3NF6A

Structural basis for a new mechanism of inhibition of hiv integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for a new mechanism of inhibition of HIV-1 integrase identified by fragment screening and structure-based design
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nf6A00
1Z25A 2VWKA 4RG8A 4RW8A 3NH2A 3O3HA 1RTIA 4DFMA 4C8KA 3AVFA 5EU7A 1T05A 3EYZA 3MAQA 1D9DA 4W5QA 3DLBA 3WNFA 4DWIA 4FJMA 3LP2A 3MXJA 1WLJA 3NF8A 4HUFA 2HW3A 1UWBA 2WOMA 4DU4A 1IKXA 3ALYA 3V1QA 3HK2A 4AH9A 2NUBA 4RW7A 3L2QA 1HYZA 3HM9A 2OYQA 1VSHA 2Q3SA 1X9SA 4CJFA 1LWCA 3AVIA 3D0PA 4LH4A 2P1JA 3NBPA 3DRPA 4CEEA 1QTMA 4FZYA 2HMIA 2XY6A 3IS9A 1NK4A 4NCAA 1CXQA 1JLEA 3OJSA 4FLVA 4W5NA 3AVBA 5HRNA 5J2QA 3WNEA 1Y97A 1Q9XA 4CHPA 5HLFA 1X1PA 4C8MA 4KO0A 1XHXA 2KW4A 2BANA 3PX6A 1X9WA 2FBTA 3NF6A 4ZTFA 2BE2A 3L3UA 2QK9A 1JXBA 2B6AA 3SZ2A 3QESA 3MECA 4LD0A 1YT3A 4E1MA 4YFUA 4FLZA 5J2NA 4CE9A 4I2QA 4CERA 1ZYQA 2BDPA 2QKBA 1NKEA 3RRHA 4IFYA 4B8AB 4FCYA 1ZBLA 4CEAA 3OYGA 1TV6A 4QAGA 1A5VA 4FLUA 1VSDA 2PYJA 4CK1A 5CYMA 4KFBA 4CGFA 1TGOA 3LZIA 1TK8A 1L3VA 3S3NA 2HHVA 1S5JA 3KKRA 1RTDA 2XY7A 3HXMA 1C0TA 1UA0A 4H8KA 2ATQA 4FW1A 3AO3A 4B9TA 1C1CA 1FXXA 1RDCA 4LH5A 4O0JA 2PYLA 1RNHA 2HHXA 4J2BA 2QXFA 3DOKA 2X78A 4DLEA 2XHBA 4DFJA 1SKSA 1KCFA 3HP6A 4FLYA 4CIEA 1GOAA 4CF8A 4FM2A 2Y1JA 3OYJA 1IKWA 1X9MA 4FJIA 1S1TA 4HUGA 2BGGA 1NK9A 4GMJB 4FLXA 3CG7A 1ASVA 3RMDA 1S1VA 4MQ3A 1WSGA 3C95A 1S1UA 3PUFA 3F9KA 4ELUA 4EP5A 3KK3A 4AHSA 2EHGA 3EY1A 3TAEA 4R5PA 4WE1A 1RBTA 3CFRA 1NK7A 2G8KA 3VQDA 4KI6A 1MU2A 4J2EA 3AVNA 3IAYA 3AVGA 3BDPA 1HNVA 3RTVA 2HVIA 5DMRA 2WONA 4KTZA 1RCHA 3DOLA 4CEDA 2DFEA 4E0DA 2HHSA 5HBMA 2RPIA 3V1OA 1FKPA 3V9SA 4AHTA 3SQ1A 3AV9A 5J2MA 1RT3A 3AO4A 3P5JA 1B9FA 3VQ6A 4CESA 5KGXA 3KJVA 4KHSA 3VQCA 3NGIA 3VA3A 3AA5X 1HPZA 3T1AA 3SV3A 1YTAA 2D5RA 2FBYA 3OYMA 4DF8A 3L2VA 3DLHA 4Z4IA 3QEVA 2F96A 3THVA 4EZ9A 1RT1A 1TKXA 2FBVA 1HQUA 5FRMA 1W9HA 3QEPA 1U47A 3QETA 3MXMA 1BHLA 1SKRA 4B9SA 1QSYA 4KPYA 3LANA 3ITHA 3I8DA 3UIQA 3HVRA 1ZBHA 1A5XA 1LWEA 4FJ8A 1EP4A 1RTJA 5SZTA 4M45A 5FROA 4FJ9A 4N56A 4IG3A 1A5WA 4OPJA 2Z1HA 1QS4A 4KV8A 4B9VA 3OYEA 3VQEA 1UOCA 4M3WA 2DTUA 3AO1A 4DTSA 5FRNA 1U04A 1JKHA 5KRTA 3HSTB 3ZSZA 4CJSA 3NGYA 3TWHA 4C8NA 4KAZA 1ASWA 4CHZA 3LDSA 3ZSQA 3BGRA 4O0IA 2P5OA 1VSEA 3VQ9A 4DF4A 4KKOA 1BIZA 4OPKA 4FK4A 3L3VA 3KLHA 2A1SA 1BI4A 2PY5A 2PZSA 2P5GA 3K5NA 2IOCA 1WSJA 2GBZA 3QLHA 3HYFA 3V9XA 3ZSYA 4ELTA 1LAVA 4DSJA 3DRSA 4FJLA 4O5BA 1C0MA 3AA2A 3OJUA 4IDKA 1ZBFA 4F4KA 3NH1A 5CZ2A 3AA4A 4QOZB 1XHZA 3DLEA 1GOBA 4G1QA 3K59A 3L2WA 3DLRA 1N6QA 1RBRA 1BQMA 1GOCA 2G8WA 4N41A 2HVHA 1NKBA 4FZZA 2IAJA 3V81A 4KB1A 4K8ZA 3SCXA 1NK8A 5D3GA 4CHOA 1BCOA 3AVHA 4J2AA 4CK3A 1CZBA 4CJLA 3PV8A 1VSMA 1S9EA 3LALA 1XI1A 1W0HA 1JL2A 4IFVA 3QEXA 3T19A 1NKCA 1TAUA 3H08A 1TK0A 4CEOA 4KRFA 4B9NA 4EZ6A 3RMCA 4CJPA 1HYVA 1TL3A 2XO7A 4OLAA 3KD5E 4AHCA 4YNQA 3G10A 2HNYA 3TR8A 4M42A 1KFDA 4FVMA 4KHYA 3AA3A 1HJRA 1RT5A 1J53A 3TAMA 3V9UA 2JLEA 3LP3A 1NJXA 4B3OA 1VK0A 3ULDA 3SUPA 4K8XA 1WAJA 2XY8A 4IKFA 4FK0A 3RR8A 1RBVA 4JRQA 4HUEA 4M3TA 3K2PA 1BIUA 4E19A 1BGXT 3QERA 3NDKA 5JS2A 3ZSRA 2YNGA 1VSFA 2E6MA 1T8EA 2OPRA 2G8HA 2RN2A 4O4GA 2G8UA 3C6UA 4F2RA 3NGZA 1JLFA 4W5OA 3HT3A 4DFPA 2Y1IA 1EETA 3NH0A 4BDZA 4LSLA 4FLWA 3TAFA 4CJ5A 4OLBA 3K5MA 4CHNA 2HHTA 4CFDA 4Z0UA 1J9AA 2KTQA 4HHTA 1JXEA 3DMJA 3SPYA 1KVCA 4CJEA 3PX0A 4H4MA 2YNHA 4CGGA 4BACA 1IKVA 3LPUA 5HRSA 2OA8A 3AVLA 3OYBA 1RTHA 3HPGA 1B9DA 1Q8IA 4NYNA 4CF0A 3DRRA 3QINA 3QEWA 1KVBA 4DQIA 3O3GA 2KFNA 2YNIA 4EP4A 3SYZA 2ETJA 2RF2A 2P51A 3VQ7A 4QCLA 2A1RA 1SKWA 1RT4A 1RT7A 1QSLA 3MXIA 3VQQA 1LW0A 3G0ZA 3LAKA 3WNGA 4DQSA 2VWJA 1F21A 4ELVA 3KIOA 3OYAA 3K57A 3OS1A 1I3AA 4CJUA 5SWMA 2KFZA 1FKOA 3M8RA 4HCBA 2Z1GA 4ZHRA 2AJQA 3PO5A 4CGJA 1BISA 3C94A 1CZ9A 3KLGA 4PA1A 4Z4CA 4FJGA 1K6YA 4CJRA 1VSKA 1S6PA 4FM0A 1TK5A 2HNDA 1RILA 3U6FA 4M3YA 2KZZA 4LSNA 1VRUA 4CJVA 3OY9A 2B4JA 4DQPA 1ITGA 4FJNA 3KK2A 4J2DA 1BL3A 4NCBA 1VSIA 3F73A 3ISNC 1WAFA 2DFFA 2YHBA 1RDBA 2IC3A 4DSFA 2GV9A 3KLIA 3NHGA 4E1NA 3HP9A 4W5TA 3WNHA 3ZSOA 4IBNA 2YV0X 4CEBA 3SV4A 4C8LA 4HCCA 1TL1A 2FC0A 4E89A 3K5OA 4CJ3A 4CHQA 3VQ5A 1KFSA 4W5RA 1HYSA 3AVKA 4DFKA 2JGUA 3EZ5A 4E7JA 1SL0A 3RMBA 2QKKA 1ZBIA 2VG7A 3OYDA 4Q5VA 2YNFA 3I0SA 4N76A 3D45A 4CJTA 1SL1A 4FJ5A 4AILC 4N47A 3SUOA 1HMVA 1JLGA 4BE1A 3P83D 2D0BA 4PUOA 1HQEA 4OKKA 1QQCA 4IG0A 3OYIA 4DTJA 4F8RA 4FZXC 3RMAA 1LV5A 4CECA 3IRXA 4M41A 3E01A 3O3FA 3HPOA 4FLTA 4B9MA 2OZMA 1C1AA 1WSEA 1D8YA 2Z1JA 1KTQA 4DTPA 1DTTA 4KI4A 1L3UA 3VQ4A 3PO4A 4FW2A 3B6OA 4GW6A 5HP1A 1U4BA 4FJ7A 3CM6A 5HRRA 4PY5A 2O4IA 2D0CA 2HNZA 5KGWA 1WSHA 4N5SA 3SI6A 3LWLA 4F2SA 4E3SA 3OYFA 4B8CA 1KRPA 4JLHA 3OYKA 3ZSWA 1KLMA 1LAWA 2X6NA 1QE1A 1U48A 2G8VA 4ID5A 4CIFA 1DTQA 4CK2A 4DMNA 2DY4A 4DTOA 4JS4A 3SNNA 3DYAA 2G8FA 3AVCA 4KTWA 4KHUA 2HHUA 2ZQBA 4C8OA 3ZSVA 4PQUA 3VQAA 4M3UA 3T3FA 3MEGA 4DG1A 4E7LA 1D5AA 2X6SA 4OKEA 4FM1A 1T7PA 1R0AA 1HNIA 3FFIA 2ZE2A 3VQPA 3VN5A 1EXQA 3TI0A 1S6QA 3NAEA 3QEIA 2ITGA 4E7HA 4F3OA 4CCHA 4OGEA 3SUQA 4B9UA 5C24A 4BWJA 4JS5A 4BDPA 3L2RA 3HVTA 4B08A 3LZJA 5E41A 3ZSXA 1ASUA 2OPQA 4O44A 3CM5A 3OYHA 3ZT1A 2YKMA 3O4QA 3HO1A 3S3OA 1YVUA 2OZSA 4DSIA 2GUIA 3QO9A 2X74A 1KLNA 3KD1E 4CGDA 5CY4A 1Z26A 1NJWA 3C6TA 5C25A 4PWDA 3DI6A 3KLFA 2HHWA 4FJHA 2OPPA 1S1XA 4FJXA 1SL2A 1LWFA 2Z1IA 3OVNA 4CJKA 2YKNA 3JSMA 3MEEA 1RBUA 4OJRA 3LP1A 3ZT0A 1EX4A 3LAMA 1WNSA 4Z4FA 5FDLA 4DU1A 4DS5A 4KHNA 2IDOA 4M3XA 3ZT3A 4GVMA 1KVAA 1IKYA 1WN7A 4Y1CA 4UQGA 3K58A 4Z4EA 3CYMA 2KQ2A 3DLKA 4XIUA 4DSEA 2B5JA 3HJFA 4CHYA 4E7KA 1BCMA 1J54A 3O4NA 1BQNA 3NE6A 3NF7A 2OPSA 4CEFA 4KHWA 4DTUA 4MFBA 3HL8A 4I9LA 5T7BA 1XWLA 3OS0A 5JS1A 3AO5A 3ZT4A 3OYCA 3KTQA 2F8SA 1J5OA 3MEDA 4AHUA 1JLCA 3KLEA 4F3TA 3V4IA 3SQ4A 4KREA 4LY7A 3JYTA 4DTNA 1QHTA 4L8RB 3K5LA 3ZCMA 3AVJA 1ZBUA 2KZMA 1C0UA 3LP0A 3S3MA 3M8SA 1SV5A 2HB5A 3LPTA 4HVJA 3B6PA 4BDYA 1L5UA 1IG9A 4Z4GA 4NCGA 3U3YA 2LSNA 1JLBA 4Q0BA 3SUNA 5I3UA 1QSSA 3QNOA 1CLQA 3QIOA 3CFPA 3DM2A 4NYFA 3SQ2A 1B92A 4B9LA 1NJZA 1O1WA 1TVRA 2FBXA 3AO2A 4OKJA 1TKZA 4OGCA 4DU3A 3L8BA 1U49A 1RDDA 1S1WA 1VRTA 1RT6A 3LWMA 5C42A 3SPZA 2EX3A 3RRGA 3DLGA 4FK2A 3U3GA 4I7FA 3V6DA 4RW9A 4CF1A 2HHQA 4I9QA 4M3RA 4DS4A 1NK0A 3PY8A 1IH7A 1JL1A 1D9FA 3V9ZA 3I0RA 5I42A 4DTMA 1CXUA 3AVAA 3L2UA 4DTXA 4AHRA 3TARA 1T03A 1RDAA 1IO2A 1UAXA 4HTUA 4DTRA 3S9HA 1C1BA 3ZT2A 4BE2A 4KTQA 5HRPA 5J1EA 3OYLA 3TAPA 2DFHA 1L3SA 4TSXA 4CFAA 3OS2A 1S9GA 2YHAA 3A2FA 4CJ4A 3HPHA 3M8QA 1UA1A 4FJJA 2D0AA 1VSLA 3ASMA 3CFOA 3QNNA 1WSIA 3AVMA 4ZTJA 4RW6A 1BI4B 1NOYA 4KHQA 5KTQA 1WSFA 1EKEA 2IS3A 5DK5A 2XRIA 3KK1A 3TABA 4FXDA 1FK9A 4FYDA 3QIPA 1NK6A 4DQQA 5CYQA 3NF9A 1Q9YA 1I39A 4CIGA 3P1GA 1SUQA 4BE0A 1RT2A 5KI6A 2VG6A 4ID1A 3RR7A 3KKSA 1VSJA 2I5JA 1NK5A 5KRSA 1NOZA 3VQ8A 4FJKA 3IG1A 1XC9A 1YTUA 3SJJA 2F8TA 2E6LA 1G15A 4Z4HA 3TAQA 3VA0A 4AHVA 2R7YA 3SQ0A 4CFBA 3V9WA 5CZ1A 4E7IA 1TKTA 4KB0A 1RBSA 2IGIA 5K14A 4CJQA 1KSPA 2G8IA 1HRHA 1C6VA 3VQBA 1LW2A 2VG5A 3OYNA 5J2PA 1JLQA 1REVA 4RW4A 3TAGA 5HROA 1TAQA 4Y1DA 1JLAA 2E4LA 4DLGA 1U45A 4I2PA 1TKDA 4CF9A 2O4GA 3NCIA 3NFAA 4CEZA 3RWUA 2RKIA 4CGHA 4ICLA 1L3TA 4H4OA 1DLOA 2ZD1A 4DQRA 4JRPA 4DSLA 3M8PA 3CQ8A 3PX4A 3V1RA 4DSKA 4CF2A 2W42A 1NJYA 4BWMA 4O55A 4OVLA 4CJWA 4M3ZA 4CFCA 1N5YA 4CEQA 2XY5A 3TANA 4CGIA
chains in the Genus database with same CATH superfamily
1Z25A 1NBWA 4RG8A 1RTIA 4DFMA 5EU7A 4DWIA 1XUPO 3WNFA 3LP2A 2HW3A 3H46O 3EE8A 3MWPA 1IKXA 3WXIA 4AH9A 3L2QA 1QVFM 1HYZA 3LDPA 1VSHA 5EX5A 2OYQA 1X9SA 4CJFA 4LH4A 3DRPA 4CJ7A 4FZYA 2HMIA 4NCAA 1CXQA 3EN9A 3L4IA 4FLVA 2E2NA 5HRNA 3WNEA 1Y97A 4KO0A 1X9WA 1Q18A 3L3UA 5E26A 2B6AA 4LD0A 2E8AA 1XQSC 2UYTA 4YFUA 5J2NA 4I2QA 4CERA 4CD3A 3ZEUB 2BDPA 3RRHA 4BRKA 2WUSA 3OYGA 3VGLA 4QAGA 3THXB 5CYMA 1TGOA 3LZIA 1TK8A 4DCHA 2HHVA 2O8DA 1RTDA 1S22A 3O9SA 3HXMA 1C0TA 3CCJN 4WYBA 4FW1A 4B9TA 4O0JA 2NRTA 1XC3A 4BRCA 1U2VB 4DLEA 4QS7A 4BGAA 2A41A 2QTDA 4XEIA 1GOAA 2A6AA 2P9UA 2Y1JA 4DR2K 3FGUA 4HUGA 3DXKB 3WXKA 1NK9A 4GMJB 1IBKK 4FWMA 1ASVA 3G6EN 4MO4A 2HBKA 4YOVA 4ELUA 3J7ZO 4R5PA 3CFRA 1M1KO 4KI6A 2JWKA 1MWKA 4J2EA 3CD6N 3IMXA 3IAYA 3GL1A 4K25A 3UKRA 3RTVA 2HVIA 5AZJB 1S3XA 4CEDA 5CR4A 4DKWA 5HBMA 1OVQA 4AQYK 2OTJN 3AA5X 3SV3A 2FBYA 1NG9A 4IO8A 4DF8A 4Z4IA 3QEVA 2F96A 3THVA 4EZ9A 1TKXA 1U47A 3QETA 4BR0A 3BUZB 3MXMA 3HRGA 4A62A 4KPYA 4RTFD 1ZBHA 1A5XA 1BU6O 4FJ8A 1C0FA 2YX6A 4BR5A 5AQVA 4IG3A 4JI7K 1OH6A 3VQEA 2VQEK 3FZKA 4DV2K 2P9PB 1U04A 1I94K 3TWHA 1KXPA 4AM6A 3WEEA 1ASWA 4O0IA 1BOTO 3PSIA 4KHPK 4DF4A 1BIZA 3L3VA 1Z05A 2A1SA 2PY5A 5BRDA 3K5NA 1WSJA 4B3MK 4OO1J 3HYFA 2BTFA 3ZSYA 2W41A 3DRSA 1C0MA 3W0LA 4IDKA 1ZBFA 4DR7K 5CZ2A 4QOZB 1XHZA 3DLEA 4G1QA 4IDHA 4N41A 4B1VA 5AQJA 3VEWA 2KHOA 2HVHA 3I55N 4KB1A 1NK8A 4CK3A 1CZBA 1VSMA 3THYB 5GAHP 3BZKA 4GV9A 1NWKA 3HM8A 4IWVA 4BG9A 5LY3A 4FPAA 3IUCA 1TL3A 3EKUA 3KD5E 4OLAA 1KFDA 4FVMA 1NJIO 3SUPA 1D4XA 3U4LA 2XY8A 4A57A 4K8XA 4CZIA 3CF5L 1BIUA 3QERA 4JI5K 2HHTA 2G8UA 2E6MA 4O4GA 4F2RA 1R59O 4BDZA 4LSLA 4YOTA 4FLWA 3TAFA 1HJOA 1QQNA 4CHNA 4Z0UA 1J9AA 2HBMA 2KTQA 4HHTA 3DMJA 1KVCA 3PX0A 4H4MA 4PL8A 5HRSA 3AVLA 2A5XA 2GTDA 1RTHA 4CF0A 3QINA 4DQIA 4QCLA 1MWMA 1RT4A 3TTFA 1QSLA 3MXIA 3ZEUA 3R3LA 3K57A 4CJUA 1FKOA 3TSPA 1EO1A 2E1YA 1HNXK 2O8EB 1HNZK 5CE3A 4B3RK 4M7YA 1CZ9A 5C15A 4FJGA 3BP8A 4DQPA 4NCBA 3MMVA 3F73A 2E5LK 2DFFA 2YHBA 3P38A 2IC3A 2HF4A 4DSFA 3ID8A 4EFHA 2O8CA 3NHGA 2Q2RA 4W5TA 1C0GA 2IVOA 1IG8A 4HCCA 4CZJA 3VQ5A 4JD2A 5A2QO 2P9NB 2JGUA 5HL7L 4E7JA 1K8KB 3F2KA 3ULEA 4JK7A 5C2DA 4N47A 4O8KA 5AQNA 4WFAL 1CZAN 2P9IA 4H5NA 3E9LA 3M3ZA 4FZXC 2O8BB 1NLVA 5DM6L 3RMAA 4FLTA 1JCEA 4H0PA 1C1AA 2Z1JA 2QEXN 4L3QA 3EZWA 3PO4A 4FW2A 5AQUA 2O4IA 2QW9A 2D0CA 2F7TA 1HLUA 1WSHA 4BG8A 2FF6A 1QHAA 2VGMA 3CCVN 4CK2A 4DMNA 4XH5A 3O9TA 1SAZA 3DYAA 3AVCA 5AQGA 4BVOA 4KHUA 4C8OA 3VQAA 2V51B 4M3UA 3MEGA 4DG1A 4E7LA 5GIPA 2YHXA 3CMEN 3CCRN 2ZE2A 4BR4A 4JV5K 1S6QA 3QEIA 2ITGA 4F3OA 4BDPA 5C24A 4BWJA 4JS5A 3VEZA 3HVTA 4H0TB 4PKGA 3EEQA 1LCUA 3HO1A 3KD1E 5CY4A 1Z26A 5TKWA 4OX9K 2DPNA 3KLFA 2HHWA 3OA9A 2OPPA 1SL2A 1NMDA 2Z1IA 1VAZA 1RBUA 4GKKK 2IDOA 1IKYA 3HZ6A 4Z4EA 3CYMA 2KQ2A 3HJFA 4CHYA 1J54A 1BQNA 3NE6A 2OPSA 4CEFA 1BA1A 4CZHA 5KPTA 1YF5L 3KWIA 4IOXA 4WFNL 1J5OA 4AHUA 3KLEA 1Q81O 4F3TA 3C6AA 4LY7A 4DTNA 1H1VA 4L8RB 2BH1A 1ZBUA 1C0UA 1NGIA 1SV5A 2E1ZA 4Z4GA 2PFUA 3A0IX 3ENOA 5LJVA 4DR3K 3LDNA 1LOTB 4DU3A 3A5OC 1VRTA 3U3GA 1BG3A 4I7FA 1VQ6N 1NK0A 3CQYA 1KC8O 4LF7K 3L2UA 4DTRA 3S9HA 1C1BA 3ZT2A 4BQLA 4LF6K 1V4SA 3OYLA 3CCEN 3OS2A 4HTLA 3KWGA 3OTOK 2D0AA 3ASMA 3QMLA 1EQYA 1JJ2M 5KTQA 1WSFA 3SLCA 2Q36A 1W7AA 1K9MO 4BY9C 3QIPA 5E84A 5CYQA 1Q9YA 4CIGA 1SUQA 1RT2A 5KI6A 3KKSA 2F8TA 1XC9A 2E6LA 3N4QA 3VGKA 1OKJA 5AQPA 1Q7YO 5CZ1A 1YI2N 2D0PA 2Q31A 4KB0A 1RBSA 1KSPA 1LW2A 4JKFA 4RW4A 3JXUA 2GWJA 4BRQA 4EHUA 4BGBA 3NCIA 3TPQA 3NFAA 4CEZA 1L3TA 4NXMK 4H4OA 1DLOA 1X3NA 4JN4A 4BRMA 5C12A 3CQ8A 3SAHA 3VOVA 4CF2A 4BWMA 2V52B 4OVLA 4CGIA 4GV3A 4WFBL 4RW8A 1W97L 1D9DA 4C8KA 3QBWA 3MAQA 3MX5A 4W5QA 3DLBA 4FJMA 1VQ9N 4KBOA 3MXJA 2VWBA 4DU4A 3ALYA 5AQRA 3V1QA 3L4QA 4BC2A 2IIRA 4K0KK 2P1JA 3NBPA 4DHYA 1HUXA 2XY6A 2ZF5O 3IS9A 1OVYA 4FWOA 5JLHA 4W5NA 1BWFO 1HX1A 4CHPA 5HLFA 3D2FA 3VERA 3PX6A 3NF6A 1GLJO 4MDBA 2QK9A 3MECA 5KPZA 3CHWA 2QKBA 4DR5K 3EO3A 4H5RA 4FCYA 1ZBLA 4FLUA 1SZ2A 4H5VA 2PYJA 4CK1A 4DR6K 3K9JA 3KKRA 1DKGD 4CZMA 2QM1A 1UA0A 3C0BA 3EL2A 1C1CA 1FXXA 1RDCA 2HHXA 3CERA 2QXFA 3DOKA 2A42A 3HP6A 4BRIA 4CF8A 4FM2A 2VCPA 4KH5A 1X9MA 4DUYK 3J7AP 4FLXA 4WF9L 3CG7A 2Q1NA 3PUFA 1N33K 1YAGA 3F9KA 4EP5A 1GLBG 2EHGA 3UKUB 3OBWA 4WQ5A 3SAGA 3VQDA 3AVNA 3BDPA 4IEEA 4BRLA 1T3VA 4BR9A 4KTZA 1HNWK 3IKMA 1G99A 3V9SA 1YUWA 4AHTA 3SQ1A 1RT3A 3P5JA 1TYQA 1HPZA 3T1AA 4H0YB 2D5RA 1YJNN 3L2VA 3FLCO 5FRMA 1HQUA 2W6LA 1W9HA 4GVEA 1SKRA 4FOEA 3MDQA 3HVRA 1LWEA 3ID6A 5BN9A 2RE2A 5SZTA 2ASMA 1QS4A 2Q0RA 4KV8A 4B9VA 3CIPA 1VQKN 3OHRA 2DTUA 3R9PA 4YOYA 4ILHA 3QICA 3ZSZA 3NGYA 4KAZA 2P5OA 3VQ9A 4OPKA 4BC5A 2PZSA 1HKGA 2P5GA 5AQYA 5H1SQ 1N34K 4DSJA 1NGJA 2P9LA 3T1YK 4F4KA 2GELA 3AA4A 5F2RA 3L2WA 3JAMO 1RFQA 1RBRA 3THWB 5GAGP 3TSQA 5JVGL 4FZZA 4FWQA 1P8ZA 3D2EB 4CHOA 3AVHA 4J2AA 3PV8A 4YOWA 1P90A 1V4TA 5ADXA 1JL2A 4IFVA 3QEXA 3T19A 2NRWA 1TAUA 1Y64A 3H08A 3O9QA 4CEOA 4CJPA 4YNQA 1HR0K 3G10A 4B1XB 3TR8A 4M42A 4FL9A 1J53A 2UU9K 2JLEA 4XH1A 1VK0A 3BF3A 1WAJA 4IKFA 1WBDA 4RWTA 1GLEG 2HF3A 4E19A 1BGXT 3ZSRA 2G8HA 1VSFA 2RN2A 5AFUA 4W5OA 1YXQA 3LL3A 1ATNA 4CJ5A 3MN6A 4CZLA 3PLAA 1GLLO 3SBTA 4DUZK 4AF1A 3LPUA 3S41A 4B3TK 2W6KA 3OYBA 3HPGA 2PAVA 3TTDA 1JCGA 1KVBA 2KFNA 3DXMA 2YJEA 1SKWA 1RT7A 1N36K 3G0ZA 4V19S 1EWQA 3FZLA 4ILJA 5SWMA 1NGCA 5AR0A 3M8RA 2Z1GA 3IFRA 4CD1A 2YCHA 1BA0A 1VQ7N 3KLGA 4PA1A 3J81O 2QWMA 1E4FT 4YY3K 4J2DA 3P39A 1WUAA 3ISNC 4B9QA 3GDQA 2GV9A 4OPAA 1NGFA 4FWLA 3WNHA 3ZSOA 3VENA 4CEBA 5GAEP 4C8LA 4YOUA 1TL1A 2FC0A 3K5OA 5BPNA 3AVKA 5AQWA 2NZTA 4BQZA 1HKCA 3RMBA 2FSNA 5AQSA 5BPLA 1ZBIA 3OYDA 2D1KA 2YNFA 1SL1A 4BE1A 3P83D 4PUOA 1HQEA 4IG0A 4DTJA 4F8RA 1LV5A 4CECA 4M41A 3O3FA 4B9MA 1WSEA 3T69A 1T6CA 4PHTX 4K42A 4GW6A 3B6OA 1U4BA 4FJ7A 4PY5A 5KGWA 3CXCM 3LWLA 5AZIB 3WUHA 4JLHA 2X6NA 2YJFA 2DY4A 3KZBA 4WQ4A 4DTOA 2G8FA 1ZXOA 4KTWA 2ZQBA 3FZHA 3CPWM 2QWNA 1D5AA 3ZLJA 4FM1A 2UXDK 1HNIA 2WFBA 3TI0A 2A3ZA 4CCHA 4OGEA 4YHHK 3L2RA 4Y0WA 3ZSXA 3ZT1A 3A5LC 4ILGB 3S3OA 4GV6A 4JHDB 2OZSA 4DSIA 2X74A 1KLNA 1FJGK 1NJWA 3C6TA 1XNRK 1S1XA 3SBGA 1LWFA 3SK3A 4CJKA 1WNSA 4YDUA 4DS5A 1S72N 3VF6A 3D2EA 4GVMA 3O6WA 3K58A 4Y1CA 3DLKA 4DSEA 4JK9A 4E7KA 4DQ8A 5KPRA 4A5BA 4DTUA 5T7BA 5JS1A 1ATRA 1XWLA 4BVPA 2F8SA 3MEDA 4IOAL 1T6DA 2QI2A 5FPEA 3LDOA 3ZCMA 3UB5A 2HB5A 3RSEB 3THXA 4NCGA 2LSNA 1JLBA 1ZC6A 3SUNA 4Q0BA 5ELZA 3OW2M 4GKJK 4JKBA 3QNOA 1CLQA 3DM2A 4NYFA 3VEVA 1B92A 5M1OA 4B9LA 1TVRA 3CJCA 3ATVA 1TKZA 4OKJA 1U49A 3LWMA 5C42A 2EX3A 1U2VA 4RW9A 4CF1A 2HHQA 3E9OA 4JI1K 3R6MA 4FVUA 3I0RA 5I42A 3ZX3A 3AVAA 1XNQK 4JNEA 1T03A 1RDAA 4HTUA 3DXKA 4KTQA 4BE2A 2FSJA 2ZM6K 3TAPA 2DFHA 1L3SA 4TSXA 1VHXA 4CFAA 1S9GA 2YHAA 3A2FA 4CJ4A 3HPHA 3CFOA 1VSLA 4XH4A 1WSIA 4ZTJA 4DV7K 1NOYA 1BI4B 1GLFO 4KHQA 1EKEA 5MLCQ 3TABA 4FXDA 4FYDA 4FWPA 4BRAA 1DT9A 5AZJA 4FO0A 5KRSA 4JAXA 1WB9A 1Q86O 1G15A 4O5FA 3VA0A 3ENHA 3SQ0A 4E7IA 3CJAA 2NRZA 4NB4A 5J2PA 1JLQA 5HROA 1TAQA 4H5TA 1U45A 2O4GA 2F4VK 4RCHA 4ICLA 2D4WA 2WBNA 3PX4A 3V1RA 2JWLA 4O55A 4M3ZA 4CEQA 3TANA 2P9PA 3NH2A 4LFAK 3AVFA 1T05A 1FW6A 4BRPA 1WLJA 3ZYYX 4HUFA 1UWBA 2WOMA 3HOTA 3HK2A 2I7PA 1LWCA 3D0PA 1QTMA 2WC9A 1JLEA 4X62K 1IBMK 2P9SB 5J2QA 1X1PA 1XHXA 4BRHA 4ZTFA 2BE2A 1DEJA 1JXBA 3SZ2A 2YHWA 4CE9A 1VQ4N 1NKEA 4B8AB 3THYA 4CEAA 1A5VA 2Q97A 1VSDA 3U9DA 4BR2A 4QS9A 3CCMN 3S3NA 4O8UA 1S5JA 3EE9A 5HOOA 3HBTA 1KD1O 2P9KB 4LH5A 1RNHA 5LMNK 4J2BA 4DFJA 3ENBA 2XHBA 5FPMA 4FLYA 5IWAK 1IKWA 1S1TA 2BGGA 3RMDA 1WSGA 5F1XA 4IO9L 5LJWA 3PSFA 1NNEA 3EY1A 3PIOL 1SQKA 3QFPA 1RBTA 2G8KA 3GE1A 4CBWA 3VESA 3QBXA 3MN5A 3C7NB 2WONA 1RCHA 3DOLA 1E3MA 4E0DA 3AV9A 3VQ6A 4H5WA 4CESA 2CGJA 3F9MA 4B3SK 3VQCA 3NGIA 3VA3A 2O8EA 4PKIA 5DM7L 2OTLN 1RT1A 3TSUA 3QEPA 4DV4K 5FPDA 4B9SA 4YORA 3UIQA 4BRGA 4C23A 1EP4A 1RTJA 4FOIA 4M45A 3O80A 4JKGB 5FROA 4N56A 4OPJA 2Z1HA 3OYEA 1UOCA 4M3WA 3AO1A 4DTSA 5FRNA 4H0VB 1JKHA 3HSTB 2ZGZA 3ZSQA 4C1NK 4CBXA 2P9NA 4KKOA 4FK4A 3KLHA 4IXCA 1BI4A 1K8KA 4H03B 3QLHA 3SAFA 3V9XA 4FJLA 4O5BA 3AA2A 3FZMA 3K59A 3DLRA 1N6QA 2O8BA 2CH5A 2G8WA 3N4PA 3V81A 1NGEA 4K8ZA 4JI4K 3HOSA 3SCXA 5D3GA 1BCOA 4CJLA 3LALA 1W0HA 1NKCA 4ISGA 1TK0A 4KRFA 4B9NA 4EZ6A 3D7EO 5C0YA 2HBJA 2O8DB 1J5EK 3U9ZA 3AA3A 1HJRA 1RT5A 3TAMA 3V9UA 3LP3A 1GLAG 3P31A 3CI5A 3ULDA 3I8BA 5AQHA 4JI2K 3RR8A 2E2OA 4M3TA 4HUEA 4JI8K 3NDKA 1BUPA 2YNGA 3C6UA 4DFPA 2Y1IA 1EETA 4X66K 4Z94A 3H1VX 5KQ8A 4NLBA 3K5MA 4BR7A 3CJBA 3NVKA 1VQ5N 3SPYA 5FLXO 4CZEA 5C2FA 4BRNA 4CGGA 1IKVA 4NYNA 3DRRA 3UKRB 4BREA 3FZFA 3QEWA 2P9SA 1OH8A 4EP4A 3SYZA 2ETJA 2P51A 1MDUB 3WQTA 4R79A 4KH4A 3VQQA 4DV3K 2VWJA 3CMAN 4A2BA 4ELVA 3OYAA 3OS1A 3G71N 1NGDA 5F0XA 4ZHRA 2AJQA 4X65K 3PO5A 4CGJA 1BISA 3C94A 2GEMA 4WQ5C 4CJRA 1VSKA 1S6PA 3G25A 5B8HA 3O8MA 2KZZA 4LSNA 4CJVA 2B4JA 1ITGA 4FJNA 3KK2A 1U6ZA 2J4RA 1GLDG 4EIAA 1VSIA 1WAFA 3MX2A 1GLCG 5BREA 3KLIA 4E1NA 3HP9A 4IBNA 3LDLA 3VETA 3WEEB 4E89A 2QA4N 4CJ3A 1KFSA 4DFKA 2UXBK 3EZ5A 1NGAA 5AQLA 3CCSN 3CCQN 1IJJA 2VG7A 3H45C 1RGIA 4MLEA 4N76A 3K0SA 3D45A 4CJTA 3I33A 4DB3A 4AILC 3VF2A 1HMVA 1JLGA 5ADXH 1TUYA 1QQCA 3RVCA 1NGBA 2ASOA 2QXLA 1DTTA 4KI4A 5BPMA 3VQ4A 4IJAA 4A5AA 4IJNA 3CM6A 3NVMA 2F9TA 3SI6A 4N5SA 1XMQK 4F2SA 3OYFA 4B8CA 1KRPA 1EWRA 1RDUA 3O1BA 1KLMA 5AFUH 4CZFA 4PL7A 1U48A 3M5RA 4CIFA 1VQMN 3MK6A 3SNNA 1QQOA 4BRFA 4PQUA 5JMVA 3C65A 4FWNA 3T3FA 3J7YP 3L0QA 4OKEA 1OH7A 1KAYA 1EXQA 3NAEA 4GY2B 4E7HA 2IVPA 3ATUA 1MA9B 5CHIA 4B9UA 4CZGA 2O8FB 3LZJA 5E41A 1ASUA 4O44A 3CM5A 3O4QA 1YVUA 2GUIA 3AAPA 2AA4A 3G4SN 3WXJA 5C25A 1VQLN 3DI6A 2NLXA 3B8AX 4FJXA 3OVNA 3JSMA 2QWLA 3MEEA 4U7BA 3L6QA 3LP1A 3MCAB 5FDLA 4DU1A 4KHNA 2NRRA 3VMFB 4M3XA 3ZT3A 1N8RO 5M1QA 2AP1A 4XIUA 3UE5A 3GG4A 5EY4A 3NF7A 1XMOK 5M1PA 4KHWA 3O9UA 4MFBA 4I9LA 3OYCA 2E2PA 4YOXA 1JLCA 4B1YB 4JEPA 3V4IA 4KREA 3K5LA 3S3MA 3CQXA 3LPTA 1L5UA 3B6PA 1IG9A 2FF3B 3A5MC 5I3UA 3KHYA 2BUPA 2O8CB 3QIOA 4CI6A 5AQTA 4NXNK 1NJZA 3BEXA 3AO2A 3O1WA 3NMUA 2HBLA 3L8BA 4JI3K 1RDDA 1S1WA 1RT6A 3RRGA 3CJ1A 4JD2B 3DLGA 4FK2A 4I9QA 4JKCA 4DS4A 3ZX2A 1D9FA 1QQMA 1QZ5A 3ULEB 3V9ZA 1CXUA 3TARA 1UAXA 1IO2A 2P9IB 5J1EA 3A8YA 1UA1A 3M8QA 4FJJA 3QNNA 2YHYA 3HSCA 2UUBK 2IS3A 4JKEA 3UKUA 2E88A 3DLLL 1O13A 1NK6A 1DGKN 3M1FA 3NF9A 1I39A 3P1GA 4BE0A 4DR1K 1KQSM 3O4WA 5GIOA 3RR7A 1NK5A 4FJKA 3IG1A 4H0XB 1YTUA 4Z4HA 2FSKA 4AHVA 2R7YA 4CFBA 3V9WA 2HHHK 2NRVA 4UY8O 5K14A 1HRHA 5AQXA 3CJ9A 3TAGA 1REVA 4Y1DA 4BROA 2E4LA 3DWLA 1E4GT 4A59A 2QWOA 4CF9A 1TKDA 2UUAK 3RWUA 1IV0A 3P4IA 1BO5O 2ZD1A 4JRPA 4DSKA 4KH6A 1NJYA 3R1XA 5GINA 1N5YA 3SMSA 4ISEA 4WQ4C 2VWKA 5AJ3K 3D6RA 3O3HA 3CJ7A 3EYZA 4IZ9A 3VGMA 2ZJQL 3NF8A 2NUBA 4RW7A 3HM9A 3LM2A 2Q3SA 3VF4A 3AVIA 3O08A 4DV5K 2GX9A 4G9ZA 3AGKA 3TU5A 4CEEA 4EAHD 1NK4A 5BR8K 1NM1A 3LDQA 1X3MA 3OJSA 3AVBA 1Q9XA 4I6MB 3THWA 4IFEA 4C8MA 2KW4A 2BANA 2FBTA 3Q7BA 3WXMB 3QESA 1YT3A 4E1MA 4FLZA 4LF9K 1ZYQA 5KQDA 3VEYA 4IFYA 3W3DA 4YDUC 1TV6A 3CPEA 4BC4A 3CC4N 4KFBA 4CGFA 1KAZA 1L3VA 2XY7A 4WCEL 2FLOA 2ATQA 4H8KA 3AO3A 2O8FA 2PYLA 1VQNN 3M6GA 2X78A 1SKSA 1KCFA 4CIEA 1NMNA 1OH5A 4EHTA 3OYJA 4FJIA 1QVGM 2YI1A 1S1VA 4MQ3A 3C95A 1S1UA 3K9KA 3KK3A 3GBTA 4AHSA 4IOCL 3TAEA 4JKAA 4BC3A 4WE1A 1NK7A 1YVNA 1MU2A 3AVGA 4U67L 1HNVA 5IT9O 2E20A 5DMRA 2HHSA 2DFEA 2RPIA 3V1OA 1FKPA 1YIJN 5J2MA 3AO4A 5KGXA 1J6ZA 1B9FA 1JCFA 4QS8A 4B1WB 3IDHA 3KJVA 2PBDA 1WBBA 4MDAA 4KHSA 1HPMA 1YTAA 3OYMA 3DLHA 4LF5K 2FBVA 3OBYA 3VTIA 1BHLA 2ZJPL 1QSYA 3LANA 3ITHA 3I8DA 1VQ8N 2EWSA 3DJCA 4CZKA 4FJ9A 1A5WA 2V7YA 4BRDA 4FWSA 3TTCA 5AQFA 4JI6K 4LFBK 2CGKA 4CW7B 5KRTA 4CJSA 2VGNA 3T7ZA 2KLAA 4C8NA 4CHZA 3LDSA 3HI0A 3BGRA 3MCPA 1VSEA 4B1UB 3ZETB 1K73O 2GUPA 2IOCA 2GBZA 3C6HA 4HWIA 4ELTA 5AQKA 1LAVA 3EKSA 1YHQN 2RHKA 5EVZA 3OJUA 3NH1A 3E9PA 1GOBA 4LC9B 5LL6Z 3CCLN 1BQMA 1GOCA 3D2FB 3LM9A 3I56N 1NKBA 4DV0K 2IAJA 3MN7A 2ZGYA 1S9EA 1XI1A 3R8EA 5AZIA 3RMCA 1HYVA 2NRHA 4X64K 3J8AA 3E1YA 3SJHA 2XO7A 4AHCA 2HNYA 3T1HK 4KHYA 1NJXA 4B3OA 4JI0K 1YITN 3H3OB 5AQMA 2HMPA 4FK0A 1RBVA 4JRQA 3K2PA 3QFUA 1TUUA 5JS2A 1T8EA 2OPRA 5BN8A 4A2AA 3NGZA 1JLFA 3HT3A 5FPNA 3NH0A 3H1QA 4M63C 4OLBA 2KKZA 3WT0A 3DAWA 4CFDA 4NLCA 1JXEA 4CJEA 4JHDA 2YNHA 3H3NO 3CC7N 1SS6A 4BACA 2OA8A 2VYPA 1B9DA 1Q8IA 2NRXA 3O3GA 4I6MA 2YNIA 3FR0A 4FWKA 3VQ7A 2RF2A 1M90O 3HTVA 2A1RA 2OCEA 4MLHA 1LW0A 3LAKA 3WNGA 4DQSA 4A61A 1F21A 4JK8A 3KIOA 1TYQB 1I3AA 5EXWA 2KFZA 2UXCK 1W2BM 4HCBA 4LF8K 4Z4CA 1K6YA 1TK5A 4FM0A 2HNDA 1RILA 3CC2N 2ITMA 1WOQA 3U6FA 5AQOA 4M3YA 1ZBSA 1VRUA 3PIPL 3OY9A 1T44A 1BL3A 3RSEA 1RDBA 2ZWHA 5BRFA 2Q0UA 2V7ZA 3SV4A 2YV0X 5TKYA 4MO5A 4CHQA 3AARA 4W5RA 1HYSA 3Q7CA 1SL0A 3VEXA 2QKKA 3O5BA 3SMPA 4NO7A 4Q5VA 3I0SA 4FJ5A 3BY5A 3O9RA 5JICA 3SUOA 4K41A 2P9LB 3J80O 2D0BA 3AGRA 3CETA 3H6EA 2D0OA 2E2QA 4OKKA 3OYIA 5LMUK 3IRXA 2OZMA 3E01A 3HPOA 1D8YA 1KTQA 4DTPA 2NNWA 2QWPA 4GNIA 1L3UA 1NU0A 2QWRA 4JKHA 5HP1A 2OANA 5HRRA 2HNZA 4E3SA 3OYKA 3KVGA 3ZSWA 1ILYA 1LAWA 1QE1A 2G8VA 1N32K 4ID5A 1DTQA 2CH6A 4JS4A 2IVNA 2HHUA 4M7XA 3ZSVA 3WXLA 3JS6A 1X9JA 2X6SA 1T7PA 2CGLA 1R0AA 3FFIA 3VQPA 3VN5A 4FPBA 3SUQA 4B08A 1RDWX 2OPQA 3ZETA 4AM7A 3OYHA 2YKMA 3WQUA 1VQPN 4LFCK 2HSTA 3QO9A 4CGDA 3F5TA 2P9UB 4PWDA 5C10A 1YJ9N 4FJHA 3U8XA 2YKNA 3DXMB 4OJRA 3ZT0A 1EX4A 3LAMA 3MN9A 4Z4FA 4C1NI 5M1FA 1KVAA 1WN7A 4H0OA 4B1ZA 3MWTA 4CBUA 4UQGA 2B5JA 5I9EB 1BCMA 1QZ6A 3VPZA 3O4NA 2QWQA 3ZX0A 4LF4K 3HL8A 4F9OA 3OS0A 3AO5A 3ZT4A 3KTQA 2UUCK 3SQ4A 5AQZA 3JYTA 1QHTA 1K8AO 3AVJA 2KZMA 3LP0A 3M8SA 4HVJA 4BDYA 3U3YA 4DR4K 5GADP 4DV1K 1QSSA 3CFPA 3SQ2A 1O1WA 2FBXA 4OGCA 2P9KA 1ESVA 4JKDA 3SPZA 3V6DA 5EOYA 4J8FA 4M3RA 3PY8A 1YJWN 1IH7A 1JL1A 2FXUA 4DTMA 4OPHA 4DTXA 4AHRA 4JYAK 3VEOA 3E66A 5HRPA 2A40A 1NGGA 3FFKB 4K43A 3AVMA 4RW6A 4ISFA 5JVHL 1NGHA 5DK5A 2XRIA 3KK1A 4FSVA 2W40A 3BZCA 3VTHA 1FK9A 4DQQA 5BRHA 3A5NC 4CVNE 3QDKA 2VG6A 4ID1A 3C7NA 4IEIA 2VQFK 1VQON 5AQIA 1VSJA 2ASPA 3BF1A 2I5JA 4FWRA 1NOZA 3VQ8A 3SJJA 1Z6RA 1BDGA 3FE1A 3TAQA 2ZJRL 4DV6K 4PKHA 5M1NA 1IBLK 3AAQA 1TKTA 3CCUN 2IGIA 2G8IA 4CJQA 5JLFA 3QB0A 1HKBA 1C6VA 2WTUA 3VQBA 2GWKA 2VG5A 3AY9A 3OYNA 1KAXA 3KK7A 1JLAA 2F9WA 4DLGA 4I2PA 2RKIA 4CGHA 4DQRA 2H3GX 4E1JA 4JKGA 3M8PA 1Q82O 4DSLA 5M1KA 2HOEA 2W42A 5AQQA 2I7NA 3GOIA 4CJWA 1ATSA 4CFCA 2XY5A 5BR9A
chains in the Genus database with same CATH topology
1Z25A 2VWKA 4RG8A 4RW8A 3NH2A 3O3HA 1RTIA 4DFMA 4C8KA 3AVFA 5EU7A 1T05A 3EYZA 3MAQA 1D9DA 4W5QA 3DLBA 3WNFA 4DWIA 4FJMA 3LP2A 3MXJA 1WLJA 3NF8A 4HUFA 2HW3A 1UWBA 2WOMA 4DU4A 1IKXA 3ALYA 3V1QA 3HK2A 4AH9A 2NUBA 4RW7A 3L2QA 1HYZA 3HM9A 2OYQA 1VSHA 2Q3SA 1X9SA 4CJFA 1LWCA 3AVIA 3D0PA 4LH4A 2P1JA 3NBPA 3DRPA 4CEEA 1QTMA 4FZYA 2HMIA 2XY6A 3IS9A 1NK4A 4NCAA 1CXQA 1JLEA 3OJSA 4FLVA 4W5NA 3AVBA 5HRNA 5J2QA 3WNEA 1Y97A 1Q9XA 4CHPA 5HLFA 1X1PA 4C8MA 4KO0A 1XHXA 2KW4A 2BANA 3PX6A 1X9WA 2FBTA 3NF6A 4ZTFA 2BE2A 3L3UA 2QK9A 1JXBA 2B6AA 3SZ2A 3QESA 3MECA 4LD0A 1YT3A 4E1MA 4YFUA 4FLZA 5J2NA 4CE9A 4I2QA 4CERA 1ZYQA 2BDPA 2QKBA 1NKEA 3RRHA 4IFYA 4B8AB 4FCYA 1ZBLA 4CEAA 3OYGA 1TV6A 4QAGA 1A5VA 4FLUA 1VSDA 2PYJA 4CK1A 5CYMA 4KFBA 4CGFA 1TGOA 3LZIA 1TK8A 1L3VA 3S3NA 2HHVA 1S5JA 3KKRA 1RTDA 2XY7A 3HXMA 1C0TA 1UA0A 4H8KA 2ATQA 4FW1A 3AO3A 4B9TA 1C1CA 1FXXA 1RDCA 4LH5A 4O0JA 2PYLA 1RNHA 2HHXA 4J2BA 2QXFA 3DOKA 2X78A 4DLEA 2XHBA 4DFJA 1SKSA 1KCFA 3HP6A 4FLYA 4CIEA 1GOAA 4CF8A 4FM2A 2Y1JA 3OYJA 1IKWA 1X9MA 4FJIA 1S1TA 4HUGA 2BGGA 1NK9A 4GMJB 4FLXA 3CG7A 1ASVA 3RMDA 1S1VA 4MQ3A 1WSGA 3C95A 1S1UA 3PUFA 3F9KA 4ELUA 4EP5A 3KK3A 4AHSA 2EHGA 3EY1A 3TAEA 4R5PA 4WE1A 1RBTA 3CFRA 1NK7A 2G8KA 3VQDA 4KI6A 1MU2A 4J2EA 3AVNA 3IAYA 3AVGA 3BDPA 1HNVA 3RTVA 2HVIA 5DMRA 2WONA 4KTZA 1RCHA 3DOLA 4CEDA 2DFEA 4E0DA 2HHSA 5HBMA 2RPIA 3V1OA 1FKPA 3V9SA 4AHTA 3SQ1A 3AV9A 5J2MA 1RT3A 3AO4A 3P5JA 1B9FA 3VQ6A 4CESA 5KGXA 3KJVA 4KHSA 3VQCA 3NGIA 3VA3A 3AA5X 1HPZA 3T1AA 3SV3A 1YTAA 2D5RA 2FBYA 3OYMA 4DF8A 3L2VA 3DLHA 4Z4IA 3QEVA 2F96A 3THVA 4EZ9A 1RT1A 1TKXA 2FBVA 1HQUA 5FRMA 1W9HA 3QEPA 1U47A 3QETA 3MXMA 1BHLA 1SKRA 4B9SA 1QSYA 4KPYA 3LANA 3ITHA 3I8DA 3UIQA 3HVRA 1ZBHA 1A5XA 1LWEA 4FJ8A 1EP4A 1RTJA 5SZTA 4M45A 5FROA 4FJ9A 4N56A 4IG3A 1A5WA 4OPJA 2Z1HA 1QS4A 4KV8A 4B9VA 3OYEA 3VQEA 1UOCA 4M3WA 2DTUA 3AO1A 4DTSA 5FRNA 1U04A 1JKHA 5KRTA 3HSTB 3ZSZA 4CJSA 3NGYA 3TWHA 4C8NA 4KAZA 1ASWA 4CHZA 3LDSA 3ZSQA 3BGRA 4O0IA 2P5OA 1VSEA 3VQ9A 4DF4A 4KKOA 1BIZA 4OPKA 4FK4A 3L3VA 3KLHA 2A1SA 1BI4A 2PY5A 2PZSA 2P5GA 3K5NA 2IOCA 1WSJA 2GBZA 3QLHA 3HYFA 3V9XA 3ZSYA 4ELTA 1LAVA 4DSJA 3DRSA 4FJLA 4O5BA 1C0MA 3AA2A 3OJUA 4IDKA 1ZBFA 4F4KA 3NH1A 5CZ2A 3AA4A 4QOZB 1XHZA 3DLEA 1GOBA 4G1QA 3K59A 3L2WA 3DLRA 1N6QA 1RBRA 1BQMA 1GOCA 2G8WA 4N41A 2HVHA 1NKBA 4FZZA 2IAJA 3V81A 4KB1A 4K8ZA 3SCXA 1NK8A 5D3GA 4CHOA 1BCOA 3AVHA 4J2AA 4CK3A 1CZBA 4CJLA 3PV8A 1VSMA 1S9EA 3LALA 1XI1A 1W0HA 1JL2A 4IFVA 3QEXA 3T19A 1NKCA 1TAUA 3H08A 1TK0A 4CEOA 4KRFA 4B9NA 4EZ6A 3RMCA 4CJPA 1HYVA 1TL3A 2XO7A 4OLAA 3KD5E 4AHCA 4YNQA 3G10A 2HNYA 3TR8A 4M42A 1KFDA 4FVMA 4KHYA 3AA3A 1HJRA 1RT5A 1J53A 3TAMA 3V9UA 2JLEA 3LP3A 1NJXA 4B3OA 1VK0A 3ULDA 3SUPA 4K8XA 1WAJA 2XY8A 4IKFA 4FK0A 3RR8A 1RBVA 4JRQA 4HUEA 4M3TA 3K2PA 1BIUA 4E19A 1BGXT 3QERA 3NDKA 5JS2A 3ZSRA 2YNGA 1VSFA 2E6MA 1T8EA 2OPRA 2G8HA 2RN2A 4O4GA 2G8UA 3C6UA 4F2RA 3NGZA 1JLFA 4W5OA 3HT3A 4DFPA 2Y1IA 1EETA 3NH0A 4BDZA 4LSLA 4FLWA 3TAFA 4CJ5A 4OLBA 3K5MA 4CHNA 2HHTA 4CFDA 4Z0UA 1J9AA 2KTQA 4HHTA 1JXEA 3DMJA 3SPYA 1KVCA 4CJEA 3PX0A 4H4MA 2YNHA 4CGGA 4BACA 1IKVA 3LPUA 5HRSA 2OA8A 3AVLA 3OYBA 1RTHA 3HPGA 1B9DA 1Q8IA 4NYNA 4CF0A 3DRRA 3QINA 3QEWA 1KVBA 4DQIA 3O3GA 2KFNA 2YNIA 4EP4A 3SYZA 2ETJA 2RF2A 2P51A 3VQ7A 4QCLA 2A1RA 1SKWA 1RT4A 1RT7A 1QSLA 3MXIA 3VQQA 1LW0A 3G0ZA 3LAKA 3WNGA 4DQSA 2VWJA 1F21A 4ELVA 3KIOA 3OYAA 3K57A 3OS1A 1I3AA 4CJUA 5SWMA 2KFZA 1FKOA 3M8RA 4HCBA 2Z1GA 4ZHRA 2AJQA 3PO5A 4CGJA 1BISA 3C94A 1CZ9A 3KLGA 4PA1A 4Z4CA 4FJGA 1K6YA 4CJRA 1VSKA 1S6PA 4FM0A 1TK5A 2HNDA 1RILA 3U6FA 4M3YA 2KZZA 4LSNA 1VRUA 4CJVA 3OY9A 2B4JA 4DQPA 1ITGA 4FJNA 3KK2A 4J2DA 1BL3A 4NCBA 1VSIA 3F73A 3ISNC 1WAFA 2DFFA 2YHBA 1RDBA 2IC3A 4DSFA 2GV9A 3KLIA 3NHGA 4E1NA 3HP9A 4W5TA 3WNHA 3ZSOA 4IBNA 2YV0X 4CEBA 3SV4A 4C8LA 4HCCA 1TL1A 2FC0A 4E89A 3K5OA 4CJ3A 4CHQA 3VQ5A 1KFSA 4W5RA 1HYSA 3AVKA 4DFKA 2JGUA 3EZ5A 4E7JA 1SL0A 3RMBA 2QKKA 1ZBIA 2VG7A 3OYDA 4Q5VA 2YNFA 3I0SA 4N76A 3D45A 4CJTA 1SL1A 4FJ5A 4AILC 4N47A 3SUOA 1HMVA 1JLGA 4BE1A 3P83D 2D0BA 4PUOA 1HQEA 4OKKA 1QQCA 4IG0A 3OYIA 4DTJA 4F8RA 4FZXC 3RMAA 1LV5A 4CECA 3IRXA 4M41A 3E01A 3O3FA 3HPOA 4FLTA 4B9MA 2OZMA 1C1AA 1WSEA 1D8YA 2Z1JA 1KTQA 4DTPA 1DTTA 4KI4A 1L3UA 3VQ4A 3PO4A 4FW2A 3B6OA 4GW6A 5HP1A 1U4BA 4FJ7A 3CM6A 5HRRA 4PY5A 2O4IA 2D0CA 2HNZA 5KGWA 1WSHA 4N5SA 3SI6A 3LWLA 4F2SA 4E3SA 3OYFA 4B8CA 1KRPA 4JLHA 3OYKA 3ZSWA 1KLMA 1LAWA 2X6NA 1QE1A 1U48A 2G8VA 4ID5A 4CIFA 1DTQA 4CK2A 4DMNA 2DY4A 4DTOA 4JS4A 3SNNA 3DYAA 2G8FA 3AVCA 4KTWA 4KHUA 2HHUA 2ZQBA 4C8OA 3ZSVA 4PQUA 3VQAA 4M3UA 3T3FA 3MEGA 4DG1A 4E7LA 1D5AA 2X6SA 4OKEA 4FM1A 1T7PA 1R0AA 1HNIA 3FFIA 2ZE2A 3VQPA 3VN5A 1EXQA 3TI0A 1S6QA 3NAEA 3QEIA 2ITGA 4E7HA 4F3OA 4CCHA 4OGEA 3SUQA 4B9UA 5C24A 4BWJA 4JS5A 4BDPA 3L2RA 3HVTA 4B08A 3LZJA 5E41A 3ZSXA 1ASUA 2OPQA 4O44A 3CM5A 3OYHA 3ZT1A 2YKMA 3O4QA 3HO1A 3S3OA 1YVUA 2OZSA 4DSIA 2GUIA 3QO9A 2X74A 1KLNA 3KD1E 4CGDA 5CY4A 1Z26A 1NJWA 3C6TA 5C25A 4PWDA 3DI6A 3KLFA 2HHWA 4FJHA 2OPPA 1S1XA 4FJXA 1SL2A 1LWFA 2Z1IA 3OVNA 4CJKA 2YKNA 3JSMA 3MEEA 1RBUA 4OJRA 3LP1A 3ZT0A 1EX4A 3LAMA 1WNSA 4Z4FA 5FDLA 4DU1A 4DS5A 4KHNA 2IDOA 4M3XA 3ZT3A 4GVMA 1KVAA 1IKYA 1WN7A 4Y1CA 4UQGA 3K58A 4Z4EA 3CYMA 2KQ2A 3DLKA 4XIUA 4DSEA 2B5JA 3HJFA 4CHYA 4E7KA 1BCMA 1J54A 3O4NA 1BQNA 3NE6A 3NF7A 2OPSA 4CEFA 4KHWA 4DTUA 4MFBA 3HL8A 4I9LA 5T7BA 1XWLA 3OS0A 5JS1A 3AO5A 3ZT4A 3OYCA 3KTQA 2F8SA 1J5OA 3MEDA 4AHUA 1JLCA 3KLEA 4F3TA 3V4IA 3SQ4A 4KREA 4LY7A 3JYTA 4DTNA 1QHTA 4L8RB 3K5LA 3ZCMA 3AVJA 1ZBUA 2KZMA 1C0UA 3LP0A 3S3MA 3M8SA 1SV5A 2HB5A 3LPTA 4HVJA 3B6PA 4BDYA 1L5UA 1IG9A 4Z4GA 4NCGA 3U3YA 2LSNA 1JLBA 4Q0BA 3SUNA 5I3UA 1QSSA 3QNOA 1CLQA 3QIOA 3CFPA 3DM2A 4NYFA 3SQ2A 1B92A 4B9LA 1NJZA 1O1WA 1TVRA 2FBXA 3AO2A 4OKJA 1TKZA 4OGCA 4DU3A 3L8BA 1U49A 1RDDA 1S1WA 1VRTA 1RT6A 3LWMA 5C42A 3SPZA 2EX3A 3RRGA 3DLGA 4FK2A 3U3GA 4I7FA 3V6DA 4RW9A 4CF1A 2HHQA 4I9QA 4M3RA 4DS4A 1NK0A 3PY8A 1IH7A 1JL1A 1D9FA 3V9ZA 3I0RA 5I42A 4DTMA 1CXUA 3AVAA 3L2UA 4DTXA 4AHRA 3TARA 1T03A 1RDAA 1IO2A 1UAXA 4HTUA 4DTRA 3S9HA 1C1BA 3ZT2A 4BE2A 4KTQA 5HRPA 5J1EA 3OYLA 3TAPA 2DFHA 1L3SA 4TSXA 4CFAA 3OS2A 1S9GA 2YHAA 3A2FA 4CJ4A 3HPHA 3M8QA 1UA1A 4FJJA 2D0AA 1VSLA 3ASMA 3CFOA 3QNNA 1WSIA 3AVMA 4ZTJA 4RW6A 1BI4B 1NOYA 4KHQA 5KTQA 1WSFA 1EKEA 2IS3A 5DK5A 2XRIA 3KK1A 3TABA 4FXDA 1FK9A 4FYDA 3QIPA 1NK6A 4DQQA 5CYQA 3NF9A 1Q9YA 1I39A 4CIGA 3P1GA 1SUQA 4BE0A 1RT2A 5KI6A 2VG6A 4ID1A 3RR7A 3KKSA 1VSJA 2I5JA 1NK5A 5KRSA 1NOZA 3VQ8A 4FJKA 3IG1A 1XC9A 1YTUA 3SJJA 2F8TA 2E6LA 1G15A 4Z4HA 3TAQA 3VA0A 4AHVA 2R7YA 3SQ0A 4CFBA 3V9WA 5CZ1A 4E7IA 1TKTA 4KB0A 1RBSA 2IGIA 5K14A 4CJQA 1KSPA 2G8IA 1HRHA 1C6VA 3VQBA 1LW2A 2VG5A 3OYNA 5J2PA 1JLQA 1REVA 4RW4A 3TAGA 5HROA 1TAQA 4Y1DA 1JLAA 2E4LA 4DLGA 1U45A 4I2PA 1TKDA 4CF9A 2O4GA 3NCIA 3NFAA 4CEZA 3RWUA 2RKIA 4CGHA 4ICLA 1L3TA 4H4OA 1DLOA 2ZD1A 4DQRA 4JRPA 4DSLA 3M8PA 3CQ8A 3PX4A 3V1RA 4DSKA 4CF2A 2W42A 1NJYA 4BWMA 4O55A 4OVLA 4CJWA 4M3ZA 4CFCA 1N5YA 4CEQA 2XY5A 3TANA 4CGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z25 A;  2VWK A;  4RG8 A;  4RW8 A;  3NH2 A;  3O3H A;  1RTI A;  4DFM A;  4C8K A;  3AVF A;  5EU7 A;  1T05 A;  3EYZ A;  3MAQ A;  1D9D A;  4W5Q A;  3DLB A;  3WNF A;  4DWI A;  4FJM A;  3LP2 A;  3MXJ A;  1WLJ A;  3NF8 A;  4HUF A;  2HW3 A;  1UWB A;  2WOM A;  4DU4 A;  1IKX A;  3ALY A;  3V1Q A;  3HK2 A;  4AH9 A;  2NUB A;  4RW7 A;  3L2Q A;  1HYZ A;  3HM9 A;  2OYQ A;  1VSH A;  2Q3S A;  1X9S A;  4CJF A;  1LWC A;  3AVI A;  3D0P A;  4LH4 A;  2P1J A;  3NBP A;  3DRP A;  4CEE A;  1QTM A;  4FZY A;  2HMI A;  2XY6 A;  3IS9 A;  1NK4 A;  4NCA A;  1CXQ A;  1JLE A;  3OJS A;  4FLV A;  4W5N A;  3AVB A;  5HRN A;  5J2Q A;  3WNE A;  1Y97 A;  1Q9X A;  4CHP A;  5HLF A;  1X1P A;  4C8M A;  4KO0 A;  1XHX A;  2KW4 A;  2BAN A;  3PX6 A;  1X9W A;  2FBT A;  3NF6 A;  4ZTF A;  2BE2 A;  3L3U A;  2QK9 A;  1JXB A;  2B6A A;  3SZ2 A;  3QES A;  3MEC A;  4LD0 A;  1YT3 A;  4E1M A;  4YFU A;  4FLZ A;  5J2N A;  4CE9 A;  4I2Q A;  4CER A;  1ZYQ A;  2BDP A;  2QKB A;  1NKE A;  3RRH A;  4IFY A;  4B8A B;  4FCY A;  1ZBL A;  4CEA A;  3OYG A;  1TV6 A;  4QAG A;  1A5V A;  4FLU A;  1VSD A;  2PYJ A;  4CK1 A;  5CYM A;  4KFB A;  4CGF A;  1TGO A;  3LZI A;  1TK8 A;  1L3V A;  3S3N A;  2HHV A;  1S5J A;  3KKR A;  1RTD A;  2XY7 A;  3HXM A;  1C0T A;  1UA0 A;  4H8K A;  2ATQ A;  4FW1 A;  3AO3 A;  4B9T A;  1C1C A;  1FXX A;  1RDC A;  4LH5 A;  4O0J A;  2PYL A;  1RNH A;  2HHX A;  4J2B A;  2QXF A;  3DOK A;  2X78 A;  4DLE A;  2XHB A;  4DFJ A;  1SKS A;  1KCF A;  3HP6 A;  4FLY A;  4CIE A;  1GOA A;  4CF8 A;  4FM2 A;  2Y1J A;  3OYJ A;  1IKW A;  1X9M A;  4FJI A;  1S1T A;  4HUG A;  2BGG A;  1NK9 A;  4GMJ B;  4FLX A;  3CG7 A;  1ASV A;  3RMD A;  1S1V A;  4MQ3 A;  1WSG A;  3C95 A;  1S1U A;  3PUF A;  3F9K A;  4ELU A;  4EP5 A;  3KK3 A;  4AHS A;  2EHG A;  3EY1 A;  3TAE A;  4R5P A;  4WE1 A;  1RBT A;  3CFR A;  1NK7 A;  2G8K A;  3VQD A;  4KI6 A;  1MU2 A;  4J2E A;  3AVN A;  3IAY A;  3AVG A;  3BDP A;  1HNV A;  3RTV A;  2HVI A;  5DMR A;  2WON A;  4KTZ A;  1RCH A;  3DOL A;  4CED A;  2DFE A;  4E0D A;  2HHS A;  5HBM A;  2RPI A;  3V1O A;  1FKP A;  3V9S A;  4AHT A;  3SQ1 A;  3AV9 A;  5J2M A;  1RT3 A;  3AO4 A;  3P5J A;  1B9F A;  3VQ6 A;  4CES A;  5KGX A;  3KJV A;  4KHS A;  3VQC A;  3NGI A;  3VA3 A;  3AA5 X;  1HPZ A;  3T1A A;  3SV3 A;  1YTA A;  2D5R A;  2FBY A;  3OYM A;  4DF8 A;  3L2V A;  3DLH A;  4Z4I A;  3QEV A;  2F96 A;  3THV A;  4EZ9 A;  1RT1 A;  1TKX A;  2FBV A;  1HQU A;  5FRM A;  1W9H A;  3QEP A;  1U47 A;  3QET A;  3MXM A;  1BHL A;  1SKR A;  4B9S A;  1QSY A;  4KPY A;  3LAN A;  3ITH A;  3I8D A;  3UIQ A;  3HVR A;  1ZBH A;  1A5X A;  1LWE A;  4FJ8 A;  1EP4 A;  1RTJ A;  5SZT A;  4M45 A;  5FRO A;  4FJ9 A;  4N56 A;  4IG3 A;  1A5W A;  4OPJ A;  2Z1H A;  1QS4 A;  4KV8 A;  4B9V A;  3OYE A;  3VQE A;  1UOC A;  4M3W A;  2DTU A;  3AO1 A;  4DTS A;  5FRN A;  1U04 A;  1JKH A;  5KRT A;  3HST B;  3ZSZ A;  4CJS A;  3NGY A;  3TWH A;  4C8N A;  4KAZ A;  1ASW A;  4CHZ A;  3LDS A;  3ZSQ A;  3BGR A;  4O0I A;  2P5O A;  1VSE A;  3VQ9 A;  4DF4 A;  4KKO A;  1BIZ A;  4OPK A;  4FK4 A;  3L3V A;  3KLH A;  2A1S A;  1BI4 A;  2PY5 A;  2PZS A;  2P5G A;  3K5N A;  2IOC A;  1WSJ A;  2GBZ A;  3QLH A;  3HYF A;  3V9X A;  3ZSY A;  4ELT A;  1LAV A;  4DSJ A;  3DRS A;  4FJL A;  4O5B A;  1C0M A;  3AA2 A;  3OJU A;  4IDK A;  1ZBF A;  4F4K A;  3NH1 A;  5CZ2 A;  3AA4 A;  4QOZ B;  1XHZ A;  3DLE A;  1GOB A;  4G1Q A;  3K59 A;  3L2W A;  3DLR A;  1N6Q A;  1RBR A;  1BQM A;  1GOC A;  2G8W A;  4N41 A;  2HVH A;  1NKB A;  4FZZ A;  2IAJ A;  3V81 A;  4KB1 A;  4K8Z A;  3SCX A;  1NK8 A;  5D3G A;  4CHO A;  1BCO A;  3AVH A;  4J2A A;  4CK3 A;  1CZB A;  4CJL A;  3PV8 A;  1VSM A;  1S9E A;  3LAL A;  1XI1 A;  1W0H A;  1JL2 A;  4IFV A;  3QEX A;  3T19 A;  1NKC A;  1TAU A;  3H08 A;  1TK0 A;  4CEO A;  4KRF A;  4B9N A;  4EZ6 A;  3RMC A;  4CJP A;  1HYV A;  1TL3 A;  2XO7 A;  4OLA A;  3KD5 E;  4AHC A;  4YNQ A;  3G10 A;  2HNY A;  3TR8 A;  4M42 A;  1KFD A;  4FVM A;  4KHY A;  3AA3 A;  1HJR A;  1RT5 A;  1J53 A;  3TAM A;  3V9U A;  2JLE A;  3LP3 A;  1NJX A;  4B3O A;  1VK0 A;  3ULD A;  3SUP A;  4K8X A;  1WAJ A;  2XY8 A;  4IKF A;  4FK0 A;  3RR8 A;  1RBV A;  4JRQ A;  4HUE A;  4M3T A;  3K2P A;  1BIU A;  4E19 A;  1BGX T;  3QER A;  3NDK A;  5JS2 A;  3ZSR A;  2YNG A;  1VSF A;  2E6M A;  1T8E A;  2OPR A;  2G8H A;  2RN2 A;  4O4G A;  2G8U A;  3C6U A;  4F2R A;  3NGZ A;  1JLF A;  4W5O A;  3HT3 A;  4DFP A;  2Y1I A;  1EET A;  3NH0 A;  4BDZ A;  4LSL A;  4FLW A;  3TAF A;  4CJ5 A;  4OLB A;  3K5M A;  4CHN A;  2HHT A;  4CFD A;  4Z0U A;  1J9A A;  2KTQ A;  4HHT A;  1JXE A;  3DMJ A;  3SPY A;  1KVC A;  4CJE A;  3PX0 A;  4H4M A;  2YNH A;  4CGG A;  4BAC A;  1IKV A;  3LPU A;  5HRS A;  2OA8 A;  3AVL A;  3OYB A;  1RTH A;  3HPG A;  1B9D A;  1Q8I A;  4NYN A;  4CF0 A;  3DRR A;  3QIN A;  3QEW A;  1KVB A;  4DQI A;  3O3G A;  2KFN A;  2YNI A;  4EP4 A;  3SYZ A;  2ETJ A;  2RF2 A;  2P51 A;  3VQ7 A;  4QCL A;  2A1R A;  1SKW A;  1RT4 A;  1RT7 A;  1QSL A;  3MXI A;  3VQQ A;  1LW0 A;  3G0Z A;  3LAK A;  3WNG A;  4DQS A;  2VWJ A;  1F21 A;  4ELV A;  3KIO A;  3OYA A;  3K57 A;  3OS1 A;  1I3A A;  4CJU A;  5SWM A;  2KFZ A;  1FKO A;  3M8R A;  4HCB A;  2Z1G A;  4ZHR A;  2AJQ A;  3PO5 A;  4CGJ A;  1BIS A;  3C94 A;  1CZ9 A;  3KLG A;  4PA1 A;  4Z4C A;  4FJG A;  1K6Y A;  4CJR A;  1VSK A;  1S6P A;  4FM0 A;  1TK5 A;  2HND A;  1RIL A;  3U6F A;  4M3Y A;  2KZZ A;  4LSN A;  1VRU A;  4CJV A;  3OY9 A;  2B4J A;  4DQP A;  1ITG A;  4FJN A;  3KK2 A;  4J2D A;  1BL3 A;  4NCB A;  1VSI A;  3F73 A;  3ISN C;  1WAF A;  2DFF A;  2YHB A;  1RDB A;  2IC3 A;  4DSF A;  2GV9 A;  3KLI A;  3NHG A;  4E1N A;  3HP9 A;  4W5T A;  3WNH A;  3ZSO A;  4IBN A;  2YV0 X;  4CEB A;  3SV4 A;  4C8L A;  4HCC A;  1TL1 A;  2FC0 A;  4E89 A;  3K5O A;  4CJ3 A;  4CHQ A;  3VQ5 A;  1KFS A;  4W5R A;  1HYS A;  3AVK A;  4DFK A;  2JGU A;  3EZ5 A;  4E7J A;  1SL0 A;  3RMB A;  2QKK A;  1ZBI A;  2VG7 A;  3OYD A;  4Q5V A;  2YNF A;  3I0S A;  4N76 A;  3D45 A;  4CJT A;  1SL1 A;  4FJ5 A;  4AIL C;  4N47 A;  3SUO A;  1HMV A;  1JLG A;  4BE1 A;  3P83 D;  2D0B A;  4PUO A;  1HQE A;  4OKK A;  1QQC A;  4IG0 A;  3OYI A;  4DTJ A;  4F8R A;  4FZX C;  3RMA A;  1LV5 A;  4CEC A;  3IRX A;  4M41 A;  3E01 A;  3O3F A;  3HPO A;  4FLT A;  4B9M A;  2OZM A;  1C1A A;  1WSE A;  1D8Y A;  2Z1J A;  1KTQ A;  4DTP A;  1DTT A;  4KI4 A;  1L3U A;  3VQ4 A;  3PO4 A;  4FW2 A;  3B6O A;  4GW6 A;  5HP1 A;  1U4B A;  4FJ7 A;  3CM6 A;  5HRR A;  4PY5 A;  2O4I A;  2D0C A;  2HNZ A;  5KGW A;  1WSH A;  4N5S A;  3SI6 A;  3LWL A;  4F2S A;  4E3S A;  3OYF A;  4B8C A;  1KRP A;  4JLH A;  3OYK A;  3ZSW A;  1KLM A;  1LAW A;  2X6N A;  1QE1 A;  1U48 A;  2G8V A;  4ID5 A;  4CIF A;  1DTQ A;  4CK2 A;  4DMN A;  2DY4 A;  4DTO A;  4JS4 A;  3SNN A;  3DYA A;  2G8F A;  3AVC A;  4KTW A;  4KHU A;  2HHU A;  2ZQB A;  4C8O A;  3ZSV A;  4PQU A;  3VQA A;  4M3U A;  3T3F A;  3MEG A;  4DG1 A;  4E7L A;  1D5A A;  2X6S A;  4OKE A;  4FM1 A;  1T7P A;  1R0A A;  1HNI A;  3FFI A;  2ZE2 A;  3VQP A;  3VN5 A;  1EXQ A;  3TI0 A;  1S6Q A;  3NAE A;  3QEI A;  2ITG A;  4E7H A;  4F3O A;  4CCH A;  4OGE A;  3SUQ A;  4B9U A;  5C24 A;  4BWJ A;  4JS5 A;  4BDP A;  3L2R A;  3HVT A;  4B08 A;  3LZJ A;  5E41 A;  3ZSX A;  1ASU A;  2OPQ A;  4O44 A;  3CM5 A;  3OYH A;  3ZT1 A;  2YKM A;  3O4Q A;  3HO1 A;  3S3O A;  1YVU A;  2OZS A;  4DSI A;  2GUI A;  3QO9 A;  2X74 A;  1KLN A;  3KD1 E;  4CGD A;  5CY4 A;  1Z26 A;  1NJW A;  3C6T A;  5C25 A;  4PWD A;  3DI6 A;  3KLF A;  2HHW A;  4FJH A;  2OPP A;  1S1X A;  4FJX A;  1SL2 A;  1LWF A;  2Z1I A;  3OVN A;  4CJK A;  2YKN A;  3JSM A;  3MEE A;  1RBU A;  4OJR A;  3LP1 A;  3ZT0 A;  1EX4 A;  3LAM A;  1WNS A;  4Z4F A;  5FDL A;  4DU1 A;  4DS5 A;  4KHN A;  2IDO A;  4M3X A;  3ZT3 A;  4GVM A;  1KVA A;  1IKY A;  1WN7 A;  4Y1C A;  4UQG A;  3K58 A;  4Z4E A;  3CYM A;  2KQ2 A;  3DLK A;  4XIU A;  4DSE A;  2B5J A;  3HJF A;  4CHY A;  4E7K A;  1BCM A;  1J54 A;  3O4N A;  1BQN A;  3NE6 A;  3NF7 A;  2OPS A;  4CEF A;  4KHW A;  4DTU A;  4MFB A;  3HL8 A;  4I9L A;  5T7B A;  1XWL A;  3OS0 A;  5JS1 A;  3AO5 A;  3ZT4 A;  3OYC A;  3KTQ A;  2F8S A;  1J5O A;  3MED A;  4AHU A;  1JLC A;  3KLE A;  4F3T A;  3V4I A;  3SQ4 A;  4KRE A;  4LY7 A;  3JYT A;  4DTN A;  1QHT A;  4L8R B;  3K5L A;  3ZCM A;  3AVJ A;  1ZBU A;  2KZM A;  1C0U A;  3LP0 A;  3S3M A;  3M8S A;  1SV5 A;  2HB5 A;  3LPT A;  4HVJ A;  3B6P A;  4BDY A;  1L5U A;  1IG9 A;  4Z4G A;  4NCG A;  3U3Y A;  2LSN A;  1JLB A;  4Q0B A;  3SUN A;  5I3U A;  1QSS A;  3QNO A;  1CLQ A;  3QIO A;  3CFP A;  3DM2 A;  4NYF A;  3SQ2 A;  1B92 A;  4B9L A;  1NJZ A;  1O1W A;  1TVR A;  2FBX A;  3AO2 A;  4OKJ A;  1TKZ A;  4OGC A;  4DU3 A;  3L8B A;  1U49 A;  1RDD A;  1S1W A;  1VRT A;  1RT6 A;  3LWM A;  5C42 A;  3SPZ A;  2EX3 A;  3RRG A;  3DLG A;  4FK2 A;  3U3G A;  4I7F A;  3V6D A;  4RW9 A;  4CF1 A;  2HHQ A;  4I9Q A;  4M3R A;  4DS4 A;  1NK0 A;  3PY8 A;  1IH7 A;  1JL1 A;  1D9F A;  3V9Z A;  3I0R A;  5I42 A;  4DTM A;  1CXU A;  3AVA A;  3L2U A;  4DTX A;  4AHR A;  3TAR A;  1T03 A;  1RDA A;  1IO2 A;  1UAX A;  4HTU A;  4DTR A;  3S9H A;  1C1B A;  3ZT2 A;  4BE2 A;  4KTQ A;  5HRP A;  5J1E A;  3OYL A;  3TAP A;  2DFH A;  1L3S A;  4TSX A;  4CFA A;  3OS2 A;  1S9G A;  2YHA A;  3A2F A;  4CJ4 A;  3HPH A;  3M8Q A;  1UA1 A;  4FJJ A;  2D0A A;  1VSL A;  3ASM A;  3CFO A;  3QNN A;  1WSI A;  3AVM A;  4ZTJ A;  4RW6 A;  1BI4 B;  1NOY A;  4KHQ A;  5KTQ A;  1WSF A;  1EKE A;  2IS3 A;  5DK5 A;  2XRI A;  3KK1 A;  3TAB A;  4FXD A;  1FK9 A;  4FYD A;  3QIP A;  1NK6 A;  4DQQ A;  5CYQ A;  3NF9 A;  1Q9Y A;  1I39 A;  4CIG A;  3P1G A;  1SUQ A;  4BE0 A;  1RT2 A;  5KI6 A;  2VG6 A;  4ID1 A;  3RR7 A;  3KKS A;  1VSJ A;  2I5J A;  1NK5 A;  5KRS A;  1NOZ A;  3VQ8 A;  4FJK A;  3IG1 A;  1XC9 A;  1YTU A;  3SJJ A;  2F8T A;  2E6L A;  1G15 A;  4Z4H A;  3TAQ A;  3VA0 A;  4AHV A;  2R7Y A;  3SQ0 A;  4CFB A;  3V9W A;  5CZ1 A;  4E7I A;  1TKT A;  4KB0 A;  1RBS A;  2IGI A;  5K14 A;  4CJQ A;  1KSP A;  2G8I A;  1HRH A;  1C6V A;  3VQB A;  1LW2 A;  2VG5 A;  3OYN A;  5J2P A;  1JLQ A;  1REV A;  4RW4 A;  3TAG A;  5HRO A;  1TAQ A;  4Y1D A;  1JLA A;  2E4L A;  4DLG A;  1U45 A;  4I2P A;  1TKD A;  4CF9 A;  2O4G A;  3NCI A;  3NFA A;  4CEZ A;  3RWU A;  2RKI A;  4CGH A;  4ICL A;  1L3T A;  4H4O A;  1DLO A;  2ZD1 A;  4DQR A;  4JRP A;  4DSL A;  3M8P A;  3CQ8 A;  3PX4 A;  3V1R A;  4DSK A;  4CF2 A;  2W42 A;  1NJY A;  4BWM A;  4O55 A;  4OVL A;  4CJW A;  4M3Z A;  4CFC A;  1N5Y A;  4CEQ A;  2XY5 A;  3TAN A;  4CGI A; 
#chains in the Genus database with same CATH topology
 1Z25 A;  1NBW A;  4RG8 A;  1RTI A;  4DFM A;  5EU7 A;  4DWI A;  1XUP O;  3WNF A;  3LP2 A;  2HW3 A;  3H46 O;  3EE8 A;  3MWP A;  1IKX A;  3WXI A;  4AH9 A;  3L2Q A;  1QVF M;  1HYZ A;  3LDP A;  1VSH A;  5EX5 A;  2OYQ A;  1X9S A;  4CJF A;  4LH4 A;  3DRP A;  4CJ7 A;  4FZY A;  2HMI A;  4NCA A;  1CXQ A;  3EN9 A;  3L4I A;  4FLV A;  2E2N A;  5HRN A;  3WNE A;  1Y97 A;  4KO0 A;  1X9W A;  1Q18 A;  3L3U A;  5E26 A;  2B6A A;  4LD0 A;  2E8A A;  1XQS C;  2UYT A;  4YFU A;  5J2N A;  4I2Q A;  4CER A;  4CD3 A;  3ZEU B;  2BDP A;  3RRH A;  4BRK A;  2WUS A;  3OYG A;  3VGL A;  4QAG A;  3THX B;  5CYM A;  1TGO A;  3LZI A;  1TK8 A;  4DCH A;  2HHV A;  2O8D A;  1RTD A;  1S22 A;  3O9S A;  3HXM A;  1C0T A;  3CCJ N;  4WYB A;  4FW1 A;  4B9T A;  4O0J A;  2NRT A;  1XC3 A;  4BRC A;  1U2V B;  4DLE A;  4QS7 A;  4BGA A;  2A41 A;  2QTD A;  4XEI A;  1GOA A;  2A6A A;  2P9U A;  2Y1J A;  4DR2 K;  3FGU A;  4HUG A;  3DXK B;  3WXK A;  1NK9 A;  4GMJ B;  1IBK K;  4FWM A;  1ASV A;  3G6E N;  4MO4 A;  2HBK A;  4YOV A;  4ELU A;  3J7Z O;  4R5P A;  3CFR A;  1M1K O;  4KI6 A;  2JWK A;  1MWK A;  4J2E A;  3CD6 N;  3IMX A;  3IAY A;  3GL1 A;  4K25 A;  3UKR A;  3RTV A;  2HVI A;  5AZJ B;  1S3X A;  4CED A;  5CR4 A;  4DKW A;  5HBM A;  1OVQ A;  4AQY K;  2OTJ N;  3AA5 X;  3SV3 A;  2FBY A;  1NG9 A;  4IO8 A;  4DF8 A;  4Z4I A;  3QEV A;  2F96 A;  3THV A;  4EZ9 A;  1TKX A;  1U47 A;  3QET A;  4BR0 A;  3BUZ B;  3MXM A;  3HRG A;  4A62 A;  4KPY A;  4RTF D;  1ZBH A;  1A5X A;  1BU6 O;  4FJ8 A;  1C0F A;  2YX6 A;  4BR5 A;  5AQV A;  4IG3 A;  4JI7 K;  1OH6 A;  3VQE A;  2VQE K;  3FZK A;  4DV2 K;  2P9P B;  1U04 A;  1I94 K;  3TWH A;  1KXP A;  4AM6 A;  3WEE A;  1ASW A;  4O0I A;  1BOT O;  3PSI A;  4KHP K;  4DF4 A;  1BIZ A;  3L3V A;  1Z05 A;  2A1S A;  2PY5 A;  5BRD A;  3K5N A;  1WSJ A;  4B3M K;  4OO1 J;  3HYF A;  2BTF A;  3ZSY A;  2W41 A;  3DRS A;  1C0M A;  3W0L A;  4IDK A;  1ZBF A;  4DR7 K;  5CZ2 A;  4QOZ B;  1XHZ A;  3DLE A;  4G1Q A;  4IDH A;  4N41 A;  4B1V A;  5AQJ A;  3VEW A;  2KHO A;  2HVH A;  3I55 N;  4KB1 A;  1NK8 A;  4CK3 A;  1CZB A;  1VSM A;  3THY B;  5GAH P;  3BZK A;  4GV9 A;  1NWK A;  3HM8 A;  4IWV A;  4BG9 A;  5LY3 A;  4FPA A;  3IUC A;  1TL3 A;  3EKU A;  3KD5 E;  4OLA A;  1KFD A;  4FVM A;  1NJI O;  3SUP A;  1D4X A;  3U4L A;  2XY8 A;  4A57 A;  4K8X A;  4CZI A;  3CF5 L;  1BIU A;  3QER A;  4JI5 K;  2HHT A;  2G8U A;  2E6M A;  4O4G A;  4F2R A;  1R59 O;  4BDZ A;  4LSL A;  4YOT A;  4FLW A;  3TAF A;  1HJO A;  1QQN A;  4CHN A;  4Z0U A;  1J9A A;  2HBM A;  2KTQ A;  4HHT A;  3DMJ A;  1KVC A;  3PX0 A;  4H4M A;  4PL8 A;  5HRS A;  3AVL A;  2A5X A;  2GTD A;  1RTH A;  4CF0 A;  3QIN A;  4DQI A;  4QCL A;  1MWM A;  1RT4 A;  3TTF A;  1QSL A;  3MXI A;  3ZEU A;  3R3L A;  3K57 A;  4CJU A;  1FKO A;  3TSP A;  1EO1 A;  2E1Y A;  1HNX K;  2O8E B;  1HNZ K;  5CE3 A;  4B3R K;  4M7Y A;  1CZ9 A;  5C15 A;  4FJG A;  3BP8 A;  4DQP A;  4NCB A;  3MMV A;  3F73 A;  2E5L K;  2DFF A;  2YHB A;  3P38 A;  2IC3 A;  2HF4 A;  4DSF A;  3ID8 A;  4EFH A;  2O8C A;  3NHG A;  2Q2R A;  4W5T A;  1C0G A;  2IVO A;  1IG8 A;  4HCC A;  4CZJ A;  3VQ5 A;  4JD2 A;  5A2Q O;  2P9N B;  2JGU A;  5HL7 L;  4E7J A;  1K8K B;  3F2K A;  3ULE A;  4JK7 A;  5C2D A;  4N47 A;  4O8K A;  5AQN A;  4WFA L;  1CZA N;  2P9I A;  4H5N A;  3E9L A;  3M3Z A;  4FZX C;  2O8B B;  1NLV A;  5DM6 L;  3RMA A;  4FLT A;  1JCE A;  4H0P A;  1C1A A;  2Z1J A;  2QEX N;  4L3Q A;  3EZW A;  3PO4 A;  4FW2 A;  5AQU A;  2O4I A;  2QW9 A;  2D0C A;  2F7T A;  1HLU A;  1WSH A;  4BG8 A;  2FF6 A;  1QHA A;  2VGM A;  3CCV N;  4CK2 A;  4DMN A;  4XH5 A;  3O9T A;  1SAZ A;  3DYA A;  3AVC A;  5AQG A;  4BVO A;  4KHU A;  4C8O A;  3VQA A;  2V51 B;  4M3U A;  3MEG A;  4DG1 A;  4E7L A;  5GIP A;  2YHX A;  3CME N;  3CCR N;  2ZE2 A;  4BR4 A;  4JV5 K;  1S6Q A;  3QEI A;  2ITG A;  4F3O A;  4BDP A;  5C24 A;  4BWJ A;  4JS5 A;  3VEZ A;  3HVT A;  4H0T B;  4PKG A;  3EEQ A;  1LCU A;  3HO1 A;  3KD1 E;  5CY4 A;  1Z26 A;  5TKW A;  4OX9 K;  2DPN A;  3KLF A;  2HHW A;  3OA9 A;  2OPP A;  1SL2 A;  1NMD A;  2Z1I A;  1VAZ A;  1RBU A;  4GKK K;  2IDO A;  1IKY A;  3HZ6 A;  4Z4E A;  3CYM A;  2KQ2 A;  3HJF A;  4CHY A;  1J54 A;  1BQN A;  3NE6 A;  2OPS A;  4CEF A;  1BA1 A;  4CZH A;  5KPT A;  1YF5 L;  3KWI A;  4IOX A;  4WFN L;  1J5O A;  4AHU A;  3KLE A;  1Q81 O;  4F3T A;  3C6A A;  4LY7 A;  4DTN A;  1H1V A;  4L8R B;  2BH1 A;  1ZBU A;  1C0U A;  1NGI A;  1SV5 A;  2E1Z A;  4Z4G A;  2PFU A;  3A0I X;  3ENO A;  5LJV A;  4DR3 K;  3LDN A;  1LOT B;  4DU3 A;  3A5O C;  1VRT A;  3U3G A;  1BG3 A;  4I7F A;  1VQ6 N;  1NK0 A;  3CQY A;  1KC8 O;  4LF7 K;  3L2U A;  4DTR A;  3S9H A;  1C1B A;  3ZT2 A;  4BQL A;  4LF6 K;  1V4S A;  3OYL A;  3CCE N;  3OS2 A;  4HTL A;  3KWG A;  3OTO K;  2D0A A;  3ASM A;  3QML A;  1EQY A;  1JJ2 M;  5KTQ A;  1WSF A;  3SLC A;  2Q36 A;  1W7A A;  1K9M O;  4BY9 C;  3QIP A;  5E84 A;  5CYQ A;  1Q9Y A;  4CIG A;  1SUQ A;  1RT2 A;  5KI6 A;  3KKS A;  2F8T A;  1XC9 A;  2E6L A;  3N4Q A;  3VGK A;  1OKJ A;  5AQP A;  1Q7Y O;  5CZ1 A;  1YI2 N;  2D0P A;  2Q31 A;  4KB0 A;  1RBS A;  1KSP A;  1LW2 A;  4JKF A;  4RW4 A;  3JXU A;  2GWJ A;  4BRQ A;  4EHU A;  4BGB A;  3NCI A;  3TPQ A;  3NFA A;  4CEZ A;  1L3T A;  4NXM K;  4H4O A;  1DLO A;  1X3N A;  4JN4 A;  4BRM A;  5C12 A;  3CQ8 A;  3SAH A;  3VOV A;  4CF2 A;  4BWM A;  2V52 B;  4OVL A;  4CGI A;  4GV3 A;  4WFB L;  4RW8 A;  1W97 L;  1D9D A;  4C8K A;  3QBW A;  3MAQ A;  3MX5 A;  4W5Q A;  3DLB A;  4FJM A;  1VQ9 N;  4KBO A;  3MXJ A;  2VWB A;  4DU4 A;  3ALY A;  5AQR A;  3V1Q A;  3L4Q A;  4BC2 A;  2IIR A;  4K0K K;  2P1J A;  3NBP A;  4DHY A;  1HUX A;  2XY6 A;  2ZF5 O;  3IS9 A;  1OVY A;  4FWO A;  5JLH A;  4W5N A;  1BWF O;  1HX1 A;  4CHP A;  5HLF A;  3D2F A;  3VER A;  3PX6 A;  3NF6 A;  1GLJ O;  4MDB A;  2QK9 A;  3MEC A;  5KPZ A;  3CHW A;  2QKB A;  4DR5 K;  3EO3 A;  4H5R A;  4FCY A;  1ZBL A;  4FLU A;  1SZ2 A;  4H5V A;  2PYJ A;  4CK1 A;  4DR6 K;  3K9J A;  3KKR A;  1DKG D;  4CZM A;  2QM1 A;  1UA0 A;  3C0B A;  3EL2 A;  1C1C A;  1FXX A;  1RDC A;  2HHX A;  3CER A;  2QXF A;  3DOK A;  2A42 A;  3HP6 A;  4BRI A;  4CF8 A;  4FM2 A;  2VCP A;  4KH5 A;  1X9M A;  4DUY K;  3J7A P;  4FLX A;  4WF9 L;  3CG7 A;  2Q1N A;  3PUF A;  1N33 K;  1YAG A;  3F9K A;  4EP5 A;  1GLB G;  2EHG A;  3UKU B;  3OBW A;  4WQ5 A;  3SAG A;  3VQD A;  3AVN A;  3BDP A;  4IEE A;  4BRL A;  1T3V A;  4BR9 A;  4KTZ A;  1HNW K;  3IKM A;  1G99 A;  3V9S A;  1YUW A;  4AHT A;  3SQ1 A;  1RT3 A;  3P5J A;  1TYQ A;  1HPZ A;  3T1A A;  4H0Y B;  2D5R A;  1YJN N;  3L2V A;  3FLC O;  5FRM A;  1HQU A;  2W6L A;  1W9H A;  4GVE A;  1SKR A;  4FOE A;  3MDQ A;  3HVR A;  1LWE A;  3ID6 A;  5BN9 A;  2RE2 A;  5SZT A;  2ASM A;  1QS4 A;  2Q0R A;  4KV8 A;  4B9V A;  3CIP A;  1VQK N;  3OHR A;  2DTU A;  3R9P A;  4YOY A;  4ILH A;  3QIC A;  3ZSZ A;  3NGY A;  4KAZ A;  2P5O A;  3VQ9 A;  4OPK A;  4BC5 A;  2PZS A;  1HKG A;  2P5G A;  5AQY A;  5H1S Q;  1N34 K;  4DSJ A;  1NGJ A;  2P9L A;  3T1Y K;  4F4K A;  2GEL A;  3AA4 A;  5F2R A;  3L2W A;  3JAM O;  1RFQ A;  1RBR A;  3THW B;  5GAG P;  3TSQ A;  5JVG L;  4FZZ A;  4FWQ A;  1P8Z A;  3D2E B;  4CHO A;  3AVH A;  4J2A A;  3PV8 A;  4YOW A;  1P90 A;  1V4T A;  5ADX A;  1JL2 A;  4IFV A;  3QEX A;  3T19 A;  2NRW A;  1TAU A;  1Y64 A;  3H08 A;  3O9Q A;  4CEO A;  4CJP A;  4YNQ A;  1HR0 K;  3G10 A;  4B1X B;  3TR8 A;  4M42 A;  4FL9 A;  1J53 A;  2UU9 K;  2JLE A;  4XH1 A;  1VK0 A;  3BF3 A;  1WAJ A;  4IKF A;  1WBD A;  4RWT A;  1GLE G;  2HF3 A;  4E19 A;  1BGX T;  3ZSR A;  2G8H A;  1VSF A;  2RN2 A;  5AFU A;  4W5O A;  1YXQ A;  3LL3 A;  1ATN A;  4CJ5 A;  3MN6 A;  4CZL A;  3PLA A;  1GLL O;  3SBT A;  4DUZ K;  4AF1 A;  3LPU A;  3S41 A;  4B3T K;  2W6K A;  3OYB A;  3HPG A;  2PAV A;  3TTD A;  1JCG A;  1KVB A;  2KFN A;  3DXM A;  2YJE A;  1SKW A;  1RT7 A;  1N36 K;  3G0Z A;  4V19 S;  1EWQ A;  3FZL A;  4ILJ A;  5SWM A;  1NGC A;  5AR0 A;  3M8R A;  2Z1G A;  3IFR A;  4CD1 A;  2YCH A;  1BA0 A;  1VQ7 N;  3KLG A;  4PA1 A;  3J81 O;  2QWM A;  1E4F T;  4YY3 K;  4J2D A;  3P39 A;  1WUA A;  3ISN C;  4B9Q A;  3GDQ A;  2GV9 A;  4OPA A;  1NGF A;  4FWL A;  3WNH A;  3ZSO A;  3VEN A;  4CEB A;  5GAE P;  4C8L A;  4YOU A;  1TL1 A;  2FC0 A;  3K5O A;  5BPN A;  3AVK A;  5AQW A;  2NZT A;  4BQZ A;  1HKC A;  3RMB A;  2FSN A;  5AQS A;  5BPL A;  1ZBI A;  3OYD A;  2D1K A;  2YNF A;  1SL1 A;  4BE1 A;  3P83 D;  4PUO A;  1HQE A;  4IG0 A;  4DTJ A;  4F8R A;  1LV5 A;  4CEC A;  4M41 A;  3O3F A;  4B9M A;  1WSE A;  3T69 A;  1T6C A;  4PHT X;  4K42 A;  4GW6 A;  3B6O A;  1U4B A;  4FJ7 A;  4PY5 A;  5KGW A;  3CXC M;  3LWL A;  5AZI B;  3WUH A;  4JLH A;  2X6N A;  2YJF A;  2DY4 A;  3KZB A;  4WQ4 A;  4DTO A;  2G8F A;  1ZXO A;  4KTW A;  2ZQB A;  3FZH A;  3CPW M;  2QWN A;  1D5A A;  3ZLJ A;  4FM1 A;  2UXD K;  1HNI A;  2WFB A;  3TI0 A;  2A3Z A;  4CCH A;  4OGE A;  4YHH K;  3L2R A;  4Y0W A;  3ZSX A;  3ZT1 A;  3A5L C;  4ILG B;  3S3O A;  4GV6 A;  4JHD B;  2OZS A;  4DSI A;  2X74 A;  1KLN A;  1FJG K;  1NJW A;  3C6T A;  1XNR K;  1S1X A;  3SBG A;  1LWF A;  3SK3 A;  4CJK A;  1WNS A;  4YDU A;  4DS5 A;  1S72 N;  3VF6 A;  3D2E A;  4GVM A;  3O6W A;  3K58 A;  4Y1C A;  3DLK A;  4DSE A;  4JK9 A;  4E7K A;  4DQ8 A;  5KPR A;  4A5B A;  4DTU A;  5T7B A;  5JS1 A;  1ATR A;  1XWL A;  4BVP A;  2F8S A;  3MED A;  4IOA L;  1T6D A;  2QI2 A;  5FPE A;  3LDO A;  3ZCM A;  3UB5 A;  2HB5 A;  3RSE B;  3THX A;  4NCG A;  2LSN A;  1JLB A;  1ZC6 A;  3SUN A;  4Q0B A;  5ELZ A;  3OW2 M;  4GKJ K;  4JKB A;  3QNO A;  1CLQ A;  3DM2 A;  4NYF A;  3VEV A;  1B92 A;  5M1O A;  4B9L A;  1TVR A;  3CJC A;  3ATV A;  1TKZ A;  4OKJ A;  1U49 A;  3LWM A;  5C42 A;  2EX3 A;  1U2V A;  4RW9 A;  4CF1 A;  2HHQ A;  3E9O A;  4JI1 K;  3R6M A;  4FVU A;  3I0R A;  5I42 A;  3ZX3 A;  3AVA A;  1XNQ K;  4JNE A;  1T03 A;  1RDA A;  4HTU A;  3DXK A;  4KTQ A;  4BE2 A;  2FSJ A;  2ZM6 K;  3TAP A;  2DFH A;  1L3S A;  4TSX A;  1VHX A;  4CFA A;  1S9G A;  2YHA A;  3A2F A;  4CJ4 A;  3HPH A;  3CFO A;  1VSL A;  4XH4 A;  1WSI A;  4ZTJ A;  4DV7 K;  1NOY A;  1BI4 B;  1GLF O;  4KHQ A;  1EKE A;  5MLC Q;  3TAB A;  4FXD A;  4FYD A;  4FWP A;  4BRA A;  1DT9 A;  5AZJ A;  4FO0 A;  5KRS A;  4JAX A;  1WB9 A;  1Q86 O;  1G15 A;  4O5F A;  3VA0 A;  3ENH A;  3SQ0 A;  4E7I A;  3CJA A;  2NRZ A;  4NB4 A;  5J2P A;  1JLQ A;  5HRO A;  1TAQ A;  4H5T A;  1U45 A;  2O4G A;  2F4V K;  4RCH A;  4ICL A;  2D4W A;  2WBN A;  3PX4 A;  3V1R A;  2JWL A;  4O55 A;  4M3Z A;  4CEQ A;  3TAN A;  2P9P A;  3NH2 A;  4LFA K;  3AVF A;  1T05 A;  1FW6 A;  4BRP A;  1WLJ A;  3ZYY X;  4HUF A;  1UWB A;  2WOM A;  3HOT A;  3HK2 A;  2I7P A;  1LWC A;  3D0P A;  1QTM A;  2WC9 A;  1JLE A;  4X62 K;  1IBM K;  2P9S B;  5J2Q A;  1X1P A;  1XHX A;  4BRH A;  4ZTF A;  2BE2 A;  1DEJ A;  1JXB A;  3SZ2 A;  2YHW A;  4CE9 A;  1VQ4 N;  1NKE A;  4B8A B;  3THY A;  4CEA A;  1A5V A;  2Q97 A;  1VSD A;  3U9D A;  4BR2 A;  4QS9 A;  3CCM N;  3S3N A;  4O8U A;  1S5J A;  3EE9 A;  5HOO A;  3HBT A;  1KD1 O;  2P9K B;  4LH5 A;  1RNH A;  5LMN K;  4J2B A;  4DFJ A;  3ENB A;  2XHB A;  5FPM A;  4FLY A;  5IWA K;  1IKW A;  1S1T A;  2BGG A;  3RMD A;  1WSG A;  5F1X A;  4IO9 L;  5LJW A;  3PSF A;  1NNE A;  3EY1 A;  3PIO L;  1SQK A;  3QFP A;  1RBT A;  2G8K A;  3GE1 A;  4CBW A;  3VES A;  3QBX A;  3MN5 A;  3C7N B;  2WON A;  1RCH A;  3DOL A;  1E3M A;  4E0D A;  3AV9 A;  3VQ6 A;  4H5W A;  4CES A;  2CGJ A;  3F9M A;  4B3S K;  3VQC A;  3NGI A;  3VA3 A;  2O8E A;  4PKI A;  5DM7 L;  2OTL N;  1RT1 A;  3TSU A;  3QEP A;  4DV4 K;  5FPD A;  4B9S A;  4YOR A;  3UIQ A;  4BRG A;  4C23 A;  1EP4 A;  1RTJ A;  4FOI A;  4M45 A;  3O80 A;  4JKG B;  5FRO A;  4N56 A;  4OPJ A;  2Z1H A;  3OYE A;  1UOC A;  4M3W A;  3AO1 A;  4DTS A;  5FRN A;  4H0V B;  1JKH A;  3HST B;  2ZGZ A;  3ZSQ A;  4C1N K;  4CBX A;  2P9N A;  4KKO A;  4FK4 A;  3KLH A;  4IXC A;  1BI4 A;  1K8K A;  4H03 B;  3QLH A;  3SAF A;  3V9X A;  4FJL A;  4O5B A;  3AA2 A;  3FZM A;  3K59 A;  3DLR A;  1N6Q A;  2O8B A;  2CH5 A;  2G8W A;  3N4P A;  3V81 A;  1NGE A;  4K8Z A;  4JI4 K;  3HOS A;  3SCX A;  5D3G A;  1BCO A;  4CJL A;  3LAL A;  1W0H A;  1NKC A;  4ISG A;  1TK0 A;  4KRF A;  4B9N A;  4EZ6 A;  3D7E O;  5C0Y A;  2HBJ A;  2O8D B;  1J5E K;  3U9Z A;  3AA3 A;  1HJR A;  1RT5 A;  3TAM A;  3V9U A;  3LP3 A;  1GLA G;  3P31 A;  3CI5 A;  3ULD A;  3I8B A;  5AQH A;  4JI2 K;  3RR8 A;  2E2O A;  4M3T A;  4HUE A;  4JI8 K;  3NDK A;  1BUP A;  2YNG A;  3C6U A;  4DFP A;  2Y1I A;  1EET A;  4X66 K;  4Z94 A;  3H1V X;  5KQ8 A;  4NLB A;  3K5M A;  4BR7 A;  3CJB A;  3NVK A;  1VQ5 N;  3SPY A;  5FLX O;  4CZE A;  5C2F A;  4BRN A;  4CGG A;  1IKV A;  4NYN A;  3DRR A;  3UKR B;  4BRE A;  3FZF A;  3QEW A;  2P9S A;  1OH8 A;  4EP4 A;  3SYZ A;  2ETJ A;  2P51 A;  1MDU B;  3WQT A;  4R79 A;  4KH4 A;  3VQQ A;  4DV3 K;  2VWJ A;  3CMA N;  4A2B A;  4ELV A;  3OYA A;  3OS1 A;  3G71 N;  1NGD A;  5F0X A;  4ZHR A;  2AJQ A;  4X65 K;  3PO5 A;  4CGJ A;  1BIS A;  3C94 A;  2GEM A;  4WQ5 C;  4CJR A;  1VSK A;  1S6P A;  3G25 A;  5B8H A;  3O8M A;  2KZZ A;  4LSN A;  4CJV A;  2B4J A;  1ITG A;  4FJN A;  3KK2 A;  1U6Z A;  2J4R A;  1GLD G;  4EIA A;  1VSI A;  1WAF A;  3MX2 A;  1GLC G;  5BRE A;  3KLI A;  4E1N A;  3HP9 A;  4IBN A;  3LDL A;  3VET A;  3WEE B;  4E89 A;  2QA4 N;  4CJ3 A;  1KFS A;  4DFK A;  2UXB K;  3EZ5 A;  1NGA A;  5AQL A;  3CCS N;  3CCQ N;  1IJJ A;  2VG7 A;  3H45 C;  1RGI A;  4MLE A;  4N76 A;  3K0S A;  3D45 A;  4CJT A;  3I33 A;  4DB3 A;  4AIL C;  3VF2 A;  1HMV A;  1JLG A;  5ADX H;  1TUY A;  1QQC A;  3RVC A;  1NGB A;  2ASO A;  2QXL A;  1DTT A;  4KI4 A;  5BPM A;  3VQ4 A;  4IJA A;  4A5A A;  4IJN A;  3CM6 A;  3NVM A;  2F9T A;  3SI6 A;  4N5S A;  1XMQ K;  4F2S A;  3OYF A;  4B8C A;  1KRP A;  1EWR A;  1RDU A;  3O1B A;  1KLM A;  5AFU H;  4CZF A;  4PL7 A;  1U48 A;  3M5R A;  4CIF A;  1VQM N;  3MK6 A;  3SNN A;  1QQO A;  4BRF A;  4PQU A;  5JMV A;  3C65 A;  4FWN A;  3T3F A;  3J7Y P;  3L0Q A;  4OKE A;  1OH7 A;  1KAY A;  1EXQ A;  3NAE A;  4GY2 B;  4E7H A;  2IVP A;  3ATU A;  1MA9 B;  5CHI A;  4B9U A;  4CZG A;  2O8F B;  3LZJ A;  5E41 A;  1ASU A;  4O44 A;  3CM5 A;  3O4Q A;  1YVU A;  2GUI A;  3AAP A;  2AA4 A;  3G4S N;  3WXJ A;  5C25 A;  1VQL N;  3DI6 A;  2NLX A;  3B8A X;  4FJX A;  3OVN A;  3JSM A;  2QWL A;  3MEE A;  4U7B A;  3L6Q A;  3LP1 A;  3MCA B;  5FDL A;  4DU1 A;  4KHN A;  2NRR A;  3VMF B;  4M3X A;  3ZT3 A;  1N8R O;  5M1Q A;  2AP1 A;  4XIU A;  3UE5 A;  3GG4 A;  5EY4 A;  3NF7 A;  1XMO K;  5M1P A;  4KHW A;  3O9U A;  4MFB A;  4I9L A;  3OYC A;  2E2P A;  4YOX A;  1JLC A;  4B1Y B;  4JEP A;  3V4I A;  4KRE A;  3K5L A;  3S3M A;  3CQX A;  3LPT A;  1L5U A;  3B6P A;  1IG9 A;  2FF3 B;  3A5M C;  5I3U A;  3KHY A;  2BUP A;  2O8C B;  3QIO A;  4CI6 A;  5AQT A;  4NXN K;  1NJZ A;  3BEX A;  3AO2 A;  3O1W A;  3NMU A;  2HBL A;  3L8B A;  4JI3 K;  1RDD A;  1S1W A;  1RT6 A;  3RRG A;  3CJ1 A;  4JD2 B;  3DLG A;  4FK2 A;  4I9Q A;  4JKC A;  4DS4 A;  3ZX2 A;  1D9F A;  1QQM A;  1QZ5 A;  3ULE B;  3V9Z A;  1CXU A;  3TAR A;  1UAX A;  1IO2 A;  2P9I B;  5J1E A;  3A8Y A;  1UA1 A;  3M8Q A;  4FJJ A;  3QNN A;  2YHY A;  3HSC A;  2UUB K;  2IS3 A;  4JKE A;  3UKU A;  2E88 A;  3DLL L;  1O13 A;  1NK6 A;  1DGK N;  3M1F A;  3NF9 A;  1I39 A;  3P1G A;  4BE0 A;  4DR1 K;  1KQS M;  3O4W A;  5GIO A;  3RR7 A;  1NK5 A;  4FJK A;  3IG1 A;  4H0X B;  1YTU A;  4Z4H A;  2FSK A;  4AHV A;  2R7Y A;  4CFB A;  3V9W A;  2HHH K;  2NRV A;  4UY8 O;  5K14 A;  1HRH A;  5AQX A;  3CJ9 A;  3TAG A;  1REV A;  4Y1D A;  4BRO A;  2E4L A;  3DWL A;  1E4G T;  4A59 A;  2QWO A;  4CF9 A;  1TKD A;  2UUA K;  3RWU A;  1IV0 A;  3P4I A;  1BO5 O;  2ZD1 A;  4JRP A;  4DSK A;  4KH6 A;  1NJY A;  3R1X A;  5GIN A;  1N5Y A;  3SMS A;  4ISE A;  4WQ4 C;  2VWK A;  5AJ3 K;  3D6R A;  3O3H A;  3CJ7 A;  3EYZ A;  4IZ9 A;  3VGM A;  2ZJQ L;  3NF8 A;  2NUB A;  4RW7 A;  3HM9 A;  3LM2 A;  2Q3S A;  3VF4 A;  3AVI A;  3O08 A;  4DV5 K;  2GX9 A;  4G9Z A;  3AGK A;  3TU5 A;  4CEE A;  4EAH D;  1NK4 A;  5BR8 K;  1NM1 A;  3LDQ A;  1X3M A;  3OJS A;  3AVB A;  1Q9X A;  4I6M B;  3THW A;  4IFE A;  4C8M A;  2KW4 A;  2BAN A;  2FBT A;  3Q7B A;  3WXM B;  3QES A;  1YT3 A;  4E1M A;  4FLZ A;  4LF9 K;  1ZYQ A;  5KQD A;  3VEY A;  4IFY A;  3W3D A;  4YDU C;  1TV6 A;  3CPE A;  4BC4 A;  3CC4 N;  4KFB A;  4CGF A;  1KAZ A;  1L3V A;  2XY7 A;  4WCE L;  2FLO A;  2ATQ A;  4H8K A;  3AO3 A;  2O8F A;  2PYL A;  1VQN N;  3M6G A;  2X78 A;  1SKS A;  1KCF A;  4CIE A;  1NMN A;  1OH5 A;  4EHT A;  3OYJ A;  4FJI A;  1QVG M;  2YI1 A;  1S1V A;  4MQ3 A;  3C95 A;  1S1U A;  3K9K A;  3KK3 A;  3GBT A;  4AHS A;  4IOC L;  3TAE A;  4JKA A;  4BC3 A;  4WE1 A;  1NK7 A;  1YVN A;  1MU2 A;  3AVG A;  4U67 L;  1HNV A;  5IT9 O;  2E20 A;  5DMR A;  2HHS A;  2DFE A;  2RPI A;  3V1O A;  1FKP A;  1YIJ N;  5J2M A;  3AO4 A;  5KGX A;  1J6Z A;  1B9F A;  1JCF A;  4QS8 A;  4B1W B;  3IDH A;  3KJV A;  2PBD A;  1WBB A;  4MDA A;  4KHS A;  1HPM A;  1YTA A;  3OYM A;  3DLH A;  4LF5 K;  2FBV A;  3OBY A;  3VTI A;  1BHL A;  2ZJP L;  1QSY A;  3LAN A;  3ITH A;  3I8D A;  1VQ8 N;  2EWS A;  3DJC A;  4CZK A;  4FJ9 A;  1A5W A;  2V7Y A;  4BRD A;  4FWS A;  3TTC A;  5AQF A;  4JI6 K;  4LFB K;  2CGK A;  4CW7 B;  5KRT A;  4CJS A;  2VGN A;  3T7Z A;  2KLA A;  4C8N A;  4CHZ A;  3LDS A;  3HI0 A;  3BGR A;  3MCP A;  1VSE A;  4B1U B;  3ZET B;  1K73 O;  2GUP A;  2IOC A;  2GBZ A;  3C6H A;  4HWI A;  4ELT A;  5AQK A;  1LAV A;  3EKS A;  1YHQ N;  2RHK A;  5EVZ A;  3OJU A;  3NH1 A;  3E9P A;  1GOB A;  4LC9 B;  5LL6 Z;  3CCL N;  1BQM A;  1GOC A;  3D2F B;  3LM9 A;  3I56 N;  1NKB A;  4DV0 K;  2IAJ A;  3MN7 A;  2ZGY A;  1S9E A;  1XI1 A;  3R8E A;  5AZI A;  3RMC A;  1HYV A;  2NRH A;  4X64 K;  3J8A A;  3E1Y A;  3SJH A;  2XO7 A;  4AHC A;  2HNY A;  3T1H K;  4KHY A;  1NJX A;  4B3O A;  4JI0 K;  1YIT N;  3H3O B;  5AQM A;  2HMP A;  4FK0 A;  1RBV A;  4JRQ A;  3K2P A;  3QFU A;  1TUU A;  5JS2 A;  1T8E A;  2OPR A;  5BN8 A;  4A2A A;  3NGZ A;  1JLF A;  3HT3 A;  5FPN A;  3NH0 A;  3H1Q A;  4M63 C;  4OLB A;  2KKZ A;  3WT0 A;  3DAW A;  4CFD A;  4NLC A;  1JXE A;  4CJE A;  4JHD A;  2YNH A;  3H3N O;  3CC7 N;  1SS6 A;  4BAC A;  2OA8 A;  2VYP A;  1B9D A;  1Q8I A;  2NRX A;  3O3G A;  4I6M A;  2YNI A;  3FR0 A;  4FWK A;  3VQ7 A;  2RF2 A;  1M90 O;  3HTV A;  2A1R A;  2OCE A;  4MLH A;  1LW0 A;  3LAK A;  3WNG A;  4DQS A;  4A61 A;  1F21 A;  4JK8 A;  3KIO A;  1TYQ B;  1I3A A;  5EXW A;  2KFZ A;  2UXC K;  1W2B M;  4HCB A;  4LF8 K;  4Z4C A;  1K6Y A;  1TK5 A;  4FM0 A;  2HND A;  1RIL A;  3CC2 N;  2ITM A;  1WOQ A;  3U6F A;  5AQO A;  4M3Y A;  1ZBS A;  1VRU A;  3PIP L;  3OY9 A;  1T44 A;  1BL3 A;  3RSE A;  1RDB A;  2ZWH A;  5BRF A;  2Q0U A;  2V7Z A;  3SV4 A;  2YV0 X;  5TKY A;  4MO5 A;  4CHQ A;  3AAR A;  4W5R A;  1HYS A;  3Q7C A;  1SL0 A;  3VEX A;  2QKK A;  3O5B A;  3SMP A;  4NO7 A;  4Q5V A;  3I0S A;  4FJ5 A;  3BY5 A;  3O9R A;  5JIC A;  3SUO A;  4K41 A;  2P9L B;  3J80 O;  2D0B A;  3AGR A;  3CET A;  3H6E A;  2D0O A;  2E2Q A;  4OKK A;  3OYI A;  5LMU K;  3IRX A;  2OZM A;  3E01 A;  3HPO A;  1D8Y A;  1KTQ A;  4DTP A;  2NNW A;  2QWP A;  4GNI A;  1L3U A;  1NU0 A;  2QWR A;  4JKH A;  5HP1 A;  2OAN A;  5HRR A;  2HNZ A;  4E3S A;  3OYK A;  3KVG A;  3ZSW A;  1ILY A;  1LAW A;  1QE1 A;  2G8V A;  1N32 K;  4ID5 A;  1DTQ A;  2CH6 A;  4JS4 A;  2IVN A;  2HHU A;  4M7X A;  3ZSV A;  3WXL A;  3JS6 A;  1X9J A;  2X6S A;  1T7P A;  2CGL A;  1R0A A;  3FFI A;  3VQP A;  3VN5 A;  4FPB A;  3SUQ A;  4B08 A;  1RDW X;  2OPQ A;  3ZET A;  4AM7 A;  3OYH A;  2YKM A;  3WQU A;  1VQP N;  4LFC K;  2HST A;  3QO9 A;  4CGD A;  3F5T A;  2P9U B;  4PWD A;  5C10 A;  1YJ9 N;  4FJH A;  3U8X A;  2YKN A;  3DXM B;  4OJR A;  3ZT0 A;  1EX4 A;  3LAM A;  3MN9 A;  4Z4F A;  4C1N I;  5M1F A;  1KVA A;  1WN7 A;  4H0O A;  4B1Z A;  3MWT A;  4CBU A;  4UQG A;  2B5J A;  5I9E B;  1BCM A;  1QZ6 A;  3VPZ A;  3O4N A;  2QWQ A;  3ZX0 A;  4LF4 K;  3HL8 A;  4F9O A;  3OS0 A;  3AO5 A;  3ZT4 A;  3KTQ A;  2UUC K;  3SQ4 A;  5AQZ A;  3JYT A;  1QHT A;  1K8A O;  3AVJ A;  2KZM A;  3LP0 A;  3M8S A;  4HVJ A;  4BDY A;  3U3Y A;  4DR4 K;  5GAD P;  4DV1 K;  1QSS A;  3CFP A;  3SQ2 A;  1O1W A;  2FBX A;  4OGC A;  2P9K A;  1ESV A;  4JKD A;  3SPZ A;  3V6D A;  5EOY A;  4J8F A;  4M3R A;  3PY8 A;  1YJW N;  1IH7 A;  1JL1 A;  2FXU A;  4DTM A;  4OPH A;  4DTX A;  4AHR A;  4JYA K;  3VEO A;  3E66 A;  5HRP A;  2A40 A;  1NGG A;  3FFK B;  4K43 A;  3AVM A;  4RW6 A;  4ISF A;  5JVH L;  1NGH A;  5DK5 A;  2XRI A;  3KK1 A;  4FSV A;  2W40 A;  3BZC A;  3VTH A;  1FK9 A;  4DQQ A;  5BRH A;  3A5N C;  4CVN E;  3QDK A;  2VG6 A;  4ID1 A;  3C7N A;  4IEI A;  2VQF K;  1VQO N;  5AQI A;  1VSJ A;  2ASP A;  3BF1 A;  2I5J A;  4FWR A;  1NOZ A;  3VQ8 A;  3SJJ A;  1Z6R A;  1BDG A;  3FE1 A;  3TAQ A;  2ZJR L;  4DV6 K;  4PKH A;  5M1N A;  1IBL K;  3AAQ A;  1TKT A;  3CCU N;  2IGI A;  2G8I A;  4CJQ A;  5JLF A;  3QB0 A;  1HKB A;  1C6V A;  2WTU A;  3VQB A;  2GWK A;  2VG5 A;  3AY9 A;  3OYN A;  1KAX A;  3KK7 A;  1JLA A;  2F9W A;  4DLG A;  4I2P A;  2RKI A;  4CGH A;  4DQR A;  2H3G X;  4E1J A;  4JKG A;  3M8P A;  1Q82 O;  4DSL A;  5M1K A;  2HOE A;  2W42 A;  5AQQ A;  2I7N A;  3GOI A;  4CJW A;  1ATS A;  4CFC A;  2XY5 A;  5BR9 A; 
#chains in the Genus database with same CATH homology
 1Z25 A;  2VWK A;  4RG8 A;  4RW8 A;  3NH2 A;  3O3H A;  1RTI A;  4DFM A;  4C8K A;  3AVF A;  5EU7 A;  1T05 A;  3EYZ A;  3MAQ A;  1D9D A;  4W5Q A;  3DLB A;  3WNF A;  4DWI A;  4FJM A;  3LP2 A;  3MXJ A;  1WLJ A;  3NF8 A;  4HUF A;  2HW3 A;  1UWB A;  2WOM A;  4DU4 A;  1IKX A;  3ALY A;  3V1Q A;  3HK2 A;  4AH9 A;  2NUB A;  4RW7 A;  3L2Q A;  1HYZ A;  3HM9 A;  2OYQ A;  1VSH A;  2Q3S A;  1X9S A;  4CJF A;  1LWC A;  3AVI A;  3D0P A;  4LH4 A;  2P1J A;  3NBP A;  3DRP A;  4CEE A;  1QTM A;  4FZY A;  2HMI A;  2XY6 A;  3IS9 A;  1NK4 A;  4NCA A;  1CXQ A;  1JLE A;  3OJS A;  4FLV A;  4W5N A;  3AVB A;  5HRN A;  5J2Q A;  3WNE A;  1Y97 A;  1Q9X A;  4CHP A;  5HLF A;  1X1P A;  4C8M A;  4KO0 A;  1XHX A;  2KW4 A;  2BAN A;  3PX6 A;  1X9W A;  2FBT A;  3NF6 A;  4ZTF A;  2BE2 A;  3L3U A;  2QK9 A;  1JXB A;  2B6A A;  3SZ2 A;  3QES A;  3MEC A;  4LD0 A;  1YT3 A;  4E1M A;  4YFU A;  4FLZ A;  5J2N A;  4CE9 A;  4I2Q A;  4CER A;  1ZYQ A;  2BDP A;  2QKB A;  1NKE A;  3RRH A;  4IFY A;  4B8A B;  4FCY A;  1ZBL A;  4CEA A;  3OYG A;  1TV6 A;  4QAG A;  1A5V A;  4FLU A;  1VSD A;  2PYJ A;  4CK1 A;  5CYM A;  4KFB A;  4CGF A;  1TGO A;  3LZI A;  1TK8 A;  1L3V A;  3S3N A;  2HHV A;  1S5J A;  3KKR A;  1RTD A;  2XY7 A;  3HXM A;  1C0T A;  1UA0 A;  4H8K A;  2ATQ A;  4FW1 A;  3AO3 A;  4B9T A;  1C1C A;  1FXX A;  1RDC A;  4LH5 A;  4O0J A;  2PYL A;  1RNH A;  2HHX A;  4J2B A;  2QXF A;  3DOK A;  2X78 A;  4DLE A;  2XHB A;  4DFJ A;  1SKS A;  1KCF A;  3HP6 A;  4FLY A;  4CIE A;  1GOA A;  4CF8 A;  4FM2 A;  2Y1J A;  3OYJ A;  1IKW A;  1X9M A;  4FJI A;  1S1T A;  4HUG A;  2BGG A;  1NK9 A;  4GMJ B;  4FLX A;  3CG7 A;  1ASV A;  3RMD A;  1S1V A;  4MQ3 A;  1WSG A;  3C95 A;  1S1U A;  3PUF A;  3F9K A;  4ELU A;  4EP5 A;  3KK3 A;  4AHS A;  2EHG A;  3EY1 A;  3TAE A;  4R5P A;  4WE1 A;  1RBT A;  3CFR A;  1NK7 A;  2G8K A;  3VQD A;  4KI6 A;  1MU2 A;  4J2E A;  3AVN A;  3IAY A;  3AVG A;  3BDP A;  1HNV A;  3RTV A;  2HVI A;  5DMR A;  2WON A;  4KTZ A;  1RCH A;  3DOL A;  4CED A;  2DFE A;  4E0D A;  2HHS A;  5HBM A;  2RPI A;  3V1O A;  1FKP A;  3V9S A;  4AHT A;  3SQ1 A;  3AV9 A;  5J2M A;  1RT3 A;  3AO4 A;  3P5J A;  1B9F A;  3VQ6 A;  4CES A;  5KGX A;  3KJV A;  4KHS A;  3VQC A;  3NGI A;  3VA3 A;  3AA5 X;  1HPZ A;  3T1A A;  3SV3 A;  1YTA A;  2D5R A;  2FBY A;  3OYM A;  4DF8 A;  3L2V A;  3DLH A;  4Z4I A;  3QEV A;  2F96 A;  3THV A;  4EZ9 A;  1RT1 A;  1TKX A;  2FBV A;  1HQU A;  5FRM A;  1W9H A;  3QEP A;  1U47 A;  3QET A;  3MXM A;  1BHL A;  1SKR A;  4B9S A;  1QSY A;  4KPY A;  3LAN A;  3ITH A;  3I8D A;  3UIQ A;  3HVR A;  1ZBH A;  1A5X A;  1LWE A;  4FJ8 A;  1EP4 A;  1RTJ A;  5SZT A;  4M45 A;  5FRO A;  4FJ9 A;  4N56 A;  4IG3 A;  1A5W A;  4OPJ A;  2Z1H A;  1QS4 A;  4KV8 A;  4B9V A;  3OYE A;  3VQE A;  1UOC A;  4M3W A;  2DTU A;  3AO1 A;  4DTS A;  5FRN A;  1U04 A;  1JKH A;  5KRT A;  3HST B;  3ZSZ A;  4CJS A;  3NGY A;  3TWH A;  4C8N A;  4KAZ A;  1ASW A;  4CHZ A;  3LDS A;  3ZSQ A;  3BGR A;  4O0I A;  2P5O A;  1VSE A;  3VQ9 A;  4DF4 A;  4KKO A;  1BIZ A;  4OPK A;  4FK4 A;  3L3V A;  3KLH A;  2A1S A;  1BI4 A;  2PY5 A;  2PZS A;  2P5G A;  3K5N A;  2IOC A;  1WSJ A;  2GBZ A;  3QLH A;  3HYF A;  3V9X A;  3ZSY A;  4ELT A;  1LAV A;  4DSJ A;  3DRS A;  4FJL A;  4O5B A;  1C0M A;  3AA2 A;  3OJU A;  4IDK A;  1ZBF A;  4F4K A;  3NH1 A;  5CZ2 A;  3AA4 A;  4QOZ B;  1XHZ A;  3DLE A;  1GOB A;  4G1Q A;  3K59 A;  3L2W A;  3DLR A;  1N6Q A;  1RBR A;  1BQM A;  1GOC A;  2G8W A;  4N41 A;  2HVH A;  1NKB A;  4FZZ A;  2IAJ A;  3V81 A;  4KB1 A;  4K8Z A;  3SCX A;  1NK8 A;  5D3G A;  4CHO A;  1BCO A;  3AVH A;  4J2A A;  4CK3 A;  1CZB A;  4CJL A;  3PV8 A;  1VSM A;  1S9E A;  3LAL A;  1XI1 A;  1W0H A;  1JL2 A;  4IFV A;  3QEX A;  3T19 A;  1NKC A;  1TAU A;  3H08 A;  1TK0 A;  4CEO A;  4KRF A;  4B9N A;  4EZ6 A;  3RMC A;  4CJP A;  1HYV A;  1TL3 A;  2XO7 A;  4OLA A;  3KD5 E;  4AHC A;  4YNQ A;  3G10 A;  2HNY A;  3TR8 A;  4M42 A;  1KFD A;  4FVM A;  4KHY A;  3AA3 A;  1HJR A;  1RT5 A;  1J53 A;  3TAM A;  3V9U A;  2JLE A;  3LP3 A;  1NJX A;  4B3O A;  1VK0 A;  3ULD A;  3SUP A;  4K8X A;  1WAJ A;  2XY8 A;  4IKF A;  4FK0 A;  3RR8 A;  1RBV A;  4JRQ A;  4HUE A;  4M3T A;  3K2P A;  1BIU A;  4E19 A;  1BGX T;  3QER A;  3NDK A;  5JS2 A;  3ZSR A;  2YNG A;  1VSF A;  2E6M A;  1T8E A;  2OPR A;  2G8H A;  2RN2 A;  4O4G A;  2G8U A;  3C6U A;  4F2R A;  3NGZ A;  1JLF A;  4W5O A;  3HT3 A;  4DFP A;  2Y1I A;  1EET A;  3NH0 A;  4BDZ A;  4LSL A;  4FLW A;  3TAF A;  4CJ5 A;  4OLB A;  3K5M A;  4CHN A;  2HHT A;  4CFD A;  4Z0U A;  1J9A A;  2KTQ A;  4HHT A;  1JXE A;  3DMJ A;  3SPY A;  1KVC A;  4CJE A;  3PX0 A;  4H4M A;  2YNH A;  4CGG A;  4BAC A;  1IKV A;  3LPU A;  5HRS A;  2OA8 A;  3AVL A;  3OYB A;  1RTH A;  3HPG A;  1B9D A;  1Q8I A;  4NYN A;  4CF0 A;  3DRR A;  3QIN A;  3QEW A;  1KVB A;  4DQI A;  3O3G A;  2KFN A;  2YNI A;  4EP4 A;  3SYZ A;  2ETJ A;  2RF2 A;  2P51 A;  3VQ7 A;  4QCL A;  2A1R A;  1SKW A;  1RT4 A;  1RT7 A;  1QSL A;  3MXI A;  3VQQ A;  1LW0 A;  3G0Z A;  3LAK A;  3WNG A;  4DQS A;  2VWJ A;  1F21 A;  4ELV A;  3KIO A;  3OYA A;  3K57 A;  3OS1 A;  1I3A A;  4CJU A;  5SWM A;  2KFZ A;  1FKO A;  3M8R A;  4HCB A;  2Z1G A;  4ZHR A;  2AJQ A;  3PO5 A;  4CGJ A;  1BIS A;  3C94 A;  1CZ9 A;  3KLG A;  4PA1 A;  4Z4C A;  4FJG A;  1K6Y A;  4CJR A;  1VSK A;  1S6P A;  4FM0 A;  1TK5 A;  2HND A;  1RIL A;  3U6F A;  4M3Y A;  2KZZ A;  4LSN A;  1VRU A;  4CJV A;  3OY9 A;  2B4J A;  4DQP A;  1ITG A;  4FJN A;  3KK2 A;  4J2D A;  1BL3 A;  4NCB A;  1VSI A;  3F73 A;  3ISN C;  1WAF A;  2DFF A;  2YHB A;  1RDB A;  2IC3 A;  4DSF A;  2GV9 A;  3KLI A;  3NHG A;  4E1N A;  3HP9 A;  4W5T A;  3WNH A;  3ZSO A;  4IBN A;  2YV0 X;  4CEB A;  3SV4 A;  4C8L A;  4HCC A;  1TL1 A;  2FC0 A;  4E89 A;  3K5O A;  4CJ3 A;  4CHQ A;  3VQ5 A;  1KFS A;  4W5R A;  1HYS A;  3AVK A;  4DFK A;  2JGU A;  3EZ5 A;  4E7J A;  1SL0 A;  3RMB A;  2QKK A;  1ZBI A;  2VG7 A;  3OYD A;  4Q5V A;  2YNF A;  3I0S A;  4N76 A;  3D45 A;  4CJT A;  1SL1 A;  4FJ5 A;  4AIL C;  4N47 A;  3SUO A;  1HMV A;  1JLG A;  4BE1 A;  3P83 D;  2D0B A;  4PUO A;  1HQE A;  4OKK A;  1QQC A;  4IG0 A;  3OYI A;  4DTJ A;  4F8R A;  4FZX C;  3RMA A;  1LV5 A;  4CEC A;  3IRX A;  4M41 A;  3E01 A;  3O3F A;  3HPO A;  4FLT A;  4B9M A;  2OZM A;  1C1A A;  1WSE A;  1D8Y A;  2Z1J A;  1KTQ A;  4DTP A;  1DTT A;  4KI4 A;  1L3U A;  3VQ4 A;  3PO4 A;  4FW2 A;  3B6O A;  4GW6 A;  5HP1 A;  1U4B A;  4FJ7 A;  3CM6 A;  5HRR A;  4PY5 A;  2O4I A;  2D0C A;  2HNZ A;  5KGW A;  1WSH A;  4N5S A;  3SI6 A;  3LWL A;  4F2S A;  4E3S A;  3OYF A;  4B8C A;  1KRP A;  4JLH A;  3OYK A;  3ZSW A;  1KLM A;  1LAW A;  2X6N A;  1QE1 A;  1U48 A;  2G8V A;  4ID5 A;  4CIF A;  1DTQ A;  4CK2 A;  4DMN A;  2DY4 A;  4DTO A;  4JS4 A;  3SNN A;  3DYA A;  2G8F A;  3AVC A;  4KTW A;  4KHU A;  2HHU A;  2ZQB A;  4C8O A;  3ZSV A;  4PQU A;  3VQA A;  4M3U A;  3T3F A;  3MEG A;  4DG1 A;  4E7L A;  1D5A A;  2X6S A;  4OKE A;  4FM1 A;  1T7P A;  1R0A A;  1HNI A;  3FFI A;  2ZE2 A;  3VQP A;  3VN5 A;  1EXQ A;  3TI0 A;  1S6Q A;  3NAE A;  3QEI A;  2ITG A;  4E7H A;  4F3O A;  4CCH A;  4OGE A;  3SUQ A;  4B9U A;  5C24 A;  4BWJ A;  4JS5 A;  4BDP A;  3L2R A;  3HVT A;  4B08 A;  3LZJ A;  5E41 A;  3ZSX A;  1ASU A;  2OPQ A;  4O44 A;  3CM5 A;  3OYH A;  3ZT1 A;  2YKM A;  3O4Q A;  3HO1 A;  3S3O A;  1YVU A;  2OZS A;  4DSI A;  2GUI A;  3QO9 A;  2X74 A;  1KLN A;  3KD1 E;  4CGD A;  5CY4 A;  1Z26 A;  1NJW A;  3C6T A;  5C25 A;  4PWD A;  3DI6 A;  3KLF A;  2HHW A;  4FJH A;  2OPP A;  1S1X A;  4FJX A;  1SL2 A;  1LWF A;  2Z1I A;  3OVN A;  4CJK A;  2YKN A;  3JSM A;  3MEE A;  1RBU A;  4OJR A;  3LP1 A;  3ZT0 A;  1EX4 A;  3LAM A;  1WNS A;  4Z4F A;  5FDL A;  4DU1 A;  4DS5 A;  4KHN A;  2IDO A;  4M3X A;  3ZT3 A;  4GVM A;  1KVA A;  1IKY A;  1WN7 A;  4Y1C A;  4UQG A;  3K58 A;  4Z4E A;  3CYM A;  2KQ2 A;  3DLK A;  4XIU A;  4DSE A;  2B5J A;  3HJF A;  4CHY A;  4E7K A;  1BCM A;  1J54 A;  3O4N A;  1BQN A;  3NE6 A;  3NF7 A;  2OPS A;  4CEF A;  4KHW A;  4DTU A;  4MFB A;  3HL8 A;  4I9L A;  5T7B A;  1XWL A;  3OS0 A;  5JS1 A;  3AO5 A;  3ZT4 A;  3OYC A;  3KTQ A;  2F8S A;  1J5O A;  3MED A;  4AHU A;  1JLC A;  3KLE A;  4F3T A;  3V4I A;  3SQ4 A;  4KRE A;  4LY7 A;  3JYT A;  4DTN A;  1QHT A;  4L8R B;  3K5L A;  3ZCM A;  3AVJ A;  1ZBU A;  2KZM A;  1C0U A;  3LP0 A;  3S3M A;  3M8S A;  1SV5 A;  2HB5 A;  3LPT A;  4HVJ A;  3B6P A;  4BDY A;  1L5U A;  1IG9 A;  4Z4G A;  4NCG A;  3U3Y A;  2LSN A;  1JLB A;  4Q0B A;  3SUN A;  5I3U A;  1QSS A;  3QNO A;  1CLQ A;  3QIO A;  3CFP A;  3DM2 A;  4NYF A;  3SQ2 A;  1B92 A;  4B9L A;  1NJZ A;  1O1W A;  1TVR A;  2FBX A;  3AO2 A;  4OKJ A;  1TKZ A;  4OGC A;  4DU3 A;  3L8B A;  1U49 A;  1RDD A;  1S1W A;  1VRT A;  1RT6 A;  3LWM A;  5C42 A;  3SPZ A;  2EX3 A;  3RRG A;  3DLG A;  4FK2 A;  3U3G A;  4I7F A;  3V6D A;  4RW9 A;  4CF1 A;  2HHQ A;  4I9Q A;  4M3R A;  4DS4 A;  1NK0 A;  3PY8 A;  1IH7 A;  1JL1 A;  1D9F A;  3V9Z A;  3I0R A;  5I42 A;  4DTM A;  1CXU A;  3AVA A;  3L2U A;  4DTX A;  4AHR A;  3TAR A;  1T03 A;  1RDA A;  1IO2 A;  1UAX A;  4HTU A;  4DTR A;  3S9H A;  1C1B A;  3ZT2 A;  4BE2 A;  4KTQ A;  5HRP A;  5J1E A;  3OYL A;  3TAP A;  2DFH A;  1L3S A;  4TSX A;  4CFA A;  3OS2 A;  1S9G A;  2YHA A;  3A2F A;  4CJ4 A;  3HPH A;  3M8Q A;  1UA1 A;  4FJJ A;  2D0A A;  1VSL A;  3ASM A;  3CFO A;  3QNN A;  1WSI A;  3AVM A;  4ZTJ A;  4RW6 A;  1BI4 B;  1NOY A;  4KHQ A;  5KTQ A;  1WSF A;  1EKE A;  2IS3 A;  5DK5 A;  2XRI A;  3KK1 A;  3TAB A;  4FXD A;  1FK9 A;  4FYD A;  3QIP A;  1NK6 A;  4DQQ A;  5CYQ A;  3NF9 A;  1Q9Y A;  1I39 A;  4CIG A;  3P1G A;  1SUQ A;  4BE0 A;  1RT2 A;  5KI6 A;  2VG6 A;  4ID1 A;  3RR7 A;  3KKS A;  1VSJ A;  2I5J A;  1NK5 A;  5KRS A;  1NOZ A;  3VQ8 A;  4FJK A;  3IG1 A;  1XC9 A;  1YTU A;  3SJJ A;  2F8T A;  2E6L A;  1G15 A;  4Z4H A;  3TAQ A;  3VA0 A;  4AHV A;  2R7Y A;  3SQ0 A;  4CFB A;  3V9W A;  5CZ1 A;  4E7I A;  1TKT A;  4KB0 A;  1RBS A;  2IGI A;  5K14 A;  4CJQ A;  1KSP A;  2G8I A;  1HRH A;  1C6V A;  3VQB A;  1LW2 A;  2VG5 A;  3OYN A;  5J2P A;  1JLQ A;  1REV A;  4RW4 A;  3TAG A;  5HRO A;  1TAQ A;  4Y1D A;  1JLA A;  2E4L A;  4DLG A;  1U45 A;  4I2P A;  1TKD A;  4CF9 A;  2O4G A;  3NCI A;  3NFA A;  4CEZ A;  3RWU A;  2RKI A;  4CGH A;  4ICL A;  1L3T A;  4H4O A;  1DLO A;  2ZD1 A;  4DQR A;  4JRP A;  4DSL A;  3M8P A;  3CQ8 A;  3PX4 A;  3V1R A;  4DSK A;  4CF2 A;  2W42 A;  1NJY A;  4BWM A;  4O55 A;  4OVL A;  4CJW A;  4M3Z A;  4CFC A;  1N5Y A;  4CEQ A;  2XY5 A;  3TAN A;  4CGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...