4KTZA

Lactococcus phage 67 ruvc
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
160
structure length
160
Chain Sequence
MKKILAINFSTASKKGEGTGYAFRKDGQVYVGSIKAYNPKKTAWERTFDIVNAIKDIIDEFDLKGYHLAIETPIMGRNRKHSITLANCNGYFIGAIDGLVNGYTFIDNSKWCSYHLISGKREQRKEESLELLKATGLVDSNCKDDNIADAYNILTYCEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RuvC endonuclease
publication title Mutants of phage bIL67 RuvC with enhanced Holliday junction binding selectivity and resolution symmetry.
pubmed doi rcsb
source organism Lactococcus phage bil67
molecule tags Hydrolase
total genus 57
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07066 DUF3882 Lactococcus phage M3 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ktzA00
2VG5A 4EP5A 1Z26A 3LAKA 4NCBA 3RR8A 2YNGA 4OKEA 1FK9A 3O3FA 1SL0A 3M8RA 1JLQA 1A5WA 2P5GA 2GUIA 1LV5A 2GBZA 4KB1A 1YTUA 4OLAA 1WAJA 3ZSXA 1T8EA 3ULDA 4IFYA 4LD0A 2FBVA 3OYBA 4DSFA 2RKIA 1REVA 3PO4A 4AHCA 1VSHA 3RTVA 1WSHA 4BE0A 1TK5A 4FCYA 3HP9A 1RBTA 3MEEA 2YHAA 2G8VA 1CZBA 5KI6A 4CJ4A 1C0UA 1QSYA 1LWFA 3LZJA 4JRQA 3WNGA 4CECA 4DMNA 1D9FA 4DQRA 3QNOA 3SV3A 3VQ9A 3V81A 4DSEA 1L3UA 5KRTA 4CEOA 4NYFA 1T03A 3VQ8A 4KHQA 2ITGA 4IBNA 4ZHRA 3G0ZA 1J53A 5HRSA 2JLEA 1RT5A 4AHTA 4CHNA 3SQ2A 3WNFA 3SQ1A 1BI4A 1JLEA 4CEEA 1JL2A 3K2PA 4R5PA 3S9HA 2OZMA 4RW6A 4KHNA 5KGXA 1KFDA 3MXMA 4CF1A 3ZSZA 4BACA 2O4GA 3QEXA 3F9KA 4DTPA 3D0PA 3V1RA 3KD5E 3VQ7A 4CFDA 2BE2A 1J54A 1U49A 2ATQA 4J2DA 4M45A 2HHUA 4CIEA 3MEGA 1NKBA 2NUBA 1ZYQA 1NK6A 2O4IA 2E6LA 4CHYA 4CFCA 1SV5A 1CLQA 4W5QA 3VA0A 2E4LA 3VQ5A 4CEZA 4FZXC 4J2EA 1S1VA 4HCBA 3QERA 4CJ3A 1WSGA 1O1WA 1KSPA 4CF2A 1I3AA 1BIZA 1X9WA 1GOCA 2EX3A 3NF7A 2X6SA 4M41A 1Y97A 5FROA 5D3GA 2JGUA 1WSFA 3L3VA 4DTUA 1VSFA 3VA3A 2XY7A 3DLHA 4E89A 3V9WA 4C8LA 3WNEA 3SCXA 4OPJA 4KRFA 4KI4A 3OY9A 3V9SA 1TL1A 1JLFA 5CZ1A 3SUQA 1XC9A 3DRSA 4EZ6A 4GW6A 3ZSQA 1RTDA 2HHQA 1S1UA 4PQUA 2VG7A 4GVMA 3QEPA 3VN5A 1QTMA 3ZT1A 5HRRA 3C6TA 1YTAA 2XY8A 5CZ2A 4B8CA 5I3UA 4BWJA 4DQQA 1T7PA 2QKKA 4CJQA 3ZSWA 4CF0A 4Z4EA 2XHBA 1S9GA 3P5JA 2IDOA 3A2FA 2BDPA 4CERA 4NCGA 3KK2A 1TKDA 4KHSA 4E1NA 3CM6A 3S3NA 4ELUA 1ZBUA 3PX6A 3ITHA 1L3VA 3P83D 3ASMA 4I9LA 3KLGA 3KLEA 1S9EA 3SV4A 1KTQA 4E3SA 3SPZA 3KTQA 3L2QA 4M3WA 4ZTFA 3BGRA 1RDAA 4CJWA 1WSEA 4DQIA 3DLGA 1U04A 1UA1A 3DMJA 3VQPA 1W0HA 1W9HA 4W5TA 2YHBA 3AO1A 4KKOA 4FJ5A 4CK3A 3MECA 3TANA 1S1TA 1TL3A 3OYDA 2ZD1A 1KVBA 3VQQA 3OYMA 3LDSA 1HRHA 2IC3A 3M8QA 4CHOA 3TAEA 5DMRA 4Z4GA 1RT1A 4DS5A 2OPPA 4DG1A 3B6PA 4BE2A 3EZ5A 4M3TA 1ZBHA 3KK3A 3CFRA 3HPOA 1GOAA 1RT7A 3PY8A 1WSJA 2WONA 3LZIA 1HNIA 2IOCA 4BDZA 3LALA 4N5SA 3FFIA 3OYHA 4M3XA 3NE6A 4LSNA 3V9ZA 1RTJA 4LSLA 3SNNA 3PO5A 1VRUA 4FJHA 1C1BA 1HQUA 4FM2A 3T19A 4O0IA 3SQ4A 4B9SA 4Z4CA 1NOYA 3NCIA 1SUQA 4M3UA 1ASVA 1KLMA 4DTJA 5HRNA 1VK0A 4DQSA 1IKYA 1C0TA 2W42A 4FK0A 3UIQA 1BCMA 3SJJA 3OYKA 3KK1A 3OJSA 4N41A 4FYDA 3VQ6A 4E1MA 3S3MA 5FDLA 3IG1A 1VSDA 3LPUA 4FLYA 3LP2A 3QLHA 2PYJA 4K8ZA 4E7IA 1BISA 4FXDA 3HXMA 3K5OA 1KVCA 1VSJA 2KW4A 1VRTA 4E7JA 1XHXA 4F8RA 4CCHA 1D5AA 1UWBA 2YKNA 2YNFA 4N56A 3V9XA 3SPYA 3KLHA 2IGIA 1QS4A 1X9MA 2OA8A 4M3RA 3CG7A 3K57A 1FKPA 3ZT2A 3DLBA 3DLKA 3NH2A 4E7LA 1IG9A 4KHYA 2HB5A 3TAFA 1KCFA 1VSIA 3ALYA 4FW2A 3KIOA 1B92A 1SKSA 1ZBIA 3VQAA 3O3GA 4KAZA 1WAFA 3V1QA 3DOLA 1JLBA 1QE1A 2HVHA 4FJGA 2Z1JA 4FW1A 4ID1A 4HVJA 4HHTA 4NCAA 2RN2A 2HHVA 2VWKA 5J2MA 3NF6A 1GOBA 3VQEA 3V4IA 4Q5VA 4Z4HA 3OYAA 4KTWA 4Q0BA 3TWHA 1FXXA 2D0CA 3MEDA 4OGCA 2HVIA 1X1PA 4AHVA 5K14A 1DLOA 1NKEA 1B9DA 4I7FA 2G8FA 4CGGA 1ZBLA 1KVAA 1S6PA 3AVHA 2LSNA 2YNHA 3NGIA 4FJMA 3K59A 5KRSA 3RMAA 3KJVA 4GMJB 4CJPA 3NH0A 5C24A 3L2VA 4CGFA 4OGEA 4UQGA 2OPSA 1NJZA 1KFSA 2P5OA 4F3TA 4AHUA 3I8DA 4KO0A 3WNHA 1D9DA 3KKSA 4DWIA 4DTMA 1NK9A 4I9QA 4PA1A 2ZE2A 3OYEA 3AVKA 1ZBFA 1JXBA 4CJSA 3TI0A 4FJ9A 4DFKA 2I5JA 3SI6A 3EY1A 4O44A 4CJKA 3HP6A 3OYCA 4QOZB 3AO4A 2Y1IA 3P1GA 4CF9A 5HP1A 4DU4A 4B9VA 5JS1A 4YNQA 2HHWA 3M8PA 3LP1A 3DOKA 5HROA 2ZQBA 4LH5A 4C8KA 3LWLA 3IS9A 4L8RB 1BQMA 3ZSVA 4CK1A 3SQ0A 4DSKA 4W5NA 3AVGA 1JXEA 4FLZA 1HPZA 2FC0A 3NFAA 4H4OA 4CJFA 3CM5A 1S1XA 1QSSA 3HJFA 2B5JA 1LAWA 1RDDA 2FBXA 1Q8IA 5C25A 3AVMA 4CJ5A 1HNVA 3V9UA 3AVBA 3HVTA 4KB0A 3D45A 3DRRA 2KZMA 2HHSA 3NGYA 4CEFA 1CZ9A 3OYLA 4QAGA 3ZT0A 3JSMA 4FZZA 2G8KA 4PWDA 4C8MA 1IO2A 4AH9A 4IKFA 1RT2A 1L5UA 4KTQA 4CFAA 3AO5A 4JS4A 4F2SA 3BDPA 4DLGA 2D0AA 4CE9A 3E01A 3ZSOA 3RMCA 4PUOA 3C95A 4CGDA 3OS1A 4OLBA 4HUGA 1HYSA 1WN7A 2Z1IA 3HPHA 5DK5A 3TABA 4M3ZA 2OPRA 5JS2A 2OPQA 3C6UA 3TARA 4CGJA 3HSTB 4DF4A 4B9NA 1KRPA 2FBYA 4FK4A 4DTOA 2HNZA 4BWMA 1NJYA 1VSEA 4G1QA 4DU1A 3EYZA 4FLVA 4MFBA 4B8AB 4F3OA 1DTTA 4AHSA 4CEAA 3K5MA 2G8IA 2YKMA 2VG6A 4ID5A 3ZT4A 5SZTA 3NGZA 3M8SA 3SUNA 1QSLA 1R0AA 4DSJA 1JLAA 4AHRA 1HYVA 2E6MA 3OYIA 4HCCA 4FJJA 2KFNA 1HYZA 1TAUA 4OPKA 1C1AA 4B9MA 5FRNA 4CJLA 2HNDA 1TKTA 1RBRA 1QQCA 4Z0UA 1YT3A 4ELVA 1S1WA 4CIGA 2HHTA 3IAYA 1RT3A 4JS5A 1RCHA 4W5RA 5FRMA 4M3YA 4KTZA 2B6AA 4Y1DA 4FJKA 3AA3A 4KV8A 1TKZA 3CFOA 3MXJA 3ZSRA 4FLXA 3I0RA 3VQCA 1XI1A 4RW7A 4DSIA 1RNHA 1C1CA 2KQ2A 3DYAA 2AJQA 1RILA 4E19A 3O4QA 3RRGA 4FK2A 2F8SA 1JL1A 1VSKA 1BCOA 4F4KA 2KTQA 1BHLA 5KTQA 1EETA 3RMBA 3DLEA 2KFZA 1NK4A 4DF8A 2XO7A 2XY5A 3C94A 3L3UA 4DFPA 1TGOA 3QEVA 4DLEA 1Q9XA 2X74A 3L8BA 3O3HA 4I2PA 1LW2A 3TAGA 3CYMA 3NBPA 1XHZA 1U4BA 2DFHA 1RBVA 3DI6A 3K58A 1NK0A 1A5VA 4ELTA 3T1AA 1C0MA 5CY4A 3ZCMA 3OS0A 2XRIA 2G8UA 4DTSA 3KLIA 1RBUA 4FJ7A 3O4NA 4IFVA 4CJEA 4CIFA 3THVA 4C8OA 3RWUA 1F21A 4IG0A 1S6QA 3AVAA 4DSLA 3AO3A 1C6VA 3L2WA 3TAQA 5J1EA 1SKWA 1CXQA 3TR8A 4FLUA 2G8WA 1UOCA 1BL3A 4CEBA 1TK8A 4M42A 4Z4IA 3ISNC 4DS4A 3VQBA 3PUFA 1LWCA 3QIPA 1G15A 2G8HA 1I39A 3AO2A 4FVMA 2IS3A 3OVNA 3HK2A 1WLJA 2EHGA 4ICLA 4K8XA 2BGGA 1RT4A 5SWMA 1TVRA 3HPGA 5HBMA 3QNNA 3HT3A 2A1SA 3HVRA 1NKCA 4IDKA 1HJRA 1JLGA 4E7HA 5I42A 3OYJA 4O5BA 3NDKA 5J2QA 1L3SA 1SL1A 2DFEA 4I2QA 4CEDA 3NAEA 4DFJA 5HRPA 2YNIA 3OYNA 3LANA 3OJUA 4Z4FA 1RDBA 4CHPA 1L3TA 4B9UA 3DRPA 1HQEA 3OYGA 2HHXA 4WE1A 1BQNA 2OZSA 3B6OA 3SUPA 1D8YA 3LAMA 2GV9A 4CF8A 3I0SA 4Y1CA 1JKHA 1NOZA 2ETJA 3K5NA 1WSIA 3DLRA 2QXFA 4N47A 3U3GA 4FZYA 3OS2A 3U6FA 1U45A 2HMIA 3QESA 1MU2A 3ZSYA 4C8NA 1QHTA 4FM1A 4RW4A 3VQDA 3CFPA 1J5OA 4J2BA 4B3OA 4BE1A 3T3FA 1ASUA 4DFMA 3AVNA 4O4GA 4CJVA 1YVUA 2RF2A 1XWLA 4TSXA 3PX4A 3DM2A 5KGWA 3H08A 4BDPA 3NF8A 1NK5A 5EU7A 2F8TA 2Z1GA 2XY6A 3KLFA 4FJNA 1N6QA 3MAQA 4HUEA 4DTXA 4E0DA 1NK7A 3SZ2A 2IAJA 3RRHA 1B9FA 1IKVA 3L2RA 1BIUA 1K6YA 3LP0A 4DQPA 1ITGA 4FLTA 4KREA 1TAQA 3HL8A 4YFUA 4XIUA 4F2RA 1WNSA 4LY7A 1FKOA 3LP3A 4H4MA 5J2PA 3LPTA 1RDCA 4QCLA 3LWMA 3ZT3A 2A1RA 3NHGA 1J9AA 2QK9A 2VWJA 1T05A 2OYQA 1IKXA 1LWEA 3TAMA 2X78A 5C42A 3QEWA 5T7BA 4KHUA 1EP4A 3OYFA 2Y1JA 3HO1A 4RW9A 4JLHA 3RR7A 1IKWA 4FJLA 1RTIA 4KPYA 4B9LA 4EZ9A 3AA2A 3SUOA 1X9SA 3HM9A 3AVFA 3QINA 5CYMA 5J2NA 4CGHA 3QETA 3MXIA 4KHWA 4LH4A 2FBTA 4DU3A 3U3YA 4CJTA 3HYFA 1UA0A 1VSMA 4OVLA 2Q3SA 1JLCA 1Z25A 4KFBA 4DTNA 4B9TA 3QO9A 3V6DA 2Z1HA 1S5JA 4O0JA 3CQ8A 4ZTJA 2D0BA 5HLFA 3QIOA 3AVCA 1HMVA 3KKRA 2P51A 3AVIA 4NYNA 1N5YA 2DY4A 1ASWA 2DTUA 3F73A 3KD1E 3IRXA 4CEQA 4MQ3A 2X6NA 2YV0X 3PX0A 2PZSA 4FJXA 2B4JA 4CJRA 3SYZA 2PY5A 3NH1A 5CYQA 3TAPA 4OJRA 2DFFA 3PV8A 2P1JA 4RG8A 2PYLA 5E41A 3S3OA 1UAXA 3JYTA 1TKXA 1KLNA 4KI6A 4CESA 4HUFA 3RMDA 4CJUA 1A5XA 1BI4B 4RW8A 4PY5A 3AVLA 3AA4A 1NK8A 4IG3A 1Q9YA 2HNYA 3L2UA 4J2AA 4AILC 2KZZA 4OKJA 3G10A 2WOMA 4B08A 3AV9A 3VQ4A 4FM0A 4FJIA 4CHQA 4DTRA 1VSLA 1EKEA 2BANA 4H8KA 1LW0A 4EP4A 3AVJA 1U47A 2QKBA 1RT6A 4JRPA 1NJWA 1SL2A 1RBSA 1NJXA 1CXUA 4BDYA 2HW3A 1EXQA 1LAVA 1TV6A 4N76A 4FJ8A 1TK0A 2D5RA 1DTQA 4W5OA 1SKRA 4OKKA 2RPIA 3QEIA 4CGIA 4HTUA 1U48A 4FLWA 1BGXT 4E7KA 2R7YA 3K5LA 4CK2A 4CFBA 1RTHA 1IH7A 2F96A 3V1OA 1EX4A 4CHZA 3NF9A 3AA5X 4O55A
chains in the Genus database with same CATH superfamily
3QFPA 4EP5A 3LAKA 1N8RO 4NXMK 2P5GA 5AZJB 4LFCK 4OLAA 5ADXH 3ULDA 1K9MO 4WFNL 4DSFA 2RKIA 4X65K 4BE0A 2I7PA 1CZBA 1QSYA 3A5OC 5KPTA 2D0PA 2NRXA 1U6ZA 3TTFA 3V81A 5AQOA 5CHIA 3ZX2A 4KHQA 1KAYA 2JLEA 5M1PA 5HRSA 4CHNA 1JLEA 3MXMA 4CF1A 1GLAG 4GV6A 4DTPA 4BR7A 4CZGA 3QFUA 2BE2A 1J54A 5GIOA 2KKZA 2ATQA 4GNIA 4CIEA 3NVMA 3KHYA 1CLQA 4CEZA 4J2EA 1S1VA 4HCBA 4CJ3A 5KQDA 1WSGA 4CF2A 4DR1K 1NGAA 1Y64A 3RSEA 3NF7A 2P9LB 2X6SA 1Y97A 5D3GA 1WSFA 2XY7A 1K8KB 3O9TA 4MO4A 2NRRA 3V9SA 4GW6A 2QEXN 1E3MA 2VG7A 4BY9C 3ZT1A 5HRRA 2XY8A 3QB0A 3WEEA 4B8CA 2QKKA 4DQQA 2UU9K 1S9GA 3P5JA 3A2FA 1K73O 3EO3A 4E1NA 3CM6A 1S3XA 3PX6A 3ITHA 1L3VA 3ASMA 3KLEA 4E3SA 2YX6A 4K41A 3L2QA 4IO9L 1IV0A 2E2PA 3DMJA 5JMVA 1W9HA 1SS6A 5M1KA 2H3GX 3LDSA 2QK9A 3TAEA 4DCHA 3A5NC 5DM7L 3PY8A 1VQ9N 3LZIA 1HNIA 2IOCA 1I94K 3I56N 1BA1A 3ATUA 3V9ZA 4MLHA 3SNNA 4DV7K 3PO5A 1OVQA 1HQUA 5AQVA 3O1BA 2WTUA 3VEXA 1YAGA 4Z4CA 4R79A 1NOYA 4DKWA 3ENHA 1KLMA 1GLJO 4JK8A 4JI4K 4FK0A 3RSEB 4CJ7A 1OH6A 1BCMA 3H6EA 3OYKA 2RE2A 3KK1A 4FYDA 1VQPN 4H5NA 3A0IX 4FWNA 3LP2A 3VF2A 3F2KA 3K5OA 3WEEB 2KW4A 4WYBA 4F8RA 4BRDA 1D5AA 1UWBA 3VTHA 3H1VX 5LJVA 2RHKA 1QS4A 1FKPA 4KHYA 2HB5A 1KCFA 1GLCG 2W6KA 1SKSA 1OH7A 3O3GA 4CZFA 2FXUA 2F9WA 2HVHA 1GLLO 4BC5A 3O9SA 2HHVA 3NF6A 4Q5VA 4KTWA 3TWHA 1P90A 4CZJA 4I7FA 1QHAA 1KVAA 1NGHA 1S6PA 2E8AA 4FJMA 3KJVA 4GMJB 3BF1A 4CJPA 5C24A 4JK7A 3TU5A 5BRFA 3I8DA 1NBWA 3PSFA 1D9DA 2IVPA 2ASOA 2CH5A 4DWIA 5GIPA 2ZE2A 4FWRA 5HL7L 4YOWA 1ZBFA 3O5BA 4CJSA 3CMAN 4BR0A 4DFKA 4CJKA 3HP6A 2Y1IA 2W6LA 5HP1A 4JV5K 4DU4A 1QQOA 3O9UA 3M8PA 3SJHA 3LP1A 4YOVA 3DOKA 1OH5A 5AQJA 2ZQBA 5HROA 3IS9A 4L8RB 1BQMA 2F9TA 4LFAK 4W5NA 3NFAA 1E4GT 4CJFA 1S1XA 1LAWA 2FBXA 3V9UA 1HNVA 2UUAK 3M3ZA 3ULEA 2HHSA 4FZZA 3ZT0A 2G8KA 5GAHP 1JCFA 3AO5A 3CC7N 1TUUA 4MDBA 3E01A 4LF5K 1NNEA 4M3ZA 3C6UA 4CBUA 3TARA 4DF4A 4FK4A 1T6CA 4H0TB 1BUPA 2QWNA 5JLFA 4FLVA 3EZWA 3R1XA 4MFBA 2G8IA 5E26A 4F3TA 2VG6A 5C12A 1HYZA 1C1AA 4K43A 2HNDA 2EWSA 5AQSA 2DPNA 4FOIA 2QWLA 4M3YA 4FJKA 3AA3A 1RDUA 4RCHA 3MXJA 3ZSRA 4MDAA 4JHDA 1XI1A 4GVEA 4RW7A 3CC4N 4B9QA 2KQ2A 3J7YP 4FK2A 3U8XA 4ISEA 4F4KA 2KFZA 5KTQA 3RMBA 3CJAA 4DF8A 2XY5A 4DFPA 4IJNA 1TGOA 3QEVA 3T7ZA 5KPZA 3FGUA 3GE1A 2QI2A 3ZCMA 4PL8A 2FF6A 3OHRA 4DR4K 2XRIA 2UXCK 2BH1A 3KLIA 1RBUA 4IFVA 4BRPA 4C8OA 3ULEB 4IG0A 1S6QA 2P9SA 4ILHA 3NMUA 5J1EA 1SKWA 1NM1A 4M42A 1TK8A 3HRGA 3PUFA 1X3NA 2HBJA 2FSNA 5AFUH 5AQUA 1RT4A 5HBMA 3U9ZA 3AGKA 4E7HA 1SL1A 4A62A 3L4IA 4OPHA 4B9UA 1HQEA 2QWMA 4KH5A 5F1XA 1BQNA 1D8YA 2GV9A 4JKDA 3I0SA 3LDQA 1OH8A 1JKHA 4JHDB 3L6QA 5HOOA 3U6FA 1U45A 3MCAB 1MU2A 3VETA 3VQDA 1YITN 3CFPA 1J5OA 4J2BA 4B3OA 3T3FA 4IXCA 2Q0RA 2RF2A 3THXA 1XQSC 3R9PA 4BDPA 3NF8A 1NK5A 2IVOA 3MWPA 5EY4A 5MLCQ 4PKIA 3MAQA 4E0DA 1NK7A 3HZ6A 2VGNA 2IAJA 3RRHA 3CCUN 4DQPA 4KREA 1NG9A 1WNSA 3J81O 3VEOA 3LP3A 5J2PA 5GAGP 3N4PA 2P9SB 4EIAA 5LJWA 4L3QA 1EP4A 4JI3K 1IKWA 4FJLA 1RTIA 3DWLA 3AAQA 1W2BM 3QETA 3MXIA 4KHWA 2FBTA 3MX2A 4OVLA 2QW9A 2Q3SA 1JLCA 3JXUA 3CCVN 1HNZK 5A2QO 4JKAA 3AVCA 1HMVA 3KKRA 4JKCA 3IRXA 3SAGA 3TAPA 2DFFA 5FPDA 5E41A 1TKXA 3RMDA 4CJUA 1BI4B 4PY5A 1VQMN 4IO8A 4YY3K 4J2AA 4OKJA 3THXB 3J80O 3FZKA 3VQ4A 4FM0A 3BF3A 4WFAL 3EL2A 4H8KA 2BANA 1U47A 3MN6A 4FPAA 1GLBG 3TSPA 4JRPA 1NJWA 1RBSA 1X9JA 4BDYA 1CZAN 1DTQA 4HTUA 1U48A 1BGXT 5LMUK 3SK3A 2R7YA 1T6DA 1RTHA 1IH7A 4A5BA 4O55A 2NZTA 1J6ZA 2QXLA 4CZIA 3LDLA 3G4SN 4OKEA 4FVUA 5AQWA 1Q18A 1FK9A 3M8RA 1JLQA 1YJ9N 1A5WA 4PHTX 4PL7A 4KB1A 3ZSXA 5BPMA 4DV2K 4LD0A 3WXIA 1VQ8N 3OYBA 1REVA 3RTVA 1WSHA 1NMNA 1XUPO 2D0OA 3DAWA 1TK5A 4WCEL 4BC2A 4WQ4C 2G8VA 1NGIA 1WUAA 1C0UA 3LZJA 3HOTA 3FZHA 4RWTA 4JRQA 4CECA 4DMNA 3CCLN 3O4WA 4DR2K 5FPMA 3EEQA 3VQ9A 5KRTA 4CEOA 1T03A 1NJIO 2ITGA 4YORA 3G0ZA 1J53A 4M63C 2KHOA 3KWIA 3SQ2A 3WNFA 3J8AA 4EAHD 4NLCA 3GG4A 3ZSZA 1DGKN 3F9KA 3VQ7A 1U49A 2E1YA 2HHUA 1NKBA 1ZYQA 1NK6A 2O4IA 2E6LA 1SV5A 4W5QA 2E4LA 4FZXC 3QERA 1O1WA 1LOTB 1KSPA 3EE8A 1MWKA 4KHPK 1X9WA 4B1YB 5FROA 4IOAL 3L3VA 4U67L 1VSFA 4OPAA 3K9JA 3WNEA 3SCXA 5AQXA 4KRFA 4EZ6A 1XC9A 5CZ1A 4XH5A 1RTDA 1S1UA 3RVCA 4U7BA 3MDQA 4GVMA 4G9ZA 2E88A 3C6TA 4KI4A 1IBMK 4BWJA 1T7PA 3ZLJA 3ZSWA 4CF0A 2ZJQL 4Z4EA 2XHBA 5GADP 3THWA 5IT9O 1QZ6A 3D2EA 3KK2A 2OTJN 4GV3A 4JKHA 2P9KA 2VCPA 2E2QA 1WSEA 4CZHA 4J8FA 1EO1A 3DLGA 1U04A 4CZKA 1UA1A 1W0HA 3O80A 3CERA 4X64K 1Q86O 2YHBA 4BGBA 3LDPA 3MECA 3TANA 2GX9A 1S1TA 4MLEA 4JI8K 4CBWA 3OYDA 3OYMA 1KVBA 2IC3A 4CHOA 3TSUA 4Z4GA 5E84A 4DS5A 2NLXA 1VQON 4M3TA 3A8YA 1ZBHA 3CFRA 3P38A 1SQKA 2D4WA 3FZMA 4H5WA 5AQMA 3VGLA 4BDZA 3L0QA 3FFIA 5LL6Z 1NLVA 4JKBA 3H45C 4LSLA 4FJHA 1BO5O 4FM2A 3T19A 3SQ4A 3NCIA 4BRHA 2A5XA 4M3UA 1ASVA 4QS9A 5AQHA 5HRNA 1IKYA 1C0TA 2W42A 3W0LA 4RTFD 3SJJA 4BRNA 1ILYA 1HKCA 1JCEA 4N41A 4FL9A 3VQ6A 1ATSA 4JEPA 4BC4A 3SBTA 2FSKA 1VSDA 3LPUA 2PYJA 4X62K 4LF4K 4DV0K 3AAPA 4FXDA 4E7JA 4CCHA 3AARA 3LDOA 3THWB 2W41A 2YNFA 3V9XA 3D2EB 1VQ4N 1XNQK 1X9MA 4KBOA 3CG7A 4M3RA 2P9KB 3DLKA 3NH2A 3TAFA 3ALYA 3FFKB 3KIOA 4OO1J 4BR4A 1ZBIA 5KQ8A 1M90O 3V1QA 5JVHL 1JLBA 1IBKK 4FJGA 1NWKA 3VTIA 4HVJA 3VQEA 3OYAA 1H1VA 4Z4HA 5F2RA 3MEDA 2HVIA 1X1PA 4FPBA 5K14A 1DLOA 3T69A 4DR3K 4B1ZA 3O08A 5BPNA 2LSNA 2YNHA 4K0KK 3E9PA 3U4LA 4IEIA 3HSCA 4BG8A 5AR0A 2WBNA 3NH0A 3L2VA 2OPSA 2P5OA 4H5VA 3N4QA 1T3VA 4DTMA 4I9QA 5C10A 3AVKA 3E66A 1JXBA 3VESA 4FJ9A 3EY1A 3OYCA 4QOZB 3ZX0A 3L4QA 4JI2K 2HHWA 1HKBA 5BN8A 5FLXO 3SBGA 4H0YB 3SQ0A 4DSKA 5LMNK 2A41A 2F7TA 2ZJPL 2FC0A 4B3MK 1QSSA 2B5JA 3AVMA 2HBKA 1E4FT 5I9EB 4AM7A 3JSMA 2VYPA 5EXWA 3CCEN 4AH9A 1RT2A 4KTQA 4CFAA 2E2OA 4DQ8A 4BVPA 2V7YA 3HM8A 2HOEA 3VEVA 3SAHA 1WN7A 5DK5A 3TABA 5JS2A 4BRFA 1QQNA 4DTOA 2YHXA 4BWMA 1NJYA 1VSEA 4DU1A 3CI5A 4ID5A 3NGZA 4DSJA 1BWFO 4HCCA 4FJJA 3OYIA 3I55N 1TAUA 3UKRA 1IBLK 1TKTA 5EX5A 2HHTA 4KH4A 1RCHA 4Y1DA 1YVNA 3H1QA 4KV8A 1TKZA 3OW2M 3VQCA 4DSIA 1RNHA 3OBWA 1RFQA 3B8AX 2YI1A 4E19A 2D1KA 1ATNA 2KTQA 1BHLA 1KAXA 3SLCA 5JLHA 5C0YA 4I2PA 3TAGA 4FWOA 3CYMA 4C23A 4ELTA 1A5VA 1C0MA 2PFUA 2G8UA 1NGDA 4FJ7A 3VGKA 3O4NA 4CJEA 3THVA 4DSLA 3GDQA 1CXQA 5DM6L 1UOCA 4CEBA 2V51B 1XMQK 3ISNC 3VQBA 1QVGM 1LWCA 4CI6A 1G15A 3AO2A 4AQYK 4FVMA 3OVNA 3HK2A 5F0XA 4ICLA 3KVGA 5ADXA 5SWMA 3ZEUA 3HPGA 1WBDA 3HVRA 1JLGA 4LFBK 3OYJA 4O5BA 3NDKA 2FSJA 3NAEA 4ILGB 4WFBL 3UKRB 5BR8K 3DRPA 4LF6K 4H0XB 2QWRA 4X66K 3CC2N 4M7XA 3LAMA 3WQUA 1NOZA 3AGRA 2YJFA 1WSIA 4FZYA 4BROA 3OS2A 3QESA 4DB3A 2O8BA 2JWLA 4RW4A 2AP1A 3KK7A 4DFMA 3AVNA 4O4GA 1NGFA 1XWLA 4TSXA 3H3OB 1BU6O 3H08A 3WXKA 1YF5L 3CJBA 1N6QA 4B1WB 3SZ2A 1QZ5A 4FLTA 3O8MA 1TAQA 3GBTA 4H4MA 3R6MA 3FR0A 3LPTA 5IWAK 3LWMA 3NHGA 2VWJA 1T05A 2OYQA 4C1NI 5C42A 5JVGL 3QEWA 1JJ2M 2CH6A 4RW9A 4JLHA 4EZ9A 4B1UB 4BG9A 3ENBA 5J2NA 4CGHA 3ZEUB 5AZIA 4DU3A 3U3YA 5EVZA 4CJTA 1UA0A 1M1KO 3D2FA 3K0SA 3VPZA 4KFBA 4JI6K 2OCEA 3QO9A 1S5JA 2F4VK 2UUCK 2BUPA 3QIOA 1QQMA 2NRWA 4NYNA 3BZKA 1BA0A 3F73A 3KD1E 5AQYA 1O13A 2YV0X 4FJXA 4DV4K 1OVYA 5AJ3K 2PY5A 2BTFA 3NH1A 5CYQA 3MK6A 4YOXA 2P1JA 4CZMA 3S3OA 3E9LA 5BPLA 4FO0A 1DEJA 4HUFA 2O8BB 3AVLA 2O8FA 1NK8A 4IG3A 1Q9YA 4B08A 4CZEA 1G99A 3DJCA 4DTRA 1N33K 2KLAA 5AQKA 1LW0A 4EP4A 4DUYK 1CXUA 2J4RA 4N76A 3WUHA 3OA9A 4W5OA 4ISGA 3QEIA 3H46O 5BN9A 3V1OA 3Q7BA 3M1FA 1WB9A 4F9OA 1YTUA 2GUIA 2GBZA 4LF7K 5AZIB 4IFYA 3D2FB 4GKKK 1BDGA 2FBVA 4IWVA 3W3DA 3PO4A 4AHCA 4B1VA 1IG8A 3VERA 4NO7A 3PIPL 4YHHK 2P9PA 2YHAA 5AQRA 2ITMA 5KI6A 4CJ4A 2GWKA 2ASPA 3H3NO 2YHWA 1YIJN 5FPNA 1D9FA 4DQRA 3SV3A 4DSEA 4DR6K 4NYFA 1N34K 3CQXA 4ZHRA 2QM1A 1RT5A 4B1XB 1BI4A 4CEEA 1JL2A 3K2PA 3VENA 4R5PA 4RW6A 2O8FB 5KGXA 4BACA 2O4GA 3QEXA 2P9UA 4J2DA 4Y0WA 4M45A 3QICA 4CHYA 4GKJK 4CFCA 4CVNE 3VA0A 3VF6A 3ID6A 3M5RA 1KC8O 1KD1O 3T1YK 1BIZA 1N32K 3CJ9A 2QWOA 4DTUA 3DLHA 3V9WA 4OPJA 2FLOA 3OY9A 1JLFA 2HHQA 3DRSA 4PQUA 3QEPA 3VN5A 1QTMA 2HHHK 1YTAA 4CJQA 5AQNA 1RGIA 4NCGA 1TKDA 5FPEA 3WQTA 3PIOL 3SV4A 3SPZA 2O8EA 2P9PB 3IUCA 3BGRA 4CJWA 3CMEN 1XNRK 3O6WA 4W5TA 3AO1A 1ESVA 3M6GA 4WQ5A 1TL3A 4IJAA 1YI2N 1RT1A 2UXDK 4JK9A 2OPPA 2P9UB 4DG1A 3B6PA 3EZ5A 4FWLA 3HPOA 2ASMA 1RT7A 3JAMO 1WSJA 2WONA 3LALA 3OYHA 3VF4A 4M3XA 1S22A 3EKUA 1RTJA 3MX5A 1C1BA 4O0IA 3D6RA 2ZGZA 1SUQA 2QWPA 2ZM6K 3LL3A 3QBXA 1HR0K 1VQ6N 3UIQA 4NB4A 3TTCA 1JCGA 3OJSA 4E1MA 3S3MA 3TTDA 3QLHA 4FWPA 4E7IA 1BISA 1KVCA 3KWGA 2GWJA 1XHXA 1K8AO 1FW6A 4N56A 3SPYA 4BRAA 3KLHA 2IGIA 2NRVA 4H03B 2OA8A 2O8CA 3DLBA 4E7LA 1EQYA 3MCPA 4BRKA 1B92A 4QS8A 3WT0A 1Q81O 2O8EB 3VQAA 1WAFA 3DOLA 1QE1A 3U9DA 2Z1JA 4FW1A 5AFUA 4HHTA 4NXNK 4NCAA 2RN2A 2VWKA 3V4IA 2D0CA 4AHVA 1NKEA 4EHTA 1B9DA 2G8FA 4CGGA 1ZBLA 3NGIA 1MDUB 5KPRA 4CGFA 4OGEA 4UQGA 1YJWN 4AHUA 3F9MA 1YHQN 3KKSA 2A6AA 2VGMA 3A5LC 3TI0A 4BRGA 1Q82O 2I5JA 4O44A 4CF9A 1ZC6A 3IKMA 3E1YA 4DHYA 4B9VA 3IFRA 1HKGA 1MWMA 1YJNN 5BRDA 3ZSVA 3P31A 3AVGA 4FLZA 1HPZA 2ZJRL 3HJFA 3I8BA 1Q8IA 4CJ5A 4KB0A 3DRRA 4BRQA 4IOXA 3NGYA 4CEFA 1CZ9A 3OYLA 4QAGA 2O8CB 1IO2A 4IKFA 3BDPA 4DLGA 4CE9A 2CGJA 3MWTA 3ZSOA 5BREA 1VAZA 3S41A 4CGDA 3OS1A 1C0GA 2OANA 2Z1IA 3HPHA 4V19S 2OPRA 4CGJA 4B9NA 1KRPA 2FBYA 4JI0K 3C6HA 3EYZA 4B8AB 4AHSA 4CEAA 3ZT4A 5SZTA 3M8SA 3SUNA 3CCJN 1R0AA 2KFNA 1JLAA 4AHRA 1HYVA 2E6MA 2UUBK 3VEYA 4OPKA 4B9MA 5FRNA 1MA9B 1QQCA 4Z0UA 4ELVA 1RT3A 4JS5A 4W5RA 5FRMA 1R59O 2UXBK 1C1CA 1Z05A 4EFHA 5C2FA 3RRGA 4IFEA 1VSKA 1BCOA 1QVFM 1EETA 3WXMB 1IJJA 1NK4A 4HWIA 3L3UA 3THYA 3O9QA 4IDHA 4A59A 3SMSA 2NRTA 3EKSA 4DLEA 3O3HA 5TKYA 4JKFA 1LW2A 4EHUA 3NBPA 1XHZA 1NK0A 4GV9A 2CGLA 1RBVA 3OS0A 1U2VA 4KH6A 3CJCA 1F21A 3AVAA 3AO3A 2V7ZA 3L2WA 4CZLA 3E9OA 1BL3A 4JKGB 3CIPA 4DS4A 3LM2A 3QIPA 4JAXA 2G8HA 1I39A 1P8ZA 1XMOK 1NGBA 2NRZA 3HTVA 1TVRA 3VMFB 4BRMA 5GAEP 3QNNA 3HOSA 4FSVA 4IDKA 5I42A 1ZBSA 5J2QA 4I2QA 4CEDA 4Z4FA 2YNIA 1RDBA 4CHPA 3CCRN 3WXJA 3OYGA 4WE1A 2OZSA 3B6OA 4CF8A 4Y1CA 2ETJA 3DLRA 3U3GA 3J7AP 2HMIA 4QS7A 3VEZA 2HF3A 1ASUA 4CJVA 1YVUA 3DM2A 3THYB 2F8TA 5CR4A 4OX9K 3KLFA 4DTXA 4O8UA 1NGCA 1U2VB 3ZETA 1B9FA 1IKVA 3L2RA 1BIUA 4IOCL 1K6YA 3LP0A 4YOUA 3HL8A 4YFUA 4F2RA 3CD6N 4YDUC 4A57A 1RDCA 4QCLA 3ZT3A 2A1RA 1J9AA 2X78A 5AQGA 5T7BA 2Y1JA 3OYFA 2P9NA 3OTOK 1T44A 4KPYA 4BGAA 1X9SA 3C65A 3AVFA 1HNXK 3QINA 5CYMA 3CCSN 3TPQA 4YDUA 2QA4N 1NU0A 3HYFA 2A3ZA 1VSMA 2E20A 1Z25A 3TSQA 3LDNA 2Z1HA 1HPMA 4O0JA 3PLAA 3CQ8A 4ZTJA 2D0BA 5HLFA 3AVIA 3BP8A 1ASWA 3F5TA 3I33A 1NMDA 4MQ3A 2X6NA 3PX0A 2PZSA 5ELZA 2B4JA 3SYZA 2E1ZA 4BR9A 3C6AA 1SZ2A 1UAXA 3JYTA 5C2DA 4H0VB 3AA4A 3ENOA 4AILC 2KZZA 3G10A 2WOMA 3AV9A 2Q97A 2GELA 1YUWA 1EKEA 2HBMA 3AVJA 2QKBA 4ILJA 1SL2A 4BR2A 4BC3A 3ZETB 3VOVA 2E5LK 1LAVA 1TV6A 1TK0A 2D5RA 3A5MC 3C0BA 4OKKA 3BEXA 4JI7K 4CK2A 2WC9A 3LM9A 2F96A 2HF4A 3G6EN 3AA5X 2VG5A 1Q7YO 1Z26A 4DV5K 3O1WA 4NCBA 3RR8A 2YNGA 2P9NB 3O3FA 1SL0A 3CJ1A 1LV5A 1EWQA 3GOIA 1WAJA 1T8EA 3O9RA 3R3LA 1V4SA 3EN9A 4BR5A 1HJOA 1VSHA 5AQZA 4FCYA 3HP9A 1RBTA 3MN9A 3MEEA 1LWFA 3WNGA 3QNOA 4IZ9A 1L3UA 3VQ8A 4IBNA 4AHTA 1J5EK 2OTLN 3SQ1A 2OZMA 3S9HA 4KHNA 1KFDA 1NGEA 3D0PA 3V1RA 3KD5E 4CFDA 4BRLA 3UE5A 3MEGA 2NUBA 3CF5L 5AQFA 3BUZB 3VQ5A 1TYQA 4HTLA 3CQYA 5CE3A 1I3AA 1GOCA 2EX3A 4M41A 2JGUA 3CETA 5H1SQ 3VA3A 4E89A 4C8LA 4JKEA 1S72N 4DV3K 1TL1A 3SUQA 1KQSM 3ZSQA 5EOYA 3FZLA 5CZ2A 2Q36A 5I3UA 4A2BA 2IDOA 4BRCA 2BDPA 4CERA 4KHSA 3S3NA 4ELUA 1ZBUA 2QTDA 3ZX3A 3P83D 4I9LA 3KLGA 3CPWM 3KTQA 1S9EA 1KTQA 3HBTA 1W97L 2WUSA 4M3WA 4ZTFA 1RDAA 4DQIA 3VQPA 4WF9L 3DXKA 1WOQA 4DV6K 3J7ZO 4FJ5A 4KKOA 4CK3A 3K9KA 5AQPA 2ZD1A 3VQQA 4H0OA 1HRHA 3M8QA 1HNWK 3VGMA 5DMRA 1GLFO 4XH4A 4BE2A 3KK3A 4Z94A 1GOAA 2VWBA 3FE1A 4N5SA 1HX1A 3D7EO 3NE6A 4LSNA 3CCQN 4UY8O 1VRUA 4XEIA 1TYQB 5M1FA 5TKWA 4B9SA 4DR5K 4DTJA 3BZCA 1VK0A 4DQSA 4BQLA 4LC9B 4DUZK 2YCHA 1Z6RA 2W40A 5AQQA 5GINA 1C0FA 5FDLA 3IG1A 1HLUA 5AQIA 4H0PA 4FLYA 4A5AA 3DLLL 3HXMA 1VSJA 3CHWA 1VRTA 2YJEA 1ZXOA 2YKNA 4H5RA 1OKJA 3MN5A 3K57A 2Q31A 3ZT2A 1IG9A 2GEMA 1VSIA 4FW2A 2VQFK 3DXMA 4KAZA 4BQZA 3CPEA 4MO5A 4FWQA 4ID1A 1W7AA 5J2MA 1GOBA 3DXKB 3CCMN 1WBBA 4Q0BA 1FXXA 1DT9A 2NRHA 4JNEA 4JD2A 4OGCA 2WFBA 3AVHA 4E1JA 1RDWX 3P39A 3K59A 3SMPA 5KRSA 3RMAA 2Q0UA 3GL1A 2I7NA 1NJZA 1KFSA 4FWSA 4KO0A 3WNHA 4AM6A 4BVOA 1X3MA 4AF1A 1NK9A 4PA1A 4JI1K 3OYEA 4O8KA 3SI6A 3ZYYX 3AO4A 1VQLN 1NGGA 3P1GA 5JS1A 4YNQA 2UYTA 3QMLA 2GUPA 4LH5A 4C8KA 3LWLA 4CK1A 2V52B 1JXEA 4H4OA 3CM5A 4ISFA 3BY5A 3EE9A 1RDDA 1V4TA 5C25A 3AVBA 3HVTA 3D45A 3VEWA 5B8HA 2KZMA 4WQ5C 1NGJA 2IIRA 1VQ7N 5LY3A 4PWDA 4FWMA 2QWQA 4C8MA 3UB5A 1L5UA 4JS4A 4F2SA 2D0AA 3DXMB 1HUXA 3RMCA 2ZF5O 4PUOA 3C95A 4OLBA 4HUGA 4YOYA 3CXCM 1HYSA 3QBWA 2OPQA 4JYAK 1KXPA 3HSTB 5M1NA 3JS6A 4JD2B 2HNZA 4LF8K 4G1QA 2DY4A 4F3OA 1DTTA 3K5MA 2YKMA 2FF3B 1QSLA 2CGKA 4A2AA 3CJ7A 4CJLA 1RBRA 4BRIA 2HMPA 1YT3A 1S1WA 4CIGA 3IAYA 2E2NA 3SAFA 5C15A 4KTZA 1GLDG 1D4XA 2B6AA 3KZBA 3CFOA 4FLXA 2NNWA 3I0RA 2HBLA 3DYAA 2AJQA 1RILA 4BREA 1GLEG 3O4QA 5AQTA 2F8SA 1JL1A 3ID8A 3DLEA 2XO7A 1Q9XA 2X74A 3L8BA 1U4BA 2DFHA 3DI6A 4IEEA 3K58A 3T1AA 3C7NA 4NLBA 1VHXA 5CY4A 3ATVA 3FLCO 4K25A 4DTSA 1VQ5N 4CIFA 5M1QA 3RWUA 1C6VA 1SAZA 1KAZA 3TAQA 3TR8A 2G8WA 4FLUA 3UKUA 5JICA 3MN7A 4Z4IA 1TUYA 1XC3A 3AY9A 2IS3A 1WLJA 2EHGA 4K8XA 2BGGA 3G25A 4GY2B 4CD1A 2GTDA 2JWKA 1ATRA 3HT3A 2A1SA 3OBYA 1NKCA 1HJRA 4K8ZA 1L3SA 3R8EA 2DFEA 4DFJA 5HRPA 3OYNA 3LANA 3OJUA 3PSIA 2O8DA 4I6MA 4JN4A 1L3TA 1BOTO 2VQEK 4B3SK 2HHXA 3QDKA 4FOEA 2PBDA 3SUPA 3K5NA 4B3TK 4N47A 2QXFA 4CW7B 1DKGD 3ZSYA 4C8NA 1QHTA 2Q2RA 4FM1A 2A42A 3Q7CA 4BE1A 4WQ4A 2A40A 2Q1NA 3PX4A 4LF9K 5KGWA 4C1NK 5M1OA 5EU7A 2Z1GA 2XY6A 4FJNA 4HUEA 1FJGK 3C7NB 1EWRA 4PKHA 4A61A 1ITGA 2PAVA 4B3RK 4XIUA 3WXLA 4LY7A 1FKOA 3FZFA 3P4IA 4YOTA 4M7YA 3UKUB 1IKXA 1LWEA 4JKGA 3TAMA 2P9IA 4KHUA 3HO1A 5BR9A 5BRHA 3RR7A 4B9LA 3AA2A 3SUOA 1BG3A 3HM9A 4H5TA 5AZJA 1N36K 4LH4A 3IDHA 4O5FA 4B9TA 4DTNA 4CD3A 3V6DA 3T1HK 4DV1K 1VQNN 1LCUA 2O8DB 4CBXA 4I6MB 2P51A 1N5YA 4DR7K 2DTUA 4CEQA 3MMVA 4CJRA 4PKGA 2PYLA 2ZWHA 4OJRA 3PV8A 4RG8A 4K42A 4FWKA 1KLNA 4KI6A 4CESA 1A5XA 4RW8A 2HNYA 3L2UA 4FJIA 2AA4A 4CHQA 1VSLA 3NVKA 5AQLA 1VQKN 2IVNA 4JI5K 1RT6A 2YHYA 3G71N 1YXQA 2HSTA 1NJXA 3IMXA 2HW3A 1EXQA 4XH1A 4FJ8A 3HI0A 1SKRA 2RPIA 2P9LA 4CGIA 4FLWA 4E7KA 2ZGYA 1K8KA 3K5LA 4CFBA 1EX4A 2P9IB 4CHZA 3NF9A 3C94A
chains in the Genus database with same CATH topology
2VG5A 4EP5A 1Z26A 3LAKA 4NCBA 3RR8A 2YNGA 4OKEA 1FK9A 3O3FA 1SL0A 3M8RA 1JLQA 1A5WA 2P5GA 2GUIA 1LV5A 2GBZA 4KB1A 1YTUA 4OLAA 1WAJA 3ZSXA 1T8EA 3ULDA 4IFYA 4LD0A 2FBVA 3OYBA 4DSFA 2RKIA 1REVA 3PO4A 4AHCA 1VSHA 3RTVA 1WSHA 4BE0A 1TK5A 4FCYA 3HP9A 1RBTA 3MEEA 2YHAA 2G8VA 1CZBA 5KI6A 4CJ4A 1C0UA 1QSYA 1LWFA 3LZJA 4JRQA 3WNGA 4CECA 4DMNA 1D9FA 4DQRA 3QNOA 3SV3A 3VQ9A 3V81A 4DSEA 1L3UA 5KRTA 4CEOA 4NYFA 1T03A 3VQ8A 4KHQA 2ITGA 4IBNA 4ZHRA 3G0ZA 1J53A 5HRSA 2JLEA 1RT5A 4AHTA 4CHNA 3SQ2A 3WNFA 3SQ1A 1BI4A 1JLEA 4CEEA 1JL2A 3K2PA 4R5PA 3S9HA 2OZMA 4RW6A 4KHNA 5KGXA 1KFDA 3MXMA 4CF1A 3ZSZA 4BACA 2O4GA 3QEXA 3F9KA 4DTPA 3D0PA 3V1RA 3KD5E 3VQ7A 4CFDA 2BE2A 1J54A 1U49A 2ATQA 4J2DA 4M45A 2HHUA 4CIEA 3MEGA 1NKBA 2NUBA 1ZYQA 1NK6A 2O4IA 2E6LA 4CHYA 4CFCA 1SV5A 1CLQA 4W5QA 3VA0A 2E4LA 3VQ5A 4CEZA 4FZXC 4J2EA 1S1VA 4HCBA 3QERA 4CJ3A 1WSGA 1O1WA 1KSPA 4CF2A 1I3AA 1BIZA 1X9WA 1GOCA 2EX3A 3NF7A 2X6SA 4M41A 1Y97A 5FROA 5D3GA 2JGUA 1WSFA 3L3VA 4DTUA 1VSFA 3VA3A 2XY7A 3DLHA 4E89A 3V9WA 4C8LA 3WNEA 3SCXA 4OPJA 4KRFA 4KI4A 3OY9A 3V9SA 1TL1A 1JLFA 5CZ1A 3SUQA 1XC9A 3DRSA 4EZ6A 4GW6A 3ZSQA 1RTDA 2HHQA 1S1UA 4PQUA 2VG7A 4GVMA 3QEPA 3VN5A 1QTMA 3ZT1A 5HRRA 3C6TA 1YTAA 2XY8A 5CZ2A 4B8CA 5I3UA 4BWJA 4DQQA 1T7PA 2QKKA 4CJQA 3ZSWA 4CF0A 4Z4EA 2XHBA 1S9GA 3P5JA 2IDOA 3A2FA 2BDPA 4CERA 4NCGA 3KK2A 1TKDA 4KHSA 4E1NA 3CM6A 3S3NA 4ELUA 1ZBUA 3PX6A 3ITHA 1L3VA 3P83D 3ASMA 4I9LA 3KLGA 3KLEA 1S9EA 3SV4A 1KTQA 4E3SA 3SPZA 3KTQA 3L2QA 4M3WA 4ZTFA 3BGRA 1RDAA 4CJWA 1WSEA 4DQIA 3DLGA 1U04A 1UA1A 3DMJA 3VQPA 1W0HA 1W9HA 4W5TA 2YHBA 3AO1A 4KKOA 4FJ5A 4CK3A 3MECA 3TANA 1S1TA 1TL3A 3OYDA 2ZD1A 1KVBA 3VQQA 3OYMA 3LDSA 1HRHA 2IC3A 3M8QA 4CHOA 3TAEA 5DMRA 4Z4GA 1RT1A 4DS5A 2OPPA 4DG1A 3B6PA 4BE2A 3EZ5A 4M3TA 1ZBHA 3KK3A 3CFRA 3HPOA 1GOAA 1RT7A 3PY8A 1WSJA 2WONA 3LZIA 1HNIA 2IOCA 4BDZA 3LALA 4N5SA 3FFIA 3OYHA 4M3XA 3NE6A 4LSNA 3V9ZA 1RTJA 4LSLA 3SNNA 3PO5A 1VRUA 4FJHA 1C1BA 1HQUA 4FM2A 3T19A 4O0IA 3SQ4A 4B9SA 4Z4CA 1NOYA 3NCIA 1SUQA 4M3UA 1ASVA 1KLMA 4DTJA 5HRNA 1VK0A 4DQSA 1IKYA 1C0TA 2W42A 4FK0A 3UIQA 1BCMA 3SJJA 3OYKA 3KK1A 3OJSA 4N41A 4FYDA 3VQ6A 4E1MA 3S3MA 5FDLA 3IG1A 1VSDA 3LPUA 4FLYA 3LP2A 3QLHA 2PYJA 4K8ZA 4E7IA 1BISA 4FXDA 3HXMA 3K5OA 1KVCA 1VSJA 2KW4A 1VRTA 4E7JA 1XHXA 4F8RA 4CCHA 1D5AA 1UWBA 2YKNA 2YNFA 4N56A 3V9XA 3SPYA 3KLHA 2IGIA 1QS4A 1X9MA 2OA8A 4M3RA 3CG7A 3K57A 1FKPA 3ZT2A 3DLBA 3DLKA 3NH2A 4E7LA 1IG9A 4KHYA 2HB5A 3TAFA 1KCFA 1VSIA 3ALYA 4FW2A 3KIOA 1B92A 1SKSA 1ZBIA 3VQAA 3O3GA 4KAZA 1WAFA 3V1QA 3DOLA 1JLBA 1QE1A 2HVHA 4FJGA 2Z1JA 4FW1A 4ID1A 4HVJA 4HHTA 4NCAA 2RN2A 2HHVA 2VWKA 5J2MA 3NF6A 1GOBA 3VQEA 3V4IA 4Q5VA 4Z4HA 3OYAA 4KTWA 4Q0BA 3TWHA 1FXXA 2D0CA 3MEDA 4OGCA 2HVIA 1X1PA 4AHVA 5K14A 1DLOA 1NKEA 1B9DA 4I7FA 2G8FA 4CGGA 1ZBLA 1KVAA 1S6PA 3AVHA 2LSNA 2YNHA 3NGIA 4FJMA 3K59A 5KRSA 3RMAA 3KJVA 4GMJB 4CJPA 3NH0A 5C24A 3L2VA 4CGFA 4OGEA 4UQGA 2OPSA 1NJZA 1KFSA 2P5OA 4F3TA 4AHUA 3I8DA 4KO0A 3WNHA 1D9DA 3KKSA 4DWIA 4DTMA 1NK9A 4I9QA 4PA1A 2ZE2A 3OYEA 3AVKA 1ZBFA 1JXBA 4CJSA 3TI0A 4FJ9A 4DFKA 2I5JA 3SI6A 3EY1A 4O44A 4CJKA 3HP6A 3OYCA 4QOZB 3AO4A 2Y1IA 3P1GA 4CF9A 5HP1A 4DU4A 4B9VA 5JS1A 4YNQA 2HHWA 3M8PA 3LP1A 3DOKA 5HROA 2ZQBA 4LH5A 4C8KA 3LWLA 3IS9A 4L8RB 1BQMA 3ZSVA 4CK1A 3SQ0A 4DSKA 4W5NA 3AVGA 1JXEA 4FLZA 1HPZA 2FC0A 3NFAA 4H4OA 4CJFA 3CM5A 1S1XA 1QSSA 3HJFA 2B5JA 1LAWA 1RDDA 2FBXA 1Q8IA 5C25A 3AVMA 4CJ5A 1HNVA 3V9UA 3AVBA 3HVTA 4KB0A 3D45A 3DRRA 2KZMA 2HHSA 3NGYA 4CEFA 1CZ9A 3OYLA 4QAGA 3ZT0A 3JSMA 4FZZA 2G8KA 4PWDA 4C8MA 1IO2A 4AH9A 4IKFA 1RT2A 1L5UA 4KTQA 4CFAA 3AO5A 4JS4A 4F2SA 3BDPA 4DLGA 2D0AA 4CE9A 3E01A 3ZSOA 3RMCA 4PUOA 3C95A 4CGDA 3OS1A 4OLBA 4HUGA 1HYSA 1WN7A 2Z1IA 3HPHA 5DK5A 3TABA 4M3ZA 2OPRA 5JS2A 2OPQA 3C6UA 3TARA 4CGJA 3HSTB 4DF4A 4B9NA 1KRPA 2FBYA 4FK4A 4DTOA 2HNZA 4BWMA 1NJYA 1VSEA 4G1QA 4DU1A 3EYZA 4FLVA 4MFBA 4B8AB 4F3OA 1DTTA 4AHSA 4CEAA 3K5MA 2G8IA 2YKMA 2VG6A 4ID5A 3ZT4A 5SZTA 3NGZA 3M8SA 3SUNA 1QSLA 1R0AA 4DSJA 1JLAA 4AHRA 1HYVA 2E6MA 3OYIA 4HCCA 4FJJA 2KFNA 1HYZA 1TAUA 4OPKA 1C1AA 4B9MA 5FRNA 4CJLA 2HNDA 1TKTA 1RBRA 1QQCA 4Z0UA 1YT3A 4ELVA 1S1WA 4CIGA 2HHTA 3IAYA 1RT3A 4JS5A 1RCHA 4W5RA 5FRMA 4M3YA 4KTZA 2B6AA 4Y1DA 4FJKA 3AA3A 4KV8A 1TKZA 3CFOA 3MXJA 3ZSRA 4FLXA 3I0RA 3VQCA 1XI1A 4RW7A 4DSIA 1RNHA 1C1CA 2KQ2A 3DYAA 2AJQA 1RILA 4E19A 3O4QA 3RRGA 4FK2A 2F8SA 1JL1A 1VSKA 1BCOA 4F4KA 2KTQA 1BHLA 5KTQA 1EETA 3RMBA 3DLEA 2KFZA 1NK4A 4DF8A 2XO7A 2XY5A 3C94A 3L3UA 4DFPA 1TGOA 3QEVA 4DLEA 1Q9XA 2X74A 3L8BA 3O3HA 4I2PA 1LW2A 3TAGA 3CYMA 3NBPA 1XHZA 1U4BA 2DFHA 1RBVA 3DI6A 3K58A 1NK0A 1A5VA 4ELTA 3T1AA 1C0MA 5CY4A 3ZCMA 3OS0A 2XRIA 2G8UA 4DTSA 3KLIA 1RBUA 4FJ7A 3O4NA 4IFVA 4CJEA 4CIFA 3THVA 4C8OA 3RWUA 1F21A 4IG0A 1S6QA 3AVAA 4DSLA 3AO3A 1C6VA 3L2WA 3TAQA 5J1EA 1SKWA 1CXQA 3TR8A 4FLUA 2G8WA 1UOCA 1BL3A 4CEBA 1TK8A 4M42A 4Z4IA 3ISNC 4DS4A 3VQBA 3PUFA 1LWCA 3QIPA 1G15A 2G8HA 1I39A 3AO2A 4FVMA 2IS3A 3OVNA 3HK2A 1WLJA 2EHGA 4ICLA 4K8XA 2BGGA 1RT4A 5SWMA 1TVRA 3HPGA 5HBMA 3QNNA 3HT3A 2A1SA 3HVRA 1NKCA 4IDKA 1HJRA 1JLGA 4E7HA 5I42A 3OYJA 4O5BA 3NDKA 5J2QA 1L3SA 1SL1A 2DFEA 4I2QA 4CEDA 3NAEA 4DFJA 5HRPA 2YNIA 3OYNA 3LANA 3OJUA 4Z4FA 1RDBA 4CHPA 1L3TA 4B9UA 3DRPA 1HQEA 3OYGA 2HHXA 4WE1A 1BQNA 2OZSA 3B6OA 3SUPA 1D8YA 3LAMA 2GV9A 4CF8A 3I0SA 4Y1CA 1JKHA 1NOZA 2ETJA 3K5NA 1WSIA 3DLRA 2QXFA 4N47A 3U3GA 4FZYA 3OS2A 3U6FA 1U45A 2HMIA 3QESA 1MU2A 3ZSYA 4C8NA 1QHTA 4FM1A 4RW4A 3VQDA 3CFPA 1J5OA 4J2BA 4B3OA 4BE1A 3T3FA 1ASUA 4DFMA 3AVNA 4O4GA 4CJVA 1YVUA 2RF2A 1XWLA 4TSXA 3PX4A 3DM2A 5KGWA 3H08A 4BDPA 3NF8A 1NK5A 5EU7A 2F8TA 2Z1GA 2XY6A 3KLFA 4FJNA 1N6QA 3MAQA 4HUEA 4DTXA 4E0DA 1NK7A 3SZ2A 2IAJA 3RRHA 1B9FA 1IKVA 3L2RA 1BIUA 1K6YA 3LP0A 4DQPA 1ITGA 4FLTA 4KREA 1TAQA 3HL8A 4YFUA 4XIUA 4F2RA 1WNSA 4LY7A 1FKOA 3LP3A 4H4MA 5J2PA 3LPTA 1RDCA 4QCLA 3LWMA 3ZT3A 2A1RA 3NHGA 1J9AA 2QK9A 2VWJA 1T05A 2OYQA 1IKXA 1LWEA 3TAMA 2X78A 5C42A 3QEWA 5T7BA 4KHUA 1EP4A 3OYFA 2Y1JA 3HO1A 4RW9A 4JLHA 3RR7A 1IKWA 4FJLA 1RTIA 4KPYA 4B9LA 4EZ9A 3AA2A 3SUOA 1X9SA 3HM9A 3AVFA 3QINA 5CYMA 5J2NA 4CGHA 3QETA 3MXIA 4KHWA 4LH4A 2FBTA 4DU3A 3U3YA 4CJTA 3HYFA 1UA0A 1VSMA 4OVLA 2Q3SA 1JLCA 1Z25A 4KFBA 4DTNA 4B9TA 3QO9A 3V6DA 2Z1HA 1S5JA 4O0JA 3CQ8A 4ZTJA 2D0BA 5HLFA 3QIOA 3AVCA 1HMVA 3KKRA 2P51A 3AVIA 4NYNA 1N5YA 2DY4A 1ASWA 2DTUA 3F73A 3KD1E 3IRXA 4CEQA 4MQ3A 2X6NA 2YV0X 3PX0A 2PZSA 4FJXA 2B4JA 4CJRA 3SYZA 2PY5A 3NH1A 5CYQA 3TAPA 4OJRA 2DFFA 3PV8A 2P1JA 4RG8A 2PYLA 5E41A 3S3OA 1UAXA 3JYTA 1TKXA 1KLNA 4KI6A 4CESA 4HUFA 3RMDA 4CJUA 1A5XA 1BI4B 4RW8A 4PY5A 3AVLA 3AA4A 1NK8A 4IG3A 1Q9YA 2HNYA 3L2UA 4J2AA 4AILC 2KZZA 4OKJA 3G10A 2WOMA 4B08A 3AV9A 3VQ4A 4FM0A 4FJIA 4CHQA 4DTRA 1VSLA 1EKEA 2BANA 4H8KA 1LW0A 4EP4A 3AVJA 1U47A 2QKBA 1RT6A 4JRPA 1NJWA 1SL2A 1RBSA 1NJXA 1CXUA 4BDYA 2HW3A 1EXQA 1LAVA 1TV6A 4N76A 4FJ8A 1TK0A 2D5RA 1DTQA 4W5OA 1SKRA 4OKKA 2RPIA 3QEIA 4CGIA 4HTUA 1U48A 4FLWA 1BGXT 4E7KA 2R7YA 3K5LA 4CK2A 4CFBA 1RTHA 1IH7A 2F96A 3V1OA 1EX4A 4CHZA 3NF9A 3AA5X 4O55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VG5 A;  4EP5 A;  1Z26 A;  3LAK A;  4NCB A;  3RR8 A;  2YNG A;  4OKE A;  1FK9 A;  3O3F A;  1SL0 A;  3M8R A;  1JLQ A;  1A5W A;  2P5G A;  2GUI A;  1LV5 A;  2GBZ A;  4KB1 A;  1YTU A;  4OLA A;  1WAJ A;  3ZSX A;  1T8E A;  3ULD A;  4IFY A;  4LD0 A;  2FBV A;  3OYB A;  4DSF A;  2RKI A;  1REV A;  3PO4 A;  4AHC A;  1VSH A;  3RTV A;  1WSH A;  4BE0 A;  1TK5 A;  4FCY A;  3HP9 A;  1RBT A;  3MEE A;  2YHA A;  2G8V A;  1CZB A;  5KI6 A;  4CJ4 A;  1C0U A;  1QSY A;  1LWF A;  3LZJ A;  4JRQ A;  3WNG A;  4CEC A;  4DMN A;  1D9F A;  4DQR A;  3QNO A;  3SV3 A;  3VQ9 A;  3V81 A;  4DSE A;  1L3U A;  5KRT A;  4CEO A;  4NYF A;  1T03 A;  3VQ8 A;  4KHQ A;  2ITG A;  4IBN A;  4ZHR A;  3G0Z A;  1J53 A;  5HRS A;  2JLE A;  1RT5 A;  4AHT A;  4CHN A;  3SQ2 A;  3WNF A;  3SQ1 A;  1BI4 A;  1JLE A;  4CEE A;  1JL2 A;  3K2P A;  4R5P A;  3S9H A;  2OZM A;  4RW6 A;  4KHN A;  5KGX A;  1KFD A;  3MXM A;  4CF1 A;  3ZSZ A;  4BAC A;  2O4G A;  3QEX A;  3F9K A;  4DTP A;  3D0P A;  3V1R A;  3KD5 E;  3VQ7 A;  4CFD A;  2BE2 A;  1J54 A;  1U49 A;  2ATQ A;  4J2D A;  4M45 A;  2HHU A;  4CIE A;  3MEG A;  1NKB A;  2NUB A;  1ZYQ A;  1NK6 A;  2O4I A;  2E6L A;  4CHY A;  4CFC A;  1SV5 A;  1CLQ A;  4W5Q A;  3VA0 A;  2E4L A;  3VQ5 A;  4CEZ A;  4FZX C;  4J2E A;  1S1V A;  4HCB A;  3QER A;  4CJ3 A;  1WSG A;  1O1W A;  1KSP A;  4CF2 A;  1I3A A;  1BIZ A;  1X9W A;  1GOC A;  2EX3 A;  3NF7 A;  2X6S A;  4M41 A;  1Y97 A;  5FRO A;  5D3G A;  2JGU A;  1WSF A;  3L3V A;  4DTU A;  1VSF A;  3VA3 A;  2XY7 A;  3DLH A;  4E89 A;  3V9W A;  4C8L A;  3WNE A;  3SCX A;  4OPJ A;  4KRF A;  4KI4 A;  3OY9 A;  3V9S A;  1TL1 A;  1JLF A;  5CZ1 A;  3SUQ A;  1XC9 A;  3DRS A;  4EZ6 A;  4GW6 A;  3ZSQ A;  1RTD A;  2HHQ A;  1S1U A;  4PQU A;  2VG7 A;  4GVM A;  3QEP A;  3VN5 A;  1QTM A;  3ZT1 A;  5HRR A;  3C6T A;  1YTA A;  2XY8 A;  5CZ2 A;  4B8C A;  5I3U A;  4BWJ A;  4DQQ A;  1T7P A;  2QKK A;  4CJQ A;  3ZSW A;  4CF0 A;  4Z4E A;  2XHB A;  1S9G A;  3P5J A;  2IDO A;  3A2F A;  2BDP A;  4CER A;  4NCG A;  3KK2 A;  1TKD A;  4KHS A;  4E1N A;  3CM6 A;  3S3N A;  4ELU A;  1ZBU A;  3PX6 A;  3ITH A;  1L3V A;  3P83 D;  3ASM A;  4I9L A;  3KLG A;  3KLE A;  1S9E A;  3SV4 A;  1KTQ A;  4E3S A;  3SPZ A;  3KTQ A;  3L2Q A;  4M3W A;  4ZTF A;  3BGR A;  1RDA A;  4CJW A;  1WSE A;  4DQI A;  3DLG A;  1U04 A;  1UA1 A;  3DMJ A;  3VQP A;  1W0H A;  1W9H A;  4W5T A;  2YHB A;  3AO1 A;  4KKO A;  4FJ5 A;  4CK3 A;  3MEC A;  3TAN A;  1S1T A;  1TL3 A;  3OYD A;  2ZD1 A;  1KVB A;  3VQQ A;  3OYM A;  3LDS A;  1HRH A;  2IC3 A;  3M8Q A;  4CHO A;  3TAE A;  5DMR A;  4Z4G A;  1RT1 A;  4DS5 A;  2OPP A;  4DG1 A;  3B6P A;  4BE2 A;  3EZ5 A;  4M3T A;  1ZBH A;  3KK3 A;  3CFR A;  3HPO A;  1GOA A;  1RT7 A;  3PY8 A;  1WSJ A;  2WON A;  3LZI A;  1HNI A;  2IOC A;  4BDZ A;  3LAL A;  4N5S A;  3FFI A;  3OYH A;  4M3X A;  3NE6 A;  4LSN A;  3V9Z A;  1RTJ A;  4LSL A;  3SNN A;  3PO5 A;  1VRU A;  4FJH A;  1C1B A;  1HQU A;  4FM2 A;  3T19 A;  4O0I A;  3SQ4 A;  4B9S A;  4Z4C A;  1NOY A;  3NCI A;  1SUQ A;  4M3U A;  1ASV A;  1KLM A;  4DTJ A;  5HRN A;  1VK0 A;  4DQS A;  1IKY A;  1C0T A;  2W42 A;  4FK0 A;  3UIQ A;  1BCM A;  3SJJ A;  3OYK A;  3KK1 A;  3OJS A;  4N41 A;  4FYD A;  3VQ6 A;  4E1M A;  3S3M A;  5FDL A;  3IG1 A;  1VSD A;  3LPU A;  4FLY A;  3LP2 A;  3QLH A;  2PYJ A;  4K8Z A;  4E7I A;  1BIS A;  4FXD A;  3HXM A;  3K5O A;  1KVC A;  1VSJ A;  2KW4 A;  1VRT A;  4E7J A;  1XHX A;  4F8R A;  4CCH A;  1D5A A;  1UWB A;  2YKN A;  2YNF A;  4N56 A;  3V9X A;  3SPY A;  3KLH A;  2IGI A;  1QS4 A;  1X9M A;  2OA8 A;  4M3R A;  3CG7 A;  3K57 A;  1FKP A;  3ZT2 A;  3DLB A;  3DLK A;  3NH2 A;  4E7L A;  1IG9 A;  4KHY A;  2HB5 A;  3TAF A;  1KCF A;  1VSI A;  3ALY A;  4FW2 A;  3KIO A;  1B92 A;  1SKS A;  1ZBI A;  3VQA A;  3O3G A;  4KAZ A;  1WAF A;  3V1Q A;  3DOL A;  1JLB A;  1QE1 A;  2HVH A;  4FJG A;  2Z1J A;  4FW1 A;  4ID1 A;  4HVJ A;  4HHT A;  4NCA A;  2RN2 A;  2HHV A;  2VWK A;  5J2M A;  3NF6 A;  1GOB A;  3VQE A;  3V4I A;  4Q5V A;  4Z4H A;  3OYA A;  4KTW A;  4Q0B A;  3TWH A;  1FXX A;  2D0C A;  3MED A;  4OGC A;  2HVI A;  1X1P A;  4AHV A;  5K14 A;  1DLO A;  1NKE A;  1B9D A;  4I7F A;  2G8F A;  4CGG A;  1ZBL A;  1KVA A;  1S6P A;  3AVH A;  2LSN A;  2YNH A;  3NGI A;  4FJM A;  3K59 A;  5KRS A;  3RMA A;  3KJV A;  4GMJ B;  4CJP A;  3NH0 A;  5C24 A;  3L2V A;  4CGF A;  4OGE A;  4UQG A;  2OPS A;  1NJZ A;  1KFS A;  2P5O A;  4F3T A;  4AHU A;  3I8D A;  4KO0 A;  3WNH A;  1D9D A;  3KKS A;  4DWI A;  4DTM A;  1NK9 A;  4I9Q A;  4PA1 A;  2ZE2 A;  3OYE A;  3AVK A;  1ZBF A;  1JXB A;  4CJS A;  3TI0 A;  4FJ9 A;  4DFK A;  2I5J A;  3SI6 A;  3EY1 A;  4O44 A;  4CJK A;  3HP6 A;  3OYC A;  4QOZ B;  3AO4 A;  2Y1I A;  3P1G A;  4CF9 A;  5HP1 A;  4DU4 A;  4B9V A;  5JS1 A;  4YNQ A;  2HHW A;  3M8P A;  3LP1 A;  3DOK A;  5HRO A;  2ZQB A;  4LH5 A;  4C8K A;  3LWL A;  3IS9 A;  4L8R B;  1BQM A;  3ZSV A;  4CK1 A;  3SQ0 A;  4DSK A;  4W5N A;  3AVG A;  1JXE A;  4FLZ A;  1HPZ A;  2FC0 A;  3NFA A;  4H4O A;  4CJF A;  3CM5 A;  1S1X A;  1QSS A;  3HJF A;  2B5J A;  1LAW A;  1RDD A;  2FBX A;  1Q8I A;  5C25 A;  3AVM A;  4CJ5 A;  1HNV A;  3V9U A;  3AVB A;  3HVT A;  4KB0 A;  3D45 A;  3DRR A;  2KZM A;  2HHS A;  3NGY A;  4CEF A;  1CZ9 A;  3OYL A;  4QAG A;  3ZT0 A;  3JSM A;  4FZZ A;  2G8K A;  4PWD A;  4C8M A;  1IO2 A;  4AH9 A;  4IKF A;  1RT2 A;  1L5U A;  4KTQ A;  4CFA A;  3AO5 A;  4JS4 A;  4F2S A;  3BDP A;  4DLG A;  2D0A A;  4CE9 A;  3E01 A;  3ZSO A;  3RMC A;  4PUO A;  3C95 A;  4CGD A;  3OS1 A;  4OLB A;  4HUG A;  1HYS A;  1WN7 A;  2Z1I A;  3HPH A;  5DK5 A;  3TAB A;  4M3Z A;  2OPR A;  5JS2 A;  2OPQ A;  3C6U A;  3TAR A;  4CGJ A;  3HST B;  4DF4 A;  4B9N A;  1KRP A;  2FBY A;  4FK4 A;  4DTO A;  2HNZ A;  4BWM A;  1NJY A;  1VSE A;  4G1Q A;  4DU1 A;  3EYZ A;  4FLV A;  4MFB A;  4B8A B;  4F3O A;  1DTT A;  4AHS A;  4CEA A;  3K5M A;  2G8I A;  2YKM A;  2VG6 A;  4ID5 A;  3ZT4 A;  5SZT A;  3NGZ A;  3M8S A;  3SUN A;  1QSL A;  1R0A A;  4DSJ A;  1JLA A;  4AHR A;  1HYV A;  2E6M A;  3OYI A;  4HCC A;  4FJJ A;  2KFN A;  1HYZ A;  1TAU A;  4OPK A;  1C1A A;  4B9M A;  5FRN A;  4CJL A;  2HND A;  1TKT A;  1RBR A;  1QQC A;  4Z0U A;  1YT3 A;  4ELV A;  1S1W A;  4CIG A;  2HHT A;  3IAY A;  1RT3 A;  4JS5 A;  1RCH A;  4W5R A;  5FRM A;  4M3Y A;  4KTZ A;  2B6A A;  4Y1D A;  4FJK A;  3AA3 A;  4KV8 A;  1TKZ A;  3CFO A;  3MXJ A;  3ZSR A;  4FLX A;  3I0R A;  3VQC A;  1XI1 A;  4RW7 A;  4DSI A;  1RNH A;  1C1C A;  2KQ2 A;  3DYA A;  2AJQ A;  1RIL A;  4E19 A;  3O4Q A;  3RRG A;  4FK2 A;  2F8S A;  1JL1 A;  1VSK A;  1BCO A;  4F4K A;  2KTQ A;  1BHL A;  5KTQ A;  1EET A;  3RMB A;  3DLE A;  2KFZ A;  1NK4 A;  4DF8 A;  2XO7 A;  2XY5 A;  3C94 A;  3L3U A;  4DFP A;  1TGO A;  3QEV A;  4DLE A;  1Q9X A;  2X74 A;  3L8B A;  3O3H A;  4I2P A;  1LW2 A;  3TAG A;  3CYM A;  3NBP A;  1XHZ A;  1U4B A;  2DFH A;  1RBV A;  3DI6 A;  3K58 A;  1NK0 A;  1A5V A;  4ELT A;  3T1A A;  1C0M A;  5CY4 A;  3ZCM A;  3OS0 A;  2XRI A;  2G8U A;  4DTS A;  3KLI A;  1RBU A;  4FJ7 A;  3O4N A;  4IFV A;  4CJE A;  4CIF A;  3THV A;  4C8O A;  3RWU A;  1F21 A;  4IG0 A;  1S6Q A;  3AVA A;  4DSL A;  3AO3 A;  1C6V A;  3L2W A;  3TAQ A;  5J1E A;  1SKW A;  1CXQ A;  3TR8 A;  4FLU A;  2G8W A;  1UOC A;  1BL3 A;  4CEB A;  1TK8 A;  4M42 A;  4Z4I A;  3ISN C;  4DS4 A;  3VQB A;  3PUF A;  1LWC A;  3QIP A;  1G15 A;  2G8H A;  1I39 A;  3AO2 A;  4FVM A;  2IS3 A;  3OVN A;  3HK2 A;  1WLJ A;  2EHG A;  4ICL A;  4K8X A;  2BGG A;  1RT4 A;  5SWM A;  1TVR A;  3HPG A;  5HBM A;  3QNN A;  3HT3 A;  2A1S A;  3HVR A;  1NKC A;  4IDK A;  1HJR A;  1JLG A;  4E7H A;  5I42 A;  3OYJ A;  4O5B A;  3NDK A;  5J2Q A;  1L3S A;  1SL1 A;  2DFE A;  4I2Q A;  4CED A;  3NAE A;  4DFJ A;  5HRP A;  2YNI A;  3OYN A;  3LAN A;  3OJU A;  4Z4F A;  1RDB A;  4CHP A;  1L3T A;  4B9U A;  3DRP A;  1HQE A;  3OYG A;  2HHX A;  4WE1 A;  1BQN A;  2OZS A;  3B6O A;  3SUP A;  1D8Y A;  3LAM A;  2GV9 A;  4CF8 A;  3I0S A;  4Y1C A;  1JKH A;  1NOZ A;  2ETJ A;  3K5N A;  1WSI A;  3DLR A;  2QXF A;  4N47 A;  3U3G A;  4FZY A;  3OS2 A;  3U6F A;  1U45 A;  2HMI A;  3QES A;  1MU2 A;  3ZSY A;  4C8N A;  1QHT A;  4FM1 A;  4RW4 A;  3VQD A;  3CFP A;  1J5O A;  4J2B A;  4B3O A;  4BE1 A;  3T3F A;  1ASU A;  4DFM A;  3AVN A;  4O4G A;  4CJV A;  1YVU A;  2RF2 A;  1XWL A;  4TSX A;  3PX4 A;  3DM2 A;  5KGW A;  3H08 A;  4BDP A;  3NF8 A;  1NK5 A;  5EU7 A;  2F8T A;  2Z1G A;  2XY6 A;  3KLF A;  4FJN A;  1N6Q A;  3MAQ A;  4HUE A;  4DTX A;  4E0D A;  1NK7 A;  3SZ2 A;  2IAJ A;  3RRH A;  1B9F A;  1IKV A;  3L2R A;  1BIU A;  1K6Y A;  3LP0 A;  4DQP A;  1ITG A;  4FLT A;  4KRE A;  1TAQ A;  3HL8 A;  4YFU A;  4XIU A;  4F2R A;  1WNS A;  4LY7 A;  1FKO A;  3LP3 A;  4H4M A;  5J2P A;  3LPT A;  1RDC A;  4QCL A;  3LWM A;  3ZT3 A;  2A1R A;  3NHG A;  1J9A A;  2QK9 A;  2VWJ A;  1T05 A;  2OYQ A;  1IKX A;  1LWE A;  3TAM A;  2X78 A;  5C42 A;  3QEW A;  5T7B A;  4KHU A;  1EP4 A;  3OYF A;  2Y1J A;  3HO1 A;  4RW9 A;  4JLH A;  3RR7 A;  1IKW A;  4FJL A;  1RTI A;  4KPY A;  4B9L A;  4EZ9 A;  3AA2 A;  3SUO A;  1X9S A;  3HM9 A;  3AVF A;  3QIN A;  5CYM A;  5J2N A;  4CGH A;  3QET A;  3MXI A;  4KHW A;  4LH4 A;  2FBT A;  4DU3 A;  3U3Y A;  4CJT A;  3HYF A;  1UA0 A;  1VSM A;  4OVL A;  2Q3S A;  1JLC A;  1Z25 A;  4KFB A;  4DTN A;  4B9T A;  3QO9 A;  3V6D A;  2Z1H A;  1S5J A;  4O0J A;  3CQ8 A;  4ZTJ A;  2D0B A;  5HLF A;  3QIO A;  3AVC A;  1HMV A;  3KKR A;  2P51 A;  3AVI A;  4NYN A;  1N5Y A;  2DY4 A;  1ASW A;  2DTU A;  3F73 A;  3KD1 E;  3IRX A;  4CEQ A;  4MQ3 A;  2X6N A;  2YV0 X;  3PX0 A;  2PZS A;  4FJX A;  2B4J A;  4CJR A;  3SYZ A;  2PY5 A;  3NH1 A;  5CYQ A;  3TAP A;  4OJR A;  2DFF A;  3PV8 A;  2P1J A;  4RG8 A;  2PYL A;  5E41 A;  3S3O A;  1UAX A;  3JYT A;  1TKX A;  1KLN A;  4KI6 A;  4CES A;  4HUF A;  3RMD A;  4CJU A;  1A5X A;  1BI4 B;  4RW8 A;  4PY5 A;  3AVL A;  3AA4 A;  1NK8 A;  4IG3 A;  1Q9Y A;  2HNY A;  3L2U A;  4J2A A;  4AIL C;  2KZZ A;  4OKJ A;  3G10 A;  2WOM A;  4B08 A;  3AV9 A;  3VQ4 A;  4FM0 A;  4FJI A;  4CHQ A;  4DTR A;  1VSL A;  1EKE A;  2BAN A;  4H8K A;  1LW0 A;  4EP4 A;  3AVJ A;  1U47 A;  2QKB A;  1RT6 A;  4JRP A;  1NJW A;  1SL2 A;  1RBS A;  1NJX A;  1CXU A;  4BDY A;  2HW3 A;  1EXQ A;  1LAV A;  1TV6 A;  4N76 A;  4FJ8 A;  1TK0 A;  2D5R A;  1DTQ A;  4W5O A;  1SKR A;  4OKK A;  2RPI A;  3QEI A;  4CGI A;  4HTU A;  1U48 A;  4FLW A;  1BGX T;  4E7K A;  2R7Y A;  3K5L A;  4CK2 A;  4CFB A;  1RTH A;  1IH7 A;  2F96 A;  3V1O A;  1EX4 A;  4CHZ A;  3NF9 A;  3AA5 X;  4O55 A; 
#chains in the Genus database with same CATH topology
 3QFP A;  4EP5 A;  3LAK A;  1N8R O;  4NXM K;  2P5G A;  5AZJ B;  4LFC K;  4OLA A;  5ADX H;  3ULD A;  1K9M O;  4WFN L;  4DSF A;  2RKI A;  4X65 K;  4BE0 A;  2I7P A;  1CZB A;  1QSY A;  3A5O C;  5KPT A;  2D0P A;  2NRX A;  1U6Z A;  3TTF A;  3V81 A;  5AQO A;  5CHI A;  3ZX2 A;  4KHQ A;  1KAY A;  2JLE A;  5M1P A;  5HRS A;  4CHN A;  1JLE A;  3MXM A;  4CF1 A;  1GLA G;  4GV6 A;  4DTP A;  4BR7 A;  4CZG A;  3QFU A;  2BE2 A;  1J54 A;  5GIO A;  2KKZ A;  2ATQ A;  4GNI A;  4CIE A;  3NVM A;  3KHY A;  1CLQ A;  4CEZ A;  4J2E A;  1S1V A;  4HCB A;  4CJ3 A;  5KQD A;  1WSG A;  4CF2 A;  4DR1 K;  1NGA A;  1Y64 A;  3RSE A;  3NF7 A;  2P9L B;  2X6S A;  1Y97 A;  5D3G A;  1WSF A;  2XY7 A;  1K8K B;  3O9T A;  4MO4 A;  2NRR A;  3V9S A;  4GW6 A;  2QEX N;  1E3M A;  2VG7 A;  4BY9 C;  3ZT1 A;  5HRR A;  2XY8 A;  3QB0 A;  3WEE A;  4B8C A;  2QKK A;  4DQQ A;  2UU9 K;  1S9G A;  3P5J A;  3A2F A;  1K73 O;  3EO3 A;  4E1N A;  3CM6 A;  1S3X A;  3PX6 A;  3ITH A;  1L3V A;  3ASM A;  3KLE A;  4E3S A;  2YX6 A;  4K41 A;  3L2Q A;  4IO9 L;  1IV0 A;  2E2P A;  3DMJ A;  5JMV A;  1W9H A;  1SS6 A;  5M1K A;  2H3G X;  3LDS A;  2QK9 A;  3TAE A;  4DCH A;  3A5N C;  5DM7 L;  3PY8 A;  1VQ9 N;  3LZI A;  1HNI A;  2IOC A;  1I94 K;  3I56 N;  1BA1 A;  3ATU A;  3V9Z A;  4MLH A;  3SNN A;  4DV7 K;  3PO5 A;  1OVQ A;  1HQU A;  5AQV A;  3O1B A;  2WTU A;  3VEX A;  1YAG A;  4Z4C A;  4R79 A;  1NOY A;  4DKW A;  3ENH A;  1KLM A;  1GLJ O;  4JK8 A;  4JI4 K;  4FK0 A;  3RSE B;  4CJ7 A;  1OH6 A;  1BCM A;  3H6E A;  3OYK A;  2RE2 A;  3KK1 A;  4FYD A;  1VQP N;  4H5N A;  3A0I X;  4FWN A;  3LP2 A;  3VF2 A;  3F2K A;  3K5O A;  3WEE B;  2KW4 A;  4WYB A;  4F8R A;  4BRD A;  1D5A A;  1UWB A;  3VTH A;  3H1V X;  5LJV A;  2RHK A;  1QS4 A;  1FKP A;  4KHY A;  2HB5 A;  1KCF A;  1GLC G;  2W6K A;  1SKS A;  1OH7 A;  3O3G A;  4CZF A;  2FXU A;  2F9W A;  2HVH A;  1GLL O;  4BC5 A;  3O9S A;  2HHV A;  3NF6 A;  4Q5V A;  4KTW A;  3TWH A;  1P90 A;  4CZJ A;  4I7F A;  1QHA A;  1KVA A;  1NGH A;  1S6P A;  2E8A A;  4FJM A;  3KJV A;  4GMJ B;  3BF1 A;  4CJP A;  5C24 A;  4JK7 A;  3TU5 A;  5BRF A;  3I8D A;  1NBW A;  3PSF A;  1D9D A;  2IVP A;  2ASO A;  2CH5 A;  4DWI A;  5GIP A;  2ZE2 A;  4FWR A;  5HL7 L;  4YOW A;  1ZBF A;  3O5B A;  4CJS A;  3CMA N;  4BR0 A;  4DFK A;  4CJK A;  3HP6 A;  2Y1I A;  2W6L A;  5HP1 A;  4JV5 K;  4DU4 A;  1QQO A;  3O9U A;  3M8P A;  3SJH A;  3LP1 A;  4YOV A;  3DOK A;  1OH5 A;  5AQJ A;  2ZQB A;  5HRO A;  3IS9 A;  4L8R B;  1BQM A;  2F9T A;  4LFA K;  4W5N A;  3NFA A;  1E4G T;  4CJF A;  1S1X A;  1LAW A;  2FBX A;  3V9U A;  1HNV A;  2UUA K;  3M3Z A;  3ULE A;  2HHS A;  4FZZ A;  3ZT0 A;  2G8K A;  5GAH P;  1JCF A;  3AO5 A;  3CC7 N;  1TUU A;  4MDB A;  3E01 A;  4LF5 K;  1NNE A;  4M3Z A;  3C6U A;  4CBU A;  3TAR A;  4DF4 A;  4FK4 A;  1T6C A;  4H0T B;  1BUP A;  2QWN A;  5JLF A;  4FLV A;  3EZW A;  3R1X A;  4MFB A;  2G8I A;  5E26 A;  4F3T A;  2VG6 A;  5C12 A;  1HYZ A;  1C1A A;  4K43 A;  2HND A;  2EWS A;  5AQS A;  2DPN A;  4FOI A;  2QWL A;  4M3Y A;  4FJK A;  3AA3 A;  1RDU A;  4RCH A;  3MXJ A;  3ZSR A;  4MDA A;  4JHD A;  1XI1 A;  4GVE A;  4RW7 A;  3CC4 N;  4B9Q A;  2KQ2 A;  3J7Y P;  4FK2 A;  3U8X A;  4ISE A;  4F4K A;  2KFZ A;  5KTQ A;  3RMB A;  3CJA A;  4DF8 A;  2XY5 A;  4DFP A;  4IJN A;  1TGO A;  3QEV A;  3T7Z A;  5KPZ A;  3FGU A;  3GE1 A;  2QI2 A;  3ZCM A;  4PL8 A;  2FF6 A;  3OHR A;  4DR4 K;  2XRI A;  2UXC K;  2BH1 A;  3KLI A;  1RBU A;  4IFV A;  4BRP A;  4C8O A;  3ULE B;  4IG0 A;  1S6Q A;  2P9S A;  4ILH A;  3NMU A;  5J1E A;  1SKW A;  1NM1 A;  4M42 A;  1TK8 A;  3HRG A;  3PUF A;  1X3N A;  2HBJ A;  2FSN A;  5AFU H;  5AQU A;  1RT4 A;  5HBM A;  3U9Z A;  3AGK A;  4E7H A;  1SL1 A;  4A62 A;  3L4I A;  4OPH A;  4B9U A;  1HQE A;  2QWM A;  4KH5 A;  5F1X A;  1BQN A;  1D8Y A;  2GV9 A;  4JKD A;  3I0S A;  3LDQ A;  1OH8 A;  1JKH A;  4JHD B;  3L6Q A;  5HOO A;  3U6F A;  1U45 A;  3MCA B;  1MU2 A;  3VET A;  3VQD A;  1YIT N;  3CFP A;  1J5O A;  4J2B A;  4B3O A;  3T3F A;  4IXC A;  2Q0R A;  2RF2 A;  3THX A;  1XQS C;  3R9P A;  4BDP A;  3NF8 A;  1NK5 A;  2IVO A;  3MWP A;  5EY4 A;  5MLC Q;  4PKI A;  3MAQ A;  4E0D A;  1NK7 A;  3HZ6 A;  2VGN A;  2IAJ A;  3RRH A;  3CCU N;  4DQP A;  4KRE A;  1NG9 A;  1WNS A;  3J81 O;  3VEO A;  3LP3 A;  5J2P A;  5GAG P;  3N4P A;  2P9S B;  4EIA A;  5LJW A;  4L3Q A;  1EP4 A;  4JI3 K;  1IKW A;  4FJL A;  1RTI A;  3DWL A;  3AAQ A;  1W2B M;  3QET A;  3MXI A;  4KHW A;  2FBT A;  3MX2 A;  4OVL A;  2QW9 A;  2Q3S A;  1JLC A;  3JXU A;  3CCV N;  1HNZ K;  5A2Q O;  4JKA A;  3AVC A;  1HMV A;  3KKR A;  4JKC A;  3IRX A;  3SAG A;  3TAP A;  2DFF A;  5FPD A;  5E41 A;  1TKX A;  3RMD A;  4CJU A;  1BI4 B;  4PY5 A;  1VQM N;  4IO8 A;  4YY3 K;  4J2A A;  4OKJ A;  3THX B;  3J80 O;  3FZK A;  3VQ4 A;  4FM0 A;  3BF3 A;  4WFA L;  3EL2 A;  4H8K A;  2BAN A;  1U47 A;  3MN6 A;  4FPA A;  1GLB G;  3TSP A;  4JRP A;  1NJW A;  1RBS A;  1X9J A;  4BDY A;  1CZA N;  1DTQ A;  4HTU A;  1U48 A;  1BGX T;  5LMU K;  3SK3 A;  2R7Y A;  1T6D A;  1RTH A;  1IH7 A;  4A5B A;  4O55 A;  2NZT A;  1J6Z A;  2QXL A;  4CZI A;  3LDL A;  3G4S N;  4OKE A;  4FVU A;  5AQW A;  1Q18 A;  1FK9 A;  3M8R A;  1JLQ A;  1YJ9 N;  1A5W A;  4PHT X;  4PL7 A;  4KB1 A;  3ZSX A;  5BPM A;  4DV2 K;  4LD0 A;  3WXI A;  1VQ8 N;  3OYB A;  1REV A;  3RTV A;  1WSH A;  1NMN A;  1XUP O;  2D0O A;  3DAW A;  1TK5 A;  4WCE L;  4BC2 A;  4WQ4 C;  2G8V A;  1NGI A;  1WUA A;  1C0U A;  3LZJ A;  3HOT A;  3FZH A;  4RWT A;  4JRQ A;  4CEC A;  4DMN A;  3CCL N;  3O4W A;  4DR2 K;  5FPM A;  3EEQ A;  3VQ9 A;  5KRT A;  4CEO A;  1T03 A;  1NJI O;  2ITG A;  4YOR A;  3G0Z A;  1J53 A;  4M63 C;  2KHO A;  3KWI A;  3SQ2 A;  3WNF A;  3J8A A;  4EAH D;  4NLC A;  3GG4 A;  3ZSZ A;  1DGK N;  3F9K A;  3VQ7 A;  1U49 A;  2E1Y A;  2HHU A;  1NKB A;  1ZYQ A;  1NK6 A;  2O4I A;  2E6L A;  1SV5 A;  4W5Q A;  2E4L A;  4FZX C;  3QER A;  1O1W A;  1LOT B;  1KSP A;  3EE8 A;  1MWK A;  4KHP K;  1X9W A;  4B1Y B;  5FRO A;  4IOA L;  3L3V A;  4U67 L;  1VSF A;  4OPA A;  3K9J A;  3WNE A;  3SCX A;  5AQX A;  4KRF A;  4EZ6 A;  1XC9 A;  5CZ1 A;  4XH5 A;  1RTD A;  1S1U A;  3RVC A;  4U7B A;  3MDQ A;  4GVM A;  4G9Z A;  2E88 A;  3C6T A;  4KI4 A;  1IBM K;  4BWJ A;  1T7P A;  3ZLJ A;  3ZSW A;  4CF0 A;  2ZJQ L;  4Z4E A;  2XHB A;  5GAD P;  3THW A;  5IT9 O;  1QZ6 A;  3D2E A;  3KK2 A;  2OTJ N;  4GV3 A;  4JKH A;  2P9K A;  2VCP A;  2E2Q A;  1WSE A;  4CZH A;  4J8F A;  1EO1 A;  3DLG A;  1U04 A;  4CZK A;  1UA1 A;  1W0H A;  3O80 A;  3CER A;  4X64 K;  1Q86 O;  2YHB A;  4BGB A;  3LDP A;  3MEC A;  3TAN A;  2GX9 A;  1S1T A;  4MLE A;  4JI8 K;  4CBW A;  3OYD A;  3OYM A;  1KVB A;  2IC3 A;  4CHO A;  3TSU A;  4Z4G A;  5E84 A;  4DS5 A;  2NLX A;  1VQO N;  4M3T A;  3A8Y A;  1ZBH A;  3CFR A;  3P38 A;  1SQK A;  2D4W A;  3FZM A;  4H5W A;  5AQM A;  3VGL A;  4BDZ A;  3L0Q A;  3FFI A;  5LL6 Z;  1NLV A;  4JKB A;  3H45 C;  4LSL A;  4FJH A;  1BO5 O;  4FM2 A;  3T19 A;  3SQ4 A;  3NCI A;  4BRH A;  2A5X A;  4M3U A;  1ASV A;  4QS9 A;  5AQH A;  5HRN A;  1IKY A;  1C0T A;  2W42 A;  3W0L A;  4RTF D;  3SJJ A;  4BRN A;  1ILY A;  1HKC A;  1JCE A;  4N41 A;  4FL9 A;  3VQ6 A;  1ATS A;  4JEP A;  4BC4 A;  3SBT A;  2FSK A;  1VSD A;  3LPU A;  2PYJ A;  4X62 K;  4LF4 K;  4DV0 K;  3AAP A;  4FXD A;  4E7J A;  4CCH A;  3AAR A;  3LDO A;  3THW B;  2W41 A;  2YNF A;  3V9X A;  3D2E B;  1VQ4 N;  1XNQ K;  1X9M A;  4KBO A;  3CG7 A;  4M3R A;  2P9K B;  3DLK A;  3NH2 A;  3TAF A;  3ALY A;  3FFK B;  3KIO A;  4OO1 J;  4BR4 A;  1ZBI A;  5KQ8 A;  1M90 O;  3V1Q A;  5JVH L;  1JLB A;  1IBK K;  4FJG A;  1NWK A;  3VTI A;  4HVJ A;  3VQE A;  3OYA A;  1H1V A;  4Z4H A;  5F2R A;  3MED A;  2HVI A;  1X1P A;  4FPB A;  5K14 A;  1DLO A;  3T69 A;  4DR3 K;  4B1Z A;  3O08 A;  5BPN A;  2LSN A;  2YNH A;  4K0K K;  3E9P A;  3U4L A;  4IEI A;  3HSC A;  4BG8 A;  5AR0 A;  2WBN A;  3NH0 A;  3L2V A;  2OPS A;  2P5O A;  4H5V A;  3N4Q A;  1T3V A;  4DTM A;  4I9Q A;  5C10 A;  3AVK A;  3E66 A;  1JXB A;  3VES A;  4FJ9 A;  3EY1 A;  3OYC A;  4QOZ B;  3ZX0 A;  3L4Q A;  4JI2 K;  2HHW A;  1HKB A;  5BN8 A;  5FLX O;  3SBG A;  4H0Y B;  3SQ0 A;  4DSK A;  5LMN K;  2A41 A;  2F7T A;  2ZJP L;  2FC0 A;  4B3M K;  1QSS A;  2B5J A;  3AVM A;  2HBK A;  1E4F T;  5I9E B;  4AM7 A;  3JSM A;  2VYP A;  5EXW A;  3CCE N;  4AH9 A;  1RT2 A;  4KTQ A;  4CFA A;  2E2O A;  4DQ8 A;  4BVP A;  2V7Y A;  3HM8 A;  2HOE A;  3VEV A;  3SAH A;  1WN7 A;  5DK5 A;  3TAB A;  5JS2 A;  4BRF A;  1QQN A;  4DTO A;  2YHX A;  4BWM A;  1NJY A;  1VSE A;  4DU1 A;  3CI5 A;  4ID5 A;  3NGZ A;  4DSJ A;  1BWF O;  4HCC A;  4FJJ A;  3OYI A;  3I55 N;  1TAU A;  3UKR A;  1IBL K;  1TKT A;  5EX5 A;  2HHT A;  4KH4 A;  1RCH A;  4Y1D A;  1YVN A;  3H1Q A;  4KV8 A;  1TKZ A;  3OW2 M;  3VQC A;  4DSI A;  1RNH A;  3OBW A;  1RFQ A;  3B8A X;  2YI1 A;  4E19 A;  2D1K A;  1ATN A;  2KTQ A;  1BHL A;  1KAX A;  3SLC A;  5JLH A;  5C0Y A;  4I2P A;  3TAG A;  4FWO A;  3CYM A;  4C23 A;  4ELT A;  1A5V A;  1C0M A;  2PFU A;  2G8U A;  1NGD A;  4FJ7 A;  3VGK A;  3O4N A;  4CJE A;  3THV A;  4DSL A;  3GDQ A;  1CXQ A;  5DM6 L;  1UOC A;  4CEB A;  2V51 B;  1XMQ K;  3ISN C;  3VQB A;  1QVG M;  1LWC A;  4CI6 A;  1G15 A;  3AO2 A;  4AQY K;  4FVM A;  3OVN A;  3HK2 A;  5F0X A;  4ICL A;  3KVG A;  5ADX A;  5SWM A;  3ZEU A;  3HPG A;  1WBD A;  3HVR A;  1JLG A;  4LFB K;  3OYJ A;  4O5B A;  3NDK A;  2FSJ A;  3NAE A;  4ILG B;  4WFB L;  3UKR B;  5BR8 K;  3DRP A;  4LF6 K;  4H0X B;  2QWR A;  4X66 K;  3CC2 N;  4M7X A;  3LAM A;  3WQU A;  1NOZ A;  3AGR A;  2YJF A;  1WSI A;  4FZY A;  4BRO A;  3OS2 A;  3QES A;  4DB3 A;  2O8B A;  2JWL A;  4RW4 A;  2AP1 A;  3KK7 A;  4DFM A;  3AVN A;  4O4G A;  1NGF A;  1XWL A;  4TSX A;  3H3O B;  1BU6 O;  3H08 A;  3WXK A;  1YF5 L;  3CJB A;  1N6Q A;  4B1W B;  3SZ2 A;  1QZ5 A;  4FLT A;  3O8M A;  1TAQ A;  3GBT A;  4H4M A;  3R6M A;  3FR0 A;  3LPT A;  5IWA K;  3LWM A;  3NHG A;  2VWJ A;  1T05 A;  2OYQ A;  4C1N I;  5C42 A;  5JVG L;  3QEW A;  1JJ2 M;  2CH6 A;  4RW9 A;  4JLH A;  4EZ9 A;  4B1U B;  4BG9 A;  3ENB A;  5J2N A;  4CGH A;  3ZEU B;  5AZI A;  4DU3 A;  3U3Y A;  5EVZ A;  4CJT A;  1UA0 A;  1M1K O;  3D2F A;  3K0S A;  3VPZ A;  4KFB A;  4JI6 K;  2OCE A;  3QO9 A;  1S5J A;  2F4V K;  2UUC K;  2BUP A;  3QIO A;  1QQM A;  2NRW A;  4NYN A;  3BZK A;  1BA0 A;  3F73 A;  3KD1 E;  5AQY A;  1O13 A;  2YV0 X;  4FJX A;  4DV4 K;  1OVY A;  5AJ3 K;  2PY5 A;  2BTF A;  3NH1 A;  5CYQ A;  3MK6 A;  4YOX A;  2P1J A;  4CZM A;  3S3O A;  3E9L A;  5BPL A;  4FO0 A;  1DEJ A;  4HUF A;  2O8B B;  3AVL A;  2O8F A;  1NK8 A;  4IG3 A;  1Q9Y A;  4B08 A;  4CZE A;  1G99 A;  3DJC A;  4DTR A;  1N33 K;  2KLA A;  5AQK A;  1LW0 A;  4EP4 A;  4DUY K;  1CXU A;  2J4R A;  4N76 A;  3WUH A;  3OA9 A;  4W5O A;  4ISG A;  3QEI A;  3H46 O;  5BN9 A;  3V1O A;  3Q7B A;  3M1F A;  1WB9 A;  4F9O A;  1YTU A;  2GUI A;  2GBZ A;  4LF7 K;  5AZI B;  4IFY A;  3D2F B;  4GKK K;  1BDG A;  2FBV A;  4IWV A;  3W3D A;  3PO4 A;  4AHC A;  4B1V A;  1IG8 A;  3VER A;  4NO7 A;  3PIP L;  4YHH K;  2P9P A;  2YHA A;  5AQR A;  2ITM A;  5KI6 A;  4CJ4 A;  2GWK A;  2ASP A;  3H3N O;  2YHW A;  1YIJ N;  5FPN A;  1D9F A;  4DQR A;  3SV3 A;  4DSE A;  4DR6 K;  4NYF A;  1N34 K;  3CQX A;  4ZHR A;  2QM1 A;  1RT5 A;  4B1X B;  1BI4 A;  4CEE A;  1JL2 A;  3K2P A;  3VEN A;  4R5P A;  4RW6 A;  2O8F B;  5KGX A;  4BAC A;  2O4G A;  3QEX A;  2P9U A;  4J2D A;  4Y0W A;  4M45 A;  3QIC A;  4CHY A;  4GKJ K;  4CFC A;  4CVN E;  3VA0 A;  3VF6 A;  3ID6 A;  3M5R A;  1KC8 O;  1KD1 O;  3T1Y K;  1BIZ A;  1N32 K;  3CJ9 A;  2QWO A;  4DTU A;  3DLH A;  3V9W A;  4OPJ A;  2FLO A;  3OY9 A;  1JLF A;  2HHQ A;  3DRS A;  4PQU A;  3QEP A;  3VN5 A;  1QTM A;  2HHH K;  1YTA A;  4CJQ A;  5AQN A;  1RGI A;  4NCG A;  1TKD A;  5FPE A;  3WQT A;  3PIO L;  3SV4 A;  3SPZ A;  2O8E A;  2P9P B;  3IUC A;  3BGR A;  4CJW A;  3CME N;  1XNR K;  3O6W A;  4W5T A;  3AO1 A;  1ESV A;  3M6G A;  4WQ5 A;  1TL3 A;  4IJA A;  1YI2 N;  1RT1 A;  2UXD K;  4JK9 A;  2OPP A;  2P9U B;  4DG1 A;  3B6P A;  3EZ5 A;  4FWL A;  3HPO A;  2ASM A;  1RT7 A;  3JAM O;  1WSJ A;  2WON A;  3LAL A;  3OYH A;  3VF4 A;  4M3X A;  1S22 A;  3EKU A;  1RTJ A;  3MX5 A;  1C1B A;  4O0I A;  3D6R A;  2ZGZ A;  1SUQ A;  2QWP A;  2ZM6 K;  3LL3 A;  3QBX A;  1HR0 K;  1VQ6 N;  3UIQ A;  4NB4 A;  3TTC A;  1JCG A;  3OJS A;  4E1M A;  3S3M A;  3TTD A;  3QLH A;  4FWP A;  4E7I A;  1BIS A;  1KVC A;  3KWG A;  2GWJ A;  1XHX A;  1K8A O;  1FW6 A;  4N56 A;  3SPY A;  4BRA A;  3KLH A;  2IGI A;  2NRV A;  4H03 B;  2OA8 A;  2O8C A;  3DLB A;  4E7L A;  1EQY A;  3MCP A;  4BRK A;  1B92 A;  4QS8 A;  3WT0 A;  1Q81 O;  2O8E B;  3VQA A;  1WAF A;  3DOL A;  1QE1 A;  3U9D A;  2Z1J A;  4FW1 A;  5AFU A;  4HHT A;  4NXN K;  4NCA A;  2RN2 A;  2VWK A;  3V4I A;  2D0C A;  4AHV A;  1NKE A;  4EHT A;  1B9D A;  2G8F A;  4CGG A;  1ZBL A;  3NGI A;  1MDU B;  5KPR A;  4CGF A;  4OGE A;  4UQG A;  1YJW N;  4AHU A;  3F9M A;  1YHQ N;  3KKS A;  2A6A A;  2VGM A;  3A5L C;  3TI0 A;  4BRG A;  1Q82 O;  2I5J A;  4O44 A;  4CF9 A;  1ZC6 A;  3IKM A;  3E1Y A;  4DHY A;  4B9V A;  3IFR A;  1HKG A;  1MWM A;  1YJN N;  5BRD A;  3ZSV A;  3P31 A;  3AVG A;  4FLZ A;  1HPZ A;  2ZJR L;  3HJF A;  3I8B A;  1Q8I A;  4CJ5 A;  4KB0 A;  3DRR A;  4BRQ A;  4IOX A;  3NGY A;  4CEF A;  1CZ9 A;  3OYL A;  4QAG A;  2O8C B;  1IO2 A;  4IKF A;  3BDP A;  4DLG A;  4CE9 A;  2CGJ A;  3MWT A;  3ZSO A;  5BRE A;  1VAZ A;  3S41 A;  4CGD A;  3OS1 A;  1C0G A;  2OAN A;  2Z1I A;  3HPH A;  4V19 S;  2OPR A;  4CGJ A;  4B9N A;  1KRP A;  2FBY A;  4JI0 K;  3C6H A;  3EYZ A;  4B8A B;  4AHS A;  4CEA A;  3ZT4 A;  5SZT A;  3M8S A;  3SUN A;  3CCJ N;  1R0A A;  2KFN A;  1JLA A;  4AHR A;  1HYV A;  2E6M A;  2UUB K;  3VEY A;  4OPK A;  4B9M A;  5FRN A;  1MA9 B;  1QQC A;  4Z0U A;  4ELV A;  1RT3 A;  4JS5 A;  4W5R A;  5FRM A;  1R59 O;  2UXB K;  1C1C A;  1Z05 A;  4EFH A;  5C2F A;  3RRG A;  4IFE A;  1VSK A;  1BCO A;  1QVF M;  1EET A;  3WXM B;  1IJJ A;  1NK4 A;  4HWI A;  3L3U A;  3THY A;  3O9Q A;  4IDH A;  4A59 A;  3SMS A;  2NRT A;  3EKS A;  4DLE A;  3O3H A;  5TKY A;  4JKF A;  1LW2 A;  4EHU A;  3NBP A;  1XHZ A;  1NK0 A;  4GV9 A;  2CGL A;  1RBV A;  3OS0 A;  1U2V A;  4KH6 A;  3CJC A;  1F21 A;  3AVA A;  3AO3 A;  2V7Z A;  3L2W A;  4CZL A;  3E9O A;  1BL3 A;  4JKG B;  3CIP A;  4DS4 A;  3LM2 A;  3QIP A;  4JAX A;  2G8H A;  1I39 A;  1P8Z A;  1XMO K;  1NGB A;  2NRZ A;  3HTV A;  1TVR A;  3VMF B;  4BRM A;  5GAE P;  3QNN A;  3HOS A;  4FSV A;  4IDK A;  5I42 A;  1ZBS A;  5J2Q A;  4I2Q A;  4CED A;  4Z4F A;  2YNI A;  1RDB A;  4CHP A;  3CCR N;  3WXJ A;  3OYG A;  4WE1 A;  2OZS A;  3B6O A;  4CF8 A;  4Y1C A;  2ETJ A;  3DLR A;  3U3G A;  3J7A P;  2HMI A;  4QS7 A;  3VEZ A;  2HF3 A;  1ASU A;  4CJV A;  1YVU A;  3DM2 A;  3THY B;  2F8T A;  5CR4 A;  4OX9 K;  3KLF A;  4DTX A;  4O8U A;  1NGC A;  1U2V B;  3ZET A;  1B9F A;  1IKV A;  3L2R A;  1BIU A;  4IOC L;  1K6Y A;  3LP0 A;  4YOU A;  3HL8 A;  4YFU A;  4F2R A;  3CD6 N;  4YDU C;  4A57 A;  1RDC A;  4QCL A;  3ZT3 A;  2A1R A;  1J9A A;  2X78 A;  5AQG A;  5T7B A;  2Y1J A;  3OYF A;  2P9N A;  3OTO K;  1T44 A;  4KPY A;  4BGA A;  1X9S A;  3C65 A;  3AVF A;  1HNX K;  3QIN A;  5CYM A;  3CCS N;  3TPQ A;  4YDU A;  2QA4 N;  1NU0 A;  3HYF A;  2A3Z A;  1VSM A;  2E20 A;  1Z25 A;  3TSQ A;  3LDN A;  2Z1H A;  1HPM A;  4O0J A;  3PLA A;  3CQ8 A;  4ZTJ A;  2D0B A;  5HLF A;  3AVI A;  3BP8 A;  1ASW A;  3F5T A;  3I33 A;  1NMD A;  4MQ3 A;  2X6N A;  3PX0 A;  2PZS A;  5ELZ A;  2B4J A;  3SYZ A;  2E1Z A;  4BR9 A;  3C6A A;  1SZ2 A;  1UAX A;  3JYT A;  5C2D A;  4H0V B;  3AA4 A;  3ENO A;  4AIL C;  2KZZ A;  3G10 A;  2WOM A;  3AV9 A;  2Q97 A;  2GEL A;  1YUW A;  1EKE A;  2HBM A;  3AVJ A;  2QKB A;  4ILJ A;  1SL2 A;  4BR2 A;  4BC3 A;  3ZET B;  3VOV A;  2E5L K;  1LAV A;  1TV6 A;  1TK0 A;  2D5R A;  3A5M C;  3C0B A;  4OKK A;  3BEX A;  4JI7 K;  4CK2 A;  2WC9 A;  3LM9 A;  2F96 A;  2HF4 A;  3G6E N;  3AA5 X;  2VG5 A;  1Q7Y O;  1Z26 A;  4DV5 K;  3O1W A;  4NCB A;  3RR8 A;  2YNG A;  2P9N B;  3O3F A;  1SL0 A;  3CJ1 A;  1LV5 A;  1EWQ A;  3GOI A;  1WAJ A;  1T8E A;  3O9R A;  3R3L A;  1V4S A;  3EN9 A;  4BR5 A;  1HJO A;  1VSH A;  5AQZ A;  4FCY A;  3HP9 A;  1RBT A;  3MN9 A;  3MEE A;  1LWF A;  3WNG A;  3QNO A;  4IZ9 A;  1L3U A;  3VQ8 A;  4IBN A;  4AHT A;  1J5E K;  2OTL N;  3SQ1 A;  2OZM A;  3S9H A;  4KHN A;  1KFD A;  1NGE A;  3D0P A;  3V1R A;  3KD5 E;  4CFD A;  4BRL A;  3UE5 A;  3MEG A;  2NUB A;  3CF5 L;  5AQF A;  3BUZ B;  3VQ5 A;  1TYQ A;  4HTL A;  3CQY A;  5CE3 A;  1I3A A;  1GOC A;  2EX3 A;  4M41 A;  2JGU A;  3CET A;  5H1S Q;  3VA3 A;  4E89 A;  4C8L A;  4JKE A;  1S72 N;  4DV3 K;  1TL1 A;  3SUQ A;  1KQS M;  3ZSQ A;  5EOY A;  3FZL A;  5CZ2 A;  2Q36 A;  5I3U A;  4A2B A;  2IDO A;  4BRC A;  2BDP A;  4CER A;  4KHS A;  3S3N A;  4ELU A;  1ZBU A;  2QTD A;  3ZX3 A;  3P83 D;  4I9L A;  3KLG A;  3CPW M;  3KTQ A;  1S9E A;  1KTQ A;  3HBT A;  1W97 L;  2WUS A;  4M3W A;  4ZTF A;  1RDA A;  4DQI A;  3VQP A;  4WF9 L;  3DXK A;  1WOQ A;  4DV6 K;  3J7Z O;  4FJ5 A;  4KKO A;  4CK3 A;  3K9K A;  5AQP A;  2ZD1 A;  3VQQ A;  4H0O A;  1HRH A;  3M8Q A;  1HNW K;  3VGM A;  5DMR A;  1GLF O;  4XH4 A;  4BE2 A;  3KK3 A;  4Z94 A;  1GOA A;  2VWB A;  3FE1 A;  4N5S A;  1HX1 A;  3D7E O;  3NE6 A;  4LSN A;  3CCQ N;  4UY8 O;  1VRU A;  4XEI A;  1TYQ B;  5M1F A;  5TKW A;  4B9S A;  4DR5 K;  4DTJ A;  3BZC A;  1VK0 A;  4DQS A;  4BQL A;  4LC9 B;  4DUZ K;  2YCH A;  1Z6R A;  2W40 A;  5AQQ A;  5GIN A;  1C0F A;  5FDL A;  3IG1 A;  1HLU A;  5AQI A;  4H0P A;  4FLY A;  4A5A A;  3DLL L;  3HXM A;  1VSJ A;  3CHW A;  1VRT A;  2YJE A;  1ZXO A;  2YKN A;  4H5R A;  1OKJ A;  3MN5 A;  3K57 A;  2Q31 A;  3ZT2 A;  1IG9 A;  2GEM A;  1VSI A;  4FW2 A;  2VQF K;  3DXM A;  4KAZ A;  4BQZ A;  3CPE A;  4MO5 A;  4FWQ A;  4ID1 A;  1W7A A;  5J2M A;  1GOB A;  3DXK B;  3CCM N;  1WBB A;  4Q0B A;  1FXX A;  1DT9 A;  2NRH A;  4JNE A;  4JD2 A;  4OGC A;  2WFB A;  3AVH A;  4E1J A;  1RDW X;  3P39 A;  3K59 A;  3SMP A;  5KRS A;  3RMA A;  2Q0U A;  3GL1 A;  2I7N A;  1NJZ A;  1KFS A;  4FWS A;  4KO0 A;  3WNH A;  4AM6 A;  4BVO A;  1X3M A;  4AF1 A;  1NK9 A;  4PA1 A;  4JI1 K;  3OYE A;  4O8K A;  3SI6 A;  3ZYY X;  3AO4 A;  1VQL N;  1NGG A;  3P1G A;  5JS1 A;  4YNQ A;  2UYT A;  3QML A;  2GUP A;  4LH5 A;  4C8K A;  3LWL A;  4CK1 A;  2V52 B;  1JXE A;  4H4O A;  3CM5 A;  4ISF A;  3BY5 A;  3EE9 A;  1RDD A;  1V4T A;  5C25 A;  3AVB A;  3HVT A;  3D45 A;  3VEW A;  5B8H A;  2KZM A;  4WQ5 C;  1NGJ A;  2IIR A;  1VQ7 N;  5LY3 A;  4PWD A;  4FWM A;  2QWQ A;  4C8M A;  3UB5 A;  1L5U A;  4JS4 A;  4F2S A;  2D0A A;  3DXM B;  1HUX A;  3RMC A;  2ZF5 O;  4PUO A;  3C95 A;  4OLB A;  4HUG A;  4YOY A;  3CXC M;  1HYS A;  3QBW A;  2OPQ A;  4JYA K;  1KXP A;  3HST B;  5M1N A;  3JS6 A;  4JD2 B;  2HNZ A;  4LF8 K;  4G1Q A;  2DY4 A;  4F3O A;  1DTT A;  3K5M A;  2YKM A;  2FF3 B;  1QSL A;  2CGK A;  4A2A A;  3CJ7 A;  4CJL A;  1RBR A;  4BRI A;  2HMP A;  1YT3 A;  1S1W A;  4CIG A;  3IAY A;  2E2N A;  3SAF A;  5C15 A;  4KTZ A;  1GLD G;  1D4X A;  2B6A A;  3KZB A;  3CFO A;  4FLX A;  2NNW A;  3I0R A;  2HBL A;  3DYA A;  2AJQ A;  1RIL A;  4BRE A;  1GLE G;  3O4Q A;  5AQT A;  2F8S A;  1JL1 A;  3ID8 A;  3DLE A;  2XO7 A;  1Q9X A;  2X74 A;  3L8B A;  1U4B A;  2DFH A;  3DI6 A;  4IEE A;  3K58 A;  3T1A A;  3C7N A;  4NLB A;  1VHX A;  5CY4 A;  3ATV A;  3FLC O;  4K25 A;  4DTS A;  1VQ5 N;  4CIF A;  5M1Q A;  3RWU A;  1C6V A;  1SAZ A;  1KAZ A;  3TAQ A;  3TR8 A;  2G8W A;  4FLU A;  3UKU A;  5JIC A;  3MN7 A;  4Z4I A;  1TUY A;  1XC3 A;  3AY9 A;  2IS3 A;  1WLJ A;  2EHG A;  4K8X A;  2BGG A;  3G25 A;  4GY2 B;  4CD1 A;  2GTD A;  2JWK A;  1ATR A;  3HT3 A;  2A1S A;  3OBY A;  1NKC A;  1HJR A;  4K8Z A;  1L3S A;  3R8E A;  2DFE A;  4DFJ A;  5HRP A;  3OYN A;  3LAN A;  3OJU A;  3PSI A;  2O8D A;  4I6M A;  4JN4 A;  1L3T A;  1BOT O;  2VQE K;  4B3S K;  2HHX A;  3QDK A;  4FOE A;  2PBD A;  3SUP A;  3K5N A;  4B3T K;  4N47 A;  2QXF A;  4CW7 B;  1DKG D;  3ZSY A;  4C8N A;  1QHT A;  2Q2R A;  4FM1 A;  2A42 A;  3Q7C A;  4BE1 A;  4WQ4 A;  2A40 A;  2Q1N A;  3PX4 A;  4LF9 K;  5KGW A;  4C1N K;  5M1O A;  5EU7 A;  2Z1G A;  2XY6 A;  4FJN A;  4HUE A;  1FJG K;  3C7N B;  1EWR A;  4PKH A;  4A61 A;  1ITG A;  2PAV A;  4B3R K;  4XIU A;  3WXL A;  4LY7 A;  1FKO A;  3FZF A;  3P4I A;  4YOT A;  4M7Y A;  3UKU B;  1IKX A;  1LWE A;  4JKG A;  3TAM A;  2P9I A;  4KHU A;  3HO1 A;  5BR9 A;  5BRH A;  3RR7 A;  4B9L A;  3AA2 A;  3SUO A;  1BG3 A;  3HM9 A;  4H5T A;  5AZJ A;  1N36 K;  4LH4 A;  3IDH A;  4O5F A;  4B9T A;  4DTN A;  4CD3 A;  3V6D A;  3T1H K;  4DV1 K;  1VQN N;  1LCU A;  2O8D B;  4CBX A;  4I6M B;  2P51 A;  1N5Y A;  4DR7 K;  2DTU A;  4CEQ A;  3MMV A;  4CJR A;  4PKG A;  2PYL A;  2ZWH A;  4OJR A;  3PV8 A;  4RG8 A;  4K42 A;  4FWK A;  1KLN A;  4KI6 A;  4CES A;  1A5X A;  4RW8 A;  2HNY A;  3L2U A;  4FJI A;  2AA4 A;  4CHQ A;  1VSL A;  3NVK A;  5AQL A;  1VQK N;  2IVN A;  4JI5 K;  1RT6 A;  2YHY A;  3G71 N;  1YXQ A;  2HST A;  1NJX A;  3IMX A;  2HW3 A;  1EXQ A;  4XH1 A;  4FJ8 A;  3HI0 A;  1SKR A;  2RPI A;  2P9L A;  4CGI A;  4FLW A;  4E7K A;  2ZGY A;  1K8K A;  3K5L A;  4CFB A;  1EX4 A;  2P9I B;  4CHZ A;  3NF9 A;  3C94 A; 
#chains in the Genus database with same CATH homology
 2VG5 A;  4EP5 A;  1Z26 A;  3LAK A;  4NCB A;  3RR8 A;  2YNG A;  4OKE A;  1FK9 A;  3O3F A;  1SL0 A;  3M8R A;  1JLQ A;  1A5W A;  2P5G A;  2GUI A;  1LV5 A;  2GBZ A;  4KB1 A;  1YTU A;  4OLA A;  1WAJ A;  3ZSX A;  1T8E A;  3ULD A;  4IFY A;  4LD0 A;  2FBV A;  3OYB A;  4DSF A;  2RKI A;  1REV A;  3PO4 A;  4AHC A;  1VSH A;  3RTV A;  1WSH A;  4BE0 A;  1TK5 A;  4FCY A;  3HP9 A;  1RBT A;  3MEE A;  2YHA A;  2G8V A;  1CZB A;  5KI6 A;  4CJ4 A;  1C0U A;  1QSY A;  1LWF A;  3LZJ A;  4JRQ A;  3WNG A;  4CEC A;  4DMN A;  1D9F A;  4DQR A;  3QNO A;  3SV3 A;  3VQ9 A;  3V81 A;  4DSE A;  1L3U A;  5KRT A;  4CEO A;  4NYF A;  1T03 A;  3VQ8 A;  4KHQ A;  2ITG A;  4IBN A;  4ZHR A;  3G0Z A;  1J53 A;  5HRS A;  2JLE A;  1RT5 A;  4AHT A;  4CHN A;  3SQ2 A;  3WNF A;  3SQ1 A;  1BI4 A;  1JLE A;  4CEE A;  1JL2 A;  3K2P A;  4R5P A;  3S9H A;  2OZM A;  4RW6 A;  4KHN A;  5KGX A;  1KFD A;  3MXM A;  4CF1 A;  3ZSZ A;  4BAC A;  2O4G A;  3QEX A;  3F9K A;  4DTP A;  3D0P A;  3V1R A;  3KD5 E;  3VQ7 A;  4CFD A;  2BE2 A;  1J54 A;  1U49 A;  2ATQ A;  4J2D A;  4M45 A;  2HHU A;  4CIE A;  3MEG A;  1NKB A;  2NUB A;  1ZYQ A;  1NK6 A;  2O4I A;  2E6L A;  4CHY A;  4CFC A;  1SV5 A;  1CLQ A;  4W5Q A;  3VA0 A;  2E4L A;  3VQ5 A;  4CEZ A;  4FZX C;  4J2E A;  1S1V A;  4HCB A;  3QER A;  4CJ3 A;  1WSG A;  1O1W A;  1KSP A;  4CF2 A;  1I3A A;  1BIZ A;  1X9W A;  1GOC A;  2EX3 A;  3NF7 A;  2X6S A;  4M41 A;  1Y97 A;  5FRO A;  5D3G A;  2JGU A;  1WSF A;  3L3V A;  4DTU A;  1VSF A;  3VA3 A;  2XY7 A;  3DLH A;  4E89 A;  3V9W A;  4C8L A;  3WNE A;  3SCX A;  4OPJ A;  4KRF A;  4KI4 A;  3OY9 A;  3V9S A;  1TL1 A;  1JLF A;  5CZ1 A;  3SUQ A;  1XC9 A;  3DRS A;  4EZ6 A;  4GW6 A;  3ZSQ A;  1RTD A;  2HHQ A;  1S1U A;  4PQU A;  2VG7 A;  4GVM A;  3QEP A;  3VN5 A;  1QTM A;  3ZT1 A;  5HRR A;  3C6T A;  1YTA A;  2XY8 A;  5CZ2 A;  4B8C A;  5I3U A;  4BWJ A;  4DQQ A;  1T7P A;  2QKK A;  4CJQ A;  3ZSW A;  4CF0 A;  4Z4E A;  2XHB A;  1S9G A;  3P5J A;  2IDO A;  3A2F A;  2BDP A;  4CER A;  4NCG A;  3KK2 A;  1TKD A;  4KHS A;  4E1N A;  3CM6 A;  3S3N A;  4ELU A;  1ZBU A;  3PX6 A;  3ITH A;  1L3V A;  3P83 D;  3ASM A;  4I9L A;  3KLG A;  3KLE A;  1S9E A;  3SV4 A;  1KTQ A;  4E3S A;  3SPZ A;  3KTQ A;  3L2Q A;  4M3W A;  4ZTF A;  3BGR A;  1RDA A;  4CJW A;  1WSE A;  4DQI A;  3DLG A;  1U04 A;  1UA1 A;  3DMJ A;  3VQP A;  1W0H A;  1W9H A;  4W5T A;  2YHB A;  3AO1 A;  4KKO A;  4FJ5 A;  4CK3 A;  3MEC A;  3TAN A;  1S1T A;  1TL3 A;  3OYD A;  2ZD1 A;  1KVB A;  3VQQ A;  3OYM A;  3LDS A;  1HRH A;  2IC3 A;  3M8Q A;  4CHO A;  3TAE A;  5DMR A;  4Z4G A;  1RT1 A;  4DS5 A;  2OPP A;  4DG1 A;  3B6P A;  4BE2 A;  3EZ5 A;  4M3T A;  1ZBH A;  3KK3 A;  3CFR A;  3HPO A;  1GOA A;  1RT7 A;  3PY8 A;  1WSJ A;  2WON A;  3LZI A;  1HNI A;  2IOC A;  4BDZ A;  3LAL A;  4N5S A;  3FFI A;  3OYH A;  4M3X A;  3NE6 A;  4LSN A;  3V9Z A;  1RTJ A;  4LSL A;  3SNN A;  3PO5 A;  1VRU A;  4FJH A;  1C1B A;  1HQU A;  4FM2 A;  3T19 A;  4O0I A;  3SQ4 A;  4B9S A;  4Z4C A;  1NOY A;  3NCI A;  1SUQ A;  4M3U A;  1ASV A;  1KLM A;  4DTJ A;  5HRN A;  1VK0 A;  4DQS A;  1IKY A;  1C0T A;  2W42 A;  4FK0 A;  3UIQ A;  1BCM A;  3SJJ A;  3OYK A;  3KK1 A;  3OJS A;  4N41 A;  4FYD A;  3VQ6 A;  4E1M A;  3S3M A;  5FDL A;  3IG1 A;  1VSD A;  3LPU A;  4FLY A;  3LP2 A;  3QLH A;  2PYJ A;  4K8Z A;  4E7I A;  1BIS A;  4FXD A;  3HXM A;  3K5O A;  1KVC A;  1VSJ A;  2KW4 A;  1VRT A;  4E7J A;  1XHX A;  4F8R A;  4CCH A;  1D5A A;  1UWB A;  2YKN A;  2YNF A;  4N56 A;  3V9X A;  3SPY A;  3KLH A;  2IGI A;  1QS4 A;  1X9M A;  2OA8 A;  4M3R A;  3CG7 A;  3K57 A;  1FKP A;  3ZT2 A;  3DLB A;  3DLK A;  3NH2 A;  4E7L A;  1IG9 A;  4KHY A;  2HB5 A;  3TAF A;  1KCF A;  1VSI A;  3ALY A;  4FW2 A;  3KIO A;  1B92 A;  1SKS A;  1ZBI A;  3VQA A;  3O3G A;  4KAZ A;  1WAF A;  3V1Q A;  3DOL A;  1JLB A;  1QE1 A;  2HVH A;  4FJG A;  2Z1J A;  4FW1 A;  4ID1 A;  4HVJ A;  4HHT A;  4NCA A;  2RN2 A;  2HHV A;  2VWK A;  5J2M A;  3NF6 A;  1GOB A;  3VQE A;  3V4I A;  4Q5V A;  4Z4H A;  3OYA A;  4KTW A;  4Q0B A;  3TWH A;  1FXX A;  2D0C A;  3MED A;  4OGC A;  2HVI A;  1X1P A;  4AHV A;  5K14 A;  1DLO A;  1NKE A;  1B9D A;  4I7F A;  2G8F A;  4CGG A;  1ZBL A;  1KVA A;  1S6P A;  3AVH A;  2LSN A;  2YNH A;  3NGI A;  4FJM A;  3K59 A;  5KRS A;  3RMA A;  3KJV A;  4GMJ B;  4CJP A;  3NH0 A;  5C24 A;  3L2V A;  4CGF A;  4OGE A;  4UQG A;  2OPS A;  1NJZ A;  1KFS A;  2P5O A;  4F3T A;  4AHU A;  3I8D A;  4KO0 A;  3WNH A;  1D9D A;  3KKS A;  4DWI A;  4DTM A;  1NK9 A;  4I9Q A;  4PA1 A;  2ZE2 A;  3OYE A;  3AVK A;  1ZBF A;  1JXB A;  4CJS A;  3TI0 A;  4FJ9 A;  4DFK A;  2I5J A;  3SI6 A;  3EY1 A;  4O44 A;  4CJK A;  3HP6 A;  3OYC A;  4QOZ B;  3AO4 A;  2Y1I A;  3P1G A;  4CF9 A;  5HP1 A;  4DU4 A;  4B9V A;  5JS1 A;  4YNQ A;  2HHW A;  3M8P A;  3LP1 A;  3DOK A;  5HRO A;  2ZQB A;  4LH5 A;  4C8K A;  3LWL A;  3IS9 A;  4L8R B;  1BQM A;  3ZSV A;  4CK1 A;  3SQ0 A;  4DSK A;  4W5N A;  3AVG A;  1JXE A;  4FLZ A;  1HPZ A;  2FC0 A;  3NFA A;  4H4O A;  4CJF A;  3CM5 A;  1S1X A;  1QSS A;  3HJF A;  2B5J A;  1LAW A;  1RDD A;  2FBX A;  1Q8I A;  5C25 A;  3AVM A;  4CJ5 A;  1HNV A;  3V9U A;  3AVB A;  3HVT A;  4KB0 A;  3D45 A;  3DRR A;  2KZM A;  2HHS A;  3NGY A;  4CEF A;  1CZ9 A;  3OYL A;  4QAG A;  3ZT0 A;  3JSM A;  4FZZ A;  2G8K A;  4PWD A;  4C8M A;  1IO2 A;  4AH9 A;  4IKF A;  1RT2 A;  1L5U A;  4KTQ A;  4CFA A;  3AO5 A;  4JS4 A;  4F2S A;  3BDP A;  4DLG A;  2D0A A;  4CE9 A;  3E01 A;  3ZSO A;  3RMC A;  4PUO A;  3C95 A;  4CGD A;  3OS1 A;  4OLB A;  4HUG A;  1HYS A;  1WN7 A;  2Z1I A;  3HPH A;  5DK5 A;  3TAB A;  4M3Z A;  2OPR A;  5JS2 A;  2OPQ A;  3C6U A;  3TAR A;  4CGJ A;  3HST B;  4DF4 A;  4B9N A;  1KRP A;  2FBY A;  4FK4 A;  4DTO A;  2HNZ A;  4BWM A;  1NJY A;  1VSE A;  4G1Q A;  4DU1 A;  3EYZ A;  4FLV A;  4MFB A;  4B8A B;  4F3O A;  1DTT A;  4AHS A;  4CEA A;  3K5M A;  2G8I A;  2YKM A;  2VG6 A;  4ID5 A;  3ZT4 A;  5SZT A;  3NGZ A;  3M8S A;  3SUN A;  1QSL A;  1R0A A;  4DSJ A;  1JLA A;  4AHR A;  1HYV A;  2E6M A;  3OYI A;  4HCC A;  4FJJ A;  2KFN A;  1HYZ A;  1TAU A;  4OPK A;  1C1A A;  4B9M A;  5FRN A;  4CJL A;  2HND A;  1TKT A;  1RBR A;  1QQC A;  4Z0U A;  1YT3 A;  4ELV A;  1S1W A;  4CIG A;  2HHT A;  3IAY A;  1RT3 A;  4JS5 A;  1RCH A;  4W5R A;  5FRM A;  4M3Y A;  4KTZ A;  2B6A A;  4Y1D A;  4FJK A;  3AA3 A;  4KV8 A;  1TKZ A;  3CFO A;  3MXJ A;  3ZSR A;  4FLX A;  3I0R A;  3VQC A;  1XI1 A;  4RW7 A;  4DSI A;  1RNH A;  1C1C A;  2KQ2 A;  3DYA A;  2AJQ A;  1RIL A;  4E19 A;  3O4Q A;  3RRG A;  4FK2 A;  2F8S A;  1JL1 A;  1VSK A;  1BCO A;  4F4K A;  2KTQ A;  1BHL A;  5KTQ A;  1EET A;  3RMB A;  3DLE A;  2KFZ A;  1NK4 A;  4DF8 A;  2XO7 A;  2XY5 A;  3C94 A;  3L3U A;  4DFP A;  1TGO A;  3QEV A;  4DLE A;  1Q9X A;  2X74 A;  3L8B A;  3O3H A;  4I2P A;  1LW2 A;  3TAG A;  3CYM A;  3NBP A;  1XHZ A;  1U4B A;  2DFH A;  1RBV A;  3DI6 A;  3K58 A;  1NK0 A;  1A5V A;  4ELT A;  3T1A A;  1C0M A;  5CY4 A;  3ZCM A;  3OS0 A;  2XRI A;  2G8U A;  4DTS A;  3KLI A;  1RBU A;  4FJ7 A;  3O4N A;  4IFV A;  4CJE A;  4CIF A;  3THV A;  4C8O A;  3RWU A;  1F21 A;  4IG0 A;  1S6Q A;  3AVA A;  4DSL A;  3AO3 A;  1C6V A;  3L2W A;  3TAQ A;  5J1E A;  1SKW A;  1CXQ A;  3TR8 A;  4FLU A;  2G8W A;  1UOC A;  1BL3 A;  4CEB A;  1TK8 A;  4M42 A;  4Z4I A;  3ISN C;  4DS4 A;  3VQB A;  3PUF A;  1LWC A;  3QIP A;  1G15 A;  2G8H A;  1I39 A;  3AO2 A;  4FVM A;  2IS3 A;  3OVN A;  3HK2 A;  1WLJ A;  2EHG A;  4ICL A;  4K8X A;  2BGG A;  1RT4 A;  5SWM A;  1TVR A;  3HPG A;  5HBM A;  3QNN A;  3HT3 A;  2A1S A;  3HVR A;  1NKC A;  4IDK A;  1HJR A;  1JLG A;  4E7H A;  5I42 A;  3OYJ A;  4O5B A;  3NDK A;  5J2Q A;  1L3S A;  1SL1 A;  2DFE A;  4I2Q A;  4CED A;  3NAE A;  4DFJ A;  5HRP A;  2YNI A;  3OYN A;  3LAN A;  3OJU A;  4Z4F A;  1RDB A;  4CHP A;  1L3T A;  4B9U A;  3DRP A;  1HQE A;  3OYG A;  2HHX A;  4WE1 A;  1BQN A;  2OZS A;  3B6O A;  3SUP A;  1D8Y A;  3LAM A;  2GV9 A;  4CF8 A;  3I0S A;  4Y1C A;  1JKH A;  1NOZ A;  2ETJ A;  3K5N A;  1WSI A;  3DLR A;  2QXF A;  4N47 A;  3U3G A;  4FZY A;  3OS2 A;  3U6F A;  1U45 A;  2HMI A;  3QES A;  1MU2 A;  3ZSY A;  4C8N A;  1QHT A;  4FM1 A;  4RW4 A;  3VQD A;  3CFP A;  1J5O A;  4J2B A;  4B3O A;  4BE1 A;  3T3F A;  1ASU A;  4DFM A;  3AVN A;  4O4G A;  4CJV A;  1YVU A;  2RF2 A;  1XWL A;  4TSX A;  3PX4 A;  3DM2 A;  5KGW A;  3H08 A;  4BDP A;  3NF8 A;  1NK5 A;  5EU7 A;  2F8T A;  2Z1G A;  2XY6 A;  3KLF A;  4FJN A;  1N6Q A;  3MAQ A;  4HUE A;  4DTX A;  4E0D A;  1NK7 A;  3SZ2 A;  2IAJ A;  3RRH A;  1B9F A;  1IKV A;  3L2R A;  1BIU A;  1K6Y A;  3LP0 A;  4DQP A;  1ITG A;  4FLT A;  4KRE A;  1TAQ A;  3HL8 A;  4YFU A;  4XIU A;  4F2R A;  1WNS A;  4LY7 A;  1FKO A;  3LP3 A;  4H4M A;  5J2P A;  3LPT A;  1RDC A;  4QCL A;  3LWM A;  3ZT3 A;  2A1R A;  3NHG A;  1J9A A;  2QK9 A;  2VWJ A;  1T05 A;  2OYQ A;  1IKX A;  1LWE A;  3TAM A;  2X78 A;  5C42 A;  3QEW A;  5T7B A;  4KHU A;  1EP4 A;  3OYF A;  2Y1J A;  3HO1 A;  4RW9 A;  4JLH A;  3RR7 A;  1IKW A;  4FJL A;  1RTI A;  4KPY A;  4B9L A;  4EZ9 A;  3AA2 A;  3SUO A;  1X9S A;  3HM9 A;  3AVF A;  3QIN A;  5CYM A;  5J2N A;  4CGH A;  3QET A;  3MXI A;  4KHW A;  4LH4 A;  2FBT A;  4DU3 A;  3U3Y A;  4CJT A;  3HYF A;  1UA0 A;  1VSM A;  4OVL A;  2Q3S A;  1JLC A;  1Z25 A;  4KFB A;  4DTN A;  4B9T A;  3QO9 A;  3V6D A;  2Z1H A;  1S5J A;  4O0J A;  3CQ8 A;  4ZTJ A;  2D0B A;  5HLF A;  3QIO A;  3AVC A;  1HMV A;  3KKR A;  2P51 A;  3AVI A;  4NYN A;  1N5Y A;  2DY4 A;  1ASW A;  2DTU A;  3F73 A;  3KD1 E;  3IRX A;  4CEQ A;  4MQ3 A;  2X6N A;  2YV0 X;  3PX0 A;  2PZS A;  4FJX A;  2B4J A;  4CJR A;  3SYZ A;  2PY5 A;  3NH1 A;  5CYQ A;  3TAP A;  4OJR A;  2DFF A;  3PV8 A;  2P1J A;  4RG8 A;  2PYL A;  5E41 A;  3S3O A;  1UAX A;  3JYT A;  1TKX A;  1KLN A;  4KI6 A;  4CES A;  4HUF A;  3RMD A;  4CJU A;  1A5X A;  1BI4 B;  4RW8 A;  4PY5 A;  3AVL A;  3AA4 A;  1NK8 A;  4IG3 A;  1Q9Y A;  2HNY A;  3L2U A;  4J2A A;  4AIL C;  2KZZ A;  4OKJ A;  3G10 A;  2WOM A;  4B08 A;  3AV9 A;  3VQ4 A;  4FM0 A;  4FJI A;  4CHQ A;  4DTR A;  1VSL A;  1EKE A;  2BAN A;  4H8K A;  1LW0 A;  4EP4 A;  3AVJ A;  1U47 A;  2QKB A;  1RT6 A;  4JRP A;  1NJW A;  1SL2 A;  1RBS A;  1NJX A;  1CXU A;  4BDY A;  2HW3 A;  1EXQ A;  1LAV A;  1TV6 A;  4N76 A;  4FJ8 A;  1TK0 A;  2D5R A;  1DTQ A;  4W5O A;  1SKR A;  4OKK A;  2RPI A;  3QEI A;  4CGI A;  4HTU A;  1U48 A;  4FLW A;  1BGX T;  4E7K A;  2R7Y A;  3K5L A;  4CK2 A;  4CFB A;  1RTH A;  1IH7 A;  2F96 A;  3V1O A;  1EX4 A;  4CHZ A;  3NF9 A;  3AA5 X;  4O55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...