4LFCK

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lfcK00
4X65K 5AJ3K 3JAMO 4LF4K 1N34K 1I94K 1J5EK 1N32K 4DV0K 1N36K 4LF9K 4X64K 2ZM6K 4NXNK 2UUBK 5A2QO 4GKJK 4OX9K 4LFAK 4LFBK 3T1YK 4DV1K 4X62K 5LMNK 1HNXK 4DR3K 2UXBK 1HNWK 4CW7B 4JI5K 4JI1K 4YHHK 4B3RK 1FJGK 4JV5K 3J7YP 2HHHK 4JI8K 3J7AP 4LF7K 5BR8K 4DR2K 1IBLK 4GKKK 1HNZK 4JYAK 3J81O 2UUAK 4DUYK 2UUCK 4KHPK 4DV6K 4LF8K 2VQEK 4B3MK 1XMQK 4DR5K 4LF5K 2F4VK 4DR1K 4DV5K 1IBKK 1XMOK 4X66K 4JI2K 3T1HK 5LMUK 2UU9K 4V19S 4JI7K 4AQYK 5IWAK 2UXCK 4LF6K 4CVNE 4LFCK 2UXDK 1N33K 1XNQK 4NXMK 2VQFK 4DR6K 4B3TK 4DUZK 3J80O 1IBMK 4DV7K 4JI3K 4DV4K 2E5LK 4K0KK 3OTOK 4B3SK 4JI0K 4YY3K 4DV2K 1HR0K 5IT9O 5FLXO 4JI4K 5LL6Z 4DR4K 4DR7K 4JI6K 4DV3K 1XNRK
chains in the Genus database with same CATH superfamily
4DFPA 1N34K 4CZKA 1QSLA 3LANA 4FWRA 4F3OA 1HPZA 2HHTA 1RDDA 3DRSA 2X78A 2QKBA 3OY9A 4M7YA 4O8KA 2O8FB 4R79A 4PL8A 1M1KO 1HX1A 4X62K 1OH6A 4KB0A 3VEYA 4A5BA 2LSNA 2VWJA 5TKWA 1BI4B 1S1TA 3CF5L 1HYSA 4CFCA 4FJHA 2O8BB 1VQMN 4B08A 5KGWA 4JNEA 5HRPA 5HRNA 5HLFA 3IUCA 2E4LA 4DTJA 1TAUA 4A5AA 4E89A 5HRSA 4BRDA 1B92A 1BQMA 1QS4A 4CHNA 3IKMA 3QINA 2VWKA 4LC9B 5JS1A 2DFHA 1WNSA 3G0ZA 1DEJA 4FWKA 4FO0A 2PY5A 4OO1J 3CCJN 3O1BA 3ALYA 2KZMA 3VEWA 3LZJA 1NM1A 3R1XA 4PKIA 3ZLJA 4DV5K 4DQIA 4HUFA 2QW9A 3BDPA 2OZSA 2ZGZA 3CJAA 4E7KA 1I39A 4GY2B 4CJ3A 4CJKA 2QWOA 3THXB 4PWDA 4IG3A 2Z1GA 4B9SA 4NYNA 4OPKA 4FZYA 5C24A 3QETA 1RT4A 3S3MA 3PV8A 3A5NC 3A2FA 4KTQA 3L2UA 3DMJA 2NRVA 4FWMA 2O8DA 2E1YA 4DTMA 5CYMA 3DI6A 3L2WA 1RBSA 1U04A 1VQLN 1RTIA 3HTVA 4FVUA 1FW6A 3VF4A 1JLFA 1HMVA 5AQLA 1YJ9N 4KTWA 4X65K 3CCSN 4LF4K 3CM5A 3HP6A 3SAHA 5M1NA 2OPPA 4HVJA 3VN5A 3CC7N 1QHTA 5KPZA 2E2OA 5KGXA 4LSLA 4CEEA 2GELA 1OH5A 1IH7A 1NGDA 4IJNA 1HKBA 3F5TA 1HUXA 3AAPA 1RNHA 2QXLA 1ZXOA 1C0MA 1TK5A 1HPMA 1C0GA 4FM2A 4EZ9A 3DXMA 4DTNA 2OZMA 3KD5E 1CXUA 1ATNA 3KK3A 1NOYA 1RBRA 2D0OA 3GOIA 5ELZA 4A61A 4A62A 2IS3A 1RILA 2YKNA 4BC3A 3WXLA 4K43A 1QQCA 1QZ5A 3RTVA 3HOTA 2E2NA 3AVGA 2O8CA 3MDQA 3L0QA 4CHQA 5E84A 2YNHA 1QVFM 4B9UA 4W5OA 4YNQA 1HQUA 1LCUA 1X9SA 4DLEA 1DGKN 1KD1O 1VK0A 2P9NB 4H0YB 5CHIA 3WEEB 3EE8A 4H0XB 4M42A 3E9OA 4DR1K 2WFBA 4ICLA 3TTFA 5AFUA 1VHXA 3OYNA 4E3SA 4CJWA 4LD0A 2ETJA 3LDOA 3KLEA 3VGLA 1X1PA 5JS2A 4CJSA 4CVNE 1D8YA 1Q86O 4CZIA 3NVKA 5EOYA 3ZSVA 1TV6A 3BF3A 2ITMA 3LDQA 2GX9A 3NF9A 2XY8A 5TKYA 4KB1A 4CZEA 1C1AA 2CGLA 4B9QA 4OLAA 4Y1CA 4FL9A 4JLHA 3HVTA 2W6LA 2XY6A 4E0DA 1EWQA 3QEPA 3KKSA 1EQYA 3ZETB 1JLGA 1QSSA 4FZXC 2IIRA 4LH4A 4JRQA 1RBUA 4FJGA 4N41A 4DFKA 1A5WA 3W3DA 4FJIA 3T69A 3OS2A 1ZBIA 3THWB 1T05A 4PKGA 1X9MA 4CEBA 1JL1A 3ZT0A 4IFYA 4FK2A 4EAHD 1K9MO 2WBNA 1D5AA 1KQSM 1VSIA 2FBYA 3VTHA 1T03A 4IDHA 2OTLN 1YJNN 1X9WA 4OPJA 3RR8A 4NCBA 1WSJA 4CZFA 3WNEA 3O4WA 4IZ9A 4MO5A 3AGRA 4FXDA 4CZGA 3ZSXA 1GLJO 1HNIA 4KREA 4JKCA 1EETA 4GNIA 2FBTA 3O4QA 5FPEA 3UKUB 1GLEG 3SQ2A 2HHQA 4B9MA 4O8UA 1R59O 3J81O 2UUAK 4E7LA 1HYZA 4BRQA 3RSEB 3K5NA 3HO1A 2G8WA 1CZBA 1ASVA 3MCPA 2NRWA 4EP4A 1KFDA 2QKKA 1SKRA 3AVHA 1KVAA 4H0VB 3OYLA 2HBMA 3JYTA 4DR5K 3NH0A 1GOAA 2ZE2A 3O4NA 3M1FA 4CD3A 3MN9A 2WOMA 4IDKA 1JKHA 2HHVA 1SL0A 4CF1A 3THXA 2UU9K 4WQ4A 4RW9A 4KI6A 1XWLA 3DAWA 3AO3A 4AHUA 4LH5A 5GAEP 3O6WA 4ZTFA 1RBTA 4H5NA 1UA1A 4IOXA 3CCRN 4NXMK 2VQFK 5J1EA 3NFAA 2DPNA 5J2NA 2G8UA 3KHYA 4XH5A 1FXXA 3HOSA 3ID6A 2P9IA 3ENBA 2DFEA 5EVZA 4J2EA 1OH7A 3MXJA 3HL8A 1T3VA 3CYMA 3CMAN 4DTRA 1GOBA 4JK9A 1GOCA 2E20A 5AQNA 1YIJN 3KLHA 3VF2A 1RT2A 2YV0X 1BA1A 2R7YA 3EY1A 1Q9YA 2FF3B 3M5RA 2Q3SA 4JAXA 4E1MA 2D1KA 3GE1A 4CHPA 4BREA 4FLXA 3LM2A 4FPAA 4E7HA 4CF8A 4DR3K 5M1OA 1YT3A 2RN2A 2GUIA 3EO3A 3HXMA 1BGXT 2D4WA 1HNWK 3ID8A 4JI5K 2IVNA 5CYQA 1X3NA 1KVBA 3DOKA 3ZT1A 3O3GA 1WBDA 2NRHA 3LM9A 5T7BA 5AQHA 4DR2K 4DS4A 1ZBFA 2YHYA 4JYAK 3OA9A 3TR8A 4FWOA 4B3OA 2YX6A 4CEQA 4RW7A 3CETA 2ITGA 3VGKA 3AO5A 3DOLA 3P83D 3ULEB 3HP9A 3CPWM 4ILJA 2ATQA 1WN7A 3BEXA 3E66A 3ENHA 3ASMA 3EKSA 2O8EA 1KTQA 1HYVA 4FVMA 4FM1A 1RDUA 2FSNA 4W5QA 1QQNA 4QS9A 4B1VA 4BGAA 5C12A 1FKPA 4B1WB 4CJRA 1VSFA 5LY3A 5BRDA 2FF6A 3DRPA 3O9TA 5MLCQ 3TAFA 3QO9A 3ULDA 3B6OA 3CM6A 4KHWA 4HCBA 3KLGA 4JI0K 2Q36A 3CJ1A 1NK7A 2Z1IA 3DLEA 3SZ2A 4ISGA 3MMVA 3DXKA 3SUNA 2Q2RA 3I33A 5JICA 3VGMA 3NH2A 5DK5A 3FFKB 3D0PA 3TAQA 5AJ3K 3H45C 1GLLO 5BN9A 2QA4N 1C6VA 4M3ZA 3TABA 3AY9A 3ZSOA 3K57A 4I6MA 3DLHA 4H5VA 4DFJA 4PQUA 2YHBA 2YCHA 3T1YK 1J9AA 1K73O 5FPNA 3K5OA 5AQSA 4N76A 2P9SB 3DWLA 4FJXA 5AQKA 3V9XA 3VENA 1U2VA 3PLAA 2UXBK 1NOZA 5M1QA 3OBWA 3NHGA 4CJTA 3DJCA 3G4SN 4OKEA 2GWJA 4JI8K 3VEXA 3N4PA 1BCOA 4Z0UA 4XIUA 3G71N 4KV8A 5CZ1A 3LAMA 1BUPA 4IG0A 2JWKA 4DTPA 3LPUA 3L3UA 4J2AA 1REVA 4EFHA 2DTUA 4NYFA 5KRTA 3OYIA 3IG1A 1BIUA 4O44A 1RGIA 3KK1A 1L3SA 4BRPA 4E1JA 4DCHA 2D0AA 1NKCA 4FJ7A 2EHGA 1LAVA 2F4VK 1JLCA 3QBXA 4JKGA 2ZJRL 4UY8O 3OYDA 3P38A 5J2QA 4HUEA 3NF7A 1HRHA 1TYQA 3HM8A 4JRPA 4BRKA 3DYAA 1RT7A 4CE9A 3QEIA 2WTUA 4W5NA 4MDAA 1SZ2A 4J2DA 4DFMA 4B3SK 1X3MA 3EN9A 4YY3K 5FPMA 3DRRA 3CCVN 2IC3A 3D2EB 5FDLA 3CFPA 3WQUA 4Z4HA 4FOIA 2QXFA 5AQMA 1N32K 3OYCA 1Y64A 3I8DA 4CJQA 4M3RA 1TAQA 3O08A 2HMIA 3HSTB 4OX9K 2VWBA 5F2RA 1G99A 3PIPL 3MN7A 4CBXA 4I9LA 1BHLA 1EX4A 2XRIA 4OLBA 3L6QA 3CIPA 3PUFA 3F9MA 4CIEA 1S6PA 4NO7A 1NG9A 3I0SA 3TARA 3PX6A 1O13A 2QWNA 4PL7A 1VQ4N 4KRFA 1NJIO 1Q81O 1R0AA 3S3NA 3CC2N 1VSEA 3BUZB 4CJLA 3O5BA 3BZKA 4IJAA 1NGGA 1N8RO 4JN4A 1B9DA 2VGNA 1CLQA 3VETA 1VSJA 3OJUA 1C1BA 5CR4A 1T8EA 1RT1A 4KHPK 4DV6K 3SPYA 1KC8O 4OPAA 1BDGA 4CJ4A 3C7NB 5ADXA 3ZX3A 1NKBA 4WQ4C 4TSXA 4CHOA 5C2DA 1XMOK 3PO4A 4DTSA 4X66K 2F9WA 4I7FA 1K8KB 4Z4IA 2RKIA 4MFBA 3KJVA 2B5JA 3TU5A 3CCMN 3V9WA 4BGBA 1WBBA 3DLGA 5BREA 3U3YA 3C94A 2IDOA 5BR9A 1VQKN 5IWAK 4AF1A 2QWPA 3CJBA 2HNYA 2AJQA 4HTLA 1Q9XA 3D2FB 3WNHA 4DU4A 1N33K 4BRHA 4B1ZA 3H3NO 4DQSA 2W40A 4G1QA 4DUZK 4BACA 1IBMK 1X9JA 1RDAA 1NGJA 1V4SA 1HNVA 4K0KK 4FYDA 3OTOK 4KAZA 4DQQA 1S9GA 4IKFA 3CFRA 2HNDA 3F73A 4WF9L 4U7BA 5AQOA 1SQKA 1NK0A 4DB3A 2YHWA 3NVMA 4DV3K 1TK8A 3D45A 1KVCA 3AARA 2CGJA 4Z4EA 1ZBHA 4WCEL 4DV0K 3H1QA 1TUUA 4FLZA 4CD1A 2CH5A 3AA3A 4DTOA 4BDZA 3D2EA 1UAXA 4A59A 3K5MA 1QQMA 3I0RA 1NJWA 3A5LC 1BWFO 2VG5A 1WSFA 4DV1K 1HKGA 5FROA 4DQRA 4BQZA 4ISFA 1NJZA 4BC4A 1TKXA 3AO2A 2HB5A 3AA2A 2GBZA 2D0CA 1NMDA 2BUPA 4BRGA 3VA3A 4F4KA 2JLEA 3P5JA 1S1WA 5M1PA 4C8LA 2QWRA 1XC9A 3NF6A 2ZQBA 4IEEA 4GVEA 3WT0A 4CGHA 1HNZK 4YOVA 4DUYK 3DXKB 1ZBLA 2F8TA 4ILHA 1ESVA 1HKCA 1SAZA 3KLIA 1ITGA 2ZJQL 4JKGB 4FJKA 1KLMA 1Q8IA 4DF4A 4BDPA 2O8DB 4NLBA 4LF8K 2PYLA 1TGOA 2PZSA 1IKYA 1KLNA 5SWMA 3ZSQA 1DTTA 3SYZA 1KAYA 3QEVA 5M1FA 2NRZA 2OPRA 3VQ6A 2A1SA 2WC9A 3VQQA 2F8SA 3VQ7A 3QBWA 5BN8A 3UKRB 3WUHA 2V52B 1DTQA 4RWTA 3BF1A 3SK3A 2I5JA 1W2BM 1S9EA 3K9JA 1MWKA 3ZETA 1U6ZA 3L4QA 4LFCK 1GLDG 5JLHA 3VQBA 5KPRA 1S5JA 2P5GA 4DR6K 4YOYA 3OYAA 3DXMB 3CMEN 1NBWA 1RCHA 3DM2A 3VQAA 1RDBA 1Z26A 2Y1IA 1XHZA 4KI4A 3FZFA 5I42A 4AHCA 1NMNA 3TAEA 4KFBA 4AILC 1D9DA 3TSPA 3OYHA 2IVPA 4RTFD 1XNRK 4FW1A 3VQ4A 4EIAA 1A5VA 5DM7L 4A2AA 4B1UB 3QMLA 4GKJK 1I3AA 1EKEA 5EXWA 5C0YA 5JVGL 4K8XA 3KTQA 4B9LA 1LWCA 3QEXA 2PYJA 4CK2A 3DLLL 3EKUA 4FJ5A 3IRXA 1QE1A 3HRGA 2NRTA 3KKRA 1VRUA 4CZHA 1JJ2M 2XO7A 1ASUA 3O80A 1BG3A 4FZZA 4DKWA 3H08A 4BG9A 1W7AA 4FCYA 4M3YA 4BR4A 3SAFA 3P4IA 1YHQN 1HQEA 3OYJA 4QS7A 4CESA 2PFUA 3GDQA 5KTQA 1GLBG 3AVFA 3LZIA 5GADP 4AM6A 1RDWX 3ATVA 3AVNA 3QIPA 3LDLA 3OJSA 3KLFA 3CJ9A 4BR2A 3AVCA 3CI5A 2VQEK 4ILGB 2V7YA 4I9QA 2VG6A 1OVQA 1MU2A 4J2BA 1K6YA 2E88A 5AQRA 3SJHA 4BRLA 1VQPN 4DU3A 1NGEA 3WXJA 3T1HK 2GEMA 4KH5A 4RW8A 3KD1E 2G8FA 2YNIA 5JLFA 2RPIA 4DTUA 2RHKA 3HPOA 2FSJA 4ZHRA 4MQ3A 3NGYA 4Y1DA 2QTDA 4K25A 4LF6K 4DMNA 1JCFA 2FC0A 1Q7YO 3VQEA 5DM6L 2UXDK 1ZBUA 3E1YA 1BO5O 3HK2A 2AP1A 1KFSA 3SNNA 2W41A 4BY9C 3MEEA 2A41A 4BC2A 4F2SA 4WE1A 1XHXA 4MO4A 4IFVA 1W9HA 2QM1A 1T6DA 2V51B 3FE1A 1QSYA 1ATSA 3FR0A 4H5TA 2GV9A 3SPZA 2XY5A 2HHSA 1JL2A 3ZSYA 3N4QA 1CZAN 1W0HA 4BC5A 3L2VA 3B8AX 4OVLA 5LMNK 2I7NA 4BRAA 2KQ2A 4LY7A 3V6DA 2Q31A 4L8RB 1GLCG 3D6RA 4C8NA 4CIFA 3THVA 2FBXA 5C15A 2OCEA 4CERA 1ZBSA 3MXMA 4JI1K 3Q7CA 4YHHK 4KHUA 4JS5A 1WAFA 1VQ6N 2FSKA 4LF7K 3CPEA 4RG8A 4G9ZA 3AVBA 3M8QA 1UOCA 3BY5A 2B4JA 3GG4A 3I55N 4CEDA 1TKDA 5AFUH 3J8AA 5EY4A 3H1VX 1SV5A 2Q1NA 3SUOA 3JXUA 1TKTA 1DLOA 4BDYA 1JXBA 3HYFA 3FZMA 3TAGA 4LF5K 1RBVA 2BTFA 3M6GA 4DHYA 3P39A 4ELVA 4DF8A 4M63C 5B8HA 4K42A 4JI7K 4FWNA 2O4IA 3MN5A 4O5FA 5E26A 1C0UA 4YOUA 1N6QA 1NGFA 3G10A 4C8KA 3AA4A 1E4GT 4NB4A 3S3OA 3NGIA 3ZEUA 5AQVA 3LAKA 3RVCA 4OGEA 3QICA 5CZ2A 3WXKA 3AVJA 1U45A 3DLRA 4DLGA 5SZTA 1S72N 3CJ7A 4DSKA 3TANA 4KBOA 3ZSZA 5BPLA 4YDUA 2DY4A 4FW2A 1ASWA 3NDKA 4CEOA 1TK0A 4JD2A 4HTUA 4ELTA 2Q0UA 4JI6K 1LAWA 1WSHA 3SQ1A 2VGMA 3HPGA 4QCLA 2BH1A 3JAMO 3SAGA 4MDBA 3PIOL 3NE6A 2P9PB 3NBPA 3JS6A 1J5EK 3FGUA 1IG9A 2ZM6K 3TAPA 1BA0A 3VQ9A 1YF5L 4EHUA 4KHYA 4LFBK 4CBWA 3HZ6A 2PBDA 4HWIA 3KK2A 2FXUA 4F2RA 3L2QA 1NKEA 4N56A 4JS4A 3VQ5A 3H6EA 2HSTA 5AQUA 2HVIA 3O8MA 2HF4A 3TAMA 3CCEN 1D4XA 1VSLA 1VQON 3BGRA 1NJXA 4B3RK 3ZYYX 3TTDA 2E6LA 3OS0A 4IBNA 4CF2A 2W42A 2HMPA 3KWIA 4I2QA 5M1KA 3HPHA 4CZMA 2O8FA 1UA0A 4JK7A 3SQ0A 5AZIB 5AQPA 5K14A 4R5PA 3IS9A 3AO4A 2O8BA 3F2KA 2P51A 4NCAA 2HOEA 1Y97A 3OYEA 3CG7A 1XMQK 4GW6A 2HBKA 1JCEA 1TYQB 1OVYA 2X6NA 3QB0A 4HHTA 4BWMA 5HRRA 3LP1A 4JI2K 3HVRA 1OKJA 2IOCA 3AVAA 1JLAA 1RDCA 4H4MA 5LMUK 5AQGA 1U49A 3OYFA 1HJOA 4JD2B 5E41A 1YI2N 4E1NA 4FM0A 3QIOA 2KKZA 1W97L 4EZ6A 4CGJA 3EZ5A 3JSMA 4CIGA 1JXEA 3TSQA 2BDPA 4B8CA 2E6MA 1G15A 3MCAB 3QERA 2D0PA 1WSGA 3OVNA 4FWSA 2KW4A 3R3LA 4Z4FA 5AQTA 4CI6A 4JHDB 4RCHA 4JKEA 4IO9L 5BRFA 4DSFA 4Q0BA 3KK7A 1Z25A 5FLXO 4JI4K 4MLEA 1VSHA 4DR4K 4Z4CA 1NU0A 4B9TA 4H0OA 4A57A 4BR0A 4RW4A 5AQWA 4YOXA 5FPDA 1BIZA 3ISNC 3THYB 2KZZA 1TVRA 3C65A 4BQLA 3ATUA 3PSIA 4FLTA 4LFAK 5I9EB 3RMBA 4FSVA 2A6AA 2NNWA 1S1XA 3WNFA 4M45A 4CCHA 1SKWA 1EP4A 5BPMA 1LV5A 3ZX0A 2KFZA 1TL3A 5KQ8A 4F9OA 3LDSA 4M41A 4MLHA 5AQQA 2WUSA 3ZT2A 3C95A 3A5OC 1U4BA 2ZGYA 3WNGA 1S6QA 4K41A 5LJVA 1BQNA 5AQXA 4WFAL 2Z1HA 3RR7A 2VCPA 3D7EO 2Q97A 2ZF5O 4KHNA 5HL7L 4FPBA 1YXQA 4DWIA 3MWPA 1L3VA 2F9TA 3M3ZA 1QTMA 4DSIA 3LL3A 5EX5A 4C1NK 2HBJA 5F1XA 1NNEA 1RT3A 3I8BA 3TI0A 1LW2A 4W5RA 5AQJA 3C6AA 3U4LA 4L3QA 5C42A 1IG8A 1IKVA 2B6AA 4GV3A 4LSNA 1L5UA 4FLUA 5AZIA 4IOAL 4WQ5C 1L3TA 3AAQA 1LWEA 3L3VA 3O9QA 3OS1A 4HUGA 4YOTA 1IO2A 3W0LA 1GLFO 3IFRA 3AVLA 2GUPA 4CGGA 3S9HA 2IVOA 3NH1A 3P31A 1NK6A 4JI3K 3M8RA 3VEZA 3CJCA 4OKJA 3AO1A 3AVMA 1CZ9A 4DSLA 3FZKA 1E4FT 1HR0K 3V1OA 5CY4A 1M90O 4PA1A 3BP8A 4H0PA 3KWGA 2DFFA 2HW3A 1O1WA 1I94K 3HI0A 4IFEA 4WQ5A 3SV4A 3CCLN 4X64K 4NXNK 1WOQA 4CJUA 2GWKA 2P9KA 3ZCMA 1YJWN 3K9KA 4H5RA 3WQTA 5I3UA 4EP5A 3I56N 1YTUA 5KI6A 2A5XA 4B1YB 3QNOA 1WSEA 1VQ8N 4GV6A 1QVGM 2NUBA 4M3WA 1U48A 1KCFA 1QZ6A 2F7TA 1LOTB 1MDUB 4FJJA 1TUYA 2KHOA 2G8KA 3E9LA 4E19A 4CEFA 3CERA 4ZTJA 1GLAG 3J7AP 2A40A 2FBVA 3MECA 3VERA 1VSMA 3U6FA 4GVMA 4I2PA 4B9NA 4NCGA 1J54A 4AHRA 4FJMA 4AH9A 4FLWA 3H46O 3VA0A 2Z1JA 2AA4A 3K58A 5ADXH 5BRHA 4I6MB 1L3UA 4BROA 1NGCA 4FLYA 3SJJA 3DLKA 2NLXA 2FLOA 2WONA 3V81A 4O5BA 2D0BA 3L2RA 3V9UA 4PUOA 2YKMA 4U67L 4B3TK 3K0SA 3C7NA 1F21A 1NWKA 2YHXA 4YDUC 4DV7K 2H3GX 4M3XA 2G8IA 4M3UA 2HVHA 4BRMA 2KFNA 5LJWA 1JLBA 1DT9A 4BRIA 3NGZA 5GINA 5KPTA 2V7ZA 3O9UA 2QI2A 3VQCA 2BE2A 3SUQA 5FRNA 4BWJA 3SMPA 4ID5A 5H1SQ 4O55A 4CJPA 3K2PA 4FJ9A 1IV0A 2HF3A 1EO1A 1D9FA 2YHAA 1C1CA 2YNGA 1P8ZA 2RE2A 4E7JA 4J8FA 1RFQA 3C6HA 3VF6A 2P9LA 2A1RA 4A2BA 3SCXA 1E3MA 1HNXK 2ASPA 3IAYA 3RMDA 3OYBA 3L8BA 3HSCA 3RRGA 4CEAA 2ZWHA 5GAGP 3LP2A 1S1UA 1H1VA 5J2MA 3J7YP 1KRPA 2RF2A 2PAVA 3J7ZO 1LWFA 1RTJA 1NK4A 2XY7A 1Q18A 1IBLK 1SUQA 3EEQA 3NCIA 3SBTA 2Y1JA 1K8KA 1S22A 4BR5A 4CGFA 5BPNA 3MAQA 1YITN 4H4OA 1NGAA 4KO0A 4KH6A 1VSDA 1KAXA 4B3MK 1T7PA 5HBMA 3U8XA 4QAGA 4WFBL 1BU6O 1U47A 3V9SA 3S41A 4IOCL 1IBKK 3R9PA 3WXMB 5AQFA 3R8EA 4CZJA 5EU7A 2P9LB 3O1WA 4BVPA 1BI4A 2P9PA 3FZLA 3AVKA 3A0IX 4FJ8A 2P9NA 1WB9A 3QEWA 1MWMA 4JKBA 1BCMA 3VPZA 2UXCK 2NRRA 3CD6N 3O9SA 4Q5VA 3LP0A 1KSPA 2P9UA 1XNQK 5HOOA 3Q7BA 4DSEA 3OBYA 4H03B 3SQ4A 3OHRA 3A5MC 3SUPA 4CJ7A 4OPHA 4H8KA 2Q0RA 5FRMA 4FWPA 2VG7A 5IT9O 2BGGA 3RMCA 1RT6A 1RTHA 1U2VB 3MXIA 4DR7K 3IDHA 1C0FA 4DG1A 4FWQA 4O4GA 2P1JA 4H5WA 5C2FA 4BE0A 3MN6A 1YVNA 1NJYA 4CF9A 3O9RA 1YUWA 3M8PA 3C0BA 3WXIA 2QK9A 5J2PA 4UQGA 1FK9A 2P9KB 4BRCA 2UUBK 3ZEUB 4B1XB 4FK0A 3E01A 2JWLA 3ZX2A 4IO8A 3RRHA 2A42A 5JMVA 2I7PA 4FK4A 1S3XA 3NMUA 3PX4A 3EE9A 4DQ8A 3HM9A 4F3TA 1EXQA 4BG8A 4BVOA 2HHXA 1VAZA 1NGIA 3EYZA 3EL2A 4IXCA 4M3TA 1ATRA 3VESA 2HHHK 3ENOA 4C23A 3PX0A 1VQ9N 4O0IA 4GV9A 4CGDA 2VYPA 3A8YA 4KTZA 4CEZA 4DQPA 4HCCA 4IWVA 3UE5A 2QEXN 2X74A 5GAHP 4XH4A 2UUCK 4CECA 3M8SA 3V1RA 2CGKA 1ILYA 3OYKA 1RT5A 3TTCA 1NK8A 3UKUA 1KAZA 5C10A 1IJJA 1IKWA 3V9ZA 3O3FA 4XH1A 4EHTA 2E2PA 4BR7A 3QFUA 5F0XA 1J5OA 3F9KA 1JLEA 4AM7A 1VSKA 2IGIA 3HBTA 3G25A 3H3OB 3GBTA 5AQIA 2OTJN 4C8OA 3QNNA 1UWBA 3P1GA 3VEOA 2BANA 3T19A 4OKKA 4BE2A 1ZC6A 3LWMA 4CHZA 2YJEA 4B8AB 2J4RA 3QDKA 3MK6A 2EX3A 2JGUA 4N47A 3O3HA 3TPQA 2F96A 4M7XA 1SKSA 4GMJB 3SI6A 2QWLA 4CJFA 3AA5X 4DV2K 4BR9A 4FLVA 5KQDA 2O4GA 2ZJPL 2G8HA 2EWSA 1TKZA 1V4TA 1VQ5N 2YJFA 4RW6A 4YORA 3VOVA 1SL1A 3NAEA 4Z4GA 3ZT4A 2D5RA 1NLVA 4C1NI 2QWMA 3MX2A 3FLCO 1N5YA 2G8VA 5A2QO 1XI1A 2OA8A 3ITHA 1NGHA 2OYQA 4YOWA 3RWUA 3OYMA 3DLBA 1TL1A 3LDNA 1XQSC 3GL1A 1P90A 5AZJA 5KRSA 5HROA 4CJEA 1ZYQA 1XC3A 3KIOA 3U9DA 4JK8A 3HJFA 4OGCA 4CW7B 3U9ZA 2O8CB 4JHDA 1QHAA 3QLHA 1FJGK 4JV5K 2X6SA 1VQNN 4QOZB 3WEEA 4FWLA 1JCGA 4XEIA 3IMXA 3C6TA 1BOTO 2XHBA 2CH6A 3T3FA 1Z6RA 3KVGA 3TSUA 3B6PA 3OYGA 4JKDA 1LW0A 2P9IB 1FKOA 3D2FA 3CCQN 4YFUA 3THYA 1B9FA 1SS6A 1MA9B 2IAJA 3VQDA 3UIQA 1EWRA 4AHTA 3AGKA 3FZHA 4ISEA 4CF0A 5D3GA 1VQ7N 2YI1A 4PY5A 1VRTA 3E9PA 3SMSA 3NF8A 3BZCA 4N5SA 4V19S 3CFOA 4KH4A 2NZTA 3OW2M 3R6MA 5AR0A 2NRXA 3LWLA 2HHWA 3QFPA 3MEGA 2HNZA 5CE3A 3MWTA 4DU1A 3J80O 3RSEA 3T7ZA 2W6KA 4ID1A 4ELUA 5C25A 3LP3A 3K5LA 2ZD1A 1DKGD 1YVUA 4O0JA 4NLCA 3U3GA 1NK9A 4CFDA 4QS8A 1Q82O 5AZJB 2E2QA 3TWHA 4BE1A 4F8RA 3FFIA 3THWA 4K8ZA 4B9VA 1JLQA 4CZLA 3QESA 5HP1A 4CGIA 2E8AA 4IEIA 4PKHA 4Z94A 1SL2A 1N36K 3ULEA 4LF9K 3PY8A 4DS5A 4FJNA 4Y0WA 2HBLA 1WAJA 3MEDA 4BRNA 3SV3A 1NK5A 3LPTA 1WSIA 1T6CA 4CBUA 2E1ZA 1KXPA 3LALA 2O8EB 3VMFB 3CC4N 5JVHL 3UB5A 4FOEA 3CQXA 2OPSA 1NGBA 4PHTX 2QWQA 1J53A 1YAGA 3MX5A 4KPYA 1WLJA 4OJRA 4BRFA 3G6EN 5BR8K 4GKKK 4WYBA 1RTDA 4H0TB 4JKFA 4E7IA 4C8MA 4W5TA 1IKXA 1BL3A 3CQ8A 3VQPA 3CHWA 5GIOA 3V4IA 4JEPA 4KKOA 2OPQA 3ZSRA 1HLUA 2OANA 1OH8A 4KHQA 1CXQA 3AV9A 2ASOA 4JKHA 4DSJA 3L4IA 3PSFA 4CHYA 4CFBA 3LDPA 3ZT3A 3SLCA 3AVIA 3VEVA 1QQOA 2YNFA 3RMAA 4CFAA 1S1VA 2KLAA 4AQYK 2ASMA 1C0TA 3ZSWA 3C6UA 3VQ8A 4CK1A 1A5XA 1YTAA 3HT3A 5AQYA 5GIPA 2KTQA 4KHSA 1XUPO 5DMRA 3PO5A 1WUAA 1K8AO 4WFNL 4AHVA 3EZWA 5AQZA 4DV4K 1BISA 3T1AA 3VTIA 2E5LK 3CCUN 2P9SA 4FJLA 3SBGA 4CJVA 4DTXA 1J6ZA 2A3ZA 1HJRA 3UKRA 4CK3A 3CQYA 4AHSA 2HHUA 3K59A 3CXCM 2UYTA 4CJ5A 4JKAA 5LL6Z 2P9UB 2GTDA 1T44A 2P5OA 3KZBA 1Z05A 3V1QA
chains in the Genus database with same CATH topology
4X65K 5AJ3K 3JAMO 4LF4K 1N34K 1I94K 1J5EK 1N32K 4DV0K 1N36K 4LF9K 4X64K 2ZM6K 4NXNK 2UUBK 5A2QO 4GKJK 4OX9K 4LFAK 4LFBK 3T1YK 4DV1K 4X62K 5LMNK 1HNXK 4DR3K 2UXBK 1HNWK 4CW7B 4JI5K 4JI1K 4YHHK 4B3RK 1FJGK 4JV5K 3J7YP 2HHHK 4JI8K 3J7AP 4LF7K 5BR8K 4DR2K 1IBLK 4GKKK 1HNZK 4JYAK 3J81O 2UUAK 4DUYK 2UUCK 4KHPK 4DV6K 4LF8K 2VQEK 4B3MK 1XMQK 4DR5K 4LF5K 2F4VK 4DR1K 4DV5K 1IBKK 1XMOK 4X66K 4JI2K 3T1HK 5LMUK 2UU9K 4V19S 4JI7K 4AQYK 5IWAK 2UXCK 4LF6K 4CVNE 4LFCK 2UXDK 1N33K 1XNQK 4NXMK 2VQFK 4DR6K 4B3TK 4DUZK 3J80O 1IBMK 4DV7K 4JI3K 4DV4K 2E5LK 4K0KK 3OTOK 4B3SK 4JI0K 4YY3K 4DV2K 1HR0K 5IT9O 5FLXO 4JI4K 5LL6Z 4DR4K 4DR7K 4JI6K 4DV3K 1XNRK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 K;  5AJ3 K;  3JAM O;  4LF4 K;  1N34 K;  1I94 K;  1J5E K;  1N32 K;  4DV0 K;  1N36 K;  4LF9 K;  4X64 K;  2ZM6 K;  4NXN K;  2UUB K;  5A2Q O;  4GKJ K;  4OX9 K;  4LFA K;  4LFB K;  3T1Y K;  4DV1 K;  4X62 K;  5LMN K;  1HNX K;  4DR3 K;  2UXB K;  1HNW K;  4CW7 B;  4JI5 K;  4JI1 K;  4YHH K;  4B3R K;  1FJG K;  4JV5 K;  3J7Y P;  2HHH K;  4JI8 K;  3J7A P;  4LF7 K;  5BR8 K;  4DR2 K;  1IBL K;  4GKK K;  1HNZ K;  4JYA K;  3J81 O;  2UUA K;  4DUY K;  2UUC K;  4KHP K;  4DV6 K;  4LF8 K;  2VQE K;  4B3M K;  1XMQ K;  4DR5 K;  4LF5 K;  2F4V K;  4DR1 K;  4DV5 K;  1IBK K;  1XMO K;  4X66 K;  4JI2 K;  3T1H K;  5LMU K;  2UU9 K;  4V19 S;  4JI7 K;  4AQY K;  5IWA K;  2UXC K;  4LF6 K;  4CVN E;  4LFC K;  2UXD K;  1N33 K;  1XNQ K;  4NXM K;  2VQF K;  4DR6 K;  4B3T K;  4DUZ K;  3J80 O;  1IBM K;  4DV7 K;  4JI3 K;  4DV4 K;  2E5L K;  4K0K K;  3OTO K;  4B3S K;  4JI0 K;  4YY3 K;  4DV2 K;  1HR0 K;  5IT9 O;  5FLX O;  4JI4 K;  5LL6 Z;  4DR4 K;  4DR7 K;  4JI6 K;  4DV3 K;  1XNR K; 
#chains in the Genus database with same CATH topology
 4DFP A;  1N34 K;  4CZK A;  1QSL A;  3LAN A;  4FWR A;  4F3O A;  1HPZ A;  2HHT A;  1RDD A;  3DRS A;  2X78 A;  2QKB A;  3OY9 A;  4M7Y A;  4O8K A;  2O8F B;  4R79 A;  4PL8 A;  1M1K O;  1HX1 A;  4X62 K;  1OH6 A;  4KB0 A;  3VEY A;  4A5B A;  2LSN A;  2VWJ A;  5TKW A;  1BI4 B;  1S1T A;  3CF5 L;  1HYS A;  4CFC A;  4FJH A;  2O8B B;  1VQM N;  4B08 A;  5KGW A;  4JNE A;  5HRP A;  5HRN A;  5HLF A;  3IUC A;  2E4L A;  4DTJ A;  1TAU A;  4A5A A;  4E89 A;  5HRS A;  4BRD A;  1B92 A;  1BQM A;  1QS4 A;  4CHN A;  3IKM A;  3QIN A;  2VWK A;  4LC9 B;  5JS1 A;  2DFH A;  1WNS A;  3G0Z A;  1DEJ A;  4FWK A;  4FO0 A;  2PY5 A;  4OO1 J;  3CCJ N;  3O1B A;  3ALY A;  2KZM A;  3VEW A;  3LZJ A;  1NM1 A;  3R1X A;  4PKI A;  3ZLJ A;  4DV5 K;  4DQI A;  4HUF A;  2QW9 A;  3BDP A;  2OZS A;  2ZGZ A;  3CJA A;  4E7K A;  1I39 A;  4GY2 B;  4CJ3 A;  4CJK A;  2QWO A;  3THX B;  4PWD A;  4IG3 A;  2Z1G A;  4B9S A;  4NYN A;  4OPK A;  4FZY A;  5C24 A;  3QET A;  1RT4 A;  3S3M A;  3PV8 A;  3A5N C;  3A2F A;  4KTQ A;  3L2U A;  3DMJ A;  2NRV A;  4FWM A;  2O8D A;  2E1Y A;  4DTM A;  5CYM A;  3DI6 A;  3L2W A;  1RBS A;  1U04 A;  1VQL N;  1RTI A;  3HTV A;  4FVU A;  1FW6 A;  3VF4 A;  1JLF A;  1HMV A;  5AQL A;  1YJ9 N;  4KTW A;  4X65 K;  3CCS N;  4LF4 K;  3CM5 A;  3HP6 A;  3SAH A;  5M1N A;  2OPP A;  4HVJ A;  3VN5 A;  3CC7 N;  1QHT A;  5KPZ A;  2E2O A;  5KGX A;  4LSL A;  4CEE A;  2GEL A;  1OH5 A;  1IH7 A;  1NGD A;  4IJN A;  1HKB A;  3F5T A;  1HUX A;  3AAP A;  1RNH A;  2QXL A;  1ZXO A;  1C0M A;  1TK5 A;  1HPM A;  1C0G A;  4FM2 A;  4EZ9 A;  3DXM A;  4DTN A;  2OZM A;  3KD5 E;  1CXU A;  1ATN A;  3KK3 A;  1NOY A;  1RBR A;  2D0O A;  3GOI A;  5ELZ A;  4A61 A;  4A62 A;  2IS3 A;  1RIL A;  2YKN A;  4BC3 A;  3WXL A;  4K43 A;  1QQC A;  1QZ5 A;  3RTV A;  3HOT A;  2E2N A;  3AVG A;  2O8C A;  3MDQ A;  3L0Q A;  4CHQ A;  5E84 A;  2YNH A;  1QVF M;  4B9U A;  4W5O A;  4YNQ A;  1HQU A;  1LCU A;  1X9S A;  4DLE A;  1DGK N;  1KD1 O;  1VK0 A;  2P9N B;  4H0Y B;  5CHI A;  3WEE B;  3EE8 A;  4H0X B;  4M42 A;  3E9O A;  4DR1 K;  2WFB A;  4ICL A;  3TTF A;  5AFU A;  1VHX A;  3OYN A;  4E3S A;  4CJW A;  4LD0 A;  2ETJ A;  3LDO A;  3KLE A;  3VGL A;  1X1P A;  5JS2 A;  4CJS A;  4CVN E;  1D8Y A;  1Q86 O;  4CZI A;  3NVK A;  5EOY A;  3ZSV A;  1TV6 A;  3BF3 A;  2ITM A;  3LDQ A;  2GX9 A;  3NF9 A;  2XY8 A;  5TKY A;  4KB1 A;  4CZE A;  1C1A A;  2CGL A;  4B9Q A;  4OLA A;  4Y1C A;  4FL9 A;  4JLH A;  3HVT A;  2W6L A;  2XY6 A;  4E0D A;  1EWQ A;  3QEP A;  3KKS A;  1EQY A;  3ZET B;  1JLG A;  1QSS A;  4FZX C;  2IIR A;  4LH4 A;  4JRQ A;  1RBU A;  4FJG A;  4N41 A;  4DFK A;  1A5W A;  3W3D A;  4FJI A;  3T69 A;  3OS2 A;  1ZBI A;  3THW B;  1T05 A;  4PKG A;  1X9M A;  4CEB A;  1JL1 A;  3ZT0 A;  4IFY A;  4FK2 A;  4EAH D;  1K9M O;  2WBN A;  1D5A A;  1KQS M;  1VSI A;  2FBY A;  3VTH A;  1T03 A;  4IDH A;  2OTL N;  1YJN N;  1X9W A;  4OPJ A;  3RR8 A;  4NCB A;  1WSJ A;  4CZF A;  3WNE A;  3O4W A;  4IZ9 A;  4MO5 A;  3AGR A;  4FXD A;  4CZG A;  3ZSX A;  1GLJ O;  1HNI A;  4KRE A;  4JKC A;  1EET A;  4GNI A;  2FBT A;  3O4Q A;  5FPE A;  3UKU B;  1GLE G;  3SQ2 A;  2HHQ A;  4B9M A;  4O8U A;  1R59 O;  3J81 O;  2UUA K;  4E7L A;  1HYZ A;  4BRQ A;  3RSE B;  3K5N A;  3HO1 A;  2G8W A;  1CZB A;  1ASV A;  3MCP A;  2NRW A;  4EP4 A;  1KFD A;  2QKK A;  1SKR A;  3AVH A;  1KVA A;  4H0V B;  3OYL A;  2HBM A;  3JYT A;  4DR5 K;  3NH0 A;  1GOA A;  2ZE2 A;  3O4N A;  3M1F A;  4CD3 A;  3MN9 A;  2WOM A;  4IDK A;  1JKH A;  2HHV A;  1SL0 A;  4CF1 A;  3THX A;  2UU9 K;  4WQ4 A;  4RW9 A;  4KI6 A;  1XWL A;  3DAW A;  3AO3 A;  4AHU A;  4LH5 A;  5GAE P;  3O6W A;  4ZTF A;  1RBT A;  4H5N A;  1UA1 A;  4IOX A;  3CCR N;  4NXM K;  2VQF K;  5J1E A;  3NFA A;  2DPN A;  5J2N A;  2G8U A;  3KHY A;  4XH5 A;  1FXX A;  3HOS A;  3ID6 A;  2P9I A;  3ENB A;  2DFE A;  5EVZ A;  4J2E A;  1OH7 A;  3MXJ A;  3HL8 A;  1T3V A;  3CYM A;  3CMA N;  4DTR A;  1GOB A;  4JK9 A;  1GOC A;  2E20 A;  5AQN A;  1YIJ N;  3KLH A;  3VF2 A;  1RT2 A;  2YV0 X;  1BA1 A;  2R7Y A;  3EY1 A;  1Q9Y A;  2FF3 B;  3M5R A;  2Q3S A;  4JAX A;  4E1M A;  2D1K A;  3GE1 A;  4CHP A;  4BRE A;  4FLX A;  3LM2 A;  4FPA A;  4E7H A;  4CF8 A;  4DR3 K;  5M1O A;  1YT3 A;  2RN2 A;  2GUI A;  3EO3 A;  3HXM A;  1BGX T;  2D4W A;  1HNW K;  3ID8 A;  4JI5 K;  2IVN A;  5CYQ A;  1X3N A;  1KVB A;  3DOK A;  3ZT1 A;  3O3G A;  1WBD A;  2NRH A;  3LM9 A;  5T7B A;  5AQH A;  4DR2 K;  4DS4 A;  1ZBF A;  2YHY A;  4JYA K;  3OA9 A;  3TR8 A;  4FWO A;  4B3O A;  2YX6 A;  4CEQ A;  4RW7 A;  3CET A;  2ITG A;  3VGK A;  3AO5 A;  3DOL A;  3P83 D;  3ULE B;  3HP9 A;  3CPW M;  4ILJ A;  2ATQ A;  1WN7 A;  3BEX A;  3E66 A;  3ENH A;  3ASM A;  3EKS A;  2O8E A;  1KTQ A;  1HYV A;  4FVM A;  4FM1 A;  1RDU A;  2FSN A;  4W5Q A;  1QQN A;  4QS9 A;  4B1V A;  4BGA A;  5C12 A;  1FKP A;  4B1W B;  4CJR A;  1VSF A;  5LY3 A;  5BRD A;  2FF6 A;  3DRP A;  3O9T A;  5MLC Q;  3TAF A;  3QO9 A;  3ULD A;  3B6O A;  3CM6 A;  4KHW A;  4HCB A;  3KLG A;  4JI0 K;  2Q36 A;  3CJ1 A;  1NK7 A;  2Z1I A;  3DLE A;  3SZ2 A;  4ISG A;  3MMV A;  3DXK A;  3SUN A;  2Q2R A;  3I33 A;  5JIC A;  3VGM A;  3NH2 A;  5DK5 A;  3FFK B;  3D0P A;  3TAQ A;  5AJ3 K;  3H45 C;  1GLL O;  5BN9 A;  2QA4 N;  1C6V A;  4M3Z A;  3TAB A;  3AY9 A;  3ZSO A;  3K57 A;  4I6M A;  3DLH A;  4H5V A;  4DFJ A;  4PQU A;  2YHB A;  2YCH A;  3T1Y K;  1J9A A;  1K73 O;  5FPN A;  3K5O A;  5AQS A;  4N76 A;  2P9S B;  3DWL A;  4FJX A;  5AQK A;  3V9X A;  3VEN A;  1U2V A;  3PLA A;  2UXB K;  1NOZ A;  5M1Q A;  3OBW A;  3NHG A;  4CJT A;  3DJC A;  3G4S N;  4OKE A;  2GWJ A;  4JI8 K;  3VEX A;  3N4P A;  1BCO A;  4Z0U A;  4XIU A;  3G71 N;  4KV8 A;  5CZ1 A;  3LAM A;  1BUP A;  4IG0 A;  2JWK A;  4DTP A;  3LPU A;  3L3U A;  4J2A A;  1REV A;  4EFH A;  2DTU A;  4NYF A;  5KRT A;  3OYI A;  3IG1 A;  1BIU A;  4O44 A;  1RGI A;  3KK1 A;  1L3S A;  4BRP A;  4E1J A;  4DCH A;  2D0A A;  1NKC A;  4FJ7 A;  2EHG A;  1LAV A;  2F4V K;  1JLC A;  3QBX A;  4JKG A;  2ZJR L;  4UY8 O;  3OYD A;  3P38 A;  5J2Q A;  4HUE A;  3NF7 A;  1HRH A;  1TYQ A;  3HM8 A;  4JRP A;  4BRK A;  3DYA A;  1RT7 A;  4CE9 A;  3QEI A;  2WTU A;  4W5N A;  4MDA A;  1SZ2 A;  4J2D A;  4DFM A;  4B3S K;  1X3M A;  3EN9 A;  4YY3 K;  5FPM A;  3DRR A;  3CCV N;  2IC3 A;  3D2E B;  5FDL A;  3CFP A;  3WQU A;  4Z4H A;  4FOI A;  2QXF A;  5AQM A;  1N32 K;  3OYC A;  1Y64 A;  3I8D A;  4CJQ A;  4M3R A;  1TAQ A;  3O08 A;  2HMI A;  3HST B;  4OX9 K;  2VWB A;  5F2R A;  1G99 A;  3PIP L;  3MN7 A;  4CBX A;  4I9L A;  1BHL A;  1EX4 A;  2XRI A;  4OLB A;  3L6Q A;  3CIP A;  3PUF A;  3F9M A;  4CIE A;  1S6P A;  4NO7 A;  1NG9 A;  3I0S A;  3TAR A;  3PX6 A;  1O13 A;  2QWN A;  4PL7 A;  1VQ4 N;  4KRF A;  1NJI O;  1Q81 O;  1R0A A;  3S3N A;  3CC2 N;  1VSE A;  3BUZ B;  4CJL A;  3O5B A;  3BZK A;  4IJA A;  1NGG A;  1N8R O;  4JN4 A;  1B9D A;  2VGN A;  1CLQ A;  3VET A;  1VSJ A;  3OJU A;  1C1B A;  5CR4 A;  1T8E A;  1RT1 A;  4KHP K;  4DV6 K;  3SPY A;  1KC8 O;  4OPA A;  1BDG A;  4CJ4 A;  3C7N B;  5ADX A;  3ZX3 A;  1NKB A;  4WQ4 C;  4TSX A;  4CHO A;  5C2D A;  1XMO K;  3PO4 A;  4DTS A;  4X66 K;  2F9W A;  4I7F A;  1K8K B;  4Z4I A;  2RKI A;  4MFB A;  3KJV A;  2B5J A;  3TU5 A;  3CCM N;  3V9W A;  4BGB A;  1WBB A;  3DLG A;  5BRE A;  3U3Y A;  3C94 A;  2IDO A;  5BR9 A;  1VQK N;  5IWA K;  4AF1 A;  2QWP A;  3CJB A;  2HNY A;  2AJQ A;  4HTL A;  1Q9X A;  3D2F B;  3WNH A;  4DU4 A;  1N33 K;  4BRH A;  4B1Z A;  3H3N O;  4DQS A;  2W40 A;  4G1Q A;  4DUZ K;  4BAC A;  1IBM K;  1X9J A;  1RDA A;  1NGJ A;  1V4S A;  1HNV A;  4K0K K;  4FYD A;  3OTO K;  4KAZ A;  4DQQ A;  1S9G A;  4IKF A;  3CFR A;  2HND A;  3F73 A;  4WF9 L;  4U7B A;  5AQO A;  1SQK A;  1NK0 A;  4DB3 A;  2YHW A;  3NVM A;  4DV3 K;  1TK8 A;  3D45 A;  1KVC A;  3AAR A;  2CGJ A;  4Z4E A;  1ZBH A;  4WCE L;  4DV0 K;  3H1Q A;  1TUU A;  4FLZ A;  4CD1 A;  2CH5 A;  3AA3 A;  4DTO A;  4BDZ A;  3D2E A;  1UAX A;  4A59 A;  3K5M A;  1QQM A;  3I0R A;  1NJW A;  3A5L C;  1BWF O;  2VG5 A;  1WSF A;  4DV1 K;  1HKG A;  5FRO A;  4DQR A;  4BQZ A;  4ISF A;  1NJZ A;  4BC4 A;  1TKX A;  3AO2 A;  2HB5 A;  3AA2 A;  2GBZ A;  2D0C A;  1NMD A;  2BUP A;  4BRG A;  3VA3 A;  4F4K A;  2JLE A;  3P5J A;  1S1W A;  5M1P A;  4C8L A;  2QWR A;  1XC9 A;  3NF6 A;  2ZQB A;  4IEE A;  4GVE A;  3WT0 A;  4CGH A;  1HNZ K;  4YOV A;  4DUY K;  3DXK B;  1ZBL A;  2F8T A;  4ILH A;  1ESV A;  1HKC A;  1SAZ A;  3KLI A;  1ITG A;  2ZJQ L;  4JKG B;  4FJK A;  1KLM A;  1Q8I A;  4DF4 A;  4BDP A;  2O8D B;  4NLB A;  4LF8 K;  2PYL A;  1TGO A;  2PZS A;  1IKY A;  1KLN A;  5SWM A;  3ZSQ A;  1DTT A;  3SYZ A;  1KAY A;  3QEV A;  5M1F A;  2NRZ A;  2OPR A;  3VQ6 A;  2A1S A;  2WC9 A;  3VQQ A;  2F8S A;  3VQ7 A;  3QBW A;  5BN8 A;  3UKR B;  3WUH A;  2V52 B;  1DTQ A;  4RWT A;  3BF1 A;  3SK3 A;  2I5J A;  1W2B M;  1S9E A;  3K9J A;  1MWK A;  3ZET A;  1U6Z A;  3L4Q A;  4LFC K;  1GLD G;  5JLH A;  3VQB A;  5KPR A;  1S5J A;  2P5G A;  4DR6 K;  4YOY A;  3OYA A;  3DXM B;  3CME N;  1NBW A;  1RCH A;  3DM2 A;  3VQA A;  1RDB A;  1Z26 A;  2Y1I A;  1XHZ A;  4KI4 A;  3FZF A;  5I42 A;  4AHC A;  1NMN A;  3TAE A;  4KFB A;  4AIL C;  1D9D A;  3TSP A;  3OYH A;  2IVP A;  4RTF D;  1XNR K;  4FW1 A;  3VQ4 A;  4EIA A;  1A5V A;  5DM7 L;  4A2A A;  4B1U B;  3QML A;  4GKJ K;  1I3A A;  1EKE A;  5EXW A;  5C0Y A;  5JVG L;  4K8X A;  3KTQ A;  4B9L A;  1LWC A;  3QEX A;  2PYJ A;  4CK2 A;  3DLL L;  3EKU A;  4FJ5 A;  3IRX A;  1QE1 A;  3HRG A;  2NRT A;  3KKR A;  1VRU A;  4CZH A;  1JJ2 M;  2XO7 A;  1ASU A;  3O80 A;  1BG3 A;  4FZZ A;  4DKW A;  3H08 A;  4BG9 A;  1W7A A;  4FCY A;  4M3Y A;  4BR4 A;  3SAF A;  3P4I A;  1YHQ N;  1HQE A;  3OYJ A;  4QS7 A;  4CES A;  2PFU A;  3GDQ A;  5KTQ A;  1GLB G;  3AVF A;  3LZI A;  5GAD P;  4AM6 A;  1RDW X;  3ATV A;  3AVN A;  3QIP A;  3LDL A;  3OJS A;  3KLF A;  3CJ9 A;  4BR2 A;  3AVC A;  3CI5 A;  2VQE K;  4ILG B;  2V7Y A;  4I9Q A;  2VG6 A;  1OVQ A;  1MU2 A;  4J2B A;  1K6Y A;  2E88 A;  5AQR A;  3SJH A;  4BRL A;  1VQP N;  4DU3 A;  1NGE A;  3WXJ A;  3T1H K;  2GEM A;  4KH5 A;  4RW8 A;  3KD1 E;  2G8F A;  2YNI A;  5JLF A;  2RPI A;  4DTU A;  2RHK A;  3HPO A;  2FSJ A;  4ZHR A;  4MQ3 A;  3NGY A;  4Y1D A;  2QTD A;  4K25 A;  4LF6 K;  4DMN A;  1JCF A;  2FC0 A;  1Q7Y O;  3VQE A;  5DM6 L;  2UXD K;  1ZBU A;  3E1Y A;  1BO5 O;  3HK2 A;  2AP1 A;  1KFS A;  3SNN A;  2W41 A;  4BY9 C;  3MEE A;  2A41 A;  4BC2 A;  4F2S A;  4WE1 A;  1XHX A;  4MO4 A;  4IFV A;  1W9H A;  2QM1 A;  1T6D A;  2V51 B;  3FE1 A;  1QSY A;  1ATS A;  3FR0 A;  4H5T A;  2GV9 A;  3SPZ A;  2XY5 A;  2HHS A;  1JL2 A;  3ZSY A;  3N4Q A;  1CZA N;  1W0H A;  4BC5 A;  3L2V A;  3B8A X;  4OVL A;  5LMN K;  2I7N A;  4BRA A;  2KQ2 A;  4LY7 A;  3V6D A;  2Q31 A;  4L8R B;  1GLC G;  3D6R A;  4C8N A;  4CIF A;  3THV A;  2FBX A;  5C15 A;  2OCE A;  4CER A;  1ZBS A;  3MXM A;  4JI1 K;  3Q7C A;  4YHH K;  4KHU A;  4JS5 A;  1WAF A;  1VQ6 N;  2FSK A;  4LF7 K;  3CPE A;  4RG8 A;  4G9Z A;  3AVB A;  3M8Q A;  1UOC A;  3BY5 A;  2B4J A;  3GG4 A;  3I55 N;  4CED A;  1TKD A;  5AFU H;  3J8A A;  5EY4 A;  3H1V X;  1SV5 A;  2Q1N A;  3SUO A;  3JXU A;  1TKT A;  1DLO A;  4BDY A;  1JXB A;  3HYF A;  3FZM A;  3TAG A;  4LF5 K;  1RBV A;  2BTF A;  3M6G A;  4DHY A;  3P39 A;  4ELV A;  4DF8 A;  4M63 C;  5B8H A;  4K42 A;  4JI7 K;  4FWN A;  2O4I A;  3MN5 A;  4O5F A;  5E26 A;  1C0U A;  4YOU A;  1N6Q A;  1NGF A;  3G10 A;  4C8K A;  3AA4 A;  1E4G T;  4NB4 A;  3S3O A;  3NGI A;  3ZEU A;  5AQV A;  3LAK A;  3RVC A;  4OGE A;  3QIC A;  5CZ2 A;  3WXK A;  3AVJ A;  1U45 A;  3DLR A;  4DLG A;  5SZT A;  1S72 N;  3CJ7 A;  4DSK A;  3TAN A;  4KBO A;  3ZSZ A;  5BPL A;  4YDU A;  2DY4 A;  4FW2 A;  1ASW A;  3NDK A;  4CEO A;  1TK0 A;  4JD2 A;  4HTU A;  4ELT A;  2Q0U A;  4JI6 K;  1LAW A;  1WSH A;  3SQ1 A;  2VGM A;  3HPG A;  4QCL A;  2BH1 A;  3JAM O;  3SAG A;  4MDB A;  3PIO L;  3NE6 A;  2P9P B;  3NBP A;  3JS6 A;  1J5E K;  3FGU A;  1IG9 A;  2ZM6 K;  3TAP A;  1BA0 A;  3VQ9 A;  1YF5 L;  4EHU A;  4KHY A;  4LFB K;  4CBW A;  3HZ6 A;  2PBD A;  4HWI A;  3KK2 A;  2FXU A;  4F2R A;  3L2Q A;  1NKE A;  4N56 A;  4JS4 A;  3VQ5 A;  3H6E A;  2HST A;  5AQU A;  2HVI A;  3O8M A;  2HF4 A;  3TAM A;  3CCE N;  1D4X A;  1VSL A;  1VQO N;  3BGR A;  1NJX A;  4B3R K;  3ZYY X;  3TTD A;  2E6L A;  3OS0 A;  4IBN A;  4CF2 A;  2W42 A;  2HMP A;  3KWI A;  4I2Q A;  5M1K A;  3HPH A;  4CZM A;  2O8F A;  1UA0 A;  4JK7 A;  3SQ0 A;  5AZI B;  5AQP A;  5K14 A;  4R5P A;  3IS9 A;  3AO4 A;  2O8B A;  3F2K A;  2P51 A;  4NCA A;  2HOE A;  1Y97 A;  3OYE A;  3CG7 A;  1XMQ K;  4GW6 A;  2HBK A;  1JCE A;  1TYQ B;  1OVY A;  2X6N A;  3QB0 A;  4HHT A;  4BWM A;  5HRR A;  3LP1 A;  4JI2 K;  3HVR A;  1OKJ A;  2IOC A;  3AVA A;  1JLA A;  1RDC A;  4H4M A;  5LMU K;  5AQG A;  1U49 A;  3OYF A;  1HJO A;  4JD2 B;  5E41 A;  1YI2 N;  4E1N A;  4FM0 A;  3QIO A;  2KKZ A;  1W97 L;  4EZ6 A;  4CGJ A;  3EZ5 A;  3JSM A;  4CIG A;  1JXE A;  3TSQ A;  2BDP A;  4B8C A;  2E6M A;  1G15 A;  3MCA B;  3QER A;  2D0P A;  1WSG A;  3OVN A;  4FWS A;  2KW4 A;  3R3L A;  4Z4F A;  5AQT A;  4CI6 A;  4JHD B;  4RCH A;  4JKE A;  4IO9 L;  5BRF A;  4DSF A;  4Q0B A;  3KK7 A;  1Z25 A;  5FLX O;  4JI4 K;  4MLE A;  1VSH A;  4DR4 K;  4Z4C A;  1NU0 A;  4B9T A;  4H0O A;  4A57 A;  4BR0 A;  4RW4 A;  5AQW A;  4YOX A;  5FPD A;  1BIZ A;  3ISN C;  3THY B;  2KZZ A;  1TVR A;  3C65 A;  4BQL A;  3ATU A;  3PSI A;  4FLT A;  4LFA K;  5I9E B;  3RMB A;  4FSV A;  2A6A A;  2NNW A;  1S1X A;  3WNF A;  4M45 A;  4CCH A;  1SKW A;  1EP4 A;  5BPM A;  1LV5 A;  3ZX0 A;  2KFZ A;  1TL3 A;  5KQ8 A;  4F9O A;  3LDS A;  4M41 A;  4MLH A;  5AQQ A;  2WUS A;  3ZT2 A;  3C95 A;  3A5O C;  1U4B A;  2ZGY A;  3WNG A;  1S6Q A;  4K41 A;  5LJV A;  1BQN A;  5AQX A;  4WFA L;  2Z1H A;  3RR7 A;  2VCP A;  3D7E O;  2Q97 A;  2ZF5 O;  4KHN A;  5HL7 L;  4FPB A;  1YXQ A;  4DWI A;  3MWP A;  1L3V A;  2F9T A;  3M3Z A;  1QTM A;  4DSI A;  3LL3 A;  5EX5 A;  4C1N K;  2HBJ A;  5F1X A;  1NNE A;  1RT3 A;  3I8B A;  3TI0 A;  1LW2 A;  4W5R A;  5AQJ A;  3C6A A;  3U4L A;  4L3Q A;  5C42 A;  1IG8 A;  1IKV A;  2B6A A;  4GV3 A;  4LSN A;  1L5U A;  4FLU A;  5AZI A;  4IOA L;  4WQ5 C;  1L3T A;  3AAQ A;  1LWE A;  3L3V A;  3O9Q A;  3OS1 A;  4HUG A;  4YOT A;  1IO2 A;  3W0L A;  1GLF O;  3IFR A;  3AVL A;  2GUP A;  4CGG A;  3S9H A;  2IVO A;  3NH1 A;  3P31 A;  1NK6 A;  4JI3 K;  3M8R A;  3VEZ A;  3CJC A;  4OKJ A;  3AO1 A;  3AVM A;  1CZ9 A;  4DSL A;  3FZK A;  1E4F T;  1HR0 K;  3V1O A;  5CY4 A;  1M90 O;  4PA1 A;  3BP8 A;  4H0P A;  3KWG A;  2DFF A;  2HW3 A;  1O1W A;  1I94 K;  3HI0 A;  4IFE A;  4WQ5 A;  3SV4 A;  3CCL N;  4X64 K;  4NXN K;  1WOQ A;  4CJU A;  2GWK A;  2P9K A;  3ZCM A;  1YJW N;  3K9K A;  4H5R A;  3WQT A;  5I3U A;  4EP5 A;  3I56 N;  1YTU A;  5KI6 A;  2A5X A;  4B1Y B;  3QNO A;  1WSE A;  1VQ8 N;  4GV6 A;  1QVG M;  2NUB A;  4M3W A;  1U48 A;  1KCF A;  1QZ6 A;  2F7T A;  1LOT B;  1MDU B;  4FJJ A;  1TUY A;  2KHO A;  2G8K A;  3E9L A;  4E19 A;  4CEF A;  3CER A;  4ZTJ A;  1GLA G;  3J7A P;  2A40 A;  2FBV A;  3MEC A;  3VER A;  1VSM A;  3U6F A;  4GVM A;  4I2P A;  4B9N A;  4NCG A;  1J54 A;  4AHR A;  4FJM A;  4AH9 A;  4FLW A;  3H46 O;  3VA0 A;  2Z1J A;  2AA4 A;  3K58 A;  5ADX H;  5BRH A;  4I6M B;  1L3U A;  4BRO A;  1NGC A;  4FLY A;  3SJJ A;  3DLK A;  2NLX A;  2FLO A;  2WON A;  3V81 A;  4O5B A;  2D0B A;  3L2R A;  3V9U A;  4PUO A;  2YKM A;  4U67 L;  4B3T K;  3K0S A;  3C7N A;  1F21 A;  1NWK A;  2YHX A;  4YDU C;  4DV7 K;  2H3G X;  4M3X A;  2G8I A;  4M3U A;  2HVH A;  4BRM A;  2KFN A;  5LJW A;  1JLB A;  1DT9 A;  4BRI A;  3NGZ A;  5GIN A;  5KPT A;  2V7Z A;  3O9U A;  2QI2 A;  3VQC A;  2BE2 A;  3SUQ A;  5FRN A;  4BWJ A;  3SMP A;  4ID5 A;  5H1S Q;  4O55 A;  4CJP A;  3K2P A;  4FJ9 A;  1IV0 A;  2HF3 A;  1EO1 A;  1D9F A;  2YHA A;  1C1C A;  2YNG A;  1P8Z A;  2RE2 A;  4E7J A;  4J8F A;  1RFQ A;  3C6H A;  3VF6 A;  2P9L A;  2A1R A;  4A2B A;  3SCX A;  1E3M A;  1HNX K;  2ASP A;  3IAY A;  3RMD A;  3OYB A;  3L8B A;  3HSC A;  3RRG A;  4CEA A;  2ZWH A;  5GAG P;  3LP2 A;  1S1U A;  1H1V A;  5J2M A;  3J7Y P;  1KRP A;  2RF2 A;  2PAV A;  3J7Z O;  1LWF A;  1RTJ A;  1NK4 A;  2XY7 A;  1Q18 A;  1IBL K;  1SUQ A;  3EEQ A;  3NCI A;  3SBT A;  2Y1J A;  1K8K A;  1S22 A;  4BR5 A;  4CGF A;  5BPN A;  3MAQ A;  1YIT N;  4H4O A;  1NGA A;  4KO0 A;  4KH6 A;  1VSD A;  1KAX A;  4B3M K;  1T7P A;  5HBM A;  3U8X A;  4QAG A;  4WFB L;  1BU6 O;  1U47 A;  3V9S A;  3S41 A;  4IOC L;  1IBK K;  3R9P A;  3WXM B;  5AQF A;  3R8E A;  4CZJ A;  5EU7 A;  2P9L B;  3O1W A;  4BVP A;  1BI4 A;  2P9P A;  3FZL A;  3AVK A;  3A0I X;  4FJ8 A;  2P9N A;  1WB9 A;  3QEW A;  1MWM A;  4JKB A;  1BCM A;  3VPZ A;  2UXC K;  2NRR A;  3CD6 N;  3O9S A;  4Q5V A;  3LP0 A;  1KSP A;  2P9U A;  1XNQ K;  5HOO A;  3Q7B A;  4DSE A;  3OBY A;  4H03 B;  3SQ4 A;  3OHR A;  3A5M C;  3SUP A;  4CJ7 A;  4OPH A;  4H8K A;  2Q0R A;  5FRM A;  4FWP A;  2VG7 A;  5IT9 O;  2BGG A;  3RMC A;  1RT6 A;  1RTH A;  1U2V B;  3MXI A;  4DR7 K;  3IDH A;  1C0F A;  4DG1 A;  4FWQ A;  4O4G A;  2P1J A;  4H5W A;  5C2F A;  4BE0 A;  3MN6 A;  1YVN A;  1NJY A;  4CF9 A;  3O9R A;  1YUW A;  3M8P A;  3C0B A;  3WXI A;  2QK9 A;  5J2P A;  4UQG A;  1FK9 A;  2P9K B;  4BRC A;  2UUB K;  3ZEU B;  4B1X B;  4FK0 A;  3E01 A;  2JWL A;  3ZX2 A;  4IO8 A;  3RRH A;  2A42 A;  5JMV A;  2I7P A;  4FK4 A;  1S3X A;  3NMU A;  3PX4 A;  3EE9 A;  4DQ8 A;  3HM9 A;  4F3T A;  1EXQ A;  4BG8 A;  4BVO A;  2HHX A;  1VAZ A;  1NGI A;  3EYZ A;  3EL2 A;  4IXC A;  4M3T A;  1ATR A;  3VES A;  2HHH K;  3ENO A;  4C23 A;  3PX0 A;  1VQ9 N;  4O0I A;  4GV9 A;  4CGD A;  2VYP A;  3A8Y A;  4KTZ A;  4CEZ A;  4DQP A;  4HCC A;  4IWV A;  3UE5 A;  2QEX N;  2X74 A;  5GAH P;  4XH4 A;  2UUC K;  4CEC A;  3M8S A;  3V1R A;  2CGK A;  1ILY A;  3OYK A;  1RT5 A;  3TTC A;  1NK8 A;  3UKU A;  1KAZ A;  5C10 A;  1IJJ A;  1IKW A;  3V9Z A;  3O3F A;  4XH1 A;  4EHT A;  2E2P A;  4BR7 A;  3QFU A;  5F0X A;  1J5O A;  3F9K A;  1JLE A;  4AM7 A;  1VSK A;  2IGI A;  3HBT A;  3G25 A;  3H3O B;  3GBT A;  5AQI A;  2OTJ N;  4C8O A;  3QNN A;  1UWB A;  3P1G A;  3VEO A;  2BAN A;  3T19 A;  4OKK A;  4BE2 A;  1ZC6 A;  3LWM A;  4CHZ A;  2YJE A;  4B8A B;  2J4R A;  3QDK A;  3MK6 A;  2EX3 A;  2JGU A;  4N47 A;  3O3H A;  3TPQ A;  2F96 A;  4M7X A;  1SKS A;  4GMJ B;  3SI6 A;  2QWL A;  4CJF A;  3AA5 X;  4DV2 K;  4BR9 A;  4FLV A;  5KQD A;  2O4G A;  2ZJP L;  2G8H A;  2EWS A;  1TKZ A;  1V4T A;  1VQ5 N;  2YJF A;  4RW6 A;  4YOR A;  3VOV A;  1SL1 A;  3NAE A;  4Z4G A;  3ZT4 A;  2D5R A;  1NLV A;  4C1N I;  2QWM A;  3MX2 A;  3FLC O;  1N5Y A;  2G8V A;  5A2Q O;  1XI1 A;  2OA8 A;  3ITH A;  1NGH A;  2OYQ A;  4YOW A;  3RWU A;  3OYM A;  3DLB A;  1TL1 A;  3LDN A;  1XQS C;  3GL1 A;  1P90 A;  5AZJ A;  5KRS A;  5HRO A;  4CJE A;  1ZYQ A;  1XC3 A;  3KIO A;  3U9D A;  4JK8 A;  3HJF A;  4OGC A;  4CW7 B;  3U9Z A;  2O8C B;  4JHD A;  1QHA A;  3QLH A;  1FJG K;  4JV5 K;  2X6S A;  1VQN N;  4QOZ B;  3WEE A;  4FWL A;  1JCG A;  4XEI A;  3IMX A;  3C6T A;  1BOT O;  2XHB A;  2CH6 A;  3T3F A;  1Z6R A;  3KVG A;  3TSU A;  3B6P A;  3OYG A;  4JKD A;  1LW0 A;  2P9I B;  1FKO A;  3D2F A;  3CCQ N;  4YFU A;  3THY A;  1B9F A;  1SS6 A;  1MA9 B;  2IAJ A;  3VQD A;  3UIQ A;  1EWR A;  4AHT A;  3AGK A;  3FZH A;  4ISE A;  4CF0 A;  5D3G A;  1VQ7 N;  2YI1 A;  4PY5 A;  1VRT A;  3E9P A;  3SMS A;  3NF8 A;  3BZC A;  4N5S A;  4V19 S;  3CFO A;  4KH4 A;  2NZT A;  3OW2 M;  3R6M A;  5AR0 A;  2NRX A;  3LWL A;  2HHW A;  3QFP A;  3MEG A;  2HNZ A;  5CE3 A;  3MWT A;  4DU1 A;  3J80 O;  3RSE A;  3T7Z A;  2W6K A;  4ID1 A;  4ELU A;  5C25 A;  3LP3 A;  3K5L A;  2ZD1 A;  1DKG D;  1YVU A;  4O0J A;  4NLC A;  3U3G A;  1NK9 A;  4CFD A;  4QS8 A;  1Q82 O;  5AZJ B;  2E2Q A;  3TWH A;  4BE1 A;  4F8R A;  3FFI A;  3THW A;  4K8Z A;  4B9V A;  1JLQ A;  4CZL A;  3QES A;  5HP1 A;  4CGI A;  2E8A A;  4IEI A;  4PKH A;  4Z94 A;  1SL2 A;  1N36 K;  3ULE A;  4LF9 K;  3PY8 A;  4DS5 A;  4FJN A;  4Y0W A;  2HBL A;  1WAJ A;  3MED A;  4BRN A;  3SV3 A;  1NK5 A;  3LPT A;  1WSI A;  1T6C A;  4CBU A;  2E1Z A;  1KXP A;  3LAL A;  2O8E B;  3VMF B;  3CC4 N;  5JVH L;  3UB5 A;  4FOE A;  3CQX A;  2OPS A;  1NGB A;  4PHT X;  2QWQ A;  1J53 A;  1YAG A;  3MX5 A;  4KPY A;  1WLJ A;  4OJR A;  4BRF A;  3G6E N;  5BR8 K;  4GKK K;  4WYB A;  1RTD A;  4H0T B;  4JKF A;  4E7I A;  4C8M A;  4W5T A;  1IKX A;  1BL3 A;  3CQ8 A;  3VQP A;  3CHW A;  5GIO A;  3V4I A;  4JEP A;  4KKO A;  2OPQ A;  3ZSR A;  1HLU A;  2OAN A;  1OH8 A;  4KHQ A;  1CXQ A;  3AV9 A;  2ASO A;  4JKH A;  4DSJ A;  3L4I A;  3PSF A;  4CHY A;  4CFB A;  3LDP A;  3ZT3 A;  3SLC A;  3AVI A;  3VEV A;  1QQO A;  2YNF A;  3RMA A;  4CFA A;  1S1V A;  2KLA A;  4AQY K;  2ASM A;  1C0T A;  3ZSW A;  3C6U A;  3VQ8 A;  4CK1 A;  1A5X A;  1YTA A;  3HT3 A;  5AQY A;  5GIP A;  2KTQ A;  4KHS A;  1XUP O;  5DMR A;  3PO5 A;  1WUA A;  1K8A O;  4WFN L;  4AHV A;  3EZW A;  5AQZ A;  4DV4 K;  1BIS A;  3T1A A;  3VTI A;  2E5L K;  3CCU N;  2P9S A;  4FJL A;  3SBG A;  4CJV A;  4DTX A;  1J6Z A;  2A3Z A;  1HJR A;  3UKR A;  4CK3 A;  3CQY A;  4AHS A;  2HHU A;  3K59 A;  3CXC M;  2UYT A;  4CJ5 A;  4JKA A;  5LL6 Z;  2P9U B;  2GTD A;  1T44 A;  2P5O A;  3KZB A;  1Z05 A;  3V1Q A; 
#chains in the Genus database with same CATH homology
 4X65 K;  5AJ3 K;  3JAM O;  4LF4 K;  1N34 K;  1I94 K;  1J5E K;  1N32 K;  4DV0 K;  1N36 K;  4LF9 K;  4X64 K;  2ZM6 K;  4NXN K;  2UUB K;  5A2Q O;  4GKJ K;  4OX9 K;  4LFA K;  4LFB K;  3T1Y K;  4DV1 K;  4X62 K;  5LMN K;  1HNX K;  4DR3 K;  2UXB K;  1HNW K;  4CW7 B;  4JI5 K;  4JI1 K;  4YHH K;  4B3R K;  1FJG K;  4JV5 K;  3J7Y P;  2HHH K;  4JI8 K;  3J7A P;  4LF7 K;  5BR8 K;  4DR2 K;  1IBL K;  4GKK K;  1HNZ K;  4JYA K;  3J81 O;  2UUA K;  4DUY K;  2UUC K;  4KHP K;  4DV6 K;  4LF8 K;  2VQE K;  4B3M K;  1XMQ K;  4DR5 K;  4LF5 K;  2F4V K;  4DR1 K;  4DV5 K;  1IBK K;  1XMO K;  4X66 K;  4JI2 K;  3T1H K;  5LMU K;  2UU9 K;  4V19 S;  4JI7 K;  4AQY K;  5IWA K;  2UXC K;  4LF6 K;  4CVN E;  4LFC K;  2UXD K;  1N33 K;  1XNQ K;  4NXM K;  2VQF K;  4DR6 K;  4B3T K;  4DUZ K;  3J80 O;  1IBM K;  4DV7 K;  4JI3 K;  4DV4 K;  2E5L K;  4K0K K;  3OTO K;  4B3S K;  4JI0 K;  4YY3 K;  4DV2 K;  1HR0 K;  5IT9 O;  5FLX O;  4JI4 K;  5LL6 Z;  4DR4 K;  4DR7 K;  4JI6 K;  4DV3 K;  1XNR K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...