2YNFA

Hiv-1 reverse transcriptase y188l mutant in complex with inhibitor gsk560
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
560
structure length
557
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
total genus 158
structure length 557
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ynfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ynfA05
3ITHB 3OSNA 2R8IA 4J2BA 1JLBB 4J2AA 4M95A 4EZ6A 4TLRA 3QGHA 1N48A 4CGIA 3I0RA 4CJLA 1RDDA 1SKRA 3MEDB 1S6PA 3OYKA 3L2VA 1NJZA 2FVRA 5T14A 4YR2A 4WZMA 4KO0A 4XPCA 4O44A 1X9WA 2B4JA 1QS4A 4DQIA 2RPIA 3PR4A 2VG7A 2HAIA 3MFHA 3RBEA 3LP2A 1S1UB 5J2QB 3DI6B 3NCIA 3OYHA 2OA8A 1UWBB 4ED1A 4CF8A 1N4LA 2HNYA 4URGA 1RBUA 4B9NA 4M3RA 4GC6A 3TABA 3QIPA 2E6MA 1C1CA 2FBVA 4CJ5A 1LW2B 3F9KA 4CESA 1JLQB 1U49A 4DFKA 1S1XA 3C94A 2HMIB 4DTNA 4TY8B 4YQWA 2R2TA 2XWYA 1WLJA 4FK2A 2C22A 1NOYA 1QSYA 4WYWA 1I6JA 2V9WA 5KFUA 3VQBA 3KHLA 1O1WA 1J5OB 1IKVA 2HHWA 1J9AA 3VQCA 4FLYA 4IFVB 4B3OB 1JLEB 2YNIB 4CFBA 2BQUA 4NCGB 1NK6A 3G6XA 3NE6A 3MTKA 4RW7A 4IFYB 3CFPA 4CFDA 3O3GA 3G0ZA 3BSAA 3DOKA 2E9RX 4DU4A 4ZP8A 5KT6A 1HRHA 2BE2B 3OL9A 2QKKA 3PY8A 5C5JA 1NJYA 2UVUA 2F96A 3AVIA 5KFBA 4FJXA 3PW2A 3PR5B 4FLWA 3C6TA 3OLAA 4ECSA 3PUFA 4F50A 2ITGA 2D7SA 4CJWA 3GIIA 3MXIA 5I3UA 3E51A 4RZRA 1RTDA 2IDOA 3LP0A 1TKTA 1LWEA 3WNEA 3RAXA 2YV0X 3CO9A 3AVJA 2J6TA 1RYSA 1RT7A 3PJWA 4FJ9A 1RT4A 3BSNA 4DQSA 4E19A 1HPZB 5L9XA 3CM5A 1BIZA 3ITHA 4DQQA 2XGPA 5KGWA 1ASUA 4URSA 4UQGA 4WFZA 4ECXA 1I3AA 1SL1A 4IR9A 4DG1A 3HK2A 2HHUA 4CHNA 5KFWA 4H4MB 4O4GB 3OYAA 2BR0A 3MEGB 3I5CA 3SJJA 4WYLA 1ITGA 3AO3A 2W9CB 1EXQA 1KFDA 2IA6A 4Q45A 3SCXA 1BQMA 1D9FA 4CEOA 1RBVA 4ECWA 4NRTA 4WE1B 1QTMA 4NCAA 2D3ZA 1NKCA 2D0BA 1KHVA 2WB4A 4RW4B 3NH2A 3TAMB 3I0SB 3ZSQA 4CFCA 2X78A 4MQ3A 3ULDA 1RDCA 2G8HA 2O5DA 1F21A 3D45A 3BQ0A 3NF7A 4I7FB 4O3PA 4DF8A 2WOMB 1B92A 1D9DA 1TQLA 1N56A 4IG0A 3KJVB 2FJWA 4NLUA 3SV4A 2HVIA 5KFRA 2XY8A 2D41A 3MFIA 3BR9A 4LSNB 4TY8A 1LWCB 2YNHA 3LWLA 2ILYA 2V4QA 3HHKA 4ICLB 2D5RA 1T8EA 3VQ7A 5F8JA 3CDEA 5HRNA 5KFAA 4TXSA 3ZT0A 4CF2A 2BQ3A 4LH4A 4W5RA 3DYAB 3WNFA 1FK9A 4CJTA 1U48A 4DFPA 2YNIA 4J9PA 3PVXA 3IG1B 1CLQA 1T03A 1RT3B 4KFBB 3C6UB 3AV9A 3AVNA 4E7HA 4Z4GA 2UUWA 2W42A 3D5MA 3L2UA 1R0AA 1JKHA 1S4FA 3SUNA 4HHTA 3P83D 4WFYA 3VQ9A 4Y2AA 4I2PA 3A2FA 3KLVA 4CJSA 1LAVA 3O4NA 1Z25A 2JEFA 4PUOA 1A5WA 3PV8A 4TQSA 1C0TB 3OS2A 4KV8B 3JSMB 1Y97A 2C2EA 5KFFA 4CHYA 1ASVA 4HTUA 3TWHA 3MEEB 1HQEB 1TL3B 1S1VB 1HNVA 4O55A 4Q8EA 2RKIA 2E6LA 1ZBIA 2FVSA 3E01A 1UOCA 3DRPB 1DLOB 2OPRB 3OYJA 3GV5B 1YTUA 2F8TA 1RT6B 3QYYA 1RTIB 1RT2B 1JLCA 4JV2A 1RBTA 3ZT1A 1S9GB 3PZPA 2YKNA 3U3GA 5KG5A 1TKXB 4U6PA 3UQSA 3DM2A 5J1EA 4F2SA 2I1RA 1DTQB 4OKKA 2G8UA 1BGXT 2PY5A 4E7IA 4FS1A 1KCFA 4FLUA 3DRRA 2UVRA 1ZBLA 1EP4A 3HPOA 5J2PB 5J2MB 2W9BA 3HYFA 2AX1A 2GC8A 4DEZA 3QGIA 4OGCA 1RTJB 4TSXA 2O4GA 3M8PA 5L1JA 4EEYA 4M45A 3UIQA 3QEPA 4GW6A 1HNIB 3KHGA 4ZHRB 1S97A 3V6DB 4CIGA 3O3FA 2UUTA 2Z1HA 3MAQA 1VRUA 3RB4A 1ZTWA 3PJXA 1WSEA 1KVCA 5K14A 2XRIA 4BWJA 1ZBHA 2PYJA 2P1JA 4PWDB 3L3VA 1SH0A 2IM1A 4CEZA 3BREA 3L2RA 3VQ5A 1EKEA 3B6OA 4WXWA 3BGRB 5C42B 3PW7A 2CJQA 4ZVFA 4B9SA 1S9EA 2BQRA 2FBXA 4FK0A 1IKYA 3N6NA 4DL7A 3ASMA 4AILC 1ZTTA 2HWIA 3VA0A 4K8ZA 4QOZB 3NFAA 4XPEA 3M8QA 4DS5A 4W5TA 4B9TA 5FROA 5SWMA 3EZUA 1LWCA 4ELVA 2G8VA 5DGAA 1TVRB 4N47A 4FCYA 5CYQA 1GX6A 4CIEA 2AGOA 1LW0A 4DL2A 1CZBA 2HHQA 2IMWP 3TAEA 3KK3B 2W8LA 2R2SA 2HHVA 3KLGB 3CJ3A 4B9LA 4MFBB 2V4RA 4N76A 4CHOA 4CEAA 3IG1A 4URQU 4TYAA 4KFBA 4DTXA 3TAQA 4ZP7A 3AVHA 5KG1A 1C2PA 4DL5A 2JGUA 4DLGA 3K5NA 3T5LA 1LV5A 1RBSA 3EPGA 4CJKA 3TAGA 3SUQA 1SKWA 1NK4A 4RNFA 3OSPA 3TR8A 1WSJA 4DTSA 2OPSA 3IRXA 5KFXA 5KFMA 2AU0A 3I0RB 2VWKA 1U45A 3KK1A 1QSSA 1S6PB 4OKEA 5DG8A 1NK8A 3T5KA 1HQEA 3FQLA 4KO0B 4O44B 3PO4A 3H5YA 4C8OA 1Q9YA 3RMAA 3SQ0A 2VG7B 3I8DA 2V0NA 4CGDA 2XY6A 3LP2B 2GIQA 3L2WA 4GVMA 5KGXA 1TV6A 4CJPA 2OPPA 4Y1CA 3DOLA 4ED6A 1TKXA 1S1WB 2HNYB 4WXOA 4FJNA 4CEEA 2CKWA 2JEJA 3QIPB 4H54A 4QW8A 3SNNA 3QINA 4FLZA 3AO1A 3TAFA 2B6AA 4CK3A 3DLBA 2QE5A 3SV3A 2DTUA 4FZZA 4FYDA 1TL1A 5KFSA 3NGDA 4FJIA 3OS1A 2HW3A 3ZSZA 3HL8A 4ZTFA 3M8SA 1Z4UA 4KTQA 2OZSA 1QAJA 4O3OA 3NBPA 2Z1IA 3OYCA 1REVA 1KLNA 3Q8QB 1S0NA 4K4WA 1WNEA 4IRKA 1RDAA 4RW7B 3H5UA 4KI4A 1KVAA 2EC0A 3DOKB 4DQRA 4KE5A 5HRPA 4MIBA 1EX4A 5DLGA 3HVAA 1NK7A 1KVBA 1MU2A 3KHRA 1G15A 3T3FA 2B43A 4F4XA 3AVGA 4NLYA 5HP1A 4GC7A 4I9LA 1QE1A 4X2BA 3KK3A 3C6TB 3KIOA 1S0MA 5KFLA 4CF1A 4FZYA 4ECQA 4K4ZA 3AA5X 4OGEA 3PO5A 1VSMA 3RB6A 3OVNA 1BCOA 5I3UB 3DLRA 1RTDB 4NLOA 4KSEB 4ZVGA 3LP0B 1XR6A 4F8RA 1LWEB 2HNZB 4OLAA 5F8LA 1RT7B 4KKOA 3QZ7A 3OHBA 4FJ5A 1RT4B 1XWLA 1FKOA 1BISA 1S10A 3U3YA 4OL8A 5HROA 2BDPA 4CF9A 4CK1A 4ELUA 4ECVA 3O3HA 1VSDA 4C8MA 4Q43A 4DG1B 1IKXA 2DFHA 1N6QA 2HHSA 1W9HA 3OJSA 2XCPA 4EZ9A 3B6PA 4Q5VA 4Z0UA 4QAGA 2PZSA 3HP9A 1BQMB 4MKAA 1EETB 2ETJA 4B9VA 3AVMA 1UA0A 5F9LA 1TKZA 1S1WA 1RBRA 3ALYA 4O3QA 1VSHA 4IKAA 1KRPA 3HJFA 5C25A 1GOBA 4ZVHA 3DRSA 5EDWA 1JL2A 2KQ2A 3MXJA 3SPYA 3LP1B 5FRNA 3O4QA 5HLFB 4OKJA 2KZMA 4QPXA 4NLXA 4IG0B 4H4OA 4C8KA 3THVA 3ZT3A 4DMNA 2YNHB 4AHUA 1S48A 4FJ8A 3ZSOA 2XI3A 1KTQA 1XI1A 4KHYA 3NGIA 2Y1JA 2G8IA 4K50A 1WSFA 1XR5A 4ZMMA 1FK9B 1JL1A 3ZCMA 5CZ1A 3S3OA 1T03B 3U6FA 4FJJA 2IAJA 3GIJA 5KFPA 5CYMA 4RW6A 4DTJA 2W8KA 1JLAA 1R0AB 1JKHB 1NK0A 4NLWA 3MR5A 4M3YA 5KFIA 4I2PB 1YT3A 4Y2CA 5F8NA 1L3UA 4EBEA 4Z4CA 4CFAA 1U04A 2OH2A 3RWUA 2R8KA 3AO2A 4PUOB 2FLLA 4LQ3A 1RA6A 4EYHB 3GIMA 2R2RA 4CECA 1HNVB 2RF2A 2RKIB 1ZBFA 3E01B 5EWGA 2HNDA 1JLCB 4M3TA 4DU3A 3CDWA 2YKNB 3DM2B 5J1EB 4QWAA 2HNZA 4DFJA 1VSLA 1QQCA 4ECTA 5KT4A 3V6HA 3V81A 3TARA 5F8IA 3DRRB 3PHEA 1NKBA 1RT1A 1EP4B 1JIHA 3LZIA 2W9BB 4DF4A 1A5VA 3M8PB 3SI8A 3H5XA 4CEFA 1RTHA 2E9ZA 3OYMA 4MIAA 2ZE2A 2VA2A 1CXUA 1BQNA 4IR1A 3M9NB 5T7BA 3QEXA 1RT5A 1VRUB 1IKWA 3OS0A 5K14B 4Z4HA 1EETA 3QETA 3V9ZA 3CJ4A 2WONA 4KHQA 4HUGA 4NLSA 3V9WA 3H5SA 2ATLA 1TGOA 4EBCA 1Q9XA 4G1QB 1S9EB 1CZ9A 1HARA 4YFUA 1IKYB 3CJ5A 3LP1A 3KK2A 4YR3A 5EU7A 5HLFA 4FM2A 3PX6A 3M8QB 3OJUA 4O0IA 4ED0A 3EY1A 3D28A 5CYQB 4CGGA 3KD5E 3T5HA 1LW0B 3PW4A 1NNDA 4EBDA 2UVWA 2KFZA 4ZTJA 3VA3A 3CJ0A 3QEWA 1L3TA 1XC9A 4CJQA 4JS5A 3K5OA 2HB5A 3KKSA 3LPTA 1BI4B 4BDZA 2P5GA 1WNSA 4ECYA 3RRHA 4J9LA 3IS9B 3QEIA 2FJVA 1S49A 4N56A 4MK9A 5DK5A 1KLMA 5L1LA 3PX4A 3KD1E 2OPSB 3IRXB 4CERA 4FJMA 3NH1A 1BIUA 4CJVA 4E89A 3CFRA 5CY4A 4W5QA 4TYBA 4CHPA 3KK1B 3ISND 3HVRA 1K1QA 2KW4A 5C24A 2VA3A 1RDBA 5DMRA 3PX0A 1W0HA 4OPKA 3AVAA 4FLVA 3M9MB 2IM3A 3CJ2A 1T94A 5KG4A 3RB0A 4HKQA 1TV6B 4ED8A 2OPPB 3L2QA 1SV5A 3DOLB 1QSLA 1VSJA 4ZPDA 2HHTA 2LSNA 3OYFA 2KZZA 4NLVA 3VQEA 4DL4A 2WCXA 3VQ6A 3GQCA 2IJFA 1W25A 4NZ0A 4CGHA 3SUPA 2AGPA 1S6QB 3OLBA 5EWEA 2B6AB 4K4XA 5CZ2A 2VG6A 4ID5A 1LWFA 4E1NA 1TL1B 2F8SA 4KBIA 4E7KA 5F8MA 4J9MA 3H4DA 2PYLA 3QLHA 2BRKA 4PQUA 1DTTA 2A1RA 3NBPB 4R5PA 3NF8A 1YVFA 4YP3A 1L5UA 4FJHA 4J9RA 1REVB 5KG6A 4KHUA 1VSFA 4F3OA 4I2QA 4FBUA 5DG7A 1S0OA 1NOZA 3H08A 4K4TA 1HJRA 1RNHA 3AVBA 4ZVEA 4FM0A 4IH6A 4G1QA 1FKPA 4Y34A 3TVKA 5KFQA 4E0DA 5D3GA 4KHNA 3DLGA 1XHZA 3V6KA 4CIFA 5KFDA 1NHUA 4K4SA 1MU2B 5KFHA 4IH5A 3BDPA 4Z4IA 3QNNA 3I5BA 1S1TB 5HP1B 3AA4A 1RA7A 1QE1B 2AQ4A 5KFYA 3LAKA 4YR0A 3KNAA 4B08A 3EYZA 4BDPA 1C6VA 2AX0A 3V1OA 2EHGA 1JX4A 3HM9A 1BI4A 1I39A 4FW2A 2J6SA 4DFMA 1NJWA 5DLFA 4QWCA 1TK8A 3AA3A 3QERA 1VSKA 4BWMA 4RUAA 3IS9A 1IM4A 1TP7A 3K5LA 4QCLA 4KKOB 3HPGA 3AO5A 1HMVA 1J53A 4KRFA 1FKOB 3SQ2A 3SI6A 1ZETA 1YVUA 3IGNA 5HROB 2YKMB 2GBZA 4RW8A 1L3SA 1U4BA 2R8HA 5EWFA 4B9UA 1HYVA 1IKXB 5KFVA 3NDKA 3HO1A 1N6QB 3CQ8A 2JLEA 1GOAA 4F4KA 4TQRA 4CF0A 2R8JA 1N5YB 3K5MA 3M9OB 1S5JA 1VRTA 4IRCA 2XY7A 4ID1A 1SH2A 1TKZB 4IKFA 5FDLA 5C25B 4RNOA 1NK5A 4BE0A 1TKDA 2IGIA 3DRSB 3FFIB 3OYIA 3VQ8A 4CJRA 1S6QA 1NJXA 3GILA 4J9NA 2G8FA 2Z1GA 1HQUA 4CJ4A 2E9TA 2QXFA 2XY5A 4H4OB 1T05A 1MMLA 3NHGA 4ED3A 1T3NA 4CGJA 4KTZA 4CJ3A 3RTVA 4IG3A 3GIKA 3OYLA 2B5JB 2XHBA 4K4UA 3Q8PB 4CJUA 3CM6A 3KTQA 2DY4A 1RDRA 2RN2A 3VQDA 3QNOA 3OL8A 2IAJB 2ZD1A 4F4ZA 4IDKA 2KTQA 4ZPBA 3RMCA 5CYMB 5KT2A 4RW6B 1D1UA 4E7LA 3DLHA 1JLAB 2AGQA 4I9QA 5F8GA 3DLKA 1C0UA 3P1GA 3OYBA 3N6MA 3K2PA 1TAUA 4R0EA 3RAQA 4NLRA 2XGQA 3MECA 4YNQA 2O4IA 2RDIA 1XR7A 2FBYA 4CJEA 5HRRA 1NK9A 4ELTA 2FVCA 4O3RA 1S1TA 3CVKA 1C1BA 3OHAA 3RB3A 3AVCA 1U47A 3CFOA 2P5OA 2RF2B 2IOCA 4U7CA 3T1AA 3FQKA 2HNDB 1WSHA 3H2LA 4C8LA 1BHLA 2YNGA 3OYDA 1WSIA 2ZKUA 4Q0BA 4KAZA 4IBNA 3V81B 2IC3A 3QIDA 2W7OA 1RT1B 5DQHA 4FM1A 1JLGA 3LANA 1JXLA 2FLPA 3P5JA 4O4RA 2YKMA 1SL0A 4R8UA 5JXSA 3KMQA 3NKYA 3NAHA 5F9NA 1D0EA 2FVQA 1RTHB 4DSIA 1X9MA 3KLHA 2ZE2B 4RNHA 5HBMA 3M8RA 2OPQA 1BQNB 2YNFB 4LH5A 1RILA 4AHSA 4CGFA 1RT5B 2ASLA 5KRSA 4RW9A 1IKWB 1SUQA 2R7YA 2ASJA 1N5YA 4WZQA 2A1SA 3GV8B 2FBTA 1Z26A 3MR6A 4FLXA 3HVTA 2WONB 1D8YA 4HCBA 4MK8A 5KI6A 1JXEA 2I5JA 2KFNA 3FFIA 4JV1A 3DLEA 4CEBA 2HHXA 3KK2B 5L1IA 5DQGA 1IG9A 2IBKA 1BCMA 5KFNA 3QZ8A 3VQ4A 3UDLA 4M3WA 3RR7A 1JLFA 3KLIB 2VG5A 4FVMA 4DSEA 4J9OA 3CG7A 4NRUA 2ASDA 4JS4A 5KFGA 3VQAA 4NLQA 2B5JA 4E7JA 2DFFA 5KG2A 4MH8A 2JEGA 4DTMA 1IO2A 3CIZA 3V1QA 1WAFA 5SZTA 4DQPA 3IN5A 4MK7A 2W9AA 3NF9A 4DTRA 3FRZA 3GV7B 4F3TA 1QAIA 3Q8RB 4J2EA 2AWZA 4ZPCA 4CHQA 3ZT4A 1KLMB 4HUEA 4IH7A 4JRPA 4KAIA 4NLPA 5KFOA 1HYSB 1ZBUA 2AJQA 1Q8IA 1B9FA 4DSLA 3LZJA 4ZP6A 3QO9A 5KFEA 5KT3A 4AHTA 5C24B 2W7PA 3UR0A 2X74A 4FJ7A 4IQXA 3OYNA 3N6LA 3SQ1A 1VSEA 1WAJA 3LDSA 4HUFA 2G8WA 1U09A 1UAXA 2BANA 4O3NA 1SV5B 3G86A 3JYTA 3ICLA 4XO0A 3WNHA 4CHZA 3ZSXA 2IM0A 4FJGA 3BSCA 2QK9A 3C95A 2HVHA 4JV0A 3KLFA 1A5XA 2VG6B 2IM2A 4ID5B 4DSFA 1LWFB 4KHMA 3HT3A 4LQ9A 1OS5A 3G10A 3TQ1A 3BQ2A 5J2NA 2VWJA 5I42B 4EO6A 3QLHB 2YNFA 3ZSWA 4AH9A 4PQUB 1DTTB 1GX5A 4FW1A 3H40A 3V9UA 2C28A 4R5PB 3EPIA 3V4IA 3IAYA 3DMJA 4XIUA 1JLBA 4J9QA 4OVLA 4E3SA 3SPZA 3MEDA 3CYMA 1CXQA 4LY7A 4I2QB 2F8EX 4DLEA 3BJYA 3RRGA 5KRTA 5JUMA 4RNNA 4O0JA 4F4WA 4Z4EA 3AO4A 4NYNA 2JC0A 3AVLA 1FKPB 4NCBA 1ZYQA 4C8NA 4EP4A 4Q8FA 1S1UA 5D3GB 3HPHA 3HKWA 3DLGB 5J2QA 3DI6A 3ISNC 1UWBA 1TK0A 3D0PA 4K4YA 4ECZA 1VSIA 3KLIA 4ED7A 3AA2A 4E1MA 4EP5A 4ECUA 3NF6A 3VQQA 2IS3A 1SKSA 1C1AA 3K58A 4KTWA 2WTFA 1BL3A 4W5NA 3H59A 4W5OA 1LW2A 5KFZA 4RU9A 1NKEA 4KB7A 3HSTB 1JLQA 5KFTA 1TAQA 4F4YA 2OZMA 1IH7A 3AVFA 4CEDA 4GMJB 2D3UA 2HMIA 4KREA 3OYEA 3EZ5A 4QWEA 2FLNA 2E4LA 4KB0A 3H4BA 2WRMA 4HYKA 4RUCA 1LAWA 3NMAA 1J5OA 4EYIB 2J6UA 4M41A 5FRMA 4DS4A 4CJFA 4MKBA 4IFVA 3K59A 4B3OA 3MF5A 2RDJA 1HMVB 3NL0A 1JLEA 2QV6A 4DTPA 3RMBA 2D0AA 5KFJA 4NCGA 4RW8B 1HYSA 4OPJA 3S3MA 2XC9A 2JC1A 1GOCA 4B9MA 3LPUA 3T5JA 3QGGA 4IFYA 4M3ZA 3OYGA 3V9SA 1CSJA 4IRDA 4K8XA 2C2DA 3WNGA 4OLBA 3KLEB 1RAJA 2BE2A 5KG0A 2IJNA 3MR3A 1VRTB 5KFKA 4F2RA 2DPIA 2UVVA 5FDLB 4Q44A 1NHVA 3I5AA 1RYRA 4CK2A 1K1SA 3FSIA 5HRSA 4KI6A 4EO8A 4FLTA 1HQUB 4LD0A 4TY9A 3SFUA 5JS2A 2ILZA 4AHCA 3AVKA 1T05B 3SYZA 3F73A 5I42A 1YTAA 4FBTA 4QWBA 4HVJA 2XCAA 4J9SA 4IG3B 1HPZA 4TN2A 3KHHA 3QEVA 4NLGA 4PA1A 3TAPA 3NH0A 2BRLA 1J54A 4RNMA 5KG7A 2ZD1B 4H4MA 4IDKB 4O4GA 3G6VA 3G6YA 3V1RA 3MEGA 4HCCA 4JRQA 2GV9A 5KT7A 4DU1A 3RMDA 2W9CA 4PY5A 3VN5A 3DLKB 1C0UB 4IOBA 4WE1A 3V9XA 2Y1IA 3MECB 4FZXC 4RW4A 3TAMA 3H98A 3I0SA 3LALA 2EX3A 3SZ2A 1C1BB 3UPFA 4G3IA 2QKBA 4NLDA 2NUBA 2X6SA 4Z4FA 4I7FA 3BQ1A 2WOMA 2BGGA 2Q3SA 5E41A 2ZQBA 2XO7A 4BDYA 4WFXA 1L3VA 5KT5A 3KJVA 3NAIA 3DDKA 4KHRA 2X6NA 4AHRA 3TANA 3K57A 4LSNA 1KSPA 4M42A 4FXDA 4DTOA 4ICLA 3GYNA 4J9KA 2YNGB 4LSLB 3ZSVA 3PW0A 4Q0BB 1C0MA 2IC3B 3SFGA 2GIRA 3DYAA 2GUIA 1JLGB 4O5BA 2HWHA 3KOAA 4R8UB 3LAMA 1RT3A 3V6JA 3C6UA 4J2DA 5DQIA 2ALZA 3FDSA 3QESA 4M3XA 4KHSA 3KLHB 3KMSA 5HBMB 2OPQB 1B9DA 3OL6A 2R8GA 2C2RA 2FVPA 3VQSA 4RW9B 1SUQB 4CE9A 1D5AA 3KLEA 2WK4A 3LP3A 3KKRA 1S9FA 4DSKA 3SQ4A 5KFCA 1C0TA 3HVTB 4KV8A 3JSMA 2D0CA 2I5JB 3HP6A 3MEEA 1KFSA 1TL3A 1S1VA 3T19A 4ED2A 3DLEB 4H8KA 4M94A 3DRPA 1DLOA 2OPRA 3NAEA 4CCHA 4N5SA 4KHWA 1RT6A 4BACA 1RTIA 4DWIA 1X9SA 1RT2A 1S9GA 4FJLA 1HYZA 1X1PA 1DTQA 1JLFB 3CWJA 4L8RB 3ZSRA 2VG5B 4FK4A 5KTQA 3RR8A 4CEQA 1WN7A 1C1CB 4ZPAA 2XI2A 4FJKA 4DL3A 4QW9A 4KPYA 5J2PA 5J2MA 3S9HA 4RG8A 1RTJA 4BE2A 4JUZA 3QIOA 1S1XB 4K4VA 5EUHA 4O3SA 4YMEA 1HNIA 3NGZA 4ZHRA 3BSOA 2DPJA 1RCHA 3VQPA 3V6DA 2WHOA 3L8BA 4N41A 2P51A 2YHBA 4DTUA 3LWMA 5DG9A 3OL7A 1IKVB 2Z1JA 3IGVA 1K6YA 1UA1A 2DFEA 4PWDA 5F8HA 4B8CA 1TK5A 3Q8SB 3BGRA 5C42A 3SUOA 1SL2A 3HVWA 4OJRA 3QO9B 3RBDA 4B8AB 3L3UA 1XHXA 5DGBA 1WSGA 4AHVA 4NYZA 4QWDA 2YHAA 3CDUA 2BANB 4Y1DA 1TVRA 1QHTA 2G8KA 3JYTB 5L1KA 4Y3CA 3TI0A 4LSLA 1ASWA 5JS1A 4FS2A 3HXMA 4BE1A 4DSJA 3OY9A 1SH3A 3PW5A 1JXBA 4M3UA 2FJXA 3KLGA 1KHWA 1VK0A 4MFBA 2OYQA 4DL6A 3MR2A 3KLFB 3ZT2A 1T7PA 2JEIA 4NYFA 2ATQA 4JLHA 5KG3A 1TKTB 4NLTA 3MXMA 5J2NB 1QUVA 2FC0A 4ECRA 1FXXA 4KB1A 3ZSYA 3S3NA 4ZP9A 3V4IB 2R2UA 3NGYA 3DMJB
chains in the Genus database with same CATH superfamily
2R8IA 3PACA 3I0RA 2FC8A 2QLXA 1RDDA 1SKRA 1QHAA 1S6PA 3L2VA 1NJZA 2FVRA 3OTEA 5T14A 1KQSM 2O8FB 2IMOA 4WZMA 4KO0A 2V7YA 3BO4A 3TU5A 1QS4A 4DN9A 4DQIA 1KONA 3MFHA 1ZC6A 3WXLA 5J2QB 3MD3A 3HDSA 3OYHA 1OJ4A 4CF8A 1EJ7L 3M2RA 2E1AA 3MUTP 3O9QA 4B9NA 3QIPA 1C1CA 3C66A 4CJ5A 4OHVA 1ZA1B 3PEHA 2QXLA 1U49A 5AQIA 3H3NO 4DFKA 1S1XA 3ETOA 4HEA9 1U7LA 4ETXA 2C3OA 5B0FA 3GU0A 2R4FA 5H9EK 1WKJA 4HI1A 2JJ4D 4WCEL 1F3VA 2LU1A 5KFUA 4G1PA 3VQBA 3DOMB 1J5OB 2OAUA 1BU6O 1J9AA 4FLYA 2CQGA 4IFVB 3TYTA 5LJ5Y 1JLEB 1D4XA 4OMFG 3F2KA 4K41A 5BYQA 2WVEA 3G6XA 2G1DA 5E5NA 2XSJA 3G0ZA 4DV5J 2OSQA 2ZH9A 4HLBA 4GVBB 5KT6A 4N8NA 4DCHA 5BR9A 2B0GA 1Z6RA 4Z7CA 5C5JA 4FXVA 1BMQB 1BDGA 2F96A 4ZVQB 5KFBA 3PW2A 4DV1K 3PR5B 5DETA 3TO8A 4FLWA 4F50A 2D7SA 3GIIA 2K1RB 1PJ6A 2F63A 3JB9k 5I3UA 4RZRA 1RTDA 4C97A 5IT9U 4NMLA 3RRKA 3KWGA 3LP0A 3QGPA 1LWEA 3WNEA 1PYSB 3P5TL 2F7TA 2HBZB 1RYSA 3PJWA 1SJ4P 2NYHA 1NEEA 1RT4A 4FWPA 2BKPA 2XGPA 2D4WA 3AT1B 1M0SA 1G1XA 3T1HJ 4A2BA 4ECXA 1SL1A 4CO0A 1H2VZ 2HHUA 4CHNA 5LL6Z 2VC1A 5THWA 4FPBA 4R25A 4BY9C 1XN9A 1RZMA 3SJJA 5E3RA 3BV8A 1FKAF 3BPSP 2IA6A 2Z2ZA 3SCXA 1D9FA 3N4PA 1VQ5N 3CJKB 3JQKA 3G87A 1TTHB 3R5BA 3D3CJ 2AT1B 3AB2B 2DO4A 2WSEC 2ZEJA 3NH2A 3ZSQA 2G8HA 1F21A 3D45A 2F7VA 2AW0A 3CMAN 3NF7A 2HBJA 1VIOA 3CIPA 3GJRB 5G4DA 4DF8A 1D9DA 3E66A 3SQOP 1TQLA 3BF4A 4IG0A 1URRA 3R97A 3SV4A 5KFRA 3G71N 3AGKA 5LXYA 2AMCB 1I94F 2V4QA 3HHKA 4ICLB 4BG9A 2CVEA 3CJ7A 1F5BA 1S3XA 4TXSA 1B0VA 4CF2A 3DYAB 1FK9A 4DV4J 4J9PA 3PVXA 1M5OC 2OTLS 1RT3B 1T9TA 1BY9A 4P2XA 3NCQA 3AVNA 2GTDA 4JI7F 4E7HA 3TR5A 6AT1B 1YJNS 1OY6A 5M2RA 3W8GA 4H0TB 2CFXA 3SUNA 1YTYA 4I2PA 3KLVA 1Z25A 4H0YB 2M70A 1HR0K 4YHHJ 3PV8A 4TQSA 4P7VA 1FXLA 2MY7A 1JJHA 1Y97A 4JB8B 1KN6A 1H1VA 3D6FB 2AYBA 1NGBA 3MEEB 1FFSB 4PG4A 3EEQA 1YTUA 3OYJA 1SQGA 2GO8A 1RTIB 2WVDA 1F5CA 2DTJA 2OD6A 2YKNA 4U6PA 3Q86A 3K9KA 5HVFA 2G8UA 1HW8A 4FS1A 2PBDA 5G0RA 1CS4B 2FUG9 2UVRA 1GMWA 3M05A 4MIWA 5J2MB 2W9BA 1RP5A 4RKUC 4OGCA 1RTJB 2ZHOA 2DGWA 2LP4A 2O4GA 3M8PA 2OKQA 4M5NA 4DX6A 4GW6A 4ETZA 1HWJA 4ZHRB 4ES3A 5E7OB 4DR2F 3BZKA 5BR8F 4MTPA 3ZZ0A 2UUTA 1O13A 4OHWA 2C2NA 2PA3A 1XNRJ 1ZTWA 8AT1B 4YB5A 1W7AA 4BBYA 1KVCA 5C15A 4BWJA 2FB0A 2PYJA 4PWDB 1YJRA 4OYWA 3L3VA 3GFYA 1O51A 3VQ5A 2CUYA 3T1YK 3J7Z5 2ACMA 4C98A 4PG8A 4WXWA 1RHKB 5HO4A 5FLXY 4NZ6A 2CJQA 4ZVFA 2HFSA 1S9EA 2BQRA 2FBXA 1OYEA 3N6NA 2JVOA 1K47A 2GVZA 2YX7A 3VGMA 1UW9A 3BBFA 4F9OA 1SS6A 4P75A 2EKNA 3L3CA 1GXTA 2LXFA 3HHDA 2G8VA 4C4WA 3B4DA 3BZQA 4MDAA 3BP8A 2O67A 3OTOK 1RWUA 3TAEA 5DZ7A 1OH8A 3ZYYX 2AJ2A 4K0KF 2HHVA 2V6AA 1TUUA 3KLGB 4L3QA 4V19X 2JH3A 2MSTA 2Z4PA 4JI3K 4DTXA 2Z2YB 3KJFB 4ZP7A 4IO9L 3BPDA 4AD6A 4DL5A 2JGUA 2J7WA 3I33A 3I82A 8ATCB 3TAGA 2RS8A 3FSYA 4RNFA 3OSPA 4DTSA 4YOUA 5KFMA 2AU0A 2B3TB 1BG3A 2VWKA 3PJ9A 3IR6B 4PABA 2OMOA 4CD1A 4ES2A 3EVMA 2YBVA 3H7HB 2PMWA 3LUYA 5KGXA 3ETMA 2CXEA 1S12A 2JWNA 1YBUA 4CJPA 2OPPA 2CJXB 1Y64A 5D4NA 4ED6A 4U95A 2HNYB 4CH7A 3O9SA 1PCAA 4FJNA 4OLOA 4LF1A 1BWEA 4P52A 3CQYA 3QINA 5ETVA 1FWKA 3PXGa 5DM7L 3TAFA 2B6AA 4U7UK 3DLBA 3P31A 3G8SA 3SV3A 2ZC4A 4YB1P 3UDVA 1TL1A 5JVHQ 1RLCL 3DLJA 3MN7A 3HL8A 4ZTFA 3M8SA 2NSBA 4KTQA 3M6WA 1QAJA 4O3OA 4LREA 3NBPA 4C1NK 2DNYA 2Z1IA 2YJFA 4CO5A 1D3WA 2BEFA 3MUVP 4BR5A 4HACB 2DHXA 3EVOA 1KLNA 4ID8A 4CP5A 3RGIA 3J7ZO 3CF5Q 1X5TA 3R27A 5H9EJ 3UDEA 3HOTA 4RW7B 4DR1F 1X0FA 2Q3PA 1VQSA 4KI4A 4JKFA 2EC0A 3DOKB 4QBUA 2DXEA 4A8YA 5HRPA 5DLGA 1ZBTA 1NK7A 1KVBA 1MU2A 3FNNA 3T3FA 4F4XA 1YVNA 2RSQA 1QAXA 2OGUA 4G65A 4M1KA 3PIOQ 1BE4A 3RSEB 1NHKL 3HCXA 3RW6A 4OGEA 4K4ZA 3PO5A 5DJBA 2FHJA 3RB6A 4QR0A 1BCOA 1CJTA 3MN5A 4B1ZA 1E3MA 4PPZA 4CZMA 4KSEB 4ZVGA 4DV1J 4F8RA 4HI2A 2E2OA 3CEDA 4OLAA 3NVMA 2YWWA 1S76D 4FJ5A 1S10A 4ILGB 2YX1A 4JKBA 2XYGB 4OL8A 2PA8D 2CJBA 4X65F 4CH1A 4DR3F 5KQDA 3CD0A 5BN8A 3SBMA 5GAHP 2PD1A 1U1NA 2OTLN 3D0IE 3I55S 2Z57B 1NAQA 4NEZA 1E4FT 4B17A 1YJNN 4Q5VA 3TZYA 2PT0A 3OA9A 1S6UA 1K8KA 2HYIB 3HP9A 5A0YB 3EGVA 1TKZA 5JLFA 1WF2A 3MM6B 2OO4A 3A4TA 1RABB 5FPDA 2FY8A 4BQLA 2LKZA 1JL2A 3UD3P 5FRNA 4X64F 3J80Y 1ILYA 3POTA 2AD9A 2AYGA 4DMNA 1TELA 1KTQA 3H25A 4KHYA 4P74A 2Y1JA 3UN2A 1WI6A 2DNZA 4JI1F 2DRDA 2ROEA 3R7SB 3S3OA 5FJ4A 4H0PA 4A5AA 5KFPA 4IEIA 1SVDA 1LCUA 1JKHB 4MKVA 1QQMA 3AGRA 1EQMA 4Y2CA 3ZTSA 3SEOA 3SAGA 2FLLA 3KWIA 2GZOA 2OCEA 3U9DA 4A5BA 1NGEA 3OBIA 3R1XA 1RAAB 4OYIA 2RKIB 3WC0A 4C3KA 1ZBFA 3AOBA 2X3GA 1N5VA 2RQCA 3W9HA 1Q81T 2NXUA 4JI8K 4UUXA 1HR0J 2I6WA 1GLFO 4DFJA 3NXZA 3MMCA 2M8DB 3ZETA 3V6HA 2HZVA 2U1AA 3V81A 3CCLS 3TARA 2CQ2A 3CNQP 1EP4B 1I94K 1P9YA 2XZWA 5AZJB 4HHJA 4CD3A 3TZXA 1A5VA 3Q8YA 4FP9A 4CEFA 2E9ZA 2HBKA 3OYMA 1EKSA 3QAEA 3AQOA 1VR6A 1U6BA 4ILRA 1TL4A 2IVNA 3FZMA 2DNMA 2YPYA 4JI7K 3Q89A 3TA2A 2V2ZA 3SJHA 3PSIA 4BRAA 2BKNA 3MM6A 3H5SA 3OBYA 1FDDA 3FK4A 1VS3A 4EBCA 4PWUA 1MWYA 1CZ9A 1HARA 3QICA 1ZM4A 3I96A 2Z58B 4O0IA 3VERA 3T1YJ 1RBAA 1OSDA 2GO9A 1M5VC 3E9PA 5CYQB 3CC7S 3KD5E 4IO1A 1NNDA 2BJ1A 4EBDA 3TEHB 3NWRA 4I6AA 4BDZA 2P5GA 1Q79A 1I51B 4OI3A 3R7NB 5LL6d 3L6QA 3AXKA 3OTOJ 2D3OR 3CXCM 4J9LA 3IS9B 1WKKA 1FRHA 1CJVA 5DK5A 3AOCA 2YI1A 3FBBA 2HFNA 1HLUA 4Q7AA 4DR2K 1BIUA 3O6WA 2DCUB 4F3MA 1VQ4S 4JI3J 4CHPA 4ZLLA 4NX9A 1X7VA 1NGHA 1Y0HA 1RDBA 3BEGB 2CPZA 3M32B 1W0HA 3AVAA 4IUFA 4FLVA 2IM3A 4I67A 5KG4A 1A7GE 1QJHA 3RB0A 4OYZA 3ADAC 1QSLA 2GMJA 3OYFA 2WCXA 3JAMO 1NCLA 3TZWA 4P72A 3WBZA 3GQCA 3VAHA 1DKGD 3CD7A 5JMNA 1HI0P 3NNAA 1UMJA 5EWEA 4MAKA 2ROGA 1LWFA 4E1NA 4KBIA 4E7KA 3J7ZT 5F8MA 2F8HA 3DCAA 4K0KK 4UOGA 4PQUA 1DTTA 3VEZA 4OV1A 1X8DA 3M6UA 3NF8A 2MY8A 4FJHA 1WG1A 1ZM2A 2JSXA 3GDQA 4J9RA 2X1AA 2ZJQL 5KG6A 2KT3A 4OYAA 3QT6A 3AH6A 1R0CB 4F3OA 4FBUA 4KPCA 2PN6A 3AVBA 4ZVEA 4FM0A 3M8ZA 1KAXA 5KFQA 5M1QA 3R2DJ 4DPXA 3I55N 2GGPB 2MKSA 5KFDA 1KD1O 4F04B 1JNRB 1TUYA 1NHUA 5D78A 2XHWA 1VQYA 4CLFA 3R6GB 1ZS6A 2ERRA 1FD8A 5KFYA 3S8SA 5EX3A 4BDPA 1X3NA 2LXUA 1C6VA 2EC2A 1JX4A 4I69A 4LF4F 1MMDA 3LL3A 4ANDA 1AUSL 1NJWA 1IBMF 1TK8A 1WTBA 3IS9A 4B1YB 5E2QA 2BM1A 3AO5A 1J53A 4KRFA 4XDDA 2YWGA 3SQ2A 1ZETA 1YVUA 3IGNA 5HROB 2YKMB 5KPTA 1RWWB 2P6TA 2I9SA 1U4BA 2FQQB 4USKA 3KG0A 2ZVIA 5MAOA 2R7WA 5AR0A 1N6QB 3W62A 4IJAA 5AQXA 2M4MA 5A2QU 3W3SA 1GOAA 3K17A 3ULEB 3K5MA 3M9OB 4DR1K 3CMQA 3CC2S 5B8HA 2XY7A 1EQYA 2DB1A 2CZVC 4NWBA 2OTJS 4BE0A 3DRSB 3OYIA 5IV3A 3AY9A 4K42A 2G8FA 2Z1GA 2ZC3A 3O1WA 2JDJA 3BS9A 2XMJA 4EFAC 5K20B 2E9TA 4H4OB 2F9TA 2MKJA 1IJJA 1T05A 1MMLA 3MAAA 1T3NA 1RKJA 5CD4H 3MM7A 3RTVA 2L48A 2E1RA 3CCLN 1YUWA 4CYUB 4CJUA 3CM6A 4MJKA 2DY4A 1FDBA 1N36F 2RN2A 3QNOA 3O3LA 4X65K 4RTFD 4CLKA 5KT2A 1D1UA 4ZJQA 3FGVA 2VJUA 1JLAB 2QO3A 1AYEA 1ZM9A 4I9QA 1FRLA 1CJKB 2GGPA 3OYBA 3N6MA 1NU4A 4CLTA 3G8QA 4XTTA 2XGQA 4YNQA 1P9QC 3GG1A 5HRRA 2F65A 2RIJA 2FVCA 4O3RA 2MLYA 5JJBA 2COLA 2P9PB 3EGZA 3T1AA 5M1NA 1Q8BA 1OPIA 4NA3A 4C8LA 2Y3YA 1KQSR 3UE2A 4X64K 2RRAA 1E6YA 4KC5A 3OTBA 4R79A 1FT8A 4IBNA 2IC3A 2O8CA 3CC7N 3SDEB 1IG8A 1DURA 5AQYA 4U8VA 1JXLA 1GK8A 3GCXP 3P5JA 4JI8J 2YKMA 4DPWA 4R8UA 4Z37A 1RXOB 2Q36A 1D0EA 2CH6A 4JI1K 2MKHA 2Q1LA 4RNHA 1BQNB 2YNFB 3HD2A 3WIVA 3IAS9 4Y65A 1I94J 5KRSA 2R42A 2VD3A 1S5ZA 1ZPVA 4BR4A 4JKEA 5HJXA 3MR6A 4FLXA 4OX9K 5ETKA 2WONB 2KH9A 1JXEA 2I5JA 2ADCA 1VQ4N 2XMKA 1N8RO 4EAHD 4JI7J 2DNLA 2K3KA 1ATRA 3ET6B 2LCWA 5CXTA 3RR7A 3NNCA 3RUBL 3KLIB 4FVMA 1MWMA 2AZ1A 1RWMB 5B7WA 4DSEA 4J9OA 2DVIA 4OX8A 2GJIA 5BRDA 5HMXA 4NLQA 2YH0A 1JWWA 1NB7A 2XMAA 2XBPA 1U1OA 3CIZA 3K8WA 5EN1A 3VEOA 2OANA 1SPBP 2MXYA 4HTIA 4I6YA 3N01A 1YBTA 3FRZA 4F3TA 4KQZA 5GMDA 1YZ6A 3FZKA 4Q2MA 1ICEB 2D3O1 1WG4A 4KAIA 2AEJA 5EX5A 2H5EA 2AJQA 1Q8IA 4DSLA 2LECA 3R3TA 5KFEA 1SZ2A 5C24B 2M9KA 3CETA 3N6LA 3SQ1A 4DR2J 2ADBA 1U09A 2R7TA 2OHDA 5CCLA 1QVGM 4XO0A 1XQSC 4OX6A 5HMZA 3UCGA 1NLKL 1Y9OA 5LM7E 4DX7A 4JV0A 1A5XA 2DPNA 3A5LC 4ID5B 3IP0A 2BKOA 1OS5A 3G10A 5HL7L 2VWJA 1B70B 2YNFA 4DL0C 3ZSWA 4AH9A 2BJEA 2J9CA 4FW1A 2LEBA 2UXBK 3EPIA 4WTYA 2XYHB 3V4IA 3IAYA 3A3NB 5E84A 3HHNB 3BBCA 1KC8O 5CD4A 4UW2A 3Q8UA 2W41A 3CYMA 4LY7A 4JKCA 4K0KJ 2JL9A 4A48A 4W92B 4HWIA 4KH0B 5JUMA 1G3OA 4YB7A 4F4WA 1P8ZA 4NYNA 3AVLA 1FKPB 3U1NA 1ZYQA 1CEZA 4HR2A 4EP4A 3PYFA 1UZDA 3HKWA 2QX0A 5A8WB 3I87A 4NLCA 4ER8A 1VSIA 4TVAB 3KLIA 2MQOA 4EP5A 3AA2A 4ECUA 3CC2N 1SKSA 2V63A 3K58A 5GIPA 3H59A 2OFGX 1TAQA 2LQ9A 5E3CA 3WT0A 3AFGA 2OTJN 1IH7A 4CEDA 4DR6F 3CJTA 1HKBA 2D3UA 1PC5A 2D0OA 2HMIA 2CPDA 2QLBB 2CRLA 4KREA 1CULB 1R89A 3AAQA 3EZ5A 3OYEA 2RILA 3H4BA 1QTNB 2P9CA 4RUCA 3NMAA 5AQGA 3I9V9 2HPUA 2CPIA 4ZITA 1GLBG 1U6FA 3S3MA 2GHPA 2XC9A 5CA5A 3PYGA 1GOCA 3QGGA 1NSPA 2AP1A 2NS1B 2QFJA 4GY2B 1CSJA 4IRDA 5ETPA 4UY8O 4RBVA 3GSDA 3C16B 2BE2A 2V9KA 1RUSA 2G0IA 2B4PA 1PO6A 3H8YA 4LT6A 1JJ2M 1NMEB 4KJIA 5FDLB 5FIIA 2G9OA 3X3UA 9ATCB 1AZSA 3L7OA 3DU6A 1RYRA 4CNZA 5HRSA 3HZ6A 2BA9A 4EO8A 2AJFE 4DR1J 4LD0A 3MM8A 4M5DB 3H2UB 1CZAN 4FWRA 2ILZA 2IFXA 3AVKA 3F73A 2AV5A 4OJ1A 4QWBA 4LF4K 4HVJA 2MKKA 2CDRB 3MD1A 2XCAA 3AJ2A 5HSPA 1IBMK 4BRLA 2LDYA 2RRBA 3PM9A 1ZPWX 3SSQA 1UFWA 3D54A 3UFCX 2X3DA 2PMHA 2DR7A 2ZH3A 1FNXH 4NLGA 4PA1A 4BG8A 3LDPA 3RU0A 4H4MA 3DGVA 3MEGA 2XNQA 2YWHA 4JRQA 4DU1A 2W9CA 3R6MA 2VONA 2D9OA 1C0UB 1AT1B 3O44A 1FERA 4AE5A 3V9XA 4FZXC 4RW4A 3TAMA 4BRHA 4JKGB 3SZ2A 2EX3A 1C1BB 3QBWA 4X65J 2NLWA 1H6KX 1B0PA 4G3IA 4CZGA 1UAWA 2X6SA 5GAGU 2WOMA 4CWBA 1RAOA 1UL3A 5E41A 4BDYA 1L3VA 3KJVA 3NAIA 4AHRA 4LSNA 2QN6B 4M42A 2XM3A 2HRYA 3GYNA 4J9KA 4LSLB 4U96A 1LOTB 4DHYA 4QIWD 5B0EA 3PW0A 1C0MA 1BLUA 1XIQA 4QU6A 4BRCA 2GIRA 1SKUB 2O8BA 4O5BA 2HWHA 5GMKa 3CIMA 4KHPF 4J2DA 3WC2A 4K25A 4X64J 4M3XA 3JTOA 1EQ0A 1Q4RA 3OL6A 2R8GA 2FVPA 1N36K 2VV5A 1SUQB 1D5AA 2WK4A 1PC4A 4NE9C 2MGZB 5KFCA 3HM8A 1G7CB 4JI1J 2C2KB 2NXEA 1W97L 4KV8A 2UU9F 3HP6A 4ED2A 2CNOB 4M5JA 4H8KA 2F4FA 3DRPA 1DLOA 2OPRA 4CCHA 4QYZK 4KHWA 1RT6A 3WXJA 4EWTA 4DWIA 1RT2A 1S9GA 4CLUA 4WFNL 4OX9J 1HYZA 1DTQA 4L8RB 2VG5B 2P9LB 5KTQA 3RR8A 3DXMA 1WN7A 3LM9A 4DL3A 5J2PA 2YX6A 1GFWB 2NZCA 3PFOA 1BD6A 1IVZA 1U1RA 1FJ7A 4ZCIA 5BRHA 3QIOA 5EUHA 3IBFB 2J9DE 3NGZA 4QS7A 3BY5A 1XJWB 4OYMA 3VQPA 4KGZB 5D4LA 5DG9A 2VH7A 1YX2A 4M5KA 2O8DA 2DFEA 2DRAA 1UCNA 5K8MA 4B8CA 4A8QA 2ZNYA 4R0JA 4V19J 3Q8SB 4PR6A 5AXLA 3HVWA 3DU5A 4PCQA 3C8YA 1WD6A 2FGCA 3CPWR 1HX1A 3EN9A 5IT9O 5A8RB 3P3DA 1HWUA 3HX9A 1T9UA 4WFBQ 5D4PA 2A18A 4QWDA 2HGMA 2BANB 2CGJA 1TVRA 4TNOA 3JYTB 1OY9A 4LSLA 3FBCA 3OFEA 1WHVA 4M3UA 1Y3JA 4P6QA 3OQ2A 3ZT2A 4F36A 4NYFA 1L3KA 1X5PA 5GVQA 3OHRA 4I56A 1TKTB 1JXVA 3CCMN 3S3NA 2W2MP 2GWJA 4ZP9A 4DQ8A 3W65A 2R2UA 3O5TB 5HQ8A 3IM8A 4J2BA 3JXUA 3QGHA 2EK6A 1N48A 4CGIA 4Y28C 2EPIA 3MEDB 1GAOA 3HMJG 1NPPA 4ISEA 3DJCA 3P8BB 3ENVA 4O44A 2UXBJ 2B4JA 3OR2A 1R8BA 5B0AA 2YTCA 3PR4A 3LP2A 2J9DA 1UWBB 1O6XA 1X5OA 1MROB 4M3RA 4NASA 1MNEA 1LW2B 1KVJA 1EWQA 1TUVA 3C94A 3UKRB 3VF0B 2R2TA 3HRGA 1NH8A 1LWXA 3MI7X 2C22A 1NOYA 2BOAA 1QSYA 3DGPA 2Y0SD 3KHLA 2RQKA 3W63A 2HHWA 1W2IA 2W7AA 1MMNA 3W3DA 3GJQB 4NCGB 4H5RA 3E8OA 1NK6A 5I9EB 2HK3A 3IMQJ 3R3LA 2FZKB 4PYAA 5FPNA 3J81U 3KDOA 2HS3A 4LFBF 5ETLA 4IFYB 3IWXA 1IWAA 3JTNA 4CI6A 4USVA 5A8RA 4L74A 4I0WA 4CLYA 4F25A 3C46A 3PY8A 3OL9A 1TFWA 1FWPA 3BYPA 2UVUA 1UEVA 2EFQA 3MCSA 3C6TA 3CW2C 4CLPA 2E5GA 3OLAA 4ECSA 3PUFA 1WEYA 4JI4F 1V5VA 4ED5A 3MZIA 2IDOA 1TYQA 4ILHA 4JKAA 1EWRA 1TKTA 1HI1A 4FOIA 1S72N 3IO1A 2YV0X 4DR6K 2J6TA 4QQBA 2ZGYA 4TU9A 1RT7A 4ZVTB 2E1MC 1VHXA 4DQSA 1NZ8A 5KOWA 5L9XA 4OZLA 4ZVRB 2XWXA 4DV2F 3MURP 3H2VE 2QA4S 1ASUA 4JN4A 1SC1B 1DBDA 4DG1A 1U26A 1TU0B 2GFFA 3OYAA 1N5QA 4KY3A 1N54B 4LF4J 1IBMJ 3OXGA 3AO3A 3QJPA 5GINA 1CLFA 3ATVA 3CCRS 1SJRA 4CEOA 1RBVA 3DLLL 2IJRA 4WE1B 2D3ZA 4OZ3A 1NKCA 3O5BA 3F44A 2D0BA 4OJHA 1B64A 2WB4A 2W01A 2P9IB 2ZBQA 3I0SB 2PE8A 3ULDA 3GIRA 4HTLA 2ZOFA 7AT1B 3NGRA 3B54A 4U7UD 2FJWA 2XY8A 2D41A 3LWLA 2ILYA 1ZAWA 3A8EA 2PAVA 1FJGK 2Q0RA 1UTAA 5TKWA 3KUGA 5F8JA 3CDEA 5HQMA 5HRNA 5KFAA 2FSJA 2CQHA 5BPLA 4LH4A 3LDOA 4W5RA 4FL9A 1Q7YO 2P8IA 2B56A 1T03A 2KYXA 4BVOA 3C6UB 3AV9A 2XS5A 4Z4GA 1CJUB 2VC0A 1VQLS 1MA9B 3CCWA 1MW7A 3DC2A 1R0AA 3BF3A 4RBUA 1AXQA 4GV6A 4CT8A 4CJSA 3THXA 3R8YA 4A8XA 1A5WA 2C2EA 5KFFA 3K8VA 1SC4B 3TWHA 2NPIA 3QDKA 2VBWA 3IA0A 4HDHA 4O55A 1N36J 2FVSA 3BEXA 2GJ2A 4CO2A 4G9ZA 1UOCA 2F8TA 3QYYA 3VF4A 4JV2A 4ZK7M 3DXSX 1U2RA 1TKXB 2VWBA 4MDBA 3DM2A 4YOYA 5J1EA 2ZVSA 2KHCA 2HFVA 2ZH5A 3PRVA 1UVIA 2D1KA 1KCFA 1ZBLA 3M3ZA 4PXCA 5B0BA 3HPOA 1PJ5A 4QYZJ 1YSJA 2GC8A 3HYFA 2KRBA 4C11B 3QGIA 1HKAA 4AL6A 3SMZA 2JNJA 1RFQA 5E3AA 1GNKA 4EEYA 3QEPA 2N82B 1UJ5A 1HNIB 3KHGA 2V52B 4GKJF 3WUHA 2BZ2A 1VQKS 1S97A 4RWTA 3V6DB 4CIGA 3UWTA 4LF6F 1VBKA 2Z1HA 1NSKL 3EE3A 4CM2A 4KHPK 1VIXA 3PJXA 1WSEA 4BVPA 1SH0A 1IBCB 2IM1A 5EGYA 4CEZA 3W8PA 3TSQA 3D2FB 2L41A 2UZAA 3B6OA 2ZBIA 2P2CB 4XEIA 5BJRA 3BGRB 5C42B 4CLLA 5B09A 3AA9A 2P6SA 4DXLA 4BGAA 1RCOB 3C3LA 1IKYA 4MO5A 4ZPWR 2YPZA 3VA0A 3G9CA 4K8ZA 2UU9K 1QVFR 4DS5A 4XPEA 3M8QA 4WIQA 4OX7A 1UVKA 4B9TA 5SWMA 3EZUA 1J2VA 3CSKA 3I31A 3GWCA 4N47A 1VJWA 4IZ9A 3Q2SC 1LW0A 4DL2A 1CZBA 4WBFA 2MYFA 3ENWA 3KK3B 2GVDB 4AT1B 1KXPA 4ZA1A 1T9XA 2R2SA 2AYMA 5AQQA 1SXLA 3CJ3A 3H20A 2GAHC 4IOAL 4CHOA 4FF1A 2KJVA 3M1VB 4TYAA 3BO3A 3DXKB 2DNKA 2DNQA 3TAQA 1F3FA 2FDNA 2OI2A 5IT9Y 4DCJB 4XK8C 1C2PA 4DLGA 3L95X 3WQUA 3QMLA 1LV5A 1Z2ZA 3EPGA 4DV7K 5LOQA 1R8PA 3TR8A 2OPSA 3IRXA 1UKUA 2DXFA 1IV0A 2HF4A 3AAPA 3LH2S 1U45A 2ZZNA 3KK1A 2HGLA 3LW5C 4FYWB 1XMOF 4OKEA 1NK8A 3T5KA 3HF5A 2NUUG 1O5JA 2WZ1A 1VK8A 4C8OA 1Q9YA 3SQ0A 2VG7B 3SSSA 4GVMA 1TV6A 4BR7A 5KQ8A 3DOLA 1PJ7A 1TKXA 2VKRA 2DGUA 3ZTPA 1FJCA 4X4RA 2QYCA 4CEEA 2NLXA 2FZGB 2J0XA 4QW8A 4KT0C 5EOYA 3SNNA 2DH8A 1UWAA 3D9BA 3VZHA 3CCJS 2DTUA 3JTPA 4DUZF 4FZZA 3NGDA 2HW3A 1F9HA 3ZSZA 4X4OA 3BH7B 2NREA 3HD1A 1IN0A 2QA2A 4BR2A 4FPIA 3OYCA 2L9DA 1Z2LA 3WQTA 1REVA 1VK3A 2W4DA 3AARA 2ZUGA 3WIUA 2D69A 3IAM9 2LFVA 1S0NA 4JI0F 2MMYA 4H5WA 1WNEA 4IRKA 1RDAA 2QA4N 3W5YA 1HBNB 1XK8A 2YJEA 2J0QD 1KVAA 1VQ9N 2P9UA 5U47A 3D67A 4MIBA 1EX4A 3IRWP 2WBNA 3CCRN 1C0GA 2HWTA 3NMRA 1V9OA 4LBHA 3GTYX 1U2FA 4BHQA 3TPQA 4I9LA 5E0OA 1N34F 1QE1A 1OIAA 2FHMA 4O8KA 3KK3A 2GVDA 3N5BA 3J7YI 4JYAF 1S0MA 5KFLA 4CF1A 4FZYA 2IVFB 5LSOA 1V5IB 2F1FA 5FPEA 4NYPA 4XH1A 2ASYA 3OVNA 1XNRF 3D6RA 4WP8A 3DXKA 2HNZB 3TJAA 2IBOA 3PIPQ 4DV0F 4QIFA 5F8LA 4KKOA 3QZ7A 4LRBA 2V51B 3MWTA 2A6MA 1WHWA 4USIA 1A6LA 1GMWD 4LJMA 3BR8A 4DR6J 4L76A 5IM0B 3TUIC 3OJSA 4Z7YA 3C6AA 1N5SA 1X4EA 2PZSA 1BQMB 4LFBK 2ETJA 4B9VA 3AVMA 4BC5A 3FMBA 2QTWA 5H9FK 2I38A 2K8GA 4O3QA 4IKAA 3CCSS 1Q53A 1KRPA 5L46A 3S41A 4CQ1A 3MMVA 4PL8A 1DAXA 1SJ3P 3MMBB 3MXJA 3SPYA 4OV6A 3P4UB 1FRXA 4B3SK 4QPXA 1RHUB 1Q7YT 2DGVA 4DR4F 4C8KA 2Y1RI 5DDRC 1QDUB 3ZT3A 2YNHB 1LXJA 3ZSOA 4S0MA 3CHWA 4W4MA 2P9KB 4JI4K 2YXLA 4CZFA 2G8IA 1XR5A 4ZMMA 2HHHF 4CI0B 1X4BA 4UT4A 1NWKA 3LGMA 1GLCG 5CZ1A 3CULA 1FJGJ 2IAJA 3A5MC 4DV2K 1N5TA 1TFYA 1NH7A 1OQ3A 2IY5B 3QRRA 2OEJA 4RW6A 2KJWA 4FNHA 1VQKN 1NK0A 4M3YA 3I32A 4X4SA 1Y00A 4J8FA 5F8NA 4EBEA 1UETA 4CFAA 2V8PA 2BJ8A 2P9SA 2QYGA 1VBZA 2R8KA 3AO2A 4PUOB 2XLKA 1RA6A 4EYHB 4UQTA 1R8CA 2R2RA 1HNVB 2RF2A 2OIHA 3ZC4A 3E01B 3QSIA 2KHDA 1HBUB 5EWGA 1FCAA 2W6LA 4UOHA 5JVGQ 4RLEA 1M5PC 2P9NB 1W26A 2XMWA 1JLCB 1Y10A 4DU3A 4M3TA 2IPOB 1GMUA 2HNZA 2YWEA 5KT4A 3VESA 3MN6A 2RDDA 4BRIA 3DAWA 3DRRB 1VMBA 1RT1A 2R7QA 1FE0A 4LVOP 5EX0A 4JD2B 3IUCA 2IA0A 4MIAA 2ZE2A 4DN0A 1CXUA 4F0KA 2QMXA 3M2UB 4ZJLA 5DDQC 2FGOA 1F2GA 3BZCA 1RT5A 1VRUB 1TMMA 5AQVA 1IKWA 3OS0A 5K14B 2NXCA 4IOCQ 3TA0A 1R6VA 2LVWA 3TJ9A 4H0VB 1VHFA 4KHQA 4NLSA 4GMKA 3V9WA 2ATLA 1B7YB 2HBYB 4KHPJ 3CJ5A 1U0HA 3KK2A 1Q1KA 2BACA 5EU7A 2HQIA 3RYLA 2DHHA 4ED0A 3QT7A 1D09B 1W2BR 1HA1A 5A8KB 3G6ES 2UVWA 2KFZA 4BROA 4BRKA 2MB0B 3QEWA 2E5HA 4E1JA 1U8SA 4JK8A 1GLDG 2KG0A 3K7RA 2UU9J 3QB0A 2V5HG 3T6JA 4F4AA 5KPRA 3K5OA 2HB5A 5BPNA 1I3OB 1T11A 1AUDA 5A2QO 3ILIA 2CQBA 3CCJN 3QPIA 3RRHA 2AJ4A 1TMJA 3S1TA 4MK9A 1S22A 4GKJK 2FHJD 1HHQA 4WK3A 4LF8F 3KD1E 1ATSA 3EUNA 4CERA 3NH1A 4CJVA 4LF6K 3HHLB 3R5DA 4E89A 3FEYB 2DBBA 4BRPA 1S7HA 2F8MA 1EO1A 2P9GA 4C0BA 5LSLA 4DV7J 2V8GA 3PX0A 4PPDA 4OPKA 3I56S 1FE4A 3RVCA 4YOTA 1VSJA 4WQ5A 2NXNA 2HRTA 3VQ6A 4C23A 4NZ0A 5ADXH 3A8IA 3OLBA 5L9NA 5CZ2A 2VG6A 1B4SA 2F8SA 2FF3B 4B9QA 3C0BA 4EMDA 4WFAL 1RK8A 4J9MA 5F41A 3QLHA 2BRKA 1E6VA 3CPEA 2NPFA 3ZZYA 3UDCA 4G6VB 1KOOA 4R5PA 2AA4A 1L5UA 1VDHA 1V3SA 4EK2A 2E5IA 1SI9A 3W0LA 2DGXA 1NBWA 3NGKA 1RHQB 3ZFVA 3OXLA 5DM6Q 2UYTA 2A5XA 3W2VB 4KRWA 4K4TA 3IXQA 4QR1A 1KOHA 5AQFA 5GAGP 4IH6A 3BGFA 4Y34A 2YVSA 2U2FA 3AQPA 4Y00A 3KDNA 4E0DA 3J80U 5C2GA 5AQSA 3HSDA 1XMOK 1WOPA 4JBCA 3SQGA 4CIFA 1EHWA 2PFDA 1Y5NB 1Q86T 2HQDA 2CQIA 1FF2A 3QNNA 2LQBA 3I5BA 5ETOA 1R8HA 5HP1B 2UUBF 3AA4A 5A8KA 5BYSA 1Q5VA 3EYZA 3CCSN 2EHGA 3AODA 3D66A 3HM9A 4USMA 4FW2A 4DX8H 5IC4B 4QWCA 3IFEA 3AA3A 1VSKA 3NEKA 4DUZK 2C2ZB 3MDFA 3MUMP 3CJAA 3Q22A 2LU2A 4PKGA 1TL7B 2RUGA 1QQOA 1HMVA 1FKOB 3E1YA 3OUYB 3CMES 2XMTA 3CDAA 3KJNB 3CUNA 2R8HA 5EWFA 5LMNF 1HYVA 4HH1A 3D2WA 1IKXB 3NDKA 4BC7A 2FPHX 4NZ7A 4F4KA 2GJFA 4JI0K 1YG0A 2R8JA 5GAEU 1S5JA 1GXUA 5T7LA 1SH2A 1IR1A 1W7WA 2W2NP 2P5VA 1PIEA 5C25B 1ZZNA 3W66A 1TKDA 2KO1A 4B3TK 2MKCA 3GILA 2XZTB 1HQUA 3M2VB 4LFBJ 1F6TA 1HNZK 1N34K 4CJ4A 2RNEA 3VEYA 2A1BA 3P39A 2XY5A 1E4GT 4JYAK 3JSBA 4AXJA 5H9FJ 3FZBA 3MXHP 4CGJA 2HF3A 1VQNS 2BJDA 2W24A 3VGTA 4CJ3A 4ZVOB 3ZZUA 4JI3F 4IG3A 3L7UA 3GIKA 1N52B 4B3SJ 3O9RA 2B5JB 4E98A 2XHBA 1UVJA 4K4UA 4DV0K 3M8WA 3KTQA 2OELA 1VHIA 3W2VA 4UOCA 1HPMA 2ZJRQ 2KTQA 5AQTA 2RRNA 4JI4J 2XHCA 3RMCA 5CYMB 4WF9Q 4CJ7A 3DLHA 3IWNC 1SCJB 1XERA 3O2IA 3K2PA 3BN7A 4R0EA 3RBXA 3CERA 5AQPA 1F1BB 2RDIA 3M30B 3IFRA 2FBYA 4CJEA 4DV2J 2E5JA 1HBMA 4USJC 5GIOA 2E66A 3MCNA 4M5MA 4NB4A 3VAGA 4U7CA 4OLPA 3FQKA 2HNDB 1LEOA 4KGKA 1BUXA 1BHLA 2YNGA 4YOWA 3U9ZA 3EJMA 4Q0BA 4KAZA 4DR4K 3HSGA 2DITA 5DQHA 4FM1A 3LANA 1S6OA 2FLPA 3G6EN 2HQCA 2V4JA 3T9NA 3NKYA 2RMLA 5F9NA 3SBGA 4PXEA 5GAHI 1RTHB 4USWA 5ADXA 2HHHK 4DSIA 2OPQA 3A3OB 2K06A 4LH5A 3QSYB 2A42A 4AHSA 2ASLA 4RW9A 1MG7A 4ES1A 4WZQA 4DV3F 2FBTA 4OHZA 1Z26A 1J27A 3NG8A 3HVTA 1Y4ZB 2CPYA 4HCBA 1WEZA 4MK8A 2GCFA 2GNKA 2NRVA 4OZ2A 3HSZA 3TZZA 3DLEA 4LIWA 3MOJB 1RWVB 3W61A 2D0PA 5DQGA 2Q0UA 1IG9A 2CWXA 5KFNA 3VQ4A 3UDLA 1WTFA 3I56N 1JLFA 2VUGA 5LT5A 2OD4A 4PL7A 2V2QA 4JV5F 2RAQA 3DRXA 1G6BA 4A2AA 3K2YA 4QOTA 2FTRA 5KFGA 4C0HA 1JNZB 5AXNA 2B5JA 3EXYA 2KYZA 2DFFA 4EU0A 4MH8A 3SCKE 1O8BA 5HK4A 5SZTA 4GVLA 3M8YA 2W9AA 2LQ5A 2DO0A 3LM2A 4ZPCA 4CHQA 3UVJA 2QA1A 3IC1A 1KLMB 4HUEA 3N0VA 3QJLA 4JRPA 3TP2A 3MMAB 4FF4A 1HYSB 1ZBUA 1B9FA 2DCLA 3L9ZA 5JMVA 5KT3A 4AHTA 2FC9A 2OEMA 2CA9A 4GKJJ 2CNNB 3UR0A 3OVBA 1RISA 3ZZRA 1VSEA 3D7SB 1WAJA 3LDSA 2CPEA 3VTHA 1U1PA 4LF6J 5AFUH 2VFVA 1K73O 2CH5A 1IQZA 1LKZA 1SV5B 1FRMA 5IOLA 2O8EB 1TZ0A 4B1WB 4CHZA 2IM0A 2V69A 4X66F 2A10A 5AT1B 2HVHA 2HBMA 3KLFA 2B9YA 1DARA 4DSFA 5E33A 1YJTA 3DDIA 2DIVA 1YKWA 3TQ1A 3BQ2A 5J2NA 2FLOA 2ZNZA 3A0IX 4EO6A 4ZJOA 3NY0A 1GLJO 3V9UA 3MCAB 3W2WB 3B6BA 4A8KA 3L4IA 3SPZA 1CXQA 4I2QB 2A2DA 3CMEN 4DLEA 2WFBA 1HL6A 1KAZA 2O8FA 3SCLE 4LF8K 4RNNA 4O0JA 3FVYA 1YI2S 3AO4A 1HD0A 4ED4A 3UKUB 2NSCA 5D3GB 3SCIE 3HPHA 2W2QP 2WSFC 4L3NA 3DLGB 4QIGA 5J2QA 2P9EA 3HSCA 3FZLA 1WUUA 3OFGA 2HFUA 2PEHA 2LMIA 3D0PA 1OH7A 2GMLA 4ECZA 3M6VA 2IS3A 4PG6A 1VBXA 4JI8F 2WTFA 1BL3A 4W5OA 4P9SA 1XMOJ 3MDQA 3GMGA 5HQLA 1HLWA 1UZHA 2FLNA 4WTOB 1XMQF 3TQEA 4KB0A 2WRMA 2CJKA 4HYKA 1LAWA 3DOMA 1J5OA 4EYIB 4DB3A 2XS2A 5FRMA 2O1PA 4IFVA 2K3IA 1C0FA 1VQNN 2RDJA 1JLEA 2QV6A 4DPUA 3RMBA 2LDIA 2HVDA 5KFJA 1HYSA 4RW8B 4OPJA 3KWMA 2JC1A 3VENA 1IR0A 2AJ1A 4DUZJ 3T5JA 1SAZA 4M3ZA 1JQGA 4WWSA 3V5RA 4GVBA 2F4VF 2C2DA 3W1YC 3KLEB 5GMEA 2IJNA 3D7EO 2I2YA 5BXIA 1VRTB 1UPPA 5KFKA 1Y5LB 4F2RA 2DR6A 3D0GE 2B51A 5TKYA 3A8JA 2EBGA 3VV2B 1NHVA 4JI0J 3I5AA 1K1SA 2I8EA 2BUNA 4FWQA 1U2CA 2HBLA 2K1RA 4FLTA 1VC6A 2UUBK 1V3RA 4TY9A 3SFUA 5JS2A 3I6PA 3SMPA 1YHQS 1LFWA 3ATUA 5LMUF 2QRRA 4FBTA 2X7IA 2J7UA 3BKUA 4JP8A 2CJYB 4B3TJ 4J37A 4F0HA 2RD5C 4QU7A 1FEHA 2R7RA 2MZRA 4F0MA 1HNZJ 3U02A 3KHHA 1N34J 3QRPA 5D0EA 4FWLA 2OUGA 3R5AA 2DIUA 5HJYA 2L9WA 4UF4A 1NDPA 4BC4A 4JYAJ 3OT9A 2BRLA 2EK1A 2E8AA 1RAIB 2ZBPA 2ZD1B 4IDKB 4QPTA 5KT7A 2E1ZA 5M1PA 3RMDA 4EHTA 1S79A 3VGLA 1BWVA 5LMNK 4WJBA 3WX8A 3DLKB 3CJKA 4DV0J 1GT8A 5LY3A 3MECB 5C7PA 3ZZPA 1WUAA 3H98A 3LALA 3N79A 4CDIA 2UUCF 4PWWA 2CNLB 4Z4FA 3LA0A 2HKEA 1WG5A 3BQ1A 4M7YA 4UOFA 4K7QA 4NLBA 4FF2A 2XO7A 4IEEA 4WFXA 5KT5A 4KHRA 2QMUB 1H2TZ 5M2UA 1KSPA 1OO0B 2C3UA 3HT0A 4DTOA 4ICLA 5AZIB 2QL5B 2FZCB 1BA1A 1X5SA 3NOCA 5AFUA 4HT7A 3DYAA 2GUIA 1JLGB 2ZZTA 4BC9A 3AA8A 5AQKA 2H4YB 3LAMA 3KXDA 1RT3A 3V6JA 2EXUA 3FDSA 4ATNA 4F3QA 1VQ7S 2CADA 3K5PA 5K8PA 3KLHB 2C3PA 2HIQA 5HBMB 3KMSA 1F0XA 5CQGA 4DR4J 2C2RA 1JB0C 2CGKA 4ZOSA 5DS7A 4CE9A 3KLEA 4IO9Q 3E9OA 3L4QA 3FGUA 1VRQC 2HHHJ 1YBAA 4ENOA 4KH4A 1Q8KA 1KAYA 3MEEA 3T19A 1NU0A 3R5JB 4E8UA 4M94A 1YF5L 1JCEA 2H5IB 1RTIA 4RO0A 3LF0A 3FR0A 2KN4A 4KBOA 1UP1A 2GQCA 2XZDB 1X1PA 1NXIA 4FK4A 4CM0A 1SQEA 1CS4A 3VAKA 4QR2A 3GB0A 4KPYA 5J2MA 4ZKAA 4RG8A 3J81O 1RTJA 1NUEA 5KPZA 4X4NA 3HZGA 5CR4A 4FVUA 4ZHRA 2DHGA 2XYPB 1RCHA 4CBUA 4WQ5C 2RQMA 4DTUA 3LWMA 1IKVB 1F9FA 4CH0S 1KNZA 1RU2A 1UW4A 5CABA 4PWDA 5B0CA 4C6AA 1K73T 1IM6A 5FPMA 4OJRA 4J9UE 3QO9B 3E2EA 4DV3K 3I4HX 1U8WA 3SAFA 3PKMA 5C10A 2HSEB 5HANA 1YI2N 4ANCA 1EARA 2CPJA 2NUHA 1RTZA 5LSRA 4AHVA 5BN9A 1PYOB 1F5AA 4Y1DA 2CZ4A 3V2UC 3TI0A 2APOA 3ZEUB 2CPHA 5JS1A 2CYYA 4FS2A 3OFFA 4PG7A 3Q0AA 3HXMA 4DSJA 4J9VA 2AKWB 3O1BA 2J8AA 3ZX2A 5F0WA 2VJVA 4NMXA 3KLGA 1VK0A 2OYQA 1YAGA 2DNNA 3WDOA 3OR1B 4JV5K 5GADU 1T7PA 5AQMA 1BOTO 2J7KA 2JEIA 3THPA 3H1VX 5KG3A 3MXMA 1U2VB 2EW9A 2DNGA 2GWKA 4GVEA 4N77A 3FE1A 1HQ2A 3ZSYA 5IT4A 3CPWM 3EDQB 1R8AA 3DMJB 2NRTA 4CT9A 1O0PA 1JLBB 4J2AA 4M95A 4EZ6A 5ELZA 4CJLA 1NGAA 3AD7C 1SJFA 1YJ7A 2YY3A 3OYKA 1KVIA 3RW7A 2FSNA 3FBFA 4H5TA 1RADB 1X9WA 5DDOC 1CBKA 3PRDA 2RPIA 4L3KA 5T41A 1S1UB 1B3TA 3DI6B 2KLAA 2OA8A 3I8BA 3KG1A 2HNYA 1RB0A 2ZJPL 4YDDB 3AOAA 4URGA 5EXWA 4LF8J 4GC6A 3VF6A 3TABA 4M8LA 3GPAA 2FBVA 5BPMA 4FPAA 2KDOA 6FD1A 3F9KA 1QAYA 1OH5A 4CESA 1JLQB 2QA4G 3NS6A 4F7VA 3OTDA 3ID6A 4X66K 1WLJA 5CH7B 4WYWA 4D3HA 4YOVA 2V9WA 2QGFB 1J6ZA 1YHQN 2YWKA 1IKVA 4RUHA 3US5A 2NRXA 3VQCA 4HACA 4B3OB 1FEEA 5C12A 2BQUA 4O8UA 2RE2A 3NE6A 4RW7A 2KM8C 4CFDA 3O3GA 3BSAA 2MQNA 2HK2A 4OX9F 3DOKA 2E9RX 5CZVA 1H73A 1CQNA 2RU3A 4ZLNA 2QKKA 5DO2A 4A8OA 4FJXA 2A3ZA 2PIIA 3GG4A 3D1HA 1T0TV 2Q97A 4F26A 3HHLD 1DT9A 3D68A 2XG8A 3RSEA 2ITGA 2MZJA 1WC0A 4CJWA 3MXIA 3UD4P 4PKDB 3VR1A 2RHSB 2QG9B 3E51A 2QT7A 4WYBA 3SAHA 3EWGA 2QWRA 2K7KA 4ZCKA 1TR0A 3RAXA 4YOXA 4FJ9A 1PAEX 1T9VA 1HPZB 3CM5A 1OH6A 5D0HA 1XMQK 1BIZA 2UUBJ 3M4XA 5KGWA 3N5FA 4URSA 3EM1A 3C7NB 4WFZA 4IR9A 3HK2A 1Y3KA 4Y2KA 5KFWA 4MLHA 2CJAA 4O4GB 3VALA 1ESVA 5M1KA 1ITGA 4FWOA 1VQ7N 1EXQA 1KFDA 4Q45A 4AXIA 4AQYF 3C65A 5A0YA 4I6MB 4ECWA 1QTMA 2LLZA 1AW0A 2F4VK 3T69A 4RX6A 4CFCA 2AYEA 3TTFA 1S77D 1RDCA 2DR8A 2O5DA 2DH7A 3OTCA 5LMNJ 1Q18A 2JWLA 4I7FB 4QYRA 4PHTX 4QIEA 1N56A 5AQZA 2FD2A 2HVIA 3MFIA 3BR9A 1LWCB 2C1EB 1FTRA 4LSZB 3TVZA 2D5RA 1P6TA 2PI5A 2JZ5A 4LF7F 1FTCA 3WQPA 3ZT0A 2BQ3A 2KHOA 3WNFA 1FFWB 4CJTA 4ISFA 5LMUK 4H0XB 1YJVA 4QZVB 5IV4A 2UXBF 4LF2A 1VCTA 4KFBB 5ETNA 2QWQA 3EE8A 3HJVA 2UUWA 3TX0A 3MPUB 3D5MA 2W42A 3OVAA 1JKHA 1S4FA 3P83D 3EO3A 3EL2A 1HNWF 1LAVA 7FD1A 2CVIA 2UXCF 1C0TB 2V8DA 1NZAA 3JSMB 3OW2R 1MWKA 4YDXA 3FEZA 2E44A 2PGCA 1ASVA 4CHYA 2YQ1A 1TL3B 3PYEA 1S1VB 1IJFB 4FSVA 1FW6A 4Q8EA 2RKIA 1ZBIA 3FSXA 2PC6A 3GV5B 1H38A 4NEYA 5CAAA 2E5LK 2UUCK 3ILOA 3U3GA 3UQSA 4F2SA 2OMLA 2I1RA 2XEXA 4OKKA 2NZTA 4FLUA 2VDHA 2DYAA 2IIRA 5DM6L 1EP4A 3V4MA 3A5OC 5AZJA 2AX1A 2UV8A 3NS7B 4DEZA 4H5NA 4TSXA 5L1JA 3HFZB 3C7NA 2VODA 5LJ3Y 1FI4A 4ILJA 3P6YC 2J4RA 2HVEA 3OFHA 1LQ9A 2CQ0A 3MAQA 1MWQA 2UP1A 3L0QA 4KYZA 1WBBA 1PSDA 2B7CB 3L2RA 1FRKA 1HD1A 1EKEA 5I3QA 1WSRA 1OPZA 2YKQA 4K2XA 2HVZA 3PW7A 4TU7A 3EKSA 1RWNB 1WDTA 4DL7A 2HWIA 4C0OC 1NBEB 4JHDB 4W5TA 1JJ4A 1N0UA 1LWCA 3TA1A 3ZTOA 5DGAA 4FCYA 5CYQA 1HBOB 4LUBA 2HZAA 1GX6A 4CIEA 2W2OP 2AGOA 4DV3J 2IMWP 1QZ6A 2EG1A 3CJ8A 3EE9A 1RHJB 2BYCA 4DR7F 2DR9A 4MFBB 1RHMB 4IO8A 1UEKA 2XS7A 3ZX3A 4CEAA 3UE5A 1K9MO 4MT1A 4KFBA 1G99A 4F67A 3AVHA 2DGOA 5KG1A 1RWPB 3K5NA 4DUTA 1OVYA 1DJ0A 4CJKA 1SKWA 2H9ZA 4OJ3A 5FD1A 1NK4A 3NRBA 3OBWA 3DFEA 1QVFM 4JV5J 5KFXA 3GR0A 5AQWA 2RQ4A 4C3MA 3I0RB 3LGHA 1QSSA 4TLQA 1ITPA 1SBRA 1S6PB 5I4MA 5DG8A 5BYRA 3CD5A 4P2MA 1LOUA 4KO0B 3THYB 2NNWA 4X4QA 3VZIA 3M32A 2E7WA 4CGDA 2GIQA 4FN5A 1HHTP 4FWMA 3LGNA 3M2RB 3U27A 1RU1A 3EX7B 2JEJA 3QIPB 4H54A 2QFIA 3CCTA 1VYAA 2HSTA 2OSRA 3HI9A 3K89A 2N4DA 2Y0BB 4ILLA 4FYDA 5KFSA 3PDNA 4FJIA 3OS1A 2HZCA 2BV3A 1ZM3A 1MDUB 1Z4UA 2AEMA 4NOHA 1BHNA 2HG4A 2IVYA 2OZSA 1M5HA 1B99A 4BREA 1Y5IB 3CCUS 2V2KA 1YRXA 5K9FA 4X4TA 3Q24A 3Q8QB 3KUEA 4X66J 3NGTA 3H5UA 1DGKN 4KGMA 2XSJB 1GMVA 2VFRA 4DQRA 1XMBA 3NOGA 2FJDB 1OYDA 3KHRA 1G15A 3AVGA 1HBOA 4NLYA 3L09A 3U8XA 3T7ZA 1ZA2B 1IXKA 3KIOA 2ZUAA 1YQHA 3H90A 1JCGA 4ECQA 3AA5X 4RJVA 5A6PA 2GW8A 5I3UB 2PDAA 3DLRA 1RTDB 2J9EA 3Q83A 3LP0B 1XR6A 1LWEB 4CZHA 3FKBA 3T6BA 1URNA 3Q23A 2QWLA 3OHBA 2KXNB 1RT4B 4ZVPB 1NPKA 2H54B 2L08A 5D0RA 5HROA 2BDPA 4CF9A 4ELUA 3HHEA 3TW0A 1VSDA 2V34A 4C8MA 3D2EB 4Q43A 3PFEA 2WBRA 3MWBA 1VI7A 2DFHA 1N6QA 2G0CA 3THYA 2CGLA 2XCPA 3P45B 3WX4A 1XMQJ 1YIJS 3ULEA 4BRDA 1VFJA 1EETB 2WW4A 3BH6B 3SCJE 1UA0A 4FO0A 4OIXA 4USHA 3M6GA 2DY9A 3ALYA 1GOBA 1C4AA 4ZVHA 3ULHA 4OZJA 2EI5A 3J8AA 2VZ9A 3DRSA 5EDWA 2KQ2A 4HH0A 2M0GB 4JAXA 3LP1B 1FJEB 4YY3F 1ATNA 2R9LA 3R7BB 4NLXA 4IG0B 4H4OA 4B1UB 3THVA 1RAHB 4AHUA 1S48A 2F4VJ 1WEXA 2XI3A 2B9XA 3Q7BA 2OP5A 3QBXA 5MLCV 2ASOA 3NGIA 1AFJA 3A3PB 1VQ8S 5LJVA 1RKIA 3DHWC 3CJSA 3ZZTA 1M90O 1FK9B 3ZCMA 1LK7A 4CYUA 2C2MB 1RGIA 4OYBA 3U6FA 2MZQA 4DTJA 1JLAA 2QLFB 1GLEG 3MR5A 1CJKA 3GJSB 2RT3A 5KFIA 5LMUJ 4I2PB 1YT3A 1U04A 2OH2A 3RWUA 3F56A 4LQ3A 3BM7A 4KH6A 4AQYK 3CJCA 4ZPTR 3GIMA 2NR0A 3W5XA 3NCRA 4CECA 4DCPB 4A8SA 4NI2B 2AHOB 2XO6A 4BC2A 4UY85 2GA7A 2P9PA 1RAEB 2EWHA 3JS9A 4FPRA 5F3ZA 2YKNB 2EFGA 2PMZD 4KIAA 1P8GA 1SJ1A 5EY4A 1VSLA 4ECTA 5H1SV 5G0RB 5F8IA 2ROPA 3PHEA 1NKBA 3SDEA 2W9BB 3M5RA 2VGNA 2UUCJ 2E5LJ 2N7YA 4LF7K 3M8PB 2N4CA 3IBCB 2E7XA 3J80O 2G13A 3D2EA 2WB1D 2CJ9A 3UB5A 1BQNA 2PFUA 4IR1A 3M9NB 5T7BA 3CCES 4Y0WA 3H6EA 3O08A 3CQXA 3GLJA 2BW7A 5HL7Q 1EETA 2BH1A 1KD1T 3QETA 4K2JA 1F9EB 3JAMY 2WONA 4HUGA 2J76E 3FCWA 1Q9XA 1HNWK 1S9EB 4YFUA 2UXCK 3LP1A 2GVZB 2ZDOA 2GAGC 4YR3A 4O23A 3ET6A 2VPWB 2PI4A 3OJUA 2Z2LA 1HNXF 1X3MA 1K9MT 3O80A 1T9YA 2FSKA 1Y7PA 3UI3A 1SJQA 3T5HA 1A9NB 3PW4A 1N33F 2VBYA 1XC9A 2DNOA 4BCAA 2LEPA 1J5EF 3LPTA 1BI4B 3ENAA 1V4SA 3VPZA 3VGKA 3GBTA 3PHTA 4FYVB 2QWNA 1RAFB 3MTJA 2CQ1A 1IBLF 2KT5A 5F3TA 2RHKA 4N56A 3R5CA 4DCOB 3QNWB 2BE7D 3MM9B 4C3LA 3PX4A 3AJDA 3NS5A 1WKLA 3CFRA 4TYBA 3CCUN 4Y2IA 1X4FA 2X1FA 2C3MA 3NNHA 1W2BM 1K1QA 1NDKA 2KW4A 1P27B 5C2DA 5C24A 1FVQA 2VA3A 4FOEA 5DMRA 2I7PA 4NI2A 4DU7A 1WSVA 4KGVB 1U1KA 2H3EB 3M9MB 2Q2RA 1T94A 4AUKA 4HKQA 5B08A 4A8MP 2OPPB 3L2QA 1X4AA 3TWZA 3CJBA 1ZXOA 4ZPDA 7FDRA 2LSNA 2KZZA 3VQEA 4DL4A 4C2MA 2H51B 2IJFA 4U8YA 1W25A 4CGHA 2AGPA 1S6QB 1CC8A 2ZH2A 1FJGF 4IFEA 3HBTA 2EG2A 2B6AB 2H4WB 4K4XA 2DGTA 3R5GA 1Q81O 1F60B 4ID5A 2R7XA 5AE1A 1TL1B 3PLAA 2DNRA 2PYLA 4LF9F 4DR7K 4BS2A 2MJUA 1NJIO 3NBPB 4YP3A 1F2HA 1H7WA 4HHUA 2K2PA 3GL1A 1VSFA 5L8RC 1KWMA 2KB2A 3BGOP 1NOZA 3H08A 1HJRA 1RNHA 3SK3A 1FKPA 4H0OA 1FESA 2IDEA 4IXCA 2IYGA 3IBWA 3X1LB 5A8WA 4GKKF 4ZVSB 3MX2A 2KXFA 3I9ZA 4A62A 3O6QA 4DKWA 3E9LA 2ITMA 4OFZA 5AXMA 1YIJN 4K4SA 3RJMB 1MU2B 1LFPA 1Q5YA 3BDPA 1S1TB 1WOQA 1RA7A 1C4CA 4MLEA 4JI2F 2AQ4A 1IR2A 4FYYB 2ASPA 4YR0A 1FO1A 1NB2A 4CLWA 3B8AX 3VVUA 3ZO7A 5IQQA 1NLVA 1BI4A 1I39A 2DGQA 4Z94A 4WP3A 2J6SA 4DFMA 1CULA 5IS2A 1BQXA 1CJTB 2DGSA 1LK5A 3QERA 4NXNF 1IM4A 1TP7A 3K5LA 4QCLA 3H46O 3P96A 2VQEF 4OPAA 2M3DA 2M8HA 3MM9A 4OZNA 2W40A 3SI6A 3F41A 3RG6A 1VQ8N 3OVSA 4HL9A 2VICA 2ZHBA 3U4LA 3ILJA