4LFCK

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lfcK00
4LF7K 4OX9K 5IWAK 1IBMK 1HNWK 4JI2K 4GKJK 4DV3K 4X64K 4NXNK 4DV1K 4NXMK 1HNZK 4DV2K 4K0KK 5LMNK 1XMOK 4DUYK 3OTOK 4X65K 1IBKK 4LFBK 4B3SK 4LF8K 1N32K 1N33K 4AQYK 4LFCK 4X62K 3J80O 1N34K 4JI8K 4DR6K 3JAMO 2UUBK 2UUCK 4DUZK 1HNXK 2E5LK 2HHHK 4B3MK 4JI5K 4DV6K 4LF5K 4LF4K 4DR4K 2UUAK 4DV5K 4KHPK 4LFAK 4DR7K 5FLXO 4CVNE 3T1YK 4LF9K 3J7YP 5LL6Z 1J5EK 5LMUK 4DR2K 4JYAK 3J7AP 2UXCK 4DR5K 4B3TK 1I94K 2UXBK 5BR8K 2UU9K 4JI1K 4X66K 4JV5K 3J81O 5AJ3K 4JI3K 4DV0K 4JI6K 4V19S 1IBLK 4DV4K 4LF6K 4GKKK 2UXDK 1N36K 1XMQK 4DV7K 4JI4K 4DR3K 4JI0K 4CW7B 3T1HK 1HR0K 1XNRK 5A2QO 4YY3K 4JI7K 4YHHK 5IT9O 2F4VK 2VQEK 4DR1K 1XNQK 1FJGK 4B3RK 2ZM6K 2VQFK
chains in the Genus database with same CATH superfamily
1IJJA 1HNIA 5AQWA 3AGKA 1ZBSA 3SQ1A 3H08A 4JD2B 3S3MA 3QEVA 4NCAA 5C2FA 1HQEA 2XY5A 3OYAA 3DMJA 1IKVA 1U2VB 1RDBA 2D1KA 5DM6L 2IGIA 4B1ZA 2QWRA 1VSEA 2VYPA 2JWKA 3HM8A 1NNEA 2KFZA 5GIPA 4IG0A 4C8MA 5J2QA 4AQYK 1KFDA 2HSTA 4X62K 3J80O 3IG1A 1N34K 4B9VA 2Z1HA 2KHOA 4F8RA 3OVNA 2I7PA 5GAGP 2Q3SA 2XY8A 4I6MB 3ZSZA 2Y1IA 3CPWM 3VQAA 3KJVA 1B92A 3NE6A 4B9NA 3LAKA 4KHNA 1QE1A 4O44A 3ZX0A 1Q9XA 2YI1A 3AVIA 2CGKA 4DQSA 1YJNN 2AA4A 2OANA 2ZGZA 4YNQA 1KFSA 1NGBA 4HCCA 3WNFA 3D2EA 3DLRA 3MN6A 2LSNA 2QXFA 2E4LA 5KRSA 3ULEB 1QQCA 1EXQA 2Q36A 1SS6A 3AGRA 2GBZA 4WE1A 1T03A 1RT4A 3GG4A 1T44A 2NLXA 3FLCO 3IDHA 3MX2A 1OVQA 3MN5A 3MCPA 2YHWA 3TTCA 4N76A 1GOCA 4DV4K 3UKUB 4CEBA 3DLEA 1GLJO 1T6DA 1ESVA 4JI0K 3RSEB 3NF8A 1RNHA 1HR0K 4E89A 3O4QA 4KTZA 2NZTA 3R9PA 1W97L 3K57A 4CGFA 1YT3A 4CJ3A 2A6AA 5AQYA 2OPSA 3ZSYA 4GVMA 3CC2N 3CQYA 4PL7A 3K59A 2G8IA 3LM9A 4ILHA 4CIFA 3CJBA 2IVOA 1HPZA 4W5RA 2E8AA 2FXUA 4FJIA 4H5WA 4BR7A 4JI2K 5BRDA 1VSJA 4DV3K 3KK2A 4BR0A 1WAFA 3DLKA 4E19A 3VQ6A 4AHVA 4YOUA 4FJXA 2YV0X 1BIUA 4A5BA 4OLAA 4A2BA 3VQDA 4AHSA 3QLHA 1DT9A 5TKYA 4LFBK 4LSNA 3LDPA 4KBOA 4XH4A 4N56A 3BGRA 5AQOA 1D9DA 1C1CA 4CFDA 4JHDB 2NNWA 3CJCA 1RGIA 3M8QA 3SAFA 3V9XA 3FZHA 4KFBA 1TL3A 2CH6A 4FJ5A 5AQLA 2G8UA 2FSJA 3CCMN 1VQ7N 1ASVA 1TK8A 3THWA 3NGYA 4CVNE 2QW9A 2HHQA 2KQ2A 4BQLA 2YNFA 4CZEA 4CEFA 2P9PA 1RDAA 4Z4HA 4CJ7A 3IMXA 1I94K 4W5TA 1K73O 1K8AO 1ILYA 4OPHA 4E3SA 1VQ6N 1O1WA 4KO0A 3PV8A 1ASUA 4CHYA 3AVCA 3HYFA 3DYAA 3LANA 1GLDG 2HF3A 4JKGB 4GV9A 4IDKA 2GWKA 3ZEUB 1Q8IA 4CFAA 3ASMA 3WXJA 4MDAA 3CG7A 1VQPN 1HQUA 2D0OA 3KD1E 1U04A 4WYBA 2D5RA 5ELZA 4BRNA 4EZ9A 3Q7BA 3W0LA 4QCLA 1QVFM 4JI7K 1ZBUA 3P38A 3NVKA 4B8CA 3SI6A 1A5VA 2EHGA 3QDKA 3MXMA 3OYCA 3LDOA 2BUPA 4ISGA 2ZM6K 5EX5A 1M90O 3H1VX 4OX9K 5BREA 3EKUA 3NGZA 5CY4A 3K5OA 3AO4A 1S5JA 1GOAA 1YHQN 4KHQA 1GLCG 1VSFA 3WNHA 4MO4A 5HRNA 3SJJA 1VSMA 3KKRA 4DV1K 2ITMA 1ZBFA 4MQ3A 3DOLA 3VMFB 1QQMA 3OTOK 4RTFD 1NJWA 2P9NA 4IO9L 3UE5A 4B3SK 1NGAA 4PUOA 1REVA 3LALA 3OYBA 2O8EA 5EY4A 4DU4A 5MLCQ 4JRPA 4PA1A 2WOMA 2UUBK 1EQYA 4FWMA 2FF6A 5AZIA 4BRCA 2E5LK 4RW9A 1WN7A 2D4WA 1DGKN 1ZYQA 4FZZA 3ZSOA 1WOQA 1NLVA 3ENBA 3SJHA 5GAHP 4G9ZA 3SPYA 3AA2A 5BN8A 2WBNA 1KTQA 3OYDA 4CZKA 1WBDA 4CZMA 2HVHA 2O4GA 1WB9A 2BH1A 2RF2A 3MXJA 4DSFA 3CC7N 3O4NA 3TAPA 1KAYA 3SCXA 4JYAK 5C0YA 3U9DA 4E7HA 4AM6A 4PQUA 1Z6RA 2UU9K 5C15A 3I8BA 4X66K 4N5SA 5J2PA 1OH7A 4AILC 3NBPA 2Q0UA 4WF9L 2HHSA 1L3VA 1NJXA 1WSFA 3O4WA 2OCEA 1QVGM 1LWCA 3MWPA 3WNEA 1JLEA 4HUEA 2A42A 5AQRA 4OKJA 3DLBA 1K8KB 1UA1A 2JGUA 2BANA 3QIPA 4JNEA 4RW7A 2NRZA 4CCHA 3LDLA 3DRSA 1HMVA 4EAHD 4DR1K 3CCRN 1OH6A 2QEXN 3ZT4A 4BG8A 3AO1A 2YHAA 3MAQA 1S9GA 5HOOA 3VENA 3HBTA 3P4IA 4MLEA 3CJ7A 5JLFA 3FZKA 1TYQB 1SV5A 1KVAA 5GADP 3WXKA 5M1PA 1T8EA 1W9HA 4IBNA 4PKHA 4CIGA 2FC0A 3J8AA 3U3GA 1GLAG 2OPQA 4KH5A 4OJRA 4U67L 4G1QA 3MEGA 1QZ6A 3H3OB 4F3TA 1RTIA 3HVTA 4M3ZA 3ID8A 1EKEA 4CHPA 1HX1A 4B3OA 5I3UA 3DRPA 4CHQA 1IG8A 1K6YA 4DUZK 5HL7L 4B3MK 3RMCA 1SUQA 3SV3A 3ENHA 4I7FA 1KAXA 4EHTA 3UB5A 3LP3A 4HCBA 3WXIA 2E1ZA 4AF1A 4JK8A 4DS4A 3QEPA 3L0QA 1BQNA 1C0TA 3QNNA 3SQ0A 5LL6Z 3RWUA 4WCEL 4BE0A 3HI0A 4Z4IA 2F8TA 5DK5A 4I9QA 3SLCA 4XH5A 3BZCA 2HBMA 2HHVA 3OBWA 3PX0A 4Z4CA 1BISA 1KD1O 2YNIA 3OS1A 4F9OA 2G8KA 2A1RA 5KGXA 2ATQA 2Q31A 4DTOA 3AVJA 1MWKA 3A2FA 3VGKA 1LWEA 3O3HA 4PWDA 3G10A 1BI4A 5KI6A 4OKKA 4JI4K 1NKBA 3IRXA 1WSEA 3VQ5A 4CW7B 4DLEA 3DLLL 3CHWA 5I42A 4QS8A 2HBJA 4YY3K 1TUUA 3K58A 1C0UA 3QFPA 4E0DA 4I2PA 2RE2A 1WLJA 1NGIA 1Q86O 1Q81O 3O6WA 1YITN 1U48A 4FJ7A 1SL1A 1JLQA 2BTFA 1C0MA 5BPMA 3DRRA 3H1QA 4FPAA 5HRSA 3L2RA 3C0BA 4BDZA 2XY6A 3A5OC 3AO3A 1SKRA 5BRFA 4BVOA 5AR0A 2KZMA 1J54A 4WFAL 3SUQA 3S9HA 5FPEA 3FFIA 4YOYA 1IBKK 1RDDA 4FK0A 4KHUA 3SQ4A 4ILJA 3RMDA 3MWTA 1RFQA 4K41A 4YORA 1HKGA 4JI8K 5KQDA 3BF3A 3P83D 3SUPA 5AQXA 5KPRA 1DLOA 4OPAA 1HNXK 1BIZA 3V6DA 4FWOA 3KK1A 1XHXA 3L3VA 2XY7A 3OYKA 4CJVA 3C6TA 3LDSA 2IOCA 1LCUA 1NK5A 1BA0A 2P9LB 2Q97A 5M1OA 3HT3A 3PUFA 1L3SA 4L8RB 1OKJA 3T1AA 1E4GT 4DTMA 3BEXA 3ZT3A 4CJTA 3J7AP 3F9KA 3A8YA 3LWMA 5AQVA 4OPKA 2UXCK 4M7XA 3CJ1A 3TSUA 4DFMA 4JV5K 4C8KA 4BR2A 4DFPA 1NGHA 1LV5A 3M6GA 3ALYA 3PSFA 4YDUC 1HLUA 5AQTA 1NK8A 4CF8A 3KHYA 3VQEA 4B9QA 1TV6A 1WSHA 3QESA 1JLGA 4E1MA 4DV7K 3ZT1A 4R79A 5F1XA 3TAEA 1KLNA 4DQQA 3KKSA 1S72N 1NK0A 2P9UB 4KV8A 3AAQA 3ATUA 3E9PA 4CF9A 2A1SA 3VF2A 4C8OA 2HNDA 1EX4A 5KGWA 1SZ2A 1XNQK 1FJGK 2IS3A 1VAZA 1IBMK 1RBSA 3ZSVA 4DSEA 2V7ZA 4JD2A 3P31A 4DSKA 1ZBLA 4FOIA 2QM1A 4DB3A 3PY8A 4EIAA 2PYJA 4BR4A 3CCUN 2QTDA 1NU0A 1NBWA 1S1VA 4H5TA 5CHIA 3OS2A 1N33K 4FJKA 1YTAA 4FO0A 4F4KA 4FM1A 4FJGA 3QMLA 4EFHA 1X9SA 2A5XA 3CXCM 4HTUA 2BGGA 4B1XB 1ZXOA 1OH5A 3EN9A 4DV6K 3NF7A 4I6MA 3C7NB 4KH6A 4Y1DA 1T6CA 1RBUA 4A2AA 1TK0A 3T3FA 2E2QA 4LF4K 2FBVA 1Y64A 4CZJA 4IJNA 1XC3A 4JS5A 3VQBA 4CJLA 1WUAA 1JKHA 3FZMA 2HNYA 4DR7K 2VCPA 3DXKA 2RN2A 4HUFA 2O8BA 3TTDA 3TAMA 5BR9A 3AAPA 3I0RA 2PAVA 3OJUA 3TABA 4BE1A 1FW6A 1EO1A 3LM2A 4GMJB 1NGGA 3E1YA 3TPQA 2QI2A 4A59A 5AQGA 5AJ3K 2F9WA 4OKEA 3O80A 1YVNA 4MO5A 1W2BM 3P1GA 2UXDK 2NRTA 4FSVA 2ZQBA 4CFBA 3EY1A 3UKUA 3D7EO 4FLTA 1SQKA 3AA4A 4RG8A 4DS5A 2ASOA 3OYJA 3E01A 3RMAA 2VGMA 4CZIA 3VF6A 3OYIA 3CD6N 5LJWA 2F4VK 3MECA 1G99A 4B9MA 1WNSA 3F73A 3VA0A 1S1TA 1S1UA 4B1VA 2JWLA 1FKOA 1U49A 3O5BA 3EEQA 2D0AA 3DXMB 2J4RA 4X64K 4IFVA 1QS4A 4CK1A 3TAGA 4JS4A 4DWIA 4IZ9A 5E84A 1RDWX 5JMVA 3N4PA 1BL3A 5JVGL 2HW3A 3QEWA 2ZWHA 1NM1A 2OPPA 5KRTA 5JS1A 4LF8K 4H5VA 4FLVA 3ZYYX 2QWMA 1JJ2M 3I33A 3D2EB 4PY5A 2HHXA 2KZZA 4FWQA 4Y0WA 3EE9A 4ISFA 3ZSQA 4DR6K 3QINA 3JAMO 4B9UA 3AY9A 2HHTA 4CGGA 2XHBA 4H03B 3VQ4A 1EWRA 3OJSA 4H0XB 2V7YA 3M8PA 4ELVA 4DCHA 4NCGA 4RW4A 3OYGA 3JS6A 2Q2RA 4J2EA 5KPZA 4FJHA 3L8BA 2YX6A 4IEIA 4E7KA 3AVGA 4DF8A 2A41A 4FK2A 5FROA 3UKRA 4FPBA 1HKCA 3E9LA 4H0OA 3AVNA 3H6EA 5C2DA 1DEJA 4H4OA 4DF4A 4O0JA 3R8EA 4K42A 4H5RA 4J8FA 3JXUA 4JI1K 4FJMA 4BRQA 3NF9A 1Q18A 4JI3K 5F2RA 3MX5A 4F2SA 3SMSA 2E1YA 3PLAA 4JKGA 4FW2A 4FLUA 4ZTJA 4FWPA 3ZEUA 3K5NA 4H0VB 1BO5O 4FL9A 1WBBA 1B9DA 4O0IA 2P9KA 1NKEA 3CI5A 4XH1A 4NLCA 3BP8A 4N41A 1NK6A 3V9SA 1NKCA 3FZLA 4Q5VA 4BACA 4O4GA 4CEZA 4DQPA 1NJYA 1X9JA 4EP5A 4DFKA 3P39A 3THXB 1QSSA 1NGDA 4B1WB 4DSIA 3D2FB 3ZLJA 1S9EA 3MN9A 5AQFA 3ZETA 3C95A 3H45C 3QB0A 1LAWA 1LAVA 2RHKA 3CM6A 3F5TA 3QO9A 4K0KK 1O13A 1S1WA 4ELUA 4ZHRA 4X65K 1F21A 1EWQA 2BDPA 3L2QA 5FPNA 2YHYA 3G0ZA 3TAFA 4I9LA 5GIOA 4BRHA 3OHRA 4DU1A 3WXLA 2P9PB 4QS7A 2O8CA 4NYFA 5JICA 4CJ5A 1I39A 1FXXA 3IUCA 5AQJA 4Q0BA 1LW0A 3T69A 1YUWA 1T7PA 5HROA 2IVNA 1RT3A 3HOSA 1CZBA 1XQSC 2P9IB 2E6LA 4J2BA 5GAEP 4QAGA 2GTDA 4FJLA 4CHOA 2ZJRL 5HRRA 4CJPA 3MXIA 3FE1A 3BY5A 3SK3A 5FLXO 1A5WA 4B9SA 3HSTB 3GE1A 2VG7A 4MLHA 3LP2A 3J7YP 3OYEA 3DI6A 1YJ9N 3LPTA 1J5EK 3RRGA 2W6LA 3VEZA 4WFBL 1RBTA 3E9OA 4CBWA 3HVRA 2WFBA 4DQRA 2QXLA 5BN9A 2CH5A 2PYLA 4Y1CA 1Q7YO 1OH8A 1BU6O 1JL2A 1GOBA 2F96A 4JKBA 1FK9A 4FLWA 1BA1A 2FLOA 1S22A 4WFNL 3KK7A 2W42A 4XIUA 4UY8O 3C6HA 3D0PA 4M3XA 4GV6A 1J6ZA 4DR3K 1LOTB 3C6UA 3T1HK 4B1YB 2P5GA 1XNRK 2X74A 1L5UA 4DQ8A 2P9SA 1IV0A 2D0CA 4RW8A 4O55A 2P9NB 4W5QA 4FWSA 4AHCA 4CD3A 2VQFK 3P5JA 1BCMA 3M8SA 4M45A 1U4BA 3WQUA 3NCIA 2W6KA 2YJFA 2YKNA 3DOKA 3C94A 3HP9A 4GKJK 3AVHA 5SZTA 1NJZA 3HPHA 5AZIB 2UYTA 4M7YA 4QS9A 4KTQA 1VSHA 4ILGB 1B9FA 3EYZA 3NH1A 1GLFO 3BF1A 2GWJA 3K5MA 4CJQA 4IOAL 4NXMK 2W41A 1HNZK 2FSKA 5KTQA 1IG9A 4KKOA 4JLHA 2DFFA 2F9TA 1C0GA 4YDUA 4GV3A 1YI2N 5EVZA 3SAHA 1S6PA 5F0XA 2QWOA 2W40A 1QQOA 4KB0A 1CLQA 2E2OA 4M3UA 4FM0A 2OA8A 1YAGA 4JN4A 4BG9A 5GINA 4JAXA 1JLBA 4BRIA 4JI5K 5CYMA 3CC4N 1TK5A 1R59O 1JCFA 3O9QA 5EOYA 3F9MA 2FBYA 3IAYA 4O5FA 2G8FA 4PL8A 3VTIA 1TUYA 2G8VA 3WEEA 1ATSA 5ADXH 4B8AB 4FW1A 3G71N 4NCBA 2QKKA 4DR2K 3CJ9A 2HB5A 1IKYA 3SNNA 4IEEA 3ZSXA 5C12A 3HK2A 2O8DA 3EZWA 1VHXA 2HMPA 1RCHA 2V52B 5FPMA 3IS9A 1IH7A 4ID5A 5CZ1A 4FVUA 1NK9A 3VGLA 3NFAA 4J2AA 4H5NA 3NMUA 4BE2A 1EP4A 1KCFA 4GKKK 1GLBG 2Q0RA 3TU5A 3PO5A 3HTVA 2GEMA 5AZJA 4W5NA 2X78A 3PX6A 2R7YA 4YOWA 3CERA 2A40A 2NRHA 3DJCA 5AQPA 3RTVA 1HJRA 2IDOA 1KC8O 2VQEK 3THYA 4BRAA 1UA0A 4FZXC 1M1KO 1RTDA 3AARA 4CZHA 3R6MA 4LF7K 4DLGA 1HUXA 2IAJA 4FLXA 1C1BA 4CGHA 1VQKN 4FJ9A 1J9AA 3VPZA 2P1JA 3GBTA 4L3QA 2E2NA 4ZTFA 3NHGA 3KTQA 3CMAN 1S6QA 1QSLA 3LZJA 4KHYA 4DTSA 1C6VA 4BQZA 3AVAA 4EP4A 4DV2K 5LMNK 1VQ5N 3O9RA 2FBXA 4IFEA 1KVBA 2DFEA 3T7ZA 4DSLA 1WSIA 2ZE2A 3L4IA 1Z05A 2ASMA 3AO2A 3CF5L 5CYQA 4CEQA 1HJOA 4AM7A 2KFNA 1JCEA 4FWNA 2O8FA 2YHBA 1XUPO 3CCEN 4KTWA 4K43A 4JKAA 2VWKA 1VQNN 4LSLA 1XI1A 3C65A 2HOEA 2PFUA 5E41A 1RTHA 4KB1A 1NOZA 4E7LA 4KPYA 2WTUA 1VSKA 4YOXA 3V1OA 1BI4B 4GNIA 4M42A 3KIOA 2GUPA 3K9JA 4BRLA 1D5AA 1IKXA 5DMRA 3OY9A 2F7TA 3NH2A 2UXBK 4IOCL 2RKIA 1RBVA 3U8XA 4NYNA 2KKZA 3V81A 4BRKA 1G15A 4EZ6A 2OYQA 1UOCA 2CGJA 4DTXA 3TI0A 4DTPA 3K5LA 4RCHA 3D45A 4FLZA 3V4IA 2QA4N 1LWFA 3G6EN 2EX3A 1RT5A 1RILA 1SAZA 1T3VA 1TL1A 3GOIA 5AQSA 3L3UA 4M3TA 1NOYA 5EU7A 3SUOA 4ID1A 3A0IX 1DKGD 5M1FA 3B6OA 1N8RO 3O1BA 2E6MA 1VRUA 4HVJA 2GELA 3KVGA 4NB4A 3CFPA 3I56N 5BRHA 3SPZA 1VSDA 4H4MA 3QICA 1L3UA 4BRFA 5JLHA 4FLYA 3QEIA 2GV9A 3IFRA 1NGJA 2OZSA 1VK0A 3A5NC 4M3WA 1Y97A 5EXWA 2ZD1A 3OYNA 1Z26A 4I2QA 1J5OA 2WONA 4OO1J 3H46O 2YHXA 3VQ9A 5KQ8A 2X6NA 5AFUH 4HHTA 4WQ5A 3HM9A 4NLBA 5HRPA 4IG3A 4DU3A 4U7BA 3L6QA 5AQZA 1U2VA 4KI4A 5AQIA 2NRRA 1C1AA 4BC2A 4RW6A 3KLIA 2HBKA 1BDGA 4IO8A 3CFRA 4LFAK 3SYZA 3A5MC 4C1NI 3VN5A 2KW4A 4JKHA 3AVFA 3ZSRA 4MDBA 2JLEA 2OZMA 1EETA 3LZIA 3O8MA 1BG3A 2PZSA 5I9EB 4BC5A 1JLAA 1NJIO 4H8KA 3M3ZA 3EE8A 3K2PA 1T05A 1ZC6A 1VQON 1P8ZA 2NRXA 1VQMN 5AQNA 2O4IA 1HRHA 4FZYA 5AQUA 2ITGA 4V19S 1IBLK 1GLLO 3AA3A 4A5AA 1CZ9A 3NAEA 4LF6K 1YXQA 3C6AA 5C25A 4BWJA 2QWPA 5C42A 4BGAA 1MA9B 3HL8A 3CFOA 1D9FA 4ISEA 1ASWA 1U6ZA 3ULEA 3QNOA 2XO7A 2YNGA 3QEXA 1KXPA 2OTLN 3FR0A 2PBDA 3OYFA 4GY2B 1KVCA 4CGDA 4BRGA 4FXDA 2IIRA 2E88A 3O1WA 2FF3B 1NK4A 4ELTA 4KHSA 3SZ2A 1ZBIA 5BPLA 3CCLN 4OPJA 1WAJA 4C23A 4FWRA 4LH5A 3DXMA 4K8XA 1BGXT 4CEAA 3OA9A 3KLEA 3RSEA 2HBLA 3EKSA 4Z4GA 1Z25A 3LL3A 5ADXA 5J1EA 4J2DA 4CEOA 3KZBA 2OTJN 1KLMA 3DXKB 3QBWA 4O5BA 4CF1A 4JKDA 3V9ZA 4FK4A 3CQXA 2O8BB 2P5OA 1NGCA 4A61A 4JRQA 3QERA 4BROA 4W5OA 3CCSN 3H3NO 5DM7L 4IWVA 3R3LA 2DY4A 1GLEG 1K9MO 4HTLA 4B9LA 3WUHA 1BOTO 3SAGA 2P51A 4CJRA 3ZT2A 4CHNA 3LPUA 4ICLA 1CXQA 1TKTA 2PY5A 3EL2A 4FJJA 3G4SN 3AVMA 2B4JA 5AQKA 3ITHA 4KHPK 1NGEA 3CETA 1H1VA 4A62A 1OVYA 4CK3A 1FKPA 1QQNA 3S3OA 1X1PA 3JSMA 3MMVA 4CF0A 2YKMA 1QZ5A 1KRPA 4CERA 4IFYA 4WQ4C 2BE2A 3LDQA 1ZBHA 4JHDA 4CF2A 3VQCA 4B3TK 2NUBA 5AQQA 3HP6A 2VGNA 3AVBA 4E1NA 1TKZA 3TARA 3SBTA 3HZ6A 1TKXA 1YVUA 3N4QA 3TWHA 3ZX2A 4LC9B 4JEPA 4DTUA 1RT2A 4R5PA 1V4TA 4B08A 3M1FA 1KSPA 2OPRA 3QBXA 4H0PA 3WQTA 4CZGA 3M8RA 3ID6A 3ENOA 4IJAA 2QK9A 1BUPA 3EO3A 1A5XA 4FJNA 3BUZB 4LY7A 4DTRA 2DTUA 4B9TA 2H3GX 2B6AA 2KTQA 3LAMA 2F8SA 3ZT0A 1TVRA 3NF6A 4DMNA 3THXA 3MDQA 4CBXA 3HSCA 2CGLA 3D2FA 4NXNK 3VEVA 3ZX3A 4FCYA 4WQ5C 1RT6A 4FOEA 5KPTA 3BDPA 1N5YA 1NWKA 3VQQA 4FYDA 1WSJA 3RMBA 1UAXA 3F2KA 2ASPA 5CE3A 2HNZA 3UKRB 1JLFA 3CCQN 3T19A 4K25A 4IXCA 4LFCK 4KHWA 5HBMA 3DM2A 4KAZA 4CJWA 2IC3A 4JKFA 3HO1A 4GW6A 5M1NA 1VQ8N 4B1UB 1E4FT 2UUCK 2I7NA 4O8KA 4LD0A 5BPNA 5CR4A 1NMNA 4A57A 4CGJA 4CD1A 3KWIA 1BQMA 2A3ZA 3G25A 3MCAB 1YJWN 1V4SA 4HWIA 4LF5K 1RBRA 4AH9A 4DR4K 2UUAK 2P9IA 3K9KA 3THWB 3PSIA 3CJAA 1XWLA 1KQSM 2G8WA 3V1RA 4DG1A 3AVKA 3HJFA 3I0SA 3PO4A 4JK7A 2RPIA 4CIEA 3DAWA 3MEDA 1MDUB 3GDQA 1CZAN 1QHTA 2Q1NA 4FJ8A 2P9KB 2HHUA 4CZLA 4BVPA 4DFJA 2VG5A 3OYLA 4AHUA 3M5RA 3IKMA 1RT1A 4H0TB 4XEIA 4DQIA 3ISNC 3HXMA 2HF4A 3V9WA 4CEDA 3ZETB 1Q82O 1BCOA 1XMQK 5J2MA 3TR8A 2HMIA 3GL1A 4FWLA 2WC9A 4Z94A 4YOVA 2YNHA 4CJUA 3VTHA 3HPOA 1L3TA 3V9UA 3AO5A 1R0AA 2HHWA 2I5JA 3PX4A 4B3RK 1TGOA 1DTTA 2O8CB 3SUNA 5AFUA 3RR8A 2QWLA 2ZF5O 1HNWK 4DHYA 4CI6A 4CJKA 1X9WA 5H1SQ 4C1NK 5B8HA 3QETA 3O08A 3OBYA 1W7AA 3ULDA 4OGCA 4DTNA 1JXEA 3B6PA 1C0FA 3OYMA 4DUYK 3AVLA 1K8KA 3DLHA 3EZ5A 3QIOA 3U4LA 4E7JA 4M63C 1D8YA 2O8EB 4CHZA 1VSLA 4CBUA 1N32K 3VESA 3MK6A 3VQ8A 3S3NA 5AQHA 3A5LC 4F3OA 4PHTX 3B8AX 2HVIA 5HLFA 2IVPA 3KD5E 1TYQA 4IKFA 2XRIA 5M1KA 3AA5X 1TKDA 3PIPL 2Z1JA 1SL2A 1NGFA 2WUSA 3THVA 4BWMA 4K8ZA 1HYVA 3VQPA 4GVEA 3FFKB 1D4XA 3T1YK 4AHRA 3LP1A 4HUGA 1NMDA 3RRHA 3J7ZO 2P9SB 3ATVA 1VQ9N 3PIOL 3QFUA 2D0BA 3JYTA 4BY9C 4BREA 1S3XA 1VQLN 4YOTA 4BR5A 1SL0A 5JS2A 4E7IA 3O9UA 3MEEA 3VEXA 4LH4A 4CGIA 4BC4A 4JI6K 3TSPA 4JK9A 3NH0A 4RWTA 2FSNA 3TANA 4CECA 3OYHA 3E66A 3NVMA 5FDLA 1RTJA 2NRVA 4M41A 5LY3A 1X3MA 3VA3A 4BDPA 1WSGA 5M1QA 3CMEN 3KWGA 5A2QO 4UQGA 1KAZA 4JKEA 1VQ4N 2ETJA 2VWJA 4C8LA 5IT9O 1HKBA 1N6QA 1LW2A 4OVLA 4Z0UA 5IWAK 1UWBA 1HNVA 2B5JA 4KH4A 4DTJA 1RDCA 5C24A 1I3AA 5SWMA 3ZSWA 1CXUA 4CJEA 4FM2A 4OGEA 4CJ4A 1XMOK 1X9MA 3WEEB 4BRMA 3DLGA 3Q7CA 3FZFA 1QHAA 1E3MA 3S41A 3VEYA 3WT0A 5E26A 3OS0A 2NRWA 2ZGYA 2EWSA 2O8DB 4Z4EA 4JKCA 3NGIA 1TAUA 1VSIA 1U45A 1YTUA 5JVHL 1HYZA 1ATNA 3HRGA 3CPEA 3CCJN 4CZFA 4DV5K 3WNGA 1SKSA 3SBGA 3TTFA 3VGMA 4KRFA 2Y1JA 5AZJB 5FRNA 5CZ2A 1RT7A 3OW2M 3U6FA 3VERA 4BRPA 4N47A 3THYB 2VG6A 3J81O 4BGBA 2VWBA 4DV0K 2E2PA 5LJVA 2GX9A 4KI6A 4PKIA 2P9LA 4CJSA 3KK3A 1YF5L 3CM5A 2FBTA 3R1XA 3LP0A 4BR9A 4E1JA 5FPDA 4YFUA 3O9SA 2G8HA 1W0HA 4IOXA 3VOVA 2YJEA 3LDNA 1QSYA 4CK2A 2ZJPL 3UIQA 2E20A 4M3RA 3VETA 1JXBA 3K0SA 4OLBA 4CFCA 4BC3A 3L2VA 1NK7A 1SKWA 2O8FB 2Z1IA 4CESA 4QOZB 5HP1A 3VEOA 1X3NA 4WQ4A 3LWLA 1BHLA 1MU2A 3RR7A 3KLGA 3FGUA 4EHUA 3RVCA 2P9UA 3O9TA 2Z1GA 1XHZA 1RDUA 2QKBA 3KLHA 1QTMA 2GUIA 1NG9A 4F2RA 3L2WA 1IO2A 1U47A 3L2UA 3TAQA 4MFBA 4BRDA 2V51B 3VEWA 1ITGA 3ZCMA 1S1XA 4FWKA 3TSQA 1ATRA 5C10A 3BZKA 2HHHK 5J2NA 1P90A 2DFHA 3DWLA 2QWQA 5FRMA 4IDHA 2D0PA 4FVMA 3O3FA 4KREA 5T7BA 2AJQA 2X6SA 2QWNA 2AP1A 1HPMA 3I55N 4LF9K 5K14A 3U3YA 1BWFO 5LMUK 1YIJN 5D3GA 3KLFA 4C8NA 5TKWA 4DR5K 3CQ8A 5BR8K 1TAQA 3HPGA 1J53A 1Q9YA 1JL1A 4PKGA 2KLAA 3CCVN 5AQMA 3L4QA 3C7NA 3AV9A 3SQ2A 1DTQA 1JLCA 4AHTA 2DPNA 4TSXA 3VQ7A 4M3YA 4CJFA 4DKWA 4NO7A 1VRTA 3HOTA 4H0YB 4CEEA 3O3GA 1N36K 2ZJQL 3CIPA 3I8DA 4DSJA 3SV4A 3D6RA 3SMPA 1IKWA 1JCGA 3CYMA 3V1QA 3MN7A 3U9ZA 3NDKA 2YCHA 4O8UA 3WXMB 4YHHK 1MWMA 4BDYA 4CE9A 3VF4A 1XC9A 4Z4FA 1HYSA 3W3DA
chains in the Genus database with same CATH topology
4LF7K 4OX9K 5IWAK 1IBMK 1HNWK 4JI2K 4GKJK 4DV3K 4X64K 4NXNK 4DV1K 4NXMK 1HNZK 4DV2K 4K0KK 5LMNK 1XMOK 4DUYK 3OTOK 4X65K 1IBKK 4LFBK 4B3SK 4LF8K 1N32K 1N33K 4AQYK 4LFCK 4X62K 3J80O 1N34K 4JI8K 4DR6K 3JAMO 2UUBK 2UUCK 4DUZK 1HNXK 2E5LK 2HHHK 4B3MK 4JI5K 4DV6K 4LF5K 4LF4K 4DR4K 2UUAK 4DV5K 4KHPK 4LFAK 4DR7K 5FLXO 4CVNE 3T1YK 4LF9K 3J7YP 5LL6Z 1J5EK 5LMUK 4DR2K 4JYAK 3J7AP 2UXCK 4DR5K 4B3TK 1I94K 2UXBK 5BR8K 2UU9K 4JI1K 4X66K 4JV5K 3J81O 5AJ3K 4JI3K 4DV0K 4JI6K 4V19S 1IBLK 4DV4K 4LF6K 4GKKK 2UXDK 1N36K 1XMQK 4DV7K 4JI4K 4DR3K 4JI0K 4CW7B 3T1HK 1HR0K 1XNRK 5A2QO 4YY3K 4JI7K 4YHHK 5IT9O 2F4VK 2VQEK 4DR1K 1XNQK 1FJGK 4B3RK 2ZM6K 2VQFK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 K;  4OX9 K;  5IWA K;  1IBM K;  1HNW K;  4JI2 K;  4GKJ K;  4DV3 K;  4X64 K;  4NXN K;  4DV1 K;  4NXM K;  1HNZ K;  4DV2 K;  4K0K K;  5LMN K;  1XMO K;  4DUY K;  3OTO K;  4X65 K;  1IBK K;  4LFB K;  4B3S K;  4LF8 K;  1N32 K;  1N33 K;  4AQY K;  4LFC K;  4X62 K;  3J80 O;  1N34 K;  4JI8 K;  4DR6 K;  3JAM O;  2UUB K;  2UUC K;  4DUZ K;  1HNX K;  2E5L K;  2HHH K;  4B3M K;  4JI5 K;  4DV6 K;  4LF5 K;  4LF4 K;  4DR4 K;  2UUA K;  4DV5 K;  4KHP K;  4LFA K;  4DR7 K;  5FLX O;  4CVN E;  3T1Y K;  4LF9 K;  3J7Y P;  5LL6 Z;  1J5E K;  5LMU K;  4DR2 K;  4JYA K;  3J7A P;  2UXC K;  4DR5 K;  4B3T K;  1I94 K;  2UXB K;  5BR8 K;  2UU9 K;  4JI1 K;  4X66 K;  4JV5 K;  3J81 O;  5AJ3 K;  4JI3 K;  4DV0 K;  4JI6 K;  4V19 S;  1IBL K;  4DV4 K;  4LF6 K;  4GKK K;  2UXD K;  1N36 K;  1XMQ K;  4DV7 K;  4JI4 K;  4DR3 K;  4JI0 K;  4CW7 B;  3T1H K;  1HR0 K;  1XNR K;  5A2Q O;  4YY3 K;  4JI7 K;  4YHH K;  5IT9 O;  2F4V K;  2VQE K;  4DR1 K;  1XNQ K;  1FJG K;  4B3R K;  2ZM6 K;  2VQF K; 
#chains in the Genus database with same CATH topology
 1IJJ A;  1HNI A;  5AQW A;  3AGK A;  1ZBS A;  3SQ1 A;  3H08 A;  4JD2 B;  3S3M A;  3QEV A;  4NCA A;  5C2F A;  1HQE A;  2XY5 A;  3OYA A;  3DMJ A;  1IKV A;  1U2V B;  1RDB A;  2D1K A;  5DM6 L;  2IGI A;  4B1Z A;  2QWR A;  1VSE A;  2VYP A;  2JWK A;  3HM8 A;  1NNE A;  2KFZ A;  5GIP A;  4IG0 A;  4C8M A;  5J2Q A;  4AQY K;  1KFD A;  2HST A;  4X62 K;  3J80 O;  3IG1 A;  1N34 K;  4B9V A;  2Z1H A;  2KHO A;  4F8R A;  3OVN A;  2I7P A;  5GAG P;  2Q3S A;  2XY8 A;  4I6M B;  3ZSZ A;  2Y1I A;  3CPW M;  3VQA A;  3KJV A;  1B92 A;  3NE6 A;  4B9N A;  3LAK A;  4KHN A;  1QE1 A;  4O44 A;  3ZX0 A;  1Q9X A;  2YI1 A;  3AVI A;  2CGK A;  4DQS A;  1YJN N;  2AA4 A;  2OAN A;  2ZGZ A;  4YNQ A;  1KFS A;  1NGB A;  4HCC A;  3WNF A;  3D2E A;  3DLR A;  3MN6 A;  2LSN A;  2QXF A;  2E4L A;  5KRS A;  3ULE B;  1QQC A;  1EXQ A;  2Q36 A;  1SS6 A;  3AGR A;  2GBZ A;  4WE1 A;  1T03 A;  1RT4 A;  3GG4 A;  1T44 A;  2NLX A;  3FLC O;  3IDH A;  3MX2 A;  1OVQ A;  3MN5 A;  3MCP A;  2YHW A;  3TTC A;  4N76 A;  1GOC A;  4DV4 K;  3UKU B;  4CEB A;  3DLE A;  1GLJ O;  1T6D A;  1ESV A;  4JI0 K;  3RSE B;  3NF8 A;  1RNH A;  1HR0 K;  4E89 A;  3O4Q A;  4KTZ A;  2NZT A;  3R9P A;  1W97 L;  3K57 A;  4CGF A;  1YT3 A;  4CJ3 A;  2A6A A;  5AQY A;  2OPS A;  3ZSY A;  4GVM A;  3CC2 N;  3CQY A;  4PL7 A;  3K59 A;  2G8I A;  3LM9 A;  4ILH A;  4CIF A;  3CJB A;  2IVO A;  1HPZ A;  4W5R A;  2E8A A;  2FXU A;  4FJI A;  4H5W A;  4BR7 A;  4JI2 K;  5BRD A;  1VSJ A;  4DV3 K;  3KK2 A;  4BR0 A;  1WAF A;  3DLK A;  4E19 A;  3VQ6 A;  4AHV A;  4YOU A;  4FJX A;  2YV0 X;  1BIU A;  4A5B A;  4OLA A;  4A2B A;  3VQD A;  4AHS A;  3QLH A;  1DT9 A;  5TKY A;  4LFB K;  4LSN A;  3LDP A;  4KBO A;  4XH4 A;  4N56 A;  3BGR A;  5AQO A;  1D9D A;  1C1C A;  4CFD A;  4JHD B;  2NNW A;  3CJC A;  1RGI A;  3M8Q A;  3SAF A;  3V9X A;  3FZH A;  4KFB A;  1TL3 A;  2CH6 A;  4FJ5 A;  5AQL A;  2G8U A;  2FSJ A;  3CCM N;  1VQ7 N;  1ASV A;  1TK8 A;  3THW A;  3NGY A;  4CVN E;  2QW9 A;  2HHQ A;  2KQ2 A;  4BQL A;  2YNF A;  4CZE A;  4CEF A;  2P9P A;  1RDA A;  4Z4H A;  4CJ7 A;  3IMX A;  1I94 K;  4W5T A;  1K73 O;  1K8A O;  1ILY A;  4OPH A;  4E3S A;  1VQ6 N;  1O1W A;  4KO0 A;  3PV8 A;  1ASU A;  4CHY A;  3AVC A;  3HYF A;  3DYA A;  3LAN A;  1GLD G;  2HF3 A;  4JKG B;  4GV9 A;  4IDK A;  2GWK A;  3ZEU B;  1Q8I A;  4CFA A;  3ASM A;  3WXJ A;  4MDA A;  3CG7 A;  1VQP N;  1HQU A;  2D0O A;  3KD1 E;  1U04 A;  4WYB A;  2D5R A;  5ELZ A;  4BRN A;  4EZ9 A;  3Q7B A;  3W0L A;  4QCL A;  1QVF M;  4JI7 K;  1ZBU A;  3P38 A;  3NVK A;  4B8C A;  3SI6 A;  1A5V A;  2EHG A;  3QDK A;  3MXM A;  3OYC A;  3LDO A;  2BUP A;  4ISG A;  2ZM6 K;  5EX5 A;  1M90 O;  3H1V X;  4OX9 K;  5BRE A;  3EKU A;  3NGZ A;  5CY4 A;  3K5O A;  3AO4 A;  1S5J A;  1GOA A;  1YHQ N;  4KHQ A;  1GLC G;  1VSF A;  3WNH A;  4MO4 A;  5HRN A;  3SJJ A;  1VSM A;  3KKR A;  4DV1 K;  2ITM A;  1ZBF A;  4MQ3 A;  3DOL A;  3VMF B;  1QQM A;  3OTO K;  4RTF D;  1NJW A;  2P9N A;  4IO9 L;  3UE5 A;  4B3S K;  1NGA A;  4PUO A;  1REV A;  3LAL A;  3OYB A;  2O8E A;  5EY4 A;  4DU4 A;  5MLC Q;  4JRP A;  4PA1 A;  2WOM A;  2UUB K;  1EQY A;  4FWM A;  2FF6 A;  5AZI A;  4BRC A;  2E5L K;  4RW9 A;  1WN7 A;  2D4W A;  1DGK N;  1ZYQ A;  4FZZ A;  3ZSO A;  1WOQ A;  1NLV A;  3ENB A;  3SJH A;  5GAH P;  4G9Z A;  3SPY A;  3AA2 A;  5BN8 A;  2WBN A;  1KTQ A;  3OYD A;  4CZK A;  1WBD A;  4CZM A;  2HVH A;  2O4G A;  1WB9 A;  2BH1 A;  2RF2 A;  3MXJ A;  4DSF A;  3CC7 N;  3O4N A;  3TAP A;  1KAY A;  3SCX A;  4JYA K;  5C0Y A;  3U9D A;  4E7H A;  4AM6 A;  4PQU A;  1Z6R A;  2UU9 K;  5C15 A;  3I8B A;  4X66 K;  4N5S A;  5J2P A;  1OH7 A;  4AIL C;  3NBP A;  2Q0U A;  4WF9 L;  2HHS A;  1L3V A;  1NJX A;  1WSF A;  3O4W A;  2OCE A;  1QVG M;  1LWC A;  3MWP A;  3WNE A;  1JLE A;  4HUE A;  2A42 A;  5AQR A;  4OKJ A;  3DLB A;  1K8K B;  1UA1 A;  2JGU A;  2BAN A;  3QIP A;  4JNE A;  4RW7 A;  2NRZ A;  4CCH A;  3LDL A;  3DRS A;  1HMV A;  4EAH D;  4DR1 K;  3CCR N;  1OH6 A;  2QEX N;  3ZT4 A;  4BG8 A;  3AO1 A;  2YHA A;  3MAQ A;  1S9G A;  5HOO A;  3VEN A;  3HBT A;  3P4I A;  4MLE A;  3CJ7 A;  5JLF A;  3FZK A;  1TYQ B;  1SV5 A;  1KVA A;  5GAD P;  3WXK A;  5M1P A;  1T8E A;  1W9H A;  4IBN A;  4PKH A;  4CIG A;  2FC0 A;  3J8A A;  3U3G A;  1GLA G;  2OPQ A;  4KH5 A;  4OJR A;  4U67 L;  4G1Q A;  3MEG A;  1QZ6 A;  3H3O B;  4F3T A;  1RTI A;  3HVT A;  4M3Z A;  3ID8 A;  1EKE A;  4CHP A;  1HX1 A;  4B3O A;  5I3U A;  3DRP A;  4CHQ A;  1IG8 A;  1K6Y A;  4DUZ K;  5HL7 L;  4B3M K;  3RMC A;  1SUQ A;  3SV3 A;  3ENH A;  4I7F A;  1KAX A;  4EHT A;  3UB5 A;  3LP3 A;  4HCB A;  3WXI A;  2E1Z A;  4AF1 A;  4JK8 A;  4DS4 A;  3QEP A;  3L0Q A;  1BQN A;  1C0T A;  3QNN A;  3SQ0 A;  5LL6 Z;  3RWU A;  4WCE L;  4BE0 A;  3HI0 A;  4Z4I A;  2F8T A;  5DK5 A;  4I9Q A;  3SLC A;  4XH5 A;  3BZC A;  2HBM A;  2HHV A;  3OBW A;  3PX0 A;  4Z4C A;  1BIS A;  1KD1 O;  2YNI A;  3OS1 A;  4F9O A;  2G8K A;  2A1R A;  5KGX A;  2ATQ A;  2Q31 A;  4DTO A;  3AVJ A;  1MWK A;  3A2F A;  3VGK A;  1LWE A;  3O3H A;  4PWD A;  3G10 A;  1BI4 A;  5KI6 A;  4OKK A;  4JI4 K;  1NKB A;  3IRX A;  1WSE A;  3VQ5 A;  4CW7 B;  4DLE A;  3DLL L;  3CHW A;  5I42 A;  4QS8 A;  2HBJ A;  4YY3 K;  1TUU A;  3K58 A;  1C0U A;  3QFP A;  4E0D A;  4I2P A;  2RE2 A;  1WLJ A;  1NGI A;  1Q86 O;  1Q81 O;  3O6W A;  1YIT N;  1U48 A;  4FJ7 A;  1SL1 A;  1JLQ A;  2BTF A;  1C0M A;  5BPM A;  3DRR A;  3H1Q A;  4FPA A;  5HRS A;  3L2R A;  3C0B A;  4BDZ A;  2XY6 A;  3A5O C;  3AO3 A;  1SKR A;  5BRF A;  4BVO A;  5AR0 A;  2KZM A;  1J54 A;  4WFA L;  3SUQ A;  3S9H A;  5FPE A;  3FFI A;  4YOY A;  1IBK K;  1RDD A;  4FK0 A;  4KHU A;  3SQ4 A;  4ILJ A;  3RMD A;  3MWT A;  1RFQ A;  4K41 A;  4YOR A;  1HKG A;  4JI8 K;  5KQD A;  3BF3 A;  3P83 D;  3SUP A;  5AQX A;  5KPR A;  1DLO A;  4OPA A;  1HNX K;  1BIZ A;  3V6D A;  4FWO A;  3KK1 A;  1XHX A;  3L3V A;  2XY7 A;  3OYK A;  4CJV A;  3C6T A;  3LDS A;  2IOC A;  1LCU A;  1NK5 A;  1BA0 A;  2P9L B;  2Q97 A;  5M1O A;  3HT3 A;  3PUF A;  1L3S A;  4L8R B;  1OKJ A;  3T1A A;  1E4G T;  4DTM A;  3BEX A;  3ZT3 A;  4CJT A;  3J7A P;  3F9K A;  3A8Y A;  3LWM A;  5AQV A;  4OPK A;  2UXC K;  4M7X A;  3CJ1 A;  3TSU A;  4DFM A;  4JV5 K;  4C8K A;  4BR2 A;  4DFP A;  1NGH A;  1LV5 A;  3M6G A;  3ALY A;  3PSF A;  4YDU C;  1HLU A;  5AQT A;  1NK8 A;  4CF8 A;  3KHY A;  3VQE A;  4B9Q A;  1TV6 A;  1WSH A;  3QES A;  1JLG A;  4E1M A;  4DV7 K;  3ZT1 A;  4R79 A;  5F1X A;  3TAE A;  1KLN A;  4DQQ A;  3KKS A;  1S72 N;  1NK0 A;  2P9U B;  4KV8 A;  3AAQ A;  3ATU A;  3E9P A;  4CF9 A;  2A1S A;  3VF2 A;  4C8O A;  2HND A;  1EX4 A;  5KGW A;  1SZ2 A;  1XNQ K;  1FJG K;  2IS3 A;  1VAZ A;  1IBM K;  1RBS A;  3ZSV A;  4DSE A;  2V7Z A;  4JD2 A;  3P31 A;  4DSK A;  1ZBL A;  4FOI A;  2QM1 A;  4DB3 A;  3PY8 A;  4EIA A;  2PYJ A;  4BR4 A;  3CCU N;  2QTD A;  1NU0 A;  1NBW A;  1S1V A;  4H5T A;  5CHI A;  3OS2 A;  1N33 K;  4FJK A;  1YTA A;  4FO0 A;  4F4K A;  4FM1 A;  4FJG A;  3QML A;  4EFH A;  1X9S A;  2A5X A;  3CXC M;  4HTU A;  2BGG A;  4B1X B;  1ZXO A;  1OH5 A;  3EN9 A;  4DV6 K;  3NF7 A;  4I6M A;  3C7N B;  4KH6 A;  4Y1D A;  1T6C A;  1RBU A;  4A2A A;  1TK0 A;  3T3F A;  2E2Q A;  4LF4 K;  2FBV A;  1Y64 A;  4CZJ A;  4IJN A;  1XC3 A;  4JS5 A;  3VQB A;  4CJL A;  1WUA A;  1JKH A;  3FZM A;  2HNY A;  4DR7 K;  2VCP A;  3DXK A;  2RN2 A;  4HUF A;  2O8B A;  3TTD A;  3TAM A;  5BR9 A;  3AAP A;  3I0R A;  2PAV A;  3OJU A;  3TAB A;  4BE1 A;  1FW6 A;  1EO1 A;  3LM2 A;  4GMJ B;  1NGG A;  3E1Y A;  3TPQ A;  2QI2 A;  4A59 A;  5AQG A;  5AJ3 K;  2F9W A;  4OKE A;  3O80 A;  1YVN A;  4MO5 A;  1W2B M;  3P1G A;  2UXD K;  2NRT A;  4FSV A;  2ZQB A;  4CFB A;  3EY1 A;  3UKU A;  3D7E O;  4FLT A;  1SQK A;  3AA4 A;  4RG8 A;  4DS5 A;  2ASO A;  3OYJ A;  3E01 A;  3RMA A;  2VGM A;  4CZI A;  3VF6 A;  3OYI A;  3CD6 N;  5LJW A;  2F4V K;  3MEC A;  1G99 A;  4B9M A;  1WNS A;  3F73 A;  3VA0 A;  1S1T A;  1S1U A;  4B1V A;  2JWL A;  1FKO A;  1U49 A;  3O5B A;  3EEQ A;  2D0A A;  3DXM B;  2J4R A;  4X64 K;  4IFV A;  1QS4 A;  4CK1 A;  3TAG A;  4JS4 A;  4DWI A;  4IZ9 A;  5E84 A;  1RDW X;  5JMV A;  3N4P A;  1BL3 A;  5JVG L;  2HW3 A;  3QEW A;  2ZWH A;  1NM1 A;  2OPP A;  5KRT A;  5JS1 A;  4LF8 K;  4H5V A;  4FLV A;  3ZYY X;  2QWM A;  1JJ2 M;  3I33 A;  3D2E B;  4PY5 A;  2HHX A;  2KZZ A;  4FWQ A;  4Y0W A;  3EE9 A;  4ISF A;  3ZSQ A;  4DR6 K;  3QIN A;  3JAM O;  4B9U A;  3AY9 A;  2HHT A;  4CGG A;  2XHB A;  4H03 B;  3VQ4 A;  1EWR A;  3OJS A;  4H0X B;  2V7Y A;  3M8P A;  4ELV A;  4DCH A;  4NCG A;  4RW4 A;  3OYG A;  3JS6 A;  2Q2R A;  4J2E A;  5KPZ A;  4FJH A;  3L8B A;  2YX6 A;  4IEI A;  4E7K A;  3AVG A;  4DF8 A;  2A41 A;  4FK2 A;  5FRO A;  3UKR A;  4FPB A;  1HKC A;  3E9L A;  4H0O A;  3AVN A;  3H6E A;  5C2D A;  1DEJ A;  4H4O A;  4DF4 A;  4O0J A;  3R8E A;  4K42 A;  4H5R A;  4J8F A;  3JXU A;  4JI1 K;  4FJM A;  4BRQ A;  3NF9 A;  1Q18 A;  4JI3 K;  5F2R A;  3MX5 A;  4F2S A;  3SMS A;  2E1Y A;  3PLA A;  4JKG A;  4FW2 A;  4FLU A;  4ZTJ A;  4FWP A;  3ZEU A;  3K5N A;  4H0V B;  1BO5 O;  4FL9 A;  1WBB A;  1B9D A;  4O0I A;  2P9K A;  1NKE A;  3CI5 A;  4XH1 A;  4NLC A;  3BP8 A;  4N41 A;  1NK6 A;  3V9S A;  1NKC A;  3FZL A;  4Q5V A;  4BAC A;  4O4G A;  4CEZ A;  4DQP A;  1NJY A;  1X9J A;  4EP5 A;  4DFK A;  3P39 A;  3THX B;  1QSS A;  1NGD A;  4B1W B;  4DSI A;  3D2F B;  3ZLJ A;  1S9E A;  3MN9 A;  5AQF A;  3ZET A;  3C95 A;  3H45 C;  3QB0 A;  1LAW A;  1LAV A;  2RHK A;  3CM6 A;  3F5T A;  3QO9 A;  4K0K K;  1O13 A;  1S1W A;  4ELU A;  4ZHR A;  4X65 K;  1F21 A;  1EWQ A;  2BDP A;  3L2Q A;  5FPN A;  2YHY A;  3G0Z A;  3TAF A;  4I9L A;  5GIO A;  4BRH A;  3OHR A;  4DU1 A;  3WXL A;  2P9P B;  4QS7 A;  2O8C A;  4NYF A;  5JIC A;  4CJ5 A;  1I39 A;  1FXX A;  3IUC A;  5AQJ A;  4Q0B A;  1LW0 A;  3T69 A;  1YUW A;  1T7P A;  5HRO A;  2IVN A;  1RT3 A;  3HOS A;  1CZB A;  1XQS C;  2P9I B;  2E6L A;  4J2B A;  5GAE P;  4QAG A;  2GTD A;  4FJL A;  4CHO A;  2ZJR L;  5HRR A;  4CJP A;  3MXI A;  3FE1 A;  3BY5 A;  3SK3 A;  5FLX O;  1A5W A;  4B9S A;  3HST B;  3GE1 A;  2VG7 A;  4MLH A;  3LP2 A;  3J7Y P;  3OYE A;  3DI6 A;  1YJ9 N;  3LPT A;  1J5E K;  3RRG A;  2W6L A;  3VEZ A;  4WFB L;  1RBT A;  3E9O A;  4CBW A;  3HVR A;  2WFB A;  4DQR A;  2QXL A;  5BN9 A;  2CH5 A;  2PYL A;  4Y1C A;  1Q7Y O;  1OH8 A;  1BU6 O;  1JL2 A;  1GOB A;  2F96 A;  4JKB A;  1FK9 A;  4FLW A;  1BA1 A;  2FLO A;  1S22 A;  4WFN L;  3KK7 A;  2W42 A;  4XIU A;  4UY8 O;  3C6H A;  3D0P A;  4M3X A;  4GV6 A;  1J6Z A;  4DR3 K;  1LOT B;  3C6U A;  3T1H K;  4B1Y B;  2P5G A;  1XNR K;  2X74 A;  1L5U A;  4DQ8 A;  2P9S A;  1IV0 A;  2D0C A;  4RW8 A;  4O55 A;  2P9N B;  4W5Q A;  4FWS A;  4AHC A;  4CD3 A;  2VQF K;  3P5J A;  1BCM A;  3M8S A;  4M45 A;  1U4B A;  3WQU A;  3NCI A;  2W6K A;  2YJF A;  2YKN A;  3DOK A;  3C94 A;  3HP9 A;  4GKJ K;  3AVH A;  5SZT A;  1NJZ A;  3HPH A;  5AZI B;  2UYT A;  4M7Y A;  4QS9 A;  4KTQ A;  1VSH A;  4ILG B;  1B9F A;  3EYZ A;  3NH1 A;  1GLF O;  3BF1 A;  2GWJ A;  3K5M A;  4CJQ A;  4IOA L;  4NXM K;  2W41 A;  1HNZ K;  2FSK A;  5KTQ A;  1IG9 A;  4KKO A;  4JLH A;  2DFF A;  2F9T A;  1C0G A;  4YDU A;  4GV3 A;  1YI2 N;  5EVZ A;  3SAH A;  1S6P A;  5F0X A;  2QWO A;  2W40 A;  1QQO A;  4KB0 A;  1CLQ A;  2E2O A;  4M3U A;  4FM0 A;  2OA8 A;  1YAG A;  4JN4 A;  4BG9 A;  5GIN A;  4JAX A;  1JLB A;  4BRI A;  4JI5 K;  5CYM A;  3CC4 N;  1TK5 A;  1R59 O;  1JCF A;  3O9Q A;  5EOY A;  3F9M A;  2FBY A;  3IAY A;  4O5F A;  2G8F A;  4PL8 A;  3VTI A;  1TUY A;  2G8V A;  3WEE A;  1ATS A;  5ADX H;  4B8A B;  4FW1 A;  3G71 N;  4NCB A;  2QKK A;  4DR2 K;  3CJ9 A;  2HB5 A;  1IKY A;  3SNN A;  4IEE A;  3ZSX A;  5C12 A;  3HK2 A;  2O8D A;  3EZW A;  1VHX A;  2HMP A;  1RCH A;  2V52 B;  5FPM A;  3IS9 A;  1IH7 A;  4ID5 A;  5CZ1 A;  4FVU A;  1NK9 A;  3VGL A;  3NFA A;  4J2A A;  4H5N A;  3NMU A;  4BE2 A;  1EP4 A;  1KCF A;  4GKK K;  1GLB G;  2Q0R A;  3TU5 A;  3PO5 A;  3HTV A;  2GEM A;  5AZJ A;  4W5N A;  2X78 A;  3PX6 A;  2R7Y A;  4YOW A;  3CER A;  2A40 A;  2NRH A;  3DJC A;  5AQP A;  3RTV A;  1HJR A;  2IDO A;  1KC8 O;  2VQE K;  3THY A;  4BRA A;  1UA0 A;  4FZX C;  1M1K O;  1RTD A;  3AAR A;  4CZH A;  3R6M A;  4LF7 K;  4DLG A;  1HUX A;  2IAJ A;  4FLX A;  1C1B A;  4CGH A;  1VQK N;  4FJ9 A;  1J9A A;  3VPZ A;  2P1J A;  3GBT A;  4L3Q A;  2E2N A;  4ZTF A;  3NHG A;  3KTQ A;  3CMA N;  1S6Q A;  1QSL A;  3LZJ A;  4KHY A;  4DTS A;  1C6V A;  4BQZ A;  3AVA A;  4EP4 A;  4DV2 K;  5LMN K;  1VQ5 N;  3O9R A;  2FBX A;  4IFE A;  1KVB A;  2DFE A;  3T7Z A;  4DSL A;  1WSI A;  2ZE2 A;  3L4I A;  1Z05 A;  2ASM A;  3AO2 A;  3CF5 L;  5CYQ A;  4CEQ A;  1HJO A;  4AM7 A;  2KFN A;  1JCE A;  4FWN A;  2O8F A;  2YHB A;  1XUP O;  3CCE N;  4KTW A;  4K43 A;  4JKA A;  2VWK A;  1VQN N;  4LSL A;  1XI1 A;  3C65 A;  2HOE A;  2PFU A;  5E41 A;  1RTH A;  4KB1 A;  1NOZ A;  4E7L A;  4KPY A;  2WTU A;  1VSK A;  4YOX A;  3V1O A;  1BI4 B;  4GNI A;  4M42 A;  3KIO A;  2GUP A;  3K9J A;  4BRL A;  1D5A A;  1IKX A;  5DMR A;  3OY9 A;  2F7T A;  3NH2 A;  2UXB K;  4IOC L;  2RKI A;  1RBV A;  3U8X A;  4NYN A;  2KKZ A;  3V81 A;  4BRK A;  1G15 A;  4EZ6 A;  2OYQ A;  1UOC A;  2CGJ A;  4DTX A;  3TI0 A;  4DTP A;  3K5L A;  4RCH A;  3D45 A;  4FLZ A;  3V4I A;  2QA4 N;  1LWF A;  3G6E N;  2EX3 A;  1RT5 A;  1RIL A;  1SAZ A;  1T3V A;  1TL1 A;  3GOI A;  5AQS A;  3L3U A;  4M3T A;  1NOY A;  5EU7 A;  3SUO A;  4ID1 A;  3A0I X;  1DKG D;  5M1F A;  3B6O A;  1N8R O;  3O1B A;  2E6M A;  1VRU A;  4HVJ A;  2GEL A;  3KVG A;  4NB4 A;  3CFP A;  3I56 N;  5BRH A;  3SPZ A;  1VSD A;  4H4M A;  3QIC A;  1L3U A;  4BRF A;  5JLH A;  4FLY A;  3QEI A;  2GV9 A;  3IFR A;  1NGJ A;  2OZS A;  1VK0 A;  3A5N C;  4M3W A;  1Y97 A;  5EXW A;  2ZD1 A;  3OYN A;  1Z26 A;  4I2Q A;  1J5O A;  2WON A;  4OO1 J;  3H46 O;  2YHX A;  3VQ9 A;  5KQ8 A;  2X6N A;  5AFU H;  4HHT A;  4WQ5 A;  3HM9 A;  4NLB A;  5HRP A;  4IG3 A;  4DU3 A;  4U7B A;  3L6Q A;  5AQZ A;  1U2V A;  4KI4 A;  5AQI A;  2NRR A;  1C1A A;  4BC2 A;  4RW6 A;  3KLI A;  2HBK A;  1BDG A;  4IO8 A;  3CFR A;  4LFA K;  3SYZ A;  3A5M C;  4C1N I;  3VN5 A;  2KW4 A;  4JKH A;  3AVF A;  3ZSR A;  4MDB A;  2JLE A;  2OZM A;  1EET A;  3LZI A;  3O8M A;  1BG3 A;  2PZS A;  5I9E B;  4BC5 A;  1JLA A;  1NJI O;  4H8K A;  3M3Z A;  3EE8 A;  3K2P A;  1T05 A;  1ZC6 A;  1VQO N;  1P8Z A;  2NRX A;  1VQM N;  5AQN A;  2O4I A;  1HRH A;  4FZY A;  5AQU A;  2ITG A;  4V19 S;  1IBL K;  1GLL O;  3AA3 A;  4A5A A;  1CZ9 A;  3NAE A;  4LF6 K;  1YXQ A;  3C6A A;  5C25 A;  4BWJ A;  2QWP A;  5C42 A;  4BGA A;  1MA9 B;  3HL8 A;  3CFO A;  1D9F A;  4ISE A;  1ASW A;  1U6Z A;  3ULE A;  3QNO A;  2XO7 A;  2YNG A;  3QEX A;  1KXP A;  2OTL N;  3FR0 A;  2PBD A;  3OYF A;  4GY2 B;  1KVC A;  4CGD A;  4BRG A;  4FXD A;  2IIR A;  2E88 A;  3O1W A;  2FF3 B;  1NK4 A;  4ELT A;  4KHS A;  3SZ2 A;  1ZBI A;  5BPL A;  3CCL N;  4OPJ A;  1WAJ A;  4C23 A;  4FWR A;  4LH5 A;  3DXM A;  4K8X A;  1BGX T;  4CEA A;  3OA9 A;  3KLE A;  3RSE A;  2HBL A;  3EKS A;  4Z4G A;  1Z25 A;  3LL3 A;  5ADX A;  5J1E A;  4J2D A;  4CEO A;  3KZB A;  2OTJ N;  1KLM A;  3DXK B;  3QBW A;  4O5B A;  4CF1 A;  4JKD A;  3V9Z A;  4FK4 A;  3CQX A;  2O8B B;  2P5O A;  1NGC A;  4A61 A;  4JRQ A;  3QER A;  4BRO A;  4W5O A;  3CCS N;  3H3N O;  5DM7 L;  4IWV A;  3R3L A;  2DY4 A;  1GLE G;  1K9M O;  4HTL A;  4B9L A;  3WUH A;  1BOT O;  3SAG A;  2P51 A;  4CJR A;  3ZT2 A;  4CHN A;  3LPU A;  4ICL A;  1CXQ A;  1TKT A;  2PY5 A;  3EL2 A;  4FJJ A;  3G4S N;  3AVM A;  2B4J A;  5AQK A;  3ITH A;  4KHP K;  1NGE A;  3CET A;  1H1V A;  4A62 A;  1OVY A;  4CK3 A;  1FKP A;  1QQN A;  3S3O A;  1X1P A;  3JSM A;  3MMV A;  4CF0 A;  2YKM A;  1QZ5 A;  1KRP A;  4CER A;  4IFY A;  4WQ4 C;  2BE2 A;  3LDQ A;  1ZBH A;  4JHD A;  4CF2 A;  3VQC A;  4B3T K;  2NUB A;  5AQQ A;  3HP6 A;  2VGN A;  3AVB A;  4E1N A;  1TKZ A;  3TAR A;  3SBT A;  3HZ6 A;  1TKX A;  1YVU A;  3N4Q A;  3TWH A;  3ZX2 A;  4LC9 B;  4JEP A;  4DTU A;  1RT2 A;  4R5P A;  1V4T A;  4B08 A;  3M1F A;  1KSP A;  2OPR A;  3QBX A;  4H0P A;  3WQT A;  4CZG A;  3M8R A;  3ID6 A;  3ENO A;  4IJA A;  2QK9 A;  1BUP A;  3EO3 A;  1A5X A;  4FJN A;  3BUZ B;  4LY7 A;  4DTR A;  2DTU A;  4B9T A;  2H3G X;  2B6A A;  2KTQ A;  3LAM A;  2F8S A;  3ZT0 A;  1TVR A;  3NF6 A;  4DMN A;  3THX A;  3MDQ A;  4CBX A;  3HSC A;  2CGL A;  3D2F A;  4NXN K;  3VEV A;  3ZX3 A;  4FCY A;  4WQ5 C;  1RT6 A;  4FOE A;  5KPT A;  3BDP A;  1N5Y A;  1NWK A;  3VQQ A;  4FYD A;  1WSJ A;  3RMB A;  1UAX A;  3F2K A;  2ASP A;  5CE3 A;  2HNZ A;  3UKR B;  1JLF A;  3CCQ N;  3T19 A;  4K25 A;  4IXC A;  4LFC K;  4KHW A;  5HBM A;  3DM2 A;  4KAZ A;  4CJW A;  2IC3 A;  4JKF A;  3HO1 A;  4GW6 A;  5M1N A;  1VQ8 N;  4B1U B;  1E4F T;  2UUC K;  2I7N A;  4O8K A;  4LD0 A;  5BPN A;  5CR4 A;  1NMN A;  4A57 A;  4CGJ A;  4CD1 A;  3KWI A;  1BQM A;  2A3Z A;  3G25 A;  3MCA B;  1YJW N;  1V4S A;  4HWI A;  4LF5 K;  1RBR A;  4AH9 A;  4DR4 K;  2UUA K;  2P9I A;  3K9K A;  3THW B;  3PSI A;  3CJA A;  1XWL A;  1KQS M;  2G8W A;  3V1R A;  4DG1 A;  3AVK A;  3HJF A;  3I0S A;  3PO4 A;  4JK7 A;  2RPI A;  4CIE A;  3DAW A;  3MED A;  1MDU B;  3GDQ A;  1CZA N;  1QHT A;  2Q1N A;  4FJ8 A;  2P9K B;  2HHU A;  4CZL A;  4BVP A;  4DFJ A;  2VG5 A;  3OYL A;  4AHU A;  3M5R A;  3IKM A;  1RT1 A;  4H0T B;  4XEI A;  4DQI A;  3ISN C;  3HXM A;  2HF4 A;  3V9W A;  4CED A;  3ZET B;  1Q82 O;  1BCO A;  1XMQ K;  5J2M A;  3TR8 A;  2HMI A;  3GL1 A;  4FWL A;  2WC9 A;  4Z94 A;  4YOV A;  2YNH A;  4CJU A;  3VTH A;  3HPO A;  1L3T A;  3V9U A;  3AO5 A;  1R0A A;  2HHW A;  2I5J A;  3PX4 A;  4B3R K;  1TGO A;  1DTT A;  2O8C B;  3SUN A;  5AFU A;  3RR8 A;  2QWL A;  2ZF5 O;  1HNW K;  4DHY A;  4CI6 A;  4CJK A;  1X9W A;  5H1S Q;  4C1N K;  5B8H A;  3QET A;  3O08 A;  3OBY A;  1W7A A;  3ULD A;  4OGC A;  4DTN A;  1JXE A;  3B6P A;  1C0F A;  3OYM A;  4DUY K;  3AVL A;  1K8K A;  3DLH A;  3EZ5 A;  3QIO A;  3U4L A;  4E7J A;  4M63 C;  1D8Y A;  2O8E B;  4CHZ A;  1VSL A;  4CBU A;  1N32 K;  3VES A;  3MK6 A;  3VQ8 A;  3S3N A;  5AQH A;  3A5L C;  4F3O A;  4PHT X;  3B8A X;  2HVI A;  5HLF A;  2IVP A;  3KD5 E;  1TYQ A;  4IKF A;  2XRI A;  5M1K A;  3AA5 X;  1TKD A;  3PIP L;  2Z1J A;  1SL2 A;  1NGF A;  2WUS A;  3THV A;  4BWM A;  4K8Z A;  1HYV A;  3VQP A;  4GVE A;  3FFK B;  1D4X A;  3T1Y K;  4AHR A;  3LP1 A;  4HUG A;  1NMD A;  3RRH A;  3J7Z O;  2P9S B;  3ATV A;  1VQ9 N;  3PIO L;  3QFU A;  2D0B A;  3JYT A;  4BY9 C;  4BRE A;  1S3X A;  1VQL N;  4YOT A;  4BR5 A;  1SL0 A;  5JS2 A;  4E7I A;  3O9U A;  3MEE A;  3VEX A;  4LH4 A;  4CGI A;  4BC4 A;  4JI6 K;  3TSP A;  4JK9 A;  3NH0 A;  4RWT A;  2FSN A;  3TAN A;  4CEC A;  3OYH A;  3E66 A;  3NVM A;  5FDL A;  1RTJ A;  2NRV A;  4M41 A;  5LY3 A;  1X3M A;  3VA3 A;  4BDP A;  1WSG A;  5M1Q A;  3CME N;  3KWG A;  5A2Q O;  4UQG A;  1KAZ A;  4JKE A;  1VQ4 N;  2ETJ A;  2VWJ A;  4C8L A;  5IT9 O;  1HKB A;  1N6Q A;  1LW2 A;  4OVL A;  4Z0U A;  5IWA K;  1UWB A;  1HNV A;  2B5J A;  4KH4 A;  4DTJ A;  1RDC A;  5C24 A;  1I3A A;  5SWM A;  3ZSW A;  1CXU A;  4CJE A;  4FM2 A;  4OGE A;  4CJ4 A;  1XMO K;  1X9M A;  3WEE B;  4BRM A;  3DLG A;  3Q7C A;  3FZF A;  1QHA A;  1E3M A;  3S41 A;  3VEY A;  3WT0 A;  5E26 A;  3OS0 A;  2NRW A;  2ZGY A;  2EWS A;  2O8D B;  4Z4E A;  4JKC A;  3NGI A;  1TAU A;  1VSI A;  1U45 A;  1YTU A;  5JVH L;  1HYZ A;  1ATN A;  3HRG A;  3CPE A;  3CCJ N;  4CZF A;  4DV5 K;  3WNG A;  1SKS A;  3SBG A;  3TTF A;  3VGM A;  4KRF A;  2Y1J A;  5AZJ B;  5FRN A;  5CZ2 A;  1RT7 A;  3OW2 M;  3U6F A;  3VER A;  4BRP A;  4N47 A;  3THY B;  2VG6 A;  3J81 O;  4BGB A;  2VWB A;  4DV0 K;  2E2P A;  5LJV A;  2GX9 A;  4KI6 A;  4PKI A;  2P9L A;  4CJS A;  3KK3 A;  1YF5 L;  3CM5 A;  2FBT A;  3R1X A;  3LP0 A;  4BR9 A;  4E1J A;  5FPD A;  4YFU A;  3O9S A;  2G8H A;  1W0H A;  4IOX A;  3VOV A;  2YJE A;  3LDN A;  1QSY A;  4CK2 A;  2ZJP L;  3UIQ A;  2E20 A;  4M3R A;  3VET A;  1JXB A;  3K0S A;  4OLB A;  4CFC A;  4BC3 A;  3L2V A;  1NK7 A;  1SKW A;  2O8F B;  2Z1I A;  4CES A;  4QOZ B;  5HP1 A;  3VEO A;  1X3N A;  4WQ4 A;  3LWL A;  1BHL A;  1MU2 A;  3RR7 A;  3KLG A;  3FGU A;  4EHU A;  3RVC A;  2P9U A;  3O9T A;  2Z1G A;  1XHZ A;  1RDU A;  2QKB A;  3KLH A;  1QTM A;  2GUI A;  1NG9 A;  4F2R A;  3L2W A;  1IO2 A;  1U47 A;  3L2U A;  3TAQ A;  4MFB A;  4BRD A;  2V51 B;  3VEW A;  1ITG A;  3ZCM A;  1S1X A;  4FWK A;  3TSQ A;  1ATR A;  5C10 A;  3BZK A;  2HHH K;  5J2N A;  1P90 A;  2DFH A;  3DWL A;  2QWQ A;  5FRM A;  4IDH A;  2D0P A;  4FVM A;  3O3F A;  4KRE A;  5T7B A;  2AJQ A;  2X6S A;  2QWN A;  2AP1 A;  1HPM A;  3I55 N;  4LF9 K;  5K14 A;  3U3Y A;  1BWF O;  5LMU K;  1YIJ N;  5D3G A;  3KLF A;  4C8N A;  5TKW A;  4DR5 K;  3CQ8 A;  5BR8 K;  1TAQ A;  3HPG A;  1J53 A;  1Q9Y A;  1JL1 A;  4PKG A;  2KLA A;  3CCV N;  5AQM A;  3L4Q A;  3C7N A;  3AV9 A;  3SQ2 A;  1DTQ A;  1JLC A;  4AHT A;  2DPN A;  4TSX A;  3VQ7 A;  4M3Y A;  4CJF A;  4DKW A;  4NO7 A;  1VRT A;  3HOT A;  4H0Y B;  4CEE A;  3O3G A;  1N36 K;  2ZJQ L;  3CIP A;  3I8D A;  4DSJ A;  3SV4 A;  3D6R A;  3SMP A;  1IKW A;  1JCG A;  3CYM A;  3V1Q A;  3MN7 A;  3U9Z A;  3NDK A;  2YCH A;  4O8U A;  3WXM B;  4YHH K;  1MWM A;  4BDY A;  4CE9 A;  3VF4 A;  1XC9 A;  4Z4F A;  1HYS A;  3W3D A; 
#chains in the Genus database with same CATH homology
 4LF7 K;  4OX9 K;  5IWA K;  1IBM K;  1HNW K;  4JI2 K;  4GKJ K;  4DV3 K;  4X64 K;  4NXN K;  4DV1 K;  4NXM K;  1HNZ K;  4DV2 K;  4K0K K;  5LMN K;  1XMO K;  4DUY K;  3OTO K;  4X65 K;  1IBK K;  4LFB K;  4B3S K;  4LF8 K;  1N32 K;  1N33 K;  4AQY K;  4LFC K;  4X62 K;  3J80 O;  1N34 K;  4JI8 K;  4DR6 K;  3JAM O;  2UUB K;  2UUC K;  4DUZ K;  1HNX K;  2E5L K;  2HHH K;  4B3M K;  4JI5 K;  4DV6 K;  4LF5 K;  4LF4 K;  4DR4 K;  2UUA K;  4DV5 K;  4KHP K;  4LFA K;  4DR7 K;  5FLX O;  4CVN E;  3T1Y K;  4LF9 K;  3J7Y P;  5LL6 Z;  1J5E K;  5LMU K;  4DR2 K;  4JYA K;  3J7A P;  2UXC K;  4DR5 K;  4B3T K;  1I94 K;  2UXB K;  5BR8 K;  2UU9 K;  4JI1 K;  4X66 K;  4JV5 K;  3J81 O;  5AJ3 K;  4JI3 K;  4DV0 K;  4JI6 K;  4V19 S;  1IBL K;  4DV4 K;  4LF6 K;  4GKK K;  2UXD K;  1N36 K;  1XMQ K;  4DV7 K;  4JI4 K;  4DR3 K;  4JI0 K;  4CW7 B;  3T1H K;  1HR0 K;  1XNR K;  5A2Q O;  4YY3 K;  4JI7 K;  4YHH K;  5IT9 O;  2F4V K;  2VQE K;  4DR1 K;  1XNQ K;  1FJG K;  4B3R K;  2ZM6 K;  2VQF K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...