4LFCK

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lfcK00
4V19S 2UXCK 4NXNK 4X65K 1IBMK 1HNXK 1J5EK 4DV5K 4LF8K 2ZM6K 4LFBK 2HHHK 5IWAK 4JYAK 2VQFK 4B3SK 5BR8K 1N34K 4JI7K 3OTOK 4JI6K 2UUBK 4JI8K 4X62K 2VQEK 5LMUK 4JI0K 1I94K 4DV4K 4X66K 4DUYK 4LF6K 5LL6Z 3JAMO 4LFAK 1HNZK 1N32K 1FJGK 4LF4K 1XMOK 2UXBK 3J7YP 4JI5K 2UXDK 4JI3K 5AJ3K 4GKKK 2UU9K 4X64K 4DV6K 4YY3K 2F4VK 5FLXO 4LF5K 5A2QO 4JI1K 1XMQK 1N33K 4DR6K 4KHPK 4NXMK 4DR2K 3J7AP 4DV1K 4JI4K 4DR5K 4B3TK 4DR4K 4CW7B 4B3MK 1XNRK 4DR3K 1HR0K 1N36K 5IT9O 4DR1K 1HNWK 4CVNE 1XNQK 4LF7K 1IBLK 2E5LK 2UUAK 3J80O 4DV0K 4DV3K 4DV2K 3T1HK 2UUCK 4LF9K 4K0KK 4OX9K 1IBKK 3T1YK 4JV5K 5LMNK 4DR7K 4DV7K 4LFCK 4JI2K 4B3RK 4DUZK 4AQYK 4YHHK 3J81O 4GKJK
chains in the Genus database with same CATH superfamily
3NH2A 2R7YA 1HPZA 2O8CB 3NGZA 3QLHA 3T1AA 3KVGA 1OKJA 1XHZA 4Z4CA 2Q36A 1BUPA 1GLBG 2Q1NA 4JKGB 3TTFA 2F9WA 4BACA 4IDKA 5AQGA 3M3ZA 1VQNN 3VERA 1OVYA 1UOCA 1MU2A 5AQMA 5GIOA 4EHTA 3U4LA 4AHTA 1OVQA 4KTWA 3K59A 2YHAA 1ZYQA 5DM7L 5E26A 4AM6A 2OPQA 3CI5A 1RGIA 1NK8A 4ZTJA 4OPJA 4BQZA 3OYLA 5HBMA 1VQ6N 3VQDA 1X3NA 3P1GA 3TANA 2QWLA 2HHVA 3CM6A 3CPEA 1KAYA 3QBXA 1QE1A 3VQ9A 4DSJA 5KRSA 4YDUA 4OPAA 1TKZA 3DRPA 3GBTA 3JAMO 1F21A 3ZT4A 4FJHA 3SAGA 3VQCA 2Q0UA 1RT3A 4JD2B 3CQYA 4CEAA 3A5OC 5TKWA 3B8AX 5CYQA 2HHSA 4G1QA 4AHCA 1DEJA 5KQ8A 4M3XA 4JI1K 3OJUA 4DQRA 3O9RA 3DLBA 2O8BB 1ASWA 3RMAA 2KFNA 3C7NA 4FWKA 4BRIA 3O6WA 4Z4GA 3THYA 1RTJA 1BQMA 1T6CA 1BG3A 4WFAL 3KLHA 2GTDA 2VYPA 2WUSA 2HMIA 3TPQA 4C8NA 3CF5L 4DTJA 5GINA 3HVTA 1C1AA 2HHWA 3IUCA 3U3YA 4ELUA 1VK0A 3EZWA 4DV2K 2HVHA 4B1WB 1Y97A 3GG4A 3ZSZA 2QKKA 4BRGA 4JI2K 1O13A 4OKKA 1KFDA 2E2OA 2FBYA 3VF2A 1NJZA 4E7JA 3NCIA 3OS1A 4DS4A 4X65K 4IFYA 1A5VA 3LAKA 2OTLN 4CK1A 1TGOA 2ATQA 1J5EK 1J54A 4U67L 2DY4A 4KPYA 2ASMA 4CEZA 1EQYA 2HHQA 3HM9A 3SAFA 2I7NA 1SKSA 2VQFK 4A5BA 2X74A 4OPHA 1ZBFA 2OPSA 5FPNA 1GOCA 4FLYA 3RMCA 1GLAG 1Z6RA 5AQJA 1QHTA 4JI6K 5I42A 4DQPA 4M41A 2XO7A 3BF1A 3DLGA 2KQ2A 4IBNA 1TK0A 4AH9A 3IDHA 4X66K 4W5OA 4DUYK 1HKCA 1EWQA 4CJ4A 3L2VA 2P9PB 5ADXH 1NOYA 1HJOA 3VEXA 5BREA 4BRCA 5B8HA 3O1BA 4CZFA 1K8AO 3TSPA 4JI5K 3MWPA 3CFPA 3NGIA 3AVKA 1KAXA 3SPZA 3P4IA 4FJ9A 3SLCA 3IKMA 3D0PA 2QTDA 4CF0A 2W6KA 4WF9L 3RTVA 1IKWA 3NF7A 3AVNA 3VESA 5JICA 4CJLA 1S6PA 3M8RA 2ASOA 5HP1A 5C2FA 4I2PA 1JCEA 4CJKA 1U47A 2QXLA 1Q81O 3UIQA 1RNHA 2W41A 4CHNA 1VSIA 2HNYA 2JGUA 3LP1A 3OYHA 4FLTA 1QVFM 3PIPL 3ZSQA 3HPHA 1IV0A 2QM1A 5BN8A 1NJXA 4I2QA 2OTJN 1LW2A 4FOIA 3VQAA 4H5RA 2UUCK 2PYLA 4C8OA 3C95A 4RG8A 3TTDA 3PUFA 2A1RA 4FJNA 2P5OA 3UKRB 1CLQA 3VTHA 1JCFA 2P1JA 1S72N 3I56N 1FXXA 3ITHA 3GL1A 2E1YA 1G99A 1TYQA 1U49A 3CXCM 1QVGM 4H0XB 2D5RA 2HB5A 3SCXA 3CETA 5HRNA 2KHOA 1I39A 1L3VA 5F1XA 3KKSA 2ITMA 4CERA 4O5BA 1FW6A 4BC5A 1JL1A 1VSDA 3TAPA 4TSXA 4JI7K 1T3VA 1KC8O 2G8HA 3ZX0A 3VF4A 2HBMA 4DQSA 5M1NA 1WSJA 3CQ8A 3ID8A 3F73A 2G8UA 4F2SA 4CGIA 1JLCA 1I94K 2HNZA 1WSFA 3ZSYA 5MLCQ 3HBTA 5CZ2A 1NGHA 2QWMA 1QZ5A 4FJMA 3C6TA 1XI1A 3V9WA 4O0IA 4BRDA 3M8SA 4KREA 2O4GA 3WXLA 5JMVA 1K8KA 4EP4A 3WEEA 2PY5A 4OGCA 5AJ3K 1BWFO 1P8ZA 4CCHA 2O8CA 1H1VA 4FJGA 4DU3A 1RDDA 4JKGA 2VWKA 1P90A 3WQUA 3HK2A 3VTIA 3EL2A 1YIJN 3FFKB 2Z1HA 4FZXC 4DR6K 1NK9A 3HOSA 1TV6A 1CZAN 1NMDA 3B6OA 1YTUA 1BIZA 2YKNA 5CR4A 2CGJA 4A2AA 3PLAA 3HZ6A 1Q8IA 4KFBA 2PZSA 1HQUA 1TKXA 1GLDG 4WQ4A 3ENHA 1EXQA 2A42A 3OYKA 2GX9A 1IH7A 1IBLK 1SL2A 1TL1A 4KH6A 2IS3A 4FVMA 4J2DA 4F3TA 1W2BM 4Y0WA 4GY2B 4AHSA 4AHRA 4H0TB 2P9SB 1MDUB 4KTZA 4MLEA 5J2NA 3K5NA 3EE8A 3LP0A 3VQQA 4H03B 4B9TA 1VQ7N 1RT4A 4AQYK 1ATSA 5HRPA 5K14A 4E7KA 2IAJA 5F2RA 2UXCK 2O8FA 3MAQA 4CBWA 3VEYA 3SMPA 2F7TA 1QQMA 2B4JA 4BQLA 3OYDA 2P51A 5HL7L 3D2EA 4AILC 5IWAK 2OPRA 3KD1E 2AA4A 3AVLA 3D45A 3QIPA 3FE1A 3DWLA 3H3NO 1XQSC 3L3VA 2V52B 5AQVA 3NHGA 3ZSWA 2KZZA 2IGIA 3CCUN 4FM2A 4M3UA 4N41A 4YDUC 3G10A 4B1UB 2WFBA 4ILGB 5DM6L 2Y1IA 1L3SA 1CXUA 4M3WA 4CF8A 4K43A 1Q82O 2V7YA 2RN2A 3FZHA 5AQSA 1K6YA 3OYBA 1C1CA 3SUNA 1HYVA 5DK5A 2YI1A 5BR9A 3MX2A 1RT5A 3KKRA 1WN7A 5LY3A 4N56A 3HXMA 4JRPA 3VQ6A 2WOMA 5M1OA 3WNEA 4O0JA 5BN9A 4CZLA 5FPMA 4PL8A 3LM2A 3HRGA 1M90O 4BREA 4CD3A 5HRSA 3MECA 3SYZA 3QEIA 3VGLA 1RDCA 3EN9A 3MCAB 3S3MA 2KTQA 4JAXA 5AQRA 1RBVA 3AO2A 4B3OA 2VCPA 4DR4K 4BDYA 3W0LA 3FGUA 4CJ3A 1OH7A 4FJ8A 3ZSOA 4FWRA 3TAGA 4J2BA 3PV8A 3G0ZA 5KPRA 4GV3A 3HI0A 2P9PA 1NGGA 3ZEUB 3CC4N 3CPWM 2ZWHA 3ZT3A 3C94A 3C6AA 2FSKA 3T7ZA 3QERA 3P31A 4KHNA 3BGRA 3UE5A 4BG9A 1FKPA 4PY5A 1JLEA 3MXJA 3MWTA 3D2FB 2DTUA 3A5MC 1WBDA 5E41A 1VQON 1D9DA 2Q0RA 4DWIA 2E20A 2D0PA 3V81A 2E2PA 4CIFA 3AARA 4GVEA 4H5VA 1TAUA 4LFBK 4Q0BA 4FPAA 3HOTA 2X6NA 3THWA 1ASUA 3LZJA 3EKSA 4GNIA 3EY1A 1SL1A 3DXKB 1RBRA 5J2QA 5TKYA 2QWOA 3NMUA 4CE9A 5FPEA 3V9XA 2NUBA 1U48A 3U8XA 4CZEA 4RWTA 2VQEK 5AZIB 1U4BA 5J2PA 4HCBA 1IJJA 4DV4K 4O5FA 3JXUA 3CJ9A 2CH6A 1S1TA 3LDNA 1L5UA 4YOTA 2HNDA 3QBWA 3DXMB 1N8RO 4NO7A 3ZCMA 4LF4K 1OH5A 3OYNA 3K0SA 3VEOA 2IC3A 2CGLA 1UA1A 2XY7A 1XC3A 3E1YA 4BRLA 4DTUA 3THVA 2E2NA 3HVRA 3MK6A 2E4LA 4LF5K 1JCGA 3LALA 5A2QO 1WOQA 4N76A 3KJVA 4CJVA 3MEGA 5H1SQ 2P9IA 4DLGA 1WAFA 4M7YA 4Z0UA 1NK7A 4WCEL 3OY9A 4FW2A 4XIUA 1DT9A 3V4IA 4DG1A 1GLFO 5C12A 1DGKN 4JKFA 1D8YA 2IIRA 1QZ6A 1VQ5N 4CJSA 4HTUA 3SQ4A 5LJWA 3CG7A 2QA4N 4HWIA 2NRZA 3FZFA 3VQ5A 2FXUA 4EZ9A 1JL2A 4E1NA 3VA3A 1W9HA 2YNGA 3VQ7A 4B9MA 1EO1A 4DQIA 3AVAA 4CIEA 4A59A 3VEZA 5BPMA 4FM0A 3CJBA 4NXNK 4PL7A 4E7IA 4DSFA 1IBMK 1BGXT 1C6VA 4OLBA 4O55A 3DLHA 3HL8A 2G8FA 4IXCA 1VQ4N 4LF8K 4OKJA 3JSMA 1HNVA 3F5TA 3NBPA 5C42A 3CCLN 4DU4A 3L6QA 3T3FA 3CC7N 2YX6A 1TL3A 2GELA 4JK7A 2GWKA 4LC9B 1BCMA 5KQDA 4KHYA 5LMUK 4L8RB 3A2FA 1NWKA 4CEFA 3MMVA 4E3SA 1UWBA 1YJWN 4M7XA 1OH6A 4FK2A 5E84A 4LFAK 3H46O 1R59O 4XH4A 4E89A 3ID6A 1GLLO 1QSSA 4BRMA 1L3TA 4DF8A 3NE6A 4OLAA 4JEPA 3OS0A 3HPGA 4CZKA 2VG7A 3HPOA 3O4WA 1ATRA 5HROA 1IG9A 3SQ0A 3O1WA 3LDQA 1JLQA 4YY3K 5AQFA 1GOAA 1JLAA 1RT7A 1B92A 2NRXA 1C1BA 4JNEA 4NXMK 3SJHA 4FWOA 3EKUA 4B9LA 3AV9A 1VSJA 3EEQA 1LW0A 2ZJQL 4CEQA 5CY4A 4B3TK 3CFOA 3CCRN 4IFEA 4WQ4C 4PHTX 3L4IA 3C6HA 1WNSA 2A6AA 5BPNA 5GIPA 3TSQA 1HJRA 1YXQA 3AAQA 3OBYA 4K42A 5JVGL 4BGAA 4BVOA 4MDBA 3JS6A 3T1HK 2O4IA 3K9KA 4NB4A 2EWSA 3PSFA 3I55N 3T1YK 3UB5A 3AA4A 4FL9A 3DRRA 1VSEA 3ATUA 4M3RA 1TAQA 2JWKA 4EP5A 3L0QA 3RMDA 3SMSA 4Z4IA 3N4QA 1GLEG 3O3FA 1Z25A 2XRIA 1QS4A 4Y1DA 4FM1A 4W5TA 1ITGA 1JLBA 3ZSRA 5LJVA 3I0SA 4BR5A 4ZTFA 4IOXA 1RCHA 4PWDA 3OYMA 4BVPA 3IMXA 4JKDA 3R8EA 4BWMA 3TABA 4YOWA 4QS9A 1VQMN 2KKZA 3MEEA 3EYZA 2QWQA 2P9KA 3HSCA 4KHSA 1RDUA 1A5WA 2E8AA 4KH4A 2A40A 3V6DA 5C24A 3LZIA 3QO9A 3G71N 4ISEA 4H5WA 4KB0A 4I6MB 2O8EB 3OYIA 4JI3K 3K5MA 3K58A 1C0FA 3FZKA 3D2FA 3VPZA 4X64K 2KW4A 3NVKA 4CJWA 3OYEA 1BQNA 1SV5A 4PKGA 2E88A 4DR2K 3V9ZA 4B8AB 1MWKA 3OYJA 4C8KA 3S9HA 2KLAA 1TK5A 4K8ZA 3O9TA 3AA2A 2JWLA 3DXKA 1W7AA 4YNQA 4BC2A 1U04A 5FDLA 1L3UA 1NGAA 3HP6A 2OZMA 1RILA 4LF7K 1RBUA 2E5LK 1K73O 2F8TA 1S1XA 3J80O 1V4TA 1VSMA 2IVNA 4HUEA 3AO5A 4QCLA 2QEXN 1S1WA 3DLKA 4B9QA 4WYBA 1JJ2M 2QI2A 4E7HA 4DSIA 3OHRA 4B9NA 5F0XA 2ZGYA 4FWNA 5AZJB 3OA9A 1ATNA 2HBLA 4Z94A 3P39A 3I33A 4B1VA 4KTQA 3K57A 3LWLA 4IJNA 2D1KA 3SV3A 1NK0A 3WT0A 4CGDA 3VENA 3PX4A 3HM8A 4CJRA 4CEBA 4EIAA 1NLVA 2QWRA 1QQCA 4CFBA 4CFCA 1HYSA 3MX5A 2OZSA 4KBOA 4X62K 3LDLA 1IKVA 3AO1A 3AVHA 2HW3A 2P9NB 1EKEA 2DFHA 2ZQBA 1NJYA 1HKBA 4CJFA 3RWUA 4C1NI 1E4GT 3IFRA 1ZBLA 4YFUA 4DKWA 4FJIA 2Q97A 1BHLA 1ZC6A 1QHAA 1KD1O 3SK3A 1ZBSA 4OGEA 2V51B 4DHYA 4DV6K 1S9GA 2F4VK 4H5TA 5JVHL 4WFNL 4H0PA 3DRSA 4OO1J 2FBTA 2G8WA 1XMQK 2QKBA 3CFRA 3CIPA 3O08A 1NKEA 2YNIA 3ZX3A 2P9LA 1CXQA 2O8DA 3THXB 1J6ZA 4BRKA 4E7LA 2FLOA 5M1KA 5J2MA 1NGDA 1RBSA 4F9OA 3AO4A 1TK8A 1LAVA 2IDOA 1XNQK 2VG5A 3BP8A 4NLBA 1WSGA 4KI6A 3DM2A 1VRUA 4ID5A 3NFAA 4JKBA 5CZ1A 2LSNA 2GEMA 3TR8A 2Z1JA 3MXIA 3SV4A 4LF9K 4JS4A 4DTNA 5T7BA 3ZETB 3SBTA 4YOUA 5LMNK 2VGNA 1VHXA 4KKOA 3LDPA 4DU1A 1YITN 3M1FA 2ZJRL 3SI6A 5GAGP 5JLFA 4DV5K 3QNNA 1BA1A 3PO5A 3BZCA 3PSIA 3LPUA 1VQPN 3KLFA 4UY8O 3RR7A 3CJ7A 5BR8K 1EETA 5AFUA 3MN7A 4YOYA 4JD2A 4GMJB 2YV0X 1XWLA 4CEDA 5I3UA 1NG9A 1YAGA 5AQNA 4JI0K 3NH0A 1M1KO 3TAEA 1Y64A 5CHIA 4RTFD 3AVJA 3OW2M 3V9SA 4NLCA 4BDZA 1NGCA 4Q5VA 2O8BA 5HOOA 4CD1A 4M45A 1LWEA 2YJFA 2FBVA 3D6RA 3BEXA 1VRTA 2D0BA 2HHUA 5FROA 3TARA 1KTQA 4CFDA 2KZMA 4QOZB 1JLGA 1KVAA 3R9PA 4O4GA 4O8UA 5FLXO 1NOZA 5GADP 1X3MA 2PAVA 1VQ9N 4FPBA 3L8BA 3VOVA 4PQUA 1Q86O 3AVIA 1E4FT 4FJXA 3ULEB 4DV1K 2VGMA 2OPPA 3MN9A 2YHBA 3CMEN 3L2WA 3C65A 1SUQA 2GUIA 2ZF5O 3KK3A 4G9ZA 4XEIA 3PX0A 4CGGA 1E3MA 3TAQA 4CEEA 4DV0K 1HNIA 4E1MA 1YT3A 3C7NB 3VF6A 1XUPO 4GV9A 4OX9K 1XC9A 3RMBA 3L2RA 4DR7K 4CI6A 2VG6A 4W5NA 3H45C 4DUZK 2BDPA 4I6MA 2O8EA 3J81O 4I9QA 3OYAA 1SS6A 4CEOA 4FLXA 4DFJA 4JHDB 1C0TA 5CE3A 4BC3A 2RF2A 3NF9A 2ZGZA 4ELTA 4BRQA 5EVZA 4CHYA 4CF9A 3IRXA 3VQ4A 1MA9B 3TU5A 5SWMA 5EOYA 4KAZA 3O3GA 2ITGA 1JXEA 1W97L 4H0OA 4BR4A 3JYTA 2HMPA 5CYMA 1V4SA 4DTXA 2QWPA 3OBWA 4NCGA 1S5JA 1N32K 1HNZK 5AQYA 4PKHA 2F9TA 3LAMA 5AQPA 3A8YA 1T7PA 4CZHA 5KI6A 3CCQN 3SNNA 4CGFA 2WBNA 1DTQA 3MN5A 1VQKN 4CECA 3MXMA 1B9DA 1RT1A 1S9EA 5HLFA 4CHQA 3VQPA 1BA0A 4H4MA 2D0CA 1TUUA 4BG8A 3I8BA 4DFMA 4PUOA 4L3QA 3OVNA 4BRFA 1NBWA 2A3ZA 2W6LA 1GLCG 4FJ5A 3UKRA 4JLHA 3ZX2A 2Q31A 1Z05A 2NRHA 1XNRK 4LH5A 3K2PA 4LD0A 3HSTB 3HT3A 2GUPA 4F4KA 2P9NA 3PX6A 2FF6A 1NK5A 2PFUA 4IEEA 2HF4A 4B1ZA 3SUPA 4R5PA 4BRPA 3R6MA 4CESA 4FJLA 4KHQA 3LDOA 4HUGA 1NK6A 4K0KK 3IAYA 3DOKA 2F96A 2DFEA 4GV6A 4DLEA 4DF4A 1D5AA 5AQTA 4AHUA 1VSKA 3NGYA 3AA5X 4YHHK 1QTMA 3M6GA 3O4QA 1YJNN 3ASMA 1REVA 4H0YB 5KPTA 4BGBA 4H8KA 5ELZA 2BGGA 2GWJA 3WXJA 1BIUA 4JKAA 2YHXA 2YNHA 1BU6O 5EU7A 4DS5A 4CJPA 4FWPA 3A5NC 2OANA 3K5OA 3SUOA 4JKCA 3U9DA 2V7ZA 4CGJA 3KWGA 1KFSA 1HLUA 1N34K 1VAZA 4LY7A 2UUBK 3LDSA 3ZSVA 3S3OA 4XH5A 5C0YA 4U7BA 3CM5A 3G25A 3R1XA 1UAXA 4BRAA 4FLWA 5BPLA 3NH1A 2P9UB 2E1ZA 5AQOA 3ZETA 1KVCA 4FJJA 3AVFA 4BR2A 4JK9A 2I7PA 5BRFA 3H3OB 4BRNA 2I5JA 3S41A 2D4WA 5KRTA 1KSPA 3LM9A 3PIOL 4QS7A 4DB3A 2NRVA 1X1PA 1NK4A 1XHXA 4CZJA 3MEDA 3RVCA 1YF5L 4ZHRA 2WTUA 3Q7CA 3AY9A 2XY6A 3KLGA 1X9SA 4QAGA 4B9UA 4K41A 4OKEA 2P9SA 3FZLA 1HMVA 1ILYA 3AA3A 3VEVA 4J2EA 1K8KB 4DR5K 3WEEB 4CW7B 3CQXA 1ZXOA 3CMAN 1HR0K 1X9JA 4FK4A 3AVGA 2ZD1A 3PO4A 1SKWA 1ASVA 5AQWA 3LPTA 2GV9A 5AR0A 4FSVA 3TAFA 3SPYA 4KB1A 4BE1A 4IG0A 3C0BA 1VSFA 3P83D 4BE2A 3WNGA 4LSLA 4F2RA 4M3YA 1BOTO 1Z26A 3HP9A 4GW6A 1QSLA 4NYFA 4E19A 4FK0A 3DLEA 1LWCA 4WFBL 1C0MA 1YTAA 2D0AA 4H4OA 4A5AA 2IOCA 3KTQA 4UQGA 3LWMA 4JKHA 3CHWA 5C25A 1KRPA 4IKFA 3RSEB 1HUXA 1MWMA 3VETA 4FZYA 4MFBA 1ZBIA 4WQ5A 5AFUH 5M1PA 1YUWA 4FYDA 3CCSN 5I9EB 1RDBA 4FLZA 3ULEA 2BANA 3SQ2A 1HYZA 3IS9A 3ZSXA 2QWNA 4JK8A 3KK1A 2W40A 4KHWA 3O9SA 2O8FB 4JI8K 2G8IA 1WAJA 3TWHA 3O4NA 3MN6A 2BTFA 4I7FA 1TVRA 1NGBA 4DQQA 2HHXA 4FOEA 3CJAA 3V1QA 5HRRA 3NF8A 3QEVA 1X9WA 1NKBA 3D2EB 5LL6Z 2IVPA 3CCMN 4FXDA 2Y1JA 1NU0A 4C8LA 3LP3A 4ILHA 4BE0A 2UXBK 2VWBA 2F8SA 1RTIA 2NRWA 1RDAA 2A5XA 2UU9K 1RT6A 3N4PA 1CZBA 1QQNA 3RRGA 3GOIA 5KGXA 1T05A 4JHDA 4AM7A 4Y1CA 3U3GA 3E01A 3O5BA 4DCHA 3V1RA 3J7AP 3QIOA 3ZEUA 4FWMA 4DTRA 3QNOA 3FR0A 1NKCA 4H0VB 2E6MA 4FCYA 3J7ZO 4DR3K 4CJUA 2OCEA 1BI4B 1YVNA 3E66A 5IT9O 1JKHA 3DI6A 3L2UA 2YJEA 4C8MA 5GAHP 1N6QA 1FK9A 4RW7A 3G4SN 2EHGA 3J8AA 5AQIA 1R0AA 3ZYYX 4ILJA 1UA0A 1IBKK 3H1QA 2RE2A 3UKUB 4BRHA 1TKDA 2HOEA 3WXMB 1YHQN 3ULDA 2X6SA 3O9UA 4E1JA 4W5QA 1VSHA 1LWFA 3IG1A 5KTQA 4DMNA 3H1VX 4M63C 4EHUA 3L2QA 3BF3A 1W0HA 5AZIA 3KD5E 1WSEA 4DTPA 3F9KA 3KZBA 5DMRA 2FF3B 3BY5A 4KV8A 4CIGA 2PYJA 5M1FA 3QDKA 2JLEA 1U2VB 3V1OA 3DXMA 2VWJA 4BC4A 3CYMA 4BY9C 3CD6N 3S3NA 4EZ6A 4RCHA 5AQHA 2PBDA 1NGFA 5D3GA 1WB9A 3OYFA 3QB0A 2ETJA 4NYNA 3I0RA 4F3OA 4HCCA 1NGJA 2HSTA 4B1XB 3U9ZA 3L3UA 3M8QA 3NF6A 3ZT0A 5KGWA 3K5LA 4GVMA 3ATVA 4LF6K 3AGRA 5KPZA 4BWJA 4FWQA 2CGKA 3E9LA 3THWB 4Z4HA 3HYFA 3VQBA 2RPIA 4BROA 5EY4A 4CZIA 4KHUA 3RR8A 5JLHA 1I3AA 4KO0A 1SQKA 3AO3A 4O44A 1NMNA 4MLHA 4IOAL 4J8FA 4W5RA 2H3GX 1JLFA 4CJQA 1S6QA 4FJKA 2Q3SA 1IG8A 1J53A 5GAEP 4CJEA 3DJCA 4NCBA 3VEWA 3CJ1A 1VSLA 4ELVA 1KXPA 1WLJA 4CFAA 4B3MK 4H5NA 1VQ8N 4M3ZA 1JXBA 3H08A 4A61A 4CHOA 4CVNE 3DYAA 3DLLL 4NCAA 1WBBA 2UUAK 2A41A 3A5LC 4ID1A 3GE1A 2P9IB 2P9UA 3DLRA 4Z4FA 4A2BA 3ZLJA 1D4XA 1LAWA 4B3RK 1LOTB 1ZBHA 1BL3A 4GKJK 3Q7BA 4BR9A 3OYCA 3G6EN 4RW8A 3U6FA 4MDAA 3VQEA 1ESVA 3QEPA 4YOXA 3SQ1A 2Z1IA 2ZM6K 4PKIA 3KLEA 4CJTA 4XH1A 5C10A 2NZTA 2YHWA 3OYGA 2QK9A 2NNWA 3CJCA 3VMFB 4IOCL 4CJ7A 4RW9A 1LCUA 3VA0A 2XY8A 3O3HA 4E0DA 3FLCO 4N5SA 1NGEA 1NJWA 1D9FA 3QESA 4CF1A 3F2KA 4JRQA 4FO0A 2X78A 3TTCA 5BRHA 3V9UA 2RKIA 2P5GA 3WUHA 2UXDK 1VQLN 3SAHA 3KK2A 4AHVA 4O8KA 3RSEA 3LP2A 4IEIA 4IO9L 3QETA 4DTMA 2WC9A 4KHPK 4CK3A 2EX3A 1C0GA 4K8XA 4CBXA 3OJSA 4DTOA 4IZ9A 3P38A 1U6ZA 4KI4A 2BUPA 4CHPA 1RFQA 4N47A 5AQLA 4JI4K 3ALYA 1BDGA 4B08A 4IO8A 4ISFA 4FLUA 4R79A 1N36K 1DKGD 2IVOA 1CZ9A 3M8PA 3WNHA 1OH8A 3HJFA 4AF1A 1TUYA 4DV3K 4ICLA 4FVUA 3GDQA 2UYTA 3QEWA 1IKYA 4BDPA 1EP4A 1U45A 5AQZA 2W42A 2XY5A 3FFIA 4LFCK 3CERA 3ENOA 3CCEN 4WE1A 3SZ2A 3KK7A 2HBKA 3HTVA 2YCHA 2HF3A 2OYQA 1K9MO 3WXKA 5FRNA 1HNXK 1SAZA 1N5YA 3B6PA 2AP1A 4F8RA 4WQ5C 3KHYA 3PY8A 3AVMA 1BCOA 3KIOA 3EZ5A 2FBXA 1KLNA 4B3SK 1YJ9N 3THYB 1KLMA 4M42A 2QW9A 3NDKA 4HUFA 1HPMA 4OPKA 4FLVA 5C2DA 1TKTA 5AQQA 1DLOA 4FW1A 1BI4A 4B8CA 2WONA 1RT2A 3FZMA 1T44A 5EX5A 2NRRA 1S3XA 3EE9A 4MO4A 4FWLA 3AGKA 3MDQA 5AQXA 3ISNC 4CHZA 2YKMA 3VQ8A 4MQ3A 4CJ5A 4B9SA 2DFFA 1O1WA 2CH5A 3WXIA 4PA1A 1HQEA 1SL0A 1KCFA 2G8VA 5FRMA 3K9JA 3F9MA 3UKUA 4B1YB 1QQOA 5ADXA 2ZE2A 4HHTA 1YI2N 1B9FA 1IO2A 1Q9XA 5FPDA 4GKKK 2BE2A 2XHBA 3VGMA 4I9LA 3TSUA 3T69A 2B6AA 3QFUA 4ISGA 4HVJA 4CZGA 4CZMA 4YOVA 1KQSM 3NVMA 3NAEA 1ZBUA 3E9OA 2P9KB 4A62A 4KH5A 4RW6A 3WQTA 1U2VA 4YORA 4FZZA 1HX1A 5AZJA 1QSYA 3M5RA 4DQ8A 5BRDA 2J4RA 1Q18A 4DR1K 2ASPA 3W3DA 4CK2A 4EFHA 4BR7A 1HKGA 5EXWA 1EWRA 3DMJA 4IG3A 1SZ2A 2DPNA 1J9AA 2YHYA 1IKXA 2FSJA 2Q2RA 1SKRA 3AVCA 2RHKA 1LV5A 2FSNA 4CBUA 1A5XA 4V19S 1C0UA 4K25A 3EO3A 3SUQA 4IDHA 2NRTA 1Q9YA 4BR0A 3CC2N 1RTHA 1KAZA 1S22A 2A1SA 4A57A 5SZTA 3DOLA 4RW4A 3TI0A 5AQUA 1RBTA 4M3TA 3VGKA 2HHHK 3AAPA 3VN5A 4JYAK 3KWIA 4OVLA 4DFKA 4LSNA 1DTTA 1YVUA 5AQKA 2HVIA 3OTOK 1T03A 3CCJN 4Z4EA 4DSKA 3E9PA 3H6EA 2Z1GA 1BO5O 4CGHA 4OJRA 4IFVA 1GOBA 3SBGA 2GBZA 2FC0A 4C23A 3BDPA 4DSEA 2KFZA 3QINA 4C1NK 4KRFA 3R3LA 1T6DA 3T19A 5J1EA 1RDWX 2HHTA 5C15A 3WNFA 2BH1A 1FJGK 1XMOK 1S1UA 3RRHA 3J7YP 3THXA 4LH4A 2D0OA 3BZKA 1J5OA 4J2AA 2B5JA 1RTDA 4HTLA 2OA8A 1TYQB 4B9VA 3BUZB 1GLJO 3ZT2A 4MO5A 3P5JA 2QXFA 1BISA 4DSLA 3AVBA 4QS8A 1WSHA 1N33K 3QMLA 3LANA 3ZT1A 2ZJPL 3C6UA 3O80A 3OS2A 4JS5A 1NJIO 2G8KA 3ENBA 1G15A 3L4QA 4CF2A 2E2QA 1T8EA 2NLXA 3CCVN 1S1VA 4FWSA 2YNFA 2AJQA 1HNWK 3QFPA 1X9MA 4EAHD 1HRHA 4DTSA 3MCPA 4JKEA 1EX4A 2HBJA 5M1QA 1NGIA 5JS2A 4JN4A 3TAMA 3QEXA 1NM1A 3QICA 3SJJA 1NNEA 5JS1A 3D7EO 1KVBA 3HO1A 4IJAA 3LL3A 4JV5K 1WUAA 2P9LB 3I8DA 2O8DB 3DAWA 2E6LA 4FJ7A 4DV7K 1WSIA 1FKOA 3KLIA 1Q7YO 3A0IX 3O9QA 3O8MA 4DFPA 4IWVA
chains in the Genus database with same CATH topology
4V19S 2UXCK 4NXNK 4X65K 1IBMK 1HNXK 1J5EK 4DV5K 4LF8K 2ZM6K 4LFBK 2HHHK 5IWAK 4JYAK 2VQFK 4B3SK 5BR8K 1N34K 4JI7K 3OTOK 4JI6K 2UUBK 4JI8K 4X62K 2VQEK 5LMUK 4JI0K 1I94K 4DV4K 4X66K 4DUYK 4LF6K 5LL6Z 3JAMO 4LFAK 1HNZK 1N32K 1FJGK 4LF4K 1XMOK 2UXBK 3J7YP 4JI5K 2UXDK 4JI3K 5AJ3K 4GKKK 2UU9K 4X64K 4DV6K 4YY3K 2F4VK 5FLXO 4LF5K 5A2QO 4JI1K 1XMQK 1N33K 4DR6K 4KHPK 4NXMK 4DR2K 3J7AP 4DV1K 4JI4K 4DR5K 4B3TK 4DR4K 4CW7B 4B3MK 1XNRK 4DR3K 1HR0K 1N36K 5IT9O 4DR1K 1HNWK 4CVNE 1XNQK 4LF7K 1IBLK 2E5LK 2UUAK 3J80O 4DV0K 4DV3K 4DV2K 3T1HK 2UUCK 4LF9K 4K0KK 4OX9K 1IBKK 3T1YK 4JV5K 5LMNK 4DR7K 4DV7K 4LFCK 4JI2K 4B3RK 4DUZK 4AQYK 4YHHK 3J81O 4GKJK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 S;  2UXC K;  4NXN K;  4X65 K;  1IBM K;  1HNX K;  1J5E K;  4DV5 K;  4LF8 K;  2ZM6 K;  4LFB K;  2HHH K;  5IWA K;  4JYA K;  2VQF K;  4B3S K;  5BR8 K;  1N34 K;  4JI7 K;  3OTO K;  4JI6 K;  2UUB K;  4JI8 K;  4X62 K;  2VQE K;  5LMU K;  4JI0 K;  1I94 K;  4DV4 K;  4X66 K;  4DUY K;  4LF6 K;  5LL6 Z;  3JAM O;  4LFA K;  1HNZ K;  1N32 K;  1FJG K;  4LF4 K;  1XMO K;  2UXB K;  3J7Y P;  4JI5 K;  2UXD K;  4JI3 K;  5AJ3 K;  4GKK K;  2UU9 K;  4X64 K;  4DV6 K;  4YY3 K;  2F4V K;  5FLX O;  4LF5 K;  5A2Q O;  4JI1 K;  1XMQ K;  1N33 K;  4DR6 K;  4KHP K;  4NXM K;  4DR2 K;  3J7A P;  4DV1 K;  4JI4 K;  4DR5 K;  4B3T K;  4DR4 K;  4CW7 B;  4B3M K;  1XNR K;  4DR3 K;  1HR0 K;  1N36 K;  5IT9 O;  4DR1 K;  1HNW K;  4CVN E;  1XNQ K;  4LF7 K;  1IBL K;  2E5L K;  2UUA K;  3J80 O;  4DV0 K;  4DV3 K;  4DV2 K;  3T1H K;  2UUC K;  4LF9 K;  4K0K K;  4OX9 K;  1IBK K;  3T1Y K;  4JV5 K;  5LMN K;  4DR7 K;  4DV7 K;  4LFC K;  4JI2 K;  4B3R K;  4DUZ K;  4AQY K;  4YHH K;  3J81 O;  4GKJ K; 
#chains in the Genus database with same CATH topology
 3NH2 A;  2R7Y A;  1HPZ A;  2O8C B;  3NGZ A;  3QLH A;  3T1A A;  3KVG A;  1OKJ A;  1XHZ A;  4Z4C A;  2Q36 A;  1BUP A;  1GLB G;  2Q1N A;  4JKG B;  3TTF A;  2F9W A;  4BAC A;  4IDK A;  5AQG A;  3M3Z A;  1VQN N;  3VER A;  1OVY A;  1UOC A;  1MU2 A;  5AQM A;  5GIO A;  4EHT A;  3U4L A;  4AHT A;  1OVQ A;  4KTW A;  3K59 A;  2YHA A;  1ZYQ A;  5DM7 L;  5E26 A;  4AM6 A;  2OPQ A;  3CI5 A;  1RGI A;  1NK8 A;  4ZTJ A;  4OPJ A;  4BQZ A;  3OYL A;  5HBM A;  1VQ6 N;  3VQD A;  1X3N A;  3P1G A;  3TAN A;  2QWL A;  2HHV A;  3CM6 A;  3CPE A;  1KAY A;  3QBX A;  1QE1 A;  3VQ9 A;  4DSJ A;  5KRS A;  4YDU A;  4OPA A;  1TKZ A;  3DRP A;  3GBT A;  3JAM O;  1F21 A;  3ZT4 A;  4FJH A;  3SAG A;  3VQC A;  2Q0U A;  1RT3 A;  4JD2 B;  3CQY A;  4CEA A;  3A5O C;  5TKW A;  3B8A X;  5CYQ A;  2HHS A;  4G1Q A;  4AHC A;  1DEJ A;  5KQ8 A;  4M3X A;  4JI1 K;  3OJU A;  4DQR A;  3O9R A;  3DLB A;  2O8B B;  1ASW A;  3RMA A;  2KFN A;  3C7N A;  4FWK A;  4BRI A;  3O6W A;  4Z4G A;  3THY A;  1RTJ A;  1BQM A;  1T6C A;  1BG3 A;  4WFA L;  3KLH A;  2GTD A;  2VYP A;  2WUS A;  2HMI A;  3TPQ A;  4C8N A;  3CF5 L;  4DTJ A;  5GIN A;  3HVT A;  1C1A A;  2HHW A;  3IUC A;  3U3Y A;  4ELU A;  1VK0 A;  3EZW A;  4DV2 K;  2HVH A;  4B1W B;  1Y97 A;  3GG4 A;  3ZSZ A;  2QKK A;  4BRG A;  4JI2 K;  1O13 A;  4OKK A;  1KFD A;  2E2O A;  2FBY A;  3VF2 A;  1NJZ A;  4E7J A;  3NCI A;  3OS1 A;  4DS4 A;  4X65 K;  4IFY A;  1A5V A;  3LAK A;  2OTL N;  4CK1 A;  1TGO A;  2ATQ A;  1J5E K;  1J54 A;  4U67 L;  2DY4 A;  4KPY A;  2ASM A;  4CEZ A;  1EQY A;  2HHQ A;  3HM9 A;  3SAF A;  2I7N A;  1SKS A;  2VQF K;  4A5B A;  2X74 A;  4OPH A;  1ZBF A;  2OPS A;  5FPN A;  1GOC A;  4FLY A;  3RMC A;  1GLA G;  1Z6R A;  5AQJ A;  1QHT A;  4JI6 K;  5I42 A;  4DQP A;  4M41 A;  2XO7 A;  3BF1 A;  3DLG A;  2KQ2 A;  4IBN A;  1TK0 A;  4AH9 A;  3IDH A;  4X66 K;  4W5O A;  4DUY K;  1HKC A;  1EWQ A;  4CJ4 A;  3L2V A;  2P9P B;  5ADX H;  1NOY A;  1HJO A;  3VEX A;  5BRE A;  4BRC A;  5B8H A;  3O1B A;  4CZF A;  1K8A O;  3TSP A;  4JI5 K;  3MWP A;  3CFP A;  3NGI A;  3AVK A;  1KAX A;  3SPZ A;  3P4I A;  4FJ9 A;  3SLC A;  3IKM A;  3D0P A;  2QTD A;  4CF0 A;  2W6K A;  4WF9 L;  3RTV A;  1IKW A;  3NF7 A;  3AVN A;  3VES A;  5JIC A;  4CJL A;  1S6P A;  3M8R A;  2ASO A;  5HP1 A;  5C2F A;  4I2P A;  1JCE A;  4CJK A;  1U47 A;  2QXL A;  1Q81 O;  3UIQ A;  1RNH A;  2W41 A;  4CHN A;  1VSI A;  2HNY A;  2JGU A;  3LP1 A;  3OYH A;  4FLT A;  1QVF M;  3PIP L;  3ZSQ A;  3HPH A;  1IV0 A;  2QM1 A;  5BN8 A;  1NJX A;  4I2Q A;  2OTJ N;  1LW2 A;  4FOI A;  3VQA A;  4H5R A;  2UUC K;  2PYL A;  4C8O A;  3C95 A;  4RG8 A;  3TTD A;  3PUF A;  2A1R A;  4FJN A;  2P5O A;  3UKR B;  1CLQ A;  3VTH A;  1JCF A;  2P1J A;  1S72 N;  3I56 N;  1FXX A;  3ITH A;  3GL1 A;  2E1Y A;  1G99 A;  1TYQ A;  1U49 A;  3CXC M;  1QVG M;  4H0X B;  2D5R A;  2HB5 A;  3SCX A;  3CET A;  5HRN A;  2KHO A;  1I39 A;  1L3V A;  5F1X A;  3KKS A;  2ITM A;  4CER A;  4O5B A;  1FW6 A;  4BC5 A;  1JL1 A;  1VSD A;  3TAP A;  4TSX A;  4JI7 K;  1T3V A;  1KC8 O;  2G8H A;  3ZX0 A;  3VF4 A;  2HBM A;  4DQS A;  5M1N A;  1WSJ A;  3CQ8 A;  3ID8 A;  3F73 A;  2G8U A;  4F2S A;  4CGI A;  1JLC A;  1I94 K;  2HNZ A;  1WSF A;  3ZSY A;  5MLC Q;  3HBT A;  5CZ2 A;  1NGH A;  2QWM A;  1QZ5 A;  4FJM A;  3C6T A;  1XI1 A;  3V9W A;  4O0I A;  4BRD A;  3M8S A;  4KRE A;  2O4G A;  3WXL A;  5JMV A;  1K8K A;  4EP4 A;  3WEE A;  2PY5 A;  4OGC A;  5AJ3 K;  1BWF O;  1P8Z A;  4CCH A;  2O8C A;  1H1V A;  4FJG A;  4DU3 A;  1RDD A;  4JKG A;  2VWK A;  1P90 A;  3WQU A;  3HK2 A;  3VTI A;  3EL2 A;  1YIJ N;  3FFK B;  2Z1H A;  4FZX C;  4DR6 K;  1NK9 A;  3HOS A;  1TV6 A;  1CZA N;  1NMD A;  3B6O A;  1YTU A;  1BIZ A;  2YKN A;  5CR4 A;  2CGJ A;  4A2A A;  3PLA A;  3HZ6 A;  1Q8I A;  4KFB A;  2PZS A;  1HQU A;  1TKX A;  1GLD G;  4WQ4 A;  3ENH A;  1EXQ A;  2A42 A;  3OYK A;  2GX9 A;  1IH7 A;  1IBL K;  1SL2 A;  1TL1 A;  4KH6 A;  2IS3 A;  4FVM A;  4J2D A;  4F3T A;  1W2B M;  4Y0W A;  4GY2 B;  4AHS A;  4AHR A;  4H0T B;  2P9S B;  1MDU B;  4KTZ A;  4MLE A;  5J2N A;  3K5N A;  3EE8 A;  3LP0 A;  3VQQ A;  4H03 B;  4B9T A;  1VQ7 N;  1RT4 A;  4AQY K;  1ATS A;  5HRP A;  5K14 A;  4E7K A;  2IAJ A;  5F2R A;  2UXC K;  2O8F A;  3MAQ A;  4CBW A;  3VEY A;  3SMP A;  2F7T A;  1QQM A;  2B4J A;  4BQL A;  3OYD A;  2P51 A;  5HL7 L;  3D2E A;  4AIL C;  5IWA K;  2OPR A;  3KD1 E;  2AA4 A;  3AVL A;  3D45 A;  3QIP A;  3FE1 A;  3DWL A;  3H3N O;  1XQS C;  3L3V A;  2V52 B;  5AQV A;  3NHG A;  3ZSW A;  2KZZ A;  2IGI A;  3CCU N;  4FM2 A;  4M3U A;  4N41 A;  4YDU C;  3G10 A;  4B1U B;  2WFB A;  4ILG B;  5DM6 L;  2Y1I A;  1L3S A;  1CXU A;  4M3W A;  4CF8 A;  4K43 A;  1Q82 O;  2V7Y A;  2RN2 A;  3FZH A;  5AQS A;  1K6Y A;  3OYB A;  1C1C A;  3SUN A;  1HYV A;  5DK5 A;  2YI1 A;  5BR9 A;  3MX2 A;  1RT5 A;  3KKR A;  1WN7 A;  5LY3 A;  4N56 A;  3HXM A;  4JRP A;  3VQ6 A;  2WOM A;  5M1O A;  3WNE A;  4O0J A;  5BN9 A;  4CZL A;  5FPM A;  4PL8 A;  3LM2 A;  3HRG A;  1M90 O;  4BRE A;  4CD3 A;  5HRS A;  3MEC A;  3SYZ A;  3QEI A;  3VGL A;  1RDC A;  3EN9 A;  3MCA B;  3S3M A;  2KTQ A;  4JAX A;  5AQR A;  1RBV A;  3AO2 A;  4B3O A;  2VCP A;  4DR4 K;  4BDY A;  3W0L A;  3FGU A;  4CJ3 A;  1OH7 A;  4FJ8 A;  3ZSO A;  4FWR A;  3TAG A;  4J2B A;  3PV8 A;  3G0Z A;  5KPR A;  4GV3 A;  3HI0 A;  2P9P A;  1NGG A;  3ZEU B;  3CC4 N;  3CPW M;  2ZWH A;  3ZT3 A;  3C94 A;  3C6A A;  2FSK A;  3T7Z A;  3QER A;  3P31 A;  4KHN A;  3BGR A;  3UE5 A;  4BG9 A;  1FKP A;  4PY5 A;  1JLE A;  3MXJ A;  3MWT A;  3D2F B;  2DTU A;  3A5M C;  1WBD A;  5E41 A;  1VQO N;  1D9D A;  2Q0R A;  4DWI A;  2E20 A;  2D0P A;  3V81 A;  2E2P A;  4CIF A;  3AAR A;  4GVE A;  4H5V A;  1TAU A;  4LFB K;  4Q0B A;  4FPA A;  3HOT A;  2X6N A;  3THW A;  1ASU A;  3LZJ A;  3EKS A;  4GNI A;  3EY1 A;  1SL1 A;  3DXK B;  1RBR A;  5J2Q A;  5TKY A;  2QWO A;  3NMU A;  4CE9 A;  5FPE A;  3V9X A;  2NUB A;  1U48 A;  3U8X A;  4CZE A;  4RWT A;  2VQE K;  5AZI B;  1U4B A;  5J2P A;  4HCB A;  1IJJ A;  4DV4 K;  4O5F A;  3JXU A;  3CJ9 A;  2CH6 A;  1S1T A;  3LDN A;  1L5U A;  4YOT A;  2HND A;  3QBW A;  3DXM B;  1N8R O;  4NO7 A;  3ZCM A;  4LF4 K;  1OH5 A;  3OYN A;  3K0S A;  3VEO A;  2IC3 A;  2CGL A;  1UA1 A;  2XY7 A;  1XC3 A;  3E1Y A;  4BRL A;  4DTU A;  3THV A;  2E2N A;  3HVR A;  3MK6 A;  2E4L A;  4LF5 K;  1JCG A;  3LAL A;  5A2Q O;  1WOQ A;  4N76 A;  3KJV A;  4CJV A;  3MEG A;  5H1S Q;  2P9I A;  4DLG A;  1WAF A;  4M7Y A;  4Z0U A;  1NK7 A;  4WCE L;  3OY9 A;  4FW2 A;  4XIU A;  1DT9 A;  3V4I A;  4DG1 A;  1GLF O;  5C12 A;  1DGK N;  4JKF A;  1D8Y A;  2IIR A;  1QZ6 A;  1VQ5 N;  4CJS A;  4HTU A;  3SQ4 A;  5LJW A;  3CG7 A;  2QA4 N;  4HWI A;  2NRZ A;  3FZF A;  3VQ5 A;  2FXU A;  4EZ9 A;  1JL2 A;  4E1N A;  3VA3 A;  1W9H A;  2YNG A;  3VQ7 A;  4B9M A;  1EO1 A;  4DQI A;  3AVA A;  4CIE A;  4A59 A;  3VEZ A;  5BPM A;  4FM0 A;  3CJB A;  4NXN K;  4PL7 A;  4E7I A;  4DSF A;  1IBM K;  1BGX T;  1C6V A;  4OLB A;  4O55 A;  3DLH A;  3HL8 A;  2G8F A;  4IXC A;  1VQ4 N;  4LF8 K;  4OKJ A;  3JSM A;  1HNV A;  3F5T A;  3NBP A;  5C42 A;  3CCL N;  4DU4 A;  3L6Q A;  3T3F A;  3CC7 N;  2YX6 A;  1TL3 A;  2GEL A;  4JK7 A;  2GWK A;  4LC9 B;  1BCM A;  5KQD A;  4KHY A;  5LMU K;  4L8R B;  3A2F A;  1NWK A;  4CEF A;  3MMV A;  4E3S A;  1UWB A;  1YJW N;  4M7X A;  1OH6 A;  4FK2 A;  5E84 A;  4LFA K;  3H46 O;  1R59 O;  4XH4 A;  4E89 A;  3ID6 A;  1GLL O;  1QSS A;  4BRM A;  1L3T A;  4DF8 A;  3NE6 A;  4OLA A;  4JEP A;  3OS0 A;  3HPG A;  4CZK A;  2VG7 A;  3HPO A;  3O4W A;  1ATR A;  5HRO A;  1IG9 A;  3SQ0 A;  3O1W A;  3LDQ A;  1JLQ A;  4YY3 K;  5AQF A;  1GOA A;  1JLA A;  1RT7 A;  1B92 A;  2NRX A;  1C1B A;  4JNE A;  4NXM K;  3SJH A;  4FWO A;  3EKU A;  4B9L A;  3AV9 A;  1VSJ A;  3EEQ A;  1LW0 A;  2ZJQ L;  4CEQ A;  5CY4 A;  4B3T K;  3CFO A;  3CCR N;  4IFE A;  4WQ4 C;  4PHT X;  3L4I A;  3C6H A;  1WNS A;  2A6A A;  5BPN A;  5GIP A;  3TSQ A;  1HJR A;  1YXQ A;  3AAQ A;  3OBY A;  4K42 A;  5JVG L;  4BGA A;  4BVO A;  4MDB A;  3JS6 A;  3T1H K;  2O4I A;  3K9K A;  4NB4 A;  2EWS A;  3PSF A;  3I55 N;  3T1Y K;  3UB5 A;  3AA4 A;  4FL9 A;  3DRR A;  1VSE A;  3ATU A;  4M3R A;  1TAQ A;  2JWK A;  4EP5 A;  3L0Q A;  3RMD A;  3SMS A;  4Z4I A;  3N4Q A;  1GLE G;  3O3F A;  1Z25 A;  2XRI A;  1QS4 A;  4Y1D A;  4FM1 A;  4W5T A;  1ITG A;  1JLB A;  3ZSR A;  5LJV A;  3I0S A;  4BR5 A;  4ZTF A;  4IOX A;  1RCH A;  4PWD A;  3OYM A;  4BVP A;  3IMX A;  4JKD A;  3R8E A;  4BWM A;  3TAB A;  4YOW A;  4QS9 A;  1VQM N;  2KKZ A;  3MEE A;  3EYZ A;  2QWQ A;  2P9K A;  3HSC A;  4KHS A;  1RDU A;  1A5W A;  2E8A A;  4KH4 A;  2A40 A;  3V6D A;  5C24 A;  3LZI A;  3QO9 A;  3G71 N;  4ISE A;  4H5W A;  4KB0 A;  4I6M B;  2O8E B;  3OYI A;  4JI3 K;  3K5M A;  3K58 A;  1C0F A;  3FZK A;  3D2F A;  3VPZ A;  4X64 K;  2KW4 A;  3NVK A;  4CJW A;  3OYE A;  1BQN A;  1SV5 A;  4PKG A;  2E88 A;  4DR2 K;  3V9Z A;  4B8A B;  1MWK A;  3OYJ A;  4C8K A;  3S9H A;  2KLA A;  1TK5 A;  4K8Z A;  3O9T A;  3AA2 A;  2JWL A;  3DXK A;  1W7A A;  4YNQ A;  4BC2 A;  1U04 A;  5FDL A;  1L3U A;  1NGA A;  3HP6 A;  2OZM A;  1RIL A;  4LF7 K;  1RBU A;  2E5L K;  1K73 O;  2F8T A;  1S1X A;  3J80 O;  1V4T A;  1VSM A;  2IVN A;  4HUE A;  3AO5 A;  4QCL A;  2QEX N;  1S1W A;  3DLK A;  4B9Q A;  4WYB A;  1JJ2 M;  2QI2 A;  4E7H A;  4DSI A;  3OHR A;  4B9N A;  5F0X A;  2ZGY A;  4FWN A;  5AZJ B;  3OA9 A;  1ATN A;  2HBL A;  4Z94 A;  3P39 A;  3I33 A;  4B1V A;  4KTQ A;  3K57 A;  3LWL A;  4IJN A;  2D1K A;  3SV3 A;  1NK0 A;  3WT0 A;  4CGD A;  3VEN A;  3PX4 A;  3HM8 A;  4CJR A;  4CEB A;  4EIA A;  1NLV A;  2QWR A;  1QQC A;  4CFB A;  4CFC A;  1HYS A;  3MX5 A;  2OZS A;  4KBO A;  4X62 K;  3LDL A;  1IKV A;  3AO1 A;  3AVH A;  2HW3 A;  2P9N B;  1EKE A;  2DFH A;  2ZQB A;  1NJY A;  1HKB A;  4CJF A;  3RWU A;  4C1N I;  1E4G T;  3IFR A;  1ZBL A;  4YFU A;  4DKW A;  4FJI A;  2Q97 A;  1BHL A;  1ZC6 A;  1QHA A;  1KD1 O;  3SK3 A;  1ZBS A;  4OGE A;  2V51 B;  4DHY A;  4DV6 K;  1S9G A;  2F4V K;  4H5T A;  5JVH L;  4WFN L;  4H0P A;  3DRS A;  4OO1 J;  2FBT A;  2G8W A;  1XMQ K;  2QKB A;  3CFR A;  3CIP A;  3O08 A;  1NKE A;  2YNI A;  3ZX3 A;  2P9L A;  1CXQ A;  2O8D A;  3THX B;  1J6Z A;  4BRK A;  4E7L A;  2FLO A;  5M1K A;  5J2M A;  1NGD A;  1RBS A;  4F9O A;  3AO4 A;  1TK8 A;  1LAV A;  2IDO A;  1XNQ K;  2VG5 A;  3BP8 A;  4NLB A;  1WSG A;  4KI6 A;  3DM2 A;  1VRU A;  4ID5 A;  3NFA A;  4JKB A;  5CZ1 A;  2LSN A;  2GEM A;  3TR8 A;  2Z1J A;  3MXI A;  3SV4 A;  4LF9 K;  4JS4 A;  4DTN A;  5T7B A;  3ZET B;  3SBT A;  4YOU A;  5LMN K;  2VGN A;  1VHX A;  4KKO A;  3LDP A;  4DU1 A;  1YIT N;  3M1F A;  2ZJR L;  3SI6 A;  5GAG P;  5JLF A;  4DV5 K;  3QNN A;  1BA1 A;  3PO5 A;  3BZC A;  3PSI A;  3LPU A;  1VQP N;  3KLF A;  4UY8 O;  3RR7 A;  3CJ7 A;  5BR8 K;  1EET A;  5AFU A;  3MN7 A;  4YOY A;  4JD2 A;  4GMJ B;  2YV0 X;  1XWL A;  4CED A;  5I3U A;  1NG9 A;  1YAG A;  5AQN A;  4JI0 K;  3NH0 A;  1M1K O;  3TAE A;  1Y64 A;  5CHI A;  4RTF D;  3AVJ A;  3OW2 M;  3V9S A;  4NLC A;  4BDZ A;  1NGC A;  4Q5V A;  2O8B A;  5HOO A;  4CD1 A;  4M45 A;  1LWE A;  2YJF A;  2FBV A;  3D6R A;  3BEX A;  1VRT A;  2D0B A;  2HHU A;  5FRO A;  3TAR A;  1KTQ A;  4CFD A;  2KZM A;  4QOZ B;  1JLG A;  1KVA A;  3R9P A;  4O4G A;  4O8U A;  5FLX O;  1NOZ A;  5GAD P;  1X3M A;  2PAV A;  1VQ9 N;  4FPB A;  3L8B A;  3VOV A;  4PQU A;  1Q86 O;  3AVI A;  1E4F T;  4FJX A;  3ULE B;  4DV1 K;  2VGM A;  2OPP A;  3MN9 A;  2YHB A;  3CME N;  3L2W A;  3C65 A;  1SUQ A;  2GUI A;  2ZF5 O;  3KK3 A;  4G9Z A;  4XEI A;  3PX0 A;  4CGG A;  1E3M A;  3TAQ A;  4CEE A;  4DV0 K;  1HNI A;  4E1M A;  1YT3 A;  3C7N B;  3VF6 A;  1XUP O;  4GV9 A;  4OX9 K;  1XC9 A;  3RMB A;  3L2R A;  4DR7 K;  4CI6 A;  2VG6 A;  4W5N A;  3H45 C;  4DUZ K;  2BDP A;  4I6M A;  2O8E A;  3J81 O;  4I9Q A;  3OYA A;  1SS6 A;  4CEO A;  4FLX A;  4DFJ A;  4JHD B;  1C0T A;  5CE3 A;  4BC3 A;  2RF2 A;  3NF9 A;  2ZGZ A;  4ELT A;  4BRQ A;  5EVZ A;  4CHY A;  4CF9 A;  3IRX A;  3VQ4 A;  1MA9 B;  3TU5 A;  5SWM A;  5EOY A;  4KAZ A;  3O3G A;  2ITG A;  1JXE A;  1W97 L;  4H0O A;  4BR4 A;  3JYT A;  2HMP A;  5CYM A;  1V4S A;  4DTX A;  2QWP A;  3OBW A;  4NCG A;  1S5J A;  1N32 K;  1HNZ K;  5AQY A;  4PKH A;  2F9T A;  3LAM A;  5AQP A;  3A8Y A;  1T7P A;  4CZH A;  5KI6 A;  3CCQ N;  3SNN A;  4CGF A;  2WBN A;  1DTQ A;  3MN5 A;  1VQK N;  4CEC A;  3MXM A;  1B9D A;  1RT1 A;  1S9E A;  5HLF A;  4CHQ A;  3VQP A;  1BA0 A;  4H4M A;  2D0C A;  1TUU A;  4BG8 A;  3I8B A;  4DFM A;  4PUO A;  4L3Q A;  3OVN A;  4BRF A;  1NBW A;  2A3Z A;  2W6L A;  1GLC G;  4FJ5 A;  3UKR A;  4JLH A;  3ZX2 A;  2Q31 A;  1Z05 A;  2NRH A;  1XNR K;  4LH5 A;  3K2P A;  4LD0 A;  3HST B;  3HT3 A;  2GUP A;  4F4K A;  2P9N A;  3PX6 A;  2FF6 A;  1NK5 A;  2PFU A;  4IEE A;  2HF4 A;  4B1Z A;  3SUP A;  4R5P A;  4BRP A;  3R6M A;  4CES A;  4FJL A;  4KHQ A;  3LDO A;  4HUG A;  1NK6 A;  4K0K K;  3IAY A;  3DOK A;  2F96 A;  2DFE A;  4GV6 A;  4DLE A;  4DF4 A;  1D5A A;  5AQT A;  4AHU A;  1VSK A;  3NGY A;  3AA5 X;  4YHH K;  1QTM A;  3M6G A;  3O4Q A;  1YJN N;  3ASM A;  1REV A;  4H0Y B;  5KPT A;  4BGB A;  4H8K A;  5ELZ A;  2BGG A;  2GWJ A;  3WXJ A;  1BIU A;  4JKA A;  2YHX A;  2YNH A;  1BU6 O;  5EU7 A;  4DS5 A;  4CJP A;  4FWP A;  3A5N C;  2OAN A;  3K5O A;  3SUO A;  4JKC A;  3U9D A;  2V7Z A;  4CGJ A;  3KWG A;  1KFS A;  1HLU A;  1N34 K;  1VAZ A;  4LY7 A;  2UUB K;  3LDS A;  3ZSV A;  3S3O A;  4XH5 A;  5C0Y A;  4U7B A;  3CM5 A;  3G25 A;  3R1X A;  1UAX A;  4BRA A;  4FLW A;  5BPL A;  3NH1 A;  2P9U B;  2E1Z A;  5AQO A;  3ZET A;  1KVC A;  4FJJ A;  3AVF A;  4BR2 A;  4JK9 A;  2I7P A;  5BRF A;  3H3O B;  4BRN A;  2I5J A;  3S41 A;  2D4W A;  5KRT A;  1KSP A;  3LM9 A;  3PIO L;  4QS7 A;  4DB3 A;  2NRV A;  1X1P A;  1NK4 A;  1XHX A;  4CZJ A;  3MED A;  3RVC A;  1YF5 L;  4ZHR A;  2WTU A;  3Q7C A;  3AY9 A;  2XY6 A;  3KLG A;  1X9S A;  4QAG A;  4B9U A;  4K41 A;  4OKE A;  2P9S A;  3FZL A;  1HMV A;  1ILY A;  3AA3 A;  3VEV A;  4J2E A;  1K8K B;  4DR5 K;  3WEE B;  4CW7 B;  3CQX A;  1ZXO A;  3CMA N;  1HR0 K;  1X9J A;  4FK4 A;  3AVG A;  2ZD1 A;  3PO4 A;  1SKW A;  1ASV A;  5AQW A;  3LPT A;  2GV9 A;  5AR0 A;  4FSV A;  3TAF A;  3SPY A;  4KB1 A;  4BE1 A;  4IG0 A;  3C0B A;  1VSF A;  3P83 D;  4BE2 A;  3WNG A;  4LSL A;  4F2R A;  4M3Y A;  1BOT O;  1Z26 A;  3HP9 A;  4GW6 A;  1QSL A;  4NYF A;  4E19 A;  4FK0 A;  3DLE A;  1LWC A;  4WFB L;  1C0M A;  1YTA A;  2D0A A;  4H4O A;  4A5A A;  2IOC A;  3KTQ A;  4UQG A;  3LWM A;  4JKH A;  3CHW A;  5C25 A;  1KRP A;  4IKF A;  3RSE B;  1HUX A;  1MWM A;  3VET A;  4FZY A;  4MFB A;  1ZBI A;  4WQ5 A;  5AFU H;  5M1P A;  1YUW A;  4FYD A;  3CCS N;  5I9E B;  1RDB A;  4FLZ A;  3ULE A;  2BAN A;  3SQ2 A;  1HYZ A;  3IS9 A;  3ZSX A;  2QWN A;  4JK8 A;  3KK1 A;  2W40 A;  4KHW A;  3O9S A;  2O8F B;  4JI8 K;  2G8I A;  1WAJ A;  3TWH A;  3O4N A;  3MN6 A;  2BTF A;  4I7F A;  1TVR A;  1NGB A;  4DQQ A;  2HHX A;  4FOE A;  3CJA A;  3V1Q A;  5HRR A;  3NF8 A;  3QEV A;  1X9W A;  1NKB A;  3D2E B;  5LL6 Z;  2IVP A;  3CCM N;  4FXD A;  2Y1J A;  1NU0 A;  4C8L A;  3LP3 A;  4ILH A;  4BE0 A;  2UXB K;  2VWB A;  2F8S A;  1RTI A;  2NRW A;  1RDA A;  2A5X A;  2UU9 K;  1RT6 A;  3N4P A;  1CZB A;  1QQN A;  3RRG A;  3GOI A;  5KGX A;  1T05 A;  4JHD A;  4AM7 A;  4Y1C A;  3U3G A;  3E01 A;  3O5B A;  4DCH A;  3V1R A;  3J7A P;  3QIO A;  3ZEU A;  4FWM A;  4DTR A;  3QNO A;  3FR0 A;  1NKC A;  4H0V B;  2E6M A;  4FCY A;  3J7Z O;  4DR3 K;  4CJU A;  2OCE A;  1BI4 B;  1YVN A;  3E66 A;  5IT9 O;  1JKH A;  3DI6 A;  3L2U A;  2YJE A;  4C8M A;  5GAH P;  1N6Q A;  1FK9 A;  4RW7 A;  3G4S N;  2EHG A;  3J8A A;  5AQI A;  1R0A A;  3ZYY X;  4ILJ A;  1UA0 A;  1IBK K;  3H1Q A;  2RE2 A;  3UKU B;  4BRH A;  1TKD A;  2HOE A;  3WXM B;  1YHQ N;  3ULD A;  2X6S A;  3O9U A;  4E1J A;  4W5Q A;  1VSH A;  1LWF A;  3IG1 A;  5KTQ A;  4DMN A;  3H1V X;  4M63 C;  4EHU A;  3L2Q A;  3BF3 A;  1W0H A;  5AZI A;  3KD5 E;  1WSE A;  4DTP A;  3F9K A;  3KZB A;  5DMR A;  2FF3 B;  3BY5 A;  4KV8 A;  4CIG A;  2PYJ A;  5M1F A;  3QDK A;  2JLE A;  1U2V B;  3V1O A;  3DXM A;  2VWJ A;  4BC4 A;  3CYM A;  4BY9 C;  3CD6 N;  3S3N A;  4EZ6 A;  4RCH A;  5AQH A;  2PBD A;  1NGF A;  5D3G A;  1WB9 A;  3OYF A;  3QB0 A;  2ETJ A;  4NYN A;  3I0R A;  4F3O A;  4HCC A;  1NGJ A;  2HST A;  4B1X B;  3U9Z A;  3L3U A;  3M8Q A;  3NF6 A;  3ZT0 A;  5KGW A;  3K5L A;  4GVM A;  3ATV A;  4LF6 K;  3AGR A;  5KPZ A;  4BWJ A;  4FWQ A;  2CGK A;  3E9L A;  3THW B;  4Z4H A;  3HYF A;  3VQB A;  2RPI A;  4BRO A;  5EY4 A;  4CZI A;  4KHU A;  3RR8 A;  5JLH A;  1I3A A;  4KO0 A;  1SQK A;  3AO3 A;  4O44 A;  1NMN A;  4MLH A;  4IOA L;  4J8F A;  4W5R A;  2H3G X;  1JLF A;  4CJQ A;  1S6Q A;  4FJK A;  2Q3S A;  1IG8 A;  1J53 A;  5GAE P;  4CJE A;  3DJC A;  4NCB A;  3VEW A;  3CJ1 A;  1VSL A;  4ELV A;  1KXP A;  1WLJ A;  4CFA A;  4B3M K;  4H5N A;  1VQ8 N;  4M3Z A;  1JXB A;  3H08 A;  4A61 A;  4CHO A;  4CVN E;  3DYA A;  3DLL L;  4NCA A;  1WBB A;  2UUA K;  2A41 A;  3A5L C;  4ID1 A;  3GE1 A;  2P9I B;  2P9U A;  3DLR A;  4Z4F A;  4A2B A;  3ZLJ A;  1D4X A;  1LAW A;  4B3R K;  1LOT B;  1ZBH A;  1BL3 A;  4GKJ K;  3Q7B A;  4BR9 A;  3OYC A;  3G6E N;  4RW8 A;  3U6F A;  4MDA A;  3VQE A;  1ESV A;  3QEP A;  4YOX A;  3SQ1 A;  2Z1I A;  2ZM6 K;  4PKI A;  3KLE A;  4CJT A;  4XH1 A;  5C10 A;  2NZT A;  2YHW A;  3OYG A;  2QK9 A;  2NNW A;  3CJC A;  3VMF B;  4IOC L;  4CJ7 A;  4RW9 A;  1LCU A;  3VA0 A;  2XY8 A;  3O3H A;  4E0D A;  3FLC O;  4N5S A;  1NGE A;  1NJW A;  1D9F A;  3QES A;  4CF1 A;  3F2K A;  4JRQ A;  4FO0 A;  2X78 A;  3TTC A;  5BRH A;  3V9U A;  2RKI A;  2P5G A;  3WUH A;  2UXD K;  1VQL N;  3SAH A;  3KK2 A;  4AHV A;  4O8K A;  3RSE A;  3LP2 A;  4IEI A;  4IO9 L;  3QET A;  4DTM A;  2WC9 A;  4KHP K;  4CK3 A;  2EX3 A;  1C0G A;  4K8X A;  4CBX A;  3OJS A;  4DTO A;  4IZ9 A;  3P38 A;  1U6Z A;  4KI4 A;  2BUP A;  4CHP A;  1RFQ A;  4N47 A;  5AQL A;  4JI4 K;  3ALY A;  1BDG A;  4B08 A;  4IO8 A;  4ISF A;  4FLU A;  4R79 A;  1N36 K;  1DKG D;  2IVO A;  1CZ9 A;  3M8P A;  3WNH A;  1OH8 A;  3HJF A;  4AF1 A;  1TUY A;  4DV3 K;  4ICL A;  4FVU A;  3GDQ A;  2UYT A;  3QEW A;  1IKY A;  4BDP A;  1EP4 A;  1U45 A;  5AQZ A;  2W42 A;  2XY5 A;  3FFI A;  4LFC K;  3CER A;  3ENO A;  3CCE N;  4WE1 A;  3SZ2 A;  3KK7 A;  2HBK A;  3HTV A;  2YCH A;  2HF3 A;  2OYQ A;  1K9M O;  3WXK A;  5FRN A;  1HNX K;  1SAZ A;  1N5Y A;  3B6P A;  2AP1 A;  4F8R A;  4WQ5 C;  3KHY A;  3PY8 A;  3AVM A;  1BCO A;  3KIO A;  3EZ5 A;  2FBX A;  1KLN A;  4B3S K;  1YJ9 N;  3THY B;  1KLM A;  4M42 A;  2QW9 A;  3NDK A;  4HUF A;  1HPM A;  4OPK A;  4FLV A;  5C2D A;  1TKT A;  5AQQ A;  1DLO A;  4FW1 A;  1BI4 A;  4B8C A;  2WON A;  1RT2 A;  3FZM A;  1T44 A;  5EX5 A;  2NRR A;  1S3X A;  3EE9 A;  4MO4 A;  4FWL A;  3AGK A;  3MDQ A;  5AQX A;  3ISN C;  4CHZ A;  2YKM A;  3VQ8 A;  4MQ3 A;  4CJ5 A;  4B9S A;  2DFF A;  1O1W A;  2CH5 A;  3WXI A;  4PA1 A;  1HQE A;  1SL0 A;  1KCF A;  2G8V A;  5FRM A;  3K9J A;  3F9M A;  3UKU A;  4B1Y B;  1QQO A;  5ADX A;  2ZE2 A;  4HHT A;  1YI2 N;  1B9F A;  1IO2 A;  1Q9X A;  5FPD A;  4GKK K;  2BE2 A;  2XHB A;  3VGM A;  4I9L A;  3TSU A;  3T69 A;  2B6A A;  3QFU A;  4ISG A;  4HVJ A;  4CZG A;  4CZM A;  4YOV A;  1KQS M;  3NVM A;  3NAE A;  1ZBU A;  3E9O A;  2P9K B;  4A62 A;  4KH5 A;  4RW6 A;  3WQT A;  1U2V A;  4YOR A;  4FZZ A;  1HX1 A;  5AZJ A;  1QSY A;  3M5R A;  4DQ8 A;  5BRD A;  2J4R A;  1Q18 A;  4DR1 K;  2ASP A;  3W3D A;  4CK2 A;  4EFH A;  4BR7 A;  1HKG A;  5EXW A;  1EWR A;  3DMJ A;  4IG3 A;  1SZ2 A;  2DPN A;  1J9A A;  2YHY A;  1IKX A;  2FSJ A;  2Q2R A;  1SKR A;  3AVC A;  2RHK A;  1LV5 A;  2FSN A;  4CBU A;  1A5X A;  4V19 S;  1C0U A;  4K25 A;  3EO3 A;  3SUQ A;  4IDH A;  2NRT A;  1Q9Y A;  4BR0 A;  3CC2 N;  1RTH A;  1KAZ A;  1S22 A;  2A1S A;  4A57 A;  5SZT A;  3DOL A;  4RW4 A;  3TI0 A;  5AQU A;  1RBT A;  4M3T A;  3VGK A;  2HHH K;  3AAP A;  3VN5 A;  4JYA K;  3KWI A;  4OVL A;  4DFK A;  4LSN A;  1DTT A;  1YVU A;  5AQK A;  2HVI A;  3OTO K;  1T03 A;  3CCJ N;  4Z4E A;  4DSK A;  3E9P A;  3H6E A;  2Z1G A;  1BO5 O;  4CGH A;  4OJR A;  4IFV A;  1GOB A;  3SBG A;  2GBZ A;  2FC0 A;  4C23 A;  3BDP A;  4DSE A;  2KFZ A;  3QIN A;  4C1N K;  4KRF A;  3R3L A;  1T6D A;  3T19 A;  5J1E A;  1RDW X;  2HHT A;  5C15 A;  3WNF A;  2BH1 A;  1FJG K;  1XMO K;  1S1U A;  3RRH A;  3J7Y P;  3THX A;  4LH4 A;  2D0O A;  3BZK A;  1J5O A;  4J2A A;  2B5J A;  1RTD A;  4HTL A;  2OA8 A;  1TYQ B;  4B9V A;  3BUZ B;  1GLJ O;  3ZT2 A;  4MO5 A;  3P5J A;  2QXF A;  1BIS A;  4DSL A;  3AVB A;  4QS8 A;  1WSH A;  1N33 K;  3QML A;  3LAN A;  3ZT1 A;  2ZJP L;  3C6U A;  3O80 A;  3OS2 A;  4JS5 A;  1NJI O;  2G8K A;  3ENB A;  1G15 A;  3L4Q A;  4CF2 A;  2E2Q A;  1T8E A;  2NLX A;  3CCV N;  1S1V A;  4FWS A;  2YNF A;  2AJQ A;  1HNW K;  3QFP A;  1X9M A;  4EAH D;  1HRH A;  4DTS A;  3MCP A;  4JKE A;  1EX4 A;  2HBJ A;  5M1Q A;  1NGI A;  5JS2 A;  4JN4 A;  3TAM A;  3QEX A;  1NM1 A;  3QIC A;  3SJJ A;  1NNE A;  5JS1 A;  3D7E O;  1KVB A;  3HO1 A;  4IJA A;  3LL3 A;  4JV5 K;  1WUA A;  2P9L B;  3I8D A;  2O8D B;  3DAW A;  2E6L A;  4FJ7 A;  4DV7 K;  1WSI A;  1FKO A;  3KLI A;  1Q7Y O;  3A0I X;  3O9Q A;  3O8M A;  4DFP A;  4IWV A; 
#chains in the Genus database with same CATH homology
 4V19 S;  2UXC K;  4NXN K;  4X65 K;  1IBM K;  1HNX K;  1J5E K;  4DV5 K;  4LF8 K;  2ZM6 K;  4LFB K;  2HHH K;  5IWA K;  4JYA K;  2VQF K;  4B3S K;  5BR8 K;  1N34 K;  4JI7 K;  3OTO K;  4JI6 K;  2UUB K;  4JI8 K;  4X62 K;  2VQE K;  5LMU K;  4JI0 K;  1I94 K;  4DV4 K;  4X66 K;  4DUY K;  4LF6 K;  5LL6 Z;  3JAM O;  4LFA K;  1HNZ K;  1N32 K;  1FJG K;  4LF4 K;  1XMO K;  2UXB K;  3J7Y P;  4JI5 K;  2UXD K;  4JI3 K;  5AJ3 K;  4GKK K;  2UU9 K;  4X64 K;  4DV6 K;  4YY3 K;  2F4V K;  5FLX O;  4LF5 K;  5A2Q O;  4JI1 K;  1XMQ K;  1N33 K;  4DR6 K;  4KHP K;  4NXM K;  4DR2 K;  3J7A P;  4DV1 K;  4JI4 K;  4DR5 K;  4B3T K;  4DR4 K;  4CW7 B;  4B3M K;  1XNR K;  4DR3 K;  1HR0 K;  1N36 K;  5IT9 O;  4DR1 K;  1HNW K;  4CVN E;  1XNQ K;  4LF7 K;  1IBL K;  2E5L K;  2UUA K;  3J80 O;  4DV0 K;  4DV3 K;  4DV2 K;  3T1H K;  2UUC K;  4LF9 K;  4K0K K;  4OX9 K;  1IBK K;  3T1Y K;  4JV5 K;  5LMN K;  4DR7 K;  4DV7 K;  4LFC K;  4JI2 K;  4B3R K;  4DUZ K;  4AQY K;  4YHH K;  3J81 O;  4GKJ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...