2YNFA

Hiv-1 reverse transcriptase y188l mutant in complex with inhibitor gsk560
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
560
structure length
557
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 158
structure length 557
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2ynfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ynfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2ynfA05
1QAIA 4J9RA 3I0SB 4G3IA 3L3UA 3CWJA 1QS4A 3SQ1A 3OYAA 3ASMA 1ASVA 4J2DA 2JEGA 1JXLA 4O3QA 1ASUA 1RCHA 3RRHA 4MK8A 3TAEA 3TAMA 5CYQA 4ED2A 4JRQA 5JS2A 4CEBA 4OL8A 4CJRA 4AHUA 1UA0A 2XGQA 3DLGB 4MKBA 4K4WA 3OS1A 4DS5A 5KFKA 4ECWA 3VQCA 3NDKA 3V6HA 2W9CA 2W42A 2FVRA 4N5SA 4TXSA 2QV6A 1Z26A 3ISND 2FVQA 2IJFA 1BQNA 4WZMA 4RW6A 4NLGA 4KHNA 1EP4A 1VSEA 3ZT4A 3HPHA 3HM9A 3RMBA 4HCBA 4CJKA 3DLBA 4DQIA 1RBVA 4FS1A 1S5JA 3KLFB 5KRTA 3RBDA 3EYZA 2R7YA 2E9TA 3AO1A 4Y1DA 3KLVA 2WONB 5L1KA 3ZSOA 1TL3A 2YNGB 4RNMA 5KGWA 4Z4CA 3DLEA 3M8QB 4NYNA 2HHTA 1EP4B 3DLGA 2XGPA 4W5NA 4O0IA 3CDEA 1LWCB 3KK2A 4M3ZA 1XI1A 2ILZA 3CO9A 1MU2A 1DTQA 1RT4B 5KFEA 2YKMA 1A5VA 1RDRA 4CGIA 1SV5A 4OPJA 3M9OB 4U7CA 4FJIA 5F8MA 3WNGA 4DL5A 3KLEB 4M42A 2KZMA 1DTTB 4KFBA 4H54A 2R8JA 2LSNA 5KT7A 2B43A 2J6TA 4ZP8A 4J2BA 3IG1B 4K4SA 4ICLB 1NHUA 3G0ZA 1QHTA 5DG9A 2XO7A 4FLTA 4K4UA 1WSHA 4FJ8A 4OJRA 3MTKA 4ECYA 1C0TA 4CJWA 1LWEB 1T94A 2R2TA 4HCCA 3LP0B 1N4LA 3PJWA 4WZQA 3TAGA 4FM0A 4RW9A 2XCAA 2VG7A 2W9BA 4R8UA 3S9HA 3UQSA 4CHZA 4LSLB 4IG3A 3IGNA 3QZ8A 4Q45A 1D1UA 3RB4A 3RMAA 3OLBA 1I39A 3SQ2A 3NF8A 1C0UB 1CLQA 5D3GA 3IN5A 4KB1A 5J2QB 1LW0A 4DQPA 1X1PA 1NK5A 3PW7A 4LSLA 4IG0A 1C0MA 3K5LA 2JEJA 2ATQA 4KPYA 1QSYA 4RW9B 1EX4A 3U3YA 4O44A 2HNYB 4KV8B 5HBMB 3RB6A 1ASWA 4NLVA 1KCFA 4DG1B 1N56A 4IDKB 3ZSZA 2XCPA 5DGBA 4K4VA 1LV5A 3BSAA 4DL3A 2Y1IA 4YMEA 3PHEA 3OYEA 4WXWA 4DTXA 4EEYA 2QKBA 3I0RB 3V6DA 2OPPB 4HTUA 4OPKA 1JLFB 3PW4A 1CZ9A 1NJXA 3PX0A 4KFBB 3PO5A 4FLWA 3DLHA 3KK1A 3GV5B 3KMQA 4EP5A 4CJUA 1MU2B 3THVA 4E89A 4CF2A 1JLGA 2DFEA 1O1WA 1TV6A 3L2VA 2I5JB 5KG6A 3QGIA 5KRSA 4M94A 3H4DA 3UR0A 1QSSA 1S1VB 2ILYA 4TN2A 1LW0B 4EYIB 1HQUB 1WSEA 1Z4UA 1NOZA 1FKOA 2HAIA 5CYMB 3H40A 3LZJA 4IH6A 3P83D 3K57A 1S6QA 4RNHA 4CHOA 5CY4A 2DPIA 3KK3B 2HNDB 3NGDA 4ZTFA 4OKKA 3LDSA 3OL7A 4HUFA 4CJTA 4FZYA 4J9MA 3KIOA 2W9CB 5DLFA 1NK6A 5J2NA 5CYMA 3MR2A 4PUOA 5FRNA 3LAMA 4RNNA 3I0SA 3F73A 3V4IB 2RKIB 3DDKA 4RUCA 4AHSA 4F50A 1BHLA 3LP1A 3NBPA 5KFBA 2OH2A 1BISA 5EWFA 1S0MA 4RW6B 3S3MA 3OYHA 1IKWB 4E7JA 5I42A 3DMJB 3V4IA 3G6VA 2X78A 4LQ9A 4ID1A 3AA4A 3LALA 3MEDB 1TVRA 1HMVB 3M9MB 1KVCA 3CJ4A 3AO3A 3NF7A 2D3UA 3E51A 4JS5A 3BDPA 5F8JA 1NJZA 4J9LA 1UWBA 2ALZA 4B9UA 4K4YA 3NH1A 3BREA 1JXEA 3IAYA 3DOLA 5DGAA 4KTWA 1HRHA 1C1BB 4QWEA 3MEEB 4O55A 4CF0A 4NLTA 1RTIB 4F3OA 1REVA 4TQRA 4AHTA 3K5NA 4YFUA 1TKXA 2AQ4A 2P1JA 1ZTTA 4MH8A 1D0EA 4I2QB 1EETA 3V6JA 3DYAB 1WSJA 2XY7A 2Z1HA 4CJEA 3LP2A 1VSMA 4IFYB 2HHVA 3DRPA 4NCGB 4M3UA 1WAJA 4E0DA 4NLYA 4URGA 2J6UA 5KFRA 3G6XA 1RBSA 3AA3A 3ZT3A 1C1AA 3KLHA 1IM4A 3T19A 3HKWA 1HNVB 3ITHA 3SPYA 1RAJA 4IRKA 1VSLA 3OJSA 3O4QA 2XC9A 4Z4IA 2FBTA 3LWLA 1KLMA 3TANA 3KD1E 3L3VA 4QWDA 1TKXB 5KFMA 3CM5A 5FDLA 1I3AA 1T3NA 4IR1A 4E7KA 1TL3B 1HYVA 3PX6A 1BIZA 5KFZA 3AVBA 3O4NA 1TL1A 3MAQA 4ZHRA 3D45A 4O3SA 2E9ZA 2DY4A 5KFVA 5J2NB 1A5XA 1SL0A 5F8GA 4ED6A 1RTDB 2KQ2A 1FK9B 3HPGA 4NLRA 3VQBA 4CHNA 1TAUA 2C2EA 1RTHA 4B8CA 5DK5A 2FBXA 1VK0A 4FJ5A 1Q9XA 1KTQA 3G10A 4KRFA 1VSIA 3DOKA 3LZIA 4CEQA 4W5OA 3QIPB 2V4RA 4CF8A 4IFVA 1SL1A 4NRUA 3OS2A 4AHRA 5KG3A 5KG4A 2G8IA 3KLFA 5HRPA 4J9SA 4F2SA 1RA6A 3FSIA 3CJ2A 1RDBA 3DOLB 4DU4A 5KFXA 5KFPA 4NCBA 4OLAA 4IG0B 2PYLA 1S48A 1XHXA 5DQIA 2WB4A 4CEEA 1OS5A 4Y2AA 5KFJA 4HHTA 1JL1A 3QEVA 1ZBLA 3CJ0A 1RBUA 2HVIA 5KFNA 4TLRA 3DLRA 3GILA 4FZZA 4I7FA 2AX0A 4RW7A 5JUMA 3NKYA 4HYKA 2IJNA 3QIDA 4ZP7A 3AVAA 3ZSVA 4FJGA 4ED8A 1TKTA 2VG5B 3OYCA 5KFUA 4ECXA 4CEAA 4CEFA 4Z0UA 2OYQA 3GIIA 2VG6A 1HYSB 1ZBHA 4RUAA 3DM2A 2FLPA 3KNAA 4E19A 4ELTA 4CGFA 3KHRA 3CFOA 3NH0A 4RG8A 1RBRA 4NYFA 3SV4A 3P1GA 3OL9A 2ZE2B 3TVKA 2W7OA 1W9HA 1SH0A 3RAQA 3MXIA 1S0OA 4DMNA 1HQEA 2XI2A 4YR3A 2IS3A 4RW8B 4TY8A 3DRRB 4C8LA 4NLOA 2G8FA 1NK8A 3T5KA 2DFFA 3QNOA 3K58A 3SJJA 1KFDA 1RYSA 1QQCA 3BQ2A 3QNNA 3OYIA 1IO2A 3KJVB 1KHVA 4WFXA 1TKDA 2FJWA 2X74A 2IC3B 4BWJA 4DEZA 3T1AA 1GOBA 1L5UA 1JKHB 3SQ4A 2W8KA 1D5AA 4ELUA 3QEWA 4FJMA 3OYJA 5L1IA 3AVIA 5K14B 3I5CA 2KTQA 1RT5A 4LSNA 3T3FA 1L3TA 3O3HA 2A1RA 2BE2B 4NCAA 2ASJA 3HVTB 2FVCA 2IM2A 3HXMA 3BQ1A 3ULDA 4IBNA 3GIJA 1RILA 3ZT1A 5KG7A 4F4KA 3V9ZA 4J9OA 2IM3A 1JLQB 3Q8RB 4CJ5A 3IGVA 3MEEA 1Z25A 1C0TB 3SQ0A 3FRZA 3HPOA 2CJQA 2XY6A 2VA2A 2HMIA 1VSJA 4F4WA 5KT6A 2IC3A 1XR6A 2YNIB 3U6FA 3QYYA 1TKZB 2WK4A 3NAEA 3RBEA 1MMLA 4ID5A 4GC7A 4DSIA 1JLBB 1T05B 4LSNB 4OKEA 4DTSA 1JXBA 3FFIB 4PQUA 4JV1A 1BIUA 4FLUA 2G8HA 2HWHA 4BE2A 4B3OA 3HP9A 4WFYA 3PW2A 1LWFB 3DYAA 1TV6B 2ITGA 1QE1A 2VG7B 5I3UB 1WSGA 3FDSA 3NFAA 3C6UA 2GC8A 2YKNA 2IAJA 2OPRA 3DRRA 2O4GA 2AJQA 3MFIA 2ETJA 1RT6B 4JLHA 1FKOB 2OPPA 4DSEA 3VQ8A 4J9PA 4DTRA 3TAPA 1VSKA 2XY8A 1VRTB 3BGRA 2XRIA 3PUFA 2BQ3A 5KFOA 4RW8A 4TY8B 4NLPA 2WTFA 3S3OA 1FXXA 4CFDA 4FJ7A 1TVRB 1N5YA 2HHXA 4I9QA 3AA5X 1RT3A 5C25A 2E6MA 4YNQA 1QTMA 4FW1A 2W9AA 1JLGB 4RNOA 2HNDA 3PR4A 2PZSA 3NAIA 1FKPB 4IG3B 4F4XA 4NLSA 5J2PB 4JS4A 3NGZA 1S1WA 4RW4B 2YKNB 2FJXA 1RTDA 2G8VA 5KT4A 3ZSWA 3RWUA 1NJWA 3N6MA 4CIFA 2HNZB 3KHHA 4BDPA 3B6PA 4M3XA 3NF9A 5J2MB 3V9SA 1NJYA 2IA6A 4XO0A 5KT2A 4ZPCA 1XWLA 4M95A 5J2PA 5KFHA 1A5WA 3V1RA 4DL7A 4DF8A 4FJJA 3DMJA 3OYLA 1KHWA 4EP4A 5HRSA 1XR5A 2F8TA 4M3TA 5KFTA 4AHCA 3TR8A 1SUQB 4Q0BA 4IRDA 3AV9A 3LPTA 4BE0A 4KB0A 4FJHA 3PR5B 1VSFA 4ECSA 3TARA 4FJKA 4MIAA 4CJ4A 3SYZA 1IKXA 3M8SA 1JIHA 1S0NA 3RR7A 5HP1B 3AO5A 3MEGB 2F8EX 4FM2A 4EZ6A 5KT5A 5I3UA 3QO9B 3CJ5A 4URSA 4KHWA 4QWBA 4DTPA 5HRNA 4TSXA 5DG7A 3KKSA 1LW2B 3K5OA 4ED7A 1RTHB 1BQMA 4ECZA 3VQ5A 3QEIA 1HQEB 3FQLA 1C1BA 2VG6B 4Q43A 3MR3A 5J2MA 1BQNB 4F4ZA 5KFSA 1RT2A 4H4OB 3K2PA 1ZBUA 4CIEA 2D0BA 1NK7A 3GIMA 4F2RA 2VG5A 4Z4HA 2R8KA 3OYBA 4BE1A 3DOKB 3KLIA 4KHSA 1EETB 3DLEB 2FLNA 3U3GA 3VQPA 2E9RX 2AGOA 5L9XA 1JKHA 3MECA 5EWGA 4CJQA 2BDPA 2AGQA 3IS9B 3VQEA 5I42B 4NYZA 3SZ2A 3ZSQA 3KLIB 3OYMA 4CFBA 4FS2A 1U04A 3AVJA 1S1TA 1G15A 4PY5A 1BL3A 2B4JA 4CESA 3M8PB 3UIQA 3OYDA 1C2PA 4CIGA 4CK1A 4BACA 1NKCA 4DFJA 4FBTA 3M9NB 3L2UA 1S1XA 4KB7A 5F8LA 2AX1A 4OVLA 2FVPA 3KJVA 4H4MA 2HHWA 3GV8B 1IKYA 4LD0A 2YNIA 3H4BA 1T03A 1K1SA 3KHLA 4B9MA 3SV3A 3BSOA 2R8GA 4DSKA 4O5BA 3AO2A 4OGCA 4WFZA 1RT6A 4IKAA 3CYMA 2DPJA 4PA1A 5FDLB 4JRPA 4DTNA 2G8KA 3N6LA 1N5YB 4DTJA 4CK3A 2ZKUA 2JEIA 4E7IA 3V1QA 1S1VA 1RTIA 4FK2A 4W5QA 1S6PA 1BI4A 1T03B 2BANA 2A1SA 5KTQA 4FCYA 3M8RA 4PWDA 5J1EA 4IQXA 1HPZA 4Z4GA 3VQ7A 1RYRA 5C25B 4N47A 4DF4A 4C8MA 4FVMA 1N48A 4M45A 4CGHA 1XR7A 3CIZA 2BR0A 4IH5A 4FXDA 5SWMA 3EPGA 3DRPB 4NCGA 1KFSA 2XWYA 2RPIA 3QERA 1S1UA 1N6QA 4I9LA 3AVMA 4FK0A 4KI6A 5KT3A 1SH2A 3HVAA 2O5DA 1NK4A 4MKAA 3N6NA 4KREA 4FJNA 4Y2CA 4BDZA 2P5OA 1UA1A 1L3SA 2BGGA 1RT1B 2JC0A 3KK1B 1J53A 3T5JA 4FLXA 1BCMA 4DS4A 3SUNA 2HHQA 2FBYA 4MK9A 4Z4FA 2FBVA 5HRRA 2C22A 4KBIA 2ZQBA 4CE9A 1TK8A 2BANB 5EWEA 3IS9A 5D3GB 2D41A 3RTVA 1B92A 4CHQA 4J9KA 4DL4A 3AVNA 4IFVB 2GUIA 4CF9A 1ZBIA 1LWCA 3KK2B 1HNIB 3VQSA 5KG2A 5KFAA 3G86A 3NGIA 4RNFA 5CYQB 3NF6A 2IOCA 5HP1A 2RDJA 4DL6A 3T5LA 4HUEA 5J2QA 4FW2A 2B5JA 3MFHA 5JXSA 5KFIA 4IRCA 4R5PA 2P5GA 4KO0B 1NHVA 3P5JA 1CXUA 1LW2A 3KMSA 2VWJA 1IKWA 4KHUA 1YTUA 3WNHA 1RTJB 4Q8EA 1QSLA 1K6YA 1K1QA 3VQ4A 4FM1A 3AVLA 4B08A 4R5PB 2X6SA 3OSPA 1S6PB 1BI4B 1ZYQA 4DU1A 4CCHA 5KI6A 1BGXT 2IAJB 2OPRB 1LWEA 4KHMA 2V0NA 1TQLA 3JSMB 2WRMA 4CEZA 3HVRA 2Q3SA 4EZ9A 4OGEA 3IRXB 5KFDA 4EO6A 4AH9A 4CECA 3AA2A 4I7FB 4O4GA 3BGRB 4GW6A 3MECB 2E4LA 1C0UA 2AWZA 4O0JA 3ICLA 4KE5A 4WE1B 1NNDA 2GIRA 4FK4A 3RR8A 3LP2B 1IG9A 4CJFA 3TAFA 3VA3A 1WNSA 2IMWP 1XHZA 2OA8A 4ZVHA 3JSMA 1JLEB 3DLKA 3PY8A 4KKOB 1LWFA 4DTUA 3ITHB 1L3VA 1FKPA 1JLQA 4FBUA 4CFCA 1SV5B 4KAIA 2EC0A 3H08A 3OL6A 5F8IA 3TABA 2R8IA 4J9QA 4E3SA 4RW4A 3V9XA 2QE5A 4ZP9A 4E7LA 1RT5B 3HJFA 3DI6B 4TQSA 3V6KA 1IKVB 3M8PA 4B9VA 3TQ1A 4NZ0A 2O4IA 2D0AA 2VWKA 3OL8A 4Z4EA 4L8RB 4Q0BB 1Q8IA 1R0AB 4Y34A 3V81A 4CGDA 3QGGA 4KO0A 3O3FA 3DRSB 5T7BA 4MFBA 3Q8SB 4FJXA 4O3OA 3KLGB 3GIKA 4ID5B 5FRMA 1T8EA 4DQRA 1LAVA 4B9TA 3KK3A 3LAKA 1BCOA 4CJLA 3PJXA 3A2FA 3OJUA 1GOAA 4DFPA 1RT1A 2C28A 4F3TA 3V9UA 2WOMB 1IH7A 5C42B 2HW3A 4PUOB 3V81B 4CF1A 2Z1GA 3FFIA 4PQUB 3BQ0A 3HVWA 5DQGA 1HYZA 4K50A 2Z1IA 2FVSA 1D9DA 2GBZA 4ZVFA 3RB0A 4TY9A 5K14A 4YP3A 3MXJA 4M3WA 5C42A 3H5UA 3ALYA 3PV8A 2D7SA 3L2RA 4Q44A 2G8UA 1U47A 2XI3A 4O3NA 5HROA 1HMVA 3KKRA 3SI8A 3KHGA 1VRUA 3C6UB 1WSIA 2OPSA 5DG8A 4BWMA 3L2QA 3OHAA 1VSDA 3VQAA 3CM6A 3NE6A 4GVMA 1YVFA 4ECUA 3QINA 2P51A 4DSFA 1D9FA 5HROB 2YV0X 4UQGA 3AVGA 1NK9A 2WCXA 2R2SA 3E01A 4URQU 1QAJA 3UDLA 1EKEA 1RBTA 1CXQA 3HK2A 1B9DA 4HVJA 4QOZB 1TK0A 4ECVA 4YQWA 1J9AA 2JGUA 4F8RA 3OYKA 2KW4A 3M8QA 3I5BA 3CFRA 4HKQA 2JEFA 4G1QB 1GX5A 4CEDA 2IM0A 4R0EA 1VRUB 4F4YA 3PW5A 4DQQA 1ZBFA 2PYJA 3NGYA 4ECRA 5F9NA 3ZCMA 3SUPA 3ISNC 1S9EA 3MEDA 3FQKA 3D0PA 2F96A 3PVXA 3IRXA 1RNHA 1KLNA 2I5JA 4JV0A 3SFGA 4K4ZA 4AILC 5KFYA 4C8KA 1ITGA 3CVKA 1CZBA 1SL2A 3HT3A 2D0CA 1U4BA 1WLJA 2D3ZA 5HLFB 1HQUA 5KFQA 4QCLA 3QEXA 1TP7A 3BJYA 2ZD1A 2G8WA 1JLEA 4NLQA 4G1QA 1F21A 3AVCA 1FK9A 4B9LA 4J2AA 3SUOA 4QW8A 1S1XB 4CGJA 3NHGA 4KTZA 4JV2A 1S9EB 3I5AA 1C1CA 2B5JB 2HMIB 3AVFA 2ZD1B 3CG7A 1DLOB 4ZP6A 1J54A 4FLVA 3PZPA 4NLWA 4FJLA 4XPCA 4DSJA 4Q5VA 3KTQA 4ZMMA 2HNYA 4KV8A 2VA3A 4I2PB 3QESA 3CJ3A 4RZRA 2B6AA 3QO9A 2OPQB 2R8HA 4LH4A 1R0AA 2YNFA 3K59A 3RMCA 1S1WB 2Y1JA 1DTTA 3D5MA 4N41A 4O44B 1JLBA 4H8KA 4K8XA 3H98A 1JLFA 1YTAA 5C5JA 5KG5A 3K5MA 4QW9A 3LPUA 2IGIA 3EPIA 4KTQA 5C24B 3O3GA 3MXMA 4XPEA 3ZSXA 1S1UB 1N6QB 2QXFA 4ED1A 4KHQA 4K4XA 3S3NA 1SKWA 4MFBB 4C8NA 1NKBA 2D5RA 1C6VA 4NLUA 1JLCA 2F8SA 4E1NA 4Y3CA 1JL2A 1WAFA 4MQ3A 3ZSRA 3C6TB 5DQHA 3WNFA 4R8UB 3RMDA 2C2RA 4LQ3A 1HNIA 3VQQA 4CJ3A 4FZXC 3GYNA 1RDDA 1NK0A 5CZ1A 3SI6A 1U09A 4OLBA 3NCIA 2KZZA 4TYAA 1W0HA 4CJVA 1TK5A 4RU9A 3DM2B 1S9GB 3OYNA 1S49A 1KVBA 3LANA 4WYLA 3B6OA 3UPFA 5T14A 3H5YA 4H4MB 3L8BA 4N56A 5F8HA 5KGXA 5DLGA 4CHYA 3QLHA 3HL8A 5CZ2A 4WE1A 3OS0A 2FJVA 2CKWA 2WOMA 4E1MA 4J9NA 4XIUA 3G6YA 4ED3A 2W7PA 3VQ6A 5KFFA 3V6DB 1T05A 3TAMB 2EHGA 1S4FA 1ZETA 4RW7B 1GX6A 3LP1B 3NBPB 4EBDA 1RT7A 5F8NA 1WSFA 1KRPA 2WONA 3AO4A 5DMRA 5EDWA 1L3UA 3T5HA 1HPZB 3CQ8A 4DWIA 2HHUA 2UVWA 3QIOA 1NOYA 1D8YA 3MF5A 4IOBA 4B9SA 1UOCA 2IM1A 4MK7A 1S9FA 2PY5A 2HVHA 3KLEA 3JYTB 4NRTA 4C8OA 3Q8PB 2ASLA 4KAZA 1IKVA 4O3PA 3PX4A 4ZPAA 1TKZA 4DL2A 2V4QA 1RT4A 3RB3A 1JX4A 3NL0A 3I0RA 4DLGA 2OPSB 1S6QB 2DFHA 3ZT2A 2DTUA 3EY1A 3QEPA 1TGOA 1UAXA 4Q8FA 1HJRA 1BQMB 2RN2A 3DRSA 1RT3B 5KG1A 4QPXA 3VQ9A 4B3OB 4W5TA 3CDWA 3E01B 4DTOA 1U49A 3CDUA 1RT7B 2R2RA 2WHOA 1GOCA 4YR0A 3RRGA 2UVVA 2FLLA 4LY7A 4WYWA 4U6PA 4O3RA 2BE2A 3NMAA 5KFGA 4NLXA 4B8AB 1X9MA 3PO4A 4BDYA 4EBCA 4ED0A 3EZ5A 4JUZA 4EO8A 3LP0A 2BRKA 2KFNA 4CEOA 4EYHB 1IKXB 5L1JA 2J6SA 2AGPA 5KG0A 3OLAA 4CGGA 4ZVGA 3KOAA 3AVHA 2JC1A 2YNFB 1VRTA 3LP3A 5JS1A 1HARA 3C94A 3SNNA 4FLZA 5SZTA 1J5OA 4ZPDA 2YNGA 4KI4A 4IKFA 2RKIA 2BQUA 3OY9A 1HYSA 1RDCA 1JLAA 2E6LA 3HSTB 2JLEA 3F9KA 2UVUA 1S1TB 4GC6A 4IFYA 2Z1JA 4OKJA 4DTMA 2BQRA 4EBEA 4ZVEA 4ECQA 2ZE2A 3V1OA 4M41A 4CERA 2X6NA 4CJPA 3ZT0A 1WN7A 4K8ZA 1VSHA 3H2LA 2HB5A 4YR2A 3HYFA 1DLOA 4E7HA 5HLFA 4FJ9A 1TAQA 1B9FA 3OYFA 4ZPBA 1C1CB 5EU7A 2C2DA 5KFCA 4TYBA 4O4GB 3TAQA 5J1EB 2ATLA 4LH5A 3VN5A 3VQDA 2FC0A 2HNZA 3BSNA 1YVUA 1DTQB 3WNEA 1WNEA 4M3RA 1QE1B 4X2BA 4DFMA 3HVTA 2ASDA 2BRLA 4B9NA 1S9GA 4CFAA 2R2UA 5L1LA 5FROA 4AHVA 4KKOA 3EZUA 5KFLA 1SH3A 4MIBA 3TI0A 4ICLA 1LAWA 2OPQA 1IKYB 1U45A 2YHAA 3PW0A 3KD5E 4DU3A 4GMJB 4DQSA 1SKSA 3MEGA 4N76A 3OYGA 2YKMB 1JLCB 1S10A 1SKRA 1X9WA 3DI6A 1S97A 1RDAA 4KHRA 4WXOA 3QZ7A 2HWIA 1NKEA 1KSPA 3SCXA 2OZSA 5E41A 3C6TA 1YT3A 1U48A 4KHYA 4ECTA 4O4RA 3HO1A 1JLAB 4IDKA 2RDIA 4ELVA 1HNVA 3H5SA 4IR9A 1I6JA 4W5RA 3HHKA 4Y1CA 2YNHA 3SUQA 3DLKB 3NH2A 4QWCA 3OHBA 3SFUA 1T7PA 1XC9A 3IG1A 2B6AB 3BR9A 1SUQA 1EXQA 3GV7B 3SPZA 3AVKA 3OVNA 3TWHA 1X9SA 2QKKA 4QWAA 4ZHRB 2V9WA 4CK2A 2UVRA 4M3YA 2W8LA 2XHBA 3QLHB 3H59A 2UUWA 4DFKA 4FYDA 1TKTB 3RAXA 4PWDB 3QIPA 4CJSA 3V9WA 4CHPA 5F9LA 2W9BB 1RTJA 4FLYA 5C24A 4NLDA 3ZSYA 5KFWA 4HUGA 1QUVA 2NUBA 3LWMA 1TL1B 2GIQA 1REVB 1ZTWA 3KLHB 3QGHA 1Q9YA 3JYTA 3MR6A 3C95A 5HBMA 2GV9A 4I2QA 3H5XA 2EX3A 1KLMB 1CSJA 3MR5A 2I1RA 2HHSA 2RF2A 1RT2B 4H4OA 3OSNA 2YHBA 2IBKA 3I8DA 2OZMA 2KFZA 2YNHB 4I2PA 5EUHA 3KLGA 4IH7A 4DLEA 3QETA 3CFPA 2QK9A 3L2WA 4DG1A 3VA0A 2AU0A 4QAGA 4ZTJA 3NAHA 3GQCA 1Y97A 2RF2B 1RA7A 3Q8QB 1J5OB 4KSEB 1UWBB 4DSLA 2XY5A 3BSCA 3HP6A 2IDOA 1W25A 4K4TA 3D28A 4J2EA 2UUTA 1KVAA
chains in the Genus database with same CATH superfamily
3IWXA 4FYYB 2GMLA 1YZ7A 3I0SB 1W2BM 4G3IA 3D1HA 2DXDA 1WKLA 3SQ1A 2EK1A 3L4IA 1JXLA 1RCHA 5DRKA 2A3JA 4MK8A 2HQGA 3FEXB 3X1LB 4H0PA 4JKDA 1FRLA 5LSRA 1YZ6A 3CC4S 1UA0A 2O8DB 4AD6A 2VC1A 3ZZOA 3PACA 3V6HA 1EQYA 3F2KA 1F9FA 1NPPA 3B4MA 3PFOA 4N5SA 2CJAA 1UVLA 1T9WA 2QV6A 2B4OA 1VHIA 1P90A 4WZMA 2AEFA 1EP4A 4FVCA 1VSEA 3ZT4A 3JQJA 2VONA 4DQIA 4LF9F 1S5JA 2GHPA 2MKCA 2RS8A 3KLFB 3RBDA 2FHJA 2E9TA 1AW0A 2AMCB 3UCUP 4Y1DA 1HBNA 1KR4A 4RWXA 2XS5A 1RXOB 4X4RA 3DLEA 5GAGI 3K17A 3KG1A 3DLGA 1FDAA 4ZPWR 2ZJRQ 2KRBA 4H03B 1XI1A 2ZM6K 3MHYA 3DLJA 3A5OC 4HDHA 2HFZA 3M9OB 4CLUA 1VQSA 3D7SB 5K8NA 5HVFA 4NMLA 4M42A 1GTEA 3H2VE 2KZMA 3CCES 2HSTA 3O08A 5KT7A 2B43A 1UMJA 1HR0J 4K4SA 1H6KX 3CCLS 3GJSB 1FRIA 2M2BA 1FE0A 5DG9A 4LFBF 4K4UA 4L3QA 4OJRA 1BDGA 3KJQB 4ECYA 4FNHA 4CZGA 1WC6A 4DR6J 2R2TA 4JI3F 3LP0B 3ZEUA 3TUZC 2RS2A 4FM0A 2APOA 3HSJA 4KQZA 3D6TB 1IG8A 3VETA 3O80A 1PAUB 5E3AA 1CJVB 3W9IA 2GHVC 2FD2A 3IGNA 3QZ8A 3NF8A 8ATCB 4YY3F 2QWMA 5D3GA 4KB1A 5J2QB 1HBUB 3CCSS 4CYUB 2BJEA 1LW0A 4DQPA 4KBOA 4LSLA 3DKDA 3K5LA 2JEJA 2KM8B 4KPYA 1ZA2B 4O44A 4KV8B 4DV0F 2KXFA 3FZKA 4IDKB 5ETLA 1R0BG 4K4VA 3DOMA 3BSAA 3W5XA 2DR9A 1SQFA 1EO1A 1KVJA 4WXWA 2QKBA 2WBNA 3M32A 3CJCA 4LIRA 2UXDF 2RU3A 2GV1A 2LEAA 2V34A 4PL7A 1LEOA 2A18A 3DLHA 3OBYA 1M1GA 3KMQA 2M7SA 3THVA 2VKRA 2OMLA 3QMQA 3CPWR 4HACA 3QGIA 2YHXA 4OJGA 1WOPA 1GXLA 1S1VB 1PJ7A 5EN1A 2ILYA 3FRYA 4UZCA 1Z4UA 1FKOA 2XLIA 1OKJA 4I56A 3H40A 1FDDA 4IH6A 2HEKA 3K57A 2HRYA 4RNHA 2I9SA 2HNDB 3NGDA 5BR8J 4MAKA 3AOBA 4HUFA 4CJTA 2GX9A 3KIOA 1NSPA 1NK6A 3LL3A 4OHVA 3CEDA 4PUOA 5FRNA 2G2OA 2DGUA 2RKIB 2B7CB 3DDKA 3HSZA 4AHSA 1YJRA 4DV6F 3LP1A 3NBPA 1RQ0A 2OH2A 2LU2A 4QS8A 1MNEA 3JSYA 1R6YA 3S3MA 4A5BA 1IKWB 3OVSA 4E7JA 3R2CJ 4LF7J 2ROEA 3QSIA 4PKDB 2N82B 4CYUA 1P9YA 4BC2A 4NXMJ 4BRFA 3DRXA 1KVCA 1RU2A 1IM6A 3Q0AA 1C4CA 3E51A 3K8VA 3BDPA 3R1HA 2IIHA 1NJZA 2E5LK 2K7KA 2WW4A 4ZN1A 4OFZA 2QGFB 1JXEA 3R97A 4YOWA 3HULA 5DGAA 3RZAA 3CJSA 5LOQA 3THPA 4CF0A 2EWHA 1RTIB 1REVA 3FVYA 1XMOK 4JD2A 3MPVA 4AT1B 4DPYA 4U7UK 4AQYF 2AEMA 4OX7A 3V6JA 1WSJA 2P9NA 1VAZA 4EFHA 4CJEA 2HHVA 3S01A 1SJFA 1OQ3A 1YJTA 3VEWA 3DRPA 1XBWA 2A41A 2XSFA 2CH6A 1X0FA 4URGA 3M30A 2GELA 3HM8A 3IDHA 1HNZF 4JKGA 3ZT3A 1IM4A 2E1PA 3ITHA 4O23A 2OHDA 4NE9C 4DDFA 3OJSA 5AJ3J 4Y2KA 3O4QA 2XC9A 1BA0A 1HNWF 2VQEK 1DAXA 2J9EA 4A57A 1NMDA 4F36A 9RUBA 1RISA 1I3AA 3C8YA 1CJKA 1T3NA 4E7KA 2EEYA 3PX6A 5KFZA 2HGLA 3GJTB 1YJNS 2O8CB 1TL1A 3QFHA 1IBKK 3CMQA 1M5SA 4M5IA 1Q78A 1IBLJ 1X5OA 1T95A 2C3OA 2WVFA 5ETSA 1FK9B 2ASOA 3HPGA 1PG5B 2V4JA 2A42A 1RTHA 3IO1A 2EKNA 2R7TA 4OJ1A 1Q9XA 1KTQA 3G10A 3PIPL 1R59O 4HVZA 2HBQB 3THYB 4DV0J 3OS2A 1NSKL 4AHRA 4M63C 2RE2A 1NZ8A 1RWOB 2LKZA 2Z4PA 3KLFA 5HRPA 2QSFA 3BH6B 2JFDA 5AQWA 4E98A 1RA6A 3FSIA 4BRLA 1BC6A 4JI4K 4OLAA 4IG0B 2PYLA 4EUVA 4CEEA 2IYIA 2DNMA 5AQYA 5LMNK 5KFJA 1ZM9A 4ZK7M 1S59A 3FZ2A 2GVDB 1MROB 1F5CA 1S22A 2VFSA 1VQ7S 4I7FA 2YX7A 5JUMA 3NKYA 1XQIA 1TKTA 5KFUA 3N4PA 2UXBK 3AXKA 4DV4J 3GIIA 2CXEA 2ZM6J 3KNAA 4ELTA 4CGFA 3KHRA 2DR8A 4WTYA 4U7UD 3CC2N 4HHUA 1RBRA 3SV4A 1AUSL 5K8PA 2A5XA 4KHPJ 3OL9A 1YJWS 3CC7N 2ZOFA 3TVKA 4OI2A 1D09B 5EXWA 1S0OA 4DMNA 1WEXA 5IZHA 1FHTA 5AQOA 2BABA 3DRRB 3WBZA 1NJIT 4LC9B 3T5KA 3SJJA 3K58A 3HRGA 1HKCA 1QQCA 2GWKA 3NMUA 2J8SA 4BC9A 4PPZA 1KHVA 5CCMA 3OYIA 1HNXF 1FTRA 3ISZA 4IOCL 4TVAB 2IC3B 8RUCA 3T1AA 2MJNA 1MWYA 4CH1A 1GOBA 3IXQA 1L5UA 2MJUA 4KC5A 1P1LA 3B4DA 3OYJA 5K14B 3I5CA 2XSJB 4IFEA 2A1RA 2ASJA 1LK5A 1OIAA 5HMXA 3MUMP 4CLPA 3BQ1A 4IBNA 2R7WA 3D2EB 4P7TA 3O9UA 1SVDA 3Q8RB 1WJ9A 3FRZA 1CULB 2CJQA 2VA2A 2FXUA 2P8IA 1VSJA 3S8SA 1FX4A 5TKYA 1W7WA 1SBRA 3NAEA 3L09A 2PA8D 3RBEA 3SBTA 1MMLA 4DV7F 4CH7A 3SMPA 1JXBA 3FFIB 4PQUA 1SCJB 2ZWPA 1BIUA 4B3OA 2SXLA 1AROP 4A62A 2RHSB 4DV1J 2N3OA 2NQPA 1NCLA 3PYGA 1VQYA 5I3UB 3F5TA 3CDAA 3KKFA 5CR4A 3FDSA 1R8HA 2NSBA 4C0OC 3C6UA 2GC8A 4FDFA 5K8MA 1JXVA 3J7YP 2ETJA 3QBWA 4JLHA 1UVKA 1CVJA 2WC9A 2B0GA 5LXYA 1IJJA 5H9EJ 2FHMA 3K0SA 1BMQB 2XY8A 3TP2A 1XMQF 3C3LA 3L7UA 3UDVA 4ZVTB 1YG0A 3CNQP 4TY8B 2RRAA 4NLPA 1P1TA 1FXXA 1TVRB 2LA6A 2G1DA 3TSQA 2XMMA 2HHXA 4LRAA 3AA5X 2X1FA 5C25A 1RBAA 2QL9B 1OVQA 3O1BA 4YNQA 3DN9A 4QPTA 2EFVA 2EFNA 5BREA 4FW1A 3BBFA 2W9AA 4IEEA 3EDQB 2QN6B 2ZC4A 5BRFA 3R5CA 5F0XA 2V4JB 4WBFA 2F65A 2H5IB 1S1WA 4RW4B 3HLUA 5KT4A 5ETNA 3CD6S 2HNZB 5AQFA 3KHHA 3B6PA 3OR2B 3V9SA 1CULA 2MHEA 1XWLA 4ZPCA 2QWLA 2DB1A 2LQJA 5A6PA 5DO2A 5RUBA 4IO1A 1ZAXA 3JTOA 1NEEA 3QT8A 4OHWA 2NXCA 3OYLA 4EHTA 3M2RB 5D0GA 1XR5A 3UFCX 4DR7J 5JMNA 3W62A 3LPTA 2DGXA 4W92B 4FJHA 4ECSA 5M1PA 3MURP 4A8WA 1IKXA 1JIHA 2CPJA 3MMJA 5LJ3Y 3P49B 1H38A 5I3UA 3QO9B 1MW7A 4URSA 4KHWA 3BEXA 1ZZNA 4PL8A 4TSXA 2CQ1A 1U24A 1U1KA 3KKSA 4C48A 2H4WB 3AAPA 1NZAA 1H3DA 1VJQA 4GKKF 5J2MA 3SQGA 4F4ZA 1N34F 5KFSA 4H4OB 4ZKAA 4BR7A 2D0BA 4LR7A 3TA0A 4RWWA 2R8KA 3OTOF 2QYGA 3T1YK 4KHSA 4DCPB 2Q1LA 2ZM6F 3EGZA 3CD6N 1JMTA 1JKHA 3MECA 2UUCK 3IS9B 2ABYA 2IVPA 1NM1A 2LVWA 2K1RB 2XMJA 3AVJA 3M8PB 3VAJA 2UUAJ 3A1YG 2NCKL 4CIGA 4BC7A 4BACA 1NKCA 4FBTA 4C7QA 4A8YA 2G0JA 1TL4A 4DV7J 4LF1A 4KB7A 1U6ZA 3KJVA 4H4MA 1VMBA 1R7IA 2ZZNA 5THWA 2YNIA 3H4BA 1T03A 1K1SA 2A40A 3BSOA 1HBMA 1WB9A 1HFEL 4JKCA 4F26A 4FYXB 4WFZA 4BG9A 3J7A1 4BG8A 2MKIA 4JRPA 2FYXA 4FYWB 1IVZA 1PYTA 2F3JA 4ZJOA 2JEIA 1S1VA 2BANA 5FD1A 1TL7B 1FJGF 4JI6F 1FCAA 3P5BP 3VENA 2FUG9 3MD1A 2W4DA 5C25B 1EJ7L 3HSDA 2VICA 4C8MA 3I33A 3CXCR 3KDNA 3J7YI 1XR7A 1HLWA 3BF4A 5B08A 2XWYA 3MOZA 1OY8A 3QERA 1S1UA 1N6QA 2C42A 4FK0A 4KI6A 4B3SF 3O9SA 4ZLPA 2O5DA 1NK4A 2RDDA 3NWRA 4QIFA 3DU5A 5GAHU 4DOZA 1H2UX 2MQ8A 3O8WA 1LK7A 4UY85 3EN9A 2D0OA 1J53A 4PPDA 3UKRB 2HHQA 4C4WA 2FBYA 2H9ZA 1SAZA 2FBVA 4QR1A 5HRRA 2ZQBA 3Q8VA 3WQUA 2BANB 3OFEA 3I6PA 5D3GB 2N7CA 4CHQA 2WSCC 1ACMB 4OJ3A 3FSXA 2M5YA 3VQSA 2EWSA 1HKAA 2OFGX 4ZPVR 1X7VA 5HP1A 2RDJA 4DL6A 4HUEA 1R43A 3PKMA 4IRCA 4CZEA 4RWTA 1JNZB 2MKKA 3FKBA 3P5JA 5BRHA 1FJEB 1LW2A 5L46A 1KOHA 2R7SA 1WORA 3WNHA 3A5MC 3CCQS 1TYQA 2NXJA 3T1YJ 4M5DA 5KI6A 4ANDA 1TQLA 3NCRA 3AODA 1BWEA 3JSMB 2WRMA 2WB1D 5HJYA 1LOUA 4BVPA 4OYXA 4M5LA 5AQSA 4USKA 1RACB 4EZ9A 3ZX3A 3D1OA 5TKWA 2GHWA 4OYWA 4AH9A 2XYHB 5F2RA 4QJVA 1Q1KA 2D9OA 3BGRB 2HAFA 3MECB 2E4LA 4RLEA 3R9LA 3LDOA 4OO1J 2AWZA 2ZVSA 3U9DA 4HT7A 4FK4A 4QS7A 1XJWB 2LECA 4LFCF 1SIWB 2HRTA 2EFGA 3TAFA 1IG9A 3VA3A 2JWKA 4ILLA 2L48A 1WNSA 3WQPA 4PKGA 3R3TA 5AXMA 1SZ2A 3DLKA 3PY8A 3W65A 3C6AA 1LWFA 3NGSA 4DTUA 5A76A 2HG4A 1CPZA 4CFCA 1SV5B 2EC0A 3OL6A 4NXMF 5IT9Y 4DUZJ 4CD3A 3F41A 3H42A 3WDOA 4DV3F 1ROFA 2V94A 3TR5A 4NLCA 4NMXA 2V8DA 5H9FJ 2KJWA 2C3YA 4Z7CA 4B9VA 2HHPA 4CZIA 4NZ0A 2MMYA 5HVHA 2ZZTA 1J2VA 1EZZB 2OELA 1TUVA 3QT6A 1LKZA 2VIHA 1Q8IA 1H7WA 3MMBB 1R0AB 5M1OA 4IJNA 4CGDA 4BGAA 1X4FA 2V63A 3NGUA 4MFBA 4DUYF 3BEGB 1WUUA 1Q82T 1KC8T 3KLGB 2M52A 5JMVA 1QVGM 3N4QA 1T8EA 2ZDOA 4B9TA 2Q3PA 1KONA 2FC8A 5AJ3F 1BCOA 3U1LA 1VQ8S 1CJUB 1TU0B 4JYAK 3A2FA 2H48B 1RT1A 2P9CA 1BG3A 4CO1A 1NWKA 3V9UA 1ATRA 2AJ1A 1ITPA 2DH9A 3V81B 4DX5A 2Z1GA 3I4HX 3BR8A 4LVOP 2DY1A 3DDNA 3EE8A 5M1NA 2HF3A 1MMNA 5IM0A 2PBDA 4ILMA 2GJ2A 4YP3A 4BRIA 2OTJN 8AT1B 2DNGA 3Q2SC 2IY5B 2XO6A 5CCLA 4Q44A 2XI3A 4HHHA 4CJ7A 1T02A 1P27B 3D6HB 1FFWB 2V2ZA 1N36F 4KT0C 3SI8A 1VRUA 4BWMA 1NGCA 4WF9Q 4FNIA 1YRUA 4DPWA 2P51A 1HD0A 4DSFA 5JVGL 3EVOA 1F9HA 4UQGA 3AVGA 4OI1A 1NK9A 2WCXA 2BJDA 2PEHA 4URQU 1B9DA 4ECVA 3OYKA 2KW4A 2B9WA 2EFOA 1RAIB 2IM0A 1DT9A 4JI0K 5F9NA 3LDQA 3FQKA 4DL0C 2CGJA 3UO0A 3IRXA 2VGNA 5AXNA 1TMMA 3ZTSA 5LM7E 3GFYA 2I5JA 1K73T 5ETPA 2WFBA 3J7AP 4K4ZA 4PWWA 4C8KA 2O8FB 1ITGA 4FYVB 1CZBA 2D0CA 1WLJA 5HLFB 1RAOA 1TP7A 2NSCA 3RGIA 2G8WA 1R27B 1JLEA 4EK2A 1R0CB 3P45B 4G1QA 4YOYA 2V5HG 4OIXA 2FZGB 3O6QA 3SUOA 4RUHA 1HI1A 2AJ2A 3NHGA 2IIRA 2B5JB 4CIOA 2HMIB 2W6KA 4FLVA 3W2WB 3R2DJ 1LFWA 3PZPA 1VQ4S 4XPCA 3TUIC 1HUXA 3KTQA 4ZCIA 2HNYA 5K20B 3MN7A 4RZRA 3TTCA 2YNFA 3CB4A 1NSQA 4WYBA 5GAEP 5IC6B 1K9MO 2DKOB 3D3CJ 4YOEA 2XS7A 4JI7K 1KP6A 4KGKA 2A2DA 4DX6A 4K8XA 1YTAA 2VASA 5C5JA 2VC0A 1SS6A 2IGIA 1U2FA 2J0WA 5JVHL 4NO7A 4HL9A 1GAOA 1QAXA 2RIJA 1E6YB 1SJQA 2QXFA 4PRFA 1SKWA 2BYCA 4WFBL 3MD3A 4MFBB 1VGYA 1NKBA 3CCRS 3A3OB 1C6VA 2D5RA 5DS7A 4NLUA 2F8SA 2UXCF 1HKBA 4Y3CA 1G3OA 3GJQB 3ULHA 1WAFA 3C6TB 5DQHA 4R8UB 4LQ3A 4FZXC 1RDDA 3SI6A 4ANCA 2JOQA 1Q81O 3NCIA 3TSPA 2IYGA 3VWSA 2QWNA 4RU9A 2RVJA 2UP1A 3MM8A 1Q8KA 4X66J 1RLDA 3M1VB 1BU6O 2KG0A 4BR5A 3AOAA 2HGMA 3PXGa 1LXJA 2RAQA 3UPFA 2I0XA 3H2UB 2CG4A 4QYZK 5AQTA 4HTLA 3L8BA 2RT3A 4B3MJ 5GMEA 2MGZB 4C1NK 2JNJA 3QLHA 4M5KA 1AXQA 2FJDB 3KJFB 3OXGA 3P31A 1SC1B 3GLJA 2VFRA 4E1MA 2Y0BB 3G6YA 2Q6CA 3VQ6A 1DJ0A 3V6DB 3TAMB 2EHGA 4JI1K 2YY3A 6FD1A 4ILJA 5CA5A 4CZHA 5FPMA 4JI2J 1Z1ZA 1RT7A 5F8NA 3M5RA 4DUYJ 3TWZA 1WSFA 3FC9A 2HQDA 4FWSA 1RKIA 3QT7A 1L3UA 3MI7X 3T5HA 2R42A 1N8RO 1HPZB 3CQ8A 4DWIA 2HHUA 4JV5J 2DVIA 2E88A 1FXRA 3OR2A 2R7VA 4CZLA 4ZCKA 1Y64A 3SCIE 4X64J 3NY0A 1QZ6A 3T9NA 4P75A 3RAMA 3G4SN 2OSRA 3AQOA 4CLLA 5E33A 4CBWA 4DCHA 4LIWA 2HS4A 3CT9A 4PR6A 1IKVA 1VC0A 4DL2A 1JK9B 5A8RB 2V4QA 3RB3A 1XMOJ 3CJKB 2B7BB 3MAHA 4DX7A 2F9JA 3ZT2A 4P72A 3HHLC 3QEPA 2KU7A 1WG1A 1AUDA 4K2XA 1Q79A 4F3MA 2CRLA 1RT3B 3A8KA 5KG1A 4B3OB 4W5TA 3UN2A 3CDUA 1RT7B 1FJGK 2UVVA 3H1VX 2IFXA 2F4FA 4OYOA 4N8NA 4A46A 2BE2A 3NMAA 4IDHA 1X9MA 4C9DA 4C3KA 2BE7D 4ED0A 3LP0A 1K0VA 3EGWB 4LRCA 5KG0A 3OLAA 4CGGA 2XMVA 1FFGB 3GP9A 1ESVA 1W97L 3T7ZA 2QLFB 4NI2A 3LP3A 1SC3B 3CCQN 1U8WA 3SNNA 3VGKA 4YOVA 5SZTA 1J5OA 4ZPDA 2CG8A 1U1RA 3OY9A 4JI0J 1JLAA 3L4QA 3R5AA 2A6OA 4FKYA 2JLEA 5KPTA 2UVUA 2Z1JA 3U7JA 2BQRA 1Z05A 2K3IA 4EBEA 1OH5A 4ECQA 2JH3A 3VAHA 2UV8A 2NNWA 4M41A 4CJPA 5LMUK 1MSWD 1VSHA 4G9ZA 1U25A 1U8SA 5B0EA 5AZJB 1TAQA 2ZH3A 5EU7A 1H2TZ 4O4GB 2QFIA 4LH5A 3BKUA 1CC7A 3NNHA 2DCUB 3VQDA 3F56A 1M0SA 3BSNA 1DTQB 3WIVA 1WNEA 3C7NB 1GT8A 4C11B 3M1VA 2KT3A 1OSDA 4CFAA 2R2UA 2D1CA 5ELZA 4KKOA 1SH3A 4MIBA 3CJRA 3TI0A 4ICLA 1IKYB 1NPKA 4QR0A 3PW0A 5CABA 3KD5E 3GE9A 4DU3A 1BXNA 2V2KA 3MCMA 4FWQA 3CCZA 4LBIA 2OP5A 3OYGA 1WDDA 2KHCA 4FWOA 4DX8H 1YITS 2DH8A 1SJRA 1RDAA 2HWIA 1NKEA 1RAHB 3SCXA 3LPEA 4JYAJ 2OZSA 3CCJS 4U67L 3C6TA 1KBRA 2D4WA 3H3OB 1CG2A 3HO1A 4WKRA 4LFBK 1X4HA 2UXDJ 1NGDA 1I6JA 3HHKA 2ASYA 3ATUA 4QWCA 1MN7A 3SFUA 3IG1A 3AARA 1U1OA 4CZMA 2DRDA 3BR9A 5D77A 3CQXA 2RE1A 3GV7B 3O8MA 3MMCA 3Q23A 1X9SA 1X60A 2V9WA 3TVYA 2UUCF 3VVTA 1G6BA 2UUWA 4PWDB 2Q31A 2VL1A 3J7ZT 4CHPA 2VFVA 1RTJA 3KXDA 4FLYA 2DHSA 2ZHBA 3R6LB 5KFWA 2RUSA 1NBWA 2NUBA 3LWMA 2E66A 4DCJB 2GIQA 5IC4B 5J1NA 2AP1A 2E1RA 2DGTA 1PJ6A 3PEHA 4OYAA 1S7HA 2AEJA 1KLMB 3UW1A 3MR5A 1YVNA 2I1RA 2HHSA 3S1TA 1RT2B 2W24A 3OSNA 2YHBA 2OZMA 2YNHB 1UVMA 2QK9A 3GYGA 1WHWA 2IVOA 4CLTA 3GFXA 3W64A 2O8FA 2CQDA 2EFPA 3NAHA 4U96A 2W4PA 1H7XA 2QA4S 3I87A 3QSYB 4WCEQ 4KSEB 1AT1B 4WFAQ 2DBBA 1FI4A 5BYQA 4OI0A 1W25A 5M2PA 1MLAA 4J2EA 2UUTA 1URNA 1KVAA 2L9DA 2VODA 3WC0A 2I6WA 5DDPC 4J9RA 2O8CA 4BRNA 3MM6A 3L3UA 4M63A 1XERA 3CCMS 3CULA 4ID8A 1ASVA 4ANEA 2JEGA 3IBCB 4O3QA 3RRHA 3TAMA 1TR0A 4P2FA 5JS2A 1E4FT 3QWPA 4OL8A 3ZTPA 3FZMA 3OS1A 2F40A 5KFKA 3V2UC 2PMZD 2D1KA 3VQCA 4GMKA 1T9TA 5HQMA 5CXTA 1VQ5S 1VI7A 2FVRA 2HQCA 1KEKA 4TXSA 3ISND 1NRKA 2IJFA 1BQNA 4C97A 4KHNA 2FPHX 3HPHA 5EX5A 3HM9A 3RMBA 4HCBA 3DLBA 4NEYA 3EKSA 2MQNA 4ZDNA 5KRTA 5B0AA 5L1KA 3ZSOA 1S72N 5A0YB 3CERA 3M8QB 4BRHA 2HHTA 4O0IA 2A1BA 1RT4B 3KHYA 2XB2D 1C0FA 3CJ1A 4JI0F 1RDRA 1SV5A 4YORA 2DR5A 4U7CA 5F8MA 2QA1A 3KLEB 1C4AA 2E5JA 4OI4A 5GMDA 3QJJA 1OYEA 4JI2K 2LSNA 2J6TA 4KH6A 3SQOP 3HSGA 1SQGA 4J9VA 1VQON 2XO7A 1S5ZA 3JB9k 3MTKA 4BLGA 1F9EB 1Y10A 2EBEA 3W9JA 2XWXA 2FY1A 1RWWB 1VLYA 4HCCA 1G1XA 2XZTB 3DGVA 1N4LA 4LFAJ 2YWKA 3IFEA 4RW9A 1VQKN 3K9KA 2FHKA 4CLKA 2W9BA 4USVA 3EM1A 4WCEL 2QTWA 2OAUA 4CHZA 4LSLB 4LF9K 2BJ7A 2FTRA 4G1PA 4B1ZA 3SQ2A 2CQ4A 1N0UA 5A2QO 1JQGA 1EARA 3ETMA 4QOTA 2IVNA 2DIUA 3FBEA 3BYPA 4LF8F 4RBTA 4S0MA 1X1PA 4OZNA 1C0MA 2VWBA 4AXIA 3IBFB 4QU7A 3EDRB 2J0QD 2FF6A 2HNYB 5HBMB 1NH8A 4NXNF 1U6FA 1VHXA 3UDEA 4B3RF 3ZSZA 4ATNA 5DGBA 2E2NA 2NUHA 3ZX0A 1WOOA 4DL3A 4AYBD 3PHEA 4DTXA 3H6EA 3OTEA 4ERDA 1JLFB 1NJXA 4KFBB 3CD5A 4JI3K 3MM7B 2ZH7A 4FLWA 3GV5B 4EP5A 4E89A 2DFEA 5H1SV 3VGMA 2I5JB 4PG5A 1ICEB 5KRSA 3QICA 1RBOB 2GUPA 2VKZG 3RYLA 1Z6RA 2ZH2A 1HNXJ 4TN2A 3B8HA 1UEKA 1B64A 5JLFA 3CMES 2VPWB 4WFNL 3LZJA 3M30B 4OV6A 1SKUB 4DV4F 4KPCA 3NCQA 5CY4A 1AYEA 3KK3B 4ZTFA 4OKKA 4P74A 4CM0A 3N5BA 3CSKA 4HDGA 3LDSA 3OL7A 1EX8A 4J9MA 3AA9A 1O13A 2UXBF 2DITA 4RNNA 3F73A 3V4IB 5H9FK 2BBEA 4RUCA 3L7PA 4F50A 1CJKB 4CM2A 5KFBA 1BISA 5EWFA 5L8RC 1DY3A 1YGYA 4DR7K 4F4AA 1DZ5A 3V4IA 3G6VA 5GINA 1TVRA 5ETKA 3OVAA 3CJ4A 1GXUA 2QI2A 3N5FA 4JS5A 7AT1B 5JVHQ 5F8JA 4NZ7A 4J9LA 4NYOA 1UWBA 1T3VA 1CC8A 4B9UA 1ZA1B 1OMSA 1N5QA 4A5AA 3NH1A 3BREA 1GK8A 3KK7A 3DOLA 4XH1A 3U1MA 1HRHA 1C1BB 2NXNA 1NDCA 2BJ1A 3PM9A 4NWBA 3TEHB 2IDEA 1VQNN 2AQ4A 1Q86O 1XMQK 1ZTTA 1Q5YA 2YHWA 1M5HA 3DYAB 2LXFA 2M4MA 3LP2A 4IO9Q 1F5AA 4NCGB 4USTA 4M3UA 2RILA 4NLYA 3VCDA 4CTAB 4B1VA 3G6XA 1RBSA 3KLHA 3T19A 3A13A 1HNVB 2CPZA 3SPYA 3CCUN 4CNZA 4DR3J 1IWAA 3CMEN 2HPUA 1D4XA 3LWLA 1V9OA 3CM5A 3ZTOA 2D9PA 4BROA 1TL3B 1HYVA 1BIZA 3AVBA 3O4NA 2LMIA 2PFUA 1JCGA 2A6MA 3D0IE 2DY4A 5E84A 5F8GA 4BRAA 5L39A 2C2ZB 1TAUA 1WI6A 2CZVC 4PABA 1VK0A 1RABB 2BOAA 4H4KA 3CJTA 3RUBL 4FWRA 1VS3A 1RWXB 2YCHA 2J8AA 3QIPB 4ZLJA 4Z37A 1U0HA 4NRUA 3O3LA 1FRXA 4JI6J 1KDNA 1K8KB 5T7LB 3SK3A 4AQYJ 1MWMA 4CD1A 3H0PA 2NXUA 4ETZA 4CP5A 3CJ2A 5D0HA 1RDBA 3DOLB 5DETA 3GL1A 2H5EA 5KFPA 4FF2A 1DURA 4I6WA 4NCBA 2NZTA 1DQ8A 1NPRA 4K5SA 5DQIA 4Y2AA 3OHRA 2UU9J 4KGVB 4HHTA 1RZMA 3R8EA 4A8FA 3FR0A 4M5JA 1V6HA 2HFOA 3J80U 1F6TA 2BE9B 4BBYA 2VQEJ 4RW7A 4BREA 2GA7A 2F8HA 4ZP7A 3AVAA 3ZSVA 4UF4A 2VG5B 1LQ9A 4ECXA 4GRSA 4LUBA 4OHZA 4CEFA 4Z0UA 2ZJPL 2OYQA 1Z2ZA 2YKOA 1ZBHA 1YF5L 1RHJB 4E19A 3VQTA 3ET6B 4GV9A 3NH0A 4RG8A 3SIPB 1IBLF 4JKFA 1VC6A 1B4SA 2ZFHA 2ZE2B 3OD2A 2W7OA 1W9HA 3BO3A 3CC7S 4CZJA 3RAQA 1LCUA 1HQEA 2XI2A 3M05A 3KVGA 3KNGA 2IS3A 4RW8B 2N4DA 5HSPA 3QNOA 1RYSA 4C6AA 1DQAA 2FGOA 3QNNA 3D3BJ 4FVUA 1N34J 4DEZA 2MZRA 1FNXH 2DJWA 2HZVA 4N77A 1OY6A 1X4DA 2Q36A 4C98A 2YI1A 1CQNA 1T6DA 3THTA 3QEWA 5L1IA 2KVIA 2KTQA 1RT5A 4YN3B 3G9CA 3T3FA 3UWTA 2ZEJA 4J9UE 4WK3A 3EJMA 2FVCA 2IM2A 2HLUA 3HJVA 5IOLA 3ULEA 1MWZA 5D4PA 1X3NA 1JJ2M 4J9OA 2IM3A 3LQVA 1HI8A 3OTBA 3MEEA 3CW2C 2BJ9A 2U1AA 3DC2A 2XY6A 3MEKA 2IC3A 1XR6A 2YNIB 2CPXA 1NG9A 3U6FA 4CRJA 3WQTA 2IRYA 1OSCA 2DXFA 4GC7A 4OYMA 3UCGA 3ENVA 3A5LC 5I3QA 4OKEA 4WWSA 5GAGP 2XM3A 2G8HA 1KVIA 2HWHA 4WFYA 2QA4N 4MLHA 1N5SA 2HOEA 1X5SA 1TV6B 5HI7A 3I9ZA 1CBKA 1JCFA 3NFAA 2UU9K 3Q8UA 2IAJA 2OPRA 3U9ZA 3ZZZA 3NXZA 2AJQA 4UOCA 1U02A 1FKOB 3MCSA 4J9PA 2ZJRL 1Q86T 1VRTB 3BGRA 3GG0A 2XRIA 3PUFA 4JI6K 3SCKE 5AJ3K 3TTFA 4NOHA 1ZM2A 5HMZA 2WTFA 4DZDA 1N52B 4CFDA 4FJ7A 2QX0A 4OZ2A 4A48A 1U1PA 4I9QA 2DNRA 1WEYA 2YX6A 4X4SA 4I69A 5GVQA 5LY3A 1QTMA 1JLGB 1BUPA 4Y6IA 3TX8A 1HR0F 2HNDA 5C0YA 2ACMA 4LFBJ 2PZSA 3F0NA 3D2WA 1U26A 4NA3A 2B4UA 4IG3B 1QJHA 3IKMA 4BS2A 3DNCA 3VF6A 4JS4A 1PC4A 4DPUA 2FJXA 3EKUA 1MG7A 1RTDA 5CHCB 2DY9A 2NXEA 2ADBA 3KWMA 4RO0A 1PAEX 3HSCA 4TNOA 4BRGA 4BDPA 2EFQA 4M3XA 3NF9A 5J2MB 3SQGB 5CZXA 2OEMA 5IXUA 2BTFA 4M95A 3DAWA 5J2PA 3QBXA 2DRAA 1DRZA 2AKWB 3BKTA 1A5WA 4DF8A 4DL7A 3V1RA 4CTAA 4FJJA 1KHWA 2AYMA 4MJKA 1CS4B 2F8TA 3TA1A 3EXCX 4AHCA 3TR8A 1SUQB 4DXLA 4Q0BA 4ZA1A 4BE0A 5LL6Z 4KB0A 3QDKA 1HR0K 4QBUA 3JS6A 2QLXA 4FJKA 2NPFA 4J90A 4DB3A 2AHOB 3SYZA 3RR7A 5HP1B 3AO5A 3MEGB 5DM7Q 2NRXA 4FM2A 2GVDA 2GWJA 4DR6F 5D4OA 4QWBA 2QXLA 4YB6A 2XLKA 1TTHB 4DR1J 1LW2B 3SLCA 3KJNB 5C12A 2BV3A 2M8HA 4PYAA 3IR7B 4ECZA 2BVZA 3VQ5A 2VBWA 3QEIA 2E7WA 1BQNB 3CCTA 3J80Y 3K2PA 3IP0A 1ZBUA 4XAKA 3GIMA 4F3QA 1K8AT 3JQKA 3OYBA 5BN9A 4F0KA 1PC5A 3DOKB 5HMWA 1UVNA 2E1AA 3UNGC 4NXNK 3U8XA 3AAQA 4H5NA 2E9RX 4CO0A 3ILIA 5GADU 2AGQA 5B7WA 3SMZA 4NYZA 3ZSQA 3WXMB 1I5OB 1KD1O 3EMTA 3P6YC 6FDRA 2QL5B 2AF6A 1I94F 4CFBA 1S1TA 2MKHA 1G15A 4X65K 3ZO7A 1WKKA 2IVMA 1X4CA 3OYDA 2AYBA 4W4MA 3QFWA 4JI7F 5F8LA 3H1QA 3BF1A 2L3MA 4JKEA 2KVQE 5HQ8A 3GV8B 1SQKA 1G7CB 2KN4A 4B9MA 4DV3K 2R8GA 4O5BA 1J5EF 4IOCQ 3TNVA 3TUPA 1HLUA 2G2ZA 3M2UA 4OGCA 3CYMA 1RT6A 4IKAA 4PA1A 4Z7YA 1UAWA 4Z94A 1NDKA 2XULA 1N5YB 3M8WA 4DV4K 4E7IA 3V1QA 4P9SA 4FK2A 1RTIA 2U2FA 1S6PA 1BI4A 2J0SD 3OBIA 3VGLA 4FCYA 4QIWD 3VV2B 4PWDA 5J1EA 3PIOL 3AAWB 2Z2ZA 4BR4A 3P3DA 4PXBA 1N48A 3G8TA 2BR0A 3CIZA 4USIA 3DGPA 3DRPB 1KFSA 2PMHA 6AT1B 3CCVN 3D54A 4P73A 1IBMF 2W2QP 1ZPWX 4JI5F 3AVMA 4BRPA 3WHIA 2UXCJ 2ZH4A 2YH0A 4JEPA 4MKAA 3G96A 1KN6A 2GGPB 4V19X 4B1UB 4FJNA 4BDZA 3CCLN 1VQPS 3DGPB 1L3SA 1RT1B 3T5JA 1Y11A 1BCMA 2V7YA 1HBOA 1OH6A 3SUNA 3T6BA 1QQOA 3P8BB 5FLXU 2DT9A 1S4EA 5AFUH 5G4DA 5HQLA 4CE9A 4LREA 1N88A 4LF4J 4U67Q 3IS9A 2D41A 3RTVA 5EGYA 1NMEB 2KB2A 1X9JA 3T1HJ 3AVNA 2JHEA 2QTDA 2F9WA 4CF9A 1ZBIA 1N36K 3ATVA 5KFAA 3G86A 3NGIA 4YHHF 2CIMA 1IBKJ 3KUGA 1NDPA 3T5LA 3I9V9 4FW2A 2B5JA 2WBRA 1K73O 3NNAA 1XN9A 1NM2A 2P5GA 4JI2F 1CXUA 1T0TV 3FZLA 3HZEA 3KMSA 2EG2A 2D0PA 4C3MA 2RRBA 4Q8EA 1K6YA 2CVIA 4DR5J 3AVLA 3TOQA 4OX9F 4R5PB 4F67A 1S6PB 4KH1B 1BI4B 5BYSA 4DU1A 4CCHA 2UUBJ 1GMUA 2IAJB 2OPRB 3DXBA 3QRPA 1LWEA 3R5DA 4GV3A 4CEZA 2E5HA 3PRVA 2Q3SA 1AZSA 4OGEA 3IRXB 3SMSA 3CCRN 3AA2A 3QPIA 3OFGA 2VBYA 4I7FB 3VGVA 5B09A 2Y9HA 3THXB 2OD6A 3EO3A 2E1CA 1XNQJ 1C0UA 5GADP 5B0CA 4O0JA 3A0IX 3LUYA 1NNDA 4LF5K 4B9QA 4CQ1A 2HFNA 2UXBJ 2VU5A 4LR9A 4CJFA 3TO8A 1UL3A 2CJBA 4K59A 4RBVA 2OA8A 1WG4A 2KT5A 3JSMA 2XMWA 1JLEB 3FLCO 2DNNA 2MLYA 3ITHB 1FKPA 1GLCG 3MAAA 2P9IB 4H0VB 1X3MA 1Y0HA 5F8IA 3TABA 1K44A 1YJ7A 3OV7A 4E3SA 2VBZA 4KHPF 3FBFA 3N9UC 1MWKA 3Q7CA 1RT5B 1F2HA 3DI6B 4TQSA 1IKVB 2EK6A 2CQ0A 4IWVA 5AE3A 1WACA 2VWKA 2O4IA 3OL8A 2HRUA 1G2EA 4Q0BB 2HHHK 1KC8O 4W98A 1T11A 3L0QA 4GKJJ 2CJ9A 4JD2B 1UFWA 1OYDA 3PIPQ 3Q8SB 2HIQA 2ATCB 3GIKA 4Y00A 2K8GA 5HO4A 1Q0NA 4OYIA 2C3UA 3HKZD 5GAEI 4JI8J 1IR2A 1LAVA 2V2VA 3KK3A 1RWUA 2O01C 4CLZA 3B82A 1VQ7N 3DJCA 2NS1B 3ID8A 4FPBA 4JBCA 3N4WA 1FTCA 3TPQA 1KVKA 1S79A 3WC2A 3FFIA 4PQUB 3BQ0A 4AE5A 4FZVA 4F7VA 2QJ3A 4ZJLA 3ENHA 3O2IA 1TL7A 3TTDA 3RB0A 4C3LA 3JAMY 4I6MB 1PBUA 1CS4A 4AL6A 3SCLE 4WF9L 2ZUAA 3OXFA 2G8UA 4O3NA 2HBLA 1HMVA 1RCOB 2FHJD 3KKRA 3F9MA 1PILA 3LPYA 5DG8A 3FNNA 4XH5A 3OHAA 1NAQA 3P39A 1WBDA 3NE6A 2DISA 5BRDA 2QW9A 1YVFA 1UJ6A 4LRFA 3HFVA 1D9FA 2YV0X 2RQMA 3A4TA 2DPNA 1OH8A 3R9PA 4DR1F 2HIYA 2QWRA 3UB5A 1GEHA 3HK2A 1CXQA 2LDIA 2P9SA 1TK0A 4R0JA 1O0PA 3DLLL 4CWBA 2XMUA 2DR7A 3VHQA 3M8QA 3I5BA 3CFRA 4HKQA 3LO3A 4CEDA 4U7BA 4DQQA 4ZVUB 2PYJA 3ZCMA 1ZH5A 3ISNC 3M2UB 1YIJN 4CLYA 2F96A 5CE3A 2O8EB 3LH2S 1RNHA 1YDLA 2JRSA 4JV0A 4MYUA 4BY9C 5KFYA 1QTNB 3O1LA 5K8OA 3HT3A 4DR4F 5AZJA 1RADB 5I9EB 1TUGB 4YY3K 1U0SA 3SSSA 3W7BA 5EX0A 1TUUA 4WKYA 1SJ4P 3AVCA 1UWAA 3DHWC 1YBUA 4QW8A 4CGJA 2W2PP 3MWPA 4B1XB 4KTZA 2MKSA 3M2RA 3BS9A 1A9NB 3CG7A 4ZP6A 4NLWA 1V3SA 2Z58B 3G8QA 4DN0A 2QYCA 2NR0A 3NG8A 4E1JA 3QO9A 4RU2A 1A7GE 4OZJA 4NYPA 3WXKA 3W8PA 2FSNA 1RWPB 2HSEB 3BN4A 3MPUB 4N41A 2WZ1A 3AGRA 5AQQA 4O44B 4H8KA 3BM7A 3H98A 3ILJA 3X3UA 1EKRA 1T9UA 2Y8WA 2W6LA 3EPIA 1YIJS 1EHWA 3WEEA 3BH7B 1S1UB 1N6QB 4HH0A 3ZFVA 4YY3J 3S3NA 2G0CA 4C8NA 3IM9A 3QB0A 1NNEA 3LW5C 4E1NA 3MAAB 2VH7A 1JL2A 3S41A 2ZHOA 2PAVA 3ZSRA 5KAKA 3RMDA 2J4RA 2DRBA 4YB1P 2ZKTA 1R8PA 1KAZA 1U1QA 2Q79A 5CZ1A 2IBOA 2XHCA 3DXKA 1U1LA 4TYAA 4A8KA 2V68A 5BR8F 4CJVA 3K8WA 3IR6B 1TK5A 1V3ZA 3NCPA 1PJ5A 3R5BA 3OYNA 2B4VA 2YJEA 1FO1A 3QBCA 3H5YA 2HS0A 4H4MB 5F8HA 2J9CA 1N32J 2CJYB 3LDPA 4CHYA 2DGVA 3OFHA 4I67A 2Z56B 2WOMA 1IBKF 1HBMB 4C2MA 1YJ9S 2EKYA 2W7PA 5KFFA 3CCVS 2QMWA 1T05A 1S4FA 1S57A 5IWAJ 4RW7B 2L41A 5B8HA 1GX6A 2DGWA 3LP1B 3NBPB 3CJ9A 3ZLJA 1KQSR 3NS6A 3W63A 2W2MP 3IMQJ 1RWNB 3C15A 1X4BA 3UDCA 1TUYA 4Y0WA 4DJBA 3UKUA 4BR2A 4A4JA 3JS9A 2O3DA 2UVWA 3BN7A 2C2OB 5LJWA 1UOCA 3SSRA 3UD5A 4B3MK 4MK7A 2L08A 2PY5A 2HVHA 4QYZJ 4NRTA 3MMCB 4C8OA 3R1XA 2NREA 3Q8PB 4EU0A 1FKAF 4HI2A 4O3PA 3PX4A 1TKZA 1RT4A 3RBXA 3UVJA 3LTOA 1S6QB 2RHQB 2DFHA 4K5RA 3TYTA 2DTUA 3EY1A 4P2MA 4M7XA 1H73A 3CIPA 1VBKA 3HZGA 3HOTA 1S99A 3W2WA 2G1HA 4LFCK 1FJ7A 3W3SA 4WYWA 4O3RA 4F25A 4BDYA 3EZ5A 3IFRA 3HF5A 3UKUB 3P4UB 3I8BA 2B4PA 1BUXA 2AGPA 4X62K 1Q81T 4RBUA 2BUNA 3P96A 4ZVGA 1NLKL 1GLFO 2JC1A 1VRTA 1HARA 2EVZA 2VCPA 1NXIA 3A8YA 1WUAA 4FPAA 1PO6A 2YNGA 2PDAA 4IKFA 2BQUA 2VF3A 4BHQA 4AL5A 1S1TB 2WW8A 2YHYA 4IFYA 4MLEA 2HZCA 4ZVEA 2XG8A 3V1OA 1BA1A 3DWLA 1U1NA 2FLOA 4JI8F 4ISEA 2O67A 2KHDA 3HYFA 4E7HA 1FVQA 4FJ9A 2CQBA 4LF5J 2UV8G 4ZPBA 4XEIA 3K89A 1MMDA 5KFCA 1K9MT 1YQHA 3CC4N 2MPUA 3OVBA 3TAQA 5BXIA 2ATLA 9ATCB 2D74B 1YI2N 1GLJO 3L95X 4DPOA 1MA9B 2KLAA 4DMZA 3W1YC 4B9NA 4GVBA 2MQMA 1IV0A 1Y3KA 2R7OA 3RRKA 1JB0C 2UUAF 1UW9A 3UD4P 3FZHA 3D6MB 5KFLA 2ROGA 2OPQA 2GCFA 3CJ7A 3ENBA 2CQCA 2CNOB 4FWNA 2AA4A 2W2OP 1WI8A 3MEGA 4N76A 4USHA 4UOHA 3R7NB 1SKRA 1Y5IB 1S97A 1GMWA 1KSPA 3TQEA 1CJTA 1F2GA 1Y9OA 3VEZA 3QJLA 4YDUC 4FOIA 2DNKA 4KHYA 1GMWD 1BOTO 3C14A 5LMUF 4H0OA 4WFBQ 1OQ6A 3ZYYX 3H5SA 2CQHA 5K9FA 4IR9A 1VQNS 3BY5A 4FOEA 1OVYA 2YNHA 4P6QA 3FCHA 3HHLB 4GKJK 1XC9A 1WOQA 3OR1A 5ADXA 2KFYA 3GYXB 5A6WA 1SUQA 3HI0A 2CJXB 4TU8A 3AHPA 5EOYA 5D6GA 2GEMA 4QWAA 3WZ0A 4CO3A 5BN8A 1FT8A 2K2PA 2E5GA 3QLHB 4K7QA 3T69A 4CVNE 3A3PB 3WUHA 3RAXA 3CMAS 4CJSA 3J7ZO 5F9LA 1Q95G 5A8KA 1GH8A 5C24A 4NLDA 2VV5A 1D9AA 1K8AO 4HUGA 1RE1B 3U1NA 3R5JB 1TFYA 2C1EB 2BKOA 4ES2A 2QEXN 4OX9K 3JYTA 3C95A 4I6AA 5HBMA 1ZC6A 2M9KA 5M1FA 2FQQB 4TU7A 1M5KC 3JAMO 4E8UA 1CSJA 1EWQA 4H4OA 4EAHD 4YDXA 2GIFA 2RQCA 3MMAA 1RB0A 4DG1A 1SC6A 1VCTA 4LF6F 2FY8A 3VA0A 2MQPA 5GAEU 3R8YA 2AU0A 1RDUA 2FJEB 4USWA 1Y97A 3M1FA 2PSZA 4FN5A 2KHOA 2R9LA 3I82A 5M2UA 3BSCA 1KXPA 4BVOA 1RLCL 3EGVA 4X62J 3OUYB 1ATSA 1QAIA 3CWJA 3NMRA 2ZDPA 3ASMA 2I7PA 3VALA 2QG9B 1FEEA 3TAEA 5CYQA 4JRQA 3TJAA 4CJRA 3ZNJ1 3GOIA 4AHUA 5C2FA 3W2VA 4K4WA 5CHIA 2FJBB 3NDKA 1NB2A 2W9CA 4DV1F 1RAFB 2W42A 2YWHA 2MB0B 1Z26A 5MLCQ 2DHHA 1WBBA 4NLGA 3RU0A 4PKIA 1N36J 3A5NC 3O9QA 4CJKA 4FS1A 4YB7A 4L72B 5C7PA 3EYZA 2R7YA 3W9HA 3AO1A 5KPRA 2WONB 1Y3JA 4CO5A 5KGWA 4Z4CA 4LF4K 4NYNA 1AFJA 1AFIA 4W5NA 1YX2A 3CDEA 1WSRA 4I68A 1Q8BA 5KFEA 5B0DA 4CGIA 4OPJA 1DEJA 3EE3A 4WP8A 1DTTB 3UN3A 4KFBA 2R8JA 4ZP8A 1G4CA 3ULEB 1KQSM 4HI1A 1NHUA 3GE1A 4JI1F 1QHTA 4FLTA 3VESA 2OEKA 5LSLA 4FJ8A 3L7OA 1BY9A 2CYYA 4CJWA 4ISGA 1WELA 2MQOA 1LWEB 1T94A 4HWIA 4WZQA 2VPZB 1YRXA 4KYZA 2XCAA 2OTLN 2VG7A 2P9NB 3ENAA 3S9HA 2AJ4A 2J0XA 2MXYA 2YKQA 3HMJG 4Q45A 2UU9F 3NGRA 3BGFA 3AB2B 3GMGA 1I39A 1C0UB 4ZITA 3K9JA 1RHUB 1WTBA 4WIIA 2YWGA 2D3OR 2KG1A 4WU3A 2WBMA 2JLGA 1ATNA 2H3GX 3DU6A 1NK5A 3PW7A 5ETVA 4DV6J 1U6BA 1WHYA 2ATQA 4CLWA 1EX4A 2M8DB 2H51B 1KNZA 1ASWA 4NLVA 2I38A 3MDFA 5AE1A 3MDQA 1WC4A 3SXLA 1LNQA 1IBLK 2XCPA 3W5ZA 2FSKA 1F3VA 3DLLQ 4Y28C 5E7OB 4X66F 2GZOA 2Y1IA 3IBWA 5IM0B 5I3PA 3CE8A 3OYEA 2G2YA 1GNKA 1N8RT 4I0WA 3V6DA 1JWWA 2OPPB 2J7KA 4HTUA 4OPKA 1NLVA 2VPYB 2HFUA 3EGNA 1TFWA 2P9PA 2BW2A 4EWTA 2GQCA 1B7FA 3KK1A 2JVOA 1FESA 1EKSA 3W0LA 3WT0A 2AJ0A 1JLGA 1O1WA 2WVCA 3E9LA 3L2VA 4UY8T 3CPWM 2G0IA 2CPEA 1W2IA 4LF6J 4H0XB 1QSSA 2CH5A 1O8BA 1WSEA 1NOZA 2DH7A 4GO5X 3SJHA 5CYMB 1HIYA 3P83D 1S6QA 2AZ3A 4CHOA 3WXIA 2ADCA 2I8EA 4WK1A 4C0HA 3IM8A 1T9XA 4LT6A 1ZXOA 2W9CB 5DLFA 5J2NA 5CYMA 2DNQA 1KS2A 3G2XA 2CZ4A 2O8BB 3LAMA 1VK3A 2C2MB 3I0SA 1HW9A 2NRWA 1BHLA 4X4TA 5J1PA 2K3KA 3L4BC 4RW6B 4IZ9A 2Q6BA 3SCJE 3OYHA 3H45C 4CZFA 5I42A 1TUWA 4KR0B 3I31A 2F5GA 3DMJB 4QIEA 2NPIA 4LQ9A 1IR0A 3LALA 3MEDB 1HMVB 2HBRB 2BUPA 2Z30B 2D3UA 4CZCA 3NF7A 1FJGJ 2C2KB 1YJUA 2PA3A 1N34K 2W1BA 4OPHA 2ALZA 2CQGA 2ZBQA 2D3O1 3TUJC 3IAYA 4PKHA 4KTWA 3GG1A 3ZETA 3N0VA 3MEEB 4F3OA 4TQRA 3NEKA 4H5TA 3K5NA 2JSXA 2IRUA 1TKXA 4OLOA 5BR8K 1KQKA 3FCWA 4H0YB 5AQUA 3KWGA 1P8ZA 2MLZA 3QMLA 3D4JA 3HZ6A 4ZJQA 1VSMA 3W60A 3J80O 3QT5A 2IVFB 1WAJA 4E0DA 2NRZA 2UUBK 4OZ5A 5KFRA 2KXHA 3CPEA 4L76A 1VQMN 4H5WA 3V4MA 3GZ7A 5F41A 2LU1A 4IRKA 3CC2S 1VSLA 3DXMA 1YLXA 2FBTA 1KLMA 1SB6A 3KD1E 3VAKA 4QWDA 4JKHA 5KFMA 3PSIA 5FDLA 2ALYB 1SJ3P 1M90T 4IR1A 1KWMA 2COLA 2LXUA 4ZHRA 1S7IA 2XHWA 1HHSA 4O3SA 2E9ZA 5KFVA 1A5XA 2V8PA 2D69A 1LFPA 3N79A 4CNYA 4UQTA 3PHTA 2WVBA 3BF3A 4A8MP 4M5MA 3GR1A 4NLRA 4BC5A 3GCWP 4CHNA 2KM8C 4W90B 2AIRB 3MXHP 1NSAA 4B3MF 4B8CA 5DK5A 1NBEB 4AQYK 2YQ0A 4PAAA 1U2RA 4ALZA 3E1YA 2CQ2A 4KRFA 3VF0B 1J5EJ 2VJVA 1VSIA 3DOKA 4DHVA 3LZIA 4FWKA 4CEQA 4W5OA 4IFVA 1SL1A 4UW2A 5IV3A 2P5VA 2QEXS 5AQKA 2E2OA 5KG4A 3BGUA 2G8IA 2CNLB 1VIXA 2LQ8A 3CTRA 4YUDA 4J9SA 3MX2A 3DXSX 3OUYA 5KFXA 3ETOA 4J8FA 1W2BR 4TU9A 2QLJB 3VAIA 2AJFE 2P9EA 4NLBA 1S48A 1XHXA 1XK8A 2M3DA 5DZ7A 2WB4A 4YOTA 3VERA 5B0GA 1FRHA 1JL1A 2C2NA 1GLLO 5M1QA 1ZBLA 3CJ0A 2CGLA 4F02A 3L3CA 3Q2TC 1RBUA 4UZBA 1HD1A 5JVGQ 1N33J 2FC9A 2W2NP 4GVLA 4FZZA 2AX0A 3KYLA 3BB5A 1M1KO 4HYKA 2IJNA 3QIDA 1AA1B 4ED8A 1RHKB 3EZWA 3OYCA 2HVZA 4BCAA 4CEAA 4BC4A 2GTDA 3TSUA 1HYSB 2YX4A 4NB4A 2CA9A 3CFOA 4B02A 4PXDA 1FE4A 4NYFA 4B1WB 4HTIA 2VGMA 1BE4A 4PWUA 4KH5A 1SH0A 4LVNP 4ISFA 3CF5Q 5AE2A 4OMFG 5IT4A 5ETQA 4C8LA 2G8FA 3I55N 3TRGA 1KFDA 4ZVOB 4JI4F 5HL7L 3CCMN 1XEZA 3HBTA 5LJVA 1IO2A 3KJVB 4WFXA 1TKDA 2P9GA 2F7VA 4DV2F 5GADI 4DU8A 2X74A 2MZQA 3C6HA 1P8GA 1JKHB 1I1GA 2O8BA 1D5AA 4ELUA 2O66A 2CQIA 3AVIA 4LMZA 2HYIB 2W40A 4LSNA 4F9OA 1UETA 3O3HA 5ETMA 3BPDA 3BGOP 3EL2A 1YI2S 4PHTX 1WDTA 2YQ3A 5AQPA 2MDAA 4JK7A 5H1SQ 3ULDA 3LA0A 3GIJA 1RILA 1HWLA 3ZT1A 1Q7YT 3T1HK 1VK8A 4OI3A 1R3NA 3O44A 3IGVA 1ELOA 1Z25A 1C0TB 3HPOA 2HMIA 4F4WA 1V5VA 5DDQC 1A0OB 1TKZB 4JI5J 1S77D 3PYEA 3IWLA 2B8PA 5AQLA 4DSIA 1JLBB 1T05B 2HMPA 1NGBA 4JV1A 1S76D 4BE2A 1NGIA 4DN9A 1NHKL 3HP9A 2VD3A 2EXUA 5LSOA 4LBPA 3C16A 1HNXK 4LF8K 3DYAA 2ITGA 2VG7B 2HZAA 5G0RA 1Q18A 2HHHF 1WSGA 2QLWA 4IXCA 2Q97A 2YKNA 3KUEA 5IV4A 1FDBA 4Y0FA 5LMNF 2YKPA 3BZQA 2QWQA 2R7UA 2ZWOA 1RT6B 3H46O 2OPPA 3BV8A 2RSQA 3VQ8A 4DTRA 3TAPA 2YTCA 2ROPA 4B1YB 2GW8A 1FA0A 2CZ9A 1GQEA 3DOMB 2BQ3A 4JYAF 1HWJA 2HQ3A 5KFOA 4RW8A 1FJCA 1R8AA 3RSEA 4DV0K 1P6TA 1BHNA 4A2AA 3QFUA 1RT3A 3HHEA 1YAGA 1VQKS 1HI0P 4Y2IA 4RNOA 3PR4A 3NAIA 1UJ5A 1WTFA 1VBZA 4DQ8A 1VJWA 1SQEA 5DDOC 3UI3A 1FKPB 2E8AA 5CZVA 4NLSA 5J2PB 2QM1A 4LF4F 4M8LA 3NGZA 4LF9J 2YKNB 3D68A 4LFAF 2P2CB 2G8VA 2RUGA 2HBYB 3ZSWA 1DGKN 1OO0B 3RWUA 1D3WA 3N6MA 4RJVA 4RR5A 2BM0A 2LQ9A 2OFHX 1NJYA 4K2JA 4XO0A 2AW0A 1WC1A 4P7VA 4IQMA 1ZBSA 4BRKA 4YHHJ 3DMJA 4CBXA 2O8DA 5HRSA 2ZH1A 3ZNUA 1Z2LA 1FDNA 1CJUA 4OZ0A 3AV9A 1S72S 1KOOA 3PR5B 1VSFA 2ZHAA 1C0GA 1ZAWA 3UVJB 2HK3A 3PDNA 4CJ4A 2KI2A 3M8SA 1S0NA 1RU1A 3O1WA 5KT5A 1DHMA 5G0RB 3HHNB 4A2BA 4DTPA 5HRNA 4K8RA 5DG7A 1RAAB 1M1KT 3K5OA 4ED7A 2J76E 1R6VA 3ENQA 2XTJP 1U2VA 2P6SA 3D1QA 2Q0UA 2JZ5A 1BQMA 2E5LJ 3FQLA 2MGZA 2B51A 4MMOA 3MR3A 2JWNA 4B3TK 1F0XA 1APSA 3SBGA 2ASMA 3ZZ0A 4CIEA 3QQCD 4JAXA 2BJ8A 4NA1A 5E0OA 3KLIA 4Q7AA 1EETB 2GJFA 5DJBA 3U3GA 2HFVA 2RU9A 3LM9A 2FB0A 3QWUA 3OW2R 5I42B 3DHXA 4WQ5A 2XMTA 3KLIB 1KD1T 4KJIA 1UTAA 2R7RA 2HURA 4FS2A 2V52B 2MYFA 3C7NA 4NI2B 5HMYA 3D6RA 1UPMB 4P2XA 4PY5A 2G4BA 1AB8A 4ED5A 3ENWA 3LM2A 2FHOB 4J5OA 1BL3A 4CESA 3FCVA 2VOPA 2FF3B 4DFJA 3ZZYA 1PKUA 3L2UA 4JI4J 2IMOA 4O5FA 5JICA 2AX1A 3MWTA 1IKYA 4LD0A 2ZOGA 1RHRB 3KHLA 3SV3A 1WHXA 1HNWK 2EC2A 3EX7B 3AO2A 2GS8A 2JJ4D 4LF6K 2DPJA 3W66A 3G4SS 3RW6A 2Z2LA 3BBCA 4DTNA 2G8KA 1T6CA 2ZKUA 3I55S 4U9RA 5KTQA 3M8RA 1HQ2A 5CD4A 3Q83A 3FGUA 2R7XA 2H1YA 4Z4GA 4C1NI 1RYRA 4N47A 4DF4A 1UCNA 1XUPO 4CGHA 1WEZA 4IH5A 3PIOQ 4PXEA 4FXDA 5SWMA 4NCGA 4DPTA 3G6EN 2X3GA 2RPIA 4ITSA 4I9LA 3OTOJ 5KT3A 1QQMA 1SH2A 5ITHA 2OD4A 3HVAA 4H0TB 4IO9L 1HWIA 3N6NA 4KREA 2F63A 5EHHA 1R31A 3UE5A 1NGFA 2P5OA 2V8GA 2BGGA 3KFWX 5IWAK 3R3LA 1V5IB 4FLXA 4DS4A 4BC3A 5E3RA 1IQTA 4Z4FA 1IR1A 2HBJA 1X31C 3KG4A 2Z0GA 1T44A 4KBIA 3JSRA 4DCOB 1TK8A 3J8AA 1HNWJ 3AD7C 2WSFC 1FRJA 3W5YA 1B0VA 4ZS6A 4KY3A 3EWGA 1VQLS 2CPIA 4IFVB 3UD3P 3GDQA 3ZETB 1HNIB 2IHR1 1M5VC 2OANA 1UFLA 5CAAA 5KG2A 1FWLA 3NGKA