4CJLA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 55
structure length 149
sequence length 154
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjlA00
3K5LA 2HHWA 4CEFA 1ITGA 4N47A 4E7IA 3IRXA 4J2AA 1TVRA 3VQEA 2BGGA 1XWLA 3K2PA 4GW6A 5CY4A 1JLCA 3V81A 2DFEA 2VG7A 3OYGA 2VWJA 1U45A 1JLEA 1VSDA 3MXIA 2P1JA 1UA0A 1L3UA 4OKKA 4AHUA 5JS1A 3PX4A 5I42A 3MECA 3SUOA 1WAFA 3O3HA 3VQ9A 4IDKA 4C8MA 1HMVA 4FJMA 1L3TA 1ZBIA 3TABA 3LAMA 4DTUA 4Z4IA 1S1WA 4E7LA 4CESA 4BDZA 4K8ZA 3DOKA 1FXXA 2DFHA 3V6DA 3OYFA 3AVFA 3LZIA 4AHRA 2HVHA 1NJXA 3EZ5A 4LD0A 1BI4A 2G8KA 2D0AA 3SI6A 4FJ9A 3PX0A 4NCGA 1XC9A 1QSLA 1S9GA 4FK2A 1EXQA 3SPZA 3V1OA 1YTUA 4W5RA 4B08A 3TAGA 4MFBA 1YTAA 4KHQA 3U3GA 4DLGA 3OYAA 2KZMA 1BISA 2OPSA 1S1XA 5J2QA 1HRHA 3O3GA 1JL1A 1TK0A 3C6TA 4KO0A 4ZHRA 1S6PA 4DQIA 3RR8A 3D0PA 3M8RA 3M8PA 4DLEA 4CHNA 3SQ4A 3TAMA 4C8KA 2HNYA 3RMAA 3C95A 1RBTA 3T19A 4N76A 4M3WA 3VQBA 2ETJA 3NAEA 3WNFA 1JLFA 1K6YA 1TV6A 1WSHA 4DTNA 4CEDA 4CJPA 3THVA 3V9WA 1JKHA 3ZSOA 4DTRA 3KTQA 3K5MA 1VSMA 5J2PA 3KD1E 1I39A 4CK3A 1HQEA 1JXEA 4Z4FA 3L3UA 4CJ3A 1QTMA 2IOCA 2R7YA 1LWFA 3VQ6A 2Z1GA 3FFIA 3ISNC 1NOYA 1RT5A 4F2RA 1BGXT 1FKOA 1C1CA 3AVJA 1TK5A 3V9XA 1Z25A 5HRRA 3LWLA 3K5NA 3AVNA 3SV3A 4DU1A 1L3SA 2RF2A 2JLEA 4LSLA 4AHSA 1CXQA 4FJJA 1NK7A 1REVA 2KW4A 4HUEA 1HYSA 4ID1A 1LW0A 1RT6A 1MU2A 3ITHA 4KV8A 3V1QA 1N6QA 3OYLA 4W5QA 2G8FA 4DSJA 1EP4A 2X6NA 4AHTA 4E7KA 3AVMA 3OYDA 3QIOA 2HNZA 5I3UA 3AO2A 3RMBA 1WSJA 4ICLA 4FJ8A 3LP1A 1RT4A 3DYAA 1ASWA 4M45A 4BE2A 2PYLA 1XI1A 4R5PA 4NYNA 4CJRA 4KAZA 3CYMA 4CJ5A 3VQQA 4NCBA 1SL0A 3SQ1A 3RRGA 4KHUA 3NFAA 1Z26A 5DK5A 4CEOA 3I8DA 4DFMA 4DFPA 3AVLA 3VQCA 4FLVA 4FZXC 4CJVA 3KLIA 4BE1A 3L2QA 1EX4A 4DQQA 4BWMA 3SQ2A 2HMIA 2DY4A 3TARA 3IG1A 2HB5A 1S6QA 2F96A 3KLGA 3NF9A 3ZSZA 3C94A 4BACA 3OYIA 4H4MA 4PQUA 5KRSA 3HPGA 4B9LA 3AVAA 4FW2A 4RW7A 3I0RA 4EZ9A 4AH9A 1QS4A 1HQUA 3LPUA 5HROA 1NK8A 1SL1A 3VQDA 4B9UA 1W9HA 2HW3A 3B6OA 4B9NA 1B92A 1J53A 4E0DA 3LP0A 1VSFA 1I3AA 2D5RA 3L2RA 3HP9A 1B9FA 4PA1A 3DLBA 3MXJA 2WOMA 4O4GA 4CEZA 4KRFA 3QO9A 2LSNA 4CHPA 4JRQA 3RWUA 4CCHA 3LAKA 1WN7A 1HNIA 1GOBA 2VG6A 3DMJA 1DTQA 3EYZA 1IH7A 3AO4A 1RBSA 1JLAA 4CIEA 3TAQA 2FBYA 4DSLA 3V1RA 4CECA 4FLXA 4CHYA 3PY8A 3L2VA 1Q9YA 4OPKA 1KFSA 3VA3A 1S1UA 4M3YA 1EETA 1VSHA 2EHGA 3HVTA 3HT3A 2F8SA 4CERA 4CJFA 1XHZA 4ID5A 3O4QA 3KIOA 3OVNA 1JLBA 1RT1A 3ZSQA 3AO3A 2X78A 4OJRA 2QXFA 5EU7A 4KHYA 2HHTA 1LW2A 1UA1A 3SCXA 1A5VA 4DTOA 1S9EA 1RT7A 4FVMA 4O0JA 3ZSXA 3PO5A 4OLBA 2JGUA 1VSLA 4M3ZA 4CGGA 4I7FA 4MQ3A 1RTIA 4CGDA 1NK6A 1IG9A 4ELTA 4W5OA 1EKEA 1RTDA 5E41A 4DQSA 5FDLA 1TAUA 3NH1A 1U04A 4FK0A 2G8VA 3AVBA 4CGFA 3SNNA 3D45A 2O4GA 3NCIA 1SV5A 3NE6A 4B9VA 1IKYA 2OPPA 4Z4CA 4CGIA 4WE1A 2ZD1A 1TAQA 4KI6A 1ASVA 3G0ZA 3SUPA 3OYMA 4KHSA 3KLFA 5SZTA 3ZSWA 2QKBA 2BANA 4M3XA 1T8EA 1KTQA 1NK0A 4FJKA 1RDCA 4CEAA 5HLFA 1RBUA 3KKSA 1WSFA 1D5AA 1KVBA 4BDYA 4IFVA 1J9AA 5KRTA 5KGXA 3LDSA 1HYZA 4FLTA 2Z1HA 1QE1A 1KCFA 3PV8A 1WNSA 4Z0UA 1ZBFA 3DRPA 4KTWA 4KREA 3QLHA 4OGEA 3IS9A 1T03A 4CEEA 4CK1A 4I2QA 3LWMA 4F3OA 3QEPA 1Q8IA 4UQGA 3RR7A 4QAGA 4HVJA 3OJSA 3AV9A 2ZQBA 3DLGA 2QK9A 5C25A 2RN2A 3P5JA 4GVMA 2IAJA 4M41A 4F2SA 4CJUA 3OS1A 4FJNA 4B8CA 3RMCA 1X9SA 4CHOA 3QNNA 3T1AA 4H4OA 2YNFA 4LSNA 4G1QA 1RTHA 3ASMA 1VSKA 3ZSVA 2OYQA 1BQMA 1UAXA 1QHTA 4IG0A 3O4NA 5JS2A 3ZT3A 1NJWA 3KD5E 3SUQA 4B9TA 2VG5A 4CEQA 2P5GA 3L8BA 3CG7A 4CF2A 4CHQA 3QETA 1BCOA 4Y1CA 1A5WA 3NGZA 2HHQA 3F9KA 4OVLA 1VSJA 2G8UA 3QEIA 1T7PA 4N41A 1BCMA 2NUBA 3HL8A 1YT3A 4JS4A 2KFNA 4DFJA 2BDPA 1ASUA 3SZ2A 3DLEA 1UOCA 2OPRA 4CFAA 4B9SA 2FBTA 4DF4A 3B6PA 2IDOA 4YNQA 3DLRA 4OLAA 1JLQA 4DSKA 1IKVA 2GBZA 1VSIA 4KB1A 4CF9A 1C1AA 4FM1A 2B4JA 3DOLA 3G10A 3OS0A 3LALA 2YV0X 3HM9A 3SJJA 4ZTJA 4QOZB 2AJQA 1BI4B 4KPYA 1RDAA 2I5JA 4DS4A 3MEGA 4NYFA 1S1TA 1X9WA 3HK2A 1DTTA 1RBVA 1U4BA 4DU4A 4DWIA 3NGYA 4CK2A 3JSMA 1HYVA 4AHCA 1QSSA 4FJGA 1G15A 1SKWA 1NOZA 4LY7A 1WSEA 4RW8A 3L2WA 4E7JA 4J2BA 1D9DA 4Q0BA 2A1SA 1F21A 5FRMA 1NK4A 4CGJA 4PY5A 3DRRA 2X74A 3H08A 5C24A 3S3MA 3M8QA 3A2FA 3K58A 1WLJA 4CJ4A 3C6UA 4CFBA 4KI4A 3PUFA 3I0SA 4Y1DA 1C0UA 1UWBA 3DM2A 1CZBA 3S3OA 4OKEA 4CJWA 3CFPA 3IAYA 3AVKA 2HHUA 4CIFA 3AVGA 2W42A 5HRPA 3U3YA 4HHTA 2OPQA 1J5OA 2QKKA 1SKSA 4FZZA 3SQ0A 2Q3SA 3QEWA 2ZE2A 1U49A 1C1BA 2PZSA 2GV9A 5HRNA 2D0CA 1B9DA 3QIPA 4E89A 3HXMA 1NKBA 4FJXA 4W5NA 4C8NA 3VQ4A 4FJLA 5KTQA 3CM5A 2X6SA 1Q9XA 1J54A 4CF1A 1L3VA 2D0BA 5CYQA 3VQ5A 3V9SA 4FJIA 2IS3A 4DTMA 2RKIA 1TKTA 2IC3A 3AA5X 4DSFA 3OYJA 4FZYA 1DLOA 3RMDA 4Z4GA 1XHXA 5CYMA 4CEBA 1LAWA 1TK8A 1O1WA 3OYHA 4DTJA 2Y1IA 3KKRA 1W0HA 4E19A 2BE2A 2KZZA 4FM2A 4HUGA 2GUIA 1GOAA 3SYZA 1IKXA 3HYFA 1JLGA 3ZT2A 5CZ2A 1RT3A 4N5SA 3EY1A 3NHGA 4EP5A 4DQPA 2E6MA 1LAVA 2EX3A 1BL3A 5T7BA 4BDPA 3LPTA 3TR8A 1IO2A 3VN5A 1LWCA 4DMNA 5KI6A 3WNHA 1BIZA 1T05A 2FBXA 4FW1A 1N5YA 2XY6A 4DSIA 3BDPA 3HO1A 4DSEA 3SPYA 3AA2A 1TKDA 5C42A 1NKEA 3DLHA 1JL2A 4CJKA 3RRHA 4DS5A 2KQ2A 5FRNA 5D3GA 1WSGA 1KSPA 2G8HA 3OY9A 4NCAA 1BHLA 4FYDA 4YFUA 4CIGA 2XRIA 1VRUA 2HNDA 3OYKA 4JLHA 4KHWA 4AILC 4CJTA 1ZYQA 3QINA 1NJYA 3TAEA 3UIQA 4H8KA 3K5OA 3AVCA 4RW6A 2OZSA 4FK4A 4PUOA 2KTQA 3NF8A 1RDDA 5K14A 4HTUA 2XY7A 3T3FA 2G8WA 4RW4A 4M3TA 4LH4A 2DFFA 2E4LA 2YHBA 4CF8A 2HHXA 4CFDA 1HNVA 3LP2A 4KFBA 3CFRA 3QEVA 2E6LA 3HPHA 5HBMA 4FLWA 1NK5A 4W5TA 2FC0A 4J2EA 4GMJB 4K8XA 2ITGA 4HUFA 4J2DA 3NBPA 3ZCMA 3M8SA 2YHAA 4Z4HA 4ZTFA 1GOCA 4E1MA 4JS5A 3DI6A 1S5JA 3P1GA 1RBRA 4DTPA 1QSYA 4C8LA 1U48A 3MEDA 3HSTB 3SUNA 4QCLA 3QESA 3LP3A 2HHSA 4CJQA 3KK3A 4JRPA 1BIUA 4F8RA 1HJRA 1ZBHA 4RG8A 1WAJA 4CHZA 4F4KA 4KB0A 2O4IA 1ZBLA 3DRSA 3KJVA 2PY5A 2YKMA 1RCHA 2P5OA 1RNHA 1KLMA 4CE9A 3ZT1A 3MXMA 4B3OA 1R0AA 4FJ5A 2YKNA 2HHVA 3NDKA 4OGCA 4CGHA 4FLYA 4DTXA 4FJ7A 3O3FA 1CLQA 4LH5A 5J2NA 4IBNA 3TAFA 2XY8A 4DTSA 1FKPA 3AO5A 4KTZA 3NF6A 4HCCA 2B5JA 3K59A 3AVHA 3V9ZA 4EZ6A 3AO1A 2OZMA 1D8YA 5J2MA 4KHNA 4DF8A 3HPOA 1NKCA 4HCBA 3KLHA 3U6FA 1NJZA 2DTUA 1A5XA 4AHVA 3NH0A 4RW9A 3F73A 1RILA 3SV4A 2XY5A 1CXUA 3KK1A 3CFOA 3E01A 4FJHA 4I2PA 1KVCA 5HP1A 3VQPA 1IKWA 3QEXA 3OJUA 3ZSYA 4FLZA 4B8AB 4EP4A 4L8RB 2ATQA 3WNGA 4F3TA 2KFZA 3CQ8A 1CZ9A 3NH2A 4DQRA 4OKJA 1SUQA 1X9MA 4BE0A 1RDBA 3AA3A 4FLUA 4IG3A 5HRSA 3TI0A 4XIUA 1BQNA 5J1EA 3KK2A 3ZT0A 1SL2A 2OA8A 4IKFA 3QERA 4KTQA 1JXBA 1TL3A 1KFDA 1U47A 4TSXA 5KGWA 4CJSA 3MAQA 1QQCA 4CFCA 1SKRA 4M42A 4Z4EA 3ZSRA 3V9UA 3TAPA 4FXDA 1ZBUA 2VWKA 4CJLA 3VQ8A 2YNGA 3WNEA 4O0IA 3MEEA 1VK0A 3L2UA 4PWDA 2WONA 1C6VA 3CM6A 3OYBA 3L3VA 2XO7A 2XHBA 1WSIA 1Y97A 3OYEA 4C8OA 4IFYA 4M3UA 2PYJA 3DLKA 4I9LA 4M3RA 4N56A 1RTJA 3S3NA 1TGOA 3HP6A 1TKZA 3VQ7A 3KLEA 2RPIA 3LZJA 1HPZA 4DG1A 4E7HA 4E1NA 4Q5VA 4B9MA 4DFKA 1C0TA 3V4IA 2HVIA 4O44A 1LV5A 2Z1JA 3LANA 1LWEA 3NF7A 4I9QA 4CJEA 1NK9A 4BWJA 3ZT4A 5SWMA 1TL1A 1RT2A 3BGRA 2Y1JA 5DMRA 1S1VA 4CF0A 3HVRA 3P83D 3JYTA 4FCYA 4DU3A 3S9HA 3PX6A 3AA4A 3AVIA 1KRPA 2A1RA 5CZ1A 2Z1IA 5FROA 3OS2A 2B6AA 3RTVA 3TANA 1L5UA 1C0MA 2FBVA 1TKXA 1D9FA 3VQAA 3NGIA 3HJFA 1X1PA 4O5BA 4KKOA 1KLNA 3VA0A 2YNHA 3OYNA 3ALYA 3PO4A 3K57A 3OYCA 4FM0A 2P51A 1FK9A 1VRTA 2IGIA 2YNIA 1KVAA 4O55A 4E3SA 2G8IA 1YVUA 4ELVA 1VSEA 3ULDA 2F8TA 4ELUA 3QNOA 4OPJA 3TWHA
chains in the Genus database with same CATH superfamily
1TUUA 2HHWA 1ITGA 4E7IA 3ZEUA 1TVRA 2P9NA 3VQEA 3OBWA 5AQFA 3JAMO 3V81A 5B8HA 3OYGA 1QQOA 3ENOA 1VSDA 3MXIA 4DV1K 5I42A 3SUOA 1WAFA 1XMOK 4IDKA 1HMVA 1L3TA 1NMDA 1ZBIA 4Z4IA 1GLDG 1BO5O 3VEVA 2DFHA 2HVHA 3AVFA 4CZJA 3O9SA 2A3ZA 5GIPA 2UYTA 1VQNN 1HPMA 3B8AX 2D0AA 3THXB 4X66K 4H5WA 3GDQA 3G4SN 3EE8A 3UE5A 2UUAK 1YTAA 4KHQA 3U3GA 4OO1J 2FF3B 5J2QA 3O3GA 4KO0A 1S6PA 3RR8A 3D0PA 4CHNA 1QZ5A 1HKBA 1OVYA 2YCHA 4FPBA 3C95A 4EHUA 1QHAA 3WNFA 1JLFA 1GLBG 1IG8A 1C0GA 2O8BA 1KD1O 3ZSOA 3KTQA 5GIOA 1VSMA 2VGNA 5J2PA 4CK3A 1JXEA 5DM6L 1QTMA 2Z1GA 1OKJA 1HKGA 2ASPA 2ASOA 1C1CA 3V9XA 1Z25A 3K5NA 1P8ZA 4LF8K 1NMNA 3M6GA 4FJJA 1G99A 1CXQA 1X3NA 5AFUH 3IDHA 4HUEA 4ID1A 1LW0A 4KV8A 2G8FA 3CMEN 3O9QA 3E9OA 2X6NA 3J7ZO 3EN9A 1WSJA 4ICLA 3DYAA 4M45A 3O8MA 1XI1A 3N4QA 2UXBK 2E2QA 4NCBA 5KPRA 4KHUA 3NFAA 2FSKA 4JHDB 4CEOA 4DFPA 3AVLA 3VQCA 4CJVA 3KLIA 4YDUA 2DY4A 3IG1A 1JCGA 2F96A 1YXQA 3CCSN 4RCHA 4BRMA 4B9LA 4C1NK 4RW7A 2QEXN 1NK8A 4YORA 2ZGYA 4JKBA 1SL1A 3VQDA 4LFAK 3HM8A 1IV0A 1T6CA 3LP0A 1VSFA 4CZGA 3HP9A 4DHYA 3DLBA 1R59O 4CCHA 3LAKA 1GOBA 3VENA 1DTQA 2CH6A 4NLBA 5AFUA 1RBSA 5M1QA 4DSLA 4BR5A 4IOAL 5FPEA 5AZIB 1KFSA 1EETA 1VSHA 2F8SA 2NZTA 3A5OC 3OVNA 2X78A 4OJRA 2HHTA 3SCXA 1TYQA 3SBTA 3ZSXA 4O0JA 3Q7CA 4I7FA 1N36K 1RTIA 4IZ9A 4ELTA 5AQXA 3FZMA 4W5OA 2ZM6K 1RTDA 5E41A 1WBBA 2P9SA 4FK0A 2G8VA 3A5NC 2NRTA 1IKYA 4BGAA 4CGIA 5AQLA 3G0ZA 3OYMA 4BROA 5IWAK 1GLFO 3A8YA 2YX6A 2BANA 4CZLA 5BPNA 1BOTO 1KTQA 1NK0A 4Y0WA 4FJKA 1RDCA 4JI7K 5HLFA 3KKSA 1WSFA 1J9AA 1HYZA 2PAVA 4HTLA 1KCFA 2NRXA 1ZBFA 4NXNK 4KTWA 4YY3K 4NB4A 5M1NA 5E84A 4OGEA 4J8FA 1XC3A 3SAGA 3LWMA 4BR7A 4GY2B 4QAGA 4IWVA 1C0FA 2ZQBA 3DLGA 3VEWA 2IAJA 4CJUA 3OS1A 4FJNA 1NGGA 3QNNA 3N4PA 3T1AA 5JVGL 2P9KB 1NLVA 4LSNA 1RTHA 4FWMA 2OYQA 4CBWA 3CC2N 3LL3A 4DR5K 4H5NA 4FPAA 5C2FA 4CHQA 3QETA 1N32K 4WQ4A 1BCOA 4Y1CA 2HHQA 3UKRB 1VSJA 2QWMA 1VQ8N 2F4VK 4N41A 1BCMA 2QWLA 2BDPA 1ASUA 4BGBA 1UOCA 2FBTA 2Q36A 4YNQA 3DLRA 1BG3A 1X9JA 3TSQA 4CF9A 3ZETA 4B3SK 1HUXA 3LALA 3HM9A 2AJQA 1BI4B 4DS4A 1D4XA 3A5MC 3U9DA 1DTTA 1U4BA 4DWIA 2QI2A 2E8AA 3JSMA 1QSSA 4B1UB 2HBKA 1SKWA 4DQ8A 4LY7A 1D9DA 5C24A 4JN4A 3L4QA 3M8QA 3O08A 4CJ4A 3THYA 5AQOA 4KI4A 3O9TA 1CZBA 5EVZA 3THWB 2W42A 5HRPA 3SQ0A 2Q3SA 2NRRA 5HRNA 4BY9C 4FJXA 4W5NA 4C8NA 5C15A 4O8UA 2X6SA 2O8EB 1YF5L 1L3VA 5CYQA 3V9SA 5KQ8A 3AA5X 3CQXA 1XHXA 1XQSC 3OYHA 4DTJA 2Y1IA 1W0HA 4EAHD 3H45C 4M7XA 4HUGA 1GOAA 1IKXA 3GL1A 1JLGA 3NHGA 4N5SA 3CJAA 1LAVA 2QWNA 2D4WA 3LPTA 3TR8A 1IO2A 5KI6A 1BIZA 2FBXA 3D7EO 4DSIA 2W40A 4AF1A 5LJWA 4DSEA 2AA4A 3RSEA 3DLHA 2WUSA 4CJKA 2G8HA 2D0OA 3W3DA 4NCAA 1E4FT 4IJAA 3O5BA 2VQEK 3ZYYX 1VRUA 2HNDA 1ZYQA 3QINA 3VETA 3UIQA 4H0PA 4H8KA 2Q31A 4PUOA 2KTQA 4LF6K 3RVCA 3CETA 3R8EA 4U7BA 4M3TA 3VGMA 4KFBA 1HLUA 3CFRA 3QEVA 4DR6K 1NK5A 2HMPA 2YHWA 4J2EA 4GMJB 4J2DA 1N33K 2YHAA 4FWKA 4E1MA 4JS5A 3DI6A 1QSYA 1DKGD 3HSTB 3R1XA 3ULEB 3SUNA 3DLLL 2HHSA 3G71N 1BIUA 1NGJA 1HJRA 4F8RA 1ZBHA 1WAJA 4IOCL 2FLOA 1ZBLA 4IOXA 1RCHA 2P5OA 3MN9A 1KLMA 1HX1A 4FJ5A 4FJ7A 4IBNA 1ESVA 1FKPA 3AO5A 4JKDA 4BRQA 2D0PA 4HCCA 1OH6A 1D8YA 2GWJA 5GADP 3U6FA 2DTUA 1ATNA 3QB0A 3KK1A 3MMVA 4DR3K 5AQVA 4FJHA 3SJHA 1IKWA 3CHWA 3DXKA 2Q0UA 4B8AB 4L8RB 4F3TA 2KFZA 4BQZA 3EO3A 1X9MA 3TI0A 3PLAA 3CQYA 3KK2A 3UKUB 1SL2A 4DV7K 1JXBA 2QWOA 1JJ2M 3HRGA 5KGWA 4Z4EA 4XH1A 2GWKA 4CFCA 3ZSRA 3PSFA 4FXDA 2VWKA 2YNGA 4PWDA 4C8OA 3VTHA 4IFYA 3DLKA 3C6AA 1TGOA 3KLEA 2RPIA 4CZHA 4E7HA 4DG1A 2OANA 2A42A 4Q5VA 4DFKA 4O44A 1TUYA 3NF7A 5BRFA 1Q7YO 1RGIA 3ZT4A 2E1YA 1TL1A 1VQLN 4DU3A 3PX6A 1DGKN 2IVOA 1KRPA 3RTVA 5JVHL 5A2QO 4DB3A 4KH5A 1TKXA 4BRGA 1D9FA 1X1PA 1K8AO 1VQ6N 4KKOA 4IO8A 3ALYA 1OH8A 3KVGA 1I94K 3A0IX 3EZWA 2IGIA 5BREA 1KVAA 4ELVA 3HZ6A 4ELUA 3TWHA 2A5XA 4CD1A 3K5LA 4N47A 2P9PB 3SAFA 1U45A 2VG7A 2P1JA 3J7AP 4AHUA 2VWBA 5JS1A 3PX4A 2W6LA 3VQ9A 2IVPA 5AZJB 4C8MA 3EKUA 3LM2A 4FJMA 3TABA 3LAMA 4FO0A 1OH5A 3V6DA 4DV2K 2FSJA 3M1FA 4MO4A 3CJ7A 4JI2K 2KKZA 1DT9A 1QSLA 1QVFM 1EXQA 2O8CA 3TAGA 4DLGA 3CERA 5BPLA 2KZMA 2P9UA 2HBMA 1JL1A 4CZEA 2UU9K 1ATRA 4A5BA 1K8KB 4DLEA 2ZWHA 4FOEA 4C8KA 2HNYA 5TKYA 1RBTA 3T19A 1HNXK 2ITMA 5BRDA 3VQBA 1WB9A 4M3WA 3NAEA 1M1KO 1TV6A 3I8BA 4CEDA 4CJPA 3THVA 1JKHA 3H1QA 5KPTA 3L3UA 4CJ3A 2IOCA 2R7YA 1LWFA 2QWQA 3VQ6A 2JWKA 3AVNA 3D2FB 2JLEA 2WFBA 3I55N 1T3VA 1RT6A 2CGJA 1EP4A 4AHTA 4E7KA 3O1BA 3T69A 2HNZA 3VMFB 3AO2A 2OTJN 2WBNA 1RDWX 3LP1A 1RT4A 4OPAA 1ASWA 3ZLJA 1S72N 1YJNN 4R5PA 4JK8A 4B3RK 4CJ5A 1NGCA 3C0BA 1SL0A 1YHQN 1VQ4N 4DQQA 1EX4A 1S6QA 3KLGA 3ZSZA 3C94A 3QBWA 3OYIA 4H4MA 5KQDA 4PQUA 1QZ6A 3HPGA 3O80A 4FW2A 3I0RA 4AH9A 1QS4A 4LF5K 4B9UA 3HBTA 3PSIA 4B9NA 4IFEA 1B92A 4FWOA 2V52B 4JKHA 4DR7K 2D5RA 1B9FA 2IIRA 2WOMA 2GEMA 3QO9A 4CHPA 3H6EA 3THXA 3RWUA 5I9EB 3K0SA 1WBDA 3NVMA 3DMJA 3EYZA 3AO4A 1N8RO 4NLCA 5AQYA 3P39A 3VA3A 3D2EB 4M3YA 5FPNA 3HVTA 2Q1NA 1XHZA 3O4QA 3VPZA 3ZSQA 4FSVA 2YJFA 4H5TA 1QQNA 5EU7A 1LW2A 1UA1A 3CCEN 1A5VA 4DTOA 2GELA 3VESA 1RT7A 4FVMA 5JMVA 4PL7A 2JGUA 1V4SA 3J7YP 4GKJK 1IG9A 1EKEA 5FDLA 3SNNA 3D45A 2O4GA 3NCIA 1SV5A 4Z4CA 1Y64A 4WE1A 5BR8K 2ZD1A 1TAQA 1IBKK 4KI6A 1NBWA 3SUPA 4KHSA 3SMPA 5SZTA 2QTDA 3ZSWA 2QKBA 5GAHP 4M3XA 1T8EA 4ISGA 2P9IB 4G9ZA 3CCRN 3OW2M 1KVBA 4IFVA 3LDSA 3PV8A 4Z0UA 1H1VA 4H5VA 4KREA 1T03A 4CK1A 4I2QA 4F3OA 4JHDA 5EX5A 3TTCA 4UQGA 3CCLN 4I6MB 4HVJA 2E2OA 3AV9A 1K9MO 1ILYA 2KLAA 2RN2A 3P5JA 4GVEA 4CZKA 4X62K 4MLHA 4CHOA 3AGKA 1X9SA 3ASMA 1VSKA 2V51B 1V4TA 1BQMA 4IG0A 1QHTA 1J6ZA 1UAXA 5JS2A 3ZT3A 4B1WB 3GOIA 4CEQA 2P9NB 2HF3A 3SMSA 5AQSA 3CF5L 4JK9A 3F9KA 3DAWA 1M90O 1T7PA 3HL8A 2E2PA 1YT3A 4F9OA 3CJ1A 3DLEA 4YHHK 2OPRA 4CFAA 3O9UA 3CCQN 3T1HK 1JLQA 3CPEA 3G10A 3PIOL 3OS0A 4IXCA 4BVPA 1SAZA 2I5JA 3MEGA 2I7NA 4A2AA 1S1TA 1X9WA 3VEOA 1RBVA 3NGYA 4GKKK 3U9ZA 1NOZA 2PBDA 3EKSA 4J2BA 3F2KA 1NK4A 4CGJA 3O9RA 3AGRA 2NNWA 3K58A 3IMXA 1RFQA 4CFBA 4Y1DA 4B1ZA 3DM2A 3S3OA 4CJWA 3IAYA 3AVKA 3ID6A 3AVGA 4FZZA 4A5AA 4JKAA 3QEWA 2ZE2A 1OVQA 3QIPA 4E89A 4GV6A 5HOOA 3E1YA 5AQHA 3CM5A 4XH5A 3P31A 4AM6A 3MK6A 5BN8A 4FJIA 1EQYA 2RKIA 4FZYA 5GAEP 4DR1K 3DWLA 3RMDA 4Z4GA 1LAWA 3ATUA 1ZXOA 3FZLA 3IUCA 2A40A 4BC3A 4FM2A 1GLJO 2A41A 2Q2RA 3BF1A 3HYFA 4H0VB 2IVNA 4ILHA 2E6MA 2EX3A 5AQKA 4BDPA 3VN5A 3HSCA 3WNHA 1T05A 4FW1A 1N5YA 2XY6A 1TKDA 3SPYA 1NKEA 1JL2A 5FRNA 5LMUK 3LDLA 4MDBA 1KSPA 3QFPA 3OY9A 4FYDA 4CIGA 3UKRA 2CH5A 4CJTA 1SS6A 4FK4A 3AVCA 3VGKA 4YOXA 3NF8A 5K14A 4HTUA 1XNRK 4RW4A 3WXLA 4RWTA 2E4LA 2YHBA 1HNVA 1NGAA 3VGLA 3U8XA 2ZF5O 4W5TA 2FC0A 4K8XA 3NBPA 4JD2B 3ZCMA 1K73O 4Z4HA 4ZTFA 1GOCA 4C8LA 1S5JA 4DTPA 1RBRA 5CHIA 4QCLA 1IJJA 2H3GX 3LP3A 3QESA 3KK3A 1S22A 4DCHA 3DRSA 3KJVA 1RNHA 1TYQB 4CE9A 1NGHA 1EWQA 2YKNA 3NDKA 3THWA 4DTXA 3O3FA 2Q0RA 4BC2A 4DTSA 4BREA 4PHTX 3K59A 3AVHA 3V9ZA 4EZ6A 2P9SB 1Q86O 5F1XA 3MCPA 5AQWA 2CGKA 3NH0A 2O8EA 1RILA 3SV4A 1CXUA 3E01A 4FVUA 5AQPA 5HP1A 1MDUB 3VQPA 3QEXA 3OJUA 3D6RA 3JXUA 3WNGA 4CBUA 3NH2A 3HOTA 3WUHA 1RDBA 4XIUA 3CJ9A 4IKFA 1YAGA 4TSXA 1SKRA 3GE1A 3WEEB 1BWFO 1ZBUA 3MEEA 1VK0A 4FWNA 2XO7A 3TTDA 1WSIA 1Y97A 3P4IA 2OTLN 4M3UA 1RTJA 3ZX3A 1TKZA 5AQGA 2FXUA 4B9MA 2HSTA 2Z1JA 3J80O 4BVOA 4CJEA 4BWJA 4MO5A 1RT2A 1VQ5N 1S1VA 4CF0A 3HVRA 3CPWM 3R6MA 2A1RA 2B6AA 4LF4K 4K41A 3DJCA 2D1KA 3J81O 3VA0A 4BR4A 2HHHK 3PO4A 4O55A 3ZETB 5AQQA 4H0XB 2G8IA 1YVUA 3EEQA 3QNOA 4OPJA 4R79A 4H03B 3QFUA 2E1ZA 4J2AA 3S41A 3C65A 1JLCA 4CZIA 2VWJA 4ISEA 4OKKA 3BP8A 3DXMA 3MECA 1NGBA 3O3HA 5AQUA 4C1NI 3MWPA 4DTUA 3THYB 4CESA 1WOQA 3DOKA 1U2VA 1FXXA 5C0YA 3OYFA 4AHRA 4H5RA 3EZ5A 2G8KA 4FJ9A 3SK3A 4NCGA 3PX0A 1S9GA 4FK2A 3OA9A 3SPZA 4JKGA 1YTUA 4W5RA 4B08A 3EL2A 1S3XA 3OYAA 1MA9B 2OPSA 1HRHA 2DPNA 4IO9L 3C6TA 3M8PA 3TAMA 3RMAA 2F9WA 2I7PA 3FLCO 4BRLA 4N76A 4BRIA 1YVNA 2ETJA 4WQ5C 4DTNA 2O8FB 3LDPA 3V9WA 4DTRA 3KD1E 3K5MA 4Z4FA 4DR2K 1YI2N 1NOYA 5LY3A 4F2RA 1BGXT 5F0XA 3AVJA 1TK5A 2ZJPL 3BUZB 4FWLA 1SQKA 3OBYA 5ELZA 4DU1A 1L3SA 4BRNA 1NK7A 4LF7K 2F9TA 3UB5A 1HYSA 3ITHA 3V1QA 1N6QA 3OYLA 4W5QA 4DSJA 1YUWA 5BR9A 3ID8A 3LM9A 3VTIA 2PYLA 4K42A 4BG9A 4CJRA 1GLEG 3CYMA 4BRHA 3SQ1A 4K43A 1GLLO 5DK5A 4FLVA 3L2QA 4BWMA 3BY5A 3KWIA 3NF9A 4BACA 3BZCA 1NGDA 2P9PA 2YI1A 5KRSA 3AVAA 2VQFK 5HROA 2BUPA 2ZJQL 5AZJA 1X3MA 2HW3A 3VEZA 3FGUA 1EO1A 1J53A 3C7NB 4PA1A 3MXJA 4KRFA 4O4GA 4JRQA 3R9PA 5DM7L 3L4IA 1WN7A 1J5EK 1HNIA 3U4LA 2VG6A 3ZX0A 3MX5A 2W41A 5JICA 1JLAA 4CIEA 3V1RA 1XMQK 4CECA 4FLXA 3PY8A 3L2VA 1Q9YA 4OPKA 4FL9A 4XH4A 3HT3A 4CERA 1NNEA 4CJFA 4ID5A 3JS6A 1W2BM 2QXFA 3MN6A 2YJEA 4OLBA 3OTOK 4M3ZA 4MQ3A 4DR4K 1NK6A 3WT0A 4DV5K 2E5LK 1TAUA 1U04A 5F2RA 3AVBA 3SLCA 4GV3A 4B9VA 2O8DB 4Z94A 1NWKA 4JI5K 4IEEA 4WF9L 1ASVA 4X65K 1IBMK 3KLFA 1BA1A 3MDQA 3MWTA 4JEPA 4CEAA 1KC8O 1RBUA 4BDYA 1D5AA 5KRTA 1QE1A 1WNSA 3DRPA 5EXWA 3TPQA 4M63C 3IS9A 3CJCA 4CEEA 2QWRA 1Q8IA 3RR7A 3OJSA 5C25A 4LF9K 4B8CA 3BZKA 4DUZK 1IBLK 4QS7A 4H4OA 2YNFA 3WXMB 4G1QA 4B1VA 1KQSM 3QMLA 3OHRA 4WFAL 3TTFA 2VG5A 1QVGM 2P5GA 1Z05A 3L8BA 4EIAA 2A6AA 3E9PA 1A5WA 3NGZA 4CW7B 2G8UA 1ZBSA 4JI3K 2CGLA 3I33A 4JS4A 2NUBA 2KFNA 5FPMA 4B9SA 4ILGB 4DF4A 4OLAA 3FZHA 2WTUA 4DSKA 1IKVA 2GBZA 2WC9A 4KB1A 1C1AA 4FM1A 2B4JA 4ZTJA 3SJJA 4QOZB 3A5LC 1NJIO 4NYFA 4JNEA 4BG8A 2O8CB 4YDUC 4KH6A 1HYVA 1NU0A 1G15A 4LC9B 3L2WA 1WSEA 4E7JA 2P9LB 2VCPA 2A1SA 2GUPA 4IDHA 3DRRA 2X74A 2QWPA 3A2FA 1WLJA 3C6UA 3PUFA 1UWBA 4JI6K 4OKEA 3CFPA 1ZC6A 1ATSA 2RHKA 4HHTA 2QKKA 4OPHA 1J5OA 1SKSA 4GNIA 3QDKA 4B1XB 2PZSA 2GV9A 3F5TA 4FWSA 1B9DA 1NKBA 3VQ4A 4WCEL 4FJLA 1T44A 1J54A 2P9IA 4CF1A 3MCAB 1HNZK 4H0YB 3T7ZA 2IC3A 4KHPK 3VF2A 4ISFA 1KAXA 3GG4A 3F9MA 3O1WA 5CYMA 1TK8A 1VAZA 2PFUA 4E19A 4I6MA 2GUIA 3SYZA 2NRZA 3O4WA 1HNWK 1RT3A 3EY1A 4DQPA 3BF3A 2UUCK 2YHXA 1BL3A 3CMAN 3CCMN 2E20A 4DMNA 4CZMA 5C42A 1HKCA 4YFUA 4JI0K 2W6KA 2XRIA 4A2BA 3OYKA 4JLHA 4KHWA 4AILC 1EWRA 2FSNA 4BRDA 5GAGP 4AM7A 3AY9A 3K5OA 4RW6A 3T1YK 1OH7A 1RDDA 2XY7A 3VOVA 2G8WA 3FZKA 5KPZA 4CF8A 2HHXA 4CFDA 3LP2A 4DV4K 5HBMA 4CJ7A 2ITGA 4HUFA 1KAYA 3KHYA 3L0QA 2VGMA 4JI1K 4JRPA 1W97L 4CHZA 4F4KA 4YOTA 2O4IA 2PY5A 2YKMA 3ZEUB 2YHYA 1VQKN 4B3OA 1R0AA 2HHVA 4FLYA 4OGCA 4WQ4C 1CLQA 4O8KA 4FWPA 4DKWA 4CD3A 4KBOA 2B5JA 4K25A 3AO1A 3WQUA 2KHOA 5J2MA 4DF8A 3HPOA 4DUYK 4AHVA 5AZIA 3F73A 2XY5A 4I2PA 1KVCA 5M1OA 2UXCK 4E1JA 4PKGA 3ZSYA 4FLZA 4EP4A 4BR9A 1LOTB 2ATQA 3H3OB 4A61A 4A59A 4PL8A 3CQ8A 3CCJN 3CD6N 3LDOA 4OKJA 4A62A 3KWGA 3AA3A 4JK7A 1BQNA 2OA8A 4B3TK 4B9QA 1TL3A 4JKCA 1U47A 2BH1A 1QQCA 4M42A 2ZGZA 5AQMA 3V9UA 3TAPA 4CJLA 4C23A 3VQ8A 3WNEA 4O0IA 3L2UA 4JAXA 1BU6O 3CM6A 1C6VA 3OYBA 2O8BB 3S3NA 4M3RA 5AJ3K 5IT9O 3HP6A 2OCEA 3LZJA 3CCVN 4K0KK 4E1NA 1E4GT 1LV5A 3IKMA 4WFNL 1LWEA 1KAZA 3Q7BA 3C6HA 2UXDK 3BGRA 4BC4A 4QS8A 2BTFA 3P83D 4B3MK 3OS2A 4YOYA 1L5UA 1YIJN 3HTVA 2FBVA 3M5RA 3NGIA 3VF4A 3FFKB 2HF4A 3HJFA 4MDAA 4JD2A 3E66A 4FM0A 2P51A 1NGEA 2P9KA 4E3SA 1YITN 1VSEA 3ULDA 1KXPA 4YOUA 1XUPO 5M1KA 4CEFA 3IRXA 1FW6A 4HWIA 2BGGA 1XWLA 3K2PA 4GW6A 5CY4A 2DFEA 1JLEA 1UA0A 1L3UA 4GV9A 3MN5A 2HOEA 1S1WA 2HBLA 4E7LA 4BDZA 1GLAG 2VYPA 4K8ZA 3LZIA 1NJXA 4LD0A 1BI4A 1P90A 3SI6A 1MWKA 1XC9A 2GX9A 3CC7N 3V1OA 3H1VX 4MFBA 1BISA 1S1XA 4DV6K 1TK0A 4UY8O 4ZHRA 4DQIA 3M8RA 3SQ4A 1VQMN 3ATVA 3WEEA 4CVNE 1JCFA 1K6YA 1WSHA 2NRVA 3PIPL 5EOYA 1I39A 1HQEA 3K9KA 3ISNC 3FFIA 2J4RA 5AQTA 2V7ZA 1RT5A 4XEIA 1QQMA 1FKOA 4X64K 1VHXA 5HRRA 3LWLA 3G25A 2F7TA 5LL6Z 3SV3A 1Q18A 2RF2A 4LSLA 4AHSA 4JKFA 1WUAA 1REVA 2KW4A 3CCUN 1MU2A 4FWQA 3AAQA 4LFCK 3AVMA 5C2DA 3QIOA 3OYDA 5I3UA 3RMBA 1Z6RA 4FJ8A 4BQLA 3ENBA 3MN7A 4IJNA 4BE2A 5CR4A 5LJVA 4A57A 4DV3K 4NYNA 4KAZA 3VQQA 1XNQK 2QA4N 3RRGA 1Z26A 3I8DA 4DFMA 4FZXC 4BE1A 3SQ2A 2HMIA 3TARA 2HB5A 3NVKA 2UUBK 2JWLA 4EZ9A 3IFRA 3WQTA 1HQUA 4CI6A 3LPUA 3KK7A 3SBGA 4EFHA 1Q82O 1W9HA 3WXKA 3CJBA 3B6OA 4FOIA 4CBXA 1NGIA 4E0DA 1I3AA 2NLXA 3L2RA 4FWRA 4CEZA 5BRHA 2LSNA 1CZAN 3TU5A 4BRPA 3BEXA 4BRFA 1IH7A 3TAQA 2FBYA 4PKHA 3O6WA 4CHYA 3ULEA 1S1UA 1DEJA 2EHGA 3KIOA 1JLBA 1RT1A 4L3QA 3AO3A 4KHYA 3VEYA 4EHTA 1S9EA 4V19S 3PO5A 2O8FA 1VSLA 4CGGA 4CZFA 3VEXA 4CGDA 4DQSA 3NH1A 2EWSA 4CGFA 3CXCM 3NE6A 2OPPA 4DV0K 3HOSA 3CIPA 2ASMA 4RTFD 5AQNA 1O13A 1VQ9N 3QICA 3UKUA 3WXIA 5KGXA 4FLTA 2Z1HA 1NG9A 3QLHA 3QEPA 4LFBK 2NRWA 3FE1A 2QK9A 3AARA 4GVMA 4M41A 4F2SA 1FJGK 4MLEA 3RMCA 1VQON 4ILJA 5FPDA 1U6ZA 3ZSVA 1BDGA 1SZ2A 4AQYK 3KD5E 2AP1A 3O4NA 1NJWA 3SUQA 3RSEB 1MWMA 4B9TA 2V7YA 1Q81O 3CG7A 4CF2A 3K9JA 3C7NA 5FLXO 3M3ZA 4OVLA 5AR0A 3QEIA 3DXMB 4DFJA 3SZ2A 5ADXH 1BA0A 4JYAK 3HI0A 3B6PA 2IDOA 1VSIA 1U2VB 3DOLA 5AQZA 4BRAA 2YV0X 4KPYA 1RDAA 5AQRA 2FF6A 4PKIA 3J8AA 3HK2A 4JKGB 3WXJA 4DU4A 4CK2A 4AHCA 4FJGA 4RW8A 4Q0BA 3GBTA 4H0OA 4M7YA 1F21A 4BC5A 5FRMA 4IEIA 1VQPN 4PY5A 5AQIA 2QXLA 3H08A 3S3MA 1JCEA 5C12A 5BN9A 5MLCQ 3VERA 3I0SA 1C0UA 2O8DA 4YOVA 2HHUA 4CIFA 3U3YA 3I56N 2OPQA 1GLCG 1NGFA 4YOWA 1U49A 1C1BA 2D0CA 3HXMA 3FR0A 3P38A 2E88A 3ZX2A 5KTQA 1Q9XA 2D0BA 3VQ5A 5TKWA 4O5FA 2IS3A 4DTMA 1K8KA 1TKTA 4DSFA 3OYJA 1DLOA 5BPMA 3DXKB 5ADXA 4CEBA 4U67L 3FZFA 1O1WA 2QM1A 3KKRA 2BE2A 2KZZA 5GINA 3W0LA 3VF6A 2HBJA 3ZT2A 5CZ2A 3MX2A 3ENHA 4EP5A 5M1FA 3NMUA 5T7BA 1LWCA 1E3MA 1HR0K 3LDQA 3HO1A 3BDPA 3AA2A 3D2FA 2E2NA 3RRHA 4DS5A 2KQ2A 5D3GA 1WSGA 1BHLA 2ZJRL 3KZBA 2GTDA 5LMNK 1NJYA 3TAEA 2OZSA 4QS9A 5H1SQ 3T3FA 4KH4A 4LH4A 2DFFA 3LDNA 3TSPA 2E6LA 3HPHA 5JLHA 4FLWA 4BRCA 3TSUA 3M8SA 1N34K 3P1GA 1NM1A 1U48A 3MEDA 2P9LA 4JI4K 4CJQA 5C10A 5EY4A 4JV5K 4RG8A 3L6QA 4KB0A 1VQ7N 3R3LA 4WQ5A 1BUPA 3ZT1A 3MXMA 5M1PA 4H0TB 4BRKA 4CGHA 4B1YB 4LH5A 5J2NA 3TAFA 4JI8K 2XY8A 4KTZA 5CE3A 3NF6A 2OZMA 4KHNA 3E9LA 4OX9K 1NKCA 4HCBA 3KLHA 1NJZA 1A5XA 5E26A 4RW9A 3D2EA 4NO7A 3CFOA 1LCUA 3QBXA 5JLFA 3H46O 2Q97A 1CZ9A 4DQRA 2RE2A 1SUQA 1HJOA 4BE0A 4FLUA 4IG3A 5HRSA 1W7AA 2P9UB 5J1EA 5AQJA 3ZT0A 4WYBA 3QERA 4KTQA 1KFDA 3AAPA 3MAQA 4CJSA 2NRHA 3H3NO 2WONA 2XHBA 3L3VA 3OYEA 2QW9A 2PYJA 4N56A 4I9LA 1YJWN 1YJ9N 3VQ7A 1HPZA 4WFBL 3G6EN 1C0TA 3V4IA 2HVIA 3CI5A 3LANA 4I9QA 1NK9A 5SWMA 2Y1JA 5DMRA 4FCYA 3JYTA 4BR2A 3EE9A 4BR0A 3S9HA 4JKEA 3SAHA 3AA4A 3AVIA 5HL7L 5CZ1A 2Z1IA 5FROA 3TANA 1C0MA 3VQAA 1T6DA 4NXMK 4O5BA 1KLNA 2YNHA 3OYNA 3K57A 3OYCA 3CC4N 1FK9A 1VRTA 1RDUA 2YNIA 2F8TA
chains in the Genus database with same CATH topology
3K5LA 2HHWA 4CEFA 1ITGA 4N47A 4E7IA 3IRXA 4J2AA 1TVRA 3VQEA 2BGGA 1XWLA 3K2PA 4GW6A 5CY4A 1JLCA 3V81A 2DFEA 2VG7A 3OYGA 2VWJA 1U45A 1JLEA 1VSDA 3MXIA 2P1JA 1UA0A 1L3UA 4OKKA 4AHUA 5JS1A 3PX4A 5I42A 3MECA 3SUOA 1WAFA 3O3HA 3VQ9A 4IDKA 4C8MA 1HMVA 4FJMA 1L3TA 1ZBIA 3TABA 3LAMA 4DTUA 4Z4IA 1S1WA 4E7LA 4CESA 4BDZA 4K8ZA 3DOKA 1FXXA 2DFHA 3V6DA 3OYFA 3AVFA 3LZIA 4AHRA 2HVHA 1NJXA 3EZ5A 4LD0A 1BI4A 2G8KA 2D0AA 3SI6A 4FJ9A 3PX0A 4NCGA 1XC9A 1QSLA 1S9GA 4FK2A 1EXQA 3SPZA 3V1OA 1YTUA 4W5RA 4B08A 3TAGA 4MFBA 1YTAA 4KHQA 3U3GA 4DLGA 3OYAA 2KZMA 1BISA 2OPSA 1S1XA 5J2QA 1HRHA 3O3GA 1JL1A 1TK0A 3C6TA 4KO0A 4ZHRA 1S6PA 4DQIA 3RR8A 3D0PA 3M8RA 3M8PA 4DLEA 4CHNA 3SQ4A 3TAMA 4C8KA 2HNYA 3RMAA 3C95A 1RBTA 3T19A 4N76A 4M3WA 3VQBA 2ETJA 3NAEA 3WNFA 1JLFA 1K6YA 1TV6A 1WSHA 4DTNA 4CEDA 4CJPA 3THVA 3V9WA 1JKHA 3ZSOA 4DTRA 3KTQA 3K5MA 1VSMA 5J2PA 3KD1E 1I39A 4CK3A 1HQEA 1JXEA 4Z4FA 3L3UA 4CJ3A 1QTMA 2IOCA 2R7YA 1LWFA 3VQ6A 2Z1GA 3FFIA 3ISNC 1NOYA 1RT5A 4F2RA 1BGXT 1FKOA 1C1CA 3AVJA 1TK5A 3V9XA 1Z25A 5HRRA 3LWLA 3K5NA 3AVNA 3SV3A 4DU1A 1L3SA 2RF2A 2JLEA 4LSLA 4AHSA 1CXQA 4FJJA 1NK7A 1REVA 2KW4A 4HUEA 1HYSA 4ID1A 1LW0A 1RT6A 1MU2A 3ITHA 4KV8A 3V1QA 1N6QA 3OYLA 4W5QA 2G8FA 4DSJA 1EP4A 2X6NA 4AHTA 4E7KA 3AVMA 3OYDA 3QIOA 2HNZA 5I3UA 3AO2A 3RMBA 1WSJA 4ICLA 4FJ8A 3LP1A 1RT4A 3DYAA 1ASWA 4M45A 4BE2A 2PYLA 1XI1A 4R5PA 4NYNA 4CJRA 4KAZA 3CYMA 4CJ5A 3VQQA 4NCBA 1SL0A 3SQ1A 3RRGA 4KHUA 3NFAA 1Z26A 5DK5A 4CEOA 3I8DA 4DFMA 4DFPA 3AVLA 3VQCA 4FLVA 4FZXC 4CJVA 3KLIA 4BE1A 3L2QA 1EX4A 4DQQA 4BWMA 3SQ2A 2HMIA 2DY4A 3TARA 3IG1A 2HB5A 1S6QA 2F96A 3KLGA 3NF9A 3ZSZA 3C94A 4BACA 3OYIA 4H4MA 4PQUA 5KRSA 3HPGA 4B9LA 3AVAA 4FW2A 4RW7A 3I0RA 4EZ9A 4AH9A 1QS4A 1HQUA 3LPUA 5HROA 1NK8A 1SL1A 3VQDA 4B9UA 1W9HA 2HW3A 3B6OA 4B9NA 1B92A 1J53A 4E0DA 3LP0A 1VSFA 1I3AA 2D5RA 3L2RA 3HP9A 1B9FA 4PA1A 3DLBA 3MXJA 2WOMA 4O4GA 4CEZA 4KRFA 3QO9A 2LSNA 4CHPA 4JRQA 3RWUA 4CCHA 3LAKA 1WN7A 1HNIA 1GOBA 2VG6A 3DMJA 1DTQA 3EYZA 1IH7A 3AO4A 1RBSA 1JLAA 4CIEA 3TAQA 2FBYA 4DSLA 3V1RA 4CECA 4FLXA 4CHYA 3PY8A 3L2VA 1Q9YA 4OPKA 1KFSA 3VA3A 1S1UA 4M3YA 1EETA 1VSHA 2EHGA 3HVTA 3HT3A 2F8SA 4CERA 4CJFA 1XHZA 4ID5A 3O4QA 3KIOA 3OVNA 1JLBA 1RT1A 3ZSQA 3AO3A 2X78A 4OJRA 2QXFA 5EU7A 4KHYA 2HHTA 1LW2A 1UA1A 3SCXA 1A5VA 4DTOA 1S9EA 1RT7A 4FVMA 4O0JA 3ZSXA 3PO5A 4OLBA 2JGUA 1VSLA 4M3ZA 4CGGA 4I7FA 4MQ3A 1RTIA 4CGDA 1NK6A 1IG9A 4ELTA 4W5OA 1EKEA 1RTDA 5E41A 4DQSA 5FDLA 1TAUA 3NH1A 1U04A 4FK0A 2G8VA 3AVBA 4CGFA 3SNNA 3D45A 2O4GA 3NCIA 1SV5A 3NE6A 4B9VA 1IKYA 2OPPA 4Z4CA 4CGIA 4WE1A 2ZD1A 1TAQA 4KI6A 1ASVA 3G0ZA 3SUPA 3OYMA 4KHSA 3KLFA 5SZTA 3ZSWA 2QKBA 2BANA 4M3XA 1T8EA 1KTQA 1NK0A 4FJKA 1RDCA 4CEAA 5HLFA 1RBUA 3KKSA 1WSFA 1D5AA 1KVBA 4BDYA 4IFVA 1J9AA 5KRTA 5KGXA 3LDSA 1HYZA 4FLTA 2Z1HA 1QE1A 1KCFA 3PV8A 1WNSA 4Z0UA 1ZBFA 3DRPA 4KTWA 4KREA 3QLHA 4OGEA 3IS9A 1T03A 4CEEA 4CK1A 4I2QA 3LWMA 4F3OA 3QEPA 1Q8IA 4UQGA 3RR7A 4QAGA 4HVJA 3OJSA 3AV9A 2ZQBA 3DLGA 2QK9A 5C25A 2RN2A 3P5JA 4GVMA 2IAJA 4M41A 4F2SA 4CJUA 3OS1A 4FJNA 4B8CA 3RMCA 1X9SA 4CHOA 3QNNA 3T1AA 4H4OA 2YNFA 4LSNA 4G1QA 1RTHA 3ASMA 1VSKA 3ZSVA 2OYQA 1BQMA 1UAXA 1QHTA 4IG0A 3O4NA 5JS2A 3ZT3A 1NJWA 3KD5E 3SUQA 4B9TA 2VG5A 4CEQA 2P5GA 3L8BA 3CG7A 4CF2A 4CHQA 3QETA 1BCOA 4Y1CA 1A5WA 3NGZA 2HHQA 3F9KA 4OVLA 1VSJA 2G8UA 3QEIA 1T7PA 4N41A 1BCMA 2NUBA 3HL8A 1YT3A 4JS4A 2KFNA 4DFJA 2BDPA 1ASUA 3SZ2A 3DLEA 1UOCA 2OPRA 4CFAA 4B9SA 2FBTA 4DF4A 3B6PA 2IDOA 4YNQA 3DLRA 4OLAA 1JLQA 4DSKA 1IKVA 2GBZA 1VSIA 4KB1A 4CF9A 1C1AA 4FM1A 2B4JA 3DOLA 3G10A 3OS0A 3LALA 2YV0X 3HM9A 3SJJA 4ZTJA 4QOZB 2AJQA 1BI4B 4KPYA 1RDAA 2I5JA 4DS4A 3MEGA 4NYFA 1S1TA 1X9WA 3HK2A 1DTTA 1RBVA 1U4BA 4DU4A 4DWIA 3NGYA 4CK2A 3JSMA 1HYVA 4AHCA 1QSSA 4FJGA 1G15A 1SKWA 1NOZA 4LY7A 1WSEA 4RW8A 3L2WA 4E7JA 4J2BA 1D9DA 4Q0BA 2A1SA 1F21A 5FRMA 1NK4A 4CGJA 4PY5A 3DRRA 2X74A 3H08A 5C24A 3S3MA 3M8QA 3A2FA 3K58A 1WLJA 4CJ4A 3C6UA 4CFBA 4KI4A 3PUFA 3I0SA 4Y1DA 1C0UA 1UWBA 3DM2A 1CZBA 3S3OA 4OKEA 4CJWA 3CFPA 3IAYA 3AVKA 2HHUA 4CIFA 3AVGA 2W42A 5HRPA 3U3YA 4HHTA 2OPQA 1J5OA 2QKKA 1SKSA 4FZZA 3SQ0A 2Q3SA 3QEWA 2ZE2A 1U49A 1C1BA 2PZSA 2GV9A 5HRNA 2D0CA 1B9DA 3QIPA 4E89A 3HXMA 1NKBA 4FJXA 4W5NA 4C8NA 3VQ4A 4FJLA 5KTQA 3CM5A 2X6SA 1Q9XA 1J54A 4CF1A 1L3VA 2D0BA 5CYQA 3VQ5A 3V9SA 4FJIA 2IS3A 4DTMA 2RKIA 1TKTA 2IC3A 3AA5X 4DSFA 3OYJA 4FZYA 1DLOA 3RMDA 4Z4GA 1XHXA 5CYMA 4CEBA 1LAWA 1TK8A 1O1WA 3OYHA 4DTJA 2Y1IA 3KKRA 1W0HA 4E19A 2BE2A 2KZZA 4FM2A 4HUGA 2GUIA 1GOAA 3SYZA 1IKXA 3HYFA 1JLGA 3ZT2A 5CZ2A 1RT3A 4N5SA 3EY1A 3NHGA 4EP5A 4DQPA 2E6MA 1LAVA 2EX3A 1BL3A 5T7BA 4BDPA 3LPTA 3TR8A 1IO2A 3VN5A 1LWCA 4DMNA 5KI6A 3WNHA 1BIZA 1T05A 2FBXA 4FW1A 1N5YA 2XY6A 4DSIA 3BDPA 3HO1A 4DSEA 3SPYA 3AA2A 1TKDA 5C42A 1NKEA 3DLHA 1JL2A 4CJKA 3RRHA 4DS5A 2KQ2A 5FRNA 5D3GA 1WSGA 1KSPA 2G8HA 3OY9A 4NCAA 1BHLA 4FYDA 4YFUA 4CIGA 2XRIA 1VRUA 2HNDA 3OYKA 4JLHA 4KHWA 4AILC 4CJTA 1ZYQA 3QINA 1NJYA 3TAEA 3UIQA 4H8KA 3K5OA 3AVCA 4RW6A 2OZSA 4FK4A 4PUOA 2KTQA 3NF8A 1RDDA 5K14A 4HTUA 2XY7A 3T3FA 2G8WA 4RW4A 4M3TA 4LH4A 2DFFA 2E4LA 2YHBA 4CF8A 2HHXA 4CFDA 1HNVA 3LP2A 4KFBA 3CFRA 3QEVA 2E6LA 3HPHA 5HBMA 4FLWA 1NK5A 4W5TA 2FC0A 4J2EA 4GMJB 4K8XA 2ITGA 4HUFA 4J2DA 3NBPA 3ZCMA 3M8SA 2YHAA 4Z4HA 4ZTFA 1GOCA 4E1MA 4JS5A 3DI6A 1S5JA 3P1GA 1RBRA 4DTPA 1QSYA 4C8LA 1U48A 3MEDA 3HSTB 3SUNA 4QCLA 3QESA 3LP3A 2HHSA 4CJQA 3KK3A 4JRPA 1BIUA 4F8RA 1HJRA 1ZBHA 4RG8A 1WAJA 4CHZA 4F4KA 4KB0A 2O4IA 1ZBLA 3DRSA 3KJVA 2PY5A 2YKMA 1RCHA 2P5OA 1RNHA 1KLMA 4CE9A 3ZT1A 3MXMA 4B3OA 1R0AA 4FJ5A 2YKNA 2HHVA 3NDKA 4OGCA 4CGHA 4FLYA 4DTXA 4FJ7A 3O3FA 1CLQA 4LH5A 5J2NA 4IBNA 3TAFA 2XY8A 4DTSA 1FKPA 3AO5A 4KTZA 3NF6A 4HCCA 2B5JA 3K59A 3AVHA 3V9ZA 4EZ6A 3AO1A 2OZMA 1D8YA 5J2MA 4KHNA 4DF8A 3HPOA 1NKCA 4HCBA 3KLHA 3U6FA 1NJZA 2DTUA 1A5XA 4AHVA 3NH0A 4RW9A 3F73A 1RILA 3SV4A 2XY5A 1CXUA 3KK1A 3CFOA 3E01A 4FJHA 4I2PA 1KVCA 5HP1A 3VQPA 1IKWA 3QEXA 3OJUA 3ZSYA 4FLZA 4B8AB 4EP4A 4L8RB 2ATQA 3WNGA 4F3TA 2KFZA 3CQ8A 1CZ9A 3NH2A 4DQRA 4OKJA 1SUQA 1X9MA 4BE0A 1RDBA 3AA3A 4FLUA 4IG3A 5HRSA 3TI0A 4XIUA 1BQNA 5J1EA 3KK2A 3ZT0A 1SL2A 2OA8A 4IKFA 3QERA 4KTQA 1JXBA 1TL3A 1KFDA 1U47A 4TSXA 5KGWA 4CJSA 3MAQA 1QQCA 4CFCA 1SKRA 4M42A 4Z4EA 3ZSRA 3V9UA 3TAPA 4FXDA 1ZBUA 2VWKA 4CJLA 3VQ8A 2YNGA 3WNEA 4O0IA 3MEEA 1VK0A 3L2UA 4PWDA 2WONA 1C6VA 3CM6A 3OYBA 3L3VA 2XO7A 2XHBA 1WSIA 1Y97A 3OYEA 4C8OA 4IFYA 4M3UA 2PYJA 3DLKA 4I9LA 4M3RA 4N56A 1RTJA 3S3NA 1TGOA 3HP6A 1TKZA 3VQ7A 3KLEA 2RPIA 3LZJA 1HPZA 4DG1A 4E7HA 4E1NA 4Q5VA 4B9MA 4DFKA 1C0TA 3V4IA 2HVIA 4O44A 1LV5A 2Z1JA 3LANA 1LWEA 3NF7A 4I9QA 4CJEA 1NK9A 4BWJA 3ZT4A 5SWMA 1TL1A 1RT2A 3BGRA 2Y1JA 5DMRA 1S1VA 4CF0A 3HVRA 3P83D 3JYTA 4FCYA 4DU3A 3S9HA 3PX6A 3AA4A 3AVIA 1KRPA 2A1RA 5CZ1A 2Z1IA 5FROA 3OS2A 2B6AA 3RTVA 3TANA 1L5UA 1C0MA 2FBVA 1TKXA 1D9FA 3VQAA 3NGIA 3HJFA 1X1PA 4O5BA 4KKOA 1KLNA 3VA0A 2YNHA 3OYNA 3ALYA 3PO4A 3K57A 3OYCA 4FM0A 2P51A 1FK9A 1VRTA 2IGIA 2YNIA 1KVAA 4O55A 4E3SA 2G8IA 1YVUA 4ELVA 1VSEA 3ULDA 2F8TA 4ELUA 3QNOA 4OPJA 3TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K5L A;  2HHW A;  4CEF A;  1ITG A;  4N47 A;  4E7I A;  3IRX A;  4J2A A;  1TVR A;  3VQE A;  2BGG A;  1XWL A;  3K2P A;  4GW6 A;  5CY4 A;  1JLC A;  3V81 A;  2DFE A;  2VG7 A;  3OYG A;  2VWJ A;  1U45 A;  1JLE A;  1VSD A;  3MXI A;  2P1J A;  1UA0 A;  1L3U A;  4OKK A;  4AHU A;  5JS1 A;  3PX4 A;  5I42 A;  3MEC A;  3SUO A;  1WAF A;  3O3H A;  3VQ9 A;  4IDK A;  4C8M A;  1HMV A;  4FJM A;  1L3T A;  1ZBI A;  3TAB A;  3LAM A;  4DTU A;  4Z4I A;  1S1W A;  4E7L A;  4CES A;  4BDZ A;  4K8Z A;  3DOK A;  1FXX A;  2DFH A;  3V6D A;  3OYF A;  3AVF A;  3LZI A;  4AHR A;  2HVH A;  1NJX A;  3EZ5 A;  4LD0 A;  1BI4 A;  2G8K A;  2D0A A;  3SI6 A;  4FJ9 A;  3PX0 A;  4NCG A;  1XC9 A;  1QSL A;  1S9G A;  4FK2 A;  1EXQ A;  3SPZ A;  3V1O A;  1YTU A;  4W5R A;  4B08 A;  3TAG A;  4MFB A;  1YTA A;  4KHQ A;  3U3G A;  4DLG A;  3OYA A;  2KZM A;  1BIS A;  2OPS A;  1S1X A;  5J2Q A;  1HRH A;  3O3G A;  1JL1 A;  1TK0 A;  3C6T A;  4KO0 A;  4ZHR A;  1S6P A;  4DQI A;  3RR8 A;  3D0P A;  3M8R A;  3M8P A;  4DLE A;  4CHN A;  3SQ4 A;  3TAM A;  4C8K A;  2HNY A;  3RMA A;  3C95 A;  1RBT A;  3T19 A;  4N76 A;  4M3W A;  3VQB A;  2ETJ A;  3NAE A;  3WNF A;  1JLF A;  1K6Y A;  1TV6 A;  1WSH A;  4DTN A;  4CED A;  4CJP A;  3THV A;  3V9W A;  1JKH A;  3ZSO A;  4DTR A;  3KTQ A;  3K5M A;  1VSM A;  5J2P A;  3KD1 E;  1I39 A;  4CK3 A;  1HQE A;  1JXE A;  4Z4F A;  3L3U A;  4CJ3 A;  1QTM A;  2IOC A;  2R7Y A;  1LWF A;  3VQ6 A;  2Z1G A;  3FFI A;  3ISN C;  1NOY A;  1RT5 A;  4F2R A;  1BGX T;  1FKO A;  1C1C A;  3AVJ A;  1TK5 A;  3V9X A;  1Z25 A;  5HRR A;  3LWL A;  3K5N A;  3AVN A;  3SV3 A;  4DU1 A;  1L3S A;  2RF2 A;  2JLE A;  4LSL A;  4AHS A;  1CXQ A;  4FJJ A;  1NK7 A;  1REV A;  2KW4 A;  4HUE A;  1HYS A;  4ID1 A;  1LW0 A;  1RT6 A;  1MU2 A;  3ITH A;  4KV8 A;  3V1Q A;  1N6Q A;  3OYL A;  4W5Q A;  2G8F A;  4DSJ A;  1EP4 A;  2X6N A;  4AHT A;  4E7K A;  3AVM A;  3OYD A;  3QIO A;  2HNZ A;  5I3U A;  3AO2 A;  3RMB A;  1WSJ A;  4ICL A;  4FJ8 A;  3LP1 A;  1RT4 A;  3DYA A;  1ASW A;  4M45 A;  4BE2 A;  2PYL A;  1XI1 A;  4R5P A;  4NYN A;  4CJR A;  4KAZ A;  3CYM A;  4CJ5 A;  3VQQ A;  4NCB A;  1SL0 A;  3SQ1 A;  3RRG A;  4KHU A;  3NFA A;  1Z26 A;  5DK5 A;  4CEO A;  3I8D A;  4DFM A;  4DFP A;  3AVL A;  3VQC A;  4FLV A;  4FZX C;  4CJV A;  3KLI A;  4BE1 A;  3L2Q A;  1EX4 A;  4DQQ A;  4BWM A;  3SQ2 A;  2HMI A;  2DY4 A;  3TAR A;  3IG1 A;  2HB5 A;  1S6Q A;  2F96 A;  3KLG A;  3NF9 A;  3ZSZ A;  3C94 A;  4BAC A;  3OYI A;  4H4M A;  4PQU A;  5KRS A;  3HPG A;  4B9L A;  3AVA A;  4FW2 A;  4RW7 A;  3I0R A;  4EZ9 A;  4AH9 A;  1QS4 A;  1HQU A;  3LPU A;  5HRO A;  1NK8 A;  1SL1 A;  3VQD A;  4B9U A;  1W9H A;  2HW3 A;  3B6O A;  4B9N A;  1B92 A;  1J53 A;  4E0D A;  3LP0 A;  1VSF A;  1I3A A;  2D5R A;  3L2R A;  3HP9 A;  1B9F A;  4PA1 A;  3DLB A;  3MXJ A;  2WOM A;  4O4G A;  4CEZ A;  4KRF A;  3QO9 A;  2LSN A;  4CHP A;  4JRQ A;  3RWU A;  4CCH A;  3LAK A;  1WN7 A;  1HNI A;  1GOB A;  2VG6 A;  3DMJ A;  1DTQ A;  3EYZ A;  1IH7 A;  3AO4 A;  1RBS A;  1JLA A;  4CIE A;  3TAQ A;  2FBY A;  4DSL A;  3V1R A;  4CEC A;  4FLX A;  4CHY A;  3PY8 A;  3L2V A;  1Q9Y A;  4OPK A;  1KFS A;  3VA3 A;  1S1U A;  4M3Y A;  1EET A;  1VSH A;  2EHG A;  3HVT A;  3HT3 A;  2F8S A;  4CER A;  4CJF A;  1XHZ A;  4ID5 A;  3O4Q A;  3KIO A;  3OVN A;  1JLB A;  1RT1 A;  3ZSQ A;  3AO3 A;  2X78 A;  4OJR A;  2QXF A;  5EU7 A;  4KHY A;  2HHT A;  1LW2 A;  1UA1 A;  3SCX A;  1A5V A;  4DTO A;  1S9E A;  1RT7 A;  4FVM A;  4O0J A;  3ZSX A;  3PO5 A;  4OLB A;  2JGU A;  1VSL A;  4M3Z A;  4CGG A;  4I7F A;  4MQ3 A;  1RTI A;  4CGD A;  1NK6 A;  1IG9 A;  4ELT A;  4W5O A;  1EKE A;  1RTD A;  5E41 A;  4DQS A;  5FDL A;  1TAU A;  3NH1 A;  1U04 A;  4FK0 A;  2G8V A;  3AVB A;  4CGF A;  3SNN A;  3D45 A;  2O4G A;  3NCI A;  1SV5 A;  3NE6 A;  4B9V A;  1IKY A;  2OPP A;  4Z4C A;  4CGI A;  4WE1 A;  2ZD1 A;  1TAQ A;  4KI6 A;  1ASV A;  3G0Z A;  3SUP A;  3OYM A;  4KHS A;  3KLF A;  5SZT A;  3ZSW A;  2QKB A;  2BAN A;  4M3X A;  1T8E A;  1KTQ A;  1NK0 A;  4FJK A;  1RDC A;  4CEA A;  5HLF A;  1RBU A;  3KKS A;  1WSF A;  1D5A A;  1KVB A;  4BDY A;  4IFV A;  1J9A A;  5KRT A;  5KGX A;  3LDS A;  1HYZ A;  4FLT A;  2Z1H A;  1QE1 A;  1KCF A;  3PV8 A;  1WNS A;  4Z0U A;  1ZBF A;  3DRP A;  4KTW A;  4KRE A;  3QLH A;  4OGE A;  3IS9 A;  1T03 A;  4CEE A;  4CK1 A;  4I2Q A;  3LWM A;  4F3O A;  3QEP A;  1Q8I A;  4UQG A;  3RR7 A;  4QAG A;  4HVJ A;  3OJS A;  3AV9 A;  2ZQB A;  3DLG A;  2QK9 A;  5C25 A;  2RN2 A;  3P5J A;  4GVM A;  2IAJ A;  4M41 A;  4F2S A;  4CJU A;  3OS1 A;  4FJN A;  4B8C A;  3RMC A;  1X9S A;  4CHO A;  3QNN A;  3T1A A;  4H4O A;  2YNF A;  4LSN A;  4G1Q A;  1RTH A;  3ASM A;  1VSK A;  3ZSV A;  2OYQ A;  1BQM A;  1UAX A;  1QHT A;  4IG0 A;  3O4N A;  5JS2 A;  3ZT3 A;  1NJW A;  3KD5 E;  3SUQ A;  4B9T A;  2VG5 A;  4CEQ A;  2P5G A;  3L8B A;  3CG7 A;  4CF2 A;  4CHQ A;  3QET A;  1BCO A;  4Y1C A;  1A5W A;  3NGZ A;  2HHQ A;  3F9K A;  4OVL A;  1VSJ A;  2G8U A;  3QEI A;  1T7P A;  4N41 A;  1BCM A;  2NUB A;  3HL8 A;  1YT3 A;  4JS4 A;  2KFN A;  4DFJ A;  2BDP A;  1ASU A;  3SZ2 A;  3DLE A;  1UOC A;  2OPR A;  4CFA A;  4B9S A;  2FBT A;  4DF4 A;  3B6P A;  2IDO A;  4YNQ A;  3DLR A;  4OLA A;  1JLQ A;  4DSK A;  1IKV A;  2GBZ A;  1VSI A;  4KB1 A;  4CF9 A;  1C1A A;  4FM1 A;  2B4J A;  3DOL A;  3G10 A;  3OS0 A;  3LAL A;  2YV0 X;  3HM9 A;  3SJJ A;  4ZTJ A;  4QOZ B;  2AJQ A;  1BI4 B;  4KPY A;  1RDA A;  2I5J A;  4DS4 A;  3MEG A;  4NYF A;  1S1T A;  1X9W A;  3HK2 A;  1DTT A;  1RBV A;  1U4B A;  4DU4 A;  4DWI A;  3NGY A;  4CK2 A;  3JSM A;  1HYV A;  4AHC A;  1QSS A;  4FJG A;  1G15 A;  1SKW A;  1NOZ A;  4LY7 A;  1WSE A;  4RW8 A;  3L2W A;  4E7J A;  4J2B A;  1D9D A;  4Q0B A;  2A1S A;  1F21 A;  5FRM A;  1NK4 A;  4CGJ A;  4PY5 A;  3DRR A;  2X74 A;  3H08 A;  5C24 A;  3S3M A;  3M8Q A;  3A2F A;  3K58 A;  1WLJ A;  4CJ4 A;  3C6U A;  4CFB A;  4KI4 A;  3PUF A;  3I0S A;  4Y1D A;  1C0U A;  1UWB A;  3DM2 A;  1CZB A;  3S3O A;  4OKE A;  4CJW A;  3CFP A;  3IAY A;  3AVK A;  2HHU A;  4CIF A;  3AVG A;  2W42 A;  5HRP A;  3U3Y A;  4HHT A;  2OPQ A;  1J5O A;  2QKK A;  1SKS A;  4FZZ A;  3SQ0 A;  2Q3S A;  3QEW A;  2ZE2 A;  1U49 A;  1C1B A;  2PZS A;  2GV9 A;  5HRN A;  2D0C A;  1B9D A;  3QIP A;  4E89 A;  3HXM A;  1NKB A;  4FJX A;  4W5N A;  4C8N A;  3VQ4 A;  4FJL A;  5KTQ A;  3CM5 A;  2X6S A;  1Q9X A;  1J54 A;  4CF1 A;  1L3V A;  2D0B A;  5CYQ A;  3VQ5 A;  3V9S A;  4FJI A;  2IS3 A;  4DTM A;  2RKI A;  1TKT A;  2IC3 A;  3AA5 X;  4DSF A;  3OYJ A;  4FZY A;  1DLO A;  3RMD A;  4Z4G A;  1XHX A;  5CYM A;  4CEB A;  1LAW A;  1TK8 A;  1O1W A;  3OYH A;  4DTJ A;  2Y1I A;  3KKR A;  1W0H A;  4E19 A;  2BE2 A;  2KZZ A;  4FM2 A;  4HUG A;  2GUI A;  1GOA A;  3SYZ A;  1IKX A;  3HYF A;  1JLG A;  3ZT2 A;  5CZ2 A;  1RT3 A;  4N5S A;  3EY1 A;  3NHG A;  4EP5 A;  4DQP A;  2E6M A;  1LAV A;  2EX3 A;  1BL3 A;  5T7B A;  4BDP A;  3LPT A;  3TR8 A;  1IO2 A;  3VN5 A;  1LWC A;  4DMN A;  5KI6 A;  3WNH A;  1BIZ A;  1T05 A;  2FBX A;  4FW1 A;  1N5Y A;  2XY6 A;  4DSI A;  3BDP A;  3HO1 A;  4DSE A;  3SPY A;  3AA2 A;  1TKD A;  5C42 A;  1NKE A;  3DLH A;  1JL2 A;  4CJK A;  3RRH A;  4DS5 A;  2KQ2 A;  5FRN A;  5D3G A;  1WSG A;  1KSP A;  2G8H A;  3OY9 A;  4NCA A;  1BHL A;  4FYD A;  4YFU A;  4CIG A;  2XRI A;  1VRU A;  2HND A;  3OYK A;  4JLH A;  4KHW A;  4AIL C;  4CJT A;  1ZYQ A;  3QIN A;  1NJY A;  3TAE A;  3UIQ A;  4H8K A;  3K5O A;  3AVC A;  4RW6 A;  2OZS A;  4FK4 A;  4PUO A;  2KTQ A;  3NF8 A;  1RDD A;  5K14 A;  4HTU A;  2XY7 A;  3T3F A;  2G8W A;  4RW4 A;  4M3T A;  4LH4 A;  2DFF A;  2E4L A;  2YHB A;  4CF8 A;  2HHX A;  4CFD A;  1HNV A;  3LP2 A;  4KFB A;  3CFR A;  3QEV A;  2E6L A;  3HPH A;  5HBM A;  4FLW A;  1NK5 A;  4W5T A;  2FC0 A;  4J2E A;  4GMJ B;  4K8X A;  2ITG A;  4HUF A;  4J2D A;  3NBP A;  3ZCM A;  3M8S A;  2YHA A;  4Z4H A;  4ZTF A;  1GOC A;  4E1M A;  4JS5 A;  3DI6 A;  1S5J A;  3P1G A;  1RBR A;  4DTP A;  1QSY A;  4C8L A;  1U48 A;  3MED A;  3HST B;  3SUN A;  4QCL A;  3QES A;  3LP3 A;  2HHS A;  4CJQ A;  3KK3 A;  4JRP A;  1BIU A;  4F8R A;  1HJR A;  1ZBH A;  4RG8 A;  1WAJ A;  4CHZ A;  4F4K A;  4KB0 A;  2O4I A;  1ZBL A;  3DRS A;  3KJV A;  2PY5 A;  2YKM A;  1RCH A;  2P5O A;  1RNH A;  1KLM A;  4CE9 A;  3ZT1 A;  3MXM A;  4B3O A;  1R0A A;  4FJ5 A;  2YKN A;  2HHV A;  3NDK A;  4OGC A;  4CGH A;  4FLY A;  4DTX A;  4FJ7 A;  3O3F A;  1CLQ A;  4LH5 A;  5J2N A;  4IBN A;  3TAF A;  2XY8 A;  4DTS A;  1FKP A;  3AO5 A;  4KTZ A;  3NF6 A;  4HCC A;  2B5J A;  3K59 A;  3AVH A;  3V9Z A;  4EZ6 A;  3AO1 A;  2OZM A;  1D8Y A;  5J2M A;  4KHN A;  4DF8 A;  3HPO A;  1NKC A;  4HCB A;  3KLH A;  3U6F A;  1NJZ A;  2DTU A;  1A5X A;  4AHV A;  3NH0 A;  4RW9 A;  3F73 A;  1RIL A;  3SV4 A;  2XY5 A;  1CXU A;  3KK1 A;  3CFO A;  3E01 A;  4FJH A;  4I2P A;  1KVC A;  5HP1 A;  3VQP A;  1IKW A;  3QEX A;  3OJU A;  3ZSY A;  4FLZ A;  4B8A B;  4EP4 A;  4L8R B;  2ATQ A;  3WNG A;  4F3T A;  2KFZ A;  3CQ8 A;  1CZ9 A;  3NH2 A;  4DQR A;  4OKJ A;  1SUQ A;  1X9M A;  4BE0 A;  1RDB A;  3AA3 A;  4FLU A;  4IG3 A;  5HRS A;  3TI0 A;  4XIU A;  1BQN A;  5J1E A;  3KK2 A;  3ZT0 A;  1SL2 A;  2OA8 A;  4IKF A;  3QER A;  4KTQ A;  1JXB A;  1TL3 A;  1KFD A;  1U47 A;  4TSX A;  5KGW A;  4CJS A;  3MAQ A;  1QQC A;  4CFC A;  1SKR A;  4M42 A;  4Z4E A;  3ZSR A;  3V9U A;  3TAP A;  4FXD A;  1ZBU A;  2VWK A;  4CJL A;  3VQ8 A;  2YNG A;  3WNE A;  4O0I A;  3MEE A;  1VK0 A;  3L2U A;  4PWD A;  2WON A;  1C6V A;  3CM6 A;  3OYB A;  3L3V A;  2XO7 A;  2XHB A;  1WSI A;  1Y97 A;  3OYE A;  4C8O A;  4IFY A;  4M3U A;  2PYJ A;  3DLK A;  4I9L A;  4M3R A;  4N56 A;  1RTJ A;  3S3N A;  1TGO A;  3HP6 A;  1TKZ A;  3VQ7 A;  3KLE A;  2RPI A;  3LZJ A;  1HPZ A;  4DG1 A;  4E7H A;  4E1N A;  4Q5V A;  4B9M A;  4DFK A;  1C0T A;  3V4I A;  2HVI A;  4O44 A;  1LV5 A;  2Z1J A;  3LAN A;  1LWE A;  3NF7 A;  4I9Q A;  4CJE A;  1NK9 A;  4BWJ A;  3ZT4 A;  5SWM A;  1TL1 A;  1RT2 A;  3BGR A;  2Y1J A;  5DMR A;  1S1V A;  4CF0 A;  3HVR A;  3P83 D;  3JYT A;  4FCY A;  4DU3 A;  3S9H A;  3PX6 A;  3AA4 A;  3AVI A;  1KRP A;  2A1R A;  5CZ1 A;  2Z1I A;  5FRO A;  3OS2 A;  2B6A A;  3RTV A;  3TAN A;  1L5U A;  1C0M A;  2FBV A;  1TKX A;  1D9F A;  3VQA A;  3NGI A;  3HJF A;  1X1P A;  4O5B A;  4KKO A;  1KLN A;  3VA0 A;  2YNH A;  3OYN A;  3ALY A;  3PO4 A;  3K57 A;  3OYC A;  4FM0 A;  2P51 A;  1FK9 A;  1VRT A;  2IGI A;  2YNI A;  1KVA A;  4O55 A;  4E3S A;  2G8I A;  1YVU A;  4ELV A;  1VSE A;  3ULD A;  2F8T A;  4ELU A;  3QNO A;  4OPJ A;  3TWH A; 
#chains in the Genus database with same CATH topology
 1TUU A;  2HHW A;  1ITG A;  4E7I A;  3ZEU A;  1TVR A;  2P9N A;  3VQE A;  3OBW A;  5AQF A;  3JAM O;  3V81 A;  5B8H A;  3OYG A;  1QQO A;  3ENO A;  1VSD A;  3MXI A;  4DV1 K;  5I42 A;  3SUO A;  1WAF A;  1XMO K;  4IDK A;  1HMV A;  1L3T A;  1NMD A;  1ZBI A;  4Z4I A;  1GLD G;  1BO5 O;  3VEV A;  2DFH A;  2HVH A;  3AVF A;  4CZJ A;  3O9S A;  2A3Z A;  5GIP A;  2UYT A;  1VQN N;  1HPM A;  3B8A X;  2D0A A;  3THX B;  4X66 K;  4H5W A;  3GDQ A;  3G4S N;  3EE8 A;  3UE5 A;  2UUA K;  1YTA A;  4KHQ A;  3U3G A;  4OO1 J;  2FF3 B;  5J2Q A;  3O3G A;  4KO0 A;  1S6P A;  3RR8 A;  3D0P A;  4CHN A;  1QZ5 A;  1HKB A;  1OVY A;  2YCH A;  4FPB A;  3C95 A;  4EHU A;  1QHA A;  3WNF A;  1JLF A;  1GLB G;  1IG8 A;  1C0G A;  2O8B A;  1KD1 O;  3ZSO A;  3KTQ A;  5GIO A;  1VSM A;  2VGN A;  5J2P A;  4CK3 A;  1JXE A;  5DM6 L;  1QTM A;  2Z1G A;  1OKJ A;  1HKG A;  2ASP A;  2ASO A;  1C1C A;  3V9X A;  1Z25 A;  3K5N A;  1P8Z A;  4LF8 K;  1NMN A;  3M6G A;  4FJJ A;  1G99 A;  1CXQ A;  1X3N A;  5AFU H;  3IDH A;  4HUE A;  4ID1 A;  1LW0 A;  4KV8 A;  2G8F A;  3CME N;  3O9Q A;  3E9O A;  2X6N A;  3J7Z O;  3EN9 A;  1WSJ A;  4ICL A;  3DYA A;  4M45 A;  3O8M A;  1XI1 A;  3N4Q A;  2UXB K;  2E2Q A;  4NCB A;  5KPR A;  4KHU A;  3NFA A;  2FSK A;  4JHD B;  4CEO A;  4DFP A;  3AVL A;  3VQC A;  4CJV A;  3KLI A;  4YDU A;  2DY4 A;  3IG1 A;  1JCG A;  2F96 A;  1YXQ A;  3CCS N;  4RCH A;  4BRM A;  4B9L A;  4C1N K;  4RW7 A;  2QEX N;  1NK8 A;  4YOR A;  2ZGY A;  4JKB A;  1SL1 A;  3VQD A;  4LFA K;  3HM8 A;  1IV0 A;  1T6C A;  3LP0 A;  1VSF A;  4CZG A;  3HP9 A;  4DHY A;  3DLB A;  1R59 O;  4CCH A;  3LAK A;  1GOB A;  3VEN A;  1DTQ A;  2CH6 A;  4NLB A;  5AFU A;  1RBS A;  5M1Q A;  4DSL A;  4BR5 A;  4IOA L;  5FPE A;  5AZI B;  1KFS A;  1EET A;  1VSH A;  2F8S A;  2NZT A;  3A5O C;  3OVN A;  2X78 A;  4OJR A;  2HHT A;  3SCX A;  1TYQ A;  3SBT A;  3ZSX A;  4O0J A;  3Q7C A;  4I7F A;  1N36 K;  1RTI A;  4IZ9 A;  4ELT A;  5AQX A;  3FZM A;  4W5O A;  2ZM6 K;  1RTD A;  5E41 A;  1WBB A;  2P9S A;  4FK0 A;  2G8V A;  3A5N C;  2NRT A;  1IKY A;  4BGA A;  4CGI A;  5AQL A;  3G0Z A;  3OYM A;  4BRO A;  5IWA K;  1GLF O;  3A8Y A;  2YX6 A;  2BAN A;  4CZL A;  5BPN A;  1BOT O;  1KTQ A;  1NK0 A;  4Y0W A;  4FJK A;  1RDC A;  4JI7 K;  5HLF A;  3KKS A;  1WSF A;  1J9A A;  1HYZ A;  2PAV A;  4HTL A;  1KCF A;  2NRX A;  1ZBF A;  4NXN K;  4KTW A;  4YY3 K;  4NB4 A;  5M1N A;  5E84 A;  4OGE A;  4J8F A;  1XC3 A;  3SAG A;  3LWM A;  4BR7 A;  4GY2 B;  4QAG A;  4IWV A;  1C0F A;  2ZQB A;  3DLG A;  3VEW A;  2IAJ A;  4CJU A;  3OS1 A;  4FJN A;  1NGG A;  3QNN A;  3N4P A;  3T1A A;  5JVG L;  2P9K B;  1NLV A;  4LSN A;  1RTH A;  4FWM A;  2OYQ A;  4CBW A;  3CC2 N;  3LL3 A;  4DR5 K;  4H5N A;  4FPA A;  5C2F A;  4CHQ A;  3QET A;  1N32 K;  4WQ4 A;  1BCO A;  4Y1C A;  2HHQ A;  3UKR B;  1VSJ A;  2QWM A;  1VQ8 N;  2F4V K;  4N41 A;  1BCM A;  2QWL A;  2BDP A;  1ASU A;  4BGB A;  1UOC A;  2FBT A;  2Q36 A;  4YNQ A;  3DLR A;  1BG3 A;  1X9J A;  3TSQ A;  4CF9 A;  3ZET A;  4B3S K;  1HUX A;  3LAL A;  3HM9 A;  2AJQ A;  1BI4 B;  4DS4 A;  1D4X A;  3A5M C;  3U9D A;  1DTT A;  1U4B A;  4DWI A;  2QI2 A;  2E8A A;  3JSM A;  1QSS A;  4B1U B;  2HBK A;  1SKW A;  4DQ8 A;  4LY7 A;  1D9D A;  5C24 A;  4JN4 A;  3L4Q A;  3M8Q A;  3O08 A;  4CJ4 A;  3THY A;  5AQO A;  4KI4 A;  3O9T A;  1CZB A;  5EVZ A;  3THW B;  2W42 A;  5HRP A;  3SQ0 A;  2Q3S A;  2NRR A;  5HRN A;  4BY9 C;  4FJX A;  4W5N A;  4C8N A;  5C15 A;  4O8U A;  2X6S A;  2O8E B;  1YF5 L;  1L3V A;  5CYQ A;  3V9S A;  5KQ8 A;  3AA5 X;  3CQX A;  1XHX A;  1XQS C;  3OYH A;  4DTJ A;  2Y1I A;  1W0H A;  4EAH D;  3H45 C;  4M7X A;  4HUG A;  1GOA A;  1IKX A;  3GL1 A;  1JLG A;  3NHG A;  4N5S A;  3CJA A;  1LAV A;  2QWN A;  2D4W A;  3LPT A;  3TR8 A;  1IO2 A;  5KI6 A;  1BIZ A;  2FBX A;  3D7E O;  4DSI A;  2W40 A;  4AF1 A;  5LJW A;  4DSE A;  2AA4 A;  3RSE A;  3DLH A;  2WUS A;  4CJK A;  2G8H A;  2D0O A;  3W3D A;  4NCA A;  1E4F T;  4IJA A;  3O5B A;  2VQE K;  3ZYY X;  1VRU A;  2HND A;  1ZYQ A;  3QIN A;  3VET A;  3UIQ A;  4H0P A;  4H8K A;  2Q31 A;  4PUO A;  2KTQ A;  4LF6 K;  3RVC A;  3CET A;  3R8E A;  4U7B A;  4M3T A;  3VGM A;  4KFB A;  1HLU A;  3CFR A;  3QEV A;  4DR6 K;  1NK5 A;  2HMP A;  2YHW A;  4J2E A;  4GMJ B;  4J2D A;  1N33 K;  2YHA A;  4FWK A;  4E1M A;  4JS5 A;  3DI6 A;  1QSY A;  1DKG D;  3HST B;  3R1X A;  3ULE B;  3SUN A;  3DLL L;  2HHS A;  3G71 N;  1BIU A;  1NGJ A;  1HJR A;  4F8R A;  1ZBH A;  1WAJ A;  4IOC L;  2FLO A;  1ZBL A;  4IOX A;  1RCH A;  2P5O A;  3MN9 A;  1KLM A;  1HX1 A;  4FJ5 A;  4FJ7 A;  4IBN A;  1ESV A;  1FKP A;  3AO5 A;  4JKD A;  4BRQ A;  2D0P A;  4HCC A;  1OH6 A;  1D8Y A;  2GWJ A;  5GAD P;  3U6F A;  2DTU A;  1ATN A;  3QB0 A;  3KK1 A;  3MMV A;  4DR3 K;  5AQV A;  4FJH A;  3SJH A;  1IKW A;  3CHW A;  3DXK A;  2Q0U A;  4B8A B;  4L8R B;  4F3T A;  2KFZ A;  4BQZ A;  3EO3 A;  1X9M A;  3TI0 A;  3PLA A;  3CQY A;  3KK2 A;  3UKU B;  1SL2 A;  4DV7 K;  1JXB A;  2QWO A;  1JJ2 M;  3HRG A;  5KGW A;  4Z4E A;  4XH1 A;  2GWK A;  4CFC A;  3ZSR A;  3PSF A;  4FXD A;  2VWK A;  2YNG A;  4PWD A;  4C8O A;  3VTH A;  4IFY A;  3DLK A;  3C6A A;  1TGO A;  3KLE A;  2RPI A;  4CZH A;  4E7H A;  4DG1 A;  2OAN A;  2A42 A;  4Q5V A;  4DFK A;  4O44 A;  1TUY A;  3NF7 A;  5BRF A;  1Q7Y O;  1RGI A;  3ZT4 A;  2E1Y A;  1TL1 A;  1VQL N;  4DU3 A;  3PX6 A;  1DGK N;  2IVO A;  1KRP A;  3RTV A;  5JVH L;  5A2Q O;  4DB3 A;  4KH5 A;  1TKX A;  4BRG A;  1D9F A;  1X1P A;  1K8A O;  1VQ6 N;  4KKO A;  4IO8 A;  3ALY A;  1OH8 A;  3KVG A;  1I94 K;  3A0I X;  3EZW A;  2IGI A;  5BRE A;  1KVA A;  4ELV A;  3HZ6 A;  4ELU A;  3TWH A;  2A5X A;  4CD1 A;  3K5L A;  4N47 A;  2P9P B;  3SAF A;  1U45 A;  2VG7 A;  2P1J A;  3J7A P;  4AHU A;  2VWB A;  5JS1 A;  3PX4 A;  2W6L A;  3VQ9 A;  2IVP A;  5AZJ B;  4C8M A;  3EKU A;  3LM2 A;  4FJM A;  3TAB A;  3LAM A;  4FO0 A;  1OH5 A;  3V6D A;  4DV2 K;  2FSJ A;  3M1F A;  4MO4 A;  3CJ7 A;  4JI2 K;  2KKZ A;  1DT9 A;  1QSL A;  1QVF M;  1EXQ A;  2O8C A;  3TAG A;  4DLG A;  3CER A;  5BPL A;  2KZM A;  2P9U A;  2HBM A;  1JL1 A;  4CZE A;  2UU9 K;  1ATR A;  4A5B A;  1K8K B;  4DLE A;  2ZWH A;  4FOE A;  4C8K A;  2HNY A;  5TKY A;  1RBT A;  3T19 A;  1HNX K;  2ITM A;  5BRD A;  3VQB A;  1WB9 A;  4M3W A;  3NAE A;  1M1K O;  1TV6 A;  3I8B A;  4CED A;  4CJP A;  3THV A;  1JKH A;  3H1Q A;  5KPT A;  3L3U A;  4CJ3 A;  2IOC A;  2R7Y A;  1LWF A;  2QWQ A;  3VQ6 A;  2JWK A;  3AVN A;  3D2F B;  2JLE A;  2WFB A;  3I55 N;  1T3V A;  1RT6 A;  2CGJ A;  1EP4 A;  4AHT A;  4E7K A;  3O1B A;  3T69 A;  2HNZ A;  3VMF B;  3AO2 A;  2OTJ N;  2WBN A;  1RDW X;  3LP1 A;  1RT4 A;  4OPA A;  1ASW A;  3ZLJ A;  1S72 N;  1YJN N;  4R5P A;  4JK8 A;  4B3R K;  4CJ5 A;  1NGC A;  3C0B A;  1SL0 A;  1YHQ N;  1VQ4 N;  4DQQ A;  1EX4 A;  1S6Q A;  3KLG A;  3ZSZ A;  3C94 A;  3QBW A;  3OYI A;  4H4M A;  5KQD A;  4PQU A;  1QZ6 A;  3HPG A;  3O80 A;  4FW2 A;  3I0R A;  4AH9 A;  1QS4 A;  4LF5 K;  4B9U A;  3HBT A;  3PSI A;  4B9N A;  4IFE A;  1B92 A;  4FWO A;  2V52 B;  4JKH A;  4DR7 K;  2D5R A;  1B9F A;  2IIR A;  2WOM A;  2GEM A;  3QO9 A;  4CHP A;  3H6E A;  3THX A;  3RWU A;  5I9E B;  3K0S A;  1WBD A;  3NVM A;  3DMJ A;  3EYZ A;  3AO4 A;  1N8R O;  4NLC A;  5AQY A;  3P39 A;  3VA3 A;  3D2E B;  4M3Y A;  5FPN A;  3HVT A;  2Q1N A;  1XHZ A;  3O4Q A;  3VPZ A;  3ZSQ A;  4FSV A;  2YJF A;  4H5T A;  1QQN A;  5EU7 A;  1LW2 A;  1UA1 A;  3CCE N;  1A5V A;  4DTO A;  2GEL A;  3VES A;  1RT7 A;  4FVM A;  5JMV A;  4PL7 A;  2JGU A;  1V4S A;  3J7Y P;  4GKJ K;  1IG9 A;  1EKE A;  5FDL A;  3SNN A;  3D45 A;  2O4G A;  3NCI A;  1SV5 A;  4Z4C A;  1Y64 A;  4WE1 A;  5BR8 K;  2ZD1 A;  1TAQ A;  1IBK K;  4KI6 A;  1NBW A;  3SUP A;  4KHS A;  3SMP A;  5SZT A;  2QTD A;  3ZSW A;  2QKB A;  5GAH P;  4M3X A;  1T8E A;  4ISG A;  2P9I B;  4G9Z A;  3CCR N;  3OW2 M;  1KVB A;  4IFV A;  3LDS A;  3PV8 A;  4Z0U A;  1H1V A;  4H5V A;  4KRE A;  1T03 A;  4CK1 A;  4I2Q A;  4F3O A;  4JHD A;  5EX5 A;  3TTC A;  4UQG A;  3CCL N;  4I6M B;  4HVJ A;  2E2O A;  3AV9 A;  1K9M O;  1ILY A;  2KLA A;  2RN2 A;  3P5J A;  4GVE A;  4CZK A;  4X62 K;  4MLH A;  4CHO A;  3AGK A;  1X9S A;  3ASM A;  1VSK A;  2V51 B;  1V4T A;  1BQM A;  4IG0 A;  1QHT A;  1J6Z A;  1UAX A;  5JS2 A;  3ZT3 A;  4B1W B;  3GOI A;  4CEQ A;  2P9N B;  2HF3 A;  3SMS A;  5AQS A;  3CF5 L;  4JK9 A;  3F9K A;  3DAW A;  1M90 O;  1T7P A;  3HL8 A;  2E2P A;  1YT3 A;  4F9O A;  3CJ1 A;  3DLE A;  4YHH K;  2OPR A;  4CFA A;  3O9U A;  3CCQ N;  3T1H K;  1JLQ A;  3CPE A;  3G10 A;  3PIO L;  3OS0 A;  4IXC A;  4BVP A;  1SAZ A;  2I5J A;  3MEG A;  2I7N A;  4A2A A;  1S1T A;  1X9W A;  3VEO A;  1RBV A;  3NGY A;  4GKK K;  3U9Z A;  1NOZ A;  2PBD A;  3EKS A;  4J2B A;  3F2K A;  1NK4 A;  4CGJ A;  3O9R A;  3AGR A;  2NNW A;  3K58 A;  3IMX A;  1RFQ A;  4CFB A;  4Y1D A;  4B1Z A;  3DM2 A;  3S3O A;  4CJW A;  3IAY A;  3AVK A;  3ID6 A;  3AVG A;  4FZZ A;  4A5A A;  4JKA A;  3QEW A;  2ZE2 A;  1OVQ A;  3QIP A;  4E89 A;  4GV6 A;  5HOO A;  3E1Y A;  5AQH A;  3CM5 A;  4XH5 A;  3P31 A;  4AM6 A;  3MK6 A;  5BN8 A;  4FJI A;  1EQY A;  2RKI A;  4FZY A;  5GAE P;  4DR1 K;  3DWL A;  3RMD A;  4Z4G A;  1LAW A;  3ATU A;  1ZXO A;  3FZL A;  3IUC A;  2A40 A;  4BC3 A;  4FM2 A;  1GLJ O;  2A41 A;  2Q2R A;  3BF1 A;  3HYF A;  4H0V B;  2IVN A;  4ILH A;  2E6M A;  2EX3 A;  5AQK A;  4BDP A;  3VN5 A;  3HSC A;  3WNH A;  1T05 A;  4FW1 A;  1N5Y A;  2XY6 A;  1TKD A;  3SPY A;  1NKE A;  1JL2 A;  5FRN A;  5LMU K;  3LDL A;  4MDB A;  1KSP A;  3QFP A;  3OY9 A;  4FYD A;  4CIG A;  3UKR A;  2CH5 A;  4CJT A;  1SS6 A;  4FK4 A;  3AVC A;  3VGK A;  4YOX A;  3NF8 A;  5K14 A;  4HTU A;  1XNR K;  4RW4 A;  3WXL A;  4RWT A;  2E4L A;  2YHB A;  1HNV A;  1NGA A;  3VGL A;  3U8X A;  2ZF5 O;  4W5T A;  2FC0 A;  4K8X A;  3NBP A;  4JD2 B;  3ZCM A;  1K73 O;  4Z4H A;  4ZTF A;  1GOC A;  4C8L A;  1S5J A;  4DTP A;  1RBR A;  5CHI A;  4QCL A;  1IJJ A;  2H3G X;  3LP3 A;  3QES A;  3KK3 A;  1S22 A;  4DCH A;  3DRS A;  3KJV A;  1RNH A;  1TYQ B;  4CE9 A;  1NGH A;  1EWQ A;  2YKN A;  3NDK A;  3THW A;  4DTX A;  3O3F A;  2Q0R A;  4BC2 A;  4DTS A;  4BRE A;  4PHT X;  3K59 A;  3AVH A;  3V9Z A;  4EZ6 A;  2P9S B;  1Q86 O;  5F1X A;  3MCP A;  5AQW A;  2CGK A;  3NH0 A;  2O8E A;  1RIL A;  3SV4 A;  1CXU A;  3E01 A;  4FVU A;  5AQP A;  5HP1 A;  1MDU B;  3VQP A;  3QEX A;  3OJU A;  3D6R A;  3JXU A;  3WNG A;  4CBU A;  3NH2 A;  3HOT A;  3WUH A;  1RDB A;  4XIU A;  3CJ9 A;  4IKF A;  1YAG A;  4TSX A;  1SKR A;  3GE1 A;  3WEE B;  1BWF O;  1ZBU A;  3MEE A;  1VK0 A;  4FWN A;  2XO7 A;  3TTD A;  1WSI A;  1Y97 A;  3P4I A;  2OTL N;  4M3U A;  1RTJ A;  3ZX3 A;  1TKZ A;  5AQG A;  2FXU A;  4B9M A;  2HST A;  2Z1J A;  3J80 O;  4BVO A;  4CJE A;  4BWJ A;  4MO5 A;  1RT2 A;  1VQ5 N;  1S1V A;  4CF0 A;  3HVR A;  3CPW M;  3R6M A;  2A1R A;  2B6A A;  4LF4 K;  4K41 A;  3DJC A;  2D1K A;  3J81 O;  3VA0 A;  4BR4 A;  2HHH K;  3PO4 A;  4O55 A;  3ZET B;  5AQQ A;  4H0X B;  2G8I A;  1YVU A;  3EEQ A;  3QNO A;  4OPJ A;  4R79 A;  4H03 B;  3QFU A;  2E1Z A;  4J2A A;  3S41 A;  3C65 A;  1JLC A;  4CZI A;  2VWJ A;  4ISE A;  4OKK A;  3BP8 A;  3DXM A;  3MEC A;  1NGB A;  3O3H A;  5AQU A;  4C1N I;  3MWP A;  4DTU A;  3THY B;  4CES A;  1WOQ A;  3DOK A;  1U2V A;  1FXX A;  5C0Y A;  3OYF A;  4AHR A;  4H5R A;  3EZ5 A;  2G8K A;  4FJ9 A;  3SK3 A;  4NCG A;  3PX0 A;  1S9G A;  4FK2 A;  3OA9 A;  3SPZ A;  4JKG A;  1YTU A;  4W5R A;  4B08 A;  3EL2 A;  1S3X A;  3OYA A;  1MA9 B;  2OPS A;  1HRH A;  2DPN A;  4IO9 L;  3C6T A;  3M8P A;  3TAM A;  3RMA A;  2F9W A;  2I7P A;  3FLC O;  4BRL A;  4N76 A;  4BRI A;  1YVN A;  2ETJ A;  4WQ5 C;  4DTN A;  2O8F B;  3LDP A;  3V9W A;  4DTR A;  3KD1 E;  3K5M A;  4Z4F A;  4DR2 K;  1YI2 N;  1NOY A;  5LY3 A;  4F2R A;  1BGX T;  5F0X A;  3AVJ A;  1TK5 A;  2ZJP L;  3BUZ B;  4FWL A;  1SQK A;  3OBY A;  5ELZ A;  4DU1 A;  1L3S A;  4BRN A;  1NK7 A;  4LF7 K;  2F9T A;  3UB5 A;  1HYS A;  3ITH A;  3V1Q A;  1N6Q A;  3OYL A;  4W5Q A;  4DSJ A;  1YUW A;  5BR9 A;  3ID8 A;  3LM9 A;  3VTI A;  2PYL A;  4K42 A;  4BG9 A;  4CJR A;  1GLE G;  3CYM A;  4BRH A;  3SQ1 A;  4K43 A;  1GLL O;  5DK5 A;  4FLV A;  3L2Q A;  4BWM A;  3BY5 A;  3KWI A;  3NF9 A;  4BAC A;  3BZC A;  1NGD A;  2P9P A;  2YI1 A;  5KRS A;  3AVA A;  2VQF K;  5HRO A;  2BUP A;  2ZJQ L;  5AZJ A;  1X3M A;  2HW3 A;  3VEZ A;  3FGU A;  1EO1 A;  1J53 A;  3C7N B;  4PA1 A;  3MXJ A;  4KRF A;  4O4G A;  4JRQ A;  3R9P A;  5DM7 L;  3L4I A;  1WN7 A;  1J5E K;  1HNI A;  3U4L A;  2VG6 A;  3ZX0 A;  3MX5 A;  2W41 A;  5JIC A;  1JLA A;  4CIE A;  3V1R A;  1XMQ K;  4CEC A;  4FLX A;  3PY8 A;  3L2V A;  1Q9Y A;  4OPK A;  4FL9 A;  4XH4 A;  3HT3 A;  4CER A;  1NNE A;  4CJF A;  4ID5 A;  3JS6 A;  1W2B M;  2QXF A;  3MN6 A;  2YJE A;  4OLB A;  3OTO K;  4M3Z A;  4MQ3 A;  4DR4 K;  1NK6 A;  3WT0 A;  4DV5 K;  2E5L K;  1TAU A;  1U04 A;  5F2R A;  3AVB A;  3SLC A;  4GV3 A;  4B9V A;  2O8D B;  4Z94 A;  1NWK A;  4JI5 K;  4IEE A;  4WF9 L;  1ASV A;  4X65 K;  1IBM K;  3KLF A;  1BA1 A;  3MDQ A;  3MWT A;  4JEP A;  4CEA A;  1KC8 O;  1RBU A;  4BDY A;  1D5A A;  5KRT A;  1QE1 A;  1WNS A;  3DRP A;  5EXW A;  3TPQ A;  4M63 C;  3IS9 A;  3CJC A;  4CEE A;  2QWR A;  1Q8I A;  3RR7 A;  3OJS A;  5C25 A;  4LF9 K;  4B8C A;  3BZK A;  4DUZ K;  1IBL K;  4QS7 A;  4H4O A;  2YNF A;  3WXM B;  4G1Q A;  4B1V A;  1KQS M;  3QML A;  3OHR A;  4WFA L;  3TTF A;  2VG5 A;  1QVG M;  2P5G A;  1Z05 A;  3L8B A;  4EIA A;  2A6A A;  3E9P A;  1A5W A;  3NGZ A;  4CW7 B;  2G8U A;  1ZBS A;  4JI3 K;  2CGL A;  3I33 A;  4JS4 A;  2NUB A;  2KFN A;  5FPM A;  4B9S A;  4ILG B;  4DF4 A;  4OLA A;  3FZH A;  2WTU A;  4DSK A;  1IKV A;  2GBZ A;  2WC9 A;  4KB1 A;  1C1A A;  4FM1 A;  2B4J A;  4ZTJ A;  3SJJ A;  4QOZ B;  3A5L C;  1NJI O;  4NYF A;  4JNE A;  4BG8 A;  2O8C B;  4YDU C;  4KH6 A;  1HYV A;  1NU0 A;  1G15 A;  4LC9 B;  3L2W A;  1WSE A;  4E7J A;  2P9L B;  2VCP A;  2A1S A;  2GUP A;  4IDH A;  3DRR A;  2X74 A;  2QWP A;  3A2F A;  1WLJ A;  3C6U A;  3PUF A;  1UWB A;  4JI6 K;  4OKE A;  3CFP A;  1ZC6 A;  1ATS A;  2RHK A;  4HHT A;  2QKK A;  4OPH A;  1J5O A;  1SKS A;  4GNI A;  3QDK A;  4B1X B;  2PZS A;  2GV9 A;  3F5T A;  4FWS A;  1B9D A;  1NKB A;  3VQ4 A;  4WCE L;  4FJL A;  1T44 A;  1J54 A;  2P9I A;  4CF1 A;  3MCA B;  1HNZ K;  4H0Y B;  3T7Z A;  2IC3 A;  4KHP K;  3VF2 A;  4ISF A;  1KAX A;  3GG4 A;  3F9M A;  3O1W A;  5CYM A;  1TK8 A;  1VAZ A;  2PFU A;  4E19 A;  4I6M A;  2GUI A;  3SYZ A;  2NRZ A;  3O4W A;  1HNW K;  1RT3 A;  3EY1 A;  4DQP A;  3BF3 A;  2UUC K;  2YHX A;  1BL3 A;  3CMA N;  3CCM N;  2E20 A;  4DMN A;  4CZM A;  5C42 A;  1HKC A;  4YFU A;  4JI0 K;  2W6K A;  2XRI A;  4A2B A;  3OYK A;  4JLH A;  4KHW A;  4AIL C;  1EWR A;  2FSN A;  4BRD A;  5GAG P;  4AM7 A;  3AY9 A;  3K5O A;  4RW6 A;  3T1Y K;  1OH7 A;  1RDD A;  2XY7 A;  3VOV A;  2G8W A;  3FZK A;  5KPZ A;  4CF8 A;  2HHX A;  4CFD A;  3LP2 A;  4DV4 K;  5HBM A;  4CJ7 A;  2ITG A;  4HUF A;  1KAY A;  3KHY A;  3L0Q A;  2VGM A;  4JI1 K;  4JRP A;  1W97 L;  4CHZ A;  4F4K A;  4YOT A;  2O4I A;  2PY5 A;  2YKM A;  3ZEU B;  2YHY A;  1VQK N;  4B3O A;  1R0A A;  2HHV A;  4FLY A;  4OGC A;  4WQ4 C;  1CLQ A;  4O8K A;  4FWP A;  4DKW A;  4CD3 A;  4KBO A;  2B5J A;  4K25 A;  3AO1 A;  3WQU A;  2KHO A;  5J2M A;  4DF8 A;  3HPO A;  4DUY K;  4AHV A;  5AZI A;  3F73 A;  2XY5 A;  4I2P A;  1KVC A;  5M1O A;  2UXC K;  4E1J A;  4PKG A;  3ZSY A;  4FLZ A;  4EP4 A;  4BR9 A;  1LOT B;  2ATQ A;  3H3O B;  4A61 A;  4A59 A;  4PL8 A;  3CQ8 A;  3CCJ N;  3CD6 N;  3LDO A;  4OKJ A;  4A62 A;  3KWG A;  3AA3 A;  4JK7 A;  1BQN A;  2OA8 A;  4B3T K;  4B9Q A;  1TL3 A;  4JKC A;  1U47 A;  2BH1 A;  1QQC A;  4M42 A;  2ZGZ A;  5AQM A;  3V9U A;  3TAP A;  4CJL A;  4C23 A;  3VQ8 A;  3WNE A;  4O0I A;  3L2U A;  4JAX A;  1BU6 O;  3CM6 A;  1C6V A;  3OYB A;  2O8B B;  3S3N A;  4M3R A;  5AJ3 K;  5IT9 O;  3HP6 A;  2OCE A;  3LZJ A;  3CCV N;  4K0K K;  4E1N A;  1E4G T;  1LV5 A;  3IKM A;  4WFN L;  1LWE A;  1KAZ A;  3Q7B A;  3C6H A;  2UXD K;  3BGR A;  4BC4 A;  4QS8 A;  2BTF A;  3P83 D;  4B3M K;  3OS2 A;  4YOY A;  1L5U A;  1YIJ N;  3HTV A;  2FBV A;  3M5R A;  3NGI A;  3VF4 A;  3FFK B;  2HF4 A;  3HJF A;  4MDA A;  4JD2 A;  3E66 A;  4FM0 A;  2P51 A;  1NGE A;  2P9K A;  4E3S A;  1YIT N;  1VSE A;  3ULD A;  1KXP A;  4YOU A;  1XUP O;  5M1K A;  4CEF A;  3IRX A;  1FW6 A;  4HWI A;  2BGG A;  1XWL A;  3K2P A;  4GW6 A;  5CY4 A;  2DFE A;  1JLE A;  1UA0 A;  1L3U A;  4GV9 A;  3MN5 A;  2HOE A;  1S1W A;  2HBL A;  4E7L A;  4BDZ A;  1GLA G;  2VYP A;  4K8Z A;  3LZI A;  1NJX A;  4LD0 A;  1BI4 A;  1P90 A;  3SI6 A;  1MWK A;  1XC9 A;  2GX9 A;  3CC7 N;  3V1O A;  3H1V X;  4MFB A;  1BIS A;  1S1X A;  4DV6 K;  1TK0 A;  4UY8 O;  4ZHR A;  4DQI A;  3M8R A;  3SQ4 A;  1VQM N;  3ATV A;  3WEE A;  4CVN E;  1JCF A;  1K6Y A;  1WSH A;  2NRV A;  3PIP L;  5EOY A;  1I39 A;  1HQE A;  3K9K A;  3ISN C;  3FFI A;  2J4R A;  5AQT A;  2V7Z A;  1RT5 A;  4XEI A;  1QQM A;  1FKO A;  4X64 K;  1VHX A;  5HRR A;  3LWL A;  3G25 A;  2F7T A;  5LL6 Z;  3SV3 A;  1Q18 A;  2RF2 A;  4LSL A;  4AHS A;  4JKF A;  1WUA A;  1REV A;  2KW4 A;  3CCU N;  1MU2 A;  4FWQ A;  3AAQ A;  4LFC K;  3AVM A;  5C2D A;  3QIO A;  3OYD A;  5I3U A;  3RMB A;  1Z6R A;  4FJ8 A;  4BQL A;  3ENB A;  3MN7 A;  4IJN A;  4BE2 A;  5CR4 A;  5LJV A;  4A57 A;  4DV3 K;  4NYN A;  4KAZ A;  3VQQ A;  1XNQ K;  2QA4 N;  3RRG A;  1Z26 A;  3I8D A;  4DFM A;  4FZX C;  4BE1 A;  3SQ2 A;  2HMI A;  3TAR A;  2HB5 A;  3NVK A;  2UUB K;  2JWL A;  4EZ9 A;  3IFR A;  3WQT A;  1HQU A;  4CI6 A;  3LPU A;  3KK7 A;  3SBG A;  4EFH A;  1Q82 O;  1W9H A;  3WXK A;  3CJB A;  3B6O A;  4FOI A;  4CBX A;  1NGI A;  4E0D A;  1I3A A;  2NLX A;  3L2R A;  4FWR A;  4CEZ A;  5BRH A;  2LSN A;  1CZA N;  3TU5 A;  4BRP A;  3BEX A;  4BRF A;  1IH7 A;  3TAQ A;  2FBY A;  4PKH A;  3O6W A;  4CHY A;  3ULE A;  1S1U A;  1DEJ A;  2EHG A;  3KIO A;  1JLB A;  1RT1 A;  4L3Q A;  3AO3 A;  4KHY A;  3VEY A;  4EHT A;  1S9E A;  4V19 S;  3PO5 A;  2O8F A;  1VSL A;  4CGG A;  4CZF A;  3VEX A;  4CGD A;  4DQS A;  3NH1 A;  2EWS A;  4CGF A;  3CXC M;  3NE6 A;  2OPP A;  4DV0 K;  3HOS A;  3CIP A;  2ASM A;  4RTF D;  5AQN A;  1O13 A;  1VQ9 N;  3QIC A;  3UKU A;  3WXI A;  5KGX A;  4FLT A;  2Z1H A;  1NG9 A;  3QLH A;  3QEP A;  4LFB K;  2NRW A;  3FE1 A;  2QK9 A;  3AAR A;  4GVM A;  4M41 A;  4F2S A;  1FJG K;  4MLE A;  3RMC A;  1VQO N;  4ILJ A;  5FPD A;  1U6Z A;  3ZSV A;  1BDG A;  1SZ2 A;  4AQY K;  3KD5 E;  2AP1 A;  3O4N A;  1NJW A;  3SUQ A;  3RSE B;  1MWM A;  4B9T A;  2V7Y A;  1Q81 O;  3CG7 A;  4CF2 A;  3K9J A;  3C7N A;  5FLX O;  3M3Z A;  4OVL A;  5AR0 A;  3QEI A;  3DXM B;  4DFJ A;  3SZ2 A;  5ADX H;  1BA0 A;  4JYA K;  3HI0 A;  3B6P A;  2IDO A;  1VSI A;  1U2V B;  3DOL A;  5AQZ A;  4BRA A;  2YV0 X;  4KPY A;  1RDA A;  5AQR A;  2FF6 A;  4PKI A;  3J8A A;  3HK2 A;  4JKG B;  3WXJ A;  4DU4 A;  4CK2 A;  4AHC A;  4FJG A;  4RW8 A;  4Q0B A;  3GBT A;  4H0O A;  4M7Y A;  1F21 A;  4BC5 A;  5FRM A;  4IEI A;  1VQP N;  4PY5 A;  5AQI A;  2QXL A;  3H08 A;  3S3M A;  1JCE A;  5C12 A;  5BN9 A;  5MLC Q;  3VER A;  3I0S A;  1C0U A;  2O8D A;  4YOV A;  2HHU A;  4CIF A;  3U3Y A;  3I56 N;  2OPQ A;  1GLC G;  1NGF A;  4YOW A;  1U49 A;  1C1B A;  2D0C A;  3HXM A;  3FR0 A;  3P38 A;  2E88 A;  3ZX2 A;  5KTQ A;  1Q9X A;  2D0B A;  3VQ5 A;  5TKW A;  4O5F A;  2IS3 A;  4DTM A;  1K8K A;  1TKT A;  4DSF A;  3OYJ A;  1DLO A;  5BPM A;  3DXK B;  5ADX A;  4CEB A;  4U67 L;  3FZF A;  1O1W A;  2QM1 A;  3KKR A;  2BE2 A;  2KZZ A;  5GIN A;  3W0L A;  3VF6 A;  2HBJ A;  3ZT2 A;  5CZ2 A;  3MX2 A;  3ENH A;  4EP5 A;  5M1F A;  3NMU A;  5T7B A;  1LWC A;  1E3M A;  1HR0 K;  3LDQ A;  3HO1 A;  3BDP A;  3AA2 A;  3D2F A;  2E2N A;  3RRH A;  4DS5 A;  2KQ2 A;  5D3G A;  1WSG A;  1BHL A;  2ZJR L;  3KZB A;  2GTD A;  5LMN K;  1NJY A;  3TAE A;  2OZS A;  4QS9 A;  5H1S Q;  3T3F A;  4KH4 A;  4LH4 A;  2DFF A;  3LDN A;  3TSP A;  2E6L A;  3HPH A;  5JLH A;  4FLW A;  4BRC A;  3TSU A;  3M8S A;  1N34 K;  3P1G A;  1NM1 A;  1U48 A;  3MED A;  2P9L A;  4JI4 K;  4CJQ A;  5C10 A;  5EY4 A;  4JV5 K;  4RG8 A;  3L6Q A;  4KB0 A;  1VQ7 N;  3R3L A;  4WQ5 A;  1BUP A;  3ZT1 A;  3MXM A;  5M1P A;  4H0T B;  4BRK A;  4CGH A;  4B1Y B;  4LH5 A;  5J2N A;  3TAF A;  4JI8 K;  2XY8 A;  4KTZ A;  5CE3 A;  3NF6 A;  2OZM A;  4KHN A;  3E9L A;  4OX9 K;  1NKC A;  4HCB A;  3KLH A;  1NJZ A;  1A5X A;  5E26 A;  4RW9 A;  3D2E A;  4NO7 A;  3CFO A;  1LCU A;  3QBX A;  5JLF A;  3H46 O;  2Q97 A;  1CZ9 A;  4DQR A;  2RE2 A;  1SUQ A;  1HJO A;  4BE0 A;  4FLU A;  4IG3 A;  5HRS A;  1W7A A;  2P9U B;  5J1E A;  5AQJ A;  3ZT0 A;  4WYB A;  3QER A;  4KTQ A;  1KFD A;  3AAP A;  3MAQ A;  4CJS A;  2NRH A;  3H3N O;  2WON A;  2XHB A;  3L3V A;  3OYE A;  2QW9 A;  2PYJ A;  4N56 A;  4I9L A;  1YJW N;  1YJ9 N;  3VQ7 A;  1HPZ A;  4WFB L;  3G6E N;  1C0T A;  3V4I A;  2HVI A;  3CI5 A;  3LAN A;  4I9Q A;  1NK9 A;  5SWM A;  2Y1J A;  5DMR A;  4FCY A;  3JYT A;  4BR2 A;  3EE9 A;  4BR0 A;  3S9H A;  4JKE A;  3SAH A;  3AA4 A;  3AVI A;  5HL7 L;  5CZ1 A;  2Z1I A;  5FRO A;  3TAN A;  1C0M A;  3VQA A;  1T6D A;  4NXM K;  4O5B A;  1KLN A;  2YNH A;  3OYN A;  3K57 A;  3OYC A;  3CC4 N;  1FK9 A;  1VRT A;  1RDU A;  2YNI A;  2F8T A; 
#chains in the Genus database with same CATH homology
 3K5L A;  2HHW A;  4CEF A;  1ITG A;  4N47 A;  4E7I A;  3IRX A;  4J2A A;  1TVR A;  3VQE A;  2BGG A;  1XWL A;  3K2P A;  4GW6 A;  5CY4 A;  1JLC A;  3V81 A;  2DFE A;  2VG7 A;  3OYG A;  2VWJ A;  1U45 A;  1JLE A;  1VSD A;  3MXI A;  2P1J A;  1UA0 A;  1L3U A;  4OKK A;  4AHU A;  5JS1 A;  3PX4 A;  5I42 A;  3MEC A;  3SUO A;  1WAF A;  3O3H A;  3VQ9 A;  4IDK A;  4C8M A;  1HMV A;  4FJM A;  1L3T A;  1ZBI A;  3TAB A;  3LAM A;  4DTU A;  4Z4I A;  1S1W A;  4E7L A;  4CES A;  4BDZ A;  4K8Z A;  3DOK A;  1FXX A;  2DFH A;  3V6D A;  3OYF A;  3AVF A;  3LZI A;  4AHR A;  2HVH A;  1NJX A;  3EZ5 A;  4LD0 A;  1BI4 A;  2G8K A;  2D0A A;  3SI6 A;  4FJ9 A;  3PX0 A;  4NCG A;  1XC9 A;  1QSL A;  1S9G A;  4FK2 A;  1EXQ A;  3SPZ A;  3V1O A;  1YTU A;  4W5R A;  4B08 A;  3TAG A;  4MFB A;  1YTA A;  4KHQ A;  3U3G A;  4DLG A;  3OYA A;  2KZM A;  1BIS A;  2OPS A;  1S1X A;  5J2Q A;  1HRH A;  3O3G A;  1JL1 A;  1TK0 A;  3C6T A;  4KO0 A;  4ZHR A;  1S6P A;  4DQI A;  3RR8 A;  3D0P A;  3M8R A;  3M8P A;  4DLE A;  4CHN A;  3SQ4 A;  3TAM A;  4C8K A;  2HNY A;  3RMA A;  3C95 A;  1RBT A;  3T19 A;  4N76 A;  4M3W A;  3VQB A;  2ETJ A;  3NAE A;  3WNF A;  1JLF A;  1K6Y A;  1TV6 A;  1WSH A;  4DTN A;  4CED A;  4CJP A;  3THV A;  3V9W A;  1JKH A;  3ZSO A;  4DTR A;  3KTQ A;  3K5M A;  1VSM A;  5J2P A;  3KD1 E;  1I39 A;  4CK3 A;  1HQE A;  1JXE A;  4Z4F A;  3L3U A;  4CJ3 A;  1QTM A;  2IOC A;  2R7Y A;  1LWF A;  3VQ6 A;  2Z1G A;  3FFI A;  3ISN C;  1NOY A;  1RT5 A;  4F2R A;  1BGX T;  1FKO A;  1C1C A;  3AVJ A;  1TK5 A;  3V9X A;  1Z25 A;  5HRR A;  3LWL A;  3K5N A;  3AVN A;  3SV3 A;  4DU1 A;  1L3S A;  2RF2 A;  2JLE A;  4LSL A;  4AHS A;  1CXQ A;  4FJJ A;  1NK7 A;  1REV A;  2KW4 A;  4HUE A;  1HYS A;  4ID1 A;  1LW0 A;  1RT6 A;  1MU2 A;  3ITH A;  4KV8 A;  3V1Q A;  1N6Q A;  3OYL A;  4W5Q A;  2G8F A;  4DSJ A;  1EP4 A;  2X6N A;  4AHT A;  4E7K A;  3AVM A;  3OYD A;  3QIO A;  2HNZ A;  5I3U A;  3AO2 A;  3RMB A;  1WSJ A;  4ICL A;  4FJ8 A;  3LP1 A;  1RT4 A;  3DYA A;  1ASW A;  4M45 A;  4BE2 A;  2PYL A;  1XI1 A;  4R5P A;  4NYN A;  4CJR A;  4KAZ A;  3CYM A;  4CJ5 A;  3VQQ A;  4NCB A;  1SL0 A;  3SQ1 A;  3RRG A;  4KHU A;  3NFA A;  1Z26 A;  5DK5 A;  4CEO A;  3I8D A;  4DFM A;  4DFP A;  3AVL A;  3VQC A;  4FLV A;  4FZX C;  4CJV A;  3KLI A;  4BE1 A;  3L2Q A;  1EX4 A;  4DQQ A;  4BWM A;  3SQ2 A;  2HMI A;  2DY4 A;  3TAR A;  3IG1 A;  2HB5 A;  1S6Q A;  2F96 A;  3KLG A;  3NF9 A;  3ZSZ A;  3C94 A;  4BAC A;  3OYI A;  4H4M A;  4PQU A;  5KRS A;  3HPG A;  4B9L A;  3AVA A;  4FW2 A;  4RW7 A;  3I0R A;  4EZ9 A;  4AH9 A;  1QS4 A;  1HQU A;  3LPU A;  5HRO A;  1NK8 A;  1SL1 A;  3VQD A;  4B9U A;  1W9H A;  2HW3 A;  3B6O A;  4B9N A;  1B92 A;  1J53 A;  4E0D A;  3LP0 A;  1VSF A;  1I3A A;  2D5R A;  3L2R A;  3HP9 A;  1B9F A;  4PA1 A;  3DLB A;  3MXJ A;  2WOM A;  4O4G A;  4CEZ A;  4KRF A;  3QO9 A;  2LSN A;  4CHP A;  4JRQ A;  3RWU A;  4CCH A;  3LAK A;  1WN7 A;  1HNI A;  1GOB A;  2VG6 A;  3DMJ A;  1DTQ A;  3EYZ A;  1IH7 A;  3AO4 A;  1RBS A;  1JLA A;  4CIE A;  3TAQ A;  2FBY A;  4DSL A;  3V1R A;  4CEC A;  4FLX A;  4CHY A;  3PY8 A;  3L2V A;  1Q9Y A;  4OPK A;  1KFS A;  3VA3 A;  1S1U A;  4M3Y A;  1EET A;  1VSH A;  2EHG A;  3HVT A;  3HT3 A;  2F8S A;  4CER A;  4CJF A;  1XHZ A;  4ID5 A;  3O4Q A;  3KIO A;  3OVN A;  1JLB A;  1RT1 A;  3ZSQ A;  3AO3 A;  2X78 A;  4OJR A;  2QXF A;  5EU7 A;  4KHY A;  2HHT A;  1LW2 A;  1UA1 A;  3SCX A;  1A5V A;  4DTO A;  1S9E A;  1RT7 A;  4FVM A;  4O0J A;  3ZSX A;  3PO5 A;  4OLB A;  2JGU A;  1VSL A;  4M3Z A;  4CGG A;  4I7F A;  4MQ3 A;  1RTI A;  4CGD A;  1NK6 A;  1IG9 A;  4ELT A;  4W5O A;  1EKE A;  1RTD A;  5E41 A;  4DQS A;  5FDL A;  1TAU A;  3NH1 A;  1U04 A;  4FK0 A;  2G8V A;  3AVB A;  4CGF A;  3SNN A;  3D45 A;  2O4G A;  3NCI A;  1SV5 A;  3NE6 A;  4B9V A;  1IKY A;  2OPP A;  4Z4C A;  4CGI A;  4WE1 A;  2ZD1 A;  1TAQ A;  4KI6 A;  1ASV A;  3G0Z A;  3SUP A;  3OYM A;  4KHS A;  3KLF A;  5SZT A;  3ZSW A;  2QKB A;  2BAN A;  4M3X A;  1T8E A;  1KTQ A;  1NK0 A;  4FJK A;  1RDC A;  4CEA A;  5HLF A;  1RBU A;  3KKS A;  1WSF A;  1D5A A;  1KVB A;  4BDY A;  4IFV A;  1J9A A;  5KRT A;  5KGX A;  3LDS A;  1HYZ A;  4FLT A;  2Z1H A;  1QE1 A;  1KCF A;  3PV8 A;  1WNS A;  4Z0U A;  1ZBF A;  3DRP A;  4KTW A;  4KRE A;  3QLH A;  4OGE A;  3IS9 A;  1T03 A;  4CEE A;  4CK1 A;  4I2Q A;  3LWM A;  4F3O A;  3QEP A;  1Q8I A;  4UQG A;  3RR7 A;  4QAG A;  4HVJ A;  3OJS A;  3AV9 A;  2ZQB A;  3DLG A;  2QK9 A;  5C25 A;  2RN2 A;  3P5J A;  4GVM A;  2IAJ A;  4M41 A;  4F2S A;  4CJU A;  3OS1 A;  4FJN A;  4B8C A;  3RMC A;  1X9S A;  4CHO A;  3QNN A;  3T1A A;  4H4O A;  2YNF A;  4LSN A;  4G1Q A;  1RTH A;  3ASM A;  1VSK A;  3ZSV A;  2OYQ A;  1BQM A;  1UAX A;  1QHT A;  4IG0 A;  3O4N A;  5JS2 A;  3ZT3 A;  1NJW A;  3KD5 E;  3SUQ A;  4B9T A;  2VG5 A;  4CEQ A;  2P5G A;  3L8B A;  3CG7 A;  4CF2 A;  4CHQ A;  3QET A;  1BCO A;  4Y1C A;  1A5W A;  3NGZ A;  2HHQ A;  3F9K A;  4OVL A;  1VSJ A;  2G8U A;  3QEI A;  1T7P A;  4N41 A;  1BCM A;  2NUB A;  3HL8 A;  1YT3 A;  4JS4 A;  2KFN A;  4DFJ A;  2BDP A;  1ASU A;  3SZ2 A;  3DLE A;  1UOC A;  2OPR A;  4CFA A;  4B9S A;  2FBT A;  4DF4 A;  3B6P A;  2IDO A;  4YNQ A;  3DLR A;  4OLA A;  1JLQ A;  4DSK A;  1IKV A;  2GBZ A;  1VSI A;  4KB1 A;  4CF9 A;  1C1A A;  4FM1 A;  2B4J A;  3DOL A;  3G10 A;  3OS0 A;  3LAL A;  2YV0 X;  3HM9 A;  3SJJ A;  4ZTJ A;  4QOZ B;  2AJQ A;  1BI4 B;  4KPY A;  1RDA A;  2I5J A;  4DS4 A;  3MEG A;  4NYF A;  1S1T A;  1X9W A;  3HK2 A;  1DTT A;  1RBV A;  1U4B A;  4DU4 A;  4DWI A;  3NGY A;  4CK2 A;  3JSM A;  1HYV A;  4AHC A;  1QSS A;  4FJG A;  1G15 A;  1SKW A;  1NOZ A;  4LY7 A;  1WSE A;  4RW8 A;  3L2W A;  4E7J A;  4J2B A;  1D9D A;  4Q0B A;  2A1S A;  1F21 A;  5FRM A;  1NK4 A;  4CGJ A;  4PY5 A;  3DRR A;  2X74 A;  3H08 A;  5C24 A;  3S3M A;  3M8Q A;  3A2F A;  3K58 A;  1WLJ A;  4CJ4 A;  3C6U A;  4CFB A;  4KI4 A;  3PUF A;  3I0S A;  4Y1D A;  1C0U A;  1UWB A;  3DM2 A;  1CZB A;  3S3O A;  4OKE A;  4CJW A;  3CFP A;  3IAY A;  3AVK A;  2HHU A;  4CIF A;  3AVG A;  2W42 A;  5HRP A;  3U3Y A;  4HHT A;  2OPQ A;  1J5O A;  2QKK A;  1SKS A;  4FZZ A;  3SQ0 A;  2Q3S A;  3QEW A;  2ZE2 A;  1U49 A;  1C1B A;  2PZS A;  2GV9 A;  5HRN A;  2D0C A;  1B9D A;  3QIP A;  4E89 A;  3HXM A;  1NKB A;  4FJX A;  4W5N A;  4C8N A;  3VQ4 A;  4FJL A;  5KTQ A;  3CM5 A;  2X6S A;  1Q9X A;  1J54 A;  4CF1 A;  1L3V A;  2D0B A;  5CYQ A;  3VQ5 A;  3V9S A;  4FJI A;  2IS3 A;  4DTM A;  2RKI A;  1TKT A;  2IC3 A;  3AA5 X;  4DSF A;  3OYJ A;  4FZY A;  1DLO A;  3RMD A;  4Z4G A;  1XHX A;  5CYM A;  4CEB A;  1LAW A;  1TK8 A;  1O1W A;  3OYH A;  4DTJ A;  2Y1I A;  3KKR A;  1W0H A;  4E19 A;  2BE2 A;  2KZZ A;  4FM2 A;  4HUG A;  2GUI A;  1GOA A;  3SYZ A;  1IKX A;  3HYF A;  1JLG A;  3ZT2 A;  5CZ2 A;  1RT3 A;  4N5S A;  3EY1 A;  3NHG A;  4EP5 A;  4DQP A;  2E6M A;  1LAV A;  2EX3 A;  1BL3 A;  5T7B A;  4BDP A;  3LPT A;  3TR8 A;  1IO2 A;  3VN5 A;  1LWC A;  4DMN A;  5KI6 A;  3WNH A;  1BIZ A;  1T05 A;  2FBX A;  4FW1 A;  1N5Y A;  2XY6 A;  4DSI A;  3BDP A;  3HO1 A;  4DSE A;  3SPY A;  3AA2 A;  1TKD A;  5C42 A;  1NKE A;  3DLH A;  1JL2 A;  4CJK A;  3RRH A;  4DS5 A;  2KQ2 A;  5FRN A;  5D3G A;  1WSG A;  1KSP A;  2G8H A;  3OY9 A;  4NCA A;  1BHL A;  4FYD A;  4YFU A;  4CIG A;  2XRI A;  1VRU A;  2HND A;  3OYK A;  4JLH A;  4KHW A;  4AIL C;  4CJT A;  1ZYQ A;  3QIN A;  1NJY A;  3TAE A;  3UIQ A;  4H8K A;  3K5O A;  3AVC A;  4RW6 A;  2OZS A;  4FK4 A;  4PUO A;  2KTQ A;  3NF8 A;  1RDD A;  5K14 A;  4HTU A;  2XY7 A;  3T3F A;  2G8W A;  4RW4 A;  4M3T A;  4LH4 A;  2DFF A;  2E4L A;  2YHB A;  4CF8 A;  2HHX A;  4CFD A;  1HNV A;  3LP2 A;  4KFB A;  3CFR A;  3QEV A;  2E6L A;  3HPH A;  5HBM A;  4FLW A;  1NK5 A;  4W5T A;  2FC0 A;  4J2E A;  4GMJ B;  4K8X A;  2ITG A;  4HUF A;  4J2D A;  3NBP A;  3ZCM A;  3M8S A;  2YHA A;  4Z4H A;  4ZTF A;  1GOC A;  4E1M A;  4JS5 A;  3DI6 A;  1S5J A;  3P1G A;  1RBR A;  4DTP A;  1QSY A;  4C8L A;  1U48 A;  3MED A;  3HST B;  3SUN A;  4QCL A;  3QES A;  3LP3 A;  2HHS A;  4CJQ A;  3KK3 A;  4JRP A;  1BIU A;  4F8R A;  1HJR A;  1ZBH A;  4RG8 A;  1WAJ A;  4CHZ A;  4F4K A;  4KB0 A;  2O4I A;  1ZBL A;  3DRS A;  3KJV A;  2PY5 A;  2YKM A;  1RCH A;  2P5O A;  1RNH A;  1KLM A;  4CE9 A;  3ZT1 A;  3MXM A;  4B3O A;  1R0A A;  4FJ5 A;  2YKN A;  2HHV A;  3NDK A;  4OGC A;  4CGH A;  4FLY A;  4DTX A;  4FJ7 A;  3O3F A;  1CLQ A;  4LH5 A;  5J2N A;  4IBN A;  3TAF A;  2XY8 A;  4DTS A;  1FKP A;  3AO5 A;  4KTZ A;  3NF6 A;  4HCC A;  2B5J A;  3K59 A;  3AVH A;  3V9Z A;  4EZ6 A;  3AO1 A;  2OZM A;  1D8Y A;  5J2M A;  4KHN A;  4DF8 A;  3HPO A;  1NKC A;  4HCB A;  3KLH A;  3U6F A;  1NJZ A;  2DTU A;  1A5X A;  4AHV A;  3NH0 A;  4RW9 A;  3F73 A;  1RIL A;  3SV4 A;  2XY5 A;  1CXU A;  3KK1 A;  3CFO A;  3E01 A;  4FJH A;  4I2P A;  1KVC A;  5HP1 A;  3VQP A;  1IKW A;  3QEX A;  3OJU A;  3ZSY A;  4FLZ A;  4B8A B;  4EP4 A;  4L8R B;  2ATQ A;  3WNG A;  4F3T A;  2KFZ A;  3CQ8 A;  1CZ9 A;  3NH2 A;  4DQR A;  4OKJ A;  1SUQ A;  1X9M A;  4BE0 A;  1RDB A;  3AA3 A;  4FLU A;  4IG3 A;  5HRS A;  3TI0 A;  4XIU A;  1BQN A;  5J1E A;  3KK2 A;  3ZT0 A;  1SL2 A;  2OA8 A;  4IKF A;  3QER A;  4KTQ A;  1JXB A;  1TL3 A;  1KFD A;  1U47 A;  4TSX A;  5KGW A;  4CJS A;  3MAQ A;  1QQC A;  4CFC A;  1SKR A;  4M42 A;  4Z4E A;  3ZSR A;  3V9U A;  3TAP A;  4FXD A;  1ZBU A;  2VWK A;  4CJL A;  3VQ8 A;  2YNG A;  3WNE A;  4O0I A;  3MEE A;  1VK0 A;  3L2U A;  4PWD A;  2WON A;  1C6V A;  3CM6 A;  3OYB A;  3L3V A;  2XO7 A;  2XHB A;  1WSI A;  1Y97 A;  3OYE A;  4C8O A;  4IFY A;  4M3U A;  2PYJ A;  3DLK A;  4I9L A;  4M3R A;  4N56 A;  1RTJ A;  3S3N A;  1TGO A;  3HP6 A;  1TKZ A;  3VQ7 A;  3KLE A;  2RPI A;  3LZJ A;  1HPZ A;  4DG1 A;  4E7H A;  4E1N A;  4Q5V A;  4B9M A;  4DFK A;  1C0T A;  3V4I A;  2HVI A;  4O44 A;  1LV5 A;  2Z1J A;  3LAN A;  1LWE A;  3NF7 A;  4I9Q A;  4CJE A;  1NK9 A;  4BWJ A;  3ZT4 A;  5SWM A;  1TL1 A;  1RT2 A;  3BGR A;  2Y1J A;  5DMR A;  1S1V A;  4CF0 A;  3HVR A;  3P83 D;  3JYT A;  4FCY A;  4DU3 A;  3S9H A;  3PX6 A;  3AA4 A;  3AVI A;  1KRP A;  2A1R A;  5CZ1 A;  2Z1I A;  5FRO A;  3OS2 A;  2B6A A;  3RTV A;  3TAN A;  1L5U A;  1C0M A;  2FBV A;  1TKX A;  1D9F A;  3VQA A;  3NGI A;  3HJF A;  1X1P A;  4O5B A;  4KKO A;  1KLN A;  3VA0 A;  2YNH A;  3OYN A;  3ALY A;  3PO4 A;  3K57 A;  3OYC A;  4FM0 A;  2P51 A;  1FK9 A;  1VRT A;  2IGI A;  2YNI A;  1KVA A;  4O55 A;  4E3S A;  2G8I A;  1YVU A;  4ELV A;  1VSE A;  3ULD A;  2F8T A;  4ELU A;  3QNO A;  4OPJ A;  3TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...