3NF6A

Structural basis for a new mechanism of inhibition of hiv integrase identified by fragment screening and structure based design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Integrase
publication title Structural basis for a new mechanism of inhibition of HIV-1 integrase identified by fragment screening and structure-based design
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nf6A00
4F2RA 3V9XA 1LW2A 2XY6A 1SL1A 5DK5A 2ETJA 1SKRA 1RT6A 1TL3A 2HHQA 1RBSA 1MU2A 3G0ZA 4G1QA 4OKKA 5T7BA 4M3ZA 3M8PA 3OVNA 3OYCA 3C6UA 4ID1A 4AHSA 3LWLA 3V81A 3TAPA 4B9SA 5KI6A 3L2QA 4CIFA 4DQSA 3NDKA 3KKRA 1QTMA 4ZTJA 3IAYA 4M3XA 5EU7A 1RNHA 3QIPA 3SQ2A 3VQAA 3F9KA 4CFBA 4CF9A 4DSEA 1LAVA 4FK0A 4FVMA 1J53A 1A5VA 3NE6A 4W5OA 2VG6A 4CEQA 1JLQA 1JLBA 3PX0A 3KD5E 3HP9A 3K5LA 4E7IA 1C0MA 4FLZA 3I8DA 4KRFA 1C1AA 3L3UA 3ZSVA 1JLGA 1L3VA 3B6OA 1VSIA 1NKBA 4Z4FA 3DLHA 4B8AB 1T05A 1W9HA 3AV9A 3IG1A 4FLTA 3RTVA 3HK2A 3SUOA 1NKCA 4F4KA 2ZD1A 3AO2A 3KKSA 3IS9A 2YKMA 4H4MA 1Q9XA 3OYFA 3AVHA 3SQ4A 3TABA 3ZT4A 4DTPA 3T3FA 4Q5VA 4PQUA 3C6TA 4IBNA 1IKVA 1BCOA 1K6YA 3K2PA 2E4LA 1ASUA 1RBUA 5J2PA 5FRMA 4FJXA 1EETA 1JL1A 1LWEA 2NUBA 3OYBA 2VWKA 4TSXA 3U3GA 3VQ5A 5KGWA 4CJSA 4FJJA 4IDKA 2GV9A 4M41A 1GOAA 1D5AA 1ZBLA 3PX6A 1XC9A 3OYDA 2HHVA 1S1VA 4Y1DA 4Z0UA 1UA1A 4IFVA 4O4GA 1KVBA 3AO3A 2FBYA 1EXQA 4KAZA 3ZSYA 1HQEA 2RF2A 4ELVA 4M3WA 4H4OA 4I2PA 1JLEA 3VN5A 2P5GA 1RDBA 2HMIA 2JLEA 3QNOA 3LPUA 3PUFA 4JRQA 3TAGA 1KRPA 4DSKA 4E0DA 1RBRA 2GBZA 3MXMA 1S1WA 3LZJA 4C8MA 4CIGA 1C6VA 2IAJA 4CE9A 5KRTA 4B9TA 4OGCA 2PYLA 5HRSA 2KZMA 4Y1CA 4AILC 1TKZA 3QNNA 4CJPA 1KSPA 4DMNA 3RMDA 2OPSA 1KLNA 3QLHA 1BISA 1IO2A 3BGRA 5HRPA 1T03A 5CYQA 2B5JA 1BI4A 2B6AA 3S3MA 1G15A 4DQPA 4IKFA 4RW4A 3EYZA 2G8FA 3KLFA 1I39A 4AHRA 3HT3A 1ASWA 1SKWA 3MXJA 4KHWA 3O3HA 2XY7A 4KI6A 3OYKA 2ITGA 3WNFA 5J1EA 4NCBA 2HHUA 4BE1A 1D9DA 1ZBFA 3AVKA 4HTUA 4B9UA 3AVCA 2VG5A 3CFPA 3KJVA 4DLGA 4KKOA 3HM9A 4UQGA 3DRPA 4HUFA 3TANA 4DWIA 3WNHA 1XI1A 4OKEA 1CLQA 2G8UA 3DLKA 4B9LA 2F8TA 3K58A 4JS5A 3BDPA 4DFPA 3HPHA 4ELTA 4F8RA 1RT1A 3DOLA 3F73A 2KW4A 3TR8A 1QSYA 1SL0A 3NCIA 4C8KA 1JXEA 4Q0BA 4CEOA 4KB1A 4CCHA 1F21A 4OJRA 2G8KA 1HJRA 1RTDA 4E19A 4FLYA 3NHGA 3V1OA 4JRPA 1TVRA 2QK9A 2HHWA 2FC0A 3OYIA 4CJRA 1RT5A 1XHXA 3NGIA 1T7PA 1RDDA 4LH4A 4K8XA 4GVMA 4CHNA 3OJSA 3K5MA 4E3SA 1U4BA 4FYDA 1KVCA 1Z25A 5JS1A 4KTQA 1Y97A 4CJFA 4W5NA 3LDSA 1VK0A 2BDPA 5C25A 4DF8A 3SPZA 1NK7A 5HBMA 1HYZA 3TAEA 2HVHA 2G8WA 4EZ6A 3NH0A 1CZBA 3U3YA 4DTOA 3O4QA 3LWMA 1WAJA 1JL2A 3V1QA 2E6LA 1NK9A 3VQ7A 3ZSQA 4CJ4A 1LW0A 1WN7A 3TWHA 4AHVA 3NAEA 1RT7A 2X74A 5J2MA 2ZE2A 1REVA 3HPGA 1U49A 3RWUA 3PO5A 1WSIA 5JS2A 4BDPA 4DTSA 4OLAA 3HPOA 1EKEA 1WSGA 2KQ2A 3DMJA 4GW6A 4CHPA 4E1MA 3SYZA 3O3GA 4CK1A 4CJ5A 4FM0A 1CXUA 3HP6A 5I3UA 2HNYA 1ZBIA 2GUIA 2HVIA 1WSFA 2HHXA 1FK9A 4DU1A 3DM2A 4FLWA 4PUOA 4E89A 1O1WA 4BDZA 5HP1A 1QSLA 4BE0A 4KREA 4C8LA 4DQQA 3H08A 3RR7A 4OPJA 3DI6A 3CFRA 3L3VA 3SQ0A 1I3AA 4CJ3A 1ZYQA 1SKSA 1N5YA 2AJQA 4E7JA 4CJWA 1NK0A 2O4GA 4HUEA 2BANA 3S9HA 4DLEA 5C42A 4FJ7A 4O0JA 3QO9A 5J2NA 5HLFA 4L8RB 1QS4A 1FKPA 1S6PA 2IC3A 3ZCMA 2QKBA 4DQIA 3ZSWA 4CHOA 3NF6A 1VSHA 1EX4A 3C94A 4KHYA 3WNGA 4DS5A 4AHTA 3OYLA 1HNVA 4LH5A 4CGFA 1TKXA 1RDAA 2DFFA 4CECA 1HNIA 1SV5A 1X1PA 3O3FA 1J54A 3RRGA 4FJ5A 1RCHA 2OZMA 3VQQA 1TAQA 1Z26A 3ZSOA 4XIUA 1IKYA 1VRTA 3TI0A 4FK2A 4KTZA 3ZT1A 3RMBA 3HJFA 1JLAA 4CGHA 1IH7A 1HMVA 1LAWA 3AA3A 3AVBA 3SUQA 3THVA 4FK4A 4CESA 3AVIA 4IG0A 1CXQA 3V9SA 3SV4A 1B92A 5HRRA 1L3SA 1HQUA 1VSFA 4FJ9A 1TL1A 4CEBA 2XY8A 2VWJA 4OLBA 4PY5A 3G10A 3PO4A 2F8SA 3IRXA 3DLGA 3D0PA 4CK2A 2WONA 4FW2A 4DTXA 4ZHRA 1WSJA 1NK6A 3P5JA 4FJGA 1TKTA 4OVLA 3SNNA 1ASVA 3JSMA 4C8OA 2HNDA 2W42A 2IOCA 5D3GA 3AVAA 2YNGA 2XHBA 4AHUA 1DTQA 1IG9A 4CEZA 3KLGA 3OYGA 2D0CA 4LSLA 3DYAA 4Z4HA 2HW3A 1NKEA 4LD0A 3M8RA 1YTAA 4CEDA 3S3NA 5CY4A 4M3RA 2RPIA 4CJTA 4N76A 1JKHA 1HYVA 3SCXA 3RMAA 3ISNC 4HCCA 4QOZB 2O4IA 2D0BA 4N47A 4CJLA 5CZ1A 3P1GA 4O55A 1BL3A 4F3OA 3RMCA 2ZQBA 4B8CA 4E7KA 4CFAA 3AVLA 1IKXA 1LWCA 3RRHA 4J2EA 3NF8A 3LZIA 3HVRA 4OKJA 4KV8A 4DF4A 4KHUA 3KTQA 3PV8A 1KTQA 1J5OA 3NFAA 1B9DA 3VQ8A 1FKOA 3CQ8A 4F3TA 3KLHA 1S6QA 3K59A 1A5XA 4GMJB 3CFOA 2F96A 3SJJA 2FBVA 4NCAA 2YHAA 4DTNA 4B3OA 1VSJA 3OYHA 4J2BA 2A1RA 3AA5X 4W5RA 3RR8A 3QEXA 4DSLA 1Q8IA 2P5OA 3LALA 2X6NA 2G8HA 2XO7A 4Z4EA 1GOBA 2I5JA 2LSNA 4LY7A 3VQCA 1BIZA 3HL8A 3K57A 4DS4A 3ULDA 3QEPA 1UA0A 1BQMA 2RKIA 3MXIA 1JLCA 2KTQA 1DLOA 4Z4CA 4DTRA 3KD1E 1BIUA 3QINA 1WSHA 1S9EA 4W5TA 3SZ2A 1HYSA 3OYNA 5HRNA 1RT4A 1NK8A 1NOYA 3AVMA 3V1RA 5KRSA 3L2VA 1HRHA 3SI6A 1U47A 4B9NA 3AO1A 1S1UA 4N5SA 3MEGA 3VA3A 3OY9A 3B6PA 3VQEA 4I2QA 3VQBA 4CEFA 4CERA 4DTJA 3VQ6A 3ALYA 4W5QA 2PYJA 4CHQA 1TK0A 1YT3A 4FZZA 4FJIA 4AH9A 4QCLA 1ITGA 3L2UA 5FDLA 2KFZA 1S9GA 5J2QA 1KCFA 3SV3A 3M8SA 3SUNA 2FBTA 1RBVA 4ZTFA 4M3TA 3TARA 4E7LA 1XHZA 1UOCA 3L2RA 1YTUA 3HYFA 2OPPA 1C0TA 2BE2A 3AA4A 4FM2A 3DLRA 2IGIA 4ELUA 3ZT3A 3AVFA 4CF1A 4K8ZA 3VQDA 4DG1A 3OYEA 4NYNA 2D0AA 2OPRA 3QEVA 3MEDA 4QAGA 1FXXA 2OPQA 3TAMA 3U6FA 1CZ9A 1KLMA 1JXBA 1IKWA 1S5JA 4CF2A 4CHYA 5DMRA 4CF8A 4KPYA 3NGZA 2OYQA 2G8IA 4DU3A 5I42A 3QEIA 4B9MA 4IFYA 2PY5A 4F2SA 3QETA 4O0IA 3LAMA 4RG8A 4JS4A 4IG3A 4O5BA 3MAQA 1D8YA 1QQCA 3MEEA 3T1AA 3V9UA 2P51A 2Y1JA 3OYMA 1X9SA 2IS3A 4FJMA 3DLEA 3S3OA 1A5WA 3DRRA 4CK3A 3KK3A 1X9WA 3DOKA 4E1NA 4KHNA 3JYTA 2HHTA 3ASMA 2Z1HA 3AVJA 1Q9YA 3WNEA 4B08A 3NH1A 3QEWA 3VQ9A 3LP2A 2X78A 2DY4A 3FFIA 3OS1A 4FLVA 1NJYA 4BDYA 3K5NA 3L8BA 2KFNA 3OJUA 5K14A 4M42A 5E41A 1L3UA 1NK5A 3OS2A 3PY8A 3E01A 3HSTB 3ZT0A 1QE1A 2D5RA 4NYFA 4FJHA 3V4IA 2WOMA 4YNQA 3NH2A 3LAKA 4HVJA 3SQ1A 3ZSXA 1W0HA 2Z1GA 1EP4A 1QHTA 3DRSA 1SUQA 1KFDA 4O44A 3HVTA 4CJUA 2XY5A 1NJZA 4HCBA 3NGYA 1TK8A 3LP3A 1WLJA 4I9LA 4LSNA 3KLEA 3NF7A 3K5OA 3AA2A 1XWLA 4C8NA 3ITHA 5KTQA 1N6QA 3NF9A 1VSEA 4Z4IA 4CJEA 1VRUA 3AO4A 2YV0X 3CG7A 1ZBUA 3VQPA 3EY1A 3OYJA 1D9FA 2OA8A 4FJ8A 1X9MA 1TAUA 5CYMA 4ID5A 4EP5A 1HPZA 4RW6A 4CIEA 1C1CA 2KZZA 1DTTA 4R5PA 3CM6A 4DU4A 3VA0A 3L2WA 1T8EA 1KVAA 3C95A 2X6SA 2OZSA 1J9AA 1C0UA 2E6MA 2Q3SA 3LANA 3QIOA 4I7FA 4RW8A 3ZT2A 1WAFA 2YKNA 2EX3A 3CM5A 4KFBA 4RW7A 4CEEA 4MQ3A 3M8QA 1BGXT 3LP0A 4EP4A 2Y1IA 5KGXA 2BGGA 1S1XA 3D45A 4RW9A 4CJVA 3I0SA 3SUPA 4BACA 5FROA 1B9FA 1WSEA 4KO0A 2EHGA 1RTIA 4FCYA 4CFDA 4BWJA 1ZBHA 4EZ9A 2QKKA 3NBPA 4DSJA 2P1JA 4N41A 1WNSA 3P83D 4FZYA 3VQ4A 1TV6A 1RBTA 4NCGA 1YVUA 4CGIA 1NK4A 1U48A 1L5UA 4DSIA 5FRNA 4HHTA 4ICLA 2YNFA 1VSKA 2HHSA 4KHQA 4CFCA 4FJKA 4KTWA 2RN2A 1RILA 4BWMA 3EZ5A 5HROA 1TKDA 1RT3A 4CGJA 4CGGA 4CEAA 4M3UA 3CYMA 4DSFA 3AVGA 2R7YA 4DFMA 3DLBA 4KHSA 1RTJA 4M3YA 4FW1A 3QESA 1L3TA 1BQNA 2FBXA 3QERA 2JGUA 4DFKA 2DTUA 4MFBA 2HB5A 5CZ2A 1RDCA 3LP1A 3OS0A 4HUGA 1LV5A 4DQRA 4DTUA 2QXFA 3O4NA 2IDOA 4N56A 4CJKA 4FJLA 3ZSZA 4FLUA 4B9VA 4J2DA 1NJWA 1BHLA 1JLFA 1U04A 2HNZA 3KIOA 2PZSA 1UAXA 1S1TA 4AHCA 1U45A 4J2AA 1NJXA 1RT2A 4I9QA 2Z1JA 4FZXC 4CJQA 2YHBA 4KB0A 1TGOA 5SWMA 4PA1A 3KK2A 3HO1A 4OPKA 1C1BA 2YNHA 4OGEA 4FM1A 2ATQA 1VSLA 4CGDA 2G8VA 1GOCA 3KLIA 1R0AA 1BI4B 2DFEA 2XRIA 3MECA 4DTMA 3AO5A 3TAQA 3V6DA 1SL2A 4FJNA 4PWDA 2A1SA 3A2FA 3I0RA 4BE2A 1UWBA 4KI4A 3KK1A 5SZTA 2B4JA 1RTHA 5C24A 4WE1A 3UIQA 1TK5A 4DFJA 1VSDA 4H8KA 2Z1IA 1NOZA 2YNIA 3V9ZA 4FLXA 2DFHA 4Z4GA 3PX4A 4CF0A 3SPYA 4M45A 4CHZA 4JLHA 2VG7A 4YFUA 3OYAA 3V9WA 1LWFA 1QSSA 1VSMA 3LPTA 3HXMA 3T19A 1BCMA 4E7HA 4FXDA 3TAFA 3ZSRA 3AVNA 1KFSA
chains in the Genus database with same CATH superfamily
1SL1A 5DK5A 3RSEA 1RT6A 1IJJA 3GE1A 2QWRA 3R8EA 1YJWN 3OYCA 3V81A 5KQDA 3L2QA 4CIFA 4DQSA 2W6KA 3U9DA 3NDKA 5CHIA 1RNHA 3QIPA 3L4IA 2HBJA 1LAVA 4FK0A 4FVMA 3NE6A 4W5OA 4CEQA 1JLQA 1JLBA 2IVOA 3HP9A 4E7IA 4FLZA 1C1AA 4H0PA 1L3VA 3DXMA 1NKBA 4DV4K 3DLHA 4A59A 4B8AB 3AV9A 3IG1A 3SUOA 3KKSA 3OA9A 4H4MA 3OYFA 3AVHA 3SQ4A 4BRMA 4Q5VA 4PQUA 3C6TA 4IBNA 3GOIA 1IKVA 3K2PA 5FRMA 1EETA 2NUBA 3VQ5A 4FJJA 2VQEK 4M41A 5ADXA 5AQRA 1ZBLA 3OYDA 2HHVA 4Z0UA 1JCEA 4EHTA 4YOTA 2RF2A 1RDBA 2HMIA 3LDNA 4BGAA 2I7NA 4JRQA 3F9MA 4QS7A 2GBZA 3BF1A 3MXMA 1IBLK 1S1WA 4YORA 5AQWA 4CIGA 1C6VA 2BTFA 2IAJA 2YHYA 4EAHD 1KSPA 2GWJA 1YUWA 1TYQA 4FOEA 2B5JA 3S3MA 3R1XA 3LDPA 2UUCK 2E2PA 4YOYA 4BRCA 2G8FA 3KLFA 3D7EO 1SKWA 3MXJA 2XY7A 3OYKA 3CCUN 5AZJA 5EX5A 3G71N 5J1EA 4NCBA 1KAYA 1ZBFA 4B9UA 3AVCA 4UQGA 1XI1A 4FWQA 2UU9K 3BDPA 4MO5A 3CI5A 1VAZA 3HPHA 1VQ5N 5HL7L 3DOLA 1NGIA 1QSYA 1SL0A 1JXEA 4CCHA 4JI1K 1T6DA 3BF3A 1HJRA 1MWMA 4CZHA 1WB9A 1K8KA 1NGDA 2HHWA 1RT5A 1XHXA 1T7PA 1RDDA 2VQFK 4CVNE 2CGLA 1BWFO 3K5MA 3CERA 1KVCA 3E1YA 4NB4A 4W5NA 1VK0A 2BDPA 1U6ZA 4GY2B 1HYZA 2HVHA 1E4GT 1IG8A 1GLAG 3CJ1A 1BU6O 1WAJA 1JL2A 5JVGL 3MWPA 1NK9A 5AR0A 5AQFA 3ULEA 3OTOK 1WN7A 2UXBK 2ZE2A 3ENHA 4DR5K 3G25A 3UB5A 4XH1A 3DMJA 1NMDA 4E1MA 2CH6A 2RHKA 5C0YA 3O3GA 5EY4A 3P31A 1WSFA 1NGCA 1KD1O 3CF5L 3KK7A 4PUOA 4BDZA 5HP1A 3F5TA 3RR7A 2AJQA 4IWVA 4HUEA 3S9HA 1X9JA 4DR4K 5J2NA 1D4XA 1QS4A 2IC3A 3IDHA 1N8RO 5FPDA 2QKBA 3ZSWA 5F2RA 4KHYA 3WNGA 4JI8K 1HUXA 5AQKA 4LH5A 4NLBA 1TKXA 4CGFA 1HNIA 1SV5A 1YJNN 3RRGA 4FJ5A 4XIUA 3CJ9A 4KTZA 2NZTA 4IJAA 3UKRB 3RMBA 4CGHA 3ZEUB 1LAWA 2A6AA 3ATUA 4CESA 3AVIA 4IG0A 1TL1A 2XY8A 4CZFA 5C10A 3G10A 2F8SA 5CR4A 3LDQA 2WONA 3WXLA 4IO9L 3NVMA 2W42A 3AVAA 3DXKB 4NXNK 5E84A 4JI3K 3OYGA 4LSLA 4UY8O 4FWKA 1K9MO 2HW3A 4A2BA 4CEDA 3S3NA 5CY4A 1N34K 4FL9A 2O4IA 4JI0K 5CZ1A 4H03B 4O55A 1BL3A 4B1WB 3CCEN 4CFAA 1IKXA 1LWCA 3NF8A 3LZIA 3HVRA 3B8AX 4DF4A 3A5MC 1VQMN 3O9QA 3WXKA 3CQ8A 3KLHA 3IKMA 3NMUA 2F96A 3SJJA 2FBVA 3DJCA 4DTNA 3DLLL 1VSJA 3L0QA 3MCPA 4DSLA 4DV1K 2XO7A 2ZJPL 4JAXA 5AQSA 4Z4EA 4DS4A 1XQSC 3MXIA 4DTRA 3QINA 3BEXA 1S9EA 3VGKA 3E9OA 5KRSA 4B3MK 4N5SA 3B6PA 3VQEA 4CEFA 5M1FA 3ALYA 2P9IB 2PYJA 1TK0A 1ITGA 5FDLA 2Q31A 3C65A 1KCFA 3SUNA 1RBVA 2NNWA 4E7LA 5LJWA 3L2RA 1YTUA 1C0TA 5M1KA 3AA4A 1HR0K 4FM2A 2VGMA 1Z05A 3AVFA 4CF1A 3VQDA 3QEVA 3W0LA 1EO1A 3QMLA 3TAMA 3SAHA 1I94K 2CGKA 1JXBA 1S5JA 4CF2A 5BPMA 4CHYA 5DMRA 4CF8A 2GELA 1BA1A 1KXPA 2G8IA 3QEIA 1HNZK 1OH7A 3N4QA 4F2SA 4YOXA 3CCVN 4IG3A 1D8YA 1QQCA 3MEEA 3T1AA 1X9SA 4FJMA 3S3OA 2NRVA 3C7NB 1X9WA 3JYTA 3ASMA 1Q9YA 2PFUA 2QTDA 3VQ9A 4YDUC 3OS1A 4BDYA 4JKHA 1C0GA 1SQKA 1ESVA 1QE1A 4BY9C 2ZGZA 3D6RA 1BG3A 4FJHA 1WOQA 5BRHA 4KHPK 1MA9B 3VOVA 4EFHA 3NH2A 3LAKA 1EP4A 3S41A 3CJ7A 1QVFM 4HCBA 3HVTA 4CJUA 2XY5A 1NJZA 4JV5K 1NG9A 1WLJA 4I9LA 1FW6A 3KLEA 3NF7A 1N6QA 5AQOA 3ITHA 3NF9A 4K41A 3CG7A 3EY1A 3VEOA 3OYJA 2CH5A 5CYMA 1U2VB 4L3QA 1HPZA 2BH1A 4CIEA 3LDOA 1DTTA 1KVAA 3C95A 1J9AA 2E6MA 2JWKA 4YDUA 2YKNA 4RW7A 4CI6A 2NRZA 4WQ4C 3M8QA 2V52B 3THXA 5ADXH 2WC9A 2BGGA 3D45A 3I0SA 5JVHL 1ZBHA 3CCLN 3H3OB 4FZYA 3O1BA 1U48A 1RBTA 4DSIA 1L5UA 3J7AP 1VSKA 2YHXA 4FJKA 4KTWA 2RN2A 4M3UA 3CYMA 3DLBA 4KHSA 1RTJA 4FW1A 2FBXA 2VCPA 3VTHA 2P9NB 2DTUA 5CZ2A 3EE8A 3SBGA 4HUGA 2IDOA 4WQ4A 4CJKA 4B9VA 1T6CA 4PKHA 3J7YP 2FSKA 1RT2A 2Z1JA 4FZXC 3KK2A 3HOSA 3MDQA 3VGMA 2YNHA 4FM1A 1NGFA 1VSLA 4CGDA 1GOCA 5AQHA 3KVGA 3CPWM 3MECA 1E4FT 1ATRA 3V6DA 1SL2A 2A1SA 3LM2A 4IFEA 4DR3K 1TK5A 4K25A 2YNIA 3V9ZA 4Z4GA 2DFHA 3PX4A 4CF0A 3SPYA 3ZETB 4M45A 4CHZA 2VG7A 5AQZA 1VSMA 3O5BA 1BCMA 3E9PA 4AHSA 1KFSA 4F2RA 3V9XA 3CQYA 2XY6A 2ETJA 1SKRA 3AGKA 1MU2A 4G1QA 3BZKA 3THYA 4FWNA 3M8PA 4BREA 3TAPA 4ZTJA 3J81O 3GDQA 5BRFA 2KKZA 1J53A 1A5VA 4AQYK 2F7TA 4JKAA 3CCSN 1SAZA 3L3UA 3ZSVA 1QQMA 1JLGA 2E1YA 1X3NA 4FLTA 3AO2A 3FZFA 2P9UB 3TABA 4IOAL 4IZ9A 1BCOA 1K6YA 2E4LA 1RBUA 1W2BM 4FJXA 3OYBA 2VWKA 5KGWA 1ZBSA 4DV5K 1GOAA 4Z94A 1D5AA 5GAGP 1UA1A 4IFVA 4O4GA 4X62K 3ZSYA 4GV6A 3VN5A 2JLEA 3QNOA 3LPUA 3PUFA 3TAGA 3D2EA 3VF6A 4DR7K 1S3XA 1YXQA 4OGCA 2ZGYA 4Y1CA 4AILC 1YHQN 4CJPA 3CJCA 5MLCQ 1KLNA 3M1FA 3BGRA 5HRPA 4B3TK 3NVKA 4O8KA 2B6AA 4IKFA 3WEEA 1NMNA 4RW4A 3KWIA 3CIPA 1BO5O 1ASWA 4KHWA 1GLJO 4KI6A 2ITGA 3VGLA 3CETA 2VG5A 3I55N 2YHWA 2HOEA 3DRPA 3DLKA 4B9LA 3K58A 2HMPA 5H1SQ 3RVCA 3THWB 1O13A 3NCIA 4C8KA 3GL1A 2KHOA 1IV0A 5ELZA 4JRPA 1YITN 4MLHA 3NGIA 4WQ5C 3QBXA 4H5NA 4LH4A 4GVMA 4E3SA 1HPMA 1Z25A 5JS1A 3FE1A 4DUYK 5C25A 2QEXN 1NK7A 5AZIA 4CJ7A 1CZBA 3U3YA 3O4QA 3LWMA 2V51B 4K43A 3ZSQA 4H0XB 1LW0A 3VEXA 5J2MA 3NAEA 2QWLA 1REVA 3HPGA 5JLHA 1S22A 3PO5A 1WSGA 4CHPA 2D0OA 1ZBIA 3CC4N 2HVIA 4BRPA 2F4VK 2ZWHA 5IWAK 4KREA 4ISGA 4XEIA 4LFCK 4BE0A 2O8DB 4WQ5A 2P9PB 4OPJA 3CFRA 3SQ0A 4OX9K 1I3AA 4E7JA 4CJWA 2O4GA 2BANA 4DLEA 5C42A 5HLFA 3ZYYX 1VSHA 3F2KA 2GTDA 4DS5A 4J8FA 3OYLA 1XMOK 5BR9A 1X1PA 1KQSM 2W41A 3P4IA 4FK2A 3ZSOA 1VRTA 1R59O 3ZT1A 4WCEL 3U8XA 4FK4A 1CXQA 3V9SA 3SV4A 1B92A 1L3SA 1VSFA 2VWJA 3JS6A 3Q7BA 3HM8A 4BRHA 1LCUA 2D4WA 3D0PA 1Q86O 4DTXA 1WSJA 3P5JA 1TKTA 3FR0A 4C8OA 4JHDB 3IUCA 1DTQA 4CEZA 3M8RA 3K9JA 4IOXA 2RPIA 4N76A 3SCXA 4HCCA 4BVPA 2D0BA 4CJLA 4A62A 1NGHA 2ZQBA 4B8CA 3U9ZA 2P9KB 4H5WA 4J2EA 4OKJA 4KV8A 2O8BB 3KTQA 3P38A 3WQUA 3EEQA 3IFRA 3W3DA 3NFAA 3VQ8A 4I6MB 1BOTO 4F3TA 4FVUA 2ZJRL 5BPLA 1S6QA 3H6EA 3K59A 3CFOA 4BRKA 2QM1A 2O8CB 4B3OA 4JYAK 1KC8O 2Q0UA 5FPNA 2A1RA 4W5RA 3QEXA 4B1VA 1IBMK 3LL3A 1GOBA 2LSNA 4LY7A 5C12A 3VQCA 3ULDA 2RKIA 3D2FB 2YJEA 3KD1E 1BIUA 1WSHA 1RT4A 4KH4A 2F9TA 3AVMA 3SI6A 4B9NA 3AO1A 3QBWA 3ENBA 4BRFA 3OY9A 4DTJA 3VQBA 4R79A 2IIRA 4YOWA 2O8EA 4CHQA 1YT3A 3MK6A 4FJIA 4AH9A 2QWNA 4ISEA 1S9GA 3SV3A 3AAPA 4ZTFA 4X65K 3HYFA 4O5FA 1QQNA 3CD6N 3EN9A 4LC9B 2IGIA 5AQJA 4ELUA 2E1ZA 3OYEA 4DG1A 2OPRA 3MEDA 4QAGA 2P9LB 1KLMA 4KPYA 4JD2B 5LJVA 2FXUA 2ZJQL 1EQYA 1LOTB 4B9MA 4FWLA 5LL6Z 2QA4N 4O0IA 4JS4A 3VEWA 2UYTA 1NBWA 3DOKA 4E1NA 4KHNA 4B1UB 5AQPA 3UE5A 4IOCL 1NU0A 3NH1A 2O8FB 2DY4A 3FFIA 4FLVA 3K5NA 2P9SA 4GKJK 4JI6K 4JKGA 4B1ZA 1L3UA 3ZT0A 3OBYA 4NYFA 4FO0A 4EIAA 2Q97A 5A2QO 4CBXA 4HVJA 3ZSXA 1W0HA 1K73O 1QHTA 3T1YK 2J4RA 4LF6K 3CJAA 1KFDA 4AM7A 2FLOA 5GIPA 2QW9A 3LP3A 3RSEB 2YI1A 4YOUA 4C8NA 1NLVA 1VSEA 3AO4A 2YV0X 4FJ8A 1D9FA 4X64K 3T7ZA 1YVNA 2KZZA 1Q81O 4DR6K 2E2QA 3CM6A 4FWPA 4DU4A 1T8EA 2OZSA 2X6SA 1C0UA 3LANA 3QIOA 4I7FA 3ZT2A 1N36K 1WAFA 3CM5A 4CEEA 2AA4A 4MQ3A 4JI4K 1IBKK 4LF9K 3PSIA 1BGXT 1GLDG 3DXMB 3CQXA 2NRXA 3CJBA 4RTFD 2JWLA 4FCYA 1OH6A 4DSJA 3DWLA 5LY3A 4WFNL 4RWTA 4H0OA 4KHQA 4LFBK 4CFCA 2A41A 1TKDA 4CGJA 4CEAA 2R7YA 1BQNA 3QERA 4FWSA 1ZC6A 4KH5A 5EOYA 3O4NA 3P39A 4N56A 1E3MA 4FJLA 4FLUA 1U04A 1JLFA 2HNZA 3O9TA 1S1TA 4HWIA 3CCMN 4J2AA 1W97L 2YHBA 1ATNA 4C1NI 3U4LA 4CD1A 4LFAK 4BG9A 4OGEA 2ATQA 1TYQB 3KLIA 3TSQA 1R0AA 4PWDA 3A2FA 1KAXA 3PIOL 5AZJB 3KK1A 2Q36A 3C6AA 1Q7YO 2W6LA 3V9WA 1VQON 1LWFA 3LPTA 3HXMA 4FXDA 3AVNA 4JKDA 3G4SN 5EXWA 3A5OC 1TL3A 5DM7L 1RBSA 1YAGA 5T7BA 4JK9A 3OVNA 4ID1A 4B9SA 5KI6A 4M63C 3ZX3A 3H46O 1K8KB 3IAYA 4M3XA 3SQ2A 3F9KA 4CF9A 3KWGA 3AY9A 2VG6A 3K5LA 3VEZA 1VSIA 4EHUA 1T05A 1W9HA 1NKCA 2ZD1A 3IS9A 4B1YB 4YHHK 2WFBA 3ULEB 3UKUA 3ZT4A 3T3FA 1CZAN 5J2PA 5LMNK 2HF3A 1ASUA 2V7ZA 1JL1A 4TSXA 1VQKN 2YCHA 2A3ZA 3PX6A 5BRDA 1S1VA 4Y1DA 2UXDK 3C6HA 1VQNN 1EXQA 4M3WA 4ELVA 4H4OA 1JLEA 3EKSA 4PKIA 4DSKA 1KRPA 4E0DA 4C8MA 3EKUA 4OPAA 4CE9A 5HRSA 1WBDA 2VWBA 2OPSA 3JXUA 1BISA 1IO2A 1T03A 5AJ3K 4JKEA 1BI4A 4DQPA 1I39A 3HT3A 3AGRA 3O3HA 3MN9A 2HBLA 1P8ZA 3WNFA 4LF7K 2HHUA 3M6GA 4C23A 5GINA 3CFPA 4BC5A 4DLGA 3K9KA 4OPHA 3TANA 4DWIA 3WNHA 3K0SA 4OKEA 1CLQA 2G8UA 2FF3B 3CCQN 4DFPA 1VQ9N 2Q0RA 2QWQA 5AQYA 3CXCM 2KW4A 3MN6A 4Q0BA 4CEOA 4KB1A 3PLAA 2OTJN 4IDHA 1QZ5A 4BR9A 4DB3A 2G8KA 1DT9A 4E19A 3V1OA 1TVRA 2E88A 4CBUA 2QK9A 2FC0A 3TSPA 4CJRA 3ID6A 1VQPN 3LM9A 3QFUA 4PKGA 4K8XA 3HTVA 3TTCA 4FYDA 4H0TB 1Y97A 4CJFA 3LDSA 3EO3A 4DF8A 3SPZA 4LF8K 5GAEP 3TAEA 1XNQK 2G8WA 4EZ6A 3ENOA 4DTOA 3V1QA 3H3NO 4JK8A 4CJ4A 4AHVA 1RT7A 5BN8A 1U49A 4FWMA 5FPEA 4OLAA 3HPOA 3SYZA 5I3UA 4CJ5A 1CXUA 3HP6A 4CBWA 2GUIA 4DV7K 2HHXA 3DM2A 4E89A 1O1WA 1QSLA 3WUHA 5IT9O 4C8LA 5AQXA 3H08A 1DEJA 3A0IX 2QWOA 4CJ3A 1ZYQA 4FJ7A 4BROA 2YX6A 4BR2A 4L8RB 3VPZA 1S6PA 3TSUA 4CW7B 4BGBA 3O6WA 4IEEA 5E26A 4AHTA 1HNVA 3I33A 1RDAA 4CECA 1TAQA 1Z26A 4IJNA 2D1KA 1YI2N 4K0KK 4GNIA 1JLAA 1IH7A 1HMVA 3AA3A 3AVBA 3SUQA 2NRTA 5M1OA 4DR2K 5HRRA 1HQUA 4QS8A 4CEBA 4OLBA 2E2NA 3IRXA 3R6MA 4FW2A 4ZHRA 1NK6A 1GLCG 3J80O 3SNNA 3JSMA 5AQIA 3VEVA 2IOCA 1RGIA 2YNGA 2XHBA 1IG9A 3KLGA 2D0CA 3DYAA 1NKEA 4LD0A 1YTAA 1T44A 4M3RA 4CJTA 1JKHA 1HYVA 5TKWA 4XH4A 2QXLA 3ISNC 3J7ZO 4QOZB 2IVPA 1SS6A 4F3OA 4MDAA 3RMCA 2RE2A 3WXIA 4E7KA 2E5LK 4LF4K 1RDWX 3VERA 1B9DA 3CC2N 3FZKA 3SBTA 4FPBA 1FKOA 5CE3A 1A5XA 1V4SA 4GMJB 3ZX2A 2YHAA 4Y0WA 3RR8A 2P5OA 3WQTA 3LALA 2X6NA 2G8HA 5EVZA 5LMUK 5KQ8A 3K57A 3HL8A 3QEPA 4JI5K 1UA0A 1BQMA 3SJHA 1JLCA 2KTQA 4Z4CA 1EWRA 3SZ2A 1HYSA 1OVQA 3OYNA 1KAZA 5HRNA 3V1RA 3L2VA 5HOOA 1U47A 3THXB 1S1UA 3H1QA 3MEGA 4FWRA 3VA3A 4CERA 3VQ6A 4W5QA 1HLUA 3FFKB 3E9LA 3T69A 2KFZA 1J6ZA 1QHAA 3M8SA 3O80A 1VQ4N 4M3TA 1VQ8N 4C1NK 3UKRA 1UOCA 1XHZA 1VQ7N 3ZEUA 4BR4A 3L6QA 2D0AA 3VF4A 5F1XA 1FXXA 3PSFA 5I9EB 1CZ9A 4MO4A 4GKKK 2GWKA 3HBTA 1NNEA 1OH8A 4DU3A 5DM6L 3DXKA 5KPZA 2Q2RA 4IFYA 2PY5A 3FZLA 4RG8A 2V7YA 2Y1JA 2P51A 4CZEA 4DCHA 3DRRA 3KK3A 3BP8A 2Z1HA 3AVJA 3WNEA 3O9RA 2X78A 1QQOA 4DV3K 4CZMA 4CZGA 1NJYA 4PL8A 2KFNA 3OJUA 5K14A 2VYPA 3HRGA 5AFUA 4M42A 1NK5A 3OS2A 3PY8A 2BUPA 3E01A 3HSTB 2D5RA 3VETA 2WOMA 5AQNA 3I8BA 2EWSA 4X66K 1K8AO 4DV6K 1SUQA 4O44A 2A42A 3NGYA 1TK8A 3O9UA 4LSNA 3K5OA 3AA2A 1XWLA 5KTQA 3THYB 3BY5A 2F9WA 1VRUA 3ATVA 2OA8A 1X9MA 3TU5A 1DKGD 4RW6A 1C1CA 4BR5A 3L2WA 4B3RK 4RW8A 4KFBA 1N32K 1QVGM 4FPAA 3C0BA 3MX5A 3LP0A 4EP4A 3QICA 3BUZB 3EZWA 1S1XA 4CJVA 3EL2A 3SUPA 2DPNA 3CHWA 1B9FA 1WSEA 1RTIA 2EHGA 4CFDA 2P9IA 4BWJA 4EZ9A 2QKKA 3NBPA 2P1JA 1WNSA 2UXCK 4AF1A 3P83D 1TV6A 1YVUA 3TPQA 1G99A 3CCJN 5AQUA 2YNFA 3VMFB 3EZ5A 2VGNA 1RT3A 4DFMA 3AVGA 2JGUA 4DFKA 1GLEG 2GUPA 2HB5A 1RDCA 3GBTA 3LP1A 2E20A 4DQRA 1HKGA 2QXFA 4CZLA 3D2EB 4J2DA 1NJWA 1BHLA 4CZKA 3KIOA 3BZCA 4I9QA 1XNRK 1TGOA 4PA1A 3HO1A 5AQVA 4OPKA 5BN9A 3FZMA 3MWTA 4BRDA 3C7NA 3GG4A 1NGJA 2ASPA 4DTMA 2XRIA 3AAQA 3TAQA 3WEEB 4FJNA 3CMAN 3I0RA 4BE2A 1BUPA 3WXMB 5B8HA 4KI4A 5SZTA 2B4JA 4H5RA 1RTHA 5C24A 4WE1A 1MDUB 3UIQA 4DFJA 1YF5L 1VSDA 2A40A 1VHXA 4H8KA 2Z1IA 1TUYA 4FLXA 3LDLA 3MN7A 4JLHA 4BVOA 4YFUA 3OYAA 3IMXA 1QZ6A 1T3VA 3T19A 4E7HA 4GV3A 1H1VA 3ZSRA 4HTUA 1LW2A 3O8MA 5C15A 5KPRA 2HHQA 3G0ZA 4M3ZA 4OKKA 3C6UA 3LWLA 2UUBK 1OKJA 1NGEA 3CPEA 1U2VA 5JLFA 3KKRA 1QTMA 5EU7A 3VQAA 4CFBA 4DSEA 3E66A 2HBKA 3R9PA 2WTUA 3SAGA 3PX0A 3KD5E 4H5TA 1C0MA 4FWOA 3I8DA 4KRFA 3B6OA 4XH5A 3J8AA 5AZIB 4Z4FA 4CZJA 3RTVA 3HK2A 5TKYA 4F4KA 4YY3K 1N33K 2YKMA 4A57A 1Q9XA 1NGAA 5KPTA 4BRAA 4DTPA 4ILHA 2E8AA 4BRQA 5C2FA 1LWEA 3U3GA 4M7XA 1HJOA 4CJSA 4IDKA 2GV9A 3SMSA 3T1HK 1XC9A 3OW2M 2P9NA 1KVBA 3AO3A 3MCAB 2FBYA 3A5LC 4KAZA 1HQEA 4I2PA 2P5GA 5FPMA 5M1QA 1RBRA 3FZHA 1J5EK 4BR0A 3LZJA 1HNXK 2NLXA 5KRTA 4B9TA 2PYLA 3ZX0A 2KZMA 3QNNA 1TKZA 2I7PA 1C0FA 4DMNA 3VEYA 3RMDA 1DGKN 3QLHA 4U67L 2HHHK 2CGJA 5CYQA 2YJFA 1G15A 4WFAL 5F0XA 3EYZA 4WYBA 4AHRA 2QI2A 3SMPA 3A8YA 5AQLA 1NGGA 1JCGA 1XUPO 4NXMK 4A2AA 4BE1A 1D9DA 3AVKA 2ZF5O 3VTIA 4LF5K 3KJVA 4KKOA 3HM9A 4A5BA 4K42A 4HUFA 3ZETA 5GADP 3VESA 2F8TA 4JS5A 4ELTA 3TTDA 4F8RA 1RT1A 3F73A 3TR8A 2D0PA 4AM6A 4M7YA 1F21A 4OJRA 2HF4A 1RTDA 2QWPA 4FLYA 3NHGA 3OYIA 3KHYA 1ATSA 4CHNA 3OJSA 1U4BA 5BR8K 4BC4A 4KTQA 3I56N 4MLEA 4BQZA 3AARA 3H1VX 5HBMA 5JICA 3Q7CA 4JI7K 3NH0A 2WBNA 4NLCA 2E6LA 4GVEA 1JCFA 2P9UA 3VQ7A 3TWHA 2X74A 4YOVA 3RWUA 1WSIA 5JS2A 4BDPA 4DTSA 1EKEA 2KQ2A 4GW6A 4JKCA 3VA0A 1RDUA 4CK1A 4JN4A 3OHRA 4FM0A 4KH6A 2HNYA 5BREA 1FJGK 3N4PA 4MDBA 1FK9A 2QWMA 4DU1A 4FLWA 4DQQA 3DI6A 1M90O 3L3VA 4PHTX 1SKSA 1N5YA 1NK0A 4JK7A 1VQ6N 1XC3A 4O0JA 1Q18A 3QO9A 1Y64A 1FKPA 3ZCMA 2ZM6K 4DQIA 4CHOA 3NF6A 1EX4A 3C94A 4DKWA 4DHYA 1JJ2M 2O8EB 3QB0A 2DFFA 1HKCA 3O3FA 1J54A 1RCHA 2OZMA 3VQQA 1IKYA 3TI0A 4JNEA 1GLBG 1NGBA 4JKBA 1Q82O 3HJFA 2FSNA 3A5NC 3THVA 4BRGA 3EE9A 1SZ2A 4FJ9A 4PY5A 3CC7N 3PO4A 3WT0A 4IEIA 3DLGA 4CK2A 5GAHP 3THWA 4DV2K 1YJ9N 1P90A 4FJGA 2ITMA 3DAWA 4OVLA 1ASVA 2NRWA 2HNDA 5D3GA 2AP1A 4AHUA 1VQLN 5AFUH 4BRNA 3TTFA 4Z4HA 3JAMO 3OBWA 4A5AA 3RMAA 1ZXOA 4IO8A 2NRRA 3ID8A 4N47A 3P1GA 3O4WA 1XMQK 2W40A 3AVLA 3RRHA 1NJIO 1X3MA 2P9SB 4KHUA 4JKGB 1KTQA 2HBMA 3O1WA 3PV8A 1J5OA 1V4TA 4WF9L 3HSCA 4WFBL 4NCAA 4JEPA 3OYHA 4J2BA 3AA5X 4FOIA 1Q8IA 2O8DA 1M1KO 4BC3A 2P9PA 2HSTA 4DUZK 2I5JA 1Z6RA 1BIZA 3WXJA 1DLOA 4W5TA 2IVNA 4BRIA 3M5RA 1NK8A 1NOYA 1HRHA 4I2QA 4OO1J 4ILJA 4FZZA 3HOTA 4F9OA 3PIPL 3L2UA 1W7AA 4QCLA 5J2QA 1WBBA 2FBTA 3TARA 4FSVA 2OPPA 2BE2A 5C2DA 3DLRA 4K8ZA 3ZT3A 3MX2A 4H0VB 1RFQA 4NYNA 4ISFA 2OPQA 3H45C 3U6FA 4QS9A 2GEMA 1IKWA 1ILYA 3G6EN 4JHDA 3NGZA 2OYQA 5I42A 1HKBA 3VF2A 4KBOA 4B1XB 1GLFO 3QETA 3LAMA 4O5BA 3MAQA 2E2OA 3V9UA 3OYMA 1BDGA 2IS3A 3O08A 3DLEA 2FSJA 4DV0K 1A5WA 4CK3A 3O9SA 3FLCO 4JKFA 2HHTA 4B08A 3QEWA 4PL7A 2P9KA 5GIOA 3VENA 3LP2A 4HTLA 2PBDA 3QFPA 3L8BA 2O8BA 5E41A 3FGUA 4H0YB 3V4IA 4YNQA 4I6MA 4BQLA 3SQ1A 2Z1GA 1OVYA 3DRSA 2ASOA 2NRHA 2O8CA 4JI2K 4V19S 3ZLJA 4B3SK 4E1JA 1NWKA 4BC2A 3QDKA 4CJEA 4Z4IA 3SLCA 1ZBUA 3VQPA 1TAUA 4ID5A 5FLXO 4EP5A 3M3ZA 4R5PA 3D2FA 2H3GX 2Q3SA 3KZBA 2EX3A 4BR7A 2Y1IA 5KGXA 4RW9A 4BACA 5FROA 4KO0A 4BRLA 3MMVA 1OH5A 4ILGB 4N41A 5AQMA 3CMEN 5M1PA 3VQ4A 4NCGA 4CGIA 1NK4A 2GX9A 2OCEA 5FRNA 3UKUB 4HHTA 2Q1NA 4ICLA 5BPNA 2HHSA 3CCRN 3HZ6A 1RILA 4BWMA 5HROA 4CGGA 4DSFA 4M3YA 1TUUA 4H5VA 5AQQA 1L3TA 3QESA 4MFBA 1GLLO 3R3LA 2KLAA 3OS0A 1LV5A 4DQ8A 1HNWK 2P9LA 4DTUA 1NM1A 2WUSA 4JD2A 3ZSZA 3MN5A 2PZSA 1UAXA 4NO7A 2OANA 4AHCA 1U45A 1NJXA 4U7BA 1YIJN 4DR1K 2FF6A 4CJQA 4KB0A 3SAFA 5SWMA 1C1BA 3L4QA 4G9ZA 2G8VA 2OTLN 1BI4B 2DFEA 2PAVA 4RCHA 5AQTA 3HI0A 5JMVA 3AO5A 4CZIA 2O8FA 2UUAK 1S72N 1UWBA 2ASMA 4GV9A 1HX1A 1MWKA 4B9QA 4BG8A 4CD3A 1BA0A 5AQGA 1NOZA 4A61A 3SK3A 4O8UA 4IXCA 1QSSA 1EWQA 1WUAA 5M1NA 3TAFA 2A5XA
chains in the Genus database with same CATH topology
4F2RA 3V9XA 1LW2A 2XY6A 1SL1A 5DK5A 2ETJA 1SKRA 1RT6A 1TL3A 2HHQA 1RBSA 1MU2A 3G0ZA 4G1QA 4OKKA 5T7BA 4M3ZA 3M8PA 3OVNA 3OYCA 3C6UA 4ID1A 4AHSA 3LWLA 3V81A 3TAPA 4B9SA 5KI6A 3L2QA 4CIFA 4DQSA 3NDKA 3KKRA 1QTMA 4ZTJA 3IAYA 4M3XA 5EU7A 1RNHA 3QIPA 3SQ2A 3VQAA 3F9KA 4CFBA 4CF9A 4DSEA 1LAVA 4FK0A 4FVMA 1J53A 1A5VA 3NE6A 4W5OA 2VG6A 4CEQA 1JLQA 1JLBA 3PX0A 3KD5E 3HP9A 3K5LA 4E7IA 1C0MA 4FLZA 3I8DA 4KRFA 1C1AA 3L3UA 3ZSVA 1JLGA 1L3VA 3B6OA 1VSIA 1NKBA 4Z4FA 3DLHA 4B8AB 1T05A 1W9HA 3AV9A 3IG1A 4FLTA 3RTVA 3HK2A 3SUOA 1NKCA 4F4KA 2ZD1A 3AO2A 3KKSA 3IS9A 2YKMA 4H4MA 1Q9XA 3OYFA 3AVHA 3SQ4A 3TABA 3ZT4A 4DTPA 3T3FA 4Q5VA 4PQUA 3C6TA 4IBNA 1IKVA 1BCOA 1K6YA 3K2PA 2E4LA 1ASUA 1RBUA 5J2PA 5FRMA 4FJXA 1EETA 1JL1A 1LWEA 2NUBA 3OYBA 2VWKA 4TSXA 3U3GA 3VQ5A 5KGWA 4CJSA 4FJJA 4IDKA 2GV9A 4M41A 1GOAA 1D5AA 1ZBLA 3PX6A 1XC9A 3OYDA 2HHVA 1S1VA 4Y1DA 4Z0UA 1UA1A 4IFVA 4O4GA 1KVBA 3AO3A 2FBYA 1EXQA 4KAZA 3ZSYA 1HQEA 2RF2A 4ELVA 4M3WA 4H4OA 4I2PA 1JLEA 3VN5A 2P5GA 1RDBA 2HMIA 2JLEA 3QNOA 3LPUA 3PUFA 4JRQA 3TAGA 1KRPA 4DSKA 4E0DA 1RBRA 2GBZA 3MXMA 1S1WA 3LZJA 4C8MA 4CIGA 1C6VA 2IAJA 4CE9A 5KRTA 4B9TA 4OGCA 2PYLA 5HRSA 2KZMA 4Y1CA 4AILC 1TKZA 3QNNA 4CJPA 1KSPA 4DMNA 3RMDA 2OPSA 1KLNA 3QLHA 1BISA 1IO2A 3BGRA 5HRPA 1T03A 5CYQA 2B5JA 1BI4A 2B6AA 3S3MA 1G15A 4DQPA 4IKFA 4RW4A 3EYZA 2G8FA 3KLFA 1I39A 4AHRA 3HT3A 1ASWA 1SKWA 3MXJA 4KHWA 3O3HA 2XY7A 4KI6A 3OYKA 2ITGA 3WNFA 5J1EA 4NCBA 2HHUA 4BE1A 1D9DA 1ZBFA 3AVKA 4HTUA 4B9UA 3AVCA 2VG5A 3CFPA 3KJVA 4DLGA 4KKOA 3HM9A 4UQGA 3DRPA 4HUFA 3TANA 4DWIA 3WNHA 1XI1A 4OKEA 1CLQA 2G8UA 3DLKA 4B9LA 2F8TA 3K58A 4JS5A 3BDPA 4DFPA 3HPHA 4ELTA 4F8RA 1RT1A 3DOLA 3F73A 2KW4A 3TR8A 1QSYA 1SL0A 3NCIA 4C8KA 1JXEA 4Q0BA 4CEOA 4KB1A 4CCHA 1F21A 4OJRA 2G8KA 1HJRA 1RTDA 4E19A 4FLYA 3NHGA 3V1OA 4JRPA 1TVRA 2QK9A 2HHWA 2FC0A 3OYIA 4CJRA 1RT5A 1XHXA 3NGIA 1T7PA 1RDDA 4LH4A 4K8XA 4GVMA 4CHNA 3OJSA 3K5MA 4E3SA 1U4BA 4FYDA 1KVCA 1Z25A 5JS1A 4KTQA 1Y97A 4CJFA 4W5NA 3LDSA 1VK0A 2BDPA 5C25A 4DF8A 3SPZA 1NK7A 5HBMA 1HYZA 3TAEA 2HVHA 2G8WA 4EZ6A 3NH0A 1CZBA 3U3YA 4DTOA 3O4QA 3LWMA 1WAJA 1JL2A 3V1QA 2E6LA 1NK9A 3VQ7A 3ZSQA 4CJ4A 1LW0A 1WN7A 3TWHA 4AHVA 3NAEA 1RT7A 2X74A 5J2MA 2ZE2A 1REVA 3HPGA 1U49A 3RWUA 3PO5A 1WSIA 5JS2A 4BDPA 4DTSA 4OLAA 3HPOA 1EKEA 1WSGA 2KQ2A 3DMJA 4GW6A 4CHPA 4E1MA 3SYZA 3O3GA 4CK1A 4CJ5A 4FM0A 1CXUA 3HP6A 5I3UA 2HNYA 1ZBIA 2GUIA 2HVIA 1WSFA 2HHXA 1FK9A 4DU1A 3DM2A 4FLWA 4PUOA 4E89A 1O1WA 4BDZA 5HP1A 1QSLA 4BE0A 4KREA 4C8LA 4DQQA 3H08A 3RR7A 4OPJA 3DI6A 3CFRA 3L3VA 3SQ0A 1I3AA 4CJ3A 1ZYQA 1SKSA 1N5YA 2AJQA 4E7JA 4CJWA 1NK0A 2O4GA 4HUEA 2BANA 3S9HA 4DLEA 5C42A 4FJ7A 4O0JA 3QO9A 5J2NA 5HLFA 4L8RB 1QS4A 1FKPA 1S6PA 2IC3A 3ZCMA 2QKBA 4DQIA 3ZSWA 4CHOA 3NF6A 1VSHA 1EX4A 3C94A 4KHYA 3WNGA 4DS5A 4AHTA 3OYLA 1HNVA 4LH5A 4CGFA 1TKXA 1RDAA 2DFFA 4CECA 1HNIA 1SV5A 1X1PA 3O3FA 1J54A 3RRGA 4FJ5A 1RCHA 2OZMA 3VQQA 1TAQA 1Z26A 3ZSOA 4XIUA 1IKYA 1VRTA 3TI0A 4FK2A 4KTZA 3ZT1A 3RMBA 3HJFA 1JLAA 4CGHA 1IH7A 1HMVA 1LAWA 3AA3A 3AVBA 3SUQA 3THVA 4FK4A 4CESA 3AVIA 4IG0A 1CXQA 3V9SA 3SV4A 1B92A 5HRRA 1L3SA 1HQUA 1VSFA 4FJ9A 1TL1A 4CEBA 2XY8A 2VWJA 4OLBA 4PY5A 3G10A 3PO4A 2F8SA 3IRXA 3DLGA 3D0PA 4CK2A 2WONA 4FW2A 4DTXA 4ZHRA 1WSJA 1NK6A 3P5JA 4FJGA 1TKTA 4OVLA 3SNNA 1ASVA 3JSMA 4C8OA 2HNDA 2W42A 2IOCA 5D3GA 3AVAA 2YNGA 2XHBA 4AHUA 1DTQA 1IG9A 4CEZA 3KLGA 3OYGA 2D0CA 4LSLA 3DYAA 4Z4HA 2HW3A 1NKEA 4LD0A 3M8RA 1YTAA 4CEDA 3S3NA 5CY4A 4M3RA 2RPIA 4CJTA 4N76A 1JKHA 1HYVA 3SCXA 3RMAA 3ISNC 4HCCA 4QOZB 2O4IA 2D0BA 4N47A 4CJLA 5CZ1A 3P1GA 4O55A 1BL3A 4F3OA 3RMCA 2ZQBA 4B8CA 4E7KA 4CFAA 3AVLA 1IKXA 1LWCA 3RRHA 4J2EA 3NF8A 3LZIA 3HVRA 4OKJA 4KV8A 4DF4A 4KHUA 3KTQA 3PV8A 1KTQA 1J5OA 3NFAA 1B9DA 3VQ8A 1FKOA 3CQ8A 4F3TA 3KLHA 1S6QA 3K59A 1A5XA 4GMJB 3CFOA 2F96A 3SJJA 2FBVA 4NCAA 2YHAA 4DTNA 4B3OA 1VSJA 3OYHA 4J2BA 2A1RA 3AA5X 4W5RA 3RR8A 3QEXA 4DSLA 1Q8IA 2P5OA 3LALA 2X6NA 2G8HA 2XO7A 4Z4EA 1GOBA 2I5JA 2LSNA 4LY7A 3VQCA 1BIZA 3HL8A 3K57A 4DS4A 3ULDA 3QEPA 1UA0A 1BQMA 2RKIA 3MXIA 1JLCA 2KTQA 1DLOA 4Z4CA 4DTRA 3KD1E 1BIUA 3QINA 1WSHA 1S9EA 4W5TA 3SZ2A 1HYSA 3OYNA 5HRNA 1RT4A 1NK8A 1NOYA 3AVMA 3V1RA 5KRSA 3L2VA 1HRHA 3SI6A 1U47A 4B9NA 3AO1A 1S1UA 4N5SA 3MEGA 3VA3A 3OY9A 3B6PA 3VQEA 4I2QA 3VQBA 4CEFA 4CERA 4DTJA 3VQ6A 3ALYA 4W5QA 2PYJA 4CHQA 1TK0A 1YT3A 4FZZA 4FJIA 4AH9A 4QCLA 1ITGA 3L2UA 5FDLA 2KFZA 1S9GA 5J2QA 1KCFA 3SV3A 3M8SA 3SUNA 2FBTA 1RBVA 4ZTFA 4M3TA 3TARA 4E7LA 1XHZA 1UOCA 3L2RA 1YTUA 3HYFA 2OPPA 1C0TA 2BE2A 3AA4A 4FM2A 3DLRA 2IGIA 4ELUA 3ZT3A 3AVFA 4CF1A 4K8ZA 3VQDA 4DG1A 3OYEA 4NYNA 2D0AA 2OPRA 3QEVA 3MEDA 4QAGA 1FXXA 2OPQA 3TAMA 3U6FA 1CZ9A 1KLMA 1JXBA 1IKWA 1S5JA 4CF2A 4CHYA 5DMRA 4CF8A 4KPYA 3NGZA 2OYQA 2G8IA 4DU3A 5I42A 3QEIA 4B9MA 4IFYA 2PY5A 4F2SA 3QETA 4O0IA 3LAMA 4RG8A 4JS4A 4IG3A 4O5BA 3MAQA 1D8YA 1QQCA 3MEEA 3T1AA 3V9UA 2P51A 2Y1JA 3OYMA 1X9SA 2IS3A 4FJMA 3DLEA 3S3OA 1A5WA 3DRRA 4CK3A 3KK3A 1X9WA 3DOKA 4E1NA 4KHNA 3JYTA 2HHTA 3ASMA 2Z1HA 3AVJA 1Q9YA 3WNEA 4B08A 3NH1A 3QEWA 3VQ9A 3LP2A 2X78A 2DY4A 3FFIA 3OS1A 4FLVA 1NJYA 4BDYA 3K5NA 3L8BA 2KFNA 3OJUA 5K14A 4M42A 5E41A 1L3UA 1NK5A 3OS2A 3PY8A 3E01A 3HSTB 3ZT0A 1QE1A 2D5RA 4NYFA 4FJHA 3V4IA 2WOMA 4YNQA 3NH2A 3LAKA 4HVJA 3SQ1A 3ZSXA 1W0HA 2Z1GA 1EP4A 1QHTA 3DRSA 1SUQA 1KFDA 4O44A 3HVTA 4CJUA 2XY5A 1NJZA 4HCBA 3NGYA 1TK8A 3LP3A 1WLJA 4I9LA 4LSNA 3KLEA 3NF7A 3K5OA 3AA2A 1XWLA 4C8NA 3ITHA 5KTQA 1N6QA 3NF9A 1VSEA 4Z4IA 4CJEA 1VRUA 3AO4A 2YV0X 3CG7A 1ZBUA 3VQPA 3EY1A 3OYJA 1D9FA 2OA8A 4FJ8A 1X9MA 1TAUA 5CYMA 4ID5A 4EP5A 1HPZA 4RW6A 4CIEA 1C1CA 2KZZA 1DTTA 4R5PA 3CM6A 4DU4A 3VA0A 3L2WA 1T8EA 1KVAA 3C95A 2X6SA 2OZSA 1J9AA 1C0UA 2E6MA 2Q3SA 3LANA 3QIOA 4I7FA 4RW8A 3ZT2A 1WAFA 2YKNA 2EX3A 3CM5A 4KFBA 4RW7A 4CEEA 4MQ3A 3M8QA 1BGXT 3LP0A 4EP4A 2Y1IA 5KGXA 2BGGA 1S1XA 3D45A 4RW9A 4CJVA 3I0SA 3SUPA 4BACA 5FROA 1B9FA 1WSEA 4KO0A 2EHGA 1RTIA 4FCYA 4CFDA 4BWJA 1ZBHA 4EZ9A 2QKKA 3NBPA 4DSJA 2P1JA 4N41A 1WNSA 3P83D 4FZYA 3VQ4A 1TV6A 1RBTA 4NCGA 1YVUA 4CGIA 1NK4A 1U48A 1L5UA 4DSIA 5FRNA 4HHTA 4ICLA 2YNFA 1VSKA 2HHSA 4KHQA 4CFCA 4FJKA 4KTWA 2RN2A 1RILA 4BWMA 3EZ5A 5HROA 1TKDA 1RT3A 4CGJA 4CGGA 4CEAA 4M3UA 3CYMA 4DSFA 3AVGA 2R7YA 4DFMA 3DLBA 4KHSA 1RTJA 4M3YA 4FW1A 3QESA 1L3TA 1BQNA 2FBXA 3QERA 2JGUA 4DFKA 2DTUA 4MFBA 2HB5A 5CZ2A 1RDCA 3LP1A 3OS0A 4HUGA 1LV5A 4DQRA 4DTUA 2QXFA 3O4NA 2IDOA 4N56A 4CJKA 4FJLA 3ZSZA 4FLUA 4B9VA 4J2DA 1NJWA 1BHLA 1JLFA 1U04A 2HNZA 3KIOA 2PZSA 1UAXA 1S1TA 4AHCA 1U45A 4J2AA 1NJXA 1RT2A 4I9QA 2Z1JA 4FZXC 4CJQA 2YHBA 4KB0A 1TGOA 5SWMA 4PA1A 3KK2A 3HO1A 4OPKA 1C1BA 2YNHA 4OGEA 4FM1A 2ATQA 1VSLA 4CGDA 2G8VA 1GOCA 3KLIA 1R0AA 1BI4B 2DFEA 2XRIA 3MECA 4DTMA 3AO5A 3TAQA 3V6DA 1SL2A 4FJNA 4PWDA 2A1SA 3A2FA 3I0RA 4BE2A 1UWBA 4KI4A 3KK1A 5SZTA 2B4JA 1RTHA 5C24A 4WE1A 3UIQA 1TK5A 4DFJA 1VSDA 4H8KA 2Z1IA 1NOZA 2YNIA 3V9ZA 4FLXA 2DFHA 4Z4GA 3PX4A 4CF0A 3SPYA 4M45A 4CHZA 4JLHA 2VG7A 4YFUA 3OYAA 3V9WA 1LWFA 1QSSA 1VSMA 3LPTA 3HXMA 3T19A 1BCMA 4E7HA 4FXDA 3TAFA 3ZSRA 3AVNA 1KFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F2R A;  3V9X A;  1LW2 A;  2XY6 A;  1SL1 A;  5DK5 A;  2ETJ A;  1SKR A;  1RT6 A;  1TL3 A;  2HHQ A;  1RBS A;  1MU2 A;  3G0Z A;  4G1Q A;  4OKK A;  5T7B A;  4M3Z A;  3M8P A;  3OVN A;  3OYC A;  3C6U A;  4ID1 A;  4AHS A;  3LWL A;  3V81 A;  3TAP A;  4B9S A;  5KI6 A;  3L2Q A;  4CIF A;  4DQS A;  3NDK A;  3KKR A;  1QTM A;  4ZTJ A;  3IAY A;  4M3X A;  5EU7 A;  1RNH A;  3QIP A;  3SQ2 A;  3VQA A;  3F9K A;  4CFB A;  4CF9 A;  4DSE A;  1LAV A;  4FK0 A;  4FVM A;  1J53 A;  1A5V A;  3NE6 A;  4W5O A;  2VG6 A;  4CEQ A;  1JLQ A;  1JLB A;  3PX0 A;  3KD5 E;  3HP9 A;  3K5L A;  4E7I A;  1C0M A;  4FLZ A;  3I8D A;  4KRF A;  1C1A A;  3L3U A;  3ZSV A;  1JLG A;  1L3V A;  3B6O A;  1VSI A;  1NKB A;  4Z4F A;  3DLH A;  4B8A B;  1T05 A;  1W9H A;  3AV9 A;  3IG1 A;  4FLT A;  3RTV A;  3HK2 A;  3SUO A;  1NKC A;  4F4K A;  2ZD1 A;  3AO2 A;  3KKS A;  3IS9 A;  2YKM A;  4H4M A;  1Q9X A;  3OYF A;  3AVH A;  3SQ4 A;  3TAB A;  3ZT4 A;  4DTP A;  3T3F A;  4Q5V A;  4PQU A;  3C6T A;  4IBN A;  1IKV A;  1BCO A;  1K6Y A;  3K2P A;  2E4L A;  1ASU A;  1RBU A;  5J2P A;  5FRM A;  4FJX A;  1EET A;  1JL1 A;  1LWE A;  2NUB A;  3OYB A;  2VWK A;  4TSX A;  3U3G A;  3VQ5 A;  5KGW A;  4CJS A;  4FJJ A;  4IDK A;  2GV9 A;  4M41 A;  1GOA A;  1D5A A;  1ZBL A;  3PX6 A;  1XC9 A;  3OYD A;  2HHV A;  1S1V A;  4Y1D A;  4Z0U A;  1UA1 A;  4IFV A;  4O4G A;  1KVB A;  3AO3 A;  2FBY A;  1EXQ A;  4KAZ A;  3ZSY A;  1HQE A;  2RF2 A;  4ELV A;  4M3W A;  4H4O A;  4I2P A;  1JLE A;  3VN5 A;  2P5G A;  1RDB A;  2HMI A;  2JLE A;  3QNO A;  3LPU A;  3PUF A;  4JRQ A;  3TAG A;  1KRP A;  4DSK A;  4E0D A;  1RBR A;  2GBZ A;  3MXM A;  1S1W A;  3LZJ A;  4C8M A;  4CIG A;  1C6V A;  2IAJ A;  4CE9 A;  5KRT A;  4B9T A;  4OGC A;  2PYL A;  5HRS A;  2KZM A;  4Y1C A;  4AIL C;  1TKZ A;  3QNN A;  4CJP A;  1KSP A;  4DMN A;  3RMD A;  2OPS A;  1KLN A;  3QLH A;  1BIS A;  1IO2 A;  3BGR A;  5HRP A;  1T03 A;  5CYQ A;  2B5J A;  1BI4 A;  2B6A A;  3S3M A;  1G15 A;  4DQP A;  4IKF A;  4RW4 A;  3EYZ A;  2G8F A;  3KLF A;  1I39 A;  4AHR A;  3HT3 A;  1ASW A;  1SKW A;  3MXJ A;  4KHW A;  3O3H A;  2XY7 A;  4KI6 A;  3OYK A;  2ITG A;  3WNF A;  5J1E A;  4NCB A;  2HHU A;  4BE1 A;  1D9D A;  1ZBF A;  3AVK A;  4HTU A;  4B9U A;  3AVC A;  2VG5 A;  3CFP A;  3KJV A;  4DLG A;  4KKO A;  3HM9 A;  4UQG A;  3DRP A;  4HUF A;  3TAN A;  4DWI A;  3WNH A;  1XI1 A;  4OKE A;  1CLQ A;  2G8U A;  3DLK A;  4B9L A;  2F8T A;  3K58 A;  4JS5 A;  3BDP A;  4DFP A;  3HPH A;  4ELT A;  4F8R A;  1RT1 A;  3DOL A;  3F73 A;  2KW4 A;  3TR8 A;  1QSY A;  1SL0 A;  3NCI A;  4C8K A;  1JXE A;  4Q0B A;  4CEO A;  4KB1 A;  4CCH A;  1F21 A;  4OJR A;  2G8K A;  1HJR A;  1RTD A;  4E19 A;  4FLY A;  3NHG A;  3V1O A;  4JRP A;  1TVR A;  2QK9 A;  2HHW A;  2FC0 A;  3OYI A;  4CJR A;  1RT5 A;  1XHX A;  3NGI A;  1T7P A;  1RDD A;  4LH4 A;  4K8X A;  4GVM A;  4CHN A;  3OJS A;  3K5M A;  4E3S A;  1U4B A;  4FYD A;  1KVC A;  1Z25 A;  5JS1 A;  4KTQ A;  1Y97 A;  4CJF A;  4W5N A;  3LDS A;  1VK0 A;  2BDP A;  5C25 A;  4DF8 A;  3SPZ A;  1NK7 A;  5HBM A;  1HYZ A;  3TAE A;  2HVH A;  2G8W A;  4EZ6 A;  3NH0 A;  1CZB A;  3U3Y A;  4DTO A;  3O4Q A;  3LWM A;  1WAJ A;  1JL2 A;  3V1Q A;  2E6L A;  1NK9 A;  3VQ7 A;  3ZSQ A;  4CJ4 A;  1LW0 A;  1WN7 A;  3TWH A;  4AHV A;  3NAE A;  1RT7 A;  2X74 A;  5J2M A;  2ZE2 A;  1REV A;  3HPG A;  1U49 A;  3RWU A;  3PO5 A;  1WSI A;  5JS2 A;  4BDP A;  4DTS A;  4OLA A;  3HPO A;  1EKE A;  1WSG A;  2KQ2 A;  3DMJ A;  4GW6 A;  4CHP A;  4E1M A;  3SYZ A;  3O3G A;  4CK1 A;  4CJ5 A;  4FM0 A;  1CXU A;  3HP6 A;  5I3U A;  2HNY A;  1ZBI A;  2GUI A;  2HVI A;  1WSF A;  2HHX A;  1FK9 A;  4DU1 A;  3DM2 A;  4FLW A;  4PUO A;  4E89 A;  1O1W A;  4BDZ A;  5HP1 A;  1QSL A;  4BE0 A;  4KRE A;  4C8L A;  4DQQ A;  3H08 A;  3RR7 A;  4OPJ A;  3DI6 A;  3CFR A;  3L3V A;  3SQ0 A;  1I3A A;  4CJ3 A;  1ZYQ A;  1SKS A;  1N5Y A;  2AJQ A;  4E7J A;  4CJW A;  1NK0 A;  2O4G A;  4HUE A;  2BAN A;  3S9H A;  4DLE A;  5C42 A;  4FJ7 A;  4O0J A;  3QO9 A;  5J2N A;  5HLF A;  4L8R B;  1QS4 A;  1FKP A;  1S6P A;  2IC3 A;  3ZCM A;  2QKB A;  4DQI A;  3ZSW A;  4CHO A;  3NF6 A;  1VSH A;  1EX4 A;  3C94 A;  4KHY A;  3WNG A;  4DS5 A;  4AHT A;  3OYL A;  1HNV A;  4LH5 A;  4CGF A;  1TKX A;  1RDA A;  2DFF A;  4CEC A;  1HNI A;  1SV5 A;  1X1P A;  3O3F A;  1J54 A;  3RRG A;  4FJ5 A;  1RCH A;  2OZM A;  3VQQ A;  1TAQ A;  1Z26 A;  3ZSO A;  4XIU A;  1IKY A;  1VRT A;  3TI0 A;  4FK2 A;  4KTZ A;  3ZT1 A;  3RMB A;  3HJF A;  1JLA A;  4CGH A;  1IH7 A;  1HMV A;  1LAW A;  3AA3 A;  3AVB A;  3SUQ A;  3THV A;  4FK4 A;  4CES A;  3AVI A;  4IG0 A;  1CXQ A;  3V9S A;  3SV4 A;  1B92 A;  5HRR A;  1L3S A;  1HQU A;  1VSF A;  4FJ9 A;  1TL1 A;  4CEB A;  2XY8 A;  2VWJ A;  4OLB A;  4PY5 A;  3G10 A;  3PO4 A;  2F8S A;  3IRX A;  3DLG A;  3D0P A;  4CK2 A;  2WON A;  4FW2 A;  4DTX A;  4ZHR A;  1WSJ A;  1NK6 A;  3P5J A;  4FJG A;  1TKT A;  4OVL A;  3SNN A;  1ASV A;  3JSM A;  4C8O A;  2HND A;  2W42 A;  2IOC A;  5D3G A;  3AVA A;  2YNG A;  2XHB A;  4AHU A;  1DTQ A;  1IG9 A;  4CEZ A;  3KLG A;  3OYG A;  2D0C A;  4LSL A;  3DYA A;  4Z4H A;  2HW3 A;  1NKE A;  4LD0 A;  3M8R A;  1YTA A;  4CED A;  3S3N A;  5CY4 A;  4M3R A;  2RPI A;  4CJT A;  4N76 A;  1JKH A;  1HYV A;  3SCX A;  3RMA A;  3ISN C;  4HCC A;  4QOZ B;  2O4I A;  2D0B A;  4N47 A;  4CJL A;  5CZ1 A;  3P1G A;  4O55 A;  1BL3 A;  4F3O A;  3RMC A;  2ZQB A;  4B8C A;  4E7K A;  4CFA A;  3AVL A;  1IKX A;  1LWC A;  3RRH A;  4J2E A;  3NF8 A;  3LZI A;  3HVR A;  4OKJ A;  4KV8 A;  4DF4 A;  4KHU A;  3KTQ A;  3PV8 A;  1KTQ A;  1J5O A;  3NFA A;  1B9D A;  3VQ8 A;  1FKO A;  3CQ8 A;  4F3T A;  3KLH A;  1S6Q A;  3K59 A;  1A5X A;  4GMJ B;  3CFO A;  2F96 A;  3SJJ A;  2FBV A;  4NCA A;  2YHA A;  4DTN A;  4B3O A;  1VSJ A;  3OYH A;  4J2B A;  2A1R A;  3AA5 X;  4W5R A;  3RR8 A;  3QEX A;  4DSL A;  1Q8I A;  2P5O A;  3LAL A;  2X6N A;  2G8H A;  2XO7 A;  4Z4E A;  1GOB A;  2I5J A;  2LSN A;  4LY7 A;  3VQC A;  1BIZ A;  3HL8 A;  3K57 A;  4DS4 A;  3ULD A;  3QEP A;  1UA0 A;  1BQM A;  2RKI A;  3MXI A;  1JLC A;  2KTQ A;  1DLO A;  4Z4C A;  4DTR A;  3KD1 E;  1BIU A;  3QIN A;  1WSH A;  1S9E A;  4W5T A;  3SZ2 A;  1HYS A;  3OYN A;  5HRN A;  1RT4 A;  1NK8 A;  1NOY A;  3AVM A;  3V1R A;  5KRS A;  3L2V A;  1HRH A;  3SI6 A;  1U47 A;  4B9N A;  3AO1 A;  1S1U A;  4N5S A;  3MEG A;  3VA3 A;  3OY9 A;  3B6P A;  3VQE A;  4I2Q A;  3VQB A;  4CEF A;  4CER A;  4DTJ A;  3VQ6 A;  3ALY A;  4W5Q A;  2PYJ A;  4CHQ A;  1TK0 A;  1YT3 A;  4FZZ A;  4FJI A;  4AH9 A;  4QCL A;  1ITG A;  3L2U A;  5FDL A;  2KFZ A;  1S9G A;  5J2Q A;  1KCF A;  3SV3 A;  3M8S A;  3SUN A;  2FBT A;  1RBV A;  4ZTF A;  4M3T A;  3TAR A;  4E7L A;  1XHZ A;  1UOC A;  3L2R A;  1YTU A;  3HYF A;  2OPP A;  1C0T A;  2BE2 A;  3AA4 A;  4FM2 A;  3DLR A;  2IGI A;  4ELU A;  3ZT3 A;  3AVF A;  4CF1 A;  4K8Z A;  3VQD A;  4DG1 A;  3OYE A;  4NYN A;  2D0A A;  2OPR A;  3QEV A;  3MED A;  4QAG A;  1FXX A;  2OPQ A;  3TAM A;  3U6F A;  1CZ9 A;  1KLM A;  1JXB A;  1IKW A;  1S5J A;  4CF2 A;  4CHY A;  5DMR A;  4CF8 A;  4KPY A;  3NGZ A;  2OYQ A;  2G8I A;  4DU3 A;  5I42 A;  3QEI A;  4B9M A;  4IFY A;  2PY5 A;  4F2S A;  3QET A;  4O0I A;  3LAM A;  4RG8 A;  4JS4 A;  4IG3 A;  4O5B A;  3MAQ A;  1D8Y A;  1QQC A;  3MEE A;  3T1A A;  3V9U A;  2P51 A;  2Y1J A;  3OYM A;  1X9S A;  2IS3 A;  4FJM A;  3DLE A;  3S3O A;  1A5W A;  3DRR A;  4CK3 A;  3KK3 A;  1X9W A;  3DOK A;  4E1N A;  4KHN A;  3JYT A;  2HHT A;  3ASM A;  2Z1H A;  3AVJ A;  1Q9Y A;  3WNE A;  4B08 A;  3NH1 A;  3QEW A;  3VQ9 A;  3LP2 A;  2X78 A;  2DY4 A;  3FFI A;  3OS1 A;  4FLV A;  1NJY A;  4BDY A;  3K5N A;  3L8B A;  2KFN A;  3OJU A;  5K14 A;  4M42 A;  5E41 A;  1L3U A;  1NK5 A;  3OS2 A;  3PY8 A;  3E01 A;  3HST B;  3ZT0 A;  1QE1 A;  2D5R A;  4NYF A;  4FJH A;  3V4I A;  2WOM A;  4YNQ A;  3NH2 A;  3LAK A;  4HVJ A;  3SQ1 A;  3ZSX A;  1W0H A;  2Z1G A;  1EP4 A;  1QHT A;  3DRS A;  1SUQ A;  1KFD A;  4O44 A;  3HVT A;  4CJU A;  2XY5 A;  1NJZ A;  4HCB A;  3NGY A;  1TK8 A;  3LP3 A;  1WLJ A;  4I9L A;  4LSN A;  3KLE A;  3NF7 A;  3K5O A;  3AA2 A;  1XWL A;  4C8N A;  3ITH A;  5KTQ A;  1N6Q A;  3NF9 A;  1VSE A;  4Z4I A;  4CJE A;  1VRU A;  3AO4 A;  2YV0 X;  3CG7 A;  1ZBU A;  3VQP A;  3EY1 A;  3OYJ A;  1D9F A;  2OA8 A;  4FJ8 A;  1X9M A;  1TAU A;  5CYM A;  4ID5 A;  4EP5 A;  1HPZ A;  4RW6 A;  4CIE A;  1C1C A;  2KZZ A;  1DTT A;  4R5P A;  3CM6 A;  4DU4 A;  3VA0 A;  3L2W A;  1T8E A;  1KVA A;  3C95 A;  2X6S A;  2OZS A;  1J9A A;  1C0U A;  2E6M A;  2Q3S A;  3LAN A;  3QIO A;  4I7F A;  4RW8 A;  3ZT2 A;  1WAF A;  2YKN A;  2EX3 A;  3CM5 A;  4KFB A;  4RW7 A;  4CEE A;  4MQ3 A;  3M8Q A;  1BGX T;  3LP0 A;  4EP4 A;  2Y1I A;  5KGX A;  2BGG A;  1S1X A;  3D45 A;  4RW9 A;  4CJV A;  3I0S A;  3SUP A;  4BAC A;  5FRO A;  1B9F A;  1WSE A;  4KO0 A;  2EHG A;  1RTI A;  4FCY A;  4CFD A;  4BWJ A;  1ZBH A;  4EZ9 A;  2QKK A;  3NBP A;  4DSJ A;  2P1J A;  4N41 A;  1WNS A;  3P83 D;  4FZY A;  3VQ4 A;  1TV6 A;  1RBT A;  4NCG A;  1YVU A;  4CGI A;  1NK4 A;  1U48 A;  1L5U A;  4DSI A;  5FRN A;  4HHT A;  4ICL A;  2YNF A;  1VSK A;  2HHS A;  4KHQ A;  4CFC A;  4FJK A;  4KTW A;  2RN2 A;  1RIL A;  4BWM A;  3EZ5 A;  5HRO A;  1TKD A;  1RT3 A;  4CGJ A;  4CGG A;  4CEA A;  4M3U A;  3CYM A;  4DSF A;  3AVG A;  2R7Y A;  4DFM A;  3DLB A;  4KHS A;  1RTJ A;  4M3Y A;  4FW1 A;  3QES A;  1L3T A;  1BQN A;  2FBX A;  3QER A;  2JGU A;  4DFK A;  2DTU A;  4MFB A;  2HB5 A;  5CZ2 A;  1RDC A;  3LP1 A;  3OS0 A;  4HUG A;  1LV5 A;  4DQR A;  4DTU A;  2QXF A;  3O4N A;  2IDO A;  4N56 A;  4CJK A;  4FJL A;  3ZSZ A;  4FLU A;  4B9V A;  4J2D A;  1NJW A;  1BHL A;  1JLF A;  1U04 A;  2HNZ A;  3KIO A;  2PZS A;  1UAX A;  1S1T A;  4AHC A;  1U45 A;  4J2A A;  1NJX A;  1RT2 A;  4I9Q A;  2Z1J A;  4FZX C;  4CJQ A;  2YHB A;  4KB0 A;  1TGO A;  5SWM A;  4PA1 A;  3KK2 A;  3HO1 A;  4OPK A;  1C1B A;  2YNH A;  4OGE A;  4FM1 A;  2ATQ A;  1VSL A;  4CGD A;  2G8V A;  1GOC A;  3KLI A;  1R0A A;  1BI4 B;  2DFE A;  2XRI A;  3MEC A;  4DTM A;  3AO5 A;  3TAQ A;  3V6D A;  1SL2 A;  4FJN A;  4PWD A;  2A1S A;  3A2F A;  3I0R A;  4BE2 A;  1UWB A;  4KI4 A;  3KK1 A;  5SZT A;  2B4J A;  1RTH A;  5C24 A;  4WE1 A;  3UIQ A;  1TK5 A;  4DFJ A;  1VSD A;  4H8K A;  2Z1I A;  1NOZ A;  2YNI A;  3V9Z A;  4FLX A;  2DFH A;  4Z4G A;  3PX4 A;  4CF0 A;  3SPY A;  4M45 A;  4CHZ A;  4JLH A;  2VG7 A;  4YFU A;  3OYA A;  3V9W A;  1LWF A;  1QSS A;  1VSM A;  3LPT A;  3HXM A;  3T19 A;  1BCM A;  4E7H A;  4FXD A;  3TAF A;  3ZSR A;  3AVN A;  1KFS A; 
#chains in the Genus database with same CATH topology
 1SL1 A;  5DK5 A;  3RSE A;  1RT6 A;  1IJJ A;  3GE1 A;  2QWR A;  3R8E A;  1YJW N;  3OYC A;  3V81 A;  5KQD A;  3L2Q A;  4CIF A;  4DQS A;  2W6K A;  3U9D A;  3NDK A;  5CHI A;  1RNH A;  3QIP A;  3L4I A;  2HBJ A;  1LAV A;  4FK0 A;  4FVM A;  3NE6 A;  4W5O A;  4CEQ A;  1JLQ A;  1JLB A;  2IVO A;  3HP9 A;  4E7I A;  4FLZ A;  1C1A A;  4H0P A;  1L3V A;  3DXM A;  1NKB A;  4DV4 K;  3DLH A;  4A59 A;  4B8A B;  3AV9 A;  3IG1 A;  3SUO A;  3KKS A;  3OA9 A;  4H4M A;  3OYF A;  3AVH A;  3SQ4 A;  4BRM A;  4Q5V A;  4PQU A;  3C6T A;  4IBN A;  3GOI A;  1IKV A;  3K2P A;  5FRM A;  1EET A;  2NUB A;  3VQ5 A;  4FJJ A;  2VQE K;  4M41 A;  5ADX A;  5AQR A;  1ZBL A;  3OYD A;  2HHV A;  4Z0U A;  1JCE A;  4EHT A;  4YOT A;  2RF2 A;  1RDB A;  2HMI A;  3LDN A;  4BGA A;  2I7N A;  4JRQ A;  3F9M A;  4QS7 A;  2GBZ A;  3BF1 A;  3MXM A;  1IBL K;  1S1W A;  4YOR A;  5AQW A;  4CIG A;  1C6V A;  2BTF A;  2IAJ A;  2YHY A;  4EAH D;  1KSP A;  2GWJ A;  1YUW A;  1TYQ A;  4FOE A;  2B5J A;  3S3M A;  3R1X A;  3LDP A;  2UUC K;  2E2P A;  4YOY A;  4BRC A;  2G8F A;  3KLF A;  3D7E O;  1SKW A;  3MXJ A;  2XY7 A;  3OYK A;  3CCU N;  5AZJ A;  5EX5 A;  3G71 N;  5J1E A;  4NCB A;  1KAY A;  1ZBF A;  4B9U A;  3AVC A;  4UQG A;  1XI1 A;  4FWQ A;  2UU9 K;  3BDP A;  4MO5 A;  3CI5 A;  1VAZ A;  3HPH A;  1VQ5 N;  5HL7 L;  3DOL A;  1NGI A;  1QSY A;  1SL0 A;  1JXE A;  4CCH A;  4JI1 K;  1T6D A;  3BF3 A;  1HJR A;  1MWM A;  4CZH A;  1WB9 A;  1K8K A;  1NGD A;  2HHW A;  1RT5 A;  1XHX A;  1T7P A;  1RDD A;  2VQF K;  4CVN E;  2CGL A;  1BWF O;  3K5M A;  3CER A;  1KVC A;  3E1Y A;  4NB4 A;  4W5N A;  1VK0 A;  2BDP A;  1U6Z A;  4GY2 B;  1HYZ A;  2HVH A;  1E4G T;  1IG8 A;  1GLA G;  3CJ1 A;  1BU6 O;  1WAJ A;  1JL2 A;  5JVG L;  3MWP A;  1NK9 A;  5AR0 A;  5AQF A;  3ULE A;  3OTO K;  1WN7 A;  2UXB K;  2ZE2 A;  3ENH A;  4DR5 K;  3G25 A;  3UB5 A;  4XH1 A;  3DMJ A;  1NMD A;  4E1M A;  2CH6 A;  2RHK A;  5C0Y A;  3O3G A;  5EY4 A;  3P31 A;  1WSF A;  1NGC A;  1KD1 O;  3CF5 L;  3KK7 A;  4PUO A;  4BDZ A;  5HP1 A;  3F5T A;  3RR7 A;  2AJQ A;  4IWV A;  4HUE A;  3S9H A;  1X9J A;  4DR4 K;  5J2N A;  1D4X A;  1QS4 A;  2IC3 A;  3IDH A;  1N8R O;  5FPD A;  2QKB A;  3ZSW A;  5F2R A;  4KHY A;  3WNG A;  4JI8 K;  1HUX A;  5AQK A;  4LH5 A;  4NLB A;  1TKX A;  4CGF A;  1HNI A;  1SV5 A;  1YJN N;  3RRG A;  4FJ5 A;  4XIU A;  3CJ9 A;  4KTZ A;  2NZT A;  4IJA A;  3UKR B;  3RMB A;  4CGH A;  3ZEU B;  1LAW A;  2A6A A;  3ATU A;  4CES A;  3AVI A;  4IG0 A;  1TL1 A;  2XY8 A;  4CZF A;  5C10 A;  3G10 A;  2F8S A;  5CR4 A;  3LDQ A;  2WON A;  3WXL A;  4IO9 L;  3NVM A;  2W42 A;  3AVA A;  3DXK B;  4NXN K;  5E84 A;  4JI3 K;  3OYG A;  4LSL A;  4UY8 O;  4FWK A;  1K9M O;  2HW3 A;  4A2B A;  4CED A;  3S3N A;  5CY4 A;  1N34 K;  4FL9 A;  2O4I A;  4JI0 K;  5CZ1 A;  4H03 B;  4O55 A;  1BL3 A;  4B1W B;  3CCE N;  4CFA A;  1IKX A;  1LWC A;  3NF8 A;  3LZI A;  3HVR A;  3B8A X;  4DF4 A;  3A5M C;  1VQM N;  3O9Q A;  3WXK A;  3CQ8 A;  3KLH A;  3IKM A;  3NMU A;  2F96 A;  3SJJ A;  2FBV A;  3DJC A;  4DTN A;  3DLL L;  1VSJ A;  3L0Q A;  3MCP A;  4DSL A;  4DV1 K;  2XO7 A;  2ZJP L;  4JAX A;  5AQS A;  4Z4E A;  4DS4 A;  1XQS C;  3MXI A;  4DTR A;  3QIN A;  3BEX A;  1S9E A;  3VGK A;  3E9O A;  5KRS A;  4B3M K;  4N5S A;  3B6P A;  3VQE A;  4CEF A;  5M1F A;  3ALY A;  2P9I B;  2PYJ A;  1TK0 A;  1ITG A;  5FDL A;  2Q31 A;  3C65 A;  1KCF A;  3SUN A;  1RBV A;  2NNW A;  4E7L A;  5LJW A;  3L2R A;  1YTU A;  1C0T A;  5M1K A;  3AA4 A;  1HR0 K;  4FM2 A;  2VGM A;  1Z05 A;  3AVF A;  4CF1 A;  3VQD A;  3QEV A;  3W0L A;  1EO1 A;  3QML A;  3TAM A;  3SAH A;  1I94 K;  2CGK A;  1JXB A;  1S5J A;  4CF2 A;  5BPM A;  4CHY A;  5DMR A;  4CF8 A;  2GEL A;  1BA1 A;  1KXP A;  2G8I A;  3QEI A;  1HNZ K;  1OH7 A;  3N4Q A;  4F2S A;  4YOX A;  3CCV N;  4IG3 A;  1D8Y A;  1QQC A;  3MEE A;  3T1A A;  1X9S A;  4FJM A;  3S3O A;  2NRV A;  3C7N B;  1X9W A;  3JYT A;  3ASM A;  1Q9Y A;  2PFU A;  2QTD A;  3VQ9 A;  4YDU C;  3OS1 A;  4BDY A;  4JKH A;  1C0G A;  1SQK A;  1ESV A;  1QE1 A;  4BY9 C;  2ZGZ A;  3D6R A;  1BG3 A;  4FJH A;  1WOQ A;  5BRH A;  4KHP K;  1MA9 B;  3VOV A;  4EFH A;  3NH2 A;  3LAK A;  1EP4 A;  3S41 A;  3CJ7 A;  1QVF M;  4HCB A;  3HVT A;  4CJU A;  2XY5 A;  1NJZ A;  4JV5 K;  1NG9 A;  1WLJ A;  4I9L A;  1FW6 A;  3KLE A;  3NF7 A;  1N6Q A;  5AQO A;  3ITH A;  3NF9 A;  4K41 A;  3CG7 A;  3EY1 A;  3VEO A;  3OYJ A;  2CH5 A;  5CYM A;  1U2V B;  4L3Q A;  1HPZ A;  2BH1 A;  4CIE A;  3LDO A;  1DTT A;  1KVA A;  3C95 A;  1J9A A;  2E6M A;  2JWK A;  4YDU A;  2YKN A;  4RW7 A;  4CI6 A;  2NRZ A;  4WQ4 C;  3M8Q A;  2V52 B;  3THX A;  5ADX H;  2WC9 A;  2BGG A;  3D45 A;  3I0S A;  5JVH L;  1ZBH A;  3CCL N;  3H3O B;  4FZY A;  3O1B A;  1U48 A;  1RBT A;  4DSI A;  1L5U A;  3J7A P;  1VSK A;  2YHX A;  4FJK A;  4KTW A;  2RN2 A;  4M3U A;  3CYM A;  3DLB A;  4KHS A;  1RTJ A;  4FW1 A;  2FBX A;  2VCP A;  3VTH A;  2P9N B;  2DTU A;  5CZ2 A;  3EE8 A;  3SBG A;  4HUG A;  2IDO A;  4WQ4 A;  4CJK A;  4B9V A;  1T6C A;  4PKH A;  3J7Y P;  2FSK A;  1RT2 A;  2Z1J A;  4FZX C;  3KK2 A;  3HOS A;  3MDQ A;  3VGM A;  2YNH A;  4FM1 A;  1NGF A;  1VSL A;  4CGD A;  1GOC A;  5AQH A;  3KVG A;  3CPW M;  3MEC A;  1E4F T;  1ATR A;  3V6D A;  1SL2 A;  2A1S A;  3LM2 A;  4IFE A;  4DR3 K;  1TK5 A;  4K25 A;  2YNI A;  3V9Z A;  4Z4G A;  2DFH A;  3PX4 A;  4CF0 A;  3SPY A;  3ZET B;  4M45 A;  4CHZ A;  2VG7 A;  5AQZ A;  1VSM A;  3O5B A;  1BCM A;  3E9P A;  4AHS A;  1KFS A;  4F2R A;  3V9X A;  3CQY A;  2XY6 A;  2ETJ A;  1SKR A;  3AGK A;  1MU2 A;  4G1Q A;  3BZK A;  3THY A;  4FWN A;  3M8P A;  4BRE A;  3TAP A;  4ZTJ A;  3J81 O;  3GDQ A;  5BRF A;  2KKZ A;  1J53 A;  1A5V A;  4AQY K;  2F7T A;  4JKA A;  3CCS N;  1SAZ A;  3L3U A;  3ZSV A;  1QQM A;  1JLG A;  2E1Y A;  1X3N A;  4FLT A;  3AO2 A;  3FZF A;  2P9U B;  3TAB A;  4IOA L;  4IZ9 A;  1BCO A;  1K6Y A;  2E4L A;  1RBU A;  1W2B M;  4FJX A;  3OYB A;  2VWK A;  5KGW A;  1ZBS A;  4DV5 K;  1GOA A;  4Z94 A;  1D5A A;  5GAG P;  1UA1 A;  4IFV A;  4O4G A;  4X62 K;  3ZSY A;  4GV6 A;  3VN5 A;  2JLE A;  3QNO A;  3LPU A;  3PUF A;  3TAG A;  3D2E A;  3VF6 A;  4DR7 K;  1S3X A;  1YXQ A;  4OGC A;  2ZGY A;  4Y1C A;  4AIL C;  1YHQ N;  4CJP A;  3CJC A;  5MLC Q;  1KLN A;  3M1F A;  3BGR A;  5HRP A;  4B3T K;  3NVK A;  4O8K A;  2B6A A;  4IKF A;  3WEE A;  1NMN A;  4RW4 A;  3KWI A;  3CIP A;  1BO5 O;  1ASW A;  4KHW A;  1GLJ O;  4KI6 A;  2ITG A;  3VGL A;  3CET A;  2VG5 A;  3I55 N;  2YHW A;  2HOE A;  3DRP A;  3DLK A;  4B9L A;  3K58 A;  2HMP A;  5H1S Q;  3RVC A;  3THW B;  1O13 A;  3NCI A;  4C8K A;  3GL1 A;  2KHO A;  1IV0 A;  5ELZ A;  4JRP A;  1YIT N;  4MLH A;  3NGI A;  4WQ5 C;  3QBX A;  4H5N A;  4LH4 A;  4GVM A;  4E3S A;  1HPM A;  1Z25 A;  5JS1 A;  3FE1 A;  4DUY K;  5C25 A;  2QEX N;  1NK7 A;  5AZI A;  4CJ7 A;  1CZB A;  3U3Y A;  3O4Q A;  3LWM A;  2V51 B;  4K43 A;  3ZSQ A;  4H0X B;  1LW0 A;  3VEX A;  5J2M A;  3NAE A;  2QWL A;  1REV A;  3HPG A;  5JLH A;  1S22 A;  3PO5 A;  1WSG A;  4CHP A;  2D0O A;  1ZBI A;  3CC4 N;  2HVI A;  4BRP A;  2F4V K;  2ZWH A;  5IWA K;  4KRE A;  4ISG A;  4XEI A;  4LFC K;  4BE0 A;  2O8D B;  4WQ5 A;  2P9P B;  4OPJ A;  3CFR A;  3SQ0 A;  4OX9 K;  1I3A A;  4E7J A;  4CJW A;  2O4G A;  2BAN A;  4DLE A;  5C42 A;  5HLF A;  3ZYY X;  1VSH A;  3F2K A;  2GTD A;  4DS5 A;  4J8F A;  3OYL A;  1XMO K;  5BR9 A;  1X1P A;  1KQS M;  2W41 A;  3P4I A;  4FK2 A;  3ZSO A;  1VRT A;  1R59 O;  3ZT1 A;  4WCE L;  3U8X A;  4FK4 A;  1CXQ A;  3V9S A;  3SV4 A;  1B92 A;  1L3S A;  1VSF A;  2VWJ A;  3JS6 A;  3Q7B A;  3HM8 A;  4BRH A;  1LCU A;  2D4W A;  3D0P A;  1Q86 O;  4DTX A;  1WSJ A;  3P5J A;  1TKT A;  3FR0 A;  4C8O A;  4JHD B;  3IUC A;  1DTQ A;  4CEZ A;  3M8R A;  3K9J A;  4IOX A;  2RPI A;  4N76 A;  3SCX A;  4HCC A;  4BVP A;  2D0B A;  4CJL A;  4A62 A;  1NGH A;  2ZQB A;  4B8C A;  3U9Z A;  2P9K B;  4H5W A;  4J2E A;  4OKJ A;  4KV8 A;  2O8B B;  3KTQ A;  3P38 A;  3WQU A;  3EEQ A;  3IFR A;  3W3D A;  3NFA A;  3VQ8 A;  4I6M B;  1BOT O;  4F3T A;  4FVU A;  2ZJR L;  5BPL A;  1S6Q A;  3H6E A;  3K59 A;  3CFO A;  4BRK A;  2QM1 A;  2O8C B;  4B3O A;  4JYA K;  1KC8 O;  2Q0U A;  5FPN A;  2A1R A;  4W5R A;  3QEX A;  4B1V A;  1IBM K;  3LL3 A;  1GOB A;  2LSN A;  4LY7 A;  5C12 A;  3VQC A;  3ULD A;  2RKI A;  3D2F B;  2YJE A;  3KD1 E;  1BIU A;  1WSH A;  1RT4 A;  4KH4 A;  2F9T A;  3AVM A;  3SI6 A;  4B9N A;  3AO1 A;  3QBW A;  3ENB A;  4BRF A;  3OY9 A;  4DTJ A;  3VQB A;  4R79 A;  2IIR A;  4YOW A;  2O8E A;  4CHQ A;  1YT3 A;  3MK6 A;  4FJI A;  4AH9 A;  2QWN A;  4ISE A;  1S9G A;  3SV3 A;  3AAP A;  4ZTF A;  4X65 K;  3HYF A;  4O5F A;  1QQN A;  3CD6 N;  3EN9 A;  4LC9 B;  2IGI A;  5AQJ A;  4ELU A;  2E1Z A;  3OYE A;  4DG1 A;  2OPR A;  3MED A;  4QAG A;  2P9L B;  1KLM A;  4KPY A;  4JD2 B;  5LJV A;  2FXU A;  2ZJQ L;  1EQY A;  1LOT B;  4B9M A;  4FWL A;  5LL6 Z;  2QA4 N;  4O0I A;  4JS4 A;  3VEW A;  2UYT A;  1NBW A;  3DOK A;  4E1N A;  4KHN A;  4B1U B;  5AQP A;  3UE5 A;  4IOC L;  1NU0 A;  3NH1 A;  2O8F B;  2DY4 A;  3FFI A;  4FLV A;  3K5N A;  2P9S A;  4GKJ K;  4JI6 K;  4JKG A;  4B1Z A;  1L3U A;  3ZT0 A;  3OBY A;  4NYF A;  4FO0 A;  4EIA A;  2Q97 A;  5A2Q O;  4CBX A;  4HVJ A;  3ZSX A;  1W0H A;  1K73 O;  1QHT A;  3T1Y K;  2J4R A;  4LF6 K;  3CJA A;  1KFD A;  4AM7 A;  2FLO A;  5GIP A;  2QW9 A;  3LP3 A;  3RSE B;  2YI1 A;  4YOU A;  4C8N A;  1NLV A;  1VSE A;  3AO4 A;  2YV0 X;  4FJ8 A;  1D9F A;  4X64 K;  3T7Z A;  1YVN A;  2KZZ A;  1Q81 O;  4DR6 K;  2E2Q A;  3CM6 A;  4FWP A;  4DU4 A;  1T8E A;  2OZS A;  2X6S A;  1C0U A;  3LAN A;  3QIO A;  4I7F A;  3ZT2 A;  1N36 K;  1WAF A;  3CM5 A;  4CEE A;  2AA4 A;  4MQ3 A;  4JI4 K;  1IBK K;  4LF9 K;  3PSI A;  1BGX T;  1GLD G;  3DXM B;  3CQX A;  2NRX A;  3CJB A;  4RTF D;  2JWL A;  4FCY A;  1OH6 A;  4DSJ A;  3DWL A;  5LY3 A;  4WFN L;  4RWT A;  4H0O A;  4KHQ A;  4LFB K;  4CFC A;  2A41 A;  1TKD A;  4CGJ A;  4CEA A;  2R7Y A;  1BQN A;  3QER A;  4FWS A;  1ZC6 A;  4KH5 A;  5EOY A;  3O4N A;  3P39 A;  4N56 A;  1E3M A;  4FJL A;  4FLU A;  1U04 A;  1JLF A;  2HNZ A;  3O9T A;  1S1T A;  4HWI A;  3CCM N;  4J2A A;  1W97 L;  2YHB A;  1ATN A;  4C1N I;  3U4L A;  4CD1 A;  4LFA K;  4BG9 A;  4OGE A;  2ATQ A;  1TYQ B;  3KLI A;  3TSQ A;  1R0A A;  4PWD A;  3A2F A;  1KAX A;  3PIO L;  5AZJ B;  3KK1 A;  2Q36 A;  3C6A A;  1Q7Y O;  2W6L A;  3V9W A;  1VQO N;  1LWF A;  3LPT A;  3HXM A;  4FXD A;  3AVN A;  4JKD A;  3G4S N;  5EXW A;  3A5O C;  1TL3 A;  5DM7 L;  1RBS A;  1YAG A;  5T7B A;  4JK9 A;  3OVN A;  4ID1 A;  4B9S A;  5KI6 A;  4M63 C;  3ZX3 A;  3H46 O;  1K8K B;  3IAY A;  4M3X A;  3SQ2 A;  3F9K A;  4CF9 A;  3KWG A;  3AY9 A;  2VG6 A;  3K5L A;  3VEZ A;  1VSI A;  4EHU A;  1T05 A;  1W9H A;  1NKC A;  2ZD1 A;  3IS9 A;  4B1Y B;  4YHH K;  2WFB A;  3ULE B;  3UKU A;  3ZT4 A;  3T3F A;  1CZA N;  5J2P A;  5LMN K;  2HF3 A;  1ASU A;  2V7Z A;  1JL1 A;  4TSX A;  1VQK N;  2YCH A;  2A3Z A;  3PX6 A;  5BRD A;  1S1V A;  4Y1D A;  2UXD K;  3C6H A;  1VQN N;  1EXQ A;  4M3W A;  4ELV A;  4H4O A;  1JLE A;  3EKS A;  4PKI A;  4DSK A;  1KRP A;  4E0D A;  4C8M A;  3EKU A;  4OPA A;  4CE9 A;  5HRS A;  1WBD A;  2VWB A;  2OPS A;  3JXU A;  1BIS A;  1IO2 A;  1T03 A;  5AJ3 K;  4JKE A;  1BI4 A;  4DQP A;  1I39 A;  3HT3 A;  3AGR A;  3O3H A;  3MN9 A;  2HBL A;  1P8Z A;  3WNF A;  4LF7 K;  2HHU A;  3M6G A;  4C23 A;  5GIN A;  3CFP A;  4BC5 A;  4DLG A;  3K9K A;  4OPH A;  3TAN A;  4DWI A;  3WNH A;  3K0S A;  4OKE A;  1CLQ A;  2G8U A;  2FF3 B;  3CCQ N;  4DFP A;  1VQ9 N;  2Q0R A;  2QWQ A;  5AQY A;  3CXC M;  2KW4 A;  3MN6 A;  4Q0B A;  4CEO A;  4KB1 A;  3PLA A;  2OTJ N;  4IDH A;  1QZ5 A;  4BR9 A;  4DB3 A;  2G8K A;  1DT9 A;  4E19 A;  3V1O A;  1TVR A;  2E88 A;  4CBU A;  2QK9 A;  2FC0 A;  3TSP A;  4CJR A;  3ID6 A;  1VQP N;  3LM9 A;  3QFU A;  4PKG A;  4K8X A;  3HTV A;  3TTC A;  4FYD A;  4H0T B;  1Y97 A;  4CJF A;  3LDS A;  3EO3 A;  4DF8 A;  3SPZ A;  4LF8 K;  5GAE P;  3TAE A;  1XNQ K;  2G8W A;  4EZ6 A;  3ENO A;  4DTO A;  3V1Q A;  3H3N O;  4JK8 A;  4CJ4 A;  4AHV A;  1RT7 A;  5BN8 A;  1U49 A;  4FWM A;  5FPE A;  4OLA A;  3HPO A;  3SYZ A;  5I3U A;  4CJ5 A;  1CXU A;  3HP6 A;  4CBW A;  2GUI A;  4DV7 K;  2HHX A;  3DM2 A;  4E89 A;  1O1W A;  1QSL A;  3WUH A;  5IT9 O;  4C8L A;  5AQX A;  3H08 A;  1DEJ A;  3A0I X;  2QWO A;  4CJ3 A;  1ZYQ A;  4FJ7 A;  4BRO A;  2YX6 A;  4BR2 A;  4L8R B;  3VPZ A;  1S6P A;  3TSU A;  4CW7 B;  4BGB A;  3O6W A;  4IEE A;  5E26 A;  4AHT A;  1HNV A;  3I33 A;  1RDA A;  4CEC A;  1TAQ A;  1Z26 A;  4IJN A;  2D1K A;  1YI2 N;  4K0K K;  4GNI A;  1JLA A;  1IH7 A;  1HMV A;  3AA3 A;  3AVB A;  3SUQ A;  2NRT A;  5M1O A;  4DR2 K;  5HRR A;  1HQU A;  4QS8 A;  4CEB A;  4OLB A;  2E2N A;  3IRX A;  3R6M A;  4FW2 A;  4ZHR A;  1NK6 A;  1GLC G;  3J80 O;  3SNN A;  3JSM A;  5AQI A;  3VEV A;  2IOC A;  1RGI A;  2YNG A;  2XHB A;  1IG9 A;  3KLG A;  2D0C A;  3DYA A;  1NKE A;  4LD0 A;  1YTA A;  1T44 A;  4M3R A;  4CJT A;  1JKH A;  1HYV A;  5TKW A;  4XH4 A;  2QXL A;  3ISN C;  3J7Z O;  4QOZ B;  2IVP A;  1SS6 A;  4F3O A;  4MDA A;  3RMC A;  2RE2 A;  3WXI A;  4E7K A;  2E5L K;  4LF4 K;  1RDW X;  3VER A;  1B9D A;  3CC2 N;  3FZK A;  3SBT A;  4FPB A;  1FKO A;  5CE3 A;  1A5X A;  1V4S A;  4GMJ B;  3ZX2 A;  2YHA A;  4Y0W A;  3RR8 A;  2P5O A;  3WQT A;  3LAL A;  2X6N A;  2G8H A;  5EVZ A;  5LMU K;  5KQ8 A;  3K57 A;  3HL8 A;  3QEP A;  4JI5 K;  1UA0 A;  1BQM A;  3SJH A;  1JLC A;  2KTQ A;  4Z4C A;  1EWR A;  3SZ2 A;  1HYS A;  1OVQ A;  3OYN A;  1KAZ A;  5HRN A;  3V1R A;  3L2V A;  5HOO A;  1U47 A;  3THX B;  1S1U A;  3H1Q A;  3MEG A;  4FWR A;  3VA3 A;  4CER A;  3VQ6 A;  4W5Q A;  1HLU A;  3FFK B;  3E9L A;  3T69 A;  2KFZ A;  1J6Z A;  1QHA A;  3M8S A;  3O80 A;  1VQ4 N;  4M3T A;  1VQ8 N;  4C1N K;  3UKR A;  1UOC A;  1XHZ A;  1VQ7 N;  3ZEU A;  4BR4 A;  3L6Q A;  2D0A A;  3VF4 A;  5F1X A;  1FXX A;  3PSF A;  5I9E B;  1CZ9 A;  4MO4 A;  4GKK K;  2GWK A;  3HBT A;  1NNE A;  1OH8 A;  4DU3 A;  5DM6 L;  3DXK A;  5KPZ A;  2Q2R A;  4IFY A;  2PY5 A;  3FZL A;  4RG8 A;  2V7Y A;  2Y1J A;  2P51 A;  4CZE A;  4DCH A;  3DRR A;  3KK3 A;  3BP8 A;  2Z1H A;  3AVJ A;  3WNE A;  3O9R A;  2X78 A;  1QQO A;  4DV3 K;  4CZM A;  4CZG A;  1NJY A;  4PL8 A;  2KFN A;  3OJU A;  5K14 A;  2VYP A;  3HRG A;  5AFU A;  4M42 A;  1NK5 A;  3OS2 A;  3PY8 A;  2BUP A;  3E01 A;  3HST B;  2D5R A;  3VET A;  2WOM A;  5AQN A;  3I8B A;  2EWS A;  4X66 K;  1K8A O;  4DV6 K;  1SUQ A;  4O44 A;  2A42 A;  3NGY A;  1TK8 A;  3O9U A;  4LSN A;  3K5O A;  3AA2 A;  1XWL A;  5KTQ A;  3THY B;  3BY5 A;  2F9W A;  1VRU A;  3ATV A;  2OA8 A;  1X9M A;  3TU5 A;  1DKG D;  4RW6 A;  1C1C A;  4BR5 A;  3L2W A;  4B3R K;  4RW8 A;  4KFB A;  1N32 K;  1QVG M;  4FPA A;  3C0B A;  3MX5 A;  3LP0 A;  4EP4 A;  3QIC A;  3BUZ B;  3EZW A;  1S1X A;  4CJV A;  3EL2 A;  3SUP A;  2DPN A;  3CHW A;  1B9F A;  1WSE A;  1RTI A;  2EHG A;  4CFD A;  2P9I A;  4BWJ A;  4EZ9 A;  2QKK A;  3NBP A;  2P1J A;  1WNS A;  2UXC K;  4AF1 A;  3P83 D;  1TV6 A;  1YVU A;  3TPQ A;  1G99 A;  3CCJ N;  5AQU A;  2YNF A;  3VMF B;  3EZ5 A;  2VGN A;  1RT3 A;  4DFM A;  3AVG A;  2JGU A;  4DFK A;  1GLE G;  2GUP A;  2HB5 A;  1RDC A;  3GBT A;  3LP1 A;  2E20 A;  4DQR A;  1HKG A;  2QXF A;  4CZL A;  3D2E B;  4J2D A;  1NJW A;  1BHL A;  4CZK A;  3KIO A;  3BZC A;  4I9Q A;  1XNR K;  1TGO A;  4PA1 A;  3HO1 A;  5AQV A;  4OPK A;  5BN9 A;  3FZM A;  3MWT A;  4BRD A;  3C7N A;  3GG4 A;  1NGJ A;  2ASP A;  4DTM A;  2XRI A;  3AAQ A;  3TAQ A;  3WEE B;  4FJN A;  3CMA N;  3I0R A;  4BE2 A;  1BUP A;  3WXM B;  5B8H A;  4KI4 A;  5SZT A;  2B4J A;  4H5R A;  1RTH A;  5C24 A;  4WE1 A;  1MDU B;  3UIQ A;  4DFJ A;  1YF5 L;  1VSD A;  2A40 A;  1VHX A;  4H8K A;  2Z1I A;  1TUY A;  4FLX A;  3LDL A;  3MN7 A;  4JLH A;  4BVO A;  4YFU A;  3OYA A;  3IMX A;  1QZ6 A;  1T3V A;  3T19 A;  4E7H A;  4GV3 A;  1H1V A;  3ZSR A;  4HTU A;  1LW2 A;  3O8M A;  5C15 A;  5KPR A;  2HHQ A;  3G0Z A;  4M3Z A;  4OKK A;  3C6U A;  3LWL A;  2UUB K;  1OKJ A;  1NGE A;  3CPE A;  1U2V A;  5JLF A;  3KKR A;  1QTM A;  5EU7 A;  3VQA A;  4CFB A;  4DSE A;  3E66 A;  2HBK A;  3R9P A;  2WTU A;  3SAG A;  3PX0 A;  3KD5 E;  4H5T A;  1C0M A;  4FWO A;  3I8D A;  4KRF A;  3B6O A;  4XH5 A;  3J8A A;  5AZI B;  4Z4F A;  4CZJ A;  3RTV A;  3HK2 A;  5TKY A;  4F4K A;  4YY3 K;  1N33 K;  2YKM A;  4A57 A;  1Q9X A;  1NGA A;  5KPT A;  4BRA A;  4DTP A;  4ILH A;  2E8A A;  4BRQ A;  5C2F A;  1LWE A;  3U3G A;  4M7X A;  1HJO A;  4CJS A;  4IDK A;  2GV9 A;  3SMS A;  3T1H K;  1XC9 A;  3OW2 M;  2P9N A;  1KVB A;  3AO3 A;  3MCA B;  2FBY A;  3A5L C;  4KAZ A;  1HQE A;  4I2P A;  2P5G A;  5FPM A;  5M1Q A;  1RBR A;  3FZH A;  1J5E K;  4BR0 A;  3LZJ A;  1HNX K;  2NLX A;  5KRT A;  4B9T A;  2PYL A;  3ZX0 A;  2KZM A;  3QNN A;  1TKZ A;  2I7P A;  1C0F A;  4DMN A;  3VEY A;  3RMD A;  1DGK N;  3QLH A;  4U67 L;  2HHH K;  2CGJ A;  5CYQ A;  2YJF A;  1G15 A;  4WFA L;  5F0X A;  3EYZ A;  4WYB A;  4AHR A;  2QI2 A;  3SMP A;  3A8Y A;  5AQL A;  1NGG A;  1JCG A;  1XUP O;  4NXM K;  4A2A A;  4BE1 A;  1D9D A;  3AVK A;  2ZF5 O;  3VTI A;  4LF5 K;  3KJV A;  4KKO A;  3HM9 A;  4A5B A;  4K42 A;  4HUF A;  3ZET A;  5GAD P;  3VES A;  2F8T A;  4JS5 A;  4ELT A;  3TTD A;  4F8R A;  1RT1 A;  3F73 A;  3TR8 A;  2D0P A;  4AM6 A;  4M7Y A;  1F21 A;  4OJR A;  2HF4 A;  1RTD A;  2QWP A;  4FLY A;  3NHG A;  3OYI A;  3KHY A;  1ATS A;  4CHN A;  3OJS A;  1U4B A;  5BR8 K;  4BC4 A;  4KTQ A;  3I56 N;  4MLE A;  4BQZ A;  3AAR A;  3H1V X;  5HBM A;  5JIC A;  3Q7C A;  4JI7 K;  3NH0 A;  2WBN A;  4NLC A;  2E6L A;  4GVE A;  1JCF A;  2P9U A;  3VQ7 A;  3TWH A;  2X74 A;  4YOV A;  3RWU A;  1WSI A;  5JS2 A;  4BDP A;  4DTS A;  1EKE A;  2KQ2 A;  4GW6 A;  4JKC A;  3VA0 A;  1RDU A;  4CK1 A;  4JN4 A;  3OHR A;  4FM0 A;  4KH6 A;  2HNY A;  5BRE A;  1FJG K;  3N4P A;  4MDB A;  1FK9 A;  2QWM A;  4DU1 A;  4FLW A;  4DQQ A;  3DI6 A;  1M90 O;  3L3V A;  4PHT X;  1SKS A;  1N5Y A;  1NK0 A;  4JK7 A;  1VQ6 N;  1XC3 A;  4O0J A;  1Q18 A;  3QO9 A;  1Y64 A;  1FKP A;  3ZCM A;  2ZM6 K;  4DQI A;  4CHO A;  3NF6 A;  1EX4 A;  3C94 A;  4DKW A;  4DHY A;  1JJ2 M;  2O8E B;  3QB0 A;  2DFF A;  1HKC A;  3O3F A;  1J54 A;  1RCH A;  2OZM A;  3VQQ A;  1IKY A;  3TI0 A;  4JNE A;  1GLB G;  1NGB A;  4JKB A;  1Q82 O;  3HJF A;  2FSN A;  3A5N C;  3THV A;  4BRG A;  3EE9 A;  1SZ2 A;  4FJ9 A;  4PY5 A;  3CC7 N;  3PO4 A;  3WT0 A;  4IEI A;  3DLG A;  4CK2 A;  5GAH P;  3THW A;  4DV2 K;  1YJ9 N;  1P90 A;  4FJG A;  2ITM A;  3DAW A;  4OVL A;  1ASV A;  2NRW A;  2HND A;  5D3G A;  2AP1 A;  4AHU A;  1VQL N;  5AFU H;  4BRN A;  3TTF A;  4Z4H A;  3JAM O;  3OBW A;  4A5A A;  3RMA A;  1ZXO A;  4IO8 A;  2NRR A;  3ID8 A;  4N47 A;  3P1G A;  3O4W A;  1XMQ K;  2W40 A;  3AVL A;  3RRH A;  1NJI O;  1X3M A;  2P9S B;  4KHU A;  4JKG B;  1KTQ A;  2HBM A;  3O1W A;  3PV8 A;  1J5O A;  1V4T A;  4WF9 L;  3HSC A;  4WFB L;  4NCA A;  4JEP A;  3OYH A;  4J2B A;  3AA5 X;  4FOI A;  1Q8I A;  2O8D A;  1M1K O;  4BC3 A;  2P9P A;  2HST A;  4DUZ K;  2I5J A;  1Z6R A;  1BIZ A;  3WXJ A;  1DLO A;  4W5T A;  2IVN A;  4BRI A;  3M5R A;  1NK8 A;  1NOY A;  1HRH A;  4I2Q A;  4OO1 J;  4ILJ A;  4FZZ A;  3HOT A;  4F9O A;  3PIP L;  3L2U A;  1W7A A;  4QCL A;  5J2Q A;  1WBB A;  2FBT A;  3TAR A;  4FSV A;  2OPP A;  2BE2 A;  5C2D A;  3DLR A;  4K8Z A;  3ZT3 A;  3MX2 A;  4H0V B;  1RFQ A;  4NYN A;  4ISF A;  2OPQ A;  3H45 C;  3U6F A;  4QS9 A;  2GEM A;  1IKW A;  1ILY A;  3G6E N;  4JHD A;  3NGZ A;  2OYQ A;  5I42 A;  1HKB A;  3VF2 A;  4KBO A;  4B1X B;  1GLF O;  3QET A;  3LAM A;  4O5B A;  3MAQ A;  2E2O A;  3V9U A;  3OYM A;  1BDG A;  2IS3 A;  3O08 A;  3DLE A;  2FSJ A;  4DV0 K;  1A5W A;  4CK3 A;  3O9S A;  3FLC O;  4JKF A;  2HHT A;  4B08 A;  3QEW A;  4PL7 A;  2P9K A;  5GIO A;  3VEN A;  3LP2 A;  4HTL A;  2PBD A;  3QFP A;  3L8B A;  2O8B A;  5E41 A;  3FGU A;  4H0Y B;  3V4I A;  4YNQ A;  4I6M A;  4BQL A;  3SQ1 A;  2Z1G A;  1OVY A;  3DRS A;  2ASO A;  2NRH A;  2O8C A;  4JI2 K;  4V19 S;  3ZLJ A;  4B3S K;  4E1J A;  1NWK A;  4BC2 A;  3QDK A;  4CJE A;  4Z4I A;  3SLC A;  1ZBU A;  3VQP A;  1TAU A;  4ID5 A;  5FLX O;  4EP5 A;  3M3Z A;  4R5P A;  3D2F A;  2H3G X;  2Q3S A;  3KZB A;  2EX3 A;  4BR7 A;  2Y1I A;  5KGX A;  4RW9 A;  4BAC A;  5FRO A;  4KO0 A;  4BRL A;  3MMV A;  1OH5 A;  4ILG B;  4N41 A;  5AQM A;  3CME N;  5M1P A;  3VQ4 A;  4NCG A;  4CGI A;  1NK4 A;  2GX9 A;  2OCE A;  5FRN A;  3UKU B;  4HHT A;  2Q1N A;  4ICL A;  5BPN A;  2HHS A;  3CCR N;  3HZ6 A;  1RIL A;  4BWM A;  5HRO A;  4CGG A;  4DSF A;  4M3Y A;  1TUU A;  4H5V A;  5AQQ A;  1L3T A;  3QES A;  4MFB A;  1GLL O;  3R3L A;  2KLA A;  3OS0 A;  1LV5 A;  4DQ8 A;  1HNW K;  2P9L A;  4DTU A;  1NM1 A;  2WUS A;  4JD2 A;  3ZSZ A;  3MN5 A;  2PZS A;  1UAX A;  4NO7 A;  2OAN A;  4AHC A;  1U45 A;  1NJX A;  4U7B A;  1YIJ N;  4DR1 K;  2FF6 A;  4CJQ A;  4KB0 A;  3SAF A;  5SWM A;  1C1B A;  3L4Q A;  4G9Z A;  2G8V A;  2OTL N;  1BI4 B;  2DFE A;  2PAV A;  4RCH A;  5AQT A;  3HI0 A;  5JMV A;  3AO5 A;  4CZI A;  2O8F A;  2UUA K;  1S72 N;  1UWB A;  2ASM A;  4GV9 A;  1HX1 A;  1MWK A;  4B9Q A;  4BG8 A;  4CD3 A;  1BA0 A;  5AQG A;  1NOZ A;  4A61 A;  3SK3 A;  4O8U A;  4IXC A;  1QSS A;  1EWQ A;  1WUA A;  5M1N A;  3TAF A;  2A5X A; 
#chains in the Genus database with same CATH homology
 4F2R A;  3V9X A;  1LW2 A;  2XY6 A;  1SL1 A;  5DK5 A;  2ETJ A;  1SKR A;  1RT6 A;  1TL3 A;  2HHQ A;  1RBS A;  1MU2 A;  3G0Z A;  4G1Q A;  4OKK A;  5T7B A;  4M3Z A;  3M8P A;  3OVN A;  3OYC A;  3C6U A;  4ID1 A;  4AHS A;  3LWL A;  3V81 A;  3TAP A;  4B9S A;  5KI6 A;  3L2Q A;  4CIF A;  4DQS A;  3NDK A;  3KKR A;  1QTM A;  4ZTJ A;  3IAY A;  4M3X A;  5EU7 A;  1RNH A;  3QIP A;  3SQ2 A;  3VQA A;  3F9K A;  4CFB A;  4CF9 A;  4DSE A;  1LAV A;  4FK0 A;  4FVM A;  1J53 A;  1A5V A;  3NE6 A;  4W5O A;  2VG6 A;  4CEQ A;  1JLQ A;  1JLB A;  3PX0 A;  3KD5 E;  3HP9 A;  3K5L A;  4E7I A;  1C0M A;  4FLZ A;  3I8D A;  4KRF A;  1C1A A;  3L3U A;  3ZSV A;  1JLG A;  1L3V A;  3B6O A;  1VSI A;  1NKB A;  4Z4F A;  3DLH A;  4B8A B;  1T05 A;  1W9H A;  3AV9 A;  3IG1 A;  4FLT A;  3RTV A;  3HK2 A;  3SUO A;  1NKC A;  4F4K A;  2ZD1 A;  3AO2 A;  3KKS A;  3IS9 A;  2YKM A;  4H4M A;  1Q9X A;  3OYF A;  3AVH A;  3SQ4 A;  3TAB A;  3ZT4 A;  4DTP A;  3T3F A;  4Q5V A;  4PQU A;  3C6T A;  4IBN A;  1IKV A;  1BCO A;  1K6Y A;  3K2P A;  2E4L A;  1ASU A;  1RBU A;  5J2P A;  5FRM A;  4FJX A;  1EET A;  1JL1 A;  1LWE A;  2NUB A;  3OYB A;  2VWK A;  4TSX A;  3U3G A;  3VQ5 A;  5KGW A;  4CJS A;  4FJJ A;  4IDK A;  2GV9 A;  4M41 A;  1GOA A;  1D5A A;  1ZBL A;  3PX6 A;  1XC9 A;  3OYD A;  2HHV A;  1S1V A;  4Y1D A;  4Z0U A;  1UA1 A;  4IFV A;  4O4G A;  1KVB A;  3AO3 A;  2FBY A;  1EXQ A;  4KAZ A;  3ZSY A;  1HQE A;  2RF2 A;  4ELV A;  4M3W A;  4H4O A;  4I2P A;  1JLE A;  3VN5 A;  2P5G A;  1RDB A;  2HMI A;  2JLE A;  3QNO A;  3LPU A;  3PUF A;  4JRQ A;  3TAG A;  1KRP A;  4DSK A;  4E0D A;  1RBR A;  2GBZ A;  3MXM A;  1S1W A;  3LZJ A;  4C8M A;  4CIG A;  1C6V A;  2IAJ A;  4CE9 A;  5KRT A;  4B9T A;  4OGC A;  2PYL A;  5HRS A;  2KZM A;  4Y1C A;  4AIL C;  1TKZ A;  3QNN A;  4CJP A;  1KSP A;  4DMN A;  3RMD A;  2OPS A;  1KLN A;  3QLH A;  1BIS A;  1IO2 A;  3BGR A;  5HRP A;  1T03 A;  5CYQ A;  2B5J A;  1BI4 A;  2B6A A;  3S3M A;  1G15 A;  4DQP A;  4IKF A;  4RW4 A;  3EYZ A;  2G8F A;  3KLF A;  1I39 A;  4AHR A;  3HT3 A;  1ASW A;  1SKW A;  3MXJ A;  4KHW A;  3O3H A;  2XY7 A;  4KI6 A;  3OYK A;  2ITG A;  3WNF A;  5J1E A;  4NCB A;  2HHU A;  4BE1 A;  1D9D A;  1ZBF A;  3AVK A;  4HTU A;  4B9U A;  3AVC A;  2VG5 A;  3CFP A;  3KJV A;  4DLG A;  4KKO A;  3HM9 A;  4UQG A;  3DRP A;  4HUF A;  3TAN A;  4DWI A;  3WNH A;  1XI1 A;  4OKE A;  1CLQ A;  2G8U A;  3DLK A;  4B9L A;  2F8T A;  3K58 A;  4JS5 A;  3BDP A;  4DFP A;  3HPH A;  4ELT A;  4F8R A;  1RT1 A;  3DOL A;  3F73 A;  2KW4 A;  3TR8 A;  1QSY A;  1SL0 A;  3NCI A;  4C8K A;  1JXE A;  4Q0B A;  4CEO A;  4KB1 A;  4CCH A;  1F21 A;  4OJR A;  2G8K A;  1HJR A;  1RTD A;  4E19 A;  4FLY A;  3NHG A;  3V1O A;  4JRP A;  1TVR A;  2QK9 A;  2HHW A;  2FC0 A;  3OYI A;  4CJR A;  1RT5 A;  1XHX A;  3NGI A;  1T7P A;  1RDD A;  4LH4 A;  4K8X A;  4GVM A;  4CHN A;  3OJS A;  3K5M A;  4E3S A;  1U4B A;  4FYD A;  1KVC A;  1Z25 A;  5JS1 A;  4KTQ A;  1Y97 A;  4CJF A;  4W5N A;  3LDS A;  1VK0 A;  2BDP A;  5C25 A;  4DF8 A;  3SPZ A;  1NK7 A;  5HBM A;  1HYZ A;  3TAE A;  2HVH A;  2G8W A;  4EZ6 A;  3NH0 A;  1CZB A;  3U3Y A;  4DTO A;  3O4Q A;  3LWM A;  1WAJ A;  1JL2 A;  3V1Q A;  2E6L A;  1NK9 A;  3VQ7 A;  3ZSQ A;  4CJ4 A;  1LW0 A;  1WN7 A;  3TWH A;  4AHV A;  3NAE A;  1RT7 A;  2X74 A;  5J2M A;  2ZE2 A;  1REV A;  3HPG A;  1U49 A;  3RWU A;  3PO5 A;  1WSI A;  5JS2 A;  4BDP A;  4DTS A;  4OLA A;  3HPO A;  1EKE A;  1WSG A;  2KQ2 A;  3DMJ A;  4GW6 A;  4CHP A;  4E1M A;  3SYZ A;  3O3G A;  4CK1 A;  4CJ5 A;  4FM0 A;  1CXU A;  3HP6 A;  5I3U A;  2HNY A;  1ZBI A;  2GUI A;  2HVI A;  1WSF A;  2HHX A;  1FK9 A;  4DU1 A;  3DM2 A;  4FLW A;  4PUO A;  4E89 A;  1O1W A;  4BDZ A;  5HP1 A;  1QSL A;  4BE0 A;  4KRE A;  4C8L A;  4DQQ A;  3H08 A;  3RR7 A;  4OPJ A;  3DI6 A;  3CFR A;  3L3V A;  3SQ0 A;  1I3A A;  4CJ3 A;  1ZYQ A;  1SKS A;  1N5Y A;  2AJQ A;  4E7J A;  4CJW A;  1NK0 A;  2O4G A;  4HUE A;  2BAN A;  3S9H A;  4DLE A;  5C42 A;  4FJ7 A;  4O0J A;  3QO9 A;  5J2N A;  5HLF A;  4L8R B;  1QS4 A;  1FKP A;  1S6P A;  2IC3 A;  3ZCM A;  2QKB A;  4DQI A;  3ZSW A;  4CHO A;  3NF6 A;  1VSH A;  1EX4 A;  3C94 A;  4KHY A;  3WNG A;  4DS5 A;  4AHT A;  3OYL A;  1HNV A;  4LH5 A;  4CGF A;  1TKX A;  1RDA A;  2DFF A;  4CEC A;  1HNI A;  1SV5 A;  1X1P A;  3O3F A;  1J54 A;  3RRG A;  4FJ5 A;  1RCH A;  2OZM A;  3VQQ A;  1TAQ A;  1Z26 A;  3ZSO A;  4XIU A;  1IKY A;  1VRT A;  3TI0 A;  4FK2 A;  4KTZ A;  3ZT1 A;  3RMB A;  3HJF A;  1JLA A;  4CGH A;  1IH7 A;  1HMV A;  1LAW A;  3AA3 A;  3AVB A;  3SUQ A;  3THV A;  4FK4 A;  4CES A;  3AVI A;  4IG0 A;  1CXQ A;  3V9S A;  3SV4 A;  1B92 A;  5HRR A;  1L3S A;  1HQU A;  1VSF A;  4FJ9 A;  1TL1 A;  4CEB A;  2XY8 A;  2VWJ A;  4OLB A;  4PY5 A;  3G10 A;  3PO4 A;  2F8S A;  3IRX A;  3DLG A;  3D0P A;  4CK2 A;  2WON A;  4FW2 A;  4DTX A;  4ZHR A;  1WSJ A;  1NK6 A;  3P5J A;  4FJG A;  1TKT A;  4OVL A;  3SNN A;  1ASV A;  3JSM A;  4C8O A;  2HND A;  2W42 A;  2IOC A;  5D3G A;  3AVA A;  2YNG A;  2XHB A;  4AHU A;  1DTQ A;  1IG9 A;  4CEZ A;  3KLG A;  3OYG A;  2D0C A;  4LSL A;  3DYA A;  4Z4H A;  2HW3 A;  1NKE A;  4LD0 A;  3M8R A;  1YTA A;  4CED A;  3S3N A;  5CY4 A;  4M3R A;  2RPI A;  4CJT A;  4N76 A;  1JKH A;  1HYV A;  3SCX A;  3RMA A;  3ISN C;  4HCC A;  4QOZ B;  2O4I A;  2D0B A;  4N47 A;  4CJL A;  5CZ1 A;  3P1G A;  4O55 A;  1BL3 A;  4F3O A;  3RMC A;  2ZQB A;  4B8C A;  4E7K A;  4CFA A;  3AVL A;  1IKX A;  1LWC A;  3RRH A;  4J2E A;  3NF8 A;  3LZI A;  3HVR A;  4OKJ A;  4KV8 A;  4DF4 A;  4KHU A;  3KTQ A;  3PV8 A;  1KTQ A;  1J5O A;  3NFA A;  1B9D A;  3VQ8 A;  1FKO A;  3CQ8 A;  4F3T A;  3KLH A;  1S6Q A;  3K59 A;  1A5X A;  4GMJ B;  3CFO A;  2F96 A;  3SJJ A;  2FBV A;  4NCA A;  2YHA A;  4DTN A;  4B3O A;  1VSJ A;  3OYH A;  4J2B A;  2A1R A;  3AA5 X;  4W5R A;  3RR8 A;  3QEX A;  4DSL A;  1Q8I A;  2P5O A;  3LAL A;  2X6N A;  2G8H A;  2XO7 A;  4Z4E A;  1GOB A;  2I5J A;  2LSN A;  4LY7 A;  3VQC A;  1BIZ A;  3HL8 A;  3K57 A;  4DS4 A;  3ULD A;  3QEP A;  1UA0 A;  1BQM A;  2RKI A;  3MXI A;  1JLC A;  2KTQ A;  1DLO A;  4Z4C A;  4DTR A;  3KD1 E;  1BIU A;  3QIN A;  1WSH A;  1S9E A;  4W5T A;  3SZ2 A;  1HYS A;  3OYN A;  5HRN A;  1RT4 A;  1NK8 A;  1NOY A;  3AVM A;  3V1R A;  5KRS A;  3L2V A;  1HRH A;  3SI6 A;  1U47 A;  4B9N A;  3AO1 A;  1S1U A;  4N5S A;  3MEG A;  3VA3 A;  3OY9 A;  3B6P A;  3VQE A;  4I2Q A;  3VQB A;  4CEF A;  4CER A;  4DTJ A;  3VQ6 A;  3ALY A;  4W5Q A;  2PYJ A;  4CHQ A;  1TK0 A;  1YT3 A;  4FZZ A;  4FJI A;  4AH9 A;  4QCL A;  1ITG A;  3L2U A;  5FDL A;  2KFZ A;  1S9G A;  5J2Q A;  1KCF A;  3SV3 A;  3M8S A;  3SUN A;  2FBT A;  1RBV A;  4ZTF A;  4M3T A;  3TAR A;  4E7L A;  1XHZ A;  1UOC A;  3L2R A;  1YTU A;  3HYF A;  2OPP A;  1C0T A;  2BE2 A;  3AA4 A;  4FM2 A;  3DLR A;  2IGI A;  4ELU A;  3ZT3 A;  3AVF A;  4CF1 A;  4K8Z A;  3VQD A;  4DG1 A;  3OYE A;  4NYN A;  2D0A A;  2OPR A;  3QEV A;  3MED A;  4QAG A;  1FXX A;  2OPQ A;  3TAM A;  3U6F A;  1CZ9 A;  1KLM A;  1JXB A;  1IKW A;  1S5J A;  4CF2 A;  4CHY A;  5DMR A;  4CF8 A;  4KPY A;  3NGZ A;  2OYQ A;  2G8I A;  4DU3 A;  5I42 A;  3QEI A;  4B9M A;  4IFY A;  2PY5 A;  4F2S A;  3QET A;  4O0I A;  3LAM A;  4RG8 A;  4JS4 A;  4IG3 A;  4O5B A;  3MAQ A;  1D8Y A;  1QQC A;  3MEE A;  3T1A A;  3V9U A;  2P51 A;  2Y1J A;  3OYM A;  1X9S A;  2IS3 A;  4FJM A;  3DLE A;  3S3O A;  1A5W A;  3DRR A;  4CK3 A;  3KK3 A;  1X9W A;  3DOK A;  4E1N A;  4KHN A;  3JYT A;  2HHT A;  3ASM A;  2Z1H A;  3AVJ A;  1Q9Y A;  3WNE A;  4B08 A;  3NH1 A;  3QEW A;  3VQ9 A;  3LP2 A;  2X78 A;  2DY4 A;  3FFI A;  3OS1 A;  4FLV A;  1NJY A;  4BDY A;  3K5N A;  3L8B A;  2KFN A;  3OJU A;  5K14 A;  4M42 A;  5E41 A;  1L3U A;  1NK5 A;  3OS2 A;  3PY8 A;  3E01 A;  3HST B;  3ZT0 A;  1QE1 A;  2D5R A;  4NYF A;  4FJH A;  3V4I A;  2WOM A;  4YNQ A;  3NH2 A;  3LAK A;  4HVJ A;  3SQ1 A;  3ZSX A;  1W0H A;  2Z1G A;  1EP4 A;  1QHT A;  3DRS A;  1SUQ A;  1KFD A;  4O44 A;  3HVT A;  4CJU A;  2XY5 A;  1NJZ A;  4HCB A;  3NGY A;  1TK8 A;  3LP3 A;  1WLJ A;  4I9L A;  4LSN A;  3KLE A;  3NF7 A;  3K5O A;  3AA2 A;  1XWL A;  4C8N A;  3ITH A;  5KTQ A;  1N6Q A;  3NF9 A;  1VSE A;  4Z4I A;  4CJE A;  1VRU A;  3AO4 A;  2YV0 X;  3CG7 A;  1ZBU A;  3VQP A;  3EY1 A;  3OYJ A;  1D9F A;  2OA8 A;  4FJ8 A;  1X9M A;  1TAU A;  5CYM A;  4ID5 A;  4EP5 A;  1HPZ A;  4RW6 A;  4CIE A;  1C1C A;  2KZZ A;  1DTT A;  4R5P A;  3CM6 A;  4DU4 A;  3VA0 A;  3L2W A;  1T8E A;  1KVA A;  3C95 A;  2X6S A;  2OZS A;  1J9A A;  1C0U A;  2E6M A;  2Q3S A;  3LAN A;  3QIO A;  4I7F A;  4RW8 A;  3ZT2 A;  1WAF A;  2YKN A;  2EX3 A;  3CM5 A;  4KFB A;  4RW7 A;  4CEE A;  4MQ3 A;  3M8Q A;  1BGX T;  3LP0 A;  4EP4 A;  2Y1I A;  5KGX A;  2BGG A;  1S1X A;  3D45 A;  4RW9 A;  4CJV A;  3I0S A;  3SUP A;  4BAC A;  5FRO A;  1B9F A;  1WSE A;  4KO0 A;  2EHG A;  1RTI A;  4FCY A;  4CFD A;  4BWJ A;  1ZBH A;  4EZ9 A;  2QKK A;  3NBP A;  4DSJ A;  2P1J A;  4N41 A;  1WNS A;  3P83 D;  4FZY A;  3VQ4 A;  1TV6 A;  1RBT A;  4NCG A;  1YVU A;  4CGI A;  1NK4 A;  1U48 A;  1L5U A;  4DSI A;  5FRN A;  4HHT A;  4ICL A;  2YNF A;  1VSK A;  2HHS A;  4KHQ A;  4CFC A;  4FJK A;  4KTW A;  2RN2 A;  1RIL A;  4BWM A;  3EZ5 A;  5HRO A;  1TKD A;  1RT3 A;  4CGJ A;  4CGG A;  4CEA A;  4M3U A;  3CYM A;  4DSF A;  3AVG A;  2R7Y A;  4DFM A;  3DLB A;  4KHS A;  1RTJ A;  4M3Y A;  4FW1 A;  3QES A;  1L3T A;  1BQN A;  2FBX A;  3QER A;  2JGU A;  4DFK A;  2DTU A;  4MFB A;  2HB5 A;  5CZ2 A;  1RDC A;  3LP1 A;  3OS0 A;  4HUG A;  1LV5 A;  4DQR A;  4DTU A;  2QXF A;  3O4N A;  2IDO A;  4N56 A;  4CJK A;  4FJL A;  3ZSZ A;  4FLU A;  4B9V A;  4J2D A;  1NJW A;  1BHL A;  1JLF A;  1U04 A;  2HNZ A;  3KIO A;  2PZS A;  1UAX A;  1S1T A;  4AHC A;  1U45 A;  4J2A A;  1NJX A;  1RT2 A;  4I9Q A;  2Z1J A;  4FZX C;  4CJQ A;  2YHB A;  4KB0 A;  1TGO A;  5SWM A;  4PA1 A;  3KK2 A;  3HO1 A;  4OPK A;  1C1B A;  2YNH A;  4OGE A;  4FM1 A;  2ATQ A;  1VSL A;  4CGD A;  2G8V A;  1GOC A;  3KLI A;  1R0A A;  1BI4 B;  2DFE A;  2XRI A;  3MEC A;  4DTM A;  3AO5 A;  3TAQ A;  3V6D A;  1SL2 A;  4FJN A;  4PWD A;  2A1S A;  3A2F A;  3I0R A;  4BE2 A;  1UWB A;  4KI4 A;  3KK1 A;  5SZT A;  2B4J A;  1RTH A;  5C24 A;  4WE1 A;  3UIQ A;  1TK5 A;  4DFJ A;  1VSD A;  4H8K A;  2Z1I A;  1NOZ A;  2YNI A;  3V9Z A;  4FLX A;  2DFH A;  4Z4G A;  3PX4 A;  4CF0 A;  3SPY A;  4M45 A;  4CHZ A;  4JLH A;  2VG7 A;  4YFU A;  3OYA A;  3V9W A;  1LWF A;  1QSS A;  1VSM A;  3LPT A;  3HXM A;  3T19 A;  1BCM A;  4E7H A;  4FXD A;  3TAF A;  3ZSR A;  3AVN A;  1KFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...