3BY5A

Crystal structure of cobalamin biosynthesis protein chig from agrobacterium tumefaciens str. c58
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
VTVAGIGCRKGAASDAIIAAVRAAERAFGVTVDYLATAPLKADEAGLAEAAKGLSLSLEIVAQERLEAVAAETMTFSQASLDHSGSPSVSEAAALAAAGAGARLVAPRLVVGDVTVAIAMTSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Cobalamin biosynthesis protein
publication title Crystal structure of cobalamin biosynthesis protein from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 3by5A00
2W6LA 3BY5A 3EEQA 2W6KA
chains in the Genus database with same CATH superfamily
5C2DA 4LFAK 4XH5A 3LM2A 4FLWA 4Z4IA 5ELZA 4KH5A 4FPBA 4B9LA 1HNXK 4DFKA 1M1KO 1HR0K 4LF4K 1RDUA 2OTLN 1GOCA 4KI6A 4KHSA 2PYJA 1RCHA 5AQSA 4DV6K 1U2VA 3FE1A 4B9VA 3CCLN 2IGIA 3UKRB 3TPQA 3PIPL 1C1BA 2RE2A 1QSLA 4BE2A 1IKXA 4BQZA 3OYAA 4X66K 4IFEA 2RN2A 4M3TA 3QIOA 1HJRA 1K9MO 5AR0A 2GUPA 2YHBA 3HPOA 4FPAA 2O8FB 4JKBA 4FWSA 4JNEA 4O5FA 4KAZA 2WC9A 4CK2A 3P5JA 4PA1A 4RW9A 3HT3A 2E2PA 1RTDA 4KHPK 1JL1A 1K8KB 3HRGA 1GLDG 4CF9A 2H3GX 1UOCA 2VGNA 5AQNA 4UQGA 4CGIA 1D8YA 3SPYA 4CEFA 4FJKA 3C94A 3KK7A 3B6PA 2UUBK 3AVJA 5FRNA 2HNYA 3OVNA 4BRHA 4JRPA 3AVCA 2V51B 4DQRA 2A41A 3AO3A 2A6AA 4YNQA 5SZTA 4TSXA 3UE5A 2BDPA 3PO4A 1TUYA 4JK8A 4KB0A 4OLBA 3DLBA 3LDOA 3LAKA 4ZHRA 1S22A 3CQXA 1TYQB 2IC3A 3MCAB 4JI7K 1HKCA 4YHHK 3VQ8A 3M6GA 2HF4A 4AM7A 4IDHA 4BRKA 3V6DA 1TAQA 2E2QA 4JKGA 4DLEA 1ZBFA 3LAMA 3TABA 4B1VA 3TU5A 2IS3A 3C6TA 5EX5A 1X9MA 4F4KA 4LH4A 1DTQA 2QM1A 4MLEA 5GIOA 2KLAA 2KFNA 2IVPA 3T69A 3WXKA 1KLMA 4BC2A 2QWMA 3CCUN 1LOTB 1QS4A 4IXCA 4WQ4A 4EZ6A 3VQDA 4FOIA 1T6DA 4HTLA 5KQDA 3I56N 3ZSOA 1WN7A 1NMNA 5J1EA 4CEBA 2P9IB 3C6UA 1W7AA 4DG1A 1IV0A 3WQUA 1N6QA 4KHUA 1GOAA 1HRHA 4A2AA 3EKUA 3TANA 1VSDA 4F8RA 4H03B 2VG5A 3HXMA 4JS5A 2O8EA 4IG3A 2OPQA 4FJ7A 5E26A 3BDPA 2D5RA 4JKCA 4DKWA 3K9JA 5J2NA 3PV8A 4KTWA 5BR8K 4ISFA 3KJVA 2P9KB 4OJRA 4EZ9A 1XI1A 3L8BA 5FRMA 1TV6A 2Y1IA 1GLFO 4CGFA 2HMPA 3KLHA 4CJ4A 4CZIA 3SBGA 1VSJA 4F3OA 2ZGYA 4FYDA 4F3TA 4DU4A 3NH0A 4W5QA 3CFOA 1O13A 4B9QA 2QI2A 4IJAA 1VQ4N 3U4LA 4CJRA 1MWKA 3NGIA 1I39A 1NGGA 3ENOA 3UKRA 3HTVA 4A61A 2UUAK 1N34K 3O5BA 4FM0A 3E9LA 1IG8A 3OJSA 3O4NA 4BRGA 2QWQA 2HHHK 4E19A 2IVNA 2OPPA 2HBMA 1Z25A 3BZCA 1YTAA 1XNQK 1VSIA 5F0XA 4GKJK 2O8FA 5EY4A 4U7BA 3V81A 2HHWA 2A3ZA 1HYZA 4KTQA 3THYB 4CZGA 4PY5A 1NGFA 1U49A 3QEVA 4BDYA 5KPTA 3THVA 2FBTA 4IFYA 1K8KA 3QERA 3KVGA 3AO4A 4CEZA 5HP1A 4CJLA 1BHLA 1ITGA 3CMAN 3HJFA 4FW1A 1LWCA 3UIQA 1BDGA 3OS0A 2I5JA 3NBPA 1T8EA 4ICLA 2P5GA 1NK0A 2F4VK 1TKTA 2Q2RA 4FLZA 1VQON 3AVKA 3OYDA 1S6PA 2NRXA 2F9TA 3DI6A 4JKEA 1NK5A 4NCBA 1TYQA 3BP8A 4W5OA 4FWQA 4CIGA 2QWRA 3AVAA 5LJWA 3TAQA 5F1XA 1NGHA 1SQKA 1HMVA 5BRDA 4OGCA 4DUZK 2ASMA 4WQ4C 4CHOA 2P9PB 1L5UA 2F8TA 4NCGA 2A40A 2ZD1A 4OX9K 1VSEA 2W41A 3TARA 1WSEA 5AQKA 3I8DA 1SS6A 3PX0A 4BG8A 3G6EN 2O8DB 3EYZA 4IO9L 4CGDA 4DV5K 1YVUA 2ITMA 5A2QO 3DLGA 3LDPA 2GWKA 4B8AB 4DTRA 3HZ6A 5EXWA 1ILYA 2P9IA 3O08A 3A5OC 1ZYQA 2E4LA 1RBSA 5AQUA 3IAYA 3M5RA 3NDKA 4JYAK 2OA8A 4YFUA 5AQXA 3DYAA 4YY3K 4GY2B 1KVAA 4RW7A 4CCHA 4JV5K 4K8XA 3U9DA 4IDKA 4DWIA 3HVRA 3LDSA 4M3YA 4WE1A 3NF9A 2VCPA 1YAGA 4CF8A 5GADP 4BRAA 1RNHA 2P9KA 2D4WA 2PZSA 2FSJA 3VF6A 1Z6RA 3NH2A 4IOAL 3ZX3A 4YOXA 5BRHA 1HQUA 2D0CA 3SNNA 1LAVA 4DV0K 1RBUA 1JKHA 3WNHA 2QXLA 4M7XA 1U04A 3PX6A 4JI2K 3ZSWA 3DRRA 4O44A 3FZLA 2GBZA 4OPKA 4NXNK 4DTXA 1WBBA 4DV3K 3H6EA 2JWKA 1IG9A 2GUIA 4M45A 3C7NB 1QVFM 2ASOA 5HLFA 3ZETB 3QFUA 2QWNA 1HPZA 5AFUH 5KQ8A 4J8FA 2A5XA 3OYGA 1T05A 2A1RA 5FROA 5C2FA 4KPYA 2HB5A 3K59A 4GVMA 1IKYA 1NKCA 1YJNN 3THYA 3CG7A 1CZBA 5GAGP 3LDLA 4CBXA 4FZZA 1UAXA 3NGYA 5AQQA 4Z4CA 4JD2B 3OYFA 4BR4A 3U8XA 4BRFA 3CCMN 3CQ8A 1RDWX 4I6MB 3OYBA 1GLCG 3H3NO 4J2AA 3ZSVA 4M7YA 4B3OA 4FJ8A 4ID1A 1B9FA 4I2PA 4CHYA 2D0AA 4E7LA 2FF3B 2A1SA 4DR5K 3ENHA 1ATNA 1U47A 4DR7K 1EKEA 1JXBA 3RMBA 4KHQA 1XUPO 3E9PA 1VQLN 5CZ2A 2UXBK 5CE3A 4CF0A 2OTJN 1LCUA 3TTFA 1XHXA 3QMLA 2P9UB 1C6VA 3K5LA 4CZLA 4RCHA 4FJMA 1Q86O 1RT1A 4K25A 3OYKA 3PY8A 4X62K 3AVFA 1RFQA 3PIOL 2O8BB 5SWMA 2P9PA 2GELA 1NK7A 4KBOA 1S9EA 3CCEN 3KK1A 2VG6A 2YNIA 3LWMA 2RKIA 3NMUA 2O8DA 3HOSA 1QSYA 1ATRA 5LY3A 4QCLA 3BF1A 1HX1A 2CGJA 3G10A 4HUEA 1JLGA 4M3WA 4N76A 2OANA 3A2FA 3KWGA 4JK7A 3TSQA 3H45C 2HBJA 5GAEP 4FJGA 3F5TA 2Q36A 1RBTA 1MWMA 3VESA 3JAMO 3SK3A 4KHYA 1IO2A 2YI1A 5C12A 5D3GA 2NRWA 4H0TB 1YJWN 1JCEA 3LP3A 3AAQA 4AH9A 2UXCK 2XY5A 4QOZB 4GVEA 3AA2A 2HNZA 4CJ5A 1TKXA 1BUPA 3AV9A 4BGBA 3CCQN 3EE9A 1RT7A 5JVHL 5K14A 4Z94A 3CYMA 1RT6A 1WAJA 5GINA 2UXDK 5HRRA 1E4GT 5EU7A 3THXB 3WNGA 4Y1DA 1EETA 3RR7A 1ZBSA 3KTQA 3CD6N 3I0SA 4EP5A 3SV4A 5JMVA 2G8WA 5AZIB 2BTFA 4YOVA 3N4QA 3ZSQA 4CHNA 4AILC 4DHYA 4DU1A 3OJUA 4C8NA 4K43A 1HLUA 1L3SA 3FZKA 4PKGA 2Z1HA 1GOBA 2BE2A 3VQQA 2XY8A 1XQSC 1RBVA 1NLVA 3C7NA 2G8KA 3O9TA 5JICA 3ZETA 3ZT3A 3SQ0A 4FLYA 2CH5A 4F2SA 4JI5K 3QICA 1JLAA 5MLCQ 4IBNA 3RRGA 3MX2A 3C0BA 1V4SA 3LP2A 3KWIA 2O8CB 1NGEA 5AJ3K 1WBDA 1QHAA 4CECA 5GAHP 1E3MA 2IVOA 4DUYK 4JD2A 3OBYA 3KK3A 4OVLA 5KRTA 3V9ZA 3P83D 3K9KA 1NJIO 1KCFA 1NWKA 4CJEA 3D7EO 1X9WA 1HQEA 3OYHA 4B9MA 4BVPA 2Q1NA 3QEIA 1YJ9N 2GX9A 2P9LB 3AVHA 3V9WA 3SZ2A 1HPMA 5J2QA 1TGOA 5AQVA 3HPHA 1QQCA 4HWIA 4B3TK 4M42A 3SLCA 2HNDA 1ZBHA 4E7KA 1NOZA 1MA9B 4C1NI 2P9UA 4WFAL 5AQHA 4H0PA 4FJHA 4C8KA 3NAEA 1DGKN 2UU9K 3SJHA 3HYFA 5M1FA 3KLGA 3K5NA 4V19S 1KAYA 1WOQA 1FKOA 2O8BA 3F2KA 3GOIA 4DTNA 5KPZA 4Z4FA 4I2QA 4DCHA 3IS9A 4A57A 2UYTA 2ZJQL 4BG9A 3SAHA 2E88A 1EWRA 1CXUA 4ZTFA 2IOCA 1REVA 4M3UA 4FZXC 3KKRA 3NF6A 4KKOA 3O3FA 4FJXA 3JSMA 2HHVA 4FO0A 2ZM6K 3DRSA 3AA4A 3SBTA 3BF3A 1C0UA 2WONA 4OPJA 5C25A 1SL2A 2CGKA 1VK0A 3SCXA 2D0PA 2FBYA 3VF2A 4QS9A 3GG4A 3AA3A 1XWLA 2JLEA 4CGJA 2I7PA 3SQ1A 1FK9A 4H5VA 3QIPA 2AP1A 4B9UA 1I3AA 4C8MA 4FM2A 1SV5A 4O5BA 1D4XA 3MWTA 2F9WA 3DLHA 2HSTA 3V1OA 5JVGL 3ULDA 3CCSN 1FJGK 3QBXA 1UA1A 4DQIA 3ZLJA 1C0GA 3OYEA 3O9QA 3AVGA 4KH6A 3LALA 4E89A 3SV3A 3OHRA 3ZSXA 1SZ2A 4HUGA 2KQ2A 5CYQA 1A5VA 4E7HA 3OS2A 4CF1A 2ZJPL 1EQYA 3H46O 5AZIA 2AA4A 2XHBA 4R5PA 3A0IX 1XNRK 4DR3K 3EKSA 3V9XA 4FWNA 4RWTA 4H0YB 2P5OA 5EVZA 1O1WA 1RGIA 4EFHA 1R0AA 3L2QA 4CZJA 1BI4A 3C65A 4JLHA 4FJIA 4B3RK 4DS5A 3J8AA 3FFIA 4IWVA 2PY5A 1A5XA 3SUNA 3KK2A 5C10A 1W9HA 2UUCK 4MO5A 4O0IA 4IKFA 1YI2N 3KD1E 2FC0A 3K5MA 4CIFA 3OYIA 1HKBA 4FWLA 2OZSA 2O8CA 5AFUA 3O3GA 3WXJA 5HRNA 4K41A 2WUSA 4CJPA 4JI0K 3VGLA 5FPEA 4PHTX 1JLEA 4DQPA 4J2DA 4DTSA 4JI4K 4BY9C 4DLGA 1KD1O 2P9NB 1LWEA 3KIOA 3MWPA 4CJKA 4M63C 1QZ6A 3HP6A 1VQ7N 3PLAA 1FXXA 4AHSA 1BA1A 1YIJN 4FW2A 3VEYA 4JAXA 2G8IA 1F21A 2P9LA 4PKHA 3ZX0A 4F9OA 3EZ5A 1VQPN 4GKKK 4DV2K 3CFRA 2NLXA 1KFSA 2E1ZA 1J6ZA 1WSGA 2R7YA 2Q97A 3LZIA 1TK5A 4A5BA 3QNNA 3VTHA 3RR8A 3LDQA 2W6KA 4CK3A 3ATVA 3E66A 4BC5A 3HVTA 1QTMA 4DR2K 4HHTA 1MDUB 3DLKA 5GIPA 1TKZA 4EHUA 3IDHA 2ITGA 1JLBA 1SUQA 1HKGA 2CGLA 5AQWA 4DU3A 3VQ9A 3WT0A 4DR4K 2F96A 2ZGZA 3FZHA 3QEWA 2E2NA 1Q7YO 1BISA 4QS7A 4FWMA 2A42A 3DM2A 4NO7A 2KTQA 3UB5A 3MX5A 3R6MA 1RTJA 4KFBA 1ASUA 2YX6A 2HOEA 2DFEA 3VEVA 4Z4HA 4R79A 1FKPA 2Y1JA 3QETA 4EHTA 2HMIA 4MDAA 3WNEA 3T1AA 5E41A 3IMXA 4CHZA 2FBVA 2OPSA 3VENA 1SAZA 3D2EB 4YDUA 1DTTA 4RG8A 4JEPA 3T3FA 3AAPA 3HL8A 2DFFA 5E84A 2GEMA 3M3ZA 1TKDA 4BRMA 3TR8A 2VWKA 1TL3A 3P4IA 5IT9O 1E4FT 1TK0A 4BRIA 3KLEA 1NKEA 4H4OA 4IFVA 2YHXA 1EO1A 2KKZA 4ELVA 1ZBIA 3DXKB 5TKWA 4IOXA 3SI6A 5LJVA 4YOYA 3BEXA 3MEGA 1OVQA 4N56A 5KGWA 5T7BA 1C1CA 2E5LK 2QTDA 2ZWHA 3ISNC 2V7ZA 4GMJB 4DV4K 4ISGA 3V9UA 2OPRA 3SUPA 4CIEA 2NRZA 4CEEA 5AQGA 4JRQA 3MECA 1HNVA 1EXQA 2ETJA 5CYMA 1NGIA 3FGUA 2XRIA 2X6SA 3DLEA 3DWLA 1X1PA 1WSJA 1S9GA 1GLJO 1VAZA 3EL2A 4XEIA 4HCBA 4OGEA 4E3SA 3O1WA 1N5YA 3LDNA 1JCFA 3L0QA 3V4IA 4OPHA 2P9NA 3TSPA 3O4WA 4RW4A 3SAFA 3CXCM 1CZAN 4AF1A 1VSHA 4BR0A 3ID6A 4MQ3A 1NJXA 2PYLA 1OH8A 1Z05A 1KLNA 1U6ZA 1IBMK 1N32K 4MLHA 1CXQA 4KO0A 4H8KA 4C23A 4U67L 1JLFA 3HM8A 4B9TA 3LANA 2OZMA 2YCHA 4E1JA 3H1VX 4NB4A 1JJ2M 1U48A 5JS2A 3G4SN 4KB1A 3AVLA 3VA0A 2YJEA 2OCEA 2YNHA 4DF8A 3NFAA 1BA0A 4DSFA 4CZKA 3N4PA 1N33K 1JXEA 4BROA 3ULEB 3AVMA 5H1SQ 1NGDA 3JS6A 3M8RA 4H0XB 2KW4A 3AGKA 5AQTA 5HBMA 3ZT4A 3CF5L 4G9ZA 3FLCO 2QKKA 2FF6A 4CJSA 3VA3A 1QQMA 2HHQA 3NF7A 5FPNA 3L2WA 4KI4A 4OO1J 1RT3A 2FLOA 2KHOA 4CJ7A 4FWRA 2ZQBA 2VYPA 3C6HA 4Z0UA 3HK2A 4PL8A 3QLHA 4E0DA 3OYMA 3G71N 4K0KK 4CHPA 4YDUC 1FW6A 3OW2M 4FM1A 1TAUA 1T7PA 4FSVA 4JHDB 4FVMA 4ELUA 4I9LA 4B08A 2NRVA 3NVMA 1QQNA 5BPLA 1DT9A 4E1MA 3IFRA 5M1QA 1LWFA 3D2EA 4H4MA 1QVGM 2GTDA 3G25A 4GV9A 1RTHA 3RVCA 4CF2A 2Q3SA 3VQAA 2NRRA 1S1TA 4CEDA 2IAJA 4KTZA 3TI0A 2BGGA 4CGHA 3SQ4A 1CZ9A 1D5AA 3K57A 3PO5A 5FPDA 1DLOA 2W42A 4CHQA 1NM1A 1U2VB 5C42A 4WYBA 1BU6O 1WSHA 4Z4GA 3GDQA 4RW8A 3L3UA 1P90A 4DFMA 1C0FA 3R1XA 3NCIA 3DRPA 3DXKA 1J5EK 2NRTA 1T6CA 3QINA 4BWMA 3H1QA 2V7YA 2D1KA 4CJWA 3ZSRA 4DSIA 2E6LA 4CFAA 1BO5O 4NLBA 4FCYA 3DXMB 3WXLA 3DLLL 5AZJB 5M1NA 1NGAA 3VETA 2W40A 3MMVA 4DFPA 2CH6A 4DV7K 2O4IA 4DQSA 3MCPA 1SKSA 2X6NA 4LSLA 3VQCA 1SL0A 3W0LA 4L3QA 4OKJA 4CERA 3SUQA 3HP9A 4J2EA 2YNFA 5HOOA 5HRPA 3WUHA 1KSPA 4CI6A 1YUWA 5KGXA 4AHCA 1Y64A 3Q7BA 1T3VA 2PFUA 4AHTA 2Q0RA 1KQSM 3PUFA 3EN9A 4ILJA 4XH4A 2FXUA 3ZCMA 3CPWM 4C8OA 4E1NA 3DMJA 1NGCA 2QWPA 5DM7L 5HROA 2ATQA 3E9OA 2YKMA 3I33A 3D2FB 4CD3A 4LH5A 3S41A 1KVCA 3A5NC 4NLCA 3CFPA 3CPEA 3U6FA 4DB3A 3J7YP 5FLXO 1JLCA 4AHRA 3OYLA 1VQNN 3MDQA 2BH1A 4QS8A 3CJBA 3ULEA 1A5WA 1YHQN 4B1ZA 4NCAA 3VEZA 1D9FA 5BR9A 3WEEB 3OYNA 4PWDA 4E7IA 4CVNE 4O8KA 4EAHD 3VEWA 4GV3A 1NU0A 4DTMA 3ITHA 3MN6A 2G8UA 2WBNA 2VQFK 3J81O 4AQYK 4CGGA 3O80A 4F2RA 3SMPA 1G99A 1QE1A 3A5MC 3IG1A 4B3SK 3KLIA 1KVBA 4DTUA 1ZBLA 2HVHA 1KRPA 4BDZA 5JLHA 4DTJA 5KPRA 4I6MA 4LFCK 3SQ2A 4JI6K 1TL1A 4IZ9A 1G15A 3MAQA 2F7TA 5C15A 1XC9A 4JKHA 2HHXA 3AO1A 4JHDA 1YITN 1C0TA 1NBWA 1I94K 3HSTB 4A62A 3ZT2A 4IEIA 5C24A 3TAEA 2JGUA 4FK2A 4Q5VA 3R9PA 4CJVA 2QK9A 2EX3A 1HJOA 1ASWA 3CM5A 4PQUA 1NGJA 2VWBA 3AVIA 3S3MA 2YKNA 3T1YK 2J4RA 4ILHA 2NRHA 1S6QA 4KHNA 4PUOA 5DK5A 4FOEA 4CZHA 3L4QA 3QO9A 3EZWA 3RMCA 1RBRA 3O9UA 3MEDA 3TWHA 1NGBA 5DM6L 2GV9A 3ZYYX 2D0OA 5AQFA 1J54A 2ASPA 2HHTA 3CCRN 4LF9K 1ZC6A 4HUFA 4FLVA 3D45A 1S1UA 3V9SA 4JKFA 3CHWA 3LP0A 3VQ5A 1K6YA 2V52B 1VSLA 2G8VA 5FDLA 3FZFA 1X3NA 3M1FA 4FJ9A 3O9RA 3E01A 2YNGA 3SYZA 1GLEG 1VQ8N 2B6AA 3AVNA 4B8CA 3DXMA 1IJJA 3ALYA 5AZJA 3C6AA 1BGXT 2RHKA 3P1GA 4CEOA 3MXIA 2G8HA 3T19A 4ISEA 4IJNA 3M8PA 3ZSZA 3KHYA 4H5TA 4RTFD 4GW6A 3QEPA 3AO2A 3FZMA 3QFPA 4FZYA 1Q82O 2YV0X 1HNWK 3CJAA 1K8AO 1UA0A 1K73O 3VQ6A 3O1BA 4E7JA 4WQ5A 2VWJA 4W5TA 1OH6A 1RDBA 2O4GA 3U3GA 5I42A 4YOWA 1ZXOA 1X3MA 3ATUA 2PBDA 4CZMA 5LMUK 3THXA 5BN9A 2RPIA 4B1WB 4BRLA 1T03A 4FJJA 4Q0BA 4CFDA 3C95A 3LP1A 3HOTA 4DV1K 1S3XA 3D2FA 4NYFA 1CLQA 4CW7B 1LW0A 1RTIA 4FWPA 4B3MK 1RDAA 2F8SA 3VTIA 3JXUA 1OH5A 3VQ4A 3EY1A 3CJ1A 4JKDA 1WUAA 4XH1A 1X9JA 4KV8A 4EIAA 1NK4A 3ID8A 4M41A 1JL2A 3KKSA 4LSNA 3WEEA 4BRPA 4A5AA 3OS1A 5AQZA 5B8HA 4CFBA 5FPMA 3CJ7A 4CZEA 3THWB 4WFNL 2P9SB 4FL9A 1VSKA 1ASVA 1RT4A 4O0JA 3QDKA 2KZMA 3J80O 1XMOK 1V4TA 1N36K 3K58A 5KTQA 1EWQA 1EX4A 2VG7A 1B9DA 1D9DA 4DTPA 2FBXA 1VQ5N 3CC7N 1OKJA 4A2BA 3SMSA 4FVUA 4H0OA 3I0RA 3OTOK 3CCJN 1NJYA 5ADXH 1BCMA 1ZBUA 3V1RA 4BR5A 4BR7A 3PSFA 4DTOA 3J7AP 2IDOA 3R8EA 4JK9A 3B8AX 1M90O 3FFKB 1Q18A 3BZKA 4C1NK 1BQNA 4JI1K 4M3ZA 3U9ZA 2NZTA 4CBWA 4BGAA 3A5LC 3FR0A 1BG3A 1Z26A 2WOMA 3QBWA 3PX4A 1XHZA 3I8BA 3HBTA 5DMRA 4I9QA 4AHUA 1WB9A 3HSCA 3F73A 1HYVA 2Q0UA 4FWOA 1GLBG 4OKKA 1OH7A 3P38A 4DQ8A 4I7FA 3OA9A 1J5OA 2P1JA 3TAPA 1U45A 5AQIA 2ZE2A 5KI6A 1RILA 1WSIA 2BANA 3HM9A 3AVBA 3VF4A 1KAZA 3LZJA 1XC3A 2NUBA 4BE0A 5BREA 1MU2A 1NK9A 4BDPA 1S1XA 5EOYA 1T44A 3O8MA 3VQ7A 1HYSA 1BWFO 3KD5E 4BRNA 3VMFB 4WQ5C 4B9NA 4UY8O 4ZTJA 3AY9A 3ZSYA 4HVJA 4EP4A 3CI5A 3EE8A 4O55A 2B5JA 3RWUA 2E8AA 1Q9XA 5TKYA 3U3YA 4BRQA 1U4BA 1RDCA 2DFHA 4WF9L 2BUPA 2QEXN 2ZJRL 2DPNA 1BL3A 3UKUB 3MN5A 3WXIA 3RMDA 3NVKA 4NXMK 2PAVA 2ZF5O 3QESA 3L4IA 3CQYA 3S3OA 2D0BA 1L3UA 4Y1CA 3CC2N 4B1XB 3TSUA 1KAXA 3MXJA 4ILGB 3ZT1A 2QA4N 1VQ9N 4WCEL 3ZX2A 4J2BA 4DSEA 1LV5A 4DFJA 4FJLA 4IO8A 2HBKA 3MK6A 3TTCA 2YHAA 1C0MA 3HO1A 4K42A 3VOVA 3MN7A 3CJ9A 4LF8K 4Y0WA 2WTUA 1VRTA 5I3UA 1ATSA 3VEOA 4A59A 4AM6A 3I55N 3GE1A 4CJ3A 1NMDA 4FJ5A 1S1WA 4OPAA 2E1YA 4FLTA 4DQQA 2KZZA 1VQKN 5CY4A 4ELTA 4FK0A 3E1YA 5BRFA 1YXQA 3CERA 2FSNA 3W3DA 3A8YA 2HHUA 3GBTA 3CETA 4DS4A 5AQMA 1Q8IA 2QXFA 3DOLA 4FLUA 1QHTA 1EP4A 3M8QA 3THWA 2P9SA 1NKBA 4FK4A 2WFBA 2E6MA 2Z1IA 3VGMA 3VERA 1SKRA 4KH4A 1WSFA 5I9EB 3OY9A 3F9MA 4CBUA 1RT5A 3AARA 4H5WA 3RRHA 4BVOA 4CJTA 4LF7K 1UWBA 2OYQA 3CC4N 3V1QA 3O6WA 3H08A 1KTQA 3BUZB 4G1QA 2Q31A 3EO3A 5IWAK 2QKBA 1NK6A 1XMQK 4LF6K 2DY4A 1BIZA 2HHSA 4ID5A 3OBWA 2HBLA 1BIUA 1N8RO 2XY6A 3DAWA 3ZEUB 4H5RA 3SPZA 1HNIA 4MDBA 2HW3A 4JN4A 1VQ6N 5AQJA 5JS1A 3RSEB 2DTUA 2AJQA 4O4GA 1R59O 3ENBA 4CZFA 3T7ZA 1IKWA 3MN9A 4YOUA 4BC4A 4JS4A 2EWSA 4CESA 3NE6A 3BGRA 3DLRA 1LW2A 1NJZA 2EHGA 4X64K 3P39A 4RW6A 4OKEA 2XO7A 4PKIA 3Q7CA 4CJUA 5AQYA 3M8SA 2I7NA 3D6RA 4B9SA 2VGMA 1BCOA 4M3RA 1P8ZA 4BREA 3AGRA 3OYJA 4MO4A 4AHVA 1J9AA 4BE1A 3L6QA 4H0VB 4LY7A 3O9SA 4IEEA 3TTDA 2FSKA 5HRSA 1S5JA 3F9KA 4BACA 3ZT0A 3NGZA 4BC3A 1W2BM 3S9HA 3CM6A 4KHWA 4JI3K 4PL7A 2YHYA 4LD0A 1WAFA 4CD1A 3VEXA 2G8FA 2YHWA 1NJWA 4QAGA 4DR6K 4B1YB 2NNWA 1IBLK 4L8RB 1IH7A 2QWLA 4BRDA 5LL6Z 2YJFA 3K5OA 2P51A 3KLFA 3SJJA 4FXDA 5LMNK 3UKUA 4OLAA 1TUUA 4MFBA 3D0PA 5HL7L 3ASMA 3TAGA 5CR4A 1S72N 1YF5L 3R3LA 3CIPA 5J2PA 1KC8O 2KFZA 1TVRA 3K0SA 4IOCL 1DEJA 2JWLA 3RTVA 3BY5A 1QSSA 4BRCA 1KXPA 3QB0A 1NK8A 4K8ZA 3S3NA 1HNZK 3VPZA 3P31A 3DJCA 3H3OB 1L3VA 2GWJA 4YOTA 3JYTA 5AQPA 3WXMB 1VRUA 5F2RA 2X74A 5AQOA 1DKGD 4BR2A 1KFDA 3QNOA 3GL1A 4LC9B 3VQEA 1RT2A 1S1VA 4N41A 1VQMN 4W5RA 3LL3A 3WQTA 3B6OA 3T1HK 1J53A 4N5SA 3J7ZO 4BQLA 3L3VA 4YORA 3OYCA 1Q81O 3DOKA 3TAFA 1IBKK 5CZ1A 5KRSA 4NYNA 4BR9A 4LFBK 1LAWA 2W6LA 3AA5X 4O8UA 3L2VA 2B4JA 2VQEK 3O4QA 3VQPA 4IG0A 4CEAA 4DSLA 1GLLO 2QWOA 3VGKA 5C0YA 4Z4EA 4FJNA 1BQMA 3NH1A 3CMEN 4HCCA 4M3XA 1WNSA 1BOTO 3G0ZA 3IRXA 2Z1GA 3IKMA 5JLFA 1L3TA 3SUOA 1NOYA 2Z1JA 5ADXA 3ZEUA 4JKGB 1YVNA 3HI0A 1NNEA 3L2UA 4XIUA 1RDDA 3QEXA 3RSEA 3NF8A 5M1PA 3NHGA 1YTUA 2QW9A 1GLAG 4GNIA 3WNFA 4JI8K 3AO5A 5J2MA 4JKAA 2HF3A 1HUXA 1SKWA 1B92A 4DF4A 4GV6A 3EEQA 1W97L 4CEQA 3CJCA 4BWJA 4HTUA 5CHIA 1SL1A 2XY7A 1VSMA 4KREA 2HVIA 1WLJA 4DR1K 4DSJA 1IKVA 1H1VA 4WFBL 4CJQA 1X9SA 2RF2A 2X78A 2LSNA 4X65K 5M1KA 1Y97A 1QQOA 2IIRA 2E2OA 4W5NA 1BI4B 3LPTA 1JCGA 4LF5K 1VSFA 1NG9A 4C8LA 4DSKA 1YT3A 5M1OA 5BPNA 1W0HA 2E20A 3L2RA 1OVYA 3RMAA 3VQBA 3SAGA 2O8EB 4CJFA 1VHXA 3MEEA 3LPUA 3KZBA 4CK1A 3MXMA 4FWKA 1Q9YA 3IUCA 4FLXA 3LM9A 3PSIA 3K2PA 1ESVA 3TAMA 3HPGA 4N47A 4B1UB 5BN8A 3VN5A 4CE9A 3CCVN 5AQRA 4H5NA 1C1AA 4CFCA 4KRFA 1JLQA 4DMNA 3LWLA 1TK8A 1QZ5A 5AQLA 5BPMA 3O3HA
chains in the Genus database with same CATH topology
2W6LA 3BY5A 3EEQA 2W6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W6L A;  3BY5 A;  3EEQ A;  2W6K A; 
#chains in the Genus database with same CATH topology
 5C2D A;  4LFA K;  4XH5 A;  3LM2 A;  4FLW A;  4Z4I A;  5ELZ A;  4KH5 A;  4FPB A;  4B9L A;  1HNX K;  4DFK A;  1M1K O;  1HR0 K;  4LF4 K;  1RDU A;  2OTL N;  1GOC A;  4KI6 A;  4KHS A;  2PYJ A;  1RCH A;  5AQS A;  4DV6 K;  1U2V A;  3FE1 A;  4B9V A;  3CCL N;  2IGI A;  3UKR B;  3TPQ A;  3PIP L;  1C1B A;  2RE2 A;  1QSL A;  4BE2 A;  1IKX A;  4BQZ A;  3OYA A;  4X66 K;  4IFE A;  2RN2 A;  4M3T A;  3QIO A;  1HJR A;  1K9M O;  5AR0 A;  2GUP A;  2YHB A;  3HPO A;  4FPA A;  2O8F B;  4JKB A;  4FWS A;  4JNE A;  4O5F A;  4KAZ A;  2WC9 A;  4CK2 A;  3P5J A;  4PA1 A;  4RW9 A;  3HT3 A;  2E2P A;  1RTD A;  4KHP K;  1JL1 A;  1K8K B;  3HRG A;  1GLD G;  4CF9 A;  2H3G X;  1UOC A;  2VGN A;  5AQN A;  4UQG A;  4CGI A;  1D8Y A;  3SPY A;  4CEF A;  4FJK A;  3C94 A;  3KK7 A;  3B6P A;  2UUB K;  3AVJ A;  5FRN A;  2HNY A;  3OVN A;  4BRH A;  4JRP A;  3AVC A;  2V51 B;  4DQR A;  2A41 A;  3AO3 A;  2A6A A;  4YNQ A;  5SZT A;  4TSX A;  3UE5 A;  2BDP A;  3PO4 A;  1TUY A;  4JK8 A;  4KB0 A;  4OLB A;  3DLB A;  3LDO A;  3LAK A;  4ZHR A;  1S22 A;  3CQX A;  1TYQ B;  2IC3 A;  3MCA B;  4JI7 K;  1HKC A;  4YHH K;  3VQ8 A;  3M6G A;  2HF4 A;  4AM7 A;  4IDH A;  4BRK A;  3V6D A;  1TAQ A;  2E2Q A;  4JKG A;  4DLE A;  1ZBF A;  3LAM A;  3TAB A;  4B1V A;  3TU5 A;  2IS3 A;  3C6T A;  5EX5 A;  1X9M A;  4F4K A;  4LH4 A;  1DTQ A;  2QM1 A;  4MLE A;  5GIO A;  2KLA A;  2KFN A;  2IVP A;  3T69 A;  3WXK A;  1KLM A;  4BC2 A;  2QWM A;  3CCU N;  1LOT B;  1QS4 A;  4IXC A;  4WQ4 A;  4EZ6 A;  3VQD A;  4FOI A;  1T6D A;  4HTL A;  5KQD A;  3I56 N;  3ZSO A;  1WN7 A;  1NMN A;  5J1E A;  4CEB A;  2P9I B;  3C6U A;  1W7A A;  4DG1 A;  1IV0 A;  3WQU A;  1N6Q A;  4KHU A;  1GOA A;  1HRH A;  4A2A A;  3EKU A;  3TAN A;  1VSD A;  4F8R A;  4H03 B;  2VG5 A;  3HXM A;  4JS5 A;  2O8E A;  4IG3 A;  2OPQ A;  4FJ7 A;  5E26 A;  3BDP A;  2D5R A;  4JKC A;  4DKW A;  3K9J A;  5J2N A;  3PV8 A;  4KTW A;  5BR8 K;  4ISF A;  3KJV A;  2P9K B;  4OJR A;  4EZ9 A;  1XI1 A;  3L8B A;  5FRM A;  1TV6 A;  2Y1I A;  1GLF O;  4CGF A;  2HMP A;  3KLH A;  4CJ4 A;  4CZI A;  3SBG A;  1VSJ A;  4F3O A;  2ZGY A;  4FYD A;  4F3T A;  4DU4 A;  3NH0 A;  4W5Q A;  3CFO A;  1O13 A;  4B9Q A;  2QI2 A;  4IJA A;  1VQ4 N;  3U4L A;  4CJR A;  1MWK A;  3NGI A;  1I39 A;  1NGG A;  3ENO A;  3UKR A;  3HTV A;  4A61 A;  2UUA K;  1N34 K;  3O5B A;  4FM0 A;  3E9L A;  1IG8 A;  3OJS A;  3O4N A;  4BRG A;  2QWQ A;  2HHH K;  4E19 A;  2IVN A;  2OPP A;  2HBM A;  1Z25 A;  3BZC A;  1YTA A;  1XNQ K;  1VSI A;  5F0X A;  4GKJ K;  2O8F A;  5EY4 A;  4U7B A;  3V81 A;  2HHW A;  2A3Z A;  1HYZ A;  4KTQ A;  3THY B;  4CZG A;  4PY5 A;  1NGF A;  1U49 A;  3QEV A;  4BDY A;  5KPT A;  3THV A;  2FBT A;  4IFY A;  1K8K A;  3QER A;  3KVG A;  3AO4 A;  4CEZ A;  5HP1 A;  4CJL A;  1BHL A;  1ITG A;  3CMA N;  3HJF A;  4FW1 A;  1LWC A;  3UIQ A;  1BDG A;  3OS0 A;  2I5J A;  3NBP A;  1T8E A;  4ICL A;  2P5G A;  1NK0 A;  2F4V K;  1TKT A;  2Q2R A;  4FLZ A;  1VQO N;  3AVK A;  3OYD A;  1S6P A;  2NRX A;  2F9T A;  3DI6 A;  4JKE A;  1NK5 A;  4NCB A;  1TYQ A;  3BP8 A;  4W5O A;  4FWQ A;  4CIG A;  2QWR A;  3AVA A;  5LJW A;  3TAQ A;  5F1X A;  1NGH A;  1SQK A;  1HMV A;  5BRD A;  4OGC A;  4DUZ K;  2ASM A;  4WQ4 C;  4CHO A;  2P9P B;  1L5U A;  2F8T A;  4NCG A;  2A40 A;  2ZD1 A;  4OX9 K;  1VSE A;  2W41 A;  3TAR A;  1WSE A;  5AQK A;  3I8D A;  1SS6 A;  3PX0 A;  4BG8 A;  3G6E N;  2O8D B;  3EYZ A;  4IO9 L;  4CGD A;  4DV5 K;  1YVU A;  2ITM A;  5A2Q O;  3DLG A;  3LDP A;  2GWK A;  4B8A B;  4DTR A;  3HZ6 A;  5EXW A;  1ILY A;  2P9I A;  3O08 A;  3A5O C;  1ZYQ A;  2E4L A;  1RBS A;  5AQU A;  3IAY A;  3M5R A;  3NDK A;  4JYA K;  2OA8 A;  4YFU A;  5AQX A;  3DYA A;  4YY3 K;  4GY2 B;  1KVA A;  4RW7 A;  4CCH A;  4JV5 K;  4K8X A;  3U9D A;  4IDK A;  4DWI A;  3HVR A;  3LDS A;  4M3Y A;  4WE1 A;  3NF9 A;  2VCP A;  1YAG A;  4CF8 A;  5GAD P;  4BRA A;  1RNH A;  2P9K A;  2D4W A;  2PZS A;  2FSJ A;  3VF6 A;  1Z6R A;  3NH2 A;  4IOA L;  3ZX3 A;  4YOX A;  5BRH A;  1HQU A;  2D0C A;  3SNN A;  1LAV A;  4DV0 K;  1RBU A;  1JKH A;  3WNH A;  2QXL A;  4M7X A;  1U04 A;  3PX6 A;  4JI2 K;  3ZSW A;  3DRR A;  4O44 A;  3FZL A;  2GBZ A;  4OPK A;  4NXN K;  4DTX A;  1WBB A;  4DV3 K;  3H6E A;  2JWK A;  1IG9 A;  2GUI A;  4M45 A;  3C7N B;  1QVF M;  2ASO A;  5HLF A;  3ZET B;  3QFU A;  2QWN A;  1HPZ A;  5AFU H;  5KQ8 A;  4J8F A;  2A5X A;  3OYG A;  1T05 A;  2A1R A;  5FRO A;  5C2F A;  4KPY A;  2HB5 A;  3K59 A;  4GVM A;  1IKY A;  1NKC A;  1YJN N;  3THY A;  3CG7 A;  1CZB A;  5GAG P;  3LDL A;  4CBX A;  4FZZ A;  1UAX A;  3NGY A;  5AQQ A;  4Z4C A;  4JD2 B;  3OYF A;  4BR4 A;  3U8X A;  4BRF A;  3CCM N;  3CQ8 A;  1RDW X;  4I6M B;  3OYB A;  1GLC G;  3H3N O;  4J2A A;  3ZSV A;  4M7Y A;  4B3O A;  4FJ8 A;  4ID1 A;  1B9F A;  4I2P A;  4CHY A;  2D0A A;  4E7L A;  2FF3 B;  2A1S A;  4DR5 K;  3ENH A;  1ATN A;  1U47 A;  4DR7 K;  1EKE A;  1JXB A;  3RMB A;  4KHQ A;  1XUP O;  3E9P A;  1VQL N;  5CZ2 A;  2UXB K;  5CE3 A;  4CF0 A;  2OTJ N;  1LCU A;  3TTF A;  1XHX A;  3QML A;  2P9U B;  1C6V A;  3K5L A;  4CZL A;  4RCH A;  4FJM A;  1Q86 O;  1RT1 A;  4K25 A;  3OYK A;  3PY8 A;  4X62 K;  3AVF A;  1RFQ A;  3PIO L;  2O8B B;  5SWM A;  2P9P A;  2GEL A;  1NK7 A;  4KBO A;  1S9E A;  3CCE N;  3KK1 A;  2VG6 A;  2YNI A;  3LWM A;  2RKI A;  3NMU A;  2O8D A;  3HOS A;  1QSY A;  1ATR A;  5LY3 A;  4QCL A;  3BF1 A;  1HX1 A;  2CGJ A;  3G10 A;  4HUE A;  1JLG A;  4M3W A;  4N76 A;  2OAN A;  3A2F A;  3KWG A;  4JK7 A;  3TSQ A;  3H45 C;  2HBJ A;  5GAE P;  4FJG A;  3F5T A;  2Q36 A;  1RBT A;  1MWM A;  3VES A;  3JAM O;  3SK3 A;  4KHY A;  1IO2 A;  2YI1 A;  5C12 A;  5D3G A;  2NRW A;  4H0T B;  1YJW N;  1JCE A;  3LP3 A;  3AAQ A;  4AH9 A;  2UXC K;  2XY5 A;  4QOZ B;  4GVE A;  3AA2 A;  2HNZ A;  4CJ5 A;  1TKX A;  1BUP A;  3AV9 A;  4BGB A;  3CCQ N;  3EE9 A;  1RT7 A;  5JVH L;  5K14 A;  4Z94 A;  3CYM A;  1RT6 A;  1WAJ A;  5GIN A;  2UXD K;  5HRR A;  1E4G T;  5EU7 A;  3THX B;  3WNG A;  4Y1D A;  1EET A;  3RR7 A;  1ZBS A;  3KTQ A;  3CD6 N;  3I0S A;  4EP5 A;  3SV4 A;  5JMV A;  2G8W A;  5AZI B;  2BTF A;  4YOV A;  3N4Q A;  3ZSQ A;  4CHN A;  4AIL C;  4DHY A;  4DU1 A;  3OJU A;  4C8N A;  4K43 A;  1HLU A;  1L3S A;  3FZK A;  4PKG A;  2Z1H A;  1GOB A;  2BE2 A;  3VQQ A;  2XY8 A;  1XQS C;  1RBV A;  1NLV A;  3C7N A;  2G8K A;  3O9T A;  5JIC A;  3ZET A;  3ZT3 A;  3SQ0 A;  4FLY A;  2CH5 A;  4F2S A;  4JI5 K;  3QIC A;  1JLA A;  5MLC Q;  4IBN A;  3RRG A;  3MX2 A;  3C0B A;  1V4S A;  3LP2 A;  3KWI A;  2O8C B;  1NGE A;  5AJ3 K;  1WBD A;  1QHA A;  4CEC A;  5GAH P;  1E3M A;  2IVO A;  4DUY K;  4JD2 A;  3OBY A;  3KK3 A;  4OVL A;  5KRT A;  3V9Z A;  3P83 D;  3K9K A;  1NJI O;  1KCF A;  1NWK A;  4CJE A;  3D7E O;  1X9W A;  1HQE A;  3OYH A;  4B9M A;  4BVP A;  2Q1N A;  3QEI A;  1YJ9 N;  2GX9 A;  2P9L B;  3AVH A;  3V9W A;  3SZ2 A;  1HPM A;  5J2Q A;  1TGO A;  5AQV A;  3HPH A;  1QQC A;  4HWI A;  4B3T K;  4M42 A;  3SLC A;  2HND A;  1ZBH A;  4E7K A;  1NOZ A;  1MA9 B;  4C1N I;  2P9U A;  4WFA L;  5AQH A;  4H0P A;  4FJH A;  4C8K A;  3NAE A;  1DGK N;  2UU9 K;  3SJH A;  3HYF A;  5M1F A;  3KLG A;  3K5N A;  4V19 S;  1KAY A;  1WOQ A;  1FKO A;  2O8B A;  3F2K A;  3GOI A;  4DTN A;  5KPZ A;  4Z4F A;  4I2Q A;  4DCH A;  3IS9 A;  4A57 A;  2UYT A;  2ZJQ L;  4BG9 A;  3SAH A;  2E88 A;  1EWR A;  1CXU A;  4ZTF A;  2IOC A;  1REV A;  4M3U A;  4FZX C;  3KKR A;  3NF6 A;  4KKO A;  3O3F A;  4FJX A;  3JSM A;  2HHV A;  4FO0 A;  2ZM6 K;  3DRS A;  3AA4 A;  3SBT A;  3BF3 A;  1C0U A;  2WON A;  4OPJ A;  5C25 A;  1SL2 A;  2CGK A;  1VK0 A;  3SCX A;  2D0P A;  2FBY A;  3VF2 A;  4QS9 A;  3GG4 A;  3AA3 A;  1XWL A;  2JLE A;  4CGJ A;  2I7P A;  3SQ1 A;  1FK9 A;  4H5V A;  3QIP A;  2AP1 A;  4B9U A;  1I3A A;  4C8M A;  4FM2 A;  1SV5 A;  4O5B A;  1D4X A;  3MWT A;  2F9W A;  3DLH A;  2HST A;  3V1O A;  5JVG L;  3ULD A;  3CCS N;  1FJG K;  3QBX A;  1UA1 A;  4DQI A;  3ZLJ A;  1C0G A;  3OYE A;  3O9Q A;  3AVG A;  4KH6 A;  3LAL A;  4E89 A;  3SV3 A;  3OHR A;  3ZSX A;  1SZ2 A;  4HUG A;  2KQ2 A;  5CYQ A;  1A5V A;  4E7H A;  3OS2 A;  4CF1 A;  2ZJP L;  1EQY A;  3H46 O;  5AZI A;  2AA4 A;  2XHB A;  4R5P A;  3A0I X;  1XNR K;  4DR3 K;  3EKS A;  3V9X A;  4FWN A;  4RWT A;  4H0Y B;  2P5O A;  5EVZ A;  1O1W A;  1RGI A;  4EFH A;  1R0A A;  3L2Q A;  4CZJ A;  1BI4 A;  3C65 A;  4JLH A;  4FJI A;  4B3R K;  4DS5 A;  3J8A A;  3FFI A;  4IWV A;  2PY5 A;  1A5X A;  3SUN A;  3KK2 A;  5C10 A;  1W9H A;  2UUC K;  4MO5 A;  4O0I A;  4IKF A;  1YI2 N;  3KD1 E;  2FC0 A;  3K5M A;  4CIF A;  3OYI A;  1HKB A;  4FWL A;  2OZS A;  2O8C A;  5AFU A;  3O3G A;  3WXJ A;  5HRN A;  4K41 A;  2WUS A;  4CJP A;  4JI0 K;  3VGL A;  5FPE A;  4PHT X;  1JLE A;  4DQP A;  4J2D A;  4DTS A;  4JI4 K;  4BY9 C;  4DLG A;  1KD1 O;  2P9N B;  1LWE A;  3KIO A;  3MWP A;  4CJK A;  4M63 C;  1QZ6 A;  3HP6 A;  1VQ7 N;  3PLA A;  1FXX A;  4AHS A;  1BA1 A;  1YIJ N;  4FW2 A;  3VEY A;  4JAX A;  2G8I A;  1F21 A;  2P9L A;  4PKH A;  3ZX0 A;  4F9O A;  3EZ5 A;  1VQP N;  4GKK K;  4DV2 K;  3CFR A;  2NLX A;  1KFS A;  2E1Z A;  1J6Z A;  1WSG A;  2R7Y A;  2Q97 A;  3LZI A;  1TK5 A;  4A5B A;  3QNN A;  3VTH A;  3RR8 A;  3LDQ A;  2W6K A;  4CK3 A;  3ATV A;  3E66 A;  4BC5 A;  3HVT A;  1QTM A;  4DR2 K;  4HHT A;  1MDU B;  3DLK A;  5GIP A;  1TKZ A;  4EHU A;  3IDH A;  2ITG A;  1JLB A;  1SUQ A;  1HKG A;  2CGL A;  5AQW A;  4DU3 A;  3VQ9 A;  3WT0 A;  4DR4 K;  2F96 A;  2ZGZ A;  3FZH A;  3QEW A;  2E2N A;  1Q7Y O;  1BIS A;  4QS7 A;  4FWM A;  2A42 A;  3DM2 A;  4NO7 A;  2KTQ A;  3UB5 A;  3MX5 A;  3R6M A;  1RTJ A;  4KFB A;  1ASU A;  2YX6 A;  2HOE A;  2DFE A;  3VEV A;  4Z4H A;  4R79 A;  1FKP A;  2Y1J A;  3QET A;  4EHT A;  2HMI A;  4MDA A;  3WNE A;  3T1A A;  5E41 A;  3IMX A;  4CHZ A;  2FBV A;  2OPS A;  3VEN A;  1SAZ A;  3D2E B;  4YDU A;  1DTT A;  4RG8 A;  4JEP A;  3T3F A;  3AAP A;  3HL8 A;  2DFF A;  5E84 A;  2GEM A;  3M3Z A;  1TKD A;  4BRM A;  3TR8 A;  2VWK A;  1TL3 A;  3P4I A;  5IT9 O;  1E4F T;  1TK0 A;  4BRI A;  3KLE A;  1NKE A;  4H4O A;  4IFV A;  2YHX A;  1EO1 A;  2KKZ A;  4ELV A;  1ZBI A;  3DXK B;  5TKW A;  4IOX A;  3SI6 A;  5LJV A;  4YOY A;  3BEX A;  3MEG A;  1OVQ A;  4N56 A;  5KGW A;  5T7B A;  1C1C A;  2E5L K;  2QTD A;  2ZWH A;  3ISN C;  2V7Z A;  4GMJ B;  4DV4 K;  4ISG A;  3V9U A;  2OPR A;  3SUP A;  4CIE A;  2NRZ A;  4CEE A;  5AQG A;  4JRQ A;  3MEC A;  1HNV A;  1EXQ A;  2ETJ A;  5CYM A;  1NGI A;  3FGU A;  2XRI A;  2X6S A;  3DLE A;  3DWL A;  1X1P A;  1WSJ A;  1S9G A;  1GLJ O;  1VAZ A;  3EL2 A;  4XEI A;  4HCB A;  4OGE A;  4E3S A;  3O1W A;  1N5Y A;  3LDN A;  1JCF A;  3L0Q A;  3V4I A;  4OPH A;  2P9N A;  3TSP A;  3O4W A;  4RW4 A;  3SAF A;  3CXC M;  1CZA N;  4AF1 A;  1VSH A;  4BR0 A;  3ID6 A;  4MQ3 A;  1NJX A;  2PYL A;  1OH8 A;  1Z05 A;  1KLN A;  1U6Z A;  1IBM K;  1N32 K;  4MLH A;  1CXQ A;  4KO0 A;  4H8K A;  4C23 A;  4U67 L;  1JLF A;  3HM8 A;  4B9T A;  3LAN A;  2OZM A;  2YCH A;  4E1J A;  3H1V X;  4NB4 A;  1JJ2 M;  1U48 A;  5JS2 A;  3G4S N;  4KB1 A;  3AVL A;  3VA0 A;  2YJE A;  2OCE A;  2YNH A;  4DF8 A;  3NFA A;  1BA0 A;  4DSF A;  4CZK A;  3N4P A;  1N33 K;  1JXE A;  4BRO A;  3ULE B;  3AVM A;  5H1S Q;  1NGD A;  3JS6 A;  3M8R A;  4H0X B;  2KW4 A;  3AGK A;  5AQT A;  5HBM A;  3ZT4 A;  3CF5 L;  4G9Z A;  3FLC O;  2QKK A;  2FF6 A;  4CJS A;  3VA3 A;  1QQM A;  2HHQ A;  3NF7 A;  5FPN A;  3L2W A;  4KI4 A;  4OO1 J;  1RT3 A;  2FLO A;  2KHO A;  4CJ7 A;  4FWR A;  2ZQB A;  2VYP A;  3C6H A;  4Z0U A;  3HK2 A;  4PL8 A;  3QLH A;  4E0D A;  3OYM A;  3G71 N;  4K0K K;  4CHP A;  4YDU C;  1FW6 A;  3OW2 M;  4FM1 A;  1TAU A;  1T7P A;  4FSV A;  4JHD B;  4FVM A;  4ELU A;  4I9L A;  4B08 A;  2NRV A;  3NVM A;  1QQN A;  5BPL A;  1DT9 A;  4E1M A;  3IFR A;  5M1Q A;  1LWF A;  3D2E A;  4H4M A;  1QVG M;  2GTD A;  3G25 A;  4GV9 A;  1RTH A;  3RVC A;  4CF2 A;  2Q3S A;  3VQA A;  2NRR A;  1S1T A;  4CED A;  2IAJ A;  4KTZ A;  3TI0 A;  2BGG A;  4CGH A;  3SQ4 A;  1CZ9 A;  1D5A A;  3K57 A;  3PO5 A;  5FPD A;  1DLO A;  2W42 A;  4CHQ A;  1NM1 A;  1U2V B;  5C42 A;  4WYB A;  1BU6 O;  1WSH A;  4Z4G A;  3GDQ A;  4RW8 A;  3L3U A;  1P90 A;  4DFM A;  1C0F A;  3R1X A;  3NCI A;  3DRP A;  3DXK A;  1J5E K;  2NRT A;  1T6C A;  3QIN A;  4BWM A;  3H1Q A;  2V7Y A;  2D1K A;  4CJW A;  3ZSR A;  4DSI A;  2E6L A;  4CFA A;  1BO5 O;  4NLB A;  4FCY A;  3DXM B;  3WXL A;  3DLL L;  5AZJ B;  5M1N A;  1NGA A;  3VET A;  2W40 A;  3MMV A;  4DFP A;  2CH6 A;  4DV7 K;  2O4I A;  4DQS A;  3MCP A;  1SKS A;  2X6N A;  4LSL A;  3VQC A;  1SL0 A;  3W0L A;  4L3Q A;  4OKJ A;  4CER A;  3SUQ A;  3HP9 A;  4J2E A;  2YNF A;  5HOO A;  5HRP A;  3WUH A;  1KSP A;  4CI6 A;  1YUW A;  5KGX A;  4AHC A;  1Y64 A;  3Q7B A;  1T3V A;  2PFU A;  4AHT A;  2Q0R A;  1KQS M;  3PUF A;  3EN9 A;  4ILJ A;  4XH4 A;  2FXU A;  3ZCM A;  3CPW M;  4C8O A;  4E1N A;  3DMJ A;  1NGC A;  2QWP A;  5DM7 L;  5HRO A;  2ATQ A;  3E9O A;  2YKM A;  3I33 A;  3D2F B;  4CD3 A;  4LH5 A;  3S41 A;  1KVC A;  3A5N C;  4NLC A;  3CFP A;  3CPE A;  3U6F A;  4DB3 A;  3J7Y P;  5FLX O;  1JLC A;  4AHR A;  3OYL A;  1VQN N;  3MDQ A;  2BH1 A;  4QS8 A;  3CJB A;  3ULE A;  1A5W A;  1YHQ N;  4B1Z A;  4NCA A;  3VEZ A;  1D9F A;  5BR9 A;  3WEE B;  3OYN A;  4PWD A;  4E7I A;  4CVN E;  4O8K A;  4EAH D;  3VEW A;  4GV3 A;  1NU0 A;  4DTM A;  3ITH A;  3MN6 A;  2G8U A;  2WBN A;  2VQF K;  3J81 O;  4AQY K;  4CGG A;  3O80 A;  4F2R A;  3SMP A;  1G99 A;  1QE1 A;  3A5M C;  3IG1 A;  4B3S K;  3KLI A;  1KVB A;  4DTU A;  1ZBL A;  2HVH A;  1KRP A;  4BDZ A;  5JLH A;  4DTJ A;  5KPR A;  4I6M A;  4LFC K;  3SQ2 A;  4JI6 K;  1TL1 A;  4IZ9 A;  1G15 A;  3MAQ A;  2F7T A;  5C15 A;  1XC9 A;  4JKH A;  2HHX A;  3AO1 A;  4JHD A;  1YIT N;  1C0T A;  1NBW A;  1I94 K;  3HST B;  4A62 A;  3ZT2 A;  4IEI A;  5C24 A;  3TAE A;  2JGU A;  4FK2 A;  4Q5V A;  3R9P A;  4CJV A;  2QK9 A;  2EX3 A;  1HJO A;  1ASW A;  3CM5 A;  4PQU A;  1NGJ A;  2VWB A;  3AVI A;  3S3M A;  2YKN A;  3T1Y K;  2J4R A;  4ILH A;  2NRH A;  1S6Q A;  4KHN A;  4PUO A;  5DK5 A;  4FOE A;  4CZH A;  3L4Q A;  3QO9 A;  3EZW A;  3RMC A;  1RBR A;  3O9U A;  3MED A;  3TWH A;  1NGB A;  5DM6 L;  2GV9 A;  3ZYY X;  2D0O A;  5AQF A;  1J54 A;  2ASP A;  2HHT A;  3CCR N;  4LF9 K;  1ZC6 A;  4HUF A;  4FLV A;  3D45 A;  1S1U A;  3V9S A;  4JKF A;  3CHW A;  3LP0 A;  3VQ5 A;  1K6Y A;  2V52 B;  1VSL A;  2G8V A;  5FDL A;  3FZF A;  1X3N A;  3M1F A;  4FJ9 A;  3O9R A;  3E01 A;  2YNG A;  3SYZ A;  1GLE G;  1VQ8 N;  2B6A A;  3AVN A;  4B8C A;  3DXM A;  1IJJ A;  3ALY A;  5AZJ A;  3C6A A;  1BGX T;  2RHK A;  3P1G A;  4CEO A;  3MXI A;  2G8H A;  3T19 A;  4ISE A;  4IJN A;  3M8P A;  3ZSZ A;  3KHY A;  4H5T A;  4RTF D;  4GW6 A;  3QEP A;  3AO2 A;  3FZM A;  3QFP A;  4FZY A;  1Q82 O;  2YV0 X;  1HNW K;  3CJA A;  1K8A O;  1UA0 A;  1K73 O;  3VQ6 A;  3O1B A;  4E7J A;  4WQ5 A;  2VWJ A;  4W5T A;  1OH6 A;  1RDB A;  2O4G A;  3U3G A;  5I42 A;  4YOW A;  1ZXO A;  1X3M A;  3ATU A;  2PBD A;  4CZM A;  5LMU K;  3THX A;  5BN9 A;  2RPI A;  4B1W B;  4BRL A;  1T03 A;  4FJJ A;  4Q0B A;  4CFD A;  3C95 A;  3LP1 A;  3HOT A;  4DV1 K;  1S3X A;  3D2F A;  4NYF A;  1CLQ A;  4CW7 B;  1LW0 A;  1RTI A;  4FWP A;  4B3M K;  1RDA A;  2F8S A;  3VTI A;  3JXU A;  1OH5 A;  3VQ4 A;  3EY1 A;  3CJ1 A;  4JKD A;  1WUA A;  4XH1 A;  1X9J A;  4KV8 A;  4EIA A;  1NK4 A;  3ID8 A;  4M41 A;  1JL2 A;  3KKS A;  4LSN A;  3WEE A;  4BRP A;  4A5A A;  3OS1 A;  5AQZ A;  5B8H A;  4CFB A;  5FPM A;  3CJ7 A;  4CZE A;  3THW B;  4WFN L;  2P9S B;  4FL9 A;  1VSK A;  1ASV A;  1RT4 A;  4O0J A;  3QDK A;  2KZM A;  3J80 O;  1XMO K;  1V4T A;  1N36 K;  3K58 A;  5KTQ A;  1EWQ A;  1EX4 A;  2VG7 A;  1B9D A;  1D9D A;  4DTP A;  2FBX A;  1VQ5 N;  3CC7 N;  1OKJ A;  4A2B A;  3SMS A;  4FVU A;  4H0O A;  3I0R A;  3OTO K;  3CCJ N;  1NJY A;  5ADX H;  1BCM A;  1ZBU A;  3V1R A;  4BR5 A;  4BR7 A;  3PSF A;  4DTO A;  3J7A P;  2IDO A;  3R8E A;  4JK9 A;  3B8A X;  1M90 O;  3FFK B;  1Q18 A;  3BZK A;  4C1N K;  1BQN A;  4JI1 K;  4M3Z A;  3U9Z A;  2NZT A;  4CBW A;  4BGA A;  3A5L C;  3FR0 A;  1BG3 A;  1Z26 A;  2WOM A;  3QBW A;  3PX4 A;  1XHZ A;  3I8B A;  3HBT A;  5DMR A;  4I9Q A;  4AHU A;  1WB9 A;  3HSC A;  3F73 A;  1HYV A;  2Q0U A;  4FWO A;  1GLB G;  4OKK A;  1OH7 A;  3P38 A;  4DQ8 A;  4I7F A;  3OA9 A;  1J5O A;  2P1J A;  3TAP A;  1U45 A;  5AQI A;  2ZE2 A;  5KI6 A;  1RIL A;  1WSI A;  2BAN A;  3HM9 A;  3AVB A;  3VF4 A;  1KAZ A;  3LZJ A;  1XC3 A;  2NUB A;  4BE0 A;  5BRE A;  1MU2 A;  1NK9 A;  4BDP A;  1S1X A;  5EOY A;  1T44 A;  3O8M A;  3VQ7 A;  1HYS A;  1BWF O;  3KD5 E;  4BRN A;  3VMF B;  4WQ5 C;  4B9N A;  4UY8 O;  4ZTJ A;  3AY9 A;  3ZSY A;  4HVJ A;  4EP4 A;  3CI5 A;  3EE8 A;  4O55 A;  2B5J A;  3RWU A;  2E8A A;  1Q9X A;  5TKY A;  3U3Y A;  4BRQ A;  1U4B A;  1RDC A;  2DFH A;  4WF9 L;  2BUP A;  2QEX N;  2ZJR L;  2DPN A;  1BL3 A;  3UKU B;  3MN5 A;  3WXI A;  3RMD A;  3NVK A;  4NXM K;  2PAV A;  2ZF5 O;  3QES A;  3L4I A;  3CQY A;  3S3O A;  2D0B A;  1L3U A;  4Y1C A;  3CC2 N;  4B1X B;  3TSU A;  1KAX A;  3MXJ A;  4ILG B;  3ZT1 A;  2QA4 N;  1VQ9 N;  4WCE L;  3ZX2 A;  4J2B A;  4DSE A;  1LV5 A;  4DFJ A;  4FJL A;  4IO8 A;  2HBK A;  3MK6 A;  3TTC A;  2YHA A;  1C0M A;  3HO1 A;  4K42 A;  3VOV A;  3MN7 A;  3CJ9 A;  4LF8 K;  4Y0W A;  2WTU A;  1VRT A;  5I3U A;  1ATS A;  3VEO A;  4A59 A;  4AM6 A;  3I55 N;  3GE1 A;  4CJ3 A;  1NMD A;  4FJ5 A;  1S1W A;  4OPA A;  2E1Y A;  4FLT A;  4DQQ A;  2KZZ A;  1VQK N;  5CY4 A;  4ELT A;  4FK0 A;  3E1Y A;  5BRF A;  1YXQ A;  3CER A;  2FSN A;  3W3D A;  3A8Y A;  2HHU A;  3GBT A;  3CET A;  4DS4 A;  5AQM A;  1Q8I A;  2QXF A;  3DOL A;  4FLU A;  1QHT A;  1EP4 A;  3M8Q A;  3THW A;  2P9S A;  1NKB A;  4FK4 A;  2WFB A;  2E6M A;  2Z1I A;  3VGM A;  3VER A;  1SKR A;  4KH4 A;  1WSF A;  5I9E B;  3OY9 A;  3F9M A;  4CBU A;  1RT5 A;  3AAR A;  4H5W A;  3RRH A;  4BVO A;  4CJT A;  4LF7 K;  1UWB A;  2OYQ A;  3CC4 N;  3V1Q A;  3O6W A;  3H08 A;  1KTQ A;  3BUZ B;  4G1Q A;  2Q31 A;  3EO3 A;  5IWA K;  2QKB A;  1NK6 A;  1XMQ K;  4LF6 K;  2DY4 A;  1BIZ A;  2HHS A;  4ID5 A;  3OBW A;  2HBL A;  1BIU A;  1N8R O;  2XY6 A;  3DAW A;  3ZEU B;  4H5R A;  3SPZ A;  1HNI A;  4MDB A;  2HW3 A;  4JN4 A;  1VQ6 N;  5AQJ A;  5JS1 A;  3RSE B;  2DTU A;  2AJQ A;  4O4G A;  1R59 O;  3ENB A;  4CZF A;  3T7Z A;  1IKW A;  3MN9 A;  4YOU A;  4BC4 A;  4JS4 A;  2EWS A;  4CES A;  3NE6 A;  3BGR A;  3DLR A;  1LW2 A;  1NJZ A;  2EHG A;  4X64 K;  3P39 A;  4RW6 A;  4OKE A;  2XO7 A;  4PKI A;  3Q7C A;  4CJU A;  5AQY A;  3M8S A;  2I7N A;  3D6R A;  4B9S A;  2VGM A;  1BCO A;  4M3R A;  1P8Z A;  4BRE A;  3AGR A;  3OYJ A;  4MO4 A;  4AHV A;  1J9A A;  4BE1 A;  3L6Q A;  4H0V B;  4LY7 A;  3O9S A;  4IEE A;  3TTD A;  2FSK A;  5HRS A;  1S5J A;  3F9K A;  4BAC A;  3ZT0 A;  3NGZ A;  4BC3 A;  1W2B M;  3S9H A;  3CM6 A;  4KHW A;  4JI3 K;  4PL7 A;  2YHY A;  4LD0 A;  1WAF A;  4CD1 A;  3VEX A;  2G8F A;  2YHW A;  1NJW A;  4QAG A;  4DR6 K;  4B1Y B;  2NNW A;  1IBL K;  4L8R B;  1IH7 A;  2QWL A;  4BRD A;  5LL6 Z;  2YJF A;  3K5O A;  2P51 A;  3KLF A;  3SJJ A;  4FXD A;  5LMN K;  3UKU A;  4OLA A;  1TUU A;  4MFB A;  3D0P A;  5HL7 L;  3ASM A;  3TAG A;  5CR4 A;  1S72 N;  1YF5 L;  3R3L A;  3CIP A;  5J2P A;  1KC8 O;  2KFZ A;  1TVR A;  3K0S A;  4IOC L;  1DEJ A;  2JWL A;  3RTV A;  3BY5 A;  1QSS A;  4BRC A;  1KXP A;  3QB0 A;  1NK8 A;  4K8Z A;  3S3N A;  1HNZ K;  3VPZ A;  3P31 A;  3DJC A;  3H3O B;  1L3V A;  2GWJ A;  4YOT A;  3JYT A;  5AQP A;  3WXM B;  1VRU A;  5F2R A;  2X74 A;  5AQO A;  1DKG D;  4BR2 A;  1KFD A;  3QNO A;  3GL1 A;  4LC9 B;  3VQE A;  1RT2 A;  1S1V A;  4N41 A;  1VQM N;  4W5R A;  3LL3 A;  3WQT A;  3B6O A;  3T1H K;  1J53 A;  4N5S A;  3J7Z O;  4BQL A;  3L3V A;  4YOR A;  3OYC A;  1Q81 O;  3DOK A;  3TAF A;  1IBK K;  5CZ1 A;  5KRS A;  4NYN A;  4BR9 A;  4LFB K;  1LAW A;  2W6L A;  3AA5 X;  4O8U A;  3L2V A;  2B4J A;  2VQE K;  3O4Q A;  3VQP A;  4IG0 A;  4CEA A;  4DSL A;  1GLL O;  2QWO A;  3VGK A;  5C0Y A;  4Z4E A;  4FJN A;  1BQM A;  3NH1 A;  3CME N;  4HCC A;  4M3X A;  1WNS A;  1BOT O;  3G0Z A;  3IRX A;  2Z1G A;  3IKM A;  5JLF A;  1L3T A;  3SUO A;  1NOY A;  2Z1J A;  5ADX A;  3ZEU A;  4JKG B;  1YVN A;  3HI0 A;  1NNE A;  3L2U A;  4XIU A;  1RDD A;  3QEX A;  3RSE A;  3NF8 A;  5M1P A;  3NHG A;  1YTU A;  2QW9 A;  1GLA G;  4GNI A;  3WNF A;  4JI8 K;  3AO5 A;  5J2M A;  4JKA A;  2HF3 A;  1HUX A;  1SKW A;  1B92 A;  4DF4 A;  4GV6 A;  3EEQ A;  1W97 L;  4CEQ A;  3CJC A;  4BWJ A;  4HTU A;  5CHI A;  1SL1 A;  2XY7 A;  1VSM A;  4KRE A;  2HVI A;  1WLJ A;  4DR1 K;  4DSJ A;  1IKV A;  1H1V A;  4WFB L;  4CJQ A;  1X9S A;  2RF2 A;  2X78 A;  2LSN A;  4X65 K;  5M1K A;  1Y97 A;  1QQO A;  2IIR A;  2E2O A;  4W5N A;  1BI4 B;  3LPT A;  1JCG A;  4LF5 K;  1VSF A;  1NG9 A;  4C8L A;  4DSK A;  1YT3 A;  5M1O A;  5BPN A;  1W0H A;  2E20 A;  3L2R A;  1OVY A;  3RMA A;  3VQB A;  3SAG A;  2O8E B;  4CJF A;  1VHX A;  3MEE A;  3LPU A;  3KZB A;  4CK1 A;  3MXM A;  4FWK A;  1Q9Y A;  3IUC A;  4FLX A;  3LM9 A;  3PSI A;  3K2P A;  1ESV A;  3TAM A;  3HPG A;  4N47 A;  4B1U B;  5BN8 A;  3VN5 A;  4CE9 A;  3CCV N;  5AQR A;  4H5N A;  1C1A A;  4CFC A;  4KRF A;  1JLQ A;  4DMN A;  3LWL A;  1TK8 A;  1QZ5 A;  5AQL A;  5BPM A;  3O3H A; 
#chains in the Genus database with same CATH homology
 2W6L A;  3BY5 A;  3EEQ A;  2W6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...