4CJLA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 149
sequence length 154
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjlA00
1L3SA 3ZT3A 4HUGA 4DTMA 1SKRA 3OYIA 2ATQA 3V1QA 4M3WA 3AV9A 1QTMA 4BE2A 3V9UA 2G8UA 4CF0A 4E7HA 1S1WA 1RT3A 4HHTA 1NJWA 3OS0A 3B6PA 4QCLA 1JLAA 2FBXA 4CFDA 4MFBA 3OVNA 3JYTA 3V81A 3OYNA 3U3YA 3SUPA 5J2QA 4PUOA 4OPKA 3LWLA 3SQ4A 3AA3A 3AVHA 3LPUA 3JSMA 3PUFA 5HP1A 1NK0A 2F8TA 4LSNA 1BI4A 1VRUA 3FFIA 4BDYA 4DTUA 1IKWA 2YKNA 1EETA 3HPGA 3SQ0A 5KI6A 3DLHA 3C6UA 2NUBA 1F21A 4KKOA 3QEVA 4JS5A 1REVA 3OYGA 3SPZA 1D8YA 3O4QA 1KLMA 1SKSA 3ZT0A 1JL1A 3RWUA 1RDDA 3VQQA 1XI1A 2DFHA 4M3TA 4F3OA 1X1PA 4FW1A 4KTWA 4RW7A 4CJTA 4CJ4A 4CHYA 4G1QA 1TKXA 3SUNA 1KFSA 3K5OA 2VWJA 4L8RB 3LP0A 3ZSVA 4NCBA 2ZQBA 2E4LA 2OPPA 2P1JA 1VRTA 4J2AA 4DSEA 4HTUA 4FJKA 3QNNA 4NCGA 1U48A 3KD5E 4IG0A 3IG1A 1RT1A 3EZ5A 3V6DA 2G8HA 4FXDA 2XHBA 4F2SA 5FRNA 4E19A 4FJGA 4IFYA 3LAKA 4DQIA 4DSJA 4DSLA 4B08A 4GVMA 3ZSYA 3LDSA 4PY5A 4KREA 2HMIA 1VSMA 3V9WA 3NF7A 4DTXA 3NGYA 3OS1A 1RTDA 3NF8A 1TK5A 4KHSA 2FBTA 1WLJA 2XY8A 3DOLA 3MEGA 5SZTA 1Z26A 4O4GA 4LY7A 1NK9A 3OYDA 3NGZA 1DLOA 1BIZA 3QEWA 1ASUA 1KCFA 4AH9A 3LWMA 1SL2A 1WSFA 1IKXA 4DS5A 4DSKA 4CJRA 2G8KA 1S5JA 3CFPA 2D5RA 3TR8A 1IH7A 1LWEA 3RRHA 1TKTA 1KVCA 1BL3A 1L3TA 1Z25A 1QE1A 4FJ9A 3NH2A 3AO1A 3L2QA 3DI6A 4FYDA 1U04A 1JXEA 1JLCA 4BWMA 4H4MA 3AVCA 4AHSA 4FLTA 3ASMA 4E1MA 1RTHA 3LPTA 3V4IA 1TK0A 1NJXA 4KHNA 1J5OA 1YTUA 3U3GA 3O3FA 1C1AA 3QEPA 4EZ9A 2GBZA 4DSIA 2Z1JA 4W5QA 3ALYA 4CIGA 4CK2A 3OS2A 4OGEA 1BI4B 1U4BA 4JS4A 4AILC 4DFPA 4NYFA 2KW4A 4FZZA 1J9AA 2P5OA 4E7JA 3PO4A 4RW8A 1KRPA 3KIOA 1I3AA 1BQMA 3CFOA 1W0HA 1L5UA 1S1VA 1BGXT 3PX4A 3M8QA 1NK8A 1C0UA 4IKFA 1XC9A 4CE9A 4QAGA 4CGGA 2FBVA 1GOAA 3VQ4A 4J2DA 3HT3A 3SQ1A 5CZ1A 4HCBA 4CCHA 3I0RA 3K58A 4CERA 4CHQA 3RMAA 4CHOA 2F96A 1VSFA 3HK2A 3NHGA 4PA1A 4HUFA 3RMBA 1LWCA 4PQUA 1JLBA 1FKPA 3S3MA 1YT3A 4DFKA 5HRRA 3ZSQA 3VQ6A 1B92A 3AVAA 4RG8A 3AVJA 1C1CA 1HQUA 3C95A 3WNFA 1N5YA 2OPSA 1RDAA 3SI6A 3U6FA 1TGOA 2P5GA 2OYQA 3DLKA 1I39A 2HHQA 3TAQA 4KPYA 2EHGA 3CG7A 1CZ9A 4RW6A 1JKHA 1KVAA 4OKJA 3WNGA 3LZJA 1VSDA 3OYKA 4DWIA 2KTQA 3AA4A 1IKVA 4RW9A 1RTIA 3MAQA 4CJSA 5KRTA 4DF8A 2WONA 3ZSOA 1VSIA 4O55A 3TABA 1R0AA 3AO5A 5CYMA 4H8KA 4MQ3A 4BDZA 2HHVA 2A1SA 1A5VA 1VSLA 4LH4A 3KK1A 1NK4A 2G8FA 1EKEA 3DRSA 3NH0A 4B8CA 3KLEA 1D9DA 2DFFA 3ZSZA 2E6MA 4DQQA 1QSSA 4CJEA 3SV3A 3NCIA 3VQ7A 4C8LA 1CXQA 1UAXA 4LH5A 4FLYA 1SKWA 4FK0A 1RBTA 3HJFA 3OYEA 1RT7A 4CESA 4FM2A 4BE0A 4KI6A 2PZSA 3QETA 4KO0A 1BIUA 5J1EA 3OJSA 1T7PA 4DFJA 4OLAA 4W5TA 4BDPA 2RF2A 2D0AA 3K5NA 4W5NA 4DS4A 1BISA 1EP4A 4I9LA 1RT6A 4B9NA 4CGHA 2KFNA 4M42A 4CHPA 2YNFA 2WOMA 4M3UA 1U47A 4C8NA 2XRIA 3V9SA 4ZTFA 5C42A 4GW6A 3VA3A 3MXMA 1SL1A 4IBNA 1QQCA 3AVKA 4I2QA 3WNHA 3HPOA 2BDPA 1WSJA 3HP9A 3A2FA 4CJUA 3NFAA 3KK2A 3QIPA 3NF6A 4FK4A 3TI0A 4N41A 1RDBA 2D0CA 4DTNA 5FRMA 1RBUA 1XWLA 1QSYA 2YNHA 5KGWA 1NKBA 3DRRA 2HHXA 2RN2A 1BHLA 3O4NA 3SUQA 1RDCA 3OYLA 4DQPA 1LWFA 4EP4A 5T7BA 1HYSA 2HHUA 1ZBHA 5C25A 1VSEA 4K8XA 4Z4CA 5HRNA 3K5MA 1HPZA 3DYAA 4Y1DA 4FZYA 1ZBLA 1EX4A 3VN5A 1ASVA 4HVJA 2FC0A 1WAFA 4E3SA 3TARA 3MXIA 1NKEA 4Z4FA 2F8SA 4FM1A 1VSHA 4QOZB 1K6YA 2VWKA 2B5JA 2IAJA 4FVMA 4FJMA 1L3VA 3NBPA 4DMNA 4N76A 4OKKA 3OYCA 3K59A 1KVBA 2HNZA 3D45A 4ID1A 2JGUA 4J2BA 3V1OA 4Z4HA 4CIEA 4DTRA 4F2RA 2DFEA 4IDKA 3EY1A 4CEQA 2W42A 3AA2A 2OZSA 4O0JA 3SUOA 3VQDA 1WAJA 4CEFA 4JLHA 4TSXA 3DLBA 4KTZA 3DLRA 3K5LA 3BDPA 4KTQA 1LAWA 4CF8A 1B9DA 1BCMA 3OYAA 3AVLA 1UA0A 4DQSA 4E0DA 4DTPA 1U49A 1TV6A 1NOYA 4FK2A 4AHVA 2KQ2A 4LSLA 3QLHA 2JLEA 1ZYQA 3QNOA 2Y1IA 3PX6A 3PX0A 1T03A 1WSGA 3F9KA 3CYMA 4DU3A 4FJLA 4NCAA 2B4JA 4M3RA 4IG3A 2XY7A 2A1RA 3K57A 4FM0A 4FJXA 3MECA 1NK5A 4B9LA 4OLBA 4OGCA 2BGGA 3TAGA 1BCOA 3ZSWA 1Y97A 2R7YA 1QHTA 1FK9A 1J54A 3P5JA 1UA1A 3KJVA 3DLGA 4O5BA 4CJQA 4N5SA 1T8EA 4LD0A 1GOBA 3NDKA 1MU2A 4OVLA 3KKSA 4CEOA 4DLEA 3IAYA 1S9GA 1UOCA 3IS9A 1LV5A 2XO7A 4CEAA 4Z4GA 4DQRA 4AHCA 4KFBA 3ZCMA 2OPRA 4OKEA 4B8AB 5EU7A 3HM9A 4FLVA 4FJ8A 2HHSA 4CEBA 5KTQA 3ISNC 3NGIA 3TAEA 4W5RA 3RMCA 3S3NA 3THVA 4ZHRA 3TAMA 2QK9A 4E7IA 1O1WA 3CM6A 1VSJA 2Z1HA 3OJUA 5I42A 3DOKA 5JS2A 5J2MA 3KD1E 4PWDA 4AHUA 1LW2A 4J2EA 3C94A 4CJLA 1NJYA 5HRSA 4UQGA 3S9HA 2PYLA 2OPQA 4K8ZA 1RT4A 1FKOA 3AVIA 1SV5A 5SWMA 5C24A 3TAFA 3G10A 3HL8A 1DTTA 4H4OA 1TL3A 3WNEA 1RTJA 3P1GA 3ULDA 1D9FA 4M3YA 3T19A 2QKBA 1TAUA 3OYFA 5CZ2A 3OY9A 1HJRA 1WSHA 3DMJA 3L3VA 4CGJA 4IFVA 3O3GA 4BE1A 1RBVA 2XY6A 4KAZA 2O4IA 3F73A 1NKCA 1G15A 2Z1IA 3AVMA 3PY8A 3V1RA 4FLWA 4CJKA 1S9EA 1GOCA 1A5WA 3M8SA 3L2WA 4BWJA 1WNSA 2VG7A 3EYZA 3QINA 3VA0A 3NH1A 2ITGA 5HRPA 1TAQA 3VQ9A 1NK7A 4CK1A 1Q8IA 2D0BA 4CIFA 5I3UA 3AO2A 3SYZA 4CHZA 3CM5A 3TWHA 3HVTA 1RCHA 3QERA 2KFZA 4JRQA 2IS3A 3OYMA 1UWBA 3I8DA 4FCYA 3ZT2A 5J2NA 3ZSXA 3G0ZA 4FZXC 1S6QA 3K2PA 4Z0UA 5KGXA 3L2VA 1XHXA 1X9SA 2IC3A 1LW0A 1JLEA 3AA5X 2HB5A 1TK8A 2IDOA 4FLXA 4ELTA 3DM2A 4CJWA 5KRSA 2PY5A 3RR8A 4EP5A 4YFUA 3ZT1A 3PV8A 2KZZA 1S1UA 1NOZA 3SCXA 1Q9YA 3SPYA 1TVRA 1WSIA 1HYZA 3AVFA 2ZE2A 1VSKA 2YNIA 4ZTJA 4CHNA 5E41A 4FW2A 1CLQA 4NYNA 5FDLA 3P83D 4KI4A 2I5JA 4KHQA 1KLNA 2YHAA 3KK3A 4YNQA 3OYBA 1JLQA 4CECA 4DFMA 3C6TA 3LP2A 3MEDA 3QEXA 2X6SA 4CJFA 5CY4A 2HVHA 3KLFA 2FBYA 1C0MA 4FLZA 2YNGA 2DY4A 1ITGA 1S1TA 1VK0A 2RPIA 3AVNA 3KTQA 2G8VA 1TKDA 2OA8A 5FROA 3S3OA 3UIQA 4RW4A 4DU1A 2RKIA 1JXBA 3ZT4A 4CJ5A 4B9UA 2HHTA 2QXFA 1S6PA 4R5PA 3LZIA 4Q0BA 2KZMA 4CEDA 1Q9XA 1ASWA 3HSTB 2Z1GA 3V9ZA 4ELUA 4I2PA 4ICLA 1T05A 1QS4A 2B6AA 1QSLA 4CF2A 3B6OA 4FJIA 4KB1A 2DTUA 4Y1CA 4M45A 4E89A 3V9XA 4HCCA 4FJ7A 3KKRA 4DTSA 4FJNA 4EZ6A 1SUQA 3I0SA 3VQCA 1DTQA 1SL0A 4CEEA 3AO4A 4B3OA 2HVIA 4OPJA 4KHUA 5HLFA 3VQPA 5JS1A 1C6VA 3KLHA 1HYVA 3L2UA 3NE6A 1KFDA 4KV8A 1JLFA 2HW3A 2X78A 3HPHA 1TKZA 2EX3A 3OYHA 3VQ8A 2ZD1A 4ELVA 1NJZA 3O3HA 1C0TA 4FJ5A 1JLGA 1ZBIA 3QO9A 3NAEA 3LP1A 3T3FA 2GV9A 3HVRA 4Z4EA 4CF1A 3H08A 3ZSRA 2YV0X 4Q5VA 3TAPA 1N6QA 3RR7A 1W9HA 1BQNA 5DMRA 3NF9A 4N56A 4F8RA 1ZBFA 1RBRA 4CK3A 3E01A 3QEIA 4E7KA 4DTOA 1LAVA 2VG5A 2X6NA 4M41A 2QKKA 2PYJA 2G8IA 3OYJA 2ETJA 1JL2A 3HYFA 3AO3A 4DSFA 1FXXA 4B9TA 4KRFA 4BACA 4E7LA 3AVGA 4DG1A 1IO2A 3RTVA 4CFBA 2O4GA 3SNNA 1IG9A 1X9MA 5K14A 4DTJA 4F3TA 3LANA 2BANA 4F4KA 1RILA 2IOCA 4CF9A 4HUEA 1X9WA 4B9MA 4CGDA 3T1AA 3LAMA 4I9QA 2AJQA 4CJVA 4CGFA 1RT5A 3VQBA 3QESA 1HMVA 2XY5A 1KTQA 2Q3SA 1CXUA 1YVUA 3KLGA 3ITHA 4I7FA 3SZ2A 2G8WA 1IKYA 4DLGA 3SQ2A 3TANA 1KSPA 4B9VA 2YHBA 1C1BA 4FJHA 4CJPA 3CQ8A 1EXQA 1HNVA 4CGIA 4C8MA 4CJ3A 2HHWA 3D0PA 1S1XA 4WE1A 3SV4A 4JRPA 1NK6A 1J53A 1WSEA 1WN7A 4B9SA 2P51A 1TL1A 2BE2A 3KLIA 4O44A 4W5OA 4AHRA 4OJRA 2Y1JA 2OZMA 4Z4IA 1RT2A 2IGIA 3QIOA 3LALA 4FJJA 2HNDA 3BGRA 1B9FA 1A5XA 4E1NA 3L8BA 4C8KA 4KB0A 3DRPA 4DF4A 3MEEA 3HO1A 4C8OA 3VQ5A 3M8PA 3L2RA 4KHYA 3RMDA 3AVBA 2GUIA 1ZBUA 1YTAA 1RNHA 1D5AA 3L3UA 5J2PA 5CYQA 3IRXA 5DK5A 5HBMA 4O0IA 3VQEA 4KHWA 2YKMA 3MXJA 4CFCA 4CEZA 4GMJB 3SJJA 3M8RA 3RRGA 1CZBA 4M3ZA 3CFRA 1HQEA 3HP6A 4CFAA 1RBSA 1XHZA 3HXMA 4M3XA 3VQAA 1HNIA 1HRHA 4FLUA 3PO5A 1L3UA 5HROA 2LSNA 4XIUA 4DU4A 2VG6A 5D3GA 2E6LA 4N47A 4ID5A 3LP3A 2X74A 2HNYA 4AHTA 3DLEA 1U45A
chains in the Genus database with same CATH superfamily
4IEEA 2QWLA 3P4IA 1SKRA 2P9SB 2A42A 3KK7A 3UKUA 4BQZA 3LDNA 4JI2K 1NJWA 2GUPA 4CFDA 4MFBA 3OVNA 3V81A 3SUPA 5J2QA 3JSMA 3PUFA 2Q2RA 3BF1A 4BDYA 4DTUA 3K9KA 4BREA 3SQ0A 3C6UA 1F21A 4JK7A 1WBBA 1SKSA 4O8KA 1NMDA 3VQQA 3M1FA 4WQ5C 2P9NB 3SJHA 1R59O 1KFSA 3CC7N 4G1QA 3K5OA 1RDUA 4L8RB 3ZSVA 3WEEA 2OPPA 4FJKA 3QNNA 1JCGA 1JCEA 3V6DA 3EZ5A 4BR4A 1IJJA 4F2SA 2HHHK 3LAKA 4PY5A 3LDSA 3H1QA 3MWTA 4CW7B 4DTXA 3NF8A 2V51B 4KHSA 2FBTA 3ID8A 5BRFA 1Z26A 1NJIO 2WBNA 2O8BB 1KCFA 3T7ZA 2F9WA 1SL2A 1IKXA 2CGKA 4BVOA 1Q86O 4A59A 3RRHA 1FW6A 2GELA 1YIJN 5GAHP 1U6ZA 3SBGA 1Z25A 3THXA 2A41A 4GV9A 5BREA 3ASMA 1RTHA 2P9UA 4QS7A 2FF6A 1J5OA 1VQ5N 2OANA 3O3FA 5ADXA 3CHWA 4IZ9A 1QQNA 2Z1JA 3UKRA 3LM9A 4JS4A 2E1ZA 4NYFA 4LF6K 3PO4A 4IJAA 5CE3A 4CE9A 3C65A 3DAWA 4J2DA 2P9SA 4CCHA 4YDUC 3RMAA 3U8XA 4CHOA 1VSFA 2J4RA 5AQYA 3NHGA 4B3MK 4PQUA 3S3MA 3MN5A 5LL6Z 1FJGK 3L4IA 3TTDA 3C7NB 3C95A 4CBWA 3SI6A 5M1FA 2HHQA 1T6DA 4RW6A 4K8ZA 1KVAA 4OKJA 1VSDA 1IKVA 3AA4A 1RTIA 3OHRA 4JKHA 3R8EA 3K9JA 1LCUA 5IT9O 4DF8A 2WONA 4CZFA 3PLAA 3D6RA 4CD3A 3TABA 1R0AA 3AO5A 5CYMA 4H8KA 4KH6A 1A5VA 5AQNA 1NK4A 3CCEN 3NH0A 4B8CA 4BC2A 3ZSZA 2NRZA 3NCIA 1UAXA 4LH5A 3C0BA 4KI6A 2FLOA 5J1EA 3OJSA 4DQ8A 5BR9A 1YITN 4BDPA 4JI6K 2RF2A 3CMEN 4FWRA 1EP4A 1RT6A 4CGHA 4K43A 5AQKA 3V9SA 2QA4N 4GW6A 4IOXA 3HPOA 2E5LK 3VEOA 3KK2A 3QIPA 4FK4A 3TI0A 2HMPA 5CR4A 1RBUA 2CGLA 3HTVA 5I9EB 5AQHA 3H6EA 3O4NA 4WQ5A 2HHUA 1ZBHA 5C25A 1VSEA 3Q7BA 4Z4CA 4PL7A 4Y1DA 2E2PA 3CCRN 1EX4A 3S41A 1WAFA 3TARA 2QI2A 1M90O 1DT9A 1NGCA 2VWKA 1NGEA 2B5JA 4FJMA 1L3VA 4H03B 4ID1A 3V1OA 4CIEA 3ID6A 1M1KO 4CEQA 2W42A 2OZSA 3W0LA 4DR4K 3DLBA 4CEFA 3BDPA 3DLRA 4XH5A 4CF8A 2FXUA 1B9DA 2HSTA 4BROA 1TV6A 4AHVA 1XUPO 4JKFA 2Y1IA 1ESVA 1WSGA 4FJLA 5KQDA 3MECA 1MWKA 4MDAA 2R7YA 3JXUA 4FOIA 1UA1A 2A6AA 3KJVA 3JS6A 4O5BA 4BRQA 5C10A 1T8EA 1MU2A 4CEOA 3CD6N 2KLAA 3IAYA 1UOCA 1Y64A 3IS9A 4CEAA 4EIAA 5LJWA 4KFBA 1X3MA 2OPRA 1KD1O 5EU7A 2HHSA 3FZHA 3ISNC 4AM7A 4W5RA 5EVZA 4G9ZA 3TAMA 1VSJA 4ILJA 4YDUA 3BUZB 2JWKA 5JS2A 5KPRA 3DLLL 3KD1E 2IVOA 4J2EA 1RT4A 2D1KA 2E20A 1SV5A 5SWMA 3TAFA 2PY5A 4A5AA 3HL8A 4JAXA 4H4OA 3JAMO 4MLEA 2QKBA 4HTLA 3O9UA 1HR0K 2QWMA 4FWQA 4BE1A 5LMNK 2O4IA 3F73A 1NKCA 3PY8A 4FLWA 3FR0A 4WYBA 1GOCA 3M8SA 4JN4A 1JCFA 5AJ3K 1XC3A 5HRPA 3AGRA 3L0QA 1Q8IA 1BU6O 1O13A 4CHZA 3CM5A 5BRHA 3TWHA 2KFZA 3VF6A 3ZSXA 3G0ZA 4BRAA 4Z0UA 5AQIA 2O8EB 1XHXA 1LW0A 3AA5X 2IDOA 3MN6A 3DM2A 4CJWA 4IO8A 5KRSA 4DV1K 4I6MA 4JHDA 3OA9A 4BRIA 3CCJN 1TVRA 3C6HA 4CHNA 1CLQA 4NYNA 3C6TA 3CJBA 4CJFA 2FBYA 2I7PA 1C0MA 3WXMB 2DY4A 2UUBK 1W97L 3AVNA 2G8VA 2OA8A 5DM7L 3PSIA 2ITMA 1HLUA 5LMUK 2HHTA 3ZETB 4CEDA 1Q9XA 4ELUA 5EOYA 1YHQN 1QSLA 4KB1A 4CZKA 2YHXA 3V9XA 4HCCA 1NLVA 4FJNA 4EZ6A 4H0VB 4BR9A 4PKHA 2YI1A 1SL0A 4CEEA 4MO4A 5TKYA 5BRDA 3L2UA 3KLHA 1HYVA 1Z05A 4LF4K 1KFDA 1NGBA 2X78A 1TKZA 1TUUA 1C0TA 1JLGA 1ZBIA 5AQPA 4EHTA 4JKEA 3LP1A 3T3FA 2GV9A 3HVRA 3H08A 3ZSRA 4Q5VA 4KH5A 4FVUA 2ZF5O 3NF9A 4N56A 4F8RA 4DTOA 4M41A 2PYJA 2QKKA 3W3DA 3OYJA 2ETJA 2G8IA 1JL2A 1FXXA 4B9TA 3O9TA 4KRFA 3M6GA 3DXKB 1VQON 2O8BA 4FPBA 3T1HK 1MWMA 5K14A 4DTJA 1NNEA 4JEPA 4I9QA 3LAMA 1BG3A 4JI5K 1QVGM 4BC4A 4DR6K 3AAQA 2G8WA 3SQ2A 2YHBA 1HNVA 2NRTA 1S1XA 4JRPA 1NK6A 1J53A 2BE2A 4A2AA 3KHYA 3HSCA 4C8KA 3HO1A 3DRPA 3KWIA 2GTDA 3RMDA 2GUIA 5FPNA 1D5AA 5CYQA 4JI7K 3IRXA 4PKGA 3O80A 3FZLA 4CEZA 4GMJB 4B1XB 3M8RA 3SJJA 2VGNA 3EKUA 3RSEA 1XHZA 4QS9A 4M3XA 3VQAA 1HNIA 3PO5A 4FLUA 2P9KB 2PBDA 5D3GA 4EAHD 4M63C 3LP3A 2P9LA 1V4SA 4BY9C 3DXMA 5M1PA 4IOCL 4AHTA 1U45A 1L3SA 4DTMA 3V1QA 4M3WA 1QTMA 5CHIA 2IIRA 2G8UA 4CF0A 2WUSA 4E7HA 1E4GT 3F2KA 1NGDA 3HRGA 4K8XA 2FBXA 3AA3A 1NK0A 3I8BA 3TPQA 4BR0A 2F8TA 4K25A 2QTDA 3FZMA 3OBYA 1BI4A 1VRUA 3FFIA 2YKNA 1EETA 5JLHA 2ZJRL 3DLHA 4QS8A 1REVA 3SPZA 3MWPA 3O4QA 1D8YA 3CJCA 4ISEA 3RWUA 1XI1A 2DFHA 1X1PA 4CJTA 3SUNA 4CHYA 1N32K 1GLCG 3ENBA 5F2RA 3CETA 3LP0A 4NCBA 2ZQBA 2E4LA 4DSEA 4HTUA 4H5NA 1DGKN 4NCGA 1U48A 4JKCA 3KD5E 3IG1A 4JD2A 5FRNA 1KC8O 4DQIA 4DSLA 4LC9B 2UUCK 3I55N 3NF7A 3OS1A 3K0SA 3PIOL 4DR3K 1BDGA 5SZTA 3VEXA 4JKAA 1ASUA 3LWMA 1WSFA 4JD2B 2RE2A 2V52B 4CJRA 2G8KA 5BN9A 3N4QA 1IG8A 5C2FA 3TR8A 2QEXN 1KVCA 1BL3A 1EWRA 1QE1A 4JI1K 3PIPL 3DI6A 3VF4A 1JXEA 4BWMA 4FWPA 3AVCA 4AHSA 1NJXA 4KHNA 4BRGA 1YTUA 4H5RA 1E4FT 4EZ9A 4W5QA 3ALYA 4CIGA 3OS2A 1U4BA 2QWRA 1OH6A 2E2QA 2IVNA 3THXB 2HBLA 1ILYA 3KIOA 1I3AA 5AQRA 2NRRA 1W0HA 3ZX2A 4CBUA 5E26A 3ZETA 3M8QA 3PX4A 4IKFA 2EWSA 5AQZA 2Q0UA 1XC9A 4QAGA 4CGGA 3VQ4A 4WFNL 1ZBSA 4OPHA 3K58A 3UB5A 3CJ9A 3HK2A 4HUFA 1LWCA 3G71N 5HRRA 3ZSQA 4H5TA 3VQ6A 1SAZA 3AVAA 4IXCA 3AVJA 1C1CA 1P8ZA 2P5GA 1TGOA 3CJAA 3DLKA 1I39A 5KQ8A 4LF5K 3LZJA 1JKHA 2P9IA 4DWIA 4RW9A 1XQSC 3ZSOA 1VSIA 5E84A 4BDZA 4LF8K 2A1SA 2FSKA 5H1SQ 3KLEA 3E1YA 1OVYA 4CJEA 3SV3A 3SMSA 3MCPA 3I56N 2W40A 3A5MC 4BE0A 1XMOK 2PZSA 4KO0A 3CCMN 1QQOA 1T7PA 1N33K 4OO1J 4OLAA 4W5TA 2D0AA 2Q1NA 1BISA 4I9LA 4C1NK 2YNFA 2WOMA 3J81O 4DV7K 1U47A 1HX1A 4C8NA 4ZTFA 1RGIA 4I2QA 1QQCA 3WNHA 2FSNA 3N4PA 1IBLK 2BDPA 3HP9A 3A2FA 4ISGA 4DV0K 4WQ4A 1D4XA 1S72N 1U2VB 1QSYA 5KGWA 2NNWA 2P9PA 2NLXA 2HBKA 2VQFK 1LWFA 1HJOA 5T7BA 2E2OA 3GL1A 1N34K 5GIOA 4FZYA 4FSVA 4DR2K 1ZBLA 3VN5A 4Z4FA 5ADXH 2HF4A 1MDUB 4JNEA 1K6YA 2IAJA 1NM1A 1GLDG 5AQQA 4EHUA 1NGIA 4PKIA 3K59A 1KVBA 4J2BA 1NU0A 3TSQA 4NB4A 3THYA 4F2RA 2DFEA 4IDKA 4BRFA 4J8FA 2VWBA 3A5LC 3AA2A 5EXWA 3ATUA 2BH1A 3ULEB 3T69A 5F1XA 4TSXA 3BZKA 4KTZA 3K5LA 1LAWA 1LOTB 4X66K 2ZGZA 5EY4A 3WQUA 4DQSA 5JVHL 4B9QA 4DTPA 4A5BA 3RSEB 3QLHA 2JLEA 3PX6A 4JI3K 3PX0A 3CYMA 4NCAA 2XY7A 4OGCA 4KHPK 1QQMA 4DHYA 1J54A 3DLGA 5GAGP 3NVKA 5JVGL 2AA4A 4Z4GA 4DQRA 1WBDA 1YUWA 4AHCA 2O8FA 5GINA 4XH1A 3R3LA 5KTQA 3TAEA 4X65K 3S3NA 2O8DA 4ZHRA 2Z1HA 3OJUA 5I42A 3GDQA 4AHUA 1NMNA 3C94A 4JKBA 1NJYA 1N36K 4UQGA 1T3VA 1FKOA 3MN7A 3AVIA 5C24A 1DTTA 1TL3A 3EO3A 3O08A 3ULDA 4M3YA 2GWKA 3OYFA 4IFVA 3O3GA 4KAZA 2XY6A 3P39A 5AQOA 1G15A 2Z1IA 3V1RA 1V4TA 1WB9A 1YJWN 4BWJA 2VG7A 1YAGA 1TAQA 1NK7A 4CK1A 2D0BA 3HOTA 5I3UA 5AQWA 4BG9A 1OH7A 2IS3A 1UWBA 4FCYA 3ZT2A 1KQSM 1S6QA 3K2PA 1TUYA 2KKZA 1X9SA 2IC3A 3D7EO 4FLXA 1VAZA 1Q81O 2FSJA 4CI6A 3PV8A 4K41A 3SPYA 1C0GA 1HYZA 3AGKA 2ZE2A 2YNIA 3AVFA 4RCHA 2I5JA 4AF1A 2YHAA 3KK3A 1BWFO 4DFMA 1JLQA 4CECA 3MEDA 4YHHK 5CY4A 2HVHA 2UU9K 3BEXA 4DUZK 4DCHA 1KAYA 1VK0A 3KTQA 1NGGA 1IBMK 3LDPA 4X64K 4WQ4C 3S3OA 3L6QA 4KH4A 4DU1A 4BGBA 3CF5L 5ELZA 2Q0RA 3DXKA 4CF2A 4FJIA 2ZJQL 4FJ7A 2QWNA 3KKRA 4DTSA 3WT0A 4IDHA 1VQLN 3VQCA 3CC2N 4M7YA 4WF9L 3AO4A 4B3OA 2HVIA 5JS1A 3VQPA 4KV8A 3HPHA 3TSPA 3VGLA 2EX3A 3OYHA 4ELVA 2ZD1A 4JK8A 5AR0A 3O3HA 1NJZA 4FJ5A 3VPZA 3VEVA 5BPNA 3NAEA 3WXLA 1HPMA 1W9HA 5AQXA 3E01A 3QEIA 1X3NA 4EFHA 3CCQN 5HL7L 3HYFA 3AO3A 3H46O 4C23A 4CD1A 3OTOK 4E7LA 2OCEA 4DG1A 4CFBA 4YY3K 3SNNA 4DV4K 3LANA 5BPMA 4GKJK 1RILA 4HUEA 1YVNA 3LM2A 4CJVA 2VYPA 2W41A 1RT5A 2XY5A 1KTQA 3ENHA 1CXUA 4I7FA 3O5BA 5IWAK 1IKYA 4DLGA 3SZ2A 5HOOA 1KSPA 4B9VA 1EXQA 5AQSA 3RVCA 3A5NC 4C8MA 1ZXOA 3SV4A 2P51A 1T44A 2P9NA 2IGIA 3LALA 4IFEA 4E1NA 4AM6A 4DF4A 3MEEA 2Q97A 4BRHA 1Q18A 1RNHA 3L3UA 3SBTA 3TU5A 1Q82O 5HBMA 4O0IA 2YKMA 1OKJA 3MXJA 3CFRA 1HQEA 4H0XB 2OTJN 1L3UA 5HROA 2LSNA 4DU4A 4H0PA 1VQ8N 5LJVA 4WCEL 1KAZA 2HNYA 4BRNA 3DLEA 2UXCK 3LDLA 5GAEP 4HUGA 2VQEK 2ATQA 5AQUA 1NBWA 1VQ4N 3QBXA 3V9UA 2ZWHA 2P9KA 1S1WA 4Z94A 3OS0A 3B6PA 3VTHA 4QCLA 2PAVA 2QW9A 3JYTA 1NGFA 3OYNA 2E8AA 4E1JA 1NG9A 4CZIA 4OPKA 3AVHA 5AZJA 5KPTA 1IKWA 3HPGA 4JS5A 5M1KA 2YJEA 4M3TA 4KTWA 4RW7A 4CJ4A 1EQYA 3O4WA 3E9PA 2P1JA 1VRTA 1I94K 4J2AA 5JICA 4BR5A 1GLFO 4B1WB 4IG0A 1QZ5A 2G8HA 3M3ZA 2XHBA 1CZAN 2QWOA 4DSJA 3R6MA 3ZSYA 1ZC6A 1VSMA 3V9WA 4PHTX 1RTDA 3MEGA 2BUPA 1NK9A 4WFAL 3WXIA 1DLOA 1BIZA 3QEWA 4AH9A 5FPEA 3ATVA 4DS5A 3CFPA 3ZEUB 1IH7A 1LWEA 1TKTA 4K0KK 4JK9A 5C12A 3NH2A 1N8RO 3AO1A 5FLXO 3L2QA 1U04A 3HOSA 3G4SN 2W6KA 2ZJPL 3LPTA 4HWIA 1BUPA 2NZTA 3ENOA 3LL3A 1C1AA 3CQXA 4CK2A 4LFBK 4OGEA 4AILC 4DFPA 1GLJO 2KW4A 2P5OA 4E7JA 3VESA 4RW8A 1IV0A 3CFOA 1S1VA 1BGXT 1NK8A 3P38A 1GOAA 2A40A 3SQ1A 4HCBA 4CERA 4CHQA 2F96A 4B3SK 4PA1A 3RMBA 1JLBA 3CPWM 2F7TA 1B92A 2YCHA 2UXBK 4NLBA 4RG8A 1HQUA 3WNFA 2OPSA 1RDAA 4BQLA 2OYQA 3A8YA 3WNGA 1CZ9A 3IMXA 2A3ZA 3OYKA 2YHYA 2W6LA 1XNQK 5A2QO 4DV6K 5KRTA 4O55A 2YHWA 3WXKA 4MQ3A 2GWJA 4ISFA 4YOXA 2HHVA 3CMAN 1VSLA 4LH4A 3KK1A 1EKEA 1D9DA 2DFFA 1QSSA 2E6MA 4DQQA 3VQ7A 1CXQA 4FLYA 1RBTA 3OYEA 4FM2A 3QETA 1BIUA 4B1VA 4W5NA 4DS4A 3EZWA 4B9NA 2KFNA 4M42A 4CHPA 3I33A 2XRIA 2D0PA 5C42A 2QXLA 4MLHA 5FPDA 3H3NO 3VA3A 1YJ9N 1X9JA 3AVKA 5C2DA 1WSJA 3CIPA 4A61A 4CJUA 3HM8A 3NFAA 3CI5A 4L3QA 4FOEA 4N41A 1RDBA 5F0XA 4DTNA 1GLLO 5FRMA 3DXMB 4C1NI 3THWA 1BA1A 1NKBA 5AQMA 3SUQA 4DQPA 3OYLA 2E2NA 1HYSA 4EP4A 4CVNE 2GX9A 5HRNA 5C15A 3K5MA 4RTFD 3EKSA 4HVJA 2FC0A 4E3SA 3DJCA 5GADP 2F8SA 4FM1A 1VSHA 3VTIA 5MLCQ 4QOZB 4DR5K 3THWB 1RFQA 3NBPA 4OKKA 3OYCA 3VEZA 3D45A 1K9MO 1K8AO 3EY1A 4BRLA 4O0JA 3UKUB 3VQDA 4KTQA 4H0YB 3OYAA 5JLFA 4BRCA 4WFBL 1UA0A 2Q36A 5BR8K 3ZX0A 2KQ2A 5M1NA 4CZLA 3L4QA 3QNOA 3D2FB 2NRWA 3F9KA 1EWQA 4DU3A 2B4JA 4M3RA 5EX5A 2A1RA 3E66A 3FE1A 4B9LA 2BGGA 3TAGA 3ZSWA 3H45C 4BRMA 1QVFM 1G99A 3P5JA 4N5SA 1DEJA 4LD0A 1GOBA 3GBTA 4FWNA 4JKDA 5JMVA 3VERA 4JKGA 2XO7A 3ZCMA 4B8AB 3HM9A 4O8UA 4BGAA 4JYAK 3NGIA 2NRHA 3SMPA 3RMCA 5BPLA 3THVA 1QZ6A 4E7IA 1O1WA 3J7YP 1LW2A 3GOIA 2RHKA 3FZKA 3G10A 3IDHA 3P1GA 1TAUA 1S22A 4I6MB 4JHDB 1K73O 4LF7K 4CGJA 3WEEB 3MK6A 3VEWA 1RBVA 3BP8A 5AFUH 3AVMA 2FF3B 1S9EA 4MO5A 3L2WA 1WNSA 3MX5A 3NH1A 3VEYA 3AAPA 3VQ9A 4FWKA 3J7AP 3AO2A 3H1VX 3D2EA 3SYZA 1SS6A 3HVTA 1RCHA 3MMVA 3QERA 4JRQA 3IFRA 4A57A 4CZHA 1MA9B 1BOTO 4FZXC 3EE8A 1P90A 4GV6A 4IO9L 1JLEA 4ELTA 2YX6A 2IVPA 4EP5A 3RR8A 4UY8O 4YFUA 3HZ6A 1NOZA 1Q9YA 1WSIA 1VSKA 4ZTJA 5E41A 4FW2A 2Q31A 3CCSN 1KLNA 4YNQA 3CXCM 3QEXA 2X6SA 3TTCA 3ZLJA 3E9LA 4FLZA 4A62A 4CZMA 4DR1K 3O8MA 1S1TA 2ASMA 3O1WA 2ASPA 1TKDA 1KXPA 4RW4A 3EEQA 4B9UA 2KZMA 1DKGD 1HNZK 3V9ZA 2Z1GA 4I2PA 1T05A 3B6OA 2DTUA 5AZIB 4JI4K 3I0SA 4GNIA 3IKMA 4OPJA 1C6VA 3TSUA 4BR7A 4B3RK 2HW3A 3BY5A 3CCUN 3VQ8A 4CBXA 3U9ZA 3U9DA 4BR2A 5AZJB 3QO9A 3T1YK 1N6QA 4PWDA 3C6AA 2YV0X 2P9PB 1W7AA 4H5VA 4CK3A 4E7KA 2CH5A 1LAVA 2VG5A 3Q7CA 3AVGA 3WUHA 1IG9A 3D2FA 4K42A 4YOTA 4F3TA 4PL8A 4F4KA 4CF9A 1X9WA 5AQVA 3T1AA 3WQTA 3SAFA 4XH4A 4CGFA 3MDQA 3VGMA 3QESA 1HMVA 4JI8K 4OX9K 4H5WA 2Q3SA 2ZM6K 4BG8A 2UXDK 4FWOA 3ITHA 1HKBA 2UYTA 4FJHA 1C1BA 3O9SA 4CGIA 2KHOA 4JV5K 4CJ3A 1YF5L 4WE1A 5AQFA 1WSEA 1TL1A 1VHXA 3KLIA 4O44A 4W5OA 4OJRA 4Z4IA 1HNXK 1RT2A 1VQ6N 1EO1A 4KB0A 3CCVN 3VQ5A 3L2RA 4KHYA 1ZBUA 5C0YA 1YTAA 1NGJA 5J2PA 3TTFA 4KHWA 4CFCA 4CZEA 4DV3K 3RRGA 1CZBA 1OH5A 4FWMA 1RBSA 3HXMA 1K8KA 3WXJA 5DM6L 4XIUA 2VG6A 2QM1A 4N47A 3AY9A 2X74A 4B3TK 3ZT3A 3THYB 3OYIA 1RDWX 3AV9A 4V19S 4BE2A 1HKCA 3B8AX 3FFKB 3CC4N 1RT3A 4FL9A 4HHTA 3BF3A 1JLAA 4PUOA 3SLCA 3U3YA 2BTFA 3LWLA 3SQ4A 3LPUA 5HP1A 4ILHA 4LSNA 3A5OC 5KI6A 4KKOA 2NUBA 4CZJA 3QFUA 3QEVA 3OYGA 1KLMA 4GKKK 3ZT0A 1JL1A 1RDDA 4NXNK 4OPAA 4LF9K 3E9OA 4F3OA 4FW1A 4YOYA 1TKXA 3VETA 2VWJA 4DKWA 4F9OA 4BC5A 2I7NA 3CJ7A 4GY2B 2F9TA 1RT1A 4FXDA 4E19A 4FJGA 4IFYA 2VCPA 3ZYYX 3QB0A 4GVMA 4B08A 2HMIA 3KWGA 3NGYA 2O8DB 1TK5A 1WLJA 2XY8A 3DOLA 4O4GA 4LY7A 4CJ7A 4NLCA 3OYDA 3NGZA 3VGKA 4BRPA 1ATNA 4DSKA 3J8AA 1S5JA 4BRKA 2D5RA 2V7YA 1L3TA 2V7ZA 1T6CA 4FJ9A 3OW2M 5AQLA 1HUXA 4FYDA 5M1QA 1JLCA 4H4MA 4FLTA 4E1MA 3V4IA 1TK0A 3H3OB 3U3GA 4IJNA 4IWVA 3ZEUA 3QEPA 2GBZA 4DSIA 1BI4B 4FZZA 1J9AA 1KRPA 1BQMA 1L5UA 2UUAK 2A5XA 3VMFB 1C0UA 1GLEG 2FBVA 3HT3A 2YJFA 5AQJA 3G6EN 4GV3A 2H3GX 5CZ1A 3O9QA 3I0RA 1FKPA 2P9LB 1YT3A 4DFKA 3M5RA 1TYQB 2WTUA 4BRDA 3UKRB 1N5YA 4YOUA 3U6FA 3TAQA 4KPYA 2EHGA 3CG7A 1ATSA 2KTQA 3MAQA 4CJSA 2D4WA 5GIPA 3HBTA 5LY3A 4DV2K 1VQNN 5KPZA 2G8FA 3DRSA 3LDQA 4FPAA 4C8LA 1VQ7N 4B1UB 1SKWA 4FK0A 1HKGA 3HJFA 1RT7A 4CESA 1XNRK 4DFJA 3K5NA 2GEMA 3EE9A 4M3UA 4B1YB 4KBOA 3CERA 3MXMA 1SL1A 4IBNA 1VQ9N 1SQKA 1GLBG 3DWLA 3VENA 3NF6A 4BC3A 3OBWA 2D0CA 4U67L 3UE5A 2DPNA 1XWLA 1WOQA 2CGJA 2YNHA 4YORA 3DRRA 5FPMA 1VQPN 2HHXA 2RN2A 1BHLA 1RDCA 1KAXA 3VF2A 5AFUA 3D2EB 1J5EK 1HPZA 3DYAA 1VQKN 1ASVA 3SAGA 4FO0A 1NKEA 3MXIA 3SAHA 4YOWA 4AQYK 1IBKK 4FVMA 4DMNA 4N76A 4DUYK 2HNZA 2JGUA 4H0OA 4Z4HA 4DTRA 3R1XA 5M1OA 2WFBA 3SUOA 1Z6RA 4U7BA 1OH8A 1WAJA 4JLHA 4OLBA 3A0IX 5AQTA 1YI2N 4CZGA 4RWTA 1BCMA 4LFAK 2F4VK 3AVLA 1TYQA 4B1ZA 4E0DA 1U49A 1NOYA 4FK2A 4LSLA 1ZYQA 1NGHA 1T03A 3G25A 4IG3A 3K57A 4FM0A 3O9RA 4FJXA 1NK5A 1BCOA 1Y97A 1QHTA 2O8EA 1FK9A 1S3XA 4CJQA 3NDKA 2OTLN 4OVLA 3KKSA 4DLEA 4ILGB 3FGUA 1S9GA 1LV5A 3FZFA 2ASOA 3ZX3A 1ATRA 2P9IB 4OKEA 4FLVA 4FJ8A 1H1VA 4CEBA 4DV5K 2ZGYA 3VOVA 4DB3A 2QK9A 3CM6A 4JKGB 3DOKA 5J2MA 2JWLA 4CJLA 2HOEA 5HRSA 3S9HA 2PYLA 2OPQA 3SK3A 1D9FA 3WNEA 2HF3A 1RTJA 3NMUA 3T19A 1C0FA 1E3MA 5CZ2A 3OY9A 1HJRA 1WSHA 3DMJA 3L3VA 1VQMN 3AARA 2VGMA 4CJKA 1A5WA 5AQGA 4FWLA 3EYZA 3QINA 2QWQA 3VA0A 3EL2A 2ITGA 3CJ1A 4CIFA 2QWPA 1GLAG 3QFPA 4LFCK 4IEIA 3OYMA 3I8DA 5J2NA 3J7ZO 3EN9A 5KGXA 3L2VA 1J6ZA 3NVMA 3F5TA 2HB5A 1TK8A 3ZT1A 2KZZA 1S1UA 1BA0A 3SCXA 2WC9A 5FDLA 4KI4A 3P83D 3GE1A 4KHQA 1OVQA 3OYBA 3LP2A 3KLFA 3KZBA 4BVPA 2YNGA 1ITGA 2PFUA 2RPIA 1QHAA 1W2BM 5FROA 4R79A 3UIQA 2RKIA 1JXBA 3ZT4A 4CJ5A 2QXFA 4MDBA 3CCLN 1S6PA 4R5PA 3LZIA 4Q0BA 1ASWA 3HSTB 4ICLA 1QS4A 2B6AA 4Y1CA 4M45A 4E89A 2HBJA 1SUQA 1DTQA 3GG4A 3LDOA 4KHUA 3CQYA 5HLFA 2E1YA 3NE6A 1JLFA 3QICA 3J80O 1SZ2A 1HNWK 3R9PA 4JI0K 3C7NA 3U4LA 3MN9A 2O8CA 4Z4EA 4CF1A 3TAPA 3O6WA 3RR7A 1BQNA 5DMRA 2P9UB 2CH6A 1NWKA 1ZBFA 3QMLA 4NXMK 2O8FB 1RBRA 2X6NA 4H0TB 3F9MA 4DSFA 4DR7K 1WUAA 4BACA 1XMQK 1IO2A 5B8HA 1Q7YO 3RTVA 2O4GA 2NRXA 1X9MA 5TKWA 1K8KB 2BANA 2IOCA 4B9MA 4CGDA 4YOVA 1NGAA 2AJQA 1YJNN 4IOAL 3VQBA 1YVUA 2D0OA 3KLGA 3MX2A 3TANA 3ULEA 4CJPA 3CQ8A 3CPEA 4Y0WA 2HHWA 2O8CB 4X62K 2NRVA 3FLCO 3D0PA 4B9SA 1WN7A 2E88A 2OZMA 4AHRA 2Y1JA 3QIOA 3BZCA 4FJJA 1YXQA 2HNDA 3P31A 3BGRA 5AZIA 1B9FA 1A5XA 2HBMA 3HI0A 3KVGA 3L8BA 3QBWA 4FWSA 4C8OA 3M8PA 3AVBA 4XEIA 1BO5O 5DK5A 3VQEA 3PSFA 4NO7A 4A2BA 2AP1A 3IUCA 4M3ZA 3HP6A 4CFAA 3MCAB 4O5FA 3QDKA 1HRHA 1JJ2M 5BN8A 2E6LA 3O1BA 4GVEA 4ID5A 4M7XA 1U2VA 4KREA
chains in the Genus database with same CATH topology
1L3SA 3ZT3A 4HUGA 4DTMA 1SKRA 3OYIA 2ATQA 3V1QA 4M3WA 3AV9A 1QTMA 4BE2A 3V9UA 2G8UA 4CF0A 4E7HA 1S1WA 1RT3A 4HHTA 1NJWA 3OS0A 3B6PA 4QCLA 1JLAA 2FBXA 4CFDA 4MFBA 3OVNA 3JYTA 3V81A 3OYNA 3U3YA 3SUPA 5J2QA 4PUOA 4OPKA 3LWLA 3SQ4A 3AA3A 3AVHA 3LPUA 3JSMA 3PUFA 5HP1A 1NK0A 2F8TA 4LSNA 1BI4A 1VRUA 3FFIA 4BDYA 4DTUA 1IKWA 2YKNA 1EETA 3HPGA 3SQ0A 5KI6A 3DLHA 3C6UA 2NUBA 1F21A 4KKOA 3QEVA 4JS5A 1REVA 3OYGA 3SPZA 1D8YA 3O4QA 1KLMA 1SKSA 3ZT0A 1JL1A 3RWUA 1RDDA 3VQQA 1XI1A 2DFHA 4M3TA 4F3OA 1X1PA 4FW1A 4KTWA 4RW7A 4CJTA 4CJ4A 4CHYA 4G1QA 1TKXA 3SUNA 1KFSA 3K5OA 2VWJA 4L8RB 3LP0A 3ZSVA 4NCBA 2ZQBA 2E4LA 2OPPA 2P1JA 1VRTA 4J2AA 4DSEA 4HTUA 4FJKA 3QNNA 4NCGA 1U48A 3KD5E 4IG0A 3IG1A 1RT1A 3EZ5A 3V6DA 2G8HA 4FXDA 2XHBA 4F2SA 5FRNA 4E19A 4FJGA 4IFYA 3LAKA 4DQIA 4DSJA 4DSLA 4B08A 4GVMA 3ZSYA 3LDSA 4PY5A 4KREA 2HMIA 1VSMA 3V9WA 3NF7A 4DTXA 3NGYA 3OS1A 1RTDA 3NF8A 1TK5A 4KHSA 2FBTA 1WLJA 2XY8A 3DOLA 3MEGA 5SZTA 1Z26A 4O4GA 4LY7A 1NK9A 3OYDA 3NGZA 1DLOA 1BIZA 3QEWA 1ASUA 1KCFA 4AH9A 3LWMA 1SL2A 1WSFA 1IKXA 4DS5A 4DSKA 4CJRA 2G8KA 1S5JA 3CFPA 2D5RA 3TR8A 1IH7A 1LWEA 3RRHA 1TKTA 1KVCA 1BL3A 1L3TA 1Z25A 1QE1A 4FJ9A 3NH2A 3AO1A 3L2QA 3DI6A 4FYDA 1U04A 1JXEA 1JLCA 4BWMA 4H4MA 3AVCA 4AHSA 4FLTA 3ASMA 4E1MA 1RTHA 3LPTA 3V4IA 1TK0A 1NJXA 4KHNA 1J5OA 1YTUA 3U3GA 3O3FA 1C1AA 3QEPA 4EZ9A 2GBZA 4DSIA 2Z1JA 4W5QA 3ALYA 4CIGA 4CK2A 3OS2A 4OGEA 1BI4B 1U4BA 4JS4A 4AILC 4DFPA 4NYFA 2KW4A 4FZZA 1J9AA 2P5OA 4E7JA 3PO4A 4RW8A 1KRPA 3KIOA 1I3AA 1BQMA 3CFOA 1W0HA 1L5UA 1S1VA 1BGXT 3PX4A 3M8QA 1NK8A 1C0UA 4IKFA 1XC9A 4CE9A 4QAGA 4CGGA 2FBVA 1GOAA 3VQ4A 4J2DA 3HT3A 3SQ1A 5CZ1A 4HCBA 4CCHA 3I0RA 3K58A 4CERA 4CHQA 3RMAA 4CHOA 2F96A 1VSFA 3HK2A 3NHGA 4PA1A 4HUFA 3RMBA 1LWCA 4PQUA 1JLBA 1FKPA 3S3MA 1YT3A 4DFKA 5HRRA 3ZSQA 3VQ6A 1B92A 3AVAA 4RG8A 3AVJA 1C1CA 1HQUA 3C95A 3WNFA 1N5YA 2OPSA 1RDAA 3SI6A 3U6FA 1TGOA 2P5GA 2OYQA 3DLKA 1I39A 2HHQA 3TAQA 4KPYA 2EHGA 3CG7A 1CZ9A 4RW6A 1JKHA 1KVAA 4OKJA 3WNGA 3LZJA 1VSDA 3OYKA 4DWIA 2KTQA 3AA4A 1IKVA 4RW9A 1RTIA 3MAQA 4CJSA 5KRTA 4DF8A 2WONA 3ZSOA 1VSIA 4O55A 3TABA 1R0AA 3AO5A 5CYMA 4H8KA 4MQ3A 4BDZA 2HHVA 2A1SA 1A5VA 1VSLA 4LH4A 3KK1A 1NK4A 2G8FA 1EKEA 3DRSA 3NH0A 4B8CA 3KLEA 1D9DA 2DFFA 3ZSZA 2E6MA 4DQQA 1QSSA 4CJEA 3SV3A 3NCIA 3VQ7A 4C8LA 1CXQA 1UAXA 4LH5A 4FLYA 1SKWA 4FK0A 1RBTA 3HJFA 3OYEA 1RT7A 4CESA 4FM2A 4BE0A 4KI6A 2PZSA 3QETA 4KO0A 1BIUA 5J1EA 3OJSA 1T7PA 4DFJA 4OLAA 4W5TA 4BDPA 2RF2A 2D0AA 3K5NA 4W5NA 4DS4A 1BISA 1EP4A 4I9LA 1RT6A 4B9NA 4CGHA 2KFNA 4M42A 4CHPA 2YNFA 2WOMA 4M3UA 1U47A 4C8NA 2XRIA 3V9SA 4ZTFA 5C42A 4GW6A 3VA3A 3MXMA 1SL1A 4IBNA 1QQCA 3AVKA 4I2QA 3WNHA 3HPOA 2BDPA 1WSJA 3HP9A 3A2FA 4CJUA 3NFAA 3KK2A 3QIPA 3NF6A 4FK4A 3TI0A 4N41A 1RDBA 2D0CA 4DTNA 5FRMA 1RBUA 1XWLA 1QSYA 2YNHA 5KGWA 1NKBA 3DRRA 2HHXA 2RN2A 1BHLA 3O4NA 3SUQA 1RDCA 3OYLA 4DQPA 1LWFA 4EP4A 5T7BA 1HYSA 2HHUA 1ZBHA 5C25A 1VSEA 4K8XA 4Z4CA 5HRNA 3K5MA 1HPZA 3DYAA 4Y1DA 4FZYA 1ZBLA 1EX4A 3VN5A 1ASVA 4HVJA 2FC0A 1WAFA 4E3SA 3TARA 3MXIA 1NKEA 4Z4FA 2F8SA 4FM1A 1VSHA 4QOZB 1K6YA 2VWKA 2B5JA 2IAJA 4FVMA 4FJMA 1L3VA 3NBPA 4DMNA 4N76A 4OKKA 3OYCA 3K59A 1KVBA 2HNZA 3D45A 4ID1A 2JGUA 4J2BA 3V1OA 4Z4HA 4CIEA 4DTRA 4F2RA 2DFEA 4IDKA 3EY1A 4CEQA 2W42A 3AA2A 2OZSA 4O0JA 3SUOA 3VQDA 1WAJA 4CEFA 4JLHA 4TSXA 3DLBA 4KTZA 3DLRA 3K5LA 3BDPA 4KTQA 1LAWA 4CF8A 1B9DA 1BCMA 3OYAA 3AVLA 1UA0A 4DQSA 4E0DA 4DTPA 1U49A 1TV6A 1NOYA 4FK2A 4AHVA 2KQ2A 4LSLA 3QLHA 2JLEA 1ZYQA 3QNOA 2Y1IA 3PX6A 3PX0A 1T03A 1WSGA 3F9KA 3CYMA 4DU3A 4FJLA 4NCAA 2B4JA 4M3RA 4IG3A 2XY7A 2A1RA 3K57A 4FM0A 4FJXA 3MECA 1NK5A 4B9LA 4OLBA 4OGCA 2BGGA 3TAGA 1BCOA 3ZSWA 1Y97A 2R7YA 1QHTA 1FK9A 1J54A 3P5JA 1UA1A 3KJVA 3DLGA 4O5BA 4CJQA 4N5SA 1T8EA 4LD0A 1GOBA 3NDKA 1MU2A 4OVLA 3KKSA 4CEOA 4DLEA 3IAYA 1S9GA 1UOCA 3IS9A 1LV5A 2XO7A 4CEAA 4Z4GA 4DQRA 4AHCA 4KFBA 3ZCMA 2OPRA 4OKEA 4B8AB 5EU7A 3HM9A 4FLVA 4FJ8A 2HHSA 4CEBA 5KTQA 3ISNC 3NGIA 3TAEA 4W5RA 3RMCA 3S3NA 3THVA 4ZHRA 3TAMA 2QK9A 4E7IA 1O1WA 3CM6A 1VSJA 2Z1HA 3OJUA 5I42A 3DOKA 5JS2A 5J2MA 3KD1E 4PWDA 4AHUA 1LW2A 4J2EA 3C94A 4CJLA 1NJYA 5HRSA 4UQGA 3S9HA 2PYLA 2OPQA 4K8ZA 1RT4A 1FKOA 3AVIA 1SV5A 5SWMA 5C24A 3TAFA 3G10A 3HL8A 1DTTA 4H4OA 1TL3A 3WNEA 1RTJA 3P1GA 3ULDA 1D9FA 4M3YA 3T19A 2QKBA 1TAUA 3OYFA 5CZ2A 3OY9A 1HJRA 1WSHA 3DMJA 3L3VA 4CGJA 4IFVA 3O3GA 4BE1A 1RBVA 2XY6A 4KAZA 2O4IA 3F73A 1NKCA 1G15A 2Z1IA 3AVMA 3PY8A 3V1RA 4FLWA 4CJKA 1S9EA 1GOCA 1A5WA 3M8SA 3L2WA 4BWJA 1WNSA 2VG7A 3EYZA 3QINA 3VA0A 3NH1A 2ITGA 5HRPA 1TAQA 3VQ9A 1NK7A 4CK1A 1Q8IA 2D0BA 4CIFA 5I3UA 3AO2A 3SYZA 4CHZA 3CM5A 3TWHA 3HVTA 1RCHA 3QERA 2KFZA 4JRQA 2IS3A 3OYMA 1UWBA 3I8DA 4FCYA 3ZT2A 5J2NA 3ZSXA 3G0ZA 4FZXC 1S6QA 3K2PA 4Z0UA 5KGXA 3L2VA 1XHXA 1X9SA 2IC3A 1LW0A 1JLEA 3AA5X 2HB5A 1TK8A 2IDOA 4FLXA 4ELTA 3DM2A 4CJWA 5KRSA 2PY5A 3RR8A 4EP5A 4YFUA 3ZT1A 3PV8A 2KZZA 1S1UA 1NOZA 3SCXA 1Q9YA 3SPYA 1TVRA 1WSIA 1HYZA 3AVFA 2ZE2A 1VSKA 2YNIA 4ZTJA 4CHNA 5E41A 4FW2A 1CLQA 4NYNA 5FDLA 3P83D 4KI4A 2I5JA 4KHQA 1KLNA 2YHAA 3KK3A 4YNQA 3OYBA 1JLQA 4CECA 4DFMA 3C6TA 3LP2A 3MEDA 3QEXA 2X6SA 4CJFA 5CY4A 2HVHA 3KLFA 2FBYA 1C0MA 4FLZA 2YNGA 2DY4A 1ITGA 1S1TA 1VK0A 2RPIA 3AVNA 3KTQA 2G8VA 1TKDA 2OA8A 5FROA 3S3OA 3UIQA 4RW4A 4DU1A 2RKIA 1JXBA 3ZT4A 4CJ5A 4B9UA 2HHTA 2QXFA 1S6PA 4R5PA 3LZIA 4Q0BA 2KZMA 4CEDA 1Q9XA 1ASWA 3HSTB 2Z1GA 3V9ZA 4ELUA 4I2PA 4ICLA 1T05A 1QS4A 2B6AA 1QSLA 4CF2A 3B6OA 4FJIA 4KB1A 2DTUA 4Y1CA 4M45A 4E89A 3V9XA 4HCCA 4FJ7A 3KKRA 4DTSA 4FJNA 4EZ6A 1SUQA 3I0SA 3VQCA 1DTQA 1SL0A 4CEEA 3AO4A 4B3OA 2HVIA 4OPJA 4KHUA 5HLFA 3VQPA 5JS1A 1C6VA 3KLHA 1HYVA 3L2UA 3NE6A 1KFDA 4KV8A 1JLFA 2HW3A 2X78A 3HPHA 1TKZA 2EX3A 3OYHA 3VQ8A 2ZD1A 4ELVA 1NJZA 3O3HA 1C0TA 4FJ5A 1JLGA 1ZBIA 3QO9A 3NAEA 3LP1A 3T3FA 2GV9A 3HVRA 4Z4EA 4CF1A 3H08A 3ZSRA 2YV0X 4Q5VA 3TAPA 1N6QA 3RR7A 1W9HA 1BQNA 5DMRA 3NF9A 4N56A 4F8RA 1ZBFA 1RBRA 4CK3A 3E01A 3QEIA 4E7KA 4DTOA 1LAVA 2VG5A 2X6NA 4M41A 2QKKA 2PYJA 2G8IA 3OYJA 2ETJA 1JL2A 3HYFA 3AO3A 4DSFA 1FXXA 4B9TA 4KRFA 4BACA 4E7LA 3AVGA 4DG1A 1IO2A 3RTVA 4CFBA 2O4GA 3SNNA 1IG9A 1X9MA 5K14A 4DTJA 4F3TA 3LANA 2BANA 4F4KA 1RILA 2IOCA 4CF9A 4HUEA 1X9WA 4B9MA 4CGDA 3T1AA 3LAMA 4I9QA 2AJQA 4CJVA 4CGFA 1RT5A 3VQBA 3QESA 1HMVA 2XY5A 1KTQA 2Q3SA 1CXUA 1YVUA 3KLGA 3ITHA 4I7FA 3SZ2A 2G8WA 1IKYA 4DLGA 3SQ2A 3TANA 1KSPA 4B9VA 2YHBA 1C1BA 4FJHA 4CJPA 3CQ8A 1EXQA 1HNVA 4CGIA 4C8MA 4CJ3A 2HHWA 3D0PA 1S1XA 4WE1A 3SV4A 4JRPA 1NK6A 1J53A 1WSEA 1WN7A 4B9SA 2P51A 1TL1A 2BE2A 3KLIA 4O44A 4W5OA 4AHRA 4OJRA 2Y1JA 2OZMA 4Z4IA 1RT2A 2IGIA 3QIOA 3LALA 4FJJA 2HNDA 3BGRA 1B9FA 1A5XA 4E1NA 3L8BA 4C8KA 4KB0A 3DRPA 4DF4A 3MEEA 3HO1A 4C8OA 3VQ5A 3M8PA 3L2RA 4KHYA 3RMDA 3AVBA 2GUIA 1ZBUA 1YTAA 1RNHA 1D5AA 3L3UA 5J2PA 5CYQA 3IRXA 5DK5A 5HBMA 4O0IA 3VQEA 4KHWA 2YKMA 3MXJA 4CFCA 4CEZA 4GMJB 3SJJA 3M8RA 3RRGA 1CZBA 4M3ZA 3CFRA 1HQEA 3HP6A 4CFAA 1RBSA 1XHZA 3HXMA 4M3XA 3VQAA 1HNIA 1HRHA 4FLUA 3PO5A 1L3UA 5HROA 2LSNA 4XIUA 4DU4A 2VG6A 5D3GA 2E6LA 4N47A 4ID5A 3LP3A 2X74A 2HNYA 4AHTA 3DLEA 1U45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3S A;  3ZT3 A;  4HUG A;  4DTM A;  1SKR A;  3OYI A;  2ATQ A;  3V1Q A;  4M3W A;  3AV9 A;  1QTM A;  4BE2 A;  3V9U A;  2G8U A;  4CF0 A;  4E7H A;  1S1W A;  1RT3 A;  4HHT A;  1NJW A;  3OS0 A;  3B6P A;  4QCL A;  1JLA A;  2FBX A;  4CFD A;  4MFB A;  3OVN A;  3JYT A;  3V81 A;  3OYN A;  3U3Y A;  3SUP A;  5J2Q A;  4PUO A;  4OPK A;  3LWL A;  3SQ4 A;  3AA3 A;  3AVH A;  3LPU A;  3JSM A;  3PUF A;  5HP1 A;  1NK0 A;  2F8T A;  4LSN A;  1BI4 A;  1VRU A;  3FFI A;  4BDY A;  4DTU A;  1IKW A;  2YKN A;  1EET A;  3HPG A;  3SQ0 A;  5KI6 A;  3DLH A;  3C6U A;  2NUB A;  1F21 A;  4KKO A;  3QEV A;  4JS5 A;  1REV A;  3OYG A;  3SPZ A;  1D8Y A;  3O4Q A;  1KLM A;  1SKS A;  3ZT0 A;  1JL1 A;  3RWU A;  1RDD A;  3VQQ A;  1XI1 A;  2DFH A;  4M3T A;  4F3O A;  1X1P A;  4FW1 A;  4KTW A;  4RW7 A;  4CJT A;  4CJ4 A;  4CHY A;  4G1Q A;  1TKX A;  3SUN A;  1KFS A;  3K5O A;  2VWJ A;  4L8R B;  3LP0 A;  3ZSV A;  4NCB A;  2ZQB A;  2E4L A;  2OPP A;  2P1J A;  1VRT A;  4J2A A;  4DSE A;  4HTU A;  4FJK A;  3QNN A;  4NCG A;  1U48 A;  3KD5 E;  4IG0 A;  3IG1 A;  1RT1 A;  3EZ5 A;  3V6D A;  2G8H A;  4FXD A;  2XHB A;  4F2S A;  5FRN A;  4E19 A;  4FJG A;  4IFY A;  3LAK A;  4DQI A;  4DSJ A;  4DSL A;  4B08 A;  4GVM A;  3ZSY A;  3LDS A;  4PY5 A;  4KRE A;  2HMI A;  1VSM A;  3V9W A;  3NF7 A;  4DTX A;  3NGY A;  3OS1 A;  1RTD A;  3NF8 A;  1TK5 A;  4KHS A;  2FBT A;  1WLJ A;  2XY8 A;  3DOL A;  3MEG A;  5SZT A;  1Z26 A;  4O4G A;  4LY7 A;  1NK9 A;  3OYD A;  3NGZ A;  1DLO A;  1BIZ A;  3QEW A;  1ASU A;  1KCF A;  4AH9 A;  3LWM A;  1SL2 A;  1WSF A;  1IKX A;  4DS5 A;  4DSK A;  4CJR A;  2G8K A;  1S5J A;  3CFP A;  2D5R A;  3TR8 A;  1IH7 A;  1LWE A;  3RRH A;  1TKT A;  1KVC A;  1BL3 A;  1L3T A;  1Z25 A;  1QE1 A;  4FJ9 A;  3NH2 A;  3AO1 A;  3L2Q A;  3DI6 A;  4FYD A;  1U04 A;  1JXE A;  1JLC A;  4BWM A;  4H4M A;  3AVC A;  4AHS A;  4FLT A;  3ASM A;  4E1M A;  1RTH A;  3LPT A;  3V4I A;  1TK0 A;  1NJX A;  4KHN A;  1J5O A;  1YTU A;  3U3G A;  3O3F A;  1C1A A;  3QEP A;  4EZ9 A;  2GBZ A;  4DSI A;  2Z1J A;  4W5Q A;  3ALY A;  4CIG A;  4CK2 A;  3OS2 A;  4OGE A;  1BI4 B;  1U4B A;  4JS4 A;  4AIL C;  4DFP A;  4NYF A;  2KW4 A;  4FZZ A;  1J9A A;  2P5O A;  4E7J A;  3PO4 A;  4RW8 A;  1KRP A;  3KIO A;  1I3A A;  1BQM A;  3CFO A;  1W0H A;  1L5U A;  1S1V A;  1BGX T;  3PX4 A;  3M8Q A;  1NK8 A;  1C0U A;  4IKF A;  1XC9 A;  4CE9 A;  4QAG A;  4CGG A;  2FBV A;  1GOA A;  3VQ4 A;  4J2D A;  3HT3 A;  3SQ1 A;  5CZ1 A;  4HCB A;  4CCH A;  3I0R A;  3K58 A;  4CER A;  4CHQ A;  3RMA A;  4CHO A;  2F96 A;  1VSF A;  3HK2 A;  3NHG A;  4PA1 A;  4HUF A;  3RMB A;  1LWC A;  4PQU A;  1JLB A;  1FKP A;  3S3M A;  1YT3 A;  4DFK A;  5HRR A;  3ZSQ A;  3VQ6 A;  1B92 A;  3AVA A;  4RG8 A;  3AVJ A;  1C1C A;  1HQU A;  3C95 A;  3WNF A;  1N5Y A;  2OPS A;  1RDA A;  3SI6 A;  3U6F A;  1TGO A;  2P5G A;  2OYQ A;  3DLK A;  1I39 A;  2HHQ A;  3TAQ A;  4KPY A;  2EHG A;  3CG7 A;  1CZ9 A;  4RW6 A;  1JKH A;  1KVA A;  4OKJ A;  3WNG A;  3LZJ A;  1VSD A;  3OYK A;  4DWI A;  2KTQ A;  3AA4 A;  1IKV A;  4RW9 A;  1RTI A;  3MAQ A;  4CJS A;  5KRT A;  4DF8 A;  2WON A;  3ZSO A;  1VSI A;  4O55 A;  3TAB A;  1R0A A;  3AO5 A;  5CYM A;  4H8K A;  4MQ3 A;  4BDZ A;  2HHV A;  2A1S A;  1A5V A;  1VSL A;  4LH4 A;  3KK1 A;  1NK4 A;  2G8F A;  1EKE A;  3DRS A;  3NH0 A;  4B8C A;  3KLE A;  1D9D A;  2DFF A;  3ZSZ A;  2E6M A;  4DQQ A;  1QSS A;  4CJE A;  3SV3 A;  3NCI A;  3VQ7 A;  4C8L A;  1CXQ A;  1UAX A;  4LH5 A;  4FLY A;  1SKW A;  4FK0 A;  1RBT A;  3HJF A;  3OYE A;  1RT7 A;  4CES A;  4FM2 A;  4BE0 A;  4KI6 A;  2PZS A;  3QET A;  4KO0 A;  1BIU A;  5J1E A;  3OJS A;  1T7P A;  4DFJ A;  4OLA A;  4W5T A;  4BDP A;  2RF2 A;  2D0A A;  3K5N A;  4W5N A;  4DS4 A;  1BIS A;  1EP4 A;  4I9L A;  1RT6 A;  4B9N A;  4CGH A;  2KFN A;  4M42 A;  4CHP A;  2YNF A;  2WOM A;  4M3U A;  1U47 A;  4C8N A;  2XRI A;  3V9S A;  4ZTF A;  5C42 A;  4GW6 A;  3VA3 A;  3MXM A;  1SL1 A;  4IBN A;  1QQC A;  3AVK A;  4I2Q A;  3WNH A;  3HPO A;  2BDP A;  1WSJ A;  3HP9 A;  3A2F A;  4CJU A;  3NFA A;  3KK2 A;  3QIP A;  3NF6 A;  4FK4 A;  3TI0 A;  4N41 A;  1RDB A;  2D0C A;  4DTN A;  5FRM A;  1RBU A;  1XWL A;  1QSY A;  2YNH A;  5KGW A;  1NKB A;  3DRR A;  2HHX A;  2RN2 A;  1BHL A;  3O4N A;  3SUQ A;  1RDC A;  3OYL A;  4DQP A;  1LWF A;  4EP4 A;  5T7B A;  1HYS A;  2HHU A;  1ZBH A;  5C25 A;  1VSE A;  4K8X A;  4Z4C A;  5HRN A;  3K5M A;  1HPZ A;  3DYA A;  4Y1D A;  4FZY A;  1ZBL A;  1EX4 A;  3VN5 A;  1ASV A;  4HVJ A;  2FC0 A;  1WAF A;  4E3S A;  3TAR A;  3MXI A;  1NKE A;  4Z4F A;  2F8S A;  4FM1 A;  1VSH A;  4QOZ B;  1K6Y A;  2VWK A;  2B5J A;  2IAJ A;  4FVM A;  4FJM A;  1L3V A;  3NBP A;  4DMN A;  4N76 A;  4OKK A;  3OYC A;  3K59 A;  1KVB A;  2HNZ A;  3D45 A;  4ID1 A;  2JGU A;  4J2B A;  3V1O A;  4Z4H A;  4CIE A;  4DTR A;  4F2R A;  2DFE A;  4IDK A;  3EY1 A;  4CEQ A;  2W42 A;  3AA2 A;  2OZS A;  4O0J A;  3SUO A;  3VQD A;  1WAJ A;  4CEF A;  4JLH A;  4TSX A;  3DLB A;  4KTZ A;  3DLR A;  3K5L A;  3BDP A;  4KTQ A;  1LAW A;  4CF8 A;  1B9D A;  1BCM A;  3OYA A;  3AVL A;  1UA0 A;  4DQS A;  4E0D A;  4DTP A;  1U49 A;  1TV6 A;  1NOY A;  4FK2 A;  4AHV A;  2KQ2 A;  4LSL A;  3QLH A;  2JLE A;  1ZYQ A;  3QNO A;  2Y1I A;  3PX6 A;  3PX0 A;  1T03 A;  1WSG A;  3F9K A;  3CYM A;  4DU3 A;  4FJL A;  4NCA A;  2B4J A;  4M3R A;  4IG3 A;  2XY7 A;  2A1R A;  3K57 A;  4FM0 A;  4FJX A;  3MEC A;  1NK5 A;  4B9L A;  4OLB A;  4OGC A;  2BGG A;  3TAG A;  1BCO A;  3ZSW A;  1Y97 A;  2R7Y A;  1QHT A;  1FK9 A;  1J54 A;  3P5J A;  1UA1 A;  3KJV A;  3DLG A;  4O5B A;  4CJQ A;  4N5S A;  1T8E A;  4LD0 A;  1GOB A;  3NDK A;  1MU2 A;  4OVL A;  3KKS A;  4CEO A;  4DLE A;  3IAY A;  1S9G A;  1UOC A;  3IS9 A;  1LV5 A;  2XO7 A;  4CEA A;  4Z4G A;  4DQR A;  4AHC A;  4KFB A;  3ZCM A;  2OPR A;  4OKE A;  4B8A B;  5EU7 A;  3HM9 A;  4FLV A;  4FJ8 A;  2HHS A;  4CEB A;  5KTQ A;  3ISN C;  3NGI A;  3TAE A;  4W5R A;  3RMC A;  3S3N A;  3THV A;  4ZHR A;  3TAM A;  2QK9 A;  4E7I A;  1O1W A;  3CM6 A;  1VSJ A;  2Z1H A;  3OJU A;  5I42 A;  3DOK A;  5JS2 A;  5J2M A;  3KD1 E;  4PWD A;  4AHU A;  1LW2 A;  4J2E A;  3C94 A;  4CJL A;  1NJY A;  5HRS A;  4UQG A;  3S9H A;  2PYL A;  2OPQ A;  4K8Z A;  1RT4 A;  1FKO A;  3AVI A;  1SV5 A;  5SWM A;  5C24 A;  3TAF A;  3G10 A;  3HL8 A;  1DTT A;  4H4O A;  1TL3 A;  3WNE A;  1RTJ A;  3P1G A;  3ULD A;  1D9F A;  4M3Y A;  3T19 A;  2QKB A;  1TAU A;  3OYF A;  5CZ2 A;  3OY9 A;  1HJR A;  1WSH A;  3DMJ A;  3L3V A;  4CGJ A;  4IFV A;  3O3G A;  4BE1 A;  1RBV A;  2XY6 A;  4KAZ A;  2O4I A;  3F73 A;  1NKC A;  1G15 A;  2Z1I A;  3AVM A;  3PY8 A;  3V1R A;  4FLW A;  4CJK A;  1S9E A;  1GOC A;  1A5W A;  3M8S A;  3L2W A;  4BWJ A;  1WNS A;  2VG7 A;  3EYZ A;  3QIN A;  3VA0 A;  3NH1 A;  2ITG A;  5HRP A;  1TAQ A;  3VQ9 A;  1NK7 A;  4CK1 A;  1Q8I A;  2D0B A;  4CIF A;  5I3U A;  3AO2 A;  3SYZ A;  4CHZ A;  3CM5 A;  3TWH A;  3HVT A;  1RCH A;  3QER A;  2KFZ A;  4JRQ A;  2IS3 A;  3OYM A;  1UWB A;  3I8D A;  4FCY A;  3ZT2 A;  5J2N A;  3ZSX A;  3G0Z A;  4FZX C;  1S6Q A;  3K2P A;  4Z0U A;  5KGX A;  3L2V A;  1XHX A;  1X9S A;  2IC3 A;  1LW0 A;  1JLE A;  3AA5 X;  2HB5 A;  1TK8 A;  2IDO A;  4FLX A;  4ELT A;  3DM2 A;  4CJW A;  5KRS A;  2PY5 A;  3RR8 A;  4EP5 A;  4YFU A;  3ZT1 A;  3PV8 A;  2KZZ A;  1S1U A;  1NOZ A;  3SCX A;  1Q9Y A;  3SPY A;  1TVR A;  1WSI A;  1HYZ A;  3AVF A;  2ZE2 A;  1VSK A;  2YNI A;  4ZTJ A;  4CHN A;  5E41 A;  4FW2 A;  1CLQ A;  4NYN A;  5FDL A;  3P83 D;  4KI4 A;  2I5J A;  4KHQ A;  1KLN A;  2YHA A;  3KK3 A;  4YNQ A;  3OYB A;  1JLQ A;  4CEC A;  4DFM A;  3C6T A;  3LP2 A;  3MED A;  3QEX A;  2X6S A;  4CJF A;  5CY4 A;  2HVH A;  3KLF A;  2FBY A;  1C0M A;  4FLZ A;  2YNG A;  2DY4 A;  1ITG A;  1S1T A;  1VK0 A;  2RPI A;  3AVN A;  3KTQ A;  2G8V A;  1TKD A;  2OA8 A;  5FRO A;  3S3O A;  3UIQ A;  4RW4 A;  4DU1 A;  2RKI A;  1JXB A;  3ZT4 A;  4CJ5 A;  4B9U A;  2HHT A;  2QXF A;  1S6P A;  4R5P A;  3LZI A;  4Q0B A;  2KZM A;  4CED A;  1Q9X A;  1ASW A;  3HST B;  2Z1G A;  3V9Z A;  4ELU A;  4I2P A;  4ICL A;  1T05 A;  1QS4 A;  2B6A A;  1QSL A;  4CF2 A;  3B6O A;  4FJI A;  4KB1 A;  2DTU A;  4Y1C A;  4M45 A;  4E89 A;  3V9X A;  4HCC A;  4FJ7 A;  3KKR A;  4DTS A;  4FJN A;  4EZ6 A;  1SUQ A;  3I0S A;  3VQC A;  1DTQ A;  1SL0 A;  4CEE A;  3AO4 A;  4B3O A;  2HVI A;  4OPJ A;  4KHU A;  5HLF A;  3VQP A;  5JS1 A;  1C6V A;  3KLH A;  1HYV A;  3L2U A;  3NE6 A;  1KFD A;  4KV8 A;  1JLF A;  2HW3 A;  2X78 A;  3HPH A;  1TKZ A;  2EX3 A;  3OYH A;  3VQ8 A;  2ZD1 A;  4ELV A;  1NJZ A;  3O3H A;  1C0T A;  4FJ5 A;  1JLG A;  1ZBI A;  3QO9 A;  3NAE A;  3LP1 A;  3T3F A;  2GV9 A;  3HVR A;  4Z4E A;  4CF1 A;  3H08 A;  3ZSR A;  2YV0 X;  4Q5V A;  3TAP A;  1N6Q A;  3RR7 A;  1W9H A;  1BQN A;  5DMR A;  3NF9 A;  4N56 A;  4F8R A;  1ZBF A;  1RBR A;  4CK3 A;  3E01 A;  3QEI A;  4E7K A;  4DTO A;  1LAV A;  2VG5 A;  2X6N A;  4M41 A;  2QKK A;  2PYJ A;  2G8I A;  3OYJ A;  2ETJ A;  1JL2 A;  3HYF A;  3AO3 A;  4DSF A;  1FXX A;  4B9T A;  4KRF A;  4BAC A;  4E7L A;  3AVG A;  4DG1 A;  1IO2 A;  3RTV A;  4CFB A;  2O4G A;  3SNN A;  1IG9 A;  1X9M A;  5K14 A;  4DTJ A;  4F3T A;  3LAN A;  2BAN A;  4F4K A;  1RIL A;  2IOC A;  4CF9 A;  4HUE A;  1X9W A;  4B9M A;  4CGD A;  3T1A A;  3LAM A;  4I9Q A;  2AJQ A;  4CJV A;  4CGF A;  1RT5 A;  3VQB A;  3QES A;  1HMV A;  2XY5 A;  1KTQ A;  2Q3S A;  1CXU A;  1YVU A;  3KLG A;  3ITH A;  4I7F A;  3SZ2 A;  2G8W A;  1IKY A;  4DLG A;  3SQ2 A;  3TAN A;  1KSP A;  4B9V A;  2YHB A;  1C1B A;  4FJH A;  4CJP A;  3CQ8 A;  1EXQ A;  1HNV A;  4CGI A;  4C8M A;  4CJ3 A;  2HHW A;  3D0P A;  1S1X A;  4WE1 A;  3SV4 A;  4JRP A;  1NK6 A;  1J53 A;  1WSE A;  1WN7 A;  4B9S A;  2P51 A;  1TL1 A;  2BE2 A;  3KLI A;  4O44 A;  4W5O A;  4AHR A;  4OJR A;  2Y1J A;  2OZM A;  4Z4I A;  1RT2 A;  2IGI A;  3QIO A;  3LAL A;  4FJJ A;  2HND A;  3BGR A;  1B9F A;  1A5X A;  4E1N A;  3L8B A;  4C8K A;  4KB0 A;  3DRP A;  4DF4 A;  3MEE A;  3HO1 A;  4C8O A;  3VQ5 A;  3M8P A;  3L2R A;  4KHY A;  3RMD A;  3AVB A;  2GUI A;  1ZBU A;  1YTA A;  1RNH A;  1D5A A;  3L3U A;  5J2P A;  5CYQ A;  3IRX A;  5DK5 A;  5HBM A;  4O0I A;  3VQE A;  4KHW A;  2YKM A;  3MXJ A;  4CFC A;  4CEZ A;  4GMJ B;  3SJJ A;  3M8R A;  3RRG A;  1CZB A;  4M3Z A;  3CFR A;  1HQE A;  3HP6 A;  4CFA A;  1RBS A;  1XHZ A;  3HXM A;  4M3X A;  3VQA A;  1HNI A;  1HRH A;  4FLU A;  3PO5 A;  1L3U A;  5HRO A;  2LSN A;  4XIU A;  4DU4 A;  2VG6 A;  5D3G A;  2E6L A;  4N47 A;  4ID5 A;  3LP3 A;  2X74 A;  2HNY A;  4AHT A;  3DLE A;  1U45 A; 
#chains in the Genus database with same CATH topology
 4IEE A;  2QWL A;  3P4I A;  1SKR A;  2P9S B;  2A42 A;  3KK7 A;  3UKU A;  4BQZ A;  3LDN A;  4JI2 K;  1NJW A;  2GUP A;  4CFD A;  4MFB A;  3OVN A;  3V81 A;  3SUP A;  5J2Q A;  3JSM A;  3PUF A;  2Q2R A;  3BF1 A;  4BDY A;  4DTU A;  3K9K A;  4BRE A;  3SQ0 A;  3C6U A;  1F21 A;  4JK7 A;  1WBB A;  1SKS A;  4O8K A;  1NMD A;  3VQQ A;  3M1F A;  4WQ5 C;  2P9N B;  3SJH A;  1R59 O;  1KFS A;  3CC7 N;  4G1Q A;  3K5O A;  1RDU A;  4L8R B;  3ZSV A;  3WEE A;  2OPP A;  4FJK A;  3QNN A;  1JCG A;  1JCE A;  3V6D A;  3EZ5 A;  4BR4 A;  1IJJ A;  4F2S A;  2HHH K;  3LAK A;  4PY5 A;  3LDS A;  3H1Q A;  3MWT A;  4CW7 B;  4DTX A;  3NF8 A;  2V51 B;  4KHS A;  2FBT A;  3ID8 A;  5BRF A;  1Z26 A;  1NJI O;  2WBN A;  2O8B B;  1KCF A;  3T7Z A;  2F9W A;  1SL2 A;  1IKX A;  2CGK A;  4BVO A;  1Q86 O;  4A59 A;  3RRH A;  1FW6 A;  2GEL A;  1YIJ N;  5GAH P;  1U6Z A;  3SBG A;  1Z25 A;  3THX A;  2A41 A;  4GV9 A;  5BRE A;  3ASM A;  1RTH A;  2P9U A;  4QS7 A;  2FF6 A;  1J5O A;  1VQ5 N;  2OAN A;  3O3F A;  5ADX A;  3CHW A;  4IZ9 A;  1QQN A;  2Z1J A;  3UKR A;  3LM9 A;  4JS4 A;  2E1Z A;  4NYF A;  4LF6 K;  3PO4 A;  4IJA A;  5CE3 A;  4CE9 A;  3C65 A;  3DAW A;  4J2D A;  2P9S A;  4CCH A;  4YDU C;  3RMA A;  3U8X A;  4CHO A;  1VSF A;  2J4R A;  5AQY A;  3NHG A;  4B3M K;  4PQU A;  3S3M A;  3MN5 A;  5LL6 Z;  1FJG K;  3L4I A;  3TTD A;  3C7N B;  3C95 A;  4CBW A;  3SI6 A;  5M1F A;  2HHQ A;  1T6D A;  4RW6 A;  4K8Z A;  1KVA A;  4OKJ A;  1VSD A;  1IKV A;  3AA4 A;  1RTI A;  3OHR A;  4JKH A;  3R8E A;  3K9J A;  1LCU A;  5IT9 O;  4DF8 A;  2WON A;  4CZF A;  3PLA A;  3D6R A;  4CD3 A;  3TAB A;  1R0A A;  3AO5 A;  5CYM A;  4H8K A;  4KH6 A;  1A5V A;  5AQN A;  1NK4 A;  3CCE N;  3NH0 A;  4B8C A;  4BC2 A;  3ZSZ A;  2NRZ A;  3NCI A;  1UAX A;  4LH5 A;  3C0B A;  4KI6 A;  2FLO A;  5J1E A;  3OJS A;  4DQ8 A;  5BR9 A;  1YIT N;  4BDP A;  4JI6 K;  2RF2 A;  3CME N;  4FWR A;  1EP4 A;  1RT6 A;  4CGH A;  4K43 A;  5AQK A;  3V9S A;  2QA4 N;  4GW6 A;  4IOX A;  3HPO A;  2E5L K;  3VEO A;  3KK2 A;  3QIP A;  4FK4 A;  3TI0 A;  2HMP A;  5CR4 A;  1RBU A;  2CGL A;  3HTV A;  5I9E B;  5AQH A;  3H6E A;  3O4N A;  4WQ5 A;  2HHU A;  1ZBH A;  5C25 A;  1VSE A;  3Q7B A;  4Z4C A;  4PL7 A;  4Y1D A;  2E2P A;  3CCR N;  1EX4 A;  3S41 A;  1WAF A;  3TAR A;  2QI2 A;  1M90 O;  1DT9 A;  1NGC A;  2VWK A;  1NGE A;  2B5J A;  4FJM A;  1L3V A;  4H03 B;  4ID1 A;  3V1O A;  4CIE A;  3ID6 A;  1M1K O;  4CEQ A;  2W42 A;  2OZS A;  3W0L A;  4DR4 K;  3DLB A;  4CEF A;  3BDP A;  3DLR A;  4XH5 A;  4CF8 A;  2FXU A;  1B9D A;  2HST A;  4BRO A;  1TV6 A;  4AHV A;  1XUP O;  4JKF A;  2Y1I A;  1ESV A;  1WSG A;  4FJL A;  5KQD A;  3MEC A;  1MWK A;  4MDA A;  2R7Y A;  3JXU A;  4FOI A;  1UA1 A;  2A6A A;  3KJV A;  3JS6 A;  4O5B A;  4BRQ A;  5C10 A;  1T8E A;  1MU2 A;  4CEO A;  3CD6 N;  2KLA A;  3IAY A;  1UOC A;  1Y64 A;  3IS9 A;  4CEA A;  4EIA A;  5LJW A;  4KFB A;  1X3M A;  2OPR A;  1KD1 O;  5EU7 A;  2HHS A;  3FZH A;  3ISN C;  4AM7 A;  4W5R A;  5EVZ A;  4G9Z A;  3TAM A;  1VSJ A;  4ILJ A;  4YDU A;  3BUZ B;  2JWK A;  5JS2 A;  5KPR A;  3DLL L;  3KD1 E;  2IVO A;  4J2E A;  1RT4 A;  2D1K A;  2E20 A;  1SV5 A;  5SWM A;  3TAF A;  2PY5 A;  4A5A A;  3HL8 A;  4JAX A;  4H4O A;  3JAM O;  4MLE A;  2QKB A;  4HTL A;  3O9U A;  1HR0 K;  2QWM A;  4FWQ A;  4BE1 A;  5LMN K;  2O4I A;  3F73 A;  1NKC A;  3PY8 A;  4FLW A;  3FR0 A;  4WYB A;  1GOC A;  3M8S A;  4JN4 A;  1JCF A;  5AJ3 K;  1XC3 A;  5HRP A;  3AGR A;  3L0Q A;  1Q8I A;  1BU6 O;  1O13 A;  4CHZ A;  3CM5 A;  5BRH A;  3TWH A;  2KFZ A;  3VF6 A;  3ZSX A;  3G0Z A;  4BRA A;  4Z0U A;  5AQI A;  2O8E B;  1XHX A;  1LW0 A;  3AA5 X;  2IDO A;  3MN6 A;  3DM2 A;  4CJW A;  4IO8 A;  5KRS A;  4DV1 K;  4I6M A;  4JHD A;  3OA9 A;  4BRI A;  3CCJ N;  1TVR A;  3C6H A;  4CHN A;  1CLQ A;  4NYN A;  3C6T A;  3CJB A;  4CJF A;  2FBY A;  2I7P A;  1C0M A;  3WXM B;  2DY4 A;  2UUB K;  1W97 L;  3AVN A;  2G8V A;  2OA8 A;  5DM7 L;  3PSI A;  2ITM A;  1HLU A;  5LMU K;  2HHT A;  3ZET B;  4CED A;  1Q9X A;  4ELU A;  5EOY A;  1YHQ N;  1QSL A;  4KB1 A;  4CZK A;  2YHX A;  3V9X A;  4HCC A;  1NLV A;  4FJN A;  4EZ6 A;  4H0V B;  4BR9 A;  4PKH A;  2YI1 A;  1SL0 A;  4CEE A;  4MO4 A;  5TKY A;  5BRD A;  3L2U A;  3KLH A;  1HYV A;  1Z05 A;  4LF4 K;  1KFD A;  1NGB A;  2X78 A;  1TKZ A;  1TUU A;  1C0T A;  1JLG A;  1ZBI A;  5AQP A;  4EHT A;  4JKE A;  3LP1 A;  3T3F A;  2GV9 A;  3HVR A;  3H08 A;  3ZSR A;  4Q5V A;  4KH5 A;  4FVU A;  2ZF5 O;  3NF9 A;  4N56 A;  4F8R A;  4DTO A;  4M41 A;  2PYJ A;  2QKK A;  3W3D A;  3OYJ A;  2ETJ A;  2G8I A;  1JL2 A;  1FXX A;  4B9T A;  3O9T A;  4KRF A;  3M6G A;  3DXK B;  1VQO N;  2O8B A;  4FPB A;  3T1H K;  1MWM A;  5K14 A;  4DTJ A;  1NNE A;  4JEP A;  4I9Q A;  3LAM A;  1BG3 A;  4JI5 K;  1QVG M;  4BC4 A;  4DR6 K;  3AAQ A;  2G8W A;  3SQ2 A;  2YHB A;  1HNV A;  2NRT A;  1S1X A;  4JRP A;  1NK6 A;  1J53 A;  2BE2 A;  4A2A A;  3KHY A;  3HSC A;  4C8K A;  3HO1 A;  3DRP A;  3KWI A;  2GTD A;  3RMD A;  2GUI A;  5FPN A;  1D5A A;  5CYQ A;  4JI7 K;  3IRX A;  4PKG A;  3O80 A;  3FZL A;  4CEZ A;  4GMJ B;  4B1X B;  3M8R A;  3SJJ A;  2VGN A;  3EKU A;  3RSE A;  1XHZ A;  4QS9 A;  4M3X A;  3VQA A;  1HNI A;  3PO5 A;  4FLU A;  2P9K B;  2PBD A;  5D3G A;  4EAH D;  4M63 C;  3LP3 A;  2P9L A;  1V4S A;  4BY9 C;  3DXM A;  5M1P A;  4IOC L;  4AHT A;  1U45 A;  1L3S A;  4DTM A;  3V1Q A;  4M3W A;  1QTM A;  5CHI A;  2IIR A;  2G8U A;  4CF0 A;  2WUS A;  4E7H A;  1E4G T;  3F2K A;  1NGD A;  3HRG A;  4K8X A;  2FBX A;  3AA3 A;  1NK0 A;  3I8B A;  3TPQ A;  4BR0 A;  2F8T A;  4K25 A;  2QTD A;  3FZM A;  3OBY A;  1BI4 A;  1VRU A;  3FFI A;  2YKN A;  1EET A;  5JLH A;  2ZJR L;  3DLH A;  4QS8 A;  1REV A;  3SPZ A;  3MWP A;  3O4Q A;  1D8Y A;  3CJC A;  4ISE A;  3RWU A;  1XI1 A;  2DFH A;  1X1P A;  4CJT A;  3SUN A;  4CHY A;  1N32 K;  1GLC G;  3ENB A;  5F2R A;  3CET A;  3LP0 A;  4NCB A;  2ZQB A;  2E4L A;  4DSE A;  4HTU A;  4H5N A;  1DGK N;  4NCG A;  1U48 A;  4JKC A;  3KD5 E;  3IG1 A;  4JD2 A;  5FRN A;  1KC8 O;  4DQI A;  4DSL A;  4LC9 B;  2UUC K;  3I55 N;  3NF7 A;  3OS1 A;  3K0S A;  3PIO L;  4DR3 K;  1BDG A;  5SZT A;  3VEX A;  4JKA A;  1ASU A;  3LWM A;  1WSF A;  4JD2 B;  2RE2 A;  2V52 B;  4CJR A;  2G8K A;  5BN9 A;  3N4Q A;  1IG8 A;  5C2F A;  3TR8 A;  2QEX N;  1KVC A;  1BL3 A;  1EWR A;  1QE1 A;  4JI1 K;  3PIP L;  3DI6 A;  3VF4 A;  1JXE A;  4BWM A;  4FWP A;  3AVC A;  4AHS A;  1NJX A;  4KHN A;  4BRG A;  1YTU A;  4H5R A;  1E4F T;  4EZ9 A;  4W5Q A;  3ALY A;  4CIG A;  3OS2 A;  1U4B A;  2QWR A;  1OH6 A;  2E2Q A;  2IVN A;  3THX B;  2HBL A;  1ILY A;  3KIO A;  1I3A A;  5AQR A;  2NRR A;  1W0H A;  3ZX2 A;  4CBU A;  5E26 A;  3ZET A;  3M8Q A;  3PX4 A;  4IKF A;  2EWS A;  5AQZ A;  2Q0U A;  1XC9 A;  4QAG A;  4CGG A;  3VQ4 A;  4WFN L;  1ZBS A;  4OPH A;  3K58 A;  3UB5 A;  3CJ9 A;  3HK2 A;  4HUF A;  1LWC A;  3G71 N;  5HRR A;  3ZSQ A;  4H5T A;  3VQ6 A;  1SAZ A;  3AVA A;  4IXC A;  3AVJ A;  1C1C A;  1P8Z A;  2P5G A;  1TGO A;  3CJA A;  3DLK A;  1I39 A;  5KQ8 A;  4LF5 K;  3LZJ A;  1JKH A;  2P9I A;  4DWI A;  4RW9 A;  1XQS C;  3ZSO A;  1VSI A;  5E84 A;  4BDZ A;  4LF8 K;  2A1S A;  2FSK A;  5H1S Q;  3KLE A;  3E1Y A;  1OVY A;  4CJE A;  3SV3 A;  3SMS A;  3MCP A;  3I56 N;  2W40 A;  3A5M C;  4BE0 A;  1XMO K;  2PZS A;  4KO0 A;  3CCM N;  1QQO A;  1T7P A;  1N33 K;  4OO1 J;  4OLA A;  4W5T A;  2D0A A;  2Q1N A;  1BIS A;  4I9L A;  4C1N K;  2YNF A;  2WOM A;  3J81 O;  4DV7 K;  1U47 A;  1HX1 A;  4C8N A;  4ZTF A;  1RGI A;  4I2Q A;  1QQC A;  3WNH A;  2FSN A;  3N4P A;  1IBL K;  2BDP A;  3HP9 A;  3A2F A;  4ISG A;  4DV0 K;  4WQ4 A;  1D4X A;  1S72 N;  1U2V B;  1QSY A;  5KGW A;  2NNW A;  2P9P A;  2NLX A;  2HBK A;  2VQF K;  1LWF A;  1HJO A;  5T7B A;  2E2O A;  3GL1 A;  1N34 K;  5GIO A;  4FZY A;  4FSV A;  4DR2 K;  1ZBL A;  3VN5 A;  4Z4F A;  5ADX H;  2HF4 A;  1MDU B;  4JNE A;  1K6Y A;  2IAJ A;  1NM1 A;  1GLD G;  5AQQ A;  4EHU A;  1NGI A;  4PKI A;  3K59 A;  1KVB A;  4J2B A;  1NU0 A;  3TSQ A;  4NB4 A;  3THY A;  4F2R A;  2DFE A;  4IDK A;  4BRF A;  4J8F A;  2VWB A;  3A5L C;  3AA2 A;  5EXW A;  3ATU A;  2BH1 A;  3ULE B;  3T69 A;  5F1X A;  4TSX A;  3BZK A;  4KTZ A;  3K5L A;  1LAW A;  1LOT B;  4X66 K;  2ZGZ A;  5EY4 A;  3WQU A;  4DQS A;  5JVH L;  4B9Q A;  4DTP A;  4A5B A;  3RSE B;  3QLH A;  2JLE A;  3PX6 A;  4JI3 K;  3PX0 A;  3CYM A;  4NCA A;  2XY7 A;  4OGC A;  4KHP K;  1QQM A;  4DHY A;  1J54 A;  3DLG A;  5GAG P;  3NVK A;  5JVG L;  2AA4 A;  4Z4G A;  4DQR A;  1WBD A;  1YUW A;  4AHC A;  2O8F A;  5GIN A;  4XH1 A;  3R3L A;  5KTQ A;  3TAE A;  4X65 K;  3S3N A;  2O8D A;  4ZHR A;  2Z1H A;  3OJU A;  5I42 A;  3GDQ A;  4AHU A;  1NMN A;  3C94 A;  4JKB A;  1NJY A;  1N36 K;  4UQG A;  1T3V A;  1FKO A;  3MN7 A;  3AVI A;  5C24 A;  1DTT A;  1TL3 A;  3EO3 A;  3O08 A;  3ULD A;  4M3Y A;  2GWK A;  3OYF A;  4IFV A;  3O3G A;  4KAZ A;  2XY6 A;  3P39 A;  5AQO A;  1G15 A;  2Z1I A;  3V1R A;  1V4T A;  1WB9 A;  1YJW N;  4BWJ A;  2VG7 A;  1YAG A;  1TAQ A;  1NK7 A;  4CK1 A;  2D0B A;  3HOT A;  5I3U A;  5AQW A;  4BG9 A;  1OH7 A;  2IS3 A;  1UWB A;  4FCY A;  3ZT2 A;  1KQS M;  1S6Q A;  3K2P A;  1TUY A;  2KKZ A;  1X9S A;  2IC3 A;  3D7E O;  4FLX A;  1VAZ A;  1Q81 O;  2FSJ A;  4CI6 A;  3PV8 A;  4K41 A;  3SPY A;  1C0G A;  1HYZ A;  3AGK A;  2ZE2 A;  2YNI A;  3AVF A;  4RCH A;  2I5J A;  4AF1 A;  2YHA A;  3KK3 A;  1BWF O;  4DFM A;  1JLQ A;  4CEC A;  3MED A;  4YHH K;  5CY4 A;  2HVH A;  2UU9 K;  3BEX A;  4DUZ K;  4DCH A;  1KAY A;  1VK0 A;  3KTQ A;  1NGG A;  1IBM K;  3LDP A;  4X64 K;  4WQ4 C;  3S3O A;  3L6Q A;  4KH4 A;  4DU1 A;  4BGB A;  3CF5 L;  5ELZ A;  2Q0R A;  3DXK A;  4CF2 A;  4FJI A;  2ZJQ L;  4FJ7 A;  2QWN A;  3KKR A;  4DTS A;  3WT0 A;  4IDH A;  1VQL N;  3VQC A;  3CC2 N;  4M7Y A;  4WF9 L;  3AO4 A;  4B3O A;  2HVI A;  5JS1 A;  3VQP A;  4KV8 A;  3HPH A;  3TSP A;  3VGL A;  2EX3 A;  3OYH A;  4ELV A;  2ZD1 A;  4JK8 A;  5AR0 A;  3O3H A;  1NJZ A;  4FJ5 A;  3VPZ A;  3VEV A;  5BPN A;  3NAE A;  3WXL A;  1HPM A;  1W9H A;  5AQX A;  3E01 A;  3QEI A;  1X3N A;  4EFH A;  3CCQ N;  5HL7 L;  3HYF A;  3AO3 A;  3H46 O;  4C23 A;  4CD1 A;  3OTO K;  4E7L A;  2OCE A;  4DG1 A;  4CFB A;  4YY3 K;  3SNN A;  4DV4 K;  3LAN A;  5BPM A;  4GKJ K;  1RIL A;  4HUE A;  1YVN A;  3LM2 A;  4CJV A;  2VYP A;  2W41 A;  1RT5 A;  2XY5 A;  1KTQ A;  3ENH A;  1CXU A;  4I7F A;  3O5B A;  5IWA K;  1IKY A;  4DLG A;  3SZ2 A;  5HOO A;  1KSP A;  4B9V A;  1EXQ A;  5AQS A;  3RVC A;  3A5N C;  4C8M A;  1ZXO A;  3SV4 A;  2P51 A;  1T44 A;  2P9N A;  2IGI A;  3LAL A;  4IFE A;  4E1N A;  4AM6 A;  4DF4 A;  3MEE A;  2Q97 A;  4BRH A;  1Q18 A;  1RNH A;  3L3U A;  3SBT A;  3TU5 A;  1Q82 O;  5HBM A;  4O0I A;  2YKM A;  1OKJ A;  3MXJ A;  3CFR A;  1HQE A;  4H0X B;  2OTJ N;  1L3U A;  5HRO A;  2LSN A;  4DU4 A;  4H0P A;  1VQ8 N;  5LJV A;  4WCE L;  1KAZ A;  2HNY A;  4BRN A;  3DLE A;  2UXC K;  3LDL A;  5GAE P;  4HUG A;  2VQE K;  2ATQ A;  5AQU A;  1NBW A;  1VQ4 N;  3QBX A;  3V9U A;  2ZWH A;  2P9K A;  1S1W A;  4Z94 A;  3OS0 A;  3B6P A;  3VTH A;  4QCL A;  2PAV A;  2QW9 A;  3JYT A;  1NGF A;  3OYN A;  2E8A A;  4E1J A;  1NG9 A;  4CZI A;  4OPK A;  3AVH A;  5AZJ A;  5KPT A;  1IKW A;  3HPG A;  4JS5 A;  5M1K A;  2YJE A;  4M3T A;  4KTW A;  4RW7 A;  4CJ4 A;  1EQY A;  3O4W A;  3E9P A;  2P1J A;  1VRT A;  1I94 K;  4J2A A;  5JIC A;  4BR5 A;  1GLF O;  4B1W B;  4IG0 A;  1QZ5 A;  2G8H A;  3M3Z A;  2XHB A;  1CZA N;  2QWO A;  4DSJ A;  3R6M A;  3ZSY A;  1ZC6 A;  1VSM A;  3V9W A;  4PHT X;  1RTD A;  3MEG A;  2BUP A;  1NK9 A;  4WFA L;  3WXI A;  1DLO A;  1BIZ A;  3QEW A;  4AH9 A;  5FPE A;  3ATV A;  4DS5 A;  3CFP A;  3ZEU B;  1IH7 A;  1LWE A;  1TKT A;  4K0K K;  4JK9 A;  5C12 A;  3NH2 A;  1N8R O;  3AO1 A;  5FLX O;  3L2Q A;  1U04 A;  3HOS A;  3G4S N;  2W6K A;  2ZJP L;  3LPT A;  4HWI A;  1BUP A;  2NZT A;  3ENO A;  3LL3 A;  1C1A A;  3CQX A;  4CK2 A;  4LFB K;  4OGE A;  4AIL C;  4DFP A;  1GLJ O;  2KW4 A;  2P5O A;  4E7J A;  3VES A;  4RW8 A;  1IV0 A;  3CFO A;  1S1V A;  1BGX T;  1NK8 A;  3P38 A;  1GOA A;  2A40 A;  3SQ1 A;  4HCB A;  4CER A;  4CHQ A;  2F96 A;  4B3S K;  4PA1 A;  3RMB A;  1JLB A;  3CPW M;  2F7T A;  1B92 A;  2YCH A;  2UXB K;  4NLB A;  4RG8 A;  1HQU A;  3WNF A;  2OPS A;  1RDA A;  4BQL A;  2OYQ A;  3A8Y A;  3WNG A;  1CZ9 A;  3IMX A;  2A3Z A;  3OYK A;  2YHY A;  2W6L A;  1XNQ K;  5A2Q O;  4DV6 K;  5KRT A;  4O55 A;  2YHW A;  3WXK A;  4MQ3 A;  2GWJ A;  4ISF A;  4YOX A;  2HHV A;  3CMA N;  1VSL A;  4LH4 A;  3KK1 A;  1EKE A;  1D9D A;  2DFF A;  1QSS A;  2E6M A;  4DQQ A;  3VQ7 A;  1CXQ A;  4FLY A;  1RBT A;  3OYE A;  4FM2 A;  3QET A;  1BIU A;  4B1V A;  4W5N A;  4DS4 A;  3EZW A;  4B9N A;  2KFN A;  4M42 A;  4CHP A;  3I33 A;  2XRI A;  2D0P A;  5C42 A;  2QXL A;  4MLH A;  5FPD A;  3H3N O;  3VA3 A;  1YJ9 N;  1X9J A;  3AVK A;  5C2D A;  1WSJ A;  3CIP A;  4A61 A;  4CJU A;  3HM8 A;  3NFA A;  3CI5 A;  4L3Q A;  4FOE A;  4N41 A;  1RDB A;  5F0X A;  4DTN A;  1GLL O;  5FRM A;  3DXM B;  4C1N I;  3THW A;  1BA1 A;  1NKB A;  5AQM A;  3SUQ A;  4DQP A;  3OYL A;  2E2N A;  1HYS A;  4EP4 A;  4CVN E;  2GX9 A;  5HRN A;  5C15 A;  3K5M A;  4RTF D;  3EKS A;  4HVJ A;  2FC0 A;  4E3S A;  3DJC A;  5GAD P;  2F8S A;  4FM1 A;  1VSH A;  3VTI A;  5MLC Q;  4QOZ B;  4DR5 K;  3THW B;  1RFQ A;  3NBP A;  4OKK A;  3OYC A;  3VEZ A;  3D45 A;  1K9M O;  1K8A O;  3EY1 A;  4BRL A;  4O0J A;  3UKU B;  3VQD A;  4KTQ A;  4H0Y B;  3OYA A;  5JLF A;  4BRC A;  4WFB L;  1UA0 A;  2Q36 A;  5BR8 K;  3ZX0 A;  2KQ2 A;  5M1N A;  4CZL A;  3L4Q A;  3QNO A;  3D2F B;  2NRW A;  3F9K A;  1EWQ A;  4DU3 A;  2B4J A;  4M3R A;  5EX5 A;  2A1R A;  3E66 A;  3FE1 A;  4B9L A;  2BGG A;  3TAG A;  3ZSW A;  3H45 C;  4BRM A;  1QVF M;  1G99 A;  3P5J A;  4N5S A;  1DEJ A;  4LD0 A;  1GOB A;  3GBT A;  4FWN A;  4JKD A;  5JMV A;  3VER A;  4JKG A;  2XO7 A;  3ZCM A;  4B8A B;  3HM9 A;  4O8U A;  4BGA A;  4JYA K;  3NGI A;  2NRH A;  3SMP A;  3RMC A;  5BPL A;  3THV A;  1QZ6 A;  4E7I A;  1O1W A;  3J7Y P;  1LW2 A;  3GOI A;  2RHK A;  3FZK A;  3G10 A;  3IDH A;  3P1G A;  1TAU A;  1S22 A;  4I6M B;  4JHD B;  1K73 O;  4LF7 K;  4CGJ A;  3WEE B;  3MK6 A;  3VEW A;  1RBV A;  3BP8 A;  5AFU H;  3AVM A;  2FF3 B;  1S9E A;  4MO5 A;  3L2W A;  1WNS A;  3MX5 A;  3NH1 A;  3VEY A;  3AAP A;  3VQ9 A;  4FWK A;  3J7A P;  3AO2 A;  3H1V X;  3D2E A;  3SYZ A;  1SS6 A;  3HVT A;  1RCH A;  3MMV A;  3QER A;  4JRQ A;  3IFR A;  4A57 A;  4CZH A;  1MA9 B;  1BOT O;  4FZX C;  3EE8 A;  1P90 A;  4GV6 A;  4IO9 L;  1JLE A;  4ELT A;  2YX6 A;  2IVP A;  4EP5 A;  3RR8 A;  4UY8 O;  4YFU A;  3HZ6 A;  1NOZ A;  1Q9Y A;  1WSI A;  1VSK A;  4ZTJ A;  5E41 A;  4FW2 A;  2Q31 A;  3CCS N;  1KLN A;  4YNQ A;  3CXC M;  3QEX A;  2X6S A;  3TTC A;  3ZLJ A;  3E9L A;  4FLZ A;  4A62 A;  4CZM A;  4DR1 K;  3O8M A;  1S1T A;  2ASM A;  3O1W A;  2ASP A;  1TKD A;  1KXP A;  4RW4 A;  3EEQ A;  4B9U A;  2KZM A;  1DKG D;  1HNZ K;  3V9Z A;  2Z1G A;  4I2P A;  1T05 A;  3B6O A;  2DTU A;  5AZI B;  4JI4 K;  3I0S A;  4GNI A;  3IKM A;  4OPJ A;  1C6V A;  3TSU A;  4BR7 A;  4B3R K;  2HW3 A;  3BY5 A;  3CCU N;  3VQ8 A;  4CBX A;  3U9Z A;  3U9D A;  4BR2 A;  5AZJ B;  3QO9 A;  3T1Y K;  1N6Q A;  4PWD A;  3C6A A;  2YV0 X;  2P9P B;  1W7A A;  4H5V A;  4CK3 A;  4E7K A;  2CH5 A;  1LAV A;  2VG5 A;  3Q7C A;  3AVG A;  3WUH A;  1IG9 A;  3D2F A;  4K42 A;  4YOT A;  4F3T A;  4PL8 A;  4F4K A;  4CF9 A;  1X9W A;  5AQV A;  3T1A A;  3WQT A;  3SAF A;  4XH4 A;  4CGF A;  3MDQ A;  3VGM A;  3QES A;  1HMV A;  4JI8 K;  4OX9 K;  4H5W A;  2Q3S A;  2ZM6 K;  4BG8 A;  2UXD K;  4FWO A;  3ITH A;  1HKB A;  2UYT A;  4FJH A;  1C1B A;  3O9S A;  4CGI A;  2KHO A;  4JV5 K;  4CJ3 A;  1YF5 L;  4WE1 A;  5AQF A;  1WSE A;  1TL1 A;  1VHX A;  3KLI A;  4O44 A;  4W5O A;  4OJR A;  4Z4I A;  1HNX K;  1RT2 A;  1VQ6 N;  1EO1 A;  4KB0 A;  3CCV N;  3VQ5 A;  3L2R A;  4KHY A;  1ZBU A;  5C0Y A;  1YTA A;  1NGJ A;  5J2P A;  3TTF A;  4KHW A;  4CFC A;  4CZE A;  4DV3 K;  3RRG A;  1CZB A;  1OH5 A;  4FWM A;  1RBS A;  3HXM A;  1K8K A;  3WXJ A;  5DM6 L;  4XIU A;  2VG6 A;  2QM1 A;  4N47 A;  3AY9 A;  2X74 A;  4B3T K;  3ZT3 A;  3THY B;  3OYI A;  1RDW X;  3AV9 A;  4V19 S;  4BE2 A;  1HKC A;  3B8A X;  3FFK B;  3CC4 N;  1RT3 A;  4FL9 A;  4HHT A;  3BF3 A;  1JLA A;  4PUO A;  3SLC A;  3U3Y A;  2BTF A;  3LWL A;  3SQ4 A;  3LPU A;  5HP1 A;  4ILH A;  4LSN A;  3A5O C;  5KI6 A;  4KKO A;  2NUB A;  4CZJ A;  3QFU A;  3QEV A;  3OYG A;  1KLM A;  4GKK K;  3ZT0 A;  1JL1 A;  1RDD A;  4NXN K;  4OPA A;  4LF9 K;  3E9O A;  4F3O A;  4FW1 A;  4YOY A;  1TKX A;  3VET A;  2VWJ A;  4DKW A;  4F9O A;  4BC5 A;  2I7N A;  3CJ7 A;  4GY2 B;  2F9T A;  1RT1 A;  4FXD A;  4E19 A;  4FJG A;  4IFY A;  2VCP A;  3ZYY X;  3QB0 A;  4GVM A;  4B08 A;  2HMI A;  3KWG A;  3NGY A;  2O8D B;  1TK5 A;  1WLJ A;  2XY8 A;  3DOL A;  4O4G A;  4LY7 A;  4CJ7 A;  4NLC A;  3OYD A;  3NGZ A;  3VGK A;  4BRP A;  1ATN A;  4DSK A;  3J8A A;  1S5J A;  4BRK A;  2D5R A;  2V7Y A;  1L3T A;  2V7Z A;  1T6C A;  4FJ9 A;  3OW2 M;  5AQL A;  1HUX A;  4FYD A;  5M1Q A;  1JLC A;  4H4M A;  4FLT A;  4E1M A;  3V4I A;  1TK0 A;  3H3O B;  3U3G A;  4IJN A;  4IWV A;  3ZEU A;  3QEP A;  2GBZ A;  4DSI A;  1BI4 B;  4FZZ A;  1J9A A;  1KRP A;  1BQM A;  1L5U A;  2UUA K;  2A5X A;  3VMF B;  1C0U A;  1GLE G;  2FBV A;  3HT3 A;  2YJF A;  5AQJ A;  3G6E N;  4GV3 A;  2H3G X;  5CZ1 A;  3O9Q A;  3I0R A;  1FKP A;  2P9L B;  1YT3 A;  4DFK A;  3M5R A;  1TYQ B;  2WTU A;  4BRD A;  3UKR B;  1N5Y A;  4YOU A;  3U6F A;  3TAQ A;  4KPY A;  2EHG A;  3CG7 A;  1ATS A;  2KTQ A;  3MAQ A;  4CJS A;  2D4W A;  5GIP A;  3HBT A;  5LY3 A;  4DV2 K;  1VQN N;  5KPZ A;  2G8F A;  3DRS A;  3LDQ A;  4FPA A;  4C8L A;  1VQ7 N;  4B1U B;  1SKW A;  4FK0 A;  1HKG A;  3HJF A;  1RT7 A;  4CES A;  1XNR K;  4DFJ A;  3K5N A;  2GEM A;  3EE9 A;  4M3U A;  4B1Y B;  4KBO A;  3CER A;  3MXM A;  1SL1 A;  4IBN A;  1VQ9 N;  1SQK A;  1GLB G;  3DWL A;  3VEN A;  3NF6 A;  4BC3 A;  3OBW A;  2D0C A;  4U67 L;  3UE5 A;  2DPN A;  1XWL A;  1WOQ A;  2CGJ A;  2YNH A;  4YOR A;  3DRR A;  5FPM A;  1VQP N;  2HHX A;  2RN2 A;  1BHL A;  1RDC A;  1KAX A;  3VF2 A;  5AFU A;  3D2E B;  1J5E K;  1HPZ A;  3DYA A;  1VQK N;  1ASV A;  3SAG A;  4FO0 A;  1NKE A;  3MXI A;  3SAH A;  4YOW A;  4AQY K;  1IBK K;  4FVM A;  4DMN A;  4N76 A;  4DUY K;  2HNZ A;  2JGU A;  4H0O A;  4Z4H A;  4DTR A;  3R1X A;  5M1O A;  2WFB A;  3SUO A;  1Z6R A;  4U7B A;  1OH8 A;  1WAJ A;  4JLH A;  4OLB A;  3A0I X;  5AQT A;  1YI2 N;  4CZG A;  4RWT A;  1BCM A;  4LFA K;  2F4V K;  3AVL A;  1TYQ A;  4B1Z A;  4E0D A;  1U49 A;  1NOY A;  4FK2 A;  4LSL A;  1ZYQ A;  1NGH A;  1T03 A;  3G25 A;  4IG3 A;  3K57 A;  4FM0 A;  3O9R A;  4FJX A;  1NK5 A;  1BCO A;  1Y97 A;  1QHT A;  2O8E A;  1FK9 A;  1S3X A;  4CJQ A;  3NDK A;  2OTL N;  4OVL A;  3KKS A;  4DLE A;  4ILG B;  3FGU A;  1S9G A;  1LV5 A;  3FZF A;  2ASO A;  3ZX3 A;  1ATR A;  2P9I B;  4OKE A;  4FLV A;  4FJ8 A;  1H1V A;  4CEB A;  4DV5 K;  2ZGY A;  3VOV A;  4DB3 A;  2QK9 A;  3CM6 A;  4JKG B;  3DOK A;  5J2M A;  2JWL A;  4CJL A;  2HOE A;  5HRS A;  3S9H A;  2PYL A;  2OPQ A;  3SK3 A;  1D9F A;  3WNE A;  2HF3 A;  1RTJ A;  3NMU A;  3T19 A;  1C0F A;  1E3M A;  5CZ2 A;  3OY9 A;  1HJR A;  1WSH A;  3DMJ A;  3L3V A;  1VQM N;  3AAR A;  2VGM A;  4CJK A;  1A5W A;  5AQG A;  4FWL A;  3EYZ A;  3QIN A;  2QWQ A;  3VA0 A;  3EL2 A;  2ITG A;  3CJ1 A;  4CIF A;  2QWP A;  1GLA G;  3QFP A;  4LFC K;  4IEI A;  3OYM A;  3I8D A;  5J2N A;  3J7Z O;  3EN9 A;  5KGX A;  3L2V A;  1J6Z A;  3NVM A;  3F5T A;  2HB5 A;  1TK8 A;  3ZT1 A;  2KZZ A;  1S1U A;  1BA0 A;  3SCX A;  2WC9 A;  5FDL A;  4KI4 A;  3P83 D;  3GE1 A;  4KHQ A;  1OVQ A;  3OYB A;  3LP2 A;  3KLF A;  3KZB A;  4BVP A;  2YNG A;  1ITG A;  2PFU A;  2RPI A;  1QHA A;  1W2B M;  5FRO A;  4R79 A;  3UIQ A;  2RKI A;  1JXB A;  3ZT4 A;  4CJ5 A;  2QXF A;  4MDB A;  3CCL N;  1S6P A;  4R5P A;  3LZI A;  4Q0B A;  1ASW A;  3HST B;  4ICL A;  1QS4 A;  2B6A A;  4Y1C A;  4M45 A;  4E89 A;  2HBJ A;  1SUQ A;  1DTQ A;  3GG4 A;  3LDO A;  4KHU A;  3CQY A;  5HLF A;  2E1Y A;  3NE6 A;  1JLF A;  3QIC A;  3J80 O;  1SZ2 A;  1HNW K;  3R9P A;  4JI0 K;  3C7N A;  3U4L A;  3MN9 A;  2O8C A;  4Z4E A;  4CF1 A;  3TAP A;  3O6W A;  3RR7 A;  1BQN A;  5DMR A;  2P9U B;  2CH6 A;  1NWK A;  1ZBF A;  3QML A;  4NXM K;  2O8F B;  1RBR A;  2X6N A;  4H0T B;  3F9M A;  4DSF A;  4DR7 K;  1WUA A;  4BAC A;  1XMQ K;  1IO2 A;  5B8H A;  1Q7Y O;  3RTV A;  2O4G A;  2NRX A;  1X9M A;  5TKW A;  1K8K B;  2BAN A;  2IOC A;  4B9M A;  4CGD A;  4YOV A;  1NGA A;  2AJQ A;  1YJN N;  4IOA L;  3VQB A;  1YVU A;  2D0O A;  3KLG A;  3MX2 A;  3TAN A;  3ULE A;  4CJP A;  3CQ8 A;  3CPE A;  4Y0W A;  2HHW A;  2O8C B;  4X62 K;  2NRV A;  3FLC O;  3D0P A;  4B9S A;  1WN7 A;  2E88 A;  2OZM A;  4AHR A;  2Y1J A;  3QIO A;  3BZC A;  4FJJ A;  1YXQ A;  2HND A;  3P31 A;  3BGR A;  5AZI A;  1B9F A;  1A5X A;  2HBM A;  3HI0 A;  3KVG A;  3L8B A;  3QBW A;  4FWS A;  4C8O A;  3M8P A;  3AVB A;  4XEI A;  1BO5 O;  5DK5 A;  3VQE A;  3PSF A;  4NO7 A;  4A2B A;  2AP1 A;  3IUC A;  4M3Z A;  3HP6 A;  4CFA A;  3MCA B;  4O5F A;  3QDK A;  1HRH A;  1JJ2 M;  5BN8 A;  2E6L A;  3O1B A;  4GVE A;  4ID5 A;  4M7X A;  1U2V A;  4KRE A; 
#chains in the Genus database with same CATH homology
 1L3S A;  3ZT3 A;  4HUG A;  4DTM A;  1SKR A;  3OYI A;  2ATQ A;  3V1Q A;  4M3W A;  3AV9 A;  1QTM A;  4BE2 A;  3V9U A;  2G8U A;  4CF0 A;  4E7H A;  1S1W A;  1RT3 A;  4HHT A;  1NJW A;  3OS0 A;  3B6P A;  4QCL A;  1JLA A;  2FBX A;  4CFD A;  4MFB A;  3OVN A;  3JYT A;  3V81 A;  3OYN A;  3U3Y A;  3SUP A;  5J2Q A;  4PUO A;  4OPK A;  3LWL A;  3SQ4 A;  3AA3 A;  3AVH A;  3LPU A;  3JSM A;  3PUF A;  5HP1 A;  1NK0 A;  2F8T A;  4LSN A;  1BI4 A;  1VRU A;  3FFI A;  4BDY A;  4DTU A;  1IKW A;  2YKN A;  1EET A;  3HPG A;  3SQ0 A;  5KI6 A;  3DLH A;  3C6U A;  2NUB A;  1F21 A;  4KKO A;  3QEV A;  4JS5 A;  1REV A;  3OYG A;  3SPZ A;  1D8Y A;  3O4Q A;  1KLM A;  1SKS A;  3ZT0 A;  1JL1 A;  3RWU A;  1RDD A;  3VQQ A;  1XI1 A;  2DFH A;  4M3T A;  4F3O A;  1X1P A;  4FW1 A;  4KTW A;  4RW7 A;  4CJT A;  4CJ4 A;  4CHY A;  4G1Q A;  1TKX A;  3SUN A;  1KFS A;  3K5O A;  2VWJ A;  4L8R B;  3LP0 A;  3ZSV A;  4NCB A;  2ZQB A;  2E4L A;  2OPP A;  2P1J A;  1VRT A;  4J2A A;  4DSE A;  4HTU A;  4FJK A;  3QNN A;  4NCG A;  1U48 A;  3KD5 E;  4IG0 A;  3IG1 A;  1RT1 A;  3EZ5 A;  3V6D A;  2G8H A;  4FXD A;  2XHB A;  4F2S A;  5FRN A;  4E19 A;  4FJG A;  4IFY A;  3LAK A;  4DQI A;  4DSJ A;  4DSL A;  4B08 A;  4GVM A;  3ZSY A;  3LDS A;  4PY5 A;  4KRE A;  2HMI A;  1VSM A;  3V9W A;  3NF7 A;  4DTX A;  3NGY A;  3OS1 A;  1RTD A;  3NF8 A;  1TK5 A;  4KHS A;  2FBT A;  1WLJ A;  2XY8 A;  3DOL A;  3MEG A;  5SZT A;  1Z26 A;  4O4G A;  4LY7 A;  1NK9 A;  3OYD A;  3NGZ A;  1DLO A;  1BIZ A;  3QEW A;  1ASU A;  1KCF A;  4AH9 A;  3LWM A;  1SL2 A;  1WSF A;  1IKX A;  4DS5 A;  4DSK A;  4CJR A;  2G8K A;  1S5J A;  3CFP A;  2D5R A;  3TR8 A;  1IH7 A;  1LWE A;  3RRH A;  1TKT A;  1KVC A;  1BL3 A;  1L3T A;  1Z25 A;  1QE1 A;  4FJ9 A;  3NH2 A;  3AO1 A;  3L2Q A;  3DI6 A;  4FYD A;  1U04 A;  1JXE A;  1JLC A;  4BWM A;  4H4M A;  3AVC A;  4AHS A;  4FLT A;  3ASM A;  4E1M A;  1RTH A;  3LPT A;  3V4I A;  1TK0 A;  1NJX A;  4KHN A;  1J5O A;  1YTU A;  3U3G A;  3O3F A;  1C1A A;  3QEP A;  4EZ9 A;  2GBZ A;  4DSI A;  2Z1J A;  4W5Q A;  3ALY A;  4CIG A;  4CK2 A;  3OS2 A;  4OGE A;  1BI4 B;  1U4B A;  4JS4 A;  4AIL C;  4DFP A;  4NYF A;  2KW4 A;  4FZZ A;  1J9A A;  2P5O A;  4E7J A;  3PO4 A;  4RW8 A;  1KRP A;  3KIO A;  1I3A A;  1BQM A;  3CFO A;  1W0H A;  1L5U A;  1S1V A;  1BGX T;  3PX4 A;  3M8Q A;  1NK8 A;  1C0U A;  4IKF A;  1XC9 A;  4CE9 A;  4QAG A;  4CGG A;  2FBV A;  1GOA A;  3VQ4 A;  4J2D A;  3HT3 A;  3SQ1 A;  5CZ1 A;  4HCB A;  4CCH A;  3I0R A;  3K58 A;  4CER A;  4CHQ A;  3RMA A;  4CHO A;  2F96 A;  1VSF A;  3HK2 A;  3NHG A;  4PA1 A;  4HUF A;  3RMB A;  1LWC A;  4PQU A;  1JLB A;  1FKP A;  3S3M A;  1YT3 A;  4DFK A;  5HRR A;  3ZSQ A;  3VQ6 A;  1B92 A;  3AVA A;  4RG8 A;  3AVJ A;  1C1C A;  1HQU A;  3C95 A;  3WNF A;  1N5Y A;  2OPS A;  1RDA A;  3SI6 A;  3U6F A;  1TGO A;  2P5G A;  2OYQ A;  3DLK A;  1I39 A;  2HHQ A;  3TAQ A;  4KPY A;  2EHG A;  3CG7 A;  1CZ9 A;  4RW6 A;  1JKH A;  1KVA A;  4OKJ A;  3WNG A;  3LZJ A;  1VSD A;  3OYK A;  4DWI A;  2KTQ A;  3AA4 A;  1IKV A;  4RW9 A;  1RTI A;  3MAQ A;  4CJS A;  5KRT A;  4DF8 A;  2WON A;  3ZSO A;  1VSI A;  4O55 A;  3TAB A;  1R0A A;  3AO5 A;  5CYM A;  4H8K A;  4MQ3 A;  4BDZ A;  2HHV A;  2A1S A;  1A5V A;  1VSL A;  4LH4 A;  3KK1 A;  1NK4 A;  2G8F A;  1EKE A;  3DRS A;  3NH0 A;  4B8C A;  3KLE A;  1D9D A;  2DFF A;  3ZSZ A;  2E6M A;  4DQQ A;  1QSS A;  4CJE A;  3SV3 A;  3NCI A;  3VQ7 A;  4C8L A;  1CXQ A;  1UAX A;  4LH5 A;  4FLY A;  1SKW A;  4FK0 A;  1RBT A;  3HJF A;  3OYE A;  1RT7 A;  4CES A;  4FM2 A;  4BE0 A;  4KI6 A;  2PZS A;  3QET A;  4KO0 A;  1BIU A;  5J1E A;  3OJS A;  1T7P A;  4DFJ A;  4OLA A;  4W5T A;  4BDP A;  2RF2 A;  2D0A A;  3K5N A;  4W5N A;  4DS4 A;  1BIS A;  1EP4 A;  4I9L A;  1RT6 A;  4B9N A;  4CGH A;  2KFN A;  4M42 A;  4CHP A;  2YNF A;  2WOM A;  4M3U A;  1U47 A;  4C8N A;  2XRI A;  3V9S A;  4ZTF A;  5C42 A;  4GW6 A;  3VA3 A;  3MXM A;  1SL1 A;  4IBN A;  1QQC A;  3AVK A;  4I2Q A;  3WNH A;  3HPO A;  2BDP A;  1WSJ A;  3HP9 A;  3A2F A;  4CJU A;  3NFA A;  3KK2 A;  3QIP A;  3NF6 A;  4FK4 A;  3TI0 A;  4N41 A;  1RDB A;  2D0C A;  4DTN A;  5FRM A;  1RBU A;  1XWL A;  1QSY A;  2YNH A;  5KGW A;  1NKB A;  3DRR A;  2HHX A;  2RN2 A;  1BHL A;  3O4N A;  3SUQ A;  1RDC A;  3OYL A;  4DQP A;  1LWF A;  4EP4 A;  5T7B A;  1HYS A;  2HHU A;  1ZBH A;  5C25 A;  1VSE A;  4K8X A;  4Z4C A;  5HRN A;  3K5M A;  1HPZ A;  3DYA A;  4Y1D A;  4FZY A;  1ZBL A;  1EX4 A;  3VN5 A;  1ASV A;  4HVJ A;  2FC0 A;  1WAF A;  4E3S A;  3TAR A;  3MXI A;  1NKE A;  4Z4F A;  2F8S A;  4FM1 A;  1VSH A;  4QOZ B;  1K6Y A;  2VWK A;  2B5J A;  2IAJ A;  4FVM A;  4FJM A;  1L3V A;  3NBP A;  4DMN A;  4N76 A;  4OKK A;  3OYC A;  3K59 A;  1KVB A;  2HNZ A;  3D45 A;  4ID1 A;  2JGU A;  4J2B A;  3V1O A;  4Z4H A;  4CIE A;  4DTR A;  4F2R A;  2DFE A;  4IDK A;  3EY1 A;  4CEQ A;  2W42 A;  3AA2 A;  2OZS A;  4O0J A;  3SUO A;  3VQD A;  1WAJ A;  4CEF A;  4JLH A;  4TSX A;  3DLB A;  4KTZ A;  3DLR A;  3K5L A;  3BDP A;  4KTQ A;  1LAW A;  4CF8 A;  1B9D A;  1BCM A;  3OYA A;  3AVL A;  1UA0 A;  4DQS A;  4E0D A;  4DTP A;  1U49 A;  1TV6 A;  1NOY A;  4FK2 A;  4AHV A;  2KQ2 A;  4LSL A;  3QLH A;  2JLE A;  1ZYQ A;  3QNO A;  2Y1I A;  3PX6 A;  3PX0 A;  1T03 A;  1WSG A;  3F9K A;  3CYM A;  4DU3 A;  4FJL A;  4NCA A;  2B4J A;  4M3R A;  4IG3 A;  2XY7 A;  2A1R A;  3K57 A;  4FM0 A;  4FJX A;  3MEC A;  1NK5 A;  4B9L A;  4OLB A;  4OGC A;  2BGG A;  3TAG A;  1BCO A;  3ZSW A;  1Y97 A;  2R7Y A;  1QHT A;  1FK9 A;  1J54 A;  3P5J A;  1UA1 A;  3KJV A;  3DLG A;  4O5B A;  4CJQ A;  4N5S A;  1T8E A;  4LD0 A;  1GOB A;  3NDK A;  1MU2 A;  4OVL A;  3KKS A;  4CEO A;  4DLE A;  3IAY A;  1S9G A;  1UOC A;  3IS9 A;  1LV5 A;  2XO7 A;  4CEA A;  4Z4G A;  4DQR A;  4AHC A;  4KFB A;  3ZCM A;  2OPR A;  4OKE A;  4B8A B;  5EU7 A;  3HM9 A;  4FLV A;  4FJ8 A;  2HHS A;  4CEB A;  5KTQ A;  3ISN C;  3NGI A;  3TAE A;  4W5R A;  3RMC A;  3S3N A;  3THV A;  4ZHR A;  3TAM A;  2QK9 A;  4E7I A;  1O1W A;  3CM6 A;  1VSJ A;  2Z1H A;  3OJU A;  5I42 A;  3DOK A;  5JS2 A;  5J2M A;  3KD1 E;  4PWD A;  4AHU A;  1LW2 A;  4J2E A;  3C94 A;  4CJL A;  1NJY A;  5HRS A;  4UQG A;  3S9H A;  2PYL A;  2OPQ A;  4K8Z A;  1RT4 A;  1FKO A;  3AVI A;  1SV5 A;  5SWM A;  5C24 A;  3TAF A;  3G10 A;  3HL8 A;  1DTT A;  4H4O A;  1TL3 A;  3WNE A;  1RTJ A;  3P1G A;  3ULD A;  1D9F A;  4M3Y A;  3T19 A;  2QKB A;  1TAU A;  3OYF A;  5CZ2 A;  3OY9 A;  1HJR A;  1WSH A;  3DMJ A;  3L3V A;  4CGJ A;  4IFV A;  3O3G A;  4BE1 A;  1RBV A;  2XY6 A;  4KAZ A;  2O4I A;  3F73 A;  1NKC A;  1G15 A;  2Z1I A;  3AVM A;  3PY8 A;  3V1R A;  4FLW A;  4CJK A;  1S9E A;  1GOC A;  1A5W A;  3M8S A;  3L2W A;  4BWJ A;  1WNS A;  2VG7 A;  3EYZ A;  3QIN A;  3VA0 A;  3NH1 A;  2ITG A;  5HRP A;  1TAQ A;  3VQ9 A;  1NK7 A;  4CK1 A;  1Q8I A;  2D0B A;  4CIF A;  5I3U A;  3AO2 A;  3SYZ A;  4CHZ A;  3CM5 A;  3TWH A;  3HVT A;  1RCH A;  3QER A;  2KFZ A;  4JRQ A;  2IS3 A;  3OYM A;  1UWB A;  3I8D A;  4FCY A;  3ZT2 A;  5J2N A;  3ZSX A;  3G0Z A;  4FZX C;  1S6Q A;  3K2P A;  4Z0U A;  5KGX A;  3L2V A;  1XHX A;  1X9S A;  2IC3 A;  1LW0 A;  1JLE A;  3AA5 X;  2HB5 A;  1TK8 A;  2IDO A;  4FLX A;  4ELT A;  3DM2 A;  4CJW A;  5KRS A;  2PY5 A;  3RR8 A;  4EP5 A;  4YFU A;  3ZT1 A;  3PV8 A;  2KZZ A;  1S1U A;  1NOZ A;  3SCX A;  1Q9Y A;  3SPY A;  1TVR A;  1WSI A;  1HYZ A;  3AVF A;  2ZE2 A;  1VSK A;  2YNI A;  4ZTJ A;  4CHN A;  5E41 A;  4FW2 A;  1CLQ A;  4NYN A;  5FDL A;  3P83 D;  4KI4 A;  2I5J A;  4KHQ A;  1KLN A;  2YHA A;  3KK3 A;  4YNQ A;  3OYB A;  1JLQ A;  4CEC A;  4DFM A;  3C6T A;  3LP2 A;  3MED A;  3QEX A;  2X6S A;  4CJF A;  5CY4 A;  2HVH A;  3KLF A;  2FBY A;  1C0M A;  4FLZ A;  2YNG A;  2DY4 A;  1ITG A;  1S1T A;  1VK0 A;  2RPI A;  3AVN A;  3KTQ A;  2G8V A;  1TKD A;  2OA8 A;  5FRO A;  3S3O A;  3UIQ A;  4RW4 A;  4DU1 A;  2RKI A;  1JXB A;  3ZT4 A;  4CJ5 A;  4B9U A;  2HHT A;  2QXF A;  1S6P A;  4R5P A;  3LZI A;  4Q0B A;  2KZM A;  4CED A;  1Q9X A;  1ASW A;  3HST B;  2Z1G A;  3V9Z A;  4ELU A;  4I2P A;  4ICL A;  1T05 A;  1QS4 A;  2B6A A;  1QSL A;  4CF2 A;  3B6O A;  4FJI A;  4KB1 A;  2DTU A;  4Y1C A;  4M45 A;  4E89 A;  3V9X A;  4HCC A;  4FJ7 A;  3KKR A;  4DTS A;  4FJN A;  4EZ6 A;  1SUQ A;  3I0S A;  3VQC A;  1DTQ A;  1SL0 A;  4CEE A;  3AO4 A;  4B3O A;  2HVI A;  4OPJ A;  4KHU A;  5HLF A;  3VQP A;  5JS1 A;  1C6V A;  3KLH A;  1HYV A;  3L2U A;  3NE6 A;  1KFD A;  4KV8 A;  1JLF A;  2HW3 A;  2X78 A;  3HPH A;  1TKZ A;  2EX3 A;  3OYH A;  3VQ8 A;  2ZD1 A;  4ELV A;  1NJZ A;  3O3H A;  1C0T A;  4FJ5 A;  1JLG A;  1ZBI A;  3QO9 A;  3NAE A;  3LP1 A;  3T3F A;  2GV9 A;  3HVR A;  4Z4E A;  4CF1 A;  3H08 A;  3ZSR A;  2YV0 X;  4Q5V A;  3TAP A;  1N6Q A;  3RR7 A;  1W9H A;  1BQN A;  5DMR A;  3NF9 A;  4N56 A;  4F8R A;  1ZBF A;  1RBR A;  4CK3 A;  3E01 A;  3QEI A;  4E7K A;  4DTO A;  1LAV A;  2VG5 A;  2X6N A;  4M41 A;  2QKK A;  2PYJ A;  2G8I A;  3OYJ A;  2ETJ A;  1JL2 A;  3HYF A;  3AO3 A;  4DSF A;  1FXX A;  4B9T A;  4KRF A;  4BAC A;  4E7L A;  3AVG A;  4DG1 A;  1IO2 A;  3RTV A;  4CFB A;  2O4G A;  3SNN A;  1IG9 A;  1X9M A;  5K14 A;  4DTJ A;  4F3T A;  3LAN A;  2BAN A;  4F4K A;  1RIL A;  2IOC A;  4CF9 A;  4HUE A;  1X9W A;  4B9M A;  4CGD A;  3T1A A;  3LAM A;  4I9Q A;  2AJQ A;  4CJV A;  4CGF A;  1RT5 A;  3VQB A;  3QES A;  1HMV A;  2XY5 A;  1KTQ A;  2Q3S A;  1CXU A;  1YVU A;  3KLG A;  3ITH A;  4I7F A;  3SZ2 A;  2G8W A;  1IKY A;  4DLG A;  3SQ2 A;  3TAN A;  1KSP A;  4B9V A;  2YHB A;  1C1B A;  4FJH A;  4CJP A;  3CQ8 A;  1EXQ A;  1HNV A;  4CGI A;  4C8M A;  4CJ3 A;  2HHW A;  3D0P A;  1S1X A;  4WE1 A;  3SV4 A;  4JRP A;  1NK6 A;  1J53 A;  1WSE A;  1WN7 A;  4B9S A;  2P51 A;  1TL1 A;  2BE2 A;  3KLI A;  4O44 A;  4W5O A;  4AHR A;  4OJR A;  2Y1J A;  2OZM A;  4Z4I A;  1RT2 A;  2IGI A;  3QIO A;  3LAL A;  4FJJ A;  2HND A;  3BGR A;  1B9F A;  1A5X A;  4E1N A;  3L8B A;  4C8K A;  4KB0 A;  3DRP A;  4DF4 A;  3MEE A;  3HO1 A;  4C8O A;  3VQ5 A;  3M8P A;  3L2R A;  4KHY A;  3RMD A;  3AVB A;  2GUI A;  1ZBU A;  1YTA A;  1RNH A;  1D5A A;  3L3U A;  5J2P A;  5CYQ A;  3IRX A;  5DK5 A;  5HBM A;  4O0I A;  3VQE A;  4KHW A;  2YKM A;  3MXJ A;  4CFC A;  4CEZ A;  4GMJ B;  3SJJ A;  3M8R A;  3RRG A;  1CZB A;  4M3Z A;  3CFR A;  1HQE A;  3HP6 A;  4CFA A;  1RBS A;  1XHZ A;  3HXM A;  4M3X A;  3VQA A;  1HNI A;  1HRH A;  4FLU A;  3PO5 A;  1L3U A;  5HRO A;  2LSN A;  4XIU A;  4DU4 A;  2VG6 A;  5D3G A;  2E6L A;  4N47 A;  4ID5 A;  3LP3 A;  2X74 A;  2HNY A;  4AHT A;  3DLE A;  1U45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...