 4OPHA 3GE1A 1Q81O 1K8KA 4O8KA 5AQJA 1YIJN 4GNIA 4JD2A 4M7YA 5HOOA 3ENBA 2P9KA 4HTLA 2H3GX 2OTLN 1Q18A 3O9SA 2GUPA 3LL3A 3SJHA 1VQ9N 2QWPA 3WT0A 3M3ZA 4CD1A 1GLLO 3ATUA 3E1YA 1MDUB 3EN9A 3MDQA 5C15A 5KPZA 2F7TA 4YDUC 2P9PA 4BRKA 4FWRA 5BREA 1BG3A 1KC8O 3RVCA 2P9NB 3DAWA 3HTVA 4A59A 3ID8A 3GOIA 3L6QA 5B8HA 1VQ6N 2HBMA 1NGCA 2V51B 4MO4A 1T44A 4IZ9A 3ENOA 3I56N 1HKGA 4YDUA 3VPZA 3KZBA 3I8BA 2ZJRL 1BU6O 2CH5A 3O4WA 5DM6L 1KAYA 2OTJN 3B8AX 4FWMA 2ZGZA 3NVMA 1WUAA 2ITMA 1C0FA 5AQGA 3WXJA 4H0OA 2JWLA 5ADXA 1QVGM 4EAHD 2QI2A 3MCAB 1QQMA 5AR0A 1KQSM 4CZIA 3N4PA 5JLFA 1W97L 4JKAA 3O9UA 1HUXA 3H45C 2QEXN 3DWLA 4JKBA 4KH4A 3C7NB 5EY4A 4ISGA 2P9NA 4ISEA 4BC2A 1GLJO 2V52B 3KVGA 1XQSC 3U9ZA 3SLCA 3QB0A 3TTDA 4I6MA 3MK6A 5HL7L 3EKSA 4H5WA 4CZJA 2VGMA 4CZEA 2NRXA 3R6MA 2NRHA 3VTIA 2E2QA 1JCGA 2HSTA 5BPNA 1GLFO 3HM8A 3L4QA 5LY3A 3CD6N 2KHOA 3CCEN 4GVEA 1VQNN 1BOTO 3QMLA 3LDPA 2E2PA 3CJAA 5EXWA 5E26A 4B1UB 4XH1A 4GV3A 1V4TA 3LM2A 2HOEA 3VF2A 3H46O 4H0XB 3DXMB 1YUWA 4JEPA 5FPEA 2YJFA 3MWPA 3QFUA 4Y0WA 1DT9A 3LDNA 5AQMA 4BQZA 5F1XA 1YITN 5AQZA 3C7NA 3CJBA 1R59O 4ILHA 4K41A 2IVNA 3D2EB 2A42A 2VGNA 3FZMA 2ZF5O 3CPEA 3OBWA 4WFNL 1BA0A 2YI1A 2IVPA 1D4XA 3SBGA 1NJIO 3EKUA 3HRGA 4BRDA 3J7ZO 2CH6A 2ASPA 4H5TA 2A5XA 2Q36A 2QW9A 3TTFA 4FWSA 4JKGB 3TU5A 1Y64A 5AQOA 2FSKA 5JVHL 4IOXA 3BP8A 3K9JA 3P39A 4WFAL 3EO3A 2NNWA 4IO9L 5GIPA 4E1JA 1ILYA 3LDOA 3FE1A 3CERA 3DXMA 3SMPA 4KH6A 5LJVA 1HLUA 5LJWA 4QS8A 1KD1O 2V7YA 5EX5A 2QM1A 1QQNA 3D2EA 3U4LA 1Q86O 1TYQA 3VGMA 4H0PA 3VEZA 2P9IB 2PFUA 4YOXA 2Q0RA 3P38A 4H03B 4IO8A 2NRVA 3VEVA 4FWPA 5CE3A 2QWRA 4JKGA 2QWLA 3SK3A 4CZKA 4DHYA 3MX2A 3WUHA 3G4SN 1X3MA 4JAXA 3EZWA 4FSVA 3I55N 3R1XA 3T69A 3L0QA 3UE5A 4BG8A 2FXUA 4XEIA 4A57A 4IOAL 4MLHA 3MCPA 5GAHP 1BWFO 4PL7A 2V7ZA 3IDHA 2E1YA 1NM1A 1VQON 1MWMA 3O8MA 3P31A 4BC5A 1QZ5A 3CI5A 3H6EA 3J8AA 1JCFA 3PIPL 1OKJA 3PIOL 3AGKA 5AQQA 1VQ5N 1NGBA 2P9IA 4QS7A 2NRTA 1RFQA 3MN7A 3CC4N 4CI6A 3SAGA 3FLCO 5BRFA 3VF6A 3SMSA 3VESA 4B1ZA 3A5NC 1Z6RA 2Q31A 3WXMB 3DJCA 5JMVA 1MA9B 4BROA 5FPMA 1K73O 1U2VB 2WC9A 4JN4A 3E9LA 1QQOA 3VERA 3QFPA 4QS9A 1VQLN 2OANA 1S3XA 3IMXA 3TPQA 4ILJA 3ZEUB 5JLHA 1NGGA 4H0VB 4JK7A 2HBJA 4HWIA 1KAXA 4O5FA 5AQWA 4BREA 1Z05A 4OPAA 3N4QA 4PKIA 3IFRA 2VYPA 4I6MB 4B9QA 4RCHA 3QBWA 1X9JA 4FWQA 5AQIA 3CF5L 1W2BM 2NRRA 5DM7L 2EWSA 3G6EN 4IEIA 1NWKA 3CQXA 4JKDA 3I33A 3E9PA 3KWIA 3CXCM 4CBXA 5FPNA 2BUPA 3BEXA 5E84A 1KAZA 4RTFD 2BTFA 4DQ8A 4BY9C 1U2VA 3MWTA 3QDKA 2D4WA 2Q97A 4DB3A 3SBTA 3H1VX 4PHTX 2J4RA 2HMPA 2P9SB 3M5RA 3OHRA 3ZEUA 3VF4A 3R9PA 1NGIA 2RHKA 1P90A 5AQKA 3MX5A 5F0XA 3VGKA 4BGBA 1O13A 1Q82O 3PLAA 2I7NA 4ILGB 2FSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KPR A;  4MO5 A;  3WQU A;  4NB4 A;  2E2O A;  1GLD G;  4JHD B;  5AFU H;  3ENH A;  4XH4 A;  4FWK A;  4FPA A;  3FFK B;  1YAG A;  2A6A A;  4BR4 A;  3VEW A;  2YJE A;  4BR0 A;  4H0Y B;  2ASO A;  4FO0 A;  2P9S A;  5BN9 A;  5ADX H;  3H1Q A;  2QWN A;  4BRQ A;  1XC3 A;  2QWO A;  1TYQ B;  1MWK A;  1ATR A;  3L4I A;  4IWV A;  1J6Z A;  4K25 A;  5AQX A;  1IJJ A;  2AP1 A;  3A5O C;  4JHD A;  5AQS A;  4WQ4 C;  4IJA A;  1LCU A;  4M7X A;  5FPD A;  3UKR B;  1ATS A;  1NGF A;  2E1Z A;  2IIR A;  4CZH A;  2IVO A;  3GBT A;  3AAQ A;  4AM6 A;  3QIC A;  2VCP A;  2GEM A;  2FLO A;  3LDL A;  4BVP A;  2NZT A;  5BPM A;  2P9U B;  5KPT A;  4BR7 A;  1RGI A;  2A40 A;  3CJ9 A;  3UKU B;  1G99 A;  2CGK A;  3R8E A;  3A0I X;  2ZWH A;  2YHY A;  1NGH A;  2FSJ A;  2QWM A;  4H5N A;  1CZA N;  2YCH A;  5BPL A;  4CZM A;  3HZ6 A;  3QBX A;  4C23 A;  3UKR A;  1V4S A;  2Q2R A;  3D2F B;  4B1X B;  1NGD A;  3FGU A;  1U6Z A;  2HF4 A;  2GTD A;  3ATV A;  2P9U A;  3C0B A;  4EHU A;  3CJC A;  4FWO A;  4K42 A;  4MLE A;  3VEO A;  3CJ7 A;  4RWT A;  3CIP A;  1H1V A;  1HX1 A;  4PKH A;  4H0T B;  3UKU A;  4CZL A;  5AQU A;  1NLV A;  2YHX A;  2CGL A;  1QZ6 A;  4M63 C;  3O1W A;  4BRG A;  1ZXO A;  2UYT A;  1LOT B;  1DGK N;  2WUS A;  4CJ7 A;  1NGE A;  5BRH A;  3O80 A;  3BUZ B;  4EIA A;  4H5R A;  5AQR A;  3AAP A;  1T6C A;  3DXK B;  4FOE A;  5AQL A;  3D2F A;  3WQT A;  3W3D A;  4EHT A;  4BC3 A;  1JCE A;  3AAR A;  3P4I A;  2P9L A;  3MMV A;  3O08 A;  3W0L A;  4BR2 A;  1HKC A;  4FOI A;  2E88 A;  2FF3 B;  5AQF A;  3F9M A;  3BF1 A;  3WXL A;  3UB5 A;  2ZGY A;  5TKY A;  1P8Z A;  1NGJ A;  2GWK A;  1ZBS A;  2HF3 A;  3WXI A;  4CD3 A;  2YHW A;  3HSC A;  4BRI A;  2PAV A;  4BR5 A;  1TUY A;  4H5V A;  5AQP A;  1X3N A;  3CQY A;  2GWJ A;  3IUC A;  4IXC A;  4NO7 A;  4A2B A;  5F2R A;  4PKG A;  3DXK A;  4J8F A;  5BR9 A;  1ATN A;  3CJ1 A;  2W41 A;  5AFU A;  4BRH A;  4LC9 B;  3RSE B;  5EVZ A;  3D7E O;  3FZF A;  5AZI B;  3U9D A;  4BVO A;  3BF3 A;  4WYB A;  3M6G A;  4BR9 A;  2QWQ A;  3AY9 A;  3WXK A;  3VET A;  2D0P A;  1NGA A;  1SQK A;  4L3Q A;  3MN5 A;  1GLE G;  4B1V A;  2W40 A;  3VGL A;  5AQT A;  4Z94 A;  3ZET B;  4BRC A;  5AZJ B;  3MN9 A;  4BGA A;  2DPN A;  3CET A;  4KBO A;  3GL1 A;  3CHW A;  5KQ8 A;  2A41 A;  2Q1N A;  4BRP A;  3RSE A;  1DKG D;  1GLB G;  4BC4 A;  2A3Z A;  3ZX0 A;  5AZI A;  2E2N A;  5AQH A;  1S22 A;  1XUP O;  4FPB A;  4BRN A;  1DEJ A;  4FWN A;  3ZX2 A;  1TUU A;  4DCH A;  3WEE B;  1BUP A;  1NBW A;  3O6W A;  3VEN A;  3ZET A;  4CBW A;  5AZJ A;  1BDG A;  3FR0 A;  1YXQ A;  3KHY A;  2QXL A;  2PBD A;  3VEY A;  4BRL A;  1QHA A;  2GEL A;  3GG4 A;  1HKB A;  3VOV A;  4EFH A;  3FZL A;  1BO5 O;  3A5L C;  1E4F T;  4WQ4 A;  3S41 A;  2ASM A;  3LM9 A;  4A2A A;  5I9E B;  3LDQ A;  4PL8 A;  3M1F A;  1ESV A;  2D0O A;  3VEX A;  1EQY A;  2NLX A;  3WEE A;  4CZG A;  1ZC6 A;  5AQV A;  3O5B A;  4ISF A;  3A5M C;  4WQ5 C;  1GLA G;  3H3O B;  2I7P A;  4GY2 B;  3A8Y A;  3HI0 A;  4B1W B;  1T6D A;  4F9O A;  4BQL A;  3U8X A;  3ULE B;  1IG8 A;  2P9L B;  1NMD A;  2VWB A;  4WQ5 A;  4BRA A;  1KXP A;  5AQY A;  3JS6 A;  1E4G T;  2CGJ A;  2D1K A;  4XH5 A;  2E8A A;  3HBT A;  1K8K B;  4BRM A;  3FZK A;  5JIC A;  4JD2 B;  1YVN A;  4FL9 A;  4B1Y B;  5BRD A;  2P9K B;  3MN6 A;  3ZX3 A;  1C0G A;  4K43 A;  1SZ2 A;  4BRF A;  5ELZ A;  3EL2 A;  3GDQ A;  4FWL A;  1WOQ A;  5KQD A;  3H3N O;  4CBU A;  4BG9 A;  3JXU A;  4A61 A;  1BA1 A;  2F9W A;  2P9P B;  5AQN A;  1RDW X;  3O1B A;  4CZF A;  4AM7 A;  1HPM A;  1HJO A;  2E20 A;  2F9T A;  3FZH A;  2FF6 A;  2AA4 A;  4JNE A;  2Q0U A;  3G25 A;  1SAZ A;  3ULE A;  5EOY A;  4A62 A;  5BN8 A;  1GLC G;  4IJN A;  3GE1 A;  1K8K A;  4O8K A;  5AQJ A;  4GNI A;  4JD2 A;  4M7Y A;  2P9K A;  4HTL A;  2H3G X;  1Q18 A;  2GUP A;  3LL3 A;  3SJH A;  2QWP A;  3WT0 A;  3M3Z A;  4CD1 A;  1GLL O;  3ATU A;  1MDU B;  3EN9 A;  3MDQ A;  5KPZ A;  4YDU C;  2P9P A;  4BRK A;  4FWR A;  5BRE A;  1BG3 A;  2P9N B;  3DAW A;  3HTV A;  5B8H A;  3ID8 A;  3GOI A;  3L6Q A;  1NGC A;  2V51 B;  4MO4 A;  1T44 A;  4IZ9 A;  3ENO A;  1HKG A;  4YDU A;  3VPZ A;  3KZB A;  3I8B A;  1BU6 O;  2CH5 A;  3O4W A;  1KAY A;  3B8A X;  4FWM A;  2ZGZ A;  1WUA A;  2ITM A;  1C0F A;  5AQG A;  3WXJ A;  4H0O A;  5ADX A;  4EAH D;  1QQM A;  5AR0 A;  4CZI A;  5JLF A;  1HUX A;  3H45 C;  3DWL A;  3C7N B;  5EY4 A;  4ISG A;  2P9N A;  4ISE A;  4BC2 A;  1GLJ O;  2V52 B;  3KVG A;  1XQS C;  3U9Z A;  3SLC A;  3QB0 A;  4I6M A;  3MK6 A;  3EKS A;  4H5W A;  4CZJ A;  4CZE A;  3R6M A;  2NRH A;  2E2Q A;  1JCG A;  5BPN A;  1GLF O;  3HM8 A;  5LY3 A;  2KHO A;  1BOT O;  3QML A;  3LDP A;  2E2P A;  3CJA A;  5EXW A;  5E26 A;  4B1U B;  4XH1 A;  1V4T A;  3LM2 A;  2HOE A;  3VF2 A;  3H46 O;  4H0X B;  3DXM B;  1YUW A;  5FPE A;  2YJF A;  3QFU A;  4Y0W A;  5AQM A;  3LDN A;  5F1X A;  4BQZ A;  5AQZ A;  3C7N A;  3CJB A;  1R59 O;  4K41 A;  2IVN A;  3D2E B;  2A42 A;  3FZM A;  2ZF5 O;  1BA0 A;  2YI1 A;  2IVP A;  1D4X A;  3EKU A;  4BRD A;  2CH6 A;  2ASP A;  4H5T A;  2A5X A;  2Q36 A;  2QW9 A;  4FWS A;  3TU5 A;  1Y64 A;  5AQO A;  2FSK A;  3BP8 A;  3EO3 A;  4E1J A;  3LDO A;  3FE1 A;  3CER A;  3DXM A;  3SMP A;  5LJV A;  1HLU A;  5LJW A;  4QS8 A;  2V7Y A;  5EX5 A;  2QM1 A;  1QQN A;  3D2E A;  3U4L A;  1TYQ A;  3VGM A;  4H0P A;  3VEZ A;  2P9I B;  2Q0R A;  4H03 B;  4IO8 A;  3VEV A;  4FWP A;  5CE3 A;  2QWR A;  2QWL A;  3SK3 A;  4CZK A;  4DHY A;  3WUH A;  1X3M A;  4JAX A;  3EZW A;  4FSV A;  3L0Q A;  3UE5 A;  4BG8 A;  2FXU A;  4XEI A;  4MLH A;  3MCP A;  1BWF O;  4PL7 A;  2V7Z A;  3IDH A;  2E1Y A;  1NM1 A;  1MWM A;  3O8M A;  4BC5 A;  1QZ5 A;  3CI5 A;  3H6E A;  3J8A A;  1JCF A;  1OKJ A;  5AQQ A;  1NGB A;  2P9I A;  4QS7 A;  1RFQ A;  3MN7 A;  4CI6 A;  3FLC O;  5BRF A;  3VF6 A;  3SMS A;  3VES A;  4B1Z A;  3A5N C;  1Z6R A;  2Q31 A;  3DJC A;  5JMV A;  1MA9 B;  4BRO A;  5FPM A;  1U2V B;  4JN4 A;  1QQO A;  3VER A;  3QFP A;  4QS9 A;  2OAN A;  1S3X A;  3IMX A;  3TPQ A;  3ZEU B;  5JLH A;  1NGG A;  4H0V B;  4HWI A;  1KAX A;  4O5F A;  5AQW A;  4BRE A;  1Z05 A;  4PKI A;  3IFR A;  2VYP A;  4I6M B;  4B9Q A;  4RCH A;  3QBW A;  1X9J A;  4FWQ A;  5AQI A;  2EWS A;  1NWK A;  3CQX A;  3I33 A;  4CBX A;  5FPN A;  2BUP A;  3BEX A;  5E84 A;  1KAZ A;  4RTF D;  2BTF A;  4DQ8 A;  1U2V A;  3QDK A;  2D4W A;  2Q97 A;  4DB3 A;  3H1V X;  2J4R A;  2HMP A;  2P9S B;  3OHR A;  3ZEU A;  3VF4 A;  3R9P A;  1NGI A;  5AQK A;  5F0X A;  3VGK A;  4BGB A;  2I7N A;  2FSN A; 
#chains in the Genus database with same CATH topology
 3AVN A;  4I2Q A;  3WQU A;  2DY4 A;  5C10 A;  1GLD G;  5AFU H;  4CEO A;  4FWK A;  4FPA A;  1NOZ A;  2F8T A;  1YAG A;  2HHQ A;  3MEC A;  2YJE A;  1NMN A;  3ZSO A;  2YX6 A;  2P9S A;  4KV8 A;  5C2F A;  3H1Q A;  5A2Q O;  4HTU A;  1J5O A;  2QWN A;  3F5T A;  1J6Z A;  4N76 A;  1IJJ A;  5LMU K;  3T19 A;  2GX9 A;  5AQS A;  4WQ4 C;  4IJA A;  2KQ2 A;  4M7X A;  5TKW A;  4DV0 K;  3UKR B;  4YOR A;  4DFJ A;  3GBT A;  1KLN A;  4AM6 A;  1OVY A;  1KVB A;  4CHP A;  4X62 K;  4OGC A;  1FKO A;  4A5B A;  4GV6 A;  1QS4 A;  2NZT A;  4DSK A;  2A40 A;  1C1B A;  1NK4 A;  3PX6 A;  4ZTF A;  4UQG A;  3R8E A;  1XC9 A;  1NGH A;  4BDY A;  3AA4 A;  5SWM A;  3D0P A;  4B08 A;  2HW3 A;  3TI0 A;  1TL3 A;  4PA1 A;  5JVG L;  2BH1 A;  3D2F B;  4IFE A;  1WSG A;  1SS6 A;  3FGU A;  4J2D A;  1U6Z A;  4AHR A;  3CMA N;  3C0B A;  3HYF A;  5CHI A;  4DFK A;  4LF8 K;  4JKC A;  3CIP A;  4KO0 A;  3RMA A;  4AHC A;  2G8K A;  1QZ6 A;  4FM1 A;  3O1W A;  4LFC K;  4DV4 K;  1ZXO A;  2UYT A;  1IBM K;  4DR5 K;  1DGK N;  5HRP A;  3SUP A;  2A1S A;  1NGE A;  2ZD1 A;  4EIA A;  3KK2 A;  3T3F A;  4H5R A;  5AQR A;  1J5E K;  4E1M A;  4JS4 A;  3WQT A;  4YOU A;  1O1W A;  4DSJ A;  4JI0 K;  3W0L A;  1HKC A;  3HL8 A;  1OH7 A;  1Q9Y A;  2E88 A;  3NHG A;  2ZJP L;  3WXL A;  3BF1 A;  3VQ6 A;  2ZGY A;  5TKY A;  1NGJ A;  2GWK A;  2HF3 A;  4KHW A;  3IAY A;  1HPZ A;  2YHW A;  3HSC A;  4M3U A;  1HNV A;  2YNI A;  3CYM A;  4H5V A;  5AQP A;  2HHS A;  3Q7C A;  4NO7 A;  1S9E A;  4JI1 K;  3M8S A;  4KRF A;  5AFU A;  4BRH A;  3P1G A;  1NK7 A;  1WBB A;  3C6A A;  3SJJ A;  1YTA A;  3QLH A;  4WYB A;  3VQ5 A;  2QWQ A;  5M1Q A;  1BIS A;  2D0P A;  3DI6 A;  4DSF A;  3AGR A;  1S6P A;  3K9K A;  1S9G A;  4GW6 A;  3VGL A;  4E7H A;  1NK9 A;  3QO9 A;  1KCF A;  3DLH A;  4IDK A;  4BGA A;  3LP3 A;  1VK0 A;  3NF6 A;  4KBO A;  3LDS A;  3ID6 A;  4C8K A;  3SZ2 A;  3KK7 A;  2A41 A;  5DK5 A;  3TSU A;  1HMV A;  4BC4 A;  1S1X A;  2A3Z A;  1WAF A;  4OO1 J;  5AQH A;  4MDB A;  3OYG A;  4FPB A;  3P5J A;  4KB0 A;  3HO1 A;  5C0Y A;  3G10 A;  3G71 N;  3NVK A;  1EWR A;  1Q7Y O;  3L2V A;  3OYB A;  3DRS A;  4CJF A;  3VMF B;  1NBW A;  3ZET A;  1KVC A;  2KTQ A;  4KKO A;  5AZJ A;  2GEL A;  1HKB A;  3VOV A;  4FYD A;  3FZL A;  1C6V A;  5LL6 Z;  4FJX A;  2O8E A;  3V9S A;  4AQY K;  3CME N;  3RRH A;  2PYJ A;  3SV4 A;  4N47 A;  2W6K A;  2KFZ A;  4DTR A;  3VEX A;  1ASV A;  2UXC K;  3JYT A;  4CZG A;  1WSI A;  4I9Q A;  5C24 A;  3TAQ A;  5FRO A;  2OPR A;  1VSH A;  1C0U A;  5AQV A;  5T7B A;  1RNH A;  4FJ8 A;  4WQ5 C;  4CJU A;  4X65 K;  3ZT0 A;  4KHU A;  1WLJ A;  1GLA G;  3A8Y A;  3HI0 A;  3QEW A;  4U7B A;  4BQL A;  3U8X A;  1IG8 A;  3S3N A;  4FVU A;  4IOC L;  1NMD A;  3SI6 A;  4WQ5 A;  5AQY A;  2FBX A;  2KW4 A;  4C1N I;  4XH5 A;  4BRM A;  4M3W A;  3VQB A;  2JLE A;  3MN6 A;  4LSN A;  2XY8 A;  2WTU A;  4JKF A;  3V4I A;  5I42 A;  1NJX A;  3GDQ A;  5GAG P;  1SUQ A;  1RCH A;  3H3N O;  4CBU A;  2PZS A;  4BG9 A;  3LWM A;  3MXM A;  2P9P B;  1RDW X;  2KZZ A;  4CZF A;  1HJO A;  3FZH A;  1IKY A;  3IKM A;  4JRP A;  4DQS A;  3EYZ A;  4A62 A;  5BN8 A;  4JS5 A;  4FJM A;  1G15 A;  5FRN A;  4IJN A;  1IKX A;  3GE1 A;  4O8K A;  4CGG A;  5AQJ A;  3TAB A;  4GNI A;  5HOO A;  4FJH A;  2OPQ A;  2QWP A;  3E1Y A;  1L5U A;  3EN9 A;  1JLG A;  4FWR A;  5BRE A;  1KC8 O;  3EEQ A;  1VQ6 N;  3NCI A;  2HBM A;  1NGC A;  1XNQ K;  1CXU A;  4Z4F A;  3BY5 A;  3THX B;  4H0O A;  4FJI A;  1VRU A;  3O4N A;  1KQS M;  3AVC A;  4CZI A;  4O44 A;  2AJQ A;  3AVM A;  3LP1 A;  2W6L A;  1VHX A;  3I8D A;  1W97 L;  3P83 D;  4JKB A;  4KH4 A;  3C7N B;  3OYE A;  4KI4 A;  2P9N A;  4ISE A;  4BC2 A;  1GLJ O;  2V52 B;  3U9Z A;  4FJG A;  3LP2 A;  3AVA A;  3SLC A;  3SQ0 A;  4CE9 A;  4I6M A;  3MK6 A;  2NRX A;  3V1O A;  2E4L A;  4DSE A;  3ZT4 A;  5BPN A;  4AHV A;  1IKW A;  3CD6 N;  1ITG A;  4JRQ A;  5IT9 O;  3CJA A;  5EXW A;  3NF9 A;  5E26 A;  3KJV A;  3LM2 A;  3BZK A;  3DXM B;  4JEP A;  4GKJ K;  1VSF A;  4FLY A;  4CGH A;  1DT9 A;  1S6Q A;  1NKC A;  5AQZ A;  3D2E B;  2G8W A;  4LF9 K;  2IGI A;  2YI1 A;  1D4X A;  3SBG A;  3T1H K;  1UWB A;  3HRG A;  4FJK A;  3OJS A;  4H5T A;  2A5X A;  2Q36 A;  1RTD A;  4PY5 A;  2B4J A;  5JVH L;  1JXE A;  2FSK A;  4CFD A;  4CHN A;  4DF4 A;  3P39 A;  3UIQ A;  3EO3 A;  4AIL C;  5GIP A;  1GOB A;  4RW4 A;  3T1A A;  3LDO A;  3J80 O;  3CER A;  2HHU A;  1BI4 A;  4Q0B A;  2F96 A;  4KH6 A;  5LJV A;  4IFV A;  4OKE A;  3NH1 A;  2ETJ A;  2QM1 A;  1QQN A;  1KFD A;  2XHB A;  2EX3 A;  3NAE A;  4YOX A;  1Q8I A;  2Q0R A;  1YTU A;  4GKK K;  4DMN A;  5CE3 A;  4JKG A;  3SK3 A;  3MX2 A;  1RT5 A;  3I55 N;  2UXB K;  4FSV A;  3R1X A;  1LW0 A;  5HRR A;  3L0Q A;  4W5Q A;  2FXU A;  4FLU A;  4MLH A;  1NM1 A;  1MWM A;  3O8M A;  4CEF A;  1OKJ A;  3PIO L;  3AGK A;  1BQM A;  4BWM A;  2VQF K;  4H4M A;  2HB5 A;  2WOM A;  4FLW A;  5BRF A;  1HNW K;  3TAE A;  4B1Z A;  3JSM A;  1S5J A;  4JI3 K;  4CJE A;  3DJC A;  1K73 O;  4RW7 A;  4JN4 A;  1C0M A;  1VQL N;  1YT3 A;  3TPQ A;  1LWE A;  5JLH A;  1NGG A;  1W9H A;  1REV A;  1HYZ A;  3V9W A;  2VG7 A;  5AQW A;  4PKI A;  4FWQ A;  3PX0 A;  3QNN A;  4X64 K;  1NWK A;  3CQX A;  3SQ1 A;  2O8F A;  4M3Z A;  4FJN A;  3KD5 E;  4RTF D;  2BTF A;  4G1Q A;  4BY9 C;  1NNE A;  4OLB A;  4BE0 A;  4PHT X;  2J4R A;  3OHR A;  4LFB K;  2HHH K;  4EZ6 A;  3VQ8 A;  5CYM A;  1TK0 A;  4Z4H A;  5F0X A;  3AVH A;  3OYN A;  3O3G A;  1UAX A;  2E2O A;  4JHD B;  5JS2 A;  3ZYY X;  2HVI A;  4R79 A;  4B9L A;  3VQD A;  3C65 A;  4XIU A;  3AV9 A;  1RIL A;  2WBN A;  4BR0 A;  3EY1 A;  4YOV A;  4H0Y B;  4KB1 A;  2ASO A;  4FO0 A;  4CJ4 A;  5ADX H;  5BN9 A;  5CY4 A;  4KFB A;  4F8R A;  2OPS A;  1BQN A;  4QCL A;  1QQC A;  1SL0 A;  3L4I A;  2IOC A;  2AP1 A;  3EE8 A;  3A5O C;  3QER A;  3EE9 A;  3NF7 A;  1X9S A;  3TSP A;  2IIR A;  4CZH A;  1BGX T;  3QIC A;  3HPH A;  4U67 L;  2GEM A;  3LDL A;  1HNZ K;  4KTW A;  3LWL A;  3CJ9 A;  3SUN A;  3UKU B;  3CPW M;  2XY5 A;  4IFY A;  2RE2 A;  1WAJ A;  2YHY A;  3CFR A;  4DUY K;  4LSL A;  4OJR A;  4I9L A;  5GIN A;  3OW2 M;  2QWM A;  3S9H A;  4B9U A;  4ZTJ A;  1N36 K;  1CZA N;  2Z1I A;  3KLG A;  2KKZ A;  3HZ6 A;  4C23 A;  3NGZ A;  2BGG A;  1S1W A;  4MFB A;  3PO5 A;  3DLK A;  4CFB A;  1M1K O;  1V4S A;  3VQA A;  1NGD A;  4YOW A;  4LH5 A;  1EO1 A;  4MQ3 A;  2P9U A;  3C6T A;  1OH6 A;  3VEO A;  4PKH A;  1H1V A;  4H0T B;  4CZL A;  5AQU A;  5MLC Q;  2YHX A;  1EX4 A;  3SYZ A;  4B8C A;  3HM9 A;  1IBL K;  2Z1G A;  1JJ2 M;  3OJU A;  2HHV A;  4CJ7 A;  1S72 N;  2WFB A;  3O80 A;  4F4K A;  4C8O A;  1SKW A;  1WSJ A;  4FOE A;  3V1Q A;  4DS4 A;  2NRZ A;  3J7Y P;  3W3D A;  3HVT A;  4CJ5 A;  3HPO A;  3J7A P;  4ICL A;  3MMV A;  3O08 A;  3JAM O;  3CCR N;  3O9Q A;  2P51 A;  3WXI A;  4BRI A;  1RDD A;  4BR5 A;  4DF8 A;  4DQQ A;  1FJG K;  2B5J A;  1ZBF A;  4IG3 A;  2B6A A;  3DXK A;  3QNO A;  4J8F A;  1ATN A;  3CJ1 A;  3RSE B;  3FZF A;  3SAF A;  3HOT A;  3SAH A;  2HMI A;  3U9D A;  4F2R A;  3WXK A;  1SQK A;  1NJW A;  1GLE G;  1DLO A;  3OY9 A;  3OA9 A;  3KD1 E;  5AQT A;  4BRC A;  3CFP A;  3ZT3 A;  3R3L A;  4KHP K;  1MU2 A;  2VG6 A;  3CHW A;  5KQ8 A;  4DR3 K;  4FK2 A;  3CC7 N;  1GLB G;  5AZI A;  4B9V A;  2E2N A;  1XUP O;  2O8D B;  5GIO A;  4BRN A;  4G9Z A;  4FWN A;  2G8U A;  1BUP A;  4C8M A;  3DM2 A;  1K9M O;  1BDG A;  4QAG A;  2UUB K;  4BRL A;  4WFB L;  4EFH A;  3SCX A;  5FDL A;  4FJ9 A;  4WQ4 A;  3S41 A;  5KTQ A;  3HP6 A;  1YJW N;  4CF0 A;  4KTQ A;  3CCQ N;  2ASM A;  1T8E A;  4DR4 K;  4OX9 K;  3LDQ A;  1U48 A;  4HUG A;  3M1F A;  1ESV A;  2D0O A;  2NLX A;  3RWU A;  1VQ8 N;  3WEE A;  3THY B;  4LF6 K;  3K57 A;  5KGW A;  3B6O A;  4DV6 K;  1X1P A;  3AO1 A;  3AA2 A;  2G8F A;  4DFP A;  4DFM A;  1TGO A;  4KHQ A;  1M90 O;  4CJ3 A;  5GAE P;  4DS5 A;  3ULE B;  2P9L B;  3OYD A;  4DQR A;  4OVL A;  1RTJ A;  4NYF A;  1VQ7 N;  3NDK A;  2D1K A;  3HBT A;  1K8K B;  2QKK A;  1YVN A;  5BRD A;  3TSQ A;  5D3G A;  1C0G A;  4B8A B;  1SZ2 A;  3Q7B A;  4BRF A;  2G8V A;  3EL2 A;  3NH0 A;  5KQD A;  3CCJ N;  5HBM A;  4NLC A;  3JXU A;  1SL1 A;  2F9W A;  3A2F A;  3QIN A;  4O4G A;  3CM5 A;  3DLB A;  4AM7 A;  2F9T A;  2FF6 A;  1U4B A;  4NCB A;  4CVN E;  5J1E A;  2AA4 A;  2Q0U A;  1SAZ A;  1Y97 A;  4DR2 K;  2DFH A;  1EET A;  4JD2 A;  4C8L A;  2P9K A;  1Q18 A;  3SJH A;  4DV7 K;  4DSI A;  3WT0 A;  4AH9 A;  4CD1 A;  4BE1 A;  1MDU B;  3MDQ A;  5KPZ A;  1NKB A;  1RTI A;  2ZE2 A;  4YDU C;  4J2B A;  4M3X A;  3O3H A;  3RVC A;  4RW8 A;  3HTV A;  3L6Q A;  3ENO A;  1OH8 A;  3I56 N;  3LPT A;  4YDU A;  4E7K A;  1HR0 K;  3KZB A;  3I8B A;  2ITG A;  3SV3 A;  2XY6 A;  4CER A;  2OTJ N;  4FWM A;  2ZGZ A;  3NVM A;  1WUA A;  4CHQ A;  5AR0 A;  3OYC A;  3K5M A;  1N5Y A;  3VA0 A;  5I3U A;  3O9U A;  1HUX A;  2QEX N;  3RMC A;  3DWL A;  3AVF A;  4CGD A;  2IC3 A;  1D9F A;  3TTD A;  5HL7 L;  3EKS A;  4BAC A;  1S1U A;  2HST A;  3BGR A;  1GLF O;  3HM8 A;  3B6P A;  3CCE N;  4B1U B;  4GV3 A;  4XH1 A;  1V4T A;  2OCE A;  4OLA A;  3KKS A;  4H0X B;  1T7P A;  2YJF A;  4Y0W A;  3AVB A;  1EKE A;  4BQZ A;  1RT2 A;  1R59 O;  4K41 A;  2IVN A;  2A42 A;  4M3Y A;  2VGN A;  1RBT A;  2ZF5 O;  3FZM A;  3CPE A;  3OBW A;  4WFN L;  1TK5 A;  4DWI A;  2IVP A;  3ITH A;  4L8R B;  2DFF A;  1WSE A;  4BRD A;  1S1T A;  3J7Z O;  2CH6 A;  4TSX A;  2HNZ A;  5AQO A;  2HHT A;  4IOX A;  2O8C B;  3G0Z A;  3FE1 A;  3SMP A;  4LF4 K;  3O4Q A;  4N56 A;  3DOL A;  4QS8 A;  2V7Y A;  3VQ9 A;  4Z4C A;  3ZSZ A;  1R0A A;  2O8B B;  4DV5 K;  3SPZ A;  2PFU A;  5LMN K;  2PYL A;  4K8X A;  3MEG A;  4C8N A;  3TAF A;  1L3T A;  3ZSR A;  2QWR A;  3I0S A;  4DHY A;  3G4S N;  2DTU A;  4CFC A;  3UE5 A;  4BG8 A;  4DUZ K;  3TAG A;  4DU3 A;  2V7Z A;  3P31 A;  1KTQ A;  1QZ5 A;  1JCF A;  3I0R A;  5AQQ A;  1NGB A;  1ASU A;  1VSK A;  1HJR A;  2P9I A;  2NRT A;  4FZY A;  2P1J A;  3SAG A;  5E41 A;  1ZBU A;  3K2P A;  3VES A;  3OTO K;  1Z6R A;  3WXM B;  4W5T A;  5JMV A;  4O0J A;  3V9X A;  1S3X A;  3IMX A;  2QK9 A;  3ZEU B;  4JK7 A;  3C6U A;  2HBJ A;  1NG9 A;  4ID1 A;  1JLC A;  1KAX A;  4IKF A;  4CFA A;  4B9Q A;  1IBK K;  3QBW A;  1X9J A;  5HRS A;  4FJJ A;  5AQI A;  3CF5 L;  1W2B M;  3AVI A;  4FLZ A;  4IEI A;  4M42 A;  4JKD A;  1JLB A;  3AA3 A;  3BZC A;  3E9P A;  3I33 A;  3NGY A;  3CXC M;  1JLF A;  3THW A;  5E84 A;  3BEX A;  1JKH A;  1N32 K;  4B9S A;  4DQ8 A;  1U2V A;  2RN2 A;  4CIE A;  4FW2 A;  4DB3 A;  1RT7 A;  1BCO A;  1JLQ A;  3SBT A;  3H1V X;  4CGI A;  3THV A;  2P9S B;  4IG0 A;  1EP4 A;  3R9P A;  1NGI A;  4FLT A;  2RHK A;  2HNY A;  3MX5 A;  4BGB A;  3PLA A;  2I7N A;  4ILG B;  3NH2 A;  4LH4 A;  5KPR A;  4MO5 A;  1N6Q A;  1UA1 A;  1RT6 A;  4FLX A;  3ZSW A;  4DTU A;  1ASW A;  1I39 A;  4JI8 K;  4CJR A;  2A6A A;  4BR4 A;  3VEW A;  4JKH A;  3L2Q A;  2UXD K;  4CJK A;  3RMB A;  2UU9 K;  3KLE A;  2Z1J A;  4CJS A;  1XC3 A;  1MWK A;  3OYL A;  1ATR A;  4IWV A;  1NKE A;  2EHG A;  3ZCM A;  1RT3 A;  3ISN C;  2OPP A;  3DLG A;  4FK0 A;  5FPD A;  2IVO A;  4JK9 A;  4HCB A;  1QSL A;  1T05 A;  2VCP A;  2FLO A;  4GVM A;  5BPM A;  5KPT A;  4BR7 A;  4YHH K;  3AVJ A;  3HVR A;  4JI6 K;  1G99 A;  1RTH A;  2CGK A;  4B3T K;  4IDH A;  1C1C A;  4CF8 A;  4CEZ A;  4FCY A;  1YJN N;  4EZ9 A;  1N33 K;  1ZBI A;  3OBY A;  1C1A A;  4H5N A;  2X78 A;  4WF9 L;  5BPL A;  2VWJ A;  4PQU A;  3UKR A;  4F3T A;  3KTQ A;  2Q2R A;  1K8A O;  3ATV A;  5CR4 A;  2QA4 N;  4EHU A;  3CJC A;  3DRP A;  4FWO A;  4MLE A;  4WE1 A;  1HX1 A;  3ASM A;  1VSI A;  2D5R A;  2YKM A;  1NLV A;  4IBN A;  2CGL A;  2OZS A;  3VQ4 A;  4RG8 A;  4E3S A;  3SNN A;  3VQ7 A;  3OVN A;  4LD0 A;  4NCG A;  2G8I A;  4EP4 A;  5BRH A;  3BUZ B;  3EZ5 A;  2XY7 A;  1VAZ A;  3AAP A;  2G8H A;  2Q3S A;  3D2F A;  1NK0 A;  1U47 A;  4EHT A;  4O5B A;  3SQ2 A;  3CCV N;  1QSS A;  3AAR A;  3P4I A;  1RDA A;  3OS0 A;  2P9L A;  2FBV A;  1HRH A;  1QHT A;  3E01 A;  2FF3 B;  5AQF A;  1XI1 A;  1RDC A;  1WSF A;  1CZB A;  5H1S Q;  3J81 O;  4E7L A;  3F2K A;  3OYJ A;  1QSY A;  4HCC A;  3CQ8 A;  4CD3 A;  2PAV A;  3K58 A;  1TUY A;  1X3N A;  4PUO A;  2RF2 A;  3CQY A;  3IUC A;  4MDA A;  3OYM A;  3O9T A;  5F2R A;  1S1V A;  3PV8 A;  3QIP A;  3VQE A;  4LC9 B;  5EVZ A;  3H08 A;  4OGE A;  4BVO A;  3IRX A;  3BF3 A;  3MXJ A;  3CCL N;  4YNQ A;  3VET A;  1NGA A;  4L3Q A;  3MN5 A;  2W40 A;  3OS1 A;  2E6M A;  5J2M A;  1N34 K;  4Z94 A;  3ZET B;  5AZJ B;  2DPN A;  4PWD A;  3CET A;  3LPU A;  3GL1 A;  3IG1 A;  3PX4 A;  3CCU N;  2O8E B;  4FK4 A;  2LSN A;  2Q1N A;  4BRP A;  3ZX0 A;  4DTO A;  2ZJQ L;  3LP0 A;  1JLA A;  5K14 A;  1DEJ A;  1LAW A;  3C6H A;  3ZX2 A;  1TUU A;  4BDP A;  2D0A A;  1Z26 A;  3VEN A;  4CBW A;  3KHY A;  5FLX O;  1YXQ A;  2NUB A;  2QXL A;  3VEY A;  2HBL A;  1QHA A;  5C12 A;  3HOS A;  1RBV A;  1LAV A;  3NMU A;  1I94 K;  4DV3 K;  1RT4 A;  4J2E A;  3LM9 A;  2UUA K;  4NXN K;  5I9E B;  3LAK A;  4Z4G A;  4DLG A;  1EQY A;  1LW2 A;  3FFI A;  2QKB A;  4N41 A;  4M3T A;  3DLR A;  1ZC6 A;  3KK1 A;  4FVM A;  1ZYQ A;  4ISF A;  1BIU A;  4X66 K;  1LWC A;  2KZM A;  3K5N A;  4B1W B;  4B3S K;  5BR8 K;  4M45 A;  4B9T A;  4FLV A;  4BRA A;  3V9U A;  3JS6 A;  4CEA A;  3T7Z A;  2E8A A;  4FZX C;  4FM2 A;  2RPI A;  4FL9 A;  4B1Y B;  4GV9 A;  3DOK A;  3SQ4 A;  1RDB A;  5ELZ A;  4NCA A;  1IH7 A;  4FWL A;  1BA1 A;  3O1B A;  1WB9 A;  2I5J A;  1HPM A;  1SV5 A;  4JNE A;  3G25 A;  3SUO A;  4H8K A;  4I7F A;  3M8Q A;  5EOY A;  1VQP N;  4FJ7 A;  3AVL A;  3C94 A;  1ZBL A;  4B3M K;  3DRR A;  3PO4 A;  4HTL A;  4FXD A;  2GUP A;  5IWA K;  3T1Y K;  2FC0 A;  4JLH A;  1OH5 A;  4ID5 A;  5C15 A;  2P9P A;  2A1R A;  4Z4I A;  2GUI A;  2P9N B;  1JL1 A;  3DAW A;  4A59 A;  3ID8 A;  3GOI A;  5B8H A;  4F2S A;  2V51 B;  3TWH A;  4IZ9 A;  5CZ2 A;  1Z25 A;  3VPZ A;  1BU6 O;  3PSI A;  3VA3 A;  2HVH A;  2CH5 A;  3AVG A;  3TAM A;  2D0B A;  2ITM A;  5ADX A;  5AQG A;  1QVG M;  1CXQ A;  3MEE A;  4CHO A;  4DQI A;  4EAH D;  1WSH A;  1I3A A;  3MCA B;  3AO4 A;  1NK5 A;  4DQP A;  5CZ1 A;  3PUF A;  3N4P A;  2YHA A;  5JLF A;  1KSP A;  3BDP A;  4DTJ A;  1NK8 A;  3PY8 A;  1X9W A;  4FZZ A;  3KVG A;  1U45 A;  3U3Y A;  1XQS C;  3KLI A;  3QB0 A;  1VSL A;  4H5W A;  1KVA A;  4CZJ A;  2VGM A;  2KFN A;  4CZE A;  3R6M A;  3VTI A;  4KPY A;  2E2Q A;  1JCG A;  4CIF A;  3QEX A;  3THX A;  4Q5V A;  5LY3 A;  5SZT A;  4GVE A;  1VQN N;  1BOT O;  3M8P A;  3OYH A;  2E2P A;  3VQQ A;  4W5N A;  3VF2 A;  2HOE A;  5HLF A;  1YUW A;  1BI4 B;  4R5P A;  3MWP A;  5AQM A;  3LDN A;  5F1X A;  3C7N A;  3RR7 A;  3CJB A;  1E3M A;  1J9A A;  1W7A A;  1XWL A;  2Y1J A;  1BA0 A;  4OKK A;  4CF2 A;  2W42 A;  4DU1 A;  2ATQ A;  1VRT A;  2QW9 A;  3QES A;  3TTF A;  4JKG B;  1WNS A;  2D0C A;  4CED A;  3NFA A;  4WFA L;  2NNW A;  4LF5 K;  1ILY A;  3NBP A;  4AHT A;  3DXM A;  4DLE A;  4DTX A;  1HLU A;  5LJW A;  2UUC K;  1DTQ A;  4CJV A;  3D2E A;  3TAP A;  3VEZ A;  4HVJ A;  1KFS A;  1GOA A;  2BAN A;  3K5O A;  3P38 A;  1HYS A;  4H03 B;  1SKR A;  3VEV A;  4F3O A;  2HHX A;  2QWL A;  4CZK A;  3KK3 A;  3EZW A;  3LAL A;  3T69 A;  3ALY A;  4XEI A;  3L3V A;  1XMQ K;  4IOA L;  3MCP A;  5GAH P;  1BWF O;  3U3G A;  4PL7 A;  3AO3 A;  2E1Y A;  3K0S A;  2XRI A;  4BC5 A;  4NYN A;  3H6E A;  3PIP L;  3RRG A;  1VQ5 N;  4EP5 A;  4KHN A;  3MN7 A;  1TAQ A;  2RKI A;  4CHZ A;  5HRO A;  5HP1 A;  2E6L A;  3ZT1 A;  4DTS A;  3A5N C;  3WNF A;  4DG1 A;  4KAZ A;  2O8F B;  2Q31 A;  4B9M A;  1MA9 B;  4BRO A;  5FPM A;  4Z4E A;  1EWQ A;  3MED A;  1QQO A;  3VER A;  4QS9 A;  5C25 A;  2X6S A;  4ILJ A;  4E0D A;  4H0V B;  4CJP A;  4HWI A;  1FK9 A;  4W5O A;  2X74 A;  4BRE A;  2BDP A;  3MAQ A;  2VYP A;  5KGX A;  4OPJ A;  4RCH A;  1JLE A;  1TKX A;  1TKT A;  1J53 A;  4CEQ A;  3DLE A;  5DM7 L;  3G6E N;  3LAM A;  1KRP A;  4Y1D A;  5FPN A;  1RBU A;  3CM6 A;  1KAZ A;  3QDK A;  3WNH A;  2D4W A;  4JV5 K;  3KLH A;  1VSE A;  3V6D A;  4KI6 A;  2HMP A;  3CG7 A;  3M5R A;  3VF4 A;  1SL2 A;  1P90 A;  5AQK A;  2Y1I A;  2Z1H A;  2FSN A;  5KRS A;  1NJZ A;  4BE2 A;  3HP9 A;  4NB4 A;  2YV0 X;  3ENH A;  4XH4 A;  1LV5 A;  4UY8 O;  1RBR A;  2YNG A;  3FFK B;  4FM0 A;  4YFU A;  3O9R A;  5M1F A;  1VQM N;  4E19 A;  2WON A;  4JYA K;  1FKP A;  3L3U A;  4KH5 A;  3MXI A;  4V19 S;  1IV0 A;  4B9N A;  5M1O A;  3F9K A;  3CCS N;  4BRQ A;  3HPG A;  2QWO A;  1TYQ B;  5CYQ A;  4W5R A;  3ZSV A;  3TTC A;  4K25 A;  5AQX A;  2HND A;  3D6R A;  1D9D A;  4JHD A;  4A5A A;  5KRT A;  1LCU A;  3NF8 A;  1HQU A;  4KTZ A;  1ATS A;  1NGF A;  2E1Z A;  5HRN A;  2JWK A;  3AAQ A;  5J2Q A;  5FRM A;  5J2N A;  2OYQ A;  3V1R A;  1U49 A;  4BVP A;  4ZHR A;  5M1P A;  1WN7 A;  4NLB A;  1VSJ A;  2P9U B;  1RGI A;  3RTV A;  1TKZ A;  4WCE L;  3OYI A;  2GV9 A;  3OYK A;  3A0I X;  2ZWH A;  4NXM K;  2NRW A;  2FSJ A;  1BCM A;  1QVF M;  2FBT A;  2YCH A;  2VQE K;  3L2W A;  3ZSX A;  4CZM A;  3QBX A;  3VN5 A;  4AF1 A;  4E89 A;  5C2D A;  4FJ5 A;  4B1X B;  3DMJ A;  3S3M A;  2X6N A;  2HF4 A;  3AO2 A;  3E9O A;  2GTD A;  4CJW A;  1VQ4 N;  4OPK A;  4QOZ B;  3DYA A;  4K42 A;  4OKJ A;  1FXX A;  3CJ7 A;  4RWT A;  1YI2 N;  3UKU A;  4DV2 K;  1F21 A;  4M63 C;  3TAN A;  4N5S A;  4BRG A;  1BIZ A;  4YOT A;  3ZT2 A;  1LOT B;  2WUS A;  4BWJ A;  1W0H A;  2VG5 A;  3WNE A;  1T6C A;  2KLA A;  3DXK B;  5AQL A;  2HBK A;  4BC3 A;  1JCE A;  4J2A A;  4E7I A;  4BR2 A;  1HNI A;  4O55 A;  4FOI A;  3VTH A;  1YJ9 N;  5C42 A;  3F9M A;  3UB5 A;  2JGU A;  1J54 A;  4E1N A;  1P8Z A;  3ULD A;  3QEP A;  1ZBS A;  3IS9 A;  3KWG A;  1B9D A;  3LAN A;  4YOY A;  3S3O A;  4IXC A;  2GWJ A;  4A2B A;  3L2U A;  4JI4 K;  4PKG A;  5JS1 A;  4JI7 K;  5BR9 A;  1NJY A;  3CCM N;  1QE1 A;  2W41 A;  4JI2 K;  3HK2 A;  5M1K A;  3D7E O;  1YHQ N;  5AZI B;  3E66 A;  3M6G A;  4BR9 A;  3AY9 A;  4Z0U A;  1U04 A;  4B1V A;  4LFA K;  4LF7 K;  3L8B A;  3KKR A;  3WNG A;  4C1N K;  3MN9 A;  4H4O A;  1C0T A;  4CGF A;  4DTM A;  4DR7 K;  2QXF A;  1A5V A;  4KRE A;  1XHX A;  1X9M A;  3RSE A;  1DKG D;  4Y1C A;  4K0K K;  3K5L A;  1ZBH A;  1S22 A;  3SPY A;  1VQK N;  1RDU A;  2IDO A;  2OZM A;  3OYA A;  2ZQB A;  4DCH A;  3WEE B;  1T3V A;  3O6W A;  3FR0 A;  2PBD A;  2XO7 A;  3GG4 A;  4DR1 K;  4JKE A;  4IEE A;  2R7Y A;  3U6F A;  4DR6 K;  2O4G A;  1BO5 O;  3A5L C;  3D45 A;  1E4F T;  4ELV A;  1XHZ A;  5M1N A;  3LZJ A;  2YNF A;  4A2A A;  4DKW A;  1NOY A;  2O8D A;  4PL8 A;  1NU0 A;  1L3S A;  1SKS A;  4HUF A;  1CZ9 A;  5AJ3 K;  3O5B A;  2PY5 A;  4KHY A;  4DU4 A;  3A5M C;  3HJF A;  3H3O B;  2VWK A;  2YKN A;  2QTD A;  2I7P A;  2IS3 A;  4GY2 B;  4O8U A;  1XMO K;  3QIO A;  1T6D A;  4F9O A;  5GAD P;  1TL1 A;  1D5A A;  1KLM A;  2VWB A;  1YVU A;  1KXP A;  1E4G T;  4CEC A;  2CGJ A;  1FW6 A;  1A5W A;  3FZK A;  5JIC A;  1L3U A;  4JD2 B;  2P9K B;  3O3F A;  1BL3 A;  4B3R K;  3ZX3 A;  3THY A;  4K43 A;  4RW9 A;  1WOQ A;  2F4V K;  1OVQ A;  4A61 A;  1YF5 L;  1TKD A;  5AQN A;  3CC2 N;  2E20 A;  3OS2 A;  3RMD A;  1N8R O;  1B92 A;  3ULE A;  1B9F A;  2GBZ A;  1TVR A;  4JK8 A;  3LZI A;  4CHY A;  3DLL L;  1GLC G;  4CES A;  4OPH A;  1Q81 O;  1K8K A;  1YIJ N;  4M7Y A;  3ENB A;  1K6Y A;  2H3G X;  2OTL N;  1RT1 A;  1UA0 A;  3O9S A;  4B3O A;  3LL3 A;  4HUE A;  1VQ9 N;  1HQE A;  3CFO A;  3M3Z A;  1GLL O;  3ATU A;  1NK6 A;  4CK1 A;  2F7T A;  4BRK A;  4CCH A;  1BG3 A;  2E5L K;  1LWF A;  4JI5 K;  4CJL A;  4CK3 A;  4MO4 A;  1T44 A;  3VQP A;  1HKG A;  2YHB A;  3NGI A;  2ZJR L;  2ZM6 K;  3O4W A;  5DM6 L;  1KAY A;  4CGJ A;  3B8A X;  3ZSY A;  3WXJ A;  1C0F A;  2JWL A;  3K59 A;  2QI2 A;  3OYF A;  3QEI A;  1QQM A;  3F73 A;  3VQC A;  3NE6 A;  4JKA A;  3H45 C;  4E7J A;  5EY4 A;  4ISG A;  1XNR K;  4DSL A;  1IKV A;  3AVK A;  2NRH A;  2FBY A;  4ELU A;  3L4Q A;  2KHO A;  3C95 A;  3QML A;  4AHS A;  4CJQ A;  3ZLJ A;  3LDP A;  2DFE A;  3SUQ A;  3H46 O;  4O0I A;  5FPE A;  3V81 A;  3QFU A;  1YIT N;  1DTT A;  1VSM A;  5J2P A;  4M41 A;  4RW6 A;  4ILH A;  4FJL A;  4DTP A;  1NJI O;  1VSD A;  3EKU A;  4BDZ A;  2ASP A;  4KHS A;  4CW7 B;  4FWS A;  3TU5 A;  1Y64 A;  4LY7 A;  2HHW A;  3BP8 A;  3K9J A;  4IO9 L;  1GOC A;  4E1J A;  3QEV A;  4I2P A;  1D8Y A;  1L3V A;  4M3R A;  1KD1 O;  1EXQ A;  5EX5 A;  3RR8 A;  3U4L A;  1Q86 O;  1TYQ A;  3PSF A;  3VGM A;  4H0P A;  2P9I B;  4CF1 A;  3HT3 A;  4IO8 A;  2NRV A;  3V9Z A;  2O4I A;  4FWP A;  3WUH A;  2O8C A;  1X3M A;  4JAX A;  4K8Z A;  1HNX K;  1CLQ A;  3KIO A;  4A57 A;  3ZSQ A;  1QTM A;  1T03 A;  3IDH A;  4CF9 A;  1VQO N;  2YNH A;  2F8S A;  3J8A A;  3CI5 A;  3M8R A;  4CJT A;  1Q9X A;  3HXM A;  3L2R A;  2O8B A;  4QS7 A;  1RFQ A;  3KLF A;  3CC4 N;  4CI6 A;  1A5X A;  3TAR A;  3FLC O;  2IAJ A;  3VF6 A;  3AO5 A;  1WBD A;  3SMS A;  3TR8 A;  1TV6 A;  3THW B;  4CK2 A;  1BHL A;  1U2V B;  2WC9 A;  3E9L A;  4YY3 K;  3QFP A;  2OAN A;  1IO2 A;  4ELT A;  2P5O A;  4O5F A;  1Z05 A;  4OPA A;  3N4Q A;  3HST B;  3IFR A;  4AHU A;  4CEB A;  4I6M B;  4CEE A;  4CIG A;  5DMR A;  4DV1 K;  2NRR A;  4HHT A;  4FW1 A;  2EWS A;  3QET A;  2OA8 A;  3KWI A;  2BE2 A;  4CBX A;  1JXB A;  2BUP A;  1UOC A;  3MWT A;  2Q97 A;  1JL2 A;  2P5G A;  4DTN A;  5EU7 A;  5KI6 A;  3ZEU A;  3AA5 X;  1HYV A;  1TAU A;  1RBS A;  1IG9 A;  4GMJ B;  3VGK A;  1O13 A;  1Q82 O;  1TK8 A; 
#chains in the Genus database with same CATH homology
 5KPR A;  4MO5 A;  3WQU A;  5C10 A;  4NB4 A;  2E2O A;  1GLD G;  4JHD B;  5AFU H;  3ENH A;  4XH4 A;  4FWK A;  4UY8 O;  4FPA A;  3ZYY X;  3FFK B;  4R79 A;  1YAG A;  2A6A A;  3C65 A;  4BR4 A;  3VEW A;  4JKH A;  3O9R A;  5M1F A;  1VQM N;  2YJE A;  2WBN A;  4BR0 A;  4YOV A;  2YX6 A;  4H0Y B;  4KH5 A;  2ASO A;  4FO0 A;  2P9S A;  5BN9 A;  5ADX H;  3H1Q A;  5C2F A;  5M1O A;  3CCS N;  2QWN A;  4BRQ A;  1XC3 A;  2QWO A;  1TYQ B;  1MWK A;  3F5T A;  1ATR A;  3L4I A;  4IWV A;  1J6Z A;  3TTC A;  4K25 A;  5AQX A;  1IJJ A;  2AP1 A;  3EE8 A;  2GX9 A;  3A5O C;  3D6R A;  4JHD A;  5AQS A;  4WQ4 C;  4IJA A;  4A5A A;  3EE9 A;  1LCU A;  4M7X A;  5TKW A;  5FPD A;  3TSP A;  3UKR B;  1ATS A;  1NGF A;  2E1Z A;  2IIR A;  4CZH A;  4YOR A;  2IVO A;  4JK9 A;  3GBT A;  2JWK A;  3AAQ A;  4AM6 A;  1OVY A;  3QIC A;  4U67 L;  2VCP A;  2GEM A;  2FLO A;  3LDL A;  4BVP A;  4A5B A;  5M1P A;  4NLB A;  4GV6 A;  2NZT A;  5BPM A;  2P9U B;  5KPT A;  4BR7 A;  1RGI A;  2A40 A;  3CJ9 A;  3UKU B;  1G99 A;  3CPW M;  2CGK A;  4WCE L;  4IDH A;  3R8E A;  3A0I X;  2ZWH A;  2RE2 A;  2NRW A;  2YHY A;  1YJN N;  5GIN A;  1NGH A;  2FSJ A;  3OW2 M;  2QWM A;  3OBY A;  4H5N A;  4WF9 L;  1QVF M;  1CZA N;  2YCH A;  5BPL A;  2KKZ A;  3HZ6 A;  3QBX A;  4AF1 A;  4C23 A;  4CZM A;  3UKR A;  5C2D A;  5JVG L;  1M1K O;  1V4S A;  2Q2R A;  2BH1 A;  3D2F B;  4IFE A;  4B1X B;  1NGD A;  4YOW A;  1SS6 A;  3FGU A;  1K8A O;  1U6Z A;  1EO1 A;  3CMA N;  2HF4 A;  3E9O A;  2GTD A;  1VQ4 N;  3ATV A;  5CR4 A;  2P9U A;  3C0B A;  4EHU A;  3CJC A;  4FWO A;  4K42 A;  4MLE A;  3VEO A;  5CHI A;  2QA4 N;  3CJ7 A;  4JKC A;  3CIP A;  1H1V A;  1HX1 A;  4PKH A;  4RWT A;  1YI2 N;  4H0T B;  3UKU A;  4CZL A;  5AQU A;  1NLV A;  2YHX A;  2CGL A;  5MLC Q;  1QZ6 A;  4M63 C;  3O1W A;  1JJ2 M;  4BRG A;  1ZXO A;  4YOT A;  2UYT A;  1LOT B;  1DGK N;  2WUS A;  4CJ7 A;  1NGE A;  2WFB A;  5BRH A;  1S72 N;  3O80 A;  3BUZ B;  4EIA A;  4H5R A;  1VAZ A;  5AQR A;  3AAP A;  1T6C A;  2KLA A;  3DXK B;  4FOE A;  2NRZ A;  5AQL A;  3D2F A;  3WQT A;  3W3D A;  2HBK A;  4EHT A;  4BC3 A;  3CCV N;  4YOU A;  1JCE A;  3AAR A;  3P4I A;  2P9L A;  3MMV A;  3O08 A;  3W0L A;  4BR2 A;  1HKC A;  4FOI A;  3VTH A;  1YJ9 N;  2E88 A;  2FF3 B;  5AQF A;  2ZJP L;  3F9M A;  3BF1 A;  3WXL A;  3UB5 A;  3CCR N;  2ZGY A;  5H1S Q;  3F2K A;  3O9Q A;  5TKY A;  1P8Z A;  1NGJ A;  2GWK A;  1ZBS A;  2HF3 A;  3KWG A;  3WXI A;  4CD3 A;  2YHW A;  3HSC A;  4BRI A;  2PAV A;  4BR5 A;  1TUY A;  4H5V A;  4YOY A;  5AQP A;  3Q7C A;  1X3N A;  3CQY A;  2GWJ A;  3IUC A;  4IXC A;  4MDA A;  4NO7 A;  4A2B A;  3O9T A;  5F2R A;  4PKG A;  3DXK A;  4J8F A;  5BR9 A;  1ATN A;  3CJ1 A;  3CCM N;  2W41 A;  5AFU A;  4BRH A;  4LC9 B;  3RSE B;  5EVZ A;  3D7E O;  3FZF A;  3C6A A;  5M1K A;  3SAF A;  3HOT A;  1YHQ N;  5AZI B;  3SAH A;  3U9D A;  4BVO A;  3BF3 A;  4WYB A;  3E66 A;  3M6G A;  3CCL N;  4BR9 A;  2QWQ A;  3AY9 A;  5M1Q A;  3WXK A;  3VET A;  2D0P A;  1NGA A;  1SQK A;  4L3Q A;  3AGR A;  3MN5 A;  3K9K A;  1GLE G;  4B1V A;  2W40 A;  3OA9 A;  3VGL A;  5AQT A;  4Z94 A;  3ZET B;  4BRC A;  4C1N K;  5AZJ B;  3MN9 A;  4BGA A;  2DPN A;  3CET A;  4KBO A;  3R3L A;  3GL1 A;  3ID6 A;  3KK7 A;  3CHW A;  5KQ8 A;  2A41 A;  3CC7 N;  3CCU N;  3TSU A;  2Q1N A;  4BRP A;  3RSE A;  1DKG D;  1GLB G;  4BC4 A;  2A3Z A;  3ZX0 A;  5AZI A;  4OO1 J;  2E2N A;  5AQH A;  1S22 A;  4MDB A;  1XUP O;  4FPB A;  2ZJQ L;  5C0Y A;  5GIO A;  3G71 N;  4BRN A;  1DEJ A;  4FWN A;  1RDU A;  1VQK N;  3NVK A;  4G9Z A;  1Q7Y O;  3C6H A;  3ZX2 A;  1TUU A;  4DCH A;  3VMF B;  3WEE B;  1BUP A;  1T3V A;  1NBW A;  3O6W A;  3VEN A;  3ZET A;  4CBW A;  5AZJ A;  1K9M O;  1BDG A;  3FR0 A;  1YXQ A;  3KHY A;  2QXL A;  2PBD A;  2HBL A;  3VEY A;  1QHA A;  2GEL A;  4BRL A;  3GG4 A;  5C12 A;  1HKB A;  3VOV A;  4EFH A;  4WFB L;  3FZL A;  3HOS A;  4JKE A;  4IEE A;  1BO5 O;  3A5L C;  3NMU A;  1E4F T;  4WQ4 A;  3S41 A;  3CME N;  1YJW N;  5M1N A;  3CCQ N;  2ASM A;  3LM9 A;  4A2A A;  4DKW A;  5I9E B;  3LDQ A;  4PL8 A;  3M1F A;  1ESV A;  2D0O A;  3VEX A;  1EQY A;  2NLX A;  1VQ8 N;  3WEE A;  4CZG A;  1ZC6 A;  5AQV A;  3O5B A;  4ISF A;  3A5M C;  4WQ5 C;  1GLA G;  3H3O B;  2QTD A;  2I7P A;  4GY2 B;  4O8U A;  3A8Y A;  3HI0 A;  4B1W B;  1T6D A;  4U7B A;  1M90 O;  4F9O A;  5GAD P;  4BQL A;  3U8X A;  5GAE P;  3ULE B;  1IG8 A;  2P9L B;  4FVU A;  4IOC L;  1NMD A;  2VWB A;  4WQ5 A;  4BRA A;  1KXP A;  5AQY A;  3JS6 A;  1E4G T;  1VQ7 N;  2CGJ A;  2D1K A;  3T7Z A;  4XH5 A;  2E8A A;  4C1N I;  3HBT A;  1K8K B;  4BRM A;  3FZK A;  5JIC A;  4JD2 B;  1YVN A;  4FL9 A;  3TSQ A;  4B1Y B;  2P9K B;  5BRD A;  4GV9 A;  3MN6 A;  3ZX3 A;  1C0G A;  4K43 A;  1SZ2 A;  3Q7B A;  4JKF A;  5ELZ A;  4BRF A;  3EL2 A;  3GDQ A;  4FWL A;  1WOQ A;  5GAG P;  5KQD A;  3H3N O;  4CBU A;  3CCJ N;  4NLC A;  4BG9 A;  3JXU A;  4A61 A;  1BA1 A;  1YF5 L;  2F9W A;  2P9P B;  5AQN A;  1RDW X;  3CC2 N;  3O1B A;  4CZF A;  4AM7 A;  1HPM A;  1HJO A;  2E20 A;  2F9T A;  3FZH A;  2FF6 A;  2AA4 A;  4JNE A;  2Q0U A;  1N8R O;  3G25 A;  1SAZ A;  3ULE A;  3IKM A;  1VQP N;  5EOY A;  4JK8 A;  4A62 A;  5BN8 A;  3DLL L;  1GLC G;  4IJN A;  4OPH A;  3GE1 A;  1Q81 O;  1K8K A;  4O8K A;  5AQJ A;  1YIJ N;  4GNI A;  4JD2 A;  4M7Y A;  5HOO A;  3ENB A;  2P9K A;  4HTL A;  2H3G X;  2OTL N;  1Q18 A;  3O9S A;  2GUP A;  3LL3 A;  3SJH A;  1VQ9 N;  2QWP A;  3WT0 A;  3M3Z A;  4CD1 A;  1GLL O;  3ATU A;  3E1Y A;  1MDU B;  3EN9 A;  3MDQ A;  5C15 A;  5KPZ A;  2F7T A;  4YDU C;  2P9P A;  4BRK A;  4FWR A;  5BRE A;  1BG3 A;  1KC8 O;  3RVC A;  2P9N B;  3DAW A;  3HTV A;  4A59 A;  3ID8 A;  3GOI A;  3L6Q A;  5B8H A;  1VQ6 N;  2HBM A;  1NGC A;  2V51 B;  4MO4 A;  1T44 A;  4IZ9 A;  3ENO A;  3I56 N;  1HKG A;  4YDU A;  3VPZ A;  3KZB A;  3I8B A;  2ZJR L;  1BU6 O;  2CH5 A;  3O4W A;  5DM6 L;  1KAY A;  2OTJ N;  3B8A X;  4FWM A;  2ZGZ A;  3NVM A;  1WUA A;  2ITM A;  1C0F A;  5AQG A;  3WXJ A;  4H0O A;  2JWL A;  5ADX A;  1QVG M;  4EAH D;  2QI2 A;  3MCA B;  1QQM A;  5AR0 A;  1KQS M;  4CZI A;  3N4P A;  5JLF A;  1W97 L;  4JKA A;  3O9U A;  1HUX A;  3H45 C;  2QEX N;  3DWL A;  4JKB A;  4KH4 A;  3C7N B;  5EY4 A;  4ISG A;  2P9N A;  4ISE A;  4BC2 A;  1GLJ O;  2V52 B;  3KVG A;  1XQS C;  3U9Z A;  3SLC A;  3QB0 A;  3TTD A;  4I6M A;  3MK6 A;  5HL7 L;  3EKS A;  4H5W A;  4CZJ A;  2VGM A;  4CZE A;  2NRX A;  3R6M A;  2NRH A;  3VTI A;  2E2Q A;  1JCG A;  2HST A;  5BPN A;  1GLF O;  3HM8 A;  3L4Q A;  5LY3 A;  3CD6 N;  2KHO A;  3CCE N;  4GVE A;  1VQN N;  1BOT O;  3QML A;  3LDP A;  2E2P A;  3CJA A;  5EXW A;  5E26 A;  4B1U B;  4XH1 A;  4GV3 A;  1V4T A;  3LM2 A;  2HOE A;  3VF2 A;  3H46 O;  4H0X B;  3DXM B;  1YUW A;  4JEP A;  5FPE A;  2YJF A;  3MWP A;  3QFU A;  4Y0W A;  1DT9 A;  3LDN A;  5AQM A;  4BQZ A;  5F1X A;  1YIT N;  5AQZ A;  3C7N A;  3CJB A;  1R59 O;  4ILH A;  4K41 A;  2IVN A;  3D2E B;  2A42 A;  2VGN A;  3FZM A;  2ZF5 O;  3CPE A;  3OBW A;  4WFN L;  1BA0 A;  2YI1 A;  2IVP A;  1D4X A;  3SBG A;  1NJI O;  3EKU A;  3HRG A;  4BRD A;  3J7Z O;  2CH6 A;  2ASP A;  4H5T A;  2A5X A;  2Q36 A;  2QW9 A;  3TTF A;  4FWS A;  4JKG B;  3TU5 A;  1Y64 A;  5AQO A;  2FSK A;  5JVH L;  4IOX A;  3BP8 A;  3K9J A;  3P39 A;  4WFA L;  3EO3 A;  2NNW A;  4IO9 L;  5GIP A;  4E1J A;  1ILY A;  3LDO A;  3FE1 A;  3CER A;  3DXM A;  3SMP A;  4KH6 A;  5LJV A;  1HLU A;  5LJW A;  4QS8 A;  1KD1 O;  2V7Y A;  5EX5 A;  2QM1 A;  1QQN A;  3D2E A;  3U4L A;  1Q86 O;  1TYQ A;  3VGM A;  4H0P A;  3VEZ A;  2P9I B;  2PFU A;  4YOX A;  2Q0R A;  3P38 A;  4H03 B;  4IO8 A;  2NRV A;  3VEV A;  4FWP A;  5CE3 A;  2QWR A;  4JKG A;  2QWL A;  3SK3 A;  4CZK A;  4DHY A;  3MX2 A;  3WUH A;  3G4S N;  1X3M A;  4JAX A;  3EZW A;  4FSV A;  3I55 N;  3R1X A;  3T69 A;  3L0Q A;  3UE5 A;  4BG8 A;  2FXU A;  4XEI A;  4A57 A;  4IOA L;  4MLH A;  3MCP A;  5GAH P;  1BWF O;  4PL7 A;  2V7Z A;  3IDH A;  2E1Y A;  1NM1 A;  1VQO N;  1MWM A;  3O8M A;  3P31 A;  4BC5 A;  1QZ5 A;  3CI5 A;  3H6E A;  3J8A A;  1JCF A;  3PIP L;  1OKJ A;  3PIO L;  3AGK A;  5AQQ A;  1VQ5 N;  1NGB A;  2P9I A;  4QS7 A;  2NRT A;  1RFQ A;  3MN7 A;  3CC4 N;  4CI6 A;  3SAG A;  3FLC O;  5BRF A;  3VF6 A;  3SMS A;  3VES A;  4B1Z A;  3A5N C;  1Z6R A;  2Q31 A;  3WXM B;  3DJC A;  5JMV A;  1MA9 B;  4BRO A;  5FPM A;  1K73 O;  1U2V B;  2WC9 A;  4JN4 A;  3E9L A;  1QQO A;  3VER A;  3QFP A;  4QS9 A;  1VQL N;  2OAN A;  1S3X A;  3IMX A;  3TPQ A;  4ILJ A;  3ZEU B;  5JLH A;  1NGG A;  4H0V B;  4JK7 A;  2HBJ A;  4HWI A;  1KAX A;  4O5F A;  5AQW A;  4BRE A;  1Z05 A;  4OPA A;  3N4Q A;  4PKI A;  3IFR A;  2VYP A;  4I6M B;  4B9Q A;  4RCH A;  3QBW A;  1X9J A;  4FWQ A;  5AQI A;  3CF5 L;  1W2B M;  2NRR A;  5DM7 L;  2EWS A;  3G6E N;  4IEI A;  1NWK A;  3CQX A;  4JKD A;  3I33 A;  3E9P A;  3KWI A;  3CXC M;  4CBX A;  5FPN A;  2BUP A;  3BEX A;  5E84 A;  1KAZ A;  4RTF D;  2BTF A;  4DQ8 A;  4BY9 C;  1U2V A;  3MWT A;  3QDK A;  2D4W A;  2Q97 A;  4DB3 A;  3SBT A;  3H1V X;  4PHT X;  2J4R A;  2HMP A;  2P9S B;  3M5R A;  3OHR A;  3ZEU A;  3VF4 A;  3R9P A;  1NGI A;  2RHK A;  1P90 A;  5AQK A;  3MX5 A;  5F0X A;  3VGK A;  4BGB A;  1O13 A;  1Q82 O;  3PLA A;  2I7N A;  4ILG B;  2FSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...