4G1QA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with rilpivirine (tmc278, edurant), a non-nucleoside rt-inhibiting drug
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshot of the equilibrium dynamics of a drug bound to HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 157
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4g1qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4g1qA05
4E1MA 3LP0B 3BSCA 3SYZA 4KV8A 3PW4A 5KFYA 3QZ8A 1C1AA 1IM4A 4H8KA 1LWEA 1HPZA 2HHUA 3SPZA 4K4WA 2UVUA 5C25B 1HNVB 3KK3A 3T5HA 3SCXA 5F8MA 4KB7A 4ELTA 3DRSB 3KHHA 3L3VA 4NLQA 2AGPA 1S48A 3AO4A 2F8EX 3VQ4A 5HROA 1RDRA 3QZ7A 1RAJA 1ZBLA 3ZSYA 2E6MA 2FC0A 5DGBA 3TWHA 3F73A 4QOZB 5HP1B 1EETB 1S6PA 5KG6A 3SUPA 3C95A 3IS9B 3VQQA 2OPRB 3KLFB 3VQDA 1J9AA 2VG6B 4DFJA 4CJVA 3T19A 1WN7A 3H08A 3OYGA 4DSEA 5J2QB 3MFHA 3PY8A 3OHBA 4M94A 3CJ3A 1HYVA 2O4IA 4JS4A 2OA8A 1VSLA 4E7IA 2IAJA 4C8MA 2IAJB 3HVAA 3SV3A 3HVTB 3PO5A 2DFHA 5JUMA 1JKHA 3E51A 2PY5A 1BQMA 5KFBA 4CF1A 1UWBA 4TSXA 3KJVB 3C6TB 4Q45A 3OL6A 3HYFA 3KJVA 4N5SA 3KK1A 3OYJA 4CJ4A 2XRIA 2X78A 1YTAA 4DTXA 1B9DA 3Q8RB 5FRMA 3H4BA 4CEZA 3PVXA 4F4XA 3CJ0A 3HO1A 2W7OA 4BACA 4CHPA 1KLMB 1K1QA 4MIBA 4ECXA 3IRXA 4Z4GA 2IA6A 4CJUA 1UA1A 5KG5A 3PZPA 4IRDA 4DSIA 4N56A 2G8WA 3OL7A 1TAQA 4E3SA 5EDWA 3NAEA 2E9TA 4JLHA 4ECZA 4HHTA 4BE0A 4B3OB 1S10A 2HNZA 1EP4A 2FVSA 3JYTB 3OSPA 3GILA 5KFXA 5KRTA 4ZP8A 5HROB 2IM3A 1KFSA 3AO1A 2QE5A 3B6PA 4E19A 1NKEA 3V6KA 1C6VA 1EXQA 4DTOA 4IR1A 4DTNA 2IDOA 4Y2CA 2D3UA 1RBSA 3HVTA 4QWBA 2I1RA 3KLGA 4ID5A 1VRUB 4WFZA 2WONB 3NE6A 2FLPA 2WONA 3H5SA 4CGJA 3IG1B 4IH7A 3V4IA 5KRSA 3BSNA 4NCGA 1S1TA 2XGQA 2AQ4A 4F8RA 4OLAA 4NLDA 2F8TA 3N6NA 3E01A 1IKXB 5C42A 4RW6B 5DQIA 3VN5A 1S1VB 4CJTA 5KGXA 4RUAA 3T5JA 4NCBA 3SJJA 2XY6A 5HRRA 3TQ1A 3QEPA 2HHXA 1SH0A 3K57A 1JLGA 5JS1A 3SFUA 4DL5A 3QINA 1NJZA 4QW8A 2HMIB 1RT3A 3NGZA 1C1BA 4DQIA 1S1WB 3TAMB 4ED3A 3LAMA 4YFUA 2X6SA 3PX4A 1HYSB 5F9LA 4FZYA 4ELVA 5KFZA 2VG5B 2GBZA 4NLSA 3NGYA 4TN2A 3VQPA 4JRPA 4CJ5A 5CYQA 3MEDB 4Q0BA 1HMVA 1C0MA 1I3AA 2BANB 3O4QA 4B9LA 3CG7A 1LW0A 4WXOA 4AH9A 1RT2B 3OLBA 1Q9YA 5J2NB 1TK8A 4DG1B 3P83D 4KV8B 1T03B 4B8AB 3V4IB 4FLYA 1HQEB 2HNDA 3V81A 3KHRA 4WZQA 4NYZA 5KI6A 4K4UA 4F50A 4HYKA 3BQ2A 4W5QA 3V9WA 4HKQA 3AO3A 3PJWA 5KGWA 3HL8A 5HRPA 3ZSRA 1W9HA 3OYHA 4DTMA 4K4ZA 4K50A 3LP1B 4O5BA 3NAIA 4YQWA 3KTQA 1S9GB 3OS1A 3OVNA 5DGAA 4J9RA 5KFTA 1FKOB 1KLMA 5J2PA 1RT7A 2ZD1B 3HPOA 3PW2A 3RR8A 3AVKA 4M45A 1BQNA 4K8XA 4LY7A 2BRLA 3ZT2A 5KG0A 3C6UA 3AA2A 1JLEA 4UQGA 1IKVA 2R8KA 3VQCA 4CFBA 3D45A 3UR0A 1GX6A 1S6QB 1RYSA 2FBXA 3AVBA 3UIQA 4IFYA 1EKEA 3CIZA 4FM1A 2HW3A 1VK0A 4LSLA 4IOBA 3UQSA 4CEBA 2R8HA 4QAGA 4RU9A 4NCAA 3HPHA 5KFFA 1RTJB 4Q5VA 5KFKA 4I7FA 2WOMB 3QIPB 3N6LA 4ZPCA 4QWEA 2NUBA 4CJSA 3KD5E 2C22A 4DL7A 1WSJA 4OPJA 1LW2A 3EPIA 1TAUA 1HMVB 4J9QA 3DLKB 5F8GA 1KSPA 5KFMA 4CFAA 1LV5A 3K5LA 4WYWA 2OPQA 3OLAA 1S1UB 3H40A 1BISA 3V1RA 3RRGA 3DRRB 3M8SA 4KB0A 2ATQA 1S1VA 4EP4A 4WFXA 1IO2A 1HPZB 4FBTA 3SV4A 4C8OA 4FS1A 1HQUB 1CSJA 3G10A 2RKIB 2V0NA 4TXSA 1TL1B 3CFOA 3KHGA 3DRSA 3NH2A 4HVJA 3GV8B 5T7BA 1L3UA 1JL1A 1UWBB 3U3GA 3DOLA 2F96A 3P1GA 1HYSA 1NOYA 3U6FA 3S3MA 4FJ7A 3OYLA 4HTUA 4WXWA 4JRQA 5HBMA 1ASUA 3M8PB 4DMNA 1MU2A 1QHTA 4MFBB 3LZIA 3SQ2A 4B9VA 5C42B 4O0JA 4J9PA 4RZRA 3QEXA 4RW9A 4DL2A 3K59A 1SV5A 4MIAA 2HNDB 4EYIB 1JXBA 4FW2A 5SZTA 3ZSVA 4FLTA 5CYMB 5F8IA 5SWMA 2HHQA 2W9CB 1FXXA 2RKIA 3S3NA 4WE1A 2WB4A 3GIKA 5DQGA 2GV9A 4OVLA 1NNDA 4CGFA 4CECA 4E1NA 3HP9A 4ECRA 2W9AA 3WNEA 3TAQA 2DY4A 2D0CA 3AA3A 3H4DA 4HUGA 1ZBHA 3LP2B 4CEEA 5I42B 4OL8A 2IOCA 1RDCA 3PV8A 5KFQA 4FW1A 4LSNA 2Y1IA 1VRUA 1SUQB 4DQSA 4JS5A 4RW7A 5C24B 1TK0A 3M8RA 4IKFA 4M3XA 1RT2A 3OHAA 5L1JA 4IDKA 4F4ZA 1RDAA 2YHAA 4FJMA 3CJ2A 4DSJA 3DLGB 2J6SA 3L3UA 4IH6A 1U4BA 2KTQA 4KBIA 3B6OA 5J2NA 4IFYB 4B9SA 3PHEA 1X9MA 1VSJA 4O44A 3C94A 5KFIA 3SUOA 4O4RA 4ICLA 5KFLA 4WE1B 4ICLB 1NOZA 4EP5A 2VG5A 3RMAA 1T05A 1C0TB 3VQ5A 4O3NA 1BCOA 4DQRA 1RYRA 4FJKA 2Z1JA 1N5YA 4B08A 4DTRA 1LAWA 3GV7B 1Y97A 3L2RA 3KHLA 1NK4A 2WHOA 1S1XA 2XY7A 3PX6A 1IKYA 3SQ0A 4PUOA 1IKVB 2XO7A 1DTTA 3KMQA 4OPKA 4IR9A 3NMAA 4Z4CA 2YNHA 4KHSA 4C8LA 4B3OA 3MXMA 3ISNC 5FROA 3VA0A 1YVUA 3G6YA 4DL3A 1C1CA 4EYHB 4CE9A 3SNNA 4B9MA 3V1OA 4MQ3A 1DTQA 3SI8A 1S6PB 1EETA 1D1UA 1A5WA 4FK4A 4W5TA 1JLBB 3AVJA 3IGVA 4FK0A 3V6DA 2VG7B 1S9GA 3LWLA 4LH5A 3FSIA 4NLTA 4IFVA 2RF2B 3QESA 1ZBFA 4DQPA 3DLRA 3QGGA 3WNFA 1N5YB 2OPPA 3VQAA 1LW0B 4ZP6A 2P51A 3BREA 3V9ZA 4AHRA 3G0ZA 1WNEA 4ELUA 3MECB 2FJVA 2IC3A 1JLAA 4F4YA 4Y34A 3CDWA 3H2LA 5KFPA 3CYMA 5EUHA 4CERA 1VSHA 1BI4B 4ED8A 4CGHA 3G6XA 4DSLA 4DQQA 3HSTB 1VSMA 4RW4B 3TANA 3RMCA 1RT3B 1ZETA 2V9WA 4K4TA 1ZTWA 3RB0A 4EBDA 5HBMB 1TKTA 3ZSOA 2OZSA 4I2QA 4X2BA 1Q9XA 4FJHA 4ECQA 4TQSA 4PQUA 1CLQA 2V4RA 1RT7B 3DLEA 4J9KA 4CFDA 4ZP9A 3NF6A 2AGQA 1GOBA 2JEIA 3DLGA 3THVA 5KG3A 3MECA 1KTQA 4AHTA 3V9XA 3I8DA 3RRHA 2IGIA 4IH5A 4O3SA 3L8BA 4E7HA 4EZ6A 5FDLA 3KLHA 1QTMA 3V9SA 3HJFA 1WSFA 3LAKA 4PWDB 2DPJA 2R2UA 4IG3A 4NZ0A 1T05B 1RT5A 4Q43A 4ECUA 4LSNB 3TR8A 3C6TA 4CEAA 5JXSA 4NLRA 4J2AA 4W5OA 2G8IA 3GIMA 3HM9A 5KFEA 1BIUA 4DS4A 2P5GA 2D7SA 3V1QA 2R2TA 5K14B 5HRNA 3DM2A 5KFCA 3QIDA 3WNHA 3C6UB 3OYKA 3OJSA 4IDKB 4DG1A 3TAGA 3KK3B 4Z4EA 3BDPA 4RW6A 2KFZA 4N41A 3AVGA 1Q8IA 3NH1A 1ZTTA 3NF8A 3CJ5A 3ZT3A 3QEVA 4F4WA 1TL3B 4ED2A 2OPSA 4I9QA 1K1SA 2RDJA 1B9FA 1WSIA 1DLOA 3OL8A 3MEGB 3M9MB 3FQKA 4I2PB 3H5UA 2B43A 2IS3A 3HKWA 4FJJA 4CK1A 3CQ8A 1REVB 4CJQA 4E89A 2HHVA 4NLXA 2KW4A 2E9RX 3ZSQA 1XR6A 2QKKA 4NLGA 1U47A 3VA3A 3TABA 4MFBA 4TY8A 5KT7A 4ED6A 4F3OA 3VQEA 4O3RA 2R8GA 1K6YA 4NLUA 1N56A 4GC7A 4CJLA 1BCMA 1SL0A 2D0BA 4NRUA 5C25A 3NKYA 4ID5B 1GOCA 3KNAA 1RT1B 3OYNA 1U49A 5J2PB 1D5AA 3RB3A 4B9NA 3DRRA 2XCPA 3A2FA 2W9BB 5KFNA 4CESA 1NK6A 3VQBA 4EEYA 4OKEA 4KREA 4E0DA 2D5RA 3LDSA 2ZKUA 5I42A 3KIOA 4URGA 4B8CA 1OS5A 4NYNA 5F9NA 3K5MA 2HVHA 5DQHA 2UVVA 3H5YA 1G15A 4KHWA 3O3GA 4QW9A 2XY5A 1DLOB 3QO9A 4KRFA 3RB6A 5F8NA 2Z1GA 3DMJB 3KKSA 4IFVB 3EZUA 2FVRA 4FZXC 1QAIA 3RWUA 4F2SA 4W5NA 4C8NA 3LALA 4G1QB 4IRKA 3NH0A 4NLWA 1T94A 4ZMMA 3OYIA 5DLGA 2R7YA 4FLWA 4DLEA 2ASDA 4PQUB 3KMSA 4J9LA 3LP3A 4CJEA 2FVQA 2J6TA 4R0EA 2YKMA 3VQ7A 1LWCA 3UPFA 1T03A 1HJRA 1RDDA 2HVIA 4M3YA 2B6AB 2BQUA 4MKAA 1TL3A 1QSSA 3BQ1A 4CJFA 4FJ8A 1U04A 3FQLA 4YP3A 1C1BB 4XO0A 4CIEA 3SUQA 3ZSZA 1QUVA 3RBEA 3NF7A 2XI2A 3CJ4A 4YR0A 3OYEA 2D41A 3MAQA 4ZVFA 2VG6A 2FJWA 3QLHB 4HCBA 2YV0X 3TI0A 3GIIA 4RW4A 4RNMA 4TQRA 1W0HA 4O3OA 3OL9A 4BE1A 3DYAA 3KOAA 1HARA 2GIQA 5J1EB 4Q44A 4ZPDA 1C0UB 2VWKA 4QWAA 2HWIA 1VSIA 3DM2B 3T5KA 1JLEB 1X9WA 1IKYB 5KG4A 4EO8A 3OS0A 3AVCA 3L2QA 1YTUA 3DLEB 1NK5A 2OPPB 1TKZB 1NJYA 4TLRA 4KKOB 2Y1JA 4BE2A 1L5UA 2FLNA 4ZTFA 3EYZA 1DTQB 1S0OA 3I0RB 3MEEA 4ECVA 3K2PA 5KG2A 4CGIA 1R0AB 1SKRA 4DL6A 1S0MA 2HB5A 4IG3B 3LP2A 3NBPB 1S5JA 3O4NA 5HP1A 4KHRA 4CHOA 3L2WA 4CF2A 2XWYA 1BL3A 4M42A 3MXIA 3NFAA 3KK1B 1IKWA 3KLIA 3V6JA 3QYYA 4GW6A 3MR5A 3QERA 1RDBA 3OYAA 5I3UB 1RBVA 2XC9A 1XR5A 3TAPA 4CF0A 3CFPA 4MK7A 4DTPA 4ECTA 1KLNA 2HHTA 2IBKA 2QK9A 5EWFA 1S4FA 1JIHA 4KHQA 5DG7A 4DSFA 4AILC 4CCHA 3TVKA 3EZ5A 4YMEA 4XPEA 4CEFA 3BGRA 3GQCA 3BGRB 3CM5A 4RG8A 2WOMA 1TKXA 4I7FB 3Q8SB 2HMIA 1C0TA 1HRHA 3ITHB 2YNGA 4G1QA 3QGHA 5EU7A 4J9NA 1CXQA 4FS2A 1RTIA 4BWMA 3LPUA 4DFKA 3HVRA 1JLCB 4KSEB 3F9KA 4DU1A 2B4JA 5KG7A 2IM2A 1S9EB 3M9NB 2ZE2A 1KRPA 4NCGB 1HQEA 1NK0A 1RTHB 1RT4B 2B6AA 2EHGA 1A5XA 1FKPA 4DFPA 2YNIA 4PY5A 2IC3B 3FRZA 4E7JA 4OKKA 2E6LA 5DG8A 4O44B 3ZT4A 3TAMA 2AGOA 4Z4IA 5HRSA 3ZCMA 4ECWA 2BE2B 1LAVA 4FJ5A 3OJUA 1NJXA 2B5JA 1RBRA 3UDLA 4FJNA 4KI4A 2OPRA 5F8JA 3O3HA 4KO0A 1VSDA 1TV6A 1IKWB 3KLIB 3DLKA 2ASLA 5J1EA 1TKXB 2YHBA 2E4LA 3ICLA 3NGDA 4K4SA 4N76A 1S1UA 2VA2A 4RW7B 5C24A 1F21A 3AA5X 4DWIA 3IG1A 5J2MB 5KT4A 4EBEA 1NK9A 1SV5B 4OJRA 1RBUA 1QSYA 2OPSB 1N48A 4FJ9A 4GVMA 1JX4A 4H54A 5FDLB 3KLHB 3SZ2A 1S6QA 4JV0A 1KVAA 4Z4HA 3IAYA 2DFEA 1C1CB 4DFMA 3VQ8A 3I0RA 4FXDA 4MK8A 4TY8B 3FDSA 3BJYA 4ECSA 4FBUA 3Q8PB 4LQ9A 4QWCA 4ED0A 3NHGA 4K4XA 2AWZA 3OS2A 4ZHRB 4WYLA 2IJNA 1RA6A 1JXEA 2W7PA 4KAZA 4Q8EA 1T7PA 2I5JB 1TKTB 3HPGA 1C0UA 4AHSA 4RW9B 3ISND 5JS2A 3KK2A 2V4QA 4LH4A 2P1JA 4YNQA 2EX3A 3KLEA 3KLEB 3QEWA 4KHNA 4NLPA 4O55A 3DOKA 2QKBA 1N4LA 3D0PA 2YNFA 4N47A 4ECYA 1KHWA 2YNFB 1RTJA 5FRNA 2RDIA 4F3TA 3OYCA 4O0IA 4LSLB 1GOAA 2JC0A 2BGGA 1JL2A 3LANA 5KFDA 2FLLA 1WAFA 2VA3A 1ASWA 1WSGA 3NBPA 2LSNA 2XY8A 3JSMA 4WFYA 3I5CA 3GYNA 1KVBA 3M8QB 2PYLA 3LP0A 5L1IA 4DU3A 2CJQA 2RN2A 3ULDA 4O4GA 3MFIA 3ALYA 3HP6A 1UAXA 1B92A 3O3FA 1XHXA 3M9OB 5F8HA 2A1SA 2JLEA 3HK2A 1N6QA 4HCCA 4KKOA 3TARA 4F4KA 3DRPB 2X74A 2YNIB 1U48A 3AO2A 4H4OA 1CZ9A 3SUNA 3ASMA 4CEQA 2Q3SA 4H4MA 3Q8QB 4J2EA 3GIJA 4CFCA 3HVWA 2KQ2A 3MTKA 3SFGA 2ZQBA 3WNGA 1QSLA 1TK5A 1RTIB 4CEDA 4FLVA 2JEGA 3CDUA 1RBTA 4CHYA 3QEIA 4BDPA 3PX0A 1WNSA 3I5BA 1D9FA 4ID1A 2R2RA 1JLBA 4Y1DA 3H98A 3RBDA 4Y3CA 3M8QA 2OPQB 1L3VA 4CHZA 1X1PA 4IQXA 4CHQA 3MEEB 1JLQA 2YKMB 2IMWP 5E41A 5C5JA 4DF4A 2W9BA 4DTUA 5KT3A 1N6QB 3PW7A 4KPYA 4J9OA 5KFSA 1EP4B 2XGPA 4KTQA 3L2VA 1TP7A 1A5VA 1Z26A 4U6PA 3IS9A 4CIFA 4DL4A 4NLYA 4ZHRA 1FK9A 3V6DB 2D3ZA 3T1AA 4Z4FA 1TKDA 3OY9A 4O3QA 4EBCA 3DYAB 1BIZA 4GMJB 4AHUA 3EY1A 1TV6B 3PW0A 3OYBA 2I5JA 4IRCA 3V9UA 3FFIA 1DTTB 1NHVA 4QCLA 1S9FA 5K14A 1XR7A 2KZZA 2WCXA 1BQNB 4M3UA 3T3FA 1RCHA 2FJXA 3E01B 4CK2A 2D0AA 4FCYA 4ZP7A 3PR5B 1VSEA 1S1TB 4DLGA 1TKZA 2R2SA 1RNHA 3LZJA 3AV9A 2ILYA 3NCIA 3T5LA 4ED7A 3ZSWA 3S9HA 1QAJA 3LPTA 2Z1HA 3MR6A 4YR2A 4RW8B 1NKBA 4OKJA 3QETA 2EC0A 1XI1A 2CKWA 2BRKA 1ZBIA 1JLCA 5KTQA 1TQLA 4Y2AA 4AHCA 1ZYQA 4PUOB 3DDKA 1D0EA 2AJQA 3AVAA 2AX0A 3U3YA 3MF5A 3NGIA 2ETJA 3IRXB 4KHMA 3V6HA 5D3GA 1SKSA 1C2PA 1HYZA 1RT6A 2KFNA 2HNYB 2UVRA 5KG1A 3IN5A 2R8JA 4QWDA 4WZMA 1JLGB 2G8UA 4EO6A 3OYMA 2XI3A 1VRTA 4YR3A 1L3TA 2PYJA 4RNNA 2FBTA 1NKCA 4PWDA 4CJWA 4NLVA 1S1WA 3AO5A 3QNOA 1J54A 3NL0A 4CK3A 4KFBA 4KHYA 4M41A 1BQMB 3DMJA 3ZT0A 4O3PA 2FVPA 4KAIA 4NRTA 4ED1A 3TAEA 2P5OA 3KKRA 4K4YA 1WSHA 1FKOA 2RF2A 4CEOA 5CYQB 2BQ3A 1RILA 1SH2A 2A1RA 4R8UB 1HNIB 4R8UA 4FVMA 4TY9A 3OYDA 1RTHA 3I5AA 4FJXA 1KVCA 4HUEA 3TAFA 1RT1A 5KFOA 3HHKA 4F2RA 3N6MA 4W5RA 1J53A 4NLOA 5KT5A 4I2PA 3RAXA 4K8ZA 3QIOA 4HUFA 4ZTJA 1BGXT 3DLHA 2OZMA 3QLHA 1QE1A 4J2DA 1J5OB 2RPIA 3JSMB 1KFDA 1JKHB 2GUIA 4URSA 2QXFA 3CVKA 2X6NA 2ATLA 2C28A 4CIGA 2E9ZA 1S0NA 4GC6A 1KCFA 5KFUA 5DK5A 1JLFB 4IKAA 3NAHA 3KLVA 4J9MA 4DSKA 4KHUA 5KFHA 2IM0A 1KHVA 2G8VA 1S1XB 1XHZA 5J2MA 4JV2A 1RT6B 3G86A 1IH7A 3RR7A 1L3SA 1LWEB 3IGNA 4CJKA 5CZ1A 2O4GA 2ITGA 3H59A 4KB1A 1WLJA 3RTVA 2YNHB 3MR2A 3S3OA 1VRTB 2VWJA 1JLQB 3SQ4A 3MEGA 5DMRA 1Z4UA 5F8LA 1HNIA 2ALZA 4MH8A 4IG0A 5L1LA 5T14A 4FLXA 3OSNA 4O4GB 4KTZA 4KO0B 1SH3A 3D5MA 1NK8A 4J2BA 1I6JA 2HHWA 4I2QB 1U09A 4URQU 1XC9A 4RUCA 4B9UA 2GC8A 1IKXA 3DLBA 4ZVEA 1Z25A 2ASJA 1TGOA 2ZD1A 2BR0A 4MKBA 2UUTA 1IG9A 1JXLA 3L2UA 4EZ9A 1O1WA 3KK2B 3AVFA 4FZZA 2WTFA 4M3RA 3I0SB 4FM0A 4MK9A 3DRPA 3PJXA 4CJ3A 3DOKB 2GIRA 2HNYA 3K58A 4CHNA 4Y1CA 1SL1A 3AVHA 4JUZA 4CJPA 3DI6B 4FJLA 4DEZA 4OLBA 5KFJA 4LD0A 1REVA 2HAIA 1SUQA 1VSFA 3AA4A 3HXMA 4Q8FA 4BDZA 3FFIB 4DTJA 4DS5A 2UUWA 3LP1A 3VQSA 2VG7A 4QPXA 3NDKA 3KLGB 1XWLA 2DTUA 5HLFA 3KD1E 2BANA 5KFRA 3RB4A 1YT3A 4RNOA 3V81B 1FKPB 2W9CA 4FLUA 1WAJA 3SQ1A 2JC1A 3PO4A 3BSOA 3ZT1A 2AU0A 4KI6A 2BQRA 3MR3A 1RTDB 4E7KA 3DOLB 1LWFA 4J9SA 1RA7A 3G6VA 3VQ9A 3RMBA 1UOCA 4OGCA 1CXUA 2QV6A 2YNGB 4M3WA 2YKNB 3HT3A 2BE2A 1EX4A 2JEFA 1NHUA 1ASVA 2IJFA 2KZMA 3AVIA 4IBNA 2O5DA 1NK7A 2C2RA 3PUFA 2R8IA 5KFGA 2JEJA 4R5PB 3M8PA 5KFVA 4R5PA 3QGIA 4TYBA 3VQ6A 3MXJA 2W8KA 1D9DA 5D3GB 4DTSA 4BDYA 1S9EA 1W25A 3CWJA 2PZSA 3JYTA 1SKWA 2IM1A 2FBYA 5KT2A 2HWHA 4RNHA 3CDEA 4K4VA 4IG0B 2XHBA 4M3ZA 3GV5B 5CYMA 4XPCA 1TL1A 4FJGA 4KFBB 4M3TA 2WK4A 3H5XA 1LW2B 1RTDA 3BQ0A 2DFFA 3NF9A 4U7CA 1FK9B 1BI4A 4KTWA 1YVFA 3RMDA 1J5OA 3QIPA 3PW5A 5I3UA 4L8RB 4OGEA 2B5JB 1MMLA 1QS4A 2C2DA 4RNFA 1VSKA 1TVRA 4TYAA 4ZPBA 3EPGA 4C8KA 2F8SA 1JLFA 5DLFA 3AVMA 1D8YA 3PR4A 1HQUA 5L9XA 1T8EA 3CFRA 5J2QA 5KFAA 1BHLA 2XCAA 3MEDA 4Q0BB 3OYFA 4M95A 4CJRA 4ZVHA 4E7LA 3BSAA 4H4OB 1QQCA 2G8KA 1RT4A 2JGUA 5EWGA 4AHVA 1ZBUA 2Z1IA 4LQ3A 4ZPAA 1GX5A 4XIUA 4CGDA 2OH2A 3AVNA 3K5NA 2W8LA 4FLZA 5L1KA 4ZVGA 2UVWA 2YKNA 3RAQA 3P5JA 3ZSXA 1ITGA 2HHSA 1QE1B 4DF8A 2W42A 2C2EA 5CY4A 4FK2A 3QO9B 4I9LA 4DU4A 2FVCA 3KLFA 4CF8A 1T3NA 2J6UA 1S97A 2ZE2B 1CZBA 5CZ2A 5KT6A 4BWJA 3SI6A 2AX1A 4FYDA 2DPIA 3CM6A 3K5OA 4Z0UA 3I0SA 3QNNA 5EWEA 1SL2A 1JLAB 1U45A 1LWCB 2G8FA 4NYFA 3SPYA 4FM2A 3CO9A 3AVLA 1HNVA 4CF9A 1LWFB 3DI6A 4JV1A 2OYQA 4H4MB 4PA1A 2HNZB 1X9SA 4KE5A 2ILZA 1R0AA 4B9TA 2G8HA 2BDPA 4FJIA 5KFWA 1NJWA 1UA0A 1RT5B 3ITHA 3BR9A 5DG9A 1WSEA 2FBVA 5HLFB 4RW8A 1I39A 4CGGA 2WRMA 4G3IA 1MU2B 1TVRB 3LWMA 3D28A 1S49A
chains in the Genus database with same CATH superfamily
5JVHQ 3G71N 3BSCA 4CZCA 2LLZA 5A2QO 2HHHK 2HFZA 3BGOP 3PW4A 3B4DA 4PEOA 3QZ8A 5H1SV 3SPZA 2UVUA 3T5HA 1FNOA 2E7VA 4KB7A 3DRSB 2VC1A 3KHHA 2F8EX 3VQ4A 1VMBA 5I3PA 3MCSA 2W25A 4F0MA 4LF5J 3ZSYA 4UF4A 5DGBA 3TWHA 4QOZB 1YQHA 2VFUA 3SUPA 3C95A 2OPRB 3D0HE 1UJ5A 4K7QA 3VQDA 2VG6B 4M5DB 4MKVA 1FA0A 3T19A 4H5RA 2KHCA 1IR0A 1XEZA 3EO3A 2D1KA 1NMDA 3EMTA 2W40A 1GLBG 4QS9A 2BUPA 3OR1B 1M5KC 2KHOA 4JD2B 2HBMA 2V68A 4L3QA 4CTAB 2O8DA 2IFXA 2R7VA 1UVKA 3HVAA 3IR6B 2M0GB 3L7UA 4OYAA 5GVQA 2MY7A 2IVFB 4FF1A 3C14A 2XS2A 3TX8A 5JUMA 4HTLA 3E51A 1SC3B 2DIVA 5GAHP 4KY3A 5DM7Q 4ILRA 1WC4A 3WXKA 3DRYA 4BRPA 3K0SA 4LF7J 2X78A 2ZHBA 5F3TA 3CC7N 4CEZA 3HO1A 2W7OA 3VEOA 1KLMB 1OQ3A 1HWJA 4Z4GA 1JQGA 4CJUA 2EKNA 1NB7A 5KG5A 3PZPA 1HFEL 4OMFG 4NEZA 4ECZA 4HHTA 2A2CA 1I51B 3BPSP 1EP4A 3ZTPA 2ZH9A 1BOTO 1HBUB 4KH4A 1X3MA 5HROB 3A3NB 4KH6A 1QJHA 4X4UA 3FVYA 4XK8C 1NKEA 1J5EF 1EXQA 1HHQA 2X3GA 4I56A 3NNHA 1RWVB 2A18A 2QN6B 3WXMB 2MHNA 1NGCA 2D3UA 3HVTA 2I1RA 4DCPB 4CO1A 4WFZA 4PG5A 3NE6A 2WONA 3H5SA 2QGFB 3OTOF 2ZBPA 1UVNA 4KRWA 3BSNA 4DR1K 4YDDB 4LBPA 4P2FA 2VASA 2ZH2A 4JV5F 3R6LB 2CYYA 4NL5A 4OI6A 4JKGA 4ANDA 3GZ7A 3SQGA 3T5JA 2UXBK 3DU5A 1SVDA 1X7VA 3QBXA 3QEPA 2HHXA 4AQYJ 3BYPA 3QT8A 3FEYB 3CPWR 2LEPA 3E9OA 3S1TA 1SQFA 1BDGA 3LAMA 2JRSA 3FKBA 5F9LA 4FZYA 4ELVA 2GBZA 2QWPA 4NLSA 3VQPA 4JRPA 2FSNA 2BANB 2A42A 2YJEA 4B9LA 5LY3A 4WXOA 3M32A 2HBQB 1WB9A 2FLOA 3Q7BA 4B8AB 1QTNB 1AZSA 3H3OB 4DR6J 1YAGA 4OHXA 3KHRA 4NYZA 3V9WA 5HOOA 3AO3A 3D6TB 2YHXA 4GKJK 4N77A 1QVGR 3EICA 2Y8WA 3HL8A 3QT5A 2ADBA 1DFDA 1S9GB 3OVNA 5DGAA 1AFJA 5KFTA 1B99A 1FJEB 1RAEB 2ZZNA 1RT7A 4JBCA 2ZD1B 2FHKA 2L9NA 2XS7A 3R2DJ 3MPDA 5B0EA 2ABYA 2YX1A 1WACA 5AQLA 4DR5K 1WC0A 4E8UA 1RYSA 3BF3A 4LIWA 1NB2A 1E4GT 1YIJN 5FJ4A 3BF1A 4L73A 4MAKA 2E5LF 4BQZA 3A3OB 4WK3A 5AQIA 2R8HA 3HT0A 3NG8A 4NCAA 3P31A 1HLWA 4PXCA 2KM8B 2CQ0A 2GW8A 1GMVA 3THWA 2FHJD 2GFFA 4LF6K 4BRIA 2QLWA 3EZOA 2OPQA 1PGZA 4LF5K 1S1UB 1FESA 4FWQA 4H0YB 4JD2A 3G6EN 3I82A 3LGMA 3SV4A 4N8NA 1Z6RA 2H5EA 3FSXA 1CSJA 4HTJA 5EN1A 1PSDA 1P90A 5A8WB 4KHPJ 3NH2A 4HVJA 4I0WA 2ACMA 3RGIA 1JL1A 3DOLA 4OYBA 2CQGA 1HYSA 2DHHA 1LXJA 5B0CA 1VQ5S 2J0SD 5C12A 1JJHA 4FJ7A 4OX9F 4WXWA 2AYMA 4IYQA 2F8HA 1T11A 2CWKA 1QY7A 1UFWA 1VJWA 3CJ1A 2NRZA 4DHVA 2QLXA 1OPZA 2VCPA 1VHFA 1DQ9A 5C42B 3SBGA 3H90A 3QEXA 1N5VA 2RIJA 4MIAA 4EYIB 5AE1A 4YOWA 4FLTA 5F8IA 5SWMA 2W9CB 2C2ZB 3MMCA 2KH9A 4WE1A 1V9OA 3GIKA 5DQGA 3AXMA 3MCMA 4OVLA 2F4VF 4E1NA 4CBUA 4H0PA 3GYGA 2W9AA 3WNEA 3CCRN 1SKUB 2XMWA 2NXCA 4HUGA 1WTFA 4W4MA 3JTOA 3LP2B 2EFGA 3I55S 5I42B 4L6V3 2P6SA 3JB9k 1R8AA 4JS5A 4RW7A 5C24B 3OBWA 1TZ0A 2HQDA 4IKFA 1LXNA 2V2KA 4PYAA 4CT9A 1WORA 3Q8UA 3DNCA 1RDAA 3FEZA 2OD6A 1TU0B 3DLGB 4DSJA 1U4BA 2GVZA 3B6OA 5L9NA 4FOIA 4IFYB 1EWQA 4AXJA 2K2PA 1PCAA 4CLLA 4ZVRB 1X9MA 1VSJA 3C6HA 4YY3F 2H5IB 2N7YA 3NMUA 4JV5K 3AY9A 5KFLA 1T02A 5SUHA 4EP5A 1T05A 1C0TB 1Q4RA 2GMLA 4BR7A 5K9FA 3W2VA 2Z1JA 2BJ9A 1GT8A 1VAZA 3L2RA 4DV4J 2WHOA 3I56N 2KKZA 1SC1B 1IKYA 3VAGA 3SQ0A 4PUOA 4DR2J 4HLBA 3KMQA 4NA3A 1O51A 4LF1A 4Z4CA 1GEHA 2ZOGA 3U7JA 2YH1A 1GXTA 1XN9A 2Q0UA 3MXMA 1IBCB 1MNEA 1ZM2A 4I64A 1YBUA 1YVUA 1UEKA 4DV5K 1H7XA 1AW0A 2BABA 4EYHB 4B9MA 3EL2A 1WOPA 2LDIA 2QL5B 2UUCF 1S6PB 1EETA 1VC6A 2G0JA 1MROB 2KM8C 3IGVA 1UJ6A 4OV6A 1S9GA 4LH5A 3AARA 2A2DA 3C7NA 2K7KA 4NLTA 3RAMA 4UTGA 1ZBFA 3DLRA 4PL7A 3CEDA 3WNFA 3LA0A 1Q8KA 4NPOA 2P51A 4IOAL 3BREA 2NYIA 4ELUA 5IT9Y 2FJVA 1Z1ZA 5GADU 5GAEU 3I31A 2WBMA 5KFPA 2XYGB 2P2CB 3CYMA 5LXRA 1MWKA 3HHLA 1U26A 4F3QA 4CGHA 4DSLA 2Z57B 4USHA 3G96A 1HHSA 3D0IE 2CQIA 3RB0A 1YJ9S 1CZAN 1KXPA 2Z0GA 4FPRA 4ZVSB 2AF6A 1UKUA 4ECQA 2FJAB 1N34F 4PQUA 2CPDA 3W3SA 4WFAL 3GWCA 1RT7B 4J9KA 3GP9A 3H2UB 3KXDA 3NF6A 1SQEA 1MA9B 1SPBP 5KG3A 4C8ZA 3ATVA 3HFVA 1G2EA 3MECA 1KTQA 1KVIA 2Z4PA 3MPUB 3PRVA 3ZC4A 4IH5A 4O3SA 2IGIA 1WF1A 2B9YA 1NDPA 3HJFA 2R2UA 4QR1A 4NZ0A 4A4JA 1T05B 4Q43A 4LSNB 2F40A 2P9PA 5JXSA 3U9ZA 1FD2A 3OA9A 2OCEA 1EZZB 2I0XA 5KFEA 4UUWA 1ZS6A 2YQ1A 4CM0A 2Z30B 1F3FA 4WK1A 3D2FA 5KFCA 4CVNE 3OYKA 2BZ2A 1R0BG 3HFKA 2JLFA 5AFUA 2AW0A 3TAGA 3A8KA 1YJNN 4RW6A 2XMVA 1M0SA 1M90O 3AVGA 3NH1A 2PDAA 4DB3A 3NF8A 2RMLA 1EARA 2ZBCA 4BBYA 2CJKA 1TL3B 4H5NA 2E2NA 4NA2A 1B9FA 4HEA9 1VQ7N 4CDIA 3CQ8A 2CJBA 2OI2A 3AA9A 2D0OA 4V19S 1HUXA 2E9RX 1XR6A 4PKGA 4NLGA 3C2PA 2XQCA 1ZPVA 3QBWA 3V4MA 4ZKAA 2EFNA 4U7UD 2HSEB 4GC7A 1BCMA 3OTBA 1SL0A 2HVEA 3NKYA 2L3MA 1RT1B 5J2PB 3RB3A 4WTOB 4PXEA 4X4VA 4ES3A 2G2ZA 2HHPA 4ALZA 3M2UB 4O0NA 5EX5A 1UJ4A 4CESA 1H73A 3GE9A 4OIXA 2CVEA 3R27A 4AM6A 4E0DA 2V6AA 3LDSA 2ZKUA 5I42A 4EGLA 3KIOA 3G4SN 4A2AA 1OYDA 1OS5A 4PRFA 2K06A 1VQOS 2XLKA 4FPBA 1DLOB 2X1FA 3F9MA 3G8SA 4IFVB 3EZUA 4J8FA 4BVOA 4W5NA 4G1QB 5BR8K 4B3SK 3NH0A 1NRKA 1OMSA 4NE9C 4V19J 1AUDA 4DPUA 3D3CJ 4DLEA 2ASDA 5JVGL 4CJEA 2FVQA 1QVGM 3EXCX 4CO3A 3VQ7A 1LWCA 1HJRA 2B6AB 4JI8F 4U9RA 3PYEA 4EAHD 1QSSA 2LEBA 4FJ8A 1C1BB 5IT9O 2XI2A 4ZVFA 3R7NB 4NYOA 2FIUA 3J7YP 4HCBA 2YV0X 4AL6A 1T9YA 3A8IA 3ENVA 3HBTA 3OL9A 3MN9A 5M2RA 2JWNA 1HARA 1GLJO 5HN0A 1X5SA 3I6PA 2VWKA 2NRVA 4KGKA 2HWIA 1CJVA 4N7TA 1VSIA 1NGGA 3NOCA 3I8BA 3CC7S 3PDNA 1X9WA 1IKYB 5KG4A 4EO8A 2BJDA 4LR7A 4JI7F 2QI2A 3AVCA 2FY1A 1GQEA 1TKZB 4TLRA 3J81O 2Y1JA 4BE2A 3HSZA 3O4WA 1FF2A 4HVZA 4ZTFA 4AL5A 1DTQB 3I0RB 5BRHA 3K2PA 1VQKN 4KIAA 2YQ3A 3ETOA 5KG2A 1WC5A 5L46A 1RGIA 1R0AB 1S0MA 4IG3B 6AT1B 5DZ6A 2RQMA 1MDUB 3EKSA 3RG6A 1PBAA 2HF4A 4KHRA 1TL4A 3HHEA 2GGPB 2HIQA 3M30A 3MXIA 1S57A 4U96A 3KK1B 1UP1A 1IKWA 4JKFA 5I3UB 3NWGA 4PQAA 1LNQA 1RBVA 4KH5A 4KBOA 1VQYA 1GMUA 4CF0A 3NS6A 1VQLS 4TKTA 4OYIA 4USWA 5JICA 5B0DA 2IBKA 2QK9A 2RHSB 1S4FA 2GHVC 4ZPWR 4DSFA 4AILC 3WQPA 4QIEA 1B64A 4XPEA 3L6QA 4N8OA 1B7YB 3BGRB 3CM5A 2V8GA 1VQPN 4I7FB 1TKXA 1VISA 1U1MA 4ILGB 4OZ2A 3ITHB 2YNGA 4G1QA 5JLFA 4FS2A 5F1XA 4DFKA 3HVRA 2I7PA 3PNIA 4G1PA 3NGUA 4U8YA 4DU1A 1U2CA 3MMAB 1S9EB 2ZE2A 3FZBA 5EXWA 3M8ZA 2HFNA 2EHGA 3SCIE 4DFPA 2YNIA 4ZJQA 3A12A 4WU3A 4NX9A 1YK9A 4OKKA 5BYSA 2OP5A 3RW7A 2E6LA 1LKZA 4U67Q 2AGOA 4RLEA 1XUPO 5HRSA 3ZCMA 4DXLA 3D7SB 1NJXA 3Q86A 4FJNA 2BH1A 5H1SQ 3KLIB 3D7EO 3GG4A 5J1EA 4B3TK 3W66A 2HFSA 2Z56B 3D68A 3DLLQ 1FJGF 2YHBA 1Y9OA 2FTRA 2ZH3A 2DRAA 3W5YA 2IVPA 4R25A 5KT4A 2YPYA 4EBEA 1NK9A 2ASPA 1SV5B 2DD8S 1BUPA 3JAMY 1V3ZA 3H8YA 3D2WA 1WG4A 3R5DA 3DFEA 2V52B 3EVMA 4P2MA 3LUYA 3UKRB 4JV0A 2RUGA 3TJ9A 2ZH8A 4Z4HA 2D74B 3TYTA 2ZWHA 1S6UA 4LFAK 3VQ8A 3KDOA 3I0RA 1EB0A 2W1BA 3TWZA 2Q6BA 4MK8A 4YHHJ 3FDSA 4BC4A 1X4HA 2B7CB 2IMOA 4ED0A 4FN5A 3AJDA 3ZETA 5B8HA 4WYLA 4JKCA 2IJNA 2D3OR 3CMQA 2GQCA 3Q24A 3MM5B 5LL6Z 1WSRA 2I5JB 2UZAA 3HPGA 3N4WA 4DR4F 4QPTA 3SSRA 4K59A 2P1JA 2WB1D 3BYRA 3QB0A 3CC4S 3QEWA 4KHNA 1X4GA 3HZ6A 3GMGA 1N4LA 1NGFA 2YNFA 1B70B 1FWLA 4ZN3A 1VDHA 2RDIA 2D1CA 5E3QA 4ZLPA 4LSLB 2JC0A 1TTHB 4ZOSA 2P9EA 1A6LA 2VD3A 3BBCA 4LF8K 4OJ3A 3NBPA 3I4PA 3IWLA 4Z7CA 3GYNA 2MJUA 1BY9A 2YWWA 1H0HB 4DU3A 5M2PA 1P1TA 1O6XA 3MFIA 3HP6A 4LRCA 1Y00A 1XHXA 3A8JA 1CVJA 1NLVA 3BZKA 2ZC3A 4FXVA 1N6QA 3DHWC 2O8FB 3WUHA 1SIZA 1JJ2R 4GV3A 3AO2A 1J2VA 1IBLF 1WF0A 3OTEA 4CEQA 1NGJA 1VQLN 5A6WA 3GIJA 2OFGX 3GIRA 5IM0B 2ZQBA 2HWTA 2LA6A 3D6RA 3FLCO 4FWNA 4BDPA 2Z2YB 2QFJA 3I55N 1WNSA 3OFGA 2NREA 4QBUA 1JLBA 4Y1DA 5GIPA 5E0OA 1X4DA 3IM9A 2NLXA 1B7FA 3N5FA 3DU6A 3O8WA 3TOQA 3BS9A 1L3VA 1X1PA 4CHQA 3MEEB 1JLQA 4M5GA 5C5JA 1F5CA 2W9BA 2E1AA 4KPYA 4DV4K 2ZVSA 5D0HA 5KOXA 5BPMA 2XGPA 5HSPA 2XHWA 1W2IA 2DO0A 4U6PA 3ATUA 1FDBA 4DL4A 5KPRA 2D3ZA 3T1AA 1TKDA 2FJBB 1O5JA 1X4EA 4EBCA 4AHUA 1Q5VA 1VQ4N 3K0JA 3PW0A 2I5JA 3V9UA 3FFIA 3QJJA 1XR7A 2GO9A 3C7NB 5HMWA 4UY8T 3MM8A 4JI0J 4M3UA 2GJFA 2CQPA 2B8PA 3E01B 3BKTA 3Q8VA 3TSPA 1ZAWA 1VSEA 1M5PC 2W6LA 4CZHA 3BM7A 1ATSA 3MMCB 4ED7A 3ZSWA 2X7IA 2XMKA 1FJGK 2V2VA 3QETA 2EC0A 1RK8A 1XI1A 2BRKA 2UXCF 4GV9A 1KR4A 2B51A 4Y2AA 4MIWA 4PUOB 3VZHA 1D0EA 2AJQA 3AVAA 2AX0A 3U3YA 4TLQA 5AXMA 4DZ6A 3MF5A 3CDAA 3IRXB 3V6HA 1TR0A 2JHEA 1SKSA 1C2PA 4OJGA 3KKFA 4DHYA 1YITN 1T6CA 3IN5A 4BRFA 2HBLA 2RD5C 4EO6A 4MT1A 4BREA 4A61A 4PWDA 2G1HA 4DJBA 1S1WA 4DX6A 3PFEA 2CQBA 2KJWA 1GXLA 4KHYA 4DUYF 3U9DA 3LDLA 3ZT0A 4HR2A 3KKRA 4LIRA 3JQMA 4X64F 3J80Y 1RCOB 4OYZA 3JS6A 3D54A 4C1NK 1TELA 4JK8A 3M6GA 1E6VA 2OO4A 4R8UA 1RWNB 4FVMA 4KH0B 3FUYA 3AH6A 3D6FB 1Q7YT 4HUEA 3E3XA 3VMFB 4OHYA 3O1LA 1U0SA 3HHKA 4W5RA 4MDBA 4I2PA 3LPEA 2AJ2A 2DK2A 4K8ZA 4GVBA 4HUFA 1J5EK 5ETKA 1AFIA 3QLHA 3V2UC 4KGVB 4J2DA 2PO4A 3THYB 2QXFA 2X6NA 2H48B 1HR0K 2C28A 2E9ZA 3W2VB 1A0OB 1ATNA 4IKAA 3SMPA 3OUYB 3KLVA 4BR2A 4K42A 3AT1B 4RBTA 1NU0A 1NXIA 4JK9A 4JV2A 2DGWA 1WUUA 5CZ1A 2O4GA 2XMUA 1Q81T 3P38A 1N34K 2IBOA 3LGNA 3TQEA 4BVPA 1JLQB 2WBRA 1D9AA 4JYAK 3VAMA 1NJIO 2JL9A 3IAM9 1K73T 3AJ1A 4DV5F 2WVEA 2ZHOA 4OZJA 2LP4A 3VGTA 4O4GB 1JB0C 4KTZA 1Y7PA 4KO0B 2FZKB 3EVWA 1RFQA 3D5MA 1NEEA 4J2BA 2M88A 5GIOA 4RUCA 1XTZA 4UZBA 1IKXA 4ZVEA 2QC3A 2VBZA 4DV0J 1X60A 1RHRB 1KQGB 7FDRA 3L2UA 3HULA 1H2VZ 3AVFA 2V4JB 4RL1A 3DOKB 2GIRA 1BWFO 2RU9A 3K58A 1YJWS 3P39A 4JV5J 4JI6K 4CRJA 4M1KA 4IO9L 4A8KA 4DEZA 4E98A 2FHOB 4LMZA 2UXCK 3FZMA 2W41A 3VAFA 4BDZA 3AA4A 3FFIB 4DTJA 3LP1A 1GFWB 4DV4F 2VG7A 4QPXA 1WKLA 1DQAA 4KGZB 1WUAA 3Q22A 3KD1E 5HAOA 5KFRA 2XSJB 2HGNA 3MUMP 3DDNA 4F0KA 3VEVA 2G9OA 1PG5B 2RRAA 3O9TA 2NLWA 3MD3A 2O8FA 3BSOA 3ZT1A 1ZA1B 4U95A 2R42A 2BQRA 1RTDB 3GSDA 1GLAG 4A8FA 3DRXA 2DITA 3G6VA 3VQ9A 1EO1A 2C3YA 3P5BP 3ZX0A 3W60A 1WDTA 4A8OA 2P9PB 1HBOA 1OH5A 3WHIA 2BE2A 1EX4A 4HT7A 1NHUA 2KVIA 3OTOJ 2ZVIA 3HSDA 5KFGA 5KFVA 3MM6A 3VGKA 2QZ8A 2H51B 4LFBJ 4TYBA 2QL7B 2NZ4A 1IXKA 1UL3A 2CPJA 3TU5A 3NNAA 4RNHA 3CDEA 4ZVQB 3VF4A 1UPPA 1Q82O 5K8PA 3ZTQA 3MK6A 1OQ6A 3LH2S 4I6MB 3GCWP 3BH6B 1LCUA 1FRLA 1IBKF 2RRNA 3IC1A 3SIPB 4I4BA 3H42A 5TKWA 3HHLC 3BQ0A 2DFFA 4U7CA 1GLCG 3OFFA 1FK9B 1I3OB 2BKPA 1YVFA 4A2BA 3TUPA 2DHSA 2B5JB 1SCJB 3C15B 4LF5F 1TVRA 4TYAA 3VCDA 4C8KA 4PPDA 3K9KA 2F8SA 5J1PA 1HQUA 5L9XA 3R1HA 2A6OA 1JK9B 4OI0A 2P9NA 4GKJF 5KFAA 1BHLA 5DETA 1HNWF 2QMXA 4CJRA 4B1YB 1WDDA 4E7LA 1QQCA 2G8KA 3MAAA 1V6HA 4M63A 3QFUA 3GR1A 3AAWB 1GX5A 4M63C 3UCGA 4CH7A 2E8AA 2YKNA 2VL1A 1ITGA 2HHSA 5D4LA 1QE1B 5IXUA 5F2RA 2HQCA 1YJRA 5A8KA 5BRFA 3TVZA 5CZ2A 4IEEA 5AQRA 3SI6A 4F3MA 5B0AA 2GQQA 2AX1A 2DPIA 4Z0UA 3MDQA 2QWMA 4JEPA 1TYQB 2YKAA 1SL2A 2VOPA 1LWCB 4Y2KA 4CH1A 3OXLA 3CMEN 4CLKA 1EX8A 3B8HA 4LF4F 2AKWB 3SMSA 3CJRA 2KT2A 1Z2ZA 3A5NC 1N5TA 4FJIA 1RT5B 3ITHA 4RJVA 2M8HA 3R8YA 5KAKA 1ZOTA 4RW8A 1WI6A 2WRMA 1N32J 2KKHA 2M2BA 3R7SB 4FZVA 4EFAC 2WTUA 4K0KF 1S49A 1HNZF 4E1MA 2GEMA 3SYZA 4KV8A 3VAIA 5B09A 1IM4A 2QLJB 3TZXA 3KK3A 1X4CA 3TP2A 2CDRB 3IFEA 3AO4A 2H1YA 1FE0A 1RDRA 3QZ7A 3CUNA 1RAJA 4YOEA 2WW8A 1EETB 1S6PA 2H4YB 3MWTA 5LSOA 1MG7A 1RTZA 2CNKB 1RKJA 2QX0A 5IS2A 4ERDA 2F8MA 1J9AA 4DFJA 4WP3A 1FDDA 2CJ9A 1VQMS 2YCHA 3MFHA 3T1YJ 3OHBA 4M94A 3CJ3A 4V1Ak 3LF0A 2DT9A 1WOQA 1HYVA 4BRGA 4JS4A 2OA8A 3DCAA 4E7IA 2YX7A 5KPZA 4C8MA 2H9ZA 2YKQA 2DGQA 1KQSR 3UKRA 3M2VB 4Z37A 2DFHA 2LXIA 1JKHA 4WFBQ 1BQMA 1WHWA 5KFBA 2ZGZA 2IY5B 3KJVB 3HYFA 3OL6A 4N5SA 3KK1A 3AD9C 3OYJA 5G0RA 4QIWD 2JOQA 3H4BA 3SSSA 3QT6A 1K1QA 1Q53A 4I69A 5CH7B 3C15A 1Q95G 3MM6B 1QQMA 2EC2A 1TAQA 4X62K 3NAEA 2RB7A 4BE0A 1S10A 2QJ3A 3QAUA 2KHDA 5KRTA 1HBOB 1Q86T 3AO1A 5D0EA 1DT9A 3M3ZA 2O8DB 3B6PA 4UW2A 3V6KA 4FWPA 4DTOA 5HMZA 5LJWA 4DTNA 2OAUA 1ZXOA 1MROA 2KYXA 4JKHA 1RBSA 2I6WA 4QWBA 3KLGA 5A0YA 2G13A 2XSFA 3S7RA 4ID5A 1SBRA 1VRUB 2R7OA 2DR8A 4CZFA 2WONB 2EWSA 4CGJA 3HTVA 4IH7A 3V4IA 2ZH7A 3O08A 4NCGA 1S1TA 2XGQA 2AQ4A 4OLAA 2UV8G 3BGFA 5DQIA 3AGKA 4RW6B 1S1VB 3OV7A 4CJTA 4Q7AA 4LBHA 2V9KA 5KGXA 2G2OA 4RUAA 2CQ4A 3CF5L 3SJJA 3TQ1A 1SH0A 4NXMF 1X8DA 1JLGA 2NPFA 3ILJA 3ILLA 1NDCA 3TTDA 2O8CA 4DQIA 1LEOA 1ZM3A 4YFUA 3KWGA 8AT1B 2NQPA 5KFZA 2DXEA 1Q0NA 2VG5B 5FLXY 3NGYA 3TVYA 2PEHA 1QLNA 3MM5A 5CYQA 5F0UA 1C0MA 2FB0A 4MTPA 3HMJG 2EW9A 2FZGB 2A6MA 3CG7A 4OI2A 4XDCA 3CE8A 1RT2B 1I94J 4J90A 2ERRA 3P83D 4KV8B 2PMWA 2VICA 4DR3J 4BC2A 2VDHA 3HSJA 3M2UA 2DISA 5C2DA 1HQEB 1FFWB 1WF2A 3V81A 2IVNA 2ZITA 4W5QA 4HKQA 3PTWA 2MKHA 1Y10A 2OEJA 1TMJA 4NB4A 1FWPA 1W9HA 4EIAA 4DTMA 1IBMJ 2YWKA 2GWJA 2C1EB 4K50A 4HTIA 1M1GA 1NSPA 4J9RA 1KP6A 3WC2A 1FKOB 1UZHA 3UCUP 1KLMA 1K8KB 4HHUA 1UCNA 2R7RA 2W01A 4M45A 4K8XA 2FSKA 6FD1A 4PAAA 3C6UA 3AA2A 3P49B 1JLEA 4HI1A 3CMAS 1IKVA 4JI4K 3VQCA 3UR0A 1GX6A 2NRHA 1M5OC 4DR5F 2FGOA 1S6QB 4LREA 3VTHA 4FM1A 2VGMA 2PT0A 1VK0A 4LSLA 4ANEA 3HPHA 1HNZJ 1RTJB 3LO3A 5AQXA 3DGPB 2DNZA 3K89A 5KFKA 1ELOA 2WOMB 3QIPB 5A0YB 3N6LA 4B3SF 4QWEA 3BF4A 2NUBA 4CZJA 3VESA 4FP9A 4CJSA 5M1NA 3T69A 2ZGYA 3EPIA 1TAUA 5LT5A 4J9QA 1DHMA 2J9EA 4CFAA 2BVZA 4WYWA 4M7XA 4B1UB 3OLAA 5H9FK 3V1RA 3RRGA 5RUBA 5BN8A 2HZCA 3JSYA 4ZLJA 4C8OA 2XNRA 4C8YA 3O2IA 4W98A 3K5PA 3ENOA 2IRUA 4HI2A 5AQKA 3CFOA 5HVGA 5HMXA 3KHGA 1M1KT 3GV8B 4MMOA 2LA4A 5T7BA 1QUPA 5ETMA 4JP8A 2RS2A 2VPZB 3UD5A 1GLEG 4MLEA 1N34J 3CT9A 2DCUB 3OYLA 4HTUA 1MSWD 2VQFF 2Q97A 3UDCA 1KNZA 1WELA 2UXCJ 2J7UA 4DMNA 2DEJA 3O80A 5FPNA 1QHTA 2DGSA 1ZC6A 3SQ2A 4B9VA 4AQYF 4J9PA 2QTDA 4RZRA 2EG1A 4HL9A 4BRCA 2HHQA 1FXXA 4CLTA 2RKIA 2ZBRA 4NLBA 4C9DA 1YBTA 2WB4A 3BGUA 3S3NA 2GV9A 2RE1A 4CGFA 4ENOA 1BG3A 4ECRA 1RAOA 4CZKA 2BKOA 2LEAA 2D0CA 3F41A 3AA3A 1U2VB 3H4DA 1ZBHA 2MGZB 5BRDA 1IBKK 4OL8A 1N0VC 2YHYA 1RDCA 3PV8A 4FW1A 4W92B 2Y1IA 1VRUA 4DQSA 4JI6J 2DGVA 3MN5A 2F63A 4A8XA 1UFLA 3M1VB 5MLCV 4M3XA 1X5OA 1VBZA 2LU1A 5L1JA 3ENAA 4IDKA 4BQLA 4F4ZA 1YDLA 2L48A 2DGTA 4GKKJ 2J6SA 3TO8A 1RISA 3WT0A 2HQGA 3VR1A 4QYRA 1JXVA 5D0RA 4F25A 1HBNA 2D9PA 3CD5A 5KFIA 4O4RA 4ZVTB 3OBIA 1FRJA 4ICLB 3AODA 5HJYA 2KRBA 2ZJRQ 4B3TJ 4DR7F 3SJHA 2YKPA 4B08A 1WBDA 1LAWA 3GV7B 1NK4A 1S1XA 2XY7A 3PX6A 4TVAB 2ALYB 2LXUA 3WX8A 1DTTA 2V2QA 4IR9A 4IZ9A 3H1QA 4WPAA 3NMAA 3WEEA 1OH7A 1T9XA 5BR8J 4UUXA 3CERA 2OTJS 2P8IA 1VQSA 4OPAA 4CT8A 1NGDA 1VQ7S 3G6YA 5BJRA 4JI8J 4CE9A 5AXNA 3V1OA 4GY2B 1DTQA 1JCGA 4YN3B 4W5TA 3R6MA 2XB2D 3F0NA 2ATCB 4YOUA 3V6DA 2VG7B 2NXEA 4NZ6A 1HR0J 3CMAN 1MLAA 3RSEA 3FSIA 4BRLA 3QESA 5EHHA 3FK4A 4BRDA 5I4MA 2VIHA 2DBBA 4DV6K 1SXLA 2UU9F 1N5YB 5EVZA 1IBMK 1LW0B 3SXLA 3V9ZA 4H5VA 1WNEA 4P7TA 3MD1A 4WCEQ 3T41A 2IC3A 4Y34A 4O8KA 1X31C 4RPFA 3BY5A 3HHDA 4IUFA 4ED8A 1VQON 3G6XA 4DV0F 3DXMA 4DQQA 2ZC4A 1VSMA 4RW4B 1RT3B 1ZETA 1R8BA 1ZTWA 1TKTA 2CUYA 1R0CB 2NUUG 2OZSA 4X4QA 3L09A 5DDQC 4FJHA 1Q78A 5LJVA 2V4RA 3K2YA 3T6BA 1K8KA 1CULB 2P9KB 1IVZA 4CFDA 3DLGA 4WFBL 2VJUA 5HQ8A 1Y3KA 2V4JA 3V9XA 2ZJPL 3NNCA 1EJ7L 1M5VC 4X65F 3OT9A 3Q7CA 5FLXU 1XNRJ 4NXNF 3LAKA 2CNNB 4B3MJ 4IG3A 2C3PA 1ZZNA 1U2FA 1S22A 3TR8A 1GLFO 2ZNYA 4JI2J 1PJ7A 3CGIA 4NLRA 4J2AA 2ZH1A 3THXB 4W5OA 2GQ2A 2G8IA 2HMPA 1VBYA 3A0IX 3GCXP 2FY8A 2IVOA 3TRGA 4DS4A 2V8VA 4JI7K 2P5GA 3V1QA 3O9SA 4AFFA 3G71S 2RQCA 5HRNA 3DM2A 1NHKL 3QIDA 4F02A 4YHHF 2UXDJ 4IDKB 2FGCA 4DG1A 2Q66A 3KK7A 4O8UA 2KFZA 4KGMA 2BEFA 5C2FA 4P52A 1QD1A 2GX9A 1ZTTA 5M1KA 3QEVA 5CR4A 2LMIA 2KB2A 2RDJA 1WSIA 1UW4A 3MEGB 3V5RA 4AQYK 3FQKA 2CADA 2B43A 2IS3A 4CK1A 4RUBA 4CJQA 4E89A 2HHVA 4K2XA 2KW4A 3G82B 2HGMA 1U47A 3VA3A 4DN9A 5KPTA 3BKFA 4EI2A 1FTCA 4MFBA 4ED6A 2UUCK 3NCQA 5HI7A 1UEVA 5D6GA 4BRHA 3VQEA 3CF5Q 4O3RA 4NLUA 2ZOFA 5T7LB 4CJLA 2D0BA 4QU6A 1LWXA 3I96A 3OYNA 1BWEA 1D5AA 2XCPA 1UETA 3QNWB 5EX3A 2W9BB 1A7GE 5GADI 1NK6A 3QQCD 2D5RA 4WF9Q 4AF1A 1Q81O 5F9NA 5DQHA 3IA0A 3H5YA 1G15A 2F9WA 1YHQN 4GKJJ 1N33F 4QW9A 4CQ1A 1RJJA 4KRFA 3RB6A 3RYLA 5F8NA 4OZLA 3DMJB 4FZXC 2FVRA 4U67L 4F2SA 4C8NA 3CCSS 3GTYX 3W1YC 3OHRA 1KC8O 2R7YA 1TL7A 4PQUB 4HH1A 3KMSA 2G0IA 1WKJA 3ISZA 4HH0A 5B08A 3UPFA 1T03A 1RDDA 3W8PA 2BQUA 4L76A 2XO6A 1K47A 3T9NA 3ZNUA 3BQ1A 1HWIA 4L75A 3KNGA 2MKYA 4JI0F 4YEAA 5BR8F 3NF7A 3ZSZA 3OYEA 3MAQA 2VG6A 1VS3A 2FJWA 1B0TA 4C2MA 3ULEB 3GIIA 4E2FB 4RW4A 1HWUA 4TNOA 4BE1A 1IG8A 2GO8A 3D2EB 5CZVA 2GIQA 4DX7A 3L4BC 2EEYA 5B0BA 1FVSA 2VKRA 1VK8A 3G6ES 1Q18A 7AT1B 3WIUA 1NJYA 4F0HA 5TKYA 4KKOB 4IOCQ 1L5UA 2FLNA 1Y11A 3SK3A 2OELA 1MN7A 3MEEA 1LQ9A 1P9QC 2U1AA 2HBZB 2CIMA 2HB5A 1VQ5N 3X1LB 1OJ4A 3NBPB 3DXMB 3TUZC 3THWB 4K8RA 4ISEA 3NFAA 4OX9K 1VQ8N 1YJTA 2ZUAA 1YI2N 3QYYA 4GW6A 4WYBA 1RDBA 2P9SB 1GK8A 1RWMB 1UVLA 3CFPA 2DR5A 4MK7A 2XZWA 4DTPA 2HHTA 5ETSA 1JMTA 5F0XA 5IV4A 3THPA 3P5TL 3QMQA 2XS5A 2RT3A 1JIHA 1XERA 2DNHA 4KHQA 3HSCA 4OPHA 5DG7A 2V63A 4JI1F 2CJAA 3BGRA 5A2QU 3GQCA 4RG8A 1PC5A 3FEXB 3Q8SB 1HRHA 1IUJA 1FRMA 3MEKA 2RILA 4ILHA 3QGHA 3RU0A 2B7BB 4J9NA 3KG4A 1RTIA 3LPUA 5IC4B 4DV7J 3ZTOA 4KSEB 2B4JA 2VQFJ 3D3BJ 1ULRA 1XMOF 1UVIA 2DR6A 1IBLK 4KPCA 3M9NB 1KRPA 2HFUA 4NCGB 2PD1A 1NK0A 4CIOA 5BR9A 2B6AA 1FKPA 1QZ6A 3UE5A 4LVOP 2BKNA 1S6OA 4PY5A 3N01A 3P6YC 1OY8A 3SAGA 2YWGA 2ZZTA 3GOIA 3H1VX 3ZT4A 2BE7D 2RAQA 1Q7YO 4Z4IA 3CCMN 3HD2A 4FNHA 1F9EB 1LAVA 4H4KA 2KFYA 2V8HA 2O01C 5ETPA 3O3HA 1VSDA 2VPWB 1YLXA 1XQIA 1F6TA 3TR5A 2MPUA 2ASLA 4C23A 2B4VA 1TKXB 1FJGJ 2VWBA 3ZYYX 2V34A 1QVFR 4K4SA 4N76A 1GTEA 3P45B 2VA2A 4RW7B 5C24A 1ZM9A 4DWIA 1IJEB 5M1OA 3US5A 1BWVA 2DPNA 1RBUA 1QSYA 2HHHF 4DPXA 2UXBJ 5B0FA 3CXCM 4BRQA 4FJ9A 1VLOA 4GVMA 1U0HA 2BX6A 3E1YA 2E2QA 3SZ2A 1KVJA 3M4XA 4DR5J 1KVAA 2DFEA 2KI2A 3PRBA 2O8BA 1Y0HA 4TY8B 5AQQA 4ECSA 2QM1A 4LQ9A 2DGOA 1WTBA 4K4XA 2YBVA 4LBIA 1MN9A 3UD3P 4ZHRB 3GLJA 1RA6A 3BKUA 3ULEA 2W7PA 4KAZA 2FPHX 1T7PA 4LFCJ 2XULA 3ISND 4RW9B 3W62A 1TUUA 2BYCA 4YNQA 4YDXA 2EX3A 2IYIA 1OSDA 3KLEB 2R7QA 3KG1A 3DOKA 5GAGI 3D0PA 4ECYA 1KHWA 3CULA 2JWKA 1N5QA 2QSWA 5JVGQ 3VGLA 1CPZA 3OYCA 2HEKA 4O0IA 3PCOB 4C98A 4U7BA 1JL2A 2X1AA 3D1HA 3M30B 1F9HA 1WAFA 2VA3A 3VAHA 4PKIA 3DGPA 2LSNA 3M8QB 1K9MT 2EPIA 3Q2TC 2RRBA 5L1IA 1HNXJ 2V2ZA 1IR2A 2VFVA 3ULDA 1RAIB 4O4GA 1RHMB 3O3FA 2X3DA 3M9OB 1VQNS 1BD6A 2F9DA 3U1NA 4F4KA 1C0FA 3DRPB 2YNIB 3PHTA 2JWLA 4IWVA 2AYEA 2GELA 3NGRA 2VBYA 2Y0SD 1UVJA 2Q3SA 2JNJA 1P8GA 5J1NA 2GIFA 4OI1A 4RWTA 4H4MA 2E66A 3Q8QB 1F5AA 9RUBA 2NUHA 4S0MA 4LFBF 3HVWA 1UTAA 2KQ2A 3MTKA 3WNGA 2M8DB 1BUXA 4RUHA 1SJ3P 3CDUA 4JNEA 1RBTA 3MM9B 3QEIA 3PX0A 2BM0A 1U8SA 4FWKA 5IFMA 4LF8J 3I4HX 1D9FA 4CZIA 4Y3CA 4Z94A 2NR0A 2W4CA 2MQNA 1NPKA 4PKDB 3MHYA 3GPAA 3U02A 2YKMB 4DF4A 1U1NA 2E5JA 2Q3PA 4GMKA 1N32K 3BO3A 4J9OA 2CPZA 2MZSA 2HKEA 5LMNF 1EP4B 5CD4H 4QIGA 2L9WA 3WXIA 2FZCB 3M2RB 3IS9A 4RWXA 2GHWA 4NLYA 2MKSA 2MZQA 4Z4FA 3ZETB 1HD0A 3CCMS 3OY9A 3DYAB 2B9WA 3FMWA 1BIZA 3EY1A 2EBGA 1TV6B 5LSRA 4ZLLA 3CCTA 3RUBL 2LYVA 5MAOA 2BXJA 4QCLA 1S9FA 5K14A 3MX2A 3DXKB 2WCXA 4JOUA 2RDDA 5HL7Q 3CCQS 3OW2M 3PR5B 4DLGA 1T9UA 2R2SA 4OX6A 1RNHA 3LZJA 2CNOB 3NCIA 1TUGB 3T5LA 2MKKA 4NA1A 1Y3JA 3LM9A 1QAJA 2OTJN 2Z1HA 5ELZA 3MR6A 1EHWA 4RW8B 4YR2A 4WFNL 1ZBTA 5AQFA 4UOCA 5CZXA 4XEIA 3MN7A 4DBQA 1JLCA 5KTQA 5AJ3J 1OVYA 3ET6A 1Y5IB 3CXCR 2MZJA 4JHDB 4I1TA 4NI2B 4DR1F 1FFGB 4M5DA 4YUDA 4PHTX 3PRDA 2ETJA 4JI3K 4X66F 4ISFA 4Y2IA 1HYZA 3S41A 1RT6A 2KFNA 3MWPA 2CQHA 2AA4A 2HLTA 3KFWX 3CCQN 2XI3A 1VRTA 4AD6A 4YR3A 1L3TA 2FBTA 4GV6A 2FC8A 4LRFA 5AFUH 2MLZA 5HQLA 4B3RF 3LW5C 2HAFA 3QNOA 4X84A 5F3ZA 5LXYA 3U8XA 1BQMB 2PA3A 3M7VA 3RSEB 3J8AA 3B6BA 1YJ7A 4KAIA 4NRTA 3TAEA 1C0GA 1W7AA 3LQVA 3OR1A 5M1QA 4J9VA 1W26A 4CEOA 1RILA 5HMYA 2A1RA 2WVDA 4R8UB 4DR4K 1HNIB 1BLUA 3GFYA 3HDSA 4BRAA 3I5AA 1U1KA 1KVCA 1VQNN 1RT1A 4F2RA 4NLOA 5KT5A 1HWLA 3CJCA 3QIOA 2DH7A 2UUBK 4ZTJA 1QE1A 3IR7B 4DUTA 2RPIA 1J5OB 1P8ZA 1KFDA 4WQ4C 1JKHB 4P73A 4WQ4A 1FXLA 3TTFA 3S6EA 3CVKA 4CIGA 2VYPA 1KCFA 3UN5A 5KFUA 5E3AA 4FWOA 5DK5A 2EG2A 4DSKA 2PI4A 4PR6A 5C10A 5BYQA 5GADP 1S1XB 1XHZA 4Y65A 1FEHA 3IDHA 3CCJS 5J2MA 3J81Y 3VALA 1O13A 3G86A 3ELHA 3IGNA 4P6QA 1VFJA 3H59A 1WLJA 1VQ6S 2YNHB 5D4OA 2VWJA 1IWGA 3SQ4A 3S3OA 1WG5A 4ETXA 3MEGA 5DMRA 5F8LA 3WXJA 5LMNK 4ZPVR 4DX8H 1FD8A 4KHPK 3NGSA 2C3UA 1N8RT 2B0GA 2ZH5A 4FLXA 2ZZMA 3R5GA 2P5VA 1IQZA 3NXZA 1F2HA 2IRXA 1I6JA 2HHWA 2E1CA 4I2QB 2V7ZA 3SBTA 4A5AA 1U09A 4URQU 1XC9A 2DXFA 4FYWB 3JTPA 2YJFA 1FEEA 1RSCA 2GC8A 4CWBA 3DLBA 1TGOA 2ZD1A 2MQLA 3MURP 3AD7C 2BR0A 4MKBA 2UUTA 1S72S 1IG9A 1M90T 2LDYA 1O1WA 3CIMA 2WTFA 4M3RA 3P3DA 3I0SB 4FM0A 4MK9A 3DRPA 1BA1A 4JUZA 3WQTA 4CJPA 2P9UA 3UNYA 3DI6B 1VC5A 1T9TA 3R5BA 2I2YA 4C7QA 3ILIA 2QWQA 5K8OA 3T1HK 4DS5A 4LR9A 2UUWA 3EDQB 5AJ3K 2OIHA 3J7AN 1H2TZ 4OYOA 3NDKA 5DM6Q 3KLGB 1XWLA 2DTUA 3R9PA 2XBPA 2BANA 2GX8A 2D69A 1T3OA 2C2NA 3ZZTA 4USTA 4H0OA 2LKZA 2E44A 2W9CA 1OO0B 3FR0A 1WAJA 3PEJA 3PO4A 5AQTA 2MKCA 3MR3A 1XQSC 3BZQA 4YB7A 5IZHA 4L3KA 1XMOK 1FTRA 3RMBA 1UOCA 4GKKF 1CXUA 4AUKA 5CAAA 3QSIA 4UT4A 4IBNA 1X0PA 5BPNA 4JAXA 1NK7A 4LR8A 5LMUF 2JEJA 4BRNA 1R31A 3M8PA 4TU9A 4R5PA 4BR4A 3MCPA 1NCLA 3SCLE 4JI5F 4OLOA 4DTSA 3OVBA 4O23A 3UO0A 4G65A 1J5EJ 4DV1J 1QAYA 2XLIA 1SKWA 1IBLJ 5KT2A 3EN9A 2QLFB 1IM6A 4CI0B 5CYMA 1DURA 3WQUA 3RW6A 2VGNA 5IOLA 1NGAA 1OWXA 2IVMA 3NF9A 3OXFA 1BI4A 2FSJA 3PW5A 5I3UA 3U4LA 4L8RB 4PG7A 1FVQA 4OGEA 1QS4A 1VQMN 3GG0A 3W5ZA 2C2DA 3PIPL 1VSKA 4CLUA 1WHXA 4HDHA 3QRRA 2XTJP 4YY3K 1YI2S 3PR4A 1T8EA 2NXUA 2XCAA 4ZJOA 3QWPA 3MEDA 4OI3A 1HQ2A 4H4OB 4OO1J 3SCKE 1XMQF 4B3MK 2JGUA 1RWUA 4AHVA 4NASA 3UN3A 2DXDA 4ZPAA 1YJWN 1DARA 2XZDB 1LK7A 2UVWA 1N36K 3KUGA 3ZSXA 2C2EA 3AD8C 5HATA 1KAZA 3VHQA 3KLFA 1ZAVA 2DHXA 2M7SA 4CF8A 5ETRA 1AA1B 2ZE2B 1S97A 1RI7A 3M1VA 1HBMA 3AQOA 1IJJA 1G4CA 4FYDA 3CM6A 3Q2SC 1XBWA 1RAHB 1U45A 3SCJE 3K17A 3NRBA 2W24A 4TU8A 2XYPB 3GR0A 3QFWA 2P6TA 4NYFA 3SPYA 1HNVA 3DI6A 2UUAJ 4JI3F 4X4NA 2OYQA 3UN2A 2M4MA 2HNZB 1FCAA 2D9OA 4ATNA 2W2NP 2KDOA 4KE5A 3PKMA 4OX8A 3TX0A 2A5XA 4DPWA 1H98A 1V3SA 1QZ5A 5GAEI 2BDPA 2UXDF 5KFWA 3PKYA 1ZA2B 2XYHB 4ANCA 3A8YA 4F26A 4CGGA 3BO4A 1QHAA 1K9MO 2P9IA 3D28A 2O8EA 3LP0B 3THTA 2VJVA 3C6AA 3FCHA 5KFYA 1C1AA 1HPZA 2EVZA 2HHUA 5D0GA 3FCVA 5C25B 1RACB 1XMQJ 4CLYA 5I9EB 3K8WA 4ELTA 2VPYB 1S77D 4LT6A 5D15A 3L3VA 4LF6F 1S48A 3IKMA 1FJ7A 1XMOJ 4ER8A 1ZBLA 1I94F 2FC0A 3DC2A 5LOQA 4NYPA 3VQQA 2CNLB 2N3LA 4CLFA 1RP5A 3ZX3A 2IYGA 4PCQA 1WN7A 4H0VB 3OYGA 4DSEA 5J2QB 1N8RO 3PY8A 4JB8B 1HBUA 2CZVC 3PACA 2O4IA 8ATCB 1PAEX 1MMDA 2LVWA 4NMXA 2Q36A 2EFQA 2IAJB 4P9SA 1FI4A 3C3LA 4HDGA 2V8DA 3IMXA 1LOTB 3FMBA 5EOYA 3SV3A 1Q8LA 3HVTB 2Q79A 3T7ZA 3EE8A 1YHQS 4CF1A 3R6GB 1UWBA 4TSXA 1H3DA 2CQ1A 3C6TB 1RE1B 4Q45A 2FHMA 1X5PA 4CJ4A 1WEYA 3OQ2A 1CG2A 3C46A 1H7WA 1B9DA 2HRUA 3PVXA 3CD7A 4F4XA 1S99A 3CJ0A 1HR0F 2RJZA 4CHPA 1AYEA 4MIBA 4ECXA 2B3TB 2IA6A 1RAAB 2OEKA 1NGBA 3G87A 4I6YA 4IRDA 4RX6A 4N56A 2G8WA 3OL7A 1N33K 4E3SA 1H2UX 4JLHA 1MWYA 1QAXA 4B3OB 3EE3A 2FVSA 2PI5A 3JYTB 1MWZA 3CMES 5LMUK 3GILA 3G8TA 2OD4A 2Z8QA 3MDFA 2BACA 4ZP8A 2IM3A 1BC6A 4FYVB 4YHHK 4E19A 1YRXA 3MXHP 4XH4A 1F5BA 2MXYA 4JI5J 1CBKA 4DV7K 2BW2A 2IDOA 4DR2F 3HFZB 1NZ8A 3RBXA 3CCRS 2WUSA 3JXOA 4M5JA 4DV2K 3TNVA 2DRDA 2WSCC 3IG1B 5BXIA 1CJVB 4F8RA 2BJ7A 1TL5A 2RQ4A 2F8TA 3N6NA 3E01A 2QIFA 3VN5A 1PIEA 5LL6d 3FJ2A 4OYWA 4NCBA 4C48A 2KXHA 3C0BA 1EAYC 3K57A 2IIRA 3SFUA 4DL5A 3AOCA 1RT3A 3NGZA 1C1BA 3CETA 4ED3A 2M3DA 5GAGP 3PX4A 1HWKA 4B02A 3THXA 2WFBA 1P1LA 1KTVA 1D3WA 3HHNB 4U7UK 4ZCMA 1N33J 2WW4A 2DTJA 3MEDB 1HMVA 1ESVA 1LW0A 4DV0K 3O5BA 3OLBA 5J2NB 1TK8A 4DG1B 2ZH6A 1T03B 3W7BA 3P8BB 4FLYA 4FXWA 3MMJA 5KI6A 1HW8A 4F50A 4JI5K 1E6YA 1RDUA 3PJWA 5KGWA 1RGVA 2ZWPA 4DV2J 1VI7A 4H4KC 3ZSRA 3OYHA 3QGPA 2CAJA 1W2BM 2V67A 3MWBA 2J9DA 1X3NA 3PSFA 5HQMA 5J2PA 1KN6A 5H9FJ 3IBWA 1QQNA 3PW2A 3RR8A 2ASYA 2AJ4A 3CCZA 3OFEA 4LY7A 3WEEB 4CBWA 2RQKA 2FXUA 2R8KA 2ZBIA 3N5BA 4C0HA 4CFBA 3D45A 1SZ2A 5AE2A 1I94K 4P10A 3M2VA 5F0WA 1BQXA 3UIQA 4IFYA 4OQJA 1EKEA 3CIZA 2HW3A 1XNQJ 2UUBJ 3UQSA 4ED5A 4CEBA 5KFFA 4MYUA 3HOSA 3Q0AA 4LFAF 4AYBD 1BU6O 3J81U 2X1BA 5A2QY 1TUWA 4IDHA 4I7FA 4A8MP 3OUYA 3MI7X 3FBBA 3AGRA 3KD5E 1TL7B 2C22A 3O44A 2PFUA 1WSJA 1LW2A 2I8EA 5K20B 3DLKB 1O8BA 1KSPA 4QYZJ 5KFMA 3T6JA 4DV3J 3CTRA 1LV5A 2P9LB 3VEZA 3PFOA 3I32A 2Q1LA 1K8AT 2NNWA 2ZUGA 1N88A 2M52A 1BISA 3M8SA 3KHYA 4KB0A 1PC4A 3EUNA 2AJ0A 4OYXA 4HWIA 4EP4A 4X65J 4WFXA 4RU2A 2N4CA 1IO2A 1HPZB 4FBTA 2EFPA 3W65A 1CQMA 2V0NA 4TXSA 1TL1B 1RBLA 2BOAA 1FXRA 4P74A 3S8SA 2KU7A 3D2EA 3P1GA 4Z2XA 3G82A 3GJTB 3U6FA 4CJ7A 1NH8A 3S3MA 1VOMA 1H6KX 4F9OA 1YG0A 4B3RK 4JRQA 5HBMA 1ASUA 1U7LA 3RRKA 3O5TB 1VQ8S 1PKUA 1MU2A 4BC3A 2QA2A 4MFBB 3LZIA 4NXMJ 4O0JA 3DXSX 4CI6A 1MMNA 1JNRB 4H0TB 4BGAA 3K59A 1SV5A 5SZTA 1JXBA 4FW2A 3CCJN 1NDKA 1SJRA 2QEXN 2G2YA 1PYSB 1Q79A 1J6ZA 4CECA 3WBZA 4USUA 3BBBA 4A62A 2DY4A 3HHLB 4MLHA 4CEEA 5AQYA 2WSEC 1VGYA 2QYCA 5C2CA 3ETMA 2UYTA 3VOVA 5G4DA 2M5YA 2N4DA 1TK0A 1NSQA 2LQBA 1RT2A 2HK3A 2DEIA 2HVZA 2MQMA 2R7WA 4PG6A 2BJ3A 4X4OA 2VBWA 4C6AA 1NMNA 3L3UA 1KDNA 3EX7B 2JZ5A 4WBFA 4B9SA 5AQHA 3PHEA 4ZIVA 2FF3B 4WP8A 3C94A 1V5VA 3PYFA 1U6FA 1KKHA 3A5MC 3SUOA 5GAHU 1IV0A 4WE1B 1NOZA 2VG5A 3RMAA 3CJKA 4O3NA 1KC8T 1BCOA 4DQRA 5LSLA 2DNNA 1U2VA 3KUHA 4EMDA 1RYRA 1ZBSA 2WBNA 4J9UE 1NBEB 4FJKA 1NG9A 4CD3A 1YRUA 3KHLA 3QRPA 1SAZA 5A8RB 2P9SA 1IKVB 2XO7A 4OPKA 1FRIA 4C0BA 2GTDA 3CC4N 3MM7B 2YNHA 1NWKA 4KHSA 2XZTB 5EY4A 1S5ZA 4B3OA 3ISNC 3VAJA 3CJQA 5FROA 3VA0A 3DKDA 3J81j 4DL3A 3SNNA 3TEGA 4QIFA 5EGYA 4MQ3A 2OGUA 3ID8A 2EFVA 3H46O 3SI8A 2OMLA 1D1UA 1A5WA 4GVEA 5U47A 1JLBB 4NWBA 3LWLA 1P27B 3NGKA 3NCPA 4A8WA 4JKDA 3GE1A 2RF2B 5BPLA 4DQPA 4QYZK 3QGGA 1EQYA 1BXNA 2RE2A 1FX4A 4YDUC 4PL8A 2OPPA 5C7PA 3VQAA 3PG9A 4ZA1A 4V19X 4ZS6A 2JFDA 1JLAA 4F4YA 2MQOA 3D6MB 3CDWA 2XMMA 2GWKA 2KG0A 2NRTA 5EUHA 2A1BA 1R8HA 3C16B 4OHWA 4UOFA 3FRYA 1AB8A 3A4TA 4EBDA 4JKBA 3ZSOA 3CCVS 4I2QA 5AZIB 1CEZA 4ZDNA 1Q9XA 4I68A 4DUZF 3NVMA 4DPTA 2FC9A 5AQPA 2KLAA 3DLEA 1AUSL 3MCOA 4XAKA 3CC2N 3BO2A 2JEIA 3THVA 2FUG9 4AHTA 4LF4J 3I8DA 3RRHA 4FO0A 3L8BA 2M9KA 1WC6A 3WC0A 4E7HA 2DB1A 4EZ6A 3KLHA 1KQKA 2HHHJ 3V9SA 2EBEA 3J7YU 2F4FA 4PWDB 2DPJA 1RT5A 4ECUA 4CEAA 3J80O 4PXDA 1APSA 2BV3A 4IOCL 1UAWA 2HQFA 3KVGA 2LQ9A 5H9EJ 4QS7A 3HM9A 3D1OA 2D7SA 4KYZA 2R2TA 3DXBA 4Y6IA 1Y4ZB 3J7ZT 1QDUB 3PIOQ 3CI5A 2CWXA 3WNHA 3E8OA 5A8RA 2R7UA 3KK3B 4YB6A 3J7Z5 2YWFA 2QWLA 4N41A 7FD1A 2CG4A 1RBOB 3JSRA 4OJ1A 1VQPS 3G4SS 3IBFB 2PBDA 3O9UA 1K1SA 1DLOA 3OL8A 1PO6A 3M9MB 4I2PB 4D3HA 3HKWA 4FJJA 1F60B 3ZO7A 1WC3A 4NLXA 2AJFE 5D77A 3ZSQA 2C3MA 2QKKA 3GL1A 2E1MC 2B56A 2DHAA 3TABA 4WJBA 2VONA 4TY8A 5KT7A 4F3OA 4DUZJ 5T7LA 1KVKA 2R8GA 4KH1B 4C11A 1K6YA 4DV2F 3CNQP 1N56A 2MKJA 3H7HB 2MQPA 1V4TA 4BRKA 3GJQB 4OZ0A 5DDOC 5IT4A 4NRUA 2YI1A 3MMVA 3DOMA 2DKOB 3KNAA 1F3VA 1U49A 3DRRA 4G1IA 3A2FA 2F9TA 3KWIA 2VQFK 1DJ0A 4GRSA 4QR2A 3CJ7A 3VWSA 3VQBA 4KREA 4PZVA 4URGA 4B1ZA 4NYNA 1BA0A 5AQNA 3K5MA 2V69A 3CDBA 2HVHA 3BGLA 1S7HA 5LMUJ 3IO1A 4TU7A 2O66A 3J7A1 4DR3K 2HG4A 2Z1GA 3KKSA 1QAIA 3RWUA 2L41A 4DUYK 4IRKA 4XH5A 4NLWA 2P9KA 1T94A 3OYIA 5L39A 2CH6A 1HIYA 3A3PB 3M32B 4FLWA 2V5HG 4F36A 5ETQA 3MM7A 2GV1A 1LFWA 3LP3A 3FBEA 2J6TA 4R0EA 2YKMA 2GA7A 2H54B 2ZOMA 4CP5A 1GLLO 1KOOA 2SXLA 3R7BB 4WIQA 4DCOB 2WSFC 4M3YA 1AT1B 4H5WA 4G9ZA 1YTYA 1TL3A 1IWAA 2EKYA 1RAGB 1U04A 8RUCA 3SQOP 2G4BA 3FQLA 4YP3A 4CIEA 3EZWA 2GVDA 1Q82T 4IEIA 3M6VA 1N0UA 3O6WA 5GINA 3QLHB 5A8WA 2Y1RI 3R97A 3DYAA 5DDPC 2AD9A 3DWLA 3TTCA 5J1EB 4Q44A 4HHHA 2DR7A 4ZPDA 1C0UB 2V94A 3SAFA 4RBVA 3DM2B 3AOBA 3T5KA 2MJNA 4LF9F 2E29A 3UDVA 3OS0A 3DLEB 2OPPB 2RUSA 2GAHC 4BCAA 3C66A 4EU0A 4C1NI 3EYZA 1X5TA 1S0OA 3R3TA 2DNGA 2E2PA 3CCVN 3VF6A 4CGIA 1SKRA 4DL6A 3H6EA 3LP2A 3C16A 3OTDA 2G1DA 5HP1A 1XIQA 3CCWA 1LOUA 4LF9J 3L2WA 4LF8F 1BL3A 2Q43A 2H3EB 1RBAA 3KLIA 2VB6A 3V6JA 5ETVA 3SLCA 3QERA 3OYAA 2CA9A 4F4AA 1XR5A 2KO1A 3TA2A 2VQEF 1NGIA 4CW7B 2ZEJA 3OVAA 1EKSA 4ECTA 3GFXA 2E7XA 1RHUB 5DS7A 3EZ5A 2V8PA 4J7CA 1K8AO 2BW7A 3EXYA 4CEFA 2F7TA 4WQ5C 4DU8A 2UU9K 2XG8A 2E20A 2RSQA 2MB0B 1C0TA 3MM9A 4BWMA 2AP1A 3L9ZA 3CD6N 1VR6A 3E2EA 1JLCB 1G1XA 4C97A 1UZDA 4OHVA 4KGXB 1YRTA 1HQEA 4LF6J 1EQ0A 4LVNP 3KJQB 3NLCA 2CPIA 1KBRA 3FRZA 4E7JA 4USMA 5HVHA 4C3MA 3O9QA 2VFSA 4O44B 2HQ3A 1DBDA 2YWHA 1Q5YA 2FJEB 5BN9A 2BE2B 1U1PA 4F67A 4FJ5A 4QR0A 1DEJA 1UMJA 1KQFB 3CQXA 4WKRA 2B5JA 1RBRA 3UDLA 4FWSA 2EFOA 4KI4A 5D78A 1HKAA 4KO0A 1TV6A 2ZDOA 1IKWB 4L74A 2FYXA 2GS8A 2HK2A 2HZVA 5DO2A 1VIOA 2F4VK 3CJSA 4DUYJ 1C4AA