4LFCK

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lfcK00
4JI6K 1N33K 3OTOK 4LFBK 4DV7K 4JI3K 2VQEK 4DR2K 4DV4K 3T1YK 1HNXK 4DV5K 1N36K 4YY3K 3J7YP 1XNQK 4B3SK 4LF6K 5LMNK 2HHHK 2VQFK 1XMOK 5A2QO 4X64K 4DR6K 1XMQK 4DR7K 4X66K 2UUAK 5FLXO 3T1HK 4LF9K 4LFCK 4K0KK 4CVNE 2UUCK 1N34K 4V19S 1J5EK 4LFAK 1IBLK 4JV5K 5LL6Z 3J7AP 4NXMK 4LF4K 4GKJK 5BR8K 4AQYK 4JI0K 1I94K 1HR0K 4DR1K 4X65K 4DV0K 4X62K 5IT9O 5IWAK 3J81O 4DR3K 2UUBK 4B3RK 4JI2K 4DV6K 4YHHK 4CW7B 4DUYK 1XNRK 4DR5K 4DR4K 4LF7K 2UXDK 4JI1K 1IBKK 4B3MK 1HNWK 3J80O 4DV3K 2F4VK 2UU9K 4B3TK 5LMUK 4JI5K 1HNZK 4KHPK 4JI7K 2UXBK 4DV2K 4LF8K 3JAMO 5AJ3K 1N32K 4DUZK 4JYAK 2E5LK 4JI8K 1FJGK 4JI4K 4GKKK 4OX9K 4DV1K 2UXCK 4NXNK 4LF5K 2ZM6K 1IBMK
chains in the Genus database with same CATH superfamily
4JI6K 4MO4A 3NMUA 1HRHA 1TL3A 1Q8IA 4E1MA 2FBXA 2G8HA 1IH7A 2BH1A 3C0BA 3AO4A 3MDQA 4BC5A 4AHRA 4Z4IA 3L6QA 4O8UA 2O4GA 3DRRA 4KBOA 4OJRA 5EX5A 3RWUA 1G15A 3M8RA 4DSFA 4L8RB 2NZTA 2G8WA 4FWPA 2O8FA 4BG9A 3D2EB 3C95A 2E4LA 4HHTA 1JLEA 1QHAA 4CD1A 4AHTA 4DFJA 3TPQA 5TKWA 3LDNA 5J2PA 3AA5X 4M7YA 2ZJPL 1VQ4N 4IDKA 3LZJA 3C6AA 3D2EA 3WEEA 2NRZA 5BRFA 4GW6A 4BRHA 1V4TA 1TK0A 3A5OC 4FWOA 1A5XA 1VRTA 3AVFA 2QK9A 5JLHA 1FW6A 3U3GA 3NH1A 4DTJA 2W6KA 4MFBA 1LAVA 4M41A 1YITN 1VQ5N 3PUFA 3OYCA 3WQTA 4C1NI 1IBKK 1RBVA 4JNEA 3K58A 1HKBA 4ICLA 4A2AA 1L5UA 3PX6A 5LY3A 4CEZA 2G8IA 3MXMA 1TK5A 1GLFO 4AH9A 3L2QA 4FLVA 1T03A 5J1EA 5E41A 2A40A 4CHNA 3I8BA 3QO9A 4CF0A 3EE9A 4DKWA 3AA2A 3C6HA 1ZBFA 3DOKA 3AO3A 4IWVA 4A62A 1L3VA 4N47A 2P9KA 3NH0A 1WSGA 4OPAA 4JKFA 3THYB 1NK4A 4C8NA 3SLCA 1VQPN 3FLCO 5AQVA 2HOEA 2E1ZA 3CYMA 3MX5A 1KXPA 4FJMA 1N33K 3WXKA 4OKJA 1C1CA 4ISEA 2WUSA 2HVIA 1XC3A 3ZT3A 1RTDA 3O9TA 2O4IA 3AVGA 4WQ5A 3N4QA 3B6PA 3S41A 2FBYA 2D5RA 1NMDA 1EETA 1T05A 2VQFK 1TK8A 3OYIA 1YVNA 4NYFA 1BA1A 4EAHD 2IAJA 1T7PA 2YJEA 3RSEA 3KK7A 3A0IX 3LP0A 4LFCK 4DTOA 3ZLJA 1X9MA 4B1VA 3O5BA 4H5TA 4PHTX 4E89A 3VQPA 2KTQA 4CEAA 1VSFA 5GIOA 4Z4FA 4B9NA 5AQMA 5BRDA 4E7JA 1BGXT 3IDHA 2HHUA 2QKBA 4CERA 1WUAA 2A41A 1WSHA 4FO0A 3SI6A 1WSJA 4FWRA 4FJHA 1A5VA 4Q5VA 4DR3K 1BHLA 4CW7B 3WXLA 4CZIA 4RW4A 2A1RA 5KRSA 2YHWA 4BQLA 2OYQA 4BRKA 2X6SA 2GELA 1EP4A 3RMCA 3OYDA 5TKYA 3CI5A 4RW8A 1HQUA 3MN7A 2YNIA 3HJFA 3HBTA 3V1RA 5CYMA 1NK8A 1U47A 1TL1A 3VA0A 3QFUA 4EP4A 3ISNC 1HPZA 1NGCA 1TVRA 4JKEA 2Y1IA 1NKBA 4O8KA 3H1VX 5BN9A 3U9DA 4IOXA 3THVA 2HHWA 4GKKK 1QVFM 3CCUN 1K8AO 3CJAA 4DTMA 5AQZA 3VPZA 4I6MB 4NXNK 3A5MC 3CPEA 4OVLA 4H4MA 4CFDA 2IOCA 1T44A 4CJWA 1CXUA 3CF5L 2HHSA 2P9KB 4HCCA 1NGHA 3VTHA 4W5QA 2W42A 4FJKA 3KK2A 2EWSA 1ATRA 4EHTA 5C24A 3OYFA 3L2VA 3DMJA 3TSPA 5FPDA 3BDPA 3K0SA 2AJQA 3ZETB 3AVJA 4CHOA 1J53A 1MU2A 5AZIA 4M3UA 1SZ2A 3C7NB 2BTFA 3F9MA 3LZIA 4FW2A 3VOVA 3OVNA 1OH5A 4MLEA 2GUPA 3CCVN 2HHVA 3ZYYX 1NM1A 3FR0A 4WCEL 4BRNA 4IZ9A 4MLHA 1VQLN 5JS1A 5AZJB 4CZFA 2G8UA 1ASVA 4K43A 1J6ZA 1RILA 3CM6A 2A5XA 2O8DB 4LF4K 4IO9L 3VQBA 2QM1A 2FSJA 4KFBA 3DRSA 4E7IA 1TUYA 1QHTA 1RBUA 3BZCA 3L2RA 2CGKA 3ZX3A 4DMNA 3WT0A 4B9SA 2E2NA 3CCJN 1IG9A 4FXDA 4A57A 3BGRA 4YOVA 4IKFA 5KQDA 3CPWM 4FWQA 1WLJA 5AQPA 4IOAL 1KAYA 5AR0A 3D2FB 1TKXA 1BI4B 4C8KA 2O8CB 3ULEA 1JJ2M 1S22A 3CCMN 1X3MA 3DJCA 2D0AA 2O8DA 4YOUA 3NF6A 1VSHA 4FWMA 4KHNA 1LCUA 3V1QA 3R1XA 4JKGA 2KKZA 4CJ5A 2ASPA 1WB9A 1Q9YA 5KI6A 2E88A 4QS8A 1NWKA 1QE1A 4YOYA 4UQGA 3QEVA 2Q1NA 4ELTA 4FK4A 1NK0A 3SPZA 2Y1JA 4GMJB 1BISA 4KTZA 5CZ1A 2A3ZA 2OCEA 3SUQA 4C8LA 1NU0A 1MA9B 1I39A 3GG4A 3OYKA 3H3NO 4CGFA 4IEIA 2XRIA 1GLCG 3AVAA 3CJ9A 5ADXH 3SQ4A 3ID6A 3V81A 3QLHA 3MX2A 1IG8A 2V7ZA 3NGYA 2GBZA 4CJFA 4Z94A 4NLBA 3MCPA 1OVQA 3MN6A 3SV3A 4FOEA 1XI1A 4M45A 4H0XB 3PO5A 4FLUA 3J7AP 3OJSA 3ATVA 3BY5A 4NXMK 1NG9A 3TAEA 2D4WA 4H8KA 3VQ4A 3O4QA 3HK2A 2FSNA 3M1FA 1J54A 2I7NA 3V1OA 1BCOA 3J81O 1OH7A 1REVA 1P8ZA 1VQ9N 3EZ5A 3ZX2A 4CF9A 4GV9A 3P5JA 5AQNA 5AZJA 2ZGZA 4M3XA 2FBVA 1LW2A 1YAGA 4HUEA 3O3FA 4KV8A 4WQ4A 2O8CA 2G8FA 5BPNA 4JI5K 1RTHA 3QIOA 3HO1A 1KFDA 2E2PA 4DV2K 2OPRA 5CHIA 3TARA 2X78A 3JXUA 4KH4A 4CHQA 4FM2A 3L8BA 1ASWA 3BF3A 3FZFA 1S9GA 3HSTB 3WXJA 3O9RA 3THXB 4L3QA 1YXQA 3NF7A 4BGBA 2XHBA 1Q7YO 1VSMA 1BG3A 1O1WA 1P90A 1VHXA 3N4PA 1WN7A 4FWNA 5MLCQ 4DU3A 1HKCA 5BPMA 2P9PA 3V9SA 4DS5A 5C42A 2FXUA 1RBTA 5JMVA 4E7KA 3SAGA 1IKYA 2P5GA 4YOXA 4FJ9A 4DTSA 4B8AB 5HLFA 1LWEA 4CEOA 5KGXA 2OZMA 2I5JA 2QWOA 3EEQA 5JS2A 3VERA 4DSIA 4H4OA 3LDPA 1SAZA 4FLTA 3AA3A 3SUPA 1C0GA 4KB1A 4KB0A 3VTIA 4CECA 3SJHA 2IGIA 4FWKA 1BQNA 3HP9A 2E20A 3A2FA 3AVMA 1BCMA 3TAPA 1KC8O 1IBLK 4FJGA 1SV5A 4JV5K 4IDHA 3H45C 1FXXA 1SKRA 2KZZA 3VGMA 3K5NA 3SAFA 1VSEA 4HVJA 2WOMA 1HR0K 2V52B 2P51A 4CD3A 1NLVA 4KTQA 4LH4A 4X62K 1M90O 3ZETA 2UUBK 5KRTA 4YOWA 4W5TA 4RW9A 4DR4K 2HSTA 3OBWA 4FK2A 4CJEA 3DAWA 1VQ7N 3WNGA 2O8BB 2UU9K 2Q3SA 3T19A 4BR9A 4TSXA 2QXLA 5J2NA 3HM8A 4FCYA 3O1BA 4CFCA 4KHPK 3VQ6A 4CF8A 4CJ7A 3D2FA 3LM9A 1ZBLA 1QZ5A 2RF2A 4KKOA 2D0PA 1SL2A 4FW1A 5C12A 1RT3A 4BDPA 1GLEG 4CI6A 3K9JA 2D0CA 2DPNA 2GV9A 2ZJRL 3VQCA 1NK5A 5JICA 4DLEA 3LDSA 3MN5A 3BP8A 4G1QA 4JK7A 2JWLA 4Q0BA 3MMVA 5AQHA 3FE1A 3EZWA 1QQOA 3AO1A 3AVNA 5CY4A 3FFKB 4BRDA 2O8BA 3CETA 4FL9A 3PX0A 2DY4A 5F2RA 5CYQA 2VQEK 4J2BA 4N5SA 4BR5A 3CD6N 4KI6A 1HYSA 4BGAA 2YHAA 1LOTB 3S9HA 2FF3B 4AILC 2B5JA 4I2QA 1N6QA 5A2QO 2QWQA 1UAXA 3TAQA 4RWTA 4H0YB 3WXMB 1S9EA 4CJ4A 4ISGA 2JLEA 3UIQA 3W0LA 4EZ9A 2AA4A 4GV3A 5DK5A 4OGCA 3WEEB 2GTDA 2PFUA 3E01A 4JD2B 4CEDA 1WBDA 1S1TA 3M8PA 4DR1K 4HUFA 4CIFA 4B3RK 4BE1A 2CGJA 3V4IA 2HBKA 2IVOA 4B1XB 3H3OB 2ITGA 2ZQBA 3HVRA 2HMIA 3KJVA 1IO2A 2VWBA 1W0HA 5JLFA 2KQ2A 5LMUK 1YT3A 1SS6A 2NRXA 3SZ2A 4PKGA 4KHWA 3O3HA 2JWKA 4IJAA 4M42A 2XY7A 3SBTA 3AV9A 4RG8A 1VQ8N 4HTUA 5M1NA 1B9FA 4ID1A 4XIUA 2P9IA 1ZXOA 3ENHA 3KZBA 3DLLL 3QNNA 4K8ZA 1NGDA 1NGJA 4K25A 4BRIA 4B3OA 2BGGA 1G99A 2J4RA 4F4KA 2ATQA 2IIRA 1UWBA 1SUQA 3TSQA 3PX4A 3RSEB 3PO4A 1U48A 1KVCA 2OPPA 1DEJA 4KAZA 5FPNA 4K41A 3GBTA 3CC4N 1S6PA 2P5OA 3KWGA 3UKRA 4DV5K 4UY8O 4AM6A 3H46O 4BG8A 4MQ3A 3NF8A 3GL1A 3CMAN 3O9QA 3LPUA 1QSSA 4FPAA 5E84A 1XQSC 2QWLA 4DU4A 4GY2B 4KH5A 4BDYA 3CCEN 3ALYA 4FWSA 2ZD1A 2O8FB 4KHQA 3HYFA 3P38A 5FPMA 5FDLA 3EN9A 3LP1A 4E3SA 4PKIA 2P9UA 1UOCA 4O55A 3NE6A 5KTQA 2CH6A 3KKRA 4IBNA 4IFEA 5GIPA 1Q81O 3RMBA 4GKJK 1JCFA 4KHYA 2FLOA 3TU5A 3QETA 3SMPA 4H0VB 3QBXA 4JKGB 4CK1A 1E4FT 2I7PA 5AQJA 2Q97A 1VRUA 1YJ9N 1JLGA 1HJOA 1EX4A 1HLUA 4WE1A 4B1WB 4DUYK 4O4GA 1E4GT 2ITMA 4M3RA 4ILHA 4CEEA 4KI4A 4DS4A 2ZWHA 3ZSRA 4N41A 1VQ6N 2GEMA 2GWJA 3CERA 4Z4EA 4CJKA 3AVBA 3NH2A 1QVGM 1IKWA 5CR4A 3M5RA 4NO7A 3RVCA 3LP3A 3K57A 1NGEA 5HRSA 3VQ5A 1KAXA 3ZSXA 3T69A 3R9PA 4LF8K 1JKHA 4NLCA 5LJVA 1RT1A 1SQKA 3MXIA 1RTJA 1VK0A 3VQQA 3IS9A 4OPJA 1BOTO 4M63C 1QQCA 4FOIA 4LY7A 2VWKA 3CFRA 1GLBG 4BRGA 4JK9A 2Q31A 4J2DA 5FRMA 2Q2RA 2OANA 3QESA 3TAFA 1WSFA 4B08A 4GV6A 4FK0A 3TTFA 2NUBA 4B9LA 1NGFA 4CGIA 2OPSA 5KPRA 1BA0A 4EIAA 1JLBA 2YJFA 3C6UA 2PBDA 2P9LA 4O0JA 4F2RA 3T1YK 1EO1A 1HNXK 1C1BA 3QEPA 4DQPA 4HWIA 2VGMA 3CQ8A 3AVHA 4CHZA 1VQNN 2NRWA 1GLJO 4CHPA 4LF6K 4CJSA 5FRNA 4O44A 4DU1A 1ZBHA 3MAQA 5AQOA 4BQZA 4E1JA 5T7BA 4DFKA 2G8KA 3AGKA 4WFBL 4W5NA 4YDUC 4WYBA 2YNGA 1LWFA 1EWRA 5HBMA 3MXJA 5FLXO 3HPHA 4LF9K 4CVNE 3AGRA 1BUPA 1A5WA 3TI0A 4FLZA 4KTWA 2HHQA 2D0OA 2GWKA 4FVMA 4BE0A 2P9LB 3DLHA 3F2KA 1Y64A 2HMPA 1DLOA 4KHSA 3H08A 3C7NA 2HBMA 1J5OA 4DSLA 1MWKA 1TKTA 3I33A 1YIJN 4F3TA 3JSMA 5J2QA 1K6YA 4AF1A 3C6TA 2KLAA 4B9QA 1XNRK 4CBUA 3HP6A 3DXMA 4QOZB 1C0FA 2VG6A 3OYEA 1ATNA 1JXBA 5DM7L 1NJYA 4Y0WA 4CEFA 4E7LA 3UKUB 2D1KA 1BI4A 3M6GA 4KPYA 4YDUA 5KGWA 1K73O 4IFVA 3QIPA 2VCPA 3JAMO 4DLGA 3AO2A 4JRQA 3V9WA 3VEZA 1YF5L 3CJCA 4H5NA 3AY9A 3SAHA 1RT7A 1JXEA 1JLFA 3ZCMA 1HQEA 3KHYA 4ID5A 2UXCK 1RT4A 3DLKA 4Z0UA 3KLEA 3CG7A 5KQ8A 2EHGA 4DQIA 3CCQN 1KRPA 2VG7A 3RMDA 3HSCA 5AFUA 3BF1A 5KPZA 4BR7A 4DV7K 4BACA 3VEXA 3LANA 1WBBA 1NMNA 2H3GX 3ZSWA 2DFHA 4BR2A 4BRPA 4XH4A 3LDLA 4H03B 4BC2A 2YHBA 5M1FA 2YX6A 4C8MA 4E1NA 4EZ6A 4G9ZA 2P9IB 2HHHK 1R0AA 1XMOK 3NDKA 4E7HA 1KFSA 1JLCA 4GVMA 5EXWA 4K0KK 4CJTA 4F2SA 5KPTA 3HOSA 4CESA 3OYLA 1NGIA 3O3GA 5M1QA 1RDWX 4IXCA 4CK2A 4OPHA 3F5TA 3QEWA 2HNDA 5AQLA 3L0QA 3F73A 1W9HA 3TR8A 1HNIA 4DSKA 5HRPA 1TGOA 3I8DA 2KHOA 1KQSM 1EWQA 4A2BA 3E1YA 3OYGA 5IT9O 3NF9A 4DWIA 2AP1A 1RFQA 2Z1HA 2W41A 4ZTFA 5FROA 4DQSA 5ELZA 4DQ8A 1FK9A 1D4XA 1D9FA 1WSIA 1CZAN 4JI1K 3IRXA 4XH5A 1HNWK 3O80A 5AQWA 4DTRA 5I42A 1MWMA 2QEXN 4B1YB 4B3TK 3KLIA 3LP2A 4CJLA 3OW2M 2HBLA 4PKHA 3A5LC 3TAGA 3ZSOA 1HNZK 4K8XA 4JI7K 4EP5A 3EY1A 1JL1A 1BDGA 4QCLA 4FJXA 1HKGA 3O4NA 4BC4A 4CJ3A 2E2QA 3R3LA 3KD5E 4JYAK 2PYLA 5HP1A 3G0ZA 5CZ2A 4IO8A 4A59A 5E26A 3PLAA 4IOCL 1ZBUA 2FF6A 4CE9A 4B1UB 2ZM6K 2BE2A 4C8OA 1V4SA 1NKEA 1EKEA 5AQKA 2IVPA 1D5AA 2CGLA 3FZKA 2ZF5O 4JI3K 1VQON 1X1PA 4J2EA 1LWCA 3ULEB 5EVZA 1WNSA 1GOAA 2ZJQL 3B6OA 1Y97A 5CE3A 1S1WA 4B9UA 3RRHA 5LMNK 1BIUA 1JCGA 4DFMA 4DFPA 5BPLA 3I0RA 3SMSA 2BANA 4CFAA 4FWLA 3KWIA 1XUPO 3NBPA 1NNEA 1MDUB 1U04A 4Z4GA 2R7YA 3KVGA 3VQ8A 4WFNL 3OS1A 3I55N 1L3TA 4BY9C 3I56N 3D45A 4RW6A 2NRVA 2EX3A 4OO1J 3E66A 3HZ6A 3CJBA 2F9WA 3ENOA 4JKHA 4C23A 3L4IA 1Z6RA 4H5WA 4DG1A 4AQYK 3VF6A 4I9QA 5EOYA 4ELVA 3KK3A 3M3ZA 1H1VA 3NVMA 2RN2A 2ZE2A 4DTXA 1K8KB 2HNZA 4CZJA 1DT9A 1X9SA 1EQYA 3OS0A 3AA4A 1KLNA 4DR5K 2Q0RA 1RTIA 3FZLA 4AHVA 3AAQA 1CLQA 4JKBA 4CIEA 4IFYA 3RTVA 3LPTA 4PUOA 5AZIB 2D0BA 2V51B 4DTNA 4NCBA 1NJXA 1T6CA 4NCAA 4CHYA 1S1VA 4PY5A 1QSYA 1D8YA 3OBYA 5GAGP 2P9UB 1S1XA 4DUZK 1S3XA 5HOOA 2E5LK 4FJLA 1KVAA 4JI8K 3OHRA 3C94A 4PL7A 1RDCA 2HB5A 2P1JA 1FJGK 1S1UA 2HF4A 4BRMA 4OX9K 2W40A 4MDBA 2YCHA 3KIOA 3SCXA 1ZBIA 1JLQA 3BZKA 3CCRN 5BRHA 1QSLA 3ATUA 5AFUH 4CJRA 3OTOK 1EXQA 1YVUA 1M1KO 1XHZA 1Q18A 3HT3A 3CQXA 5J2MA 4OLAA 4DR2K 3EYZA 4CFBA 2QA4N 4Z4CA 2QTDA 3ZT0A 4CEQA 2W6LA 2Z1GA 3SQ1A 1VSDA 1QTMA 1ZBSA 3P83D 1BL3A 3E9PA 4JRPA 2ASMA 4BREA 3DOLA 2OA8A 3ZEUB 5JVHL 4CEBA 1NBWA 4MO5A 4X66K 3K5MA 4CJPA 3VGLA 4ZTJA 3NVKA 2UUCK 1VSIA 3SYZA 1TAUA 3J8AA 3QFPA 3VEWA 3CJ1A 4M3WA 3QNOA 4CJQA 5AQTA 3DLEA 3WNFA 4BRCA 2YKMA 5SZTA 1IKXA 1TV6A 2V7YA 3LALA 3ZSZA 1QS4A 1QZ6A 1NGGA 4M3TA 5EU7A 2B6AA 4LF7K 3L4QA 4IG0A 5DM6L 2UXDK 4QAGA 4A5BA 1XWLA 5I3UA 1BWFO 2Q0UA 3VMFB 3U3YA 1RNHA 3NGIA 1HX1A 1SKSA 1NOZA 3MEGA 5M1PA 1FKOA 4BR4A 3L2UA 2UXBK 4DB3A 3SK3A 2Z1JA 2YHYA 2YKNA 1RDUA 3ASMA 5BR9A 1N32K 3LWLA 1S72N 1Z25A 5GADP 5I9EB 4CGGA 1DGKN 2ETJA 3GOIA 1RT5A 5M1OA 4DV1K 4MDAA 3O9SA 2LSNA 1BO5O 1LV5A 4F9OA 1RBSA 3AAPA 4B8CA 4I2PA 5SWMA 4HUGA 1ATSA 5C2FA 2E6LA 2QW9A 4H0OA 2RPIA 3FFIA 3O9UA 2O8EB 4JHDA 3U4LA 1IJJA 1NK9A 4O0IA 1HYZA 2RE2A 4LSNA 2RKIA 4DV4K 3HRGA 4B1ZA 3I0SA 3RRGA 3EO3A 2OTJN 5AQFA 4ILGB 2WFBA 2VWJA 3O08A 3JYTA 4YY3K 3MWTA 2QWMA 2A1SA 4A5AA 2KZMA 3L2WA 4CJVA 2BDPA 3PV8A 1KSPA 3LWMA 3VQEA 3U8XA 3RMAA 2HF3A 1TKZA 3HTVA 1VQKN 1HNVA 3J7ZO 1XMQK 1KVBA 2F8TA 3VQ9A 4JEPA 1NKCA 2XY8A 1UA1A 3T1HK 4B9VA 2NNWA 3R6MA 4GNIA 5AQGA 4CIGA 3PY8A 1RCHA 3DLRA 4BWJA 3O1WA 4I6MA 3GE1A 4KO0A 4CZLA 5LL6Z 1Z26A 2KW4A 2QWPA 3CFPA 1VSJA 1W97L 3MEEA 2GUIA 3D7EO 3UB5A 1ZC6A 4DF4A 2WONA 4DV0K 2F8SA 3HPGA 1C0TA 3EL2A 3HVTA 2X74A 4NB4A 3QEXA 3AVCA 4YORA 3FZHA 3O4WA 5FPEA 2WBNA 3W3DA 2XY6A 3NGZA 4IG3A 4RCHA 4AHUA 3VEOA 3LL3A 4CZMA 2DTUA 1GLAG 4AHCA 2IS3A 4J2AA 1RT2A 4O5FA 4LD0A 1B92A 4O5BA 4DSEA 4ZHRA 3AO5A 3TWHA 3D0PA 4FZYA 3VA3A 3ITHA 3CCLN 3ZSYA 3R8EA 1BU6O 1JL2A 5JVGL 4FSVA 4OLBA 4CGJA 3SUOA 1YTAA 1U6ZA 3DRPA 1QQMA 3TSUA 3OYMA 2YV0X 1ASUA 4I9LA 4M7XA 4DQRA 3S3OA 4LF5K 2PZSA 1IBMK 3HPOA 3HXMA 3V9ZA 1Z05A 4H0TB 3CXCM 3T7ZA 1BIZA 3OY9A 1HJRA 3NHGA 2VG5A 2ASOA 3ZT2A 1YHQN 3HOTA 3TTCA 1GLDG 3VESA 3NCIA 4LFBK 1E3MA 1NK6A 3CQYA 1SKWA 3Q7CA 1S5JA 3K9KA 1DTQA 2B4JA 1J9AA 4W5OA 1HMVA 1KAZA 4QS7A 1HUXA 1N36K 2E8AA 3FGUA 2PY5A 4XH1A 3J7YP 3SPYA 3A5NC 4JN4A 3UKRB 5AQIA 2YNHA 2WC9A 4OKKA 4HCBA 4JHDB 3OYBA 1GLLO 3DLGA 2ZGYA 1C6VA 4WQ4C 1TKDA 4FLYA 3E9OA 1W2BM 3MK6A 2GX9A 3OA9A 4DCHA 4FZZA 4DHYA 4LFAK 2JGUA 3BEXA 3G71N 3KLFA 3VGKA 1N8RO 3DWLA 5AQRA 3V9XA 4PL8A 3T1AA 4JI0K 2HHXA 1DKGD 4C1NK 4M3YA 2NRTA 3DXKA 2NRHA 4NYNA 3UE5A 4FJJA 3VEYA 4JKCA 4JI2K 2F7TA 3ZSQA 4ELUA 4KREA 2FC0A 4BC3A 4OPKA 2OZSA 4BR0A 3J80O 4DF8A 1SL1A 3F9KA 3DLBA 3H1QA 1Q9XA 4FJ5A 4CGDA 1ESVA 3O8MA 3DM2A 3AVKA 2YI1A 1R59O 3HL8A 3LAMA 1RGIA 3ULDA 1C0MA 4OKEA 2Z1IA 3QEIA 4DQQA 4B9MA 5GAHP 1DTTA 4CBXA 3CMEN 3B8AX 3OYAA 3DXKB 3K2PA 3E9LA 3K5OA 4H0PA 4AM7A 2X6NA 2QI2A 3KD1E 1OH6A 3AVIA 3QDKA 2F9TA 2VGNA 4FZXC 3EE8A 4FYDA 4U67L 3G10A 4U7BA 2P9SA 3MECA 4RW7A 3T3FA 3U9ZA 3SUNA 2FBTA 5EY4A 4R79A 3V6DA 3VETA 1T6DA 5AQYA 3WNEA 3CCSN 1NJIO 2VYPA 1L3UA 3JS6A 3KLHA 5ADXA 4B3SK 3TAMA 4CF2A 4E19A 3C65A 2DFFA 5F0XA 4J8FA 3P1GA 1KLMA 3WNHA 1U49A 3ZSVA 4JS4A 4FLWA 3S3NA 2UUAK 4M3ZA 1X9WA 1NJWA 4LSLA 1S6QA 3IAYA 1F21A 1HPMA 5GINA 1FKPA 4V19S 1J5EK 2IDOA 4Z4HA 3KK1A 4CZKA 4JS5A 5C25A 4ISFA 2HBJA 3M8SA 5AQQA 3VQDA 5BR8K 1XC9A 1X3NA 3VN5A 3G25A 4I7FA 5BREA 1VSKA 3EKUA 3A8YA 1TAQA 4E0DA 3CC2N 3S3MA 3SV4A 3IG1A 3LDQA 3UKUA 4FJ8A 1XHXA 4CJUA 3D6RA 3L3UA 5DMRA 4AHSA 3KKSA 4W5RA 4DV3K 2F4VK 3MCAB 3QICA 4EHUA 3NAEA 1W7AA 3KTQA 1UA0A 3OS2A 3DXMB 2PYJA 5H1SQ 4EFHA 3Q7BA 1OVYA 4BRLA 4FLXA 4WF9L 3VQAA 5AJ3K 1RDBA 3CFOA 3SBGA 5C2DA 4YFUA 1RT6A 3VF2A 1NJZA 4JI4K 2O8EA 4JKDA 1YTUA 3TABA 1SL0A 1CZBA 3CHWA 2KFNA 1VAZA 5AQSA 4YNQA 3EKSA 4CZEA 4RTFD 3VEVA 2XY5A 4OGEA 1B9DA 1I3AA 1U45A 5GAEP 1CXQA 4PA1A 3DI6A 1D9DA 5D3GA 5AQUA 1HYVA 1QQNA 1C1AA 3RR8A 3FZMA 5AQXA 1WOQA 1YI2N 4KHUA 2E1YA 3MEDA 4BRQA 5F1XA 4R5PA 3WXIA 4WQ5C 5B8HA 5BN8A 3IMXA 3WQUA 4DR6K 2OPQA 1ZYQA 1OH8A 3M8QA 4CBWA 3QINA 1LW0A 4QS9A 4A61A 1KCFA 3TTDA 4CZHA 2A6AA 4CK3A 1WSEA 3OYJA 1L3SA 5LJWA 4FM1A 1TUUA 1VQMN 3O6WA 1C0UA 1TYQB 4FM0A 3SJJA 1U4BA 1KD1O 4DTPA 4N56A 3ID8A 5C10A 4YOTA 1U2VB 1RDDA 4JLHA 3MWPA 1JCEA 4BRFA 1I94K 4BWMA 4H5RA 2E6MA 2DFEA 2PAVA 3CJ7A 4K42A 1VSLA 2HNYA 2P9NA 3THWB 4YHHK 3CM5A 1U2VA 1ITGA 1YJNN 3NFAA 2Q36A 3U6FA 4BRAA 3VF4A 2P9NB 3THWA 2BUPA 1WAFA 5HL7L 3PIOL 2QWNA 1CZ9A 4BDZA 1IKVA 4BE2A 3ZT4A 4F8RA 3CIPA 4GVEA 4PWDA 4KRFA 1RDAA 1RBRA 2P9PB 4F3OA 4DSJA 3G4SN 3QBWA 3WUHA 2UYTA 1IV0A 1ILYA 2A42A 4IEEA 3RR7A 4CGHA 4JD2A 2HHTA 2NLXA 3K59A 1GOCA 3THXA 1NOYA 3HM9A 3SQ0A 3IFRA 4B9TA 4LH5A 3KLGA 2IVNA 3QERA 2QWRA 3LAKA 4CF1A 3PSIA 3VENA 4CZGA 1WAJA 3K5LA 3QB0A 4PQUA 1Q82O 4FJ7A 1N5YA 3P39A 2G8VA 2E2OA 4NCGA 4Y1DA 2NRRA 4WFAL 1XNQK 5HRNA 1JLAA 3OYNA 3PIPL 1KTQA 3IUCA 4JAXA 4X64K 4XEIA 4BVPA 3OYHA 4FJIA 4DR7K 3ZEUA 2YHXA 3DYAA 5HRRA 4FPBA 4FJNA 1N34K 3V9UA 4BVOA 3ENBA 2IC3A 3AARA 1TYQA 3H6EA 5K14A 3OJUA 1K8KA 3HI0A 4JK8A 3TANA 1OKJA 4IJNA 2XO7A 4CCHA 3PSFA 1X9JA 4DTUA 3BUZB 4FVUA 4X65K 1NGBA 4HTLA 1YJWN 3G6EN 5IWAK 2P9SB 1T8EA 3GDQA 3L3VA 4DV6K 3ZT1A 4KH6A 1T3VA 2WTUA 1BQMA 4N76A 4B3MK 2OTLN 1NK7A 1O13A 5C0YA 2HVHA 2FSKA 3LM2A 2CH5A 3ZX0A 2HW3A 2F96A 3P4IA 2YNFA 3AVLA 2KFZA 2QXFA 4BROA 3MN9A 3THYA 2RHKA 3LDOA 3IKMA 1K9MO 3CC7N 4LC9B 1GOBA 4H5VA 3QMLA 3SNNA 5M1KA 5HROA 1Q86O 4ILJA 1LAWA 3P31A 2QKKA 4Y1CA 4JKAA 1YUWA 5C15A 3SQ2A 3VQ7A 1NGAA
chains in the Genus database with same CATH topology
4JI6K 1N33K 3OTOK 4LFBK 4DV7K 4JI3K 2VQEK 4DR2K 4DV4K 3T1YK 1HNXK 4DV5K 1N36K 4YY3K 3J7YP 1XNQK 4B3SK 4LF6K 5LMNK 2HHHK 2VQFK 1XMOK 5A2QO 4X64K 4DR6K 1XMQK 4DR7K 4X66K 2UUAK 5FLXO 3T1HK 4LF9K 4LFCK 4K0KK 4CVNE 2UUCK 1N34K 4V19S 1J5EK 4LFAK 1IBLK 4JV5K 5LL6Z 3J7AP 4NXMK 4LF4K 4GKJK 5BR8K 4AQYK 4JI0K 1I94K 1HR0K 4DR1K 4X65K 4DV0K 4X62K 5IT9O 5IWAK 3J81O 4DR3K 2UUBK 4B3RK 4JI2K 4DV6K 4YHHK 4CW7B 4DUYK 1XNRK 4DR5K 4DR4K 4LF7K 2UXDK 4JI1K 1IBKK 4B3MK 1HNWK 3J80O 4DV3K 2F4VK 2UU9K 4B3TK 5LMUK 4JI5K 1HNZK 4KHPK 4JI7K 2UXBK 4DV2K 4LF8K 3JAMO 5AJ3K 1N32K 4DUZK 4JYAK 2E5LK 4JI8K 1FJGK 4JI4K 4GKKK 4OX9K 4DV1K 2UXCK 4NXNK 4LF5K 2ZM6K 1IBMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 K;  1N33 K;  3OTO K;  4LFB K;  4DV7 K;  4JI3 K;  2VQE K;  4DR2 K;  4DV4 K;  3T1Y K;  1HNX K;  4DV5 K;  1N36 K;  4YY3 K;  3J7Y P;  1XNQ K;  4B3S K;  4LF6 K;  5LMN K;  2HHH K;  2VQF K;  1XMO K;  5A2Q O;  4X64 K;  4DR6 K;  1XMQ K;  4DR7 K;  4X66 K;  2UUA K;  5FLX O;  3T1H K;  4LF9 K;  4LFC K;  4K0K K;  4CVN E;  2UUC K;  1N34 K;  4V19 S;  1J5E K;  4LFA K;  1IBL K;  4JV5 K;  5LL6 Z;  3J7A P;  4NXM K;  4LF4 K;  4GKJ K;  5BR8 K;  4AQY K;  4JI0 K;  1I94 K;  1HR0 K;  4DR1 K;  4X65 K;  4DV0 K;  4X62 K;  5IT9 O;  5IWA K;  3J81 O;  4DR3 K;  2UUB K;  4B3R K;  4JI2 K;  4DV6 K;  4YHH K;  4CW7 B;  4DUY K;  1XNR K;  4DR5 K;  4DR4 K;  4LF7 K;  2UXD K;  4JI1 K;  1IBK K;  4B3M K;  1HNW K;  3J80 O;  4DV3 K;  2F4V K;  2UU9 K;  4B3T K;  5LMU K;  4JI5 K;  1HNZ K;  4KHP K;  4JI7 K;  2UXB K;  4DV2 K;  4LF8 K;  3JAM O;  5AJ3 K;  1N32 K;  4DUZ K;  4JYA K;  2E5L K;  4JI8 K;  1FJG K;  4JI4 K;  4GKK K;  4OX9 K;  4DV1 K;  2UXC K;  4NXN K;  4LF5 K;  2ZM6 K;  1IBM K; 
#chains in the Genus database with same CATH topology
 4JI6 K;  4MO4 A;  3NMU A;  1HRH A;  1TL3 A;  1Q8I A;  4E1M A;  2FBX A;  2G8H A;  1IH7 A;  2BH1 A;  3C0B A;  3AO4 A;  3MDQ A;  4BC5 A;  4AHR A;  4Z4I A;  3L6Q A;  4O8U A;  2O4G A;  3DRR A;  4KBO A;  4OJR A;  5EX5 A;  3RWU A;  1G15 A;  3M8R A;  4DSF A;  4L8R B;  2NZT A;  2G8W A;  4FWP A;  2O8F A;  4BG9 A;  3D2E B;  3C95 A;  2E4L A;  4HHT A;  1JLE A;  1QHA A;  4CD1 A;  4AHT A;  4DFJ A;  3TPQ A;  5TKW A;  3LDN A;  5J2P A;  3AA5 X;  4M7Y A;  2ZJP L;  1VQ4 N;  4IDK A;  3LZJ A;  3C6A A;  3D2E A;  3WEE A;  2NRZ A;  5BRF A;  4GW6 A;  4BRH A;  1V4T A;  1TK0 A;  3A5O C;  4FWO A;  1A5X A;  1VRT A;  3AVF A;  2QK9 A;  5JLH A;  1FW6 A;  3U3G A;  3NH1 A;  4DTJ A;  2W6K A;  4MFB A;  1LAV A;  4M41 A;  1YIT N;  1VQ5 N;  3PUF A;  3OYC A;  3WQT A;  4C1N I;  1IBK K;  1RBV A;  4JNE A;  3K58 A;  1HKB A;  4ICL A;  4A2A A;  1L5U A;  3PX6 A;  5LY3 A;  4CEZ A;  2G8I A;  3MXM A;  1TK5 A;  1GLF O;  4AH9 A;  3L2Q A;  4FLV A;  1T03 A;  5J1E A;  5E41 A;  2A40 A;  4CHN A;  3I8B A;  3QO9 A;  4CF0 A;  3EE9 A;  4DKW A;  3AA2 A;  3C6H A;  1ZBF A;  3DOK A;  3AO3 A;  4IWV A;  4A62 A;  1L3V A;  4N47 A;  2P9K A;  3NH0 A;  1WSG A;  4OPA A;  4JKF A;  3THY B;  1NK4 A;  4C8N A;  3SLC A;  1VQP N;  3FLC O;  5AQV A;  2HOE A;  2E1Z A;  3CYM A;  3MX5 A;  1KXP A;  4FJM A;  1N33 K;  3WXK A;  4OKJ A;  1C1C A;  4ISE A;  2WUS A;  2HVI A;  1XC3 A;  3ZT3 A;  1RTD A;  3O9T A;  2O4I A;  3AVG A;  4WQ5 A;  3N4Q A;  3B6P A;  3S41 A;  2FBY A;  2D5R A;  1NMD A;  1EET A;  1T05 A;  2VQF K;  1TK8 A;  3OYI A;  1YVN A;  4NYF A;  1BA1 A;  4EAH D;  2IAJ A;  1T7P A;  2YJE A;  3RSE A;  3KK7 A;  3A0I X;  3LP0 A;  4LFC K;  4DTO A;  3ZLJ A;  1X9M A;  4B1V A;  3O5B A;  4H5T A;  4PHT X;  4E89 A;  3VQP A;  2KTQ A;  4CEA A;  1VSF A;  5GIO A;  4Z4F A;  4B9N A;  5AQM A;  5BRD A;  4E7J A;  1BGX T;  3IDH A;  2HHU A;  2QKB A;  4CER A;  1WUA A;  2A41 A;  1WSH A;  4FO0 A;  3SI6 A;  1WSJ A;  4FWR A;  4FJH A;  1A5V A;  4Q5V A;  4DR3 K;  1BHL A;  4CW7 B;  3WXL A;  4CZI A;  4RW4 A;  2A1R A;  5KRS A;  2YHW A;  4BQL A;  2OYQ A;  4BRK A;  2X6S A;  2GEL A;  1EP4 A;  3RMC A;  3OYD A;  5TKY A;  3CI5 A;  4RW8 A;  1HQU A;  3MN7 A;  2YNI A;  3HJF A;  3HBT A;  3V1R A;  5CYM A;  1NK8 A;  1U47 A;  1TL1 A;  3VA0 A;  3QFU A;  4EP4 A;  3ISN C;  1HPZ A;  1NGC A;  1TVR A;  4JKE A;  2Y1I A;  1NKB A;  4O8K A;  3H1V X;  5BN9 A;  3U9D A;  4IOX A;  3THV A;  2HHW A;  4GKK K;  1QVF M;  3CCU N;  1K8A O;  3CJA A;  4DTM A;  5AQZ A;  3VPZ A;  4I6M B;  4NXN K;  3A5M C;  3CPE A;  4OVL A;  4H4M A;  4CFD A;  2IOC A;  1T44 A;  4CJW A;  1CXU A;  3CF5 L;  2HHS A;  2P9K B;  4HCC A;  1NGH A;  3VTH A;  4W5Q A;  2W42 A;  4FJK A;  3KK2 A;  2EWS A;  1ATR A;  4EHT A;  5C24 A;  3OYF A;  3L2V A;  3DMJ A;  3TSP A;  5FPD A;  3BDP A;  3K0S A;  2AJQ A;  3ZET B;  3AVJ A;  4CHO A;  1J53 A;  1MU2 A;  5AZI A;  4M3U A;  1SZ2 A;  3C7N B;  2BTF A;  3F9M A;  3LZI A;  4FW2 A;  3VOV A;  3OVN A;  1OH5 A;  4MLE A;  2GUP A;  3CCV N;  2HHV A;  3ZYY X;  1NM1 A;  3FR0 A;  4WCE L;  4BRN A;  4IZ9 A;  4MLH A;  1VQL N;  5JS1 A;  5AZJ B;  4CZF A;  2G8U A;  1ASV A;  4K43 A;  1J6Z A;  1RIL A;  3CM6 A;  2A5X A;  2O8D B;  4LF4 K;  4IO9 L;  3VQB A;  2QM1 A;  2FSJ A;  4KFB A;  3DRS A;  4E7I A;  1TUY A;  1QHT A;  1RBU A;  3BZC A;  3L2R A;  2CGK A;  3ZX3 A;  4DMN A;  3WT0 A;  4B9S A;  2E2N A;  3CCJ N;  1IG9 A;  4FXD A;  4A57 A;  3BGR A;  4YOV A;  4IKF A;  5KQD A;  3CPW M;  4FWQ A;  1WLJ A;  5AQP A;  4IOA L;  1KAY A;  5AR0 A;  3D2F B;  1TKX A;  1BI4 B;  4C8K A;  2O8C B;  3ULE A;  1JJ2 M;  1S22 A;  3CCM N;  1X3M A;  3DJC A;  2D0A A;  2O8D A;  4YOU A;  3NF6 A;  1VSH A;  4FWM A;  4KHN A;  1LCU A;  3V1Q A;  3R1X A;  4JKG A;  2KKZ A;  4CJ5 A;  2ASP A;  1WB9 A;  1Q9Y A;  5KI6 A;  2E88 A;  4QS8 A;  1NWK A;  1QE1 A;  4YOY A;  4UQG A;  3QEV A;  2Q1N A;  4ELT A;  4FK4 A;  1NK0 A;  3SPZ A;  2Y1J A;  4GMJ B;  1BIS A;  4KTZ A;  5CZ1 A;  2A3Z A;  2OCE A;  3SUQ A;  4C8L A;  1NU0 A;  1MA9 B;  1I39 A;  3GG4 A;  3OYK A;  3H3N O;  4CGF A;  4IEI A;  2XRI A;  1GLC G;  3AVA A;  3CJ9 A;  5ADX H;  3SQ4 A;  3ID6 A;  3V81 A;  3QLH A;  3MX2 A;  1IG8 A;  2V7Z A;  3NGY A;  2GBZ A;  4CJF A;  4Z94 A;  4NLB A;  3MCP A;  1OVQ A;  3MN6 A;  3SV3 A;  4FOE A;  1XI1 A;  4M45 A;  4H0X B;  3PO5 A;  4FLU A;  3J7A P;  3OJS A;  3ATV A;  3BY5 A;  4NXM K;  1NG9 A;  3TAE A;  2D4W A;  4H8K A;  3VQ4 A;  3O4Q A;  3HK2 A;  2FSN A;  3M1F A;  1J54 A;  2I7N A;  3V1O A;  1BCO A;  3J81 O;  1OH7 A;  1REV A;  1P8Z A;  1VQ9 N;  3EZ5 A;  3ZX2 A;  4CF9 A;  4GV9 A;  3P5J A;  5AQN A;  5AZJ A;  2ZGZ A;  4M3X A;  2FBV A;  1LW2 A;  1YAG A;  4HUE A;  3O3F A;  4KV8 A;  4WQ4 A;  2O8C A;  2G8F A;  5BPN A;  4JI5 K;  1RTH A;  3QIO A;  3HO1 A;  1KFD A;  2E2P A;  4DV2 K;  2OPR A;  5CHI A;  3TAR A;  2X78 A;  3JXU A;  4KH4 A;  4CHQ A;  4FM2 A;  3L8B A;  1ASW A;  3BF3 A;  3FZF A;  1S9G A;  3HST B;  3WXJ A;  3O9R A;  3THX B;  4L3Q A;  1YXQ A;  3NF7 A;  4BGB A;  2XHB A;  1Q7Y O;  1VSM A;  1BG3 A;  1O1W A;  1P90 A;  1VHX A;  3N4P A;  1WN7 A;  4FWN A;  5MLC Q;  4DU3 A;  1HKC A;  5BPM A;  2P9P A;  3V9S A;  4DS5 A;  5C42 A;  2FXU A;  1RBT A;  5JMV A;  4E7K A;  3SAG A;  1IKY A;  2P5G A;  4YOX A;  4FJ9 A;  4DTS A;  4B8A B;  5HLF A;  1LWE A;  4CEO A;  5KGX A;  2OZM A;  2I5J A;  2QWO A;  3EEQ A;  5JS2 A;  3VER A;  4DSI A;  4H4O A;  3LDP A;  1SAZ A;  4FLT A;  3AA3 A;  3SUP A;  1C0G A;  4KB1 A;  4KB0 A;  3VTI A;  4CEC A;  3SJH A;  2IGI A;  4FWK A;  1BQN A;  3HP9 A;  2E20 A;  3A2F A;  3AVM A;  1BCM A;  3TAP A;  1KC8 O;  1IBL K;  4FJG A;  1SV5 A;  4JV5 K;  4IDH A;  3H45 C;  1FXX A;  1SKR A;  2KZZ A;  3VGM A;  3K5N A;  3SAF A;  1VSE A;  4HVJ A;  2WOM A;  1HR0 K;  2V52 B;  2P51 A;  4CD3 A;  1NLV A;  4KTQ A;  4LH4 A;  4X62 K;  1M90 O;  3ZET A;  2UUB K;  5KRT A;  4YOW A;  4W5T A;  4RW9 A;  4DR4 K;  2HST A;  3OBW A;  4FK2 A;  4CJE A;  3DAW A;  1VQ7 N;  3WNG A;  2O8B B;  2UU9 K;  2Q3S A;  3T19 A;  4BR9 A;  4TSX A;  2QXL A;  5J2N A;  3HM8 A;  4FCY A;  3O1B A;  4CFC A;  4KHP K;  3VQ6 A;  4CF8 A;  4CJ7 A;  3D2F A;  3LM9 A;  1ZBL A;  1QZ5 A;  2RF2 A;  4KKO A;  2D0P A;  1SL2 A;  4FW1 A;  5C12 A;  1RT3 A;  4BDP A;  1GLE G;  4CI6 A;  3K9J A;  2D0C A;  2DPN A;  2GV9 A;  2ZJR L;  3VQC A;  1NK5 A;  5JIC A;  4DLE A;  3LDS A;  3MN5 A;  3BP8 A;  4G1Q A;  4JK7 A;  2JWL A;  4Q0B A;  3MMV A;  5AQH A;  3FE1 A;  3EZW A;  1QQO A;  3AO1 A;  3AVN A;  5CY4 A;  3FFK B;  4BRD A;  2O8B A;  3CET A;  4FL9 A;  3PX0 A;  2DY4 A;  5F2R A;  5CYQ A;  2VQE K;  4J2B A;  4N5S A;  4BR5 A;  3CD6 N;  4KI6 A;  1HYS A;  4BGA A;  2YHA A;  1LOT B;  3S9H A;  2FF3 B;  4AIL C;  2B5J A;  4I2Q A;  1N6Q A;  5A2Q O;  2QWQ A;  1UAX A;  3TAQ A;  4RWT A;  4H0Y B;  3WXM B;  1S9E A;  4CJ4 A;  4ISG A;  2JLE A;  3UIQ A;  3W0L A;  4EZ9 A;  2AA4 A;  4GV3 A;  5DK5 A;  4OGC A;  3WEE B;  2GTD A;  2PFU A;  3E01 A;  4JD2 B;  4CED A;  1WBD A;  1S1T A;  3M8P A;  4DR1 K;  4HUF A;  4CIF A;  4B3R K;  4BE1 A;  2CGJ A;  3V4I A;  2HBK A;  2IVO A;  4B1X B;  3H3O B;  2ITG A;  2ZQB A;  3HVR A;  2HMI A;  3KJV A;  1IO2 A;  2VWB A;  1W0H A;  5JLF A;  2KQ2 A;  5LMU K;  1YT3 A;  1SS6 A;  2NRX A;  3SZ2 A;  4PKG A;  4KHW A;  3O3H A;  2JWK A;  4IJA A;  4M42 A;  2XY7 A;  3SBT A;  3AV9 A;  4RG8 A;  1VQ8 N;  4HTU A;  5M1N A;  1B9F A;  4ID1 A;  4XIU A;  2P9I A;  1ZXO A;  3ENH A;  3KZB A;  3DLL L;  3QNN A;  4K8Z A;  1NGD A;  1NGJ A;  4K25 A;  4BRI A;  4B3O A;  2BGG A;  1G99 A;  2J4R A;  4F4K A;  2ATQ A;  2IIR A;  1UWB A;  1SUQ A;  3TSQ A;  3PX4 A;  3RSE B;  3PO4 A;  1U48 A;  1KVC A;  2OPP A;  1DEJ A;  4KAZ A;  5FPN A;  4K41 A;  3GBT A;  3CC4 N;  1S6P A;  2P5O A;  3KWG A;  3UKR A;  4DV5 K;  4UY8 O;  4AM6 A;  3H46 O;  4BG8 A;  4MQ3 A;  3NF8 A;  3GL1 A;  3CMA N;  3O9Q A;  3LPU A;  1QSS A;  4FPA A;  5E84 A;  1XQS C;  2QWL A;  4DU4 A;  4GY2 B;  4KH5 A;  4BDY A;  3CCE N;  3ALY A;  4FWS A;  2ZD1 A;  2O8F B;  4KHQ A;  3HYF A;  3P38 A;  5FPM A;  5FDL A;  3EN9 A;  3LP1 A;  4E3S A;  4PKI A;  2P9U A;  1UOC A;  4O55 A;  3NE6 A;  5KTQ A;  2CH6 A;  3KKR A;  4IBN A;  4IFE A;  5GIP A;  1Q81 O;  3RMB A;  4GKJ K;  1JCF A;  4KHY A;  2FLO A;  3TU5 A;  3QET A;  3SMP A;  4H0V B;  3QBX A;  4JKG B;  4CK1 A;  1E4F T;  2I7P A;  5AQJ A;  2Q97 A;  1VRU A;  1YJ9 N;  1JLG A;  1HJO A;  1EX4 A;  1HLU A;  4WE1 A;  4B1W B;  4DUY K;  4O4G A;  1E4G T;  2ITM A;  4M3R A;  4ILH A;  4CEE A;  4KI4 A;  4DS4 A;  2ZWH A;  3ZSR A;  4N41 A;  1VQ6 N;  2GEM A;  2GWJ A;  3CER A;  4Z4E A;  4CJK A;  3AVB A;  3NH2 A;  1QVG M;  1IKW A;  5CR4 A;  3M5R A;  4NO7 A;  3RVC A;  3LP3 A;  3K57 A;  1NGE A;  5HRS A;  3VQ5 A;  1KAX A;  3ZSX A;  3T69 A;  3R9P A;  4LF8 K;  1JKH A;  4NLC A;  5LJV A;  1RT1 A;  1SQK A;  3MXI A;  1RTJ A;  1VK0 A;  3VQQ A;  3IS9 A;  4OPJ A;  1BOT O;  4M63 C;  1QQC A;  4FOI A;  4LY7 A;  2VWK A;  3CFR A;  1GLB G;  4BRG A;  4JK9 A;  2Q31 A;  4J2D A;  5FRM A;  2Q2R A;  2OAN A;  3QES A;  3TAF A;  1WSF A;  4B08 A;  4GV6 A;  4FK0 A;  3TTF A;  2NUB A;  4B9L A;  1NGF A;  4CGI A;  2OPS A;  5KPR A;  1BA0 A;  4EIA A;  1JLB A;  2YJF A;  3C6U A;  2PBD A;  2P9L A;  4O0J A;  4F2R A;  3T1Y K;  1EO1 A;  1HNX K;  1C1B A;  3QEP A;  4DQP A;  4HWI A;  2VGM A;  3CQ8 A;  3AVH A;  4CHZ A;  1VQN N;  2NRW A;  1GLJ O;  4CHP A;  4LF6 K;  4CJS A;  5FRN A;  4O44 A;  4DU1 A;  1ZBH A;  3MAQ A;  5AQO A;  4BQZ A;  4E1J A;  5T7B A;  4DFK A;  2G8K A;  3AGK A;  4WFB L;  4W5N A;  4YDU C;  4WYB A;  2YNG A;  1LWF A;  1EWR A;  5HBM A;  3MXJ A;  5FLX O;  3HPH A;  4LF9 K;  4CVN E;  3AGR A;  1BUP A;  1A5W A;  3TI0 A;  4FLZ A;  4KTW A;  2HHQ A;  2D0O A;  2GWK A;  4FVM A;  4BE0 A;  2P9L B;  3DLH A;  3F2K A;  1Y64 A;  2HMP A;  1DLO A;  4KHS A;  3H08 A;  3C7N A;  2HBM A;  1J5O A;  4DSL A;  1MWK A;  1TKT A;  3I33 A;  1YIJ N;  4F3T A;  3JSM A;  5J2Q A;  1K6Y A;  4AF1 A;  3C6T A;  2KLA A;  4B9Q A;  1XNR K;  4CBU A;  3HP6 A;  3DXM A;  4QOZ B;  1C0F A;  2VG6 A;  3OYE A;  1ATN A;  1JXB A;  5DM7 L;  1NJY A;  4Y0W A;  4CEF A;  4E7L A;  3UKU B;  2D1K A;  1BI4 A;  3M6G A;  4KPY A;  4YDU A;  5KGW A;  1K73 O;  4IFV A;  3QIP A;  2VCP A;  3JAM O;  4DLG A;  3AO2 A;  4JRQ A;  3V9W A;  3VEZ A;  1YF5 L;  3CJC A;  4H5N A;  3AY9 A;  3SAH A;  1RT7 A;  1JXE A;  1JLF A;  3ZCM A;  1HQE A;  3KHY A;  4ID5 A;  2UXC K;  1RT4 A;  3DLK A;  4Z0U A;  3KLE A;  3CG7 A;  5KQ8 A;  2EHG A;  4DQI A;  3CCQ N;  1KRP A;  2VG7 A;  3RMD A;  3HSC A;  5AFU A;  3BF1 A;  5KPZ A;  4BR7 A;  4DV7 K;  4BAC A;  3VEX A;  3LAN A;  1WBB A;  1NMN A;  2H3G X;  3ZSW A;  2DFH A;  4BR2 A;  4BRP A;  4XH4 A;  3LDL A;  4H03 B;  4BC2 A;  2YHB A;  5M1F A;  2YX6 A;  4C8M A;  4E1N A;  4EZ6 A;  4G9Z A;  2P9I B;  2HHH K;  1R0A A;  1XMO K;  3NDK A;  4E7H A;  1KFS A;  1JLC A;  4GVM A;  5EXW A;  4K0K K;  4CJT A;  4F2S A;  5KPT A;  3HOS A;  4CES A;  3OYL A;  1NGI A;  3O3G A;  5M1Q A;  1RDW X;  4IXC A;  4CK2 A;  4OPH A;  3F5T A;  3QEW A;  2HND A;  5AQL A;  3L0Q A;  3F73 A;  1W9H A;  3TR8 A;  1HNI A;  4DSK A;  5HRP A;  1TGO A;  3I8D A;  2KHO A;  1KQS M;  1EWQ A;  4A2B A;  3E1Y A;  3OYG A;  5IT9 O;  3NF9 A;  4DWI A;  2AP1 A;  1RFQ A;  2Z1H A;  2W41 A;  4ZTF A;  5FRO A;  4DQS A;  5ELZ A;  4DQ8 A;  1FK9 A;  1D4X A;  1D9F A;  1WSI A;  1CZA N;  4JI1 K;  3IRX A;  4XH5 A;  1HNW K;  3O80 A;  5AQW A;  4DTR A;  5I42 A;  1MWM A;  2QEX N;  4B1Y B;  4B3T K;  3KLI A;  3LP2 A;  4CJL A;  3OW2 M;  2HBL A;  4PKH A;  3A5L C;  3TAG A;  3ZSO A;  1HNZ K;  4K8X A;  4JI7 K;  4EP5 A;  3EY1 A;  1JL1 A;  1BDG A;  4QCL A;  4FJX A;  1HKG A;  3O4N A;  4BC4 A;  4CJ3 A;  2E2Q A;  3R3L A;  3KD5 E;  4JYA K;  2PYL A;  5HP1 A;  3G0Z A;  5CZ2 A;  4IO8 A;  4A59 A;  5E26 A;  3PLA A;  4IOC L;  1ZBU A;  2FF6 A;  4CE9 A;  4B1U B;  2ZM6 K;  2BE2 A;  4C8O A;  1V4S A;  1NKE A;  1EKE A;  5AQK A;  2IVP A;  1D5A A;  2CGL A;  3FZK A;  2ZF5 O;  4JI3 K;  1VQO N;  1X1P A;  4J2E A;  1LWC A;  3ULE B;  5EVZ A;  1WNS A;  1GOA A;  2ZJQ L;  3B6O A;  1Y97 A;  5CE3 A;  1S1W A;  4B9U A;  3RRH A;  5LMN K;  1BIU A;  1JCG A;  4DFM A;  4DFP A;  5BPL A;  3I0R A;  3SMS A;  2BAN A;  4CFA A;  4FWL A;  3KWI A;  1XUP O;  3NBP A;  1NNE A;  1MDU B;  1U04 A;  4Z4G A;  2R7Y A;  3KVG A;  3VQ8 A;  4WFN L;  3OS1 A;  3I55 N;  1L3T A;  4BY9 C;  3I56 N;  3D45 A;  4RW6 A;  2NRV A;  2EX3 A;  4OO1 J;  3E66 A;  3HZ6 A;  3CJB A;  2F9W A;  3ENO A;  4JKH A;  4C23 A;  3L4I A;  1Z6R A;  4H5W A;  4DG1 A;  4AQY K;  3VF6 A;  4I9Q A;  5EOY A;  4ELV A;  3KK3 A;  3M3Z A;  1H1V A;  3NVM A;  2RN2 A;  2ZE2 A;  4DTX A;  1K8K B;  2HNZ A;  4CZJ A;  1DT9 A;  1X9S A;  1EQY A;  3OS0 A;  3AA4 A;  1KLN A;  4DR5 K;  2Q0R A;  1RTI A;  3FZL A;  4AHV A;  3AAQ A;  1CLQ A;  4JKB A;  4CIE A;  4IFY A;  3RTV A;  3LPT A;  4PUO A;  5AZI B;  2D0B A;  2V51 B;  4DTN A;  4NCB A;  1NJX A;  1T6C A;  4NCA A;  4CHY A;  1S1V A;  4PY5 A;  1QSY A;  1D8Y A;  3OBY A;  5GAG P;  2P9U B;  1S1X A;  4DUZ K;  1S3X A;  5HOO A;  2E5L K;  4FJL A;  1KVA A;  4JI8 K;  3OHR A;  3C94 A;  4PL7 A;  1RDC A;  2HB5 A;  2P1J A;  1FJG K;  1S1U A;  2HF4 A;  4BRM A;  4OX9 K;  2W40 A;  4MDB A;  2YCH A;  3KIO A;  3SCX A;  1ZBI A;  1JLQ A;  3BZK A;  3CCR N;  5BRH A;  1QSL A;  3ATU A;  5AFU H;  4CJR A;  3OTO K;  1EXQ A;  1YVU A;  1M1K O;  1XHZ A;  1Q18 A;  3HT3 A;  3CQX A;  5J2M A;  4OLA A;  4DR2 K;  3EYZ A;  4CFB A;  2QA4 N;  4Z4C A;  2QTD A;  3ZT0 A;  4CEQ A;  2W6L A;  2Z1G A;  3SQ1 A;  1VSD A;  1QTM A;  1ZBS A;  3P83 D;  1BL3 A;  3E9P A;  4JRP A;  2ASM A;  4BRE A;  3DOL A;  2OA8 A;  3ZEU B;  5JVH L;  4CEB A;  1NBW A;  4MO5 A;  4X66 K;  3K5M A;  4CJP A;  3VGL A;  4ZTJ A;  3NVK A;  2UUC K;  1VSI A;  3SYZ A;  1TAU A;  3J8A A;  3QFP A;  3VEW A;  3CJ1 A;  4M3W A;  3QNO A;  4CJQ A;  5AQT A;  3DLE A;  3WNF A;  4BRC A;  2YKM A;  5SZT A;  1IKX A;  1TV6 A;  2V7Y A;  3LAL A;  3ZSZ A;  1QS4 A;  1QZ6 A;  1NGG A;  4M3T A;  5EU7 A;  2B6A A;  4LF7 K;  3L4Q A;  4IG0 A;  5DM6 L;  2UXD K;  4QAG A;  4A5B A;  1XWL A;  5I3U A;  1BWF O;  2Q0U A;  3VMF B;  3U3Y A;  1RNH A;  3NGI A;  1HX1 A;  1SKS A;  1NOZ A;  3MEG A;  5M1P A;  1FKO A;  4BR4 A;  3L2U A;  2UXB K;  4DB3 A;  3SK3 A;  2Z1J A;  2YHY A;  2YKN A;  1RDU A;  3ASM A;  5BR9 A;  1N32 K;  3LWL A;  1S72 N;  1Z25 A;  5GAD P;  5I9E B;  4CGG A;  1DGK N;  2ETJ A;  3GOI A;  1RT5 A;  5M1O A;  4DV1 K;  4MDA A;  3O9S A;  2LSN A;  1BO5 O;  1LV5 A;  4F9O A;  1RBS A;  3AAP A;  4B8C A;  4I2P A;  5SWM A;  4HUG A;  1ATS A;  5C2F A;  2E6L A;  2QW9 A;  4H0O A;  2RPI A;  3FFI A;  3O9U A;  2O8E B;  4JHD A;  3U4L A;  1IJJ A;  1NK9 A;  4O0I A;  1HYZ A;  2RE2 A;  4LSN A;  2RKI A;  4DV4 K;  3HRG A;  4B1Z A;  3I0S A;  3RRG A;  3EO3 A;  2OTJ N;  5AQF A;  4ILG B;  2WFB A;  2VWJ A;  3O08 A;  3JYT A;  4YY3 K;  3MWT A;  2QWM A;  2A1S A;  4A5A A;  2KZM A;  3L2W A;  4CJV A;  2BDP A;  3PV8 A;  1KSP A;  3LWM A;  3VQE A;  3U8X A;  3RMA A;  2HF3 A;  1TKZ A;  3HTV A;  1VQK N;  1HNV A;  3J7Z O;  1XMQ K;  1KVB A;  2F8T A;  3VQ9 A;  4JEP A;  1NKC A;  2XY8 A;  1UA1 A;  3T1H K;  4B9V A;  2NNW A;  3R6M A;  4GNI A;  5AQG A;  4CIG A;  3PY8 A;  1RCH A;  3DLR A;  4BWJ A;  3O1W A;  4I6M A;  3GE1 A;  4KO0 A;  4CZL A;  5LL6 Z;  1Z26 A;  2KW4 A;  2QWP A;  3CFP A;  1VSJ A;  1W97 L;  3MEE A;  2GUI A;  3D7E O;  3UB5 A;  1ZC6 A;  4DF4 A;  2WON A;  4DV0 K;  2F8S A;  3HPG A;  1C0T A;  3EL2 A;  3HVT A;  2X74 A;  4NB4 A;  3QEX A;  3AVC A;  4YOR A;  3FZH A;  3O4W A;  5FPE A;  2WBN A;  3W3D A;  2XY6 A;  3NGZ A;  4IG3 A;  4RCH A;  4AHU A;  3VEO A;  3LL3 A;  4CZM A;  2DTU A;  1GLA G;  4AHC A;  2IS3 A;  4J2A A;  1RT2 A;  4O5F A;  4LD0 A;  1B92 A;  4O5B A;  4DSE A;  4ZHR A;  3AO5 A;  3TWH A;  3D0P A;  4FZY A;  3VA3 A;  3ITH A;  3CCL N;  3ZSY A;  3R8E A;  1BU6 O;  1JL2 A;  5JVG L;  4FSV A;  4OLB A;  4CGJ A;  3SUO A;  1YTA A;  1U6Z A;  3DRP A;  1QQM A;  3TSU A;  3OYM A;  2YV0 X;  1ASU A;  4I9L A;  4M7X A;  4DQR A;  3S3O A;  4LF5 K;  2PZS A;  1IBM K;  3HPO A;  3HXM A;  3V9Z A;  1Z05 A;  4H0T B;  3CXC M;  3T7Z A;  1BIZ A;  3OY9 A;  1HJR A;  3NHG A;  2VG5 A;  2ASO A;  3ZT2 A;  1YHQ N;  3HOT A;  3TTC A;  1GLD G;  3VES A;  3NCI A;  4LFB K;  1E3M A;  1NK6 A;  3CQY A;  1SKW A;  3Q7C A;  1S5J A;  3K9K A;  1DTQ A;  2B4J A;  1J9A A;  4W5O A;  1HMV A;  1KAZ A;  4QS7 A;  1HUX A;  1N36 K;  2E8A A;  3FGU A;  2PY5 A;  4XH1 A;  3J7Y P;  3SPY A;  3A5N C;  4JN4 A;  3UKR B;  5AQI A;  2YNH A;  2WC9 A;  4OKK A;  4HCB A;  4JHD B;  3OYB A;  1GLL O;  3DLG A;  2ZGY A;  1C6V A;  4WQ4 C;  1TKD A;  4FLY A;  3E9O A;  1W2B M;  3MK6 A;  2GX9 A;  3OA9 A;  4DCH A;  4FZZ A;  4DHY A;  4LFA K;  2JGU A;  3BEX A;  3G71 N;  3KLF A;  3VGK A;  1N8R O;  3DWL A;  5AQR A;  3V9X A;  4PL8 A;  3T1A A;  4JI0 K;  2HHX A;  1DKG D;  4C1N K;  4M3Y A;  2NRT A;  3DXK A;  2NRH A;  4NYN A;  3UE5 A;  4FJJ A;  3VEY A;  4JKC A;  4JI2 K;  2F7T A;  3ZSQ A;  4ELU A;  4KRE A;  2FC0 A;  4BC3 A;  4OPK A;  2OZS A;  4BR0 A;  3J80 O;  4DF8 A;  1SL1 A;  3F9K A;  3DLB A;  3H1Q A;  1Q9X A;  4FJ5 A;  4CGD A;  1ESV A;  3O8M A;  3DM2 A;  3AVK A;  2YI1 A;  1R59 O;  3HL8 A;  3LAM A;  1RGI A;  3ULD A;  1C0M A;  4OKE A;  2Z1I A;  3QEI A;  4DQQ A;  4B9M A;  5GAH P;  1DTT A;  4CBX A;  3CME N;  3B8A X;  3OYA A;  3DXK B;  3K2P A;  3E9L A;  3K5O A;  4H0P A;  4AM7 A;  2X6N A;  2QI2 A;  3KD1 E;  1OH6 A;  3AVI A;  3QDK A;  2F9T A;  2VGN A;  4FZX C;  3EE8 A;  4FYD A;  4U67 L;  3G10 A;  4U7B A;  2P9S A;  3MEC A;  4RW7 A;  3T3F A;  3U9Z A;  3SUN A;  2FBT A;  5EY4 A;  4R79 A;  3V6D A;  3VET A;  1T6D A;  5AQY A;  3WNE A;  3CCS N;  1NJI O;  2VYP A;  1L3U A;  3JS6 A;  3KLH A;  5ADX A;  4B3S K;  3TAM A;  4CF2 A;  4E19 A;  3C65 A;  2DFF A;  5F0X A;  4J8F A;  3P1G A;  1KLM A;  3WNH A;  1U49 A;  3ZSV A;  4JS4 A;  4FLW A;  3S3N A;  2UUA K;  4M3Z A;  1X9W A;  1NJW A;  4LSL A;  1S6Q A;  3IAY A;  1F21 A;  1HPM A;  5GIN A;  1FKP A;  4V19 S;  1J5E K;  2IDO A;  4Z4H A;  3KK1 A;  4CZK A;  4JS5 A;  5C25 A;  4ISF A;  2HBJ A;  3M8S A;  5AQQ A;  3VQD A;  5BR8 K;  1XC9 A;  1X3N A;  3VN5 A;  3G25 A;  4I7F A;  5BRE A;  1VSK A;  3EKU A;  3A8Y A;  1TAQ A;  4E0D A;  3CC2 N;  3S3M A;  3SV4 A;  3IG1 A;  3LDQ A;  3UKU A;  4FJ8 A;  1XHX A;  4CJU A;  3D6R A;  3L3U A;  5DMR A;  4AHS A;  3KKS A;  4W5R A;  4DV3 K;  2F4V K;  3MCA B;  3QIC A;  4EHU A;  3NAE A;  1W7A A;  3KTQ A;  1UA0 A;  3OS2 A;  3DXM B;  2PYJ A;  5H1S Q;  4EFH A;  3Q7B A;  1OVY A;  4BRL A;  4FLX A;  4WF9 L;  3VQA A;  5AJ3 K;  1RDB A;  3CFO A;  3SBG A;  5C2D A;  4YFU A;  1RT6 A;  3VF2 A;  1NJZ A;  4JI4 K;  2O8E A;  4JKD A;  1YTU A;  3TAB A;  1SL0 A;  1CZB A;  3CHW A;  2KFN A;  1VAZ A;  5AQS A;  4YNQ A;  3EKS A;  4CZE A;  4RTF D;  3VEV A;  2XY5 A;  4OGE A;  1B9D A;  1I3A A;  1U45 A;  5GAE P;  1CXQ A;  4PA1 A;  3DI6 A;  1D9D A;  5D3G A;  5AQU A;  1HYV A;  1QQN A;  1C1A A;  3RR8 A;  3FZM A;  5AQX A;  1WOQ A;  1YI2 N;  4KHU A;  2E1Y A;  3MED A;  4BRQ A;  5F1X A;  4R5P A;  3WXI A;  4WQ5 C;  5B8H A;  5BN8 A;  3IMX A;  3WQU A;  4DR6 K;  2OPQ A;  1ZYQ A;  1OH8 A;  3M8Q A;  4CBW A;  3QIN A;  1LW0 A;  4QS9 A;  4A61 A;  1KCF A;  3TTD A;  4CZH A;  2A6A A;  4CK3 A;  1WSE A;  3OYJ A;  1L3S A;  5LJW A;  4FM1 A;  1TUU A;  1VQM N;  3O6W A;  1C0U A;  1TYQ B;  4FM0 A;  3SJJ A;  1U4B A;  1KD1 O;  4DTP A;  4N56 A;  3ID8 A;  5C10 A;  4YOT A;  1U2V B;  1RDD A;  4JLH A;  3MWP A;  1JCE A;  4BRF A;  1I94 K;  4BWM A;  4H5R A;  2E6M A;  2DFE A;  2PAV A;  3CJ7 A;  4K42 A;  1VSL A;  2HNY A;  2P9N A;  3THW B;  4YHH K;  3CM5 A;  1U2V A;  1ITG A;  1YJN N;  3NFA A;  2Q36 A;  3U6F A;  4BRA A;  3VF4 A;  2P9N B;  3THW A;  2BUP A;  1WAF A;  5HL7 L;  3PIO L;  2QWN A;  1CZ9 A;  4BDZ A;  1IKV A;  4BE2 A;  3ZT4 A;  4F8R A;  3CIP A;  4GVE A;  4PWD A;  4KRF A;  1RDA A;  1RBR A;  2P9P B;  4F3O A;  4DSJ A;  3G4S N;  3QBW A;  3WUH A;  2UYT A;  1IV0 A;  1ILY A;  2A42 A;  4IEE A;  3RR7 A;  4CGH A;  4JD2 A;  2HHT A;  2NLX A;  3K59 A;  1GOC A;  3THX A;  1NOY A;  3HM9 A;  3SQ0 A;  3IFR A;  4B9T A;  4LH5 A;  3KLG A;  2IVN A;  3QER A;  2QWR A;  3LAK A;  4CF1 A;  3PSI A;  3VEN A;  4CZG A;  1WAJ A;  3K5L A;  3QB0 A;  4PQU A;  1Q82 O;  4FJ7 A;  1N5Y A;  3P39 A;  2G8V A;  2E2O A;  4NCG A;  4Y1D A;  2NRR A;  4WFA L;  1XNQ K;  5HRN A;  1JLA A;  3OYN A;  3PIP L;  1KTQ A;  3IUC A;  4JAX A;  4X64 K;  4XEI A;  4BVP A;  3OYH A;  4FJI A;  4DR7 K;  3ZEU A;  2YHX A;  3DYA A;  5HRR A;  4FPB A;  4FJN A;  1N34 K;  3V9U A;  4BVO A;  3ENB A;  2IC3 A;  3AAR A;  1TYQ A;  3H6E A;  5K14 A;  3OJU A;  1K8K A;  3HI0 A;  4JK8 A;  3TAN A;  1OKJ A;  4IJN A;  2XO7 A;  4CCH A;  3PSF A;  1X9J A;  4DTU A;  3BUZ B;  4FVU A;  4X65 K;  1NGB A;  4HTL A;  1YJW N;  3G6E N;  5IWA K;  2P9S B;  1T8E A;  3GDQ A;  3L3V A;  4DV6 K;  3ZT1 A;  4KH6 A;  1T3V A;  2WTU A;  1BQM A;  4N76 A;  4B3M K;  2OTL N;  1NK7 A;  1O13 A;  5C0Y A;  2HVH A;  2FSK A;  3LM2 A;  2CH5 A;  3ZX0 A;  2HW3 A;  2F96 A;  3P4I A;  2YNF A;  3AVL A;  2KFZ A;  2QXF A;  4BRO A;  3MN9 A;  3THY A;  2RHK A;  3LDO A;  3IKM A;  1K9M O;  3CC7 N;  4LC9 B;  1GOB A;  4H5V A;  3QML A;  3SNN A;  5M1K A;  5HRO A;  1Q86 O;  4ILJ A;  1LAW A;  3P31 A;  2QKK A;  4Y1C A;  4JKA A;  1YUW A;  5C15 A;  3SQ2 A;  3VQ7 A;  1NGA A; 
#chains in the Genus database with same CATH homology
 4JI6 K;  1N33 K;  3OTO K;  4LFB K;  4DV7 K;  4JI3 K;  2VQE K;  4DR2 K;  4DV4 K;  3T1Y K;  1HNX K;  4DV5 K;  1N36 K;  4YY3 K;  3J7Y P;  1XNQ K;  4B3S K;  4LF6 K;  5LMN K;  2HHH K;  2VQF K;  1XMO K;  5A2Q O;  4X64 K;  4DR6 K;  1XMQ K;  4DR7 K;  4X66 K;  2UUA K;  5FLX O;  3T1H K;  4LF9 K;  4LFC K;  4K0K K;  4CVN E;  2UUC K;  1N34 K;  4V19 S;  1J5E K;  4LFA K;  1IBL K;  4JV5 K;  5LL6 Z;  3J7A P;  4NXM K;  4LF4 K;  4GKJ K;  5BR8 K;  4AQY K;  4JI0 K;  1I94 K;  1HR0 K;  4DR1 K;  4X65 K;  4DV0 K;  4X62 K;  5IT9 O;  5IWA K;  3J81 O;  4DR3 K;  2UUB K;  4B3R K;  4JI2 K;  4DV6 K;  4YHH K;  4CW7 B;  4DUY K;  1XNR K;  4DR5 K;  4DR4 K;  4LF7 K;  2UXD K;  4JI1 K;  1IBK K;  4B3M K;  1HNW K;  3J80 O;  4DV3 K;  2F4V K;  2UU9 K;  4B3T K;  5LMU K;  4JI5 K;  1HNZ K;  4KHP K;  4JI7 K;  2UXB K;  4DV2 K;  4LF8 K;  3JAM O;  5AJ3 K;  1N32 K;  4DUZ K;  4JYA K;  2E5L K;  4JI8 K;  1FJG K;  4JI4 K;  4GKK K;  4OX9 K;  4DV1 K;  2UXC K;  4NXN K;  4LF5 K;  2ZM6 K;  1IBM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...