2YNFA

Hiv-1 reverse transcriptase y188l mutant in complex with inhibitor gsk560
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
560
structure length
557
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
total genus 158
structure length 557
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ynfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ynfA05
1TV6B 3THVA 3DLEB 4FK0A 4KHQA 1XR5A 4FJMA 3TAMB 2C28A 5DG9A 3L3UA 4RW4B 4J9NA 4DF8A 2V9WA 1JXBA 2IC3B 2V4QA 4ZPAA 1WSIA 1C1AA 3EPGA 1YT3A 1VSKA 3KD1E 4ZMMA 5J2QA 3ASMA 5KRSA 3KLFB 2JEFA 5DGBA 4FW2A 1T8EA 2G8VA 3MXIA 3DLGB 4F2RA 2HMIB 3K5NA 4C8MA 4BE2A 3D5MA 4CIGA 4BDYA 1W0HA 5CYQA 3OYAA 1JL1A 4YQWA 4NLSA 4FJNA 5I3UB 4AHTA 4MFBA 2DFFA 1O1WA 4EP5A 3BJYA 4KKOA 1S9GB 2YNGB 4ELUA 4OLBA 2HNZA 1JLAB 3BSCA 1KVCA 4B9UA 3CJ3A 1MMLA 1QUVA 3U6FA 5KG7A 3CWJA 4FVMA 1VRUA 4ED8A 4GMJB 1OS5A 1S0MA 1C0MA 2FVPA 1ZTWA 1QAIA 4Y1CA 2ASDA 4DU4A 1LW0A 5L9XA 3TR8A 1RT5A 2IJNA 4DS4A 3LDSA 3BSAA 2WONB 2FJXA 2HNDB 3WNHA 4CF9A 3B6PA 3G6VA 5HRNA 1BHLA 5J2NA 1KLMA 2XCPA 4OJRA 3AVLA 4DQSA 5KFXA 2IGIA 1RTIA 1J5OA 3MEEB 4F2SA 2OA8A 1QAJA 4W5TA 4IKAA 2RN2A 3C6UB 4KV8B 4Q44A 4H8KA 4FJ7A 1S6PA 1SH0A 2VG5A 4PA1A 3V9WA 3I0SA 3T1AA 2KFNA 1ZBUA 2FLPA 3DLKB 3H40A 3ZT0A 3VA3A 3MF5A 3NE6A 4ZP6A 3Q8RB 2NUBA 4M3RA 4CHZA 4LH4A 4CJQA 3OYKA 4CJRA 4DL6A 2YKNA 1TAQA 3BQ2A 3FSIA 2OPQB 1MU2B 3M8PA 2HHQA 3M8SA 2Z1JA 4DFJA 4CESA 3QEXA 5C24B 2BQUA 3ZSQA 1HYSB 4FJLA 2ZD1B 4E7IA 3I8DA 3SV4A 1QS4A 4CECA 4PWDB 2W7PA 4OGEA 1D0EA 4DSJA 4NLYA 1RTDA 1T05A 1KFSA 4B9SA 1RBRA 5D3GB 4M3YA 2QE5A 5F8NA 1DLOB 3BGRB 4NLXA 4Y34A 4CEEA 4FJJA 5C42A 2LSNA 4K4YA 3VA0A 3VQEA 1RTHA 4DTUA 1DTTB 4FJHA 2X6SA 1HMVB 3AO5A 4J2AA 3CYMA 1SV5B 4TYBA 4Y2CA 3PW5A 3AVHA 1S6QB 2W9AA 3SFGA 2JGUA 4B3OA 1XHXA 4M95A 4I9LA 4IQXA 1L3TA 4RW9A 3IRXA 1RDDA 4Z4GA 4DLEA 1U09A 1UAXA 3QNNA 2VA3A 1FXXA 3KMQA 4YFUA 1U48A 4G1QA 4Z4CA 1RT1B 3V4IA 5HROA 2ATLA 2ETJA 3PY8A 2C22A 4TLRA 4HCCA 4K4VA 3V6KA 1XC9A 4AHVA 4IFYB 3MXJA 3DLBA 3QZ7A 3A2FA 4O0IA 4JRQA 4KRFA 4MKBA 4K8ZA 4UQGA 4ZTJA 4KAIA 1RT7A 3KLEA 4CHPA 4QWAA 5CYMA 4ECVA 1G15A 4QW9A 1VK0A 4NLGA 1VRTA 2ATQA 4KHSA 3DMJA 2YKMB 3G0ZA 1QTMA 3AA2A 1RT6B 1NJZA 1S1VB 3OSPA 1LAWA 1D8YA 1NK6A 4IFVB 1CXUA 1J9AA 5KG1A 3M9NB 1NJWA 1RDAA 2XRIA 3OSNA 1QE1A 4DQPA 2EC0A 1IKWA 3DRPB 5KG5A 4NLPA 4OKKA 3P5JA 2OPSA 3MR3A 3QNOA 2KTQA 1S1XA 3ZCMA 1EETB 1RA7A 4CCHA 1JLFB 5HP1B 1TGOA 4FLUA 5SWMA 4TY8A 2XY5A 4E3SA 3PR5B 3NDKA 2BR0A 3TAQA 4HHTA 2YNIA 3RWUA 5KFHA 5KG3A 3PR4A 4DSIA 1BI4B 4CF2A 4ICLB 4EZ6A 4CJVA 1RAJA 3RB6A 2IMWP 4ECUA 1S9FA 4R0EA 1DTQA 4I9QA 4R5PB 1VSIA 2IDOA 1RT3B 4FM2A 2G8HA 1VSFA 1GX6A 4M94A 4CEBA 1TL3A 4LD0A 3BSNA 3TANA 2C2RA 2UVUA 5CZ1A 2W8LA 3TABA 3LP1A 3OYIA 1EP4B 3OYNA 4QAGA 1N5YA 3JYTB 1KLNA 3E51A 4O4RA 1BGXT 5HRSA 1U47A 2UVRA 2HHXA 2UVWA 4KE5A 3F9KA 1NK7A 2O5DA 3FQKA 3LWLA 1IKXB 1I6JA 5FRMA 3O4NA 1KVAA 3DYAA 4TYAA 5F8IA 2E6LA 5KI6A 4WE1B 4NCGA 3KLVA 3KK1B 4ZP9A 1EX4A 1C0TA 3V6JA 4FZXC 2E9RX 3SI6A 4YR3A 5KG6A 2RPIA 1UWBA 3SQ0A 3KLGA 4I2PB 4CEQA 4O3PA 4URGA 4RW7B 3OHBA 4N76A 2I5JB 3QGHA 4ED6A 4DTRA 3U3YA 4CFBA 1RTJA 1S9EA 1ZTTA 2IOCA 5DGAA 3QEPA 3OL8A 4CE9A 1Z4UA 4I2QA 3KHRA 1S1WB 2D5RA 3AVCA 4CGHA 3NGDA 4NRUA 4FJ8A 4QOZB 3I5AA 3GIMA 2FJWA 2R8JA 3AA5X 2WCXA 4LSNA 1X1PA 3QIPA 3TAEA 4IR9A 4J9LA 1BQMB 3M8QB 4QWDA 3V6DB 1D5AA 1A5XA 4FLVA 4DQQA 3VQQA 2XY7A 3N6MA 2HHTA 3P83D 3VQPA 1Q9YA 3AO3A 1EXQA 2Q3SA 2P1JA 2R2TA 3NF9A 2V4RA 4FXDA 2HHSA 2GIQA 1K1QA 1KCFA 3BDPA 4J9QA 4E1NA 3KMSA 3G6YA 4ZTFA 4CGFA 4CFCA 1T3NA 4CF0A 3DLEA 3OHAA 5K14B 2YNFB 3ISND 1WNEA 1C1CA 3NBPB 2Z1HA 3TAMA 2B6AA 4N56A 4QCLA 3QETA 3AVAA 2IM1A 3O4QA 2J6UA 2IC3A 2PYJA 4PQUB 4CGDA 4MK7A 1SL0A 5KGXA 2D0CA 1GX5A 4CK1A 1VSHA 3KLFA 4YR2A 1JIHA 4JRPA 1KHWA 3ZSXA 5L1JA 3RBEA 3NF8A 5EUHA 3CJ5A 4CHYA 1UA0A 4HKQA 1TK0A 4FS2A 4J2DA 4CIFA 4KI4A 5I3UA 3TQ1A 3V9SA 1S1UB 1JLCB 2EX3A 3C6TB 3NAIA 3S3NA 1IH7A 1N4LA 4DL7A 4NCAA 1RILA 5T14A 2WTFA 1C0UB 4PY5A 4IR1A 3SUQA 1JLAA 1RDCA 3OYDA 5KTQA 4DS5A 4AHSA 2G8IA 1LW2A 2WHOA 5KFAA 3KHGA 3IS9B 1A5WA 4Z4HA 1RBTA 5F8GA 3H5UA 3MEDB 2FLNA 1BL3A 1FKOB 5KFMA 3CVKA 4DU1A 2DPJA 2BQRA 4E1MA 3DM2A 2Y1IA 2D3UA 3LP2A 1BISA 1JX4A 2WONA 4ID5A 4CIEA 4EEYA 3QZ8A 4ZVEA 5F8LA 4DTPA 1JLEA 4BDPA 2D0AA 4AHCA 2OPPB 4FW1A 4DMNA 3OJSA 3OS0A 1SUQA 3C6UA 3V81B 2DPIA 4NYNA 4QWEA 5J2PA 1SL2A 4F4KA 2P5OA 4KFBB 5KFIA 1B92A 3TAGA 3UPFA 2HWIA 5DG8A 4O4GB 2WK4A 1X9WA 3I5CA 3RTVA 1IO2A 2OPQA 3ULDA 1MU2A 5HBMB 4KTQA 2FC0A 2FVRA 3OYBA 4ED7A 2VG7B 4B08A 3N6LA 4EBDA 4EBCA 2R8HA 3NF7A 3OYFA 1HYSA 2QKKA 2ZD1A 5KT5A 3KHHA 3KTQA 1WSEA 4ZPBA 1RNHA 3LAKA 4DG1A 3QEWA 5KFPA 2DTUA 5T7BA 4QWCA 4XPCA 2FVSA 4IH5A 2P51A 3LP3A 3RMDA 5D3GA 4E7LA 4AHRA 1CLQA 1DLOA 2FBTA 3AVIA 4CHQA 4FJ9A 4M3XA 3HPOA 5DLGA 1FK9B 2B5JA 2JC1A 4CHOA 1R0AB 1HMVA 4E7JA 5KFSA 1VSJA 4HUGA 3ZSWA 3HHKA 3L2VA 3ZT4A 1TKZA 2G8FA 4E19A 3K59A 4CFAA 3NKYA 1S6QA 3PJWA 2ALZA 4CJTA 5KFZA 3T5LA 4DL2A 4ED0A 3SZ2A 1F21A 2IAJB 2JC0A 5C25A 3ITHB 4H4MA 4Y1DA 2AJQA 1B9DA 2BQ3A 3H08A 3HKWA 3NF6A 2W8KA 4DFKA 5I42B 2RDIA 3MFIA 3D28A 1C1BB 3CJ0A 4LH5A 1N56A 1KSPA 4LY7A 4YMEA 4Q8FA 4K4SA 4HTUA 1TVRB 1RT2B 1FKPB 2FBYA 1REVA 4B9MA 1T03B 4CHNA 4J9MA 2AQ4A 1VSMA 1RCHA 1SKWA 5F9NA 3ZT2A 3KJVA 2QV6A 4IFYA 3QYYA 4RUCA 3AVBA 4ZVGA 3LP0B 1WN7A 4Z4EA 3HP6A 1B9FA 4CEOA 2KFZA 1S97A 4O3NA 4LSLB 4DQRA 4IG0B 4J2BA 4ZHRB 1RT6A 3QO9B 3ZSYA 2XGPA 5KFFA 5DQGA 4RW8B 4GW6A 4URQU 4AILC 1HYZA 4M41A 2O4GA 4X2BA 4DTNA 1NK9A 3EZ5A 5KT3A 4IKFA 3IG1B 3WNEA 3LWMA 3DRPA 1ZBFA 4URSA 3MEGA 3QEIA 1S1TB 4H54A 1JLBA 4R8UB 4NYFA 3LALA 1EETA 1NKCA 1L5UA 3DI6B 4RZRA 5HP1A 5J1EA 1GOAA 3ZT1A 1Z25A 2IBKA 2J6TA 4Q8EA 3QEVA 4DSKA 1TL1B 5JXSA 1BI4A 4EBEA 4CEFA 4TXSA 4WXOA 3KK3B 2RKIB 5KT2A 1RT4A 1TQLA 2HNYB 3OY9A 2OPRB 4PUOB 2W9BA 1RT3A 3VQ4A 4FBTA 1JLQB 4KB7A 1KFDA 4DTOA 3L3VA 4O5BA 3DRSB 3BSOA 1S5JA 2VWJA 2HAIA 4KBIA 4N47A 1HARA 4F3TA 1LWEA 1YVFA 4DL3A 3KOAA 4QPXA 5KFBA 3LANA 4DTJA 3VQ6A 1IKYA 3FDSA 1IKXA 2ITGA 5J2QB 4ZVFA 4JV1A 4WE1A 4CJWA 4RUAA 3HPGA 3KHLA 4RW6A 4BWJA 4KO0B 3TAFA 4FM1A 5DK5A 3HVTB 4RW7A 2R8KA 3E01B 5CYQB 3GYNA 3K5OA 3RAXA 3T5HA 3GIJA 4CK2A 4MFBB 2F8TA 1S10A 3K5MA 4H4OA 3T5JA 5EWGA 4KKOB 3FFIA 4NLWA 1A5VA 3PO4A 2HB5A 4DSFA 4IDKB 3RAQA 3DOKA 3G6XA 1VSDA 4O0JA 4CJSA 2P5GA 3M8QA 3H98A 1SL1A 2PYLA 1N48A 4E0DA 3V6DA 3SUNA 2R7YA 4JLHA 3RB4A 1LW0B 3QLHA 2ZKUA 3VQ8A 4J9RA 5KFTA 4QWBA 1RT5B 5KT6A 1XR6A 2IM0A 4O3QA 4W5RA 5EWFA 1LWFB 4ED1A 1HNVB 1RTIB 1J5OB 3CDUA 3H59A 3IAYA 5KT7A 1T7PA 4CJFA 4IG3A 1VSLA 2AGQA 4ZPDA 3ISNC 2RF2A 4CJLA 2JLEA 2XY8A 3MXMA 4U6PA 5J2MB 2YNFA 1S6PB 2VG5B 3I0SB 3NBPA 4QW8A 3CDEA 3NH0A 1IKVB 3LAMA 2G8WA 2ZE2A 4W5NA 2GV9A 2IJFA 4PQUA 3NFAA 3L2RA 2YKNB 1K1SA 4B9VA 3BQ1A 5KFEA 1D9FA 4DEZA 3NGZA 2WB4A 3K5LA 4DFMA 1U4BA 3JSMA 3KLIB 4WFXA 4DTMA 5JS1A 4HYKA 5EDWA 4ECTA 4CGJA 3SPZA 4NLRA 3RRGA 1S1UA 4BE1A 3CDWA 2A1SA 4Z0UA 3OS2A 3H5YA 3PVXA 3IN5A 2IA6A 3V9XA 3O3HA 4HUEA 2B43A 3DRRA 4CJKA 2GUIA 3NH1A 3NGYA 3KD5E 4F50A 3SUOA 3L2WA 1KRPA 3V9UA 1N6QB 1NK4A 3O3GA 2WRMA 1XHZA 4B3OB 1Q9XA 2HW3A 1HNIB 2VG6A 1FKOA 3AO4A 2W9CB 3KK2B 4DSEA 4RW9B 3IRXB 5KFCA 4IRDA 5HRRA 3D0PA 4B9TA 4KHRA 4NLOA 1VSEA 3OJUA 3PX0A 3FQLA 1WSFA 3NL0A 3HP9A 3EYZA 4BE0A 3AVGA 3OS1A 3GV7B 3MECB 3M8RA 3TWHA 3S3OA 3KLHA 2FVQA 4F4WA 1LAVA 4G1QB 4Q45A 4WXWA 4F4YA 2DFEA 3V4IB 4MQ3A 2BANA 3PW4A 1UOCA 1BQNB 2KQ2A 5JUMA 2JEJA 4IOBA 4Q0BB 3OLBA 4KFBA 2Z1GA 2BDPA 4FK2A 1NKEA 5FROA 2FBXA 3AV9A 3KLEB 4F4ZA 3IGVA 4FJIA 1VRTB 4M45A 4KTWA 3DMJB 1HPZB 2VG7A 1QHTA 1TK5A 3NGIA 2AGPA 1TV6A 3WNGA 5FRNA 4XPEA 3GIIA 3VQ9A 3C95A 4CEZA 5HRPA 3S3MA 4N41A 1IKWB 4CJ4A 4KB0A 5F8MA 1U45A 4KHYA 1WSHA 4J2EA 4OPJA 4RW4A 3V9ZA 4J9KA 3OYGA 3O3FA 5KFUA 3ZSRA 2YHAA 4E7KA 1XI1A 1FK9A 5HLFB 1YTUA 4B9NA 3OL7A 3SUPA 3DOLB 4DSLA 3K57A 2YNIB 1RDBA 3RBDA 1HRHA 1TKTB 3DLGA 3F73A 4WZMA 3LZJA 2HMIA 3CJ4A 5FDLB 1JXEA 2D0BA 3GIKA 2IAJA 3Q8SB 4OGCA 3HL8A 3ITHA 4NLVA 1RYRA 3H5XA 4FJXA 1NHUA 1TL3B 1RA6A 1K6YA 4KPYA 3ZSVA 1LWCB 4Q43A 3QESA 5JS2A 1QSYA 1Q8IA 2UUTA 3LP1B 1S9GA 2YNGA 3PZPA 4M3TA 2OZMA 1T94A 1TVRA 1RT2A 3PW7A 1FKPA 1T03A 4NLTA 4MIAA 4WYLA 4KHWA 1LV5A 3ICLA 1NJXA 3PW0A 1W9HA 4IRCA 4MK8A 5EWEA 3B6OA 3LP0A 1HQUB 3OYJA 5KG0A 1NNDA 5DG7A 2HNDA 3MR2A 4TSXA 4ECXA 4E7HA 1D1UA 3KKRA 5KFYA 4NCGB 2I1RA 4ZHRA 4FCYA 5L1LA 2HHVA 3MEEA 4ZP8A 1JLGB 4DLGA 4IH7A 4J9SA 4KV8A 3BREA 3AVMA 5C5JA 4Y2AA 4FLTA 4KHNA 1GOBA 3I0RB 4I7FB 4CJPA 1RTJB 1S9EB 4F4XA 3DLKA 4DU3A 2W7OA 1S1TA 4CF8A 4R8UA 4I2QB 1SKRA 3DI6A 2VA2A 5KRTA 2AX1A 2ILYA 2CKWA 4GVMA 2GBZA 2AGOA 4K4UA 3QINA 3SFUA 3NAEA 3RRHA 4CF1A 1I39A 4TN2A 2OYQA 4CERA 1TL1A 3L2UA 2BGGA 5C24A 1L3UA 2Y1JA 2RKIA 3OYLA 2HNYA 2KZZA 4RNHA 4NRTA 4PWDA 2OPRA 4PUOA 4IBNA 1SH3A 1TP7A 5CY4A 3KNAA 1ASWA 4O55A 3BGRA 3HJFA 1S48A 1WAFA 2ASJA 3MAQA 3P1GA 3AA3A 1DTTA 1WSGA 2JEIA 3OL6A 1NK5A 1S49A 5KFVA 1SV5A 1C1CB 4FK4A 2B6AB 1S4FA 1BCOA 3ALYA 3CG7A 3SI8A 3RR7A 3NAHA 4JS4A 2YNHB 1J54A 4OL8A 3VQDA 3SQ1A 1RDRA 3H4DA 4TQSA 1YVUA 4FBUA 3TARA 4KO0A 4C8NA 1NOYA 1RT1A 3EPIA 2FVCA 3HVTA 3DLHA 3SJJA 2QKBA 3E01A 3CFPA 4JUZA 2FLLA 1TKXB 4KSEB 4G3IA 3OVNA 1KVBA 3MTKA 2R8IA 4O44B 4LQ9A 3MR6A 2W42A 2C2EA 1EKEA 1HQEB 2UVVA 2XI2A 5KT4A 3SQ4A 4MK9A 4IDKA 4L8RB 1LW2B 3GV5B 3C94A 2YKMA 4M3ZA 4TQRA 4Z4FA 2ASLA 3DLRA 1ITGA 2C2DA 4CJUA 4OLAA 1S1VA 2WOMB 4IFVA 5F8HA 3DM2B 3LP2B 2G8KA 1JKHB 3NCIA 4ID5B 4FLZA 2QXFA 1W25A 2XY6A 1LWFA 1JLEB 4ZP7A 3QIOA 1HNVA 3HM9A 1JLFA 4NLUA 4EO8A 2BRKA 3SCXA 1SUQB 4TY9A 4FZYA 2CJQA 1X9SA 2F8SA 5J2PB 5J2MA 2A1RA 4NLQA 3OYCA 4HCBA 3U3GA 3S9HA 1I3AA 3SNNA 2B4JA 4B8CA 4YR0A 1IKVA 3HYFA 4ICLA 2X78A 4JV0A 5CZ2A 4R5PA 2HWHA 1TK8A 1S0OA 3NMAA 4F3OA 4CGIA 4NYZA 3TVKA 4ECYA 3N6NA 1NJYA 3KLIA 2BE2B 4KHMA 4J9OA 1EP4A 3JYTA 4DG1B 2E9ZA 3CFOA 4DF4A 4DTXA 1XR7A 2RDJA 2B5JB 3PJXA 4GC7A 3RMCA 3PHEA 4ELVA 3KK1A 1TKZB 1N6QA 4HUFA 4JS5A 2PY5A 2ZQBA 2BRLA 4B8AB 3AVNA 5KG2A 1HNIA 4I2PA 4FLWA 3CFRA 2W9CA 3KK2A 4CFDA 3OL9A 2XGQA 2FBVA 2I5JA 4M3UA 5C25B 3V1RA 4AH9A 4H4MB 1X9MA 4WZQA 3RR8A 2X74A 4ELTA 2PZSA 3MECA 4EO6A 2XWYA 2D7SA 3AA4A 1ZBLA 2OH2A 3LPTA 1S1WA 2HVIA 4DTSA 1BIUA 3EY1A 2HNZB 3DDKA 1REVB 3T19A 3OYEA 4KB1A 4OKJA 2F96A 3BQ0A 3AO1A 1VRUB 5KFGA 3ZT3A 3KJVB 4Q5VA 1BQNA 1BQMA 3NH2A 4ID1A 4Q0BA 1ZYQA 4Y3CA 3PX4A 4HVJA 3CIZA 3HT3A 1IG9A 2QK9A 4BDZA 3TI0A 4Z4IA 4K8XA 3VQAA 5J2NB 1KLMB 3UDLA 2E9TA 3Q8QB 1HPZA 4FJ5A 4ECWA 4ECQA 4F8RA 4KI6A 5KFJA 1QQCA 1U04A 4KREA 5DLFA 1QSLA 5K14A 4O3RA 4CJ5A 1CXQA 3MEGB 4W5OA 5KFLA 1U49A 4YNQA 4KHUA 4CK3A 4E89A 1JLBB 4BACA 4DL4A 4C8KA 4EP4A 2AU0A 5SZTA 5J1EB 1RBVA 1BCMA 1RBUA 3D45A 3M8PB 5HLFA 1TKDA 3DOLA 1TKTA 1KTQA 2R2UA 2D41A 5FDLA 5KFKA 5L1IA 3G10A 4CGGA 1RT4B 3H2LA 4RG8A 1SKSA 4YP3A 3HXMA 1YTAA 3G86A 1CZ9A 4IRKA 2W9BB 3SPYA 3KKSA 4K4XA 1JLCA 1RTDB 1T05B 1XWLA 3C6TA 4ZVHA 1BIZA 2DY4A 3V1QA 3EZUA 1LWCA 4K4WA 5C42B 1C0UA 4ED2A 4DQIA 5KG4A 1RTHB 1LWEB 3GV8B 1WAJA 3HVAA 1NOZA 2V0NA 4FJGA 3IS9A 1D9DA 1IKYB 1HQUA 3MEDA 3VQ7A 5KFDA 3RB0A 3LZIA 1JL2A 3I5BA 2XI3A 4IH6A 1HYVA 3AVKA 2ILZA 3GILA 2F8EX 1RYSA 4CJ3A 1HJRA 4XIUA 2HHUA 4RW6B 1WLJA 3OYHA 3SV3A 2OPPA 1JLGA 5HROB 4N5SA 3V81A 3FRZA 3HPHA 3HVRA 3I0RA 4I7FA 4H4OB 2IM2A 5KFQA 3PW2A 4BWMA 2E4LA 2R2SA 3AVFA 3FFIB 4RU9A 1S0NA 4J9PA 2HVHA 1CSJA 1RT7B 3AO2A 1NK0A 4O4GA 5CYMB 4FZZA 1KHVA 2VWKA 5DMRA 5E41A 3QERA 3DOKB 2HHWA 5KFWA 5HBMA 4C8OA 1NKBA 4RNMA 3HVWA 2XC9A 3HO1A 4GC6A 3PUFA 1ASUA 4DFPA 5KFRA 4M3WA 2Z1IA 2GC8A 3QGIA 1C6VA 2YHBA 4MKAA 4KTZA 3QLHB 2G8UA 1WSJA 4ECSA 4FLXA 3BR9A 3SQ2A 4FM0A 4RNFA 4OKEA 1QE1B 3MFHA 3WNFA 2OPSB 5L1KA 1S1XB 2AX0A 4DL5A 5KFOA 3T5KA 3K2PA 4IG3B 1TAUA 4ECRA 4CEDA 4TY8B 2RF2B 2IS3A 1R0AA 3LPUA 3VN5A 4FLYA 1Z26A 3HSTB 2KZMA 1CZBA 5KGWA 3IGNA 4LQ3A 2ZE2B 4U7CA 3V6HA 4NLDA 3RMAA 4K4TA 1NHVA 2R8GA 3RB3A 1RBSA 1DTQB 1J53A 3CQ8A 2YNHA 2XHBA 4XO0A 5EU7A 4DWIA 2IM3A 1GOCA 3JSMB 1ZBIA 3K58A 4K50A 1SH2A 4ECZA 3M9OB 5I42A 3Q8PB 1C1BA 1ASVA 3UQSA 1N5YB 3MR5A 3V1OA 1L3SA 1ZETA 4EZ9A 3PV8A 1TKXA 3NHGA 4RNNA 3GQCA 4B9LA 1JXLA 3SYZA 1L3VA 4AHUA 4FYDA 3CM5A 4O44A 4NCBA 2OZSA 2AWZA 3VQSA 3AVJA 3OYMA 3PO5A 1HQEA 3H4BA 2EHGA 3CM6A 4MH8A 3DRRB 5F8JA 4KAZA 3L2QA 5DQIA 4WFYA 3DYAB 4ZPCA 4FS1A 4EYIB 4EYHB 2O4IA 4LSLA 2E6MA 3ZSZA 4IG0A 1C0TB 2XCAA 4O3SA 3T3FA 3QO9A 4K4ZA 3QIDA 1ZBHA 2XO7A 4M42A 4RW8A 1UWBB 2VG6B 3KLGB 2UUWA 2WOMA 4CJEA 2X6NA 3CO9A 1Y97A 3IG1A 1NK8A 1JKHA 4W5QA 5KFNA 3RMBA 2KW4A 3KLHB 2FJVA 2R2RA 3VQBA 3HK2A 4CEAA 5F9LA 1QSSA 4OVLA 3TAPA 4ED3A 2BANB 4LSNB 4WFZA 3UIQA 2YV0X 3L8BA 3QIPB 4RNOA 3M9MB 4WYWA 1WNSA 1C2PA 2DFHA 4OPKA 5DQHA 3ZSOA 1IM4A 3KK3A 2JEGA 3CJ2A 4NZ0A 3UR0A 3VQ5A 4FJKA 3H5SA 2GIRA 2J6SA 3KIOA 4MIBA 2D3ZA 3PX6A 4C8LA 1JLQA 4O3OA 3VQCA 3DRSA 3QGGA 2BE2A 1UA1A 4JV2A 3OLAA
chains in the Genus database with same CATH superfamily
1VISA 5IM0B 3THVA 5L8RC 4KHQA 1XR5A 3J7AN 1OKJA 4K43A 5DG9A 2IRXA 3ELHA 4QZVB 3UCUP 5EX3A 4CO5A 4ZPAA 2B9XA 1EJ7L 1NBEB 1OPIA 5A0YB 1E6YA 4QYZK 2UXBF 1FE0A 5KRSA 2OD6A 2YHYA 3CT9A 2HF3A 2G8VA 1HR0K 3MXIA 4AQYK 2HMIB 5IWAJ 1Q81T 1JJ2R 1JL1A 4YQWA 4NLSA 3TUJC 1O1WA 4PAAA 4NB4A 3HI9A 5AQGA 3W9IA 4OLBA 2NUHA 5BR8K 3DU6A 3BSCA 2EEYA 3CJ3A 2HBYB 5BYSA 5KG7A 2QA1A 1ELOA 3IWXA 4ED8A 3R7SB 2F5GA 3BO2A 1S0MA 4JV5J 1C0MA 1AW0A 1ZTWA 4Y1CA 5HL7Q 1RT5A 3DNCA 4DS4A 2A3ZA 5CE3A 2WONB 4JD2B 2HNDB 3WNHA 3G6VA 3UWTA 1BHLA 3OXFA 3O5BA 2XCPA 3CF5Q 3TWZA 2DRAA 1M90O 1SJ1A 1XMOF 4F2SA 2X1AA 1KAXA 3CO0P 3EJMA 2WVDA 4W5TA 2YQ3A 2RN2A 4Q44A 4H8KA 3G6ES 1IJFB 1T9VA 4B1YB 4FJ7A 3MN7A 1UZHA 1VIOA 3V9WA 3S8SA 2FLPA 2X1BA 3MF5A 3NE6A 3BGFA 1UVKA 2NUBA 4M3RA 3THYB 4DL6A 1VJWA 4AF1A 1TAQA 1BA0A 2HHQA 5JMNA 2KLAA 2PMZD 4CESA 3QEXA 1U8WA 3OPKA 2BQUA 3GL1A 1HYSB 3ZSQA 4OHXA 1Q16B 4PRFA 3SV4A 3RSEB 3WX4A 2W7PA 4OGEA 1D0EA 3EE8A 4NWBA 2F3JA 3G82B 3ZZRA 1RBRA 4NLXA 2I6WA 3FMBA 2IFXA 2KRRA 4PG8A 2AEJA 3M1VA 1X4DA 3VA0A 3O3LA 5AE1A 3VQEA 4FJHA 2JWNA 1HMVB 3MMBA 1KNZA 2WUSA 3AD8C 2ZBCA 1EHWA 3BUZB 2E2OA 2HKEA 2M4MA 2EFOA 4DKWA 5BPMA 3IM8A 2HPUA 4M95A 3N5BA 1L3TA 3WC0A 4Z4GA 4OJGA 3KMQA 4YFUA 5M1OA 4P72A 2B56A 2E2NA 3V4IA 2PIIA 3PIPL 3V6KA 2VKZG 2G4BA 4UY85 3P45B 4AHVA 3CUNA 3HHNB 2L08A 2H3GX 4LF6K 3QZ7A 3JSRA 2KHOA 4UZCA 3J8AA 1RT7A 3DOMA 5K9FA 5CYMA 4QWAA 3US5A 1VK0A 4K5RA 3S1TA 1NDCA 3NGKA 4DPYA 2Q3PA 2YKMB 4GKKJ 4E1JA 3FZMA 3ILLA 4IFVB 1CXUA 2WAQD 5KG1A 1NJWA 5IS2A 2I9SA 3OSNA 4OKKA 3CHWA 1B0VA 3P5JA 3QNOA 2KTQA 2E1CA 3H2VE 1RA7A 4CCHA 3JS9A 3NNAA 1TGOA 4TY8A 1B3TA 3NDKA 4U8YA 3TAQA 4JI1K 2YNIA 2KVQE 3AOAA 3OR1A 4IOAQ 3VEWA 1BI4B 3OV7A 4CF2A 3CMEN 4ICLB 2IMWP 4I69A 2CG4A 1VHXA 1IBLF 4R0EA 4I9QA 1O5JA 2HOEA 1CC7A 2G8HA 3BSNA 3ENBA 5CZ1A 4ANCA 3OYIA 1EP4B 1J27A 1WWHA 4JI0K 2H3EB 4K0KJ 4X66J 4C11B 4O4RA 3VAIA 2Z2MA 3VGKA 1U47A 3EGZA 3BYRA 4LFCF 3C14A 3FEZA 4RWTA 4KE5A 3F9KA 1N33J 3FQKA 3LWLA 3IM9A 5E7OB 4DX5A 1QTNB 2X1GA 1M1KO 2VZ9A 4NMLA 4NYOA 1KVAA 4TYAA 1VHFA 3EVOA 1YJWS 3G4SS 3KLVA 3HKZD 3KK1B 4ZP9A 1EX4A 5H9FK 1Q53A 5D6GA 5KG6A 3SQ0A 4CEQA 4URGA 4X62K 3MCOA 1HBMB 5GMKa 2I5JB 1Z05A 4X4UA 4ED6A 1VAZA 4WFNQ 3PNIA 2PMWA 3OTOF 3G8TA 1S1WB 3VGVA 4CGHA 2MTLA 3DRYA 4FJ8A 3M30A 1T02A 3GIMA 3OW2M 2WCXA 1X1PA 2NYIA 4PPDA 4IR9A 1RUSA 4J9LA 4CWBA 3MMAA 3V6DB 2IYIA 1A5XA 3MAAA 5AXMA 2FUG9 3WT0A 3N6MA 3BKUA 1HNWK 1Q82T 3UR3C 4CNZA 2ASMA 5JICA 4UUWA 4CD1A 2R2TA 3NF9A 2DHGA 4FXDA 3ZX3A 1IBKK 4LR7A 3C16A 5C2CA 4IO1A 3CD6S 3J80U 4ZTFA 1FWLA 3CJKA 1VC5A 2Q6BA 1K8KA 3TUZC 2E44A 4ILJA 2XS2A 2B6AA 2OMLA 3HMJG 4BR7A 3MXHP 3QETA 2J9CA 3Q8UA 1BA1A 2D0CA 2B4UA 2QN6B 5B0DA 4I0WA 3OBWA 1FDBA 1PIEA 3DU5A 1T11A 1I94F 3FZHA 1VQ5S 1R8BA 2F7TA 3NVKA 2BJDA 3SBGA 3TP2A 2PN6A 4YDDB 1UFLA 4KI4A 2W2QP 2D3O1 1N36F 1REGX 1IH7A 1N4LA 1JJ4A 2P9PA 1RHMB 3C7NA 5I3QA 2KU7A 1RILA 4PY5A 2OI2A 4JI4F 3ZYYX 1NGDA 1JLAA 1TL7B 3OYDA 1QJHA 4DS5A 2G8IA 1LW2A 5KFAA 4Z4HA 1AFIA 1RBTA 5D8HB 4DI6A 1BY9A 4B1WB 1Q7LB 2G0JA 4QU7A 5RUBA 2QA4N 5KFMA 3CVKA 3BO4A 4ZN3A 3UE2A 2E29A 2ZHAA 2DPJA 4E1MA 2X1FA 2D3UA 4OI0A 3LP2A 3HX9A 1VI7A 1R6YA 1Q79A 3BGUA 4CIEA 4WP8A 2R7QA 2O67A 2D3OR 4DTPA 3L7OA 4BDPA 2D0AA 4AHCA 1NPRA 2OPPB 2BJ9A 3C6UA 4QWEA 2AV5A 1WG5A 1V3RA 1N34F 2AJ1A 4F4KA 2FYXA 2P5OA 2UXCF 5KFIA 4OX9J 4ZJLA 3LA0A 4JK7A 3KJFB 1OY9A 3TAGA 2VOOA 3SEOA 4O4GB 2OKQA 3I5CA 1MU2A 5HBMB 4KTQA 2FC0A 4WK3A 1OYEA 3PFOA 4EBDA 4DV2F 2ZD1A 1TFWA 2CH5A 2OLWA 2O8FB 4DG1A 4OIXA 5HMYA 5KFPA 4NA2A 2J8AA 2DTUA 3W9HA 4LF8F 2HIYA 3IBCB 4XPCA 1HHQA 5IT4A 3CDBA 4ANEA 4MKYA 1N5TA 4E7LA 4JYAK 4AHRA 2QO3A 1DLOA 2FBTA 3I55N 3AVIA 1ATNA 5DLGA 2ZJPQ 2HBKA 1VQ9N 4CHOA 4E7JA 5KFSA 4HUGA 3ZSWA 3O9TA 1TKZA 1UZDA 4E19A 3MN5A 3TQEA 4CJTA 3T5LA 4UOCA 3CCZA 1YI2S 4ED0A 1BUXA 3SZ2A 3ID6A 4JBCA 2VQFF 1KDNA 4USTA 2AJQA 1B9DA 1Q78A 2W8KA 3A8YA 3CJ0A 2ZH8A 4HTUA 5HOOA 1T03B 4A2AA 3EM1A 4CHNA 3IP0A 1FWPA 2DGTA 5F9NA 1Q81O 2QV6A 4AQYJ 2FY8A 4IFYA 4ZVGA 3LP0B 5A8RB 4Y2KA 3AT1B 1H6KX 2CDRB 3JSBA 4W98A 5AQPA 3ZSYA 1T9XA 5BR8J 4DJBA 3CC4S 4GW6A 4URQU 4AILC 2VFUA 1VCTA 4DTNA 4Y0FA 3WNEA 3VMFB 3MEGA 3HHDA 4NYFA 3F0NA 3FEYB 1EKRA 1S3XA 5HP1A 4IJNA 2CVIA 3OTCA 3QWUA 5J1EA 4YS2A 3AB4B 4Q8EA 4FKYA 1N5QA 1M5KC 3MPYA 1KD1T 1VQSA 5ADXA 2HNYB 3V4MA 3VQ4A 4USWA 4FBTA 4KB7A 3DXMB 3L3VA 2VOPA 4O5BA 3JTOA 1S5JA 2VWJA 3ULEA 4S0MA 2VBYA 4N47A 4B1VA 2NLWA 1LWEA 3NGSA 1QDUB 1MWKA 5EGYA 4DR1F 4QPXA 3P5TL 2R7OA 3P96A 2L9WA 2B7CB 3PM9A 1XIQA 6AT1B 3U1NA 2RNEA 1GK8A 4A2BA 3U1LA 1VQMS 2ITGA 4FVUA 1E6YB 3MUVP 1WG4A 4DV5F 5D15A 4LFAF 1NGEA 2BYCA 2MQPA 4NXNF 4RUAA 3KHLA 4EAHD 3A5OC 3TAFA 1OH5A 2CNLB 4RW7A 3OFFA 2D1CA 3GYNA 3O8WA 2AW0A 1YK9A 3T5HA 5LOQA 2QWRA 3GIJA 2F8TA 4UOGA 4DR2K 3T5JA 1ULRA 4DUYF 4DPOA 3RJMB 3FFIA 1HW9A 4M5IA 4IDKB 2D0OA 4BC5A 1GMUA 2VDIA 3VF2A 4CJSA 4OYIA 3ZEUA 5G4DA 1SL1A 4YY3K 3VQ8A 2V8DA 4K59A 3T7ZA 4JEPA 1HBOB 4QWBA 1RT5B 3AAWB 5KT6A 1HKGA 1R8AA 1SC3B 1AZSB 1Y5LB 2JZ5A 3MURP 4OI6A 4LMZA 4LF6J 2HRTA 5EWFA 4BC7A 2QLBB 5AQYA 2LCWA 3H59A 3IAYA 5KT7A 1QHAA 4IG3A 2YY3A 5GIPA 4BQZA 2J7KA 2RF2A 2MZTA 4CJLA 1MN9A 4U6PA 5J2MB 5K8OA 1LFPA 4QW8A 2E1MC 4PQUA 4JAXA 4BRNA 1K1SA 1H2VZ 3M2VA 4DEZA 3NGZA 5B0AA 2KXNB 2R3VA 4W90B 1EARA 1XMQK 1DKGD 2J7UA 2EBEA 3KLIB 3VPZA 5JS1A 4ECTA 1WBBA 3SPZA 4AL6A 2CJAA 1Y7PA 4O8KA 4JI1J 1P1LA 3CDWA 1T9TA 3FZ2A 3OS2A 2VASA 1HHTP 4NEZA 3V9XA 3CD7A 4GVLA 4JI2F 3M1VB 5HAOA 2XEXA 4KT0C 4IEIA 2IMOA 4JOUA 2GZOA 4Y2MA 2P9LB 1M5HA 1KRPA 1RU1A 4ILGB 1URNA 7FDRA 1XHZA 2HW3A 4JI0J 3AO4A 2PI4A 2W9CB 3AGKA 3BZKA 1WSFA 3EYZA 3AVGA 3MECB 3TWHA 3KLHA 4OYOA 3KHYA 4LF9F 2E5LK 2AA4A 1GFWB 3O9UA 3V4IB 2RJZA 1UVNA 4MQ3A 3FE1A 2BANA 3PW4A 4YORA 5H9FJ 1BQNB 3PSIA 2H65B 3VTHA 2KQ2A 4IOBA 4Q0BB 3U7JA 4KFBA 1TELA 2Z1GA 4FK2A 1RWKB 3NGTA 1HR0F 4X62J 3T1HK 4L3KA 5HSPA 3LM2A 2FBXA 3AV9A 3OA9A 3DOMB 3RVCA 4HH0A 1QAXA 3WXMB 1ZS6A 2PFDA 3PG9A 1QHTA 3MM7B 3D6FB 3CMAS 1WF1A 1YJUA 4WWSA 2HK2A 5F3ZA 2HQFA 1ZXOA 3VQ9A 2MKYA 2DHXA 2UYTA 5F8MA 2P9UA 3IR7B 3JXOA 2O8CB 4J2EA 3H25A 4OPJA 1HNWJ 3O3FA 1RWWB 2YHAA 2IBOA 2ZZTA 2CH6A 1XI1A 3L4IA 4RR5A 1YTUA 5GAHU 4DV6F 1IBKJ 3SUPA 3DOLB 4N8NA 2NYHA 2YNIB 1X0FA 3RBDA 1HRHA 3DLGA 3OR1B 1L3KA 3CJ4A 4WBFA 3HSZA 4XDDA 3WBZA 1Q1KA 3CCQS 3CULA 3H5XA 1RA6A 1K6YA 3BN4A 1RGVA 5JS2A 1HIYA 4IOAL 4M3TA 3R5DA 3PW7A 4C2MA 2RUSA 3UCGA 4RWXA 4NLTA 3D7SB 4WYLA 4ZKAA 4GY2B 4ZCKA 3PW0A 4MK8A 2V8PA 3W62A 2M5YA 2LEAA 3OVAA 4M1KA 1QVGR 1NNDA 1S22A 3MR2A 4ECXA 2NPIA 1C0FA 3KKRA 4HACB 4H0OA 3SLCA 4FCYA 2LMIA 5L1LA 2HHVA 3MEEA 3AA9A 4BRKA 4DLGA 4NLBA 2CQHA 3T1YF 3FEXB 3AVMA 4Y2AA 4CLZA 3I0RB 2YX6A 3W5XA 2UXDF 1LK5A 4F4XA 3DLKA 4DU3A 1QQMA 3DI6A 5KRTA 1U24A 2CKWA 2ADBA 4K4UA 2VQEF 4ITSA 2VKRA 1ESVA 3RRHA 1RK8A 3MMAB 1SC6A 4P6QA 1YG0A 3MAAB 2RKIA 1BC6A 1MWMA 4CO0A 1X5PA 2KZZA 4RNHA 2HQIA 2NXCA 4NRTA 1W26A 4IBNA 1KEKA 1UKUA 1LQ9A 4M8LA 3C16B 3EO3A 1ASWA 4DR5K 1U8SA 2JDJA 1BOTO 3AA3A 1DTTA 2F9TA 2AZ3A 3OL6A 5ETPA 2Y3YA 5KFVA 1SV5A 2ACMA 3W0LA 2B6AB 1RZMA 1N5SA 1RGIA 2BXJA 1IUJA 2L9DA 4U8VA 4JKCA 3SMSA 3M8ZA 3VQDA 3JAMO 4JYAJ 3H4DA 4BRQA 4FBUA 3TARA 2UUAK 4C8NA 4B02A 1EIYB 2NRRA 1VQLS 1K73O 2DGQA 1TUYA 1KVBA 4USUA 4IO9Q 2R8IA 4O44B 2KB2A 2P9PB 3J81O 2XYPB 2R7XA 1SVDA 2CGJA 3TTDA 3ZO7A 3SQ4A 1KQSM 4MK9A 2M3DA 4L8RB 1KWMA 4OJ3A 1LW2B 2VF3A 1TUVA 2YWEA 1HQ2A 1RWMB 4H03B 4G6VB 2YPYA 1ITGA 2Y1RI 1S1VA 2WOMB 2MZ1A 5F8HA 3OQ2A 1SI9A 3LP2B 2LQ8A 2U2FA 3IMQJ 1U2FA 2G8KA 1CJUA 3NCIA 1ATSA 5AQLA 5GAGP 1LWFA 3QIOA 4PR6A 4JI7K 1IM6A 4DCJB 1JLFA 4EO8A 4FZYA 2CJQA 1X9SA 2XMTA 1SJQA 3OUYB 3F44A 4NLQA 2A1RA 5LXYA 3DWLA 1KC8O 1P27B 3A3OB 1GXTA 2HFNA 4LF5K 2QL5B 2B9YA 2X78A 1VQ8N 5DDQC 2KRBA 1SQKA 4R5PA 1CULA 3NMAA 4F3OA 1HJOA 1UMJA 1RLCL 2HGNA 4ECYA 1YX2A 1Y4ZB 5BYRA 4KHMA 3L95X 2DISA 3HSDA 3JYTA 1TUWA 2VFSA 4DR7F 4DG1B 2V34A 3PJ9A 1FTRA 1KD1O 2H4WB 1KBRA 2IVPA 2JH3A 2RU9A 2MMYA 3MMCA 4V1Ak 1F5BA 3HF5A 3PJXA 3Q0AA 3RMCA 4FWLA 3ZZUA 2EFPA 1TKZB 3VGTA 2ZQBA 5H1SV 3MCMA 4L73A 1M5VC 5EY4A 1TMMA 1FI4A 1DARA 4C9DA 3V1RA 4EIAA 4AH9A 2ZJPL 3RR8A 2NXJA 4R0JA 2F4FA 2VFRA 1WHYA 4DTSA 1KTVA 2CQ0A 3T19A 3OYEA 4OKJA 2QEXS 1IJEB 1HPMA 3I31A 5DDOC 1BQMA 4MKVA 4PG7A 2X3DA 4L75A 3PDNA 4NXMJ 5HVGA 4Q2LA 2BJ1A 4Y00A 4QR0A 1IG9A 2QK9A 2BOAA 1VIXA 3TI0A 2VICA 2YHWA 4Z4IA 3VQAA 2FSJA 1UEUA 4DR2J 5J2NB 3G71N 1KLMB 2MZQA 2E9TA 2W1BA 4M7XA 3VGLA 4KI6A 1HBUA 2WFBA 3JXUA 1IR1A 1AUSL 2DY1A 1C4CA 1B0TA 2WC9A 2AJ0A 2KVIA 1QSLA 4CNYA 2DNGA 1EWRA 1F60B 3MEGB 2A0FB 4YY3J 2YWWA 2QTDA 1TL5A 1OY8A 2UU9F 4FWKA 1Q86T 2AU0A 5J1EB 1Z1ZA 4W4MA 3CJCA 3M8PB 2M9KA 5CZVA 1T95A 4OI2A 2R2UA 4DR6K 2XS5A 3T9NA 5EX5A 2DIUA 3FCHA 3CCUN 3HXMA 3G86A 2D74B 3CERA 1T05B 3AY0A 1XWLA 3V1QA 4BRFA 1IQZA 4FWRA 4M5GA 4K4WA 5C42B 5ETMA 3ULEB 1PAUB 2XZWA 1XJWB 4HH1A 4ED2A 2E1AA 4F4AA 1LWEB 1VQKN 1WAJA 1U1OA 1XMQJ 2HVDA 2ZWHA 3IS9A 5ETQA 2MQ8A 3FBBA 1NDLA 3IR5B 2GMLA 3EMTA 5B0BA 3RB0A 3THPA 4UT4A 1JL2A 2FZCB 4BS2A 2GAGC 4MLEA 2C3OA 2ILZA 1CJTA 2GFFA 3GILA 4CJ3A 4X65K 1HJRA 4XIUA 2HHUA 1NO8A 1WTFA 1D3WA 1WLJA 3KDNA 3OYHA 5HROB 4N5SA 3C15A 3UD5A 3V81A 3FRZA 4X4VA 3HPHA 3HVRA 2GHWA 4I7FA 3GPAA 5KFQA 2HIQA 3PW2A 4LC9B 4WFBQ 3FFIB 2C42A 4DOZA 4FWPA 1NK0A 2HRUA 5DMRA 2WW4A 2DNRA 2YH1A 3QT6A 2IPOB 4C8OA 2DR7A 3MPWA 3ZEUB 3HO1A 1H7WA 2BJ7A 1BDGA 1H2TZ 1B4SA 2E5LJ 1XC3A 4YOUA 3QGIA 4NPOA 2IJRA 1C6VA 5KPZA 2CJXB 4OFZA 4ECSA 2YJEA 4FLXA 4DDFA 1GLAG 4LRDA 2D1KA 1QE1B 2HS0A 3CPWM 2GQCA 4FF3A 3T1HJ 1VK8A 2AX0A 2XWXA 3LW5C 4U67L 5KFOA 4USHA 3T5KA 4IG3B 1EX8A 2RF2B 2WVCA 3VERA 4H5NA 1SB6A 1Z26A 4I6AA 1CZBA 1SC1B 5KGWA 3GFZA 3G8SA 1N88A 1NU0A 2NUUG 3M2VB 3ZZTA 2GWKA 1J53A 3CQ8A 1PGZA 5A6PA 4B3MK 4FNIA 1ZBIA 1Q5YA 4ECZA 1RLDA 3M9OB 3ZX2A 4PG6A 1ASVA 1N0UA 3GZ7A 3V1OA 3CJ8A 3BPDA 4EZ9A 2HSTA 2CNNB 3RG6A 1M1HA 1L3VA 5FPNA 2JX2A 4NCBA 2OZSA 4RBUA 3VQSA 1NMDA 3PO5A 4MH8A 1S6UA 3TNVA 3UE5A 4KAZA 2DHAA 3L2QA 4ZOSA 1FWKA 2O4IA 4LSLA 1ZOTA 3ZSZA 4DR3K 4O3SA 4KH5A 3QO9A 3QIDA 2HS4A 3DKDA 1ZZNA 1XTZA 3UN3A 3J80O 4F0HA 2ZJQL 3MCPA 3CO9A 1Y97A 1JKHA 3RBXA 4W5QA 1YJ9N 3SAFA 1ICEB 2Q36A 2ZGYA 3KLHB 1OVYA 4A47A 2OAUA 2VC0A 3KG0A 5AZJA 4HWIA 3EICA 5F9LA 1QSSA 3MX5A 2BANB 3L8BA 1PC5A 3M9MB 3AARA 1C2PA 1AB8A 2DFHA 1NGHA 3M6WA 5LJ5Y 1U1QA 1IM4A 1U1KA 1VQON 2MKKA 1R0BG 3NNCA 3UR0A 3JQJA 3MDQA 4FJKA 3D1QA 1GMVA 3H5SA 5M2UA 2J6SA 3GMGA 4DCHA 2CJKA 3MCAB 5CHIA 4H0VB 1OVQA 4O3OA 2YX7A 3SIPB 3O6QA 1H1VA 1YQHA 3QGGA 5MLCQ 2BE2A 1SS6A 3E9LA 5T7LB 3CJ9A 3TJ8A 2FHJA 3DLEB 1FNOA 2AKWB 3FK4A 1F9FA 2J7WA 1J5EK 4FJMA 2C28A 3L3UA 4J9NA 4DF8A 1CS4A 2RHQB 2IC3B 2V4QA 1WSIA 1C1AA 3AAQA 3EPGA 3PKYA 2XMAA 3CJSA 2GO9A 5J2QA 3CJBA 3UKRB 4ETXA 2JEFA 1UVIA 4HT7A 3DLGB 4DR5J 1NDKA 4O5FA 4ZA1A 4GO5X 4C8MA 3C19A 4BE2A 4ED4A 3D5MA 5E26A 2YWGA 3I6PA 4BDYA 4JHDA 4FJNA 5I3UB 1VQYA 4AHTA 2DFFA 4EP5A 2HFZA 3CMES 1DJ0A 2EG1A 4KKOA 2HNZA 1RDUA 4OV6A 2OANA 1KVCA 3CC7N 1QUVA 4OZLA 3EVMA 1FJGK 1W97L 1VRUA 4GMJB 1I1GA 2ZUGA 3UCZP 2QJ3A 4DU4A 3FBEA 3TR8A 1GLDG 3CJ7A 2R9LA 4FDFA 4ZVPB 1FRKA 3LDSA 1YLXA 2FJXA 2K7JA 3BSAA 3B6PA 3HZ6A 4C0OC 5L46A 4K42A 1DY3A 5HRNA 3GCXP 2CPXA 1VC0A 5AFUH 4AE5A 2IGIA 3MEEB 2OA8A 4NI2A 1S7IA 4I6WA 5T41A 4CI0B 1JQGA 4IKAA 3L4QA 1NH8A 2CJBA 1GLFO 2LDYA 2VG5A 3T1AA 2KFNA 1ZBUA 5HMZA 3DLKB 3H40A 1XQIA 1R31A 3FGVA 4OZ2A 5HVFA 1VMBA 5GMEA 3BQ2A 3HI0A 2OPQB 3VZIA 2Z2ZA 1VQNS 1HBNA 3DXBA 1S59A 2R7TA 4L3QA 2EK6A 4FPAA 4RO0A 1NJIT 3I8DA 5C15A 1QS4A 2A41A 2HRYA 4LUBA 2ZDPA 2QGFB 4DSJA 4NLYA 1RTDA 3OTDA 3VETA 4LF5J 5LSOA 3DN9A 5D3GB 2QE5A 4LRCA 1MDUB 4PHTX 3VGUA 4FJJA 2LSNA 4TVAB 3EX7B 1WB9A 2K8GA 1RTHA 4DTUA 1DTTB 3UN5A 1DZ5A 2X6SA 3AO5A 1FT8A 4KY3A 4AL7A 3CYMA 1SV5B 4K25A 3KZBA 3R5GA 2FHOB 1YITN 3C6AA 5HJYA 1AUDA 3BF1A 4B3OA 3S41A 3WQTA 4KHPK 3SSQA 4IQXA 3AOBA 5AXLA 2FDNA 2W4PA 4P52A 1ZAXA 2P9KB 1Y5IB 1YJNN 1NGIA 2VA3A 3AJDA 2C3YA 2C3MA 2HHHK 4G1QA 2QW9A 3MGJA 1RAFB 2ATLA 2YX1A 4TLRA 2QM1A 2V8VA 2EFVA 3KFWX 3W5ZA 2FIUA 2C2KB 2EFQA 3MK6A 4BR0A 4JRQA 4LJMA 1HWIA 4OPHA 4MKBA 3K8WA 4WTOB 4ZTJA 4ECVA 1PJ7A 4QW9A 2ATQA 2FZKB 4QS8A 4KHSA 1SJFA 1H3DA 3AA2A 3P39A 4EI2A 1NJZA 2PC6A 1S1VB 4RUBA 4TKTA 3JAMY 1D8YA 1NK6A 1LAWA 4EHUA 1SJRA 2V2KA 4IYQA 3M9NB 2ASOA 3D0IE 1RDAA 4BY9C 4FL9A 1CJUB 1IKWA 3DRPB 2QA4S 5HQLA 3MR3A 1HL6A 1UW4A 1S1XA 1EETB 1NGCA 3UKUB 1MWQA 5AQQA 1JLFB 1OO0B 2VBXA 2DNHA 3JTPA 3DXKA 5SWMA 1U1MA 5JVHQ 4ILMA 2N4DA 4Y6IA 4QYRA 2YKPA 2HFSA 2GGPA 5G0RA 4CLYA 4HHTA 2DNPA 1E3MA 2XMKA 3PR4A 4ER8A 1XK8A 4DSIA 1RQ0A 4ZCIA 2EFGA 2V2ZA 4MDAA 4ZPWR 4R5PB 1CULB 1RT3B 3RW7A 4JI5F 1GX6A 3LDQA 1TL3A 2C3UA 3WUHA 4ALZA 2C2RA 4DUZK 3FSXA 2W8LA 2A42A 5EN1A 4AM6A 2QSFA 2CPDA 2ZHBA 1HKAA 4QAGA 1N5YA 4OHWA 3JYTB 2OHDA 4C23A 3KG4A 5AQRA 5LL6d 1BGXT 1MW7A 4YOWA 2UVRA 2HHXA 3SQOP 4DR6J 1W2BR 4FF1A 3QICA 3MN9A 1VQ7N 2BA9A 1ZBSA 2O5DA 3L9ZA 2CQ2A 1HNZK 4ZJOA 1IKXB 4RUHA 1RP5A 2NRHA 1UCNA 1HWKA 4WTYA 3DYAA 4FF4A 4AXJA 1QQOA 1SQFA 2H5JB 4ZPVR 2Q97A 2WVEA 2H1YA 1C0TA 3FBCA 2AF6A 4E8UA 2ZJRQ 2YHXA 1PBUA 4YR3A 5AE3A 3M6UA 1OSDA 2KL8A 4DPTA 4NA1A 4N76A 3EGWB 4ZK7M 1RTJA 1S9EA 1ZTTA 2IOCA 4U7UK 4CE9A 5FIIA 5M1QA 4CTAA 3CCSN 2KXHA 5E3QA 4X65J 2FJWA 2R8JA 3TW0A 4LSNA 1KS2A 4BCAA 1BQMB 3M8QB 2VONA 4JKAA 1D5AA 5TKWA 2ZH1A 1KOHA 2HHTA 3GTYX 5HQMA 3JSYA 3P8BB 3AO3A 2UUAF 4DU7A 4OLPA 4DB3A 3AAPA 2HHSA 1WI6A 1K1QA 1RBLA 5E5NA 2QWNA 1DHMA 3NWRA 4J9QA 2POKA 4WP3A 3KMSA 3G6YA 4E1NA 3ILOA 1T3NA 4YB5A 3LGMA 2DEJA 2Z30B 3UD3P 1CZAN 3NBPB 5LMNF 1ZM2A 4QCLA 1JJ2M 2OTLS 2IM1A 2HGMA 3MPDA 4F3QA 4CH0S 1SL0A 5KGXA 2DNLA 1YBUA 3I96A 4ES1A 3ENOA 4YR2A 2BACA 3IXQA 1JIHA 3OXLA 4TLQA 5CABA 3ZSXA 1U1NA 4C3MA 3M6VA 2YQ0A 3CJ5A 1G1XA 2WB1D 4V19J 4JI7F 3V9SA 1S1UB 1TMJA 2H48B 3TR5A 3S3NA 3K5PA 4NCAA 1YIJN 5T14A 5DM6Q 3TSQA 5IC6B 4IR1A 3AQPA 2HURA 4B3MJ 1S72N 5K8MA 3IS9B 2OFGX 2HBMA 1FXDA 1LEOA 5F8GA 1QAYA 4FXVA 2RS2A 1FKOB 2EK1A 3DM2A 1EZZB 2N82B 5TKYA 2XNQA 2LEPA 5K20B 4FYXB 2WONA 4JD2A 2E1RA 4ID5A 3HDSA 4OZJA 3QZ8A 4YHHK 3NVMA 3GCWP 3R8EA 1JLEA 2MHEA 3SCJE 3SJHA 3U27A 3C15B 3SCIE 2E66A 3V81B 2W2OP 3UDVA 3P5BP 4DR3J 4DV1K 5J2PA 2WVFA 1R89A 1D4XA 4AYBD 1E4GT 2RAQA 3ZX0A 3UPFA 3M1FA 2HHPA 1D9AA 3I56N 2WK4A 4ILRA 4F9OA 3RTVA 2PAVA 3ULDA 3ULHA 2FVRA 3R27A 3KWGA 1I5OB 2VG7B 4DZDA 3MTJA 3VENA 2LYVA 1HYSA 2OJ3A 3TA0A 1ZC6A 4LT6A 2FY1A 1HLUA 1N5VA 5DDRC 3RSEA 3LAKA 1X4EA 3QEWA 5D4LA 1U25A 2V4JA 1HI8A 3G82A 3CQYA 3LP3A 5GIOA 3OD2A 1XNQF 2CUYA 1JWWA 4OYMA 3HLUA 4LRAA 3V2UC 2IVNA 2OUGA 4FJ9A 3HPOA 3ET6A 3C8YA 3A5MC 2JC1A 1HMVA 1VSJA 2DGUA 3ZETA 1LOTB 4BC9A 1ROFA 3HHKA 2V51B 3L2VA 1FHTA 2GQQA 3K59A 1OY6A 3PJWA 2ALZA 2DGXA 2JL9A 2IAJB 2JC0A 5C25A 3AODA 3ITHB 1J5EJ 1T3OA 2HBLA 3C65A 3TEGA 3QJJA 1H73A 4XH5A 2VPYB 5LMUF 3VOVA 3H08A 4DFKA 1VQ6N 2RDIA 4CH7A 3D28A 2P8IA 2GMHA 4K4SA 3PTWA 1FKPB 4ZPTR 4B9MA 4LREA 1VSMA 2Y0BB 3KJVA 1WJ9A 3P31A 4RUCA 3AVBA 2DO4A 2MQLA 1WN7A 2EWSA 3E1YA 1K8AO 3HP6A 1B9FA 3SCKE 1RACB 1GXUA 1XNRF 4DR6F 1M90T 4H0XB 4CEOA 3P4IA 4C8YA 4LSLB 4J2BA 4ZHRB 2OEJA 3QO9B 3ATVA 2XSFA 2XGPA 5DQGA 2DH7A 3RUBL 4M41A 2O4GA 1EQ0A 4X2BA 1NK9A 1FJGJ 4OZ5A 3SQGB 1N32F 4IKFA 3LWMA 5E2QA 1V3ZA 3PCOB 4OYBA 1ZBFA 1FCAA 4R8UB 3LALA 1DQAA 4J91A 4EK2A 4ZVQB 4LF2A 2AYBA 1MN7A 2KO1A 4FVCA 3PIOQ 1Q8BA 2XQCA 1Z25A 3M6XA 2J6TA 1TL1B 2DR8A 3HSGA 1YHQN 1NU4A 5JXSA 3JTNA 1BI4A 4CEFA 3OTBA 4WXOA 2HFVA 4JI8F 2DXDA 5FPDA 2CDQA 3TA2A 3J7ZO 2KYXA 5IFMA 3OY9A 2OPRB 4KH4A 3J80Y 2HZVA 1WEXA 1Z2LA 5HN0A 1HWUA 3BSOA 4KBIA 2C2OB 2QI2A 3WEEB 3ADAC 1YVFA 3Q89A 4C11A 3KOAA 5KFBA 1NJIO 1KQFB 3LANA 2B9EA 3A5LC 5H9EK 1IKYA 2CRLA 1WG1A 1OQ6A 4PABA 3LDLA 1GAOA 2DY9A 4CH1A 3GFXA 5J2QB 1KR4A 3GE9A 3DHWC 3B4DA 1FJEB 1P1TA 4RW6A 1DRZA 2O66A 2N7CA 5DK5A 3E01B 4RJVA 1HBMA 4JHDB 2J0WA 2HFUA 3G2XA 4CK2A 2FLOA 5EWGA 4KHPJ 4KKOB 5E33A 4GKKK 1FO1A 4USKA 2CGKA 2HB5A 2LFVA 1IWAA 3DOKA 1BMQB 2LEBA 2IYGA 2HHHJ 2BMBA 2P5GA 1OQ3A 1N48A 3LL3A 3V6DA 3SUNA 4JLHA 4LIWA 2K1RB 2M8HA 5KFTA 3PYFA 3OFGA 3UO0A 2ZGZA 4PWWA 1Z6RA 1MMNA 1KQKA 4CZGA 4W5RA 4B3TJ 1HNVB 4PXBA 4B3SF 5KPRA 3CDUA 2M8DB 4LBIA 5ETLA 1IBMK 1H72C 4P73A 2A40A 4CT9A 1FRIA 3R9PA 2CWXA 2NR0A 2XY8A 3D2EA 2VG5B 1RBAA 2ZE2A 3QGPA 2IJFA 3NFAA 4B9VA 4DV7F 1D9FA 3TSPA 4A59A 1YRTA 3K5LA 2JVOA 5HANA 2MYFA 4LFBK 1IJJA 3KVGA 2E5HA 1ATRA 4HYKA 3OHRA 4CGJA 1W7WA 5JLFA 4V19S 4NLRA 4OZ0A 2V7ZA 4BE1A 3WIVA 1M1KT 5DZ7A 3O3HA 4GV9A 3LM9A 2RU3A 1TL7A 2GUIA 2ZBIA 3NH1A 4A4JA 3KD5E 1X5OA 3L2WA 3FFKB 2GO8A 4FPRA 3NWGA 4DUZJ 3V9UA 4GO7X 4O8UA 5AQOA 2WRMA 4B3OB 1NLKL 1K44A 4LF7K 3ZZYA 3KK2B 3MM9A 3UDCA 1HNXF 3TJAA 5HRRA 4KHRA 2FJAB 3THXB 3PX0A 3C0BA 3HP9A 4BE0A 3KWIA 3ILIA 3M8RA 2UP1A 5BJRA 1GTHA 2GVZA 2FVQA 3LGNA 1HNZJ 4G1QB 4YB6A 4DPXA 4X64K 1MMDA 2RIJA 2UUBF 4CZEA 1UVJA 1KAYA 1UOCA 2PA8D 3MWPA 2JEJA 1D09B 3SBMA 2XBPA 2ZOFA 3GE1A 2QT7A 2W6KA 1NKEA 2DGWA 4H5VA 4JK9A 1WUUA 4R79A 5FROA 5D78A 2HF4A 2F4VK 4B9QA 2F40A 3E8OA 2YBVA 2P9EA 3U8XA 1PSDA 1HPZB 2Z4PA 3TZZA 4DV3F 2ITMA 3MOZA 4UW2A 1TV6A 3WNGA 5FRNA 3C95A 1R0CB 4N41A 1IKWB 1WSHA 3GR0A 2ZBRA 3C66A 4H5RA 3V9ZA 3BM7A 2QYCA 5KFUA 4BR5A 4E7KA 1VQ4S 2OTJS 3TX8A 7AT1B 2GGPB 4DV4K 4DSLA 2E2QA 1TKTB 2ZHOA 3R3TA 4LR8A 3F73A 3DLLQ 1YZ6A 2MY8A 1FF2A 1JXEA 3N4WA 3VTIA 5MAOA 3WXIA 2P9GA 3Q8SB 3R1XA 5JVHL 2NZ4A 2V94A 4C97A 3B54A 1S6OA 1TL3B 2G1DA 1VQ8S 1LWCB 2PBDA 1QSYA 3P38A 2MB0B 1S9GA 2YNGA 1T03A 1NJXA 2ZM6F 1W9HA 4IRCA 5EWEA 2R4FA 3VAKA 4WFAL 3K2YA 3LP0A 1HQUB 3OYJA 1NSAA 5KG0A 5A8RA 1HKBA 4GRSA 3H20A 1NWKA 2FJDB 1RAAB 4UF4A 5KFYA 2A2DA 1WC3A 3VF0B 4BLGA 1GXLA 2AYGA 4OX9K 4YEAA 1JLGB 2GJIA 3A8EA 4GVEA 4J9SA 3UNYA 4CQ1A 4F26A 3M8YA 1GOBA 3IUCA 1RTJB 3JAMU 1S9EB 4YOXA 4XK8C 1LWXA 1OYDA 2E7XA 3GOIA 2YWKA 2RRAA 4CTAB 1UFWA 3GSIA 3OT9A 5F0WA 4YHHJ 2FZGB 1I39A 4TN2A 3VAGA 1NM2A 1Y00A 4CERA 3L2UA 4KGKA 2BGGA 1YWXA 2NRWA 2W4CA 1RE1B 5E3AA 4PXCA 3VEYA 5BREA 4DV1J 2HNYA 1J6ZA 3GFHA 4PWDA 3IA0A 1SH3A 2DNKA 2J0XA 5K8NA 3KNAA 3ENHA 3GONA 3G4SN 4EU0A 1KAZA 4ZVOB 5FD1A 3MAQA 2ASJA 3P1GA 1SQEA 3G71S 2DTJA 1F1BB 2BKPA 4DR4F 3PFEA 3AXKA 4OJ1A 4KH0B 3FVYA 4X4PA 4KIAA 2RHSB 2IRYA 3GYGA 1NXIA 4KH6A 3ALYA 4TU7A 1KVIA 1GEHA 4OHYA 3RR7A 3FCWA 4PZVA 1K0TA 4FF2A 2YNHB 3KUHA 1J54A 2RSQA 2UUCF 4DV0F 3R5CA 3N4QA 2V2QA 5BN9A 2NSCA 3LUYA 4QPTA 4CM0A 1TKXB 4KSEB 3W61A 2YTCA 3EWGA 1FJ7A 4LQ9A 2W42A 2XYGB 1NNEA 4JI3F 5KT4A 4NOHA 3F56A 1EQYA 4M5LA 4IDKA 2Q0UA 3TTFA 3TVZA 3CD6N 2P9SA 3L6QA 5AQIA 4M3ZA 4BVPA 2CQCA 2C2DA 4A8FA 5M1NA 3BB5A 3RYLA 1HBOA 3DM2B 3HZEA 1WC1A 3M3ZA 1A7GE 5EVZA 1UEVA 1AZSA 3IBFB 2JFDA 4ID5B 3M05A 4GKJF 5GAEP 1RAHB 2I0XA 3EXCX 1JLEB 1OH8A 1PC4A 3J7YP 3HM9A 1VQ5N 1RADB 3DLJA 3SCXA 4EWTA 3WXLA 3W3DA 5J2PB 5J2MA 3SSRA 5LT5A 3ZTPA 4HCBA 1BD6A 3U3GA 4ZLNA 2B4JA 2GQ2A 1O51A 2Q6CA 3NGUA 2VPZB 3HYFA 2I2YA 5CYJA 4JV0A 2A6OA 2HWHA 1S0OA 3CMQA 1GLBG 2DB1A 4NYZA 4WF9Q 3FKBA 3TVKA 3N6NA 1NJYA 2VJUA 1FNXH 3KLIA 1YRUA 3NLCA 3Q2SC 2R7WA 1S99A 2V4JB 4L72B 2E9ZA 3FGUA 3VVUA 2FB0A 3EKSA 3CFOA 1T44A 4DTXA 5A8WB 2F9WA 5AQNA 1VRQC 3ET6B 3ZTRA 4BRPA 1UEKA 3E66A 3H6EA 4DXLA 1NEEA 2BOPA 4GC7A 2IVYA 3ZETB 2P9LA 4M5NA 1SXLA 4F3MA 3K9JA 3PHTA 2YH0A 3VGMA 3AVNA 4I2PA 3QT7A 5AXNA 1FX4A 2W9CA 3KKFA 3J7YI 2VUGA 2XGQA 2FBVA 1UJ6A 2ZC4A 4M3UA 5C25B 3D1OA 1DURA 1X9MA 4WZQA 3GDQA 2X74A 5H9EJ 3EGVA 3MECA 3EVWA 3AA4A 3MAHA 6FDRA 2NZTA 5AQUA 3BF3A 4CI6A 2L41A 1WOSA 3I8BA 2M2BA 2KHCA 3BQ0A 3BR8A 5KFGA 3KJVB 3D6RA 1BQNA 4IWVA 4Q0BA 2ZBPA 1HLWA 4Y3CA 5ITHA 4CLLA 2UXBK 4OYXA 3F41A 3FR0A 2C2MB 4BDZA 4QR1A 1VHIA 2VL1A 1QZ6A 1OH6A 2DHHA 4FJ5A 2F1FA 4ECQA 5AQKA 5JVGQ 4DHVA 3MM7A 4B3RF 2DXEA 1GTEA 4P10A 5LY3A 1BWVA 4X84A 4ID8A 3EZOA 3UNGC 5K14A 2RDDA 1YI2N 4LF4F 3A3NB 2M88A 1FFWB 4W5OA 2O8CA 1U49A 1RCXB 4CK3A 1X4AA 2QL9B 4EP4A 1TTHB 4QR2A 2QA2A 3TZYA 3W65A 5SZTA 3I87A 1YJ9S 2PEBA 1RBVA 4J7CA 1X4HA 1RHUB 1YVNA 1VQPS 3DOLA 2RUGA 4A61A 1KTQA 1RWUA 1IBMJ 5KFKA 2QX0A 3G10A 4CGGA 1WSVA 4WCEQ 2SXLA 2MY7A 4LIRA 4CVNE 1CZ9A 1XMOK 4K4XA 1PBAA 2KJVA 1SQGA 3PIOL 2J9DA 1HW8A 1QVGM 1HX1A 3QSYB 4RTFD 3M2UA 1C0UA 4Z94A 4DQIA 1UAWA 2VH7A 2FQQB 3CC4N 2MLXA 5IT0A 5IXUA 1GLLO 5M1PA 2FGOA 5HI7A 4LFBJ 4MYUA 1IKYB 2W2PP 1H2UX 1BE4A 1R3NA 5D0EA 3I5BA 2VPWB 3KJNB 4CO2A 4G1PA 1NAQA 2A2CA 4Z7YA 3LQVA 3X1LB 4HACA 3NMUA 1AROP 4RW6B 2Y8WA 3MPUB 4Z7CA 5B0FA 2F8HA 5IWAF 2M7SA 3I0RA 3QQCD 1XBWA 1S76D 2E4LA 4LF7J 4CO1A 5B08A 4E98A 3D68A 2LQBA 1SIWB 5E41A 1WHWA 3DOKB 5KFWA 4CZIA 1FJCA 1NKBA 4XDCA 2XC9A 4X64J 1IWGA 2GC8A 2YHBA 2G8UA 1QD1A 4JV5F 8ATCB 4RNFA 4OKEA 3JQKA 5JJBA 1VQMN 3WNFA 2OPSB 4Z2XA 3IAS9 2MZRA 2F4VJ 1WKLA 5F0UA 4UOHA 4HHUA 1WEZA 1ZPVA 3VN5A 4P2MA 4QS7A 3MPVA 3D2EB 4FLYA 3HSTB 3HHLD 2D4WA 4PQAA 2KZMA 4MTPA 5GADP 3CIPA 4LQ3A 2ZE2B 3CCLS 2B9WA 3AD7C 1CQNA 4CD3A 2B7BB 1DTQB 1X60A 4ZVTB 4DWIA 4YDUA 3QT5A 2XLJA 2XHBA 2GNKA 3VAHA 2FF6A 2CQ4A 5I42A 3Q8PB 2P6TA 5CD4H 2VFVA 2DGSA 2R7RA 4ISGA 1N8RT 4DV4J 1FDDA 3NHGA 4RNNA 3SK3A 3SYZA 1JXLA 3QFHA 3CM5A 4O44A 2AWZA 3AVJA 3OYMA 2CPZA 2R7SA 2QMUB 1OMSA 2VIHA 4EYHB 3T3FA 1C4AA 2XO7A 1IBLK 4USVA 1UW9A 1UWBB 3KLGB 2WOMA 4CJEA 1DAXA 2X6NA 3MM9B 2MKCA 2FHKA 4PKDB 4MIWA 1QY7A 3ETOA 2F65A 2GVZB 2R2RA 1U1PA 1GLEG 3EE9A 5A6WA 3HK2A 4CEAA 4W92B 4H0TB 5J1PA 4ED3A 3HBTA 2YV0X 4LFCK 3QIPB 3NY0A 4RNOA 3OUYA 1FA0A 1WNSA 3GG4A 4ISEA 4OPKA 2GWJA 5DQHA 1FTCA 3ZSOA 3PEJA 1S79A 3KK3A 4QQBA 2JEGA 3CJ2A 3T6BA 4AT1B 3VQ5A 2GIRA 2PA3A 3KIOA 4MIBA 3ETMA 1B0PA 4MO5A 2ZWOA 3DRSA 1HFEL 1UA1A 4JV2A 5HO4A 2BEFA 1TV6B 4GKKF 1GH8A 3GP9A 1YRXA 3OTOK 2J9DE 3D6MB 2QRRA 3TAMB 3CC2S 2V9WA 1MG7A 3VESA 3RW6A 4J9UE 3T9ZA 8RUCA 4KYZA 3KD1E 4WPAA 3D4JA 4ZMMA 4BRCA 3ASMA 3KLFB 3VR1A 5BXIA 2E88A 3S01A 2XMUA 3K9KA 2MEWA 1T8EA 4FW2A 1U6BA 1CJKB 4KJIA 4F2RA 2D9PA 1K73T 3QFUA 4CZLA 3K5NA 4HLBA 5CYQA 2OFHX 3VVTA 4BROA 3OYAA 1MWYA 4MFBA 1RJJA 3LO3A 4U7BA 2Q0RA 3UI3A 3ZZOA 1WOPA 3OVSA 1S9GB 2DK2A 2YNGB 3DLLL 2GX8A 2BV3A 1MMLA 3CWJA 3CMAN 4FVMA 1YJTA 2L9NA 4WJBA 1OS5A 3Q8YA 4C1NI 2I7PA 3LTOA 3H90A 4K0KF 4X66F 4PKIA 2XLIA 2H51B 3I9ZA 2VCPA 1I94K 2IJNA 2NCKL 4CF9A 1N33F 5IV4A 3GJQB 5J2NA 1U26A 1KLMA 3CJTA 1VQ7S 4OJRA 4YB7A 3THTA 4IZ9A 1RTIA 3M32B 1QAJA 3ZTSA 4ILLA 4XEIA 2KG0A 1KC8T 2AIRB 4A8YA 3WQUA 1N36K 4D3HA 4X4TA 1GLCG 4PA1A 4KQZA 3I0SA 3O08A 4JI4K 3ZT0A 3VA3A 2B0GA 4G1IA 1HD0A 3CCQN 4ZP6A 2OEKA 3QATA 2H54B 3OYKA 2YKNA 3FSIA 4WP9A 3M8PA 2CZ4A 3GJTB 4DFJA 4BHQA 3CCTA 4LSZB 5ETVA 2CPEA 4ZLLA 5ETKA 3H1VX 2XULA 3NCRA 2ZFHA 4PWDB 3HM8A 3MM5A 1T05A 1KFSA 4B9SA 3AFGA 2KKZA 2MLYA 4Y34A 4CEEA 5C42A 4GV3A 5B0CA 1N34K 3O9QA 5JLHA 2UXCK 3MI7X 2HBZB 4TYBA 2VHGA 3V5RA 3PW5A 3AVHA 2RT3A 1VJQA 3TEHB 1S6QB 2ERRA 2W40A 4WQ4A 1XHXA 4I9LA 3EDQB 3FUYA 2GHPA 4RW9A 3IRXA 1U2RA 3VEXA 1X9JA 4UTGA 4DLEA 1U09A 2ZITA 3QNNA 4DV2K 2RE2A 2VJVA 2DNOA 4Z4CA 1AA1B 5CCMA 3THWA 2O3DA 3SCLE 5HROA 2ETJA 4NXMK 4LF8K 2C22A 4HCCA 3DJCA 1XC9A 4K4VA 2JVRA 2WW8A 1BWFO 3O1LA 1QLNA 3N9UC 1WDDA 4H5TA 3DLBA 2AYEA 1XQSC 2WTUA 4LVOP 4I6MA 1RCOB 2FC8A 1H38A 4K8ZA 3GLJA 4KAIA 4CP5A 4CHPA 4H4KA 1G15A 2P9SB 1GT8A 3MR7A 3H0PA 2XNRA 1VRTA 2PI5A 2CJYB 3G0ZA 1RT6B 4OX6A 1S0VA 1Y9OA 2VQFK 3OSPA 2BABA 2YXLA 3VQTA 5B8HA 3TU5A 4N77A 5DETA 2V5HG 2XRIA 1QE1A 3TJ9A 5KG5A 4NLPA 4ZCLA 5GAGU 2UXBJ 3MOJB 5FPEA 2PMHA 4P7TA 2XY5A 2DYAA 4E3SA 2W2NP 2O01C 5HL7L 3VWSA 2LECA 1NSPA 1VQLN 3RWUA 2GELA 1K9MO 4FOEA 4OQJA 3CF5L 4HDHA 4C3LA 1F5CA 1RWXB 4EZ6A 1RAJA 3RB6A 4CIOA 4CLSA 4ECUA 4OX9F 1R27B 4FM2A 2MKHA 4CEBA 3TANA 3LP1A 2G13A 3OYNA 3POTA 1BUPA 1KLNA 3E51A 3IO1A 4ANDA 1U1LA 1TR0A 2UVWA 2HG4A 3W2WB 1E4FT 1XMOJ 1I6JA 2F9DA 3O4NA 4KGVB 5F8IA 2E6LA 1VC6A 5KI6A 4WE1B 2KI2A 3D9BA 3UFCX 3V6JA 3CJRA 5E3RA 1RB0A 3SI6A 3RGIA 3AJ1A 4UQTA 4H0YB 4A5AA 4I2PB 4O3PA 4OI4A 3E9PA 2O8EA 2VU5A 2KG1A 1M5OC 2IDLA 4ZIWA 4OX8A 1IV0A 4AXIA 5DGAA 5HK4A 2Q1LA 1FW6A 5B09A 2CQGA 3I5AA 3PSFA 2GEMA 2KH9A 1NBWA 3TAEA 1VQ6S 1N52B 2FTRA 4QWDA 1LCUA 4JI6K 1HWJA 4FLVA 2GJ2A 2JLFA 2BKOA 3IWNC 2XY7A 3P83D 4AQYF 4LFAK 4NXNK 3SSSA 2C1EB 2P1JA 3TRGA 1TU0B 5A2QU 2GIQA 1DFDA 1WKKA 4KH1B 4MT1A 4CGFA 5T7LA 1F2GA 2KXFA 4CF0A 3DLEA 3O6WA 2VDHA 5K14B 5BR8F 2YNFB 4DUYK 3TUPA 3ISND 2DNMA 1VFJA 1C1CA 1WNEA 2YKQA 2Z1HA 3D0GE 4N56A 4FXWA 3O4QA 2J6UA 2IC3A 5JVGL 4C6AA 3CCES 4MK7A 2LKZA 4DPUA 1GX5A 4CK1A 4DCPB 2IVFB 4YDUC 3R7BB 4CZJA 2RRBA 2KT2A 3UKRA 5C7PA 1B7YB 3VAMA 3Q7CA 1KHWA 4JP8A 2QEXN 1GMWA 3HFVA 5L1JA 3DGPB 3RBEA 3NF8A 1Y11A 4J8FA 5EUHA 1UA0A 5IC4B 3R6GB 1ILYA 3O8MA 4A8XA 4CIFA 4B1ZA 5I3UA 4WQ5A 1X4FA 2QFJA 2EX3A 3MWTA 3IR6B 4OYPA 3CPEA 3I4PA 4DL7A 2WTFA 3M2UB 1C0UB 1RDCA 1GQEA 4EFAC 5KTQA 2Y8YA 4WCEL 4F0KA 1PJ5A 2YKAA 2XG8A 4QIVA 1N8RO 2FLNA 3U9ZA 4CO4A 2BQRA 2Y1IA 3GJRB 4WKYA 3N01A 1EAYC 1RBOB 3VCDA 2V50A 1NGBA 4FN5A 4DMNA 2E1PA 3OJSA 3W8GA 2DH9A 3UVJA 4NYNA 1KVJA 4AFFA 4RBTA 1MWZA 4FNHA 3FZLA 2GMJA 2CPFA 4JI2K 3Q86A 1IBLJ 1B92A 4B1UB 2DIVA 1X9WA 2OPQA 2XHWA 3IBWA 3CCRS 2F63A 3LGHA 5IQQA 1FRMA 4WFNL 4B08A 2RE1A 3N6LA 1RKIA 4KRWA 3MMJA 2XO6A 5KT5A 3KHHA 1SAZA 4LFCJ 3KTQA 1WSEA 3EKUA 1XN9A 4ZPBA 2KJWA 3VHQA 3CETA 4LF9K 4NLCA 2L3MA 1X4BA 1TFYA 2P51A 3RMDA 5D3GA 3I4HX 1CLQA 3A8JA 2EBGA 3BBFA 4CHQA 4LF6F 4M3XA 1N54B 3H2UB 3R7NB 5I3PA 3KK7A 1FK9B 2LDIA 3T41A 1BQXA 4UOFA 2DR5A 2P9NB 3RAMA 1IR0A 2J76E 1E6VA 1WC4A 2KM8B 3NKYA 4Z37A 5KFZA 5D0RA 2D69A 1F21A 3OTOJ 1JMTA 2Y0SD 4AD6A 2P9KA 4H4MA 2DPNA 4Y1DA 2EI5A 3D2FA 3HKWA 2YCHA 2AEMA 1SBRA 5I42B 3M2RA 3MFIA 3D54A 4LH5A 2MGZA 1FFSB 1TVRB 1RT2B 1RHKB 5M1FA 1RCHA 3ZT2A 5MLCV 2XLKA 3QT8A 4JI1F 2FC9A 1NGJA 3ID8A 4DV6K 3ONQA 2Y1LB 1S97A 4O3NA 5C12A 3QJLA 4C1NK 4DQRA 2VYPA 3MM8A 3FZBA 5KFFA 3ZZPA 4A8MP 5KT3A 1RHJB 3FNNA 4JI0F 3DRPA 1LXNA 3EZWA 1BXNA 1S1TB 1JLBA 1EETA 1NKCA 1L5UA 3UKUA 1U6ZA 1I94J 1YJVA 2JLGA 2NREA 1GOAA 4LBHA 4BR9A 3ZT1A 2CAJA 2QLXA 1LNQA 2IBKA 4DSKA 4TXSA 3KK3B 2JFKA 4BRHA 4U95A 5AQHA 1RT4A 4DQ8A 3JQMA 2RQMA 1N36J 2ZZNA 4PUOB 2VC1A 2FHJD 1RT3A 4X62F 3EDRB 1W2BM 4MAKA 4JI4J 2NRTA 2QLWA 4LF1A 3T1YK 3DRSB 3B4MA 2G1HA 2CPIA 1HARA 3BKTA 5BPNA 1N0VC 3BO3A 2UXDK 2BBEA 3MD3A 3WC2A 3I82A 2DGOA 4DL3A 2J9EA 4U96A 5CHCB 2G2OA 4DTJA 3VQ6A 1AXQA 4WQ4C 3Q23A 2V8GA 2VQEK 4H0PA 2JHEA 2JNJA 4HI2A 1IKXA 3I32A 4HTJA 4ZVFA 3KYLA 2DR6A 1HNWF 2N3OA 5HVHA 3L09A 2XMWA 1OH7A 4JV1A 3HPGA 2HVZA 1MNEA 4BWJA 5GAGI 4KO0B 1IBKF 4ZLJA 2GHVC 1N34J 3HVTB 4ZN1A 2UXCJ 5CYQB 3RAXA 1NPPA 1WOQA 4MFBB 3W7BA 2OIHA 1S10A 3K5MA 4H4OA 3FCVA 2ZF5O 1A5VA 4H4KC 3BBBA 3S6EA 3IAM9 4DSFA 2VPXB 4P75A 3RAQA 1BLUA 1HUXA 4DV2J 3G6XA 1VSDA 2QWOA 1JCFA 3M8QA 3H98A 2NQPA 1WI8A 5L9NA 4J9VA 2R7YA 3RB4A 5KOWA 4LF8J 2ZKUA 4J37A 4KGMA 4J9RA 4EGLA 1XR6A 2V68A 3MUTP 2QXLA 2KHDA 5M2PA 2IM0A 4O3QA 2IA0A 4FKXA 4UUXA 4ED1A 1RTIB 4F04B 1T7PA 4CJFA 3WX8A 5A8KA 4HTLA 3VAJA 2QMWA 2V8HA 4PKGA 2I38A 3CCVN 2K7KA 4GMKA 2W4DA 2M52A 4HEA9 3I0SB 3NBPA 2ZEJA 1PYOB 2PFUA 1HKCA 3CCJN 2VQFJ 4PKHA 3CDEA 1IKVB 3LAMA 4X4SA 2G8WA 2H4YB 4W5NA 2GV9A 2X3GA 2YKNB 4JKHA 2QWMA 5KFEA 3VF6A 2WB4A 3TO8A 4DFMA 3JSMA 3SDEA 3HSCA 3BZCA 4DTMA 3DFEA 1S57A 1HI0P 2DNNA 1RISA 5I9EB 1Q18A 3Q24A 3W64A 1OJ4A 1PILA 3MM5B 1DEJA 1S1UA 2DCLA 2A1SA 2MJUA 5HJXA 5SUHA 4Z0UA 2N7YA 5F2RA 3H5YA 3IN5A 1LKZA 2IA6A 2DRBA 4HUEA 3MZIA 3DRRA 2O8DA 2ZVSA 2H5EA 5F41A 4BRAA 3SUOA 5AZIB 2CA9A 1LOUA 1N6QB 3NXZA 3QRQA 1WSRA 3O3GA 1YBTA 1Q9XA 1HNIB 2VG6A 1FKOA 2RHKA 1VBKA 4ILHA 4RW9B 3IRXB 2FXUA 4B9TA 3NL0A 3GV7B 1VQNN 3S3OA 1NCLA 4FYYB 1LAVA 1B70B 2FD2A 3CTRA 2MZJA 4Q45A 3PYEA 3THWB 4DR7K 3D7EO 4KC5A 2DFEA 4WK1A 4RX6A 4JYAF 4Q2MA 1DBDA 3CGIA 3CE8A 4RU2A 5JUMA 4DUTA 3OLBA 2BDPA 4I6MB 2CWKA 2OMOA 4GVBB 1VRTB 1IR2A 4I64A 3TZWA 1RWPB 2VG7A 1J2VA 3MDFA 1TK5A 4DR1J 4F36A 2AGPA 4BC3A 5HMXA 4XPEA 2ZDOA 3GIIA 3A5NC 4CEZA 3S3MA 4ES3A 4BRDA 4JI6J 4USJC 1FESA 4KHYA 2P9IA 5LJ3Y 2YVSA 2R42A 4RW4A 4DV5J 5AXKA 4LFAJ 5IT9U 3OYGA 4NXNJ 2U1AA 3ZSRA 2CNKB 3O5TB 2IRUA 3CSKA 4C48A 4JNEA 4BGAA 4GNIA 1IXKA 5HLFB 3OL7A 3K57A 3T69A 3B6BA 1RDBA 3CXCR 4WZMA 5FDLB 5I4MA 1I51B 4C0BA 3CI5A 3GIKA 3QBWA 4WQ5C 4DUYJ 2IAJA 1HD1A