1J53A

Structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
174
structure length
174
Chain Sequence
RQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase III, epsilon chain
publication title Structural Basis for Proofreading during Replication of the Escherichia coli Chromosome
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 58
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1j53A00
3ZT0A 1HPZA 3HPOA 2IS3A 1WSIA 3SNNA 4CHYA 4HVJA 2IC3A 1RTJA 4KTZA 2FBYA 4FLVA 3AA3A 1S1TA 5JS2A 4CEQA 2F8TA 5CZ1A 1LV5A 4E7KA 3AA5X 3KD1E 2FBXA 2E6LA 4DTSA 1Q8IA 4JS5A 1B9FA 1KCFA 1RT1A 1S9GA 3RRGA 2GUIA 3MXJA 3SI6A 4DU1A 4CIEA 1XC9A 4J2DA 1XWLA 4ZTFA 4AHTA 1KFSA 3VQ4A 3ZT3A 1RTHA 3MEEA 1JLQA 3KK2A 4I2QA 1R0AA 4B9VA 2KFNA 1C6VA 4AH9A 2RKIA 2OYQA 3K5NA 2R7YA 4PA1A 2IDOA 3OYEA 3LDSA 1L3VA 4DSIA 2HNDA 5I42A 4C8OA 4B9TA 5JS1A 3OS0A 3C6UA 4Z4IA 3DOLA 1BI4A 1BHLA 1JKHA 2HHWA 4ICLA 4AHVA 3TAGA 1A5VA 1S6QA 1ZYQA 1JXEA 2G8HA 4DF4A 1C1CA 2X74A 3CM6A 1CZBA 3D45A 4Z4FA 4CF2A 2YKMA 3TANA 4CHPA 4FJMA 2HMIA 2O4IA 4L8RB 1IKVA 1WAJA 3LAMA 4O5BA 2BDPA 3F73A 1FKPA 2B5JA 4KB1A 3AVCA 1VSHA 4OKKA 2DY4A 2ETJA 4FJGA 3QEPA 1O1WA 3PO5A 4FJ8A 1BL3A 3NF9A 4CFAA 3SPZA 2HB5A 1T03A 4H4OA 2KZZA 1UA0A 1VSEA 4CJQA 4E89A 1N5YA 3SJJA 4CF8A 3IAYA 3NGIA 4C8NA 1XHZA 1TKXA 3KD5E 3NCIA 3NF7A 1S1WA 4KTQA 4CGIA 1ITGA 1HRHA 3OYIA 2DFEA 4W5NA 1LWEA 1EKEA 3KLEA 4CJVA 3T1AA 4CJ5A 5HRNA 4E3SA 3L3VA 2G8KA 3P5JA 3AO2A 2GV9A 1U4BA 1B9DA 2YNFA 3ULDA 3G10A 4OLBA 1HYVA 3PX6A 4IBNA 1HQEA 4XIUA 3CFOA 3ZSYA 2XY7A 4FJHA 1WSHA 4KTWA 1IKYA 4B9SA 5SWMA 4FK2A 3AO1A 1LW2A 3AVHA 1T05A 2G8UA 3AVJA 3DRRA 4DS5A 1VRTA 1WSGA 3SYZA 1I39A 3VA0A 4N76A 1QQCA 2KQ2A 3K5MA 4F3TA 4B3OA 1WNSA 2Z1IA 3NAEA 3K5OA 1TK8A 2FBVA 4EP5A 3DLKA 3OYDA 3OVNA 3VQAA 3AVBA 4CIFA 1DTQA 1J53A 1LWCA 3DLRA 3TI0A 4CK3A 1C1AA 1HQUA 1K6YA 4LSNA 4DQSA 1S9EA 3LPUA 3TWHA 2PYJA 4EZ9A 3HP6A 5KI6A 1EXQA 2D0AA 3H08A 3KIOA 4E7HA 3LPTA 1SL2A 4B08A 4HTUA 1XI1A 2YNGA 3S3OA 3O3HA 4LH5A 5T7BA 3AO5A 3NH2A 3LP0A 1RBVA 1RT6A 2YV0X 1RBSA 1U04A 4CJEA 4E1NA 1RBUA 4Q5VA 4HUFA 3QERA 4CJ4A 4DTUA 4C8LA 1SL1A 3HVTA 4DTPA 3MXIA 2G8FA 3UIQA 2P1JA 3O3FA 3HSTB 1VK0A 2HVIA 5K14A 4FJKA 2F8SA 3THVA 4FM2A 4B9LA 4F2RA 1RILA 3WNFA 1ZBLA 2X6NA 4HHTA 3QEIA 1QSSA 3SUPA 3QINA 4GVMA 3L8BA 3I0SA 3KLFA 1GOAA 3V81A 4ID5A 4RW9A 4B9UA 4DSKA 4NCBA 4FXDA 1IKWA 1QE1A 4M41A 2XRIA 3C95A 4CJTA 1U45A 4E19A 2OA8A 3OYAA 4Z4GA 4CJPA 2Z1HA 4KFBA 4KKOA 3ITHA 4E7IA 4CEOA 1BQNA 1NKEA 4E7JA 4DFJA 3VQ7A 1CXUA 3LAKA 4CGFA 3ZT2A 1WSFA 5SZTA 2X78A 4CJWA 4KHYA 1BI4B 3P1GA 3HM9A 4KHSA 3SQ1A 3LALA 3CQ8A 3SV3A 4KHQA 3SV4A 1Q9XA 4DTMA 1KFDA 3HL8A 3DMJA 3L2QA 4AHUA 4FM1A 1NOYA 3ZSXA 1GOCA 4CHQA 4KI4A 4M3ZA 4B9NA 4CERA 1JLFA 4ID1A 2B6AA 4M3WA 2G8WA 3KLIA 1RDAA 2DFHA 3DLHA 1HMVA 3JYTA 1X9MA 1NK0A 1RCHA 2PY5A 1J5OA 1WSEA 3L2RA 3NGYA 1D9FA 2OPPA 4CFCA 3VQCA 3VQ5A 3KLHA 4DSLA 3O4QA 3K2PA 1HNVA 1TGOA 3AVMA 3ZSOA 4DTXA 1NKCA 4W5TA 4Z4EA 2KTQA 4FLXA 3CFRA 4LSLA 1C0MA 3HPHA 4DSFA 1UOCA 4HUGA 4H8KA 5HBMA 4PY5A 1DTTA 4FW2A 1W9HA 3G0ZA 5J1EA 3M8SA 2Y1JA 1Z25A 3NH0A 4YFUA 5CYMA 3OYNA 1IG9A 4FJJA 4EP4A 3MECA 5HLFA 2GBZA 4K8XA 1EP4A 4IDKA 2XY8A 5FDLA 4CHZA 4CF9A 4Y1CA 1VSDA 1VSMA 1C0TA 4CEEA 4FJXA 1KVAA 4O0JA 3ZSRA 1RTDA 1S1VA 3DRPA 2OZMA 1RBRA 4BDPA 1TAQA 1ZBFA 1YVUA 4HCCA 2VWKA 2YNIA 4Z0UA 3QEWA 1SUQA 4M3TA 4LH4A 3L3UA 1CXQA 3O3GA 3V6DA 2VG7A 3CM5A 4DU3A 2HHSA 3LZIA 4KO0A 3DM2A 2QXFA 4ELTA 3AVNA 1J54A 4CHOA 4CEFA 2A1RA 4CEBA 1VRUA 2A1SA 5FROA 4IFYA 1NK5A 1LAWA 4KAZA 4UQGA 1S1XA 4I9QA 3EZ5A 1LW0A 1NJYA 5D3GA 4KHNA 2HNZA 2P5GA 4E1MA 1U47A 1C0UA 1JL2A 4HUEA 3S3MA 1RT3A 1N6QA 3ZT4A 1KTQA 1RNHA 5E41A 4CFDA 4FLYA 1NK4A 3RMBA 4JS4A 3KKSA 5J2NA 4OLAA 3TAFA 4CCHA 2YHBA 4GW6A 3KK3A 5J2PA 3EY1A 4IKFA 4CGGA 5FRMA 4DQQA 2QKKA 4K8ZA 4DG1A 1MU2A 1U48A 3CYMA 2D5RA 4M3YA 4CFBA 3V9XA 5KGXA 3TARA 3PV8A 4BWJA 2ATQA 1F21A 3VQPA 4CJUA 3T3FA 1KRPA 4JLHA 1HNIA 4AHRA 4OJRA 3TAPA 5HRPA 1Y97A 1QHTA 3EYZA 3AO4A 3HP9A 3ISNC 2G8VA 4M3RA 2RF2A 3DLGA 1LWFA 3DLEA 2OZSA 3HK2A 1RTIA 3AVFA 3E01A 3PUFA 1RDDA 4N41A 4ELUA 3OYFA 4G1QA 2D0BA 4C8MA 3OS1A 4FLZA 3V9SA 1YTUA 2HHVA 4CJ3A 5HRRA 3AVLA 2D0CA 2ZQBA 3AVAA 1ASVA 3F9KA 3AA2A 1WN7A 1SKRA 3C94A 3V9WA 3NH1A 3PY8A 3OYJA 2FBTA 5J2QA 3HT3A 4KREA 3QIPA 1D9DA 1BIUA 4DFMA 2O4GA 4KPYA 3RMCA 4F8RA 2VG6A 4O44A 1RDCA 4EZ6A 4R5PA 1X1PA 1JL1A 4FCYA 5KGWA 4W5QA 4DS4A 4O4GA 1JLGA 4OVLA 4CGHA 4B9MA 2XY5A 4DWIA 3LWMA 1UAXA 4BE1A 3SPYA 2VG5A 1NKBA 2E4LA 1NJXA 1L5UA 4FZYA 5C25A 1BCOA 3PX4A 1NJWA 1A5XA 1IH7A 4CEAA 3HVRA 3QNNA 1TKZA 5CY4A 3L2VA 1W0HA 1SV5A 4ELVA 1RBTA 2DFFA 3K5LA 3KKRA 3ZSVA 4M45A 4RW4A 1WAFA 3BGRA 3NF8A 4FK0A 1UA1A 4KI6A 3HO1A 2AJQA 2IAJA 3LP3A 3V9ZA 4HCBA 3RTVA 1U49A 1QSLA 3RR8A 1REVA 1ASWA 2HHTA 2P51A 3NF6A 2HVHA 4J2BA 2B4JA 4F4KA 1TAUA 4F3OA 1QTMA 3LP1A 1TK0A 2RPIA 4J2EA 2FC0A 3O4NA 3VQ9A 3BDPA 3KTQA 3HXMA 4NYFA 4CEZA 4DLGA 4Q0BA 4FZZA 4AHSA 1TL1A 3QEXA 2Z1GA 4DSEA 3MXMA 4FJ7A 1YT3A 3L2UA 2YKNA 4CE9A 4CECA 3QEVA 3SQ4A 4CJFA 2Q3SA 5HRSA 3MEDA 3OYKA 3SQ0A 1XHXA 4AHCA 2KFZA 3K57A 3OJSA 4FJ5A 3LWLA 2BE2A 3V9UA 1BGXT 4PQUA 3DI6A 3K58A 3OYLA 1IO2A 4DF8A 4FK4A 3CG7A 4AILC 2Z1JA 3B6PA 5CZ2A 3IRXA 1T8EA 1RT5A 4DTRA 1NK9A 4KHWA 2BGGA 4W5RA 3JSMA 3RMAA 1FXXA 3LZJA 3I0RA 5CYQA 3RWUA 4CGDA 4OPKA 4FVMA 4KV8A 3TR8A 2QKBA 1S6PA 2DTUA 1ASUA 1EX4A 1RDBA 1JLEA 3MAQA 4KRFA 4CF1A 3RMDA 4QOZB 4CK1A 1VSKA 4ZTJA 4FYDA 3SUOA 2YHAA 1D8YA 1SKSA 3VQDA 2XHBA 3I8DA 4FJ9A 3C6TA 4BWMA 3VQEA 3QESA 2JLEA 1TK5A 3CFPA 1A5WA 1RT7A 3NHGA 4LD0A 3D0PA 2YNHA 5KTQA 3OY9A 4BDYA 4DTOA 3WNGA 1VSLA 4I2PA 4CJLA 2PYLA 4N56A 4DQRA 1TV6A 4NCGA 1HYZA 1Z26A 4BE2A 3TAQA 4DTNA 3OS2A 3OYHA 1FKOA 2E6MA 2HHUA 3S3NA 3NE6A 4Z4CA 3SCXA 4M3XA 1JLCA 4ZHRA 5DK5A 4FLTA 4DU4A 4C8KA 3NDKA 1T7PA 3SZ2A 4DSJA 3WNEA 1L3SA 4CJSA 1KVBA 3NFAA 4JRPA 5I3UA 1X9SA 1Q9YA 4DQPA 4CJKA 1CZ9A 3M8RA 1SKWA 4CHNA 2EHGA 3TAMA 4H4MA 1ZBUA 3KLGA 4FM0A 4M3UA 4FZXC 4NCAA 3S9HA 2EX3A 1NOZA 3AO3A 3HYFA 4OKEA 1YTAA 4Z4HA 4TSXA 4QCLA 1GOBA 2OPSA 3RR7A 1LAVA 3LANA 2HHQA 4NYNA 5EU7A 3PX0A 3RRHA 2X6SA 4DQIA 1WLJA 3DLBA 3KK1A 3QETA 5KRSA 4GMJB 4RW6A 3ZSZA 1NK6A 1CLQA 1HYSA 2QK9A 4RG8A 4DFKA 4B8CA 3QNOA 3IS9A 3QO9A 3QLHA 5FRNA 3DOKA 1I3AA 4WE1A 3TAEA 4KB0A 4IG3A 4M42A 4N47A 4CK2A 2IOCA 2F96A 4OGEA 4FJIA 3SQ2A 4KHUA 4O0IA 1KLMA 1BISA 3AVGA 2HNYA 2LSNA 4YNQA 1VSFA 4E7LA 4CF0A 1IKXA 3V1RA 3VQBA 4CGJA 3VA3A 4MQ3A 4B8AB 3K59A 3VQ8A 3ZT1A 4BE0A 4DFPA 4FJNA 2VWJA 4IFVA 3P83D 5C24A 3VN5A 3AVIA 2JGUA 3ZCMA 1L3UA 1BCMA 1RT2A 2I5JA 5DMRA 4DTJA 2KZMA 1X9WA 1KLNA 4FLUA 1VSJA 2HW3A 1C1BA 2OPQA 5J2MA 2XY6A 4BACA 2P5OA 3VQ6A 1FK9A 3OYCA 4CIGA 4Y1DA 4PWDA 1VSIA 1BIZA 3AVKA 3HJFA 3NGZA 4I9LA 3DYAA 1QS4A 3VQQA 1EETA 1B92A 3QIOA 4FLWA 4MFBA 4LY7A 4JRQA 3ASMA 1SL0A 4BDZA 3V1QA 3AV9A 3OJUA 1L3TA 3TABA 4OGCA 1QSYA 1KVCA 3IG1A 1UWBA 4OKJA 2PZSA 4E0DA 3L2WA 3OYBA 4FW1A 4QAGA 3U6FA 3SUNA 3V1OA 1DLOA 2NUBA 4O55A 1JXBA 3LP2A 4CESA 3HPGA 3OYMA 2G8IA 2HHXA 1S5JA 2RN2A 4OPJA 2BANA 2KW4A 1ZBHA 2IGIA 1NK7A 3U3YA 1NJZA 4W5OA 2ZE2A 4DLEA 2Y1IA 2WOMA 4PUOA 3B6OA 5C42A 5KRTA 5HP1A 4IG0A 4RW7A 3U3GA 3ZSWA 4F2SA 2ITGA 3NBPA 3DRSA 2XO7A 1WSJA 2WONA 1TL3A 3ALYA 3MEGA 3M8PA 4CJRA 5HROA 3WNHA 1NK8A 1JLAA 4FJLA 1G15A 1KSPA 1TKTA 1RT4A 4DMNA 3V4IA 3AA4A 3ZSQA 3KJVA 3OYGA 3T19A 3PO4A 4RW8A 1JLBA 1J9AA 1HJRA 4I7FA 4J2AA 2W42A 1ZBIA 3M8QA 1TKDA 1D5AA 4CEDA 3SUQA 1S1UA 3A2FA 4N5SA 1BQMA 3FFIA 2OPRA 1TVRA 2ZD1A
chains in the Genus database with same CATH superfamily
2D0OA 4MLHA 3HPOA 4BRGA 3SNNA 3CCVN 4H5NA 1RDUA 1QVFM 2F8TA 5LMNK 4BG9A 1GLCG 2FBXA 3BZKA 4DTSA 5FPNA 1Q8IA 3IMXA 1RT1A 1S9GA 2GUIA 3MXJA 3SI6A 1KFSA 4JKFA 3VQ4A 4M63C 2UXDK 1BOTO 3CCMN 2KFNA 2RKIA 2OYQA 3D7EO 2YHXA 4BGAA 3LDSA 4GY2B 5I42A 3OS0A 4Z4IA 5GIOA 4FPAA 3BY5A 3GL1A 3CM6A 3D45A 3N4QA 4Z4FA 3TANA 2CH5A 2HMIA 4L8RB 1OH5A 1WAJA 2DY4A 4KB1A 3AVCA 3G4SN 4LC9B 1O1WA 1BL3A 1Y64A 2NRHA 3BF3A 4HWIA 2H3GX 3HZ6A 5KPTA 4H0OA 3EKUA 1ITGA 3VEOA 3QDKA 3OYIA 3NMUA 2DFEA 3UE5A 4PHTX 4E3SA 2Q2RA 3CQYA 2G8KA 1B9DA 2P9SA 4FWPA 3PX6A 3CFOA 4KTWA 2GELA 3LL3A 3RVCA 1LW2A 1BA1A 2E2NA 5C0YA 3I33A 1QQCA 3K5MA 4H5WA 4F3TA 3K5OA 2E5LK 2FBVA 4EP5A 4CIFA 3EZWA 1J53A 1LWCA 3TI0A 3CCRN 1HQUA 3VEXA 1S9EA 3WXMB 3VESA 5KI6A 1MA9B 1SL2A 2YNGA 3MDQA 4R79A 4EIAA 4KBOA 1RT6A 1RBSA 3MN5A 4WYBA 4CJ4A 3PSIA 5E84A 4DTPA 3MXIA 3UIQA 3U9DA 3O9SA 4FJKA 4F2RA 4LFAK 5F2RA 1EWQA 1JJ2M 1JCFA 2X6NA 3QEIA 3L8BA 5AQOA 4RW9A 5FPMA 3V81A 2QXLA 5AZJB 3C95A 4FWSA 1U45A 2YCHA 4IXCA 2HSTA 4U67L 4YHHK 4CJPA 1VQ9N 4KFBA 1P8ZA 4CEOA 1BQNA 3I55N 4CZMA 3P38A 4XEIA 1EWRA 1WSFA 3A5LC 4DUZK 3E9PA 4JEPA 4KHSA 3SQ1A 3SV3A 1O13A 3SV4A 3L2QA 1S72N 3A5MC 3ZSXA 4KI4A 5C2DA 1SQKA 3A0IX 4M3WA 4WFAL 1Q82O 2DFHA 3DLHA 3UKUB 4LF5K 5AQLA 3ZX3A 3K0SA 4DSLA 3AVMA 1TGOA 4Z4EA 4FLXA 2A40A 4DSFA 4HUGA 3CF5L 4PY5A 3B8AX 4FYDA 5J1EA 5CYMA 2IIRA 2GBZA 4IDKA 4CZIA 1YJ9N 1W97L 3UKRB 1C0TA 4YDUA 1I94K 2QWOA 1NU0A 4BDPA 1ZBFA 5JVHL 1SUQA 4LH4A 3V6DA 2VG7A 3ENBA 4DU3A 3LZIA 2KKZA 2W40A 3DM2A 4FWRA 2J4RA 2A1RA 4IFYA 1LAWA 2JWKA 3EZ5A 1NJYA 4RTFD 2P5GA 3HBTA 4JV5K 1U47A 3CJAA 3EL2A 4FLYA 1NK4A 3VTIA 3KKSA 4DKWA 4GW6A 4IKFA 4JKGA 4CGGA 4DQQA 4K8ZA 4DG1A 1MU2A 2WBNA 1U48A 1DGKN 3CYMA 2D5RA 4FVUA 1YJNN 4BWJA 5M1FA 3KZBA 4CJ7A 1KRPA 1F21A 4BRFA 3T3FA 1QQMA 3R6MA 3ISNC 1IG8A 3NVMA 3G25A 1RTIA 3AVFA 4XH5A 4AM7A 5KPZA 4N41A 3OS1A 2D0BA 3V9SA 2P9UA 4JD2B 2QTDA 4JKHA 2ZQBA 1ASVA 3F9KA 1WN7A 4CVNE 1V4SA 3PY8A 3OYJA 5BRDA 4NB4A 3CC7N 4ILJA 3O1WA 1D9DA 3L6QA 1BIUA 1YUWA 2A5XA 3UB5A 4F8RA 4EZ6A 5KGWA 1K8KB 4JI4K 3QBWA 3LWMA 1NKBA 3FE1A 3IKMA 1NJWA 1WBBA 3CXCM 2ZGYA 4NLBA 5CY4A 1SV5A 2QWNA 3K5LA 3ZSVA 4M45A 5AQJA 3AAQA 5EVZA 1UA1A 2NRXA 3HO1A 4HCBA 4BRPA 1ASWA 3NVKA 3NF6A 2HHTA 4J2BA 1Q81O 1YITN 4NO7A 2FC0A 3O4NA 4Q0BA 4NYFA 4EFHA 3QEXA 3L4QA 4B1UB 1YT3A 2O8FB 4CJFA 1N34K 1HLUA 3TSUA 3OJSA 4FJ5A 5EXWA 4PQUA 3VTHA 4OPAA 3MMVA 4FK4A 3ZX2A 4DV7K 4LFBK 3IRXA 1IBKK 1FXXA 5CYQA 3RWUA 4CGDA 4OPKA 3TR8A 5AQKA 4CF1A 2NRZA 4L3QA 1D8YA 1HPMA 4FJ9A 3F2KA 1JCGA 3FZLA 3VQEA 4DTOA 3OY9A 3IUCA 3BUZB 2HHUA 3NE6A 3VMFB 4DU4A 2JWLA 1T7PA 1VQ8N 2O8DA 3WNEA 3BEXA 5I3UA 1X9SA 3THYA 3M8RA 4FM0A 3ID6A 2EX3A 3J81O 3AO3A 4TSXA 4GKJK 5ADXH 1NNEA 3LANA 2YJEA 2P9KA 3PX0A 3RRHA 5BPMA 4IEEA 5KRSA 1BWFO 4GMJB 3ZSZA 3K9KA 2FXUA 1HYSA 4FO0A 4RG8A 3DOKA 4KB0A 1OVYA 3D2FB 3O9UA 1KLMA 1S3XA 3JXUA 4BRLA 3VPZA 2QWMA 4DHYA 2O8BB 3ZT1A 2V7YA 4IFVA 1NG9A 2P9NB 3VEYA 4I6MB 3J8AA 2UXCK 2QI2A 3AVKA 3NGZA 3DYAA 3CI5A 3QIOA 3TTDA 1J5EK 2QWRA 4LY7A 4DV2K 4GV3A 3DAWA 2A42A 1Z6RA 3AV9A 3OJUA 3TABA 3CMAN 3IG1A 1UWBA 3L4IA 3Q7BA 1M1KO 4FW1A 4M7XA 4DR1K 3SUNA 1OH6A 3KHYA 4WFNL 3FZKA 3OYMA 3HPGA 5C10A 4A62A 2IGIA 3SK3A 3E1YA 3QBXA 4CI6A 2UXBK 4JKBA 3VGMA 4MO4A 4PUOA 5C42A 4A2AA 3U3GA 2GWKA 4F2SA 2QWPA 1SS6A 3DRSA 2XO7A 1TL3A 3WNHA 1G15A 2GX9A 3CCLN 5AR0A 4DR3K 3KJVA 1NGFA 3TTCA 5AQQA 4JHDB 2W42A 4K0KK 5JMVA 1D5AA 5F0XA 1WBDA 1S1UA 3A2FA 3FFIA 1KC8O 1IBLK 2UU9K 3ZT0A 1HPZA 4IJAA 2IS3A 3FZFA 2E1ZA 2CGLA 1FW6A 4KTZA 5JS2A 4YORA 5AQUA 4CEQA 3OA9A 4LF4K 3N4PA 5CZ1A 1LV5A 4BRMA 1V4TA 4E7KA 3KD1E 5AJ3K 2E6LA 1KCFA 4JI1K 3T1HK 4ZTFA 4XH1A 4AHTA 1RTHA 3MEEA 1JLQA 4I2QA 3THWA 4G9ZA 3K5NA 2R7YA 1L3VA 4BRCA 2HNDA 4C8OA 4B9TA 5JS1A 4ISFA 1BI4A 1U2VB 1JKHA 5JLFA 4DR2K 1A5VA 1ZYQA 2G8HA 1JXEA 2X74A 4LF8K 4CF2A 3LM2A 4FJMA 1ATRA 1IKVA 4O5BA 2BDPA 2QEXN 1FKPA 2B5JA 4BGBA 1HJOA 2EWSA 2ETJA 4FJGA 4QS9A 3QEPA 3EEQA 3PO5A 4FJ8A 4H4OA 1VSEA 5AZIB 4CJQA 4E89A 3G6EN 1N5YA 2P9IB 3IAYA 3R9PA 1GLBG 3LDNA 2QWQA 1HRHA 3THXA 3WXKA 1LWEA 3KLEA 4CJ5A 4JI7K 3HOTA 3L3VA 3AO2A 2YNFA 3SJHA 2NNWA 1HQEA 1T6CA 1VQ6N 4XIUA 4FJHA 2KLAA 5SWMA 3AVHA 4B9QA 2WFBA 3DRRA 1WSGA 3PSFA 4OPHA 3VA0A 2CH6A 2HBLA 1WNSA 1KQSM 2Z1IA 3NAEA 3OVNA 3VQAA 1P90A 1Q7YO 1K6YA 3M3ZA 3LPUA 3TWHA 4DR5K 4EZ9A 3HP6A 1OH7A 3E9OA 3GG4A 3KIOA 4IZ9A 5M1PA 3I8BA 4J8FA 1RDWX 3S3OA 1G99A 1RBVA 4CJEA 1U04A 1RBUA 4DTUA 1SL1A 2G8FA 3HSTB 5K14A 3DXKA 3H1VX 2E20A 4K43A 3VGLA 2YHYA 4YOYA 3I0SA 3KLFA 4DSKA 4JI6K 1H1VA 4M41A 4CJTA 1OKJA 4E19A 4YY3K 1YF5L 4Y0WA 2Z1HA 3ITHA 3P4IA 2A41A 4FOIA 4DFJA 1VQKN 1CXUA 3LAKA 2X78A 4CJWA 4FWKA 3WT0A 1NBWA 3AAPA 2UUCK 3DMJA 4CZJA 3ATUA 4AHUA 4FM1A 1NOYA 4C1NK 5AQPA 3A5OC 1JLFA 5BN8A 3W0LA 5AQZA 2PY5A 1RCHA 1J5OA 5IT9O 4U7BA 2VYPA 4CFCA 3VQCA 4B1WB 4DV3K 1HNVA 4DTXA 3ZETA 2KTQA 3CFRA 1C0MA 4H8KA 1M90O 5HBMA 4FW2A 2Y1JA 1VQPN 3NH0A 3OYNA 4OO1J 4K8XA 2AA4A 1EP4A 5FDLA 4BRHA 4CHZA 1IV0A 4CF9A 1VQMN 1VSMA 4CEEA 4FJXA 4WQ4C 1RTDA 3PLAA 3DRPA 4BRNA 5DM7L 1YJWN 4HCCA 4Z0UA 4M3TA 2HHSA 3L3UA 3O3GA 4K25A 5TKYA 4CD3A 4CHOA 4CEFA 3O9QA 3KWIA 2GUPA 2HNZA 1MWMA 4E1MA 3S3MA 4H0VB 3FLCO 1KTQA 3IFRA 3RMBA 4X65K 4JS4A 3DJCA 3KK3A 5C2FA 3EY1A 5FRMA 3MN6A 1HKBA 4M3YA 4CFBA 5KGXA 3PV8A 1OVQA 2ATQA 1BG3A 1X3NA 2D4WA 4JLHA 4H0TB 1HNIA 1Y97A 1NGIA 5BPLA 3EYZA 3AO4A 3HP9A 2G8VA 4M3RA 3HK2A 1U6ZA 3DXMB 3PUFA 3WXLA 3VEZA 1OH8A 4FLZA 1GLFO 1YTUA 2HHVA 4FWNA 1ILYA 3AVLA 4BQZA 2D0CA 3MN7A 3NH1A 3CCEN 1GLJO 4KREA 3T1YK 4KPYA 3RMCA 4DB3A 3Q7CA 2VG6A 4JAXA 5C15A 4LFCK 1JLGA 3LDLA 4OVLA 2XY5A 3SPYA 3F5TA 2E4LA 3FGUA 1BCOA 5C25A 5A2QO 3QNNA 1TKZA 3U9ZA 1RBTA 3CC4N 2DFFA 3KKRA 3J80O 4EHUA 1WAFA 5AQMA 2AJQA 2IAJA 3LP3A 2PFUA 3RTVA 3RR8A 1REVA 5KPRA 2B4JA 4JKAA 1X3MA 2ZJRL 3VQ9A 5M1NA 4DLGA 3P31A 3MCPA 5CE3A 1TL1A 2Z1GA 4DSEA 4FJ7A 3C7NB 2A6AA 2P9PB 2YKNA 3SQ4A 2OANA 4CD1A 2Q3SA 3OYKA 3SQ0A 5KQDA 3LWLA 2BE2A 1QVGM 1HNXK 3K58A 2Z1JA 3B6PA 3O4WA 4KHWA 4FVMA 4AF1A 2QKBA 4M7YA 1ASUA 1RDBA 1JLEA 3MAQA 4CK1A 2OTJN 2UUBK 4KH4A 3VQDA 2NZTA 3WEEA 3H3OB 3OHRA 5AQXA 1K73O 3C6TA 1MWKA 5AZJA 1TK5A 3CFPA 4LD0A 2YNHA 4A57A 3WNGA 4DQRA 3CMEN 4DTNA 4FWMA 4NXMK 4JI2K 2E6MA 3CPWM 3LDQA 4Z4CA 3SCXA 4M3XA 3BF1A 5DK5A 3NDKA 4GKKK 4DSJA 3NFAA 5KQ8A 3OBYA 4DQPA 2GTDA 1NGJA 4LF6K 3TAMA 1ZBUA 3DWLA 5E26A 4M3UA 4FOEA 2E2PA 3HYFA 4OKEA 4Z4HA 1GOBA 4YOUA 5EU7A 3UKUA 3O5BA 2X6SA 4DQIA 4MDBA 3DLBA 4H0YB 4B3TK 4RW6A 1XMOK 3CCUN 3QNOA 3QO9A 4BC5A 4B1YB 5FRNA 4WE1A 1S22A 3HM8A 3O08A 4IG3A 3ZLJA 1YIJN 1K9MO 2IOCA 4KHUA 2HNYA 4E7LA 3V1RA 3VQBA 3VA3A 3UKRA 4RWTA 4B8AB 2IVOA 5JLHA 1BCMA 1RT2A 2I5JA 4DTJA 1KLNA 4FLUA 5EY4A 4BACA 3VQ6A 4CIGA 4PWDA 1BIZA 4I9LA 1EETA 1B92A 4H5VA 4FLWA 4JK7A 3ZYYX 2IVPA 1L3TA 1KVCA 4OKJA 2PZSA 3L2WA 4QAGA 3U6FA 3C6HA 1E4GT 3LP2A 4CESA 1KAYA 1XUPO 3SAFA 2BANA 1NK7A 3O6WA 1BUPA 4BR2A 1QQNA 4YOTA 2Y1IA 1JCEA 2WOMA 5GAEP 4RW7A 2W6KA 3RSEB 1KD1O 3TSQA 1HUXA 3QMLA 2WONA 4CJRA 3M8PA 1KSPA 5CR4A 4JD2A 4DMNA 2HHHK 3V4IA 1XQSC 1WB9A 3ZEUB 3ZSQA 3T19A 1J9AA 4I7FA 1BO5O 4WFBL 4GVEA 4CEDA 3M1FA 2HBMA 1YAGA 3V1OA 2D1KA 3TTFA 5FLXO 4KHPK 1NWKA 1K8KA 1WSIA 4CHYA 4HVJA 1RTJA 2FBYA 5BRHA 3SAGA 1B9FA 4K41A 4EAHD 4IJNA 4DU1A 4CIEA 4J2DA 1XWLA 4MDAA 1YXQA 2FSJA 3ZT3A 2V7ZA 3WUHA 1R0AA 4B9VA 2NRTA 4JYAK 4JK8A 4KH5A 3GOIA 2Q97A 3C6UA 2HHWA 4ICLA 3TAGA 5AQYA 4DF4A 2O8FA 2O4IA 4V19S 3E66A 4OKKA 3CPEA 3C6AA 5LMUK 3SPZA 1T03A 2KZZA 2NLXA 3EE9A 4C8NA 1IBMK 5I9EB 3NF7A 1S1WA 4CGIA 5BREA 3J7YP 2WTUA 4W5NA 3T1AA 3MWPA 5H1SQ 1QZ5A 3K9JA 3EKSA 1HYVA 5M1KA 4IBNA 4H03B 3E9LA 3H1QA 1W7AA 1T3VA 2XY7A 1WSHA 5AQFA 1IKYA 2Q1NA 4PL7A 3AO1A 3WQUA 1T05A 2G8UA 5HOOA 1HNZK 4DS5A 1MDUB 1I39A 4IFEA 2KQ2A 4LF7K 3M6GA 4B3SK 2A3ZA 1TK8A 3OYDA 3AVBA 1GLAG 1DTQA 1HR0K 3DLRA 4CK3A 1C1AA 4LSNA 4DQSA 2PYJA 3WXIA 3H08A 3LPTA 1ATSA 4HTUA 3O3HA 1VQON 4LH5A 4BR4A 3AO5A 1NGBA 3NH2A 3LP0A 2YV0X 1TK0A 4Q5VA 2OZSA 3QERA 4C8LA 4BC3A 4B1XB 3HVTA 1YHQN 2P1JA 4C1NI 4FM2A 4B9LA 1RILA 3D2FA 1ZBLA 2FF3B 1QSSA 4FXDA 4ID5A 4B9UA 3D2EB 1IKWA 2O8CB 4IEIA 2O8BA 2P9LB 2V52B 2OA8A 3ZX0A 4JKDA 2P9NA 4IOCL 4YDUC 4BR7A 4E7IA 4A5BA 1NKEA 4I6MA 4E7JA 2OTLN 4DR6K 4CGFA 3JAMO 5AQTA 1BI4B 3CIPA 3P1GA 3LALA 1Q9XA 2O8EB 2PBDA 4H0PA 4M3ZA 3O1BA 4ID1A 2B6AA 3U8XA 3TPQA 3JYTA 1WSEA 3EE8A 3NGYA 3P39A 3KLHA 3O4QA 4BREA 4JNEA 4LSLA 3HPHA 4DV5K 1UOCA 2W41A 1XMQK 4DR7K 1W9HA 3C65A 4FJJA 1IG9A 4EP4A 3MECA 3QB0A 3LDPA 5F1XA 1KVAA 3ZSRA 3MX5A 1NMNA 3IDHA 5GAHP 2CGJA 1TAQA 2RHKA 1YVUA 2YNIA 3QEWA 1CXQA 4AQYK 4WQ5C 2QXFA 3AVNA 2WC9A 1J54A 4CEBA 5FROA 1NK5A 1NMDA 4I9QA 1LW0A 4KHNA 1TYQA 4HUEA 1JL2A 1RFQA 3G71N 4B3RK 3AGRA 2YJFA 1RNHA 2HBJA 1GLDG 4CFDA 5J2NA 4OLAA 4DQ8A 4CCHA 4DV1K 2QKKA 3V9XA 2HF3A 4IDHA 4Z94A 3VQPA 4CJUA 1J6ZA 4OJRA 1NGGA 3DXKB 2RF2A 1U2VA 1BU6O 2E88A 3E01A 4ELUA 4BQLA 3OYFA 4XH4A 5HRRA 4DV0K 1SKRA 3AA2A 3C94A 3V9WA 1DT9A 5BR8K 5J2QA 2KHOA 2O4GA 5AZIA 3F9MA 2P9IA 4O44A 2VQEK 4K42A 5GADP 1X1PA 4CBUA 4R5PA 3CCQN 4FCYA 4DS4A 2RE2A 3KWGA 1UAXA 4BRIA 4BE1A 3FFKB 5M1OA 1N33K 2VG5A 3AARA 3CD6N 5JVGL 1L5UA 4FZYA 1DKGD 1NGAA 3PX4A 4IWVA 1A5XA 1IH7A 4CEAA 3HVRA 3L2VA 3MX2A 2Q36A 3W3DA 5B8HA 2QWLA 3NF8A 3FZMA 1QHAA 1U49A 1QSLA 2W6LA 4IO9L 2HVHA 5M1QA 1TAUA 3ULEA 4F3OA 1YVNA 3AY9A 1QTMA 3LP1A 2RPIA 3KTQA 3HXMA 2VWBA 4FZZA 2QA4N 3VGKA 3R8EA 2HMPA 3L2UA 4CE9A 4CECA 3VERA 2ZJPL 3J7ZO 1XHXA 2KFZA 3OW2M 4LF9K 3K57A 1BGXT 2IVNA 3SBTA 4F9OA 3OYLA 5AQRA 3VETA 4OX9K 1NK9A 2E2OA 1BDGA 3OBWA 3JSMA 4FL9A 4KV8A 1VSKA 3SUOA 2YHAA 2YX6A 2XHBA 3I8DA 1DEJA 4BWMA 2JLEA 1A5WA 2P9SB 3NHGA 5AQIA 3D0PA 5KTQA 4BDYA 4GV9A 1WUAA 1TV6A 4NCGA 1Z26A 2UYTA 3TAQA 4A5AA 3S3NA 3HRGA 5AQWA 1JLCA 4FLTA 5AQHA 3MK6A 1HKCA 1L3SA 1Q9YA 4JRPA 2QM1A 2EHGA 4H4MA 3OTOK 4FZXC 4QCLA 1YTAA 1Z05A 2UUAK 2OPSA 3RR7A 1LAVA 3SMPA 3MWTA 4NYNA 4BR0A 2F7TA 3KK1A 3QETA 1CLQA 1NK6A 2QK9A 3LDOA 4B8CA 5CHIA 4DFKA 1VQLN 3VF6A 1I3AA 3TAEA 1T44A 3KVGA 4MLEA 4JI0K 4N47A 4OGEA 4FJIA 4IO8A 5AFUH 4O0IA 1BISA 3AVGA 3CJ1A 4YNQA 1VSFA 4CF0A 4CGJA 2VQFK 4MQ3A 3K59A 1XNRK 4BE0A 4FJNA 2VWJA 4JKEA 3AVIA 2JGUA 3ZCMA 1L3UA 5DMRA 2KZMA 1EO1A 4FSVA 2HW3A 1FK9A 1VSIA 4NLCA 3HJFA 4GNIA 2WUSA 5EX5A 4BR5A 1VAZA 3H45C 3ASMA 4BDZA 4OGCA 1QSYA 4BR9A 1X9JA 5LJWA 3VENA 2BH1A 2NUBA 1JXBA 2ITMA 4CZEA 2RN2A 3CQXA 2KW4A 3U3YA 3R1XA 4ISGA 1NJZA 4W5OA 2ZE2A 5IWAK 3B6OA 5HP1A 5AQGA 2GEMA 4IG0A 3T7ZA 3DXMA 1WSJA 4FJLA 3WEEB 4DV6K 1NK8A 1JLAA 4KH6A 1TKTA 1RT4A 2VGMA 4PKIA 1SZ2A 5AQVA 4YOVA 4RW8A 1JLBA 3M8QA 4BRAA 1TKDA 5JICA 3SUQA 2E1YA 1FJGK 4N5SA 1BQMA 2OPRA 3CCJN 1TVRA 2ZD1A 3PIPL 4GV6A 3GBTA 2CGKA 1TUUA 1QQOA 2I7NA 2IC3A 4FLVA 3AA3A 1S1TA 5AQNA 3HTVA 5LJVA 4CBWA 3AA5X 3ATVA 4JS5A 3RRGA 1GLEG 4JKGB 1XC9A 4EHTA 3KK2A 2F4VK 1C6VA 4AH9A 4PA1A 3M5RA 2IDOA 3OYEA 4BG8A 4DSIA 1XC3A 4HTLA 3DOLA 1BHLA 4AHVA 4C23A 1S6QA 3C7NA 2P9PA 1C1CA 4QS8A 1CZBA 2P9UB 1YI2N 2YKMA 1IJJA 4CHPA 1E3MA 4NXNK 3LAMA 4IOXA 3BP8A 3VOVA 5ADXA 3F73A 5C12A 1VSHA 3NF9A 4CFAA 2HB5A 3TU5A 4DCHA 1UA0A 3SJJA 4CF8A 4A61A 3NGIA 1XHZA 1TKXA 2YI1A 3NCIA 3KD5E 1E4FT 4KTQA 3HOSA 3DLLL 1EKEA 4CJVA 5HRNA 3P5JA 2GV9A 1U4BA 3ULDA 3G10A 4OLBA 4X64K 1ATNA 3ZSYA 1NGHA 1VQ5N 1NGDA 4B9SA 1RGIA 4FK2A 2ASPA 1SAZA 3AVJA 1VRTA 3SYZA 1WOQA 1XNQK 3J7AP 4N76A 4B3OA 4H5TA 4JI8K 4UY8O 4JKCA 3DLKA 4PKHA 2HF4A 1Q18A 3O9RA 1EQYA 1VQNN 1ZXOA 1EXQA 1LOTB 2D0AA 4E7HA 3GE1A 2HOEA 1LCUA 4B08A 1XI1A 4WQ5A 5T7BA 4E1NA 4HUFA 4E1JA 3SAHA 3O3FA 1VK0A 2F9TA 2HVIA 2F8SA 3THVA 2FSKA 3WNFA 5MLCQ 3C0BA 4HHTA 3SUPA 3QINA 4GVMA 1GOAA 4NCBA 4O8UA 1QE1A 2ASOA 2XRIA 3A8YA 3OYAA 3O8MA 4Z4GA 4KKOA 4B1VA 1VQ7N 4BVOA 1QZ6A 2BTFA 3VQ7A 3ZT2A 5SZTA 2HBKA 4CBXA 3FZHA 2NRVA 4KHYA 5GAGP 3HM9A 2O8DB 3CQ8A 4KHQA 3THYB 4DTMA 1KFDA 3HL8A 4CHQA 1GOCA 4PKGA 4B9NA 4CERA 1ZBSA 2G8WA 3KLIA 1RDAA 2P9KB 3PIOL 1HMVA 1NK0A 1X9MA 2ZJQL 3L2RA 4BRKA 1D9FA 2OPPA 4CZLA 3VQ5A 1C0GA 3K2PA 1NKCA 4BC4A 3ZSOA 4W5TA 2F9WA 1GLLO 3RSEA 1DTTA 3G0ZA 3D6RA 3M8SA 1Z25A 4YFUA 3VEVA 5HLFA 2D0PA 2XY8A 4Y1CA 1VSDA 1K8AO 3I56N 4O0JA 4O8KA 3ZEUA 1S1VA 2OZMA 1RBRA 4BROA 2VWKA 3CM5A 3SMSA 2QW9A 4KO0A 4ELTA 2Q31A 1VRUA 2A1SA 4KAZA 3ID8A 4UQGA 1S1XA 5D3GA 1C0UA 3VF2A 3T69A 1RT3A 5GINA 1N6QA 3ZT4A 5E41A 4FPBA 1TUYA 3TAFA 1NJIO 2YHBA 5J2PA 4H5RA 4ISEA 3EN9A 3ENOA 3SLCA 3TARA 3LM9A 2NRWA 3CJ9A 2ASMA 3CJBA 4AHRA 3TAPA 5HRPA 1QHTA 3VF4A 4CZGA 3MN9A 4B3MK 3DLGA 3DLEA 1LWFA 3KK7A 4CZKA 5LY3A 3CETA 1RDDA 4WQ4A 4JK9A 4G1QA 2FLOA 4C8MA 4CJ3A 3AVAA 1HKGA 2I7PA 5GIPA 2GWJA 2FBTA 3JS6A 3HT3A 3FR0A 3QIPA 2OCEA 4DFMA 2NRRA 2FF6A 1RDCA 5BPNA 1JL1A 4W5QA 4O4GA 4B9MA 4DWIA 4CGHA 1NJXA 2PAVA 4JN4A 1W0HA 2E2QA 4ELVA 1HNWK 4BRDA 4RW4A 3BGRA 4FK0A 4KI6A 3V9ZA 4CW7B 3THWB 2P51A 4F4KA 3R3LA 4BY9C 4A2BA 5LL6Z 4JI3K 4J2EA 3BDPA 4MO5A 4CEZA 1D4XA 1R59O 2DPNA 4AHSA 1KAZA 1NGEA 3MXMA 3QEVA 3HSCA 4WF9L 3MCAB 4DV4K 5HRSA 3MEDA 4DR4K 1KAXA 4AHCA 4AM6A 3QFUA 3V9UA 3CJCA 3QFPA 2VCPA 3DI6A 3ENHA 1IO2A 4CZHA 4DF8A 3CG7A 4AILC 3WQTA 5CZ2A 1T8EA 1RT5A 3TSPA 2ZM6K 3CERA 4DTRA 4W5RA 2BGGA 5FPEA 1ESVA 3RMAA 3LZJA 3I0RA 4ILHA 1VHXA 4QS7A 1T6DA 1S6PA 2DTUA 3H6EA 1EX4A 4KRFA 3RMDA 4QOZB 4ZTJA 1TYQB 4DUYK 4WCEL 3THXB 1SKSA 2Q0RA 1N32K 3D2EA 2O8CA 1N36K 3QESA 2P9LA 1RT7A 5AQSA 1VSLA 4I2PA 2PYLA 4N56A 2FSNA 4JHDA 4H0XB 1HYZA 5HL7L 4BE2A 3OS2A 3OYHA 1FKOA 3H3NO 3VEWA 4A59A 3SBGA 4ZHRA 4O5FA 4C8KA 2ZF5O 4BC2A 3SZ2A 4CJSA 1KVBA 2ZWHA 4CJKA 1CZ9A 1SKWA 4CHNA 5TKWA 2O8EA 3KLGA 4YOXA 1ZC6A 3S9HA 4NCAA 1NOZA 1NLVA 2HHQA 2E8AA 3S41A 1WLJA 3EO3A 1NGCA 5BR9A 4FWOA 3IS9A 3QLHA 5BRFA 1BA0A 3CC2N 4M42A 4CK2A 1C0FA 2F96A 3CJ7A 2BUPA 4FWLA 4CZFA 1N8RO 3SQ2A 5AFUA 2LSNA 1KXPA 1IKXA 4YOWA 4IOAL 2V51B 3VQ8A 4B1ZA 4DFPA 3P83D 5C24A 3VN5A 4ILGB 3L0QA 1X9WA 1VSJA 1C1BA 2OPQA 3ULEB 5J2MA 2XY6A 2P5OA 3CCSN 3OYCA 4Y1DA 5ELZA 1QS4A 3VQQA 3HI0A 5BN9A 1CZAN 4MFBA 4JRQA 1SL0A 4FWQA 3V1QA 2ZGZA 3QICA 1NM1A 4BVPA 2AP1A 2Q0UA 3O9TA 4E0DA 3OYBA 5FPDA 1HX1A 1DLOA 2YHWA 4O55A 2G8IA 4BRQA 4RCHA 2HHXA 1S5JA 3GDQA 4OPJA 1ZBHA 3ZETB 4DLEA 1VQ4N 3AGKA 5KRTA 1W2BM 3ZSWA 2ITGA 3NBPA 3MEGA 4X66K 3ALYA 5EOYA 5HROA 3O80A 3U4LA 3A5NC 4PL8A 4X62K 3H46O 3AA4A 3WXJA 3OYGA 3PO4A 1HJRA 1Q86O 3BZCA 3CHWA 4J2AA 1ZBIA 5DM6L 2VGNA 4JI5K 4CJLA
chains in the Genus database with same CATH topology
3ZT0A 1HPZA 3HPOA 2IS3A 1WSIA 3SNNA 4CHYA 4HVJA 2IC3A 1RTJA 4KTZA 2FBYA 4FLVA 3AA3A 1S1TA 5JS2A 4CEQA 2F8TA 5CZ1A 1LV5A 4E7KA 3AA5X 3KD1E 2FBXA 2E6LA 4DTSA 1Q8IA 4JS5A 1B9FA 1KCFA 1RT1A 1S9GA 3RRGA 2GUIA 3MXJA 3SI6A 4DU1A 4CIEA 1XC9A 4J2DA 1XWLA 4ZTFA 4AHTA 1KFSA 3VQ4A 3ZT3A 1RTHA 3MEEA 1JLQA 3KK2A 4I2QA 1R0AA 4B9VA 2KFNA 1C6VA 4AH9A 2RKIA 2OYQA 3K5NA 2R7YA 4PA1A 2IDOA 3OYEA 3LDSA 1L3VA 4DSIA 2HNDA 5I42A 4C8OA 4B9TA 5JS1A 3OS0A 3C6UA 4Z4IA 3DOLA 1BI4A 1BHLA 1JKHA 2HHWA 4ICLA 4AHVA 3TAGA 1A5VA 1S6QA 1ZYQA 1JXEA 2G8HA 4DF4A 1C1CA 2X74A 3CM6A 1CZBA 3D45A 4Z4FA 4CF2A 2YKMA 3TANA 4CHPA 4FJMA 2HMIA 2O4IA 4L8RB 1IKVA 1WAJA 3LAMA 4O5BA 2BDPA 3F73A 1FKPA 2B5JA 4KB1A 3AVCA 1VSHA 4OKKA 2DY4A 2ETJA 4FJGA 3QEPA 1O1WA 3PO5A 4FJ8A 1BL3A 3NF9A 4CFAA 3SPZA 2HB5A 1T03A 4H4OA 2KZZA 1UA0A 1VSEA 4CJQA 4E89A 1N5YA 3SJJA 4CF8A 3IAYA 3NGIA 4C8NA 1XHZA 1TKXA 3KD5E 3NCIA 3NF7A 1S1WA 4KTQA 4CGIA 1ITGA 1HRHA 3OYIA 2DFEA 4W5NA 1LWEA 1EKEA 3KLEA 4CJVA 3T1AA 4CJ5A 5HRNA 4E3SA 3L3VA 2G8KA 3P5JA 3AO2A 2GV9A 1U4BA 1B9DA 2YNFA 3ULDA 3G10A 4OLBA 1HYVA 3PX6A 4IBNA 1HQEA 4XIUA 3CFOA 3ZSYA 2XY7A 4FJHA 1WSHA 4KTWA 1IKYA 4B9SA 5SWMA 4FK2A 3AO1A 1LW2A 3AVHA 1T05A 2G8UA 3AVJA 3DRRA 4DS5A 1VRTA 1WSGA 3SYZA 1I39A 3VA0A 4N76A 1QQCA 2KQ2A 3K5MA 4F3TA 4B3OA 1WNSA 2Z1IA 3NAEA 3K5OA 1TK8A 2FBVA 4EP5A 3DLKA 3OYDA 3OVNA 3VQAA 3AVBA 4CIFA 1DTQA 1J53A 1LWCA 3DLRA 3TI0A 4CK3A 1C1AA 1HQUA 1K6YA 4LSNA 4DQSA 1S9EA 3LPUA 3TWHA 2PYJA 4EZ9A 3HP6A 5KI6A 1EXQA 2D0AA 3H08A 3KIOA 4E7HA 3LPTA 1SL2A 4B08A 4HTUA 1XI1A 2YNGA 3S3OA 3O3HA 4LH5A 5T7BA 3AO5A 3NH2A 3LP0A 1RBVA 1RT6A 2YV0X 1RBSA 1U04A 4CJEA 4E1NA 1RBUA 4Q5VA 4HUFA 3QERA 4CJ4A 4DTUA 4C8LA 1SL1A 3HVTA 4DTPA 3MXIA 2G8FA 3UIQA 2P1JA 3O3FA 3HSTB 1VK0A 2HVIA 5K14A 4FJKA 2F8SA 3THVA 4FM2A 4B9LA 4F2RA 1RILA 3WNFA 1ZBLA 2X6NA 4HHTA 3QEIA 1QSSA 3SUPA 3QINA 4GVMA 3L8BA 3I0SA 3KLFA 1GOAA 3V81A 4ID5A 4RW9A 4B9UA 4DSKA 4NCBA 4FXDA 1IKWA 1QE1A 4M41A 2XRIA 3C95A 4CJTA 1U45A 4E19A 2OA8A 3OYAA 4Z4GA 4CJPA 2Z1HA 4KFBA 4KKOA 3ITHA 4E7IA 4CEOA 1BQNA 1NKEA 4E7JA 4DFJA 3VQ7A 1CXUA 3LAKA 4CGFA 3ZT2A 1WSFA 5SZTA 2X78A 4CJWA 4KHYA 1BI4B 3P1GA 3HM9A 4KHSA 3SQ1A 3LALA 3CQ8A 3SV3A 4KHQA 3SV4A 1Q9XA 4DTMA 1KFDA 3HL8A 3DMJA 3L2QA 4AHUA 4FM1A 1NOYA 3ZSXA 1GOCA 4CHQA 4KI4A 4M3ZA 4B9NA 4CERA 1JLFA 4ID1A 2B6AA 4M3WA 2G8WA 3KLIA 1RDAA 2DFHA 3DLHA 1HMVA 3JYTA 1X9MA 1NK0A 1RCHA 2PY5A 1J5OA 1WSEA 3L2RA 3NGYA 1D9FA 2OPPA 4CFCA 3VQCA 3VQ5A 3KLHA 4DSLA 3O4QA 3K2PA 1HNVA 1TGOA 3AVMA 3ZSOA 4DTXA 1NKCA 4W5TA 4Z4EA 2KTQA 4FLXA 3CFRA 4LSLA 1C0MA 3HPHA 4DSFA 1UOCA 4HUGA 4H8KA 5HBMA 4PY5A 1DTTA 4FW2A 1W9HA 3G0ZA 5J1EA 3M8SA 2Y1JA 1Z25A 3NH0A 4YFUA 5CYMA 3OYNA 1IG9A 4FJJA 4EP4A 3MECA 5HLFA 2GBZA 4K8XA 1EP4A 4IDKA 2XY8A 5FDLA 4CHZA 4CF9A 4Y1CA 1VSDA 1VSMA 1C0TA 4CEEA 4FJXA 1KVAA 4O0JA 3ZSRA 1RTDA 1S1VA 3DRPA 2OZMA 1RBRA 4BDPA 1TAQA 1ZBFA 1YVUA 4HCCA 2VWKA 2YNIA 4Z0UA 3QEWA 1SUQA 4M3TA 4LH4A 3L3UA 1CXQA 3O3GA 3V6DA 2VG7A 3CM5A 4DU3A 2HHSA 3LZIA 4KO0A 3DM2A 2QXFA 4ELTA 3AVNA 1J54A 4CHOA 4CEFA 2A1RA 4CEBA 1VRUA 2A1SA 5FROA 4IFYA 1NK5A 1LAWA 4KAZA 4UQGA 1S1XA 4I9QA 3EZ5A 1LW0A 1NJYA 5D3GA 4KHNA 2HNZA 2P5GA 4E1MA 1U47A 1C0UA 1JL2A 4HUEA 3S3MA 1RT3A 1N6QA 3ZT4A 1KTQA 1RNHA 5E41A 4CFDA 4FLYA 1NK4A 3RMBA 4JS4A 3KKSA 5J2NA 4OLAA 3TAFA 4CCHA 2YHBA 4GW6A 3KK3A 5J2PA 3EY1A 4IKFA 4CGGA 5FRMA 4DQQA 2QKKA 4K8ZA 4DG1A 1MU2A 1U48A 3CYMA 2D5RA 4M3YA 4CFBA 3V9XA 5KGXA 3TARA 3PV8A 4BWJA 2ATQA 1F21A 3VQPA 4CJUA 3T3FA 1KRPA 4JLHA 1HNIA 4AHRA 4OJRA 3TAPA 5HRPA 1Y97A 1QHTA 3EYZA 3AO4A 3HP9A 3ISNC 2G8VA 4M3RA 2RF2A 3DLGA 1LWFA 3DLEA 2OZSA 3HK2A 1RTIA 3AVFA 3E01A 3PUFA 1RDDA 4N41A 4ELUA 3OYFA 4G1QA 2D0BA 4C8MA 3OS1A 4FLZA 3V9SA 1YTUA 2HHVA 4CJ3A 5HRRA 3AVLA 2D0CA 2ZQBA 3AVAA 1ASVA 3F9KA 3AA2A 1WN7A 1SKRA 3C94A 3V9WA 3NH1A 3PY8A 3OYJA 2FBTA 5J2QA 3HT3A 4KREA 3QIPA 1D9DA 1BIUA 4DFMA 2O4GA 4KPYA 3RMCA 4F8RA 2VG6A 4O44A 1RDCA 4EZ6A 4R5PA 1X1PA 1JL1A 4FCYA 5KGWA 4W5QA 4DS4A 4O4GA 1JLGA 4OVLA 4CGHA 4B9MA 2XY5A 4DWIA 3LWMA 1UAXA 4BE1A 3SPYA 2VG5A 1NKBA 2E4LA 1NJXA 1L5UA 4FZYA 5C25A 1BCOA 3PX4A 1NJWA 1A5XA 1IH7A 4CEAA 3HVRA 3QNNA 1TKZA 5CY4A 3L2VA 1W0HA 1SV5A 4ELVA 1RBTA 2DFFA 3K5LA 3KKRA 3ZSVA 4M45A 4RW4A 1WAFA 3BGRA 3NF8A 4FK0A 1UA1A 4KI6A 3HO1A 2AJQA 2IAJA 3LP3A 3V9ZA 4HCBA 3RTVA 1U49A 1QSLA 3RR8A 1REVA 1ASWA 2HHTA 2P51A 3NF6A 2HVHA 4J2BA 2B4JA 4F4KA 1TAUA 4F3OA 1QTMA 3LP1A 1TK0A 2RPIA 4J2EA 2FC0A 3O4NA 3VQ9A 3BDPA 3KTQA 3HXMA 4NYFA 4CEZA 4DLGA 4Q0BA 4FZZA 4AHSA 1TL1A 3QEXA 2Z1GA 4DSEA 3MXMA 4FJ7A 1YT3A 3L2UA 2YKNA 4CE9A 4CECA 3QEVA 3SQ4A 4CJFA 2Q3SA 5HRSA 3MEDA 3OYKA 3SQ0A 1XHXA 4AHCA 2KFZA 3K57A 3OJSA 4FJ5A 3LWLA 2BE2A 3V9UA 1BGXT 4PQUA 3DI6A 3K58A 3OYLA 1IO2A 4DF8A 4FK4A 3CG7A 4AILC 2Z1JA 3B6PA 5CZ2A 3IRXA 1T8EA 1RT5A 4DTRA 1NK9A 4KHWA 2BGGA 4W5RA 3JSMA 3RMAA 1FXXA 3LZJA 3I0RA 5CYQA 3RWUA 4CGDA 4OPKA 4FVMA 4KV8A 3TR8A 2QKBA 1S6PA 2DTUA 1ASUA 1EX4A 1RDBA 1JLEA 3MAQA 4KRFA 4CF1A 3RMDA 4QOZB 4CK1A 1VSKA 4ZTJA 4FYDA 3SUOA 2YHAA 1D8YA 1SKSA 3VQDA 2XHBA 3I8DA 4FJ9A 3C6TA 4BWMA 3VQEA 3QESA 2JLEA 1TK5A 3CFPA 1A5WA 1RT7A 3NHGA 4LD0A 3D0PA 2YNHA 5KTQA 3OY9A 4BDYA 4DTOA 3WNGA 1VSLA 4I2PA 4CJLA 2PYLA 4N56A 4DQRA 1TV6A 4NCGA 1HYZA 1Z26A 4BE2A 3TAQA 4DTNA 3OS2A 3OYHA 1FKOA 2E6MA 2HHUA 3S3NA 3NE6A 4Z4CA 3SCXA 4M3XA 1JLCA 4ZHRA 5DK5A 4FLTA 4DU4A 4C8KA 3NDKA 1T7PA 3SZ2A 4DSJA 3WNEA 1L3SA 4CJSA 1KVBA 3NFAA 4JRPA 5I3UA 1X9SA 1Q9YA 4DQPA 4CJKA 1CZ9A 3M8RA 1SKWA 4CHNA 2EHGA 3TAMA 4H4MA 1ZBUA 3KLGA 4FM0A 4M3UA 4FZXC 4NCAA 3S9HA 2EX3A 1NOZA 3AO3A 3HYFA 4OKEA 1YTAA 4Z4HA 4TSXA 4QCLA 1GOBA 2OPSA 3RR7A 1LAVA 3LANA 2HHQA 4NYNA 5EU7A 3PX0A 3RRHA 2X6SA 4DQIA 1WLJA 3DLBA 3KK1A 3QETA 5KRSA 4GMJB 4RW6A 3ZSZA 1NK6A 1CLQA 1HYSA 2QK9A 4RG8A 4DFKA 4B8CA 3QNOA 3IS9A 3QO9A 3QLHA 5FRNA 3DOKA 1I3AA 4WE1A 3TAEA 4KB0A 4IG3A 4M42A 4N47A 4CK2A 2IOCA 2F96A 4OGEA 4FJIA 3SQ2A 4KHUA 4O0IA 1KLMA 1BISA 3AVGA 2HNYA 2LSNA 4YNQA 1VSFA 4E7LA 4CF0A 1IKXA 3V1RA 3VQBA 4CGJA 3VA3A 4MQ3A 4B8AB 3K59A 3VQ8A 3ZT1A 4BE0A 4DFPA 4FJNA 2VWJA 4IFVA 3P83D 5C24A 3VN5A 3AVIA 2JGUA 3ZCMA 1L3UA 1BCMA 1RT2A 2I5JA 5DMRA 4DTJA 2KZMA 1X9WA 1KLNA 4FLUA 1VSJA 2HW3A 1C1BA 2OPQA 5J2MA 2XY6A 4BACA 2P5OA 3VQ6A 1FK9A 3OYCA 4CIGA 4Y1DA 4PWDA 1VSIA 1BIZA 3AVKA 3HJFA 3NGZA 4I9LA 3DYAA 1QS4A 3VQQA 1EETA 1B92A 3QIOA 4FLWA 4MFBA 4LY7A 4JRQA 3ASMA 1SL0A 4BDZA 3V1QA 3AV9A 3OJUA 1L3TA 3TABA 4OGCA 1QSYA 1KVCA 3IG1A 1UWBA 4OKJA 2PZSA 4E0DA 3L2WA 3OYBA 4FW1A 4QAGA 3U6FA 3SUNA 3V1OA 1DLOA 2NUBA 4O55A 1JXBA 3LP2A 4CESA 3HPGA 3OYMA 2G8IA 2HHXA 1S5JA 2RN2A 4OPJA 2BANA 2KW4A 1ZBHA 2IGIA 1NK7A 3U3YA 1NJZA 4W5OA 2ZE2A 4DLEA 2Y1IA 2WOMA 4PUOA 3B6OA 5C42A 5KRTA 5HP1A 4IG0A 4RW7A 3U3GA 3ZSWA 4F2SA 2ITGA 3NBPA 3DRSA 2XO7A 1WSJA 2WONA 1TL3A 3ALYA 3MEGA 3M8PA 4CJRA 5HROA 3WNHA 1NK8A 1JLAA 4FJLA 1G15A 1KSPA 1TKTA 1RT4A 4DMNA 3V4IA 3AA4A 3ZSQA 3KJVA 3OYGA 3T19A 3PO4A 4RW8A 1JLBA 1J9AA 1HJRA 4I7FA 4J2AA 2W42A 1ZBIA 3M8QA 1TKDA 1D5AA 4CEDA 3SUQA 1S1UA 3A2FA 4N5SA 1BQMA 3FFIA 2OPRA 1TVRA 2ZD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZT0 A;  1HPZ A;  3HPO A;  2IS3 A;  1WSI A;  3SNN A;  4CHY A;  4HVJ A;  2IC3 A;  1RTJ A;  4KTZ A;  2FBY A;  4FLV A;  3AA3 A;  1S1T A;  5JS2 A;  4CEQ A;  2F8T A;  5CZ1 A;  1LV5 A;  4E7K A;  3AA5 X;  3KD1 E;  2FBX A;  2E6L A;  4DTS A;  1Q8I A;  4JS5 A;  1B9F A;  1KCF A;  1RT1 A;  1S9G A;  3RRG A;  2GUI A;  3MXJ A;  3SI6 A;  4DU1 A;  4CIE A;  1XC9 A;  4J2D A;  1XWL A;  4ZTF A;  4AHT A;  1KFS A;  3VQ4 A;  3ZT3 A;  1RTH A;  3MEE A;  1JLQ A;  3KK2 A;  4I2Q A;  1R0A A;  4B9V A;  2KFN A;  1C6V A;  4AH9 A;  2RKI A;  2OYQ A;  3K5N A;  2R7Y A;  4PA1 A;  2IDO A;  3OYE A;  3LDS A;  1L3V A;  4DSI A;  2HND A;  5I42 A;  4C8O A;  4B9T A;  5JS1 A;  3OS0 A;  3C6U A;  4Z4I A;  3DOL A;  1BI4 A;  1BHL A;  1JKH A;  2HHW A;  4ICL A;  4AHV A;  3TAG A;  1A5V A;  1S6Q A;  1ZYQ A;  1JXE A;  2G8H A;  4DF4 A;  1C1C A;  2X74 A;  3CM6 A;  1CZB A;  3D45 A;  4Z4F A;  4CF2 A;  2YKM A;  3TAN A;  4CHP A;  4FJM A;  2HMI A;  2O4I A;  4L8R B;  1IKV A;  1WAJ A;  3LAM A;  4O5B A;  2BDP A;  3F73 A;  1FKP A;  2B5J A;  4KB1 A;  3AVC A;  1VSH A;  4OKK A;  2DY4 A;  2ETJ A;  4FJG A;  3QEP A;  1O1W A;  3PO5 A;  4FJ8 A;  1BL3 A;  3NF9 A;  4CFA A;  3SPZ A;  2HB5 A;  1T03 A;  4H4O A;  2KZZ A;  1UA0 A;  1VSE A;  4CJQ A;  4E89 A;  1N5Y A;  3SJJ A;  4CF8 A;  3IAY A;  3NGI A;  4C8N A;  1XHZ A;  1TKX A;  3KD5 E;  3NCI A;  3NF7 A;  1S1W A;  4KTQ A;  4CGI A;  1ITG A;  1HRH A;  3OYI A;  2DFE A;  4W5N A;  1LWE A;  1EKE A;  3KLE A;  4CJV A;  3T1A A;  4CJ5 A;  5HRN A;  4E3S A;  3L3V A;  2G8K A;  3P5J A;  3AO2 A;  2GV9 A;  1U4B A;  1B9D A;  2YNF A;  3ULD A;  3G10 A;  4OLB A;  1HYV A;  3PX6 A;  4IBN A;  1HQE A;  4XIU A;  3CFO A;  3ZSY A;  2XY7 A;  4FJH A;  1WSH A;  4KTW A;  1IKY A;  4B9S A;  5SWM A;  4FK2 A;  3AO1 A;  1LW2 A;  3AVH A;  1T05 A;  2G8U A;  3AVJ A;  3DRR A;  4DS5 A;  1VRT A;  1WSG A;  3SYZ A;  1I39 A;  3VA0 A;  4N76 A;  1QQC A;  2KQ2 A;  3K5M A;  4F3T A;  4B3O A;  1WNS A;  2Z1I A;  3NAE A;  3K5O A;  1TK8 A;  2FBV A;  4EP5 A;  3DLK A;  3OYD A;  3OVN A;  3VQA A;  3AVB A;  4CIF A;  1DTQ A;  1J53 A;  1LWC A;  3DLR A;  3TI0 A;  4CK3 A;  1C1A A;  1HQU A;  1K6Y A;  4LSN A;  4DQS A;  1S9E A;  3LPU A;  3TWH A;  2PYJ A;  4EZ9 A;  3HP6 A;  5KI6 A;  1EXQ A;  2D0A A;  3H08 A;  3KIO A;  4E7H A;  3LPT A;  1SL2 A;  4B08 A;  4HTU A;  1XI1 A;  2YNG A;  3S3O A;  3O3H A;  4LH5 A;  5T7B A;  3AO5 A;  3NH2 A;  3LP0 A;  1RBV A;  1RT6 A;  2YV0 X;  1RBS A;  1U04 A;  4CJE A;  4E1N A;  1RBU A;  4Q5V A;  4HUF A;  3QER A;  4CJ4 A;  4DTU A;  4C8L A;  1SL1 A;  3HVT A;  4DTP A;  3MXI A;  2G8F A;  3UIQ A;  2P1J A;  3O3F A;  3HST B;  1VK0 A;  2HVI A;  5K14 A;  4FJK A;  2F8S A;  3THV A;  4FM2 A;  4B9L A;  4F2R A;  1RIL A;  3WNF A;  1ZBL A;  2X6N A;  4HHT A;  3QEI A;  1QSS A;  3SUP A;  3QIN A;  4GVM A;  3L8B A;  3I0S A;  3KLF A;  1GOA A;  3V81 A;  4ID5 A;  4RW9 A;  4B9U A;  4DSK A;  4NCB A;  4FXD A;  1IKW A;  1QE1 A;  4M41 A;  2XRI A;  3C95 A;  4CJT A;  1U45 A;  4E19 A;  2OA8 A;  3OYA A;  4Z4G A;  4CJP A;  2Z1H A;  4KFB A;  4KKO A;  3ITH A;  4E7I A;  4CEO A;  1BQN A;  1NKE A;  4E7J A;  4DFJ A;  3VQ7 A;  1CXU A;  3LAK A;  4CGF A;  3ZT2 A;  1WSF A;  5SZT A;  2X78 A;  4CJW A;  4KHY A;  1BI4 B;  3P1G A;  3HM9 A;  4KHS A;  3SQ1 A;  3LAL A;  3CQ8 A;  3SV3 A;  4KHQ A;  3SV4 A;  1Q9X A;  4DTM A;  1KFD A;  3HL8 A;  3DMJ A;  3L2Q A;  4AHU A;  4FM1 A;  1NOY A;  3ZSX A;  1GOC A;  4CHQ A;  4KI4 A;  4M3Z A;  4B9N A;  4CER A;  1JLF A;  4ID1 A;  2B6A A;  4M3W A;  2G8W A;  3KLI A;  1RDA A;  2DFH A;  3DLH A;  1HMV A;  3JYT A;  1X9M A;  1NK0 A;  1RCH A;  2PY5 A;  1J5O A;  1WSE A;  3L2R A;  3NGY A;  1D9F A;  2OPP A;  4CFC A;  3VQC A;  3VQ5 A;  3KLH A;  4DSL A;  3O4Q A;  3K2P A;  1HNV A;  1TGO A;  3AVM A;  3ZSO A;  4DTX A;  1NKC A;  4W5T A;  4Z4E A;  2KTQ A;  4FLX A;  3CFR A;  4LSL A;  1C0M A;  3HPH A;  4DSF A;  1UOC A;  4HUG A;  4H8K A;  5HBM A;  4PY5 A;  1DTT A;  4FW2 A;  1W9H A;  3G0Z A;  5J1E A;  3M8S A;  2Y1J A;  1Z25 A;  3NH0 A;  4YFU A;  5CYM A;  3OYN A;  1IG9 A;  4FJJ A;  4EP4 A;  3MEC A;  5HLF A;  2GBZ A;  4K8X A;  1EP4 A;  4IDK A;  2XY8 A;  5FDL A;  4CHZ A;  4CF9 A;  4Y1C A;  1VSD A;  1VSM A;  1C0T A;  4CEE A;  4FJX A;  1KVA A;  4O0J A;  3ZSR A;  1RTD A;  1S1V A;  3DRP A;  2OZM A;  1RBR A;  4BDP A;  1TAQ A;  1ZBF A;  1YVU A;  4HCC A;  2VWK A;  2YNI A;  4Z0U A;  3QEW A;  1SUQ A;  4M3T A;  4LH4 A;  3L3U A;  1CXQ A;  3O3G A;  3V6D A;  2VG7 A;  3CM5 A;  4DU3 A;  2HHS A;  3LZI A;  4KO0 A;  3DM2 A;  2QXF A;  4ELT A;  3AVN A;  1J54 A;  4CHO A;  4CEF A;  2A1R A;  4CEB A;  1VRU A;  2A1S A;  5FRO A;  4IFY A;  1NK5 A;  1LAW A;  4KAZ A;  4UQG A;  1S1X A;  4I9Q A;  3EZ5 A;  1LW0 A;  1NJY A;  5D3G A;  4KHN A;  2HNZ A;  2P5G A;  4E1M A;  1U47 A;  1C0U A;  1JL2 A;  4HUE A;  3S3M A;  1RT3 A;  1N6Q A;  3ZT4 A;  1KTQ A;  1RNH A;  5E41 A;  4CFD A;  4FLY A;  1NK4 A;  3RMB A;  4JS4 A;  3KKS A;  5J2N A;  4OLA A;  3TAF A;  4CCH A;  2YHB A;  4GW6 A;  3KK3 A;  5J2P A;  3EY1 A;  4IKF A;  4CGG A;  5FRM A;  4DQQ A;  2QKK A;  4K8Z A;  4DG1 A;  1MU2 A;  1U48 A;  3CYM A;  2D5R A;  4M3Y A;  4CFB A;  3V9X A;  5KGX A;  3TAR A;  3PV8 A;  4BWJ A;  2ATQ A;  1F21 A;  3VQP A;  4CJU A;  3T3F A;  1KRP A;  4JLH A;  1HNI A;  4AHR A;  4OJR A;  3TAP A;  5HRP A;  1Y97 A;  1QHT A;  3EYZ A;  3AO4 A;  3HP9 A;  3ISN C;  2G8V A;  4M3R A;  2RF2 A;  3DLG A;  1LWF A;  3DLE A;  2OZS A;  3HK2 A;  1RTI A;  3AVF A;  3E01 A;  3PUF A;  1RDD A;  4N41 A;  4ELU A;  3OYF A;  4G1Q A;  2D0B A;  4C8M A;  3OS1 A;  4FLZ A;  3V9S A;  1YTU A;  2HHV A;  4CJ3 A;  5HRR A;  3AVL A;  2D0C A;  2ZQB A;  3AVA A;  1ASV A;  3F9K A;  3AA2 A;  1WN7 A;  1SKR A;  3C94 A;  3V9W A;  3NH1 A;  3PY8 A;  3OYJ A;  2FBT A;  5J2Q A;  3HT3 A;  4KRE A;  3QIP A;  1D9D A;  1BIU A;  4DFM A;  2O4G A;  4KPY A;  3RMC A;  4F8R A;  2VG6 A;  4O44 A;  1RDC A;  4EZ6 A;  4R5P A;  1X1P A;  1JL1 A;  4FCY A;  5KGW A;  4W5Q A;  4DS4 A;  4O4G A;  1JLG A;  4OVL A;  4CGH A;  4B9M A;  2XY5 A;  4DWI A;  3LWM A;  1UAX A;  4BE1 A;  3SPY A;  2VG5 A;  1NKB A;  2E4L A;  1NJX A;  1L5U A;  4FZY A;  5C25 A;  1BCO A;  3PX4 A;  1NJW A;  1A5X A;  1IH7 A;  4CEA A;  3HVR A;  3QNN A;  1TKZ A;  5CY4 A;  3L2V A;  1W0H A;  1SV5 A;  4ELV A;  1RBT A;  2DFF A;  3K5L A;  3KKR A;  3ZSV A;  4M45 A;  4RW4 A;  1WAF A;  3BGR A;  3NF8 A;  4FK0 A;  1UA1 A;  4KI6 A;  3HO1 A;  2AJQ A;  2IAJ A;  3LP3 A;  3V9Z A;  4HCB A;  3RTV A;  1U49 A;  1QSL A;  3RR8 A;  1REV A;  1ASW A;  2HHT A;  2P51 A;  3NF6 A;  2HVH A;  4J2B A;  2B4J A;  4F4K A;  1TAU A;  4F3O A;  1QTM A;  3LP1 A;  1TK0 A;  2RPI A;  4J2E A;  2FC0 A;  3O4N A;  3VQ9 A;  3BDP A;  3KTQ A;  3HXM A;  4NYF A;  4CEZ A;  4DLG A;  4Q0B A;  4FZZ A;  4AHS A;  1TL1 A;  3QEX A;  2Z1G A;  4DSE A;  3MXM A;  4FJ7 A;  1YT3 A;  3L2U A;  2YKN A;  4CE9 A;  4CEC A;  3QEV A;  3SQ4 A;  4CJF A;  2Q3S A;  5HRS A;  3MED A;  3OYK A;  3SQ0 A;  1XHX A;  4AHC A;  2KFZ A;  3K57 A;  3OJS A;  4FJ5 A;  3LWL A;  2BE2 A;  3V9U A;  1BGX T;  4PQU A;  3DI6 A;  3K58 A;  3OYL A;  1IO2 A;  4DF8 A;  4FK4 A;  3CG7 A;  4AIL C;  2Z1J A;  3B6P A;  5CZ2 A;  3IRX A;  1T8E A;  1RT5 A;  4DTR A;  1NK9 A;  4KHW A;  2BGG A;  4W5R A;  3JSM A;  3RMA A;  1FXX A;  3LZJ A;  3I0R A;  5CYQ A;  3RWU A;  4CGD A;  4OPK A;  4FVM A;  4KV8 A;  3TR8 A;  2QKB A;  1S6P A;  2DTU A;  1ASU A;  1EX4 A;  1RDB A;  1JLE A;  3MAQ A;  4KRF A;  4CF1 A;  3RMD A;  4QOZ B;  4CK1 A;  1VSK A;  4ZTJ A;  4FYD A;  3SUO A;  2YHA A;  1D8Y A;  1SKS A;  3VQD A;  2XHB A;  3I8D A;  4FJ9 A;  3C6T A;  4BWM A;  3VQE A;  3QES A;  2JLE A;  1TK5 A;  3CFP A;  1A5W A;  1RT7 A;  3NHG A;  4LD0 A;  3D0P A;  2YNH A;  5KTQ A;  3OY9 A;  4BDY A;  4DTO A;  3WNG A;  1VSL A;  4I2P A;  4CJL A;  2PYL A;  4N56 A;  4DQR A;  1TV6 A;  4NCG A;  1HYZ A;  1Z26 A;  4BE2 A;  3TAQ A;  4DTN A;  3OS2 A;  3OYH A;  1FKO A;  2E6M A;  2HHU A;  3S3N A;  3NE6 A;  4Z4C A;  3SCX A;  4M3X A;  1JLC A;  4ZHR A;  5DK5 A;  4FLT A;  4DU4 A;  4C8K A;  3NDK A;  1T7P A;  3SZ2 A;  4DSJ A;  3WNE A;  1L3S A;  4CJS A;  1KVB A;  3NFA A;  4JRP A;  5I3U A;  1X9S A;  1Q9Y A;  4DQP A;  4CJK A;  1CZ9 A;  3M8R A;  1SKW A;  4CHN A;  2EHG A;  3TAM A;  4H4M A;  1ZBU A;  3KLG A;  4FM0 A;  4M3U A;  4FZX C;  4NCA A;  3S9H A;  2EX3 A;  1NOZ A;  3AO3 A;  3HYF A;  4OKE A;  1YTA A;  4Z4H A;  4TSX A;  4QCL A;  1GOB A;  2OPS A;  3RR7 A;  1LAV A;  3LAN A;  2HHQ A;  4NYN A;  5EU7 A;  3PX0 A;  3RRH A;  2X6S A;  4DQI A;  1WLJ A;  3DLB A;  3KK1 A;  3QET A;  5KRS A;  4GMJ B;  4RW6 A;  3ZSZ A;  1NK6 A;  1CLQ A;  1HYS A;  2QK9 A;  4RG8 A;  4DFK A;  4B8C A;  3QNO A;  3IS9 A;  3QO9 A;  3QLH A;  5FRN A;  3DOK A;  1I3A A;  4WE1 A;  3TAE A;  4KB0 A;  4IG3 A;  4M42 A;  4N47 A;  4CK2 A;  2IOC A;  2F96 A;  4OGE A;  4FJI A;  3SQ2 A;  4KHU A;  4O0I A;  1KLM A;  1BIS A;  3AVG A;  2HNY A;  2LSN A;  4YNQ A;  1VSF A;  4E7L A;  4CF0 A;  1IKX A;  3V1R A;  3VQB A;  4CGJ A;  3VA3 A;  4MQ3 A;  4B8A B;  3K59 A;  3VQ8 A;  3ZT1 A;  4BE0 A;  4DFP A;  4FJN A;  2VWJ A;  4IFV A;  3P83 D;  5C24 A;  3VN5 A;  3AVI A;  2JGU A;  3ZCM A;  1L3U A;  1BCM A;  1RT2 A;  2I5J A;  5DMR A;  4DTJ A;  2KZM A;  1X9W A;  1KLN A;  4FLU A;  1VSJ A;  2HW3 A;  1C1B A;  2OPQ A;  5J2M A;  2XY6 A;  4BAC A;  2P5O A;  3VQ6 A;  1FK9 A;  3OYC A;  4CIG A;  4Y1D A;  4PWD A;  1VSI A;  1BIZ A;  3AVK A;  3HJF A;  3NGZ A;  4I9L A;  3DYA A;  1QS4 A;  3VQQ A;  1EET A;  1B92 A;  3QIO A;  4FLW A;  4MFB A;  4LY7 A;  4JRQ A;  3ASM A;  1SL0 A;  4BDZ A;  3V1Q A;  3AV9 A;  3OJU A;  1L3T A;  3TAB A;  4OGC A;  1QSY A;  1KVC A;  3IG1 A;  1UWB A;  4OKJ A;  2PZS A;  4E0D A;  3L2W A;  3OYB A;  4FW1 A;  4QAG A;  3U6F A;  3SUN A;  3V1O A;  1DLO A;  2NUB A;  4O55 A;  1JXB A;  3LP2 A;  4CES A;  3HPG A;  3OYM A;  2G8I A;  2HHX A;  1S5J A;  2RN2 A;  4OPJ A;  2BAN A;  2KW4 A;  1ZBH A;  2IGI A;  1NK7 A;  3U3Y A;  1NJZ A;  4W5O A;  2ZE2 A;  4DLE A;  2Y1I A;  2WOM A;  4PUO A;  3B6O A;  5C42 A;  5KRT A;  5HP1 A;  4IG0 A;  4RW7 A;  3U3G A;  3ZSW A;  4F2S A;  2ITG A;  3NBP A;  3DRS A;  2XO7 A;  1WSJ A;  2WON A;  1TL3 A;  3ALY A;  3MEG A;  3M8P A;  4CJR A;  5HRO A;  3WNH A;  1NK8 A;  1JLA A;  4FJL A;  1G15 A;  1KSP A;  1TKT A;  1RT4 A;  4DMN A;  3V4I A;  3AA4 A;  3ZSQ A;  3KJV A;  3OYG A;  3T19 A;  3PO4 A;  4RW8 A;  1JLB A;  1J9A A;  1HJR A;  4I7F A;  4J2A A;  2W42 A;  1ZBI A;  3M8Q A;  1TKD A;  1D5A A;  4CED A;  3SUQ A;  1S1U A;  3A2F A;  4N5S A;  1BQM A;  3FFI A;  2OPR A;  1TVR A;  2ZD1 A; 
#chains in the Genus database with same CATH topology
 2D0O A;  4MLH A;  3HPO A;  4BRG A;  3SNN A;  3CCV N;  4H5N A;  1RDU A;  1QVF M;  2F8T A;  5LMN K;  4BG9 A;  1GLC G;  2FBX A;  3BZK A;  4DTS A;  5FPN A;  1Q8I A;  3IMX A;  1RT1 A;  1S9G A;  2GUI A;  3MXJ A;  3SI6 A;  1KFS A;  4JKF A;  3VQ4 A;  4M63 C;  2UXD K;  1BOT O;  3CCM N;  2KFN A;  2RKI A;  2OYQ A;  3D7E O;  2YHX A;  4BGA A;  3LDS A;  4GY2 B;  5I42 A;  3OS0 A;  4Z4I A;  5GIO A;  4FPA A;  3BY5 A;  3GL1 A;  3CM6 A;  3D45 A;  3N4Q A;  4Z4F A;  3TAN A;  2CH5 A;  2HMI A;  4L8R B;  1OH5 A;  1WAJ A;  2DY4 A;  4KB1 A;  3AVC A;  3G4S N;  4LC9 B;  1O1W A;  1BL3 A;  1Y64 A;  2NRH A;  3BF3 A;  4HWI A;  2H3G X;  3HZ6 A;  5KPT A;  4H0O A;  3EKU A;  1ITG A;  3VEO A;  3QDK A;  3OYI A;  3NMU A;  2DFE A;  3UE5 A;  4PHT X;  4E3S A;  2Q2R A;  3CQY A;  2G8K A;  1B9D A;  2P9S A;  4FWP A;  3PX6 A;  3CFO A;  4KTW A;  2GEL A;  3LL3 A;  3RVC A;  1LW2 A;  1BA1 A;  2E2N A;  5C0Y A;  3I33 A;  1QQC A;  3K5M A;  4H5W A;  4F3T A;  3K5O A;  2E5L K;  2FBV A;  4EP5 A;  4CIF A;  3EZW A;  1J53 A;  1LWC A;  3TI0 A;  3CCR N;  1HQU A;  3VEX A;  1S9E A;  3WXM B;  3VES A;  5KI6 A;  1MA9 B;  1SL2 A;  2YNG A;  3MDQ A;  4R79 A;  4EIA A;  4KBO A;  1RT6 A;  1RBS A;  3MN5 A;  4WYB A;  4CJ4 A;  3PSI A;  5E84 A;  4DTP A;  3MXI A;  3UIQ A;  3U9D A;  3O9S A;  4FJK A;  4F2R A;  4LFA K;  5F2R A;  1EWQ A;  1JJ2 M;  1JCF A;  2X6N A;  3QEI A;  3L8B A;  5AQO A;  4RW9 A;  5FPM A;  3V81 A;  2QXL A;  5AZJ B;  3C95 A;  4FWS A;  1U45 A;  2YCH A;  4IXC A;  2HST A;  4U67 L;  4YHH K;  4CJP A;  1VQ9 N;  4KFB A;  1P8Z A;  4CEO A;  1BQN A;  3I55 N;  4CZM A;  3P38 A;  4XEI A;  1EWR A;  1WSF A;  3A5L C;  4DUZ K;  3E9P A;  4JEP A;  4KHS A;  3SQ1 A;  3SV3 A;  1O13 A;  3SV4 A;  3L2Q A;  1S72 N;  3A5M C;  3ZSX A;  4KI4 A;  5C2D A;  1SQK A;  3A0I X;  4M3W A;  4WFA L;  1Q82 O;  2DFH A;  3DLH A;  3UKU B;  4LF5 K;  5AQL A;  3ZX3 A;  3K0S A;  4DSL A;  3AVM A;  1TGO A;  4Z4E A;  4FLX A;  2A40 A;  4DSF A;  4HUG A;  3CF5 L;  4PY5 A;  3B8A X;  4FYD A;  5J1E A;  5CYM A;  2IIR A;  2GBZ A;  4IDK A;  4CZI A;  1YJ9 N;  1W97 L;  3UKR B;  1C0T A;  4YDU A;  1I94 K;  2QWO A;  1NU0 A;  4BDP A;  1ZBF A;  5JVH L;  1SUQ A;  4LH4 A;  3V6D A;  2VG7 A;  3ENB A;  4DU3 A;  3LZI A;  2KKZ A;  2W40 A;  3DM2 A;  4FWR A;  2J4R A;  2A1R A;  4IFY A;  1LAW A;  2JWK A;  3EZ5 A;  1NJY A;  4RTF D;  2P5G A;  3HBT A;  4JV5 K;  1U47 A;  3CJA A;  3EL2 A;  4FLY A;  1NK4 A;  3VTI A;  3KKS A;  4DKW A;  4GW6 A;  4IKF A;  4JKG A;  4CGG A;  4DQQ A;  4K8Z A;  4DG1 A;  1MU2 A;  2WBN A;  1U48 A;  1DGK N;  3CYM A;  2D5R A;  4FVU A;  1YJN N;  4BWJ A;  5M1F A;  3KZB A;  4CJ7 A;  1KRP A;  1F21 A;  4BRF A;  3T3F A;  1QQM A;  3R6M A;  3ISN C;  1IG8 A;  3NVM A;  3G25 A;  1RTI A;  3AVF A;  4XH5 A;  4AM7 A;  5KPZ A;  4N41 A;  3OS1 A;  2D0B A;  3V9S A;  2P9U A;  4JD2 B;  2QTD A;  4JKH A;  2ZQB A;  1ASV A;  3F9K A;  1WN7 A;  4CVN E;  1V4S A;  3PY8 A;  3OYJ A;  5BRD A;  4NB4 A;  3CC7 N;  4ILJ A;  3O1W A;  1D9D A;  3L6Q A;  1BIU A;  1YUW A;  2A5X A;  3UB5 A;  4F8R A;  4EZ6 A;  5KGW A;  1K8K B;  4JI4 K;  3QBW A;  3LWM A;  1NKB A;  3FE1 A;  3IKM A;  1NJW A;  1WBB A;  3CXC M;  2ZGY A;  4NLB A;  5CY4 A;  1SV5 A;  2QWN A;  3K5L A;  3ZSV A;  4M45 A;  5AQJ A;  3AAQ A;  5EVZ A;  1UA1 A;  2NRX A;  3HO1 A;  4HCB A;  4BRP A;  1ASW A;  3NVK A;  3NF6 A;  2HHT A;  4J2B A;  1Q81 O;  1YIT N;  4NO7 A;  2FC0 A;  3O4N A;  4Q0B A;  4NYF A;  4EFH A;  3QEX A;  3L4Q A;  4B1U B;  1YT3 A;  2O8F B;  4CJF A;  1N34 K;  1HLU A;  3TSU A;  3OJS A;  4FJ5 A;  5EXW A;  4PQU A;  3VTH A;  4OPA A;  3MMV A;  4FK4 A;  3ZX2 A;  4DV7 K;  4LFB K;  3IRX A;  1IBK K;  1FXX A;  5CYQ A;  3RWU A;  4CGD A;  4OPK A;  3TR8 A;  5AQK A;  4CF1 A;  2NRZ A;  4L3Q A;  1D8Y A;  1HPM A;  4FJ9 A;  3F2K A;  1JCG A;  3FZL A;  3VQE A;  4DTO A;  3OY9 A;  3IUC A;  3BUZ B;  2HHU A;  3NE6 A;  3VMF B;  4DU4 A;  2JWL A;  1T7P A;  1VQ8 N;  2O8D A;  3WNE A;  3BEX A;  5I3U A;  1X9S A;  3THY A;  3M8R A;  4FM0 A;  3ID6 A;  2EX3 A;  3J81 O;  3AO3 A;  4TSX A;  4GKJ K;  5ADX H;  1NNE A;  3LAN A;  2YJE A;  2P9K A;  3PX0 A;  3RRH A;  5BPM A;  4IEE A;  5KRS A;  1BWF O;  4GMJ B;  3ZSZ A;  3K9K A;  2FXU A;  1HYS A;  4FO0 A;  4RG8 A;  3DOK A;  4KB0 A;  1OVY A;  3D2F B;  3O9U A;  1KLM A;  1S3X A;  3JXU A;  4BRL A;  3VPZ A;  2QWM A;  4DHY A;  2O8B B;  3ZT1 A;  2V7Y A;  4IFV A;  1NG9 A;  2P9N B;  3VEY A;  4I6M B;  3J8A A;  2UXC K;  2QI2 A;  3AVK A;  3NGZ A;  3DYA A;  3CI5 A;  3QIO A;  3TTD A;  1J5E K;  2QWR A;  4LY7 A;  4DV2 K;  4GV3 A;  3DAW A;  2A42 A;  1Z6R A;  3AV9 A;  3OJU A;  3TAB A;  3CMA N;  3IG1 A;  1UWB A;  3L4I A;  3Q7B A;  1M1K O;  4FW1 A;  4M7X A;  4DR1 K;  3SUN A;  1OH6 A;  3KHY A;  4WFN L;  3FZK A;  3OYM A;  3HPG A;  5C10 A;  4A62 A;  2IGI A;  3SK3 A;  3E1Y A;  3QBX A;  4CI6 A;  2UXB K;  4JKB A;  3VGM A;  4MO4 A;  4PUO A;  5C42 A;  4A2A A;  3U3G A;  2GWK A;  4F2S A;  2QWP A;  1SS6 A;  3DRS A;  2XO7 A;  1TL3 A;  3WNH A;  1G15 A;  2GX9 A;  3CCL N;  5AR0 A;  4DR3 K;  3KJV A;  1NGF A;  3TTC A;  5AQQ A;  4JHD B;  2W42 A;  4K0K K;  5JMV A;  1D5A A;  5F0X A;  1WBD A;  1S1U A;  3A2F A;  3FFI A;  1KC8 O;  1IBL K;  2UU9 K;  3ZT0 A;  1HPZ A;  4IJA A;  2IS3 A;  3FZF A;  2E1Z A;  2CGL A;  1FW6 A;  4KTZ A;  5JS2 A;  4YOR A;  5AQU A;  4CEQ A;  3OA9 A;  4LF4 K;  3N4P A;  5CZ1 A;  1LV5 A;  4BRM A;  1V4T A;  4E7K A;  3KD1 E;  5AJ3 K;  2E6L A;  1KCF A;  4JI1 K;  3T1H K;  4ZTF A;  4XH1 A;  4AHT A;  1RTH A;  3MEE A;  1JLQ A;  4I2Q A;  3THW A;  4G9Z A;  3K5N A;  2R7Y A;  1L3V A;  4BRC A;  2HND A;  4C8O A;  4B9T A;  5JS1 A;  4ISF A;  1BI4 A;  1U2V B;  1JKH A;  5JLF A;  4DR2 K;  1A5V A;  1ZYQ A;  2G8H A;  1JXE A;  2X74 A;  4LF8 K;  4CF2 A;  3LM2 A;  4FJM A;  1ATR A;  1IKV A;  4O5B A;  2BDP A;  2QEX N;  1FKP A;  2B5J A;  4BGB A;  1HJO A;  2EWS A;  2ETJ A;  4FJG A;  4QS9 A;  3QEP A;  3EEQ A;  3PO5 A;  4FJ8 A;  4H4O A;  1VSE A;  5AZI B;  4CJQ A;  4E89 A;  3G6E N;  1N5Y A;  2P9I B;  3IAY A;  3R9P A;  1GLB G;  3LDN A;  2QWQ A;  1HRH A;  3THX A;  3WXK A;  1LWE A;  3KLE A;  4CJ5 A;  4JI7 K;  3HOT A;  3L3V A;  3AO2 A;  2YNF A;  3SJH A;  2NNW A;  1HQE A;  1T6C A;  1VQ6 N;  4XIU A;  4FJH A;  2KLA A;  5SWM A;  3AVH A;  4B9Q A;  2WFB A;  3DRR A;  1WSG A;  3PSF A;  4OPH A;  3VA0 A;  2CH6 A;  2HBL A;  1WNS A;  1KQS M;  2Z1I A;  3NAE A;  3OVN A;  3VQA A;  1P90 A;  1Q7Y O;  1K6Y A;  3M3Z A;  3LPU A;  3TWH A;  4DR5 K;  4EZ9 A;  3HP6 A;  1OH7 A;  3E9O A;  3GG4 A;  3KIO A;  4IZ9 A;  5M1P A;  3I8B A;  4J8F A;  1RDW X;  3S3O A;  1G99 A;  1RBV A;  4CJE A;  1U04 A;  1RBU A;  4DTU A;  1SL1 A;  2G8F A;  3HST B;  5K14 A;  3DXK A;  3H1V X;  2E20 A;  4K43 A;  3VGL A;  2YHY A;  4YOY A;  3I0S A;  3KLF A;  4DSK A;  4JI6 K;  1H1V A;  4M41 A;  4CJT A;  1OKJ A;  4E19 A;  4YY3 K;  1YF5 L;  4Y0W A;  2Z1H A;  3ITH A;  3P4I A;  2A41 A;  4FOI A;  4DFJ A;  1VQK N;  1CXU A;  3LAK A;  2X78 A;  4CJW A;  4FWK A;  3WT0 A;  1NBW A;  3AAP A;  2UUC K;  3DMJ A;  4CZJ A;  3ATU A;  4AHU A;  4FM1 A;  1NOY A;  4C1N K;  5AQP A;  3A5O C;  1JLF A;  5BN8 A;  3W0L A;  5AQZ A;  2PY5 A;  1RCH A;  1J5O A;  5IT9 O;  4U7B A;  2VYP A;  4CFC A;  3VQC A;  4B1W B;  4DV3 K;  1HNV A;  4DTX A;  3ZET A;  2KTQ A;  3CFR A;  1C0M A;  4H8K A;  1M90 O;  5HBM A;  4FW2 A;  2Y1J A;  1VQP N;  3NH0 A;  3OYN A;  4OO1 J;  4K8X A;  2AA4 A;  1EP4 A;  5FDL A;  4BRH A;  4CHZ A;  1IV0 A;  4CF9 A;  1VQM N;  1VSM A;  4CEE A;  4FJX A;  4WQ4 C;  1RTD A;  3PLA A;  3DRP A;  4BRN A;  5DM7 L;  1YJW N;  4HCC A;  4Z0U A;  4M3T A;  2HHS A;  3L3U A;  3O3G A;  4K25 A;  5TKY A;  4CD3 A;  4CHO A;  4CEF A;  3O9Q A;  3KWI A;  2GUP A;  2HNZ A;  1MWM A;  4E1M A;  3S3M A;  4H0V B;  3FLC O;  1KTQ A;  3IFR A;  3RMB A;  4X65 K;  4JS4 A;  3DJC A;  3KK3 A;  5C2F A;  3EY1 A;  5FRM A;  3MN6 A;  1HKB A;  4M3Y A;  4CFB A;  5KGX A;  3PV8 A;  1OVQ A;  2ATQ A;  1BG3 A;  1X3N A;  2D4W A;  4JLH A;  4H0T B;  1HNI A;  1Y97 A;  1NGI A;  5BPL A;  3EYZ A;  3AO4 A;  3HP9 A;  2G8V A;  4M3R A;  3HK2 A;  1U6Z A;  3DXM B;  3PUF A;  3WXL A;  3VEZ A;  1OH8 A;  4FLZ A;  1GLF O;  1YTU A;  2HHV A;  4FWN A;  1ILY A;  3AVL A;  4BQZ A;  2D0C A;  3MN7 A;  3NH1 A;  3CCE N;  1GLJ O;  4KRE A;  3T1Y K;  4KPY A;  3RMC A;  4DB3 A;  3Q7C A;  2VG6 A;  4JAX A;  5C15 A;  4LFC K;  1JLG A;  3LDL A;  4OVL A;  2XY5 A;  3SPY A;  3F5T A;  2E4L A;  3FGU A;  1BCO A;  5C25 A;  5A2Q O;  3QNN A;  1TKZ A;  3U9Z A;  1RBT A;  3CC4 N;  2DFF A;  3KKR A;  3J80 O;  4EHU A;  1WAF A;  5AQM A;  2AJQ A;  2IAJ A;  3LP3 A;  2PFU A;  3RTV A;  3RR8 A;  1REV A;  5KPR A;  2B4J A;  4JKA A;  1X3M A;  2ZJR L;  3VQ9 A;  5M1N A;  4DLG A;  3P31 A;  3MCP A;  5CE3 A;  1TL1 A;  2Z1G A;  4DSE A;  4FJ7 A;  3C7N B;  2A6A A;  2P9P B;  2YKN A;  3SQ4 A;  2OAN A;  4CD1 A;  2Q3S A;  3OYK A;  3SQ0 A;  5KQD A;  3LWL A;  2BE2 A;  1QVG M;  1HNX K;  3K58 A;  2Z1J A;  3B6P A;  3O4W A;  4KHW A;  4FVM A;  4AF1 A;  2QKB A;  4M7Y A;  1ASU A;  1RDB A;  1JLE A;  3MAQ A;  4CK1 A;  2OTJ N;  2UUB K;  4KH4 A;  3VQD A;  2NZT A;  3WEE A;  3H3O B;  3OHR A;  5AQX A;  1K73 O;  3C6T A;  1MWK A;  5AZJ A;  1TK5 A;  3CFP A;  4LD0 A;  2YNH A;  4A57 A;  3WNG A;  4DQR A;  3CME N;  4DTN A;  4FWM A;  4NXM K;  4JI2 K;  2E6M A;  3CPW M;  3LDQ A;  4Z4C A;  3SCX A;  4M3X A;  3BF1 A;  5DK5 A;  3NDK A;  4GKK K;  4DSJ A;  3NFA A;  5KQ8 A;  3OBY A;  4DQP A;  2GTD A;  1NGJ A;  4LF6 K;  3TAM A;  1ZBU A;  3DWL A;  5E26 A;  4M3U A;  4FOE A;  2E2P A;  3HYF A;  4OKE A;  4Z4H A;  1GOB A;  4YOU A;  5EU7 A;  3UKU A;  3O5B A;  2X6S A;  4DQI A;  4MDB A;  3DLB A;  4H0Y B;  4B3T K;  4RW6 A;  1XMO K;  3CCU N;  3QNO A;  3QO9 A;  4BC5 A;  4B1Y B;  5FRN A;  4WE1 A;  1S22 A;  3HM8 A;  3O08 A;  4IG3 A;  3ZLJ A;  1YIJ N;  1K9M O;  2IOC A;  4KHU A;  2HNY A;  4E7L A;  3V1R A;  3VQB A;  3VA3 A;  3UKR A;  4RWT A;  4B8A B;  2IVO A;  5JLH A;  1BCM A;  1RT2 A;  2I5J A;  4DTJ A;  1KLN A;  4FLU A;  5EY4 A;  4BAC A;  3VQ6 A;  4CIG A;  4PWD A;  1BIZ A;  4I9L A;  1EET A;  1B92 A;  4H5V A;  4FLW A;  4JK7 A;  3ZYY X;  2IVP A;  1L3T A;  1KVC A;  4OKJ A;  2PZS A;  3L2W A;  4QAG A;  3U6F A;  3C6H A;  1E4G T;  3LP2 A;  4CES A;  1KAY A;  1XUP O;  3SAF A;  2BAN A;  1NK7 A;  3O6W A;  1BUP A;  4BR2 A;  1QQN A;  4YOT A;  2Y1I A;  1JCE A;  2WOM A;  5GAE P;  4RW7 A;  2W6K A;  3RSE B;  1KD1 O;  3TSQ A;  1HUX A;  3QML A;  2WON A;  4CJR A;  3M8P A;  1KSP A;  5CR4 A;  4JD2 A;  4DMN A;  2HHH K;  3V4I A;  1XQS C;  1WB9 A;  3ZEU B;  3ZSQ A;  3T19 A;  1J9A A;  4I7F A;  1BO5 O;  4WFB L;  4GVE A;  4CED A;  3M1F A;  2HBM A;  1YAG A;  3V1O A;  2D1K A;  3TTF A;  5FLX O;  4KHP K;  1NWK A;  1K8K A;  1WSI A;  4CHY A;  4HVJ A;  1RTJ A;  2FBY A;  5BRH A;  3SAG A;  1B9F A;  4K41 A;  4EAH D;  4IJN A;  4DU1 A;  4CIE A;  4J2D A;  1XWL A;  4MDA A;  1YXQ A;  2FSJ A;  3ZT3 A;  2V7Z A;  3WUH A;  1R0A A;  4B9V A;  2NRT A;  4JYA K;  4JK8 A;  4KH5 A;  3GOI A;  2Q97 A;  3C6U A;  2HHW A;  4ICL A;  3TAG A;  5AQY A;  4DF4 A;  2O8F A;  2O4I A;  4V19 S;  3E66 A;  4OKK A;  3CPE A;  3C6A A;  5LMU K;  3SPZ A;  1T03 A;  2KZZ A;  2NLX A;  3EE9 A;  4C8N A;  1IBM K;  5I9E B;  3NF7 A;  1S1W A;  4CGI A;  5BRE A;  3J7Y P;  2WTU A;  4W5N A;  3T1A A;  3MWP A;  5H1S Q;  1QZ5 A;  3K9J A;  3EKS A;  1HYV A;  5M1K A;  4IBN A;  4H03 B;  3E9L A;  3H1Q A;  1W7A A;  1T3V A;  2XY7 A;  1WSH A;  5AQF A;  1IKY A;  2Q1N A;  4PL7 A;  3AO1 A;  3WQU A;  1T05 A;  2G8U A;  5HOO A;  1HNZ K;  4DS5 A;  1MDU B;  1I39 A;  4IFE A;  2KQ2 A;  4LF7 K;  3M6G A;  4B3S K;  2A3Z A;  1TK8 A;  3OYD A;  3AVB A;  1GLA G;  1DTQ A;  1HR0 K;  3DLR A;  4CK3 A;  1C1A A;  4LSN A;  4DQS A;  2PYJ A;  3WXI A;  3H08 A;  3LPT A;  1ATS A;  4HTU A;  3O3H A;  1VQO N;  4LH5 A;  4BR4 A;  3AO5 A;  1NGB A;  3NH2 A;  3LP0 A;  2YV0 X;  1TK0 A;  4Q5V A;  2OZS A;  3QER A;  4C8L A;  4BC3 A;  4B1X B;  3HVT A;  1YHQ N;  2P1J A;  4C1N I;  4FM2 A;  4B9L A;  1RIL A;  3D2F A;  1ZBL A;  2FF3 B;  1QSS A;  4FXD A;  4ID5 A;  4B9U A;  3D2E B;  1IKW A;  2O8C B;  4IEI A;  2O8B A;  2P9L B;  2V52 B;  2OA8 A;  3ZX0 A;  4JKD A;  2P9N A;  4IOC L;  4YDU C;  4BR7 A;  4E7I A;  4A5B A;  1NKE A;  4I6M A;  4E7J A;  2OTL N;  4DR6 K;  4CGF A;  3JAM O;  5AQT A;  1BI4 B;  3CIP A;  3P1G A;  3LAL A;  1Q9X A;  2O8E B;  2PBD A;  4H0P A;  4M3Z A;  3O1B A;  4ID1 A;  2B6A A;  3U8X A;  3TPQ A;  3JYT A;  1WSE A;  3EE8 A;  3NGY A;  3P39 A;  3KLH A;  3O4Q A;  4BRE A;  4JNE A;  4LSL A;  3HPH A;  4DV5 K;  1UOC A;  2W41 A;  1XMQ K;  4DR7 K;  1W9H A;  3C65 A;  4FJJ A;  1IG9 A;  4EP4 A;  3MEC A;  3QB0 A;  3LDP A;  5F1X A;  1KVA A;  3ZSR A;  3MX5 A;  1NMN A;  3IDH A;  5GAH P;  2CGJ A;  1TAQ A;  2RHK A;  1YVU A;  2YNI A;  3QEW A;  1CXQ A;  4AQY K;  4WQ5 C;  2QXF A;  3AVN A;  2WC9 A;  1J54 A;  4CEB A;  5FRO A;  1NK5 A;  1NMD A;  4I9Q A;  1LW0 A;  4KHN A;  1TYQ A;  4HUE A;  1JL2 A;  1RFQ A;  3G71 N;  4B3R K;  3AGR A;  2YJF A;  1RNH A;  2HBJ A;  1GLD G;  4CFD A;  5J2N A;  4OLA A;  4DQ8 A;  4CCH A;  4DV1 K;  2QKK A;  3V9X A;  2HF3 A;  4IDH A;  4Z94 A;  3VQP A;  4CJU A;  1J6Z A;  4OJR A;  1NGG A;  3DXK B;  2RF2 A;  1U2V A;  1BU6 O;  2E88 A;  3E01 A;  4ELU A;  4BQL A;  3OYF A;  4XH4 A;  5HRR A;  4DV0 K;  1SKR A;  3AA2 A;  3C94 A;  3V9W A;  1DT9 A;  5BR8 K;  5J2Q A;  2KHO A;  2O4G A;  5AZI A;  3F9M A;  2P9I A;  4O44 A;  2VQE K;  4K42 A;  5GAD P;  1X1P A;  4CBU A;  4R5P A;  3CCQ N;  4FCY A;  4DS4 A;  2RE2 A;  3KWG A;  1UAX A;  4BRI A;  4BE1 A;  3FFK B;  5M1O A;  1N33 K;  2VG5 A;  3AAR A;  3CD6 N;  5JVG L;  1L5U A;  4FZY A;  1DKG D;  1NGA A;  3PX4 A;  4IWV A;  1A5X A;  1IH7 A;  4CEA A;  3HVR A;  3L2V A;  3MX2 A;  2Q36 A;  3W3D A;  5B8H A;  2QWL A;  3NF8 A;  3FZM A;  1QHA A;  1U49 A;  1QSL A;  2W6L A;  4IO9 L;  2HVH A;  5M1Q A;  1TAU A;  3ULE A;  4F3O A;  1YVN A;  3AY9 A;  1QTM A;  3LP1 A;  2RPI A;  3KTQ A;  3HXM A;  2VWB A;  4FZZ A;  2QA4 N;  3VGK A;  3R8E A;  2HMP A;  3L2U A;  4CE9 A;  4CEC A;  3VER A;  2ZJP L;  3J7Z O;  1XHX A;  2KFZ A;  3OW2 M;  4LF9 K;  3K57 A;  1BGX T;  2IVN A;  3SBT A;  4F9O A;  3OYL A;  5AQR A;  3VET A;  4OX9 K;  1NK9 A;  2E2O A;  1BDG A;  3OBW A;  3JSM A;  4FL9 A;  4KV8 A;  1VSK A;  3SUO A;  2YHA A;  2YX6 A;  2XHB A;  3I8D A;  1DEJ A;  4BWM A;  2JLE A;  1A5W A;  2P9S B;  3NHG A;  5AQI A;  3D0P A;  5KTQ A;  4BDY A;  4GV9 A;  1WUA A;  1TV6 A;  4NCG A;  1Z26 A;  2UYT A;  3TAQ A;  4A5A A;  3S3N A;  3HRG A;  5AQW A;  1JLC A;  4FLT A;  5AQH A;  3MK6 A;  1HKC A;  1L3S A;  1Q9Y A;  4JRP A;  2QM1 A;  2EHG A;  4H4M A;  3OTO K;  4FZX C;  4QCL A;  1YTA A;  1Z05 A;  2UUA K;  2OPS A;  3RR7 A;  1LAV A;  3SMP A;  3MWT A;  4NYN A;  4BR0 A;  2F7T A;  3KK1 A;  3QET A;  1CLQ A;  1NK6 A;  2QK9 A;  3LDO A;  4B8C A;  5CHI A;  4DFK A;  1VQL N;  3VF6 A;  1I3A A;  3TAE A;  1T44 A;  3KVG A;  4MLE A;  4JI0 K;  4N47 A;  4OGE A;  4FJI A;  4IO8 A;  5AFU H;  4O0I A;  1BIS A;  3AVG A;  3CJ1 A;  4YNQ A;  1VSF A;  4CF0 A;  4CGJ A;  2VQF K;  4MQ3 A;  3K59 A;  1XNR K;  4BE0 A;  4FJN A;  2VWJ A;  4JKE A;  3AVI A;  2JGU A;  3ZCM A;  1L3U A;  5DMR A;  2KZM A;  1EO1 A;  4FSV A;  2HW3 A;  1FK9 A;  1VSI A;  4NLC A;  3HJF A;  4GNI A;  2WUS A;  5EX5 A;  4BR5 A;  1VAZ A;  3H45 C;  3ASM A;  4BDZ A;  4OGC A;  1QSY A;  4BR9 A;  1X9J A;  5LJW A;  3VEN A;  2BH1 A;  2NUB A;  1JXB A;  2ITM A;  4CZE A;  2RN2 A;  3CQX A;  2KW4 A;  3U3Y A;  3R1X A;  4ISG A;  1NJZ A;  4W5O A;  2ZE2 A;  5IWA K;  3B6O A;  5HP1 A;  5AQG A;  2GEM A;  4IG0 A;  3T7Z A;  3DXM A;  1WSJ A;  4FJL A;  3WEE B;  4DV6 K;  1NK8 A;  1JLA A;  4KH6 A;  1TKT A;  1RT4 A;  2VGM A;  4PKI A;  1SZ2 A;  5AQV A;  4YOV A;  4RW8 A;  1JLB A;  3M8Q A;  4BRA A;  1TKD A;  5JIC A;  3SUQ A;  2E1Y A;  1FJG K;  4N5S A;  1BQM A;  2OPR A;  3CCJ N;  1TVR A;  2ZD1 A;  3PIP L;  4GV6 A;  3GBT A;  2CGK A;  1TUU A;  1QQO A;  2I7N A;  2IC3 A;  4FLV A;  3AA3 A;  1S1T A;  5AQN A;  3HTV A;  5LJV A;  4CBW A;  3AA5 X;  3ATV A;  4JS5 A;  3RRG A;  1GLE G;  4JKG B;  1XC9 A;  4EHT A;  3KK2 A;  2F4V K;  1C6V A;  4AH9 A;  4PA1 A;  3M5R A;  2IDO A;  3OYE A;  4BG8 A;  4DSI A;  1XC3 A;  4HTL A;  3DOL A;  1BHL A;  4AHV A;  4C23 A;  1S6Q A;  3C7N A;  2P9P A;  1C1C A;  4QS8 A;  1CZB A;  2P9U B;  1YI2 N;  2YKM A;  1IJJ A;  4CHP A;  1E3M A;  4NXN K;  3LAM A;  4IOX A;  3BP8 A;  3VOV A;  5ADX A;  3F73 A;  5C12 A;  1VSH A;  3NF9 A;  4CFA A;  2HB5 A;  3TU5 A;  4DCH A;  1UA0 A;  3SJJ A;  4CF8 A;  4A61 A;  3NGI A;  1XHZ A;  1TKX A;  2YI1 A;  3NCI A;  3KD5 E;  1E4F T;  4KTQ A;  3HOS A;  3DLL L;  1EKE A;  4CJV A;  5HRN A;  3P5J A;  2GV9 A;  1U4B A;  3ULD A;  3G10 A;  4OLB A;  4X64 K;  1ATN A;  3ZSY A;  1NGH A;  1VQ5 N;  1NGD A;  4B9S A;  1RGI A;  4FK2 A;  2ASP A;  1SAZ A;  3AVJ A;  1VRT A;  3SYZ A;  1WOQ A;  1XNQ K;  3J7A P;  4N76 A;  4B3O A;  4H5T A;  4JI8 K;  4UY8 O;  4JKC A;  3DLK A;  4PKH A;  2HF4 A;  1Q18 A;  3O9R A;  1EQY A;  1VQN N;  1ZXO A;  1EXQ A;  1LOT B;  2D0A A;  4E7H A;  3GE1 A;  2HOE A;  1LCU A;  4B08 A;  1XI1 A;  4WQ5 A;  5T7B A;  4E1N A;  4HUF A;  4E1J A;  3SAH A;  3O3F A;  1VK0 A;  2F9T A;  2HVI A;  2F8S A;  3THV A;  2FSK A;  3WNF A;  5MLC Q;  3C0B A;  4HHT A;  3SUP A;  3QIN A;  4GVM A;  1GOA A;  4NCB A;  4O8U A;  1QE1 A;  2ASO A;  2XRI A;  3A8Y A;  3OYA A;  3O8M A;  4Z4G A;  4KKO A;  4B1V A;  1VQ7 N;  4BVO A;  1QZ6 A;  2BTF A;  3VQ7 A;  3ZT2 A;  5SZT A;  2HBK A;  4CBX A;  3FZH A;  2NRV A;  4KHY A;  5GAG P;  3HM9 A;  2O8D B;  3CQ8 A;  4KHQ A;  3THY B;  4DTM A;  1KFD A;  3HL8 A;  4CHQ A;  1GOC A;  4PKG A;  4B9N A;  4CER A;  1ZBS A;  2G8W A;  3KLI A;  1RDA A;  2P9K B;  3PIO L;  1HMV A;  1NK0 A;  1X9M A;  2ZJQ L;  3L2R A;  4BRK A;  1D9F A;  2OPP A;  4CZL A;  3VQ5 A;  1C0G A;  3K2P A;  1NKC A;  4BC4 A;  3ZSO A;  4W5T A;  2F9W A;  1GLL O;  3RSE A;  1DTT A;  3G0Z A;  3D6R A;  3M8S A;  1Z25 A;  4YFU A;  3VEV A;  5HLF A;  2D0P A;  2XY8 A;  4Y1C A;  1VSD A;  1K8A O;  3I56 N;  4O0J A;  4O8K A;  3ZEU A;  1S1V A;  2OZM A;  1RBR A;  4BRO A;  2VWK A;  3CM5 A;  3SMS A;  2QW9 A;  4KO0 A;  4ELT A;  2Q31 A;  1VRU A;  2A1S A;  4KAZ A;  3ID8 A;  4UQG A;  1S1X A;  5D3G A;  1C0U A;  3VF2 A;  3T69 A;  1RT3 A;  5GIN A;  1N6Q A;  3ZT4 A;  5E41 A;  4FPB A;  1TUY A;  3TAF A;  1NJI O;  2YHB A;  5J2P A;  4H5R A;  4ISE A;  3EN9 A;  3ENO A;  3SLC A;  3TAR A;  3LM9 A;  2NRW A;  3CJ9 A;  2ASM A;  3CJB A;  4AHR A;  3TAP A;  5HRP A;  1QHT A;  3VF4 A;  4CZG A;  3MN9 A;  4B3M K;  3DLG A;  3DLE A;  1LWF A;  3KK7 A;  4CZK A;  5LY3 A;  3CET A;  1RDD A;  4WQ4 A;  4JK9 A;  4G1Q A;  2FLO A;  4C8M A;  4CJ3 A;  3AVA A;  1HKG A;  2I7P A;  5GIP A;  2GWJ A;  2FBT A;  3JS6 A;  3HT3 A;  3FR0 A;  3QIP A;  2OCE A;  4DFM A;  2NRR A;  2FF6 A;  1RDC A;  5BPN A;  1JL1 A;  4W5Q A;  4O4G A;  4B9M A;  4DWI A;  4CGH A;  1NJX A;  2PAV A;  4JN4 A;  1W0H A;  2E2Q A;  4ELV A;  1HNW K;  4BRD A;  4RW4 A;  3BGR A;  4FK0 A;  4KI6 A;  3V9Z A;  4CW7 B;  3THW B;  2P51 A;  4F4K A;  3R3L A;  4BY9 C;  4A2B A;  5LL6 Z;  4JI3 K;  4J2E A;  3BDP A;  4MO5 A;  4CEZ A;  1D4X A;  1R59 O;  2DPN A;  4AHS A;  1KAZ A;  1NGE A;  3MXM A;  3QEV A;  3HSC A;  4WF9 L;  3MCA B;  4DV4 K;  5HRS A;  3MED A;  4DR4 K;  1KAX A;  4AHC A;  4AM6 A;  3QFU A;  3V9U A;  3CJC A;  3QFP A;  2VCP A;  3DI6 A;  3ENH A;  1IO2 A;  4CZH A;  4DF8 A;  3CG7 A;  4AIL C;  3WQT A;  5CZ2 A;  1T8E A;  1RT5 A;  3TSP A;  2ZM6 K;  3CER A;  4DTR A;  4W5R A;  2BGG A;  5FPE A;  1ESV A;  3RMA A;  3LZJ A;  3I0R A;  4ILH A;  1VHX A;  4QS7 A;  1T6D A;  1S6P A;  2DTU A;  3H6E A;  1EX4 A;  4KRF A;  3RMD A;  4QOZ B;  4ZTJ A;  1TYQ B;  4DUY K;  4WCE L;  3THX B;  1SKS A;  2Q0R A;  1N32 K;  3D2E A;  2O8C A;  1N36 K;  3QES A;  2P9L A;  1RT7 A;  5AQS A;  1VSL A;  4I2P A;  2PYL A;  4N56 A;  2FSN A;  4JHD A;  4H0X B;  1HYZ A;  5HL7 L;  4BE2 A;  3OS2 A;  3OYH A;  1FKO A;  3H3N O;  3VEW A;  4A59 A;  3SBG A;  4ZHR A;  4O5F A;  4C8K A;  2ZF5 O;  4BC2 A;  3SZ2 A;  4CJS A;  1KVB A;  2ZWH A;  4CJK A;  1CZ9 A;  1SKW A;  4CHN A;  5TKW A;  2O8E A;  3KLG A;  4YOX A;  1ZC6 A;  3S9H A;  4NCA A;  1NOZ A;  1NLV A;  2HHQ A;  2E8A A;  3S41 A;  1WLJ A;  3EO3 A;  1NGC A;  5BR9 A;  4FWO A;  3IS9 A;  3QLH A;  5BRF A;  1BA0 A;  3CC2 N;  4M42 A;  4CK2 A;  1C0F A;  2F96 A;  3CJ7 A;  2BUP A;  4FWL A;  4CZF A;  1N8R O;  3SQ2 A;  5AFU A;  2LSN A;  1KXP A;  1IKX A;  4YOW A;  4IOA L;  2V51 B;  3VQ8 A;  4B1Z A;  4DFP A;  3P83 D;  5C24 A;  3VN5 A;  4ILG B;  3L0Q A;  1X9W A;  1VSJ A;  1C1B A;  2OPQ A;  3ULE B;  5J2M A;  2XY6 A;  2P5O A;  3CCS N;  3OYC A;  4Y1D A;  5ELZ A;  1QS4 A;  3VQQ A;  3HI0 A;  5BN9 A;  1CZA N;  4MFB A;  4JRQ A;  1SL0 A;  4FWQ A;  3V1Q A;  2ZGZ A;  3QIC A;  1NM1 A;  4BVP A;  2AP1 A;  2Q0U A;  3O9T A;  4E0D A;  3OYB A;  5FPD A;  1HX1 A;  1DLO A;  2YHW A;  4O55 A;  2G8I A;  4BRQ A;  4RCH A;  2HHX A;  1S5J A;  3GDQ A;  4OPJ A;  1ZBH A;  3ZET B;  4DLE A;  1VQ4 N;  3AGK A;  5KRT A;  1W2B M;  3ZSW A;  2ITG A;  3NBP A;  3MEG A;  4X66 K;  3ALY A;  5EOY A;  5HRO A;  3O80 A;  3U4L A;  3A5N C;  4PL8 A;  4X62 K;  3H46 O;  3AA4 A;  3WXJ A;  3OYG A;  3PO4 A;  1HJR A;  1Q86 O;  3BZC A;  3CHW A;  4J2A A;  1ZBI A;  5DM6 L;  2VGN A;  4JI5 K;  4CJL A; 
#chains in the Genus database with same CATH homology
 3ZT0 A;  1HPZ A;  3HPO A;  2IS3 A;  1WSI A;  3SNN A;  4CHY A;  4HVJ A;  2IC3 A;  1RTJ A;  4KTZ A;  2FBY A;  4FLV A;  3AA3 A;  1S1T A;  5JS2 A;  4CEQ A;  2F8T A;  5CZ1 A;  1LV5 A;  4E7K A;  3AA5 X;  3KD1 E;  2FBX A;  2E6L A;  4DTS A;  1Q8I A;  4JS5 A;  1B9F A;  1KCF A;  1RT1 A;  1S9G A;  3RRG A;  2GUI A;  3MXJ A;  3SI6 A;  4DU1 A;  4CIE A;  1XC9 A;  4J2D A;  1XWL A;  4ZTF A;  4AHT A;  1KFS A;  3VQ4 A;  3ZT3 A;  1RTH A;  3MEE A;  1JLQ A;  3KK2 A;  4I2Q A;  1R0A A;  4B9V A;  2KFN A;  1C6V A;  4AH9 A;  2RKI A;  2OYQ A;  3K5N A;  2R7Y A;  4PA1 A;  2IDO A;  3OYE A;  3LDS A;  1L3V A;  4DSI A;  2HND A;  5I42 A;  4C8O A;  4B9T A;  5JS1 A;  3OS0 A;  3C6U A;  4Z4I A;  3DOL A;  1BI4 A;  1BHL A;  1JKH A;  2HHW A;  4ICL A;  4AHV A;  3TAG A;  1A5V A;  1S6Q A;  1ZYQ A;  1JXE A;  2G8H A;  4DF4 A;  1C1C A;  2X74 A;  3CM6 A;  1CZB A;  3D45 A;  4Z4F A;  4CF2 A;  2YKM A;  3TAN A;  4CHP A;  4FJM A;  2HMI A;  2O4I A;  4L8R B;  1IKV A;  1WAJ A;  3LAM A;  4O5B A;  2BDP A;  3F73 A;  1FKP A;  2B5J A;  4KB1 A;  3AVC A;  1VSH A;  4OKK A;  2DY4 A;  2ETJ A;  4FJG A;  3QEP A;  1O1W A;  3PO5 A;  4FJ8 A;  1BL3 A;  3NF9 A;  4CFA A;  3SPZ A;  2HB5 A;  1T03 A;  4H4O A;  2KZZ A;  1UA0 A;  1VSE A;  4CJQ A;  4E89 A;  1N5Y A;  3SJJ A;  4CF8 A;  3IAY A;  3NGI A;  4C8N A;  1XHZ A;  1TKX A;  3KD5 E;  3NCI A;  3NF7 A;  1S1W A;  4KTQ A;  4CGI A;  1ITG A;  1HRH A;  3OYI A;  2DFE A;  4W5N A;  1LWE A;  1EKE A;  3KLE A;  4CJV A;  3T1A A;  4CJ5 A;  5HRN A;  4E3S A;  3L3V A;  2G8K A;  3P5J A;  3AO2 A;  2GV9 A;  1U4B A;  1B9D A;  2YNF A;  3ULD A;  3G10 A;  4OLB A;  1HYV A;  3PX6 A;  4IBN A;  1HQE A;  4XIU A;  3CFO A;  3ZSY A;  2XY7 A;  4FJH A;  1WSH A;  4KTW A;  1IKY A;  4B9S A;  5SWM A;  4FK2 A;  3AO1 A;  1LW2 A;  3AVH A;  1T05 A;  2G8U A;  3AVJ A;  3DRR A;  4DS5 A;  1VRT A;  1WSG A;  3SYZ A;  1I39 A;  3VA0 A;  4N76 A;  1QQC A;  2KQ2 A;  3K5M A;  4F3T A;  4B3O A;  1WNS A;  2Z1I A;  3NAE A;  3K5O A;  1TK8 A;  2FBV A;  4EP5 A;  3DLK A;  3OYD A;  3OVN A;  3VQA A;  3AVB A;  4CIF A;  1DTQ A;  1J53 A;  1LWC A;  3DLR A;  3TI0 A;  4CK3 A;  1C1A A;  1HQU A;  1K6Y A;  4LSN A;  4DQS A;  1S9E A;  3LPU A;  3TWH A;  2PYJ A;  4EZ9 A;  3HP6 A;  5KI6 A;  1EXQ A;  2D0A A;  3H08 A;  3KIO A;  4E7H A;  3LPT A;  1SL2 A;  4B08 A;  4HTU A;  1XI1 A;  2YNG A;  3S3O A;  3O3H A;  4LH5 A;  5T7B A;  3AO5 A;  3NH2 A;  3LP0 A;  1RBV A;  1RT6 A;  2YV0 X;  1RBS A;  1U04 A;  4CJE A;  4E1N A;  1RBU A;  4Q5V A;  4HUF A;  3QER A;  4CJ4 A;  4DTU A;  4C8L A;  1SL1 A;  3HVT A;  4DTP A;  3MXI A;  2G8F A;  3UIQ A;  2P1J A;  3O3F A;  3HST B;  1VK0 A;  2HVI A;  5K14 A;  4FJK A;  2F8S A;  3THV A;  4FM2 A;  4B9L A;  4F2R A;  1RIL A;  3WNF A;  1ZBL A;  2X6N A;  4HHT A;  3QEI A;  1QSS A;  3SUP A;  3QIN A;  4GVM A;  3L8B A;  3I0S A;  3KLF A;  1GOA A;  3V81 A;  4ID5 A;  4RW9 A;  4B9U A;  4DSK A;  4NCB A;  4FXD A;  1IKW A;  1QE1 A;  4M41 A;  2XRI A;  3C95 A;  4CJT A;  1U45 A;  4E19 A;  2OA8 A;  3OYA A;  4Z4G A;  4CJP A;  2Z1H A;  4KFB A;  4KKO A;  3ITH A;  4E7I A;  4CEO A;  1BQN A;  1NKE A;  4E7J A;  4DFJ A;  3VQ7 A;  1CXU A;  3LAK A;  4CGF A;  3ZT2 A;  1WSF A;  5SZT A;  2X78 A;  4CJW A;  4KHY A;  1BI4 B;  3P1G A;  3HM9 A;  4KHS A;  3SQ1 A;  3LAL A;  3CQ8 A;  3SV3 A;  4KHQ A;  3SV4 A;  1Q9X A;  4DTM A;  1KFD A;  3HL8 A;  3DMJ A;  3L2Q A;  4AHU A;  4FM1 A;  1NOY A;  3ZSX A;  1GOC A;  4CHQ A;  4KI4 A;  4M3Z A;  4B9N A;  4CER A;  1JLF A;  4ID1 A;  2B6A A;  4M3W A;  2G8W A;  3KLI A;  1RDA A;  2DFH A;  3DLH A;  1HMV A;  3JYT A;  1X9M A;  1NK0 A;  1RCH A;  2PY5 A;  1J5O A;  1WSE A;  3L2R A;  3NGY A;  1D9F A;  2OPP A;  4CFC A;  3VQC A;  3VQ5 A;  3KLH A;  4DSL A;  3O4Q A;  3K2P A;  1HNV A;  1TGO A;  3AVM A;  3ZSO A;  4DTX A;  1NKC A;  4W5T A;  4Z4E A;  2KTQ A;  4FLX A;  3CFR A;  4LSL A;  1C0M A;  3HPH A;  4DSF A;  1UOC A;  4HUG A;  4H8K A;  5HBM A;  4PY5 A;  1DTT A;  4FW2 A;  1W9H A;  3G0Z A;  5J1E A;  3M8S A;  2Y1J A;  1Z25 A;  3NH0 A;  4YFU A;  5CYM A;  3OYN A;  1IG9 A;  4FJJ A;  4EP4 A;  3MEC A;  5HLF A;  2GBZ A;  4K8X A;  1EP4 A;  4IDK A;  2XY8 A;  5FDL A;  4CHZ A;  4CF9 A;  4Y1C A;  1VSD A;  1VSM A;  1C0T A;  4CEE A;  4FJX A;  1KVA A;  4O0J A;  3ZSR A;  1RTD A;  1S1V A;  3DRP A;  2OZM A;  1RBR A;  4BDP A;  1TAQ A;  1ZBF A;  1YVU A;  4HCC A;  2VWK A;  2YNI A;  4Z0U A;  3QEW A;  1SUQ A;  4M3T A;  4LH4 A;  3L3U A;  1CXQ A;  3O3G A;  3V6D A;  2VG7 A;  3CM5 A;  4DU3 A;  2HHS A;  3LZI A;  4KO0 A;  3DM2 A;  2QXF A;  4ELT A;  3AVN A;  1J54 A;  4CHO A;  4CEF A;  2A1R A;  4CEB A;  1VRU A;  2A1S A;  5FRO A;  4IFY A;  1NK5 A;  1LAW A;  4KAZ A;  4UQG A;  1S1X A;  4I9Q A;  3EZ5 A;  1LW0 A;  1NJY A;  5D3G A;  4KHN A;  2HNZ A;  2P5G A;  4E1M A;  1U47 A;  1C0U A;  1JL2 A;  4HUE A;  3S3M A;  1RT3 A;  1N6Q A;  3ZT4 A;  1KTQ A;  1RNH A;  5E41 A;  4CFD A;  4FLY A;  1NK4 A;  3RMB A;  4JS4 A;  3KKS A;  5J2N A;  4OLA A;  3TAF A;  4CCH A;  2YHB A;  4GW6 A;  3KK3 A;  5J2P A;  3EY1 A;  4IKF A;  4CGG A;  5FRM A;  4DQQ A;  2QKK A;  4K8Z A;  4DG1 A;  1MU2 A;  1U48 A;  3CYM A;  2D5R A;  4M3Y A;  4CFB A;  3V9X A;  5KGX A;  3TAR A;  3PV8 A;  4BWJ A;  2ATQ A;  1F21 A;  3VQP A;  4CJU A;  3T3F A;  1KRP A;  4JLH A;  1HNI A;  4AHR A;  4OJR A;  3TAP A;  5HRP A;  1Y97 A;  1QHT A;  3EYZ A;  3AO4 A;  3HP9 A;  3ISN C;  2G8V A;  4M3R A;  2RF2 A;  3DLG A;  1LWF A;  3DLE A;  2OZS A;  3HK2 A;  1RTI A;  3AVF A;  3E01 A;  3PUF A;  1RDD A;  4N41 A;  4ELU A;  3OYF A;  4G1Q A;  2D0B A;  4C8M A;  3OS1 A;  4FLZ A;  3V9S A;  1YTU A;  2HHV A;  4CJ3 A;  5HRR A;  3AVL A;  2D0C A;  2ZQB A;  3AVA A;  1ASV A;  3F9K A;  3AA2 A;  1WN7 A;  1SKR A;  3C94 A;  3V9W A;  3NH1 A;  3PY8 A;  3OYJ A;  2FBT A;  5J2Q A;  3HT3 A;  4KRE A;  3QIP A;  1D9D A;  1BIU A;  4DFM A;  2O4G A;  4KPY A;  3RMC A;  4F8R A;  2VG6 A;  4O44 A;  1RDC A;  4EZ6 A;  4R5P A;  1X1P A;  1JL1 A;  4FCY A;  5KGW A;  4W5Q A;  4DS4 A;  4O4G A;  1JLG A;  4OVL A;  4CGH A;  4B9M A;  2XY5 A;  4DWI A;  3LWM A;  1UAX A;  4BE1 A;  3SPY A;  2VG5 A;  1NKB A;  2E4L A;  1NJX A;  1L5U A;  4FZY A;  5C25 A;  1BCO A;  3PX4 A;  1NJW A;  1A5X A;  1IH7 A;  4CEA A;  3HVR A;  3QNN A;  1TKZ A;  5CY4 A;  3L2V A;  1W0H A;  1SV5 A;  4ELV A;  1RBT A;  2DFF A;  3K5L A;  3KKR A;  3ZSV A;  4M45 A;  4RW4 A;  1WAF A;  3BGR A;  3NF8 A;  4FK0 A;  1UA1 A;  4KI6 A;  3HO1 A;  2AJQ A;  2IAJ A;  3LP3 A;  3V9Z A;  4HCB A;  3RTV A;  1U49 A;  1QSL A;  3RR8 A;  1REV A;  1ASW A;  2HHT A;  2P51 A;  3NF6 A;  2HVH A;  4J2B A;  2B4J A;  4F4K A;  1TAU A;  4F3O A;  1QTM A;  3LP1 A;  1TK0 A;  2RPI A;  4J2E A;  2FC0 A;  3O4N A;  3VQ9 A;  3BDP A;  3KTQ A;  3HXM A;  4NYF A;  4CEZ A;  4DLG A;  4Q0B A;  4FZZ A;  4AHS A;  1TL1 A;  3QEX A;  2Z1G A;  4DSE A;  3MXM A;  4FJ7 A;  1YT3 A;  3L2U A;  2YKN A;  4CE9 A;  4CEC A;  3QEV A;  3SQ4 A;  4CJF A;  2Q3S A;  5HRS A;  3MED A;  3OYK A;  3SQ0 A;  1XHX A;  4AHC A;  2KFZ A;  3K57 A;  3OJS A;  4FJ5 A;  3LWL A;  2BE2 A;  3V9U A;  1BGX T;  4PQU A;  3DI6 A;  3K58 A;  3OYL A;  1IO2 A;  4DF8 A;  4FK4 A;  3CG7 A;  4AIL C;  2Z1J A;  3B6P A;  5CZ2 A;  3IRX A;  1T8E A;  1RT5 A;  4DTR A;  1NK9 A;  4KHW A;  2BGG A;  4W5R A;  3JSM A;  3RMA A;  1FXX A;  3LZJ A;  3I0R A;  5CYQ A;  3RWU A;  4CGD A;  4OPK A;  4FVM A;  4KV8 A;  3TR8 A;  2QKB A;  1S6P A;  2DTU A;  1ASU A;  1EX4 A;  1RDB A;  1JLE A;  3MAQ A;  4KRF A;  4CF1 A;  3RMD A;  4QOZ B;  4CK1 A;  1VSK A;  4ZTJ A;  4FYD A;  3SUO A;  2YHA A;  1D8Y A;  1SKS A;  3VQD A;  2XHB A;  3I8D A;  4FJ9 A;  3C6T A;  4BWM A;  3VQE A;  3QES A;  2JLE A;  1TK5 A;  3CFP A;  1A5W A;  1RT7 A;  3NHG A;  4LD0 A;  3D0P A;  2YNH A;  5KTQ A;  3OY9 A;  4BDY A;  4DTO A;  3WNG A;  1VSL A;  4I2P A;  4CJL A;  2PYL A;  4N56 A;  4DQR A;  1TV6 A;  4NCG A;  1HYZ A;  1Z26 A;  4BE2 A;  3TAQ A;  4DTN A;  3OS2 A;  3OYH A;  1FKO A;  2E6M A;  2HHU A;  3S3N A;  3NE6 A;  4Z4C A;  3SCX A;  4M3X A;  1JLC A;  4ZHR A;  5DK5 A;  4FLT A;  4DU4 A;  4C8K A;  3NDK A;  1T7P A;  3SZ2 A;  4DSJ A;  3WNE A;  1L3S A;  4CJS A;  1KVB A;  3NFA A;  4JRP A;  5I3U A;  1X9S A;  1Q9Y A;  4DQP A;  4CJK A;  1CZ9 A;  3M8R A;  1SKW A;  4CHN A;  2EHG A;  3TAM A;  4H4M A;  1ZBU A;  3KLG A;  4FM0 A;  4M3U A;  4FZX C;  4NCA A;  3S9H A;  2EX3 A;  1NOZ A;  3AO3 A;  3HYF A;  4OKE A;  1YTA A;  4Z4H A;  4TSX A;  4QCL A;  1GOB A;  2OPS A;  3RR7 A;  1LAV A;  3LAN A;  2HHQ A;  4NYN A;  5EU7 A;  3PX0 A;  3RRH A;  2X6S A;  4DQI A;  1WLJ A;  3DLB A;  3KK1 A;  3QET A;  5KRS A;  4GMJ B;  4RW6 A;  3ZSZ A;  1NK6 A;  1CLQ A;  1HYS A;  2QK9 A;  4RG8 A;  4DFK A;  4B8C A;  3QNO A;  3IS9 A;  3QO9 A;  3QLH A;  5FRN A;  3DOK A;  1I3A A;  4WE1 A;  3TAE A;  4KB0 A;  4IG3 A;  4M42 A;  4N47 A;  4CK2 A;  2IOC A;  2F96 A;  4OGE A;  4FJI A;  3SQ2 A;  4KHU A;  4O0I A;  1KLM A;  1BIS A;  3AVG A;  2HNY A;  2LSN A;  4YNQ A;  1VSF A;  4E7L A;  4CF0 A;  1IKX A;  3V1R A;  3VQB A;  4CGJ A;  3VA3 A;  4MQ3 A;  4B8A B;  3K59 A;  3VQ8 A;  3ZT1 A;  4BE0 A;  4DFP A;  4FJN A;  2VWJ A;  4IFV A;  3P83 D;  5C24 A;  3VN5 A;  3AVI A;  2JGU A;  3ZCM A;  1L3U A;  1BCM A;  1RT2 A;  2I5J A;  5DMR A;  4DTJ A;  2KZM A;  1X9W A;  1KLN A;  4FLU A;  1VSJ A;  2HW3 A;  1C1B A;  2OPQ A;  5J2M A;  2XY6 A;  4BAC A;  2P5O A;  3VQ6 A;  1FK9 A;  3OYC A;  4CIG A;  4Y1D A;  4PWD A;  1VSI A;  1BIZ A;  3AVK A;  3HJF A;  3NGZ A;  4I9L A;  3DYA A;  1QS4 A;  3VQQ A;  1EET A;  1B92 A;  3QIO A;  4FLW A;  4MFB A;  4LY7 A;  4JRQ A;  3ASM A;  1SL0 A;  4BDZ A;  3V1Q A;  3AV9 A;  3OJU A;  1L3T A;  3TAB A;  4OGC A;  1QSY A;  1KVC A;  3IG1 A;  1UWB A;  4OKJ A;  2PZS A;  4E0D A;  3L2W A;  3OYB A;  4FW1 A;  4QAG A;  3U6F A;  3SUN A;  3V1O A;  1DLO A;  2NUB A;  4O55 A;  1JXB A;  3LP2 A;  4CES A;  3HPG A;  3OYM A;  2G8I A;  2HHX A;  1S5J A;  2RN2 A;  4OPJ A;  2BAN A;  2KW4 A;  1ZBH A;  2IGI A;  1NK7 A;  3U3Y A;  1NJZ A;  4W5O A;  2ZE2 A;  4DLE A;  2Y1I A;  2WOM A;  4PUO A;  3B6O A;  5C42 A;  5KRT A;  5HP1 A;  4IG0 A;  4RW7 A;  3U3G A;  3ZSW A;  4F2S A;  2ITG A;  3NBP A;  3DRS A;  2XO7 A;  1WSJ A;  2WON A;  1TL3 A;  3ALY A;  3MEG A;  3M8P A;  4CJR A;  5HRO A;  3WNH A;  1NK8 A;  1JLA A;  4FJL A;  1G15 A;  1KSP A;  1TKT A;  1RT4 A;  4DMN A;  3V4I A;  3AA4 A;  3ZSQ A;  3KJV A;  3OYG A;  3T19 A;  3PO4 A;  4RW8 A;  1JLB A;  1J9A A;  1HJR A;  4I7F A;  4J2A A;  2W42 A;  1ZBI A;  3M8Q A;  1TKD A;  1D5A A;  4CED A;  3SUQ A;  1S1U A;  3A2F A;  4N5S A;  1BQM A;  3FFI A;  2OPR A;  1TVR A;  2ZD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...