3BY5A

Crystal structure of cobalamin biosynthesis protein chig from agrobacterium tumefaciens str. c58
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
VTVAGIGCRKGAASDAIIAAVRAAERAFGVTVDYLATAPLKADEAGLAEAAKGLSLSLEIVAQERLEAVAAETMTFSQASLDHSGSPSVSEAAALAAAGAGARLVAPRLVVGDVTVAIAMTSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalamin biosynthesis protein
publication title Crystal structure of cobalamin biosynthesis protein from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Biosynthetic protein
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 3by5A00
3BY5A 2W6LA 3EEQA 2W6KA
chains in the Genus database with same CATH superfamily
2YNGA 5KQ8A 2CGKA 4H5VA 3PX4A 1YAGA 3KD1E 5FPMA 3ZSZA 3OJSA 5BREA 3CCRN 3O3GA 1W2BM 4CJ4A 4DS5A 3BDPA 4FJLA 2QW9A 4BR5A 4FWRA 2OPSA 3R1XA 3Q7CA 4FLYA 1RCHA 1XI1A 4DTRA 4O55A 1QHAA 2YCHA 4M7XA 4I9LA 2G8WA 5I3UA 3V1RA 4CHNA 3GBTA 5AQZA 3DOKA 1KAYA 1EX4A 3R3LA 5D3GA 3P38A 3VEWA 4KHPK 3QEVA 2BH1A 4M7YA 2D5RA 1GLJO 2O8BA 3MWPA 4DTUA 1A5VA 1NGHA 3DXMA 1NNEA 1Z25A 4BG9A 3THWB 3VA3A 1LAWA 2Q36A 1HX1A 3OS1A 2DFHA 3OYIA 3OHRA 2B6AA 2ETJA 2GELA 4B9VA 2FLOA 3IUCA 4F2RA 3NGYA 4WFNL 2A1RA 3SAFA 5AQJA 1HNIA 3OW2M 4RCHA 4EP5A 3QETA 1ATRA 2FF6A 2Q97A 4N47A 3RMDA 2YHBA 4KB1A 3D0PA 1OVQA 1F21A 3SQ4A 3L4IA 4JKFA 3HP9A 1S5JA 3EZWA 5AQIA 5CYQA 2X6SA 2XO7A 5SZTA 4B3SK 3MDQA 3VN5A 3U3YA 3LPTA 1J5OA 3KWGA 3ZSWA 4AHCA 4JK9A 3TSQA 3F9MA 3I33A 2ZJRL 3T3FA 3V9XA 1N36K 3ATVA 1DTTA 5KPTA 3WNGA 3LWMA 4J2DA 4FVUA 4CZMA 1IV0A 3WNEA 2KLAA 1NK9A 5GAHP 3TWHA 2PBDA 3PO5A 4FXDA 4IFYA 2AJQA 1TUUA 4FOEA 3KK3A 3JS6A 4DLEA 4CZGA 1JLAA 3GL1A 1ZBFA 1IBMK 3TPQA 4JI4K 3HSTB 4BG8A 4FJJA 1ZXOA 2P9LB 2P9NA 4JKCA 4CFDA 4JHDB 3O3HA 3S3OA 1DEJA 3NBPA 1NK7A 4AHRA 5AQWA 4IFVA 3CCEN 5AQPA 3AVKA 1IG8A 4KTZA 3HXMA 3TU5A 3SUOA 4DV3K 2LSNA 3CCLN 4I9QA 4O0IA 1VQ9N 3OYLA 1JL2A 1RT1A 5AQMA 4CJVA 1HNVA 3NF7A 1IBKK 4J2EA 1MDUB 1OH8A 3SBGA 5AQNA 1ASWA 3ITHA 4W5TA 3MX5A 2V7YA 3MN6A 4B3RK 3KLGA 2PZSA 4FOIA 1K6YA 3L2WA 3LDSA 4CCHA 1MU2A 3S3NA 3DJCA 4DG1A 3CFPA 3SAGA 3QESA 2YV0X 4XH4A 4J2BA 3TANA 4H5NA 4BY9C 2HVIA 4M3RA 1RGIA 2ZWHA 2HBMA 3VF2A 4MO4A 5CY4A 5KRSA 4CD1A 3E9PA 5KQDA 2Z1JA 2QKKA 1BIUA 3HK2A 1VSKA 5AQSA 4Y1CA 4TSXA 2RPIA 1JL1A 4Z4HA 3O4WA 1W0HA 3AVLA 3P39A 3CCQN 2KQ2A 3ZETA 4WFAL 3OYHA 1TVRA 4KI6A 2Y1JA 4CEEA 3D6RA 4DB3A 1QHTA 1RNHA 3LP0A 3OYNA 3M1FA 4HVJA 3VGMA 1XHXA 4DR7K 4JKGA 4FJXA 3MECA 4CJLA 4MLHA 2YX6A 4CJ7A 3HZ6A 4KFBA 1DGKN 4B9SA 1N8RO 5M1PA 3KLHA 1WSIA 1RFQA 2ZM6K 4FJ8A 4A59A 4CEZA 4H0PA 1TKTA 1GLLO 3RTVA 4C8LA 5C24A 4KI4A 1GOAA 3CHWA 1QSSA 3HPHA 1RT3A 4DLGA 1TYQA 2FSJA 3FZLA 5I9EB 5AZJB 3A5LC 4X65K 1YVNA 3I55N 1FKPA 2JLEA 1KVAA 1VQPN 3MXMA 3BGRA 1K8KA 4RG8A 1RT4A 3T1YK 3HTVA 4WCEL 4CFAA 4WFBL 4JNEA 4C8KA 5B8HA 4R5PA 2E2NA 2HBLA 3QIOA 3JXUA 4DTOA 1B92A 2D0BA 4CI6A 3QFUA 3SQ1A 4JKDA 2ASOA 2IAJA 2A5XA 3UKUA 3C6UA 3AVNA 3MX2A 4AF1A 1V4TA 1TGOA 4H5TA 3SPZA 1T3VA 3HM9A 1R0AA 3ZSVA 1K9MO 3LDLA 4C1NI 1L3UA 1RT2A 3K9JA 3OYEA 1SL1A 3ENHA 5AFUA 3NCIA 4JI5K 1SKWA 4EHUA 3M8QA 1Z26A 4BE1A 3VQDA 5LJVA 1HLUA 3NF9A 1KAZA 3S9HA 4EAHD 4E19A 1YXQA 4RW9A 1OH5A 2W40A 4M41A 4JRPA 4JI0K 4KHWA 1X9SA 4DU3A 1GLBG 4I2QA 4CZEA 3ATUA 4BACA 3H46O 3DRRA 1QS4A 3VERA 1L3VA 2FSNA 4GMJB 4CJEA 2E88A 1XMQK 3K5MA 2QWLA 2DY4A 4XEIA 1LWCA 3SK3A 3F2KA 4OPJA 2V7ZA 1JLGA 1JLFA 3D2FB 2FF3B 1TKDA 1Z6RA 3TR8A 1IJJA 4CD3A 3LWLA 1IKVA 4A61A 3CM6A 2O8EA 2HMIA 5AQQA 4DR3K 2HBKA 1BCOA 4ILJA 4KHQA 4JKBA 2IVPA 1T8EA 3WXMB 4CFCA 3NFAA 4U67L 2D4WA 3SYZA 3UE5A 2BGGA 3IKMA 3FFIA 3EN9A 1S22A 3GDQA 4H0YB 4CK1A 1NJWA 3A5MC 4FLUA 2NRWA 3M8SA 4JS4A 1K73O 3IS9A 4K8XA 4ID5A 4QAGA 4W5OA 1RBRA 2DPNA 3OYDA 2UXCK 2UUCK 2G8KA 3LP2A 5LJWA 3CJ1A 3RRGA 3WNFA 3ZT4A 1J9AA 4N56A 3VEZA 1HYZA 5FRMA 4Z94A 4W5QA 1S1XA 2F96A 4GY2B 3HO1A 2UYTA 4J2AA 2ATQA 3P4IA 1NJZA 2KTQA 1NGGA 1T7PA 4YOWA 4KRFA 2YHWA 4CF9A 4BDZA 1BG3A 4I6MB 4E7LA 4CGIA 4IOCL 4CZLA 4WQ5A 4JAXA 1KVBA 3VESA 4JI3K 3LDPA 1GOBA 4OPKA 5CZ1A 4FZYA 1JLQA 3O9SA 3N4PA 4F9OA 3G25A 4FPAA 4FW1A 2HNZA 3B6OA 4CHOA 3QBXA 1CXQA 2GWKA 2E6LA 3QLHA 4QCLA 1RDCA 2Y1IA 4CZHA 4CE9A 5AQTA 1DLOA 1LV5A 4FK4A 2P9PB 5EY4A 3L2VA 4CJPA 2JWLA 5IT9O 2F8SA 4B9TA 1L3TA 4W5RA 2A3ZA 3ID6A 2CGLA 5AJ3K 2E1YA 3QB0A 1C0FA 2QWMA 3U4LA 4HUGA 2QA4N 3EE8A 3D2EB 4CBWA 1S6PA 1W9HA 5SWMA 1VSMA 3THXA 1ZBIA 4BDPA 3WXJA 2HB5A 1NKCA 1YF5L 1HPZA 1RBTA 5TKWA 2E2QA 4PHTX 1P8ZA 3ENOA 4YDUC 2IC3A 3VENA 3DLLL 4FLWA 3P1GA 2VWBA 4GW6A 2V52B 3I0RA 1RDBA 1Q81O 3S41A 3BF1A 2V51B 1HKCA 4FWQA 1VQ5N 5AQGA 4BE0A 4ZTJA 4ELUA 3QNNA 3V4IA 2BDPA 1CLQA 1Q82O 4FJHA 1VSJA 4OPAA 1RBVA 3R8EA 4AHSA 1SKRA 4GVMA 4DCHA 4EP4A 1HPMA 1J53A 1WSEA 2IVOA 5HRSA 3I56N 1NLVA 1C0GA 2Z1HA 5CR4A 4CEAA 1RTHA 1LWEA 3BEXA 4CVNE 1VSEA 4CK2A 1NJYA 3NE6A 3AVJA 5J2QA 3CPEA 4H0OA 2QWOA 4B9QA 2OCEA 3ULEA 4B9UA 4HCCA 1HJRA 1TUYA 4I6MA 2KHOA 1NMDA 3AA4A 4RW4A 3VF4A 3HT3A 1WBDA 2O8BB 3V9SA 3CPWM 4DFMA 4CGHA 1HNXK 3DXMB 2PY5A 2HHXA 4BRFA 3CMEN 1NOZA 4H0VB 1C0TA 1RDDA 1WUAA 4BC5A 5JVHL 3LZJA 4WQ4A 3SI6A 5AQRA 4FLZA 2FC0A 3U8XA 4ELTA 4DQIA 4B1YB 4IBNA 4CJKA 1IO2A 4EIAA 4AQYK 1HNWK 1X9WA 3VGLA 2RHKA 3R9PA 2YJEA 4EZ6A 1ATNA 3CM5A 1I39A 3CJ9A 1FKOA 2Q31A 2FXUA 1S1VA 1CZ9A 4FWKA 3HOSA 4E1MA 1BISA 1KRPA 1U48A 3KJVA 1QVGM 3RWUA 2D0PA 1VRTA 4CZJA 3TSUA 4O0JA 2NNWA 5BRDA 1P90A 1S1WA 4YNQA 1KC8O 1Q8IA 3C0BA 2QXFA 3K9KA 4XIUA 3K5NA 4IG3A 3KZBA 4IWVA 3Q7BA 2NZTA 3ZT1A 3TAMA 2A6AA 3DXKA 4ILGB 3MN9A 4CGFA 4BRHA 2D0OA 3JYTA 3THYA 1GLEG 3SPYA 3C7NB 4WYBA 5LL6Z 3WXLA 4G1QA 4BVPA 4M3UA 2P9NB 3VTHA 1U47A 4EHTA 4DV1K 4PY5A 4E89A 3CQ8A 4Q5VA 3PIOL 4M3WA 1MWKA 2OA8A 1VAZA 1CZBA 1UOCA 3M5RA 4JI8K 1O13A 2UXDK 1OKJA 4KKOA 4OKJA 1NU0A 4KPYA 4NB4A 1V4SA 4RTFD 3S3MA 4BROA 2IGIA 4CEFA 3AO1A 3EO3A 2O8CB 1L3SA 5FDLA 5EVZA 5DMRA 3SJHA 5HRRA 1YI2N 5AR0A 2YJFA 1RTJA 4YOVA 4F3TA 5FPNA 3I0SA 1SZ2A 1KCFA 1HNZK 3A2FA 2ZF5O 3HSCA 2ZQBA 4CIGA 1M1KO 3VQAA 4PUOA 4BR0A 1NGBA 2DFFA 4K25A 3CC2N 3AVBA 3G6EN 2X6NA 1TL3A 2UXBK 1Y64A 3IDHA 3OYKA 2P5OA 5JLFA 4HTLA 4NYFA 3WQUA 3RMAA 1HQUA 3FE1A 4ZHRA 5DM7L 4BRQA 5AZIA 3CCUN 3CFOA 3ULDA 1U4BA 1QSYA 3CJ7A 3M3ZA 4FWNA 3OTOK 5DM6L 3ZETB 5M1FA 3HPGA 2KW4A 1WB9A 4H0XB 4GKJK 3FLCO 5HLFA 3K0SA 2W6LA 4JKGB 4FVMA 4HTUA 3H08A 1NK0A 4DR6K 4IJNA 1RBUA 4DSJA 2Q1NA 1Q9YA 1NG9A 4B1VA 3CCSN 1BWFO 1VQ8N 2IS3A 3J80O 1NGEA 1N33K 1GLFO 3MAQA 3VQ9A 4DSLA 1ZBUA 1RILA 4Q0BA 3A8YA 3VQ5A 3T1HK 1NKBA 3C7NA 1TYQB 4OVLA 3CCVN 4IXCA 2P5GA 3NMUA 4LF8K 3T7ZA 5HL7L 3MEDA 3L2UA 1K8KB 5C12A 4DUYK 2Q3SA 4YFUA 3QEIA 4FWOA 2EHGA 1YUWA 3TAEA 3DLRA 2RN2A 1ZBHA 5C2DA 3UKUB 2E20A 3O4NA 3DM2A 3ZLJA 3TABA 2QEXN 2YKMA 4OKEA 4GNIA 4YOYA 2RKIA 4CJWA 2O8CA 4LF6K 3WT0A 3VQ4A 3H1QA 1RDAA 3ZSRA 2VYPA 5FRNA 5BN8A 2FBVA 2O4GA 1BIZA 4DU4A 2IIRA 1ZC6A 3HL8A 4KTQA 1LW0A 4K43A 4CW7B 1HR0K 3KTQA 1O1WA 3O4QA 3R6MA 3OBWA 4M63C 1KQSM 4R79A 1YIJN 2NUBA 2NLXA 1XUPO 4JLHA 4PKIA 5AQHA 3VETA 1D5AA 4A2BA 3H6EA 3CETA 3KK7A 3OY9A 2GUPA 3SBTA 4BC4A 1S1TA 5GINA 1IKWA 2E8AA 4DV0K 2O8FA 2FBYA 2A42A 4JI6K 1C1CA 4CJSA 3ZX0A 2VWJA 5JMVA 3P31A 1IKYA 4E1NA 2O8EB 3KD5E 2XY5A 1ATSA 3BF3A 2KZMA 3G10A 5C15A 1TK0A 3ZYYX 2WTUA 1NGFA 4A57A 4FO0A 4K42A 2Q0UA 3CMAN 4DKWA 4Y1DA 3PY8A 4FJ5A 3TAFA 4NCGA 2Z1GA 1BA0A 1DTQA 3OYCA 4YOUA 1TAQA 2ZE2A 3NH0A 2XY6A 2OPRA 1XC9A 1KVCA 1QQNA 4IEIA 3SJJA 1Q9XA 3CQYA 3MCAB 3NDKA 1YT3A 2Q0RA 3O5BA 4LF9K 3JAMO 1EXQA 4JI1K 4DSFA 1Q18A 1QVFM 3ZSQA 1S72N 2E1ZA 3LZIA 5EOYA 4KHUA 2QWPA 3AVGA 1QZ6A 5BR8K 3L2QA 4YOXA 2VG7A 2P9KA 2O4IA 2GBZA 4B1UB 1D4XA 2HVHA 3ALYA 3TAQA 1J6ZA 3BZCA 1IKXA 1BQMA 1ZYQA 5LMUK 4BREA 4GV9A 1VSHA 3FR0A 1SAZA 1REVA 3V9UA 3O8MA 4KHSA 4LH4A 4M42A 3PSFA 3NAEA 2ASPA 3L6QA 2I5JA 4Z4GA 3AAQA 2XY7A 5J2PA 5FROA 3MCPA 3VF6A 2HHQA 1KLMA 5E84A 4BRGA 3AA2A 4QS9A 3C6AA 4CEDA 3K5OA 1WSFA 3T1AA 4I7FA 3AGKA 3RRHA 3C65A 1NKEA 4H8KA 4CBXA 4QS7A 3DRPA 4IG0A 4LC9B 3EYZA 4MFBA 4DR5K 2FBXA 4CF2A 1BDGA 4GV3A 4DQ8A 2G8UA 3C94A 4OLBA 3THXB 3TI0A 2F4VK 2CH6A 3GG4A 1KFSA 4JEPA 1T6CA 3OYAA 3P5JA 1S3XA 3I8DA 4DQSA 4RW6A 2QWRA 2Q2RA 4BGBA 2OPQA 1D9DA 3IFRA 3SLCA 5EU7A 1NGDA 1XC3A 5C0YA 2D0CA 2P1JA 2P9SA 4BRPA 4LH5A 3L2RA 4ISEA 4N41A 3L3VA 3AY9A 1Q86O 4FSVA 3WXIA 3QEWA 5AQFA 1RTIA 2VG6A 3PSIA 3NF8A 4OPHA 3SV3A 4BQLA 3GE1A 1HYVA 2KFZA 3LP1A 1BOTO 1QQOA 1S1UA 3BZKA 2W6KA 5AQOA 5GADP 3F9KA 3RR8A 4OKKA 3U9DA 4NLBA 4A62A 3ISNC 4M3YA 4KAZA 3VQQA 1ZBLA 2VCPA 3OYJA 1WLJA 1WNSA 4BRAA 3ZSXA 2OTLN 3BP8A 2HMPA 4HWIA 2RF2A 3DI6A 4F4KA 2PFUA 4FW2A 5I42A 3UB5A 3ULEB 4B3OA 4WQ5C 1FXXA 3N4QA 4LF4K 3FZKA 2OZSA 5FPDA 4PKGA 1M90O 4CEBA 4CJTA 2UUBK 4L8RB 5T7BA 1RDUA 3AVIA 4O8KA 4FPBA 5GAGP 4YHHK 4HUEA 5F1XA 1JXBA 3H1VX 4V19S 4BE2A 1YHQN 3DLEA 1DT9A 2PAVA 2X74A 1GOCA 4CHYA 3IG1A 4H4MA 3E9LA 5GIOA 2QI2A 4CBUA 4CHZA 5C2FA 4KH5A 2F7TA 3HVRA 2PYJA 4JI7K 3WEEA 5KPRA 2OZMA 2WBNA 4CF0A 4HHTA 3HRGA 4AILC 3CC4N 1ITGA 1VSLA 4FM2A 4F2SA 4CF8A 4B8AB 4B9NA 4PL8A 5H1SQ 1TK5A 2I7PA 1KAXA 1YJ9N 5F0XA 4Z0UA 4WF9L 3L0QA 3OS2A 3KHYA 3A0IX 4DTJA 2UUAK 2B4JA 3EEQA 4KREA 1ASVA 1NGIA 3DXKB 4L3QA 4BRMA 1RDWX 2GWJA 2QTDA 3THYB 1A5XA 1KXPA 1LAVA 5M1KA 2D1KA 3CCJN 1FJGK 1GLCG 3KK1A 3AO4A 3NF6A 4YDUA 5CYMA 3UKRA 2HNYA 4JD2B 4JK7A 5TKYA 3FZMA 2BE2A 4BRIA 4DR4K 3CERA 5K14A 3CXCM 1X9MA 4LFBK 3SUQA 2O8DA 4BVOA 4OGCA 2P9IA 3QERA 4MO5A 1VQKN 3PO4A 4MLEA 3LL3A 2J4RA 3ZEUA 1W97L 3CJCA 1OH7A 4FZXC 2OYQA 3LDOA 4IO8A 5AQXA 2P51A 1W7AA 3U3GA 4O4GA 4ELVA 1NGAA 2ZGYA 4A5AA 1N6QA 3TTFA 4WQ4C 3F73A 1UA0A 5ADXH 3OYMA 3LPUA 2QWQA 3VEXA 3W0LA 2IOCA 3V9WA 4UY8O 4XH5A 2BANA 1LOTB 3CC7N 3OYFA 3QIPA 4CJQA 4M45A 1TV6A 3K2PA 5AZIB 3K58A 4PL7A 3ZSOA 3THVA 5IWAK 4CJ5A 3VMFB 3V9ZA 3AVFA 1T05A 3BY5A 1JLCA 4DFPA 3B8AX 3JSMA 3I8BA 1HMVA 1NJXA 3IAYA 4MQ3A 5M1OA 3KLEA 4DR1K 3A5NC 3KLIA 1C6VA 1RBSA 1MA9B 2HHVA 2ZD1A 1YTUA 3T19A 4AH9A 2W42A 4KB0A 2G8FA 4B3MK 4E1JA 4BR7A 3P83D 5FPEA 3VQEA 3OS0A 1Y97A 3CIPA 1XWLA 4C8OA 4E0DA 4IDKA 3UIQA 3HBTA 1G99A 2E2PA 4DV5K 2VGMA 1NK5A 2E6MA 5HOOA 1MWMA 4CGJA 2HHHK 4LY7A 4X64K 4OGEA 1NK4A 4GV6A 4JD2A 1EWRA 4JKEA 5KGXA 2P9UA 3ZX2A 3V6DA 2A40A 2G8VA 2F8TA 3QDKA 2HSTA 3MK6A 2NRXA 3SUPA 1XNQK 5BRFA 2R7YA 1ASUA 3SNNA 5J2NA 1EETA 3AV9A 4ID1A 4OO1J 3G4SN 4K8ZA 3HM8A 2WC9A 4JRQA 3VQ7A 4A2AA 2A41A 2WONA 3DOLA 2HF4A 3MN7A 3MMVA 5JICA 1SL0A 2HHWA 1T03A 3MN5A 5HP1A 1Q7YO 3SQ0A 2NRRA 3CYMA 1JXEA 3MEGA 4O5BA 3KLFA 1E3MA 4B9LA 2Z1IA 2ITGA 1K8AO 1YTAA 2NRZA 4B1ZA 3KWIA 1C0UA 5ELZA 4FWSA 3AA5X 1X9JA 4BWJA 2XY8A 5AQVA 3KK2A 3ENBA 2G8IA 5AQKA 4DTNA 1J5EK 4O8UA 4U7BA 2HHTA 4DTMA 4PKHA 4A5BA 3OA9A 2KZZA 1VRUA 1IH7A 2O8FB 1JKHA 1TKZA 2ZGZA 1BQNA 4K0KK 3ZSYA 3DLGA 4IKFA 4J8FA 1RTDA 4F3OA 2HNDA 5M1NA 1NJIO 1D8YA 4B9MA 3VOVA 4B1WB 4ISGA 3DLBA 2OTJN 4DU1A 4E7JA 2I7NA 4KH6A 1SL2A 3EKSA 3HJFA 4FLTA 4DF4A 4FK2A 3T69A 4BR9A 3PX6A 3MXIA 4MDAA 4DFJA 1BHLA 3O3FA 1UA1A 4DV2K 1U6ZA 3FGUA 5HBMA 1BL3A 4E7IA 1IBLK 4FLVA 2HHSA 4X62K 4M3ZA 4KBOA 1KLNA 4AHVA 5J1EA 4HCBA 2P9KB 3O1WA 3RSEA 3L4QA 1S9GA 4CJUA 1TL1A 1NBWA 1EQYA 3O6WA 3E66A 3M8RA 1BA1A 1RT7A 1SKSA 4FLXA 3CQXA 4Z4EA 4DR2K 2EX3A 4C8NA 2UU9K 2KFNA 4KO0A 1YJNN 3VPZA 2BUPA 3J7YP 3KKRA 2QKBA 4LSNA 3CI5A 3DLHA 2DFEA 4NYNA 2YHYA 2E4LA 5E26A 4BR4A 3QO9A 3O9QA 3J7ZO 4KHNA 1HYSA 3SMPA 3DAWA 2WOMA 1NGJA 3VQ6A 3A5OC 1EO1A 2ITMA 1OH6A 3H3OB 3OYGA 2QXLA 3SMSA 4KH4A 1VQ6N 1BI4B 1UAXA 3SCXA 1L5UA 4Z4IA 4JN4A 3G0ZA 1NWKA 3VEOA 4ZTFA 3O9RA 2VQEK 2B5JA 1UWBA 3WXKA 4CESA 2IDOA 3M8PA 2OPPA 4FM1A 4NXMK 3FZFA 3VQPA 3ID8A 4EZ9A 1HJOA 3DWLA 3AVCA 4DWIA 3QICA 3SV4A 3V1OA 3QFPA 1X3NA 2VQFK 1KFDA 4BGAA 3ZCMA 4KHYA 1WAFA 4C23A 1VQON 3THWA 1VHXA 4CF1A 4JS5A 3CFRA 1KD1O 3TARA 3D45A 3QEXA 1J54A 3CCMN 4IOXA 2VWKA 3FZHA 1GLDG 1WAJA 3AVMA 4LF5K 2FSKA 4KTWA 4BRNA 3VQ8A 1WN7A 1BGXT 1WOQA 3SAHA 2D0AA 4K41A 4M3XA 4W5NA 2YHAA 2HF3A 2P9SB 2YNHA 2XRIA 5J2MA 1QTMA 5LY3A 4B1XB 4OLAA 4FJIA 5HRPA 4IZ9A 3HP6A 5JS1A 4H5RA 4IEEA 2ZJPL 4CGDA 5KTQA 3VGKA 3AO3A 3O9UA 4CJRA 4O44A 1G15A 4O5FA 1U45A 4IDHA 4CFBA 1I3AA 3AA3A 2HOEA 2JWKA 4FJ9A 1A5WA 2WUSA 1TK8A 5CE3A 1VQLN 2CGJA 2IVNA 2XHBA 4FL9A 1HKBA 2EWSA 4FWMA 5LMNK 2OANA 1VQ7N 2YNFA 1QSLA 3VTIA 4M3TA 4DSIA 4Z4FA 5E41A 3CJBA 1R59O 5GAEP 3CD6N 4CJFA 4DSKA 3TTDA 2AP1A 5KPZA 4DFKA 3PX0A 5KGWA 4AHTA 1SS6A 2KKZA 2P9LA 4Y0WA 4JHDA 3E1YA 3EL2A 4WE1A 3QNOA 3F5TA 1ILYA 5BPMA 1TAUA 1BI4A 1VSDA 1VQ4N 4Z4CA 3O80A 1H1VA 1OVYA 1IG9A 3KVGA 1CXUA 3LAMA 5BRHA 4DQPA 4DV4K 5MLCQ 5A2QO 1NOYA 1T6DA 4RW8A 3TAPA 3L3UA 4B08A 4B3TK 4PWDA 4CZIA 4PQUA 1T44A 1CZAN 3NVMA 1VSFA 3WEEB 4QOZB 3J81O 2ASMA 3E01A 1XMOK 3MWTA 3LANA 2HBJA 1EP4A 1LW2A 5BN9A 3PLAA 2ZJQL 1HRHA 4HUFA 4H5WA 4LFAK 3EY1A 4FJGA 5BPNA 3MEEA 3VEVA 1BO5O 1QQMA 1U2VB 3RVCA 4DTPA 1X3MA 4CZKA 5DK5A 4IOAL 4YY3K 4G9ZA 3G71N 1ZBSA 2YHXA 3SQ2A 1U49A 1BCMA 5C10A 3VEYA 1X1PA 3EE9A 1E4FT 3SZ2A 3AVHA 4E3SA 4OJRA 1YJWN 3O9TA 4N76A 1VK0A 3UKRB 1N34K 4OX9K 3NH2A 4FJNA 1DKGD 4FWLA 3NGIA 3AO2A 3E9OA 3V1QA 3VA0A 3U6FA 2F9TA 4LD0A 5ADXA 4H03B 1I94K 1HKGA 1HQEA 5CZ2A 5KRTA 5KI6A 4PA1A 4QS8A 5C25A 4JYAK 3QMLA 2O8DB 3O08A 3NGZA 2P9IB 1JCGA 3VQCA 4N5SA 3ZEUB 3K57A 4CK3A 3ZX3A 3KIOA 5AZJA 2CH5A 1WSGA 1HUXA 1VQNN 1TKXA 3QBWA 3DLKA 4CECA 2FBTA 5AQLA 4H0TB 3FFKB 3CF5L 5GIPA 4IO9L 1RT6A 4AM7A 1D9FA 4DMNA 4BC2A 4GKKK 1KSPA 4ILHA 5HRNA 1B9DA 4FM0A 4NCAA 1YVUA 1EKEA 3HVTA 3LDQA 4XH1A 3HOTA 4B8CA 4AM6A 4GVEA 2NRTA 3H45C 4CIEA 4RWTA 3OBYA 1LCUA 3PIPL 4DS4A 1KTQA 3DMJA 3AO5A 4CIFA 2QWNA 4JKAA 3CJAA 3K5LA 4X66K 1XQSC 2AA4A 4F8RA 3K59A 3RMBA 3J7AP 4NO7A 4KV8A 1XNRK 1S6QA 4DV6K 4E7KA 3AGRA 4LSLA 1RT5A 3GOIA 3IMXA 5FLXO 3RR7A 3L8BA 3LALA 1VSIA 3WQTA 4FJ7A 3RMCA 2YNIA 1U2VA 3B6PA 1WBBA 2F9WA 1N32K 3D2FA 4C8MA 1NGCA 3AVAA 3PUFA 5AFUH 4ICLA 1C1AA 2GV9A 3NH1A 2QK9A 3EKUA 3LP3A 4EFHA 4DSEA 3NVKA 1BU6O 3AARA 4FZZA 3TSPA 4NXNK 4UQGA 3BUZB 2E5LK 1C1BA 3MXJA 3EZ5A 1SQKA 2HHUA 1NMNA 2NRVA 1U04A 2WFBA 4FCYA 2HW3A 2GTDA 3AAPA 5F2RA 4E7HA 1C0MA 3TAGA 3M6GA 2P9UB 3OJUA 1VQMN 5BPLA 2JGUA 1YITN 5AQUA 4CEQA 4MDBA 4IFEA 4DTSA 2VG5A 2GEMA 4DTXA 2A1SA 5BR9A 4I2PA 2X78A 3ZT2A 3LAKA 1EWQA 4BR2A 3U9ZA 5HROA 4LF7K 4LFCK 3KKSA 4ISFA 4JK8A 1WSJA 3C6HA 5EX5A 3ZT3A 1S9EA 3C6TA 3QEPA 3ASMA 4YORA 3HPOA 4CJ3A 3NHGA 5JS2A 4CHQA 4BRDA 4CZFA 1B9FA 4BC3A 5M1QA 2H3GX 3HYFA 2QM1A 1JCEA 4DQQA 1BUPA 1Z05A 4NLCA 3DYAA 3V81A 5EXWA 3TTCA 2PYLA 4IJAA 2GUIA 1QZ5A 1JJ2M 1SV5A 3SUNA 4FJMA 3HI0A 3PV8A 1NK8A 4BRKA 3WNHA 5JVGL 2YI1A 3OVNA 2BTFA 1QQCA 3OYBA 5JLHA 3D7EO 3CG7A 4DQRA 1LWFA 1NM1A 4CGGA 3ZT0A 4DUZK 4AHUA 2G8HA 4CERA 2P9PA 4C1NK 4BDYA 3QINA 3LDNA 4JKHA 5C42A 1ESVA 2VGNA 2NRHA 4BRCA 4DF8A 1NK6A 4FYDA 5AQYA 3DRSA 5CHIA 3WUHA 4NCBA 3D2EA 4FK0A 4JV5K 3H3NO 4BQZA 1JLEA 3C95A 4FJKA 3W3DA 3J8AA 1XHZA 1FK9A 4JI2K 1FW6A 4H4OA 2GX9A 2YKNA 3IRXA 1N5YA 3LM9A 4FWPA 4CEOA 4CHPA 3LM2A 3RSEB 4DV7K 3O1BA 1JLBA 3VQBA 1E4GT 4BWMA 1JCFA 2W41A 2E2OA 1QE1A 4RW7A 2RE2A 4BRLA 2DTUA 1GLAG 1SUQA 4DHYA 4YOTA 1WSHA
chains in the Genus database with same CATH topology
3BY5A 2W6LA 3EEQA 2W6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY5 A;  2W6L A;  3EEQ A;  2W6K A; 
#chains in the Genus database with same CATH topology
 2YNG A;  5KQ8 A;  2CGK A;  4H5V A;  3PX4 A;  1YAG A;  3KD1 E;  5FPM A;  3ZSZ A;  3OJS A;  5BRE A;  3CCR N;  3O3G A;  1W2B M;  4CJ4 A;  4DS5 A;  3BDP A;  4FJL A;  2QW9 A;  4BR5 A;  4FWR A;  2OPS A;  3R1X A;  3Q7C A;  4FLY A;  1RCH A;  1XI1 A;  4DTR A;  4O55 A;  1QHA A;  2YCH A;  4M7X A;  4I9L A;  2G8W A;  5I3U A;  3V1R A;  4CHN A;  3GBT A;  5AQZ A;  3DOK A;  1KAY A;  1EX4 A;  3R3L A;  5D3G A;  3P38 A;  3VEW A;  4KHP K;  3QEV A;  2BH1 A;  4M7Y A;  2D5R A;  1GLJ O;  2O8B A;  3MWP A;  4DTU A;  1A5V A;  1NGH A;  3DXM A;  1NNE A;  1Z25 A;  4BG9 A;  3THW B;  3VA3 A;  1LAW A;  2Q36 A;  1HX1 A;  3OS1 A;  2DFH A;  3OYI A;  3OHR A;  2B6A A;  2ETJ A;  2GEL A;  4B9V A;  2FLO A;  3IUC A;  4F2R A;  3NGY A;  4WFN L;  2A1R A;  3SAF A;  5AQJ A;  1HNI A;  3OW2 M;  4RCH A;  4EP5 A;  3QET A;  1ATR A;  2FF6 A;  2Q97 A;  4N47 A;  3RMD A;  2YHB A;  4KB1 A;  3D0P A;  1OVQ A;  1F21 A;  3SQ4 A;  3L4I A;  4JKF A;  3HP9 A;  1S5J A;  3EZW A;  5AQI A;  5CYQ A;  2X6S A;  2XO7 A;  5SZT A;  4B3S K;  3MDQ A;  3VN5 A;  3U3Y A;  3LPT A;  1J5O A;  3KWG A;  3ZSW A;  4AHC A;  4JK9 A;  3TSQ A;  3F9M A;  3I33 A;  2ZJR L;  3T3F A;  3V9X A;  1N36 K;  3ATV A;  1DTT A;  5KPT A;  3WNG A;  3LWM A;  4J2D A;  4FVU A;  4CZM A;  1IV0 A;  3WNE A;  2KLA A;  1NK9 A;  5GAH P;  3TWH A;  2PBD A;  3PO5 A;  4FXD A;  4IFY A;  2AJQ A;  1TUU A;  4FOE A;  3KK3 A;  3JS6 A;  4DLE A;  4CZG A;  1JLA A;  3GL1 A;  1ZBF A;  1IBM K;  3TPQ A;  4JI4 K;  3HST B;  4BG8 A;  4FJJ A;  1ZXO A;  2P9L B;  2P9N A;  4JKC A;  4CFD A;  4JHD B;  3O3H A;  3S3O A;  1DEJ A;  3NBP A;  1NK7 A;  4AHR A;  5AQW A;  4IFV A;  3CCE N;  5AQP A;  3AVK A;  1IG8 A;  4KTZ A;  3HXM A;  3TU5 A;  3SUO A;  4DV3 K;  2LSN A;  3CCL N;  4I9Q A;  4O0I A;  1VQ9 N;  3OYL A;  1JL2 A;  1RT1 A;  5AQM A;  4CJV A;  1HNV A;  3NF7 A;  1IBK K;  4J2E A;  1MDU B;  1OH8 A;  3SBG A;  5AQN A;  1ASW A;  3ITH A;  4W5T A;  3MX5 A;  2V7Y A;  3MN6 A;  4B3R K;  3KLG A;  2PZS A;  4FOI A;  1K6Y A;  3L2W A;  3LDS A;  4CCH A;  1MU2 A;  3S3N A;  3DJC A;  4DG1 A;  3CFP A;  3SAG A;  3QES A;  2YV0 X;  4XH4 A;  4J2B A;  3TAN A;  4H5N A;  4BY9 C;  2HVI A;  4M3R A;  1RGI A;  2ZWH A;  2HBM A;  3VF2 A;  4MO4 A;  5CY4 A;  5KRS A;  4CD1 A;  3E9P A;  5KQD A;  2Z1J A;  2QKK A;  1BIU A;  3HK2 A;  1VSK A;  5AQS A;  4Y1C A;  4TSX A;  2RPI A;  1JL1 A;  4Z4H A;  3O4W A;  1W0H A;  3AVL A;  3P39 A;  3CCQ N;  2KQ2 A;  3ZET A;  4WFA L;  3OYH A;  1TVR A;  4KI6 A;  2Y1J A;  4CEE A;  3D6R A;  4DB3 A;  1QHT A;  1RNH A;  3LP0 A;  3OYN A;  3M1F A;  4HVJ A;  3VGM A;  1XHX A;  4DR7 K;  4JKG A;  4FJX A;  3MEC A;  4CJL A;  4MLH A;  2YX6 A;  4CJ7 A;  3HZ6 A;  4KFB A;  1DGK N;  4B9S A;  1N8R O;  5M1P A;  3KLH A;  1WSI A;  1RFQ A;  2ZM6 K;  4FJ8 A;  4A59 A;  4CEZ A;  4H0P A;  1TKT A;  1GLL O;  3RTV A;  4C8L A;  5C24 A;  4KI4 A;  1GOA A;  3CHW A;  1QSS A;  3HPH A;  1RT3 A;  4DLG A;  1TYQ A;  2FSJ A;  3FZL A;  5I9E B;  5AZJ B;  3A5L C;  4X65 K;  1YVN A;  3I55 N;  1FKP A;  2JLE A;  1KVA A;  1VQP N;  3MXM A;  3BGR A;  1K8K A;  4RG8 A;  1RT4 A;  3T1Y K;  3HTV A;  4WCE L;  4CFA A;  4WFB L;  4JNE A;  4C8K A;  5B8H A;  4R5P A;  2E2N A;  2HBL A;  3QIO A;  3JXU A;  4DTO A;  1B92 A;  2D0B A;  4CI6 A;  3QFU A;  3SQ1 A;  4JKD A;  2ASO A;  2IAJ A;  2A5X A;  3UKU A;  3C6U A;  3AVN A;  3MX2 A;  4AF1 A;  1V4T A;  1TGO A;  4H5T A;  3SPZ A;  1T3V A;  3HM9 A;  1R0A A;  3ZSV A;  1K9M O;  3LDL A;  4C1N I;  1L3U A;  1RT2 A;  3K9J A;  3OYE A;  1SL1 A;  3ENH A;  5AFU A;  3NCI A;  4JI5 K;  1SKW A;  4EHU A;  3M8Q A;  1Z26 A;  4BE1 A;  3VQD A;  5LJV A;  1HLU A;  3NF9 A;  1KAZ A;  3S9H A;  4EAH D;  4E19 A;  1YXQ A;  4RW9 A;  1OH5 A;  2W40 A;  4M41 A;  4JRP A;  4JI0 K;  4KHW A;  1X9S A;  4DU3 A;  1GLB G;  4I2Q A;  4CZE A;  3ATU A;  4BAC A;  3H46 O;  3DRR A;  1QS4 A;  3VER A;  1L3V A;  2FSN A;  4GMJ B;  4CJE A;  2E88 A;  1XMQ K;  3K5M A;  2QWL A;  2DY4 A;  4XEI A;  1LWC A;  3SK3 A;  3F2K A;  4OPJ A;  2V7Z A;  1JLG A;  1JLF A;  3D2F B;  2FF3 B;  1TKD A;  1Z6R A;  3TR8 A;  1IJJ A;  4CD3 A;  3LWL A;  1IKV A;  4A61 A;  3CM6 A;  2O8E A;  2HMI A;  5AQQ A;  4DR3 K;  2HBK A;  1BCO A;  4ILJ A;  4KHQ A;  4JKB A;  2IVP A;  1T8E A;  3WXM B;  4CFC A;  3NFA A;  4U67 L;  2D4W A;  3SYZ A;  3UE5 A;  2BGG A;  3IKM A;  3FFI A;  3EN9 A;  1S22 A;  3GDQ A;  4H0Y B;  4CK1 A;  1NJW A;  3A5M C;  4FLU A;  2NRW A;  3M8S A;  4JS4 A;  1K73 O;  3IS9 A;  4K8X A;  4ID5 A;  4QAG A;  4W5O A;  1RBR A;  2DPN A;  3OYD A;  2UXC K;  2UUC K;  2G8K A;  3LP2 A;  5LJW A;  3CJ1 A;  3RRG A;  3WNF A;  3ZT4 A;  1J9A A;  4N56 A;  3VEZ A;  1HYZ A;  5FRM A;  4Z94 A;  4W5Q A;  1S1X A;  2F96 A;  4GY2 B;  3HO1 A;  2UYT A;  4J2A A;  2ATQ A;  3P4I A;  1NJZ A;  2KTQ A;  1NGG A;  1T7P A;  4YOW A;  4KRF A;  2YHW A;  4CF9 A;  4BDZ A;  1BG3 A;  4I6M B;  4E7L A;  4CGI A;  4IOC L;  4CZL A;  4WQ5 A;  4JAX A;  1KVB A;  3VES A;  4JI3 K;  3LDP A;  1GOB A;  4OPK A;  5CZ1 A;  4FZY A;  1JLQ A;  3O9S A;  3N4P A;  4F9O A;  3G25 A;  4FPA A;  4FW1 A;  2HNZ A;  3B6O A;  4CHO A;  3QBX A;  1CXQ A;  2GWK A;  2E6L A;  3QLH A;  4QCL A;  1RDC A;  2Y1I A;  4CZH A;  4CE9 A;  5AQT A;  1DLO A;  1LV5 A;  4FK4 A;  2P9P B;  5EY4 A;  3L2V A;  4CJP A;  2JWL A;  5IT9 O;  2F8S A;  4B9T A;  1L3T A;  4W5R A;  2A3Z A;  3ID6 A;  2CGL A;  5AJ3 K;  2E1Y A;  3QB0 A;  1C0F A;  2QWM A;  3U4L A;  4HUG A;  2QA4 N;  3EE8 A;  3D2E B;  4CBW A;  1S6P A;  1W9H A;  5SWM A;  1VSM A;  3THX A;  1ZBI A;  4BDP A;  3WXJ A;  2HB5 A;  1NKC A;  1YF5 L;  1HPZ A;  1RBT A;  5TKW A;  2E2Q A;  4PHT X;  1P8Z A;  3ENO A;  4YDU C;  2IC3 A;  3VEN A;  3DLL L;  4FLW A;  3P1G A;  2VWB A;  4GW6 A;  2V52 B;  3I0R A;  1RDB A;  1Q81 O;  3S41 A;  3BF1 A;  2V51 B;  1HKC A;  4FWQ A;  1VQ5 N;  5AQG A;  4BE0 A;  4ZTJ A;  4ELU A;  3QNN A;  3V4I A;  2BDP A;  1CLQ A;  1Q82 O;  4FJH A;  1VSJ A;  4OPA A;  1RBV A;  3R8E A;  4AHS A;  1SKR A;  4GVM A;  4DCH A;  4EP4 A;  1HPM A;  1J53 A;  1WSE A;  2IVO A;  5HRS A;  3I56 N;  1NLV A;  1C0G A;  2Z1H A;  5CR4 A;  4CEA A;  1RTH A;  1LWE A;  3BEX A;  4CVN E;  1VSE A;  4CK2 A;  1NJY A;  3NE6 A;  3AVJ A;  5J2Q A;  3CPE A;  4H0O A;  2QWO A;  4B9Q A;  2OCE A;  3ULE A;  4B9U A;  4HCC A;  1HJR A;  1TUY A;  4I6M A;  2KHO A;  1NMD A;  3AA4 A;  4RW4 A;  3VF4 A;  3HT3 A;  1WBD A;  2O8B B;  3V9S A;  3CPW M;  4DFM A;  4CGH A;  1HNX K;  3DXM B;  2PY5 A;  2HHX A;  4BRF A;  3CME N;  1NOZ A;  4H0V B;  1C0T A;  1RDD A;  1WUA A;  4BC5 A;  5JVH L;  3LZJ A;  4WQ4 A;  3SI6 A;  5AQR A;  4FLZ A;  2FC0 A;  3U8X A;  4ELT A;  4DQI A;  4B1Y B;  4IBN A;  4CJK A;  1IO2 A;  4EIA A;  4AQY K;  1HNW K;  1X9W A;  3VGL A;  2RHK A;  3R9P A;  2YJE A;  4EZ6 A;  1ATN A;  3CM5 A;  1I39 A;  3CJ9 A;  1FKO A;  2Q31 A;  2FXU A;  1S1V A;  1CZ9 A;  4FWK A;  3HOS A;  4E1M A;  1BIS A;  1KRP A;  1U48 A;  3KJV A;  1QVG M;  3RWU A;  2D0P A;  1VRT A;  4CZJ A;  3TSU A;  4O0J A;  2NNW A;  5BRD A;  1P90 A;  1S1W A;  4YNQ A;  1KC8 O;  1Q8I A;  3C0B A;  2QXF A;  3K9K A;  4XIU A;  3K5N A;  4IG3 A;  3KZB A;  4IWV A;  3Q7B A;  2NZT A;  3ZT1 A;  3TAM A;  2A6A A;  3DXK A;  4ILG B;  3MN9 A;  4CGF A;  4BRH A;  2D0O A;  3JYT A;  3THY A;  1GLE G;  3SPY A;  3C7N B;  4WYB A;  5LL6 Z;  3WXL A;  4G1Q A;  4BVP A;  4M3U A;  2P9N B;  3VTH A;  1U47 A;  4EHT A;  4DV1 K;  4PY5 A;  4E89 A;  3CQ8 A;  4Q5V A;  3PIO L;  4M3W A;  1MWK A;  2OA8 A;  1VAZ A;  1CZB A;  1UOC A;  3M5R A;  4JI8 K;  1O13 A;  2UXD K;  1OKJ A;  4KKO A;  4OKJ A;  1NU0 A;  4KPY A;  4NB4 A;  1V4S A;  4RTF D;  3S3M A;  4BRO A;  2IGI A;  4CEF A;  3AO1 A;  3EO3 A;  2O8C B;  1L3S A;  5FDL A;  5EVZ A;  5DMR A;  3SJH A;  5HRR A;  1YI2 N;  5AR0 A;  2YJF A;  1RTJ A;  4YOV A;  4F3T A;  5FPN A;  3I0S A;  1SZ2 A;  1KCF A;  1HNZ K;  3A2F A;  2ZF5 O;  3HSC A;  2ZQB A;  4CIG A;  1M1K O;  3VQA A;  4PUO A;  4BR0 A;  1NGB A;  2DFF A;  4K25 A;  3CC2 N;  3AVB A;  3G6E N;  2X6N A;  1TL3 A;  2UXB K;  1Y64 A;  3IDH A;  3OYK A;  2P5O A;  5JLF A;  4HTL A;  4NYF A;  3WQU A;  3RMA A;  1HQU A;  3FE1 A;  4ZHR A;  5DM7 L;  4BRQ A;  5AZI A;  3CCU N;  3CFO A;  3ULD A;  1U4B A;  1QSY A;  3CJ7 A;  3M3Z A;  4FWN A;  3OTO K;  5DM6 L;  3ZET B;  5M1F A;  3HPG A;  2KW4 A;  1WB9 A;  4H0X B;  4GKJ K;  3FLC O;  5HLF A;  3K0S A;  2W6L A;  4JKG B;  4FVM A;  4HTU A;  3H08 A;  1NK0 A;  4DR6 K;  4IJN A;  1RBU A;  4DSJ A;  2Q1N A;  1Q9Y A;  1NG9 A;  4B1V A;  3CCS N;  1BWF O;  1VQ8 N;  2IS3 A;  3J80 O;  1NGE A;  1N33 K;  1GLF O;  3MAQ A;  3VQ9 A;  4DSL A;  1ZBU A;  1RIL A;  4Q0B A;  3A8Y A;  3VQ5 A;  3T1H K;  1NKB A;  3C7N A;  1TYQ B;  4OVL A;  3CCV N;  4IXC A;  2P5G A;  3NMU A;  4LF8 K;  3T7Z A;  5HL7 L;  3MED A;  3L2U A;  1K8K B;  5C12 A;  4DUY K;  2Q3S A;  4YFU A;  3QEI A;  4FWO A;  2EHG A;  1YUW A;  3TAE A;  3DLR A;  2RN2 A;  1ZBH A;  5C2D A;  3UKU B;  2E20 A;  3O4N A;  3DM2 A;  3ZLJ A;  3TAB A;  2QEX N;  2YKM A;  4OKE A;  4GNI A;  4YOY A;  2RKI A;  4CJW A;  2O8C A;  4LF6 K;  3WT0 A;  3VQ4 A;  3H1Q A;  1RDA A;  3ZSR A;  2VYP A;  5FRN A;  5BN8 A;  2FBV A;  2O4G A;  1BIZ A;  4DU4 A;  2IIR A;  1ZC6 A;  3HL8 A;  4KTQ A;  1LW0 A;  4K43 A;  4CW7 B;  1HR0 K;  3KTQ A;  1O1W A;  3O4Q A;  3R6M A;  3OBW A;  4M63 C;  1KQS M;  4R79 A;  1YIJ N;  2NUB A;  2NLX A;  1XUP O;  4JLH A;  4PKI A;  5AQH A;  3VET A;  1D5A A;  4A2B A;  3H6E A;  3CET A;  3KK7 A;  3OY9 A;  2GUP A;  3SBT A;  4BC4 A;  1S1T A;  5GIN A;  1IKW A;  2E8A A;  4DV0 K;  2O8F A;  2FBY A;  2A42 A;  4JI6 K;  1C1C A;  4CJS A;  3ZX0 A;  2VWJ A;  5JMV A;  3P31 A;  1IKY A;  4E1N A;  2O8E B;  3KD5 E;  2XY5 A;  1ATS A;  3BF3 A;  2KZM A;  3G10 A;  5C15 A;  1TK0 A;  3ZYY X;  2WTU A;  1NGF A;  4A57 A;  4FO0 A;  4K42 A;  2Q0U A;  3CMA N;  4DKW A;  4Y1D A;  3PY8 A;  4FJ5 A;  3TAF A;  4NCG A;  2Z1G A;  1BA0 A;  1DTQ A;  3OYC A;  4YOU A;  1TAQ A;  2ZE2 A;  3NH0 A;  2XY6 A;  2OPR A;  1XC9 A;  1KVC A;  1QQN A;  4IEI A;  3SJJ A;  1Q9X A;  3CQY A;  3MCA B;  3NDK A;  1YT3 A;  2Q0R A;  3O5B A;  4LF9 K;  3JAM O;  1EXQ A;  4JI1 K;  4DSF A;  1Q18 A;  1QVF M;  3ZSQ A;  1S72 N;  2E1Z A;  3LZI A;  5EOY A;  4KHU A;  2QWP A;  3AVG A;  1QZ6 A;  5BR8 K;  3L2Q A;  4YOX A;  2VG7 A;  2P9K A;  2O4I A;  2GBZ A;  4B1U B;  1D4X A;  2HVH A;  3ALY A;  3TAQ A;  1J6Z A;  3BZC A;  1IKX A;  1BQM A;  1ZYQ A;  5LMU K;  4BRE A;  4GV9 A;  1VSH A;  3FR0 A;  1SAZ A;  1REV A;  3V9U A;  3O8M A;  4KHS A;  4LH4 A;  4M42 A;  3PSF A;  3NAE A;  2ASP A;  3L6Q A;  2I5J A;  4Z4G A;  3AAQ A;  2XY7 A;  5J2P A;  5FRO A;  3MCP A;  3VF6 A;  2HHQ A;  1KLM A;  5E84 A;  4BRG A;  3AA2 A;  4QS9 A;  3C6A A;  4CED A;  3K5O A;  1WSF A;  3T1A A;  4I7F A;  3AGK A;  3RRH A;  3C65 A;  1NKE A;  4H8K A;  4CBX A;  4QS7 A;  3DRP A;  4IG0 A;  4LC9 B;  3EYZ A;  4MFB A;  4DR5 K;  2FBX A;  4CF2 A;  1BDG A;  4GV3 A;  4DQ8 A;  2G8U A;  3C94 A;  4OLB A;  3THX B;  3TI0 A;  2F4V K;  2CH6 A;  3GG4 A;  1KFS A;  4JEP A;  1T6C A;  3OYA A;  3P5J A;  1S3X A;  3I8D A;  4DQS A;  4RW6 A;  2QWR A;  2Q2R A;  4BGB A;  2OPQ A;  1D9D A;  3IFR A;  3SLC A;  5EU7 A;  1NGD A;  1XC3 A;  5C0Y A;  2D0C A;  2P1J A;  2P9S A;  4BRP A;  4LH5 A;  3L2R A;  4ISE A;  4N41 A;  3L3V A;  3AY9 A;  1Q86 O;  4FSV A;  3WXI A;  3QEW A;  5AQF A;  1RTI A;  2VG6 A;  3PSI A;  3NF8 A;  4OPH A;  3SV3 A;  4BQL A;  3GE1 A;  1HYV A;  2KFZ A;  3LP1 A;  1BOT O;  1QQO A;  1S1U A;  3BZK A;  2W6K A;  5AQO A;  5GAD P;  3F9K A;  3RR8 A;  4OKK A;  3U9D A;  4NLB A;  4A62 A;  3ISN C;  4M3Y A;  4KAZ A;  3VQQ A;  1ZBL A;  2VCP A;  3OYJ A;  1WLJ A;  1WNS A;  4BRA A;  3ZSX A;  2OTL N;  3BP8 A;  2HMP A;  4HWI A;  2RF2 A;  3DI6 A;  4F4K A;  2PFU A;  4FW2 A;  5I42 A;  3UB5 A;  3ULE B;  4B3O A;  4WQ5 C;  1FXX A;  3N4Q A;  4LF4 K;  3FZK A;  2OZS A;  5FPD A;  4PKG A;  1M90 O;  4CEB A;  4CJT A;  2UUB K;  4L8R B;  5T7B A;  1RDU A;  3AVI A;  4O8K A;  4FPB A;  5GAG P;  4YHH K;  4HUE A;  5F1X A;  1JXB A;  3H1V X;  4V19 S;  4BE2 A;  1YHQ N;  3DLE A;  1DT9 A;  2PAV A;  2X74 A;  1GOC A;  4CHY A;  3IG1 A;  4H4M A;  3E9L A;  5GIO A;  2QI2 A;  4CBU A;  4CHZ A;  5C2F A;  4KH5 A;  2F7T A;  3HVR A;  2PYJ A;  4JI7 K;  3WEE A;  5KPR A;  2OZM A;  2WBN A;  4CF0 A;  4HHT A;  3HRG A;  4AIL C;  3CC4 N;  1ITG A;  1VSL A;  4FM2 A;  4F2S A;  4CF8 A;  4B8A B;  4B9N A;  4PL8 A;  5H1S Q;  1TK5 A;  2I7P A;  1KAX A;  1YJ9 N;  5F0X A;  4Z0U A;  4WF9 L;  3L0Q A;  3OS2 A;  3KHY A;  3A0I X;  4DTJ A;  2UUA K;  2B4J A;  3EEQ A;  4KRE A;  1ASV A;  1NGI A;  3DXK B;  4L3Q A;  4BRM A;  1RDW X;  2GWJ A;  2QTD A;  3THY B;  1A5X A;  1KXP A;  1LAV A;  5M1K A;  2D1K A;  3CCJ N;  1FJG K;  1GLC G;  3KK1 A;  3AO4 A;  3NF6 A;  4YDU A;  5CYM A;  3UKR A;  2HNY A;  4JD2 B;  4JK7 A;  5TKY A;  3FZM A;  2BE2 A;  4BRI A;  4DR4 K;  3CER A;  5K14 A;  3CXC M;  1X9M A;  4LFB K;  3SUQ A;  2O8D A;  4BVO A;  4OGC A;  2P9I A;  3QER A;  4MO5 A;  1VQK N;  3PO4 A;  4MLE A;  3LL3 A;  2J4R A;  3ZEU A;  1W97 L;  3CJC A;  1OH7 A;  4FZX C;  2OYQ A;  3LDO A;  4IO8 A;  5AQX A;  2P51 A;  1W7A A;  3U3G A;  4O4G A;  4ELV A;  1NGA A;  2ZGY A;  4A5A A;  1N6Q A;  3TTF A;  4WQ4 C;  3F73 A;  1UA0 A;  5ADX H;  3OYM A;  3LPU A;  2QWQ A;  3VEX A;  3W0L A;  2IOC A;  3V9W A;  4UY8 O;  4XH5 A;  2BAN A;  1LOT B;  3CC7 N;  3OYF A;  3QIP A;  4CJQ A;  4M45 A;  1TV6 A;  3K2P A;  5AZI B;  3K58 A;  4PL7 A;  3ZSO A;  3THV A;  5IWA K;  4CJ5 A;  3VMF B;  3V9Z A;  3AVF A;  1T05 A;  3BY5 A;  1JLC A;  4DFP A;  3B8A X;  3JSM A;  3I8B A;  1HMV A;  1NJX A;  3IAY A;  4MQ3 A;  5M1O A;  3KLE A;  4DR1 K;  3A5N C;  3KLI A;  1C6V A;  1RBS A;  1MA9 B;  2HHV A;  2ZD1 A;  1YTU A;  3T19 A;  4AH9 A;  2W42 A;  4KB0 A;  2G8F A;  4B3M K;  4E1J A;  4BR7 A;  3P83 D;  5FPE A;  3VQE A;  3OS0 A;  1Y97 A;  3CIP A;  1XWL A;  4C8O A;  4E0D A;  4IDK A;  3UIQ A;  3HBT A;  1G99 A;  2E2P A;  4DV5 K;  2VGM A;  1NK5 A;  2E6M A;  5HOO A;  1MWM A;  4CGJ A;  2HHH K;  4LY7 A;  4X64 K;  4OGE A;  1NK4 A;  4GV6 A;  4JD2 A;  1EWR A;  4JKE A;  5KGX A;  2P9U A;  3ZX2 A;  3V6D A;  2A40 A;  2G8V A;  2F8T A;  3QDK A;  2HST A;  3MK6 A;  2NRX A;  3SUP A;  1XNQ K;  5BRF A;  2R7Y A;  1ASU A;  3SNN A;  5J2N A;  1EET A;  3AV9 A;  4ID1 A;  4OO1 J;  3G4S N;  4K8Z A;  3HM8 A;  2WC9 A;  4JRQ A;  3VQ7 A;  4A2A A;  2A41 A;  2WON A;  3DOL A;  2HF4 A;  3MN7 A;  3MMV A;  5JIC A;  1SL0 A;  2HHW A;  1T03 A;  3MN5 A;  5HP1 A;  1Q7Y O;  3SQ0 A;  2NRR A;  3CYM A;  1JXE A;  3MEG A;  4O5B A;  3KLF A;  1E3M A;  4B9L A;  2Z1I A;  2ITG A;  1K8A O;  1YTA A;  2NRZ A;  4B1Z A;  3KWI A;  1C0U A;  5ELZ A;  4FWS A;  3AA5 X;  1X9J A;  4BWJ A;  2XY8 A;  5AQV A;  3KK2 A;  3ENB A;  2G8I A;  5AQK A;  4DTN A;  1J5E K;  4O8U A;  4U7B A;  2HHT A;  4DTM A;  4PKH A;  4A5B A;  3OA9 A;  2KZZ A;  1VRU A;  1IH7 A;  2O8F B;  1JKH A;  1TKZ A;  2ZGZ A;  1BQN A;  4K0K K;  3ZSY A;  3DLG A;  4IKF A;  4J8F A;  1RTD A;  4F3O A;  2HND A;  5M1N A;  1NJI O;  1D8Y A;  4B9M A;  3VOV A;  4B1W B;  4ISG A;  3DLB A;  2OTJ N;  4DU1 A;  4E7J A;  2I7N A;  4KH6 A;  1SL2 A;  3EKS A;  3HJF A;  4FLT A;  4DF4 A;  4FK2 A;  3T69 A;  4BR9 A;  3PX6 A;  3MXI A;  4MDA A;  4DFJ A;  1BHL A;  3O3F A;  1UA1 A;  4DV2 K;  1U6Z A;  3FGU A;  5HBM A;  1BL3 A;  4E7I A;  1IBL K;  4FLV A;  2HHS A;  4X62 K;  4M3Z A;  4KBO A;  1KLN A;  4AHV A;  5J1E A;  4HCB A;  2P9K B;  3O1W A;  3RSE A;  3L4Q A;  1S9G A;  4CJU A;  1TL1 A;  1NBW A;  1EQY A;  3O6W A;  3E66 A;  3M8R A;  1BA1 A;  1RT7 A;  1SKS A;  4FLX A;  3CQX A;  4Z4E A;  4DR2 K;  2EX3 A;  4C8N A;  2UU9 K;  2KFN A;  4KO0 A;  1YJN N;  3VPZ A;  2BUP A;  3J7Y P;  3KKR A;  2QKB A;  4LSN A;  3CI5 A;  3DLH A;  2DFE A;  4NYN A;  2YHY A;  2E4L A;  5E26 A;  4BR4 A;  3QO9 A;  3O9Q A;  3J7Z O;  4KHN A;  1HYS A;  3SMP A;  3DAW A;  2WOM A;  1NGJ A;  3VQ6 A;  3A5O C;  1EO1 A;  2ITM A;  1OH6 A;  3H3O B;  3OYG A;  2QXL A;  3SMS A;  4KH4 A;  1VQ6 N;  1BI4 B;  1UAX A;  3SCX A;  1L5U A;  4Z4I A;  4JN4 A;  3G0Z A;  1NWK A;  3VEO A;  4ZTF A;  3O9R A;  2VQE K;  2B5J A;  1UWB A;  3WXK A;  4CES A;  2IDO A;  3M8P A;  2OPP A;  4FM1 A;  4NXM K;  3FZF A;  3VQP A;  3ID8 A;  4EZ9 A;  1HJO A;  3DWL A;  3AVC A;  4DWI A;  3QIC A;  3SV4 A;  3V1O A;  3QFP A;  1X3N A;  2VQF K;  1KFD A;  4BGA A;  3ZCM A;  4KHY A;  1WAF A;  4C23 A;  1VQO N;  3THW A;  1VHX A;  4CF1 A;  4JS5 A;  3CFR A;  1KD1 O;  3TAR A;  3D45 A;  3QEX A;  1J54 A;  3CCM N;  4IOX A;  2VWK A;  3FZH A;  1GLD G;  1WAJ A;  3AVM A;  4LF5 K;  2FSK A;  4KTW A;  4BRN A;  3VQ8 A;  1WN7 A;  1BGX T;  1WOQ A;  3SAH A;  2D0A A;  4K41 A;  4M3X A;  4W5N A;  2YHA A;  2HF3 A;  2P9S B;  2YNH A;  2XRI A;  5J2M A;  1QTM A;  5LY3 A;  4B1X B;  4OLA A;  4FJI A;  5HRP A;  4IZ9 A;  3HP6 A;  5JS1 A;  4H5R A;  4IEE A;  2ZJP L;  4CGD A;  5KTQ A;  3VGK A;  3AO3 A;  3O9U A;  4CJR A;  4O44 A;  1G15 A;  4O5F A;  1U45 A;  4IDH A;  4CFB A;  1I3A A;  3AA3 A;  2HOE A;  2JWK A;  4FJ9 A;  1A5W A;  2WUS A;  1TK8 A;  5CE3 A;  1VQL N;  2CGJ A;  2IVN A;  2XHB A;  4FL9 A;  1HKB A;  2EWS A;  4FWM A;  5LMN K;  2OAN A;  1VQ7 N;  2YNF A;  1QSL A;  3VTI A;  4M3T A;  4DSI A;  4Z4F A;  5E41 A;  3CJB A;  1R59 O;  5GAE P;  3CD6 N;  4CJF A;  4DSK A;  3TTD A;  2AP1 A;  5KPZ A;  4DFK A;  3PX0 A;  5KGW A;  4AHT A;  1SS6 A;  2KKZ A;  2P9L A;  4Y0W A;  4JHD A;  3E1Y A;  3EL2 A;  4WE1 A;  3QNO A;  3F5T A;  1ILY A;  5BPM A;  1TAU A;  1BI4 A;  1VSD A;  1VQ4 N;  4Z4C A;  3O80 A;  1H1V A;  1OVY A;  1IG9 A;  3KVG A;  1CXU A;  3LAM A;  5BRH A;  4DQP A;  4DV4 K;  5MLC Q;  5A2Q O;  1NOY A;  1T6D A;  4RW8 A;  3TAP A;  3L3U A;  4B08 A;  4B3T K;  4PWD A;  4CZI A;  4PQU A;  1T44 A;  1CZA N;  3NVM A;  1VSF A;  3WEE B;  4QOZ B;  3J81 O;  2ASM A;  3E01 A;  1XMO K;  3MWT A;  3LAN A;  2HBJ A;  1EP4 A;  1LW2 A;  5BN9 A;  3PLA A;  2ZJQ L;  1HRH A;  4HUF A;  4H5W A;  4LFA K;  3EY1 A;  4FJG A;  5BPN A;  3MEE A;  3VEV A;  1BO5 O;  1QQM A;  1U2V B;  3RVC A;  4DTP A;  1X3M A;  4CZK A;  5DK5 A;  4IOA L;  4YY3 K;  4G9Z A;  3G71 N;  1ZBS A;  2YHX A;  3SQ2 A;  1U49 A;  1BCM A;  5C10 A;  3VEY A;  1X1P A;  3EE9 A;  1E4F T;  3SZ2 A;  3AVH A;  4E3S A;  4OJR A;  1YJW N;  3O9T A;  4N76 A;  1VK0 A;  3UKR B;  1N34 K;  4OX9 K;  3NH2 A;  4FJN A;  1DKG D;  4FWL A;  3NGI A;  3AO2 A;  3E9O A;  3V1Q A;  3VA0 A;  3U6F A;  2F9T A;  4LD0 A;  5ADX A;  4H03 B;  1I94 K;  1HKG A;  1HQE A;  5CZ2 A;  5KRT A;  5KI6 A;  4PA1 A;  4QS8 A;  5C25 A;  4JYA K;  3QML A;  2O8D B;  3O08 A;  3NGZ A;  2P9I B;  1JCG A;  3VQC A;  4N5S A;  3ZEU B;  3K57 A;  4CK3 A;  3ZX3 A;  3KIO A;  5AZJ A;  2CH5 A;  1WSG A;  1HUX A;  1VQN N;  1TKX A;  3QBW A;  3DLK A;  4CEC A;  2FBT A;  5AQL A;  4H0T B;  3FFK B;  3CF5 L;  5GIP A;  4IO9 L;  1RT6 A;  4AM7 A;  1D9F A;  4DMN A;  4BC2 A;  4GKK K;  1KSP A;  4ILH A;  5HRN A;  1B9D A;  4FM0 A;  4NCA A;  1YVU A;  1EKE A;  3HVT A;  3LDQ A;  4XH1 A;  3HOT A;  4B8C A;  4AM6 A;  4GVE A;  2NRT A;  3H45 C;  4CIE A;  4RWT A;  3OBY A;  1LCU A;  3PIP L;  4DS4 A;  1KTQ A;  3DMJ A;  3AO5 A;  4CIF A;  2QWN A;  4JKA A;  3CJA A;  3K5L A;  4X66 K;  1XQS C;  2AA4 A;  4F8R A;  3K59 A;  3RMB A;  3J7A P;  4NO7 A;  4KV8 A;  1XNR K;  1S6Q A;  4DV6 K;  4E7K A;  3AGR A;  4LSL A;  1RT5 A;  3GOI A;  3IMX A;  5FLX O;  3RR7 A;  3L8B A;  3LAL A;  1VSI A;  3WQT A;  4FJ7 A;  3RMC A;  2YNI A;  1U2V A;  3B6P A;  1WBB A;  2F9W A;  1N32 K;  3D2F A;  4C8M A;  1NGC A;  3AVA A;  3PUF A;  5AFU H;  4ICL A;  1C1A A;  2GV9 A;  3NH1 A;  2QK9 A;  3EKU A;  3LP3 A;  4EFH A;  4DSE A;  3NVK A;  1BU6 O;  3AAR A;  4FZZ A;  3TSP A;  4NXN K;  4UQG A;  3BUZ B;  2E5L K;  1C1B A;  3MXJ A;  3EZ5 A;  1SQK A;  2HHU A;  1NMN A;  2NRV A;  1U04 A;  2WFB A;  4FCY A;  2HW3 A;  2GTD A;  3AAP A;  5F2R A;  4E7H A;  1C0M A;  3TAG A;  3M6G A;  2P9U B;  3OJU A;  1VQM N;  5BPL A;  2JGU A;  1YIT N;  5AQU A;  4CEQ A;  4MDB A;  4IFE A;  4DTS A;  2VG5 A;  2GEM A;  4DTX A;  2A1S A;  5BR9 A;  4I2P A;  2X78 A;  3ZT2 A;  3LAK A;  1EWQ A;  4BR2 A;  3U9Z A;  5HRO A;  4LF7 K;  4LFC K;  3KKS A;  4ISF A;  4JK8 A;  1WSJ A;  3C6H A;  5EX5 A;  3ZT3 A;  1S9E A;  3C6T A;  3QEP A;  3ASM A;  4YOR A;  3HPO A;  4CJ3 A;  3NHG A;  5JS2 A;  4CHQ A;  4BRD A;  4CZF A;  1B9F A;  4BC3 A;  5M1Q A;  2H3G X;  3HYF A;  2QM1 A;  1JCE A;  4DQQ A;  1BUP A;  1Z05 A;  4NLC A;  3DYA A;  3V81 A;  5EXW A;  3TTC A;  2PYL A;  4IJA A;  2GUI A;  1QZ5 A;  1JJ2 M;  1SV5 A;  3SUN A;  4FJM A;  3HI0 A;  3PV8 A;  1NK8 A;  4BRK A;  3WNH A;  5JVG L;  2YI1 A;  3OVN A;  2BTF A;  1QQC A;  3OYB A;  5JLH A;  3D7E O;  3CG7 A;  4DQR A;  1LWF A;  1NM1 A;  4CGG A;  3ZT0 A;  4DUZ K;  4AHU A;  2G8H A;  4CER A;  2P9P A;  4C1N K;  4BDY A;  3QIN A;  3LDN A;  4JKH A;  5C42 A;  1ESV A;  2VGN A;  2NRH A;  4BRC A;  4DF8 A;  1NK6 A;  4FYD A;  5AQY A;  3DRS A;  5CHI A;  3WUH A;  4NCB A;  3D2E A;  4FK0 A;  4JV5 K;  3H3N O;  4BQZ A;  1JLE A;  3C95 A;  4FJK A;  3W3D A;  3J8A A;  1XHZ A;  1FK9 A;  4JI2 K;  1FW6 A;  4H4O A;  2GX9 A;  2YKN A;  3IRX A;  1N5Y A;  3LM9 A;  4FWP A;  4CEO A;  4CHP A;  3LM2 A;  3RSE B;  4DV7 K;  3O1B A;  1JLB A;  3VQB A;  1E4G T;  4BWM A;  1JCF A;  2W41 A;  2E2O A;  1QE1 A;  4RW7 A;  2RE2 A;  4BRL A;  2DTU A;  1GLA G;  1SUQ A;  4DHY A;  4YOT A;  1WSH A; 
#chains in the Genus database with same CATH homology
 3BY5 A;  2W6L A;  3EEQ A;  2W6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...