1ASWA

Avian sarcoma virus integrase catalytic core domain crystallized from 20% peg 4000, 10% isopropanol, hepes ph 7.5 using selenomethionine substituted protein; data collected at-165 degrees c
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
152
structure length
152
Chain Sequence
REPRGLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHFER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title High-resolution structure of the catalytic domain of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Dna integration
total genus 53
structure length 152
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1aswA00
2YHBA 3NGZA 3OJSA 2W42A 1HYVA 1MU2A 3VQCA 3OYCA 1N5YA 4ELTA 4M3RA 1QE1A 1EETA 3SJJA 4KV8A 1C0MA 1LV5A 4Z4GA 4DS4A 2YV0X 4CEAA 1CZ9A 1EXQA 1TAUA 2KW4A 1WSGA 1Z25A 4CFCA 4IDKA 3AVHA 2OZMA 3T3FA 1C6VA 3JYTA 4Z4FA 2P5OA 1HQUA 3ZSOA 3HPOA 4DTSA 1QHTA 3DRPA 3UIQA 1BI4B 3CM6A 4LSNA 4CHZA 4BACA 2PZSA 1IH7A 2NUBA 1S6PA 1KRPA 3OYGA 3HYFA 5CYMA 1WNSA 2RF2A 4CHOA 3TI0A 5J2QA 1QSLA 5FDLA 1ASVA 1NK4A 5E41A 1IKYA 4CHQA 3NHGA 3K58A 1RT4A 3TANA 1QSSA 2RKIA 1LAVA 5EU7A 1JKHA 2LSNA 3S3OA 2G8FA 2KTQA 3SQ1A 3P1GA 3KK3A 2G8WA 4KHSA 5KTQA 3LWMA 3AO3A 2FBXA 1UWBA 3OYEA 1U48A 4FLVA 5FRNA 2JGUA 2YNFA 1WSJA 4DQSA 2IAJA 1FXXA 4EP5A 1RDBA 1A5XA 3V9ZA 4AHRA 4CEFA 4CGIA 3DYAA 4H4MA 3HO1A 1CXUA 3VN5A 1GOAA 1ZBIA 4TSXA 1TKXA 1WLJA 1CXQA 4CGGA 1KVAA 4DMNA 3V6DA 1WAFA 4FJMA 4FJNA 4FM0A 5SWMA 1L3SA 2X78A 2RPIA 2Y1IA 3ZSRA 1SKSA 1JLCA 3BGRA 3OYFA 1S1WA 1J54A 2FBVA 3ZT2A 3OS0A 4DQQA 4N47A 3LAKA 4DSEA 4CGFA 1O1WA 3MEGA 3DMJA 1JL2A 1EX4A 4AHUA 4J2EA 3KLHA 3VQEA 1B9DA 3OYDA 1NK9A 3TAPA 4ZTJA 1U47A 3ZCMA 1EP4A 4HUFA 2IS3A 3AVCA 3CQ8A 5HROA 3I0SA 1BL3A 4E7KA 1KLNA 2DTUA 4CERA 3EYZA 2YKMA 4BDYA 1L3UA 3E01A 3G0ZA 1TKTA 4E89A 2IGIA 1EKEA 4DSLA 3LALA 4CECA 1KSPA 3G10A 2VWJA 4AH9A 1NOZA 3CYMA 1KFDA 2YHAA 4KKOA 5C25A 1RBUA 2GBZA 3NF7A 4NCGA 1LW2A 1SL1A 4KI4A 4CHYA 5I42A 3PX4A 4FLXA 3C6TA 2Q3SA 2ATQA 4O55A 3KKSA 3RMBA 4IFYA 3OYLA 4B9LA 4JLHA 3U6FA 5CZ1A 3TAFA 1NJZA 4B3OA 3KK2A 3AO4A 1VRUA 1ZYQA 1KCFA 4M45A 1IKWA 1KVBA 2P51A 4BE2A 3DLRA 4CFBA 2RN2A 3L2RA 3OYJA 4B9MA 3ISNC 3P5JA 3V9SA 3OY9A 3ZT4A 5J1EA 2HNZA 2ZQBA 3T1AA 1U4BA 2QKKA 4FJ8A 3KLIA 4W5OA 3HPHA 1BCOA 3NGYA 2Y1JA 1VSLA 4FJ5A 3QLHA 4M3TA 3LDSA 1C0UA 4CJKA 3SV4A 4IG3A 3AA5X 1VSKA 3QEWA 1VK0A 3A2FA 3VQBA 4FM2A 4HCBA 3SI6A 2O4IA 2WONA 2IC3A 1TGOA 1RDAA 3PX6A 2QKBA 2Z1GA 1LWFA 4K8XA 4W5TA 4FJ9A 2F96A 5DMRA 4GVMA 1U49A 1IO2A 4F2RA 4H4OA 3SUNA 1KFSA 3FFIA 4OKEA 4CK2A 4PY5A 4O0IA 2B5JA 1NK8A 1JL1A 1S1VA 1JLFA 3C94A 3JSMA 1T03A 3AA2A 3S3MA 2G8VA 4Y1DA 3NCIA 4BE0A 1QTMA 4M41A 3SV3A 3U3YA 4L8RB 3AVMA 3VQQA 4DTMA 1J9AA 2BGGA 3C6UA 2G8HA 4B9TA 1X1PA 3HT3A 1HYSA 2Z1IA 4DQRA 1KTQA 5CY4A 3CFRA 5KRTA 4DTXA 3LP1A 4CE9A 2KQ2A 4FLTA 4CEZA 3OVNA 4CFDA 4RW9A 4CJRA 1NJXA 1HNIA 3OYMA 2XHBA 4J2BA 4BE1A 3NF6A 4RW8A 1Q9YA 1QSYA 4RW6A 4E1MA 3SQ4A 1RBTA 5HRNA 4IBNA 4FK4A 3AVAA 3RTVA 1N6QA 4QAGA 3V9XA 4B9NA 4KPYA 4BWJA 4DFKA 3L3UA 3VQ9A 2HHSA 4DS5A 4NCAA 1QQCA 3ZSVA 3OYBA 1T8EA 2DFFA 4KB1A 1Z26A 1GOCA 4LSLA 4H8KA 4FJXA 1BCMA 1S5JA 4CHPA 4DLEA 1R0AA 4W5RA 1XWLA 3K5LA 3DI6A 3QNNA 5CYQA 4FJ7A 4DTNA 5KGWA 3DOLA 4FXDA 2XO7A 4J2AA 1WN7A 4CIEA 3KJVA 4N41A 2R7YA 3TAQA 1LWEA 1NKBA 4CF8A 4FJJA 3AO2A 3HXMA 1L5UA 4HUGA 4DQIA 1HMVA 4QCLA 4KFBA 1YT3A 4I9LA 1JLAA 4R5PA 3KTQA 1WSHA 2GUIA 3M8RA 1HJRA 1T7PA 2KZMA 1KVCA 4KHYA 3DRSA 2QK9A 3RR7A 4RW7A 3TWHA 1FKPA 1TL1A 3ZSYA 4FLZA 4KHQA 3IRXA 4ZHRA 1UOCA 5KGXA 1DLOA 4WE1A 4CJEA 4DF8A 4CEEA 3LZIA 1C1CA 4CJFA 2Z1JA 3KD5E 2D5RA 3K57A 2VG5A 5C42A 4ICLA 4FW2A 4E7JA 3NGIA 4Z0UA 4GMJB 4DSFA 1S9GA 3QEVA 3DLHA 3RWUA 3VQ6A 3HP9A 3K5MA 1UA1A 3AO1A 2P1JA 1J5OA 1ASWA 1XC9A 5HRRA 3L2QA 4KTWA 2A1RA 3PO5A 3DRRA 1WSEA 3M8QA 5C24A 3QEIA 3IG1A 1QS4A 4DWIA 2HVHA 4ELVA 3U3GA 1J53A 1IKXA 1YTAA 5DK5A 1UAXA 4M3WA 1UA0A 1NKCA 1I39A 4FK0A 2Z1HA 1SKWA 4F4KA 3NF9A 1JLGA 1TKDA 1BI4A 4C8KA 4FZXC 1L3TA 3ZT0A 3KK1A 3AA3A 4MFBA 3NH2A 4KHNA 1VRTA 4B8CA 3O4NA 4RW4A 4I2QA 3AVJA 2E4LA 1JLEA 1VSDA 4LH4A 1RBRA 4RG8A 2OPQA 3V1QA 3AVLA 4CJWA 3L8BA 3V9WA 3TAMA 3SQ0A 1GOBA 1WSFA 4E7IA 4CFAA 3QEPA 4KO0A 4ELUA 2BE2A 4N5SA 1RT7A 2WOMA 3VA0A 4FZYA 3SNNA 4IFVA 1S6QA 3NAEA 4C8OA 3VQDA 4CF0A 1VSIA 3QO9A 4FJHA 1Q8IA 4F3TA 4DTRA 3S3NA 3CM5A 3PV8A 1X9SA 4YNQA 3TABA 1NJWA 3P83D 4DSKA 1RT3A 1S9EA 4IG0A 4HHTA 3THVA 3OYKA 2F8SA 2JLEA 4CJQA 4E7HA 4OJRA 4OGCA 4CIGA 1TK5A 1NK5A 1X9MA 3M8PA 4O4GA 3ITHA 3EZ5A 1RTJA 2O4GA 5FROA 3O3GA 4M3XA 4OKJA 3PY8A 2FBTA 4C8NA 1NJYA 4DG1A 3CFPA 3AA4A 4DFJA 3AVGA 5HRSA 4LH5A 1DTTA 3RRHA 4HVJA 4KB0A 3SUPA 1BQNA 4CESA 4FK2A 3QETA 1W0HA 4EZ6A 2QXFA 4FLWA 3LPTA 3PO4A 3OJUA 4CJSA 4AHSA 4CK3A 5FRMA 2ITGA 4FJGA 3WNHA 3LPUA 4KREA 1VSEA 1TKZA 3DLGA 4M3ZA 3VQPA 3MAQA 3MXJA 1HYZA 5KI6A 3WNEA 4AILC 3K5NA 4F3OA 2HNYA 3L2WA 4CEOA 3HP6A 4JRQA 1SL0A 2OPPA 1YVUA 3VQ7A 4B9SA 1RT2A 1BISA 4E7LA 5CZ2A 4CEQA 3NF8A 2A1SA 4KTZA 3VQ5A 2YNIA 3QIOA 4Z4CA 3L2UA 4BDPA 2HHVA 3ZT3A 4LD0A 3F9KA 3DOKA 2HW3A 1B92A 3LANA 4Z4IA 1HPZA 1LW0A 3CFOA 2HHXA 4PA1A 2EX3A 3OYIA 2G8KA 3I0RA 1VSFA 2DFEA 1HNVA 1IKVA 1VSHA 1RBVA 3EY1A 1U45A 2VWKA 1TK8A 1HQEA 1XI1A 1ZBFA 1TL3A 2FC0A 1TAQA 2OYQA 4CGHA 1D5AA 2XY5A 2OZSA 4M3UA 3TARA 5T7BA 4CJUA 2HHTA 1NK7A 4MQ3A 2X74A 3WNFA 1D8YA 5D3GA 1BGXT 1FK9A 2OPRA 3AV9A 1NOYA 4C8LA 4OPJA 4YFUA 2YNGA 3MEDA 3KIOA 2IDOA 3L2VA 4HUEA 3HM9A 3K2PA 1RNHA 1X9WA 3H08A 3AVKA 4O44A 4C8MA 5SZTA 4FLYA 5I3UA 4FJLA 2DFHA 4OPKA 1JXBA 1TV6A 1B9FA 3OYAA 3M8SA 3LWLA 4HCCA 1ZBUA 3AVFA 4KRFA 5HLFA 1WSIA 3DM2A 4PUOA 1LAWA 4B9VA 5J2NA 4OLBA 4Q5VA 1I3AA 1FKOA 4CEDA 2AJQA 2FBYA 1C0TA 3IS9A 4B8AB 2DY4A 4PQUA 4CJVA 4N76A 3NH0A 5HP1A 4FJKA 4F8RA 2G8IA 4CF2A 3AO5A 3LP0A 4GW6A 3T19A 3RMAA 4UQGA 3WNGA 4FM1A 3B6OA 3F73A 4CCHA 3K59A 1RT6A 2HB5A 3TAEA 1RTIA 1KLMA 4I7FA 4B08A 4CEBA 3V81A 3AVBA 4BWMA 3VQ8A 2I5JA 3OS1A 3RRGA 3KKRA 4I9QA 3C95A 4JRPA 4FLUA 2PY5A 2XRIA 3LZJA 4ID5A 3NFAA 4OKKA 3MXIA 3HJFA 4DTUA 4BDZA 2EHGA 3ULDA 3MEEA 4G1QA 3DLEA 1Y97A 3ASMA 4CGDA 4CJPA 4CF9A 3NH1A 4DLGA 4NYFA 1NK6A 3ALYA 4F2SA 5KRSA 1S1UA 3V1RA 4DU3A 1REVA 2HHUA 3DLKA 4W5QA 3ZSZA 4N56A 1LWCA 2ZD1A 1W9HA 4M3YA 3AVIA 4AHVA 2ZE2A 3KLFA 2KFNA 1RT1A 3LP3A 3K5OA 3NDKA 1WAJA 4DFPA 4E0DA 4PWDA 4KAZA 4FYDA 4W5NA 4CGJA 3LAMA 4DTJA 4KHUA 2HVIA 2X6SA 2KFZA 4ZTFA 3OYNA 4Y1CA 3HVRA 3O4QA 1RTHA 3KLEA 2XY8A 4DTOA 4DU1A 1CZBA 3L3VA 2IOCA 2X6NA 4FW1A 1SV5A 4CJ5A 1K6YA 4KHWA 3MECA 3RR8A 3SUQA 3HK2A 1RILA 1VSMA 4LY7A 3S9HA 3SYZA 1IG9A 3SPYA 4DF4A 1NK0A 4FZZA 3KD1E 1JLBA 1RBSA 2P5GA 4NYNA 3D45A 2XY7A 1S1TA 1RDCA 3V1OA 4O5BA 2BDPA 2HHWA 1A5WA 4CJLA 3SCXA 3D0PA 4DSIA 2D0BA 1XHZA 1RTDA 3ZSQA 3SZ2A 3IAYA 4E1NA 4CF1A 2XY6A 4KI6A 3NBPA 1D9DA 1ZBHA 3V9UA 3QIPA 3QEXA 1BHLA 4DTPA 4QOZB 4EZ9A 4DU4A 2ETJA 4Z4EA 4CHNA 3OS2A 3I8DA 1C1AA 3SPZA 3HL8A 2B6AA 2E6MA 3QINA 4OGEA 4CJTA 4EP4A 4FCYA 1ITGA 5HBMA 4AHTA 4JS5A 3ZT1A 3QNOA 3HVTA 1RDDA 5J2PA 1RCHA 5JS1A 4I2PA 3ZSWA 4OLAA 1U04A 3CG7A 4FJIA 2HHQA 4ID1A 3QESA 2VG7A 3SQ2A 3PUFA 3B6PA 5K14A 4E19A 1F21A 3VQ4A 4Z4HA 4E3SA 3TAGA 4JS4A 3PX0A 3RMDA 4XIUA 2B4JA 1HRHA 3KLGA 1T05A 4M42A 4HTUA 4K8ZA 1C1BA 3HSTB 1TVRA 1SUQA 1A5VA 5J2MA 3BDPA 1SKRA 4DFMA 2YKNA 2BANA 2PYJA 4IKFA 4CJ4A 3O3HA 1ZBLA 2HNDA 2D0CA 2PYLA 3LP2A 1JXEA 1D9FA 2OA8A 3HPGA 2KZZA 4O0JA 3ZSXA 3MXMA 2HMIA 4DQPA 2E6LA 3DLBA 3O3FA 4DSJA 1JLQA 1BIZA 1BIUA 3V4IA 3QERA 1TK0A 1NKEA 1ASUA 1YTUA 1CLQA 5HRPA 1XHXA 4CIFA 2G8UA 3SUOA 4B9UA 3VQAA 4AHCA 4J2DA 3TR8A 2D0AA 1SL2A 1BQMA 1RT5A 1L3VA 1DTQA 4OVLA 1G15A 3OYHA 4Q0BA 2VG6A 4KTQA 1VSJA 3VA3A 1S1XA 3AVNA 2OPSA 4FVMA 4CJ3A 2GV9A 4NCBA 3RMCA 2F8TA 2YNHA 5JS2A 3NE6A 1Q9XA 4CK1A
chains in the Genus database with same CATH superfamily
2YHBA 2W42A 1N5YA 1MU2A 1QE1A 1EETA 1LV5A 1EXQA 3SAGA 1Z25A 5EVZA 1BA0A 2CH6A 3VENA 3T3FA 5ADXH 4DR5K 3ZSOA 3HPOA 4DTSA 1QHTA 3DRPA 5BR9A 3OYGA 4CZGA 5J2QA 5MLCQ 3NHGA 3TANA 1RT4A 2RKIA 1BG3A 1HKCA 2KTQA 3P1GA 4MO4A 2G8WA 4KHSA 5KTQA 3OYEA 5F1XA 3KWIA 4YOTA 3VN5A 2VCPA 5AQFA 2W40A 2IIRA 1WLJA 1CXQA 4CGGA 3HBTA 3DXMA 5JLFA 4FJNA 5BRFA 2X78A 3ZSRA 1NGEA 5FPEA 1S1WA 1J54A 2FBVA 3ZT2A 3LAKA 4J2EA 2NRHA 1B9DA 5GAEP 2P9PA 4BR2A 4HUFA 5AQMA 3L0QA 1KLNA 4IOCL 5LY3A 1L3UA 3CMEN 1TKTA 2IGIA 4CECA 2VWJA 1WUAA 1KFDA 5BN8A 4KI4A 3Q7BA 1SL1A 3UKRA 5I42A 3PX4A 3KKSA 3RMBA 3OYLA 3OA9A 3U6FA 3TAFA 1YJ9N 3QFUA 1BO5O 1KCFA 1KVBA 4FWMA 4BE2A 3H1QA 3ISNC 3OY9A 1NGBA 5J1EA 2ZQBA 1HPMA 3THXA 4FJ8A 5AQGA 3NGYA 4IJNA 1VSLA 4FJ5A 1MA9B 3HSCA 3LDSA 1C0UA 4CJKA 4JI4K 3AA5X 1VSKA 3A2FA 4BC5A 3VQBA 3NMUA 1QZ5A 3CJAA 4GKJK 1TGOA 4L3QA 1RDAA 3J7ZO 4K8XA 4CJ7A 5BN9A 4GVMA 1U49A 4RTFD 5AQVA 1NK8A 1JL1A 1S1VA 2A5XA 4WQ4A 3C94A 4BE0A 4L8RB 4M41A 4AF1A 3IFRA 1WB9A 1J9AA 3C6UA 3CCVN 4B9TA 3WXMB 1O13A 4JK8A 3VEWA 1HYSA 1N34K 3GDQA 4EIAA 3UKUB 4BRGA 3U9ZA 5CY4A 1XQSC 2P9NA 4FLTA 1NJXA 4BE1A 4RW8A 1I94K 3SQ4A 4IBNA 3HI0A 1ZBSA 4JI5K 4B9NA 2HHSA 4KPYA 4FOIA 4H0OA 1NLVA 4DS5A 4NCAA 1QQCA 3OYBA 4NLCA 2DFFA 3R3LA 4FWRA 1GOCA 4FJXA 5CYQA 3D2EB 5KGWA 3CJ7A 4FXDA 2D0PA 3M1FA 4B3SK 1NKBA 4CF8A 4FJJA 4DQIA 1NBWA 4HUGA 1BU6O 3VGKA 4RW7A 1FKPA 3H3OB 1U2VA 4KHQA 4ZHRA 1UOCA 3RVCA 5KGXA 2QA4N 3U9DA 1OH6A 1HLUA 4DSFA 2ZM6K 4KBOA 3DLHA 3K5MA 1UA1A 3O1BA 1XC9A 5HRRA 3MX2A 1WSEA 2CGLA 3SLCA 1J53A 1IKXA 4JI1K 4RCHA 1NKCA 2NRRA 1JLGA 4C8KA 3ZT0A 5LJWA 4KHNA 3O4NA 3QMLA 3AVJA 3WUHA 3ENBA 3L8BA 4DR6K 3MN5A 4H5WA 1GOBA 1WSFA 2ASOA 1HNXK 2BE2A 3VA0A 3VF2A 3SNNA 4IFVA 1S6QA 2QEXN 3MN7A 3U8XA 4OPAA 4K42A 5E84A 4F3TA 4DTRA 3CETA 1X9SA 4YNQA 5C2DA 1RT3A 2RE2A 3HM8A 3OYKA 4IO9L 2F7TA 1NK5A 1Q7YO 1RTJA 5FROA 5LMNK 3M6GA 5LL6Z 3O3GA 4M3XA 3PY8A 4C8NA 4K0KK 3OTOK 3AVGA 4LH5A 1DTTA 3IKMA 4KB0A 1BQNA 4CESA 1GLAG 2Q97A 4LF5K 4AHSA 3LPUA 4A2AA 3BF3A 1EQYA 4OX9K 1T6CA 2HNYA 3HP6A 4JRQA 4CEQA 4JD2B 3VGLA 2A1SA 2D1KA 3UE5A 4Z4CA 4YOYA 1B92A 3LANA 3CFOA 2HHXA 1Y64A 3I0RA 1HNVA 1IKVA 1BA1A 2VWKA 3VGMA 1TL3A 2FC0A 1TAQA 2OYQA 1FW6A 2YHWA 3C6HA 4CGHA 4GV6A 3LDQA 2OZSA 2ZJRL 3GBTA 1NK7A 1D8YA 4BRMA 1X3NA 2ZJPL 2O8EB 4C8LA 3PLAA 4YOXA 3EL2A 2KLAA 1X9WA 3E9LA 3H08A 4O44A 5I3UA 5M1OA 3M8SA 1ZBUA 3AVFA 5HLFA 3CMAN 2D4WA 4CEDA 1FKOA 3SAHA 3U4LA 2AJQA 1C0TA 3PIOL 4N76A 3NH0A 2CGKA 4FJKA 4F8RA 2G8IA 1GLEG 4JNEA 4FM1A 5E26A 3B6OA 2HB5A 2CH5A 3OS1A 4FLUA 1MWKA 1MWMA 3NFAA 3HJFA 4DLGA 4CGDA 3ASMA 3NH1A 1NK6A 2VQFK 1S1UA 4JKDA 1DT9A 2IVNA 3CJ1A 4XH1A 4W5QA 4DKWA 4PL7A 4Z94A 4M3YA 4BQLA 3LP3A 3NDKA 1WAJA 4JAXA 4W5NA 4PWDA 4CGJA 3LAMA 4JN4A 3ATUA 3KLEA 1RTHA 3ATVA 4ISFA 3G4SN 2VYPA 4HTLA 3HK2A 3SUQA 2DPNA 3S9HA 4LY7A 3SYZA 4FZZA 1JLBA 3V1OA 2PFUA 2YI1A 2BDPA 1A5WA 4X64K 3D0PA 3BEXA 1YJWN 3VEOA 4DSIA 1HJOA 3ZETB 3ZSQA 3SZ2A 3O9TA 4CF1A 2XY6A 4CZLA 2UUBK 2V51B 1BHLA 3FR0A 3ULEB 4DU4A 2ETJA 2YX6A 2E8AA 4CHNA 3OS2A 1C1AA 3A5NC 2B6AA 4FCYA 1ITGA 5HBMA 4CD1A 4IEIA 1N8RO 3HVTA 1Z6RA 1RCHA 5FPNA 5AZJB 4OLAA 1U04A 2HHQA 5GIPA 4CBXA 4E3SA 3B6PA 3VTIA 2WTUA 1F21A 3L6QA 4JS4A 1HRHA 4CBUA 2A42A 5AJ3K 2YKNA 2BANA 4IKFA 1K8AO 2FXUA 3O3HA 1ZBLA 4LC9B 3SBGA 1JCEA 1XMOK 2KZZA 1G99A 3K9JA 1OH8A 3TTFA 1HNZK 3I8BA 1TUYA 3V4IA 4UY8O 2G8UA 2H3GX 3VQAA 4DQ8A 3TR8A 3BP8A 3A8YA 1BQMA 3H3NO 1L3VA 3OYHA 2VG6A 2Q0RA 4KTQA 3WXJA 4DR7K 3AVNA 4B3RK 3JXUA 4IO8A 3VOVA 5JS2A 4G9ZA 1Q9XA 2NZTA 1NGJA 4FO0A 3VQCA 2GWKA 5GAHP 3SJJA 1C0MA 5LMUK 4Z4GA 4F9OA 4A62A 1CZ9A 4FOEA 1TAUA 2KW4A 2E88A 4MLHA 3VTHA 4QS7A 1C6VA 3DJCA 3JYTA 4Z4FA 2P5OA 1HQUA 4EHTA 3UIQA 1BI4B 4LSNA 3CQXA 2E5LK 2PZSA 2NUBA 1S6PA 1KRPA 3TI0A 2HOEA 1NK4A 1IKYA 3K58A 1VQMN 5M1NA 5EU7A 1LAVA 4K43A 1IBMK 3KK3A 2VGNA 3I33A 4JD2A 4LF7K 4WQ5A 3AO3A 2FBXA 1YVNA 1UWBA 3KWGA 1U48A 5FRNA 5EXWA 1WSJA 4DQSA 1FXXA 1A5XA 1NGHA 4J8FA 4TSXA 3EE9A 4A57A 2P9KB 5AZIB 4AQYK 1VQ8N 4FJMA 4FM0A 1L3SA 4BGBA 2Y1IA 2O8EA 1HUXA 1SKSA 2V7ZA 3BGRA 3OS0A 4N47A 1DEJA 2ZF5O 5C0YA 4BVPA 3DMJA 4AHUA 3VQEA 1KXPA 3OYDA 4ZTJA 3S41A 3T1YK 4DV5K 1QQMA 1BL3A 3A5MC 4PKGA 3VEYA 4CERA 2YKMA 4BDYA 4DSLA 1KSPA 3G10A 2WFBA 1NOZA 2YHAA 4IOXA 4ILHA 4FLXA 3OBYA 4IFYA 4EAHD 1NJZA 3KK2A 2ZGZA 1IKWA 1BOTO 4MLEA 4CFBA 2RN2A 5KPRA 3V9SA 3P5JA 3VPZA 3ZT4A 4JK7A 2HNZA 3J81O 2NRTA 5C10A 2HBJA 3T1AA 1NM1A 3WT0A 2QKKA 3HPHA 3B8AX 3QICA 1RDUA 2Y1JA 3JAMO 4JI3K 4HCBA 2WONA 4DV3K 1R59O 5C15A 4H0XB 2Z1GA 1N36K 1QHAA 1QVFM 3TSPA 3MN6A 1YJNN 4WYBA 3SUNA 3CQYA 3FFIA 3ZLJA 4LF9K 2B5JA 3CC4N 3AA2A 4YHHK 3S3MA 3BY5A 4A5AA 3SV3A 3U3YA 1M90O 2ASPA 4M7XA 3C7NB 2Z1IA 4X66K 1HKBA 3ZETA 4E1JA 3CD6N 2KQ2A 3SK3A 3OVNA 5AQQA 3ULEA 3OYMA 2XHBA 5C12A 1Q9YA 5AFUH 2YJEA 4DV2K 1T44A 3SMSA 3V9XA 4BWJA 2QWPA 4DFKA 4ISEA 1Z26A 5AZJA 1OKJA 4W5RA 3K5LA 4FJ7A 3GE1A 1GLFO 1WN7A 3R6MA 5AQNA 3E1YA 1YITN 3KHYA 3P4IA 1L5UA 4QCLA 4KFBA 4JKBA 1JLAA 4R5PA 1T7PA 2KZMA 1KVCA 1NNEA 4KHYA 3ZSYA 3W0LA 1DLOA 4WE1A 4CJEA 4CEEA 3LZIA 1C1CA 4CJFA 3G6EN 3KD5E 2UUAK 4ICLA 4FW2A 4GMJB 4A61A 3QEVA 3RWUA 3HP9A 4CZKA 5JVGL 2P1JA 1VQ6N 1SZ2A 3IG1A 2P9IB 4ELVA 3U3GA 3ID8A 1YTAA 5DK5A 2KKZA 4C1NK 2Z1HA 4F4KA 2YHXA 1BI4A 3WXIA 4B1WB 1L3TA 4GV3A 2FSNA 4LFCK 2E4LA 1JLEA 1NGCA 4LH4A 2NLXA 4H03B 4BC3A 4BRNA 4CJWA 4YORA 4DR3K 3SQ0A 3CHWA 3QEPA 1J5EK 4ELUA 4OO1J 1NJIO 2UU9K 5JVHL 5H1SQ 3N4PA 3VQDA 4CVNE 2O8DA 3UB5A 4FJHA 3TABA 3P83D 4BY9C 4GV9A 4IG0A 4HHTA 5AZIA 4E7HA 4CJQA 4OJRA 2JWLA 1X9MA 3M8PA 1KC8O 1S3XA 3EZ5A 4DR4K 4BR9A 4OKJA 3THYA 3KK7A 4JI8K 2HMPA 1NJYA 4A5BA 5FLXO 5HRSA 1K9MO 2Q36A 4FK2A 3QETA 4EZ6A 4FLWA 3PO4A 3R1XA 4CJSA 4CK3A 2ITGA 1K8KB 1TKZA 3VQPA 1HYZA 4QS8A 4F3OA 4CEOA 1P90A 5BPLA 1SL0A 1RT2A 2I7NA 3VQ5A 2YNIA 2HHVA 4LD0A 3F9KA 4GKKK 1HPZA 3WEEB 4BRPA 3SMPA 1H1VA 2EX3A 4IFEA 4PA1A 2G8KA 3AY9A 5EOYA 1DKGD 1VSHA 4CZIA 3DLLL 5AQRA 4BG8A 1ZBFA 1D5AA 2XY5A 3MDQA 4MQ3A 3WNFA 5D3GA 1BGXT 1FK9A 3FZHA 2OPRA 3AV9A 4JI2K 4OPJA 4YFUA 4XH5A 3MEDA 4BRLA 3FGUA 3L2VA 3K2PA 2VGMA 4WFAL 2FSKA 4FLYA 4FJLA 5AR0A 1SS6A 1JXBA 1TV6A 4FWOA 4I6MB 4KRFA 3CJ9A 1LAWA 4B9VA 5J2NA 2BTFA 4OLBA 1T3VA 1I3AA 3QBXA 4V19S 3IS9A 2E2OA 3C7NA 2YHYA 1K73O 3BUZB 3IDHA 1IBKK 4UQGA 2F9TA 2ZGYA 3WNGA 1VQKN 1RT6A 4B08A 3V81A 1GLDG 5ELZA 2I5JA 1QQOA 1Z05A 4B1VA 3VF4A 4ID5A 3MXIA 4BDZA 2EHGA 3ULDA 3MEEA 4G1QA 4CJPA 4CF9A 4F2SA 3OW2M 4U7BA 1Q18A 3ZSZA 4N56A 2ZD1A 4AHVA 2ZE2A 1RT1A 3MMVA 4LF8K 2NRWA 2UYTA 4E0DA 4DTJA 2X6SA 2KFZA 1NU0A 4Y1CA 4O5FA 3O4QA 3HVRA 4DU1A 3RSEB 2IOCA 2X6NA 1SV5A 4CJ5A 3RR8A 3LDOA 4BREA 1VSMA 3CCLN 3ZEUB 3SPYA 3KD1E 1C0GA 1C0FA 4NYNA 1SAZA 3DXKB 1S1TA 1RDCA 4O5BA 2HHWA 3ZX0A 3O4WA 2D0BA 1XHZA 4E1NA 3QIPA 2HBLA 3GOIA 2FSJA 4PL8A 3SPZA 2E6MA 4B1XB 4JS5A 3QNOA 4QS9A 2P9IA 3LDNA 5JS1A 1YUWA 4I2PA 5AQSA 4ID1A 2BUPA 3SQ2A 3H1VX 4Z4HA 3TAGA 3PX0A 3ENHA 3CXCM 3HSTB 4K8ZA 2W6LA 3BDPA 1N33K 5ADXA 2HNDA 2PYLA 4YOWA 1JXEA 3AGRA 2OA8A 4AM7A 2HMIA 5AQIA 3HOTA 4CZEA 4DUYK 2O8BB 2E6LA 3O3FA 4KHPK 1BIZA 1E3MA 1NKEA 3QERA 1ASUA 3ZX3A 3J7AP 4J2DA 2A3ZA 4DR2K 1DTQA 2HF4A 2QM1A 4Q0BA 3VA3A 1XNRK 4YDUC 4JYAK 4PKIA 2KFNA 4CK1A 3NGZA 3OJSA 2W41A 4ELTA 5AQLA 1NMDA 4M3RA 1RFQA 4KV8A 4DV1K 3GL1A 5M1FA 4DS4A 4CEAA 2ZWHA 1WSGA 4IDKA 3O1WA 4C23A 3TPQA 2JWKA 3MX5A 5F2RA 1IH7A 4XEIA 1QQNA 3HYFA 3BF1A 4CHOA 1K8KA 5FDLA 1ASVA 1VQ7N 1QSSA 3UKUA 3MCAB 2OTLN 4CZHA 1JKHA 3S3OA 3PIPL 4FWSA 5DM7L 4B9QA 3VETA 1ESVA 4BG9A 2W6KA 3LWMA 3JS6A 3CPEA 4WFBL 4FLVA 3WEEA 2IAJA 1RDBA 3V9ZA 4AHRA 4CEFA 3HO1A 1CXUA 1X3MA 3MCPA 3FZKA 1ZBIA 3ID6A 4HWIA 4DMNA 3V6DA 1WAFA 3D2EA 4BRFA 5SWMA 4U67L 3PO5A 5BPNA 3HZ6A 4DSEA 3P31A 4CGFA 3MEGA 1JL2A 1EX4A 4JHDB 1NK9A 3TU5A 5HOOA 1EP4A 4YOUA 2IS3A 3CQ8A 3I0SA 4E7KA 4I6MA 1OH7A 2DTUA 3E01A 2IVPA 3FZFA 3G0ZA 3Q7CA 4E89A 1EKEA 3CCRN 4AH9A 3T69A 4KKOA 5C25A 3NF7A 2GBZA 5KQ8A 4NCGA 1LW2A 5JLHA 1SQKA 4CHYA 3E9OA 1VQPN 1Q82O 2Q3SA 4O55A 4K41A 5GINA 2A41A 4JLHA 5CZ1A 1DGKN 2YJFA 4M63C 4M45A 1KD1O 3DLRA 3PSIA 2GEMA 4B9MA 3N4QA 1VQON 4DV0K 4WF9L 1WBDA 4B1UB 3KLIA 1Q81O 1BCOA 3CF5L 1S72N 3ENOA 5AQUA 4BC2A 3SV4A 5GAGP 3QEWA 4FM2A 1ATNA 3SI6A 2O4IA 1S22A 2ASMA 2OCEA 1VQ4N 4W5TA 5DMRA 1HR0K 1P8ZA 1IO2A 4F2RA 3EN9A 4OKEA 4DV4K 4O0IA 1KAXA 2QWLA 4BRQA 3JSMA 3R8EA 4Y1DA 3NCIA 2G8VA 3L4QA 1EWQA 3ZEUA 3AVMA 2BGGA 3DXKA 1X1PA 1EWRA 1KTQA 3AAQA 3CFRA 5KRTA 4CE9A 4RW9A 3CIPA 4CJRA 4H0YB 1VQ9N 4ILGB 3AVAA 3RTVA 1N6QA 3O9RA 4FSVA 3VQ9A 3ZSVA 4KB1A 1OVYA 4LSLA 4H8KA 1BCMA 1S5JA 4WFNL 3THWB 1R0AA 1XWLA 3DI6A 3QNNA 3IMXA 1U6ZA 5AQKA 2XO7A 4J2AA 3KJVA 3M3ZA 4N41A 1KAYA 3GG4A 4FL9A 2R7YA 3TAQA 3HXMA 5AQWA 1HMVA 2E2PA 5CE3A 2QWMA 2O8BA 3M8RA 5JMVA 3DRSA 2QK9A 3RR7A 1TL1A 5KPTA 3BZCA 5BRDA 3IRXA 1WBBA 1QVGM 1VAZA 2Q1NA 4DV7K 2Z1JA 2D5RA 3K57A 1IBLK 2QWNA 4JKEA 3EO3A 3NGIA 4E7JA 2UXCK 1VQ5N 4IXCA 1TUUA 3AO1A 1J5OA 2NRVA 3W3DA 2D0OA 4BRIA 3L2QA 2A1RA 3DRRA 3M8QA 1QS4A 4JI7K 1KAZA 4DV6K 3NVKA 1UAXA 4M3WA 1UA0A 3O08A 4FK0A 4NLBA 5AQYA 3NVMA 4FZXC 1IG8A 3KK1A 3AA3A 3NH2A 1NGFA 1VRTA 2CGJA 2P9LB 1VSDA 1RBRA 2NRZA 2OPQA 3V1QA 3AVLA 3V9WA 3TAMA 4FWLA 4CI6A 5M1KA 1XUPO 3BZKA 4E7IA 4KO0A 4BRAA 2HF3A 4N5SA 1RT7A 2WOMA 2FF3B 4JI0K 4FZYA 5BR8K 3NAEA 4JKFA 3QO9A 1Q8IA 3S3NA 5M1PA 3K0SA 4EHUA 3CM5A 4DSKA 1NJWA 2GUPA 5CHIA 3THVA 1HNWK 2A40A 2P9NB 4CIGA 1TK5A 4PKHA 4BGAA 2O4GA 3EKUA 1JCFA 4IDHA 4DG1A 4JHDA 3AA4A 4DFJA 3RRHA 4HVJA 3I55N 1ATSA 3P38A 3CC7N 3LPTA 2HBKA 3OJUA 5FRMA 1VSEA 3DLGA 4M3ZA 5KI6A 3WNEA 1W7AA 4KH5A 2HBMA 2OPPA 4CZFA 1YVUA 4B9SA 1BISA 3NF8A 4KTZA 4CZMA 3L2UA 3ZT3A 4GY2B 2V7YA 2NRXA 4O8KA 3F5TA 2DFEA 3EY1A 1U45A 3DAWA 1TK8A 4IOAL 1NGIA 1CZAN 4M3UA 3TARA 5T7BA 4CJUA 2HHTA 3SBTA 2X74A 2GTDA 2YNGA 3LM2A 3KIOA 2IDOA 3G25A 4HUEA 3HM9A 1RNHA 2F9WA 2QWOA 3AVKA 1NGDA 3OYAA 1B9FA 4HCCA 4DHYA 2QTDA 3DM2A 4Q5VA 4BROA 4JV5K 4LFAK 1D4XA 2FBYA 4B8AB 2HHHK 4CJVA 5HP1A 4CF2A 3LP0A 3K59A 1RTIA 1KLMA 4I7FA 4H5RA 4BWMA 4I9QA 3C95A 3PSFA 3ALYA 2WC9A 5KRSA 3THWA 3V1RA 1BDGA 5I9EB 1YAGA 1REVA 3DLKA 3SJHA 1TYQB 3AVIA 3KLFA 4DFPA 4FYDA 1IJJA 2HVIA 3TTCA 5GADP 5KPZA 4ZTFA 3H46O 1M1KO 3L3VA 3O9SA 1K6YA 4KHWA 2OANA 1IG9A 1NK0A 2P5GA 3T7ZA 2XY7A 4FPBA 4JKGB 5DM6L 1NMNA 2QI2A 2P9KA 4IEEA 3V9UA 3QEXA 2P9SB 3FZMA 3HL8A 4OGEA 4EP4A 4CJTA 4AHTA 3ZT1A 3EKSA 1RDDA 5J2PA 4NB4A 4FJIA 2VQEK 3QESA 5JICA 3LL3A 3VQ4A 4BVOA 3RMDA 4XIUA 2B4JA 3KLGA 5AQJA 4M42A 3A0IX 1C1BA 4BRCA 3D7EO 1SKRA 2QW9A 5LJVA 3O6WA 5IT9O 3LP2A 2P9LA 1D9FA 2ITMA 3ZSXA 4DQPA 3DLBA 2Q2RA 1XNQK 5TKYA 3A5LC 4JEPA 4K25A 1BIUA 1YTUA 4CD3A 1E4GT 5HRPA 3G71N 5EX5A 4AHCA 2D0AA 1HKGA 1SL2A 2UXDK 1RT5A 4BRKA 1S1XA 4FVMA 2OPSA 4CJ3A 2GV9A 5GIOA 3RMCA 2YNHA 3NE6A 5A2QO 1HYVA 4BR0A 3OYCA 2BH1A 3E66A 4JKHA 2YV0X 5AQOA 3VEVA 2EWSA 4CFCA 2OZMA 3AVHA 1VQLN 4FWPA 4CW7B 3CM6A 4CHZA 4BACA 3I56N 3WQUA 5CYMA 1WNSA 2RF2A 1QSLA 5E41A 4CHQA 2HSTA 4O8UA 5IWAK 2LSNA 2G8FA 3SQ1A 2NNWA 3OBWA 1YI2N 2JGUA 2YNFA 4EP5A 3MN9A 4WQ5C 4CGIA 3DYAA 1J6ZA 4H4MA 1GOAA 3MK6A 1TKXA 3MWTA 1KVAA 3WXLA 4ISGA 3VEZA 3O8MA 4BQZA 3CCJN 2RPIA 1YF5L 3O5BA 1JLCA 3OYFA 4DQQA 5BPMA 1RDWX 3A5OC 1O1WA 4DR1K 3KLHA 1RGIA 3TAPA 4A59A 1U47A 3ZCMA 1Q86O 3CCQN 5HROA 3AVCA 3EYZA 3TSUA 3LALA 3CYMA 1NG9A 1JJ2M 1RBUA 2E1ZA 4FWKA 4B3TK 3C6TA 2ATQA 4KH4A 4M7YA 1N32K 2AP1A 4B9LA 4B3OA 1V4TA 3AO4A 1VRUA 1ZYQA 2P51A 3K9KA 1GLLO 4MDAA 3OYJA 3L2RA 3TSQA 2QXLA 4JKCA 3J80O 1U4BA 4W5OA 5AQHA 5AFUA 4M3TA 3QLHA 4IG3A 4XH4A 1VK0A 5HL7L 4FWQA 1TYQA 2IC3A 3PX6A 2QKBA 1LWFA 1VHXA 4FJ9A 3HOSA 2F96A 1QZ6A 4H4OA 1KFSA 4CK2A 4PY5A 2E2NA 1T6DA 1JLFA 1T03A 1QTMA 3KZBA 3VQQA 4DTMA 2G8HA 2FLOA 3SAFA 3HT3A 2FF6A 2Q0UA 4JKGA 4A2BA 4BR4A 4CBWA 4DQRA 4X62K 2E1YA 4DTXA 3LP1A 4CEZA 4CFDA 2P9SA 1HNIA 5KQDA 4J2BA 3NF6A 3R9PA 1QSYA 4RW6A 4E1MA 4IJAA 1RBTA 5HRNA 3T1HK 4FK4A 4QAGA 1KQSM 1FJGK 3L3UA 1T8EA 2AA4A 4KH6A 4CHPA 4DLEA 3IUCA 5B8HA 5FPMA 2PBDA 4Y0WA 4DTNA 3DOLA 2O8FB 4CIEA 5C2FA 1W97L 3CCMN 4NXNK 1LWEA 3AO2A 4PHTX 1YT3A 4I9LA 3KTQA 1WSHA 2GUIA 4BR7A 1HJRA 1GLJO 3TWHA 4FLZA 4B1YB 4DF8A 3ZX2A 4OPHA 3J8AA 5M1QA 4B1ZA 2VG5A 5C42A 3FLCO 1LOTB 1ILYA 4Z0UA 1S9GA 3VQ6A 3HTVA 3D2FB 1ASWA 2YCHA 4KTWA 5C24A 3QEIA 4MO5A 4DWIA 2HVHA 4FPAA 2E20A 4C1NI 1I39A 1LCUA 3C0BA 1SKWA 3LM9A 3NF9A 1TKDA 3P39A 4NXMK 5FPDA 4BRDA 4MFBA 4B8CA 4RW4A 2UXBK 3ZYYX 4IZ9A 4I2QA 4H0VB 1MDUB 3E9PA 3D6RA 3WQTA 4RG8A 1ZXOA 4X65K 3H45C 4EFHA 4CFAA 4DUZK 1IV0A 4NO7A 5AQZA 2V52B 4YOVA 3CERA 2P9UB 4C8OA 3O80A 4DCHA 4CF0A 1VSIA 4H0TB 3J7YP 1NGAA 3PV8A 4B3MK 1S9EA 2F8SA 2JLEA 2PAVA 4OGCA 2O8CB 4IWVA 2UUCK 4JKAA 4O4GA 3ITHA 2E2QA 2WBNA 3FE1A 3DWLA 3QDKA 1XC3A 2FBTA 4ILJA 3AGKA 3L4IA 3CFPA 4YY3K 1OH5A 1NWKA 3RSEA 3SUPA 1W0HA 2QXFA 1OVQA 4RWTA 4WQ4C 5TKWA 1VQNN 1E4FT 4H5VA 4FJGA 3WNHA 1BWFO 4KREA 3CI5A 2A6AA 3MXJA 3MAQA 4AILC 3K5NA 3L2WA 3TTDA 3VQ7A 4E7LA 5CZ2A 3CCSN 2GWJA 3QIOA 4BDPA 3DOKA 2HW3A 4H5TA 4Z4IA 1LW0A 1ZC6A 3OYIA 5EY4A 1VSFA 1RBVA 4LF6K 1HQEA 3O9QA 1XI1A 3OHRA 3VMFB 3DXMB 5BRHA 3VEXA 5BREA 2OTJN 1NOYA 5AQTA 3AARA 3CJCA 3LDPA 4C8MA 3CCUN 1GLBG 5SZTA 2DFHA 2P9PB 4OPKA 3LWLA 4PUOA 1WSIA 4JK9A 4MDBA 1V4SA 4LFBK 2DY4A 1GLCG 2Q31A 3UKRB 4PQUA 3AO5A 4GW6A 3T19A 3RMAA 4JI6K 4H0PA 3F73A 4CCHA 3TAEA 4CEBA 3LDLA 4BR5A 3AVBA 3VQ8A 3RRGA 3EE8A 3KKRA 4JRPA 1YHQN 2PY5A 2XRIA 3THXB 3LZJA 3M5RA 2O8DB 4OKKA 4DTUA 4FWNA 3DLEA 1Y97A 4NYFA 3AAPA 4DU3A 1XMQK 2HHUA 1BUPA 3EEQA 2J4RA 1LWCA 3KVGA 5F0XA 1W9HA 2O8FA 3K5OA 3FFKB 2GX9A 4H5NA 4KAZA 4KHUA 3THYB 3QB0A 3OYNA 4DB3A 2XY8A 4DTOA 3F9MA 1CZBA 3EZWA 4FW1A 1HX1A 2I7PA 1JCGA 3MECA 1RILA 5AQPA 4DF4A 3CJBA 1RBSA 2ZJQL 1ATRA 3O9UA 3D45A 4LF4K 2WUSA 3C6AA 4CJLA 4GVEA 3SCXA 4CZJA 4FVUA 1RTDA 3IAYA 4KI6A 3NBPA 1D9DA 1ZBHA 4QOZB 2QWRA 4DTPA 4EZ9A 2RHKA 4Z4EA 1NGGA 3I8DA 3VESA 4BC4A 3D2FA 3QINA 2QWQA 2IVOA 3ZSWA 3CG7A 3FZLA 2VG7A 3PUFA 5K14A 4E19A 3CCEN 1T05A 3CPWM 4HTUA 1TVRA 1SUQA 1A5VA 3QBWA 5J2MA 1WOQA 4DFMA 3CC2N 2PYJA 4CJ4A 2VWBA 4WCEL 2D0CA 3F2KA 1YXQA 1W2BM 3HPGA 4R79A 4O0JA 3MXMA 2GELA 3QFPA 3HRGA 4GNIA 4AM6A 4DSJA 1JLQA 3WXKA 1TK0A 3C65A 1CLQA 1U2VB 1XHXA 4CIFA 3VERA 3SUOA 4B9UA 2P9UA 1X9JA 1EO1A 5AQXA 2KHOA 4BRHA 4OVLA 1G15A 2F4VK 4YDUA 1VSJA 3H6EA 1YIJN 3VF6A 3MWPA 4NCBA 2F8TA 2O8CA 5CR4A
chains in the Genus database with same CATH topology
2YHBA 3NGZA 3OJSA 2W42A 1HYVA 1MU2A 3VQCA 3OYCA 1N5YA 4ELTA 4M3RA 1QE1A 1EETA 3SJJA 4KV8A 1C0MA 1LV5A 4Z4GA 4DS4A 2YV0X 4CEAA 1CZ9A 1EXQA 1TAUA 2KW4A 1WSGA 1Z25A 4CFCA 4IDKA 3AVHA 2OZMA 3T3FA 1C6VA 3JYTA 4Z4FA 2P5OA 1HQUA 3ZSOA 3HPOA 4DTSA 1QHTA 3DRPA 3UIQA 1BI4B 3CM6A 4LSNA 4CHZA 4BACA 2PZSA 1IH7A 2NUBA 1S6PA 1KRPA 3OYGA 3HYFA 5CYMA 1WNSA 2RF2A 4CHOA 3TI0A 5J2QA 1QSLA 5FDLA 1ASVA 1NK4A 5E41A 1IKYA 4CHQA 3NHGA 3K58A 1RT4A 3TANA 1QSSA 2RKIA 1LAVA 5EU7A 1JKHA 2LSNA 3S3OA 2G8FA 2KTQA 3SQ1A 3P1GA 3KK3A 2G8WA 4KHSA 5KTQA 3LWMA 3AO3A 2FBXA 1UWBA 3OYEA 1U48A 4FLVA 5FRNA 2JGUA 2YNFA 1WSJA 4DQSA 2IAJA 1FXXA 4EP5A 1RDBA 1A5XA 3V9ZA 4AHRA 4CEFA 4CGIA 3DYAA 4H4MA 3HO1A 1CXUA 3VN5A 1GOAA 1ZBIA 4TSXA 1TKXA 1WLJA 1CXQA 4CGGA 1KVAA 4DMNA 3V6DA 1WAFA 4FJMA 4FJNA 4FM0A 5SWMA 1L3SA 2X78A 2RPIA 2Y1IA 3ZSRA 1SKSA 1JLCA 3BGRA 3OYFA 1S1WA 1J54A 2FBVA 3ZT2A 3OS0A 4DQQA 4N47A 3LAKA 4DSEA 4CGFA 1O1WA 3MEGA 3DMJA 1JL2A 1EX4A 4AHUA 4J2EA 3KLHA 3VQEA 1B9DA 3OYDA 1NK9A 3TAPA 4ZTJA 1U47A 3ZCMA 1EP4A 4HUFA 2IS3A 3AVCA 3CQ8A 5HROA 3I0SA 1BL3A 4E7KA 1KLNA 2DTUA 4CERA 3EYZA 2YKMA 4BDYA 1L3UA 3E01A 3G0ZA 1TKTA 4E89A 2IGIA 1EKEA 4DSLA 3LALA 4CECA 1KSPA 3G10A 2VWJA 4AH9A 1NOZA 3CYMA 1KFDA 2YHAA 4KKOA 5C25A 1RBUA 2GBZA 3NF7A 4NCGA 1LW2A 1SL1A 4KI4A 4CHYA 5I42A 3PX4A 4FLXA 3C6TA 2Q3SA 2ATQA 4O55A 3KKSA 3RMBA 4IFYA 3OYLA 4B9LA 4JLHA 3U6FA 5CZ1A 3TAFA 1NJZA 4B3OA 3KK2A 3AO4A 1VRUA 1ZYQA 1KCFA 4M45A 1IKWA 1KVBA 2P51A 4BE2A 3DLRA 4CFBA 2RN2A 3L2RA 3OYJA 4B9MA 3ISNC 3P5JA 3V9SA 3OY9A 3ZT4A 5J1EA 2HNZA 2ZQBA 3T1AA 1U4BA 2QKKA 4FJ8A 3KLIA 4W5OA 3HPHA 1BCOA 3NGYA 2Y1JA 1VSLA 4FJ5A 3QLHA 4M3TA 3LDSA 1C0UA 4CJKA 3SV4A 4IG3A 3AA5X 1VSKA 3QEWA 1VK0A 3A2FA 3VQBA 4FM2A 4HCBA 3SI6A 2O4IA 2WONA 2IC3A 1TGOA 1RDAA 3PX6A 2QKBA 2Z1GA 1LWFA 4K8XA 4W5TA 4FJ9A 2F96A 5DMRA 4GVMA 1U49A 1IO2A 4F2RA 4H4OA 3SUNA 1KFSA 3FFIA 4OKEA 4CK2A 4PY5A 4O0IA 2B5JA 1NK8A 1JL1A 1S1VA 1JLFA 3C94A 3JSMA 1T03A 3AA2A 3S3MA 2G8VA 4Y1DA 3NCIA 4BE0A 1QTMA 4M41A 3SV3A 3U3YA 4L8RB 3AVMA 3VQQA 4DTMA 1J9AA 2BGGA 3C6UA 2G8HA 4B9TA 1X1PA 3HT3A 1HYSA 2Z1IA 4DQRA 1KTQA 5CY4A 3CFRA 5KRTA 4DTXA 3LP1A 4CE9A 2KQ2A 4FLTA 4CEZA 3OVNA 4CFDA 4RW9A 4CJRA 1NJXA 1HNIA 3OYMA 2XHBA 4J2BA 4BE1A 3NF6A 4RW8A 1Q9YA 1QSYA 4RW6A 4E1MA 3SQ4A 1RBTA 5HRNA 4IBNA 4FK4A 3AVAA 3RTVA 1N6QA 4QAGA 3V9XA 4B9NA 4KPYA 4BWJA 4DFKA 3L3UA 3VQ9A 2HHSA 4DS5A 4NCAA 1QQCA 3ZSVA 3OYBA 1T8EA 2DFFA 4KB1A 1Z26A 1GOCA 4LSLA 4H8KA 4FJXA 1BCMA 1S5JA 4CHPA 4DLEA 1R0AA 4W5RA 1XWLA 3K5LA 3DI6A 3QNNA 5CYQA 4FJ7A 4DTNA 5KGWA 3DOLA 4FXDA 2XO7A 4J2AA 1WN7A 4CIEA 3KJVA 4N41A 2R7YA 3TAQA 1LWEA 1NKBA 4CF8A 4FJJA 3AO2A 3HXMA 1L5UA 4HUGA 4DQIA 1HMVA 4QCLA 4KFBA 1YT3A 4I9LA 1JLAA 4R5PA 3KTQA 1WSHA 2GUIA 3M8RA 1HJRA 1T7PA 2KZMA 1KVCA 4KHYA 3DRSA 2QK9A 3RR7A 4RW7A 3TWHA 1FKPA 1TL1A 3ZSYA 4FLZA 4KHQA 3IRXA 4ZHRA 1UOCA 5KGXA 1DLOA 4WE1A 4CJEA 4DF8A 4CEEA 3LZIA 1C1CA 4CJFA 2Z1JA 3KD5E 2D5RA 3K57A 2VG5A 5C42A 4ICLA 4FW2A 4E7JA 3NGIA 4Z0UA 4GMJB 4DSFA 1S9GA 3QEVA 3DLHA 3RWUA 3VQ6A 3HP9A 3K5MA 1UA1A 3AO1A 2P1JA 1J5OA 1ASWA 1XC9A 5HRRA 3L2QA 4KTWA 2A1RA 3PO5A 3DRRA 1WSEA 3M8QA 5C24A 3QEIA 3IG1A 1QS4A 4DWIA 2HVHA 4ELVA 3U3GA 1J53A 1IKXA 1YTAA 5DK5A 1UAXA 4M3WA 1UA0A 1NKCA 1I39A 4FK0A 2Z1HA 1SKWA 4F4KA 3NF9A 1JLGA 1TKDA 1BI4A 4C8KA 4FZXC 1L3TA 3ZT0A 3KK1A 3AA3A 4MFBA 3NH2A 4KHNA 1VRTA 4B8CA 3O4NA 4RW4A 4I2QA 3AVJA 2E4LA 1JLEA 1VSDA 4LH4A 1RBRA 4RG8A 2OPQA 3V1QA 3AVLA 4CJWA 3L8BA 3V9WA 3TAMA 3SQ0A 1GOBA 1WSFA 4E7IA 4CFAA 3QEPA 4KO0A 4ELUA 2BE2A 4N5SA 1RT7A 2WOMA 3VA0A 4FZYA 3SNNA 4IFVA 1S6QA 3NAEA 4C8OA 3VQDA 4CF0A 1VSIA 3QO9A 4FJHA 1Q8IA 4F3TA 4DTRA 3S3NA 3CM5A 3PV8A 1X9SA 4YNQA 3TABA 1NJWA 3P83D 4DSKA 1RT3A 1S9EA 4IG0A 4HHTA 3THVA 3OYKA 2F8SA 2JLEA 4CJQA 4E7HA 4OJRA 4OGCA 4CIGA 1TK5A 1NK5A 1X9MA 3M8PA 4O4GA 3ITHA 3EZ5A 1RTJA 2O4GA 5FROA 3O3GA 4M3XA 4OKJA 3PY8A 2FBTA 4C8NA 1NJYA 4DG1A 3CFPA 3AA4A 4DFJA 3AVGA 5HRSA 4LH5A 1DTTA 3RRHA 4HVJA 4KB0A 3SUPA 1BQNA 4CESA 4FK2A 3QETA 1W0HA 4EZ6A 2QXFA 4FLWA 3LPTA 3PO4A 3OJUA 4CJSA 4AHSA 4CK3A 5FRMA 2ITGA 4FJGA 3WNHA 3LPUA 4KREA 1VSEA 1TKZA 3DLGA 4M3ZA 3VQPA 3MAQA 3MXJA 1HYZA 5KI6A 3WNEA 4AILC 3K5NA 4F3OA 2HNYA 3L2WA 4CEOA 3HP6A 4JRQA 1SL0A 2OPPA 1YVUA 3VQ7A 4B9SA 1RT2A 1BISA 4E7LA 5CZ2A 4CEQA 3NF8A 2A1SA 4KTZA 3VQ5A 2YNIA 3QIOA 4Z4CA 3L2UA 4BDPA 2HHVA 3ZT3A 4LD0A 3F9KA 3DOKA 2HW3A 1B92A 3LANA 4Z4IA 1HPZA 1LW0A 3CFOA 2HHXA 4PA1A 2EX3A 3OYIA 2G8KA 3I0RA 1VSFA 2DFEA 1HNVA 1IKVA 1VSHA 1RBVA 3EY1A 1U45A 2VWKA 1TK8A 1HQEA 1XI1A 1ZBFA 1TL3A 2FC0A 1TAQA 2OYQA 4CGHA 1D5AA 2XY5A 2OZSA 4M3UA 3TARA 5T7BA 4CJUA 2HHTA 1NK7A 4MQ3A 2X74A 3WNFA 1D8YA 5D3GA 1BGXT 1FK9A 2OPRA 3AV9A 1NOYA 4C8LA 4OPJA 4YFUA 2YNGA 3MEDA 3KIOA 2IDOA 3L2VA 4HUEA 3HM9A 3K2PA 1RNHA 1X9WA 3H08A 3AVKA 4O44A 4C8MA 5SZTA 4FLYA 5I3UA 4FJLA 2DFHA 4OPKA 1JXBA 1TV6A 1B9FA 3OYAA 3M8SA 3LWLA 4HCCA 1ZBUA 3AVFA 4KRFA 5HLFA 1WSIA 3DM2A 4PUOA 1LAWA 4B9VA 5J2NA 4OLBA 4Q5VA 1I3AA 1FKOA 4CEDA 2AJQA 2FBYA 1C0TA 3IS9A 4B8AB 2DY4A 4PQUA 4CJVA 4N76A 3NH0A 5HP1A 4FJKA 4F8RA 2G8IA 4CF2A 3AO5A 3LP0A 4GW6A 3T19A 3RMAA 4UQGA 3WNGA 4FM1A 3B6OA 3F73A 4CCHA 3K59A 1RT6A 2HB5A 3TAEA 1RTIA 1KLMA 4I7FA 4B08A 4CEBA 3V81A 3AVBA 4BWMA 3VQ8A 2I5JA 3OS1A 3RRGA 3KKRA 4I9QA 3C95A 4JRPA 4FLUA 2PY5A 2XRIA 3LZJA 4ID5A 3NFAA 4OKKA 3MXIA 3HJFA 4DTUA 4BDZA 2EHGA 3ULDA 3MEEA 4G1QA 3DLEA 1Y97A 3ASMA 4CGDA 4CJPA 4CF9A 3NH1A 4DLGA 4NYFA 1NK6A 3ALYA 4F2SA 5KRSA 1S1UA 3V1RA 4DU3A 1REVA 2HHUA 3DLKA 4W5QA 3ZSZA 4N56A 1LWCA 2ZD1A 1W9HA 4M3YA 3AVIA 4AHVA 2ZE2A 3KLFA 2KFNA 1RT1A 3LP3A 3K5OA 3NDKA 1WAJA 4DFPA 4E0DA 4PWDA 4KAZA 4FYDA 4W5NA 4CGJA 3LAMA 4DTJA 4KHUA 2HVIA 2X6SA 2KFZA 4ZTFA 3OYNA 4Y1CA 3HVRA 3O4QA 1RTHA 3KLEA 2XY8A 4DTOA 4DU1A 1CZBA 3L3VA 2IOCA 2X6NA 4FW1A 1SV5A 4CJ5A 1K6YA 4KHWA 3MECA 3RR8A 3SUQA 3HK2A 1RILA 1VSMA 4LY7A 3S9HA 3SYZA 1IG9A 3SPYA 4DF4A 1NK0A 4FZZA 3KD1E 1JLBA 1RBSA 2P5GA 4NYNA 3D45A 2XY7A 1S1TA 1RDCA 3V1OA 4O5BA 2BDPA 2HHWA 1A5WA 4CJLA 3SCXA 3D0PA 4DSIA 2D0BA 1XHZA 1RTDA 3ZSQA 3SZ2A 3IAYA 4E1NA 4CF1A 2XY6A 4KI6A 3NBPA 1D9DA 1ZBHA 3V9UA 3QIPA 3QEXA 1BHLA 4DTPA 4QOZB 4EZ9A 4DU4A 2ETJA 4Z4EA 4CHNA 3OS2A 3I8DA 1C1AA 3SPZA 3HL8A 2B6AA 2E6MA 3QINA 4OGEA 4CJTA 4EP4A 4FCYA 1ITGA 5HBMA 4AHTA 4JS5A 3ZT1A 3QNOA 3HVTA 1RDDA 5J2PA 1RCHA 5JS1A 4I2PA 3ZSWA 4OLAA 1U04A 3CG7A 4FJIA 2HHQA 4ID1A 3QESA 2VG7A 3SQ2A 3PUFA 3B6PA 5K14A 4E19A 1F21A 3VQ4A 4Z4HA 4E3SA 3TAGA 4JS4A 3PX0A 3RMDA 4XIUA 2B4JA 1HRHA 3KLGA 1T05A 4M42A 4HTUA 4K8ZA 1C1BA 3HSTB 1TVRA 1SUQA 1A5VA 5J2MA 3BDPA 1SKRA 4DFMA 2YKNA 2BANA 2PYJA 4IKFA 4CJ4A 3O3HA 1ZBLA 2HNDA 2D0CA 2PYLA 3LP2A 1JXEA 1D9FA 2OA8A 3HPGA 2KZZA 4O0JA 3ZSXA 3MXMA 2HMIA 4DQPA 2E6LA 3DLBA 3O3FA 4DSJA 1JLQA 1BIZA 1BIUA 3V4IA 3QERA 1TK0A 1NKEA 1ASUA 1YTUA 1CLQA 5HRPA 1XHXA 4CIFA 2G8UA 3SUOA 4B9UA 3VQAA 4AHCA 4J2DA 3TR8A 2D0AA 1SL2A 1BQMA 1RT5A 1L3VA 1DTQA 4OVLA 1G15A 3OYHA 4Q0BA 2VG6A 4KTQA 1VSJA 3VA3A 1S1XA 3AVNA 2OPSA 4FVMA 4CJ3A 2GV9A 4NCBA 3RMCA 2F8TA 2YNHA 5JS2A 3NE6A 1Q9XA 4CK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHB A;  3NGZ A;  3OJS A;  2W42 A;  1HYV A;  1MU2 A;  3VQC A;  3OYC A;  1N5Y A;  4ELT A;  4M3R A;  1QE1 A;  1EET A;  3SJJ A;  4KV8 A;  1C0M A;  1LV5 A;  4Z4G A;  4DS4 A;  2YV0 X;  4CEA A;  1CZ9 A;  1EXQ A;  1TAU A;  2KW4 A;  1WSG A;  1Z25 A;  4CFC A;  4IDK A;  3AVH A;  2OZM A;  3T3F A;  1C6V A;  3JYT A;  4Z4F A;  2P5O A;  1HQU A;  3ZSO A;  3HPO A;  4DTS A;  1QHT A;  3DRP A;  3UIQ A;  1BI4 B;  3CM6 A;  4LSN A;  4CHZ A;  4BAC A;  2PZS A;  1IH7 A;  2NUB A;  1S6P A;  1KRP A;  3OYG A;  3HYF A;  5CYM A;  1WNS A;  2RF2 A;  4CHO A;  3TI0 A;  5J2Q A;  1QSL A;  5FDL A;  1ASV A;  1NK4 A;  5E41 A;  1IKY A;  4CHQ A;  3NHG A;  3K58 A;  1RT4 A;  3TAN A;  1QSS A;  2RKI A;  1LAV A;  5EU7 A;  1JKH A;  2LSN A;  3S3O A;  2G8F A;  2KTQ A;  3SQ1 A;  3P1G A;  3KK3 A;  2G8W A;  4KHS A;  5KTQ A;  3LWM A;  3AO3 A;  2FBX A;  1UWB A;  3OYE A;  1U48 A;  4FLV A;  5FRN A;  2JGU A;  2YNF A;  1WSJ A;  4DQS A;  2IAJ A;  1FXX A;  4EP5 A;  1RDB A;  1A5X A;  3V9Z A;  4AHR A;  4CEF A;  4CGI A;  3DYA A;  4H4M A;  3HO1 A;  1CXU A;  3VN5 A;  1GOA A;  1ZBI A;  4TSX A;  1TKX A;  1WLJ A;  1CXQ A;  4CGG A;  1KVA A;  4DMN A;  3V6D A;  1WAF A;  4FJM A;  4FJN A;  4FM0 A;  5SWM A;  1L3S A;  2X78 A;  2RPI A;  2Y1I A;  3ZSR A;  1SKS A;  1JLC A;  3BGR A;  3OYF A;  1S1W A;  1J54 A;  2FBV A;  3ZT2 A;  3OS0 A;  4DQQ A;  4N47 A;  3LAK A;  4DSE A;  4CGF A;  1O1W A;  3MEG A;  3DMJ A;  1JL2 A;  1EX4 A;  4AHU A;  4J2E A;  3KLH A;  3VQE A;  1B9D A;  3OYD A;  1NK9 A;  3TAP A;  4ZTJ A;  1U47 A;  3ZCM A;  1EP4 A;  4HUF A;  2IS3 A;  3AVC A;  3CQ8 A;  5HRO A;  3I0S A;  1BL3 A;  4E7K A;  1KLN A;  2DTU A;  4CER A;  3EYZ A;  2YKM A;  4BDY A;  1L3U A;  3E01 A;  3G0Z A;  1TKT A;  4E89 A;  2IGI A;  1EKE A;  4DSL A;  3LAL A;  4CEC A;  1KSP A;  3G10 A;  2VWJ A;  4AH9 A;  1NOZ A;  3CYM A;  1KFD A;  2YHA A;  4KKO A;  5C25 A;  1RBU A;  2GBZ A;  3NF7 A;  4NCG A;  1LW2 A;  1SL1 A;  4KI4 A;  4CHY A;  5I42 A;  3PX4 A;  4FLX A;  3C6T A;  2Q3S A;  2ATQ A;  4O55 A;  3KKS A;  3RMB A;  4IFY A;  3OYL A;  4B9L A;  4JLH A;  3U6F A;  5CZ1 A;  3TAF A;  1NJZ A;  4B3O A;  3KK2 A;  3AO4 A;  1VRU A;  1ZYQ A;  1KCF A;  4M45 A;  1IKW A;  1KVB A;  2P51 A;  4BE2 A;  3DLR A;  4CFB A;  2RN2 A;  3L2R A;  3OYJ A;  4B9M A;  3ISN C;  3P5J A;  3V9S A;  3OY9 A;  3ZT4 A;  5J1E A;  2HNZ A;  2ZQB A;  3T1A A;  1U4B A;  2QKK A;  4FJ8 A;  3KLI A;  4W5O A;  3HPH A;  1BCO A;  3NGY A;  2Y1J A;  1VSL A;  4FJ5 A;  3QLH A;  4M3T A;  3LDS A;  1C0U A;  4CJK A;  3SV4 A;  4IG3 A;  3AA5 X;  1VSK A;  3QEW A;  1VK0 A;  3A2F A;  3VQB A;  4FM2 A;  4HCB A;  3SI6 A;  2O4I A;  2WON A;  2IC3 A;  1TGO A;  1RDA A;  3PX6 A;  2QKB A;  2Z1G A;  1LWF A;  4K8X A;  4W5T A;  4FJ9 A;  2F96 A;  5DMR A;  4GVM A;  1U49 A;  1IO2 A;  4F2R A;  4H4O A;  3SUN A;  1KFS A;  3FFI A;  4OKE A;  4CK2 A;  4PY5 A;  4O0I A;  2B5J A;  1NK8 A;  1JL1 A;  1S1V A;  1JLF A;  3C94 A;  3JSM A;  1T03 A;  3AA2 A;  3S3M A;  2G8V A;  4Y1D A;  3NCI A;  4BE0 A;  1QTM A;  4M41 A;  3SV3 A;  3U3Y A;  4L8R B;  3AVM A;  3VQQ A;  4DTM A;  1J9A A;  2BGG A;  3C6U A;  2G8H A;  4B9T A;  1X1P A;  3HT3 A;  1HYS A;  2Z1I A;  4DQR A;  1KTQ A;  5CY4 A;  3CFR A;  5KRT A;  4DTX A;  3LP1 A;  4CE9 A;  2KQ2 A;  4FLT A;  4CEZ A;  3OVN A;  4CFD A;  4RW9 A;  4CJR A;  1NJX A;  1HNI A;  3OYM A;  2XHB A;  4J2B A;  4BE1 A;  3NF6 A;  4RW8 A;  1Q9Y A;  1QSY A;  4RW6 A;  4E1M A;  3SQ4 A;  1RBT A;  5HRN A;  4IBN A;  4FK4 A;  3AVA A;  3RTV A;  1N6Q A;  4QAG A;  3V9X A;  4B9N A;  4KPY A;  4BWJ A;  4DFK A;  3L3U A;  3VQ9 A;  2HHS A;  4DS5 A;  4NCA A;  1QQC A;  3ZSV A;  3OYB A;  1T8E A;  2DFF A;  4KB1 A;  1Z26 A;  1GOC A;  4LSL A;  4H8K A;  4FJX A;  1BCM A;  1S5J A;  4CHP A;  4DLE A;  1R0A A;  4W5R A;  1XWL A;  3K5L A;  3DI6 A;  3QNN A;  5CYQ A;  4FJ7 A;  4DTN A;  5KGW A;  3DOL A;  4FXD A;  2XO7 A;  4J2A A;  1WN7 A;  4CIE A;  3KJV A;  4N41 A;  2R7Y A;  3TAQ A;  1LWE A;  1NKB A;  4CF8 A;  4FJJ A;  3AO2 A;  3HXM A;  1L5U A;  4HUG A;  4DQI A;  1HMV A;  4QCL A;  4KFB A;  1YT3 A;  4I9L A;  1JLA A;  4R5P A;  3KTQ A;  1WSH A;  2GUI A;  3M8R A;  1HJR A;  1T7P A;  2KZM A;  1KVC A;  4KHY A;  3DRS A;  2QK9 A;  3RR7 A;  4RW7 A;  3TWH A;  1FKP A;  1TL1 A;  3ZSY A;  4FLZ A;  4KHQ A;  3IRX A;  4ZHR A;  1UOC A;  5KGX A;  1DLO A;  4WE1 A;  4CJE A;  4DF8 A;  4CEE A;  3LZI A;  1C1C A;  4CJF A;  2Z1J A;  3KD5 E;  2D5R A;  3K57 A;  2VG5 A;  5C42 A;  4ICL A;  4FW2 A;  4E7J A;  3NGI A;  4Z0U A;  4GMJ B;  4DSF A;  1S9G A;  3QEV A;  3DLH A;  3RWU A;  3VQ6 A;  3HP9 A;  3K5M A;  1UA1 A;  3AO1 A;  2P1J A;  1J5O A;  1ASW A;  1XC9 A;  5HRR A;  3L2Q A;  4KTW A;  2A1R A;  3PO5 A;  3DRR A;  1WSE A;  3M8Q A;  5C24 A;  3QEI A;  3IG1 A;  1QS4 A;  4DWI A;  2HVH A;  4ELV A;  3U3G A;  1J53 A;  1IKX A;  1YTA A;  5DK5 A;  1UAX A;  4M3W A;  1UA0 A;  1NKC A;  1I39 A;  4FK0 A;  2Z1H A;  1SKW A;  4F4K A;  3NF9 A;  1JLG A;  1TKD A;  1BI4 A;  4C8K A;  4FZX C;  1L3T A;  3ZT0 A;  3KK1 A;  3AA3 A;  4MFB A;  3NH2 A;  4KHN A;  1VRT A;  4B8C A;  3O4N A;  4RW4 A;  4I2Q A;  3AVJ A;  2E4L A;  1JLE A;  1VSD A;  4LH4 A;  1RBR A;  4RG8 A;  2OPQ A;  3V1Q A;  3AVL A;  4CJW A;  3L8B A;  3V9W A;  3TAM A;  3SQ0 A;  1GOB A;  1WSF A;  4E7I A;  4CFA A;  3QEP A;  4KO0 A;  4ELU A;  2BE2 A;  4N5S A;  1RT7 A;  2WOM A;  3VA0 A;  4FZY A;  3SNN A;  4IFV A;  1S6Q A;  3NAE A;  4C8O A;  3VQD A;  4CF0 A;  1VSI A;  3QO9 A;  4FJH A;  1Q8I A;  4F3T A;  4DTR A;  3S3N A;  3CM5 A;  3PV8 A;  1X9S A;  4YNQ A;  3TAB A;  1NJW A;  3P83 D;  4DSK A;  1RT3 A;  1S9E A;  4IG0 A;  4HHT A;  3THV A;  3OYK A;  2F8S A;  2JLE A;  4CJQ A;  4E7H A;  4OJR A;  4OGC A;  4CIG A;  1TK5 A;  1NK5 A;  1X9M A;  3M8P A;  4O4G A;  3ITH A;  3EZ5 A;  1RTJ A;  2O4G A;  5FRO A;  3O3G A;  4M3X A;  4OKJ A;  3PY8 A;  2FBT A;  4C8N A;  1NJY A;  4DG1 A;  3CFP A;  3AA4 A;  4DFJ A;  3AVG A;  5HRS A;  4LH5 A;  1DTT A;  3RRH A;  4HVJ A;  4KB0 A;  3SUP A;  1BQN A;  4CES A;  4FK2 A;  3QET A;  1W0H A;  4EZ6 A;  2QXF A;  4FLW A;  3LPT A;  3PO4 A;  3OJU A;  4CJS A;  4AHS A;  4CK3 A;  5FRM A;  2ITG A;  4FJG A;  3WNH A;  3LPU A;  4KRE A;  1VSE A;  1TKZ A;  3DLG A;  4M3Z A;  3VQP A;  3MAQ A;  3MXJ A;  1HYZ A;  5KI6 A;  3WNE A;  4AIL C;  3K5N A;  4F3O A;  2HNY A;  3L2W A;  4CEO A;  3HP6 A;  4JRQ A;  1SL0 A;  2OPP A;  1YVU A;  3VQ7 A;  4B9S A;  1RT2 A;  1BIS A;  4E7L A;  5CZ2 A;  4CEQ A;  3NF8 A;  2A1S A;  4KTZ A;  3VQ5 A;  2YNI A;  3QIO A;  4Z4C A;  3L2U A;  4BDP A;  2HHV A;  3ZT3 A;  4LD0 A;  3F9K A;  3DOK A;  2HW3 A;  1B92 A;  3LAN A;  4Z4I A;  1HPZ A;  1LW0 A;  3CFO A;  2HHX A;  4PA1 A;  2EX3 A;  3OYI A;  2G8K A;  3I0R A;  1VSF A;  2DFE A;  1HNV A;  1IKV A;  1VSH A;  1RBV A;  3EY1 A;  1U45 A;  2VWK A;  1TK8 A;  1HQE A;  1XI1 A;  1ZBF A;  1TL3 A;  2FC0 A;  1TAQ A;  2OYQ A;  4CGH A;  1D5A A;  2XY5 A;  2OZS A;  4M3U A;  3TAR A;  5T7B A;  4CJU A;  2HHT A;  1NK7 A;  4MQ3 A;  2X74 A;  3WNF A;  1D8Y A;  5D3G A;  1BGX T;  1FK9 A;  2OPR A;  3AV9 A;  1NOY A;  4C8L A;  4OPJ A;  4YFU A;  2YNG A;  3MED A;  3KIO A;  2IDO A;  3L2V A;  4HUE A;  3HM9 A;  3K2P A;  1RNH A;  1X9W A;  3H08 A;  3AVK A;  4O44 A;  4C8M A;  5SZT A;  4FLY A;  5I3U A;  4FJL A;  2DFH A;  4OPK A;  1JXB A;  1TV6 A;  1B9F A;  3OYA A;  3M8S A;  3LWL A;  4HCC A;  1ZBU A;  3AVF A;  4KRF A;  5HLF A;  1WSI A;  3DM2 A;  4PUO A;  1LAW A;  4B9V A;  5J2N A;  4OLB A;  4Q5V A;  1I3A A;  1FKO A;  4CED A;  2AJQ A;  2FBY A;  1C0T A;  3IS9 A;  4B8A B;  2DY4 A;  4PQU A;  4CJV A;  4N76 A;  3NH0 A;  5HP1 A;  4FJK A;  4F8R A;  2G8I A;  4CF2 A;  3AO5 A;  3LP0 A;  4GW6 A;  3T19 A;  3RMA A;  4UQG A;  3WNG A;  4FM1 A;  3B6O A;  3F73 A;  4CCH A;  3K59 A;  1RT6 A;  2HB5 A;  3TAE A;  1RTI A;  1KLM A;  4I7F A;  4B08 A;  4CEB A;  3V81 A;  3AVB A;  4BWM A;  3VQ8 A;  2I5J A;  3OS1 A;  3RRG A;  3KKR A;  4I9Q A;  3C95 A;  4JRP A;  4FLU A;  2PY5 A;  2XRI A;  3LZJ A;  4ID5 A;  3NFA A;  4OKK A;  3MXI A;  3HJF A;  4DTU A;  4BDZ A;  2EHG A;  3ULD A;  3MEE A;  4G1Q A;  3DLE A;  1Y97 A;  3ASM A;  4CGD A;  4CJP A;  4CF9 A;  3NH1 A;  4DLG A;  4NYF A;  1NK6 A;  3ALY A;  4F2S A;  5KRS A;  1S1U A;  3V1R A;  4DU3 A;  1REV A;  2HHU A;  3DLK A;  4W5Q A;  3ZSZ A;  4N56 A;  1LWC A;  2ZD1 A;  1W9H A;  4M3Y A;  3AVI A;  4AHV A;  2ZE2 A;  3KLF A;  2KFN A;  1RT1 A;  3LP3 A;  3K5O A;  3NDK A;  1WAJ A;  4DFP A;  4E0D A;  4PWD A;  4KAZ A;  4FYD A;  4W5N A;  4CGJ A;  3LAM A;  4DTJ A;  4KHU A;  2HVI A;  2X6S A;  2KFZ A;  4ZTF A;  3OYN A;  4Y1C A;  3HVR A;  3O4Q A;  1RTH A;  3KLE A;  2XY8 A;  4DTO A;  4DU1 A;  1CZB A;  3L3V A;  2IOC A;  2X6N A;  4FW1 A;  1SV5 A;  4CJ5 A;  1K6Y A;  4KHW A;  3MEC A;  3RR8 A;  3SUQ A;  3HK2 A;  1RIL A;  1VSM A;  4LY7 A;  3S9H A;  3SYZ A;  1IG9 A;  3SPY A;  4DF4 A;  1NK0 A;  4FZZ A;  3KD1 E;  1JLB A;  1RBS A;  2P5G A;  4NYN A;  3D45 A;  2XY7 A;  1S1T A;  1RDC A;  3V1O A;  4O5B A;  2BDP A;  2HHW A;  1A5W A;  4CJL A;  3SCX A;  3D0P A;  4DSI A;  2D0B A;  1XHZ A;  1RTD A;  3ZSQ A;  3SZ2 A;  3IAY A;  4E1N A;  4CF1 A;  2XY6 A;  4KI6 A;  3NBP A;  1D9D A;  1ZBH A;  3V9U A;  3QIP A;  3QEX A;  1BHL A;  4DTP A;  4QOZ B;  4EZ9 A;  4DU4 A;  2ETJ A;  4Z4E A;  4CHN A;  3OS2 A;  3I8D A;  1C1A A;  3SPZ A;  3HL8 A;  2B6A A;  2E6M A;  3QIN A;  4OGE A;  4CJT A;  4EP4 A;  4FCY A;  1ITG A;  5HBM A;  4AHT A;  4JS5 A;  3ZT1 A;  3QNO A;  3HVT A;  1RDD A;  5J2P A;  1RCH A;  5JS1 A;  4I2P A;  3ZSW A;  4OLA A;  1U04 A;  3CG7 A;  4FJI A;  2HHQ A;  4ID1 A;  3QES A;  2VG7 A;  3SQ2 A;  3PUF A;  3B6P A;  5K14 A;  4E19 A;  1F21 A;  3VQ4 A;  4Z4H A;  4E3S A;  3TAG A;  4JS4 A;  3PX0 A;  3RMD A;  4XIU A;  2B4J A;  1HRH A;  3KLG A;  1T05 A;  4M42 A;  4HTU A;  4K8Z A;  1C1B A;  3HST B;  1TVR A;  1SUQ A;  1A5V A;  5J2M A;  3BDP A;  1SKR A;  4DFM A;  2YKN A;  2BAN A;  2PYJ A;  4IKF A;  4CJ4 A;  3O3H A;  1ZBL A;  2HND A;  2D0C A;  2PYL A;  3LP2 A;  1JXE A;  1D9F A;  2OA8 A;  3HPG A;  2KZZ A;  4O0J A;  3ZSX A;  3MXM A;  2HMI A;  4DQP A;  2E6L A;  3DLB A;  3O3F A;  4DSJ A;  1JLQ A;  1BIZ A;  1BIU A;  3V4I A;  3QER A;  1TK0 A;  1NKE A;  1ASU A;  1YTU A;  1CLQ A;  5HRP A;  1XHX A;  4CIF A;  2G8U A;  3SUO A;  4B9U A;  3VQA A;  4AHC A;  4J2D A;  3TR8 A;  2D0A A;  1SL2 A;  1BQM A;  1RT5 A;  1L3V A;  1DTQ A;  4OVL A;  1G15 A;  3OYH A;  4Q0B A;  2VG6 A;  4KTQ A;  1VSJ A;  3VA3 A;  1S1X A;  3AVN A;  2OPS A;  4FVM A;  4CJ3 A;  2GV9 A;  4NCB A;  3RMC A;  2F8T A;  2YNH A;  5JS2 A;  3NE6 A;  1Q9X A;  4CK1 A; 
#chains in the Genus database with same CATH topology
 2YHB A;  2W42 A;  1N5Y A;  1MU2 A;  1QE1 A;  1EET A;  1LV5 A;  1EXQ A;  3SAG A;  1Z25 A;  5EVZ A;  1BA0 A;  2CH6 A;  3VEN A;  3T3F A;  5ADX H;  4DR5 K;  3ZSO A;  3HPO A;  4DTS A;  1QHT A;  3DRP A;  5BR9 A;  3OYG A;  4CZG A;  5J2Q A;  5MLC Q;  3NHG A;  3TAN A;  1RT4 A;  2RKI A;  1BG3 A;  1HKC A;  2KTQ A;  3P1G A;  4MO4 A;  2G8W A;  4KHS A;  5KTQ A;  3OYE A;  5F1X A;  3KWI A;  4YOT A;  3VN5 A;  2VCP A;  5AQF A;  2W40 A;  2IIR A;  1WLJ A;  1CXQ A;  4CGG A;  3HBT A;  3DXM A;  5JLF A;  4FJN A;  5BRF A;  2X78 A;  3ZSR A;  1NGE A;  5FPE A;  1S1W A;  1J54 A;  2FBV A;  3ZT2 A;  3LAK A;  4J2E A;  2NRH A;  1B9D A;  5GAE P;  2P9P A;  4BR2 A;  4HUF A;  5AQM A;  3L0Q A;  1KLN A;  4IOC L;  5LY3 A;  1L3U A;  3CME N;  1TKT A;  2IGI A;  4CEC A;  2VWJ A;  1WUA A;  1KFD A;  5BN8 A;  4KI4 A;  3Q7B A;  1SL1 A;  3UKR A;  5I42 A;  3PX4 A;  3KKS A;  3RMB A;  3OYL A;  3OA9 A;  3U6F A;  3TAF A;  1YJ9 N;  3QFU A;  1BO5 O;  1KCF A;  1KVB A;  4FWM A;  4BE2 A;  3H1Q A;  3ISN C;  3OY9 A;  1NGB A;  5J1E A;  2ZQB A;  1HPM A;  3THX A;  4FJ8 A;  5AQG A;  3NGY A;  4IJN A;  1VSL A;  4FJ5 A;  1MA9 B;  3HSC A;  3LDS A;  1C0U A;  4CJK A;  4JI4 K;  3AA5 X;  1VSK A;  3A2F A;  4BC5 A;  3VQB A;  3NMU A;  1QZ5 A;  3CJA A;  4GKJ K;  1TGO A;  4L3Q A;  1RDA A;  3J7Z O;  4K8X A;  4CJ7 A;  5BN9 A;  4GVM A;  1U49 A;  4RTF D;  5AQV A;  1NK8 A;  1JL1 A;  1S1V A;  2A5X A;  4WQ4 A;  3C94 A;  4BE0 A;  4L8R B;  4M41 A;  4AF1 A;  3IFR A;  1WB9 A;  1J9A A;  3C6U A;  3CCV N;  4B9T A;  3WXM B;  1O13 A;  4JK8 A;  3VEW A;  1HYS A;  1N34 K;  3GDQ A;  4EIA A;  3UKU B;  4BRG A;  3U9Z A;  5CY4 A;  1XQS C;  2P9N A;  4FLT A;  1NJX A;  4BE1 A;  4RW8 A;  1I94 K;  3SQ4 A;  4IBN A;  3HI0 A;  1ZBS A;  4JI5 K;  4B9N A;  2HHS A;  4KPY A;  4FOI A;  4H0O A;  1NLV A;  4DS5 A;  4NCA A;  1QQC A;  3OYB A;  4NLC A;  2DFF A;  3R3L A;  4FWR A;  1GOC A;  4FJX A;  5CYQ A;  3D2E B;  5KGW A;  3CJ7 A;  4FXD A;  2D0P A;  3M1F A;  4B3S K;  1NKB A;  4CF8 A;  4FJJ A;  4DQI A;  1NBW A;  4HUG A;  1BU6 O;  3VGK A;  4RW7 A;  1FKP A;  3H3O B;  1U2V A;  4KHQ A;  4ZHR A;  1UOC A;  3RVC A;  5KGX A;  2QA4 N;  3U9D A;  1OH6 A;  1HLU A;  4DSF A;  2ZM6 K;  4KBO A;  3DLH A;  3K5M A;  1UA1 A;  3O1B A;  1XC9 A;  5HRR A;  3MX2 A;  1WSE A;  2CGL A;  3SLC A;  1J53 A;  1IKX A;  4JI1 K;  4RCH A;  1NKC A;  2NRR A;  1JLG A;  4C8K A;  3ZT0 A;  5LJW A;  4KHN A;  3O4N A;  3QML A;  3AVJ A;  3WUH A;  3ENB A;  3L8B A;  4DR6 K;  3MN5 A;  4H5W A;  1GOB A;  1WSF A;  2ASO A;  1HNX K;  2BE2 A;  3VA0 A;  3VF2 A;  3SNN A;  4IFV A;  1S6Q A;  2QEX N;  3MN7 A;  3U8X A;  4OPA A;  4K42 A;  5E84 A;  4F3T A;  4DTR A;  3CET A;  1X9S A;  4YNQ A;  5C2D A;  1RT3 A;  2RE2 A;  3HM8 A;  3OYK A;  4IO9 L;  2F7T A;  1NK5 A;  1Q7Y O;  1RTJ A;  5FRO A;  5LMN K;  3M6G A;  5LL6 Z;  3O3G A;  4M3X A;  3PY8 A;  4C8N A;  4K0K K;  3OTO K;  3AVG A;  4LH5 A;  1DTT A;  3IKM A;  4KB0 A;  1BQN A;  4CES A;  1GLA G;  2Q97 A;  4LF5 K;  4AHS A;  3LPU A;  4A2A A;  3BF3 A;  1EQY A;  4OX9 K;  1T6C A;  2HNY A;  3HP6 A;  4JRQ A;  4CEQ A;  4JD2 B;  3VGL A;  2A1S A;  2D1K A;  3UE5 A;  4Z4C A;  4YOY A;  1B92 A;  3LAN A;  3CFO A;  2HHX A;  1Y64 A;  3I0R A;  1HNV A;  1IKV A;  1BA1 A;  2VWK A;  3VGM A;  1TL3 A;  2FC0 A;  1TAQ A;  2OYQ A;  1FW6 A;  2YHW A;  3C6H A;  4CGH A;  4GV6 A;  3LDQ A;  2OZS A;  2ZJR L;  3GBT A;  1NK7 A;  1D8Y A;  4BRM A;  1X3N A;  2ZJP L;  2O8E B;  4C8L A;  3PLA A;  4YOX A;  3EL2 A;  2KLA A;  1X9W A;  3E9L A;  3H08 A;  4O44 A;  5I3U A;  5M1O A;  3M8S A;  1ZBU A;  3AVF A;  5HLF A;  3CMA N;  2D4W A;  4CED A;  1FKO A;  3SAH A;  3U4L A;  2AJQ A;  1C0T A;  3PIO L;  4N76 A;  3NH0 A;  2CGK A;  4FJK A;  4F8R A;  2G8I A;  1GLE G;  4JNE A;  4FM1 A;  5E26 A;  3B6O A;  2HB5 A;  2CH5 A;  3OS1 A;  4FLU A;  1MWK A;  1MWM A;  3NFA A;  3HJF A;  4DLG A;  4CGD A;  3ASM A;  3NH1 A;  1NK6 A;  2VQF K;  1S1U A;  4JKD A;  1DT9 A;  2IVN A;  3CJ1 A;  4XH1 A;  4W5Q A;  4DKW A;  4PL7 A;  4Z94 A;  4M3Y A;  4BQL A;  3LP3 A;  3NDK A;  1WAJ A;  4JAX A;  4W5N A;  4PWD A;  4CGJ A;  3LAM A;  4JN4 A;  3ATU A;  3KLE A;  1RTH A;  3ATV A;  4ISF A;  3G4S N;  2VYP A;  4HTL A;  3HK2 A;  3SUQ A;  2DPN A;  3S9H A;  4LY7 A;  3SYZ A;  4FZZ A;  1JLB A;  3V1O A;  2PFU A;  2YI1 A;  2BDP A;  1A5W A;  4X64 K;  3D0P A;  3BEX A;  1YJW N;  3VEO A;  4DSI A;  1HJO A;  3ZET B;  3ZSQ A;  3SZ2 A;  3O9T A;  4CF1 A;  2XY6 A;  4CZL A;  2UUB K;  2V51 B;  1BHL A;  3FR0 A;  3ULE B;  4DU4 A;  2ETJ A;  2YX6 A;  2E8A A;  4CHN A;  3OS2 A;  1C1A A;  3A5N C;  2B6A A;  4FCY A;  1ITG A;  5HBM A;  4CD1 A;  4IEI A;  1N8R O;  3HVT A;  1Z6R A;  1RCH A;  5FPN A;  5AZJ B;  4OLA A;  1U04 A;  2HHQ A;  5GIP A;  4CBX A;  4E3S A;  3B6P A;  3VTI A;  2WTU A;  1F21 A;  3L6Q A;  4JS4 A;  1HRH A;  4CBU A;  2A42 A;  5AJ3 K;  2YKN A;  2BAN A;  4IKF A;  1K8A O;  2FXU A;  3O3H A;  1ZBL A;  4LC9 B;  3SBG A;  1JCE A;  1XMO K;  2KZZ A;  1G99 A;  3K9J A;  1OH8 A;  3TTF A;  1HNZ K;  3I8B A;  1TUY A;  3V4I A;  4UY8 O;  2G8U A;  2H3G X;  3VQA A;  4DQ8 A;  3TR8 A;  3BP8 A;  3A8Y A;  1BQM A;  3H3N O;  1L3V A;  3OYH A;  2VG6 A;  2Q0R A;  4KTQ A;  3WXJ A;  4DR7 K;  3AVN A;  4B3R K;  3JXU A;  4IO8 A;  3VOV A;  5JS2 A;  4G9Z A;  1Q9X A;  2NZT A;  1NGJ A;  4FO0 A;  3VQC A;  2GWK A;  5GAH P;  3SJJ A;  1C0M A;  5LMU K;  4Z4G A;  4F9O A;  4A62 A;  1CZ9 A;  4FOE A;  1TAU A;  2KW4 A;  2E88 A;  4MLH A;  3VTH A;  4QS7 A;  1C6V A;  3DJC A;  3JYT A;  4Z4F A;  2P5O A;  1HQU A;  4EHT A;  3UIQ A;  1BI4 B;  4LSN A;  3CQX A;  2E5L K;  2PZS A;  2NUB A;  1S6P A;  1KRP A;  3TI0 A;  2HOE A;  1NK4 A;  1IKY A;  3K58 A;  1VQM N;  5M1N A;  5EU7 A;  1LAV A;  4K43 A;  1IBM K;  3KK3 A;  2VGN A;  3I33 A;  4JD2 A;  4LF7 K;  4WQ5 A;  3AO3 A;  2FBX A;  1YVN A;  1UWB A;  3KWG A;  1U48 A;  5FRN A;  5EXW A;  1WSJ A;  4DQS A;  1FXX A;  1A5X A;  1NGH A;  4J8F A;  4TSX A;  3EE9 A;  4A57 A;  2P9K B;  5AZI B;  4AQY K;  1VQ8 N;  4FJM A;  4FM0 A;  1L3S A;  4BGB A;  2Y1I A;  2O8E A;  1HUX A;  1SKS A;  2V7Z A;  3BGR A;  3OS0 A;  4N47 A;  1DEJ A;  2ZF5 O;  5C0Y A;  4BVP A;  3DMJ A;  4AHU A;  3VQE A;  1KXP A;  3OYD A;  4ZTJ A;  3S41 A;  3T1Y K;  4DV5 K;  1QQM A;  1BL3 A;  3A5M C;  4PKG A;  3VEY A;  4CER A;  2YKM A;  4BDY A;  4DSL A;  1KSP A;  3G10 A;  2WFB A;  1NOZ A;  2YHA A;  4IOX A;  4ILH A;  4FLX A;  3OBY A;  4IFY A;  4EAH D;  1NJZ A;  3KK2 A;  2ZGZ A;  1IKW A;  1BOT O;  4MLE A;  4CFB A;  2RN2 A;  5KPR A;  3V9S A;  3P5J A;  3VPZ A;  3ZT4 A;  4JK7 A;  2HNZ A;  3J81 O;  2NRT A;  5C10 A;  2HBJ A;  3T1A A;  1NM1 A;  3WT0 A;  2QKK A;  3HPH A;  3B8A X;  3QIC A;  1RDU A;  2Y1J A;  3JAM O;  4JI3 K;  4HCB A;  2WON A;  4DV3 K;  1R59 O;  5C15 A;  4H0X B;  2Z1G A;  1N36 K;  1QHA A;  1QVF M;  3TSP A;  3MN6 A;  1YJN N;  4WYB A;  3SUN A;  3CQY A;  3FFI A;  3ZLJ A;  4LF9 K;  2B5J A;  3CC4 N;  3AA2 A;  4YHH K;  3S3M A;  3BY5 A;  4A5A A;  3SV3 A;  3U3Y A;  1M90 O;  2ASP A;  4M7X A;  3C7N B;  2Z1I A;  4X66 K;  1HKB A;  3ZET A;  4E1J A;  3CD6 N;  2KQ2 A;  3SK3 A;  3OVN A;  5AQQ A;  3ULE A;  3OYM A;  2XHB A;  5C12 A;  1Q9Y A;  5AFU H;  2YJE A;  4DV2 K;  1T44 A;  3SMS A;  3V9X A;  4BWJ A;  2QWP A;  4DFK A;  4ISE A;  1Z26 A;  5AZJ A;  1OKJ A;  4W5R A;  3K5L A;  4FJ7 A;  3GE1 A;  1GLF O;  1WN7 A;  3R6M A;  5AQN A;  3E1Y A;  1YIT N;  3KHY A;  3P4I A;  1L5U A;  4QCL A;  4KFB A;  4JKB A;  1JLA A;  4R5P A;  1T7P A;  2KZM A;  1KVC A;  1NNE A;  4KHY A;  3ZSY A;  3W0L A;  1DLO A;  4WE1 A;  4CJE A;  4CEE A;  3LZI A;  1C1C A;  4CJF A;  3G6E N;  3KD5 E;  2UUA K;  4ICL A;  4FW2 A;  4GMJ B;  4A61 A;  3QEV A;  3RWU A;  3HP9 A;  4CZK A;  5JVG L;  2P1J A;  1VQ6 N;  1SZ2 A;  3IG1 A;  2P9I B;  4ELV A;  3U3G A;  3ID8 A;  1YTA A;  5DK5 A;  2KKZ A;  4C1N K;  2Z1H A;  4F4K A;  2YHX A;  1BI4 A;  3WXI A;  4B1W B;  1L3T A;  4GV3 A;  2FSN A;  4LFC K;  2E4L A;  1JLE A;  1NGC A;  4LH4 A;  2NLX A;  4H03 B;  4BC3 A;  4BRN A;  4CJW A;  4YOR A;  4DR3 K;  3SQ0 A;  3CHW A;  3QEP A;  1J5E K;  4ELU A;  4OO1 J;  1NJI O;  2UU9 K;  5JVH L;  5H1S Q;  3N4P A;  3VQD A;  4CVN E;  2O8D A;  3UB5 A;  4FJH A;  3TAB A;  3P83 D;  4BY9 C;  4GV9 A;  4IG0 A;  4HHT A;  5AZI A;  4E7H A;  4CJQ A;  4OJR A;  2JWL A;  1X9M A;  3M8P A;  1KC8 O;  1S3X A;  3EZ5 A;  4DR4 K;  4BR9 A;  4OKJ A;  3THY A;  3KK7 A;  4JI8 K;  2HMP A;  1NJY A;  4A5B A;  5FLX O;  5HRS A;  1K9M O;  2Q36 A;  4FK2 A;  3QET A;  4EZ6 A;  4FLW A;  3PO4 A;  3R1X A;  4CJS A;  4CK3 A;  2ITG A;  1K8K B;  1TKZ A;  3VQP A;  1HYZ A;  4QS8 A;  4F3O A;  4CEO A;  1P90 A;  5BPL A;  1SL0 A;  1RT2 A;  2I7N A;  3VQ5 A;  2YNI A;  2HHV A;  4LD0 A;  3F9K A;  4GKK K;  1HPZ A;  3WEE B;  4BRP A;  3SMP A;  1H1V A;  2EX3 A;  4IFE A;  4PA1 A;  2G8K A;  3AY9 A;  5EOY A;  1DKG D;  1VSH A;  4CZI A;  3DLL L;  5AQR A;  4BG8 A;  1ZBF A;  1D5A A;  2XY5 A;  3MDQ A;  4MQ3 A;  3WNF A;  5D3G A;  1BGX T;  1FK9 A;  3FZH A;  2OPR A;  3AV9 A;  4JI2 K;  4OPJ A;  4YFU A;  4XH5 A;  3MED A;  4BRL A;  3FGU A;  3L2V A;  3K2P A;  2VGM A;  4WFA L;  2FSK A;  4FLY A;  4FJL A;  5AR0 A;  1SS6 A;  1JXB A;  1TV6 A;  4FWO A;  4I6M B;  4KRF A;  3CJ9 A;  1LAW A;  4B9V A;  5J2N A;  2BTF A;  4OLB A;  1T3V A;  1I3A A;  3QBX A;  4V19 S;  3IS9 A;  2E2O A;  3C7N A;  2YHY A;  1K73 O;  3BUZ B;  3IDH A;  1IBK K;  4UQG A;  2F9T A;  2ZGY A;  3WNG A;  1VQK N;  1RT6 A;  4B08 A;  3V81 A;  1GLD G;  5ELZ A;  2I5J A;  1QQO A;  1Z05 A;  4B1V A;  3VF4 A;  4ID5 A;  3MXI A;  4BDZ A;  2EHG A;  3ULD A;  3MEE A;  4G1Q A;  4CJP A;  4CF9 A;  4F2S A;  3OW2 M;  4U7B A;  1Q18 A;  3ZSZ A;  4N56 A;  2ZD1 A;  4AHV A;  2ZE2 A;  1RT1 A;  3MMV A;  4LF8 K;  2NRW A;  2UYT A;  4E0D A;  4DTJ A;  2X6S A;  2KFZ A;  1NU0 A;  4Y1C A;  4O5F A;  3O4Q A;  3HVR A;  4DU1 A;  3RSE B;  2IOC A;  2X6N A;  1SV5 A;  4CJ5 A;  3RR8 A;  3LDO A;  4BRE A;  1VSM A;  3CCL N;  3ZEU B;  3SPY A;  3KD1 E;  1C0G A;  1C0F A;  4NYN A;  1SAZ A;  3DXK B;  1S1T A;  1RDC A;  4O5B A;  2HHW A;  3ZX0 A;  3O4W A;  2D0B A;  1XHZ A;  4E1N A;  3QIP A;  2HBL A;  3GOI A;  2FSJ A;  4PL8 A;  3SPZ A;  2E6M A;  4B1X B;  4JS5 A;  3QNO A;  4QS9 A;  2P9I A;  3LDN A;  5JS1 A;  1YUW A;  4I2P A;  5AQS A;  4ID1 A;  2BUP A;  3SQ2 A;  3H1V X;  4Z4H A;  3TAG A;  3PX0 A;  3ENH A;  3CXC M;  3HST B;  4K8Z A;  2W6L A;  3BDP A;  1N33 K;  5ADX A;  2HND A;  2PYL A;  4YOW A;  1JXE A;  3AGR A;  2OA8 A;  4AM7 A;  2HMI A;  5AQI A;  3HOT A;  4CZE A;  4DUY K;  2O8B B;  2E6L A;  3O3F A;  4KHP K;  1BIZ A;  1E3M A;  1NKE A;  3QER A;  1ASU A;  3ZX3 A;  3J7A P;  4J2D A;  2A3Z A;  4DR2 K;  1DTQ A;  2HF4 A;  2QM1 A;  4Q0B A;  3VA3 A;  1XNR K;  4YDU C;  4JYA K;  4PKI A;  2KFN A;  4CK1 A;  3NGZ A;  3OJS A;  2W41 A;  4ELT A;  5AQL A;  1NMD A;  4M3R A;  1RFQ A;  4KV8 A;  4DV1 K;  3GL1 A;  5M1F A;  4DS4 A;  4CEA A;  2ZWH A;  1WSG A;  4IDK A;  3O1W A;  4C23 A;  3TPQ A;  2JWK A;  3MX5 A;  5F2R A;  1IH7 A;  4XEI A;  1QQN A;  3HYF A;  3BF1 A;  4CHO A;  1K8K A;  5FDL A;  1ASV A;  1VQ7 N;  1QSS A;  3UKU A;  3MCA B;  2OTL N;  4CZH A;  1JKH A;  3S3O A;  3PIP L;  4FWS A;  5DM7 L;  4B9Q A;  3VET A;  1ESV A;  4BG9 A;  2W6K A;  3LWM A;  3JS6 A;  3CPE A;  4WFB L;  4FLV A;  3WEE A;  2IAJ A;  1RDB A;  3V9Z A;  4AHR A;  4CEF A;  3HO1 A;  1CXU A;  1X3M A;  3MCP A;  3FZK A;  1ZBI A;  3ID6 A;  4HWI A;  4DMN A;  3V6D A;  1WAF A;  3D2E A;  4BRF A;  5SWM A;  4U67 L;  3PO5 A;  5BPN A;  3HZ6 A;  4DSE A;  3P31 A;  4CGF A;  3MEG A;  1JL2 A;  1EX4 A;  4JHD B;  1NK9 A;  3TU5 A;  5HOO A;  1EP4 A;  4YOU A;  2IS3 A;  3CQ8 A;  3I0S A;  4E7K A;  4I6M A;  1OH7 A;  2DTU A;  3E01 A;  2IVP A;  3FZF A;  3G0Z A;  3Q7C A;  4E89 A;  1EKE A;  3CCR N;  4AH9 A;  3T69 A;  4KKO A;  5C25 A;  3NF7 A;  2GBZ A;  5KQ8 A;  4NCG A;  1LW2 A;  5JLH A;  1SQK A;  4CHY A;  3E9O A;  1VQP N;  1Q82 O;  2Q3S A;  4O55 A;  4K41 A;  5GIN A;  2A41 A;  4JLH A;  5CZ1 A;  1DGK N;  2YJF A;  4M63 C;  4M45 A;  1KD1 O;  3DLR A;  3PSI A;  2GEM A;  4B9M A;  3N4Q A;  1VQO N;  4DV0 K;  4WF9 L;  1WBD A;  4B1U B;  3KLI A;  1Q81 O;  1BCO A;  3CF5 L;  1S72 N;  3ENO A;  5AQU A;  4BC2 A;  3SV4 A;  5GAG P;  3QEW A;  4FM2 A;  1ATN A;  3SI6 A;  2O4I A;  1S22 A;  2ASM A;  2OCE A;  1VQ4 N;  4W5T A;  5DMR A;  1HR0 K;  1P8Z A;  1IO2 A;  4F2R A;  3EN9 A;  4OKE A;  4DV4 K;  4O0I A;  1KAX A;  2QWL A;  4BRQ A;  3JSM A;  3R8E A;  4Y1D A;  3NCI A;  2G8V A;  3L4Q A;  1EWQ A;  3ZEU A;  3AVM A;  2BGG A;  3DXK A;  1X1P A;  1EWR A;  1KTQ A;  3AAQ A;  3CFR A;  5KRT A;  4CE9 A;  4RW9 A;  3CIP A;  4CJR A;  4H0Y B;  1VQ9 N;  4ILG B;  3AVA A;  3RTV A;  1N6Q A;  3O9R A;  4FSV A;  3VQ9 A;  3ZSV A;  4KB1 A;  1OVY A;  4LSL A;  4H8K A;  1BCM A;  1S5J A;  4WFN L;  3THW B;  1R0A A;  1XWL A;  3DI6 A;  3QNN A;  3IMX A;  1U6Z A;  5AQK A;  2XO7 A;  4J2A A;  3KJV A;  3M3Z A;  4N41 A;  1KAY A;  3GG4 A;  4FL9 A;  2R7Y A;  3TAQ A;  3HXM A;  5AQW A;  1HMV A;  2E2P A;  5CE3 A;  2QWM A;  2O8B A;  3M8R A;  5JMV A;  3DRS A;  2QK9 A;  3RR7 A;  1TL1 A;  5KPT A;  3BZC A;  5BRD A;  3IRX A;  1WBB A;  1QVG M;  1VAZ A;  2Q1N A;  4DV7 K;  2Z1J A;  2D5R A;  3K57 A;  1IBL K;  2QWN A;  4JKE A;  3EO3 A;  3NGI A;  4E7J A;  2UXC K;  1VQ5 N;  4IXC A;  1TUU A;  3AO1 A;  1J5O A;  2NRV A;  3W3D A;  2D0O A;  4BRI A;  3L2Q A;  2A1R A;  3DRR A;  3M8Q A;  1QS4 A;  4JI7 K;  1KAZ A;  4DV6 K;  3NVK A;  1UAX A;  4M3W A;  1UA0 A;  3O08 A;  4FK0 A;  4NLB A;  5AQY A;  3NVM A;  4FZX C;  1IG8 A;  3KK1 A;  3AA3 A;  3NH2 A;  1NGF A;  1VRT A;  2CGJ A;  2P9L B;  1VSD A;  1RBR A;  2NRZ A;  2OPQ A;  3V1Q A;  3AVL A;  3V9W A;  3TAM A;  4FWL A;  4CI6 A;  5M1K A;  1XUP O;  3BZK A;  4E7I A;  4KO0 A;  4BRA A;  2HF3 A;  4N5S A;  1RT7 A;  2WOM A;  2FF3 B;  4JI0 K;  4FZY A;  5BR8 K;  3NAE A;  4JKF A;  3QO9 A;  1Q8I A;  3S3N A;  5M1P A;  3K0S A;  4EHU A;  3CM5 A;  4DSK A;  1NJW A;  2GUP A;  5CHI A;  3THV A;  1HNW K;  2A40 A;  2P9N B;  4CIG A;  1TK5 A;  4PKH A;  4BGA A;  2O4G A;  3EKU A;  1JCF A;  4IDH A;  4DG1 A;  4JHD A;  3AA4 A;  4DFJ A;  3RRH A;  4HVJ A;  3I55 N;  1ATS A;  3P38 A;  3CC7 N;  3LPT A;  2HBK A;  3OJU A;  5FRM A;  1VSE A;  3DLG A;  4M3Z A;  5KI6 A;  3WNE A;  1W7A A;  4KH5 A;  2HBM A;  2OPP A;  4CZF A;  1YVU A;  4B9S A;  1BIS A;  3NF8 A;  4KTZ A;  4CZM A;  3L2U A;  3ZT3 A;  4GY2 B;  2V7Y A;  2NRX A;  4O8K A;  3F5T A;  2DFE A;  3EY1 A;  1U45 A;  3DAW A;  1TK8 A;  4IOA L;  1NGI A;  1CZA N;  4M3U A;  3TAR A;  5T7B A;  4CJU A;  2HHT A;  3SBT A;  2X74 A;  2GTD A;  2YNG A;  3LM2 A;  3KIO A;  2IDO A;  3G25 A;  4HUE A;  3HM9 A;  1RNH A;  2F9W A;  2QWO A;  3AVK A;  1NGD A;  3OYA A;  1B9F A;  4HCC A;  4DHY A;  2QTD A;  3DM2 A;  4Q5V A;  4BRO A;  4JV5 K;  4LFA K;  1D4X A;  2FBY A;  4B8A B;  2HHH K;  4CJV A;  5HP1 A;  4CF2 A;  3LP0 A;  3K59 A;  1RTI A;  1KLM A;  4I7F A;  4H5R A;  4BWM A;  4I9Q A;  3C95 A;  3PSF A;  3ALY A;  2WC9 A;  5KRS A;  3THW A;  3V1R A;  1BDG A;  5I9E B;  1YAG A;  1REV A;  3DLK A;  3SJH A;  1TYQ B;  3AVI A;  3KLF A;  4DFP A;  4FYD A;  1IJJ A;  2HVI A;  3TTC A;  5GAD P;  5KPZ A;  4ZTF A;  3H46 O;  1M1K O;  3L3V A;  3O9S A;  1K6Y A;  4KHW A;  2OAN A;  1IG9 A;  1NK0 A;  2P5G A;  3T7Z A;  2XY7 A;  4FPB A;  4JKG B;  5DM6 L;  1NMN A;  2QI2 A;  2P9K A;  4IEE A;  3V9U A;  3QEX A;  2P9S B;  3FZM A;  3HL8 A;  4OGE A;  4EP4 A;  4CJT A;  4AHT A;  3ZT1 A;  3EKS A;  1RDD A;  5J2P A;  4NB4 A;  4FJI A;  2VQE K;  3QES A;  5JIC A;  3LL3 A;  3VQ4 A;  4BVO A;  3RMD A;  4XIU A;  2B4J A;  3KLG A;  5AQJ A;  4M42 A;  3A0I X;  1C1B A;  4BRC A;  3D7E O;  1SKR A;  2QW9 A;  5LJV A;  3O6W A;  5IT9 O;  3LP2 A;  2P9L A;  1D9F A;  2ITM A;  3ZSX A;  4DQP A;  3DLB A;  2Q2R A;  1XNQ K;  5TKY A;  3A5L C;  4JEP A;  4K25 A;  1BIU A;  1YTU A;  4CD3 A;  1E4G T;  5HRP A;  3G71 N;  5EX5 A;  4AHC A;  2D0A A;  1HKG A;  1SL2 A;  2UXD K;  1RT5 A;  4BRK A;  1S1X A;  4FVM A;  2OPS A;  4CJ3 A;  2GV9 A;  5GIO A;  3RMC A;  2YNH A;  3NE6 A;  5A2Q O;  1HYV A;  4BR0 A;  3OYC A;  2BH1 A;  3E66 A;  4JKH A;  2YV0 X;  5AQO A;  3VEV A;  2EWS A;  4CFC A;  2OZM A;  3AVH A;  1VQL N;  4FWP A;  4CW7 B;  3CM6 A;  4CHZ A;  4BAC A;  3I56 N;  3WQU A;  5CYM A;  1WNS A;  2RF2 A;  1QSL A;  5E41 A;  4CHQ A;  2HST A;  4O8U A;  5IWA K;  2LSN A;  2G8F A;  3SQ1 A;  2NNW A;  3OBW A;  1YI2 N;  2JGU A;  2YNF A;  4EP5 A;  3MN9 A;  4WQ5 C;  4CGI A;  3DYA A;  1J6Z A;  4H4M A;  1GOA A;  3MK6 A;  1TKX A;  3MWT A;  1KVA A;  3WXL A;  4ISG A;  3VEZ A;  3O8M A;  4BQZ A;  3CCJ N;  2RPI A;  1YF5 L;  3O5B A;  1JLC A;  3OYF A;  4DQQ A;  5BPM A;  1RDW X;  3A5O C;  1O1W A;  4DR1 K;  3KLH A;  1RGI A;  3TAP A;  4A59 A;  1U47 A;  3ZCM A;  1Q86 O;  3CCQ N;  5HRO A;  3AVC A;  3EYZ A;  3TSU A;  3LAL A;  3CYM A;  1NG9 A;  1JJ2 M;  1RBU A;  2E1Z A;  4FWK A;  4B3T K;  3C6T A;  2ATQ A;  4KH4 A;  4M7Y A;  1N32 K;  2AP1 A;  4B9L A;  4B3O A;  1V4T A;  3AO4 A;  1VRU A;  1ZYQ A;  2P51 A;  3K9K A;  1GLL O;  4MDA A;  3OYJ A;  3L2R A;  3TSQ A;  2QXL A;  4JKC A;  3J80 O;  1U4B A;  4W5O A;  5AQH A;  5AFU A;  4M3T A;  3QLH A;  4IG3 A;  4XH4 A;  1VK0 A;  5HL7 L;  4FWQ A;  1TYQ A;  2IC3 A;  3PX6 A;  2QKB A;  1LWF A;  1VHX A;  4FJ9 A;  3HOS A;  2F96 A;  1QZ6 A;  4H4O A;  1KFS A;  4CK2 A;  4PY5 A;  2E2N A;  1T6D A;  1JLF A;  1T03 A;  1QTM A;  3KZB A;  3VQQ A;  4DTM A;  2G8H A;  2FLO A;  3SAF A;  3HT3 A;  2FF6 A;  2Q0U A;  4JKG A;  4A2B A;  4BR4 A;  4CBW A;  4DQR A;  4X62 K;  2E1Y A;  4DTX A;  3LP1 A;  4CEZ A;  4CFD A;  2P9S A;  1HNI A;  5KQD A;  4J2B A;  3NF6 A;  3R9P A;  1QSY A;  4RW6 A;  4E1M A;  4IJA A;  1RBT A;  5HRN A;  3T1H K;  4FK4 A;  4QAG A;  1KQS M;  1FJG K;  3L3U A;  1T8E A;  2AA4 A;  4KH6 A;  4CHP A;  4DLE A;  3IUC A;  5B8H A;  5FPM A;  2PBD A;  4Y0W A;  4DTN A;  3DOL A;  2O8F B;  4CIE A;  5C2F A;  1W97 L;  3CCM N;  4NXN K;  1LWE A;  3AO2 A;  4PHT X;  1YT3 A;  4I9L A;  3KTQ A;  1WSH A;  2GUI A;  4BR7 A;  1HJR A;  1GLJ O;  3TWH A;  4FLZ A;  4B1Y B;  4DF8 A;  3ZX2 A;  4OPH A;  3J8A A;  5M1Q A;  4B1Z A;  2VG5 A;  5C42 A;  3FLC O;  1LOT B;  1ILY A;  4Z0U A;  1S9G A;  3VQ6 A;  3HTV A;  3D2F B;  1ASW A;  2YCH A;  4KTW A;  5C24 A;  3QEI A;  4MO5 A;  4DWI A;  2HVH A;  4FPA A;  2E20 A;  4C1N I;  1I39 A;  1LCU A;  3C0B A;  1SKW A;  3LM9 A;  3NF9 A;  1TKD A;  3P39 A;  4NXM K;  5FPD A;  4BRD A;  4MFB A;  4B8C A;  4RW4 A;  2UXB K;  3ZYY X;  4IZ9 A;  4I2Q A;  4H0V B;  1MDU B;  3E9P A;  3D6R A;  3WQT A;  4RG8 A;  1ZXO A;  4X65 K;  3H45 C;  4EFH A;  4CFA A;  4DUZ K;  1IV0 A;  4NO7 A;  5AQZ A;  2V52 B;  4YOV A;  3CER A;  2P9U B;  4C8O A;  3O80 A;  4DCH A;  4CF0 A;  1VSI A;  4H0T B;  3J7Y P;  1NGA A;  3PV8 A;  4B3M K;  1S9E A;  2F8S A;  2JLE A;  2PAV A;  4OGC A;  2O8C B;  4IWV A;  2UUC K;  4JKA A;  4O4G A;  3ITH A;  2E2Q A;  2WBN A;  3FE1 A;  3DWL A;  3QDK A;  1XC3 A;  2FBT A;  4ILJ A;  3AGK A;  3L4I A;  3CFP A;  4YY3 K;  1OH5 A;  1NWK A;  3RSE A;  3SUP A;  1W0H A;  2QXF A;  1OVQ A;  4RWT A;  4WQ4 C;  5TKW A;  1VQN N;  1E4F T;  4H5V A;  4FJG A;  3WNH A;  1BWF O;  4KRE A;  3CI5 A;  2A6A A;  3MXJ A;  3MAQ A;  4AIL C;  3K5N A;  3L2W A;  3TTD A;  3VQ7 A;  4E7L A;  5CZ2 A;  3CCS N;  2GWJ A;  3QIO A;  4BDP A;  3DOK A;  2HW3 A;  4H5T A;  4Z4I A;  1LW0 A;  1ZC6 A;  3OYI A;  5EY4 A;  1VSF A;  1RBV A;  4LF6 K;  1HQE A;  3O9Q A;  1XI1 A;  3OHR A;  3VMF B;  3DXM B;  5BRH A;  3VEX A;  5BRE A;  2OTJ N;  1NOY A;  5AQT A;  3AAR A;  3CJC A;  3LDP A;  4C8M A;  3CCU N;  1GLB G;  5SZT A;  2DFH A;  2P9P B;  4OPK A;  3LWL A;  4PUO A;  1WSI A;  4JK9 A;  4MDB A;  1V4S A;  4LFB K;  2DY4 A;  1GLC G;  2Q31 A;  3UKR B;  4PQU A;  3AO5 A;  4GW6 A;  3T19 A;  3RMA A;  4JI6 K;  4H0P A;  3F73 A;  4CCH A;  3TAE A;  4CEB A;  3LDL A;  4BR5 A;  3AVB A;  3VQ8 A;  3RRG A;  3EE8 A;  3KKR A;  4JRP A;  1YHQ N;  2PY5 A;  2XRI A;  3THX B;  3LZJ A;  3M5R A;  2O8D B;  4OKK A;  4DTU A;  4FWN A;  3DLE A;  1Y97 A;  4NYF A;  3AAP A;  4DU3 A;  1XMQ K;  2HHU A;  1BUP A;  3EEQ A;  2J4R A;  1LWC A;  3KVG A;  5F0X A;  1W9H A;  2O8F A;  3K5O A;  3FFK B;  2GX9 A;  4H5N A;  4KAZ A;  4KHU A;  3THY B;  3QB0 A;  3OYN A;  4DB3 A;  2XY8 A;  4DTO A;  3F9M A;  1CZB A;  3EZW A;  4FW1 A;  1HX1 A;  2I7P A;  1JCG A;  3MEC A;  1RIL A;  5AQP A;  4DF4 A;  3CJB A;  1RBS A;  2ZJQ L;  1ATR A;  3O9U A;  3D45 A;  4LF4 K;  2WUS A;  3C6A A;  4CJL A;  4GVE A;  3SCX A;  4CZJ A;  4FVU A;  1RTD A;  3IAY A;  4KI6 A;  3NBP A;  1D9D A;  1ZBH A;  4QOZ B;  2QWR A;  4DTP A;  4EZ9 A;  2RHK A;  4Z4E A;  1NGG A;  3I8D A;  3VES A;  4BC4 A;  3D2F A;  3QIN A;  2QWQ A;  2IVO A;  3ZSW A;  3CG7 A;  3FZL A;  2VG7 A;  3PUF A;  5K14 A;  4E19 A;  3CCE N;  1T05 A;  3CPW M;  4HTU A;  1TVR A;  1SUQ A;  1A5V A;  3QBW A;  5J2M A;  1WOQ A;  4DFM A;  3CC2 N;  2PYJ A;  4CJ4 A;  2VWB A;  4WCE L;  2D0C A;  3F2K A;  1YXQ A;  1W2B M;  3HPG A;  4R79 A;  4O0J A;  3MXM A;  2GEL A;  3QFP A;  3HRG A;  4GNI A;  4AM6 A;  4DSJ A;  1JLQ A;  3WXK A;  1TK0 A;  3C65 A;  1CLQ A;  1U2V B;  1XHX A;  4CIF A;  3VER A;  3SUO A;  4B9U A;  2P9U A;  1X9J A;  1EO1 A;  5AQX A;  2KHO A;  4BRH A;  4OVL A;  1G15 A;  2F4V K;  4YDU A;  1VSJ A;  3H6E A;  1YIJ N;  3VF6 A;  3MWP A;  4NCB A;  2F8T A;  2O8C A;  5CR4 A; 
#chains in the Genus database with same CATH homology
 2YHB A;  3NGZ A;  3OJS A;  2W42 A;  1HYV A;  1MU2 A;  3VQC A;  3OYC A;  1N5Y A;  4ELT A;  4M3R A;  1QE1 A;  1EET A;  3SJJ A;  4KV8 A;  1C0M A;  1LV5 A;  4Z4G A;  4DS4 A;  2YV0 X;  4CEA A;  1CZ9 A;  1EXQ A;  1TAU A;  2KW4 A;  1WSG A;  1Z25 A;  4CFC A;  4IDK A;  3AVH A;  2OZM A;  3T3F A;  1C6V A;  3JYT A;  4Z4F A;  2P5O A;  1HQU A;  3ZSO A;  3HPO A;  4DTS A;  1QHT A;  3DRP A;  3UIQ A;  1BI4 B;  3CM6 A;  4LSN A;  4CHZ A;  4BAC A;  2PZS A;  1IH7 A;  2NUB A;  1S6P A;  1KRP A;  3OYG A;  3HYF A;  5CYM A;  1WNS A;  2RF2 A;  4CHO A;  3TI0 A;  5J2Q A;  1QSL A;  5FDL A;  1ASV A;  1NK4 A;  5E41 A;  1IKY A;  4CHQ A;  3NHG A;  3K58 A;  1RT4 A;  3TAN A;  1QSS A;  2RKI A;  1LAV A;  5EU7 A;  1JKH A;  2LSN A;  3S3O A;  2G8F A;  2KTQ A;  3SQ1 A;  3P1G A;  3KK3 A;  2G8W A;  4KHS A;  5KTQ A;  3LWM A;  3AO3 A;  2FBX A;  1UWB A;  3OYE A;  1U48 A;  4FLV A;  5FRN A;  2JGU A;  2YNF A;  1WSJ A;  4DQS A;  2IAJ A;  1FXX A;  4EP5 A;  1RDB A;  1A5X A;  3V9Z A;  4AHR A;  4CEF A;  4CGI A;  3DYA A;  4H4M A;  3HO1 A;  1CXU A;  3VN5 A;  1GOA A;  1ZBI A;  4TSX A;  1TKX A;  1WLJ A;  1CXQ A;  4CGG A;  1KVA A;  4DMN A;  3V6D A;  1WAF A;  4FJM A;  4FJN A;  4FM0 A;  5SWM A;  1L3S A;  2X78 A;  2RPI A;  2Y1I A;  3ZSR A;  1SKS A;  1JLC A;  3BGR A;  3OYF A;  1S1W A;  1J54 A;  2FBV A;  3ZT2 A;  3OS0 A;  4DQQ A;  4N47 A;  3LAK A;  4DSE A;  4CGF A;  1O1W A;  3MEG A;  3DMJ A;  1JL2 A;  1EX4 A;  4AHU A;  4J2E A;  3KLH A;  3VQE A;  1B9D A;  3OYD A;  1NK9 A;  3TAP A;  4ZTJ A;  1U47 A;  3ZCM A;  1EP4 A;  4HUF A;  2IS3 A;  3AVC A;  3CQ8 A;  5HRO A;  3I0S A;  1BL3 A;  4E7K A;  1KLN A;  2DTU A;  4CER A;  3EYZ A;  2YKM A;  4BDY A;  1L3U A;  3E01 A;  3G0Z A;  1TKT A;  4E89 A;  2IGI A;  1EKE A;  4DSL A;  3LAL A;  4CEC A;  1KSP A;  3G10 A;  2VWJ A;  4AH9 A;  1NOZ A;  3CYM A;  1KFD A;  2YHA A;  4KKO A;  5C25 A;  1RBU A;  2GBZ A;  3NF7 A;  4NCG A;  1LW2 A;  1SL1 A;  4KI4 A;  4CHY A;  5I42 A;  3PX4 A;  4FLX A;  3C6T A;  2Q3S A;  2ATQ A;  4O55 A;  3KKS A;  3RMB A;  4IFY A;  3OYL A;  4B9L A;  4JLH A;  3U6F A;  5CZ1 A;  3TAF A;  1NJZ A;  4B3O A;  3KK2 A;  3AO4 A;  1VRU A;  1ZYQ A;  1KCF A;  4M45 A;  1IKW A;  1KVB A;  2P51 A;  4BE2 A;  3DLR A;  4CFB A;  2RN2 A;  3L2R A;  3OYJ A;  4B9M A;  3ISN C;  3P5J A;  3V9S A;  3OY9 A;  3ZT4 A;  5J1E A;  2HNZ A;  2ZQB A;  3T1A A;  1U4B A;  2QKK A;  4FJ8 A;  3KLI A;  4W5O A;  3HPH A;  1BCO A;  3NGY A;  2Y1J A;  1VSL A;  4FJ5 A;  3QLH A;  4M3T A;  3LDS A;  1C0U A;  4CJK A;  3SV4 A;  4IG3 A;  3AA5 X;  1VSK A;  3QEW A;  1VK0 A;  3A2F A;  3VQB A;  4FM2 A;  4HCB A;  3SI6 A;  2O4I A;  2WON A;  2IC3 A;  1TGO A;  1RDA A;  3PX6 A;  2QKB A;  2Z1G A;  1LWF A;  4K8X A;  4W5T A;  4FJ9 A;  2F96 A;  5DMR A;  4GVM A;  1U49 A;  1IO2 A;  4F2R A;  4H4O A;  3SUN A;  1KFS A;  3FFI A;  4OKE A;  4CK2 A;  4PY5 A;  4O0I A;  2B5J A;  1NK8 A;  1JL1 A;  1S1V A;  1JLF A;  3C94 A;  3JSM A;  1T03 A;  3AA2 A;  3S3M A;  2G8V A;  4Y1D A;  3NCI A;  4BE0 A;  1QTM A;  4M41 A;  3SV3 A;  3U3Y A;  4L8R B;  3AVM A;  3VQQ A;  4DTM A;  1J9A A;  2BGG A;  3C6U A;  2G8H A;  4B9T A;  1X1P A;  3HT3 A;  1HYS A;  2Z1I A;  4DQR A;  1KTQ A;  5CY4 A;  3CFR A;  5KRT A;  4DTX A;  3LP1 A;  4CE9 A;  2KQ2 A;  4FLT A;  4CEZ A;  3OVN A;  4CFD A;  4RW9 A;  4CJR A;  1NJX A;  1HNI A;  3OYM A;  2XHB A;  4J2B A;  4BE1 A;  3NF6 A;  4RW8 A;  1Q9Y A;  1QSY A;  4RW6 A;  4E1M A;  3SQ4 A;  1RBT A;  5HRN A;  4IBN A;  4FK4 A;  3AVA A;  3RTV A;  1N6Q A;  4QAG A;  3V9X A;  4B9N A;  4KPY A;  4BWJ A;  4DFK A;  3L3U A;  3VQ9 A;  2HHS A;  4DS5 A;  4NCA A;  1QQC A;  3ZSV A;  3OYB A;  1T8E A;  2DFF A;  4KB1 A;  1Z26 A;  1GOC A;  4LSL A;  4H8K A;  4FJX A;  1BCM A;  1S5J A;  4CHP A;  4DLE A;  1R0A A;  4W5R A;  1XWL A;  3K5L A;  3DI6 A;  3QNN A;  5CYQ A;  4FJ7 A;  4DTN A;  5KGW A;  3DOL A;  4FXD A;  2XO7 A;  4J2A A;  1WN7 A;  4CIE A;  3KJV A;  4N41 A;  2R7Y A;  3TAQ A;  1LWE A;  1NKB A;  4CF8 A;  4FJJ A;  3AO2 A;  3HXM A;  1L5U A;  4HUG A;  4DQI A;  1HMV A;  4QCL A;  4KFB A;  1YT3 A;  4I9L A;  1JLA A;  4R5P A;  3KTQ A;  1WSH A;  2GUI A;  3M8R A;  1HJR A;  1T7P A;  2KZM A;  1KVC A;  4KHY A;  3DRS A;  2QK9 A;  3RR7 A;  4RW7 A;  3TWH A;  1FKP A;  1TL1 A;  3ZSY A;  4FLZ A;  4KHQ A;  3IRX A;  4ZHR A;  1UOC A;  5KGX A;  1DLO A;  4WE1 A;  4CJE A;  4DF8 A;  4CEE A;  3LZI A;  1C1C A;  4CJF A;  2Z1J A;  3KD5 E;  2D5R A;  3K57 A;  2VG5 A;  5C42 A;  4ICL A;  4FW2 A;  4E7J A;  3NGI A;  4Z0U A;  4GMJ B;  4DSF A;  1S9G A;  3QEV A;  3DLH A;  3RWU A;  3VQ6 A;  3HP9 A;  3K5M A;  1UA1 A;  3AO1 A;  2P1J A;  1J5O A;  1ASW A;  1XC9 A;  5HRR A;  3L2Q A;  4KTW A;  2A1R A;  3PO5 A;  3DRR A;  1WSE A;  3M8Q A;  5C24 A;  3QEI A;  3IG1 A;  1QS4 A;  4DWI A;  2HVH A;  4ELV A;  3U3G A;  1J53 A;  1IKX A;  1YTA A;  5DK5 A;  1UAX A;  4M3W A;  1UA0 A;  1NKC A;  1I39 A;  4FK0 A;  2Z1H A;  1SKW A;  4F4K A;  3NF9 A;  1JLG A;  1TKD A;  1BI4 A;  4C8K A;  4FZX C;  1L3T A;  3ZT0 A;  3KK1 A;  3AA3 A;  4MFB A;  3NH2 A;  4KHN A;  1VRT A;  4B8C A;  3O4N A;  4RW4 A;  4I2Q A;  3AVJ A;  2E4L A;  1JLE A;  1VSD A;  4LH4 A;  1RBR A;  4RG8 A;  2OPQ A;  3V1Q A;  3AVL A;  4CJW A;  3L8B A;  3V9W A;  3TAM A;  3SQ0 A;  1GOB A;  1WSF A;  4E7I A;  4CFA A;  3QEP A;  4KO0 A;  4ELU A;  2BE2 A;  4N5S A;  1RT7 A;  2WOM A;  3VA0 A;  4FZY A;  3SNN A;  4IFV A;  1S6Q A;  3NAE A;  4C8O A;  3VQD A;  4CF0 A;  1VSI A;  3QO9 A;  4FJH A;  1Q8I A;  4F3T A;  4DTR A;  3S3N A;  3CM5 A;  3PV8 A;  1X9S A;  4YNQ A;  3TAB A;  1NJW A;  3P83 D;  4DSK A;  1RT3 A;  1S9E A;  4IG0 A;  4HHT A;  3THV A;  3OYK A;  2F8S A;  2JLE A;  4CJQ A;  4E7H A;  4OJR A;  4OGC A;  4CIG A;  1TK5 A;  1NK5 A;  1X9M A;  3M8P A;  4O4G A;  3ITH A;  3EZ5 A;  1RTJ A;  2O4G A;  5FRO A;  3O3G A;  4M3X A;  4OKJ A;  3PY8 A;  2FBT A;  4C8N A;  1NJY A;  4DG1 A;  3CFP A;  3AA4 A;  4DFJ A;  3AVG A;  5HRS A;  4LH5 A;  1DTT A;  3RRH A;  4HVJ A;  4KB0 A;  3SUP A;  1BQN A;  4CES A;  4FK2 A;  3QET A;  1W0H A;  4EZ6 A;  2QXF A;  4FLW A;  3LPT A;  3PO4 A;  3OJU A;  4CJS A;  4AHS A;  4CK3 A;  5FRM A;  2ITG A;  4FJG A;  3WNH A;  3LPU A;  4KRE A;  1VSE A;  1TKZ A;  3DLG A;  4M3Z A;  3VQP A;  3MAQ A;  3MXJ A;  1HYZ A;  5KI6 A;  3WNE A;  4AIL C;  3K5N A;  4F3O A;  2HNY A;  3L2W A;  4CEO A;  3HP6 A;  4JRQ A;  1SL0 A;  2OPP A;  1YVU A;  3VQ7 A;  4B9S A;  1RT2 A;  1BIS A;  4E7L A;  5CZ2 A;  4CEQ A;  3NF8 A;  2A1S A;  4KTZ A;  3VQ5 A;  2YNI A;  3QIO A;  4Z4C A;  3L2U A;  4BDP A;  2HHV A;  3ZT3 A;  4LD0 A;  3F9K A;  3DOK A;  2HW3 A;  1B92 A;  3LAN A;  4Z4I A;  1HPZ A;  1LW0 A;  3CFO A;  2HHX A;  4PA1 A;  2EX3 A;  3OYI A;  2G8K A;  3I0R A;  1VSF A;  2DFE A;  1HNV A;  1IKV A;  1VSH A;  1RBV A;  3EY1 A;  1U45 A;  2VWK A;  1TK8 A;  1HQE A;  1XI1 A;  1ZBF A;  1TL3 A;  2FC0 A;  1TAQ A;  2OYQ A;  4CGH A;  1D5A A;  2XY5 A;  2OZS A;  4M3U A;  3TAR A;  5T7B A;  4CJU A;  2HHT A;  1NK7 A;  4MQ3 A;  2X74 A;  3WNF A;  1D8Y A;  5D3G A;  1BGX T;  1FK9 A;  2OPR A;  3AV9 A;  1NOY A;  4C8L A;  4OPJ A;  4YFU A;  2YNG A;  3MED A;  3KIO A;  2IDO A;  3L2V A;  4HUE A;  3HM9 A;  3K2P A;  1RNH A;  1X9W A;  3H08 A;  3AVK A;  4O44 A;  4C8M A;  5SZT A;  4FLY A;  5I3U A;  4FJL A;  2DFH A;  4OPK A;  1JXB A;  1TV6 A;  1B9F A;  3OYA A;  3M8S A;  3LWL A;  4HCC A;  1ZBU A;  3AVF A;  4KRF A;  5HLF A;  1WSI A;  3DM2 A;  4PUO A;  1LAW A;  4B9V A;  5J2N A;  4OLB A;  4Q5V A;  1I3A A;  1FKO A;  4CED A;  2AJQ A;  2FBY A;  1C0T A;  3IS9 A;  4B8A B;  2DY4 A;  4PQU A;  4CJV A;  4N76 A;  3NH0 A;  5HP1 A;  4FJK A;  4F8R A;  2G8I A;  4CF2 A;  3AO5 A;  3LP0 A;  4GW6 A;  3T19 A;  3RMA A;  4UQG A;  3WNG A;  4FM1 A;  3B6O A;  3F73 A;  4CCH A;  3K59 A;  1RT6 A;  2HB5 A;  3TAE A;  1RTI A;  1KLM A;  4I7F A;  4B08 A;  4CEB A;  3V81 A;  3AVB A;  4BWM A;  3VQ8 A;  2I5J A;  3OS1 A;  3RRG A;  3KKR A;  4I9Q A;  3C95 A;  4JRP A;  4FLU A;  2PY5 A;  2XRI A;  3LZJ A;  4ID5 A;  3NFA A;  4OKK A;  3MXI A;  3HJF A;  4DTU A;  4BDZ A;  2EHG A;  3ULD A;  3MEE A;  4G1Q A;  3DLE A;  1Y97 A;  3ASM A;  4CGD A;  4CJP A;  4CF9 A;  3NH1 A;  4DLG A;  4NYF A;  1NK6 A;  3ALY A;  4F2S A;  5KRS A;  1S1U A;  3V1R A;  4DU3 A;  1REV A;  2HHU A;  3DLK A;  4W5Q A;  3ZSZ A;  4N56 A;  1LWC A;  2ZD1 A;  1W9H A;  4M3Y A;  3AVI A;  4AHV A;  2ZE2 A;  3KLF A;  2KFN A;  1RT1 A;  3LP3 A;  3K5O A;  3NDK A;  1WAJ A;  4DFP A;  4E0D A;  4PWD A;  4KAZ A;  4FYD A;  4W5N A;  4CGJ A;  3LAM A;  4DTJ A;  4KHU A;  2HVI A;  2X6S A;  2KFZ A;  4ZTF A;  3OYN A;  4Y1C A;  3HVR A;  3O4Q A;  1RTH A;  3KLE A;  2XY8 A;  4DTO A;  4DU1 A;  1CZB A;  3L3V A;  2IOC A;  2X6N A;  4FW1 A;  1SV5 A;  4CJ5 A;  1K6Y A;  4KHW A;  3MEC A;  3RR8 A;  3SUQ A;  3HK2 A;  1RIL A;  1VSM A;  4LY7 A;  3S9H A;  3SYZ A;  1IG9 A;  3SPY A;  4DF4 A;  1NK0 A;  4FZZ A;  3KD1 E;  1JLB A;  1RBS A;  2P5G A;  4NYN A;  3D45 A;  2XY7 A;  1S1T A;  1RDC A;  3V1O A;  4O5B A;  2BDP A;  2HHW A;  1A5W A;  4CJL A;  3SCX A;  3D0P A;  4DSI A;  2D0B A;  1XHZ A;  1RTD A;  3ZSQ A;  3SZ2 A;  3IAY A;  4E1N A;  4CF1 A;  2XY6 A;  4KI6 A;  3NBP A;  1D9D A;  1ZBH A;  3V9U A;  3QIP A;  3QEX A;  1BHL A;  4DTP A;  4QOZ B;  4EZ9 A;  4DU4 A;  2ETJ A;  4Z4E A;  4CHN A;  3OS2 A;  3I8D A;  1C1A A;  3SPZ A;  3HL8 A;  2B6A A;  2E6M A;  3QIN A;  4OGE A;  4CJT A;  4EP4 A;  4FCY A;  1ITG A;  5HBM A;  4AHT A;  4JS5 A;  3ZT1 A;  3QNO A;  3HVT A;  1RDD A;  5J2P A;  1RCH A;  5JS1 A;  4I2P A;  3ZSW A;  4OLA A;  1U04 A;  3CG7 A;  4FJI A;  2HHQ A;  4ID1 A;  3QES A;  2VG7 A;  3SQ2 A;  3PUF A;  3B6P A;  5K14 A;  4E19 A;  1F21 A;  3VQ4 A;  4Z4H A;  4E3S A;  3TAG A;  4JS4 A;  3PX0 A;  3RMD A;  4XIU A;  2B4J A;  1HRH A;  3KLG A;  1T05 A;  4M42 A;  4HTU A;  4K8Z A;  1C1B A;  3HST B;  1TVR A;  1SUQ A;  1A5V A;  5J2M A;  3BDP A;  1SKR A;  4DFM A;  2YKN A;  2BAN A;  2PYJ A;  4IKF A;  4CJ4 A;  3O3H A;  1ZBL A;  2HND A;  2D0C A;  2PYL A;  3LP2 A;  1JXE A;  1D9F A;  2OA8 A;  3HPG A;  2KZZ A;  4O0J A;  3ZSX A;  3MXM A;  2HMI A;  4DQP A;  2E6L A;  3DLB A;  3O3F A;  4DSJ A;  1JLQ A;  1BIZ A;  1BIU A;  3V4I A;  3QER A;  1TK0 A;  1NKE A;  1ASU A;  1YTU A;  1CLQ A;  5HRP A;  1XHX A;  4CIF A;  2G8U A;  3SUO A;  4B9U A;  3VQA A;  4AHC A;  4J2D A;  3TR8 A;  2D0A A;  1SL2 A;  1BQM A;  1RT5 A;  1L3V A;  1DTQ A;  4OVL A;  1G15 A;  3OYH A;  4Q0B A;  2VG6 A;  4KTQ A;  1VSJ A;  3VA3 A;  1S1X A;  3AVN A;  2OPS A;  4FVM A;  4CJ3 A;  2GV9 A;  4NCB A;  3RMC A;  2F8T A;  2YNH A;  5JS2 A;  3NE6 A;  1Q9X A;  4CK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...