4G1QA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with rilpivirine (tmc278, edurant), a non-nucleoside rt-inhibiting drug
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Snapshot of the equilibrium dynamics of a drug bound to HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 157
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4g1qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4g1qA05
4KHNA 4TXSA 5KFBA 2FVQA 3LDSA 4KBIA 5HP1B 1T3NA 1JXLA 2OPSB 3VQEA 5D3GA 3ULDA 3QGIA 4DTRA 3IRXA 4EYIB 5I42A 2QKBA 2KQ2A 5T7BA 1WSHA 4O3SA 4ZHRB 5C42B 3PX0A 3DLBA 3RBEA 4ED0A 4DG1A 3UQSA 4FLWA 1N6QA 4MIBA 3KMQA 4XIUA 3IS9A 1UOCA 4CJWA 4ED2A 3V6DB 2YNGB 3HO1A 4E1MA 4FS1A 1LWFA 1S97A 1ZBUA 2DFHA 4F4KA 1RBTA 4RNHA 2UVWA 3DM2B 3SZ2A 3LP0A 2WRMA 1JLBA 4ZPDA 2C2EA 3DLEB 3I0RA 2WB4A 3OHAA 3KD5E 2BQRA 1DLOB 1BL3A 5J2QB 3KLFA 5C24B 3RB6A 5DK5A 1RT7B 3E51A 1NJYA 3V9WA 1FKPA 1T8EA 3V1QA 3Q8PB 4EZ6A 2OA8A 3NBPA 4KKOB 4O3PA 3TARA 4WYLA 5KFZA 1RDBA 2R2UA 1GX5A 3OYLA 2AQ4A 3BQ0A 4HUEA 4CGJA 3TQ1A 4DLEA 5KFXA 1MU2A 4C8NA 1S5JA 4Y3CA 1S1WA 3N6MA 4HTUA 2IAJA 4CEEA 3SUOA 4O3NA 1BI4A 3G6VA 1UWBB 1TK0A 1X9MA 1IKYA 4H4OB 2W9AA 1UA1A 5KFCA 1JX4A 3MR3A 4URSA 3NF6A 4FLVA 3MTKA 1RBRA 1O1WA 1IKWA 4B9TA 4O44B 1JLQB 3ICLA 2OYQA 3UR0A 1A5WA 4Z4GA 4I9LA 4J9OA 2PY5A 2FVRA 1D5AA 1BGXT 1QSYA 4NLDA 3PR5B 1KVBA 4MH8A 3MEDA 1IKXA 3QIPA 1TK5A 3QERA 5J2NB 3OYIA 4B9NA 4B9VA 4Y2CA 4XO0A 4WYWA 4TYAA 2ITGA 3OL9A 1C1BB 3BJYA 4HKQA 2E6MA 4ID5B 1BCOA 4KHQA 1XWLA 4CJSA 2HMIB 2V4RA 3EY1A 1W0HA 3LPUA 4KSEB 3MEGA 4IRDA 5F8HA 1NOYA 4DU4A 1S1XA 4MQ3A 4RNNA 4CHQA 1ZBHA 4J2EA 5KFWA 2IC3B 4CIEA 4FJ7A 4CGHA 4CJLA 3VN5A 3DRSA 5HROB 5KTQA 4CJEA 4EEYA 3Q8RB 4CIGA 3RTVA 1RTJB 2V0NA 2W42A 4DQRA 2BE2B 2R2TA 3NL0A 4MKAA 4L8RB 4NLWA 1CZ9A 2VWJA 1FK9B 2G8HA 1RBUA 4BE1A 4B08A 3G0ZA 4DSLA 5J1EA 5KT6A 4KI6A 3ZSRA 3VQ5A 4PA1A 1JXBA 3BSAA 2FBXA 3H5YA 4IRCA 3CJ0A 2Y1JA 5KRTA 1X9WA 1S1TA 3IAYA 4DTOA 3AO5A 4MFBB 4RZRA 4ECYA 4PUOB 3RMCA 4NLXA 4ZVFA 2HNZB 1JLFA 4O5BA 3DRRA 3NH1A 2YNIA 3CJ5A 2Z1HA 1C1CA 5CYMB 3AO3A 2RPIA 4Y1DA 3NAEA 2IJNA 3CJ4A 4KREA 2BANA 3PW2A 3TAPA 3O4QA 4DFMA 1HYVA 3NCIA 3LAKA 4MK8A 4PY5A 1JL2A 2WCXA 4J9MA 4CF8A 1RT3A 3EZUA 4YP3A 4K4UA 2HHSA 4ZP8A 5F8MA 1C0MA 3S3NA 4RW4A 4DTUA 1D8YA 4J2BA 4B9MA 3AVNA 4YQWA 3SFGA 3IG1B 3KJVA 3QO9B 3KKRA 1HNIB 3HT3A 5KFKA 1C1AA 4CGIA 1JLEB 4BDYA 4PWDA 2VG6A 5KG3A 4NCGA 3GV5B 3KLEA 1LW2B 4K50A 1S1UB 1RT1A 1LWEB 3JSMA 4AILC 3ZT2A 2XY6A 1QTMA 3OYNA 3HPHA 2XO7A 1RTHA 2UUWA 4QWDA 4I2PA 3RR7A 2ETJA 2C22A 3LP2B 2HHTA 3VQQA 2ZKUA 3TAFA 4FJLA 4CGDA 3RRHA 2FVPA 3HVWA 4KO0A 1XR5A 2D0CA 3AA3A 2PYLA 3HYFA 1VSFA 4DTMA 2ILYA 4KHSA 4KAIA 3AVKA 5DMRA 2HNDA 1X1PA 2FLPA 4CJFA 2HVHA 2WHOA 4O3RA 4ECZA 4BDZA 3BQ1A 2QXFA 4LQ9A 3CVKA 1J54A 4E7JA 5KFTA 4NLOA 4WE1A 2IM3A 1Z25A 3PW0A 1RA7A 2ASLA 4EBCA 3QGHA 1KVCA 4DTSA 1GOAA 1ZETA 1JLCA 4NYFA 3DLKA 5JUMA 1YTAA 1RDDA 3KLGA 4CFBA 3H98A 3HSTB 4DSEA 2AJQA 3QLHB 4QWCA 3T5HA 1ZYQA 4FK2A 4TY9A 3DOLA 3QINA 2OPRB 1KFSA 1QAIA 3FDSA 1JKHA 5F8GA 3LPTA 2YHBA 1N4LA 3HVRA 3DLGA 3RAXA 3H4BA 3NGYA 2OPQA 1HARA 4Q0BA 4DLGA 3NGDA 3Q8QB 3PO5A 1BQMA 1D1UA 4ECWA 5JXSA 4NLQA 3OSPA 1HYSB 4GW6A 4Z0UA 2J6TA 2HHUA 3G6XA 3CG7A 3VQ7A 4IKFA 1S9EA 3VA0A 4IR9A 4GMJB 4DL5A 4ICLB 3BQ2A 3KK2B 2R2RA 1A5XA 3UDLA 4CJKA 1U47A 4OGCA 4NLYA 1RT4A 3O3HA 3IGNA 2RDJA 2XI3A 2KZMA 4HUGA 2OPPB 4ZP7A 2HAIA 4KFBA 1BIZA 2EC0A 4B9LA 4N56A 1KCFA 5KFFA 4DL7A 5JS1A 1BQNA 4CHZA 4JV2A 4CJ5A 4XPCA 1NKCA 2P5GA 4IFVB 2GIRA 4R5PB 1SH0A 3AVMA 1S0OA 3M8RA 4FM0A 4OVLA 2WOMB 4TSXA 3ITHB 4CJUA 1HYZA 3FFIB 4YR2A 2IA6A 4LQ3A 1DTTA 3CQ8A 3BR9A 3LP3A 4DF4A 4F2RA 4GVMA 4G1QB 2HNYA 1HQUA 5HRNA 3VQDA 3GQCA 4IRKA 3PJWA 4CFAA 3RR8A 4IQXA 4QW8A 1L3TA 4FVMA 4FJJA 3DLHA 1R0AB 2HVIA 4AHVA 4DQQA 3CDEA 2YKNA 2XGPA 3NHGA 2YNFB 3VQPA 1VSMA 2VWKA 3RB3A 5F8JA 1HRHA 3GILA 4H54A 1WLJA 2DFEA 3DOKA 3KK3A 3V1OA 1HQEA 5KG6A 3DDKA 3ZSVA 5KRSA 2OZSA 1SH2A 3NFAA 3DYAA 5KFYA 3OVNA 4F3OA 4KV8B 4I7FA 3V81B 2V9WA 4I9QA 2JEIA 2I5JA 1J9AA 3ZT4A 5KT2A 1VRTB 1RT5A 4O0IA 1TGOA 3WNHA 4IG0A 3GIMA 3L2VA 1GOBA 3NF8A 1ZBIA 4ZVGA 3TVKA 4J2DA 2B4JA 5KT3A 4RW9A 4E7HA 3OYGA 5KFMA 1RT6A 3V4IA 4O4GB 1NK4A 1SUQA 3ALYA 3VQBA 3K59A 4CEBA 1S6QB 2BR0A 4PQUB 2KTQA 4JV0A 4LH4A 4CHPA 3DRPA 4IDKB 1WSGA 4I2QA 4CGGA 1MMLA 3I0SA 4HUFA 4M3UA 2ZD1A 2ALZA 5J2PB 4M3TA 4K4SA 2IMWP 1YTUA 1RYRA 4O55A 3F9KA 2W7PA 2JEGA 3GIIA 3OHBA 1DTQB 3RMDA 4KB0A 4CJPA 2HW3A 4CEFA 1KLMA 3O4NA 1QUVA 4CERA 4ED8A 2C28A 4R8UB 3H08A 1EP4A 1HMVB 3TR8A 4Q44A 4RW8B 4H4MA 3NE6A 3MF5A 3D28A 4YFUA 4YMEA 2AGPA 4HCCA 3LWMA 1CLQA 1N5YB 1KHWA 3GV8B 4FJIA 5D3GB 3NMAA 4ED7A 3RAQA 3IRXB 4CESA 5I42B 3PW4A 3OYEA 2RN2A 2GUIA 4KAZA 2I1RA 4QCLA 2D3UA 5KFVA 4IBNA 4DG1B 5KG4A 3SCXA 5L1LA 4NLSA 1N6QB 2ATQA 5F8IA 3QETA 1SV5A 5FDLA 2YNGA 4MK7A 3IS9B 5KGWA 2DTUA 1YVFA 3DM2A 1LWFB 4FZYA 5EUHA 4Z4CA 4M3ZA 3V9SA 3P5JA 3LP0B 1JLBB 1QSLA 3I0RB 1DLOA 3VQCA 5SZTA 1BIUA 1NJZA 4M95A 1W25A 4U7CA 3KLFB 1OS5A 3CDWA 4E19A 4E1NA 1RT7A 4R0EA 3L2WA 3RMAA 3QNNA 4W5RA 4HHTA 3AV9A 4KHUA 4RUCA 4JLHA 1WNSA 3K5NA 1VSHA 4EO8A 5E41A 3NBPB 3V6JA 4JS5A 2Z1IA 4KHYA 1YT3A 4O3OA 2W7OA 5SWMA 4IKAA 3WNGA 3AVFA 4DU1A 1S1WB 4FBUA 2XY8A 2IAJB 2LSNA 1S9GA 4LH5A 4NZ0A 4F50A 3HKWA 1BI4B 4H4OA 1S0NA 4QWEA 3MR5A 3KLIA 4AH9A 1IH7A 1IKYB 1YVUA 2Z1JA 4CK1A 1LV5A 3LP1A 1RAJA 4OLAA 2KFNA 4ECSA 3BDPA 3DI6A 4OL8A 1IKWB 1WN7A 1HPZA 4ECVA 5KG0A 4FM2A 1S48A 3U3GA 1D9DA 1SH3A 3KKSA 3OYAA 5KFIA 1RTIA 3IGVA 4JS4A 2IJFA 4W5NA 1ZTTA 3OYHA 3M8PA 1VSJA 3MEDB 1IKXB 4LD0A 3QIPB 3ISND 3AA5X 4WXOA 2A1RA 4URQU 4ECUA 3CIZA 1KSPA 5C5JA 1VRUB 1S0MA 4E89A 4AHCA 2W9CA 2FVSA 3WNFA 1T03A 3SYZA 3MEGB 1LAWA 1S1XB 1IKVA 3SQ0A 1L5UA 5DQIA 4FJHA 3BGRB 2DY4A 2GC8A 3PVXA 4RU9A 3H2LA 1S9FA 3OYDA 3OLBA 5CYQB 3N6LA 4NLPA 1B92A 3QEXA 4ZVEA 3E01A 2P1JA 1C0TA 2UVVA 4MK9A 4FJGA 2D41A 5KFOA 3QESA 1XR6A 4IH7A 3VQ9A 1KHVA 1RCHA 2YNHA 4DQIA 1ASVA 5FRNA 5L1IA 1BHLA 3QEWA 3V9XA 3PZPA 4ELTA 4FLTA 1C0UA 3KMSA 2YV0X 1NK7A 1TKZA 3RRGA 4DSFA 2IDOA 2FVCA 3VQAA 1JLFB 1A5VA 4DWIA 2YNIB 2D0AA 1TL3A 1RBSA 2RDIA 4NYZA 5KFNA 4MKBA 3CYMA 5DGAA 2HHQA 2RKIB 2NUBA 4FK4A 4CK3A 3QGGA 4TYBA 4LSLA 1N56A 1I39A 2BANB 4DL4A 2E6LA 3QZ7A 4DSKA 4ZMMA 5L1JA 1XR7A 4NRTA 3QIDA 2EHGA 2JEJA 1RT3B 3H5XA 3VQSA 4QOZB 1REVA 2BDPA 3D45A 4RW4B 3CFPA 3QZ8A 3GYNA 2G8VA 3DMJB 4DTXA 3FQLA 3RB4A 2R8KA 3C6TA 4NCAA 1XHZA 3KJVB 5KFLA 1Q9YA 1JLEA 1T05B 3M9MB 4RNOA 1B9DA 2GV9A 4XPEA 4FJ5A 1EX4A 4PWDB 5HRSA 1EETA 2GBZA 2B5JA 2HB5A 4NCGB 3KLEB 1SL2A 4FZXC 2DPJA 2PZSA 4DTPA 1RT1B 2KFZA 4MIAA 3MECA 3NF7A 2BQ3A 1LW0A 1TP7A 1U09A 5DLGA 3JSMB 3TANA 3PJXA 3NH2A 4WXWA 3HL8A 3PV8A 4BACA 3O3GA 4CFDA 3PW5A 1XHXA 1RTHB 3DLRA 4TQSA 1NK8A 5DG7A 4FJ8A 4I2PB 3ZT0A 2QKKA 2B6AA 3QEVA 3SUNA 2BRKA 4Q43A 1UA0A 4HCBA 4RNFA 3KTQA 4KO0B 2J6UA 1RILA 3T19A 3D0PA 4EO6A 4IFYA 2XC9A 4CJVA 1TL1A 5KFRA 3H40A 2KW4A 3V6KA 3MXIA 2D3ZA 3JYTA 4KHWA 1K1SA 3HVTA 1L3UA 3AVHA 5KFHA 1ZBFA 1QSSA 4AHTA 4KTQA 3S3OA 4WE1B 4CIFA 1VSEA 4ELVA 3PO4A 3DLKB 1K1QA 3FSIA 1TKTA 1RTDA 2AGQA 4ZPBA 4DSJA 3OLAA 1BCMA 3MR2A 3KIOA 3Q8SB 4CHYA 2VA2A 4NRUA 2YHAA 3M9NB 3HHKA 2UVRA 3RWUA 2OPRA 3C6UB 2W9BA 4O0JA 3DOLB 5J2MA 3TAMA 4CGFA 2XCPA 1JKHB 1IM4A 4FW1A 2VG7A 3AVBA 2OPQB 2ATLA 4Q0BB 3K5OA 5KFSA 5DGBA 1BQMB 4EBDA 1FKOB 3LZIA 3KOAA 3K57A 5DLFA 4ECTA 1NK5A 1J5OA 4DL3A 4ZTFA 4ZP6A 4GC7A 4FXDA 2E4LA 1S1VA 4LSNA 4HVJA 2BRLA 1S9EB 3HPOA 3K2PA 3WNEA 2R8IA 4ICLA 5F8NA 4NLRA 3NGIA 5KFPA 2XRIA 1JLAA 2IBKA 3ZSZA 4CEQA 1RT4B 2IOCA 5I3UA 4B9UA 5KFAA 3NF9A 2WONA 4DFJA 4ECQA 4KFBB 2FBYA 1QHTA 2HHWA 4BWJA 1HNVA 4TY8A 3GIKA 4HYKA 1BQNB 3BSOA 1RT2A 3OYMA 1L3VA 2YKMB 1WSIA 3SPZA 4B9SA 3T5JA 3ZT3A 3FFIA 2XCAA 4K4TA 4J9KA 3CFOA 3VQ6A 1I6JA 4TLRA 3AA2A 4RW7A 4ZTJA 2KZZA 1DTTB 5EWFA 3T5KA 1X9SA 3O3FA 4CK2A 2HNYB 1HQUB 4YR0A 2C2RA 2R7YA 1JLGB 4FZZA 2O4IA 1QS4A 3MEEB 3ZT1A 3MAQA 5L9XA 2YKNB 2FLLA 3I5AA 4KRFA 5HBMA 5T14A 3DOKB 3KK3B 1HQEB 4RW6A 2A1SA 5C25A 1L3SA 1S6PB 1TKXA 2E9RX 3DYAB 3QEPA 1EXQA 4DL2A 4IG3A 3T3FA 4I7FB 5HLFA 4AHSA 1W9HA 4DEZA 2JGUA 4E3SA 4NLUA 2I5JB 3KD1E 1QQCA 1WSJA 5K14A 3L2UA 1RT5B 1JXEA 3AO4A 2OZMA 3MXJA 1NK0A 4Y34A 3HP9A 3G86A 2G8FA 4CE9A 3SQ1A 4RW9B 3OYFA 3V6HA 3KK1A 5EWEA 2E9ZA 2DFFA 3CJ3A 1RT6B 3V4IB 3AVJA 2RF2A 1TVRA 1SUQB 5CY4A 4WZQA 5KFJA 3AVGA 4PQUA 4CJ3A 5KG2A 3M8QA 4URGA 1RDRA 1NHVA 2FBTA 3VQ8A 2F8SA 3L2QA 4M3XA 2XY5A 4J2AA 3AVLA 2G8UA 3FRZA 3DRPB 4QW9A 1GX6A 4CEDA 3KLHA 4DS5A 2FLNA 1LWCA 4OPKA 3G10A 5KFUA 2ZD1B 4QAGA 4Z4HA 1TV6B 4FJXA 2HHXA 4QWBA 2VG5A 1QE1A 4B3OA 3TAGA 1C2PA 1BISA 4IOBA 4BDPA 5KI6A 4EBEA 1RDAA 4CHNA 2ZE2A 2AX0A 1SKSA 2E9TA 5F9NA 1JL1A 1KLMB 2QE5A 3PX6A 4R8UA 4GC6A 3ZCMA 5HP1A 2OPSA 4F8RA 3TAEA 3U6FA 1VSLA 1EP4B 2AWZA 2Y1IA 4QWAA 4H4MB 4ZHRA 4ZP9A 5C42A 3OL8A 1TKDA 2XGQA 1LAVA 2JLEA 2QK9A 4FLZA 3RMBA 4WFXA 4IH6A 3NGZA 1T94A 4ID1A 4FCYA 4W5TA 4NCBA 2QV6A 1SKWA 3OY9A 2J6SA 4NLGA 1XI1A 3V6DA 3LAMA 1WNEA 3OS1A 2EX3A 3I8DA 4FYDA 4ZVHA 1RDCA 4Q8EA 2FJWA 5HRPA 2D0BA 3KLVA 1SL1A 4U6PA 1SV5B 3DLEA 5FDLB 2X6NA 2V4QA 5FRMA 4M41A 5J2QA 4KPYA 5C24A 3PR4A 5EU7A 3V1RA 3EPIA 4DL6A 2IS3A 4KKOA 1FKPB 4M42A 1U48A 1ASWA 4UQGA 3FQKA 2UVUA 4FLUA 3SI8A 5DG8A 3B6PA 1Y97A 3T1AA 2AGOA 4RG8A 1MU2B 3EZ5A 4E7IA 4DF8A 1UWBA 3AVIA 4DS4A 1U49A 1ZTWA 4N76A 3TAQA 1RYSA 1S9GB 4K8XA 1U4BA 3KHLA 5JS2A 3THVA 3AVCA 3ISNC 3KLIB 1S49A 1SKRA 4O44A 1JLQA 3U3YA 2ILZA 3LP1B 3SUPA 3H59A 1U45A 4CF0A 3SV4A 4K4VA 1KLNA 3DI6B 4JUZA 5J2NA 1HPZB 3L2RA 2ASDA 4JRQA 4M3WA 1C1BA 3NKYA 4DFKA 2P51A 3VQ4A 4CEOA 2FJVA 1RTIB 4ID5A 2VA3A 3M8PB 4NYNA 4QPXA 3MFHA 3F73A 3L8BA 3B6OA 2HMIA 3EPGA 1ZBLA 2HWHA 3MFIA 4X2BA 3SI6A 4FJMA 4KB1A 1VRUA 1Q8IA 4JV1A 3ZSOA 2IC3A 3H4DA 3V9ZA 1Z26A 4Z4EA 3K58A 4FLXA 5HROA 2W9CB 3MR6A 1T03B 2F96A 3DRSB 4FS2A 1RTJA 1CSJA 3ZSYA 1IKVB 2BE2A 3BGRA 3OYBA 4YNQA 1VSKA 5DQGA 1FK9A 5CYQA 3MXMA 4IH5A 4M3YA 3QNOA 5J1EB 4E7LA 3SFUA 3E01B 1C0TB 2BQUA 2FBVA 2IGIA 4DSIA 3HXMA 3OSNA 1C6VA 3NH0A 4KTWA 4O4RA 4MFBA 4ZPCA 5EDWA 4TQRA 4PUOA 4W5OA 3OYJA 1S1TB 4B8CA 1FXXA 2HNZA 4NLTA 1Q9XA 3LWLA 4CECA 4B8AB 2YNHB 3DRRB 4KE5A 1D0EA 3P1GA 3CM5A 2WK4A 5CYMA 1C1CB 3S9HA 4CFCA 2XWYA 3GV7B 2HWIA 4DTNA 1C0UB 5KT5A 3PY8A 1TKZB 4ED1A 2D7SA 1CZBA 4CF9A 3OL7A 3GIJA 1TAUA 1TL3B 2XY7A 2X74A 2RKIA 3L3UA 4K4ZA 3I5BA 4RUAA 3K5LA 2DPIA 4OLBA 1RNHA 4LSLB 3CFRA 2WTFA 3KHRA 3QYYA 3HPGA 3UPFA 4KB7A 4J9RA 3D5MA 4OKKA 3IG1A 5CZ1A 3KHHA 3QO9A 1REVB 2C2DA 3C94A 1HNIA 5F9LA 4KI4A 3DMJA 4F4WA 1SL0A 5KT7A 1J53A 1LW2A 4CJQA 1S1UA 2VG6B 5HRRA 4M3RA 1LWEA 1K6YA 3C6TB 1T05A 3I5CA 3AO1A 1WAJA 4W5QA 4EYHB 1EETB 2B5JB 2FC0A 2G8WA 4FJ9A 4ECXA 3MECB 3LP2A 3NAIA 3G6YA 1LW0B 1QAJA 5F8LA 5KFQA 3PHEA 4KHRA 4BE0A 1VSIA 4OGEA 3AO2A 2JEFA 4FJKA 1RBVA 1TQLA 1NNDA 3UIQA 2B6AB 3BREA 4ED3A 2GIQA 4EP4A 3OS2A 3OYCA 1ITGA 2HNDB 2F8TA 1UAXA 4E0DA 3ASMA 4WZMA 5KGXA 2AX1A 5CZ2A 2JC1A 4WFZA 1NJWA 4IFYB 4J9SA 2ZQBA 1TL1B 4Q45A 2W8KA 3PUFA 3M9OB 3JYTB 4DU3A 1TK8A 2X6SA 5DQHA 3HK2A 3HVTB 5KG5A 1VSDA 1JLCB 4C8KA 4O3QA 3KLGB 4DQPA 3OS0A 3QLHA 3LALA 3NDKA 1T7PA 3SQ2A 3OJUA 4Q5VA 3HM9A 2W8LA 4AHRA 5KG7A 3L3VA 1TKTB 1RTDB 1CXUA 4IR1A 4WFYA 1JIHA 2CKWA 4C8OA 1XC9A 4F4XA 3C6UA 3K5MA 1CXQA 3V9UA 3DLGB 2W9BB 5J2MB 3TAMB 2JC0A 3PW7A 4JRPA 3HP6A 2CJQA 1HYSA 4NLVA 2VG7B 2F8EX 5FROA 4FK0A 4DMNA 3P83D 1NHUA 4ED6A 2G8KA 3CJ2A 5KFDA 2X78A 1FKOA 1N48A 3PX4A 4BWMA 4M94A 5L1KA 3KK2A 4Z4IA 1J5OB 3TI0A 4BE2A 1S1VB 4LSNB 1KVAA 2FJXA 2P5OA 3QEIA 1KRPA 3VA3A 2G8IA 1I3AA 2OPPA 3NAHA 2R2SA 5KG1A 4H8KA 3BSCA 1JLAB 3OJSA 3ZSQA 2O5DA 4FLYA 4IFVA 2PYJA 3LANA 5I3UB 4R5PA 2R8GA 4J9NA 1NJXA 4CCHA 2WONB 4F2SA 2WOMA 3IN5A 1HNVB 4TY8B 3ITHA 1B9FA 1VK0A 4YR3A 3AVAA 4CEAA 2AU0A 2YKMA 1S4FA 1ASUA 1RT2B 3SNNA 4FW2A 3A2FA 1U04A 4G1QA 1D9FA 3AA4A 3OYKA 4KHMA 4M45A 3S3MA 2IM0A 4RW7B 4ECRA 3SUQA 1R0AA 1IO2A 3QIOA 1EKEA 1WSEA 2HHVA 4J9QA 1JLGA 2YNFA 4J9LA 2R8JA 4CJTA 3M8SA 4Z4FA 4J9PA 3MEEA 4TN2A 4K4WA 2XHBA 1NOZA 4OJRA 5KT4A 4K4YA 2IM2A 4OKEA 4KV8A 4CJRA 2D5RA 4EZ9A 3CWJA 3V81A 4OPJA 3EYZA 5HBMB 1S6PA 1Z4UA 4RW6B 4K8ZA 5C25B 1WSFA 1TKXB 1VRTA 4N5SA 4RNMA 4E7KA 1S10A 3SJJA 2IM1A 4IG3B 4FBTA 4F3TA 5HLFB 5KFEA 4Y1CA 4AHUA 4CEZA 2UUTA 1NKBA 4IG0B 2XI2A 4CJ4A 4FM1A 3HJFA 4LY7A 4DFPA 4Y2AA 3SQ4A 5DG9A 1G15A 5K14B 3BSNA 3H5UA 3N6NA 4ELUA 2OH2A 3LZJA 1TAQA 3CM6A 1RA6A 1NKEA 1KTQA 4O4GA 3HVAA 1F21A 4C8MA 5EWGA 3KHGA 4CF2A 1IG9A 2ASJA 1S6QA 3KK1B 4KTZA 3H5SA 4OKJA 4IDKA 4G3IA 2RF2B 1NK6A 1TVRB 4K4XA 4I2QB 1WAFA 4N41A 3M8QB 3I0SB 1HJRA 4CHOA 5J2PA 1KFDA 1GOCA 5KFGA 3ZSWA 4EP5A 3KLHB 4DTJA 4F4YA 1LWCB 2Q3SA 1DTQA 3CDUA 3ZSXA 4ZPAA 4Q8FA 3RB0A 1TV6A 3C95A 3OL6A 2B43A 2Z1GA 1NK9A 4CF1A 3RBDA 2R8HA 3TWHA 2VG5B 1QE1B 4DQSA 2O4GA 2BGGA 4B3OB 1HMVA 3CO9A 4RW8A 3TABA 4F4ZA 3SV3A 2ZE2B 4N47A 3T5LA 4FJNA 3KNAA 1N5YA 3SPYA 4C8LA
chains in the Genus database with same CATH superfamily
4KHNA 4ALZA 5LMNK 1RGVA 1OMSA 1FW6A 2MGZA 5M1PA 4EYIB 2QKBA 5T7BA 4O3SA 3QJJA 4RBVA 2GVZA 3PX0A 4ILJA 1DY3A 1T9UA 4J37A 5AQGA 1YRTA 3QWPA 2ZBPA 3KMQA 1H2VZ 1TUYA 2NRZA 3GFHA 2ROPA 3OFFA 2XHWA 3NEKA 1KVIA 1FO1A 3ENAA 3HO1A 3WDOA 2MKSA 3HHDA 2GGPB 4P10A 2Q0RA 4ZPDA 3I9ZA 1FKAF 3KD5E 1BL3A 1V6HA 3TZYA 4MIWA 3BZQA 4DZ6A 1F60B 3A0IX 5A76A 4EFAC 1RT7B 3E51A 1NJYA 4EZ6A 1B70B 4RWXA 1SJRA 2YX4A 3M6UA 3HX9A 4O3PA 4WP9A 1NMEB 5KFZA 2N4DA 1RHRB 1GLCG 2R2UA 1GX5A 2DVIA 3MMJA 1AFJA 1QQOA 1LQ9A 4HUEA 1P1LA 5KFXA 1S5JA 2RDDA 3N6MA 3WQUA 3BKUA 1NGCA 4C3LA 1FI4A 4P2MA 1HKBA 1IKYA 4H4OB 1UA1A 2PE8A 2DR9A 4ZPVR 5G0RA 1YWXA 1JX4A 3EJMA 4URSA 2IVMA 1RBRA 3J8AA 3EDQB 1IKWA 1O51A 1UJ5A 3TEGA 3UR0A 1IJEB 1A5WA 4Z4GA 2P9LB 4FO0A 5FJ4A 1S6UA 3QIPA 2AJ4A 3BBBA 4XO0A 4I69A 3QICA 2YPZA 3EVOA 4HKQA 4RO0A 1T95A 2ZJPL 2E6MA 3J7YI 4NO7A 2JWKA 4KHQA 2OFHX 3CTRA 3VGTA 3KNGA 5IT0A 3AJ2A 2GX8A 3P45B 3NNCA 2ZDPA 4MQ3A 1FX4A 2AIRB 2VFVA 5KFWA 3D1OA 3RJMB 2HQGA 2O66A 3JAMY 2OSQA 2PMZD 1JWWA 2P9NA 5HROB 3KK7A 2HEKA 3Q8RB 4CIGA 4H4KC 4JKGB 1RTJB 2V0NA 5A8KA 2W42A 1V5VA 4DQRA 5FLXU 4HVZA 3NL0A 3OD2A 3CXCM 2CPYA 2VWJA 2G8HA 3QT5A 4BE1A 1LOUA 4B08A 2X1BA 4IOAQ 2E1CA 5AQQA 3CD7A 2GFFA 1JXBA 3CJKB 1WC4A 1U1QA 3MM6B 2HBJA 3POTB 5IT9O 2KHCA 1R43A 2Y1JA 5M1KA 1S1TA 1NDPA 2WFBA 3C16B 4ECYA 4PUOB 1KN6A 4ZVFA 3DRRA 4Y2MA 1XMQK 1P8ZA 5DRKA 4OFZA 5HK4A 3VAHA 4LIRA 3S1TA 4AFFA 2IJNA 3CJ4A 1FRXA 1IJFB 4KREA 2BANA 3TAPA 1W2BR 4JHDB 2DO4A 1UCNA 4AQYK 1N36F 1YSJA 1JL2A 4UOGA 2NQPA 4BR9A 5BN9A 5ETNA 2KJVA 5F8MA 3HFZB 2Z2ZA 4RW4A 4DTUA 3AVNA 2OTLN 4YQWA 3SFGA 4BS2A 2MZRA 5T7LB 1OO0B 4H0PA 4YHHF 3IG1B 2P2CB 3QO9B 1CG2A 4OV1A 3RVCA 2E1AA 4CGIA 3GV5B 2XS7A 3Q8UA 1RT1A 4NMXA 5SUHA 1OVYA 1XQSC 3GE1A 2FIUA 2NNWA 1A0OB 4AILC 1J27A 4H0TB 2QT7A 3MCPA 4N7TA 3NVMA 1WACA 1Z2ZA 3HPHA 3CCJN 2VKRA 2UUWA 4P52A 2RMLA 4I2PA 3OFGA 4FJLA 4CGDA 3RRHA 2FVPA 1XR5A 3A4TA 1KVKA 2XMKA 2D0CA 3AA3A 3GG1A 1VBYA 1VSFA 2PFFB 4KAIA 3AVKA 5DMRA 3EE9A 2PC6A 3GR0A 2FLPA 4CJFA 2HVHA 2WHOA 3UDEA 4AXIA 2FHMA 4Y2KA 3O9RA 3VHQA 3GONA 4FWNA 2IM3A 1H7XA 2O01C 1Z25A 4TNOA 3PW0A 1WHWA 3AQPA 1M5OC 3CCTA 3FBFA 1IBMK 3LM2A 1Y3KA 4PXEA 1JLCA 3DLKA 5JUMA 1RDDA 3H98A 4PYAA 3GL1A 2AJQA 3QLHB 2I6WA 1UKUA 3AXKA 4DV3F 3PYDA 4TY9A 1VQ7S 3BGLA 3CNQP 4LF5J 5AQTA 1JKHA 4CT9A 4GV3A 5F8GA 3VEVA 2HBQB 3BZCA 1E6YB 2DK2A 5ETTA 3RAXA 1H3DA 4IO1A 3H4BA 4Q0BA 4DLGA 1SS6A 3PO5A 1D1UA 1UEUA 2AP1A 3GZ7A 2CADA 4C11A 3OSPA 5HO4A 2HHUA 2CGLA 5A0YB 3VQ7A 2HMPA 4ILMA 3THXB 4X4NA 1S9EA 1YZ6A 1KQKA 3CCSS 2CJ9A 2OHDA 3VA0A 2LCWA 1HLUA 2BV3A 4K0KK 1TUGB 4QR2A 4WF9Q 3ETMA 3UDLA 4WYBA 2ZKTA 1ZPWX 2KZMA 4HUGA 4GMKA 4M5MA 4M5DA 4KFBA 1WEZA 2C2OB 5JS1A 1NM2A 1NKCA 2I7NA 1BC6A 2FZGB 2GX9A 4OVLA 5E26A 2WOMB 1H7WA 4TSXA 1HYZA 1ATNA 2ZH7A 4BG8A 4DV5K 3CQ8A 3BR9A 1HNXJ 3LP3A 3UKUA 4DF4A 2HNYA 4NB4A 5AFUA 2L48A 3PJWA 3RR8A 1HD0A 2EFGA 2Z57B 3D68A 4BC3A 2SXLA 4X64F 3O1WA 2MKKA 2VPZB 1FD8A 4B3SF 3GILA 3V1OA 3NFAA 2MHEA 3OVNA 4I7FA 2YWEA 3MPYA 3V81B 4I9QA 2RRNA 2I5JA 1WKLA 1J9AA 3ZT4A 3Q24A 3PIOL 3SDEA 1RT5A 5TKWA 1TGOA 4IG0A 2JLFA 1KQGB 5AQRA 1FXLA 3L4QA 3ZXWA 4J2DA 4NZ6A 4USHA 2B4JA 1O0PA 2FHOB 1NSQA 3H20A 4P73A 2OKQA 2P9EA 4F67A 3OYGA 4F4AA 5KFMA 5CHCB 4KGKA 3BF1A 1UVJA 1NK4A 4RX6A 3ALYA 3VQBA 1NGGA 2G0JA 2BR0A 2Q43A 4LH4A 5GVQA 3DRPA 4JKAA 5KPZA 4I2QA 4CGGA 2P6TA 3ZTOA 4DR7K 1N34K 2HIYA 3DXKA 4ZIVA 2VPWB 4RKUC 4WQ5A 3I4HX 1FXDA 2JWNA 1URNA 3OHBA 3VESA 1DTQB 4PYDA 2HAFA 1N5SA 3QMQA 3RMDA 3TA2A 1QUVA 4F9OA 4K41A 2C28A 1D4XA 5B0DA 3ZNUA 3SAHA 4H4MA 2PGCA 4PPZA 4DR2F 4DPUA 2WSCC 1N5YB 1GLFO 3NWGA 3MDQA 4J8FA 3NMAA 2MGZB 3PLAA 2N3LA 4DPXA 3A1YG 4CESA 2QJ3A 3FCHA 2EFVA 3B8AX 3OYEA 3DRYA 1EQYA 3WUHA 2I1RA 2CDRB 4KAZA 3J7A1 4QCLA 4FWSA 2ERRA 2GVZB 2AEFA 2ADCA 3CJCA 3SCXA 3LPEA 1NRKA 3VOVA 2ATQA 5F8IA 1VQ8S 2IVNA 2YNGA 2AJ2A 2D4WA 2UP1A 2PIIA 1WD6A 4PHTX 1SJ1A 3W9IA 4CH1A 2HFSA 2YWGA 4Z4CA 2AZ1A 2VYPA 2LVWA 2QGFB 1QSLA 4USTA 1DLOA 5SZTA 1F6TA 1S22A 2HGMA 2MKCA 5J1NA 4M95A 2X7IA 4ZKAA 3SBMA 4YDUA 4W5RA 1X3NA 5AT1B 4WBFA 4JLHA 5JLHA 3K5NA 4A47A 2J0SD 4O3OA 1I5OB 2VONA 2V7ZA 3WC2A 3AVFA 2ITMA 3WEEA 4DR4F 3KUGA 1NSKL 1F5BA 3H3NO 2XWXA 2NS1B 4LH5A 3DLLQ 7FDRA 1IWGA 1HNZJ 1UVNA 3OR2A 1S0NA 3N4WA 2R7SA 3KLIA 1Z1ZA 3OFHA 1IKYB 4CK1A 2E20A 1RAJA 2K7JA 5G0RB 3UNGC 1G3OA 2XB2D 4CZFA 1KVJA 3NP5A 4OL8A 1TR0A 1VQSA 2NXNA 4H5RA 1IKWB 4ECVA 4FM2A 4LRCA 1JCEA 1S48A 1SH3A 4LFBK 1HKAA 3IGVA 1H74A 4ZLJA 3M8PA 3GCWP 1OVQA 3W66A 5D8HB 3QIPB 2E5HA 3D2FA 1T6CA 3RUBL 3HMJG 4JI8J 1U8WA 4L76A 1Q78A 3FZLA 3CIZA 5CQGA 1KSPA 2A5XA 1WWHA 2M8DB 1VRUB 4E89A 2NXUA 3Q89A 3IMQJ 8ATCB 3WNFA 1IKVA 1T6DA 1Q8KA 2BMBA 5I4MA 3H2LA 2P9NB 1EQ0A 1LCUA 2I2YA 3FNNA 3CMAS 5E0OA 4LRFA 2LXFA 2F9TA 1U1OA 3HHNB 1Q16B 4FJGA 3I8BA 5KFOA 2X51A 4IH7A 4B3TF 2YNHA 2VJVA 1T44A 1ASVA 4L74A 1BHLA 4NXMF 3QEWA 2PN6A 1C0UA 3KMSA 3GFXA 2FVCA 1A5VA 4NA3A 4KPCA 1T9XA 1LFWA 3HULA 2ZM6J 1RBSA 5GAEP 4DV3J 5D0HA 2HHQA 3TPQA 1FDBA 3IM8A 1NGBA 2ATCB 1I39A 2BANB 1UWAA 1GTHA 2HLTA 3QIDA 1WTFA 4PG7A 3VQSA 1REVA 5HMXA 4RW4B 2QMWA 4CZMA 2KRRA 3VVTA 4DV0K 3LQVA 2R8KA 4NCAA 1XHZA 3MEKA 4BRGA 1PYOB 3LGHA 2N3OA 4XPEA 4FJ5A 2DIUA 4BR5A 3I55N 3OBIA 2DPJA 4DTPA 1RT1B 4P71A 3RG6A 1LW0A 5DLGA 3TANA 2MLXA 3PV8A 4BACA 3O3GA 1VI7A 1QQMA 1RWKB 2OTJS 2YBVA 4CP5A 2Z8QA 1KKHA 4I2PB 4OI6A 1M5HA 1Q7LB 2B6AA 2AT1B 5AQXA 1Y5NB 4JYAJ 4RNFA 2BYCA 2J6UA 4C23A 4EO6A 3AAWB 3C14A 1TL1A 3H40A 5L46A 2D3ZA 3ZZUA 3JSYA 2FDNA 1BA1A 2QWPA 5KFHA 1ZBFA 1QSSA 4AHTA 4KTQA 3NNHA 5K9FA 3AB2B 2LA4A 4X64J 4JKHA 2CQ4A 4UW2A 3DLKB 4FXWA 4ZK7M 1TKTA 4B3SJ 4MO4A 4ZPBA 4DSJA 3KJQB 4BRFA 1BCMA 3Q8SB 2OJ3A 2YHAA 3GMGA 3M9NB 4JI2F 4LF4J 2FZKB 1YI2N 4BRDA 5D78A 2XCPA 2D3O1 1BA0A 1JKHB 4FW1A 1P1TA 2Q6BA 2F65A 4OHWA 5IWAJ 3D6MB 3ZZTA 4Q0BB 4U96A 2VFUA 4YN3B 5DGBA 4EBDA 2NYHA 1FKOB 3LZIA 1L3KA 2G1DA 1NK5A 4DL3A 2G2OA 4BVOA 3N0VA 1S9EB 1XK8A 3K2PA 1NMNA 3WNEA 2KYZA 5F8NA 2OI2A 3I33A 3P38A 2MSSA 4XH5A 1H98A 2DBBA 2IBKA 1ATSA 4CEQA 4Y65A 2NZ4A 3PRDA 3K5PA 2F4VK 4KFBB 2HHWA 4D3GA 1HNVA 3JTPA 3D6FB 2HRYA 1RT2A 4DR5F 1L3VA 2YWKA 1WSIA 3UD5A 3A12A 5JJBA 4FF3A 5LMNF 3S6EA 5M2RA 2DNGA 4K4TA 2W7AA 4YB5A 2BKPA 2RUGA 4ZPWR 2AMCB 4ZTJA 2KZZA 2QWRA 4ZN3A 2L9NA 3O3FA 4CK2A 2HNYB 3AJDA 2C2RA 5LT5A 3D1HA 1U1PA 3UDVA 3A8IA 4IWVA 3CD6S 3PHTA 4DR2J 1HWJA 2ZOFA 1QY7A 2GA7A 1XBWA 3ZT1A 5IT9Y 2B3TB 2CGKA 3B4DA 3VEZA 1SC1B 1U7LA 5T14A 4A5AA 5C25A 4BY9C 1TKXA 4B1UB 1ZAWA 2B56A 1E4GT 3QEPA 2KVIA 4L3KA 3WXKA 4I7FB 1WOOA 4I64A 4OYPA 4NLUA 2I5JB 4HTJA 2NRRA 3HDSA 1B3TA 4CM2A 4HHUA 5K14A 1JXVA 3SDEB 3AAQA 1RT5B 1M1GA 1WC5A 4F36A 4JI7K 2DNMA 2BH1A 2ZH9A 4X66F 1F5CA 3LF0A 1YJNS 3IWNC 4CE9A 1HHTP 3MM8B 1HJOA 3FEXB 1WC3A 1NB2A 1JJ2R 2NZCA 3JB9k 1YUWA 3AVJA 2A1BA 2RILA 2YQ0A 2G13A 3AVGA 1R8HA 2QL9B 5KG2A 3M8QA 1WTBA 1RDRA 4M3XA 3UE2A 4DUYK 1W7AA 4J2AA 2G8UA 3DRPB 5CA5A 1P9QC 4QW9A 2XMVA 3EUNA 3THYA 2HKEA 2R42A 1I94K 4QAGA 4Z4HA 4CH7A 2HZVA 4O0NA 1LXJA 3DXKB 5HVGA 4FJXA 1QE1A 2P6SA 5A8RA 1K0VA 2W6KA 4B3OA 1C2PA 1BISA 2DH8A 4CZKA 5KI6A 2HG4A 2ZE2A 1SKSA 2E9TA 2HQCA 5F9NA 2QE5A 4N8NA 2VUGA 4R8UA 3U6FA 1SC3B 2AWZA 1WKKA 4H4MB 2CZVC 2XGQA 2JLEA 4FLZA 1R7IA 3W9HA 1CJUB 4WFXA 4FCYA 2OMLA 3EGZA 2QV6A 1GTEA 3TX8A 4NLGA 1XI1A 2UU9K 3ENOA 5EXWA 1WNEA 1GLLO 4ZVHA 2DISA 2F5GA 1TFWA 2D0BA 2V68A 3B8HA 3W5ZA 3ZZRA 4EK2A 4U6PA 3BN4A 3DLEA 2E5LJ 1HNWK 4IOXA 2V4QA 4KPYA 2GMJA 2Y8YA 3ZX3A 3V1RA 3M32A 4LVOP 1KQSR 4DR1K 4KKOA 3DGVA 3AGRA 2MQNA 3SAGA 3FQKA 3GTYX 4ZCLA 1XMQF 2JOQA 3CJAA 1ZAXA 4FVUA 5BPLA 1Y97A 1RQ0A 2AGOA 3A3OB 2CA9A 3EZ5A 4E7IA 4FN5A 1UW4A 4X4PA 3TR5A 3BYRA 5JMNA 4AQYF 1UWBA 2OD4A 3LTOA 4NXMJ 5I9EB 2OGUA 3KXDA 2HK3A 4FOIA 3T7ZA 2VHGA 4K8XA 2DT9A 3EX7B 3OR2B 1GT8A 3AVCA 3KLIB 2BJ7A 1AA1B 4O44A 1NZ8A 1U45A 4K4VA 2VQEK 4ZIWA 5AZJA 5DDOC 3L2RA 4JRQA 4G1IA 2W2MP 3VF2A 3NCQA 3NKYA 2QZ8A 3W62A 3M8PB 1CPZA 2ZUGA 3MK6A 3D2FB 3N28A 4U8VA 2A0FB 1DJ0A 1GK8A 2BUNA 2YX7A 2KYXA 4HDHA 3ZZYA 4O8KA 3TTFA 5GIPA 3ZSOA 2RS2A 2HYIB 1Z26A 3BR8A 4A8MP 3VETA 3K58A 1QJHA 3HCXA 2F96A 2D69A 2RE2A 1IKVB 1RACB 4M7YA 2GJ2A 4QU6A 4H0XB 4YNQA 3CC7S 1R3NA 1B4SA 4ISFA 3FRYA 1IBMF 4CLPA 1YRUA 4BGBA 4M3YA 3QNOA 4LC9B 2B9EA 5J1EB 1FCAA 4M63A 5GADP 3HXMA 4CW7B 2A6AA 3D0GE 3NH0A 3GIRA 3M8WA 2YVSA 3DWLA 5EDWA 4MFBA 2IA0A 1YJ9N 4B8CA 4CECA 4B8AB 2YNHB 2WK4A 1YHQN 5F1XA 2PO4A 3GV7B 4EHTA 1C0UB 3UN2A 3PY8A 3F0NA 1VQOS 2V4JA 5ETVA 4CF9A 5BR9A 3DDNA 5LSRA 2X74A 1F9FA 3ZX2A 2RKIA 3MGJA 4K4ZA 5JVGQ 2DR5A 2MKJA 3K5LA 2GQ2A 4K0KF 2Q6CA 3F44A 1RNHA 1VIOA 3CFRA 1T9VA 3THPA 3CETA 1WUAA 4OKKA 1RWWB 5CZ1A 1OH7A 1R6YA 1REVB 2C2DA 3C94A 4HHHA 5F9LA 3DMJA 1H72C 4Z37A 4EMDA 2VD3A 1Q81T 1GNKA 1FDDA 1YRXA 5A6WA 1X0FA 1VQ6S 2YHYA 3HSDA 1YIJS 3CCRS 2O8CA 2G8WA 1Q7YO 4FJ9A 3LP2A 3NAIA 1LW0B 4DV5F 5IQQA 3OQ2A 3GJTB 3K8VA 5HL7Q 4KHRA 4BE0A 4OGEA 4OJ3A 4F7VA 2JEFA 4FJKA 2K1RA 1RTZA 1RWMB 3QT6A 3IUCA 3UIQA 2B6AB 2ADBA 3BREA 2DO0A 3DOMA 1WG1A 3MWTA 1EX8A 5LMNJ 2F8TA 2VBZA 2EVZA 4IQMA 2W6LA 3C14B 2ZQBA 1TL1B 4Q45A 2FSJA 4DX7A 3Q7BA 1BO5O 2ZJRL 2W24A 3CMAN 1OYEA 4U7UD 1WOPA 4DQPA 1WOQA 1H6KX 1HBMA 4NOHA 3OJUA 3TZWA 4J90A 1TKTB 1CXUA 1B0PA 4WFYA 2PEBA 3R5GA 4BLGA 1FVQA 1XC9A 3MWBA 2H54B 5AXNA 3C6UA 2OEKA 3O1LA 1U25A 2CH6A 3F9MA 4B3RK 2NR0A 3O1BA 4OZLA 9RUBA 1GLEG 4NLVA 1O8BA 4BRPA 2F8EX 5FROA 4Q2MA 2B4UA 2BZ2A 3L95X 2X78A 4FWOA 4IYQA 3R6MA 4Z4IA 3R5BA 2A6MA 4DR7F 4H0OA 1N34F 1NGHA 1R8BA 5FD1A 2I0XA 7FD1A 2G8IA 3UWTA 2W25A 2Q97A 2E1PA 5GAGP 3OJSA 3CE8A 2NPIA 1BY9A 3ZSQA 4IFVA 2PYJA 2R8GA 4J9NA 1NJXA 4IEIA 1YLXA 1NGIA 4H5WA 4JI1K 1HNVB 3DU6A 1VRQC 1S4FA 5HQ8A 4NPOA 1RT2B 3GJRB 5G4DA 3SNNA 3ZETA 2XQCA 4G1QA 2GVDA 3M8ZA 2CG8A 3CCMN 3CSKA 2JZ5A 3L0QA 3OYKA 4HH0A 4M45A 3LDNA 2MYFA 4OHYA 1QD1A 3IWLA 1H38A 2VBYA 3OXGA 2GWJA 1R0AA 5GMDA 1IO2A 1KR4A 3NLCA 4J9LA 4JN4A 2ABYA 1HR0J 2J0QD 1V5IB 2AP6A 3MR7A 3MX5A 4TN2A 4K4WA 4LRAA 5EY4A 5KT4A 2IM2A 3E9OA 3GSIA 1RHUB 4MLHA 3IC1A 1UVMA 5C25B 1TKXB 4N5SA 3P6YC 2XMWA 3CDBA 1S10A 3QRQA 5KFEA 4AHUA 3C6HA 1FEEA 3KWIA 2XI2A 5M1OA 4FM1A 3LGNA 3U1NA 4A8SA 2CQIA 2U2FA 3US5A 2KG1A 5K14B 3BSNA 4BC2A 3H5UA 2IVOA 2ZHAA 2OH2A 1N5QA 1TAQA 1NKEA 2LKZA 4YOXA 4O4GA 4TVAB 3GJQB 4CF2A 3MCOA 4PEOA 2DH7A 3R7SB 1W97L 4IDKA 4AL6A 4G3IA 2R7OA 3VGSA 1NK6A 3CJRA 1WEYA 3ID6A 3M8QB 3I0SB 4DJBA 3CC2S 1X4EA 2X3DA 4AQYJ 5IV3A 2Y8WA 4DTJA 3THYB 4JKFA 4LFBF 3VEOA 4DN0A 4ZPAA 4KHPK 3BPSP 4FYXB 4U67Q 1TL7A 3MTJA 4WWSA 1Z2LA 1HA1A 3HHLC 3FR0A 1WSRA 1QE1B 5A8RB 1NPPA 4B3OB 2ALYB 2L08A 1HMVA 4RW8A 3C19A 3TABA 4H4KA 2ZE2B 2ZH5A 1IBKJ 3KNAA 1K9MT 4C8LA 4TXSA 3T1YK 3LDSA 1HI8A 1T3NA 4W4MA 5D3GA 1URRA 5GAHP 4MTPA 5I42A 3AD8C 1ZXOA 1VQMS 2H65B 4O23A 4DG1A 1WKJA 2GQCA 1CQNA 1UOCA 3NS7B 4OX6A 9ATCB 4CJWA 3TYTA 2K2PA 3ZTSA 4ZS6A 1IG8A 4FS1A 3EM1A 2BABA 1VC6A 1ZBUA 3BF3A 2FC9A 4IEEA 4F4KA 1FA0A 1RBTA 2HBLA 3DM2B 2NXJA 3SZ2A 5I3QA 3DLEB 1XNRJ 4ETZA 2AEMA 2O8BA 4ZVUB 5DK5A 4P7VA 3M32B 4YORA 1BMQB 1IBMJ 2KT2A 1FKPA 4WPAA 3M1FA 4KKOB 5DZ6A 5K8OA 1Q82O 2UYTA 3OYLA 2AQ4A 3BQ0A 4JD2A 2BJDA 2H9ZA 1MN7A 4C8NA 3FZFA 2H48B 3GLJA 1SB6A 1G2EA 4HTUA 4FWRA 3VR1A 3VEYA 1BI4A 1OPZA 3TZXA 1S79A 1VS3A 2PA3A 2J0WA 3H90A 1UWBB 1TK0A 5FLXY 1DQ8A 3OR1A 2OANA 3MR3A 1HFEL 1OYDA 2QXLA 3R1XA 2OP5A 2CJYB 2P9KA 3VEWA 3NMUA 4DV0F 4JKDA 4B9TA 3HI9A 3C6AA 2Q3PA 4O44B 3ICLA 5D4OA 5U47A 3CPWR 4K0KJ 2OYQA 4I9LA 2F63A 3L4BC 3E2EA 2HVDA 1BGXT 4MH8A 1TK5A 5AZJB 3OYIA 4Y2CA 1BG3A 3BBFA 2WVCA 5FPDA 1BCOA 1HNXK 1QVFR 5AQYA 3DXMA 3MM9A 1S1XA 3CCWA 5CD4H 1ZBHA 1V3ZA 3M1VA 4FJ7A 4DV5J 3DRSA 4CJEA 3I56N 4A59A 3QRRA 4HWIA 3B54A 5F3TA 2CQGA 2DRDA 2FD2A 4MKAA 5KAKA 5HJYA 1KTVA 3FC9A 2FY1A 2QW9A 2V2ZA 4B17A 3VAGA 1HHSA 5KT6A 1NDKA 4KI6A 2XSJA 3OBWA 4CO2A 2Q31A 3NGTA 1N8RO 2V69A 3VQTA 2KKZA 4IRCA 2VWBA 1WI8A 5AR0A 4J7CA 1X9WA 3IAYA 5AQHA 2GCFA 4MFBB 4QS8A 4A8KA 4NLXA 1JLFA 2FJEB 4BCAA 4WQ4C 1F2GA 4BC9A 2Z1HA 4GKKK 1C1CA 1VC5A 2O8EA 4H0VB 3G71S 3AO3A 3BBCA 1GLDG 2E2OA 1XNQK 2V4JB 5ETPA 3O4QA 3TUZC 3LAKA 2DNQA 4EAHD 3WHIA 1RT3A 4LBIA 1D09B 4K4UA 4DV6K 2HHSA 1C0MA 2B9WA 2GO8A 2DJWA 2MDAA 5EN1A 4DUZK 4YOWA 4B9MA 3S41A 3OTBA 3S7RA 1VQPS 4QOTA 1FJGJ 2F4VF 1JLEB 4BDYA 4DR7J 1RI7A 3W64A 1N34J 4K50A 1R0CB 2HK2A 2D9OA 4OJHA 5BJRA 1SAZA 3GCXP 2XY6A 3L7PA 3R2DJ 1Q1KA 2FF6A 2XO7A 1RTHA 2O8CB 2HGNA 4QWDA 5M1NA 1Q5VA 3LP2B 3H2UB 2ZKUA 3TAFA 4CYUA 3FUYA 3UD4P 4OZ1A 2ZITA 3TVZA 2WW8A 2PDAA 2K1RB 4DX8H 1ZBSA 2PYLA 3HYFA 4RTFD 3OHRA 6FD1A 4DTMA 2ILYA 3C8YA 2HNDA 1X1PA 2OELA 3DOMB 3M8YA 4BDZA 3J7YP 3BQ1A 2UUCK 1Y11A 2V8PA 3CVKA 2I8EA 2QLFB 4E7JA 1M1KT 4JI5K 4OX9F 2ASLA 1EO1A 3NS5A 2G0CA 3G87A 1HLWA 4WFBQ 3VTIA 3BKTA 3OUYA 3KLGA 4CFBA 4Y2IA 5AQNA 1X5SA 3KVGA 5LJ3Y 4DSEA 4GY2B 3VVUA 2OMOA 4QWCA 3T5HA 1ZYQA 1HBMB 4FK2A 4JI7F 4BRNA 4HLBA 2PT0A 3PYGA 3QINA 4MDBA 2OPRB 2XLKA 1BQXA 1TMMA 3FDSA 3BS9A 1J6ZA 2RSQA 1RSCA 3LPTA 3HVRA 4OO1J 3C15A 3NGDA 3LUYA 3Q8QB 3CJSA 3DNCA 2NUUG 1BQMA 3MN9A 5J1PA 2RHSB 4NLQA 3TQEA 2BW2A 1H0HB 2M0GB 4GW6A 1HNZK 4A2AA 2U1AA 3G6XA 1WELA 1KC8O 1UVKA 3D4JA 3FZBA 4DUYF 1UZHA 1E3MA 4WCEL 2APOA 2R2RA 1CC7A 1I94F 1VBZA 4X62J 2CG4A 2XI3A 1SC6A 2CQHA 2HAIA 1PYTA 5E3RA 2DR6A 3U7JA 4B9LA 2LQBA 4DL7A 2LDYA 2QIFA 1OJ4A 4IFVB 2F8HA 2GIRA 4JI8K 1SH0A 4Z94A 2XZTB 4FM0A 4BR2A 1U2VA 2HF3A 2ZWHA 4LFBJ 2BKNA 3BEGB 1LOTB 1X8DA 4LQ3A 2HQFA 3ZETB 4GVMA 4G1QB 2GVDB 4DV4K 5HRNA 2EFOA 3SMSA 3GQCA 4JI6K 3O8MA 4ITSA 4CFAA 1IVZA 4QW8A 3PDNA 1L3TA 2BE9B 4FVMA 2UU9F 4FJJA 3TVYA 1R0AB 2QSWA 4IOCQ 4I6AA 3GOIA 4WIQA 2XGPA 4B1YB 3W1YC 2VWKA 2DFEA 4H54A 1HNWF 3KK3A 1UFKA 3ZSVA 4LF8K 2OZSA 1AFIA 4JP8A 4F3OA 3OFEA 3UNYA 1HWLA 1GXTA 3HRGA 4DR1F 1RWUA 2EBEA 2UV8G 4FXVA 4KRWA 2M88A 2XYHB 1YK9A 2DGXA 1NGEA 1GOBA 2ZM6K 3NF8A 1ZBIA 4ZVGA 3CCLS 2UXDK 3K9KA 4PCQA 2YKAA 3W60A 2IDLA 4E7HA 1ZA1B 4OPAA 3HTVA 3V4IA 1V4SA 4EFHA 4O4GB 2CRLA 1X5TA 1SUQA 3NGUA 4LFAJ 3A5NC 2OCEA 1Q8LA 2RS8A 1S59A 3JSRA 4PQUB 2KTQA 5GADU 2ZBCA 4LREA 2Y0BB 4IDKB 5LMUK 2QX0A 1MMLA 2A41A 2FB0A 1R8AA 2VQEF 2ALZA 1EQMA 2IMWP 2HS3A 6FDRA 1T9YA 2UXBK 3CQXA 1O5JA 4ZVTB 3GIIA 3DRXA 4YB1P 1QTNB 4A8FA 1IWAA 1KAYA 3HZGA 2CPJA 3PKMA 4K42A 4CJPA 1TL7B 4DV0J 3O4NA 3PYFA 1AUDA 4PR6A 2J9DA 2P5VA 4P2SA 1HMVB 3DXBA 4RW8B 2BJ8A 3D28A 2Z30B 4I1TA 3LWMA 4JYAK 5D3GB 1RKIA 7AT1B 5I42B 1PSDA 1FD2A 1P27B 1SQGA 4PQAA 3BUZB 2Y9HA 3QB0A 3VTHA 4IBNA 3VGLA 1HI0P 4DG1B 5KG4A 3ADAC 2YQ1A 1WG5A 4A61A 2Q36A 2Q2RA 4ZVRB 3M6WA 4AL5A 5EUHA 1KD1T 1FEHA 1SCJB 2WW4A 3P5JA 4M5GA 3D0HE 1VQYA 1W25A 1X7VA 1OS5A 4E19A 4LF4K 3ATUA 1S0VA 1RT7A 2EG1A 2O8BB 2LEAA 4C3MA 4HHTA 1QDUB 5BR8K 2QA1A 1VSHA 2EFNA 2ZJPQ 5E41A 2DGOA 4KHYA 5IWAK 2I7PA 2KB2A 1NPKA 4ED5A 4JD2B 4PL8A 3UVJA 1U6FA 2R7RA 3R97A 2MQOA 4FBUA 3J81O 3ZFVA 2LSNA 1OH6A 4NZ0A 4F50A 2MB0B 3HKWA 1BI4B 1ZM2A 2VZ9A 4H4OA 2HHPA 4FL9A 1IH7A 3OTOK 2Z1JA 2JSXA 3MDFA 1V3RA 4MAKA 3Q2SC 4OLAA 2ZBRA 1VQ9N 2D74B 1RAEB 2P9KB 3CPWM 2GJIA 1WN7A 5KG0A 1YJ7A 1D9DA 1WDTA 3DJCA 3FGVA 2JLGA 4QU7A 1NPRA 3LDQA 2ACYA 4JS4A 4W5NA 1ZTTA 2CH5A 3SCLE 5ITHA 3VF4A 3E3XA 2F4VJ 1QVFM 2MLZA 1RWPB 2A1RA 2RE1A 3T6JA 1U6BA 5BPMA 4ECUA 1IBCB 2C3OA 3CCVS 3NY0A 2YJEA 3DXMB 2W9CA 1T03A 3MM9B 1S1XB 1VQLS 3SQ0A 3H2VE 4DDFA 4ANCA 3M1VB 4HEA9 3O9QA 5GAGU 4OZ5A 4FJHA 4CZIA 2DY4A 1BWVA 4DCJB 4RU9A 2FLOA 3MMBB 1S9FA 3J80U 4A8XA 2JRSA 5CYQB 3G6ES 4YOEA 1B92A 4LRDA 3QEXA 1K73T 3BGFA 4AT1B 2JNJA 3QFHA 4MK9A 2E1ZA 1S72S 2FSNA 3QESA 1XR6A 2IVYA 2XSJB 1PAEX 4WIIA 4LJMA 1OSDA 4YOYA 2CJXB 5L1IA 2CWXA 4ELTA 4FLTA 2A2CA 4IJAA 1TKZA 2IDOA 3VQAA 1JLFB 2GNKA 3WBZA 4DWIA 4CO1A 2IHR1 2KJWA 2O8EB 1H73A 4MKBA 3CYMA 1VC0A 4JI7J 5ETMA 4KY3A 4TYBA 1Y9OA 2DNPA 2IPOB 3LDLA 2BXJA 2GS8A 4DSKA 2C2ZB 4ZMMA 5L1JA 5DM6L 2F7VA 2AKWB 3VAIA 1RT3B 3O9UA 3H5XA 1M0SA 1RU1A 3ILJA 2YCHA 3F41A 3GYNA 4DUYJ 3IBWA 4QBUA 2MLYA 5KFLA 1SIWB 4CT8A 5AQFA 3M9MB 4RNOA 1B9DA 2GV9A 4JI1F 1I94J 2ASYA 2GBZA 2HB5A 2KFZA 4OYOA 1TP7A 4MKYA 4NYPA 4WXWA 1EAYC 2ZGYA 4CFDA 2B0GA 2V2VA 1XHXA 1RTHB 3DLRA 4AE5A 2VU5A 5F41A 2QKKA 3DAWA 1UA0A 1DT9A 3KTQA 3D6RA 3D0PA 4C8YA 4B1WB 4CJVA 2E2PA 3H1VX 2HSEB 1D9AA 1UL3A 2IIRA 3MAAB 1WJ9A 1VOMA 3W61A 5L38A 2E5LK 3HBTA 4KHWA 2XTJP 1L3UA 3ZO7A 1Y3JA 4UY85 3S3OA 1IN0A 3HM8A 3N4QA 2UU9J 4IXCA 1U0SA 3I31A 3VZIA 3MCAB 2G2YA 3T69A 4XH1A 5JVHL 5C2FA 4YEAA 2DCUB 3PO4A 4M5IA 2V2KA 2V8HA 5GAHU 2AGQA 3CT9A 3OUYB 1E6VA 1HNWJ 4JI4K 1B99A 1QAYA 3BF4A 3KIOA 4CHYA 4UUWA 3HHKA 2UVRA 1VQKN 1T11A 2W9BA 1ACMB 3R3TA 5J2MA 4DR1J 3AXMA 4CGFA 1IM4A 1TFYA 1E6YA 2VG7A 3AVBA 3IXQA 2IBOA 1B0TA 3TJ9A 1H1VA 3IMXA 2BW7A 3C15B 2ATLA 3K5OA 3CC4S 5A2QO 4QS9A 1BQMB 2P9IA 3CIPA 2WZ1A 3D2WA 5DLFA 4Y28C 3THXA 3QSIA 4FDFA 2WBNA 3FZMA 5IQ6A 2HF4A 3G8QA 2A40A 2P9CA 3GB0A 2MQMA 2HHHK 1DHMA 5KFPA 2F4FA 2ZC3A 4RU2A 1ILYA 4IDHA 1KDNA 4KHPF 3R5JB 4P6QA 3PIOQ 2WVEA 2VQEJ 3A8JA 3UN3A 3OYMA 2V7YA 3THWA 2HFVA 4B9SA 3T1YF 2EKYA 2KL8A 1KXPA 2FYXA 4CZLA 1FTCA 3E9PA 1I6JA 4LT6A 3AA2A 1EWQA 4FWQA 2G1HA 1FDNA 3CULA 2HQ3A 5EWFA 3T5KA 2QEXN 2W4PA 3D66A 1X9SA 3CCQN 2R7UA 4OI3A 2J0XA 5HQLA 2HBYB 1JLGB 4FZZA 1RHQB 1WF1A 2VPXB 4DCPB 3P3DA 3P8BB 5DM7L 3CCUN 3W8GA 2H5JB 2DD8S 2FLLA 5EOYA 2VCPA 3I5AA 2Q1NA 3KK3B 2RIJA 1RISA 3SMZA 3TSQA 4LF5F 1P9YA 2A18A 4AHSA 3S01A 1W9HA 4DEZA 3KD1E 1QQCA 1UW9A 3O3LA 3VGUA 4UZBA 4OYBA 3NMRA 4QYZK 3MXJA 2ZZNA 4QIVA 1GLJO 4U8YA 2DIVA 3CD0A 1PILA 3SQ1A 3OYFA 3V6HA 1HKGA 4F26A 4PKIA 3H25A 5DS7A 3V4IB 2JVOA 1SUQB 1VQNS 5CY4A 3ZTPA 4WZQA 4CJ3A 4DR6K 4URGA 3VQ8A 2F8SA 1HHQA 4AL7A 3P96A 4HR2A 4CEDA 3KLHA 4DS5A 3ZYYX 1LWCA 5HI7A 2M52A 3G10A 4KYZA 2FZCB 1VLYA 1BWFO 1H2TZ 4QPTA 2D9PA 1TV6B 4Z2XA 3QSYB 3U4LA 2HHXA 4QWBA 3FBBA 1OH5A 2NRHA 3O5BA 5CE3A 2RU3A 1HNXF 2AX0A 4LF9K 2OPSA 4HTIA 2HBKA 1FXRA 4ZHRA 5C42A 3IKMA 2PFUA 3GG4A 2KLAA 1LAVA 1ROFA 1LFPA 4A8OA 4BC7A 4IH6A 1CBKA 1T94A 4ID1A 3TOQA 1Q0NA 1WC0A 1SKWA 3AT1B 4YY3K 2EX3A 3OS1A 2I38A 3KUHA 4PKHA 3FJ2A 3VZHA 4Q8EA 5HRPA 3KLVA 2RQMA 1P6TA 4FF2A 1FFGB 5GAEI 5C24A 2MKHA 4Z7YA 2XS2A 3WC0A 4DQ8A 4IJNA 4DMZA 3FSYA 2IS3A 1DQAA 1AB8A 4AM7A 2DXEA 5HQMA 1ASWA 4NLBA 4UQGA 1VQ5N 4GKKF 1V9OA 1N5TA 3J7YU 2HVEA 1F3VA 3B6PA 2E1YA 4I6MA 2D0OA 4RG8A 1MU2B 4USKA 1XNQF 1U2CA 4UUXA 2ZFHA 3VAJA 3UVJB 2VH7A 5AQUA 4DS4A 3LA0A 2MY7A 4B3RJ 1GMUA 1Q95G 2RT3A 3FMBA 4DV6F 1ZTWA 2MJUA 4N76A 1RYSA 4DUZF 1U4BA 5JS2A 3J7Z5 2P8IA 4D3HA 2DR8A 4RCHA 3ISNC 2WSEC 1S49A 1JLQA 3PYEA 3SUPA 3H59A 2H3EB 2OEMA 3M2RB 1KD1O 5J2NA 4WFAL 4X84A 4M3WA 1C1BA 2BACA 3TSPA 4OYWA 2MZ1A 3K2YA 2AA4A 3T41A 4FNIA 3B6OA 2HMIA 2CJKA 3F56A 1ZBLA 3SI6A 5KOXA 3HFKA 2VGNA 5ETQA 4JI1J 1VRUA 4DHYA 1ATRA 1R0BG 4P9SA 2DNRA 2W9CB 1FRLA 1T03B 1HR0K 4FS2A 3J7ZT 2R7WA 2UUCF 2L9DA 3TUIC 3LM9A 4Q2LA 4ILHA 1ZS6A 4JI5F 4AXJA 3BB5A 3MXMA 4IH5A 4CBWA 2AV5A 1OQ6A 4ZVPB 3TA0A 1HBNB 2QA4G 2ZHOA 2IGIA 3OSNA 4CH0S 2R7QA 1C6VA 2XNQA 4L73A 1A7GE 5HMZA 4PABA 4ZPCA 1XJWB 4TQRA 3MHYA 3SBTA 4W5OA 3OYJA 4NLTA 2PAVA 2CQ0A 2QC3A 3QATA 2AD9A 5E3CA 2XHCA 2AYEA 4ZCIA 2RD5C 1D0EA 3P1GA 5CYMA 2E2NA 3AOAA 2KI2A 4CIOA 4OJ1A 3EGWB 1TKZB 4ED1A 1DAXA 3M4XA 2GQQA 2LP4A 2W1BA 1HNZF 3OL7A 4PXCA 2AW0A 4JKCA 4KGZB 1Y64A 3ZZPA 3EMTA 1RUSA 4RUAA 5HOOA 5K8NA 2DPIA 2KT5A 4OLBA 3ZX0A 2GTDA 2DGTA 1NLVA 2WTFA 3KHRA 1VQ4S 3UPFA 4KB7A 3D5MA 1RDWX 1YX2A 2R9LA 3M6XA 3M5RA 4BRMA 3KHHA 1K73O 4KI4A 1RE1B 1MWMA 4DU7A 1LW2A 4DZDA 2VG6B 4M3RA 4O8UA 4BRHA 3EGNA 1LWEA 2F8MA 3OV7A 4JI8F 3A8EA 3I5CA 5E3AA 2O8DA 1WAJA 3HHEA 5HVHA 1IBKK 2DGWA 2Z58B 2JX2A 1Q5YA 4KHPJ 2QLWA 1YJWN 2DEIA 1B7YB 1NB7A 3N9UC 3T9ZA 4GO5X 4XTTA 3ULHA 4DV4F 3X3UA 4JI6F 1GLBG 4JK7A 1NNDA 3CCVN 3TZZA 4ED3A 4X4UA 1MWQA 3GU0A 3RAMA 4EP4A 3T1YJ 1ITGA 3OS2A 1VBKA 5BYQA 2LECA 4WZMA 2CPZA 1IBLK 2AX1A 3W9JA 5CZ2A 3KJFB 2JC1A 3OTDA 5HVFA 2ZEJA 2C3YA 1H2UX 1X4CA 1Y10A 3M9OB 4LF8F 1TK8A 2X6SA 2C3PA 1RFQA 2Z56B 3MPUB 1XNRK 1T9TA 1VSDA 5KG5A 3W63A 1J5EK 1UZDA 3OS0A 3QPIA 3EVWA 4K2XA 1TELA 3NDKA 1T7PA 1IXKA 1N32J 4RBUA 2AZ3A 3I4PA 5CZVA 2LXUA 1E6VB 2ZM6F 1F5AA 3K0JA 4BHQA 2CKWA 4C8OA 2UXDF 3K5MA 1QVGM 4EGLA 2FC8A 4X4OA 2BM0A 3QWUA 3DLGB 1FFWB 2W9BB 4YOTA 5J2MB 3SK3A 3PW7A 3CHWA 2CJQA 2YY3A 2JVRA 1JNZB 3I9V9 1HYSA 2VG7B 4DOZA 2GAHC 2NXEA 3P83D 4XDDA 1NHUA 2L9WA 3CJ2A 5KFDA 1FKOA 1N48A 2H4WB 4BWMA 3H8YA 2ASPA 2P9IB 4DI6A 4M94A 3G4SN 5LMUF 3KK2A 3I6PA 3HHLA 3B78A 1MWZA 3I96A 2V52B 5ETKA 1KVAA 2CPHA 2P5OA 1KRPA 3X1LB 2C3MA 2UXBF 2OPPA 3NAHA 1T0TV 1HX1A 5KG1A 3J80O 4H8KA 3BSCA 1WC1A 2J9EA 1XMOK 4FLYA 3QT7A 4RR5A 4YOVA 4R5PA 5BPNA 1F2HA 2DRBA 4GNIA 4C4WA 3ITHA 4EI2A 1VK0A 2O8FA 3AHPA 4CEAA 2AU0A 3V2UC 3CDAA 3THWB 4FW2A 2DNHA 2ZZTA 3A2FA 4JYAF 2CVEA 4ISGA 1D9FA 3VGMA 3AA4A 4KHMA 3S3MA 3WXIA 1YITS 3H45C 2QL7B 4TU9A 1AXQA 2FPHX 3ZZOA 2BJ9A 1GMWA 4RBTA 1WSEA 2ZWPA 3UCUP 4HT7A 4AD6A 4FYWB 3VPZA 4J9QA 2LXIA 4FPIA 2M5YA 2ZNZA 5BXIA 3M8SA 3LGMA 4N8OA 4Z4FA 3PKYA 4J9PA 4ERDA 3CCEN 3SIPB 4CZCA 4B3MK 3H7HB 3CWJA 4EZ9A 2ZC4A 3S8SA 1WF2A 4OPJA 1K44A 3TX0A 1TUUA 1Z4UA 3ILLA 2CQ2A 1SXLA 5CCMA 5IOLA 4Y0WA 1VRTA 4LF4F 4LBHA 4I68A 4E7KA 3SJJA 3BV8A 4JV5K 3EKSA 5BR8F 3O4WA 4F3TA 4Y1CA 3MXHP 1WF0A 2UUTA 4LFCJ 2NRXA 2V8DA 2W2NP 2ZVIA 4Y2AA 1MWKA 3SQ4A 4KH4A 5IWAF 4HT5A 1G15A 4CO5A 3LZJA 3UDCA 3CM6A 2E7WA 1RA6A 2V34A 1KTQA 2LU1A 4H5TA 3MM8A 4NA1A 4C8MA 5EWGA 2YKQA 1IG9A 4USWA 1NG9A 3TUPA 3W65A 4GKKJ 2CJBA 4K25A 3UR3C 4KTZA 3OTOF 1X3MA 3PRBA 1XNQJ 3UW1A 1Y5IB 2PI4A 1HJRA 2PSZA 1N33K 1FJGK 5KFGA 4C7QA 3SLCA 3KLHB 3W0LA 4DV6J 3FLCO 1LWCB 3KFWX 2AYGA 2FSKA 1KP6A 3CDUA 2VQFK 4DUZJ 3ZSXA 4BR0A 1DARA 3RB0A 2VC1A 2B43A 2BE7D 4CF1A 2R8HA 3TWHA 4DQSA 3PSIA 5ETRA 4MYUA 3CO9A 2ASMA 2WBMA 4BRLA 2CAJA 3SV3A 4N47A 4FJNA 2QG9B 5KFBA 4KBIA 3EWGA 1JXLA 3VQEA 2OPSB 4DTRA 3MPWA 1VK8A 4L72B 2KQ2A 1WSHA 4ZHRB 3OPKA 5C15A 5C42B 2OUGA 2QTWA 1CJUA 3G8SA 2NSBA 4ED0A 1JNRB 1N6QA 3TA1A 4XIUA 3P31A 3IS9A 3ENVA 4GKJK 4LF7K 4E1MA 2DFHA 4WQ4A 2UVWA 2C2NA 2UUCJ 3KG4A 2C2EA 3I0RA 3OHAA 2VGMA 3R7NB 4DPTA 3VGKA 3LH2S 1BXNA 3ZZZA 3KLFA 5C24B 4JI5J 4M5JA 2YHWA 2ZJQL 4W98A 4CTAA 4IUFA 1T8EA 4OZNA 3Q8PB 3HJVA 2XSFA 2QA4N 2KG0A 1WBBA 3BH6B 1YBTA 3R5AA 3D6HB 4Y0FA 5AQOA 4Y3CA 4I6MB 1RP5A 4ZLPA 2IAJA 1K0TA 5B0BA 3JSBA 3WXJA 3G6VA 5LJ5Y 2OTLS 2J8SA 1LWXA 4FWLA 2DYAA 3HZEA 1RKJA 2JH3A 2WSFC 3UN5A 1FNMA 1N5VA 4X62K 3NF6A 3PIPL 2D1CA 5IXUA 2J7UA 4UTGA 3G82A 2XBPA 3TJ8A 1O1WA 1TYQA 1Z05A 2QWOA 1TTHB 4ZDNA 1OY6A 4RWTA 1JLQB 3IR6B 4J9OA 2PY5A 1D5AA 2CQPA 2E7VA 1QSYA 4HTLA 5RUBA 1KVBA 2B8PA 3MEDA 3ZC4A 3QERA 5J2NB 2VC0A 3VMFB 2IDEA 1SKUB 1UVIA 4FVCA 3OL9A 1C1BB 2DITA 3OA9A 2VIHA 4EHUA 1XWLA 2P9SA 2BBEA 2HMIB 2V4RA 3EY1A 3LPUA 3HOTA 4KSEB 4BBYA 3MEGA 3N5BA 4IRDA 4NI2A 1NOYA 3IFRA 4RNNA 2DRAA 4CHQA 4PPDA 2ZGZA 2DCLA 4CIEA 3NCPA 4CGHA 1J2VA 1HWUA 4GVEA 5KTQA 4EEYA 4FF1A 2XULA 3IP0A 2E5LF 4CZJA 4DV4J 1D8ZA 1HIYA 3MD1A 1G99A 4JI6J 1GH8A 2B4OA 4DV1K 4L8RB 4NLWA 3BY5A 4Y00A 1RBUA 4DSLA 5J1EA 2RQKA 3EL2A 3ZSRA 3VQ5A 3NVKA 1Y7PA 2W2PP 2X1GA 4JI4F 4CQ1A 4AF1A 1NDCA 2LQJA 4LF8J 3U9DA 3MAHA 4QIFA 2KFYA 5KRTA 4DTOA 3CERA 4ZPTR 4BRAA 3NH1A 1NGAA 2YNIA 2M4MA 3CJ5A 1ESVA 1VAZA 1Q7YT 3QQCD 5CYMB 4X4SA 5ADXA 4LFAK 4BRQA 2HURA 5AQVA 3NAEA 3PW2A 2UXDJ 3PACA 3NGRA 3O5TB 4KH1B 2QA2A 1W2BM 3K0SA 2M70A 3J7ZO 4OI2A 2HHHF 4CF8A 3EZUA 4YP3A 3S3NA 4W92B 4J2BA 2CFXA 2LYVA 5C0YA 3RBZA 1R6VA 4CNZA 1LK5A 2ROEA 4CRJA 3DXSX 4NA2A 2ZJRQ 3WIUA 3KJVA 2EEYA 3KKRA 5LMUJ 1EARA 1QZ6A 4PWDA 5KG3A 4NCGA 3KLEA 1LW2B 1OSCA 3D9BA 2DNOA 1LWEB 2UXBJ 3VWSA 3D3BJ 2O8DB 3ZT2A 4R0JA 1WC6A 1YQHA 3J7AP 3MZIA 1VBXA 3TJAA 3RR7A 4FSVA 3JTNA 2H5EA 2UV8A 1W2IA 2HHTA 2YHXA 3VQQA 4FYVB 2F7TA 5HAOA 1HWKA 4BROA 3BZKA 5BRFA 1JK9B 4KHSA 3HOSA 2Q66A 3A5MC 1HW9A 2QXFA 4LQ9A 1EJ7L 1GXUA 1N88A 2I9SA 1J54A 4X4VA 4NLOA 4WE1A 1CQMA 4MKVA 5CHIA 4PWUA 1RA7A 4L3NA 4EBCA 3QGHA 1KVCA 4DTSA 1GOAA 1ZETA 3I87A 2M3DA 2YPYA 1SIZA 3ZTRA 4CLUA 1YTAA 4NYFA 5E33A 3IDHA 5AQSA 3HSTB 4LRBA 5E7OB 2J5AA 3DOLA 3MCMA 3ATVA 1QAIA 4ATNA 1F1BB 1ZBTA 2CZ9A 4OZ0A 1B64A 1N4LA 3GG0A 2VFRA 2OPQA 2LU2A 1HKCA 5BR8J 2G0IA 3JS6A 3ZEUA 4ECWA 2XYPB 5JXSA 2X1FA 4NEZA 2YX1A 1HYSB 1YKWA 2J7WA 5C12A 4DR6F 4IKFA 5BYSA 4RL1A 1XN9A 4ICLB 1PJ6A 3KK2B 4UT4A 3HHLB 5AQMA 2CQBA 1U47A 5CR4A 2JDJA 1RT4A 3O3HA 2RDJA 1HBUA 2OPPB 4ZP7A 3OTOJ 4XEIA 4N56A 2WVDA 1KCFA 5KFFA 3MN5A 1BQNA 4CJ5A 4XPCA 2P5GA 3AOBA 3GBTA 3R6GB 3B6BA 3GWCA 4R5PB 4LF9F 4WK3A 1S0OA 2FGCA 5D77A 3ITHB 2NXCA 4CJUA 2O8FB 2B7CB 1S76D 3FFIB 2ZWOA 2VV5A 5E84A 3HD2A 2V94A 1DTTA 1U1RA 4LF2A 3RGIA 4YUDA 3MX2A 4LIWA 1UPPA 1SQEA 3CF5L 5LL6Z 2OFGX 3L7OA 3L09A 1RBOB 3QNWB 3DLHA 4YY3F 1WEXA 2HOEA 2HVIA 4DQQA 4OI1A 1YBUA 2K06A 2VF3A 3D6TB 4J9VA 1Q86O 3VQPA 2HS0A 1S4EA 4KC5A 5F8JA 1HRHA 1WLJA 4UQTA 1DURA 1HQEA 2KN4A 5KG6A 3DDKA 2FHJA 4JI3J 2EWSA 5KRSA 1C4AA 5AQLA 1HPMA 5KFYA 5CYJA 4CD1A 2B9YA 2V9WA 5KT2A 2OEJA 2AEJA 1VRTB 2GWKA 1T3VA 1PIEA 3WNHA 3L2VA 4EU0A 2DHGA 1C4CA 1YF5L 1OIAA 2VKZG 3TVKA 4RW9A 5CD4A 1VQ7N 3O2IA 1AROP 5HMYA 1VJQA 1RT6A 2FJDB 4L6V3 4KH6A 5B09A 2A10A 2MZJA 3K59A 4CEBA 2FUG9 4CLZA 1SJ3P 4JV0A 2MTLA 4CHPA 3D2EA 3C0BA 3C65A 4MDAA 2YWWA 4QR0A 1NJIT 3I0SA 2KM8C 2CWKA 4M3UA 3CCSN 2HVZA 4M3TA 2GZOA 3CJ8A 1WG4A 4C9DA 2HW3A 2X1AA 5FIIA 1D3WA 1KLMA 1FX2A 3ZLJA 5CH7B 1BUXA 1VHFA 4CERA 3GYGA 4DPWA 3H08A 1EP4A 1Q79A 5EGYA 2HFZA 3TR8A 4Q44A 1Q82T 2F9WA 4YFUA 4YMEA 3RBXA 1CLQA 4I56A 5HSPA 5F2RA 3FZHA 1E4FT 2BOAA 1HR0F 2E88A 3TSUA 2XMAA 4ED7A 3RAQA 1YITN 3R2CJ 3RW6A 3PW4A 2RN2A 2GUIA 5KFVA 2YWHA 1U26A 1S77D 5L1LA 1N6QB 5HN0A 3QETA 1VIXA 3IS9B 1G6BA 4CZGA 4FPAA 1LKZA 3DM2A 4FZYA 4OQJA 1SPBP 3K8WA 5AXKA 3V9SA 5H9FK 3I0RB 4DCOB 4DL0C 3WIVA 1BIUA 1NJZA 4U7CA 3KLFB 4E1NA 4R0EA 3L2WA 4JKEA 3QNNA 2JJ4D 1VHXA 4ZN1A 4CTAB 4HL9A 1WNSA 4USMA 2L41A 1S99A 3V6JA 4X66K 5F0WA 4JS5A 4JI4J 4IO9L 1X31C 3QFWA 1SQFA 2DHSA 3DHXA 5SWMA 4I6YA 2Q0UA 1U2FA 4FPBA 2YKOA 4DU1A 4DR3K 2IAJB 2F9JA 3J80Y 1S12A 1I3OB 2FJAB 1P90A 3D1QA 4QWEA 3K17A 3MR5A 2IVPA 1ZOTA 3HKZD 3LP1A 2KFNA 2HLUA 2RNEA 3DI6A 1TYQB 3G82B 2E7XA 3I55S 1TUVA 1HPZA 1DBDA 5L8RC 4ZLLA 2HHHJ 1CZAN 2IMOA 2OSRA 1T02A 3OYAA 5KFIA 1RTIA 3KG0A 4NXNK 1N8RT 1IBKF 1VSJA 4QIEA 3MEDB 1V4TA 3D67A 4C3KA 5AQZA 2R4FA 3W3DA 3UO0A 1HBOA 2XMUA 4WXOA 3N4PA 4CLFA 2MY8A 3FBCA 4URQU 1VFJA 1PG5B 4V19J 2VDHA 5C5JA 2P9SB 3R8YA 2JFKA 4AHCA 1DEJA 4IFEA 4OX8A 3SYZA 1FNXH 3MEGB 1LAWA 1RWVB 4NI2B 2ZH4A 1IBLF 1S7HA 1L5UA 4H0YB 3LL3A 3BGRB 2GC8A 3PVXA 1CLFA 3T9NA 3OLBA 2ZBQA 1XNRF 3I82A 1NGJA 4NLPA 1J5EF 4CNYA 2M9KA 3E01A 2P1JA 2UVVA 1Q4RA 1VQ8N 4BC4A 3WX8A 2DHXA 3MM7A 1YI2S 1HQ2A 1RU2A 3VQ9A 3J7AN 1KHVA 1RCHA 4YB6A 4DQIA 5FRNA 3PZPA 1OH8A 2YV0X 3HLUA 1NK7A 3RRGA 2PMHA 4DSFA 2YNIB 2D0AA 2ZHBA 4NYZA 5KFNA 3HSGA 3CUNA 5DGAA 1IUJA 2AJFE 4QYZJ 2NUBA 2HZCA 1KONA 4CK3A 4FK4A 3O6WA 3D0IE 1N56A 4DL4A 2E6LA 3QZ7A 4L75A 1FESA 2EHGA 3A3PB 3FVYA 1X4DA 2BDPA 3D54A 4U9RA 1BDGA 1VYAA 3ENBA 3CFPA 4C2MA 2F1FA 4DR6J 2QLBB 1XMOF 3FQLA 3RB4A 3C6TA 3KJVB 1Q9YA 1JLEA 1T05B 3C66A 4CLLA 4CLKA 4PWDB 2PBDA 3DC2A 5HRSA 1EETA 4NCGB 3KLEB 1SL2A 3P5BP 2POKA 3MECA 3NF7A 1BE4A 3PJXA 5D0EA 4FZVA 3NH2A 4XK8C 3W2VA 4ZJQA 1QHAA 1JCGA 1R89A 1K8AO 4TQSA 1NK8A 4FJ8A 3ZT0A 2ZDOA 4LF9J 2BVZA 3SUNA 5H9EJ 1RILA 3F5TA 3T19A 4W90B 1CJKA 4IFYA 2XC9A 1LK7A 3ET6A 1O13A 2VJUA 1ZZNA 3MXIA 1KC8T 1R31A 4WCEQ 2QWLA 2ZVSA 2ZZMA 4K43A 4B3MF 3HVTA 4CLSA 3AVHA 4HACA 4A5BA 4WE1B 4CIFA 5C2DA 4YY3J 2D3OR 1SI9A 4A8QA 4ELVA 2DB1A 4JV5F 4WTYA 4C1NI 1K1QA 3FSIA 1RTDA 1GQEA 4RJVA 1MN9A 3MR2A 2VA2A 1RJJA 3AODA 3CMES 2OPRA 3HF5A 3DOLB 3TAMA 2PFDA 4DX6A 4X65K 1X4AA 2XYGB 2OPQB 1X4FA 4OYMA 5KFSA 2ACMA 3ZEUB 1SC4B 3K57A 1J5OA 4ZTFA 4ZP6A 4GC7A 2YWFA 2QTDA 3SSSA 2E4LA 3KHYA 3VGVA 1S1VA 4LSNA 4HHJA 4HVJA 3KUEA 2BRLA 2PD1A 4UF4A 1N33F 2DHAA 1FJGF 1IQZA 4HI1A 3PJ9A 3C2PA 2XRIA 2E1RA 3CB4A 2OAUA 2VQFF 4USVA 3ZSZA 3FKBA 5KPTA 4WFNL 5K20B 1RT4B 3E1YA 2IOCA 1HBUB 3UKRA 5I3UA 2AYMA 3CIMA 4V1Ak 1YVNA 2WONA 1LEOA 4DFJA 5GINA 2BJ3A 4TY8A 3LDOA 1FVSA 3GIKA 4HYKA 1BQNB 2YKMB 1OY9A 3AY0A 2EG2A 3KDOA 4PKGA 1HW8A 3LW5C 5CZXA 3AOCA 5HATA 3FFKB