4G1QA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with rilpivirine (tmc278, edurant), a non-nucleoside rt-inhibiting drug
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Snapshot of the equilibrium dynamics of a drug bound to HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/inhibitor
total genus 157
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4g1qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4g1qA05
3NH0A 1KTQA 4WZQA 4E7IA 4URGA 3KK1A 4TXSA 3NAHA 3HO1A 1YTUA 1RT4A 4IOBA 4M3XA 4CJTA 4ECWA 4FJLA 4FJ8A 2JEFA 1N5YA 4DL2A 4E19A 3DOKB 1VSEA 4ELVA 1TL3B 1FKOB 1SH2A 4CEDA 1HYZA 4M3RA 1BHLA 4MK7A 1TKXA 1A5VA 4EBEA 4KSEB 3H4DA 4E0DA 1NK9A 2QKKA 3AVCA 4TYAA 2FLLA 4C8LA 2R2SA 1ITGA 4CGHA 1C0TB 3KLEB 4CF8A 4DSKA 1VSIA 3FFIA 2ILYA 3VN5A 4E7HA 4LSLB 1WSIA 4Q0BB 1VSKA 3QIPB 3IRXB 1N6QA 4WFXA 2W9AA 3DYAA 1NKBA 1JLBA 3I5AA 2G8WA 4IKAA 3TWHA 2YNHB 2G8IA 3OHBA 1U47A 4CJEA 2XGPA 3U3GA 2A1SA 4ED8A 3HJFA 3LP2A 3L8BA 3SPYA 1WSHA 3OL7A 3H98A 4DTMA 1RBSA 5L1IA 3NKYA 4JS5A 3EPGA 1JL2A 3CJ5A 4Q8EA 3RB3A 3LPUA 1WSGA 4O55A 1ZBLA 4EO8A 1S0MA 3DLKB 1JLAB 3ICLA 4ZP6A 1XR7A 4MFBA 2XRIA 1UA0A 2W42A 1NKEA 3ITHB 4WE1B 5KGWA 3HPHA 1SV5A 1SL0A 1U45A 3MEEA 4NCGB 2R8KA 4O3PA 4ZTJA 3L2WA 3KLFA 1FK9A 1QAJA 2XY6A 3HVWA 1KHVA 2JEJA 4CECA 2OH2A 1IM4A 3KK1B 4YFUA 2X6SA 2DFEA 1TV6B 3KTQA 1RT4B 5F9NA 1C0MA 4AHCA 3KOAA 5KG1A 3L3UA 2G8HA 3S9HA 3OLBA 2RKIA 2AU0A 4KB1A 4CK1A 2KFNA 4CEBA 5HRNA 4CGIA 3EPIA 4IR9A 4XPEA 1TKXB 4C8KA 2PYJA 1I3AA 1A5WA 5SZTA 3NGYA 4DTUA 4DMNA 1LAVA 4M94A 5J2PA 3VQSA 1B9FA 3KMSA 3FFIB 4KHUA 3AVBA 1XR6A 4EBCA 3F9KA 3VQPA 4X2BA 1TK8A 1N6QB 4URSA 5FDLA 3DYAB 2Z1GA 1JLBB 3UQSA 2XCAA 2BANB 2E9ZA 3QETA 3IAYA 4RG8A 4FK4A 3SUPA 4DTXA 1VRTA 3LDSA 3LP2B 3UR0A 2WTFA 2HHSA 3HM9A 1SL2A 3VQAA 1BGXT 3OYGA 4F8RA 4ZPBA 5KT3A 4J9SA 5DMRA 3T5KA 4HCBA 3L2VA 1RBUA 1FKPA 3PZPA 1HNIB 4FLTA 3C6UB 3DOLB 4MFBB 4BDPA 1BIUA 5DGAA 3D0PA 4ECVA 3OYKA 4FBTA 4O44A 3SYZA 3O4NA 1SV5B 4F4ZA 3NF7A 5HLFA 4CJKA 3MEEB 1C1CA 4OPKA 4CIFA 2D0BA 3OYAA 4O4GA 4DTPA 4CF0A 4ICLA 3K57A 2D7SA 3KLFB 1FK9B 4WYLA 3QEVA 3NGDA 1CZ9A 3RR8A 1EP4B 1J54A 4HUEA 3K58A 2WONA 3QIDA 4MK8A 4PUOA 5EWEA 4NLUA 4CIGA 2HHWA 4Z4FA 2HWIA 3ZCMA 5CZ1A 4KHYA 2RKIB 3NCIA 1RTJA 4Q43A 1XR5A 1REVB 3NGZA 4OPJA 3H2LA 4BWMA 4KBIA 3HVTA 4B9NA 5J2PB 5KI6A 4CFDA 4F50A 1NK6A 2FVQA 4B9UA 1KCFA 4Z4HA 3WNGA 3QERA 1J53A 2OPPA 4TQSA 5K14A 2BRKA 5FDLB 3V6DB 1TK0A 3M8RA 2FLPA 4YMEA 1S1VA 3O4QA 1K1QA 4AHSA 3L2UA 4J9KA 1QAIA 4GC7A 3KLGB 4ZMMA 1SH0A 5KFAA 2C2EA 2IM2A 3PW7A 3M9NB 3CFPA 2JEIA 2HHQA 2VA2A 3IGVA 1KVCA 3V9ZA 2WHOA 4CEZA 1FKPB 4NLWA 4FLZA 3Q8QB 2EHGA 2YKNA 5KFVA 3IG1A 1Z26A 3OSPA 3SV3A 4PY5A 3AO1A 4O44B 3KNAA 1JLEB 5HLFB 3VQBA 4DTSA 4J9PA 4EP5A 2IMWP 3AVMA 4FW1A 1S0OA 2WRMA 3M8SA 3SFUA 5EDWA 3E01A 4ICLB 1HARA 4KV8A 4EZ9A 2HW3A 4DWIA 1S1WA 5C24A 1VSLA 1WNSA 4RW7A 3GV8B 1S1UA 3H59A 4J9MA 2WONB 2R8JA 1D5AA 4TQRA 3GV7B 4ZP7A 1WNEA 3TANA 3MXJA 1HRHA 3MF5A 3L2QA 4FM1A 5EWFA 3FQKA 2YKMA 3OJSA 1RT2A 2Y1JA 1RTJB 1JLGA 3OL9A 3T1AA 4HVJA 1N48A 4O5BA 3BQ2A 5KT7A 1TAQA 5HROA 5DGBA 5CYMB 4H4MA 3HVTB 3VQ8A 2XHBA 4IFVA 4TY8A 3UDLA 3ZSQA 2JC1A 2OPPB 2B5JB 4K4UA 3ZT1A 5K14B 2XO7A 4HUFA 1TKTA 3P5JA 1ZETA 3SPZA 1YTAA 5HP1B 4QWBA 5DLGA 4J9QA 2VA3A 3V6KA 1S1VB 2B6AA 5KG4A 4OKKA 3RAQA 4CIEA 3O3FA 3TARA 4BE1A 4O3NA 1ZYQA 2JGUA 3BREA 3LWLA 3QLHA 4DU4A 4LSNA 5C25B 2AWZA 2XI3A 1EXQA 1U4BA 2QV6A 3QGGA 1L5UA 3TQ1A 2ATLA 4O3RA 4CF1A 4GC6A 4W5TA 4IFYA 3EZUA 3MFIA 3OS0A 5F8LA 3OY9A 4F4YA 3IG1B 3M9MB 1RILA 4DFJA 1Y97A 3NAEA 3HYFA 4DQQA 2OPSA 3B6PA 3DOKA 2HHXA 3GIIA 5J1EB 1TL3A 1FKOA 4C8MA 1SKWA 3E01B 4I9QA 5F8MA 4BACA 3LP3A 3WNEA 3AO2A 3NF6A 1S1WB 2G8UA 3PW5A 4KHRA 2IS3A 4RW7B 5KG3A 2UUWA 3CFRA 1S1UB 3AVGA 4Y3CA 1X9MA 3UIQA 4CERA 1S10A 1HQUA 4LSLA 4CJUA 3QIPA 3IRXA 3KKSA 2HNZA 3LANA 4AHUA 4WFYA 5C5JA 4FJXA 3T5JA 4ZVFA 2WB4A 3EYZA 1RDBA 5HROB 4DQRA 2KFZA 3OVNA 1BCOA 3RMCA 1RDDA 3LWMA 4ID1A 3RMDA 4IFVB 1I6JA 4TY8B 2ZE2A 2IM3A 2A1RA 4NLPA 3QEPA 3TR8A 1BISA 4OJRA 4ZHRB 1TKTB 5KFQA 2HB5A 1NHVA 1HNVA 1D9FA 5KFWA 1D8YA 4DLGA 1T05A 3DLKA 1RA6A 4YR2A 4WZMA 4KB0A 4GW6A 3CYMA 3QGHA 5HBMA 3L2RA 3QLHB 4LSNB 4M3WA 4NLSA 3AV9A 3MEDB 3NHGA 3VQCA 1W25A 4DSFA 4EP4A 1ZBUA 1JXBA 5J2QA 1BQNA 5J2MA 3KK3B 5FRMA 1TVRB 3CIZA 1QTMA 2JC0A 3U3YA 4N47A 4NLVA 4IFYB 4R0EA 2O5DA 3MAQA 2CJQA 1UAXA 1TV6A 3CJ0A 2WCXA 2RDJA 4B8AB 3K2PA 5KFGA 3ISND 4H8KA 2OPSB 3KD5E 2R8GA 2ITGA 5KFXA 3NAIA 2GV9A 3NH2A 3V9UA 2HNDB 2AGOA 4CJQA 5KFNA 3BDPA 5EWGA 1QSSA 4M42A 2VG6A 1X9SA 2DPJA 4OKEA 4ED2A 4NLXA 4KTZA 4LQ3A 5KFJA 4G3IA 3PX0A 1W0HA 1WLJA 3DRRA 4RNOA 1IO2A 3N6MA 3ZSRA 3NH1A 3DRPB 2DY4A 1HQUB 1TGOA 1FXXA 3PX4A 2HNZB 4E1NA 2ALZA 2E6MA 1VSJA 3VQDA 4HCCA 4ECSA 5JXSA 4NLGA 2BANA 2UVVA 1RT6A 4CHYA 1TKZB 1L3UA 3D5MA 4YP3A 2ZE2B 3TAGA 2BRLA 5L1JA 2FVCA 4LH5A 4ECUA 3MR5A 4I9LA 4E7LA 1RDRA 2ASDA 5KGXA 1R0AA 2WK4A 4CEQA 5HRSA 5KTQA 3EZ5A 5KG7A 1IKWA 3OYJA 4CGDA 2W8KA 1HNVB 4CJ5A 4IG3A 3KMQA 2RN2A 1T05B 1HNIA 4Q5VA 3C6UA 5KFFA 3DOLA 5KFCA 3MR3A 4J9LA 5KFEA 2AGQA 3QINA 4FM2A 5HBMB 3N6NA 1K1SA 4Q44A 3BSOA 4DSLA 1GX6A 3WNFA 3RB4A 2E9TA 5T14A 3T5HA 2J6SA 3BR9A 5J2QB 5I3UA 1BQNB 5J2MB 3SUOA 3SCXA 4B9LA 5KT6A 4DQIA 2ASJA 4NYZA 4K4ZA 5I42A 3SJJA 4AHRA 5DQHA 1EP4A 4CF9A 3V1QA 3M8QA 4CJ4A 1SKRA 1ASVA 4ZP9A 3PR4A 1TK5A 3LP1A 4QWEA 4Q45A 2G8VA 1LWEA 3LALA 1Q9XA 5F8IA 1REVA 2HWHA 3MXMA 4ELTA 5DG9A 4CJVA 4YR0A 4NCAA 2VG6B 2V0NA 2HVIA 1U49A 3V6JA 3K5OA 3NE6A 3V81A 3DRRB 4HHTA 4KTWA 4BE2A 3AA5X 2V9WA 1JLQA 2HHUA 3RRGA 1D0EA 4B9VA 4NRTA 1Q9YA 4KHNA 3E51A 4E7JA 5KFLA 4FJIA 3FSIA 1Z4UA 2J6UA 4FJ5A 5DK5A 2DFFA 2FLNA 4NYFA 3V6DA 1RT6B 4CEEA 4AILC 1GOCA 2ASLA 1RT1A 1RYRA 4FJ7A 3KLIA 3RBDA 2IBKA 4FW2A 3RAXA 4M45A 4DTRA 3DM2A 1GOBA 3O3HA 2KZMA 4FLXA 3OYCA 4IRCA 1NK0A 4KFBA 3KLVA 4OLBA 4DS4A 4W5NA 3KLGA 3VQ4A 3KHHA 1WSEA 3RR7A 5F8JA 5KFKA 3G6VA 1R0AB 3OYEA 2BE2A 1IKWB 4QAGA 5KFRA 4DF4A 3IGNA 3MEGA 4IG3B 3AVAA 4W5RA 2FBXA 1S5JA 4JRPA 3QEIA 3UPFA 1J5OA 4DU1A 4CHOA 3QNNA 2EX3A 4KREA 3SI6A 4RZRA 4ZPCA 1VRUA 4Z4EA 1UWBB 4ECTA 1T03A 1JLEA 2UUTA 1HQEA 4OVLA 3TAMA 5KFOA 1ASUA 3BSAA 5I3UB 3U6FA 3MTKA 4F3TA 5DG8A 5I42B 3QNOA 4K4WA 2IGIA 2R8HA 3RWUA 4DTNA 5KFMA 2KQ2A 4F3OA 1QS4A 3M8QB 3VA3A 1NNDA 1RTIA 2RF2B 4CFCA 1BCMA 3CM6A 1KFSA 3SUQA 3LP1B 4FLWA 3Q8PB 1KLMB 1LWEB 3MXIA 4MIAA 4YR3A 4LQ9A 3GV5B 2R7YA 3NF9A 1N4LA 3AVHA 3QZ8A 3V81B 4OKJA 5CYMA 4EO6A 3G86A 4DFKA 4KAIA 1JLQB 3DLBA 3K5LA 3LAMA 4LD0A 2B5JA 3ZSOA 3M9OB 1L3TA 4NCBA 3SQ2A 3QEXA 2D0CA 4JV1A 4ZVEA 5HP1A 3CDUA 1VSMA 1WN7A 4ED1A 4TSXA 1RT1B 3KLIB 4KI4A 3DM2B 1NJXA 1QHTA 4DFPA 3RBEA 2FVSA 4KFBB 2IJFA 3DLGB 5C25A 1RDAA 3SNNA 5DLFA 3V9XA 2BE2B 3ZSXA 1VSDA 4QWAA 1IG9A 4U7CA 2D3UA 3MEGB 2W9BA 2D0AA 4G1QB 4FS2A 2AJQA 4DU3A 3IS9A 1J5OB 3D28A 4W5QA 2FC0A 4XO0A 4Y1CA 1VRUB 4RNMA 2VG5A 2GIQA 3VQ7A 2E9RX 4FJ9A 3VQQA 1T03B 1RT3A 1HQEB 3TAMB 4DFMA 1QSYA 3S3MA 3H5SA 5J1EA 3C95A 4M3UA 2FVPA 3FRZA 1GX5A 3MR6A 1S0NA 3OYIA 4IH7A 4ZVGA 4RW8A 3PJXA 4FVMA 3OL6A 1F21A 2B4JA 1YVUA 3Q8RB 4B9MA 1RTIB 3DLRA 4CK3A 4DSIA 3HSTB 1T3NA 5KFSA 2ATQA 4RW9A 1OS5A 2QXFA 4KO0A 2PYLA 3ALYA 5JS1A 4R8UA 4FCYA 4FJNA 4ED6A 4Z4GA 4C8NA 3V9WA 3EY1A 1VSFA 2WOMB 4F4KA 4ECRA 2IA6A 2HVHA 4FLVA 3VA0A 3AVIA 1D9DA 4NLTA 2AQ4A 3BQ1A 1KSPA 4KKOB 1VK0A 3VQ9A 4CEOA 4ZP8A 4JS4A 4FK0A 3SV4A 3B6OA 1BL3A 4ZHRA 2YNFB 2C2RA 2IAJA 2P5GA 2BDPA 4FJKA 3RTVA 4CFAA 5KRTA 3RRHA 1HMVA 3BJYA 2JLEA 1IKVA 4FJMA 3MECA 1KFDA 4B9SA 2VG7B 5HRRA 3ZT4A 3T3FA 4B3OA 2R2TA 4HKQA 4CJSA 3MEDA 4Z4CA 2QE5A 2JEGA 2BQUA 2IJNA 3KK3A 3HXMA 4KPYA 1TVRA 2W9BB 3AO5A 2IM1A 1ZBIA 1S97A 3IS9B 4C8OA 4KHWA 1S4FA 1U04A 2OZMA 1KVAA 3V9SA 3KKRA 4J9RA 2VG5B 1ASWA 4E3SA 1RT3B 1T7PA 4IR1A 4L8RB 3TI0A 4MKBA 3AVLA 2NUBA 2HNDA 4DSJA 4WXOA 1EKEA 1NK7A 3HVRA 1KVBA 3CQ8A 4TYBA 4RW8B 3N6LA 4NLRA 1G15A 3PY8A 5KT4A 4W5OA 4R5PA 2F8SA 1HYVA 4PA1A 4DF8A 2FJWA 1Z25A 1NHUA 2AX0A 2IDOA 3DRPA 3TVKA 4FLUA 4RW9B 4Y1DA 2X6NA 4EEYA 4CHQA 4KO0B 4BDZA 2UVWA 1D1UA 5L1LA 4R8UB 4K4TA 4FLYA 4PWDA 5CZ2A 4FZXC 2Q3SA 3MFHA 2Z1JA 3DMJB 4DQPA 1TKZA 5CY4A 4MK9A 4N56A 4HUGA 4IKFA 1K6YA 2KTQA 4XIUA 1NOYA 4DSEA 1QE1A 2OPQB 3PW4A 3CVKA 4BE0A 3M8PB 2IAJB 4CE9A 2HHTA 3SQ1A 4B8CA 2HNYA 1BI4A 1XWLA 4CGJA 5F8GA 4WFZA 1HMVB 4F2SA 2ZD1B 3V6HA 3TAFA 1IKVB 3DLHA 3MECB 3OS2A 1S6QA 3AVJA 2OZSA 1NKCA 3OJUA 4B3OB 4Y2AA 2RPIA 3PJWA 4QW8A 3G6XA 1U09A 1S6PA 1Q8IA 4B08A 1C1BA 2YNGA 3OHAA 1MU2A 5EU7A 3JYTA 1MMLA 4DEZA 1RT7A 3TABA 4ID5A 1ZTWA 4O3OA 3T19A 4M95A 2O4GA 4JV0A 4J2AA 4Y34A 3ZSZA 2C28A 2FJVA 4CJRA 4NLDA 4YQWA 1NJYA 3RMBA 5FRNA 2XGQA 1RTDA 2HHVA 3AO4A 1X9WA 3DI6B 3ZSVA 3HKWA 1TL1B 3ZSYA 3F73A 3PW2A 3CJ3A 2Z1IA 2GBZA 2XY8A 4R5PB 1HYSB 4DL7A 5KG6A 4CJWA 3LZJA 3P1GA 4FJJA 3RB0A 5D3GA 3RB6A 3G10A 4TLRA 4M3TA 4J2DA 2XY7A 4FJGA 4ZPDA 3I0SB 1CXUA 4CJPA 4RNHA 3ZSWA 2KZZA 4PWDB 4RNFA 1JL1A 4WYWA 4DG1A 3LP0B 3KLHA 1QQCA 2PY5A 3QGIA 1JIHA 4N41A 1EETA 4MH8A 4DL6A 4M3ZA 4E89A 1QE1B 2ILZA 2VWKA 1TAUA 4KB7A 3KHLA 4EYIB 4KTQA 4MKAA 4I2QA 3DLEB 2HNYB 1BI4B 4JRQA 4FBUA 3QESA 1SKSA 3CFOA 1S6QB 4N5SA 4O3QA 4I7FB 1LAWA 4KE5A 4JV2A 3ZT2A 1UWBA 4PQUB 3WNHA 2AX1A 3VQ6A 2W8LA 4E1MA 5KG5A 2FBVA 1YVFA 4B9TA 1QSLA 1RBRA 1S6PB 4UQGA 1C1BB 2P51A 2YNGB 5L9XA 3I5BA 4DTOA 1MU2B 1RTHA 3JYTB 1ZTTA 3BGRA 4I2PA 1DTQB 4IQXA 4BWJA 1RT7B 4TY9A 4RW4A 4ID5B 3TAPA 1LW2A 3V4IA 4O4RA 2RF2A 4ECQA 2I5JA 3SQ4A 4F2RA 2FVRA 1HPZA 4QW9A 1KRPA 4DLEA 4IG0B 1XC9A 1IKYB 2FJXA 1NK4A 2DPIA 4DL5A 5JUMA 1KLMA 1RTDB 2C22A 1XHXA 2R2UA 3VQ5A 1SL1A 1UOCA 4N76A 4NYNA 2OPRA 3OYBA 2ZKUA 4EZ6A 3MR2A 3HHKA 1N5YB 4DL4A 5F8NA 3GQCA 2R2RA 1BIZA 5D3GB 3PUFA 3H08A 3HT3A 3ASMA 2J6TA 1ZBHA 1I39A 3CM5A 3NFAA 4KAZA 2RDIA 3OYLA 3GIJA 2ETJA 4ECZA 5KFZA 4DG1B 2X78A 3HPGA 3KLHB 3GILA 4DS5A 1TP7A 3DRSA 3K5MA 1EETB 3V1RA 3DLGA 4IRKA 4O3SA 4OL8A 3OSNA 4U6PA 3S3NA 1B92A 4K4VA 1NJWA 3ULDA 4CK2A 1S1TA 4I2QB 3H5UA 3AVNA 2YV0X 2V4QA 2XCPA 3KJVA 2GUIA 1LW0A 4Z4IA 4KHMA 4DQSA 2BGGA 4KRFA 4G1QA 4FXDA 4MQ3A 4ECYA 4FJHA 3SQ0A 1J9AA 4H4OA 3THVA 3H5YA 1LWCA 3NDKA 4EYHB 3KK2A 4FK2A 1O1WA 3OYFA 4RNNA 1JLFA 4CEAA 3CDEA 3S3OA 5KFYA 4CJLA 3T5LA 4MIBA 2B43A 1RTHB 3BGRB 4I2PB 4FM0A 1C6VA 4RW4B 5KFHA 1IKXA 4F4WA 4CHPA 5KFPA 1LW2B 1S48A 3V4IB 3FDSA 2D5RA 5FROA 2I5JB 3NBPA 3IN5A 3KHGA 1HPZB 4J9NA 2HAIA 4IRDA 2XWYA 4ED0A 3BSCA 3KD1E 4NZ0A 1KHWA 4CJFA 4QWDA 4FZZA 3QZ7A 2XY5A 3PV8A 2OPRB 2WOMA 4K4YA 3OYDA 4CEFA 4XPCA 2P5OA 4QPXA 3SI8A 5KFDA 1S49A 3CO9A 4KKOA 3LAKA 1DLOA 2XC9A 3AVKA 1N56A 3NGIA 3PO5A 3KIOA 3HP9A 1S9GA 4K4XA 3L3VA 3OYNA 4TN2A 2YNFA 2BQRA 2QKBA 3V1OA 2ZQBA 5F9LA 2R8IA 3NL0A 4K4SA 4KI6A 1LV5A 4EBDA 1T8EA 5KT2A 4J2EA 1IH7A 3OL8A 1RA7A 2VG7A 3C94A 1CXQA 2X74A 3DRSB 4K8XA 3RMAA 5KRSA 1RAJA 1SH3A 4LY7A 2VWJA 5KFUA 1XHZA 4O0IA 1S1TB 2V4RA 3PO4A 3KJVB 1LW0B 4CGFA 1VRTB 1W9HA 2Z1HA 5KG0A 3BQ0A 3SFGA 4KHSA 2AGPA 2G8FA 1S1XA 3QO9A 4J2BA 1BQMA 4H4OB 3PHEA 3SZ2A 3PX6A 5SWMA 1JKHA 1LWCB 2D3ZA 3KK2B 4ED3A 3QYYA 5KG2A 4CF2A 1JLFB 1S9EA 3NF8A 3G6YA 2CKWA 4ELUA 4Z0UA 3H4BA 1RT5A 3LZIA 3KHRA 3CJ2A 2PZSA 5F8HA 1IKXB 1B9DA 5J2NA 3K5NA 4H54A 1C1CB 3NBPB 4O4GB 5L1KA 2HMIA 1YT3A 3NMAA 3K59A 1A5XA 4KHQA 4CGGA 2FBTA 1CSJA 5EUHA 1C2PA 3ZT0A 2C2DA 1TQLA 5C42A 2E4LA 4NLQA 4IH5A 2UVUA 1JLCA 3TAQA 1L3SA 5HRPA 3DMJA 3TAEA 4PUOB 4Q8FA 2BR0A 2E6LA 4HTUA 4NRUA 4CHZA 1DLOB 2OPQA 1RBTA 2W7OA 1JX4A 2EC0A 1S9GB 3D45A 4JLHA 4K8ZA 3GYNA 2YNIA 3M8PA 5E41A 3I8DA 4Y2CA 2IC3A 3PR5B 3BSNA 1NK5A 2W9CA 2ZD1A 5CYQA 3PVXA 2GC8A 1LWFA 4ZVHA 4IDKA 3CDWA 1CLQA 1XI1A 3AA3A 4CJ3A 4E7KA 3I0RA 5DG7A 4RW6A 1ZBFA 1S9FA 3GIKA 3DDKA 4CFBA 5T7BA 1JXLA 4CHNA 5DQGA 4JUZA 4IH6A 5KT5A 1UA1A 3C6TA 4ZTFA 2QK9A 1NK8A 3H5XA 3OYHA 1S1XB 3QO9B 2IOCA 1C0UA 1BQMB 3PW0A 1DTTA 1JKHB 3JSMA 3CWJA 3VQEA 1JXEA 1S9EB 4ECXA 1RYSA 4URQU 1SUQA 3AA4A 2BQ3A 2FBYA 1L3VA 1VSHA 3DI6A 4GMJB 2Y1IA 4YNQA 3SUNA 4J9OA 2G8KA 2YKNB 1RNHA 3G0ZA 2I1RA 3Q8SB 1TL1A 2F96A 1RT5B 3FQLA 3OYMA 1T94A 3P83D 5J2NB 4CESA 4FYDA 5JS2A 1HYSA 4QWCA 4OGEA 3A2FA 4FS1A 1TKDA 4DTJA 1U48A 2HMIB 1X1PA 1HJRA 1GOAA 1CZBA 4KV8B 1WSJA 4FZYA 2YHBA 3OS1A 5C24B 3I0SA 4BDYA 3GIMA 1QUVA 1WSFA 5C42B 4M41A 2IM0A 1JLCB 3LP0A 4RUCA 4RUAA 1C0TA 4ED7A 3KLEA 3I5CA 4K50A 4OGCA 4OLAA 2XI2A 4IBNA 3O3GA 4QOZB 3QEWA 4LH4A 2DFHA 4NLOA 2F8TA 4Q0BA 4M3YA 3AO3A 2YKMB 2OYQA 1RT2B 1JLGB 3ISNC 4AHTA 5DQIA 3QIOA 2DTUA 3LPTA 2YNIB 1NJZA 2YNHA 1EX4A 3DLEA 2O4IA 4QCLA 4H4MB 3OLAA 2IC3B 3H40A 2D41A 2W9CB 2OA8A 5CYQB 3HK2A 1C1AA 1WAJA 3CG7A 4HYKA 1LWFB 4IDKB 4ZPAA 2UVRA 1NOZA 4CCHA 4I7FA 3CJ4A 4PQUA 3I0RB 3HPOA 4RW6B 2W7PA 1KLNA 1RBVA 1RCHA 3HVAA 1JLAA 3HP6A 2B6AB 3AVFA 4WXWA 3AA2A 2KW4A 4DL3A 1RDCA 1DTQA 4GVMA 3C6TB 3HL8A 3ITHA 4WE1A 2F8EX 3ZT3A 4NLYA 4O0JA 1WAFA 5KFBA 2GIRA 2LSNA 1C0UB 4NCGA 1DTTB 2P1JA 4F4XA 3JSMB 4RU9A 5KFTA 5KFIA 4IG0A 4AH9A 1IKYA 2YHAA 1SUQB 4AHVA
chains in the Genus database with same CATH superfamily
1RAHB 1X5TA 3NH0A 5AXKA 3ZZOA 1GLDG 4URGA 5HVHA 3O9SA 4CJTA 3B6BA 2OIHA 4JYAJ 4ECWA 8RUCA 3MWTA 2HVDA 4NA2A 4DL2A 4BRHA 4FNHA 2A2CA 1CJTA 2J5AA 5JVGQ 4ELVA 4OZ3A 4H0XB 4XH1A 1V6HA 1BHLA 5AQKA 2B7CB 5LMUF 5GIPA 3CXCR 1PILA 3DC2A 1ITGA 6FDRA 3MEKA 2P9NB 2YX1A 3KLEB 3G6ES 1VSIA 4UZBA 1WSIA 4WK3A 4JAXA 3QIPB 3IRXB 4JI8F 2CQIA 1FRLA 4WFXA 1NKBA 3CMAS 3W7BA 1RAFB 2WVCA 1VQMS 4CO4A 3U3GA 2Y1LB 1VQ4S 3L8BA 1KONA 2GW8A 2G1HA 3M4XA 1RBSA 4FWLA 3NKYA 3QICA 4JS5A 3Q7CA 5DO2A 1OH7A 2H3EB 2KDOA 2ACYA 4U7BA 4KR0B 3CJ5A 3A8IA 3MMCA 3ZTRA 1TYQB 2ZDPA 1XR7A 1HX1A 4MFBA 2G1DA 2XRIA 3PFEA 2LU1A 2J9EA 1VQSA 4YOEA 1RAGB 1UA0A 1NKEA 2W42A 4FWMA 2CGLA 1SV5A 2H9ZA 1SL0A 2HFVA 4LRDA 4ZTJA 1HBUB 5IT9U 1KHVA 2OH2A 3FK4A 1IM4A 1FO1A 4ETXA 3KK1B 3AFGA 3R6LB 1C0MA 2M0GB 3W66A 3O4WA 2AU0A 1P1TA 4CK1A 1NJIO 1UETA 1U2RA 5HRNA 3M2VB 4CH7A 1ZZFA 1EQYA 2HMPA 3I56S 2C3YA 1I3AA 2PYJA 2AEJA 2H4YB 4X4NA 2JRSA 2K7KA 1GXUA 1R0BG 4U67L 2VASA 1CPZA 4A8MP 1XR6A 3GG0A 1RKIA 3VQPA 4KGZB 1N6QB 3DYAB 4ZCKA 3MD1A 1JLBB 3UQSA 4E8UA 5EY4A 2HK3A 2XCAA 1RWPB 2Y1RI 4RG8A 3SUPA 1VRTA 3LDSA 3WUHA 2QL9B 4HTIA 2DH8A 3J80U 3HM9A 1SJ3P 3VQAA 4F8RA 4CLYA 1VFJA 2C2OB 1QQMA 2XLJA 1FERA 2QEXS 1N33J 1HKBA 2V34A 1RBUA 1R3NA 1FKPA 5ADZA 3H1VX 2Z2MA 4BDPA 2ZOMA 1BIUA 4ES3A 3D0PA 3IAM9 2MHNA 1QVGR 3P5TL 5HLFA 3H20A 4P2MA 1FVSA 1WOPA 4OPKA 3OYAA 4JI1J 1U6FA 2CQ3A 2H5IB 3KG1A 2D7SA 3MMBB 3HHDA 3KLFB 1IM6A 1QVFM 2O8BA 2G13A 1YJWS 3GJRB 1Q7LB 1J54A 3QB0A 1MW7A 1TR0A 2PFDA 3K58A 1T3OA 2KM8B 4CM2A 3AD8C 5GAEP 2C3MA 1F60B 4NLUA 5BYQA 1QHAA 3DKDA 4KGVB 3R7SB 3VGMA 4GKKF 3FZKA 5FLXY 2E2PA 2RKIB 3NCIA 1RTJA 4Q43A 2XZDB 1XR5A 3BDEA 4K5RA 4OPJA 3SDEB 2C3OA 3H2LA 2V2QA 3EZWA 5LMUK 1PO6A 2VQFJ 3NGSA 5M1PA 4O5FA 2BUPA 1QAYA 1KCFA 3TA0A 3QERA 1JB0C 1J53A 3MAAA 4TQSA 4GV9A 2C2KB 1UZDA 1YDLA 4JI8K 2J0QD 5FDLB 3IAS9 4EHUA 2OD4A 3E3XA 5F3TA 2QA4N 2VDIA 4L6V3 2FLPA 4OV6A 3LTOA 1S1VA 1SPBP 1K1QA 3J7YI 3UD3P 4BRQA 5LSLA 2ASMA 4X84A 3PYDA 5ITHA 3KLGB 4USTA 4C23A 1SH0A 1ZM9A 2C2EA 2IVFB 1DQ9A 1XIQA 1UJ6A 2EFPA 3C14A 4K8RA 2V69A 3M9NB 1VQ9N 1GQEA 2WHOA 3MUTP 3JXOA 4NLWA 4K2XA 4QZVB 3Q8QB 3FZMA 2YKNA 5KFVA 3IG1A 3FE1A 3RUBL 2ZZNA 4QS8A 4DU8A 3HHLB 4H5WA 2YTCA 3AVMA 1RHQB 3E01A 4ICLB 5IM0B 2P9IA 4EWTA 4FVCA 5C24A 1WNSA 2WB1D 5CYJA 2KU7A 4DZDA 2IJRA 3CCEN 1U2FA 2R8JA 3MXJA 1HRHA 3L2QA 4HDHA 1U1MA 1WKKA 3OL9A 3CCLN 2GAHC 1M1GA 1NZ8A 5KT7A 3GP9A 1H2UX 1TAQA 4X4UA 3HVTB 4TY8A 4XK8C 3UDLA 2DGTA 2YJEA 2JC1A 3H0PA 3ATUA 1AROP 2XO7A 2YHYA 3G2XA 2W40A 3P5JA 5HP1B 3VAIA 4J9QA 2VA3A 1MLAA 4OKKA 3ULEA 4CIEA 3RAQA 3TARA 3CJAA 4O3NA 3PLAA 1HUXA 1SJ4P 1Q4RA 4DU4A 2CQ1A 1KBRA 2XI3A 1F5AA 3W60A 3ETMA 1U4BA 2QV6A 5GAHU 3QGGA 3TQ1A 4LF9J 4O3RA 3QQCD 4CF1A 2ZZTA 4GC6A 3D2EB 1YRUA 4YB7A 3R5DA 2ZC3A 4F4YA 5ELZA 4GO5X 3H2UB 1KD1O 3T9NA 2XWXA 1G3OA 4DQQA 1VC6A 2HHXA 3QMQA 4C8MA 1WEZA 4IOAQ 3LP3A 3R9PA 2OCEA 3LO3A 3CCVS 3KHYA 4OZJA 4KHRA 4RW7B 5E0OA 3CFRA 4WBFA 1S1UB 3FVYA 3CT9A 4NXMJ 4JNEA 3UIQA 4GKKK 2DIUA 2O8DA 4FYXB 2NZCA 4LUBA 1N0UA 3U9ZA 4CJUA 1YITN 1X4GA 3KKSA 5C5JA 2O8EA 1WEXA 1T02A 1KC8T 2ZUAA 2KFZA 2DGOA 3OVNA 4ZVSB 3TR5A 2MKIA 3RMCA 4C97A 4ID1A 4IFVB 2IM3A 2XSFA 4LF1A 2A1RA 4BLGA 3F0NA 2D74B 5B0BA 2AJFE 2Q0RA 3MN5A 1UP1A 3QEPA 2QLXA 2CZVC 1AFIA 5LOQA 1D3WA 1YZ6A 1NHVA 2VGNA 2XS7A 4F02A 3DLKA 3FBBA 1ELOA 3EGZA 3E8OA 3N5BA 4YR2A 1SBRA 5I3QA 4GW6A 4Y0WA 3LW5C 3MCMA 5LMNF 5AZJB 2GJIA 3KYLA 4I6MA 1W25A 4EP4A 1U25A 4R0JA 4M5IA 1BQNA 4HL9A 3KK3B 1TVRB 3AOCA 1H2TZ 1U8SA 4NLVA 2W4CA 2KKHA 4M8LA 5CHIA 4L72B 5AQVA 4W98A 5AE1A 3A3OB 4DV1F 3AJ1A 1WF2A 2H5JB 1WDDA 4H8KA 3ZYYX 4EAHD 3NGRA 4ZVRB 5KFXA 3V9UA 2PSZA 4C7QA 4CJQA 5KFNA 3TUPA 1QSSA 5LJ3Y 1GK8A 2A42A 2QX0A 2Q1NA 1W0HA 3TTDA 2MY7A 1RLCL 3N6MA 3ZSRA 2HF3A 3CD6S 4ITSA 1FXXA 3QT7A 4WP8A 3BR8A 4PPDA 2E6MA 3VQDA 4ECSA 3MMAA 2BANA 2UVVA 3DRYA 3BKUA 1PJ6A 4LF8F 1Y9OA 1TKZB 3D5MA 4YP3A 4BG8A 2ZHOA 2YY3A 3SCLE 3RSEA 4I9LA 5FJ4A 2RDDA 3G8TA 4AXJA 1RWXB 4CP5A 3LQVA 4CEQA 1LK7A 1DURA 3P4IA 1IKWA 3AXKA 4JI5J 4CGDA 1HNVB 4IG3A 2ZITA 3GYGA 1T05B 2CXEA 4F36A 3DOLA 5KFCA 3FLCO 2B8PA 4LRAA 4FM2A 1NNEA 2QL7B 3UCGA 3N6NA 4DUYF 2VPYB 1CQMA 1VK3A 1BWEA 4XAKA 4DSLA 1XMOJ 4NL5A 4DZ6A 5C2GA 2KXFA 3RB4A 4HHHA 1MDUB 2J6SA 5I3UA 4NEYA 2E2QA 5J2MB 3W2WB 5IC4B 2ZFHA 4MDAA 3ZLJA 4DI6A 1EP4A 1G1XA 3V1QA 1HNZF 2OUGA 4AUKA 1ASVA 4H03B 1OJ4A 4L76A 5LL6Z 1NU4A 3ETOA 1KQGB 2E1CA 4H0TB 1U7LA 4O0NA 1REVA 1N88A 3MXMA 2OTLN 4CJVA 5CXTA 4LRFA 1IBLJ 4LBPA 4DR4J 4JKEA 3V6JA 2VKZG 3V81A 1HBNA 1NRKA 4HHTA 1J5EJ 3AA5X 4JKDA 1TL4A 1Q9YA 3E51A 5LSRA 4FJIA 4OYZA 1OWXA 1BDGA 2ASPA 2ZH9A 3ZNJ1 3S6EA 4FJ5A 3Q86A 2DFFA 3FFKB 3MOZA 1RCXB 3V6DA 4ANDA 1ULRA 4V19J 4CEEA 2GNKA 2YJFA 1GOCA 1RYRA 3PTWA 2KZMA 3O3HA 4FLXA 1O51A 4USHA 3BEGB 4KFBA 3VQ4A 3KHHA 2KG0A 5F8JA 3G6VA 3OYEA 3UKUA 5IT9O 2BE2A 4KBOA 4TU9A 2J7KA 4CI0B 4QAGA 3WQUA 3CEDA 3IGNA 2W2MP 3SBTA 1NBEB 4J91A 2FBXA 1RCOB 1S5JA 4BGBA 3QEIA 4ZVPB 3WX4A 4CTAB 4DU1A 4A8SA 4KREA 3SI6A 5K8MA 5LMNK 2H51B 3E1YA 1AB8A 4ECTA 1JLEA 2UUTA 2B0GA 3AB2B 3C66A 4M1KA 1WWHA 4X66J 3MCAB 1RTZA 3MUVP 2CAJA 3TW0A 1ZPVA 3QNOA 5D0GA 2IGIA 4DTNA 2V68A 4F3OA 2YPZA 3CC7S 4W92B 3CHWA 4DV1K 1RTIA 2RF2B 3IP0A 2BKOA 1UMJA 2P6TA 3OW2M 3CM6A 3R9LA 3SUQA 3LP1B 1BA0A 2FC9A 1X9JA 4FLWA 1W2BR 3BH6B 1LWEB 3P96A 3UVJA 4MKVA 3MXIA 2PI5A 4ZJQA 3GSIA 5C12A 3IDHA 1N4LA 1ICEB 3UKRA 4OKJA 5CYMA 1WKJA 3O9UA 2NXNA 4ZCIA 3K5LA 4LD0A 1X4BA 4CD1A 2B5JA 4I0WA 1B7YB 3T6BA 3X1LB 3FEXB 4JV1A 2V63A 2IRYA 2FHJA 4LF8K 4ED1A 1RT1B 3KLIB 2GVZA 4LF5J 2FVSA 3R1HA 4CBUA 3HTVA 1RABB 2BXJA 2UUCF 1CJUB 3ZZUA 1RDAA 3SNNA 1P27B 3V9XA 3I9V9 5HL7L 2MKYA 3VR1A 1VSDA 4PWWA 4U7CA 1RJJA 4PXEA 3MM5A 3D28A 4W5QA 4L74A 4DUYK 1DJ0A 1Q18A 4XO0A 4Y1CA 4RNMA 4FJ9A 1T03B 5H9FJ 3H2VE 1HQEB 1EARA 3DDIA 2FY8A 1GX5A 1Q1KA 2P9SA 3OYIA 5FPMA 1HNZK 4FVMA 4DV2F 2CG4A 1NWKA 3MCOA 3M8WA 2N3OA 2B4JA 1TL7A 4CK3A 4CO0A 4DSIA 3HSTB 1X4EA 1IR2A 4BR4A 1YWXA 1HBMB 1IUJA 1EZZB 2YWEA 5JS1A 3C16B 4FJNA 4WP3A 1YJNS 1VSFA 4B1UB 3CJCA 3HDSA 2PBDA 2DXDA 1W97L 5EHHA 4FLVA 1UAWA 2IA0A 1D9DA 2AQ4A 1CS4B 5IXUA 1KSPA 4DR3F 1SIWB 1RZMA 1BL3A 2EXUA 4EK2A 2QMWA 2RQ4A 4DCJB 5BN8A 2ZWOA 3RTVA 4BC5A 3RRHA 2WSEC 3BJYA 2A0FB 3MECA 3CTRA 4JHDA 1Y7PA 1KWMA 3ZT4A 1WC6A 1LCUA 2RS8A 4BY9C 2ADBA 4B3OA 3VENA 2E29A 4HKQA 2B56A 4CJSA 1YRTA 1N36F 1RBAA 1EO1A 2VKRA 3DXMB 3ZZ0A 1ZBIA 4UUXA 1S97A 3IS9B 3L6QA 2QA2A 1S4FA 1IV0A 1U04A 4RPFA 4RWTA 3UB5A 3WEEB 2CVEA 3W3SA 4E3SA 5AQQA 4OJ1A 1NBWA 4RR5A 4QJVA 3VV2B 3JS9A 3QFHA 4DSJA 1FFWB 2IIRA 4WXOA 4G1IA 5L38A 3EE8A 1KVBA 3QAUA 4TYBA 4RW8B 3BPSP 3VVTA 3HM8A 4TLQA 2JJ4D 1HYVA 4PA1A 1ZBSA 2F4VF 1Z25A 2AX0A 1Y3KA 2P9UB 3US5A 5DM6Q 4ZN1A 4CO2A 4Y1DA 2J0XA 4CHQA 2GS8A 3K89A 4R8UB 4JV5J 5CZ2A 5CCLA 4C0OC 3QWPA 3THTA 2KG1A 4DR2F 4I68A 4FF1A 4DQPA 2ZBQA 5HK4A 2K1RB 1VLOA 2OSRA 4B02A 3G96A 3VEZA 4IKFA 3DGPA 4DBQA 4XIUA 1WTFA 3DJCA 3OFFA 1QE1A 4Z7CA 3SQGA 1Q16B 1AZSA 4HH1A 1BO5O 4AE5A 4CE9A 3IBCB 3DOMA 2D1CA 3SQ1A 2GQCA 2MMYA 2K7JA 2RQMA 5GADU 5F8GA 4WFZA 4F2SA 1RWKB 2ZD1B 3CCRN 4FWNA 2UXDJ 3C0BA 2DCUB 2V7YA 3CC4S 3AVJA 2OZSA 2UUCK 1HFEL 2HVZA 5IV3A 3G6XA 3S01A 3H25A 3U8XA 4B08A 2YNGA 2BYCA 1K8AT 3JYTA 1HD0A 1X3MA 4O3OA 2MHEA 4WFAL 2V7ZA 3AA9A 4Y34A 1VOMA 3F44A 2MQOA 4NLDA 3Q2TC 5FRNA 2F5GA 1YIJS 3CJ9A 3AO4A 1X9WA 1T3VA 1HLWA 1KEKA 4UY85 1TL1B 1SC4B 4DV2K 4B3RF 3CJ3A 2GBZA 2XY8A 3OUYB 2DR9A 2CPYA 5KG6A 4CT8A 4BQLA 3LZJA 3J81U 4BR0A 5IT9Y 5GAEI 3R5JB 4BRDA 4FJGA 2FZKB 3VESA 4OI0A 4ZCMA 2DGUA 2YX6A 4X62J 1WACA 3LGNA 5EXWA 3LP0B 1M90T 3TPQA 3W0LA 2PY5A 1R0CB 2W7AA 3A12A 3QGIA 3IR6B 4N41A 1EETA 3OXLA 4QR2A 4DR3K 4E89A 1FX2A 2ILZA 5K5MA 1TAUA 4QBUA 2HIQA 1GLAG 3THWA 5K8PA 1BI4B 1DRZA 2QZ8A 3IO1A 4WCEL 4IOCQ 2WC9A 3RYLA 3DWLA 1U2CA 1RWNB 3D54A 3CC2S 4JK7A 5BRHA 3D1HA 2ZVIA 4LVOP 2J9DA 4GKJF 1U1NA 1S77D 4E1MA 4B9TA 2FBVA 1N36K 3U1LA 3EKUA 2LA4A 5L9XA 3G4SS 4DTOA 1DTQB 3J80Y 1BE4A 2E44A 4ID8A 5CABA 2J0SD 3TAPA 4IFEA 4O4RA 2I5JA 4JN4A 4F2RA 1HPZA 4IG0B 1NK4A 2DPIA 5BXIA 2QYGA 3DLJA 1T9XA 1YVNA 5DDQC 2KFYA 3HI0A 3W65A 2ZKUA 3T69A 1R6VA 4IO9Q 2F4VK 2CG8A 4K0KJ 3PG9A 3TP2A 4DL4A 4FPRA 3C6HA 3V4MA 5D3GB 1HBOB 3PUFA 4A57A 3H08A 3ULHA 3HT3A 1SXLA 3ASMA 1VQKN 2J6TA 3WIVA 5LJVA 1I39A 3ZZPA 3CM5A 2CPJA 3NFAA 2ZKTA 4DR2K 2ETJA 4QOTA 4DPYA 4FYYB 4DG1B 2RJZA 3HPGA 3IFRA 3JQKA 4DV0F 2MGZB 4KIAA 3DRSA 2BJ8A 3K5MA 3U4LA 1V9OA 4AL5A 3V1RA 5F1XA 3N28A 1B92A 4K4VA 2G0CA 3ULDA 1X5SA 2GTDA 2QTWA 4J9UE 1H7XA 3O6QA 4Z4IA 4KHMA 3H42A 3UDEA 3NXZA 2R42A 1RHJB 4PG6A 5AE2A 2XO6A 4JI0J 2WBMA 5LJWA 4P52A 1IJEB 1J9AA 4P75A 4N77A 3THVA 3G6EN 3KK2A 2VH7A 1DAXA 3CDEA 4JI3F 1KVIA 5IWAJ 5JLFA 3S3OA 3MMCB 3SAHA 4YB6A 1YBAA 3T5LA 4MIBA 3PYGA 1RTHB 1GMWD 1OY9A 2BE7D 3CMAN 1C6VA 3WXIA 4RW4B 2DEIA 2CQDA 1VQMN 1IKXA 2OP5A 1AXQA 1RU1A 3FEZA 2D5RA 3NWRA 1VQ4N 2KYZA 5FROA 1GFWB 3IN5A 4YOVA 3KHGA 3NCPA 2FTRA 1OPIA 5BJRA 1NB7A 4QS7A 4HR2A 4IRDA 1IXKA 2DO0A 1ZZNA 3HHEA 3M30B 4B3RK 4Z2XA 4P2SA 3D6MB 2XY5A 3Q23A 2OPRB 2WOMA 3WBZA 4K4YA 4CZJA 3QSIA 2OEMA 1PJ7A 2RHSB 3PRDA 2YWKA 5KFDA 3CO9A 4NWBA 1DLOA 1N56A 3KIOA 3AARA 2W4DA 3G82A 1T11A 4TN2A 2NXEA 1FXDA 1U2VA 2BTFA 4F0MA 5ETOA 2ZQBA 2DB1A 4KI6A 3R7BB 1LV5A 1EIYB 1ZC6A 4EBDA 2QT7A 2XG8A 3UN5A 1MWMA 4J2EA 5IS2A 2VG7A 2QSFA 3CJSA 1Q86O 5KRSA 2AJ4A 4B1VA 1AA1B 2NRRA 4X4TA 1VYAA 3NVKA 4O0IA 1S1TB 1R8AA 2RQCA 3M32B 3KJVB 1LW0B 1W2IA 1E3MA 3FBFA 3ZX3A 5LY3A 3RBXA 1VRTB 1W9HA 5LJ5Y 3I56N 3MZIA 2Z1HA 4BVPA 3NVMA 4P72A 2MQPA 3SFGA 4KHSA 1S1XA 5ETVA 3G8SA 1Q7YO 4GKJK 2W41A 2D3ZA 4ED3A 2D3O1 1S9EA 4QYZJ 4OFZA 2RU9A 1KNZA 2MLXA 4WQ4C 4DR5J 2W01A 4YY3J 2P9KA 4PR6A 5F2RA 2UXBF 1RT5A 3QFWA 2OI2A 3BBCA 1PKUA 3L7OA 3NBPB 3A5LC 1PYOB 3F41A 3R5AA 1GMVA 2EVZA 1Y5NB 4KHQA 5BPNA 4ZS6A 1PCAA 2FBTA 2EFQA 2QEXN 1C2PA 1EQMA 2RQKA 3NCQA 1TQLA 3ZEUB 2E4LA 4IH5A 2PMHA 2JNJA 3DMJA 2HBLA 3TAEA 1RACB 4PG7A 3D2WA 1VJWA 4NRUA 1VQOS 2FDNA 4K8ZA 1K8KB 2CNLB 2CQCA 1KXPA 5HI7A 3I8DA 2VV5A 1VLYA 5K20B 1MA9B 1NK5A 2CIMA 2W9CA 1HNWJ 2GC8A 4DV0K 1YJWN 2HKEA 2GHWA 3AA3A 1RAIB 2D69A 5DG7A 5D4NA 2GX8A 4DN9A 1X31C 4WF9Q 4B3SJ 4JKCA 4JUZA 4ZTFA 4A48A 1OPZA 2EWSA 3OYHA 2ZM6F 5HSPA 4KJIA 1C0UA 3PW0A 4B9QA 5TKYA 1IN0A 3C14B 4I4BA 3CWJA 1NGBA 1UEVA 4JI3K 4ECXA 2BJ3A 2MLZA 2DRDA 2RUSA 4LFCF 1VSHA 3DI6A 4GMJB 2UYTA 4MYUA 5JICA 4J9OA 2CJYB 2YKNB 2F96A 2HBJA 1NU0A 3MXHP 4CESA 1X4CA 2D9PA 3M8YA 4OGEA 2CRLA 4C0HA 3A2FA 1U48A 2HMIB 3IRWP 1X1PA 4ILRA 1XBWA 1CZBA 3N9UC 1WSJA 5C24B 3AJDA 4ILGB 4QQBA 3GIMA 4M41A 5C42B 4HLBA 1R8CA 1HNXF 1JLCB 2P9NA 3IM9A 3KLEA 4K50A 4OX6A 1NG9A 4PKDB 4OZ5A 4KPCA 4NLOA 3AO3A 4MAKA 2DTUA 3AD9C 5TKWA 4FN5A 1GTEA 4DU7A 1M1KO 1W2BM 4AD6A 2N4CA 2JH3A 3NLCA 1UVNA 3VEXA 1NLKL 1YTYA 2DJWA 4FKXA 3TTFA 3M5RA 4P10A 4I7FA 4PQUA 3I0RB 3HPOA 1JNZB 2KHCA 3CCQN 1TYQA 3MUMP 2Q2RA 4WXWA 2QA1A 3A4TA 4DL3A 2KW4A 2EKNA 2HBMA 1RAEB 3C6TB 2VF3A 3C15B 1Q8LA 3JQMA 3PEHA 3MHYA 3HL8A 2NSCA 4O0JA 3T6JA 2G0JA 4Y0FA 3NOCA 3T9ZA 1DTTB 5C0YA 2E1MC 4M5KA 2Y8WA 3JSMB 5KFTA 4GRSA 5I3PA 1IKYA 2YHAA 4AHVA 2CGJA 3GBTA 3CNQP 2HFSA 1HI0P 1KTQA 2ZGYA 2MQ8A 2UXBK 3KK1A 4TXSA 3HO1A 1LKZA 1KP6A 4M3XA 1NPKA 4FJLA 4FZVA 5BN9A 1N5YA 4E19A 1VSEA 4OV1A 1UFWA 1SH2A 5GIOA 3M2VA 2R7VA 4EBEA 1BMQB 1NK9A 2QKKA 5CHCB 3K0JA 5M1QA 2FLLA 1CZAN 2R2SA 2DNRA 2O66A 3O8WA 3QPIA 1C0TB 3CCUN 1H6KX 3AA8A 2O67A 3MMJA 2ILYA 2FZCB 3KDOA 1XTZA 3VWSA 4A8QA 2E1AA 1N6QA 3DYAA 3IFEA 2O8EB 1JLBA 3I5AA 2G8WA 2MDAA 1JCEA 2YNHB 1WDTA 4CBWA 1U47A 2UXCJ 3TX0A 4TU8A 2XGPA 2FQQB 4ED8A 3HJFA 3CCVN 3LM9A 5F3ZA 1WSHA 3OL7A 2GIFA 4DTMA 3HZGA 3WDOA 1DT9A 3LPUA 2U1AA 1NSKL 3DLKB 1JLAB 3KJQB 2E7VA 2YPYA 2H3GX 1U24A 3ITHB 5KGWA 4NXNJ 2ZM6K 3J81O 1GMUA 5B0DA 1RKJA 4DV7J 3CJRA 1LEOA 1JQGA 2NPFA 4I6YA 5FPEA 3KLFA 4LFCK 4MIWA 3D7SB 2Z8QA 1NDKA 5ETLA 2X6SA 2M5YA 1Y10A 1RT4B 2F8HA 1FJCA 2PO4A 3S9HA 3OLBA 2EBGA 2RKIA 1SQKA 3POTB 3SDEA 4ED5A 2BE9B 2XNRA 1TKXB 3GJQB 3HMJG 2Z2ZA 1A5WA 5M1KA 3OTDA 5I9EB 1HNXK 4M94A 3ENVA 4UQTA 4RCHA 1E4FT 3ZZYA 1FWLA 3KMSA 1TFYA 4A8KA 3FFIB 2GMJA 4KHUA 1NM2A 1U26A 4A5AA 1TK8A 4A61A 5FDLA 4NI2B 4BRIA 3R6GB 3B54A 3OFGA 2A5XA 2NXCA 3MMAB 2E9ZA 2BANB 1SCJB 5CD4H 2X1BA 4IXCA 3LP2B 3QBWA 2V8DA 2WTFA 4YOUA 1SL2A 1F3VA 2J9DE 2FSJA 3VZHA 3CD6N 3T5KA 4HCBA 4ZJOA 1O13A 3D3BJ 4BRNA 3PZPA 2ZH2A 1WD6A 4XH5A 4FLTA 1V3ZA 3DOLB 2AA4A 2VJUA 3GG4A 3U27A 2YQ1A 3VQTA 1PYTA 2A6MA 4CH1A 4HI2A 3UWTA 3NF7A 3MEEB 1C1CA 3R97A 4IO8A 2KHDA 2D0BA 4FWPA 4DTPA 4CF0A 4ICLA 5IM0A 3K57A 1GEHA 3NGDA 2A41A 3RR8A 1EP4B 1NH7A 4ETZA 3R27A 4HUEA 4OX7A 1WHXA 4MK8A 4PUOA 3DLLL 2ZH4A 2NS1B 4KHYA 2OTJS 3I55S 3O1LA 3AT1B 1REVB 2DGQA 5L9NA 1RWWB 4BRCA 2E1RA 4BWMA 1YAGA 5ETMA 3B78A 3DHXA 1HBNB 3HVTA 4OMFG 3BS9A 2FHMA 2N4DA 2I9SA 3IUCA 5B8HA 1XK8A 3BKTA 3Q8UA 2O8CB 3Q83A 1SQGA 3GE9A 3RVCA 3CW2C 1IVZA 3V6DB 4EI2A 4EGLA 2OELA 1U1RA 5HN0A 3IMXA 5C10A 3LA0A 1X4AA 3E9OA 1PG5B 1NSAA 3RU0A 3WT0A 1IBMJ 3UKUB 1SIZA 3CFPA 1BC6A 2JEIA 2KXNB 5GAHP 1MNEA 1NUEA 3E2EA 2VA2A 5BR9A 3FEYB 2XNQA 1P90A 2LECA 1SJFA 2QMUB 1RHKB 5KOXA 3D2EA 4DX5A 4FLZA 1Z26A 1B7FA 2CPZA 1WSVA 4O44B 2OFGX 1ITPA 5AQSA 2CADA 1HA1A 1JLEB 3VQBA 4DTSA 2HBYB 4LBHA 3HHNB 3O1WA 4EP5A 3FMWA 4FW1A 2HEKA 4LF7F 5G0RB 4EZ9A 4HHUA 2LKZA 8AT1B 3VOVA 4DWIA 1S6UA 4O23A 2HHHF 4RW7A 2UUBJ 3MK6A 3HT0A 1Q8BA 3GV8B 3OTCA 2KHOA 1S1UA 4HACB 1D5AA 3ENHA 4ZP7A 3MF5A 3OQ2A 3FQKA 2YKMA 3OJSA 1JLGA 3UVJB 5ETKA 1KN6A 4WTYA 4G9ZA 1XNQF 2OGUA 4MT1A 4DPOA 3HOTA 3MM7B 1DY3A 5CYMB 3VQ8A 2XHBA 4IFVA 4H0PA 2CH6A 1I1GA 3H1QA 3CC7N 3WHIA 2J8SA 4X4PA 4UTGA 4ILLA 2B5JB 4K4UA 3KJFB 2RMLA 2N7CA 1JJHA 4DR6F 3D6RA 1ZETA 4QWBA 3BZKA 5DLGA 2W1BA 2ZBIA 5KG4A 1Y00A 2A40A 2X3DA 3UO0A 1GTHA 4BE1A 2GVZB 3LWLA 2ZH5A 4LF6F 3D1OA 5AZJA 2AWZA 1RUSA 1NGAA 1RP5A 1O5JA 1X3NA 1I94F 4M7YA 4QIFA 4W5TA 4EUVA 3OY9A 3M9MB 1GLFO 1TMMA 4CVNE 4OZ0A 4R79A 4C3MA 1PJ5A 3B6PA 4BQZA 1BU6O 3DOKA 1SKWA 1ZS6A 2F9WA 2C3PA 1XJWB 3WNEA 5AZIA 1MWZA 2LQJA 5CZVA 1ZA2B 2HFOA 3TTCA 2XZWA 1M5PC 2UUWA 1RADB 4XTTA 5AXMA 1TTHB 2BM1A 1S7HA 5HL7Q 2Q43A 2QWMA 2NXJA 5CAAA 2EK1A 4OHXA 4WFYA 2PA3A 3AY9A 3GFYA 3T5JA 5DM7L 4ZVFA 2WB4A 1RDBA 5HROB 2BX6A 3LWMA 3KUHA 2GFFA 2HGLA 2NYIA 3TR8A 2PGCA 2AKWB 1TKTB 3PSFA 3P5BP 3SMSA 5KFQA 1RU2A 2LXFA 1HNVA 1D9FA 5KFWA 2F63A 4C3KA 1T05A 1ATRA 5D8HB 2QLJB 4WZMA 1YJNN 3EX7B 3CYMA 1N5TA 3QGHA 1VQ8S 2ROGA 3W2VB 3QLHB 2GGPB 4LSNB 1P9YA 4OZLA 3VQCA 2CQ2A 1QVFR 3MMVA 4LIRA 2W2OP 1K9MO 1WUAA 3TUJC 1JXBA 5J2MA 2I6WA 2CZ4A 3W2WA 5FRMA 1VJQA 3TEHB 3VAJA 3IC1A 3GJTB 3A3NB 4YS2A 4PAAA 1N8RT 4IFYB 2DRBA 3CJ0A 4LFAF 2BV3A 3K2PA 2XMMA 3R5CA 5KFGA 5ADXA 2F1FA 4RTFD 4C1NK 3P49B 2ITGA 3HF5A 4LF7K 2GV9A 2HRUA 3BDPA 5EWGA 1LXNA 4OKEA 2HHHK 1MN7A 4FWQA 3K0SA 3VVUA 2E5GA 3EVWA 1FF2A 1RHMB 3I31A 3NH1A 4NE9C 2B4OA 1HQUB 4USUA 3Q22A 1FW6A 1WC5A 1M5OC 3PX4A 2HNZB 4X4RA 2ALZA 3CDBA 1XNQK 3I87A 1XNRJ 3VTHA 4CHYA 2EFGA 3HCXA 3CJKB 3U1MA 4DMZA 3TAGA 2BRLA 3T1YF 5HO4A 2F40A 2JZ5A 1Q81T 2FHKA 4E7LA 3KKFA 1RDRA 4DR6K 2ASDA 5KTQA 5KG7A 1LFPA 4WPAA 3BM7A 4OYOA 2PMZD 2W8KA 3ILJA 3WC2A 3SSRA 2CQ4A 3C6UA 4J9LA 5KFEA 5DRKA 3IR7B 4DV2J 2V51B 2ZH8A 5HBMB 4LF4F 1K1SA 4Q44A 2ZF5O 4LF6K 4CO5A 3VGSA 1GX6A 4ZITA 1I94K 1TZ0A 4W90B 5CH7B 5T14A 3NNHA 3CD7A 3PDNA 4B9LA 3SCXA 4YHHF 4NYZA 2BJEA 2Z2YB 3LGMA 3NGKA 3A5OC 4WQ4A 4U95A 4CF9A 1N34J 4CJ4A 4JK9A 4ZP9A 4PL8A 1MMDA 3PR4A 2ZZMA 3J81j 4USKA 4YN3B 1HW8A 3CC4N 3LP1A 2NRTA 1LWEA 3EGWB 4RWXA 2HWHA 3D1QA 4ELTA 2VG6B 2AMCB 3AD7C 2J0WA 3NE6A 4PEOA 3K17A 4AL6A 1WOSA 2XLKA 4Y2KA 3BBBA 2HHUA 4KHNA 5KFLA 1HJOA 1Q5YA 4JD2B 1KAZA 4PYAA 1RISA 5F41A 4NYFA 4M5HA 1YIJN 1RT6B 4AILC 1RT1A 4FJ7A 3KLIA 2JLFA 3RBDA 4FW2A 3RAXA 3R1XA 2GWKA 4CLKA 4I6WA 1HHTP 3GU0A 1NK0A 1BXNA 1WTBA 2WVBA 3KLVA 4OLBA 2XSJA 2GAGC 2ZWHA 1X4DA 1CJUA 1WSEA 2NQPA 1E4GT 3CE8A 3GLJA 2B51A 1PYSB 3HJVA 2N3LA 5M1FA 1S3XA 1WB9A 1W26A 3AVAA 4M5NA 4JRPA 2PA8D 4CHOA 1CJKB 1B70B 2VBZA 5A8KB 3R3TA 4ZPCA 4Z4EA 1UW9A 4HHJA 2HFNA 1T03A 2NYHA 3EDQB 1HQEA 3M6XA 4OVLA 2NRWA 1J2VA 3OXFA 1FJGJ 3BSAA 3MTKA 4F3TA 1T6CA 5DG8A 4YOXA 5I42B 2DGXA 4H5NA 3QMLA 2F3JA 5KFMA 1YZ7A 2ZGZA 1P9QC 3M8QB 2UU9J 3VA3A 4LFAK 4UOHA 5BYSA 4CFCA 1PC5A 4B3MJ 1NHKL 4BS2A 1KFSA 4C1NI 4OIXA 1HBMA 3KXDA 4YUDA 1RBLA 1V4TA 3UI3A 4OHZA 4YR3A 3C16A 4WCEQ 3D9BA 4YOTA 3GV5B 4QYRA 5EX0A 3G4SN 3AVHA 4P7VA 2H65B 4JYAF 3LUYA 5AQIA 3DLBA 3BN7A 1CS4A 2EFVA 1NGIA 4UOGA 3HULA 2VCPA 1L3TA 1TELA 2U2FA 3M9OB 3ZSOA 3SQ2A 2FF6A 1EAYC 2JFDA 3CDUA 2E5JA 2XMVA 1WHYA 4BC4A 3VMFB 2E2OA 5DETA 1H38A 3T1YK 2DISA 1QHTA 3NMUA 5C2CA 1Q79A 2PEHA 5DLFA 5DM6L 4A8OA 2E5IA 3JQJA 3DXMA 3Q8VA 2QGFB 2AP6A 3MEGB 4WU2A 3DDNA 1R8PA 4EIAA 4KGMA 2AJQA 3IS9A 1J5OB 4LF4K 1VQ5S 2G2ZA 2FC0A 3AOBA 1NLVA 1VRUB 2GIQA 3WEEA 5ETTA 4MO4A 3TAMB 4NLCA 3S3MA 4ATNA 4YHHK 4GO7X 2AD9A 2FVPA 1FRKA 3FRZA 5J1NA 2CJKA 4DJBA 4F0KA 1S0NA 2HG4A 1NMNA 4ZVGA 3B82A 4RW8A 2ZBRA 2JOQA 3PJXA 1KQSR 3OL6A 2RIJA 2FJEB 2EEYA 1PAEX 5H9EJ 1NH8A 5E3CA 4H4KC 4BRPA 2R7TA 2L08A 4U7UD 2MB0B 2ZOGA 4R8UA 4FCYA 4C8NA 1YJUA 2DNGA 3EY1A 2WOMB 4I1TA 3L4QA 5B0FA 2K1RA 2IA6A 4UUWA 3O9RA 3UE2A 3MN9A 3VA0A 4NLTA 5AE3A 3WC0A 2MZRA 1GH8A 3CJQA 1VK0A 3GYXB 3RGIA 5B0AA 3CMQA 4FK0A 2V2VA 4ZHRA 1U0HB 3ZTSA 2V67A 5E26A 1TUVA 4DX7A 2P5GA 1U2VB 2AJ0A 9ATCB 1FWKA 3RG6A 3VAHA 4JKHA 3R1LA 4CFAA 4BR2A 5GADP 2JLEA 2HRTA 4CLUA 2VG7B 4DR7J 3HKZD 3C3LA 3OBYA 5HRRA 2R2TA 5A2QU 2QLWA 3MEDA 1CG2A 4Z4CA 2QE5A 3PIOL 1SJ1A 2JEGA 4C6AA 2BQUA 2IJNA 2QMXA 4CZGA 4CZIA 2W9BB 4LRCA 4DCOB 2WSFC 4H0YB 1T9VA 1LFWA 1P8GA 2E8AA 4PWUA 3BUZB 2BACA 3KKRA 4J9RA 4CZHA 3BEXA 4DR1J 1ASWA 1TFWA 1T7PA 4PKHA 4IR1A 1N33F 1NGCA 2GO8A 2HNDA 1NK7A 1EKEA 3HVRA 2P9KB 3VGLA 2D9OA 1UEUA 4NLRA 1G15A 2QLFB 4DQ8A 3OUYA 1T44A 2W2NP 1VQ6S 3EO3A 4IOCL 4Z7YA 2CPFA 2CZ9A 4FWOA 3I32A 2VUGA 5B0CA 4JI1F 4RW9B 3ZC4A 2H54B 2UVWA 5L1LA 1YI2S 2Q0UA 3A1YG 2RRAA 3HD1A 4KH4A 3DMJB 4OI3A 2XQCA 2VZ9A 4PG5A 4JYAK 2V6AA 4HUGA 1K6YA 3NP5A 2R7WA 4DSEA 1VR6A 4FKYA 2QWRA 4M5MA 4FF2A 3FJ2A 2VIHA 1AUDA 2IAJB 4M5JA 5BR8J 1BI4A 4CLFA 4PG4A 1HMVB 1VDHA 3TAFA 1IKVB 3DLHA 2VQFF 3C6AA 3OS2A 2UV8A 3TNVA 3QJPA 2EG1A 4Y00A 5E7OB 4IO9L 3THYA 3EJMA 2OHDA 3PJWA 1U09A 1Q8IA 1FNMA 1VQON 3FMBA 5KOWA 5E84A 2JX2A 2F9TA 3OW2R 4JI2J 2LDIA 3TABA 2DNYA 4U8YA 3FGUA 4IYQA 1LOUA 2HQFA 2CQBA 1XMQJ 4UZCA 3ZSZA 2FJVA 4CJRA 2VFSA 3MD3A 2QWQA 3VEVA 3BBFA 3ENBA 1T9YA 3DI6B 3TJ9A 2WUSA 5HJYA 2DT9A 3EICA 2XMWA 4DB3A 4B3TJ 4R5PB 4DL7A 5AQFA 2MKJA 3P1GA 2QJ3A 5D3GA 1HBOA 3G10A 1DQAA 2ZH1A 1BWFO 4M3TA 4J2DA 1TUYA 4Y28C 1CXUA 2KZZA 2UP1A 2AW0A 1JL1A 2ROPA 4WYWA 4DG1A 1EX8A 3I8BA 2IRUA 3LPEA 2ZJRL 5BRDA 4P6QA 3FZBA 4A46A 1M1KT 1QQCA 2MGZA 4MH8A 2XEXA 1Y4ZB 2EFNA 2V50A 3KHLA 4EYIB 2RHKA 4MKAA 4EHTA 2Y3YA 1FA0A 1N52B 3VF6A 1B0TA 4JRQA 1BHNA 3NY0A 2GCFA 1F6TA 5D0EA 5DJBA 2UXBJ 4FDFA 1SKSA 1G2EA 1S6QB 3I96A 4O3QA 1UVMA 1Q0NA 4I7FB 1LAWA 2PIIA 1SJQA 4JV2A 3TO8A 4PQUB 3WNHA 2AX1A 3VQ6A 1C0FA 2NPIA 2X1AA 1YVFA 1W7AA 3FUYA 3N4PA 1RTHA 1ZM2A 2Y8YA 3ATVA 1RT7B 5GAHI 4RW4A 4ID5B 3EGVA 1U02A 4O8KA 4ECQA 3SQ4A 5CA5A 2FVRA 1N0VC 4QW9A 1KRPA 1F5BA 1N33K 2XYGB 1IKYB 1B0PA 1RGIA 5JUMA 2C22A 4LF9F 3M30A 2O1PA 4ZLJA 4BR9A 4A4JA 2OPRA 2PEBA 2HWTA 2YHXA 2VFRA 3CULA 1N5YB 1R89A 6FD1A 4NASA 2R2RA 2EG2A 4JI1K 2C2NA 1WORA 2FGOA 3BZCA 3CJTA 3EE9A 1ZBHA 4DPXA 4BRMA 3O3LA 2RNEA 4RBVA 2RDIA 2BJ1A 1Z05A 3GIJA 1QM9A 3KLHB 1QAXA 5FD1A 4M5DB 3W62A 3CCWA 3VHQA 4DS5A 2NLXA 1S72S 4NXMF 2ZM6J 3DLGA 4OYMA 1EKRA 4U6PA 3OSNA 2P9LB 3S3NA 4CK2A 1S1TA 3A3PB 3OHRA 3H5UA 3M32A 4OZ1A 2V4QA 5DDPC 1MN9A 3CPWR 3KJVA 1LW0A 3R5GA 2GELA 3MM9A 4G1QA 2VQFK 3MM6B 4B17A 4FXDA 1Z2ZA 3R8YA 4MQ3A 5GAGU 4HI1A 3H5YA 2AYGA 4C8ZA 3OYFA 4RNNA 1CEZA 4CEAA 5U47A 4CJLA 2OLWA 2VU5A 2CWXA 1HI8A 2Q97A 2QTDA 4OI4A 5KFHA 2HLTA 3PACA 4CHPA 3GL1A 1LQ9A 3TUIC 4M63C 5AQJA 3NBPA 1NPRA 2CVIA 5CZXA 1SQEA 4BRAA 2ITMA 2D1KA 4H5RA 2J9CA 3KD1E 2NRHA 4WF9L 2HURA 2IPOB 2SXLA 3ZEUA 3QZ7A 3PJ9A 1IQZA 2E5HA 3BO4A 3EEQA 3A13A 1WUUA 5AJ3J 3SI8A 2O8FB 4KKOA 4JB8B 1ATSA 3AVKA 3GWCA 3HP9A 3PYEA 4K4XA 3L3VA 2DEJA 1K8KA 2YNFA 1QTNB 2BQRA 1VI7A 2AIRB 3LDQA 5D4OA 1RA7A 4CZEA 3C94A 1CXQA 2O3DA 1RAJA 3E9PA 4LY7A 2V2ZA 5ETQA 4JI6J 5AT1B 2WTUA 6AT1B 2GA7A 2R7RA 2JDJA 1YG0A 3BQ0A 1YJRA 3N01A 2XMKA 2G8FA 2PAVA 2HBRB 4J2BA 1IBKJ 4L75A 3SZ2A 2LQ8A 3E9LA 2W25A 2DVIA 3QYYA 2FJAB 3AAQA 1IWAA 4B1ZA 4JI5F 1KR4A 2HQDA 3AGKA 3JTNA 2HRYA 3AH6A 2LQ5A 4DV3J 3H4BA 4OX9J 1NO8A 1IBCB 1JXVA 4RLEA 1YRXA 1B9DA 3K5NA 3H3NO 4KYZA 1XMOF 1C1CB 2J7WA 5T7LB 5L1KA 2HMIA 4WWSA 4LF9K 3K59A 3UN2A 3DNCA 1A5XA 2PN6A 3ZTQA 3OTBA 1PBUA 1TUGB 2DXFA 5C42A 3DXBA 1JLCA 2DY1A 3B4DA 1UPMB 1WC0A 2R7SA 4AXIA 3U1NA 4PUOB 2BEFA 4EU0A 4Q8FA 2BR0A 4P2XA 1RWVB 4HTUA 4NZ7A 1F9FA 4BC7A 2OPQA 4WJBA 2W7OA 4X4SA 1S9GB 4LIWA 3D45A 4JLHA 2JFKA 3GYNA 4UOFA 1IBLF 1NGEA 3NGTA 4DR4F 3ILIA 3NMRA 1K0TA 3KUEA 3CF5Q 3PR5B 3TVYA 1NGFA 3T1HJ 1KDNA 3CDWA 1J5EF 4NXMK 1ZOTA 3FZLA 2H1YA 2NR0A 4B1YB 4F3MA 3I0RA 1VHIA 1G99A 2P9GA 1WOOA 2KN4A 1ZBFA 5MLCQ 2OTJN 4FXWA 2GX9A 4CFBA 3I55N 4CHNA 5DQGA 2DNHA 4IH6A 1UA1A 3C6TA 2KVQE 3SCKE 3LF0A 3C15A 3OVSA 2QK9A 1NK8A 3DLLQ 1FRIA 2Y0SD 1CJVB 3BB5A 3ZZRA 1DTTA 3R5BA 1JKHB 3JSMA 5AFUH 1JXEA 2ATCB 1RYSA 4URQU 5EVZA 4XDDA 3O5TB 1X0PA 4X4QA 2BQ3A 1L3VA 2FBYA 1WF1A 3FC9A 3CCSN 4YNQA 3SUNA 3M3ZA 2HK2A 1RNHA 2M52A 3G0ZA 2I1RA 2R7UA 3Q8SB 4QIWD 1T94A 5J2NB 4FYDA 1HYSA 4X4VA 4FS1A 1X5OA 3FCHA 1YLXA 2OSQA 5IQQA 3A8KA 2ASYA 4IJNA 2Z30B 2QWOA 4UF4A 4X66F 4BC2A 1H1VA 4FZYA 2XULA 2YHBA 3I0SA 3IMQJ 1QUVA 1GMWA 4RUCA 1C0TA 4OLAA 5AQTA 1YJTA 2W6KA 5BPMA 1VHFA 4QOZB 2HGMA 2RS2A 2IVPA 2F8TA 4M3YA 2YKMB 2OYQA 1JLGB 4AHTA 3P3DA 5LM7E 1FVQA 2YNHA 1EX4A 4P71A 1O8BA 3OLAA 4AQYF 3H40A 3K8VA 2OA8A 5CYQB 1WAJA 3CG7A 2MY8A 3CJ4A 3J7AN 1RBVA 3EDRB 1HWKA 1RCHA 3HVAA 1JLAA 2FLOA 2ZNYA 2IIHA 1R8BA 3CJ7A 2DHAA 4GVMA 1X4HA 3ITHA 2F8EX 4LF5F 5KFBA 1WG5A 3GIRA 2F7TA 5L39A 1L3KA 2MSTA 4AH9A 4TVAB 1SUQB 4JI5K 2AYMA 2E1ZA 1HD1A 4DPWA 4WZQA 4E7IA 2VDHA 1NEEA 3VGTA 1FFSB 3PEJA 1R43A 1RT4A 4IOBA 2DNQA 1DEJA 2P6SA 4P2FA 1Y64A 4X64J 4BR7A 3GDQA 1XMOK 2F65A 5IOLA 4RX6A 2BABA 3DOKB 1OYEA 1DARA 2LU2A 2QWNA 3POTA 1ZM4A 1HYZA 4GVLA 3IKMA 1TKXA 5AZIB 1A5VA 4KSEB 1OVYA 2ZJQQ 3AVCA 1FX4A 4I56A 4C8LA 2D3OR 4DSKA 2HHPA 3FFIA 1R7IA 5HQMA 4A47A 4FWSA 4E7HA 4KRWA 1KQSM 4CLLA 1VAZA 4Q0BB 5E3QA 4KGKA 2VWBA 4NI2A 2W9AA 1WKLA 1HL6A 3DHWC 2VBYA 2A18A 1IBLK 4DR4K 3TWHA 2VBXA 2G8IA 3OHBA 4CM0A 4CJEA 2A1SA 1BG3A 3LP2A 2MPUA 1J5EK 3BF3A 4G65A 3SPYA 4MLHA 3H98A 5L1IA 3EPGA 4JI7J 1JL2A 4Q8EA 3RB3A 3HZEA 1WSGA 4EO8A 5C15A 1S0MA 1SC6A 3TZZA 3ICLA 2EFOA 1FE0A 4WE1B 4WQ5A 1DHMA 3MEEA 3L9ZA 2XLIA 1BA1A 3HSCA 5DM7Q 3HFZB 4P73A 3L2WA 1QAJA 2XY6A 2JEJA 4DXLA 1SB6A 2QIFA 3W63A 1XQSC 2DFEA 3KTQA 2OKQA 5F9NA 1GLBG 1NCLA 1FEEA 5AQYA 1AT1B 2KB2A 5KG1A 2G8HA 3MPVA 3QFPA 2I38A 2ZBCA 3HI9A 1VQ8N 1VQLS 3O80A 2WVDA 4HDGA 4H4KA 3G71S 1WEYA 2KFNA 4X66K 4CEBA 4JI4J 3EPIA 2KKZA 4IR9A 4C8KA 4DMNA 1LAVA 4PXCA 4DUZF 3BF4A 4FOEA 3IA0A 3QDKA 4FXVA 1B9FA 4NLBA 2HZAA 1APSA 2WW4A 3AVBA 3Q2SC 1U6BA 4EBCA 1NMEB 1FNOA 2D0OA 2O8CA 4DKWA 1VCTA 2M3DA 3QETA 4BRFA 4JV5F 5FIIA 4JK8A 3R7NB 3IAYA 4AQYK 1JJ4A 3QBCA 3QRRA 3P45B 3A5NC 4RU2A 5F0UA 2FB0A 3O5BA 4DCPB 1ACMB 1FDNA 4YDUC 5GADI 3PIPQ 2VONA 5M2PA 1GT8A 3DGVA 5DDOC 3DU5A 2L9DA 3L95X 4J9SA 4QR0A 3EWGA 3L2VA 4A62A 4QS9A 2IYGA 3C6UB 3NGUA 5RUBA 2UXDF 3W8PA 5DGAA 1FJ7A 4LF5K 3H90A 3OYKA 4FBTA 4O44A 4F4ZA 5MLCV 4CIFA 4OZNA 4O4GA 2DRAA 1UTAA 3CI5A 2NUUG 1S6OA 5G0RA 1FK9B 4WYLA 3QEVA 1AYEA 3CCJS 2Y0BB 2HLUA 1VQ7N 3QIDA 5HATA 4X65J 1N5QA 4HACA 5EWEA 3AHPA 3HFKA 2HHWA 5H9FK 1ZM3A 2HWIA 5CZ1A 4NA3A 2X7IA 1KQKA 1S76D 4FSVA 2QXLA 1MROA 1FFGB 3MM7A 3O44A 4KBIA 3J80O 5J2PB 5KI6A 4CFDA 3D6FB 2EI5A 4B9UA 2VOPA 4CNYA 3GJSB 2KLAA 4ISEA 5AQGA 2XHCA 2G9OA 4NOHA 1TK0A 2YQ0A 1UKUA 3O4QA 3L2UA 1FD2A 4J9KA 4Y65A 3AJ2A 2EBEA 4GC7A 1WOQA 2XSJB 3C19A 4ZMMA 3MURP 4OX8A 1S59A 3D0GE 2HBQB 2WVEA 3TJ8A 2P8IA 2IM2A 4TU7A 2R7XA 2RD5C 1SC3B 2MZSA 4YB5A 1Q82T 2HHQA 3IGVA 3V9ZA 4CEZA 2OFHX 4L3QA 1EJ7L 2EHGA 5A2QY 1CULB 3OSPA 3SV3A 4PY5A 3KNAA 1KKHA 2JLGA 2I7NA 2UUAJ 2I0XA 2IMWP 2GHVC 2F9DA 4FWRA 3VPZA 2ZOFA 3OV7A 1DGKN 2XYPB 1T95A 1HARA 4KV8A 2NCKL 2RH3A 1Q78A 4W4MA 2NRXA 3HZ6A 2HW3A 5CR4A 2F4FA 4FF3A 1VSLA 3ZX2A 3ZXWA 3C7NB 3LDLA 3NRBA 2WONB 3NCRA 4TQRA 3GV7B 1F9HA 1WNEA 1YJ9S 1GXTA 2ZVSA 4FM1A 3C8YA 2YQ3A 1FCAA 2F8MA 5E3AA 4CH0S 3T1AA 1FRXA 3AXMA 3BQ2A 5HROA 4DUZK 1FDDA 1D4XA 2L9WA 3CCMS 4K0KF 4K5SA 5AQOA 2OPPB 5L8RC 3BYPA 5LSOA 5K14B 3SCIE 4HUFA 1URNA 3GB0A 1TKTA 3SPZA 3JSRA 2IVNA 3FSXA 3HSGA 2V4JB 4JV5K 3GSDA 4ILMA 4ZVUB 2ZWPA 3O3FA 2L3MA 4KC5A 2YI1A 2JGUA 5EOYA 3BREA 3W2VA 3QLHA 2GGPA 4LSNA 3EGNA 2Q6BA 3BGOP 4DV5J 1K8AO 2YWWA 1QD1A 1RB0A 1L5UA 2MQMA 3I9ZA 2LCWA 4PXDA 3LDOA 4IDHA 2UXDK 4IFYA 4BRGA 3OS0A 3CPWM 4JI0F 3NNAA 3TSUA 4M5GA 4DFJA 4L73A 3HYFA 5AQLA 3GIIA 4OYWA 1TL3A 4DV6J 1FKOA 4GVEA 5IWAF 3J7ZO 4UT4A 5F8MA 2E66A 3ZZTA 1RXOB 3AO2A 1S1WB 2E5LJ 3L4IA 1UFLA 1VRQC 2H48B 3PW5A 1OSDA 3AQOA 3CD0A 5JVHL 1X9MA 3THXB 4RJVA 2ZJPL 2XMAA 1HQUA 4LSLA 3QSYB 4ZOSA 4G1PA 5THWA 1U1OA 2HNZA 3LANA 4AHUA 2DIVA 4FJXA 2E7WA 2IVOA 2OJ3A 1M90O 3EYZA 3DCAA 5A8WA 4DQRA 1QQNA 4LC9B 3CJKA 1BCOA 1RDDA 1I6JA 1WJ9A 3ENOA 1UFKA 2DPNA 1LNQA 4N8NA 4DL0C 3EUNA 4NLPA 4M7XA 2NZTA 4PQAA 1BISA 4ZHRB 2BM0A 3LDNA 4PCQA 1H7WA 2HSEB 3UD4P 1HW9A 4CD3A 1D8YA 3HSJA 2DYAA 4ZA1A 4E2FB 1IJJA 4KB0A 5HBMA 3MCNA 4M3WA 4NLSA 3O8MA 3MEDB 3NHGA 4UW2A 1ZBUA 4BC9A 1BUXA 3TX8A 5M2RA 1F5CA 1QTMA 4M5LA 4N47A 4C4WA 4V1Ak 1UAXA 1TV6A 4WFBL 2WCXA 2RDJA 3D2FA 5BYRA 4M63A 2E2NA 2AEFA 3ISND 1VIOA 1RHRB 2FGCA 2OPSB 2Z4PA 3OT9A 3DXKB 2R8GA 2M2BA 3CSKA 7FDRA 1QLNA 2HNDB 4AT1B 2FYXA 4M42A 2VG6A 1X9SA 1EB0A 3ZX0A 4DR5F 4YY3F 4ED2A 4KTZA 4KHPJ 4LQ3A 4FO0A 3P6YC 4NX9A 2GVDB 3RW6A 3TVZA 2YVSA 1UPPA 1N32J 2DY4A 4UY8T 3M2UB 3PIOQ 1E6VB 3KFWX 4JD2A 2HOEA 2JVRA 3IXQA 4E1NA 1VSJA 2R4FA 4C9DA 1OYDA 3EZOA 5SUHA 4NLGA 5E33A 1RT6A 1KS2A 2FIUA 3QT5A 2ZE2B 3DFEA 4NYOA 4K0KK 5L1JA 2FVCA 1ESVA 4Y2IA 1MWQA 4E98A 3MR5A 3FGVA 2N82B 4ECUA 4CYUB 3SMPA 1VQ6N 5KGXA 2DNKA 2WK4A 4NO7A 1VBYA 4QU6A 3DXSX 2GWJA 2MKHA 3R8EA 4CJ5A 3KMQA 3CERA 1BUPA 1HNIA 3MR3A 1CJKA 1HNWF 1YI2N 3QINA 3OVBA 5A8KA 3THYB 4WTOB 1IR1A 1BY9A 1U1QA 2HSTA 2GZOA 2E9TA 3T5HA 3BR9A 5J2QB 5KT6A 2ASJA 1NB2A 4B3SF 4K4ZA 5I42A 3SJJA 2QG9B 1NZAA 3L0QA 4AHRA 5DQHA 3TUZC 2RE2A 1GNKA 4JI0K 3M8QA 2DXEA 1TK5A 2CJAA 4MYTA 1JK9B 3CIMA 2EC2A 2IVYA 4QWEA 4Q45A 2G8VA 3Q0AA 5IWAK 3LALA 1Q9XA 5F8IA 1D8ZA 4ZVTB 4RBTA 4NCAA 1B0VA 2HVIA 3A8EA 3FZ2A 2YCHA 5A0YB 3K5OA 2E20A 5DS7A 1OH5A 3VCDA 3DRRB 4BG9A 3WXMB 4WP9A 4BE2A 1HWIA 2V9WA 2VL1A 3RRGA 1D0EA 2IDLA 3CMES 4NRTA 2D0PA 4NEZA 4E7JA 2WVFA 5F0XA 1K73O 1S4EA 1RWUA 2A3ZA 3PCOB 2J6UA 5DK5A 2P9PB 2FLNA 3J7A1 3C65A 3ONQA 4ILJA 3H6EA 2ASLA 1HIYA 3MDFA 2ZNZA 3E66A 1O0PA 4Y6IA 3OYCA 4IRCA 3MN6A 2CNNB 4DS4A 1O6XA 3MR7A 3QT8A 1H73A 2HGNA 2WBNA 3WXLA 1R0AB 4A5BA 3MPWA 3CIPA 4BROA 3QFUA 5KFRA 1B3TA 4JBCA 3CQYA 3MEGA 4W5RA 3UPFA 4O8UA 1J5OA 4B1WB 4WIQA 4U9RA 1WSRA 4NB4A 4XEIA 2EX3A 2XZTB 1VRUA 1YF5L 3MX2A 3SCJE 4JKGB 4RL1A 3TAMA 1R59O 1ASUA 4CLZA 3U6FA 5A76A 2VJVA 4YDDB 2ZJRQ 4K4WA 2R8HA 4HT7A 1QS4A 3VF2A 3ET6A 1A7GE 4QYZK 3L09A 3Q8PB 3UW1A 4USIA 3OFEA 3Q89A 4QIEA 4MIAA 2XHWA 4DR5K 4YY3K 2Q36A 3FR0A 1NJIT 2V8HA 2FXUA 3QZ8A 2XMTA 1SC1B 2MYFA 2QYCA 4PABA 3G86A 1JLQB 1Y0HA 3ID8A 2ABYA 1ZA1B 4NCBA 1U0HA 4LFBF 4ZVEA 1WN7A 3MPYA 4OI6A 4TSXA 4KI4A 3DM2B 4WK1A 4DFPA 2G0IA 2CPDA 3RBEA 2IJFA 2VPZB 3DLGB 2GQQA 5C25A 3LGHA 4BC3A 2XS5A 2OEKA 5C2FA 1IG9A 3MM9B 2W9BA 2D0AA 4G1QB 2UXCF 2YWHA 1HNWK 2B4PA 3ZETB 4HT5A 2Q79A 2HBZB 2HFUA 2P9EA 3O6WA 1UJ5A 1SZ2A 3VQ7A 2E9RX 4I64A 1TU0B 1QSYA 1S72N 3H5SA 3SAGA 5J1EA 2VD3A 3C95A 4M3UA 4B3SK 4CWBA 3MR6A 4PKIA 5LMUJ 4IH7A 4CI6A 1FXLA 2ZC4A 1YVUA 3JSBA 4NXNF 3DLRA 4V19X 4ZJLA 4YB1P 3AOAA 1XC3A 1T3NA 2DHSA 4DV7F 2ATQA 4RW9A 1OS5A 3CCQS 5E3RA 4JI8J 5JMVA 3R2CJ 2PYLA 1E6YB