4BRKA

Legionella pneumophila ntpdase1 n302y variant crystal form iii (closed) in complex with mg umppnp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
359
structure length
359
Chain Sequence
TNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISYLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 124
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4brkA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4brkA02
3U9DA 4ISGA 4EFHA 2CGKA 1T6CA 3VF4A 2D1KA 2PBDA 3H6EA 4H5WA 3UKRA 4CJ7A 1K8KB 3VEWA 4RWTA 2P9LA 4B1ZA 5EVZA 2QW9A 4CZEA 1S22A 1OKJA 1GLCG 2P9IB 5JLFA 3CERA 3H46O 1DGKN 2IIRA 3D2EB 3DAWA 1SZ2A 2E2NA 4FOIA 4K25A 3W0LA 3A0IX 2CH5A 4F9OA 3VEOA 4CZJA 1NGCA 1YXQA 5EOYA 3AY9A 1BA0A 4Y0WA 3VEVA 1NWKA 2WUSA 3IDHA 4CBWA 3J8AA 5I9EB 4BVOA 1YUWA 1HUXA 4H0YB 4FWMA 3UE5A 4BC2A 4BR4A 3H1VX 3DXMB 1U6ZA 3LDNA 3VOVA 3O6WA 2GWJA 4JHDA 3GDQA 1NGAA 3RSEA 4K41A 2P9IA 4B9QA 3GOIA 3CJ1A 4O5FA 5LY3A 4HWIA 4KBOA 1GLDG 5AQWA 5TKYA 1NGFA 3HI0A 4BRFA 2P9SB 3VGLA 4LC9B 5FPEA 2HOEA 4BRMA 2E88A 1JCEA 3CI5A 2Q2RA 3DWLA 1GLAG 2KHOA 3BP8A 4I6MB 5BRDA 3IMXA 3VGMA 3ZEUA 4BQZA 2CGJA 2P9UB 2ITMA 4BR5A 5AFUA 3MCPA 2ASMA 5AQLA 4H0XB 3FLCO 4BRHA 2D4WA 2F9TA 1JCFA 5AQZA 1KAZA 4BREA 4DQ8A 1QQMA 1BA1A 4BG9A 3FE1A 4XH1A 1HLUA 5CE3A 4CZGA 2ZWHA 3FFKB 4XEIA 4E1JA 2YHYA 3R8EA 3ZX0A 3FR0A 3LL3A 2A40A 1XQSC 1E4GT 2UYTA 2YCHA 3F9MA 4FPAA 5F2RA 1MWMA 2BUPA 1CZAN 4O8KA 4NB4A 2CH6A 3EZWA 1ESVA 2HF4A 1ATSA 5AZJB 3VF6A 4I6MA 4CI6A 3VPZA 3CJ7A 4JNEA 4H0PA 1S3XA 4HTLA 4BR2A 3CJ9A 2FLOA 4IJNA 2YI1A 5FPNA 4FWKA 2P9LB 3OHRA 3ATVA 4QS9A 1KAXA 1T44A 1GLFO 4WQ4A 3TPQA 4CBUA 1KAYA 1DKGD 5BPLA 4BRCA 3ULEB 5KQDA 3R6MA 3DXKB 3CQYA 3H3NO 1NGJA 3R9PA 4FPBA 5AQTA 2P9NB 3A5OC 3CHWA 1MDUB 4FWPA 3WXJA 3LM9A 3H3OB 5ADXH 4BR0A 3CJAA 4QS7A 1IJJA 2GEMA 4EHUA 3O5BA 3QBWA 3LDOA 4DB3A 3QMLA 2IVNA 4AM6A 2YHWA 2Q1NA 2E1YA 5AQKA 1X3NA 2ZF5O 3CETA 2HF3A 4BGAA 4JHDB 4M63C 4BRPA 2V7YA 4PKGA 3RSEB 3O1WA 4BG8A 1RFQA 2GUPA 2A41A 3ULEA 5KPTA 3TU5A 3DXKA 4IXCA 1G99A 4BRQA 2BTFA 4JD2A 2P9NA 5AQXA 1QQOA 3O08A 3M6GA 2DPNA 5AQMA 4CBXA 5FPDA 3ID8A 3CQXA 4BRGA 3MMVA 4H03B 3KHYA 5KQ8A 4DHYA 3EN9A 3ENOA 5F1XA 4K42A 4FSVA 3ZEUB 3JXUA 2Q0RA 4M7YA 2GELA 1XUPO 1T6DA 2V7ZA 3AAPA 3LM2A 2E2OA 3UKUB 2CGLA 4H5TA 4L3QA 1GLJO 4C23A 3W3DA 5AQOA 4EAHD 1BDGA 4A2BA 1NGDA 4BRIA 1TYQA 3AAQA 4NO7A 4CZMA 5E84A 3MN9A 1BU6O 5KPZA 3FZHA 1Y64A 2ASPA 2QWMA 4K43A 4GY2B 5JICA 4FWQA 1P8ZA 2IVPA 1IG8A 1NGIA 3CJBA 5EX5A 3EL2A 5AQQA 3HBTA 2EWSA 3SMPA 2OANA 2FF3B 2FSNA 5AQRA 5ELZA 4BROA 3VENA 3L6QA 2HMPA 2I7PA 3UKUA 4BRKA 3CIPA 5ADXA 4JN4A 5AQJA 4BGBA 4H5NA 1HKBA 2D0OA 2P9PA 4BC3A 1NGGA 2NLXA 5KPRA 3QDKA 3VEXA 2GTDA 3QFPA 3LDLA 4BRDA 1J6ZA 4DCHA 1GLBG 2GWKA 1ZXOA 2QXLA 5BRFA 5JLHA 3B8AX 4ISFA 3C7NB 1NMDA 4CD3A 3GBTA 2YHXA 5BN9A 1X3MA 4FWNA 4B1WB 5BR9A 4FWLA 4MO5A 3VF2A 5EXWA 1V4TA 5AZIB 1QHAA 3O8MA 1D4XA 2D0PA 1QQNA 3IUCA 4FWRA 4AM7A 1LOTB 3P4IA 4H0OA 3SMSA 3U4LA 3GE1A 1ZBSA 3FZFA 3EO3A 4FWOA 5AQYA 2W41A 5AQNA 5BRHA 3H1QA 5BPMA 1MWKA 2A6AA 4PKIA 1E4FT 3D7EO 3SK3A 3QB0A 3HSCA 3FZLA 3FGUA 1DEJA 4JD2B 2YJEA 1HKGA 3MK6A 3O80A 1SAZA 2E2QA 3M3ZA 4BR7A 3C7NA 1RDWX 4FOEA 3SJHA 3ZX3A 1QZ5A 2F9WA 1EQYA 3ENHA 3GL1A 4RTFD 2E20A 3KZBA 2YJFA 1BO5O 3WXIA 3MN7A 4A62A 1YAGA 4BRAA 5AZIA 2QWOA 4RCHA 2QWNA 4A2AA 4CZHA 2VWBA 3C0BA 2ZGYA 1KXPA 4BR9A 3BUZB 3VEZA 3EKUA 1WUAA 1HJOA 5B8HA 3L0QA 3VGKA 4EHTA 1TYQB 1TUUA 4H0VB 4B1YB 4FL9A 3ZETA 5F0XA 1U2VA 2P9KA 2PAVA 2H3GX 5AQFA 2V51B 3MN5A 3I8BA 3WEEA 1NM1A 4Z94A 2FXUA 4B1UB 1GLLO 1NBWA 1ATNA 3M1FA 5AQUA 2VCPA 3WXLA 2Q97A 5LJWA 3BF3A 4XH5A 3WXKA 4H5VA 1ZC6A 4CZKA 3HTVA 3CJCA 2QM1A 4GNIA 5AQPA 4BRLA 1HPMA 4M7XA 3QICA 1Z6RA 4MO4A 3VERA 3WT0A 1QZ6A 2P9PB 1BOTO 3MN6A 2Q31A 3D2FB 3HM8A 1SQKA 1MA9B 2Q36A 1JCGA 5AQGA 5BPNA 4CZFA 3H45C 3QBXA 2FSJA 1X9JA 2V52B 5LJVA 3S41A 1C0FA 1K8KA 3VETA 1NLVA 1GLEG 3ZX2A 3WUHA 4YDUC 2Q0UA 5AR0A 3JS6A 3LDPA 4JAXA 3VESA 4BVPA 2AP1A 2VYPA 5FPMA 4H5RA 1H1VA 3D2EA 2A5XA 2FSKA 3QFUA 3U9ZA 3A8YA 2QWRA 3L4IA 3D2FA 1V4SA 4BRNA 2J4RA 2A42A 3EKSA 3SLCA 3UB5A 5E26A 4PL7A 3FZMA 4A61A 4FO0A 5AQSA 5BN8A 4CD1A 4BC4A 2QWLA 4CZLA 1XC3A 3A5MC 4EIAA 1NGBA 2E2PA 3HZ6A 2NRHA 2AA4A 3DXMA 4H0TB 3I33A 3BF1A 1R59O 4WQ4C 4YDUA 5EY4A 2IVOA 3AARA 4PL8A 3KVGA 2E1ZA 1BUPA 1RGIA 1WOQA 2W40A 3VEYA 4WQ5C 5BREA 1HKCA 4IWVA 3WQUA 2P9SA 3U8XA 3ZETB 1C0GA 1Q18A 1U2VB 2P9KB 4B1VA 1ATRA 3LDQA 3WEEB 2NZTA 3BEXA 2QWPA 4CZIA 3FZKA 5AQIA 3G25A 4PKHA 4BQLA 1LCUA 1NGEA 5AQHA 3UKRB 4IJAA 1TUYA 1NGHA 2P9UA 2ASOA 3IFRA 4MLHA 3MDQA 3GG4A 1BG3A 4XH4A 4IZ9A 3ATUA 3O1BA 4IO8A 3DJCA 4ISEA 2A3ZA 1Z05A 4BC5A 4J8FA 5JMVA 4WQ5A 2E8AA 2I7NA 5AFUH 3O4WA 1YVNA 1BWFO 2ZGZA 4FWSA 2QWQA 4QS8A 5AQVA 4MLEA 3WQTA 4B1XB 4WYBA 3A5LC 1HX1A 3A5NC 2FF6A 5AZJA
chains in the Genus database with same CATH superfamily
1S5JA 2HHSA 3EZ5A 3UKRA 4CERA 3AO3A 1RT5A 1S22A 4RG8A 5JVGL 4B9SA 4ILJA 3CERA 3H46O 1DGKN 3I0RA 4KTQA 3AVLA 3VEOA 4HTUA 1NWKA 3IDHA 4DV2K 3TAEA 3P5JA 1A5VA 2O8FB 3SQ1A 3SPYA 3LDNA 1TKTA 5LMUK 1C0MA 4JHDA 2DY4A 3SYZA 5LY3A 4O5FA 2ZE2A 3AVNA 4KBOA 4DV5K 4DG1A 5AQWA 4CF2A 1Q82O 1NGFA 3HI0A 4BRFA 1IH7A 1L3SA 1S1WA 2O8BA 3VQCA 4ID5A 3VGLA 5FPEA 3KLIA 4WF9L 3CCSN 2HBMA 4I6MB 3IMXA 3ZCMA 4BQZA 2WTUA 2JGUA 5AFUA 3OS1A 4IG3A 4FCYA 2ASMA 5AQLA 1D9FA 2NRWA 4N56A 2D4WA 2F9TA 1KAZA 4BREA 1XWLA 3AVGA 4KH6A 1BA1A 3PSIA 4BG9A 1HLUA 1S9GA 4CZGA 2KLAA 2ZWHA 4CFDA 4E1JA 3HOTA 4W5NA 4JKEA 2KKZA 1LV5A 2Y1IA 3BY5A 3F73A 1CZAN 3CC7N 3O9RA 3MXMA 4NB4A 5AZJB 3SUOA 3T19A 3NHGA 4C1NK 1S3XA 4FJXA 2FLOA 2RN2A 4J2EA 4DV6K 1K8AO 3ATVA 3TPQA 4WQ4A 4B9NA 2XHBA 4CJPA 4CK1A 3I56N 3O3HA 2F8SA 4E7KA 5MLCQ 2WBNA 5GIPA 3LDSA 3OYIA 4G1QA 1BQNA 1JLAA 4YFUA 1TK0A 3MCAB 3CJAA 4OX9K 2NUBA 4NCAA 2GEMA 3QIOA 3VQ5A 5KGXA 4DB3A 4DTSA 4DU3A 3K5LA 3V81A 1TKXA 2D5RA 2IVNA 4AM6A 2RHKA 2Z1JA 4FK4A 2GBZA 2XRIA 5CY4A 2BGGA 4NYNA 3CETA 4JHDB 3O1WA 1NK0A 2A41A 3ULEA 4JKAA 5C12A 2BTFA 3OYDA 4JD2A 1KLMA 2P9NA 1NJXA 2W42A 2O8BB 1B9DA 3AA3A 1ZBHA 2HW3A 4JK7A 3O08A 1YJWN 2QA4N 1TK8A 4FXDA 1WSIA 3MAQA 4H03B 4Z0UA 1HNXK 5HRPA 4DHYA 5F1XA 3ENOA 5KQ8A 1X1PA 3HRGA 4FSVA 3JXUA 2GELA 2V7ZA 3VQ6A 3LM2A 4KO0A 3RVCA 4IDHA 1K73O 4KREA 3TTCA 3LALA 1GLJO 5C25A 1VK0A 4A2BA 2VG6A 3OYCA 2BANA 3L2UA 3LANA 4C8LA 1HRHA 3LZIA 4OPJA 3T69A 2ASPA 4K43A 1W7AA 5JICA 1P8ZA 1RBSA 2IVPA 1YI2N 5M1QA 1CXUA 2EWSA 3SMPA 5J2NA 5ELZA 4Q0BA 4BROA 4DTRA 3VENA 4DSFA 3T7ZA 3OJUA 4DR6K 3L6QA 4K8XA 5FRNA 1TVRA 1VSFA 2P1JA 3MWPA 3HL8A 3QO9A 3WNHA 3ZSQA 4B3SK 2B4JA 1WLJA 4H5NA 4KB0A 3ZT3A 3DLLL 2OTLN 2D0OA 4CHOA 3MXJA 2W6KA 5IWAK 3TABA 3THXB 4DCHA 3SCXA 2GWKA 5GAGP 2QXLA 4X65K 4ISFA 1NMDA 1QHTA 3K9KA 4DKWA 3GBTA 3QETA 1CZ9A 4JYAK 1NJWA 3C94A 1WSEA 2IOCA 2LSNA 2D0PA 1QQNA 1VQPN 2AJQA 4CJEA 1WAFA 4CFAA 4DTMA 2OA8A 5HRNA 3U4LA 2W41A 3H1QA 3MEGA 4CJKA 2A6AA 3IS9A 4LF5K 1YF5L 3FGUA 4X66K 4DQIA 4JD2B 2YJEA 3ZT2A 3SJJA 3O80A 4FJLA 1YJ9N 2RKIA 3C7NA 5H1SQ 1U47A 1FW6A 4AQYK 4RW8A 1EQYA 3MXIA 4RTFD 2E20A 1DT9A 2F8TA 3DRSA 1YAGA 2QWNA 3AGKA 1ITGA 5GIOA 3AVAA 1NK9A 2B5JA 4FYDA 5M1PA 1B92A 1HPZA 3C95A 5AQFA 2V51B 3WEEA 3DYAA 1VQ5N 4BE2A 5GAEP 4Z94A 3CF5L 4CIGA 2I5JA 3KD5E 4BACA 1XMQK 3HM9A 4DTOA 3G6EN 4O0IA 3NGZA 3CQ8A 4NLCA 5LJWA 4DQRA 3BF3A 5CYQA 4F3OA 5CYMA 3L2WA 4H5VA 4B9LA 2F4VK 4BRLA 4YOVA 4JKHA 4DR3K 2O8DB 1Z6RA 4MO4A 3VERA 5M1KA 5FROA 3WT0A 3J81O 1Q7YO 2HVHA 5KRSA 1BOTO 3PY8A 3MN6A 3V9ZA 2Q31A 2UXDK 3HP9A 1K6YA 3D2FB 2HHTA 4KB1A 1BL3A 3AVFA 2KZZA 5AQGA 5BPNA 3AVMA 4JKGA 3ZT0A 4IFVA 3VETA 1N8RO 1NLVA 1QE1A 2VQFK 4YNQA 1VQ7N 1N5YA 1SKRA 4JAXA 3CCRN 3LAKA 3D2EA 1J5EK 2FSKA 4JS4A 1VSMA 3O9QA 4H8KA 3A8YA 3WNEA 3JAMO 1XC9A 4BRNA 4FLUA 4PL7A 1KD1O 4M42A 4A59A 3ZSVA 2QWLA 3R3LA 2E2PA 3DXMA 3NH2A 1BI4A 3TTDA 3AO5A 4Z4HA 2IVOA 3AV9A 4B9UA 4N5SA 2E1ZA 3V9SA 3Q7CA 2ZJPL 1WOQA 3ISNC 4LF7K 4WQ5C 1DLOA 2E5LK 3WQUA 2GX9A 2P9SA 3OS0A 1HMVA 4NXMK 2D0AA 3ASMA 3WEEB 2QWPA 4CZIA 3H08A 5AQIA 4M3ZA 3G25A 1I94K 4KHNA 2HHVA 4IEIA 2WOMA 4CJTA 1TUYA 4MLHA 1C1AA 4CJVA 3V9WA 2Z1HA 1VQ4N 1QVFM 1KRPA 4LF8K 4BDPA 1QSLA 3O1BA 4KFBA 4GMJB 3OS2A 4C8MA 5JMVA 2IAJA 3SQ4A 3KK3A 4B1XB 2ATQA 5AQVA 3WQTA 1HNZK 4AHUA 4M3RA 3A5NC 4IBNA 4OPKA 4CGIA 1YTUA 4CVNE 1M90O 3KWIA 2HB5A 4JKGB 4OO1J 2CGKA 1IKVA 1X9WA 2PBDA 1JLFA 3O4QA 4HHTA 3VEWA 2P9LA 1Z25A 2G8FA 3G71N 3L8BA 1JL2A 1TAQA 1OKJA 4R5PA 4FM1A 2P9IB 5J1EA 1N34K 2IIRA 3D2EB 5C24A 1SUQA 1SZ2A 3NFAA 1SKSA 2OZMA 3HPOA 1JLBA 1UWBA 3A0IX 3NAEA 3M8PA 2CH5A 2KTQA 4DS5A 4F9OA 4AHVA 1LW2A 1NGCA 1YXQA 4DFMA 1SL0A 2YNFA 4Y0WA 2HNYA 3KTQA 1MU2A 4CBWA 3CXCM 3J8AA 3M8QA 4W5RA 3J7AP 1IKWA 4BVOA 3VQEA 4DF4A 2IC3A 3H1VX 3DXMB 3CC4N 4DR7K 1BI4B 3GDQA 4MQ3A 3KLGA 1CZBA 3TAMA 4Y1CA 4KHSA 5KI6A 2P9SB 1BIUA 4LC9B 4BRMA 2E88A 1JCEA 4C1NI 3TI0A 2DFFA 2KHOA 4YOXA 4IOCL 3OYEA 2PZSA 1JLQA 4BDZA 4DLEA 1OH5A 1D9DA 3QINA 2YKNA 3VGMA 1BCOA 3QEWA 4JI8K 4BR5A 3MCPA 4YOUA 4DV0K 3FLCO 3ZSOA 1JCFA 4DSEA 3LP1A 1RTDA 2PYJA 3FE1A 4XH1A 4CJUA 3FFKB 1Z26A 3THYA 3R8EA 1BCMA 3ZX0A 1TV6A 3NMUA 2UYTA 3F9MA 3L3VA 5F2RA 2BUPA 2KQ2A 5CR4A 4O8KA 3EZWA 1ESVA 3VF6A 1ATSA 4I6MA 3OTOK 3R1XA 1JLEA 2O8CB 3CCLN 4JNEA 4H0PA 1NOYA 3CJ9A 1TAUA 4FWKA 2P9LB 3OHRA 4LD0A 4FLWA 3DOKA 4CBUA 4U67L 1W0HA 5BPLA 4AH9A 4CGGA 3CCUN 3K2PA 4CESA 3H3NO 3AVHA 5AQTA 1MDUB 4DR5K 4FWPA 4MDBA 1Y97A 4OLBA 3LM9A 3NF8A 2VQEK 2GV9A 3KLEA 4QS7A 1CXQA 1IJJA 4EHUA 4IG0A 3QBWA 4IEEA 4DU4A 3QMLA 4ELVA 2YHWA 2Q1NA 3HSTB 2E1YA 5AQKA 1X3NA 4DTJA 4PY5A 1KVCA 4DSJA 2HF3A 4BGAA 4BRPA 4CE9A 1TL1A 4E19A 2KW4A 2F96A 4CJWA 1RFQA 2HHHK 2DFHA 1REVA 1XNQK 4KAZA 5KPTA 4IXCA 2UU9K 1JXBA 5CHIA 3G10A 1LWEA 4FJ7A 1VQ6N 3M6GA 4CGFA 5AQMA 4JI7K 2Z1IA 3MMVA 3K57A 3OVNA 3KHYA 3EN9A 4K42A 4JLHA 2O4GA 4M7YA 3AAPA 1VRUA 4CK3A 3UKUB 2CGLA 4H5TA 5AQOA 2XO7A 4KI4A 4BRIA 4CW7B 5HRRA 4WFAL 4CZMA 3LWMA 4LF9K 2G8IA 4A5BA 3MN9A 3THYB 5KPZA 1JLGA 2FC0A 2P51A 4E7LA 1T05A 1C0TA 1NGIA 3OYLA 1LWCA 2OANA 2FSNA 5AQRA 4AILC 4ZTJA 1VSEA 1NJYA 3QLHA 4BWJA 4FLTA 3LP3A 4JN4A 2QKKA 2XY7A 5AQJA 4BGBA 1NGGA 3T3FA 3CG7A 4BRDA 3LDLA 5C10A 1YIJN 3IG1A 3K5NA 5BRFA 4ELTA 4KI6A 1VSDA 4CD3A 3QESA 5BN9A 3CC2N 5BR9A 4FWLA 3OBWA 5EXWA 1I39A 2OPRA 5AZIB 1QHAA 3O8MA 4L8RB 1QSSA 3IUCA 2UUAK 3C6AA 4FJIA 3P4IA 1EXQA 4H0OA 4Z4CA 1VSLA 4JKCA 4IOAL 1ZBSA 3CYMA 4FWOA 4DFPA 5BRHA 1LW0A 4FK0A 1MWKA 1WSFA 3SK3A 1U4BA 5M1OA 1LAVA 2BE2A 1F21A 3HOSA 4CHYA 3THXA 2HBJA 4CK2A 4LF4K 4CGDA 3L4QA 4B3OA 3KJVA 4LSLA 2X6SA 3ZX3A 1OH8A 1QZ5A 3VQBA 2YJFA 1BO5O 3V6DA 3WXIA 3MN7A 4A62A 2DTUA 3SQ2A 4DMNA 4RCHA 1KQSM 1HYVA 2ZGYA 4GV3A 2OCEA 4KHYA 3TSUA 1T03A 3QEXA 1WUAA 2E4LA 5B8HA 1HR0K 1TUUA 4FW2A 2Z1GA 4B1YB 3ZETA 5A2QO 1U2VA 1RCHA 4B1UB 1BGXT 3V4IA 3TARA 2NRTA 1ATNA 4YOWA 1HNVA 1A5XA 3KK7A 4JI1K 1KC8O 2Q97A 1ZC6A 3HTVA 1NJIO 3CJCA 3T1YK 5AQPA 4Z4IA 1HPMA 3QICA 4LFCK 3TAPA 1KCFA 3BGRA 4CJLA 3VA3A 1QZ6A 4CHZA 4FJMA 1SS6A 1VQ8N 3HM8A 4CHQA 4FVUA 3C6TA 2KFZA 5FDLA 3CCVN 1C0UA 3H45C 4CJ5A 2GUIA 2FSJA 1RT3A 1X9JA 2V52B 1VSIA 4AF1A 1K8KA 1YJNN 2QXFA 3WUHA 4YDUC 5AR0A 3LDPA 4BVPA 2AP1A 5FPMA 1H1VA 4X62K 4KHQA 1NG9A 3LPTA 2O8DA 3G0ZA 4DV1K 3U9ZA 1BISA 1W9HA 2QEXN 4Z4FA 2QWRA 1NK5A 1KFDA 3MWTA 4DQSA 4CECA 4DR1K 1C6VA 3D2FA 1V4SA 4CEBA 4O4GA 2A42A 3Q7BA 3SLCA 3EYZA 5E26A 4Z4GA 3FZMA 4A61A 3CPEA 4FM2A 4CEDA 5BN8A 4CEZA 3HT3A 1XC3A 3A5MC 4EP5A 1NGBA 1NNEA 3NBPA 2NRHA 3KKRA 4LY7A 4H0TB 4WQ4C 4KHPK 1N36K 3PV8A 5JVHL 3UIQA 3NH1A 3CMAN 1RGIA 1NMNA 1SKWA 3AVBA 3VEYA 1OVQA 1ILYA 2W6LA 1HKCA 3U8XA 3ZETB 1U2VB 3I0SA 3KKSA 1YVUA 3P83D 4B1VA 1ATRA 3LDQA 4FLYA 1RTIA 4I2QA 4TSXA 3HJFA 3VA0A 2IGIA 1FXXA 1TGOA 2OPQA 4BQLA 1O1WA 3RRGA 1NGHA 2P9UA 3IFRA 4XIUA 3ULDA 4DQQA 1L3TA 3GG4A 1WNSA 1XI1A 4HCBA 3SI6A 5J2MA 5CZ2A 1O13A 4OPAA 4WQ5A 3I55N 1YVNA 1BWFO 2QWQA 3A5LC 5HBMA 3M8RA 4HUFA 1VQLN 4JI6K 4MFBA 1S9EA 4E3SA 3TAFA 3T1HK 4CF0A 5HP1A 3J7YP 3U9DA 4ISGA 3VTIA 3D0PA 2EX3A 3VF4A 3H6EA 3M5RA 4B08A 4CJ7A 1K8KB 1EWQA 4RWTA 1QVGM 4B1ZA 1N6QA 1IBLK 3TWHA 2UUCK 4CJRA 3OYKA 1GLCG 1RTJA 2VG7A 4DFJA 3PX4A 3ALYA 2YNHA 1RT7A 5TKWA 3AVKA 2E2NA 4DV7K 4B9VA 4FOIA 1RDUA 1Q81O 4K25A 1JKHA 3B6PA 1U45A 1IG9A 3ZT4A 4CF1A 4RW7A 3AY9A 1BA0A 3BDPA 4GVMA 3VEVA 2YV0X 4LH5A 5I9EB 1YUWA 2FBVA 3UE5A 3WXMB 4LH4A 1U6ZA 1JL1A 4CEOA 1NU0A 3O6WA 3AA2A 2GWJA 3N4PA 2P9IA 4GKKK 4I2PA 4B9QA 4FZXC 3K5MA 1GLDG 4UQGA 1NK4A 1XMOK 4B3RK 4OKKA 3KK2A 4I9QA 4JK9A 2G8WA 3CPWM 3VQ9A 3DI6A 3CI5A 1IKXA 1GLAG 3BP8A 1TKZA 4FZYA 5HL7L 1QS4A 5HRSA 4YOTA 4JS5A 5M1NA 1ZYQA 3PIPL 1J53A 1GOAA 3KLHA 2P9UB 3M8SA 4BDYA 3MECA 3V1OA 3AGRA 4H0XB 4OLAA 1QTMA 4BRHA 4JI3K 1EX4A 2QI2A 4PUOA 4DQ8A 1QQMA 3VQ7A 3F5TA 3V1RA 3B6OA 5C2FA 2YHYA 3FFIA 4DUZK 1XQSC 3IAYA 2YCHA 3PX0A 1MWMA 4ZTFA 2HF4A 3QERA 3LWLA 3J80O 4HTLA 3L2VA 4BR2A 3HPGA 5FPNA 3P39A 4QOZB 1GLFO 2B6AA 5KRTA 4OGEA 2OTJN 2PYLA 3R6MA 3DXKB 4R79A 1NGJA 2A1SA 1RTHA 4H4OA 3CHWA 3H3OB 5ADXH 1WN7A 3QEVA 1EETA 1JXEA 3KWGA 4PHTX 3J7ZO 3O5BA 4BWMA 4A57A 3LDOA 4CEEA 2O8CA 1U49A 2UUBK 4B8CA 1W97L 3DLHA 1UAXA 1ASUA 1RT6A 2ITGA 1G15A 1LAWA 1UA1A 4M63C 4I7FA 4FJGA 4PKGA 4CJ3A 4BG8A 4FJHA 2GUPA 1QSYA 1U48A 2DFEA 3HVTA 3KIOA 4O44A 4RW4A 4BRQA 4KKOA 3NGYA 1ZBUA 2DPNA 5JS1A 4CBXA 3ID8A 4K8ZA 5LMNK 2UXBK 3LZJA 3THWB 4KPYA 3TSPA 3BZKA 4JKFA 1WSHA 1XUPO 1T6DA 2E2OA 3EE8A 2VGMA 2G8UA 2XY6A 1CLQA 3W3DA 3RR7A 3RRHA 1BDGA 1A5WA 4A5AA 1NGDA 1VSKA 3CM5A 2JWKA 5E84A 3HXMA 1BU6O 1Y64A 3OBYA 2QWMA 2IS3A 3CM6A 1C1CA 4JKDA 4GY2B 1BIZA 3NE6A 1IG8A 4QAGA 3CJBA 3EL2A 2FF3B 2E6MA 4EP4A 1EO1A 4WCEL 4FLZA 3LAMA 1DTTA 1WAJA 3SV4A 1KLNA 2HMPA 3WNFA 2YX6A 2I7PA 1HQEA 3DMJA 3UKUA 3CIPA 5ADXA 2BDPA 3N4QA 3OYAA 3ZYYX 1HKBA 4BC3A 2NLXA 3VEXA 1J6ZA 3E1YA 3B8AX 2YHXA 1RDAA 3OYGA 2WONA 1V4TA 1NJZA 1Q9XA 1D4XA 3LP2A 3VQAA 4F3TA 4W5OA 4FWRA 4AM7A 3MEDA 1LOTB 4CJFA 3SMSA 3GE1A 3FZFA 3V9XA 4G9ZA 5AQNA 1E4FT 3HSCA 1WB9A 3HYFA 4DSIA 4NLBA 5EU7A 1HKGA 3AO2A 4X64K 4DLGA 2E2QA 4LF6K 2QTDA 1YITN 4ILGB 4B3MK 3SUQA 3GL1A 3ENHA 3KZBA 3RTVA 4NYFA 4BRAA 5AZIA 4OVLA 3OYJA 4CHPA 1VRTA 1XNRK 2VWBA 3C0BA 1KXPA 4JI2K 4BR9A 1EKEA 4KH4A 1RT2A 4YHHK 1RT4A 3DLGA 3EEQA 3EKUA 1KFSA 1HJOA 3L0QA 4EHTA 4H0VB 3OW2M 5F0XA 2PAVA 2P9KA 3E9OA 1NM1A 2O8EA 3HK2A 3SBGA 2YHBA 4B9MA 3I8DA 3NH0A 4GV6A 4PA1A 3NCIA 3M1FA 2XY5A 4PQUA 4U7BA 2F7TA 2D0BA 5DM6L 1RDDA 4XH5A 1S6PA 1HYSA 4CFBA 2QM1A 3EY1A 4GNIA 4GV9A 4M7XA 3F9KA 3JYTA 4E1MA 4CEFA 1FJGK 1YTAA 4B8AB 4FW1A 3K59A 4AHCA 2RPIA 4FJ8A 3OY9A 1VQMN 4W5QA 3SV3A 1SQKA 2Q36A 4DV4K 5GAHP 1JCGA 4CCHA 4LFAK 3QBXA 3DLKA 1C0FA 1QQCA 4NCBA 1GLEG 1Q9YA 1S6QA 3AA4A 2Q0UA 4AHTA 3JS6A 3L2QA 4BE0A 3CCMN 4DS4A 2OYQA 3NF9A 4M41A 4H5RA 4CEAA 4Y1DA 2A5XA 4DV3K 2RF2A 5D3GA 3VQDA 4JI0K 3L4IA 4E89A 5CZ1A 1VQNN 4I9LA 3S3OA 1R0AA 1FK9A 4JI4K 3G4SN 1LWFA 3UB5A 4JK8A 3E66A 4DUYK 5AQSA 3U6FA 5HLFA 5DK5A 1UA0A 4C8KA 4EIAA 3HZ6A 1BHLA 1GOBA 3F2KA 2AA4A 4E1NA 4YDUA 3KK1A 5K14A 3HO1A 3L3UA 1T8EA 3PO4A 3AARA 2ETJA 4JI5K 1T3VA 4PL8A 3KVGA 4HUEA 1BUPA 3DRPA 4LSNA 4F4KA 1WBDA 2E6LA 1VSJA 1C0GA 1VSHA 2HSTA 3PIOL 1YHQN 2P9KB 4JKBA 2VWKA 1D8YA 1D5AA 2BH1A 4FM0A 3BEXA 4JEPA 5C0YA 2O8EB 3T1AA 4PKHA 1HNIA 1IO2A 1K9MO 2D0CA 3LP0A 4F2SA 1NGEA 5AQHA 4GVEA 4C8OA 2OZSA 3UKRB 2ASOA 1SV5A 3MDQA 1E3MA 4FJJA 1BG3A 1TKDA 4XH4A 3ATUA 3RMCA 4OJRA 3PX6A 5C42A 3DJCA 2A3ZA 3QIPA 3KLFA 2UXCK 2I7NA 4ICLA 3RMDA 3V9UA 1TK5A 3ZSZA 4FJKA 4E7IA 2ZGZA 4LFBK 3E9LA 4ILHA 4MLEA 4AHSA 4WYBA 1NKCA 3VMFB 2FF6A 5GINA 3VN5A 4CGHA 4EFHA 1T6CA 1I3AA 2D1KA 4H5WA 2WFBA 5EVZA 2QW9A 4CZEA 5M1FA 1OH7A 4ELUA 5JLFA 1J9AA 3RWUA 3D6RA 3PUFA 3DAWA 1XHXA 1RBRA 1C1BA 2ZJRL 3W0LA 4E7JA 3AO4A 2QK9A 3NVKA 4CZJA 5EOYA 4DQPA 4F8RA 3MX5A 4GKJK 1NK6A 4Z4EA 5FLXO 2WUSA 4Q5VA 3WNGA 3P31A 5KTQA 3SPZA 1B9FA 1HUXA 4H0YB 4FWMA 3O9TA 4BC2A 4PWDA 4BR4A 3VOVA 4DTPA 1RILA 3HP6A 3DRRA 3RMBA 4JV5K 1NGAA 3RSEA 4K41A 4CF8A 2X78A 1JJ2M 3GOIA 3CJ1A 3K9JA 4HWIA 4NCGA 1WSGA 4DWIA 1L5UA 5TKYA 4B9TA 3ZLJA 4CFCA 3SBTA 5J2QA 2HOEA 5HOOA 2Q2RA 2FBYA 4EZ9A 3DWLA 2HNZA 5BRDA 4V19S 4CF9A 1Q8IA 3A2FA 2OPPA 3S9HA 3ZEUA 3L2RA 3SNNA 3C6HA 4CHNA 1X9SA 2CGJA 2ITMA 1N32K 3OYHA 4OGCA 5AQZA 1J54A 5IT9O 1ASWA 2ZD1A 4IKFA 5CE3A 4XEIA 3TSQA 3FR0A 2VWJA 3O9UA 3D45A 2A40A 3LL3A 4YY3K 1E4GT 1WSJA 2ZJQL 4FPAA 5I3UA 3SUPA 1VHXA 2CH6A 5HROA 4CI6A 3PO5A 1VAZA 4J2AA 3VPZA 3CJ7A 5E41A 1VQ9N 4KTZA 2YKMA 3NF7A 3OYBA 1RNHA 3ZT1A 4IJNA 2YI1A 1S72N 1SL1A 3CFPA 4QS9A 1KAXA 1T44A 2X74A 3AVJA 1KAYA 1DKGD 1WBBA 3S3MA 4BRCA 3ULEB 5KQDA 4C8NA 3MEEA 3CQYA 3R9PA 5C15A 4M3YA 4FPBA 4YORA 2P9NB 4K0KK 3A5OC 3THVA 3WXJA 3K0SA 1L3UA 2YNIA 4BR0A 3TAQA 2WC9A 4ZHRA 1ZBIA 1EP4A 1M1KO 2XY8A 3VQQA 3LPUA 3U3GA 2ZF5O 3AVIA 3TTFA 2V7YA 3RSEB 3CCJN 4DU1A 5JS2A 3TU5A 3V1QA 3DXKA 3OYNA 3O9SA 1G99A 1FKPA 5AQXA 1IBMK 1QQOA 5FPDA 3CQXA 4BRGA 2P5GA 5FRMA 3AO1A 1RDCA 3VTHA 4BY9C 3DLBA 5C2DA 3ZEUB 1P90A 2Q0RA 5GADP 1IBKK 2EHGA 3NDKA 3RMAA 1DTQA 4O55A 5BR8K 4EZ6A 1W2BM 4L3QA 2VG5A 4GW6A 4W5TA 4C23A 4FJ5A 2X6NA 3CFOA 4EAHD 1KSPA 1TYQA 1RBVA 2RE2A 3AAQA 4NO7A 3KD1E 4N76A 1OVYA 3DOLA 3FZHA 4OPHA 4YOYA 2QKBA 4KRFA 1S1UA 4FWQA 4RW6A 5AJ3K 5EX5A 2PFUA 5AQQA 3HBTA 3OA9A 1NK8A 3NGIA 3THWA 2ZM6K 4FJ9A 2R7YA 1ZBFA 1S1VA 3SAGA 5SWMA 3S3NA 1NKBA 4FJNA 3C6UA 4DTXA 1U04A 2HHWA 3ENBA 4QCLA 4MDAA 4BRKA 1Q86O 4DTUA 4O0JA 4ID1A 4M3XA 3SAFA 4KV8A 2P9PA 3HVRA 2FBTA 5KPRA 3QDKA 2P5OA 3PLAA 2KFNA 2GTDA 3QFPA 2Y1JA 4E0DA 1OH6A 1GLBG 1ZXOA 5JLHA 3C7NB 1HJRA 4OKJA 4M3WA 4N41A 1X3MA 4B3TK 4FWNA 4FK2A 1ASVA 4B1WB 3BZCA 4MO5A 3VF2A 1UOCA 1L3VA 4F2RA 4M3UA 4DR2K 3AA5X 4IDKA 3AVCA 3OJSA 3EO3A 5AQYA 1RDBA 1VQKN 2HNDA 5BPMA 4PKIA 3K58A 3D7EO 3HPHA 3QB0A 4BE1A 3FZLA 1T7PA 3PSFA 3CFRA 1N33K 1S1TA 1DEJA 2KZMA 1TL3A 4DR4K 3MK6A 1SAZA 3CCEN 2JWLA 2HBKA 3M3ZA 4BR7A 1EWRA 4FVMA 1RDWX 4NXNK 4FOEA 3SJHA 4CIEA 3QNNA 2NNWA 2F9WA 4RW9A 4CGJA 5I42A 4FLVA 4WFNL 2QWOA 4CJ4A 3QEIA 3SUNA 2VGNA 4OKEA 3EE9A 1YT3A 1BQMA 4N47A 4A2AA 4CZHA 1X9MA 4FZZA 3BUZB 3ZSYA 2HBLA 3VEZA 4O8UA 3VGKA 2ZQBA 3P38A 1TYQB 4KHUA 3SAHA 1IV0A 4FL9A 3ZSXA 4DF8A 3O3FA 2H3GX 3ZSWA 3MN5A 3I8BA 3SQ0A 4UY8O 3ITHA 3NF6A 2NRVA 1HQUA 2FXUA 1ZBLA 1GLLO 4DSKA 1NBWA 4IO9L 4HCCA 5AQUA 1NKEA 2VCPA 3CMEN 3WXLA 5J2PA 1J5OA 4M45A 3TAGA 3WXKA 3VQ4A 4CZKA 4CJSA 3RR8A 4J2BA 2PY5A 3SZ2A 2OPSA 1NK7A 2NRRA 3CD6N 2G8VA 2P9PB 1JLCA 4CEQA 3E9PA 1VQON 3TANA 3IKMA 1GOCA 4JRQA 4KH5A 1MA9B 5LL6Z 1NOZA 4CZFA 1RBTA 4E7HA 5LJVA 3S41A 1FKOA 3DM2A 2JLEA 3DLEA 3ZX2A 3K5OA 4FLXA 3VESA 4WE1A 4M3TA 1IKYA 2VYPA 2NRXA 3QFUA 2O4IA 4KHWA 2YNGA 5DM7L 2HHUA 2HHXA 1RT1A 2J4RA 1XHZA 3EKSA 4KTWA 4FO0A 4IOXA 4DFKA 2NRZA 3E01A 1SL2A 4CD1A 3CCQN 4BC4A 1HNWK 1RBUA 4CZLA 2O8FA 3ZSRA 3I33A 3BF1A 1R59O 5EY4A 4IFEA 2IDOA 3ID6A 5DMRA 2W40A 3O4NA 4CIFA 3OYMA 4J2DA 5BREA 3QNOA 4IWVA 2G8HA 3MX2A 3TR8A 4CJQA 3O3GA 1Q18A 5T7BA 5KGWA 1KVAA 5SZTA 2NZTA 2Q3SA 3FZKA 4DSLA 3NVMA 4O5BA 3DLRA 1LCUA 2FBXA 4IFYA 4IJAA 4HVJA 4AHRA 3OYFA 4JRPA 3P1GA 3U3YA 2G8KA 4IZ9A 2YHAA 3C65A 4IO8A 2A1RA 1S1XA 1KVBA 4WFBL 4DTNA 4ISEA 2HMIA 3QEPA 1Z05A 4BC5A 4J8FA 1HYZA 2HVIA 2HHQA 2E8AA 4HUGA 3IRXA 3VQPA 5AFUH 3O4WA 4FWSA 4QS8A 4H4MA 1HX1A 3JSMA 1KTQA 3VQ8A 5AZJA
chains in the Genus database with same CATH topology
1M90O 3KWIA 4JKGB 3U9DA 4ISGA 3VTIA 2CGKA 4EFHA 4OO1J 1T6CA 3VF4A 2D1KA 2PBDA 3H6EA 3M5RA 4H5WA 3UKRA 4CJ7A 1K8KB 2WFBA 3VEWA 4RWTA 2P9LA 1QVGM 4B1ZA 3G71N 5EVZA 2QW9A 4CZEA 1S22A 1OKJA 1GLCG 2P9IB 5M1FA 5JVGL 5JLFA 4ILJA 3D6RA 3CERA 3H46O 1DGKN 2IIRA 3D2EB 5TKWA 3DAWA 1SZ2A 2E2NA 4FOIA 1RDUA 1Q81O 4K25A 2ZJRL 3W0LA 3A0IX 2CH5A 3NVKA 4F9OA 3VEOA 4CZJA 1NGCA 1YXQA 5EOYA 3AY9A 3MX5A 1BA0A 4Y0WA 3VEVA 1NWKA 2WUSA 3IDHA 4CBWA 3CXCM 3J8AA 3P31A 5I9EB 4BVOA 1YUWA 1YJ9N 1HUXA 4H0YB 4FWMA 3UE5A 3WXMB 3O9TA 4BC2A 4BR4A 3H1VX 3DXMB 1U6ZA 3LDNA 3CC4N 3VOVA 3O6WA 2GWJA 4JHDA 3GDQA 1NGAA 3N4PA 3RSEA 4K41A 2P9IA 1JJ2M 4B9QA 3GOIA 3CJ1A 4O5FA 5LY3A 3K9JA 4HWIA 4KBOA 1GLDG 5AQWA 1Q82O 5TKYA 1NGFA 3HI0A 4BRFA 3SBTA 2P9SB 4JK9A 3CPWM 3VGLA 4LC9B 5FPEA 2HOEA 5HOOA 4BRMA 2E88A 1JCEA 3CI5A 4C1NI 2Q2RA 4WF9L 3DWLA 1GLAG 2HBMA 2KHOA 3CCSN 3BP8A 4YOXA 4I6MB 5BRDA 4IOCL 5HL7L 3IMXA 4YOTA 5M1NA 3VGMA 3PIPL 3ZEUA 4BQZA 3C6HA 2CGJA 2P9UB 2ITMA 4BR5A 5AFUA 3MCPA 4YOUA 2ASMA 3AGRA 4H0XB 5AQLA 3FLCO 2NRWA 4BRHA 2D4WA 2F9TA 1JCFA 5AQZA 2QI2A 1KAZA 4BREA 4DQ8A 4KH6A 1QQMA 1BA1A 4BG9A 3FE1A 4XH1A 1HLUA 5CE3A 4CZGA 2KLAA 2ZWHA 3F5TA 3FFKB 4XEIA 5C2FA 4E1JA 3HOTA 4JKEA 2YHYA 3R8EA 3ZX0A 3TSQA 3FR0A 2KKZA 3O9UA 3LL3A 2A40A 1XQSC 3NMUA 1E4GT 2UYTA 2YCHA 3F9MA 2ZJQL 4FPAA 5F2RA 1MWMA 2BUPA 1CZAN 3CC7N 3O9RA 5CR4A 4O8KA 4NB4A 2CH6A 3EZWA 1ESVA 2HF4A 1ATSA 5AZJB 3VF6A 4I6MA 4CI6A 3R1XA 1VAZA 3VPZA 3CJ7A 1VQ9N 3CCLN 4JNEA 4H0PA 4C1NK 1S3XA 4HTLA 4BR2A 3CJ9A 2FLOA 4IJNA 2YI1A 5FPNA 4FWKA 3P39A 1S72N 2P9LB 3OHRA 1K8AO 3ATVA 4QS9A 1KAXA 1T44A 1GLFO 4WQ4A 3TPQA 4CBUA 4U67L 1KAYA 1DKGD 5BPLA 3I56N 4BRCA 3ULEB 5KQDA 2OTJN 5MLCQ 3R6MA 3CCUN 3DXKB 2WBNA 5GIPA 4R79A 3CQYA 3H3NO 1NGJA 3R9PA 5C15A 4FPBA 5AQTA 4YORA 2P9NB 3A5OC 3CHWA 1MDUB 4FWPA 3WXJA 4MDBA 3LM9A 3H3OB 5ADXH 4BR0A 2WC9A 3CJAA 3MCAB 3KWGA 4QS7A 4PHTX 1IJJA 2GEMA 4EHUA 3J7ZO 3O5BA 3QBWA 1M1KO 4A57A 3LDOA 4DB3A 4IEEA 3QMLA 2IVNA 4AM6A 2RHKA 2YHWA 1W97L 2Q1NA 2E1YA 5AQKA 1X3NA 2ZF5O 3CETA 2HF3A 3TTFA 4JHDB 4M63C 4BGAA 2V7YA 4BRPA 4PKGA 3RSEB 3O1WA 3CCJN 4BG8A 1RFQA 2GUPA 2A41A 3ULEA 5KPTA 3TU5A 3DXKA 4IXCA 3O9SA 1G99A 4JKAA 4BRQA 2BTFA 5C12A 4JD2A 2P9NA 5AQXA 5CHIA 1QQOA 4JK7A 3O08A 1YJWN 3M6GA 2DPNA 2QA4N 1VQ6N 5AQMA 4CBXA 5FPDA 3ID8A 3CQXA 4BRGA 3MMVA 4H03B 3VTHA 3KHYA 4BY9C 5KQ8A 4DHYA 3EN9A 3ENOA 5F1XA 5C2DA 4K42A 3HRGA 1P90A 3JXUA 4FSVA 3TSPA 3ZEUB 2Q0RA 4JKFA 2GELA 4M7YA 5GADP 1XUPO 1T6DA 2V7ZA 3AAPA 3LM2A 3RVCA 2E2OA 3EE8A 4IDHA 1K73O 2VGMA 3UKUB 1W2BM 3TTCA 2CGLA 4H5TA 4L3QA 1GLJO 4C23A 3W3DA 5AQOA 4EAHD 1BDGA 4A2BA 4A5AA 1NGDA 4BRIA 1TYQA 2RE2A 3AAQA 4NO7A 4WFAL 4CZMA 2JWKA 1OVYA 5E84A 4A5BA 3MN9A 1BU6O 5KPZA 3FZHA 1Y64A 3OBYA 2ASPA 2QWMA 4OPHA 3T69A 4YOYA 4JKDA 4K43A 4GY2B 5JICA 4FWQA 1P8ZA 2IVPA 1IG8A 1NGIA 1YI2N 3CJBA 5EX5A 5M1QA 2PFUA 3EL2A 5AQQA 3HBTA 3OA9A 2EWSA 3SMPA 2OANA 2FF3B 1EO1A 2FSNA 5AQRA 5ELZA 4WCEL 4BROA 3VENA 3T7ZA 3L6QA 3SAGA 2HMPA 2YX6A 2I7PA 3MWPA 3UKUA 3ENBA 4MDAA 4BRKA 1Q86O 3CIPA 5ADXA 4JN4A 3N4QA 5AQJA 4BGBA 4H5NA 3SAFA 3ZYYX 3DLLL 1HKBA 2D0OA 2P9PA 4BC3A 2OTLN 1NGGA 2NLXA 5KPRA 3QDKA 3VEXA 3PLAA 2GTDA 3QFPA 3LDLA 4BRDA 5C10A 1YIJN 1J6ZA 4DCHA 1GLBG 3E1YA 2GWKA 1ZXOA 2QXLA 5GAGP 5BRFA 5JLHA 3B8AX 4ISFA 3C7NB 1NMDA 3K9KA 4CD3A 4DKWA 3GBTA 2YHXA 5BN9A 1X3MA 4FWNA 3CC2N 4B1WB 5BR9A 4FWLA 4MO5A 3OBWA 3VF2A 5EXWA 1V4TA 5AZIB 1QHAA 3O8MA 1D4XA 4B1XB 2D0PA 1QQNA 3IUCA 4FWRA 4AM7A 1VQPN 3C6AA 1LOTB 3P4IA 4H0OA 3SMSA 4JKCA 3U4LA 4IOAL 3GE1A 1ZBSA 3FZFA 3EO3A 4FWOA 5AQYA 4G9ZA 2W41A 5AQNA 5BRHA 1VQKN 3H1QA 5BPMA 1MWKA 2A6AA 4PKIA 1E4FT 3D7EO 3SK3A 5M1OA 3QB0A 3HSCA 3FZLA 3HOSA 1YF5L 3FGUA 4NLBA 1DEJA 4JD2B 2YJEA 1HKGA 3MK6A 3O80A 2HBJA 1SAZA 2E2QA 3CCEN 2JWLA 2HBKA 2QTDA 3M3ZA 3L4QA 3C7NA 4BR7A 5H1SQ 1RDWX 4ILGB 4FOEA 3SJHA 1YITN 3ZX3A 2NNWA 1QZ5A 2F9WA 1EQYA 3ENHA 3GL1A 4RTFD 2E20A 3KZBA 1DT9A 1BO5O 2YJFA 3WXIA 3MN7A 4A62A 1YAGA 4BRAA 5AZIA 4WFNL 2QWOA 2VGNA 4RCHA 2QWNA 3EE9A 4A2AA 1KQSM 4CZHA 2VWBA 3AGKA 2ZGYA 1KXPA 3C0BA 4BR9A 4GV3A 3BUZB 4KH4A 3TSUA 5GIOA 2HBLA 3VEZA 3EKUA 1WUAA 1HJOA 4O8UA 5B8HA 3L0QA 5M1PA 3P38A 1TYQB 3VGKA 4EHTA 1TUUA 4H0VB 4B1YB 3SAHA 3OW2M 4FL9A 3ZETA 5F0XA 1U2VA 2P9KA 2PAVA 2H3GX 5AQFA 2V51B 3MN5A 3I8BA 3WEEA 1VQ5N 4UY8O 3E9OA 1NM1A 2NRVA 5GAEP 4Z94A 2FXUA 4B1UB 3CF5L 3SBGA 1GLLO 2NRTA 1NBWA 1ATNA 4IO9L 4YOWA 4GV6A 3M1FA 5AQUA 3G6EN 4U7BA 2F7TA 2VCPA 3KK7A 5DM6L 3CMEN 3WXLA 4NLCA 2Q97A 1KC8O 5LJWA 3BF3A 4XH5A 3WXKA 4H5VA 1ZC6A 4CZKA 3HTVA 1NJIO 3CJCA 2QM1A 4GNIA 5AQPA 4BRLA 4YOVA 4JKHA 4GV9A 1HPMA 4M7XA 3QICA 1Z6RA 4MO4A 3VERA 5M1KA 2NRRA 3WT0A 1QZ6A 1Q7YO 3CD6N 2P9PB 1BOTO 3E9PA 3MN6A 1VQON 3IKMA 1SS6A 2Q31A 3D2FB 1VQ8N 1VQMN 3HM8A 1SQKA 1MA9B 2Q36A 4KH5A 4FVUA 5GAHP 1JCGA 5AQGA 5BPNA 4CZFA 4JKGA 3CCVN 3H45C 3QBXA 2FSJA 1X9JA 2V52B 4AF1A 3S41A 5LJVA 1C0FA 1K8KA 1YJNN 3VETA 1N8RO 1NLVA 1GLEG 3ZX2A 3WUHA 4YDUC 2Q0UA 5AR0A 3JS6A 3LDPA 1VQ7N 3CCMN 4JAXA 3VESA 4BVPA 3CCRN 2AP1A 2VYPA 5FPMA 4H5RA 1H1VA 3D2EA 2A5XA 2FSKA 2NRXA 3QFUA 3O9QA 3U9ZA 3A8YA 5DM7L 2QEXN 2QWRA 3L4IA 3MWTA 1VQNN 3D2FA 1V4SA 4BRNA 3G4SN 2J4RA 2A42A 3EKSA 3Q7BA 3SLCA 5E26A 3UB5A 3FZMA 4PL7A 4JK8A 3CPEA 4A61A 1KD1O 3E66A 4FO0A 4IOXA 4A59A 5AQSA 2NRZA 5BN8A 4CD1A 3CCQN 4BC4A 2QWLA 3R3LA 1XC3A 3A5MC 4CZLA 1NGBA 2E2PA 3HZ6A 4EIAA 2NRHA 2AA4A 3DXMA 3F2KA 4H0TB 3I33A 3BF1A 1R59O 4WQ4C 4YDUA 3TTDA 5EY4A 4IFEA 2IVOA 3AARA 5JVHL 1T3VA 4PL8A 3KVGA 2E1ZA 1BUPA 3ID6A 3Q7CA 1RGIA 3CMAN 2ZJPL 1WOQA 2W40A 3VEYA 1ILYA 4WQ5C 5BREA 1HKCA 4IWVA 3WQUA 3MX2A 2GX9A 2P9SA 3U8XA 3ZETB 1C0GA 3PIOL 1Q18A 2HSTA 1U2VB 2P9KB 1YHQN 4JKBA 4B1VA 1ATRA 3LDQA 3WEEB 2BH1A 2NZTA 3BEXA 2QWPA 4CZIA 4JEPA 5C0YA 3FZKA 5AQIA 3G25A 3NVMA 4PKHA 4BQLA 1K9MO 4IEIA 1LCUA 1NGEA 5AQHA 4GVEA 3UKRB 4IJAA 1TUYA 1NGHA 2P9UA 2ASOA 3IFRA 4MLHA 3MDQA 3GG4A 1BG3A 1VQ4N 1QVFM 4XH4A 4IZ9A 3ATUA 3O1BA 3C65A 4IO8A 3DJCA 4WFBL 4ISEA 2A3ZA 1O13A 1Z05A 4OPAA 4J8FA 4BC5A 5JMVA 4WQ5A 2E8AA 2I7NA 5AFUH 3O4WA 3I55N 1YVNA 1BWFO 2ZGZA 4FWSA 2QWQA 3E9LA 4ILHA 4MLEA 4QS8A 5AQVA 3WQTA 4WYBA 3A5LC 1HX1A 3VMFB 3A5NC 2FF6A 1VQLN 5GINA 5AZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9D A;  4ISG A;  4EFH A;  2CGK A;  1T6C A;  3VF4 A;  2D1K A;  2PBD A;  3H6E A;  4H5W A;  3UKR A;  4CJ7 A;  1K8K B;  3VEW A;  4RWT A;  2P9L A;  4B1Z A;  5EVZ A;  2QW9 A;  4CZE A;  1S22 A;  1OKJ A;  1GLC G;  2P9I B;  5JLF A;  3CER A;  3H46 O;  1DGK N;  2IIR A;  3D2E B;  3DAW A;  1SZ2 A;  2E2N A;  4FOI A;  4K25 A;  3W0L A;  3A0I X;  2CH5 A;  4F9O A;  3VEO A;  4CZJ A;  1NGC A;  1YXQ A;  5EOY A;  3AY9 A;  1BA0 A;  4Y0W A;  3VEV A;  1NWK A;  2WUS A;  3IDH A;  4CBW A;  3J8A A;  5I9E B;  4BVO A;  1YUW A;  1HUX A;  4H0Y B;  4FWM A;  3UE5 A;  4BC2 A;  4BR4 A;  3H1V X;  3DXM B;  1U6Z A;  3LDN A;  3VOV A;  3O6W A;  2GWJ A;  4JHD A;  3GDQ A;  1NGA A;  3RSE A;  4K41 A;  2P9I A;  4B9Q A;  3GOI A;  3CJ1 A;  4O5F A;  5LY3 A;  4HWI A;  4KBO A;  1GLD G;  5AQW A;  5TKY A;  1NGF A;  3HI0 A;  4BRF A;  2P9S B;  3VGL A;  4LC9 B;  5FPE A;  2HOE A;  4BRM A;  2E88 A;  1JCE A;  3CI5 A;  2Q2R A;  3DWL A;  1GLA G;  2KHO A;  3BP8 A;  4I6M B;  5BRD A;  3IMX A;  3VGM A;  3ZEU A;  4BQZ A;  2CGJ A;  2P9U B;  2ITM A;  4BR5 A;  5AFU A;  3MCP A;  2ASM A;  5AQL A;  4H0X B;  3FLC O;  4BRH A;  2D4W A;  2F9T A;  1JCF A;  5AQZ A;  1KAZ A;  4BRE A;  4DQ8 A;  1QQM A;  1BA1 A;  4BG9 A;  3FE1 A;  4XH1 A;  1HLU A;  5CE3 A;  4CZG A;  2ZWH A;  3FFK B;  4XEI A;  4E1J A;  2YHY A;  3R8E A;  3ZX0 A;  3FR0 A;  3LL3 A;  2A40 A;  1XQS C;  1E4G T;  2UYT A;  2YCH A;  3F9M A;  4FPA A;  5F2R A;  1MWM A;  2BUP A;  1CZA N;  4O8K A;  4NB4 A;  2CH6 A;  3EZW A;  1ESV A;  2HF4 A;  1ATS A;  5AZJ B;  3VF6 A;  4I6M A;  4CI6 A;  3VPZ A;  3CJ7 A;  4JNE A;  4H0P A;  1S3X A;  4HTL A;  4BR2 A;  3CJ9 A;  2FLO A;  4IJN A;  2YI1 A;  5FPN A;  4FWK A;  2P9L B;  3OHR A;  3ATV A;  4QS9 A;  1KAX A;  1T44 A;  1GLF O;  4WQ4 A;  3TPQ A;  4CBU A;  1KAY A;  1DKG D;  5BPL A;  4BRC A;  3ULE B;  5KQD A;  3R6M A;  3DXK B;  3CQY A;  3H3N O;  1NGJ A;  3R9P A;  4FPB A;  5AQT A;  2P9N B;  3A5O C;  3CHW A;  1MDU B;  4FWP A;  3WXJ A;  3LM9 A;  3H3O B;  5ADX H;  4BR0 A;  3CJA A;  4QS7 A;  1IJJ A;  2GEM A;  4EHU A;  3O5B A;  3QBW A;  3LDO A;  4DB3 A;  3QML A;  2IVN A;  4AM6 A;  2YHW A;  2Q1N A;  2E1Y A;  5AQK A;  1X3N A;  2ZF5 O;  3CET A;  2HF3 A;  4BGA A;  4JHD B;  4M63 C;  4BRP A;  2V7Y A;  4PKG A;  3RSE B;  3O1W A;  4BG8 A;  1RFQ A;  2GUP A;  2A41 A;  3ULE A;  5KPT A;  3TU5 A;  3DXK A;  4IXC A;  1G99 A;  4BRQ A;  2BTF A;  4JD2 A;  2P9N A;  5AQX A;  1QQO A;  3O08 A;  3M6G A;  2DPN A;  5AQM A;  4CBX A;  5FPD A;  3ID8 A;  3CQX A;  4BRG A;  3MMV A;  4H03 B;  3KHY A;  5KQ8 A;  4DHY A;  3EN9 A;  3ENO A;  5F1X A;  4K42 A;  4FSV A;  3ZEU B;  3JXU A;  2Q0R A;  4M7Y A;  2GEL A;  1XUP O;  1T6D A;  2V7Z A;  3AAP A;  3LM2 A;  2E2O A;  3UKU B;  2CGL A;  4H5T A;  4L3Q A;  1GLJ O;  4C23 A;  3W3D A;  5AQO A;  4EAH D;  1BDG A;  4A2B A;  1NGD A;  4BRI A;  1TYQ A;  3AAQ A;  4NO7 A;  4CZM A;  5E84 A;  3MN9 A;  1BU6 O;  5KPZ A;  3FZH A;  1Y64 A;  2ASP A;  2QWM A;  4K43 A;  4GY2 B;  5JIC A;  4FWQ A;  1P8Z A;  2IVP A;  1IG8 A;  1NGI A;  3CJB A;  5EX5 A;  3EL2 A;  5AQQ A;  3HBT A;  2EWS A;  3SMP A;  2OAN A;  2FF3 B;  2FSN A;  5AQR A;  5ELZ A;  4BRO A;  3VEN A;  3L6Q A;  2HMP A;  2I7P A;  3UKU A;  4BRK A;  3CIP A;  5ADX A;  4JN4 A;  5AQJ A;  4BGB A;  4H5N A;  1HKB A;  2D0O A;  2P9P A;  4BC3 A;  1NGG A;  2NLX A;  5KPR A;  3QDK A;  3VEX A;  2GTD A;  3QFP A;  3LDL A;  4BRD A;  1J6Z A;  4DCH A;  1GLB G;  2GWK A;  1ZXO A;  2QXL A;  5BRF A;  5JLH A;  3B8A X;  4ISF A;  3C7N B;  1NMD A;  4CD3 A;  3GBT A;  2YHX A;  5BN9 A;  1X3M A;  4FWN A;  4B1W B;  5BR9 A;  4FWL A;  4MO5 A;  3VF2 A;  5EXW A;  1V4T A;  5AZI B;  1QHA A;  3O8M A;  1D4X A;  2D0P A;  1QQN A;  3IUC A;  4FWR A;  4AM7 A;  1LOT B;  3P4I A;  4H0O A;  3SMS A;  3U4L A;  3GE1 A;  1ZBS A;  3FZF A;  3EO3 A;  4FWO A;  5AQY A;  2W41 A;  5AQN A;  5BRH A;  3H1Q A;  5BPM A;  1MWK A;  2A6A A;  4PKI A;  1E4F T;  3D7E O;  3SK3 A;  3QB0 A;  3HSC A;  3FZL A;  3FGU A;  1DEJ A;  4JD2 B;  2YJE A;  1HKG A;  3MK6 A;  3O80 A;  1SAZ A;  2E2Q A;  3M3Z A;  4BR7 A;  3C7N A;  1RDW X;  4FOE A;  3SJH A;  3ZX3 A;  1QZ5 A;  2F9W A;  1EQY A;  3ENH A;  3GL1 A;  4RTF D;  2E20 A;  3KZB A;  2YJF A;  1BO5 O;  3WXI A;  3MN7 A;  4A62 A;  1YAG A;  4BRA A;  5AZI A;  2QWO A;  4RCH A;  2QWN A;  4A2A A;  4CZH A;  2VWB A;  3C0B A;  2ZGY A;  1KXP A;  4BR9 A;  3BUZ B;  3VEZ A;  3EKU A;  1WUA A;  1HJO A;  5B8H A;  3L0Q A;  3VGK A;  4EHT A;  1TYQ B;  1TUU A;  4H0V B;  4B1Y B;  4FL9 A;  3ZET A;  5F0X A;  1U2V A;  2P9K A;  2PAV A;  2H3G X;  5AQF A;  2V51 B;  3MN5 A;  3I8B A;  3WEE A;  1NM1 A;  4Z94 A;  2FXU A;  4B1U B;  1GLL O;  1NBW A;  1ATN A;  3M1F A;  5AQU A;  2VCP A;  3WXL A;  2Q97 A;  5LJW A;  3BF3 A;  4XH5 A;  3WXK A;  4H5V A;  1ZC6 A;  4CZK A;  3HTV A;  3CJC A;  2QM1 A;  4GNI A;  5AQP A;  4BRL A;  1HPM A;  4M7X A;  3QIC A;  1Z6R A;  4MO4 A;  3VER A;  3WT0 A;  1QZ6 A;  2P9P B;  1BOT O;  3MN6 A;  2Q31 A;  3D2F B;  3HM8 A;  1SQK A;  1MA9 B;  2Q36 A;  1JCG A;  5AQG A;  5BPN A;  4CZF A;  3H45 C;  3QBX A;  2FSJ A;  1X9J A;  2V52 B;  5LJV A;  3S41 A;  1C0F A;  1K8K A;  3VET A;  1NLV A;  1GLE G;  3ZX2 A;  3WUH A;  4YDU C;  2Q0U A;  5AR0 A;  3JS6 A;  3LDP A;  4JAX A;  3VES A;  4BVP A;  2AP1 A;  2VYP A;  5FPM A;  4H5R A;  1H1V A;  3D2E A;  2A5X A;  2FSK A;  3QFU A;  3U9Z A;  3A8Y A;  2QWR A;  3L4I A;  3D2F A;  1V4S A;  4BRN A;  2J4R A;  2A42 A;  3EKS A;  3SLC A;  3UB5 A;  5E26 A;  4PL7 A;  3FZM A;  4A61 A;  4FO0 A;  5AQS A;  5BN8 A;  4CD1 A;  4BC4 A;  2QWL A;  4CZL A;  1XC3 A;  3A5M C;  4EIA A;  1NGB A;  2E2P A;  3HZ6 A;  2NRH A;  2AA4 A;  3DXM A;  4H0T B;  3I33 A;  3BF1 A;  1R59 O;  4WQ4 C;  4YDU A;  5EY4 A;  2IVO A;  3AAR A;  4PL8 A;  3KVG A;  2E1Z A;  1BUP A;  1RGI A;  1WOQ A;  2W40 A;  3VEY A;  4WQ5 C;  5BRE A;  1HKC A;  4IWV A;  3WQU A;  2P9S A;  3U8X A;  3ZET B;  1C0G A;  1Q18 A;  1U2V B;  2P9K B;  4B1V A;  1ATR A;  3LDQ A;  3WEE B;  2NZT A;  3BEX A;  2QWP A;  4CZI A;  3FZK A;  5AQI A;  3G25 A;  4PKH A;  4BQL A;  1LCU A;  1NGE A;  5AQH A;  3UKR B;  4IJA A;  1TUY A;  1NGH A;  2P9U A;  2ASO A;  3IFR A;  4MLH A;  3MDQ A;  3GG4 A;  1BG3 A;  4XH4 A;  4IZ9 A;  3ATU A;  3O1B A;  4IO8 A;  3DJC A;  4ISE A;  2A3Z A;  1Z05 A;  4BC5 A;  4J8F A;  5JMV A;  4WQ5 A;  2E8A A;  2I7N A;  5AFU H;  3O4W A;  1YVN A;  1BWF O;  2ZGZ A;  4FWS A;  2QWQ A;  4QS8 A;  5AQV A;  4MLE A;  3WQT A;  4B1X B;  4WYB A;  3A5L C;  1HX1 A;  3A5N C;  2FF6 A;  5AZJ A; 
#chains in the Genus database with same CATH topology
 1S5J A;  2HHS A;  3EZ5 A;  3UKR A;  4CER A;  3AO3 A;  1RT5 A;  1S22 A;  4RG8 A;  5JVG L;  4B9S A;  4ILJ A;  3CER A;  3H46 O;  1DGK N;  3I0R A;  4KTQ A;  3AVL A;  3VEO A;  4HTU A;  1NWK A;  3IDH A;  4DV2 K;  3TAE A;  3P5J A;  1A5V A;  2O8F B;  3SQ1 A;  3SPY A;  3LDN A;  1TKT A;  5LMU K;  1C0M A;  4JHD A;  2DY4 A;  3SYZ A;  5LY3 A;  4O5F A;  2ZE2 A;  3AVN A;  4KBO A;  4DV5 K;  4DG1 A;  5AQW A;  4CF2 A;  1Q82 O;  1NGF A;  3HI0 A;  4BRF A;  1IH7 A;  1L3S A;  1S1W A;  2O8B A;  3VQC A;  4ID5 A;  3VGL A;  5FPE A;  3KLI A;  4WF9 L;  3CCS N;  2HBM A;  4I6M B;  3IMX A;  3ZCM A;  4BQZ A;  2WTU A;  2JGU A;  5AFU A;  3OS1 A;  4IG3 A;  4FCY A;  2ASM A;  5AQL A;  1D9F A;  2NRW A;  4N56 A;  2D4W A;  2F9T A;  1KAZ A;  4BRE A;  1XWL A;  3AVG A;  4KH6 A;  1BA1 A;  3PSI A;  4BG9 A;  1HLU A;  1S9G A;  4CZG A;  2KLA A;  2ZWH A;  4CFD A;  4E1J A;  3HOT A;  4W5N A;  4JKE A;  2KKZ A;  1LV5 A;  2Y1I A;  3BY5 A;  3F73 A;  1CZA N;  3CC7 N;  3O9R A;  3MXM A;  4NB4 A;  5AZJ B;  3SUO A;  3T19 A;  3NHG A;  4C1N K;  1S3X A;  4FJX A;  2FLO A;  2RN2 A;  4J2E A;  4DV6 K;  1K8A O;  3ATV A;  3TPQ A;  4WQ4 A;  4B9N A;  2XHB A;  4CJP A;  4CK1 A;  3I56 N;  3O3H A;  2F8S A;  4E7K A;  5MLC Q;  2WBN A;  5GIP A;  3LDS A;  3OYI A;  4G1Q A;  1BQN A;  1JLA A;  4YFU A;  1TK0 A;  3MCA B;  3CJA A;  4OX9 K;  2NUB A;  4NCA A;  2GEM A;  3QIO A;  3VQ5 A;  5KGX A;  4DB3 A;  4DTS A;  4DU3 A;  3K5L A;  3V81 A;  1TKX A;  2D5R A;  2IVN A;  4AM6 A;  2RHK A;  2Z1J A;  4FK4 A;  2GBZ A;  2XRI A;  5CY4 A;  2BGG A;  4NYN A;  3CET A;  4JHD B;  3O1W A;  1NK0 A;  2A41 A;  3ULE A;  4JKA A;  5C12 A;  2BTF A;  3OYD A;  4JD2 A;  1KLM A;  2P9N A;  1NJX A;  2W42 A;  2O8B B;  1B9D A;  3AA3 A;  1ZBH A;  2HW3 A;  4JK7 A;  3O08 A;  1YJW N;  2QA4 N;  1TK8 A;  4FXD A;  1WSI A;  3MAQ A;  4H03 B;  4Z0U A;  1HNX K;  5HRP A;  4DHY A;  5F1X A;  3ENO A;  5KQ8 A;  1X1P A;  3HRG A;  4FSV A;  3JXU A;  2GEL A;  2V7Z A;  3VQ6 A;  3LM2 A;  4KO0 A;  3RVC A;  4IDH A;  1K73 O;  4KRE A;  3TTC A;  3LAL A;  1GLJ O;  5C25 A;  1VK0 A;  4A2B A;  2VG6 A;  3OYC A;  2BAN A;  3L2U A;  3LAN A;  4C8L A;  1HRH A;  3LZI A;  4OPJ A;  3T69 A;  2ASP A;  4K43 A;  1W7A A;  5JIC A;  1P8Z A;  1RBS A;  2IVP A;  1YI2 N;  5M1Q A;  1CXU A;  2EWS A;  3SMP A;  5J2N A;  5ELZ A;  4Q0B A;  4BRO A;  4DTR A;  3VEN A;  4DSF A;  3T7Z A;  3OJU A;  4DR6 K;  3L6Q A;  4K8X A;  5FRN A;  1TVR A;  1VSF A;  2P1J A;  3MWP A;  3HL8 A;  3QO9 A;  3WNH A;  3ZSQ A;  4B3S K;  2B4J A;  1WLJ A;  4H5N A;  4KB0 A;  3ZT3 A;  3DLL L;  2OTL N;  2D0O A;  4CHO A;  3MXJ A;  2W6K A;  5IWA K;  3TAB A;  3THX B;  4DCH A;  3SCX A;  2GWK A;  5GAG P;  2QXL A;  4X65 K;  4ISF A;  1NMD A;  1QHT A;  3K9K A;  4DKW A;  3GBT A;  3QET A;  1CZ9 A;  4JYA K;  1NJW A;  3C94 A;  1WSE A;  2IOC A;  2LSN A;  2D0P A;  1QQN A;  1VQP N;  2AJQ A;  4CJE A;  1WAF A;  4CFA A;  4DTM A;  2OA8 A;  5HRN A;  3U4L A;  2W41 A;  3H1Q A;  3MEG A;  4CJK A;  2A6A A;  3IS9 A;  4LF5 K;  1YF5 L;  3FGU A;  4X66 K;  4DQI A;  4JD2 B;  2YJE A;  3ZT2 A;  3SJJ A;  3O80 A;  4FJL A;  1YJ9 N;  2RKI A;  3C7N A;  5H1S Q;  1U47 A;  1FW6 A;  4AQY K;  4RW8 A;  1EQY A;  3MXI A;  4RTF D;  2E20 A;  1DT9 A;  2F8T A;  3DRS A;  1YAG A;  2QWN A;  3AGK A;  1ITG A;  5GIO A;  3AVA A;  1NK9 A;  2B5J A;  4FYD A;  5M1P A;  1B92 A;  1HPZ A;  3C95 A;  5AQF A;  2V51 B;  3WEE A;  3DYA A;  1VQ5 N;  4BE2 A;  5GAE P;  4Z94 A;  3CF5 L;  4CIG A;  2I5J A;  3KD5 E;  4BAC A;  1XMQ K;  3HM9 A;  4DTO A;  3G6E N;  4O0I A;  3NGZ A;  3CQ8 A;  4NLC A;  5LJW A;  4DQR A;  3BF3 A;  5CYQ A;  4F3O A;  5CYM A;  3L2W A;  4H5V A;  4B9L A;  2F4V K;  4BRL A;  4YOV A;  4JKH A;  4DR3 K;  2O8D B;  1Z6R A;  4MO4 A;  3VER A;  5M1K A;  5FRO A;  3WT0 A;  3J81 O;  1Q7Y O;  2HVH A;  5KRS A;  1BOT O;  3PY8 A;  3MN6 A;  3V9Z A;  2Q31 A;  2UXD K;  3HP9 A;  1K6Y A;  3D2F B;  2HHT A;  4KB1 A;  1BL3 A;  3AVF A;  2KZZ A;  5AQG A;  5BPN A;  3AVM A;  4JKG A;  3ZT0 A;  4IFV A;  3VET A;  1N8R O;  1NLV A;  1QE1 A;  2VQF K;  4YNQ A;  1VQ7 N;  1N5Y A;  1SKR A;  4JAX A;  3CCR N;  3LAK A;  3D2E A;  1J5E K;  2FSK A;  4JS4 A;  1VSM A;  3O9Q A;  4H8K A;  3A8Y A;  3WNE A;  3JAM O;  1XC9 A;  4BRN A;  4FLU A;  4PL7 A;  1KD1 O;  4M42 A;  4A59 A;  3ZSV A;  2QWL A;  3R3L A;  2E2P A;  3DXM A;  3NH2 A;  1BI4 A;  3TTD A;  3AO5 A;  4Z4H A;  2IVO A;  3AV9 A;  4B9U A;  4N5S A;  2E1Z A;  3V9S A;  3Q7C A;  2ZJP L;  1WOQ A;  3ISN C;  4LF7 K;  4WQ5 C;  1DLO A;  2E5L K;  3WQU A;  2GX9 A;  2P9S A;  3OS0 A;  1HMV A;  4NXM K;  2D0A A;  3ASM A;  3WEE B;  2QWP A;  4CZI A;  3H08 A;  5AQI A;  4M3Z A;  3G25 A;  1I94 K;  4KHN A;  2HHV A;  4IEI A;  2WOM A;  4CJT A;  1TUY A;  4MLH A;  1C1A A;  4CJV A;  3V9W A;  2Z1H A;  1VQ4 N;  1QVF M;  1KRP A;  4LF8 K;  4BDP A;  1QSL A;  3O1B A;  4KFB A;  4GMJ B;  3OS2 A;  4C8M A;  5JMV A;  2IAJ A;  3SQ4 A;  3KK3 A;  4B1X B;  2ATQ A;  5AQV A;  3WQT A;  1HNZ K;  4AHU A;  4M3R A;  3A5N C;  4IBN A;  4OPK A;  4CGI A;  1YTU A;  4CVN E;  1M90 O;  3KWI A;  2HB5 A;  4JKG B;  4OO1 J;  2CGK A;  1IKV A;  1X9W A;  2PBD A;  1JLF A;  3O4Q A;  4HHT A;  3VEW A;  2P9L A;  1Z25 A;  2G8F A;  3G71 N;  3L8B A;  1JL2 A;  1TAQ A;  1OKJ A;  4R5P A;  4FM1 A;  2P9I B;  5J1E A;  1N34 K;  2IIR A;  3D2E B;  5C24 A;  1SUQ A;  1SZ2 A;  3NFA A;  1SKS A;  2OZM A;  3HPO A;  1JLB A;  1UWB A;  3A0I X;  3NAE A;  3M8P A;  2CH5 A;  2KTQ A;  4DS5 A;  4F9O A;  4AHV A;  1LW2 A;  1NGC A;  1YXQ A;  4DFM A;  1SL0 A;  2YNF A;  4Y0W A;  2HNY A;  3KTQ A;  1MU2 A;  4CBW A;  3CXC M;  3J8A A;  3M8Q A;  4W5R A;  3J7A P;  1IKW A;  4BVO A;  3VQE A;  4DF4 A;  2IC3 A;  3H1V X;  3DXM B;  3CC4 N;  4DR7 K;  1BI4 B;  3GDQ A;  4MQ3 A;  3KLG A;  1CZB A;  3TAM A;  4Y1C A;  4KHS A;  5KI6 A;  2P9S B;  1BIU A;  4LC9 B;  4BRM A;  2E88 A;  1JCE A;  4C1N I;  3TI0 A;  2DFF A;  2KHO A;  4YOX A;  4IOC L;  3OYE A;  2PZS A;  1JLQ A;  4BDZ A;  4DLE A;  1OH5 A;  1D9D A;  3QIN A;  2YKN A;  3VGM A;  1BCO A;  3QEW A;  4JI8 K;  4BR5 A;  3MCP A;  4YOU A;  4DV0 K;  3FLC O;  3ZSO A;  1JCF A;  4DSE A;  3LP1 A;  1RTD A;  2PYJ A;  3FE1 A;  4XH1 A;  4CJU A;  3FFK B;  1Z26 A;  3THY A;  3R8E A;  1BCM A;  3ZX0 A;  1TV6 A;  3NMU A;  2UYT A;  3F9M A;  3L3V A;  5F2R A;  2BUP A;  2KQ2 A;  5CR4 A;  4O8K A;  3EZW A;  1ESV A;  3VF6 A;  1ATS A;  4I6M A;  3OTO K;  3R1X A;  1JLE A;  2O8C B;  3CCL N;  4JNE A;  4H0P A;  1NOY A;  3CJ9 A;  1TAU A;  4FWK A;  2P9L B;  3OHR A;  4LD0 A;  4FLW A;  3DOK A;  4CBU A;  4U67 L;  1W0H A;  5BPL A;  4AH9 A;  4CGG A;  3CCU N;  3K2P A;  4CES A;  3H3N O;  3AVH A;  5AQT A;  1MDU B;  4DR5 K;  4FWP A;  4MDB A;  1Y97 A;  4OLB A;  3LM9 A;  3NF8 A;  2VQE K;  2GV9 A;  3KLE A;  4QS7 A;  1CXQ A;  1IJJ A;  4EHU A;  4IG0 A;  3QBW A;  4IEE A;  4DU4 A;  3QML A;  4ELV A;  2YHW A;  2Q1N A;  3HST B;  2E1Y A;  5AQK A;  1X3N A;  4DTJ A;  4PY5 A;  1KVC A;  4DSJ A;  2HF3 A;  4BGA A;  4BRP A;  4CE9 A;  1TL1 A;  4E19 A;  2KW4 A;  2F96 A;  4CJW A;  1RFQ A;  2HHH K;  2DFH A;  1REV A;  1XNQ K;  4KAZ A;  5KPT A;  4IXC A;  2UU9 K;  1JXB A;  5CHI A;  3G10 A;  1LWE A;  4FJ7 A;  1VQ6 N;  3M6G A;  4CGF A;  5AQM A;  4JI7 K;  2Z1I A;  3MMV A;  3K57 A;  3OVN A;  3KHY A;  3EN9 A;  4K42 A;  4JLH A;  2O4G A;  4M7Y A;  3AAP A;  1VRU A;  4CK3 A;  3UKU B;  2CGL A;  4H5T A;  5AQO A;  2XO7 A;  4KI4 A;  4BRI A;  4CW7 B;  5HRR A;  4WFA L;  4CZM A;  3LWM A;  4LF9 K;  2G8I A;  4A5B A;  3MN9 A;  3THY B;  5KPZ A;  1JLG A;  2FC0 A;  2P51 A;  4E7L A;  1T05 A;  1C0T A;  1NGI A;  3OYL A;  1LWC A;  2OAN A;  2FSN A;  5AQR A;  4AIL C;  4ZTJ A;  1VSE A;  1NJY A;  3QLH A;  4BWJ A;  4FLT A;  3LP3 A;  4JN4 A;  2QKK A;  2XY7 A;  5AQJ A;  4BGB A;  1NGG A;  3T3F A;  3CG7 A;  4BRD A;  3LDL A;  5C10 A;  1YIJ N;  3IG1 A;  3K5N A;  5BRF A;  4ELT A;  4KI6 A;  1VSD A;  4CD3 A;  3QES A;  5BN9 A;  3CC2 N;  5BR9 A;  4FWL A;  3OBW A;  5EXW A;  1I39 A;  2OPR A;  5AZI B;  1QHA A;  3O8M A;  4L8R B;  1QSS A;  3IUC A;  2UUA K;  3C6A A;  4FJI A;  3P4I A;  1EXQ A;  4H0O A;  4Z4C A;  1VSL A;  4JKC A;  4IOA L;  1ZBS A;  3CYM A;  4FWO A;  4DFP A;  5BRH A;  1LW0 A;  4FK0 A;  1MWK A;  1WSF A;  3SK3 A;  1U4B A;  5M1O A;  1LAV A;  2BE2 A;  1F21 A;  3HOS A;  4CHY A;  3THX A;  2HBJ A;  4CK2 A;  4LF4 K;  4CGD A;  3L4Q A;  4B3O A;  3KJV A;  4LSL A;  2X6S A;  3ZX3 A;  1OH8 A;  1QZ5 A;  3VQB A;  2YJF A;  1BO5 O;  3V6D A;  3WXI A;  3MN7 A;  4A62 A;  2DTU A;  3SQ2 A;  4DMN A;  4RCH A;  1KQS M;  1HYV A;  2ZGY A;  4GV3 A;  2OCE A;  4KHY A;  3TSU A;  1T03 A;  3QEX A;  1WUA A;  2E4L A;  5B8H A;  1HR0 K;  1TUU A;  4FW2 A;  2Z1G A;  4B1Y B;  3ZET A;  5A2Q O;  1U2V A;  1RCH A;  4B1U B;  1BGX T;  3V4I A;  3TAR A;  2NRT A;  1ATN A;  4YOW A;  1HNV A;  1A5X A;  3KK7 A;  4JI1 K;  1KC8 O;  2Q97 A;  1ZC6 A;  3HTV A;  1NJI O;  3CJC A;  3T1Y K;  5AQP A;  4Z4I A;  1HPM A;  3QIC A;  4LFC K;  3TAP A;  1KCF A;  3BGR A;  4CJL A;  3VA3 A;  1QZ6 A;  4CHZ A;  4FJM A;  1SS6 A;  1VQ8 N;  3HM8 A;  4CHQ A;  4FVU A;  3C6T A;  2KFZ A;  5FDL A;  3CCV N;  1C0U A;  3H45 C;  4CJ5 A;  2GUI A;  2FSJ A;  1RT3 A;  1X9J A;  2V52 B;  1VSI A;  4AF1 A;  1K8K A;  1YJN N;  2QXF A;  3WUH A;  4YDU C;  5AR0 A;  3LDP A;  4BVP A;  2AP1 A;  5FPM A;  1H1V A;  4X62 K;  4KHQ A;  1NG9 A;  3LPT A;  2O8D A;  3G0Z A;  4DV1 K;  3U9Z A;  1BIS A;  1W9H A;  2QEX N;  4Z4F A;  2QWR A;  1NK5 A;  1KFD A;  3MWT A;  4DQS A;  4CEC A;  4DR1 K;  1C6V A;  3D2F A;  1V4S A;  4CEB A;  4O4G A;  2A42 A;  3Q7B A;  3SLC A;  3EYZ A;  5E26 A;  4Z4G A;  3FZM A;  4A61 A;  3CPE A;  4FM2 A;  4CED A;  5BN8 A;  4CEZ A;  3HT3 A;  1XC3 A;  3A5M C;  4EP5 A;  1NGB A;  1NNE A;  3NBP A;  2NRH A;  3KKR A;  4LY7 A;  4H0T B;  4WQ4 C;  4KHP K;  1N36 K;  3PV8 A;  5JVH L;  3UIQ A;  3NH1 A;  3CMA N;  1RGI A;  1NMN A;  1SKW A;  3AVB A;  3VEY A;  1OVQ A;  1ILY A;  2W6L A;  1HKC A;  3U8X A;  3ZET B;  1U2V B;  3I0S A;  3KKS A;  1YVU A;  3P83 D;  4B1V A;  1ATR A;  3LDQ A;  4FLY A;  1RTI A;  4I2Q A;  4TSX A;  3HJF A;  3VA0 A;  2IGI A;  1FXX A;  1TGO A;  2OPQ A;  4BQL A;  1O1W A;  3RRG A;  1NGH A;  2P9U A;  3IFR A;  4XIU A;  3ULD A;  4DQQ A;  1L3T A;  3GG4 A;  1WNS A;  1XI1 A;  4HCB A;  3SI6 A;  5J2M A;  5CZ2 A;  1O13 A;  4OPA A;  4WQ5 A;  3I55 N;  1YVN A;  1BWF O;  2QWQ A;  3A5L C;  5HBM A;  3M8R A;  4HUF A;  1VQL N;  4JI6 K;  4MFB A;  1S9E A;  4E3S A;  3TAF A;  3T1H K;  4CF0 A;  5HP1 A;  3J7Y P;  3U9D A;  4ISG A;  3VTI A;  3D0P A;  2EX3 A;  3VF4 A;  3H6E A;  3M5R A;  4B08 A;  4CJ7 A;  1K8K B;  1EWQ A;  4RWT A;  1QVG M;  4B1Z A;  1N6Q A;  1IBL K;  3TWH A;  2UUC K;  4CJR A;  3OYK A;  1GLC G;  1RTJ A;  2VG7 A;  4DFJ A;  3PX4 A;  3ALY A;  2YNH A;  1RT7 A;  5TKW A;  3AVK A;  2E2N A;  4DV7 K;  4B9V A;  4FOI A;  1RDU A;  1Q81 O;  4K25 A;  1JKH A;  3B6P A;  1U45 A;  1IG9 A;  3ZT4 A;  4CF1 A;  4RW7 A;  3AY9 A;  1BA0 A;  3BDP A;  4GVM A;  3VEV A;  2YV0 X;  4LH5 A;  5I9E B;  1YUW A;  2FBV A;  3UE5 A;  3WXM B;  4LH4 A;  1U6Z A;  1JL1 A;  4CEO A;  1NU0 A;  3O6W A;  3AA2 A;  2GWJ A;  3N4P A;  2P9I A;  4GKK K;  4I2P A;  4B9Q A;  4FZX C;  3K5M A;  1GLD G;  4UQG A;  1NK4 A;  1XMO K;  4B3R K;  4OKK A;  3KK2 A;  4I9Q A;  4JK9 A;  2G8W A;  3CPW M;  3VQ9 A;  3DI6 A;  3CI5 A;  1IKX A;  1GLA G;  3BP8 A;  1TKZ A;  4FZY A;  5HL7 L;  1QS4 A;  5HRS A;  4YOT A;  4JS5 A;  5M1N A;  1ZYQ A;  3PIP L;  1J53 A;  1GOA A;  3KLH A;  2P9U B;  3M8S A;  4BDY A;  3MEC A;  3V1O A;  3AGR A;  4H0X B;  4OLA A;  1QTM A;  4BRH A;  4JI3 K;  1EX4 A;  2QI2 A;  4PUO A;  4DQ8 A;  1QQM A;  3VQ7 A;  3F5T A;  3V1R A;  3B6O A;  5C2F A;  2YHY A;  3FFI A;  4DUZ K;  1XQS C;  3IAY A;  2YCH A;  3PX0 A;  1MWM A;  4ZTF A;  2HF4 A;  3QER A;  3LWL A;  3J80 O;  4HTL A;  3L2V A;  4BR2 A;  3HPG A;  5FPN A;  3P39 A;  4QOZ B;  1GLF O;  2B6A A;  5KRT A;  4OGE A;  2OTJ N;  2PYL A;  3R6M A;  3DXK B;  4R79 A;  1NGJ A;  2A1S A;  1RTH A;  4H4O A;  3CHW A;  3H3O B;  5ADX H;  1WN7 A;  3QEV A;  1EET A;  1JXE A;  3KWG A;  4PHT X;  3J7Z O;  3O5B A;  4BWM A;  4A57 A;  3LDO A;  4CEE A;  2O8C A;  1U49 A;  2UUB K;  4B8C A;  1W97 L;  3DLH A;  1UAX A;  1ASU A;  1RT6 A;  2ITG A;  1G15 A;  1LAW A;  1UA1 A;  4M63 C;  4I7F A;  4FJG A;  4PKG A;  4CJ3 A;  4BG8 A;  4FJH A;  2GUP A;  1QSY A;  1U48 A;  2DFE A;  3HVT A;  3KIO A;  4O44 A;  4RW4 A;  4BRQ A;  4KKO A;  3NGY A;  1ZBU A;  2DPN A;  5JS1 A;  4CBX A;  3ID8 A;  4K8Z A;  5LMN K;  2UXB K;  3LZJ A;  3THW B;  4KPY A;  3TSP A;  3BZK A;  4JKF A;  1WSH A;  1XUP O;  1T6D A;  2E2O A;  3EE8 A;  2VGM A;  2G8U A;  2XY6 A;  1CLQ A;  3W3D A;  3RR7 A;  3RRH A;  1BDG A;  1A5W A;  4A5A A;  1NGD A;  1VSK A;  3CM5 A;  2JWK A;  5E84 A;  3HXM A;  1BU6 O;  1Y64 A;  3OBY A;  2QWM A;  2IS3 A;  3CM6 A;  1C1C A;  4JKD A;  4GY2 B;  1BIZ A;  3NE6 A;  1IG8 A;  4QAG A;  3CJB A;  3EL2 A;  2FF3 B;  2E6M A;  4EP4 A;  1EO1 A;  4WCE L;  4FLZ A;  3LAM A;  1DTT A;  1WAJ A;  3SV4 A;  1KLN A;  2HMP A;  3WNF A;  2YX6 A;  2I7P A;  1HQE A;  3DMJ A;  3UKU A;  3CIP A;  5ADX A;  2BDP A;  3N4Q A;  3OYA A;  3ZYY X;  1HKB A;  4BC3 A;  2NLX A;  3VEX A;  1J6Z A;  3E1Y A;  3B8A X;  2YHX A;  1RDA A;  3OYG A;  2WON A;  1V4T A;  1NJZ A;  1Q9X A;  1D4X A;  3LP2 A;  3VQA A;  4F3T A;  4W5O A;  4FWR A;  4AM7 A;  3MED A;  1LOT B;  4CJF A;  3SMS A;  3GE1 A;  3FZF A;  3V9X A;  4G9Z A;  5AQN A;  1E4F T;  3HSC A;  1WB9 A;  3HYF A;  4DSI A;  4NLB A;  5EU7 A;  1HKG A;  3AO2 A;  4X64 K;  4DLG A;  2E2Q A;  4LF6 K;  2QTD A;  1YIT N;  4ILG B;  4B3M K;  3SUQ A;  3GL1 A;  3ENH A;  3KZB A;  3RTV A;  4NYF A;  4BRA A;  5AZI A;  4OVL A;  3OYJ A;  4CHP A;  1VRT A;  1XNR K;  2VWB A;  3C0B A;  1KXP A;  4JI2 K;  4BR9 A;  1EKE A;  4KH4 A;  1RT2 A;  4YHH K;  1RT4 A;  3DLG A;  3EEQ A;  3EKU A;  1KFS A;  1HJO A;  3L0Q A;  4EHT A;  4H0V B;  3OW2 M;  5F0X A;  2PAV A;  2P9K A;  3E9O A;  1NM1 A;  2O8E A;  3HK2 A;  3SBG A;  2YHB A;  4B9M A;  3I8D A;  3NH0 A;  4GV6 A;  4PA1 A;  3NCI A;  3M1F A;  2XY5 A;  4PQU A;  4U7B A;  2F7T A;  2D0B A;  5DM6 L;  1RDD A;  4XH5 A;  1S6P A;  1HYS A;  4CFB A;  2QM1 A;  3EY1 A;  4GNI A;  4GV9 A;  4M7X A;  3F9K A;  3JYT A;  4E1M A;  4CEF A;  1FJG K;  1YTA A;  4B8A B;  4FW1 A;  3K59 A;  4AHC A;  2RPI A;  4FJ8 A;  3OY9 A;  1VQM N;  4W5Q A;  3SV3 A;  1SQK A;  2Q36 A;  4DV4 K;  5GAH P;  1JCG A;  4CCH A;  4LFA K;  3QBX A;  3DLK A;  1C0F A;  1QQC A;  4NCB A;  1GLE G;  1Q9Y A;  1S6Q A;  3AA4 A;  2Q0U A;  4AHT A;  3JS6 A;  3L2Q A;  4BE0 A;  3CCM N;  4DS4 A;  2OYQ A;  3NF9 A;  4M41 A;  4H5R A;  4CEA A;  4Y1D A;  2A5X A;  4DV3 K;  2RF2 A;  5D3G A;  3VQD A;  4JI0 K;  3L4I A;  4E89 A;  5CZ1 A;  1VQN N;  4I9L A;  3S3O A;  1R0A A;  1FK9 A;  4JI4 K;  3G4S N;  1LWF A;  3UB5 A;  4JK8 A;  3E66 A;  4DUY K;  5AQS A;  3U6F A;  5HLF A;  5DK5 A;  1UA0 A;  4C8K A;  4EIA A;  3HZ6 A;  1BHL A;  1GOB A;  3F2K A;  2AA4 A;  4E1N A;  4YDU A;  3KK1 A;  5K14 A;  3HO1 A;  3L3U A;  1T8E A;  3PO4 A;  3AAR A;  2ETJ A;  4JI5 K;  1T3V A;  4PL8 A;  3KVG A;  4HUE A;  1BUP A;  3DRP A;  4LSN A;  4F4K A;  1WBD A;  2E6L A;  1VSJ A;  1C0G A;  1VSH A;  2HST A;  3PIO L;  1YHQ N;  2P9K B;  4JKB A;  2VWK A;  1D8Y A;  1D5A A;  2BH1 A;  4FM0 A;  3BEX A;  4JEP A;  5C0Y A;  2O8E B;  3T1A A;  4PKH A;  1HNI A;  1IO2 A;  1K9M O;  2D0C A;  3LP0 A;  4F2S A;  1NGE A;  5AQH A;  4GVE A;  4C8O A;  2OZS A;  3UKR B;  2ASO A;  1SV5 A;  3MDQ A;  1E3M A;  4FJJ A;  1BG3 A;  1TKD A;  4XH4 A;  3ATU A;  3RMC A;  4OJR A;  3PX6 A;  5C42 A;  3DJC A;  2A3Z A;  3QIP A;  3KLF A;  2UXC K;  2I7N A;  4ICL A;  3RMD A;  3V9U A;  1TK5 A;  3ZSZ A;  4FJK A;  4E7I A;  2ZGZ A;  4LFB K;  3E9L A;  4ILH A;  4MLE A;  4AHS A;  4WYB A;  1NKC A;  3VMF B;  2FF6 A;  5GIN A;  3VN5 A;  4CGH A;  4EFH A;  1T6C A;  1I3A A;  2D1K A;  4H5W A;  2WFB A;  5EVZ A;  2QW9 A;  4CZE A;  5M1F A;  1OH7 A;  4ELU A;  5JLF A;  1J9A A;  3RWU A;  3D6R A;  3PUF A;  3DAW A;  1XHX A;  1RBR A;  1C1B A;  2ZJR L;  3W0L A;  4E7J A;  3AO4 A;  2QK9 A;  3NVK A;  4CZJ A;  5EOY A;  4DQP A;  4F8R A;  3MX5 A;  4GKJ K;  1NK6 A;  4Z4E A;  5FLX O;  2WUS A;  4Q5V A;  3WNG A;  3P31 A;  5KTQ A;  3SPZ A;  1B9F A;  1HUX A;  4H0Y B;  4FWM A;  3O9T A;  4BC2 A;  4PWD A;  4BR4 A;  3VOV A;  4DTP A;  1RIL A;  3HP6 A;  3DRR A;  3RMB A;  4JV5 K;  1NGA A;  3RSE A;  4K41 A;  4CF8 A;  2X78 A;  1JJ2 M;  3GOI A;  3CJ1 A;  3K9J A;  4HWI A;  4NCG A;  1WSG A;  4DWI A;  1L5U A;  5TKY A;  4B9T A;  3ZLJ A;  4CFC A;  3SBT A;  5J2Q A;  2HOE A;  5HOO A;  2Q2R A;  2FBY A;  4EZ9 A;  3DWL A;  2HNZ A;  5BRD A;  4V19 S;  4CF9 A;  1Q8I A;  3A2F A;  2OPP A;  3S9H A;  3ZEU A;  3L2R A;  3SNN A;  3C6H A;  4CHN A;  1X9S A;  2CGJ A;  2ITM A;  1N32 K;  3OYH A;  4OGC A;  5AQZ A;  1J54 A;  5IT9 O;  1ASW A;  2ZD1 A;  4IKF A;  5CE3 A;  4XEI A;  3TSQ A;  3FR0 A;  2VWJ A;  3O9U A;  3D45 A;  2A40 A;  3LL3 A;  4YY3 K;  1E4G T;  1WSJ A;  2ZJQ L;  4FPA A;  5I3U A;  3SUP A;  1VHX A;  2CH6 A;  5HRO A;  4CI6 A;  3PO5 A;  1VAZ A;  4J2A A;  3VPZ A;  3CJ7 A;  5E41 A;  1VQ9 N;  4KTZ A;  2YKM A;  3NF7 A;  3OYB A;  1RNH A;  3ZT1 A;  4IJN A;  2YI1 A;  1S72 N;  1SL1 A;  3CFP A;  4QS9 A;  1KAX A;  1T44 A;  2X74 A;  3AVJ A;  1KAY A;  1DKG D;  1WBB A;  3S3M A;  4BRC A;  3ULE B;  5KQD A;  4C8N A;  3MEE A;  3CQY A;  3R9P A;  5C15 A;  4M3Y A;  4FPB A;  4YOR A;  2P9N B;  4K0K K;  3A5O C;  3THV A;  3WXJ A;  3K0S A;  1L3U A;  2YNI A;  4BR0 A;  3TAQ A;  2WC9 A;  4ZHR A;  1ZBI A;  1EP4 A;  1M1K O;  2XY8 A;  3VQQ A;  3LPU A;  3U3G A;  2ZF5 O;  3AVI A;  3TTF A;  2V7Y A;  3RSE B;  3CCJ N;  4DU1 A;  5JS2 A;  3TU5 A;  3V1Q A;  3DXK A;  3OYN A;  3O9S A;  1G99 A;  1FKP A;  5AQX A;  1IBM K;  1QQO A;  5FPD A;  3CQX A;  4BRG A;  2P5G A;  5FRM A;  3AO1 A;  1RDC A;  3VTH A;  4BY9 C;  3DLB A;  5C2D A;  3ZEU B;  1P90 A;  2Q0R A;  5GAD P;  1IBK K;  2EHG A;  3NDK A;  3RMA A;  1DTQ A;  4O55 A;  5BR8 K;  4EZ6 A;  1W2B M;  4L3Q A;  2VG5 A;  4GW6 A;  4W5T A;  4C23 A;  4FJ5 A;  2X6N A;  3CFO A;  4EAH D;  1KSP A;  1TYQ A;  1RBV A;  2RE2 A;  3AAQ A;  4NO7 A;  3KD1 E;  4N76 A;  1OVY A;  3DOL A;  3FZH A;  4OPH A;  4YOY A;  2QKB A;  4KRF A;  1S1U A;  4FWQ A;  4RW6 A;  5AJ3 K;  5EX5 A;  2PFU A;  5AQQ A;  3HBT A;  3OA9 A;  1NK8 A;  3NGI A;  3THW A;  2ZM6 K;  4FJ9 A;  2R7Y A;  1ZBF A;  1S1V A;  3SAG A;  5SWM A;  3S3N A;  1NKB A;  4FJN A;  3C6U A;  4DTX A;  1U04 A;  2HHW A;  3ENB A;  4QCL A;  4MDA A;  4BRK A;  1Q86 O;  4DTU A;  4O0J A;  4ID1 A;  4M3X A;  3SAF A;  4KV8 A;  2P9P A;  3HVR A;  2FBT A;  5KPR A;  3QDK A;  2P5O A;  3PLA A;  2KFN A;  2GTD A;  3QFP A;  2Y1J A;  4E0D A;  1OH6 A;  1GLB G;  1ZXO A;  5JLH A;  3C7N B;  1HJR A;  4OKJ A;  4M3W A;  4N41 A;  1X3M A;  4B3T K;  4FWN A;  4FK2 A;  1ASV A;  4B1W B;  3BZC A;  4MO5 A;  3VF2 A;  1UOC A;  1L3V A;  4F2R A;  4M3U A;  4DR2 K;  3AA5 X;  4IDK A;  3AVC A;  3OJS A;  3EO3 A;  5AQY A;  1RDB A;  1VQK N;  2HND A;  5BPM A;  4PKI A;  3K58 A;  3D7E O;  3HPH A;  3QB0 A;  4BE1 A;  3FZL A;  1T7P A;  3PSF A;  3CFR A;  1N33 K;  1S1T A;  1DEJ A;  2KZM A;  1TL3 A;  4DR4 K;  3MK6 A;  1SAZ A;  3CCE N;  2JWL A;  2HBK A;  3M3Z A;  4BR7 A;  1EWR A;  4FVM A;  1RDW X;  4NXN K;  4FOE A;  3SJH A;  4CIE A;  3QNN A;  2NNW A;  2F9W A;  4RW9 A;  4CGJ A;  5I42 A;  4FLV A;  4WFN L;  2QWO A;  4CJ4 A;  3QEI A;  3SUN A;  2VGN A;  4OKE A;  3EE9 A;  1YT3 A;  1BQM A;  4N47 A;  4A2A A;  4CZH A;  1X9M A;  4FZZ A;  3BUZ B;  3ZSY A;  2HBL A;  3VEZ A;  4O8U A;  3VGK A;  2ZQB A;  3P38 A;  1TYQ B;  4KHU A;  3SAH A;  1IV0 A;  4FL9 A;  3ZSX A;  4DF8 A;  3O3F A;  2H3G X;  3ZSW A;  3MN5 A;  3I8B A;  3SQ0 A;  4UY8 O;  3ITH A;  3NF6 A;  2NRV A;  1HQU A;  2FXU A;  1ZBL A;  1GLL O;  4DSK A;  1NBW A;  4IO9 L;  4HCC A;  5AQU A;  1NKE A;  2VCP A;  3CME N;  3WXL A;  5J2P A;  1J5O A;  4M45 A;  3TAG A;  3WXK A;  3VQ4 A;  4CZK A;  4CJS A;  3RR8 A;  4J2B A;  2PY5 A;  3SZ2 A;  2OPS A;  1NK7 A;  2NRR A;  3CD6 N;  2G8V A;  2P9P B;  1JLC A;  4CEQ A;  3E9P A;  1VQO N;  3TAN A;  3IKM A;  1GOC A;  4JRQ A;  4KH5 A;  1MA9 B;  5LL6 Z;  1NOZ A;  4CZF A;  1RBT A;  4E7H A;  5LJV A;  3S41 A;  1FKO A;  3DM2 A;  2JLE A;  3DLE A;  3ZX2 A;  3K5O A;  4FLX A;  3VES A;  4WE1 A;  4M3T A;  1IKY A;  2VYP A;  2NRX A;  3QFU A;  2O4I A;  4KHW A;  2YNG A;  5DM7 L;  2HHU A;  2HHX A;  1RT1 A;  2J4R A;  1XHZ A;  3EKS A;  4KTW A;  4FO0 A;  4IOX A;  4DFK A;  2NRZ A;  3E01 A;  1SL2 A;  4CD1 A;  3CCQ N;  4BC4 A;  1HNW K;  1RBU A;  4CZL A;  2O8F A;  3ZSR A;  3I33 A;  3BF1 A;  1R59 O;  5EY4 A;  4IFE A;  2IDO A;  3ID6 A;  5DMR A;  2W40 A;  3O4N A;  4CIF A;  3OYM A;  4J2D A;  5BRE A;  3QNO A;  4IWV A;  2G8H A;  3MX2 A;  3TR8 A;  4CJQ A;  3O3G A;  1Q18 A;  5T7B A;  5KGW A;  1KVA A;  5SZT A;  2NZT A;  2Q3S A;  3FZK A;  4DSL A;  3NVM A;  4O5B A;  3DLR A;  1LCU A;  2FBX A;  4IFY A;  4IJA A;  4HVJ A;  4AHR A;  3OYF A;  4JRP A;  3P1G A;  3U3Y A;  2G8K A;  4IZ9 A;  2YHA A;  3C65 A;  4IO8 A;  2A1R A;  1S1X A;  1KVB A;  4WFB L;  4DTN A;  4ISE A;  2HMI A;  3QEP A;  1Z05 A;  4BC5 A;  4J8F A;  1HYZ A;  2HVI A;  2HHQ A;  2E8A A;  4HUG A;  3IRX A;  3VQP A;  5AFU H;  3O4W A;  4FWS A;  4QS8 A;  4H4M A;  1HX1 A;  3JSM A;  1KTQ A;  3VQ8 A;  5AZJ A; 
#chains in the Genus database with same CATH homology
 1M90 O;  3KWI A;  4JKG B;  3U9D A;  4ISG A;  3VTI A;  2CGK A;  4EFH A;  4OO1 J;  1T6C A;  3VF4 A;  2D1K A;  2PBD A;  3H6E A;  3M5R A;  4H5W A;  3UKR A;  4CJ7 A;  1K8K B;  2WFB A;  3VEW A;  4RWT A;  2P9L A;  1QVG M;  4B1Z A;  3G71 N;  5EVZ A;  2QW9 A;  4CZE A;  1S22 A;  1OKJ A;  1GLC G;  2P9I B;  5M1F A;  5JVG L;  5JLF A;  4ILJ A;  3D6R A;  3CER A;  3H46 O;  1DGK N;  2IIR A;  3D2E B;  5TKW A;  3DAW A;  1SZ2 A;  2E2N A;  4FOI A;  1RDU A;  1Q81 O;  4K25 A;  2ZJR L;  3W0L A;  3A0I X;  2CH5 A;  3NVK A;  4F9O A;  3VEO A;  4CZJ A;  1NGC A;  1YXQ A;  5EOY A;  3AY9 A;  3MX5 A;  1BA0 A;  4Y0W A;  3VEV A;  1NWK A;  2WUS A;  3IDH A;  4CBW A;  3CXC M;  3J8A A;  3P31 A;  5I9E B;  4BVO A;  1YUW A;  1YJ9 N;  1HUX A;  4H0Y B;  4FWM A;  3UE5 A;  3WXM B;  3O9T A;  4BC2 A;  4BR4 A;  3H1V X;  3DXM B;  1U6Z A;  3LDN A;  3CC4 N;  3VOV A;  3O6W A;  2GWJ A;  4JHD A;  3GDQ A;  1NGA A;  3N4P A;  3RSE A;  4K41 A;  2P9I A;  1JJ2 M;  4B9Q A;  3GOI A;  3CJ1 A;  4O5F A;  5LY3 A;  3K9J A;  4HWI A;  4KBO A;  1GLD G;  5AQW A;  1Q82 O;  5TKY A;  1NGF A;  3HI0 A;  4BRF A;  3SBT A;  2P9S B;  4JK9 A;  3CPW M;  3VGL A;  4LC9 B;  5FPE A;  2HOE A;  5HOO A;  4BRM A;  2E88 A;  1JCE A;  3CI5 A;  4C1N I;  2Q2R A;  4WF9 L;  3DWL A;  1GLA G;  2HBM A;  2KHO A;  3CCS N;  3BP8 A;  4YOX A;  4I6M B;  5BRD A;  4IOC L;  5HL7 L;  3IMX A;  4YOT A;  5M1N A;  3VGM A;  3PIP L;  3ZEU A;  4BQZ A;  3C6H A;  2CGJ A;  2P9U B;  2ITM A;  4BR5 A;  5AFU A;  3MCP A;  4YOU A;  2ASM A;  3AGR A;  4H0X B;  5AQL A;  3FLC O;  2NRW A;  4BRH A;  2D4W A;  2F9T A;  1JCF A;  5AQZ A;  2QI2 A;  1KAZ A;  4BRE A;  4DQ8 A;  4KH6 A;  1QQM A;  1BA1 A;  4BG9 A;  3FE1 A;  4XH1 A;  1HLU A;  5CE3 A;  4CZG A;  2KLA A;  2ZWH A;  3F5T A;  3FFK B;  4XEI A;  5C2F A;  4E1J A;  3HOT A;  4JKE A;  2YHY A;  3R8E A;  3ZX0 A;  3TSQ A;  3FR0 A;  2KKZ A;  3O9U A;  3LL3 A;  2A40 A;  1XQS C;  3NMU A;  1E4G T;  2UYT A;  2YCH A;  3F9M A;  2ZJQ L;  4FPA A;  5F2R A;  1MWM A;  2BUP A;  1CZA N;  3CC7 N;  3O9R A;  5CR4 A;  4O8K A;  4NB4 A;  2CH6 A;  3EZW A;  1ESV A;  2HF4 A;  1ATS A;  5AZJ B;  3VF6 A;  4I6M A;  4CI6 A;  3R1X A;  1VAZ A;  3VPZ A;  3CJ7 A;  1VQ9 N;  3CCL N;  4JNE A;  4H0P A;  4C1N K;  1S3X A;  4HTL A;  4BR2 A;  3CJ9 A;  2FLO A;  4IJN A;  2YI1 A;  5FPN A;  4FWK A;  3P39 A;  1S72 N;  2P9L B;  3OHR A;  1K8A O;  3ATV A;  4QS9 A;  1KAX A;  1T44 A;  1GLF O;  4WQ4 A;  3TPQ A;  4CBU A;  4U67 L;  1KAY A;  1DKG D;  5BPL A;  3I56 N;  4BRC A;  3ULE B;  5KQD A;  2OTJ N;  5MLC Q;  3R6M A;  3CCU N;  3DXK B;  2WBN A;  5GIP A;  4R79 A;  3CQY A;  3H3N O;  1NGJ A;  3R9P A;  5C15 A;  4FPB A;  5AQT A;  4YOR A;  2P9N B;  3A5O C;  3CHW A;  1MDU B;  4FWP A;  3WXJ A;  4MDB A;  3LM9 A;  3H3O B;  5ADX H;  4BR0 A;  2WC9 A;  3CJA A;  3MCA B;  3KWG A;  4QS7 A;  4PHT X;  1IJJ A;  2GEM A;  4EHU A;  3J7Z O;  3O5B A;  3QBW A;  1M1K O;  4A57 A;  3LDO A;  4DB3 A;  4IEE A;  3QML A;  2IVN A;  4AM6 A;  2RHK A;  2YHW A;  1W97 L;  2Q1N A;  2E1Y A;  5AQK A;  1X3N A;  2ZF5 O;  3CET A;  2HF3 A;  3TTF A;  4JHD B;  4M63 C;  4BGA A;  2V7Y A;  4BRP A;  4PKG A;  3RSE B;  3O1W A;  3CCJ N;  4BG8 A;  1RFQ A;  2GUP A;  2A41 A;  3ULE A;  5KPT A;  3TU5 A;  3DXK A;  4IXC A;  3O9S A;  1G99 A;  4JKA A;  4BRQ A;  2BTF A;  5C12 A;  4JD2 A;  2P9N A;  5AQX A;  5CHI A;  1QQO A;  4JK7 A;  3O08 A;  1YJW N;  3M6G A;  2DPN A;  2QA4 N;  1VQ6 N;  5AQM A;  4CBX A;  5FPD A;  3ID8 A;  3CQX A;  4BRG A;  3MMV A;  4H03 B;  3VTH A;  3KHY A;  4BY9 C;  5KQ8 A;  4DHY A;  3EN9 A;  3ENO A;  5F1X A;  5C2D A;  4K42 A;  3HRG A;  1P90 A;  3JXU A;  4FSV A;  3TSP A;  3ZEU B;  2Q0R A;  4JKF A;  2GEL A;  4M7Y A;  5GAD P;  1XUP O;  1T6D A;  2V7Z A;  3AAP A;  3LM2 A;  3RVC A;  2E2O A;  3EE8 A;  4IDH A;  1K73 O;  2VGM A;  3UKU B;  1W2B M;  3TTC A;  2CGL A;  4H5T A;  4L3Q A;  1GLJ O;  4C23 A;  3W3D A;  5AQO A;  4EAH D;  1BDG A;  4A2B A;  4A5A A;  1NGD A;  4BRI A;  1TYQ A;  2RE2 A;  3AAQ A;  4NO7 A;  4WFA L;  4CZM A;  2JWK A;  1OVY A;  5E84 A;  4A5B A;  3MN9 A;  1BU6 O;  5KPZ A;  3FZH A;  1Y64 A;  3OBY A;  2ASP A;  2QWM A;  4OPH A;  3T69 A;  4YOY A;  4JKD A;  4K43 A;  4GY2 B;  5JIC A;  4FWQ A;  1P8Z A;  2IVP A;  1IG8 A;  1NGI A;  1YI2 N;  3CJB A;  5EX5 A;  5M1Q A;  2PFU A;  3EL2 A;  5AQQ A;  3HBT A;  3OA9 A;  2EWS A;  3SMP A;  2OAN A;  2FF3 B;  1EO1 A;  2FSN A;  5AQR A;  5ELZ A;  4WCE L;  4BRO A;  3VEN A;  3T7Z A;  3L6Q A;  3SAG A;  2HMP A;  2YX6 A;  2I7P A;  3MWP A;  3UKU A;  3ENB A;  4MDA A;  4BRK A;  1Q86 O;  3CIP A;  5ADX A;  4JN4 A;  3N4Q A;  5AQJ A;  4BGB A;  4H5N A;  3SAF A;  3ZYY X;  3DLL L;  1HKB A;  2D0O A;  2P9P A;  4BC3 A;  2OTL N;  1NGG A;  2NLX A;  5KPR A;  3QDK A;  3VEX A;  3PLA A;  2GTD A;  3QFP A;  3LDL A;  4BRD A;  5C10 A;  1YIJ N;  1J6Z A;  4DCH A;  1GLB G;  3E1Y A;  2GWK A;  1ZXO A;  2QXL A;  5GAG P;  5BRF A;  5JLH A;  3B8A X;  4ISF A;  3C7N B;  1NMD A;  3K9K A;  4CD3 A;  4DKW A;  3GBT A;  2YHX A;  5BN9 A;  1X3M A;  4FWN A;  3CC2 N;  4B1W B;  5BR9 A;  4FWL A;  4MO5 A;  3OBW A;  3VF2 A;  5EXW A;  1V4T A;  5AZI B;  1QHA A;  3O8M A;  1D4X A;  4B1X B;  2D0P A;  1QQN A;  3IUC A;  4FWR A;  4AM7 A;  1VQP N;  3C6A A;  1LOT B;  3P4I A;  4H0O A;  3SMS A;  4JKC A;  3U4L A;  4IOA L;  3GE1 A;  1ZBS A;  3FZF A;  3EO3 A;  4FWO A;  5AQY A;  4G9Z A;  2W41 A;  5AQN A;  5BRH A;  1VQK N;  3H1Q A;  5BPM A;  1MWK A;  2A6A A;  4PKI A;  1E4F T;  3D7E O;  3SK3 A;  5M1O A;  3QB0 A;  3HSC A;  3FZL A;  3HOS A;  1YF5 L;  3FGU A;  4NLB A;  1DEJ A;  4JD2 B;  2YJE A;  1HKG A;  3MK6 A;  3O80 A;  2HBJ A;  1SAZ A;  2E2Q A;  3CCE N;  2JWL A;  2HBK A;  2QTD A;  3M3Z A;  3L4Q A;  3C7N A;  4BR7 A;  5H1S Q;  1RDW X;  4ILG B;  4FOE A;  3SJH A;  1YIT N;  3ZX3 A;  2NNW A;  1QZ5 A;  2F9W A;  1EQY A;  3ENH A;  3GL1 A;  4RTF D;  2E20 A;  3KZB A;  1DT9 A;  1BO5 O;  2YJF A;  3WXI A;  3MN7 A;  4A62 A;  1YAG A;  4BRA A;  5AZI A;  4WFN L;  2QWO A;  2VGN A;  4RCH A;  2QWN A;  3EE9 A;  4A2A A;  1KQS M;  4CZH A;  2VWB A;  3AGK A;  2ZGY A;  1KXP A;  3C0B A;  4BR9 A;  4GV3 A;  3BUZ B;  4KH4 A;  3TSU A;  5GIO A;  2HBL A;  3VEZ A;  3EKU A;  1WUA A;  1HJO A;  4O8U A;  5B8H A;  3L0Q A;  5M1P A;  3P38 A;  1TYQ B;  3VGK A;  4EHT A;  1TUU A;  4H0V B;  4B1Y B;  3SAH A;  3OW2 M;  4FL9 A;  3ZET A;  5F0X A;  1U2V A;  2P9K A;  2PAV A;  2H3G X;  5AQF A;  2V51 B;  3MN5 A;  3I8B A;  3WEE A;  1VQ5 N;  4UY8 O;  3E9O A;  1NM1 A;  2NRV A;  5GAE P;  4Z94 A;  2FXU A;  4B1U B;  3CF5 L;  3SBG A;  1GLL O;  2NRT A;  1NBW A;  1ATN A;  4IO9 L;  4YOW A;  4GV6 A;  3M1F A;  5AQU A;  3G6E N;  4U7B A;  2F7T A;  2VCP A;  3KK7 A;  5DM6 L;  3CME N;  3WXL A;  4NLC A;  2Q97 A;  1KC8 O;  5LJW A;  3BF3 A;  4XH5 A;  3WXK A;  4H5V A;  1ZC6 A;  4CZK A;  3HTV A;  1NJI O;  3CJC A;  2QM1 A;  4GNI A;  5AQP A;  4BRL A;  4YOV A;  4JKH A;  4GV9 A;  1HPM A;  4M7X A;  3QIC A;  1Z6R A;  4MO4 A;  3VER A;  5M1K A;  2NRR A;  3WT0 A;  1QZ6 A;  1Q7Y O;  3CD6 N;  2P9P B;  1BOT O;  3E9P A;  3MN6 A;  1VQO N;  3IKM A;  1SS6 A;  2Q31 A;  3D2F B;  1VQ8 N;  1VQM N;  3HM8 A;  1SQK A;  1MA9 B;  2Q36 A;  4KH5 A;  4FVU A;  5GAH P;  1JCG A;  5AQG A;  5BPN A;  4CZF A;  4JKG A;  3CCV N;  3H45 C;  3QBX A;  2FSJ A;  1X9J A;  2V52 B;  4AF1 A;  3S41 A;  5LJV A;  1C0F A;  1K8K A;  1YJN N;  3VET A;  1N8R O;  1NLV A;  1GLE G;  3ZX2 A;  3WUH A;  4YDU C;  2Q0U A;  5AR0 A;  3JS6 A;  3LDP A;  1VQ7 N;  3CCM N;  4JAX A;  3VES A;  4BVP A;  3CCR N;  2AP1 A;  2VYP A;  5FPM A;  4H5R A;  1H1V A;  3D2E A;  2A5X A;  2FSK A;  2NRX A;  3QFU A;  3O9Q A;  3U9Z A;  3A8Y A;  5DM7 L;  2QEX N;  2QWR A;  3L4I A;  3MWT A;  1VQN N;  3D2F A;  1V4S A;  4BRN A;  3G4S N;  2J4R A;  2A42 A;  3EKS A;  3Q7B A;  3SLC A;  5E26 A;  3UB5 A;  3FZM A;  4PL7 A;  4JK8 A;  3CPE A;  4A61 A;  1KD1 O;  3E66 A;  4FO0 A;  4IOX A;  4A59 A;  5AQS A;  2NRZ A;  5BN8 A;  4CD1 A;  3CCQ N;  4BC4 A;  2QWL A;  3R3L A;  1XC3 A;  3A5M C;  4CZL A;  1NGB A;  2E2P A;  3HZ6 A;  4EIA A;  2NRH A;  2AA4 A;  3DXM A;  3F2K A;  4H0T B;  3I33 A;  3BF1 A;  1R59 O;  4WQ4 C;  4YDU A;  3TTD A;  5EY4 A;  4IFE A;  2IVO A;  3AAR A;  5JVH L;  1T3V A;  4PL8 A;  3KVG A;  2E1Z A;  1BUP A;  3ID6 A;  3Q7C A;  1RGI A;  3CMA N;  2ZJP L;  1WOQ A;  2W40 A;  3VEY A;  1ILY A;  4WQ5 C;  5BRE A;  1HKC A;  4IWV A;  3WQU A;  3MX2 A;  2GX9 A;  2P9S A;  3U8X A;  3ZET B;  1C0G A;  3PIO L;  1Q18 A;  2HST A;  1U2V B;  2P9K B;  1YHQ N;  4JKB A;  4B1V A;  1ATR A;  3LDQ A;  3WEE B;  2BH1 A;  2NZT A;  3BEX A;  2QWP A;  4CZI A;  4JEP A;  5C0Y A;  3FZK A;  5AQI A;  3G25 A;  3NVM A;  4PKH A;  4BQL A;  1K9M O;  4IEI A;  1LCU A;  1NGE A;  5AQH A;  4GVE A;  3UKR B;  4IJA A;  1TUY A;  1NGH A;  2P9U A;  2ASO A;  3IFR A;  4MLH A;  3MDQ A;  3GG4 A;  1BG3 A;  1VQ4 N;  1QVF M;  4XH4 A;  4IZ9 A;  3ATU A;  3O1B A;  3C65 A;  4IO8 A;  3DJC A;  4WFB L;  4ISE A;  2A3Z A;  1O13 A;  1Z05 A;  4OPA A;  4J8F A;  4BC5 A;  5JMV A;  4WQ5 A;  2E8A A;  2I7N A;  5AFU H;  3O4W A;  3I55 N;  1YVN A;  1BWF O;  2ZGZ A;  4FWS A;  2QWQ A;  3E9L A;  4ILH A;  4MLE A;  4QS8 A;  5AQV A;  3WQT A;  4WYB A;  3A5L C;  1HX1 A;  3VMF B;  3A5N C;  2FF6 A;  1VQL N;  5GIN A;  5AZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...