3NF6A

Structural basis for a new mechanism of inhibition of hiv integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for a new mechanism of inhibition of HIV-1 integrase identified by fragment screening and structure-based design
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nf6A00
1JL2A 4E0DA 3AVHA 4NYNA 1VSFA 1RT6A 3AVMA 3SUNA 4PY5A 2FBVA 4M41A 4O4GA 2G8UA 1QSYA 4W5NA 4DSEA 2OYQA 3IRXA 3SNNA 3LP1A 4DG1A 3KLHA 1UA0A 1F21A 3ZSOA 3K2PA 4CGIA 3MAQA 4B3OA 4C8NA 4HUFA 1KFSA 5J2MA 1Y97A 4M45A 1BGXT 4W5RA 3SUQA 4FM2A 4F3OA 4CEFA 3QERA 3ZSRA 5J2PA 3DLKA 1C0UA 3MECA 4KO0A 4CJEA 5J1EA 3NHGA 4FYDA 4OPKA 2DFHA 3HL8A 3T1AA 4IG0A 4Z0UA 4OGCA 4LH4A 3LZIA 4N76A 1CZ9A 1C1BA 3U3YA 3AA3A 4OKJA 1S1WA 2DFEA 3LPUA 5K14A 2Z1JA 1NJWA 1NKCA 2Z1GA 1WSFA 2LSNA 3L2RA 2VWKA 3K58A 4CF9A 4CK3A 3VN5A 2HHUA 1S1VA 1RBTA 3H08A 4CJRA 3KD1E 4HCCA 4CGGA 5J2QA 3AVJA 4BE1A 2XRIA 4CJLA 4O0IA 4KFBA 3NF6A 3SV4A 2YKNA 2YKMA 4Z4CA 1WSJA 4F8RA 4DU1A 1QTMA 4DFKA 1VSKA 1RTHA 3HT3A 5HBMA 3MEGA 3NDKA 4DSFA 3ZSQA 4KB1A 4FK2A 3TWHA 3HXMA 1IKVA 1WLJA 3JSMA 4FZYA 3IAYA 3VQ4A 4CHZA 1TV6A 2B4JA 4KPYA 4RW4A 1JXEA 2G8KA 4Z4EA 1NJYA 1S6QA 4L8RB 3M8QA 1KLMA 4CHYA 4CGJA 4N5SA 2KFNA 5HRSA 2E6LA 5KI6A 1J5OA 4C8KA 1CXUA 4YNQA 3NGYA 3SUPA 3HPGA 3VQ9A 3PX0A 1B9FA 1BCMA 3AA4A 5D3GA 3SPYA 4CE9A 2NUBA 3K57A 4BWJA 4CF2A 3NF8A 3QEIA 1TAUA 4B08A 1REVA 3TAMA 1N5YA 4N56A 1W0HA 1KVBA 1ASUA 3PUFA 1ITGA 1JLAA 4GMJB 3HK2A 3NCIA 2JLEA 1RT2A 1JXBA 4J2BA 4JS5A 1QSLA 2OPQA 3DLGA 4FK4A 4E7HA 3OS1A 3SI6A 3V9SA 3KIOA 3CYMA 4M3RA 3S3NA 3OYBA 3SJJA 1D9DA 2PY5A 2ETJA 3ULDA 2P5GA 1X9SA 3O3HA 3C6UA 3KLGA 2KZMA 1N6QA 3V1OA 2FBYA 1L3UA 3AVAA 3AVGA 1UWBA 5FROA 2RF2A 3ITHA 3D45A 4DQSA 1NKBA 1NK0A 3K5NA 4KKOA 3C94A 3DLRA 3ZSXA 5CYQA 1HPZA 5HRNA 3QESA 2G8FA 1HRHA 4F3TA 1RBVA 2HHWA 1LW2A 1S9GA 3OJSA 3KTQA 4ID5A 1FK9A 1S6PA 4GW6A 1CZBA 3QEWA 4CJWA 4B9TA 1ZBUA 3M8SA 1BQMA 4MQ3A 4CF8A 1C1CA 3AO2A 3OYCA 1IG9A 1JLFA 3NBPA 2KW4A 3VQAA 1VRUA 2JGUA 4QOZB 2W42A 5C24A 2BE2A 3SQ1A 4DQRA 3DI6A 3TAPA 3AVIA 4CGFA 4CJ5A 1UOCA 3DYAA 4CJUA 1KSPA 3VQ7A 3QEXA 2D0CA 1DLOA 4DQQA 4AHRA 3NE6A 1GOAA 3CFOA 4CJ3A 1XHXA 3OYAA 1T03A 2GV9A 1BIUA 2ZE2A 3JYTA 2G8HA 3RR7A 1DTTA 4E1MA 4CFBA 3SPZA 4FM1A 4I9QA 4DWIA 3LZJA 3MEDA 4DS4A 4FLWA 1KLNA 1VSEA 2HNYA 3ZT3A 4FLYA 1Z25A 1WSGA 4CEZA 3RTVA 2Y1JA 4B9SA 4AHCA 3VQ6A 1U48A 1KVAA 2YNGA 3AO3A 3OYEA 4DFMA 2HB5A 4FJNA 2HHVA 1NKEA 1NJZA 4CHOA 1TKXA 1HMVA 4F2RA 3AVLA 4DTXA 2IGIA 3AV9A 1BI4B 1R0AA 1RILA 1LV5A 1Q9YA 1UAXA 4KV8A 1HQEA 1BI4A 4C8LA 4C8OA 3SYZA 2IOCA 4KHWA 4RW7A 3O3GA 4Y1DA 2RKIA 2OPPA 3NAEA 4BE0A 4FCYA 4CEDA 1JLEA 2YNHA 5CY4A 2KTQA 3OYIA 4KHYA 3PX6A 4FK0A 4CJ4A 2D5RA 1JLQA 2OPSA 1RT7A 3O4NA 4CJKA 1X9WA 2X78A 4B9MA 4CEBA 4DS5A 1WSIA 3ZT0A 3K59A 2Y1IA 2QKKA 1T05A 4RW6A 5JS2A 4BACA 3MXMA 3QINA 2HHXA 4FLUA 4I2PA 1W9HA 4M3WA 2PYLA 1SKSA 4UQGA 3VQ8A 4LSNA 1KVCA 4H4MA 3P83D 1LWFA 4IFYA 4AILC 1U4BA 4Z4FA 1J53A 2WONA 3NF7A 4CK1A 1FKPA 3HSTB 3V9UA 3ALYA 3KK2A 2XHBA 3VA3A 4ELVA 4EP5A 4FLXA 3AVKA 3S9HA 4M3XA 3RMCA 2BDPA 3AO1A 3ZCMA 2G8IA 4FJMA 3OYGA 3G10A 3AO5A 2XY8A 4Q0BA 5C25A 3L2WA 4BDPA 5I3UA 2EX3A 4DFJA 3PV8A 4B8CA 3OYLA 2R7YA 4DTUA 2P1JA 4OGEA 1NK5A 3HVTA 2RN2A 4Q5VA 3TABA 1GOCA 1TK0A 2WOMA 4HCBA 1YT3A 3QO9A 1ZBIA 3FFIA 1VSJA 1D9FA 2RPIA 1HNIA 1IKWA 4WE1A 1S9EA 4FVMA 4TSXA 3LP2A 4DTPA 1EKEA 2YV0X 4EZ6A 2KFZA 4CHQA 4DF8A 1FXXA 3CG7A 3OY9A 4I9LA 3VQPA 1RBRA 3LANA 2ZQBA 1KTQA 1C1AA 4IDKA 4CECA 3VQBA 3D0PA 1LAVA 4K8ZA 4FJHA 1QHTA 2VG7A 4CJFA 1L3VA 3SQ2A 4ZHRA 1RDAA 4E7LA 3DLHA 3SCXA 4CFAA 3AVNA 2FBXA 4CHNA 3BDPA 1I39A 2KQ2A 3LWLA 2A1RA 3ZSYA 4H4OA 1BL3A 4FLVA 4FW1A 1D8YA 4Y1CA 1JLGA 4LSLA 3T19A 4EP4A 3F73A 4E7KA 3C6TA 4CESA 1WAFA 4JS4A 3A2FA 1HQUA 5DK5A 1RDDA 1YTAA 4PWDA 5HP1A 5KRTA 4G1QA 4XIUA 3IG1A 3HJFA 3RRHA 2XY5A 1RT1A 1NK7A 3ZSVA 3KK3A 4RG8A 4AHVA 4FJGA 3SQ4A 4QCLA 3O3FA 1WAJA 3BGRA 4CIEA 3ZSWA 3UIQA 4NCAA 3KLIA 4KI6A 1U04A 3V1QA 5E41A 1KRPA 2DY4A 4B9VA 3QEPA 2GBZA 3WNEA 4E19A 3V1RA 4Z4HA 5EU7A 1JL1A 1SL0A 4M3UA 1S1TA 2HW3A 4CCHA 1S1XA 2ZD1A 3CQ8A 1U47A 2KZZA 4KTWA 3NH0A 5DMRA 1NK6A 1J9AA 5T7BA 3L2UA 3SZ2A 3V6DA 4FLZA 1BQNA 4DLEA 1SKRA 2BANA 3AA5X 4KTZA 1TKZA 2B5JA 5KTQA 3S3MA 4AH9A 2HMIA 4R5PA 4KREA 4JRQA 3L3VA 1ZBHA 1TAQA 4HVJA 3OJUA 3G0ZA 3HPHA 4BE2A 2D0AA 2P5OA 5KGWA 4F2SA 4M3TA 1WNSA 3OYDA 3DRRA 4CEEA 3C95A 1Z26A 4N47A 2HVIA 1DTQA 4Z4IA 3ASMA 3SQ0A 1X9MA 1IKXA 4YFUA 3OYHA 1QE1A 1TL1A 2I5JA 1G15A 2DFFA 2F96A 3E01A 1TGOA 2GUIA 3DOLA 4JLHA 3M8PA 4QAGA 3HM9A 4DLGA 4IFVA 4CGDA 3HP9A 3RMAA 3AO4A 4B9LA 2QK9A 4KRFA 3L2VA 2VWJA 1I3AA 3QIPA 4B8AB 3RMDA 5CZ2A 1RBSA 4KI4A 3QEVA 4CIGA 3I0SA 2Q3SA 2OZMA 3QLHA 1NOZA 3VQCA 4FJ9A 2HNZA 1RTIA 1D5AA 4MFBA 3ZT4A 3OS0A 1Q9XA 4CJVA 2IAJA 1S5JA 4OLAA 3LWMA 4BDYA 2IDOA 2D0BA 1O1WA 1YVUA 1HYVA 3QNNA 1EX4A 1EXQA 4CF0A 2B6AA 4CEAA 3RWUA 1JLBA 3PO4A 4DSLA 3ZSZA 3THVA 1KFDA 3WNHA 4CFCA 4W5TA 1RT3A 1BISA 5I42A 4ZTJA 1YTUA 4E3SA 1XC9A 1SL2A 4DSKA 4OVLA 4EZ9A 5SWMA 4NCBA 3AVCA 1RT5A 3EY1A 4DU4A 3HYFA 3K5LA 2A1SA 2E4LA 4OJRA 3AA2A 2XY6A 4DU3A 4KHUA 2BGGA 1KCFA 1A5VA 4LY7A 2VG5A 3HP6A 2HVHA 2HHQA 3L8BA 1NK8A 4IKFA 4N41A 4FJ8A 2YHBA 2AJQA 3KLEA 1XWLA 3VQQA 4DTSA 1QSSA 3OS2A 5CZ1A 3TAFA 3S3OA 2F8SA 5KGXA 3RRGA 3TAGA 3B6OA 3OYMA 4DQPA 1WN7A 2Z1HA 3V81A 3KJVA 3HVRA 3NF9A 3P1GA 4F4KA 3QIOA 4W5OA 4KHNA 4K8XA 5SZTA 3KLFA 2HHTA 4CF1A 1T7PA 3KD5E 4FLTA 1IH7A 1TL3A 4RW8A 3TR8A 4DSJA 3HPOA 4CFDA 4FJ5A 4B9UA 1BHLA 4OPJA 1CXQA 4AHTA 4FM0A 3CFRA 1RCHA 2OPRA 3CM6A 4KHSA 3ISNC 4O5BA 4FJLA 2FBTA 4NCGA 3PX4A 3QNOA 1L3TA 2F8TA 3RR8A 3DMJA 3AVFA 3V9WA 1Q8IA 4CJSA 5HRPA 4BWMA 4BDZA 1WSHA 4DMNA 4CIFA 3I8DA 3RMBA 2YHAA 1LAWA 3LDSA 3DLEA 4CEOA 3K5MA 1BIZA 4CK2A 3ZT1A 1L3SA 4GVMA 1T8EA 4FJIA 1IKYA 2ATQA 1RTJA 4E7JA 1J54A 4E89A 1LWCA 1ASVA 2DTUA 1TKTA 3CM5A 1HNVA 1QQCA 1U49A 4PQUA 3TI0A 3LAMA 5HROA 1C6VA 3NGIA 5FRMA 1VSIA 1NK9A 4J2AA 2YNIA 3VA0A 1RBUA 1VSLA 3OYKA 3M8RA 1HYZA 4HTUA 3OYFA 4DTNA 5C42A 3DRPA 4ID1A 3TARA 4KB0A 3L3UA 4FJXA 1RDBA 1RNHA 3NFAA 1U45A 1ZBLA 1NK4A 1NJXA 3KKRA 2G8WA 4DQIA 5FRNA 4CJTA 4M3ZA 1VRTA 1B9DA 3OYNA 3OVNA 3P5JA 1EETA 1TK5A 4ZTFA 2OA8A 1RT4A 3LALA 5J2NA 4KAZA 1QS4A 2IC3A 2Z1IA 3NH2A 1LW0A 3B6PA 1S1UA 5HRRA 3V9XA 3MEEA 3SUOA 4AHSA 3OYJA 3DM2A 3WNGA 1XHZA 4DTRA 3ZT2A 1UA1A 2PZSA 2IS3A 3VQ5A 3PY8A 2QKBA 4FXDA 4IBNA 4Z4GA 4AHUA 1JLCA 1GOBA 1HJRA 2X74A 3V4IA 3V9ZA 4LH5A 2E6MA 1RDCA 5KRSA 4DTJA 1ZBFA 4M42A 1EP4A 4IG3A 4OLBA 5HLFA 4B9NA 2P51A 2X6NA 3T3FA 2ITGA 3LPTA 2EHGA 5FDLA 2XO7A 3QETA 4PA1A 3DRSA 4LD0A 2OZSA 3WNFA 4J2EA 1SL1A 1TVRA 4C8MA 4E1NA 3NH1A 3TAQA 2PYJA 3LP0A 5CYMA 4FZXC 4FJKA 3LP3A 4KTQA 4FW2A 1MU2A 2O4GA 4HUEA 1JKHA 2FC0A 4OKEA 4H8KA 3VQEA 1VSMA 3MXJA 4CHPA 4W5QA 4E7IA 4HHTA 4DTMA 3AVBA 4O44A 2YNFA 1CLQA 3L2QA 3I0RA 1XI1A 1X1PA 4O0JA 1K6YA 3K5OA 3MXIA 1C0MA 1C0TA 1FKOA 4NYFA 4CERA 4I2QA 3VQDA 4PUOA 4CJQA 3LAKA 4O55A 1A5WA 4JRPA 4DSIA 3PO5A 4CJPA 4ICLA 3TANA 2G8VA 4FJJA 3O4QA 1SUQA 4RW9A 1TK8A 1LWEA 2QXFA 4FJ7A 4DTOA 4DFPA 4ELUA 1B92A 3SV3A 4KHQA 3IS9A 4CGHA 4M3YA 1BCOA 3KK1A 4OKKA 2HNDA 4CEQA 1RTDA 2O4IA 3F9KA 2VG6A 4J2DA 3EZ5A 4DF4A 2XY7A 4HUGA 1SKWA 3NGZA 3EYZA 4FZZA 3CFPA 2X6SA 2HHSA 1ASWA 1TKDA 1VK0A 1VSHA 3HO1A 1A5XA 1L5UA 1ZYQA 3KKSA 4ELTA 5JS1A 4I7FA 3U6FA 1IO2A 3DOKA 1VSDA 3U3GA 3TAEA 1HYSA 1SV5A 1NOYA 3DLBA 1WSEA
chains in the Genus database with same CATH superfamily
1JL2A 2E20A 2P9IA 5BN9A 3AVMA 4JKAA 4X62K 4M41A 4BGAA 1QSYA 2OTLN 2OYQA 4DG1A 2F9TA 1KC8O 4CGIA 3MAQA 3MK6A 4HUFA 1NM1A 1Y97A 4M45A 4W5RA 4F3OA 3ZSRA 2P9LB 5J1EA 3NHGA 3HL8A 3T1AA 5C10A 3CCMN 3LZIA 2BTFA 4H0XB 1S1WA 2DFEA 2Z1GA 2VWKA 1J6ZA 4NB4A 3MX2A 4HCCA 4O0IA 3NF6A 3LM2A 4Z4CA 1NGJA 4X65K 1WSJA 4F8RA 1QTMA 4DFKA 4JKGB 4KB1A 4FK2A 4JYAK 1TYQB 4B3TK 1IKVA 3QMLA 3JSMA 4KH5A 3VQ4A 4FSVA 4CHZA 1TV6A 4KPYA 2QXLA 4RW4A 5EVZA 2G8KA 5DM6L 3WEEB 4DR2K 2KFNA 1VQ8N 5KI6A 1J5OA 4C8KA 1CXUA 4YNQA 3NGYA 1GLAG 5FLXO 4DR7K 4BWJA 1MWKA 1TAUA 2WTUA 3THXA 2QWLA 4JI6K 1YJNN 1RT2A 2OPQA 3SI6A 3V9SA 4M3RA 5M1PA 3OYBA 4FJGA 3MWTA 2KZMA 2HMPA 3Q7CA 1N6QA 4WQ5A 1L3UA 2RF2A 1NKBA 1Z05A 4X66K 1JJ2M 3C94A 3TTDA 5HRNA 2G8FA 1HRHA 5JLHA 1LW2A 1S9GA 3KTQA 3R6MA 1S6PA 3VGLA 1YI2N 3CCJN 4CJWA 3VERA 1ZBUA 3M8SA 4B9TA 3H3OB 1C1CA 3OYCA 2O8FA 3NBPA 5EXWA 2JGUA 5CR4A 1OKJA 3U8XA 3FZMA 2BE2A 3DI6A 3TAPA 3AVIA 4CGFA 3ENOA 1G99A 4CJUA 1NGHA 2FXUA 3QEXA 5C0YA 2D0CA 5IT9O 4AHRA 5C2FA 5ADXH 4IXCA 4O8UA 1XHXA 2GV9A 3H45C 3EO3A 3CJ1A 3VTIA 1DTTA 1U2VB 3AGKA 4CFBA 1Q82O 5TKYA 4FM1A 3LDQA 4DWIA 3UE5A 3RTVA 3E1YA 4WF9L 2V52B 3AO3A 3QBXA 4WFNL 4BRAA 4DFMA 2HHVA 4F2RA 3AVLA 1MDUB 1RILA 1BI4A 3SYZA 2FF6A 3O3GA 2A5XA 2RKIA 2OPPA 4DQ8A 4BE0A 4GV3A 2W41A 4H5TA 5CY4A 2YNHA 4BRFA 2D5RA 4BR2A 1RT7A 3O4NA 1WSIA 2Y1IA 1K9MO 4RW6A 4BQLA 2HHXA 2VCPA 3GOIA 1W9HA 4ILJA 5GINA 1HKBA 3CMAN 1SKSA 4M3WA 1YUWA 4Z4FA 1XQSC 1J53A 3NF7A 3HSTB 3ALYA 2XHBA 3EKUA 3KHYA 3EKSA 3H3NO 4FLXA 3AVKA 3S9HA 3AO1A 3AO5A 2VWBA 4FPBA 1SAZA 3RVCA 4DFJA 4IWVA 3QFUA 3DXMB 3U4LA 2RN2A 3TABA 1GOCA 2WOMA 1YT3A 3KK7A 3CJBA 1D9FA 4JNEA 3R8EA 1VQ9N 3LP2A 1RFQA 1D4XA 4DF8A 4ISGA 1NNEA 1RBRA 4NO7A 1KTQA 2HBJA 1NGEA 2BUPA 4YOWA 3WXJA 4FJHA 5AQVA 4ZHRA 1RDAA 3SQ2A 3J8AA 1GLJO 1X3NA 3SCXA 4CFAA 1YVNA 3AVNA 3ULEB 3S41A 1ATRA 4CHNA 2QA4N 3LWLA 1XNRK 2A1RA 2IVOA 4A57A 4FLVA 4FW1A 3T19A 4LSLA 3C6TA 4CESA 1WAFA 5GADP 4JS4A 1E4FT 1HQUA 3DWLA 3KVGA 5AQUA 4BC2A 4PWDA 1WB9A 3IG1A 3O80A 3HJFA 2F9WA 3CETA 5C15A 1RT1A 4BC5A 4RG8A 1WAJA 4J8FA 1K8AO 3K9JA 1KRPA 1KAXA 4B9VA 3QEPA 4Z4HA 1JL1A 3HOTA 1SL0A 3GL1A 4B1WB 2HW3A 5JVGL 1S1XA 1XNQK 1DKGD 4F9OA 3SZ2A 3V6DA 4DR6K 4KTZA 1TKZA 2B5JA 3HZ6A 3CCUN 4R5PA 4HVJA 3I56N 4BE2A 2D0AA 4JK9A 4M3TA 1WNSA 4MO4A 1HNWK 4N47A 5AQTA 1X9MA 3A0IX 1IKXA 3IDHA 3OYHA 2FF3B 2DFFA 2VQEK 3DXKA 4QAGA 4JLHA 4WYBA 3HP9A 4B9LA 3AO4A 4KRFA 4HWIA 4B8AB 3QEVA 4CIGA 2P9SB 2Q3SA 4JI2K 2WFBA 4BQZA 2A41A 1NMDA 1ZBSA 4OLAA 3WXKA 2D0BA 1YVUA 2CGJA 4CF0A 4CEAA 4M63C 1JLBA 3PO4A 3ZSZA 4WCEL 2AA4A 4ZTJA 4E3SA 1KAYA 4JKCA 4NCBA 4FOEA 1RT5A 2W6KA 3EY1A 1FJGK 3AA2A 3CHWA 5AQJA 3HP6A 5LY3A 5KPRA 2HVHA 1EQYA 3E9OA 4U67L 3OS2A 5CZ1A 2O8DB 5KGXA 4AM7A 3TAGA 4DR5K 4EFHA 3NF9A 2NRZA 4K8XA 3MX5A 2Q97A 3VF6A 2ZJRL 3VESA 3UKUA 4DSJA 5LMUK 1BHLA 4FM0A 3CM6A 5BRDA 4JKEA 3ISNC 3MCPA 2FSJA 4B9QA 3R1XA 3VEYA 4BWMA 1Q81O 1N34K 2HBLA 2GWKA 1WSHA 3I8DA 2YHAA 4CEOA 4FO0A 1RDUA 3E66A 3ZX3A 1IKYA 1RTJA 4M7YA 1LWCA 1U49A 3HOSA 5HROA 3T7ZA 1VSIA 4U7BA 4FWOA 4CZFA 3M3ZA 1RBUA 1HKCA 1HYZA 4CZJA 3L3UA 4FJXA 1NK4A 3TPQA 2G8WA 4V19S 4QS7A 3CMEN 1B9DA 3OYNA 3OVNA 2HBKA 4IZ9A 3M6GA 3WUHA 4GV6A 4KAZA 3AARA 1QS4A 3PIPL 3B6PA 3J7ZO 3P38A 1QVGM 1IV0A 3OYJA 4MO5A 1WOQA 2E88A 4IOCL 4DTRA 1UA1A 2IS3A 3VQ5A 4A5BA 3DAWA 3V4IA 1RDCA 2OTJN 3HSCA 4H0TB 1ZBFA 1NJIO 3SBGA 1C0GA 2ZJPL 4B9NA 5AZJB 3T3FA 4Z4GA 3TTFA 2OZSA 2I7NA 3MN7A 3CCSN 4A5AA 4DB3A 4KTQA 2OANA 1VSMA 3F5TA 4DTMA 3AVBA 4O44A 5AZIA 5AQFA 1X1PA 5M1OA 1K6YA 3MXIA 1BU6O 4CJQA 4O55A 4ICLA 3TANA 2QXFA 1BA1A 1NGDA 4JKBA 5AQKA 2KKZA 1B92A 4CZEA 3IS9A 4CGHA 4BREA 2HNDA 3F9KA 4H03B 3EZ5A 3VMFB 4DF4A 2XY7A 1SKWA 4FZZA 2X6SA 4LF5K 4BR5A 1VK0A 1VSHA 1L5UA 1XC3A 3VF4A 4ELTA 3U6FA 1JCGA 1HYSA 4FPAA 4CW7B 3LDNA 4E0DA 1VSFA 4PY5A 2FBVA 3E9LA 3LP1A 2KHOA 1BO5O 3KLHA 5AQXA 3ZSOA 4B3OA 3CJ9A 1Y64A 3QFPA 2E2OA 3EE8A 3QERA 1C0UA 4OPKA 5AQLA 1M1KO 4UY8O 4YDUC 2QEXN 4IG0A 4OGCA 4NLCA 4N76A 3C6HA 3U3YA 3AA3A 5JVHL 1VQ6N 5K14A 1S3XA 2YCHA 3L2RA 1WSFA 2LSNA 3OW2M 4AQYK 3VN5A 2ZWHA 1RBTA 3AAPA 3H08A 3LDPA 3KD1E 4BE1A 4KFBA 5E26A 4OX9K 1MA9B 4DU1A 5BRHA 3MEGA 1GLFO 3TWHA 3HXMA 4BRKA 4CZMA 4FZYA 4Z4EA 3THYB 3O9QA 4L8RB 5F2RA 3WEEA 4DV6K 3HRGA 3VQ9A 3AA4A 1GLEG 3SPYA 2NUBA 3K57A 4CF2A 3NF8A 4GKKK 1N5YA 1W0HA 1ASUA 3PUFA 1ITGA 5BPMA 1W2BM 4L3QA 1JXBA 3QDKA 3ZEUB 1YXQA 3S3NA 3KIOA 3CYMA 4JI8K 3SJJA 3A5MC 2ETJA 3ULDA 1X9SA 3C6UA 4JKFA 3G25A 3V1OA 5FROA 1UWBA 5M1FA 3ITHA 3D45A 5CYQA 4ID5A 1FK9A 4GW6A 3NMUA 3QEWA 3SBTA 4MQ3A 3VQAA 2KW4A 5TKWA 4DUYK 4QOZB 5C24A 5AQRA 4CBWA 5CE3A 3CQYA 1UOCA 2WBNA 3DYAA 1KSPA 3VQ7A 3O1BA 5JICA 4BRCA 4RTFD 3LL3A 4DQQA 4CZGA 3BUZB 1GOAA 4CJ3A 4JK7A 1HNXK 3OYAA 5AQGA 1BIUA 2ZE2A 3JYTA 1S22A 3RR7A 3N4QA 3CI5A 3SLCA 3SPZA 4GY2B 1U2VA 3LZJA 4FLWA 2HNYA 3H46O 4CEZA 2Y1JA 4AHCA 2YHWA 3EN9A 3ZETB 2YNGA 3O9TA 4R79A 3OYEA 5I9EB 1NKEA 4CHOA 2E2NA 2IGIA 1IBKK 1R0AA 1UAXA 4BRLA 1KQSM 3CC4N 4EAHD 4FCYA 4CEDA 3MWPA 2KTQA 5BN8A 4CJ4A 2OPSA 2X78A 3E9PA 2QKKA 3MXMA 3QINA 4BRHA 4UQGA 3VQ8A 1KVCA 4AILC 2WONA 4CK1A 3V9UA 2NNWA 1E3MA 1VQKN 2BDPA 1T6DA 5B8HA 3OYGA 3G10A 2A40A 4FJMA 4Q0BA 4Z94A 4K42A 4DV2K 4BC3A 1WBDA 3DXMA 4YOXA 5BPNA 1S9EA 4FVMA 4TSXA 1EKEA 3SMSA 2ZF5O 2KFZA 4CHQA 1FXXA 3VQPA 3LANA 2ZQBA 3R9PA 2UXDK 3J80O 1L3VA 2VQFK 4DHYA 4E7LA 3VEOA 5AFUA 4H5NA 4FWSA 1NGGA 1BL3A 4JKHA 3O08A 4EP4A 1MWMA 1D8YA 4LC9B 4OPAA 1HX1A 3F73A 4YOYA 5DK5A 4XIUA 3HBTA 2XY5A 4XH1A 2NRRA 1QQOA 3KK3A 1BDGA 4LF4K 5EX5A 4KI6A 4NCAA 3KLIA 5E41A 3A5LC 4JAXA 4DV4K 3D2FA 3V1RA 5EU7A 4B1XB 1OH5A 2V51B 4CCHA 2Q0UA 2KZZA 3NH0A 5DMRA 1NMNA 1NK6A 5BRFA 4DLEA 3CC7N 4EHUA 1SKRA 2BANA 3AA5X 4GKJK 4KREA 1NGFA 3L3VA 4JRQA 2P9NB 4F2SA 5KGWA 4BRDA 3DRRA 3C95A 1Z26A 2HVIA 4Z4IA 3WXIA 3EE9A 5FPMA 1G15A 3SAHA 1W7AA 2E1YA 3HM9A 3M8PA 3HI0A 4IFVA 2QK9A 3KWIA 3L2VA 3RMDA 2NZTA 5CZ2A 2OZMA 4H0VB 1NOZA 2P9SA 3VQCA 2HNZA 1D5AA 4BR0A 4WFBL 4CJVA 2IAJA 4CD1A 4JD2A 1HYVA 1QQNA 4I6MB 3WNHA 4CFCA 2J4RA 3SK3A 4BRMA 1BISA 4W5TA 5LJVA 2UUAK 1XC9A 4DSKA 4GVEA 1CZAN 3CCVN 4EZ9A 4KH4A 4WFAL 3AVCA 4G9ZA 3PSFA 4DU4A 3HYFA 4HTLA 1KCFA 4LY7A 1XMQK 1BUPA 4BRIA 2P9IB 1NK8A 4N41A 2AJQA 1XWLA 3VQQA 1QSSA 3SJHA 5C2DA 2CH5A 4EIAA 3NVKA 2HBMA 3TAFA 5KQ8A 2F7TA 2F8SA 3B6OA 4BC4A 4ILHA 3QIOA 3LM9A 4QS9A 3KLFA 1GLLO 1IH7A 3TR8A 2O8CB 1CXQA 4DUZK 2O8EB 2KLAA 2E2PA 2OPRA 4DCHA 2GEMA 2FBTA 4NCGA 4FWPA 2HOEA 3PX4A 3QNOA 2F8TA 4CJSA 5HRPA 4BDZA 2Q2RA 3I8BA 3LDSA 3DLEA 4FWKA 3F2KA 1T8EA 1HPMA 2ATQA 3CCLN 4E89A 3TI0A 3NGIA 4MLHA 1NK9A 4J2AA 3VA0A 2GTDA 4CZIA 4KB0A 1U45A 2P9KB 1BG3A 4CJTA 5AQOA 4M3ZA 1VRTA 1VQON 3P5JA 1OH6A 2OA8A 3BZKA 4QS8A 1TUYA 1IJJA 3OA9A 2PBDA 2IC3A 3NH2A 1S1UA 1XHZA 3PY8A 1JLCA 2X74A 2E6MA 2W40A 4BG8A 5AQQA 5KRSA 3O5BA 3GE1A 4DTJA 1EP4A 3BZCA 4K0KK 2EWSA 2EHGA 5FDLA 5AZJA 3FE1A 3U9DA 1SL1A 3TSUA 1P8ZA 4XH5A 4LFAK 4FW2A 2YHYA 4PKHA 1JKHA 2FSNA 4IEEA 3I55N 4E7IA 2YNFA 3L2QA 3I0RA 2O8BB 4CERA 4YORA 3FZLA 4JEPA 3HTVA 3PO5A 4FJ7A 3ATVA 1LWEA 5F1XA 4B1UB 1GLCG 4KHQA 3IUCA 4M3YA 4OKKA 4CEQA 3CJAA 2O4IA 2E2QA 2YJFA 2CH6A 3NGZA 3EYZA 4FWLA 2HHSA 1ASWA 4CVNE 2HSTA 1TKDA 2F4VK 3HO1A 1ZYQA 5JS1A 1N33K 1IO2A 4C1NI 3TAEA 1NOYA 1WSEA 3KWGA 4KHPK 3AVHA 2YI1A 4O4GA 1Q18A 4RWTA 4DSEA 2WUSA 3IRXA 2NLXA 4FL9A 3H1QA 2QWQA 4X64K 4DR1K 1KFSA 2JWKA 5J2MA 3WXMB 3DLKA 1X3MA 4FYDA 3PSIA 4Z0UA 1EWRA 4LH4A 1CZ9A 1C1BA 3G71N 4OKJA 3LPUA 2Z1JA 3FGUA 3K58A 5BR9A 4IJAA 3G6EN 2HHUA 1S1VA 4CJRA 4CGGA 4BR9A 2VGNA 4CJLA 4LFCK 5ADXA 3SV4A 1K8KA 2YKNA 2YKMA 1YITN 4XEIA 1VSKA 3MN5A 5KQDA 3IAYA 4CD3A 3M8QA 1KD1O 3THYA 2ITMA 4CHYA 4CGJA 4N5SA 2E6LA 3SUPA 5AQWA 3CERA 1BCMA 5HL7L 5D3GA 4CE9A 3Q7BA 4B08A 3TAMA 3H6EA 1BOTO 4GMJB 1JLAA 4A61A 4B1YB 4JKDA 3HK2A 5E84A 1YHQN 4J2BA 3D2EB 3JAMO 4E1JA 4FWQA 4OPHA 4CBXA 3ZEUA 2PY5A 3KLGA 3AVAA 3AVGA 4DQSA 3MN9A 3ZSXA 3QESA 3ATUA 1ATSA 1RBVA 3P4IA 2HHWA 3OJSA 3FZKA 1CZBA 4B1VA 1BQMA 4CF8A 4LF6K 3SAFA 3JXUA 3LDLA 4A62A 4DQRA 3P31A 5M1NA 4CJ5A 2PAVA 1DLOA 1LOTB 1T03A 1IBMK 4H0OA 2G8HA 3DXKB 3O6WA 4I9QA 4DS4A 3GDQA 1VSEA 1Z25A 4B9SA 5AQMA 4NXNK 3ZETA 1NJZA 2QWPA 3ID8A 3MDQA 1TKXA 1HMVA 2UXBK 3AV9A 4KHWA 4C8OA 1HQEA 4WQ4C 4C8LA 2IOCA 4RW7A 4Y1DA 3NAEA 2D1KA 5C12A 2UYTA 2H3GX 4FK0A 3QB0A 3O9SA 2QI2A 1X9WA 3VEWA 4B9MA 3TU5A 4DS5A 3ZT0A 3K59A 4B3SK 4BR7A 4BACA 3C7NB 2P9LA 4I2PA 3UKRB 4PL8A 3U9ZA 2PYLA 4LSNA 3P83D 3KK2A 3CQXA 3VA3A 4BVPA 4EP5A 3GG4A 4BVOA 3ZCMA 2G8IA 2XY8A 3UKUB 3L2WA 1HNZK 4BDPA 1K73O 4B8CA 2R7YA 1NK5A 3J7YP 4OGEA 1Q7YO 3HVTA 4Q5VA 1TK0A 3QO9A 5CHIA 4JKGA 2W6LA 3DJCA 1IKWA 1FW6A 1TYQA 4WE1A 3OTOK 2YV0X 3ZYYX 4EZ6A 2YHXA 4FWRA 3TTCA 5BR8K 4IDKA 3VQBA 3D0PA 1LAVA 1IBLK 2E5LK 4LF7K 4IEIA 1QHAA 1I39A 1W97L 3PLAA 2KQ2A 3MCAB 3O9RA 1GLDG 4E7KA 3ZX0A 5AQPA 3CCQN 3FR0A 3A2FA 4YOTA 1YTAA 3BY5A 5LJWA 3K0SA 2D0PA 5EOYA 3ZSVA 1P90A 4AHVA 5H1SQ 3SQ4A 3O3FA 3BGRA 3ZSWA 3V1QA 2DY4A 1YF5L 2Q36A 1VQMN 4E19A 4M3UA 4IOXA 4BRNA 2NRVA 1EWQA 3UB5A 4KTWA 3L2UA 4FLZA 5JMVA 3S3MA 3K9KA 5DM7L 4A2AA 1ZBHA 2DPNA 1TAQA 1TUUA 5AJ3K 2P5OA 4YDUA 2P9NA 4CEEA 4DV3K 4JHDB 3ASMA 3WQTA 5A2QO 3T1HK 2IVNA 2I5JA 5AQZA 2F96A 1JCFA 3E01A 2GUIA 2P9PB 3DOLA 5GAEP 4JI4K 4CGDA 2VWJA 3WQUA 1RBSA 3QICA 3SAGA 1V4SA 3QLHA 3N4PA 1XMOK 4FJ9A 4MFBA 3OS0A 1S5JA 3O8MA 3WT0A 3QNNA 1O1WA 2P9UB 1EX4A 1EXQA 2B6AA 3RWUA 4DSLA 2V7ZA 4I6MA 3VPZA 5AQIA 2QWOA 2A1SA 2XY6A 4DU3A 5GIPA 4KHUA 1A5VA 2VG5A 2HHQA 4K41A 3L8BA 4IKFA 2YHBA 1N36K 4PL7A 4WQ5C 3WXLA 3RRGA 3CCRN 1VQ4N 3OYMA 4DQPA 5AQNA 1WN7A 2ASMA 2Z1HA 5ELZA 4W5OA 4KHNA 4BRPA 3A5NC 5SZTA 2HHTA 1T7PA 3KD5E 4FLTA 4RW8A 3KZBA 4DV0K 2CGLA 4EHTA 3HPOA 4B9UA 4FWMA 4OPJA 2O8CA 4AHTA 3CFRA 1RCHA 2O8EA 1YIJN 4O5BA 1DT9A 3T1YK 2AP1A 1L3TA 1Q8IA 1RGIA 4IO8A 3TSPA 4IJNA 1VQLN 1I94K 1LAWA 3K5MA 2QW9A 4CK2A 5FPEA 3ZT1A 3ULEA 4GVMA 3CF5L 1L3SA 3RSEB 1ATNA 4FJIA 4E7JA 1J54A 1ASVA 2DTUA 1BWFO 5F0XA 3CM5A 4AF1A 1QQCA 4PQUA 5FRMA 3LAMA 1C6VA 3BF3A 3DLLL 4JK8A 1NWKA 3L6QA 3BF1A 3OYKA 4DTNA 3TARA 3DRPA 4ID1A 2A3ZA 4H0YB 1RDBA 1RNHA 3EZWA 3NFAA 1ZBLA 3VGMA 3THWB 2P9KA 1EETA 1TK5A 1RT4A 3LALA 5J2NA 3VETA 2Z1IA 1LW0A 3CPEA 3V9XA 3MEEA 3H1VX 4AHSA 2QKBA 2QWNA 3ZT2A 2PZSA 4IBNA 1HJRA 3V9ZA 5AQHA 4Y0WA 1M90O 4O8KA 4DV5K 5GAGP 3CXCM 4IG3A 3IMXA 5HLFA 2X6NA 2ITGA 3LPTA 4IO9L 1WBBA 2XO7A 3QETA 4PA1A 3DRSA 3VEZA 3WNFA 4RCHA 3CIPA 4C8MA 1NGBA 4E1NA 3NH1A 5CYMA 3CJCA 1YJWN 5IWAK 4FZXC 1MU2A 2O4GA 2QWRA 4HUEA 4OKEA 1OH8A 4ISFA 4CHPA 1CLQA 2E1ZA 1R59O 3VGKA 3K5OA 1C0TA 1FKOA 2O8BA 3LAKA 1A5WA 1SZ2A 4DSIA 4CJPA 2G8VA 1ILYA 3O4QA 4RW9A 1TK8A 4DFPA 4ELUA 4CZLA 2ZGYA 1QVFM 3SV3A 1BCOA 3KK1A 1RTDA 4O5FA 2VG6A 4J2DA 2NRTA 1O13A 3CFPA 3O4WA 3W0LA 4FOIA 2GELA 3KKSA 1E4GT 5EY4A 3DOKA 1J5EK 2PFUA 3U3GA 1U6ZA 2D4WA 1H1VA 4YOUA 4CZKA 4YHHK 4NYNA 1RT6A 3SUNA 3MN6A 2G8UA 4W5NA 3IKMA 2O8DA 4IOAL 4YOVA 4H5RA 3SNNA 2ASPA 1UA0A 1IG8A 1F21A 2GWJA 3K2PA 1ZXOA 4C8NA 1T3VA 1BGXT 3L4QA 3SUQA 4C1NK 4FM2A 4CEFA 1JCEA 5J2PA 3MECA 4KO0A 4CJEA 2DFHA 3QBWA 5BREA 3PIOL 3ENBA 1NJWA 1NKCA 3C0BA 4CF9A 4CK3A 5J2QA 3AVJA 2XRIA 3SMPA 5HOOA 1Z6RA 1RTHA 3HT3A 5HBMA 3NDKA 4DSFA 3ZSQA 2VGMA 2VYPA 1WLJA 1N32K 2B4JA 1KAZA 1JXEA 4JI3K 1NJYA 1S6QA 2ZJQL 1S72N 1KLMA 2OCEA 3CD6N 5HRSA 1HR0K 3HPGA 1HLUA 3PX0A 1B9FA 3CJ7A 4FWNA 3QEIA 1REVA 3THXB 4N56A 3I33A 1KVBA 2RE2A 3D7EO 3NCIA 2JLEA 5GIOA 3J81O 4JS5A 1QSLA 3DLGA 4FK4A 3D2EA 4MLEA 4E7HA 3OS1A 1D9DA 1C0FA 2P5GA 3O3HA 1QZ6A 2E8AA 3D2FB 2FBYA 2HF3A 4DKWA 4PKIA 5FPNA 4NXMK 5KPZA 1NK0A 3K5NA 4KKOA 3DLRA 3AGRA 4F3TA 1HPZA 3OBYA 3A8YA 2ZM6K 4H5WA 2O8FB 1YAGA 3AO2A 1IG9A 1JLFA 1VRUA 2QWMA 3BEXA 2W42A 3VTHA 3SQ1A 4LF9K 3VOVA 3B8AX 3CPWM 5LMNK 1DEJA 4YY3K 5AQYA 1NGCA 3NE6A 4JV5K 3CFOA 3MMVA 4M7XA 2QM1A 2Q0RA 1VQNN 4E1MA 3FFKB 4CBUA 3MEDA 4BR4A 1VQPN 3VENA 1KLNA 3ZT3A 1VHXA 4FLYA 1WSGA 3VQ6A 1U48A 1KVAA 4FJNA 2HB5A 1V4TA 4DTXA 4JD2B 3AY9A 2UUCK 1BI4B 1VQ7N 3VF2A 1LV5A 1Q9YA 4KV8A 4XH4A 3L4IA 3OHRA 1BA0A 3TSQA 1JLEA 3OYIA 4KHYA 3PX6A 1VAZA 1JLQA 2YJEA 4CJKA 1NGIA 3O9UA 4CEBA 2FLOA 1T05A 4JN4A 5JS2A 4FLUA 5FPDA 3C7NA 3UKRA 1SS6A 4H4MA 4IFYA 1LWFA 3ENHA 1U4BA 1FKPA 1RDWX 4ELVA 3EEQA 4M3XA 3RMCA 4ISEA 4IDHA 5C25A 3M5RA 4DV7K 5I3UA 2EX3A 3D6RA 3PV8A 3OYLA 4DTUA 2P1JA 4BRQA 4B3MK 4HCBA 1HUXA 1EO1A 1ZBIA 3FFIA 1VSJA 1Q86O 2RPIA 1HNIA 2D0OA 2JWLA 5AQSA 4DTPA 4PKGA 3CG7A 1T44A 3OY9A 4I9LA 4CJ7A 1C1AA 4BROA 4CECA 4DR3K 4JI1K 4K8ZA 2ASOA 1QHTA 2VG7A 4K43A 4CJFA 3DLHA 2FBXA 3BDPA 4FVUA 3LDOA 3ZSYA 1HKGA 5AR0A 4H4OA 1NG9A 4Y1CA 1JLGA 1GLBG 3O1WA 1RDDA 5HP1A 5KRTA 4G1QA 3RRHA 2FSKA 1NK7A 2QTDA 4QCLA 4CIEA 3UIQA 1U04A 1SQKA 2RHKA 2GBZA 3WNEA 3JS6A 2NRXA 1S1TA 1NLVA 4A2BA 2ZD1A 3CQ8A 1U47A 1J9AA 5T7BA 1BQNA 4KBOA 1OVYA 5KTQA 2HMIA 4AH9A 1DGKN 3OJUA 5JLFA 3G0ZA 3HPHA 1ESVA 4B3RK 3OYDA 1DTQA 1X9JA 3C65A 4JHDA 3SQ0A 4JI7K 4YFUA 1QE1A 1TL1A 2IVPA 1TGOA 4DLGA 3RMAA 2P9PA 5KPTA 1I3AA 3QIPA 4KI4A 5MLCQ 3I0SA 4DR4K 4IFEA 5BPLA 1RTIA 2I7PA 3ZT4A 1Q9XA 4PHTX 3CC2N 1N8RO 3LWMA 3VEVA 2IDOA 4BDYA 3CCEN 4H0PA 5AFUH 2HHHK 3OBWA 4BY9C 2P9UA 1XUPO 3FLCO 4A59A 3THVA 1KFDA 1RT3A 5I42A 2IIRA 2UXCK 1YTUA 1SL2A 2GX9A 4OVLA 3HM8A 5SWMA 3K5LA 2BGGA 2E4LA 4OJRA 1NGAA 3C6AA 4FJ8A 3KLEA 4DTSA 4DV1K 3J7AP 3S3OA 4GNIA 2HF4A 3ZX2A 3V81A 3KJVA 3HVRA 4BRGA 1YJ9N 3P1GA 4F4KA 3FZHA 4CF1A 1TL3A 1QZ5A 2A42A 1WUAA 4CFDA 1LCUA 4FJ5A 3W3DA 2WC9A 1VQ5N 4KH6A 4NLBA 4JI0K 4KHSA 4FJLA 2NRWA 3RR8A 3DMJA 3AVFA 3V9WA 3GBTA 3ID6A 4DMNA 1K8KB 4CIFA 3RMBA 4MDBA 5M1QA 1BIZA 2A6AA 3F9MA 2UUBK 5GAHP 3NVMA 3RSEA 1TKTA 3M1FA 4C23A 3L0QA 2UU9K 1HNVA 1QQMA 1KXPA 2YNIA 1VSLA 3FZFA 3M8RA 4HTUA 3OYFA 5C42A 4DQIA 1NJXA 5FRNA 3IFRA 3KKRA 1NBWA 2V7YA 3THWA 1HJOA 2Q1NA 4BGBA 4ILGB 4WQ4A 4AM6A 4ZTFA 4CZHA 4GV9A 4LF8K 1OVQA 5HRRA 4CI6A 3SUOA 3DM2A 3WNGA 4BG9A 3VEXA 4FXDA 2Q31A 2NRHA 4AHUA 1GOBA 4LH5A 3R3LA 3AAQA 3P39A 4M42A 4OLBA 2YX6A 4MDAA 2P51A 3G4SN 3EL2A 3T69A 4LD0A 4J2EA 5M1KA 1TVRA 3TAQA 2PYJA 3LP0A 4FJKA 2BH1A 3LP3A 1NU0A 1OH7A 4B1ZA 2FC0A 5AZIB 3VQEA 4H8KA 4W5QA 3MXJA 4HHTA 3BP8A 1XI1A 4O0JA 2GUPA 1ZC6A 1C0MA 4NYFA 4I2QA 3VQDA 4PUOA 4JRPA 4FJJA 1SUQA 4JI5K 4K25A 4DTOA 4OO1J 4LFBK 3A5OC 4HUGA 3ZLJA 2ZGZA 1T6CA 5LL6Z 1A5XA 4I7FA 2CGKA 4H5VA 1VSDA 1SV5A 3DLBA
chains in the Genus database with same CATH topology
1JL2A 4E0DA 3AVHA 4NYNA 1VSFA 1RT6A 3AVMA 3SUNA 4PY5A 2FBVA 4M41A 4O4GA 2G8UA 1QSYA 4W5NA 4DSEA 2OYQA 3IRXA 3SNNA 3LP1A 4DG1A 3KLHA 1UA0A 1F21A 3ZSOA 3K2PA 4CGIA 3MAQA 4B3OA 4C8NA 4HUFA 1KFSA 5J2MA 1Y97A 4M45A 1BGXT 4W5RA 3SUQA 4FM2A 4F3OA 4CEFA 3QERA 3ZSRA 5J2PA 3DLKA 1C0UA 3MECA 4KO0A 4CJEA 5J1EA 3NHGA 4FYDA 4OPKA 2DFHA 3HL8A 3T1AA 4IG0A 4Z0UA 4OGCA 4LH4A 3LZIA 4N76A 1CZ9A 1C1BA 3U3YA 3AA3A 4OKJA 1S1WA 2DFEA 3LPUA 5K14A 2Z1JA 1NJWA 1NKCA 2Z1GA 1WSFA 2LSNA 3L2RA 2VWKA 3K58A 4CF9A 4CK3A 3VN5A 2HHUA 1S1VA 1RBTA 3H08A 4CJRA 3KD1E 4HCCA 4CGGA 5J2QA 3AVJA 4BE1A 2XRIA 4CJLA 4O0IA 4KFBA 3NF6A 3SV4A 2YKNA 2YKMA 4Z4CA 1WSJA 4F8RA 4DU1A 1QTMA 4DFKA 1VSKA 1RTHA 3HT3A 5HBMA 3MEGA 3NDKA 4DSFA 3ZSQA 4KB1A 4FK2A 3TWHA 3HXMA 1IKVA 1WLJA 3JSMA 4FZYA 3IAYA 3VQ4A 4CHZA 1TV6A 2B4JA 4KPYA 4RW4A 1JXEA 2G8KA 4Z4EA 1NJYA 1S6QA 4L8RB 3M8QA 1KLMA 4CHYA 4CGJA 4N5SA 2KFNA 5HRSA 2E6LA 5KI6A 1J5OA 4C8KA 1CXUA 4YNQA 3NGYA 3SUPA 3HPGA 3VQ9A 3PX0A 1B9FA 1BCMA 3AA4A 5D3GA 3SPYA 4CE9A 2NUBA 3K57A 4BWJA 4CF2A 3NF8A 3QEIA 1TAUA 4B08A 1REVA 3TAMA 1N5YA 4N56A 1W0HA 1KVBA 1ASUA 3PUFA 1ITGA 1JLAA 4GMJB 3HK2A 3NCIA 2JLEA 1RT2A 1JXBA 4J2BA 4JS5A 1QSLA 2OPQA 3DLGA 4FK4A 4E7HA 3OS1A 3SI6A 3V9SA 3KIOA 3CYMA 4M3RA 3S3NA 3OYBA 3SJJA 1D9DA 2PY5A 2ETJA 3ULDA 2P5GA 1X9SA 3O3HA 3C6UA 3KLGA 2KZMA 1N6QA 3V1OA 2FBYA 1L3UA 3AVAA 3AVGA 1UWBA 5FROA 2RF2A 3ITHA 3D45A 4DQSA 1NKBA 1NK0A 3K5NA 4KKOA 3C94A 3DLRA 3ZSXA 5CYQA 1HPZA 5HRNA 3QESA 2G8FA 1HRHA 4F3TA 1RBVA 2HHWA 1LW2A 1S9GA 3OJSA 3KTQA 4ID5A 1FK9A 1S6PA 4GW6A 1CZBA 3QEWA 4CJWA 4B9TA 1ZBUA 3M8SA 1BQMA 4MQ3A 4CF8A 1C1CA 3AO2A 3OYCA 1IG9A 1JLFA 3NBPA 2KW4A 3VQAA 1VRUA 2JGUA 4QOZB 2W42A 5C24A 2BE2A 3SQ1A 4DQRA 3DI6A 3TAPA 3AVIA 4CGFA 4CJ5A 1UOCA 3DYAA 4CJUA 1KSPA 3VQ7A 3QEXA 2D0CA 1DLOA 4DQQA 4AHRA 3NE6A 1GOAA 3CFOA 4CJ3A 1XHXA 3OYAA 1T03A 2GV9A 1BIUA 2ZE2A 3JYTA 2G8HA 3RR7A 1DTTA 4E1MA 4CFBA 3SPZA 4FM1A 4I9QA 4DWIA 3LZJA 3MEDA 4DS4A 4FLWA 1KLNA 1VSEA 2HNYA 3ZT3A 4FLYA 1Z25A 1WSGA 4CEZA 3RTVA 2Y1JA 4B9SA 4AHCA 3VQ6A 1U48A 1KVAA 2YNGA 3AO3A 3OYEA 4DFMA 2HB5A 4FJNA 2HHVA 1NKEA 1NJZA 4CHOA 1TKXA 1HMVA 4F2RA 3AVLA 4DTXA 2IGIA 3AV9A 1BI4B 1R0AA 1RILA 1LV5A 1Q9YA 1UAXA 4KV8A 1HQEA 1BI4A 4C8LA 4C8OA 3SYZA 2IOCA 4KHWA 4RW7A 3O3GA 4Y1DA 2RKIA 2OPPA 3NAEA 4BE0A 4FCYA 4CEDA 1JLEA 2YNHA 5CY4A 2KTQA 3OYIA 4KHYA 3PX6A 4FK0A 4CJ4A 2D5RA 1JLQA 2OPSA 1RT7A 3O4NA 4CJKA 1X9WA 2X78A 4B9MA 4CEBA 4DS5A 1WSIA 3ZT0A 3K59A 2Y1IA 2QKKA 1T05A 4RW6A 5JS2A 4BACA 3MXMA 3QINA 2HHXA 4FLUA 4I2PA 1W9HA 4M3WA 2PYLA 1SKSA 4UQGA 3VQ8A 4LSNA 1KVCA 4H4MA 3P83D 1LWFA 4IFYA 4AILC 1U4BA 4Z4FA 1J53A 2WONA 3NF7A 4CK1A 1FKPA 3HSTB 3V9UA 3ALYA 3KK2A 2XHBA 3VA3A 4ELVA 4EP5A 4FLXA 3AVKA 3S9HA 4M3XA 3RMCA 2BDPA 3AO1A 3ZCMA 2G8IA 4FJMA 3OYGA 3G10A 3AO5A 2XY8A 4Q0BA 5C25A 3L2WA 4BDPA 5I3UA 2EX3A 4DFJA 3PV8A 4B8CA 3OYLA 2R7YA 4DTUA 2P1JA 4OGEA 1NK5A 3HVTA 2RN2A 4Q5VA 3TABA 1GOCA 1TK0A 2WOMA 4HCBA 1YT3A 3QO9A 1ZBIA 3FFIA 1VSJA 1D9FA 2RPIA 1HNIA 1IKWA 4WE1A 1S9EA 4FVMA 4TSXA 3LP2A 4DTPA 1EKEA 2YV0X 4EZ6A 2KFZA 4CHQA 4DF8A 1FXXA 3CG7A 3OY9A 4I9LA 3VQPA 1RBRA 3LANA 2ZQBA 1KTQA 1C1AA 4IDKA 4CECA 3VQBA 3D0PA 1LAVA 4K8ZA 4FJHA 1QHTA 2VG7A 4CJFA 1L3VA 3SQ2A 4ZHRA 1RDAA 4E7LA 3DLHA 3SCXA 4CFAA 3AVNA 2FBXA 4CHNA 3BDPA 1I39A 2KQ2A 3LWLA 2A1RA 3ZSYA 4H4OA 1BL3A 4FLVA 4FW1A 1D8YA 4Y1CA 1JLGA 4LSLA 3T19A 4EP4A 3F73A 4E7KA 3C6TA 4CESA 1WAFA 4JS4A 3A2FA 1HQUA 5DK5A 1RDDA 1YTAA 4PWDA 5HP1A 5KRTA 4G1QA 4XIUA 3IG1A 3HJFA 3RRHA 2XY5A 1RT1A 1NK7A 3ZSVA 3KK3A 4RG8A 4AHVA 4FJGA 3SQ4A 4QCLA 3O3FA 1WAJA 3BGRA 4CIEA 3ZSWA 3UIQA 4NCAA 3KLIA 4KI6A 1U04A 3V1QA 5E41A 1KRPA 2DY4A 4B9VA 3QEPA 2GBZA 3WNEA 4E19A 3V1RA 4Z4HA 5EU7A 1JL1A 1SL0A 4M3UA 1S1TA 2HW3A 4CCHA 1S1XA 2ZD1A 3CQ8A 1U47A 2KZZA 4KTWA 3NH0A 5DMRA 1NK6A 1J9AA 5T7BA 3L2UA 3SZ2A 3V6DA 4FLZA 1BQNA 4DLEA 1SKRA 2BANA 3AA5X 4KTZA 1TKZA 2B5JA 5KTQA 3S3MA 4AH9A 2HMIA 4R5PA 4KREA 4JRQA 3L3VA 1ZBHA 1TAQA 4HVJA 3OJUA 3G0ZA 3HPHA 4BE2A 2D0AA 2P5OA 5KGWA 4F2SA 4M3TA 1WNSA 3OYDA 3DRRA 4CEEA 3C95A 1Z26A 4N47A 2HVIA 1DTQA 4Z4IA 3ASMA 3SQ0A 1X9MA 1IKXA 4YFUA 3OYHA 1QE1A 1TL1A 2I5JA 1G15A 2DFFA 2F96A 3E01A 1TGOA 2GUIA 3DOLA 4JLHA 3M8PA 4QAGA 3HM9A 4DLGA 4IFVA 4CGDA 3HP9A 3RMAA 3AO4A 4B9LA 2QK9A 4KRFA 3L2VA 2VWJA 1I3AA 3QIPA 4B8AB 3RMDA 5CZ2A 1RBSA 4KI4A 3QEVA 4CIGA 3I0SA 2Q3SA 2OZMA 3QLHA 1NOZA 3VQCA 4FJ9A 2HNZA 1RTIA 1D5AA 4MFBA 3ZT4A 3OS0A 1Q9XA 4CJVA 2IAJA 1S5JA 4OLAA 3LWMA 4BDYA 2IDOA 2D0BA 1O1WA 1YVUA 1HYVA 3QNNA 1EX4A 1EXQA 4CF0A 2B6AA 4CEAA 3RWUA 1JLBA 3PO4A 4DSLA 3ZSZA 3THVA 1KFDA 3WNHA 4CFCA 4W5TA 1RT3A 1BISA 5I42A 4ZTJA 1YTUA 4E3SA 1XC9A 1SL2A 4DSKA 4OVLA 4EZ9A 5SWMA 4NCBA 3AVCA 1RT5A 3EY1A 4DU4A 3HYFA 3K5LA 2A1SA 2E4LA 4OJRA 3AA2A 2XY6A 4DU3A 4KHUA 2BGGA 1KCFA 1A5VA 4LY7A 2VG5A 3HP6A 2HVHA 2HHQA 3L8BA 1NK8A 4IKFA 4N41A 4FJ8A 2YHBA 2AJQA 3KLEA 1XWLA 3VQQA 4DTSA 1QSSA 3OS2A 5CZ1A 3TAFA 3S3OA 2F8SA 5KGXA 3RRGA 3TAGA 3B6OA 3OYMA 4DQPA 1WN7A 2Z1HA 3V81A 3KJVA 3HVRA 3NF9A 3P1GA 4F4KA 3QIOA 4W5OA 4KHNA 4K8XA 5SZTA 3KLFA 2HHTA 4CF1A 1T7PA 3KD5E 4FLTA 1IH7A 1TL3A 4RW8A 3TR8A 4DSJA 3HPOA 4CFDA 4FJ5A 4B9UA 1BHLA 4OPJA 1CXQA 4AHTA 4FM0A 3CFRA 1RCHA 2OPRA 3CM6A 4KHSA 3ISNC 4O5BA 4FJLA 2FBTA 4NCGA 3PX4A 3QNOA 1L3TA 2F8TA 3RR8A 3DMJA 3AVFA 3V9WA 1Q8IA 4CJSA 5HRPA 4BWMA 4BDZA 1WSHA 4DMNA 4CIFA 3I8DA 3RMBA 2YHAA 1LAWA 3LDSA 3DLEA 4CEOA 3K5MA 1BIZA 4CK2A 3ZT1A 1L3SA 4GVMA 1T8EA 4FJIA 1IKYA 2ATQA 1RTJA 4E7JA 1J54A 4E89A 1LWCA 1ASVA 2DTUA 1TKTA 3CM5A 1HNVA 1QQCA 1U49A 4PQUA 3TI0A 3LAMA 5HROA 1C6VA 3NGIA 5FRMA 1VSIA 1NK9A 4J2AA 2YNIA 3VA0A 1RBUA 1VSLA 3OYKA 3M8RA 1HYZA 4HTUA 3OYFA 4DTNA 5C42A 3DRPA 4ID1A 3TARA 4KB0A 3L3UA 4FJXA 1RDBA 1RNHA 3NFAA 1U45A 1ZBLA 1NK4A 1NJXA 3KKRA 2G8WA 4DQIA 5FRNA 4CJTA 4M3ZA 1VRTA 1B9DA 3OYNA 3OVNA 3P5JA 1EETA 1TK5A 4ZTFA 2OA8A 1RT4A 3LALA 5J2NA 4KAZA 1QS4A 2IC3A 2Z1IA 3NH2A 1LW0A 3B6PA 1S1UA 5HRRA 3V9XA 3MEEA 3SUOA 4AHSA 3OYJA 3DM2A 3WNGA 1XHZA 4DTRA 3ZT2A 1UA1A 2PZSA 2IS3A 3VQ5A 3PY8A 2QKBA 4FXDA 4IBNA 4Z4GA 4AHUA 1JLCA 1GOBA 1HJRA 2X74A 3V4IA 3V9ZA 4LH5A 2E6MA 1RDCA 5KRSA 4DTJA 1ZBFA 4M42A 1EP4A 4IG3A 4OLBA 5HLFA 4B9NA 2P51A 2X6NA 3T3FA 2ITGA 3LPTA 2EHGA 5FDLA 2XO7A 3QETA 4PA1A 3DRSA 4LD0A 2OZSA 3WNFA 4J2EA 1SL1A 1TVRA 4C8MA 4E1NA 3NH1A 3TAQA 2PYJA 3LP0A 5CYMA 4FZXC 4FJKA 3LP3A 4KTQA 4FW2A 1MU2A 2O4GA 4HUEA 1JKHA 2FC0A 4OKEA 4H8KA 3VQEA 1VSMA 3MXJA 4CHPA 4W5QA 4E7IA 4HHTA 4DTMA 3AVBA 4O44A 2YNFA 1CLQA 3L2QA 3I0RA 1XI1A 1X1PA 4O0JA 1K6YA 3K5OA 3MXIA 1C0MA 1C0TA 1FKOA 4NYFA 4CERA 4I2QA 3VQDA 4PUOA 4CJQA 3LAKA 4O55A 1A5WA 4JRPA 4DSIA 3PO5A 4CJPA 4ICLA 3TANA 2G8VA 4FJJA 3O4QA 1SUQA 4RW9A 1TK8A 1LWEA 2QXFA 4FJ7A 4DTOA 4DFPA 4ELUA 1B92A 3SV3A 4KHQA 3IS9A 4CGHA 4M3YA 1BCOA 3KK1A 4OKKA 2HNDA 4CEQA 1RTDA 2O4IA 3F9KA 2VG6A 4J2DA 3EZ5A 4DF4A 2XY7A 4HUGA 1SKWA 3NGZA 3EYZA 4FZZA 3CFPA 2X6SA 2HHSA 1ASWA 1TKDA 1VK0A 1VSHA 3HO1A 1A5XA 1L5UA 1ZYQA 3KKSA 4ELTA 5JS1A 4I7FA 3U6FA 1IO2A 3DOKA 1VSDA 3U3GA 3TAEA 1HYSA 1SV5A 1NOYA 3DLBA 1WSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JL2 A;  4E0D A;  3AVH A;  4NYN A;  1VSF A;  1RT6 A;  3AVM A;  3SUN A;  4PY5 A;  2FBV A;  4M41 A;  4O4G A;  2G8U A;  1QSY A;  4W5N A;  4DSE A;  2OYQ A;  3IRX A;  3SNN A;  3LP1 A;  4DG1 A;  3KLH A;  1UA0 A;  1F21 A;  3ZSO A;  3K2P A;  4CGI A;  3MAQ A;  4B3O A;  4C8N A;  4HUF A;  1KFS A;  5J2M A;  1Y97 A;  4M45 A;  1BGX T;  4W5R A;  3SUQ A;  4FM2 A;  4F3O A;  4CEF A;  3QER A;  3ZSR A;  5J2P A;  3DLK A;  1C0U A;  3MEC A;  4KO0 A;  4CJE A;  5J1E A;  3NHG A;  4FYD A;  4OPK A;  2DFH A;  3HL8 A;  3T1A A;  4IG0 A;  4Z0U A;  4OGC A;  4LH4 A;  3LZI A;  4N76 A;  1CZ9 A;  1C1B A;  3U3Y A;  3AA3 A;  4OKJ A;  1S1W A;  2DFE A;  3LPU A;  5K14 A;  2Z1J A;  1NJW A;  1NKC A;  2Z1G A;  1WSF A;  2LSN A;  3L2R A;  2VWK A;  3K58 A;  4CF9 A;  4CK3 A;  3VN5 A;  2HHU A;  1S1V A;  1RBT A;  3H08 A;  4CJR A;  3KD1 E;  4HCC A;  4CGG A;  5J2Q A;  3AVJ A;  4BE1 A;  2XRI A;  4CJL A;  4O0I A;  4KFB A;  3NF6 A;  3SV4 A;  2YKN A;  2YKM A;  4Z4C A;  1WSJ A;  4F8R A;  4DU1 A;  1QTM A;  4DFK A;  1VSK A;  1RTH A;  3HT3 A;  5HBM A;  3MEG A;  3NDK A;  4DSF A;  3ZSQ A;  4KB1 A;  4FK2 A;  3TWH A;  3HXM A;  1IKV A;  1WLJ A;  3JSM A;  4FZY A;  3IAY A;  3VQ4 A;  4CHZ A;  1TV6 A;  2B4J A;  4KPY A;  4RW4 A;  1JXE A;  2G8K A;  4Z4E A;  1NJY A;  1S6Q A;  4L8R B;  3M8Q A;  1KLM A;  4CHY A;  4CGJ A;  4N5S A;  2KFN A;  5HRS A;  2E6L A;  5KI6 A;  1J5O A;  4C8K A;  1CXU A;  4YNQ A;  3NGY A;  3SUP A;  3HPG A;  3VQ9 A;  3PX0 A;  1B9F A;  1BCM A;  3AA4 A;  5D3G A;  3SPY A;  4CE9 A;  2NUB A;  3K57 A;  4BWJ A;  4CF2 A;  3NF8 A;  3QEI A;  1TAU A;  4B08 A;  1REV A;  3TAM A;  1N5Y A;  4N56 A;  1W0H A;  1KVB A;  1ASU A;  3PUF A;  1ITG A;  1JLA A;  4GMJ B;  3HK2 A;  3NCI A;  2JLE A;  1RT2 A;  1JXB A;  4J2B A;  4JS5 A;  1QSL A;  2OPQ A;  3DLG A;  4FK4 A;  4E7H A;  3OS1 A;  3SI6 A;  3V9S A;  3KIO A;  3CYM A;  4M3R A;  3S3N A;  3OYB A;  3SJJ A;  1D9D A;  2PY5 A;  2ETJ A;  3ULD A;  2P5G A;  1X9S A;  3O3H A;  3C6U A;  3KLG A;  2KZM A;  1N6Q A;  3V1O A;  2FBY A;  1L3U A;  3AVA A;  3AVG A;  1UWB A;  5FRO A;  2RF2 A;  3ITH A;  3D45 A;  4DQS A;  1NKB A;  1NK0 A;  3K5N A;  4KKO A;  3C94 A;  3DLR A;  3ZSX A;  5CYQ A;  1HPZ A;  5HRN A;  3QES A;  2G8F A;  1HRH A;  4F3T A;  1RBV A;  2HHW A;  1LW2 A;  1S9G A;  3OJS A;  3KTQ A;  4ID5 A;  1FK9 A;  1S6P A;  4GW6 A;  1CZB A;  3QEW A;  4CJW A;  4B9T A;  1ZBU A;  3M8S A;  1BQM A;  4MQ3 A;  4CF8 A;  1C1C A;  3AO2 A;  3OYC A;  1IG9 A;  1JLF A;  3NBP A;  2KW4 A;  3VQA A;  1VRU A;  2JGU A;  4QOZ B;  2W42 A;  5C24 A;  2BE2 A;  3SQ1 A;  4DQR A;  3DI6 A;  3TAP A;  3AVI A;  4CGF A;  4CJ5 A;  1UOC A;  3DYA A;  4CJU A;  1KSP A;  3VQ7 A;  3QEX A;  2D0C A;  1DLO A;  4DQQ A;  4AHR A;  3NE6 A;  1GOA A;  3CFO A;  4CJ3 A;  1XHX A;  3OYA A;  1T03 A;  2GV9 A;  1BIU A;  2ZE2 A;  3JYT A;  2G8H A;  3RR7 A;  1DTT A;  4E1M A;  4CFB A;  3SPZ A;  4FM1 A;  4I9Q A;  4DWI A;  3LZJ A;  3MED A;  4DS4 A;  4FLW A;  1KLN A;  1VSE A;  2HNY A;  3ZT3 A;  4FLY A;  1Z25 A;  1WSG A;  4CEZ A;  3RTV A;  2Y1J A;  4B9S A;  4AHC A;  3VQ6 A;  1U48 A;  1KVA A;  2YNG A;  3AO3 A;  3OYE A;  4DFM A;  2HB5 A;  4FJN A;  2HHV A;  1NKE A;  1NJZ A;  4CHO A;  1TKX A;  1HMV A;  4F2R A;  3AVL A;  4DTX A;  2IGI A;  3AV9 A;  1BI4 B;  1R0A A;  1RIL A;  1LV5 A;  1Q9Y A;  1UAX A;  4KV8 A;  1HQE A;  1BI4 A;  4C8L A;  4C8O A;  3SYZ A;  2IOC A;  4KHW A;  4RW7 A;  3O3G A;  4Y1D A;  2RKI A;  2OPP A;  3NAE A;  4BE0 A;  4FCY A;  4CED A;  1JLE A;  2YNH A;  5CY4 A;  2KTQ A;  3OYI A;  4KHY A;  3PX6 A;  4FK0 A;  4CJ4 A;  2D5R A;  1JLQ A;  2OPS A;  1RT7 A;  3O4N A;  4CJK A;  1X9W A;  2X78 A;  4B9M A;  4CEB A;  4DS5 A;  1WSI A;  3ZT0 A;  3K59 A;  2Y1I A;  2QKK A;  1T05 A;  4RW6 A;  5JS2 A;  4BAC A;  3MXM A;  3QIN A;  2HHX A;  4FLU A;  4I2P A;  1W9H A;  4M3W A;  2PYL A;  1SKS A;  4UQG A;  3VQ8 A;  4LSN A;  1KVC A;  4H4M A;  3P83 D;  1LWF A;  4IFY A;  4AIL C;  1U4B A;  4Z4F A;  1J53 A;  2WON A;  3NF7 A;  4CK1 A;  1FKP A;  3HST B;  3V9U A;  3ALY A;  3KK2 A;  2XHB A;  3VA3 A;  4ELV A;  4EP5 A;  4FLX A;  3AVK A;  3S9H A;  4M3X A;  3RMC A;  2BDP A;  3AO1 A;  3ZCM A;  2G8I A;  4FJM A;  3OYG A;  3G10 A;  3AO5 A;  2XY8 A;  4Q0B A;  5C25 A;  3L2W A;  4BDP A;  5I3U A;  2EX3 A;  4DFJ A;  3PV8 A;  4B8C A;  3OYL A;  2R7Y A;  4DTU A;  2P1J A;  4OGE A;  1NK5 A;  3HVT A;  2RN2 A;  4Q5V A;  3TAB A;  1GOC A;  1TK0 A;  2WOM A;  4HCB A;  1YT3 A;  3QO9 A;  1ZBI A;  3FFI A;  1VSJ A;  1D9F A;  2RPI A;  1HNI A;  1IKW A;  4WE1 A;  1S9E A;  4FVM A;  4TSX A;  3LP2 A;  4DTP A;  1EKE A;  2YV0 X;  4EZ6 A;  2KFZ A;  4CHQ A;  4DF8 A;  1FXX A;  3CG7 A;  3OY9 A;  4I9L A;  3VQP A;  1RBR A;  3LAN A;  2ZQB A;  1KTQ A;  1C1A A;  4IDK A;  4CEC A;  3VQB A;  3D0P A;  1LAV A;  4K8Z A;  4FJH A;  1QHT A;  2VG7 A;  4CJF A;  1L3V A;  3SQ2 A;  4ZHR A;  1RDA A;  4E7L A;  3DLH A;  3SCX A;  4CFA A;  3AVN A;  2FBX A;  4CHN A;  3BDP A;  1I39 A;  2KQ2 A;  3LWL A;  2A1R A;  3ZSY A;  4H4O A;  1BL3 A;  4FLV A;  4FW1 A;  1D8Y A;  4Y1C A;  1JLG A;  4LSL A;  3T19 A;  4EP4 A;  3F73 A;  4E7K A;  3C6T A;  4CES A;  1WAF A;  4JS4 A;  3A2F A;  1HQU A;  5DK5 A;  1RDD A;  1YTA A;  4PWD A;  5HP1 A;  5KRT A;  4G1Q A;  4XIU A;  3IG1 A;  3HJF A;  3RRH A;  2XY5 A;  1RT1 A;  1NK7 A;  3ZSV A;  3KK3 A;  4RG8 A;  4AHV A;  4FJG A;  3SQ4 A;  4QCL A;  3O3F A;  1WAJ A;  3BGR A;  4CIE A;  3ZSW A;  3UIQ A;  4NCA A;  3KLI A;  4KI6 A;  1U04 A;  3V1Q A;  5E41 A;  1KRP A;  2DY4 A;  4B9V A;  3QEP A;  2GBZ A;  3WNE A;  4E19 A;  3V1R A;  4Z4H A;  5EU7 A;  1JL1 A;  1SL0 A;  4M3U A;  1S1T A;  2HW3 A;  4CCH A;  1S1X A;  2ZD1 A;  3CQ8 A;  1U47 A;  2KZZ A;  4KTW A;  3NH0 A;  5DMR A;  1NK6 A;  1J9A A;  5T7B A;  3L2U A;  3SZ2 A;  3V6D A;  4FLZ A;  1BQN A;  4DLE A;  1SKR A;  2BAN A;  3AA5 X;  4KTZ A;  1TKZ A;  2B5J A;  5KTQ A;  3S3M A;  4AH9 A;  2HMI A;  4R5P A;  4KRE A;  4JRQ A;  3L3V A;  1ZBH A;  1TAQ A;  4HVJ A;  3OJU A;  3G0Z A;  3HPH A;  4BE2 A;  2D0A A;  2P5O A;  5KGW A;  4F2S A;  4M3T A;  1WNS A;  3OYD A;  3DRR A;  4CEE A;  3C95 A;  1Z26 A;  4N47 A;  2HVI A;  1DTQ A;  4Z4I A;  3ASM A;  3SQ0 A;  1X9M A;  1IKX A;  4YFU A;  3OYH A;  1QE1 A;  1TL1 A;  2I5J A;  1G15 A;  2DFF A;  2F96 A;  3E01 A;  1TGO A;  2GUI A;  3DOL A;  4JLH A;  3M8P A;  4QAG A;  3HM9 A;  4DLG A;  4IFV A;  4CGD A;  3HP9 A;  3RMA A;  3AO4 A;  4B9L A;  2QK9 A;  4KRF A;  3L2V A;  2VWJ A;  1I3A A;  3QIP A;  4B8A B;  3RMD A;  5CZ2 A;  1RBS A;  4KI4 A;  3QEV A;  4CIG A;  3I0S A;  2Q3S A;  2OZM A;  3QLH A;  1NOZ A;  3VQC A;  4FJ9 A;  2HNZ A;  1RTI A;  1D5A A;  4MFB A;  3ZT4 A;  3OS0 A;  1Q9X A;  4CJV A;  2IAJ A;  1S5J A;  4OLA A;  3LWM A;  4BDY A;  2IDO A;  2D0B A;  1O1W A;  1YVU A;  1HYV A;  3QNN A;  1EX4 A;  1EXQ A;  4CF0 A;  2B6A A;  4CEA A;  3RWU A;  1JLB A;  3PO4 A;  4DSL A;  3ZSZ A;  3THV A;  1KFD A;  3WNH A;  4CFC A;  4W5T A;  1RT3 A;  1BIS A;  5I42 A;  4ZTJ A;  1YTU A;  4E3S A;  1XC9 A;  1SL2 A;  4DSK A;  4OVL A;  4EZ9 A;  5SWM A;  4NCB A;  3AVC A;  1RT5 A;  3EY1 A;  4DU4 A;  3HYF A;  3K5L A;  2A1S A;  2E4L A;  4OJR A;  3AA2 A;  2XY6 A;  4DU3 A;  4KHU A;  2BGG A;  1KCF A;  1A5V A;  4LY7 A;  2VG5 A;  3HP6 A;  2HVH A;  2HHQ A;  3L8B A;  1NK8 A;  4IKF A;  4N41 A;  4FJ8 A;  2YHB A;  2AJQ A;  3KLE A;  1XWL A;  3VQQ A;  4DTS A;  1QSS A;  3OS2 A;  5CZ1 A;  3TAF A;  3S3O A;  2F8S A;  5KGX A;  3RRG A;  3TAG A;  3B6O A;  3OYM A;  4DQP A;  1WN7 A;  2Z1H A;  3V81 A;  3KJV A;  3HVR A;  3NF9 A;  3P1G A;  4F4K A;  3QIO A;  4W5O A;  4KHN A;  4K8X A;  5SZT A;  3KLF A;  2HHT A;  4CF1 A;  1T7P A;  3KD5 E;  4FLT A;  1IH7 A;  1TL3 A;  4RW8 A;  3TR8 A;  4DSJ A;  3HPO A;  4CFD A;  4FJ5 A;  4B9U A;  1BHL A;  4OPJ A;  1CXQ A;  4AHT A;  4FM0 A;  3CFR A;  1RCH A;  2OPR A;  3CM6 A;  4KHS A;  3ISN C;  4O5B A;  4FJL A;  2FBT A;  4NCG A;  3PX4 A;  3QNO A;  1L3T A;  2F8T A;  3RR8 A;  3DMJ A;  3AVF A;  3V9W A;  1Q8I A;  4CJS A;  5HRP A;  4BWM A;  4BDZ A;  1WSH A;  4DMN A;  4CIF A;  3I8D A;  3RMB A;  2YHA A;  1LAW A;  3LDS A;  3DLE A;  4CEO A;  3K5M A;  1BIZ A;  4CK2 A;  3ZT1 A;  1L3S A;  4GVM A;  1T8E A;  4FJI A;  1IKY A;  2ATQ A;  1RTJ A;  4E7J A;  1J54 A;  4E89 A;  1LWC A;  1ASV A;  2DTU A;  1TKT A;  3CM5 A;  1HNV A;  1QQC A;  1U49 A;  4PQU A;  3TI0 A;  3LAM A;  5HRO A;  1C6V A;  3NGI A;  5FRM A;  1VSI A;  1NK9 A;  4J2A A;  2YNI A;  3VA0 A;  1RBU A;  1VSL A;  3OYK A;  3M8R A;  1HYZ A;  4HTU A;  3OYF A;  4DTN A;  5C42 A;  3DRP A;  4ID1 A;  3TAR A;  4KB0 A;  3L3U A;  4FJX A;  1RDB A;  1RNH A;  3NFA A;  1U45 A;  1ZBL A;  1NK4 A;  1NJX A;  3KKR A;  2G8W A;  4DQI A;  5FRN A;  4CJT A;  4M3Z A;  1VRT A;  1B9D A;  3OYN A;  3OVN A;  3P5J A;  1EET A;  1TK5 A;  4ZTF A;  2OA8 A;  1RT4 A;  3LAL A;  5J2N A;  4KAZ A;  1QS4 A;  2IC3 A;  2Z1I A;  3NH2 A;  1LW0 A;  3B6P A;  1S1U A;  5HRR A;  3V9X A;  3MEE A;  3SUO A;  4AHS A;  3OYJ A;  3DM2 A;  3WNG A;  1XHZ A;  4DTR A;  3ZT2 A;  1UA1 A;  2PZS A;  2IS3 A;  3VQ5 A;  3PY8 A;  2QKB A;  4FXD A;  4IBN A;  4Z4G A;  4AHU A;  1JLC A;  1GOB A;  1HJR A;  2X74 A;  3V4I A;  3V9Z A;  4LH5 A;  2E6M A;  1RDC A;  5KRS A;  4DTJ A;  1ZBF A;  4M42 A;  1EP4 A;  4IG3 A;  4OLB A;  5HLF A;  4B9N A;  2P51 A;  2X6N A;  3T3F A;  2ITG A;  3LPT A;  2EHG A;  5FDL A;  2XO7 A;  3QET A;  4PA1 A;  3DRS A;  4LD0 A;  2OZS A;  3WNF A;  4J2E A;  1SL1 A;  1TVR A;  4C8M A;  4E1N A;  3NH1 A;  3TAQ A;  2PYJ A;  3LP0 A;  5CYM A;  4FZX C;  4FJK A;  3LP3 A;  4KTQ A;  4FW2 A;  1MU2 A;  2O4G A;  4HUE A;  1JKH A;  2FC0 A;  4OKE A;  4H8K A;  3VQE A;  1VSM A;  3MXJ A;  4CHP A;  4W5Q A;  4E7I A;  4HHT A;  4DTM A;  3AVB A;  4O44 A;  2YNF A;  1CLQ A;  3L2Q A;  3I0R A;  1XI1 A;  1X1P A;  4O0J A;  1K6Y A;  3K5O A;  3MXI A;  1C0M A;  1C0T A;  1FKO A;  4NYF A;  4CER A;  4I2Q A;  3VQD A;  4PUO A;  4CJQ A;  3LAK A;  4O55 A;  1A5W A;  4JRP A;  4DSI A;  3PO5 A;  4CJP A;  4ICL A;  3TAN A;  2G8V A;  4FJJ A;  3O4Q A;  1SUQ A;  4RW9 A;  1TK8 A;  1LWE A;  2QXF A;  4FJ7 A;  4DTO A;  4DFP A;  4ELU A;  1B92 A;  3SV3 A;  4KHQ A;  3IS9 A;  4CGH A;  4M3Y A;  1BCO A;  3KK1 A;  4OKK A;  2HND A;  4CEQ A;  1RTD A;  2O4I A;  3F9K A;  2VG6 A;  4J2D A;  3EZ5 A;  4DF4 A;  2XY7 A;  4HUG A;  1SKW A;  3NGZ A;  3EYZ A;  4FZZ A;  3CFP A;  2X6S A;  2HHS A;  1ASW A;  1TKD A;  1VK0 A;  1VSH A;  3HO1 A;  1A5X A;  1L5U A;  1ZYQ A;  3KKS A;  4ELT A;  5JS1 A;  4I7F A;  3U6F A;  1IO2 A;  3DOK A;  1VSD A;  3U3G A;  3TAE A;  1HYS A;  1SV5 A;  1NOY A;  3DLB A;  1WSE A; 
#chains in the Genus database with same CATH topology
 1JL2 A;  2E20 A;  2P9I A;  5BN9 A;  3AVM A;  4JKA A;  4X62 K;  4M41 A;  4BGA A;  1QSY A;  2OTL N;  2OYQ A;  4DG1 A;  2F9T A;  1KC8 O;  4CGI A;  3MAQ A;  3MK6 A;  4HUF A;  1NM1 A;  1Y97 A;  4M45 A;  4W5R A;  4F3O A;  3ZSR A;  2P9L B;  5J1E A;  3NHG A;  3HL8 A;  3T1A A;  5C10 A;  3CCM N;  3LZI A;  2BTF A;  4H0X B;  1S1W A;  2DFE A;  2Z1G A;  2VWK A;  1J6Z A;  4NB4 A;  3MX2 A;  4HCC A;  4O0I A;  3NF6 A;  3LM2 A;  4Z4C A;  1NGJ A;  4X65 K;  1WSJ A;  4F8R A;  1QTM A;  4DFK A;  4JKG B;  4KB1 A;  4FK2 A;  4JYA K;  1TYQ B;  4B3T K;  1IKV A;  3QML A;  3JSM A;  4KH5 A;  3VQ4 A;  4FSV A;  4CHZ A;  1TV6 A;  4KPY A;  2QXL A;  4RW4 A;  5EVZ A;  2G8K A;  5DM6 L;  3WEE B;  4DR2 K;  2KFN A;  1VQ8 N;  5KI6 A;  1J5O A;  4C8K A;  1CXU A;  4YNQ A;  3NGY A;  1GLA G;  5FLX O;  4DR7 K;  4BWJ A;  1MWK A;  1TAU A;  2WTU A;  3THX A;  2QWL A;  4JI6 K;  1YJN N;  1RT2 A;  2OPQ A;  3SI6 A;  3V9S A;  4M3R A;  5M1P A;  3OYB A;  4FJG A;  3MWT A;  2KZM A;  2HMP A;  3Q7C A;  1N6Q A;  4WQ5 A;  1L3U A;  2RF2 A;  1NKB A;  1Z05 A;  4X66 K;  1JJ2 M;  3C94 A;  3TTD A;  5HRN A;  2G8F A;  1HRH A;  5JLH A;  1LW2 A;  1S9G A;  3KTQ A;  3R6M A;  1S6P A;  3VGL A;  1YI2 N;  3CCJ N;  4CJW A;  3VER A;  1ZBU A;  3M8S A;  4B9T A;  3H3O B;  1C1C A;  3OYC A;  2O8F A;  3NBP A;  5EXW A;  2JGU A;  5CR4 A;  1OKJ A;  3U8X A;  3FZM A;  2BE2 A;  3DI6 A;  3TAP A;  3AVI A;  4CGF A;  3ENO A;  1G99 A;  4CJU A;  1NGH A;  2FXU A;  3QEX A;  5C0Y A;  2D0C A;  5IT9 O;  4AHR A;  5C2F A;  5ADX H;  4IXC A;  4O8U A;  1XHX A;  2GV9 A;  3H45 C;  3EO3 A;  3CJ1 A;  3VTI A;  1DTT A;  1U2V B;  3AGK A;  4CFB A;  1Q82 O;  5TKY A;  4FM1 A;  3LDQ A;  4DWI A;  3UE5 A;  3RTV A;  3E1Y A;  4WF9 L;  2V52 B;  3AO3 A;  3QBX A;  4WFN L;  4BRA A;  4DFM A;  2HHV A;  4F2R A;  3AVL A;  1MDU B;  1RIL A;  1BI4 A;  3SYZ A;  2FF6 A;  3O3G A;  2A5X A;  2RKI A;  2OPP A;  4DQ8 A;  4BE0 A;  4GV3 A;  2W41 A;  4H5T A;  5CY4 A;  2YNH A;  4BRF A;  2D5R A;  4BR2 A;  1RT7 A;  3O4N A;  1WSI A;  2Y1I A;  1K9M O;  4RW6 A;  4BQL A;  2HHX A;  2VCP A;  3GOI A;  1W9H A;  4ILJ A;  5GIN A;  1HKB A;  3CMA N;  1SKS A;  4M3W A;  1YUW A;  4Z4F A;  1XQS C;  1J53 A;  3NF7 A;  3HST B;  3ALY A;  2XHB A;  3EKU A;  3KHY A;  3EKS A;  3H3N O;  4FLX A;  3AVK A;  3S9H A;  3AO1 A;  3AO5 A;  2VWB A;  4FPB A;  1SAZ A;  3RVC A;  4DFJ A;  4IWV A;  3QFU A;  3DXM B;  3U4L A;  2RN2 A;  3TAB A;  1GOC A;  2WOM A;  1YT3 A;  3KK7 A;  3CJB A;  1D9F A;  4JNE A;  3R8E A;  1VQ9 N;  3LP2 A;  1RFQ A;  1D4X A;  4DF8 A;  4ISG A;  1NNE A;  1RBR A;  4NO7 A;  1KTQ A;  2HBJ A;  1NGE A;  2BUP A;  4YOW A;  3WXJ A;  4FJH A;  5AQV A;  4ZHR A;  1RDA A;  3SQ2 A;  3J8A A;  1GLJ O;  1X3N A;  3SCX A;  4CFA A;  1YVN A;  3AVN A;  3ULE B;  3S41 A;  1ATR A;  4CHN A;  2QA4 N;  3LWL A;  1XNR K;  2A1R A;  2IVO A;  4A57 A;  4FLV A;  4FW1 A;  3T19 A;  4LSL A;  3C6T A;  4CES A;  1WAF A;  5GAD P;  4JS4 A;  1E4F T;  1HQU A;  3DWL A;  3KVG A;  5AQU A;  4BC2 A;  4PWD A;  1WB9 A;  3IG1 A;  3O80 A;  3HJF A;  2F9W A;  3CET A;  5C15 A;  1RT1 A;  4BC5 A;  4RG8 A;  1WAJ A;  4J8F A;  1K8A O;  3K9J A;  1KRP A;  1KAX A;  4B9V A;  3QEP A;  4Z4H A;  1JL1 A;  3HOT A;  1SL0 A;  3GL1 A;  4B1W B;  2HW3 A;  5JVG L;  1S1X A;  1XNQ K;  1DKG D;  4F9O A;  3SZ2 A;  3V6D A;  4DR6 K;  4KTZ A;  1TKZ A;  2B5J A;  3HZ6 A;  3CCU N;  4R5P A;  4HVJ A;  3I56 N;  4BE2 A;  2D0A A;  4JK9 A;  4M3T A;  1WNS A;  4MO4 A;  1HNW K;  4N47 A;  5AQT A;  1X9M A;  3A0I X;  1IKX A;  3IDH A;  3OYH A;  2FF3 B;  2DFF A;  2VQE K;  3DXK A;  4QAG A;  4JLH A;  4WYB A;  3HP9 A;  4B9L A;  3AO4 A;  4KRF A;  4HWI A;  4B8A B;  3QEV A;  4CIG A;  2P9S B;  2Q3S A;  4JI2 K;  2WFB A;  4BQZ A;  2A41 A;  1NMD A;  1ZBS A;  4OLA A;  3WXK A;  2D0B A;  1YVU A;  2CGJ A;  4CF0 A;  4CEA A;  4M63 C;  1JLB A;  3PO4 A;  3ZSZ A;  4WCE L;  2AA4 A;  4ZTJ A;  4E3S A;  1KAY A;  4JKC A;  4NCB A;  4FOE A;  1RT5 A;  2W6K A;  3EY1 A;  1FJG K;  3AA2 A;  3CHW A;  5AQJ A;  3HP6 A;  5LY3 A;  5KPR A;  2HVH A;  1EQY A;  3E9O A;  4U67 L;  3OS2 A;  5CZ1 A;  2O8D B;  5KGX A;  4AM7 A;  3TAG A;  4DR5 K;  4EFH A;  3NF9 A;  2NRZ A;  4K8X A;  3MX5 A;  2Q97 A;  3VF6 A;  2ZJR L;  3VES A;  3UKU A;  4DSJ A;  5LMU K;  1BHL A;  4FM0 A;  3CM6 A;  5BRD A;  4JKE A;  3ISN C;  3MCP A;  2FSJ A;  4B9Q A;  3R1X A;  3VEY A;  4BWM A;  1Q81 O;  1N34 K;  2HBL A;  2GWK A;  1WSH A;  3I8D A;  2YHA A;  4CEO A;  4FO0 A;  1RDU A;  3E66 A;  3ZX3 A;  1IKY A;  1RTJ A;  4M7Y A;  1LWC A;  1U49 A;  3HOS A;  5HRO A;  3T7Z A;  1VSI A;  4U7B A;  4FWO A;  4CZF A;  3M3Z A;  1RBU A;  1HKC A;  1HYZ A;  4CZJ A;  3L3U A;  4FJX A;  1NK4 A;  3TPQ A;  2G8W A;  4V19 S;  4QS7 A;  3CME N;  1B9D A;  3OYN A;  3OVN A;  2HBK A;  4IZ9 A;  3M6G A;  3WUH A;  4GV6 A;  4KAZ A;  3AAR A;  1QS4 A;  3PIP L;  3B6P A;  3J7Z O;  3P38 A;  1QVG M;  1IV0 A;  3OYJ A;  4MO5 A;  1WOQ A;  2E88 A;  4IOC L;  4DTR A;  1UA1 A;  2IS3 A;  3VQ5 A;  4A5B A;  3DAW A;  3V4I A;  1RDC A;  2OTJ N;  3HSC A;  4H0T B;  1ZBF A;  1NJI O;  3SBG A;  1C0G A;  2ZJP L;  4B9N A;  5AZJ B;  3T3F A;  4Z4G A;  3TTF A;  2OZS A;  2I7N A;  3MN7 A;  3CCS N;  4A5A A;  4DB3 A;  4KTQ A;  2OAN A;  1VSM A;  3F5T A;  4DTM A;  3AVB A;  4O44 A;  5AZI A;  5AQF A;  1X1P A;  5M1O A;  1K6Y A;  3MXI A;  1BU6 O;  4CJQ A;  4O55 A;  4ICL A;  3TAN A;  2QXF A;  1BA1 A;  1NGD A;  4JKB A;  5AQK A;  2KKZ A;  1B92 A;  4CZE A;  3IS9 A;  4CGH A;  4BRE A;  2HND A;  3F9K A;  4H03 B;  3EZ5 A;  3VMF B;  4DF4 A;  2XY7 A;  1SKW A;  4FZZ A;  2X6S A;  4LF5 K;  4BR5 A;  1VK0 A;  1VSH A;  1L5U A;  1XC3 A;  3VF4 A;  4ELT A;  3U6F A;  1JCG A;  1HYS A;  4FPA A;  4CW7 B;  3LDN A;  4E0D A;  1VSF A;  4PY5 A;  2FBV A;  3E9L A;  3LP1 A;  2KHO A;  1BO5 O;  3KLH A;  5AQX A;  3ZSO A;  4B3O A;  3CJ9 A;  1Y64 A;  3QFP A;  2E2O A;  3EE8 A;  3QER A;  1C0U A;  4OPK A;  5AQL A;  1M1K O;  4UY8 O;  4YDU C;  2QEX N;  4IG0 A;  4OGC A;  4NLC A;  4N76 A;  3C6H A;  3U3Y A;  3AA3 A;  5JVH L;  1VQ6 N;  5K14 A;  1S3X A;  2YCH A;  3L2R A;  1WSF A;  2LSN A;  3OW2 M;  4AQY K;  3VN5 A;  2ZWH A;  1RBT A;  3AAP A;  3H08 A;  3LDP A;  3KD1 E;  4BE1 A;  4KFB A;  5E26 A;  4OX9 K;  1MA9 B;  4DU1 A;  5BRH A;  3MEG A;  1GLF O;  3TWH A;  3HXM A;  4BRK A;  4CZM A;  4FZY A;  4Z4E A;  3THY B;  3O9Q A;  4L8R B;  5F2R A;  3WEE A;  4DV6 K;  3HRG A;  3VQ9 A;  3AA4 A;  1GLE G;  3SPY A;  2NUB A;  3K57 A;  4CF2 A;  3NF8 A;  4GKK K;  1N5Y A;  1W0H A;  1ASU A;  3PUF A;  1ITG A;  5BPM A;  1W2B M;  4L3Q A;  1JXB A;  3QDK A;  3ZEU B;  1YXQ A;  3S3N A;  3KIO A;  3CYM A;  4JI8 K;  3SJJ A;  3A5M C;  2ETJ A;  3ULD A;  1X9S A;  3C6U A;  4JKF A;  3G25 A;  3V1O A;  5FRO A;  1UWB A;  5M1F A;  3ITH A;  3D45 A;  5CYQ A;  4ID5 A;  1FK9 A;  4GW6 A;  3NMU A;  3QEW A;  3SBT A;  4MQ3 A;  3VQA A;  2KW4 A;  5TKW A;  4DUY K;  4QOZ B;  5C24 A;  5AQR A;  4CBW A;  5CE3 A;  3CQY A;  1UOC A;  2WBN A;  3DYA A;  1KSP A;  3VQ7 A;  3O1B A;  5JIC A;  4BRC A;  4RTF D;  3LL3 A;  4DQQ A;  4CZG A;  3BUZ B;  1GOA A;  4CJ3 A;  4JK7 A;  1HNX K;  3OYA A;  5AQG A;  1BIU A;  2ZE2 A;  3JYT A;  1S22 A;  3RR7 A;  3N4Q A;  3CI5 A;  3SLC A;  3SPZ A;  4GY2 B;  1U2V A;  3LZJ A;  4FLW A;  2HNY A;  3H46 O;  4CEZ A;  2Y1J A;  4AHC A;  2YHW A;  3EN9 A;  3ZET B;  2YNG A;  3O9T A;  4R79 A;  3OYE A;  5I9E B;  1NKE A;  4CHO A;  2E2N A;  2IGI A;  1IBK K;  1R0A A;  1UAX A;  4BRL A;  1KQS M;  3CC4 N;  4EAH D;  4FCY A;  4CED A;  3MWP A;  2KTQ A;  5BN8 A;  4CJ4 A;  2OPS A;  2X78 A;  3E9P A;  2QKK A;  3MXM A;  3QIN A;  4BRH A;  4UQG A;  3VQ8 A;  1KVC A;  4AIL C;  2WON A;  4CK1 A;  3V9U A;  2NNW A;  1E3M A;  1VQK N;  2BDP A;  1T6D A;  5B8H A;  3OYG A;  3G10 A;  2A40 A;  4FJM A;  4Q0B A;  4Z94 A;  4K42 A;  4DV2 K;  4BC3 A;  1WBD A;  3DXM A;  4YOX A;  5BPN A;  1S9E A;  4FVM A;  4TSX A;  1EKE A;  3SMS A;  2ZF5 O;  2KFZ A;  4CHQ A;  1FXX A;  3VQP A;  3LAN A;  2ZQB A;  3R9P A;  2UXD K;  3J80 O;  1L3V A;  2VQF K;  4DHY A;  4E7L A;  3VEO A;  5AFU A;  4H5N A;  4FWS A;  1NGG A;  1BL3 A;  4JKH A;  3O08 A;  4EP4 A;  1MWM A;  1D8Y A;  4LC9 B;  4OPA A;  1HX1 A;  3F73 A;  4YOY A;  5DK5 A;  4XIU A;  3HBT A;  2XY5 A;  4XH1 A;  2NRR A;  1QQO A;  3KK3 A;  1BDG A;  4LF4 K;  5EX5 A;  4KI6 A;  4NCA A;  3KLI A;  5E41 A;  3A5L C;  4JAX A;  4DV4 K;  3D2F A;  3V1R A;  5EU7 A;  4B1X B;  1OH5 A;  2V51 B;  4CCH A;  2Q0U A;  2KZZ A;  3NH0 A;  5DMR A;  1NMN A;  1NK6 A;  5BRF A;  4DLE A;  3CC7 N;  4EHU A;  1SKR A;  2BAN A;  3AA5 X;  4GKJ K;  4KRE A;  1NGF A;  3L3V A;  4JRQ A;  2P9N B;  4F2S A;  5KGW A;  4BRD A;  3DRR A;  3C95 A;  1Z26 A;  2HVI A;  4Z4I A;  3WXI A;  3EE9 A;  5FPM A;  1G15 A;  3SAH A;  1W7A A;  2E1Y A;  3HM9 A;  3M8P A;  3HI0 A;  4IFV A;  2QK9 A;  3KWI A;  3L2V A;  3RMD A;  2NZT A;  5CZ2 A;  2OZM A;  4H0V B;  1NOZ A;  2P9S A;  3VQC A;  2HNZ A;  1D5A A;  4BR0 A;  4WFB L;  4CJV A;  2IAJ A;  4CD1 A;  4JD2 A;  1HYV A;  1QQN A;  4I6M B;  3WNH A;  4CFC A;  2J4R A;  3SK3 A;  4BRM A;  1BIS A;  4W5T A;  5LJV A;  2UUA K;  1XC9 A;  4DSK A;  4GVE A;  1CZA N;  3CCV N;  4EZ9 A;  4KH4 A;  4WFA L;  3AVC A;  4G9Z A;  3PSF A;  4DU4 A;  3HYF A;  4HTL A;  1KCF A;  4LY7 A;  1XMQ K;  1BUP A;  4BRI A;  2P9I B;  1NK8 A;  4N41 A;  2AJQ A;  1XWL A;  3VQQ A;  1QSS A;  3SJH A;  5C2D A;  2CH5 A;  4EIA A;  3NVK A;  2HBM A;  3TAF A;  5KQ8 A;  2F7T A;  2F8S A;  3B6O A;  4BC4 A;  4ILH A;  3QIO A;  3LM9 A;  4QS9 A;  3KLF A;  1GLL O;  1IH7 A;  3TR8 A;  2O8C B;  1CXQ A;  4DUZ K;  2O8E B;  2KLA A;  2E2P A;  2OPR A;  4DCH A;  2GEM A;  2FBT A;  4NCG A;  4FWP A;  2HOE A;  3PX4 A;  3QNO A;  2F8T A;  4CJS A;  5HRP A;  4BDZ A;  2Q2R A;  3I8B A;  3LDS A;  3DLE A;  4FWK A;  3F2K A;  1T8E A;  1HPM A;  2ATQ A;  3CCL N;  4E89 A;  3TI0 A;  3NGI A;  4MLH A;  1NK9 A;  4J2A A;  3VA0 A;  2GTD A;  4CZI A;  4KB0 A;  1U45 A;  2P9K B;  1BG3 A;  4CJT A;  5AQO A;  4M3Z A;  1VRT A;  1VQO N;  3P5J A;  1OH6 A;  2OA8 A;  3BZK A;  4QS8 A;  1TUY A;  1IJJ A;  3OA9 A;  2PBD A;  2IC3 A;  3NH2 A;  1S1U A;  1XHZ A;  3PY8 A;  1JLC A;  2X74 A;  2E6M A;  2W40 A;  4BG8 A;  5AQQ A;  5KRS A;  3O5B A;  3GE1 A;  4DTJ A;  1EP4 A;  3BZC A;  4K0K K;  2EWS A;  2EHG A;  5FDL A;  5AZJ A;  3FE1 A;  3U9D A;  1SL1 A;  3TSU A;  1P8Z A;  4XH5 A;  4LFA K;  4FW2 A;  2YHY A;  4PKH A;  1JKH A;  2FSN A;  4IEE A;  3I55 N;  4E7I A;  2YNF A;  3L2Q A;  3I0R A;  2O8B B;  4CER A;  4YOR A;  3FZL A;  4JEP A;  3HTV A;  3PO5 A;  4FJ7 A;  3ATV A;  1LWE A;  5F1X A;  4B1U B;  1GLC G;  4KHQ A;  3IUC A;  4M3Y A;  4OKK A;  4CEQ A;  3CJA A;  2O4I A;  2E2Q A;  2YJF A;  2CH6 A;  3NGZ A;  3EYZ A;  4FWL A;  2HHS A;  1ASW A;  4CVN E;  2HST A;  1TKD A;  2F4V K;  3HO1 A;  1ZYQ A;  5JS1 A;  1N33 K;  1IO2 A;  4C1N I;  3TAE A;  1NOY A;  1WSE A;  3KWG A;  4KHP K;  3AVH A;  2YI1 A;  4O4G A;  1Q18 A;  4RWT A;  4DSE A;  2WUS A;  3IRX A;  2NLX A;  4FL9 A;  3H1Q A;  2QWQ A;  4X64 K;  4DR1 K;  1KFS A;  2JWK A;  5J2M A;  3WXM B;  3DLK A;  1X3M A;  4FYD A;  3PSI A;  4Z0U A;  1EWR A;  4LH4 A;  1CZ9 A;  1C1B A;  3G71 N;  4OKJ A;  3LPU A;  2Z1J A;  3FGU A;  3K58 A;  5BR9 A;  4IJA A;  3G6E N;  2HHU A;  1S1V A;  4CJR A;  4CGG A;  4BR9 A;  2VGN A;  4CJL A;  4LFC K;  5ADX A;  3SV4 A;  1K8K A;  2YKN A;  2YKM A;  1YIT N;  4XEI A;  1VSK A;  3MN5 A;  5KQD A;  3IAY A;  4CD3 A;  3M8Q A;  1KD1 O;  3THY A;  2ITM A;  4CHY A;  4CGJ A;  4N5S A;  2E6L A;  3SUP A;  5AQW A;  3CER A;  1BCM A;  5HL7 L;  5D3G A;  4CE9 A;  3Q7B A;  4B08 A;  3TAM A;  3H6E A;  1BOT O;  4GMJ B;  1JLA A;  4A61 A;  4B1Y B;  4JKD A;  3HK2 A;  5E84 A;  1YHQ N;  4J2B A;  3D2E B;  3JAM O;  4E1J A;  4FWQ A;  4OPH A;  4CBX A;  3ZEU A;  2PY5 A;  3KLG A;  3AVA A;  3AVG A;  4DQS A;  3MN9 A;  3ZSX A;  3QES A;  3ATU A;  1ATS A;  1RBV A;  3P4I A;  2HHW A;  3OJS A;  3FZK A;  1CZB A;  4B1V A;  1BQM A;  4CF8 A;  4LF6 K;  3SAF A;  3JXU A;  3LDL A;  4A62 A;  4DQR A;  3P31 A;  5M1N A;  4CJ5 A;  2PAV A;  1DLO A;  1LOT B;  1T03 A;  1IBM K;  4H0O A;  2G8H A;  3DXK B;  3O6W A;  4I9Q A;  4DS4 A;  3GDQ A;  1VSE A;  1Z25 A;  4B9S A;  5AQM A;  4NXN K;  3ZET A;  1NJZ A;  2QWP A;  3ID8 A;  3MDQ A;  1TKX A;  1HMV A;  2UXB K;  3AV9 A;  4KHW A;  4C8O A;  1HQE A;  4WQ4 C;  4C8L A;  2IOC A;  4RW7 A;  4Y1D A;  3NAE A;  2D1K A;  5C12 A;  2UYT A;  2H3G X;  4FK0 A;  3QB0 A;  3O9S A;  2QI2 A;  1X9W A;  3VEW A;  4B9M A;  3TU5 A;  4DS5 A;  3ZT0 A;  3K59 A;  4B3S K;  4BR7 A;  4BAC A;  3C7N B;  2P9L A;  4I2P A;  3UKR B;  4PL8 A;  3U9Z A;  2PYL A;  4LSN A;  3P83 D;  3KK2 A;  3CQX A;  3VA3 A;  4BVP A;  4EP5 A;  3GG4 A;  4BVO A;  3ZCM A;  2G8I A;  2XY8 A;  3UKU B;  3L2W A;  1HNZ K;  4BDP A;  1K73 O;  4B8C A;  2R7Y A;  1NK5 A;  3J7Y P;  4OGE A;  1Q7Y O;  3HVT A;  4Q5V A;  1TK0 A;  3QO9 A;  5CHI A;  4JKG A;  2W6L A;  3DJC A;  1IKW A;  1FW6 A;  1TYQ A;  4WE1 A;  3OTO K;  2YV0 X;  3ZYY X;  4EZ6 A;  2YHX A;  4FWR A;  3TTC A;  5BR8 K;  4IDK A;  3VQB A;  3D0P A;  1LAV A;  1IBL K;  2E5L K;  4LF7 K;  4IEI A;  1QHA A;  1I39 A;  1W97 L;  3PLA A;  2KQ2 A;  3MCA B;  3O9R A;  1GLD G;  4E7K A;  3ZX0 A;  5AQP A;  3CCQ N;  3FR0 A;  3A2F A;  4YOT A;  1YTA A;  3BY5 A;  5LJW A;  3K0S A;  2D0P A;  5EOY A;  3ZSV A;  1P90 A;  4AHV A;  5H1S Q;  3SQ4 A;  3O3F A;  3BGR A;  3ZSW A;  3V1Q A;  2DY4 A;  1YF5 L;  2Q36 A;  1VQM N;  4E19 A;  4M3U A;  4IOX A;  4BRN A;  2NRV A;  1EWQ A;  3UB5 A;  4KTW A;  3L2U A;  4FLZ A;  5JMV A;  3S3M A;  3K9K A;  5DM7 L;  4A2A A;  1ZBH A;  2DPN A;  1TAQ A;  1TUU A;  5AJ3 K;  2P5O A;  4YDU A;  2P9N A;  4CEE A;  4DV3 K;  4JHD B;  3ASM A;  3WQT A;  5A2Q O;  3T1H K;  2IVN A;  2I5J A;  5AQZ A;  2F96 A;  1JCF A;  3E01 A;  2GUI A;  2P9P B;  3DOL A;  5GAE P;  4JI4 K;  4CGD A;  2VWJ A;  3WQU A;  1RBS A;  3QIC A;  3SAG A;  1V4S A;  3QLH A;  3N4P A;  1XMO K;  4FJ9 A;  4MFB A;  3OS0 A;  1S5J A;  3O8M A;  3WT0 A;  3QNN A;  1O1W A;  2P9U B;  1EX4 A;  1EXQ A;  2B6A A;  3RWU A;  4DSL A;  2V7Z A;  4I6M A;  3VPZ A;  5AQI A;  2QWO A;  2A1S A;  2XY6 A;  4DU3 A;  5GIP A;  4KHU A;  1A5V A;  2VG5 A;  2HHQ A;  4K41 A;  3L8B A;  4IKF A;  2YHB A;  1N36 K;  4PL7 A;  4WQ5 C;  3WXL A;  3RRG A;  3CCR N;  1VQ4 N;  3OYM A;  4DQP A;  5AQN A;  1WN7 A;  2ASM A;  2Z1H A;  5ELZ A;  4W5O A;  4KHN A;  4BRP A;  3A5N C;  5SZT A;  2HHT A;  1T7P A;  3KD5 E;  4FLT A;  4RW8 A;  3KZB A;  4DV0 K;  2CGL A;  4EHT A;  3HPO A;  4B9U A;  4FWM A;  4OPJ A;  2O8C A;  4AHT A;  3CFR A;  1RCH A;  2O8E A;  1YIJ N;  4O5B A;  1DT9 A;  3T1Y K;  2AP1 A;  1L3T A;  1Q8I A;  1RGI A;  4IO8 A;  3TSP A;  4IJN A;  1VQL N;  1I94 K;  1LAW A;  3K5M A;  2QW9 A;  4CK2 A;  5FPE A;  3ZT1 A;  3ULE A;  4GVM A;  3CF5 L;  1L3S A;  3RSE B;  1ATN A;  4FJI A;  4E7J A;  1J54 A;  1ASV A;  2DTU A;  1BWF O;  5F0X A;  3CM5 A;  4AF1 A;  1QQC A;  4PQU A;  5FRM A;  3LAM A;  1C6V A;  3BF3 A;  3DLL L;  4JK8 A;  1NWK A;  3L6Q A;  3BF1 A;  3OYK A;  4DTN A;  3TAR A;  3DRP A;  4ID1 A;  2A3Z A;  4H0Y B;  1RDB A;  1RNH A;  3EZW A;  3NFA A;  1ZBL A;  3VGM A;  3THW B;  2P9K A;  1EET A;  1TK5 A;  1RT4 A;  3LAL A;  5J2N A;  3VET A;  2Z1I A;  1LW0 A;  3CPE A;  3V9X A;  3MEE A;  3H1V X;  4AHS A;  2QKB A;  2QWN A;  3ZT2 A;  2PZS A;  4IBN A;  1HJR A;  3V9Z A;  5AQH A;  4Y0W A;  1M90 O;  4O8K A;  4DV5 K;  5GAG P;  3CXC M;  4IG3 A;  3IMX A;  5HLF A;  2X6N A;  2ITG A;  3LPT A;  4IO9 L;  1WBB A;  2XO7 A;  3QET A;  4PA1 A;  3DRS A;  3VEZ A;  3WNF A;  4RCH A;  3CIP A;  4C8M A;  1NGB A;  4E1N A;  3NH1 A;  5CYM A;  3CJC A;  1YJW N;  5IWA K;  4FZX C;  1MU2 A;  2O4G A;  2QWR A;  4HUE A;  4OKE A;  1OH8 A;  4ISF A;  4CHP A;  1CLQ A;  2E1Z A;  1R59 O;  3VGK A;  3K5O A;  1C0T A;  1FKO A;  2O8B A;  3LAK A;  1A5W A;  1SZ2 A;  4DSI A;  4CJP A;  2G8V A;  1ILY A;  3O4Q A;  4RW9 A;  1TK8 A;  4DFP A;  4ELU A;  4CZL A;  2ZGY A;  1QVF M;  3SV3 A;  1BCO A;  3KK1 A;  1RTD A;  4O5F A;  2VG6 A;  4J2D A;  2NRT A;  1O13 A;  3CFP A;  3O4W A;  3W0L A;  4FOI A;  2GEL A;  3KKS A;  1E4G T;  5EY4 A;  3DOK A;  1J5E K;  2PFU A;  3U3G A;  1U6Z A;  2D4W A;  1H1V A;  4YOU A;  4CZK A;  4YHH K;  4NYN A;  1RT6 A;  3SUN A;  3MN6 A;  2G8U A;  4W5N A;  3IKM A;  2O8D A;  4IOA L;  4YOV A;  4H5R A;  3SNN A;  2ASP A;  1UA0 A;  1IG8 A;  1F21 A;  2GWJ A;  3K2P A;  1ZXO A;  4C8N A;  1T3V A;  1BGX T;  3L4Q A;  3SUQ A;  4C1N K;  4FM2 A;  4CEF A;  1JCE A;  5J2P A;  3MEC A;  4KO0 A;  4CJE A;  2DFH A;  3QBW A;  5BRE A;  3PIO L;  3ENB A;  1NJW A;  1NKC A;  3C0B A;  4CF9 A;  4CK3 A;  5J2Q A;  3AVJ A;  2XRI A;  3SMP A;  5HOO A;  1Z6R A;  1RTH A;  3HT3 A;  5HBM A;  3NDK A;  4DSF A;  3ZSQ A;  2VGM A;  2VYP A;  1WLJ A;  1N32 K;  2B4J A;  1KAZ A;  1JXE A;  4JI3 K;  1NJY A;  1S6Q A;  2ZJQ L;  1S72 N;  1KLM A;  2OCE A;  3CD6 N;  5HRS A;  1HR0 K;  3HPG A;  1HLU A;  3PX0 A;  1B9F A;  3CJ7 A;  4FWN A;  3QEI A;  1REV A;  3THX B;  4N56 A;  3I33 A;  1KVB A;  2RE2 A;  3D7E O;  3NCI A;  2JLE A;  5GIO A;  3J81 O;  4JS5 A;  1QSL A;  3DLG A;  4FK4 A;  3D2E A;  4MLE A;  4E7H A;  3OS1 A;  1D9D A;  1C0F A;  2P5G A;  3O3H A;  1QZ6 A;  2E8A A;  3D2F B;  2FBY A;  2HF3 A;  4DKW A;  4PKI A;  5FPN A;  4NXM K;  5KPZ A;  1NK0 A;  3K5N A;  4KKO A;  3DLR A;  3AGR A;  4F3T A;  1HPZ A;  3OBY A;  3A8Y A;  2ZM6 K;  4H5W A;  2O8F B;  1YAG A;  3AO2 A;  1IG9 A;  1JLF A;  1VRU A;  2QWM A;  3BEX A;  2W42 A;  3VTH A;  3SQ1 A;  4LF9 K;  3VOV A;  3B8A X;  3CPW M;  5LMN K;  1DEJ A;  4YY3 K;  5AQY A;  1NGC A;  3NE6 A;  4JV5 K;  3CFO A;  3MMV A;  4M7X A;  2QM1 A;  2Q0R A;  1VQN N;  4E1M A;  3FFK B;  4CBU A;  3MED A;  4BR4 A;  1VQP N;  3VEN A;  1KLN A;  3ZT3 A;  1VHX A;  4FLY A;  1WSG A;  3VQ6 A;  1U48 A;  1KVA A;  4FJN A;  2HB5 A;  1V4T A;  4DTX A;  4JD2 B;  3AY9 A;  2UUC K;  1BI4 B;  1VQ7 N;  3VF2 A;  1LV5 A;  1Q9Y A;  4KV8 A;  4XH4 A;  3L4I A;  3OHR A;  1BA0 A;  3TSQ A;  1JLE A;  3OYI A;  4KHY A;  3PX6 A;  1VAZ A;  1JLQ A;  2YJE A;  4CJK A;  1NGI A;  3O9U A;  4CEB A;  2FLO A;  1T05 A;  4JN4 A;  5JS2 A;  4FLU A;  5FPD A;  3C7N A;  3UKR A;  1SS6 A;  4H4M A;  4IFY A;  1LWF A;  3ENH A;  1U4B A;  1FKP A;  1RDW X;  4ELV A;  3EEQ A;  4M3X A;  3RMC A;  4ISE A;  4IDH A;  5C25 A;  3M5R A;  4DV7 K;  5I3U A;  2EX3 A;  3D6R A;  3PV8 A;  3OYL A;  4DTU A;  2P1J A;  4BRQ A;  4B3M K;  4HCB A;  1HUX A;  1EO1 A;  1ZBI A;  3FFI A;  1VSJ A;  1Q86 O;  2RPI A;  1HNI A;  2D0O A;  2JWL A;  5AQS A;  4DTP A;  4PKG A;  3CG7 A;  1T44 A;  3OY9 A;  4I9L A;  4CJ7 A;  1C1A A;  4BRO A;  4CEC A;  4DR3 K;  4JI1 K;  4K8Z A;  2ASO A;  1QHT A;  2VG7 A;  4K43 A;  4CJF A;  3DLH A;  2FBX A;  3BDP A;  4FVU A;  3LDO A;  3ZSY A;  1HKG A;  5AR0 A;  4H4O A;  1NG9 A;  4Y1C A;  1JLG A;  1GLB G;  3O1W A;  1RDD A;  5HP1 A;  5KRT A;  4G1Q A;  3RRH A;  2FSK A;  1NK7 A;  2QTD A;  4QCL A;  4CIE A;  3UIQ A;  1U04 A;  1SQK A;  2RHK A;  2GBZ A;  3WNE A;  3JS6 A;  2NRX A;  1S1T A;  1NLV A;  4A2B A;  2ZD1 A;  3CQ8 A;  1U47 A;  1J9A A;  5T7B A;  1BQN A;  4KBO A;  1OVY A;  5KTQ A;  2HMI A;  4AH9 A;  1DGK N;  3OJU A;  5JLF A;  3G0Z A;  3HPH A;  1ESV A;  4B3R K;  3OYD A;  1DTQ A;  1X9J A;  3C65 A;  4JHD A;  3SQ0 A;  4JI7 K;  4YFU A;  1QE1 A;  1TL1 A;  2IVP A;  1TGO A;  4DLG A;  3RMA A;  2P9P A;  5KPT A;  1I3A A;  3QIP A;  4KI4 A;  5MLC Q;  3I0S A;  4DR4 K;  4IFE A;  5BPL A;  1RTI A;  2I7P A;  3ZT4 A;  1Q9X A;  4PHT X;  3CC2 N;  1N8R O;  3LWM A;  3VEV A;  2IDO A;  4BDY A;  3CCE N;  4H0P A;  5AFU H;  2HHH K;  3OBW A;  4BY9 C;  2P9U A;  1XUP O;  3FLC O;  4A59 A;  3THV A;  1KFD A;  1RT3 A;  5I42 A;  2IIR A;  2UXC K;  1YTU A;  1SL2 A;  2GX9 A;  4OVL A;  3HM8 A;  5SWM A;  3K5L A;  2BGG A;  2E4L A;  4OJR A;  1NGA A;  3C6A A;  4FJ8 A;  3KLE A;  4DTS A;  4DV1 K;  3J7A P;  3S3O A;  4GNI A;  2HF4 A;  3ZX2 A;  3V81 A;  3KJV A;  3HVR A;  4BRG A;  1YJ9 N;  3P1G A;  4F4K A;  3FZH A;  4CF1 A;  1TL3 A;  1QZ5 A;  2A42 A;  1WUA A;  4CFD A;  1LCU A;  4FJ5 A;  3W3D A;  2WC9 A;  1VQ5 N;  4KH6 A;  4NLB A;  4JI0 K;  4KHS A;  4FJL A;  2NRW A;  3RR8 A;  3DMJ A;  3AVF A;  3V9W A;  3GBT A;  3ID6 A;  4DMN A;  1K8K B;  4CIF A;  3RMB A;  4MDB A;  5M1Q A;  1BIZ A;  2A6A A;  3F9M A;  2UUB K;  5GAH P;  3NVM A;  3RSE A;  1TKT A;  3M1F A;  4C23 A;  3L0Q A;  2UU9 K;  1HNV A;  1QQM A;  1KXP A;  2YNI A;  1VSL A;  3FZF A;  3M8R A;  4HTU A;  3OYF A;  5C42 A;  4DQI A;  1NJX A;  5FRN A;  3IFR A;  3KKR A;  1NBW A;  2V7Y A;  3THW A;  1HJO A;  2Q1N A;  4BGB A;  4ILG B;  4WQ4 A;  4AM6 A;  4ZTF A;  4CZH A;  4GV9 A;  4LF8 K;  1OVQ A;  5HRR A;  4CI6 A;  3SUO A;  3DM2 A;  3WNG A;  4BG9 A;  3VEX A;  4FXD A;  2Q31 A;  2NRH A;  4AHU A;  1GOB A;  4LH5 A;  3R3L A;  3AAQ A;  3P39 A;  4M42 A;  4OLB A;  2YX6 A;  4MDA A;  2P51 A;  3G4S N;  3EL2 A;  3T69 A;  4LD0 A;  4J2E A;  5M1K A;  1TVR A;  3TAQ A;  2PYJ A;  3LP0 A;  4FJK A;  2BH1 A;  3LP3 A;  1NU0 A;  1OH7 A;  4B1Z A;  2FC0 A;  5AZI B;  3VQE A;  4H8K A;  4W5Q A;  3MXJ A;  4HHT A;  3BP8 A;  1XI1 A;  4O0J A;  2GUP A;  1ZC6 A;  1C0M A;  4NYF A;  4I2Q A;  3VQD A;  4PUO A;  4JRP A;  4FJJ A;  1SUQ A;  4JI5 K;  4K25 A;  4DTO A;  4OO1 J;  4LFB K;  3A5O C;  4HUG A;  3ZLJ A;  2ZGZ A;  1T6C A;  5LL6 Z;  1A5X A;  4I7F A;  2CGK A;  4H5V A;  1VSD A;  1SV5 A;  3DLB A; 
#chains in the Genus database with same CATH homology
 1JL2 A;  4E0D A;  3AVH A;  4NYN A;  1VSF A;  1RT6 A;  3AVM A;  3SUN A;  4PY5 A;  2FBV A;  4M41 A;  4O4G A;  2G8U A;  1QSY A;  4W5N A;  4DSE A;  2OYQ A;  3IRX A;  3SNN A;  3LP1 A;  4DG1 A;  3KLH A;  1UA0 A;  1F21 A;  3ZSO A;  3K2P A;  4CGI A;  3MAQ A;  4B3O A;  4C8N A;  4HUF A;  1KFS A;  5J2M A;  1Y97 A;  4M45 A;  1BGX T;  4W5R A;  3SUQ A;  4FM2 A;  4F3O A;  4CEF A;  3QER A;  3ZSR A;  5J2P A;  3DLK A;  1C0U A;  3MEC A;  4KO0 A;  4CJE A;  5J1E A;  3NHG A;  4FYD A;  4OPK A;  2DFH A;  3HL8 A;  3T1A A;  4IG0 A;  4Z0U A;  4OGC A;  4LH4 A;  3LZI A;  4N76 A;  1CZ9 A;  1C1B A;  3U3Y A;  3AA3 A;  4OKJ A;  1S1W A;  2DFE A;  3LPU A;  5K14 A;  2Z1J A;  1NJW A;  1NKC A;  2Z1G A;  1WSF A;  2LSN A;  3L2R A;  2VWK A;  3K58 A;  4CF9 A;  4CK3 A;  3VN5 A;  2HHU A;  1S1V A;  1RBT A;  3H08 A;  4CJR A;  3KD1 E;  4HCC A;  4CGG A;  5J2Q A;  3AVJ A;  4BE1 A;  2XRI A;  4CJL A;  4O0I A;  4KFB A;  3NF6 A;  3SV4 A;  2YKN A;  2YKM A;  4Z4C A;  1WSJ A;  4F8R A;  4DU1 A;  1QTM A;  4DFK A;  1VSK A;  1RTH A;  3HT3 A;  5HBM A;  3MEG A;  3NDK A;  4DSF A;  3ZSQ A;  4KB1 A;  4FK2 A;  3TWH A;  3HXM A;  1IKV A;  1WLJ A;  3JSM A;  4FZY A;  3IAY A;  3VQ4 A;  4CHZ A;  1TV6 A;  2B4J A;  4KPY A;  4RW4 A;  1JXE A;  2G8K A;  4Z4E A;  1NJY A;  1S6Q A;  4L8R B;  3M8Q A;  1KLM A;  4CHY A;  4CGJ A;  4N5S A;  2KFN A;  5HRS A;  2E6L A;  5KI6 A;  1J5O A;  4C8K A;  1CXU A;  4YNQ A;  3NGY A;  3SUP A;  3HPG A;  3VQ9 A;  3PX0 A;  1B9F A;  1BCM A;  3AA4 A;  5D3G A;  3SPY A;  4CE9 A;  2NUB A;  3K57 A;  4BWJ A;  4CF2 A;  3NF8 A;  3QEI A;  1TAU A;  4B08 A;  1REV A;  3TAM A;  1N5Y A;  4N56 A;  1W0H A;  1KVB A;  1ASU A;  3PUF A;  1ITG A;  1JLA A;  4GMJ B;  3HK2 A;  3NCI A;  2JLE A;  1RT2 A;  1JXB A;  4J2B A;  4JS5 A;  1QSL A;  2OPQ A;  3DLG A;  4FK4 A;  4E7H A;  3OS1 A;  3SI6 A;  3V9S A;  3KIO A;  3CYM A;  4M3R A;  3S3N A;  3OYB A;  3SJJ A;  1D9D A;  2PY5 A;  2ETJ A;  3ULD A;  2P5G A;  1X9S A;  3O3H A;  3C6U A;  3KLG A;  2KZM A;  1N6Q A;  3V1O A;  2FBY A;  1L3U A;  3AVA A;  3AVG A;  1UWB A;  5FRO A;  2RF2 A;  3ITH A;  3D45 A;  4DQS A;  1NKB A;  1NK0 A;  3K5N A;  4KKO A;  3C94 A;  3DLR A;  3ZSX A;  5CYQ A;  1HPZ A;  5HRN A;  3QES A;  2G8F A;  1HRH A;  4F3T A;  1RBV A;  2HHW A;  1LW2 A;  1S9G A;  3OJS A;  3KTQ A;  4ID5 A;  1FK9 A;  1S6P A;  4GW6 A;  1CZB A;  3QEW A;  4CJW A;  4B9T A;  1ZBU A;  3M8S A;  1BQM A;  4MQ3 A;  4CF8 A;  1C1C A;  3AO2 A;  3OYC A;  1IG9 A;  1JLF A;  3NBP A;  2KW4 A;  3VQA A;  1VRU A;  2JGU A;  4QOZ B;  2W42 A;  5C24 A;  2BE2 A;  3SQ1 A;  4DQR A;  3DI6 A;  3TAP A;  3AVI A;  4CGF A;  4CJ5 A;  1UOC A;  3DYA A;  4CJU A;  1KSP A;  3VQ7 A;  3QEX A;  2D0C A;  1DLO A;  4DQQ A;  4AHR A;  3NE6 A;  1GOA A;  3CFO A;  4CJ3 A;  1XHX A;  3OYA A;  1T03 A;  2GV9 A;  1BIU A;  2ZE2 A;  3JYT A;  2G8H A;  3RR7 A;  1DTT A;  4E1M A;  4CFB A;  3SPZ A;  4FM1 A;  4I9Q A;  4DWI A;  3LZJ A;  3MED A;  4DS4 A;  4FLW A;  1KLN A;  1VSE A;  2HNY A;  3ZT3 A;  4FLY A;  1Z25 A;  1WSG A;  4CEZ A;  3RTV A;  2Y1J A;  4B9S A;  4AHC A;  3VQ6 A;  1U48 A;  1KVA A;  2YNG A;  3AO3 A;  3OYE A;  4DFM A;  2HB5 A;  4FJN A;  2HHV A;  1NKE A;  1NJZ A;  4CHO A;  1TKX A;  1HMV A;  4F2R A;  3AVL A;  4DTX A;  2IGI A;  3AV9 A;  1BI4 B;  1R0A A;  1RIL A;  1LV5 A;  1Q9Y A;  1UAX A;  4KV8 A;  1HQE A;  1BI4 A;  4C8L A;  4C8O A;  3SYZ A;  2IOC A;  4KHW A;  4RW7 A;  3O3G A;  4Y1D A;  2RKI A;  2OPP A;  3NAE A;  4BE0 A;  4FCY A;  4CED A;  1JLE A;  2YNH A;  5CY4 A;  2KTQ A;  3OYI A;  4KHY A;  3PX6 A;  4FK0 A;  4CJ4 A;  2D5R A;  1JLQ A;  2OPS A;  1RT7 A;  3O4N A;  4CJK A;  1X9W A;  2X78 A;  4B9M A;  4CEB A;  4DS5 A;  1WSI A;  3ZT0 A;  3K59 A;  2Y1I A;  2QKK A;  1T05 A;  4RW6 A;  5JS2 A;  4BAC A;  3MXM A;  3QIN A;  2HHX A;  4FLU A;  4I2P A;  1W9H A;  4M3W A;  2PYL A;  1SKS A;  4UQG A;  3VQ8 A;  4LSN A;  1KVC A;  4H4M A;  3P83 D;  1LWF A;  4IFY A;  4AIL C;  1U4B A;  4Z4F A;  1J53 A;  2WON A;  3NF7 A;  4CK1 A;  1FKP A;  3HST B;  3V9U A;  3ALY A;  3KK2 A;  2XHB A;  3VA3 A;  4ELV A;  4EP5 A;  4FLX A;  3AVK A;  3S9H A;  4M3X A;  3RMC A;  2BDP A;  3AO1 A;  3ZCM A;  2G8I A;  4FJM A;  3OYG A;  3G10 A;  3AO5 A;  2XY8 A;  4Q0B A;  5C25 A;  3L2W A;  4BDP A;  5I3U A;  2EX3 A;  4DFJ A;  3PV8 A;  4B8C A;  3OYL A;  2R7Y A;  4DTU A;  2P1J A;  4OGE A;  1NK5 A;  3HVT A;  2RN2 A;  4Q5V A;  3TAB A;  1GOC A;  1TK0 A;  2WOM A;  4HCB A;  1YT3 A;  3QO9 A;  1ZBI A;  3FFI A;  1VSJ A;  1D9F A;  2RPI A;  1HNI A;  1IKW A;  4WE1 A;  1S9E A;  4FVM A;  4TSX A;  3LP2 A;  4DTP A;  1EKE A;  2YV0 X;  4EZ6 A;  2KFZ A;  4CHQ A;  4DF8 A;  1FXX A;  3CG7 A;  3OY9 A;  4I9L A;  3VQP A;  1RBR A;  3LAN A;  2ZQB A;  1KTQ A;  1C1A A;  4IDK A;  4CEC A;  3VQB A;  3D0P A;  1LAV A;  4K8Z A;  4FJH A;  1QHT A;  2VG7 A;  4CJF A;  1L3V A;  3SQ2 A;  4ZHR A;  1RDA A;  4E7L A;  3DLH A;  3SCX A;  4CFA A;  3AVN A;  2FBX A;  4CHN A;  3BDP A;  1I39 A;  2KQ2 A;  3LWL A;  2A1R A;  3ZSY A;  4H4O A;  1BL3 A;  4FLV A;  4FW1 A;  1D8Y A;  4Y1C A;  1JLG A;  4LSL A;  3T19 A;  4EP4 A;  3F73 A;  4E7K A;  3C6T A;  4CES A;  1WAF A;  4JS4 A;  3A2F A;  1HQU A;  5DK5 A;  1RDD A;  1YTA A;  4PWD A;  5HP1 A;  5KRT A;  4G1Q A;  4XIU A;  3IG1 A;  3HJF A;  3RRH A;  2XY5 A;  1RT1 A;  1NK7 A;  3ZSV A;  3KK3 A;  4RG8 A;  4AHV A;  4FJG A;  3SQ4 A;  4QCL A;  3O3F A;  1WAJ A;  3BGR A;  4CIE A;  3ZSW A;  3UIQ A;  4NCA A;  3KLI A;  4KI6 A;  1U04 A;  3V1Q A;  5E41 A;  1KRP A;  2DY4 A;  4B9V A;  3QEP A;  2GBZ A;  3WNE A;  4E19 A;  3V1R A;  4Z4H A;  5EU7 A;  1JL1 A;  1SL0 A;  4M3U A;  1S1T A;  2HW3 A;  4CCH A;  1S1X A;  2ZD1 A;  3CQ8 A;  1U47 A;  2KZZ A;  4KTW A;  3NH0 A;  5DMR A;  1NK6 A;  1J9A A;  5T7B A;  3L2U A;  3SZ2 A;  3V6D A;  4FLZ A;  1BQN A;  4DLE A;  1SKR A;  2BAN A;  3AA5 X;  4KTZ A;  1TKZ A;  2B5J A;  5KTQ A;  3S3M A;  4AH9 A;  2HMI A;  4R5P A;  4KRE A;  4JRQ A;  3L3V A;  1ZBH A;  1TAQ A;  4HVJ A;  3OJU A;  3G0Z A;  3HPH A;  4BE2 A;  2D0A A;  2P5O A;  5KGW A;  4F2S A;  4M3T A;  1WNS A;  3OYD A;  3DRR A;  4CEE A;  3C95 A;  1Z26 A;  4N47 A;  2HVI A;  1DTQ A;  4Z4I A;  3ASM A;  3SQ0 A;  1X9M A;  1IKX A;  4YFU A;  3OYH A;  1QE1 A;  1TL1 A;  2I5J A;  1G15 A;  2DFF A;  2F96 A;  3E01 A;  1TGO A;  2GUI A;  3DOL A;  4JLH A;  3M8P A;  4QAG A;  3HM9 A;  4DLG A;  4IFV A;  4CGD A;  3HP9 A;  3RMA A;  3AO4 A;  4B9L A;  2QK9 A;  4KRF A;  3L2V A;  2VWJ A;  1I3A A;  3QIP A;  4B8A B;  3RMD A;  5CZ2 A;  1RBS A;  4KI4 A;  3QEV A;  4CIG A;  3I0S A;  2Q3S A;  2OZM A;  3QLH A;  1NOZ A;  3VQC A;  4FJ9 A;  2HNZ A;  1RTI A;  1D5A A;  4MFB A;  3ZT4 A;  3OS0 A;  1Q9X A;  4CJV A;  2IAJ A;  1S5J A;  4OLA A;  3LWM A;  4BDY A;  2IDO A;  2D0B A;  1O1W A;  1YVU A;  1HYV A;  3QNN A;  1EX4 A;  1EXQ A;  4CF0 A;  2B6A A;  4CEA A;  3RWU A;  1JLB A;  3PO4 A;  4DSL A;  3ZSZ A;  3THV A;  1KFD A;  3WNH A;  4CFC A;  4W5T A;  1RT3 A;  1BIS A;  5I42 A;  4ZTJ A;  1YTU A;  4E3S A;  1XC9 A;  1SL2 A;  4DSK A;  4OVL A;  4EZ9 A;  5SWM A;  4NCB A;  3AVC A;  1RT5 A;  3EY1 A;  4DU4 A;  3HYF A;  3K5L A;  2A1S A;  2E4L A;  4OJR A;  3AA2 A;  2XY6 A;  4DU3 A;  4KHU A;  2BGG A;  1KCF A;  1A5V A;  4LY7 A;  2VG5 A;  3HP6 A;  2HVH A;  2HHQ A;  3L8B A;  1NK8 A;  4IKF A;  4N41 A;  4FJ8 A;  2YHB A;  2AJQ A;  3KLE A;  1XWL A;  3VQQ A;  4DTS A;  1QSS A;  3OS2 A;  5CZ1 A;  3TAF A;  3S3O A;  2F8S A;  5KGX A;  3RRG A;  3TAG A;  3B6O A;  3OYM A;  4DQP A;  1WN7 A;  2Z1H A;  3V81 A;  3KJV A;  3HVR A;  3NF9 A;  3P1G A;  4F4K A;  3QIO A;  4W5O A;  4KHN A;  4K8X A;  5SZT A;  3KLF A;  2HHT A;  4CF1 A;  1T7P A;  3KD5 E;  4FLT A;  1IH7 A;  1TL3 A;  4RW8 A;  3TR8 A;  4DSJ A;  3HPO A;  4CFD A;  4FJ5 A;  4B9U A;  1BHL A;  4OPJ A;  1CXQ A;  4AHT A;  4FM0 A;  3CFR A;  1RCH A;  2OPR A;  3CM6 A;  4KHS A;  3ISN C;  4O5B A;  4FJL A;  2FBT A;  4NCG A;  3PX4 A;  3QNO A;  1L3T A;  2F8T A;  3RR8 A;  3DMJ A;  3AVF A;  3V9W A;  1Q8I A;  4CJS A;  5HRP A;  4BWM A;  4BDZ A;  1WSH A;  4DMN A;  4CIF A;  3I8D A;  3RMB A;  2YHA A;  1LAW A;  3LDS A;  3DLE A;  4CEO A;  3K5M A;  1BIZ A;  4CK2 A;  3ZT1 A;  1L3S A;  4GVM A;  1T8E A;  4FJI A;  1IKY A;  2ATQ A;  1RTJ A;  4E7J A;  1J54 A;  4E89 A;  1LWC A;  1ASV A;  2DTU A;  1TKT A;  3CM5 A;  1HNV A;  1QQC A;  1U49 A;  4PQU A;  3TI0 A;  3LAM A;  5HRO A;  1C6V A;  3NGI A;  5FRM A;  1VSI A;  1NK9 A;  4J2A A;  2YNI A;  3VA0 A;  1RBU A;  1VSL A;  3OYK A;  3M8R A;  1HYZ A;  4HTU A;  3OYF A;  4DTN A;  5C42 A;  3DRP A;  4ID1 A;  3TAR A;  4KB0 A;  3L3U A;  4FJX A;  1RDB A;  1RNH A;  3NFA A;  1U45 A;  1ZBL A;  1NK4 A;  1NJX A;  3KKR A;  2G8W A;  4DQI A;  5FRN A;  4CJT A;  4M3Z A;  1VRT A;  1B9D A;  3OYN A;  3OVN A;  3P5J A;  1EET A;  1TK5 A;  4ZTF A;  2OA8 A;  1RT4 A;  3LAL A;  5J2N A;  4KAZ A;  1QS4 A;  2IC3 A;  2Z1I A;  3NH2 A;  1LW0 A;  3B6P A;  1S1U A;  5HRR A;  3V9X A;  3MEE A;  3SUO A;  4AHS A;  3OYJ A;  3DM2 A;  3WNG A;  1XHZ A;  4DTR A;  3ZT2 A;  1UA1 A;  2PZS A;  2IS3 A;  3VQ5 A;  3PY8 A;  2QKB A;  4FXD A;  4IBN A;  4Z4G A;  4AHU A;  1JLC A;  1GOB A;  1HJR A;  2X74 A;  3V4I A;  3V9Z A;  4LH5 A;  2E6M A;  1RDC A;  5KRS A;  4DTJ A;  1ZBF A;  4M42 A;  1EP4 A;  4IG3 A;  4OLB A;  5HLF A;  4B9N A;  2P51 A;  2X6N A;  3T3F A;  2ITG A;  3LPT A;  2EHG A;  5FDL A;  2XO7 A;  3QET A;  4PA1 A;  3DRS A;  4LD0 A;  2OZS A;  3WNF A;  4J2E A;  1SL1 A;  1TVR A;  4C8M A;  4E1N A;  3NH1 A;  3TAQ A;  2PYJ A;  3LP0 A;  5CYM A;  4FZX C;  4FJK A;  3LP3 A;  4KTQ A;  4FW2 A;  1MU2 A;  2O4G A;  4HUE A;  1JKH A;  2FC0 A;  4OKE A;  4H8K A;  3VQE A;  1VSM A;  3MXJ A;  4CHP A;  4W5Q A;  4E7I A;  4HHT A;  4DTM A;  3AVB A;  4O44 A;  2YNF A;  1CLQ A;  3L2Q A;  3I0R A;  1XI1 A;  1X1P A;  4O0J A;  1K6Y A;  3K5O A;  3MXI A;  1C0M A;  1C0T A;  1FKO A;  4NYF A;  4CER A;  4I2Q A;  3VQD A;  4PUO A;  4CJQ A;  3LAK A;  4O55 A;  1A5W A;  4JRP A;  4DSI A;  3PO5 A;  4CJP A;  4ICL A;  3TAN A;  2G8V A;  4FJJ A;  3O4Q A;  1SUQ A;  4RW9 A;  1TK8 A;  1LWE A;  2QXF A;  4FJ7 A;  4DTO A;  4DFP A;  4ELU A;  1B92 A;  3SV3 A;  4KHQ A;  3IS9 A;  4CGH A;  4M3Y A;  1BCO A;  3KK1 A;  4OKK A;  2HND A;  4CEQ A;  1RTD A;  2O4I A;  3F9K A;  2VG6 A;  4J2D A;  3EZ5 A;  4DF4 A;  2XY7 A;  4HUG A;  1SKW A;  3NGZ A;  3EYZ A;  4FZZ A;  3CFP A;  2X6S A;  2HHS A;  1ASW A;  1TKD A;  1VK0 A;  1VSH A;  3HO1 A;  1A5X A;  1L5U A;  1ZYQ A;  3KKS A;  4ELT A;  5JS1 A;  4I7F A;  3U6F A;  1IO2 A;  3DOK A;  1VSD A;  3U3G A;  3TAE A;  1HYS A;  1SV5 A;  1NOY A;  3DLB A;  1WSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...