4G1QA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with rilpivirine (tmc278, edurant), a non-nucleoside rt-inhibiting drug
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshot of the equilibrium dynamics of a drug bound to HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 157
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4g1qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4g1qA05
1TKXA 3MEDB 4DQSA 3V81A 5L9XA 2D41A 3DI6A 3CDEA 3NAHA 2OH2A 3KLFA 3TARA 2HHVA 2KQ2A 3M8SA 4DQIA 4IFVA 4ECRA 4YQWA 4XPCA 4PUOA 1HYVA 4FLXA 3Q8RB 1L5UA 4E7IA 4CJ3A 3QEVA 4E19A 5J2PB 2UVWA 1NKBA 4CEBA 3PJWA 2V4QA 2O4IA 3S3MA 2DPIA 4BE1A 4CGGA 2WOMA 2IM3A 3QESA 4IDKA 3KHRA 2ALZA 1RTDA 4RG8A 4B9MA 3P5JA 3CFOA 3T5LA 1RBTA 1S1WB 1LWEA 3QIPB 3BSOA 4E0DA 1T03B 2PYJA 1RNHA 3QZ7A 1S0NA 4KAZA 2XI2A 3K5LA 3KKRA 1XR7A 3AO1A 5HRSA 4F4WA 2DFEA 3SFUA 5C24B 5L1IA 4IR9A 4KV8A 5DLGA 1HPZA 3DOKA 3OLAA 4CJTA 2P5OA 1RT4B 3AVJA 3L3VA 1Q9XA 4ZP8A 4CFAA 2FVQA 4MK8A 1LWFA 4EO6A 4Y1DA 2HNYA 2JGUA 3CFRA 4DTPA 4XPEA 1WSIA 4J2EA 4ED3A 1A5VA 4CJSA 4M3WA 3DRPA 1S9GA 3BR9A 3MF5A 4FJMA 5KFIA 1KCFA 3MR5A 1JLAA 3ZT2A 1VSFA 4KO0A 4TY9A 4W5QA 1L3UA 2W7OA 5KRSA 4DL6A 4IQXA 1BIZA 2HB5A 1J5OB 4RNOA 4CF1A 4N41A 1BGXT 3HL8A 4OL8A 3NHGA 4B3OB 3SJJA 1QTMA 2E6MA 3IS9B 5DQHA 3O3HA 4OLBA 4BDZA 3EZ5A 4Y2AA 4LQ3A 3V6HA 4ZHRB 2ZQBA 3NF7A 2VG6A 5FROA 4KHSA 3CWJA 3PX0A 3ZSOA 4C8KA 4FJJA 1IKYB 3QGIA 3EPIA 5C25B 4OPKA 1ZETA 3CJ4A 5F8MA 1SH0A 3FQKA 5F8GA 4ECUA 4M3XA 5CYQB 1S6PB 3FQLA 2IM2A 2X6NA 3ZSQA 1JL2A 4TYAA 3OYDA 2RKIA 4DTRA 3HP6A 4PQUB 4URQU 2WRMA 2W8LA 1FKPB 3KLEA 4MK7A 3NFAA 5CYMA 1YVFA 3L2WA 2E6LA 3TAQA 4Q8EA 1HNIB 1C2PA 3CVKA 4FM0A 4O4GB 1S5JA 3ISNC 3THVA 3LPTA 4FLWA 5SWMA 3C95A 2C2EA 3OSPA 4QCLA 4M42A 4DFKA 3NDKA 3LP2A 3FDSA 1IO2A 4CEDA 1LW2B 4Z4EA 4DU4A 4K8XA 1HMVB 2UUTA 1TKZA 2YNHB 5KT7A 1TAUA 5KG5A 5KFMA 2BRLA 3NH2A 3HYFA 4Q8FA 4NLDA 3OYLA 5KT4A 2F8SA 4MIBA 2DTUA 4KKOA 1IKWB 4O5BA 3QETA 3OYAA 3RRHA 1Q9YA 2IAJA 4KFBA 4ECTA 4ELVA 4KB7A 3QNOA 3SNNA 1REVA 3HP9A 1HPZB 3DOKB 1F21A 3KD5E 3LAMA 3T5HA 1VSLA 1QSYA 2IM1A 1RTJB 5I42B 1C0TB 1WLJA 4N76A 1NK4A 3CFPA 3OS1A 1WNSA 1HQEB 1HQEA 3U3YA 4WFYA 1Y97A 5KG6A 1C6VA 1VSKA 1C0UB 4FZYA 1LAWA 5KG1A 2WONB 4KPYA 1ASVA 1FK9B 2HAIA 4PWDB 4ZPDA 4O3NA 5KFZA 3UIQA 5KFTA 4M41A 2IBKA 3OYIA 3CJ5A 4CCHA 2QKBA 5KFHA 3IG1A 1D8YA 3JSMA 5DGBA 3HK2A 4Q43A 3KJVA 4KB0A 4J2BA 4HUGA 4FJXA 2FVRA 2LSNA 3V9WA 4DFMA 4RW6A 3SI6A 5JUMA 4IR1A 4B9VA 3DYAB 3SFGA 3H5SA 4CHOA 3SUQA 5KT2A 4YFUA 3MXIA 4ZHRA 3H5UA 4FLZA 4LH4A 1JLGB 3ZSXA 5KG3A 1JLGA 4EZ9A 1S97A 4DG1A 5KFUA 4CF9A 4C8NA 4K8ZA 1BQNB 1QE1B 4LH5A 3Q8PB 3HVWA 1BI4B 1BI4A 3V1OA 4G3IA 5L1JA 2IA6A 4F8RA 3VQSA 3OS2A 3OHAA 3KK2B 4F2RA 3MEEA 2RKIB 1WSGA 3DM2B 2FBVA 4WYWA 5HRPA 5HBMA 4W5OA 4J9MA 5FRMA 2AGOA 1FXXA 2ITGA 2RDJA 5KFBA 4HUFA 3KHGA 1N5YA 4QWCA 3C6UA 4G1QA 1LWCA 3KK1B 1FKPA 3KLEB 1NK8A 4RNMA 5CY4A 2YNFB 2WB4A 3RMAA 4I2QA 2QKKA 4ID5B 3NL0A 2FBXA 3ASMA 5HP1A 5HP1B 3NE6A 4TXSA 4MFBB 1RYSA 2W9BA 1JIHA 1ZBLA 4ELUA 3HXMA 5EWEA 4E1MA 3G6VA 1MU2B 4RW4B 2W42A 1CSJA 2HWIA 4RW4A 5SZTA 4E3SA 4WZQA 4KSEB 3RB6A 2BRKA 1UA1A 4CK3A 3T1AA 1C1BB 1IKWA 4BWJA 1NK9A 4JV1A 2KZMA 4CIEA 1TVRA 3M8PB 1B9DA 2HMIA 2Y1IA 1OS5A 3QEIA 5DGAA 4RW7B 1I3AA 2NUBA 3QLHB 3DI6B 2CKWA 3QLHA 1SH2A 4J9OA 4RU9A 3OYEA 4CJVA 3M8QB 3OYMA 4ID1A 4PA1A 3CQ8A 3SQ4A 3V4IB 5F8JA 3HHKA 3AO2A 1HQUA 2OPPA 2VWJA 4N56A 5KFXA 1C0UA 1SUQB 1T7PA 4CJWA 3QINA 2WONA 2A1SA 3OYKA 1U45A 4ZP9A 3QIOA 4EEYA 3G6YA 4CJEA 1NJXA 1S1TA 4ZTFA 1S1TB 4EYIB 1L3TA 4J9PA 1RDBA 4Q5VA 2HHTA 1ZTTA 2OPRA 2GBZA 2OPRB 1RT5B 1LWEB 1TP7A 2X74A 5DLFA 4M95A 4RUCA 2ZE2A 4CJ5A 4DTNA 3V1QA 4BACA 1I6JA 1SKWA 2XGPA 1JLBA 3C6TB 2R2SA 2VA3A 2FLPA 4QOZB 2G8VA 2ETJA 3AA3A 4O3QA 5FRNA 1C1CA 3UQSA 3H5XA 4DF4A 4URGA 4CEZA 4ED2A 5KFVA 3V1RA 1JLEA 2ASDA 3QO9B 4OGCA 3QO9A 2UVVA 3FFIA 1QE1A 3PHEA 2QK9A 1YTAA 1YT3A 3WNGA 5F9NA 4DSIA 4BE2A 1JLFA 3F73A 1S9EA 4CJRA 1N48A 4LD0A 5HROA 3O3GA 3K57A 1ASUA 3O4NA 3KLGB 5T7BA 3OYBA 3EY1A 2Y1JA 3E01A 3HKWA 1N5YB 1X9WA 4FJ8A 2KW4A 4O0IA 2RF2B 1Z26A 2IJNA 5KFLA 2YHAA 3IRXB 3TR8A 4CECA 1HNVA 4DEZA 4LSLB 4EO8A 2XY8A 5F8LA 4DLEA 4K4UA 2HNDB 4KE5A 4B3OA 2YKMB 1RDAA 3QNNA 2YKMA 3LALA 2D3UA 2W9BB 1ITGA 3DRSA 5EWFA 5I3UB 3CO9A 4QW9A 3CJ0A 3AA2A 3QEWA 1GOAA 4WXOA 3TAGA 4WYLA 4CJKA 1KLNA 4WE1B 3V6KA 1IKXB 1IKXA 4TN2A 1X9SA 3VQDA 3PO4A 4DSJA 1QAIA 4XO0A 2XI3A 5EWGA 4CEQA 4DQQA 4B9SA 3G10A 4AH9A 4IRKA 5CYQA 1DTTB 4GMJB 4FLTA 2X78A 4EZ6A 4AHTA 4CJ4A 4DL2A 3SQ0A 4KHNA 3F9KA 3M8QA 1RAJA 3RMDA 3K2PA 4IFVB 3OYHA 2VA2A 2QE5A 3VQEA 3K58A 2KTQA 3HO1A 4R8UB 1SUQA 2HVHA 1L3VA 3KNAA 3PO5A 4O4GA 1EXQA 2C22A 1RBRA 1KTQA 3OJUA 3HPHA 5KFNA 4NLRA 5KT3A 3PW0A 4IDKB 1XR5A 1JX4A 3I8DA 1TKDA 1TL3A 1SV5A 4KHRA 3TAFA 4ECZA 1KFDA 3PX4A 3V6DB 1NJYA 3RB0A 4HHTA 4O3SA 4TQRA 3FSIA 5J2QA 1HRHA 3NAIA 3KMSA 5KFGA 1JLBB 4YR2A 1UA0A 1QSSA 3SQ2A 4M3TA 4FK0A 1MMLA 3I0SA 1VSMA 2HHQA 3VQCA 3G6XA 1GX5A 2FBTA 5KI6A 1RTJA 4FJ9A 4Q0BA 3DLEB 1W0HA 3D45A 3UR0A 3FFIB 1N6QB 4ECSA 4ECQA 3C94A 4Z0UA 4YMEA 3T3FA 3PZPA 2XY6A 2E9TA 4H8KA 4ZVHA 1S1VA 3KOAA 3HVRA 3ULDA 3KLHA 2BQ3A 1HJRA 1T05A 1JLAB 2IM0A 3VQQA 4FXDA 3RBEA 3PR5B 5JXSA 2ZKUA 3BDPA 5KG2A 4NLYA 1RDDA 1RTIA 4CJPA 1ZBUA 4LY7A 2R8GA 2BDPA 1U48A 3IG1B 3NBPA 3I5CA 1LAVA 4CK2A 5KGXA 3ZSVA 4B9TA 2F8TA 4C8MA 5J1EB 5KG0A 4CIFA 3MFIA 2D5RA 5DQIA 4TY8B 3DLKB 3AO4A 1A5WA 5DK5A 4FLUA 4HKQA 3DLGA 4CJQA 1S6PA 3NF8A 4DTOA 3DLGB 1T03A 5C5JA 4DTXA 4DTSA 1IKYA 1B92A 1TGOA 4K4SA 4OKKA 1CXQA 1S0OA 2ILZA 4YNQA 2UUWA 5C24A 2XY5A 2I5JB 3ZT3A 4GW6A 4N47A 3CYMA 3VQ4A 1IKVA 1T3NA 2OZSA 5FDLB 2G8HA 3RR8A 3HM9A 3OYNA 3WNFA 2B43A 3LP3A 3LP2B 2ATLA 4NYFA 5KFRA 4H4OB 3KMQA 1S1XA 4H4OA 3OYFA 3PY8A 1EX4A 4NLXA 3LP1B 3DOLA 3AVHA 4F50A 4I2QB 3VQ8A 2VG5A 3TAEA 3UPFA 3V9UA 5DQGA 1HARA 3DRPB 3K5MA 4ZVEA 1KSPA 5KG7A 4DLGA 3DLBA 3K59A 2WTFA 3CM6A 4KV8B 3KHLA 2ZD1A 2ATQA 4DU1A 4AHVA 1DTQB 4FM2A 3BJYA 2W7PA 1QAJA 4DF8A 4KFBB 3NAEA 3JYTB 2HNYB 4I9QA 3MTKA 3ZT0A 4ICLB 2FJWA 3GILA 4LQ9A 3AA5X 1RT3B 2AGQA 3GV8B 1S48A 3ISND 3ALYA 2XGQA 4RW9B 1HYSB 1JLQB 4J9SA 3NH0A 3NF6A 3KTQA 3TABA 3CDWA 3PJXA 1BQMB 1S1UA 4O44B 3TANA 1JKHB 2D7SA 1BHLA 4IH5A 4CJLA 3TAMA 1S1VB 2P1JA 2KFZA 4CF8A 2OPQB 2HNZB 2JLEA 5HLFB 2HHXA 3IGNA 3CDUA 1JXLA 2JEIA 4NLQA 4OPJA 1KHVA 3RB4A 3B6PA 4JUZA 3LZIA 4W5TA 1GOBA 2XRIA 3GV5B 2R8KA 3RB3A 4AHRA 1EETB 3E51A 3SUOA 2B6AA 2G8FA 5DG9A 2RPIA 4K4XA 2B4JA 4CEOA 4J9LA 1W9HA 3VQAA 2IC3B 1JXEA 4F3OA 2W8KA 3GIKA 1VRUB 1RTDB 3H98A 3AVMA 4KRFA 4I9LA 2YNHA 5EDWA 4NLTA 1JLEB 1ZBFA 3V9SA 4B08A 5DG7A 1RDRA 3KK3B 4M3ZA 3KK3A 4JLHA 4KKOB 4PY5A 4Z4IA 3DRRB 4DL7A 4RNFA 1CLQA 4ECVA 4B9LA 5HROB 2G8KA 1VSIA 4GC7A 1X9MA 4NCGA 4O3OA 2IS3A 1FKOB 1RT6B 3LANA 4ZMMA 5HBMB 1RT6A 4O55A 4DS4A 2AGPA 4W5RA 1S1XB 2R2RA 4FBTA 1VK0A 4CEFA 3IRXA 4MH8A 3DOLB 4FLVA 1UOCA 3QYYA 4FLYA 2YNIA 4DTJA 2Z1GA 3PVXA 2V4RA 1D9DA 1FK9A 3RWUA 2HHUA 4PWDA 4RW8A 1JL1A 1J9AA 1S6QA 2DY4A 1CXUA 3DRSB 1REVB 3ITHB 5KFSA 4JS4A 4ZPCA 4M3UA 3MEDA 5J2NB 2P51A 3M8RA 2DFFA 4RW7A 1RBSA 4TLRA 4EYHB 3U3GA 1LW0B 2YKNB 1TAQA 1NJWA 2W9CA 2UVRA 3RMCA 5KFCA 4FZXC 4CERA 3ZSWA 4DQPA 1B9FA 1RT1B 4K4TA 2JC1A 1RT1A 2R8IA 4BDPA 3N6LA 1RT3A 4HCBA 3RMBA 5J2PA 1CZ9A 4KAIA 4UQGA 2VG6B 3SUPA 3V9ZA 1QHTA 1X1PA 2WOMB 3LZJA 2YNGA 5KFFA 4NCBA 3PW5A 5F9LA 4J2DA 2FLLA 4DSFA 5D3GB 1U09A 1XHZA 5D3GA 2CJQA 3TAMB 2HWHA 4EP4A 2HHWA 3M9MB 4FYDA 4J9KA 4IG0B 5KFKA 3MEGA 4DWIA 4FM1A 4JV0A 2G8IA 4J2AA 5KFPA 2AX0A 3UDLA 3IN5A 3L2RA 3T5KA 2FJXA 1NK5A 4IFYB 1EP4A 4R5PB 3AVIA 4QWDA 4ED1A 3PW7A 5K14B 1JXBA 5K14A 4E89A 2FVSA 3ZT4A 4WFXA 4AILC 4CFBA 4CHPA 3K5OA 1XC9A 4C8LA 1DLOB 3SPZA 2G8WA 2GV9A 1SL2A 2B5JA 4Y2CA 5F8NA 1LW2A 3HPGA 3VN5A 1C1CB 1RBUA 1UWBB 3SZ2A 5DG8A 1BISA 3MEEB 1MU2A 3LWMA 4HYKA 4Z4HA 4K4WA 4IKFA 3KLGA 4M3RA 3OLBA 3AVCA 3NGIA 2GC8A 3ZSRA 3E01B 4XIUA 2Z1IA 2BR0A 4KO0B 4BWMA 3DRRA 3TWHA 3HVAA 3HVTB 3NGYA 3VQBA 3VQPA 4FW1A 5CZ1A 4EBEA 4MKBA 1Q8IA 3L2VA 2WK4A 1TKXB 2J6UA 4LSLA 4IRCA 3OL8A 1RA6A 4N5SA 3DLHA 3DMJB 4QWAA 2GUIA 3DMJA 3OY9A 1KVCA 4E1NA 4ZTJA 3KLVA 2OYQA 2IJFA 1HQUB 2OPPB 3NMAA 3WNHA 3KLIA 1YTUA 3KLIB 1C1BA 2IGIA 4KHQA 2AJQA 3DLKA 1WSEA 3OYJA 2HMIB 4ZP6A 3ITHA 3EZUA 4CFDA 3CM5A 3H59A 4R0EA 4H54A 3LDSA 2W9CB 4FW2A 4L8RB 4I2PA 2XWYA 4M94A 3D28A 1A5XA 3HSTB 4ECXA 4ZPAA 1BCMA 4QAGA 5CYMB 1VSDA 4DL5A 5HRNA 2VWKA 4WFZA 2XHBA 2G8UA 2PZSA 4IG3B 5KFWA 2QV6A 2O5DA 1RT4A 3P83D 4EP5A 2BANA 4CF2A 1JLCB 4GC6A 4M3YA 4FJGA 3QGGA 4QWBA 5KFDA 4B8CA 3RAQA 2O4GA 2HW3A 4AHUA 1R0AB 4Z4GA 4E7KA 3K5NA 1SL1A 3G86A 2YHBA 3LP0B 1RT2A 4E7HA 1EP4B 3AVFA 1NNDA 2AX1A 3BSCA 3MR2A 4J9QA 2VG7B 5JS1A 4DQRA 3I0RA 4ZVFA 3I0RB 3KD1E 1J5OA 1U49A 4CGFA 3DDKA 2R8JA 2FVPA 4FCYA 5KFOA 1U4BA 1XI1A 2E4LA 1WN7A 3MECA 1S9EB 3A2FA 1UWBA 4ECYA 4NLWA 4RNHA 4DMNA 3RTVA 1KLMA 1D1UA 2JEFA 3QZ8A 1NHUA 5CZ2A 4O44A 5KFAA 1IM4A 4JS5A 2IOCA 4PUOB 4DS5A 3SCXA 4CJFA 1ZTWA 4CIGA 3GIMA 5HLFA 4CHNA 3VQ9A 3KJVB 4DU3A 2WCXA 3IAYA 2HNDA 3KLFB 1K1SA 3OVNA 3ZCMA 2X6SA 1WSHA 4DFPA 4OKJA 3TI0A 3B6OA 1I39A 3P1GA 5I3UA 1IG9A 3QERA 3MXJA 4TSXA 2J6SA 2IDOA 3PX6A 2D0CA 1KHWA 4AHSA 3SI8A 3HT3A 4TY8A 1TK8A 1TL3B 2IMWP 1SV5B 2JEJA 1GX6A 1HMVA 3VQ7A 3H2LA 3NGZA 4IBNA 3BQ0A 1S1WA 3QIPA 2RN2A 1RDCA 3KIOA 1BCOA 3DM2A 1D9FA 2YV0X 1C0MA 3BREA 1SKSA 1UAXA 4BE0A 4KB1A 3MAQA 1NJZA 1NKEA 1LWFB 3KK1A 3NCIA 4FJ5A 4CK1A 3SV4A 1XR6A 3QIDA 2I1RA 1IKVB 4NCAA 5FDLA 4IOBA 4IG3A 4ID5A 3BSNA 1S9FA 4IRDA 4K4ZA 4DFJA 3DLEA 4ZVGA 1C0TA 2DFHA 2BANB 1N6QA 1SL0A 1RCHA 4NYZA 3U6FA 4ED7A 1KRPA 2XY7A 4MFBA 2AU0A 4O3RA 1TKZB 3L2QA 5T14A 1XHXA 4FJLA 4CF0A 5J2QB 3OL6A 1ZBHA 4HVJA 3MXMA 4CEEA 3O3FA 1BIUA 5KT6A 3LP0A 2XO7A 1S9GB 4K4VA 1RILA 1TK5A 4FK2A 3H08A 3M8PA 3HPOA 2FLNA 4QW8A 2VG7A 3ZSZA 4ED0A 4FVMA 4DSEA 4OVLA 4B9NA 5F8HA 3AVBA 1GOCA 5I42A 1TL1A 4O3PA 4HUEA 1TL1B 3VQ6A 4KHYA 3ICLA 2HHSA 5C25A 1W25A 4U6PA 1VSEA 4GVMA 5C42A 1RTHA 1RYRA 3DYAA 3TQ1A 3IS9A 1J53A 2KZZA 1RTHB 3RAXA 4YP3A 2Z1HA 4FS1A 4CGDA 2OPQA 4KTWA 3PR4A 3S3OA 3V81B 4Z4CA 4NZ0A 4CGHA 3LWLA 4CE9A 4W5NA 4WE1A 3WNEA 3SPYA 3D5MA 2R2UA 1BQMA 4O4RA 4IH7A 5KT5A 2R2TA 4F4ZA 2KFNA 3MEGB 4DSKA 4ECWA 3M9NB 3MR3A 3OL9A 1C1AA 1WSFA 4MIAA 3GQCA 1TK0A 3PUFA 1HNIA 4Q44A 3OYCA 3QEXA 3Q8QB 1K6YA 4RW6B 1BL3A 1XWLA 3AVNA 4CESA 4PQUA 4FZZA 4TYBA 1TKTA 2OPSA 1EKEA 4KHMA 4K4YA 1TKTB 2GIRA 3H5YA 2HVIA 1ZBIA 1DLOA 3SV3A 2ASJA 3T19A 2BE2B 4FJ7A 4WXWA 4FJIA 3AO3A 4RZRA 5JS2A 4OGEA 5KFYA 1VRUA 2BQUA 3KKSA 4NLPA 2EX3A 4KBIA 2I5JA 3O4QA 1Z25A 3ZT1A 2QXFA 4NCGB 4CGIA 1S4FA 1NK6A 4BDYA 2IAJB 2RDIA 3OL7A 2J6TA 1S0MA 4YR3A 1NOYA 3LP1A 3TVKA 1RT7A 2YNFA 1U04A 4KI4A 4NLOA 1JLQA 1TQLA 4FJNA 1QSLA 3SQ1A 5KFJA 2Q3SA 4FJKA 2XC9A 3H4DA 1SH3A 4ED8A 4TQSA 5J2MA 5L1KA 1S1UB 5J2MB 3ZSYA 1L3SA 1NK0A 3CJ3A 4CHYA 4NLSA 4B9UA 4F4XA 4IKAA 4MK9A 5HRRA 2AQ4A 3BGRB 4IH6A 3VQ5A 4LSNB 4O0JA 3BGRA 3MR6A 3CJ2A 1QUVA 2F96A 3OHBA 1DTQA 4URSA 2YKNA 1T05B 3FRZA 4CEAA 1VRTA 3OSNA 5DMRA 4CGJA 4OLAA 4QPXA 4ICLA 1N4LA 4I7FA 5KRTA 3VA0A 4I7FB 1DTTA 5J2NA 4NLUA 4RW9A 1HYSA 1TV6B 3NBPB 3VA3A 4FS2A 3BSAA 3QGHA 3NKYA 4MQ3A 4C8OA 1BQNA 2DPJA 5C42B 3S3NA 4QWEA 2BQRA 3V4IA 1CZBA 3OYGA 3PV8A 4E7JA 1IH7A 1YVUA 1NHVA 4F2SA 2EC0A 2GIQA 2AWZA 2JEGA 2HNZA 4EBDA 4DSLA 1G15A 4IFYA 3EPGA 2Z1JA 5EU7A 4Q45A 2YNGB 4DL4A 1T94A 1N56A 3HJFA 2PY5A 1QQCA 4CFCA 4H4MA 1LWCB 5F8IA 1RT5A 4KHUA 1EETA 1R0AA 3KK2A 2ZE2B 3H40A 3BQ2A 4F4YA 3NF9A 2V9WA 3AVGA 3L2UA 4J9NA 3Q8SB 1NOZA 4RNNA 3G0ZA 3GYNA 4F3TA 4KREA 3OS0A 4ZP7A 1KFSA 4FJHA 4DTMA 4B8AB 3SYZA 3DLRA 4KTZA 2OPSB 3C6UB 4G1QB 4MKAA 4Z4FA 4NRTA 2FJVA 3I5AA 3N6NA 4ED6A 1WAJA 4Y3CA 2E9ZA 5L1LA 2BE2A 1RA7A 1S10A 1T8EA 4CJUA 2D0BA 2C28A 3AO5A 2FBYA 2FVCA 1TVRB 2OA8A 1K1QA 3GIIA 4E7LA 5KFQA 1KLMB 4AHCA 5EUHA 3NGDA 3GV7B 3D0PA 3V6JA 1WSJA 2ZD1B 3KLHB 1KVAA 4ZPBA 3MFHA 2R7YA 2BGGA 3JYTA 3I5BA 2WHOA 1RTIB 3HVTA 5KGWA 1KVBA 1RT7B 3NH1A 4JRQA 3GIJA 1VSHA 2D0AA 3S9HA 3LPUA 2YNIB 5J1EA 4DTUA 1NKCA 3TAPA 2XCPA 1O1WA 2E9RX 1WNEA 1QS4A 4WZMA 1S6QB 1LV5A 2PYLA 2W9AA 4LSNA 3L3UA 3CG7A 4IG0A 2FC0A 4NLVA 2OZMA 3JSMB 3RRGA 1LW0A 4CHQA 4I2PB 1D5AA 2ASLA 1VRTB 3C6TA 2C2DA 1TV6A 3V9XA 2B6AB 3PW2A 4DL3A 1J54A 4DG1B 3OJSA 5KFEA 1JLCA 5E41A 1D0EA 2IC3A 3RR7A 3H4BA 4NLGA 4HTUA 3SUNA 3AVKA 1JLFB 4R8UA 4NYNA 2VG5B 2EHGA 2F8EX 4Y1CA 4Q0BB 4KHWA 4EBCA 4U7CA 3QEPA 1Z4UA 1VSJA 2V0NA 4R5PA 3T5JA 3PW4A 4ELTA 4Y34A 5KTQA 3M9OB 3EYZA 4H4MB 1RBVA 3V6DA 4M45A 2RF2A 1ASWA 3CIZA 3KHHA 1HNVB 3AA4A 3AV9A 2XCAA 4OJRA 4KI6A 4FK4A 1RT2B 2R8HA 1FKOA 4FBUA 4YR0A 2B5JB 4F4KA 3BQ1A 2D3ZA 4CHZA 4JV2A 3MECB 1S49A 3LAKA 4OKEA 2P5GA 5KG4A 3I0SB 1SKRA 3AVAA 3N6MA 1ZYQA 4HCCA 1HYZA 3L8BA 2ILYA 2JC0A 4X2BA 4JRPA 4K50A 3IGVA 4J9RA 4NRUA 1U47A 3RBDA 4RW8B 1JKHA 4RUAA 1WAFA 2UVUA 3AVLA 4KTQA 2C2RA 2A1RA 1NK7A
chains in the Genus database with same CATH superfamily
4DQSA 1VI7A 2UXCJ 5L9XA 1J5EF 3DI6A 3M1VA 1RQ0A 2PMWA 1H7XA 3FBBA 4U96A 2E1CA 4OX9K 3I9V9 4JI4F 4IFVA 5IWAK 1K0TA 1L5UA 4R79A 5BN8A 2XB2D 1BDGA 4E19A 2XG8A 3PJWA 4NWBA 1KQGB 4JI4K 2WOMA 1TL7A 1VQ6N 3HSDA 1RTDA 4RG8A 3L4IA 4FSVA 1RBTA 3QIPB 5AXLA 2HPUA 2RAQA 3QZ7A 2MSSA 5C15A 1FKAF 4KAZA 5HJXA 3BR8A 1PGZA 3KKRA 3GJSB 5DM6Q 5T7LB 5L1IA 3QWUA 4KV8A 1Q0NA 3VEXA 2IVOA 3OLAA 4HTIA 2CUYA 3K8VA 4QR0A 2D69A 3KUHA 3A8YA 3L3VA 3L7UA 4ZP8A 4CFAA 1LWFA 2IRYA 1IJFB 4YOUA 4MTPA 5D6GA 4J2EA 3A13A 4ED3A 4CJSA 3DRPA 3MR5A 3ZT2A 3MCSA 2E5LF 5M1PA 4PPZA 4RNOA 4CF1A 4N41A 4QR1A 3HL8A 3EXYA 3W5ZA 5F41A 1QTMA 2E5LK 1QLNA 1V3ZA 2EVZA 3EZ5A 4X66K 4LQ3A 2P9IA 2ZQBA 4CO3A 5FROA 1IXKA 3NS6A 4C8KA 1IKYB 1TL5A 5C25B 2KJWA 4OPKA 4C8YA 2X1BA 3J8AA 2E88A 1VRQC 2VKRA 5I4MA 5D4NA 2ALYB 3MM7B 1VQOS 1XNRF 1YSJA 2L08A 3BF4A 1EWRA 4ECUA 5CYQB 4U9RA 5DM6L 2GO9A 3UN2A 4JI8J 2APOA 2RKIA 4JV5J 5EX5A 4GO5X 1P8ZA 2P9UB 2EWHA 3CNQP 3O5TB 4CO0A 2CPFA 4MK7A 4JHDA 4CH0S 1QZ5A 2B51A 4DR3F 3TAQA 2YHYA 4X65K 4YDXA 4FLWA 4M5DB 3R2DJ 3C95A 2ITMA 1IO2A 4DU4A 1RZMA 1V4TA 1HMVB 2UUTA 3J81Y 5KT7A 2YNHB 1QD1A 1TAUA 2GS8A 3NH2A 3HYFA 3PYFA 2QTWA 3ZEUB 4KKOA 3MOJB 4EHTA 4ECTA 3OR2B 4DV5K 1F2GA 4DV0J 4GKJK 1I5OB 3DOKB 3I56S 4B1VA 1VSLA 5I42B 2B7BB 2HBJA 2G2ZA 4DJBA 1JMTA 3BUZB 3ET6B 5J1NA 2MLXA 3FCVA 3CFPA 4WJBA 4PHTX 1RADB 2P9KA 3I4HX 1WDTA 1Y97A 4IO9L 1NDLA 4FWQA 1VSKA 1UW9A 1LAWA 4A8FA 1DARA 2HAIA 2W24A 3FNNA 4ZPDA 4O3NA 5KFZA 2FD2A 2DVIA 2F9TA 2YQ0A 3AXKA 2AZ1A 5K8OA 2IBKA 5JVGQ 4QU7A 4CCHA 2DNYA 3GZ7A 2ZC4A 1Q81T 8AT1B 5DGBA 4Q43A 4J2BA 3O6WA 3M30B 4FJXA 3V9WA 4RW6A 3UVJB 3SI6A 1E6VB 4ZHRA 1UWAA 3M7VA 4FLZA 1JLGB 2ZEJA 1S97A 2QG9B 2YQ1A 4D3HA 3PEJA 4C8NA 4K8ZA 4A5BA 1BQNB 4LH5A 1VQKN 3Q8PB 1NJIO 2IA6A 3BGLA 3VQSA 3OS2A 3OHAA 2CJAA 2RQCA 2CGLA 3TUZC 4LF6J 4NMLA 3MM8A 1B3TA 3D54A 4LRDA 3W3SA 2QO3A 2KYZA 1VQ5N 3OR1A 3DM2B 3KKFA 4WYWA 5HBMA 4LF1A 4PKIA 2J8SA 2RDJA 5KFBA 1BU6O 1HI0P 3KK1B 3KLEB 3D1QA 5C2CA 3MDFA 3BKUA 4I2QA 3GL1A 2V34A 1Q8LA 3H0PA 4KH0B 2ASPA 3MN7A 1VK3A 3L4BC 5HP1B 3NE6A 4TXSA 1HWIA 1S59A 4OYMA 4MFBB 1RYSA 2W9BA 3QWPA 5ADXH 2ZDOA 1N54B 3HXMA 4LR7A 3QAUA 5EWEA 3G6VA 1MU2B 4RW4B 2HWIA 4KSEB 2V68A 3RB6A 1C1BB 3OTOF 3BF1A 4JV1A 4MT1A 4ZITA 4BBYA 5HMXA 4XDDA 3P45B 2Y1IA 2X51A 4RW7B 3WQUA 2LQBA 4BLGA 2GJ2A 4F02A 3UDCA 3FZLA 3DLJA 1QQMA 1NZAA 4CJVA 3OYMA 3SQ4A 2BOPA 2AV5A 3H45C 3HHKA 4N56A 5GAEI 5MLCV 3T9ZA 4A57A 1T7PA 4CJWA 2A1SA 1R8PA 1UEKA 3G2XA 4WTYA 3G6YA 1OH8A 4ZDNA 1L3TA 2H3EB 4J9PA 2DGOA 2OPRA 3VGKA 2GBZA 1T3VA 3DXMB 4TKTA 2VCPA 4B17A 4QS8A 2HEKA 5AQLA 2CPZA 3V1QA 1NPKA 2DGQA 4FYVB 2XGPA 2DXEA 5L38A 4PL7A 2QLXA 1HR0K 2J9DE 2CH5A 3JSRA 1IBLJ 5A8KA 3NGUA 3CPEA 1M5VC 1O8BA 3R27A 4CEZA 1NLVA 3DJCA 2ASDA 3M8WA 1HR0F 3QO9A 1JJ4A 2NRTA 1OY8A 1URRA 3IR5B 2ZWPA 3FFIA 4BRFA 2GMJA 3PHEA 2QYGA 1DBDA 1HLWA 1YT3A 1QQOA 1HKAA 4HTLA 2XTJP 2PMZD 1HBNB 2LXIA 2B9XA 1ASUA 1A7GE 1WACA 3WXLA 2JSXA 3OYBA 3EY1A 1U2CA 3E01A 4MMOA 2PBDA 1N5YB 2KW4A 3QFWA 4O0IA 1V5VA 2GQQA 5E7OB 2NSCA 5FPDA 5F0WA 3TA2A 3V2UC 4MKVA 2AP1A 3DC2A 4LSLB 2XY8A 5F8LA 4DLEA 1K73T 3BP8A 3ZETA 5HMWA 2YKMB 1RDAA 1FRXA 3LALA 2D3UA 2RQ4A 1D3WA 3DRSA 4OLPA 5CCMA 3AARA 3OXGA 4FWSA 4QW9A 5E2QA 4IOCL 3V6KA 1GK8A 1RXOB 5HK4A 1IKXA 3OVBA 5EXWA 3R5GA 3VQDA 1ZPVA 2W01A 3MCMA 4CM2A 3QBXA 2FUG9 4AH9A 3LTOA 5CYQA 4OYWA 1TL7B 1FE0A 2DO4A 4AHTA 3SQ0A 3MZIA 2VICA 2HBRB 3RMDA 3MMBB 4EI2A 2MQ8A 2KTQA 2DGSA 4JV5F 5U47A 3QT5A 1WOPA 2VWBA 2AJ1A 2KI2A 3MUTP 5AZIB 1RAGB 1L3VA 4OYXA 3UD3P 3PO5A 1MLAA 2XQCA 1ZBTA 1CQMA 2M5YA 3IKMA 3W63A 2O8DB 1OVYA 3A3OB 2BV3A 4C1NK 5KFNA 4NLRA 1VQPS 1T9YA 1JX4A 3JXOA 3PX4A 3DRXA 3QT6A 4O3SA 4KGMA 1GLCG 1HRHA 3JXUA 4DV0K 4YR2A 1QSSA 2NS1B 4FK0A 2D3O1 3UNYA 1DRZA 2HHQA 3P4UB 1NPRA 4RWXA 1GX5A 2N7YA 3CT9A 5KI6A 3ZO7A 1RTJA 4FJ9A 4Q0BA 2DCLA 3I55S 4BR4A 3HOTA 1OPIA 2RU3A 3NNCA 1N6QB 2FHJA 1Q78A 1Q53A 1GMWA 1KDNA 3T3FA 2X3DA 1VHFA 1FCAA 1B0PA 1GLEG 4ZVHA 2CFXA 4ATNA 4B1WB 3F56A 1HJRA 1S99A 1JLAB 4KC5A 1HKGA 3G4SS 1X9JA 4F7VA 4JKDA 3N79A 1UFWA 4A5AA 1RGVA 3R2CJ 2HRYA 4KJIA 2J0SD 4A59A 1ZBUA 2R8GA 4B9TA 4CK2A 1D09B 5IOLA 3ZSVA 1I94K 3CCRS 4OX9F 5AQXA 2UUCJ 4OJHA 1TZ0A 4TY8B 1ROFA 3SDEA 2ROPA 2NUHA 5DK5A 4HDHA 1V4SA 1AW0A 3DLGA 4CJQA 1T03A 3TUIC 1S72S 2NZ4A 1FXDA 1B92A 2V4JA 4GVEA 4DCJB 4ENOA 3D3CJ 1S0OA 1CQNA 3PJ9A 2XY5A 4JKGA 3KWIA 3CCJN 2G8HA 3RR8A 3PRBA 1VBXA 3IC1A 2EW9A 2B43A 4CVNE 3LP2B 2ATLA 3Q2TC 5KFRA 3KMQA 3U4LA 2KRBA 3OYFA 3FSYA 4DR5K 3VV2B 4F50A 4I2QB 3ZZRA 2N4DA 1JNZB 3V9UA 4ZJLA 2CG8A 3K5MA 4ZVEA 3IBCB 2DNLA 3TJ9A 4MJKA 3DLBA 3CUNA 3CM6A 2MQLA 5HATA 4JI0J 2I2YA 4AHVA 1DTQB 2RHSB 2XZTB 1QAJA 1BUPA 1LNQA 4KFBB 3DXKA 4I9QA 1DEJA 3AA5X 2DTJA 3O9SA 3EXCX 3ISND 1TFYA 2NZTA 2HBYB 4J9SA 3NH0A 3CMES 4O23A 2J8AA 4ILRA 2A6AA 3CDWA 3PDNA 1BQMB 1S1UA 4O44B 2MSTA 1TYQA 2W2OP 2D7SA 3TAMA 2E1YA 3RAMA 2P1JA 3DHXA 2HNZB 3VGUA 2HHXA 4PXEA 3NG8A 4CLSA 1KHVA 1NUEA 1N5TA 1OKJA 4W5TA 4DU8A 1GOBA 4OHXA 3GV5B 3EDRB 2CNNB 2R8KA 1YJVA 5LJ3Y 2EG1A 2UU9K 3D2EB 2CWXA 3JSBA 4RO0A 1N33K 1HI1A 4K4XA 2B4JA 1B7YB 1W9HA 1JXEA 1UL3A 3JTOA 4ZCKA 2IY5B 4U95A 2HF3A 2OEMA 3AVMA 4I9LA 4DR3K 4NLTA 1FRMA 1ZBFA 1Y9OA 3I55N 4B08A 4NL5A 4X64J 4EAHD 1RDRA 3KJFB 2G1DA 3CEDA 4JLHA 4BY9C 4LF9J 1FT8A 2R42A 3DRRB 3Q24A 4ECVA 4B9LA 4ISEA 3U9DA 4OZ2A 2IS3A 1X4HA 1FWLA 1RT6A 3FKBA 4BC7A 4DS4A 4O55A 2AGPA 4P52A 1IBMJ 4OO1J 4KGZB 4W5RA 1S1XB 2FPHX 1ATNA 3NXZA 2OEKA 4MH8A 5DZ6A 3DOLB 2I0XA 1F9HA 1WJ9A 3QYYA 3EVMA 4JI8K 4NYOA 1WC0A 4DTJA 3I96A 1R43A 2V4RA 1D9DA 1WC1A 4NXNJ 1U6ZA 4PWDA 1ZH5A 3EGVA 1JL1A 5JICA 2GA7A 1J9AA 4ZVQB 4DPYA 3DRSB 1K73O 1REVB 3ITHB 2GTDA 3EUNA 2P51A 2DFFA 3TTFA 1KTVA 3VGLA 1NJWA 2W9CA 3RMCA 4OX9J 4LSZB 3TEHB 1B64A 1QJHA 2FC9A 4YORA 3HI0A 4NI2A 1NGFA 2L9WA 3DOMA 4KAIA 2YBVA 1CJVB 2VG6B 4Z7CA 3V9ZA 1X1PA 3CJSA 3LZJA 3Q23A 2XYHB 1RJJA 3HTVA 3ETOA 5F9LA 4QOTA 1H72C 2CJQA 2LYVA 3RW7A 2JL9A 2LQ5A 2HHWA 1RGIA 4FYDA 4J9KA 3M2RB 2VUGA 1YJWN 3MEGA 2WSCC 3K5PA 4IFYB 3AJ2A 5BYSA 4R5PB 1JJHA 2ASOA 4RWTA 3PW7A 5K14B 2QFIA 3EL2A 3ZT4A 4WFXA 3NVKA 2YX1A 3FMWA 2HK3A 4BC5A 2YWHA 3G25A 3D9BA 1ATSA 3N28A 5C12A 1UWBB 5B0FA 1BISA 4L74A 4Z4HA 4IKFA 2IFXA 3SJHA 1AUSL 3ILJA 4XIUA 1UEVA 2Z1IA 5F1XA 1WC4A 2H9ZA 3A4TA 4KHPK 2RSQA 4JNEA 1QAXA 3QBCA 4LRFA 4QU6A 1X3MA 1NM1A 3FBEA 4MKBA 2RIJA 4LSLA 1BWFO 3OY9A 1R8HA 4E1NA 4ZTJA 2HQFA 1WF2A 2V67A 4LF7J 1XNRJ 2OFHX 3NMAA 5D0GA 3WNHA 3WX8A 2HLTA 3KLIB 3VVUA 1C1BA 1NXIA 1VQPN 2X7IA 3UFCX 1EJ7L 3DRYA 2AJQA 5H1SQ 4NA2A 1MWZA 4LT6A 4ZP6A 1FD2A 2W7AA 3CM5A 2ZH8A 4R0EA 3LDSA 4OFZA 2F40A 1FJCA 2F3JA 2J9EA 1WC5A 4FW2A 3LW5C 2V94A 3PEHA 2UP1A 4W98A 4J7CA 3HSTB 1WG1A 4ZPAA 2NRVA 2IYIA 3CIMA 1U2VB 4WFZA 2XHBA 3QJJA 1K47A 2O5DA 3VZHA 2ADBA 1GQEA 1OO0B 4FWNA 4CLPA 2JRSA 2Z0GA 3ZX0A 4QWBA 2DNMA 5KFDA 4B8CA 3HHNB 2JVRA 3HHLA 4AHUA 1WF1A 1C4CA 1WSRA 1ZPWX 2B9YA 3K5NA 4E7KA 3CC7N 2YHBA 2YPYA 4FPAA 1WG4A 1RT2A 3H25A 3Q8VA 2AX1A 2V8GA 4DMZA 4J9QA 2ZH4A 3G8TA 1XMOF 1P8GA 3I0RA 4ZVFA 1U49A 5KPZA 3N5BA 3DDKA 3VF4A 2DK2A 4DUTA 4Y0FA 5KFOA 1U4BA 4OYPA 1XI1A 2HVDA 2WAQD 3TNVA 2M7SA 3QJLA 2JEFA 4RBTA 4QIVA 3IA0A 1Q8BA 4M5LA 3FEZA 3SCXA 4CO2A 4I6WA 4ZK7M 5LL6Z 5GIOA 2VPWB 3KJVB 3RYLA 5AFUH 2WCXA 5B0BA 4F4AA 4JBCA 1JJCB 3KLFB 4CWBA 1FFWB 1YBAA 2I8EA 3QT8A 3QAEA 2X6SA 4DFPA 3TI0A 2R7RA 2RS2A 4AXJA 2DHXA 4ZLNA 4A8XA 3MXJA 2AJ0A 2J6SA 4U7UD 1QVGM 2Z57B 1KHWA 2K1RA 4C3KA 2P9LA 3C7NA 1NH7A 2WSFC 1HFEL 1GEHA 4DV6J 5RUBA 1HMVA 5AQPA 1K8KB 3NGZA 4IBNA 4ER8A 3E2EA 2FJEB 1HHQA 1RDCA 4ALZA 1V9OA 3CCRN 1D9FA 4GY2B 2HS4A 3BREA 4BHQA 4KB1A 2QRRA 3NWRA 1LWFB 2DD8S 5HVHA 4QQBA 4FJ5A 3MEKA 1XR6A 3QIDA 1SQEA 4NCAA 5FDLA 4IRDA 2NCKL 4M5DA 2DFHA 2BANB 1NBEB 1RCHA 4ED7A 4DR4K 3EGNA 2YX6A 2W2PP 3OL6A 4NA1A 4HVJA 2R7TA 2HS0A 4CLZA 3O3FA 3MXMA 5KT6A 3LP0A 3UE5A 2XO7A 4PAAA 3ZNJ1 2ERRA 4FK2A 3DXKB 1PBUA 3M8PA 4P71A 3ULHA 4QW8A 2VG7A 1XJWB 4OYOA 3ATVA 4FVMA 4ED0A 4B9NA 2PMHA 2A6OA 1PJ6A 3R3LA 4LJMA 2P2CB 1GOCA 5I42A 1TL1B 4DOZA 3QQCD 3VQ6A 1RWOB 1X60A 3MTJA 1N8RT 3B8AX 3THXB 5C25A 4OJGA 2O8BB 3DYAA 3TQ1A 1J53A 5LMNF 4NXNK 2ZBPA 2D9PA 2UUAJ 5BPLA 4CGDA 3CSKA 3WC2A 3OPKA 4NZ0A 2AMCB 4CGHA 2KH9A 3LWLA 4CE9A 2CQIA 4PEOA 3D5MA 2PEBA 4QS7A 2R2TA 3I6PA 2PFFB 1YITN 3BBCA 1R31A 3M2RA 2KFNA 2WW4A 3MEGB 2NLXA 4ECWA 3M9NB 3MM8B 1C1AA 3F5TA 1O5JA 3P96A 3Q8QB 3NP5A 1VQ7S 4RW6B 2IBOA 4R25A 4WQ4A 1IBKF 4PQUA 4FZZA 4TYBA 2OPSA 1EKEA 5ETLA 4K4YA 2E2NA 1J2VA 5D0RA 2KL8A 4BRHA 1SJ4P 4BRPA 2YQ3A 1IBKK 3S8SA 4FJ7A 2Q97A 4FPIA 3P49B 3PIOQ 3ENWA 2GQCA 1UEUA 2NRRA 2Q0RA 4JKGB 3R5CA 1Z25A 3D6FB 1DQ9A 1IJJA 4FNHA 5HJYA 2DGXA 1R59O 7FDRA 1IQZA 4QIEA 3N0VA 3GE9A 1S0MA 1M0SA 3WIUA 1UJ4A 2HKEA 3R5AA 3LP1A 1L3KA 1U25A 2WVEA 2GWKA 4X4RA 2CXEA 3SCIE 2G13A 2QM1A 4FJNA 5EGYA 4FJKA 2XC9A 4C1NI 3H4DA 1Q16B 4FYYB 4ED8A 3VR1A 3M2VA 1RKJA 1XERA 3TTDA 3T41A 5J2MB 1L3SA 1RHKB 2B7CB 4F4XA 5HRRA 4LSNB 3BGRA 3VTHA 3GCXP 4JI7K 3MR6A 3CJ2A 4LRBA 3IFRA 4M5KA 4K8RA 5KOXA 3FRZA 2NQPA 2O8FB 1VRTA 4CGJA 4QPXA 1P27B 3R7NB 3PIOL 2AEFA 3EKSA 4NMXA 4I7FB 4ZPTR 4PRFA 5AQQA 3QFUA 3NBPB 2XULA 4N8OA 4M5NA 2PSZA 2P9SA 4MQ3A 2FQQB 2DPJA 3LM9A 3G82B 4H4KA 5K20B 1NPPA 1VQ8N 2QN6B 1B99A 5CHIA 3BV8A 1YVUA 2F4VJ 4F2SA 2WC9A 2EC0A 2GIQA 3CJ1A 4A62A 2JEGA 4EBDA 4LIRA 2DIVA 1G15A 3J7Z5 2YVSA 5EU7A 4Q45A 1N56A 5CA5A 1QQCA 4UY8O 2E5LJ 4CFCA 4A8KA 1GLJO 2O1PA 5ELZA 3VAJA 3KK2A 4ZA1A 3H40A 4DR6F 4F4YA 3ATUA 3Q8SB 2XEXA 1NBWA 2FF3B 2H1YA 3G4SN 1FJ7A 3OS0A 1HNZF 1KFSA 3ENBA 4FJHA 3DLRA 1RSCA 2BEFA 4L75A 4MKAA 2FLOA 4B3SJ 1UVLA 2LDYA 1R7IA 1WAJA 4Y3CA 5IT0A 2CRLA 2D1CA 1CULB 4CDIA 4LVOP 5HVGA 1S10A 1OVQA 3AO5A 4MKYA 3ZETB 4JI5F 2UUCK 3GIIA 4BQLA 4E7LA 5KFQA 2P9NB 4USJC 3D0PA 2ZD1B 3O2IA 1JXVA 3TSUA 2DNZA 2HQDA 4ZPBA 2L9NA 2UUCF 1JCFA 2ZBRA 1R8AA 2BGGA 1RTIB 3HVTA 1G3OA 1IR1A 4I6AA 1RT7B 5FLXO 5IT4A 2M9KA 3ZYYX 1X5TA 3S9HA 4A8OA 3E3XA 4IFEA 3LPUA 2YNIB 2YWEA 3MN5A 2XCPA 4RX6A 1HBOB 3NGSA 2E9RX 4C11A 1S6QB 2KVIA 3MM9B 2OIHA 2PYLA 2AJ2A 1FA0A 4ZVOB 2W2QP 2AHOB 3GDQA 1D5AA 2ASLA 2BA9A 2GO8A 5B7WA 4Q2LA 2FZKB 4RBUA 4DV3J 4YDUC 4ANCA 2AA4A 3PW2A 4DL3A 3WX4A 1J54A 4ED5A 3M5RA 5KFEA 3H1QA 1D0EA 5ETRA 2IC3A 5HOOA 4QBUA 3H4BA 3M6VA 2EEYA 1PIEA 3SUNA 4JI1K 3DFEA 4B9QA 1VQNS 1S7HA 3W60A 5BREA 4Q0BB 3J7AP 4EBCA 4R5PA 3P38A 1U1PA 4H4MB 3OTEA 3C8YA 4M63A 3WZ0A 3GMGA 3CIZA 3HCXA 1FWKA 1PILA 5M1FA 4K25A 4PR6A 4KI6A 4JI2K 1FKOA 4FBUA 3J7YI 2YX4A 4KHPF 2ZH9A 2J9CA 1SIWB 1NZ8A 3QNWB 3I0SB 4E2FB 1ITPA 2U2FA 2ADCA 2W4DA 1HHTP 4YOVA 1D4XA 4CLUA 3CC7S 4JI6F 2RE1A 4CD3A 4CH7A 2E1ZA 4X2BA 1IG8A 3FJ2A 4HH1A 4NRUA 1YQHA 3VENA 2C2RA 2N4CA 1YX2A 4TU8A 1XMBA 3RGIA 4UW2A 1Q5VA 3CF5L 3D68A 4DQIA 1IN0A 4LF5K 2R9LA 4UF4A 4FLXA 4ZLJA 4CJ3A 1RABB 3QEVA 4P73A 2V4QA 3S3MA 4EUVA 4LF5F 4OYAA 5L9NA 2B9EA 4UY8T 3MAAA 5HVFA 1ZA1B 4WP3A 4DR2J 1WI6A 2V5HG 2QFJA 4IDKA 4OX7A 3P5JA 3CFOA 3T5LA 2VF3A 4C2MA 1LWEA 3BSOA 1JK9B 4E0DA 3L6QA 3MMAA 1T03B 2OO4A 1RNHA 4HT5A 1ZBSA 3ZXWA 3MM6B 5IV3A 3DLLQ 5IM0A 5AJ3K 5HRSA 4F4WA 2DFEA 3TPQA 4DZDA 4IR9A 1HPZA 1GMVA 2QI2A 3BN4A 3CF5Q 1LXJA 4HHJA 2FVQA 4MK8A 4KYZA 4Y1DA 4WKYA 2JGUA 3D6TB 4XPEA 2HVEA 1IWAA 4JYAJ 3HI9A 1P90A 5AE3A 1A5VA 1WB9A 3FCWA 1KQFB 5LXRA 4ES3A 3J81U 2JX2A 2R7WA 3K7RA 3J7YU 4KO0A 4TY9A 4W5QA 2CGKA 5CH7B 2W7OA 5KRSA 2VQEF 3AB2B 5H9EK 3OT9A 3AJDA 4F04B 1IBCB 3SQOP 1BGXT 4DBQA 1K44A 4WP8A 5LL6d 2OEJA 2W6KA 3MI7X 2VQEK 4OLBA 4Y2AA 2RB7A 2ZWOA 1KS2A 1EB0A 4KHSA 1XTZA 3CWJA 4I1TA 3PX0A 4DV2K 3FCHA 4B3SF 4FJJA 4DV3F 4O8UA 3QGIA 3EPIA 3FUYA 1ZETA 3MPWA 5F8MA 1SH0A 5F8GA 2JWNA 4DV2F 3ZZUA 3WEEB 2H5EA 3HMJG 3R6LB 5A0YA 2I6WA 3FQLA 2X6NA 3ZSQA 4Y2MA 1RACB 4TYAA 2AYEA 3RW6A 3HP6A 4Q2MA 4IOCQ 2AW0A 4J5OA 4URQU 3DGPA 4YOTA 1FKPB 2HGLA 2VHGA 5JLHA 5CYMA 4LBIA 4Q8EA 3W8GA 4LFBJ 1C2PA 5H9EJ 1S5JA 2CZ9A 3LPTA 2LXFA 2QL5B 2D74B 3N4WA 4QCLA 3OSPA 4M42A 1XQIA 4DV7K 4K8XA 4ZOSA 1RE1B 5GVQA 2R4FA 2IA0A 5KT4A 2F8SA 5E5NA 1NDKA 2DNKA 1IKWB 3QETA 3OYAA 2ZJRQ 1Q9YA 1GLLO 2NUUG 4ELVA 3R1HA 4GKKK 3QNOA 1REVA 2B9WA 3ZX2A 5L8RC 1WTBA 1H7WA 1RTJB 2E2PA 4N76A 1CPZA 1WNSA 2P9KB 1IUJA 1HQEA 2UXBF 4WFYA 1C6VA 3VZIA 3M3ZA 1C0UB 4YY3F 4FZYA 5KG1A 2KRRA 3IBFB 3H3NO 3W61A 1ASVA 4OHWA 3A5LC 2UXBK 3QBWA 2XNRA 4F67A 5LMNK 5KFTA 3UIQA 1W2BR 4M41A 4NLBA 3OYIA 4WQ5C 1WORA 4LR8A 4DUYF 1EIYB 2P9SB 3BZQA 3HK2A 3L0QA 4KGKA 3TZXA 2ZHBA 2HHHF 3IAM9 3MN6A 2QEXN 1KBRA 1SJFA 3DYAB 2KM8C 4YFUA 4FOIA 3VMFB 1Q86T 1T9TA 1KQSM 2B0GA 3EZOA 3ZSXA 2Y0BB 5KG3A 1JLGA 4PXCA 4Y2IA 4YS2A 4XK8C 2YKAA 5KFUA 1R8BA 4M5JA 2OLWA 3MUVP 4DU7A 3VAGA 1BI4A 3LL3A 4PKHA 2I9SA 1H73A 3OTCA 3WQPA 3KK2B 1MWMA 4ISFA 5I3QA 3VF6A 2IHR1 4F2RA 1YBUA 2BABA 4PG4A 3K9KA 4M5GA 2RKIB 5FRMA 3AD7C 2ZVSA 4QPTA 3KHGA 3T7ZA 2F5GA 3Q89A 4NEZA 2C2KB 3K8WA 4RNMA 1AT1B 5CY4A 4ANEA 3LOUA 1YRUA 2QXLA 2WB4A 3W1YC 2MKHA 1CULA 1A6LA 3UKRA 4ID5B 3NL0A 1RAFB 4CBXA 2GHPA 2BTFA 5JJBA 4ID8A 1FD8A 1JIHA 1ZBLA 2DEJA 5AFUA 1UPMB 2W42A 4RW4A 5SZTA 4E3SA 4WZQA 2VKZG 2BRKA 2VGMA 4XAKA 1NK9A 4CLTA 2D0PA 2HFNA 3BH6B 4H0TB 3SSQA 2LDIA 3P5TL 4ETXA 1Y10A 5LSOA 3QLHB 3B54A 1ZM3A 3QMQA 1VLYA 1F2HA 3LPEA 3OYEA 1VGYA 3DHWC 4ID1A 1FDDA 4PA1A 3V4IB 3E9LA 3H6EA 5F8JA 3Q86A 3PIPL 1HQUA 2OPPA 2VWJA 3CC4N 3M32A 2DR5A 1SUQB 2GVDB 1XNQF 1U2VA 2WONA 1U45A 2QGFB 4IOAL 1EX8A 1VQMN 4ZP9A 3QIOA 4EEYA 1NJXA 1S1TA 3IBWA 4Q5VA 1ZTTA 2OPRB 2QA4S 1HD0A 1RT5B 1LWEB 4C6AA 4JD2B 2NPFA 3W3DA 4EFHA 1NU4A 5DLFA 1LXNA 4DTNA 4CZMA 1T9UA 4BACA 1I6JA 4V19X 2P6SA 1JLBA 2VA3A 4PG7A 4LFAF 4WFBL 4QOZB 4FWKA 1VQKS 3TSPA 1C1CA 1LFWA 3H5XA 4DF4A 3PACA 4BGBA 1HNZK 4ZVRB 5C2DA 8ATCB 1QE1A 3AB4B 2GVZA 2QK9A 1YTAA 5AZJB 5F9NA 3QT7A 2VOPA 1BQXA 1JLFA 4BE2A 1M90O 4CJRA 3O3GA 1YHQS 4OI0A 4X4UA 3O4NA 4L3QA 1FJGJ 1UP1A 2EG2A 5T7BA 1FTCA 5G0RB 5IS2A 4LF4J 1X9WA 4FJ8A 2A40A 2VONA 2OD6A 3M6UA 2RF2B 4UUWA 2YHAA 1LOTB 3LH2S 2BJ1A 4QYRA 4L73A 2F1FA 4DEZA 4ZCMA 3EEQA 2DRAA 5E0OA 1CZAN 4BS2A 4K4UA 4B3OA 2A6MA 3F2KA 4AQYK 1PC5A 2VBZA 1VQON 3NOCA 2W9BB 5EN1A 1HKCA 4NO7A 2P9NA 5EWFA 3SK3A 3JS6A 3CJ0A 4UOHA 3AA2A 3CGIA 3IUCA 4A61A 3TAGA 4WYLA 1KLNA 5AQKA 1GLBG 3A5MC 2K1RB 1NAQA 1UTAA 2LA4A 5CZXA 3PO4A 2V51B 2COLA 4XO0A 3MDQA 2DXDA 2IRUA 4CZEA 1TUWA 1FO1A 3G10A 3VEYA 1NEEA 4FLTA 2VU5A 2AZ3A 1KONA 4EZ6A 4PWUA 3B78A 4FWMA 3UCGA 4DL2A 4KHNA 3F9KA 3M8QA 1RAJA 2C42A 1TR0A 1TMMA 1N32J 2MTLA 1RTZA 1Q79A 1OQ3A 1ZAXA 3HO1A 4R8UB 3LGNA 2XLKA 3HFZB 1S6UA 3A8IA 3M6WA 1Q86O 3PFOA 3PKYA 3GR1A 4FKYA 5CCLA 2HGNA 1RBRA 3ID8A 1KTQA 2VGNA 2P9LB 3HPHA 3RG6A 4NPOA 5EVZA 5KT3A 4ED4A 5IQQA 5AE1A 1HJOA 5A8RA 1TKDA 1TL3A 2XLJA 3SLCA 2AJ4A 1SV5A 4ECZA 4ZS6A 1DGKN 2XO6A 3MCNA 4HHTA 4TQRA 1SJ1A 3FSIA 3VGSA 2V63A 1YAGA 1S79A 1LFPA 4BRCA 5KFGA 2DNNA 2I7NA 1KVJA 1M5HA 2B56A 3GFHA 1HNXF 3CJAA 3C14B 3D45A 3FFIB 4X62K 3C94A 3G6ES 1HD1A 2AYMA 3GPAA 3THPA 2YI1A 2E9TA 3C16B 4JN4A 3B4MA 3VEOA 1AZSB 3FZ2A 4KH1B 1U0HB 1G4CA 2LEPA 2IM0A 2K7JA 2LECA 5DO2A 5JXSA 4YDUA 4FP9A 3OTOK 3BDPA 5KG2A 4B1YB 1RDDA 4CJPA 4B3MF 1FRIA 3QPIA 1LAVA 2YKPA 4C8MA 1N34F 2MLZA 4PYDA 5J1EB 2C3YA 5KG0A 1NH8A 5E84A 3L7OA 3H20A 1IBLF 3J81O 5DQIA 2WW8A 2V52B 1A5WA 3AOAA 4DV4K 4FLUA 4NZ7A 2XMTA 4DTOA 3DLGB 4M1KA 3T1HJ 5C5JA 1SS6A 3LO3A 3MD3A 4K4SA 4OKKA 3P39A 1CXQA 4YNQA 1PAEX 4USVA 2IVYA 5C24A 1WTFA 2BMBA 3CYMA 3VQ4A 2OZSA 5FDLB 1RWKB 2IVMA 2F9JA 4OJ1A 4XH5A 1AFJA 1RAIB 4LF7F 3FBFA 1VQNN 2H65B 5LSRA 3NCRA 4H4OA 5D8HB 2UXDK 1EX4A 2OAUA 3LP1B 3NGKA 2VG5A 3VQ8A 2A18A 1EARA 1LK7A 5DQGA 1HARA 1KSPA 5KG7A 5IWAJ 3K59A 2WTFA 3FRYA 3KHLA 3OFEA 3CB4A 1Q82T 3W66A 3IXQA 1EQMA 3KNGA 1Y64A 1BC6A 4QYZJ 4HL9A 4EGLA 4I6MB 1VQ7N 1FRLA 3LF0A 3NAEA 2VQFJ 3JYTB 3QSYB 1EHWA 3ZT0A 3GILA 3AAPA 1U8WA 1SI9A 1RT3B 2MXYA 3BO4A 3ALYA 5H9FK 3NS5A 3CERA 3R9PA 3THWA 1T0TV 3G9CA 3CI5A 3VAFA 2EI5A 3TANA 2K2PA 1JKHB 1M1HA 1MMDA 3O1LA 1S1VB 4CF8A 2UZAA 2JLEA 4JI0K 1WOQA 4MLEA 3PG9A 5CXTA 3M30A 4NLQA 3W7BA 3M1VB 4OPJA 4OHZA 1X5OA 3LZIA 2FC8A 3V5RA 2XRIA 3LDNA 1U02A 4JI0F 2G8FA 1OQ6A 5DG9A 2MKCA 3CMAN 4F3OA 4CYUA 5HQ8A 3IWNC 2E1AA 1FFSB 3C15A 4K0KK 3TW0A 1RTDB 4OI6A 5F2RA 3R8EA 1HI8A 5C10A 1RWXB 1DT9A 3KK3B 3US5A 2GVZB 4K0KF 4DPXA 2J0QD 3UDEA 4FL9A 5AQRA 4EWTA 3U1MA 3W2WB 4DL7A 3O4WA 2DHHA 4CQ1A 2Q2RA 1CLQA 5BRDA 2IPOB 2V2KA 1X9MA 4NCGA 4O3OA 3T1YJ 4GKKF 3IDHA 4DV0F 1VK0A 3W2VB 3BKTA 2Q1LA 1FHTA 3T9NA 5DM7Q 1BO5O 4FLVA 3P8BB 2F4FA 2WBNA 4P9SA 2YNIA 1HW8A 1LOUA 1FK9A 1HBOA 4F0HA 3RWUA 4CW7B 1DJ0A 2VPYB 2XS7A 4OQJA 1S6QA 1KP6A 1CXUA 4K59A 1RB0A 4WQ4C 2QZ8A 4DV1F 4H0YB 4ZPCA 4K42A 1XMQK 4LFBK 4X64F 2DNGA 4RW7A 1RBSA 2DH9A 4H0VB 4TLRA 3TVYA 1E4FT 2QA1A 1LW0B 2E5JA 2YKNB 1TAQA 2DGUA 1M1KT 4FZXC 1J5EK 2DH7A 2Q79A 2XM3A 4DQPA 1RT1B 4BDPA 2Q1NA 2NRZA 2CG4A 2MZJA 3MMCB 3M32B 4ZCLA 3G71S 3RMBA 5GADI 5J2PA 1CZ9A 2RUSA 2CJXB 1QHTA 3UO0A 3UWTA 2M8DB 1I94F 4ANDA 3GIRA 1RLCL 4CO5A 3CCSS 2KKHA 2FLLA 3MXHP 5D3GB 1XHZA 2HWHA 3C3LA 3CJ7A 1HKBA 2H3GX 5KFKA 4DWIA 1D8ZA 1HL6A 4FM1A 1ZA2B 3IR6B 3UDLA 3IFEA 3L2RA 1NK5A 4JI3J 3LDOA 2WZ1A 3RSEA 4QWDA 4DV1J 2MZ1A 5TKWA 5JMNA 2J0WA 2FVSA 5LT5A 1T6CA 3NGTA 4ZKAA 4CHPA 3K5OA 1DLOB 1CVJA 2G8WA 1SC3B 1M1KO 1WHXA 2QIFA 4OI2A 3QJPA 1F5CA 3DCAA 1LEOA 3CPWR 1WKLA 1RBUA 3SZ2A 5DG8A 3G71N 1NG9A 2HK2A 5KPRA 2OP5A 1YLXA 4HYKA 4FWOA 1PBAA 4M3RA 3K0SA 1UFLA 1HW9A 2FGCA 2GC8A 2GUPA 3E01B 1FXRA 1B4SA 4P2FA 4A8QA 2HHPA 2BR0A 3OR2A 3P4IA 2VB6A 3HVAA 3GJQB 3VQBA 2M4MA 1Q7YT 1U0HA 4FW1A 4F26A 4EBEA 4PKGA 4H0PA 4P72A 1RA6A 2ZJQL 3DLHA 2CPDA 3DMJB 1B7FA 2H4YB 5D0EA 2HFUA 2Y0SD 4USHA 5SUHA 4UOGA 3AJ1A 2UUAK 2NXJA 2VV5A 4X66F 2Y1RI 2ZZMA 4U7BA 3R5JB 3EVWA 4XEIA 4CO4A 4K43A 1FWPA 2ZJQQ 2FY1A 1Z2ZA 4KHQA 3DLKA 2UUAF 1WSEA 1TUGB 4QIGA 3OYJA 2BZ2A 3ITHA 3TVZA 3ZLJA 2PIIA 3H59A 4H54A 1HBUB 4FVUA 2NR0A 3O3LA 2W9CB 3MM5A 1YKWA 4YOWA 3MWTA 4I2PA 1S72N 3G82A 5ETSA 5IM0B 3TZZA 4BRDA 1A5XA 2PC6A 3UD4P 1H6KX 2KN4A 1VSDA 4JHDB 4Y2KA 3HHLD 2HBMA 3DN9A 2Z8QA 4AYBD 2VWKA 2PZSA 4C4WA 4JKHA 1F3VA 2QV6A 2B8QA 4YOXA 3P83D 1VQ4N 1K0VA 1SBRA 4LFAK 1JLCB 4X65F 2DPNA 1WHWA 4GC6A 4K0KJ 4M3YA 2YJFA 4GVLA 3H2VE 3FGVA 4CBUA 3MMAB 4LREA 1R0AB 3ZTSA 2IJRA 1SL1A 3G86A 3OR1B 3M8YA 1NGCA 1PC4A 5B0EA 4E7HA 1EP4B 3AVFA 3T69A 3AHPA 3BSCA 3NRBA 5JS1A 1OWXA 5BRFA 3BZKA 3I0RB 5IC4B 1J5OA 4CGFA 2HFVA 5IT9O 4M5HA 3HHLC 4FCYA 5FLXU 1T6DA 3MECA 3VF2A 1UWBA 4YB7A 4DKWA 2QLJB 4NLWA 4W92B 2C1EB 1S7IA 1DFDA 3R7BB 3N4PA 5G0RA 4IZ9A 1RBOB 2CQBA 1IM4A 4CJFA 2BH1A 4CIGA 5HLFA 4JAXA 3BO3A 1KXPA 3VQ9A 2YHWA 4DU3A 4C23A 4NYPA 4BROA 3W9HA 2P9GA 4A2BA 1W7AA 3SDEB 4OV1A 3B6OA 1I39A 3P1GA 5I3UA 4J8FA 1VR6A 1VOMA 2IVNA 1OPZA 3NOGA 4CLLA 3ID6A 1IV0A 2EWSA 2DNRA 4USTA 3OTBA 1W97L 5JLFA 3SI8A 3HT3A 1YK9A 3TX0A 3EN9A 9RUBA 4AM6A 3G8QA 1GX6A 4N7TA 1YZ6A 3H2LA 1S1WA 3U1NA 3IAS9 3N4QA 2P5VA 1WOOA 3DM2A 2YV0X 5KPTA 1C0MA 2WSEC 1TELA 5ADXA 1NKEA 3KK1A 3UKUA 1HA1A 3QRPA 1XUPO 3KUGA 4CK1A 1AB8A 5A8KB 3BGFA 1IKVB 4IOBA 5KOWA 3DLEA 3MMJA 2C2OB 4ZVGA 3SSSA 4GVBB 2LQ8A 4HWIA 2XY7A 4MFBA 2QTDA 1ILYA 1C0FA 3L2QA 1IBMF 1XHXA 3HHLB 4ZVTB 3I87A 4FJLA 2MMYA 3ZZZA 1HNXJ 4OPAA 4X62F 1ZBHA 4CEEA 3UN3A 1BIUA 2DH8A 3ONQA 3D0GE 4D3GA 1S9GB 4P75A 1TK5A 4FYWB 3HPOA 3VOVA 3VGMA 5F3TA 4Y6IA 3LDLA 3THYA 2MQPA 1WI8A 3MPVA 4A8WA 2DO0A 1SC1B 5C42A 2F4VF 2C3OA 1RTHA 1RYRA 3IS9A 4B3MK 3C16A 1TL4A 4YP3A 4GMKA 2VFVA 4FS1A 3S3OA 5ETMA 3V81B 4QIFA 1DZ5A 3H46O 4DCOB 4A2AA 4IH7A 1IWGA 5M2PA 4DV4F 3HBTA 3VERA 7AT1B 3TTCA 4X65J 3BH7B 1SVDA 2CPIA 1LWXA 3MR3A 3PUFA 2UUBK 3OYCA 3QEXA 2ZM6F 2W40A 2OCEA 4RKUC 3PNIA 1XWLA 3AAQA 3BEXA 3AVNA 1TKTA 2GIRA 4JOUA 1DLOA 3SV3A 2QJ3A 2E8AA 3ENOA 3AGRA 2DXFA 2ZDPA 3R6GB 4FJIA 4B3TJ 4EHUA 2H48B 1VQ6S 4RZRA 2UXDF 2R3VA 2BQUA 4ERDA 1H38A 4KBIA 2P6TA 3O4QA 1M1GA 4NCGB 5ETQA 1HBMA 2I7PA 2WB1D 3ZTQA 2R7SA 4ZIWA 4LVNP 4C7QA 2CQPA 2P9PB 4WCEQ 1FDBA 2O8EB 2IAJB 3MAHA 2JOQA 5DDQC 1OJ4A 1NOYA 2V8HA 1H2VZ 4U7UK 3CCLS 5K8NA 1U04A 3IMQJ 4NLOA 1CJUA 1JLQA 3HFVA 2ZM6J 2H51B 1TQLA 1QSLA 2VIHA 2O66A 4FF2A 4TQSA 5L1KA 1YJ9N 1ATRA 2C3UA 3ZSYA 3QGPA 4WIQA 2DY9A 4NLSA 4B9UA 3BO2A 3CJ9A 4IH6A 2FSNA 3UW1A 3E66A 2GNKA 2F96A 2HBQB 3OHBA 1HR0J 2LA6A 1CJKA 1T05B 3L4QA 3ADAC 2RS8A 4LF4K 5DMRA 3DXSX 3NCQA 4OLAA 2HFZA 1UFKA 4Y28C 2MEWA 4ICLA 1XC3A 2GWJA 3CHWA 1DTTA 4RW9A 1HYSA 3LPYA 4DZ6A 2AYGA 2W2NP 2XYPB 3QGHA 3NKYA 3U8XA 3CD5A 3CQXA 4C8OA 1BQNA 3S3NA 3V4IA 4JKBA 1WC3A 2FB0A 1IH7A 4WFAQ 4JV5K 5AXNA 1W2BM 3AD8C 2HOEA 5CE3A 1MWKA 4DSLA 5C7PA 4V19S 4IFYA 3VAMA 2DGTA 2YNGB 3UDVA 2VODA 4YUDA 2FJAB 3PRDA 3AOBA 3DXMA 5F8IA 1RT5A 3QFHA 3VGVA 4ITSA 1R0AA 2DKOB 3CJKB 2Z30B 2V9WA 3L2UA 2QMUB 4RNNA 3G0ZA 2OMLA 4F3TA 1R27B 4ZP7A 5CAAA 4B8AB 3SMSA 4KTZA 4AM7A 1SQGA 4LRCA 3C6UB 4G1QB 4NRTA 4WP9A 4U67L 1YIJS 3I5AA 4JB8B 1Q81O 3H42A 3TX8A 2B4OA 4CJUA 5G4DA 3KYLA 2NZCA 2OA8A 5FIIA 1RU1A 2Z4PA 2ZZTA 2UXDJ 1KLMB 4OLOA 5EUHA 3GV7B 3BY5A 3V6JA 4DUZJ 2XZWA 2MQNA 2FZCB 1KVAA 1X5PA 1CLFA 2XNQA 3CTRA 2A3JA 1ICEB 1XNQJ 2WHOA 2HF4A 5KGWA 3FC9A 1MWQA 4LMZA 5B0AA 3GIJA 4JRQA 2D0AA 4DR1J 3VVTA 3CO0P 5IT9U 2RQKA 1WSVA 4KPCA 1RHQB 1D9AA 4C0BA 3CCQS 2RHKA 2KFYA 2EFVA 3LA0A 3N01A 4WZMA 2E7WA 1UKUA 4DV4J 2RH3A 4LSNA 3NNHA 1YIJN 2MYFA 1SCJB 2OZMA 1LW0A 5K8MA 2XYGB 4I2PB 2K7KA 1VRTB 4HDGA 2MZTA 3FVYA 4H5NA 4BRNA 2KHOA 5HANA 3LDQA 3I4PA 2B4VA 5LOQA 1TV6A 3CCVS 3K17A 2B6AB 3KXDA 2GGPB 2V50A 4K5RA 3EX7B 2X1FA 3GSDA 4PWWA 3WXIA 2L41A 2V2QA 4HTUA 4HVZA 1JLFB 4R8UA 3CCLN 3PM9A 3BKFA 2EHGA 3KG1A 1E3MA 5IT9Y 1MW7A 2V0NA 4Y34A 5KTQA 1RBVA 3SAFA 4JK8A 3FZBA 4KH6A 3H2UB 3PKMA 2NYIA 4GKJJ 3KHHA 4P2MA 1UJ5A 4CZLA 1Q8KA 3AA4A 3CW2C 4C3LA 4OJRA 2R8HA 2W4CA 4M7XA 1U0SA 4KGXB 3T1HF 1X4GA 3LAKA 4NASA 5KG4A 4FNIA 4UZCA 5LJ5Y 4KHPJ 4C48A 1SKRA 3AVAA 3MGJA 2PI4A 3THYB 4P2XA 1ZYQA 2P9IB 1JWWA 1HYZA 4HEA9 2CPHA 3L8BA 4RJVA 3GG0A 3GSIA 2JC0A 3T1HK 1Y5NB 3V4MA 4JRPA 3BDEA 4K50A 3IGVA 3OW2M 4J9RA 5AQWA 3RBDA 4RW8B 4PXDA 1H74A 4UY85 4EFAC 3C6HA 3WQTA 2QWPA 2QA4G 4WFAL 3AH6A 3D67A 1TKXA 3MEDB 4G1PA 3V81A 2HFOA 2OELA 1RDWX 1UVKA 3NAHA 2OH2A 3KLFA 3TARA 2OSRA 1QY7A 2JLGA 3MMVA 1IM6A 1PYSB 3TYTA 3F44A 2KQ2A 4O0NA 3M8SA 3M4XA 1WUUA 4YQWA 4XPCA 5GAHU 4PUOA 1BXNA 1MNEA 2Y1LB 2ZGZA 4CEBA 2ZBIA 2N3OA 2IM3A 4CO1A 3BGUA 2BJEA 1N33F 3QESA 3KHRA 2ALZA 4BVOA 2JVOA 4B9MA 2MZRA 2F8MA 1NB7A 3D0IE 1S1WB 1Q82O 4IJAA 4CD1A 5C2GA 3T1YK 1S0NA 3GR0A 2V4JB 2XI2A 4HI1A 3TOQA 3QSIA 3TP2A 5C24B 2Z56B 2UXCK 2EFQA 3D0HE 3DOKA 2DNQA 2EPIA 2MHEA 4AE5A 4DR6K 2P5OA 1RT4B 1Q9XA 4IWVA 4KGVB 3EGWB 5HMYA 4EO6A 1ZS6A 3CFRA 1WSIA 2O01C 2C2MB 4DV2J 3FBCA 4FF1A 3MF5A 4FJMA 3C66A 1KCFA 1JLAA 3VALA 4NE9C 4HHHA 4JI8F 3MCOA 4DXLA 1F5BA 3VEVA 2HSEB 1L3UA 1WD6A 1PKUA 4DL6A 3PCOB 1BIZA 2CZVC 2HB5A 1J5OB 2MKYA 2QLBB 1AUDA 3PRVA 2W1BA 4DHYA 3R3TA 4DX8H 4EU0A 1EO1A 3NHGA 3NS7B 4B3OB 3SJJA 4YOEA 1Y4ZB 1YDLA 4ZHRB 2A3ZA 4ISGA 2VG6A 3TZWA 4NLCA 1M5KC 4JI7J 3E9PA 3FQKA 3L7PA 1RWMB 4TU7A 4XDCA 4YB1P 2CH6A 5HO4A 1SPBP 2VL1A 2EK1A 4M3XA 1S6PB 2F9DA 2IM2A 1W26A 1XEZA 4DTRA 2H5IB 2HRTA 2PEHA 3OQ2A 4B3MJ 4YB5A 1K9MO 4PQUB 3HF5A 2WRMA 1M5OC 1T44A 3B6BA 5LJWA 4LBPA 5HL7L 3CJKA 3NFAA 1YVFA 3Q7BA 1YI2N 3IRWP 1HNIB 2PGCA 2EK6A 3CVKA 3ISNC 3THVA 4WYBA 2DYAA 4FZVA 3AAWB 3NDKA 5AXMA 4CEDA 1S5ZA 1LW2B 3OXFA 5A8RB 2Q36A 3D2FB 1CJTA 1TKZA 5KFMA 4CTAB 1UCNA 2BRLA 2DR7A 3H8YA 1IBKJ 5DS7A 4NLDA 3NLCA 2DTUA 2GAGC 4LF6K 4KFBA 2GIFA 2BJ8A 2WUSA 4KB7A 4LFCK 3HP9A 3HZ6A 3LAMA 3MOZA 2MKSA 2CQ0A 3TA1A 3A8EA 4DV6K 1QM9A 2IM1A 2FYXA 4B3TK 1WLJA 3ET6A 1NK4A 1VCTA 2KG1A 3ETMA 3Q22A 2NSBA 3U1LA 4OZ1A 3U3YA 4DV6F 3PXGa 3ULEA 2EKNA 2FHOB 4KPYA 4OIXA 4PWDB 2O8FA 2CQ2A 3FE1A 5B0GA 2OJ3A 2QLFB 5AJ3J 3VWSA 2A2DA 3M2UB 2QKBA 5KFHA 4XH1A 3IG1A 2AEJA 1D8YA 2W6LA 2A1BA 2FVRA 4PG8A 1XIQA 4OYIA 4IR1A 2QA2A 4KR0B 2SXLA 1YUWA 3SFGA 4CHOA 4H0XB 2MZQA 3MXIA 3SMPA 3H5UA 4A4JA 5H1SV 1KQSR 2QLWA 4LH4A 2UUBF 3KK7A 1MA9B 5M2RA 2ZM6K 3MCPA 5D4PA 3BBFA 3V1OA 4JKAA 1WEZA 4F8RA 5GADU 4U8YA 4MYUA 1WSGA 2FBVA 4W5OA 4J9MA 2AGOA 1F1BB 1GAOA 1FXXA 4HUFA 4X4PA 2A10A 3R8YA 1N5YA 4QWCA 2CVIA 4J9VA 2HBKA 1LWCA 2AJFE 4C3MA 1FKPA 1KWMA 3KWMA 4OZ3A 3RMAA 2QKKA 1H1VA 3OW2R 2O67A 2VJVA 4EK2A 3CCSN 2HZAA 3A0IX 4WU3A 3CQYA 4DR1F 4NXMF 1CSJA 4QYZK 3FZHA 4USWA 3ZEUA 3RU0A 2GHWA 4CI6A 4H5WA 2VPXB 2R7UA 4U67Q 1S4EA 1U2RA 4BRMA 1TVRA 3M8PB 3A12A 4DR1K 2HMIA 1QZ6A 3QEIA 5DGAA 4IOAQ 2GJIA 4X4VA 1SH2A 1DY3A 4FWPA 4RU9A 4LF4F 4E8UA 4DUZK 3CQ8A 3MM9A 2GAHC 3GG1A 1FNXH 3VAKA 3TQEA 1NSQA 3AO2A 2V7YA 3U7JA 5KFXA 3O80A 1SC4B 4USIA 5AZIA 3KHYA 2OANA 3OYKA 5AQZA 1DQAA 4CJEA 3BB5A 3J7AN 2ZJPL 4K7QA 3PSIA 4DV3K 3CMEN 2HHTA 3B8HA 3HJVA 1RDBA 1KKHA 1GMUA 1NDCA 4PG5A 2E44A 1TP7A 3OVSA 3PIPQ 2QWQA 4CZCA 2RILA 4M95A 4RUCA 2ZE2A 3BZCA 4DR7J 1SKWA 2ZF5O 2MKKA 5JVHL 3C6TB 3BBBA 2ETJA 3EGZA 3AA3A 2XMKA 3WIVA 1C4AA 1BA0A 4FYXB 2EBGA 4URGA 5KFVA 1JLEA 3QO9B 4OGCA 1RHUB 1SJ3P 1EZZB 1G6BA 1FNMA 3HSGA 1YJTA 3K57A 3VPZA 2PI5A 1OIAA 1RK8A 3F0NA 3KLGB 1BE4A 1QTNB 3MD1A 2Y1JA 5ETVA 2GMHA 1BWEA 2KLAA 5HAOA 2IJNA 5KFLA 5ITHA 4X84A 1O0PA 4RUHA 3UKRB 3O8WA 4EO8A 1MROA 2CAJA 3THXA 4KE5A 3JB9k 2VH7A 3HZGA 3QNNA 3PYDA 2YKMA 2G2YA 4P10A 3EE8A 4WQ5A 1ITGA 3D6RA 3U27A 4QZVB 5I3UB 3CO9A 1WHVA 3FZKA 4BR7A 1GOAA 4RTFD 4CJKA 4WE1B 5ETNA 1IKXB 3PSFA 4KH4A 1NSPA 4TN2A 1X9SA 1H98A 3LUYA 4IO8A 2BJDA 2F7VA 1X4CA 3CIPA 4IRKA 5B09A 2B8PA 4GMJB 3R6MA 4UUXA 3HOSA 5DDPC 4KRWA 4IFVB 3OYHA 4RCHA 4TLQA 1VQSA 2VA2A 2QE5A 1JJ2M 3O5BA 3K58A 2VBWA 1VIOA 3MURP 1Y0HA 1SUQA 2GVDA 2HVHA 3NMUA 1EXQA 1DAXA 4YY3J 3CD6N 4L3KA 3CMAS 1T9VA 4EMDA 3RSEB 3U02A 4FXVA 4KHRA 3TAFA 1P9YA 4IDHA 1NJYA 3I31A 2Z2LA 3RB0A 1RISA 3OUYB 5J2QA 4Z37A 1HNWF 3NAIA 2HYIB 4NXMJ 1ESVA 1JLBB 3SQ2A 4M3TA 3J81j 5AT1B 1MMLA 2F9WA 1VSMA 3VQCA 3G6XA 3D7SB 2FBTA 3EMTA 1Q7LB 3DLEB 3UR0A 4ECSA 4ECQA 2ZGYA 5AZJA 1F3FA 4YMEA 2CGJA 3PZPA 2E1RA 4H8KA 2BVZA 1NDPA 3W9JA 2UU9J 3R5DA 4AFFA 3KOAA 3ULDA 3KLHA 4HLBA 4JI7F 3VQQA 2FF6A 4FXDA 3RBEA 3PR5B 1U1LA 4BCAA 4ZVUB 4NLYA 2NXUA 1CS4A 4KQZA 2L48A 5LMNJ 4LY7A 1X4AA 3IG1B 3NBPA 3NCPA 3C65A 4CIFA 4BVPA 3PYEA 3S41A 2IMOA 2D5RA 4DR4J 4LRAA 5KQDA 3DLKB 3AO4A 1RBLA 2H5JB 1BUXA 2YH0A 1NU0A 1S6PA 3A5NC 1I94J 3J7YP 1BD6A 4DTXA 3CD0A 2ZHAA 4DTSA 1I3OB 3MM5B 1OYEA 3UD5A 2ILZA 2UUWA 2PA8D 2HLUA 3A1YG 3M6GA 3ZT3A 1TU0B 2M88A 4N47A 1IKVA 1T3NA 2GCFA 2IDEA 1OY6A 3BN7A 3HM9A 1KC8O 3MMBA 4NYFA 5KAKA 5A2QO 2G0CA 2DRDA 3PY8A 2RVJA 4CLYA 5AR0A 5JVGL 4NLXA 4YDDB 3DOLA 3AVHA 2DEIA 2GJFA 4CZKA 3DRPB 2LQ9A 2AF6A 4BRAA 5BRHA 5DDRC 4DLGA 4DR3J 5EX3A 3HSCA 1NSKL 2RD5C 3DLLL 1ELOA 2VFRA 2ZD1A 2ATQA 3H90A 3SBGA 4FM2A 3BJYA 3CJBA 4DF8A 1FF2A 2I38A 2HNYB 5CHCB 2MHNA 4ICLB 3W0LA 4AL5A 4LQ9A 4DV5J 3D1OA 3GV8B 1S48A 1WUAA 2XGQA 2M8HA 4IXCA 1RWVB 3DOMB 4RW9B 1HYSB 3HT0A 5HN0A 3CC2N 4UOCA 4Z7YA 3VESA 3THWB 3NF6A 3KTQA 1AFIA 4K2XA 4IH5A 1AZSA 1X3NA 2KFZA 2OPQB 5HLFB 5EX0A 3IGNA 3ELHA 2HZCA 5IWAF 2ZJRL 3CDAA 3O9QA 4ILGB 1UZDA 5LY3A 2ZZNA 2O8CA 3RB3A 4JYAF 1QUPA 3X3UA 2MPUA 1KVKA 3E51A 3SUOA 3AGKA 4CEOA 3VQAA 2E20A 2W8KA 1RAEB 3I33A 3GIKA 4IEIA 4DR7F 1T9XA 3L9ZA 3OFGA 4KRFA 2MGZB 3GB0A 2YNHA 5EDWA 4CIOA 1JLEB 4JI1F 1N5SA 4FF4A 3V9SA 2NXNA 3CC2S 2BJ3A 4M3ZA 1UETA 4KKOB 1KVIA 2BW7A 4PY5A 2OFGX 1AXQA 3OVAA 4PABA 1S12A 1J27A 3W5YA 2E5IA 1RT6B 4ZMMA 5HBMB 1OYDA 4ILJA 3L09A 2BBEA 3EKUA 3M2VB 4JI2F 4CEFA 3IRXA 2JLFA 1O6XA 3I32A 1UOCA 4B3TF 3U9ZA 4LF2A 1BOTO 9ATCB 2Z1GA 2M3DA 1HNXK 2HHUA 3KVGA 4JI6K 2GZOA 1A9NB 2DY4A 3S6EA 2H54B 2BE7D 5GAGI 3GG4A 1VISA 3CD7A 4MAKA 1W7WA 5KFCA 3UVJA 1KOOA 2M2BA 4GRSA 1B9FA 3C2PA 3CJTA 2R8IA 2R7QA 3N6LA 2YXLA 2DR9A 3W9IA 5FJ4A 4C98A 1P1LA 4IO9Q 3SUPA 2LCWA 2WOMB 1P6TA 3W8PA 2QYCA 4MDBA 4N8NA 3AODA 4OZJA 1N34K 3ILIA 3E8OA 4NCBA 1BMQB 3PW5A 3THTA 4DSFA 1U09A 5D3GA 1Q4RA 3TAMB 1RUSA 2AEMA 4EP4A 4AD6A 2YWKA 1KEKA 3M9MB 3SCKE 3VEZA 1XBWA 4JV0A 2G8IA 4J2AA 5KFPA 3IN5A 2LXUA 3T5KA 2ROEA 3TR5A 2HSTA 1SXLA 1WG5A 2C2ZB 1WC6A 3DKDA 2PT0A 4WFNL 3HLUA 5IC6B 5K14A 4E89A 3WT0A 4AILC 4CFBA 5I9EB 3CCMN 2DB1A 1WBBA 5AQVA 1RWWB 3W65A 3BYRA 2B5JA 4J91A 5F8NA 3CD6S 4AUKA 1RCOB