1J53A

Structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
174
structure length
174
Chain Sequence
RQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA polymerase III, epsilon chain
publication title Structural Basis for Proofreading during Replication of the Escherichia coli Chromosome
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1j53A00
3NDKA 1CLQA 1W0HA 1SV5A 3AVNA 2HHUA 4DTJA 4CJWA 2PYJA 2Y1IA 3TR8A 3HP6A 3K5NA 4FYDA 3HP9A 2IS3A 3AVFA 3SUPA 2FBYA 4IFYA 3AA4A 4BE2A 4OLBA 1J9AA 1S6PA 3AO1A 4G1QA 1Y97A 3HL8A 3K58A 2HW3A 3SZ2A 1JLBA 3L2QA 1SL2A 5CYQA 2G8FA 4K8XA 4FJKA 4GVMA 4LH4A 4JRPA 4PA1A 3DOLA 3ZSYA 4CJUA 3OYIA 3C94A 4LH5A 3F9KA 1S9GA 5KRTA 4W5NA 1VSIA 3SV3A 1QQCA 1KVCA 3KIOA 4NCBA 1REVA 3P5JA 4Z4GA 3AVAA 2HHSA 2A1RA 4W5OA 4B9MA 4IFVA 5DMRA 3OYHA 4F2RA 1QS4A 2HB5A 3OY9A 1T05A 1KCFA 4O44A 1J53A 2ZE2A 3VQPA 3SJJA 4DTUA 2QK9A 3QEPA 4CFCA 4M3WA 4FXDA 3NH0A 3ZSRA 3LDSA 4E7JA 3L3VA 1TK8A 2P5OA 1S9EA 1FK9A 4DQSA 3TAEA 1A5VA 1WSJA 1JL1A 1IKVA 2O4GA 2PZSA 4HCBA 5D3GA 4E7LA 2IDOA 4M42A 1LWCA 2EX3A 3OJSA 1BI4B 1Q9XA 5HRPA 2E4LA 4Z4IA 1VSHA 4BDYA 1T03A 2DFHA 2FBVA 4KTZA 1A5XA 3LZIA 1TKZA 4CJSA 4HUGA 3VQQA 4DU4A 1EP4A 2YKMA 2BE2A 3VQBA 3AVCA 1U45A 1L3TA 1D9FA 3ZT3A 3HYFA 1NOYA 2BGGA 3NBPA 3LP0A 1KVAA 2G8IA 1IO2A 3RMAA 1ZBLA 1RT2A 4FLZA 1DTQA 5SZTA 3SQ0A 4DTPA 3TI0A 4EZ6A 3AVJA 3AO5A 4Q0BA 4BWMA 1BI4A 3E01A 3WNEA 1C1CA 1RDBA 4AHSA 3TAFA 4AHCA 3IG1A 3O3HA 4O0IA 3CYMA 3IRXA 3QNNA 1U48A 4E7HA 3NF6A 5J2PA 3HXMA 1UA1A 4DG1A 1NKEA 3SYZA 5C25A 2DTUA 1IKXA 3OS2A 1RBRA 4ELUA 2F96A 4CK3A 4F4KA 4DQPA 3VA0A 2ETJA 2VG6A 3AA5X 3CFOA 4FM2A 4DQIA 4CFDA 1RILA 4CGHA 4CF1A 5C42A 4DSIA 2IC3A 4EZ9A 3S3MA 2VG5A 4FCYA 4IBNA 4DSJA 4CEEA 2KZMA 3SPZA 3U6FA 1WN7A 4E0DA 3AVLA 4EP5A 4E7KA 3SUQA 4GW6A 1IG9A 3AVGA 4BDPA 4KB1A 3I0RA 2HHTA 5FDLA 2OPSA 3OYKA 2LSNA 1RBVA 4Z4FA 1WNSA 4CJVA 1ZBIA 5FRNA 4CJEA 4DS4A 4B9LA 3V9ZA 3ISNC 2P1JA 1VSMA 3CM6A 2WONA 3VQ4A 3WNGA 1DLOA 4Z4CA 3KK1A 1L3VA 4B3OA 3V1QA 5HROA 4DF8A 3MXIA 4CGGA 4C8KA 3IS9A 5JS2A 4AILC 4N41A 3O3GA 4HHTA 2G8HA 1U47A 3CM5A 3HVTA 3QINA 2Q3SA 4CGJA 3DRRA 4CJRA 4FJMA 3LP3A 5KGXA 3VQAA 4FJIA 3LAMA 3ZSQA 4J2BA 4C8NA 3V1RA 3D0PA 4DWIA 5K14A 3QERA 3PV8A 3K59A 3BDPA 2Z1HA 4PWDA 3KJVA 1IH7A 2YNIA 1JXBA 2ZD1A 1NOZA 3L2VA 1BGXT 3U3GA 4KAZA 1D8YA 3VN5A 3AVMA 4DSLA 3P83D 4FLYA 4DFPA 3S3OA 2KZZA 3CG7A 4DFMA 1VSDA 5CY4A 3LALA 4FJLA 1I3AA 1S1VA 1N5YA 4BWJA 1CZ9A 4OKJA 1X9WA 3TAPA 4FLXA 2OZMA 3AVHA 2YHAA 3AV9A 2XO7A 4AHRA 3KKSA 2HHWA 4H4OA 1TKTA 4ZHRA 3OVNA 4OLAA 3OYAA 3QLHA 1LWEA 3NE6A 2X74A 4MFBA 3KLHA 1LV5A 2E6MA 2B4JA 4E19A 1JXEA 1XWLA 4J2DA 5HRSA 4CGDA 1XHZA 3U3YA 4KHYA 2HNDA 5I42A 3NGYA 5FROA 3CFPA 2O4IA 4RG8A 3QO9A 4DU3A 3TARA 2Z1IA 3OYMA 4NCAA 3HSTB 1BISA 4QAGA 4FJ9A 3NGZA 1SKWA 3L2RA 4CHZA 3AVBA 3VQ6A 4FJGA 1TKXA 1HQEA 4RW8A 3NFAA 3VQCA 3ZT4A 2D0BA 3DMJA 1LAVA 4FW2A 3DLRA 3ZT1A 3AA3A 3SQ2A 4ZTFA 1XI1A 2KFNA 1CXUA 2DY4A 2D0AA 3ZSZA 1S1TA 1RCHA 3LAKA 5FRMA 1NK5A 2YNFA 3LANA 4CFAA 1XHXA 4OPKA 3HVRA 1UA0A 1NK4A 4WE1A 2HMIA 2PY5A 4KTQA 5J2NA 4CK2A 3RRHA 4CJ3A 2JLEA 4FJJA 1ZYQA 4I2QA 2B5JA 3ZCMA 1GOAA 1D5AA 3RWUA 1VRTA 1HYVA 4B8AB 4B9VA 1S1XA 2X78A 1HNVA 3QEXA 1LAWA 3O4NA 3BGRA 1BHLA 1JLEA 2ITGA 1Q8IA 3OYEA 2XY7A 2KFZA 1A5WA 4CHYA 4BACA 3RR8A 4CGFA 2E6LA 2W42A 4DFKA 4OGCA 4KRFA 1U4BA 3EZ5A 4ELTA 4L8RB 1NK9A 5T7BA 1UAXA 4KHQA 4CHQA 3NF9A 2BDPA 3EYZA 3NCIA 4CHNA 4FM1A 4OVLA 1L3UA 4CHPA 3DI6A 4FVMA 4CJKA 2P5GA 2QKBA 2AJQA 3SUNA 1KTQA 1RT3A 4AHTA 4KI4A 4QCLA 4CIGA 2RN2A 4AHVA 4CJPA 3C95A 3KD1E 3T19A 3ZSXA 4IG0A 3OYNA 5KTQA 5J2MA 3V81A 2Z1JA 4F2SA 2QXFA 1WSHA 3RMCA 1QE1A 3PO5A 1HYZA 4OJRA 3B6PA 1NK8A 1FKPA 4DTNA 1YTAA 4HTUA 3LP1A 4FM0A 3DLHA 1B9FA 1NK6A 2OZSA 4XIUA 3NGIA 4PY5A 4N56A 4FK4A 3KK2A 3SI6A 4KHNA 3QNOA 2HVIA 1TKDA 5EU7A 2KTQA 4K8ZA 1CZBA 3T3FA 2JGUA 4CF0A 4DLEA 3A2FA 1KSPA 3OYGA 3RR7A 1HYSA 4OPJA 4DTOA 2X6NA 1R0AA 4CK1A 1G15A 3O3FA 4FLUA 4ID5A 3NF8A 4DTRA 1RBUA 3L8BA 3K5OA 5KGWA 2OPQA 4CJTA 4IDKA 4CERA 2OYQA 4FLTA 4B9TA 1TAUA 1C1BA 4BE0A 3SNNA 2X6SA 2ATQA 3KLFA 1RT4A 4O0JA 1LW2A 4MQ3A 3T1AA 3RMDA 3PUFA 3LWMA 3WNFA 3OJUA 1HJRA 1QHTA 4Q5VA 3JSMA 3QEWA 4KHWA 3VQ8A 4W5TA 4CE9A 4C8OA 1XC9A 3HO1A 4H4MA 1J54A 1SKSA 5KI6A 2G8WA 4FK2A 2D0CA 4O4GA 1C0TA 4CJ5A 4CCHA 1BCOA 1YTUA 3KLIA 3NH1A 1JKHA 3O4QA 5J1EA 4YFUA 1S6QA 1RT7A 3KLEA 1QSYA 1TK5A 3V6DA 4NCGA 2BANA 1QSLA 3QIPA 3TAGA 3DOKA 3I0SA 4KFBA 4M3ZA 1EX4A 4M41A 4AH9A 1JL2A 3MEEA 4OKEA 3DLEA 3M8RA 2GUIA 4DQRA 3OYFA 1RBTA 4DTSA 2OA8A 1KFDA 3HPOA 1X9SA 4JLHA 3HK2A 4DSFA 3DRPA 4I9QA 4CEOA 3EY1A 4Y1DA 1JLAA 3D45A 1S1WA 3QEVA 5KRSA 3UIQA 4F3TA 1Z26A 3B6OA 3G10A 3ITHA 4IKFA 2D5RA 4FZZA 3ASMA 1W9HA 3OYLA 4DQQA 1BCMA 2F8TA 2YHBA 1BL3A 1Z25A 4KHUA 1IKYA 3VQEA 4CF8A 5JS1A 1D9DA 3HPGA 4CGIA 4B9UA 2OPRA 2VWKA 4LSNA 4O55A 3VQDA 4KI6A 4N5SA 5CYMA 3OYJA 4NYNA 4JS4A 1ZBHA 4KKOA 4N76A 4QOZB 2RPIA 2Z1GA 4R5PA 4JS5A 3QEIA 4TSXA 4C8LA 4M3RA 2IOCA 3JYTA 4LSLA 2YKNA 2G8VA 2I5JA 3L2WA 4CEBA 2OPPA 4FZYA 3K57A 3K2PA 4EP4A 1VRUA 3V9UA 1HMVA 1DTTA 4Y1CA 1S1UA 4CIFA 4B9NA 3PY8A 5CZ2A 1C1AA 1SL0A 4CEZA 4FZXC 3NF7A 1WSEA 3ZT0A 1T7PA 5HP1A 3PX6A 4E1MA 3K5LA 1TK0A 1NKBA 1BIUA 3I8DA 3HJFA 4RW4A 1TL1A 1KVBA 2GV9A 2ZQBA 3HPHA 1ZBFA 3VQ9A 3C6TA 4UQGA 3KTQA 2EHGA 2XHBA 4M3UA 4ELVA 4DU1A 4H8KA 3TAQA 1BQNA 4M3TA 4KREA 1B92A 4CEFA 4E3SA 1O1WA 2QKKA 4FJ7A 2A1SA 3TAMA 3RMBA 1TAQA 1B9DA 1TL3A 2HHVA 3OS1A 4RW7A 1CXQA 2G8UA 3AO3A 1VSFA 3HM9A 4CECA 3THVA 4E89A 3KK3A 1ASVA 3KD5E 4ICLA 5C24A 1WAFA 1HPZA 4W5QA 3KLGA 1EETA 4BE1A 3V9SA 4N47A 1RNHA 3PO4A 1RDDA 3WNHA 4RW9A 3NH2A 1WAJA 4KB0A 1LWFA 3ULDA 2B6AA 4CF2A 5HRRA 3AVIA 1RTHA 2FC0A 4YNQA 5J2QA 3CQ8A 1RTJA 4OGEA 3SPYA 2VWJA 4CJ4A 4O5BA 1QSSA 3AA2A 3K5MA 3P1GA 3AVKA 4DTMA 4RW6A 3DLKA 3DRSA 3CFRA 4DTXA 3VQ7A 3S3NA 4I2PA 4LY7A 1NJZA 4NYFA 1KRPA 4CEQA 4FJHA 2RF2A 1RDAA 1SKRA 3FFIA 3DYAA 4CIEA 1YT3A 3V9WA 4CJLA 4HUEA 4M3YA 3S9HA 4CEAA 1NK7A 3QESA 2IGIA 3KKRA 3MAQA 3V1OA 4FJ5A 4IG3A 4M45A 4Z4HA 4I9LA 3NAEA 1BIZA 1GOCA 3DLBA 3L2UA 1WSFA 4E1NA 3RRGA 2IAJA 3DM2A 1I39A 3MEGA 1X1PA 3OYDA 3TANA 4FK0A 1RTIA 4C8MA 4B9SA 1NJXA 4Z0UA 1LW0A 1BQMA 3ALYA 4DF4A 2WOMA 2GBZA 2KQ2A 4OKKA 1NJWA 1KFSA 1JLFA 4CJQA 1HNIA 4B8CA 4CESA 2FBTA 1TVRA 3LZJA 1RT5A 3MECA 3SQ1A 4FJXA 5SWMA 4FLWA 2G8KA 2RKIA 1RDCA 1UOCA 3NHGA 1WLJA 1GOBA 2HNYA 3LPUA 4FW1A 1VK0A 4DS5A 2NUBA 1WSIA 1JLGA 3M8SA 2R7YA 3MEDA 3RTVA 3V9XA 4J2AA 2HNZA 4KHSA 4CEDA 4Z4EA 3SCXA 4I7FA 2KW4A 1UWBA 1EKEA 3LPTA 3F73A 4KO0A 4W5RA 1VSEA 3ZSVA 4PUOA 1YVUA 3AO2A 4FLVA 1JLQA 3G0ZA 3QIOA 3DLGA 1L3SA 3OYCA 1L5UA 3AO4A 4CFBA 3PX4A 4ZTJA 3V4IA 5I3UA 1C0MA 3QETA 3ZT2A 1ASUA 4KPYA 2P51A 4FJNA 2YNHA 4DLGA 5CZ1A 5HBMA 4DSKA 3M8QA 1C0UA 1X9MA 3HT3A 4J2EA 1K6YA 1TGOA 4E7IA 3MXJA 3TWHA 3ZSWA 3IAYA 4PQUA 1C6VA 1NJYA 1T8EA 4KTWA 1RT1A 2XY5A 4F8RA 1FXXA 1U04A 2DFFA 3SV4A 1QTMA 3LP2A 4HCCA 4M3XA 2HHQA 3OS0A 1KLMA 1F21A 1ZBUA 1RBSA 4ID1A 3ZSOA 3M8PA 1SUQA 1RTDA 1SL1A 3SQ4A 2HHXA 2XY8A 1ASWA 1TV6A 5HRNA 1NK0A 5E41A 1ITGA 4DFJA 1IKWA 4B08A 3TABA 1N6QA 1J5OA 2PYLA 3VA3A 2F8SA 4HUFA 2HVHA 4CHOA 3MXMA 1S5JA 2XY6A 4F3OA 4DMNA 1FKOA 1VSKA 1KLNA 4DSEA 1RT6A 4FJ8A 4KV8A 4LD0A 2FBXA 4CF9A 1NKCA 3H08A 5DK5A 3LWLA 1VSLA 1HRHA 1VSJA 4AHUA 4HVJA 3SUOA 3PX0A 1EXQA 1JLCA 3L3UA 4JRQA 2YV0X 3VQ5A 1U49A 3C6UA 2DFEA 3OYBA 4CJFA 4GMJB 5HLFA 1HQUA 2VG7A 2YNGA 1MU2A 2XRIA 1Q9YA 2Y1JA 1WSGA 4BDZA
chains in the Genus database with same CATH superfamily
2O8EB 3AVNA 2PYJA 2Y1IA 4LF8K 3SJHA 3D2FA 3MWPA 4DCHA 4G1QA 4B3TK 4JRPA 3VERA 4PA1A 3DOLA 4CJUA 5C2FA 4W5NA 3F9KA 5HOOA 3RSEA 2KKZA 4B1XB 1REVA 4NXMK 4Z4GA 3CC4N 3AVAA 2QWPA 2HHSA 4WF9L 5C15A 4HWIA 1QS4A 1KCFA 1OH6A 4O44A 4X66K 4CFCA 3NH0A 3ZSRA 4YORA 3L3VA 1FK9A 1A5VA 3LM2A 2PZSA 2IDOA 4M42A 1LWCA 1BI4B 1Q81O 3VOVA 4BDYA 1V4TA 5JVHL 3O1WA 3LDOA 4QS8A 1EP4A 3AVCA 3ZT3A 3HYFA 4B1YB 2BGGA 4DR7K 2G8IA 5SZTA 4EZ6A 3AVJA 3E9OA 2UU9K 4AHSA 3IG1A 4O0IA 3IRXA 1NKEA 4ISGA 4E7HA 3U9DA 3ZEUA 3HXMA 5J2PA 1UA1A 3SYZA 2P9LA 1IKXA 4ELUA 5GIOA 2P9KB 4H0TB 3CFOA 2HVIA 2HSTA 3AGRA 2IC3A 1N34K 4FCYA 4IBNA 4K41A 4GKKK 4RWTA 4DSJA 1VQNN 3HZ6A 2HMPA 5A2QO 2HHTA 5FDLA 2NZTA 5AQNA 1ZBSA 3T1YK 4LF6K 1VSMA 4JKDA 1YITN 4B3OA 4PKIA 3MXIA 5JS2A 4JI6K 4IXCA 4CGJA 5KGXA 3VQAA 4OPHA 5GIPA 1VQKN 3V1RA 2O8CB 3BDPA 2Z1HA 3CJAA 3CJ1A 1IH7A 4IOAL 1YUWA 3BZCA 3FLCO 1NOZA 2I7PA 1EWQA 1T6CA 3AVMA 4DSLA 3P83D 4FLYA 3ZYYX 3CG7A 2ASMA 1S1VA 3R1XA 3GG4A 5BRHA 3CJ7A 3O9SA 4BWJA 4YDUA 3TAPA 4FLXA 2OZMA 4AHRA 1G99A 1TKTA 4EAHD 4ZHRA 4LF5K 4A57A 3CHWA 4JKFA 3TTFA 4BGAA 2E6MA 3WQTA 3CXCM 4E19A 4CGDA 4BRPA 4KHYA 1LOTB 4AF1A 4DU3A 4NCAA 1NGHA 5AQHA 2FLOA 1BISA 3L2RA 4AM7A 4RW8A 1NGGA 3VQCA 3NFAA 3ZT4A 2CGKA 3DMJA 2P9SB 2DY4A 4EIAA 4DUYK 2D0AA 2GEMA 1OH8A 1KC8O 2Q97A 3ZSZA 5BREA 1RCHA 5BPLA 2VQFK 3LANA 5F2RA 1HUXA 3TSUA 3LDNA 3THXA 4GY2B 4CJ3A 2JLEA 4FJJA 3DLLL 4I2QA 1VRTA 1HYVA 2X78A 2FF3B 1LAWA 3BGRA 2XY7A 2ITGA 1Q8IA 3OYEA 3CPEA 1A5WA 4JI1K 4BACA 5AQMA 4CGFA 1EQYA 3ZETA 4DFKA 4KRFA 3EZ5A 4L8RB 4WFBL 2BDPA 1NM1A 4CHNA 4CHPA 4CJKA 3U8XA 3ID6A 4AHTA 4KI4A 1KAXA 4CIGA 2RN2A 4ISFA 4BRNA 3T19A 1WB9A 2F9TA 3JS6A 4F2SA 2QXFA 1VQ4N 1NK8A 3GOIA 1FKPA 4FM0A 3NGIA 3P38A 3RVCA 4DUZK 3SI6A 5AQZA 5AZJA 5EOYA 3P31A 4OPJA 1DEJA 1XNQK 4JHDB 4DTRA 4BC5A 1N36K 4IWVA 5E84A 2IVPA 4BE0A 1BA1A 2X6SA 3RMDA 1LW2A 3T1AA 3LWMA 1Z6RA 3SBGA 3I56N 3DXKA 3OJUA 3JSMA 4Q5VA 4CE9A 5AZIB 4B3MK 2D0CA 5TKYA 1BCOA 1NGJA 1SAZA 2WFBA 4YFUA 1YJWN 2BANA 1QVGM 5FLXO 4B1WB 4M3ZA 4BROA 1S72N 3MEEA 2OYQA 3BZKA 3TU5A 3OYFA 1YJ9N 5AQRA 4DSFA 4CEOA 4Y1DA 3A8YA 1JLAA 3O80A 3J7AP 2FSKA 3G10A 4IKFA 1GLLO 1BL3A 4JD2A 1IKYA 3VQEA 4BR4A 1OH5A 5M1KA 4N5SA 5CYMA 3ENHA 1ZBHA 4JS4A 1WUAA 4JS5A 4B9QA 3JYTA 4LSLA 2ZF5O 3VTHA 4FZYA 1TUUA 3QFPA 1HMVA 4FWKA 4Y1CA 1Q7YO 1OH7A 4FVUA 3NF7A 1WSEA 3WUHA 4NXNK 4GV6A 4U7BA 3C65A 3CD6N 4H8KA 3TAQA 3HTVA 3R8EA 4M3TA 2I7NA 3WXJA 4CEFA 3GDQA 4H0OA 4FJ7A 1TAQA 4RW7A 3WXIA 1NGAA 1U2VB 5AQVA 2FSJA 4ICLA 1X9JA 4BE1A 1EETA 3V9SA 5AQKA 1BWFO 3PO4A 1RDDA 4BRMA 4RW9A 1GLJO 3NH2A 2NRWA 2VWBA 3ULDA 3AVIA 4OGEA 3CJCA 5AFUA 3P1GA 4RW6A 3DLKA 3CFRA 4NB4A 3SAFA 2GWKA 1TYQB 1SKRA 1YT3A 4FWRA 4CJLA 4M3YA 3F5TA 4CEAA 4FJ5A 2IGIA 2NRHA 2UXBK 4IG3A 3O9QA 2HBKA 4I9LA 3DLBA 5AQUA 4E1NA 2IAJA 3MEGA 4CZKA 1RTIA 4IJAA 1BQMA 2WOMA 1JLFA 4C1NI 2OTLN 4CESA 1RT5A 1I94K 4FJXA 4FLWA 2G8KA 4FW1A 3LPUA 3SMSA 2F4VK 1WSIA 4GNIA 3V9XA 4IJNA 2O8DB 4KHSA 4Z4EA 2KW4A 3AAPA 3PIOL 3F73A 3IKMA 4KO0A 1VSEA 3OA9A 4PUOA 3VESA 4DV2K 3CCVN 3DLGA 4H0YB 1L5UA 4JI8K 3AO4A 4ZTJA 3G71N 3ZT2A 3VGMA 5CZ1A 3L6QA 4DR3K 1C0UA 1K6YA 4ILJA 1T8EA 2XY5A 1BU6O 2DFFA 2HF4A 3CCLN 3LP2A 3CQYA 4M3XA 2HHQA 2UYTA 1KLMA 1RBSA 4ID1A 1XUPO 3M8PA 1SUQA 2QWOA 3CIPA 1SL1A 2HHXA 2XY8A 3DXMA 4JV5K 1NK0A 4DFJA 3TABA 1GLFO 4JYAK 2XY6A 3IUCA 3VENA 1VSKA 1R59O 1RT6A 2FXUA 4LD0A 3H08A 3LWLA 4AHUA 1S22A 2W40A 1JLCA 4JRQA 5BRFA 2RHKA 4MDAA 4GMJB 4CJFA 2VG7A 3NVMA 3CI5A 4CJWA 4FYDA 3HP9A 2IS3A 1HX1A 3OTOK 3E9LA 4IFYA 4OX9K 1Y97A 4YOVA 3SZ2A 1JLBA 1NGBA 1SL2A 2G8FA 3OYIA 4NLCA 3SV3A 3O8MA 1W7AA 3KIOA 3MN5A 1BG3A 4W5OA 4CI6A 5DMRA 3UKUB 3EEQA 4B1VA 4BRAA 3D2EB 5F1XA 1YIJN 2HB5A 2UUBK 3VQPA 2ZE2A 3O4WA 3SJJA 3QEPA 4DQ8A 4FXDA 3Q7BA 2JWKA 1K8KA 1WSJA 1IKVA 2O4GA 2RE2A 5BN8A 2WTUA 5BPNA 3OJSA 3LL3A 2E4LA 4DR6K 1VSHA 3C7NB 1TKZA 4JKGB 5E26A 3VQQA 1L3TA 4FPBA 2E2QA 4BRLA 3NBPA 3LP0A 3VF4A 1QQMA 4GVEA 1IO2A 3RMAA 1H1VA 2NRZA 4FLZA 2GX9A 3AO5A 4Q0BA 1BI4A 1C1CA 3R6MA 1RDBA 3CYMA 5C10A 1U48A 3NF6A 4PL7A 3O1BA 2DTUA 5C25A 2F96A 3THWB 3VA0A 4DQIA 1N32K 1RILA 4CGHA 3C0BA 4EZ9A 1NG9A 3FR0A 3U6FA 4E0DA 3AVLA 4EP5A 3VGLA 3SUQA 5FPDA 4GW6A 3J81O 4BDPA 4AM6A 2P9KA 5C12A 4Z4FA 1WNSA 3VF2A 4CJVA 1T6DA 5BN9A 1IBMK 2PBDA 5FRNA 4CJEA 1YAGA 3VQ4A 1L3VA 2WONA 3WNGA 3KK1A 4BRKA 5AQGA 1HNZK 1HKGA 4DF8A 4C8KA 3IS9A 4N41A 3IDHA 3CMEN 3M3ZA 3ID8A 5ADXH 3QINA 4MDBA 4FJMA 3DRRA 3D7EO 3LP3A 2QI2A 4B3SK 4FJIA 3B8AX 3KK7A 3I55N 3C6HA 2QXLA 4DWIA 5K14A 3QERA 4PWDA 1JXBA 3L2VA 3EL2A 3S3OA 2W6LA 4DFMA 1VSDA 5CY4A 3H46O 1N5YA 3VF6A 4C23A 3AV9A 1O13A 4BC4A 3KKSA 5EVZA 2O8FA 3OVNA 4B1UB 3NE6A 2X74A 3KLHA 4J2DA 1IBKK 4V19S 2BUPA 3CFPA 2FF6A 5FPMA 3HSTB 4FJ9A 4B1ZA 1P90A 3NMUA 4FJGA 4O8KA 1HQEA 4IEIA 4ZTFA 3SQ2A 1XI1A 3ZT1A 1CXUA 4E1JA 4K0KK 5AQXA 5FRMA 2HBLA 3CPWM 1P8ZA 1NK4A 4WE1A 5M1FA 1ZYQA 1VQMN 2E1YA 3ZCMA 4LFCK 1GOAA 1ATNA 4B8AB 3QEXA 1BHLA 2KFZA 3CJ9A 1U4BA 4ELTA 3H6EA 1UAXA 3MWTA 2BTFA 4JKBA 5CHIA 4KHQA 3NCIA 2ZWHA 3L4QA 3CCUN 2AJQA 3SUNA 1KTQA 2E5LK 4AHVA 3TSQA 3ATVA 3SK3A 1VQPN 3KD1E 4IG0A 2IVOA 2JWLA 2E2PA 5J2MA 2Z1JA 3V81A 4IO9L 4LC9B 2GWJA 1SS6A 3H3OB 3O9TA 4K43A 3B6PA 4HTUA 5LY3A 5ADXA 1NK6A 4JI3K 4CD3A 4XIUA 4N56A 3KK2A 4KHNA 2IIRA 4K8ZA 1QHAA 3RR7A 4CZLA 3O3FA 2V51B 1RBUA 3L8BA 3K5OA 4CJTA 3VGKA 4IDKA 4CERA 5H1SQ 3SNNA 3NVKA 1Q18A 1RT4A 4O0JA 2QWNA 3OBWA 4JHDA 3QEWA 2P9IA 4KHWA 1VAZA 3VQ8A 4C8OA 4H4MA 5KI6A 4MO4A 2Q36A 5JLFA 2G8WA 4O4GA 4CZIA 5J1EA 4H5NA 3UKRA 1TK5A 4NCGA 4YOXA 3TAGA 3J80O 1EX4A 2NRVA 1JL2A 4OKEA 4DTSA 1WBDA 1RBTA 2OA8A 4JLHA 2A5XA 2P9UB 3DRPA 3G4SN 3MX5A 5GADP 3HBTA 4IFEA 3MX2A 4DB3A 1Z26A 3HRGA 3ASMA 4DQQA 3OYLA 2F8TA 4KHUA 4O5FA 1K8AO 4CGIA 4O55A 2VWKA 3CCQN 2HBJA 2P9NB 3OYJA 4NYNA 1ZXOA 4N76A 2Z1GA 3QEIA 4TSXA 4C8LA 1MWMA 2E2OA 4CZGA 4J8FA 4CEBA 4OO1J 3K2PA 1VRUA 3V9UA 2P9PA 1DTTA 1S1UA 2OANA 4FZXC 4CEZA 3D2FB 3PX6A 4E1MA 4H5RA 1NKBA 1BIUA 4YDUC 1NMDA 3HPHA 3SMPA 2NRXA 5AQYA 4DU1A 3OW2M 3FZMA 1BQNA 3CERA 3RSEB 4MLHA 4E3SA 2QKKA 2HHVA 4CVNE 1C0FA 1CXQA 2G8UA 4H0VB 3AO3A 5DM6L 3HM9A 3P39A 3KD5E 3FFKB 3ZX2A 5TKWA 3QBXA 1Q82O 3QBWA 1WAFA 4W5QA 4N47A 2Q1NA 4YOUA 4FWQA 5J2QA 4JI4K 2B6AA 2FC0A 1QSSA 3AA2A 3ENOA 3K5MA 3A5LC 3VQ7A 4BR5A 4LY7A 1NJZA 3MCAB 4DHYA 4NYFA 2RF2A 4JI7K 1RDAA 3BEXA 4HUEA 4M63C 2YCHA 2H3GX 3ULEA 3NAEA 3ZEUB 2ZGYA 4RCHA 3DM2A 4MO5A 3TANA 4B9SA 1NJXA 1OKJA 4BRGA 5AFUH 4OKKA 1QQNA 1GLBG 4CW7B 3LZJA 3MECA 3SQ1A 5SWMA 1WLJA 2A40A 3TTDA 4DS5A 5GINA 3WXMB 2VYPA 2V52B 2EWSA 4W5RA 3G0ZA 3KHYA 3PX4A 3V4IA 5I3UA 2F9WA 1C0MA 3QETA 1ASUA 1XQSC 1SZ2A 2O8DA 4MLEA 5HBMA 4DSKA 1RDWX 4BY9C 1TGOA 3MXJA 3MCPA 3ZSWA 4DV6K 3TWHA 3IAYA 1RGIA 1C6VA 1W97L 1FXXA 3M1FA 3SV4A 1QTMA 4WQ5A 4FSVA 5AQFA 3ZSOA 1E4FT 2F7TA 1RTDA 3SQ4A 3WXLA 3SAGA 1NGEA 3LDPA 5GAHP 1TV6A 3ZX0A 1ITGA 1N6QA 1IKWA 4WCEL 3MN6A 2PYLA 3THYA 1KQSM 2F8SA 4HUFA 2HVHA 1S5JA 3HSCA 5FPNA 4F3OA 1BO5O 1XMQK 4DSEA 1KLNA 1NKCA 3IMXA 1VSLA 4GKJK 1VSJA 4FWOA 5LMNK 3C6UA 2AA4A 2DFEA 5HLFA 5FPEA 2YNGA 4ISEA 4XH4A 4BDZA 3WEEB 1CLQA 1W0HA 5EXWA 2ZJRL 5IWAK 4YOYA 3HP6A 2UUAK 3AVFA 4BE2A 4OLBA 3BUZB 3WT0A 3THXB 2YHWA 3L2QA 2VGNA 4K42A 5CYQA 4FJKA 3DAWA 4ILHA 2Q0RA 3ZSYA 5DM7L 3C94A 2VCPA 5KRTA 1S9GA 1JJ2M 1QQCA 1KVCA 4YOWA 5BR9A 4GV3A 4WQ4C 5B8HA 2A1RA 3OYHA 4B3RK 3ZETB 4H0XB 3OY9A 2WBNA 1HKBA 5M1OA 4DTUA 1VQ7N 4M3WA 3LDSA 1TK8A 1D4XA 4DQSA 3TAEA 1JL1A 4U67L 4HCBA 5D3GA 4NO7A 2EX3A 1Q9XA 4Z4IA 4CBUA 4KTZA 1A5XA 3LZIA 4CJSA 3ZX3A 4HUGA 4BVPA 2ZJPL 3AGKA 2YKMA 3VQBA 3CCSN 1U45A 4JI2K 1D9FA 1NOYA 1HNWK 4JKCA 1ZBLA 1RT2A 4DTPA 4BWMA 3WNEA 5AZJB 4LF9K 3TAFA 4DV4K 4LFBK 2KZMA 4JK8A 1NGFA 4CK3A 4F4KA 2J4RA 4DQPA 2ETJA 2VG6A 4FM2A 5C42A 4BR7A 2VG5A 4WFNL 3EKUA 4CEEA 4BREA 2ASOA 5KQDA 1WN7A 3AY9A 4E7KA 1IG9A 3SBTA 5AQPA 1YJNN 2LSNA 1RBVA 4WYBA 1ZBIA 2E8AA 3CETA 3V9ZA 3GE1A 2P1JA 2AP1A 4Z4CA 2OTJN 5CE3A 3E9PA 4AILC 2PAVA 3QDKA 4HHTA 1U47A 3CM5A 3M6GA 2Q3SA 3LAMA 3W3DA 4J2BA 3IFRA 4A61A 3A5MC 3K59A 1OVQA 3ZLJA 4H03B 3O9UA 3F2KA 3LALA 4FJLA 3E1YA 2A6AA 2WC9A 1RFQA 4FOEA 5AQJA 4CD1A 3MDQA 2A42A 1X9WA 3AVHA 2YHAA 3QB0A 1ILYA 2HHWA 4H4OA 3CCEN 3VEOA 3PIPL 4BRDA 5KQ8A 2QWLA 3VTIA 1LWEA 4R79A 4MFBA 5AR0A 2B4JA 5LJVA 1XWLA 2HF3A 5I42A 4RG8A 3TARA 2Z1IA 3OYMA 4JKAA 4QAGA 3NGZA 1SKWA 4CHZA 3AVBA 3JAMO 1TKXA 3O5BA 2O4IA 1HKCA 3DLRA 3AA3A 2O8EA 4XH5A 3LDLA 2QWQA 3KZBA 4FWNA 1S1TA 1NGIA 4OPAA 2YNFA 1NK5A 3O08A 4OPKA 3HVRA 3JXUA 4JK7A 4KHPK 2HMIA 2PY5A 4KTQA 5KPTA 4CK2A 3RRHA 1KAYA 2B5JA 4DR5K 4CBWA 3RWUA 4KH5A 1QZ6A 4IOCL 2O8BB 3VEWA 1HNVA 1YI2N 2A3ZA 1JLEA 2V7ZA 4BVOA 1VQLN 4QS7A 4OGCA 1NK9A 3CJBA 4OVLA 5LL6Z 1VHXA 4FVMA 2P5GA 1V4SA 1RT3A 4CJPA 3C95A 2GUPA 3OYNA 3KWIA 1WSHA 3RMCA 3J7YP 3T69A 4OJRA 4GV9A 4DTNA 1YTAA 3VEXA 3LP1A 1IG8A 4DV5K 1NNEA 3R9PA 3QNOA 3PSFA 2JGUA 4DLEA 1KSPA 4DTOA 2GELA 1YXQA 3O9RA 4B9TA 2KLAA 4I6MB 1CZAN 1RDUA 3CMAN 3PUFA 2D0OA 1QHTA 4W5TA 2VGMA 1XC9A 1DGKN 4JN4A 3HM8A 4FK2A 3VEZA 4CCHA 1YTUA 3KLIA 3NH1A 1JKHA 1QSYA 2W6KA 1RT7A 3V6DA 3QIPA 3DOKA 4DR1K 1MA9B 3M8RA 4DQRA 3HPOA 5C2DA 3J7ZO 4K25A 2O8CA 1ESVA 3D45A 1S1WA 5CR4A 3QEVA 5KRSA 3UIQA 2UUCK 3ITHA 3B6OA 3A5NC 1QVFM 1W9HA 2E1ZA 2YHBA 3T1HK 4CF8A 1D9DA 3HPGA 4LF4K 3S41A 4B9UA 2OPRA 4LSNA 4KI6A 5JLHA 4JKHA 4QOZB 4PHTX 1TUYA 4M3RA 2G8VA 3TPQA 3L2WA 4DV0K 4EP4A 4PY5A 4CIFA 4B9NA 3PY8A 5CZ2A 3EE8A 3AARA 1T7PA 3K5LA 1TK0A 1KVBA 2ZQBA 3VQ9A 3KTQA 4M3UA 4ELVA 4CZMA 4KREA 5LJWA 4EHUA 1O1WA 3TAMA 3RMBA 3A0IX 1YHQN 2P9SA 1VSFA 4CECA 3THVA 4E89A 3KK3A 1ASVA 5MLCQ 3KLGA 1HPZA 5F0XA 1DKGD 1RNHA 1YVNA 4H5WA 1MDUB 4KB0A 1K8KB 4CF2A 5HRRA 4BRQA 1RTHA 3UB5A 4YNQA 2D1KA 3SPYA 2VWJA 5EY4A 4CJ4A 2NLXA 4DTMA 3DRSA 4I2PA 1KRPA 4CEQA 4YY3K 5C0YA 2E2NA 3V9WA 3FGUA 3KKRA 3MAQA 1XMOK 3CCMN 3Q7CA 1E3MA 2ZGZA 1BIZA 1GOCA 1WSFA 4BC3A 2BH1A 3RRGA 1EO1A 3CC2N 1I39A 1T44A 3QFUA 4DKWA 2QWRA 5JMVA 3OYDA 2VQEK 4Z0UA 1LW0A 3ALYA 3KVGA 4A2AA 1KFSA 4CJ7A 3EN9A 1WOQA 1TVRA 4JNEA 1NBWA 4CBXA 5KPRA 1UOCA 3NHGA 2HNYA 4JI5K 5AQQA 1HPMA 1VK0A 3SLCA 2NUBA 2R7YA 4J2AA 3RTVA 3MEDA 2HNZA 4FPAA 3WXKA 4M7XA 4CEDA 3SCXA 1M1KO 4I7FA 1UWBA 4FL9A 5HL7L 1IBLK 4BC2A 3CCJN 3ZSVA 1YVUA 4FLVA 1JLQA 3QIOA 1L3SA 4BG8A 3OYCA 4CZHA 2GTDA 2HOEA 3J8AA 4CFBA 4FJNA 2YNHA 4DLGA 3M8QA 3HT3A 5AQOA 5AZIA 3AAQA 2HHHK 4BR2A 3FE1A 4KTWA 1RT1A 1U04A 2CH6A 2YJEA 5AQIA 4HCCA 1FW6A 3OHRA 4PKHA 1EWRA 2ASPA 4BRHA 4EHTA 4CZFA 4H5VA 4X64K 1ASWA 2E20A 1LCUA 5M1NA 5E41A 3PSIA 2O8FB 4B08A 1WBBA 4FWSA 1HNXK 3T7ZA 1HR0K 4DMNA 3H3NO 1SQKA 2FBXA 1JCGA 3SUOA 1EXQA 1Q86O 3VQ5A 1U49A 1MU2A 4BRCA 2Y1JA 4B9LA 4HTLA 3NDKA 1SV5A 2HHUA 1NWKA 4DTJA 3TR8A 3K5NA 3SUPA 2FBYA 4BQLA 3AA4A 1J9AA 1S6PA 3AO1A 1VQ6N 3HL8A 3K58A 2HW3A 3I33A 4K8XA 4GVMA 4LH4A 5AQLA 3WEEA 4LH5A 1VSIA 1KAZA 4NCBA 3P5JA 4PKGA 2NNWA 1ATSA 4B9MA 3BP8A 3ATUA 4IFVA 4A59A 4F2RA 1K9MO 5JVGL 1T05A 1U2VA 1J53A 2QK9A 4CZEA 3QMLA 3G25A 4E7JA 2WUSA 4LFAK 3E66A 4H0PA 3N4QA 2P5OA 1S9EA 4E7LA 5HRPA 4IZ9A 1T03A 2DFHA 2FBVA 5M1PA 4DU4A 2P9LB 2BE2A 1TYQA 1KVAA 5BPMA 3HOSA 1KXPA 3L0QA 3N4PA 1DTQA 3UE5A 4A5BA 3SQ0A 3TI0A 5M1QA 1Y64A 3E01A 1BUPA 2OCEA 1ATRA 4AHCA 3O3HA 3QNNA 4UY8O 4DG1A 3P4IA 3OS2A 1RBRA 1C0GA 3AA5X 1IJJA 3I8BA 4CFDA 4CF1A 4DSIA 4DV7K 5I9EB 3S3MA 1VQ9N 3SPZA 4PL8A 3AVGA 2P9IB 4KB1A 3KWGA 3I0RA 2OPSA 3OYKA 3K0SA 4JK9A 3F9MA 4DS4A 3ISNC 3MN7A 3UKRB 3CM6A 1DLOA 2IVNA 3DJCA 3V1QA 5HROA 4CGGA 3MK6A 4F9OA 1VQ8N 3O3GA 3CCRN 2G8HA 1GLCG 3HVTA 4CJRA 5IT9O 3ZSQA 4C8NA 3D0PA 1ZC6A 3PV8A 1GLAG 3KJVA 2YNIA 1QQOA 2ZD1A 5LMUK 1BGXT 3U3GA 4KAZA 1D8YA 1N8RO 3U9ZA 3VN5A 4DFPA 2KZZA 4BG9A 4BRIA 4IEEA 4Y0WA 1I3AA 2D4WA 1YF5L 4ILGB 3EO3A 1CZ9A 1BDGA 4OKJA 4JAXA 2XO7A 1MWKA 4WQ5C 4OLAA 2P9PB 2QTDA 3LDQA 3OYAA 2UXCK 3QLHA 4JEPA 4KH4A 4A5AA 1LV5A 2QEXN 4CZJA 1JXEA 2NRTA 3WQUA 4BRFA 5HRSA 1XHZA 3U3YA 2HNDA 3ENBA 3GBTA 3NGYA 5FROA 3QO9A 3VQ6A 4WQ4A 1IV0A 2D0BA 1LAVA 4FW2A 3EZWA 2KFNA 5AQSA 2KHOA 3LAKA 4QS9A 1Z05A 1XHXA 4CFAA 1UA0A 5J2NA 3FZKA 4DV1K 2QW9A 4FWPA 4FO0A 1D5AA 1NGCA 2QA4N 4B9VA 1S1XA 3O4NA 1NGDA 3O6WA 5GAEP 4XH1A 1JCEA 4A2BA 1XC3A 4CHYA 3RR8A 3UKUA 2E6LA 2W42A 3D2EA 4YOTA 5T7BA 4CHQA 3NF9A 3EYZA 4FM1A 3U4LA 1K73O 1L3UA 2O8BA 3DI6A 2QKBA 1NU0A 4BR0A 4QCLA 3ULEB 4IOXA 3ZSXA 5KTQA 4A62A 1QE1A 3C7NA 3PO5A 1HYZA 5GAGP 5AJ3K 1NMNA 4JKGA 3DLHA 1B9FA 2OZSA 1GLEG 2V7YA 3CF5L 4FK4A 3G6EN 5EX5A 1TKDA 5EU7A 4LF7K 2KTQA 2QM1A 1NJIO 1CZBA 3T3FA 4CF0A 2UXDK 3A2FA 3OYGA 1HYSA 5JICA 4DR2K 1VQON 2X6NA 1R0AA 3EE9A 1G15A 4C1NK 4CK1A 3DXKB 3H1VX 4FLUA 4ID5A 3H1QA 3NF8A 3THWA 5KGWA 2OPQA 1TAUA 4FLTA 2A41A 1C1BA 3KLFA 2ATQA 5AQTA 4AQYK 4MQ3A 2NRRA 2Q0UA 3WNFA 4DV3K 1HJRA 2FSNA 2ITMA 1NLVA 4H5TA 3HO1A 1J54A 1SKSA 1C0TA 4CJ5A 4I6MA 3O4QA 3KLEA 1S6QA 1QSLA 1X3MA 3I0SA 4KFBA 3VETA 2CGLA 4NLBA 1DT9A 4M41A 4AH9A 3CQXA 3DLEA 2GUIA 4JD2B 3LM9A 1HJOA 1KFDA 1X9SA 3HK2A 4I9QA 1GLDG 3VPZA 3EY1A 3THYB 1J5EK 4Z94A 3TSPA 3BY5A 4F3TA 4FZZA 2D5RA 1BCMA 1HLUA 1Z25A 5ELZA 3M5RA 4RTFD 5JS1A 1XNRK 3VQDA 3L4IA 1BA0A 3FZFA 4KKOA 2RPIA 4R5PA 3HOTA 1J6ZA 2IOCA 2YKNA 3R3LA 1BOTO 2I5JA 3QICA 2OPPA 3K57A 3MMVA 2E88A 4X65K 1C1AA 1SL0A 3ZT0A 5HP1A 3I8DA 3HJFA 4RW4A 1TL1A 2GV9A 3SAHA 1ZBFA 4UQGA 3C6TA 3FZHA 2EHGA 2XHBA 2YX6A 4JKEA 4IDHA 4JI0K 1B92A 2A1SA 1B9DA 1TL3A 3OS1A 2CGJA 3HI0A 2HBMA 5C24A 1N33K 5BRDA 1QZ5A 3K9JA 4WFAL 3BF1A 1JCFA 3WNHA 4BR9A 3VMFB 1OVYA 1WAJA 1LWFA 3VEYA 2YHYA 3CQ8A 1RTJA 2ZM6K 4O5BA 2YJFA 3AVKA 4DTXA 3S3NA 4L3QA 2YI1A 2D0PA 4G9ZA 1W2BM 4FJHA 1T3VA 3FFIA 3DYAA 4CIEA 4DR4K 2QWMA 3S9HA 4BGBA 1NK7A 3QESA 2ZJQL 3V1OA 4X62K 4M45A 4KH6A 3D6RA 4Z4HA 3L2UA 4BQZA 1X1PA 4FK0A 4C8MA 3VEVA 3GL1A 1E4GT 4DF4A 2GBZA 2KQ2A 4FWLA 2Q31A 1NJWA 4CJQA 1HNIA 4B8CA 2FBTA 4FOIA 2RKIA 1RDCA 1GOBA 1U6ZA 2CH5A 1JLGA 3M8SA 1KD1O 1S3XA 1VQ5N 1EKEA 3LPTA 1FJGK 3W0LA 3AO2A 2PFUA 3DWLA 5KPZA 3C6AA 2YHXA 3K9KA 4KPYA 2P51A 2DPNA 3BF3A 1X9MA 4EFHA 4J2EA 3DXMB 4E7IA 4PQUA 1NJYA 3A5OC 5BR8K 4F8RA 3PLAA 3OS0A 3OBYA 1F21A 1ZBUA 3CC7N 1M90O 3FZLA 3H45C 4IO8A 4O8UA 2W41A 2P9UA 5HRNA 1J5OA 3EKSA 3VA3A 4CHOA 4KBOA 3TTCA 3MXMA 4YHHK 1FKOA 4FWMA 2Q2RA 4FJ8A 4KV8A 4CF9A 4M7YA 5DK5A 1HRHA 2P9NA 4HVJA 3PX0A 3L3UA 5AQWA 1X3NA 2YV0X 3OYBA 1HQUA 2XRIA 1Q9YA 4XEIA 1WSGA 3MN9A
chains in the Genus database with same CATH topology
3NDKA 1CLQA 1W0HA 1SV5A 3AVNA 2HHUA 4DTJA 4CJWA 2PYJA 2Y1IA 3TR8A 3HP6A 3K5NA 4FYDA 3HP9A 2IS3A 3AVFA 3SUPA 2FBYA 4IFYA 3AA4A 4BE2A 4OLBA 1J9AA 1S6PA 3AO1A 4G1QA 1Y97A 3HL8A 3K58A 2HW3A 3SZ2A 1JLBA 3L2QA 1SL2A 5CYQA 2G8FA 4K8XA 4FJKA 4GVMA 4LH4A 4JRPA 4PA1A 3DOLA 3ZSYA 4CJUA 3OYIA 3C94A 4LH5A 3F9KA 1S9GA 5KRTA 4W5NA 1VSIA 3SV3A 1QQCA 1KVCA 3KIOA 4NCBA 1REVA 3P5JA 4Z4GA 3AVAA 2HHSA 2A1RA 4W5OA 4B9MA 4IFVA 5DMRA 3OYHA 4F2RA 1QS4A 2HB5A 3OY9A 1T05A 1KCFA 4O44A 1J53A 2ZE2A 3VQPA 3SJJA 4DTUA 2QK9A 3QEPA 4CFCA 4M3WA 4FXDA 3NH0A 3ZSRA 3LDSA 4E7JA 3L3VA 1TK8A 2P5OA 1S9EA 1FK9A 4DQSA 3TAEA 1A5VA 1WSJA 1JL1A 1IKVA 2O4GA 2PZSA 4HCBA 5D3GA 4E7LA 2IDOA 4M42A 1LWCA 2EX3A 3OJSA 1BI4B 1Q9XA 5HRPA 2E4LA 4Z4IA 1VSHA 4BDYA 1T03A 2DFHA 2FBVA 4KTZA 1A5XA 3LZIA 1TKZA 4CJSA 4HUGA 3VQQA 4DU4A 1EP4A 2YKMA 2BE2A 3VQBA 3AVCA 1U45A 1L3TA 1D9FA 3ZT3A 3HYFA 1NOYA 2BGGA 3NBPA 3LP0A 1KVAA 2G8IA 1IO2A 3RMAA 1ZBLA 1RT2A 4FLZA 1DTQA 5SZTA 3SQ0A 4DTPA 3TI0A 4EZ6A 3AVJA 3AO5A 4Q0BA 4BWMA 1BI4A 3E01A 3WNEA 1C1CA 1RDBA 4AHSA 3TAFA 4AHCA 3IG1A 3O3HA 4O0IA 3CYMA 3IRXA 3QNNA 1U48A 4E7HA 3NF6A 5J2PA 3HXMA 1UA1A 4DG1A 1NKEA 3SYZA 5C25A 2DTUA 1IKXA 3OS2A 1RBRA 4ELUA 2F96A 4CK3A 4F4KA 4DQPA 3VA0A 2ETJA 2VG6A 3AA5X 3CFOA 4FM2A 4DQIA 4CFDA 1RILA 4CGHA 4CF1A 5C42A 4DSIA 2IC3A 4EZ9A 3S3MA 2VG5A 4FCYA 4IBNA 4DSJA 4CEEA 2KZMA 3SPZA 3U6FA 1WN7A 4E0DA 3AVLA 4EP5A 4E7KA 3SUQA 4GW6A 1IG9A 3AVGA 4BDPA 4KB1A 3I0RA 2HHTA 5FDLA 2OPSA 3OYKA 2LSNA 1RBVA 4Z4FA 1WNSA 4CJVA 1ZBIA 5FRNA 4CJEA 4DS4A 4B9LA 3V9ZA 3ISNC 2P1JA 1VSMA 3CM6A 2WONA 3VQ4A 3WNGA 1DLOA 4Z4CA 3KK1A 1L3VA 4B3OA 3V1QA 5HROA 4DF8A 3MXIA 4CGGA 4C8KA 3IS9A 5JS2A 4AILC 4N41A 3O3GA 4HHTA 2G8HA 1U47A 3CM5A 3HVTA 3QINA 2Q3SA 4CGJA 3DRRA 4CJRA 4FJMA 3LP3A 5KGXA 3VQAA 4FJIA 3LAMA 3ZSQA 4J2BA 4C8NA 3V1RA 3D0PA 4DWIA 5K14A 3QERA 3PV8A 3K59A 3BDPA 2Z1HA 4PWDA 3KJVA 1IH7A 2YNIA 1JXBA 2ZD1A 1NOZA 3L2VA 1BGXT 3U3GA 4KAZA 1D8YA 3VN5A 3AVMA 4DSLA 3P83D 4FLYA 4DFPA 3S3OA 2KZZA 3CG7A 4DFMA 1VSDA 5CY4A 3LALA 4FJLA 1I3AA 1S1VA 1N5YA 4BWJA 1CZ9A 4OKJA 1X9WA 3TAPA 4FLXA 2OZMA 3AVHA 2YHAA 3AV9A 2XO7A 4AHRA 3KKSA 2HHWA 4H4OA 1TKTA 4ZHRA 3OVNA 4OLAA 3OYAA 3QLHA 1LWEA 3NE6A 2X74A 4MFBA 3KLHA 1LV5A 2E6MA 2B4JA 4E19A 1JXEA 1XWLA 4J2DA 5HRSA 4CGDA 1XHZA 3U3YA 4KHYA 2HNDA 5I42A 3NGYA 5FROA 3CFPA 2O4IA 4RG8A 3QO9A 4DU3A 3TARA 2Z1IA 3OYMA 4NCAA 3HSTB 1BISA 4QAGA 4FJ9A 3NGZA 1SKWA 3L2RA 4CHZA 3AVBA 3VQ6A 4FJGA 1TKXA 1HQEA 4RW8A 3NFAA 3VQCA 3ZT4A 2D0BA 3DMJA 1LAVA 4FW2A 3DLRA 3ZT1A 3AA3A 3SQ2A 4ZTFA 1XI1A 2KFNA 1CXUA 2DY4A 2D0AA 3ZSZA 1S1TA 1RCHA 3LAKA 5FRMA 1NK5A 2YNFA 3LANA 4CFAA 1XHXA 4OPKA 3HVRA 1UA0A 1NK4A 4WE1A 2HMIA 2PY5A 4KTQA 5J2NA 4CK2A 3RRHA 4CJ3A 2JLEA 4FJJA 1ZYQA 4I2QA 2B5JA 3ZCMA 1GOAA 1D5AA 3RWUA 1VRTA 1HYVA 4B8AB 4B9VA 1S1XA 2X78A 1HNVA 3QEXA 1LAWA 3O4NA 3BGRA 1BHLA 1JLEA 2ITGA 1Q8IA 3OYEA 2XY7A 2KFZA 1A5WA 4CHYA 4BACA 3RR8A 4CGFA 2E6LA 2W42A 4DFKA 4OGCA 4KRFA 1U4BA 3EZ5A 4ELTA 4L8RB 1NK9A 5T7BA 1UAXA 4KHQA 4CHQA 3NF9A 2BDPA 3EYZA 3NCIA 4CHNA 4FM1A 4OVLA 1L3UA 4CHPA 3DI6A 4FVMA 4CJKA 2P5GA 2QKBA 2AJQA 3SUNA 1KTQA 1RT3A 4AHTA 4KI4A 4QCLA 4CIGA 2RN2A 4AHVA 4CJPA 3C95A 3KD1E 3T19A 3ZSXA 4IG0A 3OYNA 5KTQA 5J2MA 3V81A 2Z1JA 4F2SA 2QXFA 1WSHA 3RMCA 1QE1A 3PO5A 1HYZA 4OJRA 3B6PA 1NK8A 1FKPA 4DTNA 1YTAA 4HTUA 3LP1A 4FM0A 3DLHA 1B9FA 1NK6A 2OZSA 4XIUA 3NGIA 4PY5A 4N56A 4FK4A 3KK2A 3SI6A 4KHNA 3QNOA 2HVIA 1TKDA 5EU7A 2KTQA 4K8ZA 1CZBA 3T3FA 2JGUA 4CF0A 4DLEA 3A2FA 1KSPA 3OYGA 3RR7A 1HYSA 4OPJA 4DTOA 2X6NA 1R0AA 4CK1A 1G15A 3O3FA 4FLUA 4ID5A 3NF8A 4DTRA 1RBUA 3L8BA 3K5OA 5KGWA 2OPQA 4CJTA 4IDKA 4CERA 2OYQA 4FLTA 4B9TA 1TAUA 1C1BA 4BE0A 3SNNA 2X6SA 2ATQA 3KLFA 1RT4A 4O0JA 1LW2A 4MQ3A 3T1AA 3RMDA 3PUFA 3LWMA 3WNFA 3OJUA 1HJRA 1QHTA 4Q5VA 3JSMA 3QEWA 4KHWA 3VQ8A 4W5TA 4CE9A 4C8OA 1XC9A 3HO1A 4H4MA 1J54A 1SKSA 5KI6A 2G8WA 4FK2A 2D0CA 4O4GA 1C0TA 4CJ5A 4CCHA 1BCOA 1YTUA 3KLIA 3NH1A 1JKHA 3O4QA 5J1EA 4YFUA 1S6QA 1RT7A 3KLEA 1QSYA 1TK5A 3V6DA 4NCGA 2BANA 1QSLA 3QIPA 3TAGA 3DOKA 3I0SA 4KFBA 4M3ZA 1EX4A 4M41A 4AH9A 1JL2A 3MEEA 4OKEA 3DLEA 3M8RA 2GUIA 4DQRA 3OYFA 1RBTA 4DTSA 2OA8A 1KFDA 3HPOA 1X9SA 4JLHA 3HK2A 4DSFA 3DRPA 4I9QA 4CEOA 3EY1A 4Y1DA 1JLAA 3D45A 1S1WA 3QEVA 5KRSA 3UIQA 4F3TA 1Z26A 3B6OA 3G10A 3ITHA 4IKFA 2D5RA 4FZZA 3ASMA 1W9HA 3OYLA 4DQQA 1BCMA 2F8TA 2YHBA 1BL3A 1Z25A 4KHUA 1IKYA 3VQEA 4CF8A 5JS1A 1D9DA 3HPGA 4CGIA 4B9UA 2OPRA 2VWKA 4LSNA 4O55A 3VQDA 4KI6A 4N5SA 5CYMA 3OYJA 4NYNA 4JS4A 1ZBHA 4KKOA 4N76A 4QOZB 2RPIA 2Z1GA 4R5PA 4JS5A 3QEIA 4TSXA 4C8LA 4M3RA 2IOCA 3JYTA 4LSLA 2YKNA 2G8VA 2I5JA 3L2WA 4CEBA 2OPPA 4FZYA 3K57A 3K2PA 4EP4A 1VRUA 3V9UA 1HMVA 1DTTA 4Y1CA 1S1UA 4CIFA 4B9NA 3PY8A 5CZ2A 1C1AA 1SL0A 4CEZA 4FZXC 3NF7A 1WSEA 3ZT0A 1T7PA 5HP1A 3PX6A 4E1MA 3K5LA 1TK0A 1NKBA 1BIUA 3I8DA 3HJFA 4RW4A 1TL1A 1KVBA 2GV9A 2ZQBA 3HPHA 1ZBFA 3VQ9A 3C6TA 4UQGA 3KTQA 2EHGA 2XHBA 4M3UA 4ELVA 4DU1A 4H8KA 3TAQA 1BQNA 4M3TA 4KREA 1B92A 4CEFA 4E3SA 1O1WA 2QKKA 4FJ7A 2A1SA 3TAMA 3RMBA 1TAQA 1B9DA 1TL3A 2HHVA 3OS1A 4RW7A 1CXQA 2G8UA 3AO3A 1VSFA 3HM9A 4CECA 3THVA 4E89A 3KK3A 1ASVA 3KD5E 4ICLA 5C24A 1WAFA 1HPZA 4W5QA 3KLGA 1EETA 4BE1A 3V9SA 4N47A 1RNHA 3PO4A 1RDDA 3WNHA 4RW9A 3NH2A 1WAJA 4KB0A 1LWFA 3ULDA 2B6AA 4CF2A 5HRRA 3AVIA 1RTHA 2FC0A 4YNQA 5J2QA 3CQ8A 1RTJA 4OGEA 3SPYA 2VWJA 4CJ4A 4O5BA 1QSSA 3AA2A 3K5MA 3P1GA 3AVKA 4DTMA 4RW6A 3DLKA 3DRSA 3CFRA 4DTXA 3VQ7A 3S3NA 4I2PA 4LY7A 1NJZA 4NYFA 1KRPA 4CEQA 4FJHA 2RF2A 1RDAA 1SKRA 3FFIA 3DYAA 4CIEA 1YT3A 3V9WA 4CJLA 4HUEA 4M3YA 3S9HA 4CEAA 1NK7A 3QESA 2IGIA 3KKRA 3MAQA 3V1OA 4FJ5A 4IG3A 4M45A 4Z4HA 4I9LA 3NAEA 1BIZA 1GOCA 3DLBA 3L2UA 1WSFA 4E1NA 3RRGA 2IAJA 3DM2A 1I39A 3MEGA 1X1PA 3OYDA 3TANA 4FK0A 1RTIA 4C8MA 4B9SA 1NJXA 4Z0UA 1LW0A 1BQMA 3ALYA 4DF4A 2WOMA 2GBZA 2KQ2A 4OKKA 1NJWA 1KFSA 1JLFA 4CJQA 1HNIA 4B8CA 4CESA 2FBTA 1TVRA 3LZJA 1RT5A 3MECA 3SQ1A 4FJXA 5SWMA 4FLWA 2G8KA 2RKIA 1RDCA 1UOCA 3NHGA 1WLJA 1GOBA 2HNYA 3LPUA 4FW1A 1VK0A 4DS5A 2NUBA 1WSIA 1JLGA 3M8SA 2R7YA 3MEDA 3RTVA 3V9XA 4J2AA 2HNZA 4KHSA 4CEDA 4Z4EA 3SCXA 4I7FA 2KW4A 1UWBA 1EKEA 3LPTA 3F73A 4KO0A 4W5RA 1VSEA 3ZSVA 4PUOA 1YVUA 3AO2A 4FLVA 1JLQA 3G0ZA 3QIOA 3DLGA 1L3SA 3OYCA 1L5UA 3AO4A 4CFBA 3PX4A 4ZTJA 3V4IA 5I3UA 1C0MA 3QETA 3ZT2A 1ASUA 4KPYA 2P51A 4FJNA 2YNHA 4DLGA 5CZ1A 5HBMA 4DSKA 3M8QA 1C0UA 1X9MA 3HT3A 4J2EA 1K6YA 1TGOA 4E7IA 3MXJA 3TWHA 3ZSWA 3IAYA 4PQUA 1C6VA 1NJYA 1T8EA 4KTWA 1RT1A 2XY5A 4F8RA 1FXXA 1U04A 2DFFA 3SV4A 1QTMA 3LP2A 4HCCA 4M3XA 2HHQA 3OS0A 1KLMA 1F21A 1ZBUA 1RBSA 4ID1A 3ZSOA 3M8PA 1SUQA 1RTDA 1SL1A 3SQ4A 2HHXA 2XY8A 1ASWA 1TV6A 5HRNA 1NK0A 5E41A 1ITGA 4DFJA 1IKWA 4B08A 3TABA 1N6QA 1J5OA 2PYLA 3VA3A 2F8SA 4HUFA 2HVHA 4CHOA 3MXMA 1S5JA 2XY6A 4F3OA 4DMNA 1FKOA 1VSKA 1KLNA 4DSEA 1RT6A 4FJ8A 4KV8A 4LD0A 2FBXA 4CF9A 1NKCA 3H08A 5DK5A 3LWLA 1VSLA 1HRHA 1VSJA 4AHUA 4HVJA 3SUOA 3PX0A 1EXQA 1JLCA 3L3UA 4JRQA 2YV0X 3VQ5A 1U49A 3C6UA 2DFEA 3OYBA 4CJFA 4GMJB 5HLFA 1HQUA 2VG7A 2YNGA 1MU2A 2XRIA 1Q9YA 2Y1JA 1WSGA 4BDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NDK A;  1CLQ A;  1W0H A;  1SV5 A;  3AVN A;  2HHU A;  4DTJ A;  4CJW A;  2PYJ A;  2Y1I A;  3TR8 A;  3HP6 A;  3K5N A;  4FYD A;  3HP9 A;  2IS3 A;  3AVF A;  3SUP A;  2FBY A;  4IFY A;  3AA4 A;  4BE2 A;  4OLB A;  1J9A A;  1S6P A;  3AO1 A;  4G1Q A;  1Y97 A;  3HL8 A;  3K58 A;  2HW3 A;  3SZ2 A;  1JLB A;  3L2Q A;  1SL2 A;  5CYQ A;  2G8F A;  4K8X A;  4FJK A;  4GVM A;  4LH4 A;  4JRP A;  4PA1 A;  3DOL A;  3ZSY A;  4CJU A;  3OYI A;  3C94 A;  4LH5 A;  3F9K A;  1S9G A;  5KRT A;  4W5N A;  1VSI A;  3SV3 A;  1QQC A;  1KVC A;  3KIO A;  4NCB A;  1REV A;  3P5J A;  4Z4G A;  3AVA A;  2HHS A;  2A1R A;  4W5O A;  4B9M A;  4IFV A;  5DMR A;  3OYH A;  4F2R A;  1QS4 A;  2HB5 A;  3OY9 A;  1T05 A;  1KCF A;  4O44 A;  1J53 A;  2ZE2 A;  3VQP A;  3SJJ A;  4DTU A;  2QK9 A;  3QEP A;  4CFC A;  4M3W A;  4FXD A;  3NH0 A;  3ZSR A;  3LDS A;  4E7J A;  3L3V A;  1TK8 A;  2P5O A;  1S9E A;  1FK9 A;  4DQS A;  3TAE A;  1A5V A;  1WSJ A;  1JL1 A;  1IKV A;  2O4G A;  2PZS A;  4HCB A;  5D3G A;  4E7L A;  2IDO A;  4M42 A;  1LWC A;  2EX3 A;  3OJS A;  1BI4 B;  1Q9X A;  5HRP A;  2E4L A;  4Z4I A;  1VSH A;  4BDY A;  1T03 A;  2DFH A;  2FBV A;  4KTZ A;  1A5X A;  3LZI A;  1TKZ A;  4CJS A;  4HUG A;  3VQQ A;  4DU4 A;  1EP4 A;  2YKM A;  2BE2 A;  3VQB A;  3AVC A;  1U45 A;  1L3T A;  1D9F A;  3ZT3 A;  3HYF A;  1NOY A;  2BGG A;  3NBP A;  3LP0 A;  1KVA A;  2G8I A;  1IO2 A;  3RMA A;  1ZBL A;  1RT2 A;  4FLZ A;  1DTQ A;  5SZT A;  3SQ0 A;  4DTP A;  3TI0 A;  4EZ6 A;  3AVJ A;  3AO5 A;  4Q0B A;  4BWM A;  1BI4 A;  3E01 A;  3WNE A;  1C1C A;  1RDB A;  4AHS A;  3TAF A;  4AHC A;  3IG1 A;  3O3H A;  4O0I A;  3CYM A;  3IRX A;  3QNN A;  1U48 A;  4E7H A;  3NF6 A;  5J2P A;  3HXM A;  1UA1 A;  4DG1 A;  1NKE A;  3SYZ A;  5C25 A;  2DTU A;  1IKX A;  3OS2 A;  1RBR A;  4ELU A;  2F96 A;  4CK3 A;  4F4K A;  4DQP A;  3VA0 A;  2ETJ A;  2VG6 A;  3AA5 X;  3CFO A;  4FM2 A;  4DQI A;  4CFD A;  1RIL A;  4CGH A;  4CF1 A;  5C42 A;  4DSI A;  2IC3 A;  4EZ9 A;  3S3M A;  2VG5 A;  4FCY A;  4IBN A;  4DSJ A;  4CEE A;  2KZM A;  3SPZ A;  3U6F A;  1WN7 A;  4E0D A;  3AVL A;  4EP5 A;  4E7K A;  3SUQ A;  4GW6 A;  1IG9 A;  3AVG A;  4BDP A;  4KB1 A;  3I0R A;  2HHT A;  5FDL A;  2OPS A;  3OYK A;  2LSN A;  1RBV A;  4Z4F A;  1WNS A;  4CJV A;  1ZBI A;  5FRN A;  4CJE A;  4DS4 A;  4B9L A;  3V9Z A;  3ISN C;  2P1J A;  1VSM A;  3CM6 A;  2WON A;  3VQ4 A;  3WNG A;  1DLO A;  4Z4C A;  3KK1 A;  1L3V A;  4B3O A;  3V1Q A;  5HRO A;  4DF8 A;  3MXI A;  4CGG A;  4C8K A;  3IS9 A;  5JS2 A;  4AIL C;  4N41 A;  3O3G A;  4HHT A;  2G8H A;  1U47 A;  3CM5 A;  3HVT A;  3QIN A;  2Q3S A;  4CGJ A;  3DRR A;  4CJR A;  4FJM A;  3LP3 A;  5KGX A;  3VQA A;  4FJI A;  3LAM A;  3ZSQ A;  4J2B A;  4C8N A;  3V1R A;  3D0P A;  4DWI A;  5K14 A;  3QER A;  3PV8 A;  3K59 A;  3BDP A;  2Z1H A;  4PWD A;  3KJV A;  1IH7 A;  2YNI A;  1JXB A;  2ZD1 A;  1NOZ A;  3L2V A;  1BGX T;  3U3G A;  4KAZ A;  1D8Y A;  3VN5 A;  3AVM A;  4DSL A;  3P83 D;  4FLY A;  4DFP A;  3S3O A;  2KZZ A;  3CG7 A;  4DFM A;  1VSD A;  5CY4 A;  3LAL A;  4FJL A;  1I3A A;  1S1V A;  1N5Y A;  4BWJ A;  1CZ9 A;  4OKJ A;  1X9W A;  3TAP A;  4FLX A;  2OZM A;  3AVH A;  2YHA A;  3AV9 A;  2XO7 A;  4AHR A;  3KKS A;  2HHW A;  4H4O A;  1TKT A;  4ZHR A;  3OVN A;  4OLA A;  3OYA A;  3QLH A;  1LWE A;  3NE6 A;  2X74 A;  4MFB A;  3KLH A;  1LV5 A;  2E6M A;  2B4J A;  4E19 A;  1JXE A;  1XWL A;  4J2D A;  5HRS A;  4CGD A;  1XHZ A;  3U3Y A;  4KHY A;  2HND A;  5I42 A;  3NGY A;  5FRO A;  3CFP A;  2O4I A;  4RG8 A;  3QO9 A;  4DU3 A;  3TAR A;  2Z1I A;  3OYM A;  4NCA A;  3HST B;  1BIS A;  4QAG A;  4FJ9 A;  3NGZ A;  1SKW A;  3L2R A;  4CHZ A;  3AVB A;  3VQ6 A;  4FJG A;  1TKX A;  1HQE A;  4RW8 A;  3NFA A;  3VQC A;  3ZT4 A;  2D0B A;  3DMJ A;  1LAV A;  4FW2 A;  3DLR A;  3ZT1 A;  3AA3 A;  3SQ2 A;  4ZTF A;  1XI1 A;  2KFN A;  1CXU A;  2DY4 A;  2D0A A;  3ZSZ A;  1S1T A;  1RCH A;  3LAK A;  5FRM A;  1NK5 A;  2YNF A;  3LAN A;  4CFA A;  1XHX A;  4OPK A;  3HVR A;  1UA0 A;  1NK4 A;  4WE1 A;  2HMI A;  2PY5 A;  4KTQ A;  5J2N A;  4CK2 A;  3RRH A;  4CJ3 A;  2JLE A;  4FJJ A;  1ZYQ A;  4I2Q A;  2B5J A;  3ZCM A;  1GOA A;  1D5A A;  3RWU A;  1VRT A;  1HYV A;  4B8A B;  4B9V A;  1S1X A;  2X78 A;  1HNV A;  3QEX A;  1LAW A;  3O4N A;  3BGR A;  1BHL A;  1JLE A;  2ITG A;  1Q8I A;  3OYE A;  2XY7 A;  2KFZ A;  1A5W A;  4CHY A;  4BAC A;  3RR8 A;  4CGF A;  2E6L A;  2W42 A;  4DFK A;  4OGC A;  4KRF A;  1U4B A;  3EZ5 A;  4ELT A;  4L8R B;  1NK9 A;  5T7B A;  1UAX A;  4KHQ A;  4CHQ A;  3NF9 A;  2BDP A;  3EYZ A;  3NCI A;  4CHN A;  4FM1 A;  4OVL A;  1L3U A;  4CHP A;  3DI6 A;  4FVM A;  4CJK A;  2P5G A;  2QKB A;  2AJQ A;  3SUN A;  1KTQ A;  1RT3 A;  4AHT A;  4KI4 A;  4QCL A;  4CIG A;  2RN2 A;  4AHV A;  4CJP A;  3C95 A;  3KD1 E;  3T19 A;  3ZSX A;  4IG0 A;  3OYN A;  5KTQ A;  5J2M A;  3V81 A;  2Z1J A;  4F2S A;  2QXF A;  1WSH A;  3RMC A;  1QE1 A;  3PO5 A;  1HYZ A;  4OJR A;  3B6P A;  1NK8 A;  1FKP A;  4DTN A;  1YTA A;  4HTU A;  3LP1 A;  4FM0 A;  3DLH A;  1B9F A;  1NK6 A;  2OZS A;  4XIU A;  3NGI A;  4PY5 A;  4N56 A;  4FK4 A;  3KK2 A;  3SI6 A;  4KHN A;  3QNO A;  2HVI A;  1TKD A;  5EU7 A;  2KTQ A;  4K8Z A;  1CZB A;  3T3F A;  2JGU A;  4CF0 A;  4DLE A;  3A2F A;  1KSP A;  3OYG A;  3RR7 A;  1HYS A;  4OPJ A;  4DTO A;  2X6N A;  1R0A A;  4CK1 A;  1G15 A;  3O3F A;  4FLU A;  4ID5 A;  3NF8 A;  4DTR A;  1RBU A;  3L8B A;  3K5O A;  5KGW A;  2OPQ A;  4CJT A;  4IDK A;  4CER A;  2OYQ A;  4FLT A;  4B9T A;  1TAU A;  1C1B A;  4BE0 A;  3SNN A;  2X6S A;  2ATQ A;  3KLF A;  1RT4 A;  4O0J A;  1LW2 A;  4MQ3 A;  3T1A A;  3RMD A;  3PUF A;  3LWM A;  3WNF A;  3OJU A;  1HJR A;  1QHT A;  4Q5V A;  3JSM A;  3QEW A;  4KHW A;  3VQ8 A;  4W5T A;  4CE9 A;  4C8O A;  1XC9 A;  3HO1 A;  4H4M A;  1J54 A;  1SKS A;  5KI6 A;  2G8W A;  4FK2 A;  2D0C A;  4O4G A;  1C0T A;  4CJ5 A;  4CCH A;  1BCO A;  1YTU A;  3KLI A;  3NH1 A;  1JKH A;  3O4Q A;  5J1E A;  4YFU A;  1S6Q A;  1RT7 A;  3KLE A;  1QSY A;  1TK5 A;  3V6D A;  4NCG A;  2BAN A;  1QSL A;  3QIP A;  3TAG A;  3DOK A;  3I0S A;  4KFB A;  4M3Z A;  1EX4 A;  4M41 A;  4AH9 A;  1JL2 A;  3MEE A;  4OKE A;  3DLE A;  3M8R A;  2GUI A;  4DQR A;  3OYF A;  1RBT A;  4DTS A;  2OA8 A;  1KFD A;  3HPO A;  1X9S A;  4JLH A;  3HK2 A;  4DSF A;  3DRP A;  4I9Q A;  4CEO A;  3EY1 A;  4Y1D A;  1JLA A;  3D45 A;  1S1W A;  3QEV A;  5KRS A;  3UIQ A;  4F3T A;  1Z26 A;  3B6O A;  3G10 A;  3ITH A;  4IKF A;  2D5R A;  4FZZ A;  3ASM A;  1W9H A;  3OYL A;  4DQQ A;  1BCM A;  2F8T A;  2YHB A;  1BL3 A;  1Z25 A;  4KHU A;  1IKY A;  3VQE A;  4CF8 A;  5JS1 A;  1D9D A;  3HPG A;  4CGI A;  4B9U A;  2OPR A;  2VWK A;  4LSN A;  4O55 A;  3VQD A;  4KI6 A;  4N5S A;  5CYM A;  3OYJ A;  4NYN A;  4JS4 A;  1ZBH A;  4KKO A;  4N76 A;  4QOZ B;  2RPI A;  2Z1G A;  4R5P A;  4JS5 A;  3QEI A;  4TSX A;  4C8L A;  4M3R A;  2IOC A;  3JYT A;  4LSL A;  2YKN A;  2G8V A;  2I5J A;  3L2W A;  4CEB A;  2OPP A;  4FZY A;  3K57 A;  3K2P A;  4EP4 A;  1VRU A;  3V9U A;  1HMV A;  1DTT A;  4Y1C A;  1S1U A;  4CIF A;  4B9N A;  3PY8 A;  5CZ2 A;  1C1A A;  1SL0 A;  4CEZ A;  4FZX C;  3NF7 A;  1WSE A;  3ZT0 A;  1T7P A;  5HP1 A;  3PX6 A;  4E1M A;  3K5L A;  1TK0 A;  1NKB A;  1BIU A;  3I8D A;  3HJF A;  4RW4 A;  1TL1 A;  1KVB A;  2GV9 A;  2ZQB A;  3HPH A;  1ZBF A;  3VQ9 A;  3C6T A;  4UQG A;  3KTQ A;  2EHG A;  2XHB A;  4M3U A;  4ELV A;  4DU1 A;  4H8K A;  3TAQ A;  1BQN A;  4M3T A;  4KRE A;  1B92 A;  4CEF A;  4E3S A;  1O1W A;  2QKK A;  4FJ7 A;  2A1S A;  3TAM A;  3RMB A;  1TAQ A;  1B9D A;  1TL3 A;  2HHV A;  3OS1 A;  4RW7 A;  1CXQ A;  2G8U A;  3AO3 A;  1VSF A;  3HM9 A;  4CEC A;  3THV A;  4E89 A;  3KK3 A;  1ASV A;  3KD5 E;  4ICL A;  5C24 A;  1WAF A;  1HPZ A;  4W5Q A;  3KLG A;  1EET A;  4BE1 A;  3V9S A;  4N47 A;  1RNH A;  3PO4 A;  1RDD A;  3WNH A;  4RW9 A;  3NH2 A;  1WAJ A;  4KB0 A;  1LWF A;  3ULD A;  2B6A A;  4CF2 A;  5HRR A;  3AVI A;  1RTH A;  2FC0 A;  4YNQ A;  5J2Q A;  3CQ8 A;  1RTJ A;  4OGE A;  3SPY A;  2VWJ A;  4CJ4 A;  4O5B A;  1QSS A;  3AA2 A;  3K5M A;  3P1G A;  3AVK A;  4DTM A;  4RW6 A;  3DLK A;  3DRS A;  3CFR A;  4DTX A;  3VQ7 A;  3S3N A;  4I2P A;  4LY7 A;  1NJZ A;  4NYF A;  1KRP A;  4CEQ A;  4FJH A;  2RF2 A;  1RDA A;  1SKR A;  3FFI A;  3DYA A;  4CIE A;  1YT3 A;  3V9W A;  4CJL A;  4HUE A;  4M3Y A;  3S9H A;  4CEA A;  1NK7 A;  3QES A;  2IGI A;  3KKR A;  3MAQ A;  3V1O A;  4FJ5 A;  4IG3 A;  4M45 A;  4Z4H A;  4I9L A;  3NAE A;  1BIZ A;  1GOC A;  3DLB A;  3L2U A;  1WSF A;  4E1N A;  3RRG A;  2IAJ A;  3DM2 A;  1I39 A;  3MEG A;  1X1P A;  3OYD A;  3TAN A;  4FK0 A;  1RTI A;  4C8M A;  4B9S A;  1NJX A;  4Z0U A;  1LW0 A;  1BQM A;  3ALY A;  4DF4 A;  2WOM A;  2GBZ A;  2KQ2 A;  4OKK A;  1NJW A;  1KFS A;  1JLF A;  4CJQ A;  1HNI A;  4B8C A;  4CES A;  2FBT A;  1TVR A;  3LZJ A;  1RT5 A;  3MEC A;  3SQ1 A;  4FJX A;  5SWM A;  4FLW A;  2G8K A;  2RKI A;  1RDC A;  1UOC A;  3NHG A;  1WLJ A;  1GOB A;  2HNY A;  3LPU A;  4FW1 A;  1VK0 A;  4DS5 A;  2NUB A;  1WSI A;  1JLG A;  3M8S A;  2R7Y A;  3MED A;  3RTV A;  3V9X A;  4J2A A;  2HNZ A;  4KHS A;  4CED A;  4Z4E A;  3SCX A;  4I7F A;  2KW4 A;  1UWB A;  1EKE A;  3LPT A;  3F73 A;  4KO0 A;  4W5R A;  1VSE A;  3ZSV A;  4PUO A;  1YVU A;  3AO2 A;  4FLV A;  1JLQ A;  3G0Z A;  3QIO A;  3DLG A;  1L3S A;  3OYC A;  1L5U A;  3AO4 A;  4CFB A;  3PX4 A;  4ZTJ A;  3V4I A;  5I3U A;  1C0M A;  3QET A;  3ZT2 A;  1ASU A;  4KPY A;  2P51 A;  4FJN A;  2YNH A;  4DLG A;  5CZ1 A;  5HBM A;  4DSK A;  3M8Q A;  1C0U A;  1X9M A;  3HT3 A;  4J2E A;  1K6Y A;  1TGO A;  4E7I A;  3MXJ A;  3TWH A;  3ZSW A;  3IAY A;  4PQU A;  1C6V A;  1NJY A;  1T8E A;  4KTW A;  1RT1 A;  2XY5 A;  4F8R A;  1FXX A;  1U04 A;  2DFF A;  3SV4 A;  1QTM A;  3LP2 A;  4HCC A;  4M3X A;  2HHQ A;  3OS0 A;  1KLM A;  1F21 A;  1ZBU A;  1RBS A;  4ID1 A;  3ZSO A;  3M8P A;  1SUQ A;  1RTD A;  1SL1 A;  3SQ4 A;  2HHX A;  2XY8 A;  1ASW A;  1TV6 A;  5HRN A;  1NK0 A;  5E41 A;  1ITG A;  4DFJ A;  1IKW A;  4B08 A;  3TAB A;  1N6Q A;  1J5O A;  2PYL A;  3VA3 A;  2F8S A;  4HUF A;  2HVH A;  4CHO A;  3MXM A;  1S5J A;  2XY6 A;  4F3O A;  4DMN A;  1FKO A;  1VSK A;  1KLN A;  4DSE A;  1RT6 A;  4FJ8 A;  4KV8 A;  4LD0 A;  2FBX A;  4CF9 A;  1NKC A;  3H08 A;  5DK5 A;  3LWL A;  1VSL A;  1HRH A;  1VSJ A;  4AHU A;  4HVJ A;  3SUO A;  3PX0 A;  1EXQ A;  1JLC A;  3L3U A;  4JRQ A;  2YV0 X;  3VQ5 A;  1U49 A;  3C6U A;  2DFE A;  3OYB A;  4CJF A;  4GMJ B;  5HLF A;  1HQU A;  2VG7 A;  2YNG A;  1MU2 A;  2XRI A;  1Q9Y A;  2Y1J A;  1WSG A;  4BDZ A; 
#chains in the Genus database with same CATH topology
 2O8E B;  3AVN A;  2PYJ A;  2Y1I A;  4LF8 K;  3SJH A;  3D2F A;  3MWP A;  4DCH A;  4G1Q A;  4B3T K;  4JRP A;  3VER A;  4PA1 A;  3DOL A;  4CJU A;  5C2F A;  4W5N A;  3F9K A;  5HOO A;  3RSE A;  2KKZ A;  4B1X B;  1REV A;  4NXM K;  4Z4G A;  3CC4 N;  3AVA A;  2QWP A;  2HHS A;  4WF9 L;  5C15 A;  4HWI A;  1QS4 A;  1KCF A;  1OH6 A;  4O44 A;  4X66 K;  4CFC A;  3NH0 A;  3ZSR A;  4YOR A;  3L3V A;  1FK9 A;  1A5V A;  3LM2 A;  2PZS A;  2IDO A;  4M42 A;  1LWC A;  1BI4 B;  1Q81 O;  3VOV A;  4BDY A;  1V4T A;  5JVH L;  3O1W A;  3LDO A;  4QS8 A;  1EP4 A;  3AVC A;  3ZT3 A;  3HYF A;  4B1Y B;  2BGG A;  4DR7 K;  2G8I A;  5SZT A;  4EZ6 A;  3AVJ A;  3E9O A;  2UU9 K;  4AHS A;  3IG1 A;  4O0I A;  3IRX A;  1NKE A;  4ISG A;  4E7H A;  3U9D A;  3ZEU A;  3HXM A;  5J2P A;  1UA1 A;  3SYZ A;  2P9L A;  1IKX A;  4ELU A;  5GIO A;  2P9K B;  4H0T B;  3CFO A;  2HVI A;  2HST A;  3AGR A;  2IC3 A;  1N34 K;  4FCY A;  4IBN A;  4K41 A;  4GKK K;  4RWT A;  4DSJ A;  1VQN N;  3HZ6 A;  2HMP A;  5A2Q O;  2HHT A;  5FDL A;  2NZT A;  5AQN A;  1ZBS A;  3T1Y K;  4LF6 K;  1VSM A;  4JKD A;  1YIT N;  4B3O A;  4PKI A;  3MXI A;  5JS2 A;  4JI6 K;  4IXC A;  4CGJ A;  5KGX A;  3VQA A;  4OPH A;  5GIP A;  1VQK N;  3V1R A;  2O8C B;  3BDP A;  2Z1H A;  3CJA A;  3CJ1 A;  1IH7 A;  4IOA L;  1YUW A;  3BZC A;  3FLC O;  1NOZ A;  2I7P A;  1EWQ A;  1T6C A;  3AVM A;  4DSL A;  3P83 D;  4FLY A;  3ZYY X;  3CG7 A;  2ASM A;  1S1V A;  3R1X A;  3GG4 A;  5BRH A;  3CJ7 A;  3O9S A;  4BWJ A;  4YDU A;  3TAP A;  4FLX A;  2OZM A;  4AHR A;  1G99 A;  1TKT A;  4EAH D;  4ZHR A;  4LF5 K;  4A57 A;  3CHW A;  4JKF A;  3TTF A;  4BGA A;  2E6M A;  3WQT A;  3CXC M;  4E19 A;  4CGD A;  4BRP A;  4KHY A;  1LOT B;  4AF1 A;  4DU3 A;  4NCA A;  1NGH A;  5AQH A;  2FLO A;  1BIS A;  3L2R A;  4AM7 A;  4RW8 A;  1NGG A;  3VQC A;  3NFA A;  3ZT4 A;  2CGK A;  3DMJ A;  2P9S B;  2DY4 A;  4EIA A;  4DUY K;  2D0A A;  2GEM A;  1OH8 A;  1KC8 O;  2Q97 A;  3ZSZ A;  5BRE A;  1RCH A;  5BPL A;  2VQF K;  3LAN A;  5F2R A;  1HUX A;  3TSU A;  3LDN A;  3THX A;  4GY2 B;  4CJ3 A;  2JLE A;  4FJJ A;  3DLL L;  4I2Q A;  1VRT A;  1HYV A;  2X78 A;  2FF3 B;  1LAW A;  3BGR A;  2XY7 A;  2ITG A;  1Q8I A;  3OYE A;  3CPE A;  1A5W A;  4JI1 K;  4BAC A;  5AQM A;  4CGF A;  1EQY A;  3ZET A;  4DFK A;  4KRF A;  3EZ5 A;  4L8R B;  4WFB L;  2BDP A;  1NM1 A;  4CHN A;  4CHP A;  4CJK A;  3U8X A;  3ID6 A;  4AHT A;  4KI4 A;  1KAX A;  4CIG A;  2RN2 A;  4ISF A;  4BRN A;  3T19 A;  1WB9 A;  2F9T A;  3JS6 A;  4F2S A;  2QXF A;  1VQ4 N;  1NK8 A;  3GOI A;  1FKP A;  4FM0 A;  3NGI A;  3P38 A;  3RVC A;  4DUZ K;  3SI6 A;  5AQZ A;  5AZJ A;  5EOY A;  3P31 A;  4OPJ A;  1DEJ A;  1XNQ K;  4JHD B;  4DTR A;  4BC5 A;  1N36 K;  4IWV A;  5E84 A;  2IVP A;  4BE0 A;  1BA1 A;  2X6S A;  3RMD A;  1LW2 A;  3T1A A;  3LWM A;  1Z6R A;  3SBG A;  3I56 N;  3DXK A;  3OJU A;  3JSM A;  4Q5V A;  4CE9 A;  5AZI B;  4B3M K;  2D0C A;  5TKY A;  1BCO A;  1NGJ A;  1SAZ A;  2WFB A;  4YFU A;  1YJW N;  2BAN A;  1QVG M;  5FLX O;  4B1W B;  4M3Z A;  4BRO A;  1S72 N;  3MEE A;  2OYQ A;  3BZK A;  3TU5 A;  3OYF A;  1YJ9 N;  5AQR A;  4DSF A;  4CEO A;  4Y1D A;  3A8Y A;  1JLA A;  3O80 A;  3J7A P;  2FSK A;  3G10 A;  4IKF A;  1GLL O;  1BL3 A;  4JD2 A;  1IKY A;  3VQE A;  4BR4 A;  1OH5 A;  5M1K A;  4N5S A;  5CYM A;  3ENH A;  1ZBH A;  4JS4 A;  1WUA A;  4JS5 A;  4B9Q A;  3JYT A;  4LSL A;  2ZF5 O;  3VTH A;  4FZY A;  1TUU A;  3QFP A;  1HMV A;  4FWK A;  4Y1C A;  1Q7Y O;  1OH7 A;  4FVU A;  3NF7 A;  1WSE A;  3WUH A;  4NXN K;  4GV6 A;  4U7B A;  3C65 A;  3CD6 N;  4H8K A;  3TAQ A;  3HTV A;  3R8E A;  4M3T A;  2I7N A;  3WXJ A;  4CEF A;  3GDQ A;  4H0O A;  4FJ7 A;  1TAQ A;  4RW7 A;  3WXI A;  1NGA A;  1U2V B;  5AQV A;  2FSJ A;  4ICL A;  1X9J A;  4BE1 A;  1EET A;  3V9S A;  5AQK A;  1BWF O;  3PO4 A;  1RDD A;  4BRM A;  4RW9 A;  1GLJ O;  3NH2 A;  2NRW A;  2VWB A;  3ULD A;  3AVI A;  4OGE A;  3CJC A;  5AFU A;  3P1G A;  4RW6 A;  3DLK A;  3CFR A;  4NB4 A;  3SAF A;  2GWK A;  1TYQ B;  1SKR A;  1YT3 A;  4FWR A;  4CJL A;  4M3Y A;  3F5T A;  4CEA A;  4FJ5 A;  2IGI A;  2NRH A;  2UXB K;  4IG3 A;  3O9Q A;  2HBK A;  4I9L A;  3DLB A;  5AQU A;  4E1N A;  2IAJ A;  3MEG A;  4CZK A;  1RTI A;  4IJA A;  1BQM A;  2WOM A;  1JLF A;  4C1N I;  2OTL N;  4CES A;  1RT5 A;  1I94 K;  4FJX A;  4FLW A;  2G8K A;  4FW1 A;  3LPU A;  3SMS A;  2F4V K;  1WSI A;  4GNI A;  3V9X A;  4IJN A;  2O8D B;  4KHS A;  4Z4E A;  2KW4 A;  3AAP A;  3PIO L;  3F73 A;  3IKM A;  4KO0 A;  1VSE A;  3OA9 A;  4PUO A;  3VES A;  4DV2 K;  3CCV N;  3DLG A;  4H0Y B;  1L5U A;  4JI8 K;  3AO4 A;  4ZTJ A;  3G71 N;  3ZT2 A;  3VGM A;  5CZ1 A;  3L6Q A;  4DR3 K;  1C0U A;  1K6Y A;  4ILJ A;  1T8E A;  2XY5 A;  1BU6 O;  2DFF A;  2HF4 A;  3CCL N;  3LP2 A;  3CQY A;  4M3X A;  2HHQ A;  2UYT A;  1KLM A;  1RBS A;  4ID1 A;  1XUP O;  3M8P A;  1SUQ A;  2QWO A;  3CIP A;  1SL1 A;  2HHX A;  2XY8 A;  3DXM A;  4JV5 K;  1NK0 A;  4DFJ A;  3TAB A;  1GLF O;  4JYA K;  2XY6 A;  3IUC A;  3VEN A;  1VSK A;  1R59 O;  1RT6 A;  2FXU A;  4LD0 A;  3H08 A;  3LWL A;  4AHU A;  1S22 A;  2W40 A;  1JLC A;  4JRQ A;  5BRF A;  2RHK A;  4MDA A;  4GMJ B;  4CJF A;  2VG7 A;  3NVM A;  3CI5 A;  4CJW A;  4FYD A;  3HP9 A;  2IS3 A;  1HX1 A;  3OTO K;  3E9L A;  4IFY A;  4OX9 K;  1Y97 A;  4YOV A;  3SZ2 A;  1JLB A;  1NGB A;  1SL2 A;  2G8F A;  3OYI A;  4NLC A;  3SV3 A;  3O8M A;  1W7A A;  3KIO A;  3MN5 A;  1BG3 A;  4W5O A;  4CI6 A;  5DMR A;  3UKU B;  3EEQ A;  4B1V A;  4BRA A;  3D2E B;  5F1X A;  1YIJ N;  2HB5 A;  2UUB K;  3VQP A;  2ZE2 A;  3O4W A;  3SJJ A;  3QEP A;  4DQ8 A;  4FXD A;  3Q7B A;  2JWK A;  1K8K A;  1WSJ A;  1IKV A;  2O4G A;  2RE2 A;  5BN8 A;  2WTU A;  5BPN A;  3OJS A;  3LL3 A;  2E4L A;  4DR6 K;  1VSH A;  3C7N B;  1TKZ A;  4JKG B;  5E26 A;  3VQQ A;  1L3T A;  4FPB A;  2E2Q A;  4BRL A;  3NBP A;  3LP0 A;  3VF4 A;  1QQM A;  4GVE A;  1IO2 A;  3RMA A;  1H1V A;  2NRZ A;  4FLZ A;  2GX9 A;  3AO5 A;  4Q0B A;  1BI4 A;  1C1C A;  3R6M A;  1RDB A;  3CYM A;  5C10 A;  1U48 A;  3NF6 A;  4PL7 A;  3O1B A;  2DTU A;  5C25 A;  2F96 A;  3THW B;  3VA0 A;  4DQI A;  1N32 K;  1RIL A;  4CGH A;  3C0B A;  4EZ9 A;  1NG9 A;  3FR0 A;  3U6F A;  4E0D A;  3AVL A;  4EP5 A;  3VGL A;  3SUQ A;  5FPD A;  4GW6 A;  3J81 O;  4BDP A;  4AM6 A;  2P9K A;  5C12 A;  4Z4F A;  1WNS A;  3VF2 A;  4CJV A;  1T6D A;  5BN9 A;  1IBM K;  2PBD A;  5FRN A;  4CJE A;  1YAG A;  3VQ4 A;  1L3V A;  2WON A;  3WNG A;  3KK1 A;  4BRK A;  5AQG A;  1HNZ K;  1HKG A;  4DF8 A;  4C8K A;  3IS9 A;  4N41 A;  3IDH A;  3CME N;  3M3Z A;  3ID8 A;  5ADX H;  3QIN A;  4MDB A;  4FJM A;  3DRR A;  3D7E O;  3LP3 A;  2QI2 A;  4B3S K;  4FJI A;  3B8A X;  3KK7 A;  3I55 N;  3C6H A;  2QXL A;  4DWI A;  5K14 A;  3QER A;  4PWD A;  1JXB A;  3L2V A;  3EL2 A;  3S3O A;  2W6L A;  4DFM A;  1VSD A;  5CY4 A;  3H46 O;  1N5Y A;  3VF6 A;  4C23 A;  3AV9 A;  1O13 A;  4BC4 A;  3KKS A;  5EVZ A;  2O8F A;  3OVN A;  4B1U B;  3NE6 A;  2X74 A;  3KLH A;  4J2D A;  1IBK K;  4V19 S;  2BUP A;  3CFP A;  2FF6 A;  5FPM A;  3HST B;  4FJ9 A;  4B1Z A;  1P90 A;  3NMU A;  4FJG A;  4O8K A;  1HQE A;  4IEI A;  4ZTF A;  3SQ2 A;  1XI1 A;  3ZT1 A;  1CXU A;  4E1J A;  4K0K K;  5AQX A;  5FRM A;  2HBL A;  3CPW M;  1P8Z A;  1NK4 A;  4WE1 A;  5M1F A;  1ZYQ A;  1VQM N;  2E1Y A;  3ZCM A;  4LFC K;  1GOA A;  1ATN A;  4B8A B;  3QEX A;  1BHL A;  2KFZ A;  3CJ9 A;  1U4B A;  4ELT A;  3H6E A;  1UAX A;  3MWT A;  2BTF A;  4JKB A;  5CHI A;  4KHQ A;  3NCI A;  2ZWH A;  3L4Q A;  3CCU N;  2AJQ A;  3SUN A;  1KTQ A;  2E5L K;  4AHV A;  3TSQ A;  3ATV A;  3SK3 A;  1VQP N;  3KD1 E;  4IG0 A;  2IVO A;  2JWL A;  2E2P A;  5J2M A;  2Z1J A;  3V81 A;  4IO9 L;  4LC9 B;  2GWJ A;  1SS6 A;  3H3O B;  3O9T A;  4K43 A;  3B6P A;  4HTU A;  5LY3 A;  5ADX A;  1NK6 A;  4JI3 K;  4CD3 A;  4XIU A;  4N56 A;  3KK2 A;  4KHN A;  2IIR A;  4K8Z A;  1QHA A;  3RR7 A;  4CZL A;  3O3F A;  2V51 B;  1RBU A;  3L8B A;  3K5O A;  4CJT A;  3VGK A;  4IDK A;  4CER A;  5H1S Q;  3SNN A;  3NVK A;  1Q18 A;  1RT4 A;  4O0J A;  2QWN A;  3OBW A;  4JHD A;  3QEW A;  2P9I A;  4KHW A;  1VAZ A;  3VQ8 A;  4C8O A;  4H4M A;  5KI6 A;  4MO4 A;  2Q36 A;  5JLF A;  2G8W A;  4O4G A;  4CZI A;  5J1E A;  4H5N A;  3UKR A;  1TK5 A;  4NCG A;  4YOX A;  3TAG A;  3J80 O;  1EX4 A;  2NRV A;  1JL2 A;  4OKE A;  4DTS A;  1WBD A;  1RBT A;  2OA8 A;  4JLH A;  2A5X A;  2P9U B;  3DRP A;  3G4S N;  3MX5 A;  5GAD P;  3HBT A;  4IFE A;  3MX2 A;  4DB3 A;  1Z26 A;  3HRG A;  3ASM A;  4DQQ A;  3OYL A;  2F8T A;  4KHU A;  4O5F A;  1K8A O;  4CGI A;  4O55 A;  2VWK A;  3CCQ N;  2HBJ A;  2P9N B;  3OYJ A;  4NYN A;  1ZXO A;  4N76 A;  2Z1G A;  3QEI A;  4TSX A;  4C8L A;  1MWM A;  2E2O A;  4CZG A;  4J8F A;  4CEB A;  4OO1 J;  3K2P A;  1VRU A;  3V9U A;  2P9P A;  1DTT A;  1S1U A;  2OAN A;  4FZX C;  4CEZ A;  3D2F B;  3PX6 A;  4E1M A;  4H5R A;  1NKB A;  1BIU A;  4YDU C;  1NMD A;  3HPH A;  3SMP A;  2NRX A;  5AQY A;  4DU1 A;  3OW2 M;  3FZM A;  1BQN A;  3CER A;  3RSE B;  4MLH A;  4E3S A;  2QKK A;  2HHV A;  4CVN E;  1C0F A;  1CXQ A;  2G8U A;  4H0V B;  3AO3 A;  5DM6 L;  3HM9 A;  3P39 A;  3KD5 E;  3FFK B;  3ZX2 A;  5TKW A;  3QBX A;  1Q82 O;  3QBW A;  1WAF A;  4W5Q A;  4N47 A;  2Q1N A;  4YOU A;  4FWQ A;  5J2Q A;  4JI4 K;  2B6A A;  2FC0 A;  1QSS A;  3AA2 A;  3ENO A;  3K5M A;  3A5L C;  3VQ7 A;  4BR5 A;  4LY7 A;  1NJZ A;  3MCA B;  4DHY A;  4NYF A;  2RF2 A;  4JI7 K;  1RDA A;  3BEX A;  4HUE A;  4M63 C;  2YCH A;  2H3G X;  3ULE A;  3NAE A;  3ZEU B;  2ZGY A;  4RCH A;  3DM2 A;  4MO5 A;  3TAN A;  4B9S A;  1NJX A;  1OKJ A;  4BRG A;  5AFU H;  4OKK A;  1QQN A;  1GLB G;  4CW7 B;  3LZJ A;  3MEC A;  3SQ1 A;  5SWM A;  1WLJ A;  2A40 A;  3TTD A;  4DS5 A;  5GIN A;  3WXM B;  2VYP A;  2V52 B;  2EWS A;  4W5R A;  3G0Z A;  3KHY A;  3PX4 A;  3V4I A;  5I3U A;  2F9W A;  1C0M A;  3QET A;  1ASU A;  1XQS C;  1SZ2 A;  2O8D A;  4MLE A;  5HBM A;  4DSK A;  1RDW X;  4BY9 C;  1TGO A;  3MXJ A;  3MCP A;  3ZSW A;  4DV6 K;  3TWH A;  3IAY A;  1RGI A;  1C6V A;  1W97 L;  1FXX A;  3M1F A;  3SV4 A;  1QTM A;  4WQ5 A;  4FSV A;  5AQF A;  3ZSO A;  1E4F T;  2F7T A;  1RTD A;  3SQ4 A;  3WXL A;  3SAG A;  1NGE A;  3LDP A;  5GAH P;  1TV6 A;  3ZX0 A;  1ITG A;  1N6Q A;  1IKW A;  4WCE L;  3MN6 A;  2PYL A;  3THY A;  1KQS M;  2F8S A;  4HUF A;  2HVH A;  1S5J A;  3HSC A;  5FPN A;  4F3O A;  1BO5 O;  1XMQ K;  4DSE A;  1KLN A;  1NKC A;  3IMX A;  1VSL A;  4GKJ K;  1VSJ A;  4FWO A;  5LMN K;  3C6U A;  2AA4 A;  2DFE A;  5HLF A;  5FPE A;  2YNG A;  4ISE A;  4XH4 A;  4BDZ A;  3WEE B;  1CLQ A;  1W0H A;  5EXW A;  2ZJR L;  5IWA K;  4YOY A;  3HP6 A;  2UUA K;  3AVF A;  4BE2 A;  4OLB A;  3BUZ B;  3WT0 A;  3THX B;  2YHW A;  3L2Q A;  2VGN A;  4K42 A;  5CYQ A;  4FJK A;  3DAW A;  4ILH A;  2Q0R A;  3ZSY A;  5DM7 L;  3C94 A;  2VCP A;  5KRT A;  1S9G A;  1JJ2 M;  1QQC A;  1KVC A;  4YOW A;  5BR9 A;  4GV3 A;  4WQ4 C;  5B8H A;  2A1R A;  3OYH A;  4B3R K;  3ZET B;  4H0X B;  3OY9 A;  2WBN A;  1HKB A;  5M1O A;  4DTU A;  1VQ7 N;  4M3W A;  3LDS A;  1TK8 A;  1D4X A;  4DQS A;  3TAE A;  1JL1 A;  4U67 L;  4HCB A;  5D3G A;  4NO7 A;  2EX3 A;  1Q9X A;  4Z4I A;  4CBU A;  4KTZ A;  1A5X A;  3LZI A;  4CJS A;  3ZX3 A;  4HUG A;  4BVP A;  2ZJP L;  3AGK A;  2YKM A;  3VQB A;  3CCS N;  1U45 A;  4JI2 K;  1D9F A;  1NOY A;  1HNW K;  4JKC A;  1ZBL A;  1RT2 A;  4DTP A;  4BWM A;  3WNE A;  5AZJ B;  4LF9 K;  3TAF A;  4DV4 K;  4LFB K;  2KZM A;  4JK8 A;  1NGF A;  4CK3 A;  4F4K A;  2J4R A;  4DQP A;  2ETJ A;  2VG6 A;  4FM2 A;  5C42 A;  4BR7 A;  2VG5 A;  4WFN L;  3EKU A;  4CEE A;  4BRE A;  2ASO A;  5KQD A;  1WN7 A;  3AY9 A;  4E7K A;  1IG9 A;  3SBT A;  5AQP A;  1YJN N;  2LSN A;  1RBV A;  4WYB A;  1ZBI A;  2E8A A;  3CET A;  3V9Z A;  3GE1 A;  2P1J A;  2AP1 A;  4Z4C A;  2OTJ N;  5CE3 A;  3E9P A;  4AIL C;  2PAV A;  3QDK A;  4HHT A;  1U47 A;  3CM5 A;  3M6G A;  2Q3S A;  3LAM A;  3W3D A;  4J2B A;  3IFR A;  4A61 A;  3A5M C;  3K59 A;  1OVQ A;  3ZLJ A;  4H03 B;  3O9U A;  3F2K A;  3LAL A;  4FJL A;  3E1Y A;  2A6A A;  2WC9 A;  1RFQ A;  4FOE A;  5AQJ A;  4CD1 A;  3MDQ A;  2A42 A;  1X9W A;  3AVH A;  2YHA A;  3QB0 A;  1ILY A;  2HHW A;  4H4O A;  3CCE N;  3VEO A;  3PIP L;  4BRD A;  5KQ8 A;  2QWL A;  3VTI A;  1LWE A;  4R79 A;  4MFB A;  5AR0 A;  2B4J A;  5LJV A;  1XWL A;  2HF3 A;  5I42 A;  4RG8 A;  3TAR A;  2Z1I A;  3OYM A;  4JKA A;  4QAG A;  3NGZ A;  1SKW A;  4CHZ A;  3AVB A;  3JAM O;  1TKX A;  3O5B A;  2O4I A;  1HKC A;  3DLR A;  3AA3 A;  2O8E A;  4XH5 A;  3LDL A;  2QWQ A;  3KZB A;  4FWN A;  1S1T A;  1NGI A;  4OPA A;  2YNF A;  1NK5 A;  3O08 A;  4OPK A;  3HVR A;  3JXU A;  4JK7 A;  4KHP K;  2HMI A;  2PY5 A;  4KTQ A;  5KPT A;  4CK2 A;  3RRH A;  1KAY A;  2B5J A;  4DR5 K;  4CBW A;  3RWU A;  4KH5 A;  1QZ6 A;  4IOC L;  2O8B B;  3VEW A;  1HNV A;  1YI2 N;  2A3Z A;  1JLE A;  2V7Z A;  4BVO A;  1VQL N;  4QS7 A;  4OGC A;  1NK9 A;  3CJB A;  4OVL A;  5LL6 Z;  1VHX A;  4FVM A;  2P5G A;  1V4S A;  1RT3 A;  4CJP A;  3C95 A;  2GUP A;  3OYN A;  3KWI A;  1WSH A;  3RMC A;  3J7Y P;  3T69 A;  4OJR A;  4GV9 A;  4DTN A;  1YTA A;  3VEX A;  3LP1 A;  1IG8 A;  4DV5 K;  1NNE A;  3R9P A;  3QNO A;  3PSF A;  2JGU A;  4DLE A;  1KSP A;  4DTO A;  2GEL A;  1YXQ A;  3O9R A;  4B9T A;  2KLA A;  4I6M B;  1CZA N;  1RDU A;  3CMA N;  3PUF A;  2D0O A;  1QHT A;  4W5T A;  2VGM A;  1XC9 A;  1DGK N;  4JN4 A;  3HM8 A;  4FK2 A;  3VEZ A;  4CCH A;  1YTU A;  3KLI A;  3NH1 A;  1JKH A;  1QSY A;  2W6K A;  1RT7 A;  3V6D A;  3QIP A;  3DOK A;  4DR1 K;  1MA9 B;  3M8R A;  4DQR A;  3HPO A;  5C2D A;  3J7Z O;  4K25 A;  2O8C A;  1ESV A;  3D45 A;  1S1W A;  5CR4 A;  3QEV A;  5KRS A;  3UIQ A;  2UUC K;  3ITH A;  3B6O A;  3A5N C;  1QVF M;  1W9H A;  2E1Z A;  2YHB A;  3T1H K;  4CF8 A;  1D9D A;  3HPG A;  4LF4 K;  3S41 A;  4B9U A;  2OPR A;  4LSN A;  4KI6 A;  5JLH A;  4JKH A;  4QOZ B;  4PHT X;  1TUY A;  4M3R A;  2G8V A;  3TPQ A;  3L2W A;  4DV0 K;  4EP4 A;  4PY5 A;  4CIF A;  4B9N A;  3PY8 A;  5CZ2 A;  3EE8 A;  3AAR A;  1T7P A;  3K5L A;  1TK0 A;  1KVB A;  2ZQB A;  3VQ9 A;  3KTQ A;  4M3U A;  4ELV A;  4CZM A;  4KRE A;  5LJW A;  4EHU A;  1O1W A;  3TAM A;  3RMB A;  3A0I X;  1YHQ N;  2P9S A;  1VSF A;  4CEC A;  3THV A;  4E89 A;  3KK3 A;  1ASV A;  5MLC Q;  3KLG A;  1HPZ A;  5F0X A;  1DKG D;  1RNH A;  1YVN A;  4H5W A;  1MDU B;  4KB0 A;  1K8K B;  4CF2 A;  5HRR A;  4BRQ A;  1RTH A;  3UB5 A;  4YNQ A;  2D1K A;  3SPY A;  2VWJ A;  5EY4 A;  4CJ4 A;  2NLX A;  4DTM A;  3DRS A;  4I2P A;  1KRP A;  4CEQ A;  4YY3 K;  5C0Y A;  2E2N A;  3V9W A;  3FGU A;  3KKR A;  3MAQ A;  1XMO K;  3CCM N;  3Q7C A;  1E3M A;  2ZGZ A;  1BIZ A;  1GOC A;  1WSF A;  4BC3 A;  2BH1 A;  3RRG A;  1EO1 A;  3CC2 N;  1I39 A;  1T44 A;  3QFU A;  4DKW A;  2QWR A;  5JMV A;  3OYD A;  2VQE K;  4Z0U A;  1LW0 A;  3ALY A;  3KVG A;  4A2A A;  1KFS A;  4CJ7 A;  3EN9 A;  1WOQ A;  1TVR A;  4JNE A;  1NBW A;  4CBX A;  5KPR A;  1UOC A;  3NHG A;  2HNY A;  4JI5 K;  5AQQ A;  1HPM A;  1VK0 A;  3SLC A;  2NUB A;  2R7Y A;  4J2A A;  3RTV A;  3MED A;  2HNZ A;  4FPA A;  3WXK A;  4M7X A;  4CED A;  3SCX A;  1M1K O;  4I7F A;  1UWB A;  4FL9 A;  5HL7 L;  1IBL K;  4BC2 A;  3CCJ N;  3ZSV A;  1YVU A;  4FLV A;  1JLQ A;  3QIO A;  1L3S A;  4BG8 A;  3OYC A;  4CZH A;  2GTD A;  2HOE A;  3J8A A;  4CFB A;  4FJN A;  2YNH A;  4DLG A;  3M8Q A;  3HT3 A;  5AQO A;  5AZI A;  3AAQ A;  2HHH K;  4BR2 A;  3FE1 A;  4KTW A;  1RT1 A;  1U04 A;  2CH6 A;  2YJE A;  5AQI A;  4HCC A;  1FW6 A;  3OHR A;  4PKH A;  1EWR A;  2ASP A;  4BRH A;  4EHT A;  4CZF A;  4H5V A;  4X64 K;  1ASW A;  2E20 A;  1LCU A;  5M1N A;  5E41 A;  3PSI A;  2O8F B;  4B08 A;  1WBB A;  4FWS A;  1HNX K;  3T7Z A;  1HR0 K;  4DMN A;  3H3N O;  1SQK A;  2FBX A;  1JCG A;  3SUO A;  1EXQ A;  1Q86 O;  3VQ5 A;  1U49 A;  1MU2 A;  4BRC A;  2Y1J A;  4B9L A;  4HTL A;  3NDK A;  1SV5 A;  2HHU A;  1NWK A;  4DTJ A;  3TR8 A;  3K5N A;  3SUP A;  2FBY A;  4BQL A;  3AA4 A;  1J9A A;  1S6P A;  3AO1 A;  1VQ6 N;  3HL8 A;  3K58 A;  2HW3 A;  3I33 A;  4K8X A;  4GVM A;  4LH4 A;  5AQL A;  3WEE A;  4LH5 A;  1VSI A;  1KAZ A;  4NCB A;  3P5J A;  4PKG A;  2NNW A;  1ATS A;  4B9M A;  3BP8 A;  3ATU A;  4IFV A;  4A59 A;  4F2R A;  1K9M O;  5JVG L;  1T05 A;  1U2V A;  1J53 A;  2QK9 A;  4CZE A;  3QML A;  3G25 A;  4E7J A;  2WUS A;  4LFA K;  3E66 A;  4H0P A;  3N4Q A;  2P5O A;  1S9E A;  4E7L A;  5HRP A;  4IZ9 A;  1T03 A;  2DFH A;  2FBV A;  5M1P A;  4DU4 A;  2P9L B;  2BE2 A;  1TYQ A;  1KVA A;  5BPM A;  3HOS A;  1KXP A;  3L0Q A;  3N4P A;  1DTQ A;  3UE5 A;  4A5B A;  3SQ0 A;  3TI0 A;  5M1Q A;  1Y64 A;  3E01 A;  1BUP A;  2OCE A;  1ATR A;  4AHC A;  3O3H A;  3QNN A;  4UY8 O;  4DG1 A;  3P4I A;  3OS2 A;  1RBR A;  1C0G A;  3AA5 X;  1IJJ A;  3I8B A;  4CFD A;  4CF1 A;  4DSI A;  4DV7 K;  5I9E B;  3S3M A;  1VQ9 N;  3SPZ A;  4PL8 A;  3AVG A;  2P9I B;  4KB1 A;  3KWG A;  3I0R A;  2OPS A;  3OYK A;  3K0S A;  4JK9 A;  3F9M A;  4DS4 A;  3ISN C;  3MN7 A;  3UKR B;  3CM6 A;  1DLO A;  2IVN A;  3DJC A;  3V1Q A;  5HRO A;  4CGG A;  3MK6 A;  4F9O A;  1VQ8 N;  3O3G A;  3CCR N;  2G8H A;  1GLC G;  3HVT A;  4CJR A;  5IT9 O;  3ZSQ A;  4C8N A;  3D0P A;  1ZC6 A;  3PV8 A;  1GLA G;  3KJV A;  2YNI A;  1QQO A;  2ZD1 A;  5LMU K;  1BGX T;  3U3G A;  4KAZ A;  1D8Y A;  1N8R O;  3U9Z A;  3VN5 A;  4DFP A;  2KZZ A;  4BG9 A;  4BRI A;  4IEE A;  4Y0W A;  1I3A A;  2D4W A;  1YF5 L;  4ILG B;  3EO3 A;  1CZ9 A;  1BDG A;  4OKJ A;  4JAX A;  2XO7 A;  1MWK A;  4WQ5 C;  4OLA A;  2P9P B;  2QTD A;  3LDQ A;  3OYA A;  2UXC K;  3QLH A;  4JEP A;  4KH4 A;  4A5A A;  1LV5 A;  2QEX N;  4CZJ A;  1JXE A;  2NRT A;  3WQU A;  4BRF A;  5HRS A;  1XHZ A;  3U3Y A;  2HND A;  3ENB A;  3GBT A;  3NGY A;  5FRO A;  3QO9 A;  3VQ6 A;  4WQ4 A;  1IV0 A;  2D0B A;  1LAV A;  4FW2 A;  3EZW A;  2KFN A;  5AQS A;  2KHO A;  3LAK A;  4QS9 A;  1Z05 A;  1XHX A;  4CFA A;  1UA0 A;  5J2N A;  3FZK A;  4DV1 K;  2QW9 A;  4FWP A;  4FO0 A;  1D5A A;  1NGC A;  2QA4 N;  4B9V A;  1S1X A;  3O4N A;  1NGD A;  3O6W A;  5GAE P;  4XH1 A;  1JCE A;  4A2B A;  1XC3 A;  4CHY A;  3RR8 A;  3UKU A;  2E6L A;  2W42 A;  3D2E A;  4YOT A;  5T7B A;  4CHQ A;  3NF9 A;  3EYZ A;  4FM1 A;  3U4L A;  1K73 O;  1L3U A;  2O8B A;  3DI6 A;  2QKB A;  1NU0 A;  4BR0 A;  4QCL A;  3ULE B;  4IOX A;  3ZSX A;  5KTQ A;  4A62 A;  1QE1 A;  3C7N A;  3PO5 A;  1HYZ A;  5GAG P;  5AJ3 K;  1NMN A;  4JKG A;  3DLH A;  1B9F A;  2OZS A;  1GLE G;  2V7Y A;  3CF5 L;  4FK4 A;  3G6E N;  5EX5 A;  1TKD A;  5EU7 A;  4LF7 K;  2KTQ A;  2QM1 A;  1NJI O;  1CZB A;  3T3F A;  4CF0 A;  2UXD K;  3A2F A;  3OYG A;  1HYS A;  5JIC A;  4DR2 K;  1VQO N;  2X6N A;  1R0A A;  3EE9 A;  1G15 A;  4C1N K;  4CK1 A;  3DXK B;  3H1V X;  4FLU A;  4ID5 A;  3H1Q A;  3NF8 A;  3THW A;  5KGW A;  2OPQ A;  1TAU A;  4FLT A;  2A41 A;  1C1B A;  3KLF A;  2ATQ A;  5AQT A;  4AQY K;  4MQ3 A;  2NRR A;  2Q0U A;  3WNF A;  4DV3 K;  1HJR A;  2FSN A;  2ITM A;  1NLV A;  4H5T A;  3HO1 A;  1J54 A;  1SKS A;  1C0T A;  4CJ5 A;  4I6M A;  3O4Q A;  3KLE A;  1S6Q A;  1QSL A;  1X3M A;  3I0S A;  4KFB A;  3VET A;  2CGL A;  4NLB A;  1DT9 A;  4M41 A;  4AH9 A;  3CQX A;  3DLE A;  2GUI A;  4JD2 B;  3LM9 A;  1HJO A;  1KFD A;  1X9S A;  3HK2 A;  4I9Q A;  1GLD G;  3VPZ A;  3EY1 A;  3THY B;  1J5E K;  4Z94 A;  3TSP A;  3BY5 A;  4F3T A;  4FZZ A;  2D5R A;  1BCM A;  1HLU A;  1Z25 A;  5ELZ A;  3M5R A;  4RTF D;  5JS1 A;  1XNR K;  3VQD A;  3L4I A;  1BA0 A;  3FZF A;  4KKO A;  2RPI A;  4R5P A;  3HOT A;  1J6Z A;  2IOC A;  2YKN A;  3R3L A;  1BOT O;  2I5J A;  3QIC A;  2OPP A;  3K57 A;  3MMV A;  2E88 A;  4X65 K;  1C1A A;  1SL0 A;  3ZT0 A;  5HP1 A;  3I8D A;  3HJF A;  4RW4 A;  1TL1 A;  2GV9 A;  3SAH A;  1ZBF A;  4UQG A;  3C6T A;  3FZH A;  2EHG A;  2XHB A;  2YX6 A;  4JKE A;  4IDH A;  4JI0 K;  1B92 A;  2A1S A;  1B9D A;  1TL3 A;  3OS1 A;  2CGJ A;  3HI0 A;  2HBM A;  5C24 A;  1N33 K;  5BRD A;  1QZ5 A;  3K9J A;  4WFA L;  3BF1 A;  1JCF A;  3WNH A;  4BR9 A;  3VMF B;  1OVY A;  1WAJ A;  1LWF A;  3VEY A;  2YHY A;  3CQ8 A;  1RTJ A;  2ZM6 K;  4O5B A;  2YJF A;  3AVK A;  4DTX A;  3S3N A;  4L3Q A;  2YI1 A;  2D0P A;  4G9Z A;  1W2B M;  4FJH A;  1T3V A;  3FFI A;  3DYA A;  4CIE A;  4DR4 K;  2QWM A;  3S9H A;  4BGB A;  1NK7 A;  3QES A;  2ZJQ L;  3V1O A;  4X62 K;  4M45 A;  4KH6 A;  3D6R A;  4Z4H A;  3L2U A;  4BQZ A;  1X1P A;  4FK0 A;  4C8M A;  3VEV A;  3GL1 A;  1E4G T;  4DF4 A;  2GBZ A;  2KQ2 A;  4FWL A;  2Q31 A;  1NJW A;  4CJQ A;  1HNI A;  4B8C A;  2FBT A;  4FOI A;  2RKI A;  1RDC A;  1GOB A;  1U6Z A;  2CH5 A;  1JLG A;  3M8S A;  1KD1 O;  1S3X A;  1VQ5 N;  1EKE A;  3LPT A;  1FJG K;  3W0L A;  3AO2 A;  2PFU A;  3DWL A;  5KPZ A;  3C6A A;  2YHX A;  3K9K A;  4KPY A;  2P51 A;  2DPN A;  3BF3 A;  1X9M A;  4EFH A;  4J2E A;  3DXM B;  4E7I A;  4PQU A;  1NJY A;  3A5O C;  5BR8 K;  4F8R A;  3PLA A;  3OS0 A;  3OBY A;  1F21 A;  1ZBU A;  3CC7 N;  1M90 O;  3FZL A;  3H45 C;  4IO8 A;  4O8U A;  2W41 A;  2P9U A;  5HRN A;  1J5O A;  3EKS A;  3VA3 A;  4CHO A;  4KBO A;  3TTC A;  3MXM A;  4YHH K;  1FKO A;  4FWM A;  2Q2R A;  4FJ8 A;  4KV8 A;  4CF9 A;  4M7Y A;  5DK5 A;  1HRH A;  2P9N A;  4HVJ A;  3PX0 A;  3L3U A;  5AQW A;  1X3N A;  2YV0 X;  3OYB A;  1HQU A;  2XRI A;  1Q9Y A;  4XEI A;  1WSG A;  3MN9 A; 
#chains in the Genus database with same CATH homology
 3NDK A;  1CLQ A;  1W0H A;  1SV5 A;  3AVN A;  2HHU A;  4DTJ A;  4CJW A;  2PYJ A;  2Y1I A;  3TR8 A;  3HP6 A;  3K5N A;  4FYD A;  3HP9 A;  2IS3 A;  3AVF A;  3SUP A;  2FBY A;  4IFY A;  3AA4 A;  4BE2 A;  4OLB A;  1J9A A;  1S6P A;  3AO1 A;  4G1Q A;  1Y97 A;  3HL8 A;  3K58 A;  2HW3 A;  3SZ2 A;  1JLB A;  3L2Q A;  1SL2 A;  5CYQ A;  2G8F A;  4K8X A;  4FJK A;  4GVM A;  4LH4 A;  4JRP A;  4PA1 A;  3DOL A;  3ZSY A;  4CJU A;  3OYI A;  3C94 A;  4LH5 A;  3F9K A;  1S9G A;  5KRT A;  4W5N A;  1VSI A;  3SV3 A;  1QQC A;  1KVC A;  3KIO A;  4NCB A;  1REV A;  3P5J A;  4Z4G A;  3AVA A;  2HHS A;  2A1R A;  4W5O A;  4B9M A;  4IFV A;  5DMR A;  3OYH A;  4F2R A;  1QS4 A;  2HB5 A;  3OY9 A;  1T05 A;  1KCF A;  4O44 A;  1J53 A;  2ZE2 A;  3VQP A;  3SJJ A;  4DTU A;  2QK9 A;  3QEP A;  4CFC A;  4M3W A;  4FXD A;  3NH0 A;  3ZSR A;  3LDS A;  4E7J A;  3L3V A;  1TK8 A;  2P5O A;  1S9E A;  1FK9 A;  4DQS A;  3TAE A;  1A5V A;  1WSJ A;  1JL1 A;  1IKV A;  2O4G A;  2PZS A;  4HCB A;  5D3G A;  4E7L A;  2IDO A;  4M42 A;  1LWC A;  2EX3 A;  3OJS A;  1BI4 B;  1Q9X A;  5HRP A;  2E4L A;  4Z4I A;  1VSH A;  4BDY A;  1T03 A;  2DFH A;  2FBV A;  4KTZ A;  1A5X A;  3LZI A;  1TKZ A;  4CJS A;  4HUG A;  3VQQ A;  4DU4 A;  1EP4 A;  2YKM A;  2BE2 A;  3VQB A;  3AVC A;  1U45 A;  1L3T A;  1D9F A;  3ZT3 A;  3HYF A;  1NOY A;  2BGG A;  3NBP A;  3LP0 A;  1KVA A;  2G8I A;  1IO2 A;  3RMA A;  1ZBL A;  1RT2 A;  4FLZ A;  1DTQ A;  5SZT A;  3SQ0 A;  4DTP A;  3TI0 A;  4EZ6 A;  3AVJ A;  3AO5 A;  4Q0B A;  4BWM A;  1BI4 A;  3E01 A;  3WNE A;  1C1C A;  1RDB A;  4AHS A;  3TAF A;  4AHC A;  3IG1 A;  3O3H A;  4O0I A;  3CYM A;  3IRX A;  3QNN A;  1U48 A;  4E7H A;  3NF6 A;  5J2P A;  3HXM A;  1UA1 A;  4DG1 A;  1NKE A;  3SYZ A;  5C25 A;  2DTU A;  1IKX A;  3OS2 A;  1RBR A;  4ELU A;  2F96 A;  4CK3 A;  4F4K A;  4DQP A;  3VA0 A;  2ETJ A;  2VG6 A;  3AA5 X;  3CFO A;  4FM2 A;  4DQI A;  4CFD A;  1RIL A;  4CGH A;  4CF1 A;  5C42 A;  4DSI A;  2IC3 A;  4EZ9 A;  3S3M A;  2VG5 A;  4FCY A;  4IBN A;  4DSJ A;  4CEE A;  2KZM A;  3SPZ A;  3U6F A;  1WN7 A;  4E0D A;  3AVL A;  4EP5 A;  4E7K A;  3SUQ A;  4GW6 A;  1IG9 A;  3AVG A;  4BDP A;  4KB1 A;  3I0R A;  2HHT A;  5FDL A;  2OPS A;  3OYK A;  2LSN A;  1RBV A;  4Z4F A;  1WNS A;  4CJV A;  1ZBI A;  5FRN A;  4CJE A;  4DS4 A;  4B9L A;  3V9Z A;  3ISN C;  2P1J A;  1VSM A;  3CM6 A;  2WON A;  3VQ4 A;  3WNG A;  1DLO A;  4Z4C A;  3KK1 A;  1L3V A;  4B3O A;  3V1Q A;  5HRO A;  4DF8 A;  3MXI A;  4CGG A;  4C8K A;  3IS9 A;  5JS2 A;  4AIL C;  4N41 A;  3O3G A;  4HHT A;  2G8H A;  1U47 A;  3CM5 A;  3HVT A;  3QIN A;  2Q3S A;  4CGJ A;  3DRR A;  4CJR A;  4FJM A;  3LP3 A;  5KGX A;  3VQA A;  4FJI A;  3LAM A;  3ZSQ A;  4J2B A;  4C8N A;  3V1R A;  3D0P A;  4DWI A;  5K14 A;  3QER A;  3PV8 A;  3K59 A;  3BDP A;  2Z1H A;  4PWD A;  3KJV A;  1IH7 A;  2YNI A;  1JXB A;  2ZD1 A;  1NOZ A;  3L2V A;  1BGX T;  3U3G A;  4KAZ A;  1D8Y A;  3VN5 A;  3AVM A;  4DSL A;  3P83 D;  4FLY A;  4DFP A;  3S3O A;  2KZZ A;  3CG7 A;  4DFM A;  1VSD A;  5CY4 A;  3LAL A;  4FJL A;  1I3A A;  1S1V A;  1N5Y A;  4BWJ A;  1CZ9 A;  4OKJ A;  1X9W A;  3TAP A;  4FLX A;  2OZM A;  3AVH A;  2YHA A;  3AV9 A;  2XO7 A;  4AHR A;  3KKS A;  2HHW A;  4H4O A;  1TKT A;  4ZHR A;  3OVN A;  4OLA A;  3OYA A;  3QLH A;  1LWE A;  3NE6 A;  2X74 A;  4MFB A;  3KLH A;  1LV5 A;  2E6M A;  2B4J A;  4E19 A;  1JXE A;  1XWL A;  4J2D A;  5HRS A;  4CGD A;  1XHZ A;  3U3Y A;  4KHY A;  2HND A;  5I42 A;  3NGY A;  5FRO A;  3CFP A;  2O4I A;  4RG8 A;  3QO9 A;  4DU3 A;  3TAR A;  2Z1I A;  3OYM A;  4NCA A;  3HST B;  1BIS A;  4QAG A;  4FJ9 A;  3NGZ A;  1SKW A;  3L2R A;  4CHZ A;  3AVB A;  3VQ6 A;  4FJG A;  1TKX A;  1HQE A;  4RW8 A;  3NFA A;  3VQC A;  3ZT4 A;  2D0B A;  3DMJ A;  1LAV A;  4FW2 A;  3DLR A;  3ZT1 A;  3AA3 A;  3SQ2 A;  4ZTF A;  1XI1 A;  2KFN A;  1CXU A;  2DY4 A;  2D0A A;  3ZSZ A;  1S1T A;  1RCH A;  3LAK A;  5FRM A;  1NK5 A;  2YNF A;  3LAN A;  4CFA A;  1XHX A;  4OPK A;  3HVR A;  1UA0 A;  1NK4 A;  4WE1 A;  2HMI A;  2PY5 A;  4KTQ A;  5J2N A;  4CK2 A;  3RRH A;  4CJ3 A;  2JLE A;  4FJJ A;  1ZYQ A;  4I2Q A;  2B5J A;  3ZCM A;  1GOA A;  1D5A A;  3RWU A;  1VRT A;  1HYV A;  4B8A B;  4B9V A;  1S1X A;  2X78 A;  1HNV A;  3QEX A;  1LAW A;  3O4N A;  3BGR A;  1BHL A;  1JLE A;  2ITG A;  1Q8I A;  3OYE A;  2XY7 A;  2KFZ A;  1A5W A;  4CHY A;  4BAC A;  3RR8 A;  4CGF A;  2E6L A;  2W42 A;  4DFK A;  4OGC A;  4KRF A;  1U4B A;  3EZ5 A;  4ELT A;  4L8R B;  1NK9 A;  5T7B A;  1UAX A;  4KHQ A;  4CHQ A;  3NF9 A;  2BDP A;  3EYZ A;  3NCI A;  4CHN A;  4FM1 A;  4OVL A;  1L3U A;  4CHP A;  3DI6 A;  4FVM A;  4CJK A;  2P5G A;  2QKB A;  2AJQ A;  3SUN A;  1KTQ A;  1RT3 A;  4AHT A;  4KI4 A;  4QCL A;  4CIG A;  2RN2 A;  4AHV A;  4CJP A;  3C95 A;  3KD1 E;  3T19 A;  3ZSX A;  4IG0 A;  3OYN A;  5KTQ A;  5J2M A;  3V81 A;  2Z1J A;  4F2S A;  2QXF A;  1WSH A;  3RMC A;  1QE1 A;  3PO5 A;  1HYZ A;  4OJR A;  3B6P A;  1NK8 A;  1FKP A;  4DTN A;  1YTA A;  4HTU A;  3LP1 A;  4FM0 A;  3DLH A;  1B9F A;  1NK6 A;  2OZS A;  4XIU A;  3NGI A;  4PY5 A;  4N56 A;  4FK4 A;  3KK2 A;  3SI6 A;  4KHN A;  3QNO A;  2HVI A;  1TKD A;  5EU7 A;  2KTQ A;  4K8Z A;  1CZB A;  3T3F A;  2JGU A;  4CF0 A;  4DLE A;  3A2F A;  1KSP A;  3OYG A;  3RR7 A;  1HYS A;  4OPJ A;  4DTO A;  2X6N A;  1R0A A;  4CK1 A;  1G15 A;  3O3F A;  4FLU A;  4ID5 A;  3NF8 A;  4DTR A;  1RBU A;  3L8B A;  3K5O A;  5KGW A;  2OPQ A;  4CJT A;  4IDK A;  4CER A;  2OYQ A;  4FLT A;  4B9T A;  1TAU A;  1C1B A;  4BE0 A;  3SNN A;  2X6S A;  2ATQ A;  3KLF A;  1RT4 A;  4O0J A;  1LW2 A;  4MQ3 A;  3T1A A;  3RMD A;  3PUF A;  3LWM A;  3WNF A;  3OJU A;  1HJR A;  1QHT A;  4Q5V A;  3JSM A;  3QEW A;  4KHW A;  3VQ8 A;  4W5T A;  4CE9 A;  4C8O A;  1XC9 A;  3HO1 A;  4H4M A;  1J54 A;  1SKS A;  5KI6 A;  2G8W A;  4FK2 A;  2D0C A;  4O4G A;  1C0T A;  4CJ5 A;  4CCH A;  1BCO A;  1YTU A;  3KLI A;  3NH1 A;  1JKH A;  3O4Q A;  5J1E A;  4YFU A;  1S6Q A;  1RT7 A;  3KLE A;  1QSY A;  1TK5 A;  3V6D A;  4NCG A;  2BAN A;  1QSL A;  3QIP A;  3TAG A;  3DOK A;  3I0S A;  4KFB A;  4M3Z A;  1EX4 A;  4M41 A;  4AH9 A;  1JL2 A;  3MEE A;  4OKE A;  3DLE A;  3M8R A;  2GUI A;  4DQR A;  3OYF A;  1RBT A;  4DTS A;  2OA8 A;  1KFD A;  3HPO A;  1X9S A;  4JLH A;  3HK2 A;  4DSF A;  3DRP A;  4I9Q A;  4CEO A;  3EY1 A;  4Y1D A;  1JLA A;  3D45 A;  1S1W A;  3QEV A;  5KRS A;  3UIQ A;  4F3T A;  1Z26 A;  3B6O A;  3G10 A;  3ITH A;  4IKF A;  2D5R A;  4FZZ A;  3ASM A;  1W9H A;  3OYL A;  4DQQ A;  1BCM A;  2F8T A;  2YHB A;  1BL3 A;  1Z25 A;  4KHU A;  1IKY A;  3VQE A;  4CF8 A;  5JS1 A;  1D9D A;  3HPG A;  4CGI A;  4B9U A;  2OPR A;  2VWK A;  4LSN A;  4O55 A;  3VQD A;  4KI6 A;  4N5S A;  5CYM A;  3OYJ A;  4NYN A;  4JS4 A;  1ZBH A;  4KKO A;  4N76 A;  4QOZ B;  2RPI A;  2Z1G A;  4R5P A;  4JS5 A;  3QEI A;  4TSX A;  4C8L A;  4M3R A;  2IOC A;  3JYT A;  4LSL A;  2YKN A;  2G8V A;  2I5J A;  3L2W A;  4CEB A;  2OPP A;  4FZY A;  3K57 A;  3K2P A;  4EP4 A;  1VRU A;  3V9U A;  1HMV A;  1DTT A;  4Y1C A;  1S1U A;  4CIF A;  4B9N A;  3PY8 A;  5CZ2 A;  1C1A A;  1SL0 A;  4CEZ A;  4FZX C;  3NF7 A;  1WSE A;  3ZT0 A;  1T7P A;  5HP1 A;  3PX6 A;  4E1M A;  3K5L A;  1TK0 A;  1NKB A;  1BIU A;  3I8D A;  3HJF A;  4RW4 A;  1TL1 A;  1KVB A;  2GV9 A;  2ZQB A;  3HPH A;  1ZBF A;  3VQ9 A;  3C6T A;  4UQG A;  3KTQ A;  2EHG A;  2XHB A;  4M3U A;  4ELV A;  4DU1 A;  4H8K A;  3TAQ A;  1BQN A;  4M3T A;  4KRE A;  1B92 A;  4CEF A;  4E3S A;  1O1W A;  2QKK A;  4FJ7 A;  2A1S A;  3TAM A;  3RMB A;  1TAQ A;  1B9D A;  1TL3 A;  2HHV A;  3OS1 A;  4RW7 A;  1CXQ A;  2G8U A;  3AO3 A;  1VSF A;  3HM9 A;  4CEC A;  3THV A;  4E89 A;  3KK3 A;  1ASV A;  3KD5 E;  4ICL A;  5C24 A;  1WAF A;  1HPZ A;  4W5Q A;  3KLG A;  1EET A;  4BE1 A;  3V9S A;  4N47 A;  1RNH A;  3PO4 A;  1RDD A;  3WNH A;  4RW9 A;  3NH2 A;  1WAJ A;  4KB0 A;  1LWF A;  3ULD A;  2B6A A;  4CF2 A;  5HRR A;  3AVI A;  1RTH A;  2FC0 A;  4YNQ A;  5J2Q A;  3CQ8 A;  1RTJ A;  4OGE A;  3SPY A;  2VWJ A;  4CJ4 A;  4O5B A;  1QSS A;  3AA2 A;  3K5M A;  3P1G A;  3AVK A;  4DTM A;  4RW6 A;  3DLK A;  3DRS A;  3CFR A;  4DTX A;  3VQ7 A;  3S3N A;  4I2P A;  4LY7 A;  1NJZ A;  4NYF A;  1KRP A;  4CEQ A;  4FJH A;  2RF2 A;  1RDA A;  1SKR A;  3FFI A;  3DYA A;  4CIE A;  1YT3 A;  3V9W A;  4CJL A;  4HUE A;  4M3Y A;  3S9H A;  4CEA A;  1NK7 A;  3QES A;  2IGI A;  3KKR A;  3MAQ A;  3V1O A;  4FJ5 A;  4IG3 A;  4M45 A;  4Z4H A;  4I9L A;  3NAE A;  1BIZ A;  1GOC A;  3DLB A;  3L2U A;  1WSF A;  4E1N A;  3RRG A;  2IAJ A;  3DM2 A;  1I39 A;  3MEG A;  1X1P A;  3OYD A;  3TAN A;  4FK0 A;  1RTI A;  4C8M A;  4B9S A;  1NJX A;  4Z0U A;  1LW0 A;  1BQM A;  3ALY A;  4DF4 A;  2WOM A;  2GBZ A;  2KQ2 A;  4OKK A;  1NJW A;  1KFS A;  1JLF A;  4CJQ A;  1HNI A;  4B8C A;  4CES A;  2FBT A;  1TVR A;  3LZJ A;  1RT5 A;  3MEC A;  3SQ1 A;  4FJX A;  5SWM A;  4FLW A;  2G8K A;  2RKI A;  1RDC A;  1UOC A;  3NHG A;  1WLJ A;  1GOB A;  2HNY A;  3LPU A;  4FW1 A;  1VK0 A;  4DS5 A;  2NUB A;  1WSI A;  1JLG A;  3M8S A;  2R7Y A;  3MED A;  3RTV A;  3V9X A;  4J2A A;  2HNZ A;  4KHS A;  4CED A;  4Z4E A;  3SCX A;  4I7F A;  2KW4 A;  1UWB A;  1EKE A;  3LPT A;  3F73 A;  4KO0 A;  4W5R A;  1VSE A;  3ZSV A;  4PUO A;  1YVU A;  3AO2 A;  4FLV A;  1JLQ A;  3G0Z A;  3QIO A;  3DLG A;  1L3S A;  3OYC A;  1L5U A;  3AO4 A;  4CFB A;  3PX4 A;  4ZTJ A;  3V4I A;  5I3U A;  1C0M A;  3QET A;  3ZT2 A;  1ASU A;  4KPY A;  2P51 A;  4FJN A;  2YNH A;  4DLG A;  5CZ1 A;  5HBM A;  4DSK A;  3M8Q A;  1C0U A;  1X9M A;  3HT3 A;  4J2E A;  1K6Y A;  1TGO A;  4E7I A;  3MXJ A;  3TWH A;  3ZSW A;  3IAY A;  4PQU A;  1C6V A;  1NJY A;  1T8E A;  4KTW A;  1RT1 A;  2XY5 A;  4F8R A;  1FXX A;  1U04 A;  2DFF A;  3SV4 A;  1QTM A;  3LP2 A;  4HCC A;  4M3X A;  2HHQ A;  3OS0 A;  1KLM A;  1F21 A;  1ZBU A;  1RBS A;  4ID1 A;  3ZSO A;  3M8P A;  1SUQ A;  1RTD A;  1SL1 A;  3SQ4 A;  2HHX A;  2XY8 A;  1ASW A;  1TV6 A;  5HRN A;  1NK0 A;  5E41 A;  1ITG A;  4DFJ A;  1IKW A;  4B08 A;  3TAB A;  1N6Q A;  1J5O A;  2PYL A;  3VA3 A;  2F8S A;  4HUF A;  2HVH A;  4CHO A;  3MXM A;  1S5J A;  2XY6 A;  4F3O A;  4DMN A;  1FKO A;  1VSK A;  1KLN A;  4DSE A;  1RT6 A;  4FJ8 A;  4KV8 A;  4LD0 A;  2FBX A;  4CF9 A;  1NKC A;  3H08 A;  5DK5 A;  3LWL A;  1VSL A;  1HRH A;  1VSJ A;  4AHU A;  4HVJ A;  3SUO A;  3PX0 A;  1EXQ A;  1JLC A;  3L3U A;  4JRQ A;  2YV0 X;  3VQ5 A;  1U49 A;  3C6U A;  2DFE A;  3OYB A;  4CJF A;  4GMJ B;  5HLF A;  1HQU A;  2VG7 A;  2YNG A;  1MU2 A;  2XRI A;  1Q9Y A;  2Y1J A;  1WSG A;  4BDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...