4G1QA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with rilpivirine (tmc278, edurant), a non-nucleoside rt-inhibiting drug
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
556
structure length
556
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Snapshot of the equilibrium dynamics of a drug bound to HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/inhibitor
total genus 157
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4g1qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4g1qA05
1S1TB 5JXSA 1FKOB 4NLOA 3RMAA 4DL4A 4QAGA 1RTIB 2VWJA 1ZTTA 3QZ7A 1TKZB 4O44B 4Q45A 3M9MB 1LWFB 3O3FA 1HYVA 1TKTB 3C6TB 4O5BA 4E89A 2HMIB 2I5JA 4LQ3A 3ZCMA 2OPRA 2B6AB 4Z4EA 3QLHA 4GW6A 1WSIA 1JLAA 5C24A 3HYFA 1RILA 1KFDA 1JLCB 4M94A 3OYMA 5K14A 4O3SA 3DI6A 1JLQA 1BISA 3SFGA 5DLFA 1J53A 1S1XA 3TAQA 3QESA 3OYCA 2FVRA 2CKWA 4DSJA 2FJXA 3CO9A 2ALZA 5CYQB 3H4BA 3OYAA 1TKDA 4QWEA 4E0DA 2Z1GA 2DFFA 3OS2A 4LSLB 1S49A 4Q43A 4CJSA 4BE0A 1FXXA 3IRXA 3I5CA 4FW2A 3DYAA 3V1OA 4C8LA 4C8OA 4NLTA 3OYNA 2G8UA 1RT2B 1UWBB 2BE2A 2ZD1B 1VSFA 4CEDA 2D3UA 3KHLA 4CJ3A 1S1VA 3CQ8A 2V0NA 3HSTB 1NK4A 4J9QA 1S1WB 3DLRA 4CE9A 4DL6A 4AHUA 4B8AB 4RNOA 4QWAA 2DFHA 2R2UA 3N6NA 4KE5A 1EP4A 4TQRA 4LSNB 4DL5A 2IAJA 3M9OB 2W7OA 1VSLA 2KZZA 2RDIA 3FFIB 2Z1JA 3BSNA 3ZT0A 4Q0BA 4O3NA 4PY5A 3PX6A 3IG1B 4KHWA 3SZ2A 3PW0A 3NKYA 3ZSWA 5J2MB 5D3GB 3MEGB 3RR7A 1VRUB 2ZQBA 4CF2A 3CDEA 3KK1A 4FJ9A 1JLFB 4IH5A 4KAZA 1IKVA 3U3YA 3KLIA 3NH1A 4FZXC 3OYGA 1JKHB 3DLEA 3VQSA 1RDRA 4RW6B 4FCYA 1EX4A 1RDBA 1U49A 1NK9A 4WE1B 5L1IA 3BGRB 3QEXA 1N56A 1N6QB 2XY7A 4BACA 3V9WA 2F8SA 1C0TB 2YNIA 4K4XA 2ATQA 2Y1JA 2ILZA 4DTUA 4E7KA 3THVA 5DG9A 4AHSA 4CEOA 1C1BB 5F9LA 3VQCA 3KK2B 3T3FA 2HNZA 3S3MA 3AVNA 4I7FA 1HYZA 1RA6A 4ECSA 3NL0A 1REVB 3TWHA 3V81A 4BWMA 3MR2A 1DTQB 3PY8A 4EZ9A 4KFBB 3CJ4A 2HHUA 1BQMB 3TR8A 1R0AB 4DTNA 4FLWA 4FJLA 1QSLA 3HO1A 3BJYA 2RF2B 4HUEA 5DK5A 1U09A 1HQEB 1KVBA 4M3RA 5DG8A 3HVRA 3DDKA 3D28A 2VWKA 3HM9A 2JC0A 4FLZA 2O4IA 2Z1IA 1SUQB 4PUOB 3S3NA 4JRQA 3UDLA 1IKYB 4DQPA 4IH7A 3T5HA 3H59A 4DTPA 4M3TA 2Z1HA 3AVLA 1JIHA 4CF1A 4R5PA 4Q44A 1S5JA 1GX6A 4HTUA 4OKKA 1WLJA 4CGDA 3BSOA 4E1NA 5KFYA 3V9UA 4Z4GA 3CJ5A 1Q8IA 4CERA 1RT1A 4N76A 2EX3A 4H4MA 3IN5A 3I0RB 3PZPA 3HKWA 5KGWA 3KLHB 2IMWP 4DS4A 3RMDA 1S6QA 3LP1B 4FW1A 4C8NA 1VSJA 4PWDB 3VQ7A 1ZTWA 4QW9A 4FLVA 3EPIA 4TXSA 2KW4A 2YNGB 3C6UA 3VQ8A 1TV6A 1HRHA 1NK7A 3FQKA 3CFRA 4ELVA 3DRRA 4Q5VA 1JXBA 3OY9A 2WCXA 3Q8RB 1F21A 1DLOA 4M3UA 2YHBA 2PYJA 4KHNA 1EETA 3DLGB 4YR0A 3GIKA 3QNNA 2D0BA 4DL7A 2XY8A 2J6TA 3PVXA 4O3PA 2HHXA 4I9LA 5F8JA 2R2RA 4K4YA 3QGGA 1JL2A 4HUFA 5KRSA 1RT6B 2XI3A 4IR1A 1TL1B 4KO0B 4RW8A 1KHWA 2QKKA 4NYFA 1SH3A 4CJRA 1KTQA 3OYEA 3PX4A 1J5OB 3DOKA 1S1UB 3V6HA 1WSFA 4MK7A 3NH0A 3DM2B 1JLBA 4CJPA 1HYSA 5KI6A 1T05A 2V4RA 2ILYA 5HLFB 3TQ1A 3JSMB 3K5OA 2R8HA 2IM1A 2DY4A 5KT3A 4OLBA 5F8HA 2XY5A 5KG5A 4AHRA 3V9ZA 4ED1A 1BI4A 1J9AA 3TAMA 2HW3A 3NF8A 3OYFA 1NHUA 1QAIA 3C95A 5F8MA 4F4KA 2C2RA 5KFNA 3PO5A 4TN2A 3AVHA 4ZVGA 2R8GA 1KCFA 4J9KA 3LP0A 3MXMA 1IKWA 1HNVB 1KSPA 5J2QA 1RBRA 4W5TA 3SQ4A 1SKRA 4CJ4A 1S0OA 1TVRA 4RG8A 2YNHA 4F3OA 2VG6A 5KG2A 5DLGA 2X74A 4U6PA 4RW4A 1TK8A 4YNQA 3BR9A 4TLRA 1A5VA 3VQ5A 1T03A 2I5JB 4E7LA 2OPRB 1NKBA 2HNDB 5KFEA 3LAMA 1CZ9A 1BL3A 4J9LA 4O4GA 2PY5A 5KFOA 4BE2A 1BIZA 2ZKUA 4IRCA 3K5LA 2XY6A 4W5QA 2IM0A 5K14B 4WXWA 1S1XB 4ZTFA 3UQSA 1VSDA 3RR8A 5JS1A 1S0MA 1S10A 5KFZA 4DQRA 4EO8A 1WAFA 4O0JA 2FVCA 4NCGA 4CJ5A 3OLAA 4CIGA 1LWCA 1KLMA 3DYAB 1VSEA 3VQEA 3SQ0A 2YKMA 3KTQA 3PR5B 2RN2A 1RT5B 2ASJA 2BE2B 2IGIA 2HNYA 1JLEB 3ITHB 3TARA 1XWLA 4KHQA 2YV0X 1LWEB 3RRGA 2D5RA 1NJYA 4ZVEA 4J9NA 1QTMA 4CHQA 3V6DA 4JS4A 1EP4B 2IAJB 5KT5A 5EWEA 3OJSA 2W9CA 4ZP6A 1KVCA 1CZBA 3K57A 3NF6A 2FLNA 3OYIA 2HHWA 3HP9A 2R2TA 4KHRA 4I2PB 2GIRA 4B9UA 4K8ZA 3LAKA 3HVWA 5KT6A 2OPPA 4ZP7A 3HXMA 2JLEA 5KFDA 3OJUA 4Z4FA 4J2AA 4BDZA 1CXQA 4DTMA 3DLKB 2WONA 5CZ1A 3MAQA 2AQ4A 1SH0A 1SH2A 4CEAA 2XI2A 4R0EA 4AH9A 3IS9B 4OPKA 1NK8A 3OYLA 2D0AA 5J2NA 4DTRA 4CCHA 3FRZA 5KFQA 4IR9A 3EZ5A 4FK4A 3LPTA 2J6SA 2GUIA 1SV5A 1XI1A 2XC9A 4YMEA 3FDSA 3TAGA 5I42A 4F4XA 3T5LA 2YNIB 4QW8A 4FJHA 1WNSA 4J9MA 4GC6A 3C94A 1BQNA 4JLHA 3IAYA 4NLXA 3H5YA 2V4QA 2HNZB 1BCOA 3MEEA 2YKNB 4ED7A 3KLGA 4KI4A 2FVPA 3SUPA 3I0SA 2C28A 4CJEA 4DF4A 3GILA 1NOZA 4K50A 5HP1A 1G15A 4KTQA 3SI6A 4LH5A 5I3UB 1RTDA 3NDKA 2BANA 3GV5B 1IO2A 5T14A 4K4UA 3HK2A 1FKPB 2D3ZA 4ICLA 3LP2B 4N56A 3NGZA 2AU0A 2QV6A 3NMAA 3RWUA 3PW7A 4TY9A 3NBPA 4IH6A 1NKCA 1A5WA 3Q8PB 1RT3A 3OYKA 4WZMA 3KJVA 1K1QA 4NYNA 4BDPA 3DMJA 4DQQA 4MFBA 1RYSA 3HVTA 4IFVB 2WTFA 5EUHA 2DFEA 2PYLA 5KT7A 3SUNA 3WNEA 3QINA 3OL7A 4Q8FA 3LWMA 2G8FA 3Q8SB 4CECA 3DRSA 3BSCA 4ZP8A 2PZSA 1LW0B 3AVAA 1I3AA 3AA3A 3RB0A 1X9WA 1ZBUA 2E4LA 4LY7A 1VRTA 3RMBA 4QWDA 3V4IA 1N48A 4FJIA 1S6QB 3ZT3A 5KG1A 4F2SA 1K6YA 4XO0A 1D1UA 2IC3B 3HP6A 3D45A 4I2QA 3QYYA 5J1EA 4WZQA 3QGIA 2WOMA 3ZT1A 3PUFA 1TV6B 1QE1B 3JYTA 3M8PA 3DRRB 2P51A 1L3UA 2FBYA 5L1KA 4ED6A 1W9HA 2AGPA 4TY8B 3D0PA 1S9GB 3OSNA 5J2PA 3CM6A 5EWFA 2GIQA 2JEJA 3P5JA 4DSEA 3BSAA 1Z25A 4RNNA 3VQPA 3K59A 4H4OB 3DOLB 1LW2A 3HJFA 2G8IA 4JV1A 4WFXA 4F3TA 3KLEA 1YTAA 1IH7A 2FVSA 4I9QA 4WXOA 1TL3A 4AHCA 4CK3A 2VG7A 4NYZA 2FLLA 4KV8B 1C0UA 1U45A 1XR6A 2Q3SA 4WFZA 4Q8EA 5KG0A 2X78A 4YR3A 1RT4A 1JLBB 5DQHA 4TYAA 1HYSB 4ZHRA 5FDLA 4J9SA 1S97A 4ED8A 3G0ZA 2G8WA 1HNIB 3CYMA 3GIMA 3ISND 4CJKA 4DFKA 4Y3CA 2OA8A 4EBDA 4HVJA 4WFYA 3CDUA 3M9NB 3DLHA 1TK5A 2ATLA 4EP4A 3KLFA 3CJ2A 4IG0B 2JEIA 4J2EA 4F4ZA 1ZBHA 1LV5A 1TGOA 1HARA 3BREA 3KIOA 1IKWB 2X6SA 2KFZA 1ASWA 1K1SA 3I5AA 4M95A 1RBTA 1KHVA 4FJ5A 4LD0A 3V1RA 3BDPA 3TANA 3SV3A 1TVRB 5KFUA 1IM4A 4EBCA 2A1RA 3P1GA 4NLRA 3QIOA 1JL1A 2YNFA 1UOCA 4KHYA 3MECB 1T03B 3O4QA 4ID5A 2B5JB 4B3OA 1SL1A 2BR0A 2VA3A 5E41A 3CM5A 4FJJA 4JS5A 4KKOA 4O4GB 1TKXA 4Y1CA 4RW7A 1IKXA 4CFAA 3VN5A 4YQWA 3KMQA 2AGOA 4BDYA 2RKIB 3SNNA 4M41A 4M3YA 4NLVA 4GVMA 3RBDA 2HHVA 4FJMA 4URGA 3ZSVA 2VG5A 5HROB 4NLGA 4FZYA 2F8TA 3D5MA 1WNEA 1RA7A 4IOBA 1MU2B 2GC8A 1D9FA 1HQUA 5F8NA 4K8XA 1LWCB 4RW9B 2UVRA 2F96A 4Y1DA 4ECRA 1KLMB 3G86A 3PX0A 1HMVA 1VSHA 2YKMB 4CGJA 5JS2A 2FBTA 3MXJA 2HNYB 3KKRA 4G1QA 2XHBA 5CYMA 4JUZA 4DFJA 4Y2AA 3H4DA 2ZE2B 2JEFA 3KMSA 3HPOA 1I39A 1CXUA 4EZ6A 2D7SA 3V6DB 5HRPA 2W42A 4FS2A 3DRPA 4G3IA 4F8RA 4FLTA 1SKWA 3SQ2A 4Z4IA 4E19A 4FLXA 3H08A 3E01B 2OPSA 4IFYB 4TSXA 2ASLA 1S1TA 1T7PA 3ASMA 4B9LA 1FKOA 2E9ZA 3RB3A 3H5SA 4NLDA 4MH8A 3RAQA 1N5YB 5DGBA 3SPYA 5CZ2A 2W8LA 4CEBA 3LP3A 1L3VA 2HMIA 2C2EA 4CGFA 2WONB 4RUAA 3EY1A 5KFPA 1VSKA 3MEDB 4ELTA 3PJWA 1Q9YA 2HWHA 4JRPA 4IQXA 1LAWA 1JLCA 3SUOA 4IDKA 4RNHA 4FJ7A 4QWCA 1D0EA 1S9FA 3B6OA 4F4WA 2VA2A 4YFUA 1SKSA 1FK9A 3SPZA 1GOAA 2A1SA 4MK8A 1TK0A 4LSLA 3VQQA 1BIUA 4B9SA 2FBXA 1ITGA 2FC0A 3T5KA 3QO9A 3CJ0A 2IDOA 2B4JA 1UWBA 2W7PA 3KLGB 1B9FA 2ZD1A 5DGAA 2OYQA 3TAEA 3NAEA 4Z0UA 1NK0A 3CIZA 2R8JA 3FSIA 4R8UA 5KT4A 4F50A 3SYZA 4DFMA 1S1WA 4L8RB 2AJQA 4HCBA 1S4FA 4O0IA 3G6YA 1RTDB 2BANB 4URSA 4Z4CA 1T94A 4LSNA 4DSIA 4FVMA 4ICLB 3FFIA 4O3RA 3KOAA 4FM0A 4GMJB 4DLEA 3O3GA 3IG1A 4GC7A 1BGXT 3LZIA 5J2MA 1Z26A 3ZSQA 3OL9A 4DG1A 3KJVB 5D3GA 3ZSXA 1VRUA 5HBMB 2B43A 2JC1A 4CGHA 3MR3A 2OPQA 4M42A 2V9WA 1C0MA 1JLFA 4ZPDA 4NLUA 4ZPBA 4RNMA 4OGCA 2LSNA 1XR5A 1JKHA 4KRFA 4CJVA 3QGHA 1B9DA 1S9EA 3VQAA 4B9VA 4ED0A 5KFHA 3QLHB 4HKQA 4CEZA 1JLAB 5C24B 5KG4A 4NRTA 2IM3A 1NNDA 4EO6A 3GIIA 2E6LA 5F8IA 5J1EB 2FJWA 2UVWA 1QSSA 3DI6B 1JLQB 1XHXA 2WOMB 1A5XA 4J9OA 1UAXA 1C1BA 3LPUA 3KK2A 3NH2A 1Q9XA 4EEYA 3NF7A 4EYIB 4Z4HA 3UR0A 2KZMA 1REVA 4NLYA 3IRXB 3GV7B 1TQLA 4CGGA 4KFBA 4CJUA 2O4GA 4RUCA 3EPGA 2BQRA 4B9NA 4ZP9A 1LW2B 2W9AA 1DTTA 3SFUA 2XGQA 3OHBA 2EHGA 5KFWA 3MFHA 4CIFA 2RF2A 4NLSA 1JXLA 1UA0A 4KREA 1RDDA 4ZVFA 3U6FA 3MR6A 4E1MA 4ED3A 1S1VB 4UQGA 4JV2A 1HQEA 4QWBA 4FJNA 3PW2A 1YVUA 3L3VA 2BDPA 5KG7A 1WSGA 3L2RA 3PR4A 1SUQA 2HHTA 1RT4B 5KFIA 3VA3A 1D8YA 4CJLA 4ZHRB 4FLYA 4ELUA 3AO3A 2CJQA 2R7YA 4Q0BB 3ICLA 5KFBA 4PA1A 4M3WA 3S9HA 4B9MA 3KHGA 1RTHA 1VSIA 3KK1B 2WB4A 3KLFB 2IA6A 3PO4A 2GV9A 3GIJA 4IRDA 1IKVB 3I0RA 4QCLA 4PQUA 1NJXA 3KLIB 2HVIA 3M8RA 3DLEB 3LP1A 1NJZA 5EDWA 4PWDA 4FM1A 3M8QA 2XWYA 4MK9A 4FS1A 5SWMA 5L1LA 2BRLA 5C42A 2UVVA 2RPIA 3OYJA 2AWZA 4M3XA 4ECZA 4TYBA 2YNFB 3KHHA 2IOCA 1RBUA 2HAIA 4B8CA 4AHTA 3KK3A 1KRPA 3DLGA 4B3OB 4LH4A 4NCAA 1D5AA 5KG6A 3U3GA 4ZPAA 4ECVA 3TAPA 4KKOB 1QHTA 4I7FB 1TKXB 1IKXB 5HRNA 3V81B 3QEPA 1VK0A 2GBZA 3TAFA 3PHEA 4J2DA 3VQDA 2XRIA 1RT6A 3AA5X 2AGQA 4KO0A 3RB6A 3SCXA 3AA4A 3MFIA 3AO2A 4KTZA 3T1AA 4FJXA 1S0NA 4QOZB 1J5OA 1L3SA 3DM2A 4HCCA 4MQ3A 3TABA 3VQ6A 4E7HA 4DL3A 3A2FA 1NKEA 1HMVB 3G6XA 3L2WA 4WYLA 3MF5A 4DSKA 4G1QB 4URQU 4B9TA 5CYMB 1RBSA 1X9MA 4QPXA 4K4ZA 3TVKA 3RB4A 4R5PB 4KB1A 3H2LA 5KFVA 4E7JA 3H5UA 3OLBA 5F8GA 2DTUA 3OL6A 4DWIA 4DU4A 4ID1A 3CFPA 2ITGA 3UPFA 4CF0A 2HHQA 1RT1B 3CDWA 3I8DA 1JLGA 3KHRA 5DQIA 4H4MB 4DTJA 4FBUA 4MKAA 2AX1A 3SI8A 4K4TA 1S48A 4K4VA 3AVIA 2DPIA 3LZJA 3AVCA 3RTVA 4BWJA 5KFRA 3AVBA 1RDCA 4ZTJA 4DTXA 4F4YA 3C6UB 5FRMA 5T7BA 3AVMA 4OKJA 2HNDA 1U47A 3VA0A 1DLOB 4ZVHA 2R8IA 2KQ2A 4XPEA 3QIPA 4O3QA 4W5NA 4CK2A 3IGNA 4IRKA 1EETB 2QKBA 4IDKB 2P5OA 2JEGA 2G8KA 3N6LA 1IG9A 4IG3A 4IKAA 5DG7A 5KFXA 1FK9B 5EWGA 3AO1A 1EKEA 2F8EX 3BQ1A 1GOBA 3CFOA 3NFAA 1WSJA 5KFAA 4ZPCA 4RW8B 4HHTA 4FK0A 1JX4A 2O5DA 5EU7A 3HPHA 2OZSA 1BHLA 3SJJA 1S6PA 3QO9B 3DOKB 4N41A 2RDJA 3E51A 4N5SA 2AX0A 4AHVA 3AO5A 1RT5A 3AVGA 4J9PA 3KKSA 1JLEA 3ITHA 2W9BA 1T05B 4X2BA 4OGEA 4EP5A 4R8UB 1B92A 1LWEA 2J6UA 3VQ9A 1TAQA 4DTSA 1BI4B 4CF8A 3TAMB 3V6JA 1T8EA 3O4NA 2QXFA 3K5MA 3CG7A 1XR7A 4KSEB 1ZBFA 5JUMA 3NGIA 2QK9A 4DEZA 4Y34A 4OL8A 4KTWA 4I2PA 3LP0B 4DG1B 1Y97A 3VQ4A 1YVFA 5J2QB 1OS5A 2WK4A 2W8KA 1WSHA 3OL8A 5HRRA 2OPQB 1NHVA 1T3NA 3QETA 1QAJA 3ZSZA 2YNHB 3P83D 2VG6B 5KT2A 3DLKA 1TP7A 4KHSA 3AV9A 5FRNA 4RW4B 2BRKA 3FQLA 4FJ8A 1S9EB 3IS9A 4CHPA 2DPJA 4ECXA 5SZTA 4MIAA 1RT7A 3TI0A 4XPCA 2D0CA 4O55A 2JGUA 1RDAA 3AVJA 4HUGA 4XIUA 4KB7A 1C2PA 2IJFA 1RTJA 1HPZA 4H54A 4CHZA 1RYRA 2FVQA 3QEWA 2XO7A 4DSLA 2E6MA 3HVAA 2X6NA 4BE1A 4KI6A 4MIBA 5C25A 1Z4UA 3GYNA 3ZSYA 5CY4A 2YKNA 4DQSA 1ZBIA 1VSMA 4OLAA 3HHKA 4NCGB 1HJRA 4O3OA 4FXDA 2R2SA 1RAJA 4IKFA 4M45A 3I5BA 1QUVA 5FROA 1DTTB 4ECWA 3WNGA 3L2UA 2OH2A 5KFGA 1C1CA 1SL2A 3PW4A 4LQ9A 5I3UA 4NLQA 4CHYA 1FKPA 3SQ1A 3S3OA 3LP2A 3OYDA 2YHAA 4CK1A 1XHZA 3F73A 1BCMA 1CLQA 1RBVA 2WHOA 2BGGA 4FM2A 4HYKA 4CEEA 3HT3A 1U48A 4CF9A 2HHSA 1RNHA 2W9CB 4CEFA 2HB5A 2C22A 4IFVA 1KLNA 1RTIA 5KRTA 1TKZA 4O44A 4DTOA 1RTHB 1LWFA 5KFFA 1TKTA 2OPPB 3C6TA 1LW0A 3MR5A 4M3ZA 2BQUA 1X1PA 4OPJA 3LALA 4NCBA 2B6AA 4PQUB 4ECQA 4F2RA 3UIQA 3V9XA 4K4SA 3AVKA 3RRHA 1WSEA 1ZBLA 2IC3A 4AILC 3M8QB 3V1QA 5F8LA 5J2NB 3ZSOA 3K2PA 3RMCA 1SL0A 3QEIA 1QE1A 4OJRA 4U7CA 1QQCA 1CSJA 1SV5B 3L2QA 5C42B 5I42B 4EYHB 5CYQA 5KG3A 2OZMA 4TY8A 1S9GA 4IBNA 2XGPA 1BQNB 3KK3B 1GX5A 4FZZA 3CVKA 4EBEA 4J2BA 3MEEB 4H4OA 2P1JA 3N6MA 3DOLA 1RT2A 4FK2A 2HVHA 1U4BA 3OS0A 3I0SB 3QERA 3SUQA 2Y1IA 3LDSA 3ZT2A 3ULDA 2I1RA 3K58A 3KLVA 3DLBA 4YP3A 4O4RA 2XCPA 3QNOA 3AO4A 4TQSA 5HP1B 4KV8A 5KFSA 1JXEA 4DU3A 3OHAA 3PJXA 2UUTA 1D9DA 3EZUA 5L9XA 5KFCA 3QEVA 3KD1E 4CFDA 1HNIA 3NE6A 2G8VA 4ZMMA 4NLWA 3NBPB 4CIEA 4E7IA 1EXQA 4KBIA 1RT3B 5KFLA 5HRSA 3OYBA 2ASDA 2P5GA 4NRUA 4E3SA 2R8KA 3MEGA 4JV0A 4CEQA 4FJKA 3L3UA 4H8KA 3DMJB 4MFBB 3HVTB 4IG0A 2XCAA 4DL2A 2EC0A 2E9TA 4CJFA 1O1WA 4CJWA 3DRSB 3OS1A 1L5UA 1JLGB 4RW6A 1VRTB 2BQ3A 1J54A 1WN7A 3V9SA 2UVUA 3V4IB 4WYWA 4WE1A 4CJQA 3BGRA 3MTKA 1N6QA 3H5XA 4I2QB 3GV8B 1I6JA 1C0TA 4J9RA 3MECA 4MKBA 3JYTB 2UUWA 5KFMA 3M8PB 3RAXA 3ALYA 3L8BA 2B5JA 4ECTA 4DSFA 3NCIA 3SV4A 3QIPB 4B08A 3K5NA 4YR2A 5J2PB 1DTQA 3OVNA 4CGIA 4KHMA 3QIDA 2RKIA 1W25A 4ED2A 1BQMA 1TAUA 3KNAA 2FJVA 1R0AA 4RU9A 4IG3B 1RCHA 5KFTA 4OVLA 3WNHA 5HROA 3KLEB 1U04A 4DMNA 3KD5E 5L1JA 4DS5A 1MU2A 1WAJA 4RZRA 1TL3B 4RW9A 3M8SA 2VG7B 4FLUA 4ECYA 3QZ8A 1C0UB 1S6PB 4PUOA 1KVAA 3AVFA 1IKYA 3AA2A 2IM2A 5FDLB 2W9BB 2FBVA 2C2DA 3ZSRA 4DFPA 3LANA 1ZYQA 2QE5A 2ZE2A 3T19A 5KFKA 3O3HA 1NJWA 3LWLA 4FBTA 3NGDA 4CESA 3H98A 1L3TA 2IJNA 3EYZA 3V6KA 2FLPA 4FYDA 4N47A 3Q8QB 3E01A 2G8HA 4IFYA 3CJ3A 5F9NA 2E9RX 3KLHA 4DLGA 4KPYA 1N5YA 1UA1A 1NK6A 3VQBA 2KFNA 5KTQA 2YNGA 3NGYA 3ISNC 4OKEA 1QSYA 2WRMA 5DQGA 3MEDA 1ASVA 4CHNA 4ID5B 3B6PA 1NOYA 3PW5A 4CJTA 3F9KA 1RT7B 3BQ2A 4RW7B 2D41A 3H40A 4CHOA 3RBEA 3BQ0A 4K4WA 3NF9A 1RTJB 1HPZB 2IS3A 3G10A 3CWJA 1YTUA 1N4LA 1TL1A 4C8MA 1ASUA 4DF8A 2VG5B 4CFCA 4W5RA 4C8KA 5C25B 3OSPA 4W5OA 3T5JA 1S1UA 1XC9A 1HQUB 3IGVA 1C1AA 3ZT4A 4KB0A 1MMLA 1W0HA 5C5JA 5KGXA 5HLFA 3JSMA 4NZ0A 4DQIA 3L2VA 3NHGA 1KFSA 4FJGA 1NK5A 2ETJA 1LAVA 3G6VA 1C1CB 4Y2CA 2NUBA 4KAIA 3WNFA 3HL8A 4ECUA 1C6VA 3GQCA 3PV8A 4DU1A 1X9SA 1QS4A 3HPGA 2IBKA 3NAIA 3OYHA 5DMRA 3DRPB 4KHUA 1ZETA 5KFJA 2HWIA 1YT3A 1GOCA 4CFBA 4RNFA 3MXIA 4NLPA 1HNVA 3NAHA 2OPSB 5HBMA 2KTQA
chains in the Genus database with same CATH superfamily
1S1TB 1FKOB 3RMAA 2R9LA 2VWJA 3TX0A 3CETA 1ZTTA 1MWYA 2HBYB 3KUHA 4O44B 4Q45A 1LWFB 3O3FA 1TKTB 4ETXA 3BO3A 3ZCMA 2FLOA 2QW9A 1WB9A 4CZMA 1YHQS 4PXCA 1WSIA 4JN4A 4KHPJ 1NNEA 1ICEB 1U0SA 1CQNA 4M94A 3UCZP 3OYMA 3CE8A 2RJZA 4LF4J 2XS2A 3SFGA 1J53A 4DPXA 3QESA 1HHQA 2GJFA 5TKYA 2FVRA 4GKJJ 3EGZA 2VFTA 1T9XA 1UZDA 3BPSP 1XMBA 3OYAA 1TKDA 2FF6A 4QWEA 3OS2A 4LSLB 4A61A 4EMDA 1OJ4A 3R6GB 4CJSA 1PJ7A 2L08A 3I5CA 5HO4A 4C3KA 3R1LA 2KG0A 2IBOA 5CZVA 1VQ9N 2M8DB 4NLTA 2G8UA 4OZ1A 3SBGA 4WBFA 1N33J 3NGKA 4CEDA 5D8HB 2ZH6A 2QWMA 3K89A 1S1VA 4OJHA 4LUBA 4G65A 1S1WB 1YX2A 3ID8A 2QA4G 3ULEB 2VBXA 3IXQA 3N6NA 4KE5A 4TQRA 2DNQA 4LSNB 3M9OB 5LMNF 2W7OA 1YZ6A 3AY0A 2UYTA 3PCOB 3MD1A 2QFJA 3PX6A 3FRYA 4KHWA 3SZ2A 3BN4A 3EX7B 3MCOA 4M8LA 1F9EB 3A5LC 3T1YK 3CD6S 2NRTA 1T9UA 4CF2A 3KK1A 1KONA 1WKJA 3JSBA 3I9ZA 3K0JA 3T1YJ 3TVZA 1IVZA 4IH5A 1GNKA 3U3YA 3PIOL 4O23A 1JKHB 3DLEA 1GXUA 5U47A 1NZ8A 2HRTA 1QQMA 3W7BA 2RRBA 3OTEA 3T9ZA 2MY7A 1WOOA 1YTYA 2UUBK 1N56A 1N6QB 5L46A 2XY7A 3J7ZT 3TUPA 4BACA 2YQ1A 2RILA 4E7KA 1RLDA 4AHSA 3VQCA 5LMUK 1NGGA 2YWEA 2HK2A 3D6HB 3L7UA 3MTJA 1RA6A 2Y1RI 1WHXA 1YJNS 3TR8A 1QQOA 1YJ9S 1WC4A 3QFUA 2UP1A 3MN7A 2UV8G 3FZMA 4A62A 1R43A 3FZLA 3J7ZO 4YDDB 3P8BB 4HUEA 4OYBA 5AFUA 2B4VA 4LVNP 1G3OA 3FBEA 1VCTA 3TTCA 1CBKA 2MZSA 1XMQJ 1HR0K 3CIPA 2HBZB 2JNJA 4DTPA 4M3TA 2Z1HA 4CF1A 4HTUA 4V19X 3HLUA 4DUZK 2P9IB 3BSOA 4E1NA 2KL8A 4DPWA 5IWAF 2FQQB 2R7OA 5CE3A 4YOYA 1DJ0A 4K5SA 5C12A 4DUZJ 3W8GA 4H0OA 3HKWA 4NXMK 5KGWA 4DS4A 3RMDA 4LFAK 1S6QA 3LP1B 2UXDK 4FZVA 4PWDB 3VQ7A 1N36F 2BEFA 2MYFA 1U1LA 2HQIA 5ETQA 2BJ9A 5M1OA 5IM0A 3I31A 3IP0A 4AD6A 1NGBA 4Q5VA 1JXBA 2WCXA 2VQEK 2F4VF 3WZ0A 1F3VA 4DV4K 2K1RA 9RUBA 4KHNA 2LP4A 2DXFA 2W7AA 3AQPA 2VQEJ 3MMCA 2D0BA 5GADU 1T9WA 4DR1J 2XY8A 1U2VA 3PVXA 4C3MA 4I9LA 3UCGA 1EWRA 5F0UA 1WEYA 1DURA 3BP8A 4HUFA 5KRSA 1EHWA 4IR1A 2QKKA 4NYFA 4QPTA 4XAKA 2BTFA 3O9UA 4LRBA 3HSCA 5LSOA 3PX4A 3DOKA 1S1UB 2HVDA 4A8OA 3NH0A 3MM7A 3ATVA 1KWMA 5KI6A 1T05A 4FPBA 5HLFB 4JKDA 3JSMB 5ETLA 2IM1A 1RXOB 3FZFA 3VALA 3IUCA 1Y5IB 3K2YA 4AL6A 1MROB 2XY5A 4AHRA 4ED1A 1BI4A 3TAMA 5K5MA 2HW3A 1VR6A 1NHUA 4H5TA 4WK3A 2ZEJA 2HWTA 4PKDB 2NRRA 3X1LB 4QYZJ 4TN2A 1UVJA 1X3MA 1M1GA 1EARA 2M9KA 3T6BA 3GONA 2J7KA 2E1RA 2OCEA 1YJUA 3C3LA 3F9MA 2M70A 4P9SA 1WHYA 4OX8A 2YNHA 4BRHA 4U6PA 3UKRB 2D9OA 4UOFA 1XNQJ 2B9YA 1NU4A 3VQ5A 2I5JB 2MLZA 3HFKA 5AZJA 3VERA 4OYXA 3POTB 2CQIA 2MGZA 3KDOA 4O4GA 2QM1A 2V52B 2KJVA 3A3OB 4WXWA 1V3SA 3PFOA 1T9TA 5JS1A 3DXMA 2B56A 5KFZA 4U8VA 5A0YB 4OX7A 1WG4A 4NCGA 4OYAA 4DX5A 3OLAA 1TYQB 1LWCA 4CIGA 1YJRA 3DYAB 2L3MA 4FPAA 3A8JA 3VQEA 3VV2B 2YKMA 4RWTA 3TARA 3CJTA 3J7YU 1NM2A 2V50A 4KHQA 2YV0X 1LWEB 4J9NA 4KR0B 1Q81T 3V6DA 5GAEU 3MD3A 1PCAA 1X0PA 2HFZA 2MQLA 5BJRA 3K57A 2CFXA 2FLNA 1X0FA 3HP9A 2R2TA 4KHRA 4RPFA 3O4WA 4C4WA 4RTFD 3W3DA 2P6SA 4FF4A 1CJKB 1OQ6A 3HVWA 5MLCV 2OPPA 4LBHA 4NB4A 3MR7A 5E26A 1FRJA 1Q81O 3HMJG 5D0RA 3MAQA 2OMOA 1WHWA 1F60B 3NLCA 4AH9A 1C4CA 1SKUB 5A2QU 1M90T 2CQ1A 2J9DA 4FK4A 3LPTA 3PSIA 2GUIA 1XI1A 2XC9A 5AQKA 3O1LA 1WNSA 3SMZA 3IWXA 4BBYA 1X3NA 3HHDA 4ZVPB 1GLFO 2HNZB 2W1BA 1IQTA 2YKNB 5DRKA 3QRQA 3KLGA 4KI4A 3MZIA 3GILA 4IEIA 4OIXA 2P8IA 3CJRA 1EIYB 4K50A 8ATCB 4DDFA 5I3UB 1ZM4A 3NDKA 2BANA 1IO2A 1AUDA 1GLLO 5HAOA 3HK2A 3N5BA 1FKPB 2D3ZA 4ICLA 2X1FA 4BRCA 2AU0A 1I5OB 2BKOA 3GSDA 5LXRA 3J8AA 3GE9A 3Q22A 3PW7A 3H42A 3S6EA 1DBDA 4IH6A 1VBZA 4JI1J 1A5WA 3VEYA 3BGUA 3OTOJ 1Q53A 1FX2A 4MFBA 4WJBA 4JK8A 1WC5A 5L39A 3MMBB 1HNWF 2EVZA 1S79A 2LCWA 3OL7A 3ENAA 2CQ2A 3PKMA 2UUAF 1DQAA 1RU1A 1ZBUA 4ERDA 3BY5A 2ADCA 1F2HA 3PACA 3V4IA 2ERRA 1GTHA 4YOEA 3D45A 2ZWHA 1WELA 3WDOA 3VGSA 4U9RA 3ZT1A 3PUFA 1TV6B 1QE1B 3I56S 3M8PA 2PT0A 1MW7A 1O51A 4ED6A 2IY5B 4OX9F 4TY8B 3KVGA 1I94F 3HF5A 5EWFA 2JEJA 5E0OA 2PAVA 5ITHA 1IR1A 3VQPA 3K59A 4DR3J 1R59O 2ZC3A 2E20A 3KLEA 2B4PA 1S6OA 1IH7A 2ROEA 4WXOA 2L41A 4AHCA 2DRAA 1FA0A 2B9XA 2D4WA 3NXZA 2XM3A 2FLLA 2E5JA 4HVZA 3SEOA 3QICA 2D74B 2Q3SA 5GAEI 4WFZA 4K59A 4P2MA 3PNIA 2C2OB 3CCJN 4ED8A 3G0ZA 5K8NA 1BOTO 3CYMA 1BC6A 3VGMA 2XQCA 4DFKA 4Y3CA 3W8PA 2MKCA 4WFYA 3CDUA 3RW6A 4DN0A 4ZVQB 1UVLA 2RMLA 3Q2TC 1P27B 1D4XA 4J2EA 1JJ4A 1QQNA 3R27A 1GAOA 1Y7PA 1VQPS 2XNQA 5GAHU 1TGOA 1HARA 2VYPA 3CQYA 1E4GT 3EGNA 3H46O 1IKWB 4BVPA 1K1SA 1RBTA 1U1NA 4FJ5A 3TANA 2HFSA 1YGYA 1TVRB 1IM4A 1RHQB 2B7CB 4UW2A 1ATSA 3A0IX 3G25A 4K0KK 3QIOA 2AJ0A 2XMJA 3D3BJ 1VQ5N 1T03B 1A6LA 2V2KA 3O4QA 5IT0A 2E29A 1SL1A 5E41A 1Q4RA 1PJ5A 3LM9A 4KKOA 4RW7A 4LBIA 4H0XB 3BZQA 3VN5A 4BDYA 2WC9A 4NLVA 3UCUP 2N3LA 3RBDA 2A42A 4FJMA 3ZSVA 5E3QA 5HROB 1ELOA 3OQ2A 4FZYA 5FPDA 4BQZA 2V9KA 4NWBA 1HQUA 4YOVA 3UVJA 5F8NA 1U1PA 5H9EK 4ECRA 3G86A 3PX0A 2AZ3A 4F36A 5H9EJ 1F5AA 2HNYB 2OEMA 1TR0A 3O9QA 4CBXA 3LA0A 4QQBA 3EUNA 4MAKA 2JEFA 3PRBA 1P90A 3I82A 3VAGA 3KUEA 4OYIA 4NYOA 3DGPB 3NVKA 1GTEA 4KQZA 4E19A 5K8OA 4JI0K 2CQ0A 3E01B 4IFYB 2W6LA 2DNRA 1OSCA 2E9ZA 4ZVOB 3RB3A 2F3JA 4NLDA 2WSFC 4MH8A 3RAQA 5DGBA 3VEWA 2PC6A 4XEIA 3N28A 2AF6A 2HMIA 1S7HA 3M8WA 4S0MA 4DV2J 1IN0A 2C2EA 1RCXB 2WONB 5KFPA 4EUVA 4Y28C 4E8UA 3KG0A 4CRJA 2XZWA 3CJBA 4QWCA 4KIAA 3K8WA 1S9FA 2A2CA 5E2QA 2VA2A 4JYAJ 1LWXA 2R42A 2K3IA 4M5NA 4YN3B 2F40A 2JOQA 4B9SA 4H5NA 3MWTA 2FC0A 2HGLA 1SQEA 2WSCC 2IDOA 2V7ZA 1UWBA 2W7PA 3VPZA 2M8HA 3UE5A 1Q8LA 1NK0A 2V2ZA 4Q2LA 2RIJA 3D1HA 4R8UA 4JI2J 4Z37A 3H0PA 1T3OA 2OJ3A 3PHTA 1CG2A 4FVMA 2B3TB 3FFIA 2C3OA 4PCQA 4JI3J 5GAHI 3M30A 4DHVA 4DLEA 2MKSA 4DG1A 3KJVB 3CB4A 2Y0SD 4WCEQ 3GJTB 5HSPA 3ET6B 3VHQA 4TVAB 2NYHA 2OPQA 4DPUA 5G0RB 2BA9A 2PD1A 3TA0A 5B0EA 1U1MA 1JLFA 5E84A 4NLUA 4LF8F 4RNMA 5AQJA 1FRMA 4OGCA 3QSIA 3QJJA 3CJ7A 1YJ7A 3MM6B 4DPTA 2XB2D 2DNPA 3OV7A 4DV7F 4B9VA 1UL3A 2V8GA 3A3PB 5BN8A 4HKQA 2KM8C 4CEZA 1YRUA 3IR7B 1BMQB 3FGUA 3GIIA 2UXCF 3EKUA 2E6LA 5F8IA 1XHXA 2Q36A 1UAXA 4FO0A 2FD2A 3QWPA 1W2BM 2CQ4A 2ZDOA 2QA2A 3Q83A 3DLLL 1ZBSA 4Z4HA 2GELA 2MQMA 1A9NB 2PI5A 4CJUA 5HVFA 4RUCA 3NCPA 1FVQA 2BQRA 4B9NA 1KN6A 3SFUA 2EHGA 5KFWA 3MFHA 3N9UC 1JXLA 4NA1A 1N8RT 1F0XA 1S1VB 4HI1A 4UQGA 3CCLS 3THYA 4KC5A 4QWBA 2QWOA 3I4PA 5KG7A 1WSGA 2A6AA 3NGSA 2Y8WA 1H0HB 4OX6A 4CZKA 3VA3A 4DL0C 4CJLA 4ZHRB 4WQ5C 4DR4F 3FBCA 2XWXA 2R7YA 3OA9A 3CCVS 3I55N 1JNRB 5KFBA 5AQHA 2F7TA 1EQMA 2JLGA 5CXTA 1G1XA 4Y65A 2GZOA 4B9MA 4HACA 1VSIA 3KK1B 3CO0P 5LMNJ 3OBWA 2DT9A 1HBMA 3CI5A 3I0RA 1QUPA 2UU9F 4QCLA 1H3DA 1H72C 1NSQA 3QGPA 3DLEB 3NNCA 3CCQS 4IOCQ 2LEBA 1H7WA 4PQAA 1N5SA 4A8MP 3NS6A 2JHEA 4JI6J 1TUGB 3SBTA 1VLYA 3CCSN 5FLXY 2BRLA 2UVVA 3OYJA 1E3MA 3R5BA 3BEXA 2HLUA 2DGSA 2YNFB 1B70B 5FJ4A 3KHHA 5KPRA 2IOCA 1RBUA 3EXCX 1NJIT 3KK3A 3F56A 2QL9B 4NCAA 7FDRA 1ESVA 1QHTA 3EGVA 5AQRA 4WP9A 1LOUA 1QZ5A 4LR8A 5BPNA 2IMOA 4J2DA 4FYYB 3VQDA 4YB6A 4J9UE 2AGQA 4LF5J 3NVMA 2XS7A 3ZXWA 4KY3A 1I51B 2CXEA 3AO2A 4DV3F 1S0NA 3NCRA 2YHXA 1NUEA 3G9CA 1L3SA 1YJWS 2XYPB 1Q78A 3DM2A 3EKSA 2VOOA 3TABA 1NJIO 5ETOA 1VBKA 4E7HA 3ETOA 1NKEA 4QZVB 3L2WA 4WYLA 4A46A 3MF5A 4A8KA 2CQCA 1H2UX 2R7XA 4G1QB 2MJUA 4IJAA 3ISZA 2J0WA 4JHDA 2KJWA 1CEZA 4BRPA 3JXOA 2WVFA 4E7JA 4DR7F 5AJ3J 5F8GA 2VJUA 3OL6A 4QIGA 3UPFA 4IQMA 4CF0A 1NGCA 3I8DA 2DNKA 2JFDA 4DUYF 2V4JA 4DTJA 2MQQA 3H1VX 1SJFA 3LH2S 3HFZB 2HSEB 5IWAJ 1UFLA 3E9PA 4ZTJA 1VJWA 4Z2XA 2HHHK 4F4YA 3TTFA 2DNZA 5CHCB 2Y3YA 1YKWA 3VA0A 2DGWA 3CMAS 2BOPA 2DEIA 2APOA 2KQ2A 3CMES 3AQOA 1E4FT 2J9CA 3M8YA 3A4TA 3MMCB 1N36J 2P5OA 2JX2A 2JEGA 1FJGJ 2G8KA 4PR6A 1IG9A 4L76A 2F4VK 1U2VB 4IKAA 1SAZA 4FWOA 2F8EX 3BQ1A 2F4VJ 3A8YA 2ZJQL 5KFAA 3MMAA 3VTIA 4FK0A 4FYVB 1JX4A 1VK8A 3BH6B 3D54A 3WQUA 2P9NA 2C2MB 3ZETA 1S6PA 3DOKB 2HFOA 2RDJA 3E51A 2DKOB 2VGNA 3AVGA 1RT5A 4WTOB 2KVIA 2PIIA 1WOPA 3MM7B 3OVSA 4LRFA 1T05B 2JSXA 5LT5A 1NM1A 4FWLA 4DX7A 2MPUA 3Q7CA 3VQ9A 1TAQA 4C97A 1VQ9S 1WJ9A 2DH7A 1BI4B 4CF8A 3TAMB 1UJ5A 3O4NA 2GQCA 4KSEB 3H8YA 2A1BA 5E5NA 3DCAA 3MN5A 3V5RA 2GV1A 1PKUA 4Y34A 4CZFA 1S57A 4CI6A 4KTWA 4ZA1A 1Y97A 3E9LA 2N82B 3VQ4A 1X5TA 6FD1A 2WK4A 2W8KA 3OL8A 3U27A 1FESA 2J0XA 3ZSZA 2YNHB 5ADXH 1VRQC 2DYAA 1KOOA 1UFWA 4KHSA 2CJYB 2RQMA 3QFPA 1U26A 2BV3A 4FJ8A 3N01A 5AE3A 1P8ZA 1SI9A 1MMNA 2AP6A 4DV5F 4CHPA 1TL7B 4QJVA 3TI0A 2MGZB 1IWGA 2DGUA 2JGUA 2VD3A 4RL1A 4HUGA 4NMLA 4H54A 1RYRA 5FPMA 3QEWA 2XO7A 1E6VB 3JAMY 1YBAA 3MN6A 1ZBIA 4DQSA 4MO5A 3CF5L 1IBLF 4NCGB 1EAYC 4O3OA 4C6AA 1WOSA 2AYBA 3BGOP 1WTFA 4FL9A 3TA2A 4DU8A 2QLWA 1QUVA 2G0JA 2EFVA 1ZC6A 1DTTB 3CGIA 4OZ5A 3WNGA 5KFGA 3G8QA 4RJVA 3Q24A 3PW4A 2DR9A 4CHYA 2QWQA 3SQ1A 1W2IA 3UDEA 3RSEB 3S3OA 2GUPA 4A8XA 1XHZA 4C1NK 3F73A 1BCMA 4FM2A 4HYKA 4CEEA 1FJ7A 3HT3A 4CF9A 3KWIA 3ENVA 4BRQA 4DV6F 2HB5A 3FEYB 3D7EO 1KLNA 1RTIA 1GQEA 4WYBA 3RG6A 2HS4A 2BBEA 4BRDA 1RTHB 1F6TA 3FKBA 2OPPB 2ZJPL 3CMQA 2BQUA 1X1PA 4UF4A 4PQUB 1UETA 4IOAQ 3TUJC 4K4SA 2MQNA 3OUYB 2WVBA 1XMOF 5F8LA 4JKGA 3RMCA 1RWPB 4G1IA 3NRBA 1JB0C 4GKKJ 4EYHB 4IBNA 4P7TA 1YF5L 2AA4A 3TOQA 3TRGA 1GX5A 1CVJA 1IQZA 2E7VA 4TU9A 4TNOA 1NWKA 2WVCA 1HNZK 1N34F 2CIMA 3KNGA 2L9WA 1RT2A 4FK2A 2HVHA 4X4PA 5HANA 9ATCB 2K8GA 3A8KA 1S22A 3OS0A 2KT5A 2Y1IA 2OSRA 3P6YC 2A6OA 4FN5A 4DN9A 2UXBF 2COLA 3DLBA 2DR8A 4O4RA 3QNOA 4TQSA 4KV8A 1XUPO 1EWQA 3JQJA 4CZLA 1D9DA 2ZNYA 2DPNA 1UVKA 5L9XA 5KFCA 1HKGA 4IO8A 3QEVA 5HMWA 4CFDA 1XBWA 2EW9A 5F1XA 1A0OB 3PYFA 3H2VE 4ZCMA 5KFLA 2P9SB 4YB1P 5IV4A 3PRVA 1AZSA 2R8KA 3MEGA 4RX6A 4CEQA 2HGMA 4FJKA 3L3UA 5M1PA 4MFBB 3MPYA 1FNXH 4DL2A 2WFBA 2XTJP 1QVGR 1T3VA 2MEWA 2NNWA 3OT9A 1JLGB 4JKAA 1FXDA 5GMKa 3T69A 4LF7K 1J54A 1WN7A 3V4IB 4WYWA 1HNWK 2MSSA 3HHLD 2IVMA 4A8YA 1M1KT 1TU0B 4WP8A 4BC4A 2UUAJ 5ETTA 3M8PB 3VWSA 3ALYA 3AAQA 3QIPB 3OXLA 4USUA 4NPOA 1DTQA 2IDLA 4KHMA 3QIDA 2RKIA 1BQMA 4WFNQ 2AP1A 4QBUA 3LF0A 2V8HA 4OX9K 2HQCA 2ACMA 1NMEB 4AM7A 3KLEB 1U04A 4CVNE 2Q1NA 3MPUB 1WAJA 4CLYA 2KO1A 1DQ8A 5FIIA 1I94J 3LDPA 4FLUA 4OZNA 3MM5A 3OFGA 3H3NO 3HSZA 2ZM6F 4PUOA 4HH1A 2QL5B 3JTNA 1Q95G 2FPHX 3K5PA 2PDAA 3ZSRA 3LANA 4WU3A 2LQBA 3ZX2A 2O8EA 2CG8A 2QE5A 3KKFA 2F8HA 2RU3A 3LWLA 2KHCA 2VQFF 4AL7A 3H98A 2NRVA 2KXFA 3A3NB 2IJNA 2OD4A 3EYZA 3V6KA 2FLPA 2MMYA 4N47A 3Q8QB 2KN4A 4HHHA 1X4GA 2G8HA 3UFCX 4I64A 4BHQA 4F3MA 4DLGA 1V3ZA 2AT1B 4LF2A 1KQGB 1SIZA 1NK6A 3O2IA 2YNGA 1Q82O 3GCXP 1ZAWA 2I7NA 1HWIA 3VEVA 4H5RA 1HBOA 5DQGA 4Q2MA 1FKAF 2EBEA 4CIOA 3SMSA 3CJAA 1GK8A 1RHMB 2MLXA 1JNZB 5T7LA 1JXVA 4RW7B 2QMUB 2E5LK 2C42A 3BQ0A 1DKGD 3NF9A 2VH7A 3W9IA 1HPZB 2IS3A 2DO0A 5JVGL 2VPXB 1TL1A 1N5VA 4M5DA 4CW7B 4CLZA 2PFFB 5D6GA 1U1QA 4CI0B 1ZOTA 2F1FA 5C25B 3T5JA 2GIFA 4CLLA 1HQUB 4F3QA 1C1AA 1PO6A 3UVJB 2LMIA 1X4CA 3BV8A 4H03B 2Z2ZA 4DQIA 3L2VA 4FJGA 3R5GA 4P2XA 2ETJA 2XBPA 1X31C 3G6VA 1GMWD 2NUBA 3WNFA 3HL8A 4ECUA 1C6VA 3GQCA 5HL7L 3D67A 1EB0A 4NA2A 5DMRA 3EE8A 2HWIA 2DXEA 1MWZA 1GFWB 1J5EJ 3MXIA 1G6BA 2DR6A 2UZAA 3TR5A 4DI6A 2XZTB 4X4QA 3U02A 4PL7A 3NMUA 1BY9A 4NLOA 4CZGA 3QZ7A 1TKZB 3M9MB 3R5JB 3C6TB 5GVQA 2HMIB 4RO0A 2B6AB 2Z58B 4I67A 2OP5A 5B08A 1PAUB 4GW6A 1FRHA 1GMWA 3BB5A 3AD9C 1RILA 4QR2A 4L6V3 2IVFB 2R4FA 5K14A 4O3SA 3DI6A 3ZZYA 2CH6A 3OTDA 1S1XA 3TAQA 3QQCD 4PZVA 3VF6A 3K0SA 2FJXA 2BZ2A 3CO9A 5EXWA 5CYQB 3KYLA 4E0DA 5LJWA 2DFFA 2Z57B 4IO1A 3TU5A 1YDLA 3ZTRA 3G4SN 4FW2A 5AQPA 4C8ZA 3V1OA 3P96A 4JK9A 3J81O 4JI4F 1UWBB 2BE2A 2ABYA 1VSFA 1F1BB 4DZ6A 1VIXA 3KHLA 3CPWR 3QBWA 2Z4PA 4CJ3A 3CQ8A 2V0NA 3VEXA 4PYDA 1NK4A 3DC2A 4AHUA 1O13A 4FPIA 4ZPVR 2DFHA 1EP4A 4B1VA 2IAJA 2C3PA 2PEHA 5BPLA 1VSLA 2RDIA 3FFIB 2Z1JA 1N32K 3ZT0A 4PY5A 3M30B 3WXJA 4DMZA 4WFBQ 3PW0A 2IPOB 2A40A 1A7GE 4JV5J 3CDEA 4FJ9A 3CCJS 2CGLA 1JLFB 2KFYA 2HS0A 3R9LA 4PHTX 4LFBF 1YXQA 3M2UB 1NCLA 3R5AA 5A6WA 4K2XA 1ZS6A 3O9SA 2W01A 1SC3B 1RDRA 4RW6B 2Y0BB 5F3TA 4LF9F 1RDBA 4LBPA 4LF8K 3QEXA 2O8FA 2J9EA 3FEXB 4C0BA 2OO4A 3BR8A 2F8SA 1C0TB 2YNIA 4K4XA 5AQYA 3GG4A 2YBVA 4DV7K 1T02A 5DG9A 2E5IA 5F9LA 2Q6BA 2UXCK 1DFDA 3AVNA 3BKFA 3DN9A 3CC7N 4OI2A 3TWHA 3ZX0A 5EY4A 4GRSA 3THWA 5M1QA 2HHUA 5IOLA 1R0AB 2Z2YB 1RAIB 4FLWA 3D7SB 2ZH2A 2RQCA 2EXUA 1QSLA 2ZFHA 1TUVA 3ENHA 4X4TA 3M3ZA 3P38A 3OVAA 5F2RA 5DK5A 1KVBA 4M3RA 3HVRA 3D28A 2A0FB 2NXEA 2O4IA 3B78A 2Z1IA 1IG8A 3R6LB 3R3LA 3RVCA 2GVZB 4IH7A 4MT1A 2D1KA 3TTDA 1JIHA 4R5PA 1OMSA 1S5JA 2YI1A 2H9ZA 4C0OC 1W7AA 2AEMA 2DH9A 4OKKA 4G1PA 2ZZNA 3V9UA 1N52B 4HACB 4CERA 1RT1A 1CS4B 3PEHA 2I9SA 3EZOA 2WZ1A 4H4MA 3IN5A 4BC7A 4DR4J 3I0RB 2QZ8A 5IQQA 5JLHA 4F26A 3KLHB 3VF4A 2F9DA 4M63A 4FW1A 2FJDB 4JI7K 1SCJB 2FSNA 3VQ8A 2UU9K 1HRHA 2KI2A 2D3OR 4ELVA 3DRRA 3O8MA 1DLOA 1NGIA 3NWGA 1RDWX 2YHBA 2LA4A 2PYJA 2C2NA 4A5BA 3DHWC 2Q0RA 3TJ8A 4DX8H 1D09B 5F8JA 2QA4N 4LMZA 1BUXA 1KHWA 1BWVA 2BH1A 4CJRA 1KTQA 1VQ6N 2AJ4A 2WSEC 4MK7A 3DM2B 2HBJA 6FDRA 1JLBA 1HYSA 1NZAA 2WW4A 3P4IA 4DV3K 3DFEA 4XDCA 5GMDA 3V9ZA 4DV3J 2CWXA 4OZ0A 4CO1A 4JHDB 1QAIA 2CPYA 5F8MA 3NOGA 1B7FA 3PO5A 3W62A 1IJEB 3ENBA 4ZVGA 1SC4B 3PYGA 4IYQA 3GJQB 3W9JA 4J9KA 3LP0A 1HNVB 2YTCA 2NCKL 3D68A 2O8DA 4DR7K 3M6UA 1PSDA 4USMA 1FHTA 4W5TA 2DO4A 5LOQA 1SKRA 1CJVB 1WBDA 4F0KA 2VG6A 4K5RA 1B3TA 2X74A 2NUUG 1W97L 1TK8A 2CPZA 2DIVA 5LJ5Y 1NBWA 2PO4A 2OPRB 1NKBA 3VQTA 3OPKA 2RD5C 4DUYJ 1JK9B 3MCMA 2E2QA 3TNVA 3EICA 1BL3A 1GEHA 3O3LA 1BIZA 2ZUAA 4IRCA 2VASA 2BX6A 4WFAQ 2IM0A 4AM6A 1VFJA 4NEYA 1KVIA 1S0MA 3SXLA 2H54B 1HW9A 3K8VA 3VZIA 1NSAA 4EO8A 3T6JA 1WAFA 2DNOA 1BWEA 3MMAB 4O0JA 1FNOA 2FVCA 1VBXA 4CJ5A 2O67A 2P9NB 3ZETB 1VSEA 1NH8A 2W2QP 2A5XA 3FSYA 3UNGC 1RT5B 1VISA 3QB0A 2G0CA 3QPIA 3DXSX 3D6TB 1DAXA 1NJYA 4ZVEA 2WBNA 3CJ8A 3G6EN 4CHQA 4BR5A 5KT5A 3B54A 3GYXB 3BKTA 3QBCA 1CULA 3NF6A 1AB8A 4HHJA 2HHWA 2ZH7A 2ZGZA 2GIRA 2GHPA 4K8ZA 3LAKA 2V34A 3ZTOA 1LOTB 4ZP7A 3HXMA 3OJUA 4Z4FA 3I55S 4NXNK 1ZAXA 4X65K 3D6MB 4P2FA 3SAHA 5D15A 4YB5A 2D69A 1HL6A 4CEAA 3BGFA 4UZBA 1NK8A 4OPKA 4DV4F 4CCHA 3L4BC 1HBUA 4ZN3A 2FSJA 2A10A 4IR9A 2QWNA 4X64J 1SV5A 4LFCJ 3QMLA 3TAGA 3WT0A 2VBZA 2Q43A 4DV5K 4C9DA 4J9MA 4BRIA 3Q23A 1FEEA 2NPFA 2E1ZA 3MM9A 2R7SA 4IWVA 1BQNA 5AT1B 1VQON 4JLHA 4MKVA 2ZNZA 1BCOA 3MEEA 4QS8A 2ZH3A 4G6VB 2OLWA 1FI4A 3I0SA 4CJEA 2P9PB 4DF4A 1BE4A 5C2FA 2GGPA 2RQ4A 2BKNA 3O44A 2CUYA 2CGJA 1IBLK 3TEGA 3BBFA 3IMXA 5HP1A 3OR1A 2DB1A 3CD7A 4CQ1A 5MAOA 4LH5A 1FO1A 1RTDA 3MDFA 3P49B 1VQ8N 3M1VA 3UNYA 3CD0A 3T9NA 4C11B 4N56A 2YQ0A 2QV6A 3NMAA 3RWUA 3AARA 2MXYA 4TY9A 3NBPA 3DWLA 1RT3A 3AY9A 4JI8F 1R8CA 2HSTA 4NYNA 4JAXA 3HZGA 3HVTA 2M0GB 3UWTA 4X66J 1TL5A 4Q8FA 4CECA 3IWNC 3DRSA 3BSCA 2PZSA 1X9WA 1I3AA 4DV6K 4FVUA 2E4LA 1VRTA 1VC0A 5BR8K 4QWDA 1UCNA 1K6YA 3HP6A 1FRLA 4I2QA 5J1EA 1FW6A 1Y0HA 5HMZA 2E1CA 4BCAA 3JYTA 4I56A 4Y2KA 1M0SA 2G0IA 1Q86O 4I6AA 2FBYA 5L1KA 3D0PA 2QG9B 3BS9A 1Q18A 3CM6A 2IVNA 1F9HA 1AUSL 4DSEA 1S0VA 4ZLPA 1XMOJ 3BSAA 1RADB 3IWLA 3LW5C 4ITSA 1LW2A 4FXWA 3HJFA 3SCJE 4JV1A 4ANCA 4F3TA 1APSA 1H2VZ 2FVSA 1HWJA 3R5DA 4NASA 1KAXA 1N34K 2I0XA 2MQOA 4CK3A 4NYZA 4KV8B 1KS2A 1XR6A 3IFRA 5KG0A 2X78A 5DQHA 4H0YB 1S97A 4BRMA 1QTNB 2YWFA 3RBXA 2UXBJ 3GIMA 2UUCJ 4CJKA 2H3GX 1AZSB 3DLHA 2GAGC 2HVZA 4H0PA 1ZXOA 2BABA 2OUGA 1ZBHA 2ATCB 2GFFA 4OYPA 4J7CA 4L72B 2X6SA 1R3NA 3SSQA 3I5AA 4M95A 1KHVA 4LD0A 3SV3A 1BD6A 2VKRA 3AH6A 2A1RA 2QX0A 4WK1A 3EE9A 1UOCA 1WF0A 2O66A 5A2QY 4ID5A 5DJBA 3FVYA 4ZIWA 1TKXA 4MKYA 3FMBA 5ADXA 4CFAA 4O0NA 2NRWA 3KMQA 2GTDA 3SNNA 2RKIB 3LM2A 3VAMA 2G2YA 4GVMA 2ZKTA 4CDIA 4OI1A 3GU0A 3JSYA 3UD4P 1OY8A 2VG5A 3MAHA 4NLGA 2F8TA 3D5MA 1YIJS 4CO5A 2QLXA 4PWUA 3GL1A 5BRHA 2GC8A 1D9FA 3BUZB 2VBWA 4K8XA 1VQMN 1KLMB 1HMVA 3GP9A 1VSHA 3HHLB 4RBVA 2FBTA 2XLKA 1ZPVA 1WG1A 1S4EA 2XHBA 2EFOA 5CYMA 4JUZA 3RYLA 4CLSA 3W2VB 2O8EB 4ER8A 1NPKA 4LR7A 1WC1A 3HPOA 4JNEA 2MZRA 2LLZA 4M5LA 1X4BA 1X4FA 2P2CB 4EZ6A 2W42A 2ZM6J 2H5IB 2JH3A 4F8RA 4B1WB 4FLTA 4JP8A 1OH8A 3SQ2A 3LGHA 2VCPA 4TSXA 4OZJA 1V4SA 1T95A 2ZBQA 4PAAA 3MOJB 3GPAA 2GX9A 4U96A 3QT7A 2VQFJ 3SPYA 5CZ2A 3M2VA 3CC4S 2LFVA 4BGBA 1HBOB 4L3QA 1F5CA 5IQ6A 1VSKA 4ELTA 3W5ZA 1LAWA 4ZITA 3SUOA 5IS2A 4FJ7A 3KZBA 1BG3A 5T7LB 4LF1A 1QM9A 5AQGA 2XEXA 3SPZA 4OO1J 5HJXA 4MK8A 2NS1B 1TK0A 1YI2S 1IBMF 1BIUA 1ITGA 4U7BA 1GMVA 5LY3A 4Y0WA 3HHEA 4FOEA 2CZ9A 4QS7A 3GFXA 2ZD1A 3FGVA 3CIZA 5B0BA 2R8JA 3MWBA 2BJ8A 4RCHA 4DFMA 3SCKE 4ILMA 4B3TF 1T94A 4PG6A 1RAEB 5AXKA 3EZWA 1XIQA 3MX5A 4ZN1A 4E1JA 4O3RA 4FM0A 4CLUA 4GMJB 1QAYA 1GLAG 3IG1A 1BGXT 5LJVA 3LZIA 3SQOP 1TUWA 3OL9A 5D3GA 3CDAA 3ZSXA 1VRUA 2B43A 4GO5X 1YITS 2ZBRA 2ZF5O 4ZPDA 4CNYA 1UEVA 2LSNA 1XR5A 2QEXS 4CJVA 5H9FJ 1B9DA 3US5A 1N5TA 1RACB 4K0KF 2CJ9A 4ED0A 2E1PA 1BO5O 2DNHA 2IM3A 5E7OB 1M5KC 3G71S 2IHR1 1QSSA 2UVWA 3DI6B 3QT6A 2WOMB 4GO7X 1F5BA 2PEBA 3KUGA 4OHVA 3LPUA 3KK2A 4ZS6A 3NH2A 2DGXA 2E2OA 3QT8A 1WACA 1QY7A 4EEYA 4QU7A 3L09A 3NF7A 1FDDA 4EYIB 1REVA 4NLYA 1CQMA 3H6EA 1TQLA 4KFBA 5DO2A 3EPGA 3VVTA 4K43A 3OHBA 4L3KA 4KJIA 4WCEL 2RF2A 3THTA 4KREA 2YX1A 3Q8YA 3NNHA 3MR6A 4B3MJ 5KOWA 3N79A 4ED3A 4FJNA 3PW2A 5CCMA 3L3VA 4JI4K 2WB1D 3M7VA 2D0PA 3L2RA 4NOHA 4Z7CA 3PSFA 3D0IE 3GIRA 2HHTA 1RT4B 1U8SA 1J6ZA 5HI7A 4ELUA 4FLYA 2MZJA 3WX8A 2CQHA 4DV0K 1RWOB 3ICLA 4JI0F 4PA1A 4KGXB 3D2EA 2HRYA 3TPQA 2DNYA 1MNEA 4OJGA 1X8DA 1FWKA 2HMPA 3CD5A 3KLFB 2IA6A 2GV9A 3GIJA 3N4PA 3U1LA 2IRUA 3CIMA 1OH6A 5EDWA 1HHSA 4U67Q 5L38A 4FM1A 1HUXA 2XWYA 1X4HA 3ZC4A 2NRZA 3ZX3A 4LFBK 1MG7A 2O8FB 3VGUA 4KYZA 5C42A 2EG1A 1CPZA 1QZ6A 3AGRA 2AWZA 4M3XA 4KRWA 1NPPA 3A5MC 3W2WA 2RRAA 4B3RK 4AHTA 3WC0A 1KRPA 4B3OB 4LF9J 1D5AA 5KG6A 3U3GA 4ZPAA 2LU1A 5AXNA 1IKXB 3CUNA 4O5FA 3THWB 2PN6A 2AEFA 4OHWA 1F9FA 3AA5X 3NG8A 1M5VC 4KH6A 3A8IA 1Y4ZB 3MFIA 3O9TA 3T1AA 1J5OA 4LSZB 2MZTA 3HDSA 4AQYJ 4MQ3A 1X4EA 2Z30B 3VQ6A 4DL3A 3C8YA 2BXJA 3E66A 1SJRA 1X5OA 2QLJB 5MLCQ 4IOCL 4URQU 4LF6F 1X9MA 2R3VA 2XMAA 3RB4A 4R5PB 3DRYA 5F0WA 1U6BA 4KB1A 2N4CA 3H2LA 4LT6A 1MN7A 1YHQN 4NI2B 4ZK7M 4B3SK 3C7NA 3U8XA 3W5XA 2HHQA 1RT1B 5DQIA 4UY85 4H4MB 2XULA 2HFUA 2Z2LA 1FF2A 2AX1A 3H90A 4MKAA 1N0UA 4K4TA 1S48A 1VQ7S 1YJVA 2DPIA 3AVCA 1ZM9A 1ZM3A 1ILYA 3D1QA 5FRMA 3S41A 5T7BA 2R7WA 4P7VA 3THXA 3IMQJ 1U47A 4I68A 1DLOB 2VC1A 4DR2K 1KDNA 2KB2A 4PWWA 1XNRK 4CK2A 2QKBA 4IDKB 3QJLA 4HH0A 3ZZUA 3N6LA 4A8WA 4IG3A 4NZ6A 4ZVUB 5DG7A 1FK9B 5EWGA 1FDAA 5HVGA 2OIHA 1WI6A 4J90A 1WSJA 2ASPA 1C0FA 3HBTA 4HHTA 2OGUA 2BW7A 4YHHK 4HDHA 1LQ9A 4L73A 2J7WA 1BHLA 3SJJA 4ZVSB 3QO9B 4AHVA 3AO5A 4J9PA 4K42A 2MB0B 2QWLA 3PEJA 1JLEA 3ITHA 4X2BA 2DGVA 1IBKF 4EP5A 3G4SS 8RUCA 3NGTA 1Y5LB 3TSPA 2ZBPA 4U8YA 3GFYA 2QXFA 4PABA 1JMTA 2V94A 3TEHB 3DXKA 5LXYA 3NGIA 3ZZZA 4HI2A 2JWLA 4Y2MA 4I2PA 2O01C 3LP0B 3WQPA 4MYUA 4YOWA 1YVFA 1BUPA 2O8DB 5I9EB 1GMUA 2FHMA 3DXBA 5HRRA 2MLYA 4DV1K 1YQHA 4NEZA 3QETA 3EEQA 2VG6B 3IR6B 3UB5A 3BN7A 1DHMA 3FLCO 3AV9A 5FRNA 1WUAA 3FQLA 4EFHA 1S9EB 1YJ9N 4A5AA 1UAWA 4MIAA 2GVDA 5AFUH 2D0CA 3IFEA 4O55A 2OD6A 4XTTA 5D4PA 3AOAA 1RDAA 1C2PA 2IJFA 1RTJA 1U1KA 2UUBJ 2CG4A 3BZKA 1RHJB 1AW0A 1XTZA 4X84A 4DSLA 3UW1A 2ASOA 2LYVA 3WXLA 2E6MA 3HHLC 1CJUA 2GEMA 2X6NA 3CQXA 4KI6A 4MIBA 2JVRA 2BACA 2CDRB 2V2QA 5LMUJ 3HHKA 2KG1A 4M5KA 3CJQA 1AA1B 3TZWA 4AYBD 1OO0B 2OH2A 2I7PA 1C1CA 3CC7S 1SL2A 1FDNA 4LQ9A 3VENA 3DU6A 2J8AA 2WVDA 5IT9O 4LIRA 4N77A 3LP2A 2PSZA 1B7YB 4AFFA 4QS9A 5GAGP 2WHOA 3PM9A 1QVFM 1RNHA 2AYMA 1CULB 1TELA 2BUNA 4UUWA 5AQOA 4UZCA 4ZOSA 3WX4A 1JJCB 3GE1A 1HW8A 1HR0J 5K8MA 2JLFA 4B17A 4ED4A 1UMJA 4O44A 1UVNA 1LWFA 5KFFA 4DCOB 1TKTA 2XS5A 3CCRN 4IO9Q 1MMDA 1LW0A 1URNA 4IUFA 4NYPA 4GKJF 4M3ZA 2HHHF 1KVJA 4F2RA 4QIFA 3V9XA 3AVKA 2WBRA 2V51B 1WSEA 2DITA 2VV5A 5AQFA 3UI3A 3M8QB 3V1QA 4NXMJ 5B8HA 1XN9A 2DGTA 1HBUB 4LFAJ 4F7VA 1SL0A 2UXDJ 1QQCA 2P9GA 3GWCA 1SV5B 2YX4A 2N4DA 3L2QA 1VLOA 3QFHA 5KG3A 3HI0A 1N5QA 1SC6A 1PAEX 3MM9B 3GJRB 3CC2N 1BQNB 2M4MA 4DV4J 1FCAA 2RUSA 3MEEB 4CTAA 2P1JA 4R0JA 4WIIA 3I0SB 2M5YA 2KU7A 2U1AA 3SUQA 3J7Z5 3LDSA 4BR9A 4M7YA 4CLFA 4W90B 3ULDA 3KLVA 2GGPB 4YP3A 5KFSA 5HP1B 2ZWPA 3OR1B 3P5BP 4DU3A 3OHAA 3PJXA 2QLBB 5CZXA 2YHWA 2W41A 1UEUA 1UVMA 1R8AA 3OFFA 4WF9L 4IOAL 3W61A 3NBPB 4CIEA 4E7IA 3P3DA 1RABB 1HKAA 1RT3B 2GO9A 1OH7A 2QTDA 2P5GA 4E3SA 4JV0A 1HWUA 1YBUA 1UPPA 3HSJA 2DNLA 3HVTB 4IG0A 5I3QA 1DZ5A 2X1BA 4J5OA 1Z1ZA 3FZ2A 4JI8K 4HL9A 4CJFA 1M5HA 5ADZA 3DRSB 2YKOA 1OQ3A 2VL1A 2ZJRQ 1Y5NB 2RT3A 1VRTB 1UW4A 3AAWB 1U02A 2UVUA 4USWA 5IFMA 2YWKA 3OR2B 3E1YA 1N54B 1N6QA 2FJEB 2E88A 2Y1LB 2ZHBA 2XHCA 4I2QB 3GV8B 4WWSA 4V19J 3EGWB 3RRKA 2F4FA 4JKCA 3JYTB 2VDIA 3UN2A 3RAXA 4E2FB 1UJ4A 1K9MT 2B5JA 2HZCA 3EVOA 1H38A 3NCIA 2EFGA 3K5NA 4YR2A 1WDTA 4BY9C 3WHIA 2HZVA 4ED2A 2A41A 3KNAA 3DNCA 4RU9A 3K17A 3LO3A 5KFTA 3TSUA 1BWFO 2QT7A 2XYGB 5BPMA 2L9DA 3MEKA 3KD5E 1REGX 4H0TB 2FHJD 4RZRA 4ZCLA 3ZYYX 5KPTA 4RW9A 3M8SA 3M6VA 2RS8A 3OXGA 1K9MO 1P9QC 3J80O 3OVBA 5AQMA 5AQXA 3ZZTA 3CJCA 1KVAA 4EFAC 3GB0A 3MAAB 3AA2A 2PE8A 2W9BB 2C2DA 3AJ1A 5KQDA 3T19A 1VC6A 3O3HA 1NJWA 2O8BA 3AA8A 1HWKA 1HX1A 4FBTA 2GWKA 5AXMA 2P9IA 3CEDA 3NGDA 3DDIA 4EIAA 4ES2A 3A5OC 2PI4A 4FYDA 4YDUC 3CJKB 3EE3A 1R7IA 1JJHA 3D2FB 2E9RX 3D0HE 2CVEA 3G6ES 1WKLA 2FHJA 1UA1A 4WFNL 4LC9B 5KTQA 4JI5K 5E3CA 1PYOB 1EZZB 3ISNC 1RHUB 1VC5A 4OKEA 2G2ZA 2X1GA 1EJ7L 1Y9OA 4GVLA 4TKTA 5THWA 1CLFA 3W9HA 3VAFA 2OEJA 4CHNA 3C15A 4ID5B 3ILOA 3NNAA 1NOYA 4C23A 4FYWB 2QXLA 3F9KA 1RT7B 3BQ2A 1K8AT 2KT3A 3QBXA 3T41A 4CHOA 3RBEA 1HNZF 3FC9A 5CYJA 1B99A 1VQKS 4UOHA 1N4LA 3DOMB 1C0GA 5HOOA 2VG5B 2OFGX 3H1QA 4C8KA 4A8FA 1AT1B 1S1UA 1GLEG 3UDCA 5HQMA 2WW8A 4KB0A 4PKGA 3UD5A 4J37A 3G2XA 5KGXA 5HLFA 3J81U 3JSMA 1M90O 1KFSA 3NHGA 4NA3A 1MROA 3P39A 2Y8YA 4F67A 4GNIA 1F2GA 4DU1A 2EWSA 1QVGM 1QS4A 3HPGA 2H4WB 5D0GA 4DZDA 4CZEA 2IBKA 3N0VA 2BJ7A 3NAIA 3HX9A 1KTVA 5KFJA 1YT3A 2YPZA 2CNOB 1VQ8S 3L95X 4EHTA 3I56N 2KDOA 2EK6A 2LVWA 1OKJA 5JXSA 4X4RA 4BG9A 4UOGA 4DL4A 4QAGA 4LF7F 3CT9A 4I6MA 4ISGA 3UR3C 4AXIA 2A18A 3ENOA 3QT5A 3UKRA 4JBCA 4OJ3A 4E89A 3EN9A 3ZO7A 1NGAA 5D4LA 3HULA 2I5JA 4N8OA 4FDFA 3VTHA 3POTA 4DU7A 2FY8A 1KQSR 2QYCA 4FYXB 5C24A 3HYFA 5HMXA 2ZUGA 1NSKL 1KFDA 2KRRA 4BC9A 2H4YB 3AD7C 1JLQA 5DLFA 4KH5A 5L9NA 1S72N 3OYCA 2MZ1A 2CKWA 3G82A 2ALZA 3H4BA 3ZTSA 1S12A 2EEYA 1TYQA 4BE0A 1FXXA 5AQQA 3E9OA 3DYAA 4YY3K 4C8LA 2ASMA 2RE2A 3HRGA 2WBMA 3HM8A 1SXLA 2ZD1B 2D3UA 1WBBA 1SIWB 1IBMK 3NS5A 3R7NB 3DLRA 5B0AA 4ZCKA 2JFKA 4RNOA 1KOHA 4QWAA 1ZH5A 2B8QA 2GX8A 1SJQA 2KZZA 4OZ2A 3OTBA 1KQKA 4O3NA 4F0HA 1KAYA 3WC2A 4FF1A 3IG1B 1RUSA 3E8OA 4B3TK 1T11A 4MTPA 4CZJA 2DISA 5D3GB 5GIPA 1CJKA 3RR7A 1VRUB 2ZBCA 2ZQBA 3UDVA 4WQ5A 3CCTA 5D4NA 1SJ4P 4KAZA 1HHTP 2FSKA 3NH1A 5DZ6A 4FZXC 3OYGA 4XH1A 3GSIA 2VICA 4BC3A 4BROA 1EX4A 1XQIA 4BS2A 4WE1B 1NGFA 5L1IA 3M5RA 5AQLA 1WF2A 3BGRB 3AODA 2YWGA 1V3RA 2RS2A 1NAQA 4WP3A 2ATQA 1IV0A 2H3EB 2ILZA 2E5LF 4DTUA 3Q2SC 1PC5A 3KK2B 4K0KJ 2FC9A 2CNKB 2HNZA 3S3MA 4CP5A 4GV6A 4ILLA 2LQ5A 4I7FA 2E1MC 4HTIA 2HZAA 3NL0A 1REVB 3U1NA 2V68A 3M32B 3MR2A 4KFBB 3CJ4A 3BBBA 1WKKA 2P9KA 2ASYA 2OHDA 4ZJLA 3BF1A 1NHKL 4ZCIA 2B4OA 4KGMA 4FJLA 5H1SV 3HO1A 2RF2B 3OTOF 5EHHA 1VHIA 2NZ4A 3IR5B 2MHNA 5DG8A 3DDKA 1BHNA 1RAGB 2BMBA 2VWKA 3HM9A 2JC0A 4FLZA 1FRKA 3S3NA 3IM8A 1IKYB 4OQJA 1RP5A 1SZ2A 2AD9A 2N7CA 3T5HA 4AL5A 2ROPA 3AVLA 3OW2R 4UUXA 4OZ3A 1VQLN 4OMFG 3D2EB 2CVIA 1WLJA 3AJ2A 2BYCA 3EMTA 3EWGA 4Z4GA 3QMQA 2CYYA 1JJ2M 1S77D 5IC4B 4N76A 3W3SA 3N5FA 4R25A 4K25A 3PZPA 4JI0J 2BJDA 4A48A 3I9V9 1R8BA 1VSJA 4QR1A 5JMNA 1ZTWA 4QW9A 4U7UD 2DK2A 1JCFA 3EPIA 3VOVA 4TXSA 3C6UA 2HLTA 2XMWA 1TV6A 4DR6K 1NK7A 3CFRA 2Q1LA 4M3UA 1WSRA 1EETA 3ILIA 4YR0A 3GIKA 3QNNA 4DL7A 3L3CA 2J6TA 1P1LA 4O3PA 2HHXA 4LRAA 2GJ2A 4H4KA 2R2RA 4K4YA 1RKJA 1WSVA 5HVHA 4A2BA 1Z2ZA 4PXDA 3CCMN 3FCHA 5A6PA 1J5OB 1WSFA 1OPIA 1EQ0A 2QWPA 3ZZPA 4ANDA 3OHRA 2ILYA 1OYDA 2R8HA 1UJ6A 2Q31A 2DY4A 1U7LA 5KT3A 1T6CA 5E3AA 1N32F 3CJ9A 5F8HA 2H51B 5AR0A 2NYIA 5KG5A 1SVDA 4C1NI 2J4RA 3NF8A 3OYFA 4J8FA 4F4KA 5KFNA 3FFKB 3AVHA 4LF6K 5HJYA 5EX5A 2CJXB 4D3GA 2CQGA 4FF2A 1IKWA 4FKXA 3AJDA 1LCUA 1KSPA 3TJ9A 1OVQA 5J2QA 4LVOP 3AOBA 3LTOA 4P10A 4QIVA 4CJ4A 1S0OA 1TVRA 4RG8A 1RI7A 4F3OA 3GOIA 5KG2A 4BRGA 2NSBA 1ZPWX 3VETA 4U95A 5LSRA 4TLRA 4ZDNA 1A5VA 1T03A 4Y2IA 4E7LA 2OSQA 5KFEA 1O6XA 1PYSB 2VFUA 1CZ9A 2VBYA 2PY5A 2P9UA 2U2FA 4BE2A 1VAZA 2ZKUA 4RR5A 3K5LA 4W5QA 3IRWP 3JS6A 1FD2A 2DCLA 7AT1B 4ZTFA 3UQSA 4M5IA 4I4BA 1S10A 4PKIA 1RE1B 3FUYA 2W25A 5A8WA 3H45C 3KJFB 1Q7LB 2PA3A 3SAGA 1N0VC 3CCVN 5AZIA 3HI9A 4MLEA 3SQ0A 3KTQA 1ZZFA 2LXIA 3C65A 2RN2A 2ASJA 2HNYA 4QU6A 2JZ5A 1JLEB 3ITHB 4UY8T 1VQNN 1XWLA 4RUHA 2MQPA 1NMDA 3RRGA 4CYUA 3ELHA 4X62K 3CCQN 3DGPA 3HZEA 1ROFA 3KJQB 1IBKK 3Q0AA 2AW0A 2GS8A 4ES1A 4DV2F 4FPRA 5EWEA 3OJSA 3DXKB 2E1AA 2W9CA 1LFPA 4ILHA 4A8SA 1S99A 3R7BB 3FEZA 4I2PB 1LK5A 4WFAL 2HBQB 4CLPA 4UY8O 1VI7A 5KT6A 1N8RO 3V2UC 2JLEA 2F9WA 5KFDA 4JI7F 2R7RA 5M2PA 2ZH4A 1CXQA 2WONA 1YSJA 1SH0A 1SH2A 2P6TA 4A8QA 2FYXA 3DAWA 1HI8A 3OYLA 1Y64A 2D0AA 5J2NA 4DTRA 5I3PA 2GVDB 3EZ5A 3LPYA 3TA1A 4P52A 1W26A 1X5PA 1TZ0A 3FDSA 5HATA 4ZIVA 4F4XA 3HFVA 3T5LA 4GY2B 4XH4A 2DR5A 4JOUA 4JI2F 3C94A 4HEA9 1LKZA 4YS2A 1CJUB 3ILLA 2V4QA 3MUVP 4MJKA 3RW7A 1WEXA 3Q89A 4ED7A 3Q8VA 3SUPA 4YORA 3MCNA 2C28A 4WQ4C 4JI3F 3ZLJA 2LKZA 4CT8A 2HHPA 1AFIA 1WTBA 5DS7A 2L9NA 3SI6A 3MGJA 5T14A 4K4UA 2DTJA 4OYZA 1NH7A 4FXVA 1HA1A 1K0TA 3LP2B 2K2PA 3LGNA 2E2PA 4TU7A 2DCUB 2ZVSA 1NKCA 1HI0P 2VUGA 3I8BA 2BKPA 4WZMA 3KJVA 1TUUA 3HSDA 1Q8BA 4WIQA 3PG9A 2MTLA 3AB2B 3HKZD 3DMJA 3CMAN 4DQQA 2K7JA 5G0RA 1RYSA 4BVOA 2X1AA 2DFEA 3DJCA 3CMEN 3SUNA 2G9OA 2AYGA 3WNEA 3LWMA 2G8FA 3ENQA 2FDNA 4ZP8A 1LW0B 4I6YA 3AA3A 3MM6A 3RB0A 3MX2A 4KHPK 4LY7A 5AQNA 2E44A 1N48A 4FJIA 4LF4K 1ZZNA 3VEOA 1S6QB 1OH5A 4F4AA 4F2SA 2LECA 4XO0A 1D1UA 3Q7BA 4IOXA 5K8PA 4GKJK 3QYYA 4PEOA 4WZQA 3QGIA 3B4MA 3KDNA 5IM0B 3UD3P 3A5NC 1PBUA 2P51A 4CBUA 2VONA 1FT8A 4I6WA 2HHHJ 1W9HA 2I8EA 3GBTA 2K1RB 3OSNA 5J2PA 1I1GA 1KP6A 1HLWA 3P5JA 1BXNA 3CCEN 1FVSA 1Z25A 4RNNA 1N33K 1WF1A 4CTAB 2ZH1A 5DM7Q 3VGTA 2G8IA 1YTAA 2Q97A 1WC6A 1B4SA 3JSRA 1TL3A 3TW0A 4DUTA 5TKWA 3D4JA 2AJ1A 4Y0FA 2KYZA 1QJHA 2V6AA 4HT5A 1U45A 4TYAA 2LDIA 4ZHRA 5FDLA 4J9SA 2G8WA 2D0OA 2PGCA 3CERA 5CCLA 5HQ8A 1E6YA 4EBDA 3ETMA 4HVJA 3M9NB 2W2MP 1TK5A 4JI6F 1NSPA 2EG2A 4H0VB 3SDEA 4IG0B 3VR1A 3AHPA 1SJ1A 4WKYA 2XMMA 3KIOA 1B64A 2ZZMA 3GR1A 3THPA 2Z8QA 4NXNF 5M1KA 4CH7A 4X65F 3C2PA 1MWKA 5DM6L 3OD2A 5KFUA 4EBCA 5EN1A 3P1GA 1BA0A 3QDKA 2YNFA 4LF5F 4PG7A 5GAGU 2H1YA 1SBRA 3TJAA 1WUUA 5AZJB 1Y3KA 2B5JB 3ZEUA 3CM5A 4MDBA 4O4GB 2XHWA 4A47A 4B1UB 2V2VA 2W4DA 2AGOA 4M3YA 4M41A 2JVOA 2XSJA 3D6FB 4F9OA 5AQSA 4L74A 3DXMB 4URGA 1H98A 4Z94A 3I87A 2ACYA 5D0HA 4JK7A 3R97A 2EBGA 1RA7A 1HIYA 1LWCB 4RW9B 4OLOA 4FWQA 5AJ3F 4Y1DA 3ZZ0A 1XMQK 2YKMB 4CGJA 5JS2A 3KK7A 2OFHX 3MXJA 3KKRA 4G1QA 2DJWA 1ZAVA 2H5JB 2ZH9A 3BYPA 4GMKA 3VGVA 3TVYA 2O8BB 1CXUA 3OTCA 2A2DA 2FTRA 4JKHA 3V6DB 5AQTA 2DBBA 5F41A 4G3IA 3WEEA 2EFQA 4RUBA 1SKWA 5E33A 4FLXA 3H08A 5DDRC 5A76A 5LL6Z 2GNKA 1IBCB 4B9LA 3A1YG 5ETMA 5BR8F 2OTJN 5B0FA 5SUHA 3CPEA 2W8LA 1FJGF 3OXFA 2VODA 3LP3A 1L3VA 3TSQA 4EI2A 4ZVRB 4CGFA 4KT0C 4GVBA 2NXNA 4USKA 5LL6d 4RUAA 3EY1A 3I6PA 3PJWA 3IC1A 3R8YA 1NLKL 3W64A 4JRPA 4DR1K 3C15B 1JLCA 3O8WA 2FF3B 4NL5A 1YWXA 4RNHA 3CCRS 1D0EA 3B6OA 1J27A 4YFUA 1KXPA 3SSRA 2GMHA 2QLFB 3PKYA 1V5VA 2EFPA 4PG5A 1RAAB 2AKWB 3VQQA 2FBXA 2LDYA 4HLBA 3VEZA 3T5KA 4BR7A 3CJ0A 1GT8A 2NSCA 3KLGB 1UTAA 3A13A 3DHXA 1B9FA 3QAUA 3FZHA 1X9JA 2OYQA 1HNZJ 3Q8UA 3NAEA 3CC2S 3FSIA 3GR0A 5KT4A 4M5JA 3SYZA 1FE0A 3DGVA 3IAS9 5AXLA 3TZYA 3D9BA 4WPAA 4QYZK 4K8RA 2BANB 4URSA 5K20B 4R79A 4DSIA 3UO0A 4ICLB 1GLCG 4V1Ak 4I1TA 2HKEA 3QWUA 1WOQA 2QI2A 3ZNJ1 2CRLA 5J2MA 3BH7B 1Z26A 3ZSQA 3MPWA 4OI4A 2N7YA 1WEZA 3O80A 2JC1A 2CPJA 4CGHA 3MR3A 2V9WA 2HAFA 1C0MA 3VF0B 1XNQK 3QSYB 2Q0UA 1CC8A 1U1RA 4I6MB 4MO4A 4ZPBA 3LUYA 1R6YA 2MKJA 5FLXO 1FWPA 4KRFA 3QJPA 3QGHA 5GAGI 3E2EA 4FSVA 2HEKA 5EOYA 4FWKA 5KFHA 1TL7A 1TL4A 2FJAB 1M1HA 2YJFA 1XJWB 5C24B 1T9YA 3OFEA 2C2ZB 5KG4A 2DR7A 1RBOB 4RWWA 4LF7J 3C66A 1HKCA 2QYGA 2EFNA 3A12A 1HNWJ 1K8KA 2FJWA 2F63A 4YOUA 1JLQB 2HQGA 1YBTA 2HBKA 3GCWP 2E1YA 1C1BA 1E6VA 2KM8B 1SPBP 2G2OA 4QIEA 3G82B 2AIRB 1Q9XA