4BRKA

Legionella pneumophila ntpdase1 n302y variant crystal form iii (closed) in complex with mg umppnp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
359
structure length
359
Chain Sequence
TNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISYLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 124
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brkA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brkA02
5F2RA 2CGLA 4CZJA 2IVOA 2J4RA 3L4IA 2D4WA 3U8XA 3IUCA 4GNIA 1E4GT 4MO5A 5AQQA 2CGJA 2QW9A 4CZFA 1NGFA 3ZEUB 4K42A 5AQKA 4BVPA 3H1VX 1BOTO 3I33A 4ISFA 1T6CA 4AM7A 4JN4A 4M63C 1YUWA 4JHDA 3IMXA 3BEXA 1T44A 1XC3A 3W0LA 5ADXA 3ATUA 4Y0WA 3CJ1A 2A5XA 4XEIA 5AQVA 4NO7A 3VETA 1RGIA 4JD2B 2E8AA 3QMLA 4FWMA 2IVPA 2QWPA 1NGBA 4PKHA 2HF4A 2E88A 1LCUA 3H45C 1U6ZA 3EZWA 4H5TA 1X3MA 4BR7A 3R9PA 2IVNA 4IJNA 4FPAA 5AQTA 1IG8A 4L3QA 5I9EB 5AQPA 5JLHA 1HKBA 2P9KB 3H1QA 1ESVA 3DXMB 2ASOA 3UE5A 3CJ9A 2D0PA 4XH1A 2GWJA 4K43A 3D2EB 1MDUB 4B1YB 4BC3A 1ZBSA 2I7PA 3D2FA 3VGMA 4YDUC 4PL8A 2ITMA 2GTDA 3VESA 4CBWA 4WQ5C 5AQSA 1QQNA 3ID8A 3ULEA 3GOIA 1S3XA 3HTVA 3O4WA 2A40A 1D4XA 1SAZA 4EIAA 3CQXA 2E2OA 4BR0A 3SMPA 2VYPA 1V4SA 1SQKA 1K8KA 2D1KA 3QFPA 3AAPA 1NMDA 2EWSA 3DXKA 4JHDB 2Q97A 1KAYA 3MN9A 4RTFD 3SJHA 2AP1A 4BC2A 2FSKA 1BUPA 3F9MA 1MA9B 2YHYA 1KXPA 2P9PA 2P9LA 3WEEA 1NGDA 1ZXOA 3QDKA 2V7ZA 2YHWA 4BREA 5AFUA 4BRLA 1NGCA 3TPQA 5BRHA 4FWSA 3M1FA 4HWIA 2CGKA 3BF1A 4H5VA 3GL1A 4M7XA 4O8KA 3FZFA 5LJWA 2FSNA 1JCEA 2A42A 4BROA 1R59O 4GY2B 1RDWX 3O1BA 3AY9A 2E2NA 3VEWA 3EKSA 5FPNA 2ZF5O 4BRMA 2FF3B 2Q1NA 1HJOA 2Q0UA 4IJAA 2OANA 2QWQA 1WOQA 3LDPA 4EHUA 3A5LC 1X9JA 3D2FB 4MO4A 4CZIA 4ISEA 3ATVA 2QWNA 4H0PA 1J6ZA 1KAZA 4QS8A 3GE1A 3ULEB 3L6QA 4NB4A 4BC4A 1HUXA 3CJCA 1JCGA 2P9SA 3GBTA 3VEXA 1KAXA 3DWLA 2ZGYA 3O1WA 5AQZA 3O5BA 2NRHA 4H0VB 3A5MC 1K8KB 4BRDA 4XH5A 1DKGD 3C7NA 3DXKB 4FWRA 4M7YA 5KPRA 3CETA 1XUPO 1BDGA 3MN7A 3WXLA 1HX1A 4E1JA 3WEEB 2P9LB 1WUAA 2P9PB 1RFQA 3U9DA 1BG3A 1GLCG 1GLFO 1NWKA 2CH6A 4FWQA 5AQWA 1NGHA 2Q36A 1CZAN 5AZIA 3VGKA 3HI0A 3W3DA 2P9NA 3EN9A 4FWOA 4PL7A 4BGBA 3LL3A 4BRFA 5KQDA 3GDQA 2PBDA 4BVOA 3EL2A 4DB3A 2Q2RA 1NGIA 4FWPA 1XQSC 4CZGA 4RCHA 5AQFA 2GELA 1V4TA 3MN5A 4BR9A 3ZX3A 3SMSA 3LDOA 2E2PA 3JS6A 3CIPA 3KHYA 4WQ4A 3O80A 5EX5A 3H46O 1NM1A 2A3ZA 2E2QA 2P9SB 2WUSA 5AQOA 2GUPA 5JMVA 2F9WA 3HM8A 1S22A 3QICA 4A62A 4PKIA 4LC9B 3VEZA 2UYTA 1BO5O 3C7NB 2YI1A 3R6MA 4BRQA 1GLEG 5JICA 5AR0A 4BC5A 3AAQA 1ATNA 1NGEA 5LJVA 1YVNA 3FZKA 3VGLA 3WXIA 4A2BA 4CBXA 5CE3A 3CQYA 5AZIB 2V7YA 5AZJA 2A41A 2QWMA 3LDQA 3C0BA 1Q18A 2P9NB 4CJ7A 4BRKA 4K41A 3VPZA 1BU6O 5FPMA 3WXKA 2P9UA 1YAGA 5EVZA 4IO8A 1GLBG 1T6DA 3VOVA 3MN6A 4CZMA 3DAWA 1HKGA 5BN9A 4C23A 3G25A 3FFKB 5FPDA 3UB5A 3VEOA 5BPLA 5AQYA 5F0XA 5BPNA 2YHXA 2GEMA 2NLXA 1C0FA 3M3ZA 3VEYA 2IIRA 4BG9A 1Z05A 3VERA 1OKJA 2E1ZA 3QB0A 3AARA 4EAHD 2V51B 4MLEA 3U9ZA 3ZETA 1GLJO 3MDQA 3QFUA 3WT0A 3IFRA 4I6MA 3DJCA 3FZMA 3OHRA 3IDHA 2GWKA 2FXUA 2V52B 4H0TB 4H5WA 3RSEA 3SLCA 4H03B 1TUYA 2DPNA 2ASPA 1U2VA 4QS9A 2E1YA 4FSVA 2W40A 5AQXA 3CI5A 3QBWA 2Q0RA 5AZJB 5AQUA 4H5NA 3MK6A 3VENA 4FWKA 3VF6A 2P9UB 4RWTA 4BRCA 2PAVA 3O8MA 1DEJA 3I8BA 1HLUA 4MLHA 1X3NA 3LM2A 5BRDA 2D0OA 3WQUA 3FZLA 4B1ZA 4F9OA 1IJJA 2YJEA 5ELZA 3CHWA 3UKUA 4BG8A 4Z94A 2I7NA 4B1XB 4FWNA 2QWRA 1BWFO 3GG4A 3HSCA 2E20A 2ZGZA 5LY3A 4EHTA 3P4IA 4BQLA 1QZ5A 3VF2A 3QBXA 3ZETB 1MWKA 4BR2A 4CZLA 1EQYA 1DGKN 4I6MB 4BRIA 5BR9A 5KQ8A 1TYQA 4BR4A 4CZEA 3BF3A 3RSEB 4AM6A 4BRPA 3FZHA 4KBOA 4A2AA 4IZ9A 4PKGA 1U2VB 3U4LA 3WUHA 1JCFA 4FO0A 3S41A 4CBUA 4FOIA 3J8AA 1NBWA 4YDUA 4BRNA 3H3OB 2FLOA 3MCPA 4WQ5A 1BA1A 4HTLA 4H0XB 5AQNA 2F9TA 1GLDG 4WQ4C 5BN8A 5B8HA 2HMPA 5AFUH 1NLVA 2H3GX 1P8ZA 2CH5A 1NGGA 4CI6A 1NGAA 3KVGA 2Q31A 1H1VA 5AQLA 4DQ8A 5KPZA 4IXCA 3O08A 2ASMA 3LDNA 3A0IX 3H6EA 3UKUB 1Z6RA 1ZC6A 4J8FA 3CJ7A 4WYBA 4BQZA 4XH4A 3SK3A 2HF3A 3ZX0A 4CD3A 4B1UB 5KPTA 2ZWHA 5TKYA 1C0GA 2YCHA 4BRHA 4JNEA 2P9IA 2QXLA 1G99A 5AQMA 4BGAA 4CZKA 3ZX2A 3FE1A 4H0OA 5E26A 5BREA 4JAXA 1BA0A 3UKRA 5BPMA 3TU5A 3MMVA 1ATRA 1MWMA 5AQHA 4FOEA 1TUUA 1TYQB 2KHOA 4BRAA 3A5NC 2YJFA 4CD1A 4O5FA 3CJAA 3M6GA 4CZHA 4B9QA 3CERA 4EFHA 3EKUA 3B8AX 2QWLA 3A5OC 1HPMA 3HZ6A 3HBTA 3WQTA 1GLLO 2QWOA 4K25A 3O6WA 3VF4A 3L0QA 2HOEA 5AQIA 3FR0A 4H5RA 2W41A 5JLFA 4IWVA 3ZEUA 1QQOA 4BR5A 2NZTA 5AQGA 4BRGA 3EO3A 1E4FT 2FF6A 4H0YB 3D7EO 3H3NO 4DHYA 5E84A 3VEVA 5EY4A 1GLAG 3R8EA 3LDLA 5EXWA 5AQJA 4A61A 1Y64A 4JD2A 4QS7A 3BUZB 4ISGA 4FWLA 5AQRA 3ENHA 2VCPA 3ENOA 3LM9A 5BRFA 5ADXH 1SZ2A 3FLCO 3WXJA 2VWBA 1QHAA 2FSJA 1LOTB 2BTFA 2A6AA 3A8YA 4FL9A 2P9IB 5EOYA 5FPEA 2P9KA 3DXMA 5F1XA 4B1WB 1HKCA 1NGJA 3CJBA 3UKRB 3D2EA 4B1VA 1QQMA 3KZBA 1ATSA 2QM1A 4DCHA 1QZ6A 1YXQA 3BP8A 2AA4A 2BUPA 3JXUA 3FGUA 4FPBA
chains in the Genus database with same CATH superfamily
4CZJA 3PX0A 3L4IA 3IUCA 5AQQA 4JKGA 1SS6A 4A5AA 4CZFA 4E89A 3H1VX 1IKYA 2IC3A 3M8SA 1C0UA 3AVJA 3VTHA 1T44A 4Z4GA 2O8BB 4IFEA 2VGMA 3VQBA 5AQVA 3V9UA 2PY5A 4DR4K 3LP1A 4JD2B 3KLHA 1TAQA 5M1QA 2HF4A 1LCUA 3EZWA 4H5TA 4CJTA 1EO1A 3QIOA 1NJIO 1IG8A 5I9EB 4KH5A 5JLHA 1HKBA 4RW8A 3DXMB 1IBKK 2D0PA 3D2EB 1D9FA 2P51A 4BC3A 4KH6A 3NH2A 3VESA 1OH6A 5AQSA 1QQNA 3ID8A 3GOIA 3HTVA 2GV9A 2VQFK 4DR7K 4W5RA 3QNNA 4EIAA 3ALYA 5C2DA 4CW7B 4JKGB 1CXQA 5CHIA 1I94K 4PA1A 2LSNA 4AH9A 1YITN 3AAPA 4PUOA 4DSKA 1NMDA 5HRNA 3DXKA 2Q97A 3P5JA 2AP1A 3SJHA 2RN2A 4CIFA 1WLJA 2YHYA 3K9JA 3EEQA 2OCEA 3HXMA 1NKEA 3RR8A 3OYEA 2V7ZA 4BREA 1N34K 3C95A 3U3YA 4BRLA 3M1FA 1RDDA 4YFUA 4BE2A 5HRRA 3HK2A 4GY2B 3NVMA 3AY9A 4BDPA 5DM7L 1XNRK 1YT3A 4O44A 2OTLN 4BRMA 2ZF5O 2FF3B 3V1RA 2D5RA 4RW9A 5MLCQ 3KD1E 1Q81O 1L3TA 4ISEA 1QSLA 1EP4A 3ATVA 1XMOK 2QWNA 1KAZA 4QS8A 4BDYA 4JI4K 3L6QA 4OVLA 4NB4A 4BC4A 2FBXA 3KTQA 2P9SA 4IOXA 3LALA 5C12A 2ZGYA 1FK9A 3A5MC 3CFPA 3KD5E 3KK3A 4X62K 4BRDA 3MXIA 4F2RA 4X65K 1TKTA 3DXKB 4M7YA 2OZMA 5KPRA 3MN7A 1VQON 4J2BA 1K9MO 4B8CA 4AQYK 1GLCG 1GLFO 4DSEA 2CH6A 4O5BA 5AQWA 1NGHA 3UIQA 3TAPA 1CZAN 4ELVA 4IDKA 1SV5A 4CEQA 2X78A 2YNHA 3VQ4A 1VRUA 2ITGA 4FWOA 4BGBA 4BRFA 4NCBA 4BE0A 4NYNA 2GUIA 4FWPA 3ZSVA 4A5BA 2DFEA 5J2QA 1XHZA 1V4TA 1M1KO 4IDHA 4LY7A 2PFUA 1XMQK 3VQQA 1HPZA 2E2PA 1HNXK 4WQ4A 3T19A 3O80A 5EX5A 2OPSA 2O8CA 1JLFA 3SZ2A 3AVAA 2Y1IA 4FZYA 2P9SB 1REVA 2WUSA 1UAXA 4KREA 2F9WA 4CIGA 3MX5A 4FLWA 1S22A 3AO4A 3QICA 3VA0A 4PKIA 3SBGA 3VEZA 4ILHA 1RTIA 2EX3A 1GLEG 3OYDA 4KHYA 1XNQK 4AHCA 3D6RA 4BC5A 1KVCA 4CECA 2YHBA 3M8RA 1X9SA 1NGEA 3LPUA 5LJVA 3OYLA 4NCGA 3WXIA 1Z25A 4KHQA 1NK8A 4C8LA 3C94A 3DLEA 1RNHA 1SUQA 2A41A 2QWMA 3B6OA 3C0BA 4CFCA 4CJ7A 4K41A 1VSJA 5CZ2A 3WXKA 4FW1A 1VQ4N 4DV6K 1SKRA 4DU3A 3THWA 4F4KA 1YAGA 3CCMN 5EVZA 1L3UA 4DQIA 4RG8A 3VOVA 4CZMA 3DAWA 3TAGA 4CVNE 4CGHA 3G25A 3PIOL 3T3FA 3IG1A 3VQPA 2NLXA 3TSQA 3NF8A 4B9LA 4JYAK 2O8CB 1WSHA 3CCLN 3FFIA 4OKJA 4FXDA 2E1ZA 3S3OA 1S1WA 3CCRN 4EAHD 5GAHP 4H4MA 1GOBA 4MLEA 4CJSA 2YNIA 4IOCL 3WNEA 3MDQA 4CF2A 1DLOA 3FZMA 2X6SA 3IDHA 1S6QA 4E7HA 1S5JA 2GWKA 4FLTA 3PX4A 4H0TB 2HB5A 3SLCA 1U2VA 1CXUA 5AQXA 3KIOA 4B9TA 4FLVA 3DYAA 4HUEA 3NGYA 2NRWA 2Q0RA 4HHTA 3LP0A 1IBMK 1HYSA 3V1OA 2RKIA 4O4GA 3THWB 3VF6A 3TAQA 1OH5A 4BRCA 3CC4N 2HNZA 4OPAA 4OPJA 1DEJA 3I8BA 3KK2A 4HUFA 4FLXA 1HLUA 5M1OA 1IKVA 1N8RO 3HPGA 2WONA 3FZLA 2X6NA 3G4SN 3KLFA 3AO1A 1IH7A 1TK5A 1SKWA 1RTDA 4OKEA 1QSSA 4B9UA 3CCSN 4FWNA 2QWRA 1YJ9N 2ZGZA 5LY3A 1JKHA 4CJKA 1QZ5A 1X9MA 3K57A 3AVHA 2HBJA 4DSLA 4KRFA 1DGKN 3O3HA 1N33K 3CCEN 4YOTA 4DTRA 4Q0BA 4DV0K 3S3NA 4W5NA 4BR4A 3CQ8A 4YNQA 3FZHA 3G6EN 2P5OA 3OTOK 4A2AA 4PKGA 1R0AA 1U2VB 3WUHA 3T7ZA 1NBWA 3OYGA 5HL7L 4DTMA 4J2DA 2GBZA 4BRNA 3I56N 2FLOA 1CZBA 3MCPA 4H0XB 2KTQA 1T7PA 2PYJA 1GLDG 2E4LA 3L3VA 3E9LA 4WQ4C 1ASUA 3I8DA 2HMPA 5AFUH 4LFAK 3ZSRA 3OA9A 4W5TA 1HQUA 2CH5A 4C1NK 4R5PA 5AQLA 5KPZA 3O9RA 3AV9A 4IXCA 4DMNA 1QS4A 2ASMA 3A0IX 3L2WA 3F2KA 4J8FA 4M3YA 4CHQA 4WYBA 1SKSA 3J7ZO 4BQZA 3E9PA 4CD3A 5H1SQ 5DMRA 2ZWHA 5TKYA 1N32K 2QXLA 1KVBA 4C8OA 5AQMA 1JLCA 4H0OA 5E26A 5BREA 3HPHA 2PZSA 3ITHA 5AQHA 4BRAA 3TTDA 4O5FA 4CD1A 1JL1A 3CJAA 4FJ7A 3EKUA 4DKWA 1VHXA 5AJ3K 1HPMA 3HZ6A 3L2RA 1IBLK 1GLLO 4K8XA 3KK1A 1Q82O 3TSPA 5AQIA 3BGRA 2ZJQL 1RT3A 1QQOA 5JVGL 4DTNA 2HMIA 4BRGA 4W5OA 2OYQA 1ASWA 3EO3A 3ZT1A 3C65A 2VG5A 4H0YB 2Z1HA 4LH5A 5EY4A 4KHNA 2BANA 2G8HA 2HHVA 3ZSYA 1BCOA 5EXWA 3SUPA 1Y64A 4QS7A 4FWLA 3CCVN 4E0DA 2VCPA 1B92A 3QETA 3ENOA 2XY7A 3V9XA 5ADXH 2UUAK 3K5OA 4FJXA 2VWBA 1QHAA 3QINA 4QOZB 2FSJA 1LOTB 1RTHA 5EOYA 3K58A 5E41A 4B1WB 1Q7YO 3SCXA 4B1VA 1QQMA 4I9LA 2AA4A 2BUPA 4CERA 4OX9K 5FROA 4DS4A 3SPYA 3VQEA 1SL2A 2CGLA 2QXFA 4ICLA 2HHHK 3U8XA 3DLKA 5T7BA 2CGJA 2QW9A 1E3MA 1NGFA 4WCEL 5CY4A 4BVPA 1QE1A 1KVAA 1U4BA 2RE2A 3I0SA 4JHDA 4FK0A 4JV5K 1TK0A 3HJFA 3IMXA 3F9KA 3T69A 3ATUA 5I3UA 4Y0WA 4FJKA 2A5XA 4M42A 3JAMO 4LF6K 2JGUA 4NO7A 1LWFA 1RGIA 5C10A 4Y1DA 1RBTA 4KI4A 3AO2A 4PKHA 4DSFA 1HR0K 1RTJA 3SUNA 1S1VA 1RT7A 1X3MA 4IJNA 5AQTA 3OW2M 4CCHA 2NRXA 3RVCA 2ASOA 1NOYA 3CJ9A 2GWJA 3OYHA 2JWLA 2XY5A 3VGMA 4DFMA 2ITMA 4FVUA 4N76A 1VSMA 4HVJA 1ASVA 1S3XA 3NF6A 1MU2A 2A40A 1D4XA 2QA4N 3LP2A 4CHYA 4MFBA 3C6AA 4BR0A 1JLBA 3JYTA 3S9HA 1SQKA 2D1KA 4MDBA 4CJRA 2KFNA 4JHDB 4DF8A 1BUPA 1JLAA 3MX2A 1NKBA 4LFCK 1KXPA 4FK2A 4B9MA 2YHWA 3VQ6A 1QHTA 3C6HA 4H8KA 2OZSA 3P1GA 4FWSA 1TL3A 5LJWA 3RRGA 4FJJA 2FSNA 3OYKA 1XHXA 2A42A 1R59O 4PY5A 3DM2A 1IKXA 5HLFA 1N36K 3VEWA 4FM0A 5FPNA 4AHVA 4X64K 2F8TA 5KTQA 1HJOA 2Q0UA 2OANA 1WOQA 4B3RK 3CM5A 1X9JA 5CR4A 4CZIA 4CJ4A 3MXJA 4ZTJA 3CD6N 3E66A 1J6ZA 3PSFA 1HQEA 3PIPL 3GE1A 5A2QO 1BQNA 3OJUA 2UU9K 1IKWA 3GBTA 2G8KA 1JLQA 3E9OA 5AQZA 3O5BA 1DT9A 3BZKA 3K0SA 4XH5A 3JSMA 3KJVA 3AA4A 5C42A 1XUPO 3WXLA 2QI2A 4I9QA 2G8IA 3SQ1A 1NK0A 4Z4IA 3AVKA 3W3DA 3PV8A 2P9NA 2Q2RA 1NGIA 3RMDA 4RCHA 2GELA 3MN5A 3OBWA 1NK6A 4G9ZA 3PSIA 1VSKA 4JS4A 3HPOA 3KHYA 4DR1K 1EWQA 3T1HK 4YOYA 2ZQBA 3H46O 1NM1A 4F8RA 4KI6A 5FRNA 2YKMA 3SI6A 3HM8A 5HROA 4A62A 3OYJA 4KHUA 4BRQA 5JICA 5AR0A 4KHSA 2YHAA 1ATNA 3FZKA 3LZIA 3LWLA 1C1BA 1U45A 2KFZA 4BWMA 3SBTA 4DFKA 3KLGA 4OGCA 3LDQA 1KRPA 2OPRA 1Q18A 2P9NB 4JS5A 1N5YA 1RT2A 4HUGA 4DFPA 2P9UA 1JLGA 1T6DA 2NRTA 3RMAA 3ID6A 3MN6A 4YORA 4Z4HA 3LP3A 4KFBA 4GVMA 5BPLA 3VQAA 3MCAB 4DUZK 4BG9A 4B3OA 3V81A 1SL0A 4CHNA 3QB0A 3AARA 2DY4A 1W97L 4Z4CA 2QKKA 3THXA 3QFUA 3WT0A 3NH0A 3CMAN 4PWDA 4M3XA 1BCMA 4DV7K 2RF2A 4U7BA 2UXDK 2FXUA 3KK7A 2V52B 1M90O 4FLYA 1EKEA 1VQMN 5FDLA 2E1YA 2HNYA 1UWBA 3CI5A 1YF5L 2JWKA 3QBWA 4JKFA 4FLUA 2O4GA 1RBSA 4JKAA 2P9UB 3ASMA 3THYA 3O8MA 3ZSXA 3CCUN 4JKBA 4GV9A 5DK5A 1X9WA 4MLHA 4YOUA 1NOZA 3WQUA 4F9OA 4B1ZA 3SAHA 4B9VA 1IV0A 4FJMA 3N4QA 4DWIA 4KKOA 3UKUA 4IBNA 4A57A 4Z94A 4B1XB 3OJSA 4LSLA 3SAFA 1K8AO 3MXMA 3DLLL 4M41A 1BWFO 3GG4A 4UY8O 2X74A 4BQLA 1LWCA 2B4JA 4DTPA 1MWKA 3BZCA 4BR2A 3THXB 2O8EA 4FK4A 3L2QA 1IG9A 2O4IA 3QERA 3L4QA 3BF3A 4KAZA 3K2PA 4H4OA 3F73A 3U4LA 4FLZA 3SUOA 4CBUA 1WBBA 4WFBL 1VQ5N 3L8BA 4GVEA 1XC9A 4WQ5A 5AQNA 1VQ6N 1W2BM 2F8SA 5BN8A 3THYB 5B8HA 4F2SA 1LW2A 1NLVA 1RDUA 1P8ZA 1DTQA 1NGAA 3WXMB 1TKZA 2Q31A 3M8PA 3SYZA 4JI1K 4O0IA 3O08A 3H6EA 3UKUB 4OGEA 4CJEA 3LZJA 3QEPA 1OVYA 1CLQA 1B9FA 2O8DA 4IOAL 3NF9A 3ZX0A 1S1XA 5KPTA 1C0GA 4DG1A 4BRHA 2WFBA 3MEGA 2O8EB 1XI1A 3FE1A 2HNDA 3E01A 2RPIA 5BPMA 1S6PA 3DOLA 1MWMA 2HSTA 4FOEA 4Q5VA 4DF4A 1X1PA 1YJWN 4CZHA 1W9HA 4IFVA 3B8AX 3CF5L 3ZT0A 5J2NA 2QWOA 2A1SA 2I5JA 3HOTA 3DOKA 3FR0A 2W41A 3NE6A 3EE9A 4JKEA 5JLFA 3LANA 3CG7A 4JKDA 5GAEP 2R7YA 2NZTA 3O4QA 2NRZA 1E4FT 4EZ6A 3QESA 3G71N 3H3NO 3AVNA 3OYCA 3R8EA 2FBVA 3NDKA 2E5LK 4A61A 4ISGA 3TAMA 3RMBA 1FW6A 4MDAA 1SZ2A 3WXJA 4Z4EA 5JS1A 4DTOA 2O8DB 1NK7A 5C2FA 3A8YA 5FRMA 4Y1CA 3MWTA 2P9KA 4EP5A 1HKCA 3O9UA 3K59A 1ATSA 3VQ7A 5KRTA 4E7LA 2AJQA 1YTAA 3EZ5A 1D5AA 1YXQA 3ENBA 2VQEK 4B08A 3M8QA 3OS1A 4FPBA 5F2RA 4CF8A 2HHUA 2IVOA 2J4RA 3O3FA 4N5SA 3V4IA 2PYLA 4K42A 1RT1A 1BOTO 5JVHL 2DTUA 3LPTA 3NFAA 4N47A 3HP6A 2IOCA 4B9NA 3W0LA 4C1NI 5ADXA 2HHWA 3CJ1A 3VQCA 3OS0A 3AGKA 4XEIA 5M1FA 4X66K 1TV6A 4ILGB 5KRSA 3QMLA 3SAGA 5TKWA 3B6PA 4WE1A 1OH8A 4BR7A 1HNWK 2E6LA 1Z26A 4L3QA 1WN7A 2P9KB 2DFHA 1ESVA 3AVMA 1KLMA 4XH1A 4R79A 3SJJA 1MDUB 4B1YB 1U47A 3PO5A 3OBYA 3EE8A 4PL8A 4CFDA 5HBMA 4CBWA 4WQ5C 1J9AA 2FBYA 4DV5K 5EU7A 3ZYYX 1C1AA 3V9SA 1NNEA 4CIEA 2E2OA 1WSJA 3K5MA 3SQ4A 3SMPA 3CPWM 4Z4FA 3K9KA 4CHPA 1K8KA 3QFPA 3TABA 1WAFA 2EHGA 4K8ZA 1TK8A 1WAJA 4RTFD 4CGIA 4YOXA 2FSKA 1RT6A 1MA9B 3WEEA 2P9PA 2P9LA 4DTJA 1N6QA 1ZXOA 3QDKA 2OPQA 1NGCA 3SV3A 1A5VA 4HWIA 3AO3A 3BF1A 3GL1A 1WSEA 4BROA 5LL6Z 4GV6A 4ELUA 1B9DA 4FYDA 3O1BA 1KD1O 2E2NA 3OYBA 4FJGA 1NJWA 3O9SA 3HL8A 4CHOA 3KLIA 1WBDA 4EHUA 2W6KA 1EETA 3DRRA 3R1XA 2XRIA 3QIPA 4E7IA 3J7YP 2IS3A 4H0PA 2Z1IA 3PY8A 4CGGA 1HUXA 3CJCA 4BE1A 3VEXA 1KAXA 3DWLA 4ZTFA 4LH4A 2NRHA 4H0VB 1K8KB 3BY5A 1J54A 3LAKA 4FWRA 3CETA 2Z1JA 1U49A 1YVUA 3WEEB 2P9LB 2P9PB 1VQLN 4FWQA 4C8KA 2Q36A 1EX4A 3AVGA 5AZIA 1D8YA 3ZCMA 3U3GA 3HI0A 4WFNL 5CYMA 3EN9A 4PL7A 3I0RA 4LF5K 3HP9A 1ZBUA 4FJ8A 5KQDA 3GDQA 3K5LA 4BVOA 3HO1A 4CFAA 4Z0UA 4DB3A 3SUQA 4DTXA 3OYFA 4CK2A 4CZGA 3O4NA 2XHBA 3ZX3A 1F21A 1YHQN 3JS6A 3T1YK 2Y1JA 3CIPA 1S1TA 2NRRA 4KTZA 3O9TA 4FCYA 1KFSA 4DQPA 3Q7CA 2A3ZA 3MWPA 2E2QA 5AQOA 2GUPA 4KHWA 5CYQA 1LWEA 3DLGA 5JMVA 3RRHA 4LC9B 2BH1A 1TGOA 1BO5O 3O3GA 3QEVA 1A5WA 4KV8A 1TAUA 4LFBK 3AAQA 5IT9O 3IS9A 4CBXA 3V9ZA 1HMVA 3RMCA 5CE3A 4E7JA 1RDAA 5AZIB 3QEWA 3AVLA 2B5JA 1QQCA 3P31A 1IO2A 5DM6L 2A1RA 1BI4A 4KPYA 3VPZA 5FPMA 2ZM6K 4YOWA 1GOCA 1GLBG 4KHPK 3AA5X 1HKGA 3QNOA 1XWLA 1EWRA 3FFKB 5FPDA 5KI6A 3TAEA 3AVBA 5AQYA 4FZXC 4MQ3A 4O0JA 5GADP 1K6YA 4FJNA 3VEYA 3L3UA 2IIRA 1Z05A 1OKJA 3WNFA 4ZHRA 3ZSZA 4J2AA 4OO1J 3R3LA 3ZETA 4DR2K 3IFRA 4I6MA 2HHSA 4E7KA 3HYFA 5I42A 1W0HA 4NLBA 4DS5A 5J1EA 4H5WA 3RR7A 3TR8A 3P39A 4H03B 2HW3A 4JI7K 4QCLA 4QS9A 4FSVA 5KGXA 1U48A 3THVA 5K14A 3ZT4A 1QSYA 1T03A 5AQUA 3CFOA 4H5NA 1BI4B 2IAJA 1RBVA 1UA1A 3MK6A 4OPHA 4EP4A 1UOCA 1NJZA 1Q8IA 4FVMA 4CF1A 2PAVA 1FXXA 4CJQA 4DV3K 5HRSA 3D0PA 3ZSOA 4AHSA 1OVQA 1X3NA 1J5OA 5BRDA 4CJ3A 4KTQA 1BQMA 1O13A 3MAQA 2G8WA 1IJJA 3DLBA 2YJEA 4CJWA 4FJIA 4LF4K 2HVIA 2UUCK 2HHQA 3AA3A 1ITGA 3V1QA 5M1NA 2G8VA 4QAGA 2ZE2A 3CFRA 3HSCA 1HJRA 4CEOA 3VF2A 1D9DA 4DLGA 3ZETB 1P90A 4GW6A 1EQYA 4I6MB 4F3TA 1ZYQA 4JI8K 5BR9A 4FJLA 5C25A 5KQ8A 1NU0A 4JKHA 4M3WA 4DU4A 5D3GA 1S1UA 1TL1A 4PQUA 1WSIA 1JJ2M 1CZ9A 3J8AA 4I7FA 4OPKA 2NRVA 4YDUA 3H3OB 2XO7A 1BA1A 4CJ5A 1UA0A 1VK0A 4JI2K 3P83D 5IWAK 4FM2A 4CEBA 4U67L 3C6UA 2H3GX 1NGGA 3J7AP 4B8AB 4LSNA 4V19S 1H1VA 4DQ8A 2OTJN 1J53A 1Z6RA 1ZC6A 3CJ7A 3QEIA 5HOOA 4XH4A 2HF3A 3TTFA 4AF1A 2YCHA 1YI2N 1ZBIA 4CZKA 3P38A 3UKRA 4GKJK 2FC0A 3TU5A 2YV0X 1LV5A 2W42A 3VA3A 1TUUA 2KHOA 2WC9A 2Z1GA 3CC7N 3DMJA 4XIUA 4DSIA 4DV1K 3CERA 4EFHA 3OY9A 4KTWA 3NGIA 3WQTA 4K25A 3VF4A 3O6WA 4B3SK 1A5XA 1Y97A 3L0QA 1VQKN 2HOEA 3LDSA 3CPEA 4IWVA 3ZEUA 1RBUA 4BR5A 2WTUA 2BE2A 4IO9L 5AQGA 3OVNA 1I3AA 3K5NA 3CXCM 2ETJA 2F7TA 5GAGP 2WOMA 4W5QA 5E84A 4IFYA 4JI5K 4CFBA 2F4VK 1ZBLA 1VSIA 3BUZB 1C1CA 2VG7A 3MEEA 3ENHA 4LF9K 4CJLA 4WF9L 3LM9A 5BRFA 1L5UA 3FLCO 4KH4A 4OKKA 2QTDA 4GMJB 3ZT2A 2BTFA 2A6AA 4F3OA 3VTIA 3CM6A 4RW7A 1NGJA 3UKRB 4CGDA 4CF9A 4O55A 4DCHA 1QZ6A 3BP8A 3HRGA 2G8UA 3FGUA 1KC8O 4E3SA 1Q86O 2HVHA 2D4WA 4GV3A 3TARA 2D0BA 4JEPA 4GNIA 1E4GT 4MO5A 4FJ9A 3LAMA 4DR6K 2HHXA 1VQPN 3ZEUB 5AQKA 2HBLA 3Q7BA 2YX6A 5GIPA 4LF8K 3I33A 4ISFA 4AM7A 1T6CA 4CGJA 4JN4A 4M63C 1YUWA 2BGGA 3BEXA 2XY6A 1XC3A 5LMUK 4BWJA 1VQNN 4L8RB 1O1WA 3VETA 2E8AA 4FWMA 5J2PA 2IVPA 4CJPA 2QWPA 1NGBA 3J81O 4CEFA 3KLEA 1HNZK 2E88A 3H45C 1U6ZA 3R9PA 2QK9A 2IVNA 4FPAA 5AQPA 3H1QA 3UE5A 4N56A 4AHTA 4K43A 3OYMA 1WNSA 1ZBSA 2I7PA 4CEZA 3D2FA 2RHKA 1HRHA 4YDUC 3TWHA 3E1YA 2GTDA 4CF0A 2ZJPL 1VSLA 3NMUA 3ULEA 3I55N 1RDBA 3O4WA 3SQ2A 1SAZA 4CEAA 2D0AA 5HRPA 1NKCA 3CQXA 4DLEA 1G15A 4FJ5A 1C0MA 1NK9A 4JLHA 1VSHA 2VYPA 1V4SA 2VG6A 3BDPA 2EWSA 4CEEA 1T05A 1KAYA 3MN9A 4BC2A 3WNGA 3NCIA 3F9MA 3ULDA 5C24A 3ZSQA 1NMNA 1NGDA 4E1MA 1RILA 1NK5A 3TSUA 4E1NA 1SL1A 3D45A 5AFUA 1VSDA 4HTUA 3HM9A 3TPQA 5BRHA 4JRPA 2CGKA 4H5VA 4M7XA 4O8KA 3FZFA 2YKNA 3OS2A 3HT3A 1JCEA 1RDWX 2F96A 2HBMA 1RBRA 4N41A 3AVFA 2QKBA 4DQQA 3EKSA 2ZJRL 4M3RA 2Q1NA 4IJAA 2QWQA 1RCHA 3LDPA 4KB0A 1DTTA 3MECA 3A5LC 3D2FB 4MO4A 2FBTA 1T3VA 4BACA 3NBPA 3ULEB 4YHHK 3J80O 1JCGA 1VAZA 3A2FA 4JRQA 3PLAA 4ILJA 4DTSA 1OH7A 3O1WA 3N4PA 3DLRA 4NLCA 4JK8A 1NK4A 1KFDA 4WFAL 1KLNA 3NF7A 4AHUA 1DKGD 3C7NA 4ELTA 1ZBFA 2UXCK 1TKDA 1S72N 3ZLJA 4OLBA 5GIOA 1BDGA 1HX1A 1HYVA 4E1JA 4M3ZA 1VSEA 1WUAA 1RFQA 1KTQA 3U9DA 1BG3A 1NWKA 3TANA 3NGZA 4ID1A 1KQSM 1NJYA 1VQ8N 3VGKA 4ID5A 2HBKA 4NXMK 4HCCA 4E19A 3LL3A 4JI6K 2PBDA 4CK1A 3EL2A 1YJNN 4C8MA 3CCQN 1EXQA 1XQSC 3KKSA 2HHTA 5AQFA 2KQ2A 4BR9A 3SQ0A 3AGRA 1YIJN 3L2UA 5C0YA 1BGXT 3EY1A 3ISNC 3SMSA 3KWIA 3VQ5A 3LDOA 1FKOA 4UQGA 1L3VA 4DU1A 3F5TA 3G10A 1YTUA 2VWKA 3NAEA 4HCBA 4B3TK 1W7AA 3CYMA 2UYTA 3OYNA 1JL2A 4PHTX 3C7NB 1QTMA 3L2VA 2YI1A 3R6MA 1Q9YA 1S9EA 1RT4A 3VQ8A 3AO5A 3S3MA 1WSGA 2BDPA 2YNGA 1YVNA 4GKKK 3VGLA 3VMFB 4A2BA 3NVKA 4B3MK 3CQYA 3DRPA 2V7YA 5AZJA 4JI3K 4BRKA 4CESA 1TKXA 1BU6O 2W6LA 2OA8A 3HSTB 3IKMA 3VQ9A 4DFJA 3OYAA 4M45A 4IO8A 1BL3A 5BN9A 4C23A 4IG3A 3UB5A 3CC2N 2JLEA 3AA2A 3KKRA 3VEOA 3HVTA 1KCFA 3PO4A 3H08A 5F0XA 3VN5A 5BPNA 3NHGA 2YHXA 2GEMA 1C0FA 5J2MA 4JKCA 3M3ZA 2P1JA 1JXEA 1J5EK 3VERA 1HYZA 1RDCA 4G1QA 2V51B 5FLXO 3U9ZA 3U6FA 1GLJO 2ATQA 4DTUA 2KW4A 3DJCA 3OHRA 2KZZA 4CE9A 1S9GA 3HVRA 3RSEA 2XY8A 1BISA 1TUYA 4B9SA 2B6AA 2DPNA 2ASPA 3AVIA 3SV4A 4BY9C 2W40A 4AILC 2E6MA 1U04A 1LAWA 2DFFA 5AZJB 2KLAA 4M3UA 4OJRA 1Q9XA 1HNIA 3VENA 4DV2K 4FWKA 4RWTA 1VSFA 3EYZA 1FKPA 3RWUA 5M1KA 4C8NA 4DSJA 3O9QA 1WSFA 3LM2A 2D0OA 2VWJA 2O8FA 3DLHA 4DQRA 1WB9A 5M1PA 5ELZA 3CHWA 4K0KK 4BG8A 4FM1A 5HP1A 3TI0A 3WNHA 2IDOA 3LWMA 2I7NA 2KKZA 5JS2A 4LF7K 4J2EA 1HNVA 5KGWA 1C0TA 4IKFA 2E20A 4EHTA 3P4IA 3T1AA 1QVFM 3QBXA 3CMEN 3IAYA 2UUBK 3TTCA 4CZLA 5GINA 1VQ9N 1K73O 2OPPA 4BRIA 1RT5A 3KWGA 1TYQA 4CZEA 3RSEB 4AM6A 4BRPA 4KBOA 4DUYK 5CZ1A 3ZT3A 2P5GA 4IZ9A 3NH1A 1JCFA 4FJHA 4FO0A 3S41A 4CEDA 4FOIA 4KO0A 4NYFA 4NXNK 4FW2A 1FJGK 2QEXN 4DR5K 4HTLA 3M5RA 2F9TA 1NG9A 4CGFA 3VQDA 1TVRA 4BDZA 4CI6A 3RTVA 3KVGA 2O8FB 4JK7A 1VRTA 3LDNA 4KB1A 4CJUA 3CCJN 4CK3A 4I2PA 3AVCA 3SK3A 4B1UB 5BR8K 1JLEA 4OLAA 3SPZA 4JNEA 2P9IA 4BGAA 1G99A 1QVGM 1LW0A 3ZX2A 4DV4K 4JAXA 1BA0A 4IEIA 3MMVA 1ATRA 1JXBA 2UXBK 1TYQB 4RW4A 2YNFA 2Q3SA 2YJFA 3A5NC 1BIUA 3V9WA 3M6GA 4B9QA 2QWLA 1C6VA 3A5OC 4I2QA 4LD0A 3HBTA 1ZBHA 2GX9A 4FZZA 4JI0K 1LAVA 4A59A 4H5RA 2D0CA 1KSPA 2IGIA 2ZD1A 3MEDA 4CJFA 3DI6A 4CHZA 2FF6A 3PUFA 3D7EO 4DHYA 3SNNA 4IG0A 2O8BA 3VEVA 4EZ9A 1GLAG 1NJXA 4AHRA 3LDLA 1VQ7N 4RW6A 1ILYA 5AQJA 3PX6A 4O8UA 4DQSA 1L3SA 4JD2A 2G8FA 4NCAA 3C6TA 5AQRA 4YOVA 3QO9A 3TAFA 1BIZA 2NUBA 3QEXA 3IRXA 4DR3K 4M3TA 1GOAA 4JK9A 2KZMA 4FL9A 2P9IB 5FPEA 3DRSA 3DXMA 5F1XA 5SWMA 3OYIA 4YY3K 3CJBA 2WBNA 3D2EA 3KZBA 5SZTA 2QM1A 3ZSWA 3G0ZA 4CJVA 1T8EA 3QLHA 1BHLA 4IEEA 3JXUA 5LMNK 5C15A 3HOSA 2NNWA 3V6DA 1I39A 2VGNA 4TSXA
chains in the Genus database with same CATH topology
5F2RA 2CGLA 4CZJA 1KC8O 2IVOA 2J4RA 1Q86O 3L4IA 2D4WA 4GV3A 3U8XA 3IUCA 4JEPA 4GNIA 1E4GT 4JKGA 4MO5A 5AQQA 1SS6A 2CGJA 2QW9A 4A5AA 4CZFA 1VQPN 1NGFA 3ZEUB 4WCEL 4K42A 5AQKA 2HBLA 4BVPA 3Q7BA 2YX6A 3H1VX 5GIPA 1BOTO 3I33A 4ISFA 1T6CA 2RE2A 4JN4A 4AM7A 4M63C 1YUWA 5JVHL 4JHDA 3IMXA 3BEXA 3VTHA 1T44A 1XC3A 3W0LA 4C1NI 3T69A 5ADXA 4IFEA 3ATUA 2VGMA 4Y0WA 3CJ1A 2A5XA 1VQNN 3AGKA 4XEIA 5AQVA 5M1FA 4NO7A 4ILGB 3VETA 1RGIA 5C10A 4JD2B 2E8AA 3QMLA 3SAGA 4FWMA 5TKWA 2IVPA 2QWPA 1NGBA 5M1QA 4PKHA 2HF4A 2E88A 1LCUA 3H45C 1U6ZA 3EZWA 4H5TA 1X3MA 4BR7A 3R9PA 1EO1A 2IVNA 4IJNA 4FPAA 5AQTA 3OW2M 1IG8A 4L3QA 5I9EB 1NJIO 5AQPA 4KH5A 5JLHA 1HKBA 2NRXA 3RVCA 2P9KB 3H1QA 1ESVA 3DXMB 2ASOA 3UE5A 3CJ9A 4R79A 2D0PA 4XH1A 2GWJA 4K43A 3D2EB 2JWLA 1MDUB 4B1YB 4BC3A 3OBYA 1ZBSA 4KH6A 2I7PA 3EE8A 3D2FA 3VGMA 2RHKA 4YDUC 4PL8A 2ITMA 3E1YA 2GTDA 3VESA 4FVUA 2ZJPL 4CBWA 4WQ5C 5AQSA 1QQNA 3NMUA 3ID8A 3ULEA 3I55N 3GOIA 1S3XA 3HTVA 3O4WA 2A40A 1D4XA 3ZYYX 1SAZA 2QA4N 4EIAA 3CQXA 5C2DA 2E2OA 4JKGB 3C6AA 5CHIA 4BR0A 3SMPA 3CPWM 3K9KA 2VYPA 1V4SA 1SQKA 1K8KA 2D1KA 3QFPA 4MDBA 1YITN 3AAPA 1NMDA 2EWSA 3DXKA 4JHDB 2Q97A 1KAYA 3MN9A 4RTFD 4YOXA 3SJHA 2AP1A 4BC2A 2FSKA 1BUPA 3F9MA 3MX2A 1MA9B 2YHYA 1KXPA 2P9PA 2P9LA 3WEEA 3K9JA 1NGDA 1ZXOA 3QDKA 3TSUA 2V7ZA 2YHWA 4BREA 5AFUA 3C6HA 1NGCA 4BRLA 3TPQA 5BRHA 4FWSA 3M1FA 4HWIA 2CGKA 3BF1A 4H5VA 3GL1A 4M7XA 4O8KA 3FZFA 5LJWA 2FSNA 1JCEA 2A42A 4BROA 1R59O 4GY2B 4GV6A 1RDWX 2HBMA 3O1BA 3NVMA 3AY9A 1KD1O 2E2NA 5DM7L 3VEWA 2OTLN 3EKSA 5FPNA 2ZF5O 4BRMA 2FF3B 3O9SA 2ZJRL 2Q1NA 1HJOA 2Q0UA 4IJAA 5MLCQ 2OANA 2QWQA 1WOQA 3LDPA 4EHUA 1Q81O 3R1XA 3A5LC 1X9JA 5CR4A 3D2FB 4MO4A 4CZIA 4ISEA 3CD6N 3ATVA 2QWNA 3E66A 1J6ZA 1KAZA 1T3VA 4H0PA 4QS8A 3PIPL 3GE1A 3ULEB 3L6QA 4NB4A 4BC4A 1HUXA 3CJCA 1JCGA 1VAZA 2P9SA 3GBTA 3VEXA 3PLAA 1KAXA 4ILJA 4IOXA 3DWLA 5C12A 2ZGYA 3E9OA 3O1WA 3N4PA 5AQZA 3O5BA 4NLCA 4JK8A 1DT9A 2NRHA 4H0VB 3A5MC 1K8KB 4BRDA 4WFAL 4XH5A 1DKGD 3C7NA 3DXKB 4FWRA 4M7YA 5KPRA 3CETA 1S72N 1XUPO 5GIOA 1BDGA 3MN7A 3WXLA 1VQON 1HX1A 4E1JA 2QI2A 3WEEB 2P9LB 1WUAA 2P9PB 1K9MO 1VQLN 1RFQA 3U9DA 1BG3A 1GLCG 1GLFO 1NWKA 2CH6A 4FWQA 5AQWA 1NGHA 2Q36A 1CZAN 1KQSM 1VQ8N 5AZIA 3VGKA 3HI0A 4WFNL 2HBKA 3W3DA 2P9NA 3EN9A 4FWOA 4PL7A 4BGBA 3LL3A 4BRFA 5KQDA 3GDQA 2PBDA 4BVOA 3EL2A 1YJNN 4DB3A 2Q2RA 3CCQN 1NGIA 4FWPA 1XQSC 4CZGA 4RCHA 4A5BA 5AQFA 2GELA 1V4TA 3MN5A 3OBWA 4IDHA 4BR9A 3AGRA 1M1KO 2PFUA 4G9ZA 1YIJN 3ZX3A 5C0YA 3SMSA 1YHQN 3KWIA 3LDOA 2E2PA 3JS6A 3CIPA 3KHYA 4WQ4A 2NRRA 3O9TA 3O80A 5EX5A 4YOYA 3H46O 1NM1A 2A3ZA 2E2QA 3MWPA 2P9SB 3Q7CA 2WUSA 5AQOA 2GUPA 3F5TA 5JMVA 2F9WA 3HM8A 3MX5A 1S22A 3QICA 4A62A 4PKIA 3SBGA 4LC9B 2BH1A 3VEZA 2UYTA 4PHTX 1BO5O 3C7NB 4ILHA 2YI1A 3R6MA 4BRQA 1GLEG 5JICA 5AR0A 3D6RA 4BC5A 3AAQA 1ATNA 1NGEA 5LJVA 1YVNA 3FZKA 3VGLA 3VMFB 3WXIA 4A2BA 4CBXA 3NVKA 5CE3A 3CQYA 5AZIB 3SBTA 2V7YA 5AZJA 2A41A 2QWMA 3P31A 5DM6L 3LDQA 3C0BA 1Q18A 2P9NB 4CJ7A 4BRKA 4K41A 3VPZA 1BU6O 5FPMA 3WXKA 1VQ4N 3IKMA 2P9UA 4YOWA 1YAGA 3CCMN 5EVZA 4IO8A 1GLBG 1T6DA 3VOVA 2NRTA 3ID6A 3MN6A 4CZMA 3DAWA 1HKGA 5BN9A 4C23A 4YORA 3G25A 3PIOL 3FFKB 5FPDA 3UB5A 3CC2N 3VEOA 5BPLA 5AQYA 5F0XA 3MCAB 5BPNA 2YHXA 2GEMA 2NLXA 3TSQA 1C0FA 5GADP 4JKCA 3M3ZA 3VEYA 2IIRA 4BG9A 3CCLN 1Z05A 3VERA 1OKJA 2E1ZA 3QB0A 3AARA 1W97L 3CCRN 4EAHD 2V51B 5GAHP 4MLEA 3U9ZA 3R3LA 3ZETA 4IOCL 4OO1J 1GLJO 3MDQA 3QFUA 3WT0A 3IFRA 3CMAN 4I6MA 3DJCA 3FZMA 3OHRA 3IDHA 2GWKA 4U7BA 4NLBA 2FXUA 3KK7A 2V52B 4H0TB 4H5WA 3RSEA 1M90O 3P39A 4H03B 3SLCA 1TUYA 2DPNA 1VQMN 2ASPA 1U2VA 4QS9A 2E1YA 4FSVA 4BY9C 2W40A 5AQXA 3CI5A 1YF5L 2JWKA 3QBWA 4JKFA 2NRWA 2Q0RA 5AZJB 2KLAA 5AQUA 4H5NA 3MK6A 4OPHA 3VENA 4JKAA 4FWKA 3VF6A 2P9UB 4RWTA 4BRCA 3CC4N 2PAVA 4OPAA 5M1KA 3O8MA 3O9QA 1DEJA 3I8BA 3CCUN 4JKBA 4GV9A 1HLUA 5M1OA 4MLHA 1N8RO 1X3NA 3LM2A 5BRDA 4YOUA 2D0OA 3WQUA 3FZLA 4B1ZA 4F9OA 3SAHA 1O13A 3G4SN 1IJJA 3N4QA 2YJEA 5M1PA 5ELZA 3CHWA 3UKUA 4BG8A 4A57A 4Z94A 5M1NA 2I7NA 2KKZA 4B1XB 3CCSN 4FWNA 3SAFA 1K8AO 3DLLL 2QWRA 1BWFO 3GG4A 3HSCA 1YJ9N 4UY8O 2E20A 2ZGZA 5LY3A 4EHTA 3P4IA 4BQLA 1QVFM 1QZ5A 3VF2A 3QBXA 3ZETB 3CMEN 1MWKA 2HBJA 3TTCA 1P90A 4BR2A 4CZLA 1EQYA 1DGKN 4I6MB 5GINA 1VQ9N 1K73O 4BRIA 5BR9A 3CCEN 3KWGA 4YOTA 5KQ8A 3L4QA 1TYQA 4JKHA 4BR4A 4CZEA 3BF3A 3RSEB 4AM6A 4BRPA 3FZHA 4KBOA 3G6EN 4A2AA 4IZ9A 4PKGA 1U2VB 3U4LA 3WUHA 1JCFA 3T7ZA 4FO0A 3S41A 4CBUA 1JJ2M 4FOIA 3J8AA 1NBWA 4WFBL 5HL7L 1VQ5N 2NRVA 4YDUA 4GVEA 4BRNA 3H3OB 3I56N 2FLOA 3MCPA 4WQ5A 2QEXN 1BA1A 4HTLA 3M5RA 4H0XB 5AQNA 2F9TA 1VQ6N 1GLDG 1W2BM 3E9LA 4WQ4C 5BN8A 5B8HA 2HMPA 5AFUH 4U67L 1NLVA 1RDUA 3OA9A 2H3GX 1P8ZA 2CH5A 1NGGA 4CI6A 1NGAA 4C1NK 3WXMB 3KVGA 2Q31A 1H1VA 3O9RA 5AQLA 4DQ8A 5KPZA 2OTJN 4IXCA 3O08A 4JK7A 2ASMA 3LDNA 3A0IX 3H6EA 3UKUB 3F2KA 3CCJN 1Z6RA 1ZC6A 4J8FA 3CJ7A 1OVYA 4WYBA 5HOOA 3J7ZO 4BQZA 4XH4A 3SK3A 4IOAL 2HF3A 3ZX0A 3E9PA 3TTFA 4B1UB 4CD3A 5KPTA 5H1SQ 2ZWHA 5TKYA 1C0GA 2YCHA 4AF1A 4BRHA 4JNEA 2WFBA 2P9IA 2QXLA 1G99A 5AQMA 4BGAA 1YI2N 1QVGM 4CZKA 3ZX2A 3FE1A 4H0OA 3P38A 5E26A 5BREA 4JAXA 1BA0A 3UKRA 4IEIA 5BPMA 3TU5A 3MMVA 1ATRA 1MWMA 5AQHA 2HSTA 4FOEA 1TUUA 1TYQB 2KHOA 4BRAA 2WC9A 3A5NC 2YJFA 3TTDA 4O5FA 4CD1A 1YJWN 3CC7N 3CJAA 3M6GA 4CZHA 4B9QA 3CERA 4EFHA 3EKUA 3B8AX 2QWLA 4DKWA 3A5OC 1HPMA 3CF5L 3HZ6A 3HBTA 3WQTA 2GX9A 1GLLO 2QWOA 4K25A 3O6WA 3VF4A 1Q82O 3TSPA 3HOTA 3L0QA 1VQKN 2HOEA 5AQIA 4A59A 3FR0A 2ZJQL 4H5RA 2W41A 3CPEA 3EE9A 4JKEA 4IWVA 3ZEUA 5JLFA 1QQOA 4BR5A 5JVGL 5GAEP 4JKDA 4IO9L 2NZTA 5AQGA 2NRZA 4BRGA 3EO3A 1E4FT 2FF6A 3C65A 4H0YB 3G71N 3D7EO 3H3NO 3CXCM 2F7TA 5GAGP 4DHYA 5E84A 3VEVA 5EY4A 1GLAG 3R8EA 3LDLA 1VQ7N 5EXWA 1ILYA 5AQJA 4O8UA 4A61A 1Y64A 4JD2A 4QS7A 3BUZB 4ISGA 4FWLA 3CCVN 5AQRA 3ENHA 4YOVA 2VCPA 4WF9L 3ENOA 3LM9A 4MDAA 5BRFA 5ADXH 1SZ2A 3FLCO 3WXJA 2VWBA 1QHAA 4KH4A 2QTDA 2FSJA 1LOTB 2BTFA 4JK9A 2A6AA 5C2FA 3A8YA 4FL9A 2P9IB 5EOYA 3MWTA 3VTIA 5FPEA 2P9KA 3DXMA 5F1XA 4B1WB 1Q7YO 1HKCA 1NGJA 3CJBA 2WBNA 3D2EA 3O9UA 3UKRB 4B1VA 1QQMA 3KZBA 1ATSA 2QM1A 4DCHA 1QZ6A 4IEEA 1YXQA 3BP8A 2AA4A 2BUPA 3ENBA 3HRGA 3JXUA 5C15A 3HOSA 3FGUA 2NNWA 2VGNA 4FPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F2R A;  2CGL A;  4CZJ A;  2IVO A;  2J4R A;  3L4I A;  2D4W A;  3U8X A;  3IUC A;  4GNI A;  1E4G T;  4MO5 A;  5AQQ A;  2CGJ A;  2QW9 A;  4CZF A;  1NGF A;  3ZEU B;  4K42 A;  5AQK A;  4BVP A;  3H1V X;  1BOT O;  3I33 A;  4ISF A;  1T6C A;  4AM7 A;  4JN4 A;  4M63 C;  1YUW A;  4JHD A;  3IMX A;  3BEX A;  1T44 A;  1XC3 A;  3W0L A;  5ADX A;  3ATU A;  4Y0W A;  3CJ1 A;  2A5X A;  4XEI A;  5AQV A;  4NO7 A;  3VET A;  1RGI A;  4JD2 B;  2E8A A;  3QML A;  4FWM A;  2IVP A;  2QWP A;  1NGB A;  4PKH A;  2HF4 A;  2E88 A;  1LCU A;  3H45 C;  1U6Z A;  3EZW A;  4H5T A;  1X3M A;  4BR7 A;  3R9P A;  2IVN A;  4IJN A;  4FPA A;  5AQT A;  1IG8 A;  4L3Q A;  5I9E B;  5AQP A;  5JLH A;  1HKB A;  2P9K B;  3H1Q A;  1ESV A;  3DXM B;  2ASO A;  3UE5 A;  3CJ9 A;  2D0P A;  4XH1 A;  2GWJ A;  4K43 A;  3D2E B;  1MDU B;  4B1Y B;  4BC3 A;  1ZBS A;  2I7P A;  3D2F A;  3VGM A;  4YDU C;  4PL8 A;  2ITM A;  2GTD A;  3VES A;  4CBW A;  4WQ5 C;  5AQS A;  1QQN A;  3ID8 A;  3ULE A;  3GOI A;  1S3X A;  3HTV A;  3O4W A;  2A40 A;  1D4X A;  1SAZ A;  4EIA A;  3CQX A;  2E2O A;  4BR0 A;  3SMP A;  2VYP A;  1V4S A;  1SQK A;  1K8K A;  2D1K A;  3QFP A;  3AAP A;  1NMD A;  2EWS A;  3DXK A;  4JHD B;  2Q97 A;  1KAY A;  3MN9 A;  4RTF D;  3SJH A;  2AP1 A;  4BC2 A;  2FSK A;  1BUP A;  3F9M A;  1MA9 B;  2YHY A;  1KXP A;  2P9P A;  2P9L A;  3WEE A;  1NGD A;  1ZXO A;  3QDK A;  2V7Z A;  2YHW A;  4BRE A;  5AFU A;  4BRL A;  1NGC A;  3TPQ A;  5BRH A;  4FWS A;  3M1F A;  4HWI A;  2CGK A;  3BF1 A;  4H5V A;  3GL1 A;  4M7X A;  4O8K A;  3FZF A;  5LJW A;  2FSN A;  1JCE A;  2A42 A;  4BRO A;  1R59 O;  4GY2 B;  1RDW X;  3O1B A;  3AY9 A;  2E2N A;  3VEW A;  3EKS A;  5FPN A;  2ZF5 O;  4BRM A;  2FF3 B;  2Q1N A;  1HJO A;  2Q0U A;  4IJA A;  2OAN A;  2QWQ A;  1WOQ A;  3LDP A;  4EHU A;  3A5L C;  1X9J A;  3D2F B;  4MO4 A;  4CZI A;  4ISE A;  3ATV A;  2QWN A;  4H0P A;  1J6Z A;  1KAZ A;  4QS8 A;  3GE1 A;  3ULE B;  3L6Q A;  4NB4 A;  4BC4 A;  1HUX A;  3CJC A;  1JCG A;  2P9S A;  3GBT A;  3VEX A;  1KAX A;  3DWL A;  2ZGY A;  3O1W A;  5AQZ A;  3O5B A;  2NRH A;  4H0V B;  3A5M C;  1K8K B;  4BRD A;  4XH5 A;  1DKG D;  3C7N A;  3DXK B;  4FWR A;  4M7Y A;  5KPR A;  3CET A;  1XUP O;  1BDG A;  3MN7 A;  3WXL A;  1HX1 A;  4E1J A;  3WEE B;  2P9L B;  1WUA A;  2P9P B;  1RFQ A;  3U9D A;  1BG3 A;  1GLC G;  1GLF O;  1NWK A;  2CH6 A;  4FWQ A;  5AQW A;  1NGH A;  2Q36 A;  1CZA N;  5AZI A;  3VGK A;  3HI0 A;  3W3D A;  2P9N A;  3EN9 A;  4FWO A;  4PL7 A;  4BGB A;  3LL3 A;  4BRF A;  5KQD A;  3GDQ A;  2PBD A;  4BVO A;  3EL2 A;  4DB3 A;  2Q2R A;  1NGI A;  4FWP A;  1XQS C;  4CZG A;  4RCH A;  5AQF A;  2GEL A;  1V4T A;  3MN5 A;  4BR9 A;  3ZX3 A;  3SMS A;  3LDO A;  2E2P A;  3JS6 A;  3CIP A;  3KHY A;  4WQ4 A;  3O80 A;  5EX5 A;  3H46 O;  1NM1 A;  2A3Z A;  2E2Q A;  2P9S B;  2WUS A;  5AQO A;  2GUP A;  5JMV A;  2F9W A;  3HM8 A;  1S22 A;  3QIC A;  4A62 A;  4PKI A;  4LC9 B;  3VEZ A;  2UYT A;  1BO5 O;  3C7N B;  2YI1 A;  3R6M A;  4BRQ A;  1GLE G;  5JIC A;  5AR0 A;  4BC5 A;  3AAQ A;  1ATN A;  1NGE A;  5LJV A;  1YVN A;  3FZK A;  3VGL A;  3WXI A;  4A2B A;  4CBX A;  5CE3 A;  3CQY A;  5AZI B;  2V7Y A;  5AZJ A;  2A41 A;  2QWM A;  3LDQ A;  3C0B A;  1Q18 A;  2P9N B;  4CJ7 A;  4BRK A;  4K41 A;  3VPZ A;  1BU6 O;  5FPM A;  3WXK A;  2P9U A;  1YAG A;  5EVZ A;  4IO8 A;  1GLB G;  1T6D A;  3VOV A;  3MN6 A;  4CZM A;  3DAW A;  1HKG A;  5BN9 A;  4C23 A;  3G25 A;  3FFK B;  5FPD A;  3UB5 A;  3VEO A;  5BPL A;  5AQY A;  5F0X A;  5BPN A;  2YHX A;  2GEM A;  2NLX A;  1C0F A;  3M3Z A;  3VEY A;  2IIR A;  4BG9 A;  1Z05 A;  3VER A;  1OKJ A;  2E1Z A;  3QB0 A;  3AAR A;  4EAH D;  2V51 B;  4MLE A;  3U9Z A;  3ZET A;  1GLJ O;  3MDQ A;  3QFU A;  3WT0 A;  3IFR A;  4I6M A;  3DJC A;  3FZM A;  3OHR A;  3IDH A;  2GWK A;  2FXU A;  2V52 B;  4H0T B;  4H5W A;  3RSE A;  3SLC A;  4H03 B;  1TUY A;  2DPN A;  2ASP A;  1U2V A;  4QS9 A;  2E1Y A;  4FSV A;  2W40 A;  5AQX A;  3CI5 A;  3QBW A;  2Q0R A;  5AZJ B;  5AQU A;  4H5N A;  3MK6 A;  3VEN A;  4FWK A;  3VF6 A;  2P9U B;  4RWT A;  4BRC A;  2PAV A;  3O8M A;  1DEJ A;  3I8B A;  1HLU A;  4MLH A;  1X3N A;  3LM2 A;  5BRD A;  2D0O A;  3WQU A;  3FZL A;  4B1Z A;  4F9O A;  1IJJ A;  2YJE A;  5ELZ A;  3CHW A;  3UKU A;  4BG8 A;  4Z94 A;  2I7N A;  4B1X B;  4FWN A;  2QWR A;  1BWF O;  3GG4 A;  3HSC A;  2E20 A;  2ZGZ A;  5LY3 A;  4EHT A;  3P4I A;  4BQL A;  1QZ5 A;  3VF2 A;  3QBX A;  3ZET B;  1MWK A;  4BR2 A;  4CZL A;  1EQY A;  1DGK N;  4I6M B;  4BRI A;  5BR9 A;  5KQ8 A;  1TYQ A;  4BR4 A;  4CZE A;  3BF3 A;  3RSE B;  4AM6 A;  4BRP A;  3FZH A;  4KBO A;  4A2A A;  4IZ9 A;  4PKG A;  1U2V B;  3U4L A;  3WUH A;  1JCF A;  4FO0 A;  3S41 A;  4CBU A;  4FOI A;  3J8A A;  1NBW A;  4YDU A;  4BRN A;  3H3O B;  2FLO A;  3MCP A;  4WQ5 A;  1BA1 A;  4HTL A;  4H0X B;  5AQN A;  2F9T A;  1GLD G;  4WQ4 C;  5BN8 A;  5B8H A;  2HMP A;  5AFU H;  1NLV A;  2H3G X;  1P8Z A;  2CH5 A;  1NGG A;  4CI6 A;  1NGA A;  3KVG A;  2Q31 A;  1H1V A;  5AQL A;  4DQ8 A;  5KPZ A;  4IXC A;  3O08 A;  2ASM A;  3LDN A;  3A0I X;  3H6E A;  3UKU B;  1Z6R A;  1ZC6 A;  4J8F A;  3CJ7 A;  4WYB A;  4BQZ A;  4XH4 A;  3SK3 A;  2HF3 A;  3ZX0 A;  4CD3 A;  4B1U B;  5KPT A;  2ZWH A;  5TKY A;  1C0G A;  2YCH A;  4BRH A;  4JNE A;  2P9I A;  2QXL A;  1G99 A;  5AQM A;  4BGA A;  4CZK A;  3ZX2 A;  3FE1 A;  4H0O A;  5E26 A;  5BRE A;  4JAX A;  1BA0 A;  3UKR A;  5BPM A;  3TU5 A;  3MMV A;  1ATR A;  1MWM A;  5AQH A;  4FOE A;  1TUU A;  1TYQ B;  2KHO A;  4BRA A;  3A5N C;  2YJF A;  4CD1 A;  4O5F A;  3CJA A;  3M6G A;  4CZH A;  4B9Q A;  3CER A;  4EFH A;  3EKU A;  3B8A X;  2QWL A;  3A5O C;  1HPM A;  3HZ6 A;  3HBT A;  3WQT A;  1GLL O;  2QWO A;  4K25 A;  3O6W A;  3VF4 A;  3L0Q A;  2HOE A;  5AQI A;  3FR0 A;  4H5R A;  2W41 A;  5JLF A;  4IWV A;  3ZEU A;  1QQO A;  4BR5 A;  2NZT A;  5AQG A;  4BRG A;  3EO3 A;  1E4F T;  2FF6 A;  4H0Y B;  3D7E O;  3H3N O;  4DHY A;  5E84 A;  3VEV A;  5EY4 A;  1GLA G;  3R8E A;  3LDL A;  5EXW A;  5AQJ A;  4A61 A;  1Y64 A;  4JD2 A;  4QS7 A;  3BUZ B;  4ISG A;  4FWL A;  5AQR A;  3ENH A;  2VCP A;  3ENO A;  3LM9 A;  5BRF A;  5ADX H;  1SZ2 A;  3FLC O;  3WXJ A;  2VWB A;  1QHA A;  2FSJ A;  1LOT B;  2BTF A;  2A6A A;  3A8Y A;  4FL9 A;  2P9I B;  5EOY A;  5FPE A;  2P9K A;  3DXM A;  5F1X A;  4B1W B;  1HKC A;  1NGJ A;  3CJB A;  3UKR B;  3D2E A;  4B1V A;  1QQM A;  3KZB A;  1ATS A;  2QM1 A;  4DCH A;  1QZ6 A;  1YXQ A;  3BP8 A;  2AA4 A;  2BUP A;  3JXU A;  3FGU A;  4FPB A; 
#chains in the Genus database with same CATH topology
 4CZJ A;  3PX0 A;  3L4I A;  3IUC A;  5AQQ A;  4JKG A;  1SS6 A;  4A5A A;  4CZF A;  4E89 A;  3H1V X;  1IKY A;  2IC3 A;  3M8S A;  1C0U A;  3AVJ A;  3VTH A;  1T44 A;  4Z4G A;  2O8B B;  4IFE A;  2VGM A;  3VQB A;  5AQV A;  3V9U A;  2PY5 A;  4DR4 K;  3LP1 A;  4JD2 B;  3KLH A;  1TAQ A;  5M1Q A;  2HF4 A;  1LCU A;  3EZW A;  4H5T A;  4CJT A;  1EO1 A;  3QIO A;  1NJI O;  1IG8 A;  5I9E B;  4KH5 A;  5JLH A;  1HKB A;  4RW8 A;  3DXM B;  1IBK K;  2D0P A;  3D2E B;  1D9F A;  2P51 A;  4BC3 A;  4KH6 A;  3NH2 A;  3VES A;  1OH6 A;  5AQS A;  1QQN A;  3ID8 A;  3GOI A;  3HTV A;  2GV9 A;  2VQF K;  4DR7 K;  4W5R A;  3QNN A;  4EIA A;  3ALY A;  5C2D A;  4CW7 B;  4JKG B;  1CXQ A;  5CHI A;  1I94 K;  4PA1 A;  2LSN A;  4AH9 A;  1YIT N;  3AAP A;  4PUO A;  4DSK A;  1NMD A;  5HRN A;  3DXK A;  2Q97 A;  3P5J A;  2AP1 A;  3SJH A;  2RN2 A;  4CIF A;  1WLJ A;  2YHY A;  3K9J A;  3EEQ A;  2OCE A;  3HXM A;  1NKE A;  3RR8 A;  3OYE A;  2V7Z A;  4BRE A;  1N34 K;  3C95 A;  3U3Y A;  4BRL A;  3M1F A;  1RDD A;  4YFU A;  4BE2 A;  5HRR A;  3HK2 A;  4GY2 B;  3NVM A;  3AY9 A;  4BDP A;  5DM7 L;  1XNR K;  1YT3 A;  4O44 A;  2OTL N;  4BRM A;  2ZF5 O;  2FF3 B;  3V1R A;  2D5R A;  4RW9 A;  5MLC Q;  3KD1 E;  1Q81 O;  1L3T A;  4ISE A;  1QSL A;  1EP4 A;  3ATV A;  1XMO K;  2QWN A;  1KAZ A;  4QS8 A;  4BDY A;  4JI4 K;  3L6Q A;  4OVL A;  4NB4 A;  4BC4 A;  2FBX A;  3KTQ A;  2P9S A;  4IOX A;  3LAL A;  5C12 A;  2ZGY A;  1FK9 A;  3A5M C;  3CFP A;  3KD5 E;  3KK3 A;  4X62 K;  4BRD A;  3MXI A;  4F2R A;  4X65 K;  1TKT A;  3DXK B;  4M7Y A;  2OZM A;  5KPR A;  3MN7 A;  1VQO N;  4J2B A;  1K9M O;  4B8C A;  4AQY K;  1GLC G;  1GLF O;  4DSE A;  2CH6 A;  4O5B A;  5AQW A;  1NGH A;  3UIQ A;  3TAP A;  1CZA N;  4ELV A;  4IDK A;  1SV5 A;  4CEQ A;  2X78 A;  2YNH A;  3VQ4 A;  1VRU A;  2ITG A;  4FWO A;  4BGB A;  4BRF A;  4NCB A;  4BE0 A;  4NYN A;  2GUI A;  4FWP A;  3ZSV A;  4A5B A;  2DFE A;  5J2Q A;  1XHZ A;  1V4T A;  1M1K O;  4IDH A;  4LY7 A;  2PFU A;  1XMQ K;  3VQQ A;  1HPZ A;  2E2P A;  1HNX K;  4WQ4 A;  3T19 A;  3O80 A;  5EX5 A;  2OPS A;  2O8C A;  1JLF A;  3SZ2 A;  3AVA A;  2Y1I A;  4FZY A;  2P9S B;  1REV A;  2WUS A;  1UAX A;  4KRE A;  2F9W A;  4CIG A;  3MX5 A;  4FLW A;  1S22 A;  3AO4 A;  3QIC A;  3VA0 A;  4PKI A;  3SBG A;  3VEZ A;  4ILH A;  1RTI A;  2EX3 A;  1GLE G;  3OYD A;  4KHY A;  1XNQ K;  4AHC A;  3D6R A;  4BC5 A;  1KVC A;  4CEC A;  2YHB A;  3M8R A;  1X9S A;  1NGE A;  3LPU A;  5LJV A;  3OYL A;  4NCG A;  3WXI A;  1Z25 A;  4KHQ A;  1NK8 A;  4C8L A;  3C94 A;  3DLE A;  1RNH A;  1SUQ A;  2A41 A;  2QWM A;  3B6O A;  3C0B A;  4CFC A;  4CJ7 A;  4K41 A;  1VSJ A;  5CZ2 A;  3WXK A;  4FW1 A;  1VQ4 N;  4DV6 K;  1SKR A;  4DU3 A;  3THW A;  4F4K A;  1YAG A;  3CCM N;  5EVZ A;  1L3U A;  4DQI A;  4RG8 A;  3VOV A;  4CZM A;  3DAW A;  3TAG A;  4CVN E;  4CGH A;  3G25 A;  3PIO L;  3T3F A;  3IG1 A;  3VQP A;  2NLX A;  3TSQ A;  3NF8 A;  4B9L A;  4JYA K;  2O8C B;  1WSH A;  3CCL N;  3FFI A;  4OKJ A;  4FXD A;  2E1Z A;  3S3O A;  1S1W A;  3CCR N;  4EAH D;  5GAH P;  4H4M A;  1GOB A;  4MLE A;  4CJS A;  2YNI A;  4IOC L;  3WNE A;  3MDQ A;  4CF2 A;  1DLO A;  3FZM A;  2X6S A;  3IDH A;  1S6Q A;  4E7H A;  1S5J A;  2GWK A;  4FLT A;  3PX4 A;  4H0T B;  2HB5 A;  3SLC A;  1U2V A;  1CXU A;  5AQX A;  3KIO A;  4B9T A;  4FLV A;  3DYA A;  4HUE A;  3NGY A;  2NRW A;  2Q0R A;  4HHT A;  3LP0 A;  1IBM K;  1HYS A;  3V1O A;  2RKI A;  4O4G A;  3THW B;  3VF6 A;  3TAQ A;  1OH5 A;  4BRC A;  3CC4 N;  2HNZ A;  4OPA A;  4OPJ A;  1DEJ A;  3I8B A;  3KK2 A;  4HUF A;  4FLX A;  1HLU A;  5M1O A;  1IKV A;  1N8R O;  3HPG A;  2WON A;  3FZL A;  2X6N A;  3G4S N;  3KLF A;  3AO1 A;  1IH7 A;  1TK5 A;  1SKW A;  1RTD A;  4OKE A;  1QSS A;  4B9U A;  3CCS N;  4FWN A;  2QWR A;  1YJ9 N;  2ZGZ A;  5LY3 A;  1JKH A;  4CJK A;  1QZ5 A;  1X9M A;  3K57 A;  3AVH A;  2HBJ A;  4DSL A;  4KRF A;  1DGK N;  3O3H A;  1N33 K;  3CCE N;  4YOT A;  4DTR A;  4Q0B A;  4DV0 K;  3S3N A;  4W5N A;  4BR4 A;  3CQ8 A;  4YNQ A;  3FZH A;  3G6E N;  2P5O A;  3OTO K;  4A2A A;  4PKG A;  1R0A A;  1U2V B;  3WUH A;  3T7Z A;  1NBW A;  3OYG A;  5HL7 L;  4DTM A;  4J2D A;  2GBZ A;  4BRN A;  3I56 N;  2FLO A;  1CZB A;  3MCP A;  4H0X B;  2KTQ A;  1T7P A;  2PYJ A;  1GLD G;  2E4L A;  3L3V A;  3E9L A;  4WQ4 C;  1ASU A;  3I8D A;  2HMP A;  5AFU H;  4LFA K;  3ZSR A;  3OA9 A;  4W5T A;  1HQU A;  2CH5 A;  4C1N K;  4R5P A;  5AQL A;  5KPZ A;  3O9R A;  3AV9 A;  4IXC A;  4DMN A;  1QS4 A;  2ASM A;  3A0I X;  3L2W A;  3F2K A;  4J8F A;  4M3Y A;  4CHQ A;  4WYB A;  1SKS A;  3J7Z O;  4BQZ A;  3E9P A;  4CD3 A;  5H1S Q;  5DMR A;  2ZWH A;  5TKY A;  1N32 K;  2QXL A;  1KVB A;  4C8O A;  5AQM A;  1JLC A;  4H0O A;  5E26 A;  5BRE A;  3HPH A;  2PZS A;  3ITH A;  5AQH A;  4BRA A;  3TTD A;  4O5F A;  4CD1 A;  1JL1 A;  3CJA A;  4FJ7 A;  3EKU A;  4DKW A;  1VHX A;  5AJ3 K;  1HPM A;  3HZ6 A;  3L2R A;  1IBL K;  1GLL O;  4K8X A;  3KK1 A;  1Q82 O;  3TSP A;  5AQI A;  3BGR A;  2ZJQ L;  1RT3 A;  1QQO A;  5JVG L;  4DTN A;  2HMI A;  4BRG A;  4W5O A;  2OYQ A;  1ASW A;  3EO3 A;  3ZT1 A;  3C65 A;  2VG5 A;  4H0Y B;  2Z1H A;  4LH5 A;  5EY4 A;  4KHN A;  2BAN A;  2G8H A;  2HHV A;  3ZSY A;  1BCO A;  5EXW A;  3SUP A;  1Y64 A;  4QS7 A;  4FWL A;  3CCV N;  4E0D A;  2VCP A;  1B92 A;  3QET A;  3ENO A;  2XY7 A;  3V9X A;  5ADX H;  2UUA K;  3K5O A;  4FJX A;  2VWB A;  1QHA A;  3QIN A;  4QOZ B;  2FSJ A;  1LOT B;  1RTH A;  5EOY A;  3K58 A;  5E41 A;  4B1W B;  1Q7Y O;  3SCX A;  4B1V A;  1QQM A;  4I9L A;  2AA4 A;  2BUP A;  4CER A;  4OX9 K;  5FRO A;  4DS4 A;  3SPY A;  3VQE A;  1SL2 A;  2CGL A;  2QXF A;  4ICL A;  2HHH K;  3U8X A;  3DLK A;  5T7B A;  2CGJ A;  2QW9 A;  1E3M A;  1NGF A;  4WCE L;  5CY4 A;  4BVP A;  1QE1 A;  1KVA A;  1U4B A;  2RE2 A;  3I0S A;  4JHD A;  4FK0 A;  4JV5 K;  1TK0 A;  3HJF A;  3IMX A;  3F9K A;  3T69 A;  3ATU A;  5I3U A;  4Y0W A;  4FJK A;  2A5X A;  4M42 A;  3JAM O;  4LF6 K;  2JGU A;  4NO7 A;  1LWF A;  1RGI A;  5C10 A;  4Y1D A;  1RBT A;  4KI4 A;  3AO2 A;  4PKH A;  4DSF A;  1HR0 K;  1RTJ A;  3SUN A;  1S1V A;  1RT7 A;  1X3M A;  4IJN A;  5AQT A;  3OW2 M;  4CCH A;  2NRX A;  3RVC A;  2ASO A;  1NOY A;  3CJ9 A;  2GWJ A;  3OYH A;  2JWL A;  2XY5 A;  3VGM A;  4DFM A;  2ITM A;  4FVU A;  4N76 A;  1VSM A;  4HVJ A;  1ASV A;  1S3X A;  3NF6 A;  1MU2 A;  2A40 A;  1D4X A;  2QA4 N;  3LP2 A;  4CHY A;  4MFB A;  3C6A A;  4BR0 A;  1JLB A;  3JYT A;  3S9H A;  1SQK A;  2D1K A;  4MDB A;  4CJR A;  2KFN A;  4JHD B;  4DF8 A;  1BUP A;  1JLA A;  3MX2 A;  1NKB A;  4LFC K;  1KXP A;  4FK2 A;  4B9M A;  2YHW A;  3VQ6 A;  1QHT A;  3C6H A;  4H8K A;  2OZS A;  3P1G A;  4FWS A;  1TL3 A;  5LJW A;  3RRG A;  4FJJ A;  2FSN A;  3OYK A;  1XHX A;  2A42 A;  1R59 O;  4PY5 A;  3DM2 A;  1IKX A;  5HLF A;  1N36 K;  3VEW A;  4FM0 A;  5FPN A;  4AHV A;  4X64 K;  2F8T A;  5KTQ A;  1HJO A;  2Q0U A;  2OAN A;  1WOQ A;  4B3R K;  3CM5 A;  1X9J A;  5CR4 A;  4CZI A;  4CJ4 A;  3MXJ A;  4ZTJ A;  3CD6 N;  3E66 A;  1J6Z A;  3PSF A;  1HQE A;  3PIP L;  3GE1 A;  5A2Q O;  1BQN A;  3OJU A;  2UU9 K;  1IKW A;  3GBT A;  2G8K A;  1JLQ A;  3E9O A;  5AQZ A;  3O5B A;  1DT9 A;  3BZK A;  3K0S A;  4XH5 A;  3JSM A;  3KJV A;  3AA4 A;  5C42 A;  1XUP O;  3WXL A;  2QI2 A;  4I9Q A;  2G8I A;  3SQ1 A;  1NK0 A;  4Z4I A;  3AVK A;  3W3D A;  3PV8 A;  2P9N A;  2Q2R A;  1NGI A;  3RMD A;  4RCH A;  2GEL A;  3MN5 A;  3OBW A;  1NK6 A;  4G9Z A;  3PSI A;  1VSK A;  4JS4 A;  3HPO A;  3KHY A;  4DR1 K;  1EWQ A;  3T1H K;  4YOY A;  2ZQB A;  3H46 O;  1NM1 A;  4F8R A;  4KI6 A;  5FRN A;  2YKM A;  3SI6 A;  3HM8 A;  5HRO A;  4A62 A;  3OYJ A;  4KHU A;  4BRQ A;  5JIC A;  5AR0 A;  4KHS A;  2YHA A;  1ATN A;  3FZK A;  3LZI A;  3LWL A;  1C1B A;  1U45 A;  2KFZ A;  4BWM A;  3SBT A;  4DFK A;  3KLG A;  4OGC A;  3LDQ A;  1KRP A;  2OPR A;  1Q18 A;  2P9N B;  4JS5 A;  1N5Y A;  1RT2 A;  4HUG A;  4DFP A;  2P9U A;  1JLG A;  1T6D A;  2NRT A;  3RMA A;  3ID6 A;  3MN6 A;  4YOR A;  4Z4H A;  3LP3 A;  4KFB A;  4GVM A;  5BPL A;  3VQA A;  3MCA B;  4DUZ K;  4BG9 A;  4B3O A;  3V81 A;  1SL0 A;  4CHN A;  3QB0 A;  3AAR A;  2DY4 A;  1W97 L;  4Z4C A;  2QKK A;  3THX A;  3QFU A;  3WT0 A;  3NH0 A;  3CMA N;  4PWD A;  4M3X A;  1BCM A;  4DV7 K;  2RF2 A;  4U7B A;  2UXD K;  2FXU A;  3KK7 A;  2V52 B;  1M90 O;  4FLY A;  1EKE A;  1VQM N;  5FDL A;  2E1Y A;  2HNY A;  1UWB A;  3CI5 A;  1YF5 L;  2JWK A;  3QBW A;  4JKF A;  4FLU A;  2O4G A;  1RBS A;  4JKA A;  2P9U B;  3ASM A;  3THY A;  3O8M A;  3ZSX A;  3CCU N;  4JKB A;  4GV9 A;  5DK5 A;  1X9W A;  4MLH A;  4YOU A;  1NOZ A;  3WQU A;  4F9O A;  4B1Z A;  3SAH A;  4B9V A;  1IV0 A;  4FJM A;  3N4Q A;  4DWI A;  4KKO A;  3UKU A;  4IBN A;  4A57 A;  4Z94 A;  4B1X B;  3OJS A;  4LSL A;  3SAF A;  1K8A O;  3MXM A;  3DLL L;  4M41 A;  1BWF O;  3GG4 A;  4UY8 O;  2X74 A;  4BQL A;  1LWC A;  2B4J A;  4DTP A;  1MWK A;  3BZC A;  4BR2 A;  3THX B;  2O8E A;  4FK4 A;  3L2Q A;  1IG9 A;  2O4I A;  3QER A;  3L4Q A;  3BF3 A;  4KAZ A;  3K2P A;  4H4O A;  3F73 A;  3U4L A;  4FLZ A;  3SUO A;  4CBU A;  1WBB A;  4WFB L;  1VQ5 N;  3L8B A;  4GVE A;  1XC9 A;  4WQ5 A;  5AQN A;  1VQ6 N;  1W2B M;  2F8S A;  5BN8 A;  3THY B;  5B8H A;  4F2S A;  1LW2 A;  1NLV A;  1RDU A;  1P8Z A;  1DTQ A;  1NGA A;  3WXM B;  1TKZ A;  2Q31 A;  3M8P A;  3SYZ A;  4JI1 K;  4O0I A;  3O08 A;  3H6E A;  3UKU B;  4OGE A;  4CJE A;  3LZJ A;  3QEP A;  1OVY A;  1CLQ A;  1B9F A;  2O8D A;  4IOA L;  3NF9 A;  3ZX0 A;  1S1X A;  5KPT A;  1C0G A;  4DG1 A;  4BRH A;  2WFB A;  3MEG A;  2O8E B;  1XI1 A;  3FE1 A;  2HND A;  3E01 A;  2RPI A;  5BPM A;  1S6P A;  3DOL A;  1MWM A;  2HST A;  4FOE A;  4Q5V A;  4DF4 A;  1X1P A;  1YJW N;  4CZH A;  1W9H A;  4IFV A;  3B8A X;  3CF5 L;  3ZT0 A;  5J2N A;  2QWO A;  2A1S A;  2I5J A;  3HOT A;  3DOK A;  3FR0 A;  2W41 A;  3NE6 A;  3EE9 A;  4JKE A;  5JLF A;  3LAN A;  3CG7 A;  4JKD A;  5GAE P;  2R7Y A;  2NZT A;  3O4Q A;  2NRZ A;  1E4F T;  4EZ6 A;  3QES A;  3G71 N;  3H3N O;  3AVN A;  3OYC A;  3R8E A;  2FBV A;  3NDK A;  2E5L K;  4A61 A;  4ISG A;  3TAM A;  3RMB A;  1FW6 A;  4MDA A;  1SZ2 A;  3WXJ A;  4Z4E A;  5JS1 A;  4DTO A;  2O8D B;  1NK7 A;  5C2F A;  3A8Y A;  5FRM A;  4Y1C A;  3MWT A;  2P9K A;  4EP5 A;  1HKC A;  3O9U A;  3K59 A;  1ATS A;  3VQ7 A;  5KRT A;  4E7L A;  2AJQ A;  1YTA A;  3EZ5 A;  1D5A A;  1YXQ A;  3ENB A;  2VQE K;  4B08 A;  3M8Q A;  3OS1 A;  4FPB A;  5F2R A;  4CF8 A;  2HHU A;  2IVO A;  2J4R A;  3O3F A;  4N5S A;  3V4I A;  2PYL A;  4K42 A;  1RT1 A;  1BOT O;  5JVH L;  2DTU A;  3LPT A;  3NFA A;  4N47 A;  3HP6 A;  2IOC A;  4B9N A;  3W0L A;  4C1N I;  5ADX A;  2HHW A;  3CJ1 A;  3VQC A;  3OS0 A;  3AGK A;  4XEI A;  5M1F A;  4X66 K;  1TV6 A;  4ILG B;  5KRS A;  3QML A;  3SAG A;  5TKW A;  3B6P A;  4WE1 A;  1OH8 A;  4BR7 A;  1HNW K;  2E6L A;  1Z26 A;  4L3Q A;  1WN7 A;  2P9K B;  2DFH A;  1ESV A;  3AVM A;  1KLM A;  4XH1 A;  4R79 A;  3SJJ A;  1MDU B;  4B1Y B;  1U47 A;  3PO5 A;  3OBY A;  3EE8 A;  4PL8 A;  4CFD A;  5HBM A;  4CBW A;  4WQ5 C;  1J9A A;  2FBY A;  4DV5 K;  5EU7 A;  3ZYY X;  1C1A A;  3V9S A;  1NNE A;  4CIE A;  2E2O A;  1WSJ A;  3K5M A;  3SQ4 A;  3SMP A;  3CPW M;  4Z4F A;  3K9K A;  4CHP A;  1K8K A;  3QFP A;  3TAB A;  1WAF A;  2EHG A;  4K8Z A;  1TK8 A;  1WAJ A;  4RTF D;  4CGI A;  4YOX A;  2FSK A;  1RT6 A;  1MA9 B;  3WEE A;  2P9P A;  2P9L A;  4DTJ A;  1N6Q A;  1ZXO A;  3QDK A;  2OPQ A;  1NGC A;  3SV3 A;  1A5V A;  4HWI A;  3AO3 A;  3BF1 A;  3GL1 A;  1WSE A;  4BRO A;  5LL6 Z;  4GV6 A;  4ELU A;  1B9D A;  4FYD A;  3O1B A;  1KD1 O;  2E2N A;  3OYB A;  4FJG A;  1NJW A;  3O9S A;  3HL8 A;  4CHO A;  3KLI A;  1WBD A;  4EHU A;  2W6K A;  1EET A;  3DRR A;  3R1X A;  2XRI A;  3QIP A;  4E7I A;  3J7Y P;  2IS3 A;  4H0P A;  2Z1I A;  3PY8 A;  4CGG A;  1HUX A;  3CJC A;  4BE1 A;  3VEX A;  1KAX A;  3DWL A;  4ZTF A;  4LH4 A;  2NRH A;  4H0V B;  1K8K B;  3BY5 A;  1J54 A;  3LAK A;  4FWR A;  3CET A;  2Z1J A;  1U49 A;  1YVU A;  3WEE B;  2P9L B;  2P9P B;  1VQL N;  4FWQ A;  4C8K A;  2Q36 A;  1EX4 A;  3AVG A;  5AZI A;  1D8Y A;  3ZCM A;  3U3G A;  3HI0 A;  4WFN L;  5CYM A;  3EN9 A;  4PL7 A;  3I0R A;  4LF5 K;  3HP9 A;  1ZBU A;  4FJ8 A;  5KQD A;  3GDQ A;  3K5L A;  4BVO A;  3HO1 A;  4CFA A;  4Z0U A;  4DB3 A;  3SUQ A;  4DTX A;  3OYF A;  4CK2 A;  4CZG A;  3O4N A;  2XHB A;  3ZX3 A;  1F21 A;  1YHQ N;  3JS6 A;  3T1Y K;  2Y1J A;  3CIP A;  1S1T A;  2NRR A;  4KTZ A;  3O9T A;  4FCY A;  1KFS A;  4DQP A;  3Q7C A;  2A3Z A;  3MWP A;  2E2Q A;  5AQO A;  2GUP A;  4KHW A;  5CYQ A;  1LWE A;  3DLG A;  5JMV A;  3RRH A;  4LC9 B;  2BH1 A;  1TGO A;  1BO5 O;  3O3G A;  3QEV A;  1A5W A;  4KV8 A;  1TAU A;  4LFB K;  3AAQ A;  5IT9 O;  3IS9 A;  4CBX A;  3V9Z A;  1HMV A;  3RMC A;  5CE3 A;  4E7J A;  1RDA A;  5AZI B;  3QEW A;  3AVL A;  2B5J A;  1QQC A;  3P31 A;  1IO2 A;  5DM6 L;  2A1R A;  1BI4 A;  4KPY A;  3VPZ A;  5FPM A;  2ZM6 K;  4YOW A;  1GOC A;  1GLB G;  4KHP K;  3AA5 X;  1HKG A;  3QNO A;  1XWL A;  1EWR A;  3FFK B;  5FPD A;  5KI6 A;  3TAE A;  3AVB A;  5AQY A;  4FZX C;  4MQ3 A;  4O0J A;  5GAD P;  1K6Y A;  4FJN A;  3VEY A;  3L3U A;  2IIR A;  1Z05 A;  1OKJ A;  3WNF A;  4ZHR A;  3ZSZ A;  4J2A A;  4OO1 J;  3R3L A;  3ZET A;  4DR2 K;  3IFR A;  4I6M A;  2HHS A;  4E7K A;  3HYF A;  5I42 A;  1W0H A;  4NLB A;  4DS5 A;  5J1E A;  4H5W A;  3RR7 A;  3TR8 A;  3P39 A;  4H03 B;  2HW3 A;  4JI7 K;  4QCL A;  4QS9 A;  4FSV A;  5KGX A;  1U48 A;  3THV A;  5K14 A;  3ZT4 A;  1QSY A;  1T03 A;  5AQU A;  3CFO A;  4H5N A;  1BI4 B;  2IAJ A;  1RBV A;  1UA1 A;  3MK6 A;  4OPH A;  4EP4 A;  1UOC A;  1NJZ A;  1Q8I A;  4FVM A;  4CF1 A;  2PAV A;  1FXX A;  4CJQ A;  4DV3 K;  5HRS A;  3D0P A;  3ZSO A;  4AHS A;  1OVQ A;  1X3N A;  1J5O A;  5BRD A;  4CJ3 A;  4KTQ A;  1BQM A;  1O13 A;  3MAQ A;  2G8W A;  1IJJ A;  3DLB A;  2YJE A;  4CJW A;  4FJI A;  4LF4 K;  2HVI A;  2UUC K;  2HHQ A;  3AA3 A;  1ITG A;  3V1Q A;  5M1N A;  2G8V A;  4QAG A;  2ZE2 A;  3CFR A;  3HSC A;  1HJR A;  4CEO A;  3VF2 A;  1D9D A;  4DLG A;  3ZET B;  1P90 A;  4GW6 A;  1EQY A;  4I6M B;  4F3T A;  1ZYQ A;  4JI8 K;  5BR9 A;  4FJL A;  5C25 A;  5KQ8 A;  1NU0 A;  4JKH A;  4M3W A;  4DU4 A;  5D3G A;  1S1U A;  1TL1 A;  4PQU A;  1WSI A;  1JJ2 M;  1CZ9 A;  3J8A A;  4I7F A;  4OPK A;  2NRV A;  4YDU A;  3H3O B;  2XO7 A;  1BA1 A;  4CJ5 A;  1UA0 A;  1VK0 A;  4JI2 K;  3P83 D;  5IWA K;  4FM2 A;  4CEB A;  4U67 L;  3C6U A;  2H3G X;  1NGG A;  3J7A P;  4B8A B;  4LSN A;  4V19 S;  1H1V A;  4DQ8 A;  2OTJ N;  1J53 A;  1Z6R A;  1ZC6 A;  3CJ7 A;  3QEI A;  5HOO A;  4XH4 A;  2HF3 A;  3TTF A;  4AF1 A;  2YCH A;  1YI2 N;  1ZBI A;  4CZK A;  3P38 A;  3UKR A;  4GKJ K;  2FC0 A;  3TU5 A;  2YV0 X;  1LV5 A;  2W42 A;  3VA3 A;  1TUU A;  2KHO A;  2WC9 A;  2Z1G A;  3CC7 N;  3DMJ A;  4XIU A;  4DSI A;  4DV1 K;  3CER A;  4EFH A;  3OY9 A;  4KTW A;  3NGI A;  3WQT A;  4K25 A;  3VF4 A;  3O6W A;  4B3S K;  1A5X A;  1Y97 A;  3L0Q A;  1VQK N;  2HOE A;  3LDS A;  3CPE A;  4IWV A;  3ZEU A;  1RBU A;  4BR5 A;  2WTU A;  2BE2 A;  4IO9 L;  5AQG A;  3OVN A;  1I3A A;  3K5N A;  3CXC M;  2ETJ A;  2F7T A;  5GAG P;  2WOM A;  4W5Q A;  5E84 A;  4IFY A;  4JI5 K;  4CFB A;  2F4V K;  1ZBL A;  1VSI A;  3BUZ B;  1C1C A;  2VG7 A;  3MEE A;  3ENH A;  4LF9 K;  4CJL A;  4WF9 L;  3LM9 A;  5BRF A;  1L5U A;  3FLC O;  4KH4 A;  4OKK A;  2QTD A;  4GMJ B;  3ZT2 A;  2BTF A;  2A6A A;  4F3O A;  3VTI A;  3CM6 A;  4RW7 A;  1NGJ A;  3UKR B;  4CGD A;  4CF9 A;  4O55 A;  4DCH A;  1QZ6 A;  3BP8 A;  3HRG A;  2G8U A;  3FGU A;  1KC8 O;  4E3S A;  1Q86 O;  2HVH A;  2D4W A;  4GV3 A;  3TAR A;  2D0B A;  4JEP A;  4GNI A;  1E4G T;  4MO5 A;  4FJ9 A;  3LAM A;  4DR6 K;  2HHX A;  1VQP N;  3ZEU B;  5AQK A;  2HBL A;  3Q7B A;  2YX6 A;  5GIP A;  4LF8 K;  3I33 A;  4ISF A;  4AM7 A;  1T6C A;  4CGJ A;  4JN4 A;  4M63 C;  1YUW A;  2BGG A;  3BEX A;  2XY6 A;  1XC3 A;  5LMU K;  4BWJ A;  1VQN N;  4L8R B;  1O1W A;  3VET A;  2E8A A;  4FWM A;  5J2P A;  2IVP A;  4CJP A;  2QWP A;  1NGB A;  3J81 O;  4CEF A;  3KLE A;  1HNZ K;  2E88 A;  3H45 C;  1U6Z A;  3R9P A;  2QK9 A;  2IVN A;  4FPA A;  5AQP A;  3H1Q A;  3UE5 A;  4N56 A;  4AHT A;  4K43 A;  3OYM A;  1WNS A;  1ZBS A;  2I7P A;  4CEZ A;  3D2F A;  2RHK A;  1HRH A;  4YDU C;  3TWH A;  3E1Y A;  2GTD A;  4CF0 A;  2ZJP L;  1VSL A;  3NMU A;  3ULE A;  3I55 N;  1RDB A;  3O4W A;  3SQ2 A;  1SAZ A;  4CEA A;  2D0A A;  5HRP A;  1NKC A;  3CQX A;  4DLE A;  1G15 A;  4FJ5 A;  1C0M A;  1NK9 A;  4JLH A;  1VSH A;  2VYP A;  1V4S A;  2VG6 A;  3BDP A;  2EWS A;  4CEE A;  1T05 A;  1KAY A;  3MN9 A;  4BC2 A;  3WNG A;  3NCI A;  3F9M A;  3ULD A;  5C24 A;  3ZSQ A;  1NMN A;  1NGD A;  4E1M A;  1RIL A;  1NK5 A;  3TSU A;  4E1N A;  1SL1 A;  3D45 A;  5AFU A;  1VSD A;  4HTU A;  3HM9 A;  3TPQ A;  5BRH A;  4JRP A;  2CGK A;  4H5V A;  4M7X A;  4O8K A;  3FZF A;  2YKN A;  3OS2 A;  3HT3 A;  1JCE A;  1RDW X;  2F96 A;  2HBM A;  1RBR A;  4N41 A;  3AVF A;  2QKB A;  4DQQ A;  3EKS A;  2ZJR L;  4M3R A;  2Q1N A;  4IJA A;  2QWQ A;  1RCH A;  3LDP A;  4KB0 A;  1DTT A;  3MEC A;  3A5L C;  3D2F B;  4MO4 A;  2FBT A;  1T3V A;  4BAC A;  3NBP A;  3ULE B;  4YHH K;  3J80 O;  1JCG A;  1VAZ A;  3A2F A;  4JRQ A;  3PLA A;  4ILJ A;  4DTS A;  1OH7 A;  3O1W A;  3N4P A;  3DLR A;  4NLC A;  4JK8 A;  1NK4 A;  1KFD A;  4WFA L;  1KLN A;  3NF7 A;  4AHU A;  1DKG D;  3C7N A;  4ELT A;  1ZBF A;  2UXC K;  1TKD A;  1S72 N;  3ZLJ A;  4OLB A;  5GIO A;  1BDG A;  1HX1 A;  1HYV A;  4E1J A;  4M3Z A;  1VSE A;  1WUA A;  1RFQ A;  1KTQ A;  3U9D A;  1BG3 A;  1NWK A;  3TAN A;  3NGZ A;  4ID1 A;  1KQS M;  1NJY A;  1VQ8 N;  3VGK A;  4ID5 A;  2HBK A;  4NXM K;  4HCC A;  4E19 A;  3LL3 A;  4JI6 K;  2PBD A;  4CK1 A;  3EL2 A;  1YJN N;  4C8M A;  3CCQ N;  1EXQ A;  1XQS C;  3KKS A;  2HHT A;  5AQF A;  2KQ2 A;  4BR9 A;  3SQ0 A;  3AGR A;  1YIJ N;  3L2U A;  5C0Y A;  1BGX T;  3EY1 A;  3ISN C;  3SMS A;  3KWI A;  3VQ5 A;  3LDO A;  1FKO A;  4UQG A;  1L3V A;  4DU1 A;  3F5T A;  3G10 A;  1YTU A;  2VWK A;  3NAE A;  4HCB A;  4B3T K;  1W7A A;  3CYM A;  2UYT A;  3OYN A;  1JL2 A;  4PHT X;  3C7N B;  1QTM A;  3L2V A;  2YI1 A;  3R6M A;  1Q9Y A;  1S9E A;  1RT4 A;  3VQ8 A;  3AO5 A;  3S3M A;  1WSG A;  2BDP A;  2YNG A;  1YVN A;  4GKK K;  3VGL A;  3VMF B;  4A2B A;  3NVK A;  4B3M K;  3CQY A;  3DRP A;  2V7Y A;  5AZJ A;  4JI3 K;  4BRK A;  4CES A;  1TKX A;  1BU6 O;  2W6L A;  2OA8 A;  3HST B;  3IKM A;  3VQ9 A;  4DFJ A;  3OYA A;  4M45 A;  4IO8 A;  1BL3 A;  5BN9 A;  4C23 A;  4IG3 A;  3UB5 A;  3CC2 N;  2JLE A;  3AA2 A;  3KKR A;  3VEO A;  3HVT A;  1KCF A;  3PO4 A;  3H08 A;  5F0X A;  3VN5 A;  5BPN A;  3NHG A;  2YHX A;  2GEM A;  1C0F A;  5J2M A;  4JKC A;  3M3Z A;  2P1J A;  1JXE A;  1J5E K;  3VER A;  1HYZ A;  1RDC A;  4G1Q A;  2V51 B;  5FLX O;  3U9Z A;  3U6F A;  1GLJ O;  2ATQ A;  4DTU A;  2KW4 A;  3DJC A;  3OHR A;  2KZZ A;  4CE9 A;  1S9G A;  3HVR A;  3RSE A;  2XY8 A;  1BIS A;  1TUY A;  4B9S A;  2B6A A;  2DPN A;  2ASP A;  3AVI A;  3SV4 A;  4BY9 C;  2W40 A;  4AIL C;  2E6M A;  1U04 A;  1LAW A;  2DFF A;  5AZJ B;  2KLA A;  4M3U A;  4OJR A;  1Q9X A;  1HNI A;  3VEN A;  4DV2 K;  4FWK A;  4RWT A;  1VSF A;  3EYZ A;  1FKP A;  3RWU A;  5M1K A;  4C8N A;  4DSJ A;  3O9Q A;  1WSF A;  3LM2 A;  2D0O A;  2VWJ A;  2O8F A;  3DLH A;  4DQR A;  1WB9 A;  5M1P A;  5ELZ A;  3CHW A;  4K0K K;  4BG8 A;  4FM1 A;  5HP1 A;  3TI0 A;  3WNH A;  2IDO A;  3LWM A;  2I7N A;  2KKZ A;  5JS2 A;  4LF7 K;  4J2E A;  1HNV A;  5KGW A;  1C0T A;  4IKF A;  2E20 A;  4EHT A;  3P4I A;  3T1A A;  1QVF M;  3QBX A;  3CME N;  3IAY A;  2UUB K;  3TTC A;  4CZL A;  5GIN A;  1VQ9 N;  1K73 O;  2OPP A;  4BRI A;  1RT5 A;  3KWG A;  1TYQ A;  4CZE A;  3RSE B;  4AM6 A;  4BRP A;  4KBO A;  4DUY K;  5CZ1 A;  3ZT3 A;  2P5G A;  4IZ9 A;  3NH1 A;  1JCF A;  4FJH A;  4FO0 A;  3S41 A;  4CED A;  4FOI A;  4KO0 A;  4NYF A;  4NXN K;  4FW2 A;  1FJG K;  2QEX N;  4DR5 K;  4HTL A;  3M5R A;  2F9T A;  1NG9 A;  4CGF A;  3VQD A;  1TVR A;  4BDZ A;  4CI6 A;  3RTV A;  3KVG A;  2O8F B;  4JK7 A;  1VRT A;  3LDN A;  4KB1 A;  4CJU A;  3CCJ N;  4CK3 A;  4I2P A;  3AVC A;  3SK3 A;  4B1U B;  5BR8 K;  1JLE A;  4OLA A;  3SPZ A;  4JNE A;  2P9I A;  4BGA A;  1G99 A;  1QVG M;  1LW0 A;  3ZX2 A;  4DV4 K;  4JAX A;  1BA0 A;  4IEI A;  3MMV A;  1ATR A;  1JXB A;  2UXB K;  1TYQ B;  4RW4 A;  2YNF A;  2Q3S A;  2YJF A;  3A5N C;  1BIU A;  3V9W A;  3M6G A;  4B9Q A;  2QWL A;  1C6V A;  3A5O C;  4I2Q A;  4LD0 A;  3HBT A;  1ZBH A;  2GX9 A;  4FZZ A;  4JI0 K;  1LAV A;  4A59 A;  4H5R A;  2D0C A;  1KSP A;  2IGI A;  2ZD1 A;  3MED A;  4CJF A;  3DI6 A;  4CHZ A;  2FF6 A;  3PUF A;  3D7E O;  4DHY A;  3SNN A;  4IG0 A;  2O8B A;  3VEV A;  4EZ9 A;  1GLA G;  1NJX A;  4AHR A;  3LDL A;  1VQ7 N;  4RW6 A;  1ILY A;  5AQJ A;  3PX6 A;  4O8U A;  4DQS A;  1L3S A;  4JD2 A;  2G8F A;  4NCA A;  3C6T A;  5AQR A;  4YOV A;  3QO9 A;  3TAF A;  1BIZ A;  2NUB A;  3QEX A;  3IRX A;  4DR3 K;  4M3T A;  1GOA A;  4JK9 A;  2KZM A;  4FL9 A;  2P9I B;  5FPE A;  3DRS A;  3DXM A;  5F1X A;  5SWM A;  3OYI A;  4YY3 K;  3CJB A;  2WBN A;  3D2E A;  3KZB A;  5SZT A;  2QM1 A;  3ZSW A;  3G0Z A;  4CJV A;  1T8E A;  3QLH A;  1BHL A;  4IEE A;  3JXU A;  5LMN K;  5C15 A;  3HOS A;  2NNW A;  3V6D A;  1I39 A;  2VGN A;  4TSX A; 
#chains in the Genus database with same CATH homology
 5F2R A;  2CGL A;  4CZJ A;  1KC8 O;  2IVO A;  2J4R A;  1Q86 O;  3L4I A;  2D4W A;  4GV3 A;  3U8X A;  3IUC A;  4JEP A;  4GNI A;  1E4G T;  4JKG A;  4MO5 A;  5AQQ A;  1SS6 A;  2CGJ A;  2QW9 A;  4A5A A;  4CZF A;  1VQP N;  1NGF A;  3ZEU B;  4WCE L;  4K42 A;  5AQK A;  2HBL A;  4BVP A;  3Q7B A;  2YX6 A;  3H1V X;  5GIP A;  1BOT O;  3I33 A;  4ISF A;  1T6C A;  2RE2 A;  4JN4 A;  4AM7 A;  4M63 C;  1YUW A;  5JVH L;  4JHD A;  3IMX A;  3BEX A;  3VTH A;  1T44 A;  1XC3 A;  3W0L A;  4C1N I;  3T69 A;  5ADX A;  4IFE A;  3ATU A;  2VGM A;  4Y0W A;  3CJ1 A;  2A5X A;  1VQN N;  3AGK A;  4XEI A;  5AQV A;  5M1F A;  4NO7 A;  4ILG B;  3VET A;  1RGI A;  5C10 A;  4JD2 B;  2E8A A;  3QML A;  3SAG A;  4FWM A;  5TKW A;  2IVP A;  2QWP A;  1NGB A;  5M1Q A;  4PKH A;  2HF4 A;  2E88 A;  1LCU A;  3H45 C;  1U6Z A;  3EZW A;  4H5T A;  1X3M A;  4BR7 A;  3R9P A;  1EO1 A;  2IVN A;  4IJN A;  4FPA A;  5AQT A;  3OW2 M;  1IG8 A;  4L3Q A;  5I9E B;  1NJI O;  5AQP A;  4KH5 A;  5JLH A;  1HKB A;  2NRX A;  3RVC A;  2P9K B;  3H1Q A;  1ESV A;  3DXM B;  2ASO A;  3UE5 A;  3CJ9 A;  4R79 A;  2D0P A;  4XH1 A;  2GWJ A;  4K43 A;  3D2E B;  2JWL A;  1MDU B;  4B1Y B;  4BC3 A;  3OBY A;  1ZBS A;  4KH6 A;  2I7P A;  3EE8 A;  3D2F A;  3VGM A;  2RHK A;  4YDU C;  4PL8 A;  2ITM A;  3E1Y A;  2GTD A;  3VES A;  4FVU A;  2ZJP L;  4CBW A;  4WQ5 C;  5AQS A;  1QQN A;  3NMU A;  3ID8 A;  3ULE A;  3I55 N;  3GOI A;  1S3X A;  3HTV A;  3O4W A;  2A40 A;  1D4X A;  3ZYY X;  1SAZ A;  2QA4 N;  4EIA A;  3CQX A;  5C2D A;  2E2O A;  4JKG B;  3C6A A;  5CHI A;  4BR0 A;  3SMP A;  3CPW M;  3K9K A;  2VYP A;  1V4S A;  1SQK A;  1K8K A;  2D1K A;  3QFP A;  4MDB A;  1YIT N;  3AAP A;  1NMD A;  2EWS A;  3DXK A;  4JHD B;  2Q97 A;  1KAY A;  3MN9 A;  4RTF D;  4YOX A;  3SJH A;  2AP1 A;  4BC2 A;  2FSK A;  1BUP A;  3F9M A;  3MX2 A;  1MA9 B;  2YHY A;  1KXP A;  2P9P A;  2P9L A;  3WEE A;  3K9J A;  1NGD A;  1ZXO A;  3QDK A;  3TSU A;  2V7Z A;  2YHW A;  4BRE A;  5AFU A;  3C6H A;  1NGC A;  4BRL A;  3TPQ A;  5BRH A;  4FWS A;  3M1F A;  4HWI A;  2CGK A;  3BF1 A;  4H5V A;  3GL1 A;  4M7X A;  4O8K A;  3FZF A;  5LJW A;  2FSN A;  1JCE A;  2A42 A;  4BRO A;  1R59 O;  4GY2 B;  4GV6 A;  1RDW X;  2HBM A;  3O1B A;  3NVM A;  3AY9 A;  1KD1 O;  2E2N A;  5DM7 L;  3VEW A;  2OTL N;  3EKS A;  5FPN A;  2ZF5 O;  4BRM A;  2FF3 B;  3O9S A;  2ZJR L;  2Q1N A;  1HJO A;  2Q0U A;  4IJA A;  5MLC Q;  2OAN A;  2QWQ A;  1WOQ A;  3LDP A;  4EHU A;  1Q81 O;  3R1X A;  3A5L C;  1X9J A;  5CR4 A;  3D2F B;  4MO4 A;  4CZI A;  4ISE A;  3CD6 N;  3ATV A;  2QWN A;  3E66 A;  1J6Z A;  1KAZ A;  1T3V A;  4H0P A;  4QS8 A;  3PIP L;  3GE1 A;  3ULE B;  3L6Q A;  4NB4 A;  4BC4 A;  1HUX A;  3CJC A;  1JCG A;  1VAZ A;  2P9S A;  3GBT A;  3VEX A;  3PLA A;  1KAX A;  4ILJ A;  4IOX A;  3DWL A;  5C12 A;  2ZGY A;  3E9O A;  3O1W A;  3N4P A;  5AQZ A;  3O5B A;  4NLC A;  4JK8 A;  1DT9 A;  2NRH A;  4H0V B;  3A5M C;  1K8K B;  4BRD A;  4WFA L;  4XH5 A;  1DKG D;  3C7N A;  3DXK B;  4FWR A;  4M7Y A;  5KPR A;  3CET A;  1S72 N;  1XUP O;  5GIO A;  1BDG A;  3MN7 A;  3WXL A;  1VQO N;  1HX1 A;  4E1J A;  2QI2 A;  3WEE B;  2P9L B;  1WUA A;  2P9P B;  1K9M O;  1VQL N;  1RFQ A;  3U9D A;  1BG3 A;  1GLC G;  1GLF O;  1NWK A;  2CH6 A;  4FWQ A;  5AQW A;  1NGH A;  2Q36 A;  1CZA N;  1KQS M;  1VQ8 N;  5AZI A;  3VGK A;  3HI0 A;  4WFN L;  2HBK A;  3W3D A;  2P9N A;  3EN9 A;  4FWO A;  4PL7 A;  4BGB A;  3LL3 A;  4BRF A;  5KQD A;  3GDQ A;  2PBD A;  4BVO A;  3EL2 A;  1YJN N;  4DB3 A;  2Q2R A;  3CCQ N;  1NGI A;  4FWP A;  1XQS C;  4CZG A;  4RCH A;  4A5B A;  5AQF A;  2GEL A;  1V4T A;  3MN5 A;  3OBW A;  4IDH A;  4BR9 A;  3AGR A;  1M1K O;  2PFU A;  4G9Z A;  1YIJ N;  3ZX3 A;  5C0Y A;  3SMS A;  1YHQ N;  3KWI A;  3LDO A;  2E2P A;  3JS6 A;  3CIP A;  3KHY A;  4WQ4 A;  2NRR A;  3O9T A;  3O80 A;  5EX5 A;  4YOY A;  3H46 O;  1NM1 A;  2A3Z A;  2E2Q A;  3MWP A;  2P9S B;  3Q7C A;  2WUS A;  5AQO A;  2GUP A;  3F5T A;  5JMV A;  2F9W A;  3HM8 A;  3MX5 A;  1S22 A;  3QIC A;  4A62 A;  4PKI A;  3SBG A;  4LC9 B;  2BH1 A;  3VEZ A;  2UYT A;  4PHT X;  1BO5 O;  3C7N B;  4ILH A;  2YI1 A;  3R6M A;  4BRQ A;  1GLE G;  5JIC A;  5AR0 A;  3D6R A;  4BC5 A;  3AAQ A;  1ATN A;  1NGE A;  5LJV A;  1YVN A;  3FZK A;  3VGL A;  3VMF B;  3WXI A;  4A2B A;  4CBX A;  3NVK A;  5CE3 A;  3CQY A;  5AZI B;  3SBT A;  2V7Y A;  5AZJ A;  2A41 A;  2QWM A;  3P31 A;  5DM6 L;  3LDQ A;  3C0B A;  1Q18 A;  2P9N B;  4CJ7 A;  4BRK A;  4K41 A;  3VPZ A;  1BU6 O;  5FPM A;  3WXK A;  1VQ4 N;  3IKM A;  2P9U A;  4YOW A;  1YAG A;  3CCM N;  5EVZ A;  4IO8 A;  1GLB G;  1T6D A;  3VOV A;  2NRT A;  3ID6 A;  3MN6 A;  4CZM A;  3DAW A;  1HKG A;  5BN9 A;  4C23 A;  4YOR A;  3G25 A;  3PIO L;  3FFK B;  5FPD A;  3UB5 A;  3CC2 N;  3VEO A;  5BPL A;  5AQY A;  5F0X A;  3MCA B;  5BPN A;  2YHX A;  2GEM A;  2NLX A;  3TSQ A;  1C0F A;  5GAD P;  4JKC A;  3M3Z A;  3VEY A;  2IIR A;  4BG9 A;  3CCL N;  1Z05 A;  3VER A;  1OKJ A;  2E1Z A;  3QB0 A;  3AAR A;  1W97 L;  3CCR N;  4EAH D;  2V51 B;  5GAH P;  4MLE A;  3U9Z A;  3R3L A;  3ZET A;  4IOC L;  4OO1 J;  1GLJ O;  3MDQ A;  3QFU A;  3WT0 A;  3IFR A;  3CMA N;  4I6M A;  3DJC A;  3FZM A;  3OHR A;  3IDH A;  2GWK A;  4U7B A;  4NLB A;  2FXU A;  3KK7 A;  2V52 B;  4H0T B;  4H5W A;  3RSE A;  1M90 O;  3P39 A;  4H03 B;  3SLC A;  1TUY A;  2DPN A;  1VQM N;  2ASP A;  1U2V A;  4QS9 A;  2E1Y A;  4FSV A;  4BY9 C;  2W40 A;  5AQX A;  3CI5 A;  1YF5 L;  2JWK A;  3QBW A;  4JKF A;  2NRW A;  2Q0R A;  5AZJ B;  2KLA A;  5AQU A;  4H5N A;  3MK6 A;  4OPH A;  3VEN A;  4JKA A;  4FWK A;  3VF6 A;  2P9U B;  4RWT A;  4BRC A;  3CC4 N;  2PAV A;  4OPA A;  5M1K A;  3O8M A;  3O9Q A;  1DEJ A;  3I8B A;  3CCU N;  4JKB A;  4GV9 A;  1HLU A;  5M1O A;  4MLH A;  1N8R O;  1X3N A;  3LM2 A;  5BRD A;  4YOU A;  2D0O A;  3WQU A;  3FZL A;  4B1Z A;  4F9O A;  3SAH A;  1O13 A;  3G4S N;  1IJJ A;  3N4Q A;  2YJE A;  5M1P A;  5ELZ A;  3CHW A;  3UKU A;  4BG8 A;  4A57 A;  4Z94 A;  5M1N A;  2I7N A;  2KKZ A;  4B1X B;  3CCS N;  4FWN A;  3SAF A;  1K8A O;  3DLL L;  2QWR A;  1BWF O;  3GG4 A;  3HSC A;  1YJ9 N;  4UY8 O;  2E20 A;  2ZGZ A;  5LY3 A;  4EHT A;  3P4I A;  4BQL A;  1QVF M;  1QZ5 A;  3VF2 A;  3QBX A;  3ZET B;  3CME N;  1MWK A;  2HBJ A;  3TTC A;  1P90 A;  4BR2 A;  4CZL A;  1EQY A;  1DGK N;  4I6M B;  5GIN A;  1VQ9 N;  1K73 O;  4BRI A;  5BR9 A;  3CCE N;  3KWG A;  4YOT A;  5KQ8 A;  3L4Q A;  1TYQ A;  4JKH A;  4BR4 A;  4CZE A;  3BF3 A;  3RSE B;  4AM6 A;  4BRP A;  3FZH A;  4KBO A;  3G6E N;  4A2A A;  4IZ9 A;  4PKG A;  1U2V B;  3U4L A;  3WUH A;  1JCF A;  3T7Z A;  4FO0 A;  3S41 A;  4CBU A;  1JJ2 M;  4FOI A;  3J8A A;  1NBW A;  4WFB L;  5HL7 L;  1VQ5 N;  2NRV A;  4YDU A;  4GVE A;  4BRN A;  3H3O B;  3I56 N;  2FLO A;  3MCP A;  4WQ5 A;  2QEX N;  1BA1 A;  4HTL A;  3M5R A;  4H0X B;  5AQN A;  2F9T A;  1VQ6 N;  1GLD G;  1W2B M;  3E9L A;  4WQ4 C;  5BN8 A;  5B8H A;  2HMP A;  5AFU H;  4U67 L;  1NLV A;  1RDU A;  3OA9 A;  2H3G X;  1P8Z A;  2CH5 A;  1NGG A;  4CI6 A;  1NGA A;  4C1N K;  3WXM B;  3KVG A;  2Q31 A;  1H1V A;  3O9R A;  5AQL A;  4DQ8 A;  5KPZ A;  2OTJ N;  4IXC A;  3O08 A;  4JK7 A;  2ASM A;  3LDN A;  3A0I X;  3H6E A;  3UKU B;  3F2K A;  3CCJ N;  1Z6R A;  1ZC6 A;  4J8F A;  3CJ7 A;  1OVY A;  4WYB A;  5HOO A;  3J7Z O;  4BQZ A;  4XH4 A;  3SK3 A;  4IOA L;  2HF3 A;  3ZX0 A;  3E9P A;  3TTF A;  4B1U B;  4CD3 A;  5KPT A;  5H1S Q;  2ZWH A;  5TKY A;  1C0G A;  2YCH A;  4AF1 A;  4BRH A;  4JNE A;  2WFB A;  2P9I A;  2QXL A;  1G99 A;  5AQM A;  4BGA A;  1YI2 N;  1QVG M;  4CZK A;  3ZX2 A;  3FE1 A;  4H0O A;  3P38 A;  5E26 A;  5BRE A;  4JAX A;  1BA0 A;  3UKR A;  4IEI A;  5BPM A;  3TU5 A;  3MMV A;  1ATR A;  1MWM A;  5AQH A;  2HST A;  4FOE A;  1TUU A;  1TYQ B;  2KHO A;  4BRA A;  2WC9 A;  3A5N C;  2YJF A;  3TTD A;  4O5F A;  4CD1 A;  1YJW N;  3CC7 N;  3CJA A;  3M6G A;  4CZH A;  4B9Q A;  3CER A;  4EFH A;  3EKU A;  3B8A X;  2QWL A;  4DKW A;  3A5O C;  1HPM A;  3CF5 L;  3HZ6 A;  3HBT A;  3WQT A;  2GX9 A;  1GLL O;  2QWO A;  4K25 A;  3O6W A;  3VF4 A;  1Q82 O;  3TSP A;  3HOT A;  3L0Q A;  1VQK N;  2HOE A;  5AQI A;  4A59 A;  3FR0 A;  2ZJQ L;  4H5R A;  2W41 A;  3CPE A;  3EE9 A;  4JKE A;  4IWV A;  3ZEU A;  5JLF A;  1QQO A;  4BR5 A;  5JVG L;  5GAE P;  4JKD A;  4IO9 L;  2NZT A;  5AQG A;  2NRZ A;  4BRG A;  3EO3 A;  1E4F T;  2FF6 A;  3C65 A;  4H0Y B;  3G71 N;  3D7E O;  3H3N O;  3CXC M;  2F7T A;  5GAG P;  4DHY A;  5E84 A;  3VEV A;  5EY4 A;  1GLA G;  3R8E A;  3LDL A;  1VQ7 N;  5EXW A;  1ILY A;  5AQJ A;  4O8U A;  4A61 A;  1Y64 A;  4JD2 A;  4QS7 A;  3BUZ B;  4ISG A;  4FWL A;  3CCV N;  5AQR A;  3ENH A;  4YOV A;  2VCP A;  4WF9 L;  3ENO A;  3LM9 A;  4MDA A;  5BRF A;  5ADX H;  1SZ2 A;  3FLC O;  3WXJ A;  2VWB A;  1QHA A;  4KH4 A;  2QTD A;  2FSJ A;  1LOT B;  2BTF A;  4JK9 A;  2A6A A;  5C2F A;  3A8Y A;  4FL9 A;  2P9I B;  5EOY A;  3MWT A;  3VTI A;  5FPE A;  2P9K A;  3DXM A;  5F1X A;  4B1W B;  1Q7Y O;  1HKC A;  1NGJ A;  3CJB A;  2WBN A;  3D2E A;  3O9U A;  3UKR B;  4B1V A;  1QQM A;  3KZB A;  1ATS A;  2QM1 A;  4DCH A;  1QZ6 A;  4IEE A;  1YXQ A;  3BP8 A;  2AA4 A;  2BUP A;  3ENB A;  3HRG A;  3JXU A;  5C15 A;  3HOS A;  3FGU A;  2NNW A;  2VGN A;  4FPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...