4LFCK

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lfcK00
4DR2K 2F4VK 4JV5K 4LF9K 3J81O 4GKJK 1XNRK 2UXDK 4YHHK 4NXNK 4GKKK 4LF8K 2UUBK 1I94K 1N33K 4X62K 4DV0K 4OX9K 5LMNK 4X64K 1IBMK 4KHPK 4JI2K 4DR1K 2UUAK 2UUCK 3T1YK 4V19S 4DR4K 4JI6K 4B3TK 1N34K 3JAMO 5LMUK 4DV1K 4B3RK 1XMQK 4JI7K 5IWAK 3J7YP 4DV3K 4DV2K 4DUYK 1N36K 1HNZK 1XNQK 4LF7K 1HNXK 3T1HK 4LFCK 4B3MK 4DR5K 4JI8K 4JYAK 4LF4K 3J7AP 4CVNE 4DR3K 2ZM6K 5AJ3K 5LL6Z 1J5EK 2UXBK 4X65K 4JI4K 4B3SK 1HR0K 4LFAK 2VQFK 1IBLK 4DR6K 4DR7K 4CW7B 4X66K 2UXCK 4LFBK 4JI3K 2UU9K 4LF6K 5BR8K 4DV4K 1IBKK 1HNWK 2E5LK 4JI1K 4AQYK 1XMOK 1N32K 4DV5K 5IT9O 4JI5K 3J80O 5FLXO 4NXMK 4DUZK 4LF5K 4K0KK 2HHHK 4DV7K 1FJGK 4DV6K 3OTOK 4YY3K 4JI0K 2VQEK 5A2QO
chains in the Genus database with same CATH superfamily
2YNHA 2X6SA 3AO2A 4O4GA 5AZIB 4YOXA 1RTHA 2E1ZA 4H5WA 4NLBA 3VEZA 4OKEA 3O9RA 3VEYA 3WEEB 3PLAA 3ATVA 3AVIA 4C8KA 4BRCA 5AQIA 3WQTA 1RCHA 4E7IA 4BRHA 4AHTA 1LW2A 1VSJA 3VGKA 5AQKA 2YHBA 3MEDA 1WSGA 1NGHA 2QWPA 3QBXA 1XQSC 3SQ0A 2UUCK 1QSSA 3A5NC 4HHTA 2P9LB 2V7ZA 4FLTA 3NH0A 3VEOA 5LMUK 4FK2A 3HOSA 3THXB 3KWIA 3HXMA 4YOUA 1JL2A 3I8BA 4K41A 4KHWA 3TAMA 4PQUA 1DEJA 3QNNA 5KRSA 3LP2A 4MDAA 2CGJA 5KGWA 3L6QA 1N8RO 3V9ZA 1ZXOA 4E7JA 3ZETB 1R59O 2CH6A 3THYB 2UXBK 4RCHA 4BC5A 1XWLA 5AQYA 3WXJA 3LL3A 3HPGA 1EQYA 4JS5A 5GAHP 5C25A 1YXQA 2AA4A 4CJQA 3PX6A 1QHTA 1JXEA 4M3RA 4C8NA 4JS4A 1KAXA 1N5YA 5KPTA 1UAXA 3BGRA 1VRTA 3F73A 2YHYA 3QEIA 1S1XA 4EFHA 3OYNA 4FLYA 4DV5K 1CZBA 3CYMA 3SUNA 1JLQA 4Z4GA 3OYIA 1U47A 1SQKA 5CR4A 2PZSA 3HM8A 5ADXA 2XO7A 3CHWA 2F9TA 1MU2A 1K8KA 4A59A 1Q7YO 3P5JA 3FFKB 1NU0A 3F9MA 1FKPA 4IDKA 1BUPA 1F21A 3ZT3A 3S3MA 1Q81O 5CE3A 3ENHA 2QM1A 3O08A 4DFKA 1T03A 3QFUA 4U7BA 4IG0A 3D2EA 2QWRA 4GW6A 1D9FA 4ISFA 1I3AA 2OPRA 3O3HA 2HNYA 2HHTA 4IFYA 1RBRA 3TTDA 2PFUA 1BGXT 3OS0A 3F9KA 4NCAA 4ILGB 4FPBA 4GNIA 4A5BA 2UUAK 4LC9B 5AQRA 2GTDA 1RDCA 3OS2A 3LANA 3O9UA 3FZFA 4HWIA 3BF1A 3WUHA 1DT9A 1ATSA 4AHUA 3PX4A 1IJJA 3HP9A 1IO2A 1G99A 4KB1A 3MXJA 4ISEA 1L5UA 3DRRA 1QVFM 3VQ5A 3RWUA 1BI4B 4H4OA 1M1KO 3KZBA 4DQQA 4DTXA 1IG8A 3E9LA 3L2VA 4B3SK 4BDYA 4HUFA 1HR0K 2OZSA 4M42A 4EAHD 4KHYA 2NRWA 3DLBA 1KSPA 3NF6A 1HYSA 5BR8K 4DV4K 4PKGA 2YV0X 2G8UA 1SL1A 3CMEN 4CJSA 4E1MA 2E8AA 4FW1A 4AQYK 4Y1DA 4EHTA 5AFUH 4FVMA 1XHXA 4WQ4C 5AQQA 4FZXC 1NK6A 1VHXA 3D0PA 1NJYA 3PSIA 3G25A 3OYBA 2O8CB 1NGEA 4FJ9A 4HTLA 3KIOA 5MLCQ 2CGKA 3PIOL 1OVYA 1WBDA 4DF8A 2OZMA 1BIZA 1RDUA 3SJHA 4CJRA 5A2QO 4FM2A 3MX5A 1VSKA 3UB5A 4E7KA 4FWQA 4KTZA 3T69A 1Q8IA 4JKAA 2G8KA 4IFEA 3V4IA 3GBTA 2DY4A 1BIUA 4JK9A 3A5MC 4FCYA 4OKKA 4IXCA 4B9MA 1GLFO 4FW2A 1VQNN 4BQLA 3UIQA 3AO3A 4IZ9A 3SAHA 2G8FA 2V51B 3WNGA 3CG7A 4NYNA 1KRPA 4CJKA 1S1VA 1C0FA 2FSNA 1NGAA 1X9SA 1RDWX 1VSFA 1W2BM 4CZGA 5HRNA 4YOYA 3M1FA 1BHLA 2WONA 4DR3K 4FJMA 2QKKA 4WCEL 5DK5A 1A5WA 3PX0A 3CJCA 3NAEA 5BN9A 1HKCA 4DHYA 3LZIA 3HSTB 1NJXA 4FM1A 2Q97A 4BG9A 2O8EA 4H03B 1Q82O 4DTJA 1L3UA 4H5NA 1VQMN 3VN5A 3SV4A 1GLAG 3A2FA 3C7NA 4BREA 3SPZA 3QO9A 1J5OA 1RDDA 5EVZA 4DFPA 3VF4A 4DG1A 1C0TA 1D4XA 3U8XA 3QEVA 2I7NA 3EYZA 3ULDA 2ZGZA 2HHHK 4YORA 4ZTJA 5F2RA 3OTOK 2G8WA 5J2MA 1VSLA 3AVBA 3BP8A 2QA4N 4BQZA 3EEQA 5J1EA 2HVIA 1Z6RA 5DM6L 2NZTA 3O1WA 4NB4A 3UKUA 3L0QA 4E19A 3KLHA 5GAGP 4KI6A 1TK8A 4CHPA 3THWA 4KB0A 3OJUA 4DQRA 1T3VA 3NH2A 1MA9B 3QEPA 2P9IA 3WXLA 4DKWA 4DLEA 3LDNA 2P51A 3LAKA 5FPEA 3BDPA 4M3UA 3AVMA 4NCBA 1RBUA 3IAYA 1HYZA 3L2QA 5AZIA 4JKEA 3ZLJA 4CEZA 3NVKA 3C65A 4Z4FA 3SUQA 4WQ5A 1EO1A 3RR8A 4CJEA 1TKXA 4DR4K 4DB3A 3MXIA 3VQ4A 3WEEA 3WXIA 1Q18A 1YJWN 2HHQA 4YFUA 5AQTA 2PYJA 4CGGA 2DTUA 2VGNA 2Z1GA 3R9PA 1KTQA 3C94A 1NK0A 4B1UB 4DU3A 2OPPA 2NLXA 4IJNA 1DGKN 4BRPA 3L8BA 1QZ6A 2P9LA 1HPMA 5LL6Z 3K2PA 3AVAA 4O5FA 3MWPA 3VQ9A 2KZMA 4F3OA 3TTFA 4DTRA 4CEBA 3THXA 1L3SA 2VQFK 3DXMB 4O5BA 3CFPA 3CCVN 3ASMA 5SWMA 1JL1A 4X66K 2UXCK 2BGGA 4B1ZA 2WUSA 2RKIA 2FF3B 1BDGA 3VGLA 2EHGA 4NO7A 3NDKA 2I5JA 3BZCA 4IFVA 3OW2M 4O8KA 3MN9A 3SBTA 3ZETA 1EETA 3THYA 4RW7A 1C0GA 3W0LA 2GBZA 1BO5O 4CZKA 1MWMA 1FK9A 1NGDA 3LDPA 5C0YA 3ATUA 4JI5K 1QHAA 1ZYQA 4LF5K 4DFJA 4RW4A 1VQLN 1HPZA 1FJGK 4DV6K 2GUPA 1U4BA 1YTAA 3M3ZA 3ZSOA 5KI6A 4EP4A 3QETA 3CERA 4B3OA 4OPKA 1CZ9A 1TUUA 1SL0A 4FJ5A 4K42A 3QERA 3OVNA 2OPQA 4B1VA 4JKHA 4H4MA 1TK5A 4GKKK 4CEEA 4CFCA 4DSLA 4E1JA 2P5OA 3DLLL 1BL3A 1BA1A 4FJLA 5KPZA 2QXFA 2JWKA 2Z1HA 3AO5A 3I56N 2VWJA 3VQDA 4O0IA 3V9UA 3KKRA 3ZT2A 1C0UA 3KD1E 1NBWA 4F2RA 4BVOA 3KK2A 3HI0A 2DFFA 4JK8A 2E20A 3P38A 3MDQA 2ZGYA 3ID6A 1VSMA 4DSEA 1ITGA 4WYBA 4XEIA 4I9LA 2OYQA 4ICLA 4HUEA 3E66A 1TAUA 4YDUA 2Y1IA 1RT6A 4LSLA 1NGFA 3A5LC 3SMPA 5JLFA 3MK6A 4CD1A 4FJHA 3V9SA 3SAFA 5AQGA 1TAQA 2NRRA 3NGZA 2JWLA 1HRHA 4HVJA 5HRRA 3AA3A 1S6PA 3EZWA 3HVTA 1WSEA 4GV6A 2QWMA 1BI4A 3VEXA 1S72N 1S5JA 5FDLA 4DTOA 1QSYA 1RTIA 3TSQA 5AQSA 4GV9A 4QS7A 4RW9A 1XUPO 3OYGA 4W5OA 4I9QA 4DS4A 2QTDA 4H5TA 2B4JA 3SJJA 3U9DA 1NGIA 2FBVA 4QS9A 5C2FA 3KD5E 2P9KA 1CZAN 1SAZA 1EWQA 4PL8A 1NK4A 1IKYA 4DSKA 4CJ3A 3K59A 5FPMA 1NLVA 1JLEA 5LJVA 2RHKA 1UA1A 1ZBLA 1D8YA 3NVMA 4BRLA 2KFZA 2H3GX 3J8AA 4M41A 1JLCA 4K43A 1NK9A 4CIFA 3ZSWA 2A1SA 5C42A 1YT3A 4Z4HA 5C12A 1KLNA 4FVUA 1C6VA 4OGCA 2YX6A 4HTUA 4CD3A 5AQHA 3OYEA 2ZJQL 4DS5A 2RN2A 2P9NB 2ETJA 3EKSA 4B3TK 4CGIA 1K73O 2E2NA 3UE5A 4WFNL 3PUFA 1GLCG 5AZJB 3OBWA 3LDQA 3EL2A 3QMLA 3QICA 2QKBA 2XY6A 4PL7A 2NRTA 5M1NA 3VQEA 1T8EA 4JI8K 4JYAK 3VERA 2ZWHA 3AGRA 3E9OA 4JD2A 3PO5A 2X74A 3QB0A 3CCQN 1S1WA 4FPAA 3O9TA 5D3GA 3VTHA 5FPNA 3ZSQA 3P39A 1R0AA 3CCRN 4JI4K 3CCUN 4BE1A 3AGKA 3R6MA 3ZX3A 3TU5A 1MDUB 3ENOA 1YHQN 4WQ5C 4IOXA 1C1AA 4LF6K 4B1XB 3B6PA 3IKMA 2P5GA 3E9PA 4Y1CA 4DTPA 2HW3A 2W40A 4B8AB 2GUIA 3D6RA 3DRSA 4IOCL 4B9LA 1XMOK 1P8ZA 1GOBA 4CHYA 4JNEA 4F3TA 3DI6A 3O3FA 5EY4A 4QOZB 3BEXA 3A8YA 2HHVA 2G8HA 4FWKA 4GVEA 3K57A 5FLXO 4DF4A 1HJRA 3ZSZA 4MO5A 4MFBA 5SZTA 3U3YA 3M8QA 3OBYA 2O8BB 4R5PA 1JLBA 4FJXA 3HL8A 2CH5A 3LP0A 4CBWA 4IOAL 5LY3A 3QNOA 2A41A 3LWMA 4GKJK 4DMNA 2F8TA 3QINA 3O8MA 4BR2A 3VQPA 1HX1A 4CBXA 4C1NK 1Q9YA 4CZEA 1RT3A 4FZZA 3NCIA 2F7TA 3JSMA 4Z4CA 4KTWA 3SUOA 3CM6A 4PWDA 1J9AA 4KV8A 5C24A 1DTTA 1JLAA 4JK7A 2A42A 4DSFA 5K14A 1KAYA 4HUGA 4F9OA 2G8IA 2EX3A 1TL3A 1ZC6A 3SPYA 4BC2A 2HHUA 4OPAA 1WNSA 2VWKA 3LM9A 3PV8A 1N36K 1WUAA 4FWNA 3U9ZA 4KHSA 3EE8A 3G4SN 4IEEA 4CJ5A 3K5NA 3CFRA 4BROA 1X3NA 3C95A 1ZBUA 3CQ8A 3S9HA 4BACA 4CF9A 4R79A 3V1RA 2FBYA 1JLGA 3DXKB 4I6MA 3P83D 5C10A 1VSEA 4CZLA 3OYAA 3H3OB 2JGUA 4WFBL 3AVCA 3K9KA 1LV5A 4M45A 4A5AA 4EZ6A 3K5LA 2DFEA 3CJBA 1JXBA 3FR0A 1EWRA 1YVNA 3TWHA 4AF1A 3LPUA 2E88A 4LSNA 1BA0A 4BE0A 4GY2B 2D1KA 2D0BA 4CCHA 3FLCO 1J54A 4BVPA 3K0SA 1WAJA 1RTDA 4W5QA 2A3ZA 3SLCA 1BISA 3MWTA 5CHIA 1IG9A 3DXMA 1TL1A 3EZ5A 3BY5A 3VQAA 4CECA 2RPIA 2P9UA 2IC3A 3J80O 3H3NO 4YDUC 4E7LA 3CJ1A 4DSJA 2D0CA 4K0KK 5CZ2A 2KKZA 1NJZA 1W97L 1GLBG 2IVOA 4A61A 2HBMA 1OH6A 3WNEA 4QS8A 2OTLN 4FYDA 4MLHA 3WQUA 3I0SA 4JV5K 3VMFB 1VQ4N 3ITHA 3MCPA 1GLJO 2IVNA 5TKYA 4QCLA 4LD0A 3Q7CA 4BGAA 4J8FA 3AA5X 4CJLA 3TAGA 5AQUA 2UUBK 4KH4A 4PA1A 1I94K 3OHRA 4KH6A 2Z1JA 1BQNA 2IAJA 3LM2A 4IBNA 2BH1A 4PKHA 4JHDB 1NMNA 2OCEA 1IKVA 4PKIA 2Q31A 3RRHA 3ZYYX 3V6DA 3HVRA 2KW4A 4CZFA 4KHPK 3VEWA 4FLWA 4CEQA 2HVHA 3JXUA 1ATNA 3T1YK 5C15A 4AM7A 1VQ9N 3TSUA 5J2QA 2F9WA 4BRKA 3HRGA 1TKTA 1IH7A 3ALYA 5M1KA 1RDBA 4KREA 1JCEA 4JI7K 4FJ7A 2ITMA 1BG3A 1S9EA 2P1JA 4JLHA 3FZKA 3O5BA 3V1QA 2HF4A 3CQXA 2WC9A 3VGMA 4CGFA 5BR9A 4CK1A 2OPSA 1L3TA 4FWPA 4OVLA 3S41A 4B9QA 3RMDA 4A2AA 4IEIA 2KZZA 4PY5A 1S22A 1IBLK 4DR6K 2FBXA 5C2DA 4KH5A 2E2PA 4JN4A 1P90A 3KHYA 1U48A 4ID5A 1QQMA 1QSLA 4GMJB 2P9SA 2A5XA 3CPEA 5CYQA 2QK9A 4Z0UA 3CMAN 3CCSN 1HYVA 3H45C 4CGJA 4CF0A 4CJVA 2O8FB 2Q2RA 5JLHA 4DTNA 1NGCA 1WLJA 3BF3A 4B9NA 5JS1A 1HNVA 4IKFA 1JKHA 4WFAL 1RILA 4M7XA 1DKGD 2HBJA 5AQVA 4XH5A 5GIPA 3L2RA 1VAZA 2IGIA 2ZE2A 5EX5A 4H0XB 3L3UA 5BPLA 3CETA 2FSJA 5KGXA 3DYAA 4N41A 1KC8O 3THVA 4W5NA 1J53A 2D0AA 4CJPA 5CY4A 4CHZA 4CHQA 5I3UA 4AHSA 4YOTA 1NGBA 2Q36A 3D2FB 4FWSA 4ILHA 4LF8K 5HOOA 1N33K 4DTSA 1KQSM 3K5OA 3RSEB 4AH9A 1K9MO 4DQPA 5KRTA 3UKRA 2NUBA 3MEEA 2ZJRL 2HBLA 4DR1K 5AQFA 5JMVA 2KLAA 3D7EO 1QE1A 5AQJA 1FKOA 3OY9A 1T7PA 1HKBA 4DV1K 2E2OA 1U2VB 1VRUA 3NH1A 5E84A 2O4IA 4FK0A 3LZJA 1S1TA 2ZF5O 5ADXH 4LF7K 1X9MA 4KKOA 4DR5K 1S3XA 3LALA 1TYQB 4CFBA 3MMVA 3T19A 2P9NA 4J2AA 3F5TA 1RBSA 4C8LA 3FGUA 1G15A 3ZT0A 1EP4A 5AZJA 4ZHRA 2D0PA 1S1UA 3TABA 1K6YA 2YHAA 4L3QA 1TKDA 1E4GT 3MEGA 5KTQA 4CE9A 1NGJA 4G1QA 5AQOA 3ZSVA 1LOTB 3OYJA 4KHNA 1LAVA 4BG8A 4ELTA 1N32K 2XY5A 5GAEP 3G71N 1D9DA 4B9SA 1ZBHA 1NK7A 1ILYA 1KVCA 2NRVA 2HOEA 3MCAB 3SK3A 3VQQA 2ATQA 4DV7K 3DLHA 3HPOA 3S3OA 5KPRA 1NOZA 2HB5A 4FLXA 3V9WA 1N6QA 2BANA 4JI0K 1ASUA 4FLUA 1VQ6N 1WB9A 3PO4A 2WBNA 2VGMA 1SKWA 2I7PA 4IDHA 3VOVA 1YTUA 4NXNK 2D0OA 1LWCA 3AVLA 3MN5A 5GINA 3SNNA 3CJ7A 4CBUA 2O8BA 1OH5A 4XH1A 2IDOA 3AV9A 2UYTA 4ILJA 3JS6A 3LAMA 5E41A 3ZEUB 3U6FA 1VQ7N 3CJ9A 3VTIA 1OH8A 1TVRA 4H0PA 3QEXA 4BRDA 3L2WA 2GWJA 3DOKA 2VWBA 3E01A 3SCXA 1KFSA 1T6CA 1HQUA 1XMQK 4Z4EA 5FPDA 4DV2K 3AVGA 1HLUA 1QZ5A 3FZLA 3KJVA 1VSIA 3EE9A 3M5RA 4E7HA 2QWNA 4PUOA 3LDLA 4CVNE 4WE1A 1B9FA 4TSXA 3H08A 2FC0A 2VG6A 2YKNA 4K8XA 3C6AA 1QQCA 3MECA 4ZTFA 1S9GA 2DPNA 5AQXA 2E4LA 2YKMA 1TV6A 4CJFA 1K8AO 4EZ9A 1ESVA 4OO1J 3VEVA 4B1WB 3NFAA 5BRDA 5HP1A 4YOWA 1RT5A 3DXKA 5JICA 4JI1K 1X9JA 2YHXA 2Q0UA 1BWFO 3EO3A 3GOIA 4JAXA 2NRHA 4A57A 3GG4A 3C6HA 1KXPA 4CEOA 1NJIO 4CHOA 3RVCA 3H46O 3I33A 3TSPA 3CM5A 4BWMA 3MN6A 1I39A 3EKUA 4M3TA 4DCHA 1JCFA 5BN8A 5AQWA 3K58A 1KAZA 1Z05A 1HUXA 3KKSA 2QWQA 4OGEA 1KVBA 4CJ4A 4W5TA 1KD1O 4DQIA 1HKGA 4LF9K 1WN7A 4OKJA 5DMRA 4A62A 2GELA 1Y97A 4BR5A 4FWOA 3NMUA 2Y1JA 3AA4A 1LW0A 4B9TA 4L8RB 1C1BA 1BCOA 4AHVA 3IDHA 1SZ2A 3QBWA 1D5AA 1HMVA 3I55N 4AILC 1E4FT 4N76A 5DM7L 4DV0K 1LWEA 1IBMK 2W42A 3HSCA 4MO4A 5AFUA 2FBTA 1HJOA 3VQCA 4KBOA 1RGIA 4AM6A 3ZX0A 4KAZA 3QFPA 2A6AA 4BGBA 3OYCA 1SV5A 4B9VA 4B3RK 3M8RA 2O8CA 2XY7A 4O8UA 4DV3K 4FWLA 4JHDA 4AHCA 3WXMB 2V7YA 1OVQA 3VQ8A 1HNZK 4BDZA 1HNXK 3O4QA 3T1HK 2HBKA 5AQZA 4N5SA 1NGGA 4C8OA 1V4SA 4RTFD 4UQGA 3J7AP 3GDQA 5JVHL 4WF9L 4FJ8A 2PYLA 3VA3A 3TTCA 3CCMN 3I0RA 2KTQA 4DTUA 4FJGA 4CW7B 4RWTA 4LFBK 4BRNA 1S6QA 4OLBA 3HTVA 4OPHA 3IG1A 3AO1A 2ASPA 2HNZA 3WNHA 3V1OA 2E6MA 3E1YA 2XRIA 3ZSXA 4B8CA 5EOYA 1XHZA 4FOEA 3VQBA 1XI1A 3AARA 3AVKA 5E26A 2QEXN 5F0XA 4CJUA 1KVAA 1NWKA 1VSDA 3LDOA 3B8AX 3NHGA 2FF6A 1QTMA 3V81A 4C1NI 1C0MA 4J2EA 3B6OA 1YAGA 3Q7BA 3NF9A 3MXMA 5CYMA 3H6EA 3GL1A 1CLQA 3ID8A 5AQPA 1JLFA 3LDSA 3G0ZA 2O8FA 4LH5A 2VG7A 4J2DA 1W0HA 3RRGA 4OJRA 1XNRK 1WAFA 2DFHA 1NJWA 1VQPN 2X6NA 5HLFA 4F4KA 5BPMA 2B6AA 1Q86O 1SUQA 5I42A 1VQKN 4YOVA 4G9ZA 3FZHA 4RG8A 3VQ6A 3VESA 2YCHA 3IRXA 4X62K 3O80A 4CIEA 3DWLA 4I2PA 4X64K 4JI2K 1Y64A 3D2FA 2VYPA 4JI6K 4BY9C 4RW6A 3K9JA 2GEMA 3TR8A 4DUYK 4FWRA 2O4GA 3RSEA 4W5RA 2AP1A 3C6UA 4H5VA 4LF4K 3DM2A 2QW9A 4DFMA 1QQNA 1CXQA 2CGLA 3RMBA 2LSNA 3N4QA 1U2VA 4X65K 4Z4IA 5HRSA 3P1GA 4BWJA 2HHWA 3TAFA 3BZKA 3I8DA 4I2QA 5JS2A 4UY8O 1TYQA 1MWKA 4EIAA 3CD6N 3MAQA 1YJ9N 4N47A 3CXCM 3PIPL 2OA8A 1RNHA 2P9PB 4BC3A 2ZD1A 4CGHA 5EU7A 4CEAA 2F96A 4BRFA 3SUPA 2YJFA 5IT9O 4FLZA 1HNIA 1NM1A 3L4QA 4DUZK 3QLHA 4EHUA 2X78A 3SMSA 3R8EA 2WTUA 1JCGA 1A5XA 3M6GA 4CZMA 4FL9A 3A0IX 3HP6A 5I9EB 3KLFA 4EP5A 1UA0A 5HBMA 3CJAA 3TPQA 2RE2A 2IIRA 1SKSA 3J81O 2GWKA 3VF2A 2UXDK 2VG5A 4RW8A 1T44A 4ISGA 5F1XA 3HM9A 4PHTX 3EY1A 4CZHA 3NF7A 4CF1A 3K5MA 2KFNA 2W6LA 3M8SA 3SBGA 2ZJPL 2G8VA 2Q1NA 1BOTO 4BRMA 3NF8A 4OX9K 1B9DA 3ULEB 3VQ7A 3AVHA 2E2QA 4YNQA 1YVUA 4N56A 4H8KA 1WSIA 2B5JA 5LJWA 1N34K 3JAMO 5FRNA 5IWAK 3CPWM 2O8DB 2P9KB 4M7YA 3ZEUA 2BTFA 4IJAA 5JVGL 1U6ZA 4JEPA 4AHRA 2QWOA 3IMXA 4JKGB 1YF5L 1TKZA 1RBTA 1REVA 4CFAA 4FOIA 5FRMA 3QIOA 3CC4N 4NYFA 3AAQA 4KO0A 3OYFA 4DQ8A 1NMDA 4LFAK 4CGDA 3SAGA 4DLGA 3SV3A 4CF8A 5EXWA 5BREA 1NG9A 4JI3K 3LWLA 3O9QA 5M1PA 1IBKK 2Z1IA 3VF6A 3DLEA 1TUYA 4K8ZA 4KHUA 2A1RA 4FXDA 1GOCA 4KFBA 2E5LK 4OPJA 4IO9L 3FE1A 5B8HA 4CK2A 1KLMA 2YNFA 4KI4A 5AQLA 5FROA 4XH4A 2WOMA 4NXMK 4MLEA 3HPHA 3D45A 1NK5A 4BDPA 5M1QA 5J2PA 3CCEN 4DQSA 3M8PA 3O4WA 4NCGA 4H5RA 1RT4A 4C23A 2BDPA 2Q0RA 5ELZA 1VQ8N 2VQEK 3KK7A 3F2KA 4JD2B 1SL2A 1Z25A 4DU1A 1WBBA 4H0YB 1OKJA 1QQOA 4QAGA 3KLGA 3CCLN 5GADP 4M3YA 3U4LA 4KTQA 1RTJA 4FLVA 3DLRA 4CEFA 2XY8A 1YUWA 2WFBA 1EXQA 3TI0A 3FFIA 4I7FA 1NNEA 4O44A 1A5VA 3DOLA 5AQMA 3ZT1A 1TK0A 5LMNK 2E6LA 4E3SA 1YJNN 4DSIA 4H0OA 3RMAA 4ID1A 4FJIA 2PBDA 4LY7A 1ZBIA 1GLEG 4Y0WA 4JKBA 3DJCA 3DMJA 1UWBA 5M1OA 3T3FA 2KQ2A 2W41A 3KTQA 1Z26A 3L2UA 3OA9A 1DLOA 3HOTA 1KFDA 1ASWA 4LFCK 3KK3A 3QEWA 2RF2A 1B92A 3OYHA 3AVNA 3CCJN 3AY9A 1X1PA 3OYLA 4NLCA 2ITGA 3OS1A 1TGOA 2ASMA 2W6KA 3AVJA 3TARA 1J5EK 2HF3A 3OYMA 4CESA 4FJNA 2FXUA 1BCMA 3KLIA 2OTJN 3SQ1A 1EKEA 1L3VA 4C8MA 3WNFA 3W3DA 2YHWA 3SZ2A 1GOAA 4CFDA 3V9XA 1U45A 3R1XA 2ZQBA 4JKFA 4FJJA 2IOCA 1K8KB 1WSJA 4IO8A 4M3XA 3T1AA 4BRAA 2D4WA 2YJEA 2A40A 1ZBFA 4Q0BA 3T7ZA 1BU6O 3HZ6A 1M90O 2PY5A 4Q5VA 3QDKA 4IG3A 4FJKA 1FW6A 1RFQA 4DTMA 4CHNA 3OYDA 4M3ZA 3CC7N 3D2EB 2HHXA 1O13A 3PSFA 3ENBA 3TAQA 2HNDA 4YY3K 3L4IA 1VK0A 4FSVA 3NGIA 3TANA 2AJQA 4JRPA 1QVGM 4DR2K 3A5OC 2F4VK 2J4RA 2E1YA 2YNIA 1LAWA 3DAWA 4LH4A 1ASVA 4Z94A 3OJSA 1NOYA 4I6MB 2JLEA 1YIJN 1ZBSA 3KLEA 1YI2N 4FO0A 1GLLO 4JKCA 1WSFA 3CI5A 5KQ8A 5AQNA 4BR4A 2R7YA 3KVGA 1RBVA 3IFRA 4DWIA 3O4NA 3EN9A 3VPZA 4B9UA 3HYFA 3DRPA 4OLAA 4CIGA 1X9WA 4GVMA 2NRZA 4KRFA 1OH7A 5T7BA 4IWVA 4V19S 3NE6A 4J2BA 2D5RA 1UOCA 1XC3A 3J7YP 5TKWA 2QWLA 1IV0A 4CERA 2P9UB 2VCPA 4FZYA 1XNQK 4FWMA 2FLOA 4MQ3A 4B3MK 4BR0A 3C0BA 3H1QA 1SKRA 4H0VB 3O6WA 4JKDA 3CFOA 4CJTA 1LCUA 3ZSRA 1U49A 5GIOA 3RMCA 1NK8A 4XIUA 1GLDG 4ELVA 3LP3A 4DR7K 1WSHA 4B1YB 2YI1A 3SYZA 2UU9K 3G10A 2V52B 1E3MA 3J7ZO 1WOQA 1JJ2M 3IS9A 4CZJA 3VA0A 4BC4A 3ZCMA 3P4IA 2FSKA 3WXKA 1HNWK 3MN7A 3ZT4A 3C6TA 3LP1A 4H0TB 1HQEA 3OYKA 4MDBA 3HO1A 1VQON 2HMPA 3VENA 1QS4A 1VQ5N 4E0DA 1H1VA 2IS3A 1BQMA 2P9PA 4FK4A 4O55A 5HL7L 5AR0A 3L3VA 2NRXA 5HRPA 4BE2A 1ATRA 2YNGA 4BRGA 4DU4A 4HCCA 3CQYA 4K25A 3IUCA 5M1FA 2QI2A 4YHHK 1IKXA 3O9SA 4KPYA 2XHBA 2PAVA 3QIPA 2GV9A 3G6EN 5BRHA 5H1SQ 4CEDA 1FXXA 2NNWA 3U3GA 1Q9XA 3GE1A 3SQ4A 4CJ7A 3PY8A 1NKBA 3SQ2A 3RTVA 3AAPA 3VETA 1CXUA 3CIPA 4ELUA 4M63C 2P9SB 1X3MA 3HT3A 1W7AA 2OANA 3DLKA 1KCFA 1RT7A 2EWSA 4BRIA 1V4TA 5HROA 4KHQA 3HK2A 3DLGA 3ISNC 2BE2A 4WQ4A 4CF2A 1RT2A 3CF5L 3CC2N 3TAPA 3ULEA 4E1NA 4BRQA 4HCBA 1LWFA 1U04A 1SS6A 2ZM6K 2O8EB 2HHSA 4E89A 5AJ3K 3SI6A 3R3LA 1VSHA 3ZX2A 4GV3A 5CZ1A 1C1CA 2Q3SA 4CJWA 3H1VX 3C7NB 2O8DA 1DTQA 3N4PA 5BRFA 2BUPA 4CK3A 1NKCA 1T05A 4F8RA 3HJFA 3KWGA 1YITN 3AO4A 4O0JA 4JRQA 3JYTA 4M3WA 3TAEA 1O1WA 2KHOA 5KQDA 2F8SA 4JKGA 1NKEA 2ASOA 2QXLA 3MX2A 5J2NA 1IKWA 3QESA 1W9HA 2HSTA 3BUZB 4CZIA 3LPTA 4BR9A 3AVFA 3HBTA 1RT1A 3KK1A 3UKRB 3P31A 2GX9A 1J6ZA 3O1BA 3UKUB 2IVPA 4B08A 4FM0A 4A2BA 5BPNA 1XC9A 1T6DA 1EX4A 3THWB 3AA2A 4BR7A 3NBPA 3WT0A 3O3GA 3NGYA 3S3NA 4U67L 1RDAA 3RR7A 2P9IB 3ZSYA 4F2SA 4CI6A 3FZMA 2HMIA
chains in the Genus database with same CATH topology
4DR2K 2F4VK 4JV5K 4LF9K 3J81O 4GKJK 1XNRK 2UXDK 4YHHK 4NXNK 4GKKK 4LF8K 2UUBK 1I94K 1N33K 4X62K 4DV0K 4OX9K 5LMNK 4X64K 1IBMK 4KHPK 4JI2K 4DR1K 2UUAK 2UUCK 3T1YK 4V19S 4DR4K 4JI6K 4B3TK 1N34K 3JAMO 5LMUK 4DV1K 4B3RK 1XMQK 4JI7K 5IWAK 3J7YP 4DV3K 4DV2K 4DUYK 1N36K 1HNZK 1XNQK 4LF7K 1HNXK 3T1HK 4LFCK 4B3MK 4DR5K 4JI8K 4JYAK 4LF4K 3J7AP 4CVNE 4DR3K 2ZM6K 5AJ3K 5LL6Z 1J5EK 2UXBK 4X65K 4JI4K 4B3SK 1HR0K 4LFAK 2VQFK 1IBLK 4DR6K 4DR7K 4CW7B 4X66K 2UXCK 4LFBK 4JI3K 2UU9K 4LF6K 5BR8K 4DV4K 1IBKK 1HNWK 2E5LK 4JI1K 4AQYK 1XMOK 1N32K 4DV5K 5IT9O 4JI5K 3J80O 5FLXO 4NXMK 4DUZK 4LF5K 4K0KK 2HHHK 4DV7K 1FJGK 4DV6K 3OTOK 4YY3K 4JI0K 2VQEK 5A2QO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 K;  2F4V K;  4JV5 K;  4LF9 K;  3J81 O;  4GKJ K;  1XNR K;  2UXD K;  4YHH K;  4NXN K;  4GKK K;  4LF8 K;  2UUB K;  1I94 K;  1N33 K;  4X62 K;  4DV0 K;  4OX9 K;  5LMN K;  4X64 K;  1IBM K;  4KHP K;  4JI2 K;  4DR1 K;  2UUA K;  2UUC K;  3T1Y K;  4V19 S;  4DR4 K;  4JI6 K;  4B3T K;  1N34 K;  3JAM O;  5LMU K;  4DV1 K;  4B3R K;  1XMQ K;  4JI7 K;  5IWA K;  3J7Y P;  4DV3 K;  4DV2 K;  4DUY K;  1N36 K;  1HNZ K;  1XNQ K;  4LF7 K;  1HNX K;  3T1H K;  4LFC K;  4B3M K;  4DR5 K;  4JI8 K;  4JYA K;  4LF4 K;  3J7A P;  4CVN E;  4DR3 K;  2ZM6 K;  5AJ3 K;  5LL6 Z;  1J5E K;  2UXB K;  4X65 K;  4JI4 K;  4B3S K;  1HR0 K;  4LFA K;  2VQF K;  1IBL K;  4DR6 K;  4DR7 K;  4CW7 B;  4X66 K;  2UXC K;  4LFB K;  4JI3 K;  2UU9 K;  4LF6 K;  5BR8 K;  4DV4 K;  1IBK K;  1HNW K;  2E5L K;  4JI1 K;  4AQY K;  1XMO K;  1N32 K;  4DV5 K;  5IT9 O;  4JI5 K;  3J80 O;  5FLX O;  4NXM K;  4DUZ K;  4LF5 K;  4K0K K;  2HHH K;  4DV7 K;  1FJG K;  4DV6 K;  3OTO K;  4YY3 K;  4JI0 K;  2VQE K;  5A2Q O; 
#chains in the Genus database with same CATH topology
 2YNH A;  2X6S A;  3AO2 A;  4O4G A;  5AZI B;  4YOX A;  1RTH A;  2E1Z A;  4H5W A;  4NLB A;  3VEZ A;  4OKE A;  3O9R A;  3VEY A;  3WEE B;  3PLA A;  3ATV A;  3AVI A;  4C8K A;  4BRC A;  5AQI A;  3WQT A;  1RCH A;  4E7I A;  4BRH A;  4AHT A;  1LW2 A;  1VSJ A;  3VGK A;  5AQK A;  2YHB A;  3MED A;  1WSG A;  1NGH A;  2QWP A;  3QBX A;  1XQS C;  3SQ0 A;  2UUC K;  1QSS A;  3A5N C;  4HHT A;  2P9L B;  2V7Z A;  4FLT A;  3NH0 A;  3VEO A;  5LMU K;  4FK2 A;  3HOS A;  3THX B;  3KWI A;  3HXM A;  4YOU A;  1JL2 A;  3I8B A;  4K41 A;  4KHW A;  3TAM A;  4PQU A;  1DEJ A;  3QNN A;  5KRS A;  3LP2 A;  4MDA A;  2CGJ A;  5KGW A;  3L6Q A;  1N8R O;  3V9Z A;  1ZXO A;  4E7J A;  3ZET B;  1R59 O;  2CH6 A;  3THY B;  2UXB K;  4RCH A;  4BC5 A;  1XWL A;  5AQY A;  3WXJ A;  3LL3 A;  3HPG A;  1EQY A;  4JS5 A;  5GAH P;  5C25 A;  1YXQ A;  2AA4 A;  4CJQ A;  3PX6 A;  1QHT A;  1JXE A;  4M3R A;  4C8N A;  4JS4 A;  1KAX A;  1N5Y A;  5KPT A;  1UAX A;  3BGR A;  1VRT A;  3F73 A;  2YHY A;  3QEI A;  1S1X A;  4EFH A;  3OYN A;  4FLY A;  4DV5 K;  1CZB A;  3CYM A;  3SUN A;  1JLQ A;  4Z4G A;  3OYI A;  1U47 A;  1SQK A;  5CR4 A;  2PZS A;  3HM8 A;  5ADX A;  2XO7 A;  3CHW A;  2F9T A;  1MU2 A;  1K8K A;  4A59 A;  1Q7Y O;  3P5J A;  3FFK B;  1NU0 A;  3F9M A;  1FKP A;  4IDK A;  1BUP A;  1F21 A;  3ZT3 A;  3S3M A;  1Q81 O;  5CE3 A;  3ENH A;  2QM1 A;  3O08 A;  4DFK A;  1T03 A;  3QFU A;  4U7B A;  4IG0 A;  3D2E A;  2QWR A;  4GW6 A;  1D9F A;  4ISF A;  1I3A A;  2OPR A;  3O3H A;  2HNY A;  2HHT A;  4IFY A;  1RBR A;  3TTD A;  2PFU A;  1BGX T;  3OS0 A;  3F9K A;  4NCA A;  4ILG B;  4FPB A;  4GNI A;  4A5B A;  2UUA K;  4LC9 B;  5AQR A;  2GTD A;  1RDC A;  3OS2 A;  3LAN A;  3O9U A;  3FZF A;  4HWI A;  3BF1 A;  3WUH A;  1DT9 A;  1ATS A;  4AHU A;  3PX4 A;  1IJJ A;  3HP9 A;  1IO2 A;  1G99 A;  4KB1 A;  3MXJ A;  4ISE A;  1L5U A;  3DRR A;  1QVF M;  3VQ5 A;  3RWU A;  1BI4 B;  4H4O A;  1M1K O;  3KZB A;  4DQQ A;  4DTX A;  1IG8 A;  3E9L A;  3L2V A;  4B3S K;  4BDY A;  4HUF A;  1HR0 K;  2OZS A;  4M42 A;  4EAH D;  4KHY A;  2NRW A;  3DLB A;  1KSP A;  3NF6 A;  1HYS A;  5BR8 K;  4DV4 K;  4PKG A;  2YV0 X;  2G8U A;  1SL1 A;  3CME N;  4CJS A;  4E1M A;  2E8A A;  4FW1 A;  4AQY K;  4Y1D A;  4EHT A;  5AFU H;  4FVM A;  1XHX A;  4WQ4 C;  5AQQ A;  4FZX C;  1NK6 A;  1VHX A;  3D0P A;  1NJY A;  3PSI A;  3G25 A;  3OYB A;  2O8C B;  1NGE A;  4FJ9 A;  4HTL A;  3KIO A;  5MLC Q;  2CGK A;  3PIO L;  1OVY A;  1WBD A;  4DF8 A;  2OZM A;  1BIZ A;  1RDU A;  3SJH A;  4CJR A;  5A2Q O;  4FM2 A;  3MX5 A;  1VSK A;  3UB5 A;  4E7K A;  4FWQ A;  4KTZ A;  3T69 A;  1Q8I A;  4JKA A;  2G8K A;  4IFE A;  3V4I A;  3GBT A;  2DY4 A;  1BIU A;  4JK9 A;  3A5M C;  4FCY A;  4OKK A;  4IXC A;  4B9M A;  1GLF O;  4FW2 A;  1VQN N;  4BQL A;  3UIQ A;  3AO3 A;  4IZ9 A;  3SAH A;  2G8F A;  2V51 B;  3WNG A;  3CG7 A;  4NYN A;  1KRP A;  4CJK A;  1S1V A;  1C0F A;  2FSN A;  1NGA A;  1X9S A;  1RDW X;  1VSF A;  1W2B M;  4CZG A;  5HRN A;  4YOY A;  3M1F A;  1BHL A;  2WON A;  4DR3 K;  4FJM A;  2QKK A;  4WCE L;  5DK5 A;  1A5W A;  3PX0 A;  3CJC A;  3NAE A;  5BN9 A;  1HKC A;  4DHY A;  3LZI A;  3HST B;  1NJX A;  4FM1 A;  2Q97 A;  4BG9 A;  2O8E A;  4H03 B;  1Q82 O;  4DTJ A;  1L3U A;  4H5N A;  1VQM N;  3VN5 A;  3SV4 A;  1GLA G;  3A2F A;  3C7N A;  4BRE A;  3SPZ A;  3QO9 A;  1J5O A;  1RDD A;  5EVZ A;  4DFP A;  3VF4 A;  4DG1 A;  1C0T A;  1D4X A;  3U8X A;  3QEV A;  2I7N A;  3EYZ A;  3ULD A;  2ZGZ A;  2HHH K;  4YOR A;  4ZTJ A;  5F2R A;  3OTO K;  2G8W A;  5J2M A;  1VSL A;  3AVB A;  3BP8 A;  2QA4 N;  4BQZ A;  3EEQ A;  5J1E A;  2HVI A;  1Z6R A;  5DM6 L;  2NZT A;  3O1W A;  4NB4 A;  3UKU A;  3L0Q A;  4E19 A;  3KLH A;  5GAG P;  4KI6 A;  1TK8 A;  4CHP A;  3THW A;  4KB0 A;  3OJU A;  4DQR A;  1T3V A;  3NH2 A;  1MA9 B;  3QEP A;  2P9I A;  3WXL A;  4DKW A;  4DLE A;  3LDN A;  2P51 A;  3LAK A;  5FPE A;  3BDP A;  4M3U A;  3AVM A;  4NCB A;  1RBU A;  3IAY A;  1HYZ A;  3L2Q A;  5AZI A;  4JKE A;  3ZLJ A;  4CEZ A;  3NVK A;  3C65 A;  4Z4F A;  3SUQ A;  4WQ5 A;  1EO1 A;  3RR8 A;  4CJE A;  1TKX A;  4DR4 K;  4DB3 A;  3MXI A;  3VQ4 A;  3WEE A;  3WXI A;  1Q18 A;  1YJW N;  2HHQ A;  4YFU A;  5AQT A;  2PYJ A;  4CGG A;  2DTU A;  2VGN A;  2Z1G A;  3R9P A;  1KTQ A;  3C94 A;  1NK0 A;  4B1U B;  4DU3 A;  2OPP A;  2NLX A;  4IJN A;  1DGK N;  4BRP A;  3L8B A;  1QZ6 A;  2P9L A;  1HPM A;  5LL6 Z;  3K2P A;  3AVA A;  4O5F A;  3MWP A;  3VQ9 A;  2KZM A;  4F3O A;  3TTF A;  4DTR A;  4CEB A;  3THX A;  1L3S A;  2VQF K;  3DXM B;  4O5B A;  3CFP A;  3CCV N;  3ASM A;  5SWM A;  1JL1 A;  4X66 K;  2UXC K;  2BGG A;  4B1Z A;  2WUS A;  2RKI A;  2FF3 B;  1BDG A;  3VGL A;  2EHG A;  4NO7 A;  3NDK A;  2I5J A;  3BZC A;  4IFV A;  3OW2 M;  4O8K A;  3MN9 A;  3SBT A;  3ZET A;  1EET A;  3THY A;  4RW7 A;  1C0G A;  3W0L A;  2GBZ A;  1BO5 O;  4CZK A;  1MWM A;  1FK9 A;  1NGD A;  3LDP A;  5C0Y A;  3ATU A;  4JI5 K;  1QHA A;  1ZYQ A;  4LF5 K;  4DFJ A;  4RW4 A;  1VQL N;  1HPZ A;  1FJG K;  4DV6 K;  2GUP A;  1U4B A;  1YTA A;  3M3Z A;  3ZSO A;  5KI6 A;  4EP4 A;  3QET A;  3CER A;  4B3O A;  4OPK A;  1CZ9 A;  1TUU A;  1SL0 A;  4FJ5 A;  4K42 A;  3QER A;  3OVN A;  2OPQ A;  4B1V A;  4JKH A;  4H4M A;  1TK5 A;  4GKK K;  4CEE A;  4CFC A;  4DSL A;  4E1J A;  2P5O A;  3DLL L;  1BL3 A;  1BA1 A;  4FJL A;  5KPZ A;  2QXF A;  2JWK A;  2Z1H A;  3AO5 A;  3I56 N;  2VWJ A;  3VQD A;  4O0I A;  3V9U A;  3KKR A;  3ZT2 A;  1C0U A;  3KD1 E;  1NBW A;  4F2R A;  4BVO A;  3KK2 A;  3HI0 A;  2DFF A;  4JK8 A;  2E20 A;  3P38 A;  3MDQ A;  2ZGY A;  3ID6 A;  1VSM A;  4DSE A;  1ITG A;  4WYB A;  4XEI A;  4I9L A;  2OYQ A;  4ICL A;  4HUE A;  3E66 A;  1TAU A;  4YDU A;  2Y1I A;  1RT6 A;  4LSL A;  1NGF A;  3A5L C;  3SMP A;  5JLF A;  3MK6 A;  4CD1 A;  4FJH A;  3V9S A;  3SAF A;  5AQG A;  1TAQ A;  2NRR A;  3NGZ A;  2JWL A;  1HRH A;  4HVJ A;  5HRR A;  3AA3 A;  1S6P A;  3EZW A;  3HVT A;  1WSE A;  4GV6 A;  2QWM A;  1BI4 A;  3VEX A;  1S72 N;  1S5J A;  5FDL A;  4DTO A;  1QSY A;  1RTI A;  3TSQ A;  5AQS A;  4GV9 A;  4QS7 A;  4RW9 A;  1XUP O;  3OYG A;  4W5O A;  4I9Q A;  4DS4 A;  2QTD A;  4H5T A;  2B4J A;  3SJJ A;  3U9D A;  1NGI A;  2FBV A;  4QS9 A;  5C2F A;  3KD5 E;  2P9K A;  1CZA N;  1SAZ A;  1EWQ A;  4PL8 A;  1NK4 A;  1IKY A;  4DSK A;  4CJ3 A;  3K59 A;  5FPM A;  1NLV A;  1JLE A;  5LJV A;  2RHK A;  1UA1 A;  1ZBL A;  1D8Y A;  3NVM A;  4BRL A;  2KFZ A;  2H3G X;  3J8A A;  4M41 A;  1JLC A;  4K43 A;  1NK9 A;  4CIF A;  3ZSW A;  2A1S A;  5C42 A;  1YT3 A;  4Z4H A;  5C12 A;  1KLN A;  4FVU A;  1C6V A;  4OGC A;  2YX6 A;  4HTU A;  4CD3 A;  5AQH A;  3OYE A;  2ZJQ L;  4DS5 A;  2RN2 A;  2P9N B;  2ETJ A;  3EKS A;  4B3T K;  4CGI A;  1K73 O;  2E2N A;  3UE5 A;  4WFN L;  3PUF A;  1GLC G;  5AZJ B;  3OBW A;  3LDQ A;  3EL2 A;  3QML A;  3QIC A;  2QKB A;  2XY6 A;  4PL7 A;  2NRT A;  5M1N A;  3VQE A;  1T8E A;  4JI8 K;  4JYA K;  3VER A;  2ZWH A;  3AGR A;  3E9O A;  4JD2 A;  3PO5 A;  2X74 A;  3QB0 A;  3CCQ N;  1S1W A;  4FPA A;  3O9T A;  5D3G A;  3VTH A;  5FPN A;  3ZSQ A;  3P39 A;  1R0A A;  3CCR N;  4JI4 K;  3CCU N;  4BE1 A;  3AGK A;  3R6M A;  3ZX3 A;  3TU5 A;  1MDU B;  3ENO A;  1YHQ N;  4WQ5 C;  4IOX A;  1C1A A;  4LF6 K;  4B1X B;  3B6P A;  3IKM A;  2P5G A;  3E9P A;  4Y1C A;  4DTP A;  2HW3 A;  2W40 A;  4B8A B;  2GUI A;  3D6R A;  3DRS A;  4IOC L;  4B9L A;  1XMO K;  1P8Z A;  1GOB A;  4CHY A;  4JNE A;  4F3T A;  3DI6 A;  3O3F A;  5EY4 A;  4QOZ B;  3BEX A;  3A8Y A;  2HHV A;  2G8H A;  4FWK A;  4GVE A;  3K57 A;  5FLX O;  4DF4 A;  1HJR A;  3ZSZ A;  4MO5 A;  4MFB A;  5SZT A;  3U3Y A;  3M8Q A;  3OBY A;  2O8B B;  4R5P A;  1JLB A;  4FJX A;  3HL8 A;  2CH5 A;  3LP0 A;  4CBW A;  4IOA L;  5LY3 A;  3QNO A;  2A41 A;  3LWM A;  4GKJ K;  4DMN A;  2F8T A;  3QIN A;  3O8M A;  4BR2 A;  3VQP A;  1HX1 A;  4CBX A;  4C1N K;  1Q9Y A;  4CZE A;  1RT3 A;  4FZZ A;  3NCI A;  2F7T A;  3JSM A;  4Z4C A;  4KTW A;  3SUO A;  3CM6 A;  4PWD A;  1J9A A;  4KV8 A;  5C24 A;  1DTT A;  1JLA A;  4JK7 A;  2A42 A;  4DSF A;  5K14 A;  1KAY A;  4HUG A;  4F9O A;  2G8I A;  2EX3 A;  1TL3 A;  1ZC6 A;  3SPY A;  4BC2 A;  2HHU A;  4OPA A;  1WNS A;  2VWK A;  3LM9 A;  3PV8 A;  1N36 K;  1WUA A;  4FWN A;  3U9Z A;  4KHS A;  3EE8 A;  3G4S N;  4IEE A;  4CJ5 A;  3K5N A;  3CFR A;  4BRO A;  1X3N A;  3C95 A;  1ZBU A;  3CQ8 A;  3S9H A;  4BAC A;  4CF9 A;  4R79 A;  3V1R A;  2FBY A;  1JLG A;  3DXK B;  4I6M A;  3P83 D;  5C10 A;  1VSE A;  4CZL A;  3OYA A;  3H3O B;  2JGU A;  4WFB L;  3AVC A;  3K9K A;  1LV5 A;  4M45 A;  4A5A A;  4EZ6 A;  3K5L A;  2DFE A;  3CJB A;  1JXB A;  3FR0 A;  1EWR A;  1YVN A;  3TWH A;  4AF1 A;  3LPU A;  2E88 A;  4LSN A;  1BA0 A;  4BE0 A;  4GY2 B;  2D1K A;  2D0B A;  4CCH A;  3FLC O;  1J54 A;  4BVP A;  3K0S A;  1WAJ A;  1RTD A;  4W5Q A;  2A3Z A;  3SLC A;  1BIS A;  3MWT A;  5CHI A;  1IG9 A;  3DXM A;  1TL1 A;  3EZ5 A;  3BY5 A;  3VQA A;  4CEC A;  2RPI A;  2P9U A;  2IC3 A;  3J80 O;  3H3N O;  4YDU C;  4E7L A;  3CJ1 A;  4DSJ A;  2D0C A;  4K0K K;  5CZ2 A;  2KKZ A;  1NJZ A;  1W97 L;  1GLB G;  2IVO A;  4A61 A;  2HBM A;  1OH6 A;  3WNE A;  4QS8 A;  2OTL N;  4FYD A;  4MLH A;  3WQU A;  3I0S A;  4JV5 K;  3VMF B;  1VQ4 N;  3ITH A;  3MCP A;  1GLJ O;  2IVN A;  5TKY A;  4QCL A;  4LD0 A;  3Q7C A;  4BGA A;  4J8F A;  3AA5 X;  4CJL A;  3TAG A;  5AQU A;  2UUB K;  4KH4 A;  4PA1 A;  1I94 K;  3OHR A;  4KH6 A;  2Z1J A;  1BQN A;  2IAJ A;  3LM2 A;  4IBN A;  2BH1 A;  4PKH A;  4JHD B;  1NMN A;  2OCE A;  1IKV A;  4PKI A;  2Q31 A;  3RRH A;  3ZYY X;  3V6D A;  3HVR A;  2KW4 A;  4CZF A;  4KHP K;  3VEW A;  4FLW A;  4CEQ A;  2HVH A;  3JXU A;  1ATN A;  3T1Y K;  5C15 A;  4AM7 A;  1VQ9 N;  3TSU A;  5J2Q A;  2F9W A;  4BRK A;  3HRG A;  1TKT A;  1IH7 A;  3ALY A;  5M1K A;  1RDB A;  4KRE A;  1JCE A;  4JI7 K;  4FJ7 A;  2ITM A;  1BG3 A;  1S9E A;  2P1J A;  4JLH A;  3FZK A;  3O5B A;  3V1Q A;  2HF4 A;  3CQX A;  2WC9 A;  3VGM A;  4CGF A;  5BR9 A;  4CK1 A;  2OPS A;  1L3T A;  4FWP A;  4OVL A;  3S41 A;  4B9Q A;  3RMD A;  4A2A A;  4IEI A;  2KZZ A;  4PY5 A;  1S22 A;  1IBL K;  4DR6 K;  2FBX A;  5C2D A;  4KH5 A;  2E2P A;  4JN4 A;  1P90 A;  3KHY A;  1U48 A;  4ID5 A;  1QQM A;  1QSL A;  4GMJ B;  2P9S A;  2A5X A;  3CPE A;  5CYQ A;  2QK9 A;  4Z0U A;  3CMA N;  3CCS N;  1HYV A;  3H45 C;  4CGJ A;  4CF0 A;  4CJV A;  2O8F B;  2Q2R A;  5JLH A;  4DTN A;  1NGC A;  1WLJ A;  3BF3 A;  4B9N A;  5JS1 A;  1HNV A;  4IKF A;  1JKH A;  4WFA L;  1RIL A;  4M7X A;  1DKG D;  2HBJ A;  5AQV A;  4XH5 A;  5GIP A;  3L2R A;  1VAZ A;  2IGI A;  2ZE2 A;  5EX5 A;  4H0X B;  3L3U A;  5BPL A;  3CET A;  2FSJ A;  5KGX A;  3DYA A;  4N41 A;  1KC8 O;  3THV A;  4W5N A;  1J53 A;  2D0A A;  4CJP A;  5CY4 A;  4CHZ A;  4CHQ A;  5I3U A;  4AHS A;  4YOT A;  1NGB A;  2Q36 A;  3D2F B;  4FWS A;  4ILH A;  4LF8 K;  5HOO A;  1N33 K;  4DTS A;  1KQS M;  3K5O A;  3RSE B;  4AH9 A;  1K9M O;  4DQP A;  5KRT A;  3UKR A;  2NUB A;  3MEE A;  2ZJR L;  2HBL A;  4DR1 K;  5AQF A;  5JMV A;  2KLA A;  3D7E O;  1QE1 A;  5AQJ A;  1FKO A;  3OY9 A;  1T7P A;  1HKB A;  4DV1 K;  2E2O A;  1U2V B;  1VRU A;  3NH1 A;  5E84 A;  2O4I A;  4FK0 A;  3LZJ A;  1S1T A;  2ZF5 O;  5ADX H;  4LF7 K;  1X9M A;  4KKO A;  4DR5 K;  1S3X A;  3LAL A;  1TYQ B;  4CFB A;  3MMV A;  3T19 A;  2P9N A;  4J2A A;  3F5T A;  1RBS A;  4C8L A;  3FGU A;  1G15 A;  3ZT0 A;  1EP4 A;  5AZJ A;  4ZHR A;  2D0P A;  1S1U A;  3TAB A;  1K6Y A;  2YHA A;  4L3Q A;  1TKD A;  1E4G T;  3MEG A;  5KTQ A;  4CE9 A;  1NGJ A;  4G1Q A;  5AQO A;  3ZSV A;  1LOT B;  3OYJ A;  4KHN A;  1LAV A;  4BG8 A;  4ELT A;  1N32 K;  2XY5 A;  5GAE P;  3G71 N;  1D9D A;  4B9S A;  1ZBH A;  1NK7 A;  1ILY A;  1KVC A;  2NRV A;  2HOE A;  3MCA B;  3SK3 A;  3VQQ A;  2ATQ A;  4DV7 K;  3DLH A;  3HPO A;  3S3O A;  5KPR A;  1NOZ A;  2HB5 A;  4FLX A;  3V9W A;  1N6Q A;  2BAN A;  4JI0 K;  1ASU A;  4FLU A;  1VQ6 N;  1WB9 A;  3PO4 A;  2WBN A;  2VGM A;  1SKW A;  2I7P A;  4IDH A;  3VOV A;  1YTU A;  4NXN K;  2D0O A;  1LWC A;  3AVL A;  3MN5 A;  5GIN A;  3SNN A;  3CJ7 A;  4CBU A;  2O8B A;  1OH5 A;  4XH1 A;  2IDO A;  3AV9 A;  2UYT A;  4ILJ A;  3JS6 A;  3LAM A;  5E41 A;  3ZEU B;  3U6F A;  1VQ7 N;  3CJ9 A;  3VTI A;  1OH8 A;  1TVR A;  4H0P A;  3QEX A;  4BRD A;  3L2W A;  2GWJ A;  3DOK A;  2VWB A;  3E01 A;  3SCX A;  1KFS A;  1T6C A;  1HQU A;  1XMQ K;  4Z4E A;  5FPD A;  4DV2 K;  3AVG A;  1HLU A;  1QZ5 A;  3FZL A;  3KJV A;  1VSI A;  3EE9 A;  3M5R A;  4E7H A;  2QWN A;  4PUO A;  3LDL A;  4CVN E;  4WE1 A;  1B9F A;  4TSX A;  3H08 A;  2FC0 A;  2VG6 A;  2YKN A;  4K8X A;  3C6A A;  1QQC A;  3MEC A;  4ZTF A;  1S9G A;  2DPN A;  5AQX A;  2E4L A;  2YKM A;  1TV6 A;  4CJF A;  1K8A O;  4EZ9 A;  1ESV A;  4OO1 J;  3VEV A;  4B1W B;  3NFA A;  5BRD A;  5HP1 A;  4YOW A;  1RT5 A;  3DXK A;  5JIC A;  4JI1 K;  1X9J A;  2YHX A;  2Q0U A;  1BWF O;  3EO3 A;  3GOI A;  4JAX A;  2NRH A;  4A57 A;  3GG4 A;  3C6H A;  1KXP A;  4CEO A;  1NJI O;  4CHO A;  3RVC A;  3H46 O;  3I33 A;  3TSP A;  3CM5 A;  4BWM A;  3MN6 A;  1I39 A;  3EKU A;  4M3T A;  4DCH A;  1JCF A;  5BN8 A;  5AQW A;  3K58 A;  1KAZ A;  1Z05 A;  1HUX A;  3KKS A;  2QWQ A;  4OGE A;  1KVB A;  4CJ4 A;  4W5T A;  1KD1 O;  4DQI A;  1HKG A;  4LF9 K;  1WN7 A;  4OKJ A;  5DMR A;  4A62 A;  2GEL A;  1Y97 A;  4BR5 A;  4FWO A;  3NMU A;  2Y1J A;  3AA4 A;  1LW0 A;  4B9T A;  4L8R B;  1C1B A;  1BCO A;  4AHV A;  3IDH A;  1SZ2 A;  3QBW A;  1D5A A;  1HMV A;  3I55 N;  4AIL C;  1E4F T;  4N76 A;  5DM7 L;  4DV0 K;  1LWE A;  1IBM K;  2W42 A;  3HSC A;  4MO4 A;  5AFU A;  2FBT A;  1HJO A;  3VQC A;  4KBO A;  1RGI A;  4AM6 A;  3ZX0 A;  4KAZ A;  3QFP A;  2A6A A;  4BGB A;  3OYC A;  1SV5 A;  4B9V A;  4B3R K;  3M8R A;  2O8C A;  2XY7 A;  4O8U A;  4DV3 K;  4FWL A;  4JHD A;  4AHC A;  3WXM B;  2V7Y A;  1OVQ A;  3VQ8 A;  1HNZ K;  4BDZ A;  1HNX K;  3O4Q A;  3T1H K;  2HBK A;  5AQZ A;  4N5S A;  1NGG A;  4C8O A;  1V4S A;  4RTF D;  4UQG A;  3J7A P;  3GDQ A;  5JVH L;  4WF9 L;  4FJ8 A;  2PYL A;  3VA3 A;  3TTC A;  3CCM N;  3I0R A;  2KTQ A;  4DTU A;  4FJG A;  4CW7 B;  4RWT A;  4LFB K;  4BRN A;  1S6Q A;  4OLB A;  3HTV A;  4OPH A;  3IG1 A;  3AO1 A;  2ASP A;  2HNZ A;  3WNH A;  3V1O A;  2E6M A;  3E1Y A;  2XRI A;  3ZSX A;  4B8C A;  5EOY A;  1XHZ A;  4FOE A;  3VQB A;  1XI1 A;  3AAR A;  3AVK A;  5E26 A;  2QEX N;  5F0X A;  4CJU A;  1KVA A;  1NWK A;  1VSD A;  3LDO A;  3B8A X;  3NHG A;  2FF6 A;  1QTM A;  3V81 A;  4C1N I;  1C0M A;  4J2E A;  3B6O A;  1YAG A;  3Q7B A;  3NF9 A;  3MXM A;  5CYM A;  3H6E A;  3GL1 A;  1CLQ A;  3ID8 A;  5AQP A;  1JLF A;  3LDS A;  3G0Z A;  2O8F A;  4LH5 A;  2VG7 A;  4J2D A;  1W0H A;  3RRG A;  4OJR A;  1XNR K;  1WAF A;  2DFH A;  1NJW A;  1VQP N;  2X6N A;  5HLF A;  4F4K A;  5BPM A;  2B6A A;  1Q86 O;  1SUQ A;  5I42 A;  1VQK N;  4YOV A;  4G9Z A;  3FZH A;  4RG8 A;  3VQ6 A;  3VES A;  2YCH A;  3IRX A;  4X62 K;  3O80 A;  4CIE A;  3DWL A;  4I2P A;  4X64 K;  4JI2 K;  1Y64 A;  3D2F A;  2VYP A;  4JI6 K;  4BY9 C;  4RW6 A;  3K9J A;  2GEM A;  3TR8 A;  4DUY K;  4FWR A;  2O4G A;  3RSE A;  4W5R A;  2AP1 A;  3C6U A;  4H5V A;  4LF4 K;  3DM2 A;  2QW9 A;  4DFM A;  1QQN A;  1CXQ A;  2CGL A;  3RMB A;  2LSN A;  3N4Q A;  1U2V A;  4X65 K;  4Z4I A;  5HRS A;  3P1G A;  4BWJ A;  2HHW A;  3TAF A;  3BZK A;  3I8D A;  4I2Q A;  5JS2 A;  4UY8 O;  1TYQ A;  1MWK A;  4EIA A;  3CD6 N;  3MAQ A;  1YJ9 N;  4N47 A;  3CXC M;  3PIP L;  2OA8 A;  1RNH A;  2P9P B;  4BC3 A;  2ZD1 A;  4CGH A;  5EU7 A;  4CEA A;  2F96 A;  4BRF A;  3SUP A;  2YJF A;  5IT9 O;  4FLZ A;  1HNI A;  1NM1 A;  3L4Q A;  4DUZ K;  3QLH A;  4EHU A;  2X78 A;  3SMS A;  3R8E A;  2WTU A;  1JCG A;  1A5X A;  3M6G A;  4CZM A;  4FL9 A;  3A0I X;  3HP6 A;  5I9E B;  3KLF A;  4EP5 A;  1UA0 A;  5HBM A;  3CJA A;  3TPQ A;  2RE2 A;  2IIR A;  1SKS A;  3J81 O;  2GWK A;  3VF2 A;  2UXD K;  2VG5 A;  4RW8 A;  1T44 A;  4ISG A;  5F1X A;  3HM9 A;  4PHT X;  3EY1 A;  4CZH A;  3NF7 A;  4CF1 A;  3K5M A;  2KFN A;  2W6L A;  3M8S A;  3SBG A;  2ZJP L;  2G8V A;  2Q1N A;  1BOT O;  4BRM A;  3NF8 A;  4OX9 K;  1B9D A;  3ULE B;  3VQ7 A;  3AVH A;  2E2Q A;  4YNQ A;  1YVU A;  4N56 A;  4H8K A;  1WSI A;  2B5J A;  5LJW A;  1N34 K;  3JAM O;  5FRN A;  5IWA K;  3CPW M;  2O8D B;  2P9K B;  4M7Y A;  3ZEU A;  2BTF A;  4IJA A;  5JVG L;  1U6Z A;  4JEP A;  4AHR A;  2QWO A;  3IMX A;  4JKG B;  1YF5 L;  1TKZ A;  1RBT A;  1REV A;  4CFA A;  4FOI A;  5FRM A;  3QIO A;  3CC4 N;  4NYF A;  3AAQ A;  4KO0 A;  3OYF A;  4DQ8 A;  1NMD A;  4LFA K;  4CGD A;  3SAG A;  4DLG A;  3SV3 A;  4CF8 A;  5EXW A;  5BRE A;  1NG9 A;  4JI3 K;  3LWL A;  3O9Q A;  5M1P A;  1IBK K;  2Z1I A;  3VF6 A;  3DLE A;  1TUY A;  4K8Z A;  4KHU A;  2A1R A;  4FXD A;  1GOC A;  4KFB A;  2E5L K;  4OPJ A;  4IO9 L;  3FE1 A;  5B8H A;  4CK2 A;  1KLM A;  2YNF A;  4KI4 A;  5AQL A;  5FRO A;  4XH4 A;  2WOM A;  4NXM K;  4MLE A;  3HPH A;  3D45 A;  1NK5 A;  4BDP A;  5M1Q A;  5J2P A;  3CCE N;  4DQS A;  3M8P A;  3O4W A;  4NCG A;  4H5R A;  1RT4 A;  4C23 A;  2BDP A;  2Q0R A;  5ELZ A;  1VQ8 N;  2VQE K;  3KK7 A;  3F2K A;  4JD2 B;  1SL2 A;  1Z25 A;  4DU1 A;  1WBB A;  4H0Y B;  1OKJ A;  1QQO A;  4QAG A;  3KLG A;  3CCL N;  5GAD P;  4M3Y A;  3U4L A;  4KTQ A;  1RTJ A;  4FLV A;  3DLR A;  4CEF A;  2XY8 A;  1YUW A;  2WFB A;  1EXQ A;  3TI0 A;  3FFI A;  4I7F A;  1NNE A;  4O44 A;  1A5V A;  3DOL A;  5AQM A;  3ZT1 A;  1TK0 A;  5LMN K;  2E6L A;  4E3S A;  1YJN N;  4DSI A;  4H0O A;  3RMA A;  4ID1 A;  4FJI A;  2PBD A;  4LY7 A;  1ZBI A;  1GLE G;  4Y0W A;  4JKB A;  3DJC A;  3DMJ A;  1UWB A;  5M1O A;  3T3F A;  2KQ2 A;  2W41 A;  3KTQ A;  1Z26 A;  3L2U A;  3OA9 A;  1DLO A;  3HOT A;  1KFD A;  1ASW A;  4LFC K;  3KK3 A;  3QEW A;  2RF2 A;  1B92 A;  3OYH A;  3AVN A;  3CCJ N;  3AY9 A;  1X1P A;  3OYL A;  4NLC A;  2ITG A;  3OS1 A;  1TGO A;  2ASM A;  2W6K A;  3AVJ A;  3TAR A;  1J5E K;  2HF3 A;  3OYM A;  4CES A;  4FJN A;  2FXU A;  1BCM A;  3KLI A;  2OTJ N;  3SQ1 A;  1EKE A;  1L3V A;  4C8M A;  3WNF A;  3W3D A;  2YHW A;  3SZ2 A;  1GOA A;  4CFD A;  3V9X A;  1U45 A;  3R1X A;  2ZQB A;  4JKF A;  4FJJ A;  2IOC A;  1K8K B;  1WSJ A;  4IO8 A;  4M3X A;  3T1A A;  4BRA A;  2D4W A;  2YJE A;  2A40 A;  1ZBF A;  4Q0B A;  3T7Z A;  1BU6 O;  3HZ6 A;  1M90 O;  2PY5 A;  4Q5V A;  3QDK A;  4IG3 A;  4FJK A;  1FW6 A;  1RFQ A;  4DTM A;  4CHN A;  3OYD A;  4M3Z A;  3CC7 N;  3D2E B;  2HHX A;  1O13 A;  3PSF A;  3ENB A;  3TAQ A;  2HND A;  4YY3 K;  3L4I A;  1VK0 A;  4FSV A;  3NGI A;  3TAN A;  2AJQ A;  4JRP A;  1QVG M;  4DR2 K;  3A5O C;  2F4V K;  2J4R A;  2E1Y A;  2YNI A;  1LAW A;  3DAW A;  4LH4 A;  1ASV A;  4Z94 A;  3OJS A;  1NOY A;  4I6M B;  2JLE A;  1YIJ N;  1ZBS A;  3KLE A;  1YI2 N;  4FO0 A;  1GLL O;  4JKC A;  1WSF A;  3CI5 A;  5KQ8 A;  5AQN A;  4BR4 A;  2R7Y A;  3KVG A;  1RBV A;  3IFR A;  4DWI A;  3O4N A;  3EN9 A;  3VPZ A;  4B9U A;  3HYF A;  3DRP A;  4OLA A;  4CIG A;  1X9W A;  4GVM A;  2NRZ A;  4KRF A;  1OH7 A;  5T7B A;  4IWV A;  4V19 S;  3NE6 A;  4J2B A;  2D5R A;  1UOC A;  1XC3 A;  3J7Y P;  5TKW A;  2QWL A;  1IV0 A;  4CER A;  2P9U B;  2VCP A;  4FZY A;  1XNQ K;  4FWM A;  2FLO A;  4MQ3 A;  4B3M K;  4BR0 A;  3C0B A;  3H1Q A;  1SKR A;  4H0V B;  3O6W A;  4JKD A;  3CFO A;  4CJT A;  1LCU A;  3ZSR A;  1U49 A;  5GIO A;  3RMC A;  1NK8 A;  4XIU A;  1GLD G;  4ELV A;  3LP3 A;  4DR7 K;  1WSH A;  4B1Y B;  2YI1 A;  3SYZ A;  2UU9 K;  3G10 A;  2V52 B;  1E3M A;  3J7Z O;  1WOQ A;  1JJ2 M;  3IS9 A;  4CZJ A;  3VA0 A;  4BC4 A;  3ZCM A;  3P4I A;  2FSK A;  3WXK A;  1HNW K;  3MN7 A;  3ZT4 A;  3C6T A;  3LP1 A;  4H0T B;  1HQE A;  3OYK A;  4MDB A;  3HO1 A;  1VQO N;  2HMP A;  3VEN A;  1QS4 A;  1VQ5 N;  4E0D A;  1H1V A;  2IS3 A;  1BQM A;  2P9P A;  4FK4 A;  4O55 A;  5HL7 L;  5AR0 A;  3L3V A;  2NRX A;  5HRP A;  4BE2 A;  1ATR A;  2YNG A;  4BRG A;  4DU4 A;  4HCC A;  3CQY A;  4K25 A;  3IUC A;  5M1F A;  2QI2 A;  4YHH K;  1IKX A;  3O9S A;  4KPY A;  2XHB A;  2PAV A;  3QIP A;  2GV9 A;  3G6E N;  5BRH A;  5H1S Q;  4CED A;  1FXX A;  2NNW A;  3U3G A;  1Q9X A;  3GE1 A;  3SQ4 A;  4CJ7 A;  3PY8 A;  1NKB A;  3SQ2 A;  3RTV A;  3AAP A;  3VET A;  1CXU A;  3CIP A;  4ELU A;  4M63 C;  2P9S B;  1X3M A;  3HT3 A;  1W7A A;  2OAN A;  3DLK A;  1KCF A;  1RT7 A;  2EWS A;  4BRI A;  1V4T A;  5HRO A;  4KHQ A;  3HK2 A;  3DLG A;  3ISN C;  2BE2 A;  4WQ4 A;  4CF2 A;  1RT2 A;  3CF5 L;  3CC2 N;  3TAP A;  3ULE A;  4E1N A;  4BRQ A;  4HCB A;  1LWF A;  1U04 A;  1SS6 A;  2ZM6 K;  2O8E B;  2HHS A;  4E89 A;  5AJ3 K;  3SI6 A;  3R3L A;  1VSH A;  3ZX2 A;  4GV3 A;  5CZ1 A;  1C1C A;  2Q3S A;  4CJW A;  3H1V X;  3C7N B;  2O8D A;  1DTQ A;  3N4P A;  5BRF A;  2BUP A;  4CK3 A;  1NKC A;  1T05 A;  4F8R A;  3HJF A;  3KWG A;  1YIT N;  3AO4 A;  4O0J A;  4JRQ A;  3JYT A;  4M3W A;  3TAE A;  1O1W A;  2KHO A;  5KQD A;  2F8S A;  4JKG A;  1NKE A;  2ASO A;  2QXL A;  3MX2 A;  5J2N A;  1IKW A;  3QES A;  1W9H A;  2HST A;  3BUZ B;  4CZI A;  3LPT A;  4BR9 A;  3AVF A;  3HBT A;  1RT1 A;  3KK1 A;  3UKR B;  3P31 A;  2GX9 A;  1J6Z A;  3O1B A;  3UKU B;  2IVP A;  4B08 A;  4FM0 A;  4A2B A;  5BPN A;  1XC9 A;  1T6D A;  1EX4 A;  3THW B;  3AA2 A;  4BR7 A;  3NBP A;  3WT0 A;  3O3G A;  3NGY A;  3S3N A;  4U67 L;  1RDA A;  3RR7 A;  2P9I B;  3ZSY A;  4F2S A;  4CI6 A;  3FZM A;  2HMI A; 
#chains in the Genus database with same CATH homology
 4DR2 K;  2F4V K;  4JV5 K;  4LF9 K;  3J81 O;  4GKJ K;  1XNR K;  2UXD K;  4YHH K;  4NXN K;  4GKK K;  4LF8 K;  2UUB K;  1I94 K;  1N33 K;  4X62 K;  4DV0 K;  4OX9 K;  5LMN K;  4X64 K;  1IBM K;  4KHP K;  4JI2 K;  4DR1 K;  2UUA K;  2UUC K;  3T1Y K;  4V19 S;  4DR4 K;  4JI6 K;  4B3T K;  1N34 K;  3JAM O;  5LMU K;  4DV1 K;  4B3R K;  1XMQ K;  4JI7 K;  5IWA K;  3J7Y P;  4DV3 K;  4DV2 K;  4DUY K;  1N36 K;  1HNZ K;  1XNQ K;  4LF7 K;  1HNX K;  3T1H K;  4LFC K;  4B3M K;  4DR5 K;  4JI8 K;  4JYA K;  4LF4 K;  3J7A P;  4CVN E;  4DR3 K;  2ZM6 K;  5AJ3 K;  5LL6 Z;  1J5E K;  2UXB K;  4X65 K;  4JI4 K;  4B3S K;  1HR0 K;  4LFA K;  2VQF K;  1IBL K;  4DR6 K;  4DR7 K;  4CW7 B;  4X66 K;  2UXC K;  4LFB K;  4JI3 K;  2UU9 K;  4LF6 K;  5BR8 K;  4DV4 K;  1IBK K;  1HNW K;  2E5L K;  4JI1 K;  4AQY K;  1XMO K;  1N32 K;  4DV5 K;  5IT9 O;  4JI5 K;  3J80 O;  5FLX O;  4NXM K;  4DUZ K;  4LF5 K;  4K0K K;  2HHH K;  4DV7 K;  1FJG K;  4DV6 K;  3OTO K;  4YY3 K;  4JI0 K;  2VQE K;  5A2Q O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...