1ASWA

Avian sarcoma virus integrase catalytic core domain crystallized from 20% peg 4000, 10% isopropanol, hepes ph 7.5 using selenomethionine substituted protein; data collected at-165 degrees c
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
152
structure length
152
Chain Sequence
REPRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHFER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna integration
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title High-resolution structure of the catalytic domain of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Avian sarcoma virus
total genus 53
structure length 152
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1aswA00
3SJJA 2OPSA 2FC0A 4LH4A 2HHWA 3OYNA 4HHTA 4DF4A 4C8KA 2HNZA 3NGZA 1UA1A 4NCGA 4FJGA 4AHVA 4M3YA 1DTTA 1NK9A 1RILA 1BIUA 4HUFA 4CGDA 3TR8A 3QLHA 1JLEA 3VN5A 4DTOA 1WSGA 1X9SA 1TKTA 4Z0UA 4CK3A 2HNDA 1KFSA 1T7PA 3RR8A 2OZSA 3DRPA 4CJSA 4B8CA 1SL2A 1QSLA 1B9FA 2B4JA 2X6SA 4IG0A 4DG1A 4CJKA 3HO1A 3DRSA 3VQQA 4E0DA 3DM2A 4BE1A 4DTRA 1NK7A 1VSIA 4OLAA 5HRSA 3UIQA 2A1SA 4F2SA 1HJRA 1IO2A 1XWLA 4Z4HA 3U3YA 2G8KA 4IFVA 1LWCA 2BE2A 2HHXA 1BL3A 4DU4A 4M45A 2XHBA 3PV8A 1DLOA 3NF6A 1TKDA 1D8YA 2JGUA 2X74A 3QEPA 1QE1A 1QSSA 4BDZA 3SYZA 1JL2A 3V1OA 1T05A 1A5VA 4LSNA 3RTVA 1RDAA 2HVHA 3TABA 1W9HA 1J5OA 2F8SA 4ELTA 2KFNA 2EHGA 4B9MA 4Z4GA 4FM0A 3OJSA 2HNYA 2QXFA 1JLGA 4DFMA 4L8RB 4GVMA 2Z1IA 1BGXT 4Z4IA 3SQ4A 3AA4A 1CZBA 3DLRA 1S1TA 3OYGA 4PA1A 2QK9A 2E6LA 3C6TA 1S1UA 3ZSZA 4E19A 4R5PA 4ZTFA 4I7FA 4F8RA 4M3UA 2HHQA 4DTUA 3KLFA 1L3TA 2IGIA 3AVLA 3L8BA 5SWMA 3ZT2A 4E7IA 1RBVA 4F3OA 4FJ8A 5J2MA 3DI6A 5KRSA 3OYMA 3D0PA 4E1NA 1TKZA 5KTQA 2ATQA 3LZJA 4FZXC 1HYVA 3L3VA 4FYDA 1HQEA 1RBUA 1TKXA 1NK0A 5CZ2A 4DSLA 4PY5A 2JLEA 3ASMA 3DLBA 3RWUA 2G8WA 2W42A 4FLWA 4DQRA 1MU2A 2E6MA 4E7KA 3C94A 4C8MA 3L2RA 2GUIA 1SKWA 2G8FA 2PY5A 1LW2A 1Z26A 3AVHA 4NYNA 3WNEA 3ZT3A 4CIEA 2NUBA 4Q0BA 4BDYA 4XIUA 4FZYA 3WNHA 3SZ2A 5C42A 1W0HA 1TAQA 3RMBA 4IKFA 2YNHA 2ETJA 4CEBA 3DRRA 3M8QA 1FKPA 3D45A 3ULDA 1I3AA 2OYQA 5JS1A 3ZSRA 4BE2A 4DTPA 3QINA 3P5JA 1ASWA 2G8HA 1Y97A 4OGEA 3VQDA 2VWJA 1XC9A 3S3OA 4J2EA 4OLBA 5KGXA 3HSTB 5FRMA 3NHGA 5FRNA 4BE0A 4KKOA 3VQBA 2R7YA 3ZSYA 3KLEA 3KD1E 4M42A 3LAKA 2I5JA 4CGFA 3K5LA 3RRGA 4CF0A 3V9WA 1NK4A 4FVMA 1UA0A 3AVGA 1ZBIA 4DQIA 3TI0A 1WSJA 1YVUA 3AO3A 3CM5A 2HW3A 1GOBA 2QKKA 1BHLA 1RDBA 2VG5A 2RPIA 2XY5A 2BDPA 3ITHA 1O1WA 4KHQA 4IDKA 3TANA 3L2WA 1D9FA 3OYCA 2YHBA 3LALA 3AVCA 3K5NA 4W5RA 1C6VA 1JKHA 4OPJA 3HL8A 4ZTJA 1L3VA 1X9WA 4KI6A 3AVKA 5FDLA 4EP4A 3ZT4A 4Q5VA 2P5OA 2FBYA 2IDOA 4CIFA 4N56A 3M8PA 3NGYA 3KK1A 4W5NA 4B9LA 2IS3A 4B8AB 4O5BA 3OJUA 4FXDA 3VQCA 1KRPA 3SQ0A 1XHZA 3O3HA 1GOCA 3FFIA 1IKVA 4I2PA 4HCBA 5KI6A 2OZMA 4FJKA 1C0MA 1U04A 2BANA 3KK2A 2XY7A 1XI1A 1TK8A 3OYBA 5HP1A 4LY7A 4OVLA 2Y1IA 4CGJA 1BCOA 3HVRA 1C0UA 3I0SA 4KTQA 3BGRA 3A2FA 1S1VA 4HVJA 3O3FA 1WAJA 4FM2A 1VSKA 3HT3A 1CZ9A 1NJYA 3HJFA 3SPYA 2GV9A 1SKRA 1RCHA 3KIOA 2EX3A 3KD5E 4W5TA 3U3GA 3DYAA 3IG1A 3VQ4A 2X6NA 1C1CA 3SCXA 1WLJA 4CJTA 4W5OA 1RT6A 4CGIA 3OYFA 3SQ2A 3SUOA 3PY8A 5J1EA 3EZ5A 4DTNA 1TK5A 1X1PA 5T7BA 4YNQA 3IRXA 3V1RA 1F21A 3K57A 2O4GA 4DTSA 1L3UA 3ZSVA 4OKKA 1YTAA 3SUPA 4K8ZA 4GW6A 4QAGA 3NH2A 1VSLA 4KREA 1BCMA 1ITGA 4FW2A 5HRPA 3AVBA 2G8IA 2DFEA 3RRHA 2Z1GA 3TAFA 3T1AA 2YKMA 4CK1A 4CF1A 3HPGA 4E7HA 4Y1CA 3O4QA 3L3UA 2F8TA 4KFBA 5HRRA 1IKXA 5C24A 4CHQA 3LDSA 4AHCA 4LSLA 1U47A 5E41A 2VWKA 4J2DA 2DTUA 4O55A 4FM1A 4AHTA 5EU7A 1HYZA 1ZBFA 3LP1A 3B6PA 5I3UA 3T3FA 1I39A 4YFUA 1ZYQA 3TAMA 2PZSA 1RTIA 3AVFA 4KRFA 4DSJA 2A1RA 4M3XA 4FCYA 4WE1A 3B6OA 3L2UA 2FBXA 4CJ5A 3SV4A 3QNOA 2YV0X 3AA3A 3U6FA 3PX4A 3M8RA 1HNVA 1RT3A 3SUNA 4B9UA 4KAZA 4CF9A 4J2AA 2BGGA 4CCHA 4DLGA 3TAQA 1VSHA 4RW9A 4O44A 4OKJA 4CEFA 1ZBLA 1ASUA 1BISA 1LAWA 1LWEA 3CG7A 4EZ6A 4C8LA 2OPRA 1NKCA 4CFBA 2RF2A 2P1JA 4KTZA 2HB5A 3QEVA 4FJ5A 3JSMA 3SQ1A 3LPTA 2ZQBA 4ELUA 3AVNA 2B6AA 4CFAA 3PX6A 3KTQA 3TAGA 3DLGA 4KHWA 3KKRA 4MFBA 4KO0A 1U49A 1NJWA 2HHUA 3TAEA 2YKNA 5C25A 4DS5A 3K58A 5CZ1A 4CEOA 3K59A 4DQPA 1NK5A 1QHTA 1IH7A 3MAQA 3SNNA 1HPZA 4FJIA 4FK4A 1ZBHA 3MEGA 3QEWA 1LAVA 1TVRA 1KLMA 1A5WA 3C95A 3OS2A 3PUFA 3S9HA 1KVCA 4M3WA 3MEEA 1TV6A 3OYHA 4Z4CA 3AVMA 1REVA 3K5MA 4DFJA 3S3MA 3IAYA 3QESA 1NKBA 1HQUA 3VQ6A 5J2PA 1S6QA 2KTQA 2WONA 1TK0A 5CY4A 1S9EA 3K5OA 4AHUA 1T8EA 3MXJA 2F96A 4CJQA 1NOZA 1NK6A 1S6PA 2ITGA 3VQPA 3AA5X 1SKSA 3I0RA 4W5QA 4NCBA 1RBSA 3CYMA 4M3ZA 1KCFA 4CHYA 2KZZA 2HVIA 3S3NA 4TSXA 4N47A 5D3GA 1TGOA 4PQUA 2P5GA 3IS9A 3AO1A 1S9GA 3QETA 4FLVA 1WAFA 4CHNA 3OYEA 3NE6A 3NCIA 1RTHA 1Q9XA 4QOZB 4CK2A 2DY4A 4CHPA 4DU1A 3SUQA 2KZMA 4ID5A 2XY8A 1RT2A 4HUEA 5JS2A 3AA2A 1YTUA 4CJRA 4KHYA 2Z1HA 1NK8A 3HYFA 4FJ7A 1RT1A 4DLEA 1CLQA 1C0TA 2YNIA 4RW6A 3PO5A 2D0BA 5HBMA 4CIGA 3LZIA 4IFYA 4CF2A 4FJXA 4H4OA 3OYKA 3RMCA 3WNGA 3DOLA 3OYJA 3ZCMA 1K6YA 5DK5A 1SV5A 2VG6A 5HRNA 3RR7A 4B9NA 2D5RA 3AVAA 5CYMA 4H4MA 2RN2A 3DOKA 4PUOA 4Z4EA 1S5JA 3OYDA 4BWJA 4PWDA 3TWHA 3V4IA 1VRUA 1QTMA 4B9TA 1S1WA 3I8DA 4BDPA 1FXXA 1D9DA 2AJQA 4FLUA 3MECA 4QCLA 1RTJA 1RDCA 2ZE2A 4CERA 1KLNA 1DTQA 3HPHA 3KLHA 4FLYA 1EETA 3AVJA 4CGHA 4JRQA 3RMDA 3SPZA 1Q9YA 1RNHA 1SUQA 3AVIA 3VA0A 5HROA 4N41A 1VSDA 4DU3A 1NJZA 4E7JA 4O0JA 4F3TA 4DSFA 3HP9A 4DF8A 1X9MA 2HMIA 1EKEA 1RDDA 3NF8A 4CEEA 1BQMA 1UAXA 4I2QA 3PO4A 1LW0A 2IOCA 1EXQA 4HTUA 4K8XA 3ZSXA 4KV8A 1S1XA 4AHSA 4KHUA 1VRTA 4KHNA 3KK3A 3KKSA 4KHSA 4DMNA 4FZZA 3H08A 4DQSA 1G15A 3F9KA 3OYLA 4HCCA 1RTDA 1EP4A 4RW7A 1HMVA 1NOYA 1TL1A 4DFKA 4AILC 1WN7A 2RKIA 3HP6A 4NCAA 2OPPA 2WOMA 4CF8A 5SZTA 3V9SA 1SL1A 1WSHA 4FLXA 4FK0A 1VSEA 4KI4A 4BACA 3P1GA 1FKOA 2IAJA 1RT7A 4RW4A 3TAPA 4HUGA 3DLHA 5I42A 4CGGA 4JS5A 3CM6A 1QQCA 2P51A 3ZSOA 3NAEA 1Q8IA 2YHAA 3MEDA 1J54A 3F73A 3LANA 1WSIA 3QEIA 5K14A 3LP3A 1D5AA 4DTMA 4EZ9A 3TARA 1VSFA 4LH5A 1B92A 3G10A 3LAMA 2KW4A 4CJPA 2HHSA 1IKYA 1LWFA 1XHXA 3L2VA 3M8SA 4CFCA 2B5JA 2LSNA 3NF7A 4E1MA 3MXIA 3AO2A 4CESA 3RMAA 1U4BA 5KGWA 4CE9A 3VQ8A 2O4IA 1CXQA 4CFDA 1N5YA 3NBPA 2QKBA 4FLZA 4CJWA 2GBZA 3G0ZA 4RW8A 1A5XA 3LWLA 5FROA 4CHOA 4CHZA 1JLCA 1WSEA 1VSJA 3KLGA 1RBRA 4O4GA 3SV3A 3C6UA 4FK2A 2ZD1A 4B3OA 3AO4A 1ZBUA 3ZT1A 3QO9A 3O3GA 3KLIA 3CFRA 3CFOA 3V9XA 2HHVA 2X78A 1VSMA 1FK9A 3DLEA 3LWMA 4N5SA 4DWIA 4RG8A 4B08A 4LD0A 3CQ8A 4G1QA 3LP0A 3PX0A 3NFAA 4DFPA 4CEDA 3OY9A 1HNIA 4CJ3A 3OS0A 3OVNA 1J53A 3KJVA 3AO5A 1TAUA 1KSPA 3NH1A 3QNNA 2Z1JA 2KFZA 3O4NA 4CJLA 3THVA 3NGIA 4BWMA 4GMJB 1KVBA 4I9QA 1TL3A 4DQQA 4FJNA 1U48A 3HXMA 2G8VA 4CJ4A 2D0AA 4CEZA 4FJHA 3V6DA 1B9DA 1RBTA 3NF9A 5KRTA 1LV5A 4KB1A 2KQ2A 2PYJA 1L3SA 3OS1A 3ISNC 4EP5A 3DLKA 3LPUA 3QERA 5HLFA 1GOAA 4FLTA 4KTWA 3VQAA 2DFHA 3OYIA 3QEXA 4OPKA 1WNSA 3OYAA 3LP2A 3VA3A 3BDPA 4F2RA 1WSFA 4M3TA 3DMJA 4I9LA 2XRIA 4CJEA 4DTJA 3EYZA 4ICLA 1JXBA 1Z25A 1UOCA 3NDKA 3HK2A 1KFDA 3V9ZA 3QIPA 5DMRA 1JL1A 2E4LA 3WNFA 3SI6A 4DSKA 1IKWA 5CYQA 4M3RA 4FJMA 4IBNA 1SL0A 3MXMA 4ZHRA 1KTQA 1JXEA 1J9AA 4Z4FA 3VQ9A 1BI4B 4CEAA 4JLHA 1KVAA 4E89A 1NKEA 1VK0A 3HVTA 3V1QA 1BI4A 1BQNA 1RT4A 4CJVA 4UQGA 4OJRA 3EY1A 1QSYA 4E3SA 4Y1DA 4M41A 3V9UA 2Y1JA 2OA8A 1C1BA 1HYSA 1JLFA 4DSIA 4DS4A 3AV9A 4DTXA 2VG7A 3V81A 4CJUA 2YNGA 4DSEA 4MQ3A 1U45A 1N6QA 1ASVA 4E7LA 2PYLA 1YT3A 4CEQA 4AH9A 4FJLA 2Q3SA 1JLQA 4B9VA 4N76A 2IC3A 4AHRA 4ELVA 3T19A 1EX4A 3E01A 4FJJA 4JRPA 4KB0A 3NH0A 4J2BA 2D0CA 2OPQA 2XO7A 1R0AA 4C8NA 2XY6A 1JLBA 3HM9A 1HRHA 3P83D 1IG9A 2YNFA 4F4KA 3K2PA 1QS4A 4ID1A 1T03A 4C8OA 4CECA 2HHTA 4B9SA 3ZT0A 3L2QA 4H8KA 1BIZA 1JLAA 3VQ7A 3CFPA 4JS4A 1NJXA 3ALYA 2FBTA 3QIOA 5J2NA 3ZSQA 4FW1A 1UWBA 1C1AA 2DFFA 3VQEA 4O0IA 4OKEA 3HPOA 4IG3A 3JYTA 2FBVA 3VQ5A 4NYFA 5J2QA 4KPYA 4OGCA 4FJ9A 1RT5A 4CJFA 3ZSWA 1L5UA 1CXUA 2G8UA
chains in the Genus database with same CATH superfamily
3PSFA 3OYNA 4QS7A 5AQQA 1J6ZA 4CGDA 3TR8A 1X9SA 1WSGA 4JYAK 4PKIA 4JEPA 4Z0UA 2HNDA 3VGLA 2OZSA 3DRPA 2HOEA 4CJSA 4B8CA 1QSLA 2X6SA 4CJKA 3DRSA 3CCMN 3PLAA 2UUBK 4OLAA 3UIQA 2HHHK 4F2SA 1IO2A 1LWCA 2HHXA 1BL3A 4DU4A 1TKDA 2FLOA 5EY4A 3RVCA 4BDZA 1QSSA 3UKUA 4ISEA 4H5WA 2P9SA 3TABA 5GAHP 2F8SA 5GAEP 3QDKA 2KFNA 4Z4GA 3OJSA 2HNYA 3ID6A 4BC5A 1BGXT 3SQ4A 3DLRA 2OANA 4DV3K 3OYGA 4CZHA 3C6TA 1W97L 3AVLA 2VQEK 4E7IA 2E88A 5J2MA 4IJAA 3LZJA 3L3VA 4X64K 1HQEA 1RBUA 3O9SA 4PY5A 3ZYYX 5AQXA 1OKJA 2W6KA 4DQRA 2KKZA 4B1YB 4HWIA 4BY9C 4E7KA 1NGBA 1SKWA 3CC7N 1NGEA 4BDYA 4IKFA 1TAQA 5AQJA 2ETJA 3THWB 1BWFO 1EWRA 2OYQA 5JS1A 3MK6A 4JI3K 3P5JA 1ASWA 3ZETA 5KQDA 2WC9A 2VWJA 3S3OA 2E1ZA 5KGXA 4CZGA 1S22A 5FRNA 4KKOA 3WXJA 3KLEA 2I5JA 2QWRA 4FVMA 3AVGA 5EX5A 4A59A 3TI0A 3AO3A 4JNEA 3TSQA 1GOBA 5M1QA 3A5MC 1KQSM 1D9FA 3OYCA 3LALA 1JKHA 1XNRK 4PL8A 1X9WA 4EP4A 4DV5K 3SK3A 3ULEA 5LJWA 2IDOA 4MLHA 3ENBA 3M8PA 3U4LA 3KK1A 4LF4K 2QXLA 2QWQA 4JK7A 3THYB 1BA1A 4AM6A 4FJKA 1C0MA 1U04A 2XY7A 3KK2A 1XI1A 3ZEUA 4LY7A 2Y1IA 3HVRA 2QW9A 1ATSA 4HVJA 3O3FA 4X66K 3M3ZA 1IBMK 1NJYA 3DXMA 2GV9A 1SKRA 2BH1A 3U3GA 3DYAA 3B8AX 3VQ4A 1C1CA 5AQNA 4CGIA 2NRRA 4DTNA 3H45C 4B1VA 5T7BA 4YNQA 3IRXA 1VQNN 2O4GA 3F9MA 4JD2B 4DTSA 4OKKA 5LJVA 1T44A 3UKRA 5BPNA 4U7BA 2ASPA 3AVBA 4FPBA 2G8IA 3SMPA 4ILHA 2WUSA 4BC4A 3TAFA 2YJEA 2YKMA 4CF1A 4CK1A 1FW6A 5C24A 3LDSA 1J5EK 2KHOA 1TYQB 4LSLA 4DR2K 2DTUA 3OTOK 4FM1A 3LP1A 3TTFA 1ATRA 4LF9K 3AAQA 2A1RA 4A5BA 2FSNA 4FWRA 3QNOA 3SUNA 4DLGA 2GTDA 1DT9A 1ASUA 1MWKA 1LWEA 3CG7A 2OPRA 4FL9A 3SBTA 4CFBA 4ISFA 3L4QA 4K42A 4YOTA 2RF2A 4KTZA 2HB5A 4FJ5A 1IV0A 4WFAL 4CFAA 3KTQA 4BQZA 3HOSA 3TAGA 5FLXO 3NVMA 5BR8K 3UE5A 3W0LA 1U49A 2HHUA 3TAEA 2BUPA 3C7NA 2CH5A 1SQKA 1V4TA 3OBYA 1HPZA 4FJIA 3VEOA 1ZBHA 1TVRA 5C10A 1G99A 3WQTA 3D7EO 1TV6A 1N33K 1XUPO 1D4XA 1REVA 3S3MA 3IAYA 1HQUA 1S6QA 2WONA 1S9EA 4B9TA 1NK6A 3I0RA 4W5QA 2A3ZA 3TSUA 3CYMA 4M3ZA 4CHYA 2KZZA 2HVIA 4TSXA 3R9PA 1X3MA 2IVPA 4MDAA 3AO1A 1S9GA 3QETA 3NCIA 1BU6O 4CHPA 2KZMA 4HUEA 3AA2A 2Z1HA 1CLQA 5HBMA 4CIGA 4H4OA 2HBKA 3GL1A 1QZ5A 3RR7A 4H4MA 1XC3A 1HJOA 4BWJA 4PWDA 3TWHA 4JI1K 3I8DA 4BDPA 3Q7BA 4CERA 3HPHA 3SPZA 1EETA 1WUAA 3AVJA 3AVIA 2O8BB 2F9TA 4DV0K 1U2VA 4O0JA 3RSEB 1MDUB 4PL7A 4DSFA 3CERA 1EKEA 3NF8A 4CEEA 4CZMA 2IOCA 4OPHA 4RTFD 3JAMO 2VQFK 3ID8A 4QS9A 4KHSA 2HBJA 3HSCA 1JCEA 1RTDA 5AQHA 3SAHA 1WN7A 2RKIA 2WOMA 2DPNA 4FO0A 4FK0A 2KLAA 5EXWA 4CZLA 3DLHA 5I42A 4UY8O 1QQCA 1Q8IA 1Q86O 3MEDA 3QBWA 4YOYA 3KWIA 4EZ9A 4IO8A 3LP3A 4DTMA 3TPQA 1EWQA 1VSFA 1HLUA 2HHSA 4YORA 4XH4A 4CFCA 2LSNA 3LL3A 3NF7A 1YITN 3AO2A 3C6HA 3RMAA 1U4BA 5KGWA 2A5XA 3VQ8A 2AA4A 2QKBA 4FLZA 4H0XB 4RW8A 3DXKA 1A5XA 3O08A 3LWLA 5FROA 1VQ8N 4CHZA 3C6AA 3SV3A 3PIOL 4B3OA 3AO4A 1ZBUA 3ZT1A 4BREA 4XH5A 5AQYA 4BR0A 5C15A 3DLEA 1VSMA 5B8HA 1X9JA 4N5SA 1T6CA 4G1QA 3LP0A 3PX0A 1RFQA 1HNIA 4CJ3A 3KJVA 1J53A 1KSPA 3QNNA 3W3DA 4BWMA 2QWLA 4GMJB 2F7TA 4DQQA 1U48A 4CJ7A 1O13A 2D0AA 4BRNA 3V6DA 4KB1A 3VOVA 5KRTA 3QERA 4KTWA 3OYIA 3CCJN 3GOIA 1HPMA 3LP2A 3VA3A 3D6RA 5AFUH 4M3TA 3DMJA 2XRIA 3FGUA 3MN9A 4U67L 4KH5A 3EYZA 1Z25A 1UOCA 1ZBSA 4O8KA 1OH7A 3V9ZA 4ISGA 3E9PA 1M90O 3MXMA 2P9LA 3R3LA 1J9AA 3S41A 3VQ9A 1BI4B 4E89A 4CJVA 4UQGA 4OO1J 3E9OA 3V9UA 3CJ1A 4DR3K 4DSIA 1HKBA 3AV9A 2O8CB 4E7LA 2PYLA 4CEQA 4AH9A 2WBNA 2W6LA 3O1WA 4AHRA 1EX4A 1GLAG 3E01A 3HOTA 2HMPA 3FLCO 4C8NA 2XY6A 3HM9A 4DV2K 1RGIA 1IG9A 3K2PA 1QS4A 4GV3A 4C8OA 5FPMA 2YHXA 4YY3K 5LL6Z 1NJXA 4JS4A 3CC2N 3ALYA 1VQLN 3ZSQA 4FW1A 1UWBA 3DLLL 3VQEA 4O0IA 2EWSA 1Y64A 4OGCA 1L5UA 2G8UA 2ZWHA 1YHQN 1DKGD 3MX5A 4NB4A 2CGLA 2F4VK 1UA1A 4NCGA 4FJGA 5JICA 1RILA 4HUFA 3BUZB 3VN5A 3P39A 1TKTA 1T7PA 1BOTO 3RR8A 3SJHA 1SL2A 5AQPA 2B4JA 4DG1A 3VQQA 4E0DA 2Q2RA 2NZTA 1VSIA 5HRSA 4EHUA 1NMNA 2G8KA 2BE2A 2ZF5O 5ADXH 3J80O 3O4WA 2IVOA 1T05A 3V1OA 1A5VA 4LSNA 1E3MA 1W9HA 4BRHA 4ELTA 1NGHA 4FM0A 3CCUN 1JLGA 3E66A 3VF2A 3O9RA 4AF1A 2E8AA 2Q97A 3AA4A 3AARA 1S1TA 1TUYA 1S1UA 4BGBA 2HHQA 1T6DA 5KQ8A 4FPAA 3KLFA 1L3TA 4F3OA 4FJ8A 5SWMA 4Y0WA 4YOWA 1RBVA 5AQOA 3OYMA 1TKZA 5KTQA 4MO4A 1GLLO 1HYVA 3VGMA 5JLFA 3KK7A 2YJFA 2Q0RA 2JLEA 1OH6A 3MX2A 3RWUA 1T3VA 4FVUA 2VYPA 1MU2A 4JI8K 4CVNE 3C94A 2GUIA 4NYNA 4M7XA 4XIUA 3VERA 4K43A 4FZYA 3IKMA 1K8AO 1I3AA 3ZSRA 3QINA 1Y97A 5KPRA 3EN9A 4CBXA 4PKGA 2RHKA 4I6MB 5JVGL 5ELZA 3VPZA 1ZBIA 2O8EB 4DQ8A 2QKKA 1RDBA 4YHHK 2BDPA 3TANA 5GIPA 1GLFO 2YHBA 4CZIA 4W5RA 1C6VA 4OPJA 2I7NA 3AVKA 5FDLA 3ZT4A 2UXBK 4Q5VA 4CIFA 3NGYA 2IS3A 4O5BA 2FSJA 3O3HA 3FFIA 2OZMA 5AZJA 2JWLA 3QICA 5AZIA 5CR4A 3WXIA 2PAVA 3VTIA 5BPLA 3I0SA 3BGRA 4A5AA 2I7PA 3BZCA 1WAJA 1NGFA 3IFRA 4JHDB 3HJFA 3O1BA 1RCHA 4W5TA 3IG1A 1K8KB 1CZAN 4CJTA 4W5OA 1RT6A 3OYFA 3SQ2A 1HNXK 3PY8A 3G6EN 1X1PA 2OTJN 3V1RA 3K57A 4IZ9A 4H5TA 3ZSVA 3ZX0A 4MO5A 1BO5O 4QAGA 4KREA 1BCMA 2P9IA 3SMSA 5TKYA 1VQ5N 3MN5A 1YXQA 1HNWK 4E7HA 3HPGA 3WEEA 3L3UA 4KFBA 4AHCA 4JKFA 5BR9A 4AHTA 5EU7A 1HYZA 1QQNA 2HF3A 4EAHD 3T3FA 3DJCA 1JCGA 4KRFA 1S72N 2NNWA 3L2UA 4CZEA 3R8EA 3SV4A 3U6FA 3ENHA 4J2AA 4CF9A 4YOXA 3TAQA 1VSHA 3GDQA 4DKWA 1OVYA 3BF1A 3VEYA 1YIJN 3JSMA 3THXA 3VF6A 3AVNA 3PX6A 4G9ZA 4GKKK 2YCHA 3KKRA 4LF6K 2FSKA 2GUPA 4DQPA 1NK5A 1IH7A 2ZJQL 3SNNA 3L0QA 3CPEA 3QEWA 2QWOA 3C95A 3OS2A 2UU9K 2FF6A 3CXCM 2A6AA 1KVCA 2D0PA 2WTUA 2ZJRL 1FJGK 3AVMA 3K5MA 3QESA 1NKBA 5J2PA 2D1KA 2NRTA 4H0YB 4GKJK 5CY4A 4AHUA 3OW2M 3SBGA 3HM8A 3U9ZA 1KCFA 3M6GA 1QVFM 3G71N 3A8YA 2RE2A 4N47A 4B9QA 2Q0UA 5C2DA 2P5GA 1BG3A 4LF7K 3LDQA 1Q9XA 4JI4K 2DY4A 4DU1A 3BZKA 2E1YA 2V7YA 1RT2A 4IOCL 4CZJA 3MWTA 1RT1A 4DLEA 1Q82O 3PO5A 5KPZA 3J7YP 3LZIA 2P9PA 1VQ4N 3WNGA 1K6YA 4FWLA 2P9KA 3D2FB 2RN2A 2CGJA 3OYDA 1S1WA 1FXXA 4FLUA 1ESVA 4QCLA 1RDCA 2ZE2A 3U9DA 5HOOA 5DM7L 3H3NO 3RMDA 4BR2A 1SUQA 5HROA 3HBTA 4F3TA 1HUXA 3KHYA 1RDDA 1BQMA 1UAXA 3PO4A 1EXQA 4DB3A 4K8XA 4KV8A 1S1XA 5IT9O 1VRTA 4KHNA 4DMNA 2Q1NA 3HTVA 3F9KA 3OYLA 5JVHL 2IIRA 4RW7A 1HMVA 1NOYA 4B1UB 1TL1A 3CCSN 3VEXA 4YOVA 4AILC 4CW7B 4CF8A 1I94K 1R59O 4FOEA 1XMOK 5KPTA 4EFHA 3CM6A 2P51A 1J54A 4IDHA 3D2EB 5K14A 1D5AA 4EHTA 1IKYA 1LWFA 1XHXA 3L2VA 3M8SA 3MCPA 3G4SN 2B5JA 3ZLJA 4CESA 1CXQA 3NBPA 2ZM6K 3Q7CA 1YI2N 1HNZK 3DWLA 3G0ZA 1JLCA 3MDQA 1VSJA 3MN7A 4YDUC 3WT0A 3QO9A 4X62K 3KLIA 1KD1O 3CFOA 3V9XA 1IJJA 2X78A 5AQSA 1FK9A 3LWMA 1IBKK 4RG8A 3CQ8A 4DFPA 4LFBK 3OVNA 1NU0A 3G25A 3SLCA 4BRPA 2G8VA 4CEZA 3O9UA 4FJHA 1B9DA 4JI2K 3J7AP 4BROA 3H3OB 3VQAA 4OPKA 4DR6K 3OYAA 3BDPA 4F2RA 4CJEA 2ZGZA 4DTJA 4JI5K 2GELA 1WBBA 4JI6K 4ICLA 3WNFA 1JL1A 4B3TK 3SI6A 2O8FB 3HZ6A 1IKWA 4BC3A 2QEXN 4WF9L 4ZHRA 1KTQA 3MN6A 3CETA 1XQSC 4OJRA 4DV4K 2NRXA 4E3SA 2Y1JA 3P4IA 1JLFA 3I33A 1ATNA 4H0VB 2QWNA 3SAGA 1QQMA 4MQ3A 1N6QA 1N32K 4IOAL 4N76A 4ELVA 3T19A 4FJJA 3NH0A 3QBXA 2D0CA 2P9UA 1JLBA 2YX6A 1HRHA 3EEQA 4ID1A 1T03A 4B9SA 1BIZA 1JLAA 3QMLA 2NRWA 4DR1K 2FBTA 4DV1K 4JKGB 3LDOA 4H0TB 5BREA 1C1AA 1YVNA 4IG3A 2FBVA 3VQ5A 4JK8A 1RT5A 4KBOA 3CMAN 5F0XA 3SAFA 1CXUA 4DR5K 3SJJA 2OPSA 2FC0A 4PKHA 3VGKA 4C8KA 3NGZA 2NRHA 2NRZA 1BIUA 1YAGA 3MMVA 1JLEA 2O8DB 1KFSA 4R79A 4IXCA 4FOIA 4IG0A 3CCEN 3HO1A 4IO9L 1NK7A 1M1KO 3AGRA 1HJRA 4IFVA 2XHBA 1D8YA 1DLOA 3ZX2A 2JGUA 3UKUB 2X74A 1QE1A 2P9SB 3SYZA 1JL2A 1TUUA 4FWNA 2HVHA 1RDAA 4BRAA 2EHGA 4B9MA 3EKUA 2QXFA 5AQKA 4DFMA 4L8RB 5AQMA 2E6LA 3OBWA 3DAWA 3ZSZA 4R5PA 4ZTFA 4I7FA 4F8RA 4NCBA 3ZT2A 4PQUA 3R1XA 1YF5L 2ZGYA 2E2OA 4E1NA 2ATQA 3VESA 1S3XA 3DLBA 3ASMA 3L4IA 2G8WA 3M1FA 3JXUA 2E6MA 2PY5A 3PIPL 2OTLN 3CJ7A 3P31A 1Z26A 3AVHA 3WNEA 3WNHA 4M3UA 5C42A 1W0HA 3RMBA 2YNHA 4CEBA 3DRRA 1P90A 4WQ5A 3THWA 4BE2A 4DTPA 3ZETB 5AQVA 2G8HA 3QFPA 3A5OC 4H03B 4OGEA 5GADP 4HTLA 1XC9A 4OLBA 2UXCK 3HSTB 1JCFA 5FRMA 3NHGA 4JKBA 3VQBA 2R7YA 3KD1E 4M42A 3LAKA 4CGFA 1X3NA 3K5LA 5AQRA 1WSJA 5H1SQ 1BHLA 2VG5A 2RPIA 2XY5A 4KHQA 3AGKA 3K5NA 3CQXA 3EKSA 4KI6A 4DR7K 3KVGA 3ULEB 2P5OA 2FBYA 4GV9A 4NXNK 4N56A 4B9LA 4B8AB 3EO3A 3GBTA 5E26A 1GOCA 1IKVA 3ZEUB 4HCBA 1V4SA 2BANA 3CF5L 3THYA 1NBWA 1TK8A 3J8AA 4CGJA 1C0UA 4KTQA 3VEZA 1S1VA 3DXMB 5AQGA 4BGAA 3KD5E 2EX3A 2GWKA 2Q31A 4OPAA 5BPMA 2Q36A 3SUOA 1NNEA 4BRKA 3EZ5A 2QA4N 5IWAK 3FZKA 3UKRB 3K0SA 1YTAA 3SUPA 4K8ZA 4JD2A 3QFUA 4GW6A 4BRIA 3NH2A 4FW2A 5HRPA 4MLEA 5I9EB 1U6ZA 2Z1GA 4WQ5C 3T1AA 4Y1CA 2F8TA 3WUHA 5AQTA 4CI6A 1U47A 2VWKA 4O55A 1TYQA 1YJ9N 4X65K 1Z05A 3B6PA 4YFUA 1ZYQA 3TAMA 4AM7A 3AVFA 4DSJA 4XH1A 4M3XA 4FCYA 4WE1A 3B6OA 1HKGA 4CJ5A 3PX4A 3OHRA 1VQ7N 1RT3A 2BGGA 3C0BA 4CCHA 4C23A 4RW9A 4O44A 4CEFA 1ZBLA 3FZHA 4JK9A 5CE3A 1BISA 1LAWA 3WXKA 4EZ6A 5HL7L 2HBLA 3LPTA 4ELUA 2B6AA 4A2AA 3DLGA 4KO0A 1NJWA 3C7NB 2YKNA 4IJNA 5C25A 4JKHA 2UUAK 1Q18A 3K58A 5CZ1A 4CEOA 1QHTA 3TTDA 3K9KA 2NLXA 1KLMA 3F2KA 3FR0A 4K0KK 3JS6A 2GWJA 3T1HK 5C2FA 4M3WA 2QWMA 2V51B 5JMVA 4Z4CA 3HI0A 4DFJA 4DUYK 3VQ6A 2H3GX 2KTQA 3K5OA 1T8EA 3MXJA 2F96A 5C0YA 3AA5X 1RBSA 1Z6RA 5D3GA 4J8FA 5M1NA 3IS9A 3O80A 4FLVA 4CHNA 3OYEA 3NE6A 4QOZB 3CQYA 4ID5A 1YTUA 5JS2A 4KHYA 1NK8A 1WOQA 3HYFA 4FJ7A 2YI1A 2YNIA 4RW6A 2D0BA 3CC4N 4DV7K 4FJXA 3OYKA 3DOLA 1SV5A 2VG6A 4B9NA 4Z4EA 4H0OA 1JJ2M 3DOKA 4PUOA 1KC8O 3V4IA 1VRUA 4B3SK 2AJQA 1D9DA 1YUWA 3CJCA 1DTQA 3KLHA 4WCEL 1RNHA 4O8UA 2CGKA 2PBDA 4N41A 1U2VB 2W40A 2O8BA 4E7JA 3IDHA 4BQLA 3VTHA 1C0GA 3HP9A 2HMIA 3RSEA 4I2QA 3E1YA 4E1JA 5AFUA 1OH8A 2W41A 4KHUA 3KK3A 3TSPA 3PSIA 3H08A 4PHTX 4F9OA 4DQSA 3N4QA 1G15A 1NGJA 4HCCA 2QWPA 3O9QA 3HP6A 4NCAA 2OPPA 3T69A 1KXPA 5SZTA 1VSEA 4BACA 4FWQA 2IAJA 4XEIA 2A40A 3TAPA 4HUGA 3VF4A 4BVOA 4WQ4C 4CGGA 4JS5A 3ZSOA 2YHAA 4BG9A 3LANA 1BA0A 1WSIA 2O8DA 4LH5A 3LAMA 3N4PA 4CD1A 1NM1A 4ILJA 3GG4A 4E1MA 3MXIA 4RWTA 4CE9A 2O4IA 4CFDA 3DXKB 4FWMA 4CHOA 4K25A 3TU5A 1WSEA 1EQYA 3E9LA 1Q81O 1RBRA 4O4GA 2IVNA 4IEIA 2HHVA 3BP8A 3EZWA 4DWIA 4LD0A 1BDGA 2A42A 4OX9K 3OY9A 2ASMA 2ASOA 4BRCA 1E4FT 1TAUA 4O5FA 3NH1A 2Z1JA 3O4NA 3THVA 1KVBA 1TL3A 5AR0A 4FJNA 3HXMA 4CJ4A 3HRGA 1LV5A 1VHXA 3AY9A 2PYJA 5LMUK 1GLEG 5BN9A 4IEEA 1N34K 3O5BA 5HLFA 1GOAA 4FLTA 3L6QA 2DFHA 2YHWA 1WSFA 4I9LA 2BTFA 3CPWM 2QTDA 3UB5A 1SAZA 2FF3B 3CCVN 5ADXA 1KFDA 1MA9B 2ITMA 4BR7A 4H5NA 5DMRA 2E4LA 4AQYK 1VQPN 3MCAB 3FFKB 4FJMA 4M3RA 2P9LB 3VETA 4IBNA 4Z4FA 1XNQK 1H1VA 4JLHA 1KVAA 1NKEA 1VK0A 3V1QA 1BI4A 1BQNA 4LF8K 4YDUA 5AJ3K 3EY1A 1QSYA 1GLCG 1VQKN 2OA8A 2UXDK 1HYSA 3H6EA 3LDNA 4DS4A 4DTXA 2VG7A 3V81A 2YNGA 5GAGP 1U45A 1ASVA 4FJLA 2O8CA 4JKDA 1JLQA 4B9VA 2UYTA 3A5LC 3C65A 2IC3A 1GLBG 5GINA 4KB0A 4J2BA 3T1YK 2OPQA 5AQZA 3P83D 3FE1A 3CIPA 3H46O 4H0PA 4CECA 3ZT0A 4H8KA 3VEWA 2E2PA 3CFPA 1KAYA 3WQUA 4LC9B 1KAZA 1LCUA 5J2QA 3HPOA 4NYFA 4FJ9A 2CH6A 1QZ6A 3ZSWA 2VGNA 4LH4A 2HHWA 5BRHA 1WB9A 4BRMA 4HHTA 4DF4A 3KZBA 2HNZA 4AHVA 4M3YA 1DTTA 1NK9A 5AQLA 3F5TA 3QLHA 4A2BA 4DTOA 2QI2A 4CK3A 5F2RA 3CMEN 3KWGA 1B9FA 1NMDA 4M63C 3DM2A 4BE1A 4DTRA 2GEMA 1RDWX 2A1SA 5GIOA 1XWLA 3U3YA 4Z4HA 4M45A 3PV8A 3CJ9A 1OVQA 3NF6A 3OA9A 3WXMB 5FPNA 3QEPA 4CZFA 4JAXA 4FWKA 2E2QA 3K9JA 3RTVA 4CBWA 1J5OA 2WFBA 1NGGA 4GVMA 4A61A 2Z1IA 4Z4IA 1CZBA 4PA1A 2QK9A 2P9NB 4E19A 2D0OA 1XMQK 4DTUA 2IGIA 3L8BA 3DI6A 5KRSA 3D0PA 4FZXC 4FYDA 1N36K 1TKXA 1NK0A 5CZ2A 4DSLA 3VENA 3BEXA 2W42A 4FLWA 1W7AA 4CD3A 3I8BA 4MDBA 5F1XA 1ILYA 2G8FA 5E84A 4C8MA 3L2RA 1LW2A 1WBDA 4CIEA 4Q0BA 3ZT3A 1ZC6A 2NUBA 3LM9A 4JN4A 3SZ2A 4K41A 3M8QA 1FKPA 3D45A 3ULDA 4LFAK 3VQDA 4J2EA 4BVPA 3O6WA 5LMNK 4BE0A 4WFNL 1VQ9N 3ZSYA 1OH5A 5EOYA 3RRGA 4CF0A 3V9WA 1NK4A 2HF4A 1UA0A 4I6MA 2E20A 4DQIA 1EO1A 1YVUA 4B1XB 3CM5A 2HW3A 1NGAA 2O8EA 3ITHA 1O1WA 4IDKA 3L2WA 3AVCA 3HL8A 4ZTJA 4DHYA 1L3VA 1QVGM 1E4GT 2D4WA 1VQ6N 4W5NA 4RCHA 3MWPA 3J7ZO 3OJUA 4B3RK 4FXDA 3VQCA 1KRPA 3SQ0A 1XHZA 5AZJB 3FZMA 5AZIB 4I2PA 5AQWA 5KI6A 3A0IX 4CBUA 3H1VX 3OYBA 5HP1A 4OVLA 3CHWA 1BCOA 1SS6A 2F9WA 1QHAA 3A2FA 4FM2A 1NGDA 1VSKA 3HT3A 1CZ9A 4QS8A 3SPYA 2PFUA 3ATUA 3KIOA 4JHDA 4FWPA 4GY2B 2X6NA 3SCXA 1WLJA 1K8KA 5J1EA 1TK5A 1Q7YO 1F21A 1L3UA 4FSVA 5M1KA 2P9IB 1VSLA 1ITGA 4BR5A 4H5RA 2UUCK 2DFEA 3RRHA 4DV6K 3WEEB 3VMFB 4BR4A 3O4QA 5HRRA 1IKXA 3AAPA 4BG8A 4CHQA 4CZKA 5JLHA 5E41A 4J2DA 3ATVA 4Z94A 4M7YA 1ZBFA 5I3UA 3VEVA 3H1QA 1I39A 3A5NC 1NWKA 2HSTA 2PZSA 1RTIA 5FPDA 5AQFA 5FPEA 4V19S 2FBXA 2YV0X 3AA3A 3M8RA 1HNVA 4KAZA 4B9UA 4LFCK 4EIAA 3CJAA 4OKJA 4KH6A 1W2BM 4GNIA 4YOUA 4C8LA 5M1FA 4H5VA 3CI5A 1NKCA 4DCHA 2P1JA 4DR4K 3THXB 3QEVA 1VQON 3SQ1A 2ZQBA 2J4RA 4JI0K 3CCQN 4KHWA 4MFBA 3EE8A 5MLCQ 4BC2A 1VQMN 4DS5A 4KH4A 3LDPA 3K59A 3U8XA 3MAQA 3BY5A 5BRFA 1YJWN 4FK4A 3MEGA 3ZX3A 4JI7K 1LAVA 1A5WA 4B3MK 3M5RA 3PUFA 5AQIA 4B1WB 5EVZA 3S9HA 4GV6A 4JKEA 3MEEA 1HR0K 1DEJA 3OYHA 3NMUA 3IUCA 3LM2A 1TK0A 4NLBA 4CJQA 1NOZA 1S6PA 2ITGA 3VQPA 1SKSA 4BRLA 3S3NA 1TGOA 2JWKA 5LY3A 1WAFA 1RTHA 3I55N 4CK2A 3SUQA 4KHPK 2XY8A 4CJRA 1ZXOA 1C0TA 1GLDG 1HX1A 4GVEA 2P9PB 3CD6N 4IFYA 4A57A 4CF2A 1NGCA 3RMCA 2P9KB 3ZCMA 3OYJA 5DK5A 3ENOA 5HRNA 2D5RA 3AVAA 5CYMA 4L3QA 1QQOA 5DM6L 1S5JA 2GX9A 1MWMA 3D2FA 1QTMA 3MECA 3P38A 1RTJA 3WXLA 1KLNA 4FLYA 4CGHA 4JRQA 1Q9YA 4BRFA 3I56N 3VA0A 4BRGA 1NGIA 1VSDA 4DU3A 1NJZA 4DF8A 4IOXA 1X9MA 4JV5K 1LW0A 4FWOA 4HTUA 3ZSXA 3CJBA 4AHSA 1RDUA 3KKSA 1GLJO 4FZZA 5M1OA 1VAZA 2V7ZA 3T7ZA 1K73O 4JKAA 1C0FA 1EP4A 4NO7A 2E5LK 4DFKA 1BUPA 3V9SA 1SL1A 3TTCA 1WSHA 4FLXA 4KI4A 3NVKA 3P1GA 1FKOA 2QM1A 1RT7A 4RW4A 2VGMA 3NAEA 4B1ZA 3IMXA 3F73A 2YHYA 4IWVA 3QEIA 3D2EA 3TARA 4CJPA 1B92A 3G10A 2KW4A 5CHIA 4C1NI 1NJIO 3O9TA 1NLVA 2E2NA 1N5YA 2A41A 4CJWA 1HKCA 2GBZA 1SZ2A 3QB0A 3O8MA 3KLGA 2FXUA 3C6UA 4FK2A 2ZD1A 4A62A 3O3GA 3CFRA 2VCPA 2OCEA 3R6MA 2AP1A 3GE1A 5BRDA 4B08A 4WFBL 3NFAA 4CEDA 3OS0A 2P9NA 1P8ZA 3AO5A 5BN8A 1N8RO 3LDLA 2KFZA 4CJLA 3NGIA 4I9QA 1RBTA 3NF9A 3J81O 2KQ2A 3CCLN 1L3SA 3OS1A 3ISNC 1K9MO 5TKWA 3FZLA 4WQ4A 4EP5A 3DLKA 3LPUA 2HBMA 4BRDA 3QEXA 1WNSA 1JXBA 3HK2A 3NDKA 4DUZK 3QIPA 3CCRN 4LF5K 4DSKA 5CYQA 2O8FA 1SL0A 5A2QO 1JXEA 2NRVA 3FZFA 4CEAA 3HVTA 4C1NK 1RT4A 5AQUA 4FWSA 4BR9A 4Y1DA 4M41A 1C1BA 1LOTB 4WYBA 2ZJPL 4CJUA 4DSEA 1KAXA 1YT3A 2Q3SA 2V52B 1IBLK 4IFEA 4ILGB 2VWBA 4JRPA 2P9UB 4NXMK 2XO7A 1R0AA 4F4KA 2YNFA 3BF3A 4JKCA 2HHTA 3EL2A 3L2QA 1DGKN 5C12A 3VQ7A 3EE9A 3QIOA 5J2NA 4JKGA 2DFFA 4BRQA 1NG9A 4OKEA 3JYTA 5M1PA 4KPYA 1IG8A 4NLCA 4CJFA 1YJNN
chains in the Genus database with same CATH topology
3SJJA 2OPSA 2FC0A 4LH4A 2HHWA 3OYNA 4HHTA 4DF4A 4C8KA 2HNZA 3NGZA 1UA1A 4NCGA 4FJGA 4AHVA 4M3YA 1DTTA 1NK9A 1RILA 1BIUA 4HUFA 4CGDA 3TR8A 3QLHA 1JLEA 3VN5A 4DTOA 1WSGA 1X9SA 1TKTA 4Z0UA 4CK3A 2HNDA 1KFSA 1T7PA 3RR8A 2OZSA 3DRPA 4CJSA 4B8CA 1SL2A 1QSLA 1B9FA 2B4JA 2X6SA 4IG0A 4DG1A 4CJKA 3HO1A 3DRSA 3VQQA 4E0DA 3DM2A 4BE1A 4DTRA 1NK7A 1VSIA 4OLAA 5HRSA 3UIQA 2A1SA 4F2SA 1HJRA 1IO2A 1XWLA 4Z4HA 3U3YA 2G8KA 4IFVA 1LWCA 2BE2A 2HHXA 1BL3A 4DU4A 4M45A 2XHBA 3PV8A 1DLOA 3NF6A 1TKDA 1D8YA 2JGUA 2X74A 3QEPA 1QE1A 1QSSA 4BDZA 3SYZA 1JL2A 3V1OA 1T05A 1A5VA 4LSNA 3RTVA 1RDAA 2HVHA 3TABA 1W9HA 1J5OA 2F8SA 4ELTA 2KFNA 2EHGA 4B9MA 4Z4GA 4FM0A 3OJSA 2HNYA 2QXFA 1JLGA 4DFMA 4L8RB 4GVMA 2Z1IA 1BGXT 4Z4IA 3SQ4A 3AA4A 1CZBA 3DLRA 1S1TA 3OYGA 4PA1A 2QK9A 2E6LA 3C6TA 1S1UA 3ZSZA 4E19A 4R5PA 4ZTFA 4I7FA 4F8RA 4M3UA 2HHQA 4DTUA 3KLFA 1L3TA 2IGIA 3AVLA 3L8BA 5SWMA 3ZT2A 4E7IA 1RBVA 4F3OA 4FJ8A 5J2MA 3DI6A 5KRSA 3OYMA 3D0PA 4E1NA 1TKZA 5KTQA 2ATQA 3LZJA 4FZXC 1HYVA 3L3VA 4FYDA 1HQEA 1RBUA 1TKXA 1NK0A 5CZ2A 4DSLA 4PY5A 2JLEA 3ASMA 3DLBA 3RWUA 2G8WA 2W42A 4FLWA 4DQRA 1MU2A 2E6MA 4E7KA 3C94A 4C8MA 3L2RA 2GUIA 1SKWA 2G8FA 2PY5A 1LW2A 1Z26A 3AVHA 4NYNA 3WNEA 3ZT3A 4CIEA 2NUBA 4Q0BA 4BDYA 4XIUA 4FZYA 3WNHA 3SZ2A 5C42A 1W0HA 1TAQA 3RMBA 4IKFA 2YNHA 2ETJA 4CEBA 3DRRA 3M8QA 1FKPA 3D45A 3ULDA 1I3AA 2OYQA 5JS1A 3ZSRA 4BE2A 4DTPA 3QINA 3P5JA 1ASWA 2G8HA 1Y97A 4OGEA 3VQDA 2VWJA 1XC9A 3S3OA 4J2EA 4OLBA 5KGXA 3HSTB 5FRMA 3NHGA 5FRNA 4BE0A 4KKOA 3VQBA 2R7YA 3ZSYA 3KLEA 3KD1E 4M42A 3LAKA 2I5JA 4CGFA 3K5LA 3RRGA 4CF0A 3V9WA 1NK4A 4FVMA 1UA0A 3AVGA 1ZBIA 4DQIA 3TI0A 1WSJA 1YVUA 3AO3A 3CM5A 2HW3A 1GOBA 2QKKA 1BHLA 1RDBA 2VG5A 2RPIA 2XY5A 2BDPA 3ITHA 1O1WA 4KHQA 4IDKA 3TANA 3L2WA 1D9FA 3OYCA 2YHBA 3LALA 3AVCA 3K5NA 4W5RA 1C6VA 1JKHA 4OPJA 3HL8A 4ZTJA 1L3VA 1X9WA 4KI6A 3AVKA 5FDLA 4EP4A 3ZT4A 4Q5VA 2P5OA 2FBYA 2IDOA 4CIFA 4N56A 3M8PA 3NGYA 3KK1A 4W5NA 4B9LA 2IS3A 4B8AB 4O5BA 3OJUA 4FXDA 3VQCA 1KRPA 3SQ0A 1XHZA 3O3HA 1GOCA 3FFIA 1IKVA 4I2PA 4HCBA 5KI6A 2OZMA 4FJKA 1C0MA 1U04A 2BANA 3KK2A 2XY7A 1XI1A 1TK8A 3OYBA 5HP1A 4LY7A 4OVLA 2Y1IA 4CGJA 1BCOA 3HVRA 1C0UA 3I0SA 4KTQA 3BGRA 3A2FA 1S1VA 4HVJA 3O3FA 1WAJA 4FM2A 1VSKA 3HT3A 1CZ9A 1NJYA 3HJFA 3SPYA 2GV9A 1SKRA 1RCHA 3KIOA 2EX3A 3KD5E 4W5TA 3U3GA 3DYAA 3IG1A 3VQ4A 2X6NA 1C1CA 3SCXA 1WLJA 4CJTA 4W5OA 1RT6A 4CGIA 3OYFA 3SQ2A 3SUOA 3PY8A 5J1EA 3EZ5A 4DTNA 1TK5A 1X1PA 5T7BA 4YNQA 3IRXA 3V1RA 1F21A 3K57A 2O4GA 4DTSA 1L3UA 3ZSVA 4OKKA 1YTAA 3SUPA 4K8ZA 4GW6A 4QAGA 3NH2A 1VSLA 4KREA 1BCMA 1ITGA 4FW2A 5HRPA 3AVBA 2G8IA 2DFEA 3RRHA 2Z1GA 3TAFA 3T1AA 2YKMA 4CK1A 4CF1A 3HPGA 4E7HA 4Y1CA 3O4QA 3L3UA 2F8TA 4KFBA 5HRRA 1IKXA 5C24A 4CHQA 3LDSA 4AHCA 4LSLA 1U47A 5E41A 2VWKA 4J2DA 2DTUA 4O55A 4FM1A 4AHTA 5EU7A 1HYZA 1ZBFA 3LP1A 3B6PA 5I3UA 3T3FA 1I39A 4YFUA 1ZYQA 3TAMA 2PZSA 1RTIA 3AVFA 4KRFA 4DSJA 2A1RA 4M3XA 4FCYA 4WE1A 3B6OA 3L2UA 2FBXA 4CJ5A 3SV4A 3QNOA 2YV0X 3AA3A 3U6FA 3PX4A 3M8RA 1HNVA 1RT3A 3SUNA 4B9UA 4KAZA 4CF9A 4J2AA 2BGGA 4CCHA 4DLGA 3TAQA 1VSHA 4RW9A 4O44A 4OKJA 4CEFA 1ZBLA 1ASUA 1BISA 1LAWA 1LWEA 3CG7A 4EZ6A 4C8LA 2OPRA 1NKCA 4CFBA 2RF2A 2P1JA 4KTZA 2HB5A 3QEVA 4FJ5A 3JSMA 3SQ1A 3LPTA 2ZQBA 4ELUA 3AVNA 2B6AA 4CFAA 3PX6A 3KTQA 3TAGA 3DLGA 4KHWA 3KKRA 4MFBA 4KO0A 1U49A 1NJWA 2HHUA 3TAEA 2YKNA 5C25A 4DS5A 3K58A 5CZ1A 4CEOA 3K59A 4DQPA 1NK5A 1QHTA 1IH7A 3MAQA 3SNNA 1HPZA 4FJIA 4FK4A 1ZBHA 3MEGA 3QEWA 1LAVA 1TVRA 1KLMA 1A5WA 3C95A 3OS2A 3PUFA 3S9HA 1KVCA 4M3WA 3MEEA 1TV6A 3OYHA 4Z4CA 3AVMA 1REVA 3K5MA 4DFJA 3S3MA 3IAYA 3QESA 1NKBA 1HQUA 3VQ6A 5J2PA 1S6QA 2KTQA 2WONA 1TK0A 5CY4A 1S9EA 3K5OA 4AHUA 1T8EA 3MXJA 2F96A 4CJQA 1NOZA 1NK6A 1S6PA 2ITGA 3VQPA 3AA5X 1SKSA 3I0RA 4W5QA 4NCBA 1RBSA 3CYMA 4M3ZA 1KCFA 4CHYA 2KZZA 2HVIA 3S3NA 4TSXA 4N47A 5D3GA 1TGOA 4PQUA 2P5GA 3IS9A 3AO1A 1S9GA 3QETA 4FLVA 1WAFA 4CHNA 3OYEA 3NE6A 3NCIA 1RTHA 1Q9XA 4QOZB 4CK2A 2DY4A 4CHPA 4DU1A 3SUQA 2KZMA 4ID5A 2XY8A 1RT2A 4HUEA 5JS2A 3AA2A 1YTUA 4CJRA 4KHYA 2Z1HA 1NK8A 3HYFA 4FJ7A 1RT1A 4DLEA 1CLQA 1C0TA 2YNIA 4RW6A 3PO5A 2D0BA 5HBMA 4CIGA 3LZIA 4IFYA 4CF2A 4FJXA 4H4OA 3OYKA 3RMCA 3WNGA 3DOLA 3OYJA 3ZCMA 1K6YA 5DK5A 1SV5A 2VG6A 5HRNA 3RR7A 4B9NA 2D5RA 3AVAA 5CYMA 4H4MA 2RN2A 3DOKA 4PUOA 4Z4EA 1S5JA 3OYDA 4BWJA 4PWDA 3TWHA 3V4IA 1VRUA 1QTMA 4B9TA 1S1WA 3I8DA 4BDPA 1FXXA 1D9DA 2AJQA 4FLUA 3MECA 4QCLA 1RTJA 1RDCA 2ZE2A 4CERA 1KLNA 1DTQA 3HPHA 3KLHA 4FLYA 1EETA 3AVJA 4CGHA 4JRQA 3RMDA 3SPZA 1Q9YA 1RNHA 1SUQA 3AVIA 3VA0A 5HROA 4N41A 1VSDA 4DU3A 1NJZA 4E7JA 4O0JA 4F3TA 4DSFA 3HP9A 4DF8A 1X9MA 2HMIA 1EKEA 1RDDA 3NF8A 4CEEA 1BQMA 1UAXA 4I2QA 3PO4A 1LW0A 2IOCA 1EXQA 4HTUA 4K8XA 3ZSXA 4KV8A 1S1XA 4AHSA 4KHUA 1VRTA 4KHNA 3KK3A 3KKSA 4KHSA 4DMNA 4FZZA 3H08A 4DQSA 1G15A 3F9KA 3OYLA 4HCCA 1RTDA 1EP4A 4RW7A 1HMVA 1NOYA 1TL1A 4DFKA 4AILC 1WN7A 2RKIA 3HP6A 4NCAA 2OPPA 2WOMA 4CF8A 5SZTA 3V9SA 1SL1A 1WSHA 4FLXA 4FK0A 1VSEA 4KI4A 4BACA 3P1GA 1FKOA 2IAJA 1RT7A 4RW4A 3TAPA 4HUGA 3DLHA 5I42A 4CGGA 4JS5A 3CM6A 1QQCA 2P51A 3ZSOA 3NAEA 1Q8IA 2YHAA 3MEDA 1J54A 3F73A 3LANA 1WSIA 3QEIA 5K14A 3LP3A 1D5AA 4DTMA 4EZ9A 3TARA 1VSFA 4LH5A 1B92A 3G10A 3LAMA 2KW4A 4CJPA 2HHSA 1IKYA 1LWFA 1XHXA 3L2VA 3M8SA 4CFCA 2B5JA 2LSNA 3NF7A 4E1MA 3MXIA 3AO2A 4CESA 3RMAA 1U4BA 5KGWA 4CE9A 3VQ8A 2O4IA 1CXQA 4CFDA 1N5YA 3NBPA 2QKBA 4FLZA 4CJWA 2GBZA 3G0ZA 4RW8A 1A5XA 3LWLA 5FROA 4CHOA 4CHZA 1JLCA 1WSEA 1VSJA 3KLGA 1RBRA 4O4GA 3SV3A 3C6UA 4FK2A 2ZD1A 4B3OA 3AO4A 1ZBUA 3ZT1A 3QO9A 3O3GA 3KLIA 3CFRA 3CFOA 3V9XA 2HHVA 2X78A 1VSMA 1FK9A 3DLEA 3LWMA 4N5SA 4DWIA 4RG8A 4B08A 4LD0A 3CQ8A 4G1QA 3LP0A 3PX0A 3NFAA 4DFPA 4CEDA 3OY9A 1HNIA 4CJ3A 3OS0A 3OVNA 1J53A 3KJVA 3AO5A 1TAUA 1KSPA 3NH1A 3QNNA 2Z1JA 2KFZA 3O4NA 4CJLA 3THVA 3NGIA 4BWMA 4GMJB 1KVBA 4I9QA 1TL3A 4DQQA 4FJNA 1U48A 3HXMA 2G8VA 4CJ4A 2D0AA 4CEZA 4FJHA 3V6DA 1B9DA 1RBTA 3NF9A 5KRTA 1LV5A 4KB1A 2KQ2A 2PYJA 1L3SA 3OS1A 3ISNC 4EP5A 3DLKA 3LPUA 3QERA 5HLFA 1GOAA 4FLTA 4KTWA 3VQAA 2DFHA 3OYIA 3QEXA 4OPKA 1WNSA 3OYAA 3LP2A 3VA3A 3BDPA 4F2RA 1WSFA 4M3TA 3DMJA 4I9LA 2XRIA 4CJEA 4DTJA 3EYZA 4ICLA 1JXBA 1Z25A 1UOCA 3NDKA 3HK2A 1KFDA 3V9ZA 3QIPA 5DMRA 1JL1A 2E4LA 3WNFA 3SI6A 4DSKA 1IKWA 5CYQA 4M3RA 4FJMA 4IBNA 1SL0A 3MXMA 4ZHRA 1KTQA 1JXEA 1J9AA 4Z4FA 3VQ9A 1BI4B 4CEAA 4JLHA 1KVAA 4E89A 1NKEA 1VK0A 3HVTA 3V1QA 1BI4A 1BQNA 1RT4A 4CJVA 4UQGA 4OJRA 3EY1A 1QSYA 4E3SA 4Y1DA 4M41A 3V9UA 2Y1JA 2OA8A 1C1BA 1HYSA 1JLFA 4DSIA 4DS4A 3AV9A 4DTXA 2VG7A 3V81A 4CJUA 2YNGA 4DSEA 4MQ3A 1U45A 1N6QA 1ASVA 4E7LA 2PYLA 1YT3A 4CEQA 4AH9A 4FJLA 2Q3SA 1JLQA 4B9VA 4N76A 2IC3A 4AHRA 4ELVA 3T19A 1EX4A 3E01A 4FJJA 4JRPA 4KB0A 3NH0A 4J2BA 2D0CA 2OPQA 2XO7A 1R0AA 4C8NA 2XY6A 1JLBA 3HM9A 1HRHA 3P83D 1IG9A 2YNFA 4F4KA 3K2PA 1QS4A 4ID1A 1T03A 4C8OA 4CECA 2HHTA 4B9SA 3ZT0A 3L2QA 4H8KA 1BIZA 1JLAA 3VQ7A 3CFPA 4JS4A 1NJXA 3ALYA 2FBTA 3QIOA 5J2NA 3ZSQA 4FW1A 1UWBA 1C1AA 2DFFA 3VQEA 4O0IA 4OKEA 3HPOA 4IG3A 3JYTA 2FBVA 3VQ5A 4NYFA 5J2QA 4KPYA 4OGCA 4FJ9A 1RT5A 4CJFA 3ZSWA 1L5UA 1CXUA 2G8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJJ A;  2OPS A;  2FC0 A;  4LH4 A;  2HHW A;  3OYN A;  4HHT A;  4DF4 A;  4C8K A;  2HNZ A;  3NGZ A;  1UA1 A;  4NCG A;  4FJG A;  4AHV A;  4M3Y A;  1DTT A;  1NK9 A;  1RIL A;  1BIU A;  4HUF A;  4CGD A;  3TR8 A;  3QLH A;  1JLE A;  3VN5 A;  4DTO A;  1WSG A;  1X9S A;  1TKT A;  4Z0U A;  4CK3 A;  2HND A;  1KFS A;  1T7P A;  3RR8 A;  2OZS A;  3DRP A;  4CJS A;  4B8C A;  1SL2 A;  1QSL A;  1B9F A;  2B4J A;  2X6S A;  4IG0 A;  4DG1 A;  4CJK A;  3HO1 A;  3DRS A;  3VQQ A;  4E0D A;  3DM2 A;  4BE1 A;  4DTR A;  1NK7 A;  1VSI A;  4OLA A;  5HRS A;  3UIQ A;  2A1S A;  4F2S A;  1HJR A;  1IO2 A;  1XWL A;  4Z4H A;  3U3Y A;  2G8K A;  4IFV A;  1LWC A;  2BE2 A;  2HHX A;  1BL3 A;  4DU4 A;  4M45 A;  2XHB A;  3PV8 A;  1DLO A;  3NF6 A;  1TKD A;  1D8Y A;  2JGU A;  2X74 A;  3QEP A;  1QE1 A;  1QSS A;  4BDZ A;  3SYZ A;  1JL2 A;  3V1O A;  1T05 A;  1A5V A;  4LSN A;  3RTV A;  1RDA A;  2HVH A;  3TAB A;  1W9H A;  1J5O A;  2F8S A;  4ELT A;  2KFN A;  2EHG A;  4B9M A;  4Z4G A;  4FM0 A;  3OJS A;  2HNY A;  2QXF A;  1JLG A;  4DFM A;  4L8R B;  4GVM A;  2Z1I A;  1BGX T;  4Z4I A;  3SQ4 A;  3AA4 A;  1CZB A;  3DLR A;  1S1T A;  3OYG A;  4PA1 A;  2QK9 A;  2E6L A;  3C6T A;  1S1U A;  3ZSZ A;  4E19 A;  4R5P A;  4ZTF A;  4I7F A;  4F8R A;  4M3U A;  2HHQ A;  4DTU A;  3KLF A;  1L3T A;  2IGI A;  3AVL A;  3L8B A;  5SWM A;  3ZT2 A;  4E7I A;  1RBV A;  4F3O A;  4FJ8 A;  5J2M A;  3DI6 A;  5KRS A;  3OYM A;  3D0P A;  4E1N A;  1TKZ A;  5KTQ A;  2ATQ A;  3LZJ A;  4FZX C;  1HYV A;  3L3V A;  4FYD A;  1HQE A;  1RBU A;  1TKX A;  1NK0 A;  5CZ2 A;  4DSL A;  4PY5 A;  2JLE A;  3ASM A;  3DLB A;  3RWU A;  2G8W A;  2W42 A;  4FLW A;  4DQR A;  1MU2 A;  2E6M A;  4E7K A;  3C94 A;  4C8M A;  3L2R A;  2GUI A;  1SKW A;  2G8F A;  2PY5 A;  1LW2 A;  1Z26 A;  3AVH A;  4NYN A;  3WNE A;  3ZT3 A;  4CIE A;  2NUB A;  4Q0B A;  4BDY A;  4XIU A;  4FZY A;  3WNH A;  3SZ2 A;  5C42 A;  1W0H A;  1TAQ A;  3RMB A;  4IKF A;  2YNH A;  2ETJ A;  4CEB A;  3DRR A;  3M8Q A;  1FKP A;  3D45 A;  3ULD A;  1I3A A;  2OYQ A;  5JS1 A;  3ZSR A;  4BE2 A;  4DTP A;  3QIN A;  3P5J A;  1ASW A;  2G8H A;  1Y97 A;  4OGE A;  3VQD A;  2VWJ A;  1XC9 A;  3S3O A;  4J2E A;  4OLB A;  5KGX A;  3HST B;  5FRM A;  3NHG A;  5FRN A;  4BE0 A;  4KKO A;  3VQB A;  2R7Y A;  3ZSY A;  3KLE A;  3KD1 E;  4M42 A;  3LAK A;  2I5J A;  4CGF A;  3K5L A;  3RRG A;  4CF0 A;  3V9W A;  1NK4 A;  4FVM A;  1UA0 A;  3AVG A;  1ZBI A;  4DQI A;  3TI0 A;  1WSJ A;  1YVU A;  3AO3 A;  3CM5 A;  2HW3 A;  1GOB A;  2QKK A;  1BHL A;  1RDB A;  2VG5 A;  2RPI A;  2XY5 A;  2BDP A;  3ITH A;  1O1W A;  4KHQ A;  4IDK A;  3TAN A;  3L2W A;  1D9F A;  3OYC A;  2YHB A;  3LAL A;  3AVC A;  3K5N A;  4W5R A;  1C6V A;  1JKH A;  4OPJ A;  3HL8 A;  4ZTJ A;  1L3V A;  1X9W A;  4KI6 A;  3AVK A;  5FDL A;  4EP4 A;  3ZT4 A;  4Q5V A;  2P5O A;  2FBY A;  2IDO A;  4CIF A;  4N56 A;  3M8P A;  3NGY A;  3KK1 A;  4W5N A;  4B9L A;  2IS3 A;  4B8A B;  4O5B A;  3OJU A;  4FXD A;  3VQC A;  1KRP A;  3SQ0 A;  1XHZ A;  3O3H A;  1GOC A;  3FFI A;  1IKV A;  4I2P A;  4HCB A;  5KI6 A;  2OZM A;  4FJK A;  1C0M A;  1U04 A;  2BAN A;  3KK2 A;  2XY7 A;  1XI1 A;  1TK8 A;  3OYB A;  5HP1 A;  4LY7 A;  4OVL A;  2Y1I A;  4CGJ A;  1BCO A;  3HVR A;  1C0U A;  3I0S A;  4KTQ A;  3BGR A;  3A2F A;  1S1V A;  4HVJ A;  3O3F A;  1WAJ A;  4FM2 A;  1VSK A;  3HT3 A;  1CZ9 A;  1NJY A;  3HJF A;  3SPY A;  2GV9 A;  1SKR A;  1RCH A;  3KIO A;  2EX3 A;  3KD5 E;  4W5T A;  3U3G A;  3DYA A;  3IG1 A;  3VQ4 A;  2X6N A;  1C1C A;  3SCX A;  1WLJ A;  4CJT A;  4W5O A;  1RT6 A;  4CGI A;  3OYF A;  3SQ2 A;  3SUO A;  3PY8 A;  5J1E A;  3EZ5 A;  4DTN A;  1TK5 A;  1X1P A;  5T7B A;  4YNQ A;  3IRX A;  3V1R A;  1F21 A;  3K57 A;  2O4G A;  4DTS A;  1L3U A;  3ZSV A;  4OKK A;  1YTA A;  3SUP A;  4K8Z A;  4GW6 A;  4QAG A;  3NH2 A;  1VSL A;  4KRE A;  1BCM A;  1ITG A;  4FW2 A;  5HRP A;  3AVB A;  2G8I A;  2DFE A;  3RRH A;  2Z1G A;  3TAF A;  3T1A A;  2YKM A;  4CK1 A;  4CF1 A;  3HPG A;  4E7H A;  4Y1C A;  3O4Q A;  3L3U A;  2F8T A;  4KFB A;  5HRR A;  1IKX A;  5C24 A;  4CHQ A;  3LDS A;  4AHC A;  4LSL A;  1U47 A;  5E41 A;  2VWK A;  4J2D A;  2DTU A;  4O55 A;  4FM1 A;  4AHT A;  5EU7 A;  1HYZ A;  1ZBF A;  3LP1 A;  3B6P A;  5I3U A;  3T3F A;  1I39 A;  4YFU A;  1ZYQ A;  3TAM A;  2PZS A;  1RTI A;  3AVF A;  4KRF A;  4DSJ A;  2A1R A;  4M3X A;  4FCY A;  4WE1 A;  3B6O A;  3L2U A;  2FBX A;  4CJ5 A;  3SV4 A;  3QNO A;  2YV0 X;  3AA3 A;  3U6F A;  3PX4 A;  3M8R A;  1HNV A;  1RT3 A;  3SUN A;  4B9U A;  4KAZ A;  4CF9 A;  4J2A A;  2BGG A;  4CCH A;  4DLG A;  3TAQ A;  1VSH A;  4RW9 A;  4O44 A;  4OKJ A;  4CEF A;  1ZBL A;  1ASU A;  1BIS A;  1LAW A;  1LWE A;  3CG7 A;  4EZ6 A;  4C8L A;  2OPR A;  1NKC A;  4CFB A;  2RF2 A;  2P1J A;  4KTZ A;  2HB5 A;  3QEV A;  4FJ5 A;  3JSM A;  3SQ1 A;  3LPT A;  2ZQB A;  4ELU A;  3AVN A;  2B6A A;  4CFA A;  3PX6 A;  3KTQ A;  3TAG A;  3DLG A;  4KHW A;  3KKR A;  4MFB A;  4KO0 A;  1U49 A;  1NJW A;  2HHU A;  3TAE A;  2YKN A;  5C25 A;  4DS5 A;  3K58 A;  5CZ1 A;  4CEO A;  3K59 A;  4DQP A;  1NK5 A;  1QHT A;  1IH7 A;  3MAQ A;  3SNN A;  1HPZ A;  4FJI A;  4FK4 A;  1ZBH A;  3MEG A;  3QEW A;  1LAV A;  1TVR A;  1KLM A;  1A5W A;  3C95 A;  3OS2 A;  3PUF A;  3S9H A;  1KVC A;  4M3W A;  3MEE A;  1TV6 A;  3OYH A;  4Z4C A;  3AVM A;  1REV A;  3K5M A;  4DFJ A;  3S3M A;  3IAY A;  3QES A;  1NKB A;  1HQU A;  3VQ6 A;  5J2P A;  1S6Q A;  2KTQ A;  2WON A;  1TK0 A;  5CY4 A;  1S9E A;  3K5O A;  4AHU A;  1T8E A;  3MXJ A;  2F96 A;  4CJQ A;  1NOZ A;  1NK6 A;  1S6P A;  2ITG A;  3VQP A;  3AA5 X;  1SKS A;  3I0R A;  4W5Q A;  4NCB A;  1RBS A;  3CYM A;  4M3Z A;  1KCF A;  4CHY A;  2KZZ A;  2HVI A;  3S3N A;  4TSX A;  4N47 A;  5D3G A;  1TGO A;  4PQU A;  2P5G A;  3IS9 A;  3AO1 A;  1S9G A;  3QET A;  4FLV A;  1WAF A;  4CHN A;  3OYE A;  3NE6 A;  3NCI A;  1RTH A;  1Q9X A;  4QOZ B;  4CK2 A;  2DY4 A;  4CHP A;  4DU1 A;  3SUQ A;  2KZM A;  4ID5 A;  2XY8 A;  1RT2 A;  4HUE A;  5JS2 A;  3AA2 A;  1YTU A;  4CJR A;  4KHY A;  2Z1H A;  1NK8 A;  3HYF A;  4FJ7 A;  1RT1 A;  4DLE A;  1CLQ A;  1C0T A;  2YNI A;  4RW6 A;  3PO5 A;  2D0B A;  5HBM A;  4CIG A;  3LZI A;  4IFY A;  4CF2 A;  4FJX A;  4H4O A;  3OYK A;  3RMC A;  3WNG A;  3DOL A;  3OYJ A;  3ZCM A;  1K6Y A;  5DK5 A;  1SV5 A;  2VG6 A;  5HRN A;  3RR7 A;  4B9N A;  2D5R A;  3AVA A;  5CYM A;  4H4M A;  2RN2 A;  3DOK A;  4PUO A;  4Z4E A;  1S5J A;  3OYD A;  4BWJ A;  4PWD A;  3TWH A;  3V4I A;  1VRU A;  1QTM A;  4B9T A;  1S1W A;  3I8D A;  4BDP A;  1FXX A;  1D9D A;  2AJQ A;  4FLU A;  3MEC A;  4QCL A;  1RTJ A;  1RDC A;  2ZE2 A;  4CER A;  1KLN A;  1DTQ A;  3HPH A;  3KLH A;  4FLY A;  1EET A;  3AVJ A;  4CGH A;  4JRQ A;  3RMD A;  3SPZ A;  1Q9Y A;  1RNH A;  1SUQ A;  3AVI A;  3VA0 A;  5HRO A;  4N41 A;  1VSD A;  4DU3 A;  1NJZ A;  4E7J A;  4O0J A;  4F3T A;  4DSF A;  3HP9 A;  4DF8 A;  1X9M A;  2HMI A;  1EKE A;  1RDD A;  3NF8 A;  4CEE A;  1BQM A;  1UAX A;  4I2Q A;  3PO4 A;  1LW0 A;  2IOC A;  1EXQ A;  4HTU A;  4K8X A;  3ZSX A;  4KV8 A;  1S1X A;  4AHS A;  4KHU A;  1VRT A;  4KHN A;  3KK3 A;  3KKS A;  4KHS A;  4DMN A;  4FZZ A;  3H08 A;  4DQS A;  1G15 A;  3F9K A;  3OYL A;  4HCC A;  1RTD A;  1EP4 A;  4RW7 A;  1HMV A;  1NOY A;  1TL1 A;  4DFK A;  4AIL C;  1WN7 A;  2RKI A;  3HP6 A;  4NCA A;  2OPP A;  2WOM A;  4CF8 A;  5SZT A;  3V9S A;  1SL1 A;  1WSH A;  4FLX A;  4FK0 A;  1VSE A;  4KI4 A;  4BAC A;  3P1G A;  1FKO A;  2IAJ A;  1RT7 A;  4RW4 A;  3TAP A;  4HUG A;  3DLH A;  5I42 A;  4CGG A;  4JS5 A;  3CM6 A;  1QQC A;  2P51 A;  3ZSO A;  3NAE A;  1Q8I A;  2YHA A;  3MED A;  1J54 A;  3F73 A;  3LAN A;  1WSI A;  3QEI A;  5K14 A;  3LP3 A;  1D5A A;  4DTM A;  4EZ9 A;  3TAR A;  1VSF A;  4LH5 A;  1B92 A;  3G10 A;  3LAM A;  2KW4 A;  4CJP A;  2HHS A;  1IKY A;  1LWF A;  1XHX A;  3L2V A;  3M8S A;  4CFC A;  2B5J A;  2LSN A;  3NF7 A;  4E1M A;  3MXI A;  3AO2 A;  4CES A;  3RMA A;  1U4B A;  5KGW A;  4CE9 A;  3VQ8 A;  2O4I A;  1CXQ A;  4CFD A;  1N5Y A;  3NBP A;  2QKB A;  4FLZ A;  4CJW A;  2GBZ A;  3G0Z A;  4RW8 A;  1A5X A;  3LWL A;  5FRO A;  4CHO A;  4CHZ A;  1JLC A;  1WSE A;  1VSJ A;  3KLG A;  1RBR A;  4O4G A;  3SV3 A;  3C6U A;  4FK2 A;  2ZD1 A;  4B3O A;  3AO4 A;  1ZBU A;  3ZT1 A;  3QO9 A;  3O3G A;  3KLI A;  3CFR A;  3CFO A;  3V9X A;  2HHV A;  2X78 A;  1VSM A;  1FK9 A;  3DLE A;  3LWM A;  4N5S A;  4DWI A;  4RG8 A;  4B08 A;  4LD0 A;  3CQ8 A;  4G1Q A;  3LP0 A;  3PX0 A;  3NFA A;  4DFP A;  4CED A;  3OY9 A;  1HNI A;  4CJ3 A;  3OS0 A;  3OVN A;  1J53 A;  3KJV A;  3AO5 A;  1TAU A;  1KSP A;  3NH1 A;  3QNN A;  2Z1J A;  2KFZ A;  3O4N A;  4CJL A;  3THV A;  3NGI A;  4BWM A;  4GMJ B;  1KVB A;  4I9Q A;  1TL3 A;  4DQQ A;  4FJN A;  1U48 A;  3HXM A;  2G8V A;  4CJ4 A;  2D0A A;  4CEZ A;  4FJH A;  3V6D A;  1B9D A;  1RBT A;  3NF9 A;  5KRT A;  1LV5 A;  4KB1 A;  2KQ2 A;  2PYJ A;  1L3S A;  3OS1 A;  3ISN C;  4EP5 A;  3DLK A;  3LPU A;  3QER A;  5HLF A;  1GOA A;  4FLT A;  4KTW A;  3VQA A;  2DFH A;  3OYI A;  3QEX A;  4OPK A;  1WNS A;  3OYA A;  3LP2 A;  3VA3 A;  3BDP A;  4F2R A;  1WSF A;  4M3T A;  3DMJ A;  4I9L A;  2XRI A;  4CJE A;  4DTJ A;  3EYZ A;  4ICL A;  1JXB A;  1Z25 A;  1UOC A;  3NDK A;  3HK2 A;  1KFD A;  3V9Z A;  3QIP A;  5DMR A;  1JL1 A;  2E4L A;  3WNF A;  3SI6 A;  4DSK A;  1IKW A;  5CYQ A;  4M3R A;  4FJM A;  4IBN A;  1SL0 A;  3MXM A;  4ZHR A;  1KTQ A;  1JXE A;  1J9A A;  4Z4F A;  3VQ9 A;  1BI4 B;  4CEA A;  4JLH A;  1KVA A;  4E89 A;  1NKE A;  1VK0 A;  3HVT A;  3V1Q A;  1BI4 A;  1BQN A;  1RT4 A;  4CJV A;  4UQG A;  4OJR A;  3EY1 A;  1QSY A;  4E3S A;  4Y1D A;  4M41 A;  3V9U A;  2Y1J A;  2OA8 A;  1C1B A;  1HYS A;  1JLF A;  4DSI A;  4DS4 A;  3AV9 A;  4DTX A;  2VG7 A;  3V81 A;  4CJU A;  2YNG A;  4DSE A;  4MQ3 A;  1U45 A;  1N6Q A;  1ASV A;  4E7L A;  2PYL A;  1YT3 A;  4CEQ A;  4AH9 A;  4FJL A;  2Q3S A;  1JLQ A;  4B9V A;  4N76 A;  2IC3 A;  4AHR A;  4ELV A;  3T19 A;  1EX4 A;  3E01 A;  4FJJ A;  4JRP A;  4KB0 A;  3NH0 A;  4J2B A;  2D0C A;  2OPQ A;  2XO7 A;  1R0A A;  4C8N A;  2XY6 A;  1JLB A;  3HM9 A;  1HRH A;  3P83 D;  1IG9 A;  2YNF A;  4F4K A;  3K2P A;  1QS4 A;  4ID1 A;  1T03 A;  4C8O A;  4CEC A;  2HHT A;  4B9S A;  3ZT0 A;  3L2Q A;  4H8K A;  1BIZ A;  1JLA A;  3VQ7 A;  3CFP A;  4JS4 A;  1NJX A;  3ALY A;  2FBT A;  3QIO A;  5J2N A;  3ZSQ A;  4FW1 A;  1UWB A;  1C1A A;  2DFF A;  3VQE A;  4O0I A;  4OKE A;  3HPO A;  4IG3 A;  3JYT A;  2FBV A;  3VQ5 A;  4NYF A;  5J2Q A;  4KPY A;  4OGC A;  4FJ9 A;  1RT5 A;  4CJF A;  3ZSW A;  1L5U A;  1CXU A;  2G8U A; 
#chains in the Genus database with same CATH topology
 3PSF A;  3OYN A;  4QS7 A;  5AQQ A;  1J6Z A;  4CGD A;  3TR8 A;  1X9S A;  1WSG A;  4JYA K;  4PKI A;  4JEP A;  4Z0U A;  2HND A;  3VGL A;  2OZS A;  3DRP A;  2HOE A;  4CJS A;  4B8C A;  1QSL A;  2X6S A;  4CJK A;  3DRS A;  3CCM N;  3PLA A;  2UUB K;  4OLA A;  3UIQ A;  2HHH K;  4F2S A;  1IO2 A;  1LWC A;  2HHX A;  1BL3 A;  4DU4 A;  1TKD A;  2FLO A;  5EY4 A;  3RVC A;  4BDZ A;  1QSS A;  3UKU A;  4ISE A;  4H5W A;  2P9S A;  3TAB A;  5GAH P;  2F8S A;  5GAE P;  3QDK A;  2KFN A;  4Z4G A;  3OJS A;  2HNY A;  3ID6 A;  4BC5 A;  1BGX T;  3SQ4 A;  3DLR A;  2OAN A;  4DV3 K;  3OYG A;  4CZH A;  3C6T A;  1W97 L;  3AVL A;  2VQE K;  4E7I A;  2E88 A;  5J2M A;  4IJA A;  3LZJ A;  3L3V A;  4X64 K;  1HQE A;  1RBU A;  3O9S A;  4PY5 A;  3ZYY X;  5AQX A;  1OKJ A;  2W6K A;  4DQR A;  2KKZ A;  4B1Y B;  4HWI A;  4BY9 C;  4E7K A;  1NGB A;  1SKW A;  3CC7 N;  1NGE A;  4BDY A;  4IKF A;  1TAQ A;  5AQJ A;  2ETJ A;  3THW B;  1BWF O;  1EWR A;  2OYQ A;  5JS1 A;  3MK6 A;  4JI3 K;  3P5J A;  1ASW A;  3ZET A;  5KQD A;  2WC9 A;  2VWJ A;  3S3O A;  2E1Z A;  5KGX A;  4CZG A;  1S22 A;  5FRN A;  4KKO A;  3WXJ A;  3KLE A;  2I5J A;  2QWR A;  4FVM A;  3AVG A;  5EX5 A;  4A59 A;  3TI0 A;  3AO3 A;  4JNE A;  3TSQ A;  1GOB A;  5M1Q A;  3A5M C;  1KQS M;  1D9F A;  3OYC A;  3LAL A;  1JKH A;  1XNR K;  4PL8 A;  1X9W A;  4EP4 A;  4DV5 K;  3SK3 A;  3ULE A;  5LJW A;  2IDO A;  4MLH A;  3ENB A;  3M8P A;  3U4L A;  3KK1 A;  4LF4 K;  2QXL A;  2QWQ A;  4JK7 A;  3THY B;  1BA1 A;  4AM6 A;  4FJK A;  1C0M A;  1U04 A;  2XY7 A;  3KK2 A;  1XI1 A;  3ZEU A;  4LY7 A;  2Y1I A;  3HVR A;  2QW9 A;  1ATS A;  4HVJ A;  3O3F A;  4X66 K;  3M3Z A;  1IBM K;  1NJY A;  3DXM A;  2GV9 A;  1SKR A;  2BH1 A;  3U3G A;  3DYA A;  3B8A X;  3VQ4 A;  1C1C A;  5AQN A;  4CGI A;  2NRR A;  4DTN A;  3H45 C;  4B1V A;  5T7B A;  4YNQ A;  3IRX A;  1VQN N;  2O4G A;  3F9M A;  4JD2 B;  4DTS A;  4OKK A;  5LJV A;  1T44 A;  3UKR A;  5BPN A;  4U7B A;  2ASP A;  3AVB A;  4FPB A;  2G8I A;  3SMP A;  4ILH A;  2WUS A;  4BC4 A;  3TAF A;  2YJE A;  2YKM A;  4CF1 A;  4CK1 A;  1FW6 A;  5C24 A;  3LDS A;  1J5E K;  2KHO A;  1TYQ B;  4LSL A;  4DR2 K;  2DTU A;  3OTO K;  4FM1 A;  3LP1 A;  3TTF A;  1ATR A;  4LF9 K;  3AAQ A;  2A1R A;  4A5B A;  2FSN A;  4FWR A;  3QNO A;  3SUN A;  4DLG A;  2GTD A;  1DT9 A;  1ASU A;  1MWK A;  1LWE A;  3CG7 A;  2OPR A;  4FL9 A;  3SBT A;  4CFB A;  4ISF A;  3L4Q A;  4K42 A;  4YOT A;  2RF2 A;  4KTZ A;  2HB5 A;  4FJ5 A;  1IV0 A;  4WFA L;  4CFA A;  3KTQ A;  4BQZ A;  3HOS A;  3TAG A;  5FLX O;  3NVM A;  5BR8 K;  3UE5 A;  3W0L A;  1U49 A;  2HHU A;  3TAE A;  2BUP A;  3C7N A;  2CH5 A;  1SQK A;  1V4T A;  3OBY A;  1HPZ A;  4FJI A;  3VEO A;  1ZBH A;  1TVR A;  5C10 A;  1G99 A;  3WQT A;  3D7E O;  1TV6 A;  1N33 K;  1XUP O;  1D4X A;  1REV A;  3S3M A;  3IAY A;  1HQU A;  1S6Q A;  2WON A;  1S9E A;  4B9T A;  1NK6 A;  3I0R A;  4W5Q A;  2A3Z A;  3TSU A;  3CYM A;  4M3Z A;  4CHY A;  2KZZ A;  2HVI A;  4TSX A;  3R9P A;  1X3M A;  2IVP A;  4MDA A;  3AO1 A;  1S9G A;  3QET A;  3NCI A;  1BU6 O;  4CHP A;  2KZM A;  4HUE A;  3AA2 A;  2Z1H A;  1CLQ A;  5HBM A;  4CIG A;  4H4O A;  2HBK A;  3GL1 A;  1QZ5 A;  3RR7 A;  4H4M A;  1XC3 A;  1HJO A;  4BWJ A;  4PWD A;  3TWH A;  4JI1 K;  3I8D A;  4BDP A;  3Q7B A;  4CER A;  3HPH A;  3SPZ A;  1EET A;  1WUA A;  3AVJ A;  3AVI A;  2O8B B;  2F9T A;  4DV0 K;  1U2V A;  4O0J A;  3RSE B;  1MDU B;  4PL7 A;  4DSF A;  3CER A;  1EKE A;  3NF8 A;  4CEE A;  4CZM A;  2IOC A;  4OPH A;  4RTF D;  3JAM O;  2VQF K;  3ID8 A;  4QS9 A;  4KHS A;  2HBJ A;  3HSC A;  1JCE A;  1RTD A;  5AQH A;  3SAH A;  1WN7 A;  2RKI A;  2WOM A;  2DPN A;  4FO0 A;  4FK0 A;  2KLA A;  5EXW A;  4CZL A;  3DLH A;  5I42 A;  4UY8 O;  1QQC A;  1Q8I A;  1Q86 O;  3MED A;  3QBW A;  4YOY A;  3KWI A;  4EZ9 A;  4IO8 A;  3LP3 A;  4DTM A;  3TPQ A;  1EWQ A;  1VSF A;  1HLU A;  2HHS A;  4YOR A;  4XH4 A;  4CFC A;  2LSN A;  3LL3 A;  3NF7 A;  1YIT N;  3AO2 A;  3C6H A;  3RMA A;  1U4B A;  5KGW A;  2A5X A;  3VQ8 A;  2AA4 A;  2QKB A;  4FLZ A;  4H0X B;  4RW8 A;  3DXK A;  1A5X A;  3O08 A;  3LWL A;  5FRO A;  1VQ8 N;  4CHZ A;  3C6A A;  3SV3 A;  3PIO L;  4B3O A;  3AO4 A;  1ZBU A;  3ZT1 A;  4BRE A;  4XH5 A;  5AQY A;  4BR0 A;  5C15 A;  3DLE A;  1VSM A;  5B8H A;  1X9J A;  4N5S A;  1T6C A;  4G1Q A;  3LP0 A;  3PX0 A;  1RFQ A;  1HNI A;  4CJ3 A;  3KJV A;  1J53 A;  1KSP A;  3QNN A;  3W3D A;  4BWM A;  2QWL A;  4GMJ B;  2F7T A;  4DQQ A;  1U48 A;  4CJ7 A;  1O13 A;  2D0A A;  4BRN A;  3V6D A;  4KB1 A;  3VOV A;  5KRT A;  3QER A;  4KTW A;  3OYI A;  3CCJ N;  3GOI A;  1HPM A;  3LP2 A;  3VA3 A;  3D6R A;  5AFU H;  4M3T A;  3DMJ A;  2XRI A;  3FGU A;  3MN9 A;  4U67 L;  4KH5 A;  3EYZ A;  1Z25 A;  1UOC A;  1ZBS A;  4O8K A;  1OH7 A;  3V9Z A;  4ISG A;  3E9P A;  1M90 O;  3MXM A;  2P9L A;  3R3L A;  1J9A A;  3S41 A;  3VQ9 A;  1BI4 B;  4E89 A;  4CJV A;  4UQG A;  4OO1 J;  3E9O A;  3V9U A;  3CJ1 A;  4DR3 K;  4DSI A;  1HKB A;  3AV9 A;  2O8C B;  4E7L A;  2PYL A;  4CEQ A;  4AH9 A;  2WBN A;  2W6L A;  3O1W A;  4AHR A;  1EX4 A;  1GLA G;  3E01 A;  3HOT A;  2HMP A;  3FLC O;  4C8N A;  2XY6 A;  3HM9 A;  4DV2 K;  1RGI A;  1IG9 A;  3K2P A;  1QS4 A;  4GV3 A;  4C8O A;  5FPM A;  2YHX A;  4YY3 K;  5LL6 Z;  1NJX A;  4JS4 A;  3CC2 N;  3ALY A;  1VQL N;  3ZSQ A;  4FW1 A;  1UWB A;  3DLL L;  3VQE A;  4O0I A;  2EWS A;  1Y64 A;  4OGC A;  1L5U A;  2G8U A;  2ZWH A;  1YHQ N;  1DKG D;  3MX5 A;  4NB4 A;  2CGL A;  2F4V K;  1UA1 A;  4NCG A;  4FJG A;  5JIC A;  1RIL A;  4HUF A;  3BUZ B;  3VN5 A;  3P39 A;  1TKT A;  1T7P A;  1BOT O;  3RR8 A;  3SJH A;  1SL2 A;  5AQP A;  2B4J A;  4DG1 A;  3VQQ A;  4E0D A;  2Q2R A;  2NZT A;  1VSI A;  5HRS A;  4EHU A;  1NMN A;  2G8K A;  2BE2 A;  2ZF5 O;  5ADX H;  3J80 O;  3O4W A;  2IVO A;  1T05 A;  3V1O A;  1A5V A;  4LSN A;  1E3M A;  1W9H A;  4BRH A;  4ELT A;  1NGH A;  4FM0 A;  3CCU N;  1JLG A;  3E66 A;  3VF2 A;  3O9R A;  4AF1 A;  2E8A A;  2Q97 A;  3AA4 A;  3AAR A;  1S1T A;  1TUY A;  1S1U A;  4BGB A;  2HHQ A;  1T6D A;  5KQ8 A;  4FPA A;  3KLF A;  1L3T A;  4F3O A;  4FJ8 A;  5SWM A;  4Y0W A;  4YOW A;  1RBV A;  5AQO A;  3OYM A;  1TKZ A;  5KTQ A;  4MO4 A;  1GLL O;  1HYV A;  3VGM A;  5JLF A;  3KK7 A;  2YJF A;  2Q0R A;  2JLE A;  1OH6 A;  3MX2 A;  3RWU A;  1T3V A;  4FVU A;  2VYP A;  1MU2 A;  4JI8 K;  4CVN E;  3C94 A;  2GUI A;  4NYN A;  4M7X A;  4XIU A;  3VER A;  4K43 A;  4FZY A;  3IKM A;  1K8A O;  1I3A A;  3ZSR A;  3QIN A;  1Y97 A;  5KPR A;  3EN9 A;  4CBX A;  4PKG A;  2RHK A;  4I6M B;  5JVG L;  5ELZ A;  3VPZ A;  1ZBI A;  2O8E B;  4DQ8 A;  2QKK A;  1RDB A;  4YHH K;  2BDP A;  3TAN A;  5GIP A;  1GLF O;  2YHB A;  4CZI A;  4W5R A;  1C6V A;  4OPJ A;  2I7N A;  3AVK A;  5FDL A;  3ZT4 A;  2UXB K;  4Q5V A;  4CIF A;  3NGY A;  2IS3 A;  4O5B A;  2FSJ A;  3O3H A;  3FFI A;  2OZM A;  5AZJ A;  2JWL A;  3QIC A;  5AZI A;  5CR4 A;  3WXI A;  2PAV A;  3VTI A;  5BPL A;  3I0S A;  3BGR A;  4A5A A;  2I7P A;  3BZC A;  1WAJ A;  1NGF A;  3IFR A;  4JHD B;  3HJF A;  3O1B A;  1RCH A;  4W5T A;  3IG1 A;  1K8K B;  1CZA N;  4CJT A;  4W5O A;  1RT6 A;  3OYF A;  3SQ2 A;  1HNX K;  3PY8 A;  3G6E N;  1X1P A;  2OTJ N;  3V1R A;  3K57 A;  4IZ9 A;  4H5T A;  3ZSV A;  3ZX0 A;  4MO5 A;  1BO5 O;  4QAG A;  4KRE A;  1BCM A;  2P9I A;  3SMS A;  5TKY A;  1VQ5 N;  3MN5 A;  1YXQ A;  1HNW K;  4E7H A;  3HPG A;  3WEE A;  3L3U A;  4KFB A;  4AHC A;  4JKF A;  5BR9 A;  4AHT A;  5EU7 A;  1HYZ A;  1QQN A;  2HF3 A;  4EAH D;  3T3F A;  3DJC A;  1JCG A;  4KRF A;  1S72 N;  2NNW A;  3L2U A;  4CZE A;  3R8E A;  3SV4 A;  3U6F A;  3ENH A;  4J2A A;  4CF9 A;  4YOX A;  3TAQ A;  1VSH A;  3GDQ A;  4DKW A;  1OVY A;  3BF1 A;  3VEY A;  1YIJ N;  3JSM A;  3THX A;  3VF6 A;  3AVN A;  3PX6 A;  4G9Z A;  4GKK K;  2YCH A;  3KKR A;  4LF6 K;  2FSK A;  2GUP A;  4DQP A;  1NK5 A;  1IH7 A;  2ZJQ L;  3SNN A;  3L0Q A;  3CPE A;  3QEW A;  2QWO A;  3C95 A;  3OS2 A;  2UU9 K;  2FF6 A;  3CXC M;  2A6A A;  1KVC A;  2D0P A;  2WTU A;  2ZJR L;  1FJG K;  3AVM A;  3K5M A;  3QES A;  1NKB A;  5J2P A;  2D1K A;  2NRT A;  4H0Y B;  4GKJ K;  5CY4 A;  4AHU A;  3OW2 M;  3SBG A;  3HM8 A;  3U9Z A;  1KCF A;  3M6G A;  1QVF M;  3G71 N;  3A8Y A;  2RE2 A;  4N47 A;  4B9Q A;  2Q0U A;  5C2D A;  2P5G A;  1BG3 A;  4LF7 K;  3LDQ A;  1Q9X A;  4JI4 K;  2DY4 A;  4DU1 A;  3BZK A;  2E1Y A;  2V7Y A;  1RT2 A;  4IOC L;  4CZJ A;  3MWT A;  1RT1 A;  4DLE A;  1Q82 O;  3PO5 A;  5KPZ A;  3J7Y P;  3LZI A;  2P9P A;  1VQ4 N;  3WNG A;  1K6Y A;  4FWL A;  2P9K A;  3D2F B;  2RN2 A;  2CGJ A;  3OYD A;  1S1W A;  1FXX A;  4FLU A;  1ESV A;  4QCL A;  1RDC A;  2ZE2 A;  3U9D A;  5HOO A;  5DM7 L;  3H3N O;  3RMD A;  4BR2 A;  1SUQ A;  5HRO A;  3HBT A;  4F3T A;  1HUX A;  3KHY A;  1RDD A;  1BQM A;  1UAX A;  3PO4 A;  1EXQ A;  4DB3 A;  4K8X A;  4KV8 A;  1S1X A;  5IT9 O;  1VRT A;  4KHN A;  4DMN A;  2Q1N A;  3HTV A;  3F9K A;  3OYL A;  5JVH L;  2IIR A;  4RW7 A;  1HMV A;  1NOY A;  4B1U B;  1TL1 A;  3CCS N;  3VEX A;  4YOV A;  4AIL C;  4CW7 B;  4CF8 A;  1I94 K;  1R59 O;  4FOE A;  1XMO K;  5KPT A;  4EFH A;  3CM6 A;  2P51 A;  1J54 A;  4IDH A;  3D2E B;  5K14 A;  1D5A A;  4EHT A;  1IKY A;  1LWF A;  1XHX A;  3L2V A;  3M8S A;  3MCP A;  3G4S N;  2B5J A;  3ZLJ A;  4CES A;  1CXQ A;  3NBP A;  2ZM6 K;  3Q7C A;  1YI2 N;  1HNZ K;  3DWL A;  3G0Z A;  1JLC A;  3MDQ A;  1VSJ A;  3MN7 A;  4YDU C;  3WT0 A;  3QO9 A;  4X62 K;  3KLI A;  1KD1 O;  3CFO A;  3V9X A;  1IJJ A;  2X78 A;  5AQS A;  1FK9 A;  3LWM A;  1IBK K;  4RG8 A;  3CQ8 A;  4DFP A;  4LFB K;  3OVN A;  1NU0 A;  3G25 A;  3SLC A;  4BRP A;  2G8V A;  4CEZ A;  3O9U A;  4FJH A;  1B9D A;  4JI2 K;  3J7A P;  4BRO A;  3H3O B;  3VQA A;  4OPK A;  4DR6 K;  3OYA A;  3BDP A;  4F2R A;  4CJE A;  2ZGZ A;  4DTJ A;  4JI5 K;  2GEL A;  1WBB A;  4JI6 K;  4ICL A;  3WNF A;  1JL1 A;  4B3T K;  3SI6 A;  2O8F B;  3HZ6 A;  1IKW A;  4BC3 A;  2QEX N;  4WF9 L;  4ZHR A;  1KTQ A;  3MN6 A;  3CET A;  1XQS C;  4OJR A;  4DV4 K;  2NRX A;  4E3S A;  2Y1J A;  3P4I A;  1JLF A;  3I33 A;  1ATN A;  4H0V B;  2QWN A;  3SAG A;  1QQM A;  4MQ3 A;  1N6Q A;  1N32 K;  4IOA L;  4N76 A;  4ELV A;  3T19 A;  4FJJ A;  3NH0 A;  3QBX A;  2D0C A;  2P9U A;  1JLB A;  2YX6 A;  1HRH A;  3EEQ A;  4ID1 A;  1T03 A;  4B9S A;  1BIZ A;  1JLA A;  3QML A;  2NRW A;  4DR1 K;  2FBT A;  4DV1 K;  4JKG B;  3LDO A;  4H0T B;  5BRE A;  1C1A A;  1YVN A;  4IG3 A;  2FBV A;  3VQ5 A;  4JK8 A;  1RT5 A;  4KBO A;  3CMA N;  5F0X A;  3SAF A;  1CXU A;  4DR5 K;  3SJJ A;  2OPS A;  2FC0 A;  4PKH A;  3VGK A;  4C8K A;  3NGZ A;  2NRH A;  2NRZ A;  1BIU A;  1YAG A;  3MMV A;  1JLE A;  2O8D B;  1KFS A;  4R79 A;  4IXC A;  4FOI A;  4IG0 A;  3CCE N;  3HO1 A;  4IO9 L;  1NK7 A;  1M1K O;  3AGR A;  1HJR A;  4IFV A;  2XHB A;  1D8Y A;  1DLO A;  3ZX2 A;  2JGU A;  3UKU B;  2X74 A;  1QE1 A;  2P9S B;  3SYZ A;  1JL2 A;  1TUU A;  4FWN A;  2HVH A;  1RDA A;  4BRA A;  2EHG A;  4B9M A;  3EKU A;  2QXF A;  5AQK A;  4DFM A;  4L8R B;  5AQM A;  2E6L A;  3OBW A;  3DAW A;  3ZSZ A;  4R5P A;  4ZTF A;  4I7F A;  4F8R A;  4NCB A;  3ZT2 A;  4PQU A;  3R1X A;  1YF5 L;  2ZGY A;  2E2O A;  4E1N A;  2ATQ A;  3VES A;  1S3X A;  3DLB A;  3ASM A;  3L4I A;  2G8W A;  3M1F A;  3JXU A;  2E6M A;  2PY5 A;  3PIP L;  2OTL N;  3CJ7 A;  3P31 A;  1Z26 A;  3AVH A;  3WNE A;  3WNH A;  4M3U A;  5C42 A;  1W0H A;  3RMB A;  2YNH A;  4CEB A;  3DRR A;  1P90 A;  4WQ5 A;  3THW A;  4BE2 A;  4DTP A;  3ZET B;  5AQV A;  2G8H A;  3QFP A;  3A5O C;  4H03 B;  4OGE A;  5GAD P;  4HTL A;  1XC9 A;  4OLB A;  2UXC K;  3HST B;  1JCF A;  5FRM A;  3NHG A;  4JKB A;  3VQB A;  2R7Y A;  3KD1 E;  4M42 A;  3LAK A;  4CGF A;  1X3N A;  3K5L A;  5AQR A;  1WSJ A;  5H1S Q;  1BHL A;  2VG5 A;  2RPI A;  2XY5 A;  4KHQ A;  3AGK A;  3K5N A;  3CQX A;  3EKS A;  4KI6 A;  4DR7 K;  3KVG A;  3ULE B;  2P5O A;  2FBY A;  4GV9 A;  4NXN K;  4N56 A;  4B9L A;  4B8A B;  3EO3 A;  3GBT A;  5E26 A;  1GOC A;  1IKV A;  3ZEU B;  4HCB A;  1V4S A;  2BAN A;  3CF5 L;  3THY A;  1NBW A;  1TK8 A;  3J8A A;  4CGJ A;  1C0U A;  4KTQ A;  3VEZ A;  1S1V A;  3DXM B;  5AQG A;  4BGA A;  3KD5 E;  2EX3 A;  2GWK A;  2Q31 A;  4OPA A;  5BPM A;  2Q36 A;  3SUO A;  1NNE A;  4BRK A;  3EZ5 A;  2QA4 N;  5IWA K;  3FZK A;  3UKR B;  3K0S A;  1YTA A;  3SUP A;  4K8Z A;  4JD2 A;  3QFU A;  4GW6 A;  4BRI A;  3NH2 A;  4FW2 A;  5HRP A;  4MLE A;  5I9E B;  1U6Z A;  2Z1G A;  4WQ5 C;  3T1A A;  4Y1C A;  2F8T A;  3WUH A;  5AQT A;  4CI6 A;  1U47 A;  2VWK A;  4O55 A;  1TYQ A;  1YJ9 N;  4X65 K;  1Z05 A;  3B6P A;  4YFU A;  1ZYQ A;  3TAM A;  4AM7 A;  3AVF A;  4DSJ A;  4XH1 A;  4M3X A;  4FCY A;  4WE1 A;  3B6O A;  1HKG A;  4CJ5 A;  3PX4 A;  3OHR A;  1VQ7 N;  1RT3 A;  2BGG A;  3C0B A;  4CCH A;  4C23 A;  4RW9 A;  4O44 A;  4CEF A;  1ZBL A;  3FZH A;  4JK9 A;  5CE3 A;  1BIS A;  1LAW A;  3WXK A;  4EZ6 A;  5HL7 L;  2HBL A;  3LPT A;  4ELU A;  2B6A A;  4A2A A;  3DLG A;  4KO0 A;  1NJW A;  3C7N B;  2YKN A;  4IJN A;  5C25 A;  4JKH A;  2UUA K;  1Q18 A;  3K58 A;  5CZ1 A;  4CEO A;  1QHT A;  3TTD A;  3K9K A;  2NLX A;  1KLM A;  3F2K A;  3FR0 A;  4K0K K;  3JS6 A;  2GWJ A;  3T1H K;  5C2F A;  4M3W A;  2QWM A;  2V51 B;  5JMV A;  4Z4C A;  3HI0 A;  4DFJ A;  4DUY K;  3VQ6 A;  2H3G X;  2KTQ A;  3K5O A;  1T8E A;  3MXJ A;  2F96 A;  5C0Y A;  3AA5 X;  1RBS A;  1Z6R A;  5D3G A;  4J8F A;  5M1N A;  3IS9 A;  3O80 A;  4FLV A;  4CHN A;  3OYE A;  3NE6 A;  4QOZ B;  3CQY A;  4ID5 A;  1YTU A;  5JS2 A;  4KHY A;  1NK8 A;  1WOQ A;  3HYF A;  4FJ7 A;  2YI1 A;  2YNI A;  4RW6 A;  2D0B A;  3CC4 N;  4DV7 K;  4FJX A;  3OYK A;  3DOL A;  1SV5 A;  2VG6 A;  4B9N A;  4Z4E A;  4H0O A;  1JJ2 M;  3DOK A;  4PUO A;  1KC8 O;  3V4I A;  1VRU A;  4B3S K;  2AJQ A;  1D9D A;  1YUW A;  3CJC A;  1DTQ A;  3KLH A;  4WCE L;  1RNH A;  4O8U A;  2CGK A;  2PBD A;  4N41 A;  1U2V B;  2W40 A;  2O8B A;  4E7J A;  3IDH A;  4BQL A;  3VTH A;  1C0G A;  3HP9 A;  2HMI A;  3RSE A;  4I2Q A;  3E1Y A;  4E1J A;  5AFU A;  1OH8 A;  2W41 A;  4KHU A;  3KK3 A;  3TSP A;  3PSI A;  3H08 A;  4PHT X;  4F9O A;  4DQS A;  3N4Q A;  1G15 A;  1NGJ A;  4HCC A;  2QWP A;  3O9Q A;  3HP6 A;  4NCA A;  2OPP A;  3T69 A;  1KXP A;  5SZT A;  1VSE A;  4BAC A;  4FWQ A;  2IAJ A;  4XEI A;  2A40 A;  3TAP A;  4HUG A;  3VF4 A;  4BVO A;  4WQ4 C;  4CGG A;  4JS5 A;  3ZSO A;  2YHA A;  4BG9 A;  3LAN A;  1BA0 A;  1WSI A;  2O8D A;  4LH5 A;  3LAM A;  3N4P A;  4CD1 A;  1NM1 A;  4ILJ A;  3GG4 A;  4E1M A;  3MXI A;  4RWT A;  4CE9 A;  2O4I A;  4CFD A;  3DXK B;  4FWM A;  4CHO A;  4K25 A;  3TU5 A;  1WSE A;  1EQY A;  3E9L A;  1Q81 O;  1RBR A;  4O4G A;  2IVN A;  4IEI A;  2HHV A;  3BP8 A;  3EZW A;  4DWI A;  4LD0 A;  1BDG A;  2A42 A;  4OX9 K;  3OY9 A;  2ASM A;  2ASO A;  4BRC A;  1E4F T;  1TAU A;  4O5F A;  3NH1 A;  2Z1J A;  3O4N A;  3THV A;  1KVB A;  1TL3 A;  5AR0 A;  4FJN A;  3HXM A;  4CJ4 A;  3HRG A;  1LV5 A;  1VHX A;  3AY9 A;  2PYJ A;  5LMU K;  1GLE G;  5BN9 A;  4IEE A;  1N34 K;  3O5B A;  5HLF A;  1GOA A;  4FLT A;  3L6Q A;  2DFH A;  2YHW A;  1WSF A;  4I9L A;  2BTF A;  3CPW M;  2QTD A;  3UB5 A;  1SAZ A;  2FF3 B;  3CCV N;  5ADX A;  1KFD A;  1MA9 B;  2ITM A;  4BR7 A;  4H5N A;  5DMR A;  2E4L A;  4AQY K;  1VQP N;  3MCA B;  3FFK B;  4FJM A;  4M3R A;  2P9L B;  3VET A;  4IBN A;  4Z4F A;  1XNQ K;  1H1V A;  4JLH A;  1KVA A;  1NKE A;  1VK0 A;  3V1Q A;  1BI4 A;  1BQN A;  4LF8 K;  4YDU A;  5AJ3 K;  3EY1 A;  1QSY A;  1GLC G;  1VQK N;  2OA8 A;  2UXD K;  1HYS A;  3H6E A;  3LDN A;  4DS4 A;  4DTX A;  2VG7 A;  3V81 A;  2YNG A;  5GAG P;  1U45 A;  1ASV A;  4FJL A;  2O8C A;  4JKD A;  1JLQ A;  4B9V A;  2UYT A;  3A5L C;  3C65 A;  2IC3 A;  1GLB G;  5GIN A;  4KB0 A;  4J2B A;  3T1Y K;  2OPQ A;  5AQZ A;  3P83 D;  3FE1 A;  3CIP A;  3H46 O;  4H0P A;  4CEC A;  3ZT0 A;  4H8K A;  3VEW A;  2E2P A;  3CFP A;  1KAY A;  3WQU A;  4LC9 B;  1KAZ A;  1LCU A;  5J2Q A;  3HPO A;  4NYF A;  4FJ9 A;  2CH6 A;  1QZ6 A;  3ZSW A;  2VGN A;  4LH4 A;  2HHW A;  5BRH A;  1WB9 A;  4BRM A;  4HHT A;  4DF4 A;  3KZB A;  2HNZ A;  4AHV A;  4M3Y A;  1DTT A;  1NK9 A;  5AQL A;  3F5T A;  3QLH A;  4A2B A;  4DTO A;  2QI2 A;  4CK3 A;  5F2R A;  3CME N;  3KWG A;  1B9F A;  1NMD A;  4M63 C;  3DM2 A;  4BE1 A;  4DTR A;  2GEM A;  1RDW X;  2A1S A;  5GIO A;  1XWL A;  3U3Y A;  4Z4H A;  4M45 A;  3PV8 A;  3CJ9 A;  1OVQ A;  3NF6 A;  3OA9 A;  3WXM B;  5FPN A;  3QEP A;  4CZF A;  4JAX A;  4FWK A;  2E2Q A;  3K9J A;  3RTV A;  4CBW A;  1J5O A;  2WFB A;  1NGG A;  4GVM A;  4A61 A;  2Z1I A;  4Z4I A;  1CZB A;  4PA1 A;  2QK9 A;  2P9N B;  4E19 A;  2D0O A;  1XMQ K;  4DTU A;  2IGI A;  3L8B A;  3DI6 A;  5KRS A;  3D0P A;  4FZX C;  4FYD A;  1N36 K;  1TKX A;  1NK0 A;  5CZ2 A;  4DSL A;  3VEN A;  3BEX A;  2W42 A;  4FLW A;  1W7A A;  4CD3 A;  3I8B A;  4MDB A;  5F1X A;  1ILY A;  2G8F A;  5E84 A;  4C8M A;  3L2R A;  1LW2 A;  1WBD A;  4CIE A;  4Q0B A;  3ZT3 A;  1ZC6 A;  2NUB A;  3LM9 A;  4JN4 A;  3SZ2 A;  4K41 A;  3M8Q A;  1FKP A;  3D45 A;  3ULD A;  4LFA K;  3VQD A;  4J2E A;  4BVP A;  3O6W A;  5LMN K;  4BE0 A;  4WFN L;  1VQ9 N;  3ZSY A;  1OH5 A;  5EOY A;  3RRG A;  4CF0 A;  3V9W A;  1NK4 A;  2HF4 A;  1UA0 A;  4I6M A;  2E20 A;  4DQI A;  1EO1 A;  1YVU A;  4B1X B;  3CM5 A;  2HW3 A;  1NGA A;  2O8E A;  3ITH A;  1O1W A;  4IDK A;  3L2W A;  3AVC A;  3HL8 A;  4ZTJ A;  4DHY A;  1L3V A;  1QVG M;  1E4G T;  2D4W A;  1VQ6 N;  4W5N A;  4RCH A;  3MWP A;  3J7Z O;  3OJU A;  4B3R K;  4FXD A;  3VQC A;  1KRP A;  3SQ0 A;  1XHZ A;  5AZJ B;  3FZM A;  5AZI B;  4I2P A;  5AQW A;  5KI6 A;  3A0I X;  4CBU A;  3H1V X;  3OYB A;  5HP1 A;  4OVL A;  3CHW A;  1BCO A;  1SS6 A;  2F9W A;  1QHA A;  3A2F A;  4FM2 A;  1NGD A;  1VSK A;  3HT3 A;  1CZ9 A;  4QS8 A;  3SPY A;  2PFU A;  3ATU A;  3KIO A;  4JHD A;  4FWP A;  4GY2 B;  2X6N A;  3SCX A;  1WLJ A;  1K8K A;  5J1E A;  1TK5 A;  1Q7Y O;  1F21 A;  1L3U A;  4FSV A;  5M1K A;  2P9I B;  1VSL A;  1ITG A;  4BR5 A;  4H5R A;  2UUC K;  2DFE A;  3RRH A;  4DV6 K;  3WEE B;  3VMF B;  4BR4 A;  3O4Q A;  5HRR A;  1IKX A;  3AAP A;  4BG8 A;  4CHQ A;  4CZK A;  5JLH A;  5E41 A;  4J2D A;  3ATV A;  4Z94 A;  4M7Y A;  1ZBF A;  5I3U A;  3VEV A;  3H1Q A;  1I39 A;  3A5N C;  1NWK A;  2HST A;  2PZS A;  1RTI A;  5FPD A;  5AQF A;  5FPE A;  4V19 S;  2FBX A;  2YV0 X;  3AA3 A;  3M8R A;  1HNV A;  4KAZ A;  4B9U A;  4LFC K;  4EIA A;  3CJA A;  4OKJ A;  4KH6 A;  1W2B M;  4GNI A;  4YOU A;  4C8L A;  5M1F A;  4H5V A;  3CI5 A;  1NKC A;  4DCH A;  2P1J A;  4DR4 K;  3THX B;  3QEV A;  1VQO N;  3SQ1 A;  2ZQB A;  2J4R A;  4JI0 K;  3CCQ N;  4KHW A;  4MFB A;  3EE8 A;  5MLC Q;  4BC2 A;  1VQM N;  4DS5 A;  4KH4 A;  3LDP A;  3K59 A;  3U8X A;  3MAQ A;  3BY5 A;  5BRF A;  1YJW N;  4FK4 A;  3MEG A;  3ZX3 A;  4JI7 K;  1LAV A;  1A5W A;  4B3M K;  3M5R A;  3PUF A;  5AQI A;  4B1W B;  5EVZ A;  3S9H A;  4GV6 A;  4JKE A;  3MEE A;  1HR0 K;  1DEJ A;  3OYH A;  3NMU A;  3IUC A;  3LM2 A;  1TK0 A;  4NLB A;  4CJQ A;  1NOZ A;  1S6P A;  2ITG A;  3VQP A;  1SKS A;  4BRL A;  3S3N A;  1TGO A;  2JWK A;  5LY3 A;  1WAF A;  1RTH A;  3I55 N;  4CK2 A;  3SUQ A;  4KHP K;  2XY8 A;  4CJR A;  1ZXO A;  1C0T A;  1GLD G;  1HX1 A;  4GVE A;  2P9P B;  3CD6 N;  4IFY A;  4A57 A;  4CF2 A;  1NGC A;  3RMC A;  2P9K B;  3ZCM A;  3OYJ A;  5DK5 A;  3ENO A;  5HRN A;  2D5R A;  3AVA A;  5CYM A;  4L3Q A;  1QQO A;  5DM6 L;  1S5J A;  2GX9 A;  1MWM A;  3D2F A;  1QTM A;  3MEC A;  3P38 A;  1RTJ A;  3WXL A;  1KLN A;  4FLY A;  4CGH A;  4JRQ A;  1Q9Y A;  4BRF A;  3I56 N;  3VA0 A;  4BRG A;  1NGI A;  1VSD A;  4DU3 A;  1NJZ A;  4DF8 A;  4IOX A;  1X9M A;  4JV5 K;  1LW0 A;  4FWO A;  4HTU A;  3ZSX A;  3CJB A;  4AHS A;  1RDU A;  3KKS A;  1GLJ O;  4FZZ A;  5M1O A;  1VAZ A;  2V7Z A;  3T7Z A;  1K73 O;  4JKA A;  1C0F A;  1EP4 A;  4NO7 A;  2E5L K;  4DFK A;  1BUP A;  3V9S A;  1SL1 A;  3TTC A;  1WSH A;  4FLX A;  4KI4 A;  3NVK A;  3P1G A;  1FKO A;  2QM1 A;  1RT7 A;  4RW4 A;  2VGM A;  3NAE A;  4B1Z A;  3IMX A;  3F73 A;  2YHY A;  4IWV A;  3QEI A;  3D2E A;  3TAR A;  4CJP A;  1B92 A;  3G10 A;  2KW4 A;  5CHI A;  4C1N I;  1NJI O;  3O9T A;  1NLV A;  2E2N A;  1N5Y A;  2A41 A;  4CJW A;  1HKC A;  2GBZ A;  1SZ2 A;  3QB0 A;  3O8M A;  3KLG A;  2FXU A;  3C6U A;  4FK2 A;  2ZD1 A;  4A62 A;  3O3G A;  3CFR A;  2VCP A;  2OCE A;  3R6M A;  2AP1 A;  3GE1 A;  5BRD A;  4B08 A;  4WFB L;  3NFA A;  4CED A;  3OS0 A;  2P9N A;  1P8Z A;  3AO5 A;  5BN8 A;  1N8R O;  3LDL A;  2KFZ A;  4CJL A;  3NGI A;  4I9Q A;  1RBT A;  3NF9 A;  3J81 O;  2KQ2 A;  3CCL N;  1L3S A;  3OS1 A;  3ISN C;  1K9M O;  5TKW A;  3FZL A;  4WQ4 A;  4EP5 A;  3DLK A;  3LPU A;  2HBM A;  4BRD A;  3QEX A;  1WNS A;  1JXB A;  3HK2 A;  3NDK A;  4DUZ K;  3QIP A;  3CCR N;  4LF5 K;  4DSK A;  5CYQ A;  2O8F A;  1SL0 A;  5A2Q O;  1JXE A;  2NRV A;  3FZF A;  4CEA A;  3HVT A;  4C1N K;  1RT4 A;  5AQU A;  4FWS A;  4BR9 A;  4Y1D A;  4M41 A;  1C1B A;  1LOT B;  4WYB A;  2ZJP L;  4CJU A;  4DSE A;  1KAX A;  1YT3 A;  2Q3S A;  2V52 B;  1IBL K;  4IFE A;  4ILG B;  2VWB A;  4JRP A;  2P9U B;  4NXM K;  2XO7 A;  1R0A A;  4F4K A;  2YNF A;  3BF3 A;  4JKC A;  2HHT A;  3EL2 A;  3L2Q A;  1DGK N;  5C12 A;  3VQ7 A;  3EE9 A;  3QIO A;  5J2N A;  4JKG A;  2DFF A;  4BRQ A;  1NG9 A;  4OKE A;  3JYT A;  5M1P A;  4KPY A;  1IG8 A;  4NLC A;  4CJF A;  1YJN N; 
#chains in the Genus database with same CATH homology
 3SJJ A;  2OPS A;  2FC0 A;  4LH4 A;  2HHW A;  3OYN A;  4HHT A;  4DF4 A;  4C8K A;  2HNZ A;  3NGZ A;  1UA1 A;  4NCG A;  4FJG A;  4AHV A;  4M3Y A;  1DTT A;  1NK9 A;  1RIL A;  1BIU A;  4HUF A;  4CGD A;  3TR8 A;  3QLH A;  1JLE A;  3VN5 A;  4DTO A;  1WSG A;  1X9S A;  1TKT A;  4Z0U A;  4CK3 A;  2HND A;  1KFS A;  1T7P A;  3RR8 A;  2OZS A;  3DRP A;  4CJS A;  4B8C A;  1SL2 A;  1QSL A;  1B9F A;  2B4J A;  2X6S A;  4IG0 A;  4DG1 A;  4CJK A;  3HO1 A;  3DRS A;  3VQQ A;  4E0D A;  3DM2 A;  4BE1 A;  4DTR A;  1NK7 A;  1VSI A;  4OLA A;  5HRS A;  3UIQ A;  2A1S A;  4F2S A;  1HJR A;  1IO2 A;  1XWL A;  4Z4H A;  3U3Y A;  2G8K A;  4IFV A;  1LWC A;  2BE2 A;  2HHX A;  1BL3 A;  4DU4 A;  4M45 A;  2XHB A;  3PV8 A;  1DLO A;  3NF6 A;  1TKD A;  1D8Y A;  2JGU A;  2X74 A;  3QEP A;  1QE1 A;  1QSS A;  4BDZ A;  3SYZ A;  1JL2 A;  3V1O A;  1T05 A;  1A5V A;  4LSN A;  3RTV A;  1RDA A;  2HVH A;  3TAB A;  1W9H A;  1J5O A;  2F8S A;  4ELT A;  2KFN A;  2EHG A;  4B9M A;  4Z4G A;  4FM0 A;  3OJS A;  2HNY A;  2QXF A;  1JLG A;  4DFM A;  4L8R B;  4GVM A;  2Z1I A;  1BGX T;  4Z4I A;  3SQ4 A;  3AA4 A;  1CZB A;  3DLR A;  1S1T A;  3OYG A;  4PA1 A;  2QK9 A;  2E6L A;  3C6T A;  1S1U A;  3ZSZ A;  4E19 A;  4R5P A;  4ZTF A;  4I7F A;  4F8R A;  4M3U A;  2HHQ A;  4DTU A;  3KLF A;  1L3T A;  2IGI A;  3AVL A;  3L8B A;  5SWM A;  3ZT2 A;  4E7I A;  1RBV A;  4F3O A;  4FJ8 A;  5J2M A;  3DI6 A;  5KRS A;  3OYM A;  3D0P A;  4E1N A;  1TKZ A;  5KTQ A;  2ATQ A;  3LZJ A;  4FZX C;  1HYV A;  3L3V A;  4FYD A;  1HQE A;  1RBU A;  1TKX A;  1NK0 A;  5CZ2 A;  4DSL A;  4PY5 A;  2JLE A;  3ASM A;  3DLB A;  3RWU A;  2G8W A;  2W42 A;  4FLW A;  4DQR A;  1MU2 A;  2E6M A;  4E7K A;  3C94 A;  4C8M A;  3L2R A;  2GUI A;  1SKW A;  2G8F A;  2PY5 A;  1LW2 A;  1Z26 A;  3AVH A;  4NYN A;  3WNE A;  3ZT3 A;  4CIE A;  2NUB A;  4Q0B A;  4BDY A;  4XIU A;  4FZY A;  3WNH A;  3SZ2 A;  5C42 A;  1W0H A;  1TAQ A;  3RMB A;  4IKF A;  2YNH A;  2ETJ A;  4CEB A;  3DRR A;  3M8Q A;  1FKP A;  3D45 A;  3ULD A;  1I3A A;  2OYQ A;  5JS1 A;  3ZSR A;  4BE2 A;  4DTP A;  3QIN A;  3P5J A;  1ASW A;  2G8H A;  1Y97 A;  4OGE A;  3VQD A;  2VWJ A;  1XC9 A;  3S3O A;  4J2E A;  4OLB A;  5KGX A;  3HST B;  5FRM A;  3NHG A;  5FRN A;  4BE0 A;  4KKO A;  3VQB A;  2R7Y A;  3ZSY A;  3KLE A;  3KD1 E;  4M42 A;  3LAK A;  2I5J A;  4CGF A;  3K5L A;  3RRG A;  4CF0 A;  3V9W A;  1NK4 A;  4FVM A;  1UA0 A;  3AVG A;  1ZBI A;  4DQI A;  3TI0 A;  1WSJ A;  1YVU A;  3AO3 A;  3CM5 A;  2HW3 A;  1GOB A;  2QKK A;  1BHL A;  1RDB A;  2VG5 A;  2RPI A;  2XY5 A;  2BDP A;  3ITH A;  1O1W A;  4KHQ A;  4IDK A;  3TAN A;  3L2W A;  1D9F A;  3OYC A;  2YHB A;  3LAL A;  3AVC A;  3K5N A;  4W5R A;  1C6V A;  1JKH A;  4OPJ A;  3HL8 A;  4ZTJ A;  1L3V A;  1X9W A;  4KI6 A;  3AVK A;  5FDL A;  4EP4 A;  3ZT4 A;  4Q5V A;  2P5O A;  2FBY A;  2IDO A;  4CIF A;  4N56 A;  3M8P A;  3NGY A;  3KK1 A;  4W5N A;  4B9L A;  2IS3 A;  4B8A B;  4O5B A;  3OJU A;  4FXD A;  3VQC A;  1KRP A;  3SQ0 A;  1XHZ A;  3O3H A;  1GOC A;  3FFI A;  1IKV A;  4I2P A;  4HCB A;  5KI6 A;  2OZM A;  4FJK A;  1C0M A;  1U04 A;  2BAN A;  3KK2 A;  2XY7 A;  1XI1 A;  1TK8 A;  3OYB A;  5HP1 A;  4LY7 A;  4OVL A;  2Y1I A;  4CGJ A;  1BCO A;  3HVR A;  1C0U A;  3I0S A;  4KTQ A;  3BGR A;  3A2F A;  1S1V A;  4HVJ A;  3O3F A;  1WAJ A;  4FM2 A;  1VSK A;  3HT3 A;  1CZ9 A;  1NJY A;  3HJF A;  3SPY A;  2GV9 A;  1SKR A;  1RCH A;  3KIO A;  2EX3 A;  3KD5 E;  4W5T A;  3U3G A;  3DYA A;  3IG1 A;  3VQ4 A;  2X6N A;  1C1C A;  3SCX A;  1WLJ A;  4CJT A;  4W5O A;  1RT6 A;  4CGI A;  3OYF A;  3SQ2 A;  3SUO A;  3PY8 A;  5J1E A;  3EZ5 A;  4DTN A;  1TK5 A;  1X1P A;  5T7B A;  4YNQ A;  3IRX A;  3V1R A;  1F21 A;  3K57 A;  2O4G A;  4DTS A;  1L3U A;  3ZSV A;  4OKK A;  1YTA A;  3SUP A;  4K8Z A;  4GW6 A;  4QAG A;  3NH2 A;  1VSL A;  4KRE A;  1BCM A;  1ITG A;  4FW2 A;  5HRP A;  3AVB A;  2G8I A;  2DFE A;  3RRH A;  2Z1G A;  3TAF A;  3T1A A;  2YKM A;  4CK1 A;  4CF1 A;  3HPG A;  4E7H A;  4Y1C A;  3O4Q A;  3L3U A;  2F8T A;  4KFB A;  5HRR A;  1IKX A;  5C24 A;  4CHQ A;  3LDS A;  4AHC A;  4LSL A;  1U47 A;  5E41 A;  2VWK A;  4J2D A;  2DTU A;  4O55 A;  4FM1 A;  4AHT A;  5EU7 A;  1HYZ A;  1ZBF A;  3LP1 A;  3B6P A;  5I3U A;  3T3F A;  1I39 A;  4YFU A;  1ZYQ A;  3TAM A;  2PZS A;  1RTI A;  3AVF A;  4KRF A;  4DSJ A;  2A1R A;  4M3X A;  4FCY A;  4WE1 A;  3B6O A;  3L2U A;  2FBX A;  4CJ5 A;  3SV4 A;  3QNO A;  2YV0 X;  3AA3 A;  3U6F A;  3PX4 A;  3M8R A;  1HNV A;  1RT3 A;  3SUN A;  4B9U A;  4KAZ A;  4CF9 A;  4J2A A;  2BGG A;  4CCH A;  4DLG A;  3TAQ A;  1VSH A;  4RW9 A;  4O44 A;  4OKJ A;  4CEF A;  1ZBL A;  1ASU A;  1BIS A;  1LAW A;  1LWE A;  3CG7 A;  4EZ6 A;  4C8L A;  2OPR A;  1NKC A;  4CFB A;  2RF2 A;  2P1J A;  4KTZ A;  2HB5 A;  3QEV A;  4FJ5 A;  3JSM A;  3SQ1 A;  3LPT A;  2ZQB A;  4ELU A;  3AVN A;  2B6A A;  4CFA A;  3PX6 A;  3KTQ A;  3TAG A;  3DLG A;  4KHW A;  3KKR A;  4MFB A;  4KO0 A;  1U49 A;  1NJW A;  2HHU A;  3TAE A;  2YKN A;  5C25 A;  4DS5 A;  3K58 A;  5CZ1 A;  4CEO A;  3K59 A;  4DQP A;  1NK5 A;  1QHT A;  1IH7 A;  3MAQ A;  3SNN A;  1HPZ A;  4FJI A;  4FK4 A;  1ZBH A;  3MEG A;  3QEW A;  1LAV A;  1TVR A;  1KLM A;  1A5W A;  3C95 A;  3OS2 A;  3PUF A;  3S9H A;  1KVC A;  4M3W A;  3MEE A;  1TV6 A;  3OYH A;  4Z4C A;  3AVM A;  1REV A;  3K5M A;  4DFJ A;  3S3M A;  3IAY A;  3QES A;  1NKB A;  1HQU A;  3VQ6 A;  5J2P A;  1S6Q A;  2KTQ A;  2WON A;  1TK0 A;  5CY4 A;  1S9E A;  3K5O A;  4AHU A;  1T8E A;  3MXJ A;  2F96 A;  4CJQ A;  1NOZ A;  1NK6 A;  1S6P A;  2ITG A;  3VQP A;  3AA5 X;  1SKS A;  3I0R A;  4W5Q A;  4NCB A;  1RBS A;  3CYM A;  4M3Z A;  1KCF A;  4CHY A;  2KZZ A;  2HVI A;  3S3N A;  4TSX A;  4N47 A;  5D3G A;  1TGO A;  4PQU A;  2P5G A;  3IS9 A;  3AO1 A;  1S9G A;  3QET A;  4FLV A;  1WAF A;  4CHN A;  3OYE A;  3NE6 A;  3NCI A;  1RTH A;  1Q9X A;  4QOZ B;  4CK2 A;  2DY4 A;  4CHP A;  4DU1 A;  3SUQ A;  2KZM A;  4ID5 A;  2XY8 A;  1RT2 A;  4HUE A;  5JS2 A;  3AA2 A;  1YTU A;  4CJR A;  4KHY A;  2Z1H A;  1NK8 A;  3HYF A;  4FJ7 A;  1RT1 A;  4DLE A;  1CLQ A;  1C0T A;  2YNI A;  4RW6 A;  3PO5 A;  2D0B A;  5HBM A;  4CIG A;  3LZI A;  4IFY A;  4CF2 A;  4FJX A;  4H4O A;  3OYK A;  3RMC A;  3WNG A;  3DOL A;  3OYJ A;  3ZCM A;  1K6Y A;  5DK5 A;  1SV5 A;  2VG6 A;  5HRN A;  3RR7 A;  4B9N A;  2D5R A;  3AVA A;  5CYM A;  4H4M A;  2RN2 A;  3DOK A;  4PUO A;  4Z4E A;  1S5J A;  3OYD A;  4BWJ A;  4PWD A;  3TWH A;  3V4I A;  1VRU A;  1QTM A;  4B9T A;  1S1W A;  3I8D A;  4BDP A;  1FXX A;  1D9D A;  2AJQ A;  4FLU A;  3MEC A;  4QCL A;  1RTJ A;  1RDC A;  2ZE2 A;  4CER A;  1KLN A;  1DTQ A;  3HPH A;  3KLH A;  4FLY A;  1EET A;  3AVJ A;  4CGH A;  4JRQ A;  3RMD A;  3SPZ A;  1Q9Y A;  1RNH A;  1SUQ A;  3AVI A;  3VA0 A;  5HRO A;  4N41 A;  1VSD A;  4DU3 A;  1NJZ A;  4E7J A;  4O0J A;  4F3T A;  4DSF A;  3HP9 A;  4DF8 A;  1X9M A;  2HMI A;  1EKE A;  1RDD A;  3NF8 A;  4CEE A;  1BQM A;  1UAX A;  4I2Q A;  3PO4 A;  1LW0 A;  2IOC A;  1EXQ A;  4HTU A;  4K8X A;  3ZSX A;  4KV8 A;  1S1X A;  4AHS A;  4KHU A;  1VRT A;  4KHN A;  3KK3 A;  3KKS A;  4KHS A;  4DMN A;  4FZZ A;  3H08 A;  4DQS A;  1G15 A;  3F9K A;  3OYL A;  4HCC A;  1RTD A;  1EP4 A;  4RW7 A;  1HMV A;  1NOY A;  1TL1 A;  4DFK A;  4AIL C;  1WN7 A;  2RKI A;  3HP6 A;  4NCA A;  2OPP A;  2WOM A;  4CF8 A;  5SZT A;  3V9S A;  1SL1 A;  1WSH A;  4FLX A;  4FK0 A;  1VSE A;  4KI4 A;  4BAC A;  3P1G A;  1FKO A;  2IAJ A;  1RT7 A;  4RW4 A;  3TAP A;  4HUG A;  3DLH A;  5I42 A;  4CGG A;  4JS5 A;  3CM6 A;  1QQC A;  2P51 A;  3ZSO A;  3NAE A;  1Q8I A;  2YHA A;  3MED A;  1J54 A;  3F73 A;  3LAN A;  1WSI A;  3QEI A;  5K14 A;  3LP3 A;  1D5A A;  4DTM A;  4EZ9 A;  3TAR A;  1VSF A;  4LH5 A;  1B92 A;  3G10 A;  3LAM A;  2KW4 A;  4CJP A;  2HHS A;  1IKY A;  1LWF A;  1XHX A;  3L2V A;  3M8S A;  4CFC A;  2B5J A;  2LSN A;  3NF7 A;  4E1M A;  3MXI A;  3AO2 A;  4CES A;  3RMA A;  1U4B A;  5KGW A;  4CE9 A;  3VQ8 A;  2O4I A;  1CXQ A;  4CFD A;  1N5Y A;  3NBP A;  2QKB A;  4FLZ A;  4CJW A;  2GBZ A;  3G0Z A;  4RW8 A;  1A5X A;  3LWL A;  5FRO A;  4CHO A;  4CHZ A;  1JLC A;  1WSE A;  1VSJ A;  3KLG A;  1RBR A;  4O4G A;  3SV3 A;  3C6U A;  4FK2 A;  2ZD1 A;  4B3O A;  3AO4 A;  1ZBU A;  3ZT1 A;  3QO9 A;  3O3G A;  3KLI A;  3CFR A;  3CFO A;  3V9X A;  2HHV A;  2X78 A;  1VSM A;  1FK9 A;  3DLE A;  3LWM A;  4N5S A;  4DWI A;  4RG8 A;  4B08 A;  4LD0 A;  3CQ8 A;  4G1Q A;  3LP0 A;  3PX0 A;  3NFA A;  4DFP A;  4CED A;  3OY9 A;  1HNI A;  4CJ3 A;  3OS0 A;  3OVN A;  1J53 A;  3KJV A;  3AO5 A;  1TAU A;  1KSP A;  3NH1 A;  3QNN A;  2Z1J A;  2KFZ A;  3O4N A;  4CJL A;  3THV A;  3NGI A;  4BWM A;  4GMJ B;  1KVB A;  4I9Q A;  1TL3 A;  4DQQ A;  4FJN A;  1U48 A;  3HXM A;  2G8V A;  4CJ4 A;  2D0A A;  4CEZ A;  4FJH A;  3V6D A;  1B9D A;  1RBT A;  3NF9 A;  5KRT A;  1LV5 A;  4KB1 A;  2KQ2 A;  2PYJ A;  1L3S A;  3OS1 A;  3ISN C;  4EP5 A;  3DLK A;  3LPU A;  3QER A;  5HLF A;  1GOA A;  4FLT A;  4KTW A;  3VQA A;  2DFH A;  3OYI A;  3QEX A;  4OPK A;  1WNS A;  3OYA A;  3LP2 A;  3VA3 A;  3BDP A;  4F2R A;  1WSF A;  4M3T A;  3DMJ A;  4I9L A;  2XRI A;  4CJE A;  4DTJ A;  3EYZ A;  4ICL A;  1JXB A;  1Z25 A;  1UOC A;  3NDK A;  3HK2 A;  1KFD A;  3V9Z A;  3QIP A;  5DMR A;  1JL1 A;  2E4L A;  3WNF A;  3SI6 A;  4DSK A;  1IKW A;  5CYQ A;  4M3R A;  4FJM A;  4IBN A;  1SL0 A;  3MXM A;  4ZHR A;  1KTQ A;  1JXE A;  1J9A A;  4Z4F A;  3VQ9 A;  1BI4 B;  4CEA A;  4JLH A;  1KVA A;  4E89 A;  1NKE A;  1VK0 A;  3HVT A;  3V1Q A;  1BI4 A;  1BQN A;  1RT4 A;  4CJV A;  4UQG A;  4OJR A;  3EY1 A;  1QSY A;  4E3S A;  4Y1D A;  4M41 A;  3V9U A;  2Y1J A;  2OA8 A;  1C1B A;  1HYS A;  1JLF A;  4DSI A;  4DS4 A;  3AV9 A;  4DTX A;  2VG7 A;  3V81 A;  4CJU A;  2YNG A;  4DSE A;  4MQ3 A;  1U45 A;  1N6Q A;  1ASV A;  4E7L A;  2PYL A;  1YT3 A;  4CEQ A;  4AH9 A;  4FJL A;  2Q3S A;  1JLQ A;  4B9V A;  4N76 A;  2IC3 A;  4AHR A;  4ELV A;  3T19 A;  1EX4 A;  3E01 A;  4FJJ A;  4JRP A;  4KB0 A;  3NH0 A;  4J2B A;  2D0C A;  2OPQ A;  2XO7 A;  1R0A A;  4C8N A;  2XY6 A;  1JLB A;  3HM9 A;  1HRH A;  3P83 D;  1IG9 A;  2YNF A;  4F4K A;  3K2P A;  1QS4 A;  4ID1 A;  1T03 A;  4C8O A;  4CEC A;  2HHT A;  4B9S A;  3ZT0 A;  3L2Q A;  4H8K A;  1BIZ A;  1JLA A;  3VQ7 A;  3CFP A;  4JS4 A;  1NJX A;  3ALY A;  2FBT A;  3QIO A;  5J2N A;  3ZSQ A;  4FW1 A;  1UWB A;  1C1A A;  2DFF A;  3VQE A;  4O0I A;  4OKE A;  3HPO A;  4IG3 A;  3JYT A;  2FBV A;  3VQ5 A;  4NYF A;  5J2Q A;  4KPY A;  4OGC A;  4FJ9 A;  1RT5 A;  4CJF A;  3ZSW A;  1L5U A;  1CXU A;  2G8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...