4CJLA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 149
sequence length 154
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjlA00
4OKJA 3F73A 5I42A 1LAWA 2HNZA 4Y1DA 3KLGA 1T7PA 3V4IA 1RBUA 4DTUA 3NF8A 3ISNC 4GVMA 2YHAA 1C1AA 1S1UA 1HRHA 3ZSZA 3JYTA 3L8BA 2KZZA 1WSJA 2HNYA 1RNHA 3V9UA 3C6UA 1C1BA 1KRPA 1RBSA 2KFZA 4W5OA 4AHVA 2GUIA 4IFVA 1KVAA 2BANA 1HJRA 3ZT3A 1U04A 3M8QA 3VQ4A 3M8RA 1SL1A 3L2WA 3VQAA 2KW4A 1NJYA 1TAUA 5KGXA 3U3GA 4FK2A 2RKIA 4KTZA 2Z1HA 3TR8A 4DG1A 3EY1A 3U3YA 1D8YA 2QKKA 4M3ZA 1S9EA 1T8EA 3M8SA 2HHSA 1JL1A 4YNQA 4BE1A 4HCCA 4CF9A 1X9SA 4B9UA 1BL3A 4O0JA 4LH4A 4C8LA 1JL2A 4MFBA 3OYIA 4JS4A 1K6YA 4FW1A 4CK1A 3K58A 3DI6A 3ZSYA 4FM2A 4N41A 2P5OA 4Z0UA 2YNGA 4CGJA 5SZTA 2KTQA 1VK0A 1HNIA 3KKSA 4NYNA 3TAEA 4PUOA 4CF0A 4E7LA 4CGFA 4FLUA 1QSSA 3T1AA 4AHTA 4N76A 1NKCA 3NBPA 4LD0A 4KTQA 5T7BA 1LW2A 1GOCA 1B9DA 5EU7A 4FLVA 3VA0A 3B6PA 3QEWA 2XY7A 1FK9A 1TL3A 2G8IA 4FZZA 4KV8A 4OKEA 3RMAA 1UWBA 4HCBA 1JLBA 3RMCA 1BCMA 3KD1E 1BHLA 1LWEA 5KGWA 1RCHA 1CZBA 1KVCA 1HYSA 1L3SA 3HPGA 2OPPA 1RT5A 4HVJA 5HRSA 1W0HA 3MECA 3TABA 2GBZA 1IKWA 4LY7A 1L3TA 1B9FA 2G8FA 1RDBA 1NK7A 2YHBA 3K59A 3RRGA 3DRRA 3VQ9A 4RG8A 1Q9YA 1RBTA 5I3UA 2Q3SA 4AHSA 1WSFA 3AVAA 1C0UA 2KQ2A 2HNDA 3SV4A 4DSFA 1D9FA 3SUQA 2B4JA 4CJLA 1IKVA 4FLYA 3WNEA 4CEEA 1U47A 1TK5A 4BWMA 4FYDA 4E7JA 4DSLA 5CYMA 3NH0A 4CFAA 3KD5E 2XY6A 3NDKA 3G10A 3VQ5A 4OGCA 4CGIA 4N56A 1Z25A 4KHWA 3SQ2A 3LZJA 2HHVA 3DLEA 2BE2A 5FRNA 3HVTA 3DLGA 1LWFA 3LP1A 3LP2A 1VSMA 2OPSA 1FXXA 3CQ8A 1SUQA 4CJTA 4DU1A 2HHWA 1S1VA 1SKRA 1EP4A 2OZSA 5HRPA 3KLHA 2XY8A 1VRUA 2LSNA 4C8NA 4HTUA 2KFNA 2YNFA 4M42A 1X9MA 3HVRA 1WNSA 3QEPA 1REVA 4DF4A 5KTQA 1X1PA 3OS2A 3EZ5A 2X6NA 3QINA 1VSLA 4KKOA 1QTMA 3SQ0A 4KHNA 1TKTA 1S6PA 3DYAA 4Q5VA 3HL8A 1GOAA 4FM1A 3SI6A 4AH9A 1IKYA 1KSPA 2D0BA 2PYLA 3RR8A 1C1CA 4B9LA 2D5RA 4F2RA 4Q0BA 3D45A 4LSLA 1S9GA 1NOZA 3AVHA 2R7YA 4FJKA 4PQUA 1HNVA 2OPRA 3C94A 1Z26A 3OYBA 3RWUA 4OVLA 1EX4A 4H4OA 1G15A 4DTPA 3SJJA 1KFSA 1KLNA 2IGIA 1WSHA 4FM0A 1ZBLA 4HUGA 3AV9A 4HUEA 3QESA 1L3UA 3V81A 1BQMA 4DQPA 1RT1A 4DTOA 4CFDA 3TARA 1LW0A 3C95A 3LP0A 1TVRA 4KREA 3OS1A 2XY5A 3SNNA 4DSKA 2B5JA 3I0RA 1MU2A 3SYZA 4PWDA 3K5OA 3WNFA 1NK8A 4F3OA 3ITHA 3OS0A 1N5YA 1ZBFA 3CYMA 4PA1A 3RMDA 1JLEA 3LZIA 3S3OA 5CZ1A 3OYMA 4FJ8A 1YVUA 1BIZA 3OYGA 3KJVA 4CJSA 1A5XA 3LWMA 3G0ZA 4Z4GA 1C0TA 1VSIA 1BISA 1VSFA 3ZSOA 3ZT1A 4DLEA 2YKMA 4CE9A 3NE6A 2DFFA 3NAEA 3VA3A 1NJWA 3LALA 1EETA 2P1JA 3VQCA 4CECA 4OGEA 2FC0A 2Y1JA 3QIPA 4FJXA 2YKNA 5HRNA 3NH1A 4CCHA 4C8OA 3LP3A 1CXQA 4CJWA 4FXDA 1WAFA 3LAMA 3V9ZA 3QNNA 1Q8IA 2FBYA 4CGDA 2HVIA 3NH2A 1QSYA 4CESA 4DSIA 2DFHA 1JXEA 4J2BA 3AA4A 4AHRA 4J2DA 1O1WA 3E01A 1X9WA 1VSDA 2RPIA 4JRPA 3PX6A 4E3SA 4FZXC 4UQGA 3S3NA 2E6LA 1JXBA 4DQSA 3OYEA 1YTUA 2JGUA 3V9SA 5J2NA 1RDCA 4CF2A 4BE0A 4L8RB 4M3YA 3MEEA 3H08A 2PYJA 2HHQA 1HYVA 4CHNA 1J54A 3PV8A 3AA2A 4IG0A 2HMIA 4B9NA 3O3FA 1NK6A 4C8MA 3SUPA 2DTUA 4IBNA 3O4NA 3OYKA 2YV0X 3LPUA 4Y1CA 1GOBA 3QLHA 1U4BA 3NF9A 3TI0A 1SV5A 3LAKA 4CJEA 1QS4A 2EHGA 3OYJA 4FZYA 1UOCA 4KAZA 4CIGA 4F2SA 4I2PA 5C25A 3QO9A 2Z1GA 4CFBA 1JLAA 4O0IA 4CK2A 3KK1A 1J5OA 3OYCA 3SCXA 4B9SA 1HQEA 2P5GA 1YTAA 4AHCA 2P51A 4CJVA 4FJGA 4FJLA 4FK4A 1XC9A 2HHXA 1C0MA 1IH7A 3ZCMA 3I8DA 1SKWA 1LV5A 1BQNA 3CFOA 4F8RA 2ITGA 1BI4A 4ZHRA 2HB5A 3ZSXA 3DOKA 5SWMA 1KLMA 4DLGA 4FJMA 4I2QA 3CM5A 4CK3A 3K2PA 4NYFA 3AA5X 4GW6A 1DLOA 5DK5A 3B6OA 1S1XA 3LWLA 3OYNA 1JLCA 4Z4CA 4FJNA 1A5WA 4KHSA 2BGGA 3S9HA 4OLAA 2D0AA 3SQ4A 1Y97A 3VQDA 1EKEA 3LANA 4W5QA 1EXQA 4CJUA 3QERA 3JSMA 3OYHA 3O4QA 3OYAA 3KIOA 4KI6A 1ZBUA 1TK8A 3CFRA 1D5AA 1UAXA 3K5LA 4E7IA 3PO5A 3BDPA 4DSJA 4KPYA 3I0SA 4F3TA 4CHOA 4CJKA 1VSHA 2XO7A 5C24A 4QOZB 5FROA 3ASMA 2E6MA 4DTJA 1F21A 3TWHA 4K8XA 4J2EA 3VQ6A 5HLFA 1VRTA 2G8WA 4MQ3A 4R5PA 4LSNA 3U6FA 2ZQBA 3ALYA 3O3HA 4PY5A 1BI4B 1RTIA 3AO3A 3P5JA 3VQPA 3AO2A 3TANA 3VQQA 4B3OA 4OJRA 3HK2A 2ZD1A 4H8KA 4CJRA 3NF7A 3AVLA 3EYZA 3V6DA 5KI6A 4FLTA 3HSTB 4DMNA 3KTQA 4B9VA 2G8KA 1VSJA 4E1MA 4ID5A 1A5VA 5CZ2A 3OY9A 3MAQA 2X78A 1CLQA 2Y1IA 3C6TA 4NCAA 3T3FA 1KCFA 1RDAA 3AO4A 2G8VA 3A2FA 4LH5A 1IKXA 3LPTA 4O55A 3HO1A 5CYQA 3V1OA 1XHZA 1I39A 3MXMA 1R0AA 3MEDA 3LDSA 4E7HA 4F4KA 4DSEA 5K14A 4CEDA 3KLEA 4DU3A 3TAFA 1U49A 4DU4A 2Z1IA 2YNIA 3ULDA 3UIQA 4CJ3A 3KLIA 3SUOA 3NGYA 2HVHA 5DMRA 3MXJA 3QEVA 4KHUA 3AO5A 3VQ8A 4RW9A 2HHTA 3SPZA 3WNGA 2O4IA 3NF6A 2FBVA 3OYLA 4DTXA 5KRTA 4DFMA 3OYDA 4FCYA 1NKEA 4CF8A 3V1RA 4CGHA 1IO2A 2VG5A 4KHYA 4HHTA 1U48A 2VG7A 4ID1A 3ZSVA 4CIEA 4KHQA 2QXFA 5J2QA 5KRSA 4KB1A 4KO0A 1TK0A 1NJXA 1XI1A 1WAJA 2VWJA 4E0DA 3HP6A 1WLJA 3DLRA 1TKZA 3T19A 4NCBA 4CHYA 1ITGA 2F96A 4DTSA 3NCIA 3PO4A 1RTJA 1ASUA 1RBVA 3AO1A 4DTRA 2B6AA 4FLXA 4HUFA 2O4GA 3AVIA 4RW7A 4DFKA 3MEGA 4B9MA 4XIUA 4FJJA 4DF8A 3OYFA 3DLBA 1WSEA 2WOMA 3OJSA 4M41A 3QEXA 4J2AA 4IFYA 2EX3A 3L2QA 5HROA 2IOCA 1ZYQA 3SUNA 3AVFA 4H4MA 3SQ1A 4Z4FA 2F8TA 2KZMA 4Z4HA 3K5NA 3VN5A 4BDZA 4W5TA 4O4GA 1RTDA 2G8UA 4CEAA 1NKBA 4ICLA 2HHUA 3HT3A 4JRQA 1DTQA 1B92A 3V9XA 4M3WA 3D0PA 4DQIA 3PX4A 3ZSQA 4DS5A 2X74A 2FBTA 3AA3A 4M3XA 4BE2A 4FLWA 4QCLA 2OZMA 3RR7A 4CJ4A 2ETJA 3QIOA 3HYFA 4O5BA 2HW3A 3OJUA 4YFUA 1NJZA 1QSLA 1S6QA 3DOLA 4W5NA 4Z4EA 1WN7A 5JS2A 3HM9A 4M3RA 1WSIA 4OLBA 4CIFA 2OPQA 5HRRA 4DTMA 1TKDA 1TKXA 1ASWA 3KK3A 3DRPA 3ZT2A 4E19A 3RTVA 1T03A 4M3TA 2F8SA 4OPJA 2IAJA 3K5MA 4IKFA 4DFPA 2G8HA 1W9HA 5CY4A 3AVJA 3NGIA 1RT2A 3AVMA 5FDLA 4B8AB 3SV3A 3RRHA 1Q9XA 4CJQA 4C8KA 4Z4IA 1CZ9A 1QQCA 1NOYA 4EP4A 3L3VA 4CHZA 1T05A 4KTWA 4OPKA 3VQEA 1VSEA 3RMBA 4BDPA 5J2PA 3DMJA 2VWKA 1ZBHA 2D0CA 1RT3A 3IRXA 3S3MA 1ASVA 4ELUA 2ZE2A 2QKBA 3DM2A 4E1NA 2OA8A 4G1QA 2WONA 3IAYA 4CGGA 3HJFA 1BCOA 4E7KA 4EP5A 3V1QA 1C6VA 2FBXA 4DS4A 1NK4A 3TAPA 4ZTJA 4FW2A 4DWIA 3CG7A 3HXMA 3VQBA 4JLHA 4I9LA 4NCGA 4CEZA 3O3GA 1HPZA 4M45A 3AVNA 3DLKA 4IG3A 4ELTA 1XWLA 1TGOA 3SZ2A 4KB0A 4FJ9A 1QE1A 3AVBA 4IDKA 1S1TA 4CERA 3DRSA 4CEBA 1L5UA 3ZT0A 4B08A 4W5RA 1JKHA 1KFDA 2JLEA 2Z1JA 3CM6A 1S1WA 3V9WA 1NK5A 2BDPA 2OYQA 5JS1A 4DQQA 4RW8A 4TSXA 1UA1A 3AVGA 1JLGA 2XHBA 2GV9A 1U45A 2PY5A 3QEIA 2VG6A 1J9AA 1QHTA 2IC3A 2E4LA 3KLFA 4EZ6A 3ZSWA 1L3VA 4FJIA 4DQRA 2RN2A 4KFBA 1UA0A 2YNHA 2NUBA 3NHGA 4JS5A 4FLZA 1DTTA 1HQUA 4CJFA 1IG9A 5E41A 4FJHA 3L2RA 4O44A 1BGXT 4BWJA 2W42A 1VSKA 1SL0A 4ELVA 4FJ7A 5HP1A 4GMJB 4KI4A 2I5JA 1NK9A 1JLQA 2XRIA 2DFEA 3L2UA 4M3UA 3P83D 3OVNA 1TAQA 1WSGA 1HYZA 3ZSRA 1RDDA 5C42A 2A1RA 4RW6A 2ATQA 2QK9A 4I7FA 1J53A 1YT3A 1ZBIA 1D9DA 1RT7A 3THVA 1XHXA 1JLFA 1SKSA 3NFAA 4CF1A 5J1EA 4CJ5A 1RILA 2A1SA 1S5JA 3HP9A 5J2MA 3P1GA 2IS3A 4CFCA 4CEOA 4FK0A 1RTHA 3F9KA 3HPHA 4RW4A 4CJPA 2DY4A 1RT6A 1I3AA 3NGZA 3M8PA 1HMVA 4KRFA 1LWCA 1BIUA 1FKPA 3VQ7A 3KK2A 4DFJA 4CHPA 3PY8A 4AILC 2RF2A 3TAMA 4I9QA 3KKRA 3BGRA 4FVMA 3FFIA 3HPOA 4QAGA 1RT4A 3PUFA 1TV6A 3QETA 3TAGA 2IDOA 3AVCA 1NK0A 4EZ9A 4CHQA 4ZTFA 3WNHA 3IG1A 3K57A 3MXIA 4CEQA 4B9TA 1SL2A 4CEFA 4K8ZA 4N5SA 4B8CA 4E89A 1RBRA 3QNOA 4BDYA 3TAQA 3AVKA 1KTQA 1N6QA 3DLHA 1CXUA 4OKKA 4FJ5A 1LAVA 3SPYA 3IS9A 2X6SA 4WE1A 1FKOA 2PZSA 4BACA 5FRMA 1TL1A 3PX0A 2AJQA 3L2VA 4N47A 3CFPA 5HBMA 3ZT4A 1KVBA 5D3GA 4DTNA 3L3UA 4AHUA
chains in the Genus database with same CATH superfamily
5M1QA 1VQ8N 1NGJA 1NM1A 1LAWA 3UKRB 1T7PA 4YOUA 2YHAA 1KD1O 1S1UA 2W6LA 4H0VB 4CD3A 5C12A 3C6UA 4PHTX 5JVHL 3E9OA 1SL1A 1C0GA 3L4QA 2KW4A 1TAUA 5KGXA 1OH5A 4WFAL 4KTZA 3U3YA 3ZX0A 2ZGYA 4YNQA 4BRLA 4C8LA 3ZEUB 1X9JA 4FW1A 2D0PA 4FM2A 3VTHA 2P5OA 2QW9A 3CETA 4PL8A 2KTQA 4JD2B 4E7LA 4CZMA 4N76A 4KTQA 4YHHK 3QEWA 4CZHA 4FWNA 3EN9A 2JWLA 1BCMA 1BHLA 3LDNA 1RCHA 3ZLJA 3VENA 2OPPA 4JKEA 4HVJA 2UUBK 2E2OA 3TABA 2GBZA 4CZLA 2FSKA 4EIAA 2G8FA 2I7NA 1NK7A 3K59A 1RBTA 2ZGZA 5FPNA 3TSQA 5I3UA 3CHWA 5H1SQ 2V51B 2KLAA 2KQ2A 4IEEA 4DSFA 2B4JA 1T6DA 1IKVA 4FLYA 5CYMA 4CFAA 3G10A 3U4LA 4OGCA 4OPAA 4KHWA 1N32K 5FPDA 3LP2A 1VSMA 4CJTA 2HHWA 2GWJA 2XY8A 2LSNA 4M42A 5KTQA 3DLLL 3OS2A 4JKHA 4V19S 1VSLA 4KHNA 1TKTA 5GAGP 3HL8A 2ITMA 4F2RA 2QWMA 5LMNK 2P9UB 3AVHA 1T3VA 5TKWA 1EX4A 5GADP 5C15A 4H4OA 1WSHA 4B3RK 4FM0A 5FPEA 4BRGA 1BQMA 3H6EA 1LW0A 4DV2K 3LP0A 1TVRA 3OS1A 2YHXA 1Q81O 2E2NA 3EE8A 3OS0A 1N5YA 4PA1A 2V7ZA 1GLLO 1YVUA 3OYGA 3KJVA 1W97L 4CJSA 3LWMA 4DV6K 4DHYA 1VSIA 2BTFA 2O8CB 4AQYK 2NRWA 3CJ7A 4FPAA 1NG9A 2YKMA 3NVMA 2DFFA 3MDQA 2RHKA 3ID8A 3M5RA 2UXDK 4OGEA 3CCMN 4FWRA 3NH1A 3O1BA 2E5LK 4C8OA 3CERA 3CPEA 4FXDA 4GV6A 1NLVA 3QNNA 2FBYA 3ZETA 3NH2A 4IXCA 2QXLA 1VQPN 2WBNA 4JRPA 2P9IA 4FZXC 4BG9A 2Q36A 1NGHA 4DQSA 5AQWA 1ILYA 1YTUA 5J2NA 4LFAK 3EZWA 3H08A 5BRFA 2HHQA 4IG0A 1Q82O 3LM9A 3C6HA 3O3FA 3IFRA 3QLHA 3NF9A 3TI0A 3LAKA 3FZKA 3E9PA 2P9PA 4I6MA 3OYCA 3H3OB 4LC9B 2P51A 1XC9A 1QQNA 3H45C 2HHXA 5AJ3K 1LV5A 1BI4A 3ATUA 4CK3A 4JK8A 3ULEB 4GW6A 1DLOA 3B6OA 5MLCQ 4Z4CA 1A5WA 4KHSA 3UKUA 3S9HA 3VETA 3D2FA 2ASPA 1EKEA 4BR7A 1HUXA 5BPLA 3T1YK 1TK8A 1D5AA 1UAXA 4E7IA 4KPYA 3I0SA 3QDKA 4F3TA 3EL2A 4QOZB 4JI2K 2DPNA 3HM8A 5FROA 3ASMA 1F21A 4R5PA 3ALYA 3P5JA 1QZ5A 3AO3A 3VQPA 3AO2A 3H46O 4L3QA 3VQQA 4B3OA 5AQJA 4CJRA 4H8KA 3NF7A 4ISEA 3CCEN 5KI6A 4JI0K 4E1MA 4YORA 3OY9A 1CLQA 5M1NA 2Y1IA 3T3FA 2G8VA 2YJFA 3A2FA 5CYQA 3V1OA 1YUWA 3WEEA 4CEDA 2UXBK 4IO9L 4B9QA 3ULDA 3PIOL 4C23A 3NGYA 2HVHA 5DMRA 3MXJA 3QEVA 3MX5A 4KHUA 3VQ8A 4RW9A 2HHTA 3FLCO 4DTXA 1ATSA 1NKEA 4C1NI 5F0XA 3V1RA 4CBXA 5M1OA 1ATNA 3RVCA 4J8FA 2HOEA 3ZSVA 4BROA 5B8HA 1S3XA 4KO0A 2P9LB 5C2DA 4E0DA 3Q7CA 4DTSA 3NCIA 4FWKA 1ASUA 1RBVA 2CGLA 1U2VB 4FLXA 1IBLK 2Q1NA 4RW7A 3W0LA 4B9MA 3MEGA 3RSEB 3CJBA 1TYQA 1WSEA 1ZYQA 2EX3A 3IUCA 3VERA 4Z4FA 2F8TA 2WC9A 3K5NA 4BDZA 4O4GA 1MDUB 2G8UA 3CMAN 1DKGD 3HT3A 3V9XA 5IT9O 4FWPA 5AQRA 3PX4A 4M3XA 4BRFA 4QCLA 3RR7A 2ETJA 2E88A 2P9KB 1NJZA 1QSLA 3TU5A 4CIFA 1IBKK 2OTLN 2OPQA 3VGMA 4DTMA 4M3TA 4JI5K 3N4QA 4JI3K 4JD2A 4OPJA 2QWRA 4IKFA 4DFPA 3O8MA 1W9HA 4BREA 3D7EO 3WEEB 4B8AB 2WTUA 4Z4IA 4BRIA 4AF1A 4H0XB 3L3VA 1T05A 3E66A 4KTWA 3RMBA 4BDPA 1WB9A 1RT3A 4E1NA 2VGMA 2WONA 1YJ9N 3IAYA 1KXPA 4CGGA 3HJFA 3VOVA 3CJ9A 3TAPA 3W3DA 4JHDB 1TGOA 4KB0A 4CEBA 3DRSA 1S22A 2GX9A 3ZT0A 1JKHA 2Z1JA 2OYQA 5A2QO 4Y0WA 1TUYA 4TSXA 1UA1A 1U45A 2P9KA 1JLGA 1K8AO 3QEIA 1J9AA 1XMOK 4BRDA 3NMUA 1EWRA 4DQRA 2RN2A 1UA0A 3U8XA 4FPBA 4EFHA 4FJHA 4O44A 4BWJA 3JS6A 2I5JA 3L2UA 1ZBHA 3P83D 3OVNA 1TAQA 5C42A 4RW6A 4I7FA 4DKWA 3THVA 3NFAA 2O8CA 2A1SA 3HP9A 4FK0A 3F9KA 3HPHA 4CJPA 4RW4A 2DY4A 4DV4K 1RT6A 2A40A 3M8PA 4B1UB 4KRFA 1FKPA 4I9QA 3KK2A 3TAMA 3BGRA 2NZTA 4QAGA 4BY9C 1BO5O 3MWPA 4RWTA 3TAGA 4EZ9A 4YY3K 3WNHA 3IG1A 2OANA 4CEQA 1SL2A 4LF4K 4CEFA 4N5SA 4B8CA 4LFBK 4BDYA 5AQUA 4FJ5A 3L4IA 3SPYA 4WE1A 1FKOA 4DR2K 4EHUA 2ASMA 1K8KA 3VEVA 3MK6A 2ZM6K 3ZT4A 1KVBA 3G4SN 3KLGA 5BPNA 2NNWA 3ISNC 3ZSZA 4DR6K 1C1AA 3JYTA 3L8BA 2KZZA 3ENBA 1WSJA 2RE2A 3H3NO 1HKGA 1KRPA 1RBSA 1YXQA 4W5OA 2KFZA 1KVAA 1HJRA 5M1PA 3BEXA 3M8QA 1GLAG 3L2WA 4GY2B 4FWOA 4BGBA 2UYTA 3EY1A 2Z1HA 3TR8A 1GLDG 3M8SA 4K0KK 3GBTA 4HCCA 4CF9A 1X9SA 1BL3A 2HF3A 2A42A 4B1WB 4O0JA 4B3MK 5F2RA 3KKSA 1HNIA 3TAEA 4CGFA 4FLUA 1QSSA 4WYBA 3THYA 1Y64A 3SJHA 2E8AA 1NNEA 1GOCA 2GELA 4FLVA 3B6PA 4DV5K 2XY7A 1FK9A 3DJCA 4FZZA 2BH1A 4JI1K 4KV8A 3BY5A 1UWBA 4HCBA 1JLBA 5KGWA 2A5XA 5HRSA 1RT5A 4FK2A 5BRDA 3MECA 2O8BB 4LY7A 3KK7A 3OHRA 3KZBA 5C0YA 3HZ6A 3ZX2A 5LMUK 1OKJA 4JI8K 4CJ7A 4BR5A 1XMQK 3SUQA 1SS6A 3WNEA 1QQOA 3OW2M 1U47A 4LF6K 3NH0A 1C0FA 4N56A 1Z25A 3HVTA 1FXXA 3QB0A 4DU1A 4BR0A 2FLOA 1EP4A 5HRPA 5BPMA 3KLHA 4ILGB 2YNFA 5AQYA 1X9MA 2NRVA 3R1XA 3EZ5A 3A5MC 1QVFM 1QTMA 3OBWA 1S6PA 2W41A 1KSPA 4DV1K 2PYLA 3WQTA 1C1CA 1S9GA 1NOZA 3TTCA 2R7YA 4PQUA 1NGCA 2F9TA 4DR3K 2NRRA 3THWA 1G15A 1KFSA 2HBJA 1ZBLA 1Z6RA 3AV9A 5JVGL 3V81A 4DQPA 1RT1A 4DTOA 4CFDA 3FFKB 2O8FB 4KREA 4PWDA 1HR0K 1DT9A 2B5JA 3SYZA 3K5OA 4F3OA 3RMDA 1JLEA 3LZIA 3S3OA 5CZ1A 4YOWA 1MA9B 1BIZA 2P9PB 3G0ZA 4EAHD 1BISA 1VSFA 2A41A 4DLEA 3CCQN 3NAEA 5M1FA 4MO5A 3VA3A 1EETA 4CECA 3K0SA 4JV5K 2FC0A 3CF5L 4DV0K 1XNRK 2CH6A 4CJWA 1WAFA 3V9ZA 1NGIA 2HVIA 3PIPL 4BC2A 2DFHA 4J2DA 3E01A 4JI6K 3PX6A 1M1KO 4DV7K 4BR2A 4UQGA 3S3NA 1K73O 1JXBA 2IVOA 2JGUA 3VESA 4L8RB 3VGKA 1NGBA 3AA2A 4C8MA 4FWLA 4UY8O 3OYKA 3LPUA 2ZJQL 1GOBA 4CJEA 2EHGA 1NGFA 5AQKA 4BRHA 2EWSA 4F2SA 3OBYA 1BWFO 3VEYA 5C25A 2Z1GA 4PKGA 3WXIA 3CCRN 2V7YA 1E4FT 1JLAA 4CBWA 1VQKN 3SCXA 2P5GA 4AHCA 4CJVA 4XH5A 3HI0A 1IH7A 3I8DA 3TSPA 2ITGA 4B1ZA 4DUZK 4ZHRA 3ZSXA 2UXCK 3DOKA 4I2QA 3SMSA 1HKBA 4NLBA 4DB3A 4IOXA 4H03B 1S1XA 1X3MA 3OYNA 3PSFA 3KWIA 1T6CA 5AQMA 4H5NA 4W5QA 5EVZA 3OYHA 4BR9A 3OYAA 3CFRA 1XC3A 3M3ZA 3A5NC 1YVNA 1HNZK 3CC2N 5C24A 3J80O 4PKIA 2PFUA 4ILHA 3TPQA 3J8AA 3VQ6A 5HLFA 1J6ZA 2E2QA 4JK9A 1ZBSA 3U6FA 2ZQBA 3O3HA 4CVNE 1BI4B 4AM6A 3ENOA 3FR0A 3O80A 4FJ7A 4KB1A 4DMNA 4DR7K 4ID5A 1A5VA 1J5EK 4JI4K 1HNXK 2X78A 3O9TA 4NCAA 3BF3A 1KCFA 5HL7L 3EKSA 4LH5A 3LPTA 4IWVA 1I39A 4E7HA 4F4KA 1BUPA 3KLEA 3TAFA 1VQON 2YNIA 3O9SA 3BZKA 3ENHA 4CI6A 4CJ3A 3UIQA 1OVQA 4BRPA 4F9OA 3OYLA 2HBKA 4FWSA 2WUSA 1IO2A 1NBWA 2VG5A 2CGKA 1U48A 2QXFA 4NXNK 3DXMB 4IZ9A 4AM7A 1MWKA 1XI1A 2VWJA 1QZ6A 1WLJA 4NCBA 1ITGA 3O1WA 2F96A 3PO4A 1RTJA 4X64K 3FGUA 4YDUA 2O4GA 4FSVA 4X66K 5CE3A 3CPWM 4LF5K 3OYFA 1QHAA 3QEXA 3A5LC 1KAZA 5HROA 3AVFA 4H4MA 3K9JA 2E1ZA 3VN5A 5C2FA 4MO4A 3D0PA 3O9QA 5E84A 3AA3A 4BE2A 4CJ4A 4U7BA 1VQ7N 4IOCL 3E1YA 5JS2A 1YF5L 4A5AA 4FL9A 2P9LA 2F4VK 1TKDA 4WQ5C 1ASWA 4A2AA 3DRPA 3KK3A 2F8SA 1T03A 3QBWA 3I56N 2G8HA 3PLAA 1GLCG 3FZFA 3T1HK 3AVJA 2FSJA 3NGIA 5BR9A 3OTOK 1NJIO 3AVMA 5FDLA 3SV3A 3RRHA 3CQXA 4U67L 4BVPA 1Q7YO 3BZCA 1NOYA 4EP4A 2GWKA 4CHZA 3DXMA 2GEMA 1VSEA 3WXLA 4R79A 2KHOA 3Q7BA 3VF4A 2ZE2A 3DM2A 1OVYA 4G1QA 1NGGA 4E7KA 4EP5A 3V1QA 5AZJA 2FBXA 2PAVA 4JLHA 1HPZA 4IFEA 4H0PA 4BRQA 4FJ9A 1QE1A 2V52B 3AVBA 4IDKA 4A57A 4LF7K 1IV0A 4BGAA 4W5RA 3CM6A 5AQOA 2UUAK 3CJ1A 3HOSA 1XQSC 3AVGA 4WCEL 2VG6A 3CD6N 4K41A 2IC3A 2E4LA 1L3VA 4GVEA 4PL7A 1VQLN 4JS5A 4A5BA 4CJFA 1IG9A 4H5RA 5E41A 3UE5A 3L2RA 2W42A 5LL6Z 1SL0A 2P9SA 3HOTA 1YAGA 4NXMK 4M3UA 3MX2A 4JNEA 4BQZA 1HLUA 2QK9A 1J53A 1YT3A 3G25A 1ZBIA 1D9DA 1K8KB 1VQNN 1XHXA 1JLFA 4CW7B 4GKJK 4CJ5A 2O8BA 3P1GA 2IS3A 4CEOA 4GKKK 1I3AA 4KBOA 4FO0A 1BIUA 3VQ7A 3PY8A 3VTIA 4CHPA 4QS8A 4BVOA 2YHYA 3HPOA 3QETA 4XEIA 1NK0A 2UU9K 3K57A 3MXIA 1E3MA 1N6QA 2ZJPL 1Q86O 4KH4A 1LAVA 2X6SA 1BG3A 4QS7A 4CZKA 1P90A 2I7PA 3D2FB 4DTNA 3L3UA 5FRNA 1RDUA 5I42A 2HNZA 4Y1DA 3V4IA 1RBUA 1HRHA 2HNYA 1RNHA 1N33K 4E1JA 4IFVA 3ZT3A 1D4XA 1U04A 4JYAK 4JHDA 4A61A 3UKUB 3VQAA 3WXJA 4O5FA 1NJYA 3U3GA 4M3ZA 1YIJN 1S9EA 1T8EA 5KPZA 5FLXO 1JL1A 4I6MB 4B9UA 2IVPA 3JXUA 3AGRA 4LH4A 4C1NK 1DGKN 1JL2A 4JS4A 1VQ6N 1K6YA 4CK1A 4Z0UA 3H1VX 4A62A 4FOIA 4WQ4C 3LDLA 1VK0A 4NYNA 4CF0A 2IVNA 2UUCK 4LD0A 1NMNA 1LW2A 3VA0A 2E2PA 3T7ZA 1N8RO 1NWKA 2FSNA 3RMCA 1KC8O 3VF2A 3HPGA 1QVGM 1L3TA 5C10A 1IKWA 2BUPA 1B9FA 1RDBA 2P9SB 3MN6A 3RRGA 1Q9YA 3VQ9A 4RG8A 3F2KA 5ADXA 4YOVA 3THWB 1C0UA 4CD1A 2HNDA 3SV4A 3SLCA 1D9FA 5F1XA 3LDPA 2E1YA 4PKHA 4YOYA 4CEEA 1TK5A 4E7JA 2XY6A 1GLBG 4DCHA 3NDKA 3VQ5A 5AR0A 3LZJA 3BP8A 1VAZA 5I9EB 3DLGA 2Q31A 3LP1A 2OPSA 3CQ8A 1SUQA 5AFUH 2P9NA 4YDUC 3K9KA 4QS9A 3HVRA 1NGEA 2W40A 3QBXA 4GV9A 1E4GT 4DF4A 4KKOA 1JCGA 1GOAA 3SI6A 1IKYA 4Q0BA 2D0BA 3MN7A 2D5RA 3D45A 4JN4A 4FJKA 1HNVA 2OPRA 3UB5A 1XUPO 3SJJA 4DTPA 1KLNA 2IGIA 4NB4A 1N36K 3D2EB 4HUGA 3F9MA 3AARA 4HUEA 3QESA 1L3UA 3EEQA 3CC7N 3C95A 3P4IA 3CXCM 2XY5A 3SNNA 4DSKA 3I0RA 3A8YA 1MU2A 3WNFA 3ITHA 1K9MO 3WT0A 3DXKA 4Z4GA 3SBGA 3ZSOA 3G71N 1NJWA 3LALA 1ZXOA 3O9RA 3I8BA 3QIPA 2YKNA 5HRNA 1NU0A 5AQQA 4CCHA 2ASOA 3LP3A 1CXQA 4WFNL 1Q8IA 1QSYA 4JK7A 2QTDA 3AA4A 1MWMA 1VSDA 2RPIA 3CCVN 1VQ9N 3MCPA 4ILJA 4FWMA 2E6LA 3OYEA 3RSEA 3TTFA 4BRCA 3V9SA 3C6AA 4CF2A 4BE0A 2PYJA 1HNWK 1J54A 3PV8A 2HMIA 4B9NA 3SUPA 1O13A 4IBNA 1U4BA 4WF9L 3OYJA 2YX6A 2OCEA 1UOCA 4CIGA 4I2PA 5AQIA 3R8EA 4CFBA 3J7YP 3KK1A 4CK2A 4G9ZA 1HQEA 1YTAA 4H0TB 4FK4A 3CCUN 4WQ4A 3ZCMA 5KPRA 1SKWA 1YJNN 2VWBA 4ISGA 3WXKA 3QMLA 4F8RA 1HX1A 2HB5A 4DLGA 5SWMA 4FJMA 1KLMA 1JCFA 4NYFA 3AA5X 3LWLA 3SBTA 3UKRA 3SAHA 4BC4A 2BGGA 5ADXH 2D0AA 3VQDA 3LANA 4A59A 3HTVA 1EXQA 4CJUA 3I55N 2PBDA 3KIOA 3CIPA 5AQLA 3BDPA 1SAZA 1OH6A 2XO7A 4FWQA 3AAQA 3ZETB 5AFUA 1RFQA 3TWHA 4K8XA 4J2EA 4MQ3A 4LSNA 4PY5A 1GLFO 1RTIA 2F7TA 4IO8A 4OJRA 3V6DA 4FLTA 3HSTB 3KTQA 4B9VA 1VSJA 3R3LA 5CZ2A 3MAQA 4O8KA 3D2EA 4O55A 3HO1A 3M6GA 1XHZA 2GUPA 1R0AA 3EE9A 3GOIA 3SAFA 5K14A 3L0QA 2Z1IA 1BA0A 1VQ5N 3SUOA 3LM2A 4BC3A 2NRXA 1EQYA 4YOXA 3AO5A 4BR4A 3P31A 3J81O 3SPZA 3WNGA 3NF6A 3VPZA 5JMVA 3O08A 4DFMA 5KRTA 3OYDA 4CGHA 3N4PA 3MMVA 2E20A 2VG7A 5BREA 1TK0A 1WAJA 3DLRA 3T19A 1TKZA 1OH7A 4CHYA 1RGIA 2B6AA 2ZJRL 3AVIA 4XIUA 4DF8A 3DLBA 2WOMA 4M41A 3L2QA 2IOCA 2YJEA 3CMEN 2WFBA 3MCAB 1CZAN 1RTDA 2HMPA 4CEAA 1NKBA 2HHUA 4JRQA 4IOAL 3ID6A 4M3WA 2D4WA 5LY3A 4DQIA 3WUHA 3ZSQA 4DS5A 4XH4A 3THXB 4FLWA 4HTLA 2OZMA 5BN9A 3QIOA 3HYFA 4O5BA 4YFUA 1S6QA 3DOLA 4Z4EA 3HM9A 4M3RA 4OLBA 5BRHA 3T69A 5HRRA 1WOQA 1JJ2M 1TKXA 3RTVA 2VGNA 4E19A 2IAJA 5JLFA 3NVKA 5CY4A 1RT2A 4CZEA 2Q0RA 1Q9XA 3BF1A 1CZ9A 1WBDA 4H5TA 4OPKA 3VQEA 4H5VA 5GIPA 5J2PA 2VWKA 3IRXA 1WUAA 2A3ZA 3AGKA 4LF8K 5GIOA 1BU6O 3CJCA 1NK4A 3IKMA 3U9DA 4ZTJA 4DWIA 3HXMA 3H1QA 3VQBA 4KH6A 4I9LA 4NCGA 2HSTA 4CEZA 3O3GA 3AVNA 3C0BA 4IG3A 4ELTA 1TYQB 4CERA 5LJVA 3MN9A 1KFDA 3V9WA 4M63C 2QEXN 5JS1A 4RW8A 3G6EN 2XHBA 2GV9A 3LDQA 3VEXA 3KLFA 4B3SK 2VYPA 4FJIA 4ISFA 4KFBA 2YNHA 2NUBA 1DEJA 1DTTA 5IWAK 2D0OA 1BGXT 1VSKA 2KKZA 3FZMA 4KHPK 5HP1A 2XRIA 1ZC6A 2QWNA 1WSGA 4NLCA 3VF6A 3O4WA 2A1RA 2ATQA 1KAYA 1RT7A 1SKSA 4CF1A 3AAPA 1RILA 4CZGA 4CFCA 4DQ8A 1RTHA 3S41A 2H3GX 4OPHA 3NGZA 1HMVA 3B8AX 4DFJA 2CGJA 4AILC 3GG4A 2HBLA 3FFIA 1SQKA 1V4TA 1TV6A 2IDOA 3KHYA 4B9TA 1N34K 4K8ZA 4BRAA 4E89A 3QNOA 5EX5A 3BUZB 3IS9A 5FRMA 1TL1A 4KH5A 3PX0A 4IEIA 2AJQA 4JKBA 3L2VA 4N47A 5HBMA 4AHUA 2VCPA 3TSUA 5AQGA 4OKJA 3F73A 4DTUA 3NF8A 4GVMA 4KAZA 5TKYA 3V9UA 2O8DA 1C1BA 2NRZA 3E9LA 4JKFA 4AHVA 2GUIA 4RCHA 2O8EB 2BANA 5GAEP 3VQ4A 3M8RA 5FPMA 2RKIA 4DG1A 2QKKA 1D8YA 4JEPA 2HHSA 4BE1A 1ESVA 4JI7K 5EXWA 1NMDA 3JAMO 4MFBA 3OYIA 3K58A 3DI6A 3ZSYA 4N41A 2YNGA 4B1YB 4CGJA 5SZTA 4PUOA 2QWLA 3VEWA 4YOTA 3R9PA 3THYB 3T1AA 4AHTA 2ZF5O 1NKCA 1HPMA 3CCJN 3NBPA 4A2BA 5T7BA 3DAWA 3MWTA 1B9DA 5EU7A 2G8IA 1TL3A 4XH1A 1YI2N 1EWQA 3RMAA 4OKEA 3CCSN 4WQ5A 2P9IB 3HSCA 3KD1E 2NRHA 1LWEA 1HYSA 2OTJN 1CZBA 1KVCA 1L3SA 3MN5A 1W0HA 5JLHA 5KPTA 2QWQA 2YHBA 3DRRA 5BR8K 2Q3SA 4AHSA 1WSFA 3AVAA 4CJLA 5AQHA 4BWMA 4FYDA 1KAXA 4DSLA 3LDOA 3KD5E 3GDQA 2QWOA 4CGIA 4MLHA 3SQ2A 2HHVA 3DLEA 2BE2A 4GV3A 5AZJB 1LWFA 4RTFD 1Z05A 1S1VA 4JKAA 5AQXA 1SKRA 2OZSA 1VRUA 4C8NA 4HTUA 2KFNA 1WNSA 3QEPA 1REVA 1X1PA 2X6NA 3QINA 3SQ0A 4FM1A 3DYAA 4Q5VA 5AQSA 4AH9A 4B9LA 4M7XA 3RR8A 3QFUA 4LSLA 4B1VA 1LOTB 3C94A 4IDHA 1Z26A 3OYBA 3RWUA 4OVLA 3CI5A 3HRGA 2F9WA 3DXKB 5KQ8A 5AQZA 2Q97A 3TARA 5AQNA 2D1KA 1NK8A 1FW6A 1ZBFA 3CYMA 4BC5A 3SAGA 3OYMA 4FJ8A 4BRMA 1A5XA 1C0TA 3CCLN 3ZT1A 4EHTA 4CE9A 3NE6A 1TUUA 3VMFB 3VQCA 2P1JA 3VEOA 2Y1JA 4H5WA 4FJXA 4DR5K 2P9NB 3LL3A 1IG8A 3KWGA 3LAMA 4K25A 4DV3K 4CGDA 4CESA 3CJAA 4DSIA 1JXEA 4J2BA 4AHRA 1O1WA 1X9WA 1H1VA 4E3SA 4JKGB 1HJOA 1RDCA 4M3YA 3MEEA 3CC4N 1HYVA 3A0IX 4CHNA 1IBMK 3P39A 5AZIB 1NK6A 2DTUA 3O4NA 4IJNA 2YV0X 4FOEA 4Y1CA 5DM6L 1VQMN 3U9ZA 2QWPA 1SV5A 1QS4A 3AY9A 2YHWA 4FZYA 1U2VA 1KQSM 3VEZA 2Q2RA 1NGDA 3QO9A 4LFCK 2FF3B 5BN8A 4O0IA 4JKDA 1J5OA 4B9SA 1W7AA 1ATRA 4FJGA 5AQVA 5EOYA 4FJLA 3FZHA 1C0MA 4NO7A 3EKUA 5AQPA 4H0OA 2Q0UA 1BQNA 1JCEA 3CFOA 3P38A 1R59O 3CM5A 2YCHA 5CHIA 3K2PA 5DK5A 1GLEG 1JLCA 4FJNA 1YHQN 4BRNA 4HWIA 4X65K 4OLAA 3SQ4A 1Y97A 3ZYYX 2O8EA 1IJJA 1T44A 3QERA 3JSMA 3O4QA 4JKGA 4KI6A 1ZBUA 4OO1J 3K5LA 3PO5A 4DSJA 4CHOA 4WFBL 4CJKA 4MDBA 1VSHA 5AZIA 3IMXA 2NLXA 5JICA 2E6MA 5GAHP 4DTJA 2NRTA 2G8WA 1VRTA 4M7YA 5GINA 3GL1A 2QM1A 3TANA 3HK2A 1Q18A 2ZD1A 3EYZA 3AVLA 4K42A 2G8KA 2A6AA 2QA4N 1BDGA 2YI1A 3C6TA 1NGAA 1RDAA 3AO4A 5AQFA 1IKXA 3MXMA 4BQLA 3MEDA 1G99A 2J4RA 4CZIA 3LDSA 1QQMA 4DSEA 4BG8A 4DU3A 1U49A 4DU4A 2CH5A 3J7ZO 3KLIA 3L6QA 3ZEUA 4DR4K 1RDWX 4JAXA 2HBMA 2VQEK 4H0YB 2O4IA 2FBVA 1OH8A 4FCYA 4CF8A 4KHYA 3O5BA 4HHTA 4CIEA 4ID1A 4KHQA 3CQYA 5J2QA 5KRSA 1NJXA 3KVGA 3HP6A 4MDAA 3R6MA 3FZLA 1X3NA 2FXUA 3QICA 3AO1A 4DTRA 3QFPA 4HUFA 4DFKA 4MLEA 3THXA 1BOTO 4FJJA 3OJSA 4J2AA 4IFYA 5LJWA 3SUNA 3FE1A 3SQ1A 1U6ZA 2KZMA 4Z4HA 4CZFA 2ZWHA 4W5TA 1HKCA 3ATVA 1GLJO 3IDHA 4ICLA 1DTQA 1B92A 1EO1A 5E26A 2X74A 2FBTA 2VQFK 3SK3A 2HW3A 3OJUA 3ULEA 4W5NA 1WN7A 3WXMB 1WSIA 1SZ2A 3ZT2A 2W6KA 3VGLA 3K5MA 1S72N 3PSIA 4C8KA 4CJQA 5HOOA 4B3TK 1QQCA 1YJWN 3EO3A 5M1KA 4O8UA 2JWKA 2AA4A 1M90O 3DMJA 1YITN 2D0CA 2QI2A 3O6WA 5CR4A 1ASVA 3S3MA 4ELUA 2QKBA 2OA8A 2P9UA 3I33A 1BCOA 1C6VA 4DS4A 4FW2A 3CG7A 1WBBA 3OA9A 4M45A 3DLKA 4OX9K 1XWLA 4Z94A 3SZ2A 3ZX3A 1S1TA 1L5UA 4FVUA 1VHXA 2O8DB 4B08A 2JLEA 3SMPA 2BDPA 1LCUA 1S1WA 4CZJA 1NK5A 4DQQA 2PY5A 4JKCA 1QHTA 3C7NA 4EZ6A 3ZSWA 4DR1K 5ELZA 2FF6A 5EY4A 3NHGA 1P8ZA 4FLZA 1XNQK 3D6RA 1HQUA 3O9UA 4ELVA 4KI4A 4GMJB 4GNIA 4B1XB 1NK9A 1JLQA 4LF9K 2DFEA 1HYZA 3ZSRA 1RDDA 2IIRA 3TTDA 2HF4A 1VQ4N 4CBUA 5J1EA 2O8FA 4K43A 3WQUA 1S5JA 5J2MA 5KQDA 1FJGK 5AQTA 3HBTA 3J7AP 1LWCA 3M1FA 1V4SA 2RF2A 3KKRA 4FVMA 3F5TA 1RT4A 3PUFA 3C65A 3AVCA 4X62K 2AP1A 4CHQA 4ZTFA 4DUYK 2HHHK 1RBRA 3TAQA 3AVKA 1KTQA 3DLHA 1BA1A 1CXUA 4OKKA 1W2BM 3DWLA 2PZSA 4BACA 4BRKA 1I94K 5DM7L 2GTDA 3CFPA 5D3GA 3A5OC 3C7NB 4IJAA 3GE1A
chains in the Genus database with same CATH topology
4OKJA 3F73A 5I42A 1LAWA 2HNZA 4Y1DA 3KLGA 1T7PA 3V4IA 1RBUA 4DTUA 3NF8A 3ISNC 4GVMA 2YHAA 1C1AA 1S1UA 1HRHA 3ZSZA 3JYTA 3L8BA 2KZZA 1WSJA 2HNYA 1RNHA 3V9UA 3C6UA 1C1BA 1KRPA 1RBSA 2KFZA 4W5OA 4AHVA 2GUIA 4IFVA 1KVAA 2BANA 1HJRA 3ZT3A 1U04A 3M8QA 3VQ4A 3M8RA 1SL1A 3L2WA 3VQAA 2KW4A 1NJYA 1TAUA 5KGXA 3U3GA 4FK2A 2RKIA 4KTZA 2Z1HA 3TR8A 4DG1A 3EY1A 3U3YA 1D8YA 2QKKA 4M3ZA 1S9EA 1T8EA 3M8SA 2HHSA 1JL1A 4YNQA 4BE1A 4HCCA 4CF9A 1X9SA 4B9UA 1BL3A 4O0JA 4LH4A 4C8LA 1JL2A 4MFBA 3OYIA 4JS4A 1K6YA 4FW1A 4CK1A 3K58A 3DI6A 3ZSYA 4FM2A 4N41A 2P5OA 4Z0UA 2YNGA 4CGJA 5SZTA 2KTQA 1VK0A 1HNIA 3KKSA 4NYNA 3TAEA 4PUOA 4CF0A 4E7LA 4CGFA 4FLUA 1QSSA 3T1AA 4AHTA 4N76A 1NKCA 3NBPA 4LD0A 4KTQA 5T7BA 1LW2A 1GOCA 1B9DA 5EU7A 4FLVA 3VA0A 3B6PA 3QEWA 2XY7A 1FK9A 1TL3A 2G8IA 4FZZA 4KV8A 4OKEA 3RMAA 1UWBA 4HCBA 1JLBA 3RMCA 1BCMA 3KD1E 1BHLA 1LWEA 5KGWA 1RCHA 1CZBA 1KVCA 1HYSA 1L3SA 3HPGA 2OPPA 1RT5A 4HVJA 5HRSA 1W0HA 3MECA 3TABA 2GBZA 1IKWA 4LY7A 1L3TA 1B9FA 2G8FA 1RDBA 1NK7A 2YHBA 3K59A 3RRGA 3DRRA 3VQ9A 4RG8A 1Q9YA 1RBTA 5I3UA 2Q3SA 4AHSA 1WSFA 3AVAA 1C0UA 2KQ2A 2HNDA 3SV4A 4DSFA 1D9FA 3SUQA 2B4JA 4CJLA 1IKVA 4FLYA 3WNEA 4CEEA 1U47A 1TK5A 4BWMA 4FYDA 4E7JA 4DSLA 5CYMA 3NH0A 4CFAA 3KD5E 2XY6A 3NDKA 3G10A 3VQ5A 4OGCA 4CGIA 4N56A 1Z25A 4KHWA 3SQ2A 3LZJA 2HHVA 3DLEA 2BE2A 5FRNA 3HVTA 3DLGA 1LWFA 3LP1A 3LP2A 1VSMA 2OPSA 1FXXA 3CQ8A 1SUQA 4CJTA 4DU1A 2HHWA 1S1VA 1SKRA 1EP4A 2OZSA 5HRPA 3KLHA 2XY8A 1VRUA 2LSNA 4C8NA 4HTUA 2KFNA 2YNFA 4M42A 1X9MA 3HVRA 1WNSA 3QEPA 1REVA 4DF4A 5KTQA 1X1PA 3OS2A 3EZ5A 2X6NA 3QINA 1VSLA 4KKOA 1QTMA 3SQ0A 4KHNA 1TKTA 1S6PA 3DYAA 4Q5VA 3HL8A 1GOAA 4FM1A 3SI6A 4AH9A 1IKYA 1KSPA 2D0BA 2PYLA 3RR8A 1C1CA 4B9LA 2D5RA 4F2RA 4Q0BA 3D45A 4LSLA 1S9GA 1NOZA 3AVHA 2R7YA 4FJKA 4PQUA 1HNVA 2OPRA 3C94A 1Z26A 3OYBA 3RWUA 4OVLA 1EX4A 4H4OA 1G15A 4DTPA 3SJJA 1KFSA 1KLNA 2IGIA 1WSHA 4FM0A 1ZBLA 4HUGA 3AV9A 4HUEA 3QESA 1L3UA 3V81A 1BQMA 4DQPA 1RT1A 4DTOA 4CFDA 3TARA 1LW0A 3C95A 3LP0A 1TVRA 4KREA 3OS1A 2XY5A 3SNNA 4DSKA 2B5JA 3I0RA 1MU2A 3SYZA 4PWDA 3K5OA 3WNFA 1NK8A 4F3OA 3ITHA 3OS0A 1N5YA 1ZBFA 3CYMA 4PA1A 3RMDA 1JLEA 3LZIA 3S3OA 5CZ1A 3OYMA 4FJ8A 1YVUA 1BIZA 3OYGA 3KJVA 4CJSA 1A5XA 3LWMA 3G0ZA 4Z4GA 1C0TA 1VSIA 1BISA 1VSFA 3ZSOA 3ZT1A 4DLEA 2YKMA 4CE9A 3NE6A 2DFFA 3NAEA 3VA3A 1NJWA 3LALA 1EETA 2P1JA 3VQCA 4CECA 4OGEA 2FC0A 2Y1JA 3QIPA 4FJXA 2YKNA 5HRNA 3NH1A 4CCHA 4C8OA 3LP3A 1CXQA 4CJWA 4FXDA 1WAFA 3LAMA 3V9ZA 3QNNA 1Q8IA 2FBYA 4CGDA 2HVIA 3NH2A 1QSYA 4CESA 4DSIA 2DFHA 1JXEA 4J2BA 3AA4A 4AHRA 4J2DA 1O1WA 3E01A 1X9WA 1VSDA 2RPIA 4JRPA 3PX6A 4E3SA 4FZXC 4UQGA 3S3NA 2E6LA 1JXBA 4DQSA 3OYEA 1YTUA 2JGUA 3V9SA 5J2NA 1RDCA 4CF2A 4BE0A 4L8RB 4M3YA 3MEEA 3H08A 2PYJA 2HHQA 1HYVA 4CHNA 1J54A 3PV8A 3AA2A 4IG0A 2HMIA 4B9NA 3O3FA 1NK6A 4C8MA 3SUPA 2DTUA 4IBNA 3O4NA 3OYKA 2YV0X 3LPUA 4Y1CA 1GOBA 3QLHA 1U4BA 3NF9A 3TI0A 1SV5A 3LAKA 4CJEA 1QS4A 2EHGA 3OYJA 4FZYA 1UOCA 4KAZA 4CIGA 4F2SA 4I2PA 5C25A 3QO9A 2Z1GA 4CFBA 1JLAA 4O0IA 4CK2A 3KK1A 1J5OA 3OYCA 3SCXA 4B9SA 1HQEA 2P5GA 1YTAA 4AHCA 2P51A 4CJVA 4FJGA 4FJLA 4FK4A 1XC9A 2HHXA 1C0MA 1IH7A 3ZCMA 3I8DA 1SKWA 1LV5A 1BQNA 3CFOA 4F8RA 2ITGA 1BI4A 4ZHRA 2HB5A 3ZSXA 3DOKA 5SWMA 1KLMA 4DLGA 4FJMA 4I2QA 3CM5A 4CK3A 3K2PA 4NYFA 3AA5X 4GW6A 1DLOA 5DK5A 3B6OA 1S1XA 3LWLA 3OYNA 1JLCA 4Z4CA 4FJNA 1A5WA 4KHSA 2BGGA 3S9HA 4OLAA 2D0AA 3SQ4A 1Y97A 3VQDA 1EKEA 3LANA 4W5QA 1EXQA 4CJUA 3QERA 3JSMA 3OYHA 3O4QA 3OYAA 3KIOA 4KI6A 1ZBUA 1TK8A 3CFRA 1D5AA 1UAXA 3K5LA 4E7IA 3PO5A 3BDPA 4DSJA 4KPYA 3I0SA 4F3TA 4CHOA 4CJKA 1VSHA 2XO7A 5C24A 4QOZB 5FROA 3ASMA 2E6MA 4DTJA 1F21A 3TWHA 4K8XA 4J2EA 3VQ6A 5HLFA 1VRTA 2G8WA 4MQ3A 4R5PA 4LSNA 3U6FA 2ZQBA 3ALYA 3O3HA 4PY5A 1BI4B 1RTIA 3AO3A 3P5JA 3VQPA 3AO2A 3TANA 3VQQA 4B3OA 4OJRA 3HK2A 2ZD1A 4H8KA 4CJRA 3NF7A 3AVLA 3EYZA 3V6DA 5KI6A 4FLTA 3HSTB 4DMNA 3KTQA 4B9VA 2G8KA 1VSJA 4E1MA 4ID5A 1A5VA 5CZ2A 3OY9A 3MAQA 2X78A 1CLQA 2Y1IA 3C6TA 4NCAA 3T3FA 1KCFA 1RDAA 3AO4A 2G8VA 3A2FA 4LH5A 1IKXA 3LPTA 4O55A 3HO1A 5CYQA 3V1OA 1XHZA 1I39A 3MXMA 1R0AA 3MEDA 3LDSA 4E7HA 4F4KA 4DSEA 5K14A 4CEDA 3KLEA 4DU3A 3TAFA 1U49A 4DU4A 2Z1IA 2YNIA 3ULDA 3UIQA 4CJ3A 3KLIA 3SUOA 3NGYA 2HVHA 5DMRA 3MXJA 3QEVA 4KHUA 3AO5A 3VQ8A 4RW9A 2HHTA 3SPZA 3WNGA 2O4IA 3NF6A 2FBVA 3OYLA 4DTXA 5KRTA 4DFMA 3OYDA 4FCYA 1NKEA 4CF8A 3V1RA 4CGHA 1IO2A 2VG5A 4KHYA 4HHTA 1U48A 2VG7A 4ID1A 3ZSVA 4CIEA 4KHQA 2QXFA 5J2QA 5KRSA 4KB1A 4KO0A 1TK0A 1NJXA 1XI1A 1WAJA 2VWJA 4E0DA 3HP6A 1WLJA 3DLRA 1TKZA 3T19A 4NCBA 4CHYA 1ITGA 2F96A 4DTSA 3NCIA 3PO4A 1RTJA 1ASUA 1RBVA 3AO1A 4DTRA 2B6AA 4FLXA 4HUFA 2O4GA 3AVIA 4RW7A 4DFKA 3MEGA 4B9MA 4XIUA 4FJJA 4DF8A 3OYFA 3DLBA 1WSEA 2WOMA 3OJSA 4M41A 3QEXA 4J2AA 4IFYA 2EX3A 3L2QA 5HROA 2IOCA 1ZYQA 3SUNA 3AVFA 4H4MA 3SQ1A 4Z4FA 2F8TA 2KZMA 4Z4HA 3K5NA 3VN5A 4BDZA 4W5TA 4O4GA 1RTDA 2G8UA 4CEAA 1NKBA 4ICLA 2HHUA 3HT3A 4JRQA 1DTQA 1B92A 3V9XA 4M3WA 3D0PA 4DQIA 3PX4A 3ZSQA 4DS5A 2X74A 2FBTA 3AA3A 4M3XA 4BE2A 4FLWA 4QCLA 2OZMA 3RR7A 4CJ4A 2ETJA 3QIOA 3HYFA 4O5BA 2HW3A 3OJUA 4YFUA 1NJZA 1QSLA 1S6QA 3DOLA 4W5NA 4Z4EA 1WN7A 5JS2A 3HM9A 4M3RA 1WSIA 4OLBA 4CIFA 2OPQA 5HRRA 4DTMA 1TKDA 1TKXA 1ASWA 3KK3A 3DRPA 3ZT2A 4E19A 3RTVA 1T03A 4M3TA 2F8SA 4OPJA 2IAJA 3K5MA 4IKFA 4DFPA 2G8HA 1W9HA 5CY4A 3AVJA 3NGIA 1RT2A 3AVMA 5FDLA 4B8AB 3SV3A 3RRHA 1Q9XA 4CJQA 4C8KA 4Z4IA 1CZ9A 1QQCA 1NOYA 4EP4A 3L3VA 4CHZA 1T05A 4KTWA 4OPKA 3VQEA 1VSEA 3RMBA 4BDPA 5J2PA 3DMJA 2VWKA 1ZBHA 2D0CA 1RT3A 3IRXA 3S3MA 1ASVA 4ELUA 2ZE2A 2QKBA 3DM2A 4E1NA 2OA8A 4G1QA 2WONA 3IAYA 4CGGA 3HJFA 1BCOA 4E7KA 4EP5A 3V1QA 1C6VA 2FBXA 4DS4A 1NK4A 3TAPA 4ZTJA 4FW2A 4DWIA 3CG7A 3HXMA 3VQBA 4JLHA 4I9LA 4NCGA 4CEZA 3O3GA 1HPZA 4M45A 3AVNA 3DLKA 4IG3A 4ELTA 1XWLA 1TGOA 3SZ2A 4KB0A 4FJ9A 1QE1A 3AVBA 4IDKA 1S1TA 4CERA 3DRSA 4CEBA 1L5UA 3ZT0A 4B08A 4W5RA 1JKHA 1KFDA 2JLEA 2Z1JA 3CM6A 1S1WA 3V9WA 1NK5A 2BDPA 2OYQA 5JS1A 4DQQA 4RW8A 4TSXA 1UA1A 3AVGA 1JLGA 2XHBA 2GV9A 1U45A 2PY5A 3QEIA 2VG6A 1J9AA 1QHTA 2IC3A 2E4LA 3KLFA 4EZ6A 3ZSWA 1L3VA 4FJIA 4DQRA 2RN2A 4KFBA 1UA0A 2YNHA 2NUBA 3NHGA 4JS5A 4FLZA 1DTTA 1HQUA 4CJFA 1IG9A 5E41A 4FJHA 3L2RA 4O44A 1BGXT 4BWJA 2W42A 1VSKA 1SL0A 4ELVA 4FJ7A 5HP1A 4GMJB 4KI4A 2I5JA 1NK9A 1JLQA 2XRIA 2DFEA 3L2UA 4M3UA 3P83D 3OVNA 1TAQA 1WSGA 1HYZA 3ZSRA 1RDDA 5C42A 2A1RA 4RW6A 2ATQA 2QK9A 4I7FA 1J53A 1YT3A 1ZBIA 1D9DA 1RT7A 3THVA 1XHXA 1JLFA 1SKSA 3NFAA 4CF1A 5J1EA 4CJ5A 1RILA 2A1SA 1S5JA 3HP9A 5J2MA 3P1GA 2IS3A 4CFCA 4CEOA 4FK0A 1RTHA 3F9KA 3HPHA 4RW4A 4CJPA 2DY4A 1RT6A 1I3AA 3NGZA 3M8PA 1HMVA 4KRFA 1LWCA 1BIUA 1FKPA 3VQ7A 3KK2A 4DFJA 4CHPA 3PY8A 4AILC 2RF2A 3TAMA 4I9QA 3KKRA 3BGRA 4FVMA 3FFIA 3HPOA 4QAGA 1RT4A 3PUFA 1TV6A 3QETA 3TAGA 2IDOA 3AVCA 1NK0A 4EZ9A 4CHQA 4ZTFA 3WNHA 3IG1A 3K57A 3MXIA 4CEQA 4B9TA 1SL2A 4CEFA 4K8ZA 4N5SA 4B8CA 4E89A 1RBRA 3QNOA 4BDYA 3TAQA 3AVKA 1KTQA 1N6QA 3DLHA 1CXUA 4OKKA 4FJ5A 1LAVA 3SPYA 3IS9A 2X6SA 4WE1A 1FKOA 2PZSA 4BACA 5FRMA 1TL1A 3PX0A 2AJQA 3L2VA 4N47A 3CFPA 5HBMA 3ZT4A 1KVBA 5D3GA 4DTNA 3L3UA 4AHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OKJ A;  3F73 A;  5I42 A;  1LAW A;  2HNZ A;  4Y1D A;  3KLG A;  1T7P A;  3V4I A;  1RBU A;  4DTU A;  3NF8 A;  3ISN C;  4GVM A;  2YHA A;  1C1A A;  1S1U A;  1HRH A;  3ZSZ A;  3JYT A;  3L8B A;  2KZZ A;  1WSJ A;  2HNY A;  1RNH A;  3V9U A;  3C6U A;  1C1B A;  1KRP A;  1RBS A;  2KFZ A;  4W5O A;  4AHV A;  2GUI A;  4IFV A;  1KVA A;  2BAN A;  1HJR A;  3ZT3 A;  1U04 A;  3M8Q A;  3VQ4 A;  3M8R A;  1SL1 A;  3L2W A;  3VQA A;  2KW4 A;  1NJY A;  1TAU A;  5KGX A;  3U3G A;  4FK2 A;  2RKI A;  4KTZ A;  2Z1H A;  3TR8 A;  4DG1 A;  3EY1 A;  3U3Y A;  1D8Y A;  2QKK A;  4M3Z A;  1S9E A;  1T8E A;  3M8S A;  2HHS A;  1JL1 A;  4YNQ A;  4BE1 A;  4HCC A;  4CF9 A;  1X9S A;  4B9U A;  1BL3 A;  4O0J A;  4LH4 A;  4C8L A;  1JL2 A;  4MFB A;  3OYI A;  4JS4 A;  1K6Y A;  4FW1 A;  4CK1 A;  3K58 A;  3DI6 A;  3ZSY A;  4FM2 A;  4N41 A;  2P5O A;  4Z0U A;  2YNG A;  4CGJ A;  5SZT A;  2KTQ A;  1VK0 A;  1HNI A;  3KKS A;  4NYN A;  3TAE A;  4PUO A;  4CF0 A;  4E7L A;  4CGF A;  4FLU A;  1QSS A;  3T1A A;  4AHT A;  4N76 A;  1NKC A;  3NBP A;  4LD0 A;  4KTQ A;  5T7B A;  1LW2 A;  1GOC A;  1B9D A;  5EU7 A;  4FLV A;  3VA0 A;  3B6P A;  3QEW A;  2XY7 A;  1FK9 A;  1TL3 A;  2G8I A;  4FZZ A;  4KV8 A;  4OKE A;  3RMA A;  1UWB A;  4HCB A;  1JLB A;  3RMC A;  1BCM A;  3KD1 E;  1BHL A;  1LWE A;  5KGW A;  1RCH A;  1CZB A;  1KVC A;  1HYS A;  1L3S A;  3HPG A;  2OPP A;  1RT5 A;  4HVJ A;  5HRS A;  1W0H A;  3MEC A;  3TAB A;  2GBZ A;  1IKW A;  4LY7 A;  1L3T A;  1B9F A;  2G8F A;  1RDB A;  1NK7 A;  2YHB A;  3K59 A;  3RRG A;  3DRR A;  3VQ9 A;  4RG8 A;  1Q9Y A;  1RBT A;  5I3U A;  2Q3S A;  4AHS A;  1WSF A;  3AVA A;  1C0U A;  2KQ2 A;  2HND A;  3SV4 A;  4DSF A;  1D9F A;  3SUQ A;  2B4J A;  4CJL A;  1IKV A;  4FLY A;  3WNE A;  4CEE A;  1U47 A;  1TK5 A;  4BWM A;  4FYD A;  4E7J A;  4DSL A;  5CYM A;  3NH0 A;  4CFA A;  3KD5 E;  2XY6 A;  3NDK A;  3G10 A;  3VQ5 A;  4OGC A;  4CGI A;  4N56 A;  1Z25 A;  4KHW A;  3SQ2 A;  3LZJ A;  2HHV A;  3DLE A;  2BE2 A;  5FRN A;  3HVT A;  3DLG A;  1LWF A;  3LP1 A;  3LP2 A;  1VSM A;  2OPS A;  1FXX A;  3CQ8 A;  1SUQ A;  4CJT A;  4DU1 A;  2HHW A;  1S1V A;  1SKR A;  1EP4 A;  2OZS A;  5HRP A;  3KLH A;  2XY8 A;  1VRU A;  2LSN A;  4C8N A;  4HTU A;  2KFN A;  2YNF A;  4M42 A;  1X9M A;  3HVR A;  1WNS A;  3QEP A;  1REV A;  4DF4 A;  5KTQ A;  1X1P A;  3OS2 A;  3EZ5 A;  2X6N A;  3QIN A;  1VSL A;  4KKO A;  1QTM A;  3SQ0 A;  4KHN A;  1TKT A;  1S6P A;  3DYA A;  4Q5V A;  3HL8 A;  1GOA A;  4FM1 A;  3SI6 A;  4AH9 A;  1IKY A;  1KSP A;  2D0B A;  2PYL A;  3RR8 A;  1C1C A;  4B9L A;  2D5R A;  4F2R A;  4Q0B A;  3D45 A;  4LSL A;  1S9G A;  1NOZ A;  3AVH A;  2R7Y A;  4FJK A;  4PQU A;  1HNV A;  2OPR A;  3C94 A;  1Z26 A;  3OYB A;  3RWU A;  4OVL A;  1EX4 A;  4H4O A;  1G15 A;  4DTP A;  3SJJ A;  1KFS A;  1KLN A;  2IGI A;  1WSH A;  4FM0 A;  1ZBL A;  4HUG A;  3AV9 A;  4HUE A;  3QES A;  1L3U A;  3V81 A;  1BQM A;  4DQP A;  1RT1 A;  4DTO A;  4CFD A;  3TAR A;  1LW0 A;  3C95 A;  3LP0 A;  1TVR A;  4KRE A;  3OS1 A;  2XY5 A;  3SNN A;  4DSK A;  2B5J A;  3I0R A;  1MU2 A;  3SYZ A;  4PWD A;  3K5O A;  3WNF A;  1NK8 A;  4F3O A;  3ITH A;  3OS0 A;  1N5Y A;  1ZBF A;  3CYM A;  4PA1 A;  3RMD A;  1JLE A;  3LZI A;  3S3O A;  5CZ1 A;  3OYM A;  4FJ8 A;  1YVU A;  1BIZ A;  3OYG A;  3KJV A;  4CJS A;  1A5X A;  3LWM A;  3G0Z A;  4Z4G A;  1C0T A;  1VSI A;  1BIS A;  1VSF A;  3ZSO A;  3ZT1 A;  4DLE A;  2YKM A;  4CE9 A;  3NE6 A;  2DFF A;  3NAE A;  3VA3 A;  1NJW A;  3LAL A;  1EET A;  2P1J A;  3VQC A;  4CEC A;  4OGE A;  2FC0 A;  2Y1J A;  3QIP A;  4FJX A;  2YKN A;  5HRN A;  3NH1 A;  4CCH A;  4C8O A;  3LP3 A;  1CXQ A;  4CJW A;  4FXD A;  1WAF A;  3LAM A;  3V9Z A;  3QNN A;  1Q8I A;  2FBY A;  4CGD A;  2HVI A;  3NH2 A;  1QSY A;  4CES A;  4DSI A;  2DFH A;  1JXE A;  4J2B A;  3AA4 A;  4AHR A;  4J2D A;  1O1W A;  3E01 A;  1X9W A;  1VSD A;  2RPI A;  4JRP A;  3PX6 A;  4E3S A;  4FZX C;  4UQG A;  3S3N A;  2E6L A;  1JXB A;  4DQS A;  3OYE A;  1YTU A;  2JGU A;  3V9S A;  5J2N A;  1RDC A;  4CF2 A;  4BE0 A;  4L8R B;  4M3Y A;  3MEE A;  3H08 A;  2PYJ A;  2HHQ A;  1HYV A;  4CHN A;  1J54 A;  3PV8 A;  3AA2 A;  4IG0 A;  2HMI A;  4B9N A;  3O3F A;  1NK6 A;  4C8M A;  3SUP A;  2DTU A;  4IBN A;  3O4N A;  3OYK A;  2YV0 X;  3LPU A;  4Y1C A;  1GOB A;  3QLH A;  1U4B A;  3NF9 A;  3TI0 A;  1SV5 A;  3LAK A;  4CJE A;  1QS4 A;  2EHG A;  3OYJ A;  4FZY A;  1UOC A;  4KAZ A;  4CIG A;  4F2S A;  4I2P A;  5C25 A;  3QO9 A;  2Z1G A;  4CFB A;  1JLA A;  4O0I A;  4CK2 A;  3KK1 A;  1J5O A;  3OYC A;  3SCX A;  4B9S A;  1HQE A;  2P5G A;  1YTA A;  4AHC A;  2P51 A;  4CJV A;  4FJG A;  4FJL A;  4FK4 A;  1XC9 A;  2HHX A;  1C0M A;  1IH7 A;  3ZCM A;  3I8D A;  1SKW A;  1LV5 A;  1BQN A;  3CFO A;  4F8R A;  2ITG A;  1BI4 A;  4ZHR A;  2HB5 A;  3ZSX A;  3DOK A;  5SWM A;  1KLM A;  4DLG A;  4FJM A;  4I2Q A;  3CM5 A;  4CK3 A;  3K2P A;  4NYF A;  3AA5 X;  4GW6 A;  1DLO A;  5DK5 A;  3B6O A;  1S1X A;  3LWL A;  3OYN A;  1JLC A;  4Z4C A;  4FJN A;  1A5W A;  4KHS A;  2BGG A;  3S9H A;  4OLA A;  2D0A A;  3SQ4 A;  1Y97 A;  3VQD A;  1EKE A;  3LAN A;  4W5Q A;  1EXQ A;  4CJU A;  3QER A;  3JSM A;  3OYH A;  3O4Q A;  3OYA A;  3KIO A;  4KI6 A;  1ZBU A;  1TK8 A;  3CFR A;  1D5A A;  1UAX A;  3K5L A;  4E7I A;  3PO5 A;  3BDP A;  4DSJ A;  4KPY A;  3I0S A;  4F3T A;  4CHO A;  4CJK A;  1VSH A;  2XO7 A;  5C24 A;  4QOZ B;  5FRO A;  3ASM A;  2E6M A;  4DTJ A;  1F21 A;  3TWH A;  4K8X A;  4J2E A;  3VQ6 A;  5HLF A;  1VRT A;  2G8W A;  4MQ3 A;  4R5P A;  4LSN A;  3U6F A;  2ZQB A;  3ALY A;  3O3H A;  4PY5 A;  1BI4 B;  1RTI A;  3AO3 A;  3P5J A;  3VQP A;  3AO2 A;  3TAN A;  3VQQ A;  4B3O A;  4OJR A;  3HK2 A;  2ZD1 A;  4H8K A;  4CJR A;  3NF7 A;  3AVL A;  3EYZ A;  3V6D A;  5KI6 A;  4FLT A;  3HST B;  4DMN A;  3KTQ A;  4B9V A;  2G8K A;  1VSJ A;  4E1M A;  4ID5 A;  1A5V A;  5CZ2 A;  3OY9 A;  3MAQ A;  2X78 A;  1CLQ A;  2Y1I A;  3C6T A;  4NCA A;  3T3F A;  1KCF A;  1RDA A;  3AO4 A;  2G8V A;  3A2F A;  4LH5 A;  1IKX A;  3LPT A;  4O55 A;  3HO1 A;  5CYQ A;  3V1O A;  1XHZ A;  1I39 A;  3MXM A;  1R0A A;  3MED A;  3LDS A;  4E7H A;  4F4K A;  4DSE A;  5K14 A;  4CED A;  3KLE A;  4DU3 A;  3TAF A;  1U49 A;  4DU4 A;  2Z1I A;  2YNI A;  3ULD A;  3UIQ A;  4CJ3 A;  3KLI A;  3SUO A;  3NGY A;  2HVH A;  5DMR A;  3MXJ A;  3QEV A;  4KHU A;  3AO5 A;  3VQ8 A;  4RW9 A;  2HHT A;  3SPZ A;  3WNG A;  2O4I A;  3NF6 A;  2FBV A;  3OYL A;  4DTX A;  5KRT A;  4DFM A;  3OYD A;  4FCY A;  1NKE A;  4CF8 A;  3V1R A;  4CGH A;  1IO2 A;  2VG5 A;  4KHY A;  4HHT A;  1U48 A;  2VG7 A;  4ID1 A;  3ZSV A;  4CIE A;  4KHQ A;  2QXF A;  5J2Q A;  5KRS A;  4KB1 A;  4KO0 A;  1TK0 A;  1NJX A;  1XI1 A;  1WAJ A;  2VWJ A;  4E0D A;  3HP6 A;  1WLJ A;  3DLR A;  1TKZ A;  3T19 A;  4NCB A;  4CHY A;  1ITG A;  2F96 A;  4DTS A;  3NCI A;  3PO4 A;  1RTJ A;  1ASU A;  1RBV A;  3AO1 A;  4DTR A;  2B6A A;  4FLX A;  4HUF A;  2O4G A;  3AVI A;  4RW7 A;  4DFK A;  3MEG A;  4B9M A;  4XIU A;  4FJJ A;  4DF8 A;  3OYF A;  3DLB A;  1WSE A;  2WOM A;  3OJS A;  4M41 A;  3QEX A;  4J2A A;  4IFY A;  2EX3 A;  3L2Q A;  5HRO A;  2IOC A;  1ZYQ A;  3SUN A;  3AVF A;  4H4M A;  3SQ1 A;  4Z4F A;  2F8T A;  2KZM A;  4Z4H A;  3K5N A;  3VN5 A;  4BDZ A;  4W5T A;  4O4G A;  1RTD A;  2G8U A;  4CEA A;  1NKB A;  4ICL A;  2HHU A;  3HT3 A;  4JRQ A;  1DTQ A;  1B92 A;  3V9X A;  4M3W A;  3D0P A;  4DQI A;  3PX4 A;  3ZSQ A;  4DS5 A;  2X74 A;  2FBT A;  3AA3 A;  4M3X A;  4BE2 A;  4FLW A;  4QCL A;  2OZM A;  3RR7 A;  4CJ4 A;  2ETJ A;  3QIO A;  3HYF A;  4O5B A;  2HW3 A;  3OJU A;  4YFU A;  1NJZ A;  1QSL A;  1S6Q A;  3DOL A;  4W5N A;  4Z4E A;  1WN7 A;  5JS2 A;  3HM9 A;  4M3R A;  1WSI A;  4OLB A;  4CIF A;  2OPQ A;  5HRR A;  4DTM A;  1TKD A;  1TKX A;  1ASW A;  3KK3 A;  3DRP A;  3ZT2 A;  4E19 A;  3RTV A;  1T03 A;  4M3T A;  2F8S A;  4OPJ A;  2IAJ A;  3K5M A;  4IKF A;  4DFP A;  2G8H A;  1W9H A;  5CY4 A;  3AVJ A;  3NGI A;  1RT2 A;  3AVM A;  5FDL A;  4B8A B;  3SV3 A;  3RRH A;  1Q9X A;  4CJQ A;  4C8K A;  4Z4I A;  1CZ9 A;  1QQC A;  1NOY A;  4EP4 A;  3L3V A;  4CHZ A;  1T05 A;  4KTW A;  4OPK A;  3VQE A;  1VSE A;  3RMB A;  4BDP A;  5J2P A;  3DMJ A;  2VWK A;  1ZBH A;  2D0C A;  1RT3 A;  3IRX A;  3S3M A;  1ASV A;  4ELU A;  2ZE2 A;  2QKB A;  3DM2 A;  4E1N A;  2OA8 A;  4G1Q A;  2WON A;  3IAY A;  4CGG A;  3HJF A;  1BCO A;  4E7K A;  4EP5 A;  3V1Q A;  1C6V A;  2FBX A;  4DS4 A;  1NK4 A;  3TAP A;  4ZTJ A;  4FW2 A;  4DWI A;  3CG7 A;  3HXM A;  3VQB A;  4JLH A;  4I9L A;  4NCG A;  4CEZ A;  3O3G A;  1HPZ A;  4M45 A;  3AVN A;  3DLK A;  4IG3 A;  4ELT A;  1XWL A;  1TGO A;  3SZ2 A;  4KB0 A;  4FJ9 A;  1QE1 A;  3AVB A;  4IDK A;  1S1T A;  4CER A;  3DRS A;  4CEB A;  1L5U A;  3ZT0 A;  4B08 A;  4W5R A;  1JKH A;  1KFD A;  2JLE A;  2Z1J A;  3CM6 A;  1S1W A;  3V9W A;  1NK5 A;  2BDP A;  2OYQ A;  5JS1 A;  4DQQ A;  4RW8 A;  4TSX A;  1UA1 A;  3AVG A;  1JLG A;  2XHB A;  2GV9 A;  1U45 A;  2PY5 A;  3QEI A;  2VG6 A;  1J9A A;  1QHT A;  2IC3 A;  2E4L A;  3KLF A;  4EZ6 A;  3ZSW A;  1L3V A;  4FJI A;  4DQR A;  2RN2 A;  4KFB A;  1UA0 A;  2YNH A;  2NUB A;  3NHG A;  4JS5 A;  4FLZ A;  1DTT A;  1HQU A;  4CJF A;  1IG9 A;  5E41 A;  4FJH A;  3L2R A;  4O44 A;  1BGX T;  4BWJ A;  2W42 A;  1VSK A;  1SL0 A;  4ELV A;  4FJ7 A;  5HP1 A;  4GMJ B;  4KI4 A;  2I5J A;  1NK9 A;  1JLQ A;  2XRI A;  2DFE A;  3L2U A;  4M3U A;  3P83 D;  3OVN A;  1TAQ A;  1WSG A;  1HYZ A;  3ZSR A;  1RDD A;  5C42 A;  2A1R A;  4RW6 A;  2ATQ A;  2QK9 A;  4I7F A;  1J53 A;  1YT3 A;  1ZBI A;  1D9D A;  1RT7 A;  3THV A;  1XHX A;  1JLF A;  1SKS A;  3NFA A;  4CF1 A;  5J1E A;  4CJ5 A;  1RIL A;  2A1S A;  1S5J A;  3HP9 A;  5J2M A;  3P1G A;  2IS3 A;  4CFC A;  4CEO A;  4FK0 A;  1RTH A;  3F9K A;  3HPH A;  4RW4 A;  4CJP A;  2DY4 A;  1RT6 A;  1I3A A;  3NGZ A;  3M8P A;  1HMV A;  4KRF A;  1LWC A;  1BIU A;  1FKP A;  3VQ7 A;  3KK2 A;  4DFJ A;  4CHP A;  3PY8 A;  4AIL C;  2RF2 A;  3TAM A;  4I9Q A;  3KKR A;  3BGR A;  4FVM A;  3FFI A;  3HPO A;  4QAG A;  1RT4 A;  3PUF A;  1TV6 A;  3QET A;  3TAG A;  2IDO A;  3AVC A;  1NK0 A;  4EZ9 A;  4CHQ A;  4ZTF A;  3WNH A;  3IG1 A;  3K57 A;  3MXI A;  4CEQ A;  4B9T A;  1SL2 A;  4CEF A;  4K8Z A;  4N5S A;  4B8C A;  4E89 A;  1RBR A;  3QNO A;  4BDY A;  3TAQ A;  3AVK A;  1KTQ A;  1N6Q A;  3DLH A;  1CXU A;  4OKK A;  4FJ5 A;  1LAV A;  3SPY A;  3IS9 A;  2X6S A;  4WE1 A;  1FKO A;  2PZS A;  4BAC A;  5FRM A;  1TL1 A;  3PX0 A;  2AJQ A;  3L2V A;  4N47 A;  3CFP A;  5HBM A;  3ZT4 A;  1KVB A;  5D3G A;  4DTN A;  3L3U A;  4AHU A; 
#chains in the Genus database with same CATH topology
 5M1Q A;  1VQ8 N;  1NGJ A;  1NM1 A;  1LAW A;  3UKR B;  1T7P A;  4YOU A;  2YHA A;  1KD1 O;  1S1U A;  2W6L A;  4H0V B;  4CD3 A;  5C12 A;  3C6U A;  4PHT X;  5JVH L;  3E9O A;  1SL1 A;  1C0G A;  3L4Q A;  2KW4 A;  1TAU A;  5KGX A;  1OH5 A;  4WFA L;  4KTZ A;  3U3Y A;  3ZX0 A;  2ZGY A;  4YNQ A;  4BRL A;  4C8L A;  3ZEU B;  1X9J A;  4FW1 A;  2D0P A;  4FM2 A;  3VTH A;  2P5O A;  2QW9 A;  3CET A;  4PL8 A;  2KTQ A;  4JD2 B;  4E7L A;  4CZM A;  4N76 A;  4KTQ A;  4YHH K;  3QEW A;  4CZH A;  4FWN A;  3EN9 A;  2JWL A;  1BCM A;  1BHL A;  3LDN A;  1RCH A;  3ZLJ A;  3VEN A;  2OPP A;  4JKE A;  4HVJ A;  2UUB K;  2E2O A;  3TAB A;  2GBZ A;  4CZL A;  2FSK A;  4EIA A;  2G8F A;  2I7N A;  1NK7 A;  3K59 A;  1RBT A;  2ZGZ A;  5FPN A;  3TSQ A;  5I3U A;  3CHW A;  5H1S Q;  2V51 B;  2KLA A;  2KQ2 A;  4IEE A;  4DSF A;  2B4J A;  1T6D A;  1IKV A;  4FLY A;  5CYM A;  4CFA A;  3G10 A;  3U4L A;  4OGC A;  4OPA A;  4KHW A;  1N32 K;  5FPD A;  3LP2 A;  1VSM A;  4CJT A;  2HHW A;  2GWJ A;  2XY8 A;  2LSN A;  4M42 A;  5KTQ A;  3DLL L;  3OS2 A;  4JKH A;  4V19 S;  1VSL A;  4KHN A;  1TKT A;  5GAG P;  3HL8 A;  2ITM A;  4F2R A;  2QWM A;  5LMN K;  2P9U B;  3AVH A;  1T3V A;  5TKW A;  1EX4 A;  5GAD P;  5C15 A;  4H4O A;  1WSH A;  4B3R K;  4FM0 A;  5FPE A;  4BRG A;  1BQM A;  3H6E A;  1LW0 A;  4DV2 K;  3LP0 A;  1TVR A;  3OS1 A;  2YHX A;  1Q81 O;  2E2N A;  3EE8 A;  3OS0 A;  1N5Y A;  4PA1 A;  2V7Z A;  1GLL O;  1YVU A;  3OYG A;  3KJV A;  1W97 L;  4CJS A;  3LWM A;  4DV6 K;  4DHY A;  1VSI A;  2BTF A;  2O8C B;  4AQY K;  2NRW A;  3CJ7 A;  4FPA A;  1NG9 A;  2YKM A;  3NVM A;  2DFF A;  3MDQ A;  2RHK A;  3ID8 A;  3M5R A;  2UXD K;  4OGE A;  3CCM N;  4FWR A;  3NH1 A;  3O1B A;  2E5L K;  4C8O A;  3CER A;  3CPE A;  4FXD A;  4GV6 A;  1NLV A;  3QNN A;  2FBY A;  3ZET A;  3NH2 A;  4IXC A;  2QXL A;  1VQP N;  2WBN A;  4JRP A;  2P9I A;  4FZX C;  4BG9 A;  2Q36 A;  1NGH A;  4DQS A;  5AQW A;  1ILY A;  1YTU A;  5J2N A;  4LFA K;  3EZW A;  3H08 A;  5BRF A;  2HHQ A;  4IG0 A;  1Q82 O;  3LM9 A;  3C6H A;  3O3F A;  3IFR A;  3QLH A;  3NF9 A;  3TI0 A;  3LAK A;  3FZK A;  3E9P A;  2P9P A;  4I6M A;  3OYC A;  3H3O B;  4LC9 B;  2P51 A;  1XC9 A;  1QQN A;  3H45 C;  2HHX A;  5AJ3 K;  1LV5 A;  1BI4 A;  3ATU A;  4CK3 A;  4JK8 A;  3ULE B;  4GW6 A;  1DLO A;  3B6O A;  5MLC Q;  4Z4C A;  1A5W A;  4KHS A;  3UKU A;  3S9H A;  3VET A;  3D2F A;  2ASP A;  1EKE A;  4BR7 A;  1HUX A;  5BPL A;  3T1Y K;  1TK8 A;  1D5A A;  1UAX A;  4E7I A;  4KPY A;  3I0S A;  3QDK A;  4F3T A;  3EL2 A;  4QOZ B;  4JI2 K;  2DPN A;  3HM8 A;  5FRO A;  3ASM A;  1F21 A;  4R5P A;  3ALY A;  3P5J A;  1QZ5 A;  3AO3 A;  3VQP A;  3AO2 A;  3H46 O;  4L3Q A;  3VQQ A;  4B3O A;  5AQJ A;  4CJR A;  4H8K A;  3NF7 A;  4ISE A;  3CCE N;  5KI6 A;  4JI0 K;  4E1M A;  4YOR A;  3OY9 A;  1CLQ A;  5M1N A;  2Y1I A;  3T3F A;  2G8V A;  2YJF A;  3A2F A;  5CYQ A;  3V1O A;  1YUW A;  3WEE A;  4CED A;  2UXB K;  4IO9 L;  4B9Q A;  3ULD A;  3PIO L;  4C23 A;  3NGY A;  2HVH A;  5DMR A;  3MXJ A;  3QEV A;  3MX5 A;  4KHU A;  3VQ8 A;  4RW9 A;  2HHT A;  3FLC O;  4DTX A;  1ATS A;  1NKE A;  4C1N I;  5F0X A;  3V1R A;  4CBX A;  5M1O A;  1ATN A;  3RVC A;  4J8F A;  2HOE A;  3ZSV A;  4BRO A;  5B8H A;  1S3X A;  4KO0 A;  2P9L B;  5C2D A;  4E0D A;  3Q7C A;  4DTS A;  3NCI A;  4FWK A;  1ASU A;  1RBV A;  2CGL A;  1U2V B;  4FLX A;  1IBL K;  2Q1N A;  4RW7 A;  3W0L A;  4B9M A;  3MEG A;  3RSE B;  3CJB A;  1TYQ A;  1WSE A;  1ZYQ A;  2EX3 A;  3IUC A;  3VER A;  4Z4F A;  2F8T A;  2WC9 A;  3K5N A;  4BDZ A;  4O4G A;  1MDU B;  2G8U A;  3CMA N;  1DKG D;  3HT3 A;  3V9X A;  5IT9 O;  4FWP A;  5AQR A;  3PX4 A;  4M3X A;  4BRF A;  4QCL A;  3RR7 A;  2ETJ A;  2E88 A;  2P9K B;  1NJZ A;  1QSL A;  3TU5 A;  4CIF A;  1IBK K;  2OTL N;  2OPQ A;  3VGM A;  4DTM A;  4M3T A;  4JI5 K;  3N4Q A;  4JI3 K;  4JD2 A;  4OPJ A;  2QWR A;  4IKF A;  4DFP A;  3O8M A;  1W9H A;  4BRE A;  3D7E O;  3WEE B;  4B8A B;  2WTU A;  4Z4I A;  4BRI A;  4AF1 A;  4H0X B;  3L3V A;  1T05 A;  3E66 A;  4KTW A;  3RMB A;  4BDP A;  1WB9 A;  1RT3 A;  4E1N A;  2VGM A;  2WON A;  1YJ9 N;  3IAY A;  1KXP A;  4CGG A;  3HJF A;  3VOV A;  3CJ9 A;  3TAP A;  3W3D A;  4JHD B;  1TGO A;  4KB0 A;  4CEB A;  3DRS A;  1S22 A;  2GX9 A;  3ZT0 A;  1JKH A;  2Z1J A;  2OYQ A;  5A2Q O;  4Y0W A;  1TUY A;  4TSX A;  1UA1 A;  1U45 A;  2P9K A;  1JLG A;  1K8A O;  3QEI A;  1J9A A;  1XMO K;  4BRD A;  3NMU A;  1EWR A;  4DQR A;  2RN2 A;  1UA0 A;  3U8X A;  4FPB A;  4EFH A;  4FJH A;  4O44 A;  4BWJ A;  3JS6 A;  2I5J A;  3L2U A;  1ZBH A;  3P83 D;  3OVN A;  1TAQ A;  5C42 A;  4RW6 A;  4I7F A;  4DKW A;  3THV A;  3NFA A;  2O8C A;  2A1S A;  3HP9 A;  4FK0 A;  3F9K A;  3HPH A;  4CJP A;  4RW4 A;  2DY4 A;  4DV4 K;  1RT6 A;  2A40 A;  3M8P A;  4B1U B;  4KRF A;  1FKP A;  4I9Q A;  3KK2 A;  3TAM A;  3BGR A;  2NZT A;  4QAG A;  4BY9 C;  1BO5 O;  3MWP A;  4RWT A;  3TAG A;  4EZ9 A;  4YY3 K;  3WNH A;  3IG1 A;  2OAN A;  4CEQ A;  1SL2 A;  4LF4 K;  4CEF A;  4N5S A;  4B8C A;  4LFB K;  4BDY A;  5AQU A;  4FJ5 A;  3L4I A;  3SPY A;  4WE1 A;  1FKO A;  4DR2 K;  4EHU A;  2ASM A;  1K8K A;  3VEV A;  3MK6 A;  2ZM6 K;  3ZT4 A;  1KVB A;  3G4S N;  3KLG A;  5BPN A;  2NNW A;  3ISN C;  3ZSZ A;  4DR6 K;  1C1A A;  3JYT A;  3L8B A;  2KZZ A;  3ENB A;  1WSJ A;  2RE2 A;  3H3N O;  1HKG A;  1KRP A;  1RBS A;  1YXQ A;  4W5O A;  2KFZ A;  1KVA A;  1HJR A;  5M1P A;  3BEX A;  3M8Q A;  1GLA G;  3L2W A;  4GY2 B;  4FWO A;  4BGB A;  2UYT A;  3EY1 A;  2Z1H A;  3TR8 A;  1GLD G;  3M8S A;  4K0K K;  3GBT A;  4HCC A;  4CF9 A;  1X9S A;  1BL3 A;  2HF3 A;  2A42 A;  4B1W B;  4O0J A;  4B3M K;  5F2R A;  3KKS A;  1HNI A;  3TAE A;  4CGF A;  4FLU A;  1QSS A;  4WYB A;  3THY A;  1Y64 A;  3SJH A;  2E8A A;  1NNE A;  1GOC A;  2GEL A;  4FLV A;  3B6P A;  4DV5 K;  2XY7 A;  1FK9 A;  3DJC A;  4FZZ A;  2BH1 A;  4JI1 K;  4KV8 A;  3BY5 A;  1UWB A;  4HCB A;  1JLB A;  5KGW A;  2A5X A;  5HRS A;  1RT5 A;  4FK2 A;  5BRD A;  3MEC A;  2O8B B;  4LY7 A;  3KK7 A;  3OHR A;  3KZB A;  5C0Y A;  3HZ6 A;  3ZX2 A;  5LMU K;  1OKJ A;  4JI8 K;  4CJ7 A;  4BR5 A;  1XMQ K;  3SUQ A;  1SS6 A;  3WNE A;  1QQO A;  3OW2 M;  1U47 A;  4LF6 K;  3NH0 A;  1C0F A;  4N56 A;  1Z25 A;  3HVT A;  1FXX A;  3QB0 A;  4DU1 A;  4BR0 A;  2FLO A;  1EP4 A;  5HRP A;  5BPM A;  3KLH A;  4ILG B;  2YNF A;  5AQY A;  1X9M A;  2NRV A;  3R1X A;  3EZ5 A;  3A5M C;  1QVF M;  1QTM A;  3OBW A;  1S6P A;  2W41 A;  1KSP A;  4DV1 K;  2PYL A;  3WQT A;  1C1C A;  1S9G A;  1NOZ A;  3TTC A;  2R7Y A;  4PQU A;  1NGC A;  2F9T A;  4DR3 K;  2NRR A;  3THW A;  1G15 A;  1KFS A;  2HBJ A;  1ZBL A;  1Z6R A;  3AV9 A;  5JVG L;  3V81 A;  4DQP A;  1RT1 A;  4DTO A;  4CFD A;  3FFK B;  2O8F B;  4KRE A;  4PWD A;  1HR0 K;  1DT9 A;  2B5J A;  3SYZ A;  3K5O A;  4F3O A;  3RMD A;  1JLE A;  3LZI A;  3S3O A;  5CZ1 A;  4YOW A;  1MA9 B;  1BIZ A;  2P9P B;  3G0Z A;  4EAH D;  1BIS A;  1VSF A;  2A41 A;  4DLE A;  3CCQ N;  3NAE A;  5M1F A;  4MO5 A;  3VA3 A;  1EET A;  4CEC A;  3K0S A;  4JV5 K;  2FC0 A;  3CF5 L;  4DV0 K;  1XNR K;  2CH6 A;  4CJW A;  1WAF A;  3V9Z A;  1NGI A;  2HVI A;  3PIP L;  4BC2 A;  2DFH A;  4J2D A;  3E01 A;  4JI6 K;  3PX6 A;  1M1K O;  4DV7 K;  4BR2 A;  4UQG A;  3S3N A;  1K73 O;  1JXB A;  2IVO A;  2JGU A;  3VES A;  4L8R B;  3VGK A;  1NGB A;  3AA2 A;  4C8M A;  4FWL A;  4UY8 O;  3OYK A;  3LPU A;  2ZJQ L;  1GOB A;  4CJE A;  2EHG A;  1NGF A;  5AQK A;  4BRH A;  2EWS A;  4F2S A;  3OBY A;  1BWF O;  3VEY A;  5C25 A;  2Z1G A;  4PKG A;  3WXI A;  3CCR N;  2V7Y A;  1E4F T;  1JLA A;  4CBW A;  1VQK N;  3SCX A;  2P5G A;  4AHC A;  4CJV A;  4XH5 A;  3HI0 A;  1IH7 A;  3I8D A;  3TSP A;  2ITG A;  4B1Z A;  4DUZ K;  4ZHR A;  3ZSX A;  2UXC K;  3DOK A;  4I2Q A;  3SMS A;  1HKB A;  4NLB A;  4DB3 A;  4IOX A;  4H03 B;  1S1X A;  1X3M A;  3OYN A;  3PSF A;  3KWI A;  1T6C A;  5AQM A;  4H5N A;  4W5Q A;  5EVZ A;  3OYH A;  4BR9 A;  3OYA A;  3CFR A;  1XC3 A;  3M3Z A;  3A5N C;  1YVN A;  1HNZ K;  3CC2 N;  5C24 A;  3J80 O;  4PKI A;  2PFU A;  4ILH A;  3TPQ A;  3J8A A;  3VQ6 A;  5HLF A;  1J6Z A;  2E2Q A;  4JK9 A;  1ZBS A;  3U6F A;  2ZQB A;  3O3H A;  4CVN E;  1BI4 B;  4AM6 A;  3ENO A;  3FR0 A;  3O80 A;  4FJ7 A;  4KB1 A;  4DMN A;  4DR7 K;  4ID5 A;  1A5V A;  1J5E K;  4JI4 K;  1HNX K;  2X78 A;  3O9T A;  4NCA A;  3BF3 A;  1KCF A;  5HL7 L;  3EKS A;  4LH5 A;  3LPT A;  4IWV A;  1I39 A;  4E7H A;  4F4K A;  1BUP A;  3KLE A;  3TAF A;  1VQO N;  2YNI A;  3O9S A;  3BZK A;  3ENH A;  4CI6 A;  4CJ3 A;  3UIQ A;  1OVQ A;  4BRP A;  4F9O A;  3OYL A;  2HBK A;  4FWS A;  2WUS A;  1IO2 A;  1NBW A;  2VG5 A;  2CGK A;  1U48 A;  2QXF A;  4NXN K;  3DXM B;  4IZ9 A;  4AM7 A;  1MWK A;  1XI1 A;  2VWJ A;  1QZ6 A;  1WLJ A;  4NCB A;  1ITG A;  3O1W A;  2F96 A;  3PO4 A;  1RTJ A;  4X64 K;  3FGU A;  4YDU A;  2O4G A;  4FSV A;  4X66 K;  5CE3 A;  3CPW M;  4LF5 K;  3OYF A;  1QHA A;  3QEX A;  3A5L C;  1KAZ A;  5HRO A;  3AVF A;  4H4M A;  3K9J A;  2E1Z A;  3VN5 A;  5C2F A;  4MO4 A;  3D0P A;  3O9Q A;  5E84 A;  3AA3 A;  4BE2 A;  4CJ4 A;  4U7B A;  1VQ7 N;  4IOC L;  3E1Y A;  5JS2 A;  1YF5 L;  4A5A A;  4FL9 A;  2P9L A;  2F4V K;  1TKD A;  4WQ5 C;  1ASW A;  4A2A A;  3DRP A;  3KK3 A;  2F8S A;  1T03 A;  3QBW A;  3I56 N;  2G8H A;  3PLA A;  1GLC G;  3FZF A;  3T1H K;  3AVJ A;  2FSJ A;  3NGI A;  5BR9 A;  3OTO K;  1NJI O;  3AVM A;  5FDL A;  3SV3 A;  3RRH A;  3CQX A;  4U67 L;  4BVP A;  1Q7Y O;  3BZC A;  1NOY A;  4EP4 A;  2GWK A;  4CHZ A;  3DXM A;  2GEM A;  1VSE A;  3WXL A;  4R79 A;  2KHO A;  3Q7B A;  3VF4 A;  2ZE2 A;  3DM2 A;  1OVY A;  4G1Q A;  1NGG A;  4E7K A;  4EP5 A;  3V1Q A;  5AZJ A;  2FBX A;  2PAV A;  4JLH A;  1HPZ A;  4IFE A;  4H0P A;  4BRQ A;  4FJ9 A;  1QE1 A;  2V52 B;  3AVB A;  4IDK A;  4A57 A;  4LF7 K;  1IV0 A;  4BGA A;  4W5R A;  3CM6 A;  5AQO A;  2UUA K;  3CJ1 A;  3HOS A;  1XQS C;  3AVG A;  4WCE L;  2VG6 A;  3CD6 N;  4K41 A;  2IC3 A;  2E4L A;  1L3V A;  4GVE A;  4PL7 A;  1VQL N;  4JS5 A;  4A5B A;  4CJF A;  1IG9 A;  4H5R A;  5E41 A;  3UE5 A;  3L2R A;  2W42 A;  5LL6 Z;  1SL0 A;  2P9S A;  3HOT A;  1YAG A;  4NXM K;  4M3U A;  3MX2 A;  4JNE A;  4BQZ A;  1HLU A;  2QK9 A;  1J53 A;  1YT3 A;  3G25 A;  1ZBI A;  1D9D A;  1K8K B;  1VQN N;  1XHX A;  1JLF A;  4CW7 B;  4GKJ K;  4CJ5 A;  2O8B A;  3P1G A;  2IS3 A;  4CEO A;  4GKK K;  1I3A A;  4KBO A;  4FO0 A;  1BIU A;  3VQ7 A;  3PY8 A;  3VTI A;  4CHP A;  4QS8 A;  4BVO A;  2YHY A;  3HPO A;  3QET A;  4XEI A;  1NK0 A;  2UU9 K;  3K57 A;  3MXI A;  1E3M A;  1N6Q A;  2ZJP L;  1Q86 O;  4KH4 A;  1LAV A;  2X6S A;  1BG3 A;  4QS7 A;  4CZK A;  1P90 A;  2I7P A;  3D2F B;  4DTN A;  3L3U A;  5FRN A;  1RDU A;  5I42 A;  2HNZ A;  4Y1D A;  3V4I A;  1RBU A;  1HRH A;  2HNY A;  1RNH A;  1N33 K;  4E1J A;  4IFV A;  3ZT3 A;  1D4X A;  1U04 A;  4JYA K;  4JHD A;  4A61 A;  3UKU B;  3VQA A;  3WXJ A;  4O5F A;  1NJY A;  3U3G A;  4M3Z A;  1YIJ N;  1S9E A;  1T8E A;  5KPZ A;  5FLX O;  1JL1 A;  4I6M B;  4B9U A;  2IVP A;  3JXU A;  3AGR A;  4LH4 A;  4C1N K;  1DGK N;  1JL2 A;  4JS4 A;  1VQ6 N;  1K6Y A;  4CK1 A;  4Z0U A;  3H1V X;  4A62 A;  4FOI A;  4WQ4 C;  3LDL A;  1VK0 A;  4NYN A;  4CF0 A;  2IVN A;  2UUC K;  4LD0 A;  1NMN A;  1LW2 A;  3VA0 A;  2E2P A;  3T7Z A;  1N8R O;  1NWK A;  2FSN A;  3RMC A;  1KC8 O;  3VF2 A;  3HPG A;  1QVG M;  1L3T A;  5C10 A;  1IKW A;  2BUP A;  1B9F A;  1RDB A;  2P9S B;  3MN6 A;  3RRG A;  1Q9Y A;  3VQ9 A;  4RG8 A;  3F2K A;  5ADX A;  4YOV A;  3THW B;  1C0U A;  4CD1 A;  2HND A;  3SV4 A;  3SLC A;  1D9F A;  5F1X A;  3LDP A;  2E1Y A;  4PKH A;  4YOY A;  4CEE A;  1TK5 A;  4E7J A;  2XY6 A;  1GLB G;  4DCH A;  3NDK A;  3VQ5 A;  5AR0 A;  3LZJ A;  3BP8 A;  1VAZ A;  5I9E B;  3DLG A;  2Q31 A;  3LP1 A;  2OPS A;  3CQ8 A;  1SUQ A;  5AFU H;  2P9N A;  4YDU C;  3K9K A;  4QS9 A;  3HVR A;  1NGE A;  2W40 A;  3QBX A;  4GV9 A;  1E4G T;  4DF4 A;  4KKO A;  1JCG A;  1GOA A;  3SI6 A;  1IKY A;  4Q0B A;  2D0B A;  3MN7 A;  2D5R A;  3D45 A;  4JN4 A;  4FJK A;  1HNV A;  2OPR A;  3UB5 A;  1XUP O;  3SJJ A;  4DTP A;  1KLN A;  2IGI A;  4NB4 A;  1N36 K;  3D2E B;  4HUG A;  3F9M A;  3AAR A;  4HUE A;  3QES A;  1L3U A;  3EEQ A;  3CC7 N;  3C95 A;  3P4I A;  3CXC M;  2XY5 A;  3SNN A;  4DSK A;  3I0R A;  3A8Y A;  1MU2 A;  3WNF A;  3ITH A;  1K9M O;  3WT0 A;  3DXK A;  4Z4G A;  3SBG A;  3ZSO A;  3G71 N;  1NJW A;  3LAL A;  1ZXO A;  3O9R A;  3I8B A;  3QIP A;  2YKN A;  5HRN A;  1NU0 A;  5AQQ A;  4CCH A;  2ASO A;  3LP3 A;  1CXQ A;  4WFN L;  1Q8I A;  1QSY A;  4JK7 A;  2QTD A;  3AA4 A;  1MWM A;  1VSD A;  2RPI A;  3CCV N;  1VQ9 N;  3MCP A;  4ILJ A;  4FWM A;  2E6L A;  3OYE A;  3RSE A;  3TTF A;  4BRC A;  3V9S A;  3C6A A;  4CF2 A;  4BE0 A;  2PYJ A;  1HNW K;  1J54 A;  3PV8 A;  2HMI A;  4B9N A;  3SUP A;  1O13 A;  4IBN A;  1U4B A;  4WF9 L;  3OYJ A;  2YX6 A;  2OCE A;  1UOC A;  4CIG A;  4I2P A;  5AQI A;  3R8E A;  4CFB A;  3J7Y P;  3KK1 A;  4CK2 A;  4G9Z A;  1HQE A;  1YTA A;  4H0T B;  4FK4 A;  3CCU N;  4WQ4 A;  3ZCM A;  5KPR A;  1SKW A;  1YJN N;  2VWB A;  4ISG A;  3WXK A;  3QML A;  4F8R A;  1HX1 A;  2HB5 A;  4DLG A;  5SWM A;  4FJM A;  1KLM A;  1JCF A;  4NYF A;  3AA5 X;  3LWL A;  3SBT A;  3UKR A;  3SAH A;  4BC4 A;  2BGG A;  5ADX H;  2D0A A;  3VQD A;  3LAN A;  4A59 A;  3HTV A;  1EXQ A;  4CJU A;  3I55 N;  2PBD A;  3KIO A;  3CIP A;  5AQL A;  3BDP A;  1SAZ A;  1OH6 A;  2XO7 A;  4FWQ A;  3AAQ A;  3ZET B;  5AFU A;  1RFQ A;  3TWH A;  4K8X A;  4J2E A;  4MQ3 A;  4LSN A;  4PY5 A;  1GLF O;  1RTI A;  2F7T A;  4IO8 A;  4OJR A;  3V6D A;  4FLT A;  3HST B;  3KTQ A;  4B9V A;  1VSJ A;  3R3L A;  5CZ2 A;  3MAQ A;  4O8K A;  3D2E A;  4O55 A;  3HO1 A;  3M6G A;  1XHZ A;  2GUP A;  1R0A A;  3EE9 A;  3GOI A;  3SAF A;  5K14 A;  3L0Q A;  2Z1I A;  1BA0 A;  1VQ5 N;  3SUO A;  3LM2 A;  4BC3 A;  2NRX A;  1EQY A;  4YOX A;  3AO5 A;  4BR4 A;  3P31 A;  3J81 O;  3SPZ A;  3WNG A;  3NF6 A;  3VPZ A;  5JMV A;  3O08 A;  4DFM A;  5KRT A;  3OYD A;  4CGH A;  3N4P A;  3MMV A;  2E20 A;  2VG7 A;  5BRE A;  1TK0 A;  1WAJ A;  3DLR A;  3T19 A;  1TKZ A;  1OH7 A;  4CHY A;  1RGI A;  2B6A A;  2ZJR L;  3AVI A;  4XIU A;  4DF8 A;  3DLB A;  2WOM A;  4M41 A;  3L2Q A;  2IOC A;  2YJE A;  3CME N;  2WFB A;  3MCA B;  1CZA N;  1RTD A;  2HMP A;  4CEA A;  1NKB A;  2HHU A;  4JRQ A;  4IOA L;  3ID6 A;  4M3W A;  2D4W A;  5LY3 A;  4DQI A;  3WUH A;  3ZSQ A;  4DS5 A;  4XH4 A;  3THX B;  4FLW A;  4HTL A;  2OZM A;  5BN9 A;  3QIO A;  3HYF A;  4O5B A;  4YFU A;  1S6Q A;  3DOL A;  4Z4E A;  3HM9 A;  4M3R A;  4OLB A;  5BRH A;  3T69 A;  5HRR A;  1WOQ A;  1JJ2 M;  1TKX A;  3RTV A;  2VGN A;  4E19 A;  2IAJ A;  5JLF A;  3NVK A;  5CY4 A;  1RT2 A;  4CZE A;  2Q0R A;  1Q9X A;  3BF1 A;  1CZ9 A;  1WBD A;  4H5T A;  4OPK A;  3VQE A;  4H5V A;  5GIP A;  5J2P A;  2VWK A;  3IRX A;  1WUA A;  2A3Z A;  3AGK A;  4LF8 K;  5GIO A;  1BU6 O;  3CJC A;  1NK4 A;  3IKM A;  3U9D A;  4ZTJ A;  4DWI A;  3HXM A;  3H1Q A;  3VQB A;  4KH6 A;  4I9L A;  4NCG A;  2HST A;  4CEZ A;  3O3G A;  3AVN A;  3C0B A;  4IG3 A;  4ELT A;  1TYQ B;  4CER A;  5LJV A;  3MN9 A;  1KFD A;  3V9W A;  4M63 C;  2QEX N;  5JS1 A;  4RW8 A;  3G6E N;  2XHB A;  2GV9 A;  3LDQ A;  3VEX A;  3KLF A;  4B3S K;  2VYP A;  4FJI A;  4ISF A;  4KFB A;  2YNH A;  2NUB A;  1DEJ A;  1DTT A;  5IWA K;  2D0O A;  1BGX T;  1VSK A;  2KKZ A;  3FZM A;  4KHP K;  5HP1 A;  2XRI A;  1ZC6 A;  2QWN A;  1WSG A;  4NLC A;  3VF6 A;  3O4W A;  2A1R A;  2ATQ A;  1KAY A;  1RT7 A;  1SKS A;  4CF1 A;  3AAP A;  1RIL A;  4CZG A;  4CFC A;  4DQ8 A;  1RTH A;  3S41 A;  2H3G X;  4OPH A;  3NGZ A;  1HMV A;  3B8A X;  4DFJ A;  2CGJ A;  4AIL C;  3GG4 A;  2HBL A;  3FFI A;  1SQK A;  1V4T A;  1TV6 A;  2IDO A;  3KHY A;  4B9T A;  1N34 K;  4K8Z A;  4BRA A;  4E89 A;  3QNO A;  5EX5 A;  3BUZ B;  3IS9 A;  5FRM A;  1TL1 A;  4KH5 A;  3PX0 A;  4IEI A;  2AJQ A;  4JKB A;  3L2V A;  4N47 A;  5HBM A;  4AHU A;  2VCP A;  3TSU A;  5AQG A;  4OKJ A;  3F73 A;  4DTU A;  3NF8 A;  4GVM A;  4KAZ A;  5TKY A;  3V9U A;  2O8D A;  1C1B A;  2NRZ A;  3E9L A;  4JKF A;  4AHV A;  2GUI A;  4RCH A;  2O8E B;  2BAN A;  5GAE P;  3VQ4 A;  3M8R A;  5FPM A;  2RKI A;  4DG1 A;  2QKK A;  1D8Y A;  4JEP A;  2HHS A;  4BE1 A;  1ESV A;  4JI7 K;  5EXW A;  1NMD A;  3JAM O;  4MFB A;  3OYI A;  3K58 A;  3DI6 A;  3ZSY A;  4N41 A;  2YNG A;  4B1Y B;  4CGJ A;  5SZT A;  4PUO A;  2QWL A;  3VEW A;  4YOT A;  3R9P A;  3THY B;  3T1A A;  4AHT A;  2ZF5 O;  1NKC A;  1HPM A;  3CCJ N;  3NBP A;  4A2B A;  5T7B A;  3DAW A;  3MWT A;  1B9D A;  5EU7 A;  2G8I A;  1TL3 A;  4XH1 A;  1YI2 N;  1EWQ A;  3RMA A;  4OKE A;  3CCS N;  4WQ5 A;  2P9I B;  3HSC A;  3KD1 E;  2NRH A;  1LWE A;  1HYS A;  2OTJ N;  1CZB A;  1KVC A;  1L3S A;  3MN5 A;  1W0H A;  5JLH A;  5KPT A;  2QWQ A;  2YHB A;  3DRR A;  5BR8 K;  2Q3S A;  4AHS A;  1WSF A;  3AVA A;  4CJL A;  5AQH A;  4BWM A;  4FYD A;  1KAX A;  4DSL A;  3LDO A;  3KD5 E;  3GDQ A;  2QWO A;  4CGI A;  4MLH A;  3SQ2 A;  2HHV A;  3DLE A;  2BE2 A;  4GV3 A;  5AZJ B;  1LWF A;  4RTF D;  1Z05 A;  1S1V A;  4JKA A;  5AQX A;  1SKR A;  2OZS A;  1VRU A;  4C8N A;  4HTU A;  2KFN A;  1WNS A;  3QEP A;  1REV A;  1X1P A;  2X6N A;  3QIN A;  3SQ0 A;  4FM1 A;  3DYA A;  4Q5V A;  5AQS A;  4AH9 A;  4B9L A;  4M7X A;  3RR8 A;  3QFU A;  4LSL A;  4B1V A;  1LOT B;  3C94 A;  4IDH A;  1Z26 A;  3OYB A;  3RWU A;  4OVL A;  3CI5 A;  3HRG A;  2F9W A;  3DXK B;  5KQ8 A;  5AQZ A;  2Q97 A;  3TAR A;  5AQN A;  2D1K A;  1NK8 A;  1FW6 A;  1ZBF A;  3CYM A;  4BC5 A;  3SAG A;  3OYM A;  4FJ8 A;  4BRM A;  1A5X A;  1C0T A;  3CCL N;  3ZT1 A;  4EHT A;  4CE9 A;  3NE6 A;  1TUU A;  3VMF B;  3VQC A;  2P1J A;  3VEO A;  2Y1J A;  4H5W A;  4FJX A;  4DR5 K;  2P9N B;  3LL3 A;  1IG8 A;  3KWG A;  3LAM A;  4K25 A;  4DV3 K;  4CGD A;  4CES A;  3CJA A;  4DSI A;  1JXE A;  4J2B A;  4AHR A;  1O1W A;  1X9W A;  1H1V A;  4E3S A;  4JKG B;  1HJO A;  1RDC A;  4M3Y A;  3MEE A;  3CC4 N;  1HYV A;  3A0I X;  4CHN A;  1IBM K;  3P39 A;  5AZI B;  1NK6 A;  2DTU A;  3O4N A;  4IJN A;  2YV0 X;  4FOE A;  4Y1C A;  5DM6 L;  1VQM N;  3U9Z A;  2QWP A;  1SV5 A;  1QS4 A;  3AY9 A;  2YHW A;  4FZY A;  1U2V A;  1KQS M;  3VEZ A;  2Q2R A;  1NGD A;  3QO9 A;  4LFC K;  2FF3 B;  5BN8 A;  4O0I A;  4JKD A;  1J5O A;  4B9S A;  1W7A A;  1ATR A;  4FJG A;  5AQV A;  5EOY A;  4FJL A;  3FZH A;  1C0M A;  4NO7 A;  3EKU A;  5AQP A;  4H0O A;  2Q0U A;  1BQN A;  1JCE A;  3CFO A;  3P38 A;  1R59 O;  3CM5 A;  2YCH A;  5CHI A;  3K2P A;  5DK5 A;  1GLE G;  1JLC A;  4FJN A;  1YHQ N;  4BRN A;  4HWI A;  4X65 K;  4OLA A;  3SQ4 A;  1Y97 A;  3ZYY X;  2O8E A;  1IJJ A;  1T44 A;  3QER A;  3JSM A;  3O4Q A;  4JKG A;  4KI6 A;  1ZBU A;  4OO1 J;  3K5L A;  3PO5 A;  4DSJ A;  4CHO A;  4WFB L;  4CJK A;  4MDB A;  1VSH A;  5AZI A;  3IMX A;  2NLX A;  5JIC A;  2E6M A;  5GAH P;  4DTJ A;  2NRT A;  2G8W A;  1VRT A;  4M7Y A;  5GIN A;  3GL1 A;  2QM1 A;  3TAN A;  3HK2 A;  1Q18 A;  2ZD1 A;  3EYZ A;  3AVL A;  4K42 A;  2G8K A;  2A6A A;  2QA4 N;  1BDG A;  2YI1 A;  3C6T A;  1NGA A;  1RDA A;  3AO4 A;  5AQF A;  1IKX A;  3MXM A;  4BQL A;  3MED A;  1G99 A;  2J4R A;  4CZI A;  3LDS A;  1QQM A;  4DSE A;  4BG8 A;  4DU3 A;  1U49 A;  4DU4 A;  2CH5 A;  3J7Z O;  3KLI A;  3L6Q A;  3ZEU A;  4DR4 K;  1RDW X;  4JAX A;  2HBM A;  2VQE K;  4H0Y B;  2O4I A;  2FBV A;  1OH8 A;  4FCY A;  4CF8 A;  4KHY A;  3O5B A;  4HHT A;  4CIE A;  4ID1 A;  4KHQ A;  3CQY A;  5J2Q A;  5KRS A;  1NJX A;  3KVG A;  3HP6 A;  4MDA A;  3R6M A;  3FZL A;  1X3N A;  2FXU A;  3QIC A;  3AO1 A;  4DTR A;  3QFP A;  4HUF A;  4DFK A;  4MLE A;  3THX A;  1BOT O;  4FJJ A;  3OJS A;  4J2A A;  4IFY A;  5LJW A;  3SUN A;  3FE1 A;  3SQ1 A;  1U6Z A;  2KZM A;  4Z4H A;  4CZF A;  2ZWH A;  4W5T A;  1HKC A;  3ATV A;  1GLJ O;  3IDH A;  4ICL A;  1DTQ A;  1B92 A;  1EO1 A;  5E26 A;  2X74 A;  2FBT A;  2VQF K;  3SK3 A;  2HW3 A;  3OJU A;  3ULE A;  4W5N A;  1WN7 A;  3WXM B;  1WSI A;  1SZ2 A;  3ZT2 A;  2W6K A;  3VGL A;  3K5M A;  1S72 N;  3PSI A;  4C8K A;  4CJQ A;  5HOO A;  4B3T K;  1QQC A;  1YJW N;  3EO3 A;  5M1K A;  4O8U A;  2JWK A;  2AA4 A;  1M90 O;  3DMJ A;  1YIT N;  2D0C A;  2QI2 A;  3O6W A;  5CR4 A;  1ASV A;  3S3M A;  4ELU A;  2QKB A;  2OA8 A;  2P9U A;  3I33 A;  1BCO A;  1C6V A;  4DS4 A;  4FW2 A;  3CG7 A;  1WBB A;  3OA9 A;  4M45 A;  3DLK A;  4OX9 K;  1XWL A;  4Z94 A;  3SZ2 A;  3ZX3 A;  1S1T A;  1L5U A;  4FVU A;  1VHX A;  2O8D B;  4B08 A;  2JLE A;  3SMP A;  2BDP A;  1LCU A;  1S1W A;  4CZJ A;  1NK5 A;  4DQQ A;  2PY5 A;  4JKC A;  1QHT A;  3C7N A;  4EZ6 A;  3ZSW A;  4DR1 K;  5ELZ A;  2FF6 A;  5EY4 A;  3NHG A;  1P8Z A;  4FLZ A;  1XNQ K;  3D6R A;  1HQU A;  3O9U A;  4ELV A;  4KI4 A;  4GMJ B;  4GNI A;  4B1X B;  1NK9 A;  1JLQ A;  4LF9 K;  2DFE A;  1HYZ A;  3ZSR A;  1RDD A;  2IIR A;  3TTD A;  2HF4 A;  1VQ4 N;  4CBU A;  5J1E A;  2O8F A;  4K43 A;  3WQU A;  1S5J A;  5J2M A;  5KQD A;  1FJG K;  5AQT A;  3HBT A;  3J7A P;  1LWC A;  3M1F A;  1V4S A;  2RF2 A;  3KKR A;  4FVM A;  3F5T A;  1RT4 A;  3PUF A;  3C65 A;  3AVC A;  4X62 K;  2AP1 A;  4CHQ A;  4ZTF A;  4DUY K;  2HHH K;  1RBR A;  3TAQ A;  3AVK A;  1KTQ A;  3DLH A;  1BA1 A;  1CXU A;  4OKK A;  1W2B M;  3DWL A;  2PZS A;  4BAC A;  4BRK A;  1I94 K;  5DM7 L;  2GTD A;  3CFP A;  5D3G A;  3A5O C;  3C7N B;  4IJA A;  3GE1 A; 
#chains in the Genus database with same CATH homology
 4OKJ A;  3F73 A;  5I42 A;  1LAW A;  2HNZ A;  4Y1D A;  3KLG A;  1T7P A;  3V4I A;  1RBU A;  4DTU A;  3NF8 A;  3ISN C;  4GVM A;  2YHA A;  1C1A A;  1S1U A;  1HRH A;  3ZSZ A;  3JYT A;  3L8B A;  2KZZ A;  1WSJ A;  2HNY A;  1RNH A;  3V9U A;  3C6U A;  1C1B A;  1KRP A;  1RBS A;  2KFZ A;  4W5O A;  4AHV A;  2GUI A;  4IFV A;  1KVA A;  2BAN A;  1HJR A;  3ZT3 A;  1U04 A;  3M8Q A;  3VQ4 A;  3M8R A;  1SL1 A;  3L2W A;  3VQA A;  2KW4 A;  1NJY A;  1TAU A;  5KGX A;  3U3G A;  4FK2 A;  2RKI A;  4KTZ A;  2Z1H A;  3TR8 A;  4DG1 A;  3EY1 A;  3U3Y A;  1D8Y A;  2QKK A;  4M3Z A;  1S9E A;  1T8E A;  3M8S A;  2HHS A;  1JL1 A;  4YNQ A;  4BE1 A;  4HCC A;  4CF9 A;  1X9S A;  4B9U A;  1BL3 A;  4O0J A;  4LH4 A;  4C8L A;  1JL2 A;  4MFB A;  3OYI A;  4JS4 A;  1K6Y A;  4FW1 A;  4CK1 A;  3K58 A;  3DI6 A;  3ZSY A;  4FM2 A;  4N41 A;  2P5O A;  4Z0U A;  2YNG A;  4CGJ A;  5SZT A;  2KTQ A;  1VK0 A;  1HNI A;  3KKS A;  4NYN A;  3TAE A;  4PUO A;  4CF0 A;  4E7L A;  4CGF A;  4FLU A;  1QSS A;  3T1A A;  4AHT A;  4N76 A;  1NKC A;  3NBP A;  4LD0 A;  4KTQ A;  5T7B A;  1LW2 A;  1GOC A;  1B9D A;  5EU7 A;  4FLV A;  3VA0 A;  3B6P A;  3QEW A;  2XY7 A;  1FK9 A;  1TL3 A;  2G8I A;  4FZZ A;  4KV8 A;  4OKE A;  3RMA A;  1UWB A;  4HCB A;  1JLB A;  3RMC A;  1BCM A;  3KD1 E;  1BHL A;  1LWE A;  5KGW A;  1RCH A;  1CZB A;  1KVC A;  1HYS A;  1L3S A;  3HPG A;  2OPP A;  1RT5 A;  4HVJ A;  5HRS A;  1W0H A;  3MEC A;  3TAB A;  2GBZ A;  1IKW A;  4LY7 A;  1L3T A;  1B9F A;  2G8F A;  1RDB A;  1NK7 A;  2YHB A;  3K59 A;  3RRG A;  3DRR A;  3VQ9 A;  4RG8 A;  1Q9Y A;  1RBT A;  5I3U A;  2Q3S A;  4AHS A;  1WSF A;  3AVA A;  1C0U A;  2KQ2 A;  2HND A;  3SV4 A;  4DSF A;  1D9F A;  3SUQ A;  2B4J A;  4CJL A;  1IKV A;  4FLY A;  3WNE A;  4CEE A;  1U47 A;  1TK5 A;  4BWM A;  4FYD A;  4E7J A;  4DSL A;  5CYM A;  3NH0 A;  4CFA A;  3KD5 E;  2XY6 A;  3NDK A;  3G10 A;  3VQ5 A;  4OGC A;  4CGI A;  4N56 A;  1Z25 A;  4KHW A;  3SQ2 A;  3LZJ A;  2HHV A;  3DLE A;  2BE2 A;  5FRN A;  3HVT A;  3DLG A;  1LWF A;  3LP1 A;  3LP2 A;  1VSM A;  2OPS A;  1FXX A;  3CQ8 A;  1SUQ A;  4CJT A;  4DU1 A;  2HHW A;  1S1V A;  1SKR A;  1EP4 A;  2OZS A;  5HRP A;  3KLH A;  2XY8 A;  1VRU A;  2LSN A;  4C8N A;  4HTU A;  2KFN A;  2YNF A;  4M42 A;  1X9M A;  3HVR A;  1WNS A;  3QEP A;  1REV A;  4DF4 A;  5KTQ A;  1X1P A;  3OS2 A;  3EZ5 A;  2X6N A;  3QIN A;  1VSL A;  4KKO A;  1QTM A;  3SQ0 A;  4KHN A;  1TKT A;  1S6P A;  3DYA A;  4Q5V A;  3HL8 A;  1GOA A;  4FM1 A;  3SI6 A;  4AH9 A;  1IKY A;  1KSP A;  2D0B A;  2PYL A;  3RR8 A;  1C1C A;  4B9L A;  2D5R A;  4F2R A;  4Q0B A;  3D45 A;  4LSL A;  1S9G A;  1NOZ A;  3AVH A;  2R7Y A;  4FJK A;  4PQU A;  1HNV A;  2OPR A;  3C94 A;  1Z26 A;  3OYB A;  3RWU A;  4OVL A;  1EX4 A;  4H4O A;  1G15 A;  4DTP A;  3SJJ A;  1KFS A;  1KLN A;  2IGI A;  1WSH A;  4FM0 A;  1ZBL A;  4HUG A;  3AV9 A;  4HUE A;  3QES A;  1L3U A;  3V81 A;  1BQM A;  4DQP A;  1RT1 A;  4DTO A;  4CFD A;  3TAR A;  1LW0 A;  3C95 A;  3LP0 A;  1TVR A;  4KRE A;  3OS1 A;  2XY5 A;  3SNN A;  4DSK A;  2B5J A;  3I0R A;  1MU2 A;  3SYZ A;  4PWD A;  3K5O A;  3WNF A;  1NK8 A;  4F3O A;  3ITH A;  3OS0 A;  1N5Y A;  1ZBF A;  3CYM A;  4PA1 A;  3RMD A;  1JLE A;  3LZI A;  3S3O A;  5CZ1 A;  3OYM A;  4FJ8 A;  1YVU A;  1BIZ A;  3OYG A;  3KJV A;  4CJS A;  1A5X A;  3LWM A;  3G0Z A;  4Z4G A;  1C0T A;  1VSI A;  1BIS A;  1VSF A;  3ZSO A;  3ZT1 A;  4DLE A;  2YKM A;  4CE9 A;  3NE6 A;  2DFF A;  3NAE A;  3VA3 A;  1NJW A;  3LAL A;  1EET A;  2P1J A;  3VQC A;  4CEC A;  4OGE A;  2FC0 A;  2Y1J A;  3QIP A;  4FJX A;  2YKN A;  5HRN A;  3NH1 A;  4CCH A;  4C8O A;  3LP3 A;  1CXQ A;  4CJW A;  4FXD A;  1WAF A;  3LAM A;  3V9Z A;  3QNN A;  1Q8I A;  2FBY A;  4CGD A;  2HVI A;  3NH2 A;  1QSY A;  4CES A;  4DSI A;  2DFH A;  1JXE A;  4J2B A;  3AA4 A;  4AHR A;  4J2D A;  1O1W A;  3E01 A;  1X9W A;  1VSD A;  2RPI A;  4JRP A;  3PX6 A;  4E3S A;  4FZX C;  4UQG A;  3S3N A;  2E6L A;  1JXB A;  4DQS A;  3OYE A;  1YTU A;  2JGU A;  3V9S A;  5J2N A;  1RDC A;  4CF2 A;  4BE0 A;  4L8R B;  4M3Y A;  3MEE A;  3H08 A;  2PYJ A;  2HHQ A;  1HYV A;  4CHN A;  1J54 A;  3PV8 A;  3AA2 A;  4IG0 A;  2HMI A;  4B9N A;  3O3F A;  1NK6 A;  4C8M A;  3SUP A;  2DTU A;  4IBN A;  3O4N A;  3OYK A;  2YV0 X;  3LPU A;  4Y1C A;  1GOB A;  3QLH A;  1U4B A;  3NF9 A;  3TI0 A;  1SV5 A;  3LAK A;  4CJE A;  1QS4 A;  2EHG A;  3OYJ A;  4FZY A;  1UOC A;  4KAZ A;  4CIG A;  4F2S A;  4I2P A;  5C25 A;  3QO9 A;  2Z1G A;  4CFB A;  1JLA A;  4O0I A;  4CK2 A;  3KK1 A;  1J5O A;  3OYC A;  3SCX A;  4B9S A;  1HQE A;  2P5G A;  1YTA A;  4AHC A;  2P51 A;  4CJV A;  4FJG A;  4FJL A;  4FK4 A;  1XC9 A;  2HHX A;  1C0M A;  1IH7 A;  3ZCM A;  3I8D A;  1SKW A;  1LV5 A;  1BQN A;  3CFO A;  4F8R A;  2ITG A;  1BI4 A;  4ZHR A;  2HB5 A;  3ZSX A;  3DOK A;  5SWM A;  1KLM A;  4DLG A;  4FJM A;  4I2Q A;  3CM5 A;  4CK3 A;  3K2P A;  4NYF A;  3AA5 X;  4GW6 A;  1DLO A;  5DK5 A;  3B6O A;  1S1X A;  3LWL A;  3OYN A;  1JLC A;  4Z4C A;  4FJN A;  1A5W A;  4KHS A;  2BGG A;  3S9H A;  4OLA A;  2D0A A;  3SQ4 A;  1Y97 A;  3VQD A;  1EKE A;  3LAN A;  4W5Q A;  1EXQ A;  4CJU A;  3QER A;  3JSM A;  3OYH A;  3O4Q A;  3OYA A;  3KIO A;  4KI6 A;  1ZBU A;  1TK8 A;  3CFR A;  1D5A A;  1UAX A;  3K5L A;  4E7I A;  3PO5 A;  3BDP A;  4DSJ A;  4KPY A;  3I0S A;  4F3T A;  4CHO A;  4CJK A;  1VSH A;  2XO7 A;  5C24 A;  4QOZ B;  5FRO A;  3ASM A;  2E6M A;  4DTJ A;  1F21 A;  3TWH A;  4K8X A;  4J2E A;  3VQ6 A;  5HLF A;  1VRT A;  2G8W A;  4MQ3 A;  4R5P A;  4LSN A;  3U6F A;  2ZQB A;  3ALY A;  3O3H A;  4PY5 A;  1BI4 B;  1RTI A;  3AO3 A;  3P5J A;  3VQP A;  3AO2 A;  3TAN A;  3VQQ A;  4B3O A;  4OJR A;  3HK2 A;  2ZD1 A;  4H8K A;  4CJR A;  3NF7 A;  3AVL A;  3EYZ A;  3V6D A;  5KI6 A;  4FLT A;  3HST B;  4DMN A;  3KTQ A;  4B9V A;  2G8K A;  1VSJ A;  4E1M A;  4ID5 A;  1A5V A;  5CZ2 A;  3OY9 A;  3MAQ A;  2X78 A;  1CLQ A;  2Y1I A;  3C6T A;  4NCA A;  3T3F A;  1KCF A;  1RDA A;  3AO4 A;  2G8V A;  3A2F A;  4LH5 A;  1IKX A;  3LPT A;  4O55 A;  3HO1 A;  5CYQ A;  3V1O A;  1XHZ A;  1I39 A;  3MXM A;  1R0A A;  3MED A;  3LDS A;  4E7H A;  4F4K A;  4DSE A;  5K14 A;  4CED A;  3KLE A;  4DU3 A;  3TAF A;  1U49 A;  4DU4 A;  2Z1I A;  2YNI A;  3ULD A;  3UIQ A;  4CJ3 A;  3KLI A;  3SUO A;  3NGY A;  2HVH A;  5DMR A;  3MXJ A;  3QEV A;  4KHU A;  3AO5 A;  3VQ8 A;  4RW9 A;  2HHT A;  3SPZ A;  3WNG A;  2O4I A;  3NF6 A;  2FBV A;  3OYL A;  4DTX A;  5KRT A;  4DFM A;  3OYD A;  4FCY A;  1NKE A;  4CF8 A;  3V1R A;  4CGH A;  1IO2 A;  2VG5 A;  4KHY A;  4HHT A;  1U48 A;  2VG7 A;  4ID1 A;  3ZSV A;  4CIE A;  4KHQ A;  2QXF A;  5J2Q A;  5KRS A;  4KB1 A;  4KO0 A;  1TK0 A;  1NJX A;  1XI1 A;  1WAJ A;  2VWJ A;  4E0D A;  3HP6 A;  1WLJ A;  3DLR A;  1TKZ A;  3T19 A;  4NCB A;  4CHY A;  1ITG A;  2F96 A;  4DTS A;  3NCI A;  3PO4 A;  1RTJ A;  1ASU A;  1RBV A;  3AO1 A;  4DTR A;  2B6A A;  4FLX A;  4HUF A;  2O4G A;  3AVI A;  4RW7 A;  4DFK A;  3MEG A;  4B9M A;  4XIU A;  4FJJ A;  4DF8 A;  3OYF A;  3DLB A;  1WSE A;  2WOM A;  3OJS A;  4M41 A;  3QEX A;  4J2A A;  4IFY A;  2EX3 A;  3L2Q A;  5HRO A;  2IOC A;  1ZYQ A;  3SUN A;  3AVF A;  4H4M A;  3SQ1 A;  4Z4F A;  2F8T A;  2KZM A;  4Z4H A;  3K5N A;  3VN5 A;  4BDZ A;  4W5T A;  4O4G A;  1RTD A;  2G8U A;  4CEA A;  1NKB A;  4ICL A;  2HHU A;  3HT3 A;  4JRQ A;  1DTQ A;  1B92 A;  3V9X A;  4M3W A;  3D0P A;  4DQI A;  3PX4 A;  3ZSQ A;  4DS5 A;  2X74 A;  2FBT A;  3AA3 A;  4M3X A;  4BE2 A;  4FLW A;  4QCL A;  2OZM A;  3RR7 A;  4CJ4 A;  2ETJ A;  3QIO A;  3HYF A;  4O5B A;  2HW3 A;  3OJU A;  4YFU A;  1NJZ A;  1QSL A;  1S6Q A;  3DOL A;  4W5N A;  4Z4E A;  1WN7 A;  5JS2 A;  3HM9 A;  4M3R A;  1WSI A;  4OLB A;  4CIF A;  2OPQ A;  5HRR A;  4DTM A;  1TKD A;  1TKX A;  1ASW A;  3KK3 A;  3DRP A;  3ZT2 A;  4E19 A;  3RTV A;  1T03 A;  4M3T A;  2F8S A;  4OPJ A;  2IAJ A;  3K5M A;  4IKF A;  4DFP A;  2G8H A;  1W9H A;  5CY4 A;  3AVJ A;  3NGI A;  1RT2 A;  3AVM A;  5FDL A;  4B8A B;  3SV3 A;  3RRH A;  1Q9X A;  4CJQ A;  4C8K A;  4Z4I A;  1CZ9 A;  1QQC A;  1NOY A;  4EP4 A;  3L3V A;  4CHZ A;  1T05 A;  4KTW A;  4OPK A;  3VQE A;  1VSE A;  3RMB A;  4BDP A;  5J2P A;  3DMJ A;  2VWK A;  1ZBH A;  2D0C A;  1RT3 A;  3IRX A;  3S3M A;  1ASV A;  4ELU A;  2ZE2 A;  2QKB A;  3DM2 A;  4E1N A;  2OA8 A;  4G1Q A;  2WON A;  3IAY A;  4CGG A;  3HJF A;  1BCO A;  4E7K A;  4EP5 A;  3V1Q A;  1C6V A;  2FBX A;  4DS4 A;  1NK4 A;  3TAP A;  4ZTJ A;  4FW2 A;  4DWI A;  3CG7 A;  3HXM A;  3VQB A;  4JLH A;  4I9L A;  4NCG A;  4CEZ A;  3O3G A;  1HPZ A;  4M45 A;  3AVN A;  3DLK A;  4IG3 A;  4ELT A;  1XWL A;  1TGO A;  3SZ2 A;  4KB0 A;  4FJ9 A;  1QE1 A;  3AVB A;  4IDK A;  1S1T A;  4CER A;  3DRS A;  4CEB A;  1L5U A;  3ZT0 A;  4B08 A;  4W5R A;  1JKH A;  1KFD A;  2JLE A;  2Z1J A;  3CM6 A;  1S1W A;  3V9W A;  1NK5 A;  2BDP A;  2OYQ A;  5JS1 A;  4DQQ A;  4RW8 A;  4TSX A;  1UA1 A;  3AVG A;  1JLG A;  2XHB A;  2GV9 A;  1U45 A;  2PY5 A;  3QEI A;  2VG6 A;  1J9A A;  1QHT A;  2IC3 A;  2E4L A;  3KLF A;  4EZ6 A;  3ZSW A;  1L3V A;  4FJI A;  4DQR A;  2RN2 A;  4KFB A;  1UA0 A;  2YNH A;  2NUB A;  3NHG A;  4JS5 A;  4FLZ A;  1DTT A;  1HQU A;  4CJF A;  1IG9 A;  5E41 A;  4FJH A;  3L2R A;  4O44 A;  1BGX T;  4BWJ A;  2W42 A;  1VSK A;  1SL0 A;  4ELV A;  4FJ7 A;  5HP1 A;  4GMJ B;  4KI4 A;  2I5J A;  1NK9 A;  1JLQ A;  2XRI A;  2DFE A;  3L2U A;  4M3U A;  3P83 D;  3OVN A;  1TAQ A;  1WSG A;  1HYZ A;  3ZSR A;  1RDD A;  5C42 A;  2A1R A;  4RW6 A;  2ATQ A;  2QK9 A;  4I7F A;  1J53 A;  1YT3 A;  1ZBI A;  1D9D A;  1RT7 A;  3THV A;  1XHX A;  1JLF A;  1SKS A;  3NFA A;  4CF1 A;  5J1E A;  4CJ5 A;  1RIL A;  2A1S A;  1S5J A;  3HP9 A;  5J2M A;  3P1G A;  2IS3 A;  4CFC A;  4CEO A;  4FK0 A;  1RTH A;  3F9K A;  3HPH A;  4RW4 A;  4CJP A;  2DY4 A;  1RT6 A;  1I3A A;  3NGZ A;  3M8P A;  1HMV A;  4KRF A;  1LWC A;  1BIU A;  1FKP A;  3VQ7 A;  3KK2 A;  4DFJ A;  4CHP A;  3PY8 A;  4AIL C;  2RF2 A;  3TAM A;  4I9Q A;  3KKR A;  3BGR A;  4FVM A;  3FFI A;  3HPO A;  4QAG A;  1RT4 A;  3PUF A;  1TV6 A;  3QET A;  3TAG A;  2IDO A;  3AVC A;  1NK0 A;  4EZ9 A;  4CHQ A;  4ZTF A;  3WNH A;  3IG1 A;  3K57 A;  3MXI A;  4CEQ A;  4B9T A;  1SL2 A;  4CEF A;  4K8Z A;  4N5S A;  4B8C A;  4E89 A;  1RBR A;  3QNO A;  4BDY A;  3TAQ A;  3AVK A;  1KTQ A;  1N6Q A;  3DLH A;  1CXU A;  4OKK A;  4FJ5 A;  1LAV A;  3SPY A;  3IS9 A;  2X6S A;  4WE1 A;  1FKO A;  2PZS A;  4BAC A;  5FRM A;  1TL1 A;  3PX0 A;  2AJQ A;  3L2V A;  4N47 A;  3CFP A;  5HBM A;  3ZT4 A;  1KVB A;  5D3G A;  4DTN A;  3L3U A;  4AHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...