4G1QA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with rilpivirine (tmc278, edurant), a non-nucleoside rt-inhibiting drug
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshot of the equilibrium dynamics of a drug bound to HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 157
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4g1qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4g1qA05
4CJKA 1VRTB 1NJXA 1WNEA 3VA0A 4FJJA 5C5JA 4MFBB 5KGXA 3RTVA 3KK1A 1RT5B 3QGHA 4CIGA 4E19A 3C6UB 5J2NB 4KTQA 1JL2A 4I2PB 4NRTA 2VG6B 3FDSA 2W9BB 1VSHA 3NH1A 3PX4A 3VQQA 4OGEA 3LZIA 1L3SA 4OLAA 1RBRA 3QGGA 1FKOB 3LP1B 4J9SA 2V4QA 5CZ2A 4F2SA 3C6TA 4ZP6A 2E9RX 4NYZA 5KG4A 4W5QA 2HWIA 3GQCA 3QZ7A 2G8WA 2UUTA 4PUOA 1L3VA 1KSPA 1L3TA 5FROA 1TK8A 4AHTA 2DPJA 3NH2A 1S1WA 3MF5A 4DL3A 4AH9A 3E01B 5KFIA 4F2RA 1WLJA 1IKYA 4ECYA 1JLCB 3NAIA 2XGPA 4UQGA 4CF0A 3L2UA 3MEDA 3PW5A 1IKWA 1JXEA 3M8QA 1C2PA 1S6QB 4GC6A 4ED1A 2Y1IA 4E1MA 1R0AB 3LP0A 4DTUA 4NLPA 4K4XA 2BQUA 3ULDA 2YNFA 3BDPA 2D0AA 1NK9A 1REVB 2ASJA 2XWYA 3SUOA 3OSNA 2EX3A 3IGVA 2HMIA 4LQ9A 4I7FB 3KMSA 1BHLA 3ZSRA 2G8HA 1JKHB 3VQCA 5KFWA 4NLOA 4CFDA 1NJYA 1RNHA 4EO8A 3V4IB 1YT3A 4LY7A 4CEDA 1HNIB 2UUWA 4IDKA 3KD1E 2OA8A 1QE1B 4ECVA 2R2SA 3NHGA 4B08A 2YKMB 4F8RA 3PO4A 1KRPA 4DL4A 4X2BA 2XCAA 4RW9A 3CJ2A 4ZVFA 2IGIA 3F9KA 2YNFB 4RW8A 3IN5A 3NDKA 3VQ4A 5FDLA 1TGOA 3MXMA 1NK6A 2KZZA 1SV5B 3KLIB 1S97A 4O44A 1UA1A 2QK9A 4DQQA 1S1TA 3RR8A 2NUBA 1VRTA 1NJWA 1LAWA 4ZPAA 1EKEA 2UVWA 5EDWA 4CHYA 4O3QA 4RNOA 1SUQB 4B9VA 3HPOA 4K8XA 1ZBIA 4MIAA 3RB3A 4OVLA 2C28A 3KJVB 3CJ3A 3AO3A 1HQUB 4BDZA 4CJFA 5K14B 3SV4A 5KFSA 3BQ1A 3PR4A 1WSEA 5KG0A 4DFKA 5F8JA 4CE9A 3SNNA 4AHVA 1S48A 1S9FA 4Y1DA 4NLRA 3P83D 2W9AA 4J9PA 4J2BA 3AO1A 3RAXA 1N5YA 3FFIA 1XR6A 4K4ZA 1NOYA 4NCBA 5HP1B 4TQSA 3HXMA 3T3FA 2OPQA 3HP6A 4IOBA 3F73A 4KV8A 4LSLB 4QWEA 3ALYA 1U47A 4DEZA 4NLWA 3OYEA 3DOLB 4FJHA 2Z1GA 1S6PB 4R5PB 4J2DA 4CJQA 3K5MA 4J9RA 3N6NA 4BWJA 4QW9A 1Q8IA 3ZSQA 2YV0X 1TL1B 2HB5A 4DSFA 1RT6B 4KTWA 2XCPA 3AA5X 4FXDA 5J1EA 3VQ9A 4KHRA 3SQ1A 4E3SA 5EWEA 3RR7A 2HNYB 4MKBA 3M8SA 4YFUA 1XC9A 4FJ8A 4I7FA 4M3YA 3LAMA 3OL6A 1NK8A 3V1OA 4B3OA 2I5JA 4IBNA 2JC0A 4EP4A 2ETJA 4JRQA 1RTHB 3QLHB 4KI6A 4R8UA 2GC8A 5KFYA 1B9FA 1LWCB 4Q0BB 4AILC 3SPYA 2WHOA 1VRUB 5KT2A 2W8LA 3NF8A 4RW6B 4OJRA 4N41A 1BGXT 3PHEA 3HO1A 1TP7A 3OSPA 2JEIA 4RU9A 3TANA 4BWMA 1RDCA 4RW9B 1KVBA 2J6TA 3NGZA 3SQ2A 2ZE2B 5F9NA 4KPYA 4ZP9A 1QSSA 1A5XA 3NBPB 4KE5A 4MFBA 3ZSWA 3PZPA 1UA0A 4DU1A 2YHBA 1S4FA 5KRSA 4EBDA 4F3OA 1BIUA 3CIZA 4TQRA 3KHLA 1DLOA 2R8KA 4TY9A 2YNHA 4QWAA 2F96A 2C2DA 1HQUA 4B9TA 3D5MA 3LP3A 3PVXA 3OL8A 4O3PA 3QZ8A 4IFVA 3V6KA 3KIOA 2HHQA 3KK1B 4QPXA 2E9ZA 3ZSXA 3TAMB 3K5NA 2HHTA 1N56A 4J9MA 4W5RA 2AGPA 1A5WA 4Y3CA 1RBVA 1BCOA 3OYMA 4KFBB 4FLZA 3I8DA 4FK4A 5L1IA 1S0MA 3H40A 1S1XB 1FKPA 4IRDA 2XI2A 5KG2A 3C6UA 1TQLA 3UPFA 5KFQA 1BQNA 2WOMB 2R8HA 4RZRA 2CJQA 3OYBA 4ED3A 1NK0A 3T5JA 3PR5B 3DRPB 3M8PB 1K6YA 4ZP7A 3AVFA 2GV9A 4KI4A 2YKNB 4ICLA 3QYYA 2QKKA 3HVTA 1DTTA 3CFPA 3M8RA 4ID5A 2G8KA 3MTKA 3M8QB 1SL2A 3UDLA 4DF4A 1ZBFA 5DQHA 3AVIA 3OLBA 1HJRA 2ITGA 4URGA 3IS9B 5C25A 5FRNA 4E7LA 4ZHRB 2O5DA 3JYTB 3KKSA 3ITHB 5L1JA 4DSLA 5JXSA 4B9SA 3QETA 1SL0A 4O5BA 4QWDA 3DLGA 1S9GA 3HKWA 3LDSA 5K14A 3MXIA 3Q8RB 1EXQA 1VSJA 4QW8A 2W7PA 4M3RA 4PWDB 3LALA 4DQSA 3B6OA 4RUCA 4CEEA 3LP1A 2YNIA 3L2QA 3KKRA 4CF8A 4HKQA 5HRPA 4NLGA 1S0NA 5KI6A 1T3NA 4O3RA 5E41A 1SV5A 3KLIA 1N4LA 4DL2A 1S1XA 1DLOB 3BJYA 5KFOA 2WONA 1T03A 2LSNA 5KFMA 4KV8B 3KD5E 3L3VA 2JEGA 2BRLA 5F8HA 4CJ4A 2FVQA 4IFVB 1OS5A 3SUQA 5CYMB 1KTQA 1TKZA 4CIFA 2BR0A 1TVRA 4CHQA 3AO4A 3CFRA 2OPSA 1VSKA 2YNHB 1KCFA 1QSLA 3HL8A 3M9MB 2HNYA 2ALZA 2D3ZA 3KK2A 1X9WA 3QNOA 1RA6A 4RNMA 4ED2A 1LWFA 3SJJA 3HYFA 4IG3B 4AHRA 2GBZA 4CFBA 1D1UA 4I9QA 4WZQA 2PYLA 4FLVA 1S9EA 4Q5VA 4MKAA 4ZTFA 3MEEB 4TSXA 3TQ1A 3SQ4A 4WXWA 4KRFA 4B3OB 2Z1JA 3VQPA 3OLAA 4IH7A 4DL6A 2VA2A 3KLEB 5J2MA 4PQUB 4YR2A 1ITGA 1HRHA 5EWFA 4RW6A 3V1RA 2WCXA 4I2QB 5CY4A 4CESA 1C1AA 5KTQA 4FLXA 4Q8FA 4C8KA 2VA3A 3BR9A 3WNFA 1MU2B 3NL0A 1U4BA 4KKOA 2BANA 4LSNA 3SQ0A 1LWCA 4J2AA 1BCMA 1HPZB 2IM0A 1ZTTA 4ZTJA 1U49A 3OYAA 3H98A 4ID5B 2YNGB 1U48A 1Y97A 4F4ZA 3V6DB 2W9CB 3MEEA 1ZYQA 1DTQA 4AHCA 5SWMA 3TWHA 3EYZA 5DQGA 3MXJA 1RYSA 3GYNA 2FBXA 1TK5A 3PJXA 3V1QA 3LPUA 3I0RA 4Q8EA 4DTOA 3VQSA 2P5OA 3MR5A 3SUNA 1QS4A 4DF8A 3CJ4A 3BGRA 4NLVA 4ECSA 1XHXA 4DU3A 4FJ5A 4E0DA 2QXFA 4CJ3A 5FDLB 1IG9A 2YNGA 2G8IA 1C0TB 5J2NA 4C8NA 3EZ5A 2XGQA 1TVRB 2UVVA 4LH4A 3VQBA 2OZSA 2IA6A 1RYRA 4URSA 3DMJA 2F8SA 3DRSB 2WOMA 3G0ZA 1QAIA 5KFXA 5KG6A 3AVMA 3ZT0A 1KHVA 2RDJA 2I5JB 2R8GA 1GX5A 4KB7A 4CCHA 4ZMMA 1BIZA 4E89A 3DOKA 1RILA 1D8YA 1SKRA 2IOCA 5DG9A 3NCIA 3DYAB 3TABA 4FJ7A 1TL3B 2FVRA 3EY1A 3KHRA 2R2TA 4CGJA 1J54A 5KFDA 4LSNB 1GOBA 3NAEA 2AGQA 5KG1A 5HROA 3ZSZA 2WK4A 4XO0A 4EYIB 4IR9A 2W9CA 3DRRB 1UWBB 1Z26A 4CGFA 5DLFA 1WSGA 4CGGA 2W42A 3ITHA 4CJSA 4AHSA 1VSDA 1Q9YA 4ZHRA 4KREA 3KK3B 1J5OB 3EZUA 2BANB 2BRKA 4N47A 3S3NA 1XHZA 2HNZB 3OYFA 2VWKA 3M8PA 1WN7A 3V4IA 4TYAA 4O4GA 4B8AB 3BSOA 4DL5A 1S10A 4NCGB 4O44B 4OKEA 4PA1A 3O3FA 3RWUA 4ECRA 4LD0A 3V6DA 3GV7B 2A1SA 5EU7A 1FK9B 4JS5A 4HVJA 3AVAA 2AGOA 2FBYA 2XO7A 2XHBA 1QQCA 1XR5A 5F8LA 1HNVA 3I0RB 1C1CB 4FS1A 2B5JA 3L3UA 1LWEA 4IRKA 4BDPA 4QAGA 4K4VA 1JLFA 4H8KA 1RCHA 4F4KA 4J9QA 3DDKA 1FKOA 4XPCA 2FBVA 1EP4B 4E1NA 3DOKB 4CGHA 2VG7A 4H54A 3MFIA 4F3TA 4YP3A 3DRPA 4CJVA 3OYJA 3MR6A 4W5OA 1QHTA 3K5OA 2D41A 1JLGB 2XC9A 4NLXA 2OPSB 1K1QA 2BGGA 4WFZA 4E7JA 4FZXC 3AVGA 5CZ1A 2IC3B 3OS0A 1C0UA 2AX1A 3TVKA 4J9KA 4CK2A 1DTTB 2IM3A 3KLFA 4K4TA 3OYCA 5KFLA 4DLEA 4RW4B 1I39A 2JEJA 4LSLA 1VSIA 1C1BA 2WTFA 4Y1CA 3ZT4A 4ELVA 3VN5A 2IMWP 4FBUA 3GV8B 3PW7A 4HCCA 5J2QB 4HUEA 1QAJA 2R7YA 3QINA 4DFPA 1RTHA 2R8IA 4CHNA 4FJ9A 1RA7A 1IH7A 3DM2A 4IQXA 1BQMA 1C0MA 3I0SA 1J9AA 3TI0A 4FVMA 1JXBA 4DQPA 4DSKA 5KFVA 3LP0B 4M3TA 4NCGA 3QEWA 2FBTA 4RNHA 3H2LA 4O4GB 3OYDA 3SFUA 1YVFA 4ECWA 5DGAA 2XRIA 4FJNA 1J5OA 1RAJA 4KO0A 4RNFA 3JYTA 3HM9A 3IGNA 5KFZA 3K2PA 1U04A 4N56A 4DSEA 1S1WB 2ZD1B 4EO6A 2V9WA 3GIIA 4KB1A 1N6QA 4W5TA 3T1AA 5HRSA 4YQWA 2OPRA 3ZSOA 1RT1B 1HYSB 3THVA 3WNHA 4DS4A 2BQRA 5C24A 4IH5A 4CEBA 1TAUA 1JLEA 4OL8A 2I1RA 3T5KA 3O4QA 1HYVA 3FQLA 2DFFA 1TV6B 1QUVA 1IKYB 1I6JA 5EUHA 3OS2A 2ILYA 1R0AA 1ZBHA 3OL7A 4TYBA 1IO2A 3AO2A 1TK0A 4B9LA 3CDUA 4C8LA 4DSJA 3KTQA 2YNIB 4IFYB 1S0OA 2IC3A 2B4JA 4ECQA 1T05A 3PUFA 2PZSA 3AVKA 2X6NA 3RB6A 5JS2A 3EPGA 4EEYA 3GV5B 3I5CA 3HP9A 1NJZA 2WONB 1T03B 3CM5A 3PO5A 2JGUA 3H4BA 3N6LA 4FCYA 1RT3B 4NYFA 4FZZA 5J2QA 4WE1A 4CK1A 2W8KA 2JC1A 4JRPA 4K4UA 3ISND 4IDKB 4O0JA 4KB0A 2QE5A 1RBTA 4URQU 4KAZA 3DI6A 3BQ0A 4CJWA 1QTMA 3FQKA 3DM2B 4FM2A 4WE1B 2OPPA 1JKHA 5KGWA 4F4XA 4WXOA 4CEQA 4RW8B 4ICLB 3NKYA 1VRUA 3CM6A 1B92A 4CHOA 3OL9A 1HYSA 1RT4B 2EHGA 3HVAA 4NRUA 2Q3SA 4K4WA 3O3HA 4Z4FA 1JLBB 4FW2A 1D9DA 3SI6A 1RTIB 3KLEA 4PQUA 4EZ6A 4FJGA 4QWBA 4KTZA 3ZSYA 1QE1A 1WAJA 1IKXB 4OKKA 1ZETA 1L5UA 2B5JB 2DY4A 1JLAA 1MU2A 5JS1A 5HRNA 1HNVB 3SCXA 4M3UA 4IG0B 3ZT2A 3M9NB 1JX4A 3H4DA 1IKXA 3IG1B 4O4RA 2D5RA 3FRZA 1S1VA 2Y1JA 4ED6A 1RDBA 1RTIA 3QESA 1LW0A 1WSFA 4FJLA 4IR1A 1Z25A 2AQ4A 4CHZA 2HVIA 1S1UA 4DLGA 2FJWA 1TL3A 1D5AA 5HP1A 1HQEB 3VQEA 4LQ3A 1NKEA 1LW0B 1JLQA 3NMAA 1LW2B 3AVLA 1KFDA 3AVCA 5HRRA 4GW6A 3MAQA 2IM2A 2ASDA 3MR2A 3H5YA 5F8NA 1J53A 3PV8A 5DGBA 1C0TA 4Q43A 4CF2A 4PY5A 3MECA 2DPIA 3I5BA 1T7PA 3CDWA 4DWIA 4OKJA 4HUFA 4WFXA 1LW2A 1SKSA 4CEZA 1TL1A 4Z4EA 4F50A 4M45A 3DLKB 1X9SA 3AO5A 3UIQA 3NF9A 4ECXA 4DTMA 2JLEA 2ZQBA 4KHUA 4M94A 5EWGA 1TAQA 5I42A 5F9LA 1JL1A 1FKPB 4WZMA 4IH6A 4M3XA 2R2UA 1NHUA 3KLGA 3OYKA 3ZT3A 5KG3A 3LPTA 2IJFA 1JIHA 4FLYA 1ASVA 3SYZA 4CJPA 3AVBA 4C8MA 4O3OA 1HMVB 1SH0A 2C22A 2WB4A 1YVUA 1JLFB 3CDEA 3RRGA 1KLMB 5HBMB 3GILA 4FS2A 2KQ2A 4GMJB 4J9LA 2G8FA 3CJ5A 2C2RA 3PX0A 1S49A 1HYZA 4DTJA 3KOAA 4ED7A 2RDIA 2V4RA 4HTUA 1WNSA 2G8VA 4B8CA 3Q8PB 1L3UA 4F4YA 2HMIB 3H5XA 1HPZA 3H59A 1ASUA 2VG5B 4RUAA 3CG7A 1RT1A 2ATLA 4OLBA 4CJUA 1HNIA 4OPJA 5CYMA 4CIEA 4ECUA 2AJQA 3KLHB 2ZE2A 4Z4IA 4MK7A 2HNDA 4E7KA 4KAIA 3GIJA 3SUPA 3PW4A 2O4GA 1TV6A 4KO0B 3NGDA 4DFMA 3AA3A 2FVCA 1KVAA 3T5HA 1LAVA 4I9LA 1SL1A 3SI8A 3SZ2A 1LV5A 5F8MA 3TR8A 4NCAA 5KFJA 1ZBUA 1NK4A 4CJTA 4B9MA 4WFYA 4FJKA 3VQ8A 4YR3A 4WYLA 1GX6A 1KHWA 3VQAA 4C8OA 3OYIA 1S1UB 3OJUA 3H5UA 5KFGA 3OJSA 4K8ZA 3IRXB 3BSAA 2IM1A 2PY5A 2V0NA 4FLUA 4TY8A 3DOLA 3SFGA 2D0BA 4E7HA 3HPGA 4QCLA 1RDAA 4H4MB 5J2MB 1NHVA 1WSHA 4FYDA 3TAMA 3GIMA 3AV9A 2FVSA 3DLEB 2BQ3A 3MR3A 3E01A 2PYJA 4DS5A 4XIUA 5I42B 1VSMA 4NZ0A 1T94A 4FM1A 4L8RB 3QO9B 1K1SA 1C0UB 3PX6A 1RT2A 4DU4A 1BI4B 5C42A 3BREA 3SPZA 2XY8A 1WSJA 2D0CA 2UVRA 1NKCA 2R2RA 4DFJA 4R0EA 1S5JA 2ATQA 3DRRA 3ZT1A 1JLBA 3C95A 4CFCA 3HJFA 5KFKA 4DTRA 2XY6A 1W0HA 1NK7A 1CLQA 4Q45A 4EZ9A 3HT3A 1XWLA 1IKVB 2P1JA 3VQDA 3ASMA 4DG1A 2CKWA 5I3UA 1U09A 1XI1A 2IJNA 1N48A 4N76A 3B6PA 3Q8QB 1A5VA 2P51A 3QNNA 4Z0UA 1HARA 1VSEA 3ISNC 3DLGB 3I5AA 3SV3A 5J2PB 3V81B 4FLWA 2HW3A 5CYQA 1T8EA 1NNDA 1JLEB 2IS3A 3KHHA 4QOZB 2OZMA 3LWMA 3DI6B 3NE6A 3RMCA 3O3GA 2RKIA 4K4SA 4R8UB 3HHKA 2FLLA 4EP5A 2KW4A 5KT7A 3CVKA 4DG1B 2F8TA 2XY5A 1C1CA 2B6AA 4ZPDA 4M3WA 1W9HA 4KSEB 1S1VB 2EC0A 1RT7A 3S3MA 5F8GA 5D3GB 4BACA 3P5JA 1G15A 4ECTA 1RBUA 2B6AB 3H5SA 4O0IA 2HAIA 3P1GA 4FK0A 2HHVA 2E6MA 1YTAA 3QO9A 2IDOA 1KFSA 4O3SA 1JLGA 5KFUA 4DQRA 2VWJA 1TKZB 4LH5A 1B9DA 4I2QA 3N6MA 5HLFA 3JSMA 2QKBA 4G3IA 4CJRA 5DG7A 3K5LA 1XR7A 3PW2A 2HHSA 3PW0A 1RTJB 3AVHA 1RBSA 3JSMB 1BL3A 2YKNA 4CGIA 2HVHA 3CYMA 5KFCA 3RMBA 3CWJA 4Q0BA 3BSCA 2X74A 1N5YB 2F8EX 4CEOA 3ZCMA 1RT2B 1RDDA 2HHUA 4ZVGA 4IRCA 3EPIA 3C94A 4JS4A 1IM4A 3ZSVA 4NLTA 3BQ2A 5DMRA 4Z4HA 5L1KA 2FLPA 3OHBA 4OPKA 3KK2B 1BISA 3I0SB 2XI3A 5KG7A 3RAQA 1ASWA 1NK5A 4ZVEA 3NBPA 1Q9XA 3LWLA 1FXXA 1X9MA 3GIKA 4RG8A 5I3UB 4J9NA 3IS9A 1CXQA 1RTDA 1IKVA 4BDYA 3RB0A 1SH2A 4TLRA 2Z1IA 4O3NA 1WSIA 1GOCA 3RBEA 3CJ0A 3QLHA 1D0EA 2E6LA 1SKWA 3V81A 2OH2A 2VG6A 2W9BA 4KHQA 3HSTB 2E9TA 4ED8A 1DTQB 3KMQA 1KLNA 1CXUA 4IKFA 1X1PA 2BE2B 3KNAA 1JLQB 5DLGA 2DFHA 4GVMA 2HNDB 5JUMA 2W7OA 3U3YA 5T14A 3G6YA 4AHUA 1N6QB 4Y2CA 4Q44A 4TXSA 4NLYA 1CSJA 3D0PA 2IAJA 5DG8A 4TY8B 3RBDA 3DLBA 4DSIA 3QEIA 1RT7B 3KLHA 4HYKA 2RF2A 3QIOA 3DRSA 2J6UA 3HPHA 4M42A 4IG0A 3CQ8A 4B9NA 3RMDA 3OHAA 1TKTB 3IRXA 2FJVA 3KLVA 5KFRA 3NAHA 2YHAA 3WNGA 1QSYA 4J9OA 4JV2A 4Y34A 2ILZA 2D3UA 4CEFA 5KFTA 4WYWA 4ID1A 1WAFA 5HLFB 1RT6A 3O4NA 2WRMA 2RN2A 2HNZA 3L2WA 2RF2B 3HVRA 4IG3A 4KHWA 4BE2A 4B9UA 4DMNA 3LAKA 3H08A 4O55A 3U6FA 3RMAA 3OS1A 3S9HA 3LP2A 3V6HA 2VG5A 5DQIA 4FK2A 1UWBA 1SH3A 3K57A 5KFBA 4J2EA 1RDRA 5SZTA 3AA2A 2FLNA 2OPPB 4ELUA 1I3AA 1S6QA 4FBTA 3NH0A 5KRTA 3KHGA 4ZVHA 1C6VA 5C42B 2Z1HA 5DK5A 2RKIB 5KG5A 3CO9A 1KLMA 5HBMA 1BQMB 1EETA 4ZPCA 4I2PA 3RRHA 1VK0A 2AWZA 4FJMA 1EX4A 3V9ZA 4PUOB 2FC0A 1KVCA 3BGRB 1O1WA 2BDPA 3NF7A 3MFHA 2XY7A 3FFIB 2RPIA 2O4IA 4CFAA 3G10A 1JLAB 5KFHA 4YR0A 4MIBA 3V9XA 1EP4A 2E4LA 4YNQA 3RB4A 5KT5A 3K58A 3M9OB 3IG1A 2AU0A 4CF1A 3LANA 3G86A 4MQ3A 1T05B 1RT5A 3D28A 3BSNA 3OYLA 3S3OA 3UR0A 4JV0A 5C24B 3DMJB 3MEDB 3PJWA 2ZD1A 1TKTA 2QV6A 1VSLA 4CJEA 3AVNA 2IBKA 4H4OA 4EYHB 3NFAA 4ELTA 4JV1A 4HCBA 2JEFA 2ASLA 3LZJA 4DQIA 3DYAA 3A2FA 4RW7B 4U7CA 3VQ6A 2A1RA 1JLCA 2D7SA 2OYQA 2HHXA 3WNEA 4DTNA 3V9UA 4W5NA 2FVPA 4KHYA 4XPEA 1UAXA 4N5SA 4IKAA 4NLQA 5HROB 2HWHA 3T19A 4CJ5A 3G6VA 4FM0A 3PY8A 4CJLA 3TAFA 2DTUA 2J6SA 3VQ5A 4CK3A 1LWFB 1S6PA 1S1TB 1BQNB 4R5PA 4GC7A 1RT3A 1W25A 4MK9A 1REVA 1ZBLA 3HK2A 1TKXA 3L2RA 1JXLA 3G6XA 3CFOA 4FJXA 4NLDA 5F8IA 3KLGB 2B43A 4M95A 4Z4GA 4EBEA 3ICLA 3TAQA 3QGIA 2OPRB 4YMEA 1BI4A 3UQSA 4U6PA 1RTDB 1HMVA 4FZYA 3IAYA 4DTPA 5KFEA 3NGIA 1UOCA 3QIPA 2HHWA 1NOZA 3T5LA 4M3ZA 3Q8SB 3L8BA 2GIRA 2ZKUA 4Z4CA 4OGCA 5L1LA 3OYNA 4M41A 2YKMA 3NGYA 4CF9A 3V6JA 1GOAA 4HHTA 1U45A 3U3GA 1TKDA 4KKOB 4CECA 2GIQA 4ED0A 2R8JA 4PWDA 5FRMA 2FJXA 4CHPA 3E51A 4FLTA 4NLSA 3VQ7A 4DTSA 5CYQB 4EBCA 4NYNA 1YTUA 4ZPBA 4KFBA 3QIPB 3KJVA 2IAJB 3MECB 5D3GA 2X78A 3OYGA 5KFAA 3TAGA 1RTJA 5KFFA 3D45A 1HQEA 3DLHA 3QEPA 3V9WA 3MEGA 4IFYA 2X6SA 4H4OB 4KHSA 2KTQA 1NKBA 4KHMA 1LWEB 4RNNA 3QEVA 3TAPA 3OYHA 5KT3A 3C6TB 4CERA 3DLEA 1FK9A 1IKWB 5T7BA 4G1QA 4BE0A 4H4MA 3FSIA 4RW4A 3TAEA 1VSFA 3QEXA 3KLFB 4NLUA 4KHNA 4CGDA 4RW7A 3HVWA 4G1QB 1CZBA 3QERA 4MK8A 1S9EB 4FJIA 4FW1A 5KFPA 2OPQB 3MEGB 4Y2AA 2KZMA 2P5GA 1RT4A 2C2EA 2G8UA 3AVJA 2VG7B 4QWCA 3VA3A 4K50A 3HVTB 5KT6A 1TKXB 4CEAA 2BE2A 1ZTWA 4ZP8A 2KFZA 5J1EB 4BE1A 1MMLA 1D9FA 1EETB 3V9SA 5C25B 3OVNA 2AX0A 2UVUA 4ECZA 3AA4A 4DTXA 4JUZA 1Z4UA 4E7IA 3KK3A 2GUIA 3DLKA 4JLHA 2DFEA 4KBIA 3DLRA 1C1BB 1F21A 3L2VA 2KFNA 4TN2A 3OY9A 1S9GB 3QIDA 5KFNA 3K59A 1SUQA 5KT4A 3NF6A 4HUGA 4DL7A 4F4WA 3TARA 4MH8A 4K4YA 5J2PA 3LP2B 5L9XA 1CZ9A
chains in the Genus database with same CATH superfamily
3FMBA 2BV3A 4FVCA 4BVOA 3G8TA 4J90A 1WBDA 2CVEA 1RAFB 3KK1A 1X7VA 3V2UC 1U1KA 2ERRA 3QT5A 5GADU 3OW2M 4YB7A 3FNNA 4CT9A 1H0HB 3R27A 2ZUAA 1BD6A 1L3SA 2CIMA 3P4IA 2Y8YA 1XNQF 1NDKA 2I8EA 4BBYA 2V4QA 4W5QA 2PIIA 3GL1A 2X51A 3ENOA 4PUOA 5FROA 1TK8A 1J5EK 2XEXA 4DL3A 3E01B 3FJ2A 4GO5X 2QSWA 2YBVA 1IKYA 1JLCB 3HI9A 3CCTA 1NDCA 3Q89A 3L2UA 2DGWA 1IKWA 2E1RA 2HQCA 4DUTA 4IEIA 1S6QB 1JCEA 1W2BM 1YJVA 1S12A 2Y1IA 4RUHA 4K4XA 3W2VA 2BQUA 5HMWA 3DU6A 4YDUC 3SUOA 1EIYB 5M1PA 3OSNA 2EX3A 4P10A 2HMIA 1BHLA 3ZSRA 2G8HA 2I0XA 1JKHB 3VQCA 3PM9A 5KFWA 2E2QA 4NLOA 4CFDA 5HQLA 1RNHA 3V4IB 4USKA 1J5EF 1HNIB 1WWHA 2RRAA 2P6SA 1QE1B 4ZLLA 4V19X 4LUBA 2YKMB 1DGKN 2XCAA 3VEZA 3HHEA 4ZVFA 2IGIA 1OWXA 4OHXA 4B1UB 4E1JA 3ISZA 1WOPA 1S1TA 5ETLA 1NJWA 1LAWA 1SIWB 1EKEA 5EDWA 4CHYA 2N82B 4RNOA 3H1VX 2X7IA 1Y0HA 1SUQB 4K8XA 4OVLA 1ZAXA 3KJVB 5A6WA 3CJ3A 4CJFA 5K14B 5KFSA 3BQ1A 5KG0A 4DFKA 3QFPA 2CG4A 1NHKL 3CJ7A 3AY0A 2GV1A 4AHVA 4J9PA 4OX9F 1QD1A 4WQ4A 2YWFA 1QDUB 2ROGA 2OPQA 2CQDA 1D9AA 2HPUA 4KV8A 1TZ0A 1FVQA 2QWRA 4QWEA 3CCSN 2NUUG 5HK4A 4PXDA 4OZLA 3DOLB 4J2DA 1HI0P 3K5MA 4JB8B 4J9RA 5DM7Q 3CJQA 3DLLQ 1JCFA 3Q7CA 4OJ3A 4QW9A 2NRRA 2CDRB 1ZM9A 4BRQA 2JVRA 4JI2J 1SB6A 3SMZA 3LM2A 4A46A 3A8EA 3TA0A 4QS8A 2BABA 3NOGA 5E26A 1PAEX 3M8ZA 4E3SA 4MKBA 2P9LB 5HOOA 3FFKB 4YFUA 4DV7J 5F3ZA 2VJUA 3V1OA 4B3OA 1RTHB 4G1PA 3TQEA 3G4SS 2HBLA 2HQDA 1ATRA 3OHRA 5KFYA 1LWCB 4AILC 3SPYA 4H0PA 3OPKA 4N41A 1BGXT 3PYEA 4ZLNA 3BO4A 1FFGB 1VIXA 3HO1A 2JEIA 4UZBA 4YB6A 3D0HE 3KJQB 4RW9B 2J6TA 2XB2D 2ZE2B 1T9XA 4C1NI 4KPYA 4H0VB 3C16A 2YHBA 5C15A 4F3OA 1ATSA 1K73T 5AFUH 2GJFA 4WU3A 4LMZA 2R8KA 5EX5A 2ABYA 1HQUA 3B54A 4O3PA 4ENOA 2DH8A 3KIOA 2HHQA 1KC8T 5LM7E 1S7HA 4HACB 4FWNA 3K5NA 2HHTA 1VQKN 4W5RA 2AGPA 4JI4F 2RAQA 1YJWS 2JZ5A 2YY3A 2D1KA 5D4NA 1MMNA 4FK4A 1S0MA 3H40A 3I6PA 4IRDA 1ZH5A 1F0XA 3BBFA 2DH7A 2DGSA 3C6UA 2Q36A 4C0HA 5HMZA 1T9TA 1FO1A 4ED3A 1S22A 3T5JA 4WKYA 2H51B 3JAMU 3J80Y 3NS6A 2YKNB 1Q1KA 3EJMA 3Q22A 4F3QA 3CFPA 2GVZB 1QVGM 1AYEA 4ID5A 4CD3A 3TNVA 5AT1B 3UDLA 2OGUA 5DQHA 2Z56B 3N4PA 2GVZA 2XTJP 3N5FA 1OY6A 2Z57B 2X1FA 4LIWA 1VQ8N 4B9SA 3KJFB 3MX5A 3UO0A 4WPAA 4O5BA 4QWDA 1X4BA 2KYXA 1S9GA 4LFAJ 3HKWA 4X4UA 1ZPWX 1ZZFA 4GMKA 2W7PA 4M3RA 2AKWB 4B9QA 3LALA 5BPMA 5JVGQ 4IUFA 4USWA 2VBYA 3L2QA 5GAEP 5AQRA 4ZPVR 4RL1A 3AAWB 5KI6A 4H0XB 2YQ3A 1HBUB 4WCEQ 1RGIA 3KLIA 4QZVB 5KFOA 2WONA 4JI1J 1NG9A 4A8FA 2PA8D 1H2UX 2JEGA 4YHHF 2ZM6F 4G9ZA 2LQ9A 4ILRA 1OS5A 4ZCIA 5LSRA 3G71S 4ED4A 4DPYA 2ZGZA 1TVRA 1MN7A 2GW8A 3AO4A 3K9JA 2YNHB 3EICA 2GO8A 2UUBJ 3KUGA 1QSLA 1Y10A 2AJ1A 3MDFA 4CO1A 4DUZJ 4M5DA 3ID6A 3NNHA 2HNYA 4PXBA 2ALZA 3OTOJ 2Q3PA 3QNOA 1RA6A 4ED2A 3PSFA 5D8HB 2EFGA 2E7VA 2KL8A 3HYFA 4P52A 2QEXN 2OMOA 2YHYA 4AHRA 4UW2A 3L7UA 3BKFA 4WZQA 2PYLA 1S9EA 2F5GA 3K0SA 3SQ4A 4YY3K 2IVMA 3FZ2A 1C1AA 2XMJA 4C8KA 1FNXH 3EEQA 2VA3A 1IBCB 1MU2B 1T6DA 3UCGA 4KKOA 2BM1A 2BANA 3SDEB 4FPBA 4J2AA 2MLYA 1HPZB 4PXEA 2GAHC 4WF9Q 3I87A 3D2WA 2DR7A 1DKGD 1SZ2A 3OYAA 3H98A 3HMJG 2YNGB 5AQPA 2W9CB 4MMOA 3IAS9 1DTQA 4AHCA 5AE1A 1X9JA 4NXNJ 3TWHA 2RU9A 4Y65A 3DAWA 4O0NA 2DNMA 5DQGA 4PL7A 3GYNA 2HK2A 1WOQA 3CULA 3PJXA 2GUPA 4Q8EA 2Q1NA 4G65A 4DPUA 5K9FA 5AQLA 1Q4RA 3VQSA 3MHYA 4DR1F 3SUNA 3E8OA 1QS4A 2LDIA 3CJ4A 2JWNA 4NLVA 1XHXA 2HK3A 1UVIA 1M1HA 2AJ4A 5AQWA 5FDLB 2CYYA 5A2QU 2YNGA 1ZXOA 3O08A 4C8NA 1K9MT 2OZSA 5HN0A 2C3YA 2DNLA 3WEEA 5KPRA 3DMJA 2OJ3A 5EGYA 3DRSB 3D7SB 3T41A 3CJ1A 4NB4A 4LR7A 4CO2A 5KG6A 3JS9A 2E2NA 3MUTP 1I94J 3GSIA 5ETRA 2Q2RA 4E89A 1WBBA 1QQMA 1RILA 1I94K 1WUAA 2Q6CA 5F0XA 1YRUA 2A18A 2DIVA 1TL3B 2A10A 2ZWOA 3M1FA 3KHRA 2R2TA 2JLGA 4CGJA 5KFDA 3NAEA 3WXKA 4IOCQ 4O5FA 2HZVA 2NPFA 4WQ5C 4EYIB 2GHVC 3AFGA 4IR9A 3DRRB 1UWBB 1HKAA 2YX1A 4KBOA 4UOFA 2ZHBA 4ZHRA 2RE1A 4KREA 2W6KA 5THWA 1LQ9A 1J5OB 2BANB 3S3NA 3CTRA 2HNZB 2AYGA 1WN7A 3V4IA 3HSZA 3MM8A 1LNQA 3SSRA 4O44B 4M5MA 3O3FA 4ECRA 4W92B 1YLXA 3V6DA 1VC0A 3GV7B 4P2XA 2L9NA 3BZCA 2AP6A 2DHXA 2MKYA 5HVHA 1DJ0A 1WC0A 2IJRA 3OTBA 3A12A 4FS1A 4DUYJ 3SMPA 2FY1A 4BDPA 4K4VA 2NQPA 1RCHA 1FKOA 3OFHA 3W3SA 1EP4B 3J7YU 3CCQS 2MHNA 1NB7A 4CGHA 4I6MA 1UVMA 3OTOF 1BXNA 2KRBA 1N5QA 1OY8A 3WBZA 1K0TA 4NLXA 1K1QA 4KYZA 1R0BG 4DUZF 2IC3B 1F1BB 3LM9A 4BC3A 2B8QA 1RHJB 3PIPL 1DFDA 5IOLA 4X4RA 2IM3A 2I6WA 2K3KA 1K9MO 2JEJA 1CS4B 3DXBA 1C1BA 3G6ES 4EIAA 1TUYA 4USMA 4C98A 2WTFA 4ZPWR 3O44A 3G2XA 3N01A 4JI1F 3CJCA 4ELVA 2IMWP 3VF6A 2DR8A 2W4CA 3M8YA 1QAJA 1UMJA 3M6GA 4RWWA 4AQYK 2R8IA 1WTFA 2ZFHA 3B8AX 2EKYA 3KHYA 8AT1B 2QJ3A 3RW7A 2QL7B 2ZOMA 1JXBA 4FOIA 1YHQN 3BGOP 3CJTA 4M3TA 4LFAF 4S0MA 2ADCA 2AYBA 3OYDA 1NNEA 4FZVA 2KVQE 2KT2A 4CNZA 4UOCA 5DGAA 4WIQA 1UZHA 4DPXA 3JYTA 3HM9A 3AD8C 4DX5A 1U04A 2ZUGA 4EO6A 3GIIA 2WSFC 1N6QA 4KB1A 2C42A 5F2RA 3SCJE 2Q31A 2LKZA 1FX4A 3OXGA 5M2RA 3BF4A 2D74B 5C2DA 4MO5A 5H9EK 1OQ3A 3M6WA 3T5KA 4WP9A 1HBOA 1H2VZ 2F7VA 1HYVA 4FNIA 2M2BA 1QUVA 5ETTA 1NUEA 1R0AA 3MCSA 4EGLA 3OL7A 3O8MA 3SCKE 4JI4K 4B9LA 3CDUA 3QB0A 4B1YB 4LF4J 4DSJA 1G99A 2W6LA 3O1LA 4GVBB 4ZJLA 4YOWA 4BRDA 5E3CA 3N5BA 2PZSA 3AVKA 2P9NA 4NE9C 4ANDA 2X6NA 3T6JA 3CSKA 2GZOA 1SC6A 1LEOA 3EPGA 4EEYA 3R5BA 1NJZA 2WONB 1CULB 1U0SA 2JGUA 3H4BA 4FCYA 2RH3A 2M70A 1R0CB 3NWGA 3TEGA 4JRPA 3M6VA 3H42A 4ZIWA 4FWOA 4FWKA 2E66A 4CVNE 4KAZA 4Q7AA 3AGRA 3Q24A 4CJWA 3DM2B 1WELA 2HFUA 4I0WA 1S3XA 4F4XA 2ZH9A 3O9SA 3NKYA 1VRUA 3TA2A 4X64K 5J1NA 2WZ1A 1G1XA 2QL5B 1F3FA 1SVDA 2EHGA 2QMWA 1C4CA 1XERA 2OCEA 4IXCA 2HLUA 1GFWB 4Z4FA 1APSA 4C4WA 5FLXU 1WEXA 3C7NB 4FJGA 2NRZA 2ZH2A 3FEXB 1EB0A 3CF5Q 1ZETA 2DY4A 1MU2A 1SQGA 2M5YA 5HRNA 4N8NA 1HNWK 5B0DA 4M3UA 2MGZA 3FE1A 3DDIA 3I56S 9RUBA 1GNKA 4FWLA 4LFCK 2CZ9A 2Q43A 2DNKA 3M9NB 3QJJA 2D0PA 1D09B 3H4DA 3L6QA 2DO0A 3NP5A 4LJMA 4O4RA 4BRLA 3W8GA 3CD6N 1ICEB 3FRZA 4K7QA 4DCHA 2Y1JA 4ED6A 3HD1A 1Q53A 1M5VC 3QESA 1V5VA 5BR9A 4YUDA 3F56A 1Z25A 4CHZA 1Y7PA 1HKGA 3PXGa 1VQ5N 1AA1B 1TL3A 3BB5A 2VONA 3VQEA 2E1CA 2QWPA 4OX9K 1UCNA 3AVLA 2F3JA 4FVUA 3J7AN 2ASDA 3MR2A 1J53A 1VQNN 4BR5A 5DGBA 1C0TA 3QWPA 1Q5YA 3M30B 1NPKA 2DPIA 2BJ3A 3B82A 1YITN 4DWIA 4HUFA 4WFXA 3VAHA 2DRBA 4CBWA 3WEEB 3K9KA 3AO5A 4ECXA 4M94A 5EWGA 3ULHA 1TAQA 3CT9A 4PPDA 1VQ8S 3FBBA 1JL1A 1FKPB 2JSXA 1F9HA 4WZMA 4M3XA 3KLGA 3LTOA 2FHKA 2ASPA 3CMAS 2H5EA 4K42A 2PI4A 4FLYA 3SYZA 2PEHA 3AVBA 3FKBA 3T1HJ 4C8MA 3HULA 1FHTA 1Y11A 2V8VA 2WB4A 1QQNA 2GX8A 3RRGA 4FS2A 2FYXA 4O23A 4OHVA 2J5AA 4I6AA 2VPYB 3CJ5A 3ZZPA 1S49A 3VAFA 3LF0A 4ED7A 2RDIA 3VZHA 4AUKA 1WNSA 2G8VA 4MTPA 4TVAB 1H1VA 2DB1A 3C66A 1L3UA 1Y3KA 4F4YA 1JJ2R 1HPZA 2RS8A 1J5EJ 2CQGA 2QO3A 3EXYA 1X60A 2BYCA 1CJVB 2AJQA 3AAPA 2WFBA 2HG4A 2HNDA 2XSJA 2MPUA 3CMEN 1XEZA 2CH6A 4K41A 2RJZA 4DL0C 3NGDA 2W2NP 3W2WA 1KVAA 3T5HA 2CPEA 2MQQA 2V50A 5F8MA 4NCAA 3TUZC 2UXDJ 1NGDA 4YR3A 2CNLB 2Y3YA 4WYLA 4K59A 1KHWA 4DR7J 2RRBA 4KH4A 3OJUA 3JS6A 2OO4A 2PY5A 2V0NA 2Z0GA 1SQKA 2QMXA 1UP1A 5AQYA 3W66A 1VOMA 3SFGA 3NLCA 1EKRA 4QCLA 1V3RA 3M30A 1RDAA 4OHWA 4NPOA 4QU6A 1LK5A 1NHVA 4FYDA 3GIMA 2FVSA 1IBLK 3BN7A 3CDBA 5A2QO 1XNQJ 3E01A 2Z4PA 3PACA 3CJKB 5AZIA 3D1QA 4ITSA 3IUCA 1TMJA 3BPSP 3QO9B 3E9LA 4MJKA 4A5AA 3PX6A 2MY7A 5AQZA 3BREA 2XY8A 1C4AA 4EI2A 2UVRA 3MMVA 1NKCA 3BPDA 2R2RA 4RKUC 4DFJA 2PA3A 5AFUA 1BMQB 1S72S 2CFXA 2G2ZA 3HJFA 4CFCA 4ZJOA 1VFJA 2XY6A 1W0HA 3W61A 3D4JA 2HIYA 2V6AA 1IKVB 4ZVSB 3E66A 1N36F 3ASMA 4BC4A 2N7CA 1V4SA 1U09A 2P9UB 1RGVA 3SMSA 1IBMF 2PD1A 4N76A 3Q8QB 2P51A 4C3KA 3CE8A 3LGMA 2E5GA 4F26A 3QNNA 2VOPA 1HARA 1P90A 3DLGB 1WKKA 2ZH8A 1N32K 5D15A 2J7KA 4I6YA 4PYAA 3A8KA 1NO8A 4U9RA 1OYDA 3KHHA 5AXKA 2M8DB 3LWMA 3DI6B 5A8KA 2FZKB 2C3UA 4JKFA 3NE6A 4X84A 4K4SA 1S77D 3TR5A 3TO8A 1NXIA 3ZZRA 3VPZA 3O6QA 3S3MA 1FTCA 2LDYA 5D3GB 2ZH5A 1LXNA 2XWXA 4OFZA 3KWIA 2AJFE 1NMDA 4O0IA 2HAIA 3P1GA 2MDAA 5AZJB 3A5LC 1SJ1A 1NDLA 4DV7K 5CCMA 2E20A 1ATNA 2KFYA 2LXFA 4O3SA 1M1GA 3D6TB 5KFUA 5D4PA 2WUSA 1E4GT 2UU9K 2QKBA 2WVFA 3QFHA 4HEA9 3D6MB 1SPBP 4CTAA 1DZ5A 3Q83A 2RQMA 1U6BA 1CJKA 1W97L 1RBSA 3ULEB 4R25A 5FLXO 1Q7YO 3EWGA 3CWJA 2ZWHA 1Q8LA 3ZTSA 2HBKA 4EAHD 1SJ3P 1TUUA 2UU9F 1O6XA 2KI2A 4IRCA 3EPIA 4P75A 2HIQA 3HI0A 5GVQA 3LGNA 1N36K 3AA9A 3OHBA 4OPKA 1BISA 1FI4A 2XI3A 5M1FA 3GPAA 3IBWA 3RAQA 2RIJA 4BROA 1C0GA 3W9HA 2MEWA 1ASWA 2IRXA 1DQAA 1NK5A 4JI6J 1X9MA 1FXXA 2KLAA 4RG8A 2DGXA 1UEKA 4JI7J 3RB0A 2G0IA 4TLRA 2P9SA 2YX6A 4QIWD 3F44A 3QLHA 3O5BA 4OYZA 4JI7K 2J0QD 5AE2A 2OH2A 2VG6A 2VASA 1R6VA 2R7QA 3AH6A 3R1LA 1CXUA 3D2FA 1NGIA 2GCFA 3ILIA 3Q86A 1F9FA 4PABA 1JLQB 3QJLA 1G7CB 4DX6A 4B3TF 4ZCLA 1HNWF 1U1OA 3EE3A 2ASMA 2C1EB 2HHPA 4GKJK 5T14A 5EVZA 4QIFA 4Y2CA 2R7UA 1JJHA 1ZM2A 2KXNB 3D0PA 3A0IX 1S59A 3RBDA 3TTDA 5HJXA 2GJ2A 3QEIA 4X65J 3HSGA 4ZKAA 2RF2A 3E9PA 1LXJA 5L9NA 2VD3A 4B3SK 1V3SA 4B9NA 1TKTB 3A4TA 3IRXA 5F1XA 1HW8A 1WUUA 1T9YA 5KFRA 3TWZA 1HL6A 3CUNA 3WNGA 1QSYA 4JI5F 1HNXJ 1HIYA 3BH7B 5KFTA 4WYWA 3NS7B 1PJ7A 4K0KF 5EY4A 3W63A 3C19A 1NBWA 3L2WA 1AROP 2C3OA 3HVRA 1UFLA 4DV2J 4B9UA 2UXBJ 2ACYA 2DXFA 1FNOA 3OS1A 3S9HA 1VBYA 3GR1A 1KS2A 2A1BA 3IP0A 4AL7A 4X4VA 3MURP 1SH3A 4QIVA 3K57A 2KT3A 5KFBA 5SZTA 2V68A 1YIJN 2C2ZB 2CPIA 2P5VA 3AA2A 2FLNA 4ELUA 4A48A 5C42B 2EFQA 2OEMA 5A8RA 4WFNL 1SKUB 2HRUA 2O8DB 1KLMA 5HBMA 2HGNA 4JI8F 1EETA 1F60B 2OI2A 4P2MA 4CDIA 2DR5A 1CEZA 4I2PA 3RRHA 2PI5A 1VK0A 1EX4A 1YTYA 2R7RA 2CNKB 1Y5NB 1KVCA 2QI2A 1VLYA 3BGRB 2DGVA 4CZCA 1H73A 3FFIB 2RPIA 3K89A 5ADZA 2CG8A 2QTDA 1XUPO 3BP8A 1LWXA 5KFHA 5JVHL 3V9XA 4YNQA 3PNIA 5KT5A 2IHR1 3M9OB 3K58A 3L0QA 2AU0A 2PEBA 2IFXA 2B9XA 3G86A 2A3JA 4MQ3A 3MMJA 5CH7B 2VCPA 3OYLA 3MWTA 3S3OA 3DMJB 1IR1A 1K8KB 1WI8A 4BLGA 4DV1K 2B9WA 1TKTA 5GAEU 4WIIA 2NNWA 2BOAA 3THXA 4ELTA 4DQIA 3DYAA 3A2FA 4CZHA 1OPIA 2LA6A 1X5TA 1VBZA 2GHPA 2KB2A 4U7CA 2A1RA 4CO3A 4AYBD 2FJBB 2V9KA 4JKHA 3UD5A 1UAXA 3JSYA 4CLSA 4OV1A 2HWHA 3T19A 3JAMY 3TEHB 3HSDA 1X4FA 2J6SA 2UP1A 1SC1B 4GC7A 3QBCA 1W25A 3MCAB 1ZPVA 1REVA 3OTEA 3EGNA 3G4SN 3L2RA 3CFOA 3MMBA 2BTFA 4NLDA 3KLGB 2BACA 5GAHI 2YKPA 2W24A 2CGJA 4Z4GA 1NRKA 4LFCF 2QA4S 3MAAB 2OPRB 4YMEA 1YAGA 4EHTA 4FZYA 3MMCA 2J9CA 5AQFA 4KRWA 5KFEA 3TW0A 2ZZNA 4A61A 2YWHA 1XK8A 4WP8A 1NOZA 3T5LA 4NI2B 2XNQA 4M3ZA 1BWEA 3PRVA 2GA7A 2YKMA 3NGYA 4BRFA 4OLOA 3V6JA 3CCJN 4HHTA 1U45A 1AFJA 3U3GA 4KKOB 4GVEA 4I6WA 2NCKL 3MOJB 4OI0A 5CYJA 2XO6A 4PWDA 1OO0B 4PKHA 3JQMA 4NLSA 2CQCA 3VQ7A 4DTSA 5CYQB 4NYNA 2Z30B 4Z7YA 3MECB 2VQEK 3K17A 2X78A 5F3TA 2BOPA 3TAGA 5AQHA 1HBNB 1FRHA 1VQON 3CW2C 3QEPA 5DJBA 2X6SA 3PRDA 4KHSA 2KTQA 3CCSS 4KHMA 1LWEB 2I7NA 2V34A 5DDOC 4CERA 1FK9A 1PYTA 5IFMA 1IKWB 4BE0A 4H4MA 1TYQB 2ACMA 2A40A 4WWSA 2M3DA 1T9VA 4A62A 4NLUA 4CGDA 4RW7A 4G1QB 2ATCB 2ZJQQ 2VPWB 3VVTA 4RU2A 1J2VA 3TTFA 1RT4A 2GVDA 2RRNA 2IVYA 1KQKA 4EK2A 3OUYB 4QWCA 2DR9A 3HVTB 2H3EB 4OI1A 4DUYK 1WDDA 2NLXA 1WG5A 4WYBA 4FYWB 2KFZA 2HMPA 3HSJA 3VV2B 1MMLA 2C2MB 3V9SA 4Q2MA 1SS6A 3AA4A 2A42A 2KN4A 1RHRB 4DV5J 3MOZA 3M2RA 2IVOA 3J81Y 1YJNN 3DLRA 5DDPC 4BQZA 1F21A 3L2VA 5KFNA 4JV5J 4FF1A 5C2FA 2LCWA 3K59A 3W0LA 1U6FA 4HUGA 4DL7A 2CRLA 4MH8A 3LP2B 3VTHA 2ZBCA 1WORA 3LL3A 1CZ9A 4CJKA 1BA1A 3CCRS 1WNEA 4FJJA 5C5JA 5AQJA 1SJRA 4ETXA 5K20B 5KGXA 1HR0F 5J2NB 4KTQA 5LSOA 4DHYA 3VGVA 4NRTA 5A2QY 3D3BJ 2VG6B 3SQGA 1Q7YT 4WFNQ 3NH1A 3RZAA 3I4HX 5U47A 3VQQA 4OGEA 1PSDA 2DY1A 3QGGA 4ZVPB 1CG2A 3IR6B 5C2CA 3WC2A 4NYZA 5CAAA 2A3ZA 1FJGJ 2HWIA 3GQCA 5RUBA 2UUTA 4WFAQ 2F1FA 4WU2A 1L3VA 1P8ZA 2P9PA 1L3TA 4AHTA 4AH9A 2P9KA 1KAZA 4P72A 3Q0AA 1Q78A 2AEJA 1WLJA 3J7YP 1B0PA 4AT1B 2ZOFA 4C11A 1HI8A 3MEDA 3D2EB 2UYTA 1HBMA 1JXEA 2JRSA 4FXWA 3M8QA 4JKCA 3EN9A 4M7YA 4BG8A 1BLUA 1PCAA 4K8RA 1FJEB 4CLPA 2YNFA 3BDPA 1R59O 1M90T 2D0AA 4DN0A 2ASJA 4DV0J 2BA9A 4USHA 3WX4A 1D4XA 2P9LA 3R6LB 3FZKA 1P9QC 1NJYA 4LRAA 4LY7A 4IDKA 2OELA 2R2SA 5KAKA 4DL4A 4RW9A 3CJ2A 2KVIA 2YNFB 4RW8A 1CJUB 3MXMA 3KLIB 2QK9A 1U2VA 3RR8A 5GAGP 2P9NB 4ZPAA 2NRHA 1ESVA 3AY9A 3ENVA 2CPYA 2B7BB 3F5TA 1RDUA 3HFZB 3HPOA 1EX8A 4IO1A 3AO3A 1HQUB 4EFHA 4U7UK 1S57A 4JI8K 1FJCA 5F8JA 4RUBA 4CE9A 4ID8A 1S48A 1RWWB 4DV3J 4HACA 3P83D 1YJTA 2BZ2A 2W9AA 3FFIA 2R7VA 4K4ZA 1NOYA 2BJDA 3E3XA 4NCBA 3PKYA 4TQSA 3HP6A 4IOBA 2E2OA 3UVJB 4LSLB 4WFAL 2H54B 3ALYA 3QT8A 2VOOA 1RWMB 3OYEA 4DI6A 1P1TA 4R5PB 2ZZMA 4CJQA 4L75A 3N6NA 4HH1A 2VDIA 4U7BA 4YOXA 4KGVB 3WZ0A 1HBMB 4DR3J 1VQ6S 4JKDA 1RT6B 5GIOA 4Y6IA 4KTWA 2RB7A 2D9PA 2P9GA 1WTBA 3AA5X 2OSRA 1XMOF 1YQHA 5EWEA 3RR7A 2HNYB 5CHCB 3OR1B 1XC9A 4FJ8A 4I7FA 5G0RA 4M3YA 4ETZA 1NZAA 3KKFA 4UY8T 2I5JA 2JC0A 4EP4A 4JRQA 3CGIA 5FPNA 1KN6A 3GONA 4USIA 4R8UA 4CO4A 3HHLC 4RBVA 5IM0A 1B9FA 4L3KA 4P73A 4OJRA 3HHNB 1FEHA 4MIWA 3O1BA 4YOYA 1FFSB 3M2VB 3OSPA 1TUVA 4KIAA 4BWMA 5D0RA 2DIUA 2F65A 4JK8A 3CI5A 1RDCA 1WHWA 1KVBA 2EWHA 4CYUB 3NGZA 1F5CA 2HSTA 5F9NA 4H4KC 3WXLA 4AM7A 1S99A 4OZ5A 4KE5A 1Y5LB 4MFBA 4CI6A 1UA0A 2MLZA 4EBDA 1ZAWA 2ZM6K 3CIZA 5GAGU 3BM7A 2GWJA 4CIOA 4B9TA 3D5MA 2GAGC 2IMOA 4ZN1A 3OR2A 2DR6A 2DGOA 4AQYJ 3G9CA 3PSIA 1U1QA 1F5BA 2GWKA 4J9MA 1A5WA 4Y3CA 1BCOA 4NLCA 3T7ZA 2EC2A 2CZ4A 4FLZA 2L41A 5L1IA 1U1MA 3AOAA 1FKPA 3W9IA 5KG2A 3UPFA 2WOMB 4MO4A 4DV1F 1NK0A 1PO6A 3DRPB 5KPZA 4FKYA 4JYAK 2D1CA 3AVFA 4DQ8A 2PMZD 2RQ4A 1YG0A 4OHZA 5AQUA 1HHSA 4DN9A 2EK6A 1N32F 5G0RB 2V52B 2A5XA 3R97A 3M8RA 2G8KA 3MTKA 4OV6A 1IV0A 2QM1A 1HJRA 4URGA 4FP9A 2V8HA 5C25A 4E7LA 2ROPA 4ZHRB 2XS2A 1UAWA 2O5DA 4KGXB 4KH5A 5L1JA 1BWVA 2J0SD 3GOIA 2RS2A 3M4XA 3NY0A 1SL0A 3H25A 3GG1A 4LBIA 4ES1A 3V5RA 3DNCA 3N79A 3MXIA 3Q8RB 4M5GA 1T3OA 1A9NB 5EN1A 3KVGA 2H65B 2MGZB 4JEPA 4PWDB 6FD1A 2YNIA 3KKRA 2U1AA 4CF8A 5DDQC 4HKQA 4O3RA 1BG3A 2E88A 1X3NA 1SV5A 1N4LA 2LLZA 5DO2A 2V4JA 1S1XA 3NNCA 3VF4A 3EVWA 3GU0A 3L3VA 4DR6F 1IBMK 5F8HA 5H9EJ 1HPMA 4GVLA 4ZVTB 3VGKA 5CYMB 3BO2A 5E3QA 4HT5A 1CJTB 2B9EA 1DARA 1VSKA 3QT7A 5T41A 1X4GA 1MN9A 3D3CJ 3CCLS 3BKUA 2PFFB 2JJ4D 3M9MB 4JI3J 1MWMA 2KHOA 2DNPA 1PJ5A 1X9WA 1HFEL 1S76D 4PCQA 2UXCJ 1LWFA 1PYSB 4WBFA 2CQHA 4DB3A 4CFBA 3CXCR 1GLDG 4FLVA 2O3DA 1OMSA 3DRXA 3CJKA 5AZIB 3KJNB 5B8HA 4M1KA 4TSXA 1R7IA 3TQ1A 4WXWA 4AFFA 1VJWA 2ZH7A 4DR2J 1ITGA 3AB4B 4RW6A 2HF3A 4C9DA 2G9OA 4I2QB 2N3OA 1FKAF 1JJ4A 4Q8FA 4YOEA 3DXKA 1CLFA 3P8BB 5H9FJ 1PBAA 1U4BA 1FDBA 4LSNA 4WQ5A 5LJ5Y 3SQ0A 1MWKA 2IM0A 2LQJA 3PEHA 2AA4A 2V7YA 2B4UA 2MKJA 1Y97A 3V6DB 3MEEA 3FZHA 3PIOL 2F7TA 1RU2A 4JYAF 1WSRA 3AD9C 3JSBA 3D67A 1RISA 3MXJA 2FBXA 1GLLO 3DJCA 1XMQJ 2EXUA 2MKSA 3I0RA 4KPCA 2BUPA 5D78A 3M2UB 3MR5A 1F2GA 5AQMA 2BUNA 3FK4A 4DU3A 4FJ5A 4Y0WA 2QXFA 2WTUA 3TUJC 2G8IA 1VQ5S 3HD2A 2V8DA 5J2NA 3I96A 2P9CA 1WACA 2IA6A 1KQGB 1SQEA 4QIGA 3MM7A 5ETSA 3ZTOA 2HLTA 3VMFB 4JD2A 1FRKA 3FLCO 1NLKL 3ZT0A 4HDGA 1KHVA 4CLYA 3U8XA 4KB7A 4ZMMA 1OYEA 2Q1LA 1RSCA 1SKRA 2YKQA 4BRHA 3W62A 3NCIA 3T9NA 3ZNUA 4D3GA 4FJ7A 4YB1P 3EY1A 1H72C 5AQNA 1HWUA 1UTAA 1RU1A 2AGQA 5HROA 3J7AP 3MM7B 2ZH1A 2HRTA 5JVHQ 5HMYA 5MLCV 5LMUK 4QOTA 1Z26A 5DLFA 4A8KA 4CGGA 4CJSA 2YKOA 1VSDA 3W8PA 1RHQB 1XMQF 1Q9YA 4L74A 1IJFB 2ADBA 1AUDA 3KK3B 3I9V9 3EZUA 2BVZA 4N47A 3T1YJ 3OT9A 1G4CA 1F9EB 3OYFA 3M8PA 1KEKA 4B8AB 2SXLA 4ALZA 3BSOA 1Z05A 4NCGB 5LJVA 3CQXA 1ZZNA 4H5RA 2DNYA 2W41A 2XYGB 2K7KA 2O1PA 4PHTX 2ZBIA 5H1SQ 3P6YC 4A8OA 2A1SA 4ZVRB 2RVJA 1NU0A 3DWLA 3DU5A 3MM8B 1TFWA 4NYOA 2DNOA 3MMAA 3J81j 1XR5A 1HNVA 4MAKA 4DR2F 3I0RB 4CZMA 3QQCD 5D0EA 3D2FB 3CCJS 5IT9U 2FTRA 4QAGA 4ILHA 4CH0S 4F0MA 4J9QA 1ZA2B 2NXNA 2W40A 4XPCA 2FBVA 3GBTA 5AXLA 1GMVA 3DOKB 4UOHA 3U02A 1AUSL 1FEEA 2Y1LB 2VG7A 4F3TA 3OTCA 4LFBJ 3OYJA 3MR6A 3K5OA 2XC9A 1KOOA 3UVJA 1RBOB 4E7JA 4FZXC 4KGKA 5CZ1A 1T9WA 1C0UA 3DXMB 1EHWA 2AX1A 2KHDA 3S1TA 1DTTB 4ZOSA 3KLFA 5KFLA 5BPLA 1GK8A 3NMRA 4LSLA 2UXBK 1VSIA 1W7AA 4F0HA 4DR6J 3ZEUB 3UD4P 3G87A 1GT8A 1HBUA 4G6VB 2XQCA 3IA0A 3ZT4A 2QT7A 1W7WA 4FBUA 3GV8B 3PW7A 4HCCA 5J2QB 3MM9A 2E2PA 1VHFA 4Y0FA 4DFPA 1RTHA 4ZDNA 1IH7A 4DBQA 3ZLJA 1Z1ZA 3JAMO 1VQKS 3DM2A 4IQXA 1C0MA 1REGX 3I0SA 3R7SB 4DR5F 2ZBRA 5KQDA 2ZJQL 3LP0B 4NCGA 3QEWA 2FBTA 4RNHA 2M0GB 4L72B 3D7EO 4ZJQA 1VK8A 2OP5A 3SFUA 2F4FA 4ECWA 2WVDA 2YPYA 2XRIA 4FJNA 5ETVA 3CO0P 1PC4A 1KDNA 2AJ0A 4RNFA 2O01C 3ZZZA 2OLWA 3IGNA 5KFZA 2HF4A 3K2PA 4N56A 4DSEA 3CMES 5HRSA 4YQWA 1N32J 5D4OA 2O8EB 3ZSOA 3THVA 1ZC6A 3CETA 4QYRA 3RRKA 3HM8A 2I1RA 1B70B 3CD5A 4P6QA 2LECA 1M5HA 3FQLA 2DFFA 1XNRK 4JI0F 2ILYA 3OVSA 4TYBA 5DETA 3VAJA 1TK0A 2F9WA 1DEJA 1CQMA 4DX8H 4C8LA 3MN9A 2YNIB 1SJFA 3VESA 2NXEA 5IC6B 3OTOK 1CBKA 1GMUA 4JK9A 4C0OC 2FHMA 4K5SA 5BREA 3TA1A 4JI6K 4E98A 4AQYF 2HHHJ 2QLJB 1RT3B 1WC3A 1IVZA 4QIEA 5J2QA 5F0UA 4WE1A 3W5ZA 1AZSA 2GVDB 5IM0B 1PAUB 1RAOA 1AW0A 4X62F 4KB0A 2L08A 1RBTA 5LOQA 3BQ0A 3ZX3A 4WE1B 2GX9A 2VGMA 5KGWA 4WXOA 5LL6d 4RBUA 4CEQA 1H3DA 2YX7A 3C14B 1GEHA 1GQEA 2C3PA 3VZIA 3OL9A 1HYSA 3BGLA 3DKDA 2HHHK 3HVAA 4NYPA 4NRUA 5B0FA 5LY3A 4JOUA 4QS9A 2Q3SA 4JKGB 4C3LA 4K4WA 3O3HA 2VF3A 1JLBB 1D9DA 3O3LA 4EZ6A 2NRXA 2QW9A 1WAJA 1O8BA 2B5JB 1JLAA 1NDPA 5D4LA 2MQMA 1VQLS 2ZDPA 3JB9k 4P2SA 3M8WA 3SXLA 1XMOJ 3ZT2A 2K3IA 3VEXA 1JX4A 3IG1B 5E3RA 2GJIA 3QRQA 4R0JA 2D5RA 3FR0A 3MWBA 3L7PA 5GMDA 3GE9A 2QGFB 1HI1A 3ZC4A 2JFDA 4ILMA 1CC7A 4BC5A 1WHYA 2EG2A 1S1UA 4DLGA 3J7YI 4A2AA 4LIRA 1D5AA 5HP1A 4HTIA 1HQEB 2E5LK 3O9TA 4YDUA 4C23A 4BHQA 3NMAA 2MKHA 1LW2B 4NX9A 1NLVA 5HRRA 3MAQA 2IM2A 3KXDA 2Z2ZA 1B3TA 3FBCA 4Q43A 2XULA 2EFNA 1UEUA 2HFOA 3MECA 1T7PA 2Y1RI 1LFWA 2QA4G 1SKSA 1TL1A 4F50A 1Z6RA 3CB4A 3QAUA 3H1QA 3UIQA 3PG9A 3UW1A 4NA1A 3VR1A 1FDAA 2ZQBA 3G71N 1B0VA 5BR8K 5F9LA 1NGEA 2MQLA 3O9RA 3IXQA 2FF6A 1K8AT 3EDQB 5EHHA 2C2NA 2IJFA 3TOQA 4O3OA 2Y8WA 1S7IA 1NGJA 1JLFB 3CDEA 3GDQA 2KQ2A 3G8SA 2F4VK 4J9LA 2G8FA 2C2RA 2V4RA 4C11B 4B8CA 2GGPB 2KU7A 1N5VA 4CH7A 2GQQA 3NG8A 2HMIB 2IYGA 2HFVA 4GY2B 1YF5L 3QATA 1R27B 1NGBA 3MD3A 2VG5B 1RI7A 3VHQA 3ZTPA 4CW7B 1HNIA 5CYMA 2E5HA 4ECUA 1YXQA 3KLHB 3CPWM 1VLOA 2FGOA 3GIJA 2DHAA 3I9ZA 2F40A 3SUPA 3IMQJ 2E5JA 3VVUA 2MQNA 2J9DA 1Q7LB 1TV6A 4KO0B 4P71A 1LAVA 2MKCA 2W01A 3TR8A 1NK4A 1ZBUA 4CJTA 1HR0K 1UVJA 1WHVA 4B9MA 3ZX0A 1RAAB 3D54A 1OPZA 4C8OA 1S1UB 4JV5K 3ETOA 1EZZB 2J9DE 4XH4A 1YJ9S 3OTDA 3GSDA 1X0PA 1OH8A 2FF3B 2W2QP 3VQTA 5M1QA 2D3OR 3DOLA 2V67A 4Y2KA 1HWIA 4FWMA 4YOUA 3BZQA 2PE8A 3PHTA 3IFEA 1UPPA 1WSHA 3TAMA 1YK9A 3DLEB 2QRRA 2QYCA 2P9KB 2PYJA 3ZZ0A 3T9ZA 4DS5A 3CHWA 4XIUA 5I42B 1T94A 1YHQS 1K1SA 4BREA 3QRRA 5EX3A 2C2KB 1NGHA 1WSJA 3U1MA 1HR0J 4IFEA 1IG8A 2QWNA 1SBRA 3C6HA 3IKMA 3ZT1A 5KFKA 4DTRA 2MSSA 5BR8F 3PCOB 1CLQA 4UF4A 3CD7A 4Q45A 1XWLA 4LF7K 1QTNB 2G13A 3VQDA 4PQAA 1YBTA 3GP9A 2CKWA 1XI1A 2HVEA 1LK7A 1Y4ZB 3PRBA 4GRSA 1N48A 2Y0BB 4KJIA 7FD1A 4TU9A 4OJ1A 2JX2A 1VSEA 4Z0UA 4WK3A 3SV3A 1RK8A 3K5PA 4FLWA 4DZDA 2IS3A 2E5LF 2OZMA 3JSRA 3O3GA 1FVSA 3LA0A 5KT7A 3CVKA 2XY5A 4CJ7A 2B6AA 3WIVA 4M3WA 4LREA 3ATVA 2U2FA 2GQ2A 1RT7A 3UWTA 4IO9L 3GMGA 1SAZA 2R42A 5T7LA 3PYDA 4F02A 1G15A 1T9UA 4ECTA 4QBUA 2I38A 2B6AB 3F41A 4HHUA 1QUPA 1YTAA 4PL8A 3LW5C 2IDOA 3POTB 2CWKA 4ISGA 3KG4A 3NRBA 7AT1B 4DQRA 4NLBA 2CQ0A 5KQ8A 3N6MA 1R8BA 3JSMA 4G3IA 5A8WB 3EE8A 5DG7A 5AE3A 2RHQB 5HI7A 2HHSA 1I3OB 1I51B 1RTJB 4ANCA 2WVBA 2HBJA 3JSMB 2YPZA 2YKNA 4CGIA 4IJAA 2HVHA 3CYMA 1WF2A 3KUEA 5KFCA 4CZKA 3A8JA 4CEOA 3D1HA 3TZYA 2HHUA 4ZVGA 2ZNYA 3MAAA 1R89A 3C94A 4JS4A 3N0VA 1Q95G 4IOAL 4Z4HA 1U02A 2FLPA 3KK2B 4GKKF 2BX6A 3I0SB 4OJGA 2K1RB 4A8YA 2MKKA 5KG7A 3W1YC 3FVYA 2O8FB 1Q9XA 3IM9A 1U24A 5I3UB 1QVGR 3BH6B 4J9NA 1RTDA 1HKCA 4FL9A 4CYUA 4BC7A 4BDYA 5FJ4A 1KVJA 4LF6J 2HVZA 3UDVA 1D0EA 2POKA 1TL7A 5B09A 2V94A 4DR3K 1MA9B 4LFCJ 4XH1A 4I69A 2OUGA 3HJVA 3GIRA 1RHUB 4BRPA 1RLDA 2QFIA 3NOCA 2DFHA 4GVMA 2RILA 1QHAA 2W7OA 3U3YA 1VIOA 3C15A 4AHUA 4PG8A 1FXDA 4Q44A 2DHSA 4TXSA 3ZYYX 4NLYA 1CSJA 1PYOB 1IR0A 2J0WA 5DG8A 4TY8B 1ZAVA 3AOBA 4HTLA 3EO3A 3DLBA 3VEYA 1K0VA 4ATNA 2VH7A 5JMNA 3VEWA 3PYFA 4F4AA 3MCNA 1NSKL 1WC4A 3HPHA 4M42A 3CQ8A 3OHAA 3JXOA 2FJVA 4HL9A 4KR0B 2NZ4A 2CADA 2BBEA 1ZM3A 2NXJA 2YHAA 1YRXA 1KVIA 1M0SA 2P8IA 2AYMA 5LMNF 3HHLB 3SLCA 4F9OA 1YJWN 1FJGK 4BC2A 4BC9A 1N88A 2OFGX 1RT6A 3FEYB 3K8WA 4ANEA 2RN2A 5SUHA 6FDRA 4DMNA 3LAKA 2CPXA 1FJ7A 2YWGA 5K8OA 2MZSA 5HO4A 3R5DA 3FUYA 2W4DA 3GJRB 2IYIA 1RWOB 3IC1A 1ACMB 3M6UA 2OPPB 1U7LA 3KK7A 4FBTA 1YJNS 3VGTA 1FD8A 4N8OA 2RKIB 3CCUN 1YBUA 3R7BB 5KG5A 1FXLA 4DV0K 3CO9A 4JI8J 3HZEA 2EFPA 5E3AA 4W4MA 4ZPCA 2BJEA 1TR0A 2UUAJ 4DV3K 3VGMA 4JI5K 1VHXA 4RWXA 3D9BA 3NCPA 1HQ2A 4R79A 2RMLA 3M6XA 4FNHA 3BUZB 1N5TA 3MFHA 4IEEA 2O4IA 4PPZA 5HANA 1W2IA 4BCAA 4L76A 2XMAA 3QMQA 1JLAB 2P2CB 2OTJS 3HCXA 4DPOA 3UKUA 4DV2F 2CZVC 3IG1A 3R3TA 2M4MA 3J81U 3LANA 4PRFA 5DS7A 1VC5A 4JHDB 3D28A 3BSNA 2JLFA 3HFKA 4RBTA 4PG6A 4JV0A 3HZ6A 1DURA 2N4DA 1KD1O 4M5KA 3MEDB 3SAFA 1BU6O 4JI5J 2ZD1A 4P7VA 1U1PA 3LDLA 2A6AA 1VSLA 2IBKA 2G0CA 3NFAA 4IWVA 2KM8C 3HHLA 1G6BA 4OHYA 3HX9A 2D7SA 3WNEA 2QX0A 3DFEA 4IO8A 4X65F 2VWBA 3BBCA 2FVPA 4KHYA 1WEYA 4XPEA 5IV3A 4M5JA 3PY8A 3THTA 4A8MP 3F9MA 3TAFA 1Q8BA 2Q0RA 3UD3P 2PN6A 1S6PA 1S1TB 1BQNB 3NVMA 3SCLE 1RT3A 4MK9A 4EWTA 5CD4A 4NI2A 2NXCA 2V2QA 1GXUA 2DNHA 5F8IA 1UEVA 4M95A 1HW9A 1K44A 1XBWA 2EI5A 2VJVA 2D3O1 1RZMA 4DTPA 3NGIA 3QIPA 4NL5A 3CNQP 5K5MA 2XM3A 2VPZB 3CCQN 4JI7F 1BUPA 2J4RA 5AXMA 1DAXA 1OKJA 3THWA 2FLOA 4OGCA 1VS3A 3OYNA 4CF9A 1BQXA 3C6AA 2EPIA 3OD2A 5C0YA 3LH2S 4DV4J 4X66K 5C2GA 2FJXA 3ENWA 4CHPA 2PDAA 4PG5A 4DHVA 4FLTA 4V1Ak 4X64J 5DM6L 4QU7A 3CCLN 1OSDA 1TTHB 1FRJA 1PILA 3CCEN 4KFBA 3QIPB 1SJQA 3KJVA 2UU9J 5D3GA 3CMQA 1RTJA 3MPVA 5CA5A 1NMNA 4LF5K 4CLTA 3V9WA 2VU5A 4IFYA 1KR4A 2B3TB 2DYAA 3PFOA 2FSKA 2DJWA 4A5BA 3TAPA 5KT3A 3C6TB 2H5IB 4OZJA 3VWSA 3FSIA 1P27B 4LF9J 4MKYA 1KKHA 1VSFA 3KLFB 2QC3A 3OR1A 3THYB 5JLFA 3JTOA 1CZBA 3QERA 2OPQB 2MHEA 3MEGB 3VETA 3FSXA 3WQTA 1YI2N 3UN5A 2GIFA 2G2OA 2P5GA 4UUWA 2MJUA 3AVJA 2VG7B 3KZBA 4OPAA 4HLBA 1U1RA 1TKXB 1F6TA 1HX1A 4ZP8A 1WSVA 4V19J 5J1EB 4BE1A 2JNJA 1IBKK 2FQQB 3VAIA 3TRGA 2AX0A 4ECZA 4DTXA 1U2RA 2QTWA 3ZZOA 1Y5IB 9ATCB 1IBKJ 4CLUA 2H48B 4GV3A 1X4HA 1UW9A 1QJHA 3DLKA 2VKZG 4JLHA 1Q8KA 3P38A 1YVNA 1KVKA 1QY7A 2KXHA 1C1BB 2X1GA 1EQYA 4TN2A 1IBMJ 3OY9A 2F63A 3WXMB 4IZ9A 3TX8A 1SUQA 3HHDA 5KT4A 5B0AA 3NF6A 1NSAA 4LBHA 5L9XA 3CEDA 3SEOA 1YSJA 1VRTB 1FXRA 3M2UA 3VA0A 1RFQA 3UB5A 3FCHA 3E2EA 3RTVA 3BGFA 2HFNA 1RT5B 4CIGA 3KYLA 2L3MA 3ET6B 1K8AO 3BYRA 3T1HK 2PMHA 3P4UB 3ENQA 3FDSA 1CS4A 5HAOA 4UY8O 1I5OB 3I32A 3RUBL 5JVGL 1FKOB 3KDOA 3LP1B 3I82A 5CZ2A 3WIUA 3C6TA 4ZP6A 2E9RX 1VBXA 3W65A 1X31C 3Q8YA 2YHXA 3QZ7A 4TNOA 4I67A 2G8WA 4GVBA 1IBLF 1KSPA 3QT6A 5KFIA 1P9YA 2EFVA 4ECYA 5A8WA 1N52B 4DR7F 4XTTA 2V7ZA 2UXDF 4CF0A 5AR0A 3U27A 3M1VB 1C0FA 1N54B 1C2PA 3MM5B 3ETMA 2ASYA 4JI3K 4ED1A 3UN3A 1H98A 3FRYA 1R0AB 3LP0A 3TP2A 1FWPA 5E0OA 2B56A 2ZGYA 4ER8A 2UXCK 3CC7N 5BN8A 2MLXA 2XS5A 3KMSA 4I7FB 4FWQA 2ZDOA 3PYGA 4LFAK 2UUWA 1G2EA 3KD1E 2OA8A 1UWAA 3GYGA 2ZC3A 3GYXB 3NHGA 2E1YA 4F8RA 1KRPA 4X2BA 4OYPA 1V6HA 2FIUA 3WXJA 1ULRA 2PAVA 2KHCA 3M2VA 3IN5A 2KJVA 3B78A 1SV5B 2NXUA 1VQ9N 2XMUA 4FF2A 1VC6A 4B3MJ 1UA1A 5BXIA 1OSCA 2NUBA 3T1HF 2LEPA 1VRTA 3D6HB 1ZBSA 5J1PA 2UVWA 3WC0A 3MI7X 4O3QA 3VALA 2HWTA 3C8YA 4DZ6A 4FWPA 2C28A 1UL3A 2YX4A 1VQ4N 4USJC 5B0BA 3IMXA 5JLHA 5FIIA 5L38A 2PBDA 3SNNA 1S9FA 4LSZB 4NLRA 1HJOA 1JMTA 4RO0A 1XR6A 1EO1A 5HP1B 3HXMA 3FEZA 4AD6A 3O6WA 3OVAA 5B0EA 3T3FA 2V51B 3H0PA 5HATA 3F73A 4B3MK 3LQVA 1PBUA 2HQ3A 5ETMA 2UZAA 4NLWA 2NUHA 3MEKA 4HR2A 4JNEA 3UFCX 1BOTO 2Z1GA 2J9EA 4QYZJ 2K8GA 2UUCJ 2CUYA 1D8ZA 2HS3A 3M1VA 3U9DA 4C7QA 2GS8A 3J7Z5 1IJJA 3SQ1A 1NMEB 4H0YB 2HQFA 3MWPA 2R9LA 5K8NA 1DQ9A 3ILOA 2ETJA 3CMAN 5MLCQ 2HRYA 4M63A 1BHNA 4PKGA 4YDDB 2XZDB 3SSQA 4Q0BB 2WHOA 1VRUB 3ONQA 4ILJA 3NF8A 5AQSA 2ASOA 3FZFA 1X5PA 4HT7A 5CQGA 2PFUA 1EARA 4TU8A 4BGAA 3PHEA 1TP7A 2ZVIA 5IT0A 1NSQA 3TANA 5JICA 4U95A 7FDRA 5E5NA 3L4QA 1OY9A 4MDBA 3UR3C 1QSSA 3NBPB 4OYOA 3ZSWA 1Q81T 3PZPA 4WCEL 2VDHA 4ZLJA 1XTZA 5KRSA 4OYBA 3TPQA 4TQRA 1O51A 3MD1A 1DLOA 3HHLD 3P45B 1S6UA 2YNHA 4PWWA 2F96A 2C2DA 1N0VC 2KH9A 1KOHA 4XDCA 3OL8A 4OI4A 3QZ8A 4IFVA 2OSQA 4QPXA 4Y2MA 4DR4J 1QQOA 4NXMJ 4LFBK 1FX2A 3OYMA 4A8QA 4KFBB 3G96A 1PKUA 3BV8A 5L8RC 4LF4F 4DR1K 1RAEB 2KM8B 5KFQA 3BGUA 2KT5A 3R6MA 2AEMA 4X4PA 3OYBA 1HNXK 2I7PA 3PR5B 3R5GA 3M8PB 2IRYA 5E33A 4ZP7A 4C8YA 1CJKB 2OTLS 2GV9A 3EGWB 3QYYA 3HVTA 5D0GA 4CWBA 2OIHA 1S4EA 3G82A 2XSJB 4DF4A 1ZBFA 4I1TA 3FGUA 3AVIA 3OLBA 2ITGA 3IS9B 5ETKA 5JXSA 4NOHA 3BYPA 1U1LA 3DLGA 3DOMB 2QLBB 3LDSA 1IXKA 2VQFJ 1GXTA 2RUSA 2GGPA 1RWVB 1LCUA 4QW8A 4P74A 1SIZA 2I2YA 4DQSA 3W5YA 1CJTA 4RUCA 3QPIA 4CEEA 3LP1A 2KYZA 3KDNA 2VKRA 4JBCA 4UUXA 5AQQA 2VC0A 3PFEA 1EQ0A 2R7SA 5E41A 1ZBTA 4DL2A 3FZBA 1DLOB 2HBZB 2VIHA 4JD2B 5KFMA 4KV8B 3SQGB 1NGAA 1LOUA 4CJ4A 1X8DA 4IFVB 1NGCA 4JI1K 1L3KA 5HQMA 1KTQA 4CIFA 1WB9A 4ZK7M 2DNNA 3CFRA 2OPSA 1KCFA 3OQ2A 4ZVOB 3CCMS 1KQSR 1U8SA 3HL8A 4PR6A 5IQ6A 2OMLA 5HVFA 1V3ZA 2AV5A 1VGYA 4NZ7A 3SJJA 3MK6A 2QLWA 2VPXB 2KG0A 2VC1A 1D1UA 5IWAF 4I9QA 3HDSA 3UNYA 2JOQA 4Q5VA 1YITS 3CJRA 4ZTFA 3MEEB 2DXEA 2YVSA 4WJBA 4KRFA 4B3OB 3QGPA 4DUYF 3TSPA 3T69A 3HTVA 4PQUB 1HRHA 4YR2A 1TL5A 3TU5A 4NA3A 4B3RJ 5KTQA 5AQVA 4FLXA 2ZHAA 2QWOA 2DHGA 3WNFA 1VMBA 3NL0A 4GNIA 2YKAA 3DDNA 1LWCA 2O8EA 1BCMA 2ZKTA 4ZTJA 3ZTQA 3C7NA 3WQPA 3ZETA 4CZFA 3DXKB 5ADXA 3R5CA 4ID5B 3P49B 1U48A 4F4ZA 2FHJD 1ZYQA 3HKZD 2X3GA 1M5KC 3A3PB 4GO7X 1RAIB 1RYSA 3AD7C 1TK5A 2J8AA 1S6OA 4FF3A 3C16B 1RADB 4EHUA 5IT9Y 3AAQA 1H7XA 5E7OB 4DF8A 3TYTA 3QNWB 4ECSA 2O8FA 4CJ3A 1EKSA 2GTDA 4F67A 2MY8A 4Z37A 3EZ5A 4A2BA 4ISFA 2XMMA 2VUGA 1BDGA 4URSA 2F8SA 3G0ZA 1B0TA 1QAIA 5KFXA 3ILJA 6AT1B 1I94F 4X4NA 3RU0A 2FJEB 2K1RA 1U6ZA 2RDJA 2R8GA 4ZCMA 4KH0B 4CCHA 1BIZA 1DQ8A 4H5NA 2XLJA 4XEIA 1RQ0A 2ZOGA 1D8YA 1JNZB 1QVFM 2IOCA 3DYAB 3TABA 2FVRA 4HHHA 3GB0A 2PO4A 2WBNA 3THXB 2CGLA 1J54A 4JKBA 1GOBA 5KG1A 3ZSZA 4FN5A 4LF2A 4PKIA 2WK4A 1VQ7N 4ZLPA 4XH5A 2HOEA 4DR1J 2W9CA 2A6OA 4CGFA 3J80U 1WSGA 2PGCA 2W42A 3ITHA 4AHSA 3JQKA 3H20A 5AQXA 1AT1B 5GMKa 4DX7A 4NXNF 1XHZA 2VWKA 2DH9A 4DL5A 1S10A 1LOTB 4YDXA 4USUA 2H3GX 4ZA1A 3D68A 5EU7A 3I55N 1WOOA 4HVJA 3AVAA 3QWUA 2OEKA 4B3RF 4H5TA 4YS2A 1J6ZA 1C1CB 2W7AA 3L3UA 4IRKA 1K8KA 2UV8A 4F4KA 5A6PA 5IWAJ 1M90O 2JDJA 3J81O 4YP3A 4CJVA 3QBXA 2JHEA 3WHIA 1CPZA 4W5OA 1QHTA 1S0VA 3ELHA 3SAHA 2BGGA 1FNMA 4WFZA 3AVGA 3OS0A 5IXUA 4FYVB 4IOAQ 2IDEA 2UUBF 1G3OA 3TVKA 3AQOA 3CD0A 4CK2A 4F25A 3OXFA 1FDDA 1NJIT 2NZTA 4KC5A 1B7YB 4DLEA 4RW4B 3H8YA 2BKPA 1I39A 3I33A 1QLNA 2CPDA 4QS7A 4U8VA 2FDNA 2ZM6J 1VQSA 4YHHJ 3G25A 3MX2A 3VTIA 4C3MA 4Y1CA 3L09A 1R8AA 2O8DA 3NGKA 4BQLA 4FDFA 4HUEA 1OVQA 2R7YA 1EAYC 1NWKA 1FRMA 1WF1A 4W90B 4DU8A 4B1WB 4GV9A 3ZTRA 3MTJA 2YJFA 1YBAA 4RR5A 3PJ9A 3IFRA 1O5JA 1BQMA 3BEGB 4LT6A 1YDLA 2V8GA 1J9AA 3UN2A 3TI0A 2F9JA 2FXUA 2VQFF 4BRMA 2DGTA 2VL1A 3H2LA 2VB6A 1YVFA 4AF1A 1J5OA 2RSQA 1RAJA 3CJBA 4KO0A 5HSPA 3S8SA 4WQ4C 4KHPK 2YH0A 5HJYA 1S1WB 2ZD1B 1JWWA 3OA9A 2OPRA 3CCZA 2BW2A 2VZ9A 1RT1B 3WNHA 4B1VA 1VQPN 3MMBB 4CEBA 1TAUA 1JLEA 3S01A 4UQTA 3O4QA 1CQNA 2VYPA 5IT4A 3UCUP 1N8RT 1IKYB 1I6JA 3OS2A 2OD4A 1ZBHA 3Q23A 1U2CA 1IO2A 3AO2A 4M63C 2EK1A 2OAUA 3SAGA 2UUAK 4B3TK 1FE0A 1MW7A 2ITMA 1VBKA 4IFYB 2B4JA 1GMWA 1XNQK 4ECQA 4JI4J 3PUFA 5E84A 4QR1A 4NXMF 1OH7A 1SC4B 2IIHA 4CQ1A 3RB6A 2MZTA 5JS2A 3ULEA 5K8PA 4DR4F 3GV5B 2YJEA 3I5CA 4L73A 3HP9A 1TUGB 3N6LA 1RBAA 1NH8A 4LR9A 3IWXA 1LFPA 4NYFA 3JQJA 2MQOA 4CK1A 2W8KA 1CC8A 2Y0SD 4K4UA 5DM6Q 2FJDB 3VGUA 3MN5A 4IDKB 4O0JA 2IBOA 2QE5A 1OH6A 3DI6A 3FSYA 3EXCX 1UVLA 2OPPA 1GLEG 4LF4K 1IWGA 3TJAA 1GLAG 4RW8B 2QFJA 3MPWA 5FD1A 3IR5B 1U8WA 4OZ3A 4FOEA 1WG1A 4X4TA 5L39A 4IO9Q 1B92A 4CHOA 1RT4B 5ELZA 2XNRA 4WKRA 2NLWA 3N9UC 2R3VA 1IQZA 3VAMA 1TELA 2EEYA 3B4DA 4FW2A 3BKTA 3SI6A 1JNRB 1HHQA 1RWPB 1RTIB 4PQUA 2PMWA 4CNYA 1KWMA 4QWBA 4KTZA 2C3MA 5T7LB 4L6V3 3VGSA 2N7YA 4KQZA 4LF6K 1QE1A 2WVEA 4JKGA 3MCOA 2RQCA 4DV7F 2VICA 1IWAA 3K8VA 3TUIC 4IG0B 1U1NA 2LU1A 2JVOA 1JB0C 3UNGC 4JI2F 5DDRC 4NEYA 1F5AA 3IBFB 1S1VA 1RTIA 3Q7BA 1VAZA 1LW0A 4IR1A 2UUCF 5GAGI 2HVIA 2OEJA 3US5A