3VQ7A

Hiv-1 in core domain in complex with 4-(1h-pyrrol-1-yl)aniline
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
145
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 145
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq7A00
5HRSA 3OYJA 4RG8A 3LWMA 2IGIA 1XWLA 3O3HA 5I3UA 4CJKA 1BQNA 1C6VA 2Y1IA 1U48A 4CJSA 3QEPA 2G8KA 3ZT1A 4M3RA 4W5QA 4FJ8A 4ID5A 2R7YA 4FZYA 1ITGA 4RW9A 2A1SA 5T7BA 3HVRA 1RT7A 4CJRA 5J2QA 3AVHA 1HYVA 1WLJA 4LSLA 3OVNA 4CEZA 4M3TA 3KK3A 1ZBLA 3PX4A 4Z4EA 3ISNC 1LWEA 5KRTA 3D0PA 3CFPA 1VSFA 1HQEA 2Z1HA 2XO7A 3HXMA 4CHOA 3I0RA 3O3FA 2VG5A 1RTJA 3B6OA 4KI6A 1C1BA 3ZSOA 1JLCA 4DSEA 3ZT3A 3G0ZA 3AO3A 4LH5A 4DTNA 4I7FA 1WSGA 4Y1DA 4ZHRA 3V9ZA 4FYDA 1CXQA 3OYNA 1N5YA 2D0BA 1ZYQA 3HJFA 3U3YA 2VG6A 4FJIA 3L8BA 3DLRA 1RILA 1S1WA 3U3GA 1KFDA 2ITGA 1U4BA 3PY8A 1T7PA 2B4JA 2HVIA 2YV0X 2FC0A 4E89A 3AVLA 1UWBA 3K57A 4KHUA 4O44A 2HNYA 4KKOA 2RF2A 1NKCA 1C0MA 1QQCA 1NK9A 4CHYA 4H8KA 1KTQA 4CIEA 4KHWA 3SNNA 3PUFA 2JLEA 1WSJA 3ZSYA 2RN2A 4GMJB 5CZ1A 4FLWA 3NH2A 1SV5A 4DU4A 1NK4A 1TVRA 4F3OA 3TR8A 2A1RA 4KHYA 2IOCA 4EP4A 5KRSA 1HMVA 3OJUA 4M3ZA 2BANA 4BWJA 1TK5A 3KJVA 4YNQA 4DFKA 4DFMA 1BI4B 3HVTA 2P5OA 4FJMA 3DLHA 4QOZB 1RT1A 4HVJA 1CLQA 4N5SA 1C0UA 4CGIA 1XC9A 1DTQA 3JYTA 3TARA 1LW0A 4CJ5A 2DTUA 1QSSA 1C1CA 1RBUA 4CHQA 3P5JA 2HNDA 4CGHA 1B9FA 3H08A 1NK7A 1QSLA 4FLXA 4M45A 1IKYA 1HYSA 2X6NA 1IKVA 1KLMA 3NF7A 4DSFA 1VSJA 2DY4A 3NGIA 2X6SA 4KTZA 1XHXA 1NKBA 3QERA 2XY8A 4H4OA 3AVBA 3FFIA 1MU2A 4OGEA 3ZT0A 3LPUA 2Z1JA 1VRTA 2OPPA 1J54A 4M41A 4W5TA 1D9FA 2I5JA 2HHTA 4CERA 3KK1A 1WSEA 4DTUA 4E7JA 4QAGA 1FXXA 3TI0A 3E01A 4C8MA 3WNEA 4IBNA 3L2UA 3CM5A 3NAEA 3TAMA 3SI6A 3NGZA 3MEEA 3T3FA 3CFOA 3BDPA 3SCXA 4CK1A 3LP0A 4CK3A 4OGCA 1G15A 4B08A 3HT3A 1T03A 4FVMA 4CF9A 4FM1A 1TKDA 1UA0A 4OKKA 3OS2A 3LP2A 4Z4FA 3ZSVA 4HUGA 3S3MA 2QK9A 2HW3A 4CJUA 2AJQA 2ZQBA 4Y1CA 1U45A 1VSMA 2FBTA 1L3UA 4KFBA 4RW6A 2D0CA 2KQ2A 2DFEA 1JLBA 3QIOA 5HLFA 3ALYA 4N47A 3OYMA 3KLGA 1L3VA 3IAYA 4NCGA 3AO2A 4J2AA 3NH1A 3SV4A 1BISA 4OLBA 3NDKA 4ICLA 5K14A 2HB5A 1WNSA 4CF8A 1VSKA 3TABA 2G8UA 4WE1A 3PO5A 1TV6A 2YKNA 4FW2A 1QTMA 5J1EA 4DSLA 4FJLA 1VRUA 4CFDA 1I3AA 3RMDA 1KVCA 3OYBA 1TAQA 4CESA 2HHQA 4CFBA 1JLGA 2G8HA 4MFBA 1Q9XA 1S1XA 4C8LA 1A5WA 1RDBA 3LWLA 2XY5A 2IDOA 3MEDA 3QEIA 5SZTA 4YFUA 1C1AA 3T19A 1SL1A 3AVCA 1GOBA 2YNGA 2YNFA 3K5NA 4ZTJA 3M8RA 1X9SA 4CGGA 1S1TA 4O55A 1Z25A 3V81A 4C8NA 1WSIA 1YT3A 3F9KA 4CJFA 3MAQA 3I0SA 4Z4HA 3S3OA 5HRPA 4FLYA 3DLGA 4RW4A 1KRPA 2PYLA 1X9MA 4B9SA 4F2RA 2QKBA 2IC3A 2VWKA 1ZBHA 1BCMA 1KFSA 1HRHA 2GUIA 1YVUA 3V9WA 1XHZA 3NHGA 2YNIA 2HHXA 4B9MA 4CJEA 4DFPA 5KGWA 1FKPA 2OA8A 3KLIA 2Z1GA 3MEGA 3L2QA 4FZXC 4KB1A 4DU1A 1S6QA 4NYNA 4B9TA 1RBTA 4KPYA 4PUOA 1ZBIA 4PWDA 4DQIA 3F73A 4CFCA 4LH4A 3S3NA 3DRRA 4KHNA 3ZSXA 4CF2A 4CEAA 1NOZA 3G10A 3TAEA 1O1WA 1NJZA 3BGRA 3OYHA 1DLOA 4DS4A 3KD5E 4HUFA 4OVLA 4JS5A 1TK0A 3RMAA 2E6LA 3LANA 3AVNA 4DLEA 4FLUA 2P5GA 1LAVA 2EHGA 4E1MA 1L3TA 2P51A 3NFAA 3QINA 4JLHA 1D8YA 3L2RA 2X78A 2KW4A 3EZ5A 3SQ4A 4Z4GA 1K6YA 1X1PA 4Q0BA 4PQUA 4C8KA 1TL1A 3KKRA 3DRSA 4UQGA 3QETA 3KK2A 3OYDA 3ZSWA 5FRMA 1QHTA 1ZBFA 2RPIA 3M8QA 5HBMA 1ASUA 1W9HA 5FROA 4CGJA 4CHNA 1T8EA 2YKMA 2YHBA 5FRNA 1S6PA 4HCCA 2GV9A 1FK9A 4E7KA 4Z0UA 3SUNA 2FBVA 2G8WA 4FJGA 2BGGA 1IKWA 4RW8A 4Z4CA 1TKXA 5J2MA 3KIOA 4DTRA 2XY6A 3ZSRA 1BI4A 1WN7A 1KVAA 1JKHA 4OKEA 4DQQA 4B9LA 4FK4A 4BE1A 2Z1IA 5JS2A 3VQQA 3L2VA 4FLVA 5KGXA 3VQBA 1LWFA 5HRNA 3VA0A 3AO4A 5KI6A 3DLKA 3ITHA 4M3UA 3QLHA 3OYFA 3DLBA 3V1OA 3HO1A 2OPRA 4DMNA 1IG9A 4ELTA 3ZSQA 4ELUA 1LW2A 4NCAA 1B9DA 3VQCA 4CJLA 4O0IA 1I39A 1LV5A 1EKEA 4JRQA 4C8OA 3QNOA 3CFRA 2OZMA 1REVA 3SQ1A 1RCHA 1RT6A 1L3SA 3HYFA 1NKEA 4IDKA 4ELVA 3WNGA 3LAMA 1JL2A 1QS4A 1VSLA 4B9NA 4KI4A 1GOAA 4HHTA 4E0DA 4E19A 3OS1A 3THVA 1NJWA 4CJPA 3KLHA 2E6MA 3M8SA 3OYEA 1HNIA 4DTJA 1RDAA 1WAFA 1RNHA 3DOLA 4JS4A 1S9GA 3IS9A 1SL0A 3RRGA 4Z4IA 1VSEA 1JLFA 3WNFA 4CEOA 2D5RA 4I9LA 3QEWA 3LP3A 5EU7A 4FM0A 1TK8A 4B9VA 4HUEA 1L5UA 4KREA 3NE6A 4DTXA 1RDCA 1QE1A 4F3TA 3C6TA 3TANA 1FKOA 2YHAA 3MXIA 2DFFA 1B92A 3ASMA 3DYAA 4CF1A 5E41A 2E4LA 3HPGA 3SYZA 1RT5A 3K5LA 4IKFA 4KTQA 4JRPA 4FJKA 3AA5X 4FW1A 4J2EA 4RW7A 1RT3A 2XRIA 3QNNA 3DOKA 1TAUA 3ULDA 4FJXA 3V9XA 3HP6A 4DF4A 1NK5A 1TKTA 1KCFA 1ASVA 3TAFA 1LAWA 4FJ5A 1A5VA 4DQSA 3QEVA 2JGUA 5I42A 4FJJA 4MQ3A 2YNHA 3P1GA 3RRHA 4TSXA 3LAKA 4I2PA 2XY7A 3KD1E 3QO9A 4KHSA 4EP5A 1NK0A 3U6FA 1IH7A 3I8DA 4KHQA 3T1AA 4CEQA 2Y1JA 3M8PA 4BE0A 2O4GA 4CGFA 4PY5A 4IFVA 2BE2A 1RBSA 4OJRA 1BGXT 1SL2A 4I9QA 5D3GA 1S9EA 4M3WA 1NK8A 1BL3A 1S1VA 1J9AA 4DFJA 2VG7A 3KLEA 4B3OA 3HPHA 4GW6A 2D0AA 4DWIA 1CZBA 4CHZA 3K58A 3SZ2A 4AHRA 3V1QA 1EX4A 3NGYA 1KLNA 3DRPA 3ZT4A 3EY1A 4ZTFA 1R0AA 1U04A 3PX6A 1RBVA 4E1NA 1TL3A 1UAXA 2GBZA 1NOYA 2OPSA 4CF0A 1J5OA 2HNZA 3UIQA 4G1QA 3VA3A 4DSKA 4KAZA 3LZIA 3SPZA 4O4GA 4M42A 5C42A 3OYLA 4KTWA 3NF6A 3AVAA 3NH0A 3RMBA 3VQ5A 2PZSA 5CY4A 1EP4A 3SPYA 3PX0A 1RT4A 4FLZA 5J2PA 3QEXA 1JXEA 4DSIA 1JLEA 1U49A 3D45A 4K8XA 5HP1A 1WSFA 3TAPA 4KO0A 2XHBA 1SKWA 4M3YA 3AO1A 1EXQA 3V6DA 4KB0A 1HNVA 3V4IA 1S5JA 5J2NA 2ZE2A 4CEDA 4BDYA 1TKZA 3TWHA 2OPQA 3KKSA 3MXJA 1BIUA 3K5OA 4W5OA 3C6UA 3HM9A 2RKIA 3NF8A 3VQAA 4W5NA 1ASWA 2P1JA 1YTAA 4CJQA 3QESA 4NCBA 1DTTA 4O5BA 4CHPA 4OPKA 1EETA 4GVMA 1QSYA 3RR8A 3V9UA 4CCHA 4AILC 1HPZA 3HL8A 1XI1A 4FXDA 3TAGA 2G8IA 3VQPA 4DQRA 4DSJA 1N6QA 3QIPA 4E7HA 3KTQA 3CYMA 3WNHA 2W42A 2NUBA 3L3UA 4OKJA 4AH9A 2BDPA 1A5XA 5CYQA 4FLTA 3CM6A 1JXBA 4DTSA 2G8VA 2OYQA 4HCBA 3AVIA 2Q3SA 1KVBA 3LALA 2WONA 3HP9A 3VQ6A 1D5AA 4IG0A 4CGDA 4HTUA 3ZCMA 4CJWA 3V9SA 4AHTA 3A2FA 1RTIA 3AA4A 3TAQA 4DU3A 5DK5A 1NK6A 1VSHA 4DTMA 4LD0A 4OLAA 4BWMA 1SKRA 2KFZA 4M3XA 1CXUA 3P83D 1Z26A 2PYJA 3AVKA 4AHCA 3HK2A 5DMRA 1RTHA 2B5JA 3DI6A 2HHSA 4W5RA 5SWMA 1RDDA 1RT2A 4N56A 3AV9A 4AHVA 3B6PA 3VQEA 3LZJA 4CK2A 4N76A 2HHWA 2KZZA 4CIFA 4Q5VA 2F96A 4IG3A 3S9HA 4F4KA 3RR7A 1WSHA 1RBRA 3NF9A 3VN5A 5CZ2A 4CEEA 4FJ9A 3DM2A 3O4NA 3VQ8A 1HQUA 3AVMA 1T05A 2FBYA 3OYIA 1BQMA 3VQ9A 3O3GA 4FM2A 2G8FA 2IS3A 3RMCA 4I2QA 4LY7A 2HHUA 4FJHA 3OYCA 1KSPA 2IAJA 4QCLA 3IRXA 1BIZA 1Q8IA 1U47A 1NJYA 4L8RB 2EX3A 3LP1A 4OPJA 2KZMA 4LSNA 4B8CA 4DG1A 3IG1A 3SV3A 4DS5A 1JL1A 4EZ6A 3AVFA 4K8ZA 1VSIA 4E3SA 4F2SA 4BACA 4CECA 4F8RA 2HVHA 4R5PA 4DF8A 3NCIA 4CJVA 3OYKA 2DFHA 3RTVA 4FCYA 3RWUA 4CJ3A 1IKXA 3SJJA 4BDPA 1W0HA 4CIGA 3VQ4A 4FZZA 3PV8A 2QKKA 3SQ0A 4N41A 4CJTA 3AVJA 5KTQA 3AA3A 1J53A 1LWCA 2ETJA 4DTOA 3L3VA 3HSTB 4AHSA 3VQDA 1C0TA 2O4IA 4H4MA 3SQ2A 1HJRA 4ID1A 1CZ9A 3CG7A 4IFYA 5HRRA 4XIUA 3OY9A 3MECA 1Q9YA 4CEBA 2HHVA 3K2PA 3DMJA 4CFAA 3OYAA 3EYZA 1JLQA 4CEFA 2KTQA 2ZD1A 2LSNA 2F8TA 3MXMA 4B9UA 1YTUA 1ZBUA 1GOCA 4CJ4A 5FDLA 1IO2A 1BHLA 3SUQA 4DLGA 3ZSZA 5CYMA 1VSDA 3OYGA 2ATQA 2B6AA 3AA2A 4KV8A 1D9DA 4KRFA 1JLAA 3NBPA 4FK0A 4DQPA 3LPTA 3CQ8A 2HMIA 3JSMA 4J2DA 3L2WA 1HYZA 2F8SA 1RTDA 5C24A 4E7LA 4AHUA 3C95A 3OS0A 4CE9A 4BDZA 1VK0A 5C25A 4FJNA 3PO4A 3SUPA 4NYFA 1X9WA 3V1RA 2X74A 3K5MA 4B8AB 4DTPA 3O4QA 3LDSA 3DLEA 5JS1A 1BCOA 1F21A 4PA1A 2PY5A 1S1UA 2OZSA 3HPOA 4E7IA 1NJXA 2KFNA 4J2BA 3AVGA 3K59A 3AO5A 3OJSA 2VWJA 3KLFA 1SKSA 2QXFA 4EZ9A 4BE2A 4FK2A 1TGOA 1UA1A 2WOMA 3C94A 3SUOA 5HROA 4FJ7A 3VQ7A 1Y97A 1UOCA 1SUQA 1WAJA 4O0JA 3ZT2A 2FBXA
chains in the Genus database with same CATH superfamily
5ADXH 4RG8A 3LWMA 5BPNA 3MK6A 5MLCQ 1BQNA 4M63C 4CJSA 3OA9A 3QEPA 2G8KA 3C0BA 4FJ8A 4ID5A 4FZYA 3HVRA 2HBJA 4CJRA 4QS9A 3AVHA 4CEZA 4YOYA 1XMOK 4LF5K 2E20A 4M3TA 3KK3A 4BRAA 1OKJA 1VSFA 2J4RA 3I0RA 3O3FA 4EAHD 3B6OA 4B1UB 4DSEA 4I7FA 5EXWA 4ZHRA 4BRGA 4FYDA 1CXQA 2P9IB 3U3YA 2VG6A 3J80O 4FJIA 2P9SA 1S1WA 2ITGA 1T7PA 2YV0X 3K57A 3TU5A 3AVLA 3FZLA 3ULEA 2RF2A 2ZM6K 2VWBA 4H8KA 4CD1A 3CCSN 4JI8K 1SV5A 4DU4A 3IDHA 1NK4A 1E4GT 3AAPA 3FR0A 2A1RA 4KHYA 4JKHA 2QWNA 4CZEA 1VHXA 1TK5A 4DFKA 4JK7A 1BI4B 1QVFM 2P5OA 1RT1A 1GLEG 4N5SA 3RVCA 3OHRA 2DTUA 3H08A 1NK7A 1QSLA 4OX9K 3NF7A 5M1PA 4B3SK 3NGIA 4JKBA 4PKHA 3ZT0A 4M41A 2FXUA 3LPUA 1J54A 4ILGB 4W5TA 3CCRN 4DUYK 5E26A 5FPMA 4CERA 1WSEA 3EL2A 4QAGA 3MX5A 4IBNA 5AQPA 4GKKK 5GAHP 4GV9A 4H5WA 4CK3A 1G15A 1YF5L 4B08A 2QTDA 4FVMA 4FM1A 1UA0A 3OS2A 2QI2A 3ZSVA 4CJUA 2ZQBA 4RW6A 1YVNA 2KQ2A 2DFEA 3QIOA 4RCHA 3ALYA 4NCGA 3NH1A 3E1YA 4ICLA 5K14A 5B8HA 2HB5A 1WNSA 4LC9B 2YKNA 1QTMA 1VRUA 3VTHA 4YOVA 1I3AA 1KVCA 1OVYA 4B1YB 4CESA 1JLGA 2G8HA 1GLBG 3I33A 2YJFA 2ZF5O 4A59A 3AVCA 2YNFA 3K5NA 1JJ2M 3QMLA 3HZ6A 2FF6A 4CGGA 4O55A 4C8NA 5C10A 4K41A 1VQMN 3S3OA 5HRPA 3DLGA 2QKBA 2VWKA 1VQ5N 1BO5O 4O8KA 3KHYA 1HRHA 2YNIA 4B9MA 2OA8A 3KLIA 2Z1GA 3MEGA 4PUOA 4FZXC 4KB1A 4DR2K 4B9TA 2CH6A 4KPYA 5AQVA 4KHNA 4DV7K 1K8KB 4BRMA 3KD5E 3P38A 4OVLA 1V4SA 3RMAA 2E6LA 2P5GA 4JLHA 4Z4GA 5KQDA 1K6YA 4BC5A 4Z94A 3ZEUB 4C8KA 4AM6A 3KKRA 2NRTA 3OYDA 3ZSWA 1L3TA 4CGJA 2YKMA 1N36K 5FRNA 2GV9A 4FJGA 1IKWA 4RW8A 1TKXA 2V51B 1M1KO 3VEXA 3KIOA 4BVOA 1WN7A 4BE1A 1LWFA 3VA0A 3FE1A 3DLKA 4YOUA 4JV5K 5AFUA 3VEOA 3HO1A 2OPRA 1IG9A 4JKGB 2P9LA 1LW2A 5F0XA 4BY9C 1I39A 4CZKA 4JRQA 3QNOA 3CFRA 2OZMA 1REVA 1RT6A 3FZKA 1QS4A 1VSLA 2QM1A 4HHTA 1HNIA 3DOLA 4YHHK 4JS4A 3OBYA 5JLFA 1VSEA 5EOYA 4V19S 2NRHA 4CEOA 2D5RA 4I9LA 3LP3A 5GIPA 4B9VA 3SAHA 1M90O 3H46O 3MXIA 2DFFA 1B92A 3O9SA 4NXMK 3HPGA 1RT5A 4IKFA 3O9QA 2A41A 2HBKA 3T1YK 1MWKA 2F9WA 3ENHA 2O8CB 1GLAG 3TSQA 1ASVA 3TAFA 4X65K 2YNHA 3EZWA 4DR7K 4IEEA 4I2PA 3HTVA 1HKCA 4H0PA 3M8PA 4CGFA 5GAEP 4IFVA 1RBSA 1SL2A 5D3GA 1S9EA 5DM6L 4B3OA 4GW6A 1SZ2A 5TKWA 4CHZA 1JCEA 3BP8A 3SZ2A 3V1QA 1KLNA 3ZT4A 1QQMA 4NLCA 3PX6A 1RBVA 5M1OA 4LF4K 2GBZA 3J7ZO 1NOYA 1OVQA 3PIOL 5AZJA 2OPSA 4DR3K 4DSKA 3EKUA 4M42A 3SPZA 3SMSA 3AVAA 1RDWX 3HOSA 5CY4A 3O9RA 4A57A 3PX0A 3IUCA 4DSIA 1U49A 4K8XA 3UKUA 3O1WA 3TAPA 4M3YA 3AO1A 3V6DA 1HNVA 4KH4A 1E3MA 3CJBA 4BDYA 2OPQA 3MXJA 3HM9A 3VQAA 1ASWA 2FSKA 5GAGP 4O5BA 1GLDG 4CHPA 1EETA 4H0XB 1QSYA 3KVGA 4CCHA 4AILC 3DXMB 2PFUA 3TAGA 2G8IA 4DSJA 4BRQA 3F9MA 3CYMA 3WNHA 4OKJA 2BDPA 1A5XA 4KHWA 2IVNA 3VTIA 3LALA 4DCHA 2D4WA 3LDOA 4HTUA 4FWPA 3R6MA 3WQUA 1RTIA 3TAQA 1NK6A 1VSHA 4LD0A 2RE2A 1SKRA 1NBWA 1CXUA 5AQRA 4M3XA 4EIAA 2AP1A 3CXCM 3DI6A 4JK8A 5SWMA 1RT2A 3EEQA 3AV9A 2HHWA 4CK2A 3O4WA 4CIFA 3S9HA 3RR7A 3NF9A 2IVPA 5CZ2A 3DM2A 1HQUA 4FM2A 2O8EB 1MDUB 4I2QA 4DR6K 3D2FA 4WQ5C 3UE5A 3HBTA 4L8RB 2EX3A 3H45C 2QA4N 4LSNA 4B8CA 5AQWA 3SV3A 4DS5A 1JL1A 2A5XA 3AVFA 3VGKA 1VSIA 4K8ZA 3M6GA 3NCIA 4XEIA 4CJ3A 1HNWK 4BDPA 3N4QA 3LDNA 3OBWA 4BR0A 3H3OB 3L6QA 5KTQA 4JI7K 4CVNE 4DTOA 3L3VA 2O4IA 1HJRA 3OY9A 1GLLO 1QQOA 3OYAA 1HNZK 4CEFA 1ATNA 2ZD1A 3CETA 4B9UA 1VQLN 1ZBUA 3VGLA 4DV1K 3UKRA 5AQSA 2QWOA 1OH5A 4YOTA 4DLGA 5CYMA 3NBPA 3LPTA 4J2DA 1EO1A 1RTDA 4UY8O 4A62A 4AHUA 1NGHA 4CE9A 5F2RA 4AF1A 5KQ8A 1X9WA 1BU6O 3O4QA 5AQZA 5JS1A 1BCOA 1F21A 3KWGA 2KFNA 2Q1NA 3AO5A 3OJSA 4DV4K 2QXFA 4JAXA 4FK2A 2Q31A 1C0FA 3SUOA 1UOCA 4WFAL 3C6HA 1WAJA 3P5JA 2YI1A 4U67L 3OYJA 2IGIA 3K9KA 5I3UA 3GBTA 2E2QA 3LM2A 4M3RA 3O6WA 4W5QA 1YHQN 4KH6A 2A1SA 3F5TA 5AR0A 4LF7K 2O8DA 3ZX3A 5ADXA 1HYVA 4LSLA 3OVNA 2NRZA 3LM9A 2W41A 5KRTA 2Q0UA 3O08A 1HQEA 1X3NA 2XO7A 4IDHA 4CHOA 1BOTO 3HXMA 2VG5A 4KI6A 4NB4A 4U7BA 1Q81O 4Y1DA 2PAVA 4LF8K 1N5YA 2D0BA 3PLAA 3M1FA 3DLRA 1RILA 1U4BA 1KFDA 3PY8A 2B4JA 5AQJA 3CCQN 1UWBA 3LDPA 3FGUA 3U9ZA 2E2PA 1NKCA 1NK9A 3PUFA 2JLEA 3H6EA 4GMJB 4JI1K 3LL3A 4F3OA 3TR8A 2IOCA 1QQNA 5KRSA 1HMVA 3OJUA 2P9KB 4BWJA 2ITMA 1Q86O 1OH8A 5AQNA 4Y0WA 4CJ7A 4FJMA 2OTLN 4QOZB 1IJJA 2GWJA 1C0UA 1DTQA 3JYTA 3TARA 4CJ5A 1C1CA 4CHQA 3J7AP 2HNDA 1YITN 1Z05A 3DJCA 1HYSA 1YXQA 1VQNN 1VSJA 4KTZA 1XHXA 5CR4A 4ILHA 4H4OA 3AVBA 3FFIA 4OGEA 1D9FA 4MLHA 4FPBA 3SAGA 2HHTA 3KK1A 4C8MA 1VQKN 2UUBK 3NAEA 3WQTA 3CFOA 3BDPA 1VQ8N 4CK1A 3WXKA 5BRFA 3HT3A 3LP2A 4HUGA 2HW3A 2AJQA 4KFBA 2D0CA 4J2AA 4N47A 3ID8A 4GVEA 2CGKA 4CZFA 3Q7CA 3A5MC 1Q7YO 3T7ZA 1TUYA 4CI6A 4FW2A 4DV2K 4CFDA 1VQ6N 2IVOA 2HHQA 4MFBA 1Q9XA 1H1VA 4PHTX 4C8LA 1A5WA 4FWLA 2IDOA 5BPLA 3QEIA 1C1AA 4ILJA 4MDAA 3T19A 5AZIB 4ZTJA 3M8RA 1X9SA 1Z25A 3V81A 3MAQA 3FLCO 4FLYA 2PYLA 3HOTA 3VF2A 1HUXA 1ZBHA 5AQXA 1BCMA 1KFSA 1YVUA 2HHXA 1XHZA 3NHGA 1HX1A 4ISGA 2F4VK 4DFPA 3FZHA 3JS6A 4DU1A 3O9UA 4CFCA 4PL7A 3CERA 4JKFA 4CEAA 3TAEA 2P9PB 4F9OA 3OYHA 1DLOA 4FL9A 5EVZA 3CPEA 4JS5A 3LANA 4OO1J 3CCJN 4E1MA 3NVMA 2P51A 3NFAA 4BR7A 3QINA 3BZKA 3EZ5A 2F7TA 1VQ7N 3MN9A 2P9UB 4PQUA 1U2VB 3DRSA 5JVHL 3KK2A 1ASUA 2YHBA 1S6PA 2HBLA 4HCCA 2QXLA 4Z0UA 1DEJA 1X3MA 4FO0A 2BGGA 1WBDA 4KHPK 5JVGL 4DTRA 2XY6A 3ZSRA 2ZJPL 3C6AA 4DQQA 4JI4K 3PSFA 3AO4A 1WOQA 3ITHA 4M3UA 5F1XA 3QLHA 4ELTA 4NCAA 3L4QA 4ISFA 4CJLA 1EKEA 3H1VX 2VYPA 1RCHA 1L3SA 1NKEA 4IDKA 3VF4A 1OH6A 3F2KA 4CW7B 3VF6A 1TUUA 2GX9A 3KLHA 2E6MA 3WEEB 3M8SA 2OANA 1RNHA 1SL0A 4Z4IA 3DLLL 1JLFA 3WNFA 2GEMA 3I56N 5EU7A 4HUEA 1L5UA 3MMVA 4DTXA 4IOXA 3C6TA 3CMEN 3RSEB 3ASMA 1NGBA 4IXCA 2GTDA 3DYAA 2A3ZA 3QFPA 3ZX2A 4KTQA 1V4TA 3CD6N 4J2EA 1RT3A 5AQGA 3DOKA 4JI5K 3H3NO 3ULDA 4FJXA 3V9XA 4DF4A 5AQQA 1VQ4N 4YY3K 3VEVA 3QBWA 4WQ4A 3ZX0A 2JGUA 5I42A 4MQ3A 4R79A 5C15A 3ZYYX 4JHDB 2RHKA 4KHSA 3QO9A 3WXIA 4EP5A 2FSJA 1VQPN 1HR0K 3U6FA 3I8DA 1VQ9N 4PKGA 1I94K 4OJRA 1BGXT 4I9QA 1XMQK 3AY9A 1NK8A 1J9AA 4DFJA 1NGFA 4BROA 3N4PA 5JLHA 2QEXN 2D0AA 2FSNA 1CZBA 3K58A 1BA0A 1KC8O 4H5VA 1HPMA 1EX4A 4ZTFA 3EY1A 1R0AA 1U04A 1TL3A 4A2AA 4DQ8A 2EWSA 3SMPA 1J5OA 4KAZA 3LZIA 4O4GA 5C42A 3OYLA 2WUSA 3NF6A 3RMBA 3ID6A 5EY4A 1RT4A 3MCPA 1JXEA 3CCMN 1JLEA 2IIRA 3D45A 2E88A 1WSFA 4JI3K 2XHBA 3TSPA 1QZ5A 1SKWA 5BN8A 3V4IA 4QS8A 4C1NK 3TWHA 3DXMA 3C6UA 2RKIA 3NF8A 4W5NA 2P1JA 4CJQA 1YTAA 1DTTA 4OPKA 4GVMA 3AGRA 1XI1A 4FXDA 2O8BA 1N6QA 2CH5A 3KTQA 1FJGK 4X64K 2W42A 2O8FA 1Q82O 4FLTA 1J6ZA 4DTSA 4HCBA 1JXBA 3AVIA 1KVBA 2Q3SA 2JWLA 4IG0A 4CGDA 3E9LA 4CZHA 3A2FA 2NRVA 1ILYA 3P4IA 4DTMA 4OLAA 4KBOA 3AVKA 3ZETA 3QBXA 4AHCA 3HK2A 5DMRA 2B5JA 2P9SB 2HHSA 3VESA 3A8YA 3ULEB 4BRNA 1BUPA 4Q5VA 1RBRA 2FLOA 5JICA 4CEEA 4FJ9A 4JN4A 3OYIA 2G8FA 1RDUA 3RMCA 2W6LA 3VMFB 2D1KA 2HHUA 5HOOA 1KSPA 2IAJA 1BIZA 1Q8IA 2V7YA 3D7EO 1U47A 1W7AA 3IG1A 1EQYA 5LJVA 4E3SA 4CECA 3CJ1A 1HLUA 1WB9A 3RTVA 4FCYA 3CF5L 2A42A 1QVGM 5LMNK 3SAFA 3VQ4A 4CZJA 4FWRA 3SQ0A 3VEZA 3HSTB 1C0TA 4B3TK 4RTFD 4IFYA 1CZ9A 3O80A 4IJNA 4CEBA 4LFAK 3A5NC 3DMJA 3CJ7A 2F8TA 3MXMA 2E8AA 5FDLA 1BHLA 3SUQA 3C7NB 4EFHA 3OYGA 4KRFA 5M1NA 1JLAA 3THWB 3FZFA 2HMIA 2F8SA 3J8AA 4BDZA 5C25A 4B9QA 2UXCK 4CBWA 3HPOA 4E7IA 1WUAA 4K0KK 4FWOA 1BDGA 4AM7A 2VWJA 3TPQA 1DGKN 4EZ9A 4WCEL 1TGOA 1UA1A 2WOMA 2DPNA 3CJAA 4W5RA 3ZT2A 4FJ5A 5HRSA 4H0YB 1XWLA 1BA1A 4CJKA 1C6VA 1U48A 1ITGA 4RW9A 3KK7A 4A5AA 1WLJA 2NRRA 1ZBLA 4Z4EA 5IWAK 1LWEA 2Z1HA 1IG8A 4BGAA 3DXKA 3CQXA 1C1BA 3AO3A 4J8FA 2F9TA 3V9ZA 1NMNA 4YDUA 3OYNA 3HJFA 3I8BA 1ZYQA 3L8BA 2FC0A 4WF9L 1MA9B 2HNYA 1FW6A 5EX5A 5AFUH 1C0MA 1QQCA 1KTQA 1T6DA 3SNNA 3ZSYA 1WSJA 5CZ1A 3NH2A 1EWRA 1TVRA 1Y64A 4M3ZA 2BANA 1NU0A 3DLHA 4HVJA 4MLEA 4BRPA 1CLQA 4CGIA 5JMVA 1XC9A 2QWMA 4CGHA 4FLXA 2P9LB 2X6NA 1IKVA 4A61A 4DSFA 5C2DA 3TTCA 4IO8A 5LMUK 1NKBA 2VGMA 3THYA 1MU2A 1K9MO 2GELA 2Z1JA 3G4SN 2OPPA 2KKZA 4X66K 5FPEA 4E7JA 3L2UA 3ZLJA 3BY5A 3D2EB 1DKGD 3LP0A 3ATUA 4CF9A 2NRWA 4OKKA 4Z4FA 3AGKA 4FSVA 1L3UA 1VSMA 2FBTA 5ELZA 1S22A 5HLFA 5E84A 3KLGA 3AO2A 1BISA 4OLBA 4OPHA 3MN5A 5C2FA 2GUPA 2NZTA 3R1XA 1TV6A 4DSLA 5J1EA 4FJLA 3BF1A 3RMDA 3OYBA 1TAQA 1XNRK 3THXB 2KLAA 5AJ3K 1KQSM 4MO4A 1SS6A 1IBMK 3LWLA 4IFEA 2XY5A 5SZTA 4CBXA 2Q0RA 3GDQA 4A5BA 4OPAA 1XQSC 1S1TA 1KXPA 4H5TA 5AQIA 2E1YA 1OH7A 3LDLA 3MCAB 1YT3A 4H5RA 3F9KA 3I0SA 5AQUA 4F2RA 3W3DA 4BRFA 5KPRA 1NWKA 2GUIA 3WXLA 1FKPA 3G25A 3CI5A 1RBTA 4DV5K 3A0IX 3S3NA 3DRRA 2OTJN 2UXBK 3G10A 4JI6K 3BUZB 4GV6A 4HUFA 1X9JA 2P9IA 3O5BA 1TK0A 1JCGA 1HKBA 3AVNA 5GINA 1U2VA 2W40A 4FLUA 3NMUA 1LAVA 3VEYA 2UYTA 2ZWHA 2EHGA 4BRLA 2AA4A 2KW4A 4B3MK 1ZXOA 2ZJQL 1IBLK 1TL1A 1NGIA 3QETA 3L0QA 4H5NA 4XH5A 3M8QA 2CGLA 4CHNA 1T8EA 4BRIA 3HRGA 4IWVA 5KPZA 4E7KA 5AQHA 2FBVA 2G8WA 4BRCA 2CGJA 4Z4CA 2QWQA 4CBUA 3CJCA 1BI4A 4BQLA 1KVAA 1JKHA 4OKEA 4JEPA 3VENA 4B9LA 4FK4A 2Z1IA 5JS2A 3L2VA 5KGXA 3VQBA 5HRNA 5KI6A 4CZIA 3QB0A 3CC2N 1B9DA 3VGMA 1D4XA 1LOTB 1LV5A 1NGCA 5BRHA 4JNEA 3SBGA 1W97L 4ELVA 3LAMA 1JL2A 2A40A 1GOAA 3BF3A 4LF6K 5M1KA 3CMAN 3THVA 1NJWA 2V52B 1QHAA 1WAFA 2UU9K 1S9GA 3IS9A 3RRGA 1GLCG 2NNWA 1NGDA 4BGBA 5AQMA 4KREA 1LCUA 3TSUA 3NE6A 2I7NA 1RDCA 4QS7A 4F3TA 3TANA 1XUPO 4O8UA 2E5LK 5E41A 3SYZA 3BEXA 5BRDA 4FJKA 4FW1A 3GOIA 1XNQK 2BH1A 3D2FB 1TAUA 1YJNN 3HP6A 3M3ZA 1TKTA 3AAQA 1KCFA 2YHXA 4JI2K 4JHDA 1YAGA 3VETA 1A5VA 2HMPA 3S41A 3QEVA 4BRHA 5LJWA 3P1GA 3RRHA 4TSXA 3LAKA 4JD2B 2XY7A 3U9DA 4EHUA 1IH7A 3KWIA 3GG4A 4CEQA 2Y1JA 1BWFO 3U8XA 4BREA 4BE0A 2BE2A 1G99A 1BL3A 1S1VA 3DAWA 2VG7A 4I6MB 3ATVA 3HSCA 3SK3A 4DV6K 1HJOA 3I55N 3NGYA 3UKRB 3DRPA 5DM7L 4M7YA 1ZBSA 4E1NA 1MWMA 1R59O 1K8KA 4CF0A 1K8AO 2HNZA 3UIQA 1O13A 3VA3A 3NH0A 3VQ5A 2PZSA 3SPYA 1YIJN 5J2PA 3QEXA 4FWKA 1RFQA 3EO3A 3ZEUA 5HP1A 4KO0A 4FOIA 4E1JA 4X62K 1N32K 1GLFO 1TYQB 4CEDA 1NGJA 1NMDA 3R9PA 1S72N 3KKSA 4YDUC 1BIUA 3K5OA 4W5OA 4NCBA 1SQKA 2FF3B 3WXMB 3HI0A 1KAXA 1ZC6A 3V9UA 1RGIA 3QDKA 3VQPA 3QIPA 4E7HA 2O8DB 1T44A 4AH9A 2QWRA 4JKGA 5CYQA 2OYQA 2G8VA 3VQ6A 4K43A 1D5AA 2VQFK 4CJWA 3V9SA 3A5OC 4AHTA 3JAMO 3AA4A 3J7YP 4DU3A 4BWMA 2ZGYA 2KFZA 3P83D 2PYJA 1RTHA 1EWQA 1NNEA 1RDDA 3QICA 1IV0A 3O8MA 3LZJA 4N76A 2KZZA 4KH5A 1WBBA 3U4LA 2P9NB 4IG3A 5FPNA 1DT9A 4DR5K 3FFKB 4F4KA 4K42A 3VN5A 3C65A 4DV3K 3O4NA 3VQ8A 3AVMA 2Q2RA 1QZ6A 4XH1A 2H3GX 4CZMA 4CD3A 3EKSA 4LY7A 2ZJRL 5BREA 3OYCA 4QCLA 3IRXA 5C0YA 2O8CA 3LP1A 4OPJA 2ASMA 3JXUA 5AQOA 4DG1A 4JKEA 5KPTA 4EZ6A 3D6RA 4BACA 4F8RA 2HVHA 4AQYK 3TTDA 1N34K 3RWUA 3H1QA 2WFBA 3EE9A 3NVKA 4BRDA 3SJJA 1W0HA 4CIGA 4DB3A 3PV8A 2QKKA 4CJTA 3AVJA 4WQ5A 3AA3A 1LWCA 2ETJA 3MX2A 2E2OA 4BC4A 3GE1A 5AQLA 3VEWA 3C7NA 1YI2N 1Q9YA 3MECA 5A2QO 4BR2A 3THWA 2HHVA 3K2PA 2LSNA 1GOCA 4CJ4A 2UUCK 1IO2A 3ZSZA 4PKIA 4M7XA 1NLVA 2B6AA 2YX6A 4H0TB 2A6AA 3VERA 4DQPA 4FOEA 3L2WA 1HYZA 5C24A 4E7LA 3MWPA 3C95A 3OS0A 4FJNA 3HM8A 4NYFA 2PBDA 1HKGA 4DTPA 3LDSA 5H1SQ 4PA1A 1ATSA 1S1UA 2OZSA 1NJXA 3E66A 3K59A 3IMXA 1SKSA 5IT9O 4G9ZA 4BE2A 3CHWA 1T6CA 4FJ7A 5HROA 3VQ7A 1Y97A 3TTFA 4IOAL 5I9EB 2FBXA 3O3HA 2Y1IA 1P8ZA 2E2NA 3ZT1A 2R7YA 5T7BA 1ATRA 1RT7A 2W6KA 5J2QA 4CZGA 1U6ZA 3PX4A 4FVUA 3ISNC 3D0PA 1NGGA 3CFPA 3GL1A 1YJ9N 2KHOA 2YHWA 3LDQA 1CZAN 1RTJA 3ZSOA 1JLCA 5FPDA 1KAYA 3G0ZA 3ZT3A 4LH5A 5HL7L 4DTNA 1WSGA 3WXJA 2HHHK 3U3GA 2HVIA 1N8RO 4E89A 4KHUA 4O44A 4KKOA 4CHYA 4CIEA 2HSTA 5LL6Z 4FLWA 2RN2A 3O1BA 2O8EA 4EP4A 2QWPA 3DWLA 4DR4K 4K25A 3KJVA 3T69A 4YNQA 4DFMA 4GNIA 5GADP 3HVTA 3E9PA 3IFRA 1NM1A 3VOVA 3G6EN 2YHYA 3AARA 1LW0A 1P90A 1QSSA 1RBUA 1B9FA 3ENOA 2UXDK 4M45A 1IKYA 1KLMA 2DY4A 2X6SA 3QERA 2XY8A 4BC2A 3D2EA 1VRTA 2I5JA 1C0GA 4DTUA 5FLXO 4L3QA 1FXXA 1E4FT 3E01A 3TI0A 3WNEA 3CM5A 3FZMA 3TAMA 3SI6A 3NGZA 3MEEA 3T3FA 5M1FA 3SCXA 4B1VA 4IEIA 4OGCA 3R3LA 5BR9A 1T03A 1TKDA 3A5LC 2QK9A 4WFBL 4RWTA 3S3MA 4GV3A 4Y1CA 1U45A 3CCVN 4FPAA 5TKYA 1JLBA 3PIPL 1L3VA 3OYMA 2KZMA 3IAYA 4DKWA 3SV4A 3CIPA 4BR9A 3NDKA 4C1NI 4FWQA 3THXA 4CF8A 5M1QA 1VSKA 3TABA 2G8UA 4WE1A 3PO5A 2QWLA 3SJHA 4HTLA 2VGNA 4BRKA 4CFBA 4B3RK 1S1XA 1RDBA 4MO5A 3MEDA 4YFUA 2BTFA 1SL1A 1GOBA 2YNGA 2ASOA 3EN9A 1WSIA 4CJFA 4Z4HA 4B9SA 4JI0K 4RW4A 1KRPA 1X9MA 2IC3A 4DUZK 4LFBK 2ZGZA 3V9WA 4CJEA 5KGWA 3WT0A 5BR8K 2JWKA 3L2QA 1S6QA 4NYNA 4A2BA 1ZBIA 4XH4A 4PWDA 4DQIA 3F73A 4LH4A 3CC7N 3ZSXA 4CF2A 4NO7A 1NOZA 3VPZA 1NJZA 1O1WA 3BGRA 4DS4A 1YUWA 2HBMA 5BPMA 4DLEA 3MDQA 5BN9A 4DV0K 1D8YA 3L2RA 2X78A 3SQ4A 1X1PA 4Q0BA 1W2BM 4UQGA 4JKDA 5FRMA 1QHTA 1ZBFA 2RPIA 5HBMA 5FROA 1W9HA 4C23A 1FK9A 2HF4A 3SUNA 2P9KA 4YOXA 3M5RA 5J2MA 2V7ZA 4BG8A 5AQKA 4MDBA 5LY3A 1XC3A 2HOEA 3VQQA 4FLVA 4GKJK 2O8BB 5GIOA 2WBNA 3IKMA 3B8AX 3OYFA 3DLBA 3P39A 3V1OA 1J5EK 2O8FB 4DMNA 2VCPA 4ELUA 3ZSQA 3VQCA 4O0IA 3OW2M 4C8OA 3SQ1A 3HYFA 3WNGA 5CE3A 4BQZA 4B9NA 3ZETB 4KI4A 4E0DA 3OS1A 4CJPA 1IBKK 3OYEA 4DTJA 1RDAA 3QEWA 1TK8A 4FM0A 4WQ4C 4DHYA 1QE1A 2OCEA 1FKOA 2HF3A 2YHAA 4FWMA 4CF1A 2E4LA 3Q7BA 3K5LA 3SBTA 4JRPA 3AA5X 4WYBA 4RW7A 3CPWM 2XRIA 3QNNA 1NK5A 4DR1K 3P31A 4O5FA 1GLJO 4JD2A 4CZLA 1LAWA 4DQSA 4FJJA 5AQTA 1JCFA 1S3XA 1HNXK 3KD1E 5AZIA 1NK0A 3CQYA 4I6MA 4KHQA 3T1AA 2YCHA 4PY5A 2O4GA 2D0OA 2NRXA 1KD1O 4M3WA 3MWTA 3KLEA 3CJ9A 4YOWA 3HPHA 4B1XB 4DWIA 2I7PA 2YJEA 3CCUN 4AHRA 3SLCA 3OTOK 4GY2B 3EE8A 1UAXA 2P9PA 1SAZA 4ISEA 4G1QA 4KTWA 3E9OA 4H03B 2GWKA 1EP4A 1TYQA 4YORA 5AZJB 4FLZA 4IOCL 2P9UA 2VQEK 3MN7A 1ESVA 4NLBA 1EXQA 4KB0A 4EHTA 1S5JA 5J2NA 2ZE2A 1TKZA 3UKUB 4JKAA 3QESA 2Q97A 2WC9A 1YJWN 3RR8A 1HPZA 3HL8A 4DQRA 2NUBA 3L3UA 4LFCK 1N33K 2BUPA 3CM6A 3O9TA 4NXNK 4B1ZA 1BG3A 3K9JA 2WONA 3HP9A 3ZCMA 3ENBA 3L4IA 5DK5A 4B1WB 3DXKB 1Z26A 2WTUA 1VAZA 3CCLN 2D0PA 1NGEA 3MN6A 3WEEA 2P9NA 3CCEN 1NGAA 3W0LA 4BR4A 4N56A 4AHVA 3B6PA 3VQEA 2UUAK 3KZBA 4LF9K 2F96A 1WSHA 4FWNA 3RSEA 1Z6RA 5AQYA 1T05A 2NLXA 2FBYA 1BQMA 3VQ9A 4WFNL 3O3GA 4IO9L 2IS3A 3BZCA 4FJHA 3R8EA 3G71N 1NJYA 5CHIA 5AQFA 3PSIA 4F2SA 4R5PA 4DF8A 4JYAK 4CJVA 3OYKA 2DFHA 1KAZA 1IKXA 2QW9A 3THYB 4JK9A 4HWIA 2Q36A 4FZZA 4N41A 1K73O 1J53A 4AHSA 3VQDA 4H4MA 5C12A 3SQ2A 1T3VA 4ID1A 5HRRA 3CG7A 4BG9A 4XIUA 3K0SA 4CFAA 3EYZA 2KTQA 1JLQA 1YTUA 4PL8A 1D9DA 1VSDA 2ATQA 2ASPA 4KV8A 3AA2A 4FK0A 3CQ8A 2E1ZA 4JKCA 3JSMA 4H0OA 1NG9A 1NJIO 4H0VB 1VK0A 3PO4A 3SUPA 3J81O 4BR5A 3UB5A 3V1RA 2X74A 3K5MA 4B8AB 4FWSA 3DLEA 3WUHA 1Q18A 1VQON 2PY5A 3QFUA 4J2BA 3AVGA 4IJAA 3KLFA 4BVPA 4IZ9A 3T1HK 3C94A 3CC4N 1SUQA 4O0JA 4E19A 4BC3A
chains in the Genus database with same CATH topology
5HRSA 3OYJA 4RG8A 3LWMA 2IGIA 1XWLA 3O3HA 5I3UA 4CJKA 1BQNA 1C6VA 2Y1IA 1U48A 4CJSA 3QEPA 2G8KA 3ZT1A 4M3RA 4W5QA 4FJ8A 4ID5A 2R7YA 4FZYA 1ITGA 4RW9A 2A1SA 5T7BA 3HVRA 1RT7A 4CJRA 5J2QA 3AVHA 1HYVA 1WLJA 4LSLA 3OVNA 4CEZA 4M3TA 3KK3A 1ZBLA 3PX4A 4Z4EA 3ISNC 1LWEA 5KRTA 3D0PA 3CFPA 1VSFA 1HQEA 2Z1HA 2XO7A 3HXMA 4CHOA 3I0RA 3O3FA 2VG5A 1RTJA 3B6OA 4KI6A 1C1BA 3ZSOA 1JLCA 4DSEA 3ZT3A 3G0ZA 3AO3A 4LH5A 4DTNA 4I7FA 1WSGA 4Y1DA 4ZHRA 3V9ZA 4FYDA 1CXQA 3OYNA 1N5YA 2D0BA 1ZYQA 3HJFA 3U3YA 2VG6A 4FJIA 3L8BA 3DLRA 1RILA 1S1WA 3U3GA 1KFDA 2ITGA 1U4BA 3PY8A 1T7PA 2B4JA 2HVIA 2YV0X 2FC0A 4E89A 3AVLA 1UWBA 3K57A 4KHUA 4O44A 2HNYA 4KKOA 2RF2A 1NKCA 1C0MA 1QQCA 1NK9A 4CHYA 4H8KA 1KTQA 4CIEA 4KHWA 3SNNA 3PUFA 2JLEA 1WSJA 3ZSYA 2RN2A 4GMJB 5CZ1A 4FLWA 3NH2A 1SV5A 4DU4A 1NK4A 1TVRA 4F3OA 3TR8A 2A1RA 4KHYA 2IOCA 4EP4A 5KRSA 1HMVA 3OJUA 4M3ZA 2BANA 4BWJA 1TK5A 3KJVA 4YNQA 4DFKA 4DFMA 1BI4B 3HVTA 2P5OA 4FJMA 3DLHA 4QOZB 1RT1A 4HVJA 1CLQA 4N5SA 1C0UA 4CGIA 1XC9A 1DTQA 3JYTA 3TARA 1LW0A 4CJ5A 2DTUA 1QSSA 1C1CA 1RBUA 4CHQA 3P5JA 2HNDA 4CGHA 1B9FA 3H08A 1NK7A 1QSLA 4FLXA 4M45A 1IKYA 1HYSA 2X6NA 1IKVA 1KLMA 3NF7A 4DSFA 1VSJA 2DY4A 3NGIA 2X6SA 4KTZA 1XHXA 1NKBA 3QERA 2XY8A 4H4OA 3AVBA 3FFIA 1MU2A 4OGEA 3ZT0A 3LPUA 2Z1JA 1VRTA 2OPPA 1J54A 4M41A 4W5TA 1D9FA 2I5JA 2HHTA 4CERA 3KK1A 1WSEA 4DTUA 4E7JA 4QAGA 1FXXA 3TI0A 3E01A 4C8MA 3WNEA 4IBNA 3L2UA 3CM5A 3NAEA 3TAMA 3SI6A 3NGZA 3MEEA 3T3FA 3CFOA 3BDPA 3SCXA 4CK1A 3LP0A 4CK3A 4OGCA 1G15A 4B08A 3HT3A 1T03A 4FVMA 4CF9A 4FM1A 1TKDA 1UA0A 4OKKA 3OS2A 3LP2A 4Z4FA 3ZSVA 4HUGA 3S3MA 2QK9A 2HW3A 4CJUA 2AJQA 2ZQBA 4Y1CA 1U45A 1VSMA 2FBTA 1L3UA 4KFBA 4RW6A 2D0CA 2KQ2A 2DFEA 1JLBA 3QIOA 5HLFA 3ALYA 4N47A 3OYMA 3KLGA 1L3VA 3IAYA 4NCGA 3AO2A 4J2AA 3NH1A 3SV4A 1BISA 4OLBA 3NDKA 4ICLA 5K14A 2HB5A 1WNSA 4CF8A 1VSKA 3TABA 2G8UA 4WE1A 3PO5A 1TV6A 2YKNA 4FW2A 1QTMA 5J1EA 4DSLA 4FJLA 1VRUA 4CFDA 1I3AA 3RMDA 1KVCA 3OYBA 1TAQA 4CESA 2HHQA 4CFBA 1JLGA 2G8HA 4MFBA 1Q9XA 1S1XA 4C8LA 1A5WA 1RDBA 3LWLA 2XY5A 2IDOA 3MEDA 3QEIA 5SZTA 4YFUA 1C1AA 3T19A 1SL1A 3AVCA 1GOBA 2YNGA 2YNFA 3K5NA 4ZTJA 3M8RA 1X9SA 4CGGA 1S1TA 4O55A 1Z25A 3V81A 4C8NA 1WSIA 1YT3A 3F9KA 4CJFA 3MAQA 3I0SA 4Z4HA 3S3OA 5HRPA 4FLYA 3DLGA 4RW4A 1KRPA 2PYLA 1X9MA 4B9SA 4F2RA 2QKBA 2IC3A 2VWKA 1ZBHA 1BCMA 1KFSA 1HRHA 2GUIA 1YVUA 3V9WA 1XHZA 3NHGA 2YNIA 2HHXA 4B9MA 4CJEA 4DFPA 5KGWA 1FKPA 2OA8A 3KLIA 2Z1GA 3MEGA 3L2QA 4FZXC 4KB1A 4DU1A 1S6QA 4NYNA 4B9TA 1RBTA 4KPYA 4PUOA 1ZBIA 4PWDA 4DQIA 3F73A 4CFCA 4LH4A 3S3NA 3DRRA 4KHNA 3ZSXA 4CF2A 4CEAA 1NOZA 3G10A 3TAEA 1O1WA 1NJZA 3BGRA 3OYHA 1DLOA 4DS4A 3KD5E 4HUFA 4OVLA 4JS5A 1TK0A 3RMAA 2E6LA 3LANA 3AVNA 4DLEA 4FLUA 2P5GA 1LAVA 2EHGA 4E1MA 1L3TA 2P51A 3NFAA 3QINA 4JLHA 1D8YA 3L2RA 2X78A 2KW4A 3EZ5A 3SQ4A 4Z4GA 1K6YA 1X1PA 4Q0BA 4PQUA 4C8KA 1TL1A 3KKRA 3DRSA 4UQGA 3QETA 3KK2A 3OYDA 3ZSWA 5FRMA 1QHTA 1ZBFA 2RPIA 3M8QA 5HBMA 1ASUA 1W9HA 5FROA 4CGJA 4CHNA 1T8EA 2YKMA 2YHBA 5FRNA 1S6PA 4HCCA 2GV9A 1FK9A 4E7KA 4Z0UA 3SUNA 2FBVA 2G8WA 4FJGA 2BGGA 1IKWA 4RW8A 4Z4CA 1TKXA 5J2MA 3KIOA 4DTRA 2XY6A 3ZSRA 1BI4A 1WN7A 1KVAA 1JKHA 4OKEA 4DQQA 4B9LA 4FK4A 4BE1A 2Z1IA 5JS2A 3VQQA 3L2VA 4FLVA 5KGXA 3VQBA 1LWFA 5HRNA 3VA0A 3AO4A 5KI6A 3DLKA 3ITHA 4M3UA 3QLHA 3OYFA 3DLBA 3V1OA 3HO1A 2OPRA 4DMNA 1IG9A 4ELTA 3ZSQA 4ELUA 1LW2A 4NCAA 1B9DA 3VQCA 4CJLA 4O0IA 1I39A 1LV5A 1EKEA 4JRQA 4C8OA 3QNOA 3CFRA 2OZMA 1REVA 3SQ1A 1RCHA 1RT6A 1L3SA 3HYFA 1NKEA 4IDKA 4ELVA 3WNGA 3LAMA 1JL2A 1QS4A 1VSLA 4B9NA 4KI4A 1GOAA 4HHTA 4E0DA 4E19A 3OS1A 3THVA 1NJWA 4CJPA 3KLHA 2E6MA 3M8SA 3OYEA 1HNIA 4DTJA 1RDAA 1WAFA 1RNHA 3DOLA 4JS4A 1S9GA 3IS9A 1SL0A 3RRGA 4Z4IA 1VSEA 1JLFA 3WNFA 4CEOA 2D5RA 4I9LA 3QEWA 3LP3A 5EU7A 4FM0A 1TK8A 4B9VA 4HUEA 1L5UA 4KREA 3NE6A 4DTXA 1RDCA 1QE1A 4F3TA 3C6TA 3TANA 1FKOA 2YHAA 3MXIA 2DFFA 1B92A 3ASMA 3DYAA 4CF1A 5E41A 2E4LA 3HPGA 3SYZA 1RT5A 3K5LA 4IKFA 4KTQA 4JRPA 4FJKA 3AA5X 4FW1A 4J2EA 4RW7A 1RT3A 2XRIA 3QNNA 3DOKA 1TAUA 3ULDA 4FJXA 3V9XA 3HP6A 4DF4A 1NK5A 1TKTA 1KCFA 1ASVA 3TAFA 1LAWA 4FJ5A 1A5VA 4DQSA 3QEVA 2JGUA 5I42A 4FJJA 4MQ3A 2YNHA 3P1GA 3RRHA 4TSXA 3LAKA 4I2PA 2XY7A 3KD1E 3QO9A 4KHSA 4EP5A 1NK0A 3U6FA 1IH7A 3I8DA 4KHQA 3T1AA 4CEQA 2Y1JA 3M8PA 4BE0A 2O4GA 4CGFA 4PY5A 4IFVA 2BE2A 1RBSA 4OJRA 1BGXT 1SL2A 4I9QA 5D3GA 1S9EA 4M3WA 1NK8A 1BL3A 1S1VA 1J9AA 4DFJA 2VG7A 3KLEA 4B3OA 3HPHA 4GW6A 2D0AA 4DWIA 1CZBA 4CHZA 3K58A 3SZ2A 4AHRA 3V1QA 1EX4A 3NGYA 1KLNA 3DRPA 3ZT4A 3EY1A 4ZTFA 1R0AA 1U04A 3PX6A 1RBVA 4E1NA 1TL3A 1UAXA 2GBZA 1NOYA 2OPSA 4CF0A 1J5OA 2HNZA 3UIQA 4G1QA 3VA3A 4DSKA 4KAZA 3LZIA 3SPZA 4O4GA 4M42A 5C42A 3OYLA 4KTWA 3NF6A 3AVAA 3NH0A 3RMBA 3VQ5A 2PZSA 5CY4A 1EP4A 3SPYA 3PX0A 1RT4A 4FLZA 5J2PA 3QEXA 1JXEA 4DSIA 1JLEA 1U49A 3D45A 4K8XA 5HP1A 1WSFA 3TAPA 4KO0A 2XHBA 1SKWA 4M3YA 3AO1A 1EXQA 3V6DA 4KB0A 1HNVA 3V4IA 1S5JA 5J2NA 2ZE2A 4CEDA 4BDYA 1TKZA 3TWHA 2OPQA 3KKSA 3MXJA 1BIUA 3K5OA 4W5OA 3C6UA 3HM9A 2RKIA 3NF8A 3VQAA 4W5NA 1ASWA 2P1JA 1YTAA 4CJQA 3QESA 4NCBA 1DTTA 4O5BA 4CHPA 4OPKA 1EETA 4GVMA 1QSYA 3RR8A 3V9UA 4CCHA 4AILC 1HPZA 3HL8A 1XI1A 4FXDA 3TAGA 2G8IA 3VQPA 4DQRA 4DSJA 1N6QA 3QIPA 4E7HA 3KTQA 3CYMA 3WNHA 2W42A 2NUBA 3L3UA 4OKJA 4AH9A 2BDPA 1A5XA 5CYQA 4FLTA 3CM6A 1JXBA 4DTSA 2G8VA 2OYQA 4HCBA 3AVIA 2Q3SA 1KVBA 3LALA 2WONA 3HP9A 3VQ6A 1D5AA 4IG0A 4CGDA 4HTUA 3ZCMA 4CJWA 3V9SA 4AHTA 3A2FA 1RTIA 3AA4A 3TAQA 4DU3A 5DK5A 1NK6A 1VSHA 4DTMA 4LD0A 4OLAA 4BWMA 1SKRA 2KFZA 4M3XA 1CXUA 3P83D 1Z26A 2PYJA 3AVKA 4AHCA 3HK2A 5DMRA 1RTHA 2B5JA 3DI6A 2HHSA 4W5RA 5SWMA 1RDDA 1RT2A 4N56A 3AV9A 4AHVA 3B6PA 3VQEA 3LZJA 4CK2A 4N76A 2HHWA 2KZZA 4CIFA 4Q5VA 2F96A 4IG3A 3S9HA 4F4KA 3RR7A 1WSHA 1RBRA 3NF9A 3VN5A 5CZ2A 4CEEA 4FJ9A 3DM2A 3O4NA 3VQ8A 1HQUA 3AVMA 1T05A 2FBYA 3OYIA 1BQMA 3VQ9A 3O3GA 4FM2A 2G8FA 2IS3A 3RMCA 4I2QA 4LY7A 2HHUA 4FJHA 3OYCA 1KSPA 2IAJA 4QCLA 3IRXA 1BIZA 1Q8IA 1U47A 1NJYA 4L8RB 2EX3A 3LP1A 4OPJA 2KZMA 4LSNA 4B8CA 4DG1A 3IG1A 3SV3A 4DS5A 1JL1A 4EZ6A 3AVFA 4K8ZA 1VSIA 4E3SA 4F2SA 4BACA 4CECA 4F8RA 2HVHA 4R5PA 4DF8A 3NCIA 4CJVA 3OYKA 2DFHA 3RTVA 4FCYA 3RWUA 4CJ3A 1IKXA 3SJJA 4BDPA 1W0HA 4CIGA 3VQ4A 4FZZA 3PV8A 2QKKA 3SQ0A 4N41A 4CJTA 3AVJA 5KTQA 3AA3A 1J53A 1LWCA 2ETJA 4DTOA 3L3VA 3HSTB 4AHSA 3VQDA 1C0TA 2O4IA 4H4MA 3SQ2A 1HJRA 4ID1A 1CZ9A 3CG7A 4IFYA 5HRRA 4XIUA 3OY9A 3MECA 1Q9YA 4CEBA 2HHVA 3K2PA 3DMJA 4CFAA 3OYAA 3EYZA 1JLQA 4CEFA 2KTQA 2ZD1A 2LSNA 2F8TA 3MXMA 4B9UA 1YTUA 1ZBUA 1GOCA 4CJ4A 5FDLA 1IO2A 1BHLA 3SUQA 4DLGA 3ZSZA 5CYMA 1VSDA 3OYGA 2ATQA 2B6AA 3AA2A 4KV8A 1D9DA 4KRFA 1JLAA 3NBPA 4FK0A 4DQPA 3LPTA 3CQ8A 2HMIA 3JSMA 4J2DA 3L2WA 1HYZA 2F8SA 1RTDA 5C24A 4E7LA 4AHUA 3C95A 3OS0A 4CE9A 4BDZA 1VK0A 5C25A 4FJNA 3PO4A 3SUPA 4NYFA 1X9WA 3V1RA 2X74A 3K5MA 4B8AB 4DTPA 3O4QA 3LDSA 3DLEA 5JS1A 1BCOA 1F21A 4PA1A 2PY5A 1S1UA 2OZSA 3HPOA 4E7IA 1NJXA 2KFNA 4J2BA 3AVGA 3K59A 3AO5A 3OJSA 2VWJA 3KLFA 1SKSA 2QXFA 4EZ9A 4BE2A 4FK2A 1TGOA 1UA1A 2WOMA 3C94A 3SUOA 5HROA 4FJ7A 3VQ7A 1Y97A 1UOCA 1SUQA 1WAJA 4O0JA 3ZT2A 2FBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRS A;  3OYJ A;  4RG8 A;  3LWM A;  2IGI A;  1XWL A;  3O3H A;  5I3U A;  4CJK A;  1BQN A;  1C6V A;  2Y1I A;  1U48 A;  4CJS A;  3QEP A;  2G8K A;  3ZT1 A;  4M3R A;  4W5Q A;  4FJ8 A;  4ID5 A;  2R7Y A;  4FZY A;  1ITG A;  4RW9 A;  2A1S A;  5T7B A;  3HVR A;  1RT7 A;  4CJR A;  5J2Q A;  3AVH A;  1HYV A;  1WLJ A;  4LSL A;  3OVN A;  4CEZ A;  4M3T A;  3KK3 A;  1ZBL A;  3PX4 A;  4Z4E A;  3ISN C;  1LWE A;  5KRT A;  3D0P A;  3CFP A;  1VSF A;  1HQE A;  2Z1H A;  2XO7 A;  3HXM A;  4CHO A;  3I0R A;  3O3F A;  2VG5 A;  1RTJ A;  3B6O A;  4KI6 A;  1C1B A;  3ZSO A;  1JLC A;  4DSE A;  3ZT3 A;  3G0Z A;  3AO3 A;  4LH5 A;  4DTN A;  4I7F A;  1WSG A;  4Y1D A;  4ZHR A;  3V9Z A;  4FYD A;  1CXQ A;  3OYN A;  1N5Y A;  2D0B A;  1ZYQ A;  3HJF A;  3U3Y A;  2VG6 A;  4FJI A;  3L8B A;  3DLR A;  1RIL A;  1S1W A;  3U3G A;  1KFD A;  2ITG A;  1U4B A;  3PY8 A;  1T7P A;  2B4J A;  2HVI A;  2YV0 X;  2FC0 A;  4E89 A;  3AVL A;  1UWB A;  3K57 A;  4KHU A;  4O44 A;  2HNY A;  4KKO A;  2RF2 A;  1NKC A;  1C0M A;  1QQC A;  1NK9 A;  4CHY A;  4H8K A;  1KTQ A;  4CIE A;  4KHW A;  3SNN A;  3PUF A;  2JLE A;  1WSJ A;  3ZSY A;  2RN2 A;  4GMJ B;  5CZ1 A;  4FLW A;  3NH2 A;  1SV5 A;  4DU4 A;  1NK4 A;  1TVR A;  4F3O A;  3TR8 A;  2A1R A;  4KHY A;  2IOC A;  4EP4 A;  5KRS A;  1HMV A;  3OJU A;  4M3Z A;  2BAN A;  4BWJ A;  1TK5 A;  3KJV A;  4YNQ A;  4DFK A;  4DFM A;  1BI4 B;  3HVT A;  2P5O A;  4FJM A;  3DLH A;  4QOZ B;  1RT1 A;  4HVJ A;  1CLQ A;  4N5S A;  1C0U A;  4CGI A;  1XC9 A;  1DTQ A;  3JYT A;  3TAR A;  1LW0 A;  4CJ5 A;  2DTU A;  1QSS A;  1C1C A;  1RBU A;  4CHQ A;  3P5J A;  2HND A;  4CGH A;  1B9F A;  3H08 A;  1NK7 A;  1QSL A;  4FLX A;  4M45 A;  1IKY A;  1HYS A;  2X6N A;  1IKV A;  1KLM A;  3NF7 A;  4DSF A;  1VSJ A;  2DY4 A;  3NGI A;  2X6S A;  4KTZ A;  1XHX A;  1NKB A;  3QER A;  2XY8 A;  4H4O A;  3AVB A;  3FFI A;  1MU2 A;  4OGE A;  3ZT0 A;  3LPU A;  2Z1J A;  1VRT A;  2OPP A;  1J54 A;  4M41 A;  4W5T A;  1D9F A;  2I5J A;  2HHT A;  4CER A;  3KK1 A;  1WSE A;  4DTU A;  4E7J A;  4QAG A;  1FXX A;  3TI0 A;  3E01 A;  4C8M A;  3WNE A;  4IBN A;  3L2U A;  3CM5 A;  3NAE A;  3TAM A;  3SI6 A;  3NGZ A;  3MEE A;  3T3F A;  3CFO A;  3BDP A;  3SCX A;  4CK1 A;  3LP0 A;  4CK3 A;  4OGC A;  1G15 A;  4B08 A;  3HT3 A;  1T03 A;  4FVM A;  4CF9 A;  4FM1 A;  1TKD A;  1UA0 A;  4OKK A;  3OS2 A;  3LP2 A;  4Z4F A;  3ZSV A;  4HUG A;  3S3M A;  2QK9 A;  2HW3 A;  4CJU A;  2AJQ A;  2ZQB A;  4Y1C A;  1U45 A;  1VSM A;  2FBT A;  1L3U A;  4KFB A;  4RW6 A;  2D0C A;  2KQ2 A;  2DFE A;  1JLB A;  3QIO A;  5HLF A;  3ALY A;  4N47 A;  3OYM A;  3KLG A;  1L3V A;  3IAY A;  4NCG A;  3AO2 A;  4J2A A;  3NH1 A;  3SV4 A;  1BIS A;  4OLB A;  3NDK A;  4ICL A;  5K14 A;  2HB5 A;  1WNS A;  4CF8 A;  1VSK A;  3TAB A;  2G8U A;  4WE1 A;  3PO5 A;  1TV6 A;  2YKN A;  4FW2 A;  1QTM A;  5J1E A;  4DSL A;  4FJL A;  1VRU A;  4CFD A;  1I3A A;  3RMD A;  1KVC A;  3OYB A;  1TAQ A;  4CES A;  2HHQ A;  4CFB A;  1JLG A;  2G8H A;  4MFB A;  1Q9X A;  1S1X A;  4C8L A;  1A5W A;  1RDB A;  3LWL A;  2XY5 A;  2IDO A;  3MED A;  3QEI A;  5SZT A;  4YFU A;  1C1A A;  3T19 A;  1SL1 A;  3AVC A;  1GOB A;  2YNG A;  2YNF A;  3K5N A;  4ZTJ A;  3M8R A;  1X9S A;  4CGG A;  1S1T A;  4O55 A;  1Z25 A;  3V81 A;  4C8N A;  1WSI A;  1YT3 A;  3F9K A;  4CJF A;  3MAQ A;  3I0S A;  4Z4H A;  3S3O A;  5HRP A;  4FLY A;  3DLG A;  4RW4 A;  1KRP A;  2PYL A;  1X9M A;  4B9S A;  4F2R A;  2QKB A;  2IC3 A;  2VWK A;  1ZBH A;  1BCM A;  1KFS A;  1HRH A;  2GUI A;  1YVU A;  3V9W A;  1XHZ A;  3NHG A;  2YNI A;  2HHX A;  4B9M A;  4CJE A;  4DFP A;  5KGW A;  1FKP A;  2OA8 A;  3KLI A;  2Z1G A;  3MEG A;  3L2Q A;  4FZX C;  4KB1 A;  4DU1 A;  1S6Q A;  4NYN A;  4B9T A;  1RBT A;  4KPY A;  4PUO A;  1ZBI A;  4PWD A;  4DQI A;  3F73 A;  4CFC A;  4LH4 A;  3S3N A;  3DRR A;  4KHN A;  3ZSX A;  4CF2 A;  4CEA A;  1NOZ A;  3G10 A;  3TAE A;  1O1W A;  1NJZ A;  3BGR A;  3OYH A;  1DLO A;  4DS4 A;  3KD5 E;  4HUF A;  4OVL A;  4JS5 A;  1TK0 A;  3RMA A;  2E6L A;  3LAN A;  3AVN A;  4DLE A;  4FLU A;  2P5G A;  1LAV A;  2EHG A;  4E1M A;  1L3T A;  2P51 A;  3NFA A;  3QIN A;  4JLH A;  1D8Y A;  3L2R A;  2X78 A;  2KW4 A;  3EZ5 A;  3SQ4 A;  4Z4G A;  1K6Y A;  1X1P A;  4Q0B A;  4PQU A;  4C8K A;  1TL1 A;  3KKR A;  3DRS A;  4UQG A;  3QET A;  3KK2 A;  3OYD A;  3ZSW A;  5FRM A;  1QHT A;  1ZBF A;  2RPI A;  3M8Q A;  5HBM A;  1ASU A;  1W9H A;  5FRO A;  4CGJ A;  4CHN A;  1T8E A;  2YKM A;  2YHB A;  5FRN A;  1S6P A;  4HCC A;  2GV9 A;  1FK9 A;  4E7K A;  4Z0U A;  3SUN A;  2FBV A;  2G8W A;  4FJG A;  2BGG A;  1IKW A;  4RW8 A;  4Z4C A;  1TKX A;  5J2M A;  3KIO A;  4DTR A;  2XY6 A;  3ZSR A;  1BI4 A;  1WN7 A;  1KVA A;  1JKH A;  4OKE A;  4DQQ A;  4B9L A;  4FK4 A;  4BE1 A;  2Z1I A;  5JS2 A;  3VQQ A;  3L2V A;  4FLV A;  5KGX A;  3VQB A;  1LWF A;  5HRN A;  3VA0 A;  3AO4 A;  5KI6 A;  3DLK A;  3ITH A;  4M3U A;  3QLH A;  3OYF A;  3DLB A;  3V1O A;  3HO1 A;  2OPR A;  4DMN A;  1IG9 A;  4ELT A;  3ZSQ A;  4ELU A;  1LW2 A;  4NCA A;  1B9D A;  3VQC A;  4CJL A;  4O0I A;  1I39 A;  1LV5 A;  1EKE A;  4JRQ A;  4C8O A;  3QNO A;  3CFR A;  2OZM A;  1REV A;  3SQ1 A;  1RCH A;  1RT6 A;  1L3S A;  3HYF A;  1NKE A;  4IDK A;  4ELV A;  3WNG A;  3LAM A;  1JL2 A;  1QS4 A;  1VSL A;  4B9N A;  4KI4 A;  1GOA A;  4HHT A;  4E0D A;  4E19 A;  3OS1 A;  3THV A;  1NJW A;  4CJP A;  3KLH A;  2E6M A;  3M8S A;  3OYE A;  1HNI A;  4DTJ A;  1RDA A;  1WAF A;  1RNH A;  3DOL A;  4JS4 A;  1S9G A;  3IS9 A;  1SL0 A;  3RRG A;  4Z4I A;  1VSE A;  1JLF A;  3WNF A;  4CEO A;  2D5R A;  4I9L A;  3QEW A;  3LP3 A;  5EU7 A;  4FM0 A;  1TK8 A;  4B9V A;  4HUE A;  1L5U A;  4KRE A;  3NE6 A;  4DTX A;  1RDC A;  1QE1 A;  4F3T A;  3C6T A;  3TAN A;  1FKO A;  2YHA A;  3MXI A;  2DFF A;  1B92 A;  3ASM A;  3DYA A;  4CF1 A;  5E41 A;  2E4L A;  3HPG A;  3SYZ A;  1RT5 A;  3K5L A;  4IKF A;  4KTQ A;  4JRP A;  4FJK A;  3AA5 X;  4FW1 A;  4J2E A;  4RW7 A;  1RT3 A;  2XRI A;  3QNN A;  3DOK A;  1TAU A;  3ULD A;  4FJX A;  3V9X A;  3HP6 A;  4DF4 A;  1NK5 A;  1TKT A;  1KCF A;  1ASV A;  3TAF A;  1LAW A;  4FJ5 A;  1A5V A;  4DQS A;  3QEV A;  2JGU A;  5I42 A;  4FJJ A;  4MQ3 A;  2YNH A;  3P1G A;  3RRH A;  4TSX A;  3LAK A;  4I2P A;  2XY7 A;  3KD1 E;  3QO9 A;  4KHS A;  4EP5 A;  1NK0 A;  3U6F A;  1IH7 A;  3I8D A;  4KHQ A;  3T1A A;  4CEQ A;  2Y1J A;  3M8P A;  4BE0 A;  2O4G A;  4CGF A;  4PY5 A;  4IFV A;  2BE2 A;  1RBS A;  4OJR A;  1BGX T;  1SL2 A;  4I9Q A;  5D3G A;  1S9E A;  4M3W A;  1NK8 A;  1BL3 A;  1S1V A;  1J9A A;  4DFJ A;  2VG7 A;  3KLE A;  4B3O A;  3HPH A;  4GW6 A;  2D0A A;  4DWI A;  1CZB A;  4CHZ A;  3K58 A;  3SZ2 A;  4AHR A;  3V1Q A;  1EX4 A;  3NGY A;  1KLN A;  3DRP A;  3ZT4 A;  3EY1 A;  4ZTF A;  1R0A A;  1U04 A;  3PX6 A;  1RBV A;  4E1N A;  1TL3 A;  1UAX A;  2GBZ A;  1NOY A;  2OPS A;  4CF0 A;  1J5O A;  2HNZ A;  3UIQ A;  4G1Q A;  3VA3 A;  4DSK A;  4KAZ A;  3LZI A;  3SPZ A;  4O4G A;  4M42 A;  5C42 A;  3OYL A;  4KTW A;  3NF6 A;  3AVA A;  3NH0 A;  3RMB A;  3VQ5 A;  2PZS A;  5CY4 A;  1EP4 A;  3SPY A;  3PX0 A;  1RT4 A;  4FLZ A;  5J2P A;  3QEX A;  1JXE A;  4DSI A;  1JLE A;  1U49 A;  3D45 A;  4K8X A;  5HP1 A;  1WSF A;  3TAP A;  4KO0 A;  2XHB A;  1SKW A;  4M3Y A;  3AO1 A;  1EXQ A;  3V6D A;  4KB0 A;  1HNV A;  3V4I A;  1S5J A;  5J2N A;  2ZE2 A;  4CED A;  4BDY A;  1TKZ A;  3TWH A;  2OPQ A;  3KKS A;  3MXJ A;  1BIU A;  3K5O A;  4W5O A;  3C6U A;  3HM9 A;  2RKI A;  3NF8 A;  3VQA A;  4W5N A;  1ASW A;  2P1J A;  1YTA A;  4CJQ A;  3QES A;  4NCB A;  1DTT A;  4O5B A;  4CHP A;  4OPK A;  1EET A;  4GVM A;  1QSY A;  3RR8 A;  3V9U A;  4CCH A;  4AIL C;  1HPZ A;  3HL8 A;  1XI1 A;  4FXD A;  3TAG A;  2G8I A;  3VQP A;  4DQR A;  4DSJ A;  1N6Q A;  3QIP A;  4E7H A;  3KTQ A;  3CYM A;  3WNH A;  2W42 A;  2NUB A;  3L3U A;  4OKJ A;  4AH9 A;  2BDP A;  1A5X A;  5CYQ A;  4FLT A;  3CM6 A;  1JXB A;  4DTS A;  2G8V A;  2OYQ A;  4HCB A;  3AVI A;  2Q3S A;  1KVB A;  3LAL A;  2WON A;  3HP9 A;  3VQ6 A;  1D5A A;  4IG0 A;  4CGD A;  4HTU A;  3ZCM A;  4CJW A;  3V9S A;  4AHT A;  3A2F A;  1RTI A;  3AA4 A;  3TAQ A;  4DU3 A;  5DK5 A;  1NK6 A;  1VSH A;  4DTM A;  4LD0 A;  4OLA A;  4BWM A;  1SKR A;  2KFZ A;  4M3X A;  1CXU A;  3P83 D;  1Z26 A;  2PYJ A;  3AVK A;  4AHC A;  3HK2 A;  5DMR A;  1RTH A;  2B5J A;  3DI6 A;  2HHS A;  4W5R A;  5SWM A;  1RDD A;  1RT2 A;  4N56 A;  3AV9 A;  4AHV A;  3B6P A;  3VQE A;  3LZJ A;  4CK2 A;  4N76 A;  2HHW A;  2KZZ A;  4CIF A;  4Q5V A;  2F96 A;  4IG3 A;  3S9H A;  4F4K A;  3RR7 A;  1WSH A;  1RBR A;  3NF9 A;  3VN5 A;  5CZ2 A;  4CEE A;  4FJ9 A;  3DM2 A;  3O4N A;  3VQ8 A;  1HQU A;  3AVM A;  1T05 A;  2FBY A;  3OYI A;  1BQM A;  3VQ9 A;  3O3G A;  4FM2 A;  2G8F A;  2IS3 A;  3RMC A;  4I2Q A;  4LY7 A;  2HHU A;  4FJH A;  3OYC A;  1KSP A;  2IAJ A;  4QCL A;  3IRX A;  1BIZ A;  1Q8I A;  1U47 A;  1NJY A;  4L8R B;  2EX3 A;  3LP1 A;  4OPJ A;  2KZM A;  4LSN A;  4B8C A;  4DG1 A;  3IG1 A;  3SV3 A;  4DS5 A;  1JL1 A;  4EZ6 A;  3AVF A;  4K8Z A;  1VSI A;  4E3S A;  4F2S A;  4BAC A;  4CEC A;  4F8R A;  2HVH A;  4R5P A;  4DF8 A;  3NCI A;  4CJV A;  3OYK A;  2DFH A;  3RTV A;  4FCY A;  3RWU A;  4CJ3 A;  1IKX A;  3SJJ A;  4BDP A;  1W0H A;  4CIG A;  3VQ4 A;  4FZZ A;  3PV8 A;  2QKK A;  3SQ0 A;  4N41 A;  4CJT A;  3AVJ A;  5KTQ A;  3AA3 A;  1J53 A;  1LWC A;  2ETJ A;  4DTO A;  3L3V A;  3HST B;  4AHS A;  3VQD A;  1C0T A;  2O4I A;  4H4M A;  3SQ2 A;  1HJR A;  4ID1 A;  1CZ9 A;  3CG7 A;  4IFY A;  5HRR A;  4XIU A;  3OY9 A;  3MEC A;  1Q9Y A;  4CEB A;  2HHV A;  3K2P A;  3DMJ A;  4CFA A;  3OYA A;  3EYZ A;  1JLQ A;  4CEF A;  2KTQ A;  2ZD1 A;  2LSN A;  2F8T A;  3MXM A;  4B9U A;  1YTU A;  1ZBU A;  1GOC A;  4CJ4 A;  5FDL A;  1IO2 A;  1BHL A;  3SUQ A;  4DLG A;  3ZSZ A;  5CYM A;  1VSD A;  3OYG A;  2ATQ A;  2B6A A;  3AA2 A;  4KV8 A;  1D9D A;  4KRF A;  1JLA A;  3NBP A;  4FK0 A;  4DQP A;  3LPT A;  3CQ8 A;  2HMI A;  3JSM A;  4J2D A;  3L2W A;  1HYZ A;  2F8S A;  1RTD A;  5C24 A;  4E7L A;  4AHU A;  3C95 A;  3OS0 A;  4CE9 A;  4BDZ A;  1VK0 A;  5C25 A;  4FJN A;  3PO4 A;  3SUP A;  4NYF A;  1X9W A;  3V1R A;  2X74 A;  3K5M A;  4B8A B;  4DTP A;  3O4Q A;  3LDS A;  3DLE A;  5JS1 A;  1BCO A;  1F21 A;  4PA1 A;  2PY5 A;  1S1U A;  2OZS A;  3HPO A;  4E7I A;  1NJX A;  2KFN A;  4J2B A;  3AVG A;  3K59 A;  3AO5 A;  3OJS A;  2VWJ A;  3KLF A;  1SKS A;  2QXF A;  4EZ9 A;  4BE2 A;  4FK2 A;  1TGO A;  1UA1 A;  2WOM A;  3C94 A;  3SUO A;  5HRO A;  4FJ7 A;  3VQ7 A;  1Y97 A;  1UOC A;  1SUQ A;  1WAJ A;  4O0J A;  3ZT2 A;  2FBX A; 
#chains in the Genus database with same CATH topology
 5ADX H;  4RG8 A;  3LWM A;  5BPN A;  3MK6 A;  5MLC Q;  1BQN A;  4M63 C;  4CJS A;  3OA9 A;  3QEP A;  2G8K A;  3C0B A;  4FJ8 A;  4ID5 A;  4FZY A;  3HVR A;  2HBJ A;  4CJR A;  4QS9 A;  3AVH A;  4CEZ A;  4YOY A;  1XMO K;  4LF5 K;  2E20 A;  4M3T A;  3KK3 A;  4BRA A;  1OKJ A;  1VSF A;  2J4R A;  3I0R A;  3O3F A;  4EAH D;  3B6O A;  4B1U B;  4DSE A;  4I7F A;  5EXW A;  4ZHR A;  4BRG A;  4FYD A;  1CXQ A;  2P9I B;  3U3Y A;  2VG6 A;  3J80 O;  4FJI A;  2P9S A;  1S1W A;  2ITG A;  1T7P A;  2YV0 X;  3K57 A;  3TU5 A;  3AVL A;  3FZL A;  3ULE A;  2RF2 A;  2ZM6 K;  2VWB A;  4H8K A;  4CD1 A;  3CCS N;  4JI8 K;  1SV5 A;  4DU4 A;  3IDH A;  1NK4 A;  1E4G T;  3AAP A;  3FR0 A;  2A1R A;  4KHY A;  4JKH A;  2QWN A;  4CZE A;  1VHX A;  1TK5 A;  4DFK A;  4JK7 A;  1BI4 B;  1QVF M;  2P5O A;  1RT1 A;  1GLE G;  4N5S A;  3RVC A;  3OHR A;  2DTU A;  3H08 A;  1NK7 A;  1QSL A;  4OX9 K;  3NF7 A;  5M1P A;  4B3S K;  3NGI A;  4JKB A;  4PKH A;  3ZT0 A;  4M41 A;  2FXU A;  3LPU A;  1J54 A;  4ILG B;  4W5T A;  3CCR N;  4DUY K;  5E26 A;  5FPM A;  4CER A;  1WSE A;  3EL2 A;  4QAG A;  3MX5 A;  4IBN A;  5AQP A;  4GKK K;  5GAH P;  4GV9 A;  4H5W A;  4CK3 A;  1G15 A;  1YF5 L;  4B08 A;  2QTD A;  4FVM A;  4FM1 A;  1UA0 A;  3OS2 A;  2QI2 A;  3ZSV A;  4CJU A;  2ZQB A;  4RW6 A;  1YVN A;  2KQ2 A;  2DFE A;  3QIO A;  4RCH A;  3ALY A;  4NCG A;  3NH1 A;  3E1Y A;  4ICL A;  5K14 A;  5B8H A;  2HB5 A;  1WNS A;  4LC9 B;  2YKN A;  1QTM A;  1VRU A;  3VTH A;  4YOV A;  1I3A A;  1KVC A;  1OVY A;  4B1Y B;  4CES A;  1JLG A;  2G8H A;  1GLB G;  3I33 A;  2YJF A;  2ZF5 O;  4A59 A;  3AVC A;  2YNF A;  3K5N A;  1JJ2 M;  3QML A;  3HZ6 A;  2FF6 A;  4CGG A;  4O55 A;  4C8N A;  5C10 A;  4K41 A;  1VQM N;  3S3O A;  5HRP A;  3DLG A;  2QKB A;  2VWK A;  1VQ5 N;  1BO5 O;  4O8K A;  3KHY A;  1HRH A;  2YNI A;  4B9M A;  2OA8 A;  3KLI A;  2Z1G A;  3MEG A;  4PUO A;  4FZX C;  4KB1 A;  4DR2 K;  4B9T A;  2CH6 A;  4KPY A;  5AQV A;  4KHN A;  4DV7 K;  1K8K B;  4BRM A;  3KD5 E;  3P38 A;  4OVL A;  1V4S A;  3RMA A;  2E6L A;  2P5G A;  4JLH A;  4Z4G A;  5KQD A;  1K6Y A;  4BC5 A;  4Z94 A;  3ZEU B;  4C8K A;  4AM6 A;  3KKR A;  2NRT A;  3OYD A;  3ZSW A;  1L3T A;  4CGJ A;  2YKM A;  1N36 K;  5FRN A;  2GV9 A;  4FJG A;  1IKW A;  4RW8 A;  1TKX A;  2V51 B;  1M1K O;  3VEX A;  3KIO A;  4BVO A;  1WN7 A;  4BE1 A;  1LWF A;  3VA0 A;  3FE1 A;  3DLK A;  4YOU A;  4JV5 K;  5AFU A;  3VEO A;  3HO1 A;  2OPR A;  1IG9 A;  4JKG B;  2P9L A;  1LW2 A;  5F0X A;  4BY9 C;  1I39 A;  4CZK A;  4JRQ A;  3QNO A;  3CFR A;  2OZM A;  1REV A;  1RT6 A;  3FZK A;  1QS4 A;  1VSL A;  2QM1 A;  4HHT A;  1HNI A;  3DOL A;  4YHH K;  4JS4 A;  3OBY A;  5JLF A;  1VSE A;  5EOY A;  4V19 S;  2NRH A;  4CEO A;  2D5R A;  4I9L A;  3LP3 A;  5GIP A;  4B9V A;  3SAH A;  1M90 O;  3H46 O;  3MXI A;  2DFF A;  1B92 A;  3O9S A;  4NXM K;  3HPG A;  1RT5 A;  4IKF A;  3O9Q A;  2A41 A;  2HBK A;  3T1Y K;  1MWK A;  2F9W A;  3ENH A;  2O8C B;  1GLA G;  3TSQ A;  1ASV A;  3TAF A;  4X65 K;  2YNH A;  3EZW A;  4DR7 K;  4IEE A;  4I2P A;  3HTV A;  1HKC A;  4H0P A;  3M8P A;  4CGF A;  5GAE P;  4IFV A;  1RBS A;  1SL2 A;  5D3G A;  1S9E A;  5DM6 L;  4B3O A;  4GW6 A;  1SZ2 A;  5TKW A;  4CHZ A;  1JCE A;  3BP8 A;  3SZ2 A;  3V1Q A;  1KLN A;  3ZT4 A;  1QQM A;  4NLC A;  3PX6 A;  1RBV A;  5M1O A;  4LF4 K;  2GBZ A;  3J7Z O;  1NOY A;  1OVQ A;  3PIO L;  5AZJ A;  2OPS A;  4DR3 K;  4DSK A;  3EKU A;  4M42 A;  3SPZ A;  3SMS A;  3AVA A;  1RDW X;  3HOS A;  5CY4 A;  3O9R A;  4A57 A;  3PX0 A;  3IUC A;  4DSI A;  1U49 A;  4K8X A;  3UKU A;  3O1W A;  3TAP A;  4M3Y A;  3AO1 A;  3V6D A;  1HNV A;  4KH4 A;  1E3M A;  3CJB A;  4BDY A;  2OPQ A;  3MXJ A;  3HM9 A;  3VQA A;  1ASW A;  2FSK A;  5GAG P;  4O5B A;  1GLD G;  4CHP A;  1EET A;  4H0X B;  1QSY A;  3KVG A;  4CCH A;  4AIL C;  3DXM B;  2PFU A;  3TAG A;  2G8I A;  4DSJ A;  4BRQ A;  3F9M A;  3CYM A;  3WNH A;  4OKJ A;  2BDP A;  1A5X A;  4KHW A;  2IVN A;  3VTI A;  3LAL A;  4DCH A;  2D4W A;  3LDO A;  4HTU A;  4FWP A;  3R6M A;  3WQU A;  1RTI A;  3TAQ A;  1NK6 A;  1VSH A;  4LD0 A;  2RE2 A;  1SKR A;  1NBW A;  1CXU A;  5AQR A;  4M3X A;  4EIA A;  2AP1 A;  3CXC M;  3DI6 A;  4JK8 A;  5SWM A;  1RT2 A;  3EEQ A;  3AV9 A;  2HHW A;  4CK2 A;  3O4W A;  4CIF A;  3S9H A;  3RR7 A;  3NF9 A;  2IVP A;  5CZ2 A;  3DM2 A;  1HQU A;  4FM2 A;  2O8E B;  1MDU B;  4I2Q A;  4DR6 K;  3D2F A;  4WQ5 C;  3UE5 A;  3HBT A;  4L8R B;  2EX3 A;  3H45 C;  2QA4 N;  4LSN A;  4B8C A;  5AQW A;  3SV3 A;  4DS5 A;  1JL1 A;  2A5X A;  3AVF A;  3VGK A;  1VSI A;  4K8Z A;  3M6G A;  3NCI A;  4XEI A;  4CJ3 A;  1HNW K;  4BDP A;  3N4Q A;  3LDN A;  3OBW A;  4BR0 A;  3H3O B;  3L6Q A;  5KTQ A;  4JI7 K;  4CVN E;  4DTO A;  3L3V A;  2O4I A;  1HJR A;  3OY9 A;  1GLL O;  1QQO A;  3OYA A;  1HNZ K;  4CEF A;  1ATN A;  2ZD1 A;  3CET A;  4B9U A;  1VQL N;  1ZBU A;  3VGL A;  4DV1 K;  3UKR A;  5AQS A;  2QWO A;  1OH5 A;  4YOT A;  4DLG A;  5CYM A;  3NBP A;  3LPT A;  4J2D A;  1EO1 A;  1RTD A;  4UY8 O;  4A62 A;  4AHU A;  1NGH A;  4CE9 A;  5F2R A;  4AF1 A;  5KQ8 A;  1X9W A;  1BU6 O;  3O4Q A;  5AQZ A;  5JS1 A;  1BCO A;  1F21 A;  3KWG A;  2KFN A;  2Q1N A;  3AO5 A;  3OJS A;  4DV4 K;  2QXF A;  4JAX A;  4FK2 A;  2Q31 A;  1C0F A;  3SUO A;  1UOC A;  4WFA L;  3C6H A;  1WAJ A;  3P5J A;  2YI1 A;  4U67 L;  3OYJ A;  2IGI A;  3K9K A;  5I3U A;  3GBT A;  2E2Q A;  3LM2 A;  4M3R A;  3O6W A;  4W5Q A;  1YHQ N;  4KH6 A;  2A1S A;  3F5T A;  5AR0 A;  4LF7 K;  2O8D A;  3ZX3 A;  5ADX A;  1HYV A;  4LSL A;  3OVN A;  2NRZ A;  3LM9 A;  2W41 A;  5KRT A;  2Q0U A;  3O08 A;  1HQE A;  1X3N A;  2XO7 A;  4IDH A;  4CHO A;  1BOT O;  3HXM A;  2VG5 A;  4KI6 A;  4NB4 A;  4U7B A;  1Q81 O;  4Y1D A;  2PAV A;  4LF8 K;  1N5Y A;  2D0B A;  3PLA A;  3M1F A;  3DLR A;  1RIL A;  1U4B A;  1KFD A;  3PY8 A;  2B4J A;  5AQJ A;  3CCQ N;  1UWB A;  3LDP A;  3FGU A;  3U9Z A;  2E2P A;  1NKC A;  1NK9 A;  3PUF A;  2JLE A;  3H6E A;  4GMJ B;  4JI1 K;  3LL3 A;  4F3O A;  3TR8 A;  2IOC A;  1QQN A;  5KRS A;  1HMV A;  3OJU A;  2P9K B;  4BWJ A;  2ITM A;  1Q86 O;  1OH8 A;  5AQN A;  4Y0W A;  4CJ7 A;  4FJM A;  2OTL N;  4QOZ B;  1IJJ A;  2GWJ A;  1C0U A;  1DTQ A;  3JYT A;  3TAR A;  4CJ5 A;  1C1C A;  4CHQ A;  3J7A P;  2HND A;  1YIT N;  1Z05 A;  3DJC A;  1HYS A;  1YXQ A;  1VQN N;  1VSJ A;  4KTZ A;  1XHX A;  5CR4 A;  4ILH A;  4H4O A;  3AVB A;  3FFI A;  4OGE A;  1D9F A;  4MLH A;  4FPB A;  3SAG A;  2HHT A;  3KK1 A;  4C8M A;  1VQK N;  2UUB K;  3NAE A;  3WQT A;  3CFO A;  3BDP A;  1VQ8 N;  4CK1 A;  3WXK A;  5BRF A;  3HT3 A;  3LP2 A;  4HUG A;  2HW3 A;  2AJQ A;  4KFB A;  2D0C A;  4J2A A;  4N47 A;  3ID8 A;  4GVE A;  2CGK A;  4CZF A;  3Q7C A;  3A5M C;  1Q7Y O;  3T7Z A;  1TUY A;  4CI6 A;  4FW2 A;  4DV2 K;  4CFD A;  1VQ6 N;  2IVO A;  2HHQ A;  4MFB A;  1Q9X A;  1H1V A;  4PHT X;  4C8L A;  1A5W A;  4FWL A;  2IDO A;  5BPL A;  3QEI A;  1C1A A;  4ILJ A;  4MDA A;  3T19 A;  5AZI B;  4ZTJ A;  3M8R A;  1X9S A;  1Z25 A;  3V81 A;  3MAQ A;  3FLC O;  4FLY A;  2PYL A;  3HOT A;  3VF2 A;  1HUX A;  1ZBH A;  5AQX A;  1BCM A;  1KFS A;  1YVU A;  2HHX A;  1XHZ A;  3NHG A;  1HX1 A;  4ISG A;  2F4V K;  4DFP A;  3FZH A;  3JS6 A;  4DU1 A;  3O9U A;  4CFC A;  4PL7 A;  3CER A;  4JKF A;  4CEA A;  3TAE A;  2P9P B;  4F9O A;  3OYH A;  1DLO A;  4FL9 A;  5EVZ A;  3CPE A;  4JS5 A;  3LAN A;  4OO1 J;  3CCJ N;  4E1M A;  3NVM A;  2P51 A;  3NFA A;  4BR7 A;  3QIN A;  3BZK A;  3EZ5 A;  2F7T A;  1VQ7 N;  3MN9 A;  2P9U B;  4PQU A;  1U2V B;  3DRS A;  5JVH L;  3KK2 A;  1ASU A;  2YHB A;  1S6P A;  2HBL A;  4HCC A;  2QXL A;  4Z0U A;  1DEJ A;  1X3M A;  4FO0 A;  2BGG A;  1WBD A;  4KHP K;  5JVG L;  4DTR A;  2XY6 A;  3ZSR A;  2ZJP L;  3C6A A;  4DQQ A;  4JI4 K;  3PSF A;  3AO4 A;  1WOQ A;  3ITH A;  4M3U A;  5F1X A;  3QLH A;  4ELT A;  4NCA A;  3L4Q A;  4ISF A;  4CJL A;  1EKE A;  3H1V X;  2VYP A;  1RCH A;  1L3S A;  1NKE A;  4IDK A;  3VF4 A;  1OH6 A;  3F2K A;  4CW7 B;  3VF6 A;  1TUU A;  2GX9 A;  3KLH A;  2E6M A;  3WEE B;  3M8S A;  2OAN A;  1RNH A;  1SL0 A;  4Z4I A;  3DLL L;  1JLF A;  3WNF A;  2GEM A;  3I56 N;  5EU7 A;  4HUE A;  1L5U A;  3MMV A;  4DTX A;  4IOX A;  3C6T A;  3CME N;  3RSE B;  3ASM A;  1NGB A;  4IXC A;  2GTD A;  3DYA A;  2A3Z A;  3QFP A;  3ZX2 A;  4KTQ A;  1V4T A;  3CD6 N;  4J2E A;  1RT3 A;  5AQG A;  3DOK A;  4JI5 K;  3H3N O;  3ULD A;  4FJX A;  3V9X A;  4DF4 A;  5AQQ A;  1VQ4 N;  4YY3 K;  3VEV A;  3QBW A;  4WQ4 A;  3ZX0 A;  2JGU A;  5I42 A;  4MQ3 A;  4R79 A;  5C15 A;  3ZYY X;  4JHD B;  2RHK A;  4KHS A;  3QO9 A;  3WXI A;  4EP5 A;  2FSJ A;  1VQP N;  1HR0 K;  3U6F A;  3I8D A;  1VQ9 N;  4PKG A;  1I94 K;  4OJR A;  1BGX T;  4I9Q A;  1XMQ K;  3AY9 A;  1NK8 A;  1J9A A;  4DFJ A;  1NGF A;  4BRO A;  3N4P A;  5JLH A;  2QEX N;  2D0A A;  2FSN A;  1CZB A;  3K58 A;  1BA0 A;  1KC8 O;  4H5V A;  1HPM A;  1EX4 A;  4ZTF A;  3EY1 A;  1R0A A;  1U04 A;  1TL3 A;  4A2A A;  4DQ8 A;  2EWS A;  3SMP A;  1J5O A;  4KAZ A;  3LZI A;  4O4G A;  5C42 A;  3OYL A;  2WUS A;  3NF6 A;  3RMB A;  3ID6 A;  5EY4 A;  1RT4 A;  3MCP A;  1JXE A;  3CCM N;  1JLE A;  2IIR A;  3D45 A;  2E88 A;  1WSF A;  4JI3 K;  2XHB A;  3TSP A;  1QZ5 A;  1SKW A;  5BN8 A;  3V4I A;  4QS8 A;  4C1N K;  3TWH A;  3DXM A;  3C6U A;  2RKI A;  3NF8 A;  4W5N A;  2P1J A;  4CJQ A;  1YTA A;  1DTT A;  4OPK A;  4GVM A;  3AGR A;  1XI1 A;  4FXD A;  2O8B A;  1N6Q A;  2CH5 A;  3KTQ A;  1FJG K;  4X64 K;  2W42 A;  2O8F A;  1Q82 O;  4FLT A;  1J6Z A;  4DTS A;  4HCB A;  1JXB A;  3AVI A;  1KVB A;  2Q3S A;  2JWL A;  4IG0 A;  4CGD A;  3E9L A;  4CZH A;  3A2F A;  2NRV A;  1ILY A;  3P4I A;  4DTM A;  4OLA A;  4KBO A;  3AVK A;  3ZET A;  3QBX A;  4AHC A;  3HK2 A;  5DMR A;  2B5J A;  2P9S B;  2HHS A;  3VES A;  3A8Y A;  3ULE B;  4BRN A;  1BUP A;  4Q5V A;  1RBR A;  2FLO A;  5JIC A;  4CEE A;  4FJ9 A;  4JN4 A;  3OYI A;  2G8F A;  1RDU A;  3RMC A;  2W6L A;  3VMF B;  2D1K A;  2HHU A;  5HOO A;  1KSP A;  2IAJ A;  1BIZ A;  1Q8I A;  2V7Y A;  3D7E O;  1U47 A;  1W7A A;  3IG1 A;  1EQY A;  5LJV A;  4E3S A;  4CEC A;  3CJ1 A;  1HLU A;  1WB9 A;  3RTV A;  4FCY A;  3CF5 L;  2A42 A;  1QVG M;  5LMN K;  3SAF A;  3VQ4 A;  4CZJ A;  4FWR A;  3SQ0 A;  3VEZ A;  3HST B;  1C0T A;  4B3T K;  4RTF D;  4IFY A;  1CZ9 A;  3O80 A;  4IJN A;  4CEB A;  4LFA K;  3A5N C;  3DMJ A;  3CJ7 A;  2F8T A;  3MXM A;  2E8A A;  5FDL A;  1BHL A;  3SUQ A;  3C7N B;  4EFH A;  3OYG A;  4KRF A;  5M1N A;  1JLA A;  3THW B;  3FZF A;  2HMI A;  2F8S A;  3J8A A;  4BDZ A;  5C25 A;  4B9Q A;  2UXC K;  4CBW A;  3HPO A;  4E7I A;  1WUA A;  4K0K K;  4FWO A;  1BDG A;  4AM7 A;  2VWJ A;  3TPQ A;  1DGK N;  4EZ9 A;  4WCE L;  1TGO A;  1UA1 A;  2WOM A;  2DPN A;  3CJA A;  4W5R A;  3ZT2 A;  4FJ5 A;  5HRS A;  4H0Y B;  1XWL A;  1BA1 A;  4CJK A;  1C6V A;  1U48 A;  1ITG A;  4RW9 A;  3KK7 A;  4A5A A;  1WLJ A;  2NRR A;  1ZBL A;  4Z4E A;  5IWA K;  1LWE A;  2Z1H A;  1IG8 A;  4BGA A;  3DXK A;  3CQX A;  1C1B A;  3AO3 A;  4J8F A;  2F9T A;  3V9Z A;  1NMN A;  4YDU A;  3OYN A;  3HJF A;  3I8B A;  1ZYQ A;  3L8B A;  2FC0 A;  4WF9 L;  1MA9 B;  2HNY A;  1FW6 A;  5EX5 A;  5AFU H;  1C0M A;  1QQC A;  1KTQ A;  1T6D A;  3SNN A;  3ZSY A;  1WSJ A;  5CZ1 A;  3NH2 A;  1EWR A;  1TVR A;  1Y64 A;  4M3Z A;  2BAN A;  1NU0 A;  3DLH A;  4HVJ A;  4MLE A;  4BRP A;  1CLQ A;  4CGI A;  5JMV A;  1XC9 A;  2QWM A;  4CGH A;  4FLX A;  2P9L B;  2X6N A;  1IKV A;  4A61 A;  4DSF A;  5C2D A;  3TTC A;  4IO8 A;  5LMU K;  1NKB A;  2VGM A;  3THY A;  1MU2 A;  1K9M O;  2GEL A;  2Z1J A;  3G4S N;  2OPP A;  2KKZ A;  4X66 K;  5FPE A;  4E7J A;  3L2U A;  3ZLJ A;  3BY5 A;  3D2E B;  1DKG D;  3LP0 A;  3ATU A;  4CF9 A;  2NRW A;  4OKK A;  4Z4F A;  3AGK A;  4FSV A;  1L3U A;  1VSM A;  2FBT A;  5ELZ A;  1S22 A;  5HLF A;  5E84 A;  3KLG A;  3AO2 A;  1BIS A;  4OLB A;  4OPH A;  3MN5 A;  5C2F A;  2GUP A;  2NZT A;  3R1X A;  1TV6 A;  4DSL A;  5J1E A;  4FJL A;  3BF1 A;  3RMD A;  3OYB A;  1TAQ A;  1XNR K;  3THX B;  2KLA A;  5AJ3 K;  1KQS M;  4MO4 A;  1SS6 A;  1IBM K;  3LWL A;  4IFE A;  2XY5 A;  5SZT A;  4CBX A;  2Q0R A;  3GDQ A;  4A5B A;  4OPA A;  1XQS C;  1S1T A;  1KXP A;  4H5T A;  5AQI A;  2E1Y A;  1OH7 A;  3LDL A;  3MCA B;  1YT3 A;  4H5R A;  3F9K A;  3I0S A;  5AQU A;  4F2R A;  3W3D A;  4BRF A;  5KPR A;  1NWK A;  2GUI A;  3WXL A;  1FKP A;  3G25 A;  3CI5 A;  1RBT A;  4DV5 K;  3A0I X;  3S3N A;  3DRR A;  2OTJ N;  2UXB K;  3G10 A;  4JI6 K;  3BUZ B;  4GV6 A;  4HUF A;  1X9J A;  2P9I A;  3O5B A;  1TK0 A;  1JCG A;  1HKB A;  3AVN A;  5GIN A;  1U2V A;  2W40 A;  4FLU A;  3NMU A;  1LAV A;  3VEY A;  2UYT A;  2ZWH A;  2EHG A;  4BRL A;  2AA4 A;  2KW4 A;  4B3M K;  1ZXO A;  2ZJQ L;  1IBL K;  1TL1 A;  1NGI A;  3QET A;  3L0Q A;  4H5N A;  4XH5 A;  3M8Q A;  2CGL A;  4CHN A;  1T8E A;  4BRI A;  3HRG A;  4IWV A;  5KPZ A;  4E7K A;  5AQH A;  2FBV A;  2G8W A;  4BRC A;  2CGJ A;  4Z4C A;  2QWQ A;  4CBU A;  3CJC A;  1BI4 A;  4BQL A;  1KVA A;  1JKH A;  4OKE A;  4JEP A;  3VEN A;  4B9L A;  4FK4 A;  2Z1I A;  5JS2 A;  3L2V A;  5KGX A;  3VQB A;  5HRN A;  5KI6 A;  4CZI A;  3QB0 A;  3CC2 N;  1B9D A;  3VGM A;  1D4X A;  1LOT B;  1LV5 A;  1NGC A;  5BRH A;  4JNE A;  3SBG A;  1W97 L;  4ELV A;  3LAM A;  1JL2 A;  2A40 A;  1GOA A;  3BF3 A;  4LF6 K;  5M1K A;  3CMA N;  3THV A;  1NJW A;  2V52 B;  1QHA A;  1WAF A;  2UU9 K;  1S9G A;  3IS9 A;  3RRG A;  1GLC G;  2NNW A;  1NGD A;  4BGB A;  5AQM A;  4KRE A;  1LCU A;  3TSU A;  3NE6 A;  2I7N A;  1RDC A;  4QS7 A;  4F3T A;  3TAN A;  1XUP O;  4O8U A;  2E5L K;  5E41 A;  3SYZ A;  3BEX A;  5BRD A;  4FJK A;  4FW1 A;  3GOI A;  1XNQ K;  2BH1 A;  3D2F B;  1TAU A;  1YJN N;  3HP6 A;  3M3Z A;  1TKT A;  3AAQ A;  1KCF A;  2YHX A;  4JI2 K;  4JHD A;  1YAG A;  3VET A;  1A5V A;  2HMP A;  3S41 A;  3QEV A;  4BRH A;  5LJW A;  3P1G A;  3RRH A;  4TSX A;  3LAK A;  4JD2 B;  2XY7 A;  3U9D A;  4EHU A;  1IH7 A;  3KWI A;  3GG4 A;  4CEQ A;  2Y1J A;  1BWF O;  3U8X A;  4BRE A;  4BE0 A;  2BE2 A;  1G99 A;  1BL3 A;  1S1V A;  3DAW A;  2VG7 A;  4I6M B;  3ATV A;  3HSC A;  3SK3 A;  4DV6 K;  1HJO A;  3I55 N;  3NGY A;  3UKR B;  3DRP A;  5DM7 L;  4M7Y A;  1ZBS A;  4E1N A;  1MWM A;  1R59 O;  1K8K A;  4CF0 A;  1K8A O;  2HNZ A;  3UIQ A;  1O13 A;  3VA3 A;  3NH0 A;  3VQ5 A;  2PZS A;  3SPY A;  1YIJ N;  5J2P A;  3QEX A;  4FWK A;  1RFQ A;  3EO3 A;  3ZEU A;  5HP1 A;  4KO0 A;  4FOI A;  4E1J A;  4X62 K;  1N32 K;  1GLF O;  1TYQ B;  4CED A;  1NGJ A;  1NMD A;  3R9P A;  1S72 N;  3KKS A;  4YDU C;  1BIU A;  3K5O A;  4W5O A;  4NCB A;  1SQK A;  2FF3 B;  3WXM B;  3HI0 A;  1KAX A;  1ZC6 A;  3V9U A;  1RGI A;  3QDK A;  3VQP A;  3QIP A;  4E7H A;  2O8D B;  1T44 A;  4AH9 A;  2QWR A;  4JKG A;  5CYQ A;  2OYQ A;  2G8V A;  3VQ6 A;  4K43 A;  1D5A A;  2VQF K;  4CJW A;  3V9S A;  3A5O C;  4AHT A;  3JAM O;  3AA4 A;  3J7Y P;  4DU3 A;  4BWM A;  2ZGY A;  2KFZ A;  3P83 D;  2PYJ A;  1RTH A;  1EWQ A;  1NNE A;  1RDD A;  3QIC A;  1IV0 A;  3O8M A;  3LZJ A;  4N76 A;  2KZZ A;  4KH5 A;  1WBB A;  3U4L A;  2P9N B;  4IG3 A;  5FPN A;  1DT9 A;  4DR5 K;  3FFK B;  4F4K A;  4K42 A;  3VN5 A;  3C65 A;  4DV3 K;  3O4N A;  3VQ8 A;  3AVM A;  2Q2R A;  1QZ6 A;  4XH1 A;  2H3G X;  4CZM A;  4CD3 A;  3EKS A;  4LY7 A;  2ZJR L;  5BRE A;  3OYC A;  4QCL A;  3IRX A;  5C0Y A;  2O8C A;  3LP1 A;  4OPJ A;  2ASM A;  3JXU A;  5AQO A;  4DG1 A;  4JKE A;  5KPT A;  4EZ6 A;  3D6R A;  4BAC A;  4F8R A;  2HVH A;  4AQY K;  3TTD A;  1N34 K;  3RWU A;  3H1Q A;  2WFB A;  3EE9 A;  3NVK A;  4BRD A;  3SJJ A;  1W0H A;  4CIG A;  4DB3 A;  3PV8 A;  2QKK A;  4CJT A;  3AVJ A;  4WQ5 A;  3AA3 A;  1LWC A;  2ETJ A;  3MX2 A;  2E2O A;  4BC4 A;  3GE1 A;  5AQL A;  3VEW A;  3C7N A;  1YI2 N;  1Q9Y A;  3MEC A;  5A2Q O;  4BR2 A;  3THW A;  2HHV A;  3K2P A;  2LSN A;  1GOC A;  4CJ4 A;  2UUC K;  1IO2 A;  3ZSZ A;  4PKI A;  4M7X A;  1NLV A;  2B6A A;  2YX6 A;  4H0T B;  2A6A A;  3VER A;  4DQP A;  4FOE A;  3L2W A;  1HYZ A;  5C24 A;  4E7L A;  3MWP A;  3C95 A;  3OS0 A;  4FJN A;  3HM8 A;  4NYF A;  2PBD A;  1HKG A;  4DTP A;  3LDS A;  5H1S Q;  4PA1 A;  1ATS A;  1S1U A;  2OZS A;  1NJX A;  3E66 A;  3K59 A;  3IMX A;  1SKS A;  5IT9 O;  4G9Z A;  4BE2 A;  3CHW A;  1T6C A;  4FJ7 A;  5HRO A;  3VQ7 A;  1Y97 A;  3TTF A;  4IOA L;  5I9E B;  2FBX A;  3O3H A;  2Y1I A;  1P8Z A;  2E2N A;  3ZT1 A;  2R7Y A;  5T7B A;  1ATR A;  1RT7 A;  2W6K A;  5J2Q A;  4CZG A;  1U6Z A;  3PX4 A;  4FVU A;  3ISN C;  3D0P A;  1NGG A;  3CFP A;  3GL1 A;  1YJ9 N;  2KHO A;  2YHW A;  3LDQ A;  1CZA N;  1RTJ A;  3ZSO A;  1JLC A;  5FPD A;  1KAY A;  3G0Z A;  3ZT3 A;  4LH5 A;  5HL7 L;  4DTN A;  1WSG A;  3WXJ A;  2HHH K;  3U3G A;  2HVI A;  1N8R O;  4E89 A;  4KHU A;  4O44 A;  4KKO A;  4CHY A;  4CIE A;  2HST A;  5LL6 Z;  4FLW A;  2RN2 A;  3O1B A;  2O8E A;  4EP4 A;  2QWP A;  3DWL A;  4DR4 K;  4K25 A;  3KJV A;  3T69 A;  4YNQ A;  4DFM A;  4GNI A;  5GAD P;  3HVT A;  3E9P A;  3IFR A;  1NM1 A;  3VOV A;  3G6E N;  2YHY A;  3AAR A;  1LW0 A;  1P90 A;  1QSS A;  1RBU A;  1B9F A;  3ENO A;  2UXD K;  4M45 A;  1IKY A;  1KLM A;  2DY4 A;  2X6S A;  3QER A;  2XY8 A;  4BC2 A;  3D2E A;  1VRT A;  2I5J A;  1C0G A;  4DTU A;  5FLX O;  4L3Q A;  1FXX A;  1E4F T;  3E01 A;  3TI0 A;  3WNE A;  3CM5 A;  3FZM A;  3TAM A;  3SI6 A;  3NGZ A;  3MEE A;  3T3F A;  5M1F A;  3SCX A;  4B1V A;  4IEI A;  4OGC A;  3R3L A;  5BR9 A;  1T03 A;  1TKD A;  3A5L C;  2QK9 A;  4WFB L;  4RWT A;  3S3M A;  4GV3 A;  4Y1C A;  1U45 A;  3CCV N;  4FPA A;  5TKY A;  1JLB A;  3PIP L;  1L3V A;  3OYM A;  2KZM A;  3IAY A;  4DKW A;  3SV4 A;  3CIP A;  4BR9 A;  3NDK A;  4C1N I;  4FWQ A;  3THX A;  4CF8 A;  5M1Q A;  1VSK A;  3TAB A;  2G8U A;  4WE1 A;  3PO5 A;  2QWL A;  3SJH A;  4HTL A;  2VGN A;  4BRK A;  4CFB A;  4B3R K;  1S1X A;  1RDB A;  4MO5 A;  3MED A;  4YFU A;  2BTF A;  1SL1 A;  1GOB A;  2YNG A;  2ASO A;  3EN9 A;  1WSI A;  4CJF A;  4Z4H A;  4B9S A;  4JI0 K;  4RW4 A;  1KRP A;  1X9M A;  2IC3 A;  4DUZ K;  4LFB K;  2ZGZ A;  3V9W A;  4CJE A;  5KGW A;  3WT0 A;  5BR8 K;  2JWK A;  3L2Q A;  1S6Q A;  4NYN A;  4A2B A;  1ZBI A;  4XH4 A;  4PWD A;  4DQI A;  3F73 A;  4LH4 A;  3CC7 N;  3ZSX A;  4CF2 A;  4NO7 A;  1NOZ A;  3VPZ A;  1NJZ A;  1O1W A;  3BGR A;  4DS4 A;  1YUW A;  2HBM A;  5BPM A;  4DLE A;  3MDQ A;  5BN9 A;  4DV0 K;  1D8Y A;  3L2R A;  2X78 A;  3SQ4 A;  1X1P A;  4Q0B A;  1W2B M;  4UQG A;  4JKD A;  5FRM A;  1QHT A;  1ZBF A;  2RPI A;  5HBM A;  5FRO A;  1W9H A;  4C23 A;  1FK9 A;  2HF4 A;  3SUN A;  2P9K A;  4YOX A;  3M5R A;  5J2M A;  2V7Z A;  4BG8 A;  5AQK A;  4MDB A;  5LY3 A;  1XC3 A;  2HOE A;  3VQQ A;  4FLV A;  4GKJ K;  2O8B B;  5GIO A;  2WBN A;  3IKM A;  3B8A X;  3OYF A;  3DLB A;  3P39 A;  3V1O A;  1J5E K;  2O8F B;  4DMN A;  2VCP A;  4ELU A;  3ZSQ A;  3VQC A;  4O0I A;  3OW2 M;  4C8O A;  3SQ1 A;  3HYF A;  3WNG A;  5CE3 A;  4BQZ A;  4B9N A;  3ZET B;  4KI4 A;  4E0D A;  3OS1 A;  4CJP A;  1IBK K;  3OYE A;  4DTJ A;  1RDA A;  3QEW A;  1TK8 A;  4FM0 A;  4WQ4 C;  4DHY A;  1QE1 A;  2OCE A;  1FKO A;  2HF3 A;  2YHA A;  4FWM A;  4CF1 A;  2E4L A;  3Q7B A;  3K5L A;  3SBT A;  4JRP A;  3AA5 X;  4WYB A;  4RW7 A;  3CPW M;  2XRI A;  3QNN A;  1NK5 A;  4DR1 K;  3P31 A;  4O5F A;  1GLJ O;  4JD2 A;  4CZL A;  1LAW A;  4DQS A;  4FJJ A;  5AQT A;  1JCF A;  1S3X A;  1HNX K;  3KD1 E;  5AZI A;  1NK0 A;  3CQY A;  4I6M A;  4KHQ A;  3T1A A;  2YCH A;  4PY5 A;  2O4G A;  2D0O A;  2NRX A;  1KD1 O;  4M3W A;  3MWT A;  3KLE A;  3CJ9 A;  4YOW A;  3HPH A;  4B1X B;  4DWI A;  2I7P A;  2YJE A;  3CCU N;  4AHR A;  3SLC A;  3OTO K;  4GY2 B;  3EE8 A;  1UAX A;  2P9P A;  1SAZ A;  4ISE A;  4G1Q A;  4KTW A;  3E9O A;  4H03 B;  2GWK A;  1EP4 A;  1TYQ A;  4YOR A;  5AZJ B;  4FLZ A;  4IOC L;  2P9U A;  2VQE K;  3MN7 A;  1ESV A;  4NLB A;  1EXQ A;  4KB0 A;  4EHT A;  1S5J A;  5J2N A;  2ZE2 A;  1TKZ A;  3UKU B;  4JKA A;  3QES A;  2Q97 A;  2WC9 A;  1YJW N;  3RR8 A;  1HPZ A;  3HL8 A;  4DQR A;  2NUB A;  3L3U A;  4LFC K;  1N33 K;  2BUP A;  3CM6 A;  3O9T A;  4NXN K;  4B1Z A;  1BG3 A;  3K9J A;  2WON A;  3HP9 A;  3ZCM A;  3ENB A;  3L4I A;  5DK5 A;  4B1W B;  3DXK B;  1Z26 A;  2WTU A;  1VAZ A;  3CCL N;  2D0P A;  1NGE A;  3MN6 A;  3WEE A;  2P9N A;  3CCE N;  1NGA A;  3W0L A;  4BR4 A;  4N56 A;  4AHV A;  3B6P A;  3VQE A;  2UUA K;  3KZB A;  4LF9 K;  2F96 A;  1WSH A;  4FWN A;  3RSE A;  1Z6R A;  5AQY A;  1T05 A;  2NLX A;  2FBY A;  1BQM A;  3VQ9 A;  4WFN L;  3O3G A;  4IO9 L;  2IS3 A;  3BZC A;  4FJH A;  3R8E A;  3G71 N;  1NJY A;  5CHI A;  5AQF A;  3PSI A;  4F2S A;  4R5P A;  4DF8 A;  4JYA K;  4CJV A;  3OYK A;  2DFH A;  1KAZ A;  1IKX A;  2QW9 A;  3THY B;  4JK9 A;  4HWI A;  2Q36 A;  4FZZ A;  4N41 A;  1K73 O;  1J53 A;  4AHS A;  3VQD A;  4H4M A;  5C12 A;  3SQ2 A;  1T3V A;  4ID1 A;  5HRR A;  3CG7 A;  4BG9 A;  4XIU A;  3K0S A;  4CFA A;  3EYZ A;  2KTQ A;  1JLQ A;  1YTU A;  4PL8 A;  1D9D A;  1VSD A;  2ATQ A;  2ASP A;  4KV8 A;  3AA2 A;  4FK0 A;  3CQ8 A;  2E1Z A;  4JKC A;  3JSM A;  4H0O A;  1NG9 A;  1NJI O;  4H0V B;  1VK0 A;  3PO4 A;  3SUP A;  3J81 O;  4BR5 A;  3UB5 A;  3V1R A;  2X74 A;  3K5M A;  4B8A B;  4FWS A;  3DLE A;  3WUH A;  1Q18 A;  1VQO N;  2PY5 A;  3QFU A;  4J2B A;  3AVG A;  4IJA A;  3KLF A;  4BVP A;  4IZ9 A;  3T1H K;  3C94 A;  3CC4 N;  1SUQ A;  4O0J A;  4E19 A;  4BC3 A; 
#chains in the Genus database with same CATH homology
 5HRS A;  3OYJ A;  4RG8 A;  3LWM A;  2IGI A;  1XWL A;  3O3H A;  5I3U A;  4CJK A;  1BQN A;  1C6V A;  2Y1I A;  1U48 A;  4CJS A;  3QEP A;  2G8K A;  3ZT1 A;  4M3R A;  4W5Q A;  4FJ8 A;  4ID5 A;  2R7Y A;  4FZY A;  1ITG A;  4RW9 A;  2A1S A;  5T7B A;  3HVR A;  1RT7 A;  4CJR A;  5J2Q A;  3AVH A;  1HYV A;  1WLJ A;  4LSL A;  3OVN A;  4CEZ A;  4M3T A;  3KK3 A;  1ZBL A;  3PX4 A;  4Z4E A;  3ISN C;  1LWE A;  5KRT A;  3D0P A;  3CFP A;  1VSF A;  1HQE A;  2Z1H A;  2XO7 A;  3HXM A;  4CHO A;  3I0R A;  3O3F A;  2VG5 A;  1RTJ A;  3B6O A;  4KI6 A;  1C1B A;  3ZSO A;  1JLC A;  4DSE A;  3ZT3 A;  3G0Z A;  3AO3 A;  4LH5 A;  4DTN A;  4I7F A;  1WSG A;  4Y1D A;  4ZHR A;  3V9Z A;  4FYD A;  1CXQ A;  3OYN A;  1N5Y A;  2D0B A;  1ZYQ A;  3HJF A;  3U3Y A;  2VG6 A;  4FJI A;  3L8B A;  3DLR A;  1RIL A;  1S1W A;  3U3G A;  1KFD A;  2ITG A;  1U4B A;  3PY8 A;  1T7P A;  2B4J A;  2HVI A;  2YV0 X;  2FC0 A;  4E89 A;  3AVL A;  1UWB A;  3K57 A;  4KHU A;  4O44 A;  2HNY A;  4KKO A;  2RF2 A;  1NKC A;  1C0M A;  1QQC A;  1NK9 A;  4CHY A;  4H8K A;  1KTQ A;  4CIE A;  4KHW A;  3SNN A;  3PUF A;  2JLE A;  1WSJ A;  3ZSY A;  2RN2 A;  4GMJ B;  5CZ1 A;  4FLW A;  3NH2 A;  1SV5 A;  4DU4 A;  1NK4 A;  1TVR A;  4F3O A;  3TR8 A;  2A1R A;  4KHY A;  2IOC A;  4EP4 A;  5KRS A;  1HMV A;  3OJU A;  4M3Z A;  2BAN A;  4BWJ A;  1TK5 A;  3KJV A;  4YNQ A;  4DFK A;  4DFM A;  1BI4 B;  3HVT A;  2P5O A;  4FJM A;  3DLH A;  4QOZ B;  1RT1 A;  4HVJ A;  1CLQ A;  4N5S A;  1C0U A;  4CGI A;  1XC9 A;  1DTQ A;  3JYT A;  3TAR A;  1LW0 A;  4CJ5 A;  2DTU A;  1QSS A;  1C1C A;  1RBU A;  4CHQ A;  3P5J A;  2HND A;  4CGH A;  1B9F A;  3H08 A;  1NK7 A;  1QSL A;  4FLX A;  4M45 A;  1IKY A;  1HYS A;  2X6N A;  1IKV A;  1KLM A;  3NF7 A;  4DSF A;  1VSJ A;  2DY4 A;  3NGI A;  2X6S A;  4KTZ A;  1XHX A;  1NKB A;  3QER A;  2XY8 A;  4H4O A;  3AVB A;  3FFI A;  1MU2 A;  4OGE A;  3ZT0 A;  3LPU A;  2Z1J A;  1VRT A;  2OPP A;  1J54 A;  4M41 A;  4W5T A;  1D9F A;  2I5J A;  2HHT A;  4CER A;  3KK1 A;  1WSE A;  4DTU A;  4E7J A;  4QAG A;  1FXX A;  3TI0 A;  3E01 A;  4C8M A;  3WNE A;  4IBN A;  3L2U A;  3CM5 A;  3NAE A;  3TAM A;  3SI6 A;  3NGZ A;  3MEE A;  3T3F A;  3CFO A;  3BDP A;  3SCX A;  4CK1 A;  3LP0 A;  4CK3 A;  4OGC A;  1G15 A;  4B08 A;  3HT3 A;  1T03 A;  4FVM A;  4CF9 A;  4FM1 A;  1TKD A;  1UA0 A;  4OKK A;  3OS2 A;  3LP2 A;  4Z4F A;  3ZSV A;  4HUG A;  3S3M A;  2QK9 A;  2HW3 A;  4CJU A;  2AJQ A;  2ZQB A;  4Y1C A;  1U45 A;  1VSM A;  2FBT A;  1L3U A;  4KFB A;  4RW6 A;  2D0C A;  2KQ2 A;  2DFE A;  1JLB A;  3QIO A;  5HLF A;  3ALY A;  4N47 A;  3OYM A;  3KLG A;  1L3V A;  3IAY A;  4NCG A;  3AO2 A;  4J2A A;  3NH1 A;  3SV4 A;  1BIS A;  4OLB A;  3NDK A;  4ICL A;  5K14 A;  2HB5 A;  1WNS A;  4CF8 A;  1VSK A;  3TAB A;  2G8U A;  4WE1 A;  3PO5 A;  1TV6 A;  2YKN A;  4FW2 A;  1QTM A;  5J1E A;  4DSL A;  4FJL A;  1VRU A;  4CFD A;  1I3A A;  3RMD A;  1KVC A;  3OYB A;  1TAQ A;  4CES A;  2HHQ A;  4CFB A;  1JLG A;  2G8H A;  4MFB A;  1Q9X A;  1S1X A;  4C8L A;  1A5W A;  1RDB A;  3LWL A;  2XY5 A;  2IDO A;  3MED A;  3QEI A;  5SZT A;  4YFU A;  1C1A A;  3T19 A;  1SL1 A;  3AVC A;  1GOB A;  2YNG A;  2YNF A;  3K5N A;  4ZTJ A;  3M8R A;  1X9S A;  4CGG A;  1S1T A;  4O55 A;  1Z25 A;  3V81 A;  4C8N A;  1WSI A;  1YT3 A;  3F9K A;  4CJF A;  3MAQ A;  3I0S A;  4Z4H A;  3S3O A;  5HRP A;  4FLY A;  3DLG A;  4RW4 A;  1KRP A;  2PYL A;  1X9M A;  4B9S A;  4F2R A;  2QKB A;  2IC3 A;  2VWK A;  1ZBH A;  1BCM A;  1KFS A;  1HRH A;  2GUI A;  1YVU A;  3V9W A;  1XHZ A;  3NHG A;  2YNI A;  2HHX A;  4B9M A;  4CJE A;  4DFP A;  5KGW A;  1FKP A;  2OA8 A;  3KLI A;  2Z1G A;  3MEG A;  3L2Q A;  4FZX C;  4KB1 A;  4DU1 A;  1S6Q A;  4NYN A;  4B9T A;  1RBT A;  4KPY A;  4PUO A;  1ZBI A;  4PWD A;  4DQI A;  3F73 A;  4CFC A;  4LH4 A;  3S3N A;  3DRR A;  4KHN A;  3ZSX A;  4CF2 A;  4CEA A;  1NOZ A;  3G10 A;  3TAE A;  1O1W A;  1NJZ A;  3BGR A;  3OYH A;  1DLO A;  4DS4 A;  3KD5 E;  4HUF A;  4OVL A;  4JS5 A;  1TK0 A;  3RMA A;  2E6L A;  3LAN A;  3AVN A;  4DLE A;  4FLU A;  2P5G A;  1LAV A;  2EHG A;  4E1M A;  1L3T A;  2P51 A;  3NFA A;  3QIN A;  4JLH A;  1D8Y A;  3L2R A;  2X78 A;  2KW4 A;  3EZ5 A;  3SQ4 A;  4Z4G A;  1K6Y A;  1X1P A;  4Q0B A;  4PQU A;  4C8K A;  1TL1 A;  3KKR A;  3DRS A;  4UQG A;  3QET A;  3KK2 A;  3OYD A;  3ZSW A;  5FRM A;  1QHT A;  1ZBF A;  2RPI A;  3M8Q A;  5HBM A;  1ASU A;  1W9H A;  5FRO A;  4CGJ A;  4CHN A;  1T8E A;  2YKM A;  2YHB A;  5FRN A;  1S6P A;  4HCC A;  2GV9 A;  1FK9 A;  4E7K A;  4Z0U A;  3SUN A;  2FBV A;  2G8W A;  4FJG A;  2BGG A;  1IKW A;  4RW8 A;  4Z4C A;  1TKX A;  5J2M A;  3KIO A;  4DTR A;  2XY6 A;  3ZSR A;  1BI4 A;  1WN7 A;  1KVA A;  1JKH A;  4OKE A;  4DQQ A;  4B9L A;  4FK4 A;  4BE1 A;  2Z1I A;  5JS2 A;  3VQQ A;  3L2V A;  4FLV A;  5KGX A;  3VQB A;  1LWF A;  5HRN A;  3VA0 A;  3AO4 A;  5KI6 A;  3DLK A;  3ITH A;  4M3U A;  3QLH A;  3OYF A;  3DLB A;  3V1O A;  3HO1 A;  2OPR A;  4DMN A;  1IG9 A;  4ELT A;  3ZSQ A;  4ELU A;  1LW2 A;  4NCA A;  1B9D A;  3VQC A;  4CJL A;  4O0I A;  1I39 A;  1LV5 A;  1EKE A;  4JRQ A;  4C8O A;  3QNO A;  3CFR A;  2OZM A;  1REV A;  3SQ1 A;  1RCH A;  1RT6 A;  1L3S A;  3HYF A;  1NKE A;  4IDK A;  4ELV A;  3WNG A;  3LAM A;  1JL2 A;  1QS4 A;  1VSL A;  4B9N A;  4KI4 A;  1GOA A;  4HHT A;  4E0D A;  4E19 A;  3OS1 A;  3THV A;  1NJW A;  4CJP A;  3KLH A;  2E6M A;  3M8S A;  3OYE A;  1HNI A;  4DTJ A;  1RDA A;  1WAF A;  1RNH A;  3DOL A;  4JS4 A;  1S9G A;  3IS9 A;  1SL0 A;  3RRG A;  4Z4I A;  1VSE A;  1JLF A;  3WNF A;  4CEO A;  2D5R A;  4I9L A;  3QEW A;  3LP3 A;  5EU7 A;  4FM0 A;  1TK8 A;  4B9V A;  4HUE A;  1L5U A;  4KRE A;  3NE6 A;  4DTX A;  1RDC A;  1QE1 A;  4F3T A;  3C6T A;  3TAN A;  1FKO A;  2YHA A;  3MXI A;  2DFF A;  1B92 A;  3ASM A;  3DYA A;  4CF1 A;  5E41 A;  2E4L A;  3HPG A;  3SYZ A;  1RT5 A;  3K5L A;  4IKF A;  4KTQ A;  4JRP A;  4FJK A;  3AA5 X;  4FW1 A;  4J2E A;  4RW7 A;  1RT3 A;  2XRI A;  3QNN A;  3DOK A;  1TAU A;  3ULD A;  4FJX A;  3V9X A;  3HP6 A;  4DF4 A;  1NK5 A;  1TKT A;  1KCF A;  1ASV A;  3TAF A;  1LAW A;  4FJ5 A;  1A5V A;  4DQS A;  3QEV A;  2JGU A;  5I42 A;  4FJJ A;  4MQ3 A;  2YNH A;  3P1G A;  3RRH A;  4TSX A;  3LAK A;  4I2P A;  2XY7 A;  3KD1 E;  3QO9 A;  4KHS A;  4EP5 A;  1NK0 A;  3U6F A;  1IH7 A;  3I8D A;  4KHQ A;  3T1A A;  4CEQ A;  2Y1J A;  3M8P A;  4BE0 A;  2O4G A;  4CGF A;  4PY5 A;  4IFV A;  2BE2 A;  1RBS A;  4OJR A;  1BGX T;  1SL2 A;  4I9Q A;  5D3G A;  1S9E A;  4M3W A;  1NK8 A;  1BL3 A;  1S1V A;  1J9A A;  4DFJ A;  2VG7 A;  3KLE A;  4B3O A;  3HPH A;  4GW6 A;  2D0A A;  4DWI A;  1CZB A;  4CHZ A;  3K58 A;  3SZ2 A;  4AHR A;  3V1Q A;  1EX4 A;  3NGY A;  1KLN A;  3DRP A;  3ZT4 A;  3EY1 A;  4ZTF A;  1R0A A;  1U04 A;  3PX6 A;  1RBV A;  4E1N A;  1TL3 A;  1UAX A;  2GBZ A;  1NOY A;  2OPS A;  4CF0 A;  1J5O A;  2HNZ A;  3UIQ A;  4G1Q A;  3VA3 A;  4DSK A;  4KAZ A;  3LZI A;  3SPZ A;  4O4G A;  4M42 A;  5C42 A;  3OYL A;  4KTW A;  3NF6 A;  3AVA A;  3NH0 A;  3RMB A;  3VQ5 A;  2PZS A;  5CY4 A;  1EP4 A;  3SPY A;  3PX0 A;  1RT4 A;  4FLZ A;  5J2P A;  3QEX A;  1JXE A;  4DSI A;  1JLE A;  1U49 A;  3D45 A;  4K8X A;  5HP1 A;  1WSF A;  3TAP A;  4KO0 A;  2XHB A;  1SKW A;  4M3Y A;  3AO1 A;  1EXQ A;  3V6D A;  4KB0 A;  1HNV A;  3V4I A;  1S5J A;  5J2N A;  2ZE2 A;  4CED A;  4BDY A;  1TKZ A;  3TWH A;  2OPQ A;  3KKS A;  3MXJ A;  1BIU A;  3K5O A;  4W5O A;  3C6U A;  3HM9 A;  2RKI A;  3NF8 A;  3VQA A;  4W5N A;  1ASW A;  2P1J A;  1YTA A;  4CJQ A;  3QES A;  4NCB A;  1DTT A;  4O5B A;  4CHP A;  4OPK A;  1EET A;  4GVM A;  1QSY A;  3RR8 A;  3V9U A;  4CCH A;  4AIL C;  1HPZ A;  3HL8 A;  1XI1 A;  4FXD A;  3TAG A;  2G8I A;  3VQP A;  4DQR A;  4DSJ A;  1N6Q A;  3QIP A;  4E7H A;  3KTQ A;  3CYM A;  3WNH A;  2W42 A;  2NUB A;  3L3U A;  4OKJ A;  4AH9 A;  2BDP A;  1A5X A;  5CYQ A;  4FLT A;  3CM6 A;  1JXB A;  4DTS A;  2G8V A;  2OYQ A;  4HCB A;  3AVI A;  2Q3S A;  1KVB A;  3LAL A;  2WON A;  3HP9 A;  3VQ6 A;  1D5A A;  4IG0 A;  4CGD A;  4HTU A;  3ZCM A;  4CJW A;  3V9S A;  4AHT A;  3A2F A;  1RTI A;  3AA4 A;  3TAQ A;  4DU3 A;  5DK5 A;  1NK6 A;  1VSH A;  4DTM A;  4LD0 A;  4OLA A;  4BWM A;  1SKR A;  2KFZ A;  4M3X A;  1CXU A;  3P83 D;  1Z26 A;  2PYJ A;  3AVK A;  4AHC A;  3HK2 A;  5DMR A;  1RTH A;  2B5J A;  3DI6 A;  2HHS A;  4W5R A;  5SWM A;  1RDD A;  1RT2 A;  4N56 A;  3AV9 A;  4AHV A;  3B6P A;  3VQE A;  3LZJ A;  4CK2 A;  4N76 A;  2HHW A;  2KZZ A;  4CIF A;  4Q5V A;  2F96 A;  4IG3 A;  3S9H A;  4F4K A;  3RR7 A;  1WSH A;  1RBR A;  3NF9 A;  3VN5 A;  5CZ2 A;  4CEE A;  4FJ9 A;  3DM2 A;  3O4N A;  3VQ8 A;  1HQU A;  3AVM A;  1T05 A;  2FBY A;  3OYI A;  1BQM A;  3VQ9 A;  3O3G A;  4FM2 A;  2G8F A;  2IS3 A;  3RMC A;  4I2Q A;  4LY7 A;  2HHU A;  4FJH A;  3OYC A;  1KSP A;  2IAJ A;  4QCL A;  3IRX A;  1BIZ A;  1Q8I A;  1U47 A;  1NJY A;  4L8R B;  2EX3 A;  3LP1 A;  4OPJ A;  2KZM A;  4LSN A;  4B8C A;  4DG1 A;  3IG1 A;  3SV3 A;  4DS5 A;  1JL1 A;  4EZ6 A;  3AVF A;  4K8Z A;  1VSI A;  4E3S A;  4F2S A;  4BAC A;  4CEC A;  4F8R A;  2HVH A;  4R5P A;  4DF8 A;  3NCI A;  4CJV A;  3OYK A;  2DFH A;  3RTV A;  4FCY A;  3RWU A;  4CJ3 A;  1IKX A;  3SJJ A;  4BDP A;  1W0H A;  4CIG A;  3VQ4 A;  4FZZ A;  3PV8 A;  2QKK A;  3SQ0 A;  4N41 A;  4CJT A;  3AVJ A;  5KTQ A;  3AA3 A;  1J53 A;  1LWC A;  2ETJ A;  4DTO A;  3L3V A;  3HST B;  4AHS A;  3VQD A;  1C0T A;  2O4I A;  4H4M A;  3SQ2 A;  1HJR A;  4ID1 A;  1CZ9 A;  3CG7 A;  4IFY A;  5HRR A;  4XIU A;  3OY9 A;  3MEC A;  1Q9Y A;  4CEB A;  2HHV A;  3K2P A;  3DMJ A;  4CFA A;  3OYA A;  3EYZ A;  1JLQ A;  4CEF A;  2KTQ A;  2ZD1 A;  2LSN A;  2F8T A;  3MXM A;  4B9U A;  1YTU A;  1ZBU A;  1GOC A;  4CJ4 A;  5FDL A;  1IO2 A;  1BHL A;  3SUQ A;  4DLG A;  3ZSZ A;  5CYM A;  1VSD A;  3OYG A;  2ATQ A;  2B6A A;  3AA2 A;  4KV8 A;  1D9D A;  4KRF A;  1JLA A;  3NBP A;  4FK0 A;  4DQP A;  3LPT A;  3CQ8 A;  2HMI A;  3JSM A;  4J2D A;  3L2W A;  1HYZ A;  2F8S A;  1RTD A;  5C24 A;  4E7L A;  4AHU A;  3C95 A;  3OS0 A;  4CE9 A;  4BDZ A;  1VK0 A;  5C25 A;  4FJN A;  3PO4 A;  3SUP A;  4NYF A;  1X9W A;  3V1R A;  2X74 A;  3K5M A;  4B8A B;  4DTP A;  3O4Q A;  3LDS A;  3DLE A;  5JS1 A;  1BCO A;  1F21 A;  4PA1 A;  2PY5 A;  1S1U A;  2OZS A;  3HPO A;  4E7I A;  1NJX A;  2KFN A;  4J2B A;  3AVG A;  3K59 A;  3AO5 A;  3OJS A;  2VWJ A;  3KLF A;  1SKS A;  2QXF A;  4EZ9 A;  4BE2 A;  4FK2 A;  1TGO A;  1UA1 A;  2WOM A;  3C94 A;  3SUO A;  5HRO A;  4FJ7 A;  3VQ7 A;  1Y97 A;  1UOC A;  1SUQ A;  1WAJ A;  4O0J A;  3ZT2 A;  2FBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...