3BY5A

Crystal structure of cobalamin biosynthesis protein chig from agrobacterium tumefaciens str. c58
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
VTVAGIGCRKGAASDAIIAAVRAAERAFGVTVDYLATAPLKADEAGLAEAAKGLSLSLEIVAQERLEAVAAETMTFSQASLDHSGSPSVSEAAALAAAGAGARLVAPRLVVGDVTVAIAMTSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cobalamin biosynthesis protein from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Biosynthetic protein
molecule keywords Cobalamin biosynthesis protein
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 3by5A00
3BY5A 2W6KA 3EEQA 2W6LA
chains in the Genus database with same CATH superfamily
3TTCA 4PWDA 4B3TK 3KWIA 3TWHA 3OYGA 1RBRA 5FPEA 4F2SA 1ASUA 3SK3A 3HOTA 4IFEA 1A5VA 4JI7K 1NMNA 3EKUA 3RRGA 2QEXN 4DUYK 2W6KA 1YT3A 3HJFA 4DUZK 2VGNA 1J5OA 3J7YP 1QQOA 4CHOA 1S9GA 3CCUN 3C0BA 3OYAA 1NJZA 1WOQA 2JLEA 1TK8A 2P51A 3BY5A 5JICA 4MLEA 1SKWA 2HSTA 2AP1A 2G8KA 3WQUA 2W40A 3THXA 1L3TA 4DU3A 4WQ4C 3L2QA 4Z4GA 3AV9A 3TAEA 1ILYA 4DTRA 1HPMA 1D9FA 1YF5L 2X74A 4ELTA 4CZKA 3KZBA 4DR2K 3SUPA 3CYMA 1VRUA 4MLHA 1WNSA 3OYLA 3JS6A 3CJCA 2E4LA 1NMDA 2NRZA 5AR0A 3SQ1A 3A5LC 1OH7A 4H0PA 1S6QA 3E9OA 2RPIA 4FVMA 4O5BA 4DQRA 1MA9B 2HMIA 1ASVA 3AGRA 5BR8K 4CZHA 3KLGA 2IIRA 2QWMA 3H46O 3P5JA 3WNGA 4DSLA 4YOYA 1RT3A 3VGKA 3C94A 3PV8A 3MK6A 3BP8A 1VQMN 4O8UA 3VQDA 4NB4A 3B6OA 5AQLA 2VG7A 3OYJA 5KPZA 1NWKA 2ZE2A 3Q7CA 3VERA 4IG0A 4JD2A 3ZSYA 4IJNA 1VSKA 3D0PA 4B1UB 1VAZA 3HPGA 5C0YA 4C1NI 4DR4K 3K5LA 5KRSA 1JLCA 1TAQA 3LALA 3HM8A 4CECA 4FLZA 4ILJA 2ITMA 1U49A 4CFBA 4BWMA 1JLFA 3AVLA 1NK0A 4CF9A 3UKUA 4W5TA 1NK6A 2F8SA 1RT5A 4U67L 4KH6A 3VEVA 5J2QA 3QEVA 1K8KA 4B1VA 5GAGP 5CE3A 4DV7K 4M3YA 1NJWA 4DSIA 3CCRN 3WNFA 3DLHA 2HMPA 3OVNA 4LF5K 4DFPA 4K8XA 1OH8A 4AHRA 3CIPA 1REVA 1Z05A 3IMXA 3EE8A 1BUPA 2B5JA 1GOAA 3LWMA 3QNNA 1IG8A 2OTLN 1U48A 4M3UA 4H0YB 3S3NA 3ULEA 3OYBA 1TL3A 1S1VA 2VG6A 1BG3A 4MQ3A 1SL2A 1SS6A 1QSSA 2FSKA 3QIOA 2UYTA 1NK9A 3MCPA 1E4FT 3O9RA 4AF1A 1VSJA 4B08A 3RVCA 2UUAK 5GADP 2FF3B 1MDUB 4M41A 1LAVA 3M5RA 3UKUB 3AAPA 4I2QA 4YDUC 1TYQB 3CG7A 4DS4A 5I42A 4L8RB 3VGLA 3L2RA 4CZLA 3CCVN 3TARA 1KRPA 4H0TB 2YNHA 1GLLO 5CYQA 4OVLA 3UKRA 3ATVA 1C0UA 4KHQA 4IDKA 1DTQA 3OYIA 3PSFA 1DT9A 4FWKA 3T1AA 4KO0A 4BRLA 3ZT1A 4BVOA 4FYDA 1RNHA 4J2EA 2HF4A 2BE2A 4LSLA 3LANA 2PZSA 3HI0A 2V7YA 4DV1K 1KLNA 3IKMA 3KWGA 4CEQA 3V9ZA 1ATRA 2A42A 1XHZA 1J6ZA 3HBTA 4JNEA 3JXUA 5HRPA 1WSHA 2XY8A 3IUCA 4EFHA 5C12A 4UQGA 4IWVA 1Y64A 3V9XA 3K57A 4HHTA 4B3MK 4X65K 2NLXA 3K59A 5FPDA 2E6LA 1S1UA 3E66A 3FZLA 2P5OA 4FOIA 4KH4A 3B8AX 5KTQA 4B9MA 4IDHA 1Q18A 3MEDA 3NBPA 2Q0RA 1HJRA 3CCSN 3C7NB 4B8AB 2Z1GA 3AGKA 1C0TA 4CHNA 3SUQA 3FGUA 1TKZA 4FLVA 3ZLJA 5AQSA 3L3UA 3OS1A 1NK8A 4JI0K 1WLJA 5F0XA 1TV6A 3TSQA 1W97L 4BACA 4FLYA 4QS8A 3J8AA 4OPJA 2Q36A 4FJXA 2P9NA 4F9OA 1N33K 4CJWA 1YI2N 1EWQA 3CCJN 3EL2A 1X9WA 3CQYA 3AY9A 3MDQA 1FXXA 4DHYA 1Q8IA 2VWKA 4BC3A 2ZGYA 1W7AA 4CIFA 2KFZA 1ATSA 5H1SQ 5C10A 5AQPA 5KQDA 3VQPA 2YHBA 1BIUA 1C0GA 4EP5A 4DF8A 4O8KA 4X66K 3ENOA 2H3GX 5AQNA 3CI5A 3OYMA 2KQ2A 3O08A 5IT9O 4YY3K 4DSFA 3AVGA 3PY8A 3NF7A 4JD2B 1L5UA 1QSLA 5EVZA 4AH9A 2HB5A 4PL8A 4O0IA 3ASMA 1C6VA 3K5NA 3SI6A 4N56A 4FWRA 3BF1A 4BC5A 2KHOA 4RCHA 4MDBA 5I9EB 4DU4A 4KBOA 4OPKA 3GG4A 1QHAA 4I7FA 4PUOA 5M1OA 4HUFA 2EHGA 1B9DA 3AA4A 1R59O 3K2PA 1WB9A 4NLBA 3SBTA 5K14A 1HMVA 2HNYA 4DV3K 2QKKA 1HX1A 1NNEA 4JKBA 4CEBA 3CETA 4FPAA 4BDYA 1BWFO 2A5XA 3DLRA 4CZIA 2Z1IA 3K0SA 1HKCA 2AA4A 5C25A 4C8OA 2FSNA 3DRRA 3TPQA 3ZSWA 5JLHA 5J2MA 2Q0UA 4YOVA 3VMFB 4NYNA 4I6MA 4KHYA 1FW6A 4WCEL 4A5BA 1JLBA 1VQLN 4CEOA 3VEWA 3TTDA 1RDUA 2ASMA 4W5OA 4CGFA 5MLCQ 2YJEA 5DK5A 4F2RA 3TANA 3ZETB 3AVNA 2PY5A 5AQFA 2X6NA 1JLGA 1JXEA 3O8MA 3A5NC 2QXLA 1GLBG 3ZSRA 1XMQK 3THVA 1IKXA 2UU9K 2PBDA 3L4IA 4CZFA 4E0DA 1FK9A 1WSGA 1XUPO 5A2QO 1W2BM 3ITHA 3LDSA 1RT6A 4KFBA 4DF4A 4A62A 2BH1A 3FFIA 4ISFA 3EKSA 4G1QA 3EYZA 5KPTA 2O8BA 1HUXA 3NVMA 2G8HA 4AM7A 4JHDB 3S3OA 5HOOA 1WSFA 3HYFA 4HVJA 3PX4A 4GNIA 3JSMA 1NGIA 3NMUA 3C7NA 3QETA 3BF3A 1BL3A 1U04A 3VQBA 1NGJA 3LWLA 4JK9A 4DSEA 4NCBA 2QW9A 5IWAK 4O44A 3IAYA 1BDGA 1GLDG 4AHCA 2BUPA 5FPMA 4BRFA 3U6FA 1YXQA 3CC4N 2P9LA 3U3GA 3SAHA 1BA0A 2WUSA 4XEIA 3S41A 3HP9A 3M1FA 2YHAA 4AM6A 1NGEA 5CZ2A 3KD5E 4XH1A 4FVUA 3NHGA 1WAFA 3OYKA 2O8FB 2V51B 3DM2A 1LWEA 3T7ZA 3PO4A 1SL1A 2PYJA 3HM9A 5M1PA 3NDKA 3F5TA 4K41A 2E6MA 2GV9A 4EIAA 3I8DA 4CBWA 3DRSA 4OX9K 1QQNA 4AHUA 3SJJA 1QQCA 4FWLA 2O4IA 2P1JA 3D7EO 4DTXA 5DM7L 4BRKA 3C6HA 3T19A 3WXIA 4I9LA 3DAWA 1QTMA 4RWTA 3RSEB 1ZBSA 3WNEA 4QOZB 3KLIA 3O9UA 1HNWK 2ITGA 4E19A 1SKRA 3QBXA 2YHYA 2FBTA 2OA8A 1I39A 2Q31A 3VEYA 5AFUH 4DCHA 3MXMA 3H3OB 4DSJA 4CEFA 3MWPA 3QO9A 3LZIA 3MAQA 3KK3A 4E7JA 5BRHA 4H8KA 5KQ8A 2D4WA 4B1ZA 4BQZA 1YHQN 2XO7A 1WBBA 3QINA 4FJHA 1TKXA 4Z4HA 2EWSA 2D1KA 2NRTA 2QWPA 3QESA 4M7XA 1VSHA 3O9QA 3A8YA 4IFYA 2E5LK 2NRWA 4BRPA 5FDLA 2OPSA 3FFKB 2ZGZA 2WC9A 1RTIA 2E2OA 1JXBA 3ZT4A 4O55A 1ZC6A 4CF8A 4KHSA 1NGGA 4NCAA 1L3UA 4XH4A 2A1SA 4CJKA 1J5EK 4J8FA 3R1XA 2FC0A 3U3YA 4KV8A 5M1KA 3AVIA 4FLTA 2G8UA 5E26A 4FJ7A 4HWIA 5AQWA 3CF5L 1JCEA 3FZMA 3O4QA 2YV0X 3QEXA 4WE1A 3SYZA 4B9LA 2FBVA 3KJVA 2HW3A 4GMJB 2GUIA 1D5AA 5LJWA 1QVFM 2HBKA 3LDNA 5CR4A 2X78A 2QWLA 3DXMB 3F2KA 1NJIO 3SAFA 4X64K 2AJQA 2YJFA 2OYQA 2NUBA 3O9SA 3DLEA 1L3VA 1IBLK 5FRNA 3NGYA 3OYNA 3QLHA 4LY7A 3SQ4A 4B9NA 4E7KA 4PHTX 3KLHA 5LMNK 3U9DA 2XRIA 3I33A 3L2UA 1RBTA 4E3SA 4H0VB 4CJ4A 4NO7A 3I56N 1HJOA 3KHYA 3TSUA 2QA4N 3P31A 5CZ1A 3PIPL 1WSIA 3ZSVA 1T03A 4DV4K 4DR5K 1KFDA 4OO1J 1HNVA 4CE9A 5J1EA 2WFBA 2IVNA 1WSEA 4CF2A 4BDPA 1JJ2M 2YKMA 2OTJN 3PIOL 3ZEUA 3TAFA 2FXUA 3QEIA 5AQRA 4YHHK 2I7NA 4LFBK 1U6ZA 4QS9A 4BRAA 4M3XA 4JK7A 5F2RA 1NKEA 3DXMA 2WOMA 1CZAN 4B1XB 3FZKA 4CERA 2KZZA 3R6MA 1KVBA 4IBNA 3WUHA 3EE9A 3SV4A 4O0JA 1TK5A 1YUWA 4M3TA 1X9SA 2GELA 4A59A 4ICLA 5HLFA 3MX5A 3GE1A 3F9KA 3K5OA 3NCIA 1T44A 3CFOA 4JAXA 2YNGA 2A40A 3HP6A 4F3TA 3MXIA 3V1OA 4B9VA 2G8FA 1KFSA 3HL8A 4M3RA 3ZSZA 1IG9A 4JI2K 3TTFA 3UIQA 4NYFA 1QS4A 1YVNA 1HYZA 1W0HA 4CBXA 2O8EB 1NKCA 5TKWA 2ZD1A 5AQQA 4DKWA 3UE5A 1MWMA 3R3LA 3SNNA 4W5NA 4MO4A 5ELZA 2I5JA 4FOEA 4PKGA 3QB0A 3Q7BA 5JS1A 1NGCA 2RE2A 4ZHRA 4BR2A 3PX6A 3WEEB 4RW8A 1N6QA 2P9IA 4WYBA 3CJ7A 3WXLA 1HYSA 4Y1CA 2HVHA 3O6WA 4A2BA 3QBWA 2HHXA 3MWTA 4DR1K 4DMNA 2YNFA 1JL2A 1ASWA 1HQEA 3E9LA 5FLXO 4DTPA 1KTQA 3QNOA 3RMAA 1D8YA 1EO1A 1CXQA 2UXCK 1TKTA 3L2WA 4CZMA 2NZTA 1BA1A 3H6EA 2Z1HA 4FWNA 1RGIA 4B9UA 1SUQA 3CCEN 1JCFA 2ZJQL 1J53A 5AZIA 3SV3A 4UY8O 2GWJA 2KFNA 2ASPA 3MN7A 5JVHL 1NGHA 1OVQA 1S6PA 3ID8A 4OLAA 4CZEA 4CGIA 1RDDA 4CHQA 4YNQA 3GOIA 5CYMA 1K6YA 4BG9A 5AQGA 1I94K 2O8BB 1BO5O 4QCLA 2QI2A 3OYDA 2RN2A 4CD1A 4DR7K 2E20A 4JV5K 2QM1A 3LM2A 4A2AA 5T7BA 1G99A 1VSEA 3RTVA 3SZ2A 5M1NA 5BN9A 4DQSA 4LF7K 2HHQA 5DMRA 3OYHA 3RMDA 1ZBUA 4CJLA 4JKHA 4B9TA 3E1YA 1NJXA 4IKFA 3DLBA 4CK2A 4Z4CA 2F7TA 4RW4A 2NNWA 4AHTA 4FZZA 1U47A 1TK0A 1RDWX 4TSXA 2QWQA 3ULDA 1U45A 3MN5A 3OYEA 2BGGA 1KLMA 1J9AA 1RBUA 4DR3K 3G6EN 4JI3K 3VESA 1NK7A 4IOAL 1S1WA 5CY4A 3M8RA 2ZM6K 4YDUA 3DYAA 4BRQA 1JLQA 4CBUA 4E7IA 4V19S 3I0SA 4EAHD 3LPUA 5C15A 3CPEA 3BZCA 1UA0A 3V9WA 3EN9A 4Z4IA 2G8IA 4G9ZA 4FZXC 3ENHA 4Q5VA 4GVEA 1VQNN 1DGKN 1KAXA 4IO9L 4I9QA 2DY4A 1VQ9N 3IFRA 3D6RA 2QK9A 3VQCA 3VTHA 1VSLA 5JMVA 4FK0A 3H1VX 4CK1A 4BGBA 4DQPA 4PA1A 4EZ9A 3VQQA 5AQZA 3LP1A 1KVCA 3VF2A 2KZMA 4FO0A 2OZSA 4U7BA 3O1BA 2CH5A 4DFMA 3RR8A 1C1CA 3OYCA 3AO1A 4BC4A 3QEPA 4GVMA 1OH6A 5SZTA 4BRNA 4CESA 4DLEA 3ISNC 4H5NA 4KB0A 4A61A 3P39A 3DLKA 3NGIA 4C8NA 3O9TA 4CZGA 3PO5A 4WQ5A 4J2DA 2HBJA 3O3GA 4CF0A 5EX5A 3SQ0A 4WFAL 5AQYA 1BGXT 4LF4K 1QE1A 4CGJA 4IJAA 4OGCA 3ZETA 1LV5A 5F1XA 2F8TA 1KAYA 4B8CA 4F8RA 1BQNA 5HP1A 3O80A 4FPBA 3VQ9A 1IKYA 1HLUA 3LAMA 3VENA 1NGBA 1X3MA 4ID5A 4AILC 3V9UA 1A5XA 1I3AA 2ZJPL 3VA0A 1XMOK 4AQYK 3NFAA 4BQLA 4CW7B 3VF4A 2E2QA 1YJNN 1GOCA 4AHSA 3BUZB 1YITN 4DFJA 1IBMK 4FXDA 1K9MO 1XNRK 3D2FA 2F9TA 2BTFA 3EZWA 3VEXA 5C42A 4C8KA 3TI0A 4CGDA 4KHWA 4CJ7A 1ESVA 4BR0A 3L2VA 5EOYA 1IKWA 1GOBA 1C0FA 2P9UB 3BGRA 4CFDA 4CD3A 4A57A 3NH0A 3SMPA 1X9MA 3CJ1A 4FJGA 5CHIA 5KI6A 4JKGA 2CGLA 1LW0A 5BRFA 5D3GA 1T6DA 3AVMA 1A5WA 4KHUA 1P8ZA 3J7AP 1S3XA 2J4RA 3CPWM 2DFEA 4H4OA 4W5RA 3O4NA 3G71N 1TVRA 2YHXA 4L3QA 3ENBA 4B3OA 3KKRA 5AZJB 3VTIA 1X3NA 1HNZK 3L4QA 4CHZA 2O8DA 4BRIA 3EY1A 1NGAA 3A5OC 4PL7A 4EHUA 4LF8K 1KVAA 3AVBA 4CEZA 3CFRA 1YJWN 3HO1A 4X62K 3QIPA 3ZX0A 1ZYQA 4B3RK 3CQXA 3VQ6A 1HNXK 3NH1A 1XC9A 2OZMA 3P4IA 1S5JA 2HBLA 2HHSA 4YOXA 1V4TA 2D0OA 2FBXA 4DTMA 1VSFA 4MFBA 3ZCMA 3HOSA 5FRMA 1GLJO 3MEGA 3HZ6A 1YTAA 4JS5A 1UA1A 2KW4A 4BR9A 1QHTA 4JKCA 4JKFA 3GDQA 5LMUK 1ITGA 1BU6O 4E1NA 5JS2A 3DLGA 2Q1NA 3HPHA 2B4JA 2V52B 1EP4A 5GAEP 3MMVA 3CC7N 4J2BA 3L0QA 3LDOA 5GIPA 3SPYA 4OJRA 2HHVA 4CFCA 3SQ2A 4FK4A 3SMSA 2IVOA 4NXNK 4JI1K 4BRMA 2E1YA 4IEIA 4H5RA 3GL1A 4JRQA 5AJ3K 3I0RA 1JLAA 1RDBA 3QEWA 2XY5A 1K8KB 3O3HA 3VQ8A 3OS0A 4CCHA 4KRFA 5HRRA 4JRPA 2QWOA 3HVRA 3GBTA 1NKBA 5BPMA 3CFPA 1VQPN 2CGJA 3F9MA 4JI6K 3ZSQA 1N8RO 4FWQA 5BRDA 2BDPA 5AQOA 1HKBA 1BI4A 3S9HA 1SAZA 1CZ9A 4BVPA 1LWFA 4KAZA 2HHUA 4JK8A 4LF9K 1NOYA 1QSYA 2LSNA 5LJVA 3DXKA 4QS7A 2V7ZA 3OTOK 1QQMA 4FWMA 2HHTA 1N5YA 5C24A 4CI6A 1ZBLA 5I3UA 5AQJA 3AO4A 1QVGM 2FBYA 1Q9YA 2GWKA 3I8BA 4BWJA 5HRSA 3D2FB 1UAXA 3JAMO 4IG3A 5C2DA 2HOEA 3OBYA 4K25A 4GW6A 1RT4A 4BR4A 1Q7YO 5HROA 1VQ5N 1BCMA 4FJ9A 1C1BA 4LF6K 3M8QA 4DQQA 5EXWA 2E8AA 3PSIA 4FWOA 5AQVA 2X6SA 4GV6A 5AQUA 1RT1A 4FSVA 3U9ZA 1NGDA 3G10A 5B8HA 1T05A 2QXFA 1SL0A 2R7YA 1WAJA 4MO5A 2DFFA 3NH2A 1KD1O 3TU5A 1RILA 1XWLA 3VQ7A 3QMLA 3KVGA 3DOKA 4ZTJA 1WBDA 2O8FA 4BR7A 3R8EA 2Y1IA 4KTQA 1EQYA 4LSNA 1C1AA 4B1WB 2Z1JA 4CGGA 3CMEN 2ATQA 1FJGK 4EHTA 1Y97A 1RBSA 4CIEA 4B9QA 4RW7A 3PLAA 5SWMA 5LY3A 3MN9A 2DTUA 1XHXA 4I6MB 1BQMA 1B92A 4JKDA 1KSPA 1DLOA 3VN5A 3VOVA 3SBGA 5AFUA 3THYB 3FE1A 3C65A 1EXQA 3VQ4A 1VK0A 4DS5A 3LP0A 1YVUA 3VF6A 5J2NA 2FLOA 3KIOA 2JGUA 4OPAA 3J81O 2EX3A 1V4SA 3FLCO 5KPRA 4GY2B 3WQTA 4PKHA 3NF6A 3W0LA 3WXMB 4N76A 3KK2A 3HSCA 2YHWA 3VEZA 1JLEA 1U2VA 4FJNA 1TAUA 4YOTA 4DG1A 4M3WA 4H5VA 2PAVA 2ZQBA 1F21A 3M3ZA 4C23A 4WFBL 1NG9A 1Q9XA 3AA2A 4FZYA 3V1QA 4OPHA 3K58A 4CZJA 3A5MC 1TL1A 4FJIA 4H5WA 4KPYA 3HK2A 3V6DA 2QWRA 4JEPA 2HHHK 3MXJA 2YI1A 2VQEK 3CCMN 2P9KA 4O5FA 1P90A 1U4BA 1EX4A 3TAPA 3NE6A 1L3SA 1OH5A 4E1MA 1VQ8N 3IDHA 4Q0BA 3T1HK 4JI5K 3L6QA 3SAGA 4BREA 3RMCA 4DR6K 3THWB 3AAQA 3HT3A 3THWA 4FLUA 1IKVA 1VQON 3N4PA 5JLFA 4J2AA 1U2VB 1M1KO 1GLEG 1EWRA 1WUAA 1XQSC 3QDKA 3G0ZA 3WNHA 1LOTB 4FW1A 3OA9A 3IS9A 4M63C 3TAGA 4FM0A 4KTZA 1TUYA 4H03B 4Y0WA 4E7HA 4LFCK 2RF2A 3K5MA 2IDOA 3MN6A 4W5QA 3C6AA 3D45A 3M8PA 5KRTA 2WTUA 4DTUA 1HYVA 3MCAB 3AVHA 1N36K 1NLVA 4RG8A 3B6PA 3ID6A 4CHPA 4NXMK 1RDAA 3LP2A 1QZ5A 2P9PA 5BR9A 2IS3A 4OKEA 2VGMA 3ATUA 1TKDA 2W42A 4CJUA 3AARA 3J80O 1VQ7N 3DXKB 5M1QA 4MDAA 4WQ5C 4JI4K 2A3ZA 2O8DB 5BPLA 3JYTA 4DWIA 4KI6A 5TKYA 2UUBK 5E84A 4CJEA 4FJLA 3AO2A 4CF1A 1KAZA 2QTDA 4IFVA 1T8EA 3VA3A 4EZ6A 4F4KA 2CGKA 2VWJA 3OJUA 3CXCM 1VQ6N 1RTHA 2ZF5O 3UKRB 3ZX2A 3KTQA 2P9KB 2I7PA 1LCUA 4LH4A 4IXCA 3I55N 4BRHA 2W6LA 3TSPA 3CD6N 5GAHP 3HTVA 3N4QA 4FCYA 3BEXA 3CJ9A 1RTDA 4CK3A 2Q97A 4XH5A 3T1YK 4ELUA 3FZFA 1S72N 2P9NB 3CC2N 1DTTA 1XNQK 2P9PB 4JN4A 1MWKA 2YCHA 4HTUA 5AZIB 1JCGA 2A41A 3SUOA 1Q86O 1GLCG 4Z0UA 4A5AA 4BRGA 3O3FA 3ALYA 4JKEA 4OKKA 3F73A 2E2NA 2UXDK 3HRGA 1HRHA 1LW2A 1HPZA 3SLCA 3ZEUB 1IO2A 3NVKA 4CVNE 2NRHA 5EU7A 3SJHA 2VG5A 4K42A 1S1TA 2HHWA 1YAGA 1C0MA 2OPPA 1BIZA 4BRDA 4CJ3A 2XY7A 2O4GA 3CCLN 4BR5A 3O1WA 2GTDA 3AVJA 3WXKA 3CJAA 4C1NK 3OS2A 4I2PA 2D0PA 4FJJA 2UXBK 3ZSXA 4AHVA 4N47A 3CHWA 2PYLA 4CFAA 3A0IX 3THYA 1RTJA 2IAJA 1LWCA 4YOWA 4GV3A 4LC9B 4H0XB 3RR7A 3OW2M 4YORA 1NBWA 4ISGA 3H1QA 3G4SN 1NK4A 2HNZA 3LDPA 2D0AA 4BE1A 4CJRA 2G8WA 2VCPA 3EZ5A 3UB5A 4ZTFA 1VSMA 1T3VA 4GV9A 3KD1E 1EKEA 3MECA 1Q81O 4B3SK 3DOLA 3U8XA 4HCCA 4LD0A 3FR0A 3IG1A 1N34K 2HNDA 4DQ8A 4GKJK 3VPZA 1Z25A 4CJSA 1S1XA 3KK1A 2XHBA 4FM2A 1BCOA 3VQAA 3LM9A 4K43A 5C2FA 2ETJA 4CJ5A 1Z6RA 4C8LA 1FKOA 3V1RA 4BE0A 3P1GA 1VQKN 3MX2A 1XC3A 3LP3A 4DFKA 4IO8A 2YNIA 1GLFO 3C95A 4PQUA 3AVAA 1TGOA 1VHXA 4YOUA 4HTLA 3H3NO 5EY4A 5FROA 4JI8K 3QICA 4BDZA 4FLXA 3LPTA 3E01A 3QFPA 4KREA 3J7ZO 4PKIA 4WQ4A 1NGFA 2O8EA 1FKPA 3AO5A 1SV5A 3HSTB 3CM5A 2NRVA 4H5TA 1YTUA 2E88A 2QKBA 3CERA 2A1RA 3VQ5A 3S3MA 4BY9C 2KTQA 2OCEA 2ASOA 4CEEA 5ADXA 4DV2K 1RCHA 3RWUA 1OVYA 2OANA 2P9IB 1WSJA 4WF9L 1G15A 4LH5A 5ADXH 3U4LA 4BGAA 1IJJA 4FLWA 4HUEA 2WONA 4M3ZA 1HQUA 2P9UA 5AQTA 1O13A 2HBMA 4CHYA 2GUPA 3EEQA 4BROA 4F3OA 4DQIA 4O4GA 3KLEA 3E9PA 1VSIA 2Q2RA 4ID1A 3DJCA 4IOXA 4IEEA 1TUUA 3A2FA 3K9JA 1HKGA 3H08A 3CCQN 4YFUA 1RT7A 3V9SA 4RW6A 2D5RA 2O8CB 3OYFA 2F4VK 3NF9A 1N32K 4FJMA 3KK7A 2Y1JA 1BHLA 1ZBFA 4C8MA 4KB1A 1NU0A 5FPNA 2ZJRL 1CLQA 1SZ2A 1QZ6A 3C6TA 3DI6A 2QWNA 1D9DA 2G8VA 3OY9A 3AVKA 1BI4B 3QERA 3RMBA 4ELVA 2KKZA 5AQIA 1VRTA 4B9SA 4JS4A 4KHNA 5HBMA 1VQ4N 3SCXA 4M42A 4NLCA 2CH6A 4FL9A 2OPQA 4N41A 4BRCA 5AQMA 4JKAA 1J54A 4BG8A 1Z26A 3ZT2A 5AZJA 4EP4A 1NOZA 4RTFD 4LFAK 3NF8A 3SUNA 3FZHA 3HPOA 1B9FA 4KTWA 1IH7A 4H4MA 4HUGA 3WEEA 1NK5A 2P9SB 3KLFA 1CXUA 2A6AA 3G25A 4CGHA 4PY5A 4WFNL 4FW2A 3SPZA 3WT0A 1H1VA 3OJSA 4CJPA 1YIJN 3CQ8A 1E4GT 4H0OA 3ULEB 2P9LB 3AA3A 3D2EA 4ISEA 4OKJA 3LZJA 1YJ9N 3ZX3A 1WN7A 1HNIA 3M8SA 4JYAK 3MEEA 2F96A 4R5PA 4IOCL 3KKSA 2DPNA 5M1FA 1NJYA 2IGIA 2FF6A 2F9WA 2PFUA 3PX0A 1HR0K 3VEOA 1ZBIA 2DFHA 1TYQA 4CIGA 4HCBA 5HRNA 4DV0K 4GKKK 3LL3A 2IOCA 4KH5A 4FM1A 3L8BA 2RKIA 4DV5K 1SQKA 3K9KA 5J2PA 1X9JA 1Q82O 1DEJA 3O4WA 4DLGA 2HF3A 3TR8A 2YX6A 4Z4EA 4M7YA 1BOTO 1LAWA 2E2PA 2OPRA 4CJVA 4CJTA 3PUFA 4DTJA 2P5GA 4ILHA 3THXB 2VQFK 3BDPA 4DTOA 5KGXA 1O1WA 1T6CA 1XI1A 3WXJA 1M90O 1GLAG 1KXPA 3DRPA 4BE2A 1JKHA 4Z94A 4JKGB 3W3DA 1RBVA 4CEDA 2GBZA 1RT2A 3ZT0A 1ZXOA 3RRHA 1T7PA 1X1PA 1KCFA 4B1YB 1K73O 4FK2A 2JWLA 4QAGA 5BREA 3TAMA 4OGEA 4DSKA 2BANA 3HXMA 4FJKA 2VYPA 1D4XA 1K8AO 1E3MA 3AO3A 3M6GA 1SKSA 3VQEA 3L3VA 5GINA 4K0KK 4Z4FA 1IBKK 2WBNA 5AQHA 5BN8A 4XIUA 3HVTA 1EETA 4N5SA 3NAEA 1KC8O 3QFUA 2RHKA 4JHDA 1JL1A 3C6UA 4CJFA 1RDCA 3P83D 3BZKA 5JVGL 3T3FA 3NGZA 2NRXA 3T69A 4JLHA 5BPNA 1CZBA 5DM6L 4DB3A 4R79A 2E1ZA 1VSDA 1RFQA 3AVCA 2FSJA 5AQXA 3AA5X 3D2EB 4KHPK 3H45C 3P38A 3LDQA 2IC3A 5HL7L 2IVPA 4NCGA 2D0CA 2VWBA 2GEMA 2JWKA 5KGWA 3IRXA 4FWSA 2XY6A 2D0BA 2NRRA 4E7LA 3OHRA 3CM6A 1S22A 1ATNA 3R9PA 5GIOA 3DLLL 4RW9A 3TABA 4BC2A 4FWPA 3CJBA 5LL6Z 1UWBA 2Q3SA 1UOCA 4IZ9A 1DKGD 1W9HA 3EO3A 1KQSM 1MU2A 3ZSOA 2UUCK 3V81A 4OLBA 2KLAA 3V4IA 3OBWA 4FJ5A 4ILGB 3ZYYX 2P9SA 4K8ZA 4DTSA 4E1JA 4KKOA 5AQKA 2ZWHA 2O8CA 2GX9A 3O5BA 2HVIA 1S9EA 3LAKA 4CEAA 4CJQA 3TAQA 1ZBHA 2YKNA 2W41A 5E41A 3ZT3A 4E89A 3VGMA 3DMJA 1R0AA 1IV0A 4DTNA 3AVFA 3DWLA 4FJ8A 1BISA 3VETA 4KI4A 4M45A 4Y1DA 3CMAN 4DU1A 2B6AA 1OKJA 4DV6K 3LDLA 3RSEA 1NM1A
chains in the Genus database with same CATH topology
3BY5A 2W6KA 3EEQA 2W6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY5 A;  2W6K A;  3EEQ A;  2W6L A; 
#chains in the Genus database with same CATH topology
 3TTC A;  4PWD A;  4B3T K;  3KWI A;  3TWH A;  3OYG A;  1RBR A;  5FPE A;  4F2S A;  1ASU A;  3SK3 A;  3HOT A;  4IFE A;  1A5V A;  4JI7 K;  1NMN A;  3EKU A;  3RRG A;  2QEX N;  4DUY K;  2W6K A;  1YT3 A;  3HJF A;  4DUZ K;  2VGN A;  1J5O A;  3J7Y P;  1QQO A;  4CHO A;  1S9G A;  3CCU N;  3C0B A;  3OYA A;  1NJZ A;  1WOQ A;  2JLE A;  1TK8 A;  2P51 A;  3BY5 A;  5JIC A;  4MLE A;  1SKW A;  2HST A;  2AP1 A;  2G8K A;  3WQU A;  2W40 A;  3THX A;  1L3T A;  4DU3 A;  4WQ4 C;  3L2Q A;  4Z4G A;  3AV9 A;  3TAE A;  1ILY A;  4DTR A;  1HPM A;  1D9F A;  1YF5 L;  2X74 A;  4ELT A;  4CZK A;  3KZB A;  4DR2 K;  3SUP A;  3CYM A;  1VRU A;  4MLH A;  1WNS A;  3OYL A;  3JS6 A;  3CJC A;  2E4L A;  1NMD A;  2NRZ A;  5AR0 A;  3SQ1 A;  3A5L C;  1OH7 A;  4H0P A;  1S6Q A;  3E9O A;  2RPI A;  4FVM A;  4O5B A;  4DQR A;  1MA9 B;  2HMI A;  1ASV A;  3AGR A;  5BR8 K;  4CZH A;  3KLG A;  2IIR A;  2QWM A;  3H46 O;  3P5J A;  3WNG A;  4DSL A;  4YOY A;  1RT3 A;  3VGK A;  3C94 A;  3PV8 A;  3MK6 A;  3BP8 A;  1VQM N;  4O8U A;  3VQD A;  4NB4 A;  3B6O A;  5AQL A;  2VG7 A;  3OYJ A;  5KPZ A;  1NWK A;  2ZE2 A;  3Q7C A;  3VER A;  4IG0 A;  4JD2 A;  3ZSY A;  4IJN A;  1VSK A;  3D0P A;  4B1U B;  1VAZ A;  3HPG A;  5C0Y A;  4C1N I;  4DR4 K;  3K5L A;  5KRS A;  1JLC A;  1TAQ A;  3LAL A;  3HM8 A;  4CEC A;  4FLZ A;  4ILJ A;  2ITM A;  1U49 A;  4CFB A;  4BWM A;  1JLF A;  3AVL A;  1NK0 A;  4CF9 A;  3UKU A;  4W5T A;  1NK6 A;  2F8S A;  1RT5 A;  4U67 L;  4KH6 A;  3VEV A;  5J2Q A;  3QEV A;  1K8K A;  4B1V A;  5GAG P;  5CE3 A;  4DV7 K;  4M3Y A;  1NJW A;  4DSI A;  3CCR N;  3WNF A;  3DLH A;  2HMP A;  3OVN A;  4LF5 K;  4DFP A;  4K8X A;  1OH8 A;  4AHR A;  3CIP A;  1REV A;  1Z05 A;  3IMX A;  3EE8 A;  1BUP A;  2B5J A;  1GOA A;  3LWM A;  3QNN A;  1IG8 A;  2OTL N;  1U48 A;  4M3U A;  4H0Y B;  3S3N A;  3ULE A;  3OYB A;  1TL3 A;  1S1V A;  2VG6 A;  1BG3 A;  4MQ3 A;  1SL2 A;  1SS6 A;  1QSS A;  2FSK A;  3QIO A;  2UYT A;  1NK9 A;  3MCP A;  1E4F T;  3O9R A;  4AF1 A;  1VSJ A;  4B08 A;  3RVC A;  2UUA K;  5GAD P;  2FF3 B;  1MDU B;  4M41 A;  1LAV A;  3M5R A;  3UKU B;  3AAP A;  4I2Q A;  4YDU C;  1TYQ B;  3CG7 A;  4DS4 A;  5I42 A;  4L8R B;  3VGL A;  3L2R A;  4CZL A;  3CCV N;  3TAR A;  1KRP A;  4H0T B;  2YNH A;  1GLL O;  5CYQ A;  4OVL A;  3UKR A;  3ATV A;  1C0U A;  4KHQ A;  4IDK A;  1DTQ A;  3OYI A;  3PSF A;  1DT9 A;  4FWK A;  3T1A A;  4KO0 A;  4BRL A;  3ZT1 A;  4BVO A;  4FYD A;  1RNH A;  4J2E A;  2HF4 A;  2BE2 A;  4LSL A;  3LAN A;  2PZS A;  3HI0 A;  2V7Y A;  4DV1 K;  1KLN A;  3IKM A;  3KWG A;  4CEQ A;  3V9Z A;  1ATR A;  2A42 A;  1XHZ A;  1J6Z A;  3HBT A;  4JNE A;  3JXU A;  5HRP A;  1WSH A;  2XY8 A;  3IUC A;  4EFH A;  5C12 A;  4UQG A;  4IWV A;  1Y64 A;  3V9X A;  3K57 A;  4HHT A;  4B3M K;  4X65 K;  2NLX A;  3K59 A;  5FPD A;  2E6L A;  1S1U A;  3E66 A;  3FZL A;  2P5O A;  4FOI A;  4KH4 A;  3B8A X;  5KTQ A;  4B9M A;  4IDH A;  1Q18 A;  3MED A;  3NBP A;  2Q0R A;  1HJR A;  3CCS N;  3C7N B;  4B8A B;  2Z1G A;  3AGK A;  1C0T A;  4CHN A;  3SUQ A;  3FGU A;  1TKZ A;  4FLV A;  3ZLJ A;  5AQS A;  3L3U A;  3OS1 A;  1NK8 A;  4JI0 K;  1WLJ A;  5F0X A;  1TV6 A;  3TSQ A;  1W97 L;  4BAC A;  4FLY A;  4QS8 A;  3J8A A;  4OPJ A;  2Q36 A;  4FJX A;  2P9N A;  4F9O A;  1N33 K;  4CJW A;  1YI2 N;  1EWQ A;  3CCJ N;  3EL2 A;  1X9W A;  3CQY A;  3AY9 A;  3MDQ A;  1FXX A;  4DHY A;  1Q8I A;  2VWK A;  4BC3 A;  2ZGY A;  1W7A A;  4CIF A;  2KFZ A;  1ATS A;  5H1S Q;  5C10 A;  5AQP A;  5KQD A;  3VQP A;  2YHB A;  1BIU A;  1C0G A;  4EP5 A;  4DF8 A;  4O8K A;  4X66 K;  3ENO A;  2H3G X;  5AQN A;  3CI5 A;  3OYM A;  2KQ2 A;  3O08 A;  5IT9 O;  4YY3 K;  4DSF A;  3AVG A;  3PY8 A;  3NF7 A;  4JD2 B;  1L5U A;  1QSL A;  5EVZ A;  4AH9 A;  2HB5 A;  4PL8 A;  4O0I A;  3ASM A;  1C6V A;  3K5N A;  3SI6 A;  4N56 A;  4FWR A;  3BF1 A;  4BC5 A;  2KHO A;  4RCH A;  4MDB A;  5I9E B;  4DU4 A;  4KBO A;  4OPK A;  3GG4 A;  1QHA A;  4I7F A;  4PUO A;  5M1O A;  4HUF A;  2EHG A;  1B9D A;  3AA4 A;  1R59 O;  3K2P A;  1WB9 A;  4NLB A;  3SBT A;  5K14 A;  1HMV A;  2HNY A;  4DV3 K;  2QKK A;  1HX1 A;  1NNE A;  4JKB A;  4CEB A;  3CET A;  4FPA A;  4BDY A;  1BWF O;  2A5X A;  3DLR A;  4CZI A;  2Z1I A;  3K0S A;  1HKC A;  2AA4 A;  5C25 A;  4C8O A;  2FSN A;  3DRR A;  3TPQ A;  3ZSW A;  5JLH A;  5J2M A;  2Q0U A;  4YOV A;  3VMF B;  4NYN A;  4I6M A;  4KHY A;  1FW6 A;  4WCE L;  4A5B A;  1JLB A;  1VQL N;  4CEO A;  3VEW A;  3TTD A;  1RDU A;  2ASM A;  4W5O A;  4CGF A;  5MLC Q;  2YJE A;  5DK5 A;  4F2R A;  3TAN A;  3ZET B;  3AVN A;  2PY5 A;  5AQF A;  2X6N A;  1JLG A;  1JXE A;  3O8M A;  3A5N C;  2QXL A;  1GLB G;  3ZSR A;  1XMQ K;  3THV A;  1IKX A;  2UU9 K;  2PBD A;  3L4I A;  4CZF A;  4E0D A;  1FK9 A;  1WSG A;  1XUP O;  5A2Q O;  1W2B M;  3ITH A;  3LDS A;  1RT6 A;  4KFB A;  4DF4 A;  4A62 A;  2BH1 A;  3FFI A;  4ISF A;  3EKS A;  4G1Q A;  3EYZ A;  5KPT A;  2O8B A;  1HUX A;  3NVM A;  2G8H A;  4AM7 A;  4JHD B;  3S3O A;  5HOO A;  1WSF A;  3HYF A;  4HVJ A;  3PX4 A;  4GNI A;  3JSM A;  1NGI A;  3NMU A;  3C7N A;  3QET A;  3BF3 A;  1BL3 A;  1U04 A;  3VQB A;  1NGJ A;  3LWL A;  4JK9 A;  4DSE A;  4NCB A;  2QW9 A;  5IWA K;  4O44 A;  3IAY A;  1BDG A;  1GLD G;  4AHC A;  2BUP A;  5FPM A;  4BRF A;  3U6F A;  1YXQ A;  3CC4 N;  2P9L A;  3U3G A;  3SAH A;  1BA0 A;  2WUS A;  4XEI A;  3S41 A;  3HP9 A;  3M1F A;  2YHA A;  4AM6 A;  1NGE A;  5CZ2 A;  3KD5 E;  4XH1 A;  4FVU A;  3NHG A;  1WAF A;  3OYK A;  2O8F B;  2V51 B;  3DM2 A;  1LWE A;  3T7Z A;  3PO4 A;  1SL1 A;  2PYJ A;  3HM9 A;  5M1P A;  3NDK A;  3F5T A;  4K41 A;  2E6M A;  2GV9 A;  4EIA A;  3I8D A;  4CBW A;  3DRS A;  4OX9 K;  1QQN A;  4AHU A;  3SJJ A;  1QQC A;  4FWL A;  2O4I A;  2P1J A;  3D7E O;  4DTX A;  5DM7 L;  4BRK A;  3C6H A;  3T19 A;  3WXI A;  4I9L A;  3DAW A;  1QTM A;  4RWT A;  3RSE B;  1ZBS A;  3WNE A;  4QOZ B;  3KLI A;  3O9U A;  1HNW K;  2ITG A;  4E19 A;  1SKR A;  3QBX A;  2YHY A;  2FBT A;  2OA8 A;  1I39 A;  2Q31 A;  3VEY A;  5AFU H;  4DCH A;  3MXM A;  3H3O B;  4DSJ A;  4CEF A;  3MWP A;  3QO9 A;  3LZI A;  3MAQ A;  3KK3 A;  4E7J A;  5BRH A;  4H8K A;  5KQ8 A;  2D4W A;  4B1Z A;  4BQZ A;  1YHQ N;  2XO7 A;  1WBB A;  3QIN A;  4FJH A;  1TKX A;  4Z4H A;  2EWS A;  2D1K A;  2NRT A;  2QWP A;  3QES A;  4M7X A;  1VSH A;  3O9Q A;  3A8Y A;  4IFY A;  2E5L K;  2NRW A;  4BRP A;  5FDL A;  2OPS A;  3FFK B;  2ZGZ A;  2WC9 A;  1RTI A;  2E2O A;  1JXB A;  3ZT4 A;  4O55 A;  1ZC6 A;  4CF8 A;  4KHS A;  1NGG A;  4NCA A;  1L3U A;  4XH4 A;  2A1S A;  4CJK A;  1J5E K;  4J8F A;  3R1X A;  2FC0 A;  3U3Y A;  4KV8 A;  5M1K A;  3AVI A;  4FLT A;  2G8U A;  5E26 A;  4FJ7 A;  4HWI A;  5AQW A;  3CF5 L;  1JCE A;  3FZM A;  3O4Q A;  2YV0 X;  3QEX A;  4WE1 A;  3SYZ A;  4B9L A;  2FBV A;  3KJV A;  2HW3 A;  4GMJ B;  2GUI A;  1D5A A;  5LJW A;  1QVF M;  2HBK A;  3LDN A;  5CR4 A;  2X78 A;  2QWL A;  3DXM B;  3F2K A;  1NJI O;  3SAF A;  4X64 K;  2AJQ A;  2YJF A;  2OYQ A;  2NUB A;  3O9S A;  3DLE A;  1L3V A;  1IBL K;  5FRN A;  3NGY A;  3OYN A;  3QLH A;  4LY7 A;  3SQ4 A;  4B9N A;  4E7K A;  4PHT X;  3KLH A;  5LMN K;  3U9D A;  2XRI A;  3I33 A;  3L2U A;  1RBT A;  4E3S A;  4H0V B;  4CJ4 A;  4NO7 A;  3I56 N;  1HJO A;  3KHY A;  3TSU A;  2QA4 N;  3P31 A;  5CZ1 A;  3PIP L;  1WSI A;  3ZSV A;  1T03 A;  4DV4 K;  4DR5 K;  1KFD A;  4OO1 J;  1HNV A;  4CE9 A;  5J1E A;  2WFB A;  2IVN A;  1WSE A;  4CF2 A;  4BDP A;  1JJ2 M;  2YKM A;  2OTJ N;  3PIO L;  3ZEU A;  3TAF A;  2FXU A;  3QEI A;  5AQR A;  4YHH K;  2I7N A;  4LFB K;  1U6Z A;  4QS9 A;  4BRA A;  4M3X A;  4JK7 A;  5F2R A;  1NKE A;  3DXM A;  2WOM A;  1CZA N;  4B1X B;  3FZK A;  4CER A;  2KZZ A;  3R6M A;  1KVB A;  4IBN A;  3WUH A;  3EE9 A;  3SV4 A;  4O0J A;  1TK5 A;  1YUW A;  4M3T A;  1X9S A;  2GEL A;  4A59 A;  4ICL A;  5HLF A;  3MX5 A;  3GE1 A;  3F9K A;  3K5O A;  3NCI A;  1T44 A;  3CFO A;  4JAX A;  2YNG A;  2A40 A;  3HP6 A;  4F3T A;  3MXI A;  3V1O A;  4B9V A;  2G8F A;  1KFS A;  3HL8 A;  4M3R A;  3ZSZ A;  1IG9 A;  4JI2 K;  3TTF A;  3UIQ A;  4NYF A;  1QS4 A;  1YVN A;  1HYZ A;  1W0H A;  4CBX A;  2O8E B;  1NKC A;  5TKW A;  2ZD1 A;  5AQQ A;  4DKW A;  3UE5 A;  1MWM A;  3R3L A;  3SNN A;  4W5N A;  4MO4 A;  5ELZ A;  2I5J A;  4FOE A;  4PKG A;  3QB0 A;  3Q7B A;  5JS1 A;  1NGC A;  2RE2 A;  4ZHR A;  4BR2 A;  3PX6 A;  3WEE B;  4RW8 A;  1N6Q A;  2P9I A;  4WYB A;  3CJ7 A;  3WXL A;  1HYS A;  4Y1C A;  2HVH A;  3O6W A;  4A2B A;  3QBW A;  2HHX A;  3MWT A;  4DR1 K;  4DMN A;  2YNF A;  1JL2 A;  1ASW A;  1HQE A;  3E9L A;  5FLX O;  4DTP A;  1KTQ A;  3QNO A;  3RMA A;  1D8Y A;  1EO1 A;  1CXQ A;  2UXC K;  1TKT A;  3L2W A;  4CZM A;  2NZT A;  1BA1 A;  3H6E A;  2Z1H A;  4FWN A;  1RGI A;  4B9U A;  1SUQ A;  3CCE N;  1JCF A;  2ZJQ L;  1J53 A;  5AZI A;  3SV3 A;  4UY8 O;  2GWJ A;  2KFN A;  2ASP A;  3MN7 A;  5JVH L;  1NGH A;  1OVQ A;  1S6P A;  3ID8 A;  4OLA A;  4CZE A;  4CGI A;  1RDD A;  4CHQ A;  4YNQ A;  3GOI A;  5CYM A;  1K6Y A;  4BG9 A;  5AQG A;  1I94 K;  2O8B B;  1BO5 O;  4QCL A;  2QI2 A;  3OYD A;  2RN2 A;  4CD1 A;  4DR7 K;  2E20 A;  4JV5 K;  2QM1 A;  3LM2 A;  4A2A A;  5T7B A;  1G99 A;  1VSE A;  3RTV A;  3SZ2 A;  5M1N A;  5BN9 A;  4DQS A;  4LF7 K;  2HHQ A;  5DMR A;  3OYH A;  3RMD A;  1ZBU A;  4CJL A;  4JKH A;  4B9T A;  3E1Y A;  1NJX A;  4IKF A;  3DLB A;  4CK2 A;  4Z4C A;  2F7T A;  4RW4 A;  2NNW A;  4AHT A;  4FZZ A;  1U47 A;  1TK0 A;  1RDW X;  4TSX A;  2QWQ A;  3ULD A;  1U45 A;  3MN5 A;  3OYE A;  2BGG A;  1KLM A;  1J9A A;  1RBU A;  4DR3 K;  3G6E N;  4JI3 K;  3VES A;  1NK7 A;  4IOA L;  1S1W A;  5CY4 A;  3M8R A;  2ZM6 K;  4YDU A;  3DYA A;  4BRQ A;  1JLQ A;  4CBU A;  4E7I A;  4V19 S;  3I0S A;  4EAH D;  3LPU A;  5C15 A;  3CPE A;  3BZC A;  1UA0 A;  3V9W A;  3EN9 A;  4Z4I A;  2G8I A;  4G9Z A;  4FZX C;  3ENH A;  4Q5V A;  4GVE A;  1VQN N;  1DGK N;  1KAX A;  4IO9 L;  4I9Q A;  2DY4 A;  1VQ9 N;  3IFR A;  3D6R A;  2QK9 A;  3VQC A;  3VTH A;  1VSL A;  5JMV A;  4FK0 A;  3H1V X;  4CK1 A;  4BGB A;  4DQP A;  4PA1 A;  4EZ9 A;  3VQQ A;  5AQZ A;  3LP1 A;  1KVC A;  3VF2 A;  2KZM A;  4FO0 A;  2OZS A;  4U7B A;  3O1B A;  2CH5 A;  4DFM A;  3RR8 A;  1C1C A;  3OYC A;  3AO1 A;  4BC4 A;  3QEP A;  4GVM A;  1OH6 A;  5SZT A;  4BRN A;  4CES A;  4DLE A;  3ISN C;  4H5N A;  4KB0 A;  4A61 A;  3P39 A;  3DLK A;  3NGI A;  4C8N A;  3O9T A;  4CZG A;  3PO5 A;  4WQ5 A;  4J2D A;  2HBJ A;  3O3G A;  4CF0 A;  5EX5 A;  3SQ0 A;  4WFA L;  5AQY A;  1BGX T;  4LF4 K;  1QE1 A;  4CGJ A;  4IJA A;  4OGC A;  3ZET A;  1LV5 A;  5F1X A;  2F8T A;  1KAY A;  4B8C A;  4F8R A;  1BQN A;  5HP1 A;  3O80 A;  4FPB A;  3VQ9 A;  1IKY A;  1HLU A;  3LAM A;  3VEN A;  1NGB A;  1X3M A;  4ID5 A;  4AIL C;  3V9U A;  1A5X A;  1I3A A;  2ZJP L;  3VA0 A;  1XMO K;  4AQY K;  3NFA A;  4BQL A;  4CW7 B;  3VF4 A;  2E2Q A;  1YJN N;  1GOC A;  4AHS A;  3BUZ B;  1YIT N;  4DFJ A;  1IBM K;  4FXD A;  1K9M O;  1XNR K;  3D2F A;  2F9T A;  2BTF A;  3EZW A;  3VEX A;  5C42 A;  4C8K A;  3TI0 A;  4CGD A;  4KHW A;  4CJ7 A;  1ESV A;  4BR0 A;  3L2V A;  5EOY A;  1IKW A;  1GOB A;  1C0F A;  2P9U B;  3BGR A;  4CFD A;  4CD3 A;  4A57 A;  3NH0 A;  3SMP A;  1X9M A;  3CJ1 A;  4FJG A;  5CHI A;  5KI6 A;  4JKG A;  2CGL A;  1LW0 A;  5BRF A;  5D3G A;  1T6D A;  3AVM A;  1A5W A;  4KHU A;  1P8Z A;  3J7A P;  1S3X A;  2J4R A;  3CPW M;  2DFE A;  4H4O A;  4W5R A;  3O4N A;  3G71 N;  1TVR A;  2YHX A;  4L3Q A;  3ENB A;  4B3O A;  3KKR A;  5AZJ B;  3VTI A;  1X3N A;  1HNZ K;  3L4Q A;  4CHZ A;  2O8D A;  4BRI A;  3EY1 A;  1NGA A;  3A5O C;  4PL7 A;  4EHU A;  4LF8 K;  1KVA A;  3AVB A;  4CEZ A;  3CFR A;  1YJW N;  3HO1 A;  4X62 K;  3QIP A;  3ZX0 A;  1ZYQ A;  4B3R K;  3CQX A;  3VQ6 A;  1HNX K;  3NH1 A;  1XC9 A;  2OZM A;  3P4I A;  1S5J A;  2HBL A;  2HHS A;  4YOX A;  1V4T A;  2D0O A;  2FBX A;  4DTM A;  1VSF A;  4MFB A;  3ZCM A;  3HOS A;  5FRM A;  1GLJ O;  3MEG A;  3HZ6 A;  1YTA A;  4JS5 A;  1UA1 A;  2KW4 A;  4BR9 A;  1QHT A;  4JKC A;  4JKF A;  3GDQ A;  5LMU K;  1ITG A;  1BU6 O;  4E1N A;  5JS2 A;  3DLG A;  2Q1N A;  3HPH A;  2B4J A;  2V52 B;  1EP4 A;  5GAE P;  3MMV A;  3CC7 N;  4J2B A;  3L0Q A;  3LDO A;  5GIP A;  3SPY A;  4OJR A;  2HHV A;  4CFC A;  3SQ2 A;  4FK4 A;  3SMS A;  2IVO A;  4NXN K;  4JI1 K;  4BRM A;  2E1Y A;  4IEI A;  4H5R A;  3GL1 A;  4JRQ A;  5AJ3 K;  3I0R A;  1JLA A;  1RDB A;  3QEW A;  2XY5 A;  1K8K B;  3O3H A;  3VQ8 A;  3OS0 A;  4CCH A;  4KRF A;  5HRR A;  4JRP A;  2QWO A;  3HVR A;  3GBT A;  1NKB A;  5BPM A;  3CFP A;  1VQP N;  2CGJ A;  3F9M A;  4JI6 K;  3ZSQ A;  1N8R O;  4FWQ A;  5BRD A;  2BDP A;  5AQO A;  1HKB A;  1BI4 A;  3S9H A;  1SAZ A;  1CZ9 A;  4BVP A;  1LWF A;  4KAZ A;  2HHU A;  4JK8 A;  4LF9 K;  1NOY A;  1QSY A;  2LSN A;  5LJV A;  3DXK A;  4QS7 A;  2V7Z A;  3OTO K;  1QQM A;  4FWM A;  2HHT A;  1N5Y A;  5C24 A;  4CI6 A;  1ZBL A;  5I3U A;  5AQJ A;  3AO4 A;  1QVG M;  2FBY A;  1Q9Y A;  2GWK A;  3I8B A;  4BWJ A;  5HRS A;  3D2F B;  1UAX A;  3JAM O;  4IG3 A;  5C2D A;  2HOE A;  3OBY A;  4K25 A;  4GW6 A;  1RT4 A;  4BR4 A;  1Q7Y O;  5HRO A;  1VQ5 N;  1BCM A;  4FJ9 A;  1C1B A;  4LF6 K;  3M8Q A;  4DQQ A;  5EXW A;  2E8A A;  3PSI A;  4FWO A;  5AQV A;  2X6S A;  4GV6 A;  5AQU A;  1RT1 A;  4FSV A;  3U9Z A;  1NGD A;  3G10 A;  5B8H A;  1T05 A;  2QXF A;  1SL0 A;  2R7Y A;  1WAJ A;  4MO5 A;  2DFF A;  3NH2 A;  1KD1 O;  3TU5 A;  1RIL A;  1XWL A;  3VQ7 A;  3QML A;  3KVG A;  3DOK A;  4ZTJ A;  1WBD A;  2O8F A;  4BR7 A;  3R8E A;  2Y1I A;  4KTQ A;  1EQY A;  4LSN A;  1C1A A;  4B1W B;  2Z1J A;  4CGG A;  3CME N;  2ATQ A;  1FJG K;  4EHT A;  1Y97 A;  1RBS A;  4CIE A;  4B9Q A;  4RW7 A;  3PLA A;  5SWM A;  5LY3 A;  3MN9 A;  2DTU A;  1XHX A;  4I6M B;  1BQM A;  1B92 A;  4JKD A;  1KSP A;  1DLO A;  3VN5 A;  3VOV A;  3SBG A;  5AFU A;  3THY B;  3FE1 A;  3C65 A;  1EXQ A;  3VQ4 A;  1VK0 A;  4DS5 A;  3LP0 A;  1YVU A;  3VF6 A;  5J2N A;  2FLO A;  3KIO A;  2JGU A;  4OPA A;  3J81 O;  2EX3 A;  1V4S A;  3FLC O;  5KPR A;  4GY2 B;  3WQT A;  4PKH A;  3NF6 A;  3W0L A;  3WXM B;  4N76 A;  3KK2 A;  3HSC A;  2YHW A;  3VEZ A;  1JLE A;  1U2V A;  4FJN A;  1TAU A;  4YOT A;  4DG1 A;  4M3W A;  4H5V A;  2PAV A;  2ZQB A;  1F21 A;  3M3Z A;  4C23 A;  4WFB L;  1NG9 A;  1Q9X A;  3AA2 A;  4FZY A;  3V1Q A;  4OPH A;  3K58 A;  4CZJ A;  3A5M C;  1TL1 A;  4FJI A;  4H5W A;  4KPY A;  3HK2 A;  3V6D A;  2QWR A;  4JEP A;  2HHH K;  3MXJ A;  2YI1 A;  2VQE K;  3CCM N;  2P9K A;  4O5F A;  1P90 A;  1U4B A;  1EX4 A;  3TAP A;  3NE6 A;  1L3S A;  1OH5 A;  4E1M A;  1VQ8 N;  3IDH A;  4Q0B A;  3T1H K;  4JI5 K;  3L6Q A;  3SAG A;  4BRE A;  3RMC A;  4DR6 K;  3THW B;  3AAQ A;  3HT3 A;  3THW A;  4FLU A;  1IKV A;  1VQO N;  3N4P A;  5JLF A;  4J2A A;  1U2V B;  1M1K O;  1GLE G;  1EWR A;  1WUA A;  1XQS C;  3QDK A;  3G0Z A;  3WNH A;  1LOT B;  4FW1 A;  3OA9 A;  3IS9 A;  4M63 C;  3TAG A;  4FM0 A;  4KTZ A;  1TUY A;  4H03 B;  4Y0W A;  4E7H A;  4LFC K;  2RF2 A;  3K5M A;  2IDO A;  3MN6 A;  4W5Q A;  3C6A A;  3D45 A;  3M8P A;  5KRT A;  2WTU A;  4DTU A;  1HYV A;  3MCA B;  3AVH A;  1N36 K;  1NLV A;  4RG8 A;  3B6P A;  3ID6 A;  4CHP A;  4NXM K;  1RDA A;  3LP2 A;  1QZ5 A;  2P9P A;  5BR9 A;  2IS3 A;  4OKE A;  2VGM A;  3ATU A;  1TKD A;  2W42 A;  4CJU A;  3AAR A;  3J80 O;  1VQ7 N;  3DXK B;  5M1Q A;  4MDA A;  4WQ5 C;  4JI4 K;  2A3Z A;  2O8D B;  5BPL A;  3JYT A;  4DWI A;  4KI6 A;  5TKY A;  2UUB K;  5E84 A;  4CJE A;  4FJL A;  3AO2 A;  4CF1 A;  1KAZ A;  2QTD A;  4IFV A;  1T8E A;  3VA3 A;  4EZ6 A;  4F4K A;  2CGK A;  2VWJ A;  3OJU A;  3CXC M;  1VQ6 N;  1RTH A;  2ZF5 O;  3UKR B;  3ZX2 A;  3KTQ A;  2P9K B;  2I7P A;  1LCU A;  4LH4 A;  4IXC A;  3I55 N;  4BRH A;  2W6L A;  3TSP A;  3CD6 N;  5GAH P;  3HTV A;  3N4Q A;  4FCY A;  3BEX A;  3CJ9 A;  1RTD A;  4CK3 A;  2Q97 A;  4XH5 A;  3T1Y K;  4ELU A;  3FZF A;  1S72 N;  2P9N B;  3CC2 N;  1DTT A;  1XNQ K;  2P9P B;  4JN4 A;  1MWK A;  2YCH A;  4HTU A;  5AZI B;  1JCG A;  2A41 A;  3SUO A;  1Q86 O;  1GLC G;  4Z0U A;  4A5A A;  4BRG A;  3O3F A;  3ALY A;  4JKE A;  4OKK A;  3F73 A;  2E2N A;  2UXD K;  3HRG A;  1HRH A;  1LW2 A;  1HPZ A;  3SLC A;  3ZEU B;  1IO2 A;  3NVK A;  4CVN E;  2NRH A;  5EU7 A;  3SJH A;  2VG5 A;  4K42 A;  1S1T A;  2HHW A;  1YAG A;  1C0M A;  2OPP A;  1BIZ A;  4BRD A;  4CJ3 A;  2XY7 A;  2O4G A;  3CCL N;  4BR5 A;  3O1W A;  2GTD A;  3AVJ A;  3WXK A;  3CJA A;  4C1N K;  3OS2 A;  4I2P A;  2D0P A;  4FJJ A;  2UXB K;  3ZSX A;  4AHV A;  4N47 A;  3CHW A;  2PYL A;  4CFA A;  3A0I X;  3THY A;  1RTJ A;  2IAJ A;  1LWC A;  4YOW A;  4GV3 A;  4LC9 B;  4H0X B;  3RR7 A;  3OW2 M;  4YOR A;  1NBW A;  4ISG A;  3H1Q A;  3G4S N;  1NK4 A;  2HNZ A;  3LDP A;  2D0A A;  4BE1 A;  4CJR A;  2G8W A;  2VCP A;  3EZ5 A;  3UB5 A;  4ZTF A;  1VSM A;  1T3V A;  4GV9 A;  3KD1 E;  1EKE A;  3MEC A;  1Q81 O;  4B3S K;  3DOL A;  3U8X A;  4HCC A;  4LD0 A;  3FR0 A;  3IG1 A;  1N34 K;  2HND A;  4DQ8 A;  4GKJ K;  3VPZ A;  1Z25 A;  4CJS A;  1S1X A;  3KK1 A;  2XHB A;  4FM2 A;  1BCO A;  3VQA A;  3LM9 A;  4K43 A;  5C2F A;  2ETJ A;  4CJ5 A;  1Z6R A;  4C8L A;  1FKO A;  3V1R A;  4BE0 A;  3P1G A;  1VQK N;  3MX2 A;  1XC3 A;  3LP3 A;  4DFK A;  4IO8 A;  2YNI A;  1GLF O;  3C95 A;  4PQU A;  3AVA A;  1TGO A;  1VHX A;  4YOU A;  4HTL A;  3H3N O;  5EY4 A;  5FRO A;  4JI8 K;  3QIC A;  4BDZ A;  4FLX A;  3LPT A;  3E01 A;  3QFP A;  4KRE A;  3J7Z O;  4PKI A;  4WQ4 A;  1NGF A;  2O8E A;  1FKP A;  3AO5 A;  1SV5 A;  3HST B;  3CM5 A;  2NRV A;  4H5T A;  1YTU A;  2E88 A;  2QKB A;  3CER A;  2A1R A;  3VQ5 A;  3S3M A;  4BY9 C;  2KTQ A;  2OCE A;  2ASO A;  4CEE A;  5ADX A;  4DV2 K;  1RCH A;  3RWU A;  1OVY A;  2OAN A;  2P9I B;  1WSJ A;  4WF9 L;  1G15 A;  4LH5 A;  5ADX H;  3U4L A;  4BGA A;  1IJJ A;  4FLW A;  4HUE A;  2WON A;  4M3Z A;  1HQU A;  2P9U A;  5AQT A;  1O13 A;  2HBM A;  4CHY A;  2GUP A;  3EEQ A;  4BRO A;  4F3O A;  4DQI A;  4O4G A;  3KLE A;  3E9P A;  1VSI A;  2Q2R A;  4ID1 A;  3DJC A;  4IOX A;  4IEE A;  1TUU A;  3A2F A;  3K9J A;  1HKG A;  3H08 A;  3CCQ N;  4YFU A;  1RT7 A;  3V9S A;  4RW6 A;  2D5R A;  2O8C B;  3OYF A;  2F4V K;  3NF9 A;  1N32 K;  4FJM A;  3KK7 A;  2Y1J A;  1BHL A;  1ZBF A;  4C8M A;  4KB1 A;  1NU0 A;  5FPN A;  2ZJR L;  1CLQ A;  1SZ2 A;  1QZ6 A;  3C6T A;  3DI6 A;  2QWN A;  1D9D A;  2G8V A;  3OY9 A;  3AVK A;  1BI4 B;  3QER A;  3RMB A;  4ELV A;  2KKZ A;  5AQI A;  1VRT A;  4B9S A;  4JS4 A;  4KHN A;  5HBM A;  1VQ4 N;  3SCX A;  4M42 A;  4NLC A;  2CH6 A;  4FL9 A;  2OPQ A;  4N41 A;  4BRC A;  5AQM A;  4JKA A;  1J54 A;  4BG8 A;  1Z26 A;  3ZT2 A;  5AZJ A;  4EP4 A;  1NOZ A;  4RTF D;  4LFA K;  3NF8 A;  3SUN A;  3FZH A;  3HPO A;  1B9F A;  4KTW A;  1IH7 A;  4H4M A;  4HUG A;  3WEE A;  1NK5 A;  2P9S B;  3KLF A;  1CXU A;  2A6A A;  3G25 A;  4CGH A;  4PY5 A;  4WFN L;  4FW2 A;  3SPZ A;  3WT0 A;  1H1V A;  3OJS A;  4CJP A;  1YIJ N;  3CQ8 A;  1E4G T;  4H0O A;  3ULE B;  2P9L B;  3AA3 A;  3D2E A;  4ISE A;  4OKJ A;  3LZJ A;  1YJ9 N;  3ZX3 A;  1WN7 A;  1HNI A;  3M8S A;  4JYA K;  3MEE A;  2F96 A;  4R5P A;  4IOC L;  3KKS A;  2DPN A;  5M1F A;  1NJY A;  2IGI A;  2FF6 A;  2F9W A;  2PFU A;  3PX0 A;  1HR0 K;  3VEO A;  1ZBI A;  2DFH A;  1TYQ A;  4CIG A;  4HCB A;  5HRN A;  4DV0 K;  4GKK K;  3LL3 A;  2IOC A;  4KH5 A;  4FM1 A;  3L8B A;  2RKI A;  4DV5 K;  1SQK A;  3K9K A;  5J2P A;  1X9J A;  1Q82 O;  1DEJ A;  3O4W A;  4DLG A;  2HF3 A;  3TR8 A;  2YX6 A;  4Z4E A;  4M7Y A;  1BOT O;  1LAW A;  2E2P A;  2OPR A;  4CJV A;  4CJT A;  3PUF A;  4DTJ A;  2P5G A;  4ILH A;  3THX B;  2VQF K;  3BDP A;  4DTO A;  5KGX A;  1O1W A;  1T6C A;  1XI1 A;  3WXJ A;  1M90 O;  1GLA G;  1KXP A;  3DRP A;  4BE2 A;  1JKH A;  4Z94 A;  4JKG B;  3W3D A;  1RBV A;  4CED A;  2GBZ A;  1RT2 A;  3ZT0 A;  1ZXO A;  3RRH A;  1T7P A;  1X1P A;  1KCF A;  4B1Y B;  1K73 O;  4FK2 A;  2JWL A;  4QAG A;  5BRE A;  3TAM A;  4OGE A;  4DSK A;  2BAN A;  3HXM A;  4FJK A;  2VYP A;  1D4X A;  1K8A O;  1E3M A;  3AO3 A;  3M6G A;  1SKS A;  3VQE A;  3L3V A;  5GIN A;  4K0K K;  4Z4F A;  1IBK K;  2WBN A;  5AQH A;  5BN8 A;  4XIU A;  3HVT A;  1EET A;  4N5S A;  3NAE A;  1KC8 O;  3QFU A;  2RHK A;  4JHD A;  1JL1 A;  3C6U A;  4CJF A;  1RDC A;  3P83 D;  3BZK A;  5JVG L;  3T3F A;  3NGZ A;  2NRX A;  3T69 A;  4JLH A;  5BPN A;  1CZB A;  5DM6 L;  4DB3 A;  4R79 A;  2E1Z A;  1VSD A;  1RFQ A;  3AVC A;  2FSJ A;  5AQX A;  3AA5 X;  3D2E B;  4KHP K;  3H45 C;  3P38 A;  3LDQ A;  2IC3 A;  5HL7 L;  2IVP A;  4NCG A;  2D0C A;  2VWB A;  2GEM A;  2JWK A;  5KGW A;  3IRX A;  4FWS A;  2XY6 A;  2D0B A;  2NRR A;  4E7L A;  3OHR A;  3CM6 A;  1S22 A;  1ATN A;  3R9P A;  5GIO A;  3DLL L;  4RW9 A;  3TAB A;  4BC2 A;  4FWP A;  3CJB A;  5LL6 Z;  1UWB A;  2Q3S A;  1UOC A;  4IZ9 A;  1DKG D;  1W9H A;  3EO3 A;  1KQS M;  1MU2 A;  3ZSO A;  2UUC K;  3V81 A;  4OLB A;  2KLA A;  3V4I A;  3OBW A;  4FJ5 A;  4ILG B;  3ZYY X;  2P9S A;  4K8Z A;  4DTS A;  4E1J A;  4KKO A;  5AQK A;  2ZWH A;  2O8C A;  2GX9 A;  3O5B A;  2HVI A;  1S9E A;  3LAK A;  4CEA A;  4CJQ A;  3TAQ A;  1ZBH A;  2YKN A;  2W41 A;  5E41 A;  3ZT3 A;  4E89 A;  3VGM A;  3DMJ A;  1R0A A;  1IV0 A;  4DTN A;  3AVF A;  3DWL A;  4FJ8 A;  1BIS A;  3VET A;  4KI4 A;  4M45 A;  4Y1D A;  3CMA N;  4DU1 A;  2B6A A;  1OKJ A;  4DV6 K;  3LDL A;  3RSE A;  1NM1 A; 
#chains in the Genus database with same CATH homology
 3BY5 A;  2W6K A;  3EEQ A;  2W6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...