2YNFA

Hiv-1 reverse transcriptase y188l mutant in complex with inhibitor gsk560
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
560
structure length
557
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 158
structure length 557
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ynfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ynfA05
3NKYA 1B92A 1BL3A 1KTQA 4URGA 4ECYA 3K59A 1SV5B 4KBIA 4MQ3A 4ZVHA 4ZP9A 5KG7A 4QWBA 2R2RA 3MEDB 3K5OA 2EC0A 3NHGA 1LWCA 1ITGA 4F4WA 3KLFB 3SFUA 5DMRA 1LW2B 3MR3A 4G1QA 4CJ3A 2X78A 2D3UA 2W9AA 4OL8A 1VSKA 1N5YB 5C25B 4Z4HA 4YQWA 2E9ZA 2XO7A 4KAZA 1XWLA 2HNZB 4CFCA 2IM3A 4G1QB 2PYLA 1BGXT 4NLUA 4E1NA 4CGIA 4BDZA 4K8XA 1J5OB 1S49A 1JLBB 4Y1CA 4Q43A 3HP6A 2YKNA 5J2NA 2IM0A 3CDWA 1NK5A 2IOCA 4CECA 5KFLA 2YNFA 2D0BA 4NLTA 4DTPA 2VWKA 3KK3A 3K5NA 4JRPA 4FXDA 4X2BA 2HHUA 1CLQA 4DS4A 5CZ2A 3QNOA 2VA3A 1S1UB 1SKSA 4RUCA 2VG6B 2R8IA 4MKAA 4HUFA 4RW4B 4TLRA 1U04A 4IRKA 3KNAA 2HHWA 1LAWA 3CJ4A 3KK2A 1T05B 3RMDA 1WAJA 3VQCA 5JS1A 2ZD1B 4EBEA 4CEOA 1X9MA 3QIOA 3TWHA 3VQ5A 4TY8A 1XI1A 3B6PA 4QPXA 2F8SA 1LWCB 3PJXA 1RT6A 4MIBA 2G8WA 2V0NA 3M8PA 2KZMA 3OYFA 2IM2A 3BQ1A 4Z0UA 1G15A 4EZ6A 3GIKA 1VRTB 1RBUA 4YP3A 1KSPA 4QWDA 2FBXA 3T5LA 5J2QA 3RRGA 3VQBA 4DFJA 3QEWA 1GX5A 3IGNA 1JLGB 2PYJA 2W9CB 4EP5A 4DTRA 2RF2B 3DLBA 3SYZA 3OYKA 3OY9A 2BDPA 1GX6A 2DFFA 1REVB 3NFAA 2R2TA 4KTZA 3HJFA 3H5SA 4O44B 2DFEA 4FJNA 1SL0A 1HQEA 1YT3A 5KG4A 1RNHA 4JRQA 5C25A 2DPIA 4OKKA 3O3HA 4F4KA 4HUEA 1BISA 4LY7A 4Y34A 2DPJA 3BR9A 3AVJA 1QAIA 2WTFA 4MFBA 3V4IB 1ZYQA 5KT6A 3C6TB 3SCXA 3I0SB 2ZKUA 3QZ8A 3L2QA 1TKZB 4CF9A 5KG5A 5KFFA 3OYAA 5KFRA 2BE2B 1N56A 2R8HA 3NH2A 4KV8A 2JEIA 1XR5A 2XCPA 3L8BA 3PW4A 1KFDA 4HKQA 4NYNA 2GUIA 4CGGA 3ZSZA 4O4RA 3OL9A 2XC9A 5HROB 5HRPA 1S1VB 3DRRB 1LV5A 4ZP7A 3TARA 4RW8A 3I5BA 2X6SA 1NK9A 3LP2B 5L1KA 3NH1A 4M3UA 2XY5A 1TV6B 1WN7A 4H4MB 2V4RA 2G8FA 5KT2A 1ZBHA 4OLAA 3HSTB 4TQRA 1TVRB 1UA1A 4K4TA 3HVWA 4AHVA 2IM1A 5DG7A 3LAMA 4CJWA 1BI4B 4NLRA 1EP4A 4Q5VA 3KLEB 4FJ7A 1TVRA 4CJRA 4B9UA 1QTMA 2GIQA 3V6KA 1L3SA 4DSLA 1LAVA 1VRUB 1A5WA 2RKIA 4H8KA 1RBRA 4KTWA 3QZ7A 2F8EX 1HYSA 4MKBA 4M45A 2FVRA 3SV4A 1WSGA 3VQ8A 4PWDB 1RT5A 2X6NA 1LWEB 4GC6A 3ZT0A 1D8YA 2HAIA 4JV0A 2QXFA 3SUQA 2C2DA 1REVA 3ZCMA 3RWUA 1JLFB 3OYDA 3OS0A 5KFDA 1RT7A 1KLMB 3HPHA 3UPFA 3DRSA 3DM2A 4FM2A 3T5KA 2HHVA 1OS5A 1MU2B 1RT3B 4W5NA 1HNVA 3H4BA 2WK4A 3T5HA 4RW6B 3H5UA 4DL7A 4CEDA 1DTTB 3M8PB 3VQSA 3M8QA 4DQIA 4OPJA 2DY4A 5L9XA 4KHSA 1SUQA 4DLEA 4ID1A 2ATLA 1S6QA 4FM1A 1BQMB 4B8AB 3CQ8A 2ZD1A 3AVIA 4ECWA 3MEEB 4Z4EA 3PV8A 2E9TA 4I9QA 4YR2A 4J9QA 4JS4A 2OZSA 4FJ9A 4DL5A 4OGCA 2Q3SA 2Z1HA 3LPUA 4FBUA 3ITHB 1SL1A 4RNFA 3U3YA 3GILA 3IRXA 1S0NA 3S9HA 1S1XB 3NAIA 2ILYA 3A2FA 1JXBA 3QETA 5SWMA 2W42A 1FK9A 3CJ0A 4KFBA 1WSIA 5J2QB 1UAXA 1S1TA 2FVPA 5SZTA 2IJNA 3AVGA 3TAGA 2UVVA 2ASLA 3ULDA 4CFAA 2YNFB 3CFRA 1JKHB 3L2RA 4RW7A 4U6PA 1I6JA 4B8CA 3K5LA 3IG1A 3VQAA 3AVLA 4IG3A 3LP3A 4W5OA 4DL2A 3CJ5A 3V9UA 3E01A 1TKTA 1HRHA 4LQ3A 3M8RA 2KTQA 3DLEA 3QEPA 1NJZA 1NK7A 1TL1A 3MF5A 3BQ2A 3HK2A 2XY8A 3D5MA 2QE5A 3OL6A 4J9SA 3VQ4A 3EPGA 3ASMA 3H4DA 4I7FB 3TAMA 4ECZA 1DTQA 4JLHA 3NGDA 3PJWA 4HTUA 1RDRA 1K1SA 4EO8A 5F8IA 3PX4A 1BIUA 1HYVA 1DTQB 2XRIA 1S97A 1K6YA 4URSA 4DF8A 2WOMB 1JLCB 2D0CA 5EWEA 1S1XA 1IKVB 1TAQA 1SL2A 4NLSA 3HL8A 4DTXA 3AVNA 5C5JA 4PQUA 3QERA 4O0JA 4NCBA 3K2PA 2GIRA 4CJTA 3CFOA 5CYMA 5D3GA 4NRTA 4CESA 3L2UA 4BDPA 3I5CA 3K58A 3S3MA 4OLBA 1JKHA 5KFVA 1EX4A 1QS4A 2QKKA 1RTDA 3VQ6A 3IN5A 3VQQA 1SUQB 4FLVA 2RDJA 4KFBB 4K4UA 2ZE2B 1S1UA 5F8LA 3BSOA 1W9HA 1ZBIA 4E19A 1L3VA 4K4VA 4CGDA 3P1GA 3DDKA 1J5OA 3U6FA 1U47A 1WSHA 1IO2A 4QW8A 4CGFA 2IDOA 2W7PA 4J2BA 1RT4A 4PUOB 4DL3A 2X74A 3AA5X 4FLTA 4YR3A 4Q44A 2B5JA 1IH7A 1KLMA 3SI8A 4B9SA 3KKRA 1S9FA 4J2DA 3OJUA 4LD0A 4H4OB 4J9RA 1S6QB 1C1BB 5C24B 5KFMA 4Z4GA 1HNIA 3WNHA 2O4IA 4F2SA 1RT1A 2YNIA 5KFSA 4Z4FA 2UUWA 4XIUA 5HRNA 1TKXB 3FQLA 4N47A 4FJLA 3IAYA 3Q8QB 1VSEA 2OPSB 4K4ZA 4H54A 4IBNA 4KHWA 1NHUA 3ZSYA 4MK8A 1X9WA 2YNHA 3NF6A 4M3YA 2WCXA 3AVCA 4NLGA 4ZP8A 3I0RA 1BIZA 4FJHA 3QO9B 5F8NA 3OL7A 4FJXA 4TN2A 4I2PB 4ELUA 4CERA 4KTQA 3EPIA 5K14B 4R5PB 4K4XA 2FLLA 1TGOA 4B08A 3OJSA 4KPYA 3TAMB 2F96A 4J9KA 3SUNA 4ED2A 5EWFA 3M9OB 1NK6A 3HVTA 3LAKA 3TI0A 1U45A 2R2SA 4W5QA 2YHBA 2FJVA 2EHGA 3NDKA 3NGZA 3DLKB 1TKZA 5KG6A 1XC9A 1JLQA 4F4YA 3PUFA 2OPSA 1RTHB 3FFIB 4EBDA 5FDLA 2XI2A 5F8JA 2FLNA 1LWEA 3UR0A 4Y1DA 4CEEA 3DLKA 3KLGB 4CF0A 3NE6A 4E7LA 2IJFA 4RW7B 1EETA 4YNQA 1SKRA 3DLGA 1QQCA 3H08A 3CJ2A 1WSFA 3FFIA 2W7OA 4ZPCA 3V4IA 1L3UA 3BGRB 3V1RA 1RTJB 4F8RA 1S9GA 4O55A 4PY5A 5KFOA 1HYZA 4EZ9A 3VA0A 4KB0A 3NAEA 1R0AB 1B9DA 1FKPA 3HPGA 4CJ5A 3U3GA 1C1CB 3NGIA 4IFVB 1D9DA 3O4QA 1S9GB 1TK5A 1TL3B 3T19A 1TK8A 4FLUA 1NOYA 3T5JA 1FKPB 1KHVA 4CK2A 2P5OA 3HT3A 4LSNA 3VQDA 4CCHA 4ED8A 2YNIB 2OPPA 5J2PB 4KRFA 2V4QA 5HP1B 3ALYA 3HPOA 1UWBB 1J9AA 4BE2A 2PY5A 1JLEA 1YVUA 4KHUA 3PW5A 3TQ1A 3GQCA 5EU7A 4FJIA 2OPPB 1S4FA 4OKJA 1T05A 1NKCA 2YKMA 5JS2A 5KFEA 3EYZA 3DRRA 3NF8A 4C8LA 3G0ZA 1JXEA 1KHWA 5KTQA 3SQ1A 4ZVGA 5K14A 3K57A 3MTKA 3KIOA 1ZETA 4NLDA 4NCAA 4B3OB 3KK3B 1HQUA 4KE5A 1J53A 4CEFA 2KQ2A 3GV7B 3LZIA 2B5JB 3SJJA 5CZ1A 1ZBLA 3SUPA 4AHUA 4RW4A 3KJVA 4OPKA 4M42A 1RTJA 1C2PA 3PR4A 4CHPA 4YR0A 3QESA 1RA7A 2DFHA 3AO2A 4DQSA 2UVRA 3QO9A 1YTAA 3I0RB 3AO5A 4ICLA 4ED3A 1W0HA 1C1AA 3BJYA 4DWIA 2A1RA 1HARA 4WFYA 3CDUA 4E7IA 1HYSB 5KG0A 2RKIB 3Q8PB 3RMCA 4RZRA 4E0DA 3VQ9A 1NK8A 3ICLA 4O4GB 5DQGA 3V81B 3RB0A 5C42A 4E7JA 5CYQB 4IQXA 1LWFA 5I42B 4C8KA 5KFWA 4QCLA 5KGXA 3QGIA 2W9BB 2JGUA 1LW2A 2C2RA 2UVWA 5JUMA 3RMAA 5F8GA 2FLPA 4HVJA 1S1TB 4C8NA 3NF9A 3LP1B 4FCYA 3MECA 5DQHA 2AX0A 2QV6A 4GW6A 2R7YA 1Q9YA 1HQUB 4GVMA 3PR5B 5KFKA 4B9MA 4CJPA 3LP1A 3EY1A 4G3IA 4TYBA 1NHVA 4DEZA 2HHXA 4N5SA 2ITGA 4ZVFA 1IKWB 4J9LA 3OVNA 2W8LA 2D0AA 4TYAA 4E1MA 4CF8A 3RRHA 3CM6A 1T8EA 2I5JA 2CJQA 3OYCA 2WHOA 5HP1A 1WNSA 4WFXA 1RT2A 3IG1B 4O3SA 5J2NB 5KFNA 3HXMA 2BANB 4MH8A 3MXIA 4DSJA 1RDDA 4AHCA 4CHYA 4F4ZA 1B9FA 3JYTA 3LP0A 5KT3A 4M95A 4KHYA 4TXSA 3M8SA 2ASDA 5KI6A 1DLOB 2F8TA 1JX4A 4IFYB 2BANA 4J9PA 3MEDA 1GOCA 5J2MA 1ZBUA 1S48A 5DQIA 3TAEA 1NKEA 2FJWA 2XCAA 2VWJA 4ED1A 3QIDA 4F50A 2HB5A 4NLYA 4HCBA 5KFHA 2KW4A 4KHQA 4CJEA 4RU9A 1TKTB 4ZVEA 4MIAA 4YFUA 2C2EA 2C22A 4M3XA 1KFSA 4O3PA 1LWFB 2GC8A 3V9WA 1FKOB 5C42B 3KLIB 2BQ3A 1S1WB 4GC7A 3BDPA 1S9EB 4M3ZA 4O3NA 3IS9A 3TANA 1HNVB 2IS3A 1C0UA 1JLQB 3KK2B 4IKFA 3CM5A 4C8OA 3GV8B 1VSDA 3QGHA 3MAQA 1J54A 5HLFA 3AO3A 1F21A 4C8MA 4DTNA 4CJVA 4RG8A 4ZTJA 3OYEA 2AJQA 3RR7A 4FK0A 4H4MA 1LW0B 1NK0A 2B6AA 2PZSA 4HHTA 1C0TA 3LDSA 2YKNB 3PX0A 4ZPBA 4IR1A 3KOAA 3L3UA 1S1VA 3SPYA 1QUVA 3WNFA 2R2UA 1JXLA 3VA3A 2AGOA 4KHNA 3DLGB 3GYNA 2IC3A 4IH5A 5CYQA 4I9LA 4IOBA 1N48A 4N56A 3MEEA 1C6VA 4E7KA 4ICLB 5HBMB 3DI6A 1S10A 2EX3A 3RB6A 3BGRA 3H2LA 3TR8A 4CFDA 4N76A 4DSFA 1QSYA 2XGQA 4EP4A 3AO1A 1XR7A 3H5XA 4EYHB 2G8VA 2KFZA 3KLFA 4FJMA 3K5MA 3QYYA 1S6PB 1C1CA 3ZSWA 4DFKA 3KJVB 1S5JA 2IAJB 5FRMA 4L8RB 4IRCA 1RTIB 3RR8A 4DSKA 1MMLA 3HYFA 1RT4B 5KG2A 5KFZA 4MK7A 4WXWA 1X9SA 4CIFA 4DTMA 1TV6A 4QWEA 3MFHA 2BQRA 2FBVA 3QLHA 5I3UB 4I2QB 4M3RA 3C6UA 2ASJA 4ZHRA 4DQPA 2HVHA 4I2PA 1ZTWA 4CEQA 5KT4A 4FLWA 4WYLA 4R8UA 4DMNA 2XHBA 3OHBA 4WXOA 2E6MA 3PW2A 4ED6A 4RNOA 3MR2A 3S3NA 2A1SA 4O44A 2W8KA 1RDAA 2KFNA 3QINA 4CK3A 4JUZA 5KFIA 1HPZA 3DOKA 3SI6A 3MEGA 3ZT2A 4PQUB 3KLHA 3IGVA 1NKBA 2GV9A 3CWJA 4DL6A 1EP4B 4IFVA 1GOBA 2OPQB 2FBTA 1IG9A 4NLPA 2UUTA 3OSPA 4CJQA 4HCCA 3DRSB 3E51A 2WOMA 4F3TA 4O3QA 4DQQA 2OH2A 3VQPA 2GBZA 1S6PA 1NOZA 4CJLA 4BE0A 3N6MA 4PA1A 4WFZA 1EXQA 1CZBA 1I3AA 3HVRA 1VRTA 2BRLA 5T14A 3JSMA 4B9TA 5KFCA 1RT1B 4IFYA 3ZSXA 3KLGA 3S3OA 1YVFA 1HNIB 2BRKA 4W5RA 4NYFA 3AA2A 4ECXA 2OPRA 4QWCA 4WZQA 3O3FA 3HP9A 5KFBA 2Y1JA 1BCOA 4DTJA 1EETB 5KGWA 2G8UA 2VG5B 5HLFB 3I8DA 1JLAB 4KO0B 3BSAA 2HNDB 3DYAA 1W25A 3SQ2A 4ID5B 5DLGA 4FS1A 4FYDA 1ASWA 4BDYA 3Q8RB 4CF1A 3NH0A 1TQLA 5F8HA 3MECB 5L1JA 3V9SA 4E7HA 2YV0X 1FK9B 4LSLB 4CFBA 4KI6A 1KVAA 3BREA 2ZQBA 4DU4A 4QWAA 2B4JA 4KB1A 3GIIA 4RW9B 5L1LA 4RNMA 1JLGA 1U4BA 3KLIA 4CGHA 3GIJA 2XGPA 2WONB 3SV3A 3KD1E 1N5YA 1S0OA 4KHMA 4R0EA 2I5JB 2OYQA 1C0UB 3ZT1A 4AHTA 4Y2AA 5E41A 4Y3CA 4KREA 4KHRA 4OVLA 3F73A 3CO9A 3O3GA 4KKOB 2WONA 5F8MA 3OHAA 4ELVA 4DFMA 3CG7A 4FJKA 4EO6A 3B6OA 1T03A 1C1BA 3TVKA 5DG8A 2R8GA 3E01B 3DLHA 1QE1A 1VSJA 2HNDA 3DYAB 4WE1A 1BCMA 1QSLA 5KT7A 4ECRA 3DM2B 1TKDA 1QE1B 3V1QA 3AVHA 3KLVA 3NL0A 3JYTB 2OPRB 4CIEA 3SQ0A 4J2EA 3FRZA 1WSEA 2ZE2A 4ECSA 4ZTFA 3ZT4A 4LSLA 2FVCA 3CVKA 3RMBA 3NAHA 5D3GB 4RNHA 3C94A 2YKMB 4KKOA 4IH7A 1Z4UA 3OL8A 1XHZA 3V81A 2J6SA 3C95A 4CJUA 2JC1A 3AO4A 4TQSA 4QAGA 2W9BA 5FROA 2LSNA 2AGPA 4K4YA 4K4WA 4B9VA 4M3TA 5J2PA 2ILZA 4CJKA 2AQ4A 4NLVA 4NYZA 1BI4A 1RAJA 4OKEA 3EZ5A 4FJ8A 2AU0A 1SH0A 1JLEB 4DF4A 1RYSA 2QK9A 2XY6A 5KFUA 1SH2A 2C28A 4URQU 1TAUA 3ISND 3NBPA 2R8JA 3MR5A 1JLCA 4CEAA 4FLXA 4OGEA 1SH3A 1XHXA 2E6LA 3ZSVA 4FK2A 3SZ2A 1RBSA 4J9NA 4JS5A 3PO5A 4B3OA 5KRSA 4DLGA 1JLFA 4NCGB 3I5AA 4IKAA 1VSFA 1BQNA 2HHQA 1IKXB 4ECQA 5KRTA 3VQEA 2IA6A 4K50A 2YNGA 2XI3A 3MXJA 5JXSA 4ZMMA 4DG1A 3KLHB 1JIHA 2ETJA 3AVBA 5KFPA 3N6NA 2YNGB 4ECTA 3CIZA 1VSIA 5HRSA 3OYNA 4Z4CA 2VG5A 2WB4A 1CZ9A 1RT7B 3IRXB 2AGQA 5FDLB 4DU3A 3P5JA 4YMEA 2OA8A 4R5PA 3RB3A 1TL3A 4NCGA 2BQUA 5F9NA 1C0MA 3TAFA 1HMVA 5T7BA 5J1EA 3C6UB 2OZMA 2JC0A 1RT5B 2Z1GA 1RTIA 4IH6A 3FQKA 4DTUA 1S0MA 1WAFA 3ZT3A 1ASVA 1HMVB 2D3ZA 3HM9A 4M41A 3L2WA 2ALZA 5L1IA 4ELTA 4JV1A 3NCIA 2CKWA 3H40A 3DI6B 1K1QA 4RW8B 3V6DB 4CHOA 4IG0A 5KFXA 4Z4IA 5KG3A 3PO4A 1RDCA 4CF2A 3OYBA 1N4LA 5KG1A 3KHRA 2D5RA 3OLBA 1D1UA 4ECUA 4ZHRB 3PW7A 2FVSA 1RCHA 3D28A 4FZZA 5EUHA 2Z1IA 3PW0A 1NK4A 1I39A 1U09A 3ZSOA 4LH5A 3TAPA 3RBEA 1D5AA 3ISNC 5KFJA 5DG9A 2O4GA 3AV9A 3V9XA 2HHTA 2D41A 2E4LA 3MR6A 5KFAA 4FM0A 4O0IA 3P83D 3KHHA 4B9NA 4E89A 5KFGA 1T3NA 5DLFA 2FC0A 3PZPA 1Q8IA 5HROA 1DLOA 2XWYA 4BWMA 1RTHA 3RAXA 4MFBB 3OLAA 3ZSRA 3KLEA 5HBMA 3H5YA 2RF2A 5J2MB 4DTOA 2JLEA 1TP7A 3NMAA 3HVTB 1CSJA 3AA3A 4M3WA 3N6LA 4AH9A 4H4OA 1N6QB 1IM4A 1D9FA 2RN2A 4U7CA 3KMSA 3VN5A 4MK9A 1FKOA 3SUOA 4Y2CA 4Q45A 4TY8B 3QEIA 1QHTA 2UVUA 3DMJB 1RDBA 1QSSA 3RTVA 3SFGA 4NRUA 1U49A 1RILA 2WRMA 4NLQA 1KVBA 2P5GA 4XO0A 4AHRA 3V6JA 1VSMA 2XY7A 3LPTA 3PX6A 4QW9A 1VK0A 5EDWA 2G8IA 3H59A 4NLWA 2FJXA 4DQRA 3NBPB 4F2RA 4FBTA 3KHLA 3V6HA 3D45A 4FK4A 3IS9B 3KMQA 1WLJA 4CJFA 4ID5A 1L3TA 1D0EA 1T03B 4CK1A 2BE2A 3KD5E 2JEJA 1NJYA 4WZMA 5I42A 1RT2B 2BR0A 4DS5A 2Y1IA 3QEVA 2G8KA 3FSIA 3BSCA 4IRDA 1RTDB 4CJSA 2P1JA 1JLBA 4M94A 3L3VA 4KB7A 1RYRA 3THVA 2JEGA 4AHSA 1RBTA 1X1PA 4DTSA 3HVAA 4K4SA 4OJRA 3V9ZA 4IG3B 5CYMB 2IBKA 1T94A 3M9NB 3VQ7A 2VG7B 2R8KA 3OS2A 2KZZA 4IDKA 3QNNA 3AA4A 1Z25A 3KKSA 3OYJA 4JV2A 1O1WA 5EWGA 1IKVA 4J9OA 3LWLA 2V9WA 1GOAA 1ASUA 3HKWA 4I7FA 4XPEA 2FBYA 4EBCA 4FZXC 2RDIA 4WE1B 3CFPA 1U48A 1KLNA 4RW9A 3RB4A 3OYLA 4O4GA 4B9LA 1N6QA 1BQMA 3DLEB 2HMIA 1TK0A 3O4NA 4EYIB 3RAQA 2HNZA 4TSXA 4LQ9A 3GV5B 2DTUA 3WNGA 2IMWP 1KVCA 4O5BA 3MXMA 1Z26A 3OS1A 3KTQA 4Q8FA 2VG6A 3BQ0A 2VA2A 2BGGA 1RBVA 2HMIB 2O5DA 4W5TA 4R8UB 3BSNA 1UWBA 3PY8A 1IKWA 3AVFA 4BE1A 3G6VA 3D0PA 4KO0A 3M8QB 1JL2A 3HO1A 3OYGA 2B43A 1FXXA 4IR9A 3Q8SB 4CIGA 5DGBA 3G6YA 1WNEA 4FLYA 1MU2A 1RT3A 2HW3A 1TL1B 3OYIA 4HYKA 3FDSA 4ZPAA 4FW2A 5CY4A 4ZPDA 2VG7A 2J6TA 4FJ5A 5KT5A 3CYMA 4CEZA 3KK1B 1T7PA 1R0AA 3QIPA 3RBDA 1JLAA 4BACA 2D7SA 4FS2A 3UDLA 4DU1A 4FLZA 5FRNA 3MEGB 4O3RA 3NGYA 3DRPA 4NLXA 3QEXA 3SNNA 4PWDA 3DLRA 1BHLA 3LWMA 2J6UA 3V6DA 4RW6A 3GIMA 3DOLB 3AVMA 3AVAA 3DRPB 5KFQA 1SKWA 3PHEA 3ITHA 5KFYA 1UOCA 1RA6A 3QGGA 3OSNA 2YHAA 4CJ4A 3LANA 4WYWA 2HNYA 1VSLA 4F3OA 4ED7A 4NZ0A 3F9KA 5I3UA 3JSMB 5DK5A 3UIQA 1SV5A 2E9RX 1L5UA 2OPQA 5F9LA 4NLOA 2ATQA 5KFTA 1Q9XA 1ZTTA 3KHGA 1IKYA 4Q0BA 4ECVA 3V1OA 3DMJA 1XR6A 3LZJA 4HUGA 4O3OA 3CDEA 4RNNA 3M9MB 1YTUA 1DTTA 4XPCA 4N41A 4DL4A 3AVKA 4DFPA 3TABA 2Z1JA 4GMJB 1QAJA 4LH4A 3OYMA 1IKYB 4Q0BB 5DGAA 3C6TA 3LALA 1VRUA 3TAQA 3DOKB 1CXQA 1A5XA 3SPZA 3DOLA 2AX1A 1TKXA 4FVMA 4FW1A 4KV8B 4LSNB 1JL1A 1ZBFA 2YNHB 1HQEB 1NJWA 2IC3B 4CHNA 1NNDA 3HHKA 4K8ZA 1HJRA 5C24A 3T1AA 3UQSA 3G10A 2G8HA 1S1WA 4CHQA 2IGIA 3SQ4A 2RPIA 3EZUA 3OYHA 2JEFA 2IAJA 3MFIA 1BQNB 2HNYB 4KSEB 2NUBA 3LP0B 1A5VA 4IDKB 4DSIA 2HHSA 4BWJA 1KRPA 2W9CA 5J1EB 1C0TB 4J2AA 4J9MA 2FVQA 3CJ3A 2B6AB 1RT6B 3WNEA 5HRRA 3I0SA 4CGJA 1EKEA 4QOZB 1WSJA 1HPZB 4KAIA 4TY9A 4ED0A 3T3FA 4RUAA 2HVIA 1CXUA 4FZYA 4EEYA 4Q8EA 2HWHA 4UQGA 4IG0B 3G6XA 2QKBA 4F4XA 4KI4A 4AILC 1NJXA 3G86A 3PVXA 4ZP6A 1UA0A 1LW0A 4DSEA 4DG1B 2I1RA 1S9EA 1Y97A 4FJGA 2AWZA 3NF7A 3ZSQA 4FJJA 3LP2A 4I2QA 3QIPB 4CE9A 3QLHB 3KK1A 1VSHA 4PUOA 3L2VA 4E3SA 1IKXA 4CHZA 3H98A 2HWIA 2P51A 4CEBA 1KCFA
chains in the Genus database with same CATH superfamily
1N32K 1VMBA 1Q81T 1BHNA 1KTQA 3M2VB 4DMZA 4ZVHA 3QJPA 2M3DA 2K7JA 2R2RA 2ITMA 1TMMA 2KVQE 1BY9A 3DKDA 2E5JA 1H72C 3MR3A 2GZOA 2X78A 1VHXA 3CCMN 1U1PA 2UV8A 2E9ZA 4HTIA 1FHTA 4KAZA 4ES2A 1XMOF 2GAHC 4LBHA 1BWEA 4NLUA 1UWAA 2QL7B 4X62F 1RQ0A 2WFBA 4Q43A 4X66J 1R31A 2AD9A 2YKNA 3KKFA 1QUPA 2CPJA 4FVCA 2IM0A 5JMVA 1N8RT 2H65B 3CW2C 5KFLA 4ZIVA 1AB8A 2D0BA 3AY9A 3EDQB 4BCAA 4CYUB 2HHUA 2HWTA 1S1UB 3R2CJ 3UCGA 4IZ9A 4OQJA 4H0XB 2XS5A 2HHWA 3GYGA 3H0PA 1WAJA 3VQCA 2W1BA 2ZD1B 4OZ0A 5I4MA 3TPQA 5BJRA 2OAUA 3VQ5A 1FJGK 3AY0A 1XI1A 4QPXA 1QJHA 3NGSA 3J7AN 2IVNA 2GMHA 2KZMA 3OYFA 2IM2A 2FHJA 3LGNA 4NLBA 2CGJA 5ETPA 4IEIA 2QI2A 4DR3F 2OFHX 3AHPA 1RBUA 3TSQA 3D2FA 1KSPA 2ASPA 2P6TA 3T5LA 2B9EA 3WHIA 4X65J 2DT9A 2NXEA 2ZVIA 4EP5A 2RF2B 3P49B 3DLBA 3DWLA 2VOOA 2HOEA 5A0YB 2D0OA 1GX6A 2R4FA 1CQMA 2A18A 3UN3A 3UKRA 4FJNA 4X62J 5LJ5Y 1HQEA 1YT3A 2B9YA 4P74A 1RNHA 4JRQA 4DR7F 1U6ZA 1BISA 4LY7A 2AYBA 4Y34A 1Y64A 3AVJA 4UOCA 2ERRA 2HGMA 2HZCA 4BROA 4MFBA 3MK6A 5HJYA 1FKAF 1GAOA 4EMDA 5D0EA 3I33A 3L2QA 1TKZB 1WKKA 4CF9A 5KFFA 3NH2A 2R8HA 4KV8A 2W40A 4BLGA 3CJKA 2J9EA 4O4RA 2CPFA 5HROB 1F2GA 2GV1A 1LV5A 5CHIA 3I5BA 2X6SA 1E6VA 4ENOA 5MLCV 3LP2B 5L1KA 3CB4A 2AP6A 1WN7A 3NMRA 4MO4A 2G8FA 5KT2A 4TQRA 4WWSA 4A8SA 1KD1T 2VQEF 1FJ7A 1ACMB 4Y2MA 1Q7LB 4NLRA 1EP4A 1TVRA 1S3XA 1ZC6A 1RWNB 2DHXA 1B3TA 3C66A 4DSLA 1LAVA 5D0RA 2ZBQA 4M1KA 2F8EX 1HYSA 1WC1A 3AGKA 3DXMB 4B9QA 3PEJA 3VQ8A 5M1QA 4BRAA 4GC6A 1AUDA 2BA9A 3M32B 2LDYA 3SUQA 3U1NA 2XYPB 2E5LK 1REVA 3ZCMA 1XTZA 3OS0A 1M5KC 1HNXK 2NYIA 4C23A 1RT7A 1KLMB 4IJAA 2WZ1A 3T1YJ 4W5NA 1HNVA 1HBNA 3HRGA 3T5HA 3QJJA 4EIAA 4DL7A 3M8PB 3VQSA 4MJKA 3DXMA 2QRRA 3I87A 4QR2A 3BN7A 4WFBL 1S6QA 3CQ8A 1KQFB 4ISEA 2XULA 1R6YA 4I68A 3AVIA 4DUZJ 2KVIA 4Z4EA 3PCOB 3PV8A 4I9QA 5EOYA 3I9V9 3VTIA 3PNIA 5F2RA 4FJ9A 1VQ7S 3LDPA 3PFEA 1DT9A 1TUUA 3GILA 3NAIA 4P73A 4GKJF 1T9VA 1CS4A 4B3TJ 3CJ0A 4JI2K 3IKMA 5J2QB 2EFQA 1S1TA 2FVPA 1MWYA 2FYXA 3V4MA 2I7NA 2IJNA 3VVUA 1WHXA 3IWNC 3QSYB 4CFAA 1JKHB 4RW7A 4NLCA 3EMTA 1RCXB 1H0HB 3VQAA 1EARA 4IG3A 2EBGA 2XBPA 3AA9A 4EWTA 2XS2A 5CQGA 4H5RA 1TKTA 1HRHA 3DLEA 1CJKB 3QEPA 3NCRA 1NK7A 1TL1A 3BQ2A 2RIJA 4M5IA 3CF5L 5DS7A 2KU7A 4EFHA 3OL6A 2HK3A 3GG0A 1YWXA 3ASMA 5AQZA 4PZVA 1Q82T 5A8RB 2HS3A 1CBKA 4TVAB 5GADI 4HTUA 3POTB 2ZWPA 3ZYYX 1DTQB 2MQMA 2XRIA 1S97A 1K6YA 2FJEB 4DF8A 1QZ5A 4JHDB 3MCMA 5B7WA 2C3YA 3MM8A 3R7NB 5EWEA 1PYOB 4B02A 2W4DA 1WC3A 2K06A 3TZWA 1YJNS 4JI8K 4HEA9 2ZH3A 4NYOA 4K42A 2CQ4A 1U7LA 3L7PA 3O6QA 4FYVB 4LSZB 4NRTA 3L2UA 3I5CA 1ZZNA 3TJ9A 4Y0WA 2BM0A 1VQPN 2GHPA 3NOCA 4M5HA 1EX4A 3R6GB 2QKKA 1RTDA 1VQ8S 1NHKL 2E1AA 3W66A 4FLVA 2WSEC 3QGPA 4LIRA 3HM8A 3NGTA 1S1UA 4JKHA 1PJ6A 1ZBIA 1L3VA 3G71N 2MY8A 3DDKA 1TMJA 3U6FA 1IO2A 4QW8A 1N5QA 4JKBA 2IDOA 2CQ1A 1XK8A 2HQFA 2X74A 4XEIA 3SI8A 2BOAA 3GCXP 5AJ3F 1NDCA 1RHQB 3PYEA 4J2DA 5SUHA 4LBIA 2A0FB 1HI1A 2ZZMA 1HNIA 4WFBQ 4F2SA 2GQCA 1RT1A 5KFSA 4Z4FA 4C3MA 3V5RA 5HRNA 2CWKA 4N47A 2G1HA 4OLOA 4IBNA 2DGXA 3RYLA 3SCKE 5A8WA 3ZO7A 2MZSA 2CUYA 2VC1A 5EX5A 1Q18A 4ZCIA 3K0SA 2CQ0A 4OJ3A 3AVCA 3I0RA 5B0AA 4UOHA 5F41A 4CM0A 5F8NA 5GADP 4FJXA 3CC4N 2KJVA 4GY2B 4F0KA 4KTQA 1QTNB 4K4XA 1TGOA 3OJSA 2W2NP 4LF8K 3TAMB 2F96A 3IM9A 2JFDA 5D6GA 3HVTA 2CZ4A 3IA0A 3PLAA 5GAHP 2CH5A 1TKZA 5GAEU 2APOA 1M5VC 3PUFA 2OPSA 1M1KT 3M05A 3KFWX 2IDEA 3EEQA 4C11B 1LWEA 1P1TA 4CEEA 1T0TV 4E7LA 4LF7J 3UW1A 4A2AA 2YX4A 1RHRB 3NP5A 4QIEA 2H5EA 5MLCQ 1OY8A 4U95A 1LNQA 3V4IA 2JNJA 5HATA 1L3UA 1S79A 2RD5C 4J90A 2KJWA 4F8RA 3W5XA 4WF9L 1B9DA 4KRWA 1KC8O 3HFZB 3HPGA 2QLFB 3U3GA 4JI4J 5CABA 4DUYF 5LMNF 1S9GB 1CZAN 2DTJA 2RQMA 3CJSA 3P38A 4RLEA 1NOYA 2OUGA 3L7UA 4LR9A 4LSNA 4CCHA 4ED8A 2NCKL 1U1QA 3JSRA 4EI2A 4KRFA 1JXVA 3L9ZA 2C2ZB 2OEMA 5HP1B 3ALYA 1UWBB 2QWNA 4B3MJ 3QICA 2LYVA 2E5GA 1YLXA 4NA1A 4QIVA 4ANEA 1URRA 4OKJA 1NKCA 4DX8H 3GMGA 4B1VA 2DO4A 1DGKN 2O8BB 5HO4A 1WDDA 5FPNA 1RAAB 3A8JA 1HFEL 1HQUA 3EGZA 4NXNF 1B7YB 3JQMA 5CZ1A 1L3KA 1U2CA 1FF2A 4OPKA 1UL3A 2A6AA 2DRBA 1RA7A 2DFHA 4P6QA 1RHUB 3UI3A 2UVRA 3SBMA 1NAQA 1YTAA 4ICLA 2ZJQQ 3K17A 1W0HA 3P5BP 4ED3A 1U8WA 3CDUA 4YN3B 3VAIA 1XMQK 4E7IA 1IN0A 2RKIB 5CXTA 4D3GA 2I8EA 4UOGA 4NL5A 1RACB 1PC4A 4G1PA 3IBFB 1FDAA 3B78A 5DQGA 4OZLA 3RB0A 3A8KA 5CYQB 1WF1A 5I42B 3GWCA 3MI7X 3EZOA 3QGIA 1JK9B 2W9BB 2ZITA 2PAVA 4RWWA 2LXUA 5ETKA 4DV6J 2UVWA 2KT5A 4IQMA 5JUMA 3MMJA 3QDKA 2FLPA 4PKHA 2LDIA 2E7VA 1BG3A 2B56A 3MMBB 2V2VA 2QV6A 5BREA 4L74A 2ZM6K 2QA2A 4ZOSA 5KFKA 3R3LA 3A5MC 1BE4A 1FEEA 1UKUA 5M2RA 3WDOA 3PFOA 3BPSP 4OZ5A 4DEZA 3CPEA 4KH1B 3TP2A 5DZ6A 2Z2ZA 1V3SA 1WSRA 1Q1KA 3ATUA 3OVNA 2W8LA 2D0AA 4F02A 1YJ9N 3ELHA 4E1MA 3OYCA 1F5BA 2CGLA 4LFCK 4WFXA 3RUBL 5CYJA 4O3SA 5J2NB 3H45C 7FDRA 2HQ3A 5CD4A 3CCUS 2DGVA 4MH8A 2XMWA 4M7XA 5C2CA 1B9FA 4KHYA 4C1NI 1YVNA 4A8OA 1SJQA 2ACYA 1FA0A 4JYAJ 4J9PA 2XMVA 3MEDA 1PYSB 4JI1J 1GOCA 4LF9J 4ILGB 4QBUA 5DM7Q 2XCAA 3Q7BA 4F25A 4RJVA 4NLYA 4YOXA 4UY8O 4RUBA 4HCBA 1N5SA 2C42A 3LPEA 1TKTB 5B0EA 4RUHA 4MIAA 4YFUA 1IG8A 1FRKA 1YSJA 1NB7A 2GC8A 3VGSA 5AE2A 2HBKA 5C42B 3ZZPA 1GMUA 3I31A 2LLZA 1B64A 1TZ0A 4O3NA 1RAEB 4DN9A 3ENHA 1X4CA 3P4UB 2E5HA 4IKFA 2B9XA 1X0PA 3CM5A 5L8RC 4BRDA 2ZJQL 3QGHA 3R5BA 3AO3A 3KJNB 4EGLA 5A6PA 1UVNA 4BR0A 4DTNA 3J7ZO 2R7VA 2XNRA 1KP6A 2HEKA 4KGZB 2V51B 3AGRA 3J81Y 1AXQA 1LW0B 1IWAA 1U02A 2O8BA 5AQHA 4MO5A 1PC5A 3LDSA 2RH3A 3GDQA 1NGFA 4IR1A 3SMSA 1IBKF 3MN6A 3SSRA 5M2PA 3DLGB 3R1LA 2KXHA 1O51A 4IH5A 1GXTA 4OPAA 3RG6A 4KGXB 4DN0A 1PBAA 1XBWA 1WHVA 3DI6A 2EX3A 3RB6A 4DV4K 1XR7A 3H5XA 4EYHB 2KFZA 1OH8A 3K5MA 3TTFA 3QYYA 3CCRN 4MKYA 3ZSWA 1S5JA 2R9LA 3RR8A 3DXKB 5KFZA 2F4VK 2NPIA 1X9SA 1RP5A 4QWEA 3WT0A 4NE9C 2MZTA 1G99A 3QLHA 5I3UB 1H7XA 3UCUP 4I2QB 2A6MA 3C6UA 1FNMA 4BY9C 1T3VA 2FF3B 3PRDA 3MX2A 4I2PA 4Y2IA 3F56A 2E7XA 4CEQA 3FVYA 4CZMA 1YAGA 4FLWA 3ETMA 2O8EB 3OHBA 2UXBF 2RUSA 4DL0C 2LQ9A 3S3NA 4X4VA 2W8KA 1RDAA 2WVDA 2DYAA 4FYWB 1VCTA 5KFIA 1YX2A 3ZT2A 4PQUB 3IGVA 2PI4A 4UY8T 1YF5L 4LF5F 3E51A 4GVEA 3C7NA 2WOMA 3CJ1A 4F3TA 1HWJA 2QWLA 4CLYA 3EL2A 3TVYA 3C0BA 3VQPA 2MLZA 1NOZA 3CQYA 4BE0A 2N7CA 3DXBA 3N6MA 4PA1A 4WFZA 2MGZB 1EXQA 3CCJN 3BYPA 1CZBA 2OJ3A 2ZUAA 2LQBA 1TUYA 1TELA 4C3LA 4YY3K 2V2QA 3CCTA 2SXLA 5KFCA 4IFYA 3KLGA 2NXJA 1YVFA 3ENAA 1HNIB 2BRKA 1DZ5A 2OPRA 4JYAF 1HWKA 2R7WA 2HK2A 3O1WA 2D9OA 3I8DA 4KO0B 1W25A 2XSFA 4KJIA 2UV8G 3PG9A 4ILHA 5ETMA 3A5OC 5KOWA 4YOUA 3Q8RB 4CF1A 5JMNA 3D6MB 1HBOB 3VMFB 1LCUA 5D77A 3HI0A 1R6VA 1BD6A 2YV0X 3BREA 4LVOP 1VISA 2W2MP 5ADXA 1EWRA 3GIIA 2W2QP 2NSCA 1G2EA 1WTBA 2BJEA 2NREA 4N77A 4JKDA 3CGIA 1JLGA 3ZZOA 3KLIA 1OSDA 2R7RA 3SAGA 4JI3J 2C3UA 1N5YA 5BN9A 1OH7A 2I5JB 3FC9A 1RUSA 2NQPA 1ILYA 4AUKA 1VJQA 4W4MA 4KH0B 4KHRA 4FN5A 1NGCA 3O3GA 4KQZA 1U24A 5GIPA 3OHAA 5AQJA 3P96A 4CH1A 2NR0A 2FSNA 4FWNA 3B6OA 1C1BA 2LEAA 4FOEA 2FHKA 3RW7A 2R8GA 4DV0K 2ADCA 4CDIA 5AZJA 5HANA 1QE1A 1YJVA 4WE1A 2P8IA 3NGUA 2UXCJ 5KT7A 2MEWA 5K8NA 1TKDA 4AQYF 2MQ8A 1YIJN 3AVHA 1QQNA 2IRXA 4NI2B 3JYTB 2OPRB 1MWQA 1WF2A 1WSEA 2ASOA 1HI8A 4LSLA 1F60B 3CVKA 3RMBA 5D3GB 2YKMB 1KS2A 4RCHA 1XHZA 4XDDA 2JC1A 3R27A 3D0GE 4TQSA 2W9BA 3ATVA 4OZ2A 4J9UE 3FZKA 2DR8A 3PKMA 3HD1A 4M3TA 5JLFA 2ILZA 2R7QA 1FDNA 3CCZA 3HSZA 1BI4A 1RAJA 4OKEA 3VGUA 2HFZA 3UNGC 1ZBTA 1R3NA 3ZTRA 2QA4N 1S76D 4BC5A 5KFUA 4URQU 4QU7A 3AOAA 1OPIA 3L4BC 4YB5A 4CEAA 4OGEA 3L09A 1NMNA 4FK2A 2NXCA 4JS5A 5KPZA 3VZIA 3SLCA 4TLQA 1RWKB 4F9OA 1ZA2B 2V4JA 1K0TA 1VSFA 1BQNA 2FQQB 2AZ1A 1IKXB 1FEHA 1AFJA 5KRTA 2NPFA 3C6HA 2LVWA 1EQYA 2YNGA 2XI3A 3M8WA 2DXDA 5FD1A 2HS4A 3MXJA 2V63A 1DFDA 4DG1A 1RADB 4CJ7A 4RX6A 1GFWB 2CVIA 3DXKA 1A0OB 4LFBJ 1LFWA 3U1LA 2VG5A 2LEPA 3MHYA 1KQKA 1CZ9A 3PXGa 2A10A 1RT7B 3IRXB 3J7AP 4IYQA 2GNKA 1TL3A 2B51A 4YHHJ 3OVSA 5T7BA 5E2QA 5J1EA 3C6UB 2NRTA 5ETQA 1RT5B 5IC4B 1RTIA 4K0KF 4DTUA 3AJ2A 2BOPA 3ZT3A 4BREA 2D3ZA 3GB0A 2ALZA 4P2SA 4ELTA 4JV1A 3H40A 1KAXA 3M8ZA 4JB8B 2UUAK 4IG0A 4F7VA 3CCMS 3Q7CA 1RDCA 4CF2A 3OYBA 1XQIA 4K59A 5KG1A 2D5RA 3OLBA 3MM6B 2JH3A 3NEKA 3UDVA 4WKRA 2Z0GA 3MMCB 3D28A 5LJWA 1N5TA 4V1Ak 3VAMA 2Z1IA 4ZJLA 3PW0A 2XMAA 5K8PA 4DV3J 1RAHB 1H73A 1D5AA 3OFHA 3ISNC 3RVCA 3P5TL 1WOOA 2D41A 5KFAA 4OJHA 2I7PA 2M70A 4E89A 5K8MA 4LF4K 3HKZD 2GMLA 1FDDA 2J0SD 3R6MA 2MY7A 4H0OA 3AXKA 4BWMA 2HKEA 2WUSA 1RTHA 2DHHA 5G0RB 3THTA 1PCAA 4MFBB 4MAKA 3VTHA 3KLEA 1SB6A 3Q23A 2XHWA 3RW6A 4AD6A 2B4OA 4OYPA 4WU3A 3NMAA 3G82A 3AA3A 3W8GA 2RHQB 3N6LA 3D4JA 3G25A 1N6QB 4DV7J 4U7CA 1BXNA 4DR1J 3B4DA 5FLXY 4Y2CA 4USKA 1Q95G 3O8WA 1RDBA 3PEHA 2P5GA 3MM7A 1R8AA 3J80U 2XY7A 2QWMA 4QW9A 2GQQA 2G8IA 4NLWA 4A8FA 1UEVA 4DQRA 4Z37A 1W97L 3KHLA 4I64A 3MM9B 4FK4A 1M0SA 3IS9B 3BF1A 1T02A 1T03B 5AT1B 5AQMA 4PL7A 4AM7A 1NJYA 1DKGD 3W61A 3TX8A 2BR0A 2O8CA 1NRKA 1HJOA 2G8KA 3BSCA 4IRDA 2P1JA 1JLBA 4KB7A 2JEGA 1H2UX 4OI2A 2XMUA 2DNRA 2IRUA 2DNYA 2LXIA 3NWRA 2IBKA 1T94A 3M9NB 4DR5J 1N0VC 2GO9A 3H20A 4IO8A 4C98A 1ELOA 1HHTP 1XNRJ 5C15A 2WSCC 2FDNA 2DK2A 3LWLA 1GOAA 2OHDA 3MM8B 3A1YG 1ASUA 2YPYA 5JVGL 4I7FA 1R8PA 4JI3F 4LF7F 2Y0SD 3AAPA 2A2DA 3WXMB 3HHEA 3OXLA 3R97A 3ENBA 4YHHK 3LTOA 4RW9A 1GQEA 2ZBRA 1KOHA 4JKGB 2HMIA 2HNZA 4TSXA 4LQ9A 3H6EA 4O5BA 2ROGA 1N54B 2MLYA 3KTQA 4CLWA 4W5TA 2QLWA 1UCNA 5HJXA 4OI1A 3SQGB 4CO0A 3AVFA 3I55N 4DR4F 1HIYA 3M8QB 1YJ7A 2KH9A 2B43A 3Q8SB 5B0DA 3G6YA 1Y5NB 3OYIA 1VAZA 1K8KB 4HYKA 3FDSA 4FW2A 5FPMA 5HK4A 4I1TA 3CUNA 4M63A 2J6TA 4FJ5A 5KT5A 3CYMA 3KK1B 1IM6A 1Q8LA 1HHQA 3OR2A 5IQQA 1XJWB 4DV0F 1DURA 2BXJA 4C6AA 3SNNA 1WB9A 1Y3JA 1BHLA 3LWMA 2ATCB 4U67L 1RAFB 1Q81O 3T41A 3CIPA 2LMIA 2FHJD 3VGMA 3AVMA 1SKWA 1C0FA 3Q2SC 1UOCA 3HHLB 3OSNA 2Y8YA 2IVYA 3CCUN 1E6VB 4PQAA 3SJHA 3PDNA 2DNQA 2H54B 4DV7F 1L5UA 2VODA 2OPQA 1SQGA 3DLLQ 4NLOA 1HNWK 2ATQA 1Q9XA 2EFVA 3R7BB 1Q86T 3V1OA 3DMJA 3LZJA 4HUGA 3CDEA 1X3MA 2XLIA 4DR5K 5AZIB 3O5TB 3M9MB 4N41A 2J0WA 1WEXA 2VBXA 3MCSA 4UUXA 2GWKA 4BC4A 4IOAQ 2YQ1A 2PSZA 3KG1A 3SPZA 1EO1A 3DOLA 1R8HA 1KN6A 1OYEA 4FW1A 2QYCA 2MQOA 3BGLA 3PRVA 2YNHB 2J4RA 1HQEB 3RGIA 5IV3A 5H9FK 3CC7S 2AJ0A 1NNDA 4RO0A 3HHKA 1N34J 5C24A 1SKUB 2UXDF 3WXKA 3W2VA 1IV0A 4LRCA 3SQ4A 4JI3K 2KXFA 2RPIA 3EZUA 3OYHA 2JEFA 2BABA 2GTDA 2HNYB 2PO4A 1QVFM 2VPXB 2RQCA 2BJ3A 5J1PA 5K20B 4AE5A 3JTPA 5E3QA 3LP0B 3RAMA 1JWWA 1BA1A 1MG7A 1A5VA 2HHSA 1FE4A 1KRPA 3EE3A 1C0TB 4BC3A 5KPRA 4XH1A 3X1LB 4J2AA 2FVQA 4DR1K 2B6AB 2ZHOA 3HSDA 3D9BA 3WNEA 3I0SA 4HH0A 4CGJA 3GONA 2D1KA 2JWLA 5AQXA 2D9PA 3HOTA 3T3FA 2W6KA 3CDAA 4C0BA 1CXUA 4PKIA 4Y0FA 4FZYA 1FW6A 3BR8A 3WEEA 1YJWN 2QKBA 4KI4A 2QWRA 2ZNZA 2D74B 2MMYA 2I1RA 1S9EA 3FMWA 2AWZA 2FIUA 1CVJA 1GTEA 4PPZA 4ZPVR 4I2QA 3OR1A 4YY3J 5E3AA 4E3SA 1FFWB 1IKXA 4H5TA 4CHZA 3H98A 4JKGA 1K8AO 1XUPO 2E1PA 2DHGA 2HIQA 1BL3A 1WF0A 4OIXA 1SV5B 4KBIA 5GAEP 1U2RA 3GZ7A 3BBBA 4K5RA 3NHGA 1YJWS 2DGOA 1ITGA 3W8PA 3U4LA 3FZLA 2N7YA 2PMWA 2D3UA 1VSKA 2D3OR 1FXDA 5ETRA 4G1QB 2PYLA 1BGXT 2IVFB 3W3DA 1RWUA 3I56N 3F2KA 3QMLA 3H90A 1NM1A 2X51A 4EFAC 3WBZA 5J2NA 2NRWA 4CI0B 2MB0B 3N4QA 2YWHA 2IOCA 3FBFA 2MHEA 1C0GA 3WXJA 2IBOA 3KK3A 2HRTA 3SMZA 1J5EF 4JRPA 3EUNA 4DS4A 5AQSA 2FJDB 3M8YA 2VG6B 4MKAA 5D78A 3UDEA 1BUXA 3KNAA 3Q86A 2OTJS 2YQ3A 3ISZA 5M2UA 4LFBK 3ONQA 1T05B 4QR1A 4EBEA 1X9MA 6FD1A 2CFXA 4L76A 1IBMJ 3A8IA 1R7IA 4GO5X 4TY8A 5AE3A 4KHPJ 3CC4S 3B6PA 4DV1K 3TUJC 1X4GA 2QEXS 1SJFA 4EZ6A 5AQIA 3CNQP 1VRTB 5GAHI 4P7VA 1RWWB 1U1NA 3LPYA 1KEKA 1BA0A 5J2QA 3BM7A 3IGNA 3QT7A 2VWBA 2PYJA 2W9CB 4DTRA 4MMOA 1ULRA 2XMTA 3SYZA 5AZJB 4G65A 1FE0A 4DX7A 2ZKTA 2KM8B 2LP4A 3BO4A 3TUPA 3NFAA 2EKYA 3JQKA 1NU4A 1DJ0A 3H5SA 4O44B 2DFEA 1GT8A 4OKKA 5HMZA 3EICA 5IM0B 2P9IB 1QAIA 4QIGA 2WTFA 3ULEB 2P9LB 1B0TA 3V4IB 3KUEA 1ZYQA 4JN4A 2RVJA 5TKYA 1UZHA 3I0SB 2ZKUA 1NPPA 2QX0A 3CD6S 5KFRA 3R5CA 1VQON 1C4CA 2JEIA 2O8FB 4CD3A 2NS1B 1XR5A 3L8BA 4HKQA 4NYNA 2GUIA 3ZSZA 4CLZA 2XC9A 4FPAA 5AXMA 3MXHP 5HRPA 4M5KA 4FYXB 4QYZK 2M2BA 3HHNB 5BRHA 2YHYA 2WW4A 2IIHA 2UXCK 1SC3B 1NK9A 3MMAA 5AQNA 1UFKA 3PSFA 1EIYB 3NH1A 4DV0J 5IZHA 4MDAA 4USJC 4H4MB 1ZBHA 2PMHA 2FHMA 4CT9A 2XM3A 4OLAA 2ABYA 3TA0A 2E66A 2BKNA 4K4TA 3HVWA 1K8AT 2VJVA 2IM1A 4AHVA 3BBFA 4MLHA 3WXIA 3THYA 1P90A 1HQ2A 4Q5VA 3A0IX 1YRTA 1HD0A 2GIQA 3V6KA 2ZH8A 4JEPA 2F40A 3CJCA 4H8KA 4CRJA 1DY3A 1O6XA 2EEYA 5KQ8A 1ZS6A 1FWPA 2O3DA 2IYIA 3ZT0A 4B1YB 2HAIA 2XYGB 2QA4S 4JV0A 4OYOA 3AODA 5H1SQ 2OP5A 2MJNA 1KAZA 2B8PA 4P75A 2MQLA 3R7SB 1YDLA 4L72B 3D68A 3ZZTA 1KC8T 2VYPA 3KJQB 3T5KA 4YDUA 1RT3B 2P9LA 1WC0A 3H4BA 4CEDA 3UB5A 1TFYA 1NDLA 4DB3A 1OSCA 4FPRA 4DQIA 2QIFA 4PG7A 1JJHA 3DGVA 4B8AB 2QA4G 3E9OA 4FPBA 1EWQA 2JX2A 4ECWA 3MEEB 1VQNN 2E9TA 3PYDA 3UN2A 2B3TB 2OZSA 1KONA 2H4WB 1F0XA 2Q3SA 4I6YA 4KGKA 2BEFA 3A5LC 2NXUA 3LPUA 4FBUA 3ITHB 1SL1A 4PL8A 3IRXA 4WPAA 1KTVA 3A2FA 2ILYA 3WIUA 1JXBA 3GBTA 4XH4A 1FJGF 2W42A 1FK9A 1UAXA 2RHKA 4KT0C 4DCHA 2MZQA 4A4JA 2XMJA 1S6UA 2O67A 3TAGA 5GAGP 4DV6F 2UVVA 3CFRA 4USHA 3SDEB 3PACA 3W63A 3L2RA 4IOAL 1H1VA 3K5LA 2QJ3A 3IXQA 2KT2A 4OYWA 1B0PA 1XNQJ 3D1HA 4NB4A 2G0IA 3E01A 3M8RA 1LQ9A 4B3MK 4HI2A 5DRKA 1KR4A 1JCEA 3MDQA 4PR6A 3HK2A 5HVGA 2IHR1 1KKHA 1P6TA 2ZF5O 5HOOA 1NXIA 9RUBA 3TAMA 4ECZA 1VQKS 2PIIA 4ANDA 2EWSA 4LBPA 2M7SA 2JZ5A 1RDWX 3PJWA 1X9JA 1RDRA 3NGKA 1K1SA 4HI1A 4O5FA 2F4VJ 2DNOA 1WG1A 3E8OA 1Y0HA 2WOMB 1JLCB 4WP3A 3AAWB 1S1XA 3T6BA 3DOMA 3IAS9 5C5JA 3FRYA 4UOFA 4PQUA 4DV4J 1YRUA 2NZCA 4CJTA 2NZTA 2D69A 3CFOA 5CYMA 3C16B 4NMLA 4F0HA 2FGOA 1U1KA 1N32F 1R8BA 3S3MA 3R6LB 2KDOA 1HBOA 4C7QA 1X5PA 2IDLA 3W5YA 1FRJA 1JKHA 1QS4A 2HHHK 5I3QA 3VQQA 1SUQB 4LT6A 3M6XA 3MUVP 2J8AA 4K4UA 2ZE2B 6FDRA 2ZH6A 3CD7A 3OBIA 4FWPA 4K25A 2N4CA 4OHWA 4E19A 3Q22A 1NO8A 2M8HA 4F4AA 2YH0A 5G0RA 1U47A 4HHJA 4DPOA 4DUYJ 1WSHA 2V34A 3O1BA 4DL3A 4Q44A 1TFWA 4PXBA 1S9FA 4J9RA 3OTDA 2Q36A 1EJ7L 3WNHA 1N5VA 1W2IA 2JHEA 4PPDA 4A8MP 4KBOA 3IAYA 3Q8QB 4BGBA 1VSEA 4H54A 2L48A 3EXCX 3NXZA 4KHWA 1MWKA 2V8GA 1X9WA 1Z6RA 5D0GA 4WFAL 2A3ZA 4LF9K 3GJTB 3O44A 1QHAA 5LSRA 3RSEB 2KYXA 4FJHA 2V67A 2YVSA 3JAMO 4TN2A 4I2PB 1D3WA 1UMJA 2V6AA 3M5RA 5K14B 2HZAA 4B08A 1YI2S 2EC2A 5A8RA 1S6OA 4J9KA 3SUNA 4ED2A 4P2MA 1HWIA 3M9OB 1TUGB 2R2SA 4M8LA 3EZWA 1Q7YO 4JKCA 2ASMA 2EHGA 1IBKJ 3TX0A 3NGZA 3OBYA 5KG6A 1XC9A 3C6AA 1C4AA 4EBDA 2GHWA 2FLNA 3VGKA 3UR0A 4Y1DA 4CF0A 3KDOA 2IJFA 1U6FA 3ENOA 3NCQA 1EETA 5K8OA 3FMBA 4YB1P 3H08A 2MYFA 2AP1A 4PWUA 4ZPCA 3H1VX 4JI8J 1RTJB 4PY5A 3OPKA 5KFOA 3GFXA 3VA0A 4KB0A 1R0AB 1FKPA 4CJ5A 2QN6B 4DV5J 3SAFA 2H1YA 2HLTA 2DO0A 2EBEA 1WBBA 8RUCA 4DV6K 4FLUA 2HF3A 4KC5A 2BW2A 4DPWA 1Z05A 3C15B 5BR8F 3CCEN 3VQDA 2D4WA 2FXUA 2V2ZA 3W9JA 2MKKA 3D6TB 1NSPA 2RHSB 1N34F 3TQ1A 1HPMA 3H1QA 2N3LA 4FJIA 3OA9A 2KRBA 3VQTA 4DCOB 3ZTQA 1S4FA 1T05A 5F3ZA 3FBCA 5JS2A 3T9NA 4OFZA 3R1XA 5KFEA 4GMKA 3EYZA 3NF8A 2LEBA 3K7RA 2FUG9 3K57A 3MTKA 4DUTA 3KIOA 2X7IA 4OJGA 5EXWA 2IPOB 5GMEA 2R7SA 2CPIA 4KE5A 1J53A 3CC2N 2KQ2A 3GV7B 3LZIA 2OI2A 3SJJA 4B3TK 1WG4A 5FPDA 2RRNA 4AHUA 3KJVA 3J7A1 3TWZA 4CHPA 1VIOA 3OW2M 3AO2A 1QD1A 2YKQA 2W7AA 3CJ9A 1X5SA 3HCXA 1S72N 2CGKA 3BJYA 4WFYA 1FX4A 2VUGA 1HYSB 2BJ7A 2VC0A 3Q8PB 1GLDG 3GCWP 4H5VA 4FZVA 2DBBA 4RZRA 3VQ9A 2B7CB 3ICLA 3MN7A 4WCEL 2IVMA 1EAYC 4X64F 2PI5A 3V81B 2D3O1 1VDHA 4LF1A 4Y28C 5E0OA 2DNNA 4X66F 4W90B 3JXUA 1UP1A 2ZJPL 4LRAA 5KFWA 4QCLA 1KQGB 4OHVA 4DR6J 3FGVA 2JGUA 1LW2A 1RABB 4WK3A 3CTRA 3CCES 5C10A 5F8GA 5BR9A 4JI4K 1S1TB 4NXNK 5F0UA 2YY3A 2MZJA 3M7VA 4FCYA 4USIA 3MECA 3G9CA 3W2WA 4GW6A 1Q9YA 1HQUB 4GVMA 1R43A 1WSVA 5DETA 3D54A 3R5GA 2EI5A 4CJPA 1H6KX 4F04B 2ZFHA 2FY1A 2PA3A 1NHVA 2UXCF 4HACB 3O9QA 5A6WA 2HBJA 1GLLO 5DM7L 2EKNA 5FPEA 1KXPA 1UJ4A 3CM6A 1T8EA 2WHOA 5HP1A 2RU3A 1RT2A 3IG1B 1YZ6A 3HXMA 3I9ZA 5KPTA 3MXIA 4JI5K 1R89A 4LF8J 4JNEA 4BRGA 4WFAQ 4CHYA 1CEZA 3GSDA 3U27A 4IFYB 2CJAA 3M6VA 3S1TA 4P71A 5J2MA 2AJ2A 5DQIA 2FJWA 4TU8A 2KYZA 2J7UA 1S22A 1TYQA 5KFHA 4IO9L 1HNZJ 1FJCA 4RU9A 2GAGC 4ZVEA 1KFSA 3THWB 1LWFB 3V9WA 1FKOB 1QY7A 4GV3A 3KLIB 2BQ3A 4CLUA 4AL6A 1VBKA 4GC7A 2DCUB 1S9EB 4M3ZA 4DXLA 3KDNA 2DIVA 3PRBA 2AEJA 2GIFA 3H2VE 4WIIA 4BR9A 4USMA 4UZBA 4HVZA 4FOIA 1VSDA 1J54A 5HLFA 4QS8A 3GJQB 4C8MA 3KXDA 3MCOA 2AJQA 3RR7A 4FK0A 3HTVA 2GVZA 3CULA 1HLWA 1CJVA 3BP8A 3TJ8A 5HAOA 2YKNB 1Y10A 1VQOS 4X65K 3PX0A 4ZPBA 3HMJG 3SPYA 2OFGX 1J5EK 3ZX2A 4WFNL 3BS9A 3PIOQ 3VA3A 4KHNA 4ALZA 3TSUA 2QYGA 4IOBA 4ICLB 3GG4A 1FJGJ 1RLDA 4N76A 1XEZA 1QSYA 2XGQA 4EP4A 1LWXA 1K44A 5AJ3K 2G8VA 1S6PB 4JI7F 1C1CA 4DFKA 3EKUA 1M90T 2JLGA 5FRMA 1O8BA 4BRNA 4FWOA 4BRQA 1MMLA 3HYFA 5KG2A 1Y00A 1QVFR 4MK7A 3UN5A 4MTPA 4J37A 2DH7A 1P1LA 4CIFA 1TV6A 3S01A 4DR6F 2BQRA 2BJ9A 4M3RA 3O9TA 4LC9B 4X66K 1FRLA 4ZHRA 4DQPA 4OI4A 1ZTWA 2KRRA 3QT8A 3SQGA 1ITPA 4WF9Q 4R8UA 4DMNA 2XHBA 3BUZB 2BZ2A 2E6MA 2QMWA 4RNOA 2RB7A 3P3DA 3QINA 3VWSA 3IR7B 2AV5A 1HPZA 3DOKA 1F1BB 3MEGA 1WELA 2A42A 3KLHA 2COLA 2DEJA 3PYFA 3VAHA 1NKBA 2HQIA 5L9NA 5M1KA 2QFIA 1VOMA 1IG9A 4CJQA 4HCCA 1KQSR 1RI7A 4Y00A 4DQQA 2CQ3A 2VCPA 1ZPVA 2ZVSA 1N32J 1IBMF 2OEJA 4ITSA 1WC6A 1I3AA 3EN9A 4IEEA 3L3CA 3HVRA 2X3DA 3CCVS 3ZETA 1FXRA 4HTJA 1BWVA 4PYAA 2FZGB 4B9TA 3OXFA 1X4HA 1V3ZA 4DUZK 2QL9B 1SBRA 5AQQA 2E1ZA 3CD5A 4NYFA 4E2FB 4ECXA 2I6WA 2P9UB 3GE1A 1A7GE 4KY3A 1BCOA 4U8YA 3E2EA 1EETB 5KGWA 2G8UA 2VG5B 3D6RA 5HLFB 2VKRA 1FX2A 4YDXA 2HNDB 3DYAA 2PGCA 3IC1A 2K7KA 2ZDPA 4FYDA 3HFVA 4W92B 4RPFA 1VQLS 4BDYA 1NWKA 2UXDK 3NH0A 1TQLA 3CF5Q 3MECB 2X1AA 3V9SA 4TKTA 4ZPWR 4DR4J 4KI6A 2O01C 5CD4H 2LA6A 5A8WB 1AW0A 4RW9B 4C0OC 5BRFA 5L1LA 2PD1A 2EFOA 3VR1A 1OYDA 1AFIA 1RGIA 1U4BA 4QIFA 4EU0A 4BRMA 4WQ4C 2V8PA 2WONB 2XGPA 3WQUA 3SV3A 2UZAA 1MN7A 2V8VA 1J6ZA 2ZGYA 3N79A 5E41A 1ZOTA 1QQOA 3ET6B 3F73A 1UVIA 4KKOB 4UUWA 3UD4P 5F8MA 3J8AA 5AQVA 3CG7A 3K9JA 2MKYA 4ISGA 2CJKA 1RJJA 3TVKA 4WBFA 1YRXA 2DNPA 1AT1B 1NGGA 3VESA 1P8GA 3UR3C 2NRXA 2ZJRQ 3DLHA 4Y6IA 2HNDA 3DYAB 2Q31A 4I6MA 1QSLA 3CCRS 4ECRA 1G4CA 3DM2B 3BO3A 1V3RA 1ZM9A 2VFUA 3V1QA 3BO2A 3KLVA 4CIEA 3MN5A 3K2YA 4J2EA 2EG1A 3J7YU 3D7EO 4ZTFA 1ICEB 3ZT4A 2DNKA 3NAHA 2LA4A 4LIWA 5G4DA 4KKOA 4IH7A 2GWJA 3VZHA 5D8HB 4PABA 4YS2A 2XWXA 4BRKA 3LDLA 3QFWA 4K4YA 1SS6A 2E29A 2KG0A 5DO2A 4NLVA 3E1YA 2OTLS 4OZ1A 2RT3A 1MWZA 1YBTA 3W64A 1SH0A 1JLEB 5CE3A 2QK9A 2XO6A 2L9NA 2VKZG 2PA8D 1TAUA 3W2WB 3NBPA 3J81j 5ELZA 4JK8A 1JLCA 4FLXA 3M2RB 2RE2A 4K43A 3SZ2A 1RBSA 4J9NA 3EX7B 3HT0A 3CHWA 4FP9A 3PO5A 4NYPA 1NEEA 5LL6Z 2F63A 2DGQA 3QPIA 2HHQA 3FE1A 3NNCA 3OTBA 1PAEX 3WEEB 2KKZA 4K50A 4JD2A 3KLHB 2POKA 2ETJA 3N6NA 2CQHA 2DHAA 2VQFK 2YKPA 5MAOA 2RRAA 3CIZA 3OYNA 2WB4A 4X84A 1UVMA 2BJDA 3CJ7A 4DU3A 3P5JA 3LDNA 4R5PA 5F0XA 2IMOA 4I67A 1HMVA 4J8FA 3CMAN 2XNQA 3IUCA 3KWMA 2JC0A 1W26A 3TTCA 2Z1GA 3FQKA 1WAFA 4Z7CA 1PBUA 2AJ1A 5HQ8A 3HM9A 3CDBA 1XC3A 4M41A 2RAQA 2OGUA 2OTJN 5L1IA 1WD6A 3EGWB 3VHQA 3SK3A 2K1RA 4L75A 2NZ4A 4X64J 2VBZA 1K1QA 5KFXA 3TYTA 3MAAA 4Z4IA 1HR0F 3AD8C 2JFKA 1YI2N 3DC2A 2ZNYA 1HBUB 4ECUA 4JBCA 5HN0A 5HQMA 2YX6A 2FVSA 1VRQC 4OI0A 4OX9F 3M30B 1N36F 1NK4A 1VQ8N 1U09A 2DNGA 4LH5A 2F65A 5DG9A 2BH1A 2M8DB 3ZEUB 3V9XA 3CT9A 4JI0J 1U25A 4F3QA 3H46O 4NXMJ 4LJMA 3KYLA 1T3NA 4DV2K 2YI1A 5HROA 2XWYA 4GKKF 3RAXA 2VU5A 3T1HJ 2YKAA 3ZSRA 5HBMA 2WVBA 2LQ8A 2DGUA 2RF2A 2QWQA 5J2MB 3OXGA 1CQNA 4DTOA 3FUYA 1TP7A 1R0BG 2CJBA 1NPRA 3HVTB 4B3SK 4CLSA 1CSJA 3B8AX 4M3WA 4AH9A 4LFBF 1O0PA 4H4OA 1IM4A 4WK1A 3DHWC 4JI5F 3DHXA 1V6HA 3T9ZA 2V8HA 2VQEJ 5I3PA 1FKOA 3VV2B 3OV7A 9ATCB 4Q45A 2VFVA 4WP8A 3QEIA 3J81U 4YOVA 1TYQB 1U49A 1G7CB 4GRSA 4NLQA 1WOSA 1WEZA 1RBAA 1UPMB 3V6JA 2OD4A 3HI9A 3LPTA 4NXMK 1IR2A 1VK0A 4YOWA 3H59A 1NCLA 4F2RA 4LRDA 4FBTA 4OX9J 4C9DA 2IIRA 3CCSN 1SIZA 3WC2A 3KMQA 4JP8A 3L4IA 2E7WA 1D0EA 4GO7X 1DQAA 3JSBA 5LMUJ 4BR5A 2Z58B 2HVEA 4WZMA 2E44A 1VBZA 3C19A 2RILA 4EK2A 1RDUA 2FSKA 3BF4A 2PFDA 2AYEA 4AHSA 1MROA 1RBTA 1X1PA 4DTSA 5IM0A 4LFAF 2P9IA 2XSJB 3V9ZA 4C4WA 4P2XA 4IG3B 5AQLA 4USWA 1Z2LA 2VG7B 4X64K 2EFGA 1JJ2M 2KZZA 4IDKA 3GLJA 3QNNA 4CYUA 1VQ5S 2ZHBA 1FNXH 4P2FA 2E2QA 3A12A 4ZCLA 2V9WA 4OX8A 3WIVA 4BC7A 2MXYA 4FZXC 3VVTA 3VEWA 2V68A 2Z56B 2UU9J 4X4QA 3R3TA 2QWOA 3MZIA 4FWRA 4O4GA 3GR0A 3O4NA 4EYIB 3L6QA 3GV5B 4FWLA 3MXMA 5EX0A 3NRBA 3OS1A 4Q8FA 4LF6J 1VQNS 4DV5F 2Z2MA 2BGGA 1RBVA 2O5DA 4ZCMA 3WQTA 2ROPA 5KOXA 4KHPF 2DKOB 3BSNA 1HHSA 1UWBA 3PY8A 1VC0A 1H74A 1QVGR 1OVYA 2UUCJ 4BE1A 4BQZA 3M1FA 3MM5B 3D0PA 4LFAK 4ER8A 1JL2A 4KPCA 1N88A 4DPYA 1KBRA 1FXXA 4IR9A 3DAWA 3M4XA 4CIGA 1VQ6N 2OSQA 4USUA 2HW3A 1TL1B 5ETNA 4I56A 1Q79A 3ZZYA 1Q8BA 2NLWA 4CEZA 2PEHA 1T7PA 2C3PA 3RBDA 1JLAA 4LFAJ 2VFRA 3ETOA 1WUAA 3UDLA 3N28A 5FRNA 4NXMF 3WQPA 4O3RA 3OTEA 4NASA 2LFVA 4NLXA 3R5AA 2R7TA 1BO5O 2R42A 3ID8A 4PWDA 2BYCA 4V19X 3DLRA 1YJTA 2GMJA 2G2YA 3V6DA 3JQJA 3M1VB 3DOLB 4M5MA 3TZYA 4OZ3A 5D4LA 2BE9B 2NRHA 2WVEA 1RAIB 4CO2A 3H2UB 2YHAA 4QOTA 4WYWA 2HNYA 4HH1A 4ED7A 1LFPA 3OHRA 2Y0BB 4AFFA 3OW2R 3F9KA 5AFUA 4WQ4A 3HSCA 1OMSA 1SV5A 5F9LA 4QR0A 4WU2A 5KFTA 1ZTTA 4ANCA 4Q0BA 4LVNP 4FL9A 5CHCB 4O3OA 1GMWA 3LOUA 1Q16B 3VOVA 1JNZB 1CG2A 2AKWB 4DL4A 2UXBJ 4YOYA 4Q0BB 3LA0A 1U6BA 2CJ9A 3WX8A 1CXQA 4BR7A 3H42A 2AX1A 2DR9A 5LSLA 2DVIA 4PRFA 2G9OA 4LF9F 2C3OA 3DDNA 3UD5A 2Q97A 1NJWA 3LL3A 3S7RA 4CHNA 3IWXA 5IQ6A 4CZFA 2DEIA 1Q86O 3G10A 4I0WA 4CO5A 2G8HA 4CHQA 4OX9K 3CSKA 3RJMB 2HRUA 3EDRB 1OIAA 1JCGA 2LQJA 3HDSA 1VJWA 2DGTA 2Y1LB 4BVOA 3D6FB 5FJ4A 4IDKB 4BWJA 3CCLS 5I9EB 4DR4K 3OT9A 1PILA 1CJUA 2IVOA 4J9MA 3BZKA 3D3BJ 1VQ7N 1KNZA 1AZSB 2CH6A 1HPZB 4KAIA 3IWLA 4BQLA 2DRDA 3CETA 4B3SJ 3MWPA 5K9FA 1RWOB 3G6XA 4F4XA 3ZTPA 4AILC 3CCWA 1UA0A 4DSEA 3T1HK 2W01A 3D3CJ 3GL1A 4FJGA 5D4OA 4QQBA 4M5GA 5BR8K 5ETVA 5LJVA 4FWMA 1W2BR 4CE9A 1FO1A 4JHDA 3L2VA 2M9KA 2NRZA 1URNA 1T11A 4YB7A 4BVPA 1KCFA 5EWFA 1T9YA 3DRXA 3D2FB 1U1OA 3TEGA 2A1BA 4ECYA 2GFFA 3LW5C 4QWBA 3MEDB 3SMPA 1RAGB 1AROP 3CMES 2KB2A 4LREA 4F4WA 4R79A 3KLFB 2DNZA 2F1FA 1X5OA 3QWPA 3ZLJA 4F67A 2YHWA 1NDPA 3SFUA 4CO1A 2FLOA 1CPZA 4PHTX 1LW2B 2W41A 3SCJE 2W9AA 4OL8A 1OKJA 3KK7A 5C25B 3ZZ0A 4Z4HA 1IJEB 1B4SA 4OYAA 1B70B 1NZAA 2BV3A 2J0XA 2IM3A 3CCLN 4E1NA 4K8XA 4CGIA 1J5OB 3UKUB 3HHDA 4Y1CA 2I38A 4H0VB 3HP6A 4AM6A 5H9EJ 3QB0A 4OMFG 4DBQA 2P9NA 4ZLJA 1K47A 4CECA 1R27B 6AT1B 4JI7J 4DTPA 2F9WA 2ZH2A 4FXDA 4X2BA 3O9RA 5M1FA 5CZ2A 2VA3A 2R8IA 3SBGA 4RW4B 3GU0A 1U04A 4IRKA 2FD2A 5IT9Y 5JS1A 4DJBA 4CEOA 2A3JA 1OVQA 4H5WA 4F0MA 3DRYA 4JK9A 1OWXA 3MX5A 3TWHA 2XMKA 3IR5B 1YITN 5DDPC 2CZVC 2YH1A 3JAMU 1RT6A 3EWGA 1T6CA 1CC8A 2G8WA 3THWA 3M8PA 2P5VA 3MWBA 3BQ1A 4Z0UA 3MM7B 2PT0A 1J5EJ 5A2QO 4YP3A 2NNWA 1X4EA 1Q5VA 4LF4F 1DRZA 2ZDOA 1SJ1A 3WZ0A 4J91A 1NSKL 2FBXA 3EE9A 4DFJA 4ZKAA 3QEWA 1GX5A 3C15A 4Z7YA 1TUVA 3WXLA 4C8YA 4LRBA 2EFNA 3OY9A 4B1ZA 4D3HA 2DFFA 1REVB 1XMOJ 1UTAA 4KGVB 4WKYA 4DZDA 4X4TA 4ETZA 4KTZA 2QG9B 2HBZB 5KG4A 4F4KA 2DPIA 4PYDA 2MTLA 3AD7C 3D6HB 2DPJA 3BR9A 2B4VA 2QLBB 1I51B 4NOHA 4A62A 3C6TB 2CPXA 1U1LA 3QZ8A 3IO1A 5EY4A 1N56A 1N0UA 3ENQA 4U7UK 2CA9A 3UCZP 1I94K 3QBCA 3PW4A 1KFDA 4CGGA 1CJTB 3OL9A 1HNZK 2DXEA 3SBTA 3BH6B 4Y2KA 2WW8A 4DR2F 3DRRB 2GS8A 4ZP7A 3TARA 3GYXB 4RW8A 2U1AA 5CA5A 3M2RA 3C8YA 2L9DA 2A5XA 2XY5A 4U7BA 2GVZB 2UYTA 3J80Y 2V4RA 4CBUA 1Q53A 3FEXB 5H1SV 4JI5J 1TVRB 1UA1A 3LAMA 5HMXA 3CCSS 2J0QD 3G2XA 4OHYA 1T9WA 2CNKB 4U96A 3BKFA 1UJ5A 1L3SA 1Y5LB 1NM2A 4JI1F 1VRUB 3NS6A 1A5WA 4M7YA 4KTWA 3QZ7A 7AT1B 2ZGZA 2OTLN 2WSFC 3MUTP 3THYB 5IWAK 1WSGA 2BJ8A 4PWDB 8AT1B 1SIWB 1RT5A 1LWEB 3ZETB 1QAYA 3MDFA 2DH9A 3UNYA 5D4PA 3QNWB 1NJIT 2V4JB 2Q2RA 3O9UA 1UZDA 3KUGA 2V52B 5KFDA 4E98A 4L6V3 1XQSC 3UPFA 1D09B 3AJ1A 5DZ7A 2W6LA 3DM2A 2LU1A 4L3QA 5DM6Q 4FM2A 1RCOB 2Q0RA 3S8SA 2UXDJ 1SC6A 1MU2B 2W4CA 4EUVA 4M5DA 3N5BA 4BC9A 4DR6K 2AT1B 3M1VA 3QSIA 1DTTB 2GQ2A 1M1HA 4OV1A 4OPJA 2YWEA 1SUQA 2K1RB 4CTAA 2ATLA 2HZVA 4FM1A 1BQMB 2GCFA 3J81O 3JTNA 2ZD1A 3RSEA 1QM9A 2VFTA 4YR2A 4O8UA 3T6JA 1VS3A 4J9QA 3AQPA 3SXLA 2Z1HA 1SC1B 4RNFA 3U3YA 4PXDA 5EN1A 1S0NA 3S9HA 1GLBG 1S1XB 2HSTA 3FCWA 1YZ7A 3QETA 5SWMA 5FLXO 3A3NB 2HURA 4ZN3A 1EX8A 2XLJA 1WSIA 1Q5YA 1AUSL 1SQFA 3G4SS 2YNFB 1BC6A 3NOGA 2ZOMA 1WG5A 4U6PA 1I6JA 2DISA 2HBLA 4B8CA 3ULHA 1K9MO 1W2BM 2QMXA 3AVLA 4DL2A 3CJ5A 2FJBB 4P52A 1NSQA 4LQ3A 2KTQA 1IBCB 5BPNA 2HVZA 1NJZA 2EPIA 4FKYA 5AQWA 3ILIA 3JS9A 3MF5A 3O6WA 2PMZD 2NYHA 3D5MA 2BACA 1N33F 5HVFA 3VQ4A 4HDGA 3EPGA 2GW8A 4DV2F 2BTFA 3LF0A 5IOLA 1BDGA 4JLHA 3AB2B 3FZHA 4EO8A 5F8IA 2BJ1A 4FDFA 5T7LA 3PX4A 4DV5K 2FY8A 3HBTA 4NPOA 1ZZFA 4ZVUB 3PTWA 2ZJRL 4DPTA 5LOQA 1IKVB 1TAQA 1SL2A 5AJ3J 4ID8A 1B7FA 1CULB 1U2FA 2YWKA 3ZC4A 3VEZA 2CADA 2KHDA 1VQ9N 2HIYA 2P9SB 5BYRA 2E88A 4CESA 1HR0K 5B8HA 3NS7B 1JMTA 4OLBA 2R7OA 5KFVA 3TUIC 1D9AA 3IN5A 5ETLA 4KFBB 3O2IA 2CYYA 1TL7B 2FB0A 4ILMA 1NBWA 4CGDA 3P1GA 2Q66A 3L7OA 2BUPA 2RRBA 3BBCA 3TEHB 2W7PA 4EHUA 2CQDA 1UFLA 3ZXWA 1J2VA 1TR0A 4J2BA 1RT4A 1RXOB 2O1PA 2B5JA 2R7XA 1IH7A 4CIOA 2I0XA 4A8WA 1SVDA 3C14A 3MMCA 4H4OB 4HWIA 1C1BB 4ZJQA 4CD1A 5F3TA 3RU0A 2A41A 2YNIA 1SCJB 3B54A 5DDRC 2UUWA 3UDCA 1DHMA 2BKPA 3Q2TC 1TKXB 2FZKB 3K89A 3L0QA 3MCAB 3VEVA 2A6OA 1NHUA 3BKUA 4XK8C 1DQ8A 2P9GA 5HMYA 2YNHA 2QLXA 1GH8A 3KVGA 3AXMA 4M3YA 2WCXA 1TU0B 4NLGA 1X4FA 3QO9B 2F4VF 4CERA 4RBUA 3EPIA 3TRGA 3MR7A 2XMMA 4A59A 3LAKA 3TI0A 4I4BA 2YHBA 5E3PA 3DLKB 2J7WA 1F3VA 3PYGA 2RE1A 2Q3PA 2CQIA 4GKJJ 3J80O 1DARA 4F4YA 2MSTA 2DRAA 4GKKK 1NGBA 1NGEA 3QBWA 5F8JA 5CH7B 2CG4A 3VPZA 3NE6A 3O08A 3SDEA 2AW0A 3OFEA 1SKRA 3DLGA 4L73A 2OD6A 3CJ2A 3VAJA 1WSFA 3O9SA 3E3XA 3BGRB 3ULEA 1S9GA 1SPBP 4DR2J 4B1WB 4OYXA 2LKZA 3HHLD 3F9MA 2H9ZA 1F3FA 3NAEA 1MSWD 3TJAA 4ZPTR 4NXNJ 1YK9A 1RHKB 1D9DA 3GFHA 3CCQS 1TK5A 4BRHA 3EM1A 3T19A 2PFUA 3D66A 3T5JA 3U8XA 1FKPB 3MUMP 4A57A 1W7AA 1JB0C 1LXJA 2OPPA 4YOTA 5IWAF 3HPOA 1EKSA 1J9AA 4BE2A 1JLEA 1GXLA 4KHUA 2RS8A 3PW5A 5JLHA 1F6TA 3GQCA 1HKAA 4CLTA 1PIEA 2QA1A 1XNQK 2YKMA 1WKLA 1QVGM 3U9ZA 4C8LA 3G0ZA 1JXEA 4MKVA 1KHWA 3UVJB 4GV6A 2DXFA 1NZ8A 4CWBA 4UTGA 4NCAA 4B3OB 2Z2YB 4CEFA 1F9EB 4IOCL 3BN4A 2B5JB 4BBYA 3T1YF 3WC0A 3UKRB 3SUPA 4E1JA 1RTJA 3QESA 3OUYB 4DQSA 1M5OC 1PJ5A 2GX8A 2VASA 3IFRA 1HARA 4FSVA 1T95A 3S41A 4B1XB 4PAAA 2CWXA 1YJNN 1EQMA 3RMCA 4E0DA 1NK8A 1U8SA 2W2PP 4PXEA 4O4GB 3KZBA 4A61A 1LWFA 2QM1A 4H5NA 2J5AA 4F3MA 5KGXA 1NBEB 3ET6A 1UJ6A 5GMKa 2OO4A 2C2RA 3B8HA 4KGMA 4L3KA 3RMAA 3BV8A 1S4EA 4HVJA 3DU5A 2K3IA 3NF9A 2RDDA 3LP1B 1E6YB 3FNNA 3W62A 5DQHA 2AX0A 4PKDB 1X7VA 3N4PA 3OQ2A 2YXLA 2HRYA 4DHYA 1E4GT 3IMQJ 3MPDA 5DM6L 1HX1A 4B9MA 4RR5A 1K0VA 3T7ZA 3QFUA 4J9VA 5BYSA 3O8MA 5B08A 4DV4F 4CBXA 4TYBA 3GPAA 5D0HA 4ZVFA 1VQMN 4ZVTB 2Y1RI 3M6GA 1VQ5N 1OO0B 2KI2A 1M5HA 4TYAA 2OIHA 4GVBA 1WI6A 4CF8A 4ZVPB 3RRHA 1ZPWX 1N33J 1LOUA 4TU9A 4CO4A 4PG5A 3QRRA 4HACA 1IBKK 3JTOA 2O8CB 3CD0A 4K2JA 2R7UA 2E1YA 1JJ4A 2UUBF 3KUHA 2DGSA 4AHCA 3IBWA 4OZJA 4F4ZA 3JYTA 4TXSA 2ASDA 5KI6A 1DLOB 1WC5A 3B4MA 4P7TA 2MDAA 1JX4A 1OPZA 2BANA 5HSPA 1BQXA 1ZBUA 3TAEA 3MPYA 5GINA 1NKEA 1WORA 4AXJA 5CCMA 4F50A 3QMQA 4PWWA 2L9WA 2JJ4D 2KW4A 4KHQA 2CDQA 4CJEA 2YJFA 2CXEA 1YBAA 2E1RA 2Y9HA 2CJYB 2XSJA 3A8YA 3CJRA 5HQLA 1O5JA 1S1WB 2V8DA 3SAHA 2HF4A 3IS9A 3TANA 2H3EB 2B8QA 5C2DA 2G0CA 2P9UA 1C0UA 4DR3J 2QT7A 1JLQB 2RS2A 1IQTA 3KK2B 3CJQA 5A2QU 3EO3A 3GV8B 2UUBJ 1F21A 1RBLA 5JVHQ 4CJVA 1MW7A 3HHLC 5HL7Q 4RG8A 4ZTJA 4DUYK 3OYEA 3C46A 4H4MA 3HSGA 4K8RA 2PZSA 4HHTA 1VQPS 3IBCB 2BE7D 4CI6A 5F0WA 5RUBA 4FF2A 3KOAA 3L3UA 1S1VA 2XZDB 1QUVA 2HHHJ 3UO0A 3WNFA 2R2UA 3Q24A 4Q2MA 3GYNA 5CYQA 4I9LA 3MEEA 1BMQB 4FWKA 2AJFE 4KHPK 1HW9A 3TR8A 4CFDA 1IBMK 4X4OA 4FJMA 2V7YA 3EGVA 3KJVB 1VLOA 4L8RB 1ZM2A 4IRCA 4DSKA 3I56S 3K0JA 4DV3F 2G13A 2GX9A 2I2YA 1SJRA 5T41A 2FBVA 3MOZA 4OX6A 5L38A 3UD3P 2P9KB 2HFOA 4CZGA 4FPIA 4IXCA 1K8KA 2HVHA 3M6WA 2F8HA 5KT4A 3G4SN 2ADBA 3PIOL 4ZLPA 1HBMB 3MR2A 2A1SA 3LGHA 4LF2A 4O44A 3TOQA 1XMQF 4CK3A 2XEXA 3A5NC 3BF3A 1SI9A 2A2CA 1SQKA 1VGYA 3ZTSA 3CWJA 4IFVA 2OPQB 4H03B 3RBZA 1LOTB 2UUTA 3QJLA 3DRSB 1VC5A 3W7BA 2GA7A 1VR6A 2QO3A 4CJLA 1S6PA 1E3MA 3MD3A 2CDRB 1VQ4N 1VRTA 2BRLA 2F9JA 1IJFB 2V2KA