3VQ7A

Hiv-1 in core domain in complex with 4-(1h-pyrrol-1-yl)aniline
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
145
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 54
structure length 145
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq7A00
2DFHA 2YNGA 3ZSWA 1VSIA 4FLTA 1NK0A 3DRPA 1KLMA 1LWEA 1U04A 3MAQA 4AHVA 4CHOA 5CZ2A 4B9UA 4DS5A 2Y1IA 4CERA 1U45A 1S6PA 1S1UA 5C24A 4N76A 3QERA 3OYNA 2E4LA 3DYAA 3LAKA 1NK8A 1C6VA 4F3TA 2VG5A 1NKBA 4AHRA 2FBXA 2YNIA 3TAPA 1IO2A 1WSEA 2Z1IA 4YFUA 3AO1A 2Z1GA 1YTUA 4FZZA 1W0HA 2OPQA 4BDZA 1TAUA 1WSGA 1X1PA 1ZBHA 3LPTA 1HYZA 4DS4A 4CJLA 1XWLA 2OPPA 3LANA 2DY4A 1ASVA 2NUBA 4GVMA 4CJ3A 3L2QA 3AVAA 4WE1A 5HRPA 4FM0A 4PWDA 4QAGA 4CK3A 4ELUA 4CECA 4BE0A 1RILA 3OYHA 4IFVA 5J1EA 3ISNC 2QKKA 4B9VA 4GW6A 2E6LA 2VWJA 3B6OA 4ELVA 4CJQA 1T03A 2D0CA 1S1XA 3ITHA 1Z26A 3QEIA 1L3TA 1SV5A 3WNFA 2X6SA 4CJTA 2QKBA 1WSJA 3OYJA 4HUEA 1BI4A 2OZMA 4LH5A 3KTQA 1RT4A 4DFJA 2OA8A 1TK5A 3KLEA 3DMJA 1J54A 3L2UA 1ASWA 2YKMA 2PY5A 1NJWA 4F4KA 4IG3A 2ETJA 2BGGA 4FJ7A 3RR7A 4Q0BA 3RMAA 1LWCA 2IC3A 4W5NA 4M42A 3DLRA 3DM2A 3HXMA 1VRUA 4N47A 3LWLA 4DSIA 1D9FA 3FFIA 4FLUA 4KPYA 1JLBA 4DTXA 1FKOA 3NGIA 1NK5A 4BE1A 4YNQA 4FLVA 2O4GA 2IS3A 4B8AB 3T1AA 4DSLA 4KI4A 4KHUA 3DOKA 4IDKA 1UA1A 4O0JA 4DTPA 3QIOA 4O44A 2RPIA 1EXQA 1TKXA 4CEAA 3O4NA 1HYSA 4KKOA 2G8IA 2XRIA 1G15A 4O0IA 4IKFA 4IFYA 1TKTA 2OPRA 4LY7A 4FJNA 3P1GA 1JLFA 4CJEA 1Q9XA 3NH0A 4CJUA 4DQSA 4BWMA 4DLGA 5T7BA 3KLFA 4CFCA 2HVHA 1FXXA 5JS2A 3HM9A 4OPKA 4NYNA 4DFKA 3NDKA 3LP0A 4JLHA 1WN7A 1IG9A 2JLEA 4FJHA 1UWBA 4FCYA 3QNNA 1RBVA 4DF8A 1LWFA 3ZSYA 3THVA 3L2RA 3IAYA 3AVBA 3VQAA 3HPHA 4KREA 3P5JA 1J5OA 4O55A 4B9SA 4JS4A 3KD5E 2ITGA 2HHXA 2X74A 3PY8A 3DLGA 4I9LA 3CFOA 4FM2A 4OVLA 4B9NA 5C25A 4FJMA 1QSLA 2G8UA 2D0AA 4DTMA 3NH1A 3V1RA 4E7HA 5J2QA 4LD0A 1S9GA 4M3WA 3ZSOA 2RN2A 3OYBA 4DTSA 2PZSA 1IKVA 4UQGA 4AILC 1REVA 1LW2A 1LAWA 1W9HA 3V9XA 2XHBA 4DTNA 4RG8A 4E0DA 2YKNA 4CF0A 3LDSA 1EP4A 1NOZA 2KW4A 3HVTA 4O5BA 1GOBA 3SQ2A 3NF6A 1XC9A 1SL2A 2PYJA 3HP6A 3C95A 2ZD1A 3VQ6A 1KVBA 2I5JA 3D0PA 4OPJA 5D3GA 3RMDA 4CF8A 3M8RA 3NCIA 3KLHA 1VRTA 3OY9A 4F2SA 4KI6A 3MEGA 1KFDA 1ITGA 4CGHA 1VSMA 3AVHA 1QS4A 1NK6A 4CK2A 4F2RA 3MEEA 1EX4A 4M3RA 3RTVA 1Y97A 3QEVA 2HHVA 1C0MA 1LW0A 3V9ZA 3SNNA 4I2QA 4I9QA 2A1SA 3RRGA 3AVFA 1CLQA 2HHWA 1F21A 4EP4A 3SPZA 3S3OA 3HP9A 5KI6A 4LSLA 4CJ5A 1GOAA 4FJKA 2XY8A 1S5JA 3G0ZA 5CY4A 3T19A 2G8VA 4B9TA 3HK2A 3U3YA 3LP2A 3OYKA 3WNHA 4ZHRA 3HVRA 3O4QA 1JL2A 1KVCA 2VG6A 3WNGA 1UOCA 1SKWA 3F9KA 3M8QA 3KK3A 2AJQA 4Z4EA 4C8NA 3IS9A 3QETA 4B9LA 3S9HA 4CEQA 1NKCA 3V1OA 2F8SA 1LV5A 1YT3A 4RW9A 4EZ6A 1FKPA 2XO7A 3NE6A 3VN5A 2Y1JA 4DSEA 2HW3A 4KTQA 1HJRA 3LP3A 3U6FA 3OJUA 1RNHA 1D5AA 1RT5A 4PY5A 1JLAA 4ID1A 4PQUA 2KTQA 3CYMA 3OS1A 3JSMA 1T05A 3D45A 3ZT1A 4E7KA 4KHNA 4N41A 5EU7A 3VQBA 4OKEA 2KQ2A 4K8XA 4MFBA 3OS2A 2HHTA 1CZBA 3MEDA 4AHTA 2OYQA 3C94A 4O4GA 4QOZB 2B4JA 2OPSA 4ID5A 4C8LA 4Z4HA 4CF2A 1IKXA 3VQDA 1JLCA 3OYFA 3DLKA 4CIEA 2DFFA 3M8SA 2VG7A 5CZ1A 1ZYQA 4C8KA 1A5VA 3ZT3A 3CFPA 1B92A 4AH9A 1HNVA 4KTWA 1HQEA 3AVJA 4CJ4A 3OYEA 1RT7A 1C0UA 4CGGA 4ICLA 3OYLA 3K5MA 3PV8A 4DFPA 4M3UA 2A1RA 4FK2A 3DLHA 3LP1A 1S1TA 4FW2A 1C1AA 3VQ9A 1HRHA 2LSNA 2XY7A 4J2DA 4FJGA 1T7PA 4L8RB 4OLBA 1RTIA 3AVLA 1RCHA 2B5JA 3TAFA 1RDBA 2YNHA 1K6YA 4M41A 2DFEA 4E7IA 1NK4A 3CQ8A 4JS5A 3V9WA 2G8KA 1TAQA 2HNDA 4Y1DA 4FLXA 4CEZA 2P5GA 4CIGA 1SL1A 2X78A 1BGXT 3LPUA 4B8CA 3ALYA 3L2VA 1T8EA 3MXJA 5J2MA 1XI1A 4M3YA 2KFZA 4NYFA 1ZBUA 5HROA 1U48A 4CCHA 5JS1A 2HVIA 3AVMA 4HHTA 4FJ5A 1KVAA 1X9MA 1NJXA 4KHSA 1WAFA 2GBZA 3K58A 4Z0UA 1L3UA 1RTJA 2FC0A 3VQ4A 4DQQA 3V9SA 1CXUA 2BE2A 2FBVA 3EZ5A 3QESA 3PO5A 1BQMA 4DQPA 1YVUA 1BCMA 3TR8A 3ZT2A 3VQ7A 1B9FA 1BQNA 4E1NA 1NKEA 1Q9YA 3MXMA 4DWIA 1QE1A 3JYTA 4DQRA 4FJJA 4C8MA 4DG1A 5J2NA 5FDLA 1RBTA 3KK1A 1RT1A 4CGIA 1NK9A 3TARA 5DMRA 1TKDA 1RTDA 2G8FA 3KD1E 5CYMA 1QHTA 4H8KA 4HUGA 4KHQA 1VSFA 4AHCA 1NK7A 4CJVA 3VQCA 4J2AA 1FK9A 3NHGA 4BDYA 1TKZA 2X6NA 4HCBA 4FK4A 3AVCA 1TV6A 2Z1JA 3AVKA 1NOYA 5J2PA 1QSYA 3NAEA 1NJZA 2DTUA 4DQIA 5CYQA 4KB1A 3AO5A 3L8BA 3KKSA 3I0RA 4KAZA 1RDAA 1Q8IA 1J9AA 1WAJA 1TK8A 4OGEA 5FROA 2XY6A 3CM5A 3HL8A 3LWMA 1SKSA 1SKRA 3B6PA 4BDPA 2YHAA 3AVGA 3WNEA 3TAGA 1JXEA 3AO2A 3SPYA 3KLIA 2IAJA 3K57A 4DF4A 3RWUA 3PO4A 5KGWA 3HJFA 4FLZA 3ZT0A 1UA0A 1SL0A 2KZMA 3QIPA 3L3VA 4CHQA 3P83D 3AO4A 1JLQA 3V6DA 3SZ2A 2HMIA 1VK0A 4E89A 2P51A 3VQQA 4CJFA 3PX0A 1DLOA 1S6QA 4E1MA 5KRTA 3DLBA 4KB0A 4OLAA 1TL1A 1N6QA 1I39A 5HRNA 3HPOA 4DLEA 2YHBA 3ZCMA 4DFMA 3K5NA 1L3SA 2P5OA 4CHNA 2IGIA 1VSHA 3HYFA 2R7YA 4C8OA 3MXIA 4F3OA 1RBSA 4KO0A 1IKYA 3L3UA 4DTOA 3RMCA 3SI6A 1A5XA 1CXQA 3SQ1A 3TWHA 2HB5A 1L3VA 1MU2A 4J2BA 4B08A 3O3FA 2F96A 3PUFA 3A2FA 3IG1A 3TAMA 4ZTFA 5HRRA 4M45A 1QQCA 1KCFA 1RT3A 4PUOA 4CGJA 1HPZA 2G8HA 3CG7A 1U47A 4IG0A 1B9DA 3RRHA 3QO9A 4BACA 5E41A 2IOCA 4DU3A 2EX3A 3QINA 4KRFA 3VA3A 3AVNA 2RF2A 1IKWA 4CHYA 3QNOA 3F73A 4OKKA 3K2PA 1D9DA 5FRMA 2QXFA 3TAQA 1YTAA 1JL1A 4E3SA 3RR8A 2QK9A 1RDDA 1CZ9A 2WONA 3KLGA 4FW1A 4NCBA 2OZSA 1BL3A 3TABA 4CIFA 1I3AA 4MQ3A 4FJLA 4QCLA 1IH7A 3AA3A 3AO3A 4CEOA 1KLNA 1A5WA 1BIZA 4Z4GA 3VQEA 3KJVA 3QEWA 2XY5A 3KIOA 5C42A 3SUOA 4FJ8A 1UAXA 5HBMA 4NCAA 1BCOA 2W42A 4ELTA 4AHUA 3SUPA 5K14A 3NFAA 4OKJA 3NGZA 4N5SA 3VQPA 3OYGA 3OS0A 3SCXA 1ASUA 1BHLA 2HHUA 4W5TA 2ZE2A 4N56A 4K8ZA 3ZSVA 4M3ZA 3AA4A 1HQUA 3OYDA 1KRPA 3VQ5A 4FLYA 4Z4IA 3M8PA 3S3NA 3EY1A 4J2EA 4FVMA 4B3OA 2ATQA 1RT6A 1JLEA 2GV9A 4CK1A 4I7FA 4TSXA 3NF7A 1VSKA 4IBNA 3NH2A 2PYLA 4FJIA 2F8TA 2HHQA 2HHSA 4EP5A 3O3GA 4PA1A 4CF9A 4CEBA 4W5QA 5FRNA 1S1WA 1WSFA 4H4MA 3AA5X 3K5OA 1WLJA 3EYZA 3HSTB 3ULDA 3SJJA 3ZSQA 4W5RA 3V1QA 1JXBA 3TI0A 1L5UA 4DSJA 3I0SA 1GOCA 1QSSA 3AA2A 3OVNA 3HT3A 1RBUA 4CJRA 4G1QA 2ZQBA 4LSNA 1NJYA 4CEFA 4CFDA 4RW6A 1TVRA 2D0BA 5HRSA 1ZBIA 1U49A 1R0AA 4KFBA 4DMNA 4DU4A 3DRRA 2KZZA 3V9UA 1VSJA 4E7LA 1EKEA 3OJSA 4CHZA 1QTMA 2G8WA 1BI4B 4HVJA 4FXDA 3CFRA 1RT2A 4FZYA 3UIQA 3TAEA 1HYVA 3HPGA 4CEDA 4NCGA 1EETA 2HNYA 2D5RA 1VSLA 3T3FA 4CJSA 4ZTJA 3LZIA 2YNFA 1C1BA 3OYAA 4HTUA 3VA0A 4LH4A 3VQ8A 2VWKA 4FZXC 4R5PA 4E19A 4E7JA 1WSIA 2BANA 5SWMA 1WSHA 1XHZA 4FJ9A 1WNSA 3QLHA 2YV0X 4FJXA 4CHPA 1ZBFA 3V81A 4CE9A 4CFBA 3HO1A 2GUIA 4BE2A 3S3MA 4GMJB 3MECA 1KTQA 2FBTA 2IDOA 3KK2A 3I8DA 4DSFA 3ZSXA 3DI6A 3SV4A 4H4OA 5HP1A 1TK0A 4M3XA 1VSEA 3DLEA 2HNZA 4I2PA 3ZSRA 4W5OA 4Z4FA 1U4BA 4CF1A 3K59A 3H08A 2FBYA 4CJPA 1DTQA 3SUQA 2E6MA 3E01A 1D8YA 4FLWA 4XIUA 3ZT4A 2JGUA 1XHXA 4Y1CA 1S9EA 3ASMA 3DOLA 3DRSA 4FM1A 3NF8A 3LZJA 1C1CA 2EHGA 4CESA 5HLFA 2RKIA 3SUNA 1RTHA 4FYDA 3NBPA 4CJWA 3SQ4A 4Z4CA 4DTJA 3QEXA 5SZTA 5I3UA 3AVIA 1JLGA 3LALA 3ZSZA 4M3TA 4OGCA 4KHWA 1SUQA 1RDCA 1KFSA 4BWJA 4OJRA 4CEEA 1N5YA 4FK0A 1X9WA 4KTZA 4EZ9A 1KSPA 2O4IA 1VSDA 3SV3A 3O3HA 2KFNA 4RW7A 4AHSA 1BIUA 1TL3A 4CFAA 1Z25A 1HNIA 2P1JA 4CJKA 3G10A 3IRXA 3CM6A 5DK5A 3U3GA 3AV9A 3C6UA 2Z1HA 3V4IA 4CGFA 4DSKA 3PX4A 1S1VA 4F8RA 4KHYA 1ZBLA 1C0TA 1JKHA 1HMVA 4HUFA 5KRSA 1X9SA 1LAVA 3C6TA 1DTTA 1J53A 3K5LA 3SYZA 4DTUA 4JRQA 2Q3SA 4KV8A 4DU1A 4RW8A 3BDPA 4CGDA 3OYMA 4Q5VA 3BGRA 1O1WA 3OYCA 3L2WA 4B9MA 1RBRA 3QEPA 4HCCA 4JRPA 2WOMA 3KKRA 3PX6A 3SQ0A 4RW4A 5KTQA 3OYIA 3TANA 3RMBA 3LAMA 4DTRA 3NF9A 3NGYA 2BDPA 1BISA 5KGXA 2B6AA 1TGOA 5I42A
chains in the Genus database with same CATH superfamily
4KH4A 2DFHA 1X9JA 1SAZA 1LWEA 1K8AO 3PSFA 2Y1IA 3PSIA 1S6PA 4N76A 5A2QO 3LAKA 1C6VA 3FE1A 1NKBA 1WSEA 1BWFO 4JAXA 4U67L 3K9JA 4H03B 4CJLA 1XWLA 2OPPA 3I8BA 1TYQA 2NUBA 4CZGA 3DWLA 3N4QA 3AVAA 4ISFA 1GLEG 1HJOA 4BE0A 4JK9A 3OYHA 4AF1A 5FPEA 4H5RA 2E6LA 4ILJA 3CPWM 4IWVA 1YJNN 2D0CA 1VQMN 3CC2N 1S1XA 3ITHA 3QEIA 3O9SA 4CJTA 1WSJA 5CR4A 1NGDA 1BI4A 1RT4A 4NXNK 1TK5A 3L2UA 2ETJA 3CQYA 4FWMA 4FJ7A 2QTDA 3WXMB 3HXMA 1VRUA 3LWLA 4JKGA 1NWKA 3OBYA 5FPNA 4KI4A 4YNQA 3THYB 4DTPA 3QIOA 3RSEA 3R3LA 2Q2RA 4KKOA 1G15A 2YJFA 3I33A 4BRGA 4FWSA 4LF8K 4CJEA 4A62A 3HOSA 1OH7A 4C1NK 4BWMA 4CFCA 5JS2A 3HM9A 4EFHA 3NDKA 1IG9A 5AQLA 2P9IB 3WXKA 3BF1A 4WFBL 1LWFA 3IAYA 4KREA 3KWGA 3P5JA 5AQKA 4BRMA 3AY9A 5GAEP 3DLGA 3QFPA 2W40A 3QBXA 4BRLA 2W41A 1QSLA 3J80O 3HOTA 2O8FB 1ZC6A 4M3WA 3MN5A 1IKVA 4AILC 1REVA 4KH6A 3V9XA 3FZHA 2XHBA 4DTNA 4XH1A 4CF0A 4F4KA 2KW4A 1XC9A 1SL2A 3HP6A 2ZD1A 3VQ6A 4CJ7A 3RMDA 2QWLA 4BRKA 3M8RA 4DV4K 3OY9A 4NXMK 1ITGA 4YOTA 3AVHA 1QS4A 5KPZA 3KWIA 3U9DA 2HHVA 3A5LC 3O08A 3SNNA 5C12A 3AVFA 1F21A 4EP4A 3SPZA 3P4IA 1HKGA 3HP9A 3ULEA 1GOAA 4K0KK 3T19A 4DHYA 3BEXA 2VGNA 3SK3A 3O4QA 3CCUN 2VG6A 2IIRA 3F9KA 3MWTA 3KK3A 2AJQA 2O8DA 4CEQA 1QVGM 5GAHP 1LV5A 4BQZA 4EZ6A 3CC4N 4JI4K 1VQLN 2HW3A 4KTQA 3LP3A 1D5AA 1RT5A 4CD1A 2KTQA 3CYMA 2A3ZA 2WBNA 3DXMA 4KHNA 3NVMA 4OKEA 4AHTA 3E9PA 2OYQA 4LC9B 4BRAA 2OPSA 4ID5A 3MWPA 4CF2A 1JLCA 2Q0UA 3DLKA 2ZJPL 2QA4N 1BG3A 2Q97A 5CZ1A 5LL6Z 4CZEA 3ZT3A 1ZYQA 1HX1A 3UKRA 4KTWA 4IJNA 3OYLA 1HLUA 1C0UA 3C7NA 3L4IA 2HBKA 5M1FA 3EKUA 2P9UA 3LP1A 3VF2A 3VQ9A 1C1AA 2RHKA 4J2DA 5AQNA 1KD1O 1RCHA 4A2BA 1RDBA 5C10A 1NK4A 1JCGA 1RDUA 1TAQA 2P5GA 4CEZA 2CGKA 5AQTA 4YDUA 1T8EA 4NYFA 5HROA 2HVIA 5JLHA 3EZWA 4KHSA 4Z0UA 3L6QA 2AP1A 4BVPA 3CMEN 4A57A 3QESA 3ZT2A 3VQ7A 5BPMA 4E1NA 1Q9YA 4CI6A 3MXMA 1MWKA 2CH5A 4DQRA 4C8MA 4DG1A 5J2NA 4OO1J 5AQJA 3KK1A 4IEIA 3KD1E 2VQFK 1TKDA 5ADXH 3ZLJA 4IOCL 1FK9A 3IKMA 4CW7B 3NHGA 4BDYA 3AVKA 1TV6A 2O8EA 3BZCA 5BRDA 5J2PA 3J7AP 3AO5A 3M6GA 3KKSA 3IFRA 4JKAA 3I0RA 1RDAA 5AFUA 1WAJA 2XY6A 3CM5A 3HL8A 2ZWHA 2KHOA 3B6PA 4BDPA 4DV5K 3AVGA 3QFUA 3WXJA 3AO2A 2IAJA 2KZMA 3F5TA 4CHQA 4M7YA 1K8KA 3AO4A 1IBMK 1VK0A 3UE5A 2P51A 4CJFA 3PX0A 4E1MA 5KRTA 1WUAA 2P5OA 3HPOA 2YHBA 3K5NA 4C8OA 2IGIA 1VSHA 4F3OA 3MXIA 5C15A 4MLEA 4HWIA 1BA0A 4BRDA 2D4WA 1MU2A 1VQ9N 3I56N 1NGBA 4ZTFA 1SQKA 3OTOK 1QQCA 1RT3A 3CG7A 4IG0A 2E88A 2E2PA 4OKKA 3JAMO 3SJHA 5KPRA 3RR8A 1N33K 4PKIA 2WONA 2OZSA 1NGIA 2O8CA 4JKHA 1BIZA 3KK7A 4FJ8A 4F9OA 1BCOA 1YVNA 2NRXA 3NGZA 4JHDB 3OS0A 1I94K 4OPAA 2HHUA 4N56A 3AA4A 3G71N 1MWMA 1KRPA 4Z4IA 3S3NA 3EY1A 4B3OA 4MDAA 1RT6A 2GV9A 1R59O 4TSXA 2D0OA 2F8TA 1RFQA 4CF9A 3R1XA 2E2QA 4W5QA 1NMDA 3K5OA 4BRQA 1WLJA 2GELA 3ZSQA 1S72N 4CBWA 3I0SA 2FXUA 2PAVA 3OVNA 2ZGZA 1NJYA 4BRPA 4CEFA 2FF3B 4WQ4A 2D0BA 5HRSA 3AGKA 2CH6A 1IJJA 3FR0A 3V9UA 3OJSA 3CERA 4JI8K 4FXDA 2P9PA 1RT2A 4FZYA 2A42A 3UIQA 4CEDA 3T69A 4LF7K 2HNYA 1KXPA 5HL7L 3OYAA 4LH4A 3L4QA 1Q86O 5SWMA 4FJ9A 1WNSA 3QLHA 5F0XA 5EXWA 1M1KO 4LF4K 3N4PA 4BR2A 4IXCA 3HSCA 3D2FA 3MCPA 1LOTB 3FZKA 4GMJB 2FBTA 3CCRN 3ZSXA 5EX5A 3DLEA 4I2PA 4CF1A 3TTCA 3H08A 4NB4A 2E6MA 1D8YA 4QS9A 4XIUA 2JGUA 3CCEN 4CESA 2NRHA 3FZMA 2RKIA 2FSNA 1NM1A 3C6AA 3BP8A 3SQ4A 4DTJA 3QEXA 5I3UA 3AVIA 4KHWA 3G6EN 2O4IA 3THXA 4KTZA 1VSDA 3UKUA 1GLDG 3VGKA 1MA9B 1EWRA 1TL3A 5MLCQ 2KFNA 1YITN 3UKRB 1HNIA 4BG9A 2P1JA 5BPNA 5DK5A 3AV9A 2Z1HA 4CGFA 4DSKA 1Z05A 2P9PB 4MO4A 1HMVA 4I6MB 4AM6A 3WUHA 1LAVA 5AQHA 1X9SA 2UXBK 3SYZA 2YCHA 4JKGB 4RW8A 1O1WA 3L2WA 2HMPA 4B9MA 1RBRA 4O8KA 4RCHA 3WEEA 2WOMA 3KKRA 5KTQA 3TANA 4FO0A 2NRZA 3NGYA 1BCMA 2BUPA 5I42A 1KAZA 2YHXA 2WTUA 1NK0A 2UUBK 1KLMA 5BN8A 4DS5A 4CERA 1U45A 3T7ZA 3QERA 2O8BB 5GIPA 3DYAA 1VQ5N 1GLFO 2HBLA 4BRCA 1YAGA 2YNIA 3AGRA 3EN9A 3ZETB 1YTUA 1W0HA 1TAUA 1X1PA 2Q1NA 2DY4A 4OPHA 1HNXK 5JICA 4CK3A 4ELUA 2GUPA 4B9VA 3ISNC 3E66A 4GW6A 3FGUA 3P38A 3B6OA 4ELVA 4GKJK 2HHHK 1Z26A 3THXB 2X6SA 3OYJA 4FWRA 2OA8A 1J54A 1ASWA 1E4GT 4DV2K 4IG3A 3RR7A 4Q0BA 3M1FA 2IC3A 4W5NA 3P31A 1D9FA 1JLBA 1NK5A 4H0YB 3T1AA 4KHUA 4FWLA 1QZ5A 3DOKA 4IDKA 1UA1A 4IDHA 2RPIA 2FSKA 1TKXA 3EL2A 3VERA 2OTLN 1BO5O 2G8IA 3W3DA 4O0IA 4IKFA 4IFYA 1J6ZA 4LY7A 3VTIA 4FJNA 1JLFA 4DQSA 4DV3K 4PL7A 1FXXA 4DFKA 5AQWA 5C2FA 2JWLA 2QEXN 1UWBA 3CJBA 4FCYA 1EQYA 1RBVA 3T1HK 2E2NA 3CPEA 3AVBA 3HPHA 4H0TB 4JS4A 1P8ZA 4JK7A 2X74A 4OVLA 4MDBA 2NRVA 5AQYA 3V1RA 4E7HA 5J2QA 4LD0A 3RSEB 1S9GA 3ZSOA 4EAHD 2HOEA 2O8BA 3VMFB 4UQGA 1LW2A 3RVCA 5BRFA 2I7NA 3LDSA 3JXUA 1EP4A 1NJIO 3NF6A 1TUUA 1SZ2A 4FWQA 3DAWA 2KKZA 1WBBA 4QS7A 3WXLA 3CD6N 2JWKA 3KLHA 1VRTA 3MX5A 4KI6A 3CCLN 1VQON 3B8AX 4CK2A 1EX4A 4M3RA 3A8YA 3QEVA 1YXQA 2AA4A 5AQQA 4FWNA 5AQIA 2A1SA 5EOYA 1CLQA 4EHUA 5LJWA 1S5JA 3G0ZA 4B9TA 2G8VA 4K43A 3HVRA 4JKFA 3WNGA 1SKWA 1VQ8N 4C8NA 3IS9A 4PHTX 1NKCA 4CZMA 1YIJN 3DLLL 4RW9A 2XO7A 3NE6A 4JI3K 1HNZK 4R79A 3IMXA 3JS6A 1RNHA 1JLAA 3OS1A 2KQ2A 3THWB 4K8XA 5GADP 1CZBA 2DPNA 3C94A 4O4GA 4PKGA 3PLAA 4C8LA 1IKXA 3VQDA 1Q82O 4JD2B 1A5VA 3OYEA 2YHYA 4ICLA 4DFPA 4M3UA 2HBJA 2A1RA 4FW2A 1RGIA 4B9QA 4FJGA 1P90A 4OLBA 4K41A 3J7ZO 4E7IA 1K6YA 3SAGA 4H5NA 3CQ8A 4JI7K 1XNQK 3W0LA 4CIGA 1SL1A 1BGXT 3LPUA 3ALYA 3CXCM 2QW9A 5JLFA 1BA1A 1U48A 4CCHA 4BVOA 4YORA 4FJ5A 3K58A 1HPMA 3O4WA 4GV9A 4X64K 2QWQA 1DEJA 4DWIA 1QE1A 2VWBA 4B1UB 3H6EA 5FDLA 1RBTA 3CJ1A 1NK9A 5DMRA 4YOYA 1RTDA 4HUGA 4BRNA 4KHQA 1NK7A 3VQCA 5F2RA 4FK4A 1M90O 2Z1JA 1NOYA 3M3ZA 1QSYA 2DTUA 5CYQA 5HOOA 3L8BA 3CCQN 1J9AA 3WT0A 3U9ZA 1SKRA 3LWMA 1IG8A 3KHYA 3ID8A 3SPYA 4ILHA 3CJ7A 3RWUA 3VF4A 5KGWA 3HJFA 4LF6K 3ZT0A 3LDPA 4DUYK 1NG9A 1DGKN 1NLVA 1JLQA 3VEVA 4EHTA 5AQMA 3VQQA 1DLOA 1S6QA 1OVQA 4OLAA 1I39A 4DFMA 1L3SA 4CHNA 2WUSA 1RBSA 1IKYA 1QQMA 3S41A 3KVGA 3SQ1A 3TWHA 3HBTA 4DV1K 3O3FA 1RDWX 1NGJA 3AARA 3A2FA 5M1QA 2ZGYA 1HPZA 1U47A 2P9NA 1B9DA 2HBMA 4A61A 3VGLA 5E41A 2EX3A 1BU6O 3AVNA 3VOVA 5FRMA 3I55N 1O13A 2V52B 3EEQA 4WQ4C 1YHQN 2V7YA 3TAQA 5AQSA 4M7XA 1CZ9A 2W6KA 4FW1A 3ZX3A 1BL3A 1XNRK 1I3AA 4QCLA 3AA3A 3AO3A 1A5WA 2P9LB 4WCEL 4YDUC 3QEWA 1UAXA 4ELTA 3O1WA 2E20A 3NFAA 4OKJA 3VEXA 3SLCA 1K73O 4BGAA 2ASMA 4K8ZA 3VETA 4LF9K 3OYDA 4JK8A 1X3NA 5GIOA 3M8PA 4BGBA 4JI5K 4FVMA 3AAPA 2ATQA 4DQ8A 4J2EA 3G4SN 4I7FA 2OCEA 3NF7A 3NH2A 2HHSA 4EP5A 3BUZB 4PA1A 4CEBA 5FRNA 1WSFA 4H4MA 4DCHA 3HRGA 4W5RA 3CF5L 3HT3A 4CJRA 3VGMA 1U49A 4KFBA 4DR6K 4DU4A 3DRRA 1VSJA 4CHZA 1QTMA 2G8WA 4IO9L 4FPBA 2VCPA 3CFRA 4FOEA 3J81O 2ITMA 3IDHA 2D5RA 3EE9A 1Q18A 3O5BA 2P9KA 1NU0A 3VA0A 2Q36A 5DM6L 3CCVN 4R5PA 1GLLO 1U2VA 3ATVA 4E7JA 5E84A 2BANA 4XH4A 4XEIA 4WF9L 3S3MA 2P9LA 4H4OA 1TK0A 5CE3A 1U4BA 3K59A 4CJPA 1DTQA 5TKYA 4AM7A 1D4XA 1S9EA 3K9KA 3DOLA 3LZJA 2VGMA 4FYDA 1GLAG 4CJWA 5SZTA 3LALA 3PIPL 4OGCA 1X9WA 3TSUA 4EZ9A 3SV3A 3O3HA 3O80A 1T44A 4RW7A 3H1QA 3TTDA 1Z25A 1XMQK 4CJKA 2GX9A 4PL8A 3V4IA 5FPDA 3PIOL 2WC9A 4KHYA 1ZBLA 4HUFA 5AQOA 4DTUA 4DU1A 3BDPA 3OYMA 4HCCA 4BRIA 4Z94A 3QEPA 4CZKA 3SQ0A 3OYIA 3RMBA 1IBLK 3LAMA 1BISA 5KGXA 2B6AA 5KQDA 3H1VX 1B92A 1TGOA 4CZFA 2YNGA 3GDQA 2NLXA 4FLTA 1U04A 3LDNA 4DUZK 3OYNA 4F3TA 3CETA 2P9SB 2VG5A 4FVUA 4AHRA 3AO1A 2Z1GA 3OHRA 2HF4A 4FZZA 1NGHA 2OTJN 4DS4A 3FZFA 4GY2B 4BR5A 5C2DA 4CJ3A 4GVMA 3L2QA 3MN6A 1NGGA 4FM0A 4PWDA 4CECA 3UKUB 2W6LA 4CD3A 2QKKA 3LDOA 2VWJA 4H0PA 1T03A 2FLOA 3BY5A 4QS8A 2GWKA 3CQXA 3P39A 3WNFA 2ASPA 4HUEA 1T6DA 4LH5A 3KTQA 4DFJA 1N32K 4O5FA 3CI5A 3KLEA 1S22A 2YKMA 2BGGA 2NRTA 3QMLA 1HNWK 3DLRA 4DSIA 3FFIA 4DTXA 3NGIA 4BE1A 3D6RA 4FLVA 3CC7N 2IS3A 5M1NA 1YUWA 4K42A 5BR8K 4O0JA 1LCUA 4GVEA 4BQLA 5AR0A 2IVNA 4CEAA 2V51B 3O4NA 3VF6A 4A5AA 4GV6A 2XRIA 4B3RK 4DV6K 2OPRA 2P9SA 1VAZA 3C0BA 2RE2A 5T7BA 5ELZA 3KLFA 2HVHA 4FOIA 4OPKA 4NYNA 2JLEA 3ENHA 2ZF5O 4FJHA 4ISGA 3J8AA 3QNNA 3ENBA 4DF8A 3ZSYA 3CJAA 3THVA 4J8FA 5GAGP 1J5OA 1VHXA 2ITGA 2HHXA 3PY8A 3GE1A 4FM2A 4GKKK 4FJMA 4B1YB 2D0AA 3NH1A 1FJGK 1YI2N 4LFCK 2RN2A 4DTSA 1U6ZA 3WXIA 4JEPA 4RG8A 3VENA 4E0DA 2ZJQL 3MK6A 3HVTA 3WQTA 3SQ2A 2PYJA 5AFUH 1KVBA 4H5TA 4OPJA 2I7PA 3NCIA 4GNIA 5FPMA 2E1ZA 3MEGA 3ZEUA 4F2RA 1Z6RA 3MEEA 4BC3A 5C0YA 4I2QA 4I9QA 4DB3A 4HTLA 2HHWA 3MMVA 4LSLA 4JKDA 4CJ5A 4FJKA 2XY8A 4B1WB 3U3YA 3OYKA 4ZHRA 4CZLA 1UOCA 4Z4EA 5CHIA 3QETA 4B9LA 3S9HA 1ATRA 1YT3A 4JI6K 2Y1JA 4O8UA 5M1OA 1HJRA 3U6FA 5LMNK 4B3SK 1VQKN 4PY5A 1VQ7N 2CGLA 3BZKA 3D45A 3ZT1A 1NBWA 3HZ6A 4A59A 5EU7A 3VQBA 2F9WA 4AQYK 3OS2A 2E5LK 2HHTA 3C6HA 2V7ZA 2ZM6K 4H0XB 4QOZB 2B4JA 4CIEA 2DFFA 3M8SA 4DR5K 4H0VB 3VTHA 1K8KB 1HNVA 1HQEA 1NGEA 3AVJA 4LF5K 4CGGA 3DXKB 4IOXA 3VEZA 2YHWA 3VEYA 3AAQA 2BH1A 4BR7A 4BC4A 3LDQA 3TAFA 2YNHA 1XC3A 3V9WA 3BF3A 5AQUA 3L2VA 3MXJA 5LY3A 2ASOA 5J2MA 1XI1A 2KFZA 1ZBUA 1V4TA 4JI2K 3AVMA 1CZAN 1KVAA 1HUXA 1WAFA 2GBZA 3A0IX 1L3UA 2WFBA 2FBVA 2BE2A 3A5OC 2ZJRL 3PO5A 4WYBA 1BQMA 1OVYA 1YVUA 5JVHL 4JKBA 2A41A 4BR4A 1B9FA 4FJJA 2QXLA 3JYTA 1YF5L 1RT1A 5JMVA 3TARA 4NLCA 4JKCA 5CYMA 1QHTA 4H8KA 3THWA 2YI1A 4AHCA 4MO5A 4CJVA 4J2AA 4CBXA 4DR3K 2A6AA 1TKZA 4B1XB 3AVCA 1NJZA 4DQIA 4IZ9A 5BR9A 4KAZA 1Q8IA 4OGEA 5JVGL 5BN9A 2YJEA 1VQPN 2YHAA 3WNEA 3TAGA 1WBDA 3O9UA 5BPLA 4WQ5C 4FLZA 2NNWA 3OW2M 1W97L 1T3VA 3P83D 2HMIA 4B1VA 4DR7K 1N6QA 1WOQA 5HRNA 1EWQA 2R7YA 1VQ6N 4RWTA 5BREA 3L3UA 4DTOA 4IFEA 3RMCA 3SI6A 1CXQA 3CCSN 1L3VA 2IVPA 5M1PA 2F7TA 2F96A 3LL3A 1X3MA 5HRRA 1KCFA 4PUOA 2G8HA 4BACA 2QWPA 2IOCA 2FF6A 4DU3A 4KHPK 1OH6A 3QINA 3MX2A 1S3XA 3VA3A 2RF2A 3QNOA 3F73A 1D9DA 3K2PA 4JV5K 3LM9A 1MDUB 3DJCA 1YTAA 3ENOA 4E3SA 2QK9A 3R9PA 3KLGA 3E1YA 4MQ3A 4FJLA 4A2AA 1IH7A 3D2EB 3EO3A 4CEOA 4Z4GA 2XY5A 5HBMA 4NCAA 4AHUA 3VEWA 5K14A 4PKHA 3VQPA 4JI1K 3SCXA 1ASUA 1BHLA 2ZE2A 3ZSVA 3GL1A 4M3ZA 1HQUA 3U4LA 3VQ5A 4FLYA 2IVOA 1JLEA 1XUPO 4CK1A 5AZJB 1VSKA 1VQNN 4FJIA 2HHQA 3THYA 4K25A 3CCJN 4BREA 3C65A 4FWPA 3HSTB 3ULDA 3SJJA 1Y64A 4JNEA 3ZEUB 3A5NC 1L5UA 3AA2A 4CZJA 1RBUA 3H45C 4G1QA 2ZQBA 4LSNA 4RW6A 3MCAB 1WB9A 5AJ3K 4DMNA 3L0QA 2P9NB 1EKEA 2NRRA 3HTVA 4HVJA 2UU9K 3O9QA 4DR4K 4FWOA 4NCGA 3ZYYX 1KAYA 2QWMA 3G25A 3CMAN 2YNFA 1C1BA 2O8CB 4HTUA 2VWKA 4FZXC 3ZX0A 3MN7A 4YHHK 1ZBSA 1XHZA 5AQGA 4FJXA 3T1YK 4CHPA 3V81A 1G99A 1V4SA 3MECA 1KTQA 4DSFA 2IDOA 3I8DA 4YOWA 3J7YP 3SV4A 5HP1A 3C7NB 4M3XA 1VSEA 1ATSA 2H3GX 3ZSRA 3CIPA 2FBYA 3SUQA 4ILGB 2BTFA 4IJAA 4FLWA 3ZT4A 1XHXA 5LMUK 4FWKA 3ASMA 1HR0K 3NF8A 1C1CA 1GLJO 5HLFA 4CZHA 3SUNA 3NMUA 3NBPA 4JKEA 1JLGA 1HKCA 4M3TA 1FW6A 1SUQA 1RDCA 4BWJA 4CEEA 1KSPA 4FSVA 2UYTA 3VPZA 3G10A 3CM6A 3U3GA 1C0FA 3C6UA 5AQVA 1QVFM 3PX4A 1S1VA 4F8RA 1C0TA 1JKHA 1QHAA 5KRSA 3QB0A 3K5LA 1DTTA 1J53A 2Q3SA 4KV8A 4CGDA 4JI0K 3BGRA 5DM7L 4WFAL 4JRPA 4RW4A 3NF9A 2BDPA 1E3MA 1K9MO 4E1JA 3H46O 3ZSWA 1VSIA 3FZLA 5AZIA 3DRPA 3MAQA 4AHVA 4CHOA 5CZ2A 4B9UA 4JD2A 1S1UA 5C24A 2E4LA 1NK8A 2FBXA 3TAPA 1IO2A 2Z1IA 4YFUA 3R6MA 1OKJA 2UUAK 2OPQA 4BDZA 1WSGA 4DR2K 1ZBHA 4DR1K 3LPTA 1HYZA 2CGJA 3QICA 3LANA 2GTDA 3M5RA 1ASVA 4A5BA 4JYAK 4WE1A 5HRPA 4QAGA 2E1YA 1RILA 4IFVA 5J1EA 4CJQA 1N8RO 1L3TA 1SV5A 3O9RA 2QKBA 4BC2A 4WFNL 3E9OA 2OZMA 4UY8O 4LFBK 3Q7CA 3DMJA 4C1NI 2PY5A 1NJWA 1KAXA 5IT9O 3RMAA 1LWCA 4M42A 3DM2A 4N47A 1Q81O 4H0OA 4FLUA 4KPYA 1FKOA 4B1ZA 2NRWA 2O4GA 4B8AB 4DSLA 4O44A 1EXQA 2D0PA 1HYSA 1QZ6A 1TKTA 3P1GA 1Q9XA 3NH0A 4CJUA 1YJ9N 4DLGA 5AQZA 3LP0A 4JLHA 1WN7A 4BROA 1BDGA 4U7BA 1TYQB 1IBKK 3L2RA 3VQAA 4O55A 4B9SA 4YY3K 3KD5E 4I9LA 2P9KB 3CFOA 4B9NA 5C25A 2G8UA 4DTMA 1Q7YO 4JHDA 4NO7A 5AQRA 4X66K 3OYBA 1GLBG 2PZSA 4BY9C 2F4VK 2EWSA 1LAWA 1W9HA 3FLCO 1N34K 2YKNA 1NOZA 4O5BA 1GOBA 2UXCK 4X62K 3SAFA 3C95A 2I5JA 3D0PA 5D3GA 4CF8A 4F2SA 1KFDA 4CGHA 1VSMA 1NK6A 3RTVA 1Y97A 1C0MA 1LW0A 1NGCA 3V9ZA 3RRGA 5M1KA 3S3OA 5KI6A 2UXDK 4LFAK 5CY4A 3HK2A 3LP2A 3WNHA 2HF3A 2E2OA 1QQOA 5LJVA 1JL2A 1KVCA 1NGFA 3M8QA 3ZX2A 2VQEK 4BG8A 3D2FB 3IUCA 3O6WA 3V1OA 2F8SA 2QWRA 1FKPA 3E9LA 1ZXOA 3VN5A 1N36K 4DSEA 2D1KA 3OJUA 2Q31A 4MLHA 4ID1A 4PQUA 3JSMA 1T05A 4E7KA 4N41A 2QM1A 4MFBA 1KQSM 3MEDA 1XQSC 4G9ZA 4Z4HA 3OYFA 3HI0A 2VG7A 4C8KA 3CFPA 4AH9A 4CJ4A 3DLBA 3K5MA 1RT7A 3MDQA 3PV8A 4FK2A 3DLHA 3EE8A 1S1TA 5AQFA 1HRHA 2LSNA 1NMNA 1T6CA 3CJCA 4FPAA 4XH5A 2XY7A 1T7PA 4L8RB 1XMOK 4IEEA 1RTIA 3AVLA 3TPQA 2B5JA 1BUPA 3D7EO 4M41A 2DFEA 4JS5A 2G8KA 2HNDA 4Y1DA 4FLXA 2X78A 3Q7BA 4B8CA 4V19S 3MN9A 5E26A 4M3YA 5B8HA 5JS1A 4HHTA 5BRHA 1X9MA 1NJXA 1TUYA 1RTJA 2FC0A 4H5WA 3VQ4A 4DQQA 3EKSA 3V9SA 1CXUA 3F2KA 3EZ5A 4DQPA 3TR8A 4X65K 2UUCK 2P9UB 1BQNA 1W2BM 1NKEA 4H5VA 5FLXO 3ZETA 3CJ9A 2J4RA 4CGIA 3WEEB 2G8FA 1VSFA 2X6NA 4HCBA 5H1SQ 5I9EB 5AQXA 3ULEB 3NAEA 1KC8O 1IV0A 4KB1A 5EY4A 2QWNA 1TK8A 5FROA 1SKSA 2A40A 2Q0RA 1SS6A 1JXEA 3KLIA 3K57A 4DF4A 3PO4A 1UA0A 1SL0A 3TSQA 3QIPA 1C0GA 3L3VA 3V6DA 3SZ2A 3KZBA 4E89A 4KB0A 1TL1A 3CCMN 5AZIB 4DLEA 3ZCMA 3O1BA 5EVZA 3HYFA 3OA9A 1U2VB 3D2EA 4KO0A 1A5XA 2HB5A 4J2BA 3GG4A 4B08A 1NGAA 3PUFA 1HKBA 3TAMA 3IG1A 4WQ5A 4M45A 3TTFA 4CGJA 4GV3A 3NVKA 3RRHA 3QO9A 1JCFA 5GINA 4KRFA 4CHYA 2YX6A 1IKWA 5AZJA 1DKGD 5KPTA 2QXFA 3LDLA 1JL1A 3VESA 1RDDA 4BRHA 4NCBA 3TABA 2HSTA 4CIFA 4YOXA 1KLNA 3H3NO 2O8FA 4ISEA 3VQEA 3KJVA 3KIOA 5C42A 3SAHA 3SUOA 1JCEA 2W42A 2OANA 3SUPA 2O8EB 3GBTA 4CZIA 4N5SA 3OYGA 2GWJA 4DV7K 3SBGA 2QI2A 4W5TA 1EO1A 1W7AA 3TSPA 4YOUA 1GLCG 3O8MA 5TKWA 4IBNA 2PYLA 5F1XA 3O3GA 4IOAL 2P9IA 2QWOA 1QQNA 4EIAA 1BOTO 4KH5A 4FL9A 1S1WA 1OH5A 2PBDA 3AA5X 4OX9K 3A5MC 3EYZA 3SMPA 3V1QA 1JXBA 3TI0A 4DSJA 1GOCA 4M63C 1QSSA 2GEMA 4NLBA 4BR9A 4CFDA 1TVRA 4BR0A 1ZBIA 1R0AA 1H1VA 2A5XA 1E4FT 2NZTA 2KZZA 3GOIA 4E7LA 2KLAA 3FFKB 4YOVA 4IO8A 1BI4B 3U8XA 3K0SA 1JJ2M 4BC5A 3TAEA 1HYVA 3HPGA 3HM8A 3QBWA 3SMSA 1EETA 3SBTA 1VSLA 3DXMB 3O9TA 4CJSA 3LZIA 3T3FA 4ZTJA 3WQUA 1ILYA 3VQ8A 3R8EA 3CHWA 4E19A 2FSJA 4BRFA 1WSIA 4CVNE 1WSHA 2YV0X 1ZBFA 4CE9A 4CFBA 1NNEA 2GUIA 3HO1A 1ESVA 4BE2A 3OBWA 2O8DB 2VYPA 4L3QA 3KK2A 5IWAK 3DI6A 1J5EK 2PFUA 2HNZA 4W5OA 4Z4FA 4I6MA 3E01A 3UB5A 2F9TA 2E8AA 4B3TK 4Y1CA 4FM1A 3DRSA 1OH8A 2EHGA 3TU5A 3H3OB 1RTHA 3QDKA 4DV0K 4Z4CA 3ZSZA 1KFSA 4OJRA 1N5YA 4B3MK 3ID6A 4FK0A 4CBUA 3F9MA 1DT9A 4AHSA 1BIUA 3ATUA 1YJWN 5AQPA 4CFAA 5KQ8A 1VQ4N 3IRXA 1ATNA 4Y0WA 3VEOA 5ADXA 4JN4A 3C6TA 4C23A 4JRQA 3DXKA 4Q5VA 3OYCA 4RTFD 3PX6A 3LM2A 4DTRA 4KBOA 4DKWA
chains in the Genus database with same CATH topology
2DFHA 2YNGA 3ZSWA 1VSIA 4FLTA 1NK0A 3DRPA 1KLMA 1LWEA 1U04A 3MAQA 4AHVA 4CHOA 5CZ2A 4B9UA 4DS5A 2Y1IA 4CERA 1U45A 1S6PA 1S1UA 5C24A 4N76A 3QERA 3OYNA 2E4LA 3DYAA 3LAKA 1NK8A 1C6VA 4F3TA 2VG5A 1NKBA 4AHRA 2FBXA 2YNIA 3TAPA 1IO2A 1WSEA 2Z1IA 4YFUA 3AO1A 2Z1GA 1YTUA 4FZZA 1W0HA 2OPQA 4BDZA 1TAUA 1WSGA 1X1PA 1ZBHA 3LPTA 1HYZA 4DS4A 4CJLA 1XWLA 2OPPA 3LANA 2DY4A 1ASVA 2NUBA 4GVMA 4CJ3A 3L2QA 3AVAA 4WE1A 5HRPA 4FM0A 4PWDA 4QAGA 4CK3A 4ELUA 4CECA 4BE0A 1RILA 3OYHA 4IFVA 5J1EA 3ISNC 2QKKA 4B9VA 4GW6A 2E6LA 2VWJA 3B6OA 4ELVA 4CJQA 1T03A 2D0CA 1S1XA 3ITHA 1Z26A 3QEIA 1L3TA 1SV5A 3WNFA 2X6SA 4CJTA 2QKBA 1WSJA 3OYJA 4HUEA 1BI4A 2OZMA 4LH5A 3KTQA 1RT4A 4DFJA 2OA8A 1TK5A 3KLEA 3DMJA 1J54A 3L2UA 1ASWA 2YKMA 2PY5A 1NJWA 4F4KA 4IG3A 2ETJA 2BGGA 4FJ7A 3RR7A 4Q0BA 3RMAA 1LWCA 2IC3A 4W5NA 4M42A 3DLRA 3DM2A 3HXMA 1VRUA 4N47A 3LWLA 4DSIA 1D9FA 3FFIA 4FLUA 4KPYA 1JLBA 4DTXA 1FKOA 3NGIA 1NK5A 4BE1A 4YNQA 4FLVA 2O4GA 2IS3A 4B8AB 3T1AA 4DSLA 4KI4A 4KHUA 3DOKA 4IDKA 1UA1A 4O0JA 4DTPA 3QIOA 4O44A 2RPIA 1EXQA 1TKXA 4CEAA 3O4NA 1HYSA 4KKOA 2G8IA 2XRIA 1G15A 4O0IA 4IKFA 4IFYA 1TKTA 2OPRA 4LY7A 4FJNA 3P1GA 1JLFA 4CJEA 1Q9XA 3NH0A 4CJUA 4DQSA 4BWMA 4DLGA 5T7BA 3KLFA 4CFCA 2HVHA 1FXXA 5JS2A 3HM9A 4OPKA 4NYNA 4DFKA 3NDKA 3LP0A 4JLHA 1WN7A 1IG9A 2JLEA 4FJHA 1UWBA 4FCYA 3QNNA 1RBVA 4DF8A 1LWFA 3ZSYA 3THVA 3L2RA 3IAYA 3AVBA 3VQAA 3HPHA 4KREA 3P5JA 1J5OA 4O55A 4B9SA 4JS4A 3KD5E 2ITGA 2HHXA 2X74A 3PY8A 3DLGA 4I9LA 3CFOA 4FM2A 4OVLA 4B9NA 5C25A 4FJMA 1QSLA 2G8UA 2D0AA 4DTMA 3NH1A 3V1RA 4E7HA 5J2QA 4LD0A 1S9GA 4M3WA 3ZSOA 2RN2A 3OYBA 4DTSA 2PZSA 1IKVA 4UQGA 4AILC 1REVA 1LW2A 1LAWA 1W9HA 3V9XA 2XHBA 4DTNA 4RG8A 4E0DA 2YKNA 4CF0A 3LDSA 1EP4A 1NOZA 2KW4A 3HVTA 4O5BA 1GOBA 3SQ2A 3NF6A 1XC9A 1SL2A 2PYJA 3HP6A 3C95A 2ZD1A 3VQ6A 1KVBA 2I5JA 3D0PA 4OPJA 5D3GA 3RMDA 4CF8A 3M8RA 3NCIA 3KLHA 1VRTA 3OY9A 4F2SA 4KI6A 3MEGA 1KFDA 1ITGA 4CGHA 1VSMA 3AVHA 1QS4A 1NK6A 4CK2A 4F2RA 3MEEA 1EX4A 4M3RA 3RTVA 1Y97A 3QEVA 2HHVA 1C0MA 1LW0A 3V9ZA 3SNNA 4I2QA 4I9QA 2A1SA 3RRGA 3AVFA 1CLQA 2HHWA 1F21A 4EP4A 3SPZA 3S3OA 3HP9A 5KI6A 4LSLA 4CJ5A 1GOAA 4FJKA 2XY8A 1S5JA 3G0ZA 5CY4A 3T19A 2G8VA 4B9TA 3HK2A 3U3YA 3LP2A 3OYKA 3WNHA 4ZHRA 3HVRA 3O4QA 1JL2A 1KVCA 2VG6A 3WNGA 1UOCA 1SKWA 3F9KA 3M8QA 3KK3A 2AJQA 4Z4EA 4C8NA 3IS9A 3QETA 4B9LA 3S9HA 4CEQA 1NKCA 3V1OA 2F8SA 1LV5A 1YT3A 4RW9A 4EZ6A 1FKPA 2XO7A 3NE6A 3VN5A 2Y1JA 4DSEA 2HW3A 4KTQA 1HJRA 3LP3A 3U6FA 3OJUA 1RNHA 1D5AA 1RT5A 4PY5A 1JLAA 4ID1A 4PQUA 2KTQA 3CYMA 3OS1A 3JSMA 1T05A 3D45A 3ZT1A 4E7KA 4KHNA 4N41A 5EU7A 3VQBA 4OKEA 2KQ2A 4K8XA 4MFBA 3OS2A 2HHTA 1CZBA 3MEDA 4AHTA 2OYQA 3C94A 4O4GA 4QOZB 2B4JA 2OPSA 4ID5A 4C8LA 4Z4HA 4CF2A 1IKXA 3VQDA 1JLCA 3OYFA 3DLKA 4CIEA 2DFFA 3M8SA 2VG7A 5CZ1A 1ZYQA 4C8KA 1A5VA 3ZT3A 3CFPA 1B92A 4AH9A 1HNVA 4KTWA 1HQEA 3AVJA 4CJ4A 3OYEA 1RT7A 1C0UA 4CGGA 4ICLA 3OYLA 3K5MA 3PV8A 4DFPA 4M3UA 2A1RA 4FK2A 3DLHA 3LP1A 1S1TA 4FW2A 1C1AA 3VQ9A 1HRHA 2LSNA 2XY7A 4J2DA 4FJGA 1T7PA 4L8RB 4OLBA 1RTIA 3AVLA 1RCHA 2B5JA 3TAFA 1RDBA 2YNHA 1K6YA 4M41A 2DFEA 4E7IA 1NK4A 3CQ8A 4JS5A 3V9WA 2G8KA 1TAQA 2HNDA 4Y1DA 4FLXA 4CEZA 2P5GA 4CIGA 1SL1A 2X78A 1BGXT 3LPUA 4B8CA 3ALYA 3L2VA 1T8EA 3MXJA 5J2MA 1XI1A 4M3YA 2KFZA 4NYFA 1ZBUA 5HROA 1U48A 4CCHA 5JS1A 2HVIA 3AVMA 4HHTA 4FJ5A 1KVAA 1X9MA 1NJXA 4KHSA 1WAFA 2GBZA 3K58A 4Z0UA 1L3UA 1RTJA 2FC0A 3VQ4A 4DQQA 3V9SA 1CXUA 2BE2A 2FBVA 3EZ5A 3QESA 3PO5A 1BQMA 4DQPA 1YVUA 1BCMA 3TR8A 3ZT2A 3VQ7A 1B9FA 1BQNA 4E1NA 1NKEA 1Q9YA 3MXMA 4DWIA 1QE1A 3JYTA 4DQRA 4FJJA 4C8MA 4DG1A 5J2NA 5FDLA 1RBTA 3KK1A 1RT1A 4CGIA 1NK9A 3TARA 5DMRA 1TKDA 1RTDA 2G8FA 3KD1E 5CYMA 1QHTA 4H8KA 4HUGA 4KHQA 1VSFA 4AHCA 1NK7A 4CJVA 3VQCA 4J2AA 1FK9A 3NHGA 4BDYA 1TKZA 2X6NA 4HCBA 4FK4A 3AVCA 1TV6A 2Z1JA 3AVKA 1NOYA 5J2PA 1QSYA 3NAEA 1NJZA 2DTUA 4DQIA 5CYQA 4KB1A 3AO5A 3L8BA 3KKSA 3I0RA 4KAZA 1RDAA 1Q8IA 1J9AA 1WAJA 1TK8A 4OGEA 5FROA 2XY6A 3CM5A 3HL8A 3LWMA 1SKSA 1SKRA 3B6PA 4BDPA 2YHAA 3AVGA 3WNEA 3TAGA 1JXEA 3AO2A 3SPYA 3KLIA 2IAJA 3K57A 4DF4A 3RWUA 3PO4A 5KGWA 3HJFA 4FLZA 3ZT0A 1UA0A 1SL0A 2KZMA 3QIPA 3L3VA 4CHQA 3P83D 3AO4A 1JLQA 3V6DA 3SZ2A 2HMIA 1VK0A 4E89A 2P51A 3VQQA 4CJFA 3PX0A 1DLOA 1S6QA 4E1MA 5KRTA 3DLBA 4KB0A 4OLAA 1TL1A 1N6QA 1I39A 5HRNA 3HPOA 4DLEA 2YHBA 3ZCMA 4DFMA 3K5NA 1L3SA 2P5OA 4CHNA 2IGIA 1VSHA 3HYFA 2R7YA 4C8OA 3MXIA 4F3OA 1RBSA 4KO0A 1IKYA 3L3UA 4DTOA 3RMCA 3SI6A 1A5XA 1CXQA 3SQ1A 3TWHA 2HB5A 1L3VA 1MU2A 4J2BA 4B08A 3O3FA 2F96A 3PUFA 3A2FA 3IG1A 3TAMA 4ZTFA 5HRRA 4M45A 1QQCA 1KCFA 1RT3A 4PUOA 4CGJA 1HPZA 2G8HA 3CG7A 1U47A 4IG0A 1B9DA 3RRHA 3QO9A 4BACA 5E41A 2IOCA 4DU3A 2EX3A 3QINA 4KRFA 3VA3A 3AVNA 2RF2A 1IKWA 4CHYA 3QNOA 3F73A 4OKKA 3K2PA 1D9DA 5FRMA 2QXFA 3TAQA 1YTAA 1JL1A 4E3SA 3RR8A 2QK9A 1RDDA 1CZ9A 2WONA 3KLGA 4FW1A 4NCBA 2OZSA 1BL3A 3TABA 4CIFA 1I3AA 4MQ3A 4FJLA 4QCLA 1IH7A 3AA3A 3AO3A 4CEOA 1KLNA 1A5WA 1BIZA 4Z4GA 3VQEA 3KJVA 3QEWA 2XY5A 3KIOA 5C42A 3SUOA 4FJ8A 1UAXA 5HBMA 4NCAA 1BCOA 2W42A 4ELTA 4AHUA 3SUPA 5K14A 3NFAA 4OKJA 3NGZA 4N5SA 3VQPA 3OYGA 3OS0A 3SCXA 1ASUA 1BHLA 2HHUA 4W5TA 2ZE2A 4N56A 4K8ZA 3ZSVA 4M3ZA 3AA4A 1HQUA 3OYDA 1KRPA 3VQ5A 4FLYA 4Z4IA 3M8PA 3S3NA 3EY1A 4J2EA 4FVMA 4B3OA 2ATQA 1RT6A 1JLEA 2GV9A 4CK1A 4I7FA 4TSXA 3NF7A 1VSKA 4IBNA 3NH2A 2PYLA 4FJIA 2F8TA 2HHQA 2HHSA 4EP5A 3O3GA 4PA1A 4CF9A 4CEBA 4W5QA 5FRNA 1S1WA 1WSFA 4H4MA 3AA5X 3K5OA 1WLJA 3EYZA 3HSTB 3ULDA 3SJJA 3ZSQA 4W5RA 3V1QA 1JXBA 3TI0A 1L5UA 4DSJA 3I0SA 1GOCA 1QSSA 3AA2A 3OVNA 3HT3A 1RBUA 4CJRA 4G1QA 2ZQBA 4LSNA 1NJYA 4CEFA 4CFDA 4RW6A 1TVRA 2D0BA 5HRSA 1ZBIA 1U49A 1R0AA 4KFBA 4DMNA 4DU4A 3DRRA 2KZZA 3V9UA 1VSJA 4E7LA 1EKEA 3OJSA 4CHZA 1QTMA 2G8WA 1BI4B 4HVJA 4FXDA 3CFRA 1RT2A 4FZYA 3UIQA 3TAEA 1HYVA 3HPGA 4CEDA 4NCGA 1EETA 2HNYA 2D5RA 1VSLA 3T3FA 4CJSA 4ZTJA 3LZIA 2YNFA 1C1BA 3OYAA 4HTUA 3VA0A 4LH4A 3VQ8A 2VWKA 4FZXC 4R5PA 4E19A 4E7JA 1WSIA 2BANA 5SWMA 1WSHA 1XHZA 4FJ9A 1WNSA 3QLHA 2YV0X 4FJXA 4CHPA 1ZBFA 3V81A 4CE9A 4CFBA 3HO1A 2GUIA 4BE2A 3S3MA 4GMJB 3MECA 1KTQA 2FBTA 2IDOA 3KK2A 3I8DA 4DSFA 3ZSXA 3DI6A 3SV4A 4H4OA 5HP1A 1TK0A 4M3XA 1VSEA 3DLEA 2HNZA 4I2PA 3ZSRA 4W5OA 4Z4FA 1U4BA 4CF1A 3K59A 3H08A 2FBYA 4CJPA 1DTQA 3SUQA 2E6MA 3E01A 1D8YA 4FLWA 4XIUA 3ZT4A 2JGUA 1XHXA 4Y1CA 1S9EA 3ASMA 3DOLA 3DRSA 4FM1A 3NF8A 3LZJA 1C1CA 2EHGA 4CESA 5HLFA 2RKIA 3SUNA 1RTHA 4FYDA 3NBPA 4CJWA 3SQ4A 4Z4CA 4DTJA 3QEXA 5SZTA 5I3UA 3AVIA 1JLGA 3LALA 3ZSZA 4M3TA 4OGCA 4KHWA 1SUQA 1RDCA 1KFSA 4BWJA 4OJRA 4CEEA 1N5YA 4FK0A 1X9WA 4KTZA 4EZ9A 1KSPA 2O4IA 1VSDA 3SV3A 3O3HA 2KFNA 4RW7A 4AHSA 1BIUA 1TL3A 4CFAA 1Z25A 1HNIA 2P1JA 4CJKA 3G10A 3IRXA 3CM6A 5DK5A 3U3GA 3AV9A 3C6UA 2Z1HA 3V4IA 4CGFA 4DSKA 3PX4A 1S1VA 4F8RA 4KHYA 1ZBLA 1C0TA 1JKHA 1HMVA 4HUFA 5KRSA 1X9SA 1LAVA 3C6TA 1DTTA 1J53A 3K5LA 3SYZA 4DTUA 4JRQA 2Q3SA 4KV8A 4DU1A 4RW8A 3BDPA 4CGDA 3OYMA 4Q5VA 3BGRA 1O1WA 3OYCA 3L2WA 4B9MA 1RBRA 3QEPA 4HCCA 4JRPA 2WOMA 3KKRA 3PX6A 3SQ0A 4RW4A 5KTQA 3OYIA 3TANA 3RMBA 3LAMA 4DTRA 3NF9A 3NGYA 2BDPA 1BISA 5KGXA 2B6AA 1TGOA 5I42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFH A;  2YNG A;  3ZSW A;  1VSI A;  4FLT A;  1NK0 A;  3DRP A;  1KLM A;  1LWE A;  1U04 A;  3MAQ A;  4AHV A;  4CHO A;  5CZ2 A;  4B9U A;  4DS5 A;  2Y1I A;  4CER A;  1U45 A;  1S6P A;  1S1U A;  5C24 A;  4N76 A;  3QER A;  3OYN A;  2E4L A;  3DYA A;  3LAK A;  1NK8 A;  1C6V A;  4F3T A;  2VG5 A;  1NKB A;  4AHR A;  2FBX A;  2YNI A;  3TAP A;  1IO2 A;  1WSE A;  2Z1I A;  4YFU A;  3AO1 A;  2Z1G A;  1YTU A;  4FZZ A;  1W0H A;  2OPQ A;  4BDZ A;  1TAU A;  1WSG A;  1X1P A;  1ZBH A;  3LPT A;  1HYZ A;  4DS4 A;  4CJL A;  1XWL A;  2OPP A;  3LAN A;  2DY4 A;  1ASV A;  2NUB A;  4GVM A;  4CJ3 A;  3L2Q A;  3AVA A;  4WE1 A;  5HRP A;  4FM0 A;  4PWD A;  4QAG A;  4CK3 A;  4ELU A;  4CEC A;  4BE0 A;  1RIL A;  3OYH A;  4IFV A;  5J1E A;  3ISN C;  2QKK A;  4B9V A;  4GW6 A;  2E6L A;  2VWJ A;  3B6O A;  4ELV A;  4CJQ A;  1T03 A;  2D0C A;  1S1X A;  3ITH A;  1Z26 A;  3QEI A;  1L3T A;  1SV5 A;  3WNF A;  2X6S A;  4CJT A;  2QKB A;  1WSJ A;  3OYJ A;  4HUE A;  1BI4 A;  2OZM A;  4LH5 A;  3KTQ A;  1RT4 A;  4DFJ A;  2OA8 A;  1TK5 A;  3KLE A;  3DMJ A;  1J54 A;  3L2U A;  1ASW A;  2YKM A;  2PY5 A;  1NJW A;  4F4K A;  4IG3 A;  2ETJ A;  2BGG A;  4FJ7 A;  3RR7 A;  4Q0B A;  3RMA A;  1LWC A;  2IC3 A;  4W5N A;  4M42 A;  3DLR A;  3DM2 A;  3HXM A;  1VRU A;  4N47 A;  3LWL A;  4DSI A;  1D9F A;  3FFI A;  4FLU A;  4KPY A;  1JLB A;  4DTX A;  1FKO A;  3NGI A;  1NK5 A;  4BE1 A;  4YNQ A;  4FLV A;  2O4G A;  2IS3 A;  4B8A B;  3T1A A;  4DSL A;  4KI4 A;  4KHU A;  3DOK A;  4IDK A;  1UA1 A;  4O0J A;  4DTP A;  3QIO A;  4O44 A;  2RPI A;  1EXQ A;  1TKX A;  4CEA A;  3O4N A;  1HYS A;  4KKO A;  2G8I A;  2XRI A;  1G15 A;  4O0I A;  4IKF A;  4IFY A;  1TKT A;  2OPR A;  4LY7 A;  4FJN A;  3P1G A;  1JLF A;  4CJE A;  1Q9X A;  3NH0 A;  4CJU A;  4DQS A;  4BWM A;  4DLG A;  5T7B A;  3KLF A;  4CFC A;  2HVH A;  1FXX A;  5JS2 A;  3HM9 A;  4OPK A;  4NYN A;  4DFK A;  3NDK A;  3LP0 A;  4JLH A;  1WN7 A;  1IG9 A;  2JLE A;  4FJH A;  1UWB A;  4FCY A;  3QNN A;  1RBV A;  4DF8 A;  1LWF A;  3ZSY A;  3THV A;  3L2R A;  3IAY A;  3AVB A;  3VQA A;  3HPH A;  4KRE A;  3P5J A;  1J5O A;  4O55 A;  4B9S A;  4JS4 A;  3KD5 E;  2ITG A;  2HHX A;  2X74 A;  3PY8 A;  3DLG A;  4I9L A;  3CFO A;  4FM2 A;  4OVL A;  4B9N A;  5C25 A;  4FJM A;  1QSL A;  2G8U A;  2D0A A;  4DTM A;  3NH1 A;  3V1R A;  4E7H A;  5J2Q A;  4LD0 A;  1S9G A;  4M3W A;  3ZSO A;  2RN2 A;  3OYB A;  4DTS A;  2PZS A;  1IKV A;  4UQG A;  4AIL C;  1REV A;  1LW2 A;  1LAW A;  1W9H A;  3V9X A;  2XHB A;  4DTN A;  4RG8 A;  4E0D A;  2YKN A;  4CF0 A;  3LDS A;  1EP4 A;  1NOZ A;  2KW4 A;  3HVT A;  4O5B A;  1GOB A;  3SQ2 A;  3NF6 A;  1XC9 A;  1SL2 A;  2PYJ A;  3HP6 A;  3C95 A;  2ZD1 A;  3VQ6 A;  1KVB A;  2I5J A;  3D0P A;  4OPJ A;  5D3G A;  3RMD A;  4CF8 A;  3M8R A;  3NCI A;  3KLH A;  1VRT A;  3OY9 A;  4F2S A;  4KI6 A;  3MEG A;  1KFD A;  1ITG A;  4CGH A;  1VSM A;  3AVH A;  1QS4 A;  1NK6 A;  4CK2 A;  4F2R A;  3MEE A;  1EX4 A;  4M3R A;  3RTV A;  1Y97 A;  3QEV A;  2HHV A;  1C0M A;  1LW0 A;  3V9Z A;  3SNN A;  4I2Q A;  4I9Q A;  2A1S A;  3RRG A;  3AVF A;  1CLQ A;  2HHW A;  1F21 A;  4EP4 A;  3SPZ A;  3S3O A;  3HP9 A;  5KI6 A;  4LSL A;  4CJ5 A;  1GOA A;  4FJK A;  2XY8 A;  1S5J A;  3G0Z A;  5CY4 A;  3T19 A;  2G8V A;  4B9T A;  3HK2 A;  3U3Y A;  3LP2 A;  3OYK A;  3WNH A;  4ZHR A;  3HVR A;  3O4Q A;  1JL2 A;  1KVC A;  2VG6 A;  3WNG A;  1UOC A;  1SKW A;  3F9K A;  3M8Q A;  3KK3 A;  2AJQ A;  4Z4E A;  4C8N A;  3IS9 A;  3QET A;  4B9L A;  3S9H A;  4CEQ A;  1NKC A;  3V1O A;  2F8S A;  1LV5 A;  1YT3 A;  4RW9 A;  4EZ6 A;  1FKP A;  2XO7 A;  3NE6 A;  3VN5 A;  2Y1J A;  4DSE A;  2HW3 A;  4KTQ A;  1HJR A;  3LP3 A;  3U6F A;  3OJU A;  1RNH A;  1D5A A;  1RT5 A;  4PY5 A;  1JLA A;  4ID1 A;  4PQU A;  2KTQ A;  3CYM A;  3OS1 A;  3JSM A;  1T05 A;  3D45 A;  3ZT1 A;  4E7K A;  4KHN A;  4N41 A;  5EU7 A;  3VQB A;  4OKE A;  2KQ2 A;  4K8X A;  4MFB A;  3OS2 A;  2HHT A;  1CZB A;  3MED A;  4AHT A;  2OYQ A;  3C94 A;  4O4G A;  4QOZ B;  2B4J A;  2OPS A;  4ID5 A;  4C8L A;  4Z4H A;  4CF2 A;  1IKX A;  3VQD A;  1JLC A;  3OYF A;  3DLK A;  4CIE A;  2DFF A;  3M8S A;  2VG7 A;  5CZ1 A;  1ZYQ A;  4C8K A;  1A5V A;  3ZT3 A;  3CFP A;  1B92 A;  4AH9 A;  1HNV A;  4KTW A;  1HQE A;  3AVJ A;  4CJ4 A;  3OYE A;  1RT7 A;  1C0U A;  4CGG A;  4ICL A;  3OYL A;  3K5M A;  3PV8 A;  4DFP A;  4M3U A;  2A1R A;  4FK2 A;  3DLH A;  3LP1 A;  1S1T A;  4FW2 A;  1C1A A;  3VQ9 A;  1HRH A;  2LSN A;  2XY7 A;  4J2D A;  4FJG A;  1T7P A;  4L8R B;  4OLB A;  1RTI A;  3AVL A;  1RCH A;  2B5J A;  3TAF A;  1RDB A;  2YNH A;  1K6Y A;  4M41 A;  2DFE A;  4E7I A;  1NK4 A;  3CQ8 A;  4JS5 A;  3V9W A;  2G8K A;  1TAQ A;  2HND A;  4Y1D A;  4FLX A;  4CEZ A;  2P5G A;  4CIG A;  1SL1 A;  2X78 A;  1BGX T;  3LPU A;  4B8C A;  3ALY A;  3L2V A;  1T8E A;  3MXJ A;  5J2M A;  1XI1 A;  4M3Y A;  2KFZ A;  4NYF A;  1ZBU A;  5HRO A;  1U48 A;  4CCH A;  5JS1 A;  2HVI A;  3AVM A;  4HHT A;  4FJ5 A;  1KVA A;  1X9M A;  1NJX A;  4KHS A;  1WAF A;  2GBZ A;  3K58 A;  4Z0U A;  1L3U A;  1RTJ A;  2FC0 A;  3VQ4 A;  4DQQ A;  3V9S A;  1CXU A;  2BE2 A;  2FBV A;  3EZ5 A;  3QES A;  3PO5 A;  1BQM A;  4DQP A;  1YVU A;  1BCM A;  3TR8 A;  3ZT2 A;  3VQ7 A;  1B9F A;  1BQN A;  4E1N A;  1NKE A;  1Q9Y A;  3MXM A;  4DWI A;  1QE1 A;  3JYT A;  4DQR A;  4FJJ A;  4C8M A;  4DG1 A;  5J2N A;  5FDL A;  1RBT A;  3KK1 A;  1RT1 A;  4CGI A;  1NK9 A;  3TAR A;  5DMR A;  1TKD A;  1RTD A;  2G8F A;  3KD1 E;  5CYM A;  1QHT A;  4H8K A;  4HUG A;  4KHQ A;  1VSF A;  4AHC A;  1NK7 A;  4CJV A;  3VQC A;  4J2A A;  1FK9 A;  3NHG A;  4BDY A;  1TKZ A;  2X6N A;  4HCB A;  4FK4 A;  3AVC A;  1TV6 A;  2Z1J A;  3AVK A;  1NOY A;  5J2P A;  1QSY A;  3NAE A;  1NJZ A;  2DTU A;  4DQI A;  5CYQ A;  4KB1 A;  3AO5 A;  3L8B A;  3KKS A;  3I0R A;  4KAZ A;  1RDA A;  1Q8I A;  1J9A A;  1WAJ A;  1TK8 A;  4OGE A;  5FRO A;  2XY6 A;  3CM5 A;  3HL8 A;  3LWM A;  1SKS A;  1SKR A;  3B6P A;  4BDP A;  2YHA A;  3AVG A;  3WNE A;  3TAG A;  1JXE A;  3AO2 A;  3SPY A;  3KLI A;  2IAJ A;  3K57 A;  4DF4 A;  3RWU A;  3PO4 A;  5KGW A;  3HJF A;  4FLZ A;  3ZT0 A;  1UA0 A;  1SL0 A;  2KZM A;  3QIP A;  3L3V A;  4CHQ A;  3P83 D;  3AO4 A;  1JLQ A;  3V6D A;  3SZ2 A;  2HMI A;  1VK0 A;  4E89 A;  2P51 A;  3VQQ A;  4CJF A;  3PX0 A;  1DLO A;  1S6Q A;  4E1M A;  5KRT A;  3DLB A;  4KB0 A;  4OLA A;  1TL1 A;  1N6Q A;  1I39 A;  5HRN A;  3HPO A;  4DLE A;  2YHB A;  3ZCM A;  4DFM A;  3K5N A;  1L3S A;  2P5O A;  4CHN A;  2IGI A;  1VSH A;  3HYF A;  2R7Y A;  4C8O A;  3MXI A;  4F3O A;  1RBS A;  4KO0 A;  1IKY A;  3L3U A;  4DTO A;  3RMC A;  3SI6 A;  1A5X A;  1CXQ A;  3SQ1 A;  3TWH A;  2HB5 A;  1L3V A;  1MU2 A;  4J2B A;  4B08 A;  3O3F A;  2F96 A;  3PUF A;  3A2F A;  3IG1 A;  3TAM A;  4ZTF A;  5HRR A;  4M45 A;  1QQC A;  1KCF A;  1RT3 A;  4PUO A;  4CGJ A;  1HPZ A;  2G8H A;  3CG7 A;  1U47 A;  4IG0 A;  1B9D A;  3RRH A;  3QO9 A;  4BAC A;  5E41 A;  2IOC A;  4DU3 A;  2EX3 A;  3QIN A;  4KRF A;  3VA3 A;  3AVN A;  2RF2 A;  1IKW A;  4CHY A;  3QNO A;  3F73 A;  4OKK A;  3K2P A;  1D9D A;  5FRM A;  2QXF A;  3TAQ A;  1YTA A;  1JL1 A;  4E3S A;  3RR8 A;  2QK9 A;  1RDD A;  1CZ9 A;  2WON A;  3KLG A;  4FW1 A;  4NCB A;  2OZS A;  1BL3 A;  3TAB A;  4CIF A;  1I3A A;  4MQ3 A;  4FJL A;  4QCL A;  1IH7 A;  3AA3 A;  3AO3 A;  4CEO A;  1KLN A;  1A5W A;  1BIZ A;  4Z4G A;  3VQE A;  3KJV A;  3QEW A;  2XY5 A;  3KIO A;  5C42 A;  3SUO A;  4FJ8 A;  1UAX A;  5HBM A;  4NCA A;  1BCO A;  2W42 A;  4ELT A;  4AHU A;  3SUP A;  5K14 A;  3NFA A;  4OKJ A;  3NGZ A;  4N5S A;  3VQP A;  3OYG A;  3OS0 A;  3SCX A;  1ASU A;  1BHL A;  2HHU A;  4W5T A;  2ZE2 A;  4N56 A;  4K8Z A;  3ZSV A;  4M3Z A;  3AA4 A;  1HQU A;  3OYD A;  1KRP A;  3VQ5 A;  4FLY A;  4Z4I A;  3M8P A;  3S3N A;  3EY1 A;  4J2E A;  4FVM A;  4B3O A;  2ATQ A;  1RT6 A;  1JLE A;  2GV9 A;  4CK1 A;  4I7F A;  4TSX A;  3NF7 A;  1VSK A;  4IBN A;  3NH2 A;  2PYL A;  4FJI A;  2F8T A;  2HHQ A;  2HHS A;  4EP5 A;  3O3G A;  4PA1 A;  4CF9 A;  4CEB A;  4W5Q A;  5FRN A;  1S1W A;  1WSF A;  4H4M A;  3AA5 X;  3K5O A;  1WLJ A;  3EYZ A;  3HST B;  3ULD A;  3SJJ A;  3ZSQ A;  4W5R A;  3V1Q A;  1JXB A;  3TI0 A;  1L5U A;  4DSJ A;  3I0S A;  1GOC A;  1QSS A;  3AA2 A;  3OVN A;  3HT3 A;  1RBU A;  4CJR A;  4G1Q A;  2ZQB A;  4LSN A;  1NJY A;  4CEF A;  4CFD A;  4RW6 A;  1TVR A;  2D0B A;  5HRS A;  1ZBI A;  1U49 A;  1R0A A;  4KFB A;  4DMN A;  4DU4 A;  3DRR A;  2KZZ A;  3V9U A;  1VSJ A;  4E7L A;  1EKE A;  3OJS A;  4CHZ A;  1QTM A;  2G8W A;  1BI4 B;  4HVJ A;  4FXD A;  3CFR A;  1RT2 A;  4FZY A;  3UIQ A;  3TAE A;  1HYV A;  3HPG A;  4CED A;  4NCG A;  1EET A;  2HNY A;  2D5R A;  1VSL A;  3T3F A;  4CJS A;  4ZTJ A;  3LZI A;  2YNF A;  1C1B A;  3OYA A;  4HTU A;  3VA0 A;  4LH4 A;  3VQ8 A;  2VWK A;  4FZX C;  4R5P A;  4E19 A;  4E7J A;  1WSI A;  2BAN A;  5SWM A;  1WSH A;  1XHZ A;  4FJ9 A;  1WNS A;  3QLH A;  2YV0 X;  4FJX A;  4CHP A;  1ZBF A;  3V81 A;  4CE9 A;  4CFB A;  3HO1 A;  2GUI A;  4BE2 A;  3S3M A;  4GMJ B;  3MEC A;  1KTQ A;  2FBT A;  2IDO A;  3KK2 A;  3I8D A;  4DSF A;  3ZSX A;  3DI6 A;  3SV4 A;  4H4O A;  5HP1 A;  1TK0 A;  4M3X A;  1VSE A;  3DLE A;  2HNZ A;  4I2P A;  3ZSR A;  4W5O A;  4Z4F A;  1U4B A;  4CF1 A;  3K59 A;  3H08 A;  2FBY A;  4CJP A;  1DTQ A;  3SUQ A;  2E6M A;  3E01 A;  1D8Y A;  4FLW A;  4XIU A;  3ZT4 A;  2JGU A;  1XHX A;  4Y1C A;  1S9E A;  3ASM A;  3DOL A;  3DRS A;  4FM1 A;  3NF8 A;  3LZJ A;  1C1C A;  2EHG A;  4CES A;  5HLF A;  2RKI A;  3SUN A;  1RTH A;  4FYD A;  3NBP A;  4CJW A;  3SQ4 A;  4Z4C A;  4DTJ A;  3QEX A;  5SZT A;  5I3U A;  3AVI A;  1JLG A;  3LAL A;  3ZSZ A;  4M3T A;  4OGC A;  4KHW A;  1SUQ A;  1RDC A;  1KFS A;  4BWJ A;  4OJR A;  4CEE A;  1N5Y A;  4FK0 A;  1X9W A;  4KTZ A;  4EZ9 A;  1KSP A;  2O4I A;  1VSD A;  3SV3 A;  3O3H A;  2KFN A;  4RW7 A;  4AHS A;  1BIU A;  1TL3 A;  4CFA A;  1Z25 A;  1HNI A;  2P1J A;  4CJK A;  3G10 A;  3IRX A;  3CM6 A;  5DK5 A;  3U3G A;  3AV9 A;  3C6U A;  2Z1H A;  3V4I A;  4CGF A;  4DSK A;  3PX4 A;  1S1V A;  4F8R A;  4KHY A;  1ZBL A;  1C0T A;  1JKH A;  1HMV A;  4HUF A;  5KRS A;  1X9S A;  1LAV A;  3C6T A;  1DTT A;  1J53 A;  3K5L A;  3SYZ A;  4DTU A;  4JRQ A;  2Q3S A;  4KV8 A;  4DU1 A;  4RW8 A;  3BDP A;  4CGD A;  3OYM A;  4Q5V A;  3BGR A;  1O1W A;  3OYC A;  3L2W A;  4B9M A;  1RBR A;  3QEP A;  4HCC A;  4JRP A;  2WOM A;  3KKR A;  3PX6 A;  3SQ0 A;  4RW4 A;  5KTQ A;  3OYI A;  3TAN A;  3RMB A;  3LAM A;  4DTR A;  3NF9 A;  3NGY A;  2BDP A;  1BIS A;  5KGX A;  2B6A A;  1TGO A;  5I42 A; 
#chains in the Genus database with same CATH topology
 4KH4 A;  2DFH A;  1X9J A;  1SAZ A;  1LWE A;  1K8A O;  3PSF A;  2Y1I A;  3PSI A;  1S6P A;  4N76 A;  5A2Q O;  3LAK A;  1C6V A;  3FE1 A;  1NKB A;  1WSE A;  1BWF O;  4JAX A;  4U67 L;  3K9J A;  4H03 B;  4CJL A;  1XWL A;  2OPP A;  3I8B A;  1TYQ A;  2NUB A;  4CZG A;  3DWL A;  3N4Q A;  3AVA A;  4ISF A;  1GLE G;  1HJO A;  4BE0 A;  4JK9 A;  3OYH A;  4AF1 A;  5FPE A;  4H5R A;  2E6L A;  4ILJ A;  3CPW M;  4IWV A;  1YJN N;  2D0C A;  1VQM N;  3CC2 N;  1S1X A;  3ITH A;  3QEI A;  3O9S A;  4CJT A;  1WSJ A;  5CR4 A;  1NGD A;  1BI4 A;  1RT4 A;  4NXN K;  1TK5 A;  3L2U A;  2ETJ A;  3CQY A;  4FWM A;  4FJ7 A;  2QTD A;  3WXM B;  3HXM A;  1VRU A;  3LWL A;  4JKG A;  1NWK A;  3OBY A;  5FPN A;  4KI4 A;  4YNQ A;  3THY B;  4DTP A;  3QIO A;  3RSE A;  3R3L A;  2Q2R A;  4KKO A;  1G15 A;  2YJF A;  3I33 A;  4BRG A;  4FWS A;  4LF8 K;  4CJE A;  4A62 A;  3HOS A;  1OH7 A;  4C1N K;  4BWM A;  4CFC A;  5JS2 A;  3HM9 A;  4EFH A;  3NDK A;  1IG9 A;  5AQL A;  2P9I B;  3WXK A;  3BF1 A;  4WFB L;  1LWF A;  3IAY A;  4KRE A;  3KWG A;  3P5J A;  5AQK A;  4BRM A;  3AY9 A;  5GAE P;  3DLG A;  3QFP A;  2W40 A;  3QBX A;  4BRL A;  2W41 A;  1QSL A;  3J80 O;  3HOT A;  2O8F B;  1ZC6 A;  4M3W A;  3MN5 A;  1IKV A;  4AIL C;  1REV A;  4KH6 A;  3V9X A;  3FZH A;  2XHB A;  4DTN A;  4XH1 A;  4CF0 A;  4F4K A;  2KW4 A;  1XC9 A;  1SL2 A;  3HP6 A;  2ZD1 A;  3VQ6 A;  4CJ7 A;  3RMD A;  2QWL A;  4BRK A;  3M8R A;  4DV4 K;  3OY9 A;  4NXM K;  1ITG A;  4YOT A;  3AVH A;  1QS4 A;  5KPZ A;  3KWI A;  3U9D A;  2HHV A;  3A5L C;  3O08 A;  3SNN A;  5C12 A;  3AVF A;  1F21 A;  4EP4 A;  3SPZ A;  3P4I A;  1HKG A;  3HP9 A;  3ULE A;  1GOA A;  4K0K K;  3T19 A;  4DHY A;  3BEX A;  2VGN A;  3SK3 A;  3O4Q A;  3CCU N;  2VG6 A;  2IIR A;  3F9K A;  3MWT A;  3KK3 A;  2AJQ A;  2O8D A;  4CEQ A;  1QVG M;  5GAH P;  1LV5 A;  4BQZ A;  4EZ6 A;  3CC4 N;  4JI4 K;  1VQL N;  2HW3 A;  4KTQ A;  3LP3 A;  1D5A A;  1RT5 A;  4CD1 A;  2KTQ A;  3CYM A;  2A3Z A;  2WBN A;  3DXM A;  4KHN A;  3NVM A;  4OKE A;  4AHT A;  3E9P A;  2OYQ A;  4LC9 B;  4BRA A;  2OPS A;  4ID5 A;  3MWP A;  4CF2 A;  1JLC A;  2Q0U A;  3DLK A;  2ZJP L;  2QA4 N;  1BG3 A;  2Q97 A;  5CZ1 A;  5LL6 Z;  4CZE A;  3ZT3 A;  1ZYQ A;  1HX1 A;  3UKR A;  4KTW A;  4IJN A;  3OYL A;  1HLU A;  1C0U A;  3C7N A;  3L4I A;  2HBK A;  5M1F A;  3EKU A;  2P9U A;  3LP1 A;  3VF2 A;  3VQ9 A;  1C1A A;  2RHK A;  4J2D A;  5AQN A;  1KD1 O;  1RCH A;  4A2B A;  1RDB A;  5C10 A;  1NK4 A;  1JCG A;  1RDU A;  1TAQ A;  2P5G A;  4CEZ A;  2CGK A;  5AQT A;  4YDU A;  1T8E A;  4NYF A;  5HRO A;  2HVI A;  5JLH A;  3EZW A;  4KHS A;  4Z0U A;  3L6Q A;  2AP1 A;  4BVP A;  3CME N;  4A57 A;  3QES A;  3ZT2 A;  3VQ7 A;  5BPM A;  4E1N A;  1Q9Y A;  4CI6 A;  3MXM A;  1MWK A;  2CH5 A;  4DQR A;  4C8M A;  4DG1 A;  5J2N A;  4OO1 J;  5AQJ A;  3KK1 A;  4IEI A;  3KD1 E;  2VQF K;  1TKD A;  5ADX H;  3ZLJ A;  4IOC L;  1FK9 A;  3IKM A;  4CW7 B;  3NHG A;  4BDY A;  3AVK A;  1TV6 A;  2O8E A;  3BZC A;  5BRD A;  5J2P A;  3J7A P;  3AO5 A;  3M6G A;  3KKS A;  3IFR A;  4JKA A;  3I0R A;  1RDA A;  5AFU A;  1WAJ A;  2XY6 A;  3CM5 A;  3HL8 A;  2ZWH A;  2KHO A;  3B6P A;  4BDP A;  4DV5 K;  3AVG A;  3QFU A;  3WXJ A;  3AO2 A;  2IAJ A;  2KZM A;  3F5T A;  4CHQ A;  4M7Y A;  1K8K A;  3AO4 A;  1IBM K;  1VK0 A;  3UE5 A;  2P51 A;  4CJF A;  3PX0 A;  4E1M A;  5KRT A;  1WUA A;  2P5O A;  3HPO A;  2YHB A;  3K5N A;  4C8O A;  2IGI A;  1VSH A;  4F3O A;  3MXI A;  5C15 A;  4MLE A;  4HWI A;  1BA0 A;  4BRD A;  2D4W A;  1MU2 A;  1VQ9 N;  3I56 N;  1NGB A;  4ZTF A;  1SQK A;  3OTO K;  1QQC A;  1RT3 A;  3CG7 A;  4IG0 A;  2E88 A;  2E2P A;  4OKK A;  3JAM O;  3SJH A;  5KPR A;  3RR8 A;  1N33 K;  4PKI A;  2WON A;  2OZS A;  1NGI A;  2O8C A;  4JKH A;  1BIZ A;  3KK7 A;  4FJ8 A;  4F9O A;  1BCO A;  1YVN A;  2NRX A;  3NGZ A;  4JHD B;  3OS0 A;  1I94 K;  4OPA A;  2HHU A;  4N56 A;  3AA4 A;  3G71 N;  1MWM A;  1KRP A;  4Z4I A;  3S3N A;  3EY1 A;  4B3O A;  4MDA A;  1RT6 A;  2GV9 A;  1R59 O;  4TSX A;  2D0O A;  2F8T A;  1RFQ A;  4CF9 A;  3R1X A;  2E2Q A;  4W5Q A;  1NMD A;  3K5O A;  4BRQ A;  1WLJ A;  2GEL A;  3ZSQ A;  1S72 N;  4CBW A;  3I0S A;  2FXU A;  2PAV A;  3OVN A;  2ZGZ A;  1NJY A;  4BRP A;  4CEF A;  2FF3 B;  4WQ4 A;  2D0B A;  5HRS A;  3AGK A;  2CH6 A;  1IJJ A;  3FR0 A;  3V9U A;  3OJS A;  3CER A;  4JI8 K;  4FXD A;  2P9P A;  1RT2 A;  4FZY A;  2A42 A;  3UIQ A;  4CED A;  3T69 A;  4LF7 K;  2HNY A;  1KXP A;  5HL7 L;  3OYA A;  4LH4 A;  3L4Q A;  1Q86 O;  5SWM A;  4FJ9 A;  1WNS A;  3QLH A;  5F0X A;  5EXW A;  1M1K O;  4LF4 K;  3N4P A;  4BR2 A;  4IXC A;  3HSC A;  3D2F A;  3MCP A;  1LOT B;  3FZK A;  4GMJ B;  2FBT A;  3CCR N;  3ZSX A;  5EX5 A;  3DLE A;  4I2P A;  4CF1 A;  3TTC A;  3H08 A;  4NB4 A;  2E6M A;  1D8Y A;  4QS9 A;  4XIU A;  2JGU A;  3CCE N;  4CES A;  2NRH A;  3FZM A;  2RKI A;  2FSN A;  1NM1 A;  3C6A A;  3BP8 A;  3SQ4 A;  4DTJ A;  3QEX A;  5I3U A;  3AVI A;  4KHW A;  3G6E N;  2O4I A;  3THX A;  4KTZ A;  1VSD A;  3UKU A;  1GLD G;  3VGK A;  1MA9 B;  1EWR A;  1TL3 A;  5MLC Q;  2KFN A;  1YIT N;  3UKR B;  1HNI A;  4BG9 A;  2P1J A;  5BPN A;  5DK5 A;  3AV9 A;  2Z1H A;  4CGF A;  4DSK A;  1Z05 A;  2P9P B;  4MO4 A;  1HMV A;  4I6M B;  4AM6 A;  3WUH A;  1LAV A;  5AQH A;  1X9S A;  2UXB K;  3SYZ A;  2YCH A;  4JKG B;  4RW8 A;  1O1W A;  3L2W A;  2HMP A;  4B9M A;  1RBR A;  4O8K A;  4RCH A;  3WEE A;  2WOM A;  3KKR A;  5KTQ A;  3TAN A;  4FO0 A;  2NRZ A;  3NGY A;  1BCM A;  2BUP A;  5I42 A;  1KAZ A;  2YHX A;  2WTU A;  1NK0 A;  2UUB K;  1KLM A;  5BN8 A;  4DS5 A;  4CER A;  1U45 A;  3T7Z A;  3QER A;  2O8B B;  5GIP A;  3DYA A;  1VQ5 N;  1GLF O;  2HBL A;  4BRC A;  1YAG A;  2YNI A;  3AGR A;  3EN9 A;  3ZET B;  1YTU A;  1W0H A;  1TAU A;  1X1P A;  2Q1N A;  2DY4 A;  4OPH A;  1HNX K;  5JIC A;  4CK3 A;  4ELU A;  2GUP A;  4B9V A;  3ISN C;  3E66 A;  4GW6 A;  3FGU A;  3P38 A;  3B6O A;  4ELV A;  4GKJ K;  2HHH K;  1Z26 A;  3THX B;  2X6S A;  3OYJ A;  4FWR A;  2OA8 A;  1J54 A;  1ASW A;  1E4G T;  4DV2 K;  4IG3 A;  3RR7 A;  4Q0B A;  3M1F A;  2IC3 A;  4W5N A;  3P31 A;  1D9F A;  1JLB A;  1NK5 A;  4H0Y B;  3T1A A;  4KHU A;  4FWL A;  1QZ5 A;  3DOK A;  4IDK A;  1UA1 A;  4IDH A;  2RPI A;  2FSK A;  1TKX A;  3EL2 A;  3VER A;  2OTL N;  1BO5 O;  2G8I A;  3W3D A;  4O0I A;  4IKF A;  4IFY A;  1J6Z A;  4LY7 A;  3VTI A;  4FJN A;  1JLF A;  4DQS A;  4DV3 K;  4PL7 A;  1FXX A;  4DFK A;  5AQW A;  5C2F A;  2JWL A;  2QEX N;  1UWB A;  3CJB A;  4FCY A;  1EQY A;  1RBV A;  3T1H K;  2E2N A;  3CPE A;  3AVB A;  3HPH A;  4H0T B;  4JS4 A;  1P8Z A;  4JK7 A;  2X74 A;  4OVL A;  4MDB A;  2NRV A;  5AQY A;  3V1R A;  4E7H A;  5J2Q A;  4LD0 A;  3RSE B;  1S9G A;  3ZSO A;  4EAH D;  2HOE A;  2O8B A;  3VMF B;  4UQG A;  1LW2 A;  3RVC A;  5BRF A;  2I7N A;  3LDS A;  3JXU A;  1EP4 A;  1NJI O;  3NF6 A;  1TUU A;  1SZ2 A;  4FWQ A;  3DAW A;  2KKZ A;  1WBB A;  4QS7 A;  3WXL A;  3CD6 N;  2JWK A;  3KLH A;  1VRT A;  3MX5 A;  4KI6 A;  3CCL N;  1VQO N;  3B8A X;  4CK2 A;  1EX4 A;  4M3R A;  3A8Y A;  3QEV A;  1YXQ A;  2AA4 A;  5AQQ A;  4FWN A;  5AQI A;  2A1S A;  5EOY A;  1CLQ A;  4EHU A;  5LJW A;  1S5J A;  3G0Z A;  4B9T A;  2G8V A;  4K43 A;  3HVR A;  4JKF A;  3WNG A;  1SKW A;  1VQ8 N;  4C8N A;  3IS9 A;  4PHT X;  1NKC A;  4CZM A;  1YIJ N;  3DLL L;  4RW9 A;  2XO7 A;  3NE6 A;  4JI3 K;  1HNZ K;  4R79 A;  3IMX A;  3JS6 A;  1RNH A;  1JLA A;  3OS1 A;  2KQ2 A;  3THW B;  4K8X A;  5GAD P;  1CZB A;  2DPN A;  3C94 A;  4O4G A;  4PKG A;  3PLA A;  4C8L A;  1IKX A;  3VQD A;  1Q82 O;  4JD2 B;  1A5V A;  3OYE A;  2YHY A;  4ICL A;  4DFP A;  4M3U A;  2HBJ A;  2A1R A;  4FW2 A;  1RGI A;  4B9Q A;  4FJG A;  1P90 A;  4OLB A;  4K41 A;  3J7Z O;  4E7I A;  1K6Y A;  3SAG A;  4H5N A;  3CQ8 A;  4JI7 K;  1XNQ K;  3W0L A;  4CIG A;  1SL1 A;  1BGX T;  3LPU A;  3ALY A;  3CXC M;  2QW9 A;  5JLF A;  1BA1 A;  1U48 A;  4CCH A;  4BVO A;  4YOR A;  4FJ5 A;  3K58 A;  1HPM A;  3O4W A;  4GV9 A;  4X64 K;  2QWQ A;  1DEJ A;  4DWI A;  1QE1 A;  2VWB A;  4B1U B;  3H6E A;  5FDL A;  1RBT A;  3CJ1 A;  1NK9 A;  5DMR A;  4YOY A;  1RTD A;  4HUG A;  4BRN A;  4KHQ A;  1NK7 A;  3VQC A;  5F2R A;  4FK4 A;  1M90 O;  2Z1J A;  1NOY A;  3M3Z A;  1QSY A;  2DTU A;  5CYQ A;  5HOO A;  3L8B A;  3CCQ N;  1J9A A;  3WT0 A;  3U9Z A;  1SKR A;  3LWM A;  1IG8 A;  3KHY A;  3ID8 A;  3SPY A;  4ILH A;  3CJ7 A;  3RWU A;  3VF4 A;  5KGW A;  3HJF A;  4LF6 K;  3ZT0 A;  3LDP A;  4DUY K;  1NG9 A;  1DGK N;  1NLV A;  1JLQ A;  3VEV A;  4EHT A;  5AQM A;  3VQQ A;  1DLO A;  1S6Q A;  1OVQ A;  4OLA A;  1I39 A;  4DFM A;  1L3S A;  4CHN A;  2WUS A;  1RBS A;  1IKY A;  1QQM A;  3S41 A;  3KVG A;  3SQ1 A;  3TWH A;  3HBT A;  4DV1 K;  3O3F A;  1RDW X;  1NGJ A;  3AAR A;  3A2F A;  5M1Q A;  2ZGY A;  1HPZ A;  1U47 A;  2P9N A;  1B9D A;  2HBM A;  4A61 A;  3VGL A;  5E41 A;  2EX3 A;  1BU6 O;  3AVN A;  3VOV A;  5FRM A;  3I55 N;  1O13 A;  2V52 B;  3EEQ A;  4WQ4 C;  1YHQ N;  2V7Y A;  3TAQ A;  5AQS A;  4M7X A;  1CZ9 A;  2W6K A;  4FW1 A;  3ZX3 A;  1BL3 A;  1XNR K;  1I3A A;  4QCL A;  3AA3 A;  3AO3 A;  1A5W A;  2P9L B;  4WCE L;  4YDU C;  3QEW A;  1UAX A;  4ELT A;  3O1W A;  2E20 A;  3NFA A;  4OKJ A;  3VEX A;  3SLC A;  1K73 O;  4BGA A;  2ASM A;  4K8Z A;  3VET A;  4LF9 K;  3OYD A;  4JK8 A;  1X3N A;  5GIO A;  3M8P A;  4BGB A;  4JI5 K;  4FVM A;  3AAP A;  2ATQ A;  4DQ8 A;  4J2E A;  3G4S N;  4I7F A;  2OCE A;  3NF7 A;  3NH2 A;  2HHS A;  4EP5 A;  3BUZ B;  4PA1 A;  4CEB A;  5FRN A;  1WSF A;  4H4M A;  4DCH A;  3HRG A;  4W5R A;  3CF5 L;  3HT3 A;  4CJR A;  3VGM A;  1U49 A;  4KFB A;  4DR6 K;  4DU4 A;  3DRR A;  1VSJ A;  4CHZ A;  1QTM A;  2G8W A;  4IO9 L;  4FPB A;  2VCP A;  3CFR A;  4FOE A;  3J81 O;  2ITM A;  3IDH A;  2D5R A;  3EE9 A;  1Q18 A;  3O5B A;  2P9K A;  1NU0 A;  3VA0 A;  2Q36 A;  5DM6 L;  3CCV N;  4R5P A;  1GLL O;  1U2V A;  3ATV A;  4E7J A;  5E84 A;  2BAN A;  4XH4 A;  4XEI A;  4WF9 L;  3S3M A;  2P9L A;  4H4O A;  1TK0 A;  5CE3 A;  1U4B A;  3K59 A;  4CJP A;  1DTQ A;  5TKY A;  4AM7 A;  1D4X A;  1S9E A;  3K9K A;  3DOL A;  3LZJ A;  2VGM A;  4FYD A;  1GLA G;  4CJW A;  5SZT A;  3LAL A;  3PIP L;  4OGC A;  1X9W A;  3TSU A;  4EZ9 A;  3SV3 A;  3O3H A;  3O80 A;  1T44 A;  4RW7 A;  3H1Q A;  3TTD A;  1Z25 A;  1XMQ K;  4CJK A;  2GX9 A;  4PL8 A;  3V4I A;  5FPD A;  3PIO L;  2WC9 A;  4KHY A;  1ZBL A;  4HUF A;  5AQO A;  4DTU A;  4DU1 A;  3BDP A;  3OYM A;  4HCC A;  4BRI A;  4Z94 A;  3QEP A;  4CZK A;  3SQ0 A;  3OYI A;  3RMB A;  1IBL K;  3LAM A;  1BIS A;  5KGX A;  2B6A A;  5KQD A;  3H1V X;  1B92 A;  1TGO A;  4CZF A;  2YNG A;  3GDQ A;  2NLX A;  4FLT A;  1U04 A;  3LDN A;  4DUZ K;  3OYN A;  4F3T A;  3CET A;  2P9S B;  2VG5 A;  4FVU A;  4AHR A;  3AO1 A;  2Z1G A;  3OHR A;  2HF4 A;  4FZZ A;  1NGH A;  2OTJ N;  4DS4 A;  3FZF A;  4GY2 B;  4BR5 A;  5C2D A;  4CJ3 A;  4GVM A;  3L2Q A;  3MN6 A;  1NGG A;  4FM0 A;  4PWD A;  4CEC A;  3UKU B;  2W6L A;  4CD3 A;  2QKK A;  3LDO A;  2VWJ A;  4H0P A;  1T03 A;  2FLO A;  3BY5 A;  4QS8 A;  2GWK A;  3CQX A;  3P39 A;  3WNF A;  2ASP A;  4HUE A;  1T6D A;  4LH5 A;  3KTQ A;  4DFJ A;  1N32 K;  4O5F A;  3CI5 A;  3KLE A;  1S22 A;  2YKM A;  2BGG A;  2NRT A;  3QML A;  1HNW K;  3DLR A;  4DSI A;  3FFI A;  4DTX A;  3NGI A;  4BE1 A;  3D6R A;  4FLV A;  3CC7 N;  2IS3 A;  5M1N A;  1YUW A;  4K42 A;  5BR8 K;  4O0J A;  1LCU A;  4GVE A;  4BQL A;  5AR0 A;  2IVN A;  4CEA A;  2V51 B;  3O4N A;  3VF6 A;  4A5A A;  4GV6 A;  2XRI A;  4B3R K;  4DV6 K;  2OPR A;  2P9S A;  1VAZ A;  3C0B A;  2RE2 A;  5T7B A;  5ELZ A;  3KLF A;  2HVH A;  4FOI A;  4OPK A;  4NYN A;  2JLE A;  3ENH A;  2ZF5 O;  4FJH A;  4ISG A;  3J8A A;  3QNN A;  3ENB A;  4DF8 A;  3ZSY A;  3CJA A;  3THV A;  4J8F A;  5GAG P;  1J5O A;  1VHX A;  2ITG A;  2HHX A;  3PY8 A;  3GE1 A;  4FM2 A;  4GKK K;  4FJM A;  4B1Y B;  2D0A A;  3NH1 A;  1FJG K;  1YI2 N;  4LFC K;  2RN2 A;  4DTS A;  1U6Z A;  3WXI A;  4JEP A;  4RG8 A;  3VEN A;  4E0D A;  2ZJQ L;  3MK6 A;  3HVT A;  3WQT A;  3SQ2 A;  2PYJ A;  5AFU H;  1KVB A;  4H5T A;  4OPJ A;  2I7P A;  3NCI A;  4GNI A;  5FPM A;  2E1Z A;  3MEG A;  3ZEU A;  4F2R A;  1Z6R A;  3MEE A;  4BC3 A;  5C0Y A;  4I2Q A;  4I9Q A;  4DB3 A;  4HTL A;  2HHW A;  3MMV A;  4LSL A;  4JKD A;  4CJ5 A;  4FJK A;  2XY8 A;  4B1W B;  3U3Y A;  3OYK A;  4ZHR A;  4CZL A;  1UOC A;  4Z4E A;  5CHI A;  3QET A;  4B9L A;  3S9H A;  1ATR A;  1YT3 A;  4JI6 K;  2Y1J A;  4O8U A;  5M1O A;  1HJR A;  3U6F A;  5LMN K;  4B3S K;  1VQK N;  4PY5 A;  1VQ7 N;  2CGL A;  3BZK A;  3D45 A;  3ZT1 A;  1NBW A;  3HZ6 A;  4A59 A;  5EU7 A;  3VQB A;  2F9W A;  4AQY K;  3OS2 A;  2E5L K;  2HHT A;  3C6H A;  2V7Z A;  2ZM6 K;  4H0X B;  4QOZ B;  2B4J A;  4CIE A;  2DFF A;  3M8S A;  4DR5 K;  4H0V B;  3VTH A;  1K8K B;  1HNV A;  1HQE A;  1NGE A;  3AVJ A;  4LF5 K;  4CGG A;  3DXK B;  4IOX A;  3VEZ A;  2YHW A;  3VEY A;  3AAQ A;  2BH1 A;  4BR7 A;  4BC4 A;  3LDQ A;  3TAF A;  2YNH A;  1XC3 A;  3V9W A;  3BF3 A;  5AQU A;  3L2V A;  3MXJ A;  5LY3 A;  2ASO A;  5J2M A;  1XI1 A;  2KFZ A;  1ZBU A;  1V4T A;  4JI2 K;  3AVM A;  1CZA N;  1KVA A;  1HUX A;  1WAF A;  2GBZ A;  3A0I X;  1L3U A;  2WFB A;  2FBV A;  2BE2 A;  3A5O C;  2ZJR L;  3PO5 A;  4WYB A;  1BQM A;  1OVY A;  1YVU A;  5JVH L;  4JKB A;  2A41 A;  4BR4 A;  1B9F A;  4FJJ A;  2QXL A;  3JYT A;  1YF5 L;  1RT1 A;  5JMV A;  3TAR A;  4NLC A;  4JKC A;  5CYM A;  1QHT A;  4H8K A;  3THW A;  2YI1 A;  4AHC A;  4MO5 A;  4CJV A;  4J2A A;  4CBX A;  4DR3 K;  2A6A A;  1TKZ A;  4B1X B;  3AVC A;  1NJZ A;  4DQI A;  4IZ9 A;  5BR9 A;  4KAZ A;  1Q8I A;  4OGE A;  5JVG L;  5BN9 A;  2YJE A;  1VQP N;  2YHA A;  3WNE A;  3TAG A;  1WBD A;  3O9U A;  5BPL A;  4WQ5 C;  4FLZ A;  2NNW A;  3OW2 M;  1W97 L;  1T3V A;  3P83 D;  2HMI A;  4B1V A;  4DR7 K;  1N6Q A;  1WOQ A;  5HRN A;  1EWQ A;  2R7Y A;  1VQ6 N;  4RWT A;  5BRE A;  3L3U A;  4DTO A;  4IFE A;  3RMC A;  3SI6 A;  1CXQ A;  3CCS N;  1L3V A;  2IVP A;  5M1P A;  2F7T A;  2F96 A;  3LL3 A;  1X3M A;  5HRR A;  1KCF A;  4PUO A;  2G8H A;  4BAC A;  2QWP A;  2IOC A;  2FF6 A;  4DU3 A;  4KHP K;  1OH6 A;  3QIN A;  3MX2 A;  1S3X A;  3VA3 A;  2RF2 A;  3QNO A;  3F73 A;  1D9D A;  3K2P A;  4JV5 K;  3LM9 A;  1MDU B;  3DJC A;  1YTA A;  3ENO A;  4E3S A;  2QK9 A;  3R9P A;  3KLG A;  3E1Y A;  4MQ3 A;  4FJL A;  4A2A A;  1IH7 A;  3D2E B;  3EO3 A;  4CEO A;  4Z4G A;  2XY5 A;  5HBM A;  4NCA A;  4AHU A;  3VEW A;  5K14 A;  4PKH A;  3VQP A;  4JI1 K;  3SCX A;  1ASU A;  1BHL A;  2ZE2 A;  3ZSV A;  3GL1 A;  4M3Z A;  1HQU A;  3U4L A;  3VQ5 A;  4FLY A;  2IVO A;  1JLE A;  1XUP O;  4CK1 A;  5AZJ B;  1VSK A;  1VQN N;  4FJI A;  2HHQ A;  3THY A;  4K25 A;  3CCJ N;  4BRE A;  3C65 A;  4FWP A;  3HST B;  3ULD A;  3SJJ A;  1Y64 A;  4JNE A;  3ZEU B;  3A5N C;  1L5U A;  3AA2 A;  4CZJ A;  1RBU A;  3H45 C;  4G1Q A;  2ZQB A;  4LSN A;  4RW6 A;  3MCA B;  1WB9 A;  5AJ3 K;  4DMN A;  3L0Q A;  2P9N B;  1EKE A;  2NRR A;  3HTV A;  4HVJ A;  2UU9 K;  3O9Q A;  4DR4 K;  4FWO A;  4NCG A;  3ZYY X;  1KAY A;  2QWM A;  3G25 A;  3CMA N;  2YNF A;  1C1B A;  2O8C B;  4HTU A;  2VWK A;  4FZX C;  3ZX0 A;  3MN7 A;  4YHH K;  1ZBS A;  1XHZ A;  5AQG A;  4FJX A;  3T1Y K;  4CHP A;  3V81 A;  1G99 A;  1V4S A;  3MEC A;  1KTQ A;  4DSF A;  2IDO A;  3I8D A;  4YOW A;  3J7Y P;  3SV4 A;  5HP1 A;  3C7N B;  4M3X A;  1VSE A;  1ATS A;  2H3G X;  3ZSR A;  3CIP A;  2FBY A;  3SUQ A;  4ILG B;  2BTF A;  4IJA A;  4FLW A;  3ZT4 A;  1XHX A;  5LMU K;  4FWK A;  3ASM A;  1HR0 K;  3NF8 A;  1C1C A;  1GLJ O;  5HLF A;  4CZH A;  3SUN A;  3NMU A;  3NBP A;  4JKE A;  1JLG A;  1HKC A;  4M3T A;  1FW6 A;  1SUQ A;  1RDC A;  4BWJ A;  4CEE A;  1KSP A;  4FSV A;  2UYT A;  3VPZ A;  3G10 A;  3CM6 A;  3U3G A;  1C0F A;  3C6U A;  5AQV A;  1QVF M;  3PX4 A;  1S1V A;  4F8R A;  1C0T A;  1JKH A;  1QHA A;  5KRS A;  3QB0 A;  3K5L A;  1DTT A;  1J53 A;  2Q3S A;  4KV8 A;  4CGD A;  4JI0 K;  3BGR A;  5DM7 L;  4WFA L;  4JRP A;  4RW4 A;  3NF9 A;  2BDP A;  1E3M A;  1K9M O;  4E1J A;  3H46 O;  3ZSW A;  1VSI A;  3FZL A;  5AZI A;  3DRP A;  3MAQ A;  4AHV A;  4CHO A;  5CZ2 A;  4B9U A;  4JD2 A;  1S1U A;  5C24 A;  2E4L A;  1NK8 A;  2FBX A;  3TAP A;  1IO2 A;  2Z1I A;  4YFU A;  3R6M A;  1OKJ A;  2UUA K;  2OPQ A;  4BDZ A;  1WSG A;  4DR2 K;  1ZBH A;  4DR1 K;  3LPT A;  1HYZ A;  2CGJ A;  3QIC A;  3LAN A;  2GTD A;  3M5R A;  1ASV A;  4A5B A;  4JYA K;  4WE1 A;  5HRP A;  4QAG A;  2E1Y A;  1RIL A;  4IFV A;  5J1E A;  4CJQ A;  1N8R O;  1L3T A;  1SV5 A;  3O9R A;  2QKB A;  4BC2 A;  4WFN L;  3E9O A;  2OZM A;  4UY8 O;  4LFB K;  3Q7C A;  3DMJ A;  4C1N I;  2PY5 A;  1NJW A;  1KAX A;  5IT9 O;  3RMA A;  1LWC A;  4M42 A;  3DM2 A;  4N47 A;  1Q81 O;  4H0O A;  4FLU A;  4KPY A;  1FKO A;  4B1Z A;  2NRW A;  2O4G A;  4B8A B;  4DSL A;  4O44 A;  1EXQ A;  2D0P A;  1HYS A;  1QZ6 A;  1TKT A;  3P1G A;  1Q9X A;  3NH0 A;  4CJU A;  1YJ9 N;  4DLG A;  5AQZ A;  3LP0 A;  4JLH A;  1WN7 A;  4BRO A;  1BDG A;  4U7B A;  1TYQ B;  1IBK K;  3L2R A;  3VQA A;  4O55 A;  4B9S A;  4YY3 K;  3KD5 E;  4I9L A;  2P9K B;  3CFO A;  4B9N A;  5C25 A;  2G8U A;  4DTM A;  1Q7Y O;  4JHD A;  4NO7 A;  5AQR A;  4X66 K;  3OYB A;  1GLB G;  2PZS A;  4BY9 C;  2F4V K;  2EWS A;  1LAW A;  1W9H A;  3FLC O;  1N34 K;  2YKN A;  1NOZ A;  4O5B A;  1GOB A;  2UXC K;  4X62 K;  3SAF A;  3C95 A;  2I5J A;  3D0P A;  5D3G A;  4CF8 A;  4F2S A;  1KFD A;  4CGH A;  1VSM A;  1NK6 A;  3RTV A;  1Y97 A;  1C0M A;  1LW0 A;  1NGC A;  3V9Z A;  3RRG A;  5M1K A;  3S3O A;  5KI6 A;  2UXD K;  4LFA K;  5CY4 A;  3HK2 A;  3LP2 A;  3WNH A;  2HF3 A;  2E2O A;  1QQO A;  5LJV A;  1JL2 A;  1KVC A;  1NGF A;  3M8Q A;  3ZX2 A;  2VQE K;  4BG8 A;  3D2F B;  3IUC A;  3O6W A;  3V1O A;  2F8S A;  2QWR A;  1FKP A;  3E9L A;  1ZXO A;  3VN5 A;  1N36 K;  4DSE A;  2D1K A;  3OJU A;  2Q31 A;  4MLH A;  4ID1 A;  4PQU A;  3JSM A;  1T05 A;  4E7K A;  4N41 A;  2QM1 A;  4MFB A;  1KQS M;  3MED A;  1XQS C;  4G9Z A;  4Z4H A;  3OYF A;  3HI0 A;  2VG7 A;  4C8K A;  3CFP A;  4AH9 A;  4CJ4 A;  3DLB A;  3K5M A;  1RT7 A;  3MDQ A;  3PV8 A;  4FK2 A;  3DLH A;  3EE8 A;  1S1T A;  5AQF A;  1HRH A;  2LSN A;  1NMN A;  1T6C A;  3CJC A;  4FPA A;  4XH5 A;  2XY7 A;  1T7P A;  4L8R B;  1XMO K;  4IEE A;  1RTI A;  3AVL A;  3TPQ A;  2B5J A;  1BUP A;  3D7E O;  4M41 A;  2DFE A;  4JS5 A;  2G8K A;  2HND A;  4Y1D A;  4FLX A;  2X78 A;  3Q7B A;  4B8C A;  4V19 S;  3MN9 A;  5E26 A;  4M3Y A;  5B8H A;  5JS1 A;  4HHT A;  5BRH A;  1X9M A;  1NJX A;  1TUY A;  1RTJ A;  2FC0 A;  4H5W A;  3VQ4 A;  4DQQ A;  3EKS A;  3V9S A;  1CXU A;  3F2K A;  3EZ5 A;  4DQP A;  3TR8 A;  4X65 K;  2UUC K;  2P9U B;  1BQN A;  1W2B M;  1NKE A;  4H5V A;  5FLX O;  3ZET A;  3CJ9 A;  2J4R A;  4CGI A;  3WEE B;  2G8F A;  1VSF A;  2X6N A;  4HCB A;  5H1S Q;  5I9E B;  5AQX A;  3ULE B;  3NAE A;  1KC8 O;  1IV0 A;  4KB1 A;  5EY4 A;  2QWN A;  1TK8 A;  5FRO A;  1SKS A;  2A40 A;  2Q0R A;  1SS6 A;  1JXE A;  3KLI A;  3K57 A;  4DF4 A;  3PO4 A;  1UA0 A;  1SL0 A;  3TSQ A;  3QIP A;  1C0G A;  3L3V A;  3V6D A;  3SZ2 A;  3KZB A;  4E89 A;  4KB0 A;  1TL1 A;  3CCM N;  5AZI B;  4DLE A;  3ZCM A;  3O1B A;  5EVZ A;  3HYF A;  3OA9 A;  1U2V B;  3D2E A;  4KO0 A;  1A5X A;  2HB5 A;  4J2B A;  3GG4 A;  4B08 A;  1NGA A;  3PUF A;  1HKB A;  3TAM A;  3IG1 A;  4WQ5 A;  4M45 A;  3TTF A;  4CGJ A;  4GV3 A;  3NVK A;  3RRH A;  3QO9 A;  1JCF A;  5GIN A;  4KRF A;  4CHY A;  2YX6 A;  1IKW A;  5AZJ A;  1DKG D;  5KPT A;  2QXF A;  3LDL A;  1JL1 A;  3VES A;  1RDD A;  4BRH A;  4NCB A;  3TAB A;  2HST A;  4CIF A;  4YOX A;  1KLN A;  3H3N O;  2O8F A;  4ISE A;  3VQE A;  3KJV A;  3KIO A;  5C42 A;  3SAH A;  3SUO A;  1JCE A;  2W42 A;  2OAN A;  3SUP A;  2O8E B;  3GBT A;  4CZI A;  4N5S A;  3OYG A;  2GWJ A;  4DV7 K;  3SBG A;  2QI2 A;  4W5T A;  1EO1 A;  1W7A A;  3TSP A;  4YOU A;  1GLC G;  3O8M A;  5TKW A;  4IBN A;  2PYL A;  5F1X A;  3O3G A;  4IOA L;  2P9I A;  2QWO A;  1QQN A;  4EIA A;  1BOT O;  4KH5 A;  4FL9 A;  1S1W A;  1OH5 A;  2PBD A;  3AA5 X;  4OX9 K;  3A5M C;  3EYZ A;  3SMP A;  3V1Q A;  1JXB A;  3TI0 A;  4DSJ A;  1GOC A;  4M63 C;  1QSS A;  2GEM A;  4NLB A;  4BR9 A;  4CFD A;  1TVR A;  4BR0 A;  1ZBI A;  1R0A A;  1H1V A;  2A5X A;  1E4F T;  2NZT A;  2KZZ A;  3GOI A;  4E7L A;  2KLA A;  3FFK B;  4YOV A;  4IO8 A;  1BI4 B;  3U8X A;  3K0S A;  1JJ2 M;  4BC5 A;  3TAE A;  1HYV A;  3HPG A;  3HM8 A;  3QBW A;  3SMS A;  1EET A;  3SBT A;  1VSL A;  3DXM B;  3O9T A;  4CJS A;  3LZI A;  3T3F A;  4ZTJ A;  3WQU A;  1ILY A;  3VQ8 A;  3R8E A;  3CHW A;  4E19 A;  2FSJ A;  4BRF A;  1WSI A;  4CVN E;  1WSH A;  2YV0 X;  1ZBF A;  4CE9 A;  4CFB A;  1NNE A;  2GUI A;  3HO1 A;  1ESV A;  4BE2 A;  3OBW A;  2O8D B;  2VYP A;  4L3Q A;  3KK2 A;  5IWA K;  3DI6 A;  1J5E K;  2PFU A;  2HNZ A;  4W5O A;  4Z4F A;  4I6M A;  3E01 A;  3UB5 A;  2F9T A;  2E8A A;  4B3T K;  4Y1C A;  4FM1 A;  3DRS A;  1OH8 A;  2EHG A;  3TU5 A;  3H3O B;  1RTH A;  3QDK A;  4DV0 K;  4Z4C A;  3ZSZ A;  1KFS A;  4OJR A;  1N5Y A;  4B3M K;  3ID6 A;  4FK0 A;  4CBU A;  3F9M A;  1DT9 A;  4AHS A;  1BIU A;  3ATU A;  1YJW N;  5AQP A;  4CFA A;  5KQ8 A;  1VQ4 N;  3IRX A;  1ATN A;  4Y0W A;  3VEO A;  5ADX A;  4JN4 A;  3C6T A;  4C23 A;  4JRQ A;  3DXK A;  4Q5V A;  3OYC A;  4RTF D;  3PX6 A;  3LM2 A;  4DTR A;  4KBO A;  4DKW A; 
#chains in the Genus database with same CATH homology
 2DFH A;  2YNG A;  3ZSW A;  1VSI A;  4FLT A;  1NK0 A;  3DRP A;  1KLM A;  1LWE A;  1U04 A;  3MAQ A;  4AHV A;  4CHO A;  5CZ2 A;  4B9U A;  4DS5 A;  2Y1I A;  4CER A;  1U45 A;  1S6P A;  1S1U A;  5C24 A;  4N76 A;  3QER A;  3OYN A;  2E4L A;  3DYA A;  3LAK A;  1NK8 A;  1C6V A;  4F3T A;  2VG5 A;  1NKB A;  4AHR A;  2FBX A;  2YNI A;  3TAP A;  1IO2 A;  1WSE A;  2Z1I A;  4YFU A;  3AO1 A;  2Z1G A;  1YTU A;  4FZZ A;  1W0H A;  2OPQ A;  4BDZ A;  1TAU A;  1WSG A;  1X1P A;  1ZBH A;  3LPT A;  1HYZ A;  4DS4 A;  4CJL A;  1XWL A;  2OPP A;  3LAN A;  2DY4 A;  1ASV A;  2NUB A;  4GVM A;  4CJ3 A;  3L2Q A;  3AVA A;  4WE1 A;  5HRP A;  4FM0 A;  4PWD A;  4QAG A;  4CK3 A;  4ELU A;  4CEC A;  4BE0 A;  1RIL A;  3OYH A;  4IFV A;  5J1E A;  3ISN C;  2QKK A;  4B9V A;  4GW6 A;  2E6L A;  2VWJ A;  3B6O A;  4ELV A;  4CJQ A;  1T03 A;  2D0C A;  1S1X A;  3ITH A;  1Z26 A;  3QEI A;  1L3T A;  1SV5 A;  3WNF A;  2X6S A;  4CJT A;  2QKB A;  1WSJ A;  3OYJ A;  4HUE A;  1BI4 A;  2OZM A;  4LH5 A;  3KTQ A;  1RT4 A;  4DFJ A;  2OA8 A;  1TK5 A;  3KLE A;  3DMJ A;  1J54 A;  3L2U A;  1ASW A;  2YKM A;  2PY5 A;  1NJW A;  4F4K A;  4IG3 A;  2ETJ A;  2BGG A;  4FJ7 A;  3RR7 A;  4Q0B A;  3RMA A;  1LWC A;  2IC3 A;  4W5N A;  4M42 A;  3DLR A;  3DM2 A;  3HXM A;  1VRU A;  4N47 A;  3LWL A;  4DSI A;  1D9F A;  3FFI A;  4FLU A;  4KPY A;  1JLB A;  4DTX A;  1FKO A;  3NGI A;  1NK5 A;  4BE1 A;  4YNQ A;  4FLV A;  2O4G A;  2IS3 A;  4B8A B;  3T1A A;  4DSL A;  4KI4 A;  4KHU A;  3DOK A;  4IDK A;  1UA1 A;  4O0J A;  4DTP A;  3QIO A;  4O44 A;  2RPI A;  1EXQ A;  1TKX A;  4CEA A;  3O4N A;  1HYS A;  4KKO A;  2G8I A;  2XRI A;  1G15 A;  4O0I A;  4IKF A;  4IFY A;  1TKT A;  2OPR A;  4LY7 A;  4FJN A;  3P1G A;  1JLF A;  4CJE A;  1Q9X A;  3NH0 A;  4CJU A;  4DQS A;  4BWM A;  4DLG A;  5T7B A;  3KLF A;  4CFC A;  2HVH A;  1FXX A;  5JS2 A;  3HM9 A;  4OPK A;  4NYN A;  4DFK A;  3NDK A;  3LP0 A;  4JLH A;  1WN7 A;  1IG9 A;  2JLE A;  4FJH A;  1UWB A;  4FCY A;  3QNN A;  1RBV A;  4DF8 A;  1LWF A;  3ZSY A;  3THV A;  3L2R A;  3IAY A;  3AVB A;  3VQA A;  3HPH A;  4KRE A;  3P5J A;  1J5O A;  4O55 A;  4B9S A;  4JS4 A;  3KD5 E;  2ITG A;  2HHX A;  2X74 A;  3PY8 A;  3DLG A;  4I9L A;  3CFO A;  4FM2 A;  4OVL A;  4B9N A;  5C25 A;  4FJM A;  1QSL A;  2G8U A;  2D0A A;  4DTM A;  3NH1 A;  3V1R A;  4E7H A;  5J2Q A;  4LD0 A;  1S9G A;  4M3W A;  3ZSO A;  2RN2 A;  3OYB A;  4DTS A;  2PZS A;  1IKV A;  4UQG A;  4AIL C;  1REV A;  1LW2 A;  1LAW A;  1W9H A;  3V9X A;  2XHB A;  4DTN A;  4RG8 A;  4E0D A;  2YKN A;  4CF0 A;  3LDS A;  1EP4 A;  1NOZ A;  2KW4 A;  3HVT A;  4O5B A;  1GOB A;  3SQ2 A;  3NF6 A;  1XC9 A;  1SL2 A;  2PYJ A;  3HP6 A;  3C95 A;  2ZD1 A;  3VQ6 A;  1KVB A;  2I5J A;  3D0P A;  4OPJ A;  5D3G A;  3RMD A;  4CF8 A;  3M8R A;  3NCI A;  3KLH A;  1VRT A;  3OY9 A;  4F2S A;  4KI6 A;  3MEG A;  1KFD A;  1ITG A;  4CGH A;  1VSM A;  3AVH A;  1QS4 A;  1NK6 A;  4CK2 A;  4F2R A;  3MEE A;  1EX4 A;  4M3R A;  3RTV A;  1Y97 A;  3QEV A;  2HHV A;  1C0M A;  1LW0 A;  3V9Z A;  3SNN A;  4I2Q A;  4I9Q A;  2A1S A;  3RRG A;  3AVF A;  1CLQ A;  2HHW A;  1F21 A;  4EP4 A;  3SPZ A;  3S3O A;  3HP9 A;  5KI6 A;  4LSL A;  4CJ5 A;  1GOA A;  4FJK A;  2XY8 A;  1S5J A;  3G0Z A;  5CY4 A;  3T19 A;  2G8V A;  4B9T A;  3HK2 A;  3U3Y A;  3LP2 A;  3OYK A;  3WNH A;  4ZHR A;  3HVR A;  3O4Q A;  1JL2 A;  1KVC A;  2VG6 A;  3WNG A;  1UOC A;  1SKW A;  3F9K A;  3M8Q A;  3KK3 A;  2AJQ A;  4Z4E A;  4C8N A;  3IS9 A;  3QET A;  4B9L A;  3S9H A;  4CEQ A;  1NKC A;  3V1O A;  2F8S A;  1LV5 A;  1YT3 A;  4RW9 A;  4EZ6 A;  1FKP A;  2XO7 A;  3NE6 A;  3VN5 A;  2Y1J A;  4DSE A;  2HW3 A;  4KTQ A;  1HJR A;  3LP3 A;  3U6F A;  3OJU A;  1RNH A;  1D5A A;  1RT5 A;  4PY5 A;  1JLA A;  4ID1 A;  4PQU A;  2KTQ A;  3CYM A;  3OS1 A;  3JSM A;  1T05 A;  3D45 A;  3ZT1 A;  4E7K A;  4KHN A;  4N41 A;  5EU7 A;  3VQB A;  4OKE A;  2KQ2 A;  4K8X A;  4MFB A;  3OS2 A;  2HHT A;  1CZB A;  3MED A;  4AHT A;  2OYQ A;  3C94 A;  4O4G A;  4QOZ B;  2B4J A;  2OPS A;  4ID5 A;  4C8L A;  4Z4H A;  4CF2 A;  1IKX A;  3VQD A;  1JLC A;  3OYF A;  3DLK A;  4CIE A;  2DFF A;  3M8S A;  2VG7 A;  5CZ1 A;  1ZYQ A;  4C8K A;  1A5V A;  3ZT3 A;  3CFP A;  1B92 A;  4AH9 A;  1HNV A;  4KTW A;  1HQE A;  3AVJ A;  4CJ4 A;  3OYE A;  1RT7 A;  1C0U A;  4CGG A;  4ICL A;  3OYL A;  3K5M A;  3PV8 A;  4DFP A;  4M3U A;  2A1R A;  4FK2 A;  3DLH A;  3LP1 A;  1S1T A;  4FW2 A;  1C1A A;  3VQ9 A;  1HRH A;  2LSN A;  2XY7 A;  4J2D A;  4FJG A;  1T7P A;  4L8R B;  4OLB A;  1RTI A;  3AVL A;  1RCH A;  2B5J A;  3TAF A;  1RDB A;  2YNH A;  1K6Y A;  4M41 A;  2DFE A;  4E7I A;  1NK4 A;  3CQ8 A;  4JS5 A;  3V9W A;  2G8K A;  1TAQ A;  2HND A;  4Y1D A;  4FLX A;  4CEZ A;  2P5G A;  4CIG A;  1SL1 A;  2X78 A;  1BGX T;  3LPU A;  4B8C A;  3ALY A;  3L2V A;  1T8E A;  3MXJ A;  5J2M A;  1XI1 A;  4M3Y A;  2KFZ A;  4NYF A;  1ZBU A;  5HRO A;  1U48 A;  4CCH A;  5JS1 A;  2HVI A;  3AVM A;  4HHT A;  4FJ5 A;  1KVA A;  1X9M A;  1NJX A;  4KHS A;  1WAF A;  2GBZ A;  3K58 A;  4Z0U A;  1L3U A;  1RTJ A;  2FC0 A;  3VQ4 A;  4DQQ A;  3V9S A;  1CXU A;  2BE2 A;  2FBV A;  3EZ5 A;  3QES A;  3PO5 A;  1BQM A;  4DQP A;  1YVU A;  1BCM A;  3TR8 A;  3ZT2 A;  3VQ7 A;  1B9F A;  1BQN A;  4E1N A;  1NKE A;  1Q9Y A;  3MXM A;  4DWI A;  1QE1 A;  3JYT A;  4DQR A;  4FJJ A;  4C8M A;  4DG1 A;  5J2N A;  5FDL A;  1RBT A;  3KK1 A;  1RT1 A;  4CGI A;  1NK9 A;  3TAR A;  5DMR A;  1TKD A;  1RTD A;  2G8F A;  3KD1 E;  5CYM A;  1QHT A;  4H8K A;  4HUG A;  4KHQ A;  1VSF A;  4AHC A;  1NK7 A;  4CJV A;  3VQC A;  4J2A A;  1FK9 A;  3NHG A;  4BDY A;  1TKZ A;  2X6N A;  4HCB A;  4FK4 A;  3AVC A;  1TV6 A;  2Z1J A;  3AVK A;  1NOY A;  5J2P A;  1QSY A;  3NAE A;  1NJZ A;  2DTU A;  4DQI A;  5CYQ A;  4KB1 A;  3AO5 A;  3L8B A;  3KKS A;  3I0R A;  4KAZ A;  1RDA A;  1Q8I A;  1J9A A;  1WAJ A;  1TK8 A;  4OGE A;  5FRO A;  2XY6 A;  3CM5 A;  3HL8 A;  3LWM A;  1SKS A;  1SKR A;  3B6P A;  4BDP A;  2YHA A;  3AVG A;  3WNE A;  3TAG A;  1JXE A;  3AO2 A;  3SPY A;  3KLI A;  2IAJ A;  3K57 A;  4DF4 A;  3RWU A;  3PO4 A;  5KGW A;  3HJF A;  4FLZ A;  3ZT0 A;  1UA0 A;  1SL0 A;  2KZM A;  3QIP A;  3L3V A;  4CHQ A;  3P83 D;  3AO4 A;  1JLQ A;  3V6D A;  3SZ2 A;  2HMI A;  1VK0 A;  4E89 A;  2P51 A;  3VQQ A;  4CJF A;  3PX0 A;  1DLO A;  1S6Q A;  4E1M A;  5KRT A;  3DLB A;  4KB0 A;  4OLA A;  1TL1 A;  1N6Q A;  1I39 A;  5HRN A;  3HPO A;  4DLE A;  2YHB A;  3ZCM A;  4DFM A;  3K5N A;  1L3S A;  2P5O A;  4CHN A;  2IGI A;  1VSH A;  3HYF A;  2R7Y A;  4C8O A;  3MXI A;  4F3O A;  1RBS A;  4KO0 A;  1IKY A;  3L3U A;  4DTO A;  3RMC A;  3SI6 A;  1A5X A;  1CXQ A;  3SQ1 A;  3TWH A;  2HB5 A;  1L3V A;  1MU2 A;  4J2B A;  4B08 A;  3O3F A;  2F96 A;  3PUF A;  3A2F A;  3IG1 A;  3TAM A;  4ZTF A;  5HRR A;  4M45 A;  1QQC A;  1KCF A;  1RT3 A;  4PUO A;  4CGJ A;  1HPZ A;  2G8H A;  3CG7 A;  1U47 A;  4IG0 A;  1B9D A;  3RRH A;  3QO9 A;  4BAC A;  5E41 A;  2IOC A;  4DU3 A;  2EX3 A;  3QIN A;  4KRF A;  3VA3 A;  3AVN A;  2RF2 A;  1IKW A;  4CHY A;  3QNO A;  3F73 A;  4OKK A;  3K2P A;  1D9D A;  5FRM A;  2QXF A;  3TAQ A;  1YTA A;  1JL1 A;  4E3S A;  3RR8 A;  2QK9 A;  1RDD A;  1CZ9 A;  2WON A;  3KLG A;  4FW1 A;  4NCB A;  2OZS A;  1BL3 A;  3TAB A;  4CIF A;  1I3A A;  4MQ3 A;  4FJL A;  4QCL A;  1IH7 A;  3AA3 A;  3AO3 A;  4CEO A;  1KLN A;  1A5W A;  1BIZ A;  4Z4G A;  3VQE A;  3KJV A;  3QEW A;  2XY5 A;  3KIO A;  5C42 A;  3SUO A;  4FJ8 A;  1UAX A;  5HBM A;  4NCA A;  1BCO A;  2W42 A;  4ELT A;  4AHU A;  3SUP A;  5K14 A;  3NFA A;  4OKJ A;  3NGZ A;  4N5S A;  3VQP A;  3OYG A;  3OS0 A;  3SCX A;  1ASU A;  1BHL A;  2HHU A;  4W5T A;  2ZE2 A;  4N56 A;  4K8Z A;  3ZSV A;  4M3Z A;  3AA4 A;  1HQU A;  3OYD A;  1KRP A;  3VQ5 A;  4FLY A;  4Z4I A;  3M8P A;  3S3N A;  3EY1 A;  4J2E A;  4FVM A;  4B3O A;  2ATQ A;  1RT6 A;  1JLE A;  2GV9 A;  4CK1 A;  4I7F A;  4TSX A;  3NF7 A;  1VSK A;  4IBN A;  3NH2 A;  2PYL A;  4FJI A;  2F8T A;  2HHQ A;  2HHS A;  4EP5 A;  3O3G A;  4PA1 A;  4CF9 A;  4CEB A;  4W5Q A;  5FRN A;  1S1W A;  1WSF A;  4H4M A;  3AA5 X;  3K5O A;  1WLJ A;  3EYZ A;  3HST B;  3ULD A;  3SJJ A;  3ZSQ A;  4W5R A;  3V1Q A;  1JXB A;  3TI0 A;  1L5U A;  4DSJ A;  3I0S A;  1GOC A;  1QSS A;  3AA2 A;  3OVN A;  3HT3 A;  1RBU A;  4CJR A;  4G1Q A;  2ZQB A;  4LSN A;  1NJY A;  4CEF A;  4CFD A;  4RW6 A;  1TVR A;  2D0B A;  5HRS A;  1ZBI A;  1U49 A;  1R0A A;  4KFB A;  4DMN A;  4DU4 A;  3DRR A;  2KZZ A;  3V9U A;  1VSJ A;  4E7L A;  1EKE A;  3OJS A;  4CHZ A;  1QTM A;  2G8W A;  1BI4 B;  4HVJ A;  4FXD A;  3CFR A;  1RT2 A;  4FZY A;  3UIQ A;  3TAE A;  1HYV A;  3HPG A;  4CED A;  4NCG A;  1EET A;  2HNY A;  2D5R A;  1VSL A;  3T3F A;  4CJS A;  4ZTJ A;  3LZI A;  2YNF A;  1C1B A;  3OYA A;  4HTU A;  3VA0 A;  4LH4 A;  3VQ8 A;  2VWK A;  4FZX C;  4R5P A;  4E19 A;  4E7J A;  1WSI A;  2BAN A;  5SWM A;  1WSH A;  1XHZ A;  4FJ9 A;  1WNS A;  3QLH A;  2YV0 X;  4FJX A;  4CHP A;  1ZBF A;  3V81 A;  4CE9 A;  4CFB A;  3HO1 A;  2GUI A;  4BE2 A;  3S3M A;  4GMJ B;  3MEC A;  1KTQ A;  2FBT A;  2IDO A;  3KK2 A;  3I8D A;  4DSF A;  3ZSX A;  3DI6 A;  3SV4 A;  4H4O A;  5HP1 A;  1TK0 A;  4M3X A;  1VSE A;  3DLE A;  2HNZ A;  4I2P A;  3ZSR A;  4W5O A;  4Z4F A;  1U4B A;  4CF1 A;  3K59 A;  3H08 A;  2FBY A;  4CJP A;  1DTQ A;  3SUQ A;  2E6M A;  3E01 A;  1D8Y A;  4FLW A;  4XIU A;  3ZT4 A;  2JGU A;  1XHX A;  4Y1C A;  1S9E A;  3ASM A;  3DOL A;  3DRS A;  4FM1 A;  3NF8 A;  3LZJ A;  1C1C A;  2EHG A;  4CES A;  5HLF A;  2RKI A;  3SUN A;  1RTH A;  4FYD A;  3NBP A;  4CJW A;  3SQ4 A;  4Z4C A;  4DTJ A;  3QEX A;  5SZT A;  5I3U A;  3AVI A;  1JLG A;  3LAL A;  3ZSZ A;  4M3T A;  4OGC A;  4KHW A;  1SUQ A;  1RDC A;  1KFS A;  4BWJ A;  4OJR A;  4CEE A;  1N5Y A;  4FK0 A;  1X9W A;  4KTZ A;  4EZ9 A;  1KSP A;  2O4I A;  1VSD A;  3SV3 A;  3O3H A;  2KFN A;  4RW7 A;  4AHS A;  1BIU A;  1TL3 A;  4CFA A;  1Z25 A;  1HNI A;  2P1J A;  4CJK A;  3G10 A;  3IRX A;  3CM6 A;  5DK5 A;  3U3G A;  3AV9 A;  3C6U A;  2Z1H A;  3V4I A;  4CGF A;  4DSK A;  3PX4 A;  1S1V A;  4F8R A;  4KHY A;  1ZBL A;  1C0T A;  1JKH A;  1HMV A;  4HUF A;  5KRS A;  1X9S A;  1LAV A;  3C6T A;  1DTT A;  1J53 A;  3K5L A;  3SYZ A;  4DTU A;  4JRQ A;  2Q3S A;  4KV8 A;  4DU1 A;  4RW8 A;  3BDP A;  4CGD A;  3OYM A;  4Q5V A;  3BGR A;  1O1W A;  3OYC A;  3L2W A;  4B9M A;  1RBR A;  3QEP A;  4HCC A;  4JRP A;  2WOM A;  3KKR A;  3PX6 A;  3SQ0 A;  4RW4 A;  5KTQ A;  3OYI A;  3TAN A;  3RMB A;  3LAM A;  4DTR A;  3NF9 A;  3NGY A;  2BDP A;  1BIS A;  5KGX A;  2B6A A;  1TGO A;  5I42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...