3VQ7A

Hiv-1 in core domain in complex with 4-(1h-pyrrol-1-yl)aniline
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
145
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 54
structure length 145
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq7A00
1BIUA 4FW1A 3VQ6A 3S3NA 1NKBA 1IKWA 1NK9A 3OVNA 4CJKA 1WAJA 1GOCA 5KI6A 1DTTA 2F96A 4Z4FA 3VQ4A 4DTJA 4CEDA 1W0HA 3ISNC 4CERA 4FK2A 3OYHA 4DS5A 2B5JA 3OYNA 3KTQA 4O0IA 4NCBA 1JLBA 4O0JA 2Y1IA 4FYDA 4DMNA 3MEGA 1Q8IA 3K5OA 4FJIA 1QHTA 1EKEA 4NYFA 1DLOA 3ASMA 4CEBA 4Z4EA 1B9DA 3OS2A 2OPSA 4HTUA 3AVIA 1HRHA 3S9HA 4C8LA 4FZYA 1C0TA 4CJRA 2PYLA 2HHUA 1S1TA 2D5RA 3CM6A 3OJUA 3HP9A 3NCIA 1S5JA 1RT5A 1A5XA 1FKPA 3KKRA 3DI6A 3ZSWA 3OS1A 3ZSYA 3ZSVA 4CHOA 4HHTA 2DY4A 3ITHA 4FLZA 1UA1A 4KHSA 4B9LA 1RTHA 2RN2A 4AHRA 4F3OA 2VWJA 1CLQA 3M8PA 4AILC 1TL3A 1NK7A 4JS4A 4CJ3A 3NFAA 2A1RA 5HP1A 1QSYA 1LWEA 1S6QA 4FLXA 3QEXA 3SUQA 1T05A 5KRSA 4OKKA 1J5OA 3TARA 2PY5A 1ZBIA 3PO4A 1C1AA 4FZXC 4F2RA 3ZT0A 1R0AA 1CZBA 3CFOA 3I8DA 1X9MA 1TKXA 2E6MA 3RR8A 4CCHA 2EHGA 3O3FA 1RTIA 2DFFA 4FLYA 3QESA 3K5NA 3NF7A 2KZMA 1KTQA 3LP0A 4B9VA 1X9WA 4RW7A 4BE1A 3AVHA 1I3AA 3WNGA 2YKNA 1RDBA 4FZZA 3PO5A 4FJJA 2X6NA 3VQQA 2ITGA 4B08A 1D9FA 1XI1A 2OZSA 2HHSA 1HQEA 1CZ9A 4CGGA 2ETJA 1SL1A 1MU2A 2O4GA 4CGFA 1RTJA 3NBPA 4CFAA 3NH2A 3NHGA 4HCBA 1ZBHA 1S1UA 5JS2A 1RT7A 4Z4IA 4DTUA 2F8TA 1RT1A 1FK9A 2B6AA 3KLIA 3ZT1A 4W5RA 3WNEA 5KRTA 1Z25A 4FLWA 4DTSA 1VSFA 2W42A 3LALA 3V4IA 5FROA 3HPOA 1RBVA 3FFIA 1EP4A 1C0MA 1RT3A 4ZHRA 1KLNA 4FJ7A 3G0ZA 3MXJA 5E41A 3RR7A 4B9UA 3PX0A 4FJHA 1GOBA 2HNZA 3D45A 1S6PA 4FM2A 4Z4CA 4M3WA 4OPKA 1K6YA 3PUFA 2HNYA 4CK1A 4E1MA 4KI6A 2QKKA 1KFDA 4BWJA 4IKFA 3LPUA 4CHYA 1IG9A 3HXMA 1RBUA 3K5MA 5EU7A 1NK5A 4YNQA 4CJVA 1VK0A 1VSDA 5KGWA 1D8YA 1HMVA 4RW6A 2IC3A 4CF2A 1WNSA 3OYCA 3G10A 3QEPA 4GW6A 4OVLA 4IBNA 1NK4A 3L3UA 3AVMA 4DQRA 3TAGA 2JGUA 4B9TA 2KFNA 3RWUA 4LD0A 4N5SA 3SQ1A 3L3VA 4E7LA 4JS5A 3MXMA 1KSPA 4RG8A 3VQ7A 4CIGA 1ITGA 4CIEA 3NF6A 3CFPA 1L3UA 2HB5A 2ZQBA 4DFKA 4M3TA 3SQ0A 3KK1A 4FLVA 3HL8A 1SKRA 1VSMA 4CJUA 3QO9A 4ZTJA 1T8EA 4B8AB 3KJVA 1BIZA 5CYMA 2Z1JA 1KVAA 1WSIA 4IFVA 2HHQA 3HVTA 4MQ3A 3DLRA 2XHBA 1HYZA 4DSJA 3F73A 2KZZA 1JLAA 3TABA 4F4KA 4DSEA 4B9SA 3CM5A 4DLGA 4AHTA 3V9XA 4LSNA 3VQ9A 3V81A 3L2RA 4I9LA 4CK3A 1L5UA 3O4NA 4ID5A 2YV0X 4WE1A 1L3TA 5CZ1A 4J2EA 4DSIA 3SUPA 3NE6A 1TK0A 2X74A 3RRGA 4B9NA 4M3UA 5J2NA 1QSSA 4FLTA 4FK4A 4E3SA 4KHNA 1ZBUA 1TV6A 1YTAA 1X9SA 1EETA 4Y1CA 4L8RB 4N76A 4EP4A 2YHBA 5CZ2A 3VQBA 1WSGA 2OPRA 4FJKA 4KAZA 1TVRA 3CFRA 4CGJA 4OKJA 3KK2A 4O4GA 4CFCA 4CE9A 4OJRA 1BHLA 1L3VA 4O44A 3OYAA 3LZJA 4FM1A 1ASVA 4Q0BA 2OYQA 2IGIA 2O4IA 3LP2A 2Z1GA 4DFPA 3E01A 2OPPA 1HNIA 1TGOA 3KLHA 4E7HA 3TAQA 1DTQA 4EZ9A 1GOAA 1RILA 3V1OA 1KLMA 4BDYA 3HVRA 3UIQA 3HO1A 3T3FA 3OYMA 4N41A 3DLKA 1CXQA 1A5VA 4DTPA 1NK0A 3VQ8A 4J2DA 1RT6A 4CJQA 4I7FA 3AVNA 4CF8A 1HNVA 3HP6A 3ZSZA 4ZTFA 1WLJA 1SL0A 1HYVA 3ZCMA 3D0PA 3H08A 2R7YA 3WNHA 3PY8A 2XY8A 4KHUA 3SJJA 4H4MA 1IO2A 1IH7A 2P1JA 4CGIA 3RMCA 4W5OA 4FJMA 3IS9A 4ID1A 4E7KA 1UA0A 2WOMA 4FJNA 1U49A 1TKDA 4QOZB 1LV5A 1VRUA 1SKSA 3DRPA 4PA1A 4DS4A 1XC9A 2PZSA 4KHQA 1VSEA 1BISA 4CHQA 3NH0A 3CQ8A 2XY5A 4JLHA 4BDPA 4KTWA 3OYJA 3VA0A 4OLBA 5HRNA 4DU4A 4M3XA 4HVJA 3BGRA 3I0SA 2G8FA 5CY4A 4C8NA 2BE2A 4FLUA 4CJTA 2HW3A 1S9GA 1C1BA 2ZD1A 2YNHA 4DFJA 1I39A 4DQPA 1YTUA 3QIPA 3KLEA 4PUOA 1RDDA 2GUIA 5DK5A 5DMRA 4FK0A 1NJZA 1QS4A 4CJSA 2OA8A 3AO1A 5HRSA 3L2QA 2HHXA 2DTUA 4KB1A 4CEZA 1TAUA 5I3UA 1ZBFA 1TKTA 1JLEA 5T7BA 4CHZA 1C0UA 3P83D 4CEQA 1SKWA 3AA3A 1BQMA 3K5LA 2P51A 4KV8A 5CYQA 2XO7A 4FJ9A 3VQDA 1JXBA 2FBYA 3SCXA 2DFHA 4HCCA 3L2VA 4E7JA 1NJXA 1KCFA 1VSJA 2EX3A 4CJLA 3CYMA 2KW4A 1ZYQA 3ZT2A 1TL1A 4FJ8A 1NK6A 2KTQA 1T7PA 1F21A 1RBTA 3DLEA 4KKOA 2XY7A 1NOYA 4ICLA 2IAJA 4KHYA 1Q9XA 4OPJA 4QCLA 3LAKA 4DTXA 3DM2A 4KPYA 3VQEA 3C6TA 3NF8A 4CGDA 3L2WA 3NGYA 4CJPA 3EYZA 3K2PA 1REVA 2YNIA 4W5QA 1Q9YA 3NAEA 3AO3A 2AJQA 4KFBA 1BI4B 3QLHA 4CEOA 3V1RA 3OYFA 3AVCA 1C1CA 3QIOA 2OPQA 4CJ4A 1VSKA 4CFBA 1D9DA 4J2AA 3AVJA 1WSJA 3IG1A 3U3YA 4DSKA 2FBVA 3RMBA 3SPYA 4F2SA 3KLFA 3KIOA 2RKIA 1TAQA 3AO2A 1YT3A 2YKMA 5C24A 1IKYA 1WSHA 2VG6A 1KRPA 1A5WA 2E6LA 4DSLA 3AO5A 3LDSA 4AHVA 3ULDA 3S3OA 1QTMA 4Z0UA 3K57A 3C94A 1BCMA 3PX6A 1RDCA 2XY6A 5HBMA 1JKHA 1LW2A 3NGZA 2GBZA 4BWMA 2D0CA 2IS3A 5JS1A 4ELUA 3B6PA 3LPTA 3SQ4A 1UWBA 1NK8A 4E89A 2HVHA 4M3RA 3VQ5A 1S1VA 3ZT4A 3KK3A 3AA2A 3QNNA 3TI0A 1UAXA 3DLHA 1HYSA 4HUGA 1XWLA 3ZSRA 2G8WA 4FJXA 1X1PA 2FBXA 2Y1JA 2YHAA 2G8KA 4E1NA 1VSIA 4F8RA 1Y97A 3PV8A 4C8KA 4DTNA 4K8XA 3AVKA 3V9SA 2KQ2A 1W9HA 3OYDA 1LAVA 4ELVA 1D5AA 3NDKA 2A1SA 3V9UA 4KO0A 2X6SA 3K58A 4CJWA 3U6FA 1WSFA 4OLAA 1G15A 1BGXT 5HROA 3V6DA 2HNDA 1NKCA 3IRXA 1KFSA 4CHNA 3HPGA 1IKXA 4BE2A 1HQUA 4CESA 4O5BA 4G1QA 3OYBA 4FJGA 5J2QA 3JSMA 3DLGA 2RF2A 4DQSA 1BI4A 3LP1A 4I2QA 1NOZA 4H4OA 4CF0A 3VA3A 3VQAA 5C25A 4KHWA 3AVFA 4CK2A 1TKZA 4Z4GA 1ASWA 3HK2A 3RTVA 2XRIA 3SNNA 3KKSA 1S9EA 4CIFA 3F9KA 3OYLA 4E19A 5HRPA 3DMJA 3ZT3A 4FJLA 3DOLA 4CJFA 4N47A 2HHTA 3VN5A 2B4JA 3ZSQA 2VWKA 1O1WA 3OYEA 3LZIA 4E7IA 1EXQA 4AHCA 4DTMA 3TAFA 3MEDA 3VQCA 3RMDA 3M8RA 4IDKA 1TK5A 1C6VA 2G8HA 3AVBA 4PY5A 1BQNA 1T03A 3TR8A 3P1GA 1JL2A 1B92A 5SZTA 1JL1A 2I5JA 4M41A 5KGXA 4RW4A 3TAEA 1N5YA 2HVIA 4N56A 4DTRA 4HUFA 3AVGA 3SUOA 2FBTA 3KD5E 4FVMA 4FW2A 2Q3SA 1RBSA 4HUEA 3V9ZA 1RT2A 4CJ5A 2YNGA 1VSLA 4TSXA 4W5NA 4DSFA 1ASUA 4LSLA 4I2PA 1HPZA 1RNHA 4B8CA 4UQGA 3QERA 1SL2A 1LWFA 2ZE2A 3OS0A 3L2UA 4OKEA 3TAPA 3HPHA 4M3ZA 3TWHA 1WAFA 4CEFA 3RRHA 1JLGA 5D3GA 1N6QA 2HMIA 4NCGA 5J2MA 3A2FA 4CF9A 4Z4HA 4DU1A 4M3YA 1FXXA 3HSTB 4NCAA 4FM0A 2DFEA 3CG7A 4MFBA 5KTQA 4Q5VA 1NJYA 2P5OA 2F8SA 1XHZA 3HJFA 4CHPA 2QKBA 5FRNA 1VSHA 1KVBA 5J1EA 1U04A 1EX4A 3DLBA 3OYGA 1WSEA 3EY1A 3V9WA 4W5TA 3SUNA 1TK8A 5FRMA 2Z1HA 1SUQA 3KD1E 1FKOA 1S1WA 2IOCA 4IFYA 3KLGA 4XIUA 3AA5X 2Z1IA 4YFUA 4EZ6A 3SV4A 4OGCA 2P5GA 2G8IA 1JLCA 3O3HA 3AVAA 4AHUA 3HT3A 3SI6A 4LH5A 1WN7A 3OY9A 4DG1A 1UOCA 2QXFA 2VG5A 2X78A 4AHSA 4CF1A 4H8KA 1Z26A 4BE0A 4BDZA 1U45A 1U47A 4FJ5A 3O4QA 4F3TA 3EZ5A 4JRPA 1CXUA 3TAMA 4DF8A 5I42A 4DU3A 1J54A 3THVA 3SV3A 2ATQA 4OGEA 3MAQA 1SV5A 2FC0A 2BANA 4NYNA 2D0BA 3HM9A 4M42A 3AVLA 3AO4A 4E0DA 2WONA 4Y1DA 4M45A 5J2PA 3HYFA 4IG0A 4DQQA 2HHVA 4QAGA 3LAMA 5HRRA 4JRQA 3VQPA 3B6OA 4GVMA 4CFDA 3JYTA 4IG3A 4C8OA 4K8ZA 3LWMA 4KTQA 4LH4A 3SYZA 3QEVA 1S1XA 2PYJA 1VRTA 1XHXA 2RPIA 3M8QA 2E4LA 3NGIA 2VG7A 1L3SA 2D0AA 3I0RA 3SPZA 3OYIA 3P5JA 3WNFA 3QNOA 1JXEA 3QEWA 2NUBA 4CEEA 3QETA 3ZSOA 2JLEA 1QSLA 4DQIA 4KRFA 3NF9A 1BL3A 3DOKA 1RT4A 3PX4A 1RTDA 1KVCA 3DYAA 3MXIA 5HLFA 3L8BA 4O55A 1YVUA 1RDAA 3U3GA 3SZ2A 4R5PA 2OZMA 2G8VA 4CEAA 3MEEA 4KTZA 1BCOA 2GV9A 3V1QA 3ZSXA 3RMAA 4FXDA 4DFMA 2LSNA 4KREA 4AH9A 3T1AA 5SWMA 3O3GA 1NKEA 3NH1A 4DLEA 4I9QA 4EP5A 4LY7A 4GMJB 3OJSA 2BDPA 3IAYA 4CGHA 4BACA 3DRRA 3LANA 4PWDA 1LAWA 1LW0A 1U48A 1QE1A 1RBRA 4DTOA 1J9AA 3OYKA 1B9FA 1HJRA 3C6UA 4DF4A 1RCHA 4RW8A 1LWCA 2HHWA 3S3MA 5C42A 4KB0A 3LP3A 3QEIA 2G8UA 3C95A 3TANA 1JLQA 4C8MA 4B9MA 3LWLA 1NJWA 3T19A 4CECA 3DRSA 1ZBLA 2BGGA 5FDLA 4B3OA 3QINA 5K14A 1JLFA 2YNFA 4ELTA 4KI4A 4CJEA 1J53A 1IKVA 1QQCA 3BDPA 2KFZA 1U4BA 2QK9A 3AA4A 2IDOA 3M8SA 3SQ2A 3MECA 3ALYA 4DWIA 3K59A 4RW9A 4FCYA 4J2BA 3AV9A 4PQUA
chains in the Genus database with same CATH superfamily
1QQOA 4FW1A 1NG9A 2FF6A 4CJKA 4K42A 1DTTA 1X3MA 2F96A 3VQ4A 4JD2A 1GLCG 1ESVA 2HMPA 3ISNC 4X65K 4Y0WA 4O0IA 2HBMA 4C1NI 4DR6K 4FYDA 4ILGB 3WXIA 4DB3A 1Q8IA 3K5OA 4FJIA 4EHTA 1B9DA 4FZYA 1KAXA 2HHUA 4FJGA 2P9SA 3CC7N 1GLFO 3ZSWA 3DI6A 4CBUA 4CHOA 3ZX3A 1UA1A 4RWTA 4OPHA 2RN2A 2ZJRL 1XUPO 3M8PA 4B3RK 4JS4A 3CXCM 1Y64A 2GWJA 3B8AX 5AQPA 3WEEA 3S41A 3SUQA 2ZWHA 3D2FA 1T05A 2PY5A 1TYQA 3TARA 3THWB 4F2RA 3ZT0A 1CZBA 3CFOA 3T69A 3I8DA 2E6MA 3RR8A 4A59A 3W3DA 1KQSM 3A5NC 4GY2B 3WNGA 2YKNA 1RDBA 4GV3A 2X6NA 2OZSA 1HQEA 1M1KO 4M63C 3LDLA 1MU2A 1YJNN 2O4GA 2BUPA 1ZBHA 4HCBA 3NH2A 3VESA 1S1UA 3H6EA 2UU9K 1RT1A 3VPZA 3ZT1A 4W5RA 3SBGA 2E1ZA 1QHAA 5FROA 3HPOA 1RBVA 3FFIA 1C0MA 4ZHRA 3CCQN 3KZBA 3ID8A 1GOBA 3D45A 1S6PA 1W2BM 4CZIA 3EL2A 4FWQA 3CCSN 4CK1A 4E1MA 1KFDA 5JLFA 4Z94A 3E9OA 1VK0A 1VSDA 4BVPA 5AQHA 2NNWA 4CZLA 1WNSA 4BC2A 3G10A 5C10A 4OVLA 3QEPA 4IBNA 1NK4A 3L3UA 1VQMN 3TAGA 2JGUA 4B9TA 4PHTX 3MXMA 1BU6O 2NRRA 2IVNA 2HB5A 2ZQBA 3FZHA 4E1JA 5AR0A 4FLVA 1T8EA 4CI6A 3KJVA 2Z1JA 4IFVA 4MQ3A 2XHBA 1ATRA 1JCEA 2QWMA 2KZZA 4EIAA 1XQSC 4DLGA 3V9XA 3VQ9A 3L2RA 1L5UA 4WE1A 5CZ1A 3M6GA 4J2EA 4DSIA 5J2NA 2QM1A 4E3SA 1TV6A 2A42A 3IUCA 1N36K 1QQMA 4WFNL 1OH6A 4IXCA 4KAZA 1TVRA 1Z6RA 4A5BA 4DR5K 5AQIA 4CFCA 3T7ZA 3CJ7A 3K0SA 3CJCA 4FO0A 4KH5A 4WCEL 3ENHA 1VQ6N 2QW9A 5JVGL 2CGLA 3DLKA 4I7FA 4ZTFA 3ZSZA 1SL0A 3PY8A 4BRIA 3RMCA 4FJMA 1UA0A 2WOMA 4XH4A 2D4WA 1LV5A 3EEQA 1NMDA 4PA1A 1IBLK 2PZSA 3VA0A 3BZCA 4DU4A 4HVJA 1W7AA 1T6CA 5F0XA 3O8MA 4C8NA 1S9GA 1C1BA 3FLCO 3KLEA 5DM6L 3WXJA 3R8EA 2OA8A 3AO1A 2DTUA 4CEZA 4CZMA 1ZBFA 1TKTA 3G4SN 2YHYA 1JLEA 5T7BA 3OW2M 4YY3K 4AM6A 3AA3A 1BQMA 4FWSA 3K5LA 1EQYA 5CYQA 3VQDA 2FBYA 3Q7BA 5EX5A 4HCCA 5C2FA 1NJXA 1KCFA 3ZEUA 1ZXOA 2KW4A 3CYMA 1Q81O 4IDHA 3E66A 2PBDA 3M1FA 4OPJA 4DTXA 3DM2A 3NGYA 3EYZA 4BR0A 3THXB 3V1RA 4QS9A 3AY9A 5C2DA 4CJ4A 3AVJA 1WSJA 3UKUA 1VQLN 4DSKA 3SAGA 5AQTA 2GELA 2RKIA 1TAQA 3AO2A 4BGBA 4FWOA 3LDSA 1NGFA 1QZ6A 3C94A 1BCMA 1YI2N 3VF4A 5AQUA 3NGZA 5M1PA 2P9LA 3G71N 4JD2B 3B6PA 4EHUA 3SQ4A 1DKGD 1S3XA 3VQ5A 4JI7K 3DLHA 1UAXA 1XC3A 1XWLA 2G8WA 4FJXA 1X1PA 5LL6Z 4LFBK 1VSIA 1Y97A 4BRMA 2UUCK 4DTNA 3AVKA 3V9SA 1EWQA 1LAVA 2P9SB 4ELVA 2A1SA 3V9UA 4KO0A 3O6WA 2Q2RA 4WQ4A 1WSFA 3V6DA 5AZJA 3C0BA 3WEEB 1IKXA 3D2FB 4O5BA 5J2QA 3M5RA 3DLGA 1JJ2M 4DQSA 1BI4A 3LP1A 3HSCA 4I2QA 1NOZA 4H4OA 4CF0A 5GADP 3VQAA 4H0VB 5EVZA 4CK2A 1ASWA 3RTVA 2NRWA 1K8KA 3KKSA 2HSTA 3DOLA 2HHTA 3VN5A 2B4JA 3TAFA 3OYEA 4E7IA 3MEDA 3WQTA 4KH4A 5BPNA 3M8RA 1TK5A 3HOSA 4PY5A 3P1GA 5KGXA 2HVIA 5E84A 3AVGA 3QFPA 2Q3SA 3V9ZA 2WUSA 4CJ5A 3R9PA 4M7YA 2JWLA 4DSFA 1TUUA 3QERA 2V7ZA 4M3ZA 3HPHA 3VGKA 2ZJQL 3AAQA 3P31A 4IO8A 4DUYK 3HSTB 4NLBA 4MFBA 3KHYA 5KTQA 4Q5VA 2F8SA 3HJFA 3DXMB 2UXBK 2O8CA 3TTFA 2UUAK 3D7EO 3DLBA 5FRMA 2EWSA 4XIUA 4JEPA 4YFUA 4WQ5A 2P5GA 5AQQA 4ILJA 3TSPA 3L4QA 2NRHA 2X78A 3QBXA 3VEOA 3O4QA 1ATNA 2E2NA 4DF8A 1J54A 3THVA 3AO4A 2WONA 1P90A 3QB0A 1NGEA 5HRRA 3T1HK 2YX6A 4CZHA 3GDQA 4BRHA 3SYZA 1S1XA 2Q97A 4BQLA 2PYJA 2RPIA 5AQVA 3OA9A 2E4LA 2D0AA 3I0RA 3VF6A 4CZEA 1QSLA 3ZSOA 2JLEA 2A3ZA 3NF9A 3CCUN 1RT4A 4O8UA 3PX4A 1YVUA 3SZ2A 4R5PA 2OZMA 4A5AA 3MN5A 4CEAA 2G8VA 3UB5A 4IOAL 3RMAA 4FXDA 2LSNA 4DHYA 5SWMA 3NH1A 3F5TA 2W40A 4EP5A 4LY7A 2BDPA 3IAYA 5M1OA 3N4PA 3EZWA 4CGHA 4BACA 4OO1J 3OYKA 1JCGA 4RW8A 3Q7CA 3FZLA 3CQXA 5M1NA 3S3MA 5C42A 5JMVA 4KB0A 3QEIA 1FJGK 4IWVA 1NJWA 3T19A 1Q7YO 4CECA 2BGGA 1NNEA 2D1KA 2E20A 4ELTA 5ADXA 2KFZA 1U4BA 4DV6K 4H0XB 1FW6A 3MECA 4J2BA 3K59A 4RW9A 3O4WA 3AV9A 5BN9A 4PQUA 3S3NA 3CCJN 3OVNA 4BVOA 4Z4FA 4DTJA 4ILHA 4IOXA 3MMVA 3OYHA 4DS5A 4FK2A 3OYNA 4NCBA 3J7YP 1JLBA 1R59O 3ZEUB 4YOYA 1NGDA 4DMNA 3FZFA 4I6MA 1N33K 1EKEA 1NLVA 4CEBA 4FVUA 4CJRA 3CM6A 3SMPA 3HP9A 3NCIA 4CZJA 1RT5A 1FKPA 3OS1A 2DY4A 3ZSYA 3ZSVA 3I56N 5EOYA 4FLZA 5AQXA 4B9LA 1RTHA 1RGIA 2NRZA 4AHRA 1NGHA 2QI2A 3FGUA 1NK7A 3NFAA 1QSYA 1LWEA 3UKUB 5C15A 3ID6A 3KWGA 1C1AA 5KPTA 4FZXC 3GOIA 4MO4A 4IO9L 4HWIA 2I7PA 4PL8A 4FLYA 1K9MO 3LP0A 3E9PA 3HZ6A 1E4FT 2GWKA 3AVHA 1I3AA 4JI4K 1OKJA 5AQWA 5H1SQ 5AQNA 3HRGA 4B08A 4ISGA 1CZ9A 4CGGA 1SL1A 1IJJA 1RTJA 3NBPA 3O08A 3QICA 4JKEA 3NHGA 4Z4IA 4JNEA 4LF5K 2QWLA 4BROA 3PSFA 1RDUA 5KRTA 1NBWA 1LOTB 3U8XA 4DTSA 1YJWN 3LALA 4C1NK 4JKDA 3R6MA 1DT9A 1RT3A 4LFCK 1H1VA 3MXJA 3IDHA 1XMOK 3THYA 3PX0A 3C7NA 1SS6A 4GNIA 4M3WA 1QZ5A 4YORA 3BF3A 3PUFA 2QXLA 4KI6A 2QKKA 2Q0RA 1N8RO 2FXUA 3LPUA 4B1VA 4U7BA 3K5MA 2Q1NA 1NGIA 3SAFA 2IC3A 4GW6A 3AVMA 4A57A 2KFNA 4LD0A 2A41A 4E7LA 4JS5A 4LF6K 1ITGA 4JKHA 4CIEA 1L3UA 3VEXA 3ZLJA 4DFKA 3HL8A 1SKRA 1VSMA 2HHQA 3DLRA 3F73A 4F4KA 3LL3A 5GAEP 4I9LA 3F2KA 4O5FA 4ISEA 3O4NA 4X62K 2YV0X 1L3TA 4BRKA 3BZKA 3NE6A 3RRGA 4B9NA 2NRXA 4FLTA 1ZBUA 5FPDA 3G6EN 3I8BA 2YHBA 5CZ2A 4FJKA 2OPRA 1KAYA 3DWLA 4V19S 1BHLA 3CJ1A 3SLCA 4O44A 3LZJA 4Q0BA 1ASVA 4FOIA 2IVPA 2IGIA 4BR7A 2O4IA 4DFPA 1M90O 1HNIA 1VQ7N 4E7HA 1VHXA 4EZ9A 1GOAA 1KLMA 3AARA 3H45C 3UIQA 3T3FA 2NLXA 1YF5L 4JI1K 4DTPA 4H0OA 5KQDA 3AVNA 3DJCA 4CF8A 2H3GX 1HYVA 1CZAN 3A0IX 2D0PA 3H08A 4KHUA 3WNHA 3LDNA 3D6RA 5AQGA 3SJJA 2P1JA 4CGIA 3VGMA 3ATUA 5AFUA 4BC3A 1VRUA 3DRPA 1XC9A 1D4XA 4K43A 4KHQA 2P9KA 1NU0A 1IV0A 3CQ8A 3OYJA 3VTIA 3BGRA 3CCLN 2G8FA 4CJTA 4DQPA 3VMFB 2ZD1A 1RDDA 1NJZA 1QS4A 1HKBA 4AM7A 1YJ9N 3H1VX 1TAUA 4BRAA 1C0UA 3P83D 4CEQA 1VQ5N 2P51A 2XO7A 1U2VB 4JKGA 2DFHA 3L2VA 4E7JA 1YUWA 2F9TA 1HR0K 2O8EA 1NOYA 1RBTA 2RHKA 4DR3K 4ICLA 1Q9XA 3OTOK 4KPYA 4CGDA 2HHHK 3NAEA 1GLAG 2O8BA 1W97L 3OYFA 3J8AA 1C1CA 4J2AA 4PKHA 1VQNN 4R79A 4JI5K 3KIOA 5AQOA 3OHRA 2YKMA 1WSHA 2E6LA 4AHVA 4Z0UA 2E2OA 3PX6A 2E2PA 4JI2K 4JN4A 2KKZA 2GBZA 4BWMA 2IS3A 4ELUA 4H5TA 1NK8A 2ZGYA 5TKWA 3KK3A 3AA2A 4YDUC 4HUGA 1QVGM 5KQ8A 3UE5A 4E1NA 4DV7K 5BRHA 4K8XA 5DM7L 2KQ2A 1W9HA 3OYDA 3K58A 1C0GA 3U6FA 1EO1A 5HROA 2P9UA 2HNDA 1NKCA 3IRXA 1ATSA 1RDWX 4FWLA 4BC5A 1WOQA 3VENA 3IKMA 3HBTA 4KHWA 3AVFA 3HK2A 2ASOA 2XRIA 3SNNA 3F9KA 3OYLA 3DMJA 4MO5A 1J5EK 2Q0UA 3WXLA 3ZSQA 2VWKA 4JI8K 5MLCQ 1BWFO 3LZIA 1EXQA 4AHCA 3D2EA 1QQNA 5CE3A 2G8HA 3AVBA 5FPNA 4M41A 4DR4K 2D0OA 2UUBK 1YIJN 2FBTA 2PFUA 1XNRK 1RBSA 1SQKA 5LJWA 2YNGA 4I2PA 1HPZA 3CJ9A 4CVNE 2UXCK 1LWFA 3EE8A 3OS0A 3L2UA 4FWMA 3TAPA 1WBDA 3TWHA 1WAFA 1JLGA 5AZIA 5J2MA 3A2FA 2QWRA 4GVEA 5BR9A 1NGCA 1GLJO 3CI5A 3THYB 4FM0A 4NCAA 3C7NB 5AQSA 2FSKA 2P5OA 4DR2K 2QKBA 5FRNA 1EX4A 1WSEA 3EY1A 1SUQA 1KC8O 3KD1E 4BR9A 2G8IA 3O3HA 2FSNA 3HT3A 3SI6A 5AQFA 4DG1A 2VG5A 4AHSA 3E9LA 5HOOA 4BREA 3J81O 3ZETA 4JKFA 1Z26A 3EZ5A 1OH7A 4JRPA 1CXUA 2ATQA 3HTVA 4OGEA 3MAQA 1SV5A 2D0BA 3HM9A 4M42A 4E0DA 4JHDB 4Y1DA 3HYFA 3ZYYX 2HHVA 4QAGA 3LAMA 5LY3A 4JRQA 1LCUA 1HNZK 4C8OA 4K8ZA 3LWMA 4KTQA 1NM1A 3EKUA 3GE1A 2GTDA 4DCHA 3SPZA 3P5JA 3QEWA 3J7ZO 5BREA 1HJOA 4JI0K 3A8YA 4CD1A 3MXIA 4JK8A 4H5WA 4O55A 3U3GA 1RDAA 1GLLO 3RSEA 4H5RA 2GV9A 3MN9A 3V1QA 3ZSXA 3IFRA 1IBMK 4AH9A 4FWPA 3O3GA 4I9QA 3OJSA 3DRRA 3LANA 1LAWA 1LW0A 4B9QA 1HJRA 4DF4A 2HHWA 3LDOA 1TYQB 4B3MK 4F9OA 2YJEA 3VEYA 2VQEK 1JLQA 4WFBL 4B9MA 2IVOA 5E26A 3K9JA 4XH5A 4BRCA 4PKGA 3AA4A 2HOEA 2IDOA 1IBKK 4JI3K 1HLUA 3VQ6A 1NKBA 1IKWA 1WAJA 5AJ3K 2WFBA 1Z05A 1W0HA 4WFAL 3L0QA 4XEIA 4CERA 2GUPA 4IEEA 4Z4EA 3SMSA 4K0KK 3AVIA 1HRHA 3S9HA 4C8LA 1C0TA 2PYLA 4A2AA 2HHXA 3O9SA 4BRQA 3ITHA 4KHSA 4A2BA 1CLQA 4YOUA 4AILC 3CPEA 4WQ4C 2A1RA 5HP1A 2J4RA 1EWRA 1S6QA 2F7TA 2ZF5O 3A5LC 4XH1A 4OKKA 5KRSA 1ZBIA 3PO4A 1HPMA 3OBWA 3O5BA 4B1XB 4JAXA 1X9MA 1VQ8N 4BQZA 4CCHA 2RE2A 2DFFA 3C6HA 3QESA 1KTQA 1X9WA 4RW7A 1Q86O 3CJAA 4BE1A 4RTFD 2ITGA 1ZBSA 1WUAA 2YHXA 2ETJA 5JS2A 4DTUA 3GL1A 1FK9A 2B6AA 3JS6A 3WNEA 1Z25A 1HUXA 5EY4A 1S22A 2W42A 1EP4A 1KLNA 2VCPA 3G0ZA 4FJHA 3RR7A 1T6DA 2HNZA 4Z4CA 3H1QA 2HNYA 1U6ZA 4BWJA 3CETA 1NGGA 2IIRA 3WT0A 1RBUA 3TSQA 3THWA 4FSVA 1D8YA 1HMVA 4RW6A 3OYCA 1V4SA 4WQ5C 3QMLA 1BUPA 3D2EB 3CCEN 3L3VA 3VQ7A 4CIGA 2UYTA 2GEMA 3CJBA 3CFPA 3NF6A 4BR4A 3ULEA 4YOXA 4B8AB 2Q31A 1MDUB 5CYMA 4LC9B 1KVAA 1WSIA 4O8KA 1P8ZA 1HYZA 4DSJA 3TABA 4B9SA 3CM5A 4FOEA 4AHTA 1TUYA 3JAMO 4CK3A 1HNXK 4NLCA 1TK0A 4M3UA 1QSSA 4KHNA 5BN8A 1YTAA 1X9SA 1EETA 3R3LA 3VQBA 3CFRA 4CGJA 2QWOA 4BR2A 4B1ZA 4BRFA 3KK2A 3H46O 4O4GA 4CE9A 3CMEN 4FM1A 3WUHA 2QA4N 2QWQA 3LP2A 4BG8A 3E01A 2OPPA 3N4QA 3TTCA 3TAQA 1DTQA 1RILA 2P9PA 3FFKB 4BDYA 3JXUA 3HVRA 4LF8K 3K9KA 3HO1A 4PL7A 3OYMA 3O9UA 1N32K 4CJQA 1HNVA 2VWBA 1WLJA 5EXWA 4EFHA 3ZCMA 3D0PA 2XY8A 4H4MA 3RVCA 4W5OA 4FJNA 3VEZA 4BRPA 1U49A 4DUZK 1SKSA 5KPRA 5M1QA 4DS4A 3AAPA 1VSEA 3ENOA 4CHQA 4BRGA 4JLHA 4KTWA 4LF7K 2O8FA 3I0SA 5CY4A 2BE2A 4FLUA 1DGKN 1BG3A 4DFJA 3J7AP 2BH1A 4DQ8A 2GUIA 2P9LB 1NMNA 4BGAA 2OTJN 3SJHA 2P9NA 1BO5O 4GKKK 4OPAA 4MDAA 5JICA 4KV8A 5GIPA 1JXBA 3WQUA 3SCXA 1VSJA 3CCRN 2EX3A 4CJLA 1ZYQA 3ZT2A 1TL1A 4FJ8A 2KTQA 1T7PA 3DLEA 2XY7A 4KKOA 5FPEA 2IAJA 5AZJB 3VERA 4QCLA 4A61A 3L2WA 3O9TA 3K2PA 2YNIA 4W5QA 1T44A 4KFBA 1BI4B 3QLHA 5M1KA 4CBWA 4CEOA 1VQPN 3QIOA 2OPQA 4CFBA 3PSIA 1D9DA 3IG1A 3RMBA 3SPYA 3KLFA 1K8KB 5LMNK 4K25A 4BY9C 1IKYA 2ITMA 1GLBG 3AO5A 3ULDA 5A2QO 3S3OA 3K57A 2HBKA 1ILYA 3BUZB 3MK6A 1RDCA 4H0TB 5HBMA 1JKHA 5JS1A 3PIPL 3LPTA 1UWBA 4HTLA 4E89A 4UY8O 3MN7A 3AGRA 2E1YA 3ZSRA 2FBXA 4J8FA 2YHAA 2G8KA 1VAZA 4F8RA 4AF1A 3PV8A 4JK7A 3HM8A 1IG8A 3FZMA 3CIPA 2X6SA 4M7XA 5AQYA 3SK3A 4CJWA 4OLAA 1G15A 2WC9A 1T3VA 2O8CB 4BE2A 1HQUA 3OYBA 4G1QA 4L3QA 4QS8A 3JSMA 4B3SK 4KH6A 3F9MA 3CC2N 3DAWA 1NWKA 3VA3A 5C25A 3W0LA 1TKZA 4BG9A 1S9EA 4CIFA 3GBTA 3FE1A 5HRPA 4N47A 4DKWA 4IJAA 1O1WA 3VEVA 3VOVA 2PAVA 1OVYA 3BEXA 4CJ7A 2W6KA 1BQNA 1T03A 3TR8A 1JL2A 5SZTA 1JL1A 1N5YA 4RW4A 4JKBA 4DTRA 4HUFA 3WXMB 3KD5E 1K8AO 4HUEA 4TSXA 1VSLA 4H03B 5BR8K 1XMQK 4W5NA 1ASUA 4MDBA 2E2QA 4UQGA 1RNHA 3A5OC 4IJNA 2ZE2A 4OKEA 3ZX0A 5GAHP 2ZJPL 1VQKN 4LF4K 5D3GA 3QDKA 4NCGA 4CF9A 4M3YA 5GAGP 3KWIA 2DFEA 5AQRA 4BR5A 1NJYA 1XHZA 4CHPA 5C0YA 1VSHA 1KVBA 2DPNA 4W5TA 1O13A 2Z1HA 2IOCA 3KLGA 3CERA 4OGCA 3U9ZA 2OANA 2QTDA 3AVAA 2AA4A 2HBJA 3OY9A 5AQJA 2QXFA 5AQMA 4DV0K 4JYAK 4F3TA 4FJ5A 3FZKA 3ULEB 4YDUA 4FWKA 4DU3A 3SV3A 2BANA 4FPBA 1WB9A 2V7YA 4M45A 2HF3A 1GLDG 2NZTA 4DQQA 5JLHA 4YOTA 4GVMA 4CFDA 3JYTA 4G9ZA 1SAZA 5GINA 4LH4A 1NJIO 3UKRA 3QEVA 4BC4A 4DV2K 1XHXA 2YJFA 3M8QA 3NGIA 2WBNA 3G25A 2CH5A 3DXMA 3WNFA 3QNOA 5AQKA 3PIOL 2NUBA 1YITN 4CEEA 4YOWA 4DQIA 4NB4A 3DYAA 5HLFA 4I6MB 2P9PB 1MA9B 2KLAA 4WYBA 1Q82O 3IMXA 1BCOA 4JKCA 3O1BA 4BRNA 1NKEA 2VYPA 1Q18A 4GMJB 2CGKA 4CBXA 2ZM6K 2V51B 3NMUA 1U48A 1QE1A 4DTOA 1B9FA 2VQFK 1JCFA 2VGNA 3LM2A 3LDQA 2YHWA 3LP3A 3O9RA 2G8UA 3C95A 4LFAK 4C8MA 2I7NA 3VETA 3LWLA 4B3OA 1ZBLA 4BRDA 2O8FB 1JLFA 2YNFA 3BF1A 2VGMA 3VEWA 4CJEA 1J53A 1QQCA 2QK9A 2QWPA 4JV5K 3MCAB 4FPAA 3BP8A 1YVNA 2FF3B 1HKCA 3LM9A 4NO7A 1BIUA 2YCHA 2GX9A 4H0PA 4U67L 1NK9A 1GOCA 2NRTA 2P9NB 5KI6A 5C12A 2O8DA 4CEDA 2KHOA 2B5JA 4MLHA 3KTQA 4O0JA 2Y1IA 3MEGA 5LMUK 2OTLN 1QHTA 4NYFA 1DLOA 3ASMA 2FLOA 3OS2A 2OPSA 4HTUA 1N34K 3NVKA 2ZGZA 1S1TA 2D5RA 3OJUA 4IOCL 4DQRA 1S5JA 3KKRA 1A5XA 5IWAK 4HHTA 2KZMA 3C65A 1NGJA 4F3OA 2VWJA 1TL3A 3H3NO 4CJ3A 4FLXA 3QEXA 4JI6K 1J5OA 4K41A 2CH6A 4MLEA 1R0AA 2P9IA 1TKXA 3CCVN 2EHGA 3O3FA 1HNWK 4KHPK 1RTIA 1RFQA 3K5NA 3NF7A 4B9VA 2Q36A 1HX1A 3I33A 5CR4A 4FZZA 3PO5A 1QVFM 4FJJA 4X66K 4H0YB 3VQQA 1D9FA 1XI1A 2HHSA 1DEJA 4JKAA 4CGFA 4CFAA 3WXKA 1RT7A 3O80A 2F8TA 4KBOA 3KLIA 5FPMA 4FLWA 4IEIA 1NGBA 1VSFA 2AP1A 3V4IA 3KVGA 3MWPA 4FJ7A 5E41A 4B9UA 4FM2A 4OPKA 1K6YA 3LDPA 4IKFA 4CHYA 1IG9A 3HXMA 1OVQA 5LJVA 5EU7A 1NK5A 4YNQA 1V4TA 4CJVA 5KGWA 4FWNA 4CF2A 4CW7B 4FL9A 3RWUA 4N5SA 3SQ1A 1KSPA 4RG8A 2NRVA 4YOVA 4C23A 4M3TA 3SQ0A 3KK1A 1SZ2A 3T1YK 4CJUA 3QO9A 4ZTJA 1BIZA 1BOTO 3HVTA 2P9KB 1K73O 1JLAA 4DV5K 4DSEA 4OX9K 4LSNA 3V81A 1KXPA 1KD1O 4ID5A 3SUPA 2X74A 4FK4A 4H5NA 3E1YA 1YHQN 2F4VK 4Y1CA 3DXKA 4L8RB 4N76A 4EP4A 1WSGA 4OKJA 5CHIA 3AGKA 4OJRA 4CZGA 4JKGB 3R1XA 1L3VA 3OYAA 1BDGA 2HF4A 2OYQA 4JK9A 4NXNK 3EE9A 2Z1GA 1TGOA 3KLHA 3CHWA 2O8EB 3V1OA 4N41A 1CXQA 1A5VA 1NK0A 3VQ8A 4J2DA 1RT6A 3HP6A 3CD6N 2R7YA 2O8BB 3QFUA 4FWRA 1IO2A 1IH7A 2WTUA 3IS9A 4ID1A 4E7KA 1TKDA 4QOZB 4X64K 3BY5A 1KAZA 5BRDA 1BISA 3NH0A 2XY5A 4BDPA 4OLBA 3UKRB 4YHHK 5HRNA 4M3XA 5HL7L 3DLLL 4RCHA 3CMAN 2HW3A 2YNHA 4GV9A 1I39A 1YTUA 3QIPA 4PUOA 5DK5A 5DMRA 3J80O 2FSJA 4FK0A 4DV1K 3ATVA 3OBYA 2QEXN 4EAHD 4CJSA 5HRSA 3L2QA 3P38A 4KB1A 4B1YB 5I3UA 4CHZA 1SKWA 1ZC6A 2E5LK 3H3OB 2ASPA 4FJ9A 5TKYA 5F2RA 3MN6A 5I9EB 3QBWA 5F1XA 4QS7A 4AQYK 1NK6A 4IFEA 1F21A 4A62A 4KHYA 2P9UB 2A40A 3LAKA 1X3NA 4DV4K 3VQEA 3C6TA 3NF8A 4CJPA 5JVHL 1REVA 3C6AA 1Q9YA 1E4GT 3AO3A 2AJQA 4B1WB 3AVCA 5ADXH 1VSKA 3VTHA 3U3YA 3NVMA 2FBVA 4F2SA 1G99A 1GLEG 1I94K 4GKJK 1YT3A 5C24A 2VG6A 1KRPA 1A5WA 4DSLA 3MX5A 1QTMA 3KK7A 4DV3K 3HOTA 2XY6A 3TTDA 1LW2A 2O8DB 2D0CA 2F9WA 3TSUA 2HVHA 4M3RA 1S1VA 3ZT4A 3TI0A 3QNNA 1HYSA 2W6LA 2Y1JA 1C0FA 1U2VA 4C8KA 3O9QA 3CF5L 4H5VA 5AZIB 2A6AA 1D5AA 3NDKA 5B8HA 4CD3A 3P4IA 1BGXT 1E3MA 3VGLA 5BPMA 1KFSA 4CHNA 3HPGA 4CESA 2RF2A 4DR1K 5AQZA 2P9IB 4Z4GA 4NXMK 4E19A 4FJLA 3ZETB 3ZT3A 4CJFA 4DTMA 4ISFA 2V52B 3VQCA 3MDQA 5M1FA 1X9JA 3RMDA 4IDKA 2CGJA 1C6VA 3MX2A 1MWMA 1B92A 2I5JA 3TAEA 3HI0A 3L6QA 4N56A 3SUOA 4GV6A 5IT9O 1NGAA 4FW2A 4FVMA 1RT2A 3EKSA 3MCPA 5ELZA 4LSLA 4B8CA 1SL2A 3MWTA 2E8AA 1VQON 3A5MC 4CEFA 3RRHA 1N6QA 2HMIA 5BRFA 3U9DA 4Z4HA 4DU1A 1XNQK 1FXXA 2ASMA 3CG7A 1OH8A 1YXQA 3CC4N 5J1EA 5KPZA 1VQ4N 4B3TK 1U04A 3OYGA 3V9WA 4DR7K 3SUNA 1TK8A 1FKOA 2UXDK 1S1WA 4IFYA 1J6ZA 3AA5X 2Z1IA 4EZ6A 3U4LA 3SV4A 3M3ZA 1JLCA 2YI1A 4AHUA 3RSEB 3ENBA 4BRLA 4LH5A 1WN7A 1MWKA 1UOCA 4CF1A 4H8KA 4WF9L 3O1WA 3TPQA 1U45A 4BE0A 4BDZA 1U47A 4B1UB 2OCEA 3TAMA 5I42A 1YAGA 2HBLA 3EN9A 2FC0A 4NYNA 2A5XA 3AVLA 4LF9K 3TU5A 5J2PA 1OH5A 4IG0A 1WBBA 5GIOA 3VQPA 3B6OA 4IG3A 3EO3A 3I55N 2QWNA 1VRTA 3DXKB 3GG4A 2VG7A 1L3SA 3OYIA 1JXEA 1VQ9N 5FLXO 3QETA 4KRFA 1BL3A 3CQYA 3DOKA 3VF2A 1RTDA 1KVCA 3L4IA 3CCMN 2JWKA 3L8BA 3CPWM 3MEEA 4KTZA 4DFMA 4KREA 3T1AA 2W41A 3SAHA 3PLAA 4DLEA 5AQLA 4IZ9A 3SBTA 5AFUH 1BA0A 4CZKA 4PWDA 1RBRA 1J9AA 1BA1A 3C6UA 1RCHA 1LWCA 5BPLA 4CZFA 3ZX2A 2BTFA 3FR0A 3THXA 1S72N 3TANA 3P39A 4JHDA 3DRSA 5FDLA 3QINA 5K14A 4KI4A 1HKGA 1IKVA 3BDPA 3M8SA 3SQ2A 3ALYA 4DWIA 4FCYA 4PKIA 2E88A
chains in the Genus database with same CATH topology
1BIUA 4FW1A 3VQ6A 3S3NA 1NKBA 1IKWA 1NK9A 3OVNA 4CJKA 1WAJA 1GOCA 5KI6A 1DTTA 2F96A 4Z4FA 3VQ4A 4DTJA 4CEDA 1W0HA 3ISNC 4CERA 4FK2A 3OYHA 4DS5A 2B5JA 3OYNA 3KTQA 4O0IA 4NCBA 1JLBA 4O0JA 2Y1IA 4FYDA 4DMNA 3MEGA 1Q8IA 3K5OA 4FJIA 1QHTA 1EKEA 4NYFA 1DLOA 3ASMA 4CEBA 4Z4EA 1B9DA 3OS2A 2OPSA 4HTUA 3AVIA 1HRHA 3S9HA 4C8LA 4FZYA 1C0TA 4CJRA 2PYLA 2HHUA 1S1TA 2D5RA 3CM6A 3OJUA 3HP9A 3NCIA 1S5JA 1RT5A 1A5XA 1FKPA 3KKRA 3DI6A 3ZSWA 3OS1A 3ZSYA 3ZSVA 4CHOA 4HHTA 2DY4A 3ITHA 4FLZA 1UA1A 4KHSA 4B9LA 1RTHA 2RN2A 4AHRA 4F3OA 2VWJA 1CLQA 3M8PA 4AILC 1TL3A 1NK7A 4JS4A 4CJ3A 3NFAA 2A1RA 5HP1A 1QSYA 1LWEA 1S6QA 4FLXA 3QEXA 3SUQA 1T05A 5KRSA 4OKKA 1J5OA 3TARA 2PY5A 1ZBIA 3PO4A 1C1AA 4FZXC 4F2RA 3ZT0A 1R0AA 1CZBA 3CFOA 3I8DA 1X9MA 1TKXA 2E6MA 3RR8A 4CCHA 2EHGA 3O3FA 1RTIA 2DFFA 4FLYA 3QESA 3K5NA 3NF7A 2KZMA 1KTQA 3LP0A 4B9VA 1X9WA 4RW7A 4BE1A 3AVHA 1I3AA 3WNGA 2YKNA 1RDBA 4FZZA 3PO5A 4FJJA 2X6NA 3VQQA 2ITGA 4B08A 1D9FA 1XI1A 2OZSA 2HHSA 1HQEA 1CZ9A 4CGGA 2ETJA 1SL1A 1MU2A 2O4GA 4CGFA 1RTJA 3NBPA 4CFAA 3NH2A 3NHGA 4HCBA 1ZBHA 1S1UA 5JS2A 1RT7A 4Z4IA 4DTUA 2F8TA 1RT1A 1FK9A 2B6AA 3KLIA 3ZT1A 4W5RA 3WNEA 5KRTA 1Z25A 4FLWA 4DTSA 1VSFA 2W42A 3LALA 3V4IA 5FROA 3HPOA 1RBVA 3FFIA 1EP4A 1C0MA 1RT3A 4ZHRA 1KLNA 4FJ7A 3G0ZA 3MXJA 5E41A 3RR7A 4B9UA 3PX0A 4FJHA 1GOBA 2HNZA 3D45A 1S6PA 4FM2A 4Z4CA 4M3WA 4OPKA 1K6YA 3PUFA 2HNYA 4CK1A 4E1MA 4KI6A 2QKKA 1KFDA 4BWJA 4IKFA 3LPUA 4CHYA 1IG9A 3HXMA 1RBUA 3K5MA 5EU7A 1NK5A 4YNQA 4CJVA 1VK0A 1VSDA 5KGWA 1D8YA 1HMVA 4RW6A 2IC3A 4CF2A 1WNSA 3OYCA 3G10A 3QEPA 4GW6A 4OVLA 4IBNA 1NK4A 3L3UA 3AVMA 4DQRA 3TAGA 2JGUA 4B9TA 2KFNA 3RWUA 4LD0A 4N5SA 3SQ1A 3L3VA 4E7LA 4JS5A 3MXMA 1KSPA 4RG8A 3VQ7A 4CIGA 1ITGA 4CIEA 3NF6A 3CFPA 1L3UA 2HB5A 2ZQBA 4DFKA 4M3TA 3SQ0A 3KK1A 4FLVA 3HL8A 1SKRA 1VSMA 4CJUA 3QO9A 4ZTJA 1T8EA 4B8AB 3KJVA 1BIZA 5CYMA 2Z1JA 1KVAA 1WSIA 4IFVA 2HHQA 3HVTA 4MQ3A 3DLRA 2XHBA 1HYZA 4DSJA 3F73A 2KZZA 1JLAA 3TABA 4F4KA 4DSEA 4B9SA 3CM5A 4DLGA 4AHTA 3V9XA 4LSNA 3VQ9A 3V81A 3L2RA 4I9LA 4CK3A 1L5UA 3O4NA 4ID5A 2YV0X 4WE1A 1L3TA 5CZ1A 4J2EA 4DSIA 3SUPA 3NE6A 1TK0A 2X74A 3RRGA 4B9NA 4M3UA 5J2NA 1QSSA 4FLTA 4FK4A 4E3SA 4KHNA 1ZBUA 1TV6A 1YTAA 1X9SA 1EETA 4Y1CA 4L8RB 4N76A 4EP4A 2YHBA 5CZ2A 3VQBA 1WSGA 2OPRA 4FJKA 4KAZA 1TVRA 3CFRA 4CGJA 4OKJA 3KK2A 4O4GA 4CFCA 4CE9A 4OJRA 1BHLA 1L3VA 4O44A 3OYAA 3LZJA 4FM1A 1ASVA 4Q0BA 2OYQA 2IGIA 2O4IA 3LP2A 2Z1GA 4DFPA 3E01A 2OPPA 1HNIA 1TGOA 3KLHA 4E7HA 3TAQA 1DTQA 4EZ9A 1GOAA 1RILA 3V1OA 1KLMA 4BDYA 3HVRA 3UIQA 3HO1A 3T3FA 3OYMA 4N41A 3DLKA 1CXQA 1A5VA 4DTPA 1NK0A 3VQ8A 4J2DA 1RT6A 4CJQA 4I7FA 3AVNA 4CF8A 1HNVA 3HP6A 3ZSZA 4ZTFA 1WLJA 1SL0A 1HYVA 3ZCMA 3D0PA 3H08A 2R7YA 3WNHA 3PY8A 2XY8A 4KHUA 3SJJA 4H4MA 1IO2A 1IH7A 2P1JA 4CGIA 3RMCA 4W5OA 4FJMA 3IS9A 4ID1A 4E7KA 1UA0A 2WOMA 4FJNA 1U49A 1TKDA 4QOZB 1LV5A 1VRUA 1SKSA 3DRPA 4PA1A 4DS4A 1XC9A 2PZSA 4KHQA 1VSEA 1BISA 4CHQA 3NH0A 3CQ8A 2XY5A 4JLHA 4BDPA 4KTWA 3OYJA 3VA0A 4OLBA 5HRNA 4DU4A 4M3XA 4HVJA 3BGRA 3I0SA 2G8FA 5CY4A 4C8NA 2BE2A 4FLUA 4CJTA 2HW3A 1S9GA 1C1BA 2ZD1A 2YNHA 4DFJA 1I39A 4DQPA 1YTUA 3QIPA 3KLEA 4PUOA 1RDDA 2GUIA 5DK5A 5DMRA 4FK0A 1NJZA 1QS4A 4CJSA 2OA8A 3AO1A 5HRSA 3L2QA 2HHXA 2DTUA 4KB1A 4CEZA 1TAUA 5I3UA 1ZBFA 1TKTA 1JLEA 5T7BA 4CHZA 1C0UA 3P83D 4CEQA 1SKWA 3AA3A 1BQMA 3K5LA 2P51A 4KV8A 5CYQA 2XO7A 4FJ9A 3VQDA 1JXBA 2FBYA 3SCXA 2DFHA 4HCCA 3L2VA 4E7JA 1NJXA 1KCFA 1VSJA 2EX3A 4CJLA 3CYMA 2KW4A 1ZYQA 3ZT2A 1TL1A 4FJ8A 1NK6A 2KTQA 1T7PA 1F21A 1RBTA 3DLEA 4KKOA 2XY7A 1NOYA 4ICLA 2IAJA 4KHYA 1Q9XA 4OPJA 4QCLA 3LAKA 4DTXA 3DM2A 4KPYA 3VQEA 3C6TA 3NF8A 4CGDA 3L2WA 3NGYA 4CJPA 3EYZA 3K2PA 1REVA 2YNIA 4W5QA 1Q9YA 3NAEA 3AO3A 2AJQA 4KFBA 1BI4B 3QLHA 4CEOA 3V1RA 3OYFA 3AVCA 1C1CA 3QIOA 2OPQA 4CJ4A 1VSKA 4CFBA 1D9DA 4J2AA 3AVJA 1WSJA 3IG1A 3U3YA 4DSKA 2FBVA 3RMBA 3SPYA 4F2SA 3KLFA 3KIOA 2RKIA 1TAQA 3AO2A 1YT3A 2YKMA 5C24A 1IKYA 1WSHA 2VG6A 1KRPA 1A5WA 2E6LA 4DSLA 3AO5A 3LDSA 4AHVA 3ULDA 3S3OA 1QTMA 4Z0UA 3K57A 3C94A 1BCMA 3PX6A 1RDCA 2XY6A 5HBMA 1JKHA 1LW2A 3NGZA 2GBZA 4BWMA 2D0CA 2IS3A 5JS1A 4ELUA 3B6PA 3LPTA 3SQ4A 1UWBA 1NK8A 4E89A 2HVHA 4M3RA 3VQ5A 1S1VA 3ZT4A 3KK3A 3AA2A 3QNNA 3TI0A 1UAXA 3DLHA 1HYSA 4HUGA 1XWLA 3ZSRA 2G8WA 4FJXA 1X1PA 2FBXA 2Y1JA 2YHAA 2G8KA 4E1NA 1VSIA 4F8RA 1Y97A 3PV8A 4C8KA 4DTNA 4K8XA 3AVKA 3V9SA 2KQ2A 1W9HA 3OYDA 1LAVA 4ELVA 1D5AA 3NDKA 2A1SA 3V9UA 4KO0A 2X6SA 3K58A 4CJWA 3U6FA 1WSFA 4OLAA 1G15A 1BGXT 5HROA 3V6DA 2HNDA 1NKCA 3IRXA 1KFSA 4CHNA 3HPGA 1IKXA 4BE2A 1HQUA 4CESA 4O5BA 4G1QA 3OYBA 4FJGA 5J2QA 3JSMA 3DLGA 2RF2A 4DQSA 1BI4A 3LP1A 4I2QA 1NOZA 4H4OA 4CF0A 3VA3A 3VQAA 5C25A 4KHWA 3AVFA 4CK2A 1TKZA 4Z4GA 1ASWA 3HK2A 3RTVA 2XRIA 3SNNA 3KKSA 1S9EA 4CIFA 3F9KA 3OYLA 4E19A 5HRPA 3DMJA 3ZT3A 4FJLA 3DOLA 4CJFA 4N47A 2HHTA 3VN5A 2B4JA 3ZSQA 2VWKA 1O1WA 3OYEA 3LZIA 4E7IA 1EXQA 4AHCA 4DTMA 3TAFA 3MEDA 3VQCA 3RMDA 3M8RA 4IDKA 1TK5A 1C6VA 2G8HA 3AVBA 4PY5A 1BQNA 1T03A 3TR8A 3P1GA 1JL2A 1B92A 5SZTA 1JL1A 2I5JA 4M41A 5KGXA 4RW4A 3TAEA 1N5YA 2HVIA 4N56A 4DTRA 4HUFA 3AVGA 3SUOA 2FBTA 3KD5E 4FVMA 4FW2A 2Q3SA 1RBSA 4HUEA 3V9ZA 1RT2A 4CJ5A 2YNGA 1VSLA 4TSXA 4W5NA 4DSFA 1ASUA 4LSLA 4I2PA 1HPZA 1RNHA 4B8CA 4UQGA 3QERA 1SL2A 1LWFA 2ZE2A 3OS0A 3L2UA 4OKEA 3TAPA 3HPHA 4M3ZA 3TWHA 1WAFA 4CEFA 3RRHA 1JLGA 5D3GA 1N6QA 2HMIA 4NCGA 5J2MA 3A2FA 4CF9A 4Z4HA 4DU1A 4M3YA 1FXXA 3HSTB 4NCAA 4FM0A 2DFEA 3CG7A 4MFBA 5KTQA 4Q5VA 1NJYA 2P5OA 2F8SA 1XHZA 3HJFA 4CHPA 2QKBA 5FRNA 1VSHA 1KVBA 5J1EA 1U04A 1EX4A 3DLBA 3OYGA 1WSEA 3EY1A 3V9WA 4W5TA 3SUNA 1TK8A 5FRMA 2Z1HA 1SUQA 3KD1E 1FKOA 1S1WA 2IOCA 4IFYA 3KLGA 4XIUA 3AA5X 2Z1IA 4YFUA 4EZ6A 3SV4A 4OGCA 2P5GA 2G8IA 1JLCA 3O3HA 3AVAA 4AHUA 3HT3A 3SI6A 4LH5A 1WN7A 3OY9A 4DG1A 1UOCA 2QXFA 2VG5A 2X78A 4AHSA 4CF1A 4H8KA 1Z26A 4BE0A 4BDZA 1U45A 1U47A 4FJ5A 3O4QA 4F3TA 3EZ5A 4JRPA 1CXUA 3TAMA 4DF8A 5I42A 4DU3A 1J54A 3THVA 3SV3A 2ATQA 4OGEA 3MAQA 1SV5A 2FC0A 2BANA 4NYNA 2D0BA 3HM9A 4M42A 3AVLA 3AO4A 4E0DA 2WONA 4Y1DA 4M45A 5J2PA 3HYFA 4IG0A 4DQQA 2HHVA 4QAGA 3LAMA 5HRRA 4JRQA 3VQPA 3B6OA 4GVMA 4CFDA 3JYTA 4IG3A 4C8OA 4K8ZA 3LWMA 4KTQA 4LH4A 3SYZA 3QEVA 1S1XA 2PYJA 1VRTA 1XHXA 2RPIA 3M8QA 2E4LA 3NGIA 2VG7A 1L3SA 2D0AA 3I0RA 3SPZA 3OYIA 3P5JA 3WNFA 3QNOA 1JXEA 3QEWA 2NUBA 4CEEA 3QETA 3ZSOA 2JLEA 1QSLA 4DQIA 4KRFA 3NF9A 1BL3A 3DOKA 1RT4A 3PX4A 1RTDA 1KVCA 3DYAA 3MXIA 5HLFA 3L8BA 4O55A 1YVUA 1RDAA 3U3GA 3SZ2A 4R5PA 2OZMA 2G8VA 4CEAA 3MEEA 4KTZA 1BCOA 2GV9A 3V1QA 3ZSXA 3RMAA 4FXDA 4DFMA 2LSNA 4KREA 4AH9A 3T1AA 5SWMA 3O3GA 1NKEA 3NH1A 4DLEA 4I9QA 4EP5A 4LY7A 4GMJB 3OJSA 2BDPA 3IAYA 4CGHA 4BACA 3DRRA 3LANA 4PWDA 1LAWA 1LW0A 1U48A 1QE1A 1RBRA 4DTOA 1J9AA 3OYKA 1B9FA 1HJRA 3C6UA 4DF4A 1RCHA 4RW8A 1LWCA 2HHWA 3S3MA 5C42A 4KB0A 3LP3A 3QEIA 2G8UA 3C95A 3TANA 1JLQA 4C8MA 4B9MA 3LWLA 1NJWA 3T19A 4CECA 3DRSA 1ZBLA 2BGGA 5FDLA 4B3OA 3QINA 5K14A 1JLFA 2YNFA 4ELTA 4KI4A 4CJEA 1J53A 1IKVA 1QQCA 3BDPA 2KFZA 1U4BA 2QK9A 3AA4A 2IDOA 3M8SA 3SQ2A 3MECA 3ALYA 4DWIA 3K59A 4RW9A 4FCYA 4J2BA 3AV9A 4PQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIU A;  4FW1 A;  3VQ6 A;  3S3N A;  1NKB A;  1IKW A;  1NK9 A;  3OVN A;  4CJK A;  1WAJ A;  1GOC A;  5KI6 A;  1DTT A;  2F96 A;  4Z4F A;  3VQ4 A;  4DTJ A;  4CED A;  1W0H A;  3ISN C;  4CER A;  4FK2 A;  3OYH A;  4DS5 A;  2B5J A;  3OYN A;  3KTQ A;  4O0I A;  4NCB A;  1JLB A;  4O0J A;  2Y1I A;  4FYD A;  4DMN A;  3MEG A;  1Q8I A;  3K5O A;  4FJI A;  1QHT A;  1EKE A;  4NYF A;  1DLO A;  3ASM A;  4CEB A;  4Z4E A;  1B9D A;  3OS2 A;  2OPS A;  4HTU A;  3AVI A;  1HRH A;  3S9H A;  4C8L A;  4FZY A;  1C0T A;  4CJR A;  2PYL A;  2HHU A;  1S1T A;  2D5R A;  3CM6 A;  3OJU A;  3HP9 A;  3NCI A;  1S5J A;  1RT5 A;  1A5X A;  1FKP A;  3KKR A;  3DI6 A;  3ZSW A;  3OS1 A;  3ZSY A;  3ZSV A;  4CHO A;  4HHT A;  2DY4 A;  3ITH A;  4FLZ A;  1UA1 A;  4KHS A;  4B9L A;  1RTH A;  2RN2 A;  4AHR A;  4F3O A;  2VWJ A;  1CLQ A;  3M8P A;  4AIL C;  1TL3 A;  1NK7 A;  4JS4 A;  4CJ3 A;  3NFA A;  2A1R A;  5HP1 A;  1QSY A;  1LWE A;  1S6Q A;  4FLX A;  3QEX A;  3SUQ A;  1T05 A;  5KRS A;  4OKK A;  1J5O A;  3TAR A;  2PY5 A;  1ZBI A;  3PO4 A;  1C1A A;  4FZX C;  4F2R A;  3ZT0 A;  1R0A A;  1CZB A;  3CFO A;  3I8D A;  1X9M A;  1TKX A;  2E6M A;  3RR8 A;  4CCH A;  2EHG A;  3O3F A;  1RTI A;  2DFF A;  4FLY A;  3QES A;  3K5N A;  3NF7 A;  2KZM A;  1KTQ A;  3LP0 A;  4B9V A;  1X9W A;  4RW7 A;  4BE1 A;  3AVH A;  1I3A A;  3WNG A;  2YKN A;  1RDB A;  4FZZ A;  3PO5 A;  4FJJ A;  2X6N A;  3VQQ A;  2ITG A;  4B08 A;  1D9F A;  1XI1 A;  2OZS A;  2HHS A;  1HQE A;  1CZ9 A;  4CGG A;  2ETJ A;  1SL1 A;  1MU2 A;  2O4G A;  4CGF A;  1RTJ A;  3NBP A;  4CFA A;  3NH2 A;  3NHG A;  4HCB A;  1ZBH A;  1S1U A;  5JS2 A;  1RT7 A;  4Z4I A;  4DTU A;  2F8T A;  1RT1 A;  1FK9 A;  2B6A A;  3KLI A;  3ZT1 A;  4W5R A;  3WNE A;  5KRT A;  1Z25 A;  4FLW A;  4DTS A;  1VSF A;  2W42 A;  3LAL A;  3V4I A;  5FRO A;  3HPO A;  1RBV A;  3FFI A;  1EP4 A;  1C0M A;  1RT3 A;  4ZHR A;  1KLN A;  4FJ7 A;  3G0Z A;  3MXJ A;  5E41 A;  3RR7 A;  4B9U A;  3PX0 A;  4FJH A;  1GOB A;  2HNZ A;  3D45 A;  1S6P A;  4FM2 A;  4Z4C A;  4M3W A;  4OPK A;  1K6Y A;  3PUF A;  2HNY A;  4CK1 A;  4E1M A;  4KI6 A;  2QKK A;  1KFD A;  4BWJ A;  4IKF A;  3LPU A;  4CHY A;  1IG9 A;  3HXM A;  1RBU A;  3K5M A;  5EU7 A;  1NK5 A;  4YNQ A;  4CJV A;  1VK0 A;  1VSD A;  5KGW A;  1D8Y A;  1HMV A;  4RW6 A;  2IC3 A;  4CF2 A;  1WNS A;  3OYC A;  3G10 A;  3QEP A;  4GW6 A;  4OVL A;  4IBN A;  1NK4 A;  3L3U A;  3AVM A;  4DQR A;  3TAG A;  2JGU A;  4B9T A;  2KFN A;  3RWU A;  4LD0 A;  4N5S A;  3SQ1 A;  3L3V A;  4E7L A;  4JS5 A;  3MXM A;  1KSP A;  4RG8 A;  3VQ7 A;  4CIG A;  1ITG A;  4CIE A;  3NF6 A;  3CFP A;  1L3U A;  2HB5 A;  2ZQB A;  4DFK A;  4M3T A;  3SQ0 A;  3KK1 A;  4FLV A;  3HL8 A;  1SKR A;  1VSM A;  4CJU A;  3QO9 A;  4ZTJ A;  1T8E A;  4B8A B;  3KJV A;  1BIZ A;  5CYM A;  2Z1J A;  1KVA A;  1WSI A;  4IFV A;  2HHQ A;  3HVT A;  4MQ3 A;  3DLR A;  2XHB A;  1HYZ A;  4DSJ A;  3F73 A;  2KZZ A;  1JLA A;  3TAB A;  4F4K A;  4DSE A;  4B9S A;  3CM5 A;  4DLG A;  4AHT A;  3V9X A;  4LSN A;  3VQ9 A;  3V81 A;  3L2R A;  4I9L A;  4CK3 A;  1L5U A;  3O4N A;  4ID5 A;  2YV0 X;  4WE1 A;  1L3T A;  5CZ1 A;  4J2E A;  4DSI A;  3SUP A;  3NE6 A;  1TK0 A;  2X74 A;  3RRG A;  4B9N A;  4M3U A;  5J2N A;  1QSS A;  4FLT A;  4FK4 A;  4E3S A;  4KHN A;  1ZBU A;  1TV6 A;  1YTA A;  1X9S A;  1EET A;  4Y1C A;  4L8R B;  4N76 A;  4EP4 A;  2YHB A;  5CZ2 A;  3VQB A;  1WSG A;  2OPR A;  4FJK A;  4KAZ A;  1TVR A;  3CFR A;  4CGJ A;  4OKJ A;  3KK2 A;  4O4G A;  4CFC A;  4CE9 A;  4OJR A;  1BHL A;  1L3V A;  4O44 A;  3OYA A;  3LZJ A;  4FM1 A;  1ASV A;  4Q0B A;  2OYQ A;  2IGI A;  2O4I A;  3LP2 A;  2Z1G A;  4DFP A;  3E01 A;  2OPP A;  1HNI A;  1TGO A;  3KLH A;  4E7H A;  3TAQ A;  1DTQ A;  4EZ9 A;  1GOA A;  1RIL A;  3V1O A;  1KLM A;  4BDY A;  3HVR A;  3UIQ A;  3HO1 A;  3T3F A;  3OYM A;  4N41 A;  3DLK A;  1CXQ A;  1A5V A;  4DTP A;  1NK0 A;  3VQ8 A;  4J2D A;  1RT6 A;  4CJQ A;  4I7F A;  3AVN A;  4CF8 A;  1HNV A;  3HP6 A;  3ZSZ A;  4ZTF A;  1WLJ A;  1SL0 A;  1HYV A;  3ZCM A;  3D0P A;  3H08 A;  2R7Y A;  3WNH A;  3PY8 A;  2XY8 A;  4KHU A;  3SJJ A;  4H4M A;  1IO2 A;  1IH7 A;  2P1J A;  4CGI A;  3RMC A;  4W5O A;  4FJM A;  3IS9 A;  4ID1 A;  4E7K A;  1UA0 A;  2WOM A;  4FJN A;  1U49 A;  1TKD A;  4QOZ B;  1LV5 A;  1VRU A;  1SKS A;  3DRP A;  4PA1 A;  4DS4 A;  1XC9 A;  2PZS A;  4KHQ A;  1VSE A;  1BIS A;  4CHQ A;  3NH0 A;  3CQ8 A;  2XY5 A;  4JLH A;  4BDP A;  4KTW A;  3OYJ A;  3VA0 A;  4OLB A;  5HRN A;  4DU4 A;  4M3X A;  4HVJ A;  3BGR A;  3I0S A;  2G8F A;  5CY4 A;  4C8N A;  2BE2 A;  4FLU A;  4CJT A;  2HW3 A;  1S9G A;  1C1B A;  2ZD1 A;  2YNH A;  4DFJ A;  1I39 A;  4DQP A;  1YTU A;  3QIP A;  3KLE A;  4PUO A;  1RDD A;  2GUI A;  5DK5 A;  5DMR A;  4FK0 A;  1NJZ A;  1QS4 A;  4CJS A;  2OA8 A;  3AO1 A;  5HRS A;  3L2Q A;  2HHX A;  2DTU A;  4KB1 A;  4CEZ A;  1TAU A;  5I3U A;  1ZBF A;  1TKT A;  1JLE A;  5T7B A;  4CHZ A;  1C0U A;  3P83 D;  4CEQ A;  1SKW A;  3AA3 A;  1BQM A;  3K5L A;  2P51 A;  4KV8 A;  5CYQ A;  2XO7 A;  4FJ9 A;  3VQD A;  1JXB A;  2FBY A;  3SCX A;  2DFH A;  4HCC A;  3L2V A;  4E7J A;  1NJX A;  1KCF A;  1VSJ A;  2EX3 A;  4CJL A;  3CYM A;  2KW4 A;  1ZYQ A;  3ZT2 A;  1TL1 A;  4FJ8 A;  1NK6 A;  2KTQ A;  1T7P A;  1F21 A;  1RBT A;  3DLE A;  4KKO A;  2XY7 A;  1NOY A;  4ICL A;  2IAJ A;  4KHY A;  1Q9X A;  4OPJ A;  4QCL A;  3LAK A;  4DTX A;  3DM2 A;  4KPY A;  3VQE A;  3C6T A;  3NF8 A;  4CGD A;  3L2W A;  3NGY A;  4CJP A;  3EYZ A;  3K2P A;  1REV A;  2YNI A;  4W5Q A;  1Q9Y A;  3NAE A;  3AO3 A;  2AJQ A;  4KFB A;  1BI4 B;  3QLH A;  4CEO A;  3V1R A;  3OYF A;  3AVC A;  1C1C A;  3QIO A;  2OPQ A;  4CJ4 A;  1VSK A;  4CFB A;  1D9D A;  4J2A A;  3AVJ A;  1WSJ A;  3IG1 A;  3U3Y A;  4DSK A;  2FBV A;  3RMB A;  3SPY A;  4F2S A;  3KLF A;  3KIO A;  2RKI A;  1TAQ A;  3AO2 A;  1YT3 A;  2YKM A;  5C24 A;  1IKY A;  1WSH A;  2VG6 A;  1KRP A;  1A5W A;  2E6L A;  4DSL A;  3AO5 A;  3LDS A;  4AHV A;  3ULD A;  3S3O A;  1QTM A;  4Z0U A;  3K57 A;  3C94 A;  1BCM A;  3PX6 A;  1RDC A;  2XY6 A;  5HBM A;  1JKH A;  1LW2 A;  3NGZ A;  2GBZ A;  4BWM A;  2D0C A;  2IS3 A;  5JS1 A;  4ELU A;  3B6P A;  3LPT A;  3SQ4 A;  1UWB A;  1NK8 A;  4E89 A;  2HVH A;  4M3R A;  3VQ5 A;  1S1V A;  3ZT4 A;  3KK3 A;  3AA2 A;  3QNN A;  3TI0 A;  1UAX A;  3DLH A;  1HYS A;  4HUG A;  1XWL A;  3ZSR A;  2G8W A;  4FJX A;  1X1P A;  2FBX A;  2Y1J A;  2YHA A;  2G8K A;  4E1N A;  1VSI A;  4F8R A;  1Y97 A;  3PV8 A;  4C8K A;  4DTN A;  4K8X A;  3AVK A;  3V9S A;  2KQ2 A;  1W9H A;  3OYD A;  1LAV A;  4ELV A;  1D5A A;  3NDK A;  2A1S A;  3V9U A;  4KO0 A;  2X6S A;  3K58 A;  4CJW A;  3U6F A;  1WSF A;  4OLA A;  1G15 A;  1BGX T;  5HRO A;  3V6D A;  2HND A;  1NKC A;  3IRX A;  1KFS A;  4CHN A;  3HPG A;  1IKX A;  4BE2 A;  1HQU A;  4CES A;  4O5B A;  4G1Q A;  3OYB A;  4FJG A;  5J2Q A;  3JSM A;  3DLG A;  2RF2 A;  4DQS A;  1BI4 A;  3LP1 A;  4I2Q A;  1NOZ A;  4H4O A;  4CF0 A;  3VA3 A;  3VQA A;  5C25 A;  4KHW A;  3AVF A;  4CK2 A;  1TKZ A;  4Z4G A;  1ASW A;  3HK2 A;  3RTV A;  2XRI A;  3SNN A;  3KKS A;  1S9E A;  4CIF A;  3F9K A;  3OYL A;  4E19 A;  5HRP A;  3DMJ A;  3ZT3 A;  4FJL A;  3DOL A;  4CJF A;  4N47 A;  2HHT A;  3VN5 A;  2B4J A;  3ZSQ A;  2VWK A;  1O1W A;  3OYE A;  3LZI A;  4E7I A;  1EXQ A;  4AHC A;  4DTM A;  3TAF A;  3MED A;  3VQC A;  3RMD A;  3M8R A;  4IDK A;  1TK5 A;  1C6V A;  2G8H A;  3AVB A;  4PY5 A;  1BQN A;  1T03 A;  3TR8 A;  3P1G A;  1JL2 A;  1B92 A;  5SZT A;  1JL1 A;  2I5J A;  4M41 A;  5KGX A;  4RW4 A;  3TAE A;  1N5Y A;  2HVI A;  4N56 A;  4DTR A;  4HUF A;  3AVG A;  3SUO A;  2FBT A;  3KD5 E;  4FVM A;  4FW2 A;  2Q3S A;  1RBS A;  4HUE A;  3V9Z A;  1RT2 A;  4CJ5 A;  2YNG A;  1VSL A;  4TSX A;  4W5N A;  4DSF A;  1ASU A;  4LSL A;  4I2P A;  1HPZ A;  1RNH A;  4B8C A;  4UQG A;  3QER A;  1SL2 A;  1LWF A;  2ZE2 A;  3OS0 A;  3L2U A;  4OKE A;  3TAP A;  3HPH A;  4M3Z A;  3TWH A;  1WAF A;  4CEF A;  3RRH A;  1JLG A;  5D3G A;  1N6Q A;  2HMI A;  4NCG A;  5J2M A;  3A2F A;  4CF9 A;  4Z4H A;  4DU1 A;  4M3Y A;  1FXX A;  3HST B;  4NCA A;  4FM0 A;  2DFE A;  3CG7 A;  4MFB A;  5KTQ A;  4Q5V A;  1NJY A;  2P5O A;  2F8S A;  1XHZ A;  3HJF A;  4CHP A;  2QKB A;  5FRN A;  1VSH A;  1KVB A;  5J1E A;  1U04 A;  1EX4 A;  3DLB A;  3OYG A;  1WSE A;  3EY1 A;  3V9W A;  4W5T A;  3SUN A;  1TK8 A;  5FRM A;  2Z1H A;  1SUQ A;  3KD1 E;  1FKO A;  1S1W A;  2IOC A;  4IFY A;  3KLG A;  4XIU A;  3AA5 X;  2Z1I A;  4YFU A;  4EZ6 A;  3SV4 A;  4OGC A;  2P5G A;  2G8I A;  1JLC A;  3O3H A;  3AVA A;  4AHU A;  3HT3 A;  3SI6 A;  4LH5 A;  1WN7 A;  3OY9 A;  4DG1 A;  1UOC A;  2QXF A;  2VG5 A;  2X78 A;  4AHS A;  4CF1 A;  4H8K A;  1Z26 A;  4BE0 A;  4BDZ A;  1U45 A;  1U47 A;  4FJ5 A;  3O4Q A;  4F3T A;  3EZ5 A;  4JRP A;  1CXU A;  3TAM A;  4DF8 A;  5I42 A;  4DU3 A;  1J54 A;  3THV A;  3SV3 A;  2ATQ A;  4OGE A;  3MAQ A;  1SV5 A;  2FC0 A;  2BAN A;  4NYN A;  2D0B A;  3HM9 A;  4M42 A;  3AVL A;  3AO4 A;  4E0D A;  2WON A;  4Y1D A;  4M45 A;  5J2P A;  3HYF A;  4IG0 A;  4DQQ A;  2HHV A;  4QAG A;  3LAM A;  5HRR A;  4JRQ A;  3VQP A;  3B6O A;  4GVM A;  4CFD A;  3JYT A;  4IG3 A;  4C8O A;  4K8Z A;  3LWM A;  4KTQ A;  4LH4 A;  3SYZ A;  3QEV A;  1S1X A;  2PYJ A;  1VRT A;  1XHX A;  2RPI A;  3M8Q A;  2E4L A;  3NGI A;  2VG7 A;  1L3S A;  2D0A A;  3I0R A;  3SPZ A;  3OYI A;  3P5J A;  3WNF A;  3QNO A;  1JXE A;  3QEW A;  2NUB A;  4CEE A;  3QET A;  3ZSO A;  2JLE A;  1QSL A;  4DQI A;  4KRF A;  3NF9 A;  1BL3 A;  3DOK A;  1RT4 A;  3PX4 A;  1RTD A;  1KVC A;  3DYA A;  3MXI A;  5HLF A;  3L8B A;  4O55 A;  1YVU A;  1RDA A;  3U3G A;  3SZ2 A;  4R5P A;  2OZM A;  2G8V A;  4CEA A;  3MEE A;  4KTZ A;  1BCO A;  2GV9 A;  3V1Q A;  3ZSX A;  3RMA A;  4FXD A;  4DFM A;  2LSN A;  4KRE A;  4AH9 A;  3T1A A;  5SWM A;  3O3G A;  1NKE A;  3NH1 A;  4DLE A;  4I9Q A;  4EP5 A;  4LY7 A;  4GMJ B;  3OJS A;  2BDP A;  3IAY A;  4CGH A;  4BAC A;  3DRR A;  3LAN A;  4PWD A;  1LAW A;  1LW0 A;  1U48 A;  1QE1 A;  1RBR A;  4DTO A;  1J9A A;  3OYK A;  1B9F A;  1HJR A;  3C6U A;  4DF4 A;  1RCH A;  4RW8 A;  1LWC A;  2HHW A;  3S3M A;  5C42 A;  4KB0 A;  3LP3 A;  3QEI A;  2G8U A;  3C95 A;  3TAN A;  1JLQ A;  4C8M A;  4B9M A;  3LWL A;  1NJW A;  3T19 A;  4CEC A;  3DRS A;  1ZBL A;  2BGG A;  5FDL A;  4B3O A;  3QIN A;  5K14 A;  1JLF A;  2YNF A;  4ELT A;  4KI4 A;  4CJE A;  1J53 A;  1IKV A;  1QQC A;  3BDP A;  2KFZ A;  1U4B A;  2QK9 A;  3AA4 A;  2IDO A;  3M8S A;  3SQ2 A;  3MEC A;  3ALY A;  4DWI A;  3K59 A;  4RW9 A;  4FCY A;  4J2B A;  3AV9 A;  4PQU A; 
#chains in the Genus database with same CATH topology
 1QQO A;  4FW1 A;  1NG9 A;  2FF6 A;  4CJK A;  4K42 A;  1DTT A;  1X3M A;  2F96 A;  3VQ4 A;  4JD2 A;  1GLC G;  1ESV A;  2HMP A;  3ISN C;  4X65 K;  4Y0W A;  4O0I A;  2HBM A;  4C1N I;  4DR6 K;  4FYD A;  4ILG B;  3WXI A;  4DB3 A;  1Q8I A;  3K5O A;  4FJI A;  4EHT A;  1B9D A;  4FZY A;  1KAX A;  2HHU A;  4FJG A;  2P9S A;  3CC7 N;  1GLF O;  3ZSW A;  3DI6 A;  4CBU A;  4CHO A;  3ZX3 A;  1UA1 A;  4RWT A;  4OPH A;  2RN2 A;  2ZJR L;  1XUP O;  3M8P A;  4B3R K;  4JS4 A;  3CXC M;  1Y64 A;  2GWJ A;  3B8A X;  5AQP A;  3WEE A;  3S41 A;  3SUQ A;  2ZWH A;  3D2F A;  1T05 A;  2PY5 A;  1TYQ A;  3TAR A;  3THW B;  4F2R A;  3ZT0 A;  1CZB A;  3CFO A;  3T69 A;  3I8D A;  2E6M A;  3RR8 A;  4A59 A;  3W3D A;  1KQS M;  3A5N C;  4GY2 B;  3WNG A;  2YKN A;  1RDB A;  4GV3 A;  2X6N A;  2OZS A;  1HQE A;  1M1K O;  4M63 C;  3LDL A;  1MU2 A;  1YJN N;  2O4G A;  2BUP A;  1ZBH A;  4HCB A;  3NH2 A;  3VES A;  1S1U A;  3H6E A;  2UU9 K;  1RT1 A;  3VPZ A;  3ZT1 A;  4W5R A;  3SBG A;  2E1Z A;  1QHA A;  5FRO A;  3HPO A;  1RBV A;  3FFI A;  1C0M A;  4ZHR A;  3CCQ N;  3KZB A;  3ID8 A;  1GOB A;  3D45 A;  1S6P A;  1W2B M;  4CZI A;  3EL2 A;  4FWQ A;  3CCS N;  4CK1 A;  4E1M A;  1KFD A;  5JLF A;  4Z94 A;  3E9O A;  1VK0 A;  1VSD A;  4BVP A;  5AQH A;  2NNW A;  4CZL A;  1WNS A;  4BC2 A;  3G10 A;  5C10 A;  4OVL A;  3QEP A;  4IBN A;  1NK4 A;  3L3U A;  1VQM N;  3TAG A;  2JGU A;  4B9T A;  4PHT X;  3MXM A;  1BU6 O;  2NRR A;  2IVN A;  2HB5 A;  2ZQB A;  3FZH A;  4E1J A;  5AR0 A;  4FLV A;  1T8E A;  4CI6 A;  3KJV A;  2Z1J A;  4IFV A;  4MQ3 A;  2XHB A;  1ATR A;  1JCE A;  2QWM A;  2KZZ A;  4EIA A;  1XQS C;  4DLG A;  3V9X A;  3VQ9 A;  3L2R A;  1L5U A;  4WE1 A;  5CZ1 A;  3M6G A;  4J2E A;  4DSI A;  5J2N A;  2QM1 A;  4E3S A;  1TV6 A;  2A42 A;  3IUC A;  1N36 K;  1QQM A;  4WFN L;  1OH6 A;  4IXC A;  4KAZ A;  1TVR A;  1Z6R A;  4A5B A;  4DR5 K;  5AQI A;  4CFC A;  3T7Z A;  3CJ7 A;  3K0S A;  3CJC A;  4FO0 A;  4KH5 A;  4WCE L;  3ENH A;  1VQ6 N;  2QW9 A;  5JVG L;  2CGL A;  3DLK A;  4I7F A;  4ZTF A;  3ZSZ A;  1SL0 A;  3PY8 A;  4BRI A;  3RMC A;  4FJM A;  1UA0 A;  2WOM A;  4XH4 A;  2D4W A;  1LV5 A;  3EEQ A;  1NMD A;  4PA1 A;  1IBL K;  2PZS A;  3VA0 A;  3BZC A;  4DU4 A;  4HVJ A;  1W7A A;  1T6C A;  5F0X A;  3O8M A;  4C8N A;  1S9G A;  1C1B A;  3FLC O;  3KLE A;  5DM6 L;  3WXJ A;  3R8E A;  2OA8 A;  3AO1 A;  2DTU A;  4CEZ A;  4CZM A;  1ZBF A;  1TKT A;  3G4S N;  2YHY A;  1JLE A;  5T7B A;  3OW2 M;  4YY3 K;  4AM6 A;  3AA3 A;  1BQM A;  4FWS A;  3K5L A;  1EQY A;  5CYQ A;  3VQD A;  2FBY A;  3Q7B A;  5EX5 A;  4HCC A;  5C2F A;  1NJX A;  1KCF A;  3ZEU A;  1ZXO A;  2KW4 A;  3CYM A;  1Q81 O;  4IDH A;  3E66 A;  2PBD A;  3M1F A;  4OPJ A;  4DTX A;  3DM2 A;  3NGY A;  3EYZ A;  4BR0 A;  3THX B;  3V1R A;  4QS9 A;  3AY9 A;  5C2D A;  4CJ4 A;  3AVJ A;  1WSJ A;  3UKU A;  1VQL N;  4DSK A;  3SAG A;  5AQT A;  2GEL A;  2RKI A;  1TAQ A;  3AO2 A;  4BGB A;  4FWO A;  3LDS A;  1NGF A;  1QZ6 A;  3C94 A;  1BCM A;  1YI2 N;  3VF4 A;  5AQU A;  3NGZ A;  5M1P A;  2P9L A;  3G71 N;  4JD2 B;  3B6P A;  4EHU A;  3SQ4 A;  1DKG D;  1S3X A;  3VQ5 A;  4JI7 K;  3DLH A;  1UAX A;  1XC3 A;  1XWL A;  2G8W A;  4FJX A;  1X1P A;  5LL6 Z;  4LFB K;  1VSI A;  1Y97 A;  4BRM A;  2UUC K;  4DTN A;  3AVK A;  3V9S A;  1EWQ A;  1LAV A;  2P9S B;  4ELV A;  2A1S A;  3V9U A;  4KO0 A;  3O6W A;  2Q2R A;  4WQ4 A;  1WSF A;  3V6D A;  5AZJ A;  3C0B A;  3WEE B;  1IKX A;  3D2F B;  4O5B A;  5J2Q A;  3M5R A;  3DLG A;  1JJ2 M;  4DQS A;  1BI4 A;  3LP1 A;  3HSC A;  4I2Q A;  1NOZ A;  4H4O A;  4CF0 A;  5GAD P;  3VQA A;  4H0V B;  5EVZ A;  4CK2 A;  1ASW A;  3RTV A;  2NRW A;  1K8K A;  3KKS A;  2HST A;  3DOL A;  2HHT A;  3VN5 A;  2B4J A;  3TAF A;  3OYE A;  4E7I A;  3MED A;  3WQT A;  4KH4 A;  5BPN A;  3M8R A;  1TK5 A;  3HOS A;  4PY5 A;  3P1G A;  5KGX A;  2HVI A;  5E84 A;  3AVG A;  3QFP A;  2Q3S A;  3V9Z A;  2WUS A;  4CJ5 A;  3R9P A;  4M7Y A;  2JWL A;  4DSF A;  1TUU A;  3QER A;  2V7Z A;  4M3Z A;  3HPH A;  3VGK A;  2ZJQ L;  3AAQ A;  3P31 A;  4IO8 A;  4DUY K;  3HST B;  4NLB A;  4MFB A;  3KHY A;  5KTQ A;  4Q5V A;  2F8S A;  3HJF A;  3DXM B;  2UXB K;  2O8C A;  3TTF A;  2UUA K;  3D7E O;  3DLB A;  5FRM A;  2EWS A;  4XIU A;  4JEP A;  4YFU A;  4WQ5 A;  2P5G A;  5AQQ A;  4ILJ A;  3TSP A;  3L4Q A;  2NRH A;  2X78 A;  3QBX A;  3VEO A;  3O4Q A;  1ATN A;  2E2N A;  4DF8 A;  1J54 A;  3THV A;  3AO4 A;  2WON A;  1P90 A;  3QB0 A;  1NGE A;  5HRR A;  3T1H K;  2YX6 A;  4CZH A;  3GDQ A;  4BRH A;  3SYZ A;  1S1X A;  2Q97 A;  4BQL A;  2PYJ A;  2RPI A;  5AQV A;  3OA9 A;  2E4L A;  2D0A A;  3I0R A;  3VF6 A;  4CZE A;  1QSL A;  3ZSO A;  2JLE A;  2A3Z A;  3NF9 A;  3CCU N;  1RT4 A;  4O8U A;  3PX4 A;  1YVU A;  3SZ2 A;  4R5P A;  2OZM A;  4A5A A;  3MN5 A;  4CEA A;  2G8V A;  3UB5 A;  4IOA L;  3RMA A;  4FXD A;  2LSN A;  4DHY A;  5SWM A;  3NH1 A;  3F5T A;  2W40 A;  4EP5 A;  4LY7 A;  2BDP A;  3IAY A;  5M1O A;  3N4P A;  3EZW A;  4CGH A;  4BAC A;  4OO1 J;  3OYK A;  1JCG A;  4RW8 A;  3Q7C A;  3FZL A;  3CQX A;  5M1N A;  3S3M A;  5C42 A;  5JMV A;  4KB0 A;  3QEI A;  1FJG K;  4IWV A;  1NJW A;  3T19 A;  1Q7Y O;  4CEC A;  2BGG A;  1NNE A;  2D1K A;  2E20 A;  4ELT A;  5ADX A;  2KFZ A;  1U4B A;  4DV6 K;  4H0X B;  1FW6 A;  3MEC A;  4J2B A;  3K59 A;  4RW9 A;  3O4W A;  3AV9 A;  5BN9 A;  4PQU A;  3S3N A;  3CCJ N;  3OVN A;  4BVO A;  4Z4F A;  4DTJ A;  4ILH A;  4IOX A;  3MMV A;  3OYH A;  4DS5 A;  4FK2 A;  3OYN A;  4NCB A;  3J7Y P;  1JLB A;  1R59 O;  3ZEU B;  4YOY A;  1NGD A;  4DMN A;  3FZF A;  4I6M A;  1N33 K;  1EKE A;  1NLV A;  4CEB A;  4FVU A;  4CJR A;  3CM6 A;  3SMP A;  3HP9 A;  3NCI A;  4CZJ A;  1RT5 A;  1FKP A;  3OS1 A;  2DY4 A;  3ZSY A;  3ZSV A;  3I56 N;  5EOY A;  4FLZ A;  5AQX A;  4B9L A;  1RTH A;  1RGI A;  2NRZ A;  4AHR A;  1NGH A;  2QI2 A;  3FGU A;  1NK7 A;  3NFA A;  1QSY A;  1LWE A;  3UKU B;  5C15 A;  3ID6 A;  3KWG A;  1C1A A;  5KPT A;  4FZX C;  3GOI A;  4MO4 A;  4IO9 L;  4HWI A;  2I7P A;  4PL8 A;  4FLY A;  1K9M O;  3LP0 A;  3E9P A;  3HZ6 A;  1E4F T;  2GWK A;  3AVH A;  1I3A A;  4JI4 K;  1OKJ A;  5AQW A;  5H1S Q;  5AQN A;  3HRG A;  4B08 A;  4ISG A;  1CZ9 A;  4CGG A;  1SL1 A;  1IJJ A;  1RTJ A;  3NBP A;  3O08 A;  3QIC A;  4JKE A;  3NHG A;  4Z4I A;  4JNE A;  4LF5 K;  2QWL A;  4BRO A;  3PSF A;  1RDU A;  5KRT A;  1NBW A;  1LOT B;  3U8X A;  4DTS A;  1YJW N;  3LAL A;  4C1N K;  4JKD A;  3R6M A;  1DT9 A;  1RT3 A;  4LFC K;  1H1V A;  3MXJ A;  3IDH A;  1XMO K;  3THY A;  3PX0 A;  3C7N A;  1SS6 A;  4GNI A;  4M3W A;  1QZ5 A;  4YOR A;  3BF3 A;  3PUF A;  2QXL A;  4KI6 A;  2QKK A;  2Q0R A;  1N8R O;  2FXU A;  3LPU A;  4B1V A;  4U7B A;  3K5M A;  2Q1N A;  1NGI A;  3SAF A;  2IC3 A;  4GW6 A;  3AVM A;  4A57 A;  2KFN A;  4LD0 A;  2A41 A;  4E7L A;  4JS5 A;  4LF6 K;  1ITG A;  4JKH A;  4CIE A;  1L3U A;  3VEX A;  3ZLJ A;  4DFK A;  3HL8 A;  1SKR A;  1VSM A;  2HHQ A;  3DLR A;  3F73 A;  4F4K A;  3LL3 A;  5GAE P;  4I9L A;  3F2K A;  4O5F A;  4ISE A;  3O4N A;  4X62 K;  2YV0 X;  1L3T A;  4BRK A;  3BZK A;  3NE6 A;  3RRG A;  4B9N A;  2NRX A;  4FLT A;  1ZBU A;  5FPD A;  3G6E N;  3I8B A;  2YHB A;  5CZ2 A;  4FJK A;  2OPR A;  1KAY A;  3DWL A;  4V19 S;  1BHL A;  3CJ1 A;  3SLC A;  4O44 A;  3LZJ A;  4Q0B A;  1ASV A;  4FOI A;  2IVP A;  2IGI A;  4BR7 A;  2O4I A;  4DFP A;  1M90 O;  1HNI A;  1VQ7 N;  4E7H A;  1VHX A;  4EZ9 A;  1GOA A;  1KLM A;  3AAR A;  3H45 C;  3UIQ A;  3T3F A;  2NLX A;  1YF5 L;  4JI1 K;  4DTP A;  4H0O A;  5KQD A;  3AVN A;  3DJC A;  4CF8 A;  2H3G X;  1HYV A;  1CZA N;  3A0I X;  2D0P A;  3H08 A;  4KHU A;  3WNH A;  3LDN A;  3D6R A;  5AQG A;  3SJJ A;  2P1J A;  4CGI A;  3VGM A;  3ATU A;  5AFU A;  4BC3 A;  1VRU A;  3DRP A;  1XC9 A;  1D4X A;  4K43 A;  4KHQ A;  2P9K A;  1NU0 A;  1IV0 A;  3CQ8 A;  3OYJ A;  3VTI A;  3BGR A;  3CCL N;  2G8F A;  4CJT A;  4DQP A;  3VMF B;  2ZD1 A;  1RDD A;  1NJZ A;  1QS4 A;  1HKB A;  4AM7 A;  1YJ9 N;  3H1V X;  1TAU A;  4BRA A;  1C0U A;  3P83 D;  4CEQ A;  1VQ5 N;  2P51 A;  2XO7 A;  1U2V B;  4JKG A;  2DFH A;  3L2V A;  4E7J A;  1YUW A;  2F9T A;  1HR0 K;  2O8E A;  1NOY A;  1RBT A;  2RHK A;  4DR3 K;  4ICL A;  1Q9X A;  3OTO K;  4KPY A;  4CGD A;  2HHH K;  3NAE A;  1GLA G;  2O8B A;  1W97 L;  3OYF A;  3J8A A;  1C1C A;  4J2A A;  4PKH A;  1VQN N;  4R79 A;  4JI5 K;  3KIO A;  5AQO A;  3OHR A;  2YKM A;  1WSH A;  2E6L A;  4AHV A;  4Z0U A;  2E2O A;  3PX6 A;  2E2P A;  4JI2 K;  4JN4 A;  2KKZ A;  2GBZ A;  4BWM A;  2IS3 A;  4ELU A;  4H5T A;  1NK8 A;  2ZGY A;  5TKW A;  3KK3 A;  3AA2 A;  4YDU C;  4HUG A;  1QVG M;  5KQ8 A;  3UE5 A;  4E1N A;  4DV7 K;  5BRH A;  4K8X A;  5DM7 L;  2KQ2 A;  1W9H A;  3OYD A;  3K58 A;  1C0G A;  3U6F A;  1EO1 A;  5HRO A;  2P9U A;  2HND A;  1NKC A;  3IRX A;  1ATS A;  1RDW X;  4FWL A;  4BC5 A;  1WOQ A;  3VEN A;  3IKM A;  3HBT A;  4KHW A;  3AVF A;  3HK2 A;  2ASO A;  2XRI A;  3SNN A;  3F9K A;  3OYL A;  3DMJ A;  4MO5 A;  1J5E K;  2Q0U A;  3WXL A;  3ZSQ A;  2VWK A;  4JI8 K;  5MLC Q;  1BWF O;  3LZI A;  1EXQ A;  4AHC A;  3D2E A;  1QQN A;  5CE3 A;  2G8H A;  3AVB A;  5FPN A;  4M41 A;  4DR4 K;  2D0O A;  2UUB K;  1YIJ N;  2FBT A;  2PFU A;  1XNR K;  1RBS A;  1SQK A;  5LJW A;  2YNG A;  4I2P A;  1HPZ A;  3CJ9 A;  4CVN E;  2UXC K;  1LWF A;  3EE8 A;  3OS0 A;  3L2U A;  4FWM A;  3TAP A;  1WBD A;  3TWH A;  1WAF A;  1JLG A;  5AZI A;  5J2M A;  3A2F A;  2QWR A;  4GVE A;  5BR9 A;  1NGC A;  1GLJ O;  3CI5 A;  3THY B;  4FM0 A;  4NCA A;  3C7N B;  5AQS A;  2FSK A;  2P5O A;  4DR2 K;  2QKB A;  5FRN A;  1EX4 A;  1WSE A;  3EY1 A;  1SUQ A;  1KC8 O;  3KD1 E;  4BR9 A;  2G8I A;  3O3H A;  2FSN A;  3HT3 A;  3SI6 A;  5AQF A;  4DG1 A;  2VG5 A;  4AHS A;  3E9L A;  5HOO A;  4BRE A;  3J81 O;  3ZET A;  4JKF A;  1Z26 A;  3EZ5 A;  1OH7 A;  4JRP A;  1CXU A;  2ATQ A;  3HTV A;  4OGE A;  3MAQ A;  1SV5 A;  2D0B A;  3HM9 A;  4M42 A;  4E0D A;  4JHD B;  4Y1D A;  3HYF A;  3ZYY X;  2HHV A;  4QAG A;  3LAM A;  5LY3 A;  4JRQ A;  1LCU A;  1HNZ K;  4C8O A;  4K8Z A;  3LWM A;  4KTQ A;  1NM1 A;  3EKU A;  3GE1 A;  2GTD A;  4DCH A;  3SPZ A;  3P5J A;  3QEW A;  3J7Z O;  5BRE A;  1HJO A;  4JI0 K;  3A8Y A;  4CD1 A;  3MXI A;  4JK8 A;  4H5W A;  4O55 A;  3U3G A;  1RDA A;  1GLL O;  3RSE A;  4H5R A;  2GV9 A;  3MN9 A;  3V1Q A;  3ZSX A;  3IFR A;  1IBM K;  4AH9 A;  4FWP A;  3O3G A;  4I9Q A;  3OJS A;  3DRR A;  3LAN A;  1LAW A;  1LW0 A;  4B9Q A;  1HJR A;  4DF4 A;  2HHW A;  3LDO A;  1TYQ B;  4B3M K;  4F9O A;  2YJE A;  3VEY A;  2VQE K;  1JLQ A;  4WFB L;  4B9M A;  2IVO A;  5E26 A;  3K9J A;  4XH5 A;  4BRC A;  4PKG A;  3AA4 A;  2HOE A;  2IDO A;  1IBK K;  4JI3 K;  1HLU A;  3VQ6 A;  1NKB A;  1IKW A;  1WAJ A;  5AJ3 K;  2WFB A;  1Z05 A;  1W0H A;  4WFA L;  3L0Q A;  4XEI A;  4CER A;  2GUP A;  4IEE A;  4Z4E A;  3SMS A;  4K0K K;  3AVI A;  1HRH A;  3S9H A;  4C8L A;  1C0T A;  2PYL A;  4A2A A;  2HHX A;  3O9S A;  4BRQ A;  3ITH A;  4KHS A;  4A2B A;  1CLQ A;  4YOU A;  4AIL C;  3CPE A;  4WQ4 C;  2A1R A;  5HP1 A;  2J4R A;  1EWR A;  1S6Q A;  2F7T A;  2ZF5 O;  3A5L C;  4XH1 A;  4OKK A;  5KRS A;  1ZBI A;  3PO4 A;  1HPM A;  3OBW A;  3O5B A;  4B1X B;  4JAX A;  1X9M A;  1VQ8 N;  4BQZ A;  4CCH A;  2RE2 A;  2DFF A;  3C6H A;  3QES A;  1KTQ A;  1X9W A;  4RW7 A;  1Q86 O;  3CJA A;  4BE1 A;  4RTF D;  2ITG A;  1ZBS A;  1WUA A;  2YHX A;  2ETJ A;  5JS2 A;  4DTU A;  3GL1 A;  1FK9 A;  2B6A A;  3JS6 A;  3WNE A;  1Z25 A;  1HUX A;  5EY4 A;  1S22 A;  2W42 A;  1EP4 A;  1KLN A;  2VCP A;  3G0Z A;  4FJH A;  3RR7 A;  1T6D A;  2HNZ A;  4Z4C A;  3H1Q A;  2HNY A;  1U6Z A;  4BWJ A;  3CET A;  1NGG A;  2IIR A;  3WT0 A;  1RBU A;  3TSQ A;  3THW A;  4FSV A;  1D8Y A;  1HMV A;  4RW6 A;  3OYC A;  1V4S A;  4WQ5 C;  3QML A;  1BUP A;  3D2E B;  3CCE N;  3L3V A;  3VQ7 A;  4CIG A;  2UYT A;  2GEM A;  3CJB A;  3CFP A;  3NF6 A;  4BR4 A;  3ULE A;  4YOX A;  4B8A B;  2Q31 A;  1MDU B;  5CYM A;  4LC9 B;  1KVA A;  1WSI A;  4O8K A;  1P8Z A;  1HYZ A;  4DSJ A;  3TAB A;  4B9S A;  3CM5 A;  4FOE A;  4AHT A;  1TUY A;  3JAM O;  4CK3 A;  1HNX K;  4NLC A;  1TK0 A;  4M3U A;  1QSS A;  4KHN A;  5BN8 A;  1YTA A;  1X9S A;  1EET A;  3R3L A;  3VQB A;  3CFR A;  4CGJ A;  2QWO A;  4BR2 A;  4B1Z A;  4BRF A;  3KK2 A;  3H46 O;  4O4G A;  4CE9 A;  3CME N;  4FM1 A;  3WUH A;  2QA4 N;  2QWQ A;  3LP2 A;  4BG8 A;  3E01 A;  2OPP A;  3N4Q A;  3TTC A;  3TAQ A;  1DTQ A;  1RIL A;  2P9P A;  3FFK B;  4BDY A;  3JXU A;  3HVR A;  4LF8 K;  3K9K A;  3HO1 A;  4PL7 A;  3OYM A;  3O9U A;  1N32 K;  4CJQ A;  1HNV A;  2VWB A;  1WLJ A;  5EXW A;  4EFH A;  3ZCM A;  3D0P A;  2XY8 A;  4H4M A;  3RVC A;  4W5O A;  4FJN A;  3VEZ A;  4BRP A;  1U49 A;  4DUZ K;  1SKS A;  5KPR A;  5M1Q A;  4DS4 A;  3AAP A;  1VSE A;  3ENO A;  4CHQ A;  4BRG A;  4JLH A;  4KTW A;  4LF7 K;  2O8F A;  3I0S A;  5CY4 A;  2BE2 A;  4FLU A;  1DGK N;  1BG3 A;  4DFJ A;  3J7A P;  2BH1 A;  4DQ8 A;  2GUI A;  2P9L B;  1NMN A;  4BGA A;  2OTJ N;  3SJH A;  2P9N A;  1BO5 O;  4GKK K;  4OPA A;  4MDA A;  5JIC A;  4KV8 A;  5GIP A;  1JXB A;  3WQU A;  3SCX A;  1VSJ A;  3CCR N;  2EX3 A;  4CJL A;  1ZYQ A;  3ZT2 A;  1TL1 A;  4FJ8 A;  2KTQ A;  1T7P A;  3DLE A;  2XY7 A;  4KKO A;  5FPE A;  2IAJ A;  5AZJ B;  3VER A;  4QCL A;  4A61 A;  3L2W A;  3O9T A;  3K2P A;  2YNI A;  4W5Q A;  1T44 A;  4KFB A;  1BI4 B;  3QLH A;  5M1K A;  4CBW A;  4CEO A;  1VQP N;  3QIO A;  2OPQ A;  4CFB A;  3PSI A;  1D9D A;  3IG1 A;  3RMB A;  3SPY A;  3KLF A;  1K8K B;  5LMN K;  4K25 A;  4BY9 C;  1IKY A;  2ITM A;  1GLB G;  3AO5 A;  3ULD A;  5A2Q O;  3S3O A;  3K57 A;  2HBK A;  1ILY A;  3BUZ B;  3MK6 A;  1RDC A;  4H0T B;  5HBM A;  1JKH A;  5JS1 A;  3PIP L;  3LPT A;  1UWB A;  4HTL A;  4E89 A;  4UY8 O;  3MN7 A;  3AGR A;  2E1Y A;  3ZSR A;  2FBX A;  4J8F A;  2YHA A;  2G8K A;  1VAZ A;  4F8R A;  4AF1 A;  3PV8 A;  4JK7 A;  3HM8 A;  1IG8 A;  3FZM A;  3CIP A;  2X6S A;  4M7X A;  5AQY A;  3SK3 A;  4CJW A;  4OLA A;  1G15 A;  2WC9 A;  1T3V A;  2O8C B;  4BE2 A;  1HQU A;  3OYB A;  4G1Q A;  4L3Q A;  4QS8 A;  3JSM A;  4B3S K;  4KH6 A;  3F9M A;  3CC2 N;  3DAW A;  1NWK A;  3VA3 A;  5C25 A;  3W0L A;  1TKZ A;  4BG9 A;  1S9E A;  4CIF A;  3GBT A;  3FE1 A;  5HRP A;  4N47 A;  4DKW A;  4IJA A;  1O1W A;  3VEV A;  3VOV A;  2PAV A;  1OVY A;  3BEX A;  4CJ7 A;  2W6K A;  1BQN A;  1T03 A;  3TR8 A;  1JL2 A;  5SZT A;  1JL1 A;  1N5Y A;  4RW4 A;  4JKB A;  4DTR A;  4HUF A;  3WXM B;  3KD5 E;  1K8A O;  4HUE A;  4TSX A;  1VSL A;  4H03 B;  5BR8 K;  1XMQ K;  4W5N A;  1ASU A;  4MDB A;  2E2Q A;  4UQG A;  1RNH A;  3A5O C;  4IJN A;  2ZE2 A;  4OKE A;  3ZX0 A;  5GAH P;  2ZJP L;  1VQK N;  4LF4 K;  5D3G A;  3QDK A;  4NCG A;  4CF9 A;  4M3Y A;  5GAG P;  3KWI A;  2DFE A;  5AQR A;  4BR5 A;  1NJY A;  1XHZ A;  4CHP A;  5C0Y A;  1VSH A;  1KVB A;  2DPN A;  4W5T A;  1O13 A;  2Z1H A;  2IOC A;  3KLG A;  3CER A;  4OGC A;  3U9Z A;  2OAN A;  2QTD A;  3AVA A;  2AA4 A;  2HBJ A;  3OY9 A;  5AQJ A;  2QXF A;  5AQM A;  4DV0 K;  4JYA K;  4F3T A;  4FJ5 A;  3FZK A;  3ULE B;  4YDU A;  4FWK A;  4DU3 A;  3SV3 A;  2BAN A;  4FPB A;  1WB9 A;  2V7Y A;  4M45 A;  2HF3 A;  1GLD G;  2NZT A;  4DQQ A;  5JLH A;  4YOT A;  4GVM A;  4CFD A;  3JYT A;  4G9Z A;  1SAZ A;  5GIN A;  4LH4 A;  1NJI O;  3UKR A;  3QEV A;  4BC4 A;  4DV2 K;  1XHX A;  2YJF A;  3M8Q A;  3NGI A;  2WBN A;  3G25 A;  2CH5 A;  3DXM A;  3WNF A;  3QNO A;  5AQK A;  3PIO L;  2NUB A;  1YIT N;  4CEE A;  4YOW A;  4DQI A;  4NB4 A;  3DYA A;  5HLF A;  4I6M B;  2P9P B;  1MA9 B;  2KLA A;  4WYB A;  1Q82 O;  3IMX A;  1BCO A;  4JKC A;  3O1B A;  4BRN A;  1NKE A;  2VYP A;  1Q18 A;  4GMJ B;  2CGK A;  4CBX A;  2ZM6 K;  2V51 B;  3NMU A;  1U48 A;  1QE1 A;  4DTO A;  1B9F A;  2VQF K;  1JCF A;  2VGN A;  3LM2 A;  3LDQ A;  2YHW A;  3LP3 A;  3O9R A;  2G8U A;  3C95 A;  4LFA K;  4C8M A;  2I7N A;  3VET A;  3LWL A;  4B3O A;  1ZBL A;  4BRD A;  2O8F B;  1JLF A;  2YNF A;  3BF1 A;  2VGM A;  3VEW A;  4CJE A;  1J53 A;  1QQC A;  2QK9 A;  2QWP A;  4JV5 K;  3MCA B;  4FPA A;  3BP8 A;  1YVN A;  2FF3 B;  1HKC A;  3LM9 A;  4NO7 A;  1BIU A;  2YCH A;  2GX9 A;  4H0P A;  4U67 L;  1NK9 A;  1GOC A;  2NRT A;  2P9N B;  5KI6 A;  5C12 A;  2O8D A;  4CED A;  2KHO A;  2B5J A;  4MLH A;  3KTQ A;  4O0J A;  2Y1I A;  3MEG A;  5LMU K;  2OTL N;  1QHT A;  4NYF A;  1DLO A;  3ASM A;  2FLO A;  3OS2 A;  2OPS A;  4HTU A;  1N34 K;  3NVK A;  2ZGZ A;  1S1T A;  2D5R A;  3OJU A;  4IOC L;  4DQR A;  1S5J A;  3KKR A;  1A5X A;  5IWA K;  4HHT A;  2KZM A;  3C65 A;  1NGJ A;  4F3O A;  2VWJ A;  1TL3 A;  3H3N O;  4CJ3 A;  4FLX A;  3QEX A;  4JI6 K;  1J5O A;  4K41 A;  2CH6 A;  4MLE A;  1R0A A;  2P9I A;  1TKX A;  3CCV N;  2EHG A;  3O3F A;  1HNW K;  4KHP K;  1RTI A;  1RFQ A;  3K5N A;  3NF7 A;  4B9V A;  2Q36 A;  1HX1 A;  3I33 A;  5CR4 A;  4FZZ A;  3PO5 A;  1QVF M;  4FJJ A;  4X66 K;  4H0Y B;  3VQQ A;  1D9F A;  1XI1 A;  2HHS A;  1DEJ A;  4JKA A;  4CGF A;  4CFA A;  3WXK A;  1RT7 A;  3O80 A;  2F8T A;  4KBO A;  3KLI A;  5FPM A;  4FLW A;  4IEI A;  1NGB A;  1VSF A;  2AP1 A;  3V4I A;  3KVG A;  3MWP A;  4FJ7 A;  5E41 A;  4B9U A;  4FM2 A;  4OPK A;  1K6Y A;  3LDP A;  4IKF A;  4CHY A;  1IG9 A;  3HXM A;  1OVQ A;  5LJV A;  5EU7 A;  1NK5 A;  4YNQ A;  1V4T A;  4CJV A;  5KGW A;  4FWN A;  4CF2 A;  4CW7 B;  4FL9 A;  3RWU A;  4N5S A;  3SQ1 A;  1KSP A;  4RG8 A;  2NRV A;  4YOV A;  4C23 A;  4M3T A;  3SQ0 A;  3KK1 A;  1SZ2 A;  3T1Y K;  4CJU A;  3QO9 A;  4ZTJ A;  1BIZ A;  1BOT O;  3HVT A;  2P9K B;  1K73 O;  1JLA A;  4DV5 K;  4DSE A;  4OX9 K;  4LSN A;  3V81 A;  1KXP A;  1KD1 O;  4ID5 A;  3SUP A;  2X74 A;  4FK4 A;  4H5N A;  3E1Y A;  1YHQ N;  2F4V K;  4Y1C A;  3DXK A;  4L8R B;  4N76 A;  4EP4 A;  1WSG A;  4OKJ A;  5CHI A;  3AGK A;  4OJR A;  4CZG A;  4JKG B;  3R1X A;  1L3V A;  3OYA A;  1BDG A;  2HF4 A;  2OYQ A;  4JK9 A;  4NXN K;  3EE9 A;  2Z1G A;  1TGO A;  3KLH A;  3CHW A;  2O8E B;  3V1O A;  4N41 A;  1CXQ A;  1A5V A;  1NK0 A;  3VQ8 A;  4J2D A;  1RT6 A;  3HP6 A;  3CD6 N;  2R7Y A;  2O8B B;  3QFU A;  4FWR A;  1IO2 A;  1IH7 A;  2WTU A;  3IS9 A;  4ID1 A;  4E7K A;  1TKD A;  4QOZ B;  4X64 K;  3BY5 A;  1KAZ A;  5BRD A;  1BIS A;  3NH0 A;  2XY5 A;  4BDP A;  4OLB A;  3UKR B;  4YHH K;  5HRN A;  4M3X A;  5HL7 L;  3DLL L;  4RCH A;  3CMA N;  2HW3 A;  2YNH A;  4GV9 A;  1I39 A;  1YTU A;  3QIP A;  4PUO A;  5DK5 A;  5DMR A;  3J80 O;  2FSJ A;  4FK0 A;  4DV1 K;  3ATV A;  3OBY A;  2QEX N;  4EAH D;  4CJS A;  5HRS A;  3L2Q A;  3P38 A;  4KB1 A;  4B1Y B;  5I3U A;  4CHZ A;  1SKW A;  1ZC6 A;  2E5L K;  3H3O B;  2ASP A;  4FJ9 A;  5TKY A;  5F2R A;  3MN6 A;  5I9E B;  3QBW A;  5F1X A;  4QS7 A;  4AQY K;  1NK6 A;  4IFE A;  1F21 A;  4A62 A;  4KHY A;  2P9U B;  2A40 A;  3LAK A;  1X3N A;  4DV4 K;  3VQE A;  3C6T A;  3NF8 A;  4CJP A;  5JVH L;  1REV A;  3C6A A;  1Q9Y A;  1E4G T;  3AO3 A;  2AJQ A;  4B1W B;  3AVC A;  5ADX H;  1VSK A;  3VTH A;  3U3Y A;  3NVM A;  2FBV A;  4F2S A;  1G99 A;  1GLE G;  1I94 K;  4GKJ K;  1YT3 A;  5C24 A;  2VG6 A;  1KRP A;  1A5W A;  4DSL A;  3MX5 A;  1QTM A;  3KK7 A;  4DV3 K;  3HOT A;  2XY6 A;  3TTD A;  1LW2 A;  2O8D B;  2D0C A;  2F9W A;  3TSU A;  2HVH A;  4M3R A;  1S1V A;  3ZT4 A;  3TI0 A;  3QNN A;  1HYS A;  2W6L A;  2Y1J A;  1C0F A;  1U2V A;  4C8K A;  3O9Q A;  3CF5 L;  4H5V A;  5AZI B;  2A6A A;  1D5A A;  3NDK A;  5B8H A;  4CD3 A;  3P4I A;  1BGX T;  1E3M A;  3VGL A;  5BPM A;  1KFS A;  4CHN A;  3HPG A;  4CES A;  2RF2 A;  4DR1 K;  5AQZ A;  2P9I B;  4Z4G A;  4NXM K;  4E19 A;  4FJL A;  3ZET B;  3ZT3 A;  4CJF A;  4DTM A;  4ISF A;  2V52 B;  3VQC A;  3MDQ A;  5M1F A;  1X9J A;  3RMD A;  4IDK A;  2CGJ A;  1C6V A;  3MX2 A;  1MWM A;  1B92 A;  2I5J A;  3TAE A;  3HI0 A;  3L6Q A;  4N56 A;  3SUO A;  4GV6 A;  5IT9 O;  1NGA A;  4FW2 A;  4FVM A;  1RT2 A;  3EKS A;  3MCP A;  5ELZ A;  4LSL A;  4B8C A;  1SL2 A;  3MWT A;  2E8A A;  1VQO N;  3A5M C;  4CEF A;  3RRH A;  1N6Q A;  2HMI A;  5BRF A;  3U9D A;  4Z4H A;  4DU1 A;  1XNQ K;  1FXX A;  2ASM A;  3CG7 A;  1OH8 A;  1YXQ A;  3CC4 N;  5J1E A;  5KPZ A;  1VQ4 N;  4B3T K;  1U04 A;  3OYG A;  3V9W A;  4DR7 K;  3SUN A;  1TK8 A;  1FKO A;  2UXD K;  1S1W A;  4IFY A;  1J6Z A;  3AA5 X;  2Z1I A;  4EZ6 A;  3U4L A;  3SV4 A;  3M3Z A;  1JLC A;  2YI1 A;  4AHU A;  3RSE B;  3ENB A;  4BRL A;  4LH5 A;  1WN7 A;  1MWK A;  1UOC A;  4CF1 A;  4H8K A;  4WF9 L;  3O1W A;  3TPQ A;  1U45 A;  4BE0 A;  4BDZ A;  1U47 A;  4B1U B;  2OCE A;  3TAM A;  5I42 A;  1YAG A;  2HBL A;  3EN9 A;  2FC0 A;  4NYN A;  2A5X A;  3AVL A;  4LF9 K;  3TU5 A;  5J2P A;  1OH5 A;  4IG0 A;  1WBB A;  5GIO A;  3VQP A;  3B6O A;  4IG3 A;  3EO3 A;  3I55 N;  2QWN A;  1VRT A;  3DXK B;  3GG4 A;  2VG7 A;  1L3S A;  3OYI A;  1JXE A;  1VQ9 N;  5FLX O;  3QET A;  4KRF A;  1BL3 A;  3CQY A;  3DOK A;  3VF2 A;  1RTD A;  1KVC A;  3L4I A;  3CCM N;  2JWK A;  3L8B A;  3CPW M;  3MEE A;  4KTZ A;  4DFM A;  4KRE A;  3T1A A;  2W41 A;  3SAH A;  3PLA A;  4DLE A;  5AQL A;  4IZ9 A;  3SBT A;  5AFU H;  1BA0 A;  4CZK A;  4PWD A;  1RBR A;  1J9A A;  1BA1 A;  3C6U A;  1RCH A;  1LWC A;  5BPL A;  4CZF A;  3ZX2 A;  2BTF A;  3FR0 A;  3THX A;  1S72 N;  3TAN A;  3P39 A;  4JHD A;  3DRS A;  5FDL A;  3QIN A;  5K14 A;  4KI4 A;  1HKG A;  1IKV A;  3BDP A;  3M8S A;  3SQ2 A;  3ALY A;  4DWI A;  4FCY A;  4PKI A;  2E88 A; 
#chains in the Genus database with same CATH homology
 1BIU A;  4FW1 A;  3VQ6 A;  3S3N A;  1NKB A;  1IKW A;  1NK9 A;  3OVN A;  4CJK A;  1WAJ A;  1GOC A;  5KI6 A;  1DTT A;  2F96 A;  4Z4F A;  3VQ4 A;  4DTJ A;  4CED A;  1W0H A;  3ISN C;  4CER A;  4FK2 A;  3OYH A;  4DS5 A;  2B5J A;  3OYN A;  3KTQ A;  4O0I A;  4NCB A;  1JLB A;  4O0J A;  2Y1I A;  4FYD A;  4DMN A;  3MEG A;  1Q8I A;  3K5O A;  4FJI A;  1QHT A;  1EKE A;  4NYF A;  1DLO A;  3ASM A;  4CEB A;  4Z4E A;  1B9D A;  3OS2 A;  2OPS A;  4HTU A;  3AVI A;  1HRH A;  3S9H A;  4C8L A;  4FZY A;  1C0T A;  4CJR A;  2PYL A;  2HHU A;  1S1T A;  2D5R A;  3CM6 A;  3OJU A;  3HP9 A;  3NCI A;  1S5J A;  1RT5 A;  1A5X A;  1FKP A;  3KKR A;  3DI6 A;  3ZSW A;  3OS1 A;  3ZSY A;  3ZSV A;  4CHO A;  4HHT A;  2DY4 A;  3ITH A;  4FLZ A;  1UA1 A;  4KHS A;  4B9L A;  1RTH A;  2RN2 A;  4AHR A;  4F3O A;  2VWJ A;  1CLQ A;  3M8P A;  4AIL C;  1TL3 A;  1NK7 A;  4JS4 A;  4CJ3 A;  3NFA A;  2A1R A;  5HP1 A;  1QSY A;  1LWE A;  1S6Q A;  4FLX A;  3QEX A;  3SUQ A;  1T05 A;  5KRS A;  4OKK A;  1J5O A;  3TAR A;  2PY5 A;  1ZBI A;  3PO4 A;  1C1A A;  4FZX C;  4F2R A;  3ZT0 A;  1R0A A;  1CZB A;  3CFO A;  3I8D A;  1X9M A;  1TKX A;  2E6M A;  3RR8 A;  4CCH A;  2EHG A;  3O3F A;  1RTI A;  2DFF A;  4FLY A;  3QES A;  3K5N A;  3NF7 A;  2KZM A;  1KTQ A;  3LP0 A;  4B9V A;  1X9W A;  4RW7 A;  4BE1 A;  3AVH A;  1I3A A;  3WNG A;  2YKN A;  1RDB A;  4FZZ A;  3PO5 A;  4FJJ A;  2X6N A;  3VQQ A;  2ITG A;  4B08 A;  1D9F A;  1XI1 A;  2OZS A;  2HHS A;  1HQE A;  1CZ9 A;  4CGG A;  2ETJ A;  1SL1 A;  1MU2 A;  2O4G A;  4CGF A;  1RTJ A;  3NBP A;  4CFA A;  3NH2 A;  3NHG A;  4HCB A;  1ZBH A;  1S1U A;  5JS2 A;  1RT7 A;  4Z4I A;  4DTU A;  2F8T A;  1RT1 A;  1FK9 A;  2B6A A;  3KLI A;  3ZT1 A;  4W5R A;  3WNE A;  5KRT A;  1Z25 A;  4FLW A;  4DTS A;  1VSF A;  2W42 A;  3LAL A;  3V4I A;  5FRO A;  3HPO A;  1RBV A;  3FFI A;  1EP4 A;  1C0M A;  1RT3 A;  4ZHR A;  1KLN A;  4FJ7 A;  3G0Z A;  3MXJ A;  5E41 A;  3RR7 A;  4B9U A;  3PX0 A;  4FJH A;  1GOB A;  2HNZ A;  3D45 A;  1S6P A;  4FM2 A;  4Z4C A;  4M3W A;  4OPK A;  1K6Y A;  3PUF A;  2HNY A;  4CK1 A;  4E1M A;  4KI6 A;  2QKK A;  1KFD A;  4BWJ A;  4IKF A;  3LPU A;  4CHY A;  1IG9 A;  3HXM A;  1RBU A;  3K5M A;  5EU7 A;  1NK5 A;  4YNQ A;  4CJV A;  1VK0 A;  1VSD A;  5KGW A;  1D8Y A;  1HMV A;  4RW6 A;  2IC3 A;  4CF2 A;  1WNS A;  3OYC A;  3G10 A;  3QEP A;  4GW6 A;  4OVL A;  4IBN A;  1NK4 A;  3L3U A;  3AVM A;  4DQR A;  3TAG A;  2JGU A;  4B9T A;  2KFN A;  3RWU A;  4LD0 A;  4N5S A;  3SQ1 A;  3L3V A;  4E7L A;  4JS5 A;  3MXM A;  1KSP A;  4RG8 A;  3VQ7 A;  4CIG A;  1ITG A;  4CIE A;  3NF6 A;  3CFP A;  1L3U A;  2HB5 A;  2ZQB A;  4DFK A;  4M3T A;  3SQ0 A;  3KK1 A;  4FLV A;  3HL8 A;  1SKR A;  1VSM A;  4CJU A;  3QO9 A;  4ZTJ A;  1T8E A;  4B8A B;  3KJV A;  1BIZ A;  5CYM A;  2Z1J A;  1KVA A;  1WSI A;  4IFV A;  2HHQ A;  3HVT A;  4MQ3 A;  3DLR A;  2XHB A;  1HYZ A;  4DSJ A;  3F73 A;  2KZZ A;  1JLA A;  3TAB A;  4F4K A;  4DSE A;  4B9S A;  3CM5 A;  4DLG A;  4AHT A;  3V9X A;  4LSN A;  3VQ9 A;  3V81 A;  3L2R A;  4I9L A;  4CK3 A;  1L5U A;  3O4N A;  4ID5 A;  2YV0 X;  4WE1 A;  1L3T A;  5CZ1 A;  4J2E A;  4DSI A;  3SUP A;  3NE6 A;  1TK0 A;  2X74 A;  3RRG A;  4B9N A;  4M3U A;  5J2N A;  1QSS A;  4FLT A;  4FK4 A;  4E3S A;  4KHN A;  1ZBU A;  1TV6 A;  1YTA A;  1X9S A;  1EET A;  4Y1C A;  4L8R B;  4N76 A;  4EP4 A;  2YHB A;  5CZ2 A;  3VQB A;  1WSG A;  2OPR A;  4FJK A;  4KAZ A;  1TVR A;  3CFR A;  4CGJ A;  4OKJ A;  3KK2 A;  4O4G A;  4CFC A;  4CE9 A;  4OJR A;  1BHL A;  1L3V A;  4O44 A;  3OYA A;  3LZJ A;  4FM1 A;  1ASV A;  4Q0B A;  2OYQ A;  2IGI A;  2O4I A;  3LP2 A;  2Z1G A;  4DFP A;  3E01 A;  2OPP A;  1HNI A;  1TGO A;  3KLH A;  4E7H A;  3TAQ A;  1DTQ A;  4EZ9 A;  1GOA A;  1RIL A;  3V1O A;  1KLM A;  4BDY A;  3HVR A;  3UIQ A;  3HO1 A;  3T3F A;  3OYM A;  4N41 A;  3DLK A;  1CXQ A;  1A5V A;  4DTP A;  1NK0 A;  3VQ8 A;  4J2D A;  1RT6 A;  4CJQ A;  4I7F A;  3AVN A;  4CF8 A;  1HNV A;  3HP6 A;  3ZSZ A;  4ZTF A;  1WLJ A;  1SL0 A;  1HYV A;  3ZCM A;  3D0P A;  3H08 A;  2R7Y A;  3WNH A;  3PY8 A;  2XY8 A;  4KHU A;  3SJJ A;  4H4M A;  1IO2 A;  1IH7 A;  2P1J A;  4CGI A;  3RMC A;  4W5O A;  4FJM A;  3IS9 A;  4ID1 A;  4E7K A;  1UA0 A;  2WOM A;  4FJN A;  1U49 A;  1TKD A;  4QOZ B;  1LV5 A;  1VRU A;  1SKS A;  3DRP A;  4PA1 A;  4DS4 A;  1XC9 A;  2PZS A;  4KHQ A;  1VSE A;  1BIS A;  4CHQ A;  3NH0 A;  3CQ8 A;  2XY5 A;  4JLH A;  4BDP A;  4KTW A;  3OYJ A;  3VA0 A;  4OLB A;  5HRN A;  4DU4 A;  4M3X A;  4HVJ A;  3BGR A;  3I0S A;  2G8F A;  5CY4 A;  4C8N A;  2BE2 A;  4FLU A;  4CJT A;  2HW3 A;  1S9G A;  1C1B A;  2ZD1 A;  2YNH A;  4DFJ A;  1I39 A;  4DQP A;  1YTU A;  3QIP A;  3KLE A;  4PUO A;  1RDD A;  2GUI A;  5DK5 A;  5DMR A;  4FK0 A;  1NJZ A;  1QS4 A;  4CJS A;  2OA8 A;  3AO1 A;  5HRS A;  3L2Q A;  2HHX A;  2DTU A;  4KB1 A;  4CEZ A;  1TAU A;  5I3U A;  1ZBF A;  1TKT A;  1JLE A;  5T7B A;  4CHZ A;  1C0U A;  3P83 D;  4CEQ A;  1SKW A;  3AA3 A;  1BQM A;  3K5L A;  2P51 A;  4KV8 A;  5CYQ A;  2XO7 A;  4FJ9 A;  3VQD A;  1JXB A;  2FBY A;  3SCX A;  2DFH A;  4HCC A;  3L2V A;  4E7J A;  1NJX A;  1KCF A;  1VSJ A;  2EX3 A;  4CJL A;  3CYM A;  2KW4 A;  1ZYQ A;  3ZT2 A;  1TL1 A;  4FJ8 A;  1NK6 A;  2KTQ A;  1T7P A;  1F21 A;  1RBT A;  3DLE A;  4KKO A;  2XY7 A;  1NOY A;  4ICL A;  2IAJ A;  4KHY A;  1Q9X A;  4OPJ A;  4QCL A;  3LAK A;  4DTX A;  3DM2 A;  4KPY A;  3VQE A;  3C6T A;  3NF8 A;  4CGD A;  3L2W A;  3NGY A;  4CJP A;  3EYZ A;  3K2P A;  1REV A;  2YNI A;  4W5Q A;  1Q9Y A;  3NAE A;  3AO3 A;  2AJQ A;  4KFB A;  1BI4 B;  3QLH A;  4CEO A;  3V1R A;  3OYF A;  3AVC A;  1C1C A;  3QIO A;  2OPQ A;  4CJ4 A;  1VSK A;  4CFB A;  1D9D A;  4J2A A;  3AVJ A;  1WSJ A;  3IG1 A;  3U3Y A;  4DSK A;  2FBV A;  3RMB A;  3SPY A;  4F2S A;  3KLF A;  3KIO A;  2RKI A;  1TAQ A;  3AO2 A;  1YT3 A;  2YKM A;  5C24 A;  1IKY A;  1WSH A;  2VG6 A;  1KRP A;  1A5W A;  2E6L A;  4DSL A;  3AO5 A;  3LDS A;  4AHV A;  3ULD A;  3S3O A;  1QTM A;  4Z0U A;  3K57 A;  3C94 A;  1BCM A;  3PX6 A;  1RDC A;  2XY6 A;  5HBM A;  1JKH A;  1LW2 A;  3NGZ A;  2GBZ A;  4BWM A;  2D0C A;  2IS3 A;  5JS1 A;  4ELU A;  3B6P A;  3LPT A;  3SQ4 A;  1UWB A;  1NK8 A;  4E89 A;  2HVH A;  4M3R A;  3VQ5 A;  1S1V A;  3ZT4 A;  3KK3 A;  3AA2 A;  3QNN A;  3TI0 A;  1UAX A;  3DLH A;  1HYS A;  4HUG A;  1XWL A;  3ZSR A;  2G8W A;  4FJX A;  1X1P A;  2FBX A;  2Y1J A;  2YHA A;  2G8K A;  4E1N A;  1VSI A;  4F8R A;  1Y97 A;  3PV8 A;  4C8K A;  4DTN A;  4K8X A;  3AVK A;  3V9S A;  2KQ2 A;  1W9H A;  3OYD A;  1LAV A;  4ELV A;  1D5A A;  3NDK A;  2A1S A;  3V9U A;  4KO0 A;  2X6S A;  3K58 A;  4CJW A;  3U6F A;  1WSF A;  4OLA A;  1G15 A;  1BGX T;  5HRO A;  3V6D A;  2HND A;  1NKC A;  3IRX A;  1KFS A;  4CHN A;  3HPG A;  1IKX A;  4BE2 A;  1HQU A;  4CES A;  4O5B A;  4G1Q A;  3OYB A;  4FJG A;  5J2Q A;  3JSM A;  3DLG A;  2RF2 A;  4DQS A;  1BI4 A;  3LP1 A;  4I2Q A;  1NOZ A;  4H4O A;  4CF0 A;  3VA3 A;  3VQA A;  5C25 A;  4KHW A;  3AVF A;  4CK2 A;  1TKZ A;  4Z4G A;  1ASW A;  3HK2 A;  3RTV A;  2XRI A;  3SNN A;  3KKS A;  1S9E A;  4CIF A;  3F9K A;  3OYL A;  4E19 A;  5HRP A;  3DMJ A;  3ZT3 A;  4FJL A;  3DOL A;  4CJF A;  4N47 A;  2HHT A;  3VN5 A;  2B4J A;  3ZSQ A;  2VWK A;  1O1W A;  3OYE A;  3LZI A;  4E7I A;  1EXQ A;  4AHC A;  4DTM A;  3TAF A;  3MED A;  3VQC A;  3RMD A;  3M8R A;  4IDK A;  1TK5 A;  1C6V A;  2G8H A;  3AVB A;  4PY5 A;  1BQN A;  1T03 A;  3TR8 A;  3P1G A;  1JL2 A;  1B92 A;  5SZT A;  1JL1 A;  2I5J A;  4M41 A;  5KGX A;  4RW4 A;  3TAE A;  1N5Y A;  2HVI A;  4N56 A;  4DTR A;  4HUF A;  3AVG A;  3SUO A;  2FBT A;  3KD5 E;  4FVM A;  4FW2 A;  2Q3S A;  1RBS A;  4HUE A;  3V9Z A;  1RT2 A;  4CJ5 A;  2YNG A;  1VSL A;  4TSX A;  4W5N A;  4DSF A;  1ASU A;  4LSL A;  4I2P A;  1HPZ A;  1RNH A;  4B8C A;  4UQG A;  3QER A;  1SL2 A;  1LWF A;  2ZE2 A;  3OS0 A;  3L2U A;  4OKE A;  3TAP A;  3HPH A;  4M3Z A;  3TWH A;  1WAF A;  4CEF A;  3RRH A;  1JLG A;  5D3G A;  1N6Q A;  2HMI A;  4NCG A;  5J2M A;  3A2F A;  4CF9 A;  4Z4H A;  4DU1 A;  4M3Y A;  1FXX A;  3HST B;  4NCA A;  4FM0 A;  2DFE A;  3CG7 A;  4MFB A;  5KTQ A;  4Q5V A;  1NJY A;  2P5O A;  2F8S A;  1XHZ A;  3HJF A;  4CHP A;  2QKB A;  5FRN A;  1VSH A;  1KVB A;  5J1E A;  1U04 A;  1EX4 A;  3DLB A;  3OYG A;  1WSE A;  3EY1 A;  3V9W A;  4W5T A;  3SUN A;  1TK8 A;  5FRM A;  2Z1H A;  1SUQ A;  3KD1 E;  1FKO A;  1S1W A;  2IOC A;  4IFY A;  3KLG A;  4XIU A;  3AA5 X;  2Z1I A;  4YFU A;  4EZ6 A;  3SV4 A;  4OGC A;  2P5G A;  2G8I A;  1JLC A;  3O3H A;  3AVA A;  4AHU A;  3HT3 A;  3SI6 A;  4LH5 A;  1WN7 A;  3OY9 A;  4DG1 A;  1UOC A;  2QXF A;  2VG5 A;  2X78 A;  4AHS A;  4CF1 A;  4H8K A;  1Z26 A;  4BE0 A;  4BDZ A;  1U45 A;  1U47 A;  4FJ5 A;  3O4Q A;  4F3T A;  3EZ5 A;  4JRP A;  1CXU A;  3TAM A;  4DF8 A;  5I42 A;  4DU3 A;  1J54 A;  3THV A;  3SV3 A;  2ATQ A;  4OGE A;  3MAQ A;  1SV5 A;  2FC0 A;  2BAN A;  4NYN A;  2D0B A;  3HM9 A;  4M42 A;  3AVL A;  3AO4 A;  4E0D A;  2WON A;  4Y1D A;  4M45 A;  5J2P A;  3HYF A;  4IG0 A;  4DQQ A;  2HHV A;  4QAG A;  3LAM A;  5HRR A;  4JRQ A;  3VQP A;  3B6O A;  4GVM A;  4CFD A;  3JYT A;  4IG3 A;  4C8O A;  4K8Z A;  3LWM A;  4KTQ A;  4LH4 A;  3SYZ A;  3QEV A;  1S1X A;  2PYJ A;  1VRT A;  1XHX A;  2RPI A;  3M8Q A;  2E4L A;  3NGI A;  2VG7 A;  1L3S A;  2D0A A;  3I0R A;  3SPZ A;  3OYI A;  3P5J A;  3WNF A;  3QNO A;  1JXE A;  3QEW A;  2NUB A;  4CEE A;  3QET A;  3ZSO A;  2JLE A;  1QSL A;  4DQI A;  4KRF A;  3NF9 A;  1BL3 A;  3DOK A;  1RT4 A;  3PX4 A;  1RTD A;  1KVC A;  3DYA A;  3MXI A;  5HLF A;  3L8B A;  4O55 A;  1YVU A;  1RDA A;  3U3G A;  3SZ2 A;  4R5P A;  2OZM A;  2G8V A;  4CEA A;  3MEE A;  4KTZ A;  1BCO A;  2GV9 A;  3V1Q A;  3ZSX A;  3RMA A;  4FXD A;  4DFM A;  2LSN A;  4KRE A;  4AH9 A;  3T1A A;  5SWM A;  3O3G A;  1NKE A;  3NH1 A;  4DLE A;  4I9Q A;  4EP5 A;  4LY7 A;  4GMJ B;  3OJS A;  2BDP A;  3IAY A;  4CGH A;  4BAC A;  3DRR A;  3LAN A;  4PWD A;  1LAW A;  1LW0 A;  1U48 A;  1QE1 A;  1RBR A;  4DTO A;  1J9A A;  3OYK A;  1B9F A;  1HJR A;  3C6U A;  4DF4 A;  1RCH A;  4RW8 A;  1LWC A;  2HHW A;  3S3M A;  5C42 A;  4KB0 A;  3LP3 A;  3QEI A;  2G8U A;  3C95 A;  3TAN A;  1JLQ A;  4C8M A;  4B9M A;  3LWL A;  1NJW A;  3T19 A;  4CEC A;  3DRS A;  1ZBL A;  2BGG A;  5FDL A;  4B3O A;  3QIN A;  5K14 A;  1JLF A;  2YNF A;  4ELT A;  4KI4 A;  4CJE A;  1J53 A;  1IKV A;  1QQC A;  3BDP A;  2KFZ A;  1U4B A;  2QK9 A;  3AA4 A;  2IDO A;  3M8S A;  3SQ2 A;  3MEC A;  3ALY A;  4DWI A;  3K59 A;  4RW9 A;  4FCY A;  4J2B A;  3AV9 A;  4PQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...