1J53A

Structure of the n-terminal exonuclease domain of the epsilon subunit of e.coli dna polymerase iii at ph 8.5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
174
structure length
174
Chain Sequence
RQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase III, epsilon chain
publication title Structural Basis for Proofreading during Replication of the Escherichia coli Chromosome
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 58
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1j53A00
3RMCA 1L3UA 1HNIA 1S5JA 3SJJA 4ELTA 3C6UA 4W5QA 1HPZA 1SKWA 2EX3A 4ZTJA 1TKZA 5C25A 4IDKA 2HVIA 1CXQA 3IG1A 3DM2A 3A2FA 4OJRA 1BQNA 3KLFA 5HRNA 3HSTB 3ZT2A 3QNNA 3SQ2A 4NYFA 4AH9A 4XIUA 4ELVA 1RDAA 3CM5A 3D45A 2FBTA 1KLMA 4I2PA 4H8KA 4AHRA 4JS4A 2IS3A 4I9QA 4J2AA 2HMIA 1FXXA 3WNGA 2R7YA 3S3OA 3I0RA 1BL3A 2YNFA 2G8UA 4FVMA 4BWMA 2RF2A 3NAEA 1D9DA 3HK2A 1REVA 1NJXA 3PUFA 3M8QA 4W5RA 3TAQA 2KW4A 3AVAA 4DMNA 4CHPA 1KCFA 5CZ2A 3O3HA 3NH0A 2WONA 3V9XA 1D9FA 2OPPA 3VQEA 4FM0A 3LZJA 3EYZA 4DSEA 3MECA 3RRGA 3QEVA 4DQRA 1JLAA 4FW1A 4FZZA 1EXQA 3TANA 1Q9XA 3DLGA 4DU4A 2VWKA 4DF8A 4C8OA 2Z1HA 1A5XA 3VQAA 3OS2A 3OYAA 3HPGA 2DTUA 3ZT1A 1NOYA 3VA3A 4KRFA 3DLBA 4CJ5A 4FZXC 3OYJA 4K8XA 1TKDA 1IKWA 1RBTA 3DI6A 4H4OA 3ALYA 1L3SA 4DTNA 1IH7A 3OYHA 3PO5A 1WN7A 2B6AA 2D5RA 3AVBA 3ISNC 3MEEA 2HHTA 2DY4A 1EP4A 1NK7A 1TK8A 3P1GA 4FJMA 4B3OA 3NE6A 4GVMA 3KK3A 3ZSZA 4YFUA 3KK1A 3B6OA 3OJSA 5KGXA 3HM9A 2XY5A 1N5YA 3SQ1A 1QSSA 1RTIA 5C24A 2P5OA 1TAQA 3AO4A 4Y1DA 2ETJA 2HNZA 3V9UA 1UA1A 4O0JA 3UIQA 4RW7A 4CJKA 4M42A 4NCGA 1L5UA 2EHGA 1BI4A 1A5WA 4DFKA 1NJZA 4KI6A 3ITHA 3NF7A 3OYBA 4CEEA 3OYCA 2YHAA 3AO3A 3BGRA 4IFYA 3TABA 3TAPA 3PY8A 3ZSWA 1JLQA 4CJWA 3NGZA 4Q5VA 2X6SA 4EZ9A 3AVKA 1QHTA 4CEAA 4FJ8A 3NF6A 3SV3A 4B9NA 1IKVA 1SL1A 2P5GA 3KD1E 4QOZB 5J2MA 1I3AA 4N5SA 1SKRA 3CFRA 4DU1A 4FM2A 4DTSA 3CFPA 5FRMA 2BGGA 3SNNA 2Z1GA 3RTVA 4DQPA 1JXBA 2PY5A 1JLGA 1XI1A 2G8VA 4B9LA 4CJFA 4YNQA 3KJVA 3LZIA 2G8IA 5HRPA 5T7BA 5SZTA 1RT7A 4KFBA 2G8HA 4CIFA 4JS5A 1S1UA 3TAGA 1QSYA 5D3GA 1HYZA 3PO4A 2KTQA 3NF9A 3L2UA 2ITGA 4CIEA 3PX4A 1U48A 1BISA 4O0IA 1RCHA 3S3NA 4KHSA 3WNEA 3V9ZA 3LP3A 4ELUA 1C0TA 2IGIA 1UWBA 3AA4A 1F21A 3DMJA 3C94A 1C1BA 2YKMA 4CJLA 2E4LA 5E41A 1RDCA 2XY8A 4ID1A 3ZT3A 1Q9YA 1FKPA 1RT2A 1JKHA 2KQ2A 2D0AA 2G8KA 3DRRA 3DRPA 4ZHRA 4BACA 1KFDA 3NBPA 4BDYA 1U47A 1C1CA 3PX6A 2IC3A 4TSXA 3RMAA 4CFAA 2D0BA 3AO1A 5HROA 1U49A 4KHUA 2I5JA 1D8YA 3S9HA 1XC9A 5DMRA 3NH1A 1U04A 4CHOA 3MXMA 1ZBFA 1B9FA 3SPYA 3SYZA 1VSKA 1QTMA 4ID5A 4Z4IA 1C0UA 4KKOA 1U45A 3DLKA 2HHUA 3CQ8A 4CJRA 4FXDA 4FJIA 4FLZA 4B9UA 4Z0UA 2FC0A 4E3SA 1BQMA 3DLEA 3KLEA 4HCCA 1HYVA 4M3YA 4M3ZA 1S1TA 4KREA 1NOZA 4JRPA 3F9KA 2YV0X 5CYMA 2HHXA 3F73A 4AHVA 4CGIA 4F4KA 1JL1A 1FK9A 4LSLA 3K5MA 4F3TA 4KV8A 4KHYA 3AVIA 2VG5A 1XWLA 5KRSA 3OYDA 1LWCA 4CFCA 1T7PA 4CEZA 4PUOA 3ZSOA 4FK2A 4CEOA 4KHQA 2PYJA 2HHQA 4OPJA 4FJGA 5HLFA 1DTTA 3DLRA 4FLUA 5HP1A 4KI4A 3VA0A 3P5JA 1NK0A 5K14A 4IBNA 4DWIA 2D0CA 1IKYA 1X9SA 1NKBA 1TL3A 3TAMA 4QCLA 2YHBA 1NK5A 1C1AA 1RTDA 4KTZA 3ZT4A 2QKKA 2QK9A 4PWDA 4CGGA 1TGOA 4BDZA 3E01A 1DTQA 3AVCA 5CZ1A 4EP4A 3K59A 4CIGA 4CJEA 2RN2A 4ZTFA 4DSFA 3V4IA 4AHUA 5JS1A 2ATQA 1BIUA 4HUEA 4DLGA 1JLBA 4OGEA 2YNHA 2OPRA 4FLWA 3RRHA 2HW3A 2HHSA 4DQIA 3KIOA 4OKEA 1GOCA 1A5VA 1VRTA 3AA2A 4E7JA 1YTUA 4FCYA 4CHYA 1BCOA 4GMJB 3LDSA 2GV9A 2O4GA 3AVGA 3V1RA 4CE9A 1HRHA 3G0ZA 5CY4A 3TAEA 4LD0A 4FW2A 3HP6A 3T3FA 1RT1A 3O4QA 1LAWA 4NYNA 2DFEA 3VQ4A 1IG9A 3BDPA 4FZYA 2XHBA 3V9WA 3TI0A 2QXFA 1S1WA 3C6TA 4ICLA 4F8RA 1JLFA 1NJYA 1CZBA 1QE1A 4Q0BA 4H4MA 1NK8A 3LWMA 3RR7A 3MEDA 2W42A 4Z4EA 4Y1CA 4N47A 3I8DA 1UOCA 4CGDA 3DOKA 4B9MA 2WOMA 1SKSA 1WSIA 3V1OA 4I9LA 3QEWA 3G10A 3PV8A 3NF8A 1BI4B 3LPUA 4FJ9A 2OPSA 5I42A 1KVAA 2GUIA 2RPIA 4RW4A 4RG8A 4M3TA 3HT3A 2Y1IA 1N6QA 4FK0A 5HBMA 2BANA 4G1QA 4EP5A 2OA8A 1LW0A 3V81A 1KSPA 4DQSA 4CGFA 3QESA 3KLHA 4CFDA 4J2DA 1HQUA 4CEBA 3QINA 1W0HA 3VQ7A 3OS1A 1WSHA 2A1RA 1LW2A 3K58A 1L3TA 3I0SA 1YTAA 3SCXA 4RW8A 3HJFA 2XY6A 3AVMA 1RDBA 3QERA 3AVLA 1BCMA 3OYMA 3KTQA 2HVHA 3KKRA 5KI6A 4DG1A 2X6NA 3VQDA 1ASVA 4RW6A 1R0AA 1S9EA 3FFIA 5KTQA 1NK4A 1S6PA 2A1SA 2JGUA 2IDOA 3T1AA 4DSLA 1JL2A 4Z4HA 1J54A 3KLIA 3PX0A 1NK6A 3H08A 1TL1A 2HHVA 2HNDA 4NCAA 3HP9A 3QEPA 4KHNA 3OYKA 5J2PA 1CXUA 1SL0A 3T19A 3O3GA 3AVFA 2JLEA 4M3RA 4OVLA 4E7HA 3V6DA 2XO7A 4DU3A 4R5PA 4CEQA 4DSKA 1ZBHA 1D5AA 1ZYQA 3RWUA 4CJUA 4FK4A 1HQEA 2HB5A 2LSNA 2VG7A 4CJVA 3OYLA 1VK0A 3CM6A 4C8MA 1XHXA 3EZ5A 4DLEA 2HNYA 4E7IA 4AHCA 1X9MA 1RT3A 4J2BA 3C95A 4CEDA 3VQQA 1HYSA 1JLCA 1VSMA 4KB0A 4CHNA 3AA3A 3LAKA 4CEFA 2PZSA 4JRQA 1TKTA 2P1JA 2YNGA 3QEIA 1RT5A 3KD5E 1VSEA 2PYLA 1O1WA 1BHLA 4FJXA 1KVCA 3VQCA 2OYQA 1YT3A 1RBUA 2OZMA 1ZBIA 5KGWA 3KKSA 4DTMA 4CF1A 3AV9A 1CLQA 4DQQA 1VSJA 4N56A 3ASMA 2X74A 4HUFA 1W9HA 3JSMA 5J2NA 4IG3A 3SQ4A 2B5JA 1RTJA 1SL2A 3LWLA 1S1XA 4E19A 3V9SA 3K5LA 4W5NA 1S1VA 1S9GA 1YVUA 4FJJA 3HXMA 3VQ9A 4RW9A 4FLYA 3NGYA 4DTUA 4CECA 3L2WA 3AVHA 4KTWA 3TAFA 1KLNA 1WSJA 5I3UA 1QSLA 3LALA 3LP1A 4CERA 2FBVA 1XHZA 4KO0A 4CF2A 4E7KA 4DFMA 3OYEA 3M8SA 4LSNA 3K5NA 3ULDA 3RMDA 2XRIA 4DTOA 3L2VA 4Z4CA 4EZ6A 3MEGA 1TV6A 3CYMA 4KPYA 1RT4A 4C8NA 3NFAA 3WNFA 4CGHA 3DYAA 5EU7A 4HTUA 2KZZA 4CFBA 4E89A 4W5TA 3SUOA 1UAXA 2AJQA 1KRPA 2FBXA 1WLJA 2RKIA 3NDKA 4E1MA 2G8WA 3K2PA 3K57A 3NCIA 2OZSA 4FJKA 4OLBA 3OYGA 1BGXT 2ZD1A 1RTHA 4MFBA 4OGCA 3ZSXA 4HVJA 4DTJA 4FJLA 1QQCA 4IFVA 5HRSA 1G15A 3O3FA 3SV4A 3IS9A 3SUQA 4F2SA 1I39A 1ITGA 3L3VA 2Z1IA 3B6PA 1RDDA 3LP2A 5FROA 3HL8A 3ZCMA 4AHTA 2E6MA 4W5OA 3K5OA 3OY9A 2F96A 4FJ5A 1FKOA 3VN5A 4F2RA 1U4BA 3VQPA 2KZMA 2KFNA 1VSIA 4K8ZA 3SQ0A 1CZ9A 1IKXA 1RBSA 3U6FA 2BDPA 4FLVA 3MXJA 4B8AB 2Q3SA 4I2QA 1WSGA 3OYIA 4C8KA 3TWHA 4Z4FA 1WSEA 4IG0A 3ZSQA 3EY1A 4HCBA 1HNVA 1Z25A 2FBYA 3TARA 3KK2A 3IRXA 4WE1A 3SZ2A 4CF8A 1HMVA 4B8CA 1MU2A 4O4GA 4CESA 4OPKA 4E1NA 1L3VA 5HRRA 4DFJA 4I7FA 1JLEA 1NKEA 4CF9A 5C42A 3THVA 2IOCA 3MAQA 4B9TA 4FLTA 4FJ7A 4DS4A 4DSJA 4LH5A 1RILA 4OKJA 4DTPA 1X1PA 3U3GA 1RBVA 4CJTA 1T8EA 2G8FA 4DS5A 1WAFA 1IO2A 3ZSYA 2E6LA 3L8BA 2YKNA 3VQ5A 3NGIA 1JXEA 4OKKA 3SI6A 4KHWA 1J9AA 1BIZA 1KTQA 3RMBA 4HUGA 1LV5A 3IAYA 4FJNA 2OPQA 4L8RB 3VQ8A 4IKFA 3QEXA 3SUPA 4C8LA 3D0PA 4LY7A 2B4JA 4MQ3A 4CJPA 3M8PA 2DFFA 1DLOA 3NHGA 3QIOA 2GBZA 3OVNA 4M3XA 1ZBLA 5DK5A 4FLXA 2X78A 3HVRA 2F8TA 2VWJA 3AVJA 1Y97A 4O44A 4BWJA 4DF4A 1ASUA 4B08A 3LANA 3OS0A 4KTQA 5SWMA 2VG6A 4KAZA 1C0MA 3CFOA 4PA1A 3JYTA 1TVRA 1C6VA 1T05A 2ZE2A 4J2EA 2NUBA 1UA0A 1EKEA 3OYFA 2Y1JA 1RT6A 1WNSA 3DOLA 4QAGA 1EX4A 3QIPA 3ZT0A 1ZBUA 4OLAA 3HVTA 4M45A 1VRUA 1GOAA 3M8RA 3HPHA 1NKCA 3ZSRA 4DFPA 1T03A 1LWEA 1TK0A 4O5BA 4CJ3A 4CHQA 1EETA 1KVBA 4DTXA 4GW6A 4BDPA 4CCHA 2HHWA 1TK5A 3WNHA 1SUQA 4AHSA 1QS4A 3TR8A 3AO5A 1ASWA 2QKBA 3LP0A 1Z26A 5JS2A 4Z4GA 1SV5A 4PQUA 3SPZA 4M41A 2XY7A 1VSFA 3HYFA 4CGJA 4JLHA 4FJHA 2KFZA 1TKXA 2ZQBA 3AA5X 3V1QA 1X9WA 3O4NA 4N76A 4M3UA 5J2QA 4CK3A 3QETA 3U3YA 3MXIA 3QLHA 1J5OA 3DLHA 1WSFA 4CJQA 3HPOA 4FYDA 3ZSVA 3S3MA 1GOBA 2P51A 4CF0A 4CJSA 3L3UA 3QNOA 4M3WA 4CK2A 4HHTA 3DRSA 1B9DA 5KRTA 4PY5A 2DFHA 1WAJA 1VSHA 1Q8IA 1NJWA 4NCBA 4DTRA 3AO2A 3KLGA 3SUNA 4B9VA 1B92A 5J1EA 4KB1A 4DSIA 1VSDA 3OJUA 2BE2A 4BE1A 3RR8A 4CJ4A 1K6YA 4UQGA 3L2RA 4AILC 1J53A 3L2QA 4FM1A 3HO1A 1RNHA 3P83D 4O55A 3NH2A 3VQ6A 4CK1A 3VQBA 4BE0A 1S6QA 4LH4A 4B9SA 1LWFA 2F8SA 3OYNA 3LAMA 3AVNA 1NK9A 1RBRA 4E7LA 5FDLA 2IAJA 3LPTA 1LAVA 2YNIA 3QO9A 1HJRA 3CG7A 5CYQA 1TAUA 1KFSA 4N41A 1VSLA 4BE2A 4E0DA 2O4IA 2Z1JA 5FRNA 4F3OA 4CHZA
chains in the Genus database with same CATH superfamily
1L3UA 4YDUC 4B1UB 3C6UA 4W5QA 1SKWA 1YJNN 2HVIA 3IG1A 3SMPA 3LDNA 4OJRA 2P9SA 5EY4A 3VTIA 3SQ2A 4NYFA 2O8DA 3CM5A 3D45A 2FBTA 4I2PA 4H8KA 2W6KA 2IS3A 1YI2N 4J2AA 2HMIA 4FVMA 2RF2A 2P9IB 5JVHL 3M8QA 4FM0A 3LDOA 4DV3K 1JLAA 4BRAA 3HRGA 1Q9XA 3ZT1A 3VA3A 3DLBA 2V7YA 2UUBK 3WUHA 3OYJA 2CGLA 1TKDA 2O8BB 1IKWA 3CC2N 4NXNK 4JD2B 4BR2A 2HHTA 5ADXH 3MEEA 3SAHA 1EP4A 4ISFA 5KGXA 2NRRA 1N5YA 2P9KB 1RTIA 4JAXA 4DQ8A 2P5OA 1TAQA 4Y1DA 2ETJA 3UIQA 3SJHA 4CJKA 4M42A 3ATUA 4BC4A 2EHGA 4DFKA 1L5UA 1NJZA 3OYBA 2E2NA 3OYCA 3BGRA 3NGZA 4QS8A 3SV3A 4B9NA 1IKVA 1SL1A 4QOZB 2E2OA 3MN9A 3CFRA 3QFUA 3R6MA 3SNNA 3MCAB 3THWA 4DQPA 5FRMA 2PY5A 1JLGA 1TYQA 3U4LA 1XI1A 2DPNA 5T7BA 1RT7A 1JCEA 2G8HA 4JV5K 2QTDA 1N34K 3WXLA 3NVKA 4DV5K 1HYZA 3PO4A 1ATRA 1Z6RA 1BISA 4KHSA 5FPEA 5TKWA 4JHDB 2VYPA 1F21A 3CCJN 2YKMA 2F9WA 3ZT3A 2XY8A 4ID1A 1FKPA 4BC2A 4TSXA 3RMAA 4CFAA 2D0BA 4KHUA 2FF6A 5KPZA 3NH1A 3ULEA 1VQ8N 2P9PB 1ZBFA 4BRGA 4WQ4C 3SPYA 1VSKA 2EWSA 5ADXA 3DLKA 3FZKA 3CQ8A 4CJRA 4FLZA 4B9UA 3UE5A 4KREA 1S1TA 3N4QA 3BF1A 2YV0X 3F73A 4CBUA 4F3TA 3AVIA 3OBWA 5KRSA 3ZSOA 4CEOA 4KHQA 2ZM6K 1DTTA 1U2VA 4KI4A 3P5JA 4YOUA 5K14A 1NKBA 1K9MO 2P9LB 5C2FA 2KHOA 4MDAA 4CGGA 1TGOA 4BDZA 3E01A 4EP4A 4CJEA 4H0OA 5DM6L 1BIUA 4K41A 4OGEA 4FLWA 2HW3A 1EO1A 4PKGA 3J80O 4BRIA 3AA2A 5HOOA 4FWQA 4GMJB 3LDSA 2O4GA 1GLCG 4CE9A 5CY4A 3G0ZA 4LD0A 4FW2A 3HP6A 3RSEB 3O4QA 1LAWA 3TTFA 3VQ4A 1IG9A 2XHBA 1VQ7N 3TI0A 1S1WA 4ICLA 4F8RA 1CZBA 4CZKA 1NU0A 3EKSA 4JKHA 4Q0BA 4H4MA 4DUZK 3CJBA 3H3OB 3DOKA 2QWOA 4GV3A 3CXCM 2OTJN 2QWLA 1BI4B 5H1SQ 3LPUA 4RCHA 1Q81O 2GUIA 5HBMA 1QQNA 4EP5A 3THYB 3V81A 3KLHA 4XH4A 2ASPA 2QWQA 3QINA 1IBLK 3K58A 1L3TA 1IBKK 3I0SA 3HJFA 3QERA 3KTQA 5JVGL 3KKRA 1S9EA 5KTQA 3MWTA 2W40A 4YORA 3GBTA 4NCAA 3QEPA 1CXUA 2JLEA 3CCEN 4E7HA 2XO7A 4DU3A 4R5PA 4CEQA 1KAZA 4KHPK 3ZX3A 1XC3A 3MCPA 5AZIA 1VK0A 4GKJK 3EZ5A 1OKJA 4DLEA 4E7IA 1VQLN 3GOIA 4JRQA 1TKTA 3O9TA 1M1KO 1RT5A 3KD5E 4FWPA 4AM6A 1ZBIA 2VQFK 4N56A 1YF5L 2P9UB 3CMEN 5GIOA 5J2NA 2D0OA 1RTJA 3A5LC 1NMNA 2Q2RA 1NGCA 1TUYA 3VQ9A 4FLYA 4DTUA 3VGLA 3AARA 4JKEA 3LP1A 2FBVA 4V19S 4KO0A 4DFMA 3OYEA 4A61A 3K5NA 2O8CB 2E1YA 2P9PA 2GTDA 5GAHP 3L2VA 2KZZA 4C8NA 4CGHA 3O1BA 3WNFA 4E89A 4W5TA 2KLAA 1Y64A 1UAXA 2RKIA 4BGAA 2OZSA 3K57A 4JI8K 3EN9A 3TU5A 4DTJA 4HVJA 3CETA 3SUQA 3SV4A 1G15A 4BRFA 3IS9A 3FZLA 4AM7A 1NLVA 2F9TA 1RDDA 4H0TB 3HL8A 3BZKA 2E6MA 3CCLN 3Q7CA 3VN5A 3MMVA 2KFNA 4B1WB 5AQTA 1IKXA 3ATVA 4FLVA 1WSGA 4PL7A 1H1VA 1WSEA 1E4FT 3ZSQA 3OA9A 3EY1A 1HNVA 1Z25A 2FBYA 1K8AO 3SZ2A 1HKGA 4OPKA 4G9ZA 4DFJA 1EQYA 1JLEA 1NKEA 2IOCA 3MAQA 1KAXA 4J8FA 4FJ7A 2ASOA 2G8FA 2GWJA 2QWMA 1K8KA 1KTQA 4L8RB 4RTFD 4MQ3A 1JCGA 5BRHA 3M8PA 1XMQK 3FZHA 1YJ9N 1DLOA 3OVNA 1FW6A 5DK5A 3HVRA 2VWJA 4DF4A 4B08A 4X65K 3OS0A 4KTQA 4FSVA 4PA1A 1C0MA 1NWKA 1NJIO 3HI0A 2NUBA 1RT6A 3A0IX 3DOLA 4LFBK 3A5OC 3HPHA 4BGBA 1T03A 1TK0A 4O5BA 4CJ3A 4CHQA 1EETA 4DTXA 1NM1A 1QS4A 2ZGYA 5E84A 3LP0A 4A57A 5JS2A 4BR4A 4JYAK 2UXCK 5C0YA 5AJ3K 3CQYA 2ZQBA 1X9WA 3UKUA 4FWNA 2UXBK 3M6GA 5AQPA 3S3MA 4FOEA 3QNOA 3L3UA 3E9LA 4PY5A 3DRSA 4IOXA 1WAJA 1Q8IA 4NCBA 2YHYA 4JKGB 4BRMA 1B92A 4DR3K 4DSIA 3RR8A 3A8YA 3HO1A 3CJCA 3MN7A 5F2RA 4FM1A 3NH2A 3VQ6A 1Z05A 4CK1A 4LH4A 3OYNA 1NK9A 2WFBA 2Q1NA 1BOTO 1LAVA 2YNIA 3CG7A 1KFSA 3AAQA 3AY9A 1VQ6N 2Z1JA 4JKCA 3IUCA 4ELTA 2EX3A 5BPNA 5C25A 4IDKA 4I6MB 3H45C 1VQ4N 1VAZA 3A2FA 1GLEG 3QNNA 2HBLA 3HSTB 4ELVA 2NRXA 3VERA 4WQ5C 1BA0A 1KLMA 4JS4A 1FXXA 3C6AA 2YNFA 5CHIA 3TSUA 3NAEA 3HK2A 1REVA 3H1QA 3O9UA 3PUFA 1D9FA 1HLUA 5CZ2A 3O3HA 4MLHA 4YOYA 4BRCA 2OPPA 3VQEA 1OH5A 4IDHA 3ZEUA 3EYZA 3RRGA 4MDBA 3KVGA 1EXQA 3TANA 5KPRA 3DLGA 4U7BA 3VQAA 3OYAA 4JK9A 1YHQN 4B9QA 1L3SA 4DTNA 1IH7A 3QFPA 2B6AA 5CR4A 3AVBA 5LMNK 4GVMA 3KK3A 3ZSZA 3I8BA 3OJSA 1QSSA 2FXUA 5C24A 4DV0K 3AO4A 1UA1A 4HTLA 1P90A 4RW7A 3H6EA 4KI6A 1A5WA 3ZETB 3ITHA 3C7NB 3AO3A 3PY8A 4LF8K 1WOQA 4CJWA 4Q5VA 3LDPA 2X6SA 4EZ9A 5AQKA 5AQNA 3KHYA 3NF6A 2P5GA 4BVOA 5AQZA 1JXBA 2FF3B 4CJFA 3SBGA 5HRPA 4CZIA 4XH1A 1K73O 4KFBA 1S1UA 3TAGA 1QSYA 2QWRA 4BY9C 2KTQA 2PFUA 1VQPN 2QI2A 4CIEA 2O8FA 2RE2A 4DR4K 1C0TA 2ZJQL 1UWBA 3QMLA 5E41A 5JMVA 1QZ5A 1RT2A 1JKHA 3E9OA 3DRRA 3DRPA 1C1CA 2IC3A 4AQYK 2I5JA 1XC9A 1U04A 1QTMA 1GLJO 4ID5A 3CHWA 3PSIA 4FXDA 5AQOA 3U8XA 2FC0A 4E3SA 3KLEA 5EVZA 3UKRA 1X3NA 1NOZA 3L6QA 3F9KA 2HHXA 4F4KA 1FK9A 3K5MA 3G25A 4DCHA 1T7PA 2IVOA 2PYJA 2HHQA 1HNWK 5HLFA 4FOIA 3DLRA 4H5WA 4FLUA 1HNZK 1BA1A 1NK0A 1KXPA 5AQFA 4DB3A 3LDQA 3TAMA 1NGEA 2QKKA 4NO7A 3WEEB 4PWDA 4IEIA 1MDUB 1R59O 2YHWA 3K59A 1J5EK 5IT9O 3V4IA 5JS1A 5B8HA 3RRHA 3MX2A 3H1VX 2OPRA 3VF2A 3PIPL 4OKEA 1VRTA 3WXMB 2Q36A 1NGGA 1HUXA 3N4PA 1VHXA 3IMXA 2E2PA 5TKYA 5KPTA 1NMDA 3TSPA 3T3FA 5FPDA 4WFNL 2DFEA 3V9WA 4CZGA 1JLFA 3CQXA 5AQYA 1NJYA 1KQSM 1OH8A 1QE1A 3O9RA 3LWMA 3RR7A 2W42A 4OX9K 3I8DA 3CCUN 1GLFO 3T69A 1WSIA 2O8EA 3CPWM 3ID8A 4I9LA 3PV8A 3NF8A 4B3TK 4WYBA 2CH6A 2OPSA 1KVAA 4RW4A 3HT3A 1KSPA 4DQSA 4CFDA 1HQUA 5BREA 4CEBA 3VQ7A 5LJVA 3OS1A 5AQXA 2A3ZA 3MWPA 3J7ZO 3HSCA 3AVLA 1BCMA 5GIPA 2HVHA 5M1PA 5KI6A 4DG1A 2X6NA 4RW6A 1SS6A 3FFIA 3FLCO 2A1SA 4DSLA 2JGUA 1JL2A 5EX5A 4BC5A 4DKWA 1NK6A 1TL1A 2HHVA 2HNDA 3HP9A 3OYKA 5J2PA 1SL0A 5M1OA 4DV7K 4OVLA 3V6DA 3CD6N 4LF7K 2A5XA 1ZBHA 4AF1A 5JLHA 1D5AA 3RWUA 1VQON 2BUPA 4JK8A 4CJUA 4FK4A 1HPMA 2AP1A 1HX1A 2LSNA 3OYLA 4LF4K 3VEVA 3MDQA 1YUWA 1RT3A 3C95A 4EAHD 1JLCA 3AA3A 2NRTA 3LAKA 2PZSA 1FJGK 2P1JA 2YNGA 3QEIA 4WQ5A 2PYLA 4FJXA 1LCUA 4B1YB 3VQCA 2OZMA 2YJEA 1YT3A 3KKSA 5C15A 4CF1A 2V51B 4CZMA 4DQQA 4A2BA 3T1YK 3SQ4A 5A2QO 5BR8K 2B5JA 1SL2A 4W5NA 4E19A 3QICA 3VF6A 3HXMA 4CZJA 5BPMA 3NGYA 1KLNA 4CECA 3TAFA 5I3UA 3LALA 1XHZA 1JCFA 2QA4N 2OTLN 4DTOA 3O1WA 1TV6A 1GLLO 3C0BA 3G71N 1SQKA 1GLBG 1MA9B 4CFBA 3SUOA 2FSKA 2AJQA 2FBXA 4CZHA 3K2PA 3SLCA 1BGXT 2ZD1A 3PIOL 1QQCA 5HRSA 2ZGZA 4F2SA 2QWPA 3HPOA 5IWAK 4PHTX 4DR6K 4CVNE 3K5OA 3M1FA 2F96A 2KZMA 3VOVA 4K8ZA 3FE1A 2FLOA 4DR2K 3SQ0A 1RBSA 2BDPA 4B8AB 2Q3SA 4BRDA 5AFUH 5LY3A 2W41A 4Z4FA 4IG0A 4K43A 2HF4A 4HCBA 3TARA 4DR7K 1QQMA 2P9IA 4WE1A 2UXDK 2V52B 3OTOK 3W3DA 1MU2A 4O4GA 1L3VA 4NXMK 2J4RA 2NRVA 3B8AX 2Q31A 3THVA 3CCMN 5BRFA 2HMPA 3CCRN 4FLTA 3TPQA 4DSJA 4OKJA 3IDHA 1RBVA 1WAFA 1IO2A 2E6LA 3L8BA 1GLDG 4IOAL 3NGIA 3SI6A 1OVQA 3RMBA 5LL6Z 4FJNA 2O8BA 2HSTA 4YY3K 4JD2A 3QEXA 4LY7A 4FL9A 3SK3A 4M3XA 2P9KA 5F0XA 3RVCA 1Y97A 4O44A 2VGNA 5SWMA 2VG6A 3QBXA 4KAZA 3SAFA 3JYTA 1TVRA 1C6VA 1UA0A 3HZ6A 3OYFA 2Y1JA 4QAGA 3QIPA 3VGKA 2I7PA 3M8RA 2NRHA 3ZSRA 5BN9A 4YDUA 1KVBA 2QXLA 4GW6A 1IBMK 4CCHA 3WNHA 4C1NI 1MWKA 4BR5A 4AHSA 3AO5A 3J7AP 3KWGA 1Z26A 4DR1K 4BR9A 3VEYA 1W2BM 1SV5A 3ENBA 5AFUA 3SPZA 4M41A 1ESVA 4FJHA 3F9MA 2HBJA 3AA5X 3V1QA 3O4NA 4PKHA 4BRHA 3QETA 5EXWA 4FYDA 4YHHK 3ZSVA 3ID6A 3VMFB 1RDWX 1YIJN 4JHDA 1OH6A 4B3RK 1T44A 3JAMO 1VSHA 4DTRA 3KLGA 4OPHA 3SUNA 1QHAA 3DXMB 5J1EA 1P8ZA 1S22A 4IWVA 3OJUA 3L2RA 2NNWA 1RNHA 4O55A 3CIPA 1IJJA 3IKMA 2F4VK 4GV6A 3I56N 1RBRA 5FDLA 4WFAL 3A5MC 2HBMA 3QO9A 1HJRA 5CYQA 4FWOA 4E0DA 2O4IA 5FRNA 2ZJPL 1KD1O 3HOSA 3RMCA 3K9JA 1HNIA 1S5JA 3SJJA 5AQMA 1HPZA 4DV4K 1TKZA 5AQIA 4JKFA 1CXQA 4LF9K 4IOCL 1BQNA 3KLFA 3ZT2A 2ZWHA 2OCEA 4AH9A 2GX9A 3LM9A 5C2DA 1RDAA 3VEWA 4BRKA 2P9LA 5C12A 3WNGA 3S3OA 3I0RA 3JS6A 4BVPA 2G8UA 1NJXA 3VTHA 4Z94A 4W5RA 5JICA 1OH7A 3AVAA 1I94K 1KCFA 3V9XA 3VETA 3NH0A 3H3NO 4DSEA 3MECA 1RGIA 4DQRA 2HOEA 4FW1A 4FZZA 3MK6A 4DU4A 4DF8A 3OS2A 1A5XA 2DTUA 3HPGA 1E3MA 3RSEA 4H5NA 1RBTA 3ALYA 1WN7A 2D5RA 3ISNC 2HBKA 1NK7A 3CC7N 4FJMA 3NMUA 4B3OA 3J7YP 3BY5A 3KK1A 3B6OA 2XY5A 3SQ1A 1NGBA 4WQ4A 2E8AA 2HNZA 3V9UA 4O0JA 3DXKB 1BI4A 2P9NB 3KK7A 1N32K 3NF7A 2YHAA 2KKZA 5AQVA 3U9DA 4FWRA 3ZSWA 1JLQA 3E66A 5F1XA 1QVGM 2V7ZA 1JJ2M 4JKBA 3AVKA 1QHTA 3THYA 1HR0K 4FJ8A 3KD1E 2PAVA 1I3AA 4HWIA 1SKRA 4FM2A 4DTSA 3CFPA 3FR0A 2BGGA 1BWFO 3TTDA 2G8VA 4YNQA 3CCVN 3LZIA 4B3SK 5SZTA 4CIFA 3WXJA 3NF9A 3ENHA 1WBBA 3HOTA 3LP3A 2IGIA 3C65A 4CW7B 3DMJA 3C94A 1C1BA 3BP8A 4CJLA 1YJWN 1RDCA 4YOWA 2D0AA 1X3MA 3THXB 4ZHRA 4BACA 3O9SA 1KFDA 4BDYA 1X9JA 5HROA 4H0XB 1D8YA 3S9HA 2NRZA 3MN5A 3MXMA 3DJCA 1B9FA 1V4TA 3FFKB 4Y0WA 3SYZA 4Z4IA 1C0UA 1BG3A 4ILJA 1O13A 4FJIA 1WUAA 4Z0UA 4M3ZA 4M3YA 1HYVA 4JNEA 4GY2B 4JRPA 2CH5A 4AHVA 1JL1A 2P9UA 4KV8A 4CFCA 4PUOA 4FK2A 4OPJA 4JI3K 2P9SB 4F9OA 2UUAK 1KC8O 2WUSA 4MO5A 2O8DB 4JKAA 1TL3A 2UUCK 2O8CA 2YHBA 4OPAA 4H03B 1C1AA 3NVMA 1CZAN 4H0YB 5HL7L 1Q82O 1DTQA 3AVCA 4BQLA 3IFRA 2E2QA 4ZTFA 4AHUA 5AQLA 1DEJA 4BG9A 2QM1A 5GAGP 3KIOA 4JN4A 4E7JA 4DQIA 1T6CA 4KH6A 1BCOA 2GV9A 1HRHA 3TAEA 4GNIA 2Q0RA 3BDPA 2QXFA 3C6TA 4BR7A 4CI6A 4JK7A 4Y1CA 4JI1K 2WOMA 4IJNA 4O5FA 1SKSA 3BF3A 2YCHA 1VQ5N 1IV0A 4FJ9A 4GV9A 5I42A 4M3TA 4FK0A 4FWSA 2A40A 2BANA 4G1QA 3ENOA 4WFBL 3DWLA 4CD3A 5AQSA 3QESA 5I9EB 1W0HA 3THWB 4FVUA 1WSHA 1TYQB 3WXKA 1YTAA 1ZXOA 3AVMA 1RDBA 3OYMA 4K42A 2I7NA 3QBWA 1VQMN 1W7AA 3VQDA 1R0AA 4IXCA 2E20A 2IDOA 3T1AA 1EWRA 2PBDA 2Q97A 3EO3A 4Z4HA 4X66K 3KLIA 3H08A 3E9PA 3VEXA 1YITN 3O3GA 3TTCA 3GDQA 4A5BA 2NLXA 2IVNA 3LM2A 1DT9A 1HQEA 4FWLA 2HB5A 4IFEA 3CM6A 4C8MA 4X64K 4JI2K 4YOVA 2HNYA 4AHCA 3ULEB 1X9MA 4H0PA 4CEDA 1VSMA 4CEFA 4M7YA 1VQNN 4RWTA 3W0LA 5KGWA 4DTMA 3CC4N 3AV9A 1CLQA 1VSJA 1BU6O 1V4SA 4BRLA 5EOYA 4HUFA 1W9HA 3EE9A 4A2AA 5MLCQ 3JSMA 4O8KA 4DUYK 3F2KA 4KH4A 3LWLA 1S1XA 3BZCA 1NGJA 4JEPA 1E4GT 1YVUA 3J8AA 4FJJA 4RW9A 1U2VB 3DAWA 3THXA 3AVHA 4KTWA 3FZMA 1QSLA 4JKGA 4CERA 5BR9A 4CF2A 3FZFA 3F5TA 4LSNA 3D6RA 4DV1K 1T3VA 3RMDA 4B3MK 2XRIA 4Z4CA 4EZ6A 4KPYA 1RT4A 1T6DA 5AQQA 5EU7A 4HTUA 4ISGA 5BPLA 4FWMA 3VEOA 1WLJA 3SBTA 3NDKA 4FJKA 3NCIA 4KBOA 3OYGA 4IEEA 4MFBA 3G6EN 4IFVA 3O3FA 4KB0A 2Z1IA 5FROA 3LP2A 3ZCMA 3OY9A 4FJ5A 5E26A 1FKOA 4I6MA 4F2RA 4B1XB 3VQPA 1DGKN 1VSIA 1CZ9A 3P31A 3U6FA 2A42A 3MXJA 4C8KA 1VQKN 1M90O 3CI5A 3R3LA 4LF5K 3AGRA 3CPEA 4CF8A 5C10A 1N36K 3PSFA 4E1NA 3R9PA 3D2EB 1HNXK 4YOTA 4B9TA 5AZJB 4DS4A 4LH5A 1RILA 2E5LK 4CJTA 1T8EA 4DR5K 4DS5A 1EWQA 4M63C 4H0VB 1JXEA 3K0SA 1QVFM 1LV5A 1XUPO 2OPQA 5FPMA 1J6ZA 3SUPA 4C8LA 2D0PA 3VGMA 3R8EA 4CJPA 3NHGA 4WCEL 4FLXA 2X78A 3AVJA 1ASUA 2VWBA 3LANA 4EHUA 3EEQA 3CFOA 3ZETA 5GAEP 3C7NA 4J2EA 1T05A 2ZE2A 5CE3A 1EKEA 1EX4A 1ZBUA 3HVTA 4M45A 1BUPA 1VRUA 1GOAA 2NZTA 3SMSA 2HHHK 2GELA 3GE1A 5AZIB 2HHWA 2VCPA 3DLLL 1D4XA 1ASWA 5M1NA 4XH5A 3HYFA 4JLHA 5KQDA 2KFZA 1TKXA 4N76A 3S41A 4JI0K 1MWMA 5J2QA 3MXIA 3QLHA 1J5OA 4CJQA 3VF4A 3WQTA 1GOBA 4M7XA 4CF0A 4CJSA 5DM7L 4LFAK 4HHTA 1B9DA 2DFHA 3AO2A 4B9VA 1VSDA 4PL8A 2BE2A 4CJ4A 4AILC 1TUUA 1J53A 3P83D 1C0FA 5M1KA 3D7EO 3VESA 4CD1A 3MX5A 1ILYA 3T1HK 1LWFA 4CZLA 2D4WA 2F8SA 3AVNA 4E7LA 4O8UA 4PKIA 3LDLA 1WB9A 4KH5A 4N41A 2UYTA 2ZJRL 1XQSC 3U9ZA 4LF6K 4CHZA 1NGDA 5FPNA 1IG8A 4ZTJA 4YOXA 4JI6K 3DM2A 3KZBA 2YJFA 5HRNA 3CCSN 4DHYA 4K25A 4XIUA 4AHRA 4I9QA 1WBDA 2R7YA 1BL3A 3WEEA 4BWMA 1D9DA 2GWKA 5FLXO 3TAQA 2KW4A 4BC3A 4DMNA 4CHPA 3SAGA 2WONA 4DV6K 4IJAA 5GADP 3LZJA 4BRPA 3QEVA 3OBYA 3MN6A 2VWKA 5AR0A 4C8OA 2Z1HA 3GL1A 4EIAA 1NOYA 4KRFA 1K8KB 4CJ5A 3CCQN 3M5RA 4FZXC 4K8XA 4BRNA 3DI6A 4H4OA 4K0KK 2RHKA 3PO5A 3OYHA 2DY4A 3CERA 1TK8A 3P1GA 3NE6A 4YFUA 3HM9A 4MO4A 4MLEA 4NCGA 2CGJA 4CEEA 4L3QA 4IFYA 3TABA 3TAPA 3D2EA 4LC9B 3CJ7A 5AZJA 3D2FB 3TSQA 4CEAA 3VEZA 5JLFA 5J2MA 4N5SA 4DU1A 2Z1GA 3RTVA 2E88A 4B9LA 3KJVA 2G8IA 4NB4A 4DV2K 4JS5A 4IZ9A 1QZ6A 4IO8A 5D3GA 3JXUA 4GKKK 2GUPA 3HBTA 3M3ZA 3L2UA 3UKUB 2ITGA 1U48A 3PX4A 1OVYA 4O0IA 1RCHA 5M1FA 3S3NA 3L0QA 2W6LA 3Q7BA 3WNEA 3V9ZA 1HKBA 4ELUA 3AA4A 2E4LA 1Q86O 1LOTB 2KQ2A 2G8KA 3ZX2A 3NBPA 1U47A 1TAUA 3PX6A 1Q9YA 1U49A 1GLAG 3AO1A 3AAPA 4X62K 3KWIA 5DMRA 3P39A 4CHOA 4KKOA 1U45A 2BTFA 5AQGA 2HHUA 4JKDA 4HCCA 1BQMA 3DLEA 4ISEA 1NGIA 2ZF5O 2JWKA 5CYMA 3ZX0A 4CGIA 4H5VA 5AQRA 4LSLA 3CJAA 4CJ7A 4KHYA 1SZ2A 1XWLA 2VG5A 4WF9L 1LWCA 3OYDA 4CEZA 4FJGA 3R1XA 5HP1A 3VA0A 4IBNA 4DWIA 2D0CA 1IKYA 1X9SA 4QCLA 1NK5A 1RFQA 1RTDA 4KTZA 3ZT4A 3L4IA 2QK9A 5LMUK 5CZ1A 2YX6A 4CZEA 4CIGA 2RN2A 4BG8A 4C1NK 2YI1A 4DSFA 2ATQA 3ZEUB 4HUEA 4DLGA 1JLBA 4QS7A 2YNHA 1ATSA 3UB5A 5BN8A 2QW9A 1NNEA 2HHSA 1GOCA 1A5VA 1YTUA 4B1ZA 4FCYA 2A6AA 4CHYA 1N33K 3V1RA 3AVGA 3O6WA 3CMAN 3HM8A 1QQOA 4A5AA 1RT1A 4NYNA 4FZYA 3T7ZA 1NK8A 3MEDA 4Z4EA 4N47A 1UOCA 4CGDA 4B9MA 1U6ZA 3HTVA 3V1OA 3QEWA 3G10A 3O5BA 3QDKA 2Q0UA 2RPIA 4RG8A 2Y1IA 1N6QA 4BQZA 2OA8A 1LW0A 1YAGA 4CGFA 4J2DA 3VPZA 3GG4A 2AA4A 3VENA 4R79A 2A1RA 1LW2A 3SCXA 4RW8A 3O80A 2XY6A 2GEMA 5BRDA 3P4IA 4B1VA 1ASVA 1NK4A 1S6PA 3I55N 3P38A 1J54A 3BUZB 3PX0A 2O8FB 4EHTA 2UU9K 1S3XA 4KHNA 1YXQA 3EZWA 4NLBA 2YHXA 3AVFA 3T19A 4M3RA 2ASMA 3G4SN 3D2FA 4DSKA 1ZYQA 2QEXN 2VG7A 4CJVA 4FPAA 1XHXA 4J2BA 1HYSA 3VQQA 2WBNA 3O9QA 4CHNA 4XEIA 2JWLA 1VSEA 1O1WA 5GINA 1BHLA 1VQ9N 4BREA 3UKRB 1KVCA 2OYQA 1RBUA 4CBWA 3ASMA 2X74A 1Q18A 4IG3A 3O08A 3V9SA 1ZBSA 3K5LA 1S1VA 1S9GA 3L2WA 5ELZA 5AQUA 2WTUA 1DKGD 1WSJA 3DXMA 1NG9A 4E7KA 3M8SA 3ZLJA 3BEXA 1KAYA 3ULDA 1XMOK 3MEGA 3CYMA 3NFAA 3DYAA 2E1ZA 1KRPA 2G8WA 1YVNA 1RDUA 4E1MA 4OLBA 3ZSXA 4FPBA 1RTHA 4OGCA 4FJLA 2H3GX 3QB0A 1I39A 4H5TA 5AQWA 1ITGA 3L3VA 3B6PA 4AHTA 4W5OA 2IVPA 1U4BA 4BROA 4OO1J 3LL3A 4I2QA 3OYIA 1XNQK 3TWHA 3CJ9A 4C23A 2O8EB 2FSJA 3KK2A 3IRXA 2BH1A 1HMVA 4B8CA 4CESA 1BDGA 5HRRA 1ATNA 4I7FA 4CF9A 5C42A 1NGHA 1C0GA 1NBWA 2CGKA 4U67L 4DTPA 1X1PA 1BO5O 3U3GA 4A62A 3OHRA 3O4WA 1SAZA 3ZSYA 1ZC6A 2YKNA 3VQ5A 4OKKA 4ILHA 4KHWA 1J9AA 1BIZA 4HUGA 4GVEA 3IAYA 3VQ8A 4IKFA 4JI4K 3EL2A 3D0PA 3L4QA 2WC9A 2B4JA 2A41A 2DFFA 4CZFA 3QIOA 2GBZA 3CJ1A 1N8RO 1ZBLA 1NGFA 2F8TA 4BWJA 4BRQA 3DXKA 4JI5K 2FSNA 2P9NA 3K9KA 1S72N 4UY8O 2NRWA 1WNSA 3EKUA 3ZT0A 4OLAA 1HJOA 1NKCA 3PLAA 4FO0A 4DFPA 4E1JA 4EFHA 1LWEA 5KQ8A 4BDPA 3J81O 1TK5A 4ILGB 1SUQA 3TR8A 2QKBA 1W97L 2F7TA 3FGUA 4Z4GA 4PQUA 3OW2M 3E1YA 2XY7A 1VSFA 4CGJA 1HKCA 3EE8A 4M3UA 1NGAA 4CK3A 5LJWA 3U3YA 3DLHA 2QWNA 3C6HA 1WSFA 4JI7K 3ZYYX 1G99A 2P51A 5AQJA 5M1QA 2ITMA 4M3WA 1Q7YO 4CK2A 3WQUA 2HF3A 4NLCA 5KRTA 2IIRA 1NJWA 4KB1A 1XNRK 2VGMA 3O8MA 4IO9L 4LFCK 4BE1A 4UQGA 1K6YA 4H5RA 3L2QA 4CBXA 4BR0A 3H46O 3A5NC 4QS9A 3VQBA 1S6QA 3WT0A 4A59A 4FWKA 4BE0A 4B9SA 2VQEK 3LAMA 2D1KA 3AGKA 5AQHA 3I33A 2IAJA 3LPTA 2OANA 3WXIA 1VSLA 4BE2A 3CF5L 4F3OA
chains in the Genus database with same CATH topology
3RMCA 1L3UA 1HNIA 1S5JA 3SJJA 4ELTA 3C6UA 4W5QA 1HPZA 1SKWA 2EX3A 4ZTJA 1TKZA 5C25A 4IDKA 2HVIA 1CXQA 3IG1A 3DM2A 3A2FA 4OJRA 1BQNA 3KLFA 5HRNA 3HSTB 3ZT2A 3QNNA 3SQ2A 4NYFA 4AH9A 4XIUA 4ELVA 1RDAA 3CM5A 3D45A 2FBTA 1KLMA 4I2PA 4H8KA 4AHRA 4JS4A 2IS3A 4I9QA 4J2AA 2HMIA 1FXXA 3WNGA 2R7YA 3S3OA 3I0RA 1BL3A 2YNFA 2G8UA 4FVMA 4BWMA 2RF2A 3NAEA 1D9DA 3HK2A 1REVA 1NJXA 3PUFA 3M8QA 4W5RA 3TAQA 2KW4A 3AVAA 4DMNA 4CHPA 1KCFA 5CZ2A 3O3HA 3NH0A 2WONA 3V9XA 1D9FA 2OPPA 3VQEA 4FM0A 3LZJA 3EYZA 4DSEA 3MECA 3RRGA 3QEVA 4DQRA 1JLAA 4FW1A 4FZZA 1EXQA 3TANA 1Q9XA 3DLGA 4DU4A 2VWKA 4DF8A 4C8OA 2Z1HA 1A5XA 3VQAA 3OS2A 3OYAA 3HPGA 2DTUA 3ZT1A 1NOYA 3VA3A 4KRFA 3DLBA 4CJ5A 4FZXC 3OYJA 4K8XA 1TKDA 1IKWA 1RBTA 3DI6A 4H4OA 3ALYA 1L3SA 4DTNA 1IH7A 3OYHA 3PO5A 1WN7A 2B6AA 2D5RA 3AVBA 3ISNC 3MEEA 2HHTA 2DY4A 1EP4A 1NK7A 1TK8A 3P1GA 4FJMA 4B3OA 3NE6A 4GVMA 3KK3A 3ZSZA 4YFUA 3KK1A 3B6OA 3OJSA 5KGXA 3HM9A 2XY5A 1N5YA 3SQ1A 1QSSA 1RTIA 5C24A 2P5OA 1TAQA 3AO4A 4Y1DA 2ETJA 2HNZA 3V9UA 1UA1A 4O0JA 3UIQA 4RW7A 4CJKA 4M42A 4NCGA 1L5UA 2EHGA 1BI4A 1A5WA 4DFKA 1NJZA 4KI6A 3ITHA 3NF7A 3OYBA 4CEEA 3OYCA 2YHAA 3AO3A 3BGRA 4IFYA 3TABA 3TAPA 3PY8A 3ZSWA 1JLQA 4CJWA 3NGZA 4Q5VA 2X6SA 4EZ9A 3AVKA 1QHTA 4CEAA 4FJ8A 3NF6A 3SV3A 4B9NA 1IKVA 1SL1A 2P5GA 3KD1E 4QOZB 5J2MA 1I3AA 4N5SA 1SKRA 3CFRA 4DU1A 4FM2A 4DTSA 3CFPA 5FRMA 2BGGA 3SNNA 2Z1GA 3RTVA 4DQPA 1JXBA 2PY5A 1JLGA 1XI1A 2G8VA 4B9LA 4CJFA 4YNQA 3KJVA 3LZIA 2G8IA 5HRPA 5T7BA 5SZTA 1RT7A 4KFBA 2G8HA 4CIFA 4JS5A 1S1UA 3TAGA 1QSYA 5D3GA 1HYZA 3PO4A 2KTQA 3NF9A 3L2UA 2ITGA 4CIEA 3PX4A 1U48A 1BISA 4O0IA 1RCHA 3S3NA 4KHSA 3WNEA 3V9ZA 3LP3A 4ELUA 1C0TA 2IGIA 1UWBA 3AA4A 1F21A 3DMJA 3C94A 1C1BA 2YKMA 4CJLA 2E4LA 5E41A 1RDCA 2XY8A 4ID1A 3ZT3A 1Q9YA 1FKPA 1RT2A 1JKHA 2KQ2A 2D0AA 2G8KA 3DRRA 3DRPA 4ZHRA 4BACA 1KFDA 3NBPA 4BDYA 1U47A 1C1CA 3PX6A 2IC3A 4TSXA 3RMAA 4CFAA 2D0BA 3AO1A 5HROA 1U49A 4KHUA 2I5JA 1D8YA 3S9HA 1XC9A 5DMRA 3NH1A 1U04A 4CHOA 3MXMA 1ZBFA 1B9FA 3SPYA 3SYZA 1VSKA 1QTMA 4ID5A 4Z4IA 1C0UA 4KKOA 1U45A 3DLKA 2HHUA 3CQ8A 4CJRA 4FXDA 4FJIA 4FLZA 4B9UA 4Z0UA 2FC0A 4E3SA 1BQMA 3DLEA 3KLEA 4HCCA 1HYVA 4M3YA 4M3ZA 1S1TA 4KREA 1NOZA 4JRPA 3F9KA 2YV0X 5CYMA 2HHXA 3F73A 4AHVA 4CGIA 4F4KA 1JL1A 1FK9A 4LSLA 3K5MA 4F3TA 4KV8A 4KHYA 3AVIA 2VG5A 1XWLA 5KRSA 3OYDA 1LWCA 4CFCA 1T7PA 4CEZA 4PUOA 3ZSOA 4FK2A 4CEOA 4KHQA 2PYJA 2HHQA 4OPJA 4FJGA 5HLFA 1DTTA 3DLRA 4FLUA 5HP1A 4KI4A 3VA0A 3P5JA 1NK0A 5K14A 4IBNA 4DWIA 2D0CA 1IKYA 1X9SA 1NKBA 1TL3A 3TAMA 4QCLA 2YHBA 1NK5A 1C1AA 1RTDA 4KTZA 3ZT4A 2QKKA 2QK9A 4PWDA 4CGGA 1TGOA 4BDZA 3E01A 1DTQA 3AVCA 5CZ1A 4EP4A 3K59A 4CIGA 4CJEA 2RN2A 4ZTFA 4DSFA 3V4IA 4AHUA 5JS1A 2ATQA 1BIUA 4HUEA 4DLGA 1JLBA 4OGEA 2YNHA 2OPRA 4FLWA 3RRHA 2HW3A 2HHSA 4DQIA 3KIOA 4OKEA 1GOCA 1A5VA 1VRTA 3AA2A 4E7JA 1YTUA 4FCYA 4CHYA 1BCOA 4GMJB 3LDSA 2GV9A 2O4GA 3AVGA 3V1RA 4CE9A 1HRHA 3G0ZA 5CY4A 3TAEA 4LD0A 4FW2A 3HP6A 3T3FA 1RT1A 3O4QA 1LAWA 4NYNA 2DFEA 3VQ4A 1IG9A 3BDPA 4FZYA 2XHBA 3V9WA 3TI0A 2QXFA 1S1WA 3C6TA 4ICLA 4F8RA 1JLFA 1NJYA 1CZBA 1QE1A 4Q0BA 4H4MA 1NK8A 3LWMA 3RR7A 3MEDA 2W42A 4Z4EA 4Y1CA 4N47A 3I8DA 1UOCA 4CGDA 3DOKA 4B9MA 2WOMA 1SKSA 1WSIA 3V1OA 4I9LA 3QEWA 3G10A 3PV8A 3NF8A 1BI4B 3LPUA 4FJ9A 2OPSA 5I42A 1KVAA 2GUIA 2RPIA 4RW4A 4RG8A 4M3TA 3HT3A 2Y1IA 1N6QA 4FK0A 5HBMA 2BANA 4G1QA 4EP5A 2OA8A 1LW0A 3V81A 1KSPA 4DQSA 4CGFA 3QESA 3KLHA 4CFDA 4J2DA 1HQUA 4CEBA 3QINA 1W0HA 3VQ7A 3OS1A 1WSHA 2A1RA 1LW2A 3K58A 1L3TA 3I0SA 1YTAA 3SCXA 4RW8A 3HJFA 2XY6A 3AVMA 1RDBA 3QERA 3AVLA 1BCMA 3OYMA 3KTQA 2HVHA 3KKRA 5KI6A 4DG1A 2X6NA 3VQDA 1ASVA 4RW6A 1R0AA 1S9EA 3FFIA 5KTQA 1NK4A 1S6PA 2A1SA 2JGUA 2IDOA 3T1AA 4DSLA 1JL2A 4Z4HA 1J54A 3KLIA 3PX0A 1NK6A 3H08A 1TL1A 2HHVA 2HNDA 4NCAA 3HP9A 3QEPA 4KHNA 3OYKA 5J2PA 1CXUA 1SL0A 3T19A 3O3GA 3AVFA 2JLEA 4M3RA 4OVLA 4E7HA 3V6DA 2XO7A 4DU3A 4R5PA 4CEQA 4DSKA 1ZBHA 1D5AA 1ZYQA 3RWUA 4CJUA 4FK4A 1HQEA 2HB5A 2LSNA 2VG7A 4CJVA 3OYLA 1VK0A 3CM6A 4C8MA 1XHXA 3EZ5A 4DLEA 2HNYA 4E7IA 4AHCA 1X9MA 1RT3A 4J2BA 3C95A 4CEDA 3VQQA 1HYSA 1JLCA 1VSMA 4KB0A 4CHNA 3AA3A 3LAKA 4CEFA 2PZSA 4JRQA 1TKTA 2P1JA 2YNGA 3QEIA 1RT5A 3KD5E 1VSEA 2PYLA 1O1WA 1BHLA 4FJXA 1KVCA 3VQCA 2OYQA 1YT3A 1RBUA 2OZMA 1ZBIA 5KGWA 3KKSA 4DTMA 4CF1A 3AV9A 1CLQA 4DQQA 1VSJA 4N56A 3ASMA 2X74A 4HUFA 1W9HA 3JSMA 5J2NA 4IG3A 3SQ4A 2B5JA 1RTJA 1SL2A 3LWLA 1S1XA 4E19A 3V9SA 3K5LA 4W5NA 1S1VA 1S9GA 1YVUA 4FJJA 3HXMA 3VQ9A 4RW9A 4FLYA 3NGYA 4DTUA 4CECA 3L2WA 3AVHA 4KTWA 3TAFA 1KLNA 1WSJA 5I3UA 1QSLA 3LALA 3LP1A 4CERA 2FBVA 1XHZA 4KO0A 4CF2A 4E7KA 4DFMA 3OYEA 3M8SA 4LSNA 3K5NA 3ULDA 3RMDA 2XRIA 4DTOA 3L2VA 4Z4CA 4EZ6A 3MEGA 1TV6A 3CYMA 4KPYA 1RT4A 4C8NA 3NFAA 3WNFA 4CGHA 3DYAA 5EU7A 4HTUA 2KZZA 4CFBA 4E89A 4W5TA 3SUOA 1UAXA 2AJQA 1KRPA 2FBXA 1WLJA 2RKIA 3NDKA 4E1MA 2G8WA 3K2PA 3K57A 3NCIA 2OZSA 4FJKA 4OLBA 3OYGA 1BGXT 2ZD1A 1RTHA 4MFBA 4OGCA 3ZSXA 4HVJA 4DTJA 4FJLA 1QQCA 4IFVA 5HRSA 1G15A 3O3FA 3SV4A 3IS9A 3SUQA 4F2SA 1I39A 1ITGA 3L3VA 2Z1IA 3B6PA 1RDDA 3LP2A 5FROA 3HL8A 3ZCMA 4AHTA 2E6MA 4W5OA 3K5OA 3OY9A 2F96A 4FJ5A 1FKOA 3VN5A 4F2RA 1U4BA 3VQPA 2KZMA 2KFNA 1VSIA 4K8ZA 3SQ0A 1CZ9A 1IKXA 1RBSA 3U6FA 2BDPA 4FLVA 3MXJA 4B8AB 2Q3SA 4I2QA 1WSGA 3OYIA 4C8KA 3TWHA 4Z4FA 1WSEA 4IG0A 3ZSQA 3EY1A 4HCBA 1HNVA 1Z25A 2FBYA 3TARA 3KK2A 3IRXA 4WE1A 3SZ2A 4CF8A 1HMVA 4B8CA 1MU2A 4O4GA 4CESA 4OPKA 4E1NA 1L3VA 5HRRA 4DFJA 4I7FA 1JLEA 1NKEA 4CF9A 5C42A 3THVA 2IOCA 3MAQA 4B9TA 4FLTA 4FJ7A 4DS4A 4DSJA 4LH5A 1RILA 4OKJA 4DTPA 1X1PA 3U3GA 1RBVA 4CJTA 1T8EA 2G8FA 4DS5A 1WAFA 1IO2A 3ZSYA 2E6LA 3L8BA 2YKNA 3VQ5A 3NGIA 1JXEA 4OKKA 3SI6A 4KHWA 1J9AA 1BIZA 1KTQA 3RMBA 4HUGA 1LV5A 3IAYA 4FJNA 2OPQA 4L8RB 3VQ8A 4IKFA 3QEXA 3SUPA 4C8LA 3D0PA 4LY7A 2B4JA 4MQ3A 4CJPA 3M8PA 2DFFA 1DLOA 3NHGA 3QIOA 2GBZA 3OVNA 4M3XA 1ZBLA 5DK5A 4FLXA 2X78A 3HVRA 2F8TA 2VWJA 3AVJA 1Y97A 4O44A 4BWJA 4DF4A 1ASUA 4B08A 3LANA 3OS0A 4KTQA 5SWMA 2VG6A 4KAZA 1C0MA 3CFOA 4PA1A 3JYTA 1TVRA 1C6VA 1T05A 2ZE2A 4J2EA 2NUBA 1UA0A 1EKEA 3OYFA 2Y1JA 1RT6A 1WNSA 3DOLA 4QAGA 1EX4A 3QIPA 3ZT0A 1ZBUA 4OLAA 3HVTA 4M45A 1VRUA 1GOAA 3M8RA 3HPHA 1NKCA 3ZSRA 4DFPA 1T03A 1LWEA 1TK0A 4O5BA 4CJ3A 4CHQA 1EETA 1KVBA 4DTXA 4GW6A 4BDPA 4CCHA 2HHWA 1TK5A 3WNHA 1SUQA 4AHSA 1QS4A 3TR8A 3AO5A 1ASWA 2QKBA 3LP0A 1Z26A 5JS2A 4Z4GA 1SV5A 4PQUA 3SPZA 4M41A 2XY7A 1VSFA 3HYFA 4CGJA 4JLHA 4FJHA 2KFZA 1TKXA 2ZQBA 3AA5X 3V1QA 1X9WA 3O4NA 4N76A 4M3UA 5J2QA 4CK3A 3QETA 3U3YA 3MXIA 3QLHA 1J5OA 3DLHA 1WSFA 4CJQA 3HPOA 4FYDA 3ZSVA 3S3MA 1GOBA 2P51A 4CF0A 4CJSA 3L3UA 3QNOA 4M3WA 4CK2A 4HHTA 3DRSA 1B9DA 5KRTA 4PY5A 2DFHA 1WAJA 1VSHA 1Q8IA 1NJWA 4NCBA 4DTRA 3AO2A 3KLGA 3SUNA 4B9VA 1B92A 5J1EA 4KB1A 4DSIA 1VSDA 3OJUA 2BE2A 4BE1A 3RR8A 4CJ4A 1K6YA 4UQGA 3L2RA 4AILC 1J53A 3L2QA 4FM1A 3HO1A 1RNHA 3P83D 4O55A 3NH2A 3VQ6A 4CK1A 3VQBA 4BE0A 1S6QA 4LH4A 4B9SA 1LWFA 2F8SA 3OYNA 3LAMA 3AVNA 1NK9A 1RBRA 4E7LA 5FDLA 2IAJA 3LPTA 1LAVA 2YNIA 3QO9A 1HJRA 3CG7A 5CYQA 1TAUA 1KFSA 4N41A 1VSLA 4BE2A 4E0DA 2O4IA 2Z1JA 5FRNA 4F3OA 4CHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMC A;  1L3U A;  1HNI A;  1S5J A;  3SJJ A;  4ELT A;  3C6U A;  4W5Q A;  1HPZ A;  1SKW A;  2EX3 A;  4ZTJ A;  1TKZ A;  5C25 A;  4IDK A;  2HVI A;  1CXQ A;  3IG1 A;  3DM2 A;  3A2F A;  4OJR A;  1BQN A;  3KLF A;  5HRN A;  3HST B;  3ZT2 A;  3QNN A;  3SQ2 A;  4NYF A;  4AH9 A;  4XIU A;  4ELV A;  1RDA A;  3CM5 A;  3D45 A;  2FBT A;  1KLM A;  4I2P A;  4H8K A;  4AHR A;  4JS4 A;  2IS3 A;  4I9Q A;  4J2A A;  2HMI A;  1FXX A;  3WNG A;  2R7Y A;  3S3O A;  3I0R A;  1BL3 A;  2YNF A;  2G8U A;  4FVM A;  4BWM A;  2RF2 A;  3NAE A;  1D9D A;  3HK2 A;  1REV A;  1NJX A;  3PUF A;  3M8Q A;  4W5R A;  3TAQ A;  2KW4 A;  3AVA A;  4DMN A;  4CHP A;  1KCF A;  5CZ2 A;  3O3H A;  3NH0 A;  2WON A;  3V9X A;  1D9F A;  2OPP A;  3VQE A;  4FM0 A;  3LZJ A;  3EYZ A;  4DSE A;  3MEC A;  3RRG A;  3QEV A;  4DQR A;  1JLA A;  4FW1 A;  4FZZ A;  1EXQ A;  3TAN A;  1Q9X A;  3DLG A;  4DU4 A;  2VWK A;  4DF8 A;  4C8O A;  2Z1H A;  1A5X A;  3VQA A;  3OS2 A;  3OYA A;  3HPG A;  2DTU A;  3ZT1 A;  1NOY A;  3VA3 A;  4KRF A;  3DLB A;  4CJ5 A;  4FZX C;  3OYJ A;  4K8X A;  1TKD A;  1IKW A;  1RBT A;  3DI6 A;  4H4O A;  3ALY A;  1L3S A;  4DTN A;  1IH7 A;  3OYH A;  3PO5 A;  1WN7 A;  2B6A A;  2D5R A;  3AVB A;  3ISN C;  3MEE A;  2HHT A;  2DY4 A;  1EP4 A;  1NK7 A;  1TK8 A;  3P1G A;  4FJM A;  4B3O A;  3NE6 A;  4GVM A;  3KK3 A;  3ZSZ A;  4YFU A;  3KK1 A;  3B6O A;  3OJS A;  5KGX A;  3HM9 A;  2XY5 A;  1N5Y A;  3SQ1 A;  1QSS A;  1RTI A;  5C24 A;  2P5O A;  1TAQ A;  3AO4 A;  4Y1D A;  2ETJ A;  2HNZ A;  3V9U A;  1UA1 A;  4O0J A;  3UIQ A;  4RW7 A;  4CJK A;  4M42 A;  4NCG A;  1L5U A;  2EHG A;  1BI4 A;  1A5W A;  4DFK A;  1NJZ A;  4KI6 A;  3ITH A;  3NF7 A;  3OYB A;  4CEE A;  3OYC A;  2YHA A;  3AO3 A;  3BGR A;  4IFY A;  3TAB A;  3TAP A;  3PY8 A;  3ZSW A;  1JLQ A;  4CJW A;  3NGZ A;  4Q5V A;  2X6S A;  4EZ9 A;  3AVK A;  1QHT A;  4CEA A;  4FJ8 A;  3NF6 A;  3SV3 A;  4B9N A;  1IKV A;  1SL1 A;  2P5G A;  3KD1 E;  4QOZ B;  5J2M A;  1I3A A;  4N5S A;  1SKR A;  3CFR A;  4DU1 A;  4FM2 A;  4DTS A;  3CFP A;  5FRM A;  2BGG A;  3SNN A;  2Z1G A;  3RTV A;  4DQP A;  1JXB A;  2PY5 A;  1JLG A;  1XI1 A;  2G8V A;  4B9L A;  4CJF A;  4YNQ A;  3KJV A;  3LZI A;  2G8I A;  5HRP A;  5T7B A;  5SZT A;  1RT7 A;  4KFB A;  2G8H A;  4CIF A;  4JS5 A;  1S1U A;  3TAG A;  1QSY A;  5D3G A;  1HYZ A;  3PO4 A;  2KTQ A;  3NF9 A;  3L2U A;  2ITG A;  4CIE A;  3PX4 A;  1U48 A;  1BIS A;  4O0I A;  1RCH A;  3S3N A;  4KHS A;  3WNE A;  3V9Z A;  3LP3 A;  4ELU A;  1C0T A;  2IGI A;  1UWB A;  3AA4 A;  1F21 A;  3DMJ A;  3C94 A;  1C1B A;  2YKM A;  4CJL A;  2E4L A;  5E41 A;  1RDC A;  2XY8 A;  4ID1 A;  3ZT3 A;  1Q9Y A;  1FKP A;  1RT2 A;  1JKH A;  2KQ2 A;  2D0A A;  2G8K A;  3DRR A;  3DRP A;  4ZHR A;  4BAC A;  1KFD A;  3NBP A;  4BDY A;  1U47 A;  1C1C A;  3PX6 A;  2IC3 A;  4TSX A;  3RMA A;  4CFA A;  2D0B A;  3AO1 A;  5HRO A;  1U49 A;  4KHU A;  2I5J A;  1D8Y A;  3S9H A;  1XC9 A;  5DMR A;  3NH1 A;  1U04 A;  4CHO A;  3MXM A;  1ZBF A;  1B9F A;  3SPY A;  3SYZ A;  1VSK A;  1QTM A;  4ID5 A;  4Z4I A;  1C0U A;  4KKO A;  1U45 A;  3DLK A;  2HHU A;  3CQ8 A;  4CJR A;  4FXD A;  4FJI A;  4FLZ A;  4B9U A;  4Z0U A;  2FC0 A;  4E3S A;  1BQM A;  3DLE A;  3KLE A;  4HCC A;  1HYV A;  4M3Y A;  4M3Z A;  1S1T A;  4KRE A;  1NOZ A;  4JRP A;  3F9K A;  2YV0 X;  5CYM A;  2HHX A;  3F73 A;  4AHV A;  4CGI A;  4F4K A;  1JL1 A;  1FK9 A;  4LSL A;  3K5M A;  4F3T A;  4KV8 A;  4KHY A;  3AVI A;  2VG5 A;  1XWL A;  5KRS A;  3OYD A;  1LWC A;  4CFC A;  1T7P A;  4CEZ A;  4PUO A;  3ZSO A;  4FK2 A;  4CEO A;  4KHQ A;  2PYJ A;  2HHQ A;  4OPJ A;  4FJG A;  5HLF A;  1DTT A;  3DLR A;  4FLU A;  5HP1 A;  4KI4 A;  3VA0 A;  3P5J A;  1NK0 A;  5K14 A;  4IBN A;  4DWI A;  2D0C A;  1IKY A;  1X9S A;  1NKB A;  1TL3 A;  3TAM A;  4QCL A;  2YHB A;  1NK5 A;  1C1A A;  1RTD A;  4KTZ A;  3ZT4 A;  2QKK A;  2QK9 A;  4PWD A;  4CGG A;  1TGO A;  4BDZ A;  3E01 A;  1DTQ A;  3AVC A;  5CZ1 A;  4EP4 A;  3K59 A;  4CIG A;  4CJE A;  2RN2 A;  4ZTF A;  4DSF A;  3V4I A;  4AHU A;  5JS1 A;  2ATQ A;  1BIU A;  4HUE A;  4DLG A;  1JLB A;  4OGE A;  2YNH A;  2OPR A;  4FLW A;  3RRH A;  2HW3 A;  2HHS A;  4DQI A;  3KIO A;  4OKE A;  1GOC A;  1A5V A;  1VRT A;  3AA2 A;  4E7J A;  1YTU A;  4FCY A;  4CHY A;  1BCO A;  4GMJ B;  3LDS A;  2GV9 A;  2O4G A;  3AVG A;  3V1R A;  4CE9 A;  1HRH A;  3G0Z A;  5CY4 A;  3TAE A;  4LD0 A;  4FW2 A;  3HP6 A;  3T3F A;  1RT1 A;  3O4Q A;  1LAW A;  4NYN A;  2DFE A;  3VQ4 A;  1IG9 A;  3BDP A;  4FZY A;  2XHB A;  3V9W A;  3TI0 A;  2QXF A;  1S1W A;  3C6T A;  4ICL A;  4F8R A;  1JLF A;  1NJY A;  1CZB A;  1QE1 A;  4Q0B A;  4H4M A;  1NK8 A;  3LWM A;  3RR7 A;  3MED A;  2W42 A;  4Z4E A;  4Y1C A;  4N47 A;  3I8D A;  1UOC A;  4CGD A;  3DOK A;  4B9M A;  2WOM A;  1SKS A;  1WSI A;  3V1O A;  4I9L A;  3QEW A;  3G10 A;  3PV8 A;  3NF8 A;  1BI4 B;  3LPU A;  4FJ9 A;  2OPS A;  5I42 A;  1KVA A;  2GUI A;  2RPI A;  4RW4 A;  4RG8 A;  4M3T A;  3HT3 A;  2Y1I A;  1N6Q A;  4FK0 A;  5HBM A;  2BAN A;  4G1Q A;  4EP5 A;  2OA8 A;  1LW0 A;  3V81 A;  1KSP A;  4DQS A;  4CGF A;  3QES A;  3KLH A;  4CFD A;  4J2D A;  1HQU A;  4CEB A;  3QIN A;  1W0H A;  3VQ7 A;  3OS1 A;  1WSH A;  2A1R A;  1LW2 A;  3K58 A;  1L3T A;  3I0S A;  1YTA A;  3SCX A;  4RW8 A;  3HJF A;  2XY6 A;  3AVM A;  1RDB A;  3QER A;  3AVL A;  1BCM A;  3OYM A;  3KTQ A;  2HVH A;  3KKR A;  5KI6 A;  4DG1 A;  2X6N A;  3VQD A;  1ASV A;  4RW6 A;  1R0A A;  1S9E A;  3FFI A;  5KTQ A;  1NK4 A;  1S6P A;  2A1S A;  2JGU A;  2IDO A;  3T1A A;  4DSL A;  1JL2 A;  4Z4H A;  1J54 A;  3KLI A;  3PX0 A;  1NK6 A;  3H08 A;  1TL1 A;  2HHV A;  2HND A;  4NCA A;  3HP9 A;  3QEP A;  4KHN A;  3OYK A;  5J2P A;  1CXU A;  1SL0 A;  3T19 A;  3O3G A;  3AVF A;  2JLE A;  4M3R A;  4OVL A;  4E7H A;  3V6D A;  2XO7 A;  4DU3 A;  4R5P A;  4CEQ A;  4DSK A;  1ZBH A;  1D5A A;  1ZYQ A;  3RWU A;  4CJU A;  4FK4 A;  1HQE A;  2HB5 A;  2LSN A;  2VG7 A;  4CJV A;  3OYL A;  1VK0 A;  3CM6 A;  4C8M A;  1XHX A;  3EZ5 A;  4DLE A;  2HNY A;  4E7I A;  4AHC A;  1X9M A;  1RT3 A;  4J2B A;  3C95 A;  4CED A;  3VQQ A;  1HYS A;  1JLC A;  1VSM A;  4KB0 A;  4CHN A;  3AA3 A;  3LAK A;  4CEF A;  2PZS A;  4JRQ A;  1TKT A;  2P1J A;  2YNG A;  3QEI A;  1RT5 A;  3KD5 E;  1VSE A;  2PYL A;  1O1W A;  1BHL A;  4FJX A;  1KVC A;  3VQC A;  2OYQ A;  1YT3 A;  1RBU A;  2OZM A;  1ZBI A;  5KGW A;  3KKS A;  4DTM A;  4CF1 A;  3AV9 A;  1CLQ A;  4DQQ A;  1VSJ A;  4N56 A;  3ASM A;  2X74 A;  4HUF A;  1W9H A;  3JSM A;  5J2N A;  4IG3 A;  3SQ4 A;  2B5J A;  1RTJ A;  1SL2 A;  3LWL A;  1S1X A;  4E19 A;  3V9S A;  3K5L A;  4W5N A;  1S1V A;  1S9G A;  1YVU A;  4FJJ A;  3HXM A;  3VQ9 A;  4RW9 A;  4FLY A;  3NGY A;  4DTU A;  4CEC A;  3L2W A;  3AVH A;  4KTW A;  3TAF A;  1KLN A;  1WSJ A;  5I3U A;  1QSL A;  3LAL A;  3LP1 A;  4CER A;  2FBV A;  1XHZ A;  4KO0 A;  4CF2 A;  4E7K A;  4DFM A;  3OYE A;  3M8S A;  4LSN A;  3K5N A;  3ULD A;  3RMD A;  2XRI A;  4DTO A;  3L2V A;  4Z4C A;  4EZ6 A;  3MEG A;  1TV6 A;  3CYM A;  4KPY A;  1RT4 A;  4C8N A;  3NFA A;  3WNF A;  4CGH A;  3DYA A;  5EU7 A;  4HTU A;  2KZZ A;  4CFB A;  4E89 A;  4W5T A;  3SUO A;  1UAX A;  2AJQ A;  1KRP A;  2FBX A;  1WLJ A;  2RKI A;  3NDK A;  4E1M A;  2G8W A;  3K2P A;  3K57 A;  3NCI A;  2OZS A;  4FJK A;  4OLB A;  3OYG A;  1BGX T;  2ZD1 A;  1RTH A;  4MFB A;  4OGC A;  3ZSX A;  4HVJ A;  4DTJ A;  4FJL A;  1QQC A;  4IFV A;  5HRS A;  1G15 A;  3O3F A;  3SV4 A;  3IS9 A;  3SUQ A;  4F2S A;  1I39 A;  1ITG A;  3L3V A;  2Z1I A;  3B6P A;  1RDD A;  3LP2 A;  5FRO A;  3HL8 A;  3ZCM A;  4AHT A;  2E6M A;  4W5O A;  3K5O A;  3OY9 A;  2F96 A;  4FJ5 A;  1FKO A;  3VN5 A;  4F2R A;  1U4B A;  3VQP A;  2KZM A;  2KFN A;  1VSI A;  4K8Z A;  3SQ0 A;  1CZ9 A;  1IKX A;  1RBS A;  3U6F A;  2BDP A;  4FLV A;  3MXJ A;  4B8A B;  2Q3S A;  4I2Q A;  1WSG A;  3OYI A;  4C8K A;  3TWH A;  4Z4F A;  1WSE A;  4IG0 A;  3ZSQ A;  3EY1 A;  4HCB A;  1HNV A;  1Z25 A;  2FBY A;  3TAR A;  3KK2 A;  3IRX A;  4WE1 A;  3SZ2 A;  4CF8 A;  1HMV A;  4B8C A;  1MU2 A;  4O4G A;  4CES A;  4OPK A;  4E1N A;  1L3V A;  5HRR A;  4DFJ A;  4I7F A;  1JLE A;  1NKE A;  4CF9 A;  5C42 A;  3THV A;  2IOC A;  3MAQ A;  4B9T A;  4FLT A;  4FJ7 A;  4DS4 A;  4DSJ A;  4LH5 A;  1RIL A;  4OKJ A;  4DTP A;  1X1P A;  3U3G A;  1RBV A;  4CJT A;  1T8E A;  2G8F A;  4DS5 A;  1WAF A;  1IO2 A;  3ZSY A;  2E6L A;  3L8B A;  2YKN A;  3VQ5 A;  3NGI A;  1JXE A;  4OKK A;  3SI6 A;  4KHW A;  1J9A A;  1BIZ A;  1KTQ A;  3RMB A;  4HUG A;  1LV5 A;  3IAY A;  4FJN A;  2OPQ A;  4L8R B;  3VQ8 A;  4IKF A;  3QEX A;  3SUP A;  4C8L A;  3D0P A;  4LY7 A;  2B4J A;  4MQ3 A;  4CJP A;  3M8P A;  2DFF A;  1DLO A;  3NHG A;  3QIO A;  2GBZ A;  3OVN A;  4M3X A;  1ZBL A;  5DK5 A;  4FLX A;  2X78 A;  3HVR A;  2F8T A;  2VWJ A;  3AVJ A;  1Y97 A;  4O44 A;  4BWJ A;  4DF4 A;  1ASU A;  4B08 A;  3LAN A;  3OS0 A;  4KTQ A;  5SWM A;  2VG6 A;  4KAZ A;  1C0M A;  3CFO A;  4PA1 A;  3JYT A;  1TVR A;  1C6V A;  1T05 A;  2ZE2 A;  4J2E A;  2NUB A;  1UA0 A;  1EKE A;  3OYF A;  2Y1J A;  1RT6 A;  1WNS A;  3DOL A;  4QAG A;  1EX4 A;  3QIP A;  3ZT0 A;  1ZBU A;  4OLA A;  3HVT A;  4M45 A;  1VRU A;  1GOA A;  3M8R A;  3HPH A;  1NKC A;  3ZSR A;  4DFP A;  1T03 A;  1LWE A;  1TK0 A;  4O5B A;  4CJ3 A;  4CHQ A;  1EET A;  1KVB A;  4DTX A;  4GW6 A;  4BDP A;  4CCH A;  2HHW A;  1TK5 A;  3WNH A;  1SUQ A;  4AHS A;  1QS4 A;  3TR8 A;  3AO5 A;  1ASW A;  2QKB A;  3LP0 A;  1Z26 A;  5JS2 A;  4Z4G A;  1SV5 A;  4PQU A;  3SPZ A;  4M41 A;  2XY7 A;  1VSF A;  3HYF A;  4CGJ A;  4JLH A;  4FJH A;  2KFZ A;  1TKX A;  2ZQB A;  3AA5 X;  3V1Q A;  1X9W A;  3O4N A;  4N76 A;  4M3U A;  5J2Q A;  4CK3 A;  3QET A;  3U3Y A;  3MXI A;  3QLH A;  1J5O A;  3DLH A;  1WSF A;  4CJQ A;  3HPO A;  4FYD A;  3ZSV A;  3S3M A;  1GOB A;  2P51 A;  4CF0 A;  4CJS A;  3L3U A;  3QNO A;  4M3W A;  4CK2 A;  4HHT A;  3DRS A;  1B9D A;  5KRT A;  4PY5 A;  2DFH A;  1WAJ A;  1VSH A;  1Q8I A;  1NJW A;  4NCB A;  4DTR A;  3AO2 A;  3KLG A;  3SUN A;  4B9V A;  1B92 A;  5J1E A;  4KB1 A;  4DSI A;  1VSD A;  3OJU A;  2BE2 A;  4BE1 A;  3RR8 A;  4CJ4 A;  1K6Y A;  4UQG A;  3L2R A;  4AIL C;  1J53 A;  3L2Q A;  4FM1 A;  3HO1 A;  1RNH A;  3P83 D;  4O55 A;  3NH2 A;  3VQ6 A;  4CK1 A;  3VQB A;  4BE0 A;  1S6Q A;  4LH4 A;  4B9S A;  1LWF A;  2F8S A;  3OYN A;  3LAM A;  3AVN A;  1NK9 A;  1RBR A;  4E7L A;  5FDL A;  2IAJ A;  3LPT A;  1LAV A;  2YNI A;  3QO9 A;  1HJR A;  3CG7 A;  5CYQ A;  1TAU A;  1KFS A;  4N41 A;  1VSL A;  4BE2 A;  4E0D A;  2O4I A;  2Z1J A;  5FRN A;  4F3O A;  4CHZ A; 
#chains in the Genus database with same CATH topology
 1L3U A;  4YDU C;  4B1U B;  3C6U A;  4W5Q A;  1SKW A;  1YJN N;  2HVI A;  3IG1 A;  3SMP A;  3LDN A;  4OJR A;  2P9S A;  5EY4 A;  3VTI A;  3SQ2 A;  4NYF A;  2O8D A;  3CM5 A;  3D45 A;  2FBT A;  4I2P A;  4H8K A;  2W6K A;  2IS3 A;  1YI2 N;  4J2A A;  2HMI A;  4FVM A;  2RF2 A;  2P9I B;  5JVH L;  3M8Q A;  4FM0 A;  3LDO A;  4DV3 K;  1JLA A;  4BRA A;  3HRG A;  1Q9X A;  3ZT1 A;  3VA3 A;  3DLB A;  2V7Y A;  2UUB K;  3WUH A;  3OYJ A;  2CGL A;  1TKD A;  2O8B B;  1IKW A;  3CC2 N;  4NXN K;  4JD2 B;  4BR2 A;  2HHT A;  5ADX H;  3MEE A;  3SAH A;  1EP4 A;  4ISF A;  5KGX A;  2NRR A;  1N5Y A;  2P9K B;  1RTI A;  4JAX A;  4DQ8 A;  2P5O A;  1TAQ A;  4Y1D A;  2ETJ A;  3UIQ A;  3SJH A;  4CJK A;  4M42 A;  3ATU A;  4BC4 A;  2EHG A;  4DFK A;  1L5U A;  1NJZ A;  3OYB A;  2E2N A;  3OYC A;  3BGR A;  3NGZ A;  4QS8 A;  3SV3 A;  4B9N A;  1IKV A;  1SL1 A;  4QOZ B;  2E2O A;  3MN9 A;  3CFR A;  3QFU A;  3R6M A;  3SNN A;  3MCA B;  3THW A;  4DQP A;  5FRM A;  2PY5 A;  1JLG A;  1TYQ A;  3U4L A;  1XI1 A;  2DPN A;  5T7B A;  1RT7 A;  1JCE A;  2G8H A;  4JV5 K;  2QTD A;  1N34 K;  3WXL A;  3NVK A;  4DV5 K;  1HYZ A;  3PO4 A;  1ATR A;  1Z6R A;  1BIS A;  4KHS A;  5FPE A;  5TKW A;  4JHD B;  2VYP A;  1F21 A;  3CCJ N;  2YKM A;  2F9W A;  3ZT3 A;  2XY8 A;  4ID1 A;  1FKP A;  4BC2 A;  4TSX A;  3RMA A;  4CFA A;  2D0B A;  4KHU A;  2FF6 A;  5KPZ A;  3NH1 A;  3ULE A;  1VQ8 N;  2P9P B;  1ZBF A;  4BRG A;  4WQ4 C;  3SPY A;  1VSK A;  2EWS A;  5ADX A;  3DLK A;  3FZK A;  3CQ8 A;  4CJR A;  4FLZ A;  4B9U A;  3UE5 A;  4KRE A;  1S1T A;  3N4Q A;  3BF1 A;  2YV0 X;  3F73 A;  4CBU A;  4F3T A;  3AVI A;  3OBW A;  5KRS A;  3ZSO A;  4CEO A;  4KHQ A;  2ZM6 K;  1DTT A;  1U2V A;  4KI4 A;  3P5J A;  4YOU A;  5K14 A;  1NKB A;  1K9M O;  2P9L B;  5C2F A;  2KHO A;  4MDA A;  4CGG A;  1TGO A;  4BDZ A;  3E01 A;  4EP4 A;  4CJE A;  4H0O A;  5DM6 L;  1BIU A;  4K41 A;  4OGE A;  4FLW A;  2HW3 A;  1EO1 A;  4PKG A;  3J80 O;  4BRI A;  3AA2 A;  5HOO A;  4FWQ A;  4GMJ B;  3LDS A;  2O4G A;  1GLC G;  4CE9 A;  5CY4 A;  3G0Z A;  4LD0 A;  4FW2 A;  3HP6 A;  3RSE B;  3O4Q A;  1LAW A;  3TTF A;  3VQ4 A;  1IG9 A;  2XHB A;  1VQ7 N;  3TI0 A;  1S1W A;  4ICL A;  4F8R A;  1CZB A;  4CZK A;  1NU0 A;  3EKS A;  4JKH A;  4Q0B A;  4H4M A;  4DUZ K;  3CJB A;  3H3O B;  3DOK A;  2QWO A;  4GV3 A;  3CXC M;  2OTJ N;  2QWL A;  1BI4 B;  5H1S Q;  3LPU A;  4RCH A;  1Q81 O;  2GUI A;  5HBM A;  1QQN A;  4EP5 A;  3THY B;  3V81 A;  3KLH A;  4XH4 A;  2ASP A;  2QWQ A;  3QIN A;  1IBL K;  3K58 A;  1L3T A;  1IBK K;  3I0S A;  3HJF A;  3QER A;  3KTQ A;  5JVG L;  3KKR A;  1S9E A;  5KTQ A;  3MWT A;  2W40 A;  4YOR A;  3GBT A;  4NCA A;  3QEP A;  1CXU A;  2JLE A;  3CCE N;  4E7H A;  2XO7 A;  4DU3 A;  4R5P A;  4CEQ A;  1KAZ A;  4KHP K;  3ZX3 A;  1XC3 A;  3MCP A;  5AZI A;  1VK0 A;  4GKJ K;  3EZ5 A;  1OKJ A;  4DLE A;  4E7I A;  1VQL N;  3GOI A;  4JRQ A;  1TKT A;  3O9T A;  1M1K O;  1RT5 A;  3KD5 E;  4FWP A;  4AM6 A;  1ZBI A;  2VQF K;  4N56 A;  1YF5 L;  2P9U B;  3CME N;  5GIO A;  5J2N A;  2D0O A;  1RTJ A;  3A5L C;  1NMN A;  2Q2R A;  1NGC A;  1TUY A;  3VQ9 A;  4FLY A;  4DTU A;  3VGL A;  3AAR A;  4JKE A;  3LP1 A;  2FBV A;  4V19 S;  4KO0 A;  4DFM A;  3OYE A;  4A61 A;  3K5N A;  2O8C B;  2E1Y A;  2P9P A;  2GTD A;  5GAH P;  3L2V A;  2KZZ A;  4C8N A;  4CGH A;  3O1B A;  3WNF A;  4E89 A;  4W5T A;  2KLA A;  1Y64 A;  1UAX A;  2RKI A;  4BGA A;  2OZS A;  3K57 A;  4JI8 K;  3EN9 A;  3TU5 A;  4DTJ A;  4HVJ A;  3CET A;  3SUQ A;  3SV4 A;  1G15 A;  4BRF A;  3IS9 A;  3FZL A;  4AM7 A;  1NLV A;  2F9T A;  1RDD A;  4H0T B;  3HL8 A;  3BZK A;  2E6M A;  3CCL N;  3Q7C A;  3VN5 A;  3MMV A;  2KFN A;  4B1W B;  5AQT A;  1IKX A;  3ATV A;  4FLV A;  1WSG A;  4PL7 A;  1H1V A;  1WSE A;  1E4F T;  3ZSQ A;  3OA9 A;  3EY1 A;  1HNV A;  1Z25 A;  2FBY A;  1K8A O;  3SZ2 A;  1HKG A;  4OPK A;  4G9Z A;  4DFJ A;  1EQY A;  1JLE A;  1NKE A;  2IOC A;  3MAQ A;  1KAX A;  4J8F A;  4FJ7 A;  2ASO A;  2G8F A;  2GWJ A;  2QWM A;  1K8K A;  1KTQ A;  4L8R B;  4RTF D;  4MQ3 A;  1JCG A;  5BRH A;  3M8P A;  1XMQ K;  3FZH A;  1YJ9 N;  1DLO A;  3OVN A;  1FW6 A;  5DK5 A;  3HVR A;  2VWJ A;  4DF4 A;  4B08 A;  4X65 K;  3OS0 A;  4KTQ A;  4FSV A;  4PA1 A;  1C0M A;  1NWK A;  1NJI O;  3HI0 A;  2NUB A;  1RT6 A;  3A0I X;  3DOL A;  4LFB K;  3A5O C;  3HPH A;  4BGB A;  1T03 A;  1TK0 A;  4O5B A;  4CJ3 A;  4CHQ A;  1EET A;  4DTX A;  1NM1 A;  1QS4 A;  2ZGY A;  5E84 A;  3LP0 A;  4A57 A;  5JS2 A;  4BR4 A;  4JYA K;  2UXC K;  5C0Y A;  5AJ3 K;  3CQY A;  2ZQB A;  1X9W A;  3UKU A;  4FWN A;  2UXB K;  3M6G A;  5AQP A;  3S3M A;  4FOE A;  3QNO A;  3L3U A;  3E9L A;  4PY5 A;  3DRS A;  4IOX A;  1WAJ A;  1Q8I A;  4NCB A;  2YHY A;  4JKG B;  4BRM A;  1B92 A;  4DR3 K;  4DSI A;  3RR8 A;  3A8Y A;  3HO1 A;  3CJC A;  3MN7 A;  5F2R A;  4FM1 A;  3NH2 A;  3VQ6 A;  1Z05 A;  4CK1 A;  4LH4 A;  3OYN A;  1NK9 A;  2WFB A;  2Q1N A;  1BOT O;  1LAV A;  2YNI A;  3CG7 A;  1KFS A;  3AAQ A;  3AY9 A;  1VQ6 N;  2Z1J A;  4JKC A;  3IUC A;  4ELT A;  2EX3 A;  5BPN A;  5C25 A;  4IDK A;  4I6M B;  3H45 C;  1VQ4 N;  1VAZ A;  3A2F A;  1GLE G;  3QNN A;  2HBL A;  3HST B;  4ELV A;  2NRX A;  3VER A;  4WQ5 C;  1BA0 A;  1KLM A;  4JS4 A;  1FXX A;  3C6A A;  2YNF A;  5CHI A;  3TSU A;  3NAE A;  3HK2 A;  1REV A;  3H1Q A;  3O9U A;  3PUF A;  1D9F A;  1HLU A;  5CZ2 A;  3O3H A;  4MLH A;  4YOY A;  4BRC A;  2OPP A;  3VQE A;  1OH5 A;  4IDH A;  3ZEU A;  3EYZ A;  3RRG A;  4MDB A;  3KVG A;  1EXQ A;  3TAN A;  5KPR A;  3DLG A;  4U7B A;  3VQA A;  3OYA A;  4JK9 A;  1YHQ N;  4B9Q A;  1L3S A;  4DTN A;  1IH7 A;  3QFP A;  2B6A A;  5CR4 A;  3AVB A;  5LMN K;  4GVM A;  3KK3 A;  3ZSZ A;  3I8B A;  3OJS A;  1QSS A;  2FXU A;  5C24 A;  4DV0 K;  3AO4 A;  1UA1 A;  4HTL A;  1P90 A;  4RW7 A;  3H6E A;  4KI6 A;  1A5W A;  3ZET B;  3ITH A;  3C7N B;  3AO3 A;  3PY8 A;  4LF8 K;  1WOQ A;  4CJW A;  4Q5V A;  3LDP A;  2X6S A;  4EZ9 A;  5AQK A;  5AQN A;  3KHY A;  3NF6 A;  2P5G A;  4BVO A;  5AQZ A;  1JXB A;  2FF3 B;  4CJF A;  3SBG A;  5HRP A;  4CZI A;  4XH1 A;  1K73 O;  4KFB A;  1S1U A;  3TAG A;  1QSY A;  2QWR A;  4BY9 C;  2KTQ A;  2PFU A;  1VQP N;  2QI2 A;  4CIE A;  2O8F A;  2RE2 A;  4DR4 K;  1C0T A;  2ZJQ L;  1UWB A;  3QML A;  5E41 A;  5JMV A;  1QZ5 A;  1RT2 A;  1JKH A;  3E9O A;  3DRR A;  3DRP A;  1C1C A;  2IC3 A;  4AQY K;  2I5J A;  1XC9 A;  1U04 A;  1QTM A;  1GLJ O;  4ID5 A;  3CHW A;  3PSI A;  4FXD A;  5AQO A;  3U8X A;  2FC0 A;  4E3S A;  3KLE A;  5EVZ A;  3UKR A;  1X3N A;  1NOZ A;  3L6Q A;  3F9K A;  2HHX A;  4F4K A;  1FK9 A;  3K5M A;  3G25 A;  4DCH A;  1T7P A;  2IVO A;  2PYJ A;  2HHQ A;  1HNW K;  5HLF A;  4FOI A;  3DLR A;  4H5W A;  4FLU A;  1HNZ K;  1BA1 A;  1NK0 A;  1KXP A;  5AQF A;  4DB3 A;  3LDQ A;  3TAM A;  1NGE A;  2QKK A;  4NO7 A;  3WEE B;  4PWD A;  4IEI A;  1MDU B;  1R59 O;  2YHW A;  3K59 A;  1J5E K;  5IT9 O;  3V4I A;  5JS1 A;  5B8H A;  3RRH A;  3MX2 A;  3H1V X;  2OPR A;  3VF2 A;  3PIP L;  4OKE A;  1VRT A;  3WXM B;  2Q36 A;  1NGG A;  1HUX A;  3N4P A;  1VHX A;  3IMX A;  2E2P A;  5TKY A;  5KPT A;  1NMD A;  3TSP A;  3T3F A;  5FPD A;  4WFN L;  2DFE A;  3V9W A;  4CZG A;  1JLF A;  3CQX A;  5AQY A;  1NJY A;  1KQS M;  1OH8 A;  1QE1 A;  3O9R A;  3LWM A;  3RR7 A;  2W42 A;  4OX9 K;  3I8D A;  3CCU N;  1GLF O;  3T69 A;  1WSI A;  2O8E A;  3CPW M;  3ID8 A;  4I9L A;  3PV8 A;  3NF8 A;  4B3T K;  4WYB A;  2CH6 A;  2OPS A;  1KVA A;  4RW4 A;  3HT3 A;  1KSP A;  4DQS A;  4CFD A;  1HQU A;  5BRE A;  4CEB A;  3VQ7 A;  5LJV A;  3OS1 A;  5AQX A;  2A3Z A;  3MWP A;  3J7Z O;  3HSC A;  3AVL A;  1BCM A;  5GIP A;  2HVH A;  5M1P A;  5KI6 A;  4DG1 A;  2X6N A;  4RW6 A;  1SS6 A;  3FFI A;  3FLC O;  2A1S A;  4DSL A;  2JGU A;  1JL2 A;  5EX5 A;  4BC5 A;  4DKW A;  1NK6 A;  1TL1 A;  2HHV A;  2HND A;  3HP9 A;  3OYK A;  5J2P A;  1SL0 A;  5M1O A;  4DV7 K;  4OVL A;  3V6D A;  3CD6 N;  4LF7 K;  2A5X A;  1ZBH A;  4AF1 A;  5JLH A;  1D5A A;  3RWU A;  1VQO N;  2BUP A;  4JK8 A;  4CJU A;  4FK4 A;  1HPM A;  2AP1 A;  1HX1 A;  2LSN A;  3OYL A;  4LF4 K;  3VEV A;  3MDQ A;  1YUW A;  1RT3 A;  3C95 A;  4EAH D;  1JLC A;  3AA3 A;  2NRT A;  3LAK A;  2PZS A;  1FJG K;  2P1J A;  2YNG A;  3QEI A;  4WQ5 A;  2PYL A;  4FJX A;  1LCU A;  4B1Y B;  3VQC A;  2OZM A;  2YJE A;  1YT3 A;  3KKS A;  5C15 A;  4CF1 A;  2V51 B;  4CZM A;  4DQQ A;  4A2B A;  3T1Y K;  3SQ4 A;  5A2Q O;  5BR8 K;  2B5J A;  1SL2 A;  4W5N A;  4E19 A;  3QIC A;  3VF6 A;  3HXM A;  4CZJ A;  5BPM A;  3NGY A;  1KLN A;  4CEC A;  3TAF A;  5I3U A;  3LAL A;  1XHZ A;  1JCF A;  2QA4 N;  2OTL N;  4DTO A;  3O1W A;  1TV6 A;  1GLL O;  3C0B A;  3G71 N;  1SQK A;  1GLB G;  1MA9 B;  4CFB A;  3SUO A;  2FSK A;  2AJQ A;  2FBX A;  4CZH A;  3K2P A;  3SLC A;  1BGX T;  2ZD1 A;  3PIO L;  1QQC A;  5HRS A;  2ZGZ A;  4F2S A;  2QWP A;  3HPO A;  5IWA K;  4PHT X;  4DR6 K;  4CVN E;  3K5O A;  3M1F A;  2F96 A;  2KZM A;  3VOV A;  4K8Z A;  3FE1 A;  2FLO A;  4DR2 K;  3SQ0 A;  1RBS A;  2BDP A;  4B8A B;  2Q3S A;  4BRD A;  5AFU H;  5LY3 A;  2W41 A;  4Z4F A;  4IG0 A;  4K43 A;  2HF4 A;  4HCB A;  3TAR A;  4DR7 K;  1QQM A;  2P9I A;  4WE1 A;  2UXD K;  2V52 B;  3OTO K;  3W3D A;  1MU2 A;  4O4G A;  1L3V A;  4NXM K;  2J4R A;  2NRV A;  3B8A X;  2Q31 A;  3THV A;  3CCM N;  5BRF A;  2HMP A;  3CCR N;  4FLT A;  3TPQ A;  4DSJ A;  4OKJ A;  3IDH A;  1RBV A;  1WAF A;  1IO2 A;  2E6L A;  3L8B A;  1GLD G;  4IOA L;  3NGI A;  3SI6 A;  1OVQ A;  3RMB A;  5LL6 Z;  4FJN A;  2O8B A;  2HST A;  4YY3 K;  4JD2 A;  3QEX A;  4LY7 A;  4FL9 A;  3SK3 A;  4M3X A;  2P9K A;  5F0X A;  3RVC A;  1Y97 A;  4O44 A;  2VGN A;  5SWM A;  2VG6 A;  3QBX A;  4KAZ A;  3SAF A;  3JYT A;  1TVR A;  1C6V A;  1UA0 A;  3HZ6 A;  3OYF A;  2Y1J A;  4QAG A;  3QIP A;  3VGK A;  2I7P A;  3M8R A;  2NRH A;  3ZSR A;  5BN9 A;  4YDU A;  1KVB A;  2QXL A;  4GW6 A;  1IBM K;  4CCH A;  3WNH A;  4C1N I;  1MWK A;  4BR5 A;  4AHS A;  3AO5 A;  3J7A P;  3KWG A;  1Z26 A;  4DR1 K;  4BR9 A;  3VEY A;  1W2B M;  1SV5 A;  3ENB A;  5AFU A;  3SPZ A;  4M41 A;  1ESV A;  4FJH A;  3F9M A;  2HBJ A;  3AA5 X;  3V1Q A;  3O4N A;  4PKH A;  4BRH A;  3QET A;  5EXW A;  4FYD A;  4YHH K;  3ZSV A;  3ID6 A;  3VMF B;  1RDW X;  1YIJ N;  4JHD A;  1OH6 A;  4B3R K;  1T44 A;  3JAM O;  1VSH A;  4DTR A;  3KLG A;  4OPH A;  3SUN A;  1QHA A;  3DXM B;  5J1E A;  1P8Z A;  1S22 A;  4IWV A;  3OJU A;  3L2R A;  2NNW A;  1RNH A;  4O55 A;  3CIP A;  1IJJ A;  3IKM A;  2F4V K;  4GV6 A;  3I56 N;  1RBR A;  5FDL A;  4WFA L;  3A5M C;  2HBM A;  3QO9 A;  1HJR A;  5CYQ A;  4FWO A;  4E0D A;  2O4I A;  5FRN A;  2ZJP L;  1KD1 O;  3HOS A;  3RMC A;  3K9J A;  1HNI A;  1S5J A;  3SJJ A;  5AQM A;  1HPZ A;  4DV4 K;  1TKZ A;  5AQI A;  4JKF A;  1CXQ A;  4LF9 K;  4IOC L;  1BQN A;  3KLF A;  3ZT2 A;  2ZWH A;  2OCE A;  4AH9 A;  2GX9 A;  3LM9 A;  5C2D A;  1RDA A;  3VEW A;  4BRK A;  2P9L A;  5C12 A;  3WNG A;  3S3O A;  3I0R A;  3JS6 A;  4BVP A;  2G8U A;  1NJX A;  3VTH A;  4Z94 A;  4W5R A;  5JIC A;  1OH7 A;  3AVA A;  1I94 K;  1KCF A;  3V9X A;  3VET A;  3NH0 A;  3H3N O;  4DSE A;  3MEC A;  1RGI A;  4DQR A;  2HOE A;  4FW1 A;  4FZZ A;  3MK6 A;  4DU4 A;  4DF8 A;  3OS2 A;  1A5X A;  2DTU A;  3HPG A;  1E3M A;  3RSE A;  4H5N A;  1RBT A;  3ALY A;  1WN7 A;  2D5R A;  3ISN C;  2HBK A;  1NK7 A;  3CC7 N;  4FJM A;  3NMU A;  4B3O A;  3J7Y P;  3BY5 A;  3KK1 A;  3B6O A;  2XY5 A;  3SQ1 A;  1NGB A;  4WQ4 A;  2E8A A;  2HNZ A;  3V9U A;  4O0J A;  3DXK B;  1BI4 A;  2P9N B;  3KK7 A;  1N32 K;  3NF7 A;  2YHA A;  2KKZ A;  5AQV A;  3U9D A;  4FWR A;  3ZSW A;  1JLQ A;  3E66 A;  5F1X A;  1QVG M;  2V7Z A;  1JJ2 M;  4JKB A;  3AVK A;  1QHT A;  3THY A;  1HR0 K;  4FJ8 A;  3KD1 E;  2PAV A;  1I3A A;  4HWI A;  1SKR A;  4FM2 A;  4DTS A;  3CFP A;  3FR0 A;  2BGG A;  1BWF O;  3TTD A;  2G8V A;  4YNQ A;  3CCV N;  3LZI A;  4B3S K;  5SZT A;  4CIF A;  3WXJ A;  3NF9 A;  3ENH A;  1WBB A;  3HOT A;  3LP3 A;  2IGI A;  3C65 A;  4CW7 B;  3DMJ A;  3C94 A;  1C1B A;  3BP8 A;  4CJL A;  1YJW N;  1RDC A;  4YOW A;  2D0A A;  1X3M A;  3THX B;  4ZHR A;  4BAC A;  3O9S A;  1KFD A;  4BDY A;  1X9J A;  5HRO A;  4H0X B;  1D8Y A;  3S9H A;  2NRZ A;  3MN5 A;  3MXM A;  3DJC A;  1B9F A;  1V4T A;  3FFK B;  4Y0W A;  3SYZ A;  4Z4I A;  1C0U A;  1BG3 A;  4ILJ A;  1O13 A;  4FJI A;  1WUA A;  4Z0U A;  4M3Z A;  4M3Y A;  1HYV A;  4JNE A;  4GY2 B;  4JRP A;  2CH5 A;  4AHV A;  1JL1 A;  2P9U A;  4KV8 A;  4CFC A;  4PUO A;  4FK2 A;  4OPJ A;  4JI3 K;  2P9S B;  4F9O A;  2UUA K;  1KC8 O;  2WUS A;  4MO5 A;  2O8D B;  4JKA A;  1TL3 A;  2UUC K;  2O8C A;  2YHB A;  4OPA A;  4H03 B;  1C1A A;  3NVM A;  1CZA N;  4H0Y B;  5HL7 L;  1Q82 O;  1DTQ A;  3AVC A;  4BQL A;  3IFR A;  2E2Q A;  4ZTF A;  4AHU A;  5AQL A;  1DEJ A;  4BG9 A;  2QM1 A;  5GAG P;  3KIO A;  4JN4 A;  4E7J A;  4DQI A;  1T6C A;  4KH6 A;  1BCO A;  2GV9 A;  1HRH A;  3TAE A;  4GNI A;  2Q0R A;  3BDP A;  2QXF A;  3C6T A;  4BR7 A;  4CI6 A;  4JK7 A;  4Y1C A;  4JI1 K;  2WOM A;  4IJN A;  4O5F A;  1SKS A;  3BF3 A;  2YCH A;  1VQ5 N;  1IV0 A;  4FJ9 A;  4GV9 A;  5I42 A;  4M3T A;  4FK0 A;  4FWS A;  2A40 A;  2BAN A;  4G1Q A;  3ENO A;  4WFB L;  3DWL A;  4CD3 A;  5AQS A;  3QES A;  5I9E B;  1W0H A;  3THW B;  4FVU A;  1WSH A;  1TYQ B;  3WXK A;  1YTA A;  1ZXO A;  3AVM A;  1RDB A;  3OYM A;  4K42 A;  2I7N A;  3QBW A;  1VQM N;  1W7A A;  3VQD A;  1R0A A;  4IXC A;  2E20 A;  2IDO A;  3T1A A;  1EWR A;  2PBD A;  2Q97 A;  3EO3 A;  4Z4H A;  4X66 K;  3KLI A;  3H08 A;  3E9P A;  3VEX A;  1YIT N;  3O3G A;  3TTC A;  3GDQ A;  4A5B A;  2NLX A;  2IVN A;  3LM2 A;  1DT9 A;  1HQE A;  4FWL A;  2HB5 A;  4IFE A;  3CM6 A;  4C8M A;  4X64 K;  4JI2 K;  4YOV A;  2HNY A;  4AHC A;  3ULE B;  1X9M A;  4H0P A;  4CED A;  1VSM A;  4CEF A;  4M7Y A;  1VQN N;  4RWT A;  3W0L A;  5KGW A;  4DTM A;  3CC4 N;  3AV9 A;  1CLQ A;  1VSJ A;  1BU6 O;  1V4S A;  4BRL A;  5EOY A;  4HUF A;  1W9H A;  3EE9 A;  4A2A A;  5MLC Q;  3JSM A;  4O8K A;  4DUY K;  3F2K A;  4KH4 A;  3LWL A;  1S1X A;  3BZC A;  1NGJ A;  4JEP A;  1E4G T;  1YVU A;  3J8A A;  4FJJ A;  4RW9 A;  1U2V B;  3DAW A;  3THX A;  3AVH A;  4KTW A;  3FZM A;  1QSL A;  4JKG A;  4CER A;  5BR9 A;  4CF2 A;  3FZF A;  3F5T A;  4LSN A;  3D6R A;  4DV1 K;  1T3V A;  3RMD A;  4B3M K;  2XRI A;  4Z4C A;  4EZ6 A;  4KPY A;  1RT4 A;  1T6D A;  5AQQ A;  5EU7 A;  4HTU A;  4ISG A;  5BPL A;  4FWM A;  3VEO A;  1WLJ A;  3SBT A;  3NDK A;  4FJK A;  3NCI A;  4KBO A;  3OYG A;  4IEE A;  4MFB A;  3G6E N;  4IFV A;  3O3F A;  4KB0 A;  2Z1I A;  5FRO A;  3LP2 A;  3ZCM A;  3OY9 A;  4FJ5 A;  5E26 A;  1FKO A;  4I6M A;  4F2R A;  4B1X B;  3VQP A;  1DGK N;  1VSI A;  1CZ9 A;  3P31 A;  3U6F A;  2A42 A;  3MXJ A;  4C8K A;  1VQK N;  1M90 O;  3CI5 A;  3R3L A;  4LF5 K;  3AGR A;  3CPE A;  4CF8 A;  5C10 A;  1N36 K;  3PSF A;  4E1N A;  3R9P A;  3D2E B;  1HNX K;  4YOT A;  4B9T A;  5AZJ B;  4DS4 A;  4LH5 A;  1RIL A;  2E5L K;  4CJT A;  1T8E A;  4DR5 K;  4DS5 A;  1EWQ A;  4M63 C;  4H0V B;  1JXE A;  3K0S A;  1QVF M;  1LV5 A;  1XUP O;  2OPQ A;  5FPM A;  1J6Z A;  3SUP A;  4C8L A;  2D0P A;  3VGM A;  3R8E A;  4CJP A;  3NHG A;  4WCE L;  4FLX A;  2X78 A;  3AVJ A;  1ASU A;  2VWB A;  3LAN A;  4EHU A;  3EEQ A;  3CFO A;  3ZET A;  5GAE P;  3C7N A;  4J2E A;  1T05 A;  2ZE2 A;  5CE3 A;  1EKE A;  1EX4 A;  1ZBU A;  3HVT A;  4M45 A;  1BUP A;  1VRU A;  1GOA A;  2NZT A;  3SMS A;  2HHH K;  2GEL A;  3GE1 A;  5AZI B;  2HHW A;  2VCP A;  3DLL L;  1D4X A;  1ASW A;  5M1N A;  4XH5 A;  3HYF A;  4JLH A;  5KQD A;  2KFZ A;  1TKX A;  4N76 A;  3S41 A;  4JI0 K;  1MWM A;  5J2Q A;  3MXI A;  3QLH A;  1J5O A;  4CJQ A;  3VF4 A;  3WQT A;  1GOB A;  4M7X A;  4CF0 A;  4CJS A;  5DM7 L;  4LFA K;  4HHT A;  1B9D A;  2DFH A;  3AO2 A;  4B9V A;  1VSD A;  4PL8 A;  2BE2 A;  4CJ4 A;  4AIL C;  1TUU A;  1J53 A;  3P83 D;  1C0F A;  5M1K A;  3D7E O;  3VES A;  4CD1 A;  3MX5 A;  1ILY A;  3T1H K;  1LWF A;  4CZL A;  2D4W A;  2F8S A;  3AVN A;  4E7L A;  4O8U A;  4PKI A;  3LDL A;  1WB9 A;  4KH5 A;  4N41 A;  2UYT A;  2ZJR L;  1XQS C;  3U9Z A;  4LF6 K;  4CHZ A;  1NGD A;  5FPN A;  1IG8 A;  4ZTJ A;  4YOX A;  4JI6 K;  3DM2 A;  3KZB A;  2YJF A;  5HRN A;  3CCS N;  4DHY A;  4K25 A;  4XIU A;  4AHR A;  4I9Q A;  1WBD A;  2R7Y A;  1BL3 A;  3WEE A;  4BWM A;  1D9D A;  2GWK A;  5FLX O;  3TAQ A;  2KW4 A;  4BC3 A;  4DMN A;  4CHP A;  3SAG A;  2WON A;  4DV6 K;  4IJA A;  5GAD P;  3LZJ A;  4BRP A;  3QEV A;  3OBY A;  3MN6 A;  2VWK A;  5AR0 A;  4C8O A;  2Z1H A;  3GL1 A;  4EIA A;  1NOY A;  4KRF A;  1K8K B;  4CJ5 A;  3CCQ N;  3M5R A;  4FZX C;  4K8X A;  4BRN A;  3DI6 A;  4H4O A;  4K0K K;  2RHK A;  3PO5 A;  3OYH A;  2DY4 A;  3CER A;  1TK8 A;  3P1G A;  3NE6 A;  4YFU A;  3HM9 A;  4MO4 A;  4MLE A;  4NCG A;  2CGJ A;  4CEE A;  4L3Q A;  4IFY A;  3TAB A;  3TAP A;  3D2E A;  4LC9 B;  3CJ7 A;  5AZJ A;  3D2F B;  3TSQ A;  4CEA A;  3VEZ A;  5JLF A;  5J2M A;  4N5S A;  4DU1 A;  2Z1G A;  3RTV A;  2E88 A;  4B9L A;  3KJV A;  2G8I A;  4NB4 A;  4DV2 K;  4JS5 A;  4IZ9 A;  1QZ6 A;  4IO8 A;  5D3G A;  3JXU A;  4GKK K;  2GUP A;  3HBT A;  3M3Z A;  3L2U A;  3UKU B;  2ITG A;  1U48 A;  3PX4 A;  1OVY A;  4O0I A;  1RCH A;  5M1F A;  3S3N A;  3L0Q A;  2W6L A;  3Q7B A;  3WNE A;  3V9Z A;  1HKB A;  4ELU A;  3AA4 A;  2E4L A;  1Q86 O;  1LOT B;  2KQ2 A;  2G8K A;  3ZX2 A;  3NBP A;  1U47 A;  1TAU A;  3PX6 A;  1Q9Y A;  1U49 A;  1GLA G;  3AO1 A;  3AAP A;  4X62 K;  3KWI A;  5DMR A;  3P39 A;  4CHO A;  4KKO A;  1U45 A;  2BTF A;  5AQG A;  2HHU A;  4JKD A;  4HCC A;  1BQM A;  3DLE A;  4ISE A;  1NGI A;  2ZF5 O;  2JWK A;  5CYM A;  3ZX0 A;  4CGI A;  4H5V A;  5AQR A;  4LSL A;  3CJA A;  4CJ7 A;  4KHY A;  1SZ2 A;  1XWL A;  2VG5 A;  4WF9 L;  1LWC A;  3OYD A;  4CEZ A;  4FJG A;  3R1X A;  5HP1 A;  3VA0 A;  4IBN A;  4DWI A;  2D0C A;  1IKY A;  1X9S A;  4QCL A;  1NK5 A;  1RFQ A;  1RTD A;  4KTZ A;  3ZT4 A;  3L4I A;  2QK9 A;  5LMU K;  5CZ1 A;  2YX6 A;  4CZE A;  4CIG A;  2RN2 A;  4BG8 A;  4C1N K;  2YI1 A;  4DSF A;  2ATQ A;  3ZEU B;  4HUE A;  4DLG A;  1JLB A;  4QS7 A;  2YNH A;  1ATS A;  3UB5 A;  5BN8 A;  2QW9 A;  1NNE A;  2HHS A;  1GOC A;  1A5V A;  1YTU A;  4B1Z A;  4FCY A;  2A6A A;  4CHY A;  1N33 K;  3V1R A;  3AVG A;  3O6W A;  3CMA N;  3HM8 A;  1QQO A;  4A5A A;  1RT1 A;  4NYN A;  4FZY A;  3T7Z A;  1NK8 A;  3MED A;  4Z4E A;  4N47 A;  1UOC A;  4CGD A;  4B9M A;  1U6Z A;  3HTV A;  3V1O A;  3QEW A;  3G10 A;  3O5B A;  3QDK A;  2Q0U A;  2RPI A;  4RG8 A;  2Y1I A;  1N6Q A;  4BQZ A;  2OA8 A;  1LW0 A;  1YAG A;  4CGF A;  4J2D A;  3VPZ A;  3GG4 A;  2AA4 A;  3VEN A;  4R79 A;  2A1R A;  1LW2 A;  3SCX A;  4RW8 A;  3O80 A;  2XY6 A;  2GEM A;  5BRD A;  3P4I A;  4B1V A;  1ASV A;  1NK4 A;  1S6P A;  3I55 N;  3P38 A;  1J54 A;  3BUZ B;  3PX0 A;  2O8F B;  4EHT A;  2UU9 K;  1S3X A;  4KHN A;  1YXQ A;  3EZW A;  4NLB A;  2YHX A;  3AVF A;  3T19 A;  4M3R A;  2ASM A;  3G4S N;  3D2F A;  4DSK A;  1ZYQ A;  2QEX N;  2VG7 A;  4CJV A;  4FPA A;  1XHX A;  4J2B A;  1HYS A;  3VQQ A;  2WBN A;  3O9Q A;  4CHN A;  4XEI A;  2JWL A;  1VSE A;  1O1W A;  5GIN A;  1BHL A;  1VQ9 N;  4BRE A;  3UKR B;  1KVC A;  2OYQ A;  1RBU A;  4CBW A;  3ASM A;  2X74 A;  1Q18 A;  4IG3 A;  3O08 A;  3V9S A;  1ZBS A;  3K5L A;  1S1V A;  1S9G A;  3L2W A;  5ELZ A;  5AQU A;  2WTU A;  1DKG D;  1WSJ A;  3DXM A;  1NG9 A;  4E7K A;  3M8S A;  3ZLJ A;  3BEX A;  1KAY A;  3ULD A;  1XMO K;  3MEG A;  3CYM A;  3NFA A;  3DYA A;  2E1Z A;  1KRP A;  2G8W A;  1YVN A;  1RDU A;  4E1M A;  4OLB A;  3ZSX A;  4FPB A;  1RTH A;  4OGC A;  4FJL A;  2H3G X;  3QB0 A;  1I39 A;  4H5T A;  5AQW A;  1ITG A;  3L3V A;  3B6P A;  4AHT A;  4W5O A;  2IVP A;  1U4B A;  4BRO A;  4OO1 J;  3LL3 A;  4I2Q A;  3OYI A;  1XNQ K;  3TWH A;  3CJ9 A;  4C23 A;  2O8E B;  2FSJ A;  3KK2 A;  3IRX A;  2BH1 A;  1HMV A;  4B8C A;  4CES A;  1BDG A;  5HRR A;  1ATN A;  4I7F A;  4CF9 A;  5C42 A;  1NGH A;  1C0G A;  1NBW A;  2CGK A;  4U67 L;  4DTP A;  1X1P A;  1BO5 O;  3U3G A;  4A62 A;  3OHR A;  3O4W A;  1SAZ A;  3ZSY A;  1ZC6 A;  2YKN A;  3VQ5 A;  4OKK A;  4ILH A;  4KHW A;  1J9A A;  1BIZ A;  4HUG A;  4GVE A;  3IAY A;  3VQ8 A;  4IKF A;  4JI4 K;  3EL2 A;  3D0P A;  3L4Q A;  2WC9 A;  2B4J A;  2A41 A;  2DFF A;  4CZF A;  3QIO A;  2GBZ A;  3CJ1 A;  1N8R O;  1ZBL A;  1NGF A;  2F8T A;  4BWJ A;  4BRQ A;  3DXK A;  4JI5 K;  2FSN A;  2P9N A;  3K9K A;  1S72 N;  4UY8 O;  2NRW A;  1WNS A;  3EKU A;  3ZT0 A;  4OLA A;  1HJO A;  1NKC A;  3PLA A;  4FO0 A;  4DFP A;  4E1J A;  4EFH A;  1LWE A;  5KQ8 A;  4BDP A;  3J81 O;  1TK5 A;  4ILG B;  1SUQ A;  3TR8 A;  2QKB A;  1W97 L;  2F7T A;  3FGU A;  4Z4G A;  4PQU A;  3OW2 M;  3E1Y A;  2XY7 A;  1VSF A;  4CGJ A;  1HKC A;  3EE8 A;  4M3U A;  1NGA A;  4CK3 A;  5LJW A;  3U3Y A;  3DLH A;  2QWN A;  3C6H A;  1WSF A;  4JI7 K;  3ZYY X;  1G99 A;  2P51 A;  5AQJ A;  5M1Q A;  2ITM A;  4M3W A;  1Q7Y O;  4CK2 A;  3WQU A;  2HF3 A;  4NLC A;  5KRT A;  2IIR A;  1NJW A;  4KB1 A;  1XNR K;  2VGM A;  3O8M A;  4IO9 L;  4LFC K;  4BE1 A;  4UQG A;  1K6Y A;  4H5R A;  3L2Q A;  4CBX A;  4BR0 A;  3H46 O;  3A5N C;  4QS9 A;  3VQB A;  1S6Q A;  3WT0 A;  4A59 A;  4FWK A;  4BE0 A;  4B9S A;  2VQE K;  3LAM A;  2D1K A;  3AGK A;  5AQH A;  3I33 A;  2IAJ A;  3LPT A;  2OAN A;  3WXI A;  1VSL A;  4BE2 A;  3CF5 L;  4F3O A; 
#chains in the Genus database with same CATH homology
 3RMC A;  1L3U A;  1HNI A;  1S5J A;  3SJJ A;  4ELT A;  3C6U A;  4W5Q A;  1HPZ A;  1SKW A;  2EX3 A;  4ZTJ A;  1TKZ A;  5C25 A;  4IDK A;  2HVI A;  1CXQ A;  3IG1 A;  3DM2 A;  3A2F A;  4OJR A;  1BQN A;  3KLF A;  5HRN A;  3HST B;  3ZT2 A;  3QNN A;  3SQ2 A;  4NYF A;  4AH9 A;  4XIU A;  4ELV A;  1RDA A;  3CM5 A;  3D45 A;  2FBT A;  1KLM A;  4I2P A;  4H8K A;  4AHR A;  4JS4 A;  2IS3 A;  4I9Q A;  4J2A A;  2HMI A;  1FXX A;  3WNG A;  2R7Y A;  3S3O A;  3I0R A;  1BL3 A;  2YNF A;  2G8U A;  4FVM A;  4BWM A;  2RF2 A;  3NAE A;  1D9D A;  3HK2 A;  1REV A;  1NJX A;  3PUF A;  3M8Q A;  4W5R A;  3TAQ A;  2KW4 A;  3AVA A;  4DMN A;  4CHP A;  1KCF A;  5CZ2 A;  3O3H A;  3NH0 A;  2WON A;  3V9X A;  1D9F A;  2OPP A;  3VQE A;  4FM0 A;  3LZJ A;  3EYZ A;  4DSE A;  3MEC A;  3RRG A;  3QEV A;  4DQR A;  1JLA A;  4FW1 A;  4FZZ A;  1EXQ A;  3TAN A;  1Q9X A;  3DLG A;  4DU4 A;  2VWK A;  4DF8 A;  4C8O A;  2Z1H A;  1A5X A;  3VQA A;  3OS2 A;  3OYA A;  3HPG A;  2DTU A;  3ZT1 A;  1NOY A;  3VA3 A;  4KRF A;  3DLB A;  4CJ5 A;  4FZX C;  3OYJ A;  4K8X A;  1TKD A;  1IKW A;  1RBT A;  3DI6 A;  4H4O A;  3ALY A;  1L3S A;  4DTN A;  1IH7 A;  3OYH A;  3PO5 A;  1WN7 A;  2B6A A;  2D5R A;  3AVB A;  3ISN C;  3MEE A;  2HHT A;  2DY4 A;  1EP4 A;  1NK7 A;  1TK8 A;  3P1G A;  4FJM A;  4B3O A;  3NE6 A;  4GVM A;  3KK3 A;  3ZSZ A;  4YFU A;  3KK1 A;  3B6O A;  3OJS A;  5KGX A;  3HM9 A;  2XY5 A;  1N5Y A;  3SQ1 A;  1QSS A;  1RTI A;  5C24 A;  2P5O A;  1TAQ A;  3AO4 A;  4Y1D A;  2ETJ A;  2HNZ A;  3V9U A;  1UA1 A;  4O0J A;  3UIQ A;  4RW7 A;  4CJK A;  4M42 A;  4NCG A;  1L5U A;  2EHG A;  1BI4 A;  1A5W A;  4DFK A;  1NJZ A;  4KI6 A;  3ITH A;  3NF7 A;  3OYB A;  4CEE A;  3OYC A;  2YHA A;  3AO3 A;  3BGR A;  4IFY A;  3TAB A;  3TAP A;  3PY8 A;  3ZSW A;  1JLQ A;  4CJW A;  3NGZ A;  4Q5V A;  2X6S A;  4EZ9 A;  3AVK A;  1QHT A;  4CEA A;  4FJ8 A;  3NF6 A;  3SV3 A;  4B9N A;  1IKV A;  1SL1 A;  2P5G A;  3KD1 E;  4QOZ B;  5J2M A;  1I3A A;  4N5S A;  1SKR A;  3CFR A;  4DU1 A;  4FM2 A;  4DTS A;  3CFP A;  5FRM A;  2BGG A;  3SNN A;  2Z1G A;  3RTV A;  4DQP A;  1JXB A;  2PY5 A;  1JLG A;  1XI1 A;  2G8V A;  4B9L A;  4CJF A;  4YNQ A;  3KJV A;  3LZI A;  2G8I A;  5HRP A;  5T7B A;  5SZT A;  1RT7 A;  4KFB A;  2G8H A;  4CIF A;  4JS5 A;  1S1U A;  3TAG A;  1QSY A;  5D3G A;  1HYZ A;  3PO4 A;  2KTQ A;  3NF9 A;  3L2U A;  2ITG A;  4CIE A;  3PX4 A;  1U48 A;  1BIS A;  4O0I A;  1RCH A;  3S3N A;  4KHS A;  3WNE A;  3V9Z A;  3LP3 A;  4ELU A;  1C0T A;  2IGI A;  1UWB A;  3AA4 A;  1F21 A;  3DMJ A;  3C94 A;  1C1B A;  2YKM A;  4CJL A;  2E4L A;  5E41 A;  1RDC A;  2XY8 A;  4ID1 A;  3ZT3 A;  1Q9Y A;  1FKP A;  1RT2 A;  1JKH A;  2KQ2 A;  2D0A A;  2G8K A;  3DRR A;  3DRP A;  4ZHR A;  4BAC A;  1KFD A;  3NBP A;  4BDY A;  1U47 A;  1C1C A;  3PX6 A;  2IC3 A;  4TSX A;  3RMA A;  4CFA A;  2D0B A;  3AO1 A;  5HRO A;  1U49 A;  4KHU A;  2I5J A;  1D8Y A;  3S9H A;  1XC9 A;  5DMR A;  3NH1 A;  1U04 A;  4CHO A;  3MXM A;  1ZBF A;  1B9F A;  3SPY A;  3SYZ A;  1VSK A;  1QTM A;  4ID5 A;  4Z4I A;  1C0U A;  4KKO A;  1U45 A;  3DLK A;  2HHU A;  3CQ8 A;  4CJR A;  4FXD A;  4FJI A;  4FLZ A;  4B9U A;  4Z0U A;  2FC0 A;  4E3S A;  1BQM A;  3DLE A;  3KLE A;  4HCC A;  1HYV A;  4M3Y A;  4M3Z A;  1S1T A;  4KRE A;  1NOZ A;  4JRP A;  3F9K A;  2YV0 X;  5CYM A;  2HHX A;  3F73 A;  4AHV A;  4CGI A;  4F4K A;  1JL1 A;  1FK9 A;  4LSL A;  3K5M A;  4F3T A;  4KV8 A;  4KHY A;  3AVI A;  2VG5 A;  1XWL A;  5KRS A;  3OYD A;  1LWC A;  4CFC A;  1T7P A;  4CEZ A;  4PUO A;  3ZSO A;  4FK2 A;  4CEO A;  4KHQ A;  2PYJ A;  2HHQ A;  4OPJ A;  4FJG A;  5HLF A;  1DTT A;  3DLR A;  4FLU A;  5HP1 A;  4KI4 A;  3VA0 A;  3P5J A;  1NK0 A;  5K14 A;  4IBN A;  4DWI A;  2D0C A;  1IKY A;  1X9S A;  1NKB A;  1TL3 A;  3TAM A;  4QCL A;  2YHB A;  1NK5 A;  1C1A A;  1RTD A;  4KTZ A;  3ZT4 A;  2QKK A;  2QK9 A;  4PWD A;  4CGG A;  1TGO A;  4BDZ A;  3E01 A;  1DTQ A;  3AVC A;  5CZ1 A;  4EP4 A;  3K59 A;  4CIG A;  4CJE A;  2RN2 A;  4ZTF A;  4DSF A;  3V4I A;  4AHU A;  5JS1 A;  2ATQ A;  1BIU A;  4HUE A;  4DLG A;  1JLB A;  4OGE A;  2YNH A;  2OPR A;  4FLW A;  3RRH A;  2HW3 A;  2HHS A;  4DQI A;  3KIO A;  4OKE A;  1GOC A;  1A5V A;  1VRT A;  3AA2 A;  4E7J A;  1YTU A;  4FCY A;  4CHY A;  1BCO A;  4GMJ B;  3LDS A;  2GV9 A;  2O4G A;  3AVG A;  3V1R A;  4CE9 A;  1HRH A;  3G0Z A;  5CY4 A;  3TAE A;  4LD0 A;  4FW2 A;  3HP6 A;  3T3F A;  1RT1 A;  3O4Q A;  1LAW A;  4NYN A;  2DFE A;  3VQ4 A;  1IG9 A;  3BDP A;  4FZY A;  2XHB A;  3V9W A;  3TI0 A;  2QXF A;  1S1W A;  3C6T A;  4ICL A;  4F8R A;  1JLF A;  1NJY A;  1CZB A;  1QE1 A;  4Q0B A;  4H4M A;  1NK8 A;  3LWM A;  3RR7 A;  3MED A;  2W42 A;  4Z4E A;  4Y1C A;  4N47 A;  3I8D A;  1UOC A;  4CGD A;  3DOK A;  4B9M A;  2WOM A;  1SKS A;  1WSI A;  3V1O A;  4I9L A;  3QEW A;  3G10 A;  3PV8 A;  3NF8 A;  1BI4 B;  3LPU A;  4FJ9 A;  2OPS A;  5I42 A;  1KVA A;  2GUI A;  2RPI A;  4RW4 A;  4RG8 A;  4M3T A;  3HT3 A;  2Y1I A;  1N6Q A;  4FK0 A;  5HBM A;  2BAN A;  4G1Q A;  4EP5 A;  2OA8 A;  1LW0 A;  3V81 A;  1KSP A;  4DQS A;  4CGF A;  3QES A;  3KLH A;  4CFD A;  4J2D A;  1HQU A;  4CEB A;  3QIN A;  1W0H A;  3VQ7 A;  3OS1 A;  1WSH A;  2A1R A;  1LW2 A;  3K58 A;  1L3T A;  3I0S A;  1YTA A;  3SCX A;  4RW8 A;  3HJF A;  2XY6 A;  3AVM A;  1RDB A;  3QER A;  3AVL A;  1BCM A;  3OYM A;  3KTQ A;  2HVH A;  3KKR A;  5KI6 A;  4DG1 A;  2X6N A;  3VQD A;  1ASV A;  4RW6 A;  1R0A A;  1S9E A;  3FFI A;  5KTQ A;  1NK4 A;  1S6P A;  2A1S A;  2JGU A;  2IDO A;  3T1A A;  4DSL A;  1JL2 A;  4Z4H A;  1J54 A;  3KLI A;  3PX0 A;  1NK6 A;  3H08 A;  1TL1 A;  2HHV A;  2HND A;  4NCA A;  3HP9 A;  3QEP A;  4KHN A;  3OYK A;  5J2P A;  1CXU A;  1SL0 A;  3T19 A;  3O3G A;  3AVF A;  2JLE A;  4M3R A;  4OVL A;  4E7H A;  3V6D A;  2XO7 A;  4DU3 A;  4R5P A;  4CEQ A;  4DSK A;  1ZBH A;  1D5A A;  1ZYQ A;  3RWU A;  4CJU A;  4FK4 A;  1HQE A;  2HB5 A;  2LSN A;  2VG7 A;  4CJV A;  3OYL A;  1VK0 A;  3CM6 A;  4C8M A;  1XHX A;  3EZ5 A;  4DLE A;  2HNY A;  4E7I A;  4AHC A;  1X9M A;  1RT3 A;  4J2B A;  3C95 A;  4CED A;  3VQQ A;  1HYS A;  1JLC A;  1VSM A;  4KB0 A;  4CHN A;  3AA3 A;  3LAK A;  4CEF A;  2PZS A;  4JRQ A;  1TKT A;  2P1J A;  2YNG A;  3QEI A;  1RT5 A;  3KD5 E;  1VSE A;  2PYL A;  1O1W A;  1BHL A;  4FJX A;  1KVC A;  3VQC A;  2OYQ A;  1YT3 A;  1RBU A;  2OZM A;  1ZBI A;  5KGW A;  3KKS A;  4DTM A;  4CF1 A;  3AV9 A;  1CLQ A;  4DQQ A;  1VSJ A;  4N56 A;  3ASM A;  2X74 A;  4HUF A;  1W9H A;  3JSM A;  5J2N A;  4IG3 A;  3SQ4 A;  2B5J A;  1RTJ A;  1SL2 A;  3LWL A;  1S1X A;  4E19 A;  3V9S A;  3K5L A;  4W5N A;  1S1V A;  1S9G A;  1YVU A;  4FJJ A;  3HXM A;  3VQ9 A;  4RW9 A;  4FLY A;  3NGY A;  4DTU A;  4CEC A;  3L2W A;  3AVH A;  4KTW A;  3TAF A;  1KLN A;  1WSJ A;  5I3U A;  1QSL A;  3LAL A;  3LP1 A;  4CER A;  2FBV A;  1XHZ A;  4KO0 A;  4CF2 A;  4E7K A;  4DFM A;  3OYE A;  3M8S A;  4LSN A;  3K5N A;  3ULD A;  3RMD A;  2XRI A;  4DTO A;  3L2V A;  4Z4C A;  4EZ6 A;  3MEG A;  1TV6 A;  3CYM A;  4KPY A;  1RT4 A;  4C8N A;  3NFA A;  3WNF A;  4CGH A;  3DYA A;  5EU7 A;  4HTU A;  2KZZ A;  4CFB A;  4E89 A;  4W5T A;  3SUO A;  1UAX A;  2AJQ A;  1KRP A;  2FBX A;  1WLJ A;  2RKI A;  3NDK A;  4E1M A;  2G8W A;  3K2P A;  3K57 A;  3NCI A;  2OZS A;  4FJK A;  4OLB A;  3OYG A;  1BGX T;  2ZD1 A;  1RTH A;  4MFB A;  4OGC A;  3ZSX A;  4HVJ A;  4DTJ A;  4FJL A;  1QQC A;  4IFV A;  5HRS A;  1G15 A;  3O3F A;  3SV4 A;  3IS9 A;  3SUQ A;  4F2S A;  1I39 A;  1ITG A;  3L3V A;  2Z1I A;  3B6P A;  1RDD A;  3LP2 A;  5FRO A;  3HL8 A;  3ZCM A;  4AHT A;  2E6M A;  4W5O A;  3K5O A;  3OY9 A;  2F96 A;  4FJ5 A;  1FKO A;  3VN5 A;  4F2R A;  1U4B A;  3VQP A;  2KZM A;  2KFN A;  1VSI A;  4K8Z A;  3SQ0 A;  1CZ9 A;  1IKX A;  1RBS A;  3U6F A;  2BDP A;  4FLV A;  3MXJ A;  4B8A B;  2Q3S A;  4I2Q A;  1WSG A;  3OYI A;  4C8K A;  3TWH A;  4Z4F A;  1WSE A;  4IG0 A;  3ZSQ A;  3EY1 A;  4HCB A;  1HNV A;  1Z25 A;  2FBY A;  3TAR A;  3KK2 A;  3IRX A;  4WE1 A;  3SZ2 A;  4CF8 A;  1HMV A;  4B8C A;  1MU2 A;  4O4G A;  4CES A;  4OPK A;  4E1N A;  1L3V A;  5HRR A;  4DFJ A;  4I7F A;  1JLE A;  1NKE A;  4CF9 A;  5C42 A;  3THV A;  2IOC A;  3MAQ A;  4B9T A;  4FLT A;  4FJ7 A;  4DS4 A;  4DSJ A;  4LH5 A;  1RIL A;  4OKJ A;  4DTP A;  1X1P A;  3U3G A;  1RBV A;  4CJT A;  1T8E A;  2G8F A;  4DS5 A;  1WAF A;  1IO2 A;  3ZSY A;  2E6L A;  3L8B A;  2YKN A;  3VQ5 A;  3NGI A;  1JXE A;  4OKK A;  3SI6 A;  4KHW A;  1J9A A;  1BIZ A;  1KTQ A;  3RMB A;  4HUG A;  1LV5 A;  3IAY A;  4FJN A;  2OPQ A;  4L8R B;  3VQ8 A;  4IKF A;  3QEX A;  3SUP A;  4C8L A;  3D0P A;  4LY7 A;  2B4J A;  4MQ3 A;  4CJP A;  3M8P A;  2DFF A;  1DLO A;  3NHG A;  3QIO A;  2GBZ A;  3OVN A;  4M3X A;  1ZBL A;  5DK5 A;  4FLX A;  2X78 A;  3HVR A;  2F8T A;  2VWJ A;  3AVJ A;  1Y97 A;  4O44 A;  4BWJ A;  4DF4 A;  1ASU A;  4B08 A;  3LAN A;  3OS0 A;  4KTQ A;  5SWM A;  2VG6 A;  4KAZ A;  1C0M A;  3CFO A;  4PA1 A;  3JYT A;  1TVR A;  1C6V A;  1T05 A;  2ZE2 A;  4J2E A;  2NUB A;  1UA0 A;  1EKE A;  3OYF A;  2Y1J A;  1RT6 A;  1WNS A;  3DOL A;  4QAG A;  1EX4 A;  3QIP A;  3ZT0 A;  1ZBU A;  4OLA A;  3HVT A;  4M45 A;  1VRU A;  1GOA A;  3M8R A;  3HPH A;  1NKC A;  3ZSR A;  4DFP A;  1T03 A;  1LWE A;  1TK0 A;  4O5B A;  4CJ3 A;  4CHQ A;  1EET A;  1KVB A;  4DTX A;  4GW6 A;  4BDP A;  4CCH A;  2HHW A;  1TK5 A;  3WNH A;  1SUQ A;  4AHS A;  1QS4 A;  3TR8 A;  3AO5 A;  1ASW A;  2QKB A;  3LP0 A;  1Z26 A;  5JS2 A;  4Z4G A;  1SV5 A;  4PQU A;  3SPZ A;  4M41 A;  2XY7 A;  1VSF A;  3HYF A;  4CGJ A;  4JLH A;  4FJH A;  2KFZ A;  1TKX A;  2ZQB A;  3AA5 X;  3V1Q A;  1X9W A;  3O4N A;  4N76 A;  4M3U A;  5J2Q A;  4CK3 A;  3QET A;  3U3Y A;  3MXI A;  3QLH A;  1J5O A;  3DLH A;  1WSF A;  4CJQ A;  3HPO A;  4FYD A;  3ZSV A;  3S3M A;  1GOB A;  2P51 A;  4CF0 A;  4CJS A;  3L3U A;  3QNO A;  4M3W A;  4CK2 A;  4HHT A;  3DRS A;  1B9D A;  5KRT A;  4PY5 A;  2DFH A;  1WAJ A;  1VSH A;  1Q8I A;  1NJW A;  4NCB A;  4DTR A;  3AO2 A;  3KLG A;  3SUN A;  4B9V A;  1B92 A;  5J1E A;  4KB1 A;  4DSI A;  1VSD A;  3OJU A;  2BE2 A;  4BE1 A;  3RR8 A;  4CJ4 A;  1K6Y A;  4UQG A;  3L2R A;  4AIL C;  1J53 A;  3L2Q A;  4FM1 A;  3HO1 A;  1RNH A;  3P83 D;  4O55 A;  3NH2 A;  3VQ6 A;  4CK1 A;  3VQB A;  4BE0 A;  1S6Q A;  4LH4 A;  4B9S A;  1LWF A;  2F8S A;  3OYN A;  3LAM A;  3AVN A;  1NK9 A;  1RBR A;  4E7L A;  5FDL A;  2IAJ A;  3LPT A;  1LAV A;  2YNI A;  3QO9 A;  1HJR A;  3CG7 A;  5CYQ A;  1TAU A;  1KFS A;  4N41 A;  1VSL A;  4BE2 A;  4E0D A;  2O4I A;  2Z1J A;  5FRN A;  4F3O A;  4CHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...