4KTZA

Lactococcus phage 67 ruvc
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
160
structure length
160
Chain Sequence
MKKILAINFSTASKKGEGTGYAFRKDGQVYVGSIKAYNPKKTAWERTFDIVNAIKDIIDEFDLKGYHLAIETPIMGRNRKHSITLANCNGYFIGAIDGLVNGYTFIDNSKWCSYHLISGKREQRKEESLELLKATGLVDSNCKDDNIADAYNILTYCEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RuvC endonuclease
publication title Mutants of phage bIL67 RuvC with enhanced Holliday junction binding selectivity and resolution symmetry.
pubmed doi rcsb
source organism Lactococcus phage bil67
molecule tags Hydrolase
total genus 57
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07066 DUF3882 Lactococcus phage M3 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ktzA00
2OPRA 3VQ7A 3VQ5A 5CY4A 1O1WA 2KQ2A 3VN5A 3LP1A 4YNQA 2A1RA 4J2AA 3K5OA 4CJWA 4C8OA 1TK8A 2Z1IA 3BGRA 4KHQA 2E4LA 2P5GA 4NCGA 1HRHA 1TGOA 1VSFA 3V1OA 3ZSYA 2RKIA 4O0IA 3EZ5A 2HB5A 1JL1A 4O55A 2B4JA 3ZSOA 1RTHA 4Z4HA 4Z4CA 3OYIA 3T1AA 3AO5A 4DTJA 4M41A 3V9UA 2YHBA 3TAGA 4M45A 4FYDA 3OJUA 1JLAA 3NGIA 3S3NA 4BDPA 2WOMA 3QEPA 4KHSA 2A1SA 1LW2A 3WNFA 3NF7A 3LAMA 3O3FA 1NK0A 3E01A 1TKDA 3AVKA 4B9MA 2P5OA 1WAFA 2KFZA 1S1XA 3WNGA 4CK3A 2X74A 4B8CA 3M8SA 1N6QA 3RWUA 1KLNA 3OYEA 3D0PA 5JS1A 2ZE2A 4PA1A 4FM1A 5E41A 4QAGA 3LWLA 3AVMA 4CEQA 3T19A 4LSLA 2IOCA 2YKMA 3AVBA 3CQ8A 1A5WA 3G0ZA 3IG1A 4O5BA 3KLGA 4DTXA 2G8KA 4B9LA 2HMIA 1S1UA 1BCOA 3VQ6A 4CIEA 3RRHA 1BL3A 3DOKA 1RT2A 1KFDA 3PO5A 4Q5VA 4OGEA 3P83D 3L2WA 4FLTA 1BI4A 2OPPA 3SJJA 4AHRA 2PYJA 4N76A 4KHYA 2ITGA 3SYZA 3KKSA 4CK2A 3NH2A 1K6YA 2O4GA 3LALA 4AHCA 1LV5A 3I8DA 3OS0A 1WSJA 4OLAA 3HO1A 3ZSWA 4CF8A 3DLEA 4F2RA 1FKOA 3S3OA 3SUNA 4RW9A 4LH5A 1W0HA 4DSIA 3O4NA 1YVUA 3OJSA 4HCCA 3NBPA 2OA8A 1KVAA 4CEDA 1BQNA 3CM6A 4IG3A 3NH1A 4DMNA 4Z4FA 1TKXA 1RILA 4FJ5A 4CF9A 4B3OA 1RDAA 4M3ZA 4I7FA 2HHVA 2DFEA 4ZHRA 4RW7A 1KLMA 5KRTA 3TAPA 4RW8A 2HVIA 4HUGA 3ALYA 4M3YA 2VWKA 4CJSA 3ZT2A 4OKKA 3DM2A 1RBRA 5C24A 3L2QA 2BDPA 1BGXT 1S5JA 2G8VA 3SQ0A 2HW3A 3AA2A 3AV9A 3HVTA 4GW6A 3AVHA 2YHAA 4KTZA 3F9KA 3OYLA 3DRSA 3LANA 2XO7A 1DLOA 3NGZA 3C6TA 3TI0A 4M3TA 4CGDA 3HP6A 4FLXA 1HYSA 1JL2A 1NKEA 3FFIA 4AILC 3NF9A 1MU2A 3LP2A 2VG6A 3THVA 2RPIA 1ZBHA 4BE1A 4FJMA 4DFMA 4DU4A 3LDSA 3A2FA 4FCYA 5KTQA 3PO4A 4FJJA 3ZT3A 3SQ2A 2ZD1A 3TAEA 1QQCA 4CGIA 3DI6A 1U49A 3PX0A 3PY8A 3AA3A 5KI6A 1RDCA 4N56A 4CF1A 1XHZA 3C6UA 4PQUA 3DLRA 4CFBA 1IG9A 4ELUA 4RG8A 4E7HA 4CERA 4FLZA 1JLEA 3LPUA 3SV3A 1IKYA 4C8KA 3BDPA 4FK0A 1Q8IA 1HJRA 4JS5A 4DSLA 4CHOA 4CECA 3KIOA 2IAJA 3P1GA 2IGIA 3MEDA 1SL2A 1A5XA 2FBVA 3PX4A 4AHTA 2G8UA 3C95A 1G15A 3AA4A 3MEGA 4M3RA 3OYDA 3RR7A 4CEEA 4QCLA 3L2RA 3KLHA 4F8RA 1RBUA 3I0RA 4HCBA 2QKBA 1UAXA 2HHWA 4UQGA 3LWMA 3KK2A 4AH9A 2HVHA 1WNSA 2HHQA 3LAKA 4KKOA 4FLVA 3RMAA 2HHSA 2HNDA 3NCIA 1RDBA 3TAMA 1RT1A 4FW1A 1RTDA 2KFNA 1TKZA 2B5JA 4CEAA 1WSEA 4FZZA 4M3XA 4DQRA 4CFCA 3V9ZA 1JKHA 1U4BA 1YTAA 3V9XA 1Q9XA 1LWCA 4KHNA 3UIQA 4LSNA 4FJXA 4PY5A 4DQSA 2GV9A 2XRIA 5KRSA 2R7YA 2G8FA 3IS9A 1L3SA 2B6AA 3OYNA 4JRPA 2Q3SA 4BE2A 1VRTA 2Y1IA 1IKXA 5JS2A 3LP0A 1HQUA 2VG7A 4F4KA 4FJIA 4HUEA 4DF8A 4MQ3A 3ZSZA 2RN2A 2EX3A 3ZSXA 1RT7A 3VQ4A 4KHUA 3VQQA 1RBTA 4CGHA 1WLJA 5FROA 3V4IA 1S9EA 1NKCA 4FW2A 1Y97A 4M3WA 1C1BA 1TV6A 4N41A 4F3OA 1SUQA 2OZMA 4DG1A 4IBNA 1TK0A 3NF6A 1NK5A 1BI4B 3ZT0A 2OYQA 1JLGA 3SQ1A 1HNVA 4Z0UA 1GOBA 3OS2A 4C8LA 1JLBA 1S1TA 2E6MA 4IFYA 1TVRA 4DLGA 1EXQA 3ZCMA 4DU1A 4KB1A 3VQEA 4FLYA 2X6SA 1SKRA 3NAEA 3WNEA 4KRFA 3DMJA 3L3UA 1VSMA 4I9QA 1IH7A 3AVGA 1RDDA 2HNZA 4DTNA 1F21A 4AHUA 3VQDA 1LW0A 5DMRA 1VSJA 3VQ8A 4FZXC 1UA1A 4B08A 5I42A 1T05A 4B9SA 3DRPA 4NYFA 3B6OA 3HP9A 2NUBA 3L2VA 2EHGA 4J2DA 4I9LA 1BHLA 3NE6A 1JLCA 1RT4A 1WN7A 3S3MA 1WSGA 3DRRA 1YT3A 3NHGA 3SUOA 3SCXA 4E7IA 4OPJA 1C1AA 2KW4A 2Z1JA 3AVLA 1W9HA 4HVJA 1XI1A 4FJLA 4L8RB 2F8TA 4FJHA 4EP5A 3K59A 4FJ8A 4IFVA 1ASUA 3NGYA 1SKSA 4FVMA 2D0AA 4KTWA 4TSXA 5HRPA 4DTUA 3EYZA 2FBTA 4CFAA 4KB0A 4K8XA 3RTVA 2IS3A 4K8ZA 3L3VA 4O44A 1A5VA 2QXFA 2ATQA 4DSEA 1ZBUA 3SZ2A 4EZ6A 4F2SA 4DF4A 4ELTA 4E7JA 3L8BA 2QK9A 2ZQBA 4W5RA 1J5OA 3OYFA 3HM9A 4DQQA 1GOCA 2DFHA 3HPOA 4DTMA 3T3FA 1B92A 1NJWA 5FRMA 5DK5A 1RT5A 3QLHA 4CGFA 3V1QA 3OYBA 4CEOA 2XY6A 3K5MA 3SPYA 3RRGA 4Z4IA 3OYAA 2XHBA 4B9NA 1U45A 1KVCA 4H4OA 1FK9A 4G1QA 2XY5A 3CYMA 1NOZA 1JXBA 2G8HA 1KCFA 3M8RA 3EY1A 3HJFA 1S6QA 3C94A 4CJ4A 2AJQA 1X1PA 1VSEA 1D5AA 1IO2A 3CM5A 3OYGA 3QEIA 4EZ9A 3CFRA 1QTMA 3ZT1A 4I2QA 4MFBA 4GVMA 4AHSA 2G8IA 3V81A 1QSYA 1JLQA 3KK3A 5CYQA 5HRSA 1TAQA 4KFBA 4N5SA 3DOLA 2IC3A 3RMDA 1S6PA 1RBVA 1LWFA 3G10A 4CJKA 1EETA 3QNOA 3QESA 4B9UA 1WAJA 4N47A 4DLEA 1SL0A 3AA5X 2Z1GA 5C42A 4J2EA 3U3GA 4E1NA 5CZ1A 1U04A 5KGWA 4CGJA 3MAQA 3QERA 3SV4A 4FJ9A 4Z4EA 3QINA 1VSKA 4CIFA 3MXMA 4FLWA 3F73A 3U3YA 1WSIA 1J53A 2F96A 1UWBA 3VQAA 3NFAA 2VWJA 5HP1A 1C0TA 1EP4A 1I39A 4LY7A 4DQIA 1NK6A 4FJ7A 1LAWA 2GBZA 2YV0X 3B6PA 1NJYA 4KPYA 4E7LA 3RMBA 4OJRA 5FDLA 3KTQA 2WONA 3P5JA 1KSPA 4OKJA 4DWIA 4LH4A 3DLKA 3TANA 3LP3A 3RMCA 1ZYQA 1X9MA 1L3TA 4FLUA 4KI6A 4CJQA 4OPKA 4CEBA 4DSKA 4DTRA 3ASMA 1FXXA 4E1MA 3ZSRA 3VA0A 2RF2A 3AVNA 1ASWA 1JXEA 5J1EA 3JYTA 3TAFA 4KAZA 2HHXA 1HNIA 1EX4A 4CHPA 1VK0A 3ISNC 2OZSA 2FBYA 3DLGA 3D45A 4FJGA 4NCAA 2KTQA 2DY4A 2O4IA 3HYFA 4NCBA 3KD5E 1LAVA 1TL1A 4ICLA 1TK5A 2QKKA 4ZTFA 1NK7A 3DYAA 3O3GA 1GOAA 1RNHA 1RBSA 4O0JA 2I5JA 4CJFA 4DS4A 3PX6A 4CJVA 3SPZA 4PUOA 4CJPA 3OY9A 3DLBA 3VQBA 4BWJA 1QS4A 3OYHA 4IG0A 4KI4A 5D3GA 1L5UA 2YNFA 4B9TA 5J2QA 2YNHA 1B9FA 1FKPA 1RT6A 1KVBA 3NH0A 3QIPA 2ETJA 2DFFA 1SV5A 3V1RA 3V9WA 3VA3A 1B9DA 4IDKA 4R5PA 1HQEA 4CJTA 1IKVA 1KTQA 1QE1A 2OPQA 3M8QA 3KLFA 1ZBLA 1X9SA 3OYMA 3WNHA 5HBMA 4ELVA 4O4GA 4B9VA 3TWHA 2W42A 3KJVA 1QSSA 4YFUA 3HXMA 5I3UA 1C0MA 1J9AA 3OYJA 3QO9A 1XHXA 4LD0A 3AO3A 1T7PA 4E3SA 4CJ5A 1RTJA 3KKRA 3PUFA 1ITGA 1VSDA 1T8EA 4CHQA 4DSFA 5HLFA 1U47A 4CCHA 4RW6A 3K58A 1C1CA 3M8PA 4Z4GA 1NKBA 1NK9A 1DTTA 4Y1CA 3OS1A 1DTQA 2D0CA 2FC0A 2P51A 3CFPA 4FK4A 1YTUA 4ZTJA 4E89A 3OYCA 3OYKA 4HUFA 3VQPA 3AVAA 1NK8A 4DFKA 1SKWA 2Y1JA 1N5YA 3HK2A 4DTOA 3O4QA 3NDKA 3LZJA 2X6NA 4OVLA 3ZT4A 4CJUA 4FXDA 2KZMA 3KLEA 3U6FA 1JLFA 3AVJA 4CESA 4CHYA 1S9GA 4OGCA 3MXIA 2VG5A 5CZ2A 3MXJA 3QEWA 3DLHA 4CIGA 4Q0BA 5K14A 3K5LA 4Y1DA 3KD1E 4JRQA 4W5OA 3K2PA 1CZBA 2XY8A 3SUPA 4XIUA 1SL1A 4J2BA 1KFSA 4M42A 1ZBIA 4CJEA 1WSFA 4BE0A 1RCHA 4FZYA 2D5RA 1BISA 2LSNA 3LZIA 4C8NA 4W5NA 2BE2A 1I3AA 3SI6A 5HRRA 4CE9A 1C0UA 4H8KA 3LPTA 4CF2A 4FJNA 3NF8A 4KO0A 4AHVA 5HRNA 3HT3A 3I0SA 5J2MA 2HNYA 3V6DA 3MEEA 5SZTA 3ZSVA 1BIZA 3SNNA 3ITHA 3ZSQA 1VSLA 3KLIA 4FM2A 1S1VA 2JGUA 5EU7A 4CHZA 1TKTA 1NJZA 2PZSA 4CK1A 4DFJA 5KGXA 2F8SA 1D8YA 4DFPA 4CHNA 3HPHA 1L3VA 4M3UA 4QOZB 1D9FA 4CEFA 1J54A 3JSMA 4JLHA 2FBXA 4KREA 1XC9A 4ID5A 3TARA 1IKWA 4HHTA 3O3HA 4I2PA 4CFDA 1BCMA 1ZBFA 3VQ9A 4B8AB 4RW4A 3AO4A 3H08A 1ASVA 4BDYA 2G8WA 1HMVA 1C6VA 3HSTB 1U48A 3SQ4A 1NJXA 2YNGA 1S1WA 3AO1A 5J2NA 3RR8A 1Q9YA 4DSJA 4KV8A 5J2PA 3K5NA 4E0DA 1BIUA 4KHWA 3TR8A 2IDOA 5SWMA 2KZZA 2PYLA 3PV8A 1UA0A 1CXUA 1RT3A 3TABA 5HROA 1WSHA 2X78A 2P1JA 3IRXA 2JLEA 3V9SA 4W5TA 1D9DA 3AVFA 4CJ3A 4FM0A 4DTPA 3QEVA 3CFOA 4E19A 1VSIA 3QNNA 1NOYA 1TL3A 3AO2A 5FRNA 1CLQA 1NK4A 1HPZA 1Z25A 4CJLA 3KK1A 4W5QA 2YNIA 4E7KA 3CG7A 3TAQA 4F3TA 2OPSA 4CF0A 3QETA 2PY5A 4CEZA 2D0BA 4CGGA 1T03A 4DU3A 3MECA 1LWEA 1VRUA 2Z1HA 3HPGA 4C8MA 3K57A 4BACA 5CYMA 2E6LA 4DQPA 4CJRA 1R0AA 1L3UA 2XY7A 1CZ9A 4GMJB 4H4MA 1REVA 3HL8A 4BWMA 4HTUA 4NYNA 1XWLA 4OKEA 4WE1A 1TAUA 3VQCA 3QEXA 2BGGA 4EP4A 3L2UA 1QHTA 4PWDA 1UOCA 3HVRA 1CXQA 1BQMA 3S9HA 2GUIA 3AVCA 1HYZA 4FJKA 2HHUA 2BANA 3IAYA 1EKEA 4JS4A 1KRPA 3SUQA 3QIOA 4ID1A 1X9WA 4OLBA 2HHTA 3OVNA 1HYVA 3ULDA 1VSHA 1QSLA 4DTSA 5T7BA 4IKFA 4FK2A 2YKNA 1RTIA 2DTUA 4KTQA 4BDZA 1Z26A 4DS5A 3AVIA 5C25A
chains in the Genus database with same CATH superfamily
4AQYK 4YNQA 2KQ2A 2VGNA 3LP1A 4CJWA 1BG3A 1TK8A 2Z1IA 4KHQA 1ZBSA 2P5GA 3G6EN 1VSFA 4O0IA 1VQLN 4O55A 2HBLA 2HF3A 1RTHA 3ZSOA 4Z4HA 3OYIA 3THWB 3MN9A 1S22A 3TAGA 3E9PA 4OO1J 2PBDA 3NMUA 3CPEA 4BDPA 2WOMA 4BVOA 4ILGB 2P5OA 1NK0A 3CJAA 1TKDA 3AVKA 5AZJA 4BRLA 1WAFA 1S1XA 2X74A 3C6AA 4IJAA 3M8SA 4CD3A 3RWUA 3OYEA 3D0PA 4H5WA 3QDKA 4PA1A 5AQRA 3AVMA 3QMLA 3T19A 4LSLA 3CCSN 2UYTA 3SMSA 1A5WA 1VQ9N 4O5BA 1NGEA 2HMIA 1S1UA 3VQ6A 2CH5A 5AQOA 3RRHA 3DOKA 1C0GA 5AQMA 4BRHA 3UKUA 3P83D 4I6MB 3L2WA 2OPPA 4CZLA 1YXQA 3VTIA 3KKSA 2GX9A 4WYBA 3SAGA 3ZSWA 2A42A 3D2EA 4F2RA 3C0BA 3SUNA 4A5BA 4BG8A 4LH5A 1W0HA 4YOXA 3ENOA 1YF5L 1YVUA 3A5OC 2OA8A 4CVNE 1BQNA 3CM6A 4LFAK 3NH1A 2QWLA 1RDAA 2NRTA 4NLBA 4M3YA 1TYQB 4CJSA 2FSNA 4ISFA 3DM2A 2BDPA 1BGXT 3O9RA 2YHAA 3TI0A 4CGDA 1HYSA 2UUCK 2VG6A 3MCAB 4BE1A 4DU4A 2D4WA 5JLHA 2ZD1A 3LDQA 3PY8A 5KI6A 5GAGP 3M3ZA 3VGMA 3DLLL 1YJ9N 4JI0K 3TU5A 4FLZA 3IUCA 4JK9A 3VERA 4EHUA 4C8KA 4PHTX 3J8AA 4FK0A 4YOTA 4FWRA 4CECA 3KIOA 3DJCA 3CF5L 1M1KO 3A5LC 4BGBA 4A5AA 2FXUA 3OYDA 4CEEA 4HCBA 3R6MA 4MLHA 1UAXA 2OCEA 1N8RO 2P9IA 3JS6A 4FWPA 5JICA 4FLVA 3WQUA 4BRPA 5EOYA 2D0PA 1TKZA 2B5JA 5AZJB 3H3NO 2GEMA 1U4BA 3UIQA 4DQSA 2R7YA 2B6AA 5C0YA 1IKXA 4BY9C 5JS2A 3U8XA 1NGDA 1N32K 5AQQA 2EX3A 2P9PA 4JI5K 4KHUA 3VPZA 4CGHA 3EL2A 4DKWA 1Y97A 3JXUA 1OKJA 3UKUB 3VEXA 2QA4N 3EKUA 3MMVA 3NF6A 3ZT0A 3GBTA 2Q1NA 4Z0UA 4IFYA 2A5XA 5BR9A 4FLYA 4H5RA 1Z6RA 3D2EB 3L3UA 1VQ5N 2E88A 4AHUA 3VQDA 1LW0A 5DMRA 1KAZA 4FZXC 1UA1A 5I42A 2IVPA 1T05A 3O9SA 3CIPA 1YVNA 2P9KA 3B6OA 5FPMA 2NUBA 3L2VA 3C6HA 1BHLA 2GTDA 5AQIA 1WSGA 3DRRA 1YT3A 3SUOA 3SCXA 4OPJA 3E9OA 1YAGA 3K59A 4FJ8A 4IFVA 4FVMA 4K8XA 3RTVA 2IS3A 2IIRA 1SQKA 3CXCM 1ZBUA 4EZ6A 5EVZA 5BREA 4ELTA 3EZWA 2QK9A 3HM9A 4DQQA 1GOCA 5DK5A 4IEIA 3K5MA 3SPYA 4B9NA 4H4OA 5H1SQ 2A3ZA 4ILJA 1NOZA 1JXBA 1KCFA 2E1ZA 3EY1A 1NMDA 1S6QA 1X1PA 1VSEA 5AZIA 2WUSA 4JI8K 4EZ9A 4AHSA 1JLQA 3KK3A 3O1WA 5F1XA 4KH6A 1S6PA 3HSCA 4CJKA 2P9IB 3QNOA 1WAJA 4N47A 1E3MA 2Z1GA 5C42A 4YOYA 4J2EA 3D6RA 4Z4EA 2O8EA 1Q86O 4DV1K 2CGLA 1J53A 3OBYA 4HWIA 2VWJA 5HP1A 1XQSC 5M1NA 1YITN 5AJ3K 4LY7A 4DQIA 4E7LA 2WONA 4OKJA 4YOWA 4LH4A 5JVGL 2YHYA 3LP3A 1ZYQA 4CEBA 4DSKA 2P9PB 3ASMA 1FXXA 4B3RK 3ZSRA 2WBNA 2Q31A 3ULEA 3VA0A 5AQGA 3FZLA 3AVNA 5J1EA 3JYTA 4KAZA 3ZX3A 3J80O 3FE1A 2OZSA 1MWKA 4NCAA 3HYFA 4NCBA 3T1YK 2YI1A 4NLCA 3WEEA 1RNHA 3K0SA 3CI5A 2I5JA 4CJFA 3PX6A 4CJVA 3VF4A 1V4TA 3VQBA 4BR4A 4KI4A 3OYHA 1L5UA 3CD6N 3L4IA 2P9SA 4BG9A 1B9FA 2P9KB 2DFFA 4JHDA 4X64K 3VA3A 2UUAK 4B3SK 3BY5A 2OPQA 1X9SA 5E26A 4JYAK 1QVFM 3KJVA 5I3UA 3E66A 4EHTA 1WBDA 3FZHA 1RTJA 3PUFA 3WXMB 3PIOL 4WQ4A 1NGHA 4DSFA 4CI6A 3WT0A 3M8PA 1NKBA 1DTTA 1VQ7N 3EKSA 1U6ZA 1YTUA 3CFPA 1DKGD 3OYCA 4HUFA 3HK2A 3ENBA 5AQNA 2PFUA 3U6FA 4JD2A 2BUPA 3EO3A 2VG5A 3C65A 3CJCA 4CZIA 5AZIB 4Y1DA 1SAZA 4JK8A 4W5OA 5FPNA 1RDUA 3FLCO 1KFSA 4CD1A 4BE0A 2UU9K 1RCHA 4FZYA 2D5RA 4W5NA 4CBUA 1C0UA 4H8KA 3LPTA 4FJNA 3NF8A 4KO0A 3SBGA 3HT3A 2O8EB 3VGLA 1GLEG 1BIZA 3D2FA 1HUXA 3ZSQA 4B1UB 4FM2A 1S1VA 2JGUA 1T3VA 4EFHA 5LY3A 3U9DA 5EU7A 4CJ7A 1TKTA 3EE8A 3SMPA 3I56N 4BRAA 4CHNA 2HHHK 4K25A 4DR7K 3JSMA 4JLHA 2FBXA 3ULEB 5CR4A 4ID5A 3TARA 1IKWA 1ZC6A 2P9LA 3L6QA 4CFDA 1NGCA 4BR9A 4RW4A 1ASVA 3SQ4A 3NVKA 3AO1A 3HI0A 3VETA 3RR8A 4BRGA 3T7ZA 3K5NA 3J7ZO 4KHWA 3TR8A 2IDOA 5SWMA 1NGIA 3WEEB 1CXUA 3IRXA 2JLEA 3QEVA 4DTPA 3CFOA 2P9SB 4E19A 1M90O 4BR7A 5C12A 4GVEA 3TAQA 2OPSA 5BR8K 1IBKK 3TSPA 3I33A 1LWEA 1VQ8N 4H4MA 3HL8A 4NYNA 3VQCA 3L2UA 4H0PA 1UOCA 3HVRA 2P9NA 4IDHA 3MN7A 4DR3K 4IOAL 2ASMA 2YKNA 1RTIA 4BRKA 1NU0A 4DS5A 3AVIA 4HCCA 3VQ7A 3VQ5A 5CY4A 1O1WA 4RCHA 2BH1A 4IXCA 4J2AA 5GIOA 4BRMA 3K5OA 4C8OA 4JD2B 4DR4K 2KTQA 4DTJA 2E8AA 4Z4CA 4M41A 5AQSA 3UB5A 3V9UA 1ZXOA 3S3NA 3NGIA 3QEPA 2QEXN 1LW2A 5AQYA 3O3FA 3E01A 3DXMA 3LDOA 4CK3A 2VQEK 4H5VA 4B8CA 2DPNA 2HMPA 4FM1A 5E41A 3D2FB 3IFRA 3AVBA 3G0ZA 4B9LA 3F2KA 4IFEA 1BCOA 3CERA 4CIEA 1NGAA 4XH1A 2FF3B 1IBLK 1KFDA 1BI4A 5BPMA 4AHRA 2PYJA 4N76A 2V7ZA 2P9LB 4AHCA 1LV5A 3I8DA 3OS0A 1WSJA 5BPNA 3S3OA 4H0XB 4XH5A 3NBPA 3ATVA 4IG3A 1K73O 4FJ5A 4M3ZA 4WQ5A 1N33K 2DFEA 4RW7A 5KRTA 4HUGA 3VMFB 3ZT2A 2I7NA 3L2QA 2G8VA 3AV9A 3HVTA 5AQKA 3CETA 4UY8O 3OYLA 3F9KA 2XO7A 3NGZA 5JLFA 4FLXA 2NRHA 3FFIA 1ILYA 4JN4A 3E1YA 1ZBHA 3A2FA 4FJJA 5KTQA 4BRQA 5EXWA 4ISEA 3SQ2A 5BN9A 1T6CA 2P9NB 3PX0A 2A41A 3LL3A 1XHZA 4PQUA 4CFBA 3PIPL 4ELUA 4CERA 3SV3A 3CCMN 1IKYA 2KHOA 3BDPA 1Q8IA 2GUPA 4JS5A 2E2OA 4CHOA 4DSLA 2IGIA 1ESVA 4BC3A 4GV3A 5KPZA 1SL2A 2ZGZA 2G8UA 1G15A 3AA4A 3MEGA 4M3RA 5AQZA 4LF5K 4AF1A 1EQYA 4UQGA 3LWMA 4H5NA 2I7PA 3ID6A 3LAKA 3QBWA 4FPBA 4DUZK 4FW1A 3CMAN 1RTDA 1WSEA 3UKRA 1YTAA 3WXIA 4LSNA 2QWNA 1LOTB 2KLAA 4NXMK 2PAVA 2G8FA 2QXLA 4X66K 4BE2A 1P8ZA 4BGAA 3TTDA 2YX6A 3LP0A 2WC9A 4HUEA 3CCEN 4A2AA 2RN2A 3W0LA 3VQ4A 3VQQA 4BR0A 1QQMA 5FROA 2GWKA 2H3GX 4N41A 4F3OA 1TK0A 1NJIO 1BI4B 2OYQA 4C8LA 2E6MA 4R79A 1EXQA 3ZCMA 4DU1A 3VQEA 3KHYA 1SKRA 2NRXA 3WNEA 5HOOA 3DMJA 4K42A 4O5FA 1IH7A 1RDDA 2HNZA 3AVGA 3J7AP 4JEPA 3OBWA 4GY2B 1N34K 3VQ8A 3DRPA 4NYFA 1T6DA 2NNWA 3HP9A 4J2DA 2E2PA 4DR1K 4I9LA 4DV0K 1OVQA 2Z1JA 3AVLA 4FJLA 4L8RB 4FPAA 3SJHA 1ASUA 4KTWA 5AQPA 4DTUA 4LFCK 3EYZA 4KB0A 2QWRA 4JI6K 3L3VA 4H0YB 1SS6A 4O44A 1WUAA 4DSEA 1HPMA 2E2QA 4RWTA 3SZ2A 1NGFA 3HM8A 3L8BA 4W5RA 3QFUA 2DFHA 1RT5A 3QLHA 4Z4IA 3OYBA 1BU6O 3RRGA 2O8DA 3HZ6A 4YOUA 2XHBA 1FK9A 2XY5A 4FOEA 3CYMA 3P4IA 4U7BA 3UE5A 3EEQA 4DV2K 3IDHA 3R8EA 3CCJN 4IO9L 2E5LK 1NGJA 3FGUA 3HJFA 5BN8A 3C94A 4CJ4A 2AJQA 1IO2A 3QEIA 1ATRA 5LJVA 3CFRA 4GV6A 1QSYA 3N4QA 5CYQA 4WFAL 4BRNA 1BUPA 1RBVA 4GNIA 1EETA 3GE1A 1SL0A 1Y64A 4E1NA 4CGJA 4CIFA 3U3YA 2OTLN 3NFAA 3UKRB 3ZYYX 1EP4A 1KAXA 1LAWA 2GBZA 4OJRA 5FDLA 3KTQA 1KSPA 4BC4A 4DCHA 3OW2M 3DLKA 3TANA 4KI6A 1X9MA 4QS9A 3M1FA 4DTRA 3LM9A 5MLCQ 3CJ7A 3LDNA 5KQDA 1VQPN 3CCRN 4KBOA 3J81O 3F5TA 4DV7K 3O9TA 2FBYA 3DLGA 4FJGA 2O4IA 3KD5E 1LAVA 4IJNA 4C23A 1TK5A 3O3GA 2V52B 1NM1A 5I9EB 3OHRA 3SPZA 1HX1A 4CJPA 4PUOA 3DLBA 1QS4A 5D3GA 2YNFA 4JKDA 4B9TA 5KPTA 1FKPA 3CJBA 4PL8A 4X65K 3NH0A 1SV5A 2HF4A 4PL7A 3V9WA 1B9DA 4R5PA 4WCEL 1IKVA 1QE1A 3M8QA 3P31A 4JKGA 4ELVA 2Q0RA 3TWHA 4BQZA 5AQUA 1C0MA 1J9AA 4LD0A 1ATNA 1MWMA 3KKRA 1JJ2M 1QQNA 1T8EA 4CHQA 3BZCA 3LDPA 4RW6A 5AQJA 1XC3A 2FLOA 4DB3A 2JWLA 4Y1CA 1DTQA 2D0CA 2FC0A 2O8DB 3OYKA 1NK8A 2NZTA 3AVAA 3SLCA 3VQPA 4BRDA 2W6KA 3H1QA 3DWLA 4OVLA 1OH5A 3EN9A 3KLEA 5JVHL 3VEZA 3TSQA 4OGCA 4LF7K 4CIGA 4Q0BA 3G4SN 3K2PA 1SL1A 4M42A 1BISA 2VQFK 1I3AA 4FO0A 3G25A 4AHVA 4BC2A 5SZTA 3ZSVA 3MX5A 1VSLA 4YDUA 3ZETA 3H45C 4CK1A 4JKHA 5KGXA 1D8YA 4DFPA 5AR0A 3HPHA 4M3UA 4QOZB 1D9FA 4CEFA 3CPWM 1QZ6A 1XC9A 4HHTA 1DGKN 1BCMA 4B8AB 4X62K 3H08A 3MN5A 2W40A 1C6VA 3HSTB 4H0VB 1BWFO 4DSJA 4E0DA 1BIUA 2KZZA 2UXCK 3TABA 3O80A 1JCFA 3TPQA 5LL6Z 3V9SA 1TUUA 2YJEA 3AVFA 5GAHP 4FWSA 3MDQA 3JAMO 3QNNA 1NOYA 1GLCG 2V51B 4CBWA 3KK1A 2YNIA 4QS8A 4F3TA 4PKGA 2PY5A 5EX5A 1Q81O 2D0BA 1X3NA 3MECA 3K57A 2Z1HA 4JKGB 4EAHD 4BACA 4CZEA 5CYMA 3TTFA 3H3OB 4GMJB 5BRFA 1XWLA 1WBBA 2QWMA 4BROA 4YY3K 4B1XB 1CXQA 4FJKA 2HHUA 2BANA 1EKEA 1WOQA 5B8HA 1KRPA 3SUQA 3GL1A 4FL9A 3MN6A 4OPAA 4DTSA 5T7BA 4IKFA 4FWOA 4FK2A 5HL7L 1OH7A 3QFPA 2CGJA 4BDZA 4JKAA 5C25A 2A1RA 3H1VX 3BGRA 2E4LA 5BPLA 1HRHA 3EZ5A 1T44A 3V1OA 1JL1A 2B4JA 3T1AA 3AO5A 3AAPA 2A40A 2YHBA 3K9KA 4M45A 1NG9A 3OJUA 1JLAA 4AM6A 4KHSA 2GWJA 4WQ4C 2KFZA 3WNGA 1N6QA 1KLNA 1Z05A 3O1BA 4FVUA 2ZJQL 3LWLA 5TKYA 3VTHA 1X3MA 2YKMA 3ZETB 4RTFD 3CQ8A 3IG1A 1BL3A 1RT2A 3C7NA 4BREA 3SJJA 5KPRA 4CW7B 1K6YA 2O4GA 3AAQA 4OLAA 3HO1A 3MCPA 4YHHK 2QW9A 1KVAA 2BTFA 4DMNA 1W2BM 3VEWA 4ILHA 4FWQA 3FZFA 4I7FA 3AY9A 2HHVA 4ZHRA 3TAPA 3CCUN 4RW8A 4YOVA 1RBRA 5C24A 3SQ0A 4WF9L 1VQKN 1HLUA 3L0QA 1K8KA 3C6TA 3HP6A 5AFUA 4BQLA 3NF9A 3LP2A 3CMEN 3THVA 2RPIA 4DFMA 3R3LA 5IT9O 3MX2A 3OA9A 4CGIA 1X9JA 4N56A 4CF1A 5FPEA 1IG9A 1VQNN 2UXBK 4E7HA 1JLEA 4JHDB 4C1NK 2F9TA 1HJRA 1V4SA 4A57A 2HBJA 3P1GA 3ZEUA 3MEDA 3CJ1A 3TSUA 3PX4A 2FBVA 4AHTA 3C95A 1BDGA 4QCLA 4JAXA 3KLHA 4CBXA 3BEXA 3THYA 2WFBA 2E1YA 3W3DA 2HVHA 2HHQA 1MDUB 2HHSA 4DUYK 3TAMA 1RT1A 2YHWA 2KFNA 4JKBA 2A6AA 4Y0WA 4LF8K 4DQRA 4CFCA 5FRMA 1JKHA 1Q9XA 5DM6L 3V9XA 1JCGA 4OPHA 2GV9A 2XRIA 3PSFA 1L3SA 2HSTA 3OYNA 1VRTA 2P9UA 1HQUA 2VG7A 4K41A 5F2RA 1NLVA 3ZSZA 3DAWA 5F0XA 3EE9A 4KH4A 1RT7A 1QHAA 3BF1A 1RBTA 3U9ZA 1S9EA 3CQXA 4FW2A 1WB9A 1C1BA 1OVYA 1NK5A 1HNVA 2NRZA 3CC7N 1GOBA 1TVRA 4DLGA 2X6SA 3Q7BA 5LMUK 1HNZK 1F21A 1FJGK 4GKJK 3M6GA 4B08A 2EHGA 4H5TA 4DR6K 3NE6A 1I94K 1JLCA 1RT4A 3S3MA 3THXA 1R59O 4E7IA 1C1AA 4HVJA 4DV3K 4GV9A 1W9HA 2W41A 4DR5K 1XNRK 3NGYA 3LDLA 4TSXA 2ZWHA 5HRPA 1U2VA 2FBTA 4K8ZA 4J8FA 1K8KB 1MA9B 2ATQA 1K8AO 4DF4A 4E7JA 2ZQBA 1VQ6N 3V1QA 2XY6A 5AQFA 4CZFA 4U67L 1KVCA 1D4XA 4M7YA 2G8HA 1YI2N 3M8RA 4WQ5C 2D1KA 2FSJA 3ZEUB 4JI4K 1D5AA 3OYGA 1VQ4N 4E1JA 1QTMA 4JI3K 4I2QA 4GVMA 4V19S 2G8IA 1XUPO 5EY4A 5HRSA 4KFBA 4N5SA 3DOLA 1Q82O 3RMDA 2ZJPL 3AARA 5FLXO 3R1XA 3QERA 5CZ1A 3MAQA 3QINA 1VSKA 3SBTA 3F73A 2F96A 4IOXA 1UWBA 1YJNN 4O8UA 5AQHA 1Q18A 3Q7CA 1I39A 1GLJO 2YV0X 3B6PA 3VGKA 1NJYA 3A8YA 3OTOK 5ADXH 3P5JA 2P9UB 1VQON 4DWIA 4PKHA 2Q97A 3RMCA 1LCUA 4FLUA 4CJQA 4OPKA 4B9QA 3R9PA 4CZKA 3M5RA 4E1MA 1ASWA 2ASPA 3AGRA 3TAFA 3G71N 1HNIA 1EX4A 1VK0A 3DXMB 3ISNC 4C1NI 3D45A 4FWMA 1TL1A 3O6WA 2QKKA 1BO5O 4ZTFA 3VOVA 1NGGA 1GOAA 3I8BA 1RBSA 4O0JA 2QM1A 3OY9A 3GOIA 4IG0A 3BP8A 5GIPA 2FSKA 1BOTO 4B1WB 2YNHA 3CJ9A 1RT6A 1KVBA 5A2QO 3QIPA 2ETJA 3V1RA 1GLBG 4IDKA 1HQEA 4CJTA 1ZBLA 3KLFA 3WNHA 5HBMA 2W42A 1XMOK 4YFUA 3HXMA 4MO4A 1KQSM 1U2VB 1W97L 3QO9A 1RGIA 4B3MK 4E3SA 4CJ5A 1HKBA 3IKMA 3BZKA 3GDQA 1HJOA 1U47A 4CCHA 1C1CA 4Z4GA 2GELA 3TTCA 4FK4A 1OH8A 4ZTJA 4XH4A 1SKWA 1C0FA 2Y1JA 5FPDA 1N5YA 3LZJA 2X6NA 3CCVN 1GLFO 3AVJA 4CESA 4CHYA 4JKCA 1E4FT 3MXIA 3DLHA 2QWPA 3HTVA 5GADP 4PKIA 4JRQA 3KD1E 1CZBA 4A62A 4DR2K 2XY8A 4J2BA 4BC5A 1ZBIA 2NRRA 1WSFA 2LSNA 3CCLN 4C8NA 3WUHA 3HOSA 2BE2A 5CHIA 1NMNA 5HRRA 4CE9A 4MDAA 5HRNA 5J2MA 3I0SA 2HNYA 4DHYA 3V6DA 2V7YA 4MLEA 3SNNA 5C15A 2O8BA 3KLIA 1O13A 4DQ8A 4DV4K 1P90A 1NJZA 3U4LA 4DFJA 2F8SA 3SAHA 4CZJA 2F7TA 4CZHA 4DV6K 4IOCL 3O3HA 5M1OA 1ZBFA 3VQ9A 3AO4A 4BDYA 1HMVA 4WFNL 1NJXA 1S1WA 2Q2RA 5J2NA 4IO8A 4KV8A 1YJWN 5BRDA 3ENHA 2F9WA 2PYLA 3PV8A 4NB4A 1SZ2A 5AFUH 5HROA 1WSHA 4JI7K 4IWVA 5KQ8A 3A0IX 4W5TA 1D9DA 4FM0A 3P38A 1VSIA 5FRNA 1YUWA 1HPZA 1XNQK 4JI1K 5C2FA 3CG7A 3WXKA 2IVOA 4L3QA 4CF0A 4DU3A 4C8MA 1VRUA 1Q7YO 1HNWK 4CJRA 1L3UA 4BR2A 1REVA 2OTJN 4OKEA 4WE1A 1TAUA 3QEXA 2BGGA 5M1PA 4EP4A 1QHTA 4H0TB 4YORA 1BQMA 2GUIA 3IAYA 2JWKA 4JS4A 3ATUA 4OLBA 3OVNA 3O5BA 3F9MA 3ULDA 1QSLA 2YHXA 2DTUA 4KTQA 1Z26A 2Y1IA 1HKGA 2OPRA 3VN5A 5C2DA 3MWTA 3KWIA 4FWKA 3FFKB 2VGMA 1RDWX 1KAYA 1S72N 4NCGA 1TGOA 3ZSYA 2RKIA 2HB5A 4XEIA 1NKEA 4LF9K 2O8FA 1KXPA 5LJWA 4GKKK 4M7XA 4FYDA 2A1SA 3H6EA 3WNFA 3NF7A 3LAMA 5ELZA 4B9MA 5AQLA 2F4VK 4G9ZA 3RSEA 1GLLO 5AQXA 4EIAA 5JS1A 3S41A 4Z94A 2ZE2A 1EWRA 4QAGA 2RE2A 3CCQN 4CEQA 5BRHA 2O8BB 2IOCA 3KLGA 2WTUA 4DTXA 2G8KA 5M1QA 4BRCA 3CHWA 3VENA 2HOEA 3N4PA 4BR5A 3PO5A 4Q5VA 3E9LA 3T69A 4OGEA 3A5NC 4FLTA 1EWQA 1IG8A 4KHYA 2ITGA 1J6ZA 3SYZA 4AM7A 4CK2A 3NH2A 3LALA 2RHKA 4CF8A 2VWBA 3DLEA 1FKOA 4H03B 1EO1A 4FWNA 4RW9A 4DSIA 3O4NA 3OJSA 4A2BA 4CEDA 3T1HK 4Z4FA 1TKXA 4YDUC 1RILA 4B3OA 4CF9A 5TKWA 2HVIA 1KLMA 3VEVA 3ALYA 2VWKA 4OKKA 2HW3A 1S5JA 3AA2A 4GW6A 3AVHA 4KTZA 3HBTA 5LMNK 3DRSA 3LANA 4BRFA 3QBXA 3IMXA 5ADXA 1DLOA 4M3TA 1JL2A 4FWLA 4AILC 5DM7L 1MU2A 4LF4K 4FJMA 3LDSA 3PO4A 4FCYA 3ZT3A 3TAEA 1QQCA 3DI6A 1U49A 3AA3A 4IZ9A 1RDCA 5GAEP 2EWSA 3J7YP 3C6UA 3DLRA 4RG8A 2ITMA 3KVGA 2E2NA 3LPUA 1VAZA 2UUBK 4HTLA 2IAJA 1H1VA 3WXJA 1A5XA 1W7AA 5M1KA 3RR7A 2HHWA 3L2RA 4F8RA 2QKBA 1RBUA 3I0RA 4JNEA 3KK2A 1N36K 4AH9A 2O8FB 1WNSA 1XMQK 3CC4N 4KKOA 2VCPA 3RMAA 1HR0K 2HNDA 3NCIA 1RDBA 3VF6A 1RFQA 4CEAA 3MWPA 4FZZA 4M3XA 3RSEB 3HRGA 3V9ZA 4KHNA 1LWCA 4PY5A 4FJXA 1OH6A 2ZGYA 5KRSA 1TUYA 3IS9A 4JRPA 2Q3SA 3SK3A 4K43A 4F4KA 4FJIA 5AQWA 4DF8A 1BA1A 2FF6A 4MQ3A 3CC2N 1IJJA 3ZSXA 1WLJA 3V4IA 3H46O 1NKCA 4M3WA 1TV6A 1SUQA 2OZMA 4DG1A 4IBNA 3SAFA 1VHXA 1JLGA 3SQ1A 1DEJA 3OS2A 1JLBA 1S1TA 2NLXA 2O8CA 4KB1A 4LFBK 4ISGA 3NAEA 3PSIA 4KRFA 1VSMA 4I9QA 4DTNA 1BA0A 1VSJA 3WXLA 4B9SA 1WN7A 3NHGA 2KW4A 1XI1A 2F8TA 4WFBL 4FJHA 4EP5A 2VYPA 3KK7A 1SKSA 4LC9B 2D0AA 3AGKA 3ZX2A 3VEOA 5IWAK 3KZBA 4CFAA 1DT9A 1A5VA 2QXFA 5E84A 4F2SA 5M1FA 1J5OA 4M63C 3OYFA 2QI2A 5CE3A 2QWQA 4DTMA 3HPOA 1NJWA 3T3FA 1QVGM 1B92A 2HBMA 4CGFA 3CQYA 4CEOA 2HBKA 3OYAA 3BUZB 4JK7A 1U45A 4G1QA 4OX9K 1HKCA 2QWOA 1JCEA 3CM5A 1ATSA 2AA4A 3ZT1A 4MFBA 3V81A 1TAQA 2IC3A 3FZKA 3O9QA 1LWFA 3G10A 3QESA 2CGKA 4B9UA 4DLEA 4JKEA 3AA5X 1G99A 3U3GA 1U04A 5KGWA 3SV4A 4FJ9A 3I55N 2ZJRL 4FLWA 3MXMA 1WSIA 3VQAA 1IBMK 1C0TA 3D7EO 4CZGA 1HNXK 4FJ7A 1YIJN 1NK6A 4KPYA 3ID8A 3RMBA 1GLAG 3DXKA 1L3TA 2IVNA 4FSVA 4IEEA 4B1ZA 4F9OA 2J4RA 2KKZA 3A5MC 1NWKA 2RF2A 1JXEA 2HHXA 2NRWA 1YHQN 4CHPA 2E20A 4MO5A 1KC8O 2D0OA 2DY4A 4ICLA 4NO7A 4CZMA 2O8CB 3KWGA 3B8AX 1NK7A 3DYAA 4DV5K 4DS4A 1J5EK 1KD1O 4BWJA 3K9JA 4QS7A 3RVCA 5J2QA 5GINA 3C7NB 1KTQA 4B1VA 4JKFA 3OYMA 2QTDA 4O4GA 4B9VA 4H0OA 1QSSA 4JI2K 3OYJA 3FR0A 1XHXA 3VEYA 3AO3A 1T7PA 1ITGA 1VSDA 1FW6A 3NVMA 5HLFA 3K58A 3QICA 1NK9A 3OS1A 2UXDK 4O8KA 2NRVA 2P51A 4E89A 4B3TK 4DFKA 4DTOA 3O4QA 3NDKA 1VQMN 3ZT4A 4CJUA 4FXDA 2KZMA 3HOTA 4KHPK 1JLFA 1S9GA 3O08A 2Q36A 5CZ2A 3MXJA 3QEWA 5K14A 3THWA 3K5LA 4A59A 3WQTA 1S3XA 3VESA 4XIUA 3SUPA 4CJEA 2ZF5O 3O4WA 3LZIA 4A61A 5AQVA 3FZMA 4JV5K 1GLDG 3SI6A 4CF2A 3O8MA 1CZAN 3MEEA 1E4GT 1IV0A 3ITHA 2ASOA 3GG4A 5AQTA 4CHZA 3QB0A 3ZX0A 2ZM6K 5C10A 2PZSA 3DXKB 3THYB 2YCHA 1L3VA 1J54A 4I6MA 4KREA 4FOIA 3P39A 4I2PA 2W6LA 2G8WA 3ZLJA 1U48A 4BVPA 1NBWA 2YNGA 1Q9YA 5J2PA 1QQOA 1UA0A 1RT3A 4B1YB 1NNEA 1QZ5A 2X78A 2P1JA 3O9UA 4K0KK 4CJ3A 2OANA 3L4QA 2Q0UA 1TL3A 3AO2A 3MK6A 1CLQA 1NK4A 1Z25A 1TYQA 4CJLA 4W5QA 4E7KA 3QETA 3BF3A 4CEZA 4CGGA 1T03A 3HPGA 4DQPA 2E6LA 4MDBA 3PLAA 2YJFA 1R0AA 2XY7A 1CZ9A 4BWMA 4HTUA 1NGBA 1K9MO 2CH6A 3VF2A 4KH5A 4PWDA 3S9HA 3AVCA 1HYZA 3QIOA 4LF6K 4ID1A 1X9WA 2HHTA 1HYVA 4NXNK 1VSHA 5JMVA 4BRIA 2AP1A 3THXB 3LM2A
chains in the Genus database with same CATH topology
2OPRA 3VQ7A 3VQ5A 5CY4A 1O1WA 2KQ2A 3VN5A 3LP1A 4YNQA 2A1RA 4J2AA 3K5OA 4CJWA 4C8OA 1TK8A 2Z1IA 3BGRA 4KHQA 2E4LA 2P5GA 4NCGA 1HRHA 1TGOA 1VSFA 3V1OA 3ZSYA 2RKIA 4O0IA 3EZ5A 2HB5A 1JL1A 4O55A 2B4JA 3ZSOA 1RTHA 4Z4HA 4Z4CA 3OYIA 3T1AA 3AO5A 4DTJA 4M41A 3V9UA 2YHBA 3TAGA 4M45A 4FYDA 3OJUA 1JLAA 3NGIA 3S3NA 4BDPA 2WOMA 3QEPA 4KHSA 2A1SA 1LW2A 3WNFA 3NF7A 3LAMA 3O3FA 1NK0A 3E01A 1TKDA 3AVKA 4B9MA 2P5OA 1WAFA 2KFZA 1S1XA 3WNGA 4CK3A 2X74A 4B8CA 3M8SA 1N6QA 3RWUA 1KLNA 3OYEA 3D0PA 5JS1A 2ZE2A 4PA1A 4FM1A 5E41A 4QAGA 3LWLA 3AVMA 4CEQA 3T19A 4LSLA 2IOCA 2YKMA 3AVBA 3CQ8A 1A5WA 3G0ZA 3IG1A 4O5BA 3KLGA 4DTXA 2G8KA 4B9LA 2HMIA 1S1UA 1BCOA 3VQ6A 4CIEA 3RRHA 1BL3A 3DOKA 1RT2A 1KFDA 3PO5A 4Q5VA 4OGEA 3P83D 3L2WA 4FLTA 1BI4A 2OPPA 3SJJA 4AHRA 2PYJA 4N76A 4KHYA 2ITGA 3SYZA 3KKSA 4CK2A 3NH2A 1K6YA 2O4GA 3LALA 4AHCA 1LV5A 3I8DA 3OS0A 1WSJA 4OLAA 3HO1A 3ZSWA 4CF8A 3DLEA 4F2RA 1FKOA 3S3OA 3SUNA 4RW9A 4LH5A 1W0HA 4DSIA 3O4NA 1YVUA 3OJSA 4HCCA 3NBPA 2OA8A 1KVAA 4CEDA 1BQNA 3CM6A 4IG3A 3NH1A 4DMNA 4Z4FA 1TKXA 1RILA 4FJ5A 4CF9A 4B3OA 1RDAA 4M3ZA 4I7FA 2HHVA 2DFEA 4ZHRA 4RW7A 1KLMA 5KRTA 3TAPA 4RW8A 2HVIA 4HUGA 3ALYA 4M3YA 2VWKA 4CJSA 3ZT2A 4OKKA 3DM2A 1RBRA 5C24A 3L2QA 2BDPA 1BGXT 1S5JA 2G8VA 3SQ0A 2HW3A 3AA2A 3AV9A 3HVTA 4GW6A 3AVHA 2YHAA 4KTZA 3F9KA 3OYLA 3DRSA 3LANA 2XO7A 1DLOA 3NGZA 3C6TA 3TI0A 4M3TA 4CGDA 3HP6A 4FLXA 1HYSA 1JL2A 1NKEA 3FFIA 4AILC 3NF9A 1MU2A 3LP2A 2VG6A 3THVA 2RPIA 1ZBHA 4BE1A 4FJMA 4DFMA 4DU4A 3LDSA 3A2FA 4FCYA 5KTQA 3PO4A 4FJJA 3ZT3A 3SQ2A 2ZD1A 3TAEA 1QQCA 4CGIA 3DI6A 1U49A 3PX0A 3PY8A 3AA3A 5KI6A 1RDCA 4N56A 4CF1A 1XHZA 3C6UA 4PQUA 3DLRA 4CFBA 1IG9A 4ELUA 4RG8A 4E7HA 4CERA 4FLZA 1JLEA 3LPUA 3SV3A 1IKYA 4C8KA 3BDPA 4FK0A 1Q8IA 1HJRA 4JS5A 4DSLA 4CHOA 4CECA 3KIOA 2IAJA 3P1GA 2IGIA 3MEDA 1SL2A 1A5XA 2FBVA 3PX4A 4AHTA 2G8UA 3C95A 1G15A 3AA4A 3MEGA 4M3RA 3OYDA 3RR7A 4CEEA 4QCLA 3L2RA 3KLHA 4F8RA 1RBUA 3I0RA 4HCBA 2QKBA 1UAXA 2HHWA 4UQGA 3LWMA 3KK2A 4AH9A 2HVHA 1WNSA 2HHQA 3LAKA 4KKOA 4FLVA 3RMAA 2HHSA 2HNDA 3NCIA 1RDBA 3TAMA 1RT1A 4FW1A 1RTDA 2KFNA 1TKZA 2B5JA 4CEAA 1WSEA 4FZZA 4M3XA 4DQRA 4CFCA 3V9ZA 1JKHA 1U4BA 1YTAA 3V9XA 1Q9XA 1LWCA 4KHNA 3UIQA 4LSNA 4FJXA 4PY5A 4DQSA 2GV9A 2XRIA 5KRSA 2R7YA 2G8FA 3IS9A 1L3SA 2B6AA 3OYNA 4JRPA 2Q3SA 4BE2A 1VRTA 2Y1IA 1IKXA 5JS2A 3LP0A 1HQUA 2VG7A 4F4KA 4FJIA 4HUEA 4DF8A 4MQ3A 3ZSZA 2RN2A 2EX3A 3ZSXA 1RT7A 3VQ4A 4KHUA 3VQQA 1RBTA 4CGHA 1WLJA 5FROA 3V4IA 1S9EA 1NKCA 4FW2A 1Y97A 4M3WA 1C1BA 1TV6A 4N41A 4F3OA 1SUQA 2OZMA 4DG1A 4IBNA 1TK0A 3NF6A 1NK5A 1BI4B 3ZT0A 2OYQA 1JLGA 3SQ1A 1HNVA 4Z0UA 1GOBA 3OS2A 4C8LA 1JLBA 1S1TA 2E6MA 4IFYA 1TVRA 4DLGA 1EXQA 3ZCMA 4DU1A 4KB1A 3VQEA 4FLYA 2X6SA 1SKRA 3NAEA 3WNEA 4KRFA 3DMJA 3L3UA 1VSMA 4I9QA 1IH7A 3AVGA 1RDDA 2HNZA 4DTNA 1F21A 4AHUA 3VQDA 1LW0A 5DMRA 1VSJA 3VQ8A 4FZXC 1UA1A 4B08A 5I42A 1T05A 4B9SA 3DRPA 4NYFA 3B6OA 3HP9A 2NUBA 3L2VA 2EHGA 4J2DA 4I9LA 1BHLA 3NE6A 1JLCA 1RT4A 1WN7A 3S3MA 1WSGA 3DRRA 1YT3A 3NHGA 3SUOA 3SCXA 4E7IA 4OPJA 1C1AA 2KW4A 2Z1JA 3AVLA 1W9HA 4HVJA 1XI1A 4FJLA 4L8RB 2F8TA 4FJHA 4EP5A 3K59A 4FJ8A 4IFVA 1ASUA 3NGYA 1SKSA 4FVMA 2D0AA 4KTWA 4TSXA 5HRPA 4DTUA 3EYZA 2FBTA 4CFAA 4KB0A 4K8XA 3RTVA 2IS3A 4K8ZA 3L3VA 4O44A 1A5VA 2QXFA 2ATQA 4DSEA 1ZBUA 3SZ2A 4EZ6A 4F2SA 4DF4A 4ELTA 4E7JA 3L8BA 2QK9A 2ZQBA 4W5RA 1J5OA 3OYFA 3HM9A 4DQQA 1GOCA 2DFHA 3HPOA 4DTMA 3T3FA 1B92A 1NJWA 5FRMA 5DK5A 1RT5A 3QLHA 4CGFA 3V1QA 3OYBA 4CEOA 2XY6A 3K5MA 3SPYA 3RRGA 4Z4IA 3OYAA 2XHBA 4B9NA 1U45A 1KVCA 4H4OA 1FK9A 4G1QA 2XY5A 3CYMA 1NOZA 1JXBA 2G8HA 1KCFA 3M8RA 3EY1A 3HJFA 1S6QA 3C94A 4CJ4A 2AJQA 1X1PA 1VSEA 1D5AA 1IO2A 3CM5A 3OYGA 3QEIA 4EZ9A 3CFRA 1QTMA 3ZT1A 4I2QA 4MFBA 4GVMA 4AHSA 2G8IA 3V81A 1QSYA 1JLQA 3KK3A 5CYQA 5HRSA 1TAQA 4KFBA 4N5SA 3DOLA 2IC3A 3RMDA 1S6PA 1RBVA 1LWFA 3G10A 4CJKA 1EETA 3QNOA 3QESA 4B9UA 1WAJA 4N47A 4DLEA 1SL0A 3AA5X 2Z1GA 5C42A 4J2EA 3U3GA 4E1NA 5CZ1A 1U04A 5KGWA 4CGJA 3MAQA 3QERA 3SV4A 4FJ9A 4Z4EA 3QINA 1VSKA 4CIFA 3MXMA 4FLWA 3F73A 3U3YA 1WSIA 1J53A 2F96A 1UWBA 3VQAA 3NFAA 2VWJA 5HP1A 1C0TA 1EP4A 1I39A 4LY7A 4DQIA 1NK6A 4FJ7A 1LAWA 2GBZA 2YV0X 3B6PA 1NJYA 4KPYA 4E7LA 3RMBA 4OJRA 5FDLA 3KTQA 2WONA 3P5JA 1KSPA 4OKJA 4DWIA 4LH4A 3DLKA 3TANA 3LP3A 3RMCA 1ZYQA 1X9MA 1L3TA 4FLUA 4KI6A 4CJQA 4OPKA 4CEBA 4DSKA 4DTRA 3ASMA 1FXXA 4E1MA 3ZSRA 3VA0A 2RF2A 3AVNA 1ASWA 1JXEA 5J1EA 3JYTA 3TAFA 4KAZA 2HHXA 1HNIA 1EX4A 4CHPA 1VK0A 3ISNC 2OZSA 2FBYA 3DLGA 3D45A 4FJGA 4NCAA 2KTQA 2DY4A 2O4IA 3HYFA 4NCBA 3KD5E 1LAVA 1TL1A 4ICLA 1TK5A 2QKKA 4ZTFA 1NK7A 3DYAA 3O3GA 1GOAA 1RNHA 1RBSA 4O0JA 2I5JA 4CJFA 4DS4A 3PX6A 4CJVA 3SPZA 4PUOA 4CJPA 3OY9A 3DLBA 3VQBA 4BWJA 1QS4A 3OYHA 4IG0A 4KI4A 5D3GA 1L5UA 2YNFA 4B9TA 5J2QA 2YNHA 1B9FA 1FKPA 1RT6A 1KVBA 3NH0A 3QIPA 2ETJA 2DFFA 1SV5A 3V1RA 3V9WA 3VA3A 1B9DA 4IDKA 4R5PA 1HQEA 4CJTA 1IKVA 1KTQA 1QE1A 2OPQA 3M8QA 3KLFA 1ZBLA 1X9SA 3OYMA 3WNHA 5HBMA 4ELVA 4O4GA 4B9VA 3TWHA 2W42A 3KJVA 1QSSA 4YFUA 3HXMA 5I3UA 1C0MA 1J9AA 3OYJA 3QO9A 1XHXA 4LD0A 3AO3A 1T7PA 4E3SA 4CJ5A 1RTJA 3KKRA 3PUFA 1ITGA 1VSDA 1T8EA 4CHQA 4DSFA 5HLFA 1U47A 4CCHA 4RW6A 3K58A 1C1CA 3M8PA 4Z4GA 1NKBA 1NK9A 1DTTA 4Y1CA 3OS1A 1DTQA 2D0CA 2FC0A 2P51A 3CFPA 4FK4A 1YTUA 4ZTJA 4E89A 3OYCA 3OYKA 4HUFA 3VQPA 3AVAA 1NK8A 4DFKA 1SKWA 2Y1JA 1N5YA 3HK2A 4DTOA 3O4QA 3NDKA 3LZJA 2X6NA 4OVLA 3ZT4A 4CJUA 4FXDA 2KZMA 3KLEA 3U6FA 1JLFA 3AVJA 4CESA 4CHYA 1S9GA 4OGCA 3MXIA 2VG5A 5CZ2A 3MXJA 3QEWA 3DLHA 4CIGA 4Q0BA 5K14A 3K5LA 4Y1DA 3KD1E 4JRQA 4W5OA 3K2PA 1CZBA 2XY8A 3SUPA 4XIUA 1SL1A 4J2BA 1KFSA 4M42A 1ZBIA 4CJEA 1WSFA 4BE0A 1RCHA 4FZYA 2D5RA 1BISA 2LSNA 3LZIA 4C8NA 4W5NA 2BE2A 1I3AA 3SI6A 5HRRA 4CE9A 1C0UA 4H8KA 3LPTA 4CF2A 4FJNA 3NF8A 4KO0A 4AHVA 5HRNA 3HT3A 3I0SA 5J2MA 2HNYA 3V6DA 3MEEA 5SZTA 3ZSVA 1BIZA 3SNNA 3ITHA 3ZSQA 1VSLA 3KLIA 4FM2A 1S1VA 2JGUA 5EU7A 4CHZA 1TKTA 1NJZA 2PZSA 4CK1A 4DFJA 5KGXA 2F8SA 1D8YA 4DFPA 4CHNA 3HPHA 1L3VA 4M3UA 4QOZB 1D9FA 4CEFA 1J54A 3JSMA 4JLHA 2FBXA 4KREA 1XC9A 4ID5A 3TARA 1IKWA 4HHTA 3O3HA 4I2PA 4CFDA 1BCMA 1ZBFA 3VQ9A 4B8AB 4RW4A 3AO4A 3H08A 1ASVA 4BDYA 2G8WA 1HMVA 1C6VA 3HSTB 1U48A 3SQ4A 1NJXA 2YNGA 1S1WA 3AO1A 5J2NA 3RR8A 1Q9YA 4DSJA 4KV8A 5J2PA 3K5NA 4E0DA 1BIUA 4KHWA 3TR8A 2IDOA 5SWMA 2KZZA 2PYLA 3PV8A 1UA0A 1CXUA 1RT3A 3TABA 5HROA 1WSHA 2X78A 2P1JA 3IRXA 2JLEA 3V9SA 4W5TA 1D9DA 3AVFA 4CJ3A 4FM0A 4DTPA 3QEVA 3CFOA 4E19A 1VSIA 3QNNA 1NOYA 1TL3A 3AO2A 5FRNA 1CLQA 1NK4A 1HPZA 1Z25A 4CJLA 3KK1A 4W5QA 2YNIA 4E7KA 3CG7A 3TAQA 4F3TA 2OPSA 4CF0A 3QETA 2PY5A 4CEZA 2D0BA 4CGGA 1T03A 4DU3A 3MECA 1LWEA 1VRUA 2Z1HA 3HPGA 4C8MA 3K57A 4BACA 5CYMA 2E6LA 4DQPA 4CJRA 1R0AA 1L3UA 2XY7A 1CZ9A 4GMJB 4H4MA 1REVA 3HL8A 4BWMA 4HTUA 4NYNA 1XWLA 4OKEA 4WE1A 1TAUA 3VQCA 3QEXA 2BGGA 4EP4A 3L2UA 1QHTA 4PWDA 1UOCA 3HVRA 1CXQA 1BQMA 3S9HA 2GUIA 3AVCA 1HYZA 4FJKA 2HHUA 2BANA 3IAYA 1EKEA 4JS4A 1KRPA 3SUQA 3QIOA 4ID1A 1X9WA 4OLBA 2HHTA 3OVNA 1HYVA 3ULDA 1VSHA 1QSLA 4DTSA 5T7BA 4IKFA 4FK2A 2YKNA 1RTIA 2DTUA 4KTQA 4BDZA 1Z26A 4DS5A 3AVIA 5C25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPR A;  3VQ7 A;  3VQ5 A;  5CY4 A;  1O1W A;  2KQ2 A;  3VN5 A;  3LP1 A;  4YNQ A;  2A1R A;  4J2A A;  3K5O A;  4CJW A;  4C8O A;  1TK8 A;  2Z1I A;  3BGR A;  4KHQ A;  2E4L A;  2P5G A;  4NCG A;  1HRH A;  1TGO A;  1VSF A;  3V1O A;  3ZSY A;  2RKI A;  4O0I A;  3EZ5 A;  2HB5 A;  1JL1 A;  4O55 A;  2B4J A;  3ZSO A;  1RTH A;  4Z4H A;  4Z4C A;  3OYI A;  3T1A A;  3AO5 A;  4DTJ A;  4M41 A;  3V9U A;  2YHB A;  3TAG A;  4M45 A;  4FYD A;  3OJU A;  1JLA A;  3NGI A;  3S3N A;  4BDP A;  2WOM A;  3QEP A;  4KHS A;  2A1S A;  1LW2 A;  3WNF A;  3NF7 A;  3LAM A;  3O3F A;  1NK0 A;  3E01 A;  1TKD A;  3AVK A;  4B9M A;  2P5O A;  1WAF A;  2KFZ A;  1S1X A;  3WNG A;  4CK3 A;  2X74 A;  4B8C A;  3M8S A;  1N6Q A;  3RWU A;  1KLN A;  3OYE A;  3D0P A;  5JS1 A;  2ZE2 A;  4PA1 A;  4FM1 A;  5E41 A;  4QAG A;  3LWL A;  3AVM A;  4CEQ A;  3T19 A;  4LSL A;  2IOC A;  2YKM A;  3AVB A;  3CQ8 A;  1A5W A;  3G0Z A;  3IG1 A;  4O5B A;  3KLG A;  4DTX A;  2G8K A;  4B9L A;  2HMI A;  1S1U A;  1BCO A;  3VQ6 A;  4CIE A;  3RRH A;  1BL3 A;  3DOK A;  1RT2 A;  1KFD A;  3PO5 A;  4Q5V A;  4OGE A;  3P83 D;  3L2W A;  4FLT A;  1BI4 A;  2OPP A;  3SJJ A;  4AHR A;  2PYJ A;  4N76 A;  4KHY A;  2ITG A;  3SYZ A;  3KKS A;  4CK2 A;  3NH2 A;  1K6Y A;  2O4G A;  3LAL A;  4AHC A;  1LV5 A;  3I8D A;  3OS0 A;  1WSJ A;  4OLA A;  3HO1 A;  3ZSW A;  4CF8 A;  3DLE A;  4F2R A;  1FKO A;  3S3O A;  3SUN A;  4RW9 A;  4LH5 A;  1W0H A;  4DSI A;  3O4N A;  1YVU A;  3OJS A;  4HCC A;  3NBP A;  2OA8 A;  1KVA A;  4CED A;  1BQN A;  3CM6 A;  4IG3 A;  3NH1 A;  4DMN A;  4Z4F A;  1TKX A;  1RIL A;  4FJ5 A;  4CF9 A;  4B3O A;  1RDA A;  4M3Z A;  4I7F A;  2HHV A;  2DFE A;  4ZHR A;  4RW7 A;  1KLM A;  5KRT A;  3TAP A;  4RW8 A;  2HVI A;  4HUG A;  3ALY A;  4M3Y A;  2VWK A;  4CJS A;  3ZT2 A;  4OKK A;  3DM2 A;  1RBR A;  5C24 A;  3L2Q A;  2BDP A;  1BGX T;  1S5J A;  2G8V A;  3SQ0 A;  2HW3 A;  3AA2 A;  3AV9 A;  3HVT A;  4GW6 A;  3AVH A;  2YHA A;  4KTZ A;  3F9K A;  3OYL A;  3DRS A;  3LAN A;  2XO7 A;  1DLO A;  3NGZ A;  3C6T A;  3TI0 A;  4M3T A;  4CGD A;  3HP6 A;  4FLX A;  1HYS A;  1JL2 A;  1NKE A;  3FFI A;  4AIL C;  3NF9 A;  1MU2 A;  3LP2 A;  2VG6 A;  3THV A;  2RPI A;  1ZBH A;  4BE1 A;  4FJM A;  4DFM A;  4DU4 A;  3LDS A;  3A2F A;  4FCY A;  5KTQ A;  3PO4 A;  4FJJ A;  3ZT3 A;  3SQ2 A;  2ZD1 A;  3TAE A;  1QQC A;  4CGI A;  3DI6 A;  1U49 A;  3PX0 A;  3PY8 A;  3AA3 A;  5KI6 A;  1RDC A;  4N56 A;  4CF1 A;  1XHZ A;  3C6U A;  4PQU A;  3DLR A;  4CFB A;  1IG9 A;  4ELU A;  4RG8 A;  4E7H A;  4CER A;  4FLZ A;  1JLE A;  3LPU A;  3SV3 A;  1IKY A;  4C8K A;  3BDP A;  4FK0 A;  1Q8I A;  1HJR A;  4JS5 A;  4DSL A;  4CHO A;  4CEC A;  3KIO A;  2IAJ A;  3P1G A;  2IGI A;  3MED A;  1SL2 A;  1A5X A;  2FBV A;  3PX4 A;  4AHT A;  2G8U A;  3C95 A;  1G15 A;  3AA4 A;  3MEG A;  4M3R A;  3OYD A;  3RR7 A;  4CEE A;  4QCL A;  3L2R A;  3KLH A;  4F8R A;  1RBU A;  3I0R A;  4HCB A;  2QKB A;  1UAX A;  2HHW A;  4UQG A;  3LWM A;  3KK2 A;  4AH9 A;  2HVH A;  1WNS A;  2HHQ A;  3LAK A;  4KKO A;  4FLV A;  3RMA A;  2HHS A;  2HND A;  3NCI A;  1RDB A;  3TAM A;  1RT1 A;  4FW1 A;  1RTD A;  2KFN A;  1TKZ A;  2B5J A;  4CEA A;  1WSE A;  4FZZ A;  4M3X A;  4DQR A;  4CFC A;  3V9Z A;  1JKH A;  1U4B A;  1YTA A;  3V9X A;  1Q9X A;  1LWC A;  4KHN A;  3UIQ A;  4LSN A;  4FJX A;  4PY5 A;  4DQS A;  2GV9 A;  2XRI A;  5KRS A;  2R7Y A;  2G8F A;  3IS9 A;  1L3S A;  2B6A A;  3OYN A;  4JRP A;  2Q3S A;  4BE2 A;  1VRT A;  2Y1I A;  1IKX A;  5JS2 A;  3LP0 A;  1HQU A;  2VG7 A;  4F4K A;  4FJI A;  4HUE A;  4DF8 A;  4MQ3 A;  3ZSZ A;  2RN2 A;  2EX3 A;  3ZSX A;  1RT7 A;  3VQ4 A;  4KHU A;  3VQQ A;  1RBT A;  4CGH A;  1WLJ A;  5FRO A;  3V4I A;  1S9E A;  1NKC A;  4FW2 A;  1Y97 A;  4M3W A;  1C1B A;  1TV6 A;  4N41 A;  4F3O A;  1SUQ A;  2OZM A;  4DG1 A;  4IBN A;  1TK0 A;  3NF6 A;  1NK5 A;  1BI4 B;  3ZT0 A;  2OYQ A;  1JLG A;  3SQ1 A;  1HNV A;  4Z0U A;  1GOB A;  3OS2 A;  4C8L A;  1JLB A;  1S1T A;  2E6M A;  4IFY A;  1TVR A;  4DLG A;  1EXQ A;  3ZCM A;  4DU1 A;  4KB1 A;  3VQE A;  4FLY A;  2X6S A;  1SKR A;  3NAE A;  3WNE A;  4KRF A;  3DMJ A;  3L3U A;  1VSM A;  4I9Q A;  1IH7 A;  3AVG A;  1RDD A;  2HNZ A;  4DTN A;  1F21 A;  4AHU A;  3VQD A;  1LW0 A;  5DMR A;  1VSJ A;  3VQ8 A;  4FZX C;  1UA1 A;  4B08 A;  5I42 A;  1T05 A;  4B9S A;  3DRP A;  4NYF A;  3B6O A;  3HP9 A;  2NUB A;  3L2V A;  2EHG A;  4J2D A;  4I9L A;  1BHL A;  3NE6 A;  1JLC A;  1RT4 A;  1WN7 A;  3S3M A;  1WSG A;  3DRR A;  1YT3 A;  3NHG A;  3SUO A;  3SCX A;  4E7I A;  4OPJ A;  1C1A A;  2KW4 A;  2Z1J A;  3AVL A;  1W9H A;  4HVJ A;  1XI1 A;  4FJL A;  4L8R B;  2F8T A;  4FJH A;  4EP5 A;  3K59 A;  4FJ8 A;  4IFV A;  1ASU A;  3NGY A;  1SKS A;  4FVM A;  2D0A A;  4KTW A;  4TSX A;  5HRP A;  4DTU A;  3EYZ A;  2FBT A;  4CFA A;  4KB0 A;  4K8X A;  3RTV A;  2IS3 A;  4K8Z A;  3L3V A;  4O44 A;  1A5V A;  2QXF A;  2ATQ A;  4DSE A;  1ZBU A;  3SZ2 A;  4EZ6 A;  4F2S A;  4DF4 A;  4ELT A;  4E7J A;  3L8B A;  2QK9 A;  2ZQB A;  4W5R A;  1J5O A;  3OYF A;  3HM9 A;  4DQQ A;  1GOC A;  2DFH A;  3HPO A;  4DTM A;  3T3F A;  1B92 A;  1NJW A;  5FRM A;  5DK5 A;  1RT5 A;  3QLH A;  4CGF A;  3V1Q A;  3OYB A;  4CEO A;  2XY6 A;  3K5M A;  3SPY A;  3RRG A;  4Z4I A;  3OYA A;  2XHB A;  4B9N A;  1U45 A;  1KVC A;  4H4O A;  1FK9 A;  4G1Q A;  2XY5 A;  3CYM A;  1NOZ A;  1JXB A;  2G8H A;  1KCF A;  3M8R A;  3EY1 A;  3HJF A;  1S6Q A;  3C94 A;  4CJ4 A;  2AJQ A;  1X1P A;  1VSE A;  1D5A A;  1IO2 A;  3CM5 A;  3OYG A;  3QEI A;  4EZ9 A;  3CFR A;  1QTM A;  3ZT1 A;  4I2Q A;  4MFB A;  4GVM A;  4AHS A;  2G8I A;  3V81 A;  1QSY A;  1JLQ A;  3KK3 A;  5CYQ A;  5HRS A;  1TAQ A;  4KFB A;  4N5S A;  3DOL A;  2IC3 A;  3RMD A;  1S6P A;  1RBV A;  1LWF A;  3G10 A;  4CJK A;  1EET A;  3QNO A;  3QES A;  4B9U A;  1WAJ A;  4N47 A;  4DLE A;  1SL0 A;  3AA5 X;  2Z1G A;  5C42 A;  4J2E A;  3U3G A;  4E1N A;  5CZ1 A;  1U04 A;  5KGW A;  4CGJ A;  3MAQ A;  3QER A;  3SV4 A;  4FJ9 A;  4Z4E A;  3QIN A;  1VSK A;  4CIF A;  3MXM A;  4FLW A;  3F73 A;  3U3Y A;  1WSI A;  1J53 A;  2F96 A;  1UWB A;  3VQA A;  3NFA A;  2VWJ A;  5HP1 A;  1C0T A;  1EP4 A;  1I39 A;  4LY7 A;  4DQI A;  1NK6 A;  4FJ7 A;  1LAW A;  2GBZ A;  2YV0 X;  3B6P A;  1NJY A;  4KPY A;  4E7L A;  3RMB A;  4OJR A;  5FDL A;  3KTQ A;  2WON A;  3P5J A;  1KSP A;  4OKJ A;  4DWI A;  4LH4 A;  3DLK A;  3TAN A;  3LP3 A;  3RMC A;  1ZYQ A;  1X9M A;  1L3T A;  4FLU A;  4KI6 A;  4CJQ A;  4OPK A;  4CEB A;  4DSK A;  4DTR A;  3ASM A;  1FXX A;  4E1M A;  3ZSR A;  3VA0 A;  2RF2 A;  3AVN A;  1ASW A;  1JXE A;  5J1E A;  3JYT A;  3TAF A;  4KAZ A;  2HHX A;  1HNI A;  1EX4 A;  4CHP A;  1VK0 A;  3ISN C;  2OZS A;  2FBY A;  3DLG A;  3D45 A;  4FJG A;  4NCA A;  2KTQ A;  2DY4 A;  2O4I A;  3HYF A;  4NCB A;  3KD5 E;  1LAV A;  1TL1 A;  4ICL A;  1TK5 A;  2QKK A;  4ZTF A;  1NK7 A;  3DYA A;  3O3G A;  1GOA A;  1RNH A;  1RBS A;  4O0J A;  2I5J A;  4CJF A;  4DS4 A;  3PX6 A;  4CJV A;  3SPZ A;  4PUO A;  4CJP A;  3OY9 A;  3DLB A;  3VQB A;  4BWJ A;  1QS4 A;  3OYH A;  4IG0 A;  4KI4 A;  5D3G A;  1L5U A;  2YNF A;  4B9T A;  5J2Q A;  2YNH A;  1B9F A;  1FKP A;  1RT6 A;  1KVB A;  3NH0 A;  3QIP A;  2ETJ A;  2DFF A;  1SV5 A;  3V1R A;  3V9W A;  3VA3 A;  1B9D A;  4IDK A;  4R5P A;  1HQE A;  4CJT A;  1IKV A;  1KTQ A;  1QE1 A;  2OPQ A;  3M8Q A;  3KLF A;  1ZBL A;  1X9S A;  3OYM A;  3WNH A;  5HBM A;  4ELV A;  4O4G A;  4B9V A;  3TWH A;  2W42 A;  3KJV A;  1QSS A;  4YFU A;  3HXM A;  5I3U A;  1C0M A;  1J9A A;  3OYJ A;  3QO9 A;  1XHX A;  4LD0 A;  3AO3 A;  1T7P A;  4E3S A;  4CJ5 A;  1RTJ A;  3KKR A;  3PUF A;  1ITG A;  1VSD A;  1T8E A;  4CHQ A;  4DSF A;  5HLF A;  1U47 A;  4CCH A;  4RW6 A;  3K58 A;  1C1C A;  3M8P A;  4Z4G A;  1NKB A;  1NK9 A;  1DTT A;  4Y1C A;  3OS1 A;  1DTQ A;  2D0C A;  2FC0 A;  2P51 A;  3CFP A;  4FK4 A;  1YTU A;  4ZTJ A;  4E89 A;  3OYC A;  3OYK A;  4HUF A;  3VQP A;  3AVA A;  1NK8 A;  4DFK A;  1SKW A;  2Y1J A;  1N5Y A;  3HK2 A;  4DTO A;  3O4Q A;  3NDK A;  3LZJ A;  2X6N A;  4OVL A;  3ZT4 A;  4CJU A;  4FXD A;  2KZM A;  3KLE A;  3U6F A;  1JLF A;  3AVJ A;  4CES A;  4CHY A;  1S9G A;  4OGC A;  3MXI A;  2VG5 A;  5CZ2 A;  3MXJ A;  3QEW A;  3DLH A;  4CIG A;  4Q0B A;  5K14 A;  3K5L A;  4Y1D A;  3KD1 E;  4JRQ A;  4W5O A;  3K2P A;  1CZB A;  2XY8 A;  3SUP A;  4XIU A;  1SL1 A;  4J2B A;  1KFS A;  4M42 A;  1ZBI A;  4CJE A;  1WSF A;  4BE0 A;  1RCH A;  4FZY A;  2D5R A;  1BIS A;  2LSN A;  3LZI A;  4C8N A;  4W5N A;  2BE2 A;  1I3A A;  3SI6 A;  5HRR A;  4CE9 A;  1C0U A;  4H8K A;  3LPT A;  4CF2 A;  4FJN A;  3NF8 A;  4KO0 A;  4AHV A;  5HRN A;  3HT3 A;  3I0S A;  5J2M A;  2HNY A;  3V6D A;  3MEE A;  5SZT A;  3ZSV A;  1BIZ A;  3SNN A;  3ITH A;  3ZSQ A;  1VSL A;  3KLI A;  4FM2 A;  1S1V A;  2JGU A;  5EU7 A;  4CHZ A;  1TKT A;  1NJZ A;  2PZS A;  4CK1 A;  4DFJ A;  5KGX A;  2F8S A;  1D8Y A;  4DFP A;  4CHN A;  3HPH A;  1L3V A;  4M3U A;  4QOZ B;  1D9F A;  4CEF A;  1J54 A;  3JSM A;  4JLH A;  2FBX A;  4KRE A;  1XC9 A;  4ID5 A;  3TAR A;  1IKW A;  4HHT A;  3O3H A;  4I2P A;  4CFD A;  1BCM A;  1ZBF A;  3VQ9 A;  4B8A B;  4RW4 A;  3AO4 A;  3H08 A;  1ASV A;  4BDY A;  2G8W A;  1HMV A;  1C6V A;  3HST B;  1U48 A;  3SQ4 A;  1NJX A;  2YNG A;  1S1W A;  3AO1 A;  5J2N A;  3RR8 A;  1Q9Y A;  4DSJ A;  4KV8 A;  5J2P A;  3K5N A;  4E0D A;  1BIU A;  4KHW A;  3TR8 A;  2IDO A;  5SWM A;  2KZZ A;  2PYL A;  3PV8 A;  1UA0 A;  1CXU A;  1RT3 A;  3TAB A;  5HRO A;  1WSH A;  2X78 A;  2P1J A;  3IRX A;  2JLE A;  3V9S A;  4W5T A;  1D9D A;  3AVF A;  4CJ3 A;  4FM0 A;  4DTP A;  3QEV A;  3CFO A;  4E19 A;  1VSI A;  3QNN A;  1NOY A;  1TL3 A;  3AO2 A;  5FRN A;  1CLQ A;  1NK4 A;  1HPZ A;  1Z25 A;  4CJL A;  3KK1 A;  4W5Q A;  2YNI A;  4E7K A;  3CG7 A;  3TAQ A;  4F3T A;  2OPS A;  4CF0 A;  3QET A;  2PY5 A;  4CEZ A;  2D0B A;  4CGG A;  1T03 A;  4DU3 A;  3MEC A;  1LWE A;  1VRU A;  2Z1H A;  3HPG A;  4C8M A;  3K57 A;  4BAC A;  5CYM A;  2E6L A;  4DQP A;  4CJR A;  1R0A A;  1L3U A;  2XY7 A;  1CZ9 A;  4GMJ B;  4H4M A;  1REV A;  3HL8 A;  4BWM A;  4HTU A;  4NYN A;  1XWL A;  4OKE A;  4WE1 A;  1TAU A;  3VQC A;  3QEX A;  2BGG A;  4EP4 A;  3L2U A;  1QHT A;  4PWD A;  1UOC A;  3HVR A;  1CXQ A;  1BQM A;  3S9H A;  2GUI A;  3AVC A;  1HYZ A;  4FJK A;  2HHU A;  2BAN A;  3IAY A;  1EKE A;  4JS4 A;  1KRP A;  3SUQ A;  3QIO A;  4ID1 A;  1X9W A;  4OLB A;  2HHT A;  3OVN A;  1HYV A;  3ULD A;  1VSH A;  1QSL A;  4DTS A;  5T7B A;  4IKF A;  4FK2 A;  2YKN A;  1RTI A;  2DTU A;  4KTQ A;  4BDZ A;  1Z26 A;  4DS5 A;  3AVI A;  5C25 A; 
#chains in the Genus database with same CATH topology
 4AQY K;  4YNQ A;  2KQ2 A;  2VGN A;  3LP1 A;  4CJW A;  1BG3 A;  1TK8 A;  2Z1I A;  4KHQ A;  1ZBS A;  2P5G A;  3G6E N;  1VSF A;  4O0I A;  1VQL N;  4O55 A;  2HBL A;  2HF3 A;  1RTH A;  3ZSO A;  4Z4H A;  3OYI A;  3THW B;  3MN9 A;  1S22 A;  3TAG A;  3E9P A;  4OO1 J;  2PBD A;  3NMU A;  3CPE A;  4BDP A;  2WOM A;  4BVO A;  4ILG B;  2P5O A;  1NK0 A;  3CJA A;  1TKD A;  3AVK A;  5AZJ A;  4BRL A;  1WAF A;  1S1X A;  2X74 A;  3C6A A;  4IJA A;  3M8S A;  4CD3 A;  3RWU A;  3OYE A;  3D0P A;  4H5W A;  3QDK A;  4PA1 A;  5AQR A;  3AVM A;  3QML A;  3T19 A;  4LSL A;  3CCS N;  2UYT A;  3SMS A;  1A5W A;  1VQ9 N;  4O5B A;  1NGE A;  2HMI A;  1S1U A;  3VQ6 A;  2CH5 A;  5AQO A;  3RRH A;  3DOK A;  1C0G A;  5AQM A;  4BRH A;  3UKU A;  3P83 D;  4I6M B;  3L2W A;  2OPP A;  4CZL A;  1YXQ A;  3VTI A;  3KKS A;  2GX9 A;  4WYB A;  3SAG A;  3ZSW A;  2A42 A;  3D2E A;  4F2R A;  3C0B A;  3SUN A;  4A5B A;  4BG8 A;  4LH5 A;  1W0H A;  4YOX A;  3ENO A;  1YF5 L;  1YVU A;  3A5O C;  2OA8 A;  4CVN E;  1BQN A;  3CM6 A;  4LFA K;  3NH1 A;  2QWL A;  1RDA A;  2NRT A;  4NLB A;  4M3Y A;  1TYQ B;  4CJS A;  2FSN A;  4ISF A;  3DM2 A;  2BDP A;  1BGX T;  3O9R A;  2YHA A;  3TI0 A;  4CGD A;  1HYS A;  2UUC K;  2VG6 A;  3MCA B;  4BE1 A;  4DU4 A;  2D4W A;  5JLH A;  2ZD1 A;  3LDQ A;  3PY8 A;  5KI6 A;  5GAG P;  3M3Z A;  3VGM A;  3DLL L;  1YJ9 N;  4JI0 K;  3TU5 A;  4FLZ A;  3IUC A;  4JK9 A;  3VER A;  4EHU A;  4C8K A;  4PHT X;  3J8A A;  4FK0 A;  4YOT A;  4FWR A;  4CEC A;  3KIO A;  3DJC A;  3CF5 L;  1M1K O;  3A5L C;  4BGB A;  4A5A A;  2FXU A;  3OYD A;  4CEE A;  4HCB A;  3R6M A;  4MLH A;  1UAX A;  2OCE A;  1N8R O;  2P9I A;  3JS6 A;  4FWP A;  5JIC A;  4FLV A;  3WQU A;  4BRP A;  5EOY A;  2D0P A;  1TKZ A;  2B5J A;  5AZJ B;  3H3N O;  2GEM A;  1U4B A;  3UIQ A;  4DQS A;  2R7Y A;  2B6A A;  5C0Y A;  1IKX A;  4BY9 C;  5JS2 A;  3U8X A;  1NGD A;  1N32 K;  5AQQ A;  2EX3 A;  2P9P A;  4JI5 K;  4KHU A;  3VPZ A;  4CGH A;  3EL2 A;  4DKW A;  1Y97 A;  3JXU A;  1OKJ A;  3UKU B;  3VEX A;  2QA4 N;  3EKU A;  3MMV A;  3NF6 A;  3ZT0 A;  3GBT A;  2Q1N A;  4Z0U A;  4IFY A;  2A5X A;  5BR9 A;  4FLY A;  4H5R A;  1Z6R A;  3D2E B;  3L3U A;  1VQ5 N;  2E88 A;  4AHU A;  3VQD A;  1LW0 A;  5DMR A;  1KAZ A;  4FZX C;  1UA1 A;  5I42 A;  2IVP A;  1T05 A;  3O9S A;  3CIP A;  1YVN A;  2P9K A;  3B6O A;  5FPM A;  2NUB A;  3L2V A;  3C6H A;  1BHL A;  2GTD A;  5AQI A;  1WSG A;  3DRR A;  1YT3 A;  3SUO A;  3SCX A;  4OPJ A;  3E9O A;  1YAG A;  3K59 A;  4FJ8 A;  4IFV A;  4FVM A;  4K8X A;  3RTV A;  2IS3 A;  2IIR A;  1SQK A;  3CXC M;  1ZBU A;  4EZ6 A;  5EVZ A;  5BRE A;  4ELT A;  3EZW A;  2QK9 A;  3HM9 A;  4DQQ A;  1GOC A;  5DK5 A;  4IEI A;  3K5M A;  3SPY A;  4B9N A;  4H4O A;  5H1S Q;  2A3Z A;  4ILJ A;  1NOZ A;  1JXB A;  1KCF A;  2E1Z A;  3EY1 A;  1NMD A;  1S6Q A;  1X1P A;  1VSE A;  5AZI A;  2WUS A;  4JI8 K;  4EZ9 A;  4AHS A;  1JLQ A;  3KK3 A;  3O1W A;  5F1X A;  4KH6 A;  1S6P A;  3HSC A;  4CJK A;  2P9I B;  3QNO A;  1WAJ A;  4N47 A;  1E3M A;  2Z1G A;  5C42 A;  4YOY A;  4J2E A;  3D6R A;  4Z4E A;  2O8E A;  1Q86 O;  4DV1 K;  2CGL A;  1J53 A;  3OBY A;  4HWI A;  2VWJ A;  5HP1 A;  1XQS C;  5M1N A;  1YIT N;  5AJ3 K;  4LY7 A;  4DQI A;  4E7L A;  2WON A;  4OKJ A;  4YOW A;  4LH4 A;  5JVG L;  2YHY A;  3LP3 A;  1ZYQ A;  4CEB A;  4DSK A;  2P9P B;  3ASM A;  1FXX A;  4B3R K;  3ZSR A;  2WBN A;  2Q31 A;  3ULE A;  3VA0 A;  5AQG A;  3FZL A;  3AVN A;  5J1E A;  3JYT A;  4KAZ A;  3ZX3 A;  3J80 O;  3FE1 A;  2OZS A;  1MWK A;  4NCA A;  3HYF A;  4NCB A;  3T1Y K;  2YI1 A;  4NLC A;  3WEE A;  1RNH A;  3K0S A;  3CI5 A;  2I5J A;  4CJF A;  3PX6 A;  4CJV A;  3VF4 A;  1V4T A;  3VQB A;  4BR4 A;  4KI4 A;  3OYH A;  1L5U A;  3CD6 N;  3L4I A;  2P9S A;  4BG9 A;  1B9F A;  2P9K B;  2DFF A;  4JHD A;  4X64 K;  3VA3 A;  2UUA K;  4B3S K;  3BY5 A;  2OPQ A;  1X9S A;  5E26 A;  4JYA K;  1QVF M;  3KJV A;  5I3U A;  3E66 A;  4EHT A;  1WBD A;  3FZH A;  1RTJ A;  3PUF A;  3WXM B;  3PIO L;  4WQ4 A;  1NGH A;  4DSF A;  4CI6 A;  3WT0 A;  3M8P A;  1NKB A;  1DTT A;  1VQ7 N;  3EKS A;  1U6Z A;  1YTU A;  3CFP A;  1DKG D;  3OYC A;  4HUF A;  3HK2 A;  3ENB A;  5AQN A;  2PFU A;  3U6F A;  4JD2 A;  2BUP A;  3EO3 A;  2VG5 A;  3C65 A;  3CJC A;  4CZI A;  5AZI B;  4Y1D A;  1SAZ A;  4JK8 A;  4W5O A;  5FPN A;  1RDU A;  3FLC O;  1KFS A;  4CD1 A;  4BE0 A;  2UU9 K;  1RCH A;  4FZY A;  2D5R A;  4W5N A;  4CBU A;  1C0U A;  4H8K A;  3LPT A;  4FJN A;  3NF8 A;  4KO0 A;  3SBG A;  3HT3 A;  2O8E B;  3VGL A;  1GLE G;  1BIZ A;  3D2F A;  1HUX A;  3ZSQ A;  4B1U B;  4FM2 A;  1S1V A;  2JGU A;  1T3V A;  4EFH A;  5LY3 A;  3U9D A;  5EU7 A;  4CJ7 A;  1TKT A;  3EE8 A;  3SMP A;  3I56 N;  4BRA A;  4CHN A;  2HHH K;  4K25 A;  4DR7 K;  3JSM A;  4JLH A;  2FBX A;  3ULE B;  5CR4 A;  4ID5 A;  3TAR A;  1IKW A;  1ZC6 A;  2P9L A;  3L6Q A;  4CFD A;  1NGC A;  4BR9 A;  4RW4 A;  1ASV A;  3SQ4 A;  3NVK A;  3AO1 A;  3HI0 A;  3VET A;  3RR8 A;  4BRG A;  3T7Z A;  3K5N A;  3J7Z O;  4KHW A;  3TR8 A;  2IDO A;  5SWM A;  1NGI A;  3WEE B;  1CXU A;  3IRX A;  2JLE A;  3QEV A;  4DTP A;  3CFO A;  2P9S B;  4E19 A;  1M90 O;  4BR7 A;  5C12 A;  4GVE A;  3TAQ A;  2OPS A;  5BR8 K;  1IBK K;  3TSP A;  3I33 A;  1LWE A;  1VQ8 N;  4H4M A;  3HL8 A;  4NYN A;  3VQC A;  3L2U A;  4H0P A;  1UOC A;  3HVR A;  2P9N A;  4IDH A;  3MN7 A;  4DR3 K;  4IOA L;  2ASM A;  2YKN A;  1RTI A;  4BRK A;  1NU0 A;  4DS5 A;  3AVI A;  4HCC A;  3VQ7 A;  3VQ5 A;  5CY4 A;  1O1W A;  4RCH A;  2BH1 A;  4IXC A;  4J2A A;  5GIO A;  4BRM A;  3K5O A;  4C8O A;  4JD2 B;  4DR4 K;  2KTQ A;  4DTJ A;  2E8A A;  4Z4C A;  4M41 A;  5AQS A;  3UB5 A;  3V9U A;  1ZXO A;  3S3N A;  3NGI A;  3QEP A;  2QEX N;  1LW2 A;  5AQY A;  3O3F A;  3E01 A;  3DXM A;  3LDO A;  4CK3 A;  2VQE K;  4H5V A;  4B8C A;  2DPN A;  2HMP A;  4FM1 A;  5E41 A;  3D2F B;  3IFR A;  3AVB A;  3G0Z A;  4B9L A;  3F2K A;  4IFE A;  1BCO A;  3CER A;  4CIE A;  1NGA A;  4XH1 A;  2FF3 B;  1IBL K;  1KFD A;  1BI4 A;  5BPM A;  4AHR A;  2PYJ A;  4N76 A;  2V7Z A;  2P9L B;  4AHC A;  1LV5 A;  3I8D A;  3OS0 A;  1WSJ A;  5BPN A;  3S3O A;  4H0X B;  4XH5 A;  3NBP A;  3ATV A;  4IG3 A;  1K73 O;  4FJ5 A;  4M3Z A;  4WQ5 A;  1N33 K;  2DFE A;  4RW7 A;  5KRT A;  4HUG A;  3VMF B;  3ZT2 A;  2I7N A;  3L2Q A;  2G8V A;  3AV9 A;  3HVT A;  5AQK A;  3CET A;  4UY8 O;  3OYL A;  3F9K A;  2XO7 A;  3NGZ A;  5JLF A;  4FLX A;  2NRH A;  3FFI A;  1ILY A;  4JN4 A;  3E1Y A;  1ZBH A;  3A2F A;  4FJJ A;  5KTQ A;  4BRQ A;  5EXW A;  4ISE A;  3SQ2 A;  5BN9 A;  1T6C A;  2P9N B;  3PX0 A;  2A41 A;  3LL3 A;  1XHZ A;  4PQU A;  4CFB A;  3PIP L;  4ELU A;  4CER A;  3SV3 A;  3CCM N;  1IKY A;  2KHO A;  3BDP A;  1Q8I A;  2GUP A;  4JS5 A;  2E2O A;  4CHO A;  4DSL A;  2IGI A;  1ESV A;  4BC3 A;  4GV3 A;  5KPZ A;  1SL2 A;  2ZGZ A;  2G8U A;  1G15 A;  3AA4 A;  3MEG A;  4M3R A;  5AQZ A;  4LF5 K;  4AF1 A;  1EQY A;  4UQG A;  3LWM A;  4H5N A;  2I7P A;  3ID6 A;  3LAK A;  3QBW A;  4FPB A;  4DUZ K;  4FW1 A;  3CMA N;  1RTD A;  1WSE A;  3UKR A;  1YTA A;  3WXI A;  4LSN A;  2QWN A;  1LOT B;  2KLA A;  4NXM K;  2PAV A;  2G8F A;  2QXL A;  4X66 K;  4BE2 A;  1P8Z A;  4BGA A;  3TTD A;  2YX6 A;  3LP0 A;  2WC9 A;  4HUE A;  3CCE N;  4A2A A;  2RN2 A;  3W0L A;  3VQ4 A;  3VQQ A;  4BR0 A;  1QQM A;  5FRO A;  2GWK A;  2H3G X;  4N41 A;  4F3O A;  1TK0 A;  1NJI O;  1BI4 B;  2OYQ A;  4C8L A;  2E6M A;  4R79 A;  1EXQ A;  3ZCM A;  4DU1 A;  3VQE A;  3KHY A;  1SKR A;  2NRX A;  3WNE A;  5HOO A;  3DMJ A;  4K42 A;  4O5F A;  1IH7 A;  1RDD A;  2HNZ A;  3AVG A;  3J7A P;  4JEP A;  3OBW A;  4GY2 B;  1N34 K;  3VQ8 A;  3DRP A;  4NYF A;  1T6D A;  2NNW A;  3HP9 A;  4J2D A;  2E2P A;  4DR1 K;  4I9L A;  4DV0 K;  1OVQ A;  2Z1J A;  3AVL A;  4FJL A;  4L8R B;  4FPA A;  3SJH A;  1ASU A;  4KTW A;  5AQP A;  4DTU A;  4LFC K;  3EYZ A;  4KB0 A;  2QWR A;  4JI6 K;  3L3V A;  4H0Y B;  1SS6 A;  4O44 A;  1WUA A;  4DSE A;  1HPM A;  2E2Q A;  4RWT A;  3SZ2 A;  1NGF A;  3HM8 A;  3L8B A;  4W5R A;  3QFU A;  2DFH A;  1RT5 A;  3QLH A;  4Z4I A;  3OYB A;  1BU6 O;  3RRG A;  2O8D A;  3HZ6 A;  4YOU A;  2XHB A;  1FK9 A;  2XY5 A;  4FOE A;  3CYM A;  3P4I A;  4U7B A;  3UE5 A;  3EEQ A;  4DV2 K;  3IDH A;  3R8E A;  3CCJ N;  4IO9 L;  2E5L K;  1NGJ A;  3FGU A;  3HJF A;  5BN8 A;  3C94 A;  4CJ4 A;  2AJQ A;  1IO2 A;  3QEI A;  1ATR A;  5LJV A;  3CFR A;  4GV6 A;  1QSY A;  3N4Q A;  5CYQ A;  4WFA L;  4BRN A;  1BUP A;  1RBV A;  4GNI A;  1EET A;  3GE1 A;  1SL0 A;  1Y64 A;  4E1N A;  4CGJ A;  4CIF A;  3U3Y A;  2OTL N;  3NFA A;  3UKR B;  3ZYY X;  1EP4 A;  1KAX A;  1LAW A;  2GBZ A;  4OJR A;  5FDL A;  3KTQ A;  1KSP A;  4BC4 A;  4DCH A;  3OW2 M;  3DLK A;  3TAN A;  4KI6 A;  1X9M A;  4QS9 A;  3M1F A;  4DTR A;  3LM9 A;  5MLC Q;  3CJ7 A;  3LDN A;  5KQD A;  1VQP N;  3CCR N;  4KBO A;  3J81 O;  3F5T A;  4DV7 K;  3O9T A;  2FBY A;  3DLG A;  4FJG A;  2O4I A;  3KD5 E;  1LAV A;  4IJN A;  4C23 A;  1TK5 A;  3O3G A;  2V52 B;  1NM1 A;  5I9E B;  3OHR A;  3SPZ A;  1HX1 A;  4CJP A;  4PUO A;  3DLB A;  1QS4 A;  5D3G A;  2YNF A;  4JKD A;  4B9T A;  5KPT A;  1FKP A;  3CJB A;  4PL8 A;  4X65 K;  3NH0 A;  1SV5 A;  2HF4 A;  4PL7 A;  3V9W A;  1B9D A;  4R5P A;  4WCE L;  1IKV A;  1QE1 A;  3M8Q A;  3P31 A;  4JKG A;  4ELV A;  2Q0R A;  3TWH A;  4BQZ A;  5AQU A;  1C0M A;  1J9A A;  4LD0 A;  1ATN A;  1MWM A;  3KKR A;  1JJ2 M;  1QQN A;  1T8E A;  4CHQ A;  3BZC A;  3LDP A;  4RW6 A;  5AQJ A;  1XC3 A;  2FLO A;  4DB3 A;  2JWL A;  4Y1C A;  1DTQ A;  2D0C A;  2FC0 A;  2O8D B;  3OYK A;  1NK8 A;  2NZT A;  3AVA A;  3SLC A;  3VQP A;  4BRD A;  2W6K A;  3H1Q A;  3DWL A;  4OVL A;  1OH5 A;  3EN9 A;  3KLE A;  5JVH L;  3VEZ A;  3TSQ A;  4OGC A;  4LF7 K;  4CIG A;  4Q0B A;  3G4S N;  3K2P A;  1SL1 A;  4M42 A;  1BIS A;  2VQF K;  1I3A A;  4FO0 A;  3G25 A;  4AHV A;  4BC2 A;  5SZT A;  3ZSV A;  3MX5 A;  1VSL A;  4YDU A;  3ZET A;  3H45 C;  4CK1 A;  4JKH A;  5KGX A;  1D8Y A;  4DFP A;  5AR0 A;  3HPH A;  4M3U A;  4QOZ B;  1D9F A;  4CEF A;  3CPW M;  1QZ6 A;  1XC9 A;  4HHT A;  1DGK N;  1BCM A;  4B8A B;  4X62 K;  3H08 A;  3MN5 A;  2W40 A;  1C6V A;  3HST B;  4H0V B;  1BWF O;  4DSJ A;  4E0D A;  1BIU A;  2KZZ A;  2UXC K;  3TAB A;  3O80 A;  1JCF A;  3TPQ A;  5LL6 Z;  3V9S A;  1TUU A;  2YJE A;  3AVF A;  5GAH P;  4FWS A;  3MDQ A;  3JAM O;  3QNN A;  1NOY A;  1GLC G;  2V51 B;  4CBW A;  3KK1 A;  2YNI A;  4QS8 A;  4F3T A;  4PKG A;  2PY5 A;  5EX5 A;  1Q81 O;  2D0B A;  1X3N A;  3MEC A;  3K57 A;  2Z1H A;  4JKG B;  4EAH D;  4BAC A;  4CZE A;  5CYM A;  3TTF A;  3H3O B;  4GMJ B;  5BRF A;  1XWL A;  1WBB A;  2QWM A;  4BRO A;  4YY3 K;  4B1X B;  1CXQ A;  4FJK A;  2HHU A;  2BAN A;  1EKE A;  1WOQ A;  5B8H A;  1KRP A;  3SUQ A;  3GL1 A;  4FL9 A;  3MN6 A;  4OPA A;  4DTS A;  5T7B A;  4IKF A;  4FWO A;  4FK2 A;  5HL7 L;  1OH7 A;  3QFP A;  2CGJ A;  4BDZ A;  4JKA A;  5C25 A;  2A1R A;  3H1V X;  3BGR A;  2E4L A;  5BPL A;  1HRH A;  3EZ5 A;  1T44 A;  3V1O A;  1JL1 A;  2B4J A;  3T1A A;  3AO5 A;  3AAP A;  2A40 A;  2YHB A;  3K9K A;  4M45 A;  1NG9 A;  3OJU A;  1JLA A;  4AM6 A;  4KHS A;  2GWJ A;  4WQ4 C;  2KFZ A;  3WNG A;  1N6Q A;  1KLN A;  1Z05 A;  3O1B A;  4FVU A;  2ZJQ L;  3LWL A;  5TKY A;  3VTH A;  1X3M A;  2YKM A;  3ZET B;  4RTF D;  3CQ8 A;  3IG1 A;  1BL3 A;  1RT2 A;  3C7N A;  4BRE A;  3SJJ A;  5KPR A;  4CW7 B;  1K6Y A;  2O4G A;  3AAQ A;  4OLA A;  3HO1 A;  3MCP A;  4YHH K;  2QW9 A;  1KVA A;  2BTF A;  4DMN A;  1W2B M;  3VEW A;  4ILH A;  4FWQ A;  3FZF A;  4I7F A;  3AY9 A;  2HHV A;  4ZHR A;  3TAP A;  3CCU N;  4RW8 A;  4YOV A;  1RBR A;  5C24 A;  3SQ0 A;  4WF9 L;  1VQK N;  1HLU A;  3L0Q A;  1K8K A;  3C6T A;  3HP6 A;  5AFU A;  4BQL A;  3NF9 A;  3LP2 A;  3CME N;  3THV A;  2RPI A;  4DFM A;  3R3L A;  5IT9 O;  3MX2 A;  3OA9 A;  4CGI A;  1X9J A;  4N56 A;  4CF1 A;  5FPE A;  1IG9 A;  1VQN N;  2UXB K;  4E7H A;  1JLE A;  4JHD B;  4C1N K;  2F9T A;  1HJR A;  1V4S A;  4A57 A;  2HBJ A;  3P1G A;  3ZEU A;  3MED A;  3CJ1 A;  3TSU A;  3PX4 A;  2FBV A;  4AHT A;  3C95 A;  1BDG A;  4QCL A;  4JAX A;  3KLH A;  4CBX A;  3BEX A;  3THY A;  2WFB A;  2E1Y A;  3W3D A;  2HVH A;  2HHQ A;  1MDU B;  2HHS A;  4DUY K;  3TAM A;  1RT1 A;  2YHW A;  2KFN A;  4JKB A;  2A6A A;  4Y0W A;  4LF8 K;  4DQR A;  4CFC A;  5FRM A;  1JKH A;  1Q9X A;  5DM6 L;  3V9X A;  1JCG A;  4OPH A;  2GV9 A;  2XRI A;  3PSF A;  1L3S A;  2HST A;  3OYN A;  1VRT A;  2P9U A;  1HQU A;  2VG7 A;  4K41 A;  5F2R A;  1NLV A;  3ZSZ A;  3DAW A;  5F0X A;  3EE9 A;  4KH4 A;  1RT7 A;  1QHA A;  3BF1 A;  1RBT A;  3U9Z A;  1S9E A;  3CQX A;  4FW2 A;  1WB9 A;  1C1B A;  1OVY A;  1NK5 A;  1HNV A;  2NRZ A;  3CC7 N;  1GOB A;  1TVR A;  4DLG A;  2X6S A;  3Q7B A;  5LMU K;  1HNZ K;  1F21 A;  1FJG K;  4GKJ K;  3M6G A;  4B08 A;  2EHG A;  4H5T A;  4DR6 K;  3NE6 A;  1I94 K;  1JLC A;  1RT4 A;  3S3M A;  3THX A;  1R59 O;  4E7I A;  1C1A A;  4HVJ A;  4DV3 K;  4GV9 A;  1W9H A;  2W41 A;  4DR5 K;  1XNR K;  3NGY A;  3LDL A;  4TSX A;  2ZWH A;  5HRP A;  1U2V A;  2FBT A;  4K8Z A;  4J8F A;  1K8K B;  1MA9 B;  2ATQ A;  1K8A O;  4DF4 A;  4E7J A;  2ZQB A;  1VQ6 N;  3V1Q A;  2XY6 A;  5AQF A;  4CZF A;  4U67 L;  1KVC A;  1D4X A;  4M7Y A;  2G8H A;  1YI2 N;  3M8R A;  4WQ5 C;  2D1K A;  2FSJ A;  3ZEU B;  4JI4 K;  1D5A A;  3OYG A;  1VQ4 N;  4E1J A;  1QTM A;  4JI3 K;  4I2Q A;  4GVM A;  4V19 S;  2G8I A;  1XUP O;  5EY4 A;  5HRS A;  4KFB A;  4N5S A;  3DOL A;  1Q82 O;  3RMD A;  2ZJP L;  3AAR A;  5FLX O;  3R1X A;  3QER A;  5CZ1 A;  3MAQ A;  3QIN A;  1VSK A;  3SBT A;  3F73 A;  2F96 A;  4IOX A;  1UWB A;  1YJN N;  4O8U A;  5AQH A;  1Q18 A;  3Q7C A;  1I39 A;  1GLJ O;  2YV0 X;  3B6P A;  3VGK A;  1NJY A;  3A8Y A;  3OTO K;  5ADX H;  3P5J A;  2P9U B;  1VQO N;  4DWI A;  4PKH A;  2Q97 A;  3RMC A;  1LCU A;  4FLU A;  4CJQ A;  4OPK A;  4B9Q A;  3R9P A;  4CZK A;  3M5R A;  4E1M A;  1ASW A;  2ASP A;  3AGR A;  3TAF A;  3G71 N;  1HNI A;  1EX4 A;  1VK0 A;  3DXM B;  3ISN C;  4C1N I;  3D45 A;  4FWM A;  1TL1 A;  3O6W A;  2QKK A;  1BO5 O;  4ZTF A;  3VOV A;  1NGG A;  1GOA A;  3I8B A;  1RBS A;  4O0J A;  2QM1 A;  3OY9 A;  3GOI A;  4IG0 A;  3BP8 A;  5GIP A;  2FSK A;  1BOT O;  4B1W B;  2YNH A;  3CJ9 A;  1RT6 A;  1KVB A;  5A2Q O;  3QIP A;  2ETJ A;  3V1R A;  1GLB G;  4IDK A;  1HQE A;  4CJT A;  1ZBL A;  3KLF A;  3WNH A;  5HBM A;  2W42 A;  1XMO K;  4YFU A;  3HXM A;  4MO4 A;  1KQS M;  1U2V B;  1W97 L;  3QO9 A;  1RGI A;  4B3M K;  4E3S A;  4CJ5 A;  1HKB A;  3IKM A;  3BZK A;  3GDQ A;  1HJO A;  1U47 A;  4CCH A;  1C1C A;  4Z4G A;  2GEL A;  3TTC A;  4FK4 A;  1OH8 A;  4ZTJ A;  4XH4 A;  1SKW A;  1C0F A;  2Y1J A;  5FPD A;  1N5Y A;  3LZJ A;  2X6N A;  3CCV N;  1GLF O;  3AVJ A;  4CES A;  4CHY A;  4JKC A;  1E4F T;  3MXI A;  3DLH A;  2QWP A;  3HTV A;  5GAD P;  4PKI A;  4JRQ A;  3KD1 E;  1CZB A;  4A62 A;  4DR2 K;  2XY8 A;  4J2B A;  4BC5 A;  1ZBI A;  2NRR A;  1WSF A;  2LSN A;  3CCL N;  4C8N A;  3WUH A;  3HOS A;  2BE2 A;  5CHI A;  1NMN A;  5HRR A;  4CE9 A;  4MDA A;  5HRN A;  5J2M A;  3I0S A;  2HNY A;  4DHY A;  3V6D A;  2V7Y A;  4MLE A;  3SNN A;  5C15 A;  2O8B A;  3KLI A;  1O13 A;  4DQ8 A;  4DV4 K;  1P90 A;  1NJZ A;  3U4L A;  4DFJ A;  2F8S A;  3SAH A;  4CZJ A;  2F7T A;  4CZH A;  4DV6 K;  4IOC L;  3O3H A;  5M1O A;  1ZBF A;  3VQ9 A;  3AO4 A;  4BDY A;  1HMV A;  4WFN L;  1NJX A;  1S1W A;  2Q2R A;  5J2N A;  4IO8 A;  4KV8 A;  1YJW N;  5BRD A;  3ENH A;  2F9W A;  2PYL A;  3PV8 A;  4NB4 A;  1SZ2 A;  5AFU H;  5HRO A;  1WSH A;  4JI7 K;  4IWV A;  5KQ8 A;  3A0I X;  4W5T A;  1D9D A;  4FM0 A;  3P38 A;  1VSI A;  5FRN A;  1YUW A;  1HPZ A;  1XNQ K;  4JI1 K;  5C2F A;  3CG7 A;  3WXK A;  2IVO A;  4L3Q A;  4CF0 A;  4DU3 A;  4C8M A;  1VRU A;  1Q7Y O;  1HNW K;  4CJR A;  1L3U A;  4BR2 A;  1REV A;  2OTJ N;  4OKE A;  4WE1 A;  1TAU A;  3QEX A;  2BGG A;  5M1P A;  4EP4 A;  1QHT A;  4H0T B;  4YOR A;  1BQM A;  2GUI A;  3IAY A;  2JWK A;  4JS4 A;  3ATU A;  4OLB A;  3OVN A;  3O5B A;  3F9M A;  3ULD A;  1QSL A;  2YHX A;  2DTU A;  4KTQ A;  1Z26 A;  2Y1I A;  1HKG A;  2OPR A;  3VN5 A;  5C2D A;  3MWT A;  3KWI A;  4FWK A;  3FFK B;  2VGM A;  1RDW X;  1KAY A;  1S72 N;  4NCG A;  1TGO A;  3ZSY A;  2RKI A;  2HB5 A;  4XEI A;  1NKE A;  4LF9 K;  2O8F A;  1KXP A;  5LJW A;  4GKK K;  4M7X A;  4FYD A;  2A1S A;  3H6E A;  3WNF A;  3NF7 A;  3LAM A;  5ELZ A;  4B9M A;  5AQL A;  2F4V K;  4G9Z A;  3RSE A;  1GLL O;  5AQX A;  4EIA A;  5JS1 A;  3S41 A;  4Z94 A;  2ZE2 A;  1EWR A;  4QAG A;  2RE2 A;  3CCQ N;  4CEQ A;  5BRH A;  2O8B B;  2IOC A;  3KLG A;  2WTU A;  4DTX A;  2G8K A;  5M1Q A;  4BRC A;  3CHW A;  3VEN A;  2HOE A;  3N4P A;  4BR5 A;  3PO5 A;  4Q5V A;  3E9L A;  3T69 A;  4OGE A;  3A5N C;  4FLT A;  1EWQ A;  1IG8 A;  4KHY A;  2ITG A;  1J6Z A;  3SYZ A;  4AM7 A;  4CK2 A;  3NH2 A;  3LAL A;  2RHK A;  4CF8 A;  2VWB A;  3DLE A;  1FKO A;  4H03 B;  1EO1 A;  4FWN A;  4RW9 A;  4DSI A;  3O4N A;  3OJS A;  4A2B A;  4CED A;  3T1H K;  4Z4F A;  1TKX A;  4YDU C;  1RIL A;  4B3O A;  4CF9 A;  5TKW A;  2HVI A;  1KLM A;  3VEV A;  3ALY A;  2VWK A;  4OKK A;  2HW3 A;  1S5J A;  3AA2 A;  4GW6 A;  3AVH A;  4KTZ A;  3HBT A;  5LMN K;  3DRS A;  3LAN A;  4BRF A;  3QBX A;  3IMX A;  5ADX A;  1DLO A;  4M3T A;  1JL2 A;  4FWL A;  4AIL C;  5DM7 L;  1MU2 A;  4LF4 K;  4FJM A;  3LDS A;  3PO4 A;  4FCY A;  3ZT3 A;  3TAE A;  1QQC A;  3DI6 A;  1U49 A;  3AA3 A;  4IZ9 A;  1RDC A;  5GAE P;  2EWS A;  3J7Y P;  3C6U A;  3DLR A;  4RG8 A;  2ITM A;  3KVG A;  2E2N A;  3LPU A;  1VAZ A;  2UUB K;  4HTL A;  2IAJ A;  1H1V A;  3WXJ A;  1A5X A;  1W7A A;  5M1K A;  3RR7 A;  2HHW A;  3L2R A;  4F8R A;  2QKB A;  1RBU A;  3I0R A;  4JNE A;  3KK2 A;  1N36 K;  4AH9 A;  2O8F B;  1WNS A;  1XMQ K;  3CC4 N;  4KKO A;  2VCP A;  3RMA A;  1HR0 K;  2HND A;  3NCI A;  1RDB A;  3VF6 A;  1RFQ A;  4CEA A;  3MWP A;  4FZZ A;  4M3X A;  3RSE B;  3HRG A;  3V9Z A;  4KHN A;  1LWC A;  4PY5 A;  4FJX A;  1OH6 A;  2ZGY A;  5KRS A;  1TUY A;  3IS9 A;  4JRP A;  2Q3S A;  3SK3 A;  4K43 A;  4F4K A;  4FJI A;  5AQW A;  4DF8 A;  1BA1 A;  2FF6 A;  4MQ3 A;  3CC2 N;  1IJJ A;  3ZSX A;  1WLJ A;  3V4I A;  3H46 O;  1NKC A;  4M3W A;  1TV6 A;  1SUQ A;  2OZM A;  4DG1 A;  4IBN A;  3SAF A;  1VHX A;  1JLG A;  3SQ1 A;  1DEJ A;  3OS2 A;  1JLB A;  1S1T A;  2NLX A;  2O8C A;  4KB1 A;  4LFB K;  4ISG A;  3NAE A;  3PSI A;  4KRF A;  1VSM A;  4I9Q A;  4DTN A;  1BA0 A;  1VSJ A;  3WXL A;  4B9S A;  1WN7 A;  3NHG A;  2KW4 A;  1XI1 A;  2F8T A;  4WFB L;  4FJH A;  4EP5 A;  2VYP A;  3KK7 A;  1SKS A;  4LC9 B;  2D0A A;  3AGK A;  3ZX2 A;  3VEO A;  5IWA K;  3KZB A;  4CFA A;  1DT9 A;  1A5V A;  2QXF A;  5E84 A;  4F2S A;  5M1F A;  1J5O A;  4M63 C;  3OYF A;  2QI2 A;  5CE3 A;  2QWQ A;  4DTM A;  3HPO A;  1NJW A;  3T3F A;  1QVG M;  1B92 A;  2HBM A;  4CGF A;  3CQY A;  4CEO A;  2HBK A;  3OYA A;  3BUZ B;  4JK7 A;  1U45 A;  4G1Q A;  4OX9 K;  1HKC A;  2QWO A;  1JCE A;  3CM5 A;  1ATS A;  2AA4 A;  3ZT1 A;  4MFB A;  3V81 A;  1TAQ A;  2IC3 A;  3FZK A;  3O9Q A;  1LWF A;  3G10 A;  3QES A;  2CGK A;  4B9U A;  4DLE A;  4JKE A;  3AA5 X;  1G99 A;  3U3G A;  1U04 A;  5KGW A;  3SV4 A;  4FJ9 A;  3I55 N;  2ZJR L;  4FLW A;  3MXM A;  1WSI A;  3VQA A;  1IBM K;  1C0T A;  3D7E O;  4CZG A;  1HNX K;  4FJ7 A;  1YIJ N;  1NK6 A;  4KPY A;  3ID8 A;  3RMB A;  1GLA G;  3DXK A;  1L3T A;  2IVN A;  4FSV A;  4IEE A;  4B1Z A;  4F9O A;  2J4R A;  2KKZ A;  3A5M C;  1NWK A;  2RF2 A;  1JXE A;  2HHX A;  2NRW A;  1YHQ N;  4CHP A;  2E20 A;  4MO5 A;  1KC8 O;  2D0O A;  2DY4 A;  4ICL A;  4NO7 A;  4CZM A;  2O8C B;  3KWG A;  3B8A X;  1NK7 A;  3DYA A;  4DV5 K;  4DS4 A;  1J5E K;  1KD1 O;  4BWJ A;  3K9J A;  4QS7 A;  3RVC A;  5J2Q A;  5GIN A;  3C7N B;  1KTQ A;  4B1V A;  4JKF A;  3OYM A;  2QTD A;  4O4G A;  4B9V A;  4H0O A;  1QSS A;  4JI2 K;  3OYJ A;  3FR0 A;  1XHX A;  3VEY A;  3AO3 A;  1T7P A;  1ITG A;  1VSD A;  1FW6 A;  3NVM A;  5HLF A;  3K58 A;  3QIC A;  1NK9 A;  3OS1 A;  2UXD K;  4O8K A;  2NRV A;  2P51 A;  4E89 A;  4B3T K;  4DFK A;  4DTO A;  3O4Q A;  3NDK A;  1VQM N;  3ZT4 A;  4CJU A;  4FXD A;  2KZM A;  3HOT A;  4KHP K;  1JLF A;  1S9G A;  3O08 A;  2Q36 A;  5CZ2 A;  3MXJ A;  3QEW A;  5K14 A;  3THW A;  3K5L A;  4A59 A;  3WQT A;  1S3X A;  3VES A;  4XIU A;  3SUP A;  4CJE A;  2ZF5 O;  3O4W A;  3LZI A;  4A61 A;  5AQV A;  3FZM A;  4JV5 K;  1GLD G;  3SI6 A;  4CF2 A;  3O8M A;  1CZA N;  3MEE A;  1E4G T;  1IV0 A;  3ITH A;  2ASO A;  3GG4 A;  5AQT A;  4CHZ A;  3QB0 A;  3ZX0 A;  2ZM6 K;  5C10 A;  2PZS A;  3DXK B;  3THY B;  2YCH A;  1L3V A;  1J54 A;  4I6M A;  4KRE A;  4FOI A;  3P39 A;  4I2P A;  2W6L A;  2G8W A;  3ZLJ A;  1U48 A;  4BVP A;  1NBW A;  2YNG A;  1Q9Y A;  5J2P A;  1QQO A;  1UA0 A;  1RT3 A;  4B1Y B;  1NNE A;  1QZ5 A;  2X78 A;  2P1J A;  3O9U A;  4K0K K;  4CJ3 A;  2OAN A;  3L4Q A;  2Q0U A;  1TL3 A;  3AO2 A;  3MK6 A;  1CLQ A;  1NK4 A;  1Z25 A;  1TYQ A;  4CJL A;  4W5Q A;  4E7K A;  3QET A;  3BF3 A;  4CEZ A;  4CGG A;  1T03 A;  3HPG A;  4DQP A;  2E6L A;  4MDB A;  3PLA A;  2YJF A;  1R0A A;  2XY7 A;  1CZ9 A;  4BWM A;  4HTU A;  1NGB A;  1K9M O;  2CH6 A;  3VF2 A;  4KH5 A;  4PWD A;  3S9H A;  3AVC A;  1HYZ A;  3QIO A;  4LF6 K;  4ID1 A;  1X9W A;  2HHT A;  1HYV A;  4NXN K;  1VSH A;  5JMV A;  4BRI A;  2AP1 A;  3THX B;  3LM2 A; 
#chains in the Genus database with same CATH homology
 2OPR A;  3VQ7 A;  3VQ5 A;  5CY4 A;  1O1W A;  2KQ2 A;  3VN5 A;  3LP1 A;  4YNQ A;  2A1R A;  4J2A A;  3K5O A;  4CJW A;  4C8O A;  1TK8 A;  2Z1I A;  3BGR A;  4KHQ A;  2E4L A;  2P5G A;  4NCG A;  1HRH A;  1TGO A;  1VSF A;  3V1O A;  3ZSY A;  2RKI A;  4O0I A;  3EZ5 A;  2HB5 A;  1JL1 A;  4O55 A;  2B4J A;  3ZSO A;  1RTH A;  4Z4H A;  4Z4C A;  3OYI A;  3T1A A;  3AO5 A;  4DTJ A;  4M41 A;  3V9U A;  2YHB A;  3TAG A;  4M45 A;  4FYD A;  3OJU A;  1JLA A;  3NGI A;  3S3N A;  4BDP A;  2WOM A;  3QEP A;  4KHS A;  2A1S A;  1LW2 A;  3WNF A;  3NF7 A;  3LAM A;  3O3F A;  1NK0 A;  3E01 A;  1TKD A;  3AVK A;  4B9M A;  2P5O A;  1WAF A;  2KFZ A;  1S1X A;  3WNG A;  4CK3 A;  2X74 A;  4B8C A;  3M8S A;  1N6Q A;  3RWU A;  1KLN A;  3OYE A;  3D0P A;  5JS1 A;  2ZE2 A;  4PA1 A;  4FM1 A;  5E41 A;  4QAG A;  3LWL A;  3AVM A;  4CEQ A;  3T19 A;  4LSL A;  2IOC A;  2YKM A;  3AVB A;  3CQ8 A;  1A5W A;  3G0Z A;  3IG1 A;  4O5B A;  3KLG A;  4DTX A;  2G8K A;  4B9L A;  2HMI A;  1S1U A;  1BCO A;  3VQ6 A;  4CIE A;  3RRH A;  1BL3 A;  3DOK A;  1RT2 A;  1KFD A;  3PO5 A;  4Q5V A;  4OGE A;  3P83 D;  3L2W A;  4FLT A;  1BI4 A;  2OPP A;  3SJJ A;  4AHR A;  2PYJ A;  4N76 A;  4KHY A;  2ITG A;  3SYZ A;  3KKS A;  4CK2 A;  3NH2 A;  1K6Y A;  2O4G A;  3LAL A;  4AHC A;  1LV5 A;  3I8D A;  3OS0 A;  1WSJ A;  4OLA A;  3HO1 A;  3ZSW A;  4CF8 A;  3DLE A;  4F2R A;  1FKO A;  3S3O A;  3SUN A;  4RW9 A;  4LH5 A;  1W0H A;  4DSI A;  3O4N A;  1YVU A;  3OJS A;  4HCC A;  3NBP A;  2OA8 A;  1KVA A;  4CED A;  1BQN A;  3CM6 A;  4IG3 A;  3NH1 A;  4DMN A;  4Z4F A;  1TKX A;  1RIL A;  4FJ5 A;  4CF9 A;  4B3O A;  1RDA A;  4M3Z A;  4I7F A;  2HHV A;  2DFE A;  4ZHR A;  4RW7 A;  1KLM A;  5KRT A;  3TAP A;  4RW8 A;  2HVI A;  4HUG A;  3ALY A;  4M3Y A;  2VWK A;  4CJS A;  3ZT2 A;  4OKK A;  3DM2 A;  1RBR A;  5C24 A;  3L2Q A;  2BDP A;  1BGX T;  1S5J A;  2G8V A;  3SQ0 A;  2HW3 A;  3AA2 A;  3AV9 A;  3HVT A;  4GW6 A;  3AVH A;  2YHA A;  4KTZ A;  3F9K A;  3OYL A;  3DRS A;  3LAN A;  2XO7 A;  1DLO A;  3NGZ A;  3C6T A;  3TI0 A;  4M3T A;  4CGD A;  3HP6 A;  4FLX A;  1HYS A;  1JL2 A;  1NKE A;  3FFI A;  4AIL C;  3NF9 A;  1MU2 A;  3LP2 A;  2VG6 A;  3THV A;  2RPI A;  1ZBH A;  4BE1 A;  4FJM A;  4DFM A;  4DU4 A;  3LDS A;  3A2F A;  4FCY A;  5KTQ A;  3PO4 A;  4FJJ A;  3ZT3 A;  3SQ2 A;  2ZD1 A;  3TAE A;  1QQC A;  4CGI A;  3DI6 A;  1U49 A;  3PX0 A;  3PY8 A;  3AA3 A;  5KI6 A;  1RDC A;  4N56 A;  4CF1 A;  1XHZ A;  3C6U A;  4PQU A;  3DLR A;  4CFB A;  1IG9 A;  4ELU A;  4RG8 A;  4E7H A;  4CER A;  4FLZ A;  1JLE A;  3LPU A;  3SV3 A;  1IKY A;  4C8K A;  3BDP A;  4FK0 A;  1Q8I A;  1HJR A;  4JS5 A;  4DSL A;  4CHO A;  4CEC A;  3KIO A;  2IAJ A;  3P1G A;  2IGI A;  3MED A;  1SL2 A;  1A5X A;  2FBV A;  3PX4 A;  4AHT A;  2G8U A;  3C95 A;  1G15 A;  3AA4 A;  3MEG A;  4M3R A;  3OYD A;  3RR7 A;  4CEE A;  4QCL A;  3L2R A;  3KLH A;  4F8R A;  1RBU A;  3I0R A;  4HCB A;  2QKB A;  1UAX A;  2HHW A;  4UQG A;  3LWM A;  3KK2 A;  4AH9 A;  2HVH A;  1WNS A;  2HHQ A;  3LAK A;  4KKO A;  4FLV A;  3RMA A;  2HHS A;  2HND A;  3NCI A;  1RDB A;  3TAM A;  1RT1 A;  4FW1 A;  1RTD A;  2KFN A;  1TKZ A;  2B5J A;  4CEA A;  1WSE A;  4FZZ A;  4M3X A;  4DQR A;  4CFC A;  3V9Z A;  1JKH A;  1U4B A;  1YTA A;  3V9X A;  1Q9X A;  1LWC A;  4KHN A;  3UIQ A;  4LSN A;  4FJX A;  4PY5 A;  4DQS A;  2GV9 A;  2XRI A;  5KRS A;  2R7Y A;  2G8F A;  3IS9 A;  1L3S A;  2B6A A;  3OYN A;  4JRP A;  2Q3S A;  4BE2 A;  1VRT A;  2Y1I A;  1IKX A;  5JS2 A;  3LP0 A;  1HQU A;  2VG7 A;  4F4K A;  4FJI A;  4HUE A;  4DF8 A;  4MQ3 A;  3ZSZ A;  2RN2 A;  2EX3 A;  3ZSX A;  1RT7 A;  3VQ4 A;  4KHU A;  3VQQ A;  1RBT A;  4CGH A;  1WLJ A;  5FRO A;  3V4I A;  1S9E A;  1NKC A;  4FW2 A;  1Y97 A;  4M3W A;  1C1B A;  1TV6 A;  4N41 A;  4F3O A;  1SUQ A;  2OZM A;  4DG1 A;  4IBN A;  1TK0 A;  3NF6 A;  1NK5 A;  1BI4 B;  3ZT0 A;  2OYQ A;  1JLG A;  3SQ1 A;  1HNV A;  4Z0U A;  1GOB A;  3OS2 A;  4C8L A;  1JLB A;  1S1T A;  2E6M A;  4IFY A;  1TVR A;  4DLG A;  1EXQ A;  3ZCM A;  4DU1 A;  4KB1 A;  3VQE A;  4FLY A;  2X6S A;  1SKR A;  3NAE A;  3WNE A;  4KRF A;  3DMJ A;  3L3U A;  1VSM A;  4I9Q A;  1IH7 A;  3AVG A;  1RDD A;  2HNZ A;  4DTN A;  1F21 A;  4AHU A;  3VQD A;  1LW0 A;  5DMR A;  1VSJ A;  3VQ8 A;  4FZX C;  1UA1 A;  4B08 A;  5I42 A;  1T05 A;  4B9S A;  3DRP A;  4NYF A;  3B6O A;  3HP9 A;  2NUB A;  3L2V A;  2EHG A;  4J2D A;  4I9L A;  1BHL A;  3NE6 A;  1JLC A;  1RT4 A;  1WN7 A;  3S3M A;  1WSG A;  3DRR A;  1YT3 A;  3NHG A;  3SUO A;  3SCX A;  4E7I A;  4OPJ A;  1C1A A;  2KW4 A;  2Z1J A;  3AVL A;  1W9H A;  4HVJ A;  1XI1 A;  4FJL A;  4L8R B;  2F8T A;  4FJH A;  4EP5 A;  3K59 A;  4FJ8 A;  4IFV A;  1ASU A;  3NGY A;  1SKS A;  4FVM A;  2D0A A;  4KTW A;  4TSX A;  5HRP A;  4DTU A;  3EYZ A;  2FBT A;  4CFA A;  4KB0 A;  4K8X A;  3RTV A;  2IS3 A;  4K8Z A;  3L3V A;  4O44 A;  1A5V A;  2QXF A;  2ATQ A;  4DSE A;  1ZBU A;  3SZ2 A;  4EZ6 A;  4F2S A;  4DF4 A;  4ELT A;  4E7J A;  3L8B A;  2QK9 A;  2ZQB A;  4W5R A;  1J5O A;  3OYF A;  3HM9 A;  4DQQ A;  1GOC A;  2DFH A;  3HPO A;  4DTM A;  3T3F A;  1B92 A;  1NJW A;  5FRM A;  5DK5 A;  1RT5 A;  3QLH A;  4CGF A;  3V1Q A;  3OYB A;  4CEO A;  2XY6 A;  3K5M A;  3SPY A;  3RRG A;  4Z4I A;  3OYA A;  2XHB A;  4B9N A;  1U45 A;  1KVC A;  4H4O A;  1FK9 A;  4G1Q A;  2XY5 A;  3CYM A;  1NOZ A;  1JXB A;  2G8H A;  1KCF A;  3M8R A;  3EY1 A;  3HJF A;  1S6Q A;  3C94 A;  4CJ4 A;  2AJQ A;  1X1P A;  1VSE A;  1D5A A;  1IO2 A;  3CM5 A;  3OYG A;  3QEI A;  4EZ9 A;  3CFR A;  1QTM A;  3ZT1 A;  4I2Q A;  4MFB A;  4GVM A;  4AHS A;  2G8I A;  3V81 A;  1QSY A;  1JLQ A;  3KK3 A;  5CYQ A;  5HRS A;  1TAQ A;  4KFB A;  4N5S A;  3DOL A;  2IC3 A;  3RMD A;  1S6P A;  1RBV A;  1LWF A;  3G10 A;  4CJK A;  1EET A;  3QNO A;  3QES A;  4B9U A;  1WAJ A;  4N47 A;  4DLE A;  1SL0 A;  3AA5 X;  2Z1G A;  5C42 A;  4J2E A;  3U3G A;  4E1N A;  5CZ1 A;  1U04 A;  5KGW A;  4CGJ A;  3MAQ A;  3QER A;  3SV4 A;  4FJ9 A;  4Z4E A;  3QIN A;  1VSK A;  4CIF A;  3MXM A;  4FLW A;  3F73 A;  3U3Y A;  1WSI A;  1J53 A;  2F96 A;  1UWB A;  3VQA A;  3NFA A;  2VWJ A;  5HP1 A;  1C0T A;  1EP4 A;  1I39 A;  4LY7 A;  4DQI A;  1NK6 A;  4FJ7 A;  1LAW A;  2GBZ A;  2YV0 X;  3B6P A;  1NJY A;  4KPY A;  4E7L A;  3RMB A;  4OJR A;  5FDL A;  3KTQ A;  2WON A;  3P5J A;  1KSP A;  4OKJ A;  4DWI A;  4LH4 A;  3DLK A;  3TAN A;  3LP3 A;  3RMC A;  1ZYQ A;  1X9M A;  1L3T A;  4FLU A;  4KI6 A;  4CJQ A;  4OPK A;  4CEB A;  4DSK A;  4DTR A;  3ASM A;  1FXX A;  4E1M A;  3ZSR A;  3VA0 A;  2RF2 A;  3AVN A;  1ASW A;  1JXE A;  5J1E A;  3JYT A;  3TAF A;  4KAZ A;  2HHX A;  1HNI A;  1EX4 A;  4CHP A;  1VK0 A;  3ISN C;  2OZS A;  2FBY A;  3DLG A;  3D45 A;  4FJG A;  4NCA A;  2KTQ A;  2DY4 A;  2O4I A;  3HYF A;  4NCB A;  3KD5 E;  1LAV A;  1TL1 A;  4ICL A;  1TK5 A;  2QKK A;  4ZTF A;  1NK7 A;  3DYA A;  3O3G A;  1GOA A;  1RNH A;  1RBS A;  4O0J A;  2I5J A;  4CJF A;  4DS4 A;  3PX6 A;  4CJV A;  3SPZ A;  4PUO A;  4CJP A;  3OY9 A;  3DLB A;  3VQB A;  4BWJ A;  1QS4 A;  3OYH A;  4IG0 A;  4KI4 A;  5D3G A;  1L5U A;  2YNF A;  4B9T A;  5J2Q A;  2YNH A;  1B9F A;  1FKP A;  1RT6 A;  1KVB A;  3NH0 A;  3QIP A;  2ETJ A;  2DFF A;  1SV5 A;  3V1R A;  3V9W A;  3VA3 A;  1B9D A;  4IDK A;  4R5P A;  1HQE A;  4CJT A;  1IKV A;  1KTQ A;  1QE1 A;  2OPQ A;  3M8Q A;  3KLF A;  1ZBL A;  1X9S A;  3OYM A;  3WNH A;  5HBM A;  4ELV A;  4O4G A;  4B9V A;  3TWH A;  2W42 A;  3KJV A;  1QSS A;  4YFU A;  3HXM A;  5I3U A;  1C0M A;  1J9A A;  3OYJ A;  3QO9 A;  1XHX A;  4LD0 A;  3AO3 A;  1T7P A;  4E3S A;  4CJ5 A;  1RTJ A;  3KKR A;  3PUF A;  1ITG A;  1VSD A;  1T8E A;  4CHQ A;  4DSF A;  5HLF A;  1U47 A;  4CCH A;  4RW6 A;  3K58 A;  1C1C A;  3M8P A;  4Z4G A;  1NKB A;  1NK9 A;  1DTT A;  4Y1C A;  3OS1 A;  1DTQ A;  2D0C A;  2FC0 A;  2P51 A;  3CFP A;  4FK4 A;  1YTU A;  4ZTJ A;  4E89 A;  3OYC A;  3OYK A;  4HUF A;  3VQP A;  3AVA A;  1NK8 A;  4DFK A;  1SKW A;  2Y1J A;  1N5Y A;  3HK2 A;  4DTO A;  3O4Q A;  3NDK A;  3LZJ A;  2X6N A;  4OVL A;  3ZT4 A;  4CJU A;  4FXD A;  2KZM A;  3KLE A;  3U6F A;  1JLF A;  3AVJ A;  4CES A;  4CHY A;  1S9G A;  4OGC A;  3MXI A;  2VG5 A;  5CZ2 A;  3MXJ A;  3QEW A;  3DLH A;  4CIG A;  4Q0B A;  5K14 A;  3K5L A;  4Y1D A;  3KD1 E;  4JRQ A;  4W5O A;  3K2P A;  1CZB A;  2XY8 A;  3SUP A;  4XIU A;  1SL1 A;  4J2B A;  1KFS A;  4M42 A;  1ZBI A;  4CJE A;  1WSF A;  4BE0 A;  1RCH A;  4FZY A;  2D5R A;  1BIS A;  2LSN A;  3LZI A;  4C8N A;  4W5N A;  2BE2 A;  1I3A A;  3SI6 A;  5HRR A;  4CE9 A;  1C0U A;  4H8K A;  3LPT A;  4CF2 A;  4FJN A;  3NF8 A;  4KO0 A;  4AHV A;  5HRN A;  3HT3 A;  3I0S A;  5J2M A;  2HNY A;  3V6D A;  3MEE A;  5SZT A;  3ZSV A;  1BIZ A;  3SNN A;  3ITH A;  3ZSQ A;  1VSL A;  3KLI A;  4FM2 A;  1S1V A;  2JGU A;  5EU7 A;  4CHZ A;  1TKT A;  1NJZ A;  2PZS A;  4CK1 A;  4DFJ A;  5KGX A;  2F8S A;  1D8Y A;  4DFP A;  4CHN A;  3HPH A;  1L3V A;  4M3U A;  4QOZ B;  1D9F A;  4CEF A;  1J54 A;  3JSM A;  4JLH A;  2FBX A;  4KRE A;  1XC9 A;  4ID5 A;  3TAR A;  1IKW A;  4HHT A;  3O3H A;  4I2P A;  4CFD A;  1BCM A;  1ZBF A;  3VQ9 A;  4B8A B;  4RW4 A;  3AO4 A;  3H08 A;  1ASV A;  4BDY A;  2G8W A;  1HMV A;  1C6V A;  3HST B;  1U48 A;  3SQ4 A;  1NJX A;  2YNG A;  1S1W A;  3AO1 A;  5J2N A;  3RR8 A;  1Q9Y A;  4DSJ A;  4KV8 A;  5J2P A;  3K5N A;  4E0D A;  1BIU A;  4KHW A;  3TR8 A;  2IDO A;  5SWM A;  2KZZ A;  2PYL A;  3PV8 A;  1UA0 A;  1CXU A;  1RT3 A;  3TAB A;  5HRO A;  1WSH A;  2X78 A;  2P1J A;  3IRX A;  2JLE A;  3V9S A;  4W5T A;  1D9D A;  3AVF A;  4CJ3 A;  4FM0 A;  4DTP A;  3QEV A;  3CFO A;  4E19 A;  1VSI A;  3QNN A;  1NOY A;  1TL3 A;  3AO2 A;  5FRN A;  1CLQ A;  1NK4 A;  1HPZ A;  1Z25 A;  4CJL A;  3KK1 A;  4W5Q A;  2YNI A;  4E7K A;  3CG7 A;  3TAQ A;  4F3T A;  2OPS A;  4CF0 A;  3QET A;  2PY5 A;  4CEZ A;  2D0B A;  4CGG A;  1T03 A;  4DU3 A;  3MEC A;  1LWE A;  1VRU A;  2Z1H A;  3HPG A;  4C8M A;  3K57 A;  4BAC A;  5CYM A;  2E6L A;  4DQP A;  4CJR A;  1R0A A;  1L3U A;  2XY7 A;  1CZ9 A;  4GMJ B;  4H4M A;  1REV A;  3HL8 A;  4BWM A;  4HTU A;  4NYN A;  1XWL A;  4OKE A;  4WE1 A;  1TAU A;  3VQC A;  3QEX A;  2BGG A;  4EP4 A;  3L2U A;  1QHT A;  4PWD A;  1UOC A;  3HVR A;  1CXQ A;  1BQM A;  3S9H A;  2GUI A;  3AVC A;  1HYZ A;  4FJK A;  2HHU A;  2BAN A;  3IAY A;  1EKE A;  4JS4 A;  1KRP A;  3SUQ A;  3QIO A;  4ID1 A;  1X9W A;  4OLB A;  2HHT A;  3OVN A;  1HYV A;  3ULD A;  1VSH A;  1QSL A;  4DTS A;  5T7B A;  4IKF A;  4FK2 A;  2YKN A;  1RTI A;  2DTU A;  4KTQ A;  4BDZ A;  1Z26 A;  4DS5 A;  3AVI A;  5C25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...