3VQ7A

Hiv-1 in core domain in complex with 4-(1h-pyrrol-1-yl)aniline
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
145
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 54
structure length 145
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq7A00
2JGUA 3VQ7A 1VSIA 4B8CA 1WAJA 2XHBA 2ZE2A 3NAEA 4FJGA 3A2FA 3DLKA 4IFVA 1WAFA 4BWMA 3QINA 1KLNA 3E01A 1LAWA 3T19A 1WSHA 2OPPA 3KLEA 1QTMA 1G15A 2OYQA 2FBXA 3ASMA 3LPTA 2IDOA 2Z1JA 1XI1A 2XRIA 4HCBA 4FYDA 2KQ2A 2OPSA 4KTWA 1SV5A 2ZD1A 4FZZA 4E7IA 3QNOA 4HVJA 1XWLA 1U04A 1JL1A 3EYZA 3K59A 4QCLA 1TGOA 3V9XA 1LWFA 4DQSA 3ZSOA 3SPYA 4CGFA 2YKMA 4CJFA 4DFMA 3KK2A 3SV4A 3NF8A 3CFPA 1Z25A 3AVFA 1KCFA 4B9UA 4AHTA 4CFBA 2DFEA 1J9AA 1JLFA 1UWBA 4FW2A 3SQ2A 4C8LA 4HCCA 4PWDA 1QHTA 5FDLA 4EZ9A 3HK2A 3TAEA 2RPIA 3SZ2A 1VSKA 5JS2A 3SQ1A 3IAYA 4Z4GA 3ITHA 4NCGA 4J2BA 1BQNA 1RBUA 4B3OA 5FROA 1RBTA 3WNHA 3HXMA 4FLWA 4DTPA 3DLBA 2HHXA 4IG0A 2IOCA 1CLQA 1B92A 3QNNA 1ZBLA 4CF0A 4M42A 2HVHA 3RRGA 3V1OA 3TAFA 4CJPA 3L2UA 2HB5A 4GW6A 1S1WA 3SPZA 4CGJA 3VQ6A 3G0ZA 4LH5A 1KSPA 1JLCA 4CGGA 2YKNA 1T7PA 1RDAA 4Z4CA 1VSLA 4G1QA 3LP0A 3K5MA 5E41A 3VQ4A 2G8VA 2KZZA 3TAGA 4ID5A 3DMJA 3K2PA 3CYMA 3LAMA 4LSLA 3L2VA 3MAQA 2JLEA 4DQIA 2YV0X 3IG1A 3EZ5A 4KO0A 2PYJA 3M8SA 5CZ2A 3MEDA 2XO7A 3AO2A 4DQRA 5HROA 1D9FA 4J2EA 2FBTA 4M3RA 4DU3A 5C24A 4RW4A 3V9WA 1RTHA 4CJRA 2F96A 3B6OA 3NGZA 4FJIA 2IC3A 1NJYA 4FW1A 4KI6A 4KTZA 4DWIA 4FZXC 1NOYA 1O1WA 4DSIA 1ZBFA 3QESA 2OZMA 1Y97A 4DMNA 3P1GA 1ASUA 1XHZA 1C1CA 2BANA 5HRNA 3I8DA 3LWMA 4IFYA 3K57A 4CFAA 3S3OA 4O55A 2XY7A 5J2MA 4O0JA 1KRPA 1SKSA 2GV9A 2BGGA 3ZSQA 1RT7A 3HPGA 1L3SA 3HVRA 3HYFA 4NCBA 4O0IA 1NKEA 3TWHA 4CEFA 4CESA 1RTJA 4NYFA 5FRNA 4CJTA 3AO1A 1BCMA 1VRUA 4KREA 1JLQA 4AILC 1BIZA 1J53A 1QS4A 3ZSZA 3ALYA 4E7LA 3P5JA 3WNEA 2FBYA 2G8UA 4KHSA 3HO1A 3C6UA 1TKXA 4CEAA 2HNZA 3OS0A 4ZTJA 1N5YA 3T3FA 3AVNA 1VSHA 4B9TA 1EX4A 1EXQA 1HQEA 4M3YA 3RR8A 3TI0A 4O44A 3ZT2A 4FM1A 4E1MA 3UIQA 4Y1DA 4PY5A 2HHSA 5KRSA 3NH0A 2HW3A 4FM0A 3PY8A 3NFAA 4CGDA 1YT3A 3U3YA 4DTMA 1RBRA 3V9ZA 4E19A 2G8WA 1QE1A 2X6NA 4WE1A 1NJXA 4DSEA 5CYQA 4MQ3A 4C8OA 4CIFA 3OYCA 3VQ8A 3O3HA 1S1UA 1JLBA 2P51A 1U49A 2D0BA 1D5AA 4OPJA 1C0UA 4DS4A 1S9GA 2X74A 4CK1A 1BGXT 1JLAA 3H08A 4HHTA 2RKIA 1GOAA 3V81A 3OS2A 4M3WA 4DU1A 1U47A 4E89A 2E6LA 1HNVA 3F9KA 1TK0A 4J2DA 3ULDA 2OPRA 3NF7A 3HPOA 4Q5VA 4JS5A 3JYTA 4ZHRA 3L3VA 2Q3SA 2VG7A 1B9FA 3LPUA 4I7FA 4RG8A 3VQBA 4CF8A 4HTUA 2IAJA 4DTXA 4DTOA 3VN5A 4DSLA 1KVCA 1S1VA 2YHBA 3D45A 3MECA 4B08A 1RT2A 3OYHA 3SUNA 2X78A 3SQ0A 3AA2A 3MXMA 3OYDA 3DLHA 3KLGA 4ELUA 4FJNA 1KVBA 1RT5A 4CCHA 4FLVA 3V1QA 2QK9A 1VRTA 4FK2A 4KHQA 1TL1A 4KB0A 1C6VA 4CJWA 4FJ9A 5KTQA 3B6PA 1Z26A 3TARA 5KI6A 1A5XA 4CF1A 4N76A 3M8QA 4CECA 3JSMA 3NH1A 4CHQA 4C8NA 3K5LA 1D9DA 4C8MA 3AVKA 4CGIA 3DRRA 3HP6A 3TABA 1CXUA 1DTTA 5J1EA 3RTVA 2PZSA 2D5RA 2Z1HA 5CY4A 3V9SA 4W5RA 3KTQA 2ATQA 3QEVA 4IKFA 2QKBA 4FCYA 2E6MA 3WNFA 2NUBA 1WN7A 4KKOA 3NBPA 1N6QA 4F3TA 3AVHA 1JL2A 4CJ4A 4DFJA 4GVMA 2ETJA 2XY8A 4RW9A 1S6QA 1LAVA 3V6DA 4CEEA 3KLFA 4ICLA 3NE6A 2B6AA 4JLHA 4W5QA 3QEPA 4KAZA 2F8TA 1JKHA 3L2WA 3LZIA 4DTSA 4RW6A 4OKJA 5EU7A 1VSMA 3L2RA 4LSNA 4FZYA 4CK2A 4RW8A 5HRSA 1ZBIA 4I9LA 3DLEA 3RMCA 4CJUA 3TAPA 1TK5A 4KHUA 1WSIA 4FXDA 3PX6A 3RMBA 2XY5A 2E4LA 3AV9A 3MXJA 3OYLA 5KGWA 3OYIA 3QEIA 3PX0A 3DOKA 1ZBUA 4CJKA 1RT3A 1NK5A 1SL2A 4H4MA 1SUQA 2P5OA 3KLIA 4CEOA 4CHZA 2KFZA 5I3UA 4KHNA 1BISA 1DLOA 4CJSA 1BI4B 2FBVA 3QO9A 4YNQA 4KTQA 3VQDA 1S1TA 4NYNA 3KJVA 1HRHA 1JXBA 3MEGA 3DM2A 3HL8A 3KKSA 4DQQA 4DTNA 4DF8A 4OLBA 3PX4A 1QQCA 3DLRA 4KV8A 4CJLA 1TKDA 1WNSA 4EZ6A 4FJMA 2O4IA 4QAGA 4OVLA 4E7KA 3KD5E 2O4GA 1JLEA 1YTUA 2VWJA 5I42A 3S3NA 3O4NA 3V1RA 1NK8A 1WSGA 1B9DA 3KIOA 5T7BA 4CJVA 3CM5A 2D0AA 2HHQA 1HPZA 3SI6A 1X1PA 5J2NA 3IS9A 4F8RA 1HJRA 3SQ4A 4BDPA 4Z4FA 2HVIA 1IO2A 4RW7A 4CJEA 3L8BA 2QKKA 3S3MA 3HSTB 4TSXA 1KLMA 1IKVA 3KK1A 2W42A 1W0HA 2HNYA 3OYKA 5HRPA 2G8KA 2KZMA 1KFSA 3OYEA 3OJSA 4LD0A 4Z4HA 1BQMA 4CHOA 3AVLA 1NJWA 2ZQBA 1J54A 3AVAA 5C42A 3OYNA 4BWJA 2Z1GA 1ASVA 3LP2A 4DLGA 4CIGA 3OS1A 4N56A 3VQQA 1HYZA 4CF9A 4KPYA 1UAXA 4N5SA 4F3OA 1REVA 3AVCA 1C1BA 5SZTA 3NDKA 5HRRA 4BDZA 2OA8A 2XY6A 3PO4A 1NK9A 3BGRA 2IGIA 4DSKA 4Z4EA 3D0PA 1LV5A 5KRTA 1K6YA 1NK0A 3MXIA 1EETA 3LDSA 3RR7A 3PO5A 3HJFA 3VQEA 5DMRA 1GOCA 4CE9A 2ITGA 4CHPA 1VSJA 1LWEA 2WOMA 4CEQA 1L3UA 1D8YA 1WSJA 3LP3A 4PUOA 4B9SA 4BDYA 1J5OA 2PYLA 2AJQA 3AVJA 3BDPA 4OGCA 1FK9A 4YFUA 3F73A 4ZTFA 1X9SA 2P5GA 2GUIA 1CZ9A 4UQGA 4DFPA 4M3XA 2YNFA 1U48A 4W5NA 1NKBA 3U3GA 1HYSA 3MEEA 4KHYA 4AHUA 3CQ8A 2Z1IA 4PQUA 1EKEA 4IG3A 1Q9YA 1IKYA 2HMIA 1IKWA 3OYAA 4KFBA 3C6TA 2RN2A 2Y1IA 4E0DA 4E7JA 1TV6A 5CZ1A 5CYMA 3OVNA 3U6FA 3VQAA 4ELVA 2I5JA 1ZYQA 4DU4A 4B9NA 5DK5A 1DTQA 3QIPA 2FC0A 3ZSWA 2DFHA 3HVTA 4DTRA 1L3TA 4FJ7A 4BE1A 1A5WA 1RDDA 2VG5A 4DS5A 4KRFA 3VA3A 3DRSA 1HNIA 3NH2A 2G8HA 4CIEA 1TVRA 3O3GA 4DFKA 3G10A 1JLGA 4CHNA 2R7YA 1TKTA 4O4GA 4CFCA 1HQUA 1NK6A 4FJ5A 3RMDA 4QOZB 4DSJA 3QETA 1BCOA 3PV8A 4CJQA 2KFNA 4R5PA 3L3UA 4M3ZA 1W9HA 2EHGA 3P83D 1VSEA 3NF9A 3ISNC 3LP1A 4OJRA 4B9LA 4CJ3A 5D3GA 4C8KA 1RT1A 1FXXA 2DY4A 4FJLA 1WLJA 3LALA 3QERA 3O4QA 3RMAA 2Y1JA 3AA3A 2B5JA 4FLZA 3KD1E 4KI4A 1MU2A 1HYVA 1LW2A 3DRPA 2YNGA 4EP4A 1S1XA 1RDBA 1F21A 3K5NA 3SUOA 1CZBA 5KGXA 3AA4A 1GOBA 3EY1A 3SV3A 3NGIA 4Z0UA 2D0CA 2IS3A 2YHAA 2KW4A 3O3FA 3TAMA 3SNNA 4ELTA 4M3TA 3LAKA 4H4OA 1IG9A 4OKEA 3FFIA 2LSNA 1Q8IA 3CG7A 3ZT0A 4FJXA 4CGHA 3VQ9A 4XIUA 4JRPA 3HPHA 3ZSXA 2X6SA 1KVAA 4NCAA 5C25A 3QLHA 2VWKA 4Z4IA 5K14A 1LW0A 1S6PA 4FLUA 4DF4A 4EP5A 5SWMA 4FM2A 1BI4A 4HUFA 3THVA 3NCIA 3LANA 3TANA 3ZSRA 4F2SA 1RCHA 1RBSA 4B9MA 1ASWA 4FJ8A 1SL0A 2HHWA 3K5OA 4CFDA 3AVBA 3KLHA 1XC9A 2HHVA 4CF2A 4AHSA 4OLAA 2KTQA 4LY7A 1WSFA 1I3AA 1IH7A 4CERA 4Y1CA 3CM6A 1WSEA 4DG1A 3RRHA 4BACA 1NJZA 4DSFA 1LWCA 3ZCMA 4FJHA 4GMJB 2WONA 2A1RA 3AVMA 3TAQA 4E1NA 4M41A 1FKPA 5FRMA 1RDCA 3AO4A 4M45A 5HP1A 1VSFA 1YTAA 2GBZA 3SJJA 4W5OA 3CFRA 4CEDA 3DYAA 4Q0BA 3VQ5A 4DLEA 2PY5A 4N41A 2YNHA 3S9HA 3QEWA 4J2AA 2G8IA 4FJKA 4M3UA 4IBNA 1SKWA 2OZSA 4W5TA 3QEXA 2BE2A 1C1AA 4I2QA 4JS4A 2G8FA 3VA0A 3OYMA 3L2QA 1TAUA 1U45A 4F4KA 3QIOA 5HLFA 4I9QA 3V4IA 1JXEA 1VK0A 1HMVA 3KKRA 3SCXA 2QXFA 3ZT1A 4E7HA 4K8ZA 1A5VA 1VSDA 1IKXA 3I0RA 1C0TA 4AHCA 5J2QA 1TK8A 4KB1A 1S5JA 1UA0A 4H8KA 3OYJA 3ZT4A 4B9VA 4FLXA 1RT6A 3T1AA 1TL3A 1TAQA 1I39A 4OKKA 4CJ5A 4DTJA 1TKZA 5J2PA 1CXQA 3LWLA 3ZSVA 4ID1A 1L3VA 4N47A 4FK4A 4AH9A 1R0AA 1T05A 4FK0A 3KK3A 3K58A 4FLYA 5HBMA 1QSSA 4CEZA 3OY9A 2DTUA 4B8AB 3OYGA 1KFDA 3SYZA 3NGYA 1RTDA 2HHTA 4OPKA 3VQCA 1NK4A 4K8XA 3C94A 4DQPA 2BDPA 2DFFA 3HT3A 3V9UA 3NF6A 3RWUA 1YVUA 3AO5A 3AVIA 4E3SA 4BE0A 3DLGA 1U4BA 3AO3A 4AHVA 4LH4A 4CHYA 1SKRA 1T03A 3HP9A 3ZT3A 1Q9XA 3M8RA 1T8EA 1UOCA 3WNGA 3NHGA 4F2RA 1RNHA 1BIUA 2YNIA 4OGEA 2P1JA 4CK3A 3DOLA 1S9EA 4HUEA 1X9WA 3SUQA 4JRQA 3SUPA 1L5UA 3M8PA 4IDKA 1NK7A 3CFOA 2OPQA 3IRXA 3AVGA 1NKCA 1RILA 2HNDA 4AHRA 4L8RB 1FKOA 1X9MA 2HHUA 1RBVA 1XHXA 4CEBA 3AA5X 1SL1A 2VG6A 4O5BA 1RT4A 1QSLA 5JS1A 1ITGA 4MFBA 4HUGA 3OJUA 3HM9A 4KHWA 2EX3A 2B4JA 4DTUA 1UA1A 4BE2A 3DI6A 3I0SA 3LZJA 1BL3A 4I2PA 3PUFA 1QSYA 3OYFA 1BHLA 1NOZA 2A1SA 3C95A 2F8SA 1KTQA 3TR8A 4FLTA 1EP4A 2RF2A 4FJJA 4PA1A 3OYBA 1ZBHA 4FVMA 1RTIA 3VQPA 3ZSYA 1C0MA
chains in the Genus database with same CATH superfamily
2JGUA 4B8CA 2Q0UA 4IFVA 1KLNA 3IDHA 4H0XB 3E01A 1KAXA 4JN4A 1WSHA 2V52B 4BVOA 3ASMA 2BUPA 1DKGD 2Z1JA 2XRIA 1IBKK 4FYDA 4IEIA 2OPSA 1K8KB 1SV5A 2ZD1A 4FZZA 1BG3A 2JWKA 4E7IA 4K0KK 4HVJA 1JL1A 3K59A 1TGOA 3V9XA 2OTJN 4B1YB 3ZSOA 3VF4A 4CJFA 1WB9A 3AVFA 2DFEA 1NGHA 4FW2A 4PWDA 1GLAG 1QHTA 4YY3K 3HK2A 1WUAA 1VSKA 1NGGA 4IEEA 4NCGA 5FROA 3HXMA 3WNHA 3I33A 2HHXA 2GTDA 4ISEA 4JHDA 4M42A 3RRGA 4H0VB 1VQ7N 5F0XA 4GW6A 1S1WA 3N4QA 4CGJA 3VQ6A 3SMPA 1P90A 3EO3A 3ZETB 2ZJRL 1VSLA 4G1QA 3LP0A 5DM7L 3K5MA 5E41A 5F2RA 3TAGA 3K9KA 4LSLA 3P39A 2VQEK 4DQ8A 3DWLA 3IG1A 4M63C 3MEDA 4KHPK 2WFBA 4DU3A 4RW4A 3V9WA 4CJRA 2CH5A 2J4RA 1SAZA 1Y97A 1XHZA 1C1CA 5HRNA 3I8DA 3H46O 4OO1J 1XMOK 2BGGA 5AZJA 1N33K 2YHYA 4O0IA 2P9IB 3AO1A 3CJCA 1QS4A 5E26A 3ZSZA 2G8UA 3HO1A 1C0FA 3ATVA 3A5NC 4Y0WA 4ZTJA 1N5YA 3AVNA 4B1VA 3UKRB 3BUZB 1W7AA 4E1MA 4PY5A 5AZIA 4NXMK 2QM1A 3NFAA 5AQQA 3BP8A 1RBRA 3V9ZA 3TSUA 2X6NA 2YJFA 3TTCA 1NJXA 3A0IX 4C8OA 3OYCA 1MDUB 3VQ8A 1OH7A 3O3HA 1JLBA 4NLBA 2D0BA 3LM2A 4JI4K 2X74A 4HHTA 4DU1A 4H5RA 2E6LA 3E1YA 3O1WA 4F9OA 3NF7A 3GE1A 3JYTA 1OKJA 3VETA 3TPQA 2Q3SA 3CCMN 2VG7A 3DXKA 4WQ5C 1TAUA 4FK2A 1QVFM 1S1VA 1P8ZA 2UUAK 3F2KA 3SQ0A 3KLGA 1RT5A 4CCHA 4FPAA 5JLHA 1U2VA 5JICA 1VRTA 5FLXO 4KB0A 3P38A 5GADP 1VQKN 3U9DA 4H5VA 1IV0A 3VEWA 4CECA 3JSMA 4CHQA 3AVKA 1DTTA 3RTVA 4W5RA 4IKFA 3QEVA 3T69A 3S41A 1WN7A 4CJ4A 4GVMA 1T6CA 4GV6A 3V6DA 3KLFA 4ICLA 3TSPA 4JLHA 4DV5K 3LZIA 3E66A 4DTSA 4OKJA 3L2RA 5M1KA 2YJEA 4BGAA 2OCEA 3NMUA 5TKWA 5AJ3K 2P9PB 3TAPA 3PX6A 3RSEA 3AV9A 1BA0A 3G25A 1SL2A 1ZBUA 4CHZA 2KFZA 5I3UA 1BISA 2VCPA 2A42A 4YNQA 5C0YA 3HL8A 3THWA 3PX4A 4U7BA 2E88A 3DLRA 4KV8A 4CBXA 1TKDA 2O4IA 1HKBA 4OVLA 4QAGA 4E7KA 1JLEA 5I42A 1N36K 3IMXA 1XUPO 1T44A 4PKHA 5T7BA 1HPZA 4YORA 4F8RA 3SQ4A 4BDPA 1NMNA 2HVIA 1XC3A 1IO2A 2QKKA 1KQSM 3S3MA 4TSXA 4QS8A 2G8KA 2HNYA 3MMVA 5AQJA 1BQMA 4WFNL 1NJWA 2ZQBA 1J54A 3LL3A 4ILJA 4FWLA 4EFHA 4DLGA 1Q18A 3OS1A 1HYZA 4ILGB 1VQLN 3O5BA 3QICA 5AQGA 4BREA 5HRRA 4JKDA 3BGRA 2IGIA 4DSKA 2FSKA 4ILHA 1NK0A 1NJIO 2GWJA 2ASMA 2NRRA 5DM6L 4DV7K 4CE9A 1GOCA 4CHPA 2ITGA 4CEQA 3FZFA 3RVCA 1OVYA 5AQUA 2PYLA 5BPNA 1FK9A 4YOUA 4YFUA 2GUIA 2UXDK 3ID6A 4DHYA 2E5LK 2QEXN 2VYPA 3U3GA 1HYSA 3MX2A 3MEEA 4X66K 4PQUA 1IKYA 2P9KB 3J80O 4DV3K 1NBWA 2Y1IA 4JNEA 3U6FA 3CJ9A 3VQAA 5AR0A 2I5JA 1DTQA 2FC0A 3ZSWA 2DFHA 3HVTA 1KD1O 4BE1A 4A5AA 3O9QA 2W40A 5GAEP 1HNIA 5A2QO 3NH2A 4XH1A 2G8HA 4CHNA 2P9SA 1HQUA 4FJ5A 4QOZB 1X3NA 3QETA 1BCOA 5AQSA 4CJQA 4R5PA 4M3ZA 1W9HA 3SAGA 3NF9A 2D0OA 3LP1A 4OJRA 5IWAK 3CC7N 1FXXA 1WOQA 4FJLA 3R6MA 1OH8A 2Y1JA 4LF7K 3AA3A 2B5JA 4KI4A 1HYVA 1LW2A 1NM1A 1EWRA 4LF8K 3AA4A 4BC3A 4Z0UA 2D0CA 2IS3A 4CZGA 2KW4A 4ELTA 3LAKA 4CBUA 1ILYA 4IOXA 3FFIA 2LSNA 3CMEN 3ZT0A 4FJXA 4CGHA 1KVAA 5C25A 1Z05A 5K14A 1S6PA 2GX9A 4DF4A 1XQSC 1BI4A 3ENHA 3I56N 1RCHA 1ASWA 3K9JA 3KWGA 3CCVN 4DV1K 4CFDA 1RGIA 1XC9A 4NXNK 1MA9B 1G99A 2QXLA 2E8AA 4AM7A 4LY7A 4Y1CA 1NGDA 2KLAA 1YIJN 1NGCA 5M1OA 1KC8O 4KBOA 4CD3A 1YI2N 2D4WA 2GBZA 3SJJA 1J6ZA 3CFRA 4CEDA 3LDNA 4DLEA 2HMPA 1W2BM 4Z94A 2PY5A 3WEEA 3QEWA 5MLCQ 2P9UB 3H6EA 3QEXA 1C1AA 3VA0A 4BRHA 2Q0RA 4IWVA 1V4SA 1QHAA 4FWNA 4I9QA 3V4IA 1JXEA 3SCXA 1YJWN 3CMAN 1TYQA 3ZT1A 1DT9A 2PFUA 4B9VA 3T1AA 1TL3A 1SQKA 1I39A 3SUOA 3ZSVA 3VTHA 1R0AA 1VQON 4FWRA 4YOYA 5LY3A 4B8AB 3OYGA 1RTDA 4K8XA 3C94A 3PIOL 2BDPA 3WXLA 4BRQA 3HT3A 1BU6O 3V9UA 3RWUA 4E3SA 3MN5A 4DV6K 2F9TA 4JKHA 4BE0A 1YJ9N 3AAPA 3AO3A 1Q9XA 3M8RA 3CXCM 4OGEA 1L5UA 4A61A 2A41A 5GAGP 1K8AO 4R79A 5BR9A 3IRXA 4L8RB 3O1BA 1QSLA 2EX3A 2B4JA 1GLCG 1UA1A 4A57A 3ID8A 2O8CB 2F8SA 4JKGA 2YI1A 4FLTA 1EP4A 2RF2A 5BR8K 3WXMB 4UY8O 3HTVA 3OYBA 2GELA 1C0MA 3FFKB 3WXKA 2XHBA 1EQYA 4FJGA 2OPPA 3CQYA 4AF1A 3VEYA 4B9QA 4HCBA 2ZGYA 2ZM6K 3CIPA 4JKEA 4KTWA 4K42A 2Q2RA 1XWLA 1U04A 4JKAA 4YOXA 5HL7L 3LDPA 3QMLA 3SPYA 5KPZA 2YKMA 3CETA 4DFMA 3NF8A 3CCLN 1X9JA 2CGKA 2P9NB 1UWBA 2Q1NA 4HCCA 3FLCO 3EKSA 5TKYA 4EZ9A 2RPIA 5JS2A 3AAQA 4J2BA 1RBUA 2NNWA 2QTDA 3WQTA 4IOAL 4B3OA 1IG8A 4GVEA 4FLWA 3DLBA 2IOCA 3MN7A 2HVHA 1ZBLA 1OVQA 3TAFA 4CJPA 2QWPA 3L2UA 2ZF5O 3SPZA 3H1VX 1RDAA 4Z4CA 3VQ4A 2G8VA 2KZZA 3DMJA 4M7YA 2BH1A 3ENBA 3CYMA 3K2PA 5LJWA 3MAQA 5ADXA 4BG9A 2IIRA 2YV0X 3EZ5A 4KO0A 4CZHA 2XO7A 5HROA 4DQRA 2FBTA 4B1UB 2KKZA 3NGZA 2VGNA 4FW1A 4WQ4A 4KI6A 5H1SQ 4FZXC 1NOYA 4DB3A 3ZEUA 4DMNA 4FWKA 3P1GA 1ASUA 1GLJO 2BANA 5J2MA 4O0JA 1RT7A 1GLBG 4NCBA 3TWHA 1X3MA 1RDUA 4NYFA 5FRNA 1BCMA 3TTFA 1BIZA 1J53A 3ALYA 2FBYA 3R1XA 3UKRA 1RFQA 4YOWA 4B9TA 4M3YA 1NLVA 4FM1A 2HHSA 3NH0A 1S72N 5AQZA 1ATNA 1YT3A 2WC9A 4DR6K 3O4WA 1QE1A 4WE1A 4MDBA 1QQOA 5CYQA 3C7NB 4CIFA 3MCPA 4BRGA 3AGRA 4CK1A 1VQ4N 1BGXT 2NRXA 5EVZA 3D6RA 3V81A 4M3WA 3CCUN 4H5TA 1E3MA 1XNQK 3F9KA 4J2DA 3ULDA 4G9ZA 3HPOA 1JCGA 2NLXA 3J8AA 4MO5A 2QWOA 4RG8A 1B9FA 3UIQA 4I7FA 3VQBA 4DSLA 4DTOA 1VQ9N 2YHBA 1RT2A 3MXMA 3OYDA 4C23A 1GLFO 1KVBA 3EE9A 2QK9A 4HWIA 4KHQA 4YOVA 3CCQN 4CJWA 3TARA 4BQLA 4CF1A 3SAHA 2GEMA 4L3QA 4C8NA 1J5EK 1QZ5A 4C8MA 4CGIA 4FWQA 4JKCA 3HP6A 5CR4A 2A5XA 2Z1HA 4DV2K 2ITMA 3NBPA 1N6QA 1JL2A 4DFJA 2NRHA 4RW9A 5CHIA 4CI6A 4KAZA 2F8TA 4DR2K 4NB4A 3QEPA 1JKHA 1CZAN 3L2WA 4RW6A 4FZYA 4CK2A 1ZBIA 2ASOA 4I9LA 2EWSA 3RMBA 3PO5A 2E4LA 3QEIA 4Z4GA 3OYIA 2HBKA 3HM8A 2ZJQL 3ZLJA 3KLIA 2O8EB 4XEIA 5C15A 4KHNA 1DLOA 2PBDA 4CJSA 3FZMA 4FL9A 4KTQA 2FSNA 3VQDA 2E2NA 3KJVA 3BY5A 3DM2A 4DTNA 4DF8A 1QQCA 5FPNA 3DAWA 3KD5E 1S22A 2Q31A 3GG4A 1YTUA 4EHUA 3S3NA 1I94K 3O4NA 4C1NI 1B9DA 3THYA 2D0AA 2CH6A 1X1PA 3PSFA 4J8FA 3AY9A 1HJRA 3TTDA 3ATUA 4H0PA 1KLMA 2W42A 1W0HA 3OYKA 5HRPA 1KFSA 4LD0A 3ZYYX 3WUHA 2KHOA 3DXMB 4FOIA 5C42A 1NGJA 4BWJA 3D2FA 2Z1GA 2E2OA 3VQQA 2O8BB 4KPYA 1UAXA 4N5SA 4F3OA 5SZTA 1R59O 3QBWA 2XY6A 3PO4A 3D0PA 3VTIA 4CJ7A 1FJGK 2Q36A 5DMRA 5AQTA 1VSJA 1LWEA 2UUCK 3ZX0A 1WSJA 3QB0A 4B9SA 2AJQA 4GV3A 3AVJA 2P5GA 4ZTFA 4JAXA 1X9SA 1C0GA 1CZ9A 1U48A 3M3ZA 1HJOA 4RTFD 2VGMA 4AHUA 3CCSN 2ZGZA 2Z1IA 1EKEA 1ZXOA 1Q9YA 3HRGA 1IKWA 4KFBA 1VQ8N 3C6TA 2RN2A 1TV6A 5DK5A 1L3TA 3DRSA 3HOTA 1H1VA 3O3GA 4NLCA 2D0PA 4BC5A 1QQMA 2KFNA 1OH6A 3P83D 1VSEA 2HHHK 3KZBA 4B9LA 4CJ3A 4PKGA 2FF6A 4CZMA 4X65K 4DUZK 2I7NA 4BC2A 2DY4A 3QERA 3O4QA 2E1ZA 2WTUA 1HNWK 4EP4A 5KGXA 3TSQA 3SV3A 3NGIA 3O3FA 4LF6K 3MN9A 4H4OA 4OKEA 1Q8IA 3CG7A 4K41A 3MCAB 5SWMA 2FF3B 3AGKA 4HUFA 1K9MO 3THVA 4FJ8A 1Q82O 4B9MA 1SL0A 3J7ZO 2HHVA 1KAYA 4CF2A 3VERA 4DCHA 3CM6A 3MWTA 4DG1A 4LF9K 4DSFA 4JI8K 4FJHA 3AVMA 5FRMA 4BR0A 2P9UA 4N41A 3S9HA 2G8IA 2HF3A 4FJKA 4FWOA 2OZSA 5AQNA 4I2QA 5KPRA 3OYMA 3L2QA 4F4KA 4JI1K 5HLFA 4BRPA 4H03B 3PLAA 1VSDA 1BWFO 3I0RA 4AHCA 3CPWM 4CBWA 1UA0A 4H8KA 3OYJA 4FLXA 1RT6A 1VAZA 3LWLA 2PAVA 4FK4A 4FWPA 3WXIA 5EXWA 3KK3A 3VEXA 3K58A 3JXUA 3L4IA 5HBMA 1QSSA 3IUCA 3NGYA 4WF9L 4OPKA 5JLFA 1BA1A 2DFFA 2E20A 1YF5L 1YVUA 3EE8A 1JCFA 3IFRA 4AHVA 4CHYA 3HP9A 4CZFA 3WNGA 4F2RA 3DOLA 3SUQA 2QWLA 5LMUK 3M8PA 4IDKA 4LFBK 3G71N 3F9MA 3OBWA 3CCRN 3HI0A 2HHUA 4EIAA 4CEBA 4YHHK 2VG6A 1RT4A 1ITGA 1LOTB 3VOVA 4HUGA 2O8CA 4DTUA 5FPEA 2Q97A 2HOEA 1BL3A 4I2PA 1QSYA 1NOZA 1MWKA 3C95A 4BR9A 4JD2A 2VQFK 2FSJA 3L0QA 3THXA 5AQKA 4PA1A 2O8FA 3LDLA 3A5OC 3VQPA 3VQ7A 1VSIA 1WAJA 3DJCA 3UE5A 2ZE2A 3NAEA 3DXKB 1WAFA 3QINA 2QWRA 1LAWA 3T19A 4IO8A 3CF5L 3KLEA 2OYQA 1G15A 3GDQA 4H0YB 4KH5A 2IDOA 2AP1A 1FW6A 1U2VB 3O8MA 4CZKA 1NGBA 3QNOA 1E4FT 4DQSA 4BRLA 3U8XA 3KK2A 5AFUH 3BZCA 5EOYA 4B9UA 4AHTA 4CFBA 1K73O 4C8LA 3SQ2A 3JAMO 5FDLA 3TAEA 3CJ7A 3SZ2A 3SQ1A 3GOIA 3CPEA 1KAZA 1RBTA 3EL2A 4WCEL 1NGIA 1B92A 3QNNA 5KPTA 3LM9A 3V1OA 1GLDG 1HKCA 4CD1A 4AQYK 3G0ZA 4LH5A 1JLCA 5GIOA 1T7PA 4BRKA 3BEXA 4ID5A 3LAMA 4K25A 3O80A 2JLEA 3CJBA 2I7PA 2PYJA 5CZ2A 4J2EA 4M3RA 3Q7CA 5C24A 5CE3A 1RTHA 2F96A 3B6OA 4EHTA 1NJYA 5AQOA 4DWIA 4DSIA 1O1WA 4JKFA 4YDUA 1ZBFA 2QWMA 4IJAA 2UXCK 2OZMA 4A62A 2ZJPL 3LWMA 4IFYA 5GAHP 4O55A 3VEVA 3M1FA 2GV9A 1L3SA 3HPGA 2JWLA 3HVRA 3HYFA 2YHXA 1NKEA 4CEFA 4CESA 4CJTA 1VRUA 4KREA 3G6EN 4AILC 4BR5A 4E7LA 3MWPA 4KHSA 4B1WB 3C6UA 1VQPN 1DEJA 2HNZA 4JI6K 3T3FA 1EXQA 1HQEA 3EEQA 3RR8A 3TI0A 4O44A 3ZT2A 3SBGA 5AQLA 4I6MB 2HW3A 4FM0A 4CGDA 3U3YA 4DTMA 2G8WA 4BQZA 5M1PA 3QFPA 5BRFA 3OTOK 4DSEA 3PIPL 1YXQA 1S1UA 2QWQA 2HF4A 4OPJA 1C0UA 4BGBA 3O9UA 3OS2A 1U47A 1TK0A 2OPRA 3WXJA 1HLUA 1MWMA 4FSVA 4ZHRA 3L3VA 4BY9C 4OLAA 2P9LB 2IAJA 1KVCA 3D45A 3SUNA 3MECA 4B08A 3CJAA 3OYHA 2X78A 3AA2A 3H45C 2IVPA 4ELUA 3FR0A 4FLVA 3LDOA 1RDWX 2RE2A 2YHWA 5AQVA 1K8KA 1C6VA 3OA9A 5KI6A 1A5XA 3M8QA 2P9SB 3K5LA 3HSCA 3A5LC 1ATRA 1CXUA 1VQ6N 2D5RA 2FLOA 2ATQA 2QKBA 1M1KO 4FCYA 2E6MA 3WNFA 5I9EB 1S6QA 4NO7A 2FXUA 4MDAA 4CEEA 1ZC6A 3NE6A 3NVMA 4B3RK 3VEZA 4O8UA 5EU7A 4LSNA 3TU5A 1EO1A 4RW8A 5HRSA 2YCHA 1BDGA 3ZETA 2UXBK 1HR0K 3DLEA 4CJUA 2W6KA 4FXDA 4BC4A 4CJKA 1RT3A 3UKUB 3ULEB 3MN6A 1SUQA 4DKWA 4CEOA 4LFAK 1BI4B 3L4QA 1S1TA 3CJ1A 4NYNA 3EKUA 1HRHA 1JXBA 3GL1A 3P31A 2O8DB 3KKSA 4DQQA 5M1QA 4CJLA 5M1NA 4B3TK 4M7XA 4DUYK 2VWJA 2H3GX 1NK8A 1WSGA 2V7YA 4FWMA 4CJVA 1N8RO 4MLEA 2P9IA 3MX5A 1T3VA 3MK6A 4CJEA 3HSTB 2KZMA 3B8AX 3OJSA 4Z4HA 3AVLA 3SAFA 4A2BA 3AVAA 4HTLA 4H5WA 4CIGA 4DR7K 1REVA 1C1BA 4BDZA 1NK9A 3N4PA 4DV0K 1EETA 3VGKA 3HJFA 1L3UA 2IVOA 2WOMA 3LP3A 4PUOA 4QS9A 4BDYA 1J5OA 4IJNA 3BDPA 4PHTX 4UQGA 4M3XA 2YNFA 1HNZK 4W5NA 1OH5A 1IBLK 2BTFA 3CC4N 4KHYA 4A2AA 3CQ8A 4IG3A 3PSIA 1SZ2A 3OYAA 4WQ5A 4CW7B 5CZ1A 4ELVA 2W41A 4B9NA 1ZYQA 4DU4A 4QS7A 3QIPA 4DTRA 4FJ7A 1A5WA 2VG5A 3VESA 4DS5A 4KRFA 3VA3A 4CIEA 1TVRA 3OBYA 4DFKA 3G10A 1JLGA 1TKTA 4O4GA 4CFCA 5GINA 1NK6A 4JI0K 3L3UA 4JKGB 3M5RA 3R3LA 3ISNC 1NMDA 5D3GA 4XH5A 5ADXH 4C8KA 1WLJA 3LALA 5JVHL 3R9PA 4DR5K 1MU2A 5C12A 2E2PA 1RDBA 1F21A 3K5NA 5BN9A 3EY1A 1GOBA 4MLHA 2HBMA 3SNNA 2YHAA 4M3TA 3TAMA 3CC2N 2P9PA 2ASPA 4NCAA 4Z4IA 2X6SA 3QLHA 1LW0A 4EP5A 3VPZA 1D4XA 3A5MC 3LANA 4BRCA 3NCIA 4F2SA 1RBSA 2HHWA 3CQXA 3K5OA 3AVBA 4OPHA 4GKJK 4CZJA 2KTQA 1WSFA 1I3AA 1IH7A 1N34K 1WSEA 3SBTA 3K0SA 2A3ZA 2A1RA 4E1NA 4M45A 1YTAA 3SLCA 4W5OA 4OX9K 3DYAA 5LJVA 3VQ5A 2NRTA 1HUXA 4J2AA 3H1QA 4M3UA 4IBNA 4W5TA 4ISFA 5HOOA 2G8FA 3VEOA 3VGLA 3QIOA 3KHYA 4XH4A 3KKRA 3AARA 4B1ZA 4DR3K 1YITN 4WQ4C 1IKXA 1C0TA 4KB1A 2UYTA 3ZEUB 4IFEA 4OKKA 4DTJA 5BPLA 1CXQA 4ID1A 4N47A 4V19S 4AH9A 4FK0A 1T05A 2F4VK 4CEZA 3D2EB 1KFDA 3SYZA 2HHTA 4MO4A 3NF6A 4H0TB 1VQNN 3AO5A 4JK8A 3UB5A 4LF5K 1T03A 3ZT3A 1HKGA 3LDQA 1T8EA 1YHQN 1UOCA 4CK3A 2P9KA 1S9EA 1E4GT 3CFOA 3IKMA 2OPQA 3W3DA 3AVGA 2HNDA 4AHRA 4O8KA 1FKOA 5AQYA 2YX6A 1NGFA 1X9MA 4A59A 4MFBA 3HM9A 3M6GA 2UU9K 3PUFA 3OYFA 1BHLA 3U4LA 3TR8A 1JCEA 5AQXA 4FJJA 4FVMA 1NWKA 1RTIA 2HSTA 1JJ2M 3A2FA 3DLKA 4BWMA 2NZTA 5C2DA 4JI5K 3CD6N 5AQPA 1QTMA 2FBXA 3LPTA 1XI1A 5C10A 1NGEA 4JK7A 2KQ2A 1BUPA 4FVUA 3EYZA 4JEPA 4QCLA 1LWFA 1HPMA 4CGFA 1O13A 3SV4A 3CFPA 1Z25A 3O6WA 1KCFA 4K43A 3EZWA 3KWIA 3CERA 1J9AA 1JLFA 2E2QA 2OANA 4IZ9A 3IAYA 1LCUA 3ITHA 3VF2A 1BQNA 4B3MK 4BRAA 4DTPA 4IG0A 1CLQA 4JI3K 1Y64A 4JK9A 4CF0A 4JKBA 4RWTA 5AQRA 4JHDB 2HB5A 3I8BA 2OTLN 1KSPA 4CGGA 2YKNA 1ATSA 4BG8A 3L2VA 5FPMA 4DQIA 1N32K 4EAHD 3M8SA 3AO2A 1D9FA 1Q86O 2E1YA 4GNIA 4FJIA 2IC3A 2A6AA 3FZLA 4KTZA 3CHWA 4FO0A 4BR7A 3QESA 2D1KA 3HZ6A 3FZKA 3S3OA 3K57A 4CFAA 1QQNA 2XY7A 3Q7BA 3THYB 1SKSA 1KRPA 5AFUA 2QW9A 3ZSQA 4BRNA 4LF4K 3CI5A 1RTJA 5AZJB 5M1FA 3VENA 4KH4A 1JLQA 1SS6A 4CZLA 4BR4A 1U6ZA 3P5JA 3WNEA 1M90O 1TKXA 1Z6RA 4CEAA 3QFUA 4IOCL 3OS0A 2GWKA 1VSHA 1EX4A 3D2FB 4I6MA 5EX5A 3O9SA 4BROA 4Y1DA 1HNXK 5KRSA 5KQDA 3PY8A 1BO5O 3ZX2A 3BF1A 5AZIB 1YVNA 4E19A 3HBTA 4MQ3A 4JI2K 3HOSA 2P51A 1U49A 1D5AA 5AQWA 4DS4A 1S9GA 5ELZA 1JLAA 3J81O 3H08A 2RKIA 1GOAA 5BREA 2QA4N 1WBBA 4WYBA 4E89A 2QI2A 1HNVA 3QDKA 4Q5VA 2P9LA 4JS5A 4LC9B 3LPUA 4CF8A 4HTUA 4DTXA 3VN5A 3DLHA 3G4SN 5BPMA 2CGLA 4FJNA 5GIPA 3V1QA 3FZHA 1TL1A 1Q81O 4FJ9A 5KTQA 3B6PA 1Z26A 3CCEN 1GLLO 3L6QA 4BRDA 2NRVA 3DLLL 4N76A 1NU0A 3NH1A 1D9DA 3DRRA 4LFCK 3TABA 5J1EA 2PZSA 2P9NA 5EY4A 1ZBSA 5CY4A 3I55N 3V9SA 2V7ZA 3KTQA 1KXPA 2NUBA 4KKOA 4F3TA 3AVHA 2ETJA 2XY8A 1BOTO 1LAVA 5AQHA 2B6AA 5FPDA 4W5QA 3C6AA 3EN9A 3D7EO 1VSMA 2VWBA 3CCJN 2IVNA 2HBJA 1TK5A 3UKUA 3ULEA 3RMCA 3C65A 4FWSA 1WSIA 4BVPA 4KHUA 2XY5A 3MXJA 1DGKN 3OYLA 5KGWA 3PX0A 3DOKA 1NK5A 3MDQA 4H4MA 2P5OA 3RSEB 5B8HA 3BZKA 2WUSA 2O8DA 5LL6Z 2FBVA 3QO9A 4GY2B 2RHKA 1V4TA 2NRZA 3MEGA 4OLBA 4JYAK 4FJMA 5IT9O 1VQ5N 1WNSA 4EZ6A 3THWB 2O4GA 4IO9L 5JVGL 1W97L 3V1RA 3O9RA 3KIOA 3F5TA 2HHQA 3CM5A 4IDHA 3SI6A 4CZEA 5J2NA 3IS9A 1IBMK 5F1XA 4FOEA 1GLEG 1Q7YO 4Z4FA 4DV4K 5KQ8A 4CVNE 4JI7K 4RW7A 3L8BA 4JV5K 1IKVA 3R8EA 3KK1A 4H5NA 4U67L 3OYEA 4IXCA 2UUBK 4CHOA 3KK7A 4AM6A 5LMNK 3OYNA 1ASVA 3LP2A 1NNEA 4B1XB 1QZ6A 1NG9A 4N56A 4B3SK 4CF9A 1IJJA 1VHXA 1YAGA 3AVCA 3NDKA 2OA8A 2V51B 1TUYA 4KH6A 4Z4EA 3J7YP 3VGMA 3A8YA 1LV5A 5KRTA 1K6YA 2W6LA 3MXIA 3C7NA 3LDSA 3OHRA 4YOTA 3RR7A 2DPNA 3VQEA 1D8YA 3OW2M 4WFBL 2AA4A 1VQMN 4OGCA 3F73A 3E9LA 4DFPA 1NKBA 5BN8A 3ZX3A 2GUPA 2HMIA 4E0DA 4E7JA 5CYMA 3OVNA 3FGUA 4PKIA 5BRHA 1RDDA 5AQMA 5BRDA 3VF6A 3H3NO 3FE1A 2R7YA 2HBLA 4DR4K 3RMDA 4DSJA 3PV8A 1YUWA 4JD2B 2EHGA 3JS6A 3NVKA 3THXB 4BRFA 2O8FB 3O08A 4FPBA 1RT1A 3P4IA 3RMAA 4WFAL 3BF3A 2QWNA 3KD1E 2A40A 4FLZA 3T7ZA 3DRPA 2YNGA 1S1XA 5AQFA 1CZBA 3ENOA 3O9TA 4E1JA 1IG9A 3VQ9A 3E9PA 4XIUA 3HPHA 3ZSXA 2F9WA 4JRPA 2VWKA 2O8EA 4FLUA 4FM2A 1XNRK 3TANA 3ZSRA 3U9ZA 2F7TA 2WBNA 3KLHA 4X64K 4PL7A 1TUUA 3T1HK 3SMSA 3VMFB 4AHSA 1S3XA 4CERA 4X62K 3W0LA 3SK3A 3RRHA 4BACA 1NJZA 1LWCA 3ZCMA 4GMJB 2WONA 3TAQA 4M41A 1FKPA 1YJNN 2ZWHA 4PL8A 1RDCA 3AO4A 4RCHA 5E84A 5HP1A 1VSFA 3SJHA 4Q0BA 2YNHA 5JMVA 4DR1K 4GV9A 1SKWA 1EWQA 3WEEB 2BE2A 4JS4A 3H3OB 4A5BA 1NGAA 3E9OA 1U45A 3DXMA 1VK0A 1HMVA 3KVGA 2QXFA 2O8BA 4E7HA 4K8ZA 3J7AP 1A5VA 1TK8A 4YDUC 5J2QA 1S5JA 1T6DA 1TYQB 3WQUA 3ZT4A 1TAQA 4CJ5A 1L3VA 4C1NK 1TKZA 5J2PA 4BRIA 3D2EA 4GKKK 4FLYA 2DTUA 3OY9A 3QBXA 2NRWA 3VQCA 1NK4A 4DQPA 3AVIA 3DLGA 1U4BA 1QVGM 1SKRA 4LH4A 5AQIA 3NHGA 3GBTA 1RNHA 1BIUA 2YNIA 1X9WA 2P1JA 4HUEA 4H0OA 2CGJA 4JRQA 3SUPA 5C2FA 1XMQK 1NK7A 3WT0A 1NKCA 4BRMA 1RILA 4ISGA 1RBVA 1XHXA 4O5FA 3AA5X 1SL1A 4O5BA 5JS1A 4KHWA 3OJUA 3C0BA 1ESVA 4BE2A 3DI6A 3I0SA 3LZJA 4OPAA 4CZIA 2A1SA 4BR2A 1KTQA 3C6HA 3T1YK 1HX1A 1ZBHA 1WBDA 3ZSYA
chains in the Genus database with same CATH topology
2JGUA 3VQ7A 1VSIA 4B8CA 1WAJA 2XHBA 2ZE2A 3NAEA 4FJGA 3A2FA 3DLKA 4IFVA 1WAFA 4BWMA 3QINA 1KLNA 3E01A 1LAWA 3T19A 1WSHA 2OPPA 3KLEA 1QTMA 1G15A 2OYQA 2FBXA 3ASMA 3LPTA 2IDOA 2Z1JA 1XI1A 2XRIA 4HCBA 4FYDA 2KQ2A 2OPSA 4KTWA 1SV5A 2ZD1A 4FZZA 4E7IA 3QNOA 4HVJA 1XWLA 1U04A 1JL1A 3EYZA 3K59A 4QCLA 1TGOA 3V9XA 1LWFA 4DQSA 3ZSOA 3SPYA 4CGFA 2YKMA 4CJFA 4DFMA 3KK2A 3SV4A 3NF8A 3CFPA 1Z25A 3AVFA 1KCFA 4B9UA 4AHTA 4CFBA 2DFEA 1J9AA 1JLFA 1UWBA 4FW2A 3SQ2A 4C8LA 4HCCA 4PWDA 1QHTA 5FDLA 4EZ9A 3HK2A 3TAEA 2RPIA 3SZ2A 1VSKA 5JS2A 3SQ1A 3IAYA 4Z4GA 3ITHA 4NCGA 4J2BA 1BQNA 1RBUA 4B3OA 5FROA 1RBTA 3WNHA 3HXMA 4FLWA 4DTPA 3DLBA 2HHXA 4IG0A 2IOCA 1CLQA 1B92A 3QNNA 1ZBLA 4CF0A 4M42A 2HVHA 3RRGA 3V1OA 3TAFA 4CJPA 3L2UA 2HB5A 4GW6A 1S1WA 3SPZA 4CGJA 3VQ6A 3G0ZA 4LH5A 1KSPA 1JLCA 4CGGA 2YKNA 1T7PA 1RDAA 4Z4CA 1VSLA 4G1QA 3LP0A 3K5MA 5E41A 3VQ4A 2G8VA 2KZZA 3TAGA 4ID5A 3DMJA 3K2PA 3CYMA 3LAMA 4LSLA 3L2VA 3MAQA 2JLEA 4DQIA 2YV0X 3IG1A 3EZ5A 4KO0A 2PYJA 3M8SA 5CZ2A 3MEDA 2XO7A 3AO2A 4DQRA 5HROA 1D9FA 4J2EA 2FBTA 4M3RA 4DU3A 5C24A 4RW4A 3V9WA 1RTHA 4CJRA 2F96A 3B6OA 3NGZA 4FJIA 2IC3A 1NJYA 4FW1A 4KI6A 4KTZA 4DWIA 4FZXC 1NOYA 1O1WA 4DSIA 1ZBFA 3QESA 2OZMA 1Y97A 4DMNA 3P1GA 1ASUA 1XHZA 1C1CA 2BANA 5HRNA 3I8DA 3LWMA 4IFYA 3K57A 4CFAA 3S3OA 4O55A 2XY7A 5J2MA 4O0JA 1KRPA 1SKSA 2GV9A 2BGGA 3ZSQA 1RT7A 3HPGA 1L3SA 3HVRA 3HYFA 4NCBA 4O0IA 1NKEA 3TWHA 4CEFA 4CESA 1RTJA 4NYFA 5FRNA 4CJTA 3AO1A 1BCMA 1VRUA 4KREA 1JLQA 4AILC 1BIZA 1J53A 1QS4A 3ZSZA 3ALYA 4E7LA 3P5JA 3WNEA 2FBYA 2G8UA 4KHSA 3HO1A 3C6UA 1TKXA 4CEAA 2HNZA 3OS0A 4ZTJA 1N5YA 3T3FA 3AVNA 1VSHA 4B9TA 1EX4A 1EXQA 1HQEA 4M3YA 3RR8A 3TI0A 4O44A 3ZT2A 4FM1A 4E1MA 3UIQA 4Y1DA 4PY5A 2HHSA 5KRSA 3NH0A 2HW3A 4FM0A 3PY8A 3NFAA 4CGDA 1YT3A 3U3YA 4DTMA 1RBRA 3V9ZA 4E19A 2G8WA 1QE1A 2X6NA 4WE1A 1NJXA 4DSEA 5CYQA 4MQ3A 4C8OA 4CIFA 3OYCA 3VQ8A 3O3HA 1S1UA 1JLBA 2P51A 1U49A 2D0BA 1D5AA 4OPJA 1C0UA 4DS4A 1S9GA 2X74A 4CK1A 1BGXT 1JLAA 3H08A 4HHTA 2RKIA 1GOAA 3V81A 3OS2A 4M3WA 4DU1A 1U47A 4E89A 2E6LA 1HNVA 3F9KA 1TK0A 4J2DA 3ULDA 2OPRA 3NF7A 3HPOA 4Q5VA 4JS5A 3JYTA 4ZHRA 3L3VA 2Q3SA 2VG7A 1B9FA 3LPUA 4I7FA 4RG8A 3VQBA 4CF8A 4HTUA 2IAJA 4DTXA 4DTOA 3VN5A 4DSLA 1KVCA 1S1VA 2YHBA 3D45A 3MECA 4B08A 1RT2A 3OYHA 3SUNA 2X78A 3SQ0A 3AA2A 3MXMA 3OYDA 3DLHA 3KLGA 4ELUA 4FJNA 1KVBA 1RT5A 4CCHA 4FLVA 3V1QA 2QK9A 1VRTA 4FK2A 4KHQA 1TL1A 4KB0A 1C6VA 4CJWA 4FJ9A 5KTQA 3B6PA 1Z26A 3TARA 5KI6A 1A5XA 4CF1A 4N76A 3M8QA 4CECA 3JSMA 3NH1A 4CHQA 4C8NA 3K5LA 1D9DA 4C8MA 3AVKA 4CGIA 3DRRA 3HP6A 3TABA 1CXUA 1DTTA 5J1EA 3RTVA 2PZSA 2D5RA 2Z1HA 5CY4A 3V9SA 4W5RA 3KTQA 2ATQA 3QEVA 4IKFA 2QKBA 4FCYA 2E6MA 3WNFA 2NUBA 1WN7A 4KKOA 3NBPA 1N6QA 4F3TA 3AVHA 1JL2A 4CJ4A 4DFJA 4GVMA 2ETJA 2XY8A 4RW9A 1S6QA 1LAVA 3V6DA 4CEEA 3KLFA 4ICLA 3NE6A 2B6AA 4JLHA 4W5QA 3QEPA 4KAZA 2F8TA 1JKHA 3L2WA 3LZIA 4DTSA 4RW6A 4OKJA 5EU7A 1VSMA 3L2RA 4LSNA 4FZYA 4CK2A 4RW8A 5HRSA 1ZBIA 4I9LA 3DLEA 3RMCA 4CJUA 3TAPA 1TK5A 4KHUA 1WSIA 4FXDA 3PX6A 3RMBA 2XY5A 2E4LA 3AV9A 3MXJA 3OYLA 5KGWA 3OYIA 3QEIA 3PX0A 3DOKA 1ZBUA 4CJKA 1RT3A 1NK5A 1SL2A 4H4MA 1SUQA 2P5OA 3KLIA 4CEOA 4CHZA 2KFZA 5I3UA 4KHNA 1BISA 1DLOA 4CJSA 1BI4B 2FBVA 3QO9A 4YNQA 4KTQA 3VQDA 1S1TA 4NYNA 3KJVA 1HRHA 1JXBA 3MEGA 3DM2A 3HL8A 3KKSA 4DQQA 4DTNA 4DF8A 4OLBA 3PX4A 1QQCA 3DLRA 4KV8A 4CJLA 1TKDA 1WNSA 4EZ6A 4FJMA 2O4IA 4QAGA 4OVLA 4E7KA 3KD5E 2O4GA 1JLEA 1YTUA 2VWJA 5I42A 3S3NA 3O4NA 3V1RA 1NK8A 1WSGA 1B9DA 3KIOA 5T7BA 4CJVA 3CM5A 2D0AA 2HHQA 1HPZA 3SI6A 1X1PA 5J2NA 3IS9A 4F8RA 1HJRA 3SQ4A 4BDPA 4Z4FA 2HVIA 1IO2A 4RW7A 4CJEA 3L8BA 2QKKA 3S3MA 3HSTB 4TSXA 1KLMA 1IKVA 3KK1A 2W42A 1W0HA 2HNYA 3OYKA 5HRPA 2G8KA 2KZMA 1KFSA 3OYEA 3OJSA 4LD0A 4Z4HA 1BQMA 4CHOA 3AVLA 1NJWA 2ZQBA 1J54A 3AVAA 5C42A 3OYNA 4BWJA 2Z1GA 1ASVA 3LP2A 4DLGA 4CIGA 3OS1A 4N56A 3VQQA 1HYZA 4CF9A 4KPYA 1UAXA 4N5SA 4F3OA 1REVA 3AVCA 1C1BA 5SZTA 3NDKA 5HRRA 4BDZA 2OA8A 2XY6A 3PO4A 1NK9A 3BGRA 2IGIA 4DSKA 4Z4EA 3D0PA 1LV5A 5KRTA 1K6YA 1NK0A 3MXIA 1EETA 3LDSA 3RR7A 3PO5A 3HJFA 3VQEA 5DMRA 1GOCA 4CE9A 2ITGA 4CHPA 1VSJA 1LWEA 2WOMA 4CEQA 1L3UA 1D8YA 1WSJA 3LP3A 4PUOA 4B9SA 4BDYA 1J5OA 2PYLA 2AJQA 3AVJA 3BDPA 4OGCA 1FK9A 4YFUA 3F73A 4ZTFA 1X9SA 2P5GA 2GUIA 1CZ9A 4UQGA 4DFPA 4M3XA 2YNFA 1U48A 4W5NA 1NKBA 3U3GA 1HYSA 3MEEA 4KHYA 4AHUA 3CQ8A 2Z1IA 4PQUA 1EKEA 4IG3A 1Q9YA 1IKYA 2HMIA 1IKWA 3OYAA 4KFBA 3C6TA 2RN2A 2Y1IA 4E0DA 4E7JA 1TV6A 5CZ1A 5CYMA 3OVNA 3U6FA 3VQAA 4ELVA 2I5JA 1ZYQA 4DU4A 4B9NA 5DK5A 1DTQA 3QIPA 2FC0A 3ZSWA 2DFHA 3HVTA 4DTRA 1L3TA 4FJ7A 4BE1A 1A5WA 1RDDA 2VG5A 4DS5A 4KRFA 3VA3A 3DRSA 1HNIA 3NH2A 2G8HA 4CIEA 1TVRA 3O3GA 4DFKA 3G10A 1JLGA 4CHNA 2R7YA 1TKTA 4O4GA 4CFCA 1HQUA 1NK6A 4FJ5A 3RMDA 4QOZB 4DSJA 3QETA 1BCOA 3PV8A 4CJQA 2KFNA 4R5PA 3L3UA 4M3ZA 1W9HA 2EHGA 3P83D 1VSEA 3NF9A 3ISNC 3LP1A 4OJRA 4B9LA 4CJ3A 5D3GA 4C8KA 1RT1A 1FXXA 2DY4A 4FJLA 1WLJA 3LALA 3QERA 3O4QA 3RMAA 2Y1JA 3AA3A 2B5JA 4FLZA 3KD1E 4KI4A 1MU2A 1HYVA 1LW2A 3DRPA 2YNGA 4EP4A 1S1XA 1RDBA 1F21A 3K5NA 3SUOA 1CZBA 5KGXA 3AA4A 1GOBA 3EY1A 3SV3A 3NGIA 4Z0UA 2D0CA 2IS3A 2YHAA 2KW4A 3O3FA 3TAMA 3SNNA 4ELTA 4M3TA 3LAKA 4H4OA 1IG9A 4OKEA 3FFIA 2LSNA 1Q8IA 3CG7A 3ZT0A 4FJXA 4CGHA 3VQ9A 4XIUA 4JRPA 3HPHA 3ZSXA 2X6SA 1KVAA 4NCAA 5C25A 3QLHA 2VWKA 4Z4IA 5K14A 1LW0A 1S6PA 4FLUA 4DF4A 4EP5A 5SWMA 4FM2A 1BI4A 4HUFA 3THVA 3NCIA 3LANA 3TANA 3ZSRA 4F2SA 1RCHA 1RBSA 4B9MA 1ASWA 4FJ8A 1SL0A 2HHWA 3K5OA 4CFDA 3AVBA 3KLHA 1XC9A 2HHVA 4CF2A 4AHSA 4OLAA 2KTQA 4LY7A 1WSFA 1I3AA 1IH7A 4CERA 4Y1CA 3CM6A 1WSEA 4DG1A 3RRHA 4BACA 1NJZA 4DSFA 1LWCA 3ZCMA 4FJHA 4GMJB 2WONA 2A1RA 3AVMA 3TAQA 4E1NA 4M41A 1FKPA 5FRMA 1RDCA 3AO4A 4M45A 5HP1A 1VSFA 1YTAA 2GBZA 3SJJA 4W5OA 3CFRA 4CEDA 3DYAA 4Q0BA 3VQ5A 4DLEA 2PY5A 4N41A 2YNHA 3S9HA 3QEWA 4J2AA 2G8IA 4FJKA 4M3UA 4IBNA 1SKWA 2OZSA 4W5TA 3QEXA 2BE2A 1C1AA 4I2QA 4JS4A 2G8FA 3VA0A 3OYMA 3L2QA 1TAUA 1U45A 4F4KA 3QIOA 5HLFA 4I9QA 3V4IA 1JXEA 1VK0A 1HMVA 3KKRA 3SCXA 2QXFA 3ZT1A 4E7HA 4K8ZA 1A5VA 1VSDA 1IKXA 3I0RA 1C0TA 4AHCA 5J2QA 1TK8A 4KB1A 1S5JA 1UA0A 4H8KA 3OYJA 3ZT4A 4B9VA 4FLXA 1RT6A 3T1AA 1TL3A 1TAQA 1I39A 4OKKA 4CJ5A 4DTJA 1TKZA 5J2PA 1CXQA 3LWLA 3ZSVA 4ID1A 1L3VA 4N47A 4FK4A 4AH9A 1R0AA 1T05A 4FK0A 3KK3A 3K58A 4FLYA 5HBMA 1QSSA 4CEZA 3OY9A 2DTUA 4B8AB 3OYGA 1KFDA 3SYZA 3NGYA 1RTDA 2HHTA 4OPKA 3VQCA 1NK4A 4K8XA 3C94A 4DQPA 2BDPA 2DFFA 3HT3A 3V9UA 3NF6A 3RWUA 1YVUA 3AO5A 3AVIA 4E3SA 4BE0A 3DLGA 1U4BA 3AO3A 4AHVA 4LH4A 4CHYA 1SKRA 1T03A 3HP9A 3ZT3A 1Q9XA 3M8RA 1T8EA 1UOCA 3WNGA 3NHGA 4F2RA 1RNHA 1BIUA 2YNIA 4OGEA 2P1JA 4CK3A 3DOLA 1S9EA 4HUEA 1X9WA 3SUQA 4JRQA 3SUPA 1L5UA 3M8PA 4IDKA 1NK7A 3CFOA 2OPQA 3IRXA 3AVGA 1NKCA 1RILA 2HNDA 4AHRA 4L8RB 1FKOA 1X9MA 2HHUA 1RBVA 1XHXA 4CEBA 3AA5X 1SL1A 2VG6A 4O5BA 1RT4A 1QSLA 5JS1A 1ITGA 4MFBA 4HUGA 3OJUA 3HM9A 4KHWA 2EX3A 2B4JA 4DTUA 1UA1A 4BE2A 3DI6A 3I0SA 3LZJA 1BL3A 4I2PA 3PUFA 1QSYA 3OYFA 1BHLA 1NOZA 2A1SA 3C95A 2F8SA 1KTQA 3TR8A 4FLTA 1EP4A 2RF2A 4FJJA 4PA1A 3OYBA 1ZBHA 4FVMA 1RTIA 3VQPA 3ZSYA 1C0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JGU A;  3VQ7 A;  1VSI A;  4B8C A;  1WAJ A;  2XHB A;  2ZE2 A;  3NAE A;  4FJG A;  3A2F A;  3DLK A;  4IFV A;  1WAF A;  4BWM A;  3QIN A;  1KLN A;  3E01 A;  1LAW A;  3T19 A;  1WSH A;  2OPP A;  3KLE A;  1QTM A;  1G15 A;  2OYQ A;  2FBX A;  3ASM A;  3LPT A;  2IDO A;  2Z1J A;  1XI1 A;  2XRI A;  4HCB A;  4FYD A;  2KQ2 A;  2OPS A;  4KTW A;  1SV5 A;  2ZD1 A;  4FZZ A;  4E7I A;  3QNO A;  4HVJ A;  1XWL A;  1U04 A;  1JL1 A;  3EYZ A;  3K59 A;  4QCL A;  1TGO A;  3V9X A;  1LWF A;  4DQS A;  3ZSO A;  3SPY A;  4CGF A;  2YKM A;  4CJF A;  4DFM A;  3KK2 A;  3SV4 A;  3NF8 A;  3CFP A;  1Z25 A;  3AVF A;  1KCF A;  4B9U A;  4AHT A;  4CFB A;  2DFE A;  1J9A A;  1JLF A;  1UWB A;  4FW2 A;  3SQ2 A;  4C8L A;  4HCC A;  4PWD A;  1QHT A;  5FDL A;  4EZ9 A;  3HK2 A;  3TAE A;  2RPI A;  3SZ2 A;  1VSK A;  5JS2 A;  3SQ1 A;  3IAY A;  4Z4G A;  3ITH A;  4NCG A;  4J2B A;  1BQN A;  1RBU A;  4B3O A;  5FRO A;  1RBT A;  3WNH A;  3HXM A;  4FLW A;  4DTP A;  3DLB A;  2HHX A;  4IG0 A;  2IOC A;  1CLQ A;  1B92 A;  3QNN A;  1ZBL A;  4CF0 A;  4M42 A;  2HVH A;  3RRG A;  3V1O A;  3TAF A;  4CJP A;  3L2U A;  2HB5 A;  4GW6 A;  1S1W A;  3SPZ A;  4CGJ A;  3VQ6 A;  3G0Z A;  4LH5 A;  1KSP A;  1JLC A;  4CGG A;  2YKN A;  1T7P A;  1RDA A;  4Z4C A;  1VSL A;  4G1Q A;  3LP0 A;  3K5M A;  5E41 A;  3VQ4 A;  2G8V A;  2KZZ A;  3TAG A;  4ID5 A;  3DMJ A;  3K2P A;  3CYM A;  3LAM A;  4LSL A;  3L2V A;  3MAQ A;  2JLE A;  4DQI A;  2YV0 X;  3IG1 A;  3EZ5 A;  4KO0 A;  2PYJ A;  3M8S A;  5CZ2 A;  3MED A;  2XO7 A;  3AO2 A;  4DQR A;  5HRO A;  1D9F A;  4J2E A;  2FBT A;  4M3R A;  4DU3 A;  5C24 A;  4RW4 A;  3V9W A;  1RTH A;  4CJR A;  2F96 A;  3B6O A;  3NGZ A;  4FJI A;  2IC3 A;  1NJY A;  4FW1 A;  4KI6 A;  4KTZ A;  4DWI A;  4FZX C;  1NOY A;  1O1W A;  4DSI A;  1ZBF A;  3QES A;  2OZM A;  1Y97 A;  4DMN A;  3P1G A;  1ASU A;  1XHZ A;  1C1C A;  2BAN A;  5HRN A;  3I8D A;  3LWM A;  4IFY A;  3K57 A;  4CFA A;  3S3O A;  4O55 A;  2XY7 A;  5J2M A;  4O0J A;  1KRP A;  1SKS A;  2GV9 A;  2BGG A;  3ZSQ A;  1RT7 A;  3HPG A;  1L3S A;  3HVR A;  3HYF A;  4NCB A;  4O0I A;  1NKE A;  3TWH A;  4CEF A;  4CES A;  1RTJ A;  4NYF A;  5FRN A;  4CJT A;  3AO1 A;  1BCM A;  1VRU A;  4KRE A;  1JLQ A;  4AIL C;  1BIZ A;  1J53 A;  1QS4 A;  3ZSZ A;  3ALY A;  4E7L A;  3P5J A;  3WNE A;  2FBY A;  2G8U A;  4KHS A;  3HO1 A;  3C6U A;  1TKX A;  4CEA A;  2HNZ A;  3OS0 A;  4ZTJ A;  1N5Y A;  3T3F A;  3AVN A;  1VSH A;  4B9T A;  1EX4 A;  1EXQ A;  1HQE A;  4M3Y A;  3RR8 A;  3TI0 A;  4O44 A;  3ZT2 A;  4FM1 A;  4E1M A;  3UIQ A;  4Y1D A;  4PY5 A;  2HHS A;  5KRS A;  3NH0 A;  2HW3 A;  4FM0 A;  3PY8 A;  3NFA A;  4CGD A;  1YT3 A;  3U3Y A;  4DTM A;  1RBR A;  3V9Z A;  4E19 A;  2G8W A;  1QE1 A;  2X6N A;  4WE1 A;  1NJX A;  4DSE A;  5CYQ A;  4MQ3 A;  4C8O A;  4CIF A;  3OYC A;  3VQ8 A;  3O3H A;  1S1U A;  1JLB A;  2P51 A;  1U49 A;  2D0B A;  1D5A A;  4OPJ A;  1C0U A;  4DS4 A;  1S9G A;  2X74 A;  4CK1 A;  1BGX T;  1JLA A;  3H08 A;  4HHT A;  2RKI A;  1GOA A;  3V81 A;  3OS2 A;  4M3W A;  4DU1 A;  1U47 A;  4E89 A;  2E6L A;  1HNV A;  3F9K A;  1TK0 A;  4J2D A;  3ULD A;  2OPR A;  3NF7 A;  3HPO A;  4Q5V A;  4JS5 A;  3JYT A;  4ZHR A;  3L3V A;  2Q3S A;  2VG7 A;  1B9F A;  3LPU A;  4I7F A;  4RG8 A;  3VQB A;  4CF8 A;  4HTU A;  2IAJ A;  4DTX A;  4DTO A;  3VN5 A;  4DSL A;  1KVC A;  1S1V A;  2YHB A;  3D45 A;  3MEC A;  4B08 A;  1RT2 A;  3OYH A;  3SUN A;  2X78 A;  3SQ0 A;  3AA2 A;  3MXM A;  3OYD A;  3DLH A;  3KLG A;  4ELU A;  4FJN A;  1KVB A;  1RT5 A;  4CCH A;  4FLV A;  3V1Q A;  2QK9 A;  1VRT A;  4FK2 A;  4KHQ A;  1TL1 A;  4KB0 A;  1C6V A;  4CJW A;  4FJ9 A;  5KTQ A;  3B6P A;  1Z26 A;  3TAR A;  5KI6 A;  1A5X A;  4CF1 A;  4N76 A;  3M8Q A;  4CEC A;  3JSM A;  3NH1 A;  4CHQ A;  4C8N A;  3K5L A;  1D9D A;  4C8M A;  3AVK A;  4CGI A;  3DRR A;  3HP6 A;  3TAB A;  1CXU A;  1DTT A;  5J1E A;  3RTV A;  2PZS A;  2D5R A;  2Z1H A;  5CY4 A;  3V9S A;  4W5R A;  3KTQ A;  2ATQ A;  3QEV A;  4IKF A;  2QKB A;  4FCY A;  2E6M A;  3WNF A;  2NUB A;  1WN7 A;  4KKO A;  3NBP A;  1N6Q A;  4F3T A;  3AVH A;  1JL2 A;  4CJ4 A;  4DFJ A;  4GVM A;  2ETJ A;  2XY8 A;  4RW9 A;  1S6Q A;  1LAV A;  3V6D A;  4CEE A;  3KLF A;  4ICL A;  3NE6 A;  2B6A A;  4JLH A;  4W5Q A;  3QEP A;  4KAZ A;  2F8T A;  1JKH A;  3L2W A;  3LZI A;  4DTS A;  4RW6 A;  4OKJ A;  5EU7 A;  1VSM A;  3L2R A;  4LSN A;  4FZY A;  4CK2 A;  4RW8 A;  5HRS A;  1ZBI A;  4I9L A;  3DLE A;  3RMC A;  4CJU A;  3TAP A;  1TK5 A;  4KHU A;  1WSI A;  4FXD A;  3PX6 A;  3RMB A;  2XY5 A;  2E4L A;  3AV9 A;  3MXJ A;  3OYL A;  5KGW A;  3OYI A;  3QEI A;  3PX0 A;  3DOK A;  1ZBU A;  4CJK A;  1RT3 A;  1NK5 A;  1SL2 A;  4H4M A;  1SUQ A;  2P5O A;  3KLI A;  4CEO A;  4CHZ A;  2KFZ A;  5I3U A;  4KHN A;  1BIS A;  1DLO A;  4CJS A;  1BI4 B;  2FBV A;  3QO9 A;  4YNQ A;  4KTQ A;  3VQD A;  1S1T A;  4NYN A;  3KJV A;  1HRH A;  1JXB A;  3MEG A;  3DM2 A;  3HL8 A;  3KKS A;  4DQQ A;  4DTN A;  4DF8 A;  4OLB A;  3PX4 A;  1QQC A;  3DLR A;  4KV8 A;  4CJL A;  1TKD A;  1WNS A;  4EZ6 A;  4FJM A;  2O4I A;  4QAG A;  4OVL A;  4E7K A;  3KD5 E;  2O4G A;  1JLE A;  1YTU A;  2VWJ A;  5I42 A;  3S3N A;  3O4N A;  3V1R A;  1NK8 A;  1WSG A;  1B9D A;  3KIO A;  5T7B A;  4CJV A;  3CM5 A;  2D0A A;  2HHQ A;  1HPZ A;  3SI6 A;  1X1P A;  5J2N A;  3IS9 A;  4F8R A;  1HJR A;  3SQ4 A;  4BDP A;  4Z4F A;  2HVI A;  1IO2 A;  4RW7 A;  4CJE A;  3L8B A;  2QKK A;  3S3M A;  3HST B;  4TSX A;  1KLM A;  1IKV A;  3KK1 A;  2W42 A;  1W0H A;  2HNY A;  3OYK A;  5HRP A;  2G8K A;  2KZM A;  1KFS A;  3OYE A;  3OJS A;  4LD0 A;  4Z4H A;  1BQM A;  4CHO A;  3AVL A;  1NJW A;  2ZQB A;  1J54 A;  3AVA A;  5C42 A;  3OYN A;  4BWJ A;  2Z1G A;  1ASV A;  3LP2 A;  4DLG A;  4CIG A;  3OS1 A;  4N56 A;  3VQQ A;  1HYZ A;  4CF9 A;  4KPY A;  1UAX A;  4N5S A;  4F3O A;  1REV A;  3AVC A;  1C1B A;  5SZT A;  3NDK A;  5HRR A;  4BDZ A;  2OA8 A;  2XY6 A;  3PO4 A;  1NK9 A;  3BGR A;  2IGI A;  4DSK A;  4Z4E A;  3D0P A;  1LV5 A;  5KRT A;  1K6Y A;  1NK0 A;  3MXI A;  1EET A;  3LDS A;  3RR7 A;  3PO5 A;  3HJF A;  3VQE A;  5DMR A;  1GOC A;  4CE9 A;  2ITG A;  4CHP A;  1VSJ A;  1LWE A;  2WOM A;  4CEQ A;  1L3U A;  1D8Y A;  1WSJ A;  3LP3 A;  4PUO A;  4B9S A;  4BDY A;  1J5O A;  2PYL A;  2AJQ A;  3AVJ A;  3BDP A;  4OGC A;  1FK9 A;  4YFU A;  3F73 A;  4ZTF A;  1X9S A;  2P5G A;  2GUI A;  1CZ9 A;  4UQG A;  4DFP A;  4M3X A;  2YNF A;  1U48 A;  4W5N A;  1NKB A;  3U3G A;  1HYS A;  3MEE A;  4KHY A;  4AHU A;  3CQ8 A;  2Z1I A;  4PQU A;  1EKE A;  4IG3 A;  1Q9Y A;  1IKY A;  2HMI A;  1IKW A;  3OYA A;  4KFB A;  3C6T A;  2RN2 A;  2Y1I A;  4E0D A;  4E7J A;  1TV6 A;  5CZ1 A;  5CYM A;  3OVN A;  3U6F A;  3VQA A;  4ELV A;  2I5J A;  1ZYQ A;  4DU4 A;  4B9N A;  5DK5 A;  1DTQ A;  3QIP A;  2FC0 A;  3ZSW A;  2DFH A;  3HVT A;  4DTR A;  1L3T A;  4FJ7 A;  4BE1 A;  1A5W A;  1RDD A;  2VG5 A;  4DS5 A;  4KRF A;  3VA3 A;  3DRS A;  1HNI A;  3NH2 A;  2G8H A;  4CIE A;  1TVR A;  3O3G A;  4DFK A;  3G10 A;  1JLG A;  4CHN A;  2R7Y A;  1TKT A;  4O4G A;  4CFC A;  1HQU A;  1NK6 A;  4FJ5 A;  3RMD A;  4QOZ B;  4DSJ A;  3QET A;  1BCO A;  3PV8 A;  4CJQ A;  2KFN A;  4R5P A;  3L3U A;  4M3Z A;  1W9H A;  2EHG A;  3P83 D;  1VSE A;  3NF9 A;  3ISN C;  3LP1 A;  4OJR A;  4B9L A;  4CJ3 A;  5D3G A;  4C8K A;  1RT1 A;  1FXX A;  2DY4 A;  4FJL A;  1WLJ A;  3LAL A;  3QER A;  3O4Q A;  3RMA A;  2Y1J A;  3AA3 A;  2B5J A;  4FLZ A;  3KD1 E;  4KI4 A;  1MU2 A;  1HYV A;  1LW2 A;  3DRP A;  2YNG A;  4EP4 A;  1S1X A;  1RDB A;  1F21 A;  3K5N A;  3SUO A;  1CZB A;  5KGX A;  3AA4 A;  1GOB A;  3EY1 A;  3SV3 A;  3NGI A;  4Z0U A;  2D0C A;  2IS3 A;  2YHA A;  2KW4 A;  3O3F A;  3TAM A;  3SNN A;  4ELT A;  4M3T A;  3LAK A;  4H4O A;  1IG9 A;  4OKE A;  3FFI A;  2LSN A;  1Q8I A;  3CG7 A;  3ZT0 A;  4FJX A;  4CGH A;  3VQ9 A;  4XIU A;  4JRP A;  3HPH A;  3ZSX A;  2X6S A;  1KVA A;  4NCA A;  5C25 A;  3QLH A;  2VWK A;  4Z4I A;  5K14 A;  1LW0 A;  1S6P A;  4FLU A;  4DF4 A;  4EP5 A;  5SWM A;  4FM2 A;  1BI4 A;  4HUF A;  3THV A;  3NCI A;  3LAN A;  3TAN A;  3ZSR A;  4F2S A;  1RCH A;  1RBS A;  4B9M A;  1ASW A;  4FJ8 A;  1SL0 A;  2HHW A;  3K5O A;  4CFD A;  3AVB A;  3KLH A;  1XC9 A;  2HHV A;  4CF2 A;  4AHS A;  4OLA A;  2KTQ A;  4LY7 A;  1WSF A;  1I3A A;  1IH7 A;  4CER A;  4Y1C A;  3CM6 A;  1WSE A;  4DG1 A;  3RRH A;  4BAC A;  1NJZ A;  4DSF A;  1LWC A;  3ZCM A;  4FJH A;  4GMJ B;  2WON A;  2A1R A;  3AVM A;  3TAQ A;  4E1N A;  4M41 A;  1FKP A;  5FRM A;  1RDC A;  3AO4 A;  4M45 A;  5HP1 A;  1VSF A;  1YTA A;  2GBZ A;  3SJJ A;  4W5O A;  3CFR A;  4CED A;  3DYA A;  4Q0B A;  3VQ5 A;  4DLE A;  2PY5 A;  4N41 A;  2YNH A;  3S9H A;  3QEW A;  4J2A A;  2G8I A;  4FJK A;  4M3U A;  4IBN A;  1SKW A;  2OZS A;  4W5T A;  3QEX A;  2BE2 A;  1C1A A;  4I2Q A;  4JS4 A;  2G8F A;  3VA0 A;  3OYM A;  3L2Q A;  1TAU A;  1U45 A;  4F4K A;  3QIO A;  5HLF A;  4I9Q A;  3V4I A;  1JXE A;  1VK0 A;  1HMV A;  3KKR A;  3SCX A;  2QXF A;  3ZT1 A;  4E7H A;  4K8Z A;  1A5V A;  1VSD A;  1IKX A;  3I0R A;  1C0T A;  4AHC A;  5J2Q A;  1TK8 A;  4KB1 A;  1S5J A;  1UA0 A;  4H8K A;  3OYJ A;  3ZT4 A;  4B9V A;  4FLX A;  1RT6 A;  3T1A A;  1TL3 A;  1TAQ A;  1I39 A;  4OKK A;  4CJ5 A;  4DTJ A;  1TKZ A;  5J2P A;  1CXQ A;  3LWL A;  3ZSV A;  4ID1 A;  1L3V A;  4N47 A;  4FK4 A;  4AH9 A;  1R0A A;  1T05 A;  4FK0 A;  3KK3 A;  3K58 A;  4FLY A;  5HBM A;  1QSS A;  4CEZ A;  3OY9 A;  2DTU A;  4B8A B;  3OYG A;  1KFD A;  3SYZ A;  3NGY A;  1RTD A;  2HHT A;  4OPK A;  3VQC A;  1NK4 A;  4K8X A;  3C94 A;  4DQP A;  2BDP A;  2DFF A;  3HT3 A;  3V9U A;  3NF6 A;  3RWU A;  1YVU A;  3AO5 A;  3AVI A;  4E3S A;  4BE0 A;  3DLG A;  1U4B A;  3AO3 A;  4AHV A;  4LH4 A;  4CHY A;  1SKR A;  1T03 A;  3HP9 A;  3ZT3 A;  1Q9X A;  3M8R A;  1T8E A;  1UOC A;  3WNG A;  3NHG A;  4F2R A;  1RNH A;  1BIU A;  2YNI A;  4OGE A;  2P1J A;  4CK3 A;  3DOL A;  1S9E A;  4HUE A;  1X9W A;  3SUQ A;  4JRQ A;  3SUP A;  1L5U A;  3M8P A;  4IDK A;  1NK7 A;  3CFO A;  2OPQ A;  3IRX A;  3AVG A;  1NKC A;  1RIL A;  2HND A;  4AHR A;  4L8R B;  1FKO A;  1X9M A;  2HHU A;  1RBV A;  1XHX A;  4CEB A;  3AA5 X;  1SL1 A;  2VG6 A;  4O5B A;  1RT4 A;  1QSL A;  5JS1 A;  1ITG A;  4MFB A;  4HUG A;  3OJU A;  3HM9 A;  4KHW A;  2EX3 A;  2B4J A;  4DTU A;  1UA1 A;  4BE2 A;  3DI6 A;  3I0S A;  3LZJ A;  1BL3 A;  4I2P A;  3PUF A;  1QSY A;  3OYF A;  1BHL A;  1NOZ A;  2A1S A;  3C95 A;  2F8S A;  1KTQ A;  3TR8 A;  4FLT A;  1EP4 A;  2RF2 A;  4FJJ A;  4PA1 A;  3OYB A;  1ZBH A;  4FVM A;  1RTI A;  3VQP A;  3ZSY A;  1C0M A; 
#chains in the Genus database with same CATH topology
 2JGU A;  4B8C A;  2Q0U A;  4IFV A;  1KLN A;  3IDH A;  4H0X B;  3E01 A;  1KAX A;  4JN4 A;  1WSH A;  2V52 B;  4BVO A;  3ASM A;  2BUP A;  1DKG D;  2Z1J A;  2XRI A;  1IBK K;  4FYD A;  4IEI A;  2OPS A;  1K8K B;  1SV5 A;  2ZD1 A;  4FZZ A;  1BG3 A;  2JWK A;  4E7I A;  4K0K K;  4HVJ A;  1JL1 A;  3K59 A;  1TGO A;  3V9X A;  2OTJ N;  4B1Y B;  3ZSO A;  3VF4 A;  4CJF A;  1WB9 A;  3AVF A;  2DFE A;  1NGH A;  4FW2 A;  4PWD A;  1GLA G;  1QHT A;  4YY3 K;  3HK2 A;  1WUA A;  1VSK A;  1NGG A;  4IEE A;  4NCG A;  5FRO A;  3HXM A;  3WNH A;  3I33 A;  2HHX A;  2GTD A;  4ISE A;  4JHD A;  4M42 A;  3RRG A;  4H0V B;  1VQ7 N;  5F0X A;  4GW6 A;  1S1W A;  3N4Q A;  4CGJ A;  3VQ6 A;  3SMP A;  1P90 A;  3EO3 A;  3ZET B;  2ZJR L;  1VSL A;  4G1Q A;  3LP0 A;  5DM7 L;  3K5M A;  5E41 A;  5F2R A;  3TAG A;  3K9K A;  4LSL A;  3P39 A;  2VQE K;  4DQ8 A;  3DWL A;  3IG1 A;  4M63 C;  3MED A;  4KHP K;  2WFB A;  4DU3 A;  4RW4 A;  3V9W A;  4CJR A;  2CH5 A;  2J4R A;  1SAZ A;  1Y97 A;  1XHZ A;  1C1C A;  5HRN A;  3I8D A;  3H46 O;  4OO1 J;  1XMO K;  2BGG A;  5AZJ A;  1N33 K;  2YHY A;  4O0I A;  2P9I B;  3AO1 A;  3CJC A;  1QS4 A;  5E26 A;  3ZSZ A;  2G8U A;  3HO1 A;  1C0F A;  3ATV A;  3A5N C;  4Y0W A;  4ZTJ A;  1N5Y A;  3AVN A;  4B1V A;  3UKR B;  3BUZ B;  1W7A A;  4E1M A;  4PY5 A;  5AZI A;  4NXM K;  2QM1 A;  3NFA A;  5AQQ A;  3BP8 A;  1RBR A;  3V9Z A;  3TSU A;  2X6N A;  2YJF A;  3TTC A;  1NJX A;  3A0I X;  4C8O A;  3OYC A;  1MDU B;  3VQ8 A;  1OH7 A;  3O3H A;  1JLB A;  4NLB A;  2D0B A;  3LM2 A;  4JI4 K;  2X74 A;  4HHT A;  4DU1 A;  4H5R A;  2E6L A;  3E1Y A;  3O1W A;  4F9O A;  3NF7 A;  3GE1 A;  3JYT A;  1OKJ A;  3VET A;  3TPQ A;  2Q3S A;  3CCM N;  2VG7 A;  3DXK A;  4WQ5 C;  1TAU A;  4FK2 A;  1QVF M;  1S1V A;  1P8Z A;  2UUA K;  3F2K A;  3SQ0 A;  3KLG A;  1RT5 A;  4CCH A;  4FPA A;  5JLH A;  1U2V A;  5JIC A;  1VRT A;  5FLX O;  4KB0 A;  3P38 A;  5GAD P;  1VQK N;  3U9D A;  4H5V A;  1IV0 A;  3VEW A;  4CEC A;  3JSM A;  4CHQ A;  3AVK A;  1DTT A;  3RTV A;  4W5R A;  4IKF A;  3QEV A;  3T69 A;  3S41 A;  1WN7 A;  4CJ4 A;  4GVM A;  1T6C A;  4GV6 A;  3V6D A;  3KLF A;  4ICL A;  3TSP A;  4JLH A;  4DV5 K;  3LZI A;  3E66 A;  4DTS A;  4OKJ A;  3L2R A;  5M1K A;  2YJE A;  4BGA A;  2OCE A;  3NMU A;  5TKW A;  5AJ3 K;  2P9P B;  3TAP A;  3PX6 A;  3RSE A;  3AV9 A;  1BA0 A;  3G25 A;  1SL2 A;  1ZBU A;  4CHZ A;  2KFZ A;  5I3U A;  1BIS A;  2VCP A;  2A42 A;  4YNQ A;  5C0Y A;  3HL8 A;  3THW A;  3PX4 A;  4U7B A;  2E88 A;  3DLR A;  4KV8 A;  4CBX A;  1TKD A;  2O4I A;  1HKB A;  4OVL A;  4QAG A;  4E7K A;  1JLE A;  5I42 A;  1N36 K;  3IMX A;  1XUP O;  1T44 A;  4PKH A;  5T7B A;  1HPZ A;  4YOR A;  4F8R A;  3SQ4 A;  4BDP A;  1NMN A;  2HVI A;  1XC3 A;  1IO2 A;  2QKK A;  1KQS M;  3S3M A;  4TSX A;  4QS8 A;  2G8K A;  2HNY A;  3MMV A;  5AQJ A;  1BQM A;  4WFN L;  1NJW A;  2ZQB A;  1J54 A;  3LL3 A;  4ILJ A;  4FWL A;  4EFH A;  4DLG A;  1Q18 A;  3OS1 A;  1HYZ A;  4ILG B;  1VQL N;  3O5B A;  3QIC A;  5AQG A;  4BRE A;  5HRR A;  4JKD A;  3BGR A;  2IGI A;  4DSK A;  2FSK A;  4ILH A;  1NK0 A;  1NJI O;  2GWJ A;  2ASM A;  2NRR A;  5DM6 L;  4DV7 K;  4CE9 A;  1GOC A;  4CHP A;  2ITG A;  4CEQ A;  3FZF A;  3RVC A;  1OVY A;  5AQU A;  2PYL A;  5BPN A;  1FK9 A;  4YOU A;  4YFU A;  2GUI A;  2UXD K;  3ID6 A;  4DHY A;  2E5L K;  2QEX N;  2VYP A;  3U3G A;  1HYS A;  3MX2 A;  3MEE A;  4X66 K;  4PQU A;  1IKY A;  2P9K B;  3J80 O;  4DV3 K;  1NBW A;  2Y1I A;  4JNE A;  3U6F A;  3CJ9 A;  3VQA A;  5AR0 A;  2I5J A;  1DTQ A;  2FC0 A;  3ZSW A;  2DFH A;  3HVT A;  1KD1 O;  4BE1 A;  4A5A A;  3O9Q A;  2W40 A;  5GAE P;  1HNI A;  5A2Q O;  3NH2 A;  4XH1 A;  2G8H A;  4CHN A;  2P9S A;  1HQU A;  4FJ5 A;  4QOZ B;  1X3N A;  3QET A;  1BCO A;  5AQS A;  4CJQ A;  4R5P A;  4M3Z A;  1W9H A;  3SAG A;  3NF9 A;  2D0O A;  3LP1 A;  4OJR A;  5IWA K;  3CC7 N;  1FXX A;  1WOQ A;  4FJL A;  3R6M A;  1OH8 A;  2Y1J A;  4LF7 K;  3AA3 A;  2B5J A;  4KI4 A;  1HYV A;  1LW2 A;  1NM1 A;  1EWR A;  4LF8 K;  3AA4 A;  4BC3 A;  4Z0U A;  2D0C A;  2IS3 A;  4CZG A;  2KW4 A;  4ELT A;  3LAK A;  4CBU A;  1ILY A;  4IOX A;  3FFI A;  2LSN A;  3CME N;  3ZT0 A;  4FJX A;  4CGH A;  1KVA A;  5C25 A;  1Z05 A;  5K14 A;  1S6P A;  2GX9 A;  4DF4 A;  1XQS C;  1BI4 A;  3ENH A;  3I56 N;  1RCH A;  1ASW A;  3K9J A;  3KWG A;  3CCV N;  4DV1 K;  4CFD A;  1RGI A;  1XC9 A;  4NXN K;  1MA9 B;  1G99 A;  2QXL A;  2E8A A;  4AM7 A;  4LY7 A;  4Y1C A;  1NGD A;  2KLA A;  1YIJ N;  1NGC A;  5M1O A;  1KC8 O;  4KBO A;  4CD3 A;  1YI2 N;  2D4W A;  2GBZ A;  3SJJ A;  1J6Z A;  3CFR A;  4CED A;  3LDN A;  4DLE A;  2HMP A;  1W2B M;  4Z94 A;  2PY5 A;  3WEE A;  3QEW A;  5MLC Q;  2P9U B;  3H6E A;  3QEX A;  1C1A A;  3VA0 A;  4BRH A;  2Q0R A;  4IWV A;  1V4S A;  1QHA A;  4FWN A;  4I9Q A;  3V4I A;  1JXE A;  3SCX A;  1YJW N;  3CMA N;  1TYQ A;  3ZT1 A;  1DT9 A;  2PFU A;  4B9V A;  3T1A A;  1TL3 A;  1SQK A;  1I39 A;  3SUO A;  3ZSV A;  3VTH A;  1R0A A;  1VQO N;  4FWR A;  4YOY A;  5LY3 A;  4B8A B;  3OYG A;  1RTD A;  4K8X A;  3C94 A;  3PIO L;  2BDP A;  3WXL A;  4BRQ A;  3HT3 A;  1BU6 O;  3V9U A;  3RWU A;  4E3S A;  3MN5 A;  4DV6 K;  2F9T A;  4JKH A;  4BE0 A;  1YJ9 N;  3AAP A;  3AO3 A;  1Q9X A;  3M8R A;  3CXC M;  4OGE A;  1L5U A;  4A61 A;  2A41 A;  5GAG P;  1K8A O;  4R79 A;  5BR9 A;  3IRX A;  4L8R B;  3O1B A;  1QSL A;  2EX3 A;  2B4J A;  1GLC G;  1UA1 A;  4A57 A;  3ID8 A;  2O8C B;  2F8S A;  4JKG A;  2YI1 A;  4FLT A;  1EP4 A;  2RF2 A;  5BR8 K;  3WXM B;  4UY8 O;  3HTV A;  3OYB A;  2GEL A;  1C0M A;  3FFK B;  3WXK A;  2XHB A;  1EQY A;  4FJG A;  2OPP A;  3CQY A;  4AF1 A;  3VEY A;  4B9Q A;  4HCB A;  2ZGY A;  2ZM6 K;  3CIP A;  4JKE A;  4KTW A;  4K42 A;  2Q2R A;  1XWL A;  1U04 A;  4JKA A;  4YOX A;  5HL7 L;  3LDP A;  3QML A;  3SPY A;  5KPZ A;  2YKM A;  3CET A;  4DFM A;  3NF8 A;  3CCL N;  1X9J A;  2CGK A;  2P9N B;  1UWB A;  2Q1N A;  4HCC A;  3FLC O;  3EKS A;  5TKY A;  4EZ9 A;  2RPI A;  5JS2 A;  3AAQ A;  4J2B A;  1RBU A;  2NNW A;  2QTD A;  3WQT A;  4IOA L;  4B3O A;  1IG8 A;  4GVE A;  4FLW A;  3DLB A;  2IOC A;  3MN7 A;  2HVH A;  1ZBL A;  1OVQ A;  3TAF A;  4CJP A;  2QWP A;  3L2U A;  2ZF5 O;  3SPZ A;  3H1V X;  1RDA A;  4Z4C A;  3VQ4 A;  2G8V A;  2KZZ A;  3DMJ A;  4M7Y A;  2BH1 A;  3ENB A;  3CYM A;  3K2P A;  5LJW A;  3MAQ A;  5ADX A;  4BG9 A;  2IIR A;  2YV0 X;  3EZ5 A;  4KO0 A;  4CZH A;  2XO7 A;  5HRO A;  4DQR A;  2FBT A;  4B1U B;  2KKZ A;  3NGZ A;  2VGN A;  4FW1 A;  4WQ4 A;  4KI6 A;  5H1S Q;  4FZX C;  1NOY A;  4DB3 A;  3ZEU A;  4DMN A;  4FWK A;  3P1G A;  1ASU A;  1GLJ O;  2BAN A;  5J2M A;  4O0J A;  1RT7 A;  1GLB G;  4NCB A;  3TWH A;  1X3M A;  1RDU A;  4NYF A;  5FRN A;  1BCM A;  3TTF A;  1BIZ A;  1J53 A;  3ALY A;  2FBY A;  3R1X A;  3UKR A;  1RFQ A;  4YOW A;  4B9T A;  4M3Y A;  1NLV A;  4FM1 A;  2HHS A;  3NH0 A;  1S72 N;  5AQZ A;  1ATN A;  1YT3 A;  2WC9 A;  4DR6 K;  3O4W A;  1QE1 A;  4WE1 A;  4MDB A;  1QQO A;  5CYQ A;  3C7N B;  4CIF A;  3MCP A;  4BRG A;  3AGR A;  4CK1 A;  1VQ4 N;  1BGX T;  2NRX A;  5EVZ A;  3D6R A;  3V81 A;  4M3W A;  3CCU N;  4H5T A;  1E3M A;  1XNQ K;  3F9K A;  4J2D A;  3ULD A;  4G9Z A;  3HPO A;  1JCG A;  2NLX A;  3J8A A;  4MO5 A;  2QWO A;  4RG8 A;  1B9F A;  3UIQ A;  4I7F A;  3VQB A;  4DSL A;  4DTO A;  1VQ9 N;  2YHB A;  1RT2 A;  3MXM A;  3OYD A;  4C23 A;  1GLF O;  1KVB A;  3EE9 A;  2QK9 A;  4HWI A;  4KHQ A;  4YOV A;  3CCQ N;  4CJW A;  3TAR A;  4BQL A;  4CF1 A;  3SAH A;  2GEM A;  4L3Q A;  4C8N A;  1J5E K;  1QZ5 A;  4C8M A;  4CGI A;  4FWQ A;  4JKC A;  3HP6 A;  5CR4 A;  2A5X A;  2Z1H A;  4DV2 K;  2ITM A;  3NBP A;  1N6Q A;  1JL2 A;  4DFJ A;  2NRH A;  4RW9 A;  5CHI A;  4CI6 A;  4KAZ A;  2F8T A;  4DR2 K;  4NB4 A;  3QEP A;  1JKH A;  1CZA N;  3L2W A;  4RW6 A;  4FZY A;  4CK2 A;  1ZBI A;  2ASO A;  4I9L A;  2EWS A;  3RMB A;  3PO5 A;  2E4L A;  3QEI A;  4Z4G A;  3OYI A;  2HBK A;  3HM8 A;  2ZJQ L;  3ZLJ A;  3KLI A;  2O8E B;  4XEI A;  5C15 A;  4KHN A;  1DLO A;  2PBD A;  4CJS A;  3FZM A;  4FL9 A;  4KTQ A;  2FSN A;  3VQD A;  2E2N A;  3KJV A;  3BY5 A;  3DM2 A;  4DTN A;  4DF8 A;  1QQC A;  5FPN A;  3DAW A;  3KD5 E;  1S22 A;  2Q31 A;  3GG4 A;  1YTU A;  4EHU A;  3S3N A;  1I94 K;  3O4N A;  4C1N I;  1B9D A;  3THY A;  2D0A A;  2CH6 A;  1X1P A;  3PSF A;  4J8F A;  3AY9 A;  1HJR A;  3TTD A;  3ATU A;  4H0P A;  1KLM A;  2W42 A;  1W0H A;  3OYK A;  5HRP A;  1KFS A;  4LD0 A;  3ZYY X;  3WUH A;  2KHO A;  3DXM B;  4FOI A;  5C42 A;  1NGJ A;  4BWJ A;  3D2F A;  2Z1G A;  2E2O A;  3VQQ A;  2O8B B;  4KPY A;  1UAX A;  4N5S A;  4F3O A;  5SZT A;  1R59 O;  3QBW A;  2XY6 A;  3PO4 A;  3D0P A;  3VTI A;  4CJ7 A;  1FJG K;  2Q36 A;  5DMR A;  5AQT A;  1VSJ A;  1LWE A;  2UUC K;  3ZX0 A;  1WSJ A;  3QB0 A;  4B9S A;  2AJQ A;  4GV3 A;  3AVJ A;  2P5G A;  4ZTF A;  4JAX A;  1X9S A;  1C0G A;  1CZ9 A;  1U48 A;  3M3Z A;  1HJO A;  4RTF D;  2VGM A;  4AHU A;  3CCS N;  2ZGZ A;  2Z1I A;  1EKE A;  1ZXO A;  1Q9Y A;  3HRG A;  1IKW A;  4KFB A;  1VQ8 N;  3C6T A;  2RN2 A;  1TV6 A;  5DK5 A;  1L3T A;  3DRS A;  3HOT A;  1H1V A;  3O3G A;  4NLC A;  2D0P A;  4BC5 A;  1QQM A;  2KFN A;  1OH6 A;  3P83 D;  1VSE A;  2HHH K;  3KZB A;  4B9L A;  4CJ3 A;  4PKG A;  2FF6 A;  4CZM A;  4X65 K;  4DUZ K;  2I7N A;  4BC2 A;  2DY4 A;  3QER A;  3O4Q A;  2E1Z A;  2WTU A;  1HNW K;  4EP4 A;  5KGX A;  3TSQ A;  3SV3 A;  3NGI A;  3O3F A;  4LF6 K;  3MN9 A;  4H4O A;  4OKE A;  1Q8I A;  3CG7 A;  4K41 A;  3MCA B;  5SWM A;  2FF3 B;  3AGK A;  4HUF A;  1K9M O;  3THV A;  4FJ8 A;  1Q82 O;  4B9M A;  1SL0 A;  3J7Z O;  2HHV A;  1KAY A;  4CF2 A;  3VER A;  4DCH A;  3CM6 A;  3MWT A;  4DG1 A;  4LF9 K;  4DSF A;  4JI8 K;  4FJH A;  3AVM A;  5FRM A;  4BR0 A;  2P9U A;  4N41 A;  3S9H A;  2G8I A;  2HF3 A;  4FJK A;  4FWO A;  2OZS A;  5AQN A;  4I2Q A;  5KPR A;  3OYM A;  3L2Q A;  4F4K A;  4JI1 K;  5HLF A;  4BRP A;  4H03 B;  3PLA A;  1VSD A;  1BWF O;  3I0R A;  4AHC A;  3CPW M;  4CBW A;  1UA0 A;  4H8K A;  3OYJ A;  4FLX A;  1RT6 A;  1VAZ A;  3LWL A;  2PAV A;  4FK4 A;  4FWP A;  3WXI A;  5EXW A;  3KK3 A;  3VEX A;  3K58 A;  3JXU A;  3L4I A;  5HBM A;  1QSS A;  3IUC A;  3NGY A;  4WF9 L;  4OPK A;  5JLF A;  1BA1 A;  2DFF A;  2E20 A;  1YF5 L;  1YVU A;  3EE8 A;  1JCF A;  3IFR A;  4AHV A;  4CHY A;  3HP9 A;  4CZF A;  3WNG A;  4F2R A;  3DOL A;  3SUQ A;  2QWL A;  5LMU K;  3M8P A;  4IDK A;  4LFB K;  3G71 N;  3F9M A;  3OBW A;  3CCR N;  3HI0 A;  2HHU A;  4EIA A;  4CEB A;  4YHH K;  2VG6 A;  1RT4 A;  1ITG A;  1LOT B;  3VOV A;  4HUG A;  2O8C A;  4DTU A;  5FPE A;  2Q97 A;  2HOE A;  1BL3 A;  4I2P A;  1QSY A;  1NOZ A;  1MWK A;  3C95 A;  4BR9 A;  4JD2 A;  2VQF K;  2FSJ A;  3L0Q A;  3THX A;  5AQK A;  4PA1 A;  2O8F A;  3LDL A;  3A5O C;  3VQP A;  3VQ7 A;  1VSI A;  1WAJ A;  3DJC A;  3UE5 A;  2ZE2 A;  3NAE A;  3DXK B;  1WAF A;  3QIN A;  2QWR A;  1LAW A;  3T19 A;  4IO8 A;  3CF5 L;  3KLE A;  2OYQ A;  1G15 A;  3GDQ A;  4H0Y B;  4KH5 A;  2IDO A;  2AP1 A;  1FW6 A;  1U2V B;  3O8M A;  4CZK A;  1NGB A;  3QNO A;  1E4F T;  4DQS A;  4BRL A;  3U8X A;  3KK2 A;  5AFU H;  3BZC A;  5EOY A;  4B9U A;  4AHT A;  4CFB A;  1K73 O;  4C8L A;  3SQ2 A;  3JAM O;  5FDL A;  3TAE A;  3CJ7 A;  3SZ2 A;  3SQ1 A;  3GOI A;  3CPE A;  1KAZ A;  1RBT A;  3EL2 A;  4WCE L;  1NGI A;  1B92 A;  3QNN A;  5KPT A;  3LM9 A;  3V1O A;  1GLD G;  1HKC A;  4CD1 A;  4AQY K;  3G0Z A;  4LH5 A;  1JLC A;  5GIO A;  1T7P A;  4BRK A;  3BEX A;  4ID5 A;  3LAM A;  4K25 A;  3O80 A;  2JLE A;  3CJB A;  2I7P A;  2PYJ A;  5CZ2 A;  4J2E A;  4M3R A;  3Q7C A;  5C24 A;  5CE3 A;  1RTH A;  2F96 A;  3B6O A;  4EHT A;  1NJY A;  5AQO A;  4DWI A;  4DSI A;  1O1W A;  4JKF A;  4YDU A;  1ZBF A;  2QWM A;  4IJA A;  2UXC K;  2OZM A;  4A62 A;  2ZJP L;  3LWM A;  4IFY A;  5GAH P;  4O55 A;  3VEV A;  3M1F A;  2GV9 A;  1L3S A;  3HPG A;  2JWL A;  3HVR A;  3HYF A;  2YHX A;  1NKE A;  4CEF A;  4CES A;  4CJT A;  1VRU A;  4KRE A;  3G6E N;  4AIL C;  4BR5 A;  4E7L A;  3MWP A;  4KHS A;  4B1W B;  3C6U A;  1VQP N;  1DEJ A;  2HNZ A;  4JI6 K;  3T3F A;  1EXQ A;  1HQE A;  3EEQ A;  3RR8 A;  3TI0 A;  4O44 A;  3ZT2 A;  3SBG A;  5AQL A;  4I6M B;  2HW3 A;  4FM0 A;  4CGD A;  3U3Y A;  4DTM A;  2G8W A;  4BQZ A;  5M1P A;  3QFP A;  5BRF A;  3OTO K;  4DSE A;  3PIP L;  1YXQ A;  1S1U A;  2QWQ A;  2HF4 A;  4OPJ A;  1C0U A;  4BGB A;  3O9U A;  3OS2 A;  1U47 A;  1TK0 A;  2OPR A;  3WXJ A;  1HLU A;  1MWM A;  4FSV A;  4ZHR A;  3L3V A;  4BY9 C;  4OLA A;  2P9L B;  2IAJ A;  1KVC A;  3D45 A;  3SUN A;  3MEC A;  4B08 A;  3CJA A;  3OYH A;  2X78 A;  3AA2 A;  3H45 C;  2IVP A;  4ELU A;  3FR0 A;  4FLV A;  3LDO A;  1RDW X;  2RE2 A;  2YHW A;  5AQV A;  1K8K A;  1C6V A;  3OA9 A;  5KI6 A;  1A5X A;  3M8Q A;  2P9S B;  3K5L A;  3HSC A;  3A5L C;  1ATR A;  1CXU A;  1VQ6 N;  2D5R A;  2FLO A;  2ATQ A;  2QKB A;  1M1K O;  4FCY A;  2E6M A;  3WNF A;  5I9E B;  1S6Q A;  4NO7 A;  2FXU A;  4MDA A;  4CEE A;  1ZC6 A;  3NE6 A;  3NVM A;  4B3R K;  3VEZ A;  4O8U A;  5EU7 A;  4LSN A;  3TU5 A;  1EO1 A;  4RW8 A;  5HRS A;  2YCH A;  1BDG A;  3ZET A;  2UXB K;  1HR0 K;  3DLE A;  4CJU A;  2W6K A;  4FXD A;  4BC4 A;  4CJK A;  1RT3 A;  3UKU B;  3ULE B;  3MN6 A;  1SUQ A;  4DKW A;  4CEO A;  4LFA K;  1BI4 B;  3L4Q A;  1S1T A;  3CJ1 A;  4NYN A;  3EKU A;  1HRH A;  1JXB A;  3GL1 A;  3P31 A;  2O8D B;  3KKS A;  4DQQ A;  5M1Q A;  4CJL A;  5M1N A;  4B3T K;  4M7X A;  4DUY K;  2VWJ A;  2H3G X;  1NK8 A;  1WSG A;  2V7Y A;  4FWM A;  4CJV A;  1N8R O;  4MLE A;  2P9I A;  3MX5 A;  1T3V A;  3MK6 A;  4CJE A;  3HST B;  2KZM A;  3B8A X;  3OJS A;  4Z4H A;  3AVL A;  3SAF A;  4A2B A;  3AVA A;  4HTL A;  4H5W A;  4CIG A;  4DR7 K;  1REV A;  1C1B A;  4BDZ A;  1NK9 A;  3N4P A;  4DV0 K;  1EET A;  3VGK A;  3HJF A;  1L3U A;  2IVO A;  2WOM A;  3LP3 A;  4PUO A;  4QS9 A;  4BDY A;  1J5O A;  4IJN A;  3BDP A;  4PHT X;  4UQG A;  4M3X A;  2YNF A;  1HNZ K;  4W5N A;  1OH5 A;  1IBL K;  2BTF A;  3CC4 N;  4KHY A;  4A2A A;  3CQ8 A;  4IG3 A;  3PSI A;  1SZ2 A;  3OYA A;  4WQ5 A;  4CW7 B;  5CZ1 A;  4ELV A;  2W41 A;  4B9N A;  1ZYQ A;  4DU4 A;  4QS7 A;  3QIP A;  4DTR A;  4FJ7 A;  1A5W A;  2VG5 A;  3VES A;  4DS5 A;  4KRF A;  3VA3 A;  4CIE A;  1TVR A;  3OBY A;  4DFK A;  3G10 A;  1JLG A;  1TKT A;  4O4G A;  4CFC A;  5GIN A;  1NK6 A;  4JI0 K;  3L3U A;  4JKG B;  3M5R A;  3R3L A;  3ISN C;  1NMD A;  5D3G A;  4XH5 A;  5ADX H;  4C8K A;  1WLJ A;  3LAL A;  5JVH L;  3R9P A;  4DR5 K;  1MU2 A;  5C12 A;  2E2P A;  1RDB A;  1F21 A;  3K5N A;  5BN9 A;  3EY1 A;  1GOB A;  4MLH A;  2HBM A;  3SNN A;  2YHA A;  4M3T A;  3TAM A;  3CC2 N;  2P9P A;  2ASP A;  4NCA A;  4Z4I A;  2X6S A;  3QLH A;  1LW0 A;  4EP5 A;  3VPZ A;  1D4X A;  3A5M C;  3LAN A;  4BRC A;  3NCI A;  4F2S A;  1RBS A;  2HHW A;  3CQX A;  3K5O A;  3AVB A;  4OPH A;  4GKJ K;  4CZJ A;  2KTQ A;  1WSF A;  1I3A A;  1IH7 A;  1N34 K;  1WSE A;  3SBT A;  3K0S A;  2A3Z A;  2A1R A;  4E1N A;  4M45 A;  1YTA A;  3SLC A;  4W5O A;  4OX9 K;  3DYA A;  5LJV A;  3VQ5 A;  2NRT A;  1HUX A;  4J2A A;  3H1Q A;  4M3U A;  4IBN A;  4W5T A;  4ISF A;  5HOO A;  2G8F A;  3VEO A;  3VGL A;  3QIO A;  3KHY A;  4XH4 A;  3KKR A;  3AAR A;  4B1Z A;  4DR3 K;  1YIT N;  4WQ4 C;  1IKX A;  1C0T A;  4KB1 A;  2UYT A;  3ZEU B;  4IFE A;  4OKK A;  4DTJ A;  5BPL A;  1CXQ A;  4ID1 A;  4N47 A;  4V19 S;  4AH9 A;  4FK0 A;  1T05 A;  2F4V K;  4CEZ A;  3D2E B;  1KFD A;  3SYZ A;  2HHT A;  4MO4 A;  3NF6 A;  4H0T B;  1VQN N;  3AO5 A;  4JK8 A;  3UB5 A;  4LF5 K;  1T03 A;  3ZT3 A;  1HKG A;  3LDQ A;  1T8E A;  1YHQ N;  1UOC A;  4CK3 A;  2P9K A;  1S9E A;  1E4G T;  3CFO A;  3IKM A;  2OPQ A;  3W3D A;  3AVG A;  2HND A;  4AHR A;  4O8K A;  1FKO A;  5AQY A;  2YX6 A;  1NGF A;  1X9M A;  4A59 A;  4MFB A;  3HM9 A;  3M6G A;  2UU9 K;  3PUF A;  3OYF A;  1BHL A;  3U4L A;  3TR8 A;  1JCE A;  5AQX A;  4FJJ A;  4FVM A;  1NWK A;  1RTI A;  2HST A;  1JJ2 M;  3A2F A;  3DLK A;  4BWM A;  2NZT A;  5C2D A;  4JI5 K;  3CD6 N;  5AQP A;  1QTM A;  2FBX A;  3LPT A;  1XI1 A;  5C10 A;  1NGE A;  4JK7 A;  2KQ2 A;  1BUP A;  4FVU A;  3EYZ A;  4JEP A;  4QCL A;  1LWF A;  1HPM A;  4CGF A;  1O13 A;  3SV4 A;  3CFP A;  1Z25 A;  3O6W A;  1KCF A;  4K43 A;  3EZW A;  3KWI A;  3CER A;  1J9A A;  1JLF A;  2E2Q A;  2OAN A;  4IZ9 A;  3IAY A;  1LCU A;  3ITH A;  3VF2 A;  1BQN A;  4B3M K;  4BRA A;  4DTP A;  4IG0 A;  1CLQ A;  4JI3 K;  1Y64 A;  4JK9 A;  4CF0 A;  4JKB A;  4RWT A;  5AQR A;  4JHD B;  2HB5 A;  3I8B A;  2OTL N;  1KSP A;  4CGG A;  2YKN A;  1ATS A;  4BG8 A;  3L2V A;  5FPM A;  4DQI A;  1N32 K;  4EAH D;  3M8S A;  3AO2 A;  1D9F A;  1Q86 O;  2E1Y A;  4GNI A;  4FJI A;  2IC3 A;  2A6A A;  3FZL A;  4KTZ A;  3CHW A;  4FO0 A;  4BR7 A;  3QES A;  2D1K A;  3HZ6 A;  3FZK A;  3S3O A;  3K57 A;  4CFA A;  1QQN A;  2XY7 A;  3Q7B A;  3THY B;  1SKS A;  1KRP A;  5AFU A;  2QW9 A;  3ZSQ A;  4BRN A;  4LF4 K;  3CI5 A;  1RTJ A;  5AZJ B;  5M1F A;  3VEN A;  4KH4 A;  1JLQ A;  1SS6 A;  4CZL A;  4BR4 A;  1U6Z A;  3P5J A;  3WNE A;  1M90 O;  1TKX A;  1Z6R A;  4CEA A;  3QFU A;  4IOC L;  3OS0 A;  2GWK A;  1VSH A;  1EX4 A;  3D2F B;  4I6M A;  5EX5 A;  3O9S A;  4BRO A;  4Y1D A;  1HNX K;  5KRS A;  5KQD A;  3PY8 A;  1BO5 O;  3ZX2 A;  3BF1 A;  5AZI B;  1YVN A;  4E19 A;  3HBT A;  4MQ3 A;  4JI2 K;  3HOS A;  2P51 A;  1U49 A;  1D5A A;  5AQW A;  4DS4 A;  1S9G A;  5ELZ A;  1JLA A;  3J81 O;  3H08 A;  2RKI A;  1GOA A;  5BRE A;  2QA4 N;  1WBB A;  4WYB A;  4E89 A;  2QI2 A;  1HNV A;  3QDK A;  4Q5V A;  2P9L A;  4JS5 A;  4LC9 B;  3LPU A;  4CF8 A;  4HTU A;  4DTX A;  3VN5 A;  3DLH A;  3G4S N;  5BPM A;  2CGL A;  4FJN A;  5GIP A;  3V1Q A;  3FZH A;  1TL1 A;  1Q81 O;  4FJ9 A;  5KTQ A;  3B6P A;  1Z26 A;  3CCE N;  1GLL O;  3L6Q A;  4BRD A;  2NRV A;  3DLL L;  4N76 A;  1NU0 A;  3NH1 A;  1D9D A;  3DRR A;  4LFC K;  3TAB A;  5J1E A;  2PZS A;  2P9N A;  5EY4 A;  1ZBS A;  5CY4 A;  3I55 N;  3V9S A;  2V7Z A;  3KTQ A;  1KXP A;  2NUB A;  4KKO A;  4F3T A;  3AVH A;  2ETJ A;  2XY8 A;  1BOT O;  1LAV A;  5AQH A;  2B6A A;  5FPD A;  4W5Q A;  3C6A A;  3EN9 A;  3D7E O;  1VSM A;  2VWB A;  3CCJ N;  2IVN A;  2HBJ A;  1TK5 A;  3UKU A;  3ULE A;  3RMC A;  3C65 A;  4FWS A;  1WSI A;  4BVP A;  4KHU A;  2XY5 A;  3MXJ A;  1DGK N;  3OYL A;  5KGW A;  3PX0 A;  3DOK A;  1NK5 A;  3MDQ A;  4H4M A;  2P5O A;  3RSE B;  5B8H A;  3BZK A;  2WUS A;  2O8D A;  5LL6 Z;  2FBV A;  3QO9 A;  4GY2 B;  2RHK A;  1V4T A;  2NRZ A;  3MEG A;  4OLB A;  4JYA K;  4FJM A;  5IT9 O;  1VQ5 N;  1WNS A;  4EZ6 A;  3THW B;  2O4G A;  4IO9 L;  5JVG L;  1W97 L;  3V1R A;  3O9R A;  3KIO A;  3F5T A;  2HHQ A;  3CM5 A;  4IDH A;  3SI6 A;  4CZE A;  5J2N A;  3IS9 A;  1IBM K;  5F1X A;  4FOE A;  1GLE G;  1Q7Y O;  4Z4F A;  4DV4 K;  5KQ8 A;  4CVN E;  4JI7 K;  4RW7 A;  3L8B A;  4JV5 K;  1IKV A;  3R8E A;  3KK1 A;  4H5N A;  4U67 L;  3OYE A;  4IXC A;  2UUB K;  4CHO A;  3KK7 A;  4AM6 A;  5LMN K;  3OYN A;  1ASV A;  3LP2 A;  1NNE A;  4B1X B;  1QZ6 A;  1NG9 A;  4N56 A;  4B3S K;  4CF9 A;  1IJJ A;  1VHX A;  1YAG A;  3AVC A;  3NDK A;  2OA8 A;  2V51 B;  1TUY A;  4KH6 A;  4Z4E A;  3J7Y P;  3VGM A;  3A8Y A;  1LV5 A;  5KRT A;  1K6Y A;  2W6L A;  3MXI A;  3C7N A;  3LDS A;  3OHR A;  4YOT A;  3RR7 A;  2DPN A;  3VQE A;  1D8Y A;  3OW2 M;  4WFB L;  2AA4 A;  1VQM N;  4OGC A;  3F73 A;  3E9L A;  4DFP A;  1NKB A;  5BN8 A;  3ZX3 A;  2GUP A;  2HMI A;  4E0D A;  4E7J A;  5CYM A;  3OVN A;  3FGU A;  4PKI A;  5BRH A;  1RDD A;  5AQM A;  5BRD A;  3VF6 A;  3H3N O;  3FE1 A;  2R7Y A;  2HBL A;  4DR4 K;  3RMD A;  4DSJ A;  3PV8 A;  1YUW A;  4JD2 B;  2EHG A;  3JS6 A;  3NVK A;  3THX B;  4BRF A;  2O8F B;  3O08 A;  4FPB A;  1RT1 A;  3P4I A;  3RMA A;  4WFA L;  3BF3 A;  2QWN A;  3KD1 E;  2A40 A;  4FLZ A;  3T7Z A;  3DRP A;  2YNG A;  1S1X A;  5AQF A;  1CZB A;  3ENO A;  3O9T A;  4E1J A;  1IG9 A;  3VQ9 A;  3E9P A;  4XIU A;  3HPH A;  3ZSX A;  2F9W A;  4JRP A;  2VWK A;  2O8E A;  4FLU A;  4FM2 A;  1XNR K;  3TAN A;  3ZSR A;  3U9Z A;  2F7T A;  2WBN A;  3KLH A;  4X64 K;  4PL7 A;  1TUU A;  3T1H K;  3SMS A;  3VMF B;  4AHS A;  1S3X A;  4CER A;  4X62 K;  3W0L A;  3SK3 A;  3RRH A;  4BAC A;  1NJZ A;  1LWC A;  3ZCM A;  4GMJ B;  2WON A;  3TAQ A;  4M41 A;  1FKP A;  1YJN N;  2ZWH A;  4PL8 A;  1RDC A;  3AO4 A;  4RCH A;  5E84 A;  5HP1 A;  1VSF A;  3SJH A;  4Q0B A;  2YNH A;  5JMV A;  4DR1 K;  4GV9 A;  1SKW A;  1EWQ A;  3WEE B;  2BE2 A;  4JS4 A;  3H3O B;  4A5B A;  1NGA A;  3E9O A;  1U45 A;  3DXM A;  1VK0 A;  1HMV A;  3KVG A;  2QXF A;  2O8B A;  4E7H A;  4K8Z A;  3J7A P;  1A5V A;  1TK8 A;  4YDU C;  5J2Q A;  1S5J A;  1T6D A;  1TYQ B;  3WQU A;  3ZT4 A;  1TAQ A;  4CJ5 A;  1L3V A;  4C1N K;  1TKZ A;  5J2P A;  4BRI A;  3D2E A;  4GKK K;  4FLY A;  2DTU A;  3OY9 A;  3QBX A;  2NRW A;  3VQC A;  1NK4 A;  4DQP A;  3AVI A;  3DLG A;  1U4B A;  1QVG M;  1SKR A;  4LH4 A;  5AQI A;  3NHG A;  3GBT A;  1RNH A;  1BIU A;  2YNI A;  1X9W A;  2P1J A;  4HUE A;  4H0O A;  2CGJ A;  4JRQ A;  3SUP A;  5C2F A;  1XMQ K;  1NK7 A;  3WT0 A;  1NKC A;  4BRM A;  1RIL A;  4ISG A;  1RBV A;  1XHX A;  4O5F A;  3AA5 X;  1SL1 A;  4O5B A;  5JS1 A;  4KHW A;  3OJU A;  3C0B A;  1ESV A;  4BE2 A;  3DI6 A;  3I0S A;  3LZJ A;  4OPA A;  4CZI A;  2A1S A;  4BR2 A;  1KTQ A;  3C6H A;  3T1Y K;  1HX1 A;  1ZBH A;  1WBD A;  3ZSY A; 
#chains in the Genus database with same CATH homology
 2JGU A;  3VQ7 A;  1VSI A;  4B8C A;  1WAJ A;  2XHB A;  2ZE2 A;  3NAE A;  4FJG A;  3A2F A;  3DLK A;  4IFV A;  1WAF A;  4BWM A;  3QIN A;  1KLN A;  3E01 A;  1LAW A;  3T19 A;  1WSH A;  2OPP A;  3KLE A;  1QTM A;  1G15 A;  2OYQ A;  2FBX A;  3ASM A;  3LPT A;  2IDO A;  2Z1J A;  1XI1 A;  2XRI A;  4HCB A;  4FYD A;  2KQ2 A;  2OPS A;  4KTW A;  1SV5 A;  2ZD1 A;  4FZZ A;  4E7I A;  3QNO A;  4HVJ A;  1XWL A;  1U04 A;  1JL1 A;  3EYZ A;  3K59 A;  4QCL A;  1TGO A;  3V9X A;  1LWF A;  4DQS A;  3ZSO A;  3SPY A;  4CGF A;  2YKM A;  4CJF A;  4DFM A;  3KK2 A;  3SV4 A;  3NF8 A;  3CFP A;  1Z25 A;  3AVF A;  1KCF A;  4B9U A;  4AHT A;  4CFB A;  2DFE A;  1J9A A;  1JLF A;  1UWB A;  4FW2 A;  3SQ2 A;  4C8L A;  4HCC A;  4PWD A;  1QHT A;  5FDL A;  4EZ9 A;  3HK2 A;  3TAE A;  2RPI A;  3SZ2 A;  1VSK A;  5JS2 A;  3SQ1 A;  3IAY A;  4Z4G A;  3ITH A;  4NCG A;  4J2B A;  1BQN A;  1RBU A;  4B3O A;  5FRO A;  1RBT A;  3WNH A;  3HXM A;  4FLW A;  4DTP A;  3DLB A;  2HHX A;  4IG0 A;  2IOC A;  1CLQ A;  1B92 A;  3QNN A;  1ZBL A;  4CF0 A;  4M42 A;  2HVH A;  3RRG A;  3V1O A;  3TAF A;  4CJP A;  3L2U A;  2HB5 A;  4GW6 A;  1S1W A;  3SPZ A;  4CGJ A;  3VQ6 A;  3G0Z A;  4LH5 A;  1KSP A;  1JLC A;  4CGG A;  2YKN A;  1T7P A;  1RDA A;  4Z4C A;  1VSL A;  4G1Q A;  3LP0 A;  3K5M A;  5E41 A;  3VQ4 A;  2G8V A;  2KZZ A;  3TAG A;  4ID5 A;  3DMJ A;  3K2P A;  3CYM A;  3LAM A;  4LSL A;  3L2V A;  3MAQ A;  2JLE A;  4DQI A;  2YV0 X;  3IG1 A;  3EZ5 A;  4KO0 A;  2PYJ A;  3M8S A;  5CZ2 A;  3MED A;  2XO7 A;  3AO2 A;  4DQR A;  5HRO A;  1D9F A;  4J2E A;  2FBT A;  4M3R A;  4DU3 A;  5C24 A;  4RW4 A;  3V9W A;  1RTH A;  4CJR A;  2F96 A;  3B6O A;  3NGZ A;  4FJI A;  2IC3 A;  1NJY A;  4FW1 A;  4KI6 A;  4KTZ A;  4DWI A;  4FZX C;  1NOY A;  1O1W A;  4DSI A;  1ZBF A;  3QES A;  2OZM A;  1Y97 A;  4DMN A;  3P1G A;  1ASU A;  1XHZ A;  1C1C A;  2BAN A;  5HRN A;  3I8D A;  3LWM A;  4IFY A;  3K57 A;  4CFA A;  3S3O A;  4O55 A;  2XY7 A;  5J2M A;  4O0J A;  1KRP A;  1SKS A;  2GV9 A;  2BGG A;  3ZSQ A;  1RT7 A;  3HPG A;  1L3S A;  3HVR A;  3HYF A;  4NCB A;  4O0I A;  1NKE A;  3TWH A;  4CEF A;  4CES A;  1RTJ A;  4NYF A;  5FRN A;  4CJT A;  3AO1 A;  1BCM A;  1VRU A;  4KRE A;  1JLQ A;  4AIL C;  1BIZ A;  1J53 A;  1QS4 A;  3ZSZ A;  3ALY A;  4E7L A;  3P5J A;  3WNE A;  2FBY A;  2G8U A;  4KHS A;  3HO1 A;  3C6U A;  1TKX A;  4CEA A;  2HNZ A;  3OS0 A;  4ZTJ A;  1N5Y A;  3T3F A;  3AVN A;  1VSH A;  4B9T A;  1EX4 A;  1EXQ A;  1HQE A;  4M3Y A;  3RR8 A;  3TI0 A;  4O44 A;  3ZT2 A;  4FM1 A;  4E1M A;  3UIQ A;  4Y1D A;  4PY5 A;  2HHS A;  5KRS A;  3NH0 A;  2HW3 A;  4FM0 A;  3PY8 A;  3NFA A;  4CGD A;  1YT3 A;  3U3Y A;  4DTM A;  1RBR A;  3V9Z A;  4E19 A;  2G8W A;  1QE1 A;  2X6N A;  4WE1 A;  1NJX A;  4DSE A;  5CYQ A;  4MQ3 A;  4C8O A;  4CIF A;  3OYC A;  3VQ8 A;  3O3H A;  1S1U A;  1JLB A;  2P51 A;  1U49 A;  2D0B A;  1D5A A;  4OPJ A;  1C0U A;  4DS4 A;  1S9G A;  2X74 A;  4CK1 A;  1BGX T;  1JLA A;  3H08 A;  4HHT A;  2RKI A;  1GOA A;  3V81 A;  3OS2 A;  4M3W A;  4DU1 A;  1U47 A;  4E89 A;  2E6L A;  1HNV A;  3F9K A;  1TK0 A;  4J2D A;  3ULD A;  2OPR A;  3NF7 A;  3HPO A;  4Q5V A;  4JS5 A;  3JYT A;  4ZHR A;  3L3V A;  2Q3S A;  2VG7 A;  1B9F A;  3LPU A;  4I7F A;  4RG8 A;  3VQB A;  4CF8 A;  4HTU A;  2IAJ A;  4DTX A;  4DTO A;  3VN5 A;  4DSL A;  1KVC A;  1S1V A;  2YHB A;  3D45 A;  3MEC A;  4B08 A;  1RT2 A;  3OYH A;  3SUN A;  2X78 A;  3SQ0 A;  3AA2 A;  3MXM A;  3OYD A;  3DLH A;  3KLG A;  4ELU A;  4FJN A;  1KVB A;  1RT5 A;  4CCH A;  4FLV A;  3V1Q A;  2QK9 A;  1VRT A;  4FK2 A;  4KHQ A;  1TL1 A;  4KB0 A;  1C6V A;  4CJW A;  4FJ9 A;  5KTQ A;  3B6P A;  1Z26 A;  3TAR A;  5KI6 A;  1A5X A;  4CF1 A;  4N76 A;  3M8Q A;  4CEC A;  3JSM A;  3NH1 A;  4CHQ A;  4C8N A;  3K5L A;  1D9D A;  4C8M A;  3AVK A;  4CGI A;  3DRR A;  3HP6 A;  3TAB A;  1CXU A;  1DTT A;  5J1E A;  3RTV A;  2PZS A;  2D5R A;  2Z1H A;  5CY4 A;  3V9S A;  4W5R A;  3KTQ A;  2ATQ A;  3QEV A;  4IKF A;  2QKB A;  4FCY A;  2E6M A;  3WNF A;  2NUB A;  1WN7 A;  4KKO A;  3NBP A;  1N6Q A;  4F3T A;  3AVH A;  1JL2 A;  4CJ4 A;  4DFJ A;  4GVM A;  2ETJ A;  2XY8 A;  4RW9 A;  1S6Q A;  1LAV A;  3V6D A;  4CEE A;  3KLF A;  4ICL A;  3NE6 A;  2B6A A;  4JLH A;  4W5Q A;  3QEP A;  4KAZ A;  2F8T A;  1JKH A;  3L2W A;  3LZI A;  4DTS A;  4RW6 A;  4OKJ A;  5EU7 A;  1VSM A;  3L2R A;  4LSN A;  4FZY A;  4CK2 A;  4RW8 A;  5HRS A;  1ZBI A;  4I9L A;  3DLE A;  3RMC A;  4CJU A;  3TAP A;  1TK5 A;  4KHU A;  1WSI A;  4FXD A;  3PX6 A;  3RMB A;  2XY5 A;  2E4L A;  3AV9 A;  3MXJ A;  3OYL A;  5KGW A;  3OYI A;  3QEI A;  3PX0 A;  3DOK A;  1ZBU A;  4CJK A;  1RT3 A;  1NK5 A;  1SL2 A;  4H4M A;  1SUQ A;  2P5O A;  3KLI A;  4CEO A;  4CHZ A;  2KFZ A;  5I3U A;  4KHN A;  1BIS A;  1DLO A;  4CJS A;  1BI4 B;  2FBV A;  3QO9 A;  4YNQ A;  4KTQ A;  3VQD A;  1S1T A;  4NYN A;  3KJV A;  1HRH A;  1JXB A;  3MEG A;  3DM2 A;  3HL8 A;  3KKS A;  4DQQ A;  4DTN A;  4DF8 A;  4OLB A;  3PX4 A;  1QQC A;  3DLR A;  4KV8 A;  4CJL A;  1TKD A;  1WNS A;  4EZ6 A;  4FJM A;  2O4I A;  4QAG A;  4OVL A;  4E7K A;  3KD5 E;  2O4G A;  1JLE A;  1YTU A;  2VWJ A;  5I42 A;  3S3N A;  3O4N A;  3V1R A;  1NK8 A;  1WSG A;  1B9D A;  3KIO A;  5T7B A;  4CJV A;  3CM5 A;  2D0A A;  2HHQ A;  1HPZ A;  3SI6 A;  1X1P A;  5J2N A;  3IS9 A;  4F8R A;  1HJR A;  3SQ4 A;  4BDP A;  4Z4F A;  2HVI A;  1IO2 A;  4RW7 A;  4CJE A;  3L8B A;  2QKK A;  3S3M A;  3HST B;  4TSX A;  1KLM A;  1IKV A;  3KK1 A;  2W42 A;  1W0H A;  2HNY A;  3OYK A;  5HRP A;  2G8K A;  2KZM A;  1KFS A;  3OYE A;  3OJS A;  4LD0 A;  4Z4H A;  1BQM A;  4CHO A;  3AVL A;  1NJW A;  2ZQB A;  1J54 A;  3AVA A;  5C42 A;  3OYN A;  4BWJ A;  2Z1G A;  1ASV A;  3LP2 A;  4DLG A;  4CIG A;  3OS1 A;  4N56 A;  3VQQ A;  1HYZ A;  4CF9 A;  4KPY A;  1UAX A;  4N5S A;  4F3O A;  1REV A;  3AVC A;  1C1B A;  5SZT A;  3NDK A;  5HRR A;  4BDZ A;  2OA8 A;  2XY6 A;  3PO4 A;  1NK9 A;  3BGR A;  2IGI A;  4DSK A;  4Z4E A;  3D0P A;  1LV5 A;  5KRT A;  1K6Y A;  1NK0 A;  3MXI A;  1EET A;  3LDS A;  3RR7 A;  3PO5 A;  3HJF A;  3VQE A;  5DMR A;  1GOC A;  4CE9 A;  2ITG A;  4CHP A;  1VSJ A;  1LWE A;  2WOM A;  4CEQ A;  1L3U A;  1D8Y A;  1WSJ A;  3LP3 A;  4PUO A;  4B9S A;  4BDY A;  1J5O A;  2PYL A;  2AJQ A;  3AVJ A;  3BDP A;  4OGC A;  1FK9 A;  4YFU A;  3F73 A;  4ZTF A;  1X9S A;  2P5G A;  2GUI A;  1CZ9 A;  4UQG A;  4DFP A;  4M3X A;  2YNF A;  1U48 A;  4W5N A;  1NKB A;  3U3G A;  1HYS A;  3MEE A;  4KHY A;  4AHU A;  3CQ8 A;  2Z1I A;  4PQU A;  1EKE A;  4IG3 A;  1Q9Y A;  1IKY A;  2HMI A;  1IKW A;  3OYA A;  4KFB A;  3C6T A;  2RN2 A;  2Y1I A;  4E0D A;  4E7J A;  1TV6 A;  5CZ1 A;  5CYM A;  3OVN A;  3U6F A;  3VQA A;  4ELV A;  2I5J A;  1ZYQ A;  4DU4 A;  4B9N A;  5DK5 A;  1DTQ A;  3QIP A;  2FC0 A;  3ZSW A;  2DFH A;  3HVT A;  4DTR A;  1L3T A;  4FJ7 A;  4BE1 A;  1A5W A;  1RDD A;  2VG5 A;  4DS5 A;  4KRF A;  3VA3 A;  3DRS A;  1HNI A;  3NH2 A;  2G8H A;  4CIE A;  1TVR A;  3O3G A;  4DFK A;  3G10 A;  1JLG A;  4CHN A;  2R7Y A;  1TKT A;  4O4G A;  4CFC A;  1HQU A;  1NK6 A;  4FJ5 A;  3RMD A;  4QOZ B;  4DSJ A;  3QET A;  1BCO A;  3PV8 A;  4CJQ A;  2KFN A;  4R5P A;  3L3U A;  4M3Z A;  1W9H A;  2EHG A;  3P83 D;  1VSE A;  3NF9 A;  3ISN C;  3LP1 A;  4OJR A;  4B9L A;  4CJ3 A;  5D3G A;  4C8K A;  1RT1 A;  1FXX A;  2DY4 A;  4FJL A;  1WLJ A;  3LAL A;  3QER A;  3O4Q A;  3RMA A;  2Y1J A;  3AA3 A;  2B5J A;  4FLZ A;  3KD1 E;  4KI4 A;  1MU2 A;  1HYV A;  1LW2 A;  3DRP A;  2YNG A;  4EP4 A;  1S1X A;  1RDB A;  1F21 A;  3K5N A;  3SUO A;  1CZB A;  5KGX A;  3AA4 A;  1GOB A;  3EY1 A;  3SV3 A;  3NGI A;  4Z0U A;  2D0C A;  2IS3 A;  2YHA A;  2KW4 A;  3O3F A;  3TAM A;  3SNN A;  4ELT A;  4M3T A;  3LAK A;  4H4O A;  1IG9 A;  4OKE A;  3FFI A;  2LSN A;  1Q8I A;  3CG7 A;  3ZT0 A;  4FJX A;  4CGH A;  3VQ9 A;  4XIU A;  4JRP A;  3HPH A;  3ZSX A;  2X6S A;  1KVA A;  4NCA A;  5C25 A;  3QLH A;  2VWK A;  4Z4I A;  5K14 A;  1LW0 A;  1S6P A;  4FLU A;  4DF4 A;  4EP5 A;  5SWM A;  4FM2 A;  1BI4 A;  4HUF A;  3THV A;  3NCI A;  3LAN A;  3TAN A;  3ZSR A;  4F2S A;  1RCH A;  1RBS A;  4B9M A;  1ASW A;  4FJ8 A;  1SL0 A;  2HHW A;  3K5O A;  4CFD A;  3AVB A;  3KLH A;  1XC9 A;  2HHV A;  4CF2 A;  4AHS A;  4OLA A;  2KTQ A;  4LY7 A;  1WSF A;  1I3A A;  1IH7 A;  4CER A;  4Y1C A;  3CM6 A;  1WSE A;  4DG1 A;  3RRH A;  4BAC A;  1NJZ A;  4DSF A;  1LWC A;  3ZCM A;  4FJH A;  4GMJ B;  2WON A;  2A1R A;  3AVM A;  3TAQ A;  4E1N A;  4M41 A;  1FKP A;  5FRM A;  1RDC A;  3AO4 A;  4M45 A;  5HP1 A;  1VSF A;  1YTA A;  2GBZ A;  3SJJ A;  4W5O A;  3CFR A;  4CED A;  3DYA A;  4Q0B A;  3VQ5 A;  4DLE A;  2PY5 A;  4N41 A;  2YNH A;  3S9H A;  3QEW A;  4J2A A;  2G8I A;  4FJK A;  4M3U A;  4IBN A;  1SKW A;  2OZS A;  4W5T A;  3QEX A;  2BE2 A;  1C1A A;  4I2Q A;  4JS4 A;  2G8F A;  3VA0 A;  3OYM A;  3L2Q A;  1TAU A;  1U45 A;  4F4K A;  3QIO A;  5HLF A;  4I9Q A;  3V4I A;  1JXE A;  1VK0 A;  1HMV A;  3KKR A;  3SCX A;  2QXF A;  3ZT1 A;  4E7H A;  4K8Z A;  1A5V A;  1VSD A;  1IKX A;  3I0R A;  1C0T A;  4AHC A;  5J2Q A;  1TK8 A;  4KB1 A;  1S5J A;  1UA0 A;  4H8K A;  3OYJ A;  3ZT4 A;  4B9V A;  4FLX A;  1RT6 A;  3T1A A;  1TL3 A;  1TAQ A;  1I39 A;  4OKK A;  4CJ5 A;  4DTJ A;  1TKZ A;  5J2P A;  1CXQ A;  3LWL A;  3ZSV A;  4ID1 A;  1L3V A;  4N47 A;  4FK4 A;  4AH9 A;  1R0A A;  1T05 A;  4FK0 A;  3KK3 A;  3K58 A;  4FLY A;  5HBM A;  1QSS A;  4CEZ A;  3OY9 A;  2DTU A;  4B8A B;  3OYG A;  1KFD A;  3SYZ A;  3NGY A;  1RTD A;  2HHT A;  4OPK A;  3VQC A;  1NK4 A;  4K8X A;  3C94 A;  4DQP A;  2BDP A;  2DFF A;  3HT3 A;  3V9U A;  3NF6 A;  3RWU A;  1YVU A;  3AO5 A;  3AVI A;  4E3S A;  4BE0 A;  3DLG A;  1U4B A;  3AO3 A;  4AHV A;  4LH4 A;  4CHY A;  1SKR A;  1T03 A;  3HP9 A;  3ZT3 A;  1Q9X A;  3M8R A;  1T8E A;  1UOC A;  3WNG A;  3NHG A;  4F2R A;  1RNH A;  1BIU A;  2YNI A;  4OGE A;  2P1J A;  4CK3 A;  3DOL A;  1S9E A;  4HUE A;  1X9W A;  3SUQ A;  4JRQ A;  3SUP A;  1L5U A;  3M8P A;  4IDK A;  1NK7 A;  3CFO A;  2OPQ A;  3IRX A;  3AVG A;  1NKC A;  1RIL A;  2HND A;  4AHR A;  4L8R B;  1FKO A;  1X9M A;  2HHU A;  1RBV A;  1XHX A;  4CEB A;  3AA5 X;  1SL1 A;  2VG6 A;  4O5B A;  1RT4 A;  1QSL A;  5JS1 A;  1ITG A;  4MFB A;  4HUG A;  3OJU A;  3HM9 A;  4KHW A;  2EX3 A;  2B4J A;  4DTU A;  1UA1 A;  4BE2 A;  3DI6 A;  3I0S A;  3LZJ A;  1BL3 A;  4I2P A;  3PUF A;  1QSY A;  3OYF A;  1BHL A;  1NOZ A;  2A1S A;  3C95 A;  2F8S A;  1KTQ A;  3TR8 A;  4FLT A;  1EP4 A;  2RF2 A;  4FJJ A;  4PA1 A;  3OYB A;  1ZBH A;  4FVM A;  1RTI A;  3VQP A;  3ZSY A;  1C0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...