2YNFA

Hiv-1 reverse transcriptase y188l mutant in complex with inhibitor gsk560
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
560
structure length
557
Chain Sequence
b'NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
total genus 158
structure length 557
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ynfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ynfA05
3MR6A 2PYJA 4KV8B 1L5UA 2EC0A 1S9GB 2UUTA 3AVFA 4RNMA 1IG9A 1TK5A 5DQGA 4NLDA 4DL2A 4NLPA 5JUMA 3KD5E 1F21A 1JLGA 3AVNA 1NKBA 1TKZB 4CJPA 5KFZA 3H5UA 4RNHA 3AV9A 4HTUA 3NGIA 2X6NA 2FVPA 4K4SA 1VRTA 3L2UA 4ZVGA 4KHMA 1L3SA 4CCHA 4I2PB 4FJXA 3HPGA 4ICLA 1UA0A 1FK9A 5HROA 2HNDA 1RBTA 4OLBA 1ZYQA 3QESA 5J2NA 3O4QA 4XPEA 2E9ZA 1IO2A 2R8KA 1S0OA 3NH2A 1U49A 4B9UA 1FKOA 3KK1A 4QPXA 1SV5B 3ZT1A 2D3UA 3DOKA 4TSXA 5DG8A 4WE1B 4TQSA 3Q8RB 5I3UA 4OKKA 1IKXB 2RF2B 4OVLA 1RDDA 1QSLA 2PY5A 1ZTWA 3GV5B 1LWEB 3VQ9A 4CEAA 4IG3A 5KFJA 4IRKA 1RBUA 3ZSVA 3VQ6A 3MEEA 3DRSA 1K1SA 4R8UB 4DQPA 3OYNA 5L1LA 3ZSWA 4ECVA 1HQEA 4IOBA 4KKOB 4ZPCA 5KFYA 4ZHRB 3B6PA 1DLOB 3O3FA 3IAYA 1Y97A 4IDKB 3C6TB 2OPRB 2ATQA 3NMAA 3PO4A 3AVIA 1C1BB 2YKMA 4DLGA 3KK2A 3DI6B 4TYAA 4ID5B 3OSPA 3LDSA 4Y2CA 1YTUA 4DSIA 3CDUA 3SYZA 4C8NA 3NGDA 1TGOA 4PUOB 2IAJB 2IBKA 2HHUA 1TK8A 4H4MB 3AO3A 4E7LA 2RN2A 3V1RA 4B3OB 4MIBA 4J9KA 1NNDA 1S1XA 3WNFA 3VA3A 1KTQA 1XHXA 2UVWA 1JLBA 1TAQA 1BCOA 1JLAA 1SH2A 4FS1A 4O4GA 1X9WA 2IJNA 3U6FA 1QTMA 3HVTB 3NF8A 4B9VA 1NJYA 5J2PA 2ZE2B 1HYSA 4NCBA 5KG2A 4NCGA 2UUWA 2Q3SA 4CJSA 4IKAA 3VQ4A 4KB7A 1C0UA 1BQNB 1JL2A 4DF8A 4IFVB 4CF0A 2XWYA 3OYJA 4G1QB 3SV3A 3N6MA 2C2EA 4K4XA 1HYZA 3RR7A 1WLJA 2R8HA 4RG8A 2XRIA 4CGIA 2KZZA 4CF1A 4DL3A 1C1CA 4M3ZA 3HO1A 5FRMA 3AO4A 5HLFA 1TP7A 2B43A 3L2QA 3ITHB 1ASVA 3DYAB 4Q0BB 1NHUA 4KV8A 2YHBA 3K58A 1S1VA 4O3PA 1C1AA 3M9OB 2O5DA 3KJVB 1TKTA 3KLIB 1WSHA 3PW0A 2HW3A 1N5YB 2XI2A 4NLOA 3MEGB 4O4RA 3M8SA 4DFKA 4KE5A 3QO9A 3CJ2A 4FJ5A 2HNZB 4FJHA 4DWIA 2HHXA 3AO5A 1TVRA 2E9RX 3SUOA 1VSHA 3L3VA 3H2LA 3SI6A 3FFIB 1R0AA 2E4LA 4CE9A 3ICLA 1T05B 1LAVA 1RILA 3NCIA 1HPZB 4I2PA 4FJIA 1A5XA 3KLGB 4WYWA 4ECXA 2R2SA 4CJUA 5HRSA 1QQCA 1U47A 1FXXA 2GIRA 2R2UA 4ZVEA 1HNIA 2OZSA 1RTDA 1TV6B 3OS1A 2OA8A 4FJ7A 4N76A 4FBTA 4NLTA 1RTHA 2W9BA 3HHKA 4F4YA 5I42A 4CGDA 4OPKA 3PV8A 4DL5A 2OH2A 4RNFA 4MFBB 3BSOA 3TABA 1JLEA 3OYFA 4CEOA 3D5MA 1HRHA 3DOLA 2RF2A 2R7YA 3HJFA 2ILZA 1RBSA 4PWDB 2I1RA 1RNHA 1JKHA 2DFEA 3JYTA 3M8QA 4PQUA 5K14B 1KLMB 4Q8EA 4J9NA 4NLUA 3L2WA 4J9PA 3C95A 4DQRA 4IH5A 1LW0B 4CECA 3TAGA 3DLKA 3M9MB 3QGGA 3LP3A 4ED3A 4EYHB 4WXWA 3LP1B 4M41A 1VRUB 3DRRB 3NKYA 5KFFA 4MK8A 1I39A 2JLEA 1EXQA 3SPZA 3TI0A 2JGUA 2B5JA 2HNYA 5F8HA 3RRGA 3T3FA 4KHNA 5L1KA 3HK2A 4N47A 4LSLA 3M8PA 4CK3A 4HKQA 1LWCB 1JL1A 4FW1A 5FDLA 2D0CA 1C0TB 1VSDA 3M8RA 2OPPA 4RUCA 4DSFA 3HT3A 1QE1B 3OJSA 3THVA 5D3GB 4UQGA 4F4XA 4DTPA 3KMQA 4JRQA 3QIPA 1Q9YA 2V4QA 2HHSA 1KVAA 4Z4IA 3ZT4A 1T8EA 4AILC 4WFXA 1RT1A 3QYYA 3Q8QB 2VWKA 3E51A 4IG0A 4FM2A 1VSJA 2ASJA 1MU2B 3SV4A 4K8ZA 3QEXA 1GOCA 4TYBA 4I9LA 1SH3A 1WNEA 4N41A 3OL7A 2GC8A 2KFNA 1T94A 5KFMA 4O3NA 3KIOA 2HVIA 1XWLA 2HHQA 4IH6A 1N48A 4DF4A 1U45A 4Q0BA 3TAMB 3D45A 1SL1A 4FXDA 1JLQA 3Q8SB 4M95A 3SQ0A 1JLGB 3PW5A 2D0AA 4C8KA 5KRSA 4WFYA 1HMVA 3KLVA 1CXUA 3IS9A 5HP1B 3EZUA 5KGXA 1QUVA 2QKBA 3E01B 4WFZA 4OLAA 3NFAA 3MEGA 3BQ2A 4R0EA 2P5GA 3AVLA 1RT2B 1T03A 3BSNA 3HYFA 4PA1A 1FK9B 3AVCA 3ASMA 5HROB 4TQRA 3DMJA 2HNDB 5KT6A 4U6PA 4Z4EA 4RW6A 1RTIA 3MF5A 1BHLA 5J2NB 3KMSA 3LANA 1J53A 1HPZA 2AGPA 1BIUA 3VQ7A 4E89A 5J2MB 1FKOB 2YNFB 3KK1B 3L3UA 4ED2A 2IM3A 3O3HA 1Q9XA 3DOKB 4HHTA 1GOAA 3H40A 5I3UB 3A2FA 3V6HA 3QINA 2P51A 4O55A 5KI6A 1IKYA 4O44A 5KFGA 2E9TA 4AH9A 5KFTA 4B8AB 3LP2A 4IG3B 2G8VA 2ATLA 3H5YA 1UWBA 4IRDA 3MEEB 3DRSB 3NH1A 4FJMA 5DGAA 3TVKA 3QEPA 2IM1A 1T3NA 1ZBIA 1HQEB 1KCFA 4BE0A 4ECTA 3VQ8A 4NLWA 3AA3A 1RYSA 3AA4A 1LW0A 5KT5A 2XHBA 3GIJA 4YMEA 2YKMB 4CGHA 4J9RA 3KK2B 3NL0A 2F8TA 4K4VA 1LAWA 1RT4A 3H59A 2V9WA 3FQLA 1DTQA 4DTRA 3RMDA 2J6SA 4QW9A 1ASWA 4M3RA 2F8EX 1S1XB 3OL9A 3QGIA 3MR3A 1RT5A 3P1GA 1VSKA 1JLBB 4AHSA 2D0BA 3HP6A 1JLAB 4DFMA 3PUFA 4O4GB 4YNQA 4AHUA 4Z4CA 4AHVA 3OYKA 2YKNA 3RMBA 5J2PB 4DTJA 1HYSB 3QEVA 4Y1DA 3VQBA 2OPQB 4KHRA 5KFSA 4ZVHA 3BREA 2UVUA 3S3MA 1C0UB 4K4TA 2V0NA 2FLNA 1D1UA 1NKEA 3MXIA 3SCXA 3UIQA 3AO2A 5KFDA 4DEZA 2GIQA 1XHZA 3SQ1A 4IKFA 1MU2A 2A1RA 1C1CB 3TAPA 3QNOA 2EX3A 4FCYA 3S3NA 3MEDA 5HLFB 1QAIA 1NK9A 3LP0A 2WB4A 1EETA 1S1VB 5DK5A 1J9AA 1S97A 3BQ1A 4RW9B 5F8LA 1TKTB 1RAJA 5KFWA 2UVRA 3TAMA 4KB0A 3PR5B 4CHYA 3G6VA 4H54A 4LSNA 4DTXA 3QO9B 1BQMB 1XR5A 1L3VA 3GV7B 5HP1A 3VQ5A 3QZ7A 1TVRB 4Z4HA 4JS4A 3E01A 3CDWA 3V9ZA 2JC1A 4CEQA 2BRKA 1R0AB 3RAXA 2ILYA 5SWMA 3HPOA 1RT2A 1K1QA 4JV2A 4E7KA 2HHVA 4HUFA 1S6PA 1KVBA 1HNIB 4FYDA 1RTDB 2YNIA 1HQUA 4CEDA 3PY8A 1RTHB 2W9BB 5J2MA 2YNFA 5I42B 2FBTA 4CF2A 4M45A 3IN5A 1JLEB 3T19A 4J9LA 3N6NA 1S1TB 1XR6A 1RT3A 3LAMA 3EPIA 3DOLB 2FBVA 4F50A 3ALYA 5DMRA 2YV0X 4E1NA 4EBDA 3CVKA 4DFPA 2IA6A 4IQXA 1JKHB 4DQIA 3DRPA 3JYTB 1S10A 3M8QB 4PQUB 2C28A 5KFUA 1XI1A 3QLHA 2A1SA 4CJRA 5CYQA 3T5LA 4ID1A 5KFIA 2ZD1A 3K57A 4FBUA 3ZSQA 3OYAA 5F8IA 3DLKB 3HM9A 3M9NB 4I2QB 5F9LA 3PX6A 3HP9A 2YNGA 3TARA 3C6UA 1QAJA 1KFSA 4LQ9A 4IFYB 4URSA 4FZZA 1TL3B 2B5JB 2HNYB 4FM0A 2ASLA 2JEJA 3PW7A 4LSLB 3M8PB 1ZBFA 4H4OA 4IR9A 4ZVFA 5C25A 5FROA 5FDLB 2OPPB 3IGNA 4ECRA 4YR0A 3MXMA 3AVAA 4B08A 5EWEA 1IKVA 2GBZA 2BR0A 4X2BA 1TL1A 4QCLA 4ZPBA 3CJ4A 3CG7A 4DTSA 3QIPB 3V9SA 4DSKA 3ZSXA 4GC7A 1NJWA 1SUQA 2JEGA 3QERA 3HKWA 3OSNA 3CM6A 1RT1B 3CJ5A 2QXFA 2VG6A 1S6QA 4JV1A 2OPQA 1S4FA 4IG0B 3KNAA 1A5VA 3NF6A 3TWHA 3PW2A 4KB1A 2G8UA 3NF7A 4E7HA 4ZP7A 3PJXA 2XY8A 4J2BA 3KLFA 3KHGA 3BQ0A 3V9XA 5C42A 1VK0A 3DLGA 4B9LA 1JX4A 4CIEA 4YP3A 3IG1A 3LZIA 4I7FA 2WK4A 3VQEA 4FJ9A 1JLQB 3L8BA 5DQIA 4DSEA 4KHYA 5L1IA 3EY1A 5DG9A 2E6MA 1SKRA 4FZXC 4RW9A 4DTUA 1HMVB 3MR2A 1NK7A 3IS9B 4O3SA 2Z1HA 2ETJA 1WSGA 2UVVA 4ED0A 1O1WA 3NHGA 1ASUA 1A5WA 2VA2A 1SKWA 1Q8IA 4ZPAA 5KTQA 1VSEA 1BQMA 2VG5A 3H5XA 1T03B 2AU0A 3VQCA 3V1OA 5KFOA 1B92A 2W7OA 2FJWA 3DMJB 1JLFA 1W0HA 4RW6B 1RTIB 1D9FA 2Y1JA 5F8MA 4CJQA 3AVBA 2DTUA 4RZRA 4OKJA 2D41A 3EZ5A 4DU4A 3PHEA 3V6DA 2Z1IA 2OPSA 4OGEA 4TY9A 3KLHA 3SQ4A 1S1WA 2HWIA 1J5OA 4HUEA 3GILA 3ZT2A 2W9CB 3DM2A 3UDLA 2R2RA 2GUIA 2LSNA 4BWMA 5KRTA 5KT3A 2RDJA 1IKYB 3HSTB 5EDWA 4O44B 1GOBA 3PO5A 4NRUA 1S1TA 1YVFA 5KFXA 1NJZA 5KG7A 3LP2B 2YNHA 4PY5A 3B6OA 4RW7A 5KFKA 2VG7A 1UWBB 3D28A 4CEBA 2AX0A 4I9QA 2ITGA 4Q8FA 1HJRA 4ECYA 4YFUA 4FK4A 5CYMB 2AQ4A 3VQDA 3OYCA 1RBVA 3F73A 5J2QA 4EYIB 3AVGA 5DLGA 2XGQA 3H4BA 3VQQA 4CEEA 3LWLA 3T1AA 1TKXA 2C22A 1L3TA 4TLRA 4LH5A 2X6SA 5KG4A 1RT4B 4I2QA 1U4BA 2ASDA 3AA2A 3SUQA 1K6YA 5EWFA 1S49A 2J6TA 1DTQB 4FLTA 1D0EA 4F4KA 4NYZA 2R8GA 3NBPB 4IFYA 4FJNA 1ITGA 1TL3A 4Z0UA 1RT5B 4W5QA 2R8JA 4J2DA 4ZP9A 1QSYA 4EBEA 4ZPDA 4FLZA 4KFBA 2ZKUA 4URQU 4DFJA 1MMLA 1QHTA 2FVSA 1BISA 1ZBHA 2YKNB 4ED6A 3TAQA 1X1PA 4E1MA 5KFEA 4KHQA 3T5KA 2FC0A 4O0IA 2W9AA 4FK0A 4NZ0A 4BDZA 3LAKA 2R2TA 1EP4A 3VQSA 3KLEA 4Y3CA 4KO0A 2BANB 2KFZA 5KT4A 3N6LA 1U04A 2KTQA 4JS5A 4WZMA 3ZT0A 2IC3A 3U3YA 3KHRA 1YVUA 1Z4UA 3MEDB 1NOYA 3CYMA 5C24A 3FRZA 4QWEA 1N56A 1J54A 3LP0B 5F8GA 3NF9A 1EETB 2BQ3A 3G6YA 1B9FA 4F4ZA 4MQ3A 3SJJA 1IKWA 3UPFA 3OYLA 4CERA 3OHAA 2HHWA 4GW6A 3CJ0A 5KFHA 4LSNB 3K2PA 4LD0A 4N5SA 2J6UA 1JXLA 1JLCB 4RU9A 3CM5A 3RBDA 1UOCA 3T5JA 1WSIA 2X78A 1CZBA 2AGQA 2V4RA 3MECB 2WCXA 3NGZA 4CGGA 2XGPA 4EO6A 4O0JA 3DLHA 3SFGA 1IM4A 2PYLA 2KW4A 3HVAA 4CJEA 3KKSA 4DS5A 1S6PB 4B9TA 3GIMA 4ZMMA 4K50A 4QOZB 1W9HA 2VA3A 2IS3A 4FW2A 3SZ2A 2YNIB 2R8IA 3OYHA 2HHTA 1HQUB 1B9DA 2AX1A 1REVA 4F2RA 4CJLA 1RA7A 1WNSA 3QIOA 2BRLA 4LQ3A 1KLNA 4WXOA 4CHNA 2DPIA 4Z4FA 2RKIA 5KFPA 4KHUA 3SQ2A 2W9CA 1RT3B 1S1UA 4W5RA 3OY9A 3NAEA 4KTWA 4RW8A 4R5PA 1TK0A 4NLYA 2DFHA 2IM0A 5E41A 4CFDA 2B6AA 4CJ3A 1HNVA 2IDOA 3DRPB 3V1QA 4ZP8A 4CJFA 3AVJA 4FK2A 1RTJB 1TQLA 3QLHB 3L2VA 3DLEA 5CYQB 3U3GA 1GX5A 1BI4A 3AVMA 2ZD1B 1C2PA 4Z4GA 1D8YA 5CYMA 3UQSA 4F3OA 1WSJA 3G0ZA 5F9NA 3PW4A 3PX4A 4M3XA 4DU3A 1YTAA 2CJQA 5SZTA 2HMIA 2AGOA 2YNGB 1CXQA 1NK4A 3GV8B 4K8XA 3C6UB 4DL6A 5KG1A 3AA5X 1BCMA 2C2DA 1KRPA 3CFPA 4WZQA 4M3YA 2IOCA 3S9HA 1C0MA 3NGYA 3V6JA 4IR1A 4H4OB 3H08A 4H8KA 4CJ5A 3BDPA 4KI6A 5C25B 5KGWA 2FVRA 3NBPA 4M94A 3I0SB 5J1EB 4FLUA 4JUZA 1WSEA 4URGA 1JXEA 5KFAA 1RT6B 1IKVB 4FJGA 3RB0A 4HCBA 1TL1B 4M3WA 2W8KA 4N56A 4KTZA 1SUQB 3GIKA 4W5NA 4BDYA 3RB3A 3O3GA 3OJUA 1T7PA 3CO9A 4BWJA 2VG6B 3WNEA 1S6QB 3S3OA 3JSMA 1LW2A 2QKKA 1W25A 3ZSYA 5KG0A 2BANA 1Z26A 4Y1CA 3KLFB 1RDCA 3KTQA 5C42B 4DG1A 3EYZA 3DLGB 2BE2A 4FJ8A 4B9SA 2I5JA 4F8RA 4FM1A 4ECUA 3O4NA 4HYKA 1HYVA 1KHVA 4OJRA 3CQ8A 3IG1B 3FDSA 4I7FB 4DQSA 2QV6A 4EBCA 1VSLA 2X74A 4K4UA 4CHZA 4YR2A 3OVNA 2W42A 1LV5A 4HVJA 4OPJA 1Z25A 2P1JA 5FRNA 4BE2A 1LWFB 2VG5B 2PZSA 1JLCA 2OZMA 3G10A 5HRNA 3LALA 3PZPA 4OL8A 4NLGA 3MXJA 5KT7A 3TQ1A 1JLFB 4CFBA 2F8SA 2IM2A 5KFBA 5HRPA 2WOMB 3MECA 3LZJA 4DS4A 2XCPA 2XO7A 1NK8A 3LPUA 4FLYA 3QIDA 3V9UA 2BQUA 4DLEA 3V6DB 4O3RA 2OPSB 4NLVA 3KLHB 1RT7B 4M3UA 1S1WB 4JV0A 1ZBLA 1FKPA 4BE1A 2G8IA 4CHPA 4F4WA 1J5OB 1G15A 3MFIA 3DM2B 1JXBA 3V9WA 4DTMA 3AVHA 2FBXA 3LPTA 3ISNC 3MAQA 4DMNA 3H98A 2D7SA 3MTKA 1CLQA 4G3IA 2P5OA 3OYIA 1D9DA 2XCAA 2YNHB 1YT3A 2IJFA 4RW7B 2JEIA 2VG7B 3KHLA 1S9FA 5KFQA 2XY6A 5L9XA 3P83D 4DSJA 1D5AA 5HRRA 2D3ZA 2OYQA 5JS2A 5KFNA 5J2QB 1RTJA 3QETA 5EWGA 4AHTA 1N6QA 3RWUA 4ECWA 4KRFA 4FLVA 1TKXB 4MKAA 3IGVA 1RYRA 3H4DA 4CESA 4ECQA 2VWJA 3I5BA 1I3AA 2DY4A 1VSMA 4BDPA 1CSJA 1SH0A 5KG6A 4XO0A 3NH0A 1KHWA 3RAQA 1DTTA 2FJVA 4TY8A 3K5LA 1NJXA 2BDPA 4MKBA 2WHOA 3C94A 4LH4A 1RBRA 4KFBB 2QE5A 3TR8A 3V81A 3I0SA 5J1EA 4CFAA 1S0MA 1RT6A 3F9KA 3RR8A 2WONA 4CHQA 3QEWA 4YQWA 1UA1A 5CY4A 4CGFA 3H5SA 4W5OA 4C8LA 1EP4B 3V4IA 5JS1A 3BSAA 3EPGA 1KFDA 3KLEB 3WNGA 4NLXA 4KO0B 2XY7A 4MK7A 4ZP6A 3PVXA 3KHHA 1KSPA 1XR7A 1QSSA 2IC3B 1NK6A 4F2SA 1EX4A 3VA0A 4E7JA 3HXMA 3OYMA 4CK2A 4J2EA 5C24B 1SKSA 3SNNA 3BGRA 3KD1E 4CEZA 1RDAA 3IRXB 4FJKA 1IKWB 2ZQBA 1S9EA 3NE6A 3KK3A 4FVMA 3SI8A 4J2AA 3VQPA 4CJKA 2CKWA 3KOAA 3OYEA 3BSCA 1RCHA 4HCCA 4NLQA 3OS0A 4NCAA 4QWCA 1N4LA 3RB4A 1WSFA 1NKCA 2G8WA 4RW4B 2C2RA 2JEFA 1JIHA 5C5JA 4XPCA 3FSIA 3WNHA 1LWFA 3SUPA 4TN2A 4ECZA 1S9GA 1WAJA 4OGCA 3D0PA 4RUAA 3HVWA 3HVRA 3TAEA 4O3OA 2WOMA 2YHAA 3OLBA 3PR4A 1ZBUA 4DSLA 1RDRA 4AHRA 1TKZA 1HARA 4CJVA 1TAUA 4QW8A 1REVB 4IH7A 4HUGA 1RT7A 2G8FA 2RKIB 4U7CA 3CWJA 4YR3A 2FBYA 1S1UB 4Q43A 2IGIA 4FJJA 4RW8B 4R5PB 4DL7A 4KI4A 4DTOA 4Q5VA 1VSFA 4GC6A 4ECSA 5KFRA 3ZSZA 2B6AB 3MFHA 1ZETA 4RNOA 4K4WA 1HNVB 4E0DA 2NUBA 4EZ6A 4QWAA 4KHWA 2W7PA 3SFUA 4ELTA 3VQAA 2O4IA 3DLEB 2XC9A 1BI4B 3OYGA 4KAZA 3I0RB 4KAIA 4CEFA 3DLBA 2G8HA 1SV5A 5JXSA 2E6LA 4WE1A 4E7IA 4IBNA 1IKXA 2HMIB 1S5JA 4CJWA 1QS4A 3LWMA 4EP4A 1U48A 1NHVA 1RDBA 5T14A 4C8OA 4DQQA 2G8KA 1LWEA 3OHBA 3I8DA 4MK9A 2XY5A 2FLLA 2D5RA 4R8UA 4FLXA 3NAIA 3DLRA 4KKOA 2BQRA 4NYFA 1SL0A 4ZHRA 1DLOA 5HBMB 3MR5A 4CF9A 4IDKA 4EEYA 2FJXA 1UAXA 4DTNA 3QGHA 3C6TA 2OPRA 3ZSRA 1C1BA 4K4YA 3DI6A 4ID5A 4F3TA 2QK9A 4ED1A 3RBEA 2AJQA 3TAFA 3SPYA 2WRMA 4EO8A 4KPYA 4Y2AA 3QZ8A 3JSMB 1LW2B 3K5NA 5DLFA 4PUOA 2IAJA 3P5JA 2KZMA 4CJTA 4H4MA 4B8CA 3BJYA 1I6JA 4B3OA 4ZTJA 4GMJB 3RB6A 1ZTTA 4RNNA 3KKRA 1SL2A 4DG1B 3OL8A 3RRHA 2BE2B 3ULDA 2I5JB 2Z1JA 4QWBA 4O5BA 3HVTA 1NK0A 3AO1A 4CIFA 2ZE2A 2W8LA 3IRXA 3Q8PB 2HVHA 1IH7A 1BL3A 1BQNA 1U09A 3TANA 4IFVA 3GIIA 4M42A 4TXSA 4G1QA 4NLSA 3G6XA 3PJWA 4KBIA 3CDEA 1S48A 4FS2A 2BGGA 5DQHA 2KQ2A 3QEIA 1VSIA 3ZSOA 4RW4A 2DFFA 2FVCA 4XIUA 3ITHA 4NYNA 3DYAA 3T5HA 3NDKA 4ELVA 3OS2A 5KFLA 1X9MA 3KJVA 4QWDA 2EHGA 3KLIA 2JC0A 5EU7A 1KVCA 3CFOA 1N5YA 3K59A 1WN7A 4B9NA 4J9MA 4Y34A 4CK1A 4L8RB 1FKPB 2HAIA 2XI3A 2HNZA 1VRTB 4EP5A 1NK5A 5EUHA 2O4GA 4ICLB 3ISND 4O3QA 1BIZA 3FFIA 4DU1A 1T05A 2ALZA 1X9SA 5DGBA 4NRTA 3DDKA 3K5MA 3KLGA 2WTFA 1BGXT 4FJLA 3OL6A 1TV6A 5KG5A 2FLPA 1N6QB 4NLRA 5T7BA 3UR0A 5KFVA 4C8MA 4E3SA 3I0RA 2RPIA 4EZ9A 4MFBA 3I5AA 5F8JA 2HB5A 4BACA 4J9OA 3HL8A 5KT2A 5CZ2A 2HWHA 1S0NA 2FVQA 1GX6A 3OYBA 4J9QA 3HPHA 3NAHA 2GV9A 4CF8A 3CJ3A 3K5OA 1DTTB 3I5CA 3GQCA 4WYLA 4PWDA 4TY8B 1OS5A 3OLAA 4CFCA 4E19A 4JLHA 3VN5A 5K14A 1KLMA 1WAFA 3L2RA 3RMAA 4CHOA 4MIAA 3V81B 3RTVA 1C6VA 3ZCMA 3ZT3A 1NOZA 4AHCA 5HBMA 3OYDA 4MH8A 2WONB 4CGJA 3LP1A 3CFRA 4CIGA 1VRUA 4Q44A 3DRRA 2F96A 4FZYA 3V4IB 2B4JA 4Q45A 3FQKA 1EKEA 4QAGA 3SUNA 4GVMA 4ED7A 3AVKA 3GYNA 3G86A 3RMCA 1RA6A 1LWCA 4LY7A 2Y1IA 3CIZA 1C0TA 1XC9A 2Z1GA 3QNNA 4KHSA 1QE1A 3BGRB 4FLWA 5D3GA 2AWZA 4NCGB 4ZTFA 4JRPA 4KTQA 1L3UA 1S9EB 3V6KA 2IMWP 3KK3B 4IRCA 4KREA 1TKDA 4KSEB 4ELUA 1CZ9A 4K4ZA 5F8NA 4B9MA 5KG3A 3PX0A 2DPJA 4W5TA 4M3TA 5CZ1A 5L1JA 5DG7A 4DL4A 5KFCA 3BR9A 2RDIA 4CJ4A 4J9SA 4ED8A 4OKEA
chains in the Genus database with same CATH superfamily
1RAHB 5IM0A 4KV8B 1XUPO 3SCIE 3NEKA 3HHLD 3NXZA 2G1HA 5CXTA 4RNMA 2B7CB 2QFJA 5EVZA 4A48A 1UJ6A 2P9SB 5JUMA 2ASMA 3KD5E 1F21A 3WXLA 3A5LC 2OFGX 2ACMA 4RNHA 2B9XA 3SIPB 3IMQJ 4RTFD 4JYAF 3NGIA 4ZVSB 1KWMA 2PC6A 4K4SA 1VRTA 5F3ZA 5JLHA 5LSRA 1AFIA 4FJXA 3HPGA 4ICLA 4NYOA 1FK9A 2ZVIA 4OLBA 2IIRA 5J2NA 1GH8A 1RHMB 3DRXA 1X3NA 1IO2A 1S0OA 4QPTA 3I82A 2DJWA 3TSQA 4OYOA 4OI1A 1WF1A 3QB0A 4WE1B 2VKRA 3Q8RB 3HF5A 4QIEA 2WFBA 4OVLA 2QM1A 1QSLA 1OYEA 2W41A 3GV5B 5IT4A 4BRAA 2RSQA 1GMWA 1BHNA 4IRKA 1DQ9A 5BR8K 3I87A 3VQ6A 2ALYB 3DRSA 4LBHA 4ED4A 1VQ6N 1YJUA 4K41A 2HBRB 4IOBA 1FO1A 5KFYA 4ZHRB 4GMKA 3MUVP 4ZCKA 3ULHA 3X3UA 5BPNA 4U67L 2OPRB 1Y64A 3PO4A 3AVIA 2J0SD 2DGQA 3FNNA 2Q79A 3DI6B 1I94K 2X1GA 4TYAA 4ID5B 3BYPA 1NGCA 3SYZA 1HBOB 2IAJB 2HQFA 2HHUA 4YOXA 1KTQA 2DNMA 2MKHA 5FPEA 3MMCA 2QG9B 1JLBA 1RSCA 2FSKA 2GHWA 5IQ6A 1SH2A 4FS1A 4OJ1A 3FCHA 2Q6BA 3RRKA 2RB7A 3K9KA 3W8PA 2IJNA 3U6FA 1RWMB 1QTMA 5CAAA 3R8YA 1DFDA 1N5SA 2CXEA 3MXHP 5J2PA 4GRSA 2HFNA 1S7IA 2Q3SA 3AGKA 1UL3A 2NUUG 4KB7A 1BQNB 4G1IA 4DF8A 5ETQA 5A76A 3OYJA 1XMOF 4K4XA 3OTOK 3RR7A 1WLJA 4WQ5C 1IQZA 4RG8A 2JRSA 3UVJB 3Q0AA 4DL3A 3IR5B 1HBMA 3LGMA 4LUBA 2NREA 5HLFA 3SSQA 2B43A 3L2QA 3DYAB 2YHBA 1VC5A 3PSIA 2P9IA 2VODA 4CM0A 1S1VA 1FDBA 2O5DA 2FYXA 2XBPA 1FRHA 1TKTA 4JKGA 5C10A 1N5YB 2VQEJ 4NLOA 4O4RA 1SQGA 4KE5A 3QO9A 3CJ2A 3R7SB 2Y9HA 1M90T 3WBZA 2F40A 3W61A 2KG0A 1URNA 2QYCA 3SI6A 5D6GA 1KS2A 4CE9A 3ICLA 4NXNF 1RILA 1TL5A 1U8SA 4OZ2A 1PSDA 4QU7A 4CJUA 4A8YA 1T9TA 2CVIA 1FXXA 2GIRA 4Y65A 1W2BR 1HNIA 5IC4B 2OZSA 3CF5Q 4H03B 1GMWD 2OA8A 4FBTA 1HNZF 3G6EN 4B3MK 4F4YA 1RABB 1FI4A 4MFBB 4B1YB 4EHUA 5DDPC 3D5MA 3PEHA 1HRHA 1HBUB 3DOLA 2R7QA 1YJ9N 2LEPA 3LTOA 2YHWA 2ILZA 2WB1D 4PWDB 1QLNA 1RNHA 1Y9OA 3CJAA 1DQ8A 5K14B 2PMWA 1RHJB 4ZITA 3C95A 4DQRA 1LW0B 3EGNA 2F4VF 1SJ4P 5B8HA 3TAGA 3DLKA 2AJ2A 3M9MB 1TUUA 4FDFA 3LP3A 4ED3A 2QEXS 3CC4S 1VR6A 3OR1B 3LP1B 4E98A 4QR2A 3C2PA 3LH2S 3HCXA 3CCJN 2V2VA 1T9YA 3GCWP 3CETA 3SPZA 2P6SA 4A47A 3RRGA 4KHNA 3HK2A 4LSLA 2DBBA 1LWCB 5FDLA 3IAM9 3WEEA 2D0CA 1VSDA 1FNOA 2OPPA 4DSFA 1QE1B 3TTDA 2K06A 4JKCA 5AQKA 5C7PA 4UQTA 1Q9YA 3IUCA 4A57A 3ZT4A 3DN9A 2E2QA 4FPBA 4PHTX 4WFXA 3N9UC 3Q8QB 5DRKA 3H3OB 1U6BA 3TP2A 3QT5A 9ATCB 1T02A 2Y8WA 2L9NA 1VSJA 4CO5A 4H5NA 3QEXA 4WCEL 1GOCA 4JI3J 4TYBA 2AEFA 1RAAB 1YJRA 2KDOA 3T69A 4X4VA 2GC8A 1GTEA 1FNXH 2NQPA 2KFYA 5KFMA 4O3NA 1DJ0A 3PJ9A 3FCVA 3TX8A 2HVIA 3KIOA 2KHDA 4IH6A 1VQON 3MCMA 3CCEN 2C2MB 4ZPTR 4FXDA 2HQGA 1HMVA 1FW6A 1OSDA 5HP1B 3GDQA 2QKBA 1WF0A 1VLOA 3CMES 4R0EA 2P5GA 3MPWA 2DNOA 2UYTA 3JSBA 5KOWA 1FWPA 3IMXA 1RZMA 3BSNA 1RKJA 4PA1A 2VPZB 4P2SA 3ASMA 3ZTOA 2HNDB 4Z4EA 3V5RA 1YJVA 2PAVA 3VALA 1X0PA 1S3XA 1BHLA 3KYLA 4OLPA 3LANA 3MCSA 2J7UA 1PJ7A 1AUDA 1BIUA 3GB0A 1VC0A 2AEMA 2V2KA 3B4MA 4NZ7A 1KAYA 1Q9XA 3H40A 3QFUA 3OFFA 4CD1A 4LF5K 2VZ9A 2ZDOA 4HH0A 4OJ3A 4DV3J 3A2FA 5KAKA 3QINA 1UVNA 1VQPN 1IKYA 1I94F 5KFGA 3WQPA 4DV0J 2NYHA 3UN2A 2QWNA 1RBOB 1ZM3A 2GHVC 3NH1A 1X4FA 4FWSA 4FJMA 4LT6A 4DPYA 2BEFA 2OMLA 2IM1A 1T3NA 3QEPA 1O5JA 1ZBIA 2AV5A 1KCFA 4BE0A 4GO7X 4ECTA 3J7ZT 4NA2A 3VQ8A 3G96A 3VAJA 3AA3A 3T7ZA 4X4TA 2XHBA 3GIJA 4X62F 4YMEA 5AQLA 2YKMB 4OJHA 4WK3A 2F8TA 1YRTA 4K4VA 2HBJA 4ANDA 4DV4F 3FQLA 1VQLS 1DTQA 4DTRA 4C0OC 1D3WA 3R3TA 2J6SA 1NGFA 1S1XB 3MR3A 3GIRA 4AHSA 3HP6A 4KH5A 1JLAB 5D4NA 3OTOF 4DFMA 2QI2A 1X4HA 4AHUA 4U67Q 1WD6A 3CB4A 2XLJA 4O5FA 4Z4CA 3OVAA 2HIYA 4ALZA 3F2KA 2DR8A 3RMBA 3C66A 4JKHA 1PKUA 1HYSB 2O8DB 2E20A 3VQBA 4KHRA 3VEOA 2I6WA 1JJ4A 3BREA 3J81j 2Q66A 4Y6IA 4QS9A 1SC1B 3F9MA 3O1LA 3HSZA 3MXIA 2YY3A 4UOHA 4KH0B 3SCXA 3UIQA 2KL8A 5GAGU 1S72S 4LR8A 4DEZA 1B7YB 2GIQA 1N54B 4C0HA 1DEJA 3TAPA 2QW9A 1EX8A 4DR2K 1Z6RA 4KPCA 3R97A 2WZ1A 2WB4A 1EETA 4XH5A 2XEXA 4CO4A 2OEKA 4RW9B 2Q97A 2NLWA 3TAMA 2HFZA 3UR3C 4K0KF 1WI8A 3UI3A 3G6VA 1XNRK 4H54A 4LSNA 2BBEA 4DTXA 5KOXA 3ELHA 3GV7B 2FSJA 2P9KA 4Z4HA 3CDWA 2EW9A 4CEQA 4LREA 5THWA 1R0AB 3HPOA 5AQJA 3P8BB 4Y00A 5DM7Q 4JV2A 1HL6A 4E7KA 3EXYA 2CYYA 3QAUA 1TELA 2V8VA 1KOOA 4Y0FA 5AQOA 4MJKA 3VEYA 1KVBA 3VZIA 1WOPA 2DGWA 4WQ4C 1RCXB 4BGAA 1XMQF 2YNFA 1IUJA 2QTDA 1VFJA 3K17A 3MMBA 2AP1A 3T19A 1XQIA 2MQOA 5B0BA 2MEWA 2EWHA 4JI0F 2JL9A 3LAMA 3AHPA 3CJRA 1N36J 4F50A 4C6AA 4RUBA 1Y3KA 2KT5A 1WC6A 4EBDA 4DFPA 2UXBJ 1JKHB 1JXVA 4DQIA 3AY9A 4GY2B 3DAWA 1XERA 3LDOA 3SMPA 4HLBA 1XI1A 4DX7A 3T5LA 3T6JA 5KFIA 3NLCA 3P39A 5GVQA 3ZSQA 5CHIA 2ZOGA 3OYAA 3CMAS 3S01A 4H5RA 2YNGA 2B3TB 4DR4J 3C6UA 5IC6B 3MPDA 1F9EB 4LQ9A 4IFYB 4FZZA 2VFSA 4FM0A 2ASLA 2JEJA 1UETA 1FXLA 1BA0A 2VQFJ 1ZBFA 3L4BC 4H4OA 3AB4B 5FROA 1FVSA 2E5GA 2DR9A 4B08A 2F4FA 4L72B 2CADA 3UB5A 3W2WA 4DB3A 3T9NA 2GBZA 1TL1A 4ZPBA 3CJ4A 2R7RA 3ZSXA 1NJWA 4OMFG 4JEPA 4DI6A 4H5TA 1OY8A 4F04B 4OO1J 4GKKJ 4NWBA 2LU1A 1ZA2B 4BG8A 1TFWA 4KB1A 4V19J 2G8UA 4H0YB 3LDPA 4GV6A 4OZ1A 4DV1J 2OD4A 3MM6A 3DDIA 4J2BA 3KLFA 1IR2A 3UO0A 5C42A 3K2YA 1MROA 2FTRA 2M8DB 2GW8A 1Y5NB 2Y3YA 3U1LA 4DR1K 1GLBG 3C16A 3VOVA 3KUHA 3DDNA 1H6KX 3RW7A 4P9SA 2VD3A 3PSFA 2WK4A 3VQEA 1FTCA 4CO0A 5DG9A 2E1AA 4DTUA 1QUPA 3FC9A 3S41A 3WQTA 5E2QA 2VDHA 3MR2A 2ETJA 2OP5A 2YH0A 1O1WA 3NHGA 2MKYA 1ASUA 1ZBSA 1RFQA 1A5WA 5M1OA 3SDEA 5GADU 2MZJA 3MTJA 5LM7E 2J8SA 2W7OA 2QMWA 1LXJA 1K73O 3DMJB 2FY8A 2M5YA 4RW6B 4JHDB 5BYRA 3N01A 4HEA9 1WC3A 4RZRA 1ZA1B 5HVFA 3CJCA 4JI7K 2N4DA 4I6YA 3V6DA 1FRXA 2PMZD 2OPSA 4KHPK 2HF4A 3FVYA 4OGEA 4TY9A 3OA9A 2XMKA 2FLOA 4HUEA 2RUGA 4BRMA 2NPIA 3PYFA 3GE1A 2R2RA 2GUIA 2A41A 2A0FB 1HNWJ 4DCOB 4X4OA 4NRUA 3LP2B 4YN3B 4DV2J 3A1YG 4I9QA 2PD1A 4Q8FA 1HJRA 3B8AX 2V8PA 1VRQC 4ECYA 3UD3P 4FK4A 4N8OA 2HKEA 2V5HG 4EYIB 3SSSA 2NNWA 3VQQA 4CEEA 3LWLA 1UAWA 4TLRA 1TMMA 2X6SA 3C15B 5KG4A 1W26A 3C6HA 1RT4B 4I2QA 2ASDA 3AA2A 1S49A 4JBCA 3THTA 4CQ1A 3FZFA 3NBPB 1TL3A 4USMA 4X66J 1VBXA 3MUTP 1TL7B 4FLZA 5GAHP 1MMLA 2H5JB 2FHKA 2EK6A 2RAQA 3FGUA 4USHA 2YKNB 4Y2KA 1H7XA 3VEXA 1BOTO 1X1PA 5KFEA 3HD2A 1RCOB 3T5KA 2FC0A 3CSKA 2AJ1A 1EP4A 3KLEA 1FE4A 3MM7B 1LK7A 3N6LA 2KTQA 1U04A 4JS5A 2YX4A 4JI8K 3R2DJ 2IC3A 1JQGA 3B6BA 2UXCK 5C24A 1N56A 3HOTA 2ZM6F 3LP0B 4AL7A 3NF9A 2BQ3A 3G6YA 1B9FA 4F4ZA 4NA1A 4B3SK 1NCLA 1VQKS 4CERA 2NCKL 3GTYX 2A6OA 5KFHA 4J5OA 1YZ6A 4N5SA 4LD0A 2J6UA 2VDIA 1JLCB 3SQOP 4EFAC 5IT0A 3T5JA 2X78A 3ULEB 3RUBL 2R3VA 2RE1A 2AGQA 3S7RA 2V4RA 3NGZA 2XGPA 3D6MB 3A8IA 4EHTA 4O0JA 2VYPA 1IM4A 2FJEB 2KW4A 1OIAA 4DU7A 4CJEA 4ZMMA 4QOZB 4LFCK 1W9HA 5AQUA 2VA3A 4WU2A 2JWLA 4LFAJ 2A5XA 4AF1A 2HHTA 1HQUB 5BREA 1WUAA 4YOEA 3M7VA 4CH0S 2QSWA 4CJLA 2WSEC 1U1PA 4CHNA 2HSEB 3B4DA 3PFEA 2RKIA 5KFPA 2QLXA 1S1UA 4W5RA 3CPWR 2PDAA 1WF2A 4X65J 3CXCR 4RW8A 4R5PA 4HI2A 1P8GA 1NH8A 4AXJA 1RWWB 1BWEA 2B6AA 5E26A 2IDOA 4OQJA 2KJWA 4DX8H 3KKFA 2VQEF 1YJWN 4OYXA 4FF3A 4M5GA 4JD2B 3DNCA 2E7XA 3DLLQ 3PX4A 2D0OA 3IDHA 2BE7D 3DXBA 3T1HF 8RUCA 3WZ0A 1BCMA 1P90A 3CFPA 5AE2A 2KYXA 3NGYA 3V6JA 4IR1A 3BDPA 4H8KA 2W1BA 2DXEA 5C25B 3F56A 2DIUA 3ILOA 1E4FT 2XSJB 1WSEA 1JXEA 4L6V3 3JQMA 4YB6A 3LO3A 2E5LK 2H3EB 2W8KA 4BDYA 4UUWA 1E6VB 3BF3A 3CCTA 1DZ5A 4ZOSA 4WFAL 4OV1A 2BM0A 2KXFA 3JSMA 1R31A 3RYLA 2VCPA 2G1DA 2QLFB 3RJMB 3AAWB 2HRYA 4I67A 2RHKA 5AZIB 3THWA 3CC2N 1UEKA 2NS1B 1YITS 3PYEA 5G0RA 1RDCA 3H2UB 4U96A 5HK4A 4EWTA 2BE2A 3C6AA 2ZOMA 1KHVA 2IYGA 1NLKL 7AT1B 4OYIA 3G25A 2V4JA 4C1NI 3H3NO 4I7FB 4U8VA 5DO2A 3MM5A 4EBCA 3MN5A 3NNAA 2QO3A 2GS8A 3W64A 1VAZA 4K4UA 3PRVA 4K25A 2OAUA 4MLEA 4HVJA 1RLCL 4CLKA 4FVUA 1VYAA 5FRNA 1LWFB 4AM6A 2PZSA 2OZMA 1FJEB 5HRNA 2NXUA 2RD5C 3RBZA 2GV1A 1HKAA 4NLGA 3MXJA 2ZJRQ 5HRPA 1F5BA 1NMEB 2GIFA 3MECA 3OBWA 4XDDA 1NK8A 5L38A 5M2UA 3R1XA 4BR2A 4FLYA 3V9UA 1I1GA 4DLEA 1U1OA 3CCLN 1F2GA 4UY8O 2NPFA 3KDOA 1S1WB 4E1JA 1FKPA 1G15A 4JI3F 3DM2B 3UNGC 4CZIA 4DN0A 3V9WA 2HG4A 3HSGA 3LPTA 3ISNC 2AJ4A 2D7SA 1D9DA 3UDCA 1Q5YA 2JEIA 4KRWA 2EFOA 1RAEB 4AYBD 3L4IA 3QBWA 4NI2B 4TNOA 2OYQA 5J2QB 3QETA 1NGJA 4DV6J 5H9FK 4AHTA 1N6QA 1IJFB 1HWJA 3RWUA 2ZBCA 4KRFA 4C0BA 1TKXB 1MW7A 3QBXA 2KT2A 4CESA 5JVGL 3D9BA 2VWJA 4DQ8A 2NRZA 3BZCA 3MM8A 1SH0A 1SI9A 1K47A 1FFSB 4TY8A 1NJXA 5M1KA 1M1KT 2V68A 1V4SA 1GLJO 5ADXH 3C94A 3IA0A 1N33J 4LRDA 4GV9A 4BC2A 1RBRA 4KFBB 5A2QO 1RWKB 3OXGA 4LRBA 4ER8A 3I0SA 1S0MA 3D54A 3TUZC 4JI6K 2CGKA 4CBXA 3J80Y 5AXLA 1VQ5N 3W2VA 1OKJA 3P4IA 4A2BA 2CJAA 2C1EB 3J7YI 3FBEA 3BSAA 2Q3PA 3WNGA 3O6QA 4YY3J 4NLXA 2Q2RA 2MZRA 2ZH9A 4ZP6A 4RL1A 4UZCA 1C4AA 3CC7S 1XJWB 3B54A 1PCAA 1WBBA 1RAOA 2V6AA 4E7JA 3OYMA 3NGRA 2KM8C 2HQCA 3WT0A 1WKLA 5SUHA 1RDAA 3IRXB 1FESA 4BRNA 3DJCA 1N8RO 3SI8A 3VQPA 4CJKA 1RWNB 4B1ZA 4B3TJ 4LF8J 2P9LA 3OYEA 1D09B 1X4DA 1GLCG 1RCHA 5DM6L 4NLQA 1MWMA 3OS0A 4YB7A 5L9NA 3TO8A 3RB4A 3CULA 3NG8A 4RW4B 2UU9K 2PI5A 4LF6F 2OI2A 1VQSA 5C5JA 4DU8A 3MR7A 4TN2A 3MWBA 4I4BA 4DR7J 5A6WA 4CM2A 3TAEA 3FEYB 3SBTA 4B3RJ 3VF2A 3FSXA 4AHRA 3A8YA 1PC5A 3H7HB 1TAUA 4QW8A 4HUGA 1IBKJ 3JXOA 2UXDK 3O9SA 4L3QA 2G8FA 2LQJA 3S8SA 4KGXB 3IWNC 4PWWA 4DL7A 1SZ2A 1VSFA 4GC6A 1HNXK 1HNVB 4E0DA 4EZ6A 2NUBA 4WTYA 2ZBQA 4KHWA 3HHNB 3SFUA 1CZAN 4ELTA 3VQAA 2RMLA 4KAIA 1UTAA 3DLBA 1SV5A 1RB0A 2CQIA 5BYSA 2KHOA 2AMCB 4E7IA 2M4MA 1OH8A 4BY9C 1QS4A 2R7TA 1X4AA 1U48A 1VBYA 3QMLA 1NHVA 4P75A 4DV7F 4C8OA 4DQQA 1LWEA 1EB0A 3MZIA 4YDUA 3VTIA 4BVOA 2XY5A 2FLLA 5ITHA 5J1NA 3H0PA 1SC4B 3DLRA 4KKOA 5AE1A 3GYXB 2ERRA 4IOAL 2RNEA 3M1VB 4CF9A 3OTDA 1UAXA 3C6TA 3S6EA 4PXBA 3EUNA 4K4YA 1KTVA 1NH7A 2DHSA 4F3TA 1N36F 4DUYJ 1NAQA 3SPYA 1UCNA 3CDAA 2MLXA 3QZ8A 2UXBF 3ZZPA 4OI3A 4CYUA 4B8CA 1I6JA 3O9UA 4GMJB 4GKJJ 5AQFA 3ILLA 1RWXB 4RNNA 4QU6A 4ZS6A 5FPNA 3LM9A 2BTFA 2I5JB 3JAMY 2RILA 1K8AO 4O5BA 3AO1A 5DJBA 4DR4F 1WC5A 2EFPA 4ZDNA 3Q8PB 2W01A 1AT1B 1UPPA 2NXCA 5H1SV 1R7IA 3BH6B 5FLXY 4F0HA 2VQFF 3AB2B 5M1QA 4L76A 3PJWA 1GTHA 2ZBPA 1R6VA 3Q89A 4RX6A 2KQ2A 3L09A 1XNQK 3HSCA 5LL6d 3UN3A 3ZSOA 2ITMA 1B0PA 5IT9Y 3VMFB 2DGTA 1Q18A 1T3VA 3T5HA 2RE2A 3HDSA 2FXUA 3MAHA 4C3LA 1YJTA 3HFVA 4ELVA 2HGLA 5J1PA 2WVFA 4OZLA 1CULB 4C11B 4IJNA 4DV5J 3KLIA 2JC0A 2MKCA 2ZDPA 1KVCA 4J9MA 4DV1F 4CK1A 1SVDA 2XI3A 1WC4A 3MUMP 2E1ZA 1EHWA 4EP5A 3PKMA 2OEJA 2DEIA 4A8MP 3OW2R 4O3QA 4M5HA 3OQ2A 3VVUA 2HYIB 1T05A 3Q86A 5IV4A 1O51A 1X9SA 2W4DA 2HBKA 5DGBA 2GUPA 3KLGA 2R4FA 3W8GA 4OX9K 4WU3A 1J2VA 3PDNA 4Y2MA 5D8HB 1BGXT 3KG4A 4ZVUB 3OL6A 1AROP 2V8DA 3BN4A 2V9KA 2ZHBA 3UR0A 1ZXOA 2RPIA 3OBYA 2NRVA 4EZ9A 2IMOA 1HUXA 2VBWA 3I56S 1K0TA 5CZ2A 2ZJPQ 3ZETB 4USTA 3OYBA 3NAHA 4O8UA 3OTCA 3DHXA 2YWKA 3OLAA 1FRJA 4E19A 3E8OA 1CLFA 4OPAA 1CS4B 2YCHA 2DTJA 2GQ2A 4LRFA 5D0EA 3RMAA 1TUYA 3TOQA 1DURA 4CHOA 3THXB 3SMZA 3RTVA 3ZCMA 1NOZA 1QZ5A 5CYJA 5HBMA 1HNWF 2I7PA 2WONB 2CQPA 3MOJB 4A8WA 4FVCA 2UP1A 1GXTA 4R25A 2F96A 3U9DA 2XMUA 3FQKA 4Q45A 3JXUA 2GVDB 5A6PA 4LY7A 2Y1IA 3CIZA 2VU5A 4ZKAA 2Z1GA 1YG0A 3T1YJ 4XTTA 4KHSA 2Y0BB 2VB6A 4FLWA 1OY6A 4NCGB 5CD4H 3FRYA 3V6KA 3GR0A 3A8KA 1Z05A 5ETVA 4KREA 5M2RA 1VQMS 1TKDA 4IEEA 4YHHK 4CDIA 3VAIA 1QQOA 2DPJA 2ZBIA 5CZ1A 2NUHA 2DITA 2Q43A 1NXIA 5DG7A 4DL4A 5KFCA 3W5ZA 4OHYA 4ED8A 4KH4A 3MN7A 3E3XA 5C15A 3W66A 2PYJA 1F0XA 1HWLA 4X4NA 2RUSA 2UUTA 3DGPA 1LFPA 2H1YA 5DQGA 3H25A 4NLDA 1X3MA 3L4QA 1N5TA 2BKPA 5CZVA 3AVNA 1NKBA 1TKZB 5JICA 2ATCB 4MTPA 2VOPA 4QZVB 1OVYA 1Q82O 3C14B 4CNYA 5C2CA 3A5NC 4JI2J 3PYGA 2LVWA 1VQ9N 1RHUB 4KHMA 2R7OA 4HDHA 3G8TA 3HI9A 3NCPA 1UA0A 4Y28C 5HROA 2DK2A 4HT5A 4HHHA 4PYDA 4UOGA 2AYBA 2VHGA 3A3NB 2XTJP 1NPKA 4NL5A 3O4QA 4XPEA 5GAHI 5MLCQ 4B9QA 2YPYA 1EQ0A 4LFBK 2XMWA 4WP3A 5E3AA 1U49A 2A40A 2DGOA 4PXCA 1HWIA 4QPXA 3DOKA 4TSXA 5DG8A 4TQSA 2DR5A 5I3UA 2FJBB 3O5BA 5C0YA 1IKXB 2RF2B 2KLAA 2R42A 4WFNQ 2O8EB 2PY5A 4N77A 1NSQA 4TU7A 4CEAA 1RBUA 3ZSVA 3MEEA 3ZSWA 4ECVA 4QOTA 3AJ1A 3CD7A 2AP6A 3HHDA 1B99A 1Y97A 4IDKB 3R5CA 3NMAA 4DLGA 4UZBA 3KK2A 4Y2CA 1YTUA 4DSIA 4IO8A 3W0LA 3NGDA 4H4MB 3R5AA 4E7LA 2RN2A 4MLHA 1RU2A 1P6TA 4PL8A 4MIBA 4J9KA 4NLCA 3Q8YA 3O1WA 4RLEA 4FPAA 1XHXA 1HBNA 2LQ9A 3CCQN 1TAQA 1X7VA 4O4GA 1X9WA 3W9JA 3FE1A 2MMYA 2BW2A 2VUGA 1LFWA 4EIAA 4B9VA 1NJYA 4CZJA 4NCBA 2CFXA 4CJSA 4A8SA 4IKAA 2HFSA 3ENVA 4EK2A 4AQYJ 1LOUA 2N82B 4IFVB 2HAFA 4CF0A 2XWYA 4UY85 2PGCA 4PG7A 3I6PA 2C2EA 2EWSA 3AY0A 2P9UB 4H0VB 4LF7J 1C1CA 3THPA 3HO1A 5FRMA 3O9QA 1NZAA 3ITHB 4Q0BB 4KV8A 1BY9A 3MPYA 1X5PA 1ZAXA 3M9OB 3KJVB 4F36A 5E3CA 3TA0A 3MEGB 5CCLA 2GEMA 3HHLB 4FJ5A 2HNZB 1F3VA 3PIPL 3CNQP 2HHXA 3AO5A 1TVRA 1IBLF 2QL7B 3RGIA 2E4LA 1ZH5A 5KPRA 2QWMA 3RSEA 3DGVA 3POTB 1S77D 2K3KA 3NCIA 1CJTA 2D74B 4FJIA 3BPDA 3WX4A 3TSPA 4OX8A 2B9YA 1K9MO 4EI2A 1QQCA 1U47A 4BR0A 3IBFB 1JK9B 2PMHA 3VENA 4FJ7A 3EKSA 4FWKA 5IXUA 2W9BA 1W2IA 2MGZA 4OPKA 4DL5A 2OH2A 4RNFA 3BSOA 4FL9A 3ID8A 4CEOA 2HHHK 1XTZA 3A5OC 2F1FA 2QT7A 4BRQA 4X4QA 4M63A 3WIUA 3TWZA 4DR3K 1FCAA 2I1RA 1VQ7S 2DYAA 1FHTA 3Q22A 2DFEA 4LF4J 1IBMK 3M8QA 3BBCA 4PQUA 1KLMB 3L2WA 4NLUA 4IH5A 3W60A 1RU1A 2NSBA 1PJ6A 3MK6A 3HFKA 2YQ0A 1HHSA 1FXRA 4JKAA 3A5MC 4YUDA 2YQ3A 1VRUB 2JVRA 1NGAA 3DRRB 1Z2ZA 2LECA 1MDUB 1OSCA 1I39A 4BCAA 4ISEA 3IWXA 5L1KA 5LMUJ 3M8PA 4CK3A 3D6FB 1FJ7A 2EXUA 4FW1A 1H74A 4DV6F 3HT3A 3HLUA 3OJSA 2I8EA 4F26A 3THVA 4UQGA 2ASYA 3VEWA 3EM1A 4JRQA 1IG8A 3QIPA 2CH5A 1IWGA 3M2RA 3BEXA 2HHSA 4Z4IA 4WJBA 3SQGB 5ADZA 1KVKA 4A8FA 4DV0K 3BYRA 2VWKA 4CH7A 4IUFA 3CC7N 2QA4N 4K8ZA 1JCGA 1F2HA 2MQ8A 5IM0B 5ETPA 1Q8BA 1QDUB 4BRCA 1G2EA 4LVOP 3UVJA 1VC6A 3K7RA 1AB8A 1MMDA 1T94A 1R3NA 1GK8A 1K8KA 3LPYA 4TVAB 2M52A 4P2FA 4WQ5A 2E5JA 1JLQA 5T7LA 1FD8A 3OR2A 4AFFA 5EX5A 2QZ8A 4A8OA 4CLLA 1CXUA 3IS9A 5KGXA 2LQ5A 1QUVA 1AA1B 3PNIA 3E01B 2HZAA 1I5OB 3ID6A 2CQHA 3BQ2A 1WB9A 3AVLA 1RT2B 5E3QA 2DNPA 4EFHA 3JS9A 2GMJA 3Q7BA 1FK9B 5AQMA 3NNCA 2QWRA 3N0VA 1YIJS 2BOPA 1MMNA 1A6LA 4QJVA 3O44A 3FLCO 3UKRA 5J2NB 5E3PA 4LF8F 3BGLA 2C3MA 1HWKA 3DKDA 5CH7B 3L3UA 3U8XA 2M88A 4ED2A 3O3HA 3MI7X 4HHTA 1GOAA 3VGUA 1HI1A 1HI0P 1F3FA 1KEKA 2P51A 4O44A 2E9TA 5ETNA 3H5YA 1UWBA 4YOUA 4IRDA 3DRSB 4CWBA 4B3RF 5DGAA 1S4EA 1VJQA 2WW4A 1XQSC 3VR1A 3BN7A 5D4LA 5EOYA 1IBKF 4GVBA 3IM9A 2JX2A 5B08A 1LW0A 2H5EA 1VIXA 2EC2A 2IYIA 3MCOA 4F0MA 2ZGYA 1MN7A 1N5QA 3H59A 5I3PA 3RMDA 1XMOJ 2WVEA 1S57A 4RBVA 3ENHA 2CUYA 2PSZA 2F8EX 5F1XA 4AL5A 2HBLA 2M2BA 1RT5A 5BYQA 1JLBB 4PG8A 2D0BA 5B09A 1M0SA 1QM9A 1WG5A 4YNQA 2FZCB 3D2EA 3CO0P 1G6BA 2I9SA 4DJBA 4AHVA 1GT8A 1JMTA 4FOIA 5JLFA 5J2PB 4Y1DA 3VPZA 2OPQB 1BLUA 1VI7A 3EO3A 4ZVHA 3CCVN 2UVUA 3S3MA 4K4TA 5LL6Z 1SIWB 2PFDA 2V67A 4FXVA 4PEOA 3TUJC 3FKBA 1GLDG 3AO2A 1XHZA 2EI5A 2A1RA 2OSQA 1Y7PA 5HLFB 4P73A 4FWPA 4NXNJ 5MAOA 4AL6A 3BP8A 1S59A 1VCTA 2E1YA 2NXEA 1S1VB 2PEHA 1HR0J 1HKBA 1J9AA 3N4WA 1S97A 2CNOB 1KKHA 1TKTB 3FZHA 5KFWA 4JKGB 1WORA 4L75A 5AJ3F 1KVJA 5EHHA 2Z2LA 4KT0C 4GKJF 3QO9B 3CJKB 1L3VA 2F63A 1SXLA 1FRIA 1VIOA 5HP1A 3VQ5A 4FWOA 4JS4A 2DHGA 2F65A 2BRKA 2ILYA 5SWMA 1RUSA 2GQCA 1K1QA 3BY5A 2NZTA 4CW7B 2HHVA 4EAHD 2NXJA 3ENQA 1IVZA 1S6PA 1Q16B 2VV5A 1YHQS 1HNIB 2J0QD 1IBMF 2F4VJ 3DRYA 3KZBA 1VQ4N 4CEDA 2VICA 4HL9A 4CF2A 4QIGA 1WACA 2HF3A 5AQSA 2CNKB 3DOLB 2XG8A 2Z4PA 1U2CA 1RAGB 1PC4A 3NNHA 4WKRA 2FBVA 4LJMA 5DMRA 2KJVA 5LSOA 3RG6A 2V8HA 1C0FA 4IQXA 3WC2A 2OEMA 3DRPA 4PQAA 5BRDA 3E2EA 5KFUA 3C7NA 2A1SA 4C2MA 3LQVA 3AQOA 5CYQA 2CPJA 1KQGB 2KKHA 3PIOL 1UWAA 5HO4A 5F8IA 1J5EK 3DLKB 3M9NB 3Q2SC 3FBBA 3PX6A 3GWCA 1YKWA 4AXIA 1VQNS 3KG0A 3PRBA 3CCSN 4JI1F 1IXKA 1KFSA 1TMJA 2ZGZA 3KUEA 4LSLB 3OXLA 5LMNF 4IR9A 3L9ZA 1NDKA 5FDLB 2IVFB 3WEEB 4CLPA 2OPPB 3IGNA 2YQ1A 1IKVA 2BR0A 3UDVA 3MD3A 4QCLA 2RH3A 1O13A 2LXFA 1KQSR 3CM6A 1EKRA 1T95A 2HS3A 2YTCA 3HTVA 3ET6A 3KNAA 3TWHA 4DV2K 2ZEJA 3J7YU 3VCDA 1J6ZA 4K2XA 2CA9A 2DNQA 3M30A 4BC7A 4FOEA 3M32B 4YP3A 3LZIA 4FJ9A 3L8BA 5BR8J 1M90O 3D2FA 4DSEA 4KHYA 5A8WB 2E6MA 3GMGA 2WBMA 4FZXC 4RW9A 1HMVB 1DQAA 5K20B 1NMDA 3NMRA 1WSGA 3P31A 2DY1A 3LM2A 3G4SN 5GAGP 4ED5A 2VA2A 1YK9A 1QHAA 3MDQA 5KTQA 3T1YF 4X66K 1A9NB 3VQCA 1S22A 1I94J 5KFOA 1RWOB 2FJWA 1JLFA 1W0HA 4H4KC 4KYZA 5F8MA 3AVBA 1WKJA 2DNZA 2G9OA 3J80U 4X4RA 3I33A 4CLWA 4M5JA 1OQ6A 1OY9A 5AQZA 4DUZK 3EE3A 4KJIA 4PXEA 2BJ3A 3NCRA 2FUG9 4X62J 1J5OA 1H2VZ 2W9CB 3AARA 3ILIA 5GINA 5CCMA 2IRXA 1ZZNA 2CZVC 5KRTA 5KT3A 1IKYB 3VWSA 5EDWA 1GOBA 3PO5A 3CJTA 4DV4J 1YVFA 1NJZA 3NWGA 1KNZA 4RW7A 6AT1B 2F9DA 5KFKA 4WQ4A 3PTWA 1ROFA 2BJ1A 3OTOJ 4YFUA 3NP5A 1U26A 4JI2F 1FEEA 3D6TB 1PG5B 4Q7AA 5HQLA 2MQMA 1Z1ZA 2F8HA 2EBEA 1U4BA 4ZLLA 3SUQA 4OLOA 3WXIA 2RVJA 1DTQB 1QJHA 4FWRA 4N7TA 1D0EA 2QXLA 4BREA 4F4KA 3W63A 4IFYA 2VFTA 1HWUA 2BZ2A 1QVGM 2KT3A 2HIQA 4PG6A 4M5MA 4LRAA 2Y1RI 3ZZUA 3ZX2A 2V2ZA 4I0WA 4LFAK 4EBEA 1XMBA 2NR0A 2FVSA 4CZLA 3TAQA 2J0XA 4E1MA 2Z30B 1WUUA 1EO1A 1NLVA 2W9AA 4FK0A 4BDZA 2R2TA 4K0KJ 2UUAF 4DUTA 2E66A 2BANB 2FDNA 2KFZA 3AH6A 3LF0A 3ZT0A 4B3MJ 4USJC 1YVUA 5A8RA 3CYMA 4JKDA 3MPUB 5F8GA 4EGLA 1EETB 1QAYA 3SJJA 3P38A 1IKWA 3R8EA 5LXYA 3OYLA 1YGYA 1X5SA 4ZVRB 3OHAA 4NEYA 5DDOC 1ACMB 5HMZA 4HT7A 3VQTA 2MZ1A 1UKUA 4LSNB 3FJ2A 1UJ4A 1XMQJ 3R27A 1NPRA 1UOCA 2P9KB 5D0RA 3OFGA 4JI0J 1ZAVA 1FRMA 1U1LA 3D4JA 3CCRN 4MYUA 4EO6A 3J81U 4DZ6A 3JTNA 2D1CA 2J9EA 2ZH7A 2O1PA 5IWAK 2DT9A 4AQYF 5JVHL 3GIMA 2IS3A 4FW2A 4QIFA 2R8IA 3OYHA 2AX1A 2JZ5A 3HZEA 1REVA 4LF7F 3QIOA 3H46O 4LQ3A 3MMBB 1KLNA 3CDBA 3DXKA 4WXOA 4Z4FA 2CPDA 1J5EF 3JTOA 1M5KC 5GADP 4F02A 4KH6A 2NZ4A 1WOSA 5K8OA 3JAMU 1NB2A 4KTWA 1TK0A 1CJKA 3W9IA 3J7ZO 5AFUH 3ZTRA 4CFDA 4YEAA 4F25A 3V1QA 4F9OA 1U0HA 4IO9L 4CJFA 3AVJA 4DPOA 4Z7YA 3DLEA 3VTHA 4RU2A 1RHQB 1BI4A 1FX2A 4Z4GA 2QL9B 3DXMA 3G0ZA 5F9NA 1DBDA 4M3XA 4DU3A 1TYQA 1YTAA 5H9EJ 5GMKa 5LJ5Y 3UD5A 3TX0A 5SZTA 2HMIA 2YNGB 1YBAA 2CJBA 3C6UB 3P96A 5AQWA 4DL6A 2G4BA 3AA5X 3RAMA 2DGVA 1KRPA 2H5IB 1IQTA 4J91A 5IT9U 1OH6A 3MGJA 4M3YA 2RQKA 1C0MA 2HRTA 1WG1A 2AEJA 2HLTA 4H4OB 2OKQA 4CJ5A 5AXMA 3ENOA 2FVRA 2DH7A 4LBIA 3NBPA 2F9TA 3K9JA 5J1EB 4URGA 5KFAA 1RT6B 3W2WB 2D69A 3RB0A 1SBRA 1TL1B 3IXQA 4N56A 1V3ZA 5F0WA 4E8UA 1T7PA 2XULA 3S3OA 1R43A 2K1RA 1V3SA 1DY3A 2YWGA 2QKKA 1PIEA 4FF4A 3ZSYA 3MWTA 5IS2A 1JCEA 3MM6B 3KLFB 4FZVA 5C42B 4CLSA 4DG1A 4A8KA 1MROB 4FJ8A 3ZX0A 4FM1A 3W3DA 3O4NA 1HD0A 1YDLA 3C16B 5E0OA 1AZSB 2GWKA 1TUGB 1KQFB 4DQSA 2CPIA 3KK7A 1H2TZ 1VSLA 4CHZA 1NSKL 5LMUF 2W42A 1LV5A 4LF9F 1UEVA 3OV7A 3AA9A 4FPRA 1V3RA 2FC8A 2CDRB 1UZHA 5HAOA 4JK9A 3E1YA 4DHYA 1N33K 3SDEB 1JLCA 3QFWA 4P74A 4OL8A 2A1BA 1UVJA 5KT7A 3TQ1A 2M70A 4HTLA 4CFBA 2B8PA 4HDGA 3RBXA 5KFBA 4NO7A 2RT3A 2WOMB 4M1KA 1WOQA 3LPUA 3GBTA 2N7YA 2O01C 1YI2N 3KG1A 3V6DB 2OPSB 5A0YA 2HHPA 2HOEA 4NLVA 1RT7B 3EICA 2XYHB 3GG0A 4JK8A 4WF9Q 4CHPA 4F4WA 2O8CB 2F3JA 2ZZTA 4WYBA 2FGCA 1JXBA 3IM8A 2VJUA 4K7QA 4CD3A 3D7SB 4DTMA 3RU0A 1U1MA 3NCQA 2FBXA 3QPIA 1OO0B 4DMNA 2CVEA 3W62A 4YB1P 1CLQA 2P5OA 3OYIA 2VIHA 2LA6A 2DD8S 3KHLA 4DR5K 1DAXA 1S9FA 1NNEA 1WBDA 2ZH4A 2AJFE 4B3TK 1VJWA 4NA3A 3GR1A 5HRRA 4QBUA 3GJRB 3EZOA 5EWGA 2B56A 4C48A 2OTJS 4U7UK 1BWVA 4I56A 3MAAA 3OVBA 3TZYA 4JD2A 4FLVA 4IOCQ 4RPFA 2JVOA 1F1BB 3IWLA 1NM2A 4DR6F 3BF1A 4BDPA 3VAHA 3NH0A 4XO0A 3SXLA 3C3LA 5FPDA 2CWKA 2XYPB 2FJVA 3WIVA 5D15A 2K3IA 2BDPA 4DR7K 4NXMF 1YUWA 2PA3A 3GFHA 5DS7A 1SQEA 2HFOA 4LH4A 3TVZA 2QE5A 3V81A 3CCUS 2OTLS 2ZM6J 2E2OA 3BUZB 3F9KA 4UF4A 3SAHA 4CHQA 3CCMN 4YQWA 2ZC4A 2A10A 3H5SA 4FXWA 3R7NB 1EP4B 1E6VA 5JS1A 3EPGA 4RWWA 3KLEB 2XY7A 4MK7A 5HN0A 2AIRB 3ONQA 1KSPA 1GLEG 2MB0B 2OANA 2PN6A 2IC3B 4F2SA 2V52B 2BYCA 4J2EA 4CJ7A 1WTFA 2OCEA 5C24B 5HL7L 2DRDA 1FWKA 5D77A 1H98A 1R8CA 3P45B 3KK3A 4FVMA 1RLDA 4KBOA 2G0IA 4J2AA 2L41A 2W2NP 2O8FA 4P7TA 3VAKA 1P8ZA 2YWHA 2OELA 2DH8A 3GE9A 4NCAA 5CA5A 4FYXB 1WSFA 1NKCA 2MLYA 2IBOA 2G8WA 2CQDA 4A8XA 4XPCA 3MOZA 3M5RA 3VGVA 2B4VA 1LWFA 1UEUA 3SUPA 3MWPA 2FC9A 1S9GA 3HVWA 2XHWA 4A4JA 2GGPA 3R3LA 1U24A 4CLUA 4DUYK 3OLBA 3HULA 3TVYA 5LOQA 3PR4A 4DSLA 1RDRA 5ETTA 4A59A 2XLIA 1HARA 2P6TA 3UD4P 1GMUA 3T1HJ 3Q83A 3CW2C 2ZC3A 4O0NA 2RKIB 3EWGA 4YR3A 1S1UB 2MLZA 4FJJA 1NDLA 4RW8B 4R5PB 3ZZ0A 1HR0F 4DTOA 3NWRA 4OHVA 2OUGA 2W4PA 2A6AA 2B6AB 4RNOA 5C12A 2LQ8A 4QIVA 2B4OA 2P9NA 2YI1A 2W7PA 1KQKA 3JS6A 1H2UX 3OYGA 2VC1A 3I0RB 3K8VA 1RGIA 1G3OA 4RO0A 3ZFVA 3DWLA 1WC1A 3TTCA 4DR1J 4GVLA 1L3KA 4CJWA 1SC3B 3PACA 2UUBF 2IVPA 1RDBA 3CT9A 2G8KA 2BJEA 2DR7A 3ZLJA 4MK9A 2EFGA 4DBQA 4R8UA 5BJRA 4DV5K 1U2VA 4NYFA 4X64K 3J80O 4JV5K 1DLOA 3MR5A 4EEYA 2FJXA 5D0HA 3PG9A 3QGHA 3VAMA 2YJFA 1C1BA 3L7OA 1LEOA 4R0JA 4DX5A 1KONA 2W40A 2QK9A 1WEYA 3RBEA 1CJVA 2HURA 3JSMB 4JI7J 4TU9A 4PUOA 1VQYA 3JTPA 4CJTA 4NEZA 2KRRA 4B3OA 1N34F 4ZTJA 3BBFA 3RB6A 2V2QA 1VS3A 5G0RB 4ZJQA 2BE2B 3ULDA 3LA0A 5K9FA 3HVTA 1NK0A 2AYEA 1NRKA 4CZFA 2V4JB 2ZE2A 1VISA 3IRXA 1YJNN 2L9DA 1IH7A 1BL3A 5BR9A 5KQ8A 1BG3A 1H7WA 1U09A 3TANA 1WI6A 3SBGA 4M42A 2IJRA 4TXSA 4IZ9A 4G1QA 4M7XA 2J76E 2P9CA 3CDEA 3N4QA 2BGGA 1E3MA 4RW4A 1X31C 2BABA 4JB8B 2MQPA 2W4CA 4DPXA 3LUYA 2N3OA 5B0AA 4MDAA 4CI6A 3AT1B 2GAHC 5EU7A 4L3NA 3K59A 1FKPB 2HAIA 2VPWB 2EPIA 1B70B 2CG8A 3R6LB 5EUHA 2O4GA 2IRUA 4ENOA 4V19X 3EZWA 3ISND 3U9ZA 3FFIA 2EG2A 1UW4A 3TU5A 2BMBA 3M6UA 2ALZA 2DNRA 1FRKA 2AYMA 1LCUA 2ROPA 5BR8F 5B0FA 4OIXA 5D4PA 2NYIA 2AW0A 4DXLA 4C23A 2VBXA 2FY1A 1VQ6S 5HMWA 1TV6A 5KG5A 2FLPA 1N6QB 4NLRA 3G8QA 5KFVA 2XMVA 2UXCJ 2FHJA 2RQCA 2UUCK 3ISZA 5KT2A 4NLBA 3D67A 4B3SJ 1S0NA 4P52A 3M8YA 1GX6A 3CQYA 3HPHA 5F0XA 3RVCA 2ZHOA 1TR0A 4WYLA 4TY8B 3R6GB 1OS5A 4RKUC 2H48B 4ISGA 3VN5A 3M8ZA 4ES3A 5IZHA 2Z2ZA 2Z2YB 2A6MA 2OMOA 4V1Ak 4WFBL 5IQQA 4MH8A 3ZNUA 2RHQB 1UVLA 3EVWA 4OHZA 4FZYA 3ATUA 2B4JA 2DRAA 3JAMO 4WTOB 3RMCA 1RA6A 1S6OA 2BE9B 4LF6J 1C0TA 3I4PA 4JOUA 5D3GA 2FJAB 2P9GA 4ZTFA 1SJRA 1SJFA 2CPXA 5FLXO 5EN1A 2ZVSA 5T41A 4KSEB 2XS5A 4ELUA 1RP5A 5E7OB 2P9LB 2FZKB 5KG3A 4W5TA 2MZSA 3FK4A 2XB2D 5IT9O 3R9LA 4CJ4A 4LIRA 3THYB 3MR6A 5AZJA 1L5UA 1RI7A 2XMJA 1TTHB 2IHR1 2EC0A 1RTZA 3OFEA 2XMMA 2FSNA 5BPLA 3QRRA 1IG9A 4JI4K 2QMUB 3J7Z5 2QLJB 5BRHA 4NLPA 3M8WA 1HLUA 4PKHA 1JJ2M 1JLGA 3P49B 1CVJA 2P9EA 1X4CA 2DXFA 2RRAA 4B3MF 3QJLA 1T6CA 3AV9A 4RWXA 3WDOA 4Z2XA 3BS9A 4HTUA 3MM9A 2X6NA 2FVPA 3G6ES 3L2UA 1EWRA 1MWKA 4C1NK 3EJMA 4DV7J 1N32K 4I2PB 2FHJD 5KPTA 2GJ2A 3W5XA 4WKYA 5BXIA 2IRYA 1ATNA 1YJ9S 2E9ZA 3I55N 3M2VA 2R8KA 3AD8C 3NGUA 4B9UA 1FKOA 3KK1A 5DETA 3ZT1A 1SV5B 1F5CA 2BJDA 3D1QA 4EMDA 1EZZB 4OKKA 4YDUC 4JNEA 4K42A 3CD5A 1M1KO 3HZ6A 3Q8VA 1ZTWA 3AQPA 4GO5X 4CO2A 1LWEB 3CCJS 1U1QA 3QFPA 3ZETA 4KQZA 4IG3A 3P3DA 3EGVA 2XNQA 1K1SA 2ZJQL 1HHTP 1BU6O 4DQPA 4F4AA 4F3QA 3BKUA 1HQEA 1Y00A 4KKOB 2CPEA 3K8WA 2BA9A 5A8KB 5HJXA 5LJWA 3C6TB 4M5DB 3Q2TC 1FJGK 1NBEB 2YKOA 3W1YC 4K2JA 3LDSA 2JNJA 1HLWA 1PBUA 3WQUA 2ZNYA 3CDUA 4BR7A 4BGBA 4C8NA 1TGOA 2LDIA 4NMXA 3UWTA 4CYUB 3V1RA 2YBVA 3JQJA 3U1MA 3NGSA 5HJYA 3WNFA 3VA3A 4ZN1A 4PWUA 2UVWA 2OHDA 2AD9A 1BA1A 1BCOA 1PGZA 4ZIWA 2HGMA 1S99A 5M1PA 5ADXA 1WJ9A 3G71N 4JI5K 3NF8A 2CPHA 1QD1A 4ANCA 5F2RA 1X4BA 4NCGA 4ERDA 2UUWA 2D1KA 1ICEB 2G2ZA 1VQOS 3CERA 4I6MB 3CCZA 1C0UA 3CCES 1JL2A 1X8DA 1BE4A 2MQQA 1Q1KA 3SV3A 3QQCD 1HYZA 1R0BG 5H9FJ 2R8HA 5GADI 4LF4K 2KZZA 4CF1A 3O8WA 1F9FA 4PABA 3VF0B 4M3ZA 3AO4A 2PA8D 2BV3A 4PPDA 1TP7A 2XMAA 2CJ9A 1CPZA 1NHUA 3K58A 3TUPA 4O3PA 2DEJA 3N79A 1C1AA 3KUGA 4OYWA 5E33A 4CT9A 3KLIB 1KAXA 3PW0A 2XI2A 3M8SA 1RGVA 4WCEQ 2HLUA 4C9DA 1YVNA 4LF5F 1WEZA 2ZUAA 2DCLA 4JI6J 4I6AA 5GAEI 1U2FA 1VSHA 3L3VA 3H2LA 2EBGA 1AUSL 2QN6B 4OHWA 1SAZA 2Z58B 4IO1A 1T05B 5B0CA 3MHYA 1RKIA 4BR9A 2GWJA 1HPZB 3GFZA 1A5XA 1GQEA 3KLGB 2R2SA 1IR1A 5HRSA 3SJHA 5AR0A 2R2UA 4ZVEA 1RTDA 3P4UB 2E29A 1RTHA 4DCHA 5I42A 3B82A 4CGDA 4JYAK 3TABA 1M1HA 4XDCA 1JLEA 3OYFA 3ZZRA 1FD2A 2XZTB 5HQ8A 2RF2A 5DZ6A 3O1BA 3L7PA 3HJFA 3MEKA 2O8EA 2I38A 4HACA 3K0SA 2DHHA 1Q86T 3JYTA 5EXWA 3ATVA 2B4UA 2VC0A 4J9PA 3DHWC 1WSVA 2UU9J 1Q8LA 5KPZA 1YBUA 4CECA 2EFQA 4CIOA 3EMTA 3QGGA 1KP6A 4WXWA 2LEBA 4M41A 2QFIA 2MSTA 4C7QA 3W5YA 4MK8A 2Q6CA 1HPMA 3OD2A 2JLEA 2B5JA 2HNYA 5F8HA 3ADAC 3U1NA 2KH9A 4M7YA 4N47A 2MYFA 2CQ1A 2BM1A 1JL1A 2J9CA 4RUCA 1VK8A 4BRHA 3BDEA 4DR2F 4F4XA 2CPFA 4DTPA 4W4MA 2E5IA 2V4QA 4Y0WA 1T8EA 4AILC 3GG1A 1RT1A 1HNXJ 2I2YA 4JI4F 4HI1A 4CTAA 3PXGa 3EGWB 5E5NA 4IG0A 2EFNA 2H4YB 1HQ2A 1XNRF 2ASJA 1AXQA 1MU2B 4X4SA 2FHOB 1NG9A 1Y4ZB 2V50A 1WNEA 5AQIA 4JN4A 3KDNA 3LGHA 5AQTA 2QWOA 2DCUB 3PKYA 1XWLA 5TKYA 1FRLA 4Q0BA 4DZDA 1CQMA 2CPYA 3D45A 1SL1A 4M95A 3A4TA 3PW5A 2ASOA 4C8KA 4WFYA 1LOTB 1Q95G 1Q5VA 3UDEA 1UFWA 5AQHA 1XMOK 3KLVA 1FDDA 4BRDA 1MN9A 2H4WB 4WFZA 3CF5L 1UFLA 3NFAA 3MEGA 1E6YA 5AQXA 2FB0A 1DGKN 2E1MC 1T03A 1KN6A 4PCQA 4TU8A 3CEDA 4WBFA 5HROB 1FVQA 3QICA 4DOZA 4U6PA 1RTIA 2YX6A 4I68A 1PAEX 2DHAA 2D9PA 3MF5A 3KMSA 4WP9A 1J53A 2AGPA 2BACA 4BBYA 3VQ7A 1U0SA 3NGTA 4E89A 5J2MB 3VGKA 2IM3A 3DOKB 1R6YA 1VHXA 5I3UB 1NGGA 3AA8A 4O8KA 4O55A 5KI6A 1T9WA 3JQKA 4B8AB 4NXNK 3GYGA 2G8VA 3MEEB 3M05A 4ZLNA 1V5IB 4C97A 2D0PA 4XEIA 3TVKA 1JJCB 3QWPA 1IV0A 2E2PA 4NLWA 1HNZK 1RYSA 1XNQJ 3G82A 1YLXA 2XMTA 2XSFA 4HHUA 2E1CA 1Q7LB 3KK2B 3NL0A 3G8SA 5JMVA 3I96A 4ILJA 2EFVA 1N0UA 2PFFB 4EU0A 3FCWA 4FYYB 1DT9A 2GO9A 3R5GA 4QW9A 3A0IX 1ASWA 3JSYA 1EIYB 3QSYB 4M3RA 3QGIA 3VHQA 3LDQA 3P1GA 1HBNB 1EQYA 2QMXA 1VSKA 4O4GB 1NSAA 4PZVA 1W2BM 2F4VK 3CC4N 1MA9B 2QEXN 4FP9A 3OYKA 2CQGA 4DR1F 3CIPA 2WBNA 2WAQD 3NRBA 4DTJA 1V9OA 3UE2A 3BKFA 3D0HE 5KFSA 2DISA 3HD1A 1NGHA 4D3GA 5U47A 3DU5A 1NKEA 4GVEA 4FYVB 3CCWA 1DARA 3BBBA 4LVNP 3FR0A 4ZLJA 3NOCA 1IBLJ 5K8NA 1QAXA 1C1CB 1K44A 3QNOA 2J8AA 2EX3A 3MEDA 3GONA 2GELA 1QAIA 1NK9A 4LR9A 4FF1A 2W7AA 4UUXA 1R59O 3BQ1A 4UT4A 3WHIA 5F8LA 4OHXA 2R9LA 1BDGA 4JI7F 5CD4A 1RAJA 2UVRA 3GOIA 1KOHA 3PR5B 4KHPF 4DHVA 4CHYA 4ID8A 2XS2A 4A61A 2CGLA 4PL7A 1BQMB 4ZVPB 4ZVOB 1TVRB 3E01A 2LU2A 4IWVA 4ETXA 2K8GA 3RAXA 3WXMB 5FIIA 2ZHAA 1RT2A 2YH1A 3RSEB 1UP1A 3C8YA 5B0GA 3VF4A 2M0GB 2ZH5A 1CJTB 5K8PA 1ULRA 2V8GA 3NVKA 5I3QA 1CJUB 3DCAA 5B7WA 2AA4A 3EDQB 3A3OB 2VKZG 3VGSA 2YNIA 1JCFA 3CMEN 1T9VA 4M63C 2W9BB 2MGZB 3IN5A 1J27A 2KVQE 1T44A 4J9LA 2E5HA 1S1TB 2LEAA 1RT3A 3EPIA 3W7BA 3LDNA 2WC9A 3CMQA 4BHQA 3ALYA 4AM7A 2YV0X 2CNNB 4YHHJ 3CVKA 2P9PA 3VEVA 2PEBA 3M8QB 2KRBA 4PQUB 2C28A 5CZXA 2WUSA 2DKOB 3QLHA 2HPUA 1WG4A 2E88A 2ZD1A 5AQNA 1H1VA 2V69A 5F9LA 3ZTQA 2RQ4A 2COLA 2XYGB 4URSA 1FTRA 3PW7A 3M8PB 3HSDA 3KWMA 4ES1A 2HVEA 4JI8F 4YR0A 1Q4RA 3AVAA 4OV6A 5EWEA 2LP4A 2UXCF 4IJAA 5IFMA 4K59A 2OFHX 2XNRA 2C42A 4X62K 3CG7A 4DTSA 3QIPB 3V9SA 3M2RB 4DSKA 1SUQA 2JEGA 4B3SF 3HKWA 3OSNA 1VQLN 4FPIA 3R5DA 2QXFA 3VERA 2VG6A 5CR4A 1S6QA 3TEHB 2F9WA 2OPQA 2NXNA 2V63A 4DV4K 2HFUA 3PW2A 4LFBJ 4G6VB 3NF7A 2RS8A 4P6QA 1H3DA 4KIAA 4WP8A 5D78A 3PJXA 2XY8A 3KHGA 1VK0A 1JJHA 3DLGA 4B9LA 1LXNA 1JX4A 1K8KB 2O8BA 4OX6A 1BWFO 3IG1A 5DM7L 1JLQB 5T7LB 4LFCF 3OR2B 5L1IA 1S72N 3EY1A 1N88A 3TYTA 3IS9B 4YS2A 4O3SA 2UVVA 2FF3B 1U1KA 2H65B 1SKWA 1Q8IA 4ZPAA 1OMSA 3CJKA 2VG5A 2AU0A 2YKQA 3V1OA 2VFUA 3CQXA 1D9FA 3QJPA 2Y1JA 4CJQA 3UKRB 4OKJA 2D41A 3EZ5A 4TKTA 5JJBA 4K0KK 1Q78A 3KLHA 3D3BJ 5H1SQ 3TA2A 2HWIA 1YJWS 3KNGA 2E8AA 2WTUA 2LSNA 4BWMA 2Q31A 2IVNA 3HBTA 2RDJA 2DNLA 3HSTB 4O44B 1GLFO 5AQGA 2YNHA 2FGOA 4XK8C 3B6OA 4BRGA 2VG7A 1UWBB 3BH7B 4QYRA 4CLZA 5CYMB 3VQDA 4CBWA 5AQVA 4ANEA 3F73A 4GVBB 3AVGA 1SQKA 5DLGA 2E5LF 3H4BA 1XMQK 3BO4A 4FWQA 3IKMA 2JSXA 4IQMA 3SEOA 2C22A 1L3TA 3KVGA 4JI0K 1SJQA 4IOXA 1FDAA 4FLTA 2G13A 4NYZA 1Y5LB 8AT1B 1Q81T 5I9EB 1ITGA 4FJNA 4FNIA 3C19A 1RT5B 4BS2A 4W5QA 4J2DA 2Q0UA 4IXCA 2GVZB 3J81Y 4ZPDA 3CMAN 3D2EB 4URQU 4CZHA 3CC2S 4DFJA 1QHTA 4QR1A 1YTYA 1RBAA 2MZTA 4ED6A 1TFYA 1PYSB 5HVHA 4KHQA 3IBWA 1G99A 4ZA1A 4O0IA 4J37A 3HMJG 3AXMA 4NZ0A 1E4GT 5AJ3J 3VQSA 4Y3CA 4KO0A 3DOMA 4ZCIA 3PCOB 1ZAWA 4BQLA 2ZITA 4L73A 4F0KA 2PIIA 4F7VA 2Q1LA 2Y1LB 1NOYA 1J54A 4QWEA 2HHHJ 2YX7A 3AOAA 4K8RA 3V2UC 2U2FA 4MQ3A 5H9EK 4DR3J 3UPFA 3FEZA 4WFAQ 1XEZA 3M32A 3OUYA 2KO1A 1NBWA 1OH7A 2LLZA 1LWXA 1IBMJ 2HHWA 1XBWA 4GW6A 1EAYC 5A8WA 3CCLS 4RU9A 2EKNA 3CM5A 2LDYA 3GSIA 3J7YP 4ISFA 1WSIA 1WOOA 3CHWA 3GCXP 4CGGA 3M6GA 3DLHA 3BZKA 3SFGA 3UCGA 4FO0A 5E3RA 4DS5A 1S6PB 4K50A 1U6ZA 3FMBA 3OPKA 3SZ2A 4ILGB 3P6YC 1R8BA 4F2RA 4NZ6A 4H4KA 2HZVA 1KBRA 5L46A 3H90A 2W9CA 1P1TA