4LFCK

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lfcK00
4JV5K 4DV3K 3J80O 1XNQK 2ZM6K 4NXMK 4DR4K 4LF8K 4LF6K 3JAMO 5A2QO 4YHHK 4X66K 4YY3K 5LMUK 4LF4K 4JI4K 4GKJK 4B3MK 4X65K 4DUYK 4JI0K 4DR3K 4JI5K 5IT9O 4DV1K 4JI2K 4KHPK 1N34K 3J7AP 4LFBK 4DV6K 4JI8K 4DUZK 4LFCK 1XNRK 4AQYK 4JI3K 4JYAK 4B3TK 4CW7B 1XMQK 3J7YP 4LFAK 2UUAK 4DR1K 4JI1K 4JI7K 2VQFK 4V19S 1HR0K 4LF9K 1N36K 5BR8K 4X64K 2UXBK 3T1YK 1HNZK 4DR2K 5FLXO 2UUBK 1N32K 4DV5K 2UXCK 4LF7K 4X62K 2UUCK 4JI6K 1J5EK 1I94K 4DV7K 3J81O 4B3SK 2HHHK 3T1HK 4LF5K 5IWAK 4K0KK 1FJGK 2UU9K 1IBMK 4DR7K 1IBKK 4DV4K 2VQEK 4B3RK 1N33K 1HNXK 4DV2K 4NXNK 2F4VK 4DR6K 3OTOK 5LL6Z 1XMOK 5AJ3K 1IBLK 4CVNE 1HNWK 4DV0K 2E5LK 4OX9K 4DR5K 2UXDK 4GKKK 5LMNK
chains in the Genus database with same CATH superfamily
5AZIB 3O3FA 4H4OA 2NNWA 4CJSA 5HRNA 1VQ5N 4FM1A 4M7XA 3QDKA 3RMDA 4KHWA 4NXMK 1BUPA 4BRAA 4FLTA 1YVUA 3ZT1A 2FSJA 3SLCA 3OYBA 2HNZA 4RCHA 1C0MA 1EQYA 1A5WA 2PY5A 1U2VA 1JCFA 3KK3A 1JLBA 1VK0A 4PKHA 4WQ5C 4NCGA 2PYJA 2WFBA 4JKCA 2E20A 3M8QA 3CQYA 4BC5A 3H45C 1TKTA 1U45A 2OTLN 4ZHRA 1KQSM 5M1NA 3JXUA 3U9DA 1F21A 4IBNA 3PX0A 2HNYA 2P9UB 1HR0K 3SQ1A 3O4WA 4BG9A 3SAFA 4C8LA 2YI1A 2A41A 4JD2B 1LAVA 4FK0A 3ZSXA 4BRMA 4FLXA 1BI4B 1YITN 4CZFA 2UUBK 3MCPA 2B6AA 2AP1A 2QI2A 3WNEA 4WF9L 3CD6N 3V9ZA 1YTAA 3LDQA 1KVCA 1NJIO 1TL3A 4KTWA 3KK7A 4DTUA 3UIQA 2QW9A 4CZMA 3TABA 2VQEK 4CJ4A 3V4IA 4GV3A 4ISGA 4JNEA 4DV2K 1HYZA 1QS4A 3QEPA 2FBXA 3DLEA 1OH8A 1RBVA 4BRKA 5EXWA 3OYFA 3QEVA 3THVA 1IKVA 1Q81O 1X9JA 1HKCA 3VMFB 1TVRA 1D8YA 4FJMA 4FPBA 3O1WA 1VQ7N 3ZSRA 4EIAA 4DR5K 2BDPA 4GKKK 5CYQA 1K8KA 1D5AA 2B5JA 1VQMN 2W42A 4NO7A 5C42A 4MLHA 1A5XA 2O4GA 3C7NB 3D2EA 2ZM6K 4E7HA 2HF4A 5CY4A 3I56N 5JS2A 2W6KA 4YHHK 4FZYA 1X1PA 1VRTA 4FW2A 5GAEP 2NLXA 1Z25A 5K14A 4B3MK 4X65K 4CD1A 3VQCA 5CYMA 3RMBA 3NGIA 4CIFA 4DV1K 4EHUA 3DJCA 5J2NA 1T7PA 2QKBA 3TARA 3CMAN 5C2DA 3DRRA 4YDUC 4CW7B 3TTFA 4J8FA 5HP1A 1L3SA 4ISEA 2D0PA 1E3MA 5DMRA 1KLMA 4A2BA 1BO5O 2E2PA 4B8CA 5F1XA 4GV9A 3SK3A 2E2NA 3HXMA 4H0OA 4JS5A 2HBLA 2BH1A 1DLOA 1KC8O 4K42A 3OS2A 4C1NI 1TGOA 4H0XB 2P9LB 3HP9A 4M7YA 5BN9A 3SNNA 4DR2K 3IUCA 2UXCK 1D9DA 1GLBG 4F2RA 1NGFA 3RWUA 4CBWA 2HHHK 3LDLA 3VEVA 4IEIA 3K0SA 5BPLA 1TL1A 1EETA 4FO0A 3DWLA 3TAPA 4C23A 3ENHA 3F73A 3W0LA 2WUSA 1RTIA 3FZHA 4LY7A 3L2VA 2VG6A 4ILGB 4N41A 2NUBA 4CI6A 2VG5A 4B8AB 4FJ9A 5FROA 3K9KA 2D0OA 1GLEG 4I6MB 1REVA 1S1VA 3RRHA 3OYKA 2YNHA 3N4PA 4BR9A 5JVGL 4AH9A 4KI6A 5GAHP 4NYNA 4CZKA 4DFJA 4BRDA 4Z4GA 3PY8A 4M3WA 1ZXOA 3DRPA 3MN7A 2GELA 3BF3A 3OYEA 5FPDA 2D5RA 3L2RA 4H8KA 2A40A 3HPOA 3L0QA 1WAJA 4CEEA 1JL2A 4XH5A 4E1JA 3I55N 4IG3A 2QWNA 4B9SA 2HHUA 1GLLO 3CJ9A 1RDCA 1BWFO 4YOYA 2XO7A 3HO1A 4OPJA 4CECA 4CZEA 4B9NA 3CCMN 3T19A 4H0VB 4DQQA 1W7AA 2JWLA 4IFEA 3O9RA 4BDYA 3C6TA 3KVGA 4IG0A 4CFDA 4F3TA 4F3OA 3U3GA 4CEZA 1TYQA 4DLGA 3AA2A 5M1OA 3CPEA 3EYZA 2GV9A 4C8NA 1JLQA 1HKBA 4Z4EA 1JLAA 4KI4A 2CH6A 4Z4IA 2Y1JA 2QTDA 4KB0A 3O6WA 4KTQA 1JJ2M 1D4XA 4CEFA 3TWHA 2YNFA 1QSLA 2NRRA 4IEEA 1Q18A 4I7FA 2KHOA 1NWKA 1N5YA 1TYQB 5J2PA 1TKDA 3TTCA 1SV5A 2YKMA 4CJTA 1XUPO 1ASUA 1VSLA 3IDHA 5DK5A 1QSSA 3D2FA 5GINA 4AHRA 4E19A 2O8DA 5AJ3K 4I2QA 1JLFA 4NYFA 4FZXC 4KRFA 2D0BA 3MX5A 4MLEA 3ZX3A 3BF1A 1WAFA 5KI6A 1JCEA 4JV5K 1T3VA 3LP3A 2OYQA 3RMAA 3AAPA 4CFBA 1BA1A 4KB1A 3GBTA 4CZLA 1T05A 5F2RA 4OPAA 2VG7A 4H5RA 2QKKA 2P9IB 4O8KA 4LF6K 1J53A 3FZMA 1BQMA 4DTPA 1RTJA 3M1FA 1U04A 5LMUK 4AM6A 3V9XA 4CBXA 3TSPA 4I9LA 3SJHA 5AFUA 1XHXA 3LDNA 4J2BA 3IKMA 4DMNA 1W0HA 1KAXA 4DTRA 1UA1A 1JLCA 3K5NA 2VGNA 4E1NA 3ALYA 4N76A 1O13A 3DLKA 4FM2A 3K59A 3VQ9A 1BG3A 4DUZK 2QWLA 3NVMA 4XEIA 4E7LA 4JKGA 2E1YA 3VQ6A 2XRIA 1RBSA 1RFQA 1SAZA 5BRFA 1ATSA 1R0AA 3CJ7A 3UKUA 1NGBA 4FLVA 2IVNA 3QMLA 5FDLA 4JI7K 1NGGA 3IAYA 1ZBSA 1XQSC 3CI5A 3TSUA 4GNIA 4JKEA 1XHZA 3KLHA 2OPRA 4BR0A 4CF9A 2ITGA 3K9JA 3ZETB 1ASWA 4DS5A 3LP0A 5KRSA 2HVIA 4IOXA 2P9IA 4EP5A 1XI1A 2IAJA 3ITHA 4XH1A 1VSDA 3WXLA 4BE0A 4OO1J 3PO5A 2D0AA 1FJGK 3FFKB 1NLVA 4DV4K 1IBKK 4BGAA 2O8EB 1RILA 4ID1A 2YV0X 3QNOA 1IO2A 3OW2M 1C1AA 5C25A 4CJKA 4ILHA 1QHAA 1NGDA 3O9SA 3JYTA 4R79A 1HJRA 3AVHA 1C0GA 3OYIA 3DRSA 4QCLA 1TUUA 5FPMA 1WNSA 2YX6A 3OYNA 1X3MA 3D45A 2O8FA 3O3HA 1S3XA 5HRPA 1QQCA 3QBWA 1RT4A 4M3UA 3ULDA 4QOZB 4QAGA 3J80O 1OKJA 1N8RO 4CFAA 2HHWA 4DR4K 5TKYA 1NK7A 1RT7A 2E2QA 2YHBA 2ZJQL 3JAMO 5A2QO 2P9NB 3ZT2A 5ELZA 2ZD1A 2E8AA 1X3NA 1T6CA 3SI6A 1HRHA 5BN8A 1VHXA 3A5LC 4H0YB 1BCMA 3I8BA 5C0YA 4BE1A 5DM6L 2XY5A 3O8MA 3E1YA 3NCIA 4DU1A 2GTDA 3AVLA 4JI5K 4JI2K 1TKXA 3TAQA 4A2AA 2GX9A 3J7ZO 1OH7A 3VQBA 4O8UA 4JI8K 3O80A 4BE2A 1XNRK 3KZBA 3SMPA 4IDHA 3CC4N 2HBJA 1RBRA 4C8MA 3ZSYA 3OYJA 4FJKA 3MN5A 2DTUA 2PYLA 1NNEA 3OYGA 3CCJN 2F8SA 2FSKA 1VSHA 3AAQA 3EN9A 3LZJA 1QSYA 3HOTA 3K57A 1ZBLA 3ZEUA 3CCQN 4PY5A 3P39A 3T1HK 1NKCA 3HVRA 2P9NA 2KZMA 3U3YA 1VRUA 4DFMA 3R6MA 3PIPL 2QM1A 2UU9K 1IBMK 1EWRA 2G8KA 1XC3A 1KRPA 1JXBA 3DM2A 3SUOA 4NLCA 4FJIA 3MCAB 3LANA 3FGUA 3AVFA 4H03B 1C6VA 3E9PA 1S72N 1NG9A 1VSJA 4FJGA 4DTMA 5AZIA 3OS1A 4DS4A 3KHYA 1WSGA 2W40A 3R1XA 4XIUA 3OYCA 3NE6A 4CZHA 3A5OC 3AVIA 3LAKA 4CGDA 1IV0A 2OPQA 4CK1A 2HNDA 4IXCA 3WEEA 1OH5A 5AZJB 2F96A 4N56A 3THXA 3VERA 4FJ5A 1R59O 3O4NA 2HOEA 4DV3K 4BDZA 4RW9A 4LH5A 3FZFA 4ZTJA 3T1AA 3ZYYX 4KH5A 3C6AA 2PAVA 4LF8K 4DTSA 2R7YA 3E66A 3J8AA 3IMXA 2KLAA 1CXUA 1G99A 3TR8A 4KHSA 3OBWA 3QIOA 3RSEA 2NRHA 3AA3A 2OTJN 3UKRB 4E7IA 4DSKA 3ZETA 4DHYA 3QEIA 5ADXH 3CMEN 4BR4A 5FPNA 3R3LA 3BEXA 4LFBK 1Z6RA 4AHSA 2Q2RA 5HOOA 3OYHA 4FJLA 2HVHA 3QFPA 4AQYK 3EE9A 1SL2A 4ILJA 3AO5A 4FK2A 4FLZA 1KFSA 3HVTA 4DR1K 5J1EA 3WXMB 2X78A 4FJXA 3MXMA 1NM1A 4AM7A 2YCHA 3LWMA 4KHNA 3KK1A 5AQKA 5AQTA 3V81A 4DSLA 1WBDA 4IZ9A 2UXBK 3RTVA 1HNZK 1VQLN 3CG7A 5FRNA 3THWB 1VAZA 3OYAA 1BOTO 3AA5X 1I94K 3VTHA 4CZJA 5AQOA 1YXQA 3NAEA 3KJVA 3VOVA 3OHRA 4CJ7A 1HNIA 4JRPA 1U6ZA 3VQ7A 4IO8A 2G8UA 3VF4A 1FXXA 3P4IA 4PL7A 4QS9A 4CJWA 3BZCA 4B9VA 3V6DA 3IFRA 3Q7BA 4NB4A 3MXIA 4MQ3A 1NK6A 4LH4A 2FBVA 3KWGA 1QTMA 4FWRA 3QEXA 2FLOA 3M8PA 4KPYA 1MWKA 4JKDA 5GAGP 2Q36A 4YFUA 3BP8A 1FW6A 1HX1A 3QETA 4B3OA 1X9WA 3ZSVA 3VEYA 3H1VX 5AQIA 3D6RA 4BRFA 4M45A 1HLUA 3IRXA 3D7EO 3CQ8A 2RKIA 3VF6A 5HBMA 1W9HA 5SZTA 1J9AA 3ZLJA 4K8XA 1RBTA 4F4KA 2IOCA 2JLEA 2EX3A 3DLBA 3TSQA 5AQNA 4RW4A 3HPGA 1KAYA 1ZBFA 4O4GA 3SZ2A 2XY7A 1VQ6N 4KO0A 2P9PB 4DQ8A 2NRWA 3LZIA 2G8VA 4JS4A 5C12A 4DV6K 3D0PA 1VSIA 4A59A 1X9SA 3OYMA 1N6QA 1ZBIA 3KIOA 2IC3A 3ZT4A 4DQPA 5LY3A 2YNIA 1IG9A 3KKSA 4JI1K 4BRCA 2RF2A 1IKXA 3TAFA 4FSVA 4WE1A 2E2OA 1KVBA 1V4TA 3QFUA 1U2VB 4C1NK 4H5NA 3AO4A 3LAMA 4FLUA 1TKZA 1NOYA 4X64K 5DM7L 4ELUA 3KK2A 4CF2A 3O9QA 1LW2A 4CE9A 3TTDA 4WQ4C 4B1YB 3L2UA 4AILC 1WN7A 4JKGB 4M3RA 4IKFA 1ATNA 2OA8A 4DSFA 4JN4A 4H4MA 1G15A 3THXB 2GWKA 2I5JA 5AQFA 3HPHA 1WSIA 1WBBA 3VA0A 2KZZA 3ZEUB 4KHQA 4FM0A 3ID6A 4YOTA 2KFNA 4B3RK 1GLFO 3OBYA 2A6AA 1H1VA 2F7TA 2ZQBA 1SUQA 4ID5A 4JD2A 4FWSA 4BC3A 1HYSA 4DU3A 4CIGA 5C2FA 4MO5A 5KPTA 1NK4A 3QIPA 5LL6Z 1YF5L 1XMOK 3E01A 2VYPA 3PLAA 4BRNA 4AF1A 4KHYA 2KQ2A 4HUGA 1NKBA 3ATVA 2GWJA 3ENBA 2UXDK 4CEDA 5LMNK 2O8EA 3VQ4A 3I0SA 3NGYA 4Z4CA 4BVPA 2QEXN 1XNQK 4C8KA 1GLDG 4E89A 4J2AA 3O08A 1BI4A 3DXMA 4FOEA 1KTQA 5I9EB 1U4BA 4LF4K 2DY4A 3HP6A 1NGIA 4L8RB 5AQLA 1LOTB 2NRZA 1NJXA 1RT2A 3S9HA 4FJJA 4U67L 3C95A 2GBZA 4GVMA 2E6MA 4W5TA 2HMIA 1WB9A 2QWQA 4HWIA 5CZ2A 3W3DA 2Z1GA 4DQIA 1E4GT 3SV3A 3G71N 2E4LA 3G6EN 3DOKA 1KXPA 4O5FA 5I3UA 1WSFA 3MAQA 3AVBA 4JI3K 4JYAK 1LAWA 1HNVA 1WSHA 1VSEA 1U49A 3KLEA 5BRHA 3CCEN 4GV6A 3FR0A 3L3VA 1LW0A 3RMCA 1T03A 3A5NC 4JK9A 4LF9K 2LSNA 5D3GA 4HUEA 2QWRA 5BPMA 3DMJA 2KKZA 1N36K 4DCHA 3CJCA 4Y1CA 2O8CB 1C0FA 3KLIA 3M6GA 2D0CA 1I3AA 4J2DA 3C0BA 4RW8A 4LF7K 1RDAA 1RDWX 4A61A 5JMVA 1KLNA 4FWQA 3A8YA 1HPZA 1LWEA 3L8BA 1Z05A 3VGLA 4Q0BA 3DYAA 4M3YA 3TANA 1N33K 3AVAA 2F9TA 3QBXA 3NH2A 3CPWM 2FF3B 2VWKA 1YJNN 4BY9C 1EX4A 4UY8O 3VQ8A 4CZIA 5T7BA 5M1PA 3SUNA 4E1MA 1CLQA 1VQON 2XY8A 3OY9A 1T6DA 4FJ7A 2E5LK 3PX4A 4OX9K 2QWOA 1K6YA 1VSMA 4F2SA 4OLAA 1KAZA 3QO9A 4KKOA 2Z1HA 2E6LA 4PQUA 5LJWA 2H3GX 4FWNA 2D4WA 1Q8IA 4CEBA 1QVGM 3PSFA 1TK8A 3GDQA 4BRPA 3CM5A 4I6MA 4PKIA 2PZSA 5I42A 3LP2A 4YNQA 1YUWA 2G8WA 1T44A 4BG8A 1VSFA 3QNNA 4J2EA 3CCSN 1C1BA 1ATRA 2YHYA 3VEZA 3C65A 4BROA 3RR7A 1HYVA 3CJ1A 3PSIA 3CJAA 3RR8A 1C0TA 3DXKB 3SPYA 2EHGA 4FCYA 1QE1A 3CYMA 3EZ5A 4NLBA 1OVQA 4BGBA 3NH0A 1BIZA 1BDGA 3JS6A 4NCAA 4B3TK 3E9LA 4MDAA 2IVOA 3RSEB 2XHBA 1T8EA 1EWQA 4B9UA 4O55A 1NU0A 4GMJB 3ULEA 2X74A 3DXKA 4CGJA 3CFOA 5BR8K 1SS6A 2ASPA 2D1KA 4CHPA 5KGXA 5FLXO 5GIPA 3UKUB 3HM9A 1ZC6A 3BDPA 4O0IA 4KH6A 1YJWN 3SQ0A 4H5TA 4FVUA 4OPKA 3DLGA 4K0KK 1EKEA 1UOCA 2NRVA 4DF4A 1U47A 4BC4A 4CJRA 4OPHA 4RTFD 4B9LA 4FJ8A 1ILYA 4DU4A 1C0UA 3MK6A 1X9MA 1YTUA 1HPMA 1HMVA 1IJJA 5AQPA 3WUHA 4BDPA 2ZJRL 4DTNA 3MECA 3O1BA 4RWTA 3CCRN 5BPNA 3CQXA 2O8CA 4B08A 1A5VA 2V51B 5JICA 1Q86O 4E7JA 4PUOA 3R9PA 4O0JA 4O44A 4WFAL 4K41A 3VQEA 5AR0A 3MMVA 3M8RA 1RTDA 3EE8A 1NKEA 5HL7L 3ULEB 1HKGA 1NK5A 1UWBA 3FZLA 1L3TA 3FE1A 3PV8A 1OVYA 1QQMA 4FK4A 3SBTA 4DFKA 4CESA 2X6SA 1RTHA 4A57A 3EKSA 3LL3A 1WLJA 1RT1A 4PWDA 3HL8A 3V1RA 4JK7A 1VQ8N 3C94A 1YI2N 2J4RA 5IT9O 1Y64A 1RDBA 3ZSZA 3P5JA 2NZTA 5C15A 1BISA 4LFCK 5AZJA 2X6NA 3L2QA 5HROA 1NGCA 5J2MA 1XMQK 1RNHA 1JLEA 4AHVA 3ZX2A 4RW7A 2YJFA 1TV6A 4H5VA 4DQSA 4FWLA 5M1KA 4KTZA 4HCCA 3AGKA 2E1ZA 2QK9A 1SL0A 1KD1O 1MDUB 2P9SB 1O1WA 3OYLA 3U6FA 4IOAL 2I7NA 3VESA 2IIRA 3QB0A 4TSXA 1LV5A 4FWMA 2KTQA 1NK9A 1BGXT 1TK0A 5JVHL 2P9KB 2O8BA 3CIPA 3V1QA 3HOSA 3LM2A 1QQNA 2GUIA 2P9KA 5FRMA 2O8BB 3SUQA 4L3QA 1JLGA 4JEPA 1RDDA 4AHUA 2Y1IA 3B6PA 2P9LA 4CERA 5AQUA 3VA3A 1K8AO 4FOIA 4M3XA 3VENA 5AQMA 1BHLA 3EKUA 3VTIA 4KV8A 3K5OA 1ASVA 2VWJA 5AQZA 4LD0A 2G8IA 5E26A 5HRRA 4B1VA 2RN2A 3KD5E 3RVCA 3AARA 4F9OA 1UAXA 2DFHA 4CJEA 4GW6A 3K5MA 1DKGD 3QEWA 2Z1IA 4BREA 1UA0A 4DQRA 1DGKN 3LP1A 3L4QA 1HJOA 3LDPA 4ELVA 2DPNA 1S5JA 3CCUN 4PHTX 4Q5VA 3MEEA 3LDOA 1RBUA 4WYBA 5EVZA 4A5BA 5AQRA 1TUYA 4KBOA 4H0PA 4B9TA 3VQAA 2CGLA 2EWSA 4X66K 4YY3K 5CE3A 4F8RA 3K2PA 3KWIA 4JI4K 4OGEA 3KLFA 2P51A 3TU5A 3H3NO 3CETA 5EOYA 2WTUA 1Q9XA 4B1XB 2HHSA 3A2FA 3VGKA 1VQ4N 4JKBA 1YVNA 5AQYA 2WONA 4MFBA 4CHZA 2FXUA 1LWFA 4CD3A 1SKWA 3WXKA 3MEGA 4FZZA 1BCOA 3WXIA 2FBYA 4CGHA 1KSPA 3G10A 1CZAN 1S22A 4FWKA 2IGIA 4GY2B 1NOZA 1S6PA 4CF8A 4LFAK 2P5GA 3DLRA 4CK3A 2HB5A 4DFPA 3LALA 2ZWHA 4I9QA 4EP4A 2FSNA 1EP4A 4V19S 2HHVA 3OS0A 1RDUA 1KFDA 1EO1A 5LJVA 4JRQA 2AA4A 3V9SA 4CJPA 4U7BA 4E7KA 3I33A 3LPUA 4CHNA 2CH5A 3JSMA 4DV7K 3HSTB 1WUAA 3DI6A 3T3FA 2BANA 2ZE2A 2HBMA 5E84A 3WNGA 4M42A 3LDSA 4FWOA 4CIEA 3CXCM 4UQGA 1S6QA 2P1JA 3L3UA 4NCBA 4K25A 4WQ5A 1WSJA 2HHTA 3LPTA 1BA0A 1MWMA 3ATUA 4FYDA 3QLHA 1NGEA 4C8OA 4FWPA 3O5BA 3H6EA 2E88A 3P1GA 4CJ3A 3PUFA 3FLCO 1VQKN 4CVNE 3EY1A 4PL8A 4EFHA 3O9UA 3ISNC 4DV0K 3QERA 4CHOA 3WQTA 4YOVA 3CFRA 2FC0A 1QVFM 1NJYA 1BQNA 2OZMA 3SMSA 3ZSQA 1ESVA 3TPQA 3SV4A 4YORA 4CEOA 1CZBA 5JLFA 2BE2A 5KTQA 1S1XA 3AO1A 3SQ2A 4G1QA 4AHTA 4CGIA 5E41A 3SAHA 3SAGA 1GOBA 4Z4HA 4CK2A 1IH7A 3P31A 3LWLA 5EU7A 3T7ZA 4A5AA 3V9UA 3AVGA 4FLYA 1ITGA 3KD1E 1Q7YO 3OJUA 4ISFA 1VQPN 1SZ2A 3NF6A 2G8HA 3HM8A 2W41A 4FPAA 2Q97A 1P8ZA 3B8AX 2BTFA 2F9WA 2NRXA 3NFAA 3NDKA 4HVJA 2Q0RA 1VQ9N 3SQ4A 2UUAK 4EZ9A 4OLBA 2OCEA 2OZSA 1RT5A 4YOWA 3DOLA 3CFPA 4HTUA 4DB3A 1FKPA 3V9WA 1C1CA 3THWA 3GOIA 4XH4A 3AVJA 3MX2A 1B9DA 2P9UA 3OJSA 4PKGA 3L4IA 3H1QA 3NVKA 4Y1DA 4W5RA 4BRIA 2KFZA 1GOAA 3S3OA 1RT3A 3F2KA 1NJZA 3UE5A 4OKJA 3MWPA 3ASMA 1GLAG 1Q9YA 1QHTA 3E9OA 3QINA 2KW4A 5C24A 3EL2A 4M3TA 5HRSA 3HSCA 4DR6K 4BACA 4K43A 4Z0UA 1DT9A 2O8DB 4M63C 4KFBA 1K8KB 1K73O 4YOXA 2IDOA 4HUFA 1Y97A 2VWBA 2YHAA 3MN9A 3ZX0A 2YKNA 3M3ZA 1KCFA 3C6HA 3CM6A 3NGZA 1NJWA 1J6ZA 3V1OA 3SUPA 2YNGA 1J54A 3AVNA 3KTQA 1BIUA 3CCLN 4CJLA 3VQ5A 3MXJA 4ICLA 3H08A 2Q1NA 4JHDB 2FF6A 4CZGA 3N4QA 3G4SN 1SKRA 3C7NA 5F0XA 4CHYA 3OYDA 1DTTA 4O5BA 3DLLL 5TKWA 3WT0A 2HBKA 2UYTA 4ELTA 1IG8A 5EY4A 4CCHA 2ITMA 1OH6A 5HLFA 1L3VA 2HHQA 5EX5A 3ZT3A 1BU6O 2HSTA 3NH1A 3SBGA 3BGRA 1TK5A 5JS1A 2B4JA 1RT6A 5AQGA 1V4SA 4CEAA 4DSEA 1LCUA 2HW3A 3AY9A 3I0RA 3TAMA 5AQQA 2V52B 2WBNA 4JKAA 4BR2A 4G9ZA 2V7YA 4CJQA 3O3GA 3H46O 2BUPA 2IVPA 2WC9A 4N47A 1TAQA 4DV5K 2UUCK 4OVLA 4A62A 1BL3A 1J5EK 3U4LA 3HBTA 5MLCQ 5AQJA 1XWLA 3A5MC 3VPZA 2P5OA 3WNHA 2YHWA 4BRLA 3FFIA 3VQPA 3SPZA 4JK8A 4JHDA 3WNFA 3HJFA 1HUXA 4BWJA 5CHIA 4DR7K 3FZKA 3AVKA 2Z1JA 1GOCA 2FBTA 1VSKA 3VEOA 2ASMA 1SL1A 3SCXA 1J5OA 3Q7CA 4HTLA 4I2PA 3CHWA 4B1WB 1NGJA 4OJRA 4KHUA 4WQ4A 1NK0A 1SQKA 3CC2N 2XY6A 4DTJA 1HNWK 3MWTA 2ZGYA 3I8DA 4DSJA 1RCHA 4HCBA 2V7ZA 3EO3A 3GE1A 4FVMA 2G8FA 3NF9A 3EZWA 1L5UA 4Z4FA 4LSLA 3WXJA 3G25A 1B92A 4Y0WA 1MA9B 4DG1A 3ID8A 2JWKA 2OPSA 2DFEA 4Z94A 3S3NA 2A3ZA 1YIJN 2Q31A 5CR4A 5KPRA 3TAGA 4CF0A 3HRGA 2RHKA 2Q0UA 4IJNA 1ZYQA 1NK8A 2QXLA 4GKJK 3SJJA 4QS7A 1EXQA 3PIOL 3AA4A 3PO4A 1S1UA 4CF1A 1YT3A 4EHTA 4DR3K 4E3SA 3P38A 3PX6A 4LC9B 4JKFA 5B8HA 1N34K 1U48A 3F9KA 4YDUA 3R8EA 2AJQA 4H5WA 3UKRA 2YHXA 2JGUA 5AQWA 4FLWA 2A5XA 3F5TA 3L2WA 3NF7A 5AFUH 4IFYA 2GUPA 1MU2A 2RPIA 4BC2A 4BQLA 3RRGA 4EAHD 4RG8A 5C10A 3S3MA 1XC9A 3CERA 5AQVA 1L3UA 3P83D 3VQQA 5JLHA 1S1WA 2NRTA 4FXDA 4CJVA 3M8SA 3DXMB 2QA4N 3HTVA 1NBWA 5KPZA 3THYB 1IKWA 2QWMA 3QICA 5GIOA 4WCEL 4BQZA 3IS9A 3CF5L 3CJBA 2IS3A 5KRTA 1M90O 2BGGA 2F4VK 5SWMA 4CJ5A 3VF2A 4N5SA 2QXFA 1JKHA 2ETJA 5GADP 1IBLK 1DTQA 3KLGA 3VEWA 2HHXA 4MO4A 2YJEA 4IJAA 4W5QA 4H0TB 5AQXA 4MDBA 4KREA 4DKWA 3D2FB 3NF8A 5ADXA 3F9MA 4BVOA 4BRHA 4CHQA 2OPPA 3HK2A 3B6OA 3K58A 4M41A 3O4QA 3EEQA 4WFBL 2DFFA 3VEXA 4BRQA 1Q82O 2ASOA 3OVNA 1JCGA 3HT3A 3BZKA 3THYA 1YAGA 3CC7N 1FKOA 4PA1A 4ZTFA 3O9TA 1JL1A 3HI0A 1IKYA 3VQDA 3MEDA 1SKSA 3AO3A 3L6QA 5KQDA 2VQFK 4DTOA 1CXQA 5CZ1A 4B9QA 2CGKA 1M1KO 3A0IX 4FW1A 1HQEA 2QWPA 1P90A 1I39A 3M5RA 1W97L 3T1YK 1NGAA 3ZT0A 2OANA 1DEJA 1VQNN 4CJUA 2I7PA 4X62K 2P9SA 4JI6K 2ZF5O 3U9ZA 4B3SK 4CJFA 4W5NA 2ZGZA 3OA9A 5J2QA 3WEEB 4AHCA 4E0DA 4FJNA 4JKHA 4YOUA 4DLEA 3DAWA 4QS8A 5M1FA 4BR5A 4NXNK 1S1TA 1K9MO 4KAZA 4FL9A 2VGMA 1NMDA 3G0ZA 3NMUA 1CZ9A 3AVMA 4OKEA 1FK9A 1B9FA 1LWCA 5KGWA 3AVCA 4R5PA 1YJ9N 3KKRA 5BREA 3C6UA 4B1UB 1ZBUA 4W5OA 1QZ5A 1S9GA 4DSIA 1YHQN 3VN5A 4GVEA 3MDQA 3T69A 4IOCL 4DF8A 3TAEA 2A42A 4CGFA 3H3OB 3MN6A 3CCVN 2O4IA 3TI0A 1E4FT 4BR7A 3BY5A 4CFCA 4CEQA 3AV9A 3HZ6A 1NMNA 4RW6A 2GEMA 2PBDA 4IO9L 1NGHA 3GG4A 4DUYK 2ATQA 4JI0K 1JXEA 1WSEA 3UB5A 3ENOA 4KHPK 2A1RA 3ZSWA 1W2BM 4DWIA 3J7AP 3AO2A 3NBPA 2O8FB 2ZJPL 3BUZB 3VETA 4EZ6A 1QQOA 4M3ZA 3J7YP 2HMPA 4JAXA 4IFVA 3D2EB 3ZSOA 4WFNL 3IG1A 2Q3SA 5BR9A 5AQSA 1ZBHA 5FPEA 4BWMA 1RGIA 4K8ZA 4KH4A 4FJHA 3NHGA 3LM9A 4OKKA 3DLHA 1N32K 1S9EA 1KVAA 5AQHA 5H1SQ 3J81O 4DTXA 1Z26A 1HQUA 2PFUA 4LF5K 5IWAK 4OGCA 3QESA 4IWVA 1GLJO 3GL1A 1GLCG 2P9PA 4HHTA 3AGRA 3HYFA 5BRDA 1HNXK 4LSNA 2CGJA 2W6LA 3ZCMA 3SYZA 3OTOK 1D9FA 4CBUA 5KQ8A 2A1SA 4B1ZA 3K5LA 5M1QA 2HF3A 2VCPA 2WOMA 1QZ6A 3S41A 3U8XA 4BRGA 1TAUA 2RE2A 3WQUA 4CGGA 2F8TA 4JLHA 4B9MA 3VGMA 1WOQA 4IDKA
chains in the Genus database with same CATH topology
4JV5K 4DV3K 3J80O 1XNQK 2ZM6K 4NXMK 4DR4K 4LF8K 4LF6K 3JAMO 5A2QO 4YHHK 4X66K 4YY3K 5LMUK 4LF4K 4JI4K 4GKJK 4B3MK 4X65K 4DUYK 4JI0K 4DR3K 4JI5K 5IT9O 4DV1K 4JI2K 4KHPK 1N34K 3J7AP 4LFBK 4DV6K 4JI8K 4DUZK 4LFCK 1XNRK 4AQYK 4JI3K 4JYAK 4B3TK 4CW7B 1XMQK 3J7YP 4LFAK 2UUAK 4DR1K 4JI1K 4JI7K 2VQFK 4V19S 1HR0K 4LF9K 1N36K 5BR8K 4X64K 2UXBK 3T1YK 1HNZK 4DR2K 5FLXO 2UUBK 1N32K 4DV5K 2UXCK 4LF7K 4X62K 2UUCK 4JI6K 1J5EK 1I94K 4DV7K 3J81O 4B3SK 2HHHK 3T1HK 4LF5K 5IWAK 4K0KK 1FJGK 2UU9K 1IBMK 4DR7K 1IBKK 4DV4K 2VQEK 4B3RK 1N33K 1HNXK 4DV2K 4NXNK 2F4VK 4DR6K 3OTOK 5LL6Z 1XMOK 5AJ3K 1IBLK 4CVNE 1HNWK 4DV0K 2E5LK 4OX9K 4DR5K 2UXDK 4GKKK 5LMNK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 K;  4DV3 K;  3J80 O;  1XNQ K;  2ZM6 K;  4NXM K;  4DR4 K;  4LF8 K;  4LF6 K;  3JAM O;  5A2Q O;  4YHH K;  4X66 K;  4YY3 K;  5LMU K;  4LF4 K;  4JI4 K;  4GKJ K;  4B3M K;  4X65 K;  4DUY K;  4JI0 K;  4DR3 K;  4JI5 K;  5IT9 O;  4DV1 K;  4JI2 K;  4KHP K;  1N34 K;  3J7A P;  4LFB K;  4DV6 K;  4JI8 K;  4DUZ K;  4LFC K;  1XNR K;  4AQY K;  4JI3 K;  4JYA K;  4B3T K;  4CW7 B;  1XMQ K;  3J7Y P;  4LFA K;  2UUA K;  4DR1 K;  4JI1 K;  4JI7 K;  2VQF K;  4V19 S;  1HR0 K;  4LF9 K;  1N36 K;  5BR8 K;  4X64 K;  2UXB K;  3T1Y K;  1HNZ K;  4DR2 K;  5FLX O;  2UUB K;  1N32 K;  4DV5 K;  2UXC K;  4LF7 K;  4X62 K;  2UUC K;  4JI6 K;  1J5E K;  1I94 K;  4DV7 K;  3J81 O;  4B3S K;  2HHH K;  3T1H K;  4LF5 K;  5IWA K;  4K0K K;  1FJG K;  2UU9 K;  1IBM K;  4DR7 K;  1IBK K;  4DV4 K;  2VQE K;  4B3R K;  1N33 K;  1HNX K;  4DV2 K;  4NXN K;  2F4V K;  4DR6 K;  3OTO K;  5LL6 Z;  1XMO K;  5AJ3 K;  1IBL K;  4CVN E;  1HNW K;  4DV0 K;  2E5L K;  4OX9 K;  4DR5 K;  2UXD K;  4GKK K;  5LMN K; 
#chains in the Genus database with same CATH topology
 5AZI B;  3O3F A;  4H4O A;  2NNW A;  4CJS A;  5HRN A;  1VQ5 N;  4FM1 A;  4M7X A;  3QDK A;  3RMD A;  4KHW A;  4NXM K;  1BUP A;  4BRA A;  4FLT A;  1YVU A;  3ZT1 A;  2FSJ A;  3SLC A;  3OYB A;  2HNZ A;  4RCH A;  1C0M A;  1EQY A;  1A5W A;  2PY5 A;  1U2V A;  1JCF A;  3KK3 A;  1JLB A;  1VK0 A;  4PKH A;  4WQ5 C;  4NCG A;  2PYJ A;  2WFB A;  4JKC A;  2E20 A;  3M8Q A;  3CQY A;  4BC5 A;  3H45 C;  1TKT A;  1U45 A;  2OTL N;  4ZHR A;  1KQS M;  5M1N A;  3JXU A;  3U9D A;  1F21 A;  4IBN A;  3PX0 A;  2HNY A;  2P9U B;  1HR0 K;  3SQ1 A;  3O4W A;  4BG9 A;  3SAF A;  4C8L A;  2YI1 A;  2A41 A;  4JD2 B;  1LAV A;  4FK0 A;  3ZSX A;  4BRM A;  4FLX A;  1BI4 B;  1YIT N;  4CZF A;  2UUB K;  3MCP A;  2B6A A;  2AP1 A;  2QI2 A;  3WNE A;  4WF9 L;  3CD6 N;  3V9Z A;  1YTA A;  3LDQ A;  1KVC A;  1NJI O;  1TL3 A;  4KTW A;  3KK7 A;  4DTU A;  3UIQ A;  2QW9 A;  4CZM A;  3TAB A;  2VQE K;  4CJ4 A;  3V4I A;  4GV3 A;  4ISG A;  4JNE A;  4DV2 K;  1HYZ A;  1QS4 A;  3QEP A;  2FBX A;  3DLE A;  1OH8 A;  1RBV A;  4BRK A;  5EXW A;  3OYF A;  3QEV A;  3THV A;  1IKV A;  1Q81 O;  1X9J A;  1HKC A;  3VMF B;  1TVR A;  1D8Y A;  4FJM A;  4FPB A;  3O1W A;  1VQ7 N;  3ZSR A;  4EIA A;  4DR5 K;  2BDP A;  4GKK K;  5CYQ A;  1K8K A;  1D5A A;  2B5J A;  1VQM N;  2W42 A;  4NO7 A;  5C42 A;  4MLH A;  1A5X A;  2O4G A;  3C7N B;  3D2E A;  2ZM6 K;  4E7H A;  2HF4 A;  5CY4 A;  3I56 N;  5JS2 A;  2W6K A;  4YHH K;  4FZY A;  1X1P A;  1VRT A;  4FW2 A;  5GAE P;  2NLX A;  1Z25 A;  5K14 A;  4B3M K;  4X65 K;  4CD1 A;  3VQC A;  5CYM A;  3RMB A;  3NGI A;  4CIF A;  4DV1 K;  4EHU A;  3DJC A;  5J2N A;  1T7P A;  2QKB A;  3TAR A;  3CMA N;  5C2D A;  3DRR A;  4YDU C;  4CW7 B;  3TTF A;  4J8F A;  5HP1 A;  1L3S A;  4ISE A;  2D0P A;  1E3M A;  5DMR A;  1KLM A;  4A2B A;  1BO5 O;  2E2P A;  4B8C A;  5F1X A;  4GV9 A;  3SK3 A;  2E2N A;  3HXM A;  4H0O A;  4JS5 A;  2HBL A;  2BH1 A;  1DLO A;  1KC8 O;  4K42 A;  3OS2 A;  4C1N I;  1TGO A;  4H0X B;  2P9L B;  3HP9 A;  4M7Y A;  5BN9 A;  3SNN A;  4DR2 K;  3IUC A;  2UXC K;  1D9D A;  1GLB G;  4F2R A;  1NGF A;  3RWU A;  4CBW A;  2HHH K;  3LDL A;  3VEV A;  4IEI A;  3K0S A;  5BPL A;  1TL1 A;  1EET A;  4FO0 A;  3DWL A;  3TAP A;  4C23 A;  3ENH A;  3F73 A;  3W0L A;  2WUS A;  1RTI A;  3FZH A;  4LY7 A;  3L2V A;  2VG6 A;  4ILG B;  4N41 A;  2NUB A;  4CI6 A;  2VG5 A;  4B8A B;  4FJ9 A;  5FRO A;  3K9K A;  2D0O A;  1GLE G;  4I6M B;  1REV A;  1S1V A;  3RRH A;  3OYK A;  2YNH A;  3N4P A;  4BR9 A;  5JVG L;  4AH9 A;  4KI6 A;  5GAH P;  4NYN A;  4CZK A;  4DFJ A;  4BRD A;  4Z4G A;  3PY8 A;  4M3W A;  1ZXO A;  3DRP A;  3MN7 A;  2GEL A;  3BF3 A;  3OYE A;  5FPD A;  2D5R A;  3L2R A;  4H8K A;  2A40 A;  3HPO A;  3L0Q A;  1WAJ A;  4CEE A;  1JL2 A;  4XH5 A;  4E1J A;  3I55 N;  4IG3 A;  2QWN A;  4B9S A;  2HHU A;  1GLL O;  3CJ9 A;  1RDC A;  1BWF O;  4YOY A;  2XO7 A;  3HO1 A;  4OPJ A;  4CEC A;  4CZE A;  4B9N A;  3CCM N;  3T19 A;  4H0V B;  4DQQ A;  1W7A A;  2JWL A;  4IFE A;  3O9R A;  4BDY A;  3C6T A;  3KVG A;  4IG0 A;  4CFD A;  4F3T A;  4F3O A;  3U3G A;  4CEZ A;  1TYQ A;  4DLG A;  3AA2 A;  5M1O A;  3CPE A;  3EYZ A;  2GV9 A;  4C8N A;  1JLQ A;  1HKB A;  4Z4E A;  1JLA A;  4KI4 A;  2CH6 A;  4Z4I A;  2Y1J A;  2QTD A;  4KB0 A;  3O6W A;  4KTQ A;  1JJ2 M;  1D4X A;  4CEF A;  3TWH A;  2YNF A;  1QSL A;  2NRR A;  4IEE A;  1Q18 A;  4I7F A;  2KHO A;  1NWK A;  1N5Y A;  1TYQ B;  5J2P A;  1TKD A;  3TTC A;  1SV5 A;  2YKM A;  4CJT A;  1XUP O;  1ASU A;  1VSL A;  3IDH A;  5DK5 A;  1QSS A;  3D2F A;  5GIN A;  4AHR A;  4E19 A;  2O8D A;  5AJ3 K;  4I2Q A;  1JLF A;  4NYF A;  4FZX C;  4KRF A;  2D0B A;  3MX5 A;  4MLE A;  3ZX3 A;  3BF1 A;  1WAF A;  5KI6 A;  1JCE A;  4JV5 K;  1T3V A;  3LP3 A;  2OYQ A;  3RMA A;  3AAP A;  4CFB A;  1BA1 A;  4KB1 A;  3GBT A;  4CZL A;  1T05 A;  5F2R A;  4OPA A;  2VG7 A;  4H5R A;  2QKK A;  2P9I B;  4O8K A;  4LF6 K;  1J53 A;  3FZM A;  1BQM A;  4DTP A;  1RTJ A;  3M1F A;  1U04 A;  5LMU K;  4AM6 A;  3V9X A;  4CBX A;  3TSP A;  4I9L A;  3SJH A;  5AFU A;  1XHX A;  3LDN A;  4J2B A;  3IKM A;  4DMN A;  1W0H A;  1KAX A;  4DTR A;  1UA1 A;  1JLC A;  3K5N A;  2VGN A;  4E1N A;  3ALY A;  4N76 A;  1O13 A;  3DLK A;  4FM2 A;  3K59 A;  3VQ9 A;  1BG3 A;  4DUZ K;  2QWL A;  3NVM A;  4XEI A;  4E7L A;  4JKG A;  2E1Y A;  3VQ6 A;  2XRI A;  1RBS A;  1RFQ A;  1SAZ A;  5BRF A;  1ATS A;  1R0A A;  3CJ7 A;  3UKU A;  1NGB A;  4FLV A;  2IVN A;  3QML A;  5FDL A;  4JI7 K;  1NGG A;  3IAY A;  1ZBS A;  1XQS C;  3CI5 A;  3TSU A;  4GNI A;  4JKE A;  1XHZ A;  3KLH A;  2OPR A;  4BR0 A;  4CF9 A;  2ITG A;  3K9J A;  3ZET B;  1ASW A;  4DS5 A;  3LP0 A;  5KRS A;  2HVI A;  4IOX A;  2P9I A;  4EP5 A;  1XI1 A;  2IAJ A;  3ITH A;  4XH1 A;  1VSD A;  3WXL A;  4BE0 A;  4OO1 J;  3PO5 A;  2D0A A;  1FJG K;  3FFK B;  1NLV A;  4DV4 K;  1IBK K;  4BGA A;  2O8E B;  1RIL A;  4ID1 A;  2YV0 X;  3QNO A;  1IO2 A;  3OW2 M;  1C1A A;  5C25 A;  4CJK A;  4ILH A;  1QHA A;  1NGD A;  3O9S A;  3JYT A;  4R79 A;  1HJR A;  3AVH A;  1C0G A;  3OYI A;  3DRS A;  4QCL A;  1TUU A;  5FPM A;  1WNS A;  2YX6 A;  3OYN A;  1X3M A;  3D45 A;  2O8F A;  3O3H A;  1S3X A;  5HRP A;  1QQC A;  3QBW A;  1RT4 A;  4M3U A;  3ULD A;  4QOZ B;  4QAG A;  3J80 O;  1OKJ A;  1N8R O;  4CFA A;  2HHW A;  4DR4 K;  5TKY A;  1NK7 A;  1RT7 A;  2E2Q A;  2YHB A;  2ZJQ L;  3JAM O;  5A2Q O;  2P9N B;  3ZT2 A;  5ELZ A;  2ZD1 A;  2E8A A;  1X3N A;  1T6C A;  3SI6 A;  1HRH A;  5BN8 A;  1VHX A;  3A5L C;  4H0Y B;  1BCM A;  3I8B A;  5C0Y A;  4BE1 A;  5DM6 L;  2XY5 A;  3O8M A;  3E1Y A;  3NCI A;  4DU1 A;  2GTD A;  3AVL A;  4JI5 K;  4JI2 K;  1TKX A;  3TAQ A;  4A2A A;  2GX9 A;  3J7Z O;  1OH7 A;  3VQB A;  4O8U A;  4JI8 K;  3O80 A;  4BE2 A;  1XNR K;  3KZB A;  3SMP A;  4IDH A;  3CC4 N;  2HBJ A;  1RBR A;  4C8M A;  3ZSY A;  3OYJ A;  4FJK A;  3MN5 A;  2DTU A;  2PYL A;  1NNE A;  3OYG A;  3CCJ N;  2F8S A;  2FSK A;  1VSH A;  3AAQ A;  3EN9 A;  3LZJ A;  1QSY A;  3HOT A;  3K57 A;  1ZBL A;  3ZEU A;  3CCQ N;  4PY5 A;  3P39 A;  3T1H K;  1NKC A;  3HVR A;  2P9N A;  2KZM A;  3U3Y A;  1VRU A;  4DFM A;  3R6M A;  3PIP L;  2QM1 A;  2UU9 K;  1IBM K;  1EWR A;  2G8K A;  1XC3 A;  1KRP A;  1JXB A;  3DM2 A;  3SUO A;  4NLC A;  4FJI A;  3MCA B;  3LAN A;  3FGU A;  3AVF A;  4H03 B;  1C6V A;  3E9P A;  1S72 N;  1NG9 A;  1VSJ A;  4FJG A;  4DTM A;  5AZI A;  3OS1 A;  4DS4 A;  3KHY A;  1WSG A;  2W40 A;  3R1X A;  4XIU A;  3OYC A;  3NE6 A;  4CZH A;  3A5O C;  3AVI A;  3LAK A;  4CGD A;  1IV0 A;  2OPQ A;  4CK1 A;  2HND A;  4IXC A;  3WEE A;  1OH5 A;  5AZJ B;  2F96 A;  4N56 A;  3THX A;  3VER A;  4FJ5 A;  1R59 O;  3O4N A;  2HOE A;  4DV3 K;  4BDZ A;  4RW9 A;  4LH5 A;  3FZF A;  4ZTJ A;  3T1A A;  3ZYY X;  4KH5 A;  3C6A A;  2PAV A;  4LF8 K;  4DTS A;  2R7Y A;  3E66 A;  3J8A A;  3IMX A;  2KLA A;  1CXU A;  1G99 A;  3TR8 A;  4KHS A;  3OBW A;  3QIO A;  3RSE A;  2NRH A;  3AA3 A;  2OTJ N;  3UKR B;  4E7I A;  4DSK A;  3ZET A;  4DHY A;  3QEI A;  5ADX H;  3CME N;  4BR4 A;  5FPN A;  3R3L A;  3BEX A;  4LFB K;  1Z6R A;  4AHS A;  2Q2R A;  5HOO A;  3OYH A;  4FJL A;  2HVH A;  3QFP A;  4AQY K;  3EE9 A;  1SL2 A;  4ILJ A;  3AO5 A;  4FK2 A;  4FLZ A;  1KFS A;  3HVT A;  4DR1 K;  5J1E A;  3WXM B;  2X78 A;  4FJX A;  3MXM A;  1NM1 A;  4AM7 A;  2YCH A;  3LWM A;  4KHN A;  3KK1 A;  5AQK A;  5AQT A;  3V81 A;  4DSL A;  1WBD A;  4IZ9 A;  2UXB K;  3RTV A;  1HNZ K;  1VQL N;  3CG7 A;  5FRN A;  3THW B;  1VAZ A;  3OYA A;  1BOT O;  3AA5 X;  1I94 K;  3VTH A;  4CZJ A;  5AQO A;  1YXQ A;  3NAE A;  3KJV A;  3VOV A;  3OHR A;  4CJ7 A;  1HNI A;  4JRP A;  1U6Z A;  3VQ7 A;  4IO8 A;  2G8U A;  3VF4 A;  1FXX A;  3P4I A;  4PL7 A;  4QS9 A;  4CJW A;  3BZC A;  4B9V A;  3V6D A;  3IFR A;  3Q7B A;  4NB4 A;  3MXI A;  4MQ3 A;  1NK6 A;  4LH4 A;  2FBV A;  3KWG A;  1QTM A;  4FWR A;  3QEX A;  2FLO A;  3M8P A;  4KPY A;  1MWK A;  4JKD A;  5GAG P;  2Q36 A;  4YFU A;  3BP8 A;  1FW6 A;  1HX1 A;  3QET A;  4B3O A;  1X9W A;  3ZSV A;  3VEY A;  3H1V X;  5AQI A;  3D6R A;  4BRF A;  4M45 A;  1HLU A;  3IRX A;  3D7E O;  3CQ8 A;  2RKI A;  3VF6 A;  5HBM A;  1W9H A;  5SZT A;  1J9A A;  3ZLJ A;  4K8X A;  1RBT A;  4F4K A;  2IOC A;  2JLE A;  2EX3 A;  3DLB A;  3TSQ A;  5AQN A;  4RW4 A;  3HPG A;  1KAY A;  1ZBF A;  4O4G A;  3SZ2 A;  2XY7 A;  1VQ6 N;  4KO0 A;  2P9P B;  4DQ8 A;  2NRW A;  3LZI A;  2G8V A;  4JS4 A;  5C12 A;  4DV6 K;  3D0P A;  1VSI A;  4A59 A;  1X9S A;  3OYM A;  1N6Q A;  1ZBI A;  3KIO A;  2IC3 A;  3ZT4 A;  4DQP A;  5LY3 A;  2YNI A;  1IG9 A;  3KKS A;  4JI1 K;  4BRC A;  2RF2 A;  1IKX A;  3TAF A;  4FSV A;  4WE1 A;  2E2O A;  1KVB A;  1V4T A;  3QFU A;  1U2V B;  4C1N K;  4H5N A;  3AO4 A;  3LAM A;  4FLU A;  1TKZ A;  1NOY A;  4X64 K;  5DM7 L;  4ELU A;  3KK2 A;  4CF2 A;  3O9Q A;  1LW2 A;  4CE9 A;  3TTD A;  4WQ4 C;  4B1Y B;  3L2U A;  4AIL C;  1WN7 A;  4JKG B;  4M3R A;  4IKF A;  1ATN A;  2OA8 A;  4DSF A;  4JN4 A;  4H4M A;  1G15 A;  3THX B;  2GWK A;  2I5J A;  5AQF A;  3HPH A;  1WSI A;  1WBB A;  3VA0 A;  2KZZ A;  3ZEU B;  4KHQ A;  4FM0 A;  3ID6 A;  4YOT A;  2KFN A;  4B3R K;  1GLF O;  3OBY A;  2A6A A;  1H1V A;  2F7T A;  2ZQB A;  1SUQ A;  4ID5 A;  4JD2 A;  4FWS A;  4BC3 A;  1HYS A;  4DU3 A;  4CIG A;  5C2F A;  4MO5 A;  5KPT A;  1NK4 A;  3QIP A;  5LL6 Z;  1YF5 L;  1XMO K;  3E01 A;  2VYP A;  3PLA A;  4BRN A;  4AF1 A;  4KHY A;  2KQ2 A;  4HUG A;  1NKB A;  3ATV A;  2GWJ A;  3ENB A;  2UXD K;  4CED A;  5LMN K;  2O8E A;  3VQ4 A;  3I0S A;  3NGY A;  4Z4C A;  4BVP A;  2QEX N;  1XNQ K;  4C8K A;  1GLD G;  4E89 A;  4J2A A;  3O08 A;  1BI4 A;  3DXM A;  4FOE A;  1KTQ A;  5I9E B;  1U4B A;  4LF4 K;  2DY4 A;  3HP6 A;  1NGI A;  4L8R B;  5AQL A;  1LOT B;  2NRZ A;  1NJX A;  1RT2 A;  3S9H A;  4FJJ A;  4U67 L;  3C95 A;  2GBZ A;  4GVM A;  2E6M A;  4W5T A;  2HMI A;  1WB9 A;  2QWQ A;  4HWI A;  5CZ2 A;  3W3D A;  2Z1G A;  4DQI A;  1E4G T;  3SV3 A;  3G71 N;  2E4L A;  3G6E N;  3DOK A;  1KXP A;  4O5F A;  5I3U A;  1WSF A;  3MAQ A;  3AVB A;  4JI3 K;  4JYA K;  1LAW A;  1HNV A;  1WSH A;  1VSE A;  1U49 A;  3KLE A;  5BRH A;  3CCE N;  4GV6 A;  3FR0 A;  3L3V A;  1LW0 A;  3RMC A;  1T03 A;  3A5N C;  4JK9 A;  4LF9 K;  2LSN A;  5D3G A;  4HUE A;  2QWR A;  5BPM A;  3DMJ A;  2KKZ A;  1N36 K;  4DCH A;  3CJC A;  4Y1C A;  2O8C B;  1C0F A;  3KLI A;  3M6G A;  2D0C A;  1I3A A;  4J2D A;  3C0B A;  4RW8 A;  4LF7 K;  1RDA A;  1RDW X;  4A61 A;  5JMV A;  1KLN A;  4FWQ A;  3A8Y A;  1HPZ A;  1LWE A;  3L8B A;  1Z05 A;  3VGL A;  4Q0B A;  3DYA A;  4M3Y A;  3TAN A;  1N33 K;  3AVA A;  2F9T A;  3QBX A;  3NH2 A;  3CPW M;  2FF3 B;  2VWK A;  1YJN N;  4BY9 C;  1EX4 A;  4UY8 O;  3VQ8 A;  4CZI A;  5T7B A;  5M1P A;  3SUN A;  4E1M A;  1CLQ A;  1VQO N;  2XY8 A;  3OY9 A;  1T6D A;  4FJ7 A;  2E5L K;  3PX4 A;  4OX9 K;  2QWO A;  1K6Y A;  1VSM A;  4F2S A;  4OLA A;  1KAZ A;  3QO9 A;  4KKO A;  2Z1H A;  2E6L A;  4PQU A;  5LJW A;  2H3G X;  4FWN A;  2D4W A;  1Q8I A;  4CEB A;  1QVG M;  3PSF A;  1TK8 A;  3GDQ A;  4BRP A;  3CM5 A;  4I6M A;  4PKI A;  2PZS A;  5I42 A;  3LP2 A;  4YNQ A;  1YUW A;  2G8W A;  1T44 A;  4BG8 A;  1VSF A;  3QNN A;  4J2E A;  3CCS N;  1C1B A;  1ATR A;  2YHY A;  3VEZ A;  3C65 A;  4BRO A;  3RR7 A;  1HYV A;  3CJ1 A;  3PSI A;  3CJA A;  3RR8 A;  1C0T A;  3DXK B;  3SPY A;  2EHG A;  4FCY A;  1QE1 A;  3CYM A;  3EZ5 A;  4NLB A;  1OVQ A;  4BGB A;  3NH0 A;  1BIZ A;  1BDG A;  3JS6 A;  4NCA A;  4B3T K;  3E9L A;  4MDA A;  2IVO A;  3RSE B;  2XHB A;  1T8E A;  1EWQ A;  4B9U A;  4O55 A;  1NU0 A;  4GMJ B;  3ULE A;  2X74 A;  3DXK A;  4CGJ A;  3CFO A;  5BR8 K;  1SS6 A;  2ASP A;  2D1K A;  4CHP A;  5KGX A;  5FLX O;  5GIP A;  3UKU B;  3HM9 A;  1ZC6 A;  3BDP A;  4O0I A;  4KH6 A;  1YJW N;  3SQ0 A;  4H5T A;  4FVU A;  4OPK A;  3DLG A;  4K0K K;  1EKE A;  1UOC A;  2NRV A;  4DF4 A;  1U47 A;  4BC4 A;  4CJR A;  4OPH A;  4RTF D;  4B9L A;  4FJ8 A;  1ILY A;  4DU4 A;  1C0U A;  3MK6 A;  1X9M A;  1YTU A;  1HPM A;  1HMV A;  1IJJ A;  5AQP A;  3WUH A;  4BDP A;  2ZJR L;  4DTN A;  3MEC A;  3O1B A;  4RWT A;  3CCR N;  5BPN A;  3CQX A;  2O8C A;  4B08 A;  1A5V A;  2V51 B;  5JIC A;  1Q86 O;  4E7J A;  4PUO A;  3R9P A;  4O0J A;  4O44 A;  4WFA L;  4K41 A;  3VQE A;  5AR0 A;  3MMV A;  3M8R A;  1RTD A;  3EE8 A;  1NKE A;  5HL7 L;  3ULE B;  1HKG A;  1NK5 A;  1UWB A;  3FZL A;  1L3T A;  3FE1 A;  3PV8 A;  1OVY A;  1QQM A;  4FK4 A;  3SBT A;  4DFK A;  4CES A;  2X6S A;  1RTH A;  4A57 A;  3EKS A;  3LL3 A;  1WLJ A;  1RT1 A;  4PWD A;  3HL8 A;  3V1R A;  4JK7 A;  1VQ8 N;  3C94 A;  1YI2 N;  2J4R A;  5IT9 O;  1Y64 A;  1RDB A;  3ZSZ A;  3P5J A;  2NZT A;  5C15 A;  1BIS A;  4LFC K;  5AZJ A;  2X6N A;  3L2Q A;  5HRO A;  1NGC A;  5J2M A;  1XMQ K;  1RNH A;  1JLE A;  4AHV A;  3ZX2 A;  4RW7 A;  2YJF A;  1TV6 A;  4H5V A;  4DQS A;  4FWL A;  5M1K A;  4KTZ A;  4HCC A;  3AGK A;  2E1Z A;  2QK9 A;  1SL0 A;  1KD1 O;  1MDU B;  2P9S B;  1O1W A;  3OYL A;  3U6F A;  4IOA L;  2I7N A;  3VES A;  2IIR A;  3QB0 A;  4TSX A;  1LV5 A;  4FWM A;  2KTQ A;  1NK9 A;  1BGX T;  1TK0 A;  5JVH L;  2P9K B;  2O8B A;  3CIP A;  3V1Q A;  3HOS A;  3LM2 A;  1QQN A;  2GUI A;  2P9K A;  5FRM A;  2O8B B;  3SUQ A;  4L3Q A;  1JLG A;  4JEP A;  1RDD A;  4AHU A;  2Y1I A;  3B6P A;  2P9L A;  4CER A;  5AQU A;  3VA3 A;  1K8A O;  4FOI A;  4M3X A;  3VEN A;  5AQM A;  1BHL A;  3EKU A;  3VTI A;  4KV8 A;  3K5O A;  1ASV A;  2VWJ A;  5AQZ A;  4LD0 A;  2G8I A;  5E26 A;  5HRR A;  4B1V A;  2RN2 A;  3KD5 E;  3RVC A;  3AAR A;  4F9O A;  1UAX A;  2DFH A;  4CJE A;  4GW6 A;  3K5M A;  1DKG D;  3QEW A;  2Z1I A;  4BRE A;  1UA0 A;  4DQR A;  1DGK N;  3LP1 A;  3L4Q A;  1HJO A;  3LDP A;  4ELV A;  2DPN A;  1S5J A;  3CCU N;  4PHT X;  4Q5V A;  3MEE A;  3LDO A;  1RBU A;  4WYB A;  5EVZ A;  4A5B A;  5AQR A;  1TUY A;  4KBO A;  4H0P A;  4B9T A;  3VQA A;  2CGL A;  2EWS A;  4X66 K;  4YY3 K;  5CE3 A;  4F8R A;  3K2P A;  3KWI A;  4JI4 K;  4OGE A;  3KLF A;  2P51 A;  3TU5 A;  3H3N O;  3CET A;  5EOY A;  2WTU A;  1Q9X A;  4B1X B;  2HHS A;  3A2F A;  3VGK A;  1VQ4 N;  4JKB A;  1YVN A;  5AQY A;  2WON A;  4MFB A;  4CHZ A;  2FXU A;  1LWF A;  4CD3 A;  1SKW A;  3WXK A;  3MEG A;  4FZZ A;  1BCO A;  3WXI A;  2FBY A;  4CGH A;  1KSP A;  3G10 A;  1CZA N;  1S22 A;  4FWK A;  2IGI A;  4GY2 B;  1NOZ A;  1S6P A;  4CF8 A;  4LFA K;  2P5G A;  3DLR A;  4CK3 A;  2HB5 A;  4DFP A;  3LAL A;  2ZWH A;  4I9Q A;  4EP4 A;  2FSN A;  1EP4 A;  4V19 S;  2HHV A;  3OS0 A;  1RDU A;  1KFD A;  1EO1 A;  5LJV A;  4JRQ A;  2AA4 A;  3V9S A;  4CJP A;  4U7B A;  4E7K A;  3I33 A;  3LPU A;  4CHN A;  2CH5 A;  3JSM A;  4DV7 K;  3HST B;  1WUA A;  3DI6 A;  3T3F A;  2BAN A;  2ZE2 A;  2HBM A;  5E84 A;  3WNG A;  4M42 A;  3LDS A;  4FWO A;  4CIE A;  3CXC M;  4UQG A;  1S6Q A;  2P1J A;  3L3U A;  4NCB A;  4K25 A;  4WQ5 A;  1WSJ A;  2HHT A;  3LPT A;  1BA0 A;  1MWM A;  3ATU A;  4FYD A;  3QLH A;  1NGE A;  4C8O A;  4FWP A;  3O5B A;  3H6E A;  2E88 A;  3P1G A;  4CJ3 A;  3PUF A;  3FLC O;  1VQK N;  4CVN E;  3EY1 A;  4PL8 A;  4EFH A;  3O9U A;  3ISN C;  4DV0 K;  3QER A;  4CHO A;  3WQT A;  4YOV A;  3CFR A;  2FC0 A;  1QVF M;  1NJY A;  1BQN A;  2OZM A;  3SMS A;  3ZSQ A;  1ESV A;  3TPQ A;  3SV4 A;  4YOR A;  4CEO A;  1CZB A;  5JLF A;  2BE2 A;  5KTQ A;  1S1X A;  3AO1 A;  3SQ2 A;  4G1Q A;  4AHT A;  4CGI A;  5E41 A;  3SAH A;  3SAG A;  1GOB A;  4Z4H A;  4CK2 A;  1IH7 A;  3P31 A;  3LWL A;  5EU7 A;  3T7Z A;  4A5A A;  3V9U A;  3AVG A;  4FLY A;  1ITG A;  3KD1 E;  1Q7Y O;  3OJU A;  4ISF A;  1VQP N;  1SZ2 A;  3NF6 A;  2G8H A;  3HM8 A;  2W41 A;  4FPA A;  2Q97 A;  1P8Z A;  3B8A X;  2BTF A;  2F9W A;  2NRX A;  3NFA A;  3NDK A;  4HVJ A;  2Q0R A;  1VQ9 N;  3SQ4 A;  2UUA K;  4EZ9 A;  4OLB A;  2OCE A;  2OZS A;  1RT5 A;  4YOW A;  3DOL A;  3CFP A;  4HTU A;  4DB3 A;  1FKP A;  3V9W A;  1C1C A;  3THW A;  3GOI A;  4XH4 A;  3AVJ A;  3MX2 A;  1B9D A;  2P9U A;  3OJS A;  4PKG A;  3L4I A;  3H1Q A;  3NVK A;  4Y1D A;  4W5R A;  4BRI A;  2KFZ A;  1GOA A;  3S3O A;  1RT3 A;  3F2K A;  1NJZ A;  3UE5 A;  4OKJ A;  3MWP A;  3ASM A;  1GLA G;  1Q9Y A;  1QHT A;  3E9O A;  3QIN A;  2KW4 A;  5C24 A;  3EL2 A;  4M3T A;  5HRS A;  3HSC A;  4DR6 K;  4BAC A;  4K43 A;  4Z0U A;  1DT9 A;  2O8D B;  4M63 C;  4KFB A;  1K8K B;  1K73 O;  4YOX A;  2IDO A;  4HUF A;  1Y97 A;  2VWB A;  2YHA A;  3MN9 A;  3ZX0 A;  2YKN A;  3M3Z A;  1KCF A;  3C6H A;  3CM6 A;  3NGZ A;  1NJW A;  1J6Z A;  3V1O A;  3SUP A;  2YNG A;  1J54 A;  3AVN A;  3KTQ A;  1BIU A;  3CCL N;  4CJL A;  3VQ5 A;  3MXJ A;  4ICL A;  3H08 A;  2Q1N A;  4JHD B;  2FF6 A;  4CZG A;  3N4Q A;  3G4S N;  1SKR A;  3C7N A;  5F0X A;  4CHY A;  3OYD A;  1DTT A;  4O5B A;  3DLL L;  5TKW A;  3WT0 A;  2HBK A;  2UYT A;  4ELT A;  1IG8 A;  5EY4 A;  4CCH A;  2ITM A;  1OH6 A;  5HLF A;  1L3V A;  2HHQ A;  5EX5 A;  3ZT3 A;  1BU6 O;  2HST A;  3NH1 A;  3SBG A;  3BGR A;  1TK5 A;  5JS1 A;  2B4J A;  1RT6 A;  5AQG A;  1V4S A;  4CEA A;  4DSE A;  1LCU A;  2HW3 A;  3AY9 A;  3I0R A;  3TAM A;  5AQQ A;  2V52 B;  2WBN A;  4JKA A;  4BR2 A;  4G9Z A;  2V7Y A;  4CJQ A;  3O3G A;  3H46 O;  2BUP A;  2IVP A;  2WC9 A;  4N47 A;  1TAQ A;  4DV5 K;  2UUC K;  4OVL A;  4A62 A;  1BL3 A;  1J5E K;  3U4L A;  3HBT A;  5MLC Q;  5AQJ A;  1XWL A;  3A5M C;  3VPZ A;  2P5O A;  3WNH A;  2YHW A;  4BRL A;  3FFI A;  3VQP A;  3SPZ A;  4JK8 A;  4JHD A;  3WNF A;  3HJF A;  1HUX A;  4BWJ A;  5CHI A;  4DR7 K;  3FZK A;  3AVK A;  2Z1J A;  1GOC A;  2FBT A;  1VSK A;  3VEO A;  2ASM A;  1SL1 A;  3SCX A;  1J5O A;  3Q7C A;  4HTL A;  4I2P A;  3CHW A;  4B1W B;  1NGJ A;  4OJR A;  4KHU A;  4WQ4 A;  1NK0 A;  1SQK A;  3CC2 N;  2XY6 A;  4DTJ A;  1HNW K;  3MWT A;  2ZGY A;  3I8D A;  4DSJ A;  1RCH A;  4HCB A;  2V7Z A;  3EO3 A;  3GE1 A;  4FVM A;  2G8F A;  3NF9 A;  3EZW A;  1L5U A;  4Z4F A;  4LSL A;  3WXJ A;  3G25 A;  1B92 A;  4Y0W A;  1MA9 B;  4DG1 A;  3ID8 A;  2JWK A;  2OPS A;  2DFE A;  4Z94 A;  3S3N A;  2A3Z A;  1YIJ N;  2Q31 A;  5CR4 A;  5KPR A;  3TAG A;  4CF0 A;  3HRG A;  2RHK A;  2Q0U A;  4IJN A;  1ZYQ A;  1NK8 A;  2QXL A;  4GKJ K;  3SJJ A;  4QS7 A;  1EXQ A;  3PIO L;  3AA4 A;  3PO4 A;  1S1U A;  4CF1 A;  1YT3 A;  4EHT A;  4DR3 K;  4E3S A;  3P38 A;  3PX6 A;  4LC9 B;  4JKF A;  5B8H A;  1N34 K;  1U48 A;  3F9K A;  4YDU A;  3R8E A;  2AJQ A;  4H5W A;  3UKR A;  2YHX A;  2JGU A;  5AQW A;  4FLW A;  2A5X A;  3F5T A;  3L2W A;  3NF7 A;  5AFU H;  4IFY A;  2GUP A;  1MU2 A;  2RPI A;  4BC2 A;  4BQL A;  3RRG A;  4EAH D;  4RG8 A;  5C10 A;  3S3M A;  1XC9 A;  3CER A;  5AQV A;  1L3U A;  3P83 D;  3VQQ A;  5JLH A;  1S1W A;  2NRT A;  4FXD A;  4CJV A;  3M8S A;  3DXM B;  2QA4 N;  3HTV A;  1NBW A;  5KPZ A;  3THY B;  1IKW A;  2QWM A;  3QIC A;  5GIO A;  4WCE L;  4BQZ A;  3IS9 A;  3CF5 L;  3CJB A;  2IS3 A;  5KRT A;  1M90 O;  2BGG A;  2F4V K;  5SWM A;  4CJ5 A;  3VF2 A;  4N5S A;  2QXF A;  1JKH A;  2ETJ A;  5GAD P;  1IBL K;  1DTQ A;  3KLG A;  3VEW A;  2HHX A;  4MO4 A;  2YJE A;  4IJA A;  4W5Q A;  4H0T B;  5AQX A;  4MDB A;  4KRE A;  4DKW A;  3D2F B;  3NF8 A;  5ADX A;  3F9M A;  4BVO A;  4BRH A;  4CHQ A;  2OPP A;  3HK2 A;  3B6O A;  3K58 A;  4M41 A;  3O4Q A;  3EEQ A;  4WFB L;  2DFF A;  3VEX A;  4BRQ A;  1Q82 O;  2ASO A;  3OVN A;  1JCG A;  3HT3 A;  3BZK A;  3THY A;  1YAG A;  3CC7 N;  1FKO A;  4PA1 A;  4ZTF A;  3O9T A;  1JL1 A;  3HI0 A;  1IKY A;  3VQD A;  3MED A;  1SKS A;  3AO3 A;  3L6Q A;  5KQD A;  2VQF K;  4DTO A;  1CXQ A;  5CZ1 A;  4B9Q A;  2CGK A;  1M1K O;  3A0I X;  4FW1 A;  1HQE A;  2QWP A;  1P90 A;  1I39 A;  3M5R A;  1W97 L;  3T1Y K;  1NGA A;  3ZT0 A;  2OAN A;  1DEJ A;  1VQN N;  4CJU A;  2I7P A;  4X62 K;  2P9S A;  4JI6 K;  2ZF5 O;  3U9Z A;  4B3S K;  4CJF A;  4W5N A;  2ZGZ A;  3OA9 A;  5J2Q A;  3WEE B;  4AHC A;  4E0D A;  4FJN A;  4JKH A;  4YOU A;  4DLE A;  3DAW A;  4QS8 A;  5M1F A;  4BR5 A;  4NXN K;  1S1T A;  1K9M O;  4KAZ A;  4FL9 A;  2VGM A;  1NMD A;  3G0Z A;  3NMU A;  1CZ9 A;  3AVM A;  4OKE A;  1FK9 A;  1B9F A;  1LWC A;  5KGW A;  3AVC A;  4R5P A;  1YJ9 N;  3KKR A;  5BRE A;  3C6U A;  4B1U B;  1ZBU A;  4W5O A;  1QZ5 A;  1S9G A;  4DSI A;  1YHQ N;  3VN5 A;  4GVE A;  3MDQ A;  3T69 A;  4IOC L;  4DF8 A;  3TAE A;  2A42 A;  4CGF A;  3H3O B;  3MN6 A;  3CCV N;  2O4I A;  3TI0 A;  1E4F T;  4BR7 A;  3BY5 A;  4CFC A;  4CEQ A;  3AV9 A;  3HZ6 A;  1NMN A;  4RW6 A;  2GEM A;  2PBD A;  4IO9 L;  1NGH A;  3GG4 A;  4DUY K;  2ATQ A;  4JI0 K;  1JXE A;  1WSE A;  3UB5 A;  3ENO A;  4KHP K;  2A1R A;  3ZSW A;  1W2B M;  4DWI A;  3J7A P;  3AO2 A;  3NBP A;  2O8F B;  2ZJP L;  3BUZ B;  3VET A;  4EZ6 A;  1QQO A;  4M3Z A;  3J7Y P;  2HMP A;  4JAX A;  4IFV A;  3D2E B;  3ZSO A;  4WFN L;  3IG1 A;  2Q3S A;  5BR9 A;  5AQS A;  1ZBH A;  5FPE A;  4BWM A;  1RGI A;  4K8Z A;  4KH4 A;  4FJH A;  3NHG A;  3LM9 A;  4OKK A;  3DLH A;  1N32 K;  1S9E A;  1KVA A;  5AQH A;  5H1S Q;  3J81 O;  4DTX A;  1Z26 A;  1HQU A;  2PFU A;  4LF5 K;  5IWA K;  4OGC A;  3QES A;  4IWV A;  1GLJ O;  3GL1 A;  1GLC G;  2P9P A;  4HHT A;  3AGR A;  3HYF A;  5BRD A;  1HNX K;  4LSN A;  2CGJ A;  2W6L A;  3ZCM A;  3SYZ A;  3OTO K;  1D9F A;  4CBU A;  5KQ8 A;  2A1S A;  4B1Z A;  3K5L A;  5M1Q A;  2HF3 A;  2VCP A;  2WOM A;  1QZ6 A;  3S41 A;  3U8X A;  4BRG A;  1TAU A;  2RE2 A;  3WQU A;  4CGG A;  2F8T A;  4JLH A;  4B9M A;  3VGM A;  1WOQ A;  4IDK A; 
#chains in the Genus database with same CATH homology
 4JV5 K;  4DV3 K;  3J80 O;  1XNQ K;  2ZM6 K;  4NXM K;  4DR4 K;  4LF8 K;  4LF6 K;  3JAM O;  5A2Q O;  4YHH K;  4X66 K;  4YY3 K;  5LMU K;  4LF4 K;  4JI4 K;  4GKJ K;  4B3M K;  4X65 K;  4DUY K;  4JI0 K;  4DR3 K;  4JI5 K;  5IT9 O;  4DV1 K;  4JI2 K;  4KHP K;  1N34 K;  3J7A P;  4LFB K;  4DV6 K;  4JI8 K;  4DUZ K;  4LFC K;  1XNR K;  4AQY K;  4JI3 K;  4JYA K;  4B3T K;  4CW7 B;  1XMQ K;  3J7Y P;  4LFA K;  2UUA K;  4DR1 K;  4JI1 K;  4JI7 K;  2VQF K;  4V19 S;  1HR0 K;  4LF9 K;  1N36 K;  5BR8 K;  4X64 K;  2UXB K;  3T1Y K;  1HNZ K;  4DR2 K;  5FLX O;  2UUB K;  1N32 K;  4DV5 K;  2UXC K;  4LF7 K;  4X62 K;  2UUC K;  4JI6 K;  1J5E K;  1I94 K;  4DV7 K;  3J81 O;  4B3S K;  2HHH K;  3T1H K;  4LF5 K;  5IWA K;  4K0K K;  1FJG K;  2UU9 K;  1IBM K;  4DR7 K;  1IBK K;  4DV4 K;  2VQE K;  4B3R K;  1N33 K;  1HNX K;  4DV2 K;  4NXN K;  2F4V K;  4DR6 K;  3OTO K;  5LL6 Z;  1XMO K;  5AJ3 K;  1IBL K;  4CVN E;  1HNW K;  4DV0 K;  2E5L K;  4OX9 K;  4DR5 K;  2UXD K;  4GKK K;  5LMN K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...