4NXMK

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 29
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4nxmK00
3J7AP 4JI6K 5LL6Z 4NXMK 5FLXO 1N34K 4B3RK 4JI1K 2UUCK 4LFBK 4DR6K 4DV1K 2UXDK 4DR7K 4DV6K 4JI7K 4X64K 4NXNK 4X66K 1IBLK 1HNZK 1IBMK 4LF5K 4GKKK 4X65K 4AQYK 4B3MK 1XMOK 3OTOK 4YY3K 2UUAK 4GKJK 1I94K 2E5LK 2VQFK 4JYAK 4CW7B 1XNRK 3JAMO 4DV4K 5A2QO 5IT9O 1XMQK 4JI4K 3J7YP 5LMUK 4LF4K 2UXBK 4DR1K 5BR8K 1N36K 1N33K 4B3TK 4DV2K 4OX9K 4V19S 2HHHK 4CVNE 4JI3K 4LF6K 3J81O 2VQEK 1FJGK 4LFCK 4DR3K 4DR5K 4JI8K 4B3SK 4DV5K 4DV7K 1HNXK 4DUZK 2UUBK 1N32K 2UXCK 2F4VK 4JV5K 1J5EK 1IBKK 4JI0K 5IWAK 1HNWK 4JI2K 4X62K 5LMNK 4DV3K 2ZM6K 4DR2K 3J80O 1HR0K 4YHHK 4K0KK 4DR4K 4LFAK 1XNQK 2UU9K 3T1HK 3T1YK 4JI5K 4LF8K 4LF7K 4DV0K 4LF9K 4KHPK 5AJ3K 4DUYK
chains in the Genus database with same CATH superfamily
1NGJA 1N34K 3TI0A 2KW4A 2QW9A 3AVFA 2XY5A 1T05A 5BN9A 1GLLO 3IMXA 2VG6A 4AH9A 5AQIA 4DR7K 4DV6K 3LPTA 1S6PA 4EIAA 2IVNA 2YHYA 1RDCA 1IBLK 1QQOA 1ZBHA 3VF2A 5J2QA 4FLXA 3DLKA 4CHNA 3V9WA 1TKXA 4CZLA 3ZT0A 5BRHA 3Q7CA 4JYAK 4FJLA 1SV5A 3DJCA 2KQ2A 4KTWA 2D4WA 3U9ZA 1JLFA 4DQ8A 2IVOA 1H1VA 4CJ7A 3RR7A 4K42A 3LDOA 1NKCA 4GV9A 3L4QA 4CHQA 5JLFA 1Z26A 4IO8A 4Z0UA 3VPZA 1JL1A 1IH7A 3CF5L 4AHUA 3VETA 1LWEA 5ADXA 5JS1A 4DTPA 5HRNA 4IOAL 1GLDG 4J2DA 1IJJA 5BN8A 3L4IA 1S6QA 3EZ5A 3S3NA 3RMAA 2P9KB 4FM2A 5GIPA 3HVTA 3CQYA 5AQHA 3P4IA 3ULEB 4BC5A 1NGEA 2W42A 4MDAA 4A59A 1RT7A 4YHHK 3ATUA 2NRZA 4DTNA 3O3GA 1BQMA 1MDUB 1VK0A 1UAXA 4CJSA 4DTSA 3AAQA 5C15A 4B9NA 2AA4A 3O9RA 2GV9A 2YI1A 3HSTB 2P9SB 4JNEA 4C8MA 1KD1O 2F8TA 1VSJA 5AQXA 2IC3A 3ULDA 1NJWA 4F4KA 1RTJA 4CESA 1GLAG 4CHOA 4EFHA 1NK5A 3E9OA 1Y97A 2OANA 5BRDA 4DUYK 1VQ7N 1S1UA 3DXMB 4YNQA 1YIJN 4DR6K 3H3NO 4BWMA 2NRRA 3B6OA 4FW2A 2AJQA 3O1WA 1BL3A 1RILA 5JVHL 4HUFA 4JK7A 3SUOA 2A1RA 3SPYA 3WXKA 3WUHA 3PX4A 1U6ZA 1YUWA 3WXIA 3SV3A 4BRMA 4BR2A 3ZX3A 3TWHA 3S3OA 4ELUA 3OYIA 4FCYA 3HM8A 2B6AA 1KFSA 1RTDA 1I94K 3WEEA 3C65A 3O9UA 4LY7A 3ZT4A 2J4RA 3DLEA 3RSEA 2ZJPL 2Q1NA 4CK3A 1ASUA 4CGJA 1ZBIA 1D9DA 3L8BA 3ISNC 4E7LA 4NLCA 3T19A 1QVFM 2OPSA 3TARA 3SK3A 3KLIA 1IG8A 2NRTA 1NGIA 4WQ5A 4V19S 4LF6K 2P9IA 4B08A 3J81O 3LDQA 4ILGB 1XQSC 4IG3A 1TYQB 4BRQA 2YKNA 4CERA 5BREA 1VSMA 1VQ9N 3PX0A 3O9TA 2YHWA 2P5OA 3C6TA 5GADP 5JMVA 1M1KO 4BE1A 3CJBA 3MWPA 3LP1A 1BI4B 3CERA 1E4GT 3P5JA 2HVIA 4RW4A 1HPZA 1RTHA 3KK2A 3VGKA 3EE9A 4H4MA 3LDLA 3CHWA 1UA0A 4KFBA 3M8RA 4FPAA 4KH4A 3THYB 3ENHA 4IKFA 3H3OB 1RTIA 3C7NB 2RHKA 2FF6A 3PO4A 3QEWA 3DRSA 2D0PA 2Z1JA 3MECA 3K58A 2RKIA 4M3RA 4CGDA 1ASVA 1T6DA 4M63C 4FWQA 3P31A 3VQBA 4AF1A 3AA4A 4JI1K 3RWUA 2KZMA 4HVJA 4CJLA 4YOWA 3D2FA 2O8EB 4EP5A 4B1YB 4DQPA 1QS4A 4M3YA 3HT3A 4HCBA 1HYSA 4XEIA 3SAFA 3HPGA 2E6MA 1XUPO 1YITN 5J2PA 4JD2A 3ZCMA 4AQYK 3O3HA 4DTJA 1U49A 3QICA 1LV5A 2WBNA 4HHTA 4LSNA 5SWMA 1DLOA 2HMIA 3NVKA 2QXLA 3H6EA 5HROA 1NWKA 3TTCA 4CJKA 1D9FA 4K25A 4YFUA 3HP9A 4OJRA 3QEVA 2HHWA 4GVMA 2P1JA 3M8SA 3KIOA 1KAZA 4U67L 5K14A 2A41A 1KLNA 2VG7A 2IAJA 3DLBA 4MFBA 1WAJA 2VYPA 2XY8A 3K9JA 4ISFA 3TSUA 4CD1A 4BE0A 3G0ZA 1LWFA 2NRHA 3VGLA 1JLEA 5LJWA 1YHQN 1ZYQA 4CVNE 1IKWA 5AQRA 3DLGA 1B9FA 1EKEA 3VERA 3OYHA 5AQMA 4OO1J 4JKDA 5AQWA 5AFUA 2YV0X 1VQKN 4Z4IA 1YTUA 4PY5A 2P51A 3CFOA 2RN2A 5AZIA 3ZSXA 2XRIA 1SS6A 4KB1A 4JI0K 4DFMA 1A5XA 4IFVA 4JI2K 3KWGA 5LMNK 3HOSA 2B4JA 4CF2A 2ASOA 3ZT3A 1CZBA 1NG9A 2E88A 3AGKA 2ASMA 4CBUA 4LFAK 3OYEA 1HLUA 3DXKB 4C8NA 4BRLA 3VA0A 1M90O 5GAGP 1XHXA 3AVMA 3CPEA 3HM9A 3KWIA 4CZHA 3CETA 1LWCA 3V1OA 5TKYA 4B3RK 2DTUA 1BQNA 3RTVA 2UUCK 1RDDA 3DLRA 3CXCM 1T03A 5C2DA 3MEDA 4CZEA 2W40A 5TKWA 4E7HA 3QIOA 5AZJB 3BZKA 4N56A 5F0XA 4FWMA 3VQ6A 4GW6A 1DT9A 4X65K 3RR8A 3ZETB 2G8HA 3PX6A 4O8UA 3MXJA 2HBJA 2VQFK 1W97L 2HW3A 1TL3A 4GNIA 3VQQA 3QB0A 2FBTA 4A5BA 3OYDA 4DFJA 1EWRA 4J8FA 1GOCA 4KI4A 1JLGA 5ELZA 1P8ZA 3MN5A 1S1TA 2QWMA 2FLOA 3VQ9A 3TAEA 4BQZA 3CYMA 4EHUA 2IDOA 4CGIA 4OX9K 4JI3K 1J6ZA 3IFRA 3UKUA 1TKTA 3V9ZA 3RSEB 3M6GA 3KHYA 4M41A 3CG7A 1NM1A 1IO2A 4CZJA 3OJSA 1JCEA 4DQIA 3V81A 2NNWA 4N5SA 3VQPA 3KJVA 3N4QA 4C23A 4JK9A 4AHRA 3ITHA 1TAQA 3SBTA 5DM6L 2XHBA 3ULEA 1BWFO 1S3XA 1WB9A 3O8MA 4YOXA 4YOTA 1VQLN 1HR0K 4Z4GA 1RBVA 2E6LA 5C12A 2QWQA 4Z4EA 4W5NA 4CJVA 4C8OA 1JXBA 4GMJB 1BIZA 1WSJA 3OYNA 1QQCA 4JK8A 3NCIA 1QSSA 4KV8A 2P9SA 3NBPA 2G8FA 2KFNA 4LF9K 1C1CA 5FPEA 1RDUA 5AR0A 1VQ5N 1QZ5A 3LM9A 2QWOA 1DEJA 4FLZA 4NCAA 4KHSA 1NMNA 3R1XA 3DXMA 3S3MA 3CQXA 3ALYA 3DMJA 5KRSA 1WAFA 3Q7BA 4NXNK 4RG8A 3WXLA 4KHYA 2OPQA 4EZ6A 1XC3A 2EWSA 4H0XB 5M1PA 1RT2A 1W2BM 3SQ0A 1Q9YA 3HRGA 1J53A 3EEQA 2QA4N 4HWIA 4GVEA 4OPJA 3D7EO 4DKWA 3JSMA 4CZMA 3QFPA 1A5VA 1DTQA 1C0UA 2X6SA 3MN6A 1CLQA 3CJ9A 4CEZA 1HJOA 3KLEA 3HZ6A 1BOTO 4KRFA 4CEAA 3DI6A 3J7YP 5C0YA 2UXBK 4JD2B 3HBTA 3GDQA 1NK6A 3IS9A 1NGCA 2XY6A 4YDUA 1N36K 1EWQA 2HHHK 4FW1A 4H5VA 5KGWA 2Z1GA 1J5OA 3OYAA 3LZJA 2A6AA 2D1KA 4DU3A 4CF0A 3VQ7A 4GV3A 3VGMA 2HHXA 4DUZK 1N32K 3NF9A 4IDHA 2D5RA 1VRUA 2GX9A 1RT3A 1WBBA 4KHWA 5AQVA 5KRTA 2OCEA 1GLJO 2HBMA 2GWJA 4BRPA 4TSXA 3CJ7A 3ASMA 3OS2A 3VQCA 2A3ZA 3EZWA 4LD0A 1RGIA 4FZXC 3VQDA 1FKOA 1ZBFA 1C1BA 1WSEA 2X74A 1Q9XA 1IKVA 3L2RA 3A5MC 2RF2A 1U2VB 2Q3SA 3F73A 3L6QA 2G8KA 2QKBA 3MN7A 3A0IX 4CJPA 1HYZA 4DSLA 3C7NA 4JLHA 5AQOA 4F8RA 2LSNA 1TK0A 5SZTA 3TAPA 3TAQA 3BP8A 1QSYA 1JKHA 5FLXO 4FVUA 4I7FA 1QQNA 3O9SA 2G8IA 2EX3A 3QNOA 2OPRA 3TTDA 2F9TA 1RNHA 2O8EA 4DU1A 3B8AX 1MA9B 2F9WA 2E2PA 3TR8A 3U3YA 3OS0A 5HRPA 4JHDB 2Z1HA 2HHTA 2BANA 1SL0A 3VTHA 1BO5O 3NGYA 4H0YB 4KAZA 4YOVA 3QEXA 4AHSA 4W5RA 5CYMA 4DSJA 1Y64A 2IOCA 2V51B 4PKHA 5DM7L 2GWKA 2KKZA 4L3QA 4IO9L 4DFPA 2QM1A 3KK3A 3SCXA 4BRGA 3KLHA 1SZ2A 2P9NB 4H5WA 4Z4FA 2Q2RA 3BY5A 3OS1A 1N8RO 1SKWA 4DWIA 4AHCA 5KI6A 5CHIA 4CD3A 3TABA 5JLHA 2EHGA 4DLEA 4WQ4A 3SJJA 3AY9A 2I7PA 1T8EA 4MO5A 3VEVA 5LJVA 3LP2A 2DFHA 4JV5K 1ESVA 4B9UA 1NJZA 3FFIA 4FVMA 3J8AA 1ZC6A 4GV6A 3CCVN 3H1VX 3EY1A 3SBGA 3CIPA 3BGRA 3SI6A 3HXMA 3UKUB 1VSEA 1GLCG 3HI0A 3CD6N 3G10A 2ATQA 5AQUA 4CZGA 2VGMA 3NAEA 5EX5A 1R59O 2UU9K 3OYLA 4FJGA 2RPIA 3DXKA 4Z4CA 3V9XA 3T1YK 4FJNA 1KAXA 1OH5A 4JI5K 1HNIA 3K5MA 4KHPK 3E1YA 3VMFB 3C94A 4BY9C 3MXIA 3P1GA 3SQ2A 2BTFA 3NGIA 3H1QA 4B1VA 3F2KA 3U8XA 4FJHA 1QZ6A 4CEFA 4CJTA 3V9UA 3U4LA 1UWBA 1VQ8N 3OYKA 4Z94A 1BISA 2OZSA 3CFRA 3H08A 4X66K 4BRFA 3PIOL 2DFFA 4BRDA 4Q0BA 4M3WA 5AZJA 3H45C 1CXQA 3HOTA 3CCSN 2NRXA 4FL9A 3L2WA 4B3MK 1RBUA 4Y1CA 3F9KA 5J1EA 4YY3K 3ZETA 4OPKA 3BEXA 3K0SA 4BDZA 4CZKA 5HBMA 3VEZA 3ZT2A 2YJFA 4DU4A 2YHBA 4N47A 4OKKA 5F2RA 5BRFA 3RMCA 3F5TA 5J2MA 2JWLA 1NK0A 1U4BA 5FRNA 1NGAA 3CM6A 4CEDA 4FSVA 2FSJA 4MO4A 1HKGA 1L3TA 4H5NA 4DSEA 3EO3A 3MEGA 3HL8A 4ZTFA 2QKKA 3QESA 3NHGA 3DOKA 1S9EA 1N5YA 2BDPA 2HMPA 4KI6A 5T7BA 4FM1A 3AO5A 2P9LB 2OTLN 1V4SA 4CI6A 3NF7A 3AVGA 2F96A 1GOAA 4B3OA 3HPHA 2HB5A 3O4NA 3IRXA 3CCEN 3SMSA 4IJNA 4CJFA 3HK2A 3FR0A 4G1QA 3ZSQA 4F3OA 4DB3A 1SUQA 4FOEA 4OKJA 3W0LA 4NO7A 3K5NA 1X9MA 4CGFA 5CYQA 5ADXH 2PZSA 2WOMA 5EY4A 4DHYA 3MAQA 3RRGA 2GBZA 2YNGA 2QWRA 3L2QA 4FLUA 1KAYA 4CJEA 1EX4A 3ZYYX 4PQUA 4J2AA 3LDSA 1TK5A 3L3UA 1WN7A 2QWNA 5I9EB 3PUFA 3NH2A 1C6VA 1QHTA 5KPZA 4LF8K 4FK4A 4F3TA 1KRPA 3D2EB 2QTDA 5BPLA 1G15A 4PL8A 3J7AP 4NCGA 5DK5A 3D45A 4B9QA 3FZMA 4MLEA 1NK7A 2DPNA 3VF6A 4W5QA 2UXDK 1U04A 4ID1A 1HMVA 1NJIO 1U47A 2CGLA 4BQLA 1JLCA 1D8YA 4CIFA 3QINA 1KVAA 4CEQA 1XMOK 3FLCO 4MQ3A 3BF1A 1YJNN 4FLWA 4OPAA 3SYZA 4F9OA 4JKBA 2Q31A 1VAZA 3MWTA 1BCOA 2IIRA 5KGXA 4IXCA 1JCGA 1XMQK 4CHPA 4AM7A 1TAUA 1K73O 4K8ZA 4CZFA 1XHZA 2E2OA 3QERA 2HBLA 2PYJA 3WNEA 4DF8A 2YCHA 2CGJA 4XH1A 3VN5A 3NGZA 5BR9A 3V6DA 3P39A 1WSGA 4PKIA 1TV6A 1YAGA 4BGBA 4ELVA 1OKJA 2A40A 2QWPA 3IUCA 4BC4A 3G71N 3C6UA 4FZYA 3OW2M 1E4FT 1GOBA 3R9PA 5AQZA 4FJXA 4UQGA 1L3UA 4E19A 1VSIA 1IBKK 3DOLA 3DRPA 2X6NA 3IG1A 4IJAA 1YXQA 1ATSA 4H4OA 1RDAA 2OZMA 4QAGA 3TSQA 3THVA 4WFAL 4NCBA 3QDKA 1O1WA 4FJ5A 1CZ9A 4BR9A 1RFQA 4J2EA 1MU2A 2QI2A 3K5OA 5AQPA 4BR0A 1U2VA 4IZ9A 3ZSZA 1EO1A 4WE1A 4BRIA 2P5GA 4FJKA 3VENA 2QEXN 1HUXA 5LL6Z 4BRNA 4DCHA 1HJRA 3BDPA 1K8AO 3NH0A 1L3VA 2PBDA 2ZD1A 4CFDA 3HJFA 4C8KA 4FWKA 1YI2N 2HHSA 3IDHA 2OA8A 3FZFA 1VQ6N 4CZIA 1NNEA 3NH1A 5HRSA 2FBYA 2ZGYA 3AA2A 1RBTA 2WC9A 1IBMK 5H1SQ 4B8AB 4JHDA 2ZE2A 4O4GA 4BR7A 4QCLA 2P9UB 3M1FA 3WQUA 4AILC 2OPPA 1KCFA 3GL1A 4KO0A 4M3XA 4LH5A 3QMLA 3E9PA 3GOIA 1JJ2M 2NRVA 3QIPA 3QLHA 4RWTA 2NRWA 1B92A 2HNDA 4LF4K 1IV0A 3SMPA 4JKAA 3A8YA 3ZT1A 3FZLA 4WFBL 4O5FA 4WQ5C 4EZ9A 4WFNL 2P9NA 4M45A 1WNSA 1X9JA 3QBXA 3SUNA 1S72N 3NMUA 3MMVA 1MWKA 4HUGA 2Q0RA 2PAVA 1X9WA 4DR5K 2WUSA 3I55N 4CECA 4FWLA 3HVRA 4DSKA 3FFKB 4E1MA 4ZTJA 4KHQA 1NGBA 2F4VK 4DSFA 3BZCA 1VSDA 4IWVA 1HYVA 1NGGA 3MDQA 1TL1A 4IFEA 4Z4HA 3QFUA 4O0IA 4DR4K 1BHLA 4B9TA 1RDWX 1IKYA 2BH1A 3BF3A 5AFUH 4FWOA 5EU7A 1S1VA 1WUAA 3G4SN 3T1HK 1W7AA 1Z6RA 4OPHA 4JKFA 2IVPA 1TUYA 2KLAA 5GAHP 2GUPA 3ENOA 2YHXA 4NXMK 2JGUA 3R3LA 1N6QA 1TVRA 2ZJQL 3CCQN 3JXUA 4JKGA 3J7ZO 4JI7K 4W5TA 3AVHA 3LWMA 4CFBA 2JLEA 3PY8A 3AO1A 3LAKA 3FZHA 2VWJA 3EKSA 1LW0A 4BACA 1HNZK 1NGDA 4GKKK 1BDGA 5AQYA 4H0OA 4QS7A 1NOZA 3AV9A 3ZSWA 1ITGA 5M1FA 1HNVA 3AVAA 4CGHA 4YOYA 3CFPA 3ZLJA 1HX1A 2KZZA 3MEEA 3B6PA 4KBOA 3OYGA 4FLYA 4CEBA 1YF5L 5LMUK 1VRTA 3NF8A 4DR1K 4KTQA 4KTZA 2D0CA 4K41A 2CGKA 3F9MA 1C0GA 5BPNA 3UIQA 4FO0A 2BE2A 4JRQA 3HO1A 4LFCK 2P9LA 5FDLA 5M1QA 3HP6A 2FBXA 3O5BA 2I7NA 2O8DB 3DWLA 3CJAA 2ZJRL 4B9LA 3U9DA 5HLFA 1HPMA 5M1NA 3VQEA 1CZAN 1C0FA 2WTUA 1VSKA 3RVCA 1JLAA 1U45A 2Z1IA 3AA5X 3K5LA 4X62K 4RCHA 4XH5A 4IEEA 4CGGA 5JS2A 4BRCA 4DR2K 3IAYA 4KB0A 2KHOA 3V1QA 1XC9A 3HYFA 4FWSA 3E01A 4CIEA 3P83D 3K9KA 4RW6A 2GEMA 4OLAA 3I8BA 2B5JA 4IFYA 3VEWA 3AAPA 1VQPN 1V4TA 2O8BA 1A5WA 2V7YA 2FC0A 2E1ZA 3D2EA 1X3NA 4HTUA 3L3VA 2GUIA 3V1RA 1DKGD 4N41A 4JI6K 1S22A 2UYTA 3AVLA 2VWBA 3RMDA 4B1WB 3WNHA 1K6YA 1LAWA 3THWB 3HPOA 2O4GA 3MX5A 1WLJA 2KFZA 2H3GX 1VHXA 3CJ1A 4WYBA 3QEPA 1LCUA 1Z25A 3PLAA 1KVBA 3CMEN 3LDPA 4DS4A 2HHVA 4CJQA 4M3ZA 2HHUA 2WONA 1KXPA 3WNFA 1ATRA 4QOZB 4K43A 4I2PA 3QO9A 1BGXT 4RTFD 4B1XB 2VGNA 3TU5A 1RCHA 1ATNA 3JAMO 1NKEA 4L8RB 1VQ4N 2AP1A 4M3UA 3I0RA 4FPBA 4JI4K 3LZIA 4DTRA 3O3FA 3EN9A 4BREA 3LL3A 5MLCQ 4BR5A 5C2FA 5KPTA 3C6HA 3OYCA 2O8FA 4I2QA 1L5UA 4G9ZA 4FZZA 4M42A 2GELA 3CC4N 4DMNA 4DR3K 2F8SA 4RW8A 4B3SK 4DV5K 1HNXK 1XWLA 4Q5VA 1JL2A 1JXEA 1D4XA 4F2SA 1TKDA 3SJHA 2A42A 3VOVA 1IG9A 2D0AA 4H0TB 5AQJA 5AQTA 4HCCA 3S41A 5E84A 1K8KA 3CCUN 4OLBA 3AA3A 2Q36A 3CM5A 3ZSOA 1UOCA 3ZEUB 3QNNA 1WSHA 2DFEA 2QWLA 5GIOA 2HSTA 3I8DA 1JCFA 3O80A 4CHYA 2G8VA 2E2QA 1OH7A 4ICLA 4ISGA 4LF7K 4JKEA 4BDYA 3UKRB 3U3GA 3KLGA 4JS4A 3CCJN 4LSLA 2ETJA 3U6FA 1P90A 1QVGM 3OBYA 3IKMA 1KLMA 2Q0UA 1W9HA 3M8QA 3OJUA 3CPWM 1YVUA 3C6AA 3O4WA 1QE1A 3SZ2A 4DG1A 2F7TA 3UB5A 4FLTA 4B9VA 1BCMA 4LH4A 1SQKA 3FE1A 1WSIA 5AQFA 4BDPA 3LP3A 4GKJK 2E5LK 2YHAA 4E7IA 3NDKA 1IKXA 2RE2A 4WF9L 4BVOA 4JKGB 5GINA 4A57A 3SNNA 1VQMN 2P9UA 4B8CA 1VSHA 1LOTB 4DV4K 1RT5A 3PO5A 5IT9O 1QQMA 4FK0A 3KD5E 1RT6A 4DLGA 1WBDA 3H46O 2HVHA 1NOYA 4BGAA 1S1XA 5BR8K 4DQRA 3O4QA 4YDUC 4DTUA 5B8HA 4FK2A 4ILJA 2OTJN 1N33K 4FJMA 3GE1A 3LM2A 4JKHA 1ASWA 4CJ5A 3T69A 2ZWHA 4PWDA 4JI8K 3NFAA 2E4LA 2HHQA 5HL7L 3LPUA 4PHTX 3LDNA 5HOOA 4AHTA 3ID6A 4CK2A 5IWAK 3A5LC 4KPYA 3J80O 3G25A 1NK8A 5I42A 1NKBA 4NYFA 4HTLA 3DLLL 2PYLA 3OVNA 1NGFA 1GLFO 3AGRA 3CCLN 5AQLA 1C0MA 3EYZA 1YJ9N 2W6LA 4QS9A 4FJ7A 1RT4A 3KZBA 4RW7A 1R0AA 1Q18A 5CZ1A 4J2BA 1U48A 2P9PB 3CCMN 4CJWA 3A5NC 3SQ1A 1J54A 1RBSA 4CE9A 3DYAA 5EXWA 4CHZA 5JVGL 4H5RA 1Q7YO 3HSCA 5AQKA 3SLCA 1J9AA 1ZBLA 4IBNA 3AVNA 1QHAA 4O5BA 2O8BB 2V52B 1I39A 3R6MA 5CZ2A 3WNGA 1QSLA 1DGKN 1I3AA 3LALA 3OTOK 3R8EA 5GAEP 3K59A 3CCRN 1XI1A 2FXUA 3MX2A 1REVA 1TK8A 1O13A 4N76A 3WQTA 4R5PA 4O0JA 4DF4A 4LC9B 4IDKA 3GG4A 1EETA 4BWJA 2FSNA 1HQEA 1EQYA 2O8CB 3KTQA 1RT1A 4I6MA 3QBWA 3T7ZA 4BRHA 1EXQA 1JLBA 1SL1A 1BA0A 4B3TK 1T6CA 2ITGA 2Y1IA 2W41A 4WQ4C 2VQEK 4ZHRA 4PL7A 3NE6A 1X1PA 3THXB 2YNHA 4BC3A 2Y1JA 3OYFA 3CQ8A 3W3DA 4A5AA 5M1KA 1HKBA 2YKMA 1L3SA 2E2NA 2O8DA 2YJEA 3E9LA 4B1UB 2HF4A 2WFBA 2VCPA 3GBTA 5FRMA 4FWPA 1E3MA 3VTIA 2O8FB 4E3SA 1HKCA 4KH5A 4YOUA 3AVIA 3E66A 3SAHA 4CK1A 5AQGA 3TSPA 4E89A 1VQNN 4BROA 3P38A 2HF3A 5I3UA 3MK6A 4DTOA 2VG5A 5C25A 4KREA 3MXMA 4O44A 3TAGA 4B9MA 2YX6A 4DV0K 3FGUA 3TAMA 2IS3A 4AM6A 3V4IA 3L2UA 3CMAN 4E7JA 4C8LA 4M7YA 1X3MA 1K8KB 3KVGA 3D0PA 3CC7N 5J2NA 4CCHA 2BGGA 3ZX0A 3KK1A 5FPMA 3KLFA 4OKEA 4DV1K 1T7PA 3OHRA 3THWA 1Q82O 3S9HA 2QXFA 3EE8A 4MLHA 4H0VB 4F2RA 2ZF5O 2BUPA 1VQON 3SAGA 3JYTA 4CIGA 5AQSA 1Q81O 2ASPA 4Y0WA 1EP4A 3ZSVA 1NBWA 1ILYA 3CI5A 5FROA 1Q86O 4MDBA 3I0SA 4OGCA 5A2QO 2FF3B 1FW6A 4KKOA 4CBWA 1SKSA 4CJ4A 5BPMA 5CE3A 4AHVA 4ELTA 1C0TA 2HOEA 1LAVA 4FJJA 3OY9A 4QS8A 1FKPA 4H8KA 1TGOA 4GY2B 4EAHD 3SV4A 4DV2K 1BUPA 4FJIA 4RW9A 1NJYA 4DSIA 1WOQA 1SL2A 1JLQA 1D5AA 1NGHA 4CEEA 4C1NK 4DV7K 2UUBK 4A61A 4FOIA 5EOYA 3PSIA 3M3ZA 2ZGZA 4CBXA 4BRAA 5FPNA 3K57A 3L0QA 4CJUA 5JICA 3ZSYA 3ZX2A 3EL2A 2XY7A 4PKGA 1CXUA 1UA1A 4DTMA 3OYBA 4BVPA 1OVYA 2GTDA 4FWRA 3M8PA 2G8UA 3ZEUA 2A5XA 1NU0A 2E20A 4JN4A 5EVZA 2CH6A 4OVLA 1NK9A 3OYJA 4DS5A 2NZTA 1BIUA 1F21A 2V7ZA 4ILHA 4FXDA 3ATVA 3OA9A 3AO2A 4EHTA 4EP4A 4IOXA 4IEIA 3UKRA 4OGEA 1TUUA 3ID8A 4FWNA 3PSFA 3L2VA 3SUPA 4ISEA 3RRHA 3K2PA 4X64K 4C1NI 4M7XA 4KHNA 1NMDA 4XIUA 3OBWA 1BG3A 1NJXA 4DFKA 5C24A 1NK4A 2IGIA 4KH6A 2D0OA 3VQ8A 3DLHA 3ENBA 3V9SA 3AO3A 1W0HA 5KQ8A 2OYQA 4YORA 3WEEB 4NB4A 2UUAK 1HRHA 3LAMA 2QK9A 3AARA 1YTAA 1B9DA 3JS6A 2W6KA 4O8KA 3VA3A 4KHUA 1OH8A 4M3TA 5M1OA 3M5RA 1KFDA 4CF9A 4WCEL 3CC2N 1ZXOA 3KK7A 3PV8A 1MWMA 2P9KA 3SQ4A 1TKZA 3QETA 3SPZA 2PFUA 3O08A 3D6RA 3WXMB 4FLVA 4BRKA 1ZBSA 2P9IB 5HRRA 4W5OA 2I5JA 1Z05A 1FJGK 3VEYA 2HNYA 3HTVA 1WSFA 4CF1A 3C95A 1G99A 2JWKA 3G6EN 4FYDA 5AQQA 2X78A 4JAXA 3KKSA 5C42A 5D3GA 2UXCK 4BE2A 4I6MB 1VSLA 2HNZA 1J5EK 3AVBA 1BU6O 1RDBA 1HNWK 4O55A 3VESA 3DM2A 4A2AA 3T1AA 4FJ9A 2E8AA 3PIPL 4K0KK 4CJRA 3VEXA 5FPDA 4XH4A 2KTQA 5AQNA 1XNQK 4HUEA 3LANA 4FJ8A 2D0BA 1S5JA 4E1NA 1OVQA 4CJ3A 3O1BA 3LWLA 1BA1A 3ZSRA 2FSKA 5AJ3K 4E0DA 4H0PA 4IG0A 4E7KA 1C1AA 1RBRA 2P9PA 4I9QA 1DTTA 2Q97A 3OYMA 4ID5A 4CFCA 1ZBUA 3D2FB 4LFBK 4DTXA 3DRRA 3MCPA 1S9GA 3I33A 4NLBA 4E1JA 4K8XA 3VQAA 4R79A 4JRPA 1KQSM 1S1WA 4BG9A 1KTQA 2YNIA 3NVMA 4LF5K 4B1ZA 1KC8O 3KKRA 2FBVA 3KD1E 1VSFA 5LY3A 2A1SA 1K9MO 3A5OC 3I56N 4DQSA 4CW7B 1XNRK 3UE5A 3VF4A 1TYQA 2NLXA 1T44A 3AVJA 1GLEG 4I9LA 3WXJA 4CFAA 3AVCA 3SUQA 3VEOA 3O9QA 4Y1DA 4BG8A 3MCAB 4NYNA 2XO7A 3TANA 5F1XA 5CY4A 5E41A 2O8CA 2DY4A 3N4PA 2R7YA 3EKUA 3C0BA 3DAWA 3TTFA 3T3FA 1BI4A 5DMRA 5C10A 1YJWN 3QEIA 3RMBA 4BR4A 3TAFA 1QTMA 3AVKA 4H5TA 3NF6A 1X9SA 4UY8O 2PY5A 3THXA 1LW2A 2G8WA 3THYA 5AZIB 4CEOA 2HBKA 5E26A 3LP0A 5HP1A 2CH5A 1NLVA 1GLBG 2ZQBA 4U7BA 4DQQA 2ITMA 2E1YA 2O4IA 1KVCA 4BC2A 2VWKA 4JKCA 4A62A 1SKRA 4DV3K 2ZM6K 3FZKA 4H03B 4CF8A 4B9SA 4A2BA 3BUZB 1FK9A 3O6WA 5KTQA 3A2FA 1YVNA 4JEPA 2YNFA 3CJCA 1SAZA 4PA1A 4IOCL 5KPRA 1T3VA 1KSPA 4PUOA 4FM0A 4JS5A 2NUBA 3MN9A 1HQUA 1YT3A 1Q8IA 3VQ5A 3VQ4A 5CR4A 1OH6A 3AO4A 5KQDA 3WT0A 1FXXA 3TPQA
chains in the Genus database with same CATH topology
3J7AP 4JI6K 5LL6Z 4NXMK 5FLXO 1N34K 4B3RK 4JI1K 2UUCK 4LFBK 4DR6K 4DV1K 2UXDK 4DR7K 4DV6K 4JI7K 4X64K 4NXNK 4X66K 1IBLK 1HNZK 1IBMK 4LF5K 4GKKK 4X65K 4AQYK 4B3MK 1XMOK 3OTOK 4YY3K 2UUAK 4GKJK 1I94K 2E5LK 2VQFK 4JYAK 4CW7B 1XNRK 3JAMO 4DV4K 5A2QO 5IT9O 1XMQK 4JI4K 3J7YP 5LMUK 4LF4K 2UXBK 4DR1K 5BR8K 1N36K 1N33K 4B3TK 4DV2K 4OX9K 4V19S 2HHHK 4CVNE 4JI3K 4LF6K 3J81O 2VQEK 1FJGK 4LFCK 4DR3K 4DR5K 4JI8K 4B3SK 4DV5K 4DV7K 1HNXK 4DUZK 2UUBK 1N32K 2UXCK 2F4VK 4JV5K 1J5EK 1IBKK 4JI0K 5IWAK 1HNWK 4JI2K 4X62K 5LMNK 4DV3K 2ZM6K 4DR2K 3J80O 1HR0K 4YHHK 4K0KK 4DR4K 4LFAK 1XNQK 2UU9K 3T1HK 3T1YK 4JI5K 4LF8K 4LF7K 4DV0K 4LF9K 4KHPK 5AJ3K 4DUYK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A P;  4JI6 K;  5LL6 Z;  4NXM K;  5FLX O;  1N34 K;  4B3R K;  4JI1 K;  2UUC K;  4LFB K;  4DR6 K;  4DV1 K;  2UXD K;  4DR7 K;  4DV6 K;  4JI7 K;  4X64 K;  4NXN K;  4X66 K;  1IBL K;  1HNZ K;  1IBM K;  4LF5 K;  4GKK K;  4X65 K;  4AQY K;  4B3M K;  1XMO K;  3OTO K;  4YY3 K;  2UUA K;  4GKJ K;  1I94 K;  2E5L K;  2VQF K;  4JYA K;  4CW7 B;  1XNR K;  3JAM O;  4DV4 K;  5A2Q O;  5IT9 O;  1XMQ K;  4JI4 K;  3J7Y P;  5LMU K;  4LF4 K;  2UXB K;  4DR1 K;  5BR8 K;  1N36 K;  1N33 K;  4B3T K;  4DV2 K;  4OX9 K;  4V19 S;  2HHH K;  4CVN E;  4JI3 K;  4LF6 K;  3J81 O;  2VQE K;  1FJG K;  4LFC K;  4DR3 K;  4DR5 K;  4JI8 K;  4B3S K;  4DV5 K;  4DV7 K;  1HNX K;  4DUZ K;  2UUB K;  1N32 K;  2UXC K;  2F4V K;  4JV5 K;  1J5E K;  1IBK K;  4JI0 K;  5IWA K;  1HNW K;  4JI2 K;  4X62 K;  5LMN K;  4DV3 K;  2ZM6 K;  4DR2 K;  3J80 O;  1HR0 K;  4YHH K;  4K0K K;  4DR4 K;  4LFA K;  1XNQ K;  2UU9 K;  3T1H K;  3T1Y K;  4JI5 K;  4LF8 K;  4LF7 K;  4DV0 K;  4LF9 K;  4KHP K;  5AJ3 K;  4DUY K; 
#chains in the Genus database with same CATH topology
 1NGJ A;  1N34 K;  3TI0 A;  2KW4 A;  2QW9 A;  3AVF A;  2XY5 A;  1T05 A;  5BN9 A;  1GLL O;  3IMX A;  2VG6 A;  4AH9 A;  5AQI A;  4DR7 K;  4DV6 K;  3LPT A;  1S6P A;  4EIA A;  2IVN A;  2YHY A;  1RDC A;  1IBL K;  1QQO A;  1ZBH A;  3VF2 A;  5J2Q A;  4FLX A;  3DLK A;  4CHN A;  3V9W A;  1TKX A;  4CZL A;  3ZT0 A;  5BRH A;  3Q7C A;  4JYA K;  4FJL A;  1SV5 A;  3DJC A;  2KQ2 A;  4KTW A;  2D4W A;  3U9Z A;  1JLF A;  4DQ8 A;  2IVO A;  1H1V A;  4CJ7 A;  3RR7 A;  4K42 A;  3LDO A;  1NKC A;  4GV9 A;  3L4Q A;  4CHQ A;  5JLF A;  1Z26 A;  4IO8 A;  4Z0U A;  3VPZ A;  1JL1 A;  1IH7 A;  3CF5 L;  4AHU A;  3VET A;  1LWE A;  5ADX A;  5JS1 A;  4DTP A;  5HRN A;  4IOA L;  1GLD G;  4J2D A;  1IJJ A;  5BN8 A;  3L4I A;  1S6Q A;  3EZ5 A;  3S3N A;  3RMA A;  2P9K B;  4FM2 A;  5GIP A;  3HVT A;  3CQY A;  5AQH A;  3P4I A;  3ULE B;  4BC5 A;  1NGE A;  2W42 A;  4MDA A;  4A59 A;  1RT7 A;  4YHH K;  3ATU A;  2NRZ A;  4DTN A;  3O3G A;  1BQM A;  1MDU B;  1VK0 A;  1UAX A;  4CJS A;  4DTS A;  3AAQ A;  5C15 A;  4B9N A;  2AA4 A;  3O9R A;  2GV9 A;  2YI1 A;  3HST B;  2P9S B;  4JNE A;  4C8M A;  1KD1 O;  2F8T A;  1VSJ A;  5AQX A;  2IC3 A;  3ULD A;  1NJW A;  4F4K A;  1RTJ A;  4CES A;  1GLA G;  4CHO A;  4EFH A;  1NK5 A;  3E9O A;  1Y97 A;  2OAN A;  5BRD A;  4DUY K;  1VQ7 N;  1S1U A;  3DXM B;  4YNQ A;  1YIJ N;  4DR6 K;  3H3N O;  4BWM A;  2NRR A;  3B6O A;  4FW2 A;  2AJQ A;  3O1W A;  1BL3 A;  1RIL A;  5JVH L;  4HUF A;  4JK7 A;  3SUO A;  2A1R A;  3SPY A;  3WXK A;  3WUH A;  3PX4 A;  1U6Z A;  1YUW A;  3WXI A;  3SV3 A;  4BRM A;  4BR2 A;  3ZX3 A;  3TWH A;  3S3O A;  4ELU A;  3OYI A;  4FCY A;  3HM8 A;  2B6A A;  1KFS A;  1RTD A;  1I94 K;  3WEE A;  3C65 A;  3O9U A;  4LY7 A;  3ZT4 A;  2J4R A;  3DLE A;  3RSE A;  2ZJP L;  2Q1N A;  4CK3 A;  1ASU A;  4CGJ A;  1ZBI A;  1D9D A;  3L8B A;  3ISN C;  4E7L A;  4NLC A;  3T19 A;  1QVF M;  2OPS A;  3TAR A;  3SK3 A;  3KLI A;  1IG8 A;  2NRT A;  1NGI A;  4WQ5 A;  4V19 S;  4LF6 K;  2P9I A;  4B08 A;  3J81 O;  3LDQ A;  4ILG B;  1XQS C;  4IG3 A;  1TYQ B;  4BRQ A;  2YKN A;  4CER A;  5BRE A;  1VSM A;  1VQ9 N;  3PX0 A;  3O9T A;  2YHW A;  2P5O A;  3C6T A;  5GAD P;  5JMV A;  1M1K O;  4BE1 A;  3CJB A;  3MWP A;  3LP1 A;  1BI4 B;  3CER A;  1E4G T;  3P5J A;  2HVI A;  4RW4 A;  1HPZ A;  1RTH A;  3KK2 A;  3VGK A;  3EE9 A;  4H4M A;  3LDL A;  3CHW A;  1UA0 A;  4KFB A;  3M8R A;  4FPA A;  4KH4 A;  3THY B;  3ENH A;  4IKF A;  3H3O B;  1RTI A;  3C7N B;  2RHK A;  2FF6 A;  3PO4 A;  3QEW A;  3DRS A;  2D0P A;  2Z1J A;  3MEC A;  3K58 A;  2RKI A;  4M3R A;  4CGD A;  1ASV A;  1T6D A;  4M63 C;  4FWQ A;  3P31 A;  3VQB A;  4AF1 A;  3AA4 A;  4JI1 K;  3RWU A;  2KZM A;  4HVJ A;  4CJL A;  4YOW A;  3D2F A;  2O8E B;  4EP5 A;  4B1Y B;  4DQP A;  1QS4 A;  4M3Y A;  3HT3 A;  4HCB A;  1HYS A;  4XEI A;  3SAF A;  3HPG A;  2E6M A;  1XUP O;  1YIT N;  5J2P A;  4JD2 A;  3ZCM A;  4AQY K;  3O3H A;  4DTJ A;  1U49 A;  3QIC A;  1LV5 A;  2WBN A;  4HHT A;  4LSN A;  5SWM A;  1DLO A;  2HMI A;  3NVK A;  2QXL A;  3H6E A;  5HRO A;  1NWK A;  3TTC A;  4CJK A;  1D9F A;  4K25 A;  4YFU A;  3HP9 A;  4OJR A;  3QEV A;  2HHW A;  4GVM A;  2P1J A;  3M8S A;  3KIO A;  1KAZ A;  4U67 L;  5K14 A;  2A41 A;  1KLN A;  2VG7 A;  2IAJ A;  3DLB A;  4MFB A;  1WAJ A;  2VYP A;  2XY8 A;  3K9J A;  4ISF A;  3TSU A;  4CD1 A;  4BE0 A;  3G0Z A;  1LWF A;  2NRH A;  3VGL A;  1JLE A;  5LJW A;  1YHQ N;  1ZYQ A;  4CVN E;  1IKW A;  5AQR A;  3DLG A;  1B9F A;  1EKE A;  3VER A;  3OYH A;  5AQM A;  4OO1 J;  4JKD A;  5AQW A;  5AFU A;  2YV0 X;  1VQK N;  4Z4I A;  1YTU A;  4PY5 A;  2P51 A;  3CFO A;  2RN2 A;  5AZI A;  3ZSX A;  2XRI A;  1SS6 A;  4KB1 A;  4JI0 K;  4DFM A;  1A5X A;  4IFV A;  4JI2 K;  3KWG A;  5LMN K;  3HOS A;  2B4J A;  4CF2 A;  2ASO A;  3ZT3 A;  1CZB A;  1NG9 A;  2E88 A;  3AGK A;  2ASM A;  4CBU A;  4LFA K;  3OYE A;  1HLU A;  3DXK B;  4C8N A;  4BRL A;  3VA0 A;  1M90 O;  5GAG P;  1XHX A;  3AVM A;  3CPE A;  3HM9 A;  3KWI A;  4CZH A;  3CET A;  1LWC A;  3V1O A;  5TKY A;  4B3R K;  2DTU A;  1BQN A;  3RTV A;  2UUC K;  1RDD A;  3DLR A;  3CXC M;  1T03 A;  5C2D A;  3MED A;  4CZE A;  2W40 A;  5TKW A;  4E7H A;  3QIO A;  5AZJ B;  3BZK A;  4N56 A;  5F0X A;  4FWM A;  3VQ6 A;  4GW6 A;  1DT9 A;  4X65 K;  3RR8 A;  3ZET B;  2G8H A;  3PX6 A;  4O8U A;  3MXJ A;  2HBJ A;  2VQF K;  1W97 L;  2HW3 A;  1TL3 A;  4GNI A;  3VQQ A;  3QB0 A;  2FBT A;  4A5B A;  3OYD A;  4DFJ A;  1EWR A;  4J8F A;  1GOC A;  4KI4 A;  1JLG A;  5ELZ A;  1P8Z A;  3MN5 A;  1S1T A;  2QWM A;  2FLO A;  3VQ9 A;  3TAE A;  4BQZ A;  3CYM A;  4EHU A;  2IDO A;  4CGI A;  4OX9 K;  4JI3 K;  1J6Z A;  3IFR A;  3UKU A;  1TKT A;  3V9Z A;  3RSE B;  3M6G A;  3KHY A;  4M41 A;  3CG7 A;  1NM1 A;  1IO2 A;  4CZJ A;  3OJS A;  1JCE A;  4DQI A;  3V81 A;  2NNW A;  4N5S A;  3VQP A;  3KJV A;  3N4Q A;  4C23 A;  4JK9 A;  4AHR A;  3ITH A;  1TAQ A;  3SBT A;  5DM6 L;  2XHB A;  3ULE A;  1BWF O;  1S3X A;  1WB9 A;  3O8M A;  4YOX A;  4YOT A;  1VQL N;  1HR0 K;  4Z4G A;  1RBV A;  2E6L A;  5C12 A;  2QWQ A;  4Z4E A;  4W5N A;  4CJV A;  4C8O A;  1JXB A;  4GMJ B;  1BIZ A;  1WSJ A;  3OYN A;  1QQC A;  4JK8 A;  3NCI A;  1QSS A;  4KV8 A;  2P9S A;  3NBP A;  2G8F A;  2KFN A;  4LF9 K;  1C1C A;  5FPE A;  1RDU A;  5AR0 A;  1VQ5 N;  1QZ5 A;  3LM9 A;  2QWO A;  1DEJ A;  4FLZ A;  4NCA A;  4KHS A;  1NMN A;  3R1X A;  3DXM A;  3S3M A;  3CQX A;  3ALY A;  3DMJ A;  5KRS A;  1WAF A;  3Q7B A;  4NXN K;  4RG8 A;  3WXL A;  4KHY A;  2OPQ A;  4EZ6 A;  1XC3 A;  2EWS A;  4H0X B;  5M1P A;  1RT2 A;  1W2B M;  3SQ0 A;  1Q9Y A;  3HRG A;  1J53 A;  3EEQ A;  2QA4 N;  4HWI A;  4GVE A;  4OPJ A;  3D7E O;  4DKW A;  3JSM A;  4CZM A;  3QFP A;  1A5V A;  1DTQ A;  1C0U A;  2X6S A;  3MN6 A;  1CLQ A;  3CJ9 A;  4CEZ A;  1HJO A;  3KLE A;  3HZ6 A;  1BOT O;  4KRF A;  4CEA A;  3DI6 A;  3J7Y P;  5C0Y A;  2UXB K;  4JD2 B;  3HBT A;  3GDQ A;  1NK6 A;  3IS9 A;  1NGC A;  2XY6 A;  4YDU A;  1N36 K;  1EWQ A;  2HHH K;  4FW1 A;  4H5V A;  5KGW A;  2Z1G A;  1J5O A;  3OYA A;  3LZJ A;  2A6A A;  2D1K A;  4DU3 A;  4CF0 A;  3VQ7 A;  4GV3 A;  3VGM A;  2HHX A;  4DUZ K;  1N32 K;  3NF9 A;  4IDH A;  2D5R A;  1VRU A;  2GX9 A;  1RT3 A;  1WBB A;  4KHW A;  5AQV A;  5KRT A;  2OCE A;  1GLJ O;  2HBM A;  2GWJ A;  4BRP A;  4TSX A;  3CJ7 A;  3ASM A;  3OS2 A;  3VQC A;  2A3Z A;  3EZW A;  4LD0 A;  1RGI A;  4FZX C;  3VQD A;  1FKO A;  1ZBF A;  1C1B A;  1WSE A;  2X74 A;  1Q9X A;  1IKV A;  3L2R A;  3A5M C;  2RF2 A;  1U2V B;  2Q3S A;  3F73 A;  3L6Q A;  2G8K A;  2QKB A;  3MN7 A;  3A0I X;  4CJP A;  1HYZ A;  4DSL A;  3C7N A;  4JLH A;  5AQO A;  4F8R A;  2LSN A;  1TK0 A;  5SZT A;  3TAP A;  3TAQ A;  3BP8 A;  1QSY A;  1JKH A;  5FLX O;  4FVU A;  4I7F A;  1QQN A;  3O9S A;  2G8I A;  2EX3 A;  3QNO A;  2OPR A;  3TTD A;  2F9T A;  1RNH A;  2O8E A;  4DU1 A;  3B8A X;  1MA9 B;  2F9W A;  2E2P A;  3TR8 A;  3U3Y A;  3OS0 A;  5HRP A;  4JHD B;  2Z1H A;  2HHT A;  2BAN A;  1SL0 A;  3VTH A;  1BO5 O;  3NGY A;  4H0Y B;  4KAZ A;  4YOV A;  3QEX A;  4AHS A;  4W5R A;  5CYM A;  4DSJ A;  1Y64 A;  2IOC A;  2V51 B;  4PKH A;  5DM7 L;  2GWK A;  2KKZ A;  4L3Q A;  4IO9 L;  4DFP A;  2QM1 A;  3KK3 A;  3SCX A;  4BRG A;  3KLH A;  1SZ2 A;  2P9N B;  4H5W A;  4Z4F A;  2Q2R A;  3BY5 A;  3OS1 A;  1N8R O;  1SKW A;  4DWI A;  4AHC A;  5KI6 A;  5CHI A;  4CD3 A;  3TAB A;  5JLH A;  2EHG A;  4DLE A;  4WQ4 A;  3SJJ A;  3AY9 A;  2I7P A;  1T8E A;  4MO5 A;  3VEV A;  5LJV A;  3LP2 A;  2DFH A;  4JV5 K;  1ESV A;  4B9U A;  1NJZ A;  3FFI A;  4FVM A;  3J8A A;  1ZC6 A;  4GV6 A;  3CCV N;  3H1V X;  3EY1 A;  3SBG A;  3CIP A;  3BGR A;  3SI6 A;  3HXM A;  3UKU B;  1VSE A;  1GLC G;  3HI0 A;  3CD6 N;  3G10 A;  2ATQ A;  5AQU A;  4CZG A;  2VGM A;  3NAE A;  5EX5 A;  1R59 O;  2UU9 K;  3OYL A;  4FJG A;  2RPI A;  3DXK A;  4Z4C A;  3V9X A;  3T1Y K;  4FJN A;  1KAX A;  1OH5 A;  4JI5 K;  1HNI A;  3K5M A;  4KHP K;  3E1Y A;  3VMF B;  3C94 A;  4BY9 C;  3MXI A;  3P1G A;  3SQ2 A;  2BTF A;  3NGI A;  3H1Q A;  4B1V A;  3F2K A;  3U8X A;  4FJH A;  1QZ6 A;  4CEF A;  4CJT A;  3V9U A;  3U4L A;  1UWB A;  1VQ8 N;  3OYK A;  4Z94 A;  1BIS A;  2OZS A;  3CFR A;  3H08 A;  4X66 K;  4BRF A;  3PIO L;  2DFF A;  4BRD A;  4Q0B A;  4M3W A;  5AZJ A;  3H45 C;  1CXQ A;  3HOT A;  3CCS N;  2NRX A;  4FL9 A;  3L2W A;  4B3M K;  1RBU A;  4Y1C A;  3F9K A;  5J1E A;  4YY3 K;  3ZET A;  4OPK A;  3BEX A;  3K0S A;  4BDZ A;  4CZK A;  5HBM A;  3VEZ A;  3ZT2 A;  2YJF A;  4DU4 A;  2YHB A;  4N47 A;  4OKK A;  5F2R A;  5BRF A;  3RMC A;  3F5T A;  5J2M A;  2JWL A;  1NK0 A;  1U4B A;  5FRN A;  1NGA A;  3CM6 A;  4CED A;  4FSV A;  2FSJ A;  4MO4 A;  1HKG A;  1L3T A;  4H5N A;  4DSE A;  3EO3 A;  3MEG A;  3HL8 A;  4ZTF A;  2QKK A;  3QES A;  3NHG A;  3DOK A;  1S9E A;  1N5Y A;  2BDP A;  2HMP A;  4KI6 A;  5T7B A;  4FM1 A;  3AO5 A;  2P9L B;  2OTL N;  1V4S A;  4CI6 A;  3NF7 A;  3AVG A;  2F96 A;  1GOA A;  4B3O A;  3HPH A;  2HB5 A;  3O4N A;  3IRX A;  3CCE N;  3SMS A;  4IJN A;  4CJF A;  3HK2 A;  3FR0 A;  4G1Q A;  3ZSQ A;  4F3O A;  4DB3 A;  1SUQ A;  4FOE A;  4OKJ A;  3W0L A;  4NO7 A;  3K5N A;  1X9M A;  4CGF A;  5CYQ A;  5ADX H;  2PZS A;  2WOM A;  5EY4 A;  4DHY A;  3MAQ A;  3RRG A;  2GBZ A;  2YNG A;  2QWR A;  3L2Q A;  4FLU A;  1KAY A;  4CJE A;  1EX4 A;  3ZYY X;  4PQU A;  4J2A A;  3LDS A;  1TK5 A;  3L3U A;  1WN7 A;  2QWN A;  5I9E B;  3PUF A;  3NH2 A;  1C6V A;  1QHT A;  5KPZ A;  4LF8 K;  4FK4 A;  4F3T A;  1KRP A;  3D2E B;  2QTD A;  5BPL A;  1G15 A;  4PL8 A;  3J7A P;  4NCG A;  5DK5 A;  3D45 A;  4B9Q A;  3FZM A;  4MLE A;  1NK7 A;  2DPN A;  3VF6 A;  4W5Q A;  2UXD K;  1U04 A;  4ID1 A;  1HMV A;  1NJI O;  1U47 A;  2CGL A;  4BQL A;  1JLC A;  1D8Y A;  4CIF A;  3QIN A;  1KVA A;  4CEQ A;  1XMO K;  3FLC O;  4MQ3 A;  3BF1 A;  1YJN N;  4FLW A;  4OPA A;  3SYZ A;  4F9O A;  4JKB A;  2Q31 A;  1VAZ A;  3MWT A;  1BCO A;  2IIR A;  5KGX A;  4IXC A;  1JCG A;  1XMQ K;  4CHP A;  4AM7 A;  1TAU A;  1K73 O;  4K8Z A;  4CZF A;  1XHZ A;  2E2O A;  3QER A;  2HBL A;  2PYJ A;  3WNE A;  4DF8 A;  2YCH A;  2CGJ A;  4XH1 A;  3VN5 A;  3NGZ A;  5BR9 A;  3V6D A;  3P39 A;  1WSG A;  4PKI A;  1TV6 A;  1YAG A;  4BGB A;  4ELV A;  1OKJ A;  2A40 A;  2QWP A;  3IUC A;  4BC4 A;  3G71 N;  3C6U A;  4FZY A;  3OW2 M;  1E4F T;  1GOB A;  3R9P A;  5AQZ A;  4FJX A;  4UQG A;  1L3U A;  4E19 A;  1VSI A;  1IBK K;  3DOL A;  3DRP A;  2X6N A;  3IG1 A;  4IJA A;  1YXQ A;  1ATS A;  4H4O A;  1RDA A;  2OZM A;  4QAG A;  3TSQ A;  3THV A;  4WFA L;  4NCB A;  3QDK A;  1O1W A;  4FJ5 A;  1CZ9 A;  4BR9 A;  1RFQ A;  4J2E A;  1MU2 A;  2QI2 A;  3K5O A;  5AQP A;  4BR0 A;  1U2V A;  4IZ9 A;  3ZSZ A;  1EO1 A;  4WE1 A;  4BRI A;  2P5G A;  4FJK A;  3VEN A;  2QEX N;  1HUX A;  5LL6 Z;  4BRN A;  4DCH A;  1HJR A;  3BDP A;  1K8A O;  3NH0 A;  1L3V A;  2PBD A;  2ZD1 A;  4CFD A;  3HJF A;  4C8K A;  4FWK A;  1YI2 N;  2HHS A;  3IDH A;  2OA8 A;  3FZF A;  1VQ6 N;  4CZI A;  1NNE A;  3NH1 A;  5HRS A;  2FBY A;  2ZGY A;  3AA2 A;  1RBT A;  2WC9 A;  1IBM K;  5H1S Q;  4B8A B;  4JHD A;  2ZE2 A;  4O4G A;  4BR7 A;  4QCL A;  2P9U B;  3M1F A;  3WQU A;  4AIL C;  2OPP A;  1KCF A;  3GL1 A;  4KO0 A;  4M3X A;  4LH5 A;  3QML A;  3E9P A;  3GOI A;  1JJ2 M;  2NRV A;  3QIP A;  3QLH A;  4RWT A;  2NRW A;  1B92 A;  2HND A;  4LF4 K;  1IV0 A;  3SMP A;  4JKA A;  3A8Y A;  3ZT1 A;  3FZL A;  4WFB L;  4O5F A;  4WQ5 C;  4EZ9 A;  4WFN L;  2P9N A;  4M45 A;  1WNS A;  1X9J A;  3QBX A;  3SUN A;  1S72 N;  3NMU A;  3MMV A;  1MWK A;  4HUG A;  2Q0R A;  2PAV A;  1X9W A;  4DR5 K;  2WUS A;  3I55 N;  4CEC A;  4FWL A;  3HVR A;  4DSK A;  3FFK B;  4E1M A;  4ZTJ A;  4KHQ A;  1NGB A;  2F4V K;  4DSF A;  3BZC A;  1VSD A;  4IWV A;  1HYV A;  1NGG A;  3MDQ A;  1TL1 A;  4IFE A;  4Z4H A;  3QFU A;  4O0I A;  4DR4 K;  1BHL A;  4B9T A;  1RDW X;  1IKY A;  2BH1 A;  3BF3 A;  5AFU H;  4FWO A;  5EU7 A;  1S1V A;  1WUA A;  3G4S N;  3T1H K;  1W7A A;  1Z6R A;  4OPH A;  4JKF A;  2IVP A;  1TUY A;  2KLA A;  5GAH P;  2GUP A;  3ENO A;  2YHX A;  4NXM K;  2JGU A;  3R3L A;  1N6Q A;  1TVR A;  2ZJQ L;  3CCQ N;  3JXU A;  4JKG A;  3J7Z O;  4JI7 K;  4W5T A;  3AVH A;  3LWM A;  4CFB A;  2JLE A;  3PY8 A;  3AO1 A;  3LAK A;  3FZH A;  2VWJ A;  3EKS A;  1LW0 A;  4BAC A;  1HNZ K;  1NGD A;  4GKK K;  1BDG A;  5AQY A;  4H0O A;  4QS7 A;  1NOZ A;  3AV9 A;  3ZSW A;  1ITG A;  5M1F A;  1HNV A;  3AVA A;  4CGH A;  4YOY A;  3CFP A;  3ZLJ A;  1HX1 A;  2KZZ A;  3MEE A;  3B6P A;  4KBO A;  3OYG A;  4FLY A;  4CEB A;  1YF5 L;  5LMU K;  1VRT A;  3NF8 A;  4DR1 K;  4KTQ A;  4KTZ A;  2D0C A;  4K41 A;  2CGK A;  3F9M A;  1C0G A;  5BPN A;  3UIQ A;  4FO0 A;  2BE2 A;  4JRQ A;  3HO1 A;  4LFC K;  2P9L A;  5FDL A;  5M1Q A;  3HP6 A;  2FBX A;  3O5B A;  2I7N A;  2O8D B;  3DWL A;  3CJA A;  2ZJR L;  4B9L A;  3U9D A;  5HLF A;  1HPM A;  5M1N A;  3VQE A;  1CZA N;  1C0F A;  2WTU A;  1VSK A;  3RVC A;  1JLA A;  1U45 A;  2Z1I A;  3AA5 X;  3K5L A;  4X62 K;  4RCH A;  4XH5 A;  4IEE A;  4CGG A;  5JS2 A;  4BRC A;  4DR2 K;  3IAY A;  4KB0 A;  2KHO A;  3V1Q A;  1XC9 A;  3HYF A;  4FWS A;  3E01 A;  4CIE A;  3P83 D;  3K9K A;  4RW6 A;  2GEM A;  4OLA A;  3I8B A;  2B5J A;  4IFY A;  3VEW A;  3AAP A;  1VQP N;  1V4T A;  2O8B A;  1A5W A;  2V7Y A;  2FC0 A;  2E1Z A;  3D2E A;  1X3N A;  4HTU A;  3L3V A;  2GUI A;  3V1R A;  1DKG D;  4N41 A;  4JI6 K;  1S22 A;  2UYT A;  3AVL A;  2VWB A;  3RMD A;  4B1W B;  3WNH A;  1K6Y A;  1LAW A;  3THW B;  3HPO A;  2O4G A;  3MX5 A;  1WLJ A;  2KFZ A;  2H3G X;  1VHX A;  3CJ1 A;  4WYB A;  3QEP A;  1LCU A;  1Z25 A;  3PLA A;  1KVB A;  3CME N;  3LDP A;  4DS4 A;  2HHV A;  4CJQ A;  4M3Z A;  2HHU A;  2WON A;  1KXP A;  3WNF A;  1ATR A;  4QOZ B;  4K43 A;  4I2P A;  3QO9 A;  1BGX T;  4RTF D;  4B1X B;  2VGN A;  3TU5 A;  1RCH A;  1ATN A;  3JAM O;  1NKE A;  4L8R B;  1VQ4 N;  2AP1 A;  4M3U A;  3I0R A;  4FPB A;  4JI4 K;  3LZI A;  4DTR A;  3O3F A;  3EN9 A;  4BRE A;  3LL3 A;  5MLC Q;  4BR5 A;  5C2F A;  5KPT A;  3C6H A;  3OYC A;  2O8F A;  4I2Q A;  1L5U A;  4G9Z A;  4FZZ A;  4M42 A;  2GEL A;  3CC4 N;  4DMN A;  4DR3 K;  2F8S A;  4RW8 A;  4B3S K;  4DV5 K;  1HNX K;  1XWL A;  4Q5V A;  1JL2 A;  1JXE A;  1D4X A;  4F2S A;  1TKD A;  3SJH A;  2A42 A;  3VOV A;  1IG9 A;  2D0A A;  4H0T B;  5AQJ A;  5AQT A;  4HCC A;  3S41 A;  5E84 A;  1K8K A;  3CCU N;  4OLB A;  3AA3 A;  2Q36 A;  3CM5 A;  3ZSO A;  1UOC A;  3ZEU B;  3QNN A;  1WSH A;  2DFE A;  2QWL A;  5GIO A;  2HST A;  3I8D A;  1JCF A;  3O80 A;  4CHY A;  2G8V A;  2E2Q A;  1OH7 A;  4ICL A;  4ISG A;  4LF7 K;  4JKE A;  4BDY A;  3UKR B;  3U3G A;  3KLG A;  4JS4 A;  3CCJ N;  4LSL A;  2ETJ A;  3U6F A;  1P90 A;  1QVG M;  3OBY A;  3IKM A;  1KLM A;  2Q0U A;  1W9H A;  3M8Q A;  3OJU A;  3CPW M;  1YVU A;  3C6A A;  3O4W A;  1QE1 A;  3SZ2 A;  4DG1 A;  2F7T A;  3UB5 A;  4FLT A;  4B9V A;  1BCM A;  4LH4 A;  1SQK A;  3FE1 A;  1WSI A;  5AQF A;  4BDP A;  3LP3 A;  4GKJ K;  2E5L K;  2YHA A;  4E7I A;  3NDK A;  1IKX A;  2RE2 A;  4WF9 L;  4BVO A;  4JKG B;  5GIN A;  4A57 A;  3SNN A;  1VQM N;  2P9U A;  4B8C A;  1VSH A;  1LOT B;  4DV4 K;  1RT5 A;  3PO5 A;  5IT9 O;  1QQM A;  4FK0 A;  3KD5 E;  1RT6 A;  4DLG A;  1WBD A;  3H46 O;  2HVH A;  1NOY A;  4BGA A;  1S1X A;  5BR8 K;  4DQR A;  3O4Q A;  4YDU C;  4DTU A;  5B8H A;  4FK2 A;  4ILJ A;  2OTJ N;  1N33 K;  4FJM A;  3GE1 A;  3LM2 A;  4JKH A;  1ASW A;  4CJ5 A;  3T69 A;  2ZWH A;  4PWD A;  4JI8 K;  3NFA A;  2E4L A;  2HHQ A;  5HL7 L;  3LPU A;  4PHT X;  3LDN A;  5HOO A;  4AHT A;  3ID6 A;  4CK2 A;  5IWA K;  3A5L C;  4KPY A;  3J80 O;  3G25 A;  1NK8 A;  5I42 A;  1NKB A;  4NYF A;  4HTL A;  3DLL L;  2PYL A;  3OVN A;  1NGF A;  1GLF O;  3AGR A;  3CCL N;  5AQL A;  1C0M A;  3EYZ A;  1YJ9 N;  2W6L A;  4QS9 A;  4FJ7 A;  1RT4 A;  3KZB A;  4RW7 A;  1R0A A;  1Q18 A;  5CZ1 A;  4J2B A;  1U48 A;  2P9P B;  3CCM N;  4CJW A;  3A5N C;  3SQ1 A;  1J54 A;  1RBS A;  4CE9 A;  3DYA A;  5EXW A;  4CHZ A;  5JVG L;  4H5R A;  1Q7Y O;  3HSC A;  5AQK A;  3SLC A;  1J9A A;  1ZBL A;  4IBN A;  3AVN A;  1QHA A;  4O5B A;  2O8B B;  2V52 B;  1I39 A;  3R6M A;  5CZ2 A;  3WNG A;  1QSL A;  1DGK N;  1I3A A;  3LAL A;  3OTO K;  3R8E A;  5GAE P;  3K59 A;  3CCR N;  1XI1 A;  2FXU A;  3MX2 A;  1REV A;  1TK8 A;  1O13 A;  4N76 A;  3WQT A;  4R5P A;  4O0J A;  4DF4 A;  4LC9 B;  4IDK A;  3GG4 A;  1EET A;  4BWJ A;  2FSN A;  1HQE A;  1EQY A;  2O8C B;  3KTQ A;  1RT1 A;  4I6M A;  3QBW A;  3T7Z A;  4BRH A;  1EXQ A;  1JLB A;  1SL1 A;  1BA0 A;  4B3T K;  1T6C A;  2ITG A;  2Y1I A;  2W41 A;  4WQ4 C;  2VQE K;  4ZHR A;  4PL7 A;  3NE6 A;  1X1P A;  3THX B;  2YNH A;  4BC3 A;  2Y1J A;  3OYF A;  3CQ8 A;  3W3D A;  4A5A A;  5M1K A;  1HKB A;  2YKM A;  1L3S A;  2E2N A;  2O8D A;  2YJE A;  3E9L A;  4B1U B;  2HF4 A;  2WFB A;  2VCP A;  3GBT A;  5FRM A;  4FWP A;  1E3M A;  3VTI A;  2O8F B;  4E3S A;  1HKC A;  4KH5 A;  4YOU A;  3AVI A;  3E66 A;  3SAH A;  4CK1 A;  5AQG A;  3TSP A;  4E89 A;  1VQN N;  4BRO A;  3P38 A;  2HF3 A;  5I3U A;  3MK6 A;  4DTO A;  2VG5 A;  5C25 A;  4KRE A;  3MXM A;  4O44 A;  3TAG A;  4B9M A;  2YX6 A;  4DV0 K;  3FGU A;  3TAM A;  2IS3 A;  4AM6 A;  3V4I A;  3L2U A;  3CMA N;  4E7J A;  4C8L A;  4M7Y A;  1X3M A;  1K8K B;  3KVG A;  3D0P A;  3CC7 N;  5J2N A;  4CCH A;  2BGG A;  3ZX0 A;  3KK1 A;  5FPM A;  3KLF A;  4OKE A;  4DV1 K;  1T7P A;  3OHR A;  3THW A;  1Q82 O;  3S9H A;  2QXF A;  3EE8 A;  4MLH A;  4H0V B;  4F2R A;  2ZF5 O;  2BUP A;  1VQO N;  3SAG A;  3JYT A;  4CIG A;  5AQS A;  1Q81 O;  2ASP A;  4Y0W A;  1EP4 A;  3ZSV A;  1NBW A;  1ILY A;  3CI5 A;  5FRO A;  1Q86 O;  4MDB A;  3I0S A;  4OGC A;  5A2Q O;  2FF3 B;  1FW6 A;  4KKO A;  4CBW A;  1SKS A;  4CJ4 A;  5BPM A;  5CE3 A;  4AHV A;  4ELT A;  1C0T A;  2HOE A;  1LAV A;  4FJJ A;  3OY9 A;  4QS8 A;  1FKP A;  4H8K A;  1TGO A;  4GY2 B;  4EAH D;  3SV4 A;  4DV2 K;  1BUP A;  4FJI A;  4RW9 A;  1NJY A;  4DSI A;  1WOQ A;  1SL2 A;  1JLQ A;  1D5A A;  1NGH A;  4CEE A;  4C1N K;  4DV7 K;  2UUB K;  4A61 A;  4FOI A;  5EOY A;  3PSI A;  3M3Z A;  2ZGZ A;  4CBX A;  4BRA A;  5FPN A;  3K57 A;  3L0Q A;  4CJU A;  5JIC A;  3ZSY A;  3ZX2 A;  3EL2 A;  2XY7 A;  4PKG A;  1CXU A;  1UA1 A;  4DTM A;  3OYB A;  4BVP A;  1OVY A;  2GTD A;  4FWR A;  3M8P A;  2G8U A;  3ZEU A;  2A5X A;  1NU0 A;  2E20 A;  4JN4 A;  5EVZ A;  2CH6 A;  4OVL A;  1NK9 A;  3OYJ A;  4DS5 A;  2NZT A;  1BIU A;  1F21 A;  2V7Z A;  4ILH A;  4FXD A;  3ATV A;  3OA9 A;  3AO2 A;  4EHT A;  4EP4 A;  4IOX A;  4IEI A;  3UKR A;  4OGE A;  1TUU A;  3ID8 A;  4FWN A;  3PSF A;  3L2V A;  3SUP A;  4ISE A;  3RRH A;  3K2P A;  4X64 K;  4C1N I;  4M7X A;  4KHN A;  1NMD A;  4XIU A;  3OBW A;  1BG3 A;  1NJX A;  4DFK A;  5C24 A;  1NK4 A;  2IGI A;  4KH6 A;  2D0O A;  3VQ8 A;  3DLH A;  3ENB A;  3V9S A;  3AO3 A;  1W0H A;  5KQ8 A;  2OYQ A;  4YOR A;  3WEE B;  4NB4 A;  2UUA K;  1HRH A;  3LAM A;  2QK9 A;  3AAR A;  1YTA A;  1B9D A;  3JS6 A;  2W6K A;  4O8K A;  3VA3 A;  4KHU A;  1OH8 A;  4M3T A;  5M1O A;  3M5R A;  1KFD A;  4CF9 A;  4WCE L;  3CC2 N;  1ZXO A;  3KK7 A;  3PV8 A;  1MWM A;  2P9K A;  3SQ4 A;  1TKZ A;  3QET A;  3SPZ A;  2PFU A;  3O08 A;  3D6R A;  3WXM B;  4FLV A;  4BRK A;  1ZBS A;  2P9I B;  5HRR A;  4W5O A;  2I5J A;  1Z05 A;  1FJG K;  3VEY A;  2HNY A;  3HTV A;  1WSF A;  4CF1 A;  3C95 A;  1G99 A;  2JWK A;  3G6E N;  4FYD A;  5AQQ A;  2X78 A;  4JAX A;  3KKS A;  5C42 A;  5D3G A;  2UXC K;  4BE2 A;  4I6M B;  1VSL A;  2HNZ A;  1J5E K;  3AVB A;  1BU6 O;  1RDB A;  1HNW K;  4O55 A;  3VES A;  3DM2 A;  4A2A A;  3T1A A;  4FJ9 A;  2E8A A;  3PIP L;  4K0K K;  4CJR A;  3VEX A;  5FPD A;  4XH4 A;  2KTQ A;  5AQN A;  1XNQ K;  4HUE A;  3LAN A;  4FJ8 A;  2D0B A;  1S5J A;  4E1N A;  1OVQ A;  4CJ3 A;  3O1B A;  3LWL A;  1BA1 A;  3ZSR A;  2FSK A;  5AJ3 K;  4E0D A;  4H0P A;  4IG0 A;  4E7K A;  1C1A A;  1RBR A;  2P9P A;  4I9Q A;  1DTT A;  2Q97 A;  3OYM A;  4ID5 A;  4CFC A;  1ZBU A;  3D2F B;  4LFB K;  4DTX A;  3DRR A;  3MCP A;  1S9G A;  3I33 A;  4NLB A;  4E1J A;  4K8X A;  3VQA A;  4R79 A;  4JRP A;  1KQS M;  1S1W A;  4BG9 A;  1KTQ A;  2YNI A;  3NVM A;  4LF5 K;  4B1Z A;  1KC8 O;  3KKR A;  2FBV A;  3KD1 E;  1VSF A;  5LY3 A;  2A1S A;  1K9M O;  3A5O C;  3I56 N;  4DQS A;  4CW7 B;  1XNR K;  3UE5 A;  3VF4 A;  1TYQ A;  2NLX A;  1T44 A;  3AVJ A;  1GLE G;  4I9L A;  3WXJ A;  4CFA A;  3AVC A;  3SUQ A;  3VEO A;  3O9Q A;  4Y1D A;  4BG8 A;  3MCA B;  4NYN A;  2XO7 A;  3TAN A;  5F1X A;  5CY4 A;  5E41 A;  2O8C A;  2DY4 A;  3N4P A;  2R7Y A;  3EKU A;  3C0B A;  3DAW A;  3TTF A;  3T3F A;  1BI4 A;  5DMR A;  5C10 A;  1YJW N;  3QEI A;  3RMB A;  4BR4 A;  3TAF A;  1QTM A;  3AVK A;  4H5T A;  3NF6 A;  1X9S A;  4UY8 O;  2PY5 A;  3THX A;  1LW2 A;  2G8W A;  3THY A;  5AZI B;  4CEO A;  2HBK A;  5E26 A;  3LP0 A;  5HP1 A;  2CH5 A;  1NLV A;  1GLB G;  2ZQB A;  4U7B A;  4DQQ A;  2ITM A;  2E1Y A;  2O4I A;  1KVC A;  4BC2 A;  2VWK A;  4JKC A;  4A62 A;  1SKR A;  4DV3 K;  2ZM6 K;  3FZK A;  4H03 B;  4CF8 A;  4B9S A;  4A2B A;  3BUZ B;  1FK9 A;  3O6W A;  5KTQ A;  3A2F A;  1YVN A;  4JEP A;  2YNF A;  3CJC A;  1SAZ A;  4PA1 A;  4IOC L;  5KPR A;  1T3V A;  1KSP A;  4PUO A;  4FM0 A;  4JS5 A;  2NUB A;  3MN9 A;  1HQU A;  1YT3 A;  1Q8I A;  3VQ5 A;  3VQ4 A;  5CR4 A;  1OH6 A;  3AO4 A;  5KQD A;  3WT0 A;  1FXX A;  3TPQ A; 
#chains in the Genus database with same CATH homology
 3J7A P;  4JI6 K;  5LL6 Z;  4NXM K;  5FLX O;  1N34 K;  4B3R K;  4JI1 K;  2UUC K;  4LFB K;  4DR6 K;  4DV1 K;  2UXD K;  4DR7 K;  4DV6 K;  4JI7 K;  4X64 K;  4NXN K;  4X66 K;  1IBL K;  1HNZ K;  1IBM K;  4LF5 K;  4GKK K;  4X65 K;  4AQY K;  4B3M K;  1XMO K;  3OTO K;  4YY3 K;  2UUA K;  4GKJ K;  1I94 K;  2E5L K;  2VQF K;  4JYA K;  4CW7 B;  1XNR K;  3JAM O;  4DV4 K;  5A2Q O;  5IT9 O;  1XMQ K;  4JI4 K;  3J7Y P;  5LMU K;  4LF4 K;  2UXB K;  4DR1 K;  5BR8 K;  1N36 K;  1N33 K;  4B3T K;  4DV2 K;  4OX9 K;  4V19 S;  2HHH K;  4CVN E;  4JI3 K;  4LF6 K;  3J81 O;  2VQE K;  1FJG K;  4LFC K;  4DR3 K;  4DR5 K;  4JI8 K;  4B3S K;  4DV5 K;  4DV7 K;  1HNX K;  4DUZ K;  2UUB K;  1N32 K;  2UXC K;  2F4V K;  4JV5 K;  1J5E K;  1IBK K;  4JI0 K;  5IWA K;  1HNW K;  4JI2 K;  4X62 K;  5LMN K;  4DV3 K;  2ZM6 K;  4DR2 K;  3J80 O;  1HR0 K;  4YHH K;  4K0K K;  4DR4 K;  4LFA K;  1XNQ K;  2UU9 K;  3T1H K;  3T1Y K;  4JI5 K;  4LF8 K;  4LF7 K;  4DV0 K;  4LF9 K;  4KHP K;  5AJ3 K;  4DUY K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...