4BRKA

Legionella pneumophila ntpdase1 n302y variant crystal form iii (closed) in complex with mg umppnp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
359
structure length
359
Chain Sequence
TNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISYLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
total genus 124
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brkA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brkA02
2VCPA 3QBWA 3JXUA 3D2FA 4DCHA 5KPTA 1NGAA 1NGDA 2ASPA 5LJVA 1XUPO 2GWJA 3A8YA 4H5TA 4BGAA 3MN5A 4CZJA 3GDQA 3VOVA 3CJBA 4RWTA 3FGUA 2IIRA 3WEEB 3CIPA 5AQTA 1KXPA 4XH4A 4FWNA 4M63C 3DAWA 2ZGZA 2ZWHA 3FZKA 3LDQA 4IZ9A 5FPMA 4CZLA 1V4TA 3TPQA 3VENA 1KAYA 4O5FA 2E2PA 4E1JA 1T44A 2I7PA 1X9JA 1JCEA 2QWLA 4FPAA 4JD2A 3AAQA 5B8HA 4PL8A 3LDLA 2Q2RA 3DXMB 4B1ZA 4BREA 4IXCA 4ISGA 2CGKA 4B1XB 3IUCA 2DPNA 1JCFA 3HZ6A 1QZ5A 5BR9A 1QQOA 4BQZA 1WOQA 4MO4A 4YDUC 3LM2A 5E26A 5EOYA 5JLFA 3M6GA 1T6CA 1QHAA 2V51B 4BC4A 3LDNA 4BR0A 4BG8A 3CQYA 5KQ8A 2EWSA 3WXJA 2P9SB 3RSEB 5KPRA 5KQDA 2J4RA 2E20A 1V4SA 5BRDA 1DEJA 2YHWA 5BPNA 3MMVA 4QS9A 5AQLA 2D0PA 3LL3A 3L0QA 2FSNA 4CZFA 2YJEA 1QZ6A 5EVZA 3WXIA 1RGIA 1SQKA 4WQ4C 3DXKB 5AQYA 2P9UB 3UKRB 2FLOA 3C0BA 3CJ7A 3CHWA 1GLDG 1GLLO 3IDHA 1U6ZA 2D0OA 3FZMA 4AM7A 4O8KA 4CZIA 3W3DA 2AA4A 5AQQA 3VF2A 1X3MA 2QWRA 4CBWA 3R8EA 2QWOA 3O80A 3L6QA 2CGLA 3BP8A 2ITMA 1HKGA 3EZWA 4QS7A 2HF4A 2OANA 3VEWA 3ZETB 4EHUA 1BOTO 5F1XA 4BC3A 2P9SA 2QW9A 3GOIA 3RSEA 3O1WA 5CE3A 4BROA 3HTVA 4H0XB 2IVPA 5E84A 3VPZA 1WUAA 1NWKA 4WQ5C 3O4WA 3CJAA 4ISFA 3H46O 1BO5O 5BPMA 3DXKA 2PBDA 3VEOA 4H0OA 2P9UA 3UKRA 3U4LA 1U2VB 3H45C 5EY4A 1NGIA 5JICA 3VEYA 1NBWA 4BGBA 3G25A 3CETA 1NGBA 2IVNA 3MN9A 2ZF5O 4CD1A 3WT0A 2P9IB 3A5OC 4AM6A 3MN6A 2QWNA 3UB5A 1P8ZA 3VESA 3WXKA 4H0VB 5FPDA 3SMSA 3ZETA 2QWPA 5ADXA 3HI0A 4BRIA 4RTFD 3BF3A 3DWLA 3FZFA 2F9WA 1ATNA 3LDPA 5KPZA 1NGEA 1S3XA 1QQNA 1YXQA 3I33A 2GWKA 4KBOA 5JMVA 3HSCA 4I6MA 4H03B 4RCHA 1MDUB 3D7EO 3H1VX 3O08A 3MK6A 3AARA 4Z94A 2V7ZA 2A6AA 3QDKA 4WQ4A 3ATUA 5AQKA 1U2VA 5BREA 1LOTB 4BC5A 1HLUA 4BR2A 5AQJA 4JHDB 1R59O 4CZEA 4CZGA 4BRGA 4CD3A 2BUPA 1J6ZA 3VGMA 3VF6A 4B1UB 4BG9A 3CI5A 3WXLA 1Q18A 2YI1A 3QFUA 1S22A 2UYTA 4C23A 2P9IA 1BG3A 2H3GX 1BA1A 3EL2A 1HX1A 2HMPA 3O5BA 4MLEA 2WUSA 1SAZA 5AQIA 2E88A 4WYBA 1GLCG 2HOEA 5EXWA 4A2BA 2E1YA 3KZBA 4ISEA 5AQHA 4A2AA 4FWPA 2GELA 5AR0A 4XH5A 4MLHA 3ZEUB 2A40A 3R9PA 3MCPA 1YAGA 2P9KB 2D1KA 2F9TA 1IG8A 2VWBA 2FSJA 2ASMA 4EAHD 2CH5A 4IO8A 4EHTA 4LC9B 2A3ZA 3SMPA 4NO7A 5AZIB 3O8MA 1HKBA 4FOEA 4DHYA 4BRPA 3OHRA 2Q1NA 4JHDA 4PL7A 4CBXA 4BR4A 3AY9A 1NGJA 1HUXA 2P9LB 1K8KA 4GY2B 1ZBSA 3O6WA 4FWQA 3JS6A 1E4FT 3H1QA 4K43A 3H3OB 4B1WB 3L4IA 4CZMA 3VEVA 4BRMA 4HWIA 5AQMA 5BN8A 4H5NA 1Z6RA 1NGFA 3H6EA 3SLCA 5BN9A 1RFQA 2YHYA 4A61A 3GBTA 1BUPA 4BRHA 5LY3A 1BDGA 2Q36A 3VEZA 3ZEUA 2P9KA 3C7NA 3ATVA 4FWOA 3GG4A 4PKGA 1TUUA 2D4WA 1CZAN 4BVOA 4CI6A 5AZJB 3VF4A 4FSVA 4IWVA 4I6MB 3SJHA 5AQWA 4BVPA 2W41A 5AZIA 3BF1A 3FZLA 4B9QA 2FF6A 2E2QA 4EFHA 3U8XA 5AQUA 2P9LA 4BC2A 2QWQA 2V7YA 3U9ZA 4BQLA 3HBTA 4BRLA 1RDWX 4MO5A 1HJOA 1NGGA 1MA9B 2A42A 2NZTA 3QB0A 4YDUA 4BRQA 3EKSA 3TU5A 2Q0RA 3O1BA 5TKYA 5AQFA 2GUPA 3EN9A 5BRHA 5AFUH 4FWRA 4B1VA 3IMXA 1BWFO 2CGJA 4BRFA 4IJAA 3CJ1A 3ENHA 2PAVA 2VYPA 1YVNA 3BEXA 3R6MA 1HKCA 2E2OA 2CH6A 5AZJA 1T6DA 3A5NC 5JLHA 1HPMA 2E1ZA 2FF3B 4IJNA 2QXLA 2NLXA 3ZX3A 5AQZA 3KHYA 2E8AA 2HF3A 4B1YB 2FXUA 3B8AX 3MN7A 3GE1A 4BRCA 5AQPA 4K41A 1OKJA 2P9NB 1NGHA 4H0TB 3W0LA 5AQOA 5LJWA 2Q97A 1SZ2A 5AQSA 4F9OA 1GLFO 3SK3A 3WUHA 4BRAA 1E4GT 4M7XA 1TYQB 4FWSA 3D2EB 4BR9A 1K8KB 5ELZA 2KHOA 3S41A 3KVGA 4H0PA 2YJFA 4K25A 3A0IX 3VERA 5EX5A 4QS8A 3VGKA 1ATRA 3ULEB 3VEXA 3FLCO 4H5RA 4K42A 1DGKN 4EIAA 2NRHA 3QICA 3CERA 4FOIA 3WQUA 3IFRA 1JCGA 1TUYA 2IVOA 4CJ7A 3GL1A 2AP1A 1ESVA 3A5MC 4XEIA 4L3QA 2BTFA 3C7NB 1KAXA 1D4XA 5FPNA 4CBUA 3ZX0A 3MDQA 5F2RA 4XH1A 4WQ5A 1C0FA 3QFPA 4JNEA 4CZKA 3ZX2A 4DB3A 4J8FA 5F0XA 2P9NA 1C0GA 4FO0A 3ENOA 2I7NA 2P9PB 1NMDA 2QWMA 2A41A 1Z05A 1TYQA 3FR0A 4PKIA 3D2EA 3I8BA 2ASOA 3WEEA 2A5XA 2E2NA 1H1VA 3LDOA 4FPBA 4H5VA 1ZC6A 1XC3A 3AAPA 4PKHA 1GLBG 3ULEA 4A62A 1Y64A 3U9DA 1QQMA 4BRKA 1GLAG 2ZGYA 5I9EB 3DJCA 4FWKA 4HTLA 4JAXA 3DXMA 1DKGD 3UKUB 3CJ9A 3FFKB 3M3ZA 4FWMA 4GNIA 5AQRA 5FPEA 3FZHA 2V52B 3FE1A 1XQSC 1YUWA 4M7YA 3BUZB 2YHXA 2W40A 1GLEG 1GLJO 2Q0UA 3M1FA 3P4IA 4JN4A 3F9MA 3VETA 3VGLA 1NM1A 4H5WA 2Q31A 4BR5A 3D2FB 2YCHA 1NGCA 5BRFA 2P9PA 1X3NA 3CJCA 4H0YB 3J8AA 1ZXOA 3EO3A 1KAZA 4FWLA 1BU6O 2QM1A 2FSKA 3WQTA 1NLVA 3A5LC 5AQGA 1BA0A 1ATSA 2GEMA 3HM8A 3QMLA 4NB4A 4BRDA 1IJJA 3UE5A 1EQYA 3ID8A 4DQ8A 3H3NO 4JD2B 3QBXA 3UKUA 1LCUA 5AQXA 3LM9A 5BPLA 4CZHA 5AFUA 3EKUA 4FL9A 4BR7A 5AQVA 1MWMA 2GTDA 1MWKA 3CQXA 4Y0WA 4BRNA 5ADXH 1G99A 5AQNA
chains in the Genus database with same CATH superfamily
3CM6A 4KV8A 3QBWA 3AVCA 4DCHA 4OKKA 3TSUA 1KQSM 4M3XA 1XHXA 2FBVA 5MLCQ 2ASPA 1CLQA 4CEFA 3I56N 1N32K 5LJVA 4CJVA 2GWJA 4A5BA 4MQ3A 4RWTA 3FGUA 3M8RA 4DQRA 3THXA 3CIPA 3NF7A 2ZGZA 3SAHA 3LDQA 5FPMA 1NK8A 3VENA 4FM2A 4JRQA 1T44A 1JCEA 2FC0A 4PL8A 4IFVA 3ZSRA 4J2DA 4OPHA 4B1ZA 5FDLA 3SUOA 4IXCA 2CGKA 4CJ3A 4PY5A 1QZ5A 1UAXA 4CJWA 3VA0A 4YDUC 4CF1A 4C8OA 3CMAN 2JLEA 4PHTX 4BG8A 3CQYA 5KQ8A 3DLRA 3CFPA 4J2BA 2HHWA 2P9SB 2J4RA 1YF5L 5BPNA 3EEQA 4QS9A 3L2UA 2D0PA 2JGUA 5AJ3K 4M42A 4CZFA 4MFBA 1L3TA 2O4GA 1QZ6A 3NGYA 5EVZA 3BZKA 4I9LA 2GV9A 4BE0A 4WQ4C 4ICLA 4FJIA 1GOCA 1I39A 5AQYA 1F21A 4CEEA 3CHWA 1U6ZA 2P5OA 3FZMA 4M3WA 4O8KA 5GIPA 4CZIA 2G8FA 2AA4A 4DU4A 3O9SA 1JLAA 1X3MA 3K58A 2QWRA 3CC4N 3SYZA 1XC9A 1I3AA 3RMBA 4DV2K 3BP8A 4QS7A 1VSFA 2OANA 3OYCA 5F1XA 1BI4A 2PYLA 4B9NA 3O4QA 2YNHA 5C10A 3LPTA 4JKEA 2IVPA 5E84A 5JS1A 4Q5VA 4LFBK 1OH8A 3OYMA 2F8TA 3EE8A 3ZSQA 4DSKA 5BPMA 3V1OA 2F8SA 2P9UA 2EX3A 1ASWA 2HSTA 3U4LA 4JKFA 1QHTA 1NGIA 5FRMA 5HL7L 4FJMA 3G25A 2W42A 2Z1IA 2ZF5O 1XMQK 1K8AO 3SQ4A 1WSJA 3VESA 5C15A 4X66K 3WXKA 3ZETA 4Q0BA 4CHOA 2QWPA 5JS2A 1LW2A 3V1QA 1KCFA 1SKWA 3TANA 1ATNA 3AVBA 3LDPA 2KFNA 2A1RA 2VG5A 3OTOK 1QQNA 2GWKA 4KBOA 4CEBA 5JMVA 3QINA 4LF9K 3TSQA 1MDUB 4X65K 4KH5A 1SKSA 5C2FA 3G10A 4NXNK 3MK6A 3S3OA 3RTVA 3QDKA 4DTSA 2F4VK 4LSLA 4DQPA 1QVFM 3AVKA 4BR2A 5HBMA 4CZGA 4CD3A 2BUPA 1J6ZA 3WXLA 1Q18A 2YI1A 4DS4A 1X9SA 4KHSA 4IDKA 4XIUA 3KK7A 2H3GX 1BA1A 1C0UA 4ILHA 3O5BA 1NG9A 3V9XA 1BCOA 1XNQK 4BACA 3LZIA 3C6AA 4M3TA 2UXDK 4AH9A 4IG0A 4RW6A 4ISEA 5AQHA 4FLWA 2HMIA 3E66A 3A2FA 3VQCA 4MLHA 2HVHA 3AVGA 2OA8A 1WAFA 1YAGA 1S1WA 1IG8A 2FSJA 3AV9A 4DTPA 4EAHD 3HOTA 4WF9L 3DOKA 4DV7K 4JI5K 3RRHA 4PUOA 3J81O 3AA2A 4W5QA 1HKBA 4HHTA 3C65A 2X6SA 3OHRA 4CBXA 1NGJA 4DG1A 4Z4EA 4CJTA 1ZBSA 3K2PA 1E4FT 4B1WB 3P31A 4JI7K 4H5NA 3G6EN 3CCUN 1VSKA 3KLHA 3PIPL 4FW1A 1RT2A 3VQ5A 3KLFA 1N6QA 5CZ1A 5BN9A 4FK2A 1RFQA 4JV5K 3GBTA 2RN2A 4BRHA 3SUPA 1BDGA 3ZEUA 2P9KA 4LH4A 2NRTA 2Z1HA 3SPZA 1CZAN 2YHAA 1WLJA 4FSVA 1KC8O 4IWVA 2Z1JA 2HBKA 3SJHA 4B8AB 5AZIA 3TABA 3QERA 4FLYA 3F5TA 5DM7L 4OJRA 1NJIO 3U8XA 4DV1K 2P9LA 4F8RA 4O0JA 2V7YA 4OGEA 1MA9B 2A42A 3QB0A 4IEIA 4OVLA 4YDUA 4J2AA 5KGXA 5TKYA 5CHIA 5AQFA 4DR4K 3QEXA 4DUYK 1VHXA 4B1VA 4IJAA 4IBNA 3OY9A 1YVNA 1FW6A 4KPYA 3OJUA 1K9MO 3KD1E 3HSTB 2VG6A 5JLHA 3P83D 2X74A 1TV6A 2E1ZA 4IJNA 2UUBK 4O44A 3CC7N 2QXLA 1D9FA 1MU2A 4EP5A 3S3MA 4FLUA 4WFNL 1HYVA 4EZ9A 4K41A 1NGHA 4CEOA 5AQOA 4HVJA 5J1EA 1GLFO 4BRAA 1YJ9N 1E4GT 4FJNA 3EY1A 4FWSA 4KHNA 5ELZA 3VQQA 2XRIA 4YOUA 3KVGA 3ZSVA 1D5AA 4K25A 3MCAB 2O8BA 1ATRA 3ULEB 3CD6N 3VEXA 1KTQA 2VG7A 4K42A 4CJ4A 1DGKN 4H4OA 1J53A 3O9TA 4EIAA 3NVMA 4HCCA 4FOIA 1TAQA 3DRSA 1JCGA 1TUYA 2IVOA 4CJ7A 2D0CA 4DR1K 4DR2K 1ESVA 3A5MC 4XEIA 1RTDA 1KAXA 4CBUA 4TSXA 1RDAA 1C0FA 4C8KA 3QFPA 4ID5A 1XI1A 3OA9A 4M45A 4CZKA 4LF5K 3QIPA 3ZX2A 4FJGA 4JKHA 3P5JA 2KQ2A 3ENOA 2QI2A 1NMDA 3CF5L 4JRPA 1VSDA 3I8BA 4FJKA 3RMAA 3O3FA 2PZSA 2OPQA 1H1VA 1VQ9N 1KD1O 2F7TA 4CEZA 3T3FA 1I94K 2D0BA 3CCMN 5LMNK 4BDZA 1BIZA 1QQMA 1EX4A 1VQMN 3RRGA 4DTXA 3CMEN 3OYGA 3JAMO 1QSYA 5I9EB 4I2QA 3ITHA 4HCBA 4HTLA 2KFZA 2RHKA 3CCEN 1JXEA 1VQ4N 4B3MK 1VAZA 5AQRA 1RTIA 4FWMA 5GINA 3THWA 3HPHA 1ZBHA 4ILGB 2YHXA 2Q3SA 1IBLK 2IS3A 4CHZA 4JN4A 4BR5A 1VQ8N 5A2QO 2HHSA 1SL0A 3THYA 4DR5K 3CJCA 3NVKA 4H0YB 1RBTA 4YOTA 3EO3A 2ZD1A 1WB9A 4DV6K 3NMUA 3KWGA 3ZLJA 4DLGA 1NLVA 1NK9A 5D3GA 3A5LC 2YKNA 4CJEA 3THXB 2HW3A 4FLTA 5AQGA 4NB4A 1EQYA 1NJWA 4LFCK 4DQ8A 3D6RA 5C2DA 4DF8A 3ZSWA 3OYEA 2FBTA 5SWMA 4JI6K 1MWMA 4C8NA 4Y0WA 3OBYA 3CPWM 3VTIA 4IFEA 3K5MA 2VCPA 5C0YA 3O9QA 4CFDA 3NDKA 3WXMB 5K14A 1NGDA 1U04A 1HNZK 2GX9A 5LL6Z 4FK4A 4H5TA 3QETA 3E1YA 4JK7A 4E7JA 1WSGA 3WEEB 1KXPA 3PX0A 4FWNA 1TAUA 4IZ9A 4MDAA 1NJZA 3CXCM 4IO9L 4CJQA 2RPIA 1T7PA 2QWLA 3C95A 4FPAA 3MWTA 5B8HA 1WSFA 4AHTA 3DXMB 3HT3A 3IUCA 3PX6A 3KLGA 3VQ7A 3SNNA 1W2BM 5BR9A 1J5EK 2AJQA 4BQZA 4JKDA 1FKOA 4Z4FA 3AVLA 5EOYA 5JLFA 3OYJA 4LFAK 1QHAA 2V51B 3FFIA 5C42A 2HBMA 4M3RA 1TKXA 4F2RA 1BI4B 4O5BA 2ZM6K 3CQ8A 3OYIA 5KQDA 2E20A 3AGKA 4KO0A 2VQFK 1DTTA 1KVBA 2YHWA 2W6LA 1VSMA 3NBPA 3LL3A 2QTDA 4JI8K 1LWEA 1ASUA 3IKMA 3DOLA 3O9UA 2WC9A 3OYKA 1ILYA 2P9UB 2P5GA 1ZBIA 1TL1A 4CGHA 4DU3A 5M1OA 1UA1A 1RBUA 1T05A 1VQKN 4Z4HA 1GLDG 1GLLO 2D0OA 3AGRA 2NRVA 3W3DA 4JI0K 3BY5A 4CBWA 1HQEA 2QWOA 4DF4A 3L6QA 4CFCA 2KZMA 2HF4A 3ZETB 3JSMA 1N33K 3CG7A 3GOIA 3RSEA 1J9AA 2D5RA 2UU9K 5DM6L 4FJ9A 3ZT1A 4DR3K 4K8XA 3K5OA 1RT4A 2GUIA 3HTVA 4H0XB 3NGIA 4A57A 3TR8A 1WUAA 3CJAA 1UOCA 3TTDA 5C24A 1B92A 1BO5O 2HHTA 2YNGA 3DXKA 2PBDA 3EYZA 5EY4A 4CVNE 4UQGA 1N36K 4BGBA 4CHQA 3QEWA 4KB0A 3KD5E 2IVNA 3OYDA 4CD1A 5T7BA 3F73A 3WT0A 2QWNA 1P8ZA 1LWCA 1YTUA 3ZYYX 5SZTA 3SMSA 5ADXA 1HNWK 3C94A 3DYAA 4RTFD 3BF3A 1WSIA 3K5NA 4IEEA 4G9ZA 1S6PA 4V19S 3I55N 1NGEA 2EHGA 4NCGA 4I6MA 4RCHA 1YIJN 1S9EA 2QA4N 3D7EO 1IKWA 3D45A 4I9QA 5M1NA 3O3GA 2V7ZA 2WBNA 2A6AA 1NKBA 3OVNA 1HNVA 2UUAK 1K6YA 5BREA 3U3YA 3VQEA 5CY4A 4GV6A 1HLUA 4JKGA 5AQJA 4NYNA 3AVIA 3MWPA 3VF6A 4G1QA 4BG9A 2FBXA 3AVAA 2D0AA 2P9IA 1HPZA 2HMPA 5C12A 1P90A 2E88A 5HP1A 4FM1A 4WYBA 1DTQA 4DTRA 1GLCG 2OZSA 2WOMA 1RDUA 4RG8A 1VSHA 2QKBA 4A2AA 5AR0A 3ZEUB 3R9PA 2NUBA 2P9KB 3AA3A 2F9TA 1ZBFA 3OYFA 1NK0A 3DI6A 2ASMA 5JVGL 1Q81O 4E7LA 4IO8A 1Q8IA 4YORA 4YFUA 1VQPN 3OYHA 4NO7A 1LAWA 5AZIB 5E41A 4FOEA 4DHYA 4BRPA 3AVHA 4JHDA 1S5JA 4Z0UA 1HUXA 2P9LB 5KGWA 4B9TA 3LAMA 4ZTFA 3H3OB 1RDCA 3QEVA 1YVUA 4CZMA 3LP2A 4DSJA 1VSIA 4M3UA 3DLKA 1HYSA 3TWHA 1OH7A 4PQUA 1NGFA 4DKWA 2YV0X 5GAEP 4LD0A 2YHYA 4A61A 2HNYA 3WNEA 3VN5A 2ETJA 5LY3A 4FJLA 4FZZA 2IAJA 3ATVA 1VSLA 4FJ8A 4PKGA 4BVOA 4FLZA 3VF4A 3RMCA 1W97L 4WFBL 3WNHA 3SQ0A 1E3MA 1NJYA 4KH6A 3SAFA 4Z4GA 3BF1A 3FZLA 4BE1A 2A1SA 2OYQA 4B9UA 1OH5A 3NH0A 2E2QA 5AQUA 3KIOA 4BC2A 1S1XA 4E7IA 1A5XA 4JI1K 4BQLA 4BRLA 1D8YA 2NZTA 3E01A 2P1JA 3MXIA 3HJFA 2QXFA 4OPAA 3SBTA 4JLHA 5AFUH 2O8BB 4BRFA 3CJ1A 3ENHA 2VYPA 4KAZA 1U49A 3R6MA 2E2OA 5EU7A 2NNWA 1S72N 3T69A 2CH6A 2HNZA 4IOAL 4LSNA 1NKEA 2FF3B 3S9HA 3RR8A 2BE2A 2P51A 1QTMA 4DTJA 5AQZA 2HF3A 4CEDA 2QEXN 4BRCA 4KFBA 2YX6A 5LJWA 4N76A 1SZ2A 5HRNA 3SK3A 3WUHA 4Z4IA 2HB5A 1BQNA 3AA4A 1K8KB 2KHOA 3S41A 4R79A 4H0PA 1NOYA 2YJFA 4AHSA 2NRHA 3VQ9A 1JLCA 4NLBA 5J2MA 3CERA 2PFUA 2ZE2A 4KTQA 3GL1A 3L3UA 2G8IA 3PSFA 3C7NB 4L3QA 1D4XA 5FPNA 3ZX0A 1IH7A 3MDQA 5F2RA 1RILA 1NMNA 5KRTA 3ENBA 4AHRA 3R1XA 2O8EA 1IV0A 4DB3A 4J8FA 5F0XA 1BGXT 4CF2A 1ASVA 1C0GA 4LF7K 4CHPA 3THYB 2X6NA 4DFMA 1VQNN 4O8UA 4BY9C 3M8QA 4CEAA 5CYQA 4DQIA 2O8DB 3ISNC 3LP1A 4KKOA 3NGZA 1XC3A 4R5PA 3QLHA 4HTUA 3OJSA 3U9DA 4GW6A 4OGCA 3ZSXA 3DJCA 1VQON 1RT1A 5HLFA 1C6VA 3K5LA 3J7YP 3QNNA 5I3UA 3TAMA 4U7BA 1HMVA 4CIEA 4KHWA 3AA5X 4M7YA 5KRSA 1GLEG 3M1FA 4HUFA 3L4QA 3F9MA 2RE2A 2YCHA 5CZ2A 2R7YA 5BRFA 3E9OA 2ZJQL 1BL3A 4KTWA 4OPKA 4DTOA 3ZT2A 4EP4A 4NXMK 4B3SK 2QM1A 1JLFA 2ATQA 2FSKA 4ELVA 1VSEA 3HPOA 1KSPA 3QMLA 1LW0A 4KREA 2OPPA 1IJJA 4IDHA 2OPRA 3RVCA 3H3NO 4DFPA 3QBXA 4JI4K 3Q7BA 1HQUA 1SUQA 5BPLA 4DWIA 3EKUA 3CCJN 3N4QA 2NRXA 4BR7A 3PSIA 2GTDA 4CERA 5J2NA 4BRNA 3WNGA 4GVMA 3JXUA 3D2FA 3M8PA 3KJVA 1JLGA 3HVTA 2DY4A 1TKTA 1NGAA 3CCRN 1QSLA 3IS9A 1C0MA 1WSEA 4E7KA 1HNIA 2ZJRL 5J2PA 1RNHA 1XUPO 2KZZA 4BGAA 3A8YA 1Z26A 3MN5A 3GDQA 4JEPA 4C8LA 3P1GA 1N5YA 4CJPA 2IIRA 3PLAA 5AQTA 1JJ2M 3LP0A 4XH4A 4M63C 3DAWA 1Q7YO 4CZLA 5FLXO 4GKKK 1KAYA 4O5FA 1X9JA 1QS4A 4B3RK 4GV3A 4J2EA 4CIGA 3LDLA 1GOAA 4BWJA 1YITN 4ISGA 4YOWA 4O4GA 2DPNA 1JCFA 3NAEA 4DUZK 4CEQA 3OS0A 1WOQA 4MO4A 1RBRA 1WBDA 4Z4CA 3MAQA 3CCLN 3M6GA 1NK6A 4U67L 1C1AA 3MEEA 1IO2A 1T6CA 3U6FA 4BC4A 3LDNA 1UA0A 4BR0A 4RW9A 1WBBA 4IOCL 3KTQA 2EWSA 1NU0A 3WXJA 3NFAA 3RSEB 2DFEA 5BRDA 1DEJA 3MMVA 5AQLA 2UXBK 3ULDA 4DU1A 3V9WA 2PY5A 2YJEA 3WXIA 3LZJA 1RGIA 1SQKA 1IKVA 2NRRA 4ELTA 3DXKB 4FLXA 4ZHRA 3KKSA 3O4NA 4E1NA 3C0BA 3CJ7A 2WTUA 4A59A 3TAFA 3KK2A 1W7AA 1TK8A 4OPJA 3VF2A 2BDPA 1WNSA 3R8EA 5GADP 2CGLA 2ITMA 1HKGA 1C0TA 1NJXA 4EHUA 3H08A 5BR8K 1G15A 3SV4A 5GAGP 4CK3A 2E4LA 5CE3A 4BROA 4KHUA 3SCXA 3LALA 4A5AA 3TAPA 4E7HA 2KW4A 3CFRA 4B8CA 3VPZA 3VA3A 1NWKA 4DSFA 3O4WA 1SL1A 1LAVA 1TKDA 1KRPA 1GOBA 3VEOA 3NHGA 2ZJPL 4H0OA 1U48A 3UKRA 3LANA 3H45C 1FJGK 3DLEA 5JICA 5HRSA 3VEYA 4JKGB 1NBWA 4KRFA 3K57A 3CETA 3TSPA 1ITGA 4DSEA 3MN9A 2PYJA 3AVFA 2IGIA 1HRHA 2P9IB 4CF0A 4AM6A 3MN6A 3PUFA 3UB5A 3CC2N 4F3OA 4H0VB 3D0PA 4DLEA 1B9FA 2I5JA 4BRIA 2KTQA 4WFAL 3V1RA 5CYMA 1JLEA 4DSIA 4CJLA 3AO4A 3C6TA 5KPZA 4DFJA 3VQPA 3SQ2A 3I33A 1S1TA 1U47A 2QK9A 5M1FA 2RKIA 3HM9A 2HHHK 5DMRA 4E3SA 3O08A 3AARA 1WSHA 2G8KA 3ATUA 4CW7B 2E6LA 1CXQA 4K0KK 1U2VA 1LOTB 4I7FA 3KK3A 5GAHP 4JHDB 1R59O 4BRGA 3J7ZO 4NLCA 3U3GA 2ITGA 4FK0A 1BHLA 1JXBA 3CI5A 3ZSYA 4YY3K 4B9VA 4BDPA 1L5UA 1EWQA 2O8CA 1HX1A 3MECA 2HOEA 3RWUA 4W5OA 4WE1A 3ASMA 1L3SA 5EXWA 1BQMA 4A2BA 3DLLL 3KKRA 3L2RA 3KZBA 5KTQA 3LWMA 3KLEA 1ZYQA 3K59A 4HUEA 4FVMA 4XH5A 2OZMA 1U45A 1EETA 2HHQA 3RR7A 3SAGA 4IOXA 1FK9A 1VK0A 3VTHA 1S6QA 2CH5A 4PA1A 1RT5A 4MDBA 1S1VA 2A3ZA 3SMPA 3AVMA 4F4KA 4DV4K 4LF4K 3O8MA 4B9LA 4DV5K 4KI4A 4ILJA 2Q1NA 4KHQA 4BR4A 3NF9A 4GY2B 1EP4A 3O6WA 4FWQA 2HNDA 3NH1A 2KKZA 3SPYA 1Q9YA 1YJNN 4M41A 3QEPA 3VEVA 3TAGA 4BRMA 4C1NI 1NK5A 2OTJN 2VGMA 1JKHA 1T3VA 3DRPA 4ELUA 2VGNA 4FCYA 3SJJA 4FWOA 3OBWA 2X78A 4CI6A 3HO1A 4FZXC 3DLGA 4CGIA 5AQWA 4IG3A 4BVPA 2W41A 5FROA 1VSJA 5M1QA 4B9QA 2WONA 2FF6A 5HRRA 3F9KA 3MX5A 1W0HA 1RCHA 1NK4A 3WNFA 3HBTA 4MO5A 1HJOA 1NGGA 2XY5A 4AF1A 3O1BA 2YNIA 2GUPA 2F96A 3EN9A 4OO1J 4AHVA 4FWRA 3OYBA 1RT3A 4C1NK 1BWFO 2XY6A 1YHQN 1FXXA 3S3NA 1KVAA 2XY8A 3BEXA 1HKCA 5M1KA 1BIUA 1UWBA 3SV3A 5AZJA 1T6DA 3A5NC 5GIOA 3TARA 3T1YK 1SL2A 3ZX3A 4N41A 2E8AA 4B1YB 2FXUA 2HVIA 3B8AX 2O8EB 3MN7A 1Z25A 3MXMA 5AQPA 4DMNA 2XO7A 1OKJA 3SUNA 1Q9XA 3W0LA 2B6AA 3O3HA 1DT9A 4DTMA 2G8WA 3G4SN 4GVEA 4BR9A 3RMDA 1NOZA 3VQ6A 3QESA 1Q86O 3A0IX 5EX5A 4QS8A 4GMJB 3FLCO 4H5RA 4CK1A 1TK5A 3B6PA 3QICA 2Y1IA 4DQQA 3HP9A 4LY7A 3WQUA 3IFRA 1SV5A 1QSSA 4W5RA 1RT6A 5LMUK 1RT7A 1IBKK 4CJKA 4XH1A 1ZBLA 3TI0A 2P9NA 3PX4A 1TYQA 2VWJA 3D2EA 4Y1CA 1JLBA 3CM5A 3WEEA 3HVRA 3LDOA 4FPBA 2HHUA 1ZC6A 3NH2A 3AAPA 4UY8O 3CCVN 1Y64A 4IFYA 4BRKA 2ZGYA 3LWLA 4L8RB 4FWKA 4CGDA 4KI6A 2ZQBA 4JAXA 3DXMA 5HOOA 2FBYA 4OKJA 1K73O 4HUGA 1DKGD 3CJ9A 4CE9A 3M3ZA 3LPUA 4BDYA 2V52B 1XNRK 4YOVA 4DFKA 1EWRA 1YUWA 1OVYA 2W40A 3PO4A 1GLJO 2Q0UA 3VETA 1NM1A 4H5WA 2Q31A 4ID1A 3D2FB 3CFOA 1NGCA 1QQCA 2P9PA 1X3NA 4CJRA 3J8AA 1KAZA 2O4IA 3MEGA 3T1HK 1NKCA 4BE2A 2E5LK 3V4IA 2O8FA 4OKEA 3WQTA 1VQ6N 3MEDA 3K9KA 3J7AP 1BA0A 1ATSA 3UE5A 4AHUA 4CESA 3ID8A 3UKUA 1LCUA 3CYMA 5AQXA 1NNEA 3LM9A 4CF8A 4CZHA 4FXDA 3DMJA 4FL9A 3T7ZA 4YOXA 3HRGA 5AQVA 3P38A 3QO9A 1MWKA 3CQXA 5ADXH 1G99A 5AQNA 1FKPA 4FW2A 3MX2A 1TL3A 4B9SA 5KPTA 3ZSZA 2DTUA 4RW4A 3HL8A 4AILC 2HBJA 4OLBA 4CZJA 4B3OA 3VOVA 3CJBA 4JS5A 1LV5A 3ZT0A 3DRRA 4CHYA 3V9SA 3QIOA 3FZKA 2ZWHA 3IG1A 4OLAA 1V4TA 3TPQA 2XHBA 1EO1A 2E2PA 4E1JA 1D9DA 3AO5A 2I7PA 4CF9A 3PV8A 4JD2A 4YNQA 3AAQA 1QE1A 4FM0A 5J2QA 4WCEL 2Q2RA 4BREA 4CJ5A 2VQEK 2HHXA 2W6KA 4B1XB 3OW2M 2YNFA 3HZ6A 4LF6K 1C1CA 3G0ZA 3THWB 1QQOA 3LP3A 5I42A 5E26A 3LM2A 3C6UA 1VRUA 1N34K 1VQLN 3MXJA 1JL1A 1O1WA 4KB1A 2NRZA 4CGGA 4E89A 4CHNA 2G8HA 1HNXK 3CCQN 4YHHK 5KPRA 4K8ZA 3CPEA 1V4SA 4M3ZA 5IWAK 1L3UA 4OX9K 2Z1GA 2BGGA 3VQ4A 3L0QA 2FSNA 3ID6A 4BWMA 3ZT3A 2E6MA 5C25A 1WAJA 1HR0K 4KTZA 3OYLA 1S9GA 5H1SQ 1Q82O 2G8VA 1X1PA 3UKRB 2FLOA 1C1BA 2BH1A 2KLAA 4F3TA 2WFBA 3EE9A 3IDHA 4B08A 1RDDA 3I0SA 4AM7A 5AQQA 4CJSA 1S1UA 1U4BA 3M8SA 4IKFA 3O80A 1KFSA 3LAKA 3DLHA 3BDPA 3KWIA 3EZWA 3VEWA 1IKXA 1BOTO 3V9ZA 4BC3A 2P9SA 2QW9A 3O1WA 3P39A 1YTAA 4CCHA 4FJXA 4KH4A 3O9RA 4CJUA 2BANA 1HJRA 4N56A 1DLOA 1LWFA 4WQ5C 5KI6A 3BZCA 4ISFA 3H46O 3AO3A 3LDSA 1YJWN 4M3YA 1U2VB 3KK1A 1SKRA 3L2QA 4DTUA 1VQ5N 4CK2A 1NGBA 4CGJA 5M1PA 4O0IA 3B6OA 3A5OC 4YOYA 4JI3K 2O8CB 3AVJA 3N4PA 3K0SA 5FPDA 4B3TK 1ZBUA 3HI0A 1W9HA 3DWLA 3FZFA 2F9WA 4DR6K 3I0RA 4W5TA 4QAGA 4DV3K 4RW7A 3JYTA 1S3XA 1YXQA 4N5SA 2RF2A 3HSCA 4H03B 3ZSOA 3VQAA 1OVQA 3H1VX 2OPSA 4H8KA 2OCEA 4Z94A 4E0DA 4E19A 1WN7A 4WQ4A 5AQKA 3HK2A 1CZ9A 4JS4A 4FJ5A 4AQYK 1O13A 4NYFA 4BC5A 3NF8A 1IG9A 4CFAA 2G8UA 1EKEA 4CZEA 1SS6A 3VGMA 4B1UB 3QFUA 1S22A 2UYTA 4NCAA 4C23A 1BG3A 3SBGA 3EL2A 3DLBA 4MLEA 2WUSA 1SAZA 3HYFA 5AQIA 3K9JA 2E1YA 1BISA 3HP6A 4FWPA 2GELA 1A5VA 2A40A 1CZBA 3MCPA 4CFBA 2D1KA 4FJ7A 4JYAK 2VWBA 5HRPA 2UXCK 4EHTA 4LC9B 2DFHA 4O55A 3ALYA 2IC3A 5DK5A 4PL7A 3IAYA 5IT9O 3AY9A 4ZTJA 1VQ7N 1RTHA 1K8KA 3E9PA 1BCMA 4CGFA 2JWLA 3JS6A 3H1QA 4NCBA 4K43A 3L4IA 4JKAA 1XMOK 4HWIA 5AQMA 4X64K 5BN8A 4KHYA 1Z6RA 3H6EA 3SLCA 1JLQA 1BUPA 3QNOA 3THVA 2Q36A 3VEZA 3C7NA 2IDOA 2LSNA 4W5NA 3GG4A 1TUUA 2D4WA 2B5JA 1M90O 5AZJB 2GBZA 4I6MB 1QVGM 3NE6A 4LH5A 3VMFB 2NRWA 1RBVA 3PIOL 4B9MA 3L3VA 4EFHA 1TKZA 2HHVA 3KLIA 4DTNA 1JL2A 5FRNA 2QWQA 2Y1JA 1L3VA 3U9ZA 2O8DA 4FJJA 1RDWX 3QEIA 3OS2A 2XY7A 4BRQA 3EKSA 3TU5A 4DV0K 1X9WA 2Q0RA 1N8RO 1YI2N 4CECA 5BRHA 3J80O 3E9LA 3TTCA 3IMXA 3PY8A 3TAQA 2CGJA 2PAVA 4PWDA 4JK9A 3SQ1A 4DR7K 4RW8A 1RBSA 1HPMA 5JVHL 4N47A 4FYDA 2NLXA 4DQSA 3KHYA 1T03A 3IRXA 3GE1A 4FJHA 1Y97A 4FVUA 3L2VA 2P9NB 4H0TB 3I8DA 2UUCK 2Q97A 5AQSA 2B4JA 4F9OA 3C6HA 4M7XA 1TYQB 3OYAA 3D2EB 4GV9A 3R3LA 1XHZA 1NK7A 3Q7CA 2DFFA 1IKYA 1R0AA 3VERA 1T8EA 3VGKA 3NCIA 1KFDA 2OTLN 1J54A 3SZ2A 3T1AA 1TVRA 1RDBA 3F2KA 3HPGA 3ZCMA 1B9DA 2AP1A 3V9UA 5HROA 1RTJA 4Y1DA 2BTFA 3V6DA 3CCSN 4WQ5A 5TKWA 1TK0A 1REVA 4JNEA 3SI6A 1J5OA 3TAEA 1X9MA 4FO0A 3TTFA 4E1MA 4JKBA 3V81A 3M5RA 2I7NA 2P9PB 2QWMA 2A41A 1Z05A 3FR0A 4JK8A 4PKIA 4C8MA 1TGOA 3HOSA 3AO1A 4CJFA 2ASOA 1KLNA 5CR4A 3OYNA 3AO2A 2A5XA 3VQBA 2E2NA 3G71N 4H5VA 4F2SA 2QKKA 2O8FB 4PKHA 1GLBG 3ULEA 4A62A 1GLAG 2YHBA 2VWKA 4X62K 3VQDA 4QCLA 1CXUA 4EZ6A 1XWLA 4DSLA 3NF6A 3UKUB 3EZ5A 3FFKB 4GNIA 5FPEA 4FLVA 3FZHA 3SUQA 3FE1A 1XQSC 4FZYA 1HYZA 4QOZB 3BUZB 4GKJK 2JWKA 3P4IA 3VQ8A 3VGLA 3ZT4A 1OH6A 4JI2K 3L8BA 3DM2A 2IOCA 4I2PA 4DS5A 4JKCA 1ZXOA 4LF8K 4FWLA 1BU6O 3HXMA 4CIFA 1M1KO 3UIQA 3OS1A 3BGRA 1KVCA 1A5WA 2GEMA 3HM8A 1EXQA 4BRDA 4AHCA 4KHPK 3PO5A 3L2WA 1YT3A 4JD2B 2HBLA 4H4MA 5AFUA 3AVNA 3T19A 1VRTA 2YKMA 1KLMA 1IBMK
chains in the Genus database with same CATH topology
2VCPA 5C0YA 3QBWA 3JXUA 3D2FA 3MX2A 3O9QA 4DCHA 5KPTA 3TSUA 3WXMB 1NGAA 3CCRN 1NGDA 1KQSM 5MLCQ 2GX9A 2ASPA 2ZJRL 3I56N 5LJVA 1XUPO 2GWJA 3A8YA 4H5TA 4BGAA 2HBJA 3E1YA 4JK7A 3MN5A 4A5BA 4CZJA 3GDQA 3VOVA 3CJBA 4JEPA 4RWTA 3FGUA 2IIRA 3WEEB 3CIPA 5AQTA 1JJ2M 1KXPA 3PLAA 4XH4A 4FWNA 4M63C 3DAWA 2ZGZA 2ZWHA 3FZKA 3LDQA 4IZ9A 4MDAA 5FPMA 4CZLA 1V4TA 3TPQA 3VENA 3CXCM 4IO9L 1KAYA 4O5FA 2E2PA 1EO1A 4E1JA 1T44A 2I7PA 1X9JA 1JCEA 2QWLA 4FPAA 4JD2A 4GV3A 3AAQA 3MWTA 4PL8A 3LDLA 5ADXH 4WCEL 5B8HA 2Q2RA 3DXMB 4OPHA 4B1ZA 4BREA 1YITN 4IXCA 4ISGA 2CGKA 4YOWA 4B1XB 3IUCA 2DPNA 3OW2M 1JCFA 3HZ6A 1QZ5A 1W2BM 5BR9A 1QQOA 4BQZA 4JKDA 1WOQA 4MO4A 4YDUC 3LM2A 5E26A 5EOYA 5JLFA 3CCLN 3M6GA 4U67L 1VQLN 3CMAN 1T6CA 1QHAA 2V51B 4BC4A 3LDNA 4PHTX 4BR0A 4BG8A 2NRZA 2HBMA 3CQYA 4IOCL 5KQ8A 2EWSA 3WXJA 2P9SB 3CCQN 3RSEB 5KPRA 5KQDA 2J4RA 3AGKA 2E20A 1YF5L 1V4SA 3CPEA 5BRDA 1DEJA 2YHWA 5BPNA 3MMVA 4QS9A 5AQLA 2D0PA 3LL3A 3L0QA 3SAHA 2QTDA 2FSNA 3ID6A 4CZFA 2YJEA 1QZ6A 5EVZA 3IKMA 3WXIA 1RGIA 1SQKA 4WQ4C 2NRRA 3O9UA 2WC9A 3DXKB 5H1SQ 1Q82O 5AQYA 1ILYA 2P9UB 3UKRB 2FLOA 3C0BA 3CJ7A 3CHWA 5M1OA 2BH1A 2KLAA 4A59A 2WFBA 3EE9A 1VQKN 1GLDG 1GLLO 3IDHA 1U6ZA 2D0OA 3FZMA 4AM7A 3AGRA 4O8KA 4CZIA 5GIPA 2NRVA 3W3DA 2AA4A 5AQQA 3O9SA 3VF2A 1X3MA 3CC4N 2QWRA 4CBWA 3R8EA 2QWOA 3O80A 5GADP 3L6QA 2CGLA 3BP8A 2ITMA 3KWIA 1HKGA 3EZWA 4QS7A 2HF4A 2OANA 3VEWA 3ZETB 4EHUA 1BOTO 5F1XA 4BC3A 2P9SA 2QW9A 3GOIA 3RSEA 3O1WA 3P39A 5GAGP 4KH4A 5CE3A 3O9RA 4BROA 5DM6L 5C10A 4JKEA 4A5AA 3HTVA 4H0XB 2IVPA 5E84A 4A57A 3VPZA 1WUAA 1NWKA 4WQ5C 3O4WA 3CJAA 3EE8A 3TTDA 4ISFA 3H46O 1BO5O 5BPMA 1YJWN 3DXKA 2PBDA 3VEOA 2ZJPL 4H0OA 2P9UA 3UKRA 2HSTA 3U4LA 1U2VB 4JKFA 3H45C 5EY4A 1NGIA 5JICA 3VEYA 4JKGB 1NBWA 5HL7L 4BGBA 3G25A 1VQ5N 3CETA 1NGBA 2IVNA 3TSPA 3MN9A 2ZF5O 4CD1A 5M1PA 3WT0A 2P9IB 3A5OC 4YOYA 4AM6A 1K8AO 3MN6A 2QWNA 3UB5A 1P8ZA 3CC2N 3VESA 3N4PA 5C15A 3ZYYX 3WXKA 4H0VB 5FPDA 3SMSA 3ZETA 1VQ9N 2QWPA 5ADXA 3HI0A 4BRIA 4RTFD 3BF3A 5AQNA 3DWLA 3FZFA 2F9WA 4WFAL 1ATNA 3LDPA 4IEEA 4G9ZA 3I55N 5KPZA 1NGEA 1S3XA 1QQNA 1Q7YO 1YXQA 3I33A 2GWKA 4KBOA 5JMVA 3HSCA 4I6MA 4H03B 4RCHA 3TSQA 5M1FA 1MDUB 2QA4N 1YIJN 4KH5A 3D7EO 3H1VX 5C2FA 3O08A 5M1NA 3MK6A 3AARA 4Z94A 2V7ZA 2WBNA 2A6AA 3QDKA 4WQ4A 3ATUA 5AQKA 1U2VA 1QVFM 5BREA 1O13A 1LOTB 4BC5A 4GV6A 1HLUA 4BR2A 4JKGA 5AQJA 5GAHP 4JHDB 1R59O 4CZEA 4CZGA 4BRGA 4CD3A 3J7ZO 1SS6A 2BUPA 1J6ZA 3MWPA 4NLCA 3VGMA 3VF6A 4B1UB 3CI5A 3WXLA 4BG9A 1Q18A 2YI1A 3QFUA 1S22A 2UYTA 4C23A 2P9IA 1BG3A 3KK7A 2H3GX 3SBGA 1BA1A 3EL2A 4ILHA 1HX1A 2HMPA 3O5BA 1P90A 5C12A 4MLEA 2WUSA 1SAZA 5AQIA 2E88A 4WYBA 1GLCG 2HOEA 3C6AA 3K9JA 1RDUA 5EXWA 4A2BA 3DLLL 2E1YA 3KZBA 4ISEA 5AQHA 4A2AA 4FWPA 2GELA 3E66A 5AR0A 4XH5A 4MLHA 3ZEUB 2A40A 3R9PA 3MCPA 1YAGA 2P9KB 2D1KA 2F9TA 1IG8A 2VWBA 2FSJA 3SAGA 2ASMA 4IOXA 4EAHD 5JVGL 3VTHA 2CH5A 1Q81O 4IO8A 4EHTA 3HOTA 4LC9B 4WF9L 4MDBA 4YORA 2A3ZA 1VQPN 3SMPA 4NO7A 5AZIB 3O8MA 1HKBA 4FOEA 4DHYA 3C65A 4ILJA 4BRPA 3OHRA 2Q1NA 4JHDA 4PL7A 4CBXA 4BR4A 3AY9A 1NGJA 1VQ7N 1HUXA 2P9LB 1K8KA 3E9PA 1ZBSA 4GY2B 3O6WA 4FWQA 2JWLA 3JS6A 2KKZA 1E4FT 3H1QA 4K43A 3H3OB 4B1WB 1YJNN 3L4IA 4CZMA 4JKAA 3VEVA 3P31A 4BRMA 4C1NI 4HWIA 5AQMA 5BN8A 4H5NA 3G6EN 1Z6RA 3CCUN 1NGFA 3PIPL 4DKWA 3H6EA 3SLCA 5BN9A 5GAEP 1RFQA 2YHYA 4A61A 2OTJN 3GBTA 1BUPA 4BRHA 2VGMA 5LY3A 1BDGA 2Q36A 3VEZA 1T3VA 3ZEUA 2P9KA 3C7NA 2VGNA 3ATVA 2NRTA 4FWOA 3GG4A 4PKGA 1TUUA 2D4WA 1CZAN 3OBWA 4BVOA 4CI6A 1M90O 5AZJB 3VF4A 4FSVA 1KC8O 4IWVA 1W97L 4I6MB 4WFBL 1QVGM 2HBKA 3SJHA 4KH6A 5AQWA 4BVPA 2W41A 5AZIA 3SAFA 3BF1A 3FZLA 5M1QA 4B9QA 3VMFB 3F5TA 2FF6A 2NRWA 5DM7L 3PIOL 1NJIO 2E2QA 4EFHA 3U8XA 5AQUA 3MX5A 2P9LA 4BC2A 2QWQA 2V7YA 3U9ZA 4BQLA 3HBTA 4BRLA 1RDWX 4MO5A 1HJOA 1NGGA 1MA9B 2A42A 2NZTA 3QB0A 4IEIA 4YDUA 4BRQA 3EKSA 3TU5A 4AF1A 2Q0RA 3O1BA 5TKYA 5CHIA 1N8RO 5AQFA 1YI2N 2GUPA 4OPAA 3SBTA 3EN9A 5BRHA 4OO1J 3E9LA 5AFUH 3TTCA 4FWRA 4B1VA 3IMXA 4C1NK 1BWFO 2CGJA 4BRFA 4IJAA 1YHQN 3CJ1A 3ENHA 2PAVA 2VYPA 1YVNA 3BEXA 3R6MA 1HKCA 2E2OA 1K9MO 5M1KA 2NNWA 1S72N 3T69A 2CH6A 4JK9A 4IOAL 5AZJA 1T6DA 3A5NC 5JLHA 1HPMA 5GIOA 2E1ZA 5JVHL 2FF3B 4IJNA 3CC7N 2QXLA 2NLXA 3ZX3A 5AQZA 3KHYA 2E8AA 2HF3A 4B1YB 2FXUA 3B8AX 4WFNL 3MN7A 2QEXN 3GE1A 4BRCA 5AQPA 4K41A 4FVUA 1OKJA 2P9NB 1NGHA 4H0TB 3W0LA 2YX6A 5AQOA 2Q97A 5LJWA 1SZ2A 1DT9A 5AQSA 4F9OA 1GLFO 3SK3A 3WUHA 4BRAA 1YJ9N 1E4GT 3C6HA 4M7XA 1TYQB 4GVEA 3G4SN 4FWSA 3D2EB 4BR9A 4GV9A 1K8KB 3R3LA 5ELZA 2KHOA 3Q7CA 4YOUA 3S41A 4R79A 3KVGA 1Q86O 4H0PA 2YJFA 4K25A 3MCAB 3A0IX 3VERA 5EX5A 4QS8A 3VGKA 1ATRA 3ULEB 3CD6N 3VEXA 3FLCO 4H5RA 4K42A 1DGKN 3O9TA 4EIAA 2NRHA 2OTLN 3QICA 3NVMA 4NLBA 3F2KA 3CERA 4FOIA 3WQUA 2PFUA 3IFRA 1JCGA 1TUYA 2IVOA 4CJ7A 3GL1A 2AP1A 1ESVA 3A5MC 4XEIA 4L3QA 2BTFA 3C7NB 1KAXA 1D4XA 5FPNA 4CBUA 3ZX0A 3MDQA 5F2RA 4XH1A 3CCSN 4WQ5A 1C0FA 3ENBA 5TKWA 3R1XA 3QFPA 4JNEA 3OA9A 4CZKA 3ZX2A 4DB3A 4J8FA 5F0XA 2P9NA 4JKHA 1C0GA 4FO0A 3TTFA 4JKBA 3ENOA 3M5RA 2I7NA 2P9PB 2QI2A 1NMDA 2QWMA 2A41A 1Z05A 1TYQA 3FR0A 4JK8A 4PKIA 3CF5L 4O8UA 4BY9C 3D2EA 3I8BA 1VQNN 3HOSA 2ASOA 5CR4A 3WEEA 2A5XA 2E2NA 3G71N 1H1VA 3LDOA 4FPBA 4H5VA 1KD1O 1ZC6A 2F7TA 1XC3A 3AAPA 4PKHA 1GLBG 3ULEA 3CCMN 4UY8O 4A62A 3CCVN 1Y64A 3U9DA 1QQMA 4BRKA 1VQMN 1GLAG 2ZGYA 3CMEN 5I9EB 3DJCA 1VQON 4FWKA 4HTLA 4JAXA 2RHKA 3DXMA 5HOOA 1K73O 1DKGD 3CCEN 1VQ4N 3UKUB 3CJ9A 1VAZA 3FFKB 3M3ZA 4FWMA 4GNIA 5AQRA 5FPEA 5GINA 3FZHA 4U7BA 2V52B 4YOVA 3FE1A 1XQSC 1YUWA 4M7YA 4ILGB 1OVYA 3BUZB 2YHXA 2W40A 1GLEG 1GLJO 2JWKA 2Q0UA 3L4QA 3M1FA 3P4IA 4JN4A 3F9MA 3VETA 3VGLA 1NM1A 4H5WA 2Q31A 2RE2A 4BR5A 3D2FB 1VQ8N 2YCHA 1NGCA 5BRFA 2P9PA 1X3NA 3CJCA 3E9OA 2ZJQL 3NVKA 4H0YB 3J8AA 4JKCA 1ZXOA 4YOTA 3EO3A 1KAZA 4FWLA 1BU6O 3NMUA 2QM1A 2FSKA 3KWGA 1M1KO 3WQTA 1NLVA 3A5LC 1VQ6N 3K9KA 5AQGA 1BA0A 1ATSA 2GEMA 3HM8A 3QMLA 4NB4A 4BRDA 1IJJA 3UE5A 1EQYA 3ID8A 4IDHA 4DQ8A 3D6RA 3H3NO 4JD2B 3QBXA 3RVCA 1LCUA 3UKUA 5C2DA 2HBLA 5AQXA 3Q7BA 3LM9A 5BPLA 4CZHA 5AFUA 3EKUA 3CCJN 4FL9A 3T7ZA 3N4QA 3HRGA 2NRXA 4YOXA 4BR7A 5AQVA 3P38A 1MWMA 2GTDA 1MWKA 3CQXA 4Y0WA 4BRNA 3OBYA 1G99A 3CPWM 3VTIA 4IFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCP A;  3QBW A;  3JXU A;  3D2F A;  4DCH A;  5KPT A;  1NGA A;  1NGD A;  2ASP A;  5LJV A;  1XUP O;  2GWJ A;  3A8Y A;  4H5T A;  4BGA A;  3MN5 A;  4CZJ A;  3GDQ A;  3VOV A;  3CJB A;  4RWT A;  3FGU A;  2IIR A;  3WEE B;  3CIP A;  5AQT A;  1KXP A;  4XH4 A;  4FWN A;  4M63 C;  3DAW A;  2ZGZ A;  2ZWH A;  3FZK A;  3LDQ A;  4IZ9 A;  5FPM A;  4CZL A;  1V4T A;  3TPQ A;  3VEN A;  1KAY A;  4O5F A;  2E2P A;  4E1J A;  1T44 A;  2I7P A;  1X9J A;  1JCE A;  2QWL A;  4FPA A;  4JD2 A;  3AAQ A;  5B8H A;  4PL8 A;  3LDL A;  2Q2R A;  3DXM B;  4B1Z A;  4BRE A;  4IXC A;  4ISG A;  2CGK A;  4B1X B;  3IUC A;  2DPN A;  1JCF A;  3HZ6 A;  1QZ5 A;  5BR9 A;  1QQO A;  4BQZ A;  1WOQ A;  4MO4 A;  4YDU C;  3LM2 A;  5E26 A;  5EOY A;  5JLF A;  3M6G A;  1T6C A;  1QHA A;  2V51 B;  4BC4 A;  3LDN A;  4BR0 A;  4BG8 A;  3CQY A;  5KQ8 A;  2EWS A;  3WXJ A;  2P9S B;  3RSE B;  5KPR A;  5KQD A;  2J4R A;  2E20 A;  1V4S A;  5BRD A;  1DEJ A;  2YHW A;  5BPN A;  3MMV A;  4QS9 A;  5AQL A;  2D0P A;  3LL3 A;  3L0Q A;  2FSN A;  4CZF A;  2YJE A;  1QZ6 A;  5EVZ A;  3WXI A;  1RGI A;  1SQK A;  4WQ4 C;  3DXK B;  5AQY A;  2P9U B;  3UKR B;  2FLO A;  3C0B A;  3CJ7 A;  3CHW A;  1GLD G;  1GLL O;  3IDH A;  1U6Z A;  2D0O A;  3FZM A;  4AM7 A;  4O8K A;  4CZI A;  3W3D A;  2AA4 A;  5AQQ A;  3VF2 A;  1X3M A;  2QWR A;  4CBW A;  3R8E A;  2QWO A;  3O80 A;  3L6Q A;  2CGL A;  3BP8 A;  2ITM A;  1HKG A;  3EZW A;  4QS7 A;  2HF4 A;  2OAN A;  3VEW A;  3ZET B;  4EHU A;  1BOT O;  5F1X A;  4BC3 A;  2P9S A;  2QW9 A;  3GOI A;  3RSE A;  3O1W A;  5CE3 A;  4BRO A;  3HTV A;  4H0X B;  2IVP A;  5E84 A;  3VPZ A;  1WUA A;  1NWK A;  4WQ5 C;  3O4W A;  3CJA A;  4ISF A;  3H46 O;  1BO5 O;  5BPM A;  3DXK A;  2PBD A;  3VEO A;  4H0O A;  2P9U A;  3UKR A;  3U4L A;  1U2V B;  3H45 C;  5EY4 A;  1NGI A;  5JIC A;  3VEY A;  1NBW A;  4BGB A;  3G25 A;  3CET A;  1NGB A;  2IVN A;  3MN9 A;  2ZF5 O;  4CD1 A;  3WT0 A;  2P9I B;  3A5O C;  4AM6 A;  3MN6 A;  2QWN A;  3UB5 A;  1P8Z A;  3VES A;  3WXK A;  4H0V B;  5FPD A;  3SMS A;  3ZET A;  2QWP A;  5ADX A;  3HI0 A;  4BRI A;  4RTF D;  3BF3 A;  3DWL A;  3FZF A;  2F9W A;  1ATN A;  3LDP A;  5KPZ A;  1NGE A;  1S3X A;  1QQN A;  1YXQ A;  3I33 A;  2GWK A;  4KBO A;  5JMV A;  3HSC A;  4I6M A;  4H03 B;  4RCH A;  1MDU B;  3D7E O;  3H1V X;  3O08 A;  3MK6 A;  3AAR A;  4Z94 A;  2V7Z A;  2A6A A;  3QDK A;  4WQ4 A;  3ATU A;  5AQK A;  1U2V A;  5BRE A;  1LOT B;  4BC5 A;  1HLU A;  4BR2 A;  5AQJ A;  4JHD B;  1R59 O;  4CZE A;  4CZG A;  4BRG A;  4CD3 A;  2BUP A;  1J6Z A;  3VGM A;  3VF6 A;  4B1U B;  4BG9 A;  3CI5 A;  3WXL A;  1Q18 A;  2YI1 A;  3QFU A;  1S22 A;  2UYT A;  4C23 A;  2P9I A;  1BG3 A;  2H3G X;  1BA1 A;  3EL2 A;  1HX1 A;  2HMP A;  3O5B A;  4MLE A;  2WUS A;  1SAZ A;  5AQI A;  2E88 A;  4WYB A;  1GLC G;  2HOE A;  5EXW A;  4A2B A;  2E1Y A;  3KZB A;  4ISE A;  5AQH A;  4A2A A;  4FWP A;  2GEL A;  5AR0 A;  4XH5 A;  4MLH A;  3ZEU B;  2A40 A;  3R9P A;  3MCP A;  1YAG A;  2P9K B;  2D1K A;  2F9T A;  1IG8 A;  2VWB A;  2FSJ A;  2ASM A;  4EAH D;  2CH5 A;  4IO8 A;  4EHT A;  4LC9 B;  2A3Z A;  3SMP A;  4NO7 A;  5AZI B;  3O8M A;  1HKB A;  4FOE A;  4DHY A;  4BRP A;  3OHR A;  2Q1N A;  4JHD A;  4PL7 A;  4CBX A;  4BR4 A;  3AY9 A;  1NGJ A;  1HUX A;  2P9L B;  1K8K A;  4GY2 B;  1ZBS A;  3O6W A;  4FWQ A;  3JS6 A;  1E4F T;  3H1Q A;  4K43 A;  3H3O B;  4B1W B;  3L4I A;  4CZM A;  3VEV A;  4BRM A;  4HWI A;  5AQM A;  5BN8 A;  4H5N A;  1Z6R A;  1NGF A;  3H6E A;  3SLC A;  5BN9 A;  1RFQ A;  2YHY A;  4A61 A;  3GBT A;  1BUP A;  4BRH A;  5LY3 A;  1BDG A;  2Q36 A;  3VEZ A;  3ZEU A;  2P9K A;  3C7N A;  3ATV A;  4FWO A;  3GG4 A;  4PKG A;  1TUU A;  2D4W A;  1CZA N;  4BVO A;  4CI6 A;  5AZJ B;  3VF4 A;  4FSV A;  4IWV A;  4I6M B;  3SJH A;  5AQW A;  4BVP A;  2W41 A;  5AZI A;  3BF1 A;  3FZL A;  4B9Q A;  2FF6 A;  2E2Q A;  4EFH A;  3U8X A;  5AQU A;  2P9L A;  4BC2 A;  2QWQ A;  2V7Y A;  3U9Z A;  4BQL A;  3HBT A;  4BRL A;  1RDW X;  4MO5 A;  1HJO A;  1NGG A;  1MA9 B;  2A42 A;  2NZT A;  3QB0 A;  4YDU A;  4BRQ A;  3EKS A;  3TU5 A;  2Q0R A;  3O1B A;  5TKY A;  5AQF A;  2GUP A;  3EN9 A;  5BRH A;  5AFU H;  4FWR A;  4B1V A;  3IMX A;  1BWF O;  2CGJ A;  4BRF A;  4IJA A;  3CJ1 A;  3ENH A;  2PAV A;  2VYP A;  1YVN A;  3BEX A;  3R6M A;  1HKC A;  2E2O A;  2CH6 A;  5AZJ A;  1T6D A;  3A5N C;  5JLH A;  1HPM A;  2E1Z A;  2FF3 B;  4IJN A;  2QXL A;  2NLX A;  3ZX3 A;  5AQZ A;  3KHY A;  2E8A A;  2HF3 A;  4B1Y B;  2FXU A;  3B8A X;  3MN7 A;  3GE1 A;  4BRC A;  5AQP A;  4K41 A;  1OKJ A;  2P9N B;  1NGH A;  4H0T B;  3W0L A;  5AQO A;  5LJW A;  2Q97 A;  1SZ2 A;  5AQS A;  4F9O A;  1GLF O;  3SK3 A;  3WUH A;  4BRA A;  1E4G T;  4M7X A;  1TYQ B;  4FWS A;  3D2E B;  4BR9 A;  1K8K B;  5ELZ A;  2KHO A;  3S41 A;  3KVG A;  4H0P A;  2YJF A;  4K25 A;  3A0I X;  3VER A;  5EX5 A;  4QS8 A;  3VGK A;  1ATR A;  3ULE B;  3VEX A;  3FLC O;  4H5R A;  4K42 A;  1DGK N;  4EIA A;  2NRH A;  3QIC A;  3CER A;  4FOI A;  3WQU A;  3IFR A;  1JCG A;  1TUY A;  2IVO A;  4CJ7 A;  3GL1 A;  2AP1 A;  1ESV A;  3A5M C;  4XEI A;  4L3Q A;  2BTF A;  3C7N B;  1KAX A;  1D4X A;  5FPN A;  4CBU A;  3ZX0 A;  3MDQ A;  5F2R A;  4XH1 A;  4WQ5 A;  1C0F A;  3QFP A;  4JNE A;  4CZK A;  3ZX2 A;  4DB3 A;  4J8F A;  5F0X A;  2P9N A;  1C0G A;  4FO0 A;  3ENO A;  2I7N A;  2P9P B;  1NMD A;  2QWM A;  2A41 A;  1Z05 A;  1TYQ A;  3FR0 A;  4PKI A;  3D2E A;  3I8B A;  2ASO A;  3WEE A;  2A5X A;  2E2N A;  1H1V A;  3LDO A;  4FPB A;  4H5V A;  1ZC6 A;  1XC3 A;  3AAP A;  4PKH A;  1GLB G;  3ULE A;  4A62 A;  1Y64 A;  3U9D A;  1QQM A;  4BRK A;  1GLA G;  2ZGY A;  5I9E B;  3DJC A;  4FWK A;  4HTL A;  4JAX A;  3DXM A;  1DKG D;  3UKU B;  3CJ9 A;  3FFK B;  3M3Z A;  4FWM A;  4GNI A;  5AQR A;  5FPE A;  3FZH A;  2V52 B;  3FE1 A;  1XQS C;  1YUW A;  4M7Y A;  3BUZ B;  2YHX A;  2W40 A;  1GLE G;  1GLJ O;  2Q0U A;  3M1F A;  3P4I A;  4JN4 A;  3F9M A;  3VET A;  3VGL A;  1NM1 A;  4H5W A;  2Q31 A;  4BR5 A;  3D2F B;  2YCH A;  1NGC A;  5BRF A;  2P9P A;  1X3N A;  3CJC A;  4H0Y B;  3J8A A;  1ZXO A;  3EO3 A;  1KAZ A;  4FWL A;  1BU6 O;  2QM1 A;  2FSK A;  3WQT A;  1NLV A;  3A5L C;  5AQG A;  1BA0 A;  1ATS A;  2GEM A;  3HM8 A;  3QML A;  4NB4 A;  4BRD A;  1IJJ A;  3UE5 A;  1EQY A;  3ID8 A;  4DQ8 A;  3H3N O;  4JD2 B;  3QBX A;  3UKU A;  1LCU A;  5AQX A;  3LM9 A;  5BPL A;  4CZH A;  5AFU A;  3EKU A;  4FL9 A;  4BR7 A;  5AQV A;  1MWM A;  2GTD A;  1MWK A;  3CQX A;  4Y0W A;  4BRN A;  5ADX H;  1G99 A;  5AQN A; 
#chains in the Genus database with same CATH topology
 3CM6 A;  4KV8 A;  3QBW A;  3AVC A;  4DCH A;  4OKK A;  3TSU A;  1KQS M;  4M3X A;  1XHX A;  2FBV A;  5MLC Q;  2ASP A;  1CLQ A;  4CEF A;  3I56 N;  1N32 K;  5LJV A;  4CJV A;  2GWJ A;  4A5B A;  4MQ3 A;  4RWT A;  3FGU A;  3M8R A;  4DQR A;  3THX A;  3CIP A;  3NF7 A;  2ZGZ A;  3SAH A;  3LDQ A;  5FPM A;  1NK8 A;  3VEN A;  4FM2 A;  4JRQ A;  1T44 A;  1JCE A;  2FC0 A;  4PL8 A;  4IFV A;  3ZSR A;  4J2D A;  4OPH A;  4B1Z A;  5FDL A;  3SUO A;  4IXC A;  2CGK A;  4CJ3 A;  4PY5 A;  1QZ5 A;  1UAX A;  4CJW A;  3VA0 A;  4YDU C;  4CF1 A;  4C8O A;  3CMA N;  2JLE A;  4PHT X;  4BG8 A;  3CQY A;  5KQ8 A;  3DLR A;  3CFP A;  4J2B A;  2HHW A;  2P9S B;  2J4R A;  1YF5 L;  5BPN A;  3EEQ A;  4QS9 A;  3L2U A;  2D0P A;  2JGU A;  5AJ3 K;  4M42 A;  4CZF A;  4MFB A;  1L3T A;  2O4G A;  1QZ6 A;  3NGY A;  5EVZ A;  3BZK A;  4I9L A;  2GV9 A;  4BE0 A;  4WQ4 C;  4ICL A;  4FJI A;  1GOC A;  1I39 A;  5AQY A;  1F21 A;  4CEE A;  3CHW A;  1U6Z A;  2P5O A;  3FZM A;  4M3W A;  4O8K A;  5GIP A;  4CZI A;  2G8F A;  2AA4 A;  4DU4 A;  3O9S A;  1JLA A;  1X3M A;  3K58 A;  2QWR A;  3CC4 N;  3SYZ A;  1XC9 A;  1I3A A;  3RMB A;  4DV2 K;  3BP8 A;  4QS7 A;  1VSF A;  2OAN A;  3OYC A;  5F1X A;  1BI4 A;  2PYL A;  4B9N A;  3O4Q A;  2YNH A;  5C10 A;  3LPT A;  4JKE A;  2IVP A;  5E84 A;  5JS1 A;  4Q5V A;  4LFB K;  1OH8 A;  3OYM A;  2F8T A;  3EE8 A;  3ZSQ A;  4DSK A;  5BPM A;  3V1O A;  2F8S A;  2P9U A;  2EX3 A;  1ASW A;  2HST A;  3U4L A;  4JKF A;  1QHT A;  1NGI A;  5FRM A;  5HL7 L;  4FJM A;  3G25 A;  2W42 A;  2Z1I A;  2ZF5 O;  1XMQ K;  1K8A O;  3SQ4 A;  1WSJ A;  3VES A;  5C15 A;  4X66 K;  3WXK A;  3ZET A;  4Q0B A;  4CHO A;  2QWP A;  5JS2 A;  1LW2 A;  3V1Q A;  1KCF A;  1SKW A;  3TAN A;  1ATN A;  3AVB A;  3LDP A;  2KFN A;  2A1R A;  2VG5 A;  3OTO K;  1QQN A;  2GWK A;  4KBO A;  4CEB A;  5JMV A;  3QIN A;  4LF9 K;  3TSQ A;  1MDU B;  4X65 K;  4KH5 A;  1SKS A;  5C2F A;  3G10 A;  4NXN K;  3MK6 A;  3S3O A;  3RTV A;  3QDK A;  4DTS A;  2F4V K;  4LSL A;  4DQP A;  1QVF M;  3AVK A;  4BR2 A;  5HBM A;  4CZG A;  4CD3 A;  2BUP A;  1J6Z A;  3WXL A;  1Q18 A;  2YI1 A;  4DS4 A;  1X9S A;  4KHS A;  4IDK A;  4XIU A;  3KK7 A;  2H3G X;  1BA1 A;  1C0U A;  4ILH A;  3O5B A;  1NG9 A;  3V9X A;  1BCO A;  1XNQ K;  4BAC A;  3LZI A;  3C6A A;  4M3T A;  2UXD K;  4AH9 A;  4IG0 A;  4RW6 A;  4ISE A;  5AQH A;  4FLW A;  2HMI A;  3E66 A;  3A2F A;  3VQC A;  4MLH A;  2HVH A;  3AVG A;  2OA8 A;  1WAF A;  1YAG A;  1S1W A;  1IG8 A;  2FSJ A;  3AV9 A;  4DTP A;  4EAH D;  3HOT A;  4WF9 L;  3DOK A;  4DV7 K;  4JI5 K;  3RRH A;  4PUO A;  3J81 O;  3AA2 A;  4W5Q A;  1HKB A;  4HHT A;  3C65 A;  2X6S A;  3OHR A;  4CBX A;  1NGJ A;  4DG1 A;  4Z4E A;  4CJT A;  1ZBS A;  3K2P A;  1E4F T;  4B1W B;  3P31 A;  4JI7 K;  4H5N A;  3G6E N;  3CCU N;  1VSK A;  3KLH A;  3PIP L;  4FW1 A;  1RT2 A;  3VQ5 A;  3KLF A;  1N6Q A;  5CZ1 A;  5BN9 A;  4FK2 A;  1RFQ A;  4JV5 K;  3GBT A;  2RN2 A;  4BRH A;  3SUP A;  1BDG A;  3ZEU A;  2P9K A;  4LH4 A;  2NRT A;  2Z1H A;  3SPZ A;  1CZA N;  2YHA A;  1WLJ A;  4FSV A;  1KC8 O;  4IWV A;  2Z1J A;  2HBK A;  3SJH A;  4B8A B;  5AZI A;  3TAB A;  3QER A;  4FLY A;  3F5T A;  5DM7 L;  4OJR A;  1NJI O;  3U8X A;  4DV1 K;  2P9L A;  4F8R A;  4O0J A;  2V7Y A;  4OGE A;  1MA9 B;  2A42 A;  3QB0 A;  4IEI A;  4OVL A;  4YDU A;  4J2A A;  5KGX A;  5TKY A;  5CHI A;  5AQF A;  4DR4 K;  3QEX A;  4DUY K;  1VHX A;  4B1V A;  4IJA A;  4IBN A;  3OY9 A;  1YVN A;  1FW6 A;  4KPY A;  3OJU A;  1K9M O;  3KD1 E;  3HST B;  2VG6 A;  5JLH A;  3P83 D;  2X74 A;  1TV6 A;  2E1Z A;  4IJN A;  2UUB K;  4O44 A;  3CC7 N;  2QXL A;  1D9F A;  1MU2 A;  4EP5 A;  3S3M A;  4FLU A;  4WFN L;  1HYV A;  4EZ9 A;  4K41 A;  1NGH A;  4CEO A;  5AQO A;  4HVJ A;  5J1E A;  1GLF O;  4BRA A;  1YJ9 N;  1E4G T;  4FJN A;  3EY1 A;  4FWS A;  4KHN A;  5ELZ A;  3VQQ A;  2XRI A;  4YOU A;  3KVG A;  3ZSV A;  1D5A A;  4K25 A;  3MCA B;  2O8B A;  1ATR A;  3ULE B;  3CD6 N;  3VEX A;  1KTQ A;  2VG7 A;  4K42 A;  4CJ4 A;  1DGK N;  4H4O A;  1J53 A;  3O9T A;  4EIA A;  3NVM A;  4HCC A;  4FOI A;  1TAQ A;  3DRS A;  1JCG A;  1TUY A;  2IVO A;  4CJ7 A;  2D0C A;  4DR1 K;  4DR2 K;  1ESV A;  3A5M C;  4XEI A;  1RTD A;  1KAX A;  4CBU A;  4TSX A;  1RDA A;  1C0F A;  4C8K A;  3QFP A;  4ID5 A;  1XI1 A;  3OA9 A;  4M45 A;  4CZK A;  4LF5 K;  3QIP A;  3ZX2 A;  4FJG A;  4JKH A;  3P5J A;  2KQ2 A;  3ENO A;  2QI2 A;  1NMD A;  3CF5 L;  4JRP A;  1VSD A;  3I8B A;  4FJK A;  3RMA A;  3O3F A;  2PZS A;  2OPQ A;  1H1V A;  1VQ9 N;  1KD1 O;  2F7T A;  4CEZ A;  3T3F A;  1I94 K;  2D0B A;  3CCM N;  5LMN K;  4BDZ A;  1BIZ A;  1QQM A;  1EX4 A;  1VQM N;  3RRG A;  4DTX A;  3CME N;  3OYG A;  3JAM O;  1QSY A;  5I9E B;  4I2Q A;  3ITH A;  4HCB A;  4HTL A;  2KFZ A;  2RHK A;  3CCE N;  1JXE A;  1VQ4 N;  4B3M K;  1VAZ A;  5AQR A;  1RTI A;  4FWM A;  5GIN A;  3THW A;  3HPH A;  1ZBH A;  4ILG B;  2YHX A;  2Q3S A;  1IBL K;  2IS3 A;  4CHZ A;  4JN4 A;  4BR5 A;  1VQ8 N;  5A2Q O;  2HHS A;  1SL0 A;  3THY A;  4DR5 K;  3CJC A;  3NVK A;  4H0Y B;  1RBT A;  4YOT A;  3EO3 A;  2ZD1 A;  1WB9 A;  4DV6 K;  3NMU A;  3KWG A;  3ZLJ A;  4DLG A;  1NLV A;  1NK9 A;  5D3G A;  3A5L C;  2YKN A;  4CJE A;  3THX B;  2HW3 A;  4FLT A;  5AQG A;  4NB4 A;  1EQY A;  1NJW A;  4LFC K;  4DQ8 A;  3D6R A;  5C2D A;  4DF8 A;  3ZSW A;  3OYE A;  2FBT A;  5SWM A;  4JI6 K;  1MWM A;  4C8N A;  4Y0W A;  3OBY A;  3CPW M;  3VTI A;  4IFE A;  3K5M A;  2VCP A;  5C0Y A;  3O9Q A;  4CFD A;  3NDK A;  3WXM B;  5K14 A;  1NGD A;  1U04 A;  1HNZ K;  2GX9 A;  5LL6 Z;  4FK4 A;  4H5T A;  3QET A;  3E1Y A;  4JK7 A;  4E7J A;  1WSG A;  3WEE B;  1KXP A;  3PX0 A;  4FWN A;  1TAU A;  4IZ9 A;  4MDA A;  1NJZ A;  3CXC M;  4IO9 L;  4CJQ A;  2RPI A;  1T7P A;  2QWL A;  3C95 A;  4FPA A;  3MWT A;  5B8H A;  1WSF A;  4AHT A;  3DXM B;  3HT3 A;  3IUC A;  3PX6 A;  3KLG A;  3VQ7 A;  3SNN A;  1W2B M;  5BR9 A;  1J5E K;  2AJQ A;  4BQZ A;  4JKD A;  1FKO A;  4Z4F A;  3AVL A;  5EOY A;  5JLF A;  3OYJ A;  4LFA K;  1QHA A;  2V51 B;  3FFI A;  5C42 A;  2HBM A;  4M3R A;  1TKX A;  4F2R A;  1BI4 B;  4O5B A;  2ZM6 K;  3CQ8 A;  3OYI A;  5KQD A;  2E20 A;  3AGK A;  4KO0 A;  2VQF K;  1DTT A;  1KVB A;  2YHW A;  2W6L A;  1VSM A;  3NBP A;  3LL3 A;  2QTD A;  4JI8 K;  1LWE A;  1ASU A;  3IKM A;  3DOL A;  3O9U A;  2WC9 A;  3OYK A;  1ILY A;  2P9U B;  2P5G A;  1ZBI A;  1TL1 A;  4CGH A;  4DU3 A;  5M1O A;  1UA1 A;  1RBU A;  1T05 A;  1VQK N;  4Z4H A;  1GLD G;  1GLL O;  2D0O A;  3AGR A;  2NRV A;  3W3D A;  4JI0 K;  3BY5 A;  4CBW A;  1HQE A;  2QWO A;  4DF4 A;  3L6Q A;  4CFC A;  2KZM A;  2HF4 A;  3ZET B;  3JSM A;  1N33 K;  3CG7 A;  3GOI A;  3RSE A;  1J9A A;  2D5R A;  2UU9 K;  5DM6 L;  4FJ9 A;  3ZT1 A;  4DR3 K;  4K8X A;  3K5O A;  1RT4 A;  2GUI A;  3HTV A;  4H0X B;  3NGI A;  4A57 A;  3TR8 A;  1WUA A;  3CJA A;  1UOC A;  3TTD A;  5C24 A;  1B92 A;  1BO5 O;  2HHT A;  2YNG A;  3DXK A;  2PBD A;  3EYZ A;  5EY4 A;  4CVN E;  4UQG A;  1N36 K;  4BGB A;  4CHQ A;  3QEW A;  4KB0 A;  3KD5 E;  2IVN A;  3OYD A;  4CD1 A;  5T7B A;  3F73 A;  3WT0 A;  2QWN A;  1P8Z A;  1LWC A;  1YTU A;  3ZYY X;  5SZT A;  3SMS A;  5ADX A;  1HNW K;  3C94 A;  3DYA A;  4RTF D;  3BF3 A;  1WSI A;  3K5N A;  4IEE A;  4G9Z A;  1S6P A;  4V19 S;  3I55 N;  1NGE A;  2EHG A;  4NCG A;  4I6M A;  4RCH A;  1YIJ N;  1S9E A;  2QA4 N;  3D7E O;  1IKW A;  3D45 A;  4I9Q A;  5M1N A;  3O3G A;  2V7Z A;  2WBN A;  2A6A A;  1NKB A;  3OVN A;  1HNV A;  2UUA K;  1K6Y A;  5BRE A;  3U3Y A;  3VQE A;  5CY4 A;  4GV6 A;  1HLU A;  4JKG A;  5AQJ A;  4NYN A;  3AVI A;  3MWP A;  3VF6 A;  4G1Q A;  4BG9 A;  2FBX A;  3AVA A;  2D0A A;  2P9I A;  1HPZ A;  2HMP A;  5C12 A;  1P90 A;  2E88 A;  5HP1 A;  4FM1 A;  4WYB A;  1DTQ A;  4DTR A;  1GLC G;  2OZS A;  2WOM A;  1RDU A;  4RG8 A;  1VSH A;  2QKB A;  4A2A A;  5AR0 A;  3ZEU B;  3R9P A;  2NUB A;  2P9K B;  3AA3 A;  2F9T A;  1ZBF A;  3OYF A;  1NK0 A;  3DI6 A;  2ASM A;  5JVG L;  1Q81 O;  4E7L A;  4IO8 A;  1Q8I A;  4YOR A;  4YFU A;  1VQP N;  3OYH A;  4NO7 A;  1LAW A;  5AZI B;  5E41 A;  4FOE A;  4DHY A;  4BRP A;  3AVH A;  4JHD A;  1S5J A;  4Z0U A;  1HUX A;  2P9L B;  5KGW A;  4B9T A;  3LAM A;  4ZTF A;  3H3O B;  1RDC A;  3QEV A;  1YVU A;  4CZM A;  3LP2 A;  4DSJ A;  1VSI A;  4M3U A;  3DLK A;  1HYS A;  3TWH A;  1OH7 A;  4PQU A;  1NGF A;  4DKW A;  2YV0 X;  5GAE P;  4LD0 A;  2YHY A;  4A61 A;  2HNY A;  3WNE A;  3VN5 A;  2ETJ A;  5LY3 A;  4FJL A;  4FZZ A;  2IAJ A;  3ATV A;  1VSL A;  4FJ8 A;  4PKG A;  4BVO A;  4FLZ A;  3VF4 A;  3RMC A;  1W97 L;  4WFB L;  3WNH A;  3SQ0 A;  1E3M A;  1NJY A;  4KH6 A;  3SAF A;  4Z4G A;  3BF1 A;  3FZL A;  4BE1 A;  2A1S A;  2OYQ A;  4B9U A;  1OH5 A;  3NH0 A;  2E2Q A;  5AQU A;  3KIO A;  4BC2 A;  1S1X A;  4E7I A;  1A5X A;  4JI1 K;  4BQL A;  4BRL A;  1D8Y A;  2NZT A;  3E01 A;  2P1J A;  3MXI A;  3HJF A;  2QXF A;  4OPA A;  3SBT A;  4JLH A;  5AFU H;  2O8B B;  4BRF A;  3CJ1 A;  3ENH A;  2VYP A;  4KAZ A;  1U49 A;  3R6M A;  2E2O A;  5EU7 A;  2NNW A;  1S72 N;  3T69 A;  2CH6 A;  2HNZ A;  4IOA L;  4LSN A;  1NKE A;  2FF3 B;  3S9H A;  3RR8 A;  2BE2 A;  2P51 A;  1QTM A;  4DTJ A;  5AQZ A;  2HF3 A;  4CED A;  2QEX N;  4BRC A;  4KFB A;  2YX6 A;  5LJW A;  4N76 A;  1SZ2 A;  5HRN A;  3SK3 A;  3WUH A;  4Z4I A;  2HB5 A;  1BQN A;  3AA4 A;  1K8K B;  2KHO A;  3S41 A;  4R79 A;  4H0P A;  1NOY A;  2YJF A;  4AHS A;  2NRH A;  3VQ9 A;  1JLC A;  4NLB A;  5J2M A;  3CER A;  2PFU A;  2ZE2 A;  4KTQ A;  3GL1 A;  3L3U A;  2G8I A;  3PSF A;  3C7N B;  4L3Q A;  1D4X A;  5FPN A;  3ZX0 A;  1IH7 A;  3MDQ A;  5F2R A;  1RIL A;  1NMN A;  5KRT A;  3ENB A;  4AHR A;  3R1X A;  2O8E A;  1IV0 A;  4DB3 A;  4J8F A;  5F0X A;  1BGX T;  4CF2 A;  1ASV A;  1C0G A;  4LF7 K;  4CHP A;  3THY B;  2X6N A;  4DFM A;  1VQN N;  4O8U A;  4BY9 C;  3M8Q A;  4CEA A;  5CYQ A;  4DQI A;  2O8D B;  3ISN C;  3LP1 A;  4KKO A;  3NGZ A;  1XC3 A;  4R5P A;  3QLH A;  4HTU A;  3OJS A;  3U9D A;  4GW6 A;  4OGC A;  3ZSX A;  3DJC A;  1VQO N;  1RT1 A;  5HLF A;  1C6V A;  3K5L A;  3J7Y P;  3QNN A;  5I3U A;  3TAM A;  4U7B A;  1HMV A;  4CIE A;  4KHW A;  3AA5 X;  4M7Y A;  5KRS A;  1GLE G;  3M1F A;  4HUF A;  3L4Q A;  3F9M A;  2RE2 A;  2YCH A;  5CZ2 A;  2R7Y A;  5BRF A;  3E9O A;  2ZJQ L;  1BL3 A;  4KTW A;  4OPK A;  4DTO A;  3ZT2 A;  4EP4 A;  4NXM K;  4B3S K;  2QM1 A;  1JLF A;  2ATQ A;  2FSK A;  4ELV A;  1VSE A;  3HPO A;  1KSP A;  3QML A;  1LW0 A;  4KRE A;  2OPP A;  1IJJ A;  4IDH A;  2OPR A;  3RVC A;  3H3N O;  4DFP A;  3QBX A;  4JI4 K;  3Q7B A;  1HQU A;  1SUQ A;  5BPL A;  4DWI A;  3EKU A;  3CCJ N;  3N4Q A;  2NRX A;  4BR7 A;  3PSI A;  2GTD A;  4CER A;  5J2N A;  4BRN A;  3WNG A;  4GVM A;  3JXU A;  3D2F A;  3M8P A;  3KJV A;  1JLG A;  3HVT A;  2DY4 A;  1TKT A;  1NGA A;  3CCR N;  1QSL A;  3IS9 A;  1C0M A;  1WSE A;  4E7K A;  1HNI A;  2ZJR L;  5J2P A;  1RNH A;  1XUP O;  2KZZ A;  4BGA A;  3A8Y A;  1Z26 A;  3MN5 A;  3GDQ A;  4JEP A;  4C8L A;  3P1G A;  1N5Y A;  4CJP A;  2IIR A;  3PLA A;  5AQT A;  1JJ2 M;  3LP0 A;  4XH4 A;  4M63 C;  3DAW A;  1Q7Y O;  4CZL A;  5FLX O;  4GKK K;  1KAY A;  4O5F A;  1X9J A;  1QS4 A;  4B3R K;  4GV3 A;  4J2E A;  4CIG A;  3LDL A;  1GOA A;  4BWJ A;  1YIT N;  4ISG A;  4YOW A;  4O4G A;  2DPN A;  1JCF A;  3NAE A;  4DUZ K;  4CEQ A;  3OS0 A;  1WOQ A;  4MO4 A;  1RBR A;  1WBD A;  4Z4C A;  3MAQ A;  3CCL N;  3M6G A;  1NK6 A;  4U67 L;  1C1A A;  3MEE A;  1IO2 A;  1T6C A;  3U6F A;  4BC4 A;  3LDN A;  1UA0 A;  4BR0 A;  4RW9 A;  1WBB A;  4IOC L;  3KTQ A;  2EWS A;  1NU0 A;  3WXJ A;  3NFA A;  3RSE B;  2DFE A;  5BRD A;  1DEJ A;  3MMV A;  5AQL A;  2UXB K;  3ULD A;  4DU1 A;  3V9W A;  2PY5 A;  2YJE A;  3WXI A;  3LZJ A;  1RGI A;  1SQK A;  1IKV A;  2NRR A;  4ELT A;  3DXK B;  4FLX A;  4ZHR A;  3KKS A;  3O4N A;  4E1N A;  3C0B A;  3CJ7 A;  2WTU A;  4A59 A;  3TAF A;  3KK2 A;  1W7A A;  1TK8 A;  4OPJ A;  3VF2 A;  2BDP A;  1WNS A;  3R8E A;  5GAD P;  2CGL A;  2ITM A;  1HKG A;  1C0T A;  1NJX A;  4EHU A;  3H08 A;  5BR8 K;  1G15 A;  3SV4 A;  5GAG P;  4CK3 A;  2E4L A;  5CE3 A;  4BRO A;  4KHU A;  3SCX A;  3LAL A;  4A5A A;  3TAP A;  4E7H A;  2KW4 A;  3CFR A;  4B8C A;  3VPZ A;  3VA3 A;  1NWK A;  4DSF A;  3O4W A;  1SL1 A;  1LAV A;  1TKD A;  1KRP A;  1GOB A;  3VEO A;  3NHG A;  2ZJP L;  4H0O A;  1U48 A;  3UKR A;  3LAN A;  3H45 C;  1FJG K;  3DLE A;  5JIC A;  5HRS A;  3VEY A;  4JKG B;  1NBW A;  4KRF A;  3K57 A;  3CET A;  3TSP A;  1ITG A;  4DSE A;  3MN9 A;  2PYJ A;  3AVF A;  2IGI A;  1HRH A;  2P9I B;  4CF0 A;  4AM6 A;  3MN6 A;  3PUF A;  3UB5 A;  3CC2 N;  4F3O A;  4H0V B;  3D0P A;  4DLE A;  1B9F A;  2I5J A;  4BRI A;  2KTQ A;  4WFA L;  3V1R A;  5CYM A;  1JLE A;  4DSI A;  4CJL A;  3AO4 A;  3C6T A;  5KPZ A;  4DFJ A;  3VQP A;  3SQ2 A;  3I33 A;  1S1T A;  1U47 A;  2QK9 A;  5M1F A;  2RKI A;  3HM9 A;  2HHH K;  5DMR A;  4E3S A;  3O08 A;  3AAR A;  1WSH A;  2G8K A;  3ATU A;  4CW7 B;  2E6L A;  1CXQ A;  4K0K K;  1U2V A;  1LOT B;  4I7F A;  3KK3 A;  5GAH P;  4JHD B;  1R59 O;  4BRG A;  3J7Z O;  4NLC A;  3U3G A;  2ITG A;  4FK0 A;  1BHL A;  1JXB A;  3CI5 A;  3ZSY A;  4YY3 K;  4B9V A;  4BDP A;  1L5U A;  1EWQ A;  2O8C A;  1HX1 A;  3MEC A;  2HOE A;  3RWU A;  4W5O A;  4WE1 A;  3ASM A;  1L3S A;  5EXW A;  1BQM A;  4A2B A;  3DLL L;  3KKR A;  3L2R A;  3KZB A;  5KTQ A;  3LWM A;  3KLE A;  1ZYQ A;  3K59 A;  4HUE A;  4FVM A;  4XH5 A;  2OZM A;  1U45 A;  1EET A;  2HHQ A;  3RR7 A;  3SAG A;  4IOX A;  1FK9 A;  1VK0 A;  3VTH A;  1S6Q A;  2CH5 A;  4PA1 A;  1RT5 A;  4MDB A;  1S1V A;  2A3Z A;  3SMP A;  3AVM A;  4F4K A;  4DV4 K;  4LF4 K;  3O8M A;  4B9L A;  4DV5 K;  4KI4 A;  4ILJ A;  2Q1N A;  4KHQ A;  4BR4 A;  3NF9 A;  4GY2 B;  1EP4 A;  3O6W A;  4FWQ A;  2HND A;  3NH1 A;  2KKZ A;  3SPY A;  1Q9Y A;  1YJN N;  4M41 A;  3QEP A;  3VEV A;  3TAG A;  4BRM A;  4C1N I;  1NK5 A;  2OTJ N;  2VGM A;  1JKH A;  1T3V A;  3DRP A;  4ELU A;  2VGN A;  4FCY A;  3SJJ A;  4FWO A;  3OBW A;  2X78 A;  4CI6 A;  3HO1 A;  4FZX C;  3DLG A;  4CGI A;  5AQW A;  4IG3 A;  4BVP A;  2W41 A;  5FRO A;  1VSJ A;  5M1Q A;  4B9Q A;  2WON A;  2FF6 A;  5HRR A;  3F9K A;  3MX5 A;  1W0H A;  1RCH A;  1NK4 A;  3WNF A;  3HBT A;  4MO5 A;  1HJO A;  1NGG A;  2XY5 A;  4AF1 A;  3O1B A;  2YNI A;  2GUP A;  2F96 A;  3EN9 A;  4OO1 J;  4AHV A;  4FWR A;  3OYB A;  1RT3 A;  4C1N K;  1BWF O;  2XY6 A;  1YHQ N;  1FXX A;  3S3N A;  1KVA A;  2XY8 A;  3BEX A;  1HKC A;  5M1K A;  1BIU A;  1UWB A;  3SV3 A;  5AZJ A;  1T6D A;  3A5N C;  5GIO A;  3TAR A;  3T1Y K;  1SL2 A;  3ZX3 A;  4N41 A;  2E8A A;  4B1Y B;  2FXU A;  2HVI A;  3B8A X;  2O8E B;  3MN7 A;  1Z25 A;  3MXM A;  5AQP A;  4DMN A;  2XO7 A;  1OKJ A;  3SUN A;  1Q9X A;  3W0L A;  2B6A A;  3O3H A;  1DT9 A;  4DTM A;  2G8W A;  3G4S N;  4GVE A;  4BR9 A;  3RMD A;  1NOZ A;  3VQ6 A;  3QES A;  1Q86 O;  3A0I X;  5EX5 A;  4QS8 A;  4GMJ B;  3FLC O;  4H5R A;  4CK1 A;  1TK5 A;  3B6P A;  3QIC A;  2Y1I A;  4DQQ A;  3HP9 A;  4LY7 A;  3WQU A;  3IFR A;  1SV5 A;  1QSS A;  4W5R A;  1RT6 A;  5LMU K;  1RT7 A;  1IBK K;  4CJK A;  4XH1 A;  1ZBL A;  3TI0 A;  2P9N A;  3PX4 A;  1TYQ A;  2VWJ A;  3D2E A;  4Y1C A;  1JLB A;  3CM5 A;  3WEE A;  3HVR A;  3LDO A;  4FPB A;  2HHU A;  1ZC6 A;  3NH2 A;  3AAP A;  4UY8 O;  3CCV N;  1Y64 A;  4IFY A;  4BRK A;  2ZGY A;  3LWL A;  4L8R B;  4FWK A;  4CGD A;  4KI6 A;  2ZQB A;  4JAX A;  3DXM A;  5HOO A;  2FBY A;  4OKJ A;  1K73 O;  4HUG A;  1DKG D;  3CJ9 A;  4CE9 A;  3M3Z A;  3LPU A;  4BDY A;  2V52 B;  1XNR K;  4YOV A;  4DFK A;  1EWR A;  1YUW A;  1OVY A;  2W40 A;  3PO4 A;  1GLJ O;  2Q0U A;  3VET A;  1NM1 A;  4H5W A;  2Q31 A;  4ID1 A;  3D2F B;  3CFO A;  1NGC A;  1QQC A;  2P9P A;  1X3N A;  4CJR A;  3J8A A;  1KAZ A;  2O4I A;  3MEG A;  3T1H K;  1NKC A;  4BE2 A;  2E5L K;  3V4I A;  2O8F A;  4OKE A;  3WQT A;  1VQ6 N;  3MED A;  3K9K A;  3J7A P;  1BA0 A;  1ATS A;  3UE5 A;  4AHU A;  4CES A;  3ID8 A;  3UKU A;  1LCU A;  3CYM A;  5AQX A;  1NNE A;  3LM9 A;  4CF8 A;  4CZH A;  4FXD A;  3DMJ A;  4FL9 A;  3T7Z A;  4YOX A;  3HRG A;  5AQV A;  3P38 A;  3QO9 A;  1MWK A;  3CQX A;  5ADX H;  1G99 A;  5AQN A;  1FKP A;  4FW2 A;  3MX2 A;  1TL3 A;  4B9S A;  5KPT A;  3ZSZ A;  2DTU A;  4RW4 A;  3HL8 A;  4AIL C;  2HBJ A;  4OLB A;  4CZJ A;  4B3O A;  3VOV A;  3CJB A;  4JS5 A;  1LV5 A;  3ZT0 A;  3DRR A;  4CHY A;  3V9S A;  3QIO A;  3FZK A;  2ZWH A;  3IG1 A;  4OLA A;  1V4T A;  3TPQ A;  2XHB A;  1EO1 A;  2E2P A;  4E1J A;  1D9D A;  3AO5 A;  2I7P A;  4CF9 A;  3PV8 A;  4JD2 A;  4YNQ A;  3AAQ A;  1QE1 A;  4FM0 A;  5J2Q A;  4WCE L;  2Q2R A;  4BRE A;  4CJ5 A;  2VQE K;  2HHX A;  2W6K A;  4B1X B;  3OW2 M;  2YNF A;  3HZ6 A;  4LF6 K;  1C1C A;  3G0Z A;  3THW B;  1QQO A;  3LP3 A;  5I42 A;  5E26 A;  3LM2 A;  3C6U A;  1VRU A;  1N34 K;  1VQL N;  3MXJ A;  1JL1 A;  1O1W A;  4KB1 A;  2NRZ A;  4CGG A;  4E89 A;  4CHN A;  2G8H A;  1HNX K;  3CCQ N;  4YHH K;  5KPR A;  4K8Z A;  3CPE A;  1V4S A;  4M3Z A;  5IWA K;  1L3U A;  4OX9 K;  2Z1G A;  2BGG A;  3VQ4 A;  3L0Q A;  2FSN A;  3ID6 A;  4BWM A;  3ZT3 A;  2E6M A;  5C25 A;  1WAJ A;  1HR0 K;  4KTZ A;  3OYL A;  1S9G A;  5H1S Q;  1Q82 O;  2G8V A;  1X1P A;  3UKR B;  2FLO A;  1C1B A;  2BH1 A;  2KLA A;  4F3T A;  2WFB A;  3EE9 A;  3IDH A;  4B08 A;  1RDD A;  3I0S A;  4AM7 A;  5AQQ A;  4CJS A;  1S1U A;  1U4B A;  3M8S A;  4IKF A;  3O80 A;  1KFS A;  3LAK A;  3DLH A;  3BDP A;  3KWI A;  3EZW A;  3VEW A;  1IKX A;  1BOT O;  3V9Z A;  4BC3 A;  2P9S A;  2QW9 A;  3O1W A;  3P39 A;  1YTA A;  4CCH A;  4FJX A;  4KH4 A;  3O9R A;  4CJU A;  2BAN A;  1HJR A;  4N56 A;  1DLO A;  1LWF A;  4WQ5 C;  5KI6 A;  3BZC A;  4ISF A;  3H46 O;  3AO3 A;  3LDS A;  1YJW N;  4M3Y A;  1U2V B;  3KK1 A;  1SKR A;  3L2Q A;  4DTU A;  1VQ5 N;  4CK2 A;  1NGB A;  4CGJ A;  5M1P A;  4O0I A;  3B6O A;  3A5O C;  4YOY A;  4JI3 K;  2O8C B;  3AVJ A;  3N4P A;  3K0S A;  5FPD A;  4B3T K;  1ZBU A;  3HI0 A;  1W9H A;  3DWL A;  3FZF A;  2F9W A;  4DR6 K;  3I0R A;  4W5T A;  4QAG A;  4DV3 K;  4RW7 A;  3JYT A;  1S3X A;  1YXQ A;  4N5S A;  2RF2 A;  3HSC A;  4H03 B;  3ZSO A;  3VQA A;  1OVQ A;  3H1V X;  2OPS A;  4H8K A;  2OCE A;  4Z94 A;  4E0D A;  4E19 A;  1WN7 A;  4WQ4 A;  5AQK A;  3HK2 A;  1CZ9 A;  4JS4 A;  4FJ5 A;  4AQY K;  1O13 A;  4NYF A;  4BC5 A;  3NF8 A;  1IG9 A;  4CFA A;  2G8U A;  1EKE A;  4CZE A;  1SS6 A;  3VGM A;  4B1U B;  3QFU A;  1S22 A;  2UYT A;  4NCA A;  4C23 A;  1BG3 A;  3SBG A;  3EL2 A;  3DLB A;  4MLE A;  2WUS A;  1SAZ A;  3HYF A;  5AQI A;  3K9J A;  2E1Y A;  1BIS A;  3HP6 A;  4FWP A;  2GEL A;  1A5V A;  2A40 A;  1CZB A;  3MCP A;  4CFB A;  2D1K A;  4FJ7 A;  4JYA K;  2VWB A;  5HRP A;  2UXC K;  4EHT A;  4LC9 B;  2DFH A;  4O55 A;  3ALY A;  2IC3 A;  5DK5 A;  4PL7 A;  3IAY A;  5IT9 O;  3AY9 A;  4ZTJ A;  1VQ7 N;  1RTH A;  1K8K A;  3E9P A;  1BCM A;  4CGF A;  2JWL A;  3JS6 A;  3H1Q A;  4NCB A;  4K43 A;  3L4I A;  4JKA A;  1XMO K;  4HWI A;  5AQM A;  4X64 K;  5BN8 A;  4KHY A;  1Z6R A;  3H6E A;  3SLC A;  1JLQ A;  1BUP A;  3QNO A;  3THV A;  2Q36 A;  3VEZ A;  3C7N A;  2IDO A;  2LSN A;  4W5N A;  3GG4 A;  1TUU A;  2D4W A;  2B5J A;  1M90 O;  5AZJ B;  2GBZ A;  4I6M B;  1QVG M;  3NE6 A;  4LH5 A;  3VMF B;  2NRW A;  1RBV A;  3PIO L;  4B9M A;  3L3V A;  4EFH A;  1TKZ A;  2HHV A;  3KLI A;  4DTN A;  1JL2 A;  5FRN A;  2QWQ A;  2Y1J A;  1L3V A;  3U9Z A;  2O8D A;  4FJJ A;  1RDW X;  3QEI A;  3OS2 A;  2XY7 A;  4BRQ A;  3EKS A;  3TU5 A;  4DV0 K;  1X9W A;  2Q0R A;  1N8R O;  1YI2 N;  4CEC A;  5BRH A;  3J80 O;  3E9L A;  3TTC A;  3IMX A;  3PY8 A;  3TAQ A;  2CGJ A;  2PAV A;  4PWD A;  4JK9 A;  3SQ1 A;  4DR7 K;  4RW8 A;  1RBS A;  1HPM A;  5JVH L;  4N47 A;  4FYD A;  2NLX A;  4DQS A;  3KHY A;  1T03 A;  3IRX A;  3GE1 A;  4FJH A;  1Y97 A;  4FVU A;  3L2V A;  2P9N B;  4H0T B;  3I8D A;  2UUC K;  2Q97 A;  5AQS A;  2B4J A;  4F9O A;  3C6H A;  4M7X A;  1TYQ B;  3OYA A;  3D2E B;  4GV9 A;  3R3L A;  1XHZ A;  1NK7 A;  3Q7C A;  2DFF A;  1IKY A;  1R0A A;  3VER A;  1T8E A;  3VGK A;  3NCI A;  1KFD A;  2OTL N;  1J54 A;  3SZ2 A;  3T1A A;  1TVR A;  1RDB A;  3F2K A;  3HPG A;  3ZCM A;  1B9D A;  2AP1 A;  3V9U A;  5HRO A;  1RTJ A;  4Y1D A;  2BTF A;  3V6D A;  3CCS N;  4WQ5 A;  5TKW A;  1TK0 A;  1REV A;  4JNE A;  3SI6 A;  1J5O A;  3TAE A;  1X9M A;  4FO0 A;  3TTF A;  4E1M A;  4JKB A;  3V81 A;  3M5R A;  2I7N A;  2P9P B;  2QWM A;  2A41 A;  1Z05 A;  3FR0 A;  4JK8 A;  4PKI A;  4C8M A;  1TGO A;  3HOS A;  3AO1 A;  4CJF A;  2ASO A;  1KLN A;  5CR4 A;  3OYN A;  3AO2 A;  2A5X A;  3VQB A;  2E2N A;  3G71 N;  4H5V A;  4F2S A;  2QKK A;  2O8F B;  4PKH A;  1GLB G;  3ULE A;  4A62 A;  1GLA G;  2YHB A;  2VWK A;  4X62 K;  3VQD A;  4QCL A;  1CXU A;  4EZ6 A;  1XWL A;  4DSL A;  3NF6 A;  3UKU B;  3EZ5 A;  3FFK B;  4GNI A;  5FPE A;  4FLV A;  3FZH A;  3SUQ A;  3FE1 A;  1XQS C;  4FZY A;  1HYZ A;  4QOZ B;  3BUZ B;  4GKJ K;  2JWK A;  3P4I A;  3VQ8 A;  3VGL A;  3ZT4 A;  1OH6 A;  4JI2 K;  3L8B A;  3DM2 A;  2IOC A;  4I2P A;  4DS5 A;  4JKC A;  1ZXO A;  4LF8 K;  4FWL A;  1BU6 O;  3HXM A;  4CIF A;  1M1K O;  3UIQ A;  3OS1 A;  3BGR A;  1KVC A;  1A5W A;  2GEM A;  3HM8 A;  1EXQ A;  4BRD A;  4AHC A;  4KHP K;  3PO5 A;  3L2W A;  1YT3 A;  4JD2 B;  2HBL A;  4H4M A;  5AFU A;  3AVN A;  3T19 A;  1VRT A;  2YKM A;  1KLM A;  1IBM K; 
#chains in the Genus database with same CATH homology
 2VCP A;  5C0Y A;  3QBW A;  3JXU A;  3D2F A;  3MX2 A;  3O9Q A;  4DCH A;  5KPT A;  3TSU A;  3WXM B;  1NGA A;  3CCR N;  1NGD A;  1KQS M;  5MLC Q;  2GX9 A;  2ASP A;  2ZJR L;  3I56 N;  5LJV A;  1XUP O;  2GWJ A;  3A8Y A;  4H5T A;  4BGA A;  2HBJ A;  3E1Y A;  4JK7 A;  3MN5 A;  4A5B A;  4CZJ A;  3GDQ A;  3VOV A;  3CJB A;  4JEP A;  4RWT A;  3FGU A;  2IIR A;  3WEE B;  3CIP A;  5AQT A;  1JJ2 M;  1KXP A;  3PLA A;  4XH4 A;  4FWN A;  4M63 C;  3DAW A;  2ZGZ A;  2ZWH A;  3FZK A;  3LDQ A;  4IZ9 A;  4MDA A;  5FPM A;  4CZL A;  1V4T A;  3TPQ A;  3VEN A;  3CXC M;  4IO9 L;  1KAY A;  4O5F A;  2E2P A;  1EO1 A;  4E1J A;  1T44 A;  2I7P A;  1X9J A;  1JCE A;  2QWL A;  4FPA A;  4JD2 A;  4GV3 A;  3AAQ A;  3MWT A;  4PL8 A;  3LDL A;  5ADX H;  4WCE L;  5B8H A;  2Q2R A;  3DXM B;  4OPH A;  4B1Z A;  4BRE A;  1YIT N;  4IXC A;  4ISG A;  2CGK A;  4YOW A;  4B1X B;  3IUC A;  2DPN A;  3OW2 M;  1JCF A;  3HZ6 A;  1QZ5 A;  1W2B M;  5BR9 A;  1QQO A;  4BQZ A;  4JKD A;  1WOQ A;  4MO4 A;  4YDU C;  3LM2 A;  5E26 A;  5EOY A;  5JLF A;  3CCL N;  3M6G A;  4U67 L;  1VQL N;  3CMA N;  1T6C A;  1QHA A;  2V51 B;  4BC4 A;  3LDN A;  4PHT X;  4BR0 A;  4BG8 A;  2NRZ A;  2HBM A;  3CQY A;  4IOC L;  5KQ8 A;  2EWS A;  3WXJ A;  2P9S B;  3CCQ N;  3RSE B;  5KPR A;  5KQD A;  2J4R A;  3AGK A;  2E20 A;  1YF5 L;  1V4S A;  3CPE A;  5BRD A;  1DEJ A;  2YHW A;  5BPN A;  3MMV A;  4QS9 A;  5AQL A;  2D0P A;  3LL3 A;  3L0Q A;  3SAH A;  2QTD A;  2FSN A;  3ID6 A;  4CZF A;  2YJE A;  1QZ6 A;  5EVZ A;  3IKM A;  3WXI A;  1RGI A;  1SQK A;  4WQ4 C;  2NRR A;  3O9U A;  2WC9 A;  3DXK B;  5H1S Q;  1Q82 O;  5AQY A;  1ILY A;  2P9U B;  3UKR B;  2FLO A;  3C0B A;  3CJ7 A;  3CHW A;  5M1O A;  2BH1 A;  2KLA A;  4A59 A;  2WFB A;  3EE9 A;  1VQK N;  1GLD G;  1GLL O;  3IDH A;  1U6Z A;  2D0O A;  3FZM A;  4AM7 A;  3AGR A;  4O8K A;  4CZI A;  5GIP A;  2NRV A;  3W3D A;  2AA4 A;  5AQQ A;  3O9S A;  3VF2 A;  1X3M A;  3CC4 N;  2QWR A;  4CBW A;  3R8E A;  2QWO A;  3O80 A;  5GAD P;  3L6Q A;  2CGL A;  3BP8 A;  2ITM A;  3KWI A;  1HKG A;  3EZW A;  4QS7 A;  2HF4 A;  2OAN A;  3VEW A;  3ZET B;  4EHU A;  1BOT O;  5F1X A;  4BC3 A;  2P9S A;  2QW9 A;  3GOI A;  3RSE A;  3O1W A;  3P39 A;  5GAG P;  4KH4 A;  5CE3 A;  3O9R A;  4BRO A;  5DM6 L;  5C10 A;  4JKE A;  4A5A A;  3HTV A;  4H0X B;  2IVP A;  5E84 A;  4A57 A;  3VPZ A;  1WUA A;  1NWK A;  4WQ5 C;  3O4W A;  3CJA A;  3EE8 A;  3TTD A;  4ISF A;  3H46 O;  1BO5 O;  5BPM A;  1YJW N;  3DXK A;  2PBD A;  3VEO A;  2ZJP L;  4H0O A;  2P9U A;  3UKR A;  2HST A;  3U4L A;  1U2V B;  4JKF A;  3H45 C;  5EY4 A;  1NGI A;  5JIC A;  3VEY A;  4JKG B;  1NBW A;  5HL7 L;  4BGB A;  3G25 A;  1VQ5 N;  3CET A;  1NGB A;  2IVN A;  3TSP A;  3MN9 A;  2ZF5 O;  4CD1 A;  5M1P A;  3WT0 A;  2P9I B;  3A5O C;  4YOY A;  4AM6 A;  1K8A O;  3MN6 A;  2QWN A;  3UB5 A;  1P8Z A;  3CC2 N;  3VES A;  3N4P A;  5C15 A;  3ZYY X;  3WXK A;  4H0V B;  5FPD A;  3SMS A;  3ZET A;  1VQ9 N;  2QWP A;  5ADX A;  3HI0 A;  4BRI A;  4RTF D;  3BF3 A;  5AQN A;  3DWL A;  3FZF A;  2F9W A;  4WFA L;  1ATN A;  3LDP A;  4IEE A;  4G9Z A;  3I55 N;  5KPZ A;  1NGE A;  1S3X A;  1QQN A;  1Q7Y O;  1YXQ A;  3I33 A;  2GWK A;  4KBO A;  5JMV A;  3HSC A;  4I6M A;  4H03 B;  4RCH A;  3TSQ A;  5M1F A;  1MDU B;  2QA4 N;  1YIJ N;  4KH5 A;  3D7E O;  3H1V X;  5C2F A;  3O08 A;  5M1N A;  3MK6 A;  3AAR A;  4Z94 A;  2V7Z A;  2WBN A;  2A6A A;  3QDK A;  4WQ4 A;  3ATU A;  5AQK A;  1U2V A;  1QVF M;  5BRE A;  1O13 A;  1LOT B;  4BC5 A;  4GV6 A;  1HLU A;  4BR2 A;  4JKG A;  5AQJ A;  5GAH P;  4JHD B;  1R59 O;  4CZE A;  4CZG A;  4BRG A;  4CD3 A;  3J7Z O;  1SS6 A;  2BUP A;  1J6Z A;  3MWP A;  4NLC A;  3VGM A;  3VF6 A;  4B1U B;  3CI5 A;  3WXL A;  4BG9 A;  1Q18 A;  2YI1 A;  3QFU A;  1S22 A;  2UYT A;  4C23 A;  2P9I A;  1BG3 A;  3KK7 A;  2H3G X;  3SBG A;  1BA1 A;  3EL2 A;  4ILH A;  1HX1 A;  2HMP A;  3O5B A;  1P90 A;  5C12 A;  4MLE A;  2WUS A;  1SAZ A;  5AQI A;  2E88 A;  4WYB A;  1GLC G;  2HOE A;  3C6A A;  3K9J A;  1RDU A;  5EXW A;  4A2B A;  3DLL L;  2E1Y A;  3KZB A;  4ISE A;  5AQH A;  4A2A A;  4FWP A;  2GEL A;  3E66 A;  5AR0 A;  4XH5 A;  4MLH A;  3ZEU B;  2A40 A;  3R9P A;  3MCP A;  1YAG A;  2P9K B;  2D1K A;  2F9T A;  1IG8 A;  2VWB A;  2FSJ A;  3SAG A;  2ASM A;  4IOX A;  4EAH D;  5JVG L;  3VTH A;  2CH5 A;  1Q81 O;  4IO8 A;  4EHT A;  3HOT A;  4LC9 B;  4WF9 L;  4MDB A;  4YOR A;  2A3Z A;  1VQP N;  3SMP A;  4NO7 A;  5AZI B;  3O8M A;  1HKB A;  4FOE A;  4DHY A;  3C65 A;  4ILJ A;  4BRP A;  3OHR A;  2Q1N A;  4JHD A;  4PL7 A;  4CBX A;  4BR4 A;  3AY9 A;  1NGJ A;  1VQ7 N;  1HUX A;  2P9L B;  1K8K A;  3E9P A;  1ZBS A;  4GY2 B;  3O6W A;  4FWQ A;  2JWL A;  3JS6 A;  2KKZ A;  1E4F T;  3H1Q A;  4K43 A;  3H3O B;  4B1W B;  1YJN N;  3L4I A;  4CZM A;  4JKA A;  3VEV A;  3P31 A;  4BRM A;  4C1N I;  4HWI A;  5AQM A;  5BN8 A;  4H5N A;  3G6E N;  1Z6R A;  3CCU N;  1NGF A;  3PIP L;  4DKW A;  3H6E A;  3SLC A;  5BN9 A;  5GAE P;  1RFQ A;  2YHY A;  4A61 A;  2OTJ N;  3GBT A;  1BUP A;  4BRH A;  2VGM A;  5LY3 A;  1BDG A;  2Q36 A;  3VEZ A;  1T3V A;  3ZEU A;  2P9K A;  3C7N A;  2VGN A;  3ATV A;  2NRT A;  4FWO A;  3GG4 A;  4PKG A;  1TUU A;  2D4W A;  1CZA N;  3OBW A;  4BVO A;  4CI6 A;  1M90 O;  5AZJ B;  3VF4 A;  4FSV A;  1KC8 O;  4IWV A;  1W97 L;  4I6M B;  4WFB L;  1QVG M;  2HBK A;  3SJH A;  4KH6 A;  5AQW A;  4BVP A;  2W41 A;  5AZI A;  3SAF A;  3BF1 A;  3FZL A;  5M1Q A;  4B9Q A;  3VMF B;  3F5T A;  2FF6 A;  2NRW A;  5DM7 L;  3PIO L;  1NJI O;  2E2Q A;  4EFH A;  3U8X A;  5AQU A;  3MX5 A;  2P9L A;  4BC2 A;  2QWQ A;  2V7Y A;  3U9Z A;  4BQL A;  3HBT A;  4BRL A;  1RDW X;  4MO5 A;  1HJO A;  1NGG A;  1MA9 B;  2A42 A;  2NZT A;  3QB0 A;  4IEI A;  4YDU A;  4BRQ A;  3EKS A;  3TU5 A;  4AF1 A;  2Q0R A;  3O1B A;  5TKY A;  5CHI A;  1N8R O;  5AQF A;  1YI2 N;  2GUP A;  4OPA A;  3SBT A;  3EN9 A;  5BRH A;  4OO1 J;  3E9L A;  5AFU H;  3TTC A;  4FWR A;  4B1V A;  3IMX A;  4C1N K;  1BWF O;  2CGJ A;  4BRF A;  4IJA A;  1YHQ N;  3CJ1 A;  3ENH A;  2PAV A;  2VYP A;  1YVN A;  3BEX A;  3R6M A;  1HKC A;  2E2O A;  1K9M O;  5M1K A;  2NNW A;  1S72 N;  3T69 A;  2CH6 A;  4JK9 A;  4IOA L;  5AZJ A;  1T6D A;  3A5N C;  5JLH A;  1HPM A;  5GIO A;  2E1Z A;  5JVH L;  2FF3 B;  4IJN A;  3CC7 N;  2QXL A;  2NLX A;  3ZX3 A;  5AQZ A;  3KHY A;  2E8A A;  2HF3 A;  4B1Y B;  2FXU A;  3B8A X;  4WFN L;  3MN7 A;  2QEX N;  3GE1 A;  4BRC A;  5AQP A;  4K41 A;  4FVU A;  1OKJ A;  2P9N B;  1NGH A;  4H0T B;  3W0L A;  2YX6 A;  5AQO A;  2Q97 A;  5LJW A;  1SZ2 A;  1DT9 A;  5AQS A;  4F9O A;  1GLF O;  3SK3 A;  3WUH A;  4BRA A;  1YJ9 N;  1E4G T;  3C6H A;  4M7X A;  1TYQ B;  4GVE A;  3G4S N;  4FWS A;  3D2E B;  4BR9 A;  4GV9 A;  1K8K B;  3R3L A;  5ELZ A;  2KHO A;  3Q7C A;  4YOU A;  3S41 A;  4R79 A;  3KVG A;  1Q86 O;  4H0P A;  2YJF A;  4K25 A;  3MCA B;  3A0I X;  3VER A;  5EX5 A;  4QS8 A;  3VGK A;  1ATR A;  3ULE B;  3CD6 N;  3VEX A;  3FLC O;  4H5R A;  4K42 A;  1DGK N;  3O9T A;  4EIA A;  2NRH A;  2OTL N;  3QIC A;  3NVM A;  4NLB A;  3F2K A;  3CER A;  4FOI A;  3WQU A;  2PFU A;  3IFR A;  1JCG A;  1TUY A;  2IVO A;  4CJ7 A;  3GL1 A;  2AP1 A;  1ESV A;  3A5M C;  4XEI A;  4L3Q A;  2BTF A;  3C7N B;  1KAX A;  1D4X A;  5FPN A;  4CBU A;  3ZX0 A;  3MDQ A;  5F2R A;  4XH1 A;  3CCS N;  4WQ5 A;  1C0F A;  3ENB A;  5TKW A;  3R1X A;  3QFP A;  4JNE A;  3OA9 A;  4CZK A;  3ZX2 A;  4DB3 A;  4J8F A;  5F0X A;  2P9N A;  4JKH A;  1C0G A;  4FO0 A;  3TTF A;  4JKB A;  3ENO A;  3M5R A;  2I7N A;  2P9P B;  2QI2 A;  1NMD A;  2QWM A;  2A41 A;  1Z05 A;  1TYQ A;  3FR0 A;  4JK8 A;  4PKI A;  3CF5 L;  4O8U A;  4BY9 C;  3D2E A;  3I8B A;  1VQN N;  3HOS A;  2ASO A;  5CR4 A;  3WEE A;  2A5X A;  2E2N A;  3G71 N;  1H1V A;  3LDO A;  4FPB A;  4H5V A;  1KD1 O;  1ZC6 A;  2F7T A;  1XC3 A;  3AAP A;  4PKH A;  1GLB G;  3ULE A;  3CCM N;  4UY8 O;  4A62 A;  3CCV N;  1Y64 A;  3U9D A;  1QQM A;  4BRK A;  1VQM N;  1GLA G;  2ZGY A;  3CME N;  5I9E B;  3DJC A;  1VQO N;  4FWK A;  4HTL A;  4JAX A;  2RHK A;  3DXM A;  5HOO A;  1K73 O;  1DKG D;  3CCE N;  1VQ4 N;  3UKU B;  3CJ9 A;  1VAZ A;  3FFK B;  3M3Z A;  4FWM A;  4GNI A;  5AQR A;  5FPE A;  5GIN A;  3FZH A;  4U7B A;  2V52 B;  4YOV A;  3FE1 A;  1XQS C;  1YUW A;  4M7Y A;  4ILG B;  1OVY A;  3BUZ B;  2YHX A;  2W40 A;  1GLE G;  1GLJ O;  2JWK A;  2Q0U A;  3L4Q A;  3M1F A;  3P4I A;  4JN4 A;  3F9M A;  3VET A;  3VGL A;  1NM1 A;  4H5W A;  2Q31 A;  2RE2 A;  4BR5 A;  3D2F B;  1VQ8 N;  2YCH A;  1NGC A;  5BRF A;  2P9P A;  1X3N A;  3CJC A;  3E9O A;  2ZJQ L;  3NVK A;  4H0Y B;  3J8A A;  4JKC A;  1ZXO A;  4YOT A;  3EO3 A;  1KAZ A;  4FWL A;  1BU6 O;  3NMU A;  2QM1 A;  2FSK A;  3KWG A;  1M1K O;  3WQT A;  1NLV A;  3A5L C;  1VQ6 N;  3K9K A;  5AQG A;  1BA0 A;  1ATS A;  2GEM A;  3HM8 A;  3QML A;  4NB4 A;  4BRD A;  1IJJ A;  3UE5 A;  1EQY A;  3ID8 A;  4IDH A;  4DQ8 A;  3D6R A;  3H3N O;  4JD2 B;  3QBX A;  3RVC A;  1LCU A;  3UKU A;  5C2D A;  2HBL A;  5AQX A;  3Q7B A;  3LM9 A;  5BPL A;  4CZH A;  5AFU A;  3EKU A;  3CCJ N;  4FL9 A;  3T7Z A;  3N4Q A;  3HRG A;  2NRX A;  4YOX A;  4BR7 A;  5AQV A;  3P38 A;  1MWM A;  2GTD A;  1MWK A;  3CQX A;  4Y0W A;  4BRN A;  3OBY A;  1G99 A;  3CPW M;  3VTI A;  4IFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...