3SLCA

Crystal structure of apo form of acetate kinase (acka) from salmonella typhimurium
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
401
structure length
401
Chain Sequence
HMSSKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVMGTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTEVTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic investigations on Salmonella typhimurium acetate kinase (AckA): identification of a putative ligand binding pocket at the dimeric interface
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
molecule keywords Acetate kinase
total genus 128
structure length 401
sequence length 401
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3slcA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3slcA02
2HF3A 4B1WB 3GOIA 1U2VA 3TPQA 3CQYA 3QBWA 1NGDA 1WOQA 3H46O 3M1FA 5EX5A 3HBTA 2E88A 2NRHA 3ZX0A 5KPTA 2A3ZA 2Q0RA 3IMXA 2ASMA 3CI5A 1EQYA 4BR2A 4FWPA 3SJHA 1YUWA 3EKUA 4H5WA 4A62A 5AQRA 3FZFA 4ISFA 1KAZA 1WUAA 4BRGA 5KPRA 1RDWX 1S3XA 3LDPA 4PKHA 2PBDA 4EAHD 4M7XA 4BRQA 3ID8A 2Q0UA 4ISGA 5AQTA 1GLEG 4K43A 4XEIA 3ATVA 2P9LA 1IJJA 2P9IB 1NGEA 3UKUB 3WXIA 3O1BA 3H3NO 1C0GA 3LDQA 2P9PA 5AQMA 2CGLA 3VEOA 1DGKN 1IG8A 2W40A 4FWRA 3G25A 1SAZA 3JXUA 1NWKA 4NO7A 5F1XA 5AQIA 1ZC6A 1Z6RA 4AM7A 3IFRA 3AAQA 1LOTB 4A61A 4BC3A 2PAVA 2VWBA 4MLHA 1BUPA 4BG8A 3M6GA 2A6AA 4BRHA 1BDGA 1XUPO 4A2BA 4FWLA 4WQ4C 5AZIA 4CZLA 3VESA 4CZHA 3CJ7A 3BP8A 3HZ6A 4HTLA 3GDQA 3WEEB 1RFQA 4FL9A 2W41A 4BC5A 3KVGA 5AQYA 3O8MA 1NGGA 4GNIA 1GLJO 4EFHA 4DCHA 1BO5O 2FXUA 3MCPA 4J8FA 4DQ8A 2J4RA 1X9JA 3QICA 4A2AA 3GBTA 4WYBA 1GLFO 4B9QA 4BR7A 3BF3A 5JLFA 5I9EB 3A5LC 2YHXA 2QWOA 2YJEA 1X3NA 1QQOA 4FPAA 3ZX2A 3EKSA 3WXLA 4CD1A 5AQFA 3VEYA 1YAGA 1TUYA 5AQUA 1GLBG 2A40A 1NGFA 4CJ7A 5BR9A 1Q18A 3DAWA 4B1ZA 4BQLA 3RSEB 4IXCA 1DKGD 1HX1A 3HSCA 2YHYA 1BA1A 5AQNA 2QM1A 3RSEA 2GELA 1BU6O 4CI6A 5E26A 3O4WA 4BRKA 2WUSA 4BR4A 2IIRA 4B1VA 2CGJA 2HOEA 4CZEA 2D4WA 1NLVA 2ZF5O 3TU5A 3VF6A 3W0LA 3U8XA 1TYQB 4NB4A 5KPZA 4CZIA 3A5NC 1ATSA 4H03B 1NM1A 1ZXOA 3KHYA 4IO8A 4BC4A 5BRDA 1BA0A 2AA4A 2BTFA 1XC3A 3D2EA 4WQ4A 2D0OA 2QWQA 4H0YB 2QXLA 5AQSA 1V4TA 3SMSA 1G99A 3WXJA 3H45C 3CHWA 3LDNA 4O5FA 3VPZA 3F9MA 3U9DA 3SLCA 5LJVA 3D2FA 4C23A 5AQJA 4K41A 4BGAA 3LM9A 4PKIA 1T6DA 3WXKA 2FSNA 1KAYA 3CETA 4Y0WA 3VEZA 3ZETB 3O5BA 1MA9B 1QQMA 1BG3A 3W3DA 1OKJA 2HMPA 2HF4A 3AARA 2Q1NA 3A0IX 2YJFA 4FOEA 4H5TA 4EHUA 2UYTA 3IUCA 4PL8A 4FWSA 2P9SA 3O08A 5FPNA 5BPLA 4BVOA 2P9SB 4JHDA 3VGKA 1TUUA 2F9TA 4MO5A 4BRMA 2Q97A 5FPDA 2FSKA 3HI0A 5F0XA 1QZ5A 3O1WA 4JHDB 4BG9A 3AY9A 3R9PA 3AAPA 4O8KA 2GEMA 2P9IA 3ZX3A 2Q2RA 5F2RA 4ISEA 2IVOA 2FSJA 4HWIA 4QS9A 4PKGA 2Q36A 4DHYA 3FZHA 3VENA 3ATUA 4CBWA 2GUPA 3A5OC 3QFPA 2ASOA 3LDOA 3EZWA 1MWKA 2D1KA 5AQZA 3L0QA 5AQOA 3H1QA 3H3OB 1E4FT 3D7EO 3MN7A 2E2PA 3KZBA 3QB0A 3MDQA 1T6CA 2D0PA 1CZAN 4B1XB 1KAXA 3IDHA 4QS8A 3MN6A 4FWOA 2V51B 2Q31A 3A8YA 2QWRA 3ZEUB 3EL2A 1HLUA 1ESVA 2VCPA 4YDUA 3FLCO 5AQVA 2A42A 3H1VX 5TKYA 2V52B 3MN5A 4CZKA 1H1VA 4BRFA 1YXQA 4JD2A 3MN9A 1KXPA 4Z94A 1HKGA 4BRIA 2NLXA 1HKCA 5EVZA 4BR9A 3J8AA 1BWFO 1RGIA 1QHAA 1QZ6A 3GG4A 4H0TB 4JN4A 5BPMA 3FZKA 5BN9A 4CZGA 5E84A 3GL1A 5ELZA 3R8EA 2QWPA 5AQLA 3L6QA 3VGMA 3VEWA 4QS7A 3FZMA 5FPEA 2GWKA 3FR0A 2CH6A 3H6EA 4CZJA 2OANA 3CERA 3DXKB 4BR5A 4IWVA 2V7YA 3OHRA 2AP1A 3GE1A 3HM8A 2EWSA 1NBWA 5BN8A 1S22A 3QFUA 2QWMA 3I8BA 1HUXA 1ATRA 3FFKB 3M3ZA 4FO0A 2ITMA 2IVNA 2P9LB 4F9OA 3VF2A 3QDKA 5AZJA 3JS6A 2P9PB 4M7YA 3VEXA 4MO4A 2YCHA 4BRDA 1SZ2A 2H3GX 4I6MA 3ENOA 1TYQA 4RCHA 1R59O 4FWMA 4I6MB 3DXMA 1SQKA 4L3QA 5AFUH 1HPMA 4IJNA 2E2OA 2QWNA 5AQHA 4FOIA 4PL7A 3A5MC 4IZ9A 1GLAG 3DXMB 1XQSC 4K25A 1BOTO 2QW9A 4XH4A 3S41A 3UKRA 2E2QA 2I7NA 4BR0A 4K42A 2A41A 3WQTA 4XH5A 3UE5A 3I33A 1K8KB 3BEXA 3CJBA 5KQ8A 5AFUA 4M63C 4MLEA 1JCEA 3WEEA 2ZWHA 3D2FB 4BRCA 5LJWA 1GLCG 4EIAA 4BREA 4FWQA 4FSVA 5AQPA 5BPNA 3QMLA 5AQKA 2E20A 2CGKA 3EO3A 1MDUB 4FWNA 3ULEB 3C0BA 2P9NB 3CJ9A 4BVPA 3ZETA 3UB5A 4BROA 3FGUA 2CH5A 2ZGZA 3CJ1A 5ADXA 5LY3A 2P9NA 4BGBA 5AQGA 4BC2A 4FPBA 1P8ZA 3CJCA 1MWMA 1D4XA 1HKBA 2V7ZA 3CIPA 4H5VA 4H0VB 4CZMA 5JICA 2NZTA 4B1UB 4H0PA 2E2NA 3SMPA 2E1YA 3WT0A 2YHWA 3VGLA 2DPNA 2VYPA 3DXKA 5EOYA 5AQXA 4FWKA 4H5NA 2YI1A 3O6WA 3VOVA 1QQNA 4LC9B 3VEVA 4JNEA 4DB3A 3B8AX 4WQ5C 1HJOA 5AR0A 5AZJB 4BRAA 4RTFD 1NGAA 3CJAA 1T44A 3CQXA 2GWJA 3MMVA 1NGCA 1GLDG 5FPMA 2P9KA 2BUPA 4BRNA 4CBXA 2F9WA 2IVPA 4GY2B 2FF3B 4BQZA 2P9KB 3BUZB 4H0XB 3WUHA 3WQUA 4CD3A 4B1YB 4CBUA 3ENHA 3C7NB 3U9ZA 2P9UA 5JMVA 3LM2A 3UKRB 3FZLA 1NGIA 2FLOA 5AQWA 4AM6A 3C7NA 4BRLA 2P9UB 1Y64A 3R6MA 2FF6A 1K8KA 1ATNA 3MK6A 5JLHA 3SK3A 5B8HA 1LCUA 4XH1A 3FE1A 2KHOA 1YVNA 3BF1A 1NGHA 3VF4A 1J6ZA 3DJCA 3P4IA 3UKUA 3ULEA 4H5RA 4KBOA 1NGBA 4JD2B 4RWTA 4WQ5A 3LL3A 1E4GT 3DWLA 3O80A 4IJAA 4YDUC 5BRHA 4E1JA 5ADXH 1NGJA 4CZFA 5EY4A 1V4SA 2QWLA 2GTDA 3D2EB 3HTVA 1NMDA 3VERA 2A5XA 4EHTA 1JCFA 4JAXA 2ASPA 2E1ZA 5BREA 3LDLA 3ZEUA 5EXWA 2E8AA 1C0FA 5AQQA 5AZIB 1X3MA 4H0OA 1JCGA 5KQDA 3QBXA 3U4LA 1GLLO 3VETA 2I7PA 1DEJA 1U6ZA 1ZBSA 3L4IA 4BRPA 1U2VB 1Z05A 5CE3A 2ZGYA 3EN9A 5BRFA
chains in the Genus database with same CATH superfamily
2HF3A 3J7ZO 3GOIA 1VRUA 3KLGA 1TK5A 3SUQA 1WOQA 3CG7A 3H46O 4GVMA 4J2EA 5EX5A 3ZX0A 2DY4A 1S9GA 2E88A 4J2BA 5KPTA 2Q0RA 5M1OA 4B3RK 1OVQA 2HHVA 1C0UA 4KRFA 3EKUA 4A62A 4BRGA 3FZFA 1EO1A 4DKWA 4FCYA 3V1QA 1RDWX 3LDPA 2GUIA 4DSLA 4DF4A 2PBDA 2XY5A 4EAHD 4M7XA 1O1WA 1ZYQA 4ISGA 4GV3A 2B6AA 5C42A 3NE6A 4ID1A 4K43A 3C65A 4CFAA 1IO2A 3LP0A 1IJJA 2P9IB 3TANA 5SWMA 1NGEA 3LPTA 3O1BA 1IKWA 2P9PA 3QEXA 4ZHRA 2A1RA 2CGLA 1VQPN 2B4JA 4FWRA 2JLEA 3G25A 3SPYA 1VSMA 2HVHA 3AGRA 4DLGA 1Z6RA 3K9KA 1LOTB 2UXCK 4E7HA 4MLHA 3I0SA 2YKMA 4J2DA 1NK8A 1S6QA 3QIOA 4FVUA 4BRHA 3OBWA 4FLVA 1EX4A 3CC7N 2HHUA 4DFKA 4CZHA 3IRXA 3CJ7A 3BP8A 4HTLA 2PY5A 3WEEB 2YNGA 3P83D 4AHTA 2W41A 4CIFA 2HHSA 2IS3A 4RW6A 2A1SA 4E1NA 1QSLA 4CJ3A 3ENBA 4FJLA 3DMJA 4CJEA 3ZSWA 1WSHA 4DSKA 2HHTA 3TAFA 4G1QA 3GBTA 1GLFO 2RPIA 1UAXA 4B9QA 4BE1A 3BF3A 5I9EB 2QWOA 1X3NA 1QQOA 4GKJK 3ZX2A 4E7JA 5AQFA 4YOYA 4Z4GA 2F8SA 3NF6A 4CJ7A 1ZBIA 1Q18A 1I94K 3ZSRA 4B1ZA 3EY1A 3CMEN 4IXCA 4DSJA 3SV4A 1S1VA 5M1QA 1WSGA 4O4GA 3HVTA 4M3WA 4FZZA 4DV7K 5DK5A 1IKXA 2VG6A 4IFVA 3QEWA 3G71N 3ZSVA 1NMNA 3HL8A 5I3UA 3KWIA 1WNSA 1NLVA 4JI8K 3AO5A 3LAMA 3H08A 4NB4A 4L8RB 4BACA 5KPZA 3VQPA 4B08A 3ZCMA 3B6OA 2IAJA 4JKEA 1UA0A 1S6PA 5JVGL 4KH5A 1VQ4N 4I2QA 4E19A 1LAVA 1BA0A 4LF5K 2AA4A 1XC3A 4FLWA 1T05A 5FRNA 1C0TA 1RBSA 3TTFA 3SQ2A 3THVA 4JS4A 3ZT1A 3K9JA 4B9UA 4O5FA 2OYQA 2UUCK 3C94A 3QEVA 3SQ4A 3I56N 1YITN 3T3FA 4M45A 4BGAA 1T6DA 3OYCA 2FSNA 3L3UA 3E1YA 3ZETB 1NKBA 3LWMA 3O5BA 2YHAA 3SUPA 1ITGA 1UOCA 3G4SN 3AVIA 2HMPA 1SKRA 3A0IX 1W0HA 3THYB 2IGIA 4NYFA 3M8SA 4ID5A 1VSEA 4WF9L 5AJ3K 4PL8A 1VQNN 4KTQA 4CF2A 4BVOA 1TL1A 4JHDA 3E66A 2LSNA 1JLEA 3MECA 5FPDA 3NAEA 2FSKA 3WNGA 5F0XA 1WAFA 4BG9A 4JHDB 1HRHA 4B9MA 4CEDA 3NHGA 1HPZA 3AAPA 2WTUA 3S3NA 2QXFA 2BH1A 4QS9A 4QCLA 1HNZK 2Q36A 4DHYA 3FZHA 4DUYK 3V9WA 2GUPA 4JI5K 3A5OC 1TK0A 3KD5E 2NRRA 1UA1A 2PYJA 5HLFA 5AQOA 3H1QA 3D7EO 1VSKA 4O44A 5CZ2A 4EP4A 3QB0A 3MDQA 1BI4B 1CZAN 3NFAA 4B1XB 1IBMK 1X9MA 3MEEA 4QS8A 2Q31A 3A8YA 5J1EA 4GW6A 3ZEUB 1XNRK 4W5NA 2VCPA 5TKYA 4JRPA 1EKEA 4BRFA 5M1KA 2G8IA 4FZYA 5M1PA 4BWMA 1RNHA 1BIUA 3HYFA 2OZSA 1HKCA 5EVZA 1SS6A 1QHAA 1I3AA 4DF8A 4DFJA 4CEAA 1IKVA 3C6AA 5BPMA 5BN9A 4KHWA 5E41A 5ELZA 3AVFA 4I7FA 1W9HA 1MU2A 4QS7A 3KK7A 1HQUA 3T19A 1XHZA 4LY7A 4DSIA 2GWKA 3FR0A 2CH6A 2EHGA 4CHZA 3H6EA 4CZJA 4BR5A 3SJJA 3VQAA 4IWVA 4N5SA 2AP1A 4Z4CA 2EWSA 3M5RA 4W5TA 5BN8A 3T1YK 5KRTA 2VG7A 4FO0A 2QK9A 4KREA 3QDKA 4JI4K 4Q0BA 1HNXK 1J54A 3WXMB 1VK0A 3OYMA 4KO0A 4CJVA 3NGZA 4BRDA 3OYHA 4FLXA 3EYZA 1TK8A 2H3GX 4I6MA 4YY3K 3LZJA 4OPHA 3ZT2A 4I6MB 1QHTA 2QTDA 2YKNA 5AFUH 2QWNA 4KKOA 4DUZK 1YTAA 3A5MC 1XMOK 1XQSC 1P90A 4LFAK 2E2QA 2I7NA 3I33A 1VQON 2VWKA 1J9AA 3VQ6A 1RBTA 4FJIA 4MLEA 2HVIA 4FJ8A 1FJGK 4DR4K 5HL7L 4BRCA 1HNWK 2G8KA 4NCAA 2JWLA 5GAEP 4M42A 1MDUB 1TKXA 3PX6A 1TVRA 3P1GA 4HTUA 4PY5A 1Z25A 4BROA 3FGUA 1RT7A 3CJ1A 5ADXA 5LY3A 1C1CA 4BGBA 1XWLA 2VQFK 4FPBA 4CGJA 1P8ZA 5K14A 1D5AA 4GV9A 1MWMA 1D4XA 2NRZA 3LP2A 5JICA 3K59A 4B1UB 5M1FA 1W97L 5A2QO 2E1YA 4YORA 2YHWA 3O9SA 2DPNA 1HYVA 3DXKA 1R0AA 4FWKA 4CF8A 4IDKA 3O3FA 4QAGA 2W42A 4LC9B 1W7AA 1BGXT 1RDBA 4JNEA 4DB3A 1L3TA 4OPJA 4WQ5C 4H8KA 1HJOA 5AZJB 3AO1A 3AVKA 4O8UA 4BRAA 5HRNA 4CEBA 3DLLL 3OYLA 3OS1A 2NRXA 4BRNA 4PUOA 2Z1JA 1EETA 2FF3B 4IG3A 2O8BB 4YFUA 3M8RA 3K5OA 4LH5A 2QA4N 3CC2N 2RKIA 3C7NB 1IBKK 3LM2A 2ZJPL 4C8NA 1SUQA 1NGIA 5AQWA 2VWJA 3C7NA 4KHUA 1DT9A 3CCMN 4DR5K 3TWHA 1K8KA 1ATNA 5JLHA 1QSYA 3O4QA 4YOTA 3D0PA 5B8HA 3FE1A 4E7LA 4RW7A 4DQPA 4NYNA 3TSPA 3KLHA 3AVNA 5HRPA 2P51A 4Z4HA 1K6YA 3ZT3A 4UY8O 1GOAA 1NGBA 3T7ZA 3O9RA 1TKDA 5IWAK 3TAMA 1OVYA 1TGOA 4OKKA 4E1MA 3LL3A 1KFDA 4N41A 3OYKA 4AHRA 5ADXH 2AJQA 3G6EN 4JLHA 1L3VA 2GTDA 4EHTA 3CM5A 3CF5L 4DTXA 3LDLA 3J80O 5AQQA 4H0OA 3U4LA 3V1RA 3VQEA 2BANA 1DEJA 2ETJA 3L4IA 1VRTA 3DLEA 5CE3A 3EN9A 1U04A 4H4OA 5DM7L 1RT4A 3G0ZA 4B1WB 5FDLA 4CGFA 3TPQA 4W5OA 1NGDA 4PA1A 4KHQA 3HBTA 1KVAA 3DI6A 3T1AA 2G8VA 2A3ZA 4AHCA 4FLUA 1CXUA 5FLXO 2E5LK 1ASVA 3CI5A 4I2PA 4BR2A 4CHPA 2WC9A 4CJ5A 3LPUA 3SAFA 5KPRA 5AQRA 4ISFA 4CGDA 3VTIA 4DS5A 4PKHA 3HPGA 1XC9A 1J5OA 3ID8A 2YHBA 4FM2A 4JK8A 2NRTA 3AVHA 4AF1A 4KHPK 1ZBHA 3WXIA 1JL2A 3RRHA 4JKAA 4FJXA 3NBPA 1IG8A 2W40A 5FROA 3PX0A 1B92A 5CYMA 4IBNA 4AM7A 3SUNA 3CXCM 4A61A 3BDPA 2PAVA 3L2QA 1BI4A 1RBVA 3M6GA 1DTQA 2A6AA 1BDGA 1IG9A 1XUPO 1QSSA 3RR7A 3LWLA 4A2BA 4X66K 1TAUA 1JXBA 1C1BA 3KVGA 2HBMA 3O8MA 1NGGA 1J5EK 2ITGA 4B3OA 4EFHA 4K0KK 4OKJA 4ILGB 4JYAK 3MCPA 4J8FA 2W6KA 4DQ8A 3S3OA 2XO7A 2FBYA 4EZ9A 4WYBA 3LANA 3EZ5A 3K2PA 2YHXA 3K57A 2YJEA 4DQRA 2D5RA 5H1SQ 3EKSA 3DOLA 3WXLA 3S3MA 3VEYA 1YAGA 3P39A 4IEEA 5AQUA 2A40A 1NGFA 5BR9A 3V9UA 4BQLA 4CK3A 4N76A 4DTOA 1TKTA 1DKGD 2YHYA 4IKFA 4KHNA 1ZBFA 2GELA 1Q82O 4CI6A 4JKGA 2R7YA 5C2DA 3QESA 3O4WA 1YT3A 1E3MA 3ZSXA 4DV6K 2Y1IA 1X9WA 2IIRA 2CGJA 3KK3A 4E7IA 2D4WA 3TU5A 2ZF5O 4M3YA 2X78A 3W0LA 3L8BA 1HMVA 3U8XA 4A59A 1KTQA 3ULDA 4R79A 1Q9XA 1RT3A 1ZXOA 5BRDA 4IO8A 1YF5L 3AA5X 3D2EA 5TKWA 3QERA 1V4TA 3SMSA 4CJPA 4LSNA 3SAHA 1KVCA 3H45C 3CHWA 1SL0A 3U9DA 5LJVA 4LH4A 5AQJA 2KTQA 3THWA 3K5MA 3LM9A 4MDAA 1HQEA 1KAYA 2ZM6K 3DLHA 1VSDA 1MA9B 3CFPA 1BG3A 3PX4A 2VGNA 4ILHA 4DTSA 3AARA 1A5VA 3DRRA 4HUFA 1Z26A 1S72N 3KD1E 3WNFA 2O8EB 3L3VA 4FOEA 3MX2A 4EHUA 2UYTA 3LP3A 1Q9YA 4C1NI 2P9SA 1BIZA 1SV5A 5FPNA 1K73O 5BPLA 3CCSN 2P9SB 4MFBA 4CJFA 4CE9A 1JLFA 4CW7B 2KZMA 2KFNA 3R9PA 1M90O 4F3TA 4FJ9A 2IVOA 4HWIA 3ATUA 4E7KA 3BZCA 4CBWA 4DFPA 3QFPA 3LZIA 5J2PA 3KJVA 3AO2A 3EZWA 2D1KA 2GV9A 1M1KO 3CCUN 1E4FT 4DU3A 4HUGA 1T6CA 2D0PA 4KB0A 3TR8A 1A5WA 4B8CA 3QNOA 2QWRA 4F2SA 5CR4A 5AQVA 3J81O 2V52B 3MN5A 4FJHA 4DU1A 4CFDA 3VQDA 1CZBA 5C0YA 3NMUA 4JKCA 1FKPA 1HKGA 3THXB 1Q86O 1VSLA 5HBMA 2X6SA 4H0TB 2OA8A 4JN4A 3L4QA 4XIUA 4GMJB 3GL1A 2QWPA 4YHHK 4BY9C 3P31A 4NXMK 3SI6A 1O13A 1VSHA 5T7BA 3U3YA 2OTJN 3PSFA 1YVUA 2OANA 3OHRA 1NBWA 3QFUA 3DRSA 2HSTA 3C6HA 3FFKB 3KKRA 2ITMA 2ZJQL 2G8WA 4FJNA 4DSFA 4DR6K 2FBTA 4W5QA 3JS6A 1RILA 5MLCQ 2P9PB 4M7YA 3LP1A 2HHQA 2YCHA 2BE2A 4FJ7A 3DLGA 3ENOA 1QTMA 1K8AO 4LFBK 1U48A 1R59O 5C12A 3DXMA 3TTDA 5AQHA 4C8MA 4HCBA 1BISA 3DXMB 3MXJA 3ZSYA 1BOTO 3S41A 3UKRA 3R1XA 4FLYA 4FJGA 1SKSA 2A41A 3WQTA 3OYEA 5JVHL 4EZ6A 5KI6A 1NJWA 3BEXA 5KQ8A 3WEEA 2ZWHA 3D2FB 4E0DA 4KHYA 3RRGA 2WONA 4CJRA 3VTHA 4EIAA 5BPNA 5CZ1A 3CD6N 3QMLA 5AQKA 3RMCA 3ULEB 3NH0A 3P5JA 3CJ9A 5DM6L 5GINA 2WOMA 1NU0A 1ILYA 1LW0A 4O5BA 1RT6A 4CZMA 2RF2A 2QKKA 2Z1GA 1XHXA 3WT0A 4CJLA 4CGGA 4CEOA 5HROA 2BGGA 4W5RA 2Q3SA 5EOYA 4DR2K 4I9QA 1LWCA 5C25A 4OGCA 1QQNA 3OYNA 2DTUA 4OGEA 3CC4N 4ELUA 5AR0A 2NUBA 1NGAA 4FK0A 4U67L 1D8YA 3CQXA 2GWJA 1NJXA 3MMVA 1NGCA 5FRMA 4ZTJA 1QE1A 3QEIA 3HP6A 4GY2B 3TTCA 4FLZA 4DV2K 3WUHA 1KD1O 3U3GA 1UWBA 4CD3A 3U9ZA 4KPYA 2P9UA 1XMQK 4DTPA 3FZLA 3AVAA 5GAHP 1D9DA 2OPPA 1NKEA 2P9UB 2IOCA 4HCCA 4WFBL 1LCUA 4XH1A 4JI7K 4A5BA 3MX5A 4OX9K 5SZTA 1NGHA 3A2FA 3J7AP 1SL1A 3P4IA 4CHOA 3SBGA 4KBOA 1REVA 1LWEA 1ZBUA 4DQSA 4HUEA 3R3LA 4WQ5A 2IC3A 4Q5VA 3C6UA 4YDUC 5BRHA 4OO1J 3AVGA 3NVMA 4F8RA 1C6VA 3D2EB 2A5XA 4CGHA 2ASPA 4CIGA 3AA2A 5EXWA 2E8AA 4U7BA 4DWIA 4I9LA 1JCGA 2ZD1A 3VN5A 3ZLJA 2UUAK 1ZBSA 1C1AA 1U2VB 1FKOA 1Z05A 3L2UA 3OBYA 3OYDA 3VQ5A 4KTZA 1U2VA 4IO9L 3QBWA 2HBJA 2HBLA 2NRHA 1OH6A 4RW9A 1WSFA 4M3TA 4DS4A 3O4NA 3IMXA 1B9DA 2ASMA 4IOCL 3WNEA 4FWPA 1YI2N 1N33K 4H5WA 1WUAA 3V1OA 1S5JA 1NK5A 1XI1A 1S3XA 5HRRA 4F4KA 4DTUA 2Q0UA 1RDCA 2F4VK 2OPRA 1GLEG 1BHLA 4B9SA 2RHKA 4XEIA 1BCMA 3ATVA 2P9LA 1BCOA 4DTRA 3UKUB 3LDQA 3AVCA 4RW8A 4X62K 2VQEK 4DV0K 2YV0X 1DGKN 3DLKA 3JXUA 3HPHA 3DLBA 5AQIA 1VQLN 3F2KA 3IFRA 3CCLN 3AAQA 3RR8A 4BC3A 2VWBA 2HB5A 1BUPA 3ZSOA 3MCAB 2G8UA 2EX3A 4DTMA 3KK2A 4FWLA 3RMAA 5AZIA 4YNQA 3GDQA 4B3SK 5LL6Z 4BC5A 3ISNC 5AQYA 2OTLN 2QEXN 2O8CA 3E01A 1D9FA 2X74A 4KFBA 2UXDK 4YOVA 4LSLA 4DCHA 1BO5O 1N32K 2PYLA 1NK6A 4JK9A 4FJJA 4KV8A 3QICA 5C15A 4A2AA 2ZJRL 4DR1K 1YIJN 3NF9A 3THYA 2RN2A 1TUYA 1KQSM 3DAWA 4CEFA 3HSCA 3OY9A 1BA1A 3HPOA 5AQNA 2QM1A 3SCXA 1ASUA 3F9KA 5C2FA 1YTUA 1FXXA 3SAGA 1KVBA 1KLMA 2WBNA 1J53A 2WUSA 4BR4A 4FVMA 1TV6A 1KCFA 2D0AA 3FFIA 1N5YA 3VF6A 2F7TA 3O9QA 3DRPA 1OH7A 4MQ3A 1YJNN 1VHXA 4A5AA 3A5NC 1VQ5N 1ATSA 1QVGM 1EWRA 1NM1A 1S9EA 4BC4A 3OJUA 4CEQA 4B3TK 1RT1A 1EXQA 1VSJA 4AQYK 3QEPA 4WQ4A 4JRQA 2QWQA 2NNWA 2QXLA 4PHTX 3CCEN 1RTHA 3E9LA 3WXJA 4N47A 3LDNA 4EP5A 3VPZA 4IOAL 4NCGA 4LF9K 3D2FA 4C23A 1KFSA 3HP9A 3EE8A 3NH1A 4Z4EA 4PKIA 2VGMA 1U47A 3HJFA 2DFHA 4LD0A 4Y0WA 1JLBA 3IG1A 3VEZA 3Q7CA 1QQMA 2HHWA 1OKJA 2HF4A 5HOOA 1NK9A 2Q1NA 2YJFA 1JXEA 3HO1A 3IUCA 3PV8A 4ELVA 4FWSA 3O08A 3QO9A 1X1PA 1T7PA 1RTDA 3VGKA 1VAZA 1TUUA 2F9TA 5C10A 3G10A 2Q97A 3HI0A 1QZ5A 3O1WA 3AY9A 4KH6A 2O8DB 4O8KA 3NH2A 3F5TA 4DR7K 1T8EA 5KRSA 5F2RA 2FSJA 4PKGA 3CCRN 4OKEA 4FLTA 2KQ2A 1NKCA 5C24A 3RWUA 1VQ6N 4C8KA 3AA4A 2HNZA 3MN7A 2E2PA 1TAQA 3K5LA 3JAMO 2UXBK 2XY8A 1KAXA 1HYZA 1WBBA 3MN6A 4FWOA 2V51B 2JWKA 1LV5A 4GV6A 4JI3K 3EE9A 1IV0A 1HLUA 3BY5A 1YJWN 4CVNE 3O3HA 1RTJA 3OS0A 3MXMA 2KKZA 3NGYA 3CM6A 1YXQA 1GOBA 1A5XA 4B3MK 3KKSA 2FBVA 2KFZA 1Y97A 4AH9A 4Z94A 1HR0K 4BRIA 2IDOA 3U6FA 3N4QA 1VQ7N 3E9PA 4BR9A 3J8AA 3CFRA 5JS1A 4CK1A 3KLFA 4JEPA 3VQ7A 4CEEA 4CZGA 5E84A 2HNDA 4WCEL 3R8EA 3NDKA 5AQLA 4JI6K 3VEWA 4KB1A 4OVLA 4IFEA 3DXKB 5DMRA 2V7YA 3CCQN 1RBUA 1S22A 2XRIA 3QETA 1HUXA 1ATRA 3M3ZA 4FJKA 3VF2A 5AZJA 1WSIA 1CLQA 3TSUA 1CZ9A 3AA3A 4MO4A 1SZ2A 1NOZA 3IAYA 3ITHA 4IG0A 1TYQA 3JSMA 4RCHA 2O8BA 4FWMA 3Q7BA 3N4PA 3V9ZA 1SQKA 2O4GA 1HPMA 4IJNA 2E2OA 4E89A 4FOIA 4PL7A 4XH4A 4K25A 5CY4A 1GLAG 3DOKA 4BR0A 3TABA 2E6LA 3I8DA 4K42A 3UE5A 3AVBA 5HP1A 1K8KB 1KSPA 2UU9K 4M63C 4JV5K 1U45A 4C8LA 3OYIA 1BQMA 1GLCG 3SYZA 4FSVA 5AQPA 4K8ZA 4FWNA 4YOXA 1JLAA 3C0BA 2P9NB 3HOTA 3V81A 4Z4IA 5GAGP 1IH7A 1NK4A 2CH5A 2ZGZA 2P9NA 4DR3K 1QQCA 5AQGA 4FK2A 4DV4K 1HYSA 4FM1A 4JKDA 1X9SA 3D6RA 3ZT0A 3SMPA 5J2QA 3AVJA 3QIPA 5AQXA 4H5NA 4CJUA 2JGUA 2HW3A 3O9TA 4KHSA 3VOVA 2O8CB 3I0RA 3VEVA 1KC8O 3B8AX 3DLRA 4QOZB 4RTFD 1YJ9N 4JKGB 3TAGA 3CJAA 1T44A 3SZ2A 1GLDG 5FPMA 2DFFA 2P9KA 5I42A 4CBXA 2IVPA 4DLEA 3ZSZA 1T03A 2P9KB 4B9NA 4H0XB 5LMNK 3WQUA 3CPEA 4CBUA 4M3ZA 4TSXA 4X65K 5J2MA 3S9HA 3AO4A 4WFNL 3HOSA 4NCBA 5M1NA 4CJ4A 1JKHA 3PIPL 2PZSA 3MWPA 4BRLA 3R6MA 1KRPA 3MK6A 3KLIA 3SK3A 4NLCA 4AHUA 1NNEA 1WLJA 4OJRA 3AGKA 4Y1DA 2KHOA 4DTNA 3NCIA 1YHQN 1J6ZA 2G8HA 3DJCA 4MDBA 3OYFA 3V4IA 2O4IA 1EP4A 4JD2B 3VQCA 4JKBA 3D45A 4RWTA 4JI0K 2D0CA 3O80A 4IJAA 5EU7A 4E1JA 3ZT4A 3TI0A 4NLBA 3SBTA 2DFEA 4IEIA 4ZTFA 2QWLA 4CHYA 1NMDA 1L5UA 4AHSA 1HNVA 3QINA 2KLAA 4OPAA 4JAXA 2OZMA 2YX6A 3ZEUA 4LF4K 1C0FA 1JL1A 1X3MA 3PY8A 1RBRA 3QBXA 1NG9A 2X6NA 1GLLO 3VETA 2I7PA 2OPQA 3PLAA 1U6ZA 1N34K 2ZGYA 1FK9A 3CQYA 3M1FA 4DMNA 4FM0A 1N6QA 1XNQK 3TARA 1NJYA 3CFOA 3DM2A 1EQYA 3O3GA 3SJHA 1YUWA 3EEQA 1U4BA 4DTJA 1KAZA 1HNIA 2YNIA 5GIOA 4J2AA 4CESA 4BRQA 4BE0A 5AQTA 4CF0A 4DV3K 2O8DA 5IT9O 5KTQA 4H4MA 5HRSA 2E6MA 1LWFA 2ZE2A 3H3NO 1C0GA 3HVRA 1NK0A 5AQMA 3HM9A 1VQMN 1RDUA 3AVLA 3M8PA 3VEOA 1SAZA 5F1XA 1NWKA 4NO7A 1ZC6A 4WFAL 4AILC 3THXA 3QLHA 3HXMA 4BG8A 1S1XA 3MEGA 4C1NK 2P1JA 4O0JA 3NGIA 2ATQA 4DV5K 3OTOK 5D3GA 4WQ4C 1ASWA 4CZLA 3VESA 1RT2A 3HZ6A 3OJSA 1RFQA 4FL9A 2FBXA 2Z1IA 4CJWA 2O8FB 3OVNA 4NXNK 4GNIA 1GLJO 4M3XA 3C95A 3CPWM 1KLNA 2FXUA 3SNNA 2YNHA 2J4RA 1X9JA 2XY7A 2GX9A 4BR7A 5JLFA 4BDPA 3A5LC 1WSJA 4FPAA 4YOUA 4CD1A 4KI6A 2O8EA 3KWGA 3TAEA 3PSIA 1GLBG 1JLCA 3CYMA 1T3VA 3RSEB 1K9MO 1HX1A 3V6DA 1Q7YO 2P5OA 4Y1CA 3C6TA 3RSEA 3CMAN 1JLGA 1BU6O 4CECA 4R5PA 5E26A 4F2RA 4FK4A 3J7YP 3KTQA 4FXDA 5GADP 3VQ8A 4BRKA 4RW4A 1GOCA 4BDZA 1N8RO 3PUFA 4B1VA 1IKYA 2HOEA 4CZEA 4YOWA 4CJQA 1DTTA 4CEZA 1TYQB 2GBZA 3O9UA 4CZIA 1B9FA 3LAKA 4H03B 2Z1HA 3DYAA 3KHYA 4ILJA 3TAQA 1BQNA 1LW2A 4K8XA 1RCHA 2BTFA 1QVFM 2D0OA 4H0YB 3ID6A 5AQSA 1G99A 1SKWA 2XY6A 3F9MA 2P5GA 3SLCA 4KTWA 4DU4A 4FYDA 1U49A 2KZZA 1FW6A 3WNHA 4K41A 3CCJN 3OYJA 1LAWA 4M3UA 3L2VA 5J2NA 3WXKA 4DFMA 3CETA 1N36K 2NRVA 3OA9A 4WE1A 1S1UA 2RE2A 1WN7A 3VQBA 1BL3A 1VQKN 3W3DA 3VMFB 1F21A 1DLOA 4Z0UA 3AV9A 4RG8A 3CCVN 3KK1A 4H5TA 3VQQA 4CJKA 4IOXA 1Q8IA 3K5NA 1NJZA 2B5JA 3L2RA 1C0MA 4DG1A 3KLEA 1VQ8N 4UQGA 4CIEA 2YNFA 4MO5A 4BRMA 3RTVA 5KGXA 5CYQA 4JK7A 1NJIO 4JKHA 4N56A 5LMUK 2GEMA 2P9IA 3ZX3A 2Q2RA 4ISEA 3BZKA 3VENA 1JJ2M 2ASOA 3LDOA 1MWKA 5AQZA 3E9OA 3F73A 3SPZA 1VSIA 3L0QA 3H3OB 3I55N 2G8FA 3K0SA 3PIOL 3RMBA 3KZBA 3ZYYX 4O0IA 4LF7K 3IDHA 3UIQA 3AVMA 3LDSA 1SL2A 2HHHK 1TL3A 1S1WA 3EL2A 4YDUA 1ESVA 3JYTA 3QNNA 3FLCO 3ALYA 2A42A 3H1VX 4CZKA 1H1VA 4M41A 3VQ9A 1VSFA 4JD2A 3MN9A 3ZSQA 3RVCA 1KXPA 4OLBA 2HBKA 4A57A 1CXQA 2NLXA 3OYAA 4CHQA 2Y1JA 1BWFO 1RGIA 2NRWA 4ICLA 1QZ6A 4B8AB 5KGWA 4LFCK 2PFUA 4KAZA 3GG4A 1W2BM 3FZKA 4FW1A 3L6QA 3VGMA 3HK2A 3ASMA 4GVEA 2OCEA 3FZMA 5FPEA 3T1HK 1NOYA 3NF7A 4CERA 3CERA 3SQ0A 3NVKA 4X64K 1JLQA 3GE1A 3HM8A 4CF1A 5GIPA 4M3RA 2QWMA 3I8BA 4CK2A 4HVJA 2F96A 2IVNA 2P9LB 4F9OA 3KIOA 3M8QA 3PO5A 2OPSA 2HNYA 1L3UA 2KW4A 1VQ9N 3RMDA 2QKBA 4HHTA 3BGRA 4GKKK 3VEXA 1QS4A 3HT3A 3B6PA 2D0BA 3V9XA 1IBLK 1WB9A 1OH8A 4C8OA 4L3QA 2UUBK 1S1TA 4DQQA 4IZ9A 4KI4A 3TSQA 2QW9A 4BWJA 4ELTA 4B9LA 2XHBA 4JI2K 2HMIA 4XH5A 1WBDA 2W6LA 3IKMA 3VA3A 3CJBA 4Z4FA 5AFUA 3V9SA 1JCEA 4FJ5A 4DQIA 2FC0A 5LJWA 4CFBA 4BE2A 4BREA 4FWQA 1I39A 2E20A 2CGKA 1RDAA 3EO3A 1L3SA 4BVPA 3ZETA 1TKZA 3UB5A 4FJMA 4PQUA 4CJSA 4BC2A 3CJCA 2ZQBA 1HKBA 2V7ZA 3CIPA 4IFYA 4H5VA 3OYBA 4H0VB 4JI1K 2BDPA 4DV1K 2NZTA 4H0PA 3MXIA 2E2NA 3VGLA 2F8TA 3HSTB 2VYPA 3L2WA 3HRGA 4CFCA 2YI1A 3AO3A 3O6WA 3THWB 3SUOA 2O8FA 4JS5A 1WSEA 4O55A 1RT5A 1RDDA 5CHIA 1RTIA 1G15A 4KH4A 2WFBA 1OH5A 1NK7A 4CF9A 4CHNA 5BR8K 4B9TA 4E3SA 2BUPA 3MWTA 2F9WA 4CGIA 5JS2A 3OYGA 3MEDA 4BQZA 3BUZB 4AHVA 2QI2A 4B1YB 3P38A 3ENHA 3VA0A 3PO4A 5JMVA 3OS2A 3UKRB 3TAPA 4JKFA 3SV3A 4DSEA 3MAQA 2FLOA 4AM6A 1Y64A 2FF6A 2VG5A 4B9VA 4V19S 4F3OA 4BDYA 1YVNA 3BF1A 3LALA 4CCHA 4FZXC 3VF4A 2HHXA 3UKUA 3ULEA 4H5RA 4LF6K 3T69A 1ZBLA 1WAJA 4LF8K 4PWDA 4IDHA 1EWQA 3CQ8A 1E4GT 3DWLA 4FW2A 3K58A 1NGJA 4OLAA 4CJTA 4CZFA 5EY4A 1V4SA 3IS9A 3OW2M 3HTVA 3SQ1A 3VERA 1JCFA 1Q81O 2E1ZA 5BREA 1HJRA 4G9ZA 2I5JA 3NF8A 3VQ4A 5AZIB 2E4LA 5KQDA 4OPKA 4BRPA 5BRFA
chains in the Genus database with same CATH topology
3OBYA 2HF3A 4B1WB 3J7ZO 4IO9L 3GOIA 1U2VA 3TPQA 3CQYA 3QBWA 1NGDA 1WOQA 2HBJA 2HBLA 3H46O 3M1FA 5EX5A 3HBTA 2E88A 2NRHA 3ZX0A 5KPTA 2A3ZA 2Q0RA 5M1OA 3IMXA 2ASMA 4IOCL 3CI5A 1EQYA 4BR2A 4FWPA 3SJHA 2WC9A 1YI2N 1YUWA 3EKUA 4H5WA 4A62A 5AQRA 3FZFA 4ISFA 1KAZA 1WUAA 4BRGA 5KPRA 4DKWA 1EO1A 3VTIA 1RDWX 5GIOA 1S3XA 3LDPA 4PKHA 2PBDA 4EAHD 4M7XA 4BRQA 3ID8A 2Q0UA 4ISGA 4GV3A 5AQTA 4JK8A 1GLEG 2NRTA 2RHKA 4K43A 3C65A 4XEIA 4AF1A 3ATVA 2P9LA 1IJJA 2P9IB 1NGEA 3UKUB 3WXIA 3O1BA 3H3NO 1C0GA 3LDQA 4JKAA 2P9PA 5AQMA 2CGLA 1VQMN 1RDUA 1VQPN 3VEOA 1DGKN 1IG8A 2W40A 4FWRA 3G25A 1SAZA 3JXUA 1NWKA 4NO7A 5F1XA 3AGRA 5AQIA 1ZC6A 1VQLN 3F2KA 1Z6RA 4AM7A 4WFAL 3IFRA 3CXCM 3AAQA 3K9KA 1LOTB 3CCLN 4A61A 4BC3A 2PAVA 2VWBA 4MLHA 1BUPA 4BG8A 3MCAB 3M6GA 2A6AA 4C1NK 4BRHA 1BDGA 4FVUA 3OBWA 1XUPO 4A2BA 3CC7N 4FWLA 4WQ4C 5AZIA 4CZLA 3VESA 4CZHA 3CJ7A 3BP8A 3HZ6A 4HTLA 3GDQA 3WEEB 1RFQA 4FL9A 2W41A 4BC5A 3KVGA 5AQYA 2OTLN 2HBMA 2QEXN 3O8MA 1NGGA 3ENBA 4GNIA 1GLJO 4YOVA 4EFHA 3CPWM 4DCHA 1BO5O 2FXUA 4ILGB 3MCPA 4JK9A 4J8FA 4DQ8A 2J4RA 1X9JA 3QICA 5C15A 4A2AA 3GBTA 2ZJRL 4WYBA 1GLFO 2GX9A 4B9QA 4BR7A 3BF3A 5JLFA 5I9EB 3A5LC 2YHXA 2QWOA 2YJEA 1X3NA 1QQOA 4FPAA 1YIJN 3ZX2A 5H1SQ 3EKSA 3WXLA 4YOUA 4CD1A 5AQFA 3VEYA 4YOYA 1YAGA 3KWGA 3P39A 4IEEA 1TUYA 1KQSM 5AQUA 1GLBG 2A40A 1NGFA 4CJ7A 5BR9A 1Q18A 3DAWA 4B1ZA 4BQLA 1T3VA 3RSEB 1K9MO 4IXCA 1DKGD 3CMEN 1HX1A 5M1QA 3HSCA 1Q7YO 2YHYA 1BA1A 5AQNA 2QM1A 3RSEA 3CMAN 2GELA 1BU6O 5C2FA 1Q82O 4CI6A 4JKGA 5E26A 5C2DA 3O4WA 3SAGA 5GADP 4BRKA 3G71N 2WBNA 2WUSA 4BR4A 2IIRA 1N8RO 4B1VA 3KWIA 4YOWA 2CGJA 2HOEA 4CZEA 2D4WA 1NLVA 2ZF5O 3TU5A 3VF6A 3W0LA 2F7TA 3O9QA 3U8XA 1TYQB 4NB4A 4A59A 1YJNN 5KPZA 3O9UA 4CZIA 4A5AA 3A5NC 1VQ5N 4R79A 1ATSA 4H03B 4JKEA 1QVGM 5JVGL 1NM1A 1ZXOA 4KH5A 3KHYA 4ILJA 4IO8A 4BC4A 5BRDA 1VQ4N 1YF5L 1BA0A 2AA4A 2BTFA 1XC3A 1QVFM 3D2EA 4WQ4A 5TKWA 2D0OA 3TTFA 2QWQA 2NNWA 2QXLA 3ID6A 4H0YB 5AQSA 1V4TA 3SMSA 4PHTX 1G99A 3CCEN 3E9LA 3WXJA 3H45C 3SAHA 3K9JA 3CHWA 3LDNA 4O5FA 3VPZA 3F9MA 3U9DA 3SLCA 4IOAL 5LJVA 3D2FA 4C23A 5AQJA 3EE8A 4K41A 3I56N 3CCJN 1YITN 4BGAA 3LM9A 4PKIA 2VGMA 1T6DA 4MDAA 3WXKA 2FSNA 1KAYA 3CETA 4Y0WA 2NRVA 3E1YA 3VEZA 3ZETB 3OA9A 3Q7CA 2RE2A 3O5BA 1MA9B 3G4SN 1QQMA 1BG3A 1VQKN 3W3DA 1OKJA 2HMPA 2VGNA 3VMFB 2HF4A 5HOOA 4ILHA 3AARA 3CCVN 2Q1NA 3A0IX 1S72N 2YJFA 4FOEA 4H5TA 3MX2A 4EHUA 4WF9L 2UYTA 3IUCA 4IOXA 4PL8A 4FWSA 4C1NI 2P9SA 3O08A 5FPNA 1K73O 1VQ8N 1VQNN 5BPLA 4BVOA 2P9SB 3CCSN 4JHDA 1VAZA 1TUUA 3E66A 3VGKA 2F9TA 5C10A 4MO5A 4BRMA 2Q97A 5FPDA 2FSKA 4JK7A 3HI0A 5F0XA 1NJIO 1QZ5A 3O1WA 4JHDB 4BG9A 3AY9A 4KH6A 3R9PA 4JKHA 1M90O 3AAPA 4O8KA 3F5TA 2GEMA 2P9IA 3ZX3A 2Q2RA 5F2RA 4ISEA 2BH1A 2IVOA 2FSJA 4HWIA 4QS9A 4PKGA 3CCRN 2Q36A 4DHYA 3FZHA 3VENA 3ATUA 4CBWA 2GUPA 1JJ2M 3A5OC 3QFPA 2ASOA 3LDOA 2NRRA 3EZWA 1MWKA 2D1KA 3E9OA 5AQZA 1M1KO 1VQ6N 3CCUN 3L0QA 5AQOA 1E4FT 3H1QA 3H3OB 3I55N 3D7EO 3MN7A 3PIOL 2E2PA 3KZBA 3QB0A 3MDQA 3ZYYX 1T6CA 2D0PA 1CZAN 4B1XB 1KAXA 3IDHA 4QS8A 3MN6A 4FWOA 2V51B 2Q31A 2JWKA 3A8YA 4GV6A 2QWRA 3EE9A 3ZEUB 5DM7L 3EL2A 1HLUA 1ESVA 2VCPA 4YDUA 5CR4A 3FLCO 5AQVA 1YJWN 2A42A 2KKZA 3H1VX 5TKYA 2V52B 3MN5A 4CZKA 1H1VA 4BRFA 5M1KA 1YXQA 5C0YA 4JD2A 3NMUA 3MN9A 5M1PA 3RVCA 1KXPA 4Z94A 4JKCA 2HBKA 1HKGA 4A57A 4BRIA 2NLXA 1Q86O 1VQ7N 3N4QA 3E9PA 1HKCA 5EVZA 4BR9A 3J8AA 1BWFO 1RGIA 1QHAA 1SS6A 2NRWA 1QZ6A 2PFUA 3GG4A 4H0TB 4JEPA 4JN4A 3C6AA 5BPMA 1W2BM 3L4QA 3FZKA 5BN9A 4CZGA 5E84A 3GL1A 4WCEL 5ELZA 3R8EA 2QWPA 5AQLA 3L6QA 3VGMA 4BY9C 3VEWA 4QS7A 3KK7A 4GVEA 3P31A 3FZMA 1O13A 5FPEA 2GWKA 3FR0A 2CH6A 2OTJN 3H6EA 4CZJA 4IFEA 2OANA 3CERA 3DXKB 4BR5A 3NVKA 4IWVA 2V7YA 3OHRA 3CCQN 2AP1A 3GE1A 3HM8A 2EWSA 1NBWA 3M5RA 5GIPA 5BN8A 1S22A 3QFUA 2QWMA 2HSTA 1HUXA 1ATRA 3I8BA 3C6HA 3FFKB 3M3ZA 4FO0A 2ITMA 2ZJQL 2IVNA 2P9LB 4F9OA 3VF2A 3QDKA 5AZJA 1VQ9N 3WXMB 3JS6A 5MLCQ 2P9PB 4M7YA 3TSUA 3VEXA 4MO4A 2YCHA 4BRDA 1SZ2A 2H3GX 4I6MA 3ENOA 1K8AO 1TYQA 4OPHA 4RCHA 1R59O 5C12A 4FWMA 3Q7BA 3N4PA 4I6MB 2QTDA 3DXMA 1SQKA 4L3QA 5AFUH 1HPMA 4IJNA 2E2OA 3TTDA 2QWNA 5AQHA 4FOIA 4PL7A 3A5MC 4IZ9A 1GLAG 3DXMB 1XQSC 1P90A 1BOTO 2QW9A 4K25A 4XH4A 3R1XA 2E2QA 2I7NA 3TSQA 3UKRA 4BR0A 4K42A 2A41A 3WQTA 4XH5A 3UE5A 5JVHL 3I33A 3IKMA 1VQON 1K8KB 3BEXA 3CJBA 5KQ8A 5AFUA 4M63C 4MLEA 1JCEA 3WEEA 2ZWHA 3D2FB 5HL7L 4BRCA 5LJWA 2JWLA 3VTHA 1GLCG 4EIAA 4BREA 4FWQA 4FSVA 5AQPA 5GAEP 5BPNA 3QMLA 5AQKA 3SAFA 2E20A 2CGKA 3CD6N 3EO3A 1MDUB 4FWNA 3ULEB 4YOXA 3C0BA 2P9NB 3CJ9A 4BVPA 3HOTA 3ZETA 3UB5A 5GAGP 5DM6L 5GINA 4BROA 3FGUA 2CH5A 2ZGZA 3CJ1A 5ADXA 5LY3A 2P9NA 4BGBA 5AQGA 4BC2A 4FPBA 1P8ZA 4GV9A 1ILYA 3CJCA 1MWMA 1D4XA 1HKBA 2V7ZA 3CIPA 2NRZA 4H5VA 4H0VB 4JKDA 4CZMA 5JICA 2NZTA 3D6RA 4B1UB 4H0PA 1W97L 2E2NA 3SMPA 5M1FA 2E1YA 4YORA 3WT0A 2YHWA 3O9SA 3VGLA 2DPNA 2VYPA 3DXKA 5EOYA 5AQXA 3HRGA 4FWKA 4H5NA 2YI1A 3O6WA 3O9TA 3VOVA 1QQNA 4LC9B 3VEVA 4JNEA 1KC8O 4DB3A 5CHIA 3B8AX 4KH4A 4WQ5C 3CC4N 1HJOA 5AR0A 2WFBA 4O8UA 5AZJB 4RTFD 1NGAA 4BRAA 3DLLL 1YJ9N 4JKGB 4U67L 3CJAA 1T44A 3CQXA 2GWJA 2NRXA 3MMVA 1NGCA 1GLDG 5FPMA 2P9KA 2BUPA 4BRNA 4CBXA 3MWTA 2F9WA 2IVPA 4GY2B 2FF3B 3TTCA 4BQZA 2P9KB 3BUZB 4H0XB 2QI2A 3WUHA 1KD1O 3WQUA 4CD3A 2QA4N 3CPEA 3P38A 4B1YB 4CBUA 3CC2N 3ENHA 3C7NB 3U9ZA 2P9UA 5JMVA 4WFNL 3HOSA 3LM2A 3UKRB 2ZJPL 3FZLA 4JKFA 5M1NA 1NGIA 5GAHP 2FLOA 5AQWA 4AM6A 3PIPL 3C7NA 3MWPA 1DT9A 2P9UB 1Y64A 3R6MA 2FF6A 4BRLA 3CCMN 1K8KA 1ATNA 3MK6A 5JLHA 4YOTA 3SK3A 4NLCA 4WFBL 3S41A 5B8HA 1LCUA 4XH1A 3FE1A 3AGKA 4A5BA 3MX5A 2KHOA 1YVNA 3BF1A 3TSPA 1NGHA 3VF4A 1YHQN 1J6ZA 3DJCA 4MDBA 3P4IA 3UKUA 3ULEA 3SBGA 4H5RA 4KBOA 3T69A 4UY8O 1NGBA 4JD2B 3T7ZA 3O9RA 4JKBA 4RWTA 1OVYA 3R3LA 4IDHA 4WQ5A 3LL3A 1E4GT 3DWLA 3O80A 4IJAA 4YDUC 5BRHA 4E1JA 5ADXH 1NGJA 4OO1J 4NLBA 4CZFA 3SBTA 5EY4A 1V4SA 3NVMA 4IEIA 3G6EN 3OW2M 2QWLA 2GTDA 3D2EB 3HTVA 1NMDA 3VERA 2A5XA 4EHTA 2KLAA 4OPAA 1JCFA 4JAXA 2ASPA 2YX6A 3CF5L 1Q81O 2E1ZA 5BREA 3LDLA 3ZEUA 4G9ZA 5EXWA 2E8AA 1C0FA 5AQQA 4U7BA 5AZIB 1X3MA 4H0OA 1JCGA 5KQDA 3QBXA 3U4LA 1GLLO 3VETA 2I7PA 3PLAA 1DEJA 1U6ZA 1ZBSA 3L4IA 4BRPA 1U2VB 1Z05A 5CE3A 2ZGYA 3EN9A 5BRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF3 A;  4B1W B;  3GOI A;  1U2V A;  3TPQ A;  3CQY A;  3QBW A;  1NGD A;  1WOQ A;  3H46 O;  3M1F A;  5EX5 A;  3HBT A;  2E88 A;  2NRH A;  3ZX0 A;  5KPT A;  2A3Z A;  2Q0R A;  3IMX A;  2ASM A;  3CI5 A;  1EQY A;  4BR2 A;  4FWP A;  3SJH A;  1YUW A;  3EKU A;  4H5W A;  4A62 A;  5AQR A;  3FZF A;  4ISF A;  1KAZ A;  1WUA A;  4BRG A;  5KPR A;  1RDW X;  1S3X A;  3LDP A;  4PKH A;  2PBD A;  4EAH D;  4M7X A;  4BRQ A;  3ID8 A;  2Q0U A;  4ISG A;  5AQT A;  1GLE G;  4K43 A;  4XEI A;  3ATV A;  2P9L A;  1IJJ A;  2P9I B;  1NGE A;  3UKU B;  3WXI A;  3O1B A;  3H3N O;  1C0G A;  3LDQ A;  2P9P A;  5AQM A;  2CGL A;  3VEO A;  1DGK N;  1IG8 A;  2W40 A;  4FWR A;  3G25 A;  1SAZ A;  3JXU A;  1NWK A;  4NO7 A;  5F1X A;  5AQI A;  1ZC6 A;  1Z6R A;  4AM7 A;  3IFR A;  3AAQ A;  1LOT B;  4A61 A;  4BC3 A;  2PAV A;  2VWB A;  4MLH A;  1BUP A;  4BG8 A;  3M6G A;  2A6A A;  4BRH A;  1BDG A;  1XUP O;  4A2B A;  4FWL A;  4WQ4 C;  5AZI A;  4CZL A;  3VES A;  4CZH A;  3CJ7 A;  3BP8 A;  3HZ6 A;  4HTL A;  3GDQ A;  3WEE B;  1RFQ A;  4FL9 A;  2W41 A;  4BC5 A;  3KVG A;  5AQY A;  3O8M A;  1NGG A;  4GNI A;  1GLJ O;  4EFH A;  4DCH A;  1BO5 O;  2FXU A;  3MCP A;  4J8F A;  4DQ8 A;  2J4R A;  1X9J A;  3QIC A;  4A2A A;  3GBT A;  4WYB A;  1GLF O;  4B9Q A;  4BR7 A;  3BF3 A;  5JLF A;  5I9E B;  3A5L C;  2YHX A;  2QWO A;  2YJE A;  1X3N A;  1QQO A;  4FPA A;  3ZX2 A;  3EKS A;  3WXL A;  4CD1 A;  5AQF A;  3VEY A;  1YAG A;  1TUY A;  5AQU A;  1GLB G;  2A40 A;  1NGF A;  4CJ7 A;  5BR9 A;  1Q18 A;  3DAW A;  4B1Z A;  4BQL A;  3RSE B;  4IXC A;  1DKG D;  1HX1 A;  3HSC A;  2YHY A;  1BA1 A;  5AQN A;  2QM1 A;  3RSE A;  2GEL A;  1BU6 O;  4CI6 A;  5E26 A;  3O4W A;  4BRK A;  2WUS A;  4BR4 A;  2IIR A;  4B1V A;  2CGJ A;  2HOE A;  4CZE A;  2D4W A;  1NLV A;  2ZF5 O;  3TU5 A;  3VF6 A;  3W0L A;  3U8X A;  1TYQ B;  4NB4 A;  5KPZ A;  4CZI A;  3A5N C;  1ATS A;  4H03 B;  1NM1 A;  1ZXO A;  3KHY A;  4IO8 A;  4BC4 A;  5BRD A;  1BA0 A;  2AA4 A;  2BTF A;  1XC3 A;  3D2E A;  4WQ4 A;  2D0O A;  2QWQ A;  4H0Y B;  2QXL A;  5AQS A;  1V4T A;  3SMS A;  1G99 A;  3WXJ A;  3H45 C;  3CHW A;  3LDN A;  4O5F A;  3VPZ A;  3F9M A;  3U9D A;  3SLC A;  5LJV A;  3D2F A;  4C23 A;  5AQJ A;  4K41 A;  4BGA A;  3LM9 A;  4PKI A;  1T6D A;  3WXK A;  2FSN A;  1KAY A;  3CET A;  4Y0W A;  3VEZ A;  3ZET B;  3O5B A;  1MA9 B;  1QQM A;  1BG3 A;  3W3D A;  1OKJ A;  2HMP A;  2HF4 A;  3AAR A;  2Q1N A;  3A0I X;  2YJF A;  4FOE A;  4H5T A;  4EHU A;  2UYT A;  3IUC A;  4PL8 A;  4FWS A;  2P9S A;  3O08 A;  5FPN A;  5BPL A;  4BVO A;  2P9S B;  4JHD A;  3VGK A;  1TUU A;  2F9T A;  4MO5 A;  4BRM A;  2Q97 A;  5FPD A;  2FSK A;  3HI0 A;  5F0X A;  1QZ5 A;  3O1W A;  4JHD B;  4BG9 A;  3AY9 A;  3R9P A;  3AAP A;  4O8K A;  2GEM A;  2P9I A;  3ZX3 A;  2Q2R A;  5F2R A;  4ISE A;  2IVO A;  2FSJ A;  4HWI A;  4QS9 A;  4PKG A;  2Q36 A;  4DHY A;  3FZH A;  3VEN A;  3ATU A;  4CBW A;  2GUP A;  3A5O C;  3QFP A;  2ASO A;  3LDO A;  3EZW A;  1MWK A;  2D1K A;  5AQZ A;  3L0Q A;  5AQO A;  3H1Q A;  3H3O B;  1E4F T;  3D7E O;  3MN7 A;  2E2P A;  3KZB A;  3QB0 A;  3MDQ A;  1T6C A;  2D0P A;  1CZA N;  4B1X B;  1KAX A;  3IDH A;  4QS8 A;  3MN6 A;  4FWO A;  2V51 B;  2Q31 A;  3A8Y A;  2QWR A;  3ZEU B;  3EL2 A;  1HLU A;  1ESV A;  2VCP A;  4YDU A;  3FLC O;  5AQV A;  2A42 A;  3H1V X;  5TKY A;  2V52 B;  3MN5 A;  4CZK A;  1H1V A;  4BRF A;  1YXQ A;  4JD2 A;  3MN9 A;  1KXP A;  4Z94 A;  1HKG A;  4BRI A;  2NLX A;  1HKC A;  5EVZ A;  4BR9 A;  3J8A A;  1BWF O;  1RGI A;  1QHA A;  1QZ6 A;  3GG4 A;  4H0T B;  4JN4 A;  5BPM A;  3FZK A;  5BN9 A;  4CZG A;  5E84 A;  3GL1 A;  5ELZ A;  3R8E A;  2QWP A;  5AQL A;  3L6Q A;  3VGM A;  3VEW A;  4QS7 A;  3FZM A;  5FPE A;  2GWK A;  3FR0 A;  2CH6 A;  3H6E A;  4CZJ A;  2OAN A;  3CER A;  3DXK B;  4BR5 A;  4IWV A;  2V7Y A;  3OHR A;  2AP1 A;  3GE1 A;  3HM8 A;  2EWS A;  1NBW A;  5BN8 A;  1S22 A;  3QFU A;  2QWM A;  3I8B A;  1HUX A;  1ATR A;  3FFK B;  3M3Z A;  4FO0 A;  2ITM A;  2IVN A;  2P9L B;  4F9O A;  3VF2 A;  3QDK A;  5AZJ A;  3JS6 A;  2P9P B;  4M7Y A;  3VEX A;  4MO4 A;  2YCH A;  4BRD A;  1SZ2 A;  2H3G X;  4I6M A;  3ENO A;  1TYQ A;  4RCH A;  1R59 O;  4FWM A;  4I6M B;  3DXM A;  1SQK A;  4L3Q A;  5AFU H;  1HPM A;  4IJN A;  2E2O A;  2QWN A;  5AQH A;  4FOI A;  4PL7 A;  3A5M C;  4IZ9 A;  1GLA G;  3DXM B;  1XQS C;  4K25 A;  1BOT O;  2QW9 A;  4XH4 A;  3S41 A;  3UKR A;  2E2Q A;  2I7N A;  4BR0 A;  4K42 A;  2A41 A;  3WQT A;  4XH5 A;  3UE5 A;  3I33 A;  1K8K B;  3BEX A;  3CJB A;  5KQ8 A;  5AFU A;  4M63 C;  4MLE A;  1JCE A;  3WEE A;  2ZWH A;  3D2F B;  4BRC A;  5LJW A;  1GLC G;  4EIA A;  4BRE A;  4FWQ A;  4FSV A;  5AQP A;  5BPN A;  3QML A;  5AQK A;  2E20 A;  2CGK A;  3EO3 A;  1MDU B;  4FWN A;  3ULE B;  3C0B A;  2P9N B;  3CJ9 A;  4BVP A;  3ZET A;  3UB5 A;  4BRO A;  3FGU A;  2CH5 A;  2ZGZ A;  3CJ1 A;  5ADX A;  5LY3 A;  2P9N A;  4BGB A;  5AQG A;  4BC2 A;  4FPB A;  1P8Z A;  3CJC A;  1MWM A;  1D4X A;  1HKB A;  2V7Z A;  3CIP A;  4H5V A;  4H0V B;  4CZM A;  5JIC A;  2NZT A;  4B1U B;  4H0P A;  2E2N A;  3SMP A;  2E1Y A;  3WT0 A;  2YHW A;  3VGL A;  2DPN A;  2VYP A;  3DXK A;  5EOY A;  5AQX A;  4FWK A;  4H5N A;  2YI1 A;  3O6W A;  3VOV A;  1QQN A;  4LC9 B;  3VEV A;  4JNE A;  4DB3 A;  3B8A X;  4WQ5 C;  1HJO A;  5AR0 A;  5AZJ B;  4BRA A;  4RTF D;  1NGA A;  3CJA A;  1T44 A;  3CQX A;  2GWJ A;  3MMV A;  1NGC A;  1GLD G;  5FPM A;  2P9K A;  2BUP A;  4BRN A;  4CBX A;  2F9W A;  2IVP A;  4GY2 B;  2FF3 B;  4BQZ A;  2P9K B;  3BUZ B;  4H0X B;  3WUH A;  3WQU A;  4CD3 A;  4B1Y B;  4CBU A;  3ENH A;  3C7N B;  3U9Z A;  2P9U A;  5JMV A;  3LM2 A;  3UKR B;  3FZL A;  1NGI A;  2FLO A;  5AQW A;  4AM6 A;  3C7N A;  4BRL A;  2P9U B;  1Y64 A;  3R6M A;  2FF6 A;  1K8K A;  1ATN A;  3MK6 A;  5JLH A;  3SK3 A;  5B8H A;  1LCU A;  4XH1 A;  3FE1 A;  2KHO A;  1YVN A;  3BF1 A;  1NGH A;  3VF4 A;  1J6Z A;  3DJC A;  3P4I A;  3UKU A;  3ULE A;  4H5R A;  4KBO A;  1NGB A;  4JD2 B;  4RWT A;  4WQ5 A;  3LL3 A;  1E4G T;  3DWL A;  3O80 A;  4IJA A;  4YDU C;  5BRH A;  4E1J A;  5ADX H;  1NGJ A;  4CZF A;  5EY4 A;  1V4S A;  2QWL A;  2GTD A;  3D2E B;  3HTV A;  1NMD A;  3VER A;  2A5X A;  4EHT A;  1JCF A;  4JAX A;  2ASP A;  2E1Z A;  5BRE A;  3LDL A;  3ZEU A;  5EXW A;  2E8A A;  1C0F A;  5AQQ A;  5AZI B;  1X3M A;  4H0O A;  1JCG A;  5KQD A;  3QBX A;  3U4L A;  1GLL O;  3VET A;  2I7P A;  1DEJ A;  1U6Z A;  1ZBS A;  3L4I A;  4BRP A;  1U2V B;  1Z05 A;  5CE3 A;  2ZGY A;  3EN9 A;  5BRF A; 
#chains in the Genus database with same CATH topology
 2HF3 A;  3J7Z O;  3GOI A;  1VRU A;  3KLG A;  1TK5 A;  3SUQ A;  1WOQ A;  3CG7 A;  3H46 O;  4GVM A;  4J2E A;  5EX5 A;  3ZX0 A;  2DY4 A;  1S9G A;  2E88 A;  4J2B A;  5KPT A;  2Q0R A;  5M1O A;  4B3R K;  1OVQ A;  2HHV A;  1C0U A;  4KRF A;  3EKU A;  4A62 A;  4BRG A;  3FZF A;  1EO1 A;  4DKW A;  4FCY A;  3V1Q A;  1RDW X;  3LDP A;  2GUI A;  4DSL A;  4DF4 A;  2PBD A;  2XY5 A;  4EAH D;  4M7X A;  1O1W A;  1ZYQ A;  4ISG A;  4GV3 A;  2B6A A;  5C42 A;  3NE6 A;  4ID1 A;  4K43 A;  3C65 A;  4CFA A;  1IO2 A;  3LP0 A;  1IJJ A;  2P9I B;  3TAN A;  5SWM A;  1NGE A;  3LPT A;  3O1B A;  1IKW A;  2P9P A;  3QEX A;  4ZHR A;  2A1R A;  2CGL A;  1VQP N;  2B4J A;  4FWR A;  2JLE A;  3G25 A;  3SPY A;  1VSM A;  2HVH A;  3AGR A;  4DLG A;  1Z6R A;  3K9K A;  1LOT B;  2UXC K;  4E7H A;  4MLH A;  3I0S A;  2YKM A;  4J2D A;  1NK8 A;  1S6Q A;  3QIO A;  4FVU A;  4BRH A;  3OBW A;  4FLV A;  1EX4 A;  3CC7 N;  2HHU A;  4DFK A;  4CZH A;  3IRX A;  3CJ7 A;  3BP8 A;  4HTL A;  2PY5 A;  3WEE B;  2YNG A;  3P83 D;  4AHT A;  2W41 A;  4CIF A;  2HHS A;  2IS3 A;  4RW6 A;  2A1S A;  4E1N A;  1QSL A;  4CJ3 A;  3ENB A;  4FJL A;  3DMJ A;  4CJE A;  3ZSW A;  1WSH A;  4DSK A;  2HHT A;  3TAF A;  4G1Q A;  3GBT A;  1GLF O;  2RPI A;  1UAX A;  4B9Q A;  4BE1 A;  3BF3 A;  5I9E B;  2QWO A;  1X3N A;  1QQO A;  4GKJ K;  3ZX2 A;  4E7J A;  5AQF A;  4YOY A;  4Z4G A;  2F8S A;  3NF6 A;  4CJ7 A;  1ZBI A;  1Q18 A;  1I94 K;  3ZSR A;  4B1Z A;  3EY1 A;  3CME N;  4IXC A;  4DSJ A;  3SV4 A;  1S1V A;  5M1Q A;  1WSG A;  4O4G A;  3HVT A;  4M3W A;  4FZZ A;  4DV7 K;  5DK5 A;  1IKX A;  2VG6 A;  4IFV A;  3QEW A;  3G71 N;  3ZSV A;  1NMN A;  3HL8 A;  5I3U A;  3KWI A;  1WNS A;  1NLV A;  4JI8 K;  3AO5 A;  3LAM A;  3H08 A;  4NB4 A;  4L8R B;  4BAC A;  5KPZ A;  3VQP A;  4B08 A;  3ZCM A;  3B6O A;  2IAJ A;  4JKE A;  1UA0 A;  1S6P A;  5JVG L;  4KH5 A;  1VQ4 N;  4I2Q A;  4E19 A;  1LAV A;  1BA0 A;  4LF5 K;  2AA4 A;  1XC3 A;  4FLW A;  1T05 A;  5FRN A;  1C0T A;  1RBS A;  3TTF A;  3SQ2 A;  3THV A;  4JS4 A;  3ZT1 A;  3K9J A;  4B9U A;  4O5F A;  2OYQ A;  2UUC K;  3C94 A;  3QEV A;  3SQ4 A;  3I56 N;  1YIT N;  3T3F A;  4M45 A;  4BGA A;  1T6D A;  3OYC A;  2FSN A;  3L3U A;  3E1Y A;  3ZET B;  1NKB A;  3LWM A;  3O5B A;  2YHA A;  3SUP A;  1ITG A;  1UOC A;  3G4S N;  3AVI A;  2HMP A;  1SKR A;  3A0I X;  1W0H A;  3THY B;  2IGI A;  4NYF A;  3M8S A;  4ID5 A;  1VSE A;  4WF9 L;  5AJ3 K;  4PL8 A;  1VQN N;  4KTQ A;  4CF2 A;  4BVO A;  1TL1 A;  4JHD A;  3E66 A;  2LSN A;  1JLE A;  3MEC A;  5FPD A;  3NAE A;  2FSK A;  3WNG A;  5F0X A;  1WAF A;  4BG9 A;  4JHD B;  1HRH A;  4B9M A;  4CED A;  3NHG A;  1HPZ A;  3AAP A;  2WTU A;  3S3N A;  2QXF A;  2BH1 A;  4QS9 A;  4QCL A;  1HNZ K;  2Q36 A;  4DHY A;  3FZH A;  4DUY K;  3V9W A;  2GUP A;  4JI5 K;  3A5O C;  1TK0 A;  3KD5 E;  2NRR A;  1UA1 A;  2PYJ A;  5HLF A;  5AQO A;  3H1Q A;  3D7E O;  1VSK A;  4O44 A;  5CZ2 A;  4EP4 A;  3QB0 A;  3MDQ A;  1BI4 B;  1CZA N;  3NFA A;  4B1X B;  1IBM K;  1X9M A;  3MEE A;  4QS8 A;  2Q31 A;  3A8Y A;  5J1E A;  4GW6 A;  3ZEU B;  1XNR K;  4W5N A;  2VCP A;  5TKY A;  4JRP A;  1EKE A;  4BRF A;  5M1K A;  2G8I A;  4FZY A;  5M1P A;  4BWM A;  1RNH A;  1BIU A;  3HYF A;  2OZS A;  1HKC A;  5EVZ A;  1SS6 A;  1QHA A;  1I3A A;  4DF8 A;  4DFJ A;  4CEA A;  1IKV A;  3C6A A;  5BPM A;  5BN9 A;  4KHW A;  5E41 A;  5ELZ A;  3AVF A;  4I7F A;  1W9H A;  1MU2 A;  4QS7 A;  3KK7 A;  1HQU A;  3T19 A;  1XHZ A;  4LY7 A;  4DSI A;  2GWK A;  3FR0 A;  2CH6 A;  2EHG A;  4CHZ A;  3H6E A;  4CZJ A;  4BR5 A;  3SJJ A;  3VQA A;  4IWV A;  4N5S A;  2AP1 A;  4Z4C A;  2EWS A;  3M5R A;  4W5T A;  5BN8 A;  3T1Y K;  5KRT A;  2VG7 A;  4FO0 A;  2QK9 A;  4KRE A;  3QDK A;  4JI4 K;  4Q0B A;  1HNX K;  1J54 A;  3WXM B;  1VK0 A;  3OYM A;  4KO0 A;  4CJV A;  3NGZ A;  4BRD A;  3OYH A;  4FLX A;  3EYZ A;  1TK8 A;  2H3G X;  4I6M A;  4YY3 K;  3LZJ A;  4OPH A;  3ZT2 A;  4I6M B;  1QHT A;  2QTD A;  2YKN A;  5AFU H;  2QWN A;  4KKO A;  4DUZ K;  1YTA A;  3A5M C;  1XMO K;  1XQS C;  1P90 A;  4LFA K;  2E2Q A;  2I7N A;  3I33 A;  1VQO N;  2VWK A;  1J9A A;  3VQ6 A;  1RBT A;  4FJI A;  4MLE A;  2HVI A;  4FJ8 A;  1FJG K;  4DR4 K;  5HL7 L;  4BRC A;  1HNW K;  2G8K A;  4NCA A;  2JWL A;  5GAE P;  4M42 A;  1MDU B;  1TKX A;  3PX6 A;  1TVR A;  3P1G A;  4HTU A;  4PY5 A;  1Z25 A;  4BRO A;  3FGU A;  1RT7 A;  3CJ1 A;  5ADX A;  5LY3 A;  1C1C A;  4BGB A;  1XWL A;  2VQF K;  4FPB A;  4CGJ A;  1P8Z A;  5K14 A;  1D5A A;  4GV9 A;  1MWM A;  1D4X A;  2NRZ A;  3LP2 A;  5JIC A;  3K59 A;  4B1U B;  5M1F A;  1W97 L;  5A2Q O;  2E1Y A;  4YOR A;  2YHW A;  3O9S A;  2DPN A;  1HYV A;  3DXK A;  1R0A A;  4FWK A;  4CF8 A;  4IDK A;  3O3F A;  4QAG A;  2W42 A;  4LC9 B;  1W7A A;  1BGX T;  1RDB A;  4JNE A;  4DB3 A;  1L3T A;  4OPJ A;  4WQ5 C;  4H8K A;  1HJO A;  5AZJ B;  3AO1 A;  3AVK A;  4O8U A;  4BRA A;  5HRN A;  4CEB A;  3DLL L;  3OYL A;  3OS1 A;  2NRX A;  4BRN A;  4PUO A;  2Z1J A;  1EET A;  2FF3 B;  4IG3 A;  2O8B B;  4YFU A;  3M8R A;  3K5O A;  4LH5 A;  2QA4 N;  3CC2 N;  2RKI A;  3C7N B;  1IBK K;  3LM2 A;  2ZJP L;  4C8N A;  1SUQ A;  1NGI A;  5AQW A;  2VWJ A;  3C7N A;  4KHU A;  1DT9 A;  3CCM N;  4DR5 K;  3TWH A;  1K8K A;  1ATN A;  5JLH A;  1QSY A;  3O4Q A;  4YOT A;  3D0P A;  5B8H A;  3FE1 A;  4E7L A;  4RW7 A;  4DQP A;  4NYN A;  3TSP A;  3KLH A;  3AVN A;  5HRP A;  2P51 A;  4Z4H A;  1K6Y A;  3ZT3 A;  4UY8 O;  1GOA A;  1NGB A;  3T7Z A;  3O9R A;  1TKD A;  5IWA K;  3TAM A;  1OVY A;  1TGO A;  4OKK A;  4E1M A;  3LL3 A;  1KFD A;  4N41 A;  3OYK A;  4AHR A;  5ADX H;  2AJQ A;  3G6E N;  4JLH A;  1L3V A;  2GTD A;  4EHT A;  3CM5 A;  3CF5 L;  4DTX A;  3LDL A;  3J80 O;  5AQQ A;  4H0O A;  3U4L A;  3V1R A;  3VQE A;  2BAN A;  1DEJ A;  2ETJ A;  3L4I A;  1VRT A;  3DLE A;  5CE3 A;  3EN9 A;  1U04 A;  4H4O A;  5DM7 L;  1RT4 A;  3G0Z A;  4B1W B;  5FDL A;  4CGF A;  3TPQ A;  4W5O A;  1NGD A;  4PA1 A;  4KHQ A;  3HBT A;  1KVA A;  3DI6 A;  3T1A A;  2G8V A;  2A3Z A;  4AHC A;  4FLU A;  1CXU A;  5FLX O;  2E5L K;  1ASV A;  3CI5 A;  4I2P A;  4BR2 A;  4CHP A;  2WC9 A;  4CJ5 A;  3LPU A;  3SAF A;  5KPR A;  5AQR A;  4ISF A;  4CGD A;  3VTI A;  4DS5 A;  4PKH A;  3HPG A;  1XC9 A;  1J5O A;  3ID8 A;  2YHB A;  4FM2 A;  4JK8 A;  2NRT A;  3AVH A;  4AF1 A;  4KHP K;  1ZBH A;  3WXI A;  1JL2 A;  3RRH A;  4JKA A;  4FJX A;  3NBP A;  1IG8 A;  2W40 A;  5FRO A;  3PX0 A;  1B92 A;  5CYM A;  4IBN A;  4AM7 A;  3SUN A;  3CXC M;  4A61 A;  3BDP A;  2PAV A;  3L2Q A;  1BI4 A;  1RBV A;  3M6G A;  1DTQ A;  2A6A A;  1BDG A;  1IG9 A;  1XUP O;  1QSS A;  3RR7 A;  3LWL A;  4A2B A;  4X66 K;  1TAU A;  1JXB A;  1C1B A;  3KVG A;  2HBM A;  3O8M A;  1NGG A;  1J5E K;  2ITG A;  4B3O A;  4EFH A;  4K0K K;  4OKJ A;  4ILG B;  4JYA K;  3MCP A;  4J8F A;  2W6K A;  4DQ8 A;  3S3O A;  2XO7 A;  2FBY A;  4EZ9 A;  4WYB A;  3LAN A;  3EZ5 A;  3K2P A;  2YHX A;  3K57 A;  2YJE A;  4DQR A;  2D5R A;  5H1S Q;  3EKS A;  3DOL A;  3WXL A;  3S3M A;  3VEY A;  1YAG A;  3P39 A;  4IEE A;  5AQU A;  2A40 A;  1NGF A;  5BR9 A;  3V9U A;  4BQL A;  4CK3 A;  4N76 A;  4DTO A;  1TKT A;  1DKG D;  2YHY A;  4IKF A;  4KHN A;  1ZBF A;  2GEL A;  1Q82 O;  4CI6 A;  4JKG A;  2R7Y A;  5C2D A;  3QES A;  3O4W A;  1YT3 A;  1E3M A;  3ZSX A;  4DV6 K;  2Y1I A;  1X9W A;  2IIR A;  2CGJ A;  3KK3 A;  4E7I A;  2D4W A;  3TU5 A;  2ZF5 O;  4M3Y A;  2X78 A;  3W0L A;  3L8B A;  1HMV A;  3U8X A;  4A59 A;  1KTQ A;  3ULD A;  4R79 A;  1Q9X A;  1RT3 A;  1ZXO A;  5BRD A;  4IO8 A;  1YF5 L;  3AA5 X;  3D2E A;  5TKW A;  3QER A;  1V4T A;  3SMS A;  4CJP A;  4LSN A;  3SAH A;  1KVC A;  3H45 C;  3CHW A;  1SL0 A;  3U9D A;  5LJV A;  4LH4 A;  5AQJ A;  2KTQ A;  3THW A;  3K5M A;  3LM9 A;  4MDA A;  1HQE A;  1KAY A;  2ZM6 K;  3DLH A;  1VSD A;  1MA9 B;  3CFP A;  1BG3 A;  3PX4 A;  2VGN A;  4ILH A;  4DTS A;  3AAR A;  1A5V A;  3DRR A;  4HUF A;  1Z26 A;  1S72 N;  3KD1 E;  3WNF A;  2O8E B;  3L3V A;  4FOE A;  3MX2 A;  4EHU A;  2UYT A;  3LP3 A;  1Q9Y A;  4C1N I;  2P9S A;  1BIZ A;  1SV5 A;  5FPN A;  1K73 O;  5BPL A;  3CCS N;  2P9S B;  4MFB A;  4CJF A;  4CE9 A;  1JLF A;  4CW7 B;  2KZM A;  2KFN A;  3R9P A;  1M90 O;  4F3T A;  4FJ9 A;  2IVO A;  4HWI A;  3ATU A;  4E7K A;  3BZC A;  4CBW A;  4DFP A;  3QFP A;  3LZI A;  5J2P A;  3KJV A;  3AO2 A;  3EZW A;  2D1K A;  2GV9 A;  1M1K O;  3CCU N;  1E4F T;  4DU3 A;  4HUG A;  1T6C A;  2D0P A;  4KB0 A;  3TR8 A;  1A5W A;  4B8C A;  3QNO A;  2QWR A;  4F2S A;  5CR4 A;  5AQV A;  3J81 O;  2V52 B;  3MN5 A;  4FJH A;  4DU1 A;  4CFD A;  3VQD A;  1CZB A;  5C0Y A;  3NMU A;  4JKC A;  1FKP A;  1HKG A;  3THX B;  1Q86 O;  1VSL A;  5HBM A;  2X6S A;  4H0T B;  2OA8 A;  4JN4 A;  3L4Q A;  4XIU A;  4GMJ B;  3GL1 A;  2QWP A;  4YHH K;  4BY9 C;  3P31 A;  4NXM K;  3SI6 A;  1O13 A;  1VSH A;  5T7B A;  3U3Y A;  2OTJ N;  3PSF A;  1YVU A;  2OAN A;  3OHR A;  1NBW A;  3QFU A;  3DRS A;  2HST A;  3C6H A;  3FFK B;  3KKR A;  2ITM A;  2ZJQ L;  2G8W A;  4FJN A;  4DSF A;  4DR6 K;  2FBT A;  4W5Q A;  3JS6 A;  1RIL A;  5MLC Q;  2P9P B;  4M7Y A;  3LP1 A;  2HHQ A;  2YCH A;  2BE2 A;  4FJ7 A;  3DLG A;  3ENO A;  1QTM A;  1K8A O;  4LFB K;  1U48 A;  1R59 O;  5C12 A;  3DXM A;  3TTD A;  5AQH A;  4C8M A;  4HCB A;  1BIS A;  3DXM B;  3MXJ A;  3ZSY A;  1BOT O;  3S41 A;  3UKR A;  3R1X A;  4FLY A;  4FJG A;  1SKS A;  2A41 A;  3WQT A;  3OYE A;  5JVH L;  4EZ6 A;  5KI6 A;  1NJW A;  3BEX A;  5KQ8 A;  3WEE A;  2ZWH A;  3D2F B;  4E0D A;  4KHY A;  3RRG A;  2WON A;  4CJR A;  3VTH A;  4EIA A;  5BPN A;  5CZ1 A;  3CD6 N;  3QML A;  5AQK A;  3RMC A;  3ULE B;  3NH0 A;  3P5J A;  3CJ9 A;  5DM6 L;  5GIN A;  2WOM A;  1NU0 A;  1ILY A;  1LW0 A;  4O5B A;  1RT6 A;  4CZM A;  2RF2 A;  2QKK A;  2Z1G A;  1XHX A;  3WT0 A;  4CJL A;  4CGG A;  4CEO A;  5HRO A;  2BGG A;  4W5R A;  2Q3S A;  5EOY A;  4DR2 K;  4I9Q A;  1LWC A;  5C25 A;  4OGC A;  1QQN A;  3OYN A;  2DTU A;  4OGE A;  3CC4 N;  4ELU A;  5AR0 A;  2NUB A;  1NGA A;  4FK0 A;  4U67 L;  1D8Y A;  3CQX A;  2GWJ A;  1NJX A;  3MMV A;  1NGC A;  5FRM A;  4ZTJ A;  1QE1 A;  3QEI A;  3HP6 A;  4GY2 B;  3TTC A;  4FLZ A;  4DV2 K;  3WUH A;  1KD1 O;  3U3G A;  1UWB A;  4CD3 A;  3U9Z A;  4KPY A;  2P9U A;  1XMQ K;  4DTP A;  3FZL A;  3AVA A;  5GAH P;  1D9D A;  2OPP A;  1NKE A;  2P9U B;  2IOC A;  4HCC A;  4WFB L;  1LCU A;  4XH1 A;  4JI7 K;  4A5B A;  3MX5 A;  4OX9 K;  5SZT A;  1NGH A;  3A2F A;  3J7A P;  1SL1 A;  3P4I A;  4CHO A;  3SBG A;  4KBO A;  1REV A;  1LWE A;  1ZBU A;  4DQS A;  4HUE A;  3R3L A;  4WQ5 A;  2IC3 A;  4Q5V A;  3C6U A;  4YDU C;  5BRH A;  4OO1 J;  3AVG A;  3NVM A;  4F8R A;  1C6V A;  3D2E B;  2A5X A;  4CGH A;  2ASP A;  4CIG A;  3AA2 A;  5EXW A;  2E8A A;  4U7B A;  4DWI A;  4I9L A;  1JCG A;  2ZD1 A;  3VN5 A;  3ZLJ A;  2UUA K;  1ZBS A;  1C1A A;  1U2V B;  1FKO A;  1Z05 A;  3L2U A;  3OBY A;  3OYD A;  3VQ5 A;  4KTZ A;  1U2V A;  4IO9 L;  3QBW A;  2HBJ A;  2HBL A;  2NRH A;  1OH6 A;  4RW9 A;  1WSF A;  4M3T A;  4DS4 A;  3O4N A;  3IMX A;  1B9D A;  2ASM A;  4IOC L;  3WNE A;  4FWP A;  1YI2 N;  1N33 K;  4H5W A;  1WUA A;  3V1O A;  1S5J A;  1NK5 A;  1XI1 A;  1S3X A;  5HRR A;  4F4K A;  4DTU A;  2Q0U A;  1RDC A;  2F4V K;  2OPR A;  1GLE G;  1BHL A;  4B9S A;  2RHK A;  4XEI A;  1BCM A;  3ATV A;  2P9L A;  1BCO A;  4DTR A;  3UKU B;  3LDQ A;  3AVC A;  4RW8 A;  4X62 K;  2VQE K;  4DV0 K;  2YV0 X;  1DGK N;  3DLK A;  3JXU A;  3HPH A;  3DLB A;  5AQI A;  1VQL N;  3F2K A;  3IFR A;  3CCL N;  3AAQ A;  3RR8 A;  4BC3 A;  2VWB A;  2HB5 A;  1BUP A;  3ZSO A;  3MCA B;  2G8U A;  2EX3 A;  4DTM A;  3KK2 A;  4FWL A;  3RMA A;  5AZI A;  4YNQ A;  3GDQ A;  4B3S K;  5LL6 Z;  4BC5 A;  3ISN C;  5AQY A;  2OTL N;  2QEX N;  2O8C A;  3E01 A;  1D9F A;  2X74 A;  4KFB A;  2UXD K;  4YOV A;  4LSL A;  4DCH A;  1BO5 O;  1N32 K;  2PYL A;  1NK6 A;  4JK9 A;  4FJJ A;  4KV8 A;  3QIC A;  5C15 A;  4A2A A;  2ZJR L;  4DR1 K;  1YIJ N;  3NF9 A;  3THY A;  2RN2 A;  1TUY A;  1KQS M;  3DAW A;  4CEF A;  3HSC A;  3OY9 A;  1BA1 A;  3HPO A;  5AQN A;  2QM1 A;  3SCX A;  1ASU A;  3F9K A;  5C2F A;  1YTU A;  1FXX A;  3SAG A;  1KVB A;  1KLM A;  2WBN A;  1J53 A;  2WUS A;  4BR4 A;  4FVM A;  1TV6 A;  1KCF A;  2D0A A;  3FFI A;  1N5Y A;  3VF6 A;  2F7T A;  3O9Q A;  3DRP A;  1OH7 A;  4MQ3 A;  1YJN N;  1VHX A;  4A5A A;  3A5N C;  1VQ5 N;  1ATS A;  1QVG M;  1EWR A;  1NM1 A;  1S9E A;  4BC4 A;  3OJU A;  4CEQ A;  4B3T K;  1RT1 A;  1EXQ A;  1VSJ A;  4AQY K;  3QEP A;  4WQ4 A;  4JRQ A;  2QWQ A;  2NNW A;  2QXL A;  4PHT X;  3CCE N;  1RTH A;  3E9L A;  3WXJ A;  4N47 A;  3LDN A;  4EP5 A;  3VPZ A;  4IOA L;  4NCG A;  4LF9 K;  3D2F A;  4C23 A;  1KFS A;  3HP9 A;  3EE8 A;  3NH1 A;  4Z4E A;  4PKI A;  2VGM A;  1U47 A;  3HJF A;  2DFH A;  4LD0 A;  4Y0W A;  1JLB A;  3IG1 A;  3VEZ A;  3Q7C A;  1QQM A;  2HHW A;  1OKJ A;  2HF4 A;  5HOO A;  1NK9 A;  2Q1N A;  2YJF A;  1JXE A;  3HO1 A;  3IUC A;  3PV8 A;  4ELV A;  4FWS A;  3O08 A;  3QO9 A;  1X1P A;  1T7P A;  1RTD A;  3VGK A;  1VAZ A;  1TUU A;  2F9T A;  5C10 A;  3G10 A;  2Q97 A;  3HI0 A;  1QZ5 A;  3O1W A;  3AY9 A;  4KH6 A;  2O8D B;  4O8K A;  3NH2 A;  3F5T A;  4DR7 K;  1T8E A;  5KRS A;  5F2R A;  2FSJ A;  4PKG A;  3CCR N;  4OKE A;  4FLT A;  2KQ2 A;  1NKC A;  5C24 A;  3RWU A;  1VQ6 N;  4C8K A;  3AA4 A;  2HNZ A;  3MN7 A;  2E2P A;  1TAQ A;  3K5L A;  3JAM O;  2UXB K;  2XY8 A;  1KAX A;  1HYZ A;  1WBB A;  3MN6 A;  4FWO A;  2V51 B;  2JWK A;  1LV5 A;  4GV6 A;  4JI3 K;  3EE9 A;  1IV0 A;  1HLU A;  3BY5 A;  1YJW N;  4CVN E;  3O3H A;  1RTJ A;  3OS0 A;  3MXM A;  2KKZ A;  3NGY A;  3CM6 A;  1YXQ A;  1GOB A;  1A5X A;  4B3M K;  3KKS A;  2FBV A;  2KFZ A;  1Y97 A;  4AH9 A;  4Z94 A;  1HR0 K;  4BRI A;  2IDO A;  3U6F A;  3N4Q A;  1VQ7 N;  3E9P A;  4BR9 A;  3J8A A;  3CFR A;  5JS1 A;  4CK1 A;  3KLF A;  4JEP A;  3VQ7 A;  4CEE A;  4CZG A;  5E84 A;  2HND A;  4WCE L;  3R8E A;  3NDK A;  5AQL A;  4JI6 K;  3VEW A;  4KB1 A;  4OVL A;  4IFE A;  3DXK B;  5DMR A;  2V7Y A;  3CCQ N;  1RBU A;  1S22 A;  2XRI A;  3QET A;  1HUX A;  1ATR A;  3M3Z A;  4FJK A;  3VF2 A;  5AZJ A;  1WSI A;  1CLQ A;  3TSU A;  1CZ9 A;  3AA3 A;  4MO4 A;  1SZ2 A;  1NOZ A;  3IAY A;  3ITH A;  4IG0 A;  1TYQ A;  3JSM A;  4RCH A;  2O8B A;  4FWM A;  3Q7B A;  3N4P A;  3V9Z A;  1SQK A;  2O4G A;  1HPM A;  4IJN A;  2E2O A;  4E89 A;  4FOI A;  4PL7 A;  4XH4 A;  4K25 A;  5CY4 A;  1GLA G;  3DOK A;  4BR0 A;  3TAB A;  2E6L A;  3I8D A;  4K42 A;  3UE5 A;  3AVB A;  5HP1 A;  1K8K B;  1KSP A;  2UU9 K;  4M63 C;  4JV5 K;  1U45 A;  4C8L A;  3OYI A;  1BQM A;  1GLC G;  3SYZ A;  4FSV A;  5AQP A;  4K8Z A;  4FWN A;  4YOX A;  1JLA A;  3C0B A;  2P9N B;  3HOT A;  3V81 A;  4Z4I A;  5GAG P;  1IH7 A;  1NK4 A;  2CH5 A;  2ZGZ A;  2P9N A;  4DR3 K;  1QQC A;  5AQG A;  4FK2 A;  4DV4 K;  1HYS A;  4FM1 A;  4JKD A;  1X9S A;  3D6R A;  3ZT0 A;  3SMP A;  5J2Q A;  3AVJ A;  3QIP A;  5AQX A;  4H5N A;  4CJU A;  2JGU A;  2HW3 A;  3O9T A;  4KHS A;  3VOV A;  2O8C B;  3I0R A;  3VEV A;  1KC8 O;  3B8A X;  3DLR A;  4QOZ B;  4RTF D;  1YJ9 N;  4JKG B;  3TAG A;  3CJA A;  1T44 A;  3SZ2 A;  1GLD G;  5FPM A;  2DFF A;  2P9K A;  5I42 A;  4CBX A;  2IVP A;  4DLE A;  3ZSZ A;  1T03 A;  2P9K B;  4B9N A;  4H0X B;  5LMN K;  3WQU A;  3CPE A;  4CBU A;  4M3Z A;  4TSX A;  4X65 K;  5J2M A;  3S9H A;  3AO4 A;  4WFN L;  3HOS A;  4NCB A;  5M1N A;  4CJ4 A;  1JKH A;  3PIP L;  2PZS A;  3MWP A;  4BRL A;  3R6M A;  1KRP A;  3MK6 A;  3KLI A;  3SK3 A;  4NLC A;  4AHU A;  1NNE A;  1WLJ A;  4OJR A;  3AGK A;  4Y1D A;  2KHO A;  4DTN A;  3NCI A;  1YHQ N;  1J6Z A;  2G8H A;  3DJC A;  4MDB A;  3OYF A;  3V4I A;  2O4I A;  1EP4 A;  4JD2 B;  3VQC A;  4JKB A;  3D45 A;  4RWT A;  4JI0 K;  2D0C A;  3O80 A;  4IJA A;  5EU7 A;  4E1J A;  3ZT4 A;  3TI0 A;  4NLB A;  3SBT A;  2DFE A;  4IEI A;  4ZTF A;  2QWL A;  4CHY A;  1NMD A;  1L5U A;  4AHS A;  1HNV A;  3QIN A;  2KLA A;  4OPA A;  4JAX A;  2OZM A;  2YX6 A;  3ZEU A;  4LF4 K;  1C0F A;  1JL1 A;  1X3M A;  3PY8 A;  1RBR A;  3QBX A;  1NG9 A;  2X6N A;  1GLL O;  3VET A;  2I7P A;  2OPQ A;  3PLA A;  1U6Z A;  1N34 K;  2ZGY A;  1FK9 A;  3CQY A;  3M1F A;  4DMN A;  4FM0 A;  1N6Q A;  1XNQ K;  3TAR A;  1NJY A;  3CFO A;  3DM2 A;  1EQY A;  3O3G A;  3SJH A;  1YUW A;  3EEQ A;  1U4B A;  4DTJ A;  1KAZ A;  1HNI A;  2YNI A;  5GIO A;  4J2A A;  4CES A;  4BRQ A;  4BE0 A;  5AQT A;  4CF0 A;  4DV3 K;  2O8D A;  5IT9 O;  5KTQ A;  4H4M A;  5HRS A;  2E6M A;  1LWF A;  2ZE2 A;  3H3N O;  1C0G A;  3HVR A;  1NK0 A;  5AQM A;  3HM9 A;  1VQM N;  1RDU A;  3AVL A;  3M8P A;  3VEO A;  1SAZ A;  5F1X A;  1NWK A;  4NO7 A;  1ZC6 A;  4WFA L;  4AIL C;  3THX A;  3QLH A;  3HXM A;  4BG8 A;  1S1X A;  3MEG A;  4C1N K;  2P1J A;  4O0J A;  3NGI A;  2ATQ A;  4DV5 K;  3OTO K;  5D3G A;  4WQ4 C;  1ASW A;  4CZL A;  3VES A;  1RT2 A;  3HZ6 A;  3OJS A;  1RFQ A;  4FL9 A;  2FBX A;  2Z1I A;  4CJW A;  2O8F B;  3OVN A;  4NXN K;  4GNI A;  1GLJ O;  4M3X A;  3C95 A;  3CPW M;  1KLN A;  2FXU A;  3SNN A;  2YNH A;  2J4R A;  1X9J A;  2XY7 A;  2GX9 A;  4BR7 A;  5JLF A;  4BDP A;  3A5L C;  1WSJ A;  4FPA A;  4YOU A;  4CD1 A;  4KI6 A;  2O8E A;  3KWG A;  3TAE A;  3PSI A;  1GLB G;  1JLC A;  3CYM A;  1T3V A;  3RSE B;  1K9M O;  1HX1 A;  3V6D A;  1Q7Y O;  2P5O A;  4Y1C A;  3C6T A;  3RSE A;  3CMA N;  1JLG A;  1BU6 O;  4CEC A;  4R5P A;  5E26 A;  4F2R A;  4FK4 A;  3J7Y P;  3KTQ A;  4FXD A;  5GAD P;  3VQ8 A;  4BRK A;  4RW4 A;  1GOC A;  4BDZ A;  1N8R O;  3PUF A;  4B1V A;  1IKY A;  2HOE A;  4CZE A;  4YOW A;  4CJQ A;  1DTT A;  4CEZ A;  1TYQ B;  2GBZ A;  3O9U A;  4CZI A;  1B9F A;  3LAK A;  4H03 B;  2Z1H A;  3DYA A;  3KHY A;  4ILJ A;  3TAQ A;  1BQN A;  1LW2 A;  4K8X A;  1RCH A;  2BTF A;  1QVF M;  2D0O A;  4H0Y B;  3ID6 A;  5AQS A;  1G99 A;  1SKW A;  2XY6 A;  3F9M A;  2P5G A;  3SLC A;  4KTW A;  4DU4 A;  4FYD A;  1U49 A;  2KZZ A;  1FW6 A;  3WNH A;  4K41 A;  3CCJ N;  3OYJ A;  1LAW A;  4M3U A;  3L2V A;  5J2N A;  3WXK A;  4DFM A;  3CET A;  1N36 K;  2NRV A;  3OA9 A;  4WE1 A;  1S1U A;  2RE2 A;  1WN7 A;  3VQB A;  1BL3 A;  1VQK N;  3W3D A;  3VMF B;  1F21 A;  1DLO A;  4Z0U A;  3AV9 A;  4RG8 A;  3CCV N;  3KK1 A;  4H5T A;  3VQQ A;  4CJK A;  4IOX A;  1Q8I A;  3K5N A;  1NJZ A;  2B5J A;  3L2R A;  1C0M A;  4DG1 A;  3KLE A;  1VQ8 N;  4UQG A;  4CIE A;  2YNF A;  4MO5 A;  4BRM A;  3RTV A;  5KGX A;  5CYQ A;  4JK7 A;  1NJI O;  4JKH A;  4N56 A;  5LMU K;  2GEM A;  2P9I A;  3ZX3 A;  2Q2R A;  4ISE A;  3BZK A;  3VEN A;  1JJ2 M;  2ASO A;  3LDO A;  1MWK A;  5AQZ A;  3E9O A;  3F73 A;  3SPZ A;  1VSI A;  3L0Q A;  3H3O B;  3I55 N;  2G8F A;  3K0S A;  3PIO L;  3RMB A;  3KZB A;  3ZYY X;  4O0I A;  4LF7 K;  3IDH A;  3UIQ A;  3AVM A;  3LDS A;  1SL2 A;  2HHH K;  1TL3 A;  1S1W A;  3EL2 A;  4YDU A;  1ESV A;  3JYT A;  3QNN A;  3FLC O;  3ALY A;  2A42 A;  3H1V X;  4CZK A;  1H1V A;  4M41 A;  3VQ9 A;  1VSF A;  4JD2 A;  3MN9 A;  3ZSQ A;  3RVC A;  1KXP A;  4OLB A;  2HBK A;  4A57 A;  1CXQ A;  2NLX A;  3OYA A;  4CHQ A;  2Y1J A;  1BWF O;  1RGI A;  2NRW A;  4ICL A;  1QZ6 A;  4B8A B;  5KGW A;  4LFC K;  2PFU A;  4KAZ A;  3GG4 A;  1W2B M;  3FZK A;  4FW1 A;  3L6Q A;  3VGM A;  3HK2 A;  3ASM A;  4GVE A;  2OCE A;  3FZM A;  5FPE A;  3T1H K;  1NOY A;  3NF7 A;  4CER A;  3CER A;  3SQ0 A;  3NVK A;  4X64 K;  1JLQ A;  3GE1 A;  3HM8 A;  4CF1 A;  5GIP A;  4M3R A;  2QWM A;  3I8B A;  4CK2 A;  4HVJ A;  2F96 A;  2IVN A;  2P9L B;  4F9O A;  3KIO A;  3M8Q A;  3PO5 A;  2OPS A;  2HNY A;  1L3U A;  2KW4 A;  1VQ9 N;  3RMD A;  2QKB A;  4HHT A;  3BGR A;  4GKK K;  3VEX A;  1QS4 A;  3HT3 A;  3B6P A;  2D0B A;  3V9X A;  1IBL K;  1WB9 A;  1OH8 A;  4C8O A;  4L3Q A;  2UUB K;  1S1T A;  4DQQ A;  4IZ9 A;  4KI4 A;  3TSQ A;  2QW9 A;  4BWJ A;  4ELT A;  4B9L A;  2XHB A;  4JI2 K;  2HMI A;  4XH5 A;  1WBD A;  2W6L A;  3IKM A;  3VA3 A;  3CJB A;  4Z4F A;  5AFU A;  3V9S A;  1JCE A;  4FJ5 A;  4DQI A;  2FC0 A;  5LJW A;  4CFB A;  4BE2 A;  4BRE A;  4FWQ A;  1I39 A;  2E20 A;  2CGK A;  1RDA A;  3EO3 A;  1L3S A;  4BVP A;  3ZET A;  1TKZ A;  3UB5 A;  4FJM A;  4PQU A;  4CJS A;  4BC2 A;  3CJC A;  2ZQB A;  1HKB A;  2V7Z A;  3CIP A;  4IFY A;  4H5V A;  3OYB A;  4H0V B;  4JI1 K;  2BDP A;  4DV1 K;  2NZT A;  4H0P A;  3MXI A;  2E2N A;  3VGL A;  2F8T A;  3HST B;  2VYP A;  3L2W A;  3HRG A;  4CFC A;  2YI1 A;  3AO3 A;  3O6W A;  3THW B;  3SUO A;  2O8F A;  4JS5 A;  1WSE A;  4O55 A;  1RT5 A;  1RDD A;  5CHI A;  1RTI A;  1G15 A;  4KH4 A;  2WFB A;  1OH5 A;  1NK7 A;  4CF9 A;  4CHN A;  5BR8 K;  4B9T A;  4E3S A;  2BUP A;  3MWT A;  2F9W A;  4CGI A;  5JS2 A;  3OYG A;  3MED A;  4BQZ A;  3BUZ B;  4AHV A;  2QI2 A;  4B1Y B;  3P38 A;  3ENH A;  3VA0 A;  3PO4 A;  5JMV A;  3OS2 A;  3UKR B;  3TAP A;  4JKF A;  3SV3 A;  4DSE A;  3MAQ A;  2FLO A;  4AM6 A;  1Y64 A;  2FF6 A;  2VG5 A;  4B9V A;  4V19 S;  4F3O A;  4BDY A;  1YVN A;  3BF1 A;  3LAL A;  4CCH A;  4FZX C;  3VF4 A;  2HHX A;  3UKU A;  3ULE A;  4H5R A;  4LF6 K;  3T69 A;  1ZBL A;  1WAJ A;  4LF8 K;  4PWD A;  4IDH A;  1EWQ A;  3CQ8 A;  1E4G T;  3DWL A;  4FW2 A;  3K58 A;  1NGJ A;  4OLA A;  4CJT A;  4CZF A;  5EY4 A;  1V4S A;  3IS9 A;  3OW2 M;  3HTV A;  3SQ1 A;  3VER A;  1JCF A;  1Q81 O;  2E1Z A;  5BRE A;  1HJR A;  4G9Z A;  2I5J A;  3NF8 A;  3VQ4 A;  5AZI B;  2E4L A;  5KQD A;  4OPK A;  4BRP A;  5BRF A; 
#chains in the Genus database with same CATH homology
 3OBY A;  2HF3 A;  4B1W B;  3J7Z O;  4IO9 L;  3GOI A;  1U2V A;  3TPQ A;  3CQY A;  3QBW A;  1NGD A;  1WOQ A;  2HBJ A;  2HBL A;  3H46 O;  3M1F A;  5EX5 A;  3HBT A;  2E88 A;  2NRH A;  3ZX0 A;  5KPT A;  2A3Z A;  2Q0R A;  5M1O A;  3IMX A;  2ASM A;  4IOC L;  3CI5 A;  1EQY A;  4BR2 A;  4FWP A;  3SJH A;  2WC9 A;  1YI2 N;  1YUW A;  3EKU A;  4H5W A;  4A62 A;  5AQR A;  3FZF A;  4ISF A;  1KAZ A;  1WUA A;  4BRG A;  5KPR A;  4DKW A;  1EO1 A;  3VTI A;  1RDW X;  5GIO A;  1S3X A;  3LDP A;  4PKH A;  2PBD A;  4EAH D;  4M7X A;  4BRQ A;  3ID8 A;  2Q0U A;  4ISG A;  4GV3 A;  5AQT A;  4JK8 A;  1GLE G;  2NRT A;  2RHK A;  4K43 A;  3C65 A;  4XEI A;  4AF1 A;  3ATV A;  2P9L A;  1IJJ A;  2P9I B;  1NGE A;  3UKU B;  3WXI A;  3O1B A;  3H3N O;  1C0G A;  3LDQ A;  4JKA A;  2P9P A;  5AQM A;  2CGL A;  1VQM N;  1RDU A;  1VQP N;  3VEO A;  1DGK N;  1IG8 A;  2W40 A;  4FWR A;  3G25 A;  1SAZ A;  3JXU A;  1NWK A;  4NO7 A;  5F1X A;  3AGR A;  5AQI A;  1ZC6 A;  1VQL N;  3F2K A;  1Z6R A;  4AM7 A;  4WFA L;  3IFR A;  3CXC M;  3AAQ A;  3K9K A;  1LOT B;  3CCL N;  4A61 A;  4BC3 A;  2PAV A;  2VWB A;  4MLH A;  1BUP A;  4BG8 A;  3MCA B;  3M6G A;  2A6A A;  4C1N K;  4BRH A;  1BDG A;  4FVU A;  3OBW A;  1XUP O;  4A2B A;  3CC7 N;  4FWL A;  4WQ4 C;  5AZI A;  4CZL A;  3VES A;  4CZH A;  3CJ7 A;  3BP8 A;  3HZ6 A;  4HTL A;  3GDQ A;  3WEE B;  1RFQ A;  4FL9 A;  2W41 A;  4BC5 A;  3KVG A;  5AQY A;  2OTL N;  2HBM A;  2QEX N;  3O8M A;  1NGG A;  3ENB A;  4GNI A;  1GLJ O;  4YOV A;  4EFH A;  3CPW M;  4DCH A;  1BO5 O;  2FXU A;  4ILG B;  3MCP A;  4JK9 A;  4J8F A;  4DQ8 A;  2J4R A;  1X9J A;  3QIC A;  5C15 A;  4A2A A;  3GBT A;  2ZJR L;  4WYB A;  1GLF O;  2GX9 A;  4B9Q A;  4BR7 A;  3BF3 A;  5JLF A;  5I9E B;  3A5L C;  2YHX A;  2QWO A;  2YJE A;  1X3N A;  1QQO A;  4FPA A;  1YIJ N;  3ZX2 A;  5H1S Q;  3EKS A;  3WXL A;  4YOU A;  4CD1 A;  5AQF A;  3VEY A;  4YOY A;  1YAG A;  3KWG A;  3P39 A;  4IEE A;  1TUY A;  1KQS M;  5AQU A;  1GLB G;  2A40 A;  1NGF A;  4CJ7 A;  5BR9 A;  1Q18 A;  3DAW A;  4B1Z A;  4BQL A;  1T3V A;  3RSE B;  1K9M O;  4IXC A;  1DKG D;  3CME N;  1HX1 A;  5M1Q A;  3HSC A;  1Q7Y O;  2YHY A;  1BA1 A;  5AQN A;  2QM1 A;  3RSE A;  3CMA N;  2GEL A;  1BU6 O;  5C2F A;  1Q82 O;  4CI6 A;  4JKG A;  5E26 A;  5C2D A;  3O4W A;  3SAG A;  5GAD P;  4BRK A;  3G71 N;  2WBN A;  2WUS A;  4BR4 A;  2IIR A;  1N8R O;  4B1V A;  3KWI A;  4YOW A;  2CGJ A;  2HOE A;  4CZE A;  2D4W A;  1NLV A;  2ZF5 O;  3TU5 A;  3VF6 A;  3W0L A;  2F7T A;  3O9Q A;  3U8X A;  1TYQ B;  4NB4 A;  4A59 A;  1YJN N;  5KPZ A;  3O9U A;  4CZI A;  4A5A A;  3A5N C;  1VQ5 N;  4R79 A;  1ATS A;  4H03 B;  4JKE A;  1QVG M;  5JVG L;  1NM1 A;  1ZXO A;  4KH5 A;  3KHY A;  4ILJ A;  4IO8 A;  4BC4 A;  5BRD A;  1VQ4 N;  1YF5 L;  1BA0 A;  2AA4 A;  2BTF A;  1XC3 A;  1QVF M;  3D2E A;  4WQ4 A;  5TKW A;  2D0O A;  3TTF A;  2QWQ A;  2NNW A;  2QXL A;  3ID6 A;  4H0Y B;  5AQS A;  1V4T A;  3SMS A;  4PHT X;  1G99 A;  3CCE N;  3E9L A;  3WXJ A;  3H45 C;  3SAH A;  3K9J A;  3CHW A;  3LDN A;  4O5F A;  3VPZ A;  3F9M A;  3U9D A;  3SLC A;  4IOA L;  5LJV A;  3D2F A;  4C23 A;  5AQJ A;  3EE8 A;  4K41 A;  3I56 N;  3CCJ N;  1YIT N;  4BGA A;  3LM9 A;  4PKI A;  2VGM A;  1T6D A;  4MDA A;  3WXK A;  2FSN A;  1KAY A;  3CET A;  4Y0W A;  2NRV A;  3E1Y A;  3VEZ A;  3ZET B;  3OA9 A;  3Q7C A;  2RE2 A;  3O5B A;  1MA9 B;  3G4S N;  1QQM A;  1BG3 A;  1VQK N;  3W3D A;  1OKJ A;  2HMP A;  2VGN A;  3VMF B;  2HF4 A;  5HOO A;  4ILH A;  3AAR A;  3CCV N;  2Q1N A;  3A0I X;  1S72 N;  2YJF A;  4FOE A;  4H5T A;  3MX2 A;  4EHU A;  4WF9 L;  2UYT A;  3IUC A;  4IOX A;  4PL8 A;  4FWS A;  4C1N I;  2P9S A;  3O08 A;  5FPN A;  1K73 O;  1VQ8 N;  1VQN N;  5BPL A;  4BVO A;  2P9S B;  3CCS N;  4JHD A;  1VAZ A;  1TUU A;  3E66 A;  3VGK A;  2F9T A;  5C10 A;  4MO5 A;  4BRM A;  2Q97 A;  5FPD A;  2FSK A;  4JK7 A;  3HI0 A;  5F0X A;  1NJI O;  1QZ5 A;  3O1W A;  4JHD B;  4BG9 A;  3AY9 A;  4KH6 A;  3R9P A;  4JKH A;  1M90 O;  3AAP A;  4O8K A;  3F5T A;  2GEM A;  2P9I A;  3ZX3 A;  2Q2R A;  5F2R A;  4ISE A;  2BH1 A;  2IVO A;  2FSJ A;  4HWI A;  4QS9 A;  4PKG A;  3CCR N;  2Q36 A;  4DHY A;  3FZH A;  3VEN A;  3ATU A;  4CBW A;  2GUP A;  1JJ2 M;  3A5O C;  3QFP A;  2ASO A;  3LDO A;  2NRR A;  3EZW A;  1MWK A;  2D1K A;  3E9O A;  5AQZ A;  1M1K O;  1VQ6 N;  3CCU N;  3L0Q A;  5AQO A;  1E4F T;  3H1Q A;  3H3O B;  3I55 N;  3D7E O;  3MN7 A;  3PIO L;  2E2P A;  3KZB A;  3QB0 A;  3MDQ A;  3ZYY X;  1T6C A;  2D0P A;  1CZA N;  4B1X B;  1KAX A;  3IDH A;  4QS8 A;  3MN6 A;  4FWO A;  2V51 B;  2Q31 A;  2JWK A;  3A8Y A;  4GV6 A;  2QWR A;  3EE9 A;  3ZEU B;  5DM7 L;  3EL2 A;  1HLU A;  1ESV A;  2VCP A;  4YDU A;  5CR4 A;  3FLC O;  5AQV A;  1YJW N;  2A42 A;  2KKZ A;  3H1V X;  5TKY A;  2V52 B;  3MN5 A;  4CZK A;  1H1V A;  4BRF A;  5M1K A;  1YXQ A;  5C0Y A;  4JD2 A;  3NMU A;  3MN9 A;  5M1P A;  3RVC A;  1KXP A;  4Z94 A;  4JKC A;  2HBK A;  1HKG A;  4A57 A;  4BRI A;  2NLX A;  1Q86 O;  1VQ7 N;  3N4Q A;  3E9P A;  1HKC A;  5EVZ A;  4BR9 A;  3J8A A;  1BWF O;  1RGI A;  1QHA A;  1SS6 A;  2NRW A;  1QZ6 A;  2PFU A;  3GG4 A;  4H0T B;  4JEP A;  4JN4 A;  3C6A A;  5BPM A;  1W2B M;  3L4Q A;  3FZK A;  5BN9 A;  4CZG A;  5E84 A;  3GL1 A;  4WCE L;  5ELZ A;  3R8E A;  2QWP A;  5AQL A;  3L6Q A;  3VGM A;  4BY9 C;  3VEW A;  4QS7 A;  3KK7 A;  4GVE A;  3P31 A;  3FZM A;  1O13 A;  5FPE A;  2GWK A;  3FR0 A;  2CH6 A;  2OTJ N;  3H6E A;  4CZJ A;  4IFE A;  2OAN A;  3CER A;  3DXK B;  4BR5 A;  3NVK A;  4IWV A;  2V7Y A;  3OHR A;  3CCQ N;  2AP1 A;  3GE1 A;  3HM8 A;  2EWS A;  1NBW A;  3M5R A;  5GIP A;  5BN8 A;  1S22 A;  3QFU A;  2QWM A;  2HST A;  1HUX A;  1ATR A;  3I8B A;  3C6H A;  3FFK B;  3M3Z A;  4FO0 A;  2ITM A;  2ZJQ L;  2IVN A;  2P9L B;  4F9O A;  3VF2 A;  3QDK A;  5AZJ A;  1VQ9 N;  3WXM B;  3JS6 A;  5MLC Q;  2P9P B;  4M7Y A;  3TSU A;  3VEX A;  4MO4 A;  2YCH A;  4BRD A;  1SZ2 A;  2H3G X;  4I6M A;  3ENO A;  1K8A O;  1TYQ A;  4OPH A;  4RCH A;  1R59 O;  5C12 A;  4FWM A;  3Q7B A;  3N4P A;  4I6M B;  2QTD A;  3DXM A;  1SQK A;  4L3Q A;  5AFU H;  1HPM A;  4IJN A;  2E2O A;  3TTD A;  2QWN A;  5AQH A;  4FOI A;  4PL7 A;  3A5M C;  4IZ9 A;  1GLA G;  3DXM B;  1XQS C;  1P90 A;  1BOT O;  2QW9 A;  4K25 A;  4XH4 A;  3R1X A;  2E2Q A;  2I7N A;  3TSQ A;  3UKR A;  4BR0 A;  4K42 A;  2A41 A;  3WQT A;  4XH5 A;  3UE5 A;  5JVH L;  3I33 A;  3IKM A;  1VQO N;  1K8K B;  3BEX A;  3CJB A;  5KQ8 A;  5AFU A;  4M63 C;  4MLE A;  1JCE A;  3WEE A;  2ZWH A;  3D2F B;  5HL7 L;  4BRC A;  5LJW A;  2JWL A;  3VTH A;  1GLC G;  4EIA A;  4BRE A;  4FWQ A;  4FSV A;  5AQP A;  5GAE P;  5BPN A;  3QML A;  5AQK A;  3SAF A;  2E20 A;  2CGK A;  3CD6 N;  3EO3 A;  1MDU B;  4FWN A;  3ULE B;  4YOX A;  3C0B A;  2P9N B;  3CJ9 A;  4BVP A;  3HOT A;  3ZET A;  3UB5 A;  5GAG P;  5DM6 L;  5GIN A;  4BRO A;  3FGU A;  2CH5 A;  2ZGZ A;  3CJ1 A;  5ADX A;  5LY3 A;  2P9N A;  4BGB A;  5AQG A;  4BC2 A;  4FPB A;  1P8Z A;  4GV9 A;  1ILY A;  3CJC A;  1MWM A;  1D4X A;  1HKB A;  2V7Z A;  3CIP A;  2NRZ A;  4H5V A;  4H0V B;  4JKD A;  4CZM A;  5JIC A;  2NZT A;  3D6R A;  4B1U B;  4H0P A;  1W97 L;  2E2N A;  3SMP A;  5M1F A;  2E1Y A;  4YOR A;  3WT0 A;  2YHW A;  3O9S A;  3VGL A;  2DPN A;  2VYP A;  3DXK A;  5EOY A;  5AQX A;  3HRG A;  4FWK A;  4H5N A;  2YI1 A;  3O6W A;  3O9T A;  3VOV A;  1QQN A;  4LC9 B;  3VEV A;  4JNE A;  1KC8 O;  4DB3 A;  5CHI A;  3B8A X;  4KH4 A;  4WQ5 C;  3CC4 N;  1HJO A;  5AR0 A;  2WFB A;  4O8U A;  5AZJ B;  4RTF D;  1NGA A;  4BRA A;  3DLL L;  1YJ9 N;  4JKG B;  4U67 L;  3CJA A;  1T44 A;  3CQX A;  2GWJ A;  2NRX A;  3MMV A;  1NGC A;  1GLD G;  5FPM A;  2P9K A;  2BUP A;  4BRN A;  4CBX A;  3MWT A;  2F9W A;  2IVP A;  4GY2 B;  2FF3 B;  3TTC A;  4BQZ A;  2P9K B;  3BUZ B;  4H0X B;  2QI2 A;  3WUH A;  1KD1 O;  3WQU A;  4CD3 A;  2QA4 N;  3CPE A;  3P38 A;  4B1Y B;  4CBU A;  3CC2 N;  3ENH A;  3C7N B;  3U9Z A;  2P9U A;  5JMV A;  4WFN L;  3HOS A;  3LM2 A;  3UKR B;  2ZJP L;  3FZL A;  4JKF A;  5M1N A;  1NGI A;  5GAH P;  2FLO A;  5AQW A;  4AM6 A;  3PIP L;  3C7N A;  3MWP A;  1DT9 A;  2P9U B;  1Y64 A;  3R6M A;  2FF6 A;  4BRL A;  3CCM N;  1K8K A;  1ATN A;  3MK6 A;  5JLH A;  4YOT A;  3SK3 A;  4NLC A;  4WFB L;  3S41 A;  5B8H A;  1LCU A;  4XH1 A;  3FE1 A;  3AGK A;  4A5B A;  3MX5 A;  2KHO A;  1YVN A;  3BF1 A;  3TSP A;  1NGH A;  3VF4 A;  1YHQ N;  1J6Z A;  3DJC A;  4MDB A;  3P4I A;  3UKU A;  3ULE A;  3SBG A;  4H5R A;  4KBO A;  3T69 A;  4UY8 O;  1NGB A;  4JD2 B;  3T7Z A;  3O9R A;  4JKB A;  4RWT A;  1OVY A;  3R3L A;  4IDH A;  4WQ5 A;  3LL3 A;  1E4G T;  3DWL A;  3O80 A;  4IJA A;  4YDU C;  5BRH A;  4E1J A;  5ADX H;  1NGJ A;  4OO1 J;  4NLB A;  4CZF A;  3SBT A;  5EY4 A;  1V4S A;  3NVM A;  4IEI A;  3G6E N;  3OW2 M;  2QWL A;  2GTD A;  3D2E B;  3HTV A;  1NMD A;  3VER A;  2A5X A;  4EHT A;  2KLA A;  4OPA A;  1JCF A;  4JAX A;  2ASP A;  2YX6 A;  3CF5 L;  1Q81 O;  2E1Z A;  5BRE A;  3LDL A;  3ZEU A;  4G9Z A;  5EXW A;  2E8A A;  1C0F A;  5AQQ A;  4U7B A;  5AZI B;  1X3M A;  4H0O A;  1JCG A;  5KQD A;  3QBX A;  3U4L A;  1GLL O;  3VET A;  2I7P A;  3PLA A;  1DEJ A;  1U6Z A;  1ZBS A;  3L4I A;  4BRP A;  1U2V B;  1Z05 A;  5CE3 A;  2ZGY A;  3EN9 A;  5BRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...