3VQ7A

Hiv-1 in core domain in complex with 4-(1h-pyrrol-1-yl)aniline
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
145
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 54
structure length 145
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq7A00
3MAQA 1JLQA 1R0AA 1D9FA 4DSKA 3KJVA 4N56A 2Q3SA 4HUFA 4O4GA 3ITHA 3VQ9A 1Q9YA 4M3XA 2PZSA 4LD0A 4FJLA 4C8NA 3OYIA 4I7FA 2FBVA 2LSNA 3KD1E 5JS1A 1VSEA 3T19A 5J2MA 4CFDA 1LV5A 1YT3A 3EY1A 2I5JA 4CF8A 1NK6A 3F73A 2Z1GA 4I2QA 3V1QA 3QINA 1VSHA 3KLFA 1L3VA 3OYHA 4CF1A 4C8MA 4J2AA 4BE2A 4Z4HA 5HLFA 4DF8A 4O0JA 4EP5A 3PX6A 4O55A 5HRSA 1U04A 5SWMA 3OY9A 2VWJA 2WOMA 1YTUA 4QCLA 1IKXA 5HRPA 3OJSA 1L3UA 2FBXA 2YNFA 1J54A 4DWIA 4M3RA 4AHSA 1U45A 1SV5A 3KIOA 4CESA 3I0RA 3NF9A 1YVUA 4G1QA 4R5PA 4FJ8A 1Y97A 4M3YA 4CGGA 1ASUA 5CZ1A 3P83D 3TAPA 4HUGA 3HK2A 4AH9A 2RKIA 1RT4A 2G8FA 2ZE2A 5FRMA 4DS5A 4K8XA 1TKXA 1C1BA 3JYTA 1RBUA 1F21A 3AVFA 3SZ2A 4OGCA 3V4IA 3OYBA 1K6YA 4WE1A 1C0UA 3U3GA 3VQCA 5FRNA 2Y1IA 1XHXA 1BCOA 3DLBA 3HPGA 1T05A 1NK9A 4OKKA 4NCAA 3AVKA 4OVLA 5DMRA 4CJWA 1T8EA 2JGUA 3LP3A 1BQMA 3PV8A 4CHZA 3PX0A 1JXBA 2BANA 3AVBA 4CJVA 3DOLA 1VSFA 5CY4A 5KRSA 3KTQA 4QAGA 4DLEA 3MECA 1KVBA 3AO4A 1RCHA 3SQ0A 4KAZA 4UQGA 4OPKA 4OLBA 1SUQA 3EZ5A 4BDYA 4FK4A 3VQEA 4Y1DA 4N47A 1RT6A 1HNIA 2HNZA 2F8SA 3DM2A 3DYAA 2XY5A 4JS4A 1CZBA 3ZCMA 4Z4CA 2QKKA 5D3GA 1BQNA 2QXFA 1TL1A 3QNNA 3DLEA 1NK8A 2IDOA 1FXXA 3JSMA 3S3OA 4DQQA 2PY5A 3QEWA 4FJJA 3AVGA 1FKPA 1BIUA 4M3WA 4Z0UA 4B3OA 3K5MA 1WAJA 3L3VA 3TANA 3L3UA 1CXQA 3ZSXA 2RPIA 4LH5A 3L8BA 3DLHA 3PO5A 3TAMA 3L2UA 4FJ9A 2PYJA 1B9DA 2E4LA 3HP9A 2KQ2A 3WNGA 4IDKA 3HO1A 3NH1A 1VSKA 4DTNA 4EP4A 4PA1A 1RT1A 3AO1A 2FBYA 1BI4B 2VG6A 3DRPA 3SQ2A 4B9TA 3HVTA 4FLWA 3V1RA 2XY6A 2G8UA 4OJRA 4IFYA 4CHOA 1RDCA 3LZJA 3RR7A 1XI1A 4CGHA 1UWBA 2HHQA 3LPUA 4M41A 3IRXA 4FLUA 4IFVA 5C24A 2OPRA 4DFPA 3TABA 3M8SA 4IBNA 1L3SA 2HHSA 3IS9A 2HHWA 1CZ9A 4E3SA 2IAJA 1B92A 3OYCA 4FK0A 1ITGA 1RDBA 1REVA 4KHSA 2HHUA 1QE1A 1KTQA 1S9EA 3AVLA 3V6DA 4K8ZA 3DLRA 3KLHA 4PWDA 1X1PA 5HRRA 4E7LA 2KZMA 3KK1A 4CJ4A 1RT7A 3T1AA 4FJ7A 3SV3A 1SL2A 1BIZA 2HMIA 1IKWA 1TV6A 3MEDA 2OYQA 3K59A 3NHGA 4BE1A 1A5VA 1BISA 1T7PA 4NCBA 3LAKA 4C8LA 1I3AA 4DU1A 1LWFA 2OPPA 1QQCA 1S1XA 1W0HA 3FFIA 1NK0A 3RRGA 4E19A 1LAVA 4ZHRA 3E01A 3NDKA 1C0TA 2OPSA 4CIFA 1TK5A 3S9HA 4CF0A 5KI6A 2IC3A 1JL1A 4KPYA 5K14A 3VQAA 2XO7A 3ZT1A 4FJNA 1X9SA 3WNHA 1T03A 1TKDA 2G8VA 4BE0A 2FC0A 3M8RA 1RNHA 2HNDA 4FZXC 1C0MA 3NAEA 4FCYA 4CK2A 4CJ3A 4O0IA 1XWLA 3VQQA 3VQ8A 3OYFA 3HP6A 3SUPA 1NK7A 2HHVA 3C95A 2ZD1A 3NH2A 2D0AA 4NCGA 4E7HA 1HPZA 2DY4A 4DTUA 4DTRA 1HQUA 3D0PA 3VQ6A 1IO2A 4CE9A 3O3FA 3DI6A 2ITGA 3AVHA 2YHBA 3HVRA 2P5GA 1BHLA 3AO3A 4ELTA 4I2PA 4CK1A 2G8IA 4E89A 4W5QA 4QOZB 4KO0A 4O5BA 5C42A 3MXIA 1S1TA 1VSIA 2VWKA 4DTJA 3PX4A 3V9UA 4RW4A 4E7IA 4DQRA 3QEPA 2B5JA 1IKYA 3QIPA 3NF6A 4CGFA 3NH0A 3HPHA 1TAUA 2DTUA 4CJQA 1BCMA 4LY7A 4CEEA 1WSIA 3L2WA 3D45A 2X6SA 2GV9A 4MQ3A 3O4QA 4CF9A 3L2RA 4KTQA 2QK9A 1WLJA 4DFKA 4Z4FA 3SUNA 4DG1A 4ID5A 3QERA 4GW6A 5HROA 2D0BA 4AHTA 3LZIA 4DSEA 4NYNA 4BACA 1S1WA 1EETA 1TGOA 3RMBA 3S3MA 4E0DA 4CJPA 2D5RA 3LP2A 3SCXA 3VQ4A 3AA2A 4BDPA 2HB5A 1RBSA 1Q8IA 4MFBA 3VQ5A 2KTQA 3V81A 1FK9A 3AVIA 3K57A 1ZBLA 5CYQA 3U3YA 4HCBA 2HHTA 1RDDA 3CM5A 1UA1A 4CHQA 1ASWA 2NUBA 3CFPA 1CXUA 3S3NA 4KFBA 2GUIA 3EYZA 3AVNA 4DTOA 1WSJA 1WSEA 1D9DA 4FLTA 1UAXA 4IG3A 3TI0A 3SNNA 2O4GA 4YFUA 3RRHA 3MXMA 3ZSYA 1HYZA 1DTQA 4FJGA 4Z4IA 4IKFA 1DLOA 4IG0A 4AHCA 5FDLA 3KK3A 1FKOA 1S9GA 2F8TA 1JLGA 1L3TA 3PY8A 1NOZA 2G8HA 3AVMA 1B9FA 3THVA 3MXJA 1Q9XA 1SKWA 2XY8A 3ZSZA 1S6PA 4H4OA 1JKHA 1LW2A 4CJTA 3SI6A 4FM1A 2QKBA 4B8CA 4OGEA 2B4JA 2HW3A 2HVIA 4CJLA 1NJYA 2OZMA 3SUQA 3ZSVA 2Z1JA 3NF7A 3OYEA 3V9SA 2AJQA 2EX3A 2YKNA 4KTZA 3ZT3A 1S6QA 1JLBA 1VSJA 3ASMA 3V9WA 4DFJA 1I39A 3SQ1A 1ZYQA 4FXDA 3LDSA 3OYMA 1JLFA 4C8OA 3UIQA 1RDAA 3HT3A 2Y1JA 1KRPA 4J2EA 2A1RA 4N5SA 2ETJA 5JS2A 1TL3A 1NKEA 3CYMA 3AVCA 3KK2A 1W9HA 3TAGA 2BDPA 3V9XA 4M3ZA 3G10A 1WSFA 3L2VA 4DTSA 3TWHA 2YV0X 4FJKA 1QHTA 1WNSA 3M8QA 1NKCA 3OYAA 3BDPA 4FLYA 3HPOA 2XY7A 4RG8A 3LP1A 1NJWA 4CF2A 4LH4A 4LSNA 4CGIA 4BDZA 4FJMA 3BGRA 4CK3A 1LWCA 4CECA 3KKRA 5CYMA 3OYJA 3HXMA 4KRFA 1KVCA 3ZSQA 1BGXT 3ZT2A 4E7JA 3RMDA 3IAYA 4N41A 1VK0A 2X78A 1DTTA 1IH7A 1HNVA 1XC9A 3DLKA 3VQ7A 1VSMA 1RTIA 4RW7A 4FJIA 3LWLA 4CEQA 3AO2A 4TSXA 5KGXA 3DRRA 4W5OA 4B9SA 3I0SA 3QLHA 1IG9A 4Q5VA 2ATQA 3WNEA 1NK4A 4KTWA 4ZTJA 1U47A 4W5RA 4DSFA 2YNGA 4DQSA 1HYSA 2XRIA 4DSLA 2HNYA 3ZT4A 3OYNA 1VRUA 3NGYA 4HHTA 2R7YA 3ULDA 4DSIA 3RWUA 4I9QA 4E1NA 2G8KA 1RT5A 1EKEA 1VRTA 3HL8A 1GOBA 2A1SA 4FW2A 4CJUA 1U4BA 2P1JA 3DLGA 3LANA 4H4MA 4RW9A 3NF8A 4M45A 4CIEA 3NBPA 4FVMA 4E7KA 1N6QA 4DU4A 1KLMA 1HRHA 1SL0A 3AA5X 4ICLA 4B08A 2G8WA 4Z4GA 1UA0A 1NJXA 4W5NA 3ZSOA 4HUEA 1HJRA 4LSLA 4FLVA 3OYGA 3QIOA 4JLHA 5E41A 3HM9A 3CQ8A 3KLGA 4RW6A 1C1CA 1SKSA 2X6NA 1TVRA 2XHBA 1D5AA 4DTPA 5FROA 1KVAA 3CG7A 4CJFA 2PYLA 3C94A 5J1EA 3OS1A 2IS3A 4FJXA 1C1AA 1TKZA 3QO9A 4Q0BA 1LWEA 4B9LA 1WN7A 2EHGA 4ELVA 3K5OA 4AHUA 1ZBUA 3OJUA 3IG1A 3P5JA 2OZSA 4KB1A 4CHPA 1RT3A 3K5NA 4FW1A 2HHXA 4CFAA 2KFZA 4DTMA 4FM2A 3QEVA 3M8PA 4GVMA 4Z4EA 4KHNA 4DU3A 4ZTFA 5EU7A 3AV9A 1N5YA 4FLZA 3SYZA 4Y1CA 1SKRA 4CEAA 2OA8A 3QNOA 4KHWA 2VG5A 4F3TA 1HQEA 4NYFA 1WSHA 3SQ4A 5C25A 3AVAA 4KB0A 1KFDA 3MEEA 3NGIA 2DFHA 2WONA 4CFBA 4DF4A 1C6VA 3H08A 1JL2A 1RTHA 3OS0A 3SPZA 1UOCA 2KZZA 3HSTB 2OPQA 4CJ5A 3DMJA 4DLGA 3KLEA 1J53A 3A2FA 2B6AA 4O44A 3LPTA 4AHRA 4XIUA 3U6FA 4CEFA 3LP0A 1IKVA 3ZSRA 4FJ5A 1GOCA 1KSPA 4EZ9A 3O3GA 4H8KA 3RTVA 1VSDA 4FK2A 5DK5A 5KTQA 1TK8A 4DQPA 2YNHA 1NOYA 3ZT0A 4DS4A 3DRSA 3B6PA 4F4KA 4CHYA 4KI4A 1SL1A 4B9MA 1EXQA 3WNFA 4AHVA 5SZTA 4KHQA 3NCIA 5HBMA 3V9ZA 3AA4A 4I9LA 3OS2A 1EP4A 4DFMA 4B9NA 4HVJA 2YNIA 1Z26A 3I8DA 3LAMA 3C6UA 1O1WA 4CEZA 4DQIA 4ID1A 4CERA 4OLAA 1A5WA 1D8YA 3TAQA 5CZ2A 3CFRA 3NFAA 3CFOA 1ZBIA 4F2RA 4KREA 1ASVA 3V1OA 5KRTA 3K5LA 1X9WA 4CJKA 3DOKA 3NE6A 4YNQA 2GBZA 3P1GA 5T7BA 3QETA 4CJRA 4L8RB 2IOCA 4M3TA 1ZBHA 1J5OA 2DFEA 4CEBA 1YTAA 4OKJA 4CJSA 4GMJB 4CHNA 4B9VA 5J2NA 4CCHA 1RTDA 3O3HA 1RBTA 2E6MA 1VSLA 4RW8A 4PUOA 3HJFA 2JLEA 1TKTA 2P51A 3VN5A 2KW4A 2Z1IA 3VQPA 1RT2A 1RBVA 1RBRA 3C6TA 2Z1HA 1A5XA 3QEIA 3LWMA 3PUFA 5I3UA 5HRNA 3TAFA 2BE2A 4FZYA 3T3FA 2YKMA 2F96A 1KLNA 2RF2A 1BL3A 1WSGA 3LALA 3MEGA 2DFFA 4W5TA 3OYDA 4E1MA 4AILC 4CJEA 3O4NA 1GOAA 1S1VA 3TR8A 5J2PA 1U48A 1NK5A 1HYVA 3VA3A 4F2SA 3RR8A 1JLAA 3K58A 3ALYA 2VG7A 4FLXA 2BGGA 3ZSWA 4BWJA 1QTMA 1X9MA 1L5UA 1BI4A 4CGDA 4OPJA 3QESA 3KKSA 3PO4A 1QS4A 3K2PA 3SPYA 2O4IA 3QEXA 3KLIA 1Z25A 1KFSA 3SUOA 1ZBFA 5J2QA 2KFNA 4OKEA 1HMVA 3ISNC 1G15A 1J9AA 3TAEA 4KHYA 2YHAA 1QSSA 3OYLA 1XHZA 3AO5A 2E6LA 4CEDA 4FJHA 2D0CA 4B9UA 4DSJA 1MU2A 3HYFA 4B8AB 3NGZA 1RTJA 1WAFA 1CLQA 3OVNA 4HCCA 1EX4A 4FZZA 1TAQA 3AA3A 4N76A 1TK0A 2IGIA 4CGJA 4JS5A 4FM0A 3SV4A 4C8KA 2HVHA 4J2DA 4JRPA 3G0ZA 1RILA 1QSYA 3F9KA 5HP1A 1S1UA 3SJJA 3VQDA 4FYDA 4EZ6A 1JLCA 1JXEA 3AVJA 2FBTA 4JRQA 5I42A 1NJZA 3L2QA 4M42A 4HTUA 4KKOA 1JLEA 3VA0A 4BWMA 3OYKA 4CEOA 3VQBA 4F8RA 3RMAA 1LAWA 3KD5E 4KHUA 4KI6A 3TARA 1NKBA 2ZQBA 4J2BA 4DMNA 2X74A 1U49A 2P5OA 3B6OA 4PQUA 4DTXA 3CM6A 4PY5A 1S5JA 3RMCA 1LW0A 4ELUA 4M3UA 5KGWA 1KCFA 4KV8A 4CIGA 2W42A 4CFCA 2RN2A 1QSLA 4F3OA
chains in the Genus database with same CATH superfamily
3MAQA 1R0AA 2F7TA 1M90O 2FBVA 3KZBA 4JN4A 4MDBA 3KD1E 4OX9K 5JS1A 2V51B 4U7BA 4HTLA 3CJ9A 3HBTA 2WFBA 3V1QA 1EWQA 4J2AA 4Z4HA 3OTOK 5HLFA 4A59A 5SWMA 1YTUA 2CGKA 2I7NA 1IKXA 5HRPA 2FBXA 3A5OC 2VGMA 2E1YA 2E88A 5I9EB 3DXKA 1U45A 2E1ZA 5C15A 4CGGA 4HUGA 1QQMA 2OTJN 1RT4A 1VQLN 3P31A 2O8BB 1TKXA 1C1BA 1RBUA 4MO4A 4JKDA 3V4IA 3VQCA 1XHXA 4KH4A 3HPGA 4JI1K 1T05A 4OVLA 1E4GT 2JGUA 2A6AA 4CHZA 3J7ZO 2BANA 3T1YK 4CI6A 3AO4A 2YCHA 4OPKA 4FK4A 3M6GA 4Z4CA 4FPBA 4V19S 1BDGA 3QNNA 1NK8A 1HX1A 3DLEA 3EE8A 3E1YA 3R8EA 3PLAA 5ADXA 3S3OA 4LF7K 2PY5A 3AVGA 4Z0UA 1HNZK 4B3OA 1WAJA 3RSEA 3L3UA 2RPIA 3L2UA 2E4LA 2GTDA 2KQ2A 1N34K 4KHPK 2IIRA 5AQYA 1HLUA 5JICA 2VG6A 3DRPA 3THWA 4NLCA 5F0XA 4OJRA 1YUWA 4IFYA 4BVOA 4BY9C 3RR7A 4B3SK 2HHQA 4DFPA 4IFVA 5C24A 2OPRA 3TABA 2HHWA 4IBNA 1VQNN 3ZX2A 1U2VA 2F9WA 1B92A 4QS7A 4FK0A 2HHUA 4KHSA 1KTQA 2QWRA 4AM7A 4B3MK 3O8MA 2KZMA 2JWLA 4IO8A 1SL2A 1ZXOA 4JYAK 5AR0A 3MCPA 1BA1A 4BE1A 2Q2RA 3R6MA 4C8LA 3AGKA 1S1XA 3RRGA 4E19A 4GNIA 4ZHRA 3E01A 2W6KA 2OPSA 1DKGD 2IC3A 2H3GX 4JV5K 4KPYA 2XO7A 3ZT1A 5FPDA 4FJNA 1NGAA 2HNDA 1C0MA 1NGBA 3MDQA 4FWRA 1I94K 3NAEA 3OHRA 4O0IA 1XWLA 3SUPA 1NK7A 2UUAK 2ZD1A 3LDOA 4DCHA 2VYPA 3SK3A 2FXUA 3B8AX 5AQPA 2DY4A 1NGDA 4DTRA 3CJCA 3ENOA 1IO2A 3C7NA 3HVRA 2W40A 4W5QA 4KO0A 2A41A 1VSIA 2VWKA 3VGLA 3FLCO 1IKYA 3NH0A 4YY3K 4JKBA 2DTUA 1BCMA 4OPAA 1HKGA 3TPQA 4MDAA 4RWTA 4A2AA 5HROA 4GW6A 4QS9A 4C23A 1KD1O 2D0BA 4BACA 3O4WA 3S3MA 1EETA 3RMBA 3LP2A 4X64K 3U8XA 3AA2A 2HB5A 3BF3A 1Q8IA 4G9ZA 2P9SA 2YX6A 3VQ5A 3QICA 1X3MA 1UA1A 3FR0A 1VQ6N 2V52B 5BREA 2D0PA 2GUIA 4KFBA 3EYZA 1WSEA 3TI0A 1GLAG 3HRGA 3WXIA 4IKFA 5FDLA 3KK3A 2NRZA 2F8TA 1L3TA 1K8AO 3GL1A 1NOZA 5ELZA 5GIPA 1SKWA 3ZSZA 4H4OA 1YHQN 2OTLN 2QKBA 4B8CA 2PBDA 2OZMA 1NLVA 2AJQA 2YKNA 5IWAK 4DFJA 3V9WA 1NWKA 1W97L 4DR2K 4WCEL 3DLLL 1ZYQA 4FXDA 3UB5A 3UIQA 4DV5K 4IFEA 1Q86O 1OH7A 2PAVA 3V9XA 4M3ZA 2E8AA 3L2VA 1K9MO 2GEMA 2KKZA 1QHTA 1NKCA 4BQLA 3BDPA 4PKGA 3ZYYX 3HPOA 4GV9A 3LP1A 4CF2A 2P9UA 1NGGA 4LSNA 1XQSC 4BDZA 3BGRA 4WFNL 1ATRA 1LWCA 4CECA 3FFKB 1KVCA 4E7JA 3RMDA 1VK0A 1BWFO 2WC9A 3O9UA 3DLKA 1VQ5N 1TYQA 4FWNA 4CEQA 3DRRA 4B9SA 1IG9A 4W5RA 1QVGM 2YNGA 1HYSA 2XRIA 2HNYA 2CGLA 4GVEA 4IJNA 4ISGA 4FW2A 4M45A 3I33A 4CIEA 4E7KA 3VGKA 4DU4A 3AA5X 4ICLA 4B08A 4W5NA 1MDUB 2FF6A 3K9KA 4LSLA 3G71N 4FLVA 4LF9K 3HM9A 3CQ8A 1C1CA 1TVRA 3IFRA 1D5AA 4YOWA 5M1PA 3C94A 2IS3A 4FJXA 2UUCK 2E2QA 4Q0BA 1WN7A 2OZSA 4BQZA 1RT3A 4FW1A 5E26A 2QWPA 4FM2A 3H46O 4DUYK 3VGMA 4DU3A 3AV9A 2YHXA 3CCMN 4Y1CA 4X62K 5BR8K 1HQEA 3HZ6A 1WSHA 4B1WB 3SQ4A 3NVKA 2ASOA 5C25A 3AVAA 4KB0A 2NRVA 2DFHA 1SQKA 3H08A 3OS0A 4JD2A 2OPQA 3R9PA 3VF6A 4O44A 2B6AA 4AHRA 4CEFA 1GLBG 1IKVA 5DM7L 3VEYA 5DK5A 5KTQA 3MWPA 5GADP 1TK8A 4BRGA 3ZT0A 4DS4A 3B6PA 4F4KA 4EHUA 4KI4A 3CPEA 3JXUA 3NCIA 5HBMA 3CCLN 1J5EK 4I9LA 4HVJA 1Z26A 3LAMA 3MCAB 4H0OA 3C6UA 4CEZA 4ID1A 4CERA 4PKIA 4LF8K 1X9JA 3CFOA 4BVPA 4F2RA 3H45C 3VEVA 5FPEA 4NXNK 3NE6A 4BRPA 4CJRA 1VQ9N 4B9VA 5AQNA 3O1BA 1RBTA 1ESVA 3CCSN 1X3NA 3LWMA 3ZETB 3QMLA 4IOAL 1EO1A 3T3FA 2F96A 2J4RA 5JLFA 1WSGA 5LL6Z 3QFUA 4K41A 1HR0K 3VPZA 2GWKA 3DAWA 3TR8A 4CZKA 3EN9A 5J2PA 1HYVA 4F2SA 3RR8A 2P9LB 3UKRB 1JLAA 3K58A 4H0VB 1X9MA 1BI4A 4CGDA 4OPJA 2Q0RA 1Z25A 2ZF5O 4H5VA 3SUOA 5HL7L 2E2NA 4JKFA 2QEXN 1XHZA 1JCFA 4CEDA 4FJHA 4IEEA 4DSJA 1MU2A 4JI6K 4HCCA 4DB3A 4FZZA 5JVGL 3G0ZA 5KPZA 1G99A 4DUZK 4EZ6A 2YJEA 3EKUA 4KKOA 4LFCK 2O8EB 4CEOA 5EX5A 1LAWA 1NKBA 3BP8A 1YVNA 3B6OA 4CIGA 5AQJA 1QSLA 4F3OA 4EIAA 2Q3SA 4HUFA 3ITHA 3CHWA 4M3XA 2PZSA 4AQYK 4LD0A 4FJLA 4DV3K 4I7FA 1VSEA 5AQXA 1YT3A 3CMAN 3VF2A 4FWQA 5AQSA 5BN8A 1NK6A 4I2QA 4C8MA 4BE2A 4B1VA 3PX6A 4O55A 2VWJA 1L3UA 2YNFA 3IUCA 1OH5A 1J54A 4DWIA 4M3RA 3UKUB 3ZETA 3I0RA 5GAEP 4FJ8A 3CJAA 4R5PA 1QVFM 3AARA 3P83D 3ZEUA 4FPAA 3LDLA 4CZHA 4K8XA 4ILJA 3SZ2A 4OGCA 3OYBA 1K6YA 3U3GA 5M1QA 1Q81O 3EZWA 1NK9A 3F5TA 1S3XA 3AVKA 5DMRA 1T8EA 3J7YP 5BRHA 3FZFA 3PV8A 3VMFB 4BGBA 1W2BM 3PX0A 2I7PA 5KRSA 1VSFA 5CY4A 4CJ7A 2A42A 3N4PA 4DLEA 3MECA 3KTQA 4JK9A 4KAZA 3THXA 4UQGA 3JAMO 3EZ5A 4CZJA 4N47A 1RT6A 5KQDA 3DYAA 1U2VB 3CQXA 1BQNA 1TL1A 3JSMA 4DQQA 3VENA 4FJJA 1VAZA 3L3VA 3K0SA 3TANA 4IZ9A 3ZSXA 3PO5A 3O1WA 2PYJA 2UXBK 1WBDA 2P9PA 3HP9A 3WNGA 1VSKA 4EP4A 2YI1A 4PA1A 2W6LA 4IDHA 2Q0UA 1OKJA 2BTFA 4YOTA 3A8YA 4FLWA 4CHOA 3LZJA 4WQ4A 1UWBA 3LPUA 4M41A 3IRXA 5C0YA 3A5LC 3S41A 4E3SA 2IAJA 3WEEA 5C12A 1ITGA 1REVA 3JS6A 1S9EA 3AVLA 3MX2A 3O08A 4BR5A 3KLHA 1X1PA 4BRCA 3GOIA 4UY8O 3LM2A 5TKWA 1RT7A 4FJ7A 3SV3A 2O8CB 4YHHK 2RE2A 2HBKA 3VEOA 3K59A 1T7PA 4NCBA 4CD1A 1ATSA 2E2PA 4DU1A 1W0HA 3TU5A 5BPLA 3FZHA 4DR4K 1C0TA 4CIFA 1TK5A 1LCUA 1Z6RA 5K14A 4CZGA 1MA9B 2DPNA 3WNHA 4BE0A 1RNHA 1DGKN 2ASMA 4FZXC 2QWLA 3BZCA 2QM1A 3H1QA 1SZ2A 5EXWA 4FWSA 3ZEUB 4FCYA 2P9SB 3VQ8A 5BRDA 2ZJQL 4DTUA 3D0PA 3VQ6A 2O8CA 2YHYA 3O3FA 2ITGA 2YHBA 2AA4A 2P5GA 1BHLA 2G8IA 1VQON 3EKSA 4CK1A 4HWIA 4E89A 4QOZB 5C42A 3MXIA 1S1TA 1XNQK 4DQRA 3QEPA 2B5JA 1GLCG 3HPHA 4K25A 4CJQA 3L2WA 4LY7A 4CEEA 1WSIA 2X6SA 4KTQA 3P4IA 4DFKA 3SUNA 5F2RA 5DM6L 3UKUA 4F9OA 1M1KO 4DSEA 1S1WA 2E5LK 1TGOA 4CJPA 3VQ4A 4CBXA 3SBTA 1IBMK 4BREA 2P9IB 5A2QO 5AQFA 3K57A 5CYQA 4JI0K 2E20A 1R59O 1RDDA 4ILGB 2HF3A 4CHQA 1ASWA 3S3NA 1GLDG 3AVNA 5LJVA 1WSJA 3ENBA 4CW7B 5AQVA 1UAXA 2V7YA 1NGEA 3MXMA 1HYZA 3WXLA 4FJGA 1VQKN 1RGIA 3M3ZA 4YOUA 3FGUA 4DHYA 3MXJA 2XY8A 3C0BA 1MWKA 3J8AA 1LW2A 4OGEA 2B4JA 3CIPA 3NMUA 4B3TK 2D4WA 3NF7A 3ZT3A 2BH1A 1S6QA 1BG3A 2P9IA 1VSJA 4GV3A 3OYMA 1JLFA 3WXKA 1KRPA 4J2EA 2ETJA 3WUHA 1NKEA 4BRFA 5AJ3K 4H5NA 4PHTX 3TWHA 2YV0X 4FJKA 1GLFO 4LFBK 4O8KA 4RG8A 1N8RO 1NM1A 4CGIA 4CK3A 3G6EN 5CYMA 1BUPA 5AQTA 2O8FB 2FLOA 3ZT2A 3IAYA 2X78A 1Q7YO 4BRIA 2QTDA 1VQ8N 3VQ7A 1WB9A 3H3NO 3TSQA 2ITMA 4BRKA 5KGXA 4XH1A 4Q5VA 3WNEA 4KTWA 3MMVA 3VEZA 4YOXA 3ZT4A 4HHTA 5IT9O 4E1NA 5M1OA 2ZGYA 1VRTA 3HL8A 1U4BA 4RW9A 4DV4K 1IJJA 1HNWK 1MWMA 1N6QA 4Z4GA 3WQTA 4LF4K 2CH5A 3ZSOA 4HUEA 3OYGA 3MX5A 3H1VX 5FROA 1KVAA 1C1AA 1TKZA 3SAFA 3QO9A 5AQGA 3CCVN 3DXMB 3IG1A 4KB1A 3K5NA 4MLHA 4O8UA 5BR9A 4ZTFA 2NRTA 3GG4A 3ATVA 4B1UB 5GAHP 4FSVA 4F3TA 3LM9A 1N36K 1LOTB 3MEEA 3NGIA 1NU0A 3TTFA 3SPZA 3QBXA 1UOCA 4JI2K 4EHTA 2KZZA 3KLEA 1U6ZA 3LPTA 4FWLA 4FJ5A 4EZ9A 3E9OA 5JLHA 4BC2A 3GE1A 4JHDB 2YNHA 1VQPN 3DRSA 4CHYA 5EVZA 2IVOA 3OW2M 3V9ZA 4JI5K 4RTFD 4QS8A 1EP4A 3I8DA 3BY5A 4OLAA 4BRDA 2P9LA 3CFRA 3NFAA 3V1OA 3DOKA 3C7NB 5T7BA 3C6AA 4BRAA 1J5OA 4CEBA 4CHNA 4OKJA 4JKEA 2Q1NA 3O3HA 1VSLA 4PUOA 1QQNA 2Z1IA 2O8DB 3KVGA 3PUFA 3TAFA 4FZYA 2NZTA 3FZMA 3AGRA 2RF2A 3LALA 1JJ2M 3MEGA 2DFFA 4CJEA 2ZM6K 2NLXA 1U48A 3VA3A 3BUZB 4K0KK 1ZBSA 1XUPO 3ZSWA 1L5UA 3WT0A 5M1NA 3QESA 5AZIB 2O4IA 1KFSA 3SMSA 4OKEA 1G15A 1J9AA 3TAEA 4KHYA 1D4XA 3OYLA 3M5RA 1QSSA 3AO5A 2E6LA 3IMXA 3ZLJA 1RTJA 2KLAA 1EX4A 2D0OA 4N76A 2IGIA 4FM0A 4C8KA 2NNWA 4JRPA 2UU9K 2IVPA 1QSYA 2Q36A 3F9KA 5BRFA 1NJZA 2FBTA 2FSNA 3L2QA 4OO1J 4M42A 3MWTA 4HTUA 5AQIA 3KD5E 4KHUA 5GINA 4DMNA 1U49A 4J2BA 2P5OA 4PQUA 1DEJA 3DXMA 1W7AA 3RMCA 2HBLA 4KV8A 4JK7A 4CFCA 2GX9A 4QCLA 1JLQA 1D9FA 4DSKA 3KJVA 4N56A 4CBWA 2NRXA 3ATUA 3VQ9A 1Q9YA 1VQ7N 5C2FA 2FSJA 3LDPA 4C8NA 3WQUA 3T19A 2A5XA 4A5BA 3VOVA 3O9QA 4CFDA 1LV5A 3EY1A 3O5BA 1KC8O 2Z1GA 3QINA 4BC3A 3OYHA 4CF1A 4BR7A 2CH6A 4O0JA 4H5RA 5AQHA 4EP5A 3OY9A 2QWNA 2WOMA 4DR7K 3OBYA 1JCEA 5GAGP 4ILHA 4CESA 1SV5A 3NF9A 1YVUA 3VETA 4AH9A 3SJHA 2G8FA 5FRMA 4DS5A 1C0UA 2P9KB 3VTHA 1BCOA 3DLBA 4NCAA 3VTIA 4CJWA 4I6MB 3LP3A 1BQMA 1DT9A 2NRRA 4CJVA 3DOLA 4QAGA 4A62A 1KVBA 4R79A 4WQ5A 4X65K 4OLBA 1SUQA 4BDYA 1IBKK 3VQEA 4Y1DA 5AFUA 1HNIA 2HNZA 3F9MA 4JS4A 3ZCMA 3DJCA 2QXFA 4K43A 1FXXA 5KPTA 4CD3A 1BA0A 4MO5A 3ULEA 4M3WA 5FLXO 1WUAA 3BZKA 5FPNA 2QW9A 3TAMA 1BO5O 4FWKA 2P9KA 4WQ4C 3AY9A 5C10A 4DTNA 1RT1A 3AO1A 3MN7A 1BI4B 5AQMA 3KWGA 5AZIA 4B9TA 3HVTA 3I8BA 2XY6A 3V1RA 4FVUA 2G8UA 1RDCA 1QHAA 1XI1A 4CGHA 1XMQK 2GWJA 2ZWHA 1L3SA 3M8SA 1RDWX 1QE1A 5HRRA 3KK1A 4CJ4A 4C1NI 5HOOA 1BIZA 2HMIA 1TV6A 3MEDA 3SAGA 2OYQA 3NHGA 1OH8A 1BISA 3LAKA 2O8EA 1LWFA 1QQCA 5AQKA 1LAVA 3HOTA 1KXPA 3PIPL 3A0IX 3VQAA 1X9SA 1T03A 1TKDA 4B1ZA 2FC0A 3CCEN 4CJ3A 3VQQA 4XEIA 1HJOA 3CJBA 4BR2A 4YDUA 1HQUA 1HUXA 4JI3K 1ZC6A 3AVHA 3AO3A 4I2PA 4I6MA 5AQZA 4O5BA 1ATNA 1NG9A 2HBMA 4E7IA 5LMNK 3QIPA 3NF6A 1HKCA 2IVNA 4GY2B 5E84A 3CC4N 3D45A 3L2RA 2QK9A 1WLJA 4Z4FA 4DG1A 3EEQA 4ID5A 3KHYA 3VESA 4E0DA 3SCXA 4FWOA 1RBSA 2AP1A 2UYTA 4MFBA 3V81A 1IV0A 3AVIA 4BR4A 3U3YA 3HTVA 3E9PA 1Q18A 4DTOA 5AQLA 4FLTA 4IG3A 3D2EA 2UUBK 3RRHA 3ZSYA 4WF9L 1DTQA 4A61A 4Z4IA 4JKGA 5H1SQ 1YAGA 4AHCA 2ZJRL 1FKOA 4LF6K 1JLGA 3PY8A 4ISEA 3THVA 1QZ5A 4PKHA 1Y64A 4CJTA 4FM1A 2HW3A 1IBLK 1NJYA 3SUQA 2Z1JA 3D6RA 3Q7BA 2EX3A 4KTZA 5AZJB 1WOQA 1JLBA 1I39A 4C8OA 2Y1JA 2VQFK 4N5SA 5JS2A 3CQYA 3CYMA 3AVCA 3KK2A 1W9HA 5EY4A 2BDPA 3OA9A 4CZFA 1C0FA 1WNSA 3NVMA 4FLYA 3THYA 5AFUH 3ENHA 4CZMA 3KKRA 5MLCQ 3HXMA 4IOCL 2O8BA 3ZSQA 4WFBL 4N41A 4IJAA 4LFAK 4C1NK 1HNVA 1OVQA 3E66A 4IO9L 4RW7A 2OCEA 3LWLA 3AO2A 1N32K 4GKJK 3J7AP 3QLHA 3ID6A 2ATQA 1NK4A 4ZTJA 1U47A 1QZ6A 4PL7A 2WBNA 4DSIA 3RWUA 2R7YA 1EKEA 4M63C 4CJUA 1YXQA 2P1JA 3LANA 4H4MA 3NF8A 3NBPA 4RCHA 4IXCA 2G8WA 1UA0A 1HJRA 3QIOA 4JLHA 5E41A 1HKBA 2XHBA 4DKWA 5LMUK 4FL9A 4CJFA 3CG7A 2YHWA 2PYLA 5J1EA 3OS1A 4JNEA 5BPMA 3THWB 3TSUA 1LWEA 4BRHA 4AHUA 4FWMA 1ZBUA 4JKAA 4BRQA 5LY3A 3P5JA 1VQ4N 4CHPA 2HHXA 4JKGB 4CFAA 1KAZA 3FZKA 4DTMA 3O80A 3ZX3A 1GLLO 3QBWA 2YJFA 1SKRA 4CEAA 2OA8A 2VG5A 3D2FA 4NYFA 1KFDA 1Q82O 3CCRN 2P9PB 4CFBA 3VERA 1C6VA 1RTHA 3CJ1A 1KAXA 3HSTB 4LF5K 3R3LA 1J53A 3AAQA 3LP0A 4B1XB 1KSPA 3O3GA 1VSDA 4FK2A 3MN9A 2KHOA 4DV2K 1NOYA 3KK7A 4DQPA 3DWLA 1SL1A 3CI5A 4B9MA 4KHQA 1FW6A 4H0PA 3OS2A 3CCQN 4DFMA 1KQSM 1O1WA 1A5WA 1H1VA 1D8YA 3TAQA 1ZBIA 4H0YB 4JI8K 5KRTA 3K5LA 1X9WA 4CJKA 4YNQA 3P1GA 2IOCA 2DFEA 1YTAA 5J2NA 4KH6A 3TTDA 1RTDA 3IDHA 3C65A 4IOXA 1TKTA 3VN5A 3LL3A 3VQPA 1RT2A 2W41A 3C6TA 1A5XA 5I3UA 5HRNA 1XNRK 1JCGA 2BE2A 2QA4N 2UXCK 4CZIA 4WFAL 1BL3A 3SBGA 1T44A 3WXJA 3LDQA 4E1MA 4AILC 3O4NA 4JAXA 1GOAA 1S1VA 2WUSA 1NK5A 3CPWM 2Q97A 2GUPA 4A2BA 2VG7A 4FLXA 3T1HK 1QTMA 3PO4A 1O13A 3SPYA 3QEXA 3MN6A 1ZBFA 3ZX0A 3M1FA 2KFNA 4OPHA 2YHAA 4DQ8A 4B9UA 3NGZA 1CLQA 3OVNA 3W0LA 3HOSA 3AA3A 3VEXA 1TK0A 3AAPA 3SV4A 4J2DA 4YOVA 2RHKA 4BR9A 1RILA 2VCPA 4IWVA 5HP1A 3SJJA 1J6ZA 4K42A 1JLCA 3AVJA 1SAZA 4JRQA 4B9QA 4KBOA 3CMEN 3TSPA 4BGAA 4KI6A 3TARA 2NRWA 2X74A 4Y0WA 2NRHA 4DTXA 3CM6A 5AQRA 1S5JA 5CE3A 4ELUA 4M3UA 2RN2A 4YOYA 4O4GA 2P9UB 3OYIA 3D2FB 2LSNA 3W3DA 5J2MA 2OANA 3D7EO 2QWOA 2I5JA 4XH5A 4CF8A 1YIJN 2QWMA 3F73A 1S22A 4JI7K 4J8FA 3KLFA 1VSHA 1L3VA 3O9TA 4DF8A 3WXMB 1IG8A 1Z05A 1U04A 2D1KA 5HRSA 1CZAN 3OJSA 3QDKA 4JHDA 1K8KA 1OH6A 2O8DA 1NGFA 4AHSA 3C6HA 3KIOA 4G1QA 4M3YA 1C0GA 1Y97A 3H6EA 3P39A 1YI2N 1ASUA 5CZ1A 3HK2A 3TAPA 2RKIA 2ZE2A 3SMPA 2O8FA 2F9TA 3JYTA 1F21A 3AVFA 2HOEA 1V4SA 3F2KA 4WE1A 5FRNA 2Y1IA 2PFUA 4OKKA 5GIOA 4BC4A 4A5AA 4CCHA 1JXBA 3AVBA 1RCHA 3SQ0A 3CXCM 3CCUN 5BN9A 2V7ZA 4CVNE 3RVCA 2F8SA 3DM2A 2XY5A 3UE5A 4Z94A 1CZBA 5D3GA 1K8KB 2QKKA 2IDOA 3DXKB 4KH5A 3QEWA 4BR0A 3KWIA 1FKPA 1BIUA 3E9LA 3OBWA 1P90A 3K5MA 4H0TB 1TUUA 4H03B 1CXQA 4LH5A 3L8BA 3DLHA 5KPRA 4FJ9A 1K73O 5F1XA 1B9DA 5JMVA 4IDKA 3HO1A 5AQUA 3NH1A 4M7YA 4JD2B 1NGHA 2FBYA 3QFPA 3SQ2A 1WBBA 2HHHK 4FLUA 5M1FA 4AM6A 2HHSA 3IS9A 3CETA 1CZ9A 1NBWA 1EQYA 3OYCA 2JWKA 1RDBA 4FOIA 3V6DA 4K8ZA 3DLRA 4JEPA 5CR4A 4PWDA 4JKCA 4E7LA 4B1YB 2BUPA 1BOTO 4FO0A 3T1AA 1YJWN 1IKWA 3QB0A 3G25A 1YF5L 1A5VA 4WYBA 1I3AA 2OPPA 1NK0A 3FFIA 5BPNA 2ZJPL 3NDKA 3S9HA 4CF0A 5KI6A 1JL1A 2P9NB 2G8VA 3M8RA 2QWQA 4NO7A 1GLJO 4DV1K 4BRNA 4BROA 3SAHA 2Q31A 4CK2A 5FPMA 3OYFA 3HP6A 2HHVA 3C95A 5JVHL 3GBTA 3NH2A 1S72N 3CC2N 4BG8A 2D0AA 4NCGA 4E7HA 1HPZA 1YJNN 1TYQB 4CE9A 3DI6A 4ELTA 3CJ7A 5ADXH 4EFHA 3D2EB 3I56N 4DTJA 3PX4A 3V9UA 4RW4A 3EL2A 4CGFA 1TAUA 1BU6O 1XMOK 4MQ3A 2GV9A 4CF9A 3O4QA 5B8HA 3TTCA 2P9NA 2FF3B 4JK8A 4H0XB 3QERA 3U9ZA 4AHTA 3LZIA 4NYNA 5AQQA 3HI0A 2D5RA 4BDPA 3A5NC 4EAHD 4CBUA 2KTQA 1NGCA 1FK9A 1ZBLA 4HCBA 2HHTA 3CM5A 2NUBA 1V4TA 3CFPA 1CXUA 1NGJA 1T6DA 1D9DA 3IKMA 3SLCA 3SNNA 1FJGK 2O4GA 2VWBA 4YFUA 1RFQA 1DLOA 3P38A 4IG0A 5TKYA 1S9GA 2G8HA 3THYB 3AVMA 1B9FA 3PIOL 2FSKA 1Q9XA 4WQ5C 1ILYA 2A3ZA 1S6PA 1JKHA 3O9SA 3SI6A 4CJLA 3ZSVA 3R1XA 3OYEA 3V9SA 1EWRA 3U9DA 3ASMA 3SQ1A 3LDSA 1RDAA 3HT3A 2A1RA 4BG9A 4DV6K 1E3MA 2CGJA 1TL3A 3TAGA 3G10A 1YJ9N 3HSCA 1WSFA 4DTSA 1TUYA 3M8QA 3OYAA 4FOEA 2XY7A 3MK6A 1NJWA 4LH4A 3L0QA 4FJMA 1P8ZA 3OYJA 5C2DA 4KRFA 1HPMA 1BGXT 1DTTA 1IH7A 3O9RA 1XC9A 5LJWA 4DR3K 1VSMA 1RTIA 4JI4K 4DR5K 4FJIA 3A5MC 4TSXA 5AQWA 3L6QA 4W5OA 3I0SA 4MLEA 4DSFA 4DQSA 4YDUC 4NLBA 4DSLA 3OYNA 4I9QA 1VRUA 3NGYA 3ULDA 4GV6A 4IEIA 2A40A 2G8KA 3CC7N 1RT5A 1N33K 1GOBA 2A1SA 5EOYA 3DLGA 3U4LA 3ULEB 4FVMA 4DV0K 1KLMA 1HRHA 1SL0A 1HNXK 1NJXA 2HVIA 3KLGA 4RW6A 2QI2A 1SKSA 2X6NA 4DTPA 3L4QA 2HF4A 4YORA 4A57A 4CZLA 4E1JA 4B9LA 2EHGA 4ELVA 4ISFA 4AF1A 3K5OA 4M7XA 3OJUA 3BF1A 1NNEA 3CCJN 2KFZA 2HBJA 3CERA 3QEVA 2VGNA 3M8PA 4GVMA 4Z4EA 4KHNA 5EU7A 1N5YA 4FLZA 3SYZA 3L4IA 4KHWA 4CZEA 3QNOA 3MN5A 4GKKK 1SS6A 1QQOA 4BRMA 3LDNA 4X66K 2WONA 4DF4A 1JL2A 1VHXA 3PSIA 4DLGA 4CJ5A 3DMJA 3A2FA 4XIUA 3U6FA 3H3OB 3ZSRA 1NGIA 1GOCA 4H5WA 4BC5A 4H8KA 3RTVA 3T69A 1EXQA 3WNFA 1XC3A 4AHVA 5SZTA 3AA4A 1NMNA 2HMPA 4B9NA 1T3VA 2YNIA 1YITN 4DQIA 2VQEK 5CZ2A 4KREA 1ASVA 1RDUA 3HM8A 2GBZA 4L8RB 3QETA 4M3TA 3ID8A 5M1KA 4DR1K 1ZBHA 4CJSA 3PSFA 4GMJB 2QXLA 2E6MA 4JKHA 4RW8A 4O5FA 3HJFA 1T6CA 2JLEA 2P51A 3J81O 2KW4A 1RBVA 4NXMK 1RBRA 3VF4A 2Z1HA 2ZGZA 3QEIA 3N4QA 3G4SN 2YKMA 1KLNA 5KQ8A 4W5TA 3OYDA 4B3RK 4NB4A 2EWSA 1VQMN 3RSEB 3VEWA 3J80O 1E4FT 1KAYA 4DV7K 3I55N 4U67L 1OVYA 4L3QA 3ALYA 3EE9A 3GDQA 2BGGA 4BWJA 1NJIO 4FWPA 3THXB 3KKSA 2F4VK 1QS4A 3K2PA 3BEXA 4BRLA 3KLIA 5J2QA 1HMVA 3ISNC 1GLEG 2GELA 2D0CA 2ASPA 3FE1A 3HYFA 4B8AB 3WEEB 4LC9B 1WAFA 1TAQA 4CGJA 4PL8A 4JS5A 2HVHA 2E2OA 5AQOA 3EO3A 3CF5L 3FZLA 1S1UA 5AZJA 5CHIA 2HSTA 3VQDA 4FYDA 1JXEA 5I42A 3UKRA 3CD6N 1JLEA 3VA0A 4BWMA 4DR6K 3OYKA 4F8RA 3VQBA 3O6WA 3RMAA 1NMDA 4XH4A 4H5TA 2ZQBA 3Q7CA 4PY5A 2WTUA 2UXDK 1LW0A 5KGWA 1KCFA 2W42A 3K9JA 3T7ZA
chains in the Genus database with same CATH topology
3MAQA 1JLQA 1R0AA 1D9FA 4DSKA 3KJVA 4N56A 2Q3SA 4HUFA 4O4GA 3ITHA 3VQ9A 1Q9YA 4M3XA 2PZSA 4LD0A 4FJLA 4C8NA 3OYIA 4I7FA 2FBVA 2LSNA 3KD1E 5JS1A 1VSEA 3T19A 5J2MA 4CFDA 1LV5A 1YT3A 3EY1A 2I5JA 4CF8A 1NK6A 3F73A 2Z1GA 4I2QA 3V1QA 3QINA 1VSHA 3KLFA 1L3VA 3OYHA 4CF1A 4C8MA 4J2AA 4BE2A 4Z4HA 5HLFA 4DF8A 4O0JA 4EP5A 3PX6A 4O55A 5HRSA 1U04A 5SWMA 3OY9A 2VWJA 2WOMA 1YTUA 4QCLA 1IKXA 5HRPA 3OJSA 1L3UA 2FBXA 2YNFA 1J54A 4DWIA 4M3RA 4AHSA 1U45A 1SV5A 3KIOA 4CESA 3I0RA 3NF9A 1YVUA 4G1QA 4R5PA 4FJ8A 1Y97A 4M3YA 4CGGA 1ASUA 5CZ1A 3P83D 3TAPA 4HUGA 3HK2A 4AH9A 2RKIA 1RT4A 2G8FA 2ZE2A 5FRMA 4DS5A 4K8XA 1TKXA 1C1BA 3JYTA 1RBUA 1F21A 3AVFA 3SZ2A 4OGCA 3V4IA 3OYBA 1K6YA 4WE1A 1C0UA 3U3GA 3VQCA 5FRNA 2Y1IA 1XHXA 1BCOA 3DLBA 3HPGA 1T05A 1NK9A 4OKKA 4NCAA 3AVKA 4OVLA 5DMRA 4CJWA 1T8EA 2JGUA 3LP3A 1BQMA 3PV8A 4CHZA 3PX0A 1JXBA 2BANA 3AVBA 4CJVA 3DOLA 1VSFA 5CY4A 5KRSA 3KTQA 4QAGA 4DLEA 3MECA 1KVBA 3AO4A 1RCHA 3SQ0A 4KAZA 4UQGA 4OPKA 4OLBA 1SUQA 3EZ5A 4BDYA 4FK4A 3VQEA 4Y1DA 4N47A 1RT6A 1HNIA 2HNZA 2F8SA 3DM2A 3DYAA 2XY5A 4JS4A 1CZBA 3ZCMA 4Z4CA 2QKKA 5D3GA 1BQNA 2QXFA 1TL1A 3QNNA 3DLEA 1NK8A 2IDOA 1FXXA 3JSMA 3S3OA 4DQQA 2PY5A 3QEWA 4FJJA 3AVGA 1FKPA 1BIUA 4M3WA 4Z0UA 4B3OA 3K5MA 1WAJA 3L3VA 3TANA 3L3UA 1CXQA 3ZSXA 2RPIA 4LH5A 3L8BA 3DLHA 3PO5A 3TAMA 3L2UA 4FJ9A 2PYJA 1B9DA 2E4LA 3HP9A 2KQ2A 3WNGA 4IDKA 3HO1A 3NH1A 1VSKA 4DTNA 4EP4A 4PA1A 1RT1A 3AO1A 2FBYA 1BI4B 2VG6A 3DRPA 3SQ2A 4B9TA 3HVTA 4FLWA 3V1RA 2XY6A 2G8UA 4OJRA 4IFYA 4CHOA 1RDCA 3LZJA 3RR7A 1XI1A 4CGHA 1UWBA 2HHQA 3LPUA 4M41A 3IRXA 4FLUA 4IFVA 5C24A 2OPRA 4DFPA 3TABA 3M8SA 4IBNA 1L3SA 2HHSA 3IS9A 2HHWA 1CZ9A 4E3SA 2IAJA 1B92A 3OYCA 4FK0A 1ITGA 1RDBA 1REVA 4KHSA 2HHUA 1QE1A 1KTQA 1S9EA 3AVLA 3V6DA 4K8ZA 3DLRA 3KLHA 4PWDA 1X1PA 5HRRA 4E7LA 2KZMA 3KK1A 4CJ4A 1RT7A 3T1AA 4FJ7A 3SV3A 1SL2A 1BIZA 2HMIA 1IKWA 1TV6A 3MEDA 2OYQA 3K59A 3NHGA 4BE1A 1A5VA 1BISA 1T7PA 4NCBA 3LAKA 4C8LA 1I3AA 4DU1A 1LWFA 2OPPA 1QQCA 1S1XA 1W0HA 3FFIA 1NK0A 3RRGA 4E19A 1LAVA 4ZHRA 3E01A 3NDKA 1C0TA 2OPSA 4CIFA 1TK5A 3S9HA 4CF0A 5KI6A 2IC3A 1JL1A 4KPYA 5K14A 3VQAA 2XO7A 3ZT1A 4FJNA 1X9SA 3WNHA 1T03A 1TKDA 2G8VA 4BE0A 2FC0A 3M8RA 1RNHA 2HNDA 4FZXC 1C0MA 3NAEA 4FCYA 4CK2A 4CJ3A 4O0IA 1XWLA 3VQQA 3VQ8A 3OYFA 3HP6A 3SUPA 1NK7A 2HHVA 3C95A 2ZD1A 3NH2A 2D0AA 4NCGA 4E7HA 1HPZA 2DY4A 4DTUA 4DTRA 1HQUA 3D0PA 3VQ6A 1IO2A 4CE9A 3O3FA 3DI6A 2ITGA 3AVHA 2YHBA 3HVRA 2P5GA 1BHLA 3AO3A 4ELTA 4I2PA 4CK1A 2G8IA 4E89A 4W5QA 4QOZB 4KO0A 4O5BA 5C42A 3MXIA 1S1TA 1VSIA 2VWKA 4DTJA 3PX4A 3V9UA 4RW4A 4E7IA 4DQRA 3QEPA 2B5JA 1IKYA 3QIPA 3NF6A 4CGFA 3NH0A 3HPHA 1TAUA 2DTUA 4CJQA 1BCMA 4LY7A 4CEEA 1WSIA 3L2WA 3D45A 2X6SA 2GV9A 4MQ3A 3O4QA 4CF9A 3L2RA 4KTQA 2QK9A 1WLJA 4DFKA 4Z4FA 3SUNA 4DG1A 4ID5A 3QERA 4GW6A 5HROA 2D0BA 4AHTA 3LZIA 4DSEA 4NYNA 4BACA 1S1WA 1EETA 1TGOA 3RMBA 3S3MA 4E0DA 4CJPA 2D5RA 3LP2A 3SCXA 3VQ4A 3AA2A 4BDPA 2HB5A 1RBSA 1Q8IA 4MFBA 3VQ5A 2KTQA 3V81A 1FK9A 3AVIA 3K57A 1ZBLA 5CYQA 3U3YA 4HCBA 2HHTA 1RDDA 3CM5A 1UA1A 4CHQA 1ASWA 2NUBA 3CFPA 1CXUA 3S3NA 4KFBA 2GUIA 3EYZA 3AVNA 4DTOA 1WSJA 1WSEA 1D9DA 4FLTA 1UAXA 4IG3A 3TI0A 3SNNA 2O4GA 4YFUA 3RRHA 3MXMA 3ZSYA 1HYZA 1DTQA 4FJGA 4Z4IA 4IKFA 1DLOA 4IG0A 4AHCA 5FDLA 3KK3A 1FKOA 1S9GA 2F8TA 1JLGA 1L3TA 3PY8A 1NOZA 2G8HA 3AVMA 1B9FA 3THVA 3MXJA 1Q9XA 1SKWA 2XY8A 3ZSZA 1S6PA 4H4OA 1JKHA 1LW2A 4CJTA 3SI6A 4FM1A 2QKBA 4B8CA 4OGEA 2B4JA 2HW3A 2HVIA 4CJLA 1NJYA 2OZMA 3SUQA 3ZSVA 2Z1JA 3NF7A 3OYEA 3V9SA 2AJQA 2EX3A 2YKNA 4KTZA 3ZT3A 1S6QA 1JLBA 1VSJA 3ASMA 3V9WA 4DFJA 1I39A 3SQ1A 1ZYQA 4FXDA 3LDSA 3OYMA 1JLFA 4C8OA 3UIQA 1RDAA 3HT3A 2Y1JA 1KRPA 4J2EA 2A1RA 4N5SA 2ETJA 5JS2A 1TL3A 1NKEA 3CYMA 3AVCA 3KK2A 1W9HA 3TAGA 2BDPA 3V9XA 4M3ZA 3G10A 1WSFA 3L2VA 4DTSA 3TWHA 2YV0X 4FJKA 1QHTA 1WNSA 3M8QA 1NKCA 3OYAA 3BDPA 4FLYA 3HPOA 2XY7A 4RG8A 3LP1A 1NJWA 4CF2A 4LH4A 4LSNA 4CGIA 4BDZA 4FJMA 3BGRA 4CK3A 1LWCA 4CECA 3KKRA 5CYMA 3OYJA 3HXMA 4KRFA 1KVCA 3ZSQA 1BGXT 3ZT2A 4E7JA 3RMDA 3IAYA 4N41A 1VK0A 2X78A 1DTTA 1IH7A 1HNVA 1XC9A 3DLKA 3VQ7A 1VSMA 1RTIA 4RW7A 4FJIA 3LWLA 4CEQA 3AO2A 4TSXA 5KGXA 3DRRA 4W5OA 4B9SA 3I0SA 3QLHA 1IG9A 4Q5VA 2ATQA 3WNEA 1NK4A 4KTWA 4ZTJA 1U47A 4W5RA 4DSFA 2YNGA 4DQSA 1HYSA 2XRIA 4DSLA 2HNYA 3ZT4A 3OYNA 1VRUA 3NGYA 4HHTA 2R7YA 3ULDA 4DSIA 3RWUA 4I9QA 4E1NA 2G8KA 1RT5A 1EKEA 1VRTA 3HL8A 1GOBA 2A1SA 4FW2A 4CJUA 1U4BA 2P1JA 3DLGA 3LANA 4H4MA 4RW9A 3NF8A 4M45A 4CIEA 3NBPA 4FVMA 4E7KA 1N6QA 4DU4A 1KLMA 1HRHA 1SL0A 3AA5X 4ICLA 4B08A 2G8WA 4Z4GA 1UA0A 1NJXA 4W5NA 3ZSOA 4HUEA 1HJRA 4LSLA 4FLVA 3OYGA 3QIOA 4JLHA 5E41A 3HM9A 3CQ8A 3KLGA 4RW6A 1C1CA 1SKSA 2X6NA 1TVRA 2XHBA 1D5AA 4DTPA 5FROA 1KVAA 3CG7A 4CJFA 2PYLA 3C94A 5J1EA 3OS1A 2IS3A 4FJXA 1C1AA 1TKZA 3QO9A 4Q0BA 1LWEA 4B9LA 1WN7A 2EHGA 4ELVA 3K5OA 4AHUA 1ZBUA 3OJUA 3IG1A 3P5JA 2OZSA 4KB1A 4CHPA 1RT3A 3K5NA 4FW1A 2HHXA 4CFAA 2KFZA 4DTMA 4FM2A 3QEVA 3M8PA 4GVMA 4Z4EA 4KHNA 4DU3A 4ZTFA 5EU7A 3AV9A 1N5YA 4FLZA 3SYZA 4Y1CA 1SKRA 4CEAA 2OA8A 3QNOA 4KHWA 2VG5A 4F3TA 1HQEA 4NYFA 1WSHA 3SQ4A 5C25A 3AVAA 4KB0A 1KFDA 3MEEA 3NGIA 2DFHA 2WONA 4CFBA 4DF4A 1C6VA 3H08A 1JL2A 1RTHA 3OS0A 3SPZA 1UOCA 2KZZA 3HSTB 2OPQA 4CJ5A 3DMJA 4DLGA 3KLEA 1J53A 3A2FA 2B6AA 4O44A 3LPTA 4AHRA 4XIUA 3U6FA 4CEFA 3LP0A 1IKVA 3ZSRA 4FJ5A 1GOCA 1KSPA 4EZ9A 3O3GA 4H8KA 3RTVA 1VSDA 4FK2A 5DK5A 5KTQA 1TK8A 4DQPA 2YNHA 1NOYA 3ZT0A 4DS4A 3DRSA 3B6PA 4F4KA 4CHYA 4KI4A 1SL1A 4B9MA 1EXQA 3WNFA 4AHVA 5SZTA 4KHQA 3NCIA 5HBMA 3V9ZA 3AA4A 4I9LA 3OS2A 1EP4A 4DFMA 4B9NA 4HVJA 2YNIA 1Z26A 3I8DA 3LAMA 3C6UA 1O1WA 4CEZA 4DQIA 4ID1A 4CERA 4OLAA 1A5WA 1D8YA 3TAQA 5CZ2A 3CFRA 3NFAA 3CFOA 1ZBIA 4F2RA 4KREA 1ASVA 3V1OA 5KRTA 3K5LA 1X9WA 4CJKA 3DOKA 3NE6A 4YNQA 2GBZA 3P1GA 5T7BA 3QETA 4CJRA 4L8RB 2IOCA 4M3TA 1ZBHA 1J5OA 2DFEA 4CEBA 1YTAA 4OKJA 4CJSA 4GMJB 4CHNA 4B9VA 5J2NA 4CCHA 1RTDA 3O3HA 1RBTA 2E6MA 1VSLA 4RW8A 4PUOA 3HJFA 2JLEA 1TKTA 2P51A 3VN5A 2KW4A 2Z1IA 3VQPA 1RT2A 1RBVA 1RBRA 3C6TA 2Z1HA 1A5XA 3QEIA 3LWMA 3PUFA 5I3UA 5HRNA 3TAFA 2BE2A 4FZYA 3T3FA 2YKMA 2F96A 1KLNA 2RF2A 1BL3A 1WSGA 3LALA 3MEGA 2DFFA 4W5TA 3OYDA 4E1MA 4AILC 4CJEA 3O4NA 1GOAA 1S1VA 3TR8A 5J2PA 1U48A 1NK5A 1HYVA 3VA3A 4F2SA 3RR8A 1JLAA 3K58A 3ALYA 2VG7A 4FLXA 2BGGA 3ZSWA 4BWJA 1QTMA 1X9MA 1L5UA 1BI4A 4CGDA 4OPJA 3QESA 3KKSA 3PO4A 1QS4A 3K2PA 3SPYA 2O4IA 3QEXA 3KLIA 1Z25A 1KFSA 3SUOA 1ZBFA 5J2QA 2KFNA 4OKEA 1HMVA 3ISNC 1G15A 1J9AA 3TAEA 4KHYA 2YHAA 1QSSA 3OYLA 1XHZA 3AO5A 2E6LA 4CEDA 4FJHA 2D0CA 4B9UA 4DSJA 1MU2A 3HYFA 4B8AB 3NGZA 1RTJA 1WAFA 1CLQA 3OVNA 4HCCA 1EX4A 4FZZA 1TAQA 3AA3A 4N76A 1TK0A 2IGIA 4CGJA 4JS5A 4FM0A 3SV4A 4C8KA 2HVHA 4J2DA 4JRPA 3G0ZA 1RILA 1QSYA 3F9KA 5HP1A 1S1UA 3SJJA 3VQDA 4FYDA 4EZ6A 1JLCA 1JXEA 3AVJA 2FBTA 4JRQA 5I42A 1NJZA 3L2QA 4M42A 4HTUA 4KKOA 1JLEA 3VA0A 4BWMA 3OYKA 4CEOA 3VQBA 4F8RA 3RMAA 1LAWA 3KD5E 4KHUA 4KI6A 3TARA 1NKBA 2ZQBA 4J2BA 4DMNA 2X74A 1U49A 2P5OA 3B6OA 4PQUA 4DTXA 3CM6A 4PY5A 1S5JA 3RMCA 1LW0A 4ELUA 4M3UA 5KGWA 1KCFA 4KV8A 4CIGA 2W42A 4CFCA 2RN2A 1QSLA 4F3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MAQ A;  1JLQ A;  1R0A A;  1D9F A;  4DSK A;  3KJV A;  4N56 A;  2Q3S A;  4HUF A;  4O4G A;  3ITH A;  3VQ9 A;  1Q9Y A;  4M3X A;  2PZS A;  4LD0 A;  4FJL A;  4C8N A;  3OYI A;  4I7F A;  2FBV A;  2LSN A;  3KD1 E;  5JS1 A;  1VSE A;  3T19 A;  5J2M A;  4CFD A;  1LV5 A;  1YT3 A;  3EY1 A;  2I5J A;  4CF8 A;  1NK6 A;  3F73 A;  2Z1G A;  4I2Q A;  3V1Q A;  3QIN A;  1VSH A;  3KLF A;  1L3V A;  3OYH A;  4CF1 A;  4C8M A;  4J2A A;  4BE2 A;  4Z4H A;  5HLF A;  4DF8 A;  4O0J A;  4EP5 A;  3PX6 A;  4O55 A;  5HRS A;  1U04 A;  5SWM A;  3OY9 A;  2VWJ A;  2WOM A;  1YTU A;  4QCL A;  1IKX A;  5HRP A;  3OJS A;  1L3U A;  2FBX A;  2YNF A;  1J54 A;  4DWI A;  4M3R A;  4AHS A;  1U45 A;  1SV5 A;  3KIO A;  4CES A;  3I0R A;  3NF9 A;  1YVU A;  4G1Q A;  4R5P A;  4FJ8 A;  1Y97 A;  4M3Y A;  4CGG A;  1ASU A;  5CZ1 A;  3P83 D;  3TAP A;  4HUG A;  3HK2 A;  4AH9 A;  2RKI A;  1RT4 A;  2G8F A;  2ZE2 A;  5FRM A;  4DS5 A;  4K8X A;  1TKX A;  1C1B A;  3JYT A;  1RBU A;  1F21 A;  3AVF A;  3SZ2 A;  4OGC A;  3V4I A;  3OYB A;  1K6Y A;  4WE1 A;  1C0U A;  3U3G A;  3VQC A;  5FRN A;  2Y1I A;  1XHX A;  1BCO A;  3DLB A;  3HPG A;  1T05 A;  1NK9 A;  4OKK A;  4NCA A;  3AVK A;  4OVL A;  5DMR A;  4CJW A;  1T8E A;  2JGU A;  3LP3 A;  1BQM A;  3PV8 A;  4CHZ A;  3PX0 A;  1JXB A;  2BAN A;  3AVB A;  4CJV A;  3DOL A;  1VSF A;  5CY4 A;  5KRS A;  3KTQ A;  4QAG A;  4DLE A;  3MEC A;  1KVB A;  3AO4 A;  1RCH A;  3SQ0 A;  4KAZ A;  4UQG A;  4OPK A;  4OLB A;  1SUQ A;  3EZ5 A;  4BDY A;  4FK4 A;  3VQE A;  4Y1D A;  4N47 A;  1RT6 A;  1HNI A;  2HNZ A;  2F8S A;  3DM2 A;  3DYA A;  2XY5 A;  4JS4 A;  1CZB A;  3ZCM A;  4Z4C A;  2QKK A;  5D3G A;  1BQN A;  2QXF A;  1TL1 A;  3QNN A;  3DLE A;  1NK8 A;  2IDO A;  1FXX A;  3JSM A;  3S3O A;  4DQQ A;  2PY5 A;  3QEW A;  4FJJ A;  3AVG A;  1FKP A;  1BIU A;  4M3W A;  4Z0U A;  4B3O A;  3K5M A;  1WAJ A;  3L3V A;  3TAN A;  3L3U A;  1CXQ A;  3ZSX A;  2RPI A;  4LH5 A;  3L8B A;  3DLH A;  3PO5 A;  3TAM A;  3L2U A;  4FJ9 A;  2PYJ A;  1B9D A;  2E4L A;  3HP9 A;  2KQ2 A;  3WNG A;  4IDK A;  3HO1 A;  3NH1 A;  1VSK A;  4DTN A;  4EP4 A;  4PA1 A;  1RT1 A;  3AO1 A;  2FBY A;  1BI4 B;  2VG6 A;  3DRP A;  3SQ2 A;  4B9T A;  3HVT A;  4FLW A;  3V1R A;  2XY6 A;  2G8U A;  4OJR A;  4IFY A;  4CHO A;  1RDC A;  3LZJ A;  3RR7 A;  1XI1 A;  4CGH A;  1UWB A;  2HHQ A;  3LPU A;  4M41 A;  3IRX A;  4FLU A;  4IFV A;  5C24 A;  2OPR A;  4DFP A;  3TAB A;  3M8S A;  4IBN A;  1L3S A;  2HHS A;  3IS9 A;  2HHW A;  1CZ9 A;  4E3S A;  2IAJ A;  1B92 A;  3OYC A;  4FK0 A;  1ITG A;  1RDB A;  1REV A;  4KHS A;  2HHU A;  1QE1 A;  1KTQ A;  1S9E A;  3AVL A;  3V6D A;  4K8Z A;  3DLR A;  3KLH A;  4PWD A;  1X1P A;  5HRR A;  4E7L A;  2KZM A;  3KK1 A;  4CJ4 A;  1RT7 A;  3T1A A;  4FJ7 A;  3SV3 A;  1SL2 A;  1BIZ A;  2HMI A;  1IKW A;  1TV6 A;  3MED A;  2OYQ A;  3K59 A;  3NHG A;  4BE1 A;  1A5V A;  1BIS A;  1T7P A;  4NCB A;  3LAK A;  4C8L A;  1I3A A;  4DU1 A;  1LWF A;  2OPP A;  1QQC A;  1S1X A;  1W0H A;  3FFI A;  1NK0 A;  3RRG A;  4E19 A;  1LAV A;  4ZHR A;  3E01 A;  3NDK A;  1C0T A;  2OPS A;  4CIF A;  1TK5 A;  3S9H A;  4CF0 A;  5KI6 A;  2IC3 A;  1JL1 A;  4KPY A;  5K14 A;  3VQA A;  2XO7 A;  3ZT1 A;  4FJN A;  1X9S A;  3WNH A;  1T03 A;  1TKD A;  2G8V A;  4BE0 A;  2FC0 A;  3M8R A;  1RNH A;  2HND A;  4FZX C;  1C0M A;  3NAE A;  4FCY A;  4CK2 A;  4CJ3 A;  4O0I A;  1XWL A;  3VQQ A;  3VQ8 A;  3OYF A;  3HP6 A;  3SUP A;  1NK7 A;  2HHV A;  3C95 A;  2ZD1 A;  3NH2 A;  2D0A A;  4NCG A;  4E7H A;  1HPZ A;  2DY4 A;  4DTU A;  4DTR A;  1HQU A;  3D0P A;  3VQ6 A;  1IO2 A;  4CE9 A;  3O3F A;  3DI6 A;  2ITG A;  3AVH A;  2YHB A;  3HVR A;  2P5G A;  1BHL A;  3AO3 A;  4ELT A;  4I2P A;  4CK1 A;  2G8I A;  4E89 A;  4W5Q A;  4QOZ B;  4KO0 A;  4O5B A;  5C42 A;  3MXI A;  1S1T A;  1VSI A;  2VWK A;  4DTJ A;  3PX4 A;  3V9U A;  4RW4 A;  4E7I A;  4DQR A;  3QEP A;  2B5J A;  1IKY A;  3QIP A;  3NF6 A;  4CGF A;  3NH0 A;  3HPH A;  1TAU A;  2DTU A;  4CJQ A;  1BCM A;  4LY7 A;  4CEE A;  1WSI A;  3L2W A;  3D45 A;  2X6S A;  2GV9 A;  4MQ3 A;  3O4Q A;  4CF9 A;  3L2R A;  4KTQ A;  2QK9 A;  1WLJ A;  4DFK A;  4Z4F A;  3SUN A;  4DG1 A;  4ID5 A;  3QER A;  4GW6 A;  5HRO A;  2D0B A;  4AHT A;  3LZI A;  4DSE A;  4NYN A;  4BAC A;  1S1W A;  1EET A;  1TGO A;  3RMB A;  3S3M A;  4E0D A;  4CJP A;  2D5R A;  3LP2 A;  3SCX A;  3VQ4 A;  3AA2 A;  4BDP A;  2HB5 A;  1RBS A;  1Q8I A;  4MFB A;  3VQ5 A;  2KTQ A;  3V81 A;  1FK9 A;  3AVI A;  3K57 A;  1ZBL A;  5CYQ A;  3U3Y A;  4HCB A;  2HHT A;  1RDD A;  3CM5 A;  1UA1 A;  4CHQ A;  1ASW A;  2NUB A;  3CFP A;  1CXU A;  3S3N A;  4KFB A;  2GUI A;  3EYZ A;  3AVN A;  4DTO A;  1WSJ A;  1WSE A;  1D9D A;  4FLT A;  1UAX A;  4IG3 A;  3TI0 A;  3SNN A;  2O4G A;  4YFU A;  3RRH A;  3MXM A;  3ZSY A;  1HYZ A;  1DTQ A;  4FJG A;  4Z4I A;  4IKF A;  1DLO A;  4IG0 A;  4AHC A;  5FDL A;  3KK3 A;  1FKO A;  1S9G A;  2F8T A;  1JLG A;  1L3T A;  3PY8 A;  1NOZ A;  2G8H A;  3AVM A;  1B9F A;  3THV A;  3MXJ A;  1Q9X A;  1SKW A;  2XY8 A;  3ZSZ A;  1S6P A;  4H4O A;  1JKH A;  1LW2 A;  4CJT A;  3SI6 A;  4FM1 A;  2QKB A;  4B8C A;  4OGE A;  2B4J A;  2HW3 A;  2HVI A;  4CJL A;  1NJY A;  2OZM A;  3SUQ A;  3ZSV A;  2Z1J A;  3NF7 A;  3OYE A;  3V9S A;  2AJQ A;  2EX3 A;  2YKN A;  4KTZ A;  3ZT3 A;  1S6Q A;  1JLB A;  1VSJ A;  3ASM A;  3V9W A;  4DFJ A;  1I39 A;  3SQ1 A;  1ZYQ A;  4FXD A;  3LDS A;  3OYM A;  1JLF A;  4C8O A;  3UIQ A;  1RDA A;  3HT3 A;  2Y1J A;  1KRP A;  4J2E A;  2A1R A;  4N5S A;  2ETJ A;  5JS2 A;  1TL3 A;  1NKE A;  3CYM A;  3AVC A;  3KK2 A;  1W9H A;  3TAG A;  2BDP A;  3V9X A;  4M3Z A;  3G10 A;  1WSF A;  3L2V A;  4DTS A;  3TWH A;  2YV0 X;  4FJK A;  1QHT A;  1WNS A;  3M8Q A;  1NKC A;  3OYA A;  3BDP A;  4FLY A;  3HPO A;  2XY7 A;  4RG8 A;  3LP1 A;  1NJW A;  4CF2 A;  4LH4 A;  4LSN A;  4CGI A;  4BDZ A;  4FJM A;  3BGR A;  4CK3 A;  1LWC A;  4CEC A;  3KKR A;  5CYM A;  3OYJ A;  3HXM A;  4KRF A;  1KVC A;  3ZSQ A;  1BGX T;  3ZT2 A;  4E7J A;  3RMD A;  3IAY A;  4N41 A;  1VK0 A;  2X78 A;  1DTT A;  1IH7 A;  1HNV A;  1XC9 A;  3DLK A;  3VQ7 A;  1VSM A;  1RTI A;  4RW7 A;  4FJI A;  3LWL A;  4CEQ A;  3AO2 A;  4TSX A;  5KGX A;  3DRR A;  4W5O A;  4B9S A;  3I0S A;  3QLH A;  1IG9 A;  4Q5V A;  2ATQ A;  3WNE A;  1NK4 A;  4KTW A;  4ZTJ A;  1U47 A;  4W5R A;  4DSF A;  2YNG A;  4DQS A;  1HYS A;  2XRI A;  4DSL A;  2HNY A;  3ZT4 A;  3OYN A;  1VRU A;  3NGY A;  4HHT A;  2R7Y A;  3ULD A;  4DSI A;  3RWU A;  4I9Q A;  4E1N A;  2G8K A;  1RT5 A;  1EKE A;  1VRT A;  3HL8 A;  1GOB A;  2A1S A;  4FW2 A;  4CJU A;  1U4B A;  2P1J A;  3DLG A;  3LAN A;  4H4M A;  4RW9 A;  3NF8 A;  4M45 A;  4CIE A;  3NBP A;  4FVM A;  4E7K A;  1N6Q A;  4DU4 A;  1KLM A;  1HRH A;  1SL0 A;  3AA5 X;  4ICL A;  4B08 A;  2G8W A;  4Z4G A;  1UA0 A;  1NJX A;  4W5N A;  3ZSO A;  4HUE A;  1HJR A;  4LSL A;  4FLV A;  3OYG A;  3QIO A;  4JLH A;  5E41 A;  3HM9 A;  3CQ8 A;  3KLG A;  4RW6 A;  1C1C A;  1SKS A;  2X6N A;  1TVR A;  2XHB A;  1D5A A;  4DTP A;  5FRO A;  1KVA A;  3CG7 A;  4CJF A;  2PYL A;  3C94 A;  5J1E A;  3OS1 A;  2IS3 A;  4FJX A;  1C1A A;  1TKZ A;  3QO9 A;  4Q0B A;  1LWE A;  4B9L A;  1WN7 A;  2EHG A;  4ELV A;  3K5O A;  4AHU A;  1ZBU A;  3OJU A;  3IG1 A;  3P5J A;  2OZS A;  4KB1 A;  4CHP A;  1RT3 A;  3K5N A;  4FW1 A;  2HHX A;  4CFA A;  2KFZ A;  4DTM A;  4FM2 A;  3QEV A;  3M8P A;  4GVM A;  4Z4E A;  4KHN A;  4DU3 A;  4ZTF A;  5EU7 A;  3AV9 A;  1N5Y A;  4FLZ A;  3SYZ A;  4Y1C A;  1SKR A;  4CEA A;  2OA8 A;  3QNO A;  4KHW A;  2VG5 A;  4F3T A;  1HQE A;  4NYF A;  1WSH A;  3SQ4 A;  5C25 A;  3AVA A;  4KB0 A;  1KFD A;  3MEE A;  3NGI A;  2DFH A;  2WON A;  4CFB A;  4DF4 A;  1C6V A;  3H08 A;  1JL2 A;  1RTH A;  3OS0 A;  3SPZ A;  1UOC A;  2KZZ A;  3HST B;  2OPQ A;  4CJ5 A;  3DMJ A;  4DLG A;  3KLE A;  1J53 A;  3A2F A;  2B6A A;  4O44 A;  3LPT A;  4AHR A;  4XIU A;  3U6F A;  4CEF A;  3LP0 A;  1IKV A;  3ZSR A;  4FJ5 A;  1GOC A;  1KSP A;  4EZ9 A;  3O3G A;  4H8K A;  3RTV A;  1VSD A;  4FK2 A;  5DK5 A;  5KTQ A;  1TK8 A;  4DQP A;  2YNH A;  1NOY A;  3ZT0 A;  4DS4 A;  3DRS A;  3B6P A;  4F4K A;  4CHY A;  4KI4 A;  1SL1 A;  4B9M A;  1EXQ A;  3WNF A;  4AHV A;  5SZT A;  4KHQ A;  3NCI A;  5HBM A;  3V9Z A;  3AA4 A;  4I9L A;  3OS2 A;  1EP4 A;  4DFM A;  4B9N A;  4HVJ A;  2YNI A;  1Z26 A;  3I8D A;  3LAM A;  3C6U A;  1O1W A;  4CEZ A;  4DQI A;  4ID1 A;  4CER A;  4OLA A;  1A5W A;  1D8Y A;  3TAQ A;  5CZ2 A;  3CFR A;  3NFA A;  3CFO A;  1ZBI A;  4F2R A;  4KRE A;  1ASV A;  3V1O A;  5KRT A;  3K5L A;  1X9W A;  4CJK A;  3DOK A;  3NE6 A;  4YNQ A;  2GBZ A;  3P1G A;  5T7B A;  3QET A;  4CJR A;  4L8R B;  2IOC A;  4M3T A;  1ZBH A;  1J5O A;  2DFE A;  4CEB A;  1YTA A;  4OKJ A;  4CJS A;  4GMJ B;  4CHN A;  4B9V A;  5J2N A;  4CCH A;  1RTD A;  3O3H A;  1RBT A;  2E6M A;  1VSL A;  4RW8 A;  4PUO A;  3HJF A;  2JLE A;  1TKT A;  2P51 A;  3VN5 A;  2KW4 A;  2Z1I A;  3VQP A;  1RT2 A;  1RBV A;  1RBR A;  3C6T A;  2Z1H A;  1A5X A;  3QEI A;  3LWM A;  3PUF A;  5I3U A;  5HRN A;  3TAF A;  2BE2 A;  4FZY A;  3T3F A;  2YKM A;  2F96 A;  1KLN A;  2RF2 A;  1BL3 A;  1WSG A;  3LAL A;  3MEG A;  2DFF A;  4W5T A;  3OYD A;  4E1M A;  4AIL C;  4CJE A;  3O4N A;  1GOA A;  1S1V A;  3TR8 A;  5J2P A;  1U48 A;  1NK5 A;  1HYV A;  3VA3 A;  4F2S A;  3RR8 A;  1JLA A;  3K58 A;  3ALY A;  2VG7 A;  4FLX A;  2BGG A;  3ZSW A;  4BWJ A;  1QTM A;  1X9M A;  1L5U A;  1BI4 A;  4CGD A;  4OPJ A;  3QES A;  3KKS A;  3PO4 A;  1QS4 A;  3K2P A;  3SPY A;  2O4I A;  3QEX A;  3KLI A;  1Z25 A;  1KFS A;  3SUO A;  1ZBF A;  5J2Q A;  2KFN A;  4OKE A;  1HMV A;  3ISN C;  1G15 A;  1J9A A;  3TAE A;  4KHY A;  2YHA A;  1QSS A;  3OYL A;  1XHZ A;  3AO5 A;  2E6L A;  4CED A;  4FJH A;  2D0C A;  4B9U A;  4DSJ A;  1MU2 A;  3HYF A;  4B8A B;  3NGZ A;  1RTJ A;  1WAF A;  1CLQ A;  3OVN A;  4HCC A;  1EX4 A;  4FZZ A;  1TAQ A;  3AA3 A;  4N76 A;  1TK0 A;  2IGI A;  4CGJ A;  4JS5 A;  4FM0 A;  3SV4 A;  4C8K A;  2HVH A;  4J2D A;  4JRP A;  3G0Z A;  1RIL A;  1QSY A;  3F9K A;  5HP1 A;  1S1U A;  3SJJ A;  3VQD A;  4FYD A;  4EZ6 A;  1JLC A;  1JXE A;  3AVJ A;  2FBT A;  4JRQ A;  5I42 A;  1NJZ A;  3L2Q A;  4M42 A;  4HTU A;  4KKO A;  1JLE A;  3VA0 A;  4BWM A;  3OYK A;  4CEO A;  3VQB A;  4F8R A;  3RMA A;  1LAW A;  3KD5 E;  4KHU A;  4KI6 A;  3TAR A;  1NKB A;  2ZQB A;  4J2B A;  4DMN A;  2X74 A;  1U49 A;  2P5O A;  3B6O A;  4PQU A;  4DTX A;  3CM6 A;  4PY5 A;  1S5J A;  3RMC A;  1LW0 A;  4ELU A;  4M3U A;  5KGW A;  1KCF A;  4KV8 A;  4CIG A;  2W42 A;  4CFC A;  2RN2 A;  1QSL A;  4F3O A; 
#chains in the Genus database with same CATH topology
 3MAQ A;  1R0A A;  2F7T A;  1M90 O;  2FBV A;  3KZB A;  4JN4 A;  4MDB A;  3KD1 E;  4OX9 K;  5JS1 A;  2V51 B;  4U7B A;  4HTL A;  3CJ9 A;  3HBT A;  2WFB A;  3V1Q A;  1EWQ A;  4J2A A;  4Z4H A;  3OTO K;  5HLF A;  4A59 A;  5SWM A;  1YTU A;  2CGK A;  2I7N A;  1IKX A;  5HRP A;  2FBX A;  3A5O C;  2VGM A;  2E1Y A;  2E88 A;  5I9E B;  3DXK A;  1U45 A;  2E1Z A;  5C15 A;  4CGG A;  4HUG A;  1QQM A;  2OTJ N;  1RT4 A;  1VQL N;  3P31 A;  2O8B B;  1TKX A;  1C1B A;  1RBU A;  4MO4 A;  4JKD A;  3V4I A;  3VQC A;  1XHX A;  4KH4 A;  3HPG A;  4JI1 K;  1T05 A;  4OVL A;  1E4G T;  2JGU A;  2A6A A;  4CHZ A;  3J7Z O;  2BAN A;  3T1Y K;  4CI6 A;  3AO4 A;  2YCH A;  4OPK A;  4FK4 A;  3M6G A;  4Z4C A;  4FPB A;  4V19 S;  1BDG A;  3QNN A;  1NK8 A;  1HX1 A;  3DLE A;  3EE8 A;  3E1Y A;  3R8E A;  3PLA A;  5ADX A;  3S3O A;  4LF7 K;  2PY5 A;  3AVG A;  4Z0U A;  1HNZ K;  4B3O A;  1WAJ A;  3RSE A;  3L3U A;  2RPI A;  3L2U A;  2E4L A;  2GTD A;  2KQ2 A;  1N34 K;  4KHP K;  2IIR A;  5AQY A;  1HLU A;  5JIC A;  2VG6 A;  3DRP A;  3THW A;  4NLC A;  5F0X A;  4OJR A;  1YUW A;  4IFY A;  4BVO A;  4BY9 C;  3RR7 A;  4B3S K;  2HHQ A;  4DFP A;  4IFV A;  5C24 A;  2OPR A;  3TAB A;  2HHW A;  4IBN A;  1VQN N;  3ZX2 A;  1U2V A;  2F9W A;  1B92 A;  4QS7 A;  4FK0 A;  2HHU A;  4KHS A;  1KTQ A;  2QWR A;  4AM7 A;  4B3M K;  3O8M A;  2KZM A;  2JWL A;  4IO8 A;  1SL2 A;  1ZXO A;  4JYA K;  5AR0 A;  3MCP A;  1BA1 A;  4BE1 A;  2Q2R A;  3R6M A;  4C8L A;  3AGK A;  1S1X A;  3RRG A;  4E19 A;  4GNI A;  4ZHR A;  3E01 A;  2W6K A;  2OPS A;  1DKG D;  2IC3 A;  2H3G X;  4JV5 K;  4KPY A;  2XO7 A;  3ZT1 A;  5FPD A;  4FJN A;  1NGA A;  2HND A;  1C0M A;  1NGB A;  3MDQ A;  4FWR A;  1I94 K;  3NAE A;  3OHR A;  4O0I A;  1XWL A;  3SUP A;  1NK7 A;  2UUA K;  2ZD1 A;  3LDO A;  4DCH A;  2VYP A;  3SK3 A;  2FXU A;  3B8A X;  5AQP A;  2DY4 A;  1NGD A;  4DTR A;  3CJC A;  3ENO A;  1IO2 A;  3C7N A;  3HVR A;  2W40 A;  4W5Q A;  4KO0 A;  2A41 A;  1VSI A;  2VWK A;  3VGL A;  3FLC O;  1IKY A;  3NH0 A;  4YY3 K;  4JKB A;  2DTU A;  1BCM A;  4OPA A;  1HKG A;  3TPQ A;  4MDA A;  4RWT A;  4A2A A;  5HRO A;  4GW6 A;  4QS9 A;  4C23 A;  1KD1 O;  2D0B A;  4BAC A;  3O4W A;  3S3M A;  1EET A;  3RMB A;  3LP2 A;  4X64 K;  3U8X A;  3AA2 A;  2HB5 A;  3BF3 A;  1Q8I A;  4G9Z A;  2P9S A;  2YX6 A;  3VQ5 A;  3QIC A;  1X3M A;  1UA1 A;  3FR0 A;  1VQ6 N;  2V52 B;  5BRE A;  2D0P A;  2GUI A;  4KFB A;  3EYZ A;  1WSE A;  3TI0 A;  1GLA G;  3HRG A;  3WXI A;  4IKF A;  5FDL A;  3KK3 A;  2NRZ A;  2F8T A;  1L3T A;  1K8A O;  3GL1 A;  1NOZ A;  5ELZ A;  5GIP A;  1SKW A;  3ZSZ A;  4H4O A;  1YHQ N;  2OTL N;  2QKB A;  4B8C A;  2PBD A;  2OZM A;  1NLV A;  2AJQ A;  2YKN A;  5IWA K;  4DFJ A;  3V9W A;  1NWK A;  1W97 L;  4DR2 K;  4WCE L;  3DLL L;  1ZYQ A;  4FXD A;  3UB5 A;  3UIQ A;  4DV5 K;  4IFE A;  1Q86 O;  1OH7 A;  2PAV A;  3V9X A;  4M3Z A;  2E8A A;  3L2V A;  1K9M O;  2GEM A;  2KKZ A;  1QHT A;  1NKC A;  4BQL A;  3BDP A;  4PKG A;  3ZYY X;  3HPO A;  4GV9 A;  3LP1 A;  4CF2 A;  2P9U A;  1NGG A;  4LSN A;  1XQS C;  4BDZ A;  3BGR A;  4WFN L;  1ATR A;  1LWC A;  4CEC A;  3FFK B;  1KVC A;  4E7J A;  3RMD A;  1VK0 A;  1BWF O;  2WC9 A;  3O9U A;  3DLK A;  1VQ5 N;  1TYQ A;  4FWN A;  4CEQ A;  3DRR A;  4B9S A;  1IG9 A;  4W5R A;  1QVG M;  2YNG A;  1HYS A;  2XRI A;  2HNY A;  2CGL A;  4GVE A;  4IJN A;  4ISG A;  4FW2 A;  4M45 A;  3I33 A;  4CIE A;  4E7K A;  3VGK A;  4DU4 A;  3AA5 X;  4ICL A;  4B08 A;  4W5N A;  1MDU B;  2FF6 A;  3K9K A;  4LSL A;  3G71 N;  4FLV A;  4LF9 K;  3HM9 A;  3CQ8 A;  1C1C A;  1TVR A;  3IFR A;  1D5A A;  4YOW A;  5M1P A;  3C94 A;  2IS3 A;  4FJX A;  2UUC K;  2E2Q A;  4Q0B A;  1WN7 A;  2OZS A;  4BQZ A;  1RT3 A;  4FW1 A;  5E26 A;  2QWP A;  4FM2 A;  3H46 O;  4DUY K;  3VGM A;  4DU3 A;  3AV9 A;  2YHX A;  3CCM N;  4Y1C A;  4X62 K;  5BR8 K;  1HQE A;  3HZ6 A;  1WSH A;  4B1W B;  3SQ4 A;  3NVK A;  2ASO A;  5C25 A;  3AVA A;  4KB0 A;  2NRV A;  2DFH A;  1SQK A;  3H08 A;  3OS0 A;  4JD2 A;  2OPQ A;  3R9P A;  3VF6 A;  4O44 A;  2B6A A;  4AHR A;  4CEF A;  1GLB G;  1IKV A;  5DM7 L;  3VEY A;  5DK5 A;  5KTQ A;  3MWP A;  5GAD P;  1TK8 A;  4BRG A;  3ZT0 A;  4DS4 A;  3B6P A;  4F4K A;  4EHU A;  4KI4 A;  3CPE A;  3JXU A;  3NCI A;  5HBM A;  3CCL N;  1J5E K;  4I9L A;  4HVJ A;  1Z26 A;  3LAM A;  3MCA B;  4H0O A;  3C6U A;  4CEZ A;  4ID1 A;  4CER A;  4PKI A;  4LF8 K;  1X9J A;  3CFO A;  4BVP A;  4F2R A;  3H45 C;  3VEV A;  5FPE A;  4NXN K;  3NE6 A;  4BRP A;  4CJR A;  1VQ9 N;  4B9V A;  5AQN A;  3O1B A;  1RBT A;  1ESV A;  3CCS N;  1X3N A;  3LWM A;  3ZET B;  3QML A;  4IOA L;  1EO1 A;  3T3F A;  2F96 A;  2J4R A;  5JLF A;  1WSG A;  5LL6 Z;  3QFU A;  4K41 A;  1HR0 K;  3VPZ A;  2GWK A;  3DAW A;  3TR8 A;  4CZK A;  3EN9 A;  5J2P A;  1HYV A;  4F2S A;  3RR8 A;  2P9L B;  3UKR B;  1JLA A;  3K58 A;  4H0V B;  1X9M A;  1BI4 A;  4CGD A;  4OPJ A;  2Q0R A;  1Z25 A;  2ZF5 O;  4H5V A;  3SUO A;  5HL7 L;  2E2N A;  4JKF A;  2QEX N;  1XHZ A;  1JCF A;  4CED A;  4FJH A;  4IEE A;  4DSJ A;  1MU2 A;  4JI6 K;  4HCC A;  4DB3 A;  4FZZ A;  5JVG L;  3G0Z A;  5KPZ A;  1G99 A;  4DUZ K;  4EZ6 A;  2YJE A;  3EKU A;  4KKO A;  4LFC K;  2O8E B;  4CEO A;  5EX5 A;  1LAW A;  1NKB A;  3BP8 A;  1YVN A;  3B6O A;  4CIG A;  5AQJ A;  1QSL A;  4F3O A;  4EIA A;  2Q3S A;  4HUF A;  3ITH A;  3CHW A;  4M3X A;  2PZS A;  4AQY K;  4LD0 A;  4FJL A;  4DV3 K;  4I7F A;  1VSE A;  5AQX A;  1YT3 A;  3CMA N;  3VF2 A;  4FWQ A;  5AQS A;  5BN8 A;  1NK6 A;  4I2Q A;  4C8M A;  4BE2 A;  4B1V A;  3PX6 A;  4O55 A;  2VWJ A;  1L3U A;  2YNF A;  3IUC A;  1OH5 A;  1J54 A;  4DWI A;  4M3R A;  3UKU B;  3ZET A;  3I0R A;  5GAE P;  4FJ8 A;  3CJA A;  4R5P A;  1QVF M;  3AAR A;  3P83 D;  3ZEU A;  4FPA A;  3LDL A;  4CZH A;  4K8X A;  4ILJ A;  3SZ2 A;  4OGC A;  3OYB A;  1K6Y A;  3U3G A;  5M1Q A;  1Q81 O;  3EZW A;  1NK9 A;  3F5T A;  1S3X A;  3AVK A;  5DMR A;  1T8E A;  3J7Y P;  5BRH A;  3FZF A;  3PV8 A;  3VMF B;  4BGB A;  1W2B M;  3PX0 A;  2I7P A;  5KRS A;  1VSF A;  5CY4 A;  4CJ7 A;  2A42 A;  3N4P A;  4DLE A;  3MEC A;  3KTQ A;  4JK9 A;  4KAZ A;  3THX A;  4UQG A;  3JAM O;  3EZ5 A;  4CZJ A;  4N47 A;  1RT6 A;  5KQD A;  3DYA A;  1U2V B;  3CQX A;  1BQN A;  1TL1 A;  3JSM A;  4DQQ A;  3VEN A;  4FJJ A;  1VAZ A;  3L3V A;  3K0S A;  3TAN A;  4IZ9 A;  3ZSX A;  3PO5 A;  3O1W A;  2PYJ A;  2UXB K;  1WBD A;  2P9P A;  3HP9 A;  3WNG A;  1VSK A;  4EP4 A;  2YI1 A;  4PA1 A;  2W6L A;  4IDH A;  2Q0U A;  1OKJ A;  2BTF A;  4YOT A;  3A8Y A;  4FLW A;  4CHO A;  3LZJ A;  4WQ4 A;  1UWB A;  3LPU A;  4M41 A;  3IRX A;  5C0Y A;  3A5L C;  3S41 A;  4E3S A;  2IAJ A;  3WEE A;  5C12 A;  1ITG A;  1REV A;  3JS6 A;  1S9E A;  3AVL A;  3MX2 A;  3O08 A;  4BR5 A;  3KLH A;  1X1P A;  4BRC A;  3GOI A;  4UY8 O;  3LM2 A;  5TKW A;  1RT7 A;  4FJ7 A;  3SV3 A;  2O8C B;  4YHH K;  2RE2 A;  2HBK A;  3VEO A;  3K59 A;  1T7P A;  4NCB A;  4CD1 A;  1ATS A;  2E2P A;  4DU1 A;  1W0H A;  3TU5 A;  5BPL A;  3FZH A;  4DR4 K;  1C0T A;  4CIF A;  1TK5 A;  1LCU A;  1Z6R A;  5K14 A;  4CZG A;  1MA9 B;  2DPN A;  3WNH A;  4BE0 A;  1RNH A;  1DGK N;  2ASM A;  4FZX C;  2QWL A;  3BZC A;  2QM1 A;  3H1Q A;  1SZ2 A;  5EXW A;  4FWS A;  3ZEU B;  4FCY A;  2P9S B;  3VQ8 A;  5BRD A;  2ZJQ L;  4DTU A;  3D0P A;  3VQ6 A;  2O8C A;  2YHY A;  3O3F A;  2ITG A;  2YHB A;  2AA4 A;  2P5G A;  1BHL A;  2G8I A;  1VQO N;  3EKS A;  4CK1 A;  4HWI A;  4E89 A;  4QOZ B;  5C42 A;  3MXI A;  1S1T A;  1XNQ K;  4DQR A;  3QEP A;  2B5J A;  1GLC G;  3HPH A;  4K25 A;  4CJQ A;  3L2W A;  4LY7 A;  4CEE A;  1WSI A;  2X6S A;  4KTQ A;  3P4I A;  4DFK A;  3SUN A;  5F2R A;  5DM6 L;  3UKU A;  4F9O A;  1M1K O;  4DSE A;  1S1W A;  2E5L K;  1TGO A;  4CJP A;  3VQ4 A;  4CBX A;  3SBT A;  1IBM K;  4BRE A;  2P9I B;  5A2Q O;  5AQF A;  3K57 A;  5CYQ A;  4JI0 K;  2E20 A;  1R59 O;  1RDD A;  4ILG B;  2HF3 A;  4CHQ A;  1ASW A;  3S3N A;  1GLD G;  3AVN A;  5LJV A;  1WSJ A;  3ENB A;  4CW7 B;  5AQV A;  1UAX A;  2V7Y A;  1NGE A;  3MXM A;  1HYZ A;  3WXL A;  4FJG A;  1VQK N;  1RGI A;  3M3Z A;  4YOU A;  3FGU A;  4DHY A;  3MXJ A;  2XY8 A;  3C0B A;  1MWK A;  3J8A A;  1LW2 A;  4OGE A;  2B4J A;  3CIP A;  3NMU A;  4B3T K;  2D4W A;  3NF7 A;  3ZT3 A;  2BH1 A;  1S6Q A;  1BG3 A;  2P9I A;  1VSJ A;  4GV3 A;  3OYM A;  1JLF A;  3WXK A;  1KRP A;  4J2E A;  2ETJ A;  3WUH A;  1NKE A;  4BRF A;  5AJ3 K;  4H5N A;  4PHT X;  3TWH A;  2YV0 X;  4FJK A;  1GLF O;  4LFB K;  4O8K A;  4RG8 A;  1N8R O;  1NM1 A;  4CGI A;  4CK3 A;  3G6E N;  5CYM A;  1BUP A;  5AQT A;  2O8F B;  2FLO A;  3ZT2 A;  3IAY A;  2X78 A;  1Q7Y O;  4BRI A;  2QTD A;  1VQ8 N;  3VQ7 A;  1WB9 A;  3H3N O;  3TSQ A;  2ITM A;  4BRK A;  5KGX A;  4XH1 A;  4Q5V A;  3WNE A;  4KTW A;  3MMV A;  3VEZ A;  4YOX A;  3ZT4 A;  4HHT A;  5IT9 O;  4E1N A;  5M1O A;  2ZGY A;  1VRT A;  3HL8 A;  1U4B A;  4RW9 A;  4DV4 K;  1IJJ A;  1HNW K;  1MWM A;  1N6Q A;  4Z4G A;  3WQT A;  4LF4 K;  2CH5 A;  3ZSO A;  4HUE A;  3OYG A;  3MX5 A;  3H1V X;  5FRO A;  1KVA A;  1C1A A;  1TKZ A;  3SAF A;  3QO9 A;  5AQG A;  3CCV N;  3DXM B;  3IG1 A;  4KB1 A;  3K5N A;  4MLH A;  4O8U A;  5BR9 A;  4ZTF A;  2NRT A;  3GG4 A;  3ATV A;  4B1U B;  5GAH P;  4FSV A;  4F3T A;  3LM9 A;  1N36 K;  1LOT B;  3MEE A;  3NGI A;  1NU0 A;  3TTF A;  3SPZ A;  3QBX A;  1UOC A;  4JI2 K;  4EHT A;  2KZZ A;  3KLE A;  1U6Z A;  3LPT A;  4FWL A;  4FJ5 A;  4EZ9 A;  3E9O A;  5JLH A;  4BC2 A;  3GE1 A;  4JHD B;  2YNH A;  1VQP N;  3DRS A;  4CHY A;  5EVZ A;  2IVO A;  3OW2 M;  3V9Z A;  4JI5 K;  4RTF D;  4QS8 A;  1EP4 A;  3I8D A;  3BY5 A;  4OLA A;  4BRD A;  2P9L A;  3CFR A;  3NFA A;  3V1O A;  3DOK A;  3C7N B;  5T7B A;  3C6A A;  4BRA A;  1J5O A;  4CEB A;  4CHN A;  4OKJ A;  4JKE A;  2Q1N A;  3O3H A;  1VSL A;  4PUO A;  1QQN A;  2Z1I A;  2O8D B;  3KVG A;  3PUF A;  3TAF A;  4FZY A;  2NZT A;  3FZM A;  3AGR A;  2RF2 A;  3LAL A;  1JJ2 M;  3MEG A;  2DFF A;  4CJE A;  2ZM6 K;  2NLX A;  1U48 A;  3VA3 A;  3BUZ B;  4K0K K;  1ZBS A;  1XUP O;  3ZSW A;  1L5U A;  3WT0 A;  5M1N A;  3QES A;  5AZI B;  2O4I A;  1KFS A;  3SMS A;  4OKE A;  1G15 A;  1J9A A;  3TAE A;  4KHY A;  1D4X A;  3OYL A;  3M5R A;  1QSS A;  3AO5 A;  2E6L A;  3IMX A;  3ZLJ A;  1RTJ A;  2KLA A;  1EX4 A;  2D0O A;  4N76 A;  2IGI A;  4FM0 A;  4C8K A;  2NNW A;  4JRP A;  2UU9 K;  2IVP A;  1QSY A;  2Q36 A;  3F9K A;  5BRF A;  1NJZ A;  2FBT A;  2FSN A;  3L2Q A;  4OO1 J;  4M42 A;  3MWT A;  4HTU A;  5AQI A;  3KD5 E;  4KHU A;  5GIN A;  4DMN A;  1U49 A;  4J2B A;  2P5O A;  4PQU A;  1DEJ A;  3DXM A;  1W7A A;  3RMC A;  2HBL A;  4KV8 A;  4JK7 A;  4CFC A;  2GX9 A;  4QCL A;  1JLQ A;  1D9F A;  4DSK A;  3KJV A;  4N56 A;  4CBW A;  2NRX A;  3ATU A;  3VQ9 A;  1Q9Y A;  1VQ7 N;  5C2F A;  2FSJ A;  3LDP A;  4C8N A;  3WQU A;  3T19 A;  2A5X A;  4A5B A;  3VOV A;  3O9Q A;  4CFD A;  1LV5 A;  3EY1 A;  3O5B A;  1KC8 O;  2Z1G A;  3QIN A;  4BC3 A;  3OYH A;  4CF1 A;  4BR7 A;  2CH6 A;  4O0J A;  4H5R A;  5AQH A;  4EP5 A;  3OY9 A;  2QWN A;  2WOM A;  4DR7 K;  3OBY A;  1JCE A;  5GAG P;  4ILH A;  4CES A;  1SV5 A;  3NF9 A;  1YVU A;  3VET A;  4AH9 A;  3SJH A;  2G8F A;  5FRM A;  4DS5 A;  1C0U A;  2P9K B;  3VTH A;  1BCO A;  3DLB A;  4NCA A;  3VTI A;  4CJW A;  4I6M B;  3LP3 A;  1BQM A;  1DT9 A;  2NRR A;  4CJV A;  3DOL A;  4QAG A;  4A62 A;  1KVB A;  4R79 A;  4WQ5 A;  4X65 K;  4OLB A;  1SUQ A;  4BDY A;  1IBK K;  3VQE A;  4Y1D A;  5AFU A;  1HNI A;  2HNZ A;  3F9M A;  4JS4 A;  3ZCM A;  3DJC A;  2QXF A;  4K43 A;  1FXX A;  5KPT A;  4CD3 A;  1BA0 A;  4MO5 A;  3ULE A;  4M3W A;  5FLX O;  1WUA A;  3BZK A;  5FPN A;  2QW9 A;  3TAM A;  1BO5 O;  4FWK A;  2P9K A;  4WQ4 C;  3AY9 A;  5C10 A;  4DTN A;  1RT1 A;  3AO1 A;  3MN7 A;  1BI4 B;  5AQM A;  3KWG A;  5AZI A;  4B9T A;  3HVT A;  3I8B A;  2XY6 A;  3V1R A;  4FVU A;  2G8U A;  1RDC A;  1QHA A;  1XI1 A;  4CGH A;  1XMQ K;  2GWJ A;  2ZWH A;  1L3S A;  3M8S A;  1RDW X;  1QE1 A;  5HRR A;  3KK1 A;  4CJ4 A;  4C1N I;  5HOO A;  1BIZ A;  2HMI A;  1TV6 A;  3MED A;  3SAG A;  2OYQ A;  3NHG A;  1OH8 A;  1BIS A;  3LAK A;  2O8E A;  1LWF A;  1QQC A;  5AQK A;  1LAV A;  3HOT A;  1KXP A;  3PIP L;  3A0I X;  3VQA A;  1X9S A;  1T03 A;  1TKD A;  4B1Z A;  2FC0 A;  3CCE N;  4CJ3 A;  3VQQ A;  4XEI A;  1HJO A;  3CJB A;  4BR2 A;  4YDU A;  1HQU A;  1HUX A;  4JI3 K;  1ZC6 A;  3AVH A;  3AO3 A;  4I2P A;  4I6M A;  5AQZ A;  4O5B A;  1ATN A;  1NG9 A;  2HBM A;  4E7I A;  5LMN K;  3QIP A;  3NF6 A;  1HKC A;  2IVN A;  4GY2 B;  5E84 A;  3CC4 N;  3D45 A;  3L2R A;  2QK9 A;  1WLJ A;  4Z4F A;  4DG1 A;  3EEQ A;  4ID5 A;  3KHY A;  3VES A;  4E0D A;  3SCX A;  4FWO A;  1RBS A;  2AP1 A;  2UYT A;  4MFB A;  3V81 A;  1IV0 A;  3AVI A;  4BR4 A;  3U3Y A;  3HTV A;  3E9P A;  1Q18 A;  4DTO A;  5AQL A;  4FLT A;  4IG3 A;  3D2E A;  2UUB K;  3RRH A;  3ZSY A;  4WF9 L;  1DTQ A;  4A61 A;  4Z4I A;  4JKG A;  5H1S Q;  1YAG A;  4AHC A;  2ZJR L;  1FKO A;  4LF6 K;  1JLG A;  3PY8 A;  4ISE A;  3THV A;  1QZ5 A;  4PKH A;  1Y64 A;  4CJT A;  4FM1 A;  2HW3 A;  1IBL K;  1NJY A;  3SUQ A;  2Z1J A;  3D6R A;  3Q7B A;  2EX3 A;  4KTZ A;  5AZJ B;  1WOQ A;  1JLB A;  1I39 A;  4C8O A;  2Y1J A;  2VQF K;  4N5S A;  5JS2 A;  3CQY A;  3CYM A;  3AVC A;  3KK2 A;  1W9H A;  5EY4 A;  2BDP A;  3OA9 A;  4CZF A;  1C0F A;  1WNS A;  3NVM A;  4FLY A;  3THY A;  5AFU H;  3ENH A;  4CZM A;  3KKR A;  5MLC Q;  3HXM A;  4IOC L;  2O8B A;  3ZSQ A;  4WFB L;  4N41 A;  4IJA A;  4LFA K;  4C1N K;  1HNV A;  1OVQ A;  3E66 A;  4IO9 L;  4RW7 A;  2OCE A;  3LWL A;  3AO2 A;  1N32 K;  4GKJ K;  3J7A P;  3QLH A;  3ID6 A;  2ATQ A;  1NK4 A;  4ZTJ A;  1U47 A;  1QZ6 A;  4PL7 A;  2WBN A;  4DSI A;  3RWU A;  2R7Y A;  1EKE A;  4M63 C;  4CJU A;  1YXQ A;  2P1J A;  3LAN A;  4H4M A;  3NF8 A;  3NBP A;  4RCH A;  4IXC A;  2G8W A;  1UA0 A;  1HJR A;  3QIO A;  4JLH A;  5E41 A;  1HKB A;  2XHB A;  4DKW A;  5LMU K;  4FL9 A;  4CJF A;  3CG7 A;  2YHW A;  2PYL A;  5J1E A;  3OS1 A;  4JNE A;  5BPM A;  3THW B;  3TSU A;  1LWE A;  4BRH A;  4AHU A;  4FWM A;  1ZBU A;  4JKA A;  4BRQ A;  5LY3 A;  3P5J A;  1VQ4 N;  4CHP A;  2HHX A;  4JKG B;  4CFA A;  1KAZ A;  3FZK A;  4DTM A;  3O80 A;  3ZX3 A;  1GLL O;  3QBW A;  2YJF A;  1SKR A;  4CEA A;  2OA8 A;  2VG5 A;  3D2F A;  4NYF A;  1KFD A;  1Q82 O;  3CCR N;  2P9P B;  4CFB A;  3VER A;  1C6V A;  1RTH A;  3CJ1 A;  1KAX A;  3HST B;  4LF5 K;  3R3L A;  1J53 A;  3AAQ A;  3LP0 A;  4B1X B;  1KSP A;  3O3G A;  1VSD A;  4FK2 A;  3MN9 A;  2KHO A;  4DV2 K;  1NOY A;  3KK7 A;  4DQP A;  3DWL A;  1SL1 A;  3CI5 A;  4B9M A;  4KHQ A;  1FW6 A;  4H0P A;  3OS2 A;  3CCQ N;  4DFM A;  1KQS M;  1O1W A;  1A5W A;  1H1V A;  1D8Y A;  3TAQ A;  1ZBI A;  4H0Y B;  4JI8 K;  5KRT A;  3K5L A;  1X9W A;  4CJK A;  4YNQ A;  3P1G A;  2IOC A;  2DFE A;  1YTA A;  5J2N A;  4KH6 A;  3TTD A;  1RTD A;  3IDH A;  3C65 A;  4IOX A;  1TKT A;  3VN5 A;  3LL3 A;  3VQP A;  1RT2 A;  2W41 A;  3C6T A;  1A5X A;  5I3U A;  5HRN A;  1XNR K;  1JCG A;  2BE2 A;  2QA4 N;  2UXC K;  4CZI A;  4WFA L;  1BL3 A;  3SBG A;  1T44 A;  3WXJ A;  3LDQ A;  4E1M A;  4AIL C;  3O4N A;  4JAX A;  1GOA A;  1S1V A;  2WUS A;  1NK5 A;  3CPW M;  2Q97 A;  2GUP A;  4A2B A;  2VG7 A;  4FLX A;  3T1H K;  1QTM A;  3PO4 A;  1O13 A;  3SPY A;  3QEX A;  3MN6 A;  1ZBF A;  3ZX0 A;  3M1F A;  2KFN A;  4OPH A;  2YHA A;  4DQ8 A;  4B9U A;  3NGZ A;  1CLQ A;  3OVN A;  3W0L A;  3HOS A;  3AA3 A;  3VEX A;  1TK0 A;  3AAP A;  3SV4 A;  4J2D A;  4YOV A;  2RHK A;  4BR9 A;  1RIL A;  2VCP A;  4IWV A;  5HP1 A;  3SJJ A;  1J6Z A;  4K42 A;  1JLC A;  3AVJ A;  1SAZ A;  4JRQ A;  4B9Q A;  4KBO A;  3CME N;  3TSP A;  4BGA A;  4KI6 A;  3TAR A;  2NRW A;  2X74 A;  4Y0W A;  2NRH A;  4DTX A;  3CM6 A;  5AQR A;  1S5J A;  5CE3 A;  4ELU A;  4M3U A;  2RN2 A;  4YOY A;  4O4G A;  2P9U B;  3OYI A;  3D2F B;  2LSN A;  3W3D A;  5J2M A;  2OAN A;  3D7E O;  2QWO A;  2I5J A;  4XH5 A;  4CF8 A;  1YIJ N;  2QWM A;  3F73 A;  1S22 A;  4JI7 K;  4J8F A;  3KLF A;  1VSH A;  1L3V A;  3O9T A;  4DF8 A;  3WXM B;  1IG8 A;  1Z05 A;  1U04 A;  2D1K A;  5HRS A;  1CZA N;  3OJS A;  3QDK A;  4JHD A;  1K8K A;  1OH6 A;  2O8D A;  1NGF A;  4AHS A;  3C6H A;  3KIO A;  4G1Q A;  4M3Y A;  1C0G A;  1Y97 A;  3H6E A;  3P39 A;  1YI2 N;  1ASU A;  5CZ1 A;  3HK2 A;  3TAP A;  2RKI A;  2ZE2 A;  3SMP A;  2O8F A;  2F9T A;  3JYT A;  1F21 A;  3AVF A;  2HOE A;  1V4S A;  3F2K A;  4WE1 A;  5FRN A;  2Y1I A;  2PFU A;  4OKK A;  5GIO A;  4BC4 A;  4A5A A;  4CCH A;  1JXB A;  3AVB A;  1RCH A;  3SQ0 A;  3CXC M;  3CCU N;  5BN9 A;  2V7Z A;  4CVN E;  3RVC A;  2F8S A;  3DM2 A;  2XY5 A;  3UE5 A;  4Z94 A;  1CZB A;  5D3G A;  1K8K B;  2QKK A;  2IDO A;  3DXK B;  4KH5 A;  3QEW A;  4BR0 A;  3KWI A;  1FKP A;  1BIU A;  3E9L A;  3OBW A;  1P90 A;  3K5M A;  4H0T B;  1TUU A;  4H03 B;  1CXQ A;  4LH5 A;  3L8B A;  3DLH A;  5KPR A;  4FJ9 A;  1K73 O;  5F1X A;  1B9D A;  5JMV A;  4IDK A;  3HO1 A;  5AQU A;  3NH1 A;  4M7Y A;  4JD2 B;  1NGH A;  2FBY A;  3QFP A;  3SQ2 A;  1WBB A;  2HHH K;  4FLU A;  5M1F A;  4AM6 A;  2HHS A;  3IS9 A;  3CET A;  1CZ9 A;  1NBW A;  1EQY A;  3OYC A;  2JWK A;  1RDB A;  4FOI A;  3V6D A;  4K8Z A;  3DLR A;  4JEP A;  5CR4 A;  4PWD A;  4JKC A;  4E7L A;  4B1Y B;  2BUP A;  1BOT O;  4FO0 A;  3T1A A;  1YJW N;  1IKW A;  3QB0 A;  3G25 A;  1YF5 L;  1A5V A;  4WYB A;  1I3A A;  2OPP A;  1NK0 A;  3FFI A;  5BPN A;  2ZJP L;  3NDK A;  3S9H A;  4CF0 A;  5KI6 A;  1JL1 A;  2P9N B;  2G8V A;  3M8R A;  2QWQ A;  4NO7 A;  1GLJ O;  4DV1 K;  4BRN A;  4BRO A;  3SAH A;  2Q31 A;  4CK2 A;  5FPM A;  3OYF A;  3HP6 A;  2HHV A;  3C95 A;  5JVH L;  3GBT A;  3NH2 A;  1S72 N;  3CC2 N;  4BG8 A;  2D0A A;  4NCG A;  4E7H A;  1HPZ A;  1YJN N;  1TYQ B;  4CE9 A;  3DI6 A;  4ELT A;  3CJ7 A;  5ADX H;  4EFH A;  3D2E B;  3I56 N;  4DTJ A;  3PX4 A;  3V9U A;  4RW4 A;  3EL2 A;  4CGF A;  1TAU A;  1BU6 O;  1XMO K;  4MQ3 A;  2GV9 A;  4CF9 A;  3O4Q A;  5B8H A;  3TTC A;  2P9N A;  2FF3 B;  4JK8 A;  4H0X B;  3QER A;  3U9Z A;  4AHT A;  3LZI A;  4NYN A;  5AQQ A;  3HI0 A;  2D5R A;  4BDP A;  3A5N C;  4EAH D;  4CBU A;  2KTQ A;  1NGC A;  1FK9 A;  1ZBL A;  4HCB A;  2HHT A;  3CM5 A;  2NUB A;  1V4T A;  3CFP A;  1CXU A;  1NGJ A;  1T6D A;  1D9D A;  3IKM A;  3SLC A;  3SNN A;  1FJG K;  2O4G A;  2VWB A;  4YFU A;  1RFQ A;  1DLO A;  3P38 A;  4IG0 A;  5TKY A;  1S9G A;  2G8H A;  3THY B;  3AVM A;  1B9F A;  3PIO L;  2FSK A;  1Q9X A;  4WQ5 C;  1ILY A;  2A3Z A;  1S6P A;  1JKH A;  3O9S A;  3SI6 A;  4CJL A;  3ZSV A;  3R1X A;  3OYE A;  3V9S A;  1EWR A;  3U9D A;  3ASM A;  3SQ1 A;  3LDS A;  1RDA A;  3HT3 A;  2A1R A;  4BG9 A;  4DV6 K;  1E3M A;  2CGJ A;  1TL3 A;  3TAG A;  3G10 A;  1YJ9 N;  3HSC A;  1WSF A;  4DTS A;  1TUY A;  3M8Q A;  3OYA A;  4FOE A;  2XY7 A;  3MK6 A;  1NJW A;  4LH4 A;  3L0Q A;  4FJM A;  1P8Z A;  3OYJ A;  5C2D A;  4KRF A;  1HPM A;  1BGX T;  1DTT A;  1IH7 A;  3O9R A;  1XC9 A;  5LJW A;  4DR3 K;  1VSM A;  1RTI A;  4JI4 K;  4DR5 K;  4FJI A;  3A5M C;  4TSX A;  5AQW A;  3L6Q A;  4W5O A;  3I0S A;  4MLE A;  4DSF A;  4DQS A;  4YDU C;  4NLB A;  4DSL A;  3OYN A;  4I9Q A;  1VRU A;  3NGY A;  3ULD A;  4GV6 A;  4IEI A;  2A40 A;  2G8K A;  3CC7 N;  1RT5 A;  1N33 K;  1GOB A;  2A1S A;  5EOY A;  3DLG A;  3U4L A;  3ULE B;  4FVM A;  4DV0 K;  1KLM A;  1HRH A;  1SL0 A;  1HNX K;  1NJX A;  2HVI A;  3KLG A;  4RW6 A;  2QI2 A;  1SKS A;  2X6N A;  4DTP A;  3L4Q A;  2HF4 A;  4YOR A;  4A57 A;  4CZL A;  4E1J A;  4B9L A;  2EHG A;  4ELV A;  4ISF A;  4AF1 A;  3K5O A;  4M7X A;  3OJU A;  3BF1 A;  1NNE A;  3CCJ N;  2KFZ A;  2HBJ A;  3CER A;  3QEV A;  2VGN A;  3M8P A;  4GVM A;  4Z4E A;  4KHN A;  5EU7 A;  1N5Y A;  4FLZ A;  3SYZ A;  3L4I A;  4KHW A;  4CZE A;  3QNO A;  3MN5 A;  4GKK K;  1SS6 A;  1QQO A;  4BRM A;  3LDN A;  4X66 K;  2WON A;  4DF4 A;  1JL2 A;  1VHX A;  3PSI A;  4DLG A;  4CJ5 A;  3DMJ A;  3A2F A;  4XIU A;  3U6F A;  3H3O B;  3ZSR A;  1NGI A;  1GOC A;  4H5W A;  4BC5 A;  4H8K A;  3RTV A;  3T69 A;  1EXQ A;  3WNF A;  1XC3 A;  4AHV A;  5SZT A;  3AA4 A;  1NMN A;  2HMP A;  4B9N A;  1T3V A;  2YNI A;  1YIT N;  4DQI A;  2VQE K;  5CZ2 A;  4KRE A;  1ASV A;  1RDU A;  3HM8 A;  2GBZ A;  4L8R B;  3QET A;  4M3T A;  3ID8 A;  5M1K A;  4DR1 K;  1ZBH A;  4CJS A;  3PSF A;  4GMJ B;  2QXL A;  2E6M A;  4JKH A;  4RW8 A;  4O5F A;  3HJF A;  1T6C A;  2JLE A;  2P51 A;  3J81 O;  2KW4 A;  1RBV A;  4NXM K;  1RBR A;  3VF4 A;  2Z1H A;  2ZGZ A;  3QEI A;  3N4Q A;  3G4S N;  2YKM A;  1KLN A;  5KQ8 A;  4W5T A;  3OYD A;  4B3R K;  4NB4 A;  2EWS A;  1VQM N;  3RSE B;  3VEW A;  3J80 O;  1E4F T;  1KAY A;  4DV7 K;  3I55 N;  4U67 L;  1OVY A;  4L3Q A;  3ALY A;  3EE9 A;  3GDQ A;  2BGG A;  4BWJ A;  1NJI O;  4FWP A;  3THX B;  3KKS A;  2F4V K;  1QS4 A;  3K2P A;  3BEX A;  4BRL A;  3KLI A;  5J2Q A;  1HMV A;  3ISN C;  1GLE G;  2GEL A;  2D0C A;  2ASP A;  3FE1 A;  3HYF A;  4B8A B;  3WEE B;  4LC9 B;  1WAF A;  1TAQ A;  4CGJ A;  4PL8 A;  4JS5 A;  2HVH A;  2E2O A;  5AQO A;  3EO3 A;  3CF5 L;  3FZL A;  1S1U A;  5AZJ A;  5CHI A;  2HST A;  3VQD A;  4FYD A;  1JXE A;  5I42 A;  3UKR A;  3CD6 N;  1JLE A;  3VA0 A;  4BWM A;  4DR6 K;  3OYK A;  4F8R A;  3VQB A;  3O6W A;  3RMA A;  1NMD A;  4XH4 A;  4H5T A;  2ZQB A;  3Q7C A;  4PY5 A;  2WTU A;  2UXD K;  1LW0 A;  5KGW A;  1KCF A;  2W42 A;  3K9J A;  3T7Z A; 
#chains in the Genus database with same CATH homology
 3MAQ A;  1JLQ A;  1R0A A;  1D9F A;  4DSK A;  3KJV A;  4N56 A;  2Q3S A;  4HUF A;  4O4G A;  3ITH A;  3VQ9 A;  1Q9Y A;  4M3X A;  2PZS A;  4LD0 A;  4FJL A;  4C8N A;  3OYI A;  4I7F A;  2FBV A;  2LSN A;  3KD1 E;  5JS1 A;  1VSE A;  3T19 A;  5J2M A;  4CFD A;  1LV5 A;  1YT3 A;  3EY1 A;  2I5J A;  4CF8 A;  1NK6 A;  3F73 A;  2Z1G A;  4I2Q A;  3V1Q A;  3QIN A;  1VSH A;  3KLF A;  1L3V A;  3OYH A;  4CF1 A;  4C8M A;  4J2A A;  4BE2 A;  4Z4H A;  5HLF A;  4DF8 A;  4O0J A;  4EP5 A;  3PX6 A;  4O55 A;  5HRS A;  1U04 A;  5SWM A;  3OY9 A;  2VWJ A;  2WOM A;  1YTU A;  4QCL A;  1IKX A;  5HRP A;  3OJS A;  1L3U A;  2FBX A;  2YNF A;  1J54 A;  4DWI A;  4M3R A;  4AHS A;  1U45 A;  1SV5 A;  3KIO A;  4CES A;  3I0R A;  3NF9 A;  1YVU A;  4G1Q A;  4R5P A;  4FJ8 A;  1Y97 A;  4M3Y A;  4CGG A;  1ASU A;  5CZ1 A;  3P83 D;  3TAP A;  4HUG A;  3HK2 A;  4AH9 A;  2RKI A;  1RT4 A;  2G8F A;  2ZE2 A;  5FRM A;  4DS5 A;  4K8X A;  1TKX A;  1C1B A;  3JYT A;  1RBU A;  1F21 A;  3AVF A;  3SZ2 A;  4OGC A;  3V4I A;  3OYB A;  1K6Y A;  4WE1 A;  1C0U A;  3U3G A;  3VQC A;  5FRN A;  2Y1I A;  1XHX A;  1BCO A;  3DLB A;  3HPG A;  1T05 A;  1NK9 A;  4OKK A;  4NCA A;  3AVK A;  4OVL A;  5DMR A;  4CJW A;  1T8E A;  2JGU A;  3LP3 A;  1BQM A;  3PV8 A;  4CHZ A;  3PX0 A;  1JXB A;  2BAN A;  3AVB A;  4CJV A;  3DOL A;  1VSF A;  5CY4 A;  5KRS A;  3KTQ A;  4QAG A;  4DLE A;  3MEC A;  1KVB A;  3AO4 A;  1RCH A;  3SQ0 A;  4KAZ A;  4UQG A;  4OPK A;  4OLB A;  1SUQ A;  3EZ5 A;  4BDY A;  4FK4 A;  3VQE A;  4Y1D A;  4N47 A;  1RT6 A;  1HNI A;  2HNZ A;  2F8S A;  3DM2 A;  3DYA A;  2XY5 A;  4JS4 A;  1CZB A;  3ZCM A;  4Z4C A;  2QKK A;  5D3G A;  1BQN A;  2QXF A;  1TL1 A;  3QNN A;  3DLE A;  1NK8 A;  2IDO A;  1FXX A;  3JSM A;  3S3O A;  4DQQ A;  2PY5 A;  3QEW A;  4FJJ A;  3AVG A;  1FKP A;  1BIU A;  4M3W A;  4Z0U A;  4B3O A;  3K5M A;  1WAJ A;  3L3V A;  3TAN A;  3L3U A;  1CXQ A;  3ZSX A;  2RPI A;  4LH5 A;  3L8B A;  3DLH A;  3PO5 A;  3TAM A;  3L2U A;  4FJ9 A;  2PYJ A;  1B9D A;  2E4L A;  3HP9 A;  2KQ2 A;  3WNG A;  4IDK A;  3HO1 A;  3NH1 A;  1VSK A;  4DTN A;  4EP4 A;  4PA1 A;  1RT1 A;  3AO1 A;  2FBY A;  1BI4 B;  2VG6 A;  3DRP A;  3SQ2 A;  4B9T A;  3HVT A;  4FLW A;  3V1R A;  2XY6 A;  2G8U A;  4OJR A;  4IFY A;  4CHO A;  1RDC A;  3LZJ A;  3RR7 A;  1XI1 A;  4CGH A;  1UWB A;  2HHQ A;  3LPU A;  4M41 A;  3IRX A;  4FLU A;  4IFV A;  5C24 A;  2OPR A;  4DFP A;  3TAB A;  3M8S A;  4IBN A;  1L3S A;  2HHS A;  3IS9 A;  2HHW A;  1CZ9 A;  4E3S A;  2IAJ A;  1B92 A;  3OYC A;  4FK0 A;  1ITG A;  1RDB A;  1REV A;  4KHS A;  2HHU A;  1QE1 A;  1KTQ A;  1S9E A;  3AVL A;  3V6D A;  4K8Z A;  3DLR A;  3KLH A;  4PWD A;  1X1P A;  5HRR A;  4E7L A;  2KZM A;  3KK1 A;  4CJ4 A;  1RT7 A;  3T1A A;  4FJ7 A;  3SV3 A;  1SL2 A;  1BIZ A;  2HMI A;  1IKW A;  1TV6 A;  3MED A;  2OYQ A;  3K59 A;  3NHG A;  4BE1 A;  1A5V A;  1BIS A;  1T7P A;  4NCB A;  3LAK A;  4C8L A;  1I3A A;  4DU1 A;  1LWF A;  2OPP A;  1QQC A;  1S1X A;  1W0H A;  3FFI A;  1NK0 A;  3RRG A;  4E19 A;  1LAV A;  4ZHR A;  3E01 A;  3NDK A;  1C0T A;  2OPS A;  4CIF A;  1TK5 A;  3S9H A;  4CF0 A;  5KI6 A;  2IC3 A;  1JL1 A;  4KPY A;  5K14 A;  3VQA A;  2XO7 A;  3ZT1 A;  4FJN A;  1X9S A;  3WNH A;  1T03 A;  1TKD A;  2G8V A;  4BE0 A;  2FC0 A;  3M8R A;  1RNH A;  2HND A;  4FZX C;  1C0M A;  3NAE A;  4FCY A;  4CK2 A;  4CJ3 A;  4O0I A;  1XWL A;  3VQQ A;  3VQ8 A;  3OYF A;  3HP6 A;  3SUP A;  1NK7 A;  2HHV A;  3C95 A;  2ZD1 A;  3NH2 A;  2D0A A;  4NCG A;  4E7H A;  1HPZ A;  2DY4 A;  4DTU A;  4DTR A;  1HQU A;  3D0P A;  3VQ6 A;  1IO2 A;  4CE9 A;  3O3F A;  3DI6 A;  2ITG A;  3AVH A;  2YHB A;  3HVR A;  2P5G A;  1BHL A;  3AO3 A;  4ELT A;  4I2P A;  4CK1 A;  2G8I A;  4E89 A;  4W5Q A;  4QOZ B;  4KO0 A;  4O5B A;  5C42 A;  3MXI A;  1S1T A;  1VSI A;  2VWK A;  4DTJ A;  3PX4 A;  3V9U A;  4RW4 A;  4E7I A;  4DQR A;  3QEP A;  2B5J A;  1IKY A;  3QIP A;  3NF6 A;  4CGF A;  3NH0 A;  3HPH A;  1TAU A;  2DTU A;  4CJQ A;  1BCM A;  4LY7 A;  4CEE A;  1WSI A;  3L2W A;  3D45 A;  2X6S A;  2GV9 A;  4MQ3 A;  3O4Q A;  4CF9 A;  3L2R A;  4KTQ A;  2QK9 A;  1WLJ A;  4DFK A;  4Z4F A;  3SUN A;  4DG1 A;  4ID5 A;  3QER A;  4GW6 A;  5HRO A;  2D0B A;  4AHT A;  3LZI A;  4DSE A;  4NYN A;  4BAC A;  1S1W A;  1EET A;  1TGO A;  3RMB A;  3S3M A;  4E0D A;  4CJP A;  2D5R A;  3LP2 A;  3SCX A;  3VQ4 A;  3AA2 A;  4BDP A;  2HB5 A;  1RBS A;  1Q8I A;  4MFB A;  3VQ5 A;  2KTQ A;  3V81 A;  1FK9 A;  3AVI A;  3K57 A;  1ZBL A;  5CYQ A;  3U3Y A;  4HCB A;  2HHT A;  1RDD A;  3CM5 A;  1UA1 A;  4CHQ A;  1ASW A;  2NUB A;  3CFP A;  1CXU A;  3S3N A;  4KFB A;  2GUI A;  3EYZ A;  3AVN A;  4DTO A;  1WSJ A;  1WSE A;  1D9D A;  4FLT A;  1UAX A;  4IG3 A;  3TI0 A;  3SNN A;  2O4G A;  4YFU A;  3RRH A;  3MXM A;  3ZSY A;  1HYZ A;  1DTQ A;  4FJG A;  4Z4I A;  4IKF A;  1DLO A;  4IG0 A;  4AHC A;  5FDL A;  3KK3 A;  1FKO A;  1S9G A;  2F8T A;  1JLG A;  1L3T A;  3PY8 A;  1NOZ A;  2G8H A;  3AVM A;  1B9F A;  3THV A;  3MXJ A;  1Q9X A;  1SKW A;  2XY8 A;  3ZSZ A;  1S6P A;  4H4O A;  1JKH A;  1LW2 A;  4CJT A;  3SI6 A;  4FM1 A;  2QKB A;  4B8C A;  4OGE A;  2B4J A;  2HW3 A;  2HVI A;  4CJL A;  1NJY A;  2OZM A;  3SUQ A;  3ZSV A;  2Z1J A;  3NF7 A;  3OYE A;  3V9S A;  2AJQ A;  2EX3 A;  2YKN A;  4KTZ A;  3ZT3 A;  1S6Q A;  1JLB A;  1VSJ A;  3ASM A;  3V9W A;  4DFJ A;  1I39 A;  3SQ1 A;  1ZYQ A;  4FXD A;  3LDS A;  3OYM A;  1JLF A;  4C8O A;  3UIQ A;  1RDA A;  3HT3 A;  2Y1J A;  1KRP A;  4J2E A;  2A1R A;  4N5S A;  2ETJ A;  5JS2 A;  1TL3 A;  1NKE A;  3CYM A;  3AVC A;  3KK2 A;  1W9H A;  3TAG A;  2BDP A;  3V9X A;  4M3Z A;  3G10 A;  1WSF A;  3L2V A;  4DTS A;  3TWH A;  2YV0 X;  4FJK A;  1QHT A;  1WNS A;  3M8Q A;  1NKC A;  3OYA A;  3BDP A;  4FLY A;  3HPO A;  2XY7 A;  4RG8 A;  3LP1 A;  1NJW A;  4CF2 A;  4LH4 A;  4LSN A;  4CGI A;  4BDZ A;  4FJM A;  3BGR A;  4CK3 A;  1LWC A;  4CEC A;  3KKR A;  5CYM A;  3OYJ A;  3HXM A;  4KRF A;  1KVC A;  3ZSQ A;  1BGX T;  3ZT2 A;  4E7J A;  3RMD A;  3IAY A;  4N41 A;  1VK0 A;  2X78 A;  1DTT A;  1IH7 A;  1HNV A;  1XC9 A;  3DLK A;  3VQ7 A;  1VSM A;  1RTI A;  4RW7 A;  4FJI A;  3LWL A;  4CEQ A;  3AO2 A;  4TSX A;  5KGX A;  3DRR A;  4W5O A;  4B9S A;  3I0S A;  3QLH A;  1IG9 A;  4Q5V A;  2ATQ A;  3WNE A;  1NK4 A;  4KTW A;  4ZTJ A;  1U47 A;  4W5R A;  4DSF A;  2YNG A;  4DQS A;  1HYS A;  2XRI A;  4DSL A;  2HNY A;  3ZT4 A;  3OYN A;  1VRU A;  3NGY A;  4HHT A;  2R7Y A;  3ULD A;  4DSI A;  3RWU A;  4I9Q A;  4E1N A;  2G8K A;  1RT5 A;  1EKE A;  1VRT A;  3HL8 A;  1GOB A;  2A1S A;  4FW2 A;  4CJU A;  1U4B A;  2P1J A;  3DLG A;  3LAN A;  4H4M A;  4RW9 A;  3NF8 A;  4M45 A;  4CIE A;  3NBP A;  4FVM A;  4E7K A;  1N6Q A;  4DU4 A;  1KLM A;  1HRH A;  1SL0 A;  3AA5 X;  4ICL A;  4B08 A;  2G8W A;  4Z4G A;  1UA0 A;  1NJX A;  4W5N A;  3ZSO A;  4HUE A;  1HJR A;  4LSL A;  4FLV A;  3OYG A;  3QIO A;  4JLH A;  5E41 A;  3HM9 A;  3CQ8 A;  3KLG A;  4RW6 A;  1C1C A;  1SKS A;  2X6N A;  1TVR A;  2XHB A;  1D5A A;  4DTP A;  5FRO A;  1KVA A;  3CG7 A;  4CJF A;  2PYL A;  3C94 A;  5J1E A;  3OS1 A;  2IS3 A;  4FJX A;  1C1A A;  1TKZ A;  3QO9 A;  4Q0B A;  1LWE A;  4B9L A;  1WN7 A;  2EHG A;  4ELV A;  3K5O A;  4AHU A;  1ZBU A;  3OJU A;  3IG1 A;  3P5J A;  2OZS A;  4KB1 A;  4CHP A;  1RT3 A;  3K5N A;  4FW1 A;  2HHX A;  4CFA A;  2KFZ A;  4DTM A;  4FM2 A;  3QEV A;  3M8P A;  4GVM A;  4Z4E A;  4KHN A;  4DU3 A;  4ZTF A;  5EU7 A;  3AV9 A;  1N5Y A;  4FLZ A;  3SYZ A;  4Y1C A;  1SKR A;  4CEA A;  2OA8 A;  3QNO A;  4KHW A;  2VG5 A;  4F3T A;  1HQE A;  4NYF A;  1WSH A;  3SQ4 A;  5C25 A;  3AVA A;  4KB0 A;  1KFD A;  3MEE A;  3NGI A;  2DFH A;  2WON A;  4CFB A;  4DF4 A;  1C6V A;  3H08 A;  1JL2 A;  1RTH A;  3OS0 A;  3SPZ A;  1UOC A;  2KZZ A;  3HST B;  2OPQ A;  4CJ5 A;  3DMJ A;  4DLG A;  3KLE A;  1J53 A;  3A2F A;  2B6A A;  4O44 A;  3LPT A;  4AHR A;  4XIU A;  3U6F A;  4CEF A;  3LP0 A;  1IKV A;  3ZSR A;  4FJ5 A;  1GOC A;  1KSP A;  4EZ9 A;  3O3G A;  4H8K A;  3RTV A;  1VSD A;  4FK2 A;  5DK5 A;  5KTQ A;  1TK8 A;  4DQP A;  2YNH A;  1NOY A;  3ZT0 A;  4DS4 A;  3DRS A;  3B6P A;  4F4K A;  4CHY A;  4KI4 A;  1SL1 A;  4B9M A;  1EXQ A;  3WNF A;  4AHV A;  5SZT A;  4KHQ A;  3NCI A;  5HBM A;  3V9Z A;  3AA4 A;  4I9L A;  3OS2 A;  1EP4 A;  4DFM A;  4B9N A;  4HVJ A;  2YNI A;  1Z26 A;  3I8D A;  3LAM A;  3C6U A;  1O1W A;  4CEZ A;  4DQI A;  4ID1 A;  4CER A;  4OLA A;  1A5W A;  1D8Y A;  3TAQ A;  5CZ2 A;  3CFR A;  3NFA A;  3CFO A;  1ZBI A;  4F2R A;  4KRE A;  1ASV A;  3V1O A;  5KRT A;  3K5L A;  1X9W A;  4CJK A;  3DOK A;  3NE6 A;  4YNQ A;  2GBZ A;  3P1G A;  5T7B A;  3QET A;  4CJR A;  4L8R B;  2IOC A;  4M3T A;  1ZBH A;  1J5O A;  2DFE A;  4CEB A;  1YTA A;  4OKJ A;  4CJS A;  4GMJ B;  4CHN A;  4B9V A;  5J2N A;  4CCH A;  1RTD A;  3O3H A;  1RBT A;  2E6M A;  1VSL A;  4RW8 A;  4PUO A;  3HJF A;  2JLE A;  1TKT A;  2P51 A;  3VN5 A;  2KW4 A;  2Z1I A;  3VQP A;  1RT2 A;  1RBV A;  1RBR A;  3C6T A;  2Z1H A;  1A5X A;  3QEI A;  3LWM A;  3PUF A;  5I3U A;  5HRN A;  3TAF A;  2BE2 A;  4FZY A;  3T3F A;  2YKM A;  2F96 A;  1KLN A;  2RF2 A;  1BL3 A;  1WSG A;  3LAL A;  3MEG A;  2DFF A;  4W5T A;  3OYD A;  4E1M A;  4AIL C;  4CJE A;  3O4N A;  1GOA A;  1S1V A;  3TR8 A;  5J2P A;  1U48 A;  1NK5 A;  1HYV A;  3VA3 A;  4F2S A;  3RR8 A;  1JLA A;  3K58 A;  3ALY A;  2VG7 A;  4FLX A;  2BGG A;  3ZSW A;  4BWJ A;  1QTM A;  1X9M A;  1L5U A;  1BI4 A;  4CGD A;  4OPJ A;  3QES A;  3KKS A;  3PO4 A;  1QS4 A;  3K2P A;  3SPY A;  2O4I A;  3QEX A;  3KLI A;  1Z25 A;  1KFS A;  3SUO A;  1ZBF A;  5J2Q A;  2KFN A;  4OKE A;  1HMV A;  3ISN C;  1G15 A;  1J9A A;  3TAE A;  4KHY A;  2YHA A;  1QSS A;  3OYL A;  1XHZ A;  3AO5 A;  2E6L A;  4CED A;  4FJH A;  2D0C A;  4B9U A;  4DSJ A;  1MU2 A;  3HYF A;  4B8A B;  3NGZ A;  1RTJ A;  1WAF A;  1CLQ A;  3OVN A;  4HCC A;  1EX4 A;  4FZZ A;  1TAQ A;  3AA3 A;  4N76 A;  1TK0 A;  2IGI A;  4CGJ A;  4JS5 A;  4FM0 A;  3SV4 A;  4C8K A;  2HVH A;  4J2D A;  4JRP A;  3G0Z A;  1RIL A;  1QSY A;  3F9K A;  5HP1 A;  1S1U A;  3SJJ A;  3VQD A;  4FYD A;  4EZ6 A;  1JLC A;  1JXE A;  3AVJ A;  2FBT A;  4JRQ A;  5I42 A;  1NJZ A;  3L2Q A;  4M42 A;  4HTU A;  4KKO A;  1JLE A;  3VA0 A;  4BWM A;  3OYK A;  4CEO A;  3VQB A;  4F8R A;  3RMA A;  1LAW A;  3KD5 E;  4KHU A;  4KI6 A;  3TAR A;  1NKB A;  2ZQB A;  4J2B A;  4DMN A;  2X74 A;  1U49 A;  2P5O A;  3B6O A;  4PQU A;  4DTX A;  3CM6 A;  4PY5 A;  1S5J A;  3RMC A;  1LW0 A;  4ELU A;  4M3U A;  5KGW A;  1KCF A;  4KV8 A;  4CIG A;  2W42 A;  4CFC A;  2RN2 A;  1QSL A;  4F3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...