4KTZA

Lactococcus phage 67 ruvc
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
160
structure length
160
Chain Sequence
MKKILAINFSTASKKGEGTGYAFRKDGQVYVGSIKAYNPKKTAWERTFDIVNAIKDIIDEFDLKGYHLAIETPIMGRNRKHSITLANCNGYFIGAIDGLVNGYTFIDNSKWCSYHLISGKREQRKEESLELLKATGLVDSNCKDDNIADAYNILTYCEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RuvC endonuclease
publication title Mutants of phage bIL67 RuvC with enhanced Holliday junction binding selectivity and resolution symmetry.
pubmed doi rcsb
source organism Lactococcus phage bil67
total genus 57
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07066 DUF3882 Lactococcus phage M3 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ktzA00
3DLRA 5FDLA 2QK9A 1Y97A 3K2PA 2EHGA 3WNHA 2E4LA 1J9AA 1RBUA 2DFFA 1F21A 3EYZA 2BDPA 1QHTA 4AHRA 3SQ1A 2FBXA 1IKWA 1TAQA 2JLEA 3K5NA 1QQCA 3TARA 3T1AA 1ASUA 3AVKA 5D3GA 1HQUA 3AVLA 3QINA 1T8EA 3ZSOA 3ZSYA 3AO4A 4C8NA 4OGCA 1J53A 3TAMA 3AO1A 4KTZA 1X9WA 4CEAA 4CK3A 1TAUA 2WONA 3DLEA 1GOAA 4GMJB 4LH5A 3ZT0A 1YTAA 4CIGA 4N41A 3OYKA 4RW6A 5EU7A 5J2MA 3RMDA 4FJ5A 1HPZA 4FZZA 1U04A 4N76A 4Q5VA 1A5VA 1MU2A 5C24A 1RTIA 4H8KA 1REVA 2YV0X 3V9UA 1TL1A 4F2SA 2G8VA 3HXMA 2WOMA 4Y1DA 3EY1A 2EX3A 3CM6A 3LWLA 1VRUA 3VQCA 1S1XA 4H4OA 4CJVA 1VSFA 2ZQBA 5CYQA 4DLGA 3QEWA 3SQ4A 3I0SA 3LALA 5JS2A 3WNFA 4CJTA 4B9VA 4DSIA 3E01A 3HM9A 2FBTA 1T05A 4FK2A 1RBRA 3NH1A 4DQIA 2VG7A 3THVA 1JLGA 4B9UA 3KD1E 3KLEA 4CERA 2Z1GA 3P5JA 3OYAA 1XWLA 4RW4A 4HUFA 4ID5A 4CJQA 1EP4A 4FK4A 3M8RA 4CIEA 2XY8A 4E3SA 2YNIA 4CF2A 5KRSA 3CFPA 1ZBFA 4CHZA 1JLCA 3OYFA 4FJXA 5FRMA 4W5NA 3HP6A 4CHOA 1SKRA 1WSHA 4LY7A 1IKXA 3ASMA 4B9NA 3KK2A 1I39A 4CJPA 1BCMA 4ELTA 1N6QA 2Z1IA 4DFKA 1IKVA 1VRTA 4O44A 4F2RA 4GVMA 1NK0A 4Z4IA 3QIPA 4BDZA 3M8PA 1I3AA 1ASWA 5J2PA 2PYLA 2P5GA 2BANA 2DY4A 3PO5A 1L3UA 2ZD1A 3T3FA 1RDCA 3AVCA 2YHBA 1HQEA 1WSEA 4Z4FA 3AV9A 5KTQA 2VWJA 3DOLA 2HB5A 4CEDA 3C6UA 5I3UA 3CFOA 2OPPA 3L8BA 1X9SA 4NYFA 1HMVA 1J54A 4OGEA 3RTVA 4DTUA 3SNNA 5HRSA 5HBMA 5J2QA 4N47A 1BISA 1A5XA 1NJYA 3I0RA 2Y1IA 3RRGA 4FLYA 3TAEA 3PX0A 1U49A 1BIZA 4H4MA 4CHYA 4B08A 3LDSA 2GUIA 4DU3A 3OYCA 1JXEA 4N5SA 4FM0A 1RTJA 2XY5A 4DQQA 4ID1A 1TKDA 4OLBA 3PUFA 1RT7A 3DRSA 4DTXA 2F8SA 4QOZB 4IBNA 4CFCA 1JLQA 3HPOA 1TV6A 4Z4CA 2G8HA 3SUOA 2OPRA 1O1WA 1C6VA 3AO3A 3HP9A 3ZT2A 4AHVA 3BGRA 4FM1A 3PV8A 5HROA 4J2BA 4DF4A 4CHQA 1W0HA 3IG1A 4M42A 4DSEA 1FKPA 4CEFA 4ZHRA 3TWHA 1BL3A 2OZSA 3HPHA 3WNGA 3MEDA 2O4GA 1KVBA 3A2FA 5HRNA 2A1RA 2B5JA 3KLIA 2Z1HA 1ZBHA 1RBSA 3JYTA 2B4JA 4ELVA 4HCBA 5HRPA 3TABA 1ITGA 2BE2A 3RR7A 4FXDA 1VSMA 4CEBA 1NK9A 4E7HA 4CF8A 4HHTA 3VQ4A 2VG5A 4HVJA 4B3OA 1C0MA 3H08A 4CJSA 3OJUA 4I2PA 4LSLA 4B9SA 2KFNA 3OS0A 1N5YA 4ICLA 1WNSA 4FJGA 3CQ8A 2OZMA 2DFEA 4I2QA 3NF8A 5FRNA 5JS1A 2YKNA 3DLBA 3V4IA 1U48A 4M41A 4XIUA 4FLVA 3L2UA 2GV9A 3DM2A 3LAMA 3MEGA 5I42A 2ZE2A 3SUNA 1SL1A 1VSDA 4BDYA 2KTQA 1ZBUA 3AVAA 1HNVA 3QERA 4Z4EA 2LSNA 3OYLA 2IOCA 2IDOA 4BWJA 3LP1A 3PO4A 4DTJA 4JRQA 2I5JA 4RW8A 1IG9A 3DMJA 4E19A 2IC3A 1HYSA 5SZTA 1A5WA 1BQMA 4DTOA 1S1VA 1HRHA 1TKXA 1WAJA 2GBZA 4E0DA 1RT5A 3O4NA 4C8MA 1R0AA 4QCLA 5DK5A 1LW2A 2RKIA 3QEIA 4B9MA 5KGWA 3HSTB 4KKOA 2G8FA 4CGJA 1IKYA 3HPGA 3SCXA 5J1EA 2F8TA 1K6YA 3BDPA 4F3TA 4MFBA 3G0ZA 3RWUA 3LZJA 1XC9A 3VN5A 5J2NA 3PX4A 1U47A 2FBVA 3ULDA 1NJXA 3LPTA 3ALYA 5KGXA 1U4BA 1ASVA 3QEVA 1C0UA 1DLOA 1RTHA 3AVHA 3L2RA 1NKBA 3MAQA 1SUQA 4QAGA 4OPJA 2O4IA 2DFHA 1T7PA 1S9EA 4B9TA 3VQDA 4CEOA 1FXXA 2G8IA 4C8KA 1KLMA 4IKFA 3U6FA 4AHSA 2W42A 2E6MA 3LP0A 1IO2A 3V1RA 4FLXA 1SL0A 4EZ6A 4AHUA 3F73A 2YNGA 3TAQA 3ZSQA 1RT1A 1NK8A 4W5RA 2X74A 4M3TA 4LSNA 5SWMA 4W5QA 1HYVA 4UQGA 2A1SA 3DOKA 1HNIA 3MECA 4M3WA 3LAKA 2RF2A 4FW1A 4FJIA 1X9MA 3KLGA 3P83D 4DG1A 3LP2A 4FJ7A 4PY5A 4OLAA 3QESA 2KQ2A 3KJVA 3SPZA 1RT4A 5HRRA 4EP5A 4JRPA 4FW2A 5C25A 2F96A 4KTQA 1DTQA 3V81A 3TAPA 4PA1A 2HNDA 4OKJA 4FM2A 4CJLA 4DFMA 1NJZA 3SV3A 2YNHA 4M3YA 4CGHA 2RPIA 2JGUA 3CYMA 1KFDA 5CY4A 3OYJA 4J2DA 4FJ9A 1RBTA 3V9WA 4L8RB 3SYZA 3AA4A 4KRFA 1UA0A 3K5OA 2KFZA 4E7IA 3V1QA 4I9QA 4PWDA 2DTUA 1B9DA 3AVIA 1RT6A 4CFDA 1ZYQA 3UIQA 3IAYA 3ZT1A 3ZSRA 2HHVA 4IFVA 3PY8A 3LANA 4CJUA 4KB0A 4CCHA 3AVBA 4OKEA 2XY7A 2HHWA 4Z4GA 4EZ9A 3OYIA 1JLBA 3QO9A 4NCGA 1YVUA 2XHBA 4HUGA 3S3OA 3NDKA 4E7JA 2QKBA 4BDPA 4DTMA 1C1CA 4KB1A 3DI6A 3AVMA 1TKZA 4M3XA 4CK2A 4FCYA 4G1QA 3V9XA 1L3TA 1XI1A 3V9ZA 4I7FA 1NK6A 2PZSA 4FJ8A 2KZMA 1RBVA 3SPYA 2OPSA 3QIOA 4JS5A 3F9KA 3OYEA 1TVRA 4AHTA 1ZBLA 1S5JA 1LWCA 1D5AA 3KLHA 2XO7A 2HW3A 1Q9XA 1L3SA 4ELUA 4IG3A 4KI6A 1BGXT 5T7BA 1XHXA 3NF9A 5KRTA 4M3ZA 1BCOA 3HT3A 1KVAA 1G15A 4M45A 4DTRA 4AH9A 4K8ZA 4KHQA 4R5PA 1S1UA 1TK8A 3SQ0A 3KK3A 4DS4A 1Z25A 3AO2A 1Z26A 4JS4A 3QEPA 3K5MA 3KKSA 3AVJA 1NJWA 2VG6A 4DWIA 1SKSA 4BE2A 3LZIA 4CF0A 1JL2A 4KFBA 3DLKA 4IFYA 5E41A 4O4GA 3AO5A 3LWMA 1S1TA 4FYDA 4Z0UA 4I9LA 3TANA 2X6SA 1S6QA 4M3RA 1NKEA 2BGGA 4AILC 3DLGA 3OVNA 3C95A 4OVLA 2YHAA 3VQ8A 4DFPA 2FBYA 3VQAA 2QKKA 4DSLA 1LW0A 1JXBA 3LPUA 5HP1A 3AA2A 4KV8A 3SZ2A 3KIOA 2KZZA 1RTDA 4DU1A 2ITGA 1C0TA 2P1JA 4GW6A 4CJFA 3K58A 3CFRA 1C1BA 1RCHA 3OYBA 1U45A 3FFIA 3RMCA 3MXMA 4N56A 4MQ3A 1VSIA 1LAWA 3NE6A 1VK0A 4B8CA 3RMAA 1HJRA 4CGGA 1TK0A 3SUPA 2G8UA 4FJKA 4KO0A 2OPQA 3MXJA 3M8SA 3EZ5A 5DMRA 4DQRA 3L3UA 3V6DA 2Z1JA 4KHNA 3KKRA 3D45A 3OS1A 4NCBA 1L5UA 3S9HA 1T03A 4DS5A 3CG7A 3HJFA 1BHLA 1CXUA 4OKKA 4W5TA 3DRPA 3TAFA 4DTNA 3LP3A 4DQSA 4DU4A 4DSJA 4DLEA 3S3NA 1CZBA 3OYGA 4C8LA 4E7KA 1NKCA 1LWEA 4O0IA 4FLTA 3VQ7A 3NGYA 4CGDA 2HHUA 4YNQA 4WE1A 3HVTA 2HHTA 3P1GA 3QEXA 4E1MA 2YKMA 4NYNA 1RT3A 1FKOA 3L2WA 4BE1A 4KHUA 2X78A 1TK5A 3TAGA 3KTQA 4J2AA 3QNNA 3I8DA 3MEEA 3OY9A 3M8QA 3VQ6A 1BI4B 1VSLA 3HO1A 3VQEA 2XY6A 2B6AA 3ZT3A 1WSFA 1WSIA 3MXIA 4KI4A 1RDBA 5FROA 3SV4A 4B8AB 1YTUA 4DQPA 4NCAA 3NHGA 1KTQA 4CGFA 2PY5A 4CJ4A 4CJWA 3ZCMA 1KVCA 3VQBA 4CFBA 1VSJA 3L2QA 2QXFA 1FK9A 3V9SA 1D9FA 2OYQA 4KAZA 3VQ9A 3HK2A 1CZ9A 1TGOA 5K14A 1QSLA 2D0CA 3NF7A 3V1OA 1GOCA 1UAXA 4OPKA 3AA3A 1QSSA 3B6OA 3VQPA 4LH4A 1SL2A 2HNYA 4O0JA 4O5BA 4CEZA 4FVMA 1LV5A 2HVIA 1KFSA 3NH0A 1BI4A 1JKHA 1B92A 4DF8A 3ISNC 3O3HA 5CZ2A 1VSHA 1EKEA 4O55A 3SJJA 1WSJA 2HHXA 4CJRA 3VA0A 2D0AA 3ITHA 2ETJA 3AA5X 4FJLA 3L3VA 1QS4A 1NK4A 4KPYA 4CF1A 4W5OA 1BQNA 4ZTJA 2E6LA 3C94A 4CESA 4DSKA 4LD0A 1KCFA 1RNHA 1SV5A 4CE9A 4PUOA 3B6PA 4CECA 4CEQA 3OYHA 3RMBA 2Y1JA 3TI0A 4FJNA 1UOCA 1TKTA 4RG8A 4FJHA 4CHNA 2PYJA 3T19A 1S6PA 3VQ5A 2IGIA 4FLWA 3RR8A 3OS2A 2XRIA 3K59A 3KLFA 4DMNA 1CLQA 3IS9A 1VSKA 3G10A 4Y1CA 3NFAA 4YFUA 3NGIA 3K57A 1WN7A 1D9DA 1UA1A 4RW7A 3O4QA 4CJ5A 3OYMA 1UWBA 4CJKA 4M3UA 2HHQA 1BIUA 2FC0A 1S1WA 4BACA 4AHCA 3VQQA 3KD5E 3HL8A 4CHPA 5C42A 3QETA 1TL3A 3VA3A 4FZYA 2X6NA 3QLHA 1WSGA 3HVRA 4DFJA 4F3OA 4TSXA 3RRHA 4HUEA 3AVNA 4FK0A 4FLZA 1W9HA 3SI6A 4DTPA 5HLFA 4HCCA 1D8YA 4Z4HA 1J5OA 2YNFA 1NK7A 2RN2A 4DTSA 3ZSXA 3HYFA 4CIFA 4F4KA 2Q3SA 2HHSA 2P51A 3U3YA 3IRXA 4CJEA 3O3GA 3SQ2A 1JL1A 4IG0A 1KSPA 3QNOA 5CYMA 3NAEA 4CJ3A 2KW4A 3L2VA 3O3FA 2NUBA 2ATQA 1YT3A 4HTUA 4ZTFA 2G8KA 1HYZA 4KREA 4E1NA 4E7LA 2D0BA 3AVFA 3C6TA 4BE0A 3S3MA 4CGIA 4CEEA 3D0PA 4KHSA 3DRRA 3OYNA 1S9GA 1RILA 4BWMA 3U3GA 2R7YA 1Q9YA 1B9FA 4CF9A 4E89A 1Q8IA 1DTTA 2OA8A 4C8OA 5KI6A 1GOBA 4F8RA 2HNZA 4CK1A 4KHWA 1RT2A 1JLEA 1X1PA 3KK1A 4RW9A 4FZXC 3K5LA 3SUQA 4Q0BA 2IS3A 1RDAA 1EETA 1NOZA 1QE1A 3ZSVA 3ZT4A 1L3VA 2D5RA 1EXQA 4FLUA 1JLAA 3NGZA 1WLJA 2VWKA 4DSFA 1WAFA 4B9LA 1C1AA 2IAJA 1QTMA 3TR8A 2G8WA 1CXQA 4FJMA 1EX4A 3CM5A 1VSEA 3JSMA 2HMIA 1LAVA 1RDDA 2P5OA 3NCIA 3NH2A 1JLFA 3PX6A 3WNEA 4OJRA 1NOYA 4K8XA 3ZSWA 3ZSZA 1XHZA 5CZ1A 1NK5A 4J2EA 3OYDA 3DYAA 4KHYA 1ZBIA 1SKWA 4IDKA 1LWFA 3NF6A 1KLNA 4FJJA 2AJQA 4JLHA 3AVGA 3OJSA 1IH7A 4KTWA 4CFAA 3NBPA 3DLHA 4PQUA 4EP4A 1KRPA 2HVHA 1QSYA
chains in the Genus database with same CATH superfamily
5AQUA 5KQDA 3FR0A 4DHYA 2P9IA 2E8AA 1RBUA 2DFFA 3EZWA 3IMXA 1ASUA 4ILGB 3AVKA 1HQUA 3AVLA 3BF3A 5AQNA 1J53A 3R3LA 2O8FB 4CBUA 4CK3A 1SQKA 3O6WA 4ILHA 4LH5A 4CBXA 3OYKA 4RW6A 2FF3B 1HPZA 3JXUA 1YITN 4N76A 2QWLA 1RTIA 4H8KA 1REVA 4F2SA 3HXMA 3QERA 4FWPA 4DLGA 1S1XA 3SQ4A 1VSFA 2VGNA 5CYQA 4OLBA 3WNFA 3MDQA 3U4LA 1VQ9N 3E9PA 3LDLA 4JKCA 1HR0K 4NB4A 3KLEA 4CERA 3MN7A 2Z1GA 3P5JA 4RW4A 1QHAA 4CJQA 5CE3A 3M8RA 4CIEA 4GKKK 2YNIA 4CF2A 5KRSA 1ZBFA 2JWLA 1JLCA 4FL9A 4B9NA 1WSHA 4LY7A 1IKXA 3A5MC 3KK2A 1I39A 3O9UA 4F2RA 1Q18A 5C2DA 1NK0A 4BDZA 2P5GA 3M8PA 1ASWA 3WXJA 3FFKB 1RDCA 3VF4A 2VWJA 3ZYYX 3C6UA 5I3UA 2UXCK 4OGEA 3RTVA 3SNNA 5HRSA 1HKCA 1BISA 1A5XA 4BC3A 1ESVA 4H4MA 4CHYA 4B08A 3LDSA 2CH6A 1NM1A 4BR4A 4CFCA 1TV6A 2A5XA 3SUOA 1O1WA 1C6VA 4FM1A 4J2BA 4AHVA 4DF4A 5GIPA 1W0HA 1VQ4N 4M42A 4DSEA 1FKPA 4ZHRA 1BL3A 3HPHA 3WNGA 3MEDA 1OH6A 5HRNA 2A1RA 1WBBA 2B4JA 1VQ5N 5HRPA 1ITGA 2VQFK 2YJFA 4CEBA 4EHUA 1KAXA 4BG8A 1HNZK 4CW7B 4JI2K 5BRFA 4JHDA 3OS0A 3D2EB 1GLDG 3CMEN 4BRAA 3CQ8A 2OZMA 5F2RA 2F9TA 2DFEA 4BRQA 2F7TA 3V4IA 4BG9A 4M41A 5JLFA 4XIUA 1U48A 5I42A 2ZE2A 2FSJA 2KTQA 2DPNA 4BGBA 4JK9A 1KD1O 4X64K 3J81O 2IOCA 4KH6A 3LP1A 4JRQA 2I5JA 5AFUH 5AQQA 3BEXA 4DTOA 1WAJA 3O4NA 4C8MA 4QS8A 4H0VB 4IO8A 1JJ2M 1LW2A 2YCHA 3QEIA 5KGWA 4DR5K 4WCEL 2G8FA 4MLEA 1IKYA 3SCXA 5J1EA 3EO3A 2QWRA 1DLOA 3AVHA 3MAQA 1T6DA 4LC9B 1T7PA 3VQDA 4CEOA 4CZMA 3U6FA 2W42A 1IO2A 3SBGA 4AHUA 5AQXA 3I33A 3CMAN 1IV0A 4W5RA 4M3TA 1HYVA 3C65A 2WC9A 3DOKA 2D4WA 4EFHA 2RF2A 4DG1A 4PY5A 3D2FB 1RT4A 2ZGYA 4JRPA 1EQYA 3TSUA 4DQ8A 2YNHA 3HTVA 2RPIA 1KFDA 4FJ9A 3JAMO 4BRPA 1QQMA 1VQMN 4RCHA 3CCLN 1RT6A 3H1VX 5AQMA 3ZT1A 3AY9A 3LANA 4CJUA 4CCHA 5EVZA 3OYIA 3QO9A 2XHBA 1DKGD 1EWQA 4KB1A 4DV7K 4M3XA 4FCYA 4G1QA 4BQLA 1L3TA 4I7FA 2KZMA 4JI4K 1KAYA 2OPSA 2YHYA 1X9JA 2FXUA 3F9KA 3OYEA 1HX1A 4WFAL 1ZBLA 2NRVA 1SS6A 2HW3A 2WUSA 4DR3K 1Q9XA 4PKIA 3IFRA 1CZAN 4BRNA 3MN6A 3NF9A 1OH8A 4K8ZA 3SQ0A 3KK3A 4DS4A 4CZJA 3RSEA 4JS4A 3VPZA 3OBYA 3C0BA 3THWB 5M1PA 4BE2A 4KFBA 3DLKA 2WBNA 1XUPO 5IWAK 3CETA 3MMVA 4I9LA 3TANA 2BGGA 3VEVA 3DLGA 3VESA 3VQ8A 4DFPA 3I55N 4A61A 1LW0A 5M1NA 3AA2A 3SZ2A 1BA1A 4GW6A 4CJFA 1C1BA 1NMNA 4N56A 3QDKA 3RVCA 4B1UB 2HBJA 3H1QA 3SUPA 4GV3A 4BQZA 3CI5A 3PIOL 5DMRA 3L3UA 2Z1JA 5BRDA 5AQKA 3KKRA 4NCBA 5BPMA 1L5UA 2FSNA 3CG7A 4WQ5A 2ZGZA 3DRPA 3LP3A 4DLEA 2YHXA 5AQHA 3OYGA 1YI2N 4E7KA 1NKCA 3H3NO 1XMOK 4B3SK 4BY9C 3P1GA 3VGLA 1FKOA 3L2WA 4IJAA 2X78A 4DV5K 4BC5A 3MEEA 4KBOA 5LMNK 3G71N 2B6AA 3U9ZA 3MXIA 4KI4A 4IJNA 5TKWA 4DR2K 4NCAA 2ZF5O 4CGFA 5HP1A 3L2QA 1KVCA 2P9PB 1VSJA 4H0TB 2QW9A 3NF7A 1GOCA 1UAXA 4OPKA 3L4QA 1SL2A 2HVIA 4FWRA 4IWVA 1VSHA 1EKEA 3SJJA 3A8YA 2PFUA 4CJRA 3VA0A 2D0AA 4GVEA 2UYTA 4CZFA 4ZTJA 4CESA 4DSKA 4CE9A 2P9PA 3B6PA 4BVPA 4CEQA 4JI6K 4CZHA 3CXCM 4FJNA 1UOCA 4FJHA 4CHNA 3GG4A 1BA0A 4DMNA 1VSKA 4Y1CA 1D9DA 4RW7A 1QQNA 3OYMA 4PKHA 5EY4A 3HL8A 3VA3A 4FZYA 1WSGA 2P9NA 3UB5A 4MO5A 3RRHA 3LDNA 1GLBG 1NWKA 3QFPA 4Z4HA 1J5OA 4DV1K 2RN2A 3SK3A 3ZSXA 4DTSA 3IRXA 1U2VB 3SQ2A 1J5EK 1JL1A 4B1XB 1KSPA 1NGHA 1WUAA 5CYMA 3L2VA 1YT3A 2G8KA 2HBLA 4ZTFA 1HYZA 4BR5A 3HOTA 2GTDA 5KPRA 4KHSA 4YOYA 3OYNA 1S9GA 3U3GA 4E89A 1NGIA 5KI6A 5C15A 4QS9A 4F8RA 1RT2A 1JLEA 4BRIA 4RW9A 3FGUA 4Q0BA 2IS3A 1RDAA 2D1KA 1U2VA 2ZWHA 3ZT4A 5I9EB 5GAHP 1L3VA 2NRZA 1RGIA 3NGZA 1WLJA 3LDOA 1C1AA 4EIAA 2G8WA 4BC2A 3CM5A 1VSEA 3JSMA 1LAVA 1NGAA 3TTDA 3NCIA 1JLFA 5C0YA 3IDHA 1TUYA 1MWMA 3ZSWA 2O8CB 1N8RO 2ZJPL 4CZKA 2PAVA 5AQWA 1LWFA 1KLNA 3SBTA 4O8UA 3BZCA 4A5BA 4KTWA 4CFAA 3NBPA 4LF8K 4LF7K 3WXMB 2HVHA 2OTLN 5FDLA 3VOVA 4JKAA 3WNHA 5GADP 2BDPA 3SQ1A 2FBXA 3U8XA 1BOTO 3MCPA 3LM9A 3ZSYA 2O8CA 2YJEA 4IEIA 3A5OC 3AO1A 3H3OB 4JKEA 2QM1A 4GMJB 1GOAA 5AJ3K 4N41A 1BUPA 1YTAA 2EWSA 4CIGA 4BROA 2V7ZA 1IBKK 4NLBA 1W7AA 4YOVA 1GLEG 5TKYA 5BN9A 3CERA 3NVKA 3UKUB 4FWKA 2D0OA 1YIJN 4B9QA 4DCHA 2ASPA 4CJVA 1NNEA 3I0SA 4DSIA 4CJTA 4C1NK 1Q86O 2W41A 3G6EN 4JK7A 1RBRA 3NH1A 2VGMA 2OCEA 3CPEA 3OYAA 4HUFA 4A59A 2W6LA 4ID5A 3O1WA 4FK4A 2NZTA 3O8MA 3CFPA 3OYFA 4JKHA 3T1YK 3HP6A 4CHOA 3OW2M 4B1VA 4ISFA 3W0LA 4CJPA 2Z1IA 1IKVA 1VRTA 4O44A 5AQOA 4CD3A 3QIPA 1ATRA 1I3AA 2BANA 2BUPA 3T3FA 1FJGK 2YHBA 1HQEA 1WSEA 2CGLA 5KTQA 3DOLA 2E5LK 2HB5A 2OPPA 1X9SA 4FVUA 4NYFA 4CZLA 4DTUA 3A5LC 2Y1IA 3RRGA 4FLYA 1KQSM 1U49A 4DU3A 1JXEA 4N5SA 1RTJA 2PBDA 3ZETB 4BRKA 1RT7A 4BR7A 3QICA 3HBTA 2F8SA 4IBNA 2G8HA 2OPRA 3HP9A 3BGRA 5AQSA 4LFAK 3CJAA 3TWHA 1E3MA 3A2FA 4E1JA 2B5JA 1ZBHA 1RBSA 3JYTA 3TPQA 4HCBA 1P8ZA 4BRGA 3RR7A 4KH5A 1TUUA 4FXDA 1NK9A 3WXKA 1C0MA 3H08A 4B9SA 4FJGA 3VTIA 5FRNA 1N32K 4FLVA 2GV9A 3DM2A 3MEGA 3J7ZO 4KH4A 1VSDA 5HOOA 3W3DA 3WT0A 1LOTB 2A6AA 4BWJA 4DTJA 5E84A 4RW8A 1IG9A 3ID6A 4E19A 3GDQA 5SZTA 3VEZA 1A5WA 4E0DA 1S1VA 1HRHA 1TKXA 1R0AA 4BREA 1GLCG 3CC4N 1R59O 5DK5A 4B9MA 2QWOA 3ENBA 2F8TA 2ITMA 4F3TA 3WEEA 1XC9A 2UUBK 3VN5A 3PX4A 3LPTA 1OKJA 1NKBA 4DUYK 2O4IA 4OPJA 5ADXA 1S9EA 4K25A 4CZEA 3QMLA 1KLMA 3E66A 4CVNE 1Z6RA 4AHSA 2E6MA 3LP0A 1SL0A 2YNGA 4K42A 5M1OA 1NK8A 2Q0RA 4BVOA 3HOSA 2A1SA 3MWTA 3GOIA 1ZC6A 3MECA 5LY3A 4FW1A 3TTCA 4WYBA 3K0SA 2A3ZA 3VETA 3QESA 3FZMA 3KJVA 4H5WA 5C25A 3TSPA 4KTQA 3VF2A 1DTQA 3TAPA 4PA1A 2HNDA 4OKJA 4U7BA 1NJZA 5AR0A 3SV3A 4M3YA 4AM7A 3THYA 1RBTA 4L3QA 4L8RB 4OPHA 3MN5A 3K5OA 4E7IA 3V1QA 1B9DA 4DR4K 3AGKA 3ZSRA 4IFVA 3PY8A 1N33K 2E2NA 4OKEA 1ATNA 2XY7A 2HHWA 4EZ9A 3J7YP 4HUGA 1YVUA 2QWMA 4B3RK 4E7JA 4BDPA 4A5AA 4X62K 4B3MK 1IBMK 3FZHA 4JI5K 3V9XA 4JHDB 5AQGA 1XI1A 1BG3A 4FJ8A 1IG8A 3QIOA 2ASMA 4AHTA 5C12A 1S5JA 4C1NI 1LWCA 1D5AA 5B8HA 3ENHA 2XO7A 1L3SA 4ELUA 4IG3A 3C7NB 3CCQN 1BCOA 3ATVA 1KVAA 3R1XA 4WQ5C 4RTFD 3THXA 1Z26A 3QEPA 3K5MA 3KKSA 3AVJA 2VG6A 1NGDA 3WQUA 4JK8A 1SKSA 2E88A 3CCRN 3DXKB 4O4GA 3AO5A 3LWMA 1S1TA 1S22A 2X6SA 3C95A 2IVPA 3C7NA 2FBYA 3ZX3A 2ITGA 1C0TA 1IBLK 2GUPA 3OYBA 3RMCA 3MXMA 1VQLN 4MQ3A 1VSIA 1LAWA 3FZLA 3NE6A 1VK0A 1GLJO 1TK0A 3DXKA 3EZ5A 1RFQA 2QWPA 3LDQA 1BO5O 4DQRA 1E4FT 4WQ4C 5H1SQ 1YAGA 3ATUA 3CCJN 3D45A 3OS1A 1T03A 5CHIA 3B8AX 3HJFA 1BHLA 1CXUA 2E2PA 4W5TA 1YUWA 3S3NA 1CZBA 4BR9A 4FLTA 3VF6A 3F9MA 4M63C 4WE1A 4OO1J 3T69A 4A2AA 1TK5A 1TYQA 2QXLA 2NRWA 5KPZA 3KTQA 3I8DA 3VQ6A 1BI4B 3H46O 4MDBA 4XH1A 1VSLA 2XY6A 5F0XA 2YX6A 4CBWA 1WSIA 1RDBA 2D0PA 3SV4A 2P9UA 3BZKA 4B8AB 4F9OA 1K8AO 3NHGA 1KTQA 4CJWA 5JLHA 2OYQA 3MX5A 3VQ9A 3G25A 4H5VA 1NGFA 2D0CA 1QZ5A 3AA3A 1QSSA 3VQPA 3EE8A 3SLCA 4YORA 1LV5A 1BI4A 1B92A 1XC3A 3ISNC 4DF8A 4DV6K 1NGCA 4O55A 1WSJA 2HHXA 1XNRK 3EL2A 1NK4A 1BQNA 4KHWA 2P9LA 5JVGL 4LD0A 4PUOA 4CECA 3RMBA 2Y1JA 1TKTA 4PKGA 3T19A 2HSTA 2A41A 2XRIA 1S72N 3CPWM 3KLFA 3I56N 3IS9A 3G10A 3KHYA 3KWIA 4H0OA 1MA9B 3NGIA 3K57A 1WN7A 5C2FA 2P9KB 3RSEB 1BIUA 2FC0A 4AHCA 5E26A 2J4RA 3KD5E 3HVRA 4F3OA 4FK0A 5AQRA 4HCCA 4GY2B 2HHSA 3HYFA 4CIFA 4F4KA 2Q3SA 4CJEA 4JI1K 4IG0A 2P9KA 2NRHA 3O3FA 2ATQA 3ZLJA 2D0BA 4V19S 3C6TA 3L0QA 4CGIA 1NGBA 4JKDA 2WFBA 4BWMA 4KHPK 2O8BB 4YY3K 4CF9A 5M1FA 1Q8IA 3N4QA 1GOBA 3S41A 2HNZA 4CK1A 4DV2K 1X1PA 3N4PA 1EETA 2KHOA 3CD6N 3ZSVA 2V51B 4CZGA 3LL3A 3T1HK 3AAPA 2VWKA 2IAJA 3TR8A 1CXQA 2HMIA 5MLCQ 3NH2A 5AQFA 4K8XA 1NOYA 3OHRA 2O8BA 3PLAA 1NK5A 4H03B 4I6MA 5CZ1A 4J2EA 4IDKA 3NF6A 2QEXN 1MDUB 5GAEP 3CCSN 3AVGA 2Q31A 4PQUA 2HF4A 1E4GT 5AZJA 2QK9A 1Y97A 1NG9A 3K9JA 1J9AA 3EYZA 1F21A 1QHTA 4AHRA 4UY8O 1IKWA 2CGKA 2JLEA 3K5NA 3T1AA 5HL7L 3ULEA 5D3GA 1K9MO 3QINA 1T8EA 3DWLA 3MN9A 5AFUA 3AO4A 4C8NA 4OGCA 3TAMA 2F4VK 4KTZA 1X9WA 4CEAA 2BTFA 2WONA 1D4XA 3DLEA 3ZT0A 4FJ5A 5EU7A 5J2MA 3ID8A 1KXPA 4ILJA 4FZZA 1U04A 4JKFA 4Q5VA 3BY5A 5C24A 2YV0X 1TL1A 4O5FA 2WOMA 2EX3A 3CM6A 3QEWA 4WQ4A 4B9VA 3E01A 3HM9A 5FPDA 4FK2A 4BRDA 1SAZA 2VG7A 3THVA 4B9UA 3KD1E 1XWLA 2P9NB 2XY8A 1NJIO 4H0YB 2UU9K 5JVHL 3NVMA 1YVNA 3VTHA 1SKRA 3ASMA 4ELTA 1N6QA 4DFKA 4GVMA 3O5BA 3PO5A 1L3UA 2ZD1A 4FSVA 3CCVN 1KC8O 4CEDA 3CFOA 4NO7A 3L8BA 2I7NA 3UKRA 2O8EA 2GEMA 3BP8A 4B3TK 1HMVA 2Q97A 4XH4A 5HBMA 3VGMA 3I0RA 3TAEA 3PX0A 1BIZA 4QS7A 3OYCA 4FM0A 2XY5A 4LF9K 4ID1A 4PHTX 3DRSA 1NBWA 3KWGA 4DTXA 1YJNN 1WOQA 3HPOA 3P38A 4Z4CA 3AO3A 4CHQA 1XNQK 3IG1A 2OZSA 2O4GA 3KLIA 2QWQA 2BE2A 1VSMA 4E7HA 4CF8A 1Q82O 2P9SA 4HVJA 5LJVA 2A40A 4CJSA 3OJUA 4DV4K 2KFNA 1JCEA 3ZX0A 4LF6K 4I2QA 4NXMK 3NF8A 2YHWA 3L2UA 3LAMA 3KVGA 3SUNA 3GBTA 1SL1A 2E1ZA 4C23A 4BDYA 4CI6A 1ZBUA 2UXDK 4EAHD 3OYLA 2IDOA 1M90O 3D7EO 3QBXA 2IC3A 4BRCA 1BQMA 2GBZA 1RT5A 3O9RA 4QCLA 1OVYA 2RKIA 3HPGA 4IDHA 3MWPA 4JI0K 2QI2A 1K8KA 5JMVA 3P31A 3MX2A 3LZJA 5J2NA 1U47A 3QEVA 1C0UA 1RTHA 3L2RA 1SUQA 2DFHA 2FLOA 2G8IA 4C8KA 4WFNL 3HM8A 3V1RA 3TAQA 3F73A 3D6RA 3ZSQA 1RT1A 5BRHA 4AM6A 2X74A 4LSNA 4HWIA 5JICA 4W5QA 3PSIA 5ELZA 1HNIA 4M3WA 1JCFA 3HZ6A 4K0KK 4YDUC 4JI7K 3KLGA 3LP2A 1BU6O 3CCEN 3M6GA 4EP5A 2BH1A 5BR8K 3A5NC 5AQJA 4FM2A 4CJLA 4DFMA 4CGHA 2JGUA 3CYMA 5CY4A 3OYJA 4J2DA 2GX9A 3AA4A 1UA0A 3ZX2A 2KFZA 2Q2RA 3SMSA 2DTUA 4CFDA 1ZYQA 5C10A 5AQVA 1ZBSA 2OANA 4KB0A 3CJ1A 1P90A 5AQTA 3O08A 1JLBA 2Q36A 4NCGA 3S3OA 1C1CA 4XEIA 3AVMA 1OH7A 2PZSA 1NK6A 3FZFA 5F1XA 1VQ7N 1QVFM 4JS5A 4H0PA 3H6EA 3DXMA 1W97L 3KLHA 2ASOA 1GLLO 4KI6A 3E9OA 3Q7CA 1XHXA 3FZKA 5KRTA 5T7BA 1IJJA 1G15A 4M45A 4DTRA 1RDUA 4R5PA 1S1UA 5FPNA 4DV0K 1Z25A 4JD2A 3OA9A 4JKBA 4MO4A 1NJWA 4XH5A 2HMPA 2QA4N 4DR7K 4MDAA 4FYDA 4Z0UA 1W2BM 3CJ7A 1NKEA 1S6QA 1C0FA 2HBKA 4AILC 3O4WA 3OVNA 2YHAA 2QKKA 3SMPA 4FO0A 4DSLA 1JXBA 4KV8A 3WEEB 3KIOA 2KZZA 1RTDA 4DU1A 4NLCA 1U45A 4IOAL 4FWOA 4A62A 4B8CA 3RMAA 4CGGA 4FJKA 3F5TA 4FPAA 3MXJA 4JN4A 1J6ZA 4WFBL 4DUZK 3V6DA 4IFEA 1X3NA 4K41A 3CJCA 1NU0A 4DS5A 5AZIA 3M5RA 3ZEUA 3TAFA 4OKKA 4AF1A 4B1ZA 4DTNA 4DQSA 4C8LA 4H0XB 3VQ7A 3NGYA 3QEXA 2YKMA 3M3ZA 4FOEA 1RT3A 4NYNA 5AQIA 4KHUA 1XQSC 3TAGA 4J2AA 3THYB 3QBWA 3M8QA 2HHHK 3HO1A 3VQEA 3ZT3A 1HJOA 4CJ7A 3SAFA 5FROA 3E1YA 4M3ZA 3ZCMA 3VQBA 4RWTA 2QXFA 1TGOA 1V4SA 1QSLA 3LDPA 3B6OA 4LH4A 4PL7A 4FWSA 4O5BA 5FPMA 1KFSA 3NH0A 1JKHA 3BUZB 5EX5A 2O8FA 3ITHA 2ETJA 1QS4A 3F2KA 1HKGA 4W5OA 4DKWA 3C94A 4LFBK 1KCFA 3OBWA 1VQON 5DM6L 4RG8A 3R6MA 2PYJA 2E20A 2YI1A 4JEPA 1DT9A 2RE2A 3CJBA 4FLWA 3RR8A 3OS2A 3K59A 1N36K 3THXB 1UA1A 3DLLL 1SZ2A 3O4QA 4CJ5A 1UWBA 3P4IA 4CJKA 4M3UA 2HHQA 1S1WA 4X65K 3GL1A 4H5RA 4IEEA 1YJ9N 4CHPA 1TL3A 3DAWA 3EN9A 3G4SN 3QLHA 5IT9O 4YDUA 3AVNA 5FLXO 4FLZA 3SI6A 2HBMA 1D8YA 1WB9A 4LFCK 2YNFA 1NK7A 4YOXA 1DGKN 1QQOA 3PSFA 2Q0UA 1T6CA 3K9KA 3NAEA 4CJ3A 4LF5K 1OVQA 2NUBA 3SAHA 3AVFA 4BE0A 3CIPA 3I8BA 3MCAB 4JAXA 1NGEA 1B9FA 4AQYK 4CD1A 2UXBK 5EOYA 3KK1A 2Q1NA 2NNWA 3K5LA 4FZXC 1QE1A 2D5RA 4FLUA 3L4IA 3VEOA 1WAFA 3AARA 3HI0A 4FJMA 1EX4A 5BR9A 1TYQB 1RDDA 2P5OA 4YOTA 3FLCO 2AA4A 3QB0A 2E2OA 1ZBIA 3OYDA 4FJJA 2AJQA 4JLHA 2P9UB 1IH7A 4EP4A 1KRPA 3EKUA 1QSYA 3DLRA 3L6QA 2W6KA 3H45C 3CHWA 3K2PA 2EHGA 2E4LA 3D2EA 5LJWA 3CQYA 1VQNN 1TAQA 1OH5A 1QQCA 3TARA 3WXIA 3ZSOA 2FSKA 2NRXA 4GNIA 1TAUA 3IUCA 2P9LB 3RMDA 4B1WB 3CC2N 5GIOA 1A5VA 1MU2A 3WQTA 1VHXA 2KKZA 3V9UA 3VMFB 2G8VA 1C0GA 3VEYA 4Y1DA 3EY1A 3LWLA 5J2PA 1VRUA 3VQCA 3IKMA 4H4OA 2ZQBA 3LALA 5JS2A 1YHQN 3VGKA 2FBTA 1T05A 4DQIA 4IXCA 1JLGA 4JNEA 1T44A 3TU5A 1EP4A 3O9SA 4E3SA 2HF3A 1VQKN 5FRMA 4CHZA 4W5NA 4FJXA 5KPTA 2JWKA 4DV3K 1MWKA 3FE1A 3HSCA 1BCMA 3NMUA 3PIPL 4Y0WA 1VQ8N 4Z4IA 1I94K 2PYLA 2DY4A 4JKGB 3AVCA 4Z4FA 3AV9A 3WXLA 1HNWK 4ISGA 3ENOA 3JS6A 1J54A 1NLVA 3D2FA 5J2QA 4N47A 1NJYA 3AAQA 4FWMA 4FWQA 1Z05A 2GUIA 1TKDA 4DQQA 3PUFA 1NGJA 3O9TA 1EWRA 4JKGA 4QOZB 1JLQA 3CCUN 3PV8A 3ZT2A 5BREA 5HROA 1YTUA 4CZIA 4CEFA 2IIRA 5M1QA 1KVBA 4I6MB 3GE1A 2Z1HA 4ELVA 1QVGM 3TABA 1DEJA 5AZJB 4HHTA 4G9ZA 3VQ4A 2HOEA 2VG5A 4B3OA 3Q7BA 4I2PA 4LSLA 4BGAA 5KQ8A 1N5YA 4ICLA 1WNSA 5FPEA 1YXQA 2GWJA 5JS1A 2YKNA 3ULEB 3DLBA 4GV9A 2H3GX 3AVAA 1HNVA 4Z4EA 2NRTA 2LSNA 3O1BA 4K43A 4FWLA 1YF5L 3PO4A 1ZXOA 3DMJA 1HYSA 1BDGA 1Y64A 2V52B 4JYAK 3THWA 3DJCA 3R8EA 5GAGP 4BRMA 3HSTB 4KKOA 1H1VA 4CGJA 1K6YA 3BDPA 4MFBA 3G0ZA 2VWBA 2FBVA 3ULDA 1NJXA 3ALYA 5CR4A 5KGXA 1U4BA 1ASVA 1HUXA 4IZ9A 4QAGA 1V4TA 4B9TA 4BRLA 1FXXA 4H5NA 2IVOA 4IKFA 4BR0A 5DM7L 4FLXA 4EZ6A 4Z94A 4YOWA 2CH5A 3O9QA 5SWMA 4UQGA 3LAKA 3EEQA 4FPBA 4FJIA 1X9MA 3UKRB 2O8EB 3P83D 4FJ7A 4M7XA 3SPZA 2KQ2A 4OLAA 5HRRA 4FW2A 3TTFA 4H5TA 2VQEK 2F96A 3V81A 3SJHA 2OTJN 5A2QO 3V9WA 3SYZA 2O8DB 4KRFA 2QTDA 3M1FA 4I9QA 4PWDA 3KK7A 3AVIA 4IOCL 3UE5A 5LL6Z 3UIQA 3IAYA 2HHVA 3R9PA 3E9LA 4BRFA 3AVBA 1S3XA 4Z4GA 1ILYA 3NDKA 2QKBA 1HLUA 4DTMA 5BN8A 3HRGA 3DI6A 2P9SB 1TKZA 3VERA 4CK2A 1X3MA 3V9ZA 2O8DA 1RBVA 3SPYA 1TVRA 2GWKA 5M1KA 2CGJA 3J8AA 1BGXT 2GELA 5AQLA 4DR6K 3QFUA 4ISEA 1WBDA 3HT3A 3C6AA 4YHHK 1XMQK 4KHQA 4M7YA 4AH9A 3CJ9A 1TK8A 2A42A 3AO2A 3J7AP 4A2BA 4DWIA 4DB3A 3LZIA 4CF0A 1JL2A 4IFYA 5E41A 3CQXA 2IVNA 2VCPA 4M3RA 4R79A 1GLAG 4OVLA 1FW6A 3VQAA 1K8KB 3LPUA 5EXWA 2P1JA 2ZM6K 4JV5K 2AP1A 2W40A 3A0IX 3K58A 3EKSA 3CFRA 1RCHA 4WF9L 3FFIA 2RHKA 1HJRA 2G8UA 4U67L 4KO0A 2OPQA 3M8SA 4YOUA 4HTLA 5ADXH 1U6ZA 4KHNA 3S9HA 2I7PA 4JI8K 4IO9L 4DSJA 4FWNA 4DU4A 1HKBA 1VQ6N 3SAGA 2UUAK 3J80O 1LWEA 4O0IA 4CGDA 2HHUA 4YNQA 2HHTA 3HVTA 1GLFO 4E1MA 1M1KO 4BE1A 2VYPA 3CCMN 3QNNA 3OY9A 5AQZA 3WUHA 1WSFA 2ZJQL 3P39A 3MK6A 4MLHA 1Q7YO 4DQPA 4BC4A 2PY5A 4CJ4A 1G99A 4CFBA 1D9FA 1FK9A 3V9SA 4KAZA 2KLAA 3HK2A 1CZ9A 5K14A 1N34K 3V1OA 4B1YB 1RDWX 2HNYA 4O0JA 4CEZA 4FVMA 4DR1K 4GKJK 3O3HA 5CZ2A 3AA5X 4FJLA 3CF5L 3L3VA 3KZBA 1ATSA 4KPYA 4CF1A 4EHTA 2E6LA 3DXMB 1RNHA 3U9DA 1SV5A 3TSQA 3OYHA 4BR2A 3TI0A 1HNXK 4PL8A 3UKUA 4OX9K 3VQ5A 1S6PA 2IGIA 4X66K 1CLQA 3NFAA 4YFUA 4IOXA 5AQPA 5BPNA 1VQPN 5LMUK 4JD2B 1T3VA 3O80A 3BF1A 5BPLA 1K73O 4BACA 3VEXA 3VQQA 1Q81O 3QETA 5C42A 2X6NA 3VENA 4DFJA 4TSXA 4HUEA 1W9HA 4DTPA 2FF6A 5HLFA 2NLXA 1EO1A 1YJWN 2P51A 2WTUA 3U3YA 4GV6A 3O3GA 3C6HA 3QNOA 3VEWA 2E1YA 2KW4A 1KAZA 4HTUA 2V7YA 4KREA 1NMDA 4E1NA 3OTOK 4E7LA 5AQYA 3T7ZA 1HPMA 3S3MA 4BRHA 4CEEA 3D0PA 3DRRA 4JI3K 4A57A 1NGGA 1RILA 3EE9A 1O13A 2R7YA 1Q9YA 5GINA 2F9WA 4FOIA 1DTTA 2OA8A 4C8OA 2UUCK 3AGRA 5AZIB 3ZEUB 4J8FA 3SUQA 2NRRA 3CC7N 4NXNK 1NOZA 1LCUA 3ZETA 4LF4K 2P9IB 1EXQA 1JLAA 2E2QA 4O8KA 4DSFA 4B9LA 1QTMA 4OPAA 3LM2A 3PX6A 1VAZA 3WNEA 4OJRA 1BWFO 3ZSZA 1XHZA 1JCGA 3DYAA 1SKWA 2QWNA 1QZ6A 3OJSA 3DLHA 2ZJRL 4KHYA 3RWUA
chains in the Genus database with same CATH topology
3DLRA 5FDLA 2QK9A 1Y97A 3K2PA 2EHGA 3WNHA 2E4LA 1J9AA 1RBUA 2DFFA 1F21A 3EYZA 2BDPA 1QHTA 4AHRA 3SQ1A 2FBXA 1IKWA 1TAQA 2JLEA 3K5NA 1QQCA 3TARA 3T1AA 1ASUA 3AVKA 5D3GA 1HQUA 3AVLA 3QINA 1T8EA 3ZSOA 3ZSYA 3AO4A 4C8NA 4OGCA 1J53A 3TAMA 3AO1A 4KTZA 1X9WA 4CEAA 4CK3A 1TAUA 2WONA 3DLEA 1GOAA 4GMJB 4LH5A 3ZT0A 1YTAA 4CIGA 4N41A 3OYKA 4RW6A 5EU7A 5J2MA 3RMDA 4FJ5A 1HPZA 4FZZA 1U04A 4N76A 4Q5VA 1A5VA 1MU2A 5C24A 1RTIA 4H8KA 1REVA 2YV0X 3V9UA 1TL1A 4F2SA 2G8VA 3HXMA 2WOMA 4Y1DA 3EY1A 2EX3A 3CM6A 3LWLA 1VRUA 3VQCA 1S1XA 4H4OA 4CJVA 1VSFA 2ZQBA 5CYQA 4DLGA 3QEWA 3SQ4A 3I0SA 3LALA 5JS2A 3WNFA 4CJTA 4B9VA 4DSIA 3E01A 3HM9A 2FBTA 1T05A 4FK2A 1RBRA 3NH1A 4DQIA 2VG7A 3THVA 1JLGA 4B9UA 3KD1E 3KLEA 4CERA 2Z1GA 3P5JA 3OYAA 1XWLA 4RW4A 4HUFA 4ID5A 4CJQA 1EP4A 4FK4A 3M8RA 4CIEA 2XY8A 4E3SA 2YNIA 4CF2A 5KRSA 3CFPA 1ZBFA 4CHZA 1JLCA 3OYFA 4FJXA 5FRMA 4W5NA 3HP6A 4CHOA 1SKRA 1WSHA 4LY7A 1IKXA 3ASMA 4B9NA 3KK2A 1I39A 4CJPA 1BCMA 4ELTA 1N6QA 2Z1IA 4DFKA 1IKVA 1VRTA 4O44A 4F2RA 4GVMA 1NK0A 4Z4IA 3QIPA 4BDZA 3M8PA 1I3AA 1ASWA 5J2PA 2PYLA 2P5GA 2BANA 2DY4A 3PO5A 1L3UA 2ZD1A 3T3FA 1RDCA 3AVCA 2YHBA 1HQEA 1WSEA 4Z4FA 3AV9A 5KTQA 2VWJA 3DOLA 2HB5A 4CEDA 3C6UA 5I3UA 3CFOA 2OPPA 3L8BA 1X9SA 4NYFA 1HMVA 1J54A 4OGEA 3RTVA 4DTUA 3SNNA 5HRSA 5HBMA 5J2QA 4N47A 1BISA 1A5XA 1NJYA 3I0RA 2Y1IA 3RRGA 4FLYA 3TAEA 3PX0A 1U49A 1BIZA 4H4MA 4CHYA 4B08A 3LDSA 2GUIA 4DU3A 3OYCA 1JXEA 4N5SA 4FM0A 1RTJA 2XY5A 4DQQA 4ID1A 1TKDA 4OLBA 3PUFA 1RT7A 3DRSA 4DTXA 2F8SA 4QOZB 4IBNA 4CFCA 1JLQA 3HPOA 1TV6A 4Z4CA 2G8HA 3SUOA 2OPRA 1O1WA 1C6VA 3AO3A 3HP9A 3ZT2A 4AHVA 3BGRA 4FM1A 3PV8A 5HROA 4J2BA 4DF4A 4CHQA 1W0HA 3IG1A 4M42A 4DSEA 1FKPA 4CEFA 4ZHRA 3TWHA 1BL3A 2OZSA 3HPHA 3WNGA 3MEDA 2O4GA 1KVBA 3A2FA 5HRNA 2A1RA 2B5JA 3KLIA 2Z1HA 1ZBHA 1RBSA 3JYTA 2B4JA 4ELVA 4HCBA 5HRPA 3TABA 1ITGA 2BE2A 3RR7A 4FXDA 1VSMA 4CEBA 1NK9A 4E7HA 4CF8A 4HHTA 3VQ4A 2VG5A 4HVJA 4B3OA 1C0MA 3H08A 4CJSA 3OJUA 4I2PA 4LSLA 4B9SA 2KFNA 3OS0A 1N5YA 4ICLA 1WNSA 4FJGA 3CQ8A 2OZMA 2DFEA 4I2QA 3NF8A 5FRNA 5JS1A 2YKNA 3DLBA 3V4IA 1U48A 4M41A 4XIUA 4FLVA 3L2UA 2GV9A 3DM2A 3LAMA 3MEGA 5I42A 2ZE2A 3SUNA 1SL1A 1VSDA 4BDYA 2KTQA 1ZBUA 3AVAA 1HNVA 3QERA 4Z4EA 2LSNA 3OYLA 2IOCA 2IDOA 4BWJA 3LP1A 3PO4A 4DTJA 4JRQA 2I5JA 4RW8A 1IG9A 3DMJA 4E19A 2IC3A 1HYSA 5SZTA 1A5WA 1BQMA 4DTOA 1S1VA 1HRHA 1TKXA 1WAJA 2GBZA 4E0DA 1RT5A 3O4NA 4C8MA 1R0AA 4QCLA 5DK5A 1LW2A 2RKIA 3QEIA 4B9MA 5KGWA 3HSTB 4KKOA 2G8FA 4CGJA 1IKYA 3HPGA 3SCXA 5J1EA 2F8TA 1K6YA 3BDPA 4F3TA 4MFBA 3G0ZA 3RWUA 3LZJA 1XC9A 3VN5A 5J2NA 3PX4A 1U47A 2FBVA 3ULDA 1NJXA 3LPTA 3ALYA 5KGXA 1U4BA 1ASVA 3QEVA 1C0UA 1DLOA 1RTHA 3AVHA 3L2RA 1NKBA 3MAQA 1SUQA 4QAGA 4OPJA 2O4IA 2DFHA 1T7PA 1S9EA 4B9TA 3VQDA 4CEOA 1FXXA 2G8IA 4C8KA 1KLMA 4IKFA 3U6FA 4AHSA 2W42A 2E6MA 3LP0A 1IO2A 3V1RA 4FLXA 1SL0A 4EZ6A 4AHUA 3F73A 2YNGA 3TAQA 3ZSQA 1RT1A 1NK8A 4W5RA 2X74A 4M3TA 4LSNA 5SWMA 4W5QA 1HYVA 4UQGA 2A1SA 3DOKA 1HNIA 3MECA 4M3WA 3LAKA 2RF2A 4FW1A 4FJIA 1X9MA 3KLGA 3P83D 4DG1A 3LP2A 4FJ7A 4PY5A 4OLAA 3QESA 2KQ2A 3KJVA 3SPZA 1RT4A 5HRRA 4EP5A 4JRPA 4FW2A 5C25A 2F96A 4KTQA 1DTQA 3V81A 3TAPA 4PA1A 2HNDA 4OKJA 4FM2A 4CJLA 4DFMA 1NJZA 3SV3A 2YNHA 4M3YA 4CGHA 2RPIA 2JGUA 3CYMA 1KFDA 5CY4A 3OYJA 4J2DA 4FJ9A 1RBTA 3V9WA 4L8RB 3SYZA 3AA4A 4KRFA 1UA0A 3K5OA 2KFZA 4E7IA 3V1QA 4I9QA 4PWDA 2DTUA 1B9DA 3AVIA 1RT6A 4CFDA 1ZYQA 3UIQA 3IAYA 3ZT1A 3ZSRA 2HHVA 4IFVA 3PY8A 3LANA 4CJUA 4KB0A 4CCHA 3AVBA 4OKEA 2XY7A 2HHWA 4Z4GA 4EZ9A 3OYIA 1JLBA 3QO9A 4NCGA 1YVUA 2XHBA 4HUGA 3S3OA 3NDKA 4E7JA 2QKBA 4BDPA 4DTMA 1C1CA 4KB1A 3DI6A 3AVMA 1TKZA 4M3XA 4CK2A 4FCYA 4G1QA 3V9XA 1L3TA 1XI1A 3V9ZA 4I7FA 1NK6A 2PZSA 4FJ8A 2KZMA 1RBVA 3SPYA 2OPSA 3QIOA 4JS5A 3F9KA 3OYEA 1TVRA 4AHTA 1ZBLA 1S5JA 1LWCA 1D5AA 3KLHA 2XO7A 2HW3A 1Q9XA 1L3SA 4ELUA 4IG3A 4KI6A 1BGXT 5T7BA 1XHXA 3NF9A 5KRTA 4M3ZA 1BCOA 3HT3A 1KVAA 1G15A 4M45A 4DTRA 4AH9A 4K8ZA 4KHQA 4R5PA 1S1UA 1TK8A 3SQ0A 3KK3A 4DS4A 1Z25A 3AO2A 1Z26A 4JS4A 3QEPA 3K5MA 3KKSA 3AVJA 1NJWA 2VG6A 4DWIA 1SKSA 4BE2A 3LZIA 4CF0A 1JL2A 4KFBA 3DLKA 4IFYA 5E41A 4O4GA 3AO5A 3LWMA 1S1TA 4FYDA 4Z0UA 4I9LA 3TANA 2X6SA 1S6QA 4M3RA 1NKEA 2BGGA 4AILC 3DLGA 3OVNA 3C95A 4OVLA 2YHAA 3VQ8A 4DFPA 2FBYA 3VQAA 2QKKA 4DSLA 1LW0A 1JXBA 3LPUA 5HP1A 3AA2A 4KV8A 3SZ2A 3KIOA 2KZZA 1RTDA 4DU1A 2ITGA 1C0TA 2P1JA 4GW6A 4CJFA 3K58A 3CFRA 1C1BA 1RCHA 3OYBA 1U45A 3FFIA 3RMCA 3MXMA 4N56A 4MQ3A 1VSIA 1LAWA 3NE6A 1VK0A 4B8CA 3RMAA 1HJRA 4CGGA 1TK0A 3SUPA 2G8UA 4FJKA 4KO0A 2OPQA 3MXJA 3M8SA 3EZ5A 5DMRA 4DQRA 3L3UA 3V6DA 2Z1JA 4KHNA 3KKRA 3D45A 3OS1A 4NCBA 1L5UA 3S9HA 1T03A 4DS5A 3CG7A 3HJFA 1BHLA 1CXUA 4OKKA 4W5TA 3DRPA 3TAFA 4DTNA 3LP3A 4DQSA 4DU4A 4DSJA 4DLEA 3S3NA 1CZBA 3OYGA 4C8LA 4E7KA 1NKCA 1LWEA 4O0IA 4FLTA 3VQ7A 3NGYA 4CGDA 2HHUA 4YNQA 4WE1A 3HVTA 2HHTA 3P1GA 3QEXA 4E1MA 2YKMA 4NYNA 1RT3A 1FKOA 3L2WA 4BE1A 4KHUA 2X78A 1TK5A 3TAGA 3KTQA 4J2AA 3QNNA 3I8DA 3MEEA 3OY9A 3M8QA 3VQ6A 1BI4B 1VSLA 3HO1A 3VQEA 2XY6A 2B6AA 3ZT3A 1WSFA 1WSIA 3MXIA 4KI4A 1RDBA 5FROA 3SV4A 4B8AB 1YTUA 4DQPA 4NCAA 3NHGA 1KTQA 4CGFA 2PY5A 4CJ4A 4CJWA 3ZCMA 1KVCA 3VQBA 4CFBA 1VSJA 3L2QA 2QXFA 1FK9A 3V9SA 1D9FA 2OYQA 4KAZA 3VQ9A 3HK2A 1CZ9A 1TGOA 5K14A 1QSLA 2D0CA 3NF7A 3V1OA 1GOCA 1UAXA 4OPKA 3AA3A 1QSSA 3B6OA 3VQPA 4LH4A 1SL2A 2HNYA 4O0JA 4O5BA 4CEZA 4FVMA 1LV5A 2HVIA 1KFSA 3NH0A 1BI4A 1JKHA 1B92A 4DF8A 3ISNC 3O3HA 5CZ2A 1VSHA 1EKEA 4O55A 3SJJA 1WSJA 2HHXA 4CJRA 3VA0A 2D0AA 3ITHA 2ETJA 3AA5X 4FJLA 3L3VA 1QS4A 1NK4A 4KPYA 4CF1A 4W5OA 1BQNA 4ZTJA 2E6LA 3C94A 4CESA 4DSKA 4LD0A 1KCFA 1RNHA 1SV5A 4CE9A 4PUOA 3B6PA 4CECA 4CEQA 3OYHA 3RMBA 2Y1JA 3TI0A 4FJNA 1UOCA 1TKTA 4RG8A 4FJHA 4CHNA 2PYJA 3T19A 1S6PA 3VQ5A 2IGIA 4FLWA 3RR8A 3OS2A 2XRIA 3K59A 3KLFA 4DMNA 1CLQA 3IS9A 1VSKA 3G10A 4Y1CA 3NFAA 4YFUA 3NGIA 3K57A 1WN7A 1D9DA 1UA1A 4RW7A 3O4QA 4CJ5A 3OYMA 1UWBA 4CJKA 4M3UA 2HHQA 1BIUA 2FC0A 1S1WA 4BACA 4AHCA 3VQQA 3KD5E 3HL8A 4CHPA 5C42A 3QETA 1TL3A 3VA3A 4FZYA 2X6NA 3QLHA 1WSGA 3HVRA 4DFJA 4F3OA 4TSXA 3RRHA 4HUEA 3AVNA 4FK0A 4FLZA 1W9HA 3SI6A 4DTPA 5HLFA 4HCCA 1D8YA 4Z4HA 1J5OA 2YNFA 1NK7A 2RN2A 4DTSA 3ZSXA 3HYFA 4CIFA 4F4KA 2Q3SA 2HHSA 2P51A 3U3YA 3IRXA 4CJEA 3O3GA 3SQ2A 1JL1A 4IG0A 1KSPA 3QNOA 5CYMA 3NAEA 4CJ3A 2KW4A 3L2VA 3O3FA 2NUBA 2ATQA 1YT3A 4HTUA 4ZTFA 2G8KA 1HYZA 4KREA 4E1NA 4E7LA 2D0BA 3AVFA 3C6TA 4BE0A 3S3MA 4CGIA 4CEEA 3D0PA 4KHSA 3DRRA 3OYNA 1S9GA 1RILA 4BWMA 3U3GA 2R7YA 1Q9YA 1B9FA 4CF9A 4E89A 1Q8IA 1DTTA 2OA8A 4C8OA 5KI6A 1GOBA 4F8RA 2HNZA 4CK1A 4KHWA 1RT2A 1JLEA 1X1PA 3KK1A 4RW9A 4FZXC 3K5LA 3SUQA 4Q0BA 2IS3A 1RDAA 1EETA 1NOZA 1QE1A 3ZSVA 3ZT4A 1L3VA 2D5RA 1EXQA 4FLUA 1JLAA 3NGZA 1WLJA 2VWKA 4DSFA 1WAFA 4B9LA 1C1AA 2IAJA 1QTMA 3TR8A 2G8WA 1CXQA 4FJMA 1EX4A 3CM5A 1VSEA 3JSMA 2HMIA 1LAVA 1RDDA 2P5OA 3NCIA 3NH2A 1JLFA 3PX6A 3WNEA 4OJRA 1NOYA 4K8XA 3ZSWA 3ZSZA 1XHZA 5CZ1A 1NK5A 4J2EA 3OYDA 3DYAA 4KHYA 1ZBIA 1SKWA 4IDKA 1LWFA 3NF6A 1KLNA 4FJJA 2AJQA 4JLHA 3AVGA 3OJSA 1IH7A 4KTWA 4CFAA 3NBPA 3DLHA 4PQUA 4EP4A 1KRPA 2HVHA 1QSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLR A;  5FDL A;  2QK9 A;  1Y97 A;  3K2P A;  2EHG A;  3WNH A;  2E4L A;  1J9A A;  1RBU A;  2DFF A;  1F21 A;  3EYZ A;  2BDP A;  1QHT A;  4AHR A;  3SQ1 A;  2FBX A;  1IKW A;  1TAQ A;  2JLE A;  3K5N A;  1QQC A;  3TAR A;  3T1A A;  1ASU A;  3AVK A;  5D3G A;  1HQU A;  3AVL A;  3QIN A;  1T8E A;  3ZSO A;  3ZSY A;  3AO4 A;  4C8N A;  4OGC A;  1J53 A;  3TAM A;  3AO1 A;  4KTZ A;  1X9W A;  4CEA A;  4CK3 A;  1TAU A;  2WON A;  3DLE A;  1GOA A;  4GMJ B;  4LH5 A;  3ZT0 A;  1YTA A;  4CIG A;  4N41 A;  3OYK A;  4RW6 A;  5EU7 A;  5J2M A;  3RMD A;  4FJ5 A;  1HPZ A;  4FZZ A;  1U04 A;  4N76 A;  4Q5V A;  1A5V A;  1MU2 A;  5C24 A;  1RTI A;  4H8K A;  1REV A;  2YV0 X;  3V9U A;  1TL1 A;  4F2S A;  2G8V A;  3HXM A;  2WOM A;  4Y1D A;  3EY1 A;  2EX3 A;  3CM6 A;  3LWL A;  1VRU A;  3VQC A;  1S1X A;  4H4O A;  4CJV A;  1VSF A;  2ZQB A;  5CYQ A;  4DLG A;  3QEW A;  3SQ4 A;  3I0S A;  3LAL A;  5JS2 A;  3WNF A;  4CJT A;  4B9V A;  4DSI A;  3E01 A;  3HM9 A;  2FBT A;  1T05 A;  4FK2 A;  1RBR A;  3NH1 A;  4DQI A;  2VG7 A;  3THV A;  1JLG A;  4B9U A;  3KD1 E;  3KLE A;  4CER A;  2Z1G A;  3P5J A;  3OYA A;  1XWL A;  4RW4 A;  4HUF A;  4ID5 A;  4CJQ A;  1EP4 A;  4FK4 A;  3M8R A;  4CIE A;  2XY8 A;  4E3S A;  2YNI A;  4CF2 A;  5KRS A;  3CFP A;  1ZBF A;  4CHZ A;  1JLC A;  3OYF A;  4FJX A;  5FRM A;  4W5N A;  3HP6 A;  4CHO A;  1SKR A;  1WSH A;  4LY7 A;  1IKX A;  3ASM A;  4B9N A;  3KK2 A;  1I39 A;  4CJP A;  1BCM A;  4ELT A;  1N6Q A;  2Z1I A;  4DFK A;  1IKV A;  1VRT A;  4O44 A;  4F2R A;  4GVM A;  1NK0 A;  4Z4I A;  3QIP A;  4BDZ A;  3M8P A;  1I3A A;  1ASW A;  5J2P A;  2PYL A;  2P5G A;  2BAN A;  2DY4 A;  3PO5 A;  1L3U A;  2ZD1 A;  3T3F A;  1RDC A;  3AVC A;  2YHB A;  1HQE A;  1WSE A;  4Z4F A;  3AV9 A;  5KTQ A;  2VWJ A;  3DOL A;  2HB5 A;  4CED A;  3C6U A;  5I3U A;  3CFO A;  2OPP A;  3L8B A;  1X9S A;  4NYF A;  1HMV A;  1J54 A;  4OGE A;  3RTV A;  4DTU A;  3SNN A;  5HRS A;  5HBM A;  5J2Q A;  4N47 A;  1BIS A;  1A5X A;  1NJY A;  3I0R A;  2Y1I A;  3RRG A;  4FLY A;  3TAE A;  3PX0 A;  1U49 A;  1BIZ A;  4H4M A;  4CHY A;  4B08 A;  3LDS A;  2GUI A;  4DU3 A;  3OYC A;  1JXE A;  4N5S A;  4FM0 A;  1RTJ A;  2XY5 A;  4DQQ A;  4ID1 A;  1TKD A;  4OLB A;  3PUF A;  1RT7 A;  3DRS A;  4DTX A;  2F8S A;  4QOZ B;  4IBN A;  4CFC A;  1JLQ A;  3HPO A;  1TV6 A;  4Z4C A;  2G8H A;  3SUO A;  2OPR A;  1O1W A;  1C6V A;  3AO3 A;  3HP9 A;  3ZT2 A;  4AHV A;  3BGR A;  4FM1 A;  3PV8 A;  5HRO A;  4J2B A;  4DF4 A;  4CHQ A;  1W0H A;  3IG1 A;  4M42 A;  4DSE A;  1FKP A;  4CEF A;  4ZHR A;  3TWH A;  1BL3 A;  2OZS A;  3HPH A;  3WNG A;  3MED A;  2O4G A;  1KVB A;  3A2F A;  5HRN A;  2A1R A;  2B5J A;  3KLI A;  2Z1H A;  1ZBH A;  1RBS A;  3JYT A;  2B4J A;  4ELV A;  4HCB A;  5HRP A;  3TAB A;  1ITG A;  2BE2 A;  3RR7 A;  4FXD A;  1VSM A;  4CEB A;  1NK9 A;  4E7H A;  4CF8 A;  4HHT A;  3VQ4 A;  2VG5 A;  4HVJ A;  4B3O A;  1C0M A;  3H08 A;  4CJS A;  3OJU A;  4I2P A;  4LSL A;  4B9S A;  2KFN A;  3OS0 A;  1N5Y A;  4ICL A;  1WNS A;  4FJG A;  3CQ8 A;  2OZM A;  2DFE A;  4I2Q A;  3NF8 A;  5FRN A;  5JS1 A;  2YKN A;  3DLB A;  3V4I A;  1U48 A;  4M41 A;  4XIU A;  4FLV A;  3L2U A;  2GV9 A;  3DM2 A;  3LAM A;  3MEG A;  5I42 A;  2ZE2 A;  3SUN A;  1SL1 A;  1VSD A;  4BDY A;  2KTQ A;  1ZBU A;  3AVA A;  1HNV A;  3QER A;  4Z4E A;  2LSN A;  3OYL A;  2IOC A;  2IDO A;  4BWJ A;  3LP1 A;  3PO4 A;  4DTJ A;  4JRQ A;  2I5J A;  4RW8 A;  1IG9 A;  3DMJ A;  4E19 A;  2IC3 A;  1HYS A;  5SZT A;  1A5W A;  1BQM A;  4DTO A;  1S1V A;  1HRH A;  1TKX A;  1WAJ A;  2GBZ A;  4E0D A;  1RT5 A;  3O4N A;  4C8M A;  1R0A A;  4QCL A;  5DK5 A;  1LW2 A;  2RKI A;  3QEI A;  4B9M A;  5KGW A;  3HST B;  4KKO A;  2G8F A;  4CGJ A;  1IKY A;  3HPG A;  3SCX A;  5J1E A;  2F8T A;  1K6Y A;  3BDP A;  4F3T A;  4MFB A;  3G0Z A;  3RWU A;  3LZJ A;  1XC9 A;  3VN5 A;  5J2N A;  3PX4 A;  1U47 A;  2FBV A;  3ULD A;  1NJX A;  3LPT A;  3ALY A;  5KGX A;  1U4B A;  1ASV A;  3QEV A;  1C0U A;  1DLO A;  1RTH A;  3AVH A;  3L2R A;  1NKB A;  3MAQ A;  1SUQ A;  4QAG A;  4OPJ A;  2O4I A;  2DFH A;  1T7P A;  1S9E A;  4B9T A;  3VQD A;  4CEO A;  1FXX A;  2G8I A;  4C8K A;  1KLM A;  4IKF A;  3U6F A;  4AHS A;  2W42 A;  2E6M A;  3LP0 A;  1IO2 A;  3V1R A;  4FLX A;  1SL0 A;  4EZ6 A;  4AHU A;  3F73 A;  2YNG A;  3TAQ A;  3ZSQ A;  1RT1 A;  1NK8 A;  4W5R A;  2X74 A;  4M3T A;  4LSN A;  5SWM A;  4W5Q A;  1HYV A;  4UQG A;  2A1S A;  3DOK A;  1HNI A;  3MEC A;  4M3W A;  3LAK A;  2RF2 A;  4FW1 A;  4FJI A;  1X9M A;  3KLG A;  3P83 D;  4DG1 A;  3LP2 A;  4FJ7 A;  4PY5 A;  4OLA A;  3QES A;  2KQ2 A;  3KJV A;  3SPZ A;  1RT4 A;  5HRR A;  4EP5 A;  4JRP A;  4FW2 A;  5C25 A;  2F96 A;  4KTQ A;  1DTQ A;  3V81 A;  3TAP A;  4PA1 A;  2HND A;  4OKJ A;  4FM2 A;  4CJL A;  4DFM A;  1NJZ A;  3SV3 A;  2YNH A;  4M3Y A;  4CGH A;  2RPI A;  2JGU A;  3CYM A;  1KFD A;  5CY4 A;  3OYJ A;  4J2D A;  4FJ9 A;  1RBT A;  3V9W A;  4L8R B;  3SYZ A;  3AA4 A;  4KRF A;  1UA0 A;  3K5O A;  2KFZ A;  4E7I A;  3V1Q A;  4I9Q A;  4PWD A;  2DTU A;  1B9D A;  3AVI A;  1RT6 A;  4CFD A;  1ZYQ A;  3UIQ A;  3IAY A;  3ZT1 A;  3ZSR A;  2HHV A;  4IFV A;  3PY8 A;  3LAN A;  4CJU A;  4KB0 A;  4CCH A;  3AVB A;  4OKE A;  2XY7 A;  2HHW A;  4Z4G A;  4EZ9 A;  3OYI A;  1JLB A;  3QO9 A;  4NCG A;  1YVU A;  2XHB A;  4HUG A;  3S3O A;  3NDK A;  4E7J A;  2QKB A;  4BDP A;  4DTM A;  1C1C A;  4KB1 A;  3DI6 A;  3AVM A;  1TKZ A;  4M3X A;  4CK2 A;  4FCY A;  4G1Q A;  3V9X A;  1L3T A;  1XI1 A;  3V9Z A;  4I7F A;  1NK6 A;  2PZS A;  4FJ8 A;  2KZM A;  1RBV A;  3SPY A;  2OPS A;  3QIO A;  4JS5 A;  3F9K A;  3OYE A;  1TVR A;  4AHT A;  1ZBL A;  1S5J A;  1LWC A;  1D5A A;  3KLH A;  2XO7 A;  2HW3 A;  1Q9X A;  1L3S A;  4ELU A;  4IG3 A;  4KI6 A;  1BGX T;  5T7B A;  1XHX A;  3NF9 A;  5KRT A;  4M3Z A;  1BCO A;  3HT3 A;  1KVA A;  1G15 A;  4M45 A;  4DTR A;  4AH9 A;  4K8Z A;  4KHQ A;  4R5P A;  1S1U A;  1TK8 A;  3SQ0 A;  3KK3 A;  4DS4 A;  1Z25 A;  3AO2 A;  1Z26 A;  4JS4 A;  3QEP A;  3K5M A;  3KKS A;  3AVJ A;  1NJW A;  2VG6 A;  4DWI A;  1SKS A;  4BE2 A;  3LZI A;  4CF0 A;  1JL2 A;  4KFB A;  3DLK A;  4IFY A;  5E41 A;  4O4G A;  3AO5 A;  3LWM A;  1S1T A;  4FYD A;  4Z0U A;  4I9L A;  3TAN A;  2X6S A;  1S6Q A;  4M3R A;  1NKE A;  2BGG A;  4AIL C;  3DLG A;  3OVN A;  3C95 A;  4OVL A;  2YHA A;  3VQ8 A;  4DFP A;  2FBY A;  3VQA A;  2QKK A;  4DSL A;  1LW0 A;  1JXB A;  3LPU A;  5HP1 A;  3AA2 A;  4KV8 A;  3SZ2 A;  3KIO A;  2KZZ A;  1RTD A;  4DU1 A;  2ITG A;  1C0T A;  2P1J A;  4GW6 A;  4CJF A;  3K58 A;  3CFR A;  1C1B A;  1RCH A;  3OYB A;  1U45 A;  3FFI A;  3RMC A;  3MXM A;  4N56 A;  4MQ3 A;  1VSI A;  1LAW A;  3NE6 A;  1VK0 A;  4B8C A;  3RMA A;  1HJR A;  4CGG A;  1TK0 A;  3SUP A;  2G8U A;  4FJK A;  4KO0 A;  2OPQ A;  3MXJ A;  3M8S A;  3EZ5 A;  5DMR A;  4DQR A;  3L3U A;  3V6D A;  2Z1J A;  4KHN A;  3KKR A;  3D45 A;  3OS1 A;  4NCB A;  1L5U A;  3S9H A;  1T03 A;  4DS5 A;  3CG7 A;  3HJF A;  1BHL A;  1CXU A;  4OKK A;  4W5T A;  3DRP A;  3TAF A;  4DTN A;  3LP3 A;  4DQS A;  4DU4 A;  4DSJ A;  4DLE A;  3S3N A;  1CZB A;  3OYG A;  4C8L A;  4E7K A;  1NKC A;  1LWE A;  4O0I A;  4FLT A;  3VQ7 A;  3NGY A;  4CGD A;  2HHU A;  4YNQ A;  4WE1 A;  3HVT A;  2HHT A;  3P1G A;  3QEX A;  4E1M A;  2YKM A;  4NYN A;  1RT3 A;  1FKO A;  3L2W A;  4BE1 A;  4KHU A;  2X78 A;  1TK5 A;  3TAG A;  3KTQ A;  4J2A A;  3QNN A;  3I8D A;  3MEE A;  3OY9 A;  3M8Q A;  3VQ6 A;  1BI4 B;  1VSL A;  3HO1 A;  3VQE A;  2XY6 A;  2B6A A;  3ZT3 A;  1WSF A;  1WSI A;  3MXI A;  4KI4 A;  1RDB A;  5FRO A;  3SV4 A;  4B8A B;  1YTU A;  4DQP A;  4NCA A;  3NHG A;  1KTQ A;  4CGF A;  2PY5 A;  4CJ4 A;  4CJW A;  3ZCM A;  1KVC A;  3VQB A;  4CFB A;  1VSJ A;  3L2Q A;  2QXF A;  1FK9 A;  3V9S A;  1D9F A;  2OYQ A;  4KAZ A;  3VQ9 A;  3HK2 A;  1CZ9 A;  1TGO A;  5K14 A;  1QSL A;  2D0C A;  3NF7 A;  3V1O A;  1GOC A;  1UAX A;  4OPK A;  3AA3 A;  1QSS A;  3B6O A;  3VQP A;  4LH4 A;  1SL2 A;  2HNY A;  4O0J A;  4O5B A;  4CEZ A;  4FVM A;  1LV5 A;  2HVI A;  1KFS A;  3NH0 A;  1BI4 A;  1JKH A;  1B92 A;  4DF8 A;  3ISN C;  3O3H A;  5CZ2 A;  1VSH A;  1EKE A;  4O55 A;  3SJJ A;  1WSJ A;  2HHX A;  4CJR A;  3VA0 A;  2D0A A;  3ITH A;  2ETJ A;  3AA5 X;  4FJL A;  3L3V A;  1QS4 A;  1NK4 A;  4KPY A;  4CF1 A;  4W5O A;  1BQN A;  4ZTJ A;  2E6L A;  3C94 A;  4CES A;  4DSK A;  4LD0 A;  1KCF A;  1RNH A;  1SV5 A;  4CE9 A;  4PUO A;  3B6P A;  4CEC A;  4CEQ A;  3OYH A;  3RMB A;  2Y1J A;  3TI0 A;  4FJN A;  1UOC A;  1TKT A;  4RG8 A;  4FJH A;  4CHN A;  2PYJ A;  3T19 A;  1S6P A;  3VQ5 A;  2IGI A;  4FLW A;  3RR8 A;  3OS2 A;  2XRI A;  3K59 A;  3KLF A;  4DMN A;  1CLQ A;  3IS9 A;  1VSK A;  3G10 A;  4Y1C A;  3NFA A;  4YFU A;  3NGI A;  3K57 A;  1WN7 A;  1D9D A;  1UA1 A;  4RW7 A;  3O4Q A;  4CJ5 A;  3OYM A;  1UWB A;  4CJK A;  4M3U A;  2HHQ A;  1BIU A;  2FC0 A;  1S1W A;  4BAC A;  4AHC A;  3VQQ A;  3KD5 E;  3HL8 A;  4CHP A;  5C42 A;  3QET A;  1TL3 A;  3VA3 A;  4FZY A;  2X6N A;  3QLH A;  1WSG A;  3HVR A;  4DFJ A;  4F3O A;  4TSX A;  3RRH A;  4HUE A;  3AVN A;  4FK0 A;  4FLZ A;  1W9H A;  3SI6 A;  4DTP A;  5HLF A;  4HCC A;  1D8Y A;  4Z4H A;  1J5O A;  2YNF A;  1NK7 A;  2RN2 A;  4DTS A;  3ZSX A;  3HYF A;  4CIF A;  4F4K A;  2Q3S A;  2HHS A;  2P51 A;  3U3Y A;  3IRX A;  4CJE A;  3O3G A;  3SQ2 A;  1JL1 A;  4IG0 A;  1KSP A;  3QNO A;  5CYM A;  3NAE A;  4CJ3 A;  2KW4 A;  3L2V A;  3O3F A;  2NUB A;  2ATQ A;  1YT3 A;  4HTU A;  4ZTF A;  2G8K A;  1HYZ A;  4KRE A;  4E1N A;  4E7L A;  2D0B A;  3AVF A;  3C6T A;  4BE0 A;  3S3M A;  4CGI A;  4CEE A;  3D0P A;  4KHS A;  3DRR A;  3OYN A;  1S9G A;  1RIL A;  4BWM A;  3U3G A;  2R7Y A;  1Q9Y A;  1B9F A;  4CF9 A;  4E89 A;  1Q8I A;  1DTT A;  2OA8 A;  4C8O A;  5KI6 A;  1GOB A;  4F8R A;  2HNZ A;  4CK1 A;  4KHW A;  1RT2 A;  1JLE A;  1X1P A;  3KK1 A;  4RW9 A;  4FZX C;  3K5L A;  3SUQ A;  4Q0B A;  2IS3 A;  1RDA A;  1EET A;  1NOZ A;  1QE1 A;  3ZSV A;  3ZT4 A;  1L3V A;  2D5R A;  1EXQ A;  4FLU A;  1JLA A;  3NGZ A;  1WLJ A;  2VWK A;  4DSF A;  1WAF A;  4B9L A;  1C1A A;  2IAJ A;  1QTM A;  3TR8 A;  2G8W A;  1CXQ A;  4FJM A;  1EX4 A;  3CM5 A;  1VSE A;  3JSM A;  2HMI A;  1LAV A;  1RDD A;  2P5O A;  3NCI A;  3NH2 A;  1JLF A;  3PX6 A;  3WNE A;  4OJR A;  1NOY A;  4K8X A;  3ZSW A;  3ZSZ A;  1XHZ A;  5CZ1 A;  1NK5 A;  4J2E A;  3OYD A;  3DYA A;  4KHY A;  1ZBI A;  1SKW A;  4IDK A;  1LWF A;  3NF6 A;  1KLN A;  4FJJ A;  2AJQ A;  4JLH A;  3AVG A;  3OJS A;  1IH7 A;  4KTW A;  4CFA A;  3NBP A;  3DLH A;  4PQU A;  4EP4 A;  1KRP A;  2HVH A;  1QSY A; 
#chains in the Genus database with same CATH topology
 5AQU A;  5KQD A;  3FR0 A;  4DHY A;  2P9I A;  2E8A A;  1RBU A;  2DFF A;  3EZW A;  3IMX A;  1ASU A;  4ILG B;  3AVK A;  1HQU A;  3AVL A;  3BF3 A;  5AQN A;  1J53 A;  3R3L A;  2O8F B;  4CBU A;  4CK3 A;  1SQK A;  3O6W A;  4ILH A;  4LH5 A;  4CBX A;  3OYK A;  4RW6 A;  2FF3 B;  1HPZ A;  3JXU A;  1YIT N;  4N76 A;  2QWL A;  1RTI A;  4H8K A;  1REV A;  4F2S A;  3HXM A;  3QER A;  4FWP A;  4DLG A;  1S1X A;  3SQ4 A;  1VSF A;  2VGN A;  5CYQ A;  4OLB A;  3WNF A;  3MDQ A;  3U4L A;  1VQ9 N;  3E9P A;  3LDL A;  4JKC A;  1HR0 K;  4NB4 A;  3KLE A;  4CER A;  3MN7 A;  2Z1G A;  3P5J A;  4RW4 A;  1QHA A;  4CJQ A;  5CE3 A;  3M8R A;  4CIE A;  4GKK K;  2YNI A;  4CF2 A;  5KRS A;  1ZBF A;  2JWL A;  1JLC A;  4FL9 A;  4B9N A;  1WSH A;  4LY7 A;  1IKX A;  3A5M C;  3KK2 A;  1I39 A;  3O9U A;  4F2R A;  1Q18 A;  5C2D A;  1NK0 A;  4BDZ A;  2P5G A;  3M8P A;  1ASW A;  3WXJ A;  3FFK B;  1RDC A;  3VF4 A;  2VWJ A;  3ZYY X;  3C6U A;  5I3U A;  2UXC K;  4OGE A;  3RTV A;  3SNN A;  5HRS A;  1HKC A;  1BIS A;  1A5X A;  4BC3 A;  1ESV A;  4H4M A;  4CHY A;  4B08 A;  3LDS A;  2CH6 A;  1NM1 A;  4BR4 A;  4CFC A;  1TV6 A;  2A5X A;  3SUO A;  1O1W A;  1C6V A;  4FM1 A;  4J2B A;  4AHV A;  4DF4 A;  5GIP A;  1W0H A;  1VQ4 N;  4M42 A;  4DSE A;  1FKP A;  4ZHR A;  1BL3 A;  3HPH A;  3WNG A;  3MED A;  1OH6 A;  5HRN A;  2A1R A;  1WBB A;  2B4J A;  1VQ5 N;  5HRP A;  1ITG A;  2VQF K;  2YJF A;  4CEB A;  4EHU A;  1KAX A;  4BG8 A;  1HNZ K;  4CW7 B;  4JI2 K;  5BRF A;  4JHD A;  3OS0 A;  3D2E B;  1GLD G;  3CME N;  4BRA A;  3CQ8 A;  2OZM A;  5F2R A;  2F9T A;  2DFE A;  4BRQ A;  2F7T A;  3V4I A;  4BG9 A;  4M41 A;  5JLF A;  4XIU A;  1U48 A;  5I42 A;  2ZE2 A;  2FSJ A;  2KTQ A;  2DPN A;  4BGB A;  4JK9 A;  1KD1 O;  4X64 K;  3J81 O;  2IOC A;  4KH6 A;  3LP1 A;  4JRQ A;  2I5J A;  5AFU H;  5AQQ A;  3BEX A;  4DTO A;  1WAJ A;  3O4N A;  4C8M A;  4QS8 A;  4H0V B;  4IO8 A;  1JJ2 M;  1LW2 A;  2YCH A;  3QEI A;  5KGW A;  4DR5 K;  4WCE L;  2G8F A;  4MLE A;  1IKY A;  3SCX A;  5J1E A;  3EO3 A;  2QWR A;  1DLO A;  3AVH A;  3MAQ A;  1T6D A;  4LC9 B;  1T7P A;  3VQD A;  4CEO A;  4CZM A;  3U6F A;  2W42 A;  1IO2 A;  3SBG A;  4AHU A;  5AQX A;  3I33 A;  3CMA N;  1IV0 A;  4W5R A;  4M3T A;  1HYV A;  3C65 A;  2WC9 A;  3DOK A;  2D4W A;  4EFH A;  2RF2 A;  4DG1 A;  4PY5 A;  3D2F B;  1RT4 A;  2ZGY A;  4JRP A;  1EQY A;  3TSU A;  4DQ8 A;  2YNH A;  3HTV A;  2RPI A;  1KFD A;  4FJ9 A;  3JAM O;  4BRP A;  1QQM A;  1VQM N;  4RCH A;  3CCL N;  1RT6 A;  3H1V X;  5AQM A;  3ZT1 A;  3AY9 A;  3LAN A;  4CJU A;  4CCH A;  5EVZ A;  3OYI A;  3QO9 A;  2XHB A;  1DKG D;  1EWQ A;  4KB1 A;  4DV7 K;  4M3X A;  4FCY A;  4G1Q A;  4BQL A;  1L3T A;  4I7F A;  2KZM A;  4JI4 K;  1KAY A;  2OPS A;  2YHY A;  1X9J A;  2FXU A;  3F9K A;  3OYE A;  1HX1 A;  4WFA L;  1ZBL A;  2NRV A;  1SS6 A;  2HW3 A;  2WUS A;  4DR3 K;  1Q9X A;  4PKI A;  3IFR A;  1CZA N;  4BRN A;  3MN6 A;  3NF9 A;  1OH8 A;  4K8Z A;  3SQ0 A;  3KK3 A;  4DS4 A;  4CZJ A;  3RSE A;  4JS4 A;  3VPZ A;  3OBY A;  3C0B A;  3THW B;  5M1P A;  4BE2 A;  4KFB A;  3DLK A;  2WBN A;  1XUP O;  5IWA K;  3CET A;  3MMV A;  4I9L A;  3TAN A;  2BGG A;  3VEV A;  3DLG A;  3VES A;  3VQ8 A;  4DFP A;  3I55 N;  4A61 A;  1LW0 A;  5M1N A;  3AA2 A;  3SZ2 A;  1BA1 A;  4GW6 A;  4CJF A;  1C1B A;  1NMN A;  4N56 A;  3QDK A;  3RVC A;  4B1U B;  2HBJ A;  3H1Q A;  3SUP A;  4GV3 A;  4BQZ A;  3CI5 A;  3PIO L;  5DMR A;  3L3U A;  2Z1J A;  5BRD A;  5AQK A;  3KKR A;  4NCB A;  5BPM A;  1L5U A;  2FSN A;  3CG7 A;  4WQ5 A;  2ZGZ A;  3DRP A;  3LP3 A;  4DLE A;  2YHX A;  5AQH A;  3OYG A;  1YI2 N;  4E7K A;  1NKC A;  3H3N O;  1XMO K;  4B3S K;  4BY9 C;  3P1G A;  3VGL A;  1FKO A;  3L2W A;  4IJA A;  2X78 A;  4DV5 K;  4BC5 A;  3MEE A;  4KBO A;  5LMN K;  3G71 N;  2B6A A;  3U9Z A;  3MXI A;  4KI4 A;  4IJN A;  5TKW A;  4DR2 K;  4NCA A;  2ZF5 O;  4CGF A;  5HP1 A;  3L2Q A;  1KVC A;  2P9P B;  1VSJ A;  4H0T B;  2QW9 A;  3NF7 A;  1GOC A;  1UAX A;  4OPK A;  3L4Q A;  1SL2 A;  2HVI A;  4FWR A;  4IWV A;  1VSH A;  1EKE A;  3SJJ A;  3A8Y A;  2PFU A;  4CJR A;  3VA0 A;  2D0A A;  4GVE A;  2UYT A;  4CZF A;  4ZTJ A;  4CES A;  4DSK A;  4CE9 A;  2P9P A;  3B6P A;  4BVP A;  4CEQ A;  4JI6 K;  4CZH A;  3CXC M;  4FJN A;  1UOC A;  4FJH A;  4CHN A;  3GG4 A;  1BA0 A;  4DMN A;  1VSK A;  4Y1C A;  1D9D A;  4RW7 A;  1QQN A;  3OYM A;  4PKH A;  5EY4 A;  3HL8 A;  3VA3 A;  4FZY A;  1WSG A;  2P9N A;  3UB5 A;  4MO5 A;  3RRH A;  3LDN A;  1GLB G;  1NWK A;  3QFP A;  4Z4H A;  1J5O A;  4DV1 K;  2RN2 A;  3SK3 A;  3ZSX A;  4DTS A;  3IRX A;  1U2V B;  3SQ2 A;  1J5E K;  1JL1 A;  4B1X B;  1KSP A;  1NGH A;  1WUA A;  5CYM A;  3L2V A;  1YT3 A;  2G8K A;  2HBL A;  4ZTF A;  1HYZ A;  4BR5 A;  3HOT A;  2GTD A;  5KPR A;  4KHS A;  4YOY A;  3OYN A;  1S9G A;  3U3G A;  4E89 A;  1NGI A;  5KI6 A;  5C15 A;  4QS9 A;  4F8R A;  1RT2 A;  1JLE A;  4BRI A;  4RW9 A;  3FGU A;  4Q0B A;  2IS3 A;  1RDA A;  2D1K A;  1U2V A;  2ZWH A;  3ZT4 A;  5I9E B;  5GAH P;  1L3V A;  2NRZ A;  1RGI A;  3NGZ A;  1WLJ A;  3LDO A;  1C1A A;  4EIA A;  2G8W A;  4BC2 A;  3CM5 A;  1VSE A;  3JSM A;  1LAV A;  1NGA A;  3TTD A;  3NCI A;  1JLF A;  5C0Y A;  3IDH A;  1TUY A;  1MWM A;  3ZSW A;  2O8C B;  1N8R O;  2ZJP L;  4CZK A;  2PAV A;  5AQW A;  1LWF A;  1KLN A;  3SBT A;  4O8U A;  3BZC A;  4A5B A;  4KTW A;  4CFA A;  3NBP A;  4LF8 K;  4LF7 K;  3WXM B;  2HVH A;  2OTL N;  5FDL A;  3VOV A;  4JKA A;  3WNH A;  5GAD P;  2BDP A;  3SQ1 A;  2FBX A;  3U8X A;  1BOT O;  3MCP A;  3LM9 A;  3ZSY A;  2O8C A;  2YJE A;  4IEI A;  3A5O C;  3AO1 A;  3H3O B;  4JKE A;  2QM1 A;  4GMJ B;  1GOA A;  5AJ3 K;  4N41 A;  1BUP A;  1YTA A;  2EWS A;  4CIG A;  4BRO A;  2V7Z A;  1IBK K;  4NLB A;  1W7A A;  4YOV A;  1GLE G;  5TKY A;  5BN9 A;  3CER A;  3NVK A;  3UKU B;  4FWK A;  2D0O A;  1YIJ N;  4B9Q A;  4DCH A;  2ASP A;  4CJV A;  1NNE A;  3I0S A;  4DSI A;  4CJT A;  4C1N K;  1Q86 O;  2W41 A;  3G6E N;  4JK7 A;  1RBR A;  3NH1 A;  2VGM A;  2OCE A;  3CPE A;  3OYA A;  4HUF A;  4A59 A;  2W6L A;  4ID5 A;  3O1W A;  4FK4 A;  2NZT A;  3O8M A;  3CFP A;  3OYF A;  4JKH A;  3T1Y K;  3HP6 A;  4CHO A;  3OW2 M;  4B1V A;  4ISF A;  3W0L A;  4CJP A;  2Z1I A;  1IKV A;  1VRT A;  4O44 A;  5AQO A;  4CD3 A;  3QIP A;  1ATR A;  1I3A A;  2BAN A;  2BUP A;  3T3F A;  1FJG K;  2YHB A;  1HQE A;  1WSE A;  2CGL A;  5KTQ A;  3DOL A;  2E5L K;  2HB5 A;  2OPP A;  1X9S A;  4FVU A;  4NYF A;  4CZL A;  4DTU A;  3A5L C;  2Y1I A;  3RRG A;  4FLY A;  1KQS M;  1U49 A;  4DU3 A;  1JXE A;  4N5S A;  1RTJ A;  2PBD A;  3ZET B;  4BRK A;  1RT7 A;  4BR7 A;  3QIC A;  3HBT A;  2F8S A;  4IBN A;  2G8H A;  2OPR A;  3HP9 A;  3BGR A;  5AQS A;  4LFA K;  3CJA A;  3TWH A;  1E3M A;  3A2F A;  4E1J A;  2B5J A;  1ZBH A;  1RBS A;  3JYT A;  3TPQ A;  4HCB A;  1P8Z A;  4BRG A;  3RR7 A;  4KH5 A;  1TUU A;  4FXD A;  1NK9 A;  3WXK A;  1C0M A;  3H08 A;  4B9S A;  4FJG A;  3VTI A;  5FRN A;  1N32 K;  4FLV A;  2GV9 A;  3DM2 A;  3MEG A;  3J7Z O;  4KH4 A;  1VSD A;  5HOO A;  3W3D A;  3WT0 A;  1LOT B;  2A6A A;  4BWJ A;  4DTJ A;  5E84 A;  4RW8 A;  1IG9 A;  3ID6 A;  4E19 A;  3GDQ A;  5SZT A;  3VEZ A;  1A5W A;  4E0D A;  1S1V A;  1HRH A;  1TKX A;  1R0A A;  4BRE A;  1GLC G;  3CC4 N;  1R59 O;  5DK5 A;  4B9M A;  2QWO A;  3ENB A;  2F8T A;  2ITM A;  4F3T A;  3WEE A;  1XC9 A;  2UUB K;  3VN5 A;  3PX4 A;  3LPT A;  1OKJ A;  1NKB A;  4DUY K;  2O4I A;  4OPJ A;  5ADX A;  1S9E A;  4K25 A;  4CZE A;  3QML A;  1KLM A;  3E66 A;  4CVN E;  1Z6R A;  4AHS A;  2E6M A;  3LP0 A;  1SL0 A;  2YNG A;  4K42 A;  5M1O A;  1NK8 A;  2Q0R A;  4BVO A;  3HOS A;  2A1S A;  3MWT A;  3GOI A;  1ZC6 A;  3MEC A;  5LY3 A;  4FW1 A;  3TTC A;  4WYB A;  3K0S A;  2A3Z A;  3VET A;  3QES A;  3FZM A;  3KJV A;  4H5W A;  5C25 A;  3TSP A;  4KTQ A;  3VF2 A;  1DTQ A;  3TAP A;  4PA1 A;  2HND A;  4OKJ A;  4U7B A;  1NJZ A;  5AR0 A;  3SV3 A;  4M3Y A;  4AM7 A;  3THY A;  1RBT A;  4L3Q A;  4L8R B;  4OPH A;  3MN5 A;  3K5O A;  4E7I A;  3V1Q A;  1B9D A;  4DR4 K;  3AGK A;  3ZSR A;  4IFV A;  3PY8 A;  1N33 K;  2E2N A;  4OKE A;  1ATN A;  2XY7 A;  2HHW A;  4EZ9 A;  3J7Y P;  4HUG A;  1YVU A;  2QWM A;  4B3R K;  4E7J A;  4BDP A;  4A5A A;  4X62 K;  4B3M K;  1IBM K;  3FZH A;  4JI5 K;  3V9X A;  4JHD B;  5AQG A;  1XI1 A;  1BG3 A;  4FJ8 A;  1IG8 A;  3QIO A;  2ASM A;  4AHT A;  5C12 A;  1S5J A;  4C1N I;  1LWC A;  1D5A A;  5B8H A;  3ENH A;  2XO7 A;  1L3S A;  4ELU A;  4IG3 A;  3C7N B;  3CCQ N;  1BCO A;  3ATV A;  1KVA A;  3R1X A;  4WQ5 C;  4RTF D;  3THX A;  1Z26 A;  3QEP A;  3K5M A;  3KKS A;  3AVJ A;  2VG6 A;  1NGD A;  3WQU A;  4JK8 A;  1SKS A;  2E88 A;  3CCR N;  3DXK B;  4O4G A;  3AO5 A;  3LWM A;  1S1T A;  1S22 A;  2X6S A;  3C95 A;  2IVP A;  3C7N A;  2FBY A;  3ZX3 A;  2ITG A;  1C0T A;  1IBL K;  2GUP A;  3OYB A;  3RMC A;  3MXM A;  1VQL N;  4MQ3 A;  1VSI A;  1LAW A;  3FZL A;  3NE6 A;  1VK0 A;  1GLJ O;  1TK0 A;  3DXK A;  3EZ5 A;  1RFQ A;  2QWP A;  3LDQ A;  1BO5 O;  4DQR A;  1E4F T;  4WQ4 C;  5H1S Q;  1YAG A;  3ATU A;  3CCJ N;  3D45 A;  3OS1 A;  1T03 A;  5CHI A;  3B8A X;  3HJF A;  1BHL A;  1CXU A;  2E2P A;  4W5T A;  1YUW A;  3S3N A;  1CZB A;  4BR9 A;  4FLT A;  3VF6 A;  3F9M A;  4M63 C;  4WE1 A;  4OO1 J;  3T69 A;  4A2A A;  1TK5 A;  1TYQ A;  2QXL A;  2NRW A;  5KPZ A;  3KTQ A;  3I8D A;  3VQ6 A;  1BI4 B;  3H46 O;  4MDB A;  4XH1 A;  1VSL A;  2XY6 A;  5F0X A;  2YX6 A;  4CBW A;  1WSI A;  1RDB A;  2D0P A;  3SV4 A;  2P9U A;  3BZK A;  4B8A B;  4F9O A;  1K8A O;  3NHG A;  1KTQ A;  4CJW A;  5JLH A;  2OYQ A;  3MX5 A;  3VQ9 A;  3G25 A;  4H5V A;  1NGF A;  2D0C A;  1QZ5 A;  3AA3 A;  1QSS A;  3VQP A;  3EE8 A;  3SLC A;  4YOR A;  1LV5 A;  1BI4 A;  1B92 A;  1XC3 A;  3ISN C;  4DF8 A;  4DV6 K;  1NGC A;  4O55 A;  1WSJ A;  2HHX A;  1XNR K;  3EL2 A;  1NK4 A;  1BQN A;  4KHW A;  2P9L A;  5JVG L;  4LD0 A;  4PUO A;  4CEC A;  3RMB A;  2Y1J A;  1TKT A;  4PKG A;  3T19 A;  2HST A;  2A41 A;  2XRI A;  1S72 N;  3CPW M;  3KLF A;  3I56 N;  3IS9 A;  3G10 A;  3KHY A;  3KWI A;  4H0O A;  1MA9 B;  3NGI A;  3K57 A;  1WN7 A;  5C2F A;  2P9K B;  3RSE B;  1BIU A;  2FC0 A;  4AHC A;  5E26 A;  2J4R A;  3KD5 E;  3HVR A;  4F3O A;  4FK0 A;  5AQR A;  4HCC A;  4GY2 B;  2HHS A;  3HYF A;  4CIF A;  4F4K A;  2Q3S A;  4CJE A;  4JI1 K;  4IG0 A;  2P9K A;  2NRH A;  3O3F A;  2ATQ A;  3ZLJ A;  2D0B A;  4V19 S;  3C6T A;  3L0Q A;  4CGI A;  1NGB A;  4JKD A;  2WFB A;  4BWM A;  4KHP K;  2O8B B;  4YY3 K;  4CF9 A;  5M1F A;  1Q8I A;  3N4Q A;  1GOB A;  3S41 A;  2HNZ A;  4CK1 A;  4DV2 K;  1X1P A;  3N4P A;  1EET A;  2KHO A;  3CD6 N;  3ZSV A;  2V51 B;  4CZG A;  3LL3 A;  3T1H K;  3AAP A;  2VWK A;  2IAJ A;  3TR8 A;  1CXQ A;  2HMI A;  5MLC Q;  3NH2 A;  5AQF A;  4K8X A;  1NOY A;  3OHR A;  2O8B A;  3PLA A;  1NK5 A;  4H03 B;  4I6M A;  5CZ1 A;  4J2E A;  4IDK A;  3NF6 A;  2QEX N;  1MDU B;  5GAE P;  3CCS N;  3AVG A;  2Q31 A;  4PQU A;  2HF4 A;  1E4G T;  5AZJ A;  2QK9 A;  1Y97 A;  1NG9 A;  3K9J A;  1J9A A;  3EYZ A;  1F21 A;  1QHT A;  4AHR A;  4UY8 O;  1IKW A;  2CGK A;  2JLE A;  3K5N A;  3T1A A;  5HL7 L;  3ULE A;  5D3G A;  1K9M O;  3QIN A;  1T8E A;  3DWL A;  3MN9 A;  5AFU A;  3AO4 A;  4C8N A;  4OGC A;  3TAM A;  2F4V K;  4KTZ A;  1X9W A;  4CEA A;  2BTF A;  2WON A;  1D4X A;  3DLE A;  3ZT0 A;  4FJ5 A;  5EU7 A;  5J2M A;  3ID8 A;  1KXP A;  4ILJ A;  4FZZ A;  1U04 A;  4JKF A;  4Q5V A;  3BY5 A;  5C24 A;  2YV0 X;  1TL1 A;  4O5F A;  2WOM A;  2EX3 A;  3CM6 A;  3QEW A;  4WQ4 A;  4B9V A;  3E01 A;  3HM9 A;  5FPD A;  4FK2 A;  4BRD A;  1SAZ A;  2VG7 A;  3THV A;  4B9U A;  3KD1 E;  1XWL A;  2P9N B;  2XY8 A;  1NJI O;  4H0Y B;  2UU9 K;  5JVH L;  3NVM A;  1YVN A;  3VTH A;  1SKR A;  3ASM A;  4ELT A;  1N6Q A;  4DFK A;  4GVM A;  3O5B A;  3PO5 A;  1L3U A;  2ZD1 A;  4FSV A;  3CCV N;  1KC8 O;  4CED A;  3CFO A;  4NO7 A;  3L8B A;  2I7N A;  3UKR A;  2O8E A;  2GEM A;  3BP8 A;  4B3T K;  1HMV A;  2Q97 A;  4XH4 A;  5HBM A;  3VGM A;  3I0R A;  3TAE A;  3PX0 A;  1BIZ A;  4QS7 A;  3OYC A;  4FM0 A;  2XY5 A;  4LF9 K;  4ID1 A;  4PHT X;  3DRS A;  1NBW A;  3KWG A;  4DTX A;  1YJN N;  1WOQ A;  3HPO A;  3P38 A;  4Z4C A;  3AO3 A;  4CHQ A;  1XNQ K;  3IG1 A;  2OZS A;  2O4G A;  3KLI A;  2QWQ A;  2BE2 A;  1VSM A;  4E7H A;  4CF8 A;  1Q82 O;  2P9S A;  4HVJ A;  5LJV A;  2A40 A;  4CJS A;  3OJU A;  4DV4 K;  2KFN A;  1JCE A;  3ZX0 A;  4LF6 K;  4I2Q A;  4NXM K;  3NF8 A;  2YHW A;  3L2U A;  3LAM A;  3KVG A;  3SUN A;  3GBT A;  1SL1 A;  2E1Z A;  4C23 A;  4BDY A;  4CI6 A;  1ZBU A;  2UXD K;  4EAH D;  3OYL A;  2IDO A;  1M90 O;  3D7E O;  3QBX A;  2IC3 A;  4BRC A;  1BQM A;  2GBZ A;  1RT5 A;  3O9R A;  4QCL A;  1OVY A;  2RKI A;  3HPG A;  4IDH A;  3MWP A;  4JI0 K;  2QI2 A;  1K8K A;  5JMV A;  3P31 A;  3MX2 A;  3LZJ A;  5J2N A;  1U47 A;  3QEV A;  1C0U A;  1RTH A;  3L2R A;  1SUQ A;  2DFH A;  2FLO A;  2G8I A;  4C8K A;  4WFN L;  3HM8 A;  3V1R A;  3TAQ A;  3F73 A;  3D6R A;  3ZSQ A;  1RT1 A;  5BRH A;  4AM6 A;  2X74 A;  4LSN A;  4HWI A;  5JIC A;  4W5Q A;  3PSI A;  5ELZ A;  1HNI A;  4M3W A;  1JCF A;  3HZ6 A;  4K0K K;  4YDU C;  4JI7 K;  3KLG A;  3LP2 A;  1BU6 O;  3CCE N;  3M6G A;  4EP5 A;  2BH1 A;  5BR8 K;  3A5N C;  5AQJ A;  4FM2 A;  4CJL A;  4DFM A;  4CGH A;  2JGU A;  3CYM A;  5CY4 A;  3OYJ A;  4J2D A;  2GX9 A;  3AA4 A;  1UA0 A;  3ZX2 A;  2KFZ A;  2Q2R A;  3SMS A;  2DTU A;  4CFD A;  1ZYQ A;  5C10 A;  5AQV A;  1ZBS A;  2OAN A;  4KB0 A;  3CJ1 A;  1P90 A;  5AQT A;  3O08 A;  1JLB A;  2Q36 A;  4NCG A;  3S3O A;  1C1C A;  4XEI A;  3AVM A;  1OH7 A;  2PZS A;  1NK6 A;  3FZF A;  5F1X A;  1VQ7 N;  1QVF M;  4JS5 A;  4H0P A;  3H6E A;  3DXM A;  1W97 L;  3KLH A;  2ASO A;  1GLL O;  4KI6 A;  3E9O A;  3Q7C A;  1XHX A;  3FZK A;  5KRT A;  5T7B A;  1IJJ A;  1G15 A;  4M45 A;  4DTR A;  1RDU A;  4R5P A;  1S1U A;  5FPN A;  4DV0 K;  1Z25 A;  4JD2 A;  3OA9 A;  4JKB A;  4MO4 A;  1NJW A;  4XH5 A;  2HMP A;  2QA4 N;  4DR7 K;  4MDA A;  4FYD A;  4Z0U A;  1W2B M;  3CJ7 A;  1NKE A;  1S6Q A;  1C0F A;  2HBK A;  4AIL C;  3O4W A;  3OVN A;  2YHA A;  2QKK A;  3SMP A;  4FO0 A;  4DSL A;  1JXB A;  4KV8 A;  3WEE B;  3KIO A;  2KZZ A;  1RTD A;  4DU1 A;  4NLC A;  1U45 A;  4IOA L;  4FWO A;  4A62 A;  4B8C A;  3RMA A;  4CGG A;  4FJK A;  3F5T A;  4FPA A;  3MXJ A;  4JN4 A;  1J6Z A;  4WFB L;  4DUZ K;  3V6D A;  4IFE A;  1X3N A;  4K41 A;  3CJC A;  1NU0 A;  4DS5 A;  5AZI A;  3M5R A;  3ZEU A;  3TAF A;  4OKK A;  4AF1 A;  4B1Z A;  4DTN A;  4DQS A;  4C8L A;  4H0X B;  3VQ7 A;  3NGY A;  3QEX A;  2YKM A;  3M3Z A;  4FOE A;  1RT3 A;  4NYN A;  5AQI A;  4KHU A;  1XQS C;  3TAG A;  4J2A A;  3THY B;  3QBW A;  3M8Q A;  2HHH K;  3HO1 A;  3VQE A;  3ZT3 A;  1HJO A;  4CJ7 A;  3SAF A;  5FRO A;  3E1Y A;  4M3Z A;  3ZCM A;  3VQB A;  4RWT A;  2QXF A;  1TGO A;  1V4S A;  1QSL A;  3LDP A;  3B6O A;  4LH4 A;  4PL7 A;  4FWS A;  4O5B A;  5FPM A;  1KFS A;  3NH0 A;  1JKH A;  3BUZ B;  5EX5 A;  2O8F A;  3ITH A;  2ETJ A;  1QS4 A;  3F2K A;  1HKG A;  4W5O A;  4DKW A;  3C94 A;  4LFB K;  1KCF A;  3OBW A;  1VQO N;  5DM6 L;  4RG8 A;  3R6M A;  2PYJ A;  2E20 A;  2YI1 A;  4JEP A;  1DT9 A;  2RE2 A;  3CJB A;  4FLW A;  3RR8 A;  3OS2 A;  3K59 A;  1N36 K;  3THX B;  1UA1 A;  3DLL L;  1SZ2 A;  3O4Q A;  4CJ5 A;  1UWB A;  3P4I A;  4CJK A;  4M3U A;  2HHQ A;  1S1W A;  4X65 K;  3GL1 A;  4H5R A;  4IEE A;  1YJ9 N;  4CHP A;  1TL3 A;  3DAW A;  3EN9 A;  3G4S N;  3QLH A;  5IT9 O;  4YDU A;  3AVN A;  5FLX O;  4FLZ A;  3SI6 A;  2HBM A;  1D8Y A;  1WB9 A;  4LFC K;  2YNF A;  1NK7 A;  4YOX A;  1DGK N;  1QQO A;  3PSF A;  2Q0U A;  1T6C A;  3K9K A;  3NAE A;  4CJ3 A;  4LF5 K;  1OVQ A;  2NUB A;  3SAH A;  3AVF A;  4BE0 A;  3CIP A;  3I8B A;  3MCA B;  4JAX A;  1NGE A;  1B9F A;  4AQY K;  4CD1 A;  2UXB K;  5EOY A;  3KK1 A;  2Q1N A;  2NNW A;  3K5L A;  4FZX C;  1QE1 A;  2D5R A;  4FLU A;  3L4I A;  3VEO A;  1WAF A;  3AAR A;  3HI0 A;  4FJM A;  1EX4 A;  5BR9 A;  1TYQ B;  1RDD A;  2P5O A;  4YOT A;  3FLC O;  2AA4 A;  3QB0 A;  2E2O A;  1ZBI A;  3OYD A;  4FJJ A;  2AJQ A;  4JLH A;  2P9U B;  1IH7 A;  4EP4 A;  1KRP A;  3EKU A;  1QSY A;  3DLR A;  3L6Q A;  2W6K A;  3H45 C;  3CHW A;  3K2P A;  2EHG A;  2E4L A;  3D2E A;  5LJW A;  3CQY A;  1VQN N;  1TAQ A;  1OH5 A;  1QQC A;  3TAR A;  3WXI A;  3ZSO A;  2FSK A;  2NRX A;  4GNI A;  1TAU A;  3IUC A;  2P9L B;  3RMD A;  4B1W B;  3CC2 N;  5GIO A;  1A5V A;  1MU2 A;  3WQT A;  1VHX A;  2KKZ A;  3V9U A;  3VMF B;  2G8V A;  1C0G A;  3VEY A;  4Y1D A;  3EY1 A;  3LWL A;  5J2P A;  1VRU A;  3VQC A;  3IKM A;  4H4O A;  2ZQB A;  3LAL A;  5JS2 A;  1YHQ N;  3VGK A;  2FBT A;  1T05 A;  4DQI A;  4IXC A;  1JLG A;  4JNE A;  1T44 A;  3TU5 A;  1EP4 A;  3O9S A;  4E3S A;  2HF3 A;  1VQK N;  5FRM A;  4CHZ A;  4W5N A;  4FJX A;  5KPT A;  2JWK A;  4DV3 K;  1MWK A;  3FE1 A;  3HSC A;  1BCM A;  3NMU A;  3PIP L;  4Y0W A;  1VQ8 N;  4Z4I A;  1I94 K;  2PYL A;  2DY4 A;  4JKG B;  3AVC A;  4Z4F A;  3AV9 A;  3WXL A;  1HNW K;  4ISG A;  3ENO A;  3JS6 A;  1J54 A;  1NLV A;  3D2F A;  5J2Q A;  4N47 A;  1NJY A;  3AAQ A;  4FWM A;  4FWQ A;  1Z05 A;  2GUI A;  1TKD A;  4DQQ A;  3PUF A;  1NGJ A;  3O9T A;  1EWR A;  4JKG A;  4QOZ B;  1JLQ A;  3CCU N;  3PV8 A;  3ZT2 A;  5BRE A;  5HRO A;  1YTU A;  4CZI A;  4CEF A;  2IIR A;  5M1Q A;  1KVB A;  4I6M B;  3GE1 A;  2Z1H A;  4ELV A;  1QVG M;  3TAB A;  1DEJ A;  5AZJ B;  4HHT A;  4G9Z A;  3VQ4 A;  2HOE A;  2VG5 A;  4B3O A;  3Q7B A;  4I2P A;  4LSL A;  4BGA A;  5KQ8 A;  1N5Y A;  4ICL A;  1WNS A;  5FPE A;  1YXQ A;  2GWJ A;  5JS1 A;  2YKN A;  3ULE B;  3DLB A;  4GV9 A;  2H3G X;  3AVA A;  1HNV A;  4Z4E A;  2NRT A;  2LSN A;  3O1B A;  4K43 A;  4FWL A;  1YF5 L;  3PO4 A;  1ZXO A;  3DMJ A;  1HYS A;  1BDG A;  1Y64 A;  2V52 B;  4JYA K;  3THW A;  3DJC A;  3R8E A;  5GAG P;  4BRM A;  3HST B;  4KKO A;  1H1V A;  4CGJ A;  1K6Y A;  3BDP A;  4MFB A;  3G0Z A;  2VWB A;  2FBV A;  3ULD A;  1NJX A;  3ALY A;  5CR4 A;  5KGX A;  1U4B A;  1ASV A;  1HUX A;  4IZ9 A;  4QAG A;  1V4T A;  4B9T A;  4BRL A;  1FXX A;  4H5N A;  2IVO A;  4IKF A;  4BR0 A;  5DM7 L;  4FLX A;  4EZ6 A;  4Z94 A;  4YOW A;  2CH5 A;  3O9Q A;  5SWM A;  4UQG A;  3LAK A;  3EEQ A;  4FPB A;  4FJI A;  1X9M A;  3UKR B;  2O8E B;  3P83 D;  4FJ7 A;  4M7X A;  3SPZ A;  2KQ2 A;  4OLA A;  5HRR A;  4FW2 A;  3TTF A;  4H5T A;  2VQE K;  2F96 A;  3V81 A;  3SJH A;  2OTJ N;  5A2Q O;  3V9W A;  3SYZ A;  2O8D B;  4KRF A;  2QTD A;  3M1F A;  4I9Q A;  4PWD A;  3KK7 A;  3AVI A;  4IOC L;  3UE5 A;  5LL6 Z;  3UIQ A;  3IAY A;  2HHV A;  3R9P A;  3E9L A;  4BRF A;  3AVB A;  1S3X A;  4Z4G A;  1ILY A;  3NDK A;  2QKB A;  1HLU A;  4DTM A;  5BN8 A;  3HRG A;  3DI6 A;  2P9S B;  1TKZ A;  3VER A;  4CK2 A;  1X3M A;  3V9Z A;  2O8D A;  1RBV A;  3SPY A;  1TVR A;  2GWK A;  5M1K A;  2CGJ A;  3J8A A;  1BGX T;  2GEL A;  5AQL A;  4DR6 K;  3QFU A;  4ISE A;  1WBD A;  3HT3 A;  3C6A A;  4YHH K;  1XMQ K;  4KHQ A;  4M7Y A;  4AH9 A;  3CJ9 A;  1TK8 A;  2A42 A;  3AO2 A;  3J7A P;  4A2B A;  4DWI A;  4DB3 A;  3LZI A;  4CF0 A;  1JL2 A;  4IFY A;  5E41 A;  3CQX A;  2IVN A;  2VCP A;  4M3R A;  4R79 A;  1GLA G;  4OVL A;  1FW6 A;  3VQA A;  1K8K B;  3LPU A;  5EXW A;  2P1J A;  2ZM6 K;  4JV5 K;  2AP1 A;  2W40 A;  3A0I X;  3K58 A;  3EKS A;  3CFR A;  1RCH A;  4WF9 L;  3FFI A;  2RHK A;  1HJR A;  2G8U A;  4U67 L;  4KO0 A;  2OPQ A;  3M8S A;  4YOU A;  4HTL A;  5ADX H;  1U6Z A;  4KHN A;  3S9H A;  2I7P A;  4JI8 K;  4IO9 L;  4DSJ A;  4FWN A;  4DU4 A;  1HKB A;  1VQ6 N;  3SAG A;  2UUA K;  3J80 O;  1LWE A;  4O0I A;  4CGD A;  2HHU A;  4YNQ A;  2HHT A;  3HVT A;  1GLF O;  4E1M A;  1M1K O;  4BE1 A;  2VYP A;  3CCM N;  3QNN A;  3OY9 A;  5AQZ A;  3WUH A;  1WSF A;  2ZJQ L;  3P39 A;  3MK6 A;  4MLH A;  1Q7Y O;  4DQP A;  4BC4 A;  2PY5 A;  4CJ4 A;  1G99 A;  4CFB A;  1D9F A;  1FK9 A;  3V9S A;  4KAZ A;  2KLA A;  3HK2 A;  1CZ9 A;  5K14 A;  1N34 K;  3V1O A;  4B1Y B;  1RDW X;  2HNY A;  4O0J A;  4CEZ A;  4FVM A;  4DR1 K;  4GKJ K;  3O3H A;  5CZ2 A;  3AA5 X;  4FJL A;  3CF5 L;  3L3V A;  3KZB A;  1ATS A;  4KPY A;  4CF1 A;  4EHT A;  2E6L A;  3DXM B;  1RNH A;  3U9D A;  1SV5 A;  3TSQ A;  3OYH A;  4BR2 A;  3TI0 A;  1HNX K;  4PL8 A;  3UKU A;  4OX9 K;  3VQ5 A;  1S6P A;  2IGI A;  4X66 K;  1CLQ A;  3NFA A;  4YFU A;  4IOX A;  5AQP A;  5BPN A;  1VQP N;  5LMU K;  4JD2 B;  1T3V A;  3O80 A;  3BF1 A;  5BPL A;  1K73 O;  4BAC A;  3VEX A;  3VQQ A;  1Q81 O;  3QET A;  5C42 A;  2X6N A;  3VEN A;  4DFJ A;  4TSX A;  4HUE A;  1W9H A;  4DTP A;  2FF6 A;  5HLF A;  2NLX A;  1EO1 A;  1YJW N;  2P51 A;  2WTU A;  3U3Y A;  4GV6 A;  3O3G A;  3C6H A;  3QNO A;  3VEW A;  2E1Y A;  2KW4 A;  1KAZ A;  4HTU A;  2V7Y A;  4KRE A;  1NMD A;  4E1N A;  3OTO K;  4E7L A;  5AQY A;  3T7Z A;  1HPM A;  3S3M A;  4BRH A;  4CEE A;  3D0P A;  3DRR A;  4JI3 K;  4A57 A;  1NGG A;  1RIL A;  3EE9 A;  1O13 A;  2R7Y A;  1Q9Y A;  5GIN A;  2F9W A;  4FOI A;  1DTT A;  2OA8 A;  4C8O A;  2UUC K;  3AGR A;  5AZI B;  3ZEU B;  4J8F A;  3SUQ A;  2NRR A;  3CC7 N;  4NXN K;  1NOZ A;  1LCU A;  3ZET A;  4LF4 K;  2P9I B;  1EXQ A;  1JLA A;  2E2Q A;  4O8K A;  4DSF A;  4B9L A;  1QTM A;  4OPA A;  3LM2 A;  3PX6 A;  1VAZ A;  3WNE A;  4OJR A;  1BWF O;  3ZSZ A;  1XHZ A;  1JCG A;  3DYA A;  1SKW A;  2QWN A;  1QZ6 A;  3OJS A;  3DLH A;  2ZJR L;  4KHY A;  3RWU A; 
#chains in the Genus database with same CATH homology
 3DLR A;  5FDL A;  2QK9 A;  1Y97 A;  3K2P A;  2EHG A;  3WNH A;  2E4L A;  1J9A A;  1RBU A;  2DFF A;  1F21 A;  3EYZ A;  2BDP A;  1QHT A;  4AHR A;  3SQ1 A;  2FBX A;  1IKW A;  1TAQ A;  2JLE A;  3K5N A;  1QQC A;  3TAR A;  3T1A A;  1ASU A;  3AVK A;  5D3G A;  1HQU A;  3AVL A;  3QIN A;  1T8E A;  3ZSO A;  3ZSY A;  3AO4 A;  4C8N A;  4OGC A;  1J53 A;  3TAM A;  3AO1 A;  4KTZ A;  1X9W A;  4CEA A;  4CK3 A;  1TAU A;  2WON A;  3DLE A;  1GOA A;  4GMJ B;  4LH5 A;  3ZT0 A;  1YTA A;  4CIG A;  4N41 A;  3OYK A;  4RW6 A;  5EU7 A;  5J2M A;  3RMD A;  4FJ5 A;  1HPZ A;  4FZZ A;  1U04 A;  4N76 A;  4Q5V A;  1A5V A;  1MU2 A;  5C24 A;  1RTI A;  4H8K A;  1REV A;  2YV0 X;  3V9U A;  1TL1 A;  4F2S A;  2G8V A;  3HXM A;  2WOM A;  4Y1D A;  3EY1 A;  2EX3 A;  3CM6 A;  3LWL A;  1VRU A;  3VQC A;  1S1X A;  4H4O A;  4CJV A;  1VSF A;  2ZQB A;  5CYQ A;  4DLG A;  3QEW A;  3SQ4 A;  3I0S A;  3LAL A;  5JS2 A;  3WNF A;  4CJT A;  4B9V A;  4DSI A;  3E01 A;  3HM9 A;  2FBT A;  1T05 A;  4FK2 A;  1RBR A;  3NH1 A;  4DQI A;  2VG7 A;  3THV A;  1JLG A;  4B9U A;  3KD1 E;  3KLE A;  4CER A;  2Z1G A;  3P5J A;  3OYA A;  1XWL A;  4RW4 A;  4HUF A;  4ID5 A;  4CJQ A;  1EP4 A;  4FK4 A;  3M8R A;  4CIE A;  2XY8 A;  4E3S A;  2YNI A;  4CF2 A;  5KRS A;  3CFP A;  1ZBF A;  4CHZ A;  1JLC A;  3OYF A;  4FJX A;  5FRM A;  4W5N A;  3HP6 A;  4CHO A;  1SKR A;  1WSH A;  4LY7 A;  1IKX A;  3ASM A;  4B9N A;  3KK2 A;  1I39 A;  4CJP A;  1BCM A;  4ELT A;  1N6Q A;  2Z1I A;  4DFK A;  1IKV A;  1VRT A;  4O44 A;  4F2R A;  4GVM A;  1NK0 A;  4Z4I A;  3QIP A;  4BDZ A;  3M8P A;  1I3A A;  1ASW A;  5J2P A;  2PYL A;  2P5G A;  2BAN A;  2DY4 A;  3PO5 A;  1L3U A;  2ZD1 A;  3T3F A;  1RDC A;  3AVC A;  2YHB A;  1HQE A;  1WSE A;  4Z4F A;  3AV9 A;  5KTQ A;  2VWJ A;  3DOL A;  2HB5 A;  4CED A;  3C6U A;  5I3U A;  3CFO A;  2OPP A;  3L8B A;  1X9S A;  4NYF A;  1HMV A;  1J54 A;  4OGE A;  3RTV A;  4DTU A;  3SNN A;  5HRS A;  5HBM A;  5J2Q A;  4N47 A;  1BIS A;  1A5X A;  1NJY A;  3I0R A;  2Y1I A;  3RRG A;  4FLY A;  3TAE A;  3PX0 A;  1U49 A;  1BIZ A;  4H4M A;  4CHY A;  4B08 A;  3LDS A;  2GUI A;  4DU3 A;  3OYC A;  1JXE A;  4N5S A;  4FM0 A;  1RTJ A;  2XY5 A;  4DQQ A;  4ID1 A;  1TKD A;  4OLB A;  3PUF A;  1RT7 A;  3DRS A;  4DTX A;  2F8S A;  4QOZ B;  4IBN A;  4CFC A;  1JLQ A;  3HPO A;  1TV6 A;  4Z4C A;  2G8H A;  3SUO A;  2OPR A;  1O1W A;  1C6V A;  3AO3 A;  3HP9 A;  3ZT2 A;  4AHV A;  3BGR A;  4FM1 A;  3PV8 A;  5HRO A;  4J2B A;  4DF4 A;  4CHQ A;  1W0H A;  3IG1 A;  4M42 A;  4DSE A;  1FKP A;  4CEF A;  4ZHR A;  3TWH A;  1BL3 A;  2OZS A;  3HPH A;  3WNG A;  3MED A;  2O4G A;  1KVB A;  3A2F A;  5HRN A;  2A1R A;  2B5J A;  3KLI A;  2Z1H A;  1ZBH A;  1RBS A;  3JYT A;  2B4J A;  4ELV A;  4HCB A;  5HRP A;  3TAB A;  1ITG A;  2BE2 A;  3RR7 A;  4FXD A;  1VSM A;  4CEB A;  1NK9 A;  4E7H A;  4CF8 A;  4HHT A;  3VQ4 A;  2VG5 A;  4HVJ A;  4B3O A;  1C0M A;  3H08 A;  4CJS A;  3OJU A;  4I2P A;  4LSL A;  4B9S A;  2KFN A;  3OS0 A;  1N5Y A;  4ICL A;  1WNS A;  4FJG A;  3CQ8 A;  2OZM A;  2DFE A;  4I2Q A;  3NF8 A;  5FRN A;  5JS1 A;  2YKN A;  3DLB A;  3V4I A;  1U48 A;  4M41 A;  4XIU A;  4FLV A;  3L2U A;  2GV9 A;  3DM2 A;  3LAM A;  3MEG A;  5I42 A;  2ZE2 A;  3SUN A;  1SL1 A;  1VSD A;  4BDY A;  2KTQ A;  1ZBU A;  3AVA A;  1HNV A;  3QER A;  4Z4E A;  2LSN A;  3OYL A;  2IOC A;  2IDO A;  4BWJ A;  3LP1 A;  3PO4 A;  4DTJ A;  4JRQ A;  2I5J A;  4RW8 A;  1IG9 A;  3DMJ A;  4E19 A;  2IC3 A;  1HYS A;  5SZT A;  1A5W A;  1BQM A;  4DTO A;  1S1V A;  1HRH A;  1TKX A;  1WAJ A;  2GBZ A;  4E0D A;  1RT5 A;  3O4N A;  4C8M A;  1R0A A;  4QCL A;  5DK5 A;  1LW2 A;  2RKI A;  3QEI A;  4B9M A;  5KGW A;  3HST B;  4KKO A;  2G8F A;  4CGJ A;  1IKY A;  3HPG A;  3SCX A;  5J1E A;  2F8T A;  1K6Y A;  3BDP A;  4F3T A;  4MFB A;  3G0Z A;  3RWU A;  3LZJ A;  1XC9 A;  3VN5 A;  5J2N A;  3PX4 A;  1U47 A;  2FBV A;  3ULD A;  1NJX A;  3LPT A;  3ALY A;  5KGX A;  1U4B A;  1ASV A;  3QEV A;  1C0U A;  1DLO A;  1RTH A;  3AVH A;  3L2R A;  1NKB A;  3MAQ A;  1SUQ A;  4QAG A;  4OPJ A;  2O4I A;  2DFH A;  1T7P A;  1S9E A;  4B9T A;  3VQD A;  4CEO A;  1FXX A;  2G8I A;  4C8K A;  1KLM A;  4IKF A;  3U6F A;  4AHS A;  2W42 A;  2E6M A;  3LP0 A;  1IO2 A;  3V1R A;  4FLX A;  1SL0 A;  4EZ6 A;  4AHU A;  3F73 A;  2YNG A;  3TAQ A;  3ZSQ A;  1RT1 A;  1NK8 A;  4W5R A;  2X74 A;  4M3T A;  4LSN A;  5SWM A;  4W5Q A;  1HYV A;  4UQG A;  2A1S A;  3DOK A;  1HNI A;  3MEC A;  4M3W A;  3LAK A;  2RF2 A;  4FW1 A;  4FJI A;  1X9M A;  3KLG A;  3P83 D;  4DG1 A;  3LP2 A;  4FJ7 A;  4PY5 A;  4OLA A;  3QES A;  2KQ2 A;  3KJV A;  3SPZ A;  1RT4 A;  5HRR A;  4EP5 A;  4JRP A;  4FW2 A;  5C25 A;  2F96 A;  4KTQ A;  1DTQ A;  3V81 A;  3TAP A;  4PA1 A;  2HND A;  4OKJ A;  4FM2 A;  4CJL A;  4DFM A;  1NJZ A;  3SV3 A;  2YNH A;  4M3Y A;  4CGH A;  2RPI A;  2JGU A;  3CYM A;  1KFD A;  5CY4 A;  3OYJ A;  4J2D A;  4FJ9 A;  1RBT A;  3V9W A;  4L8R B;  3SYZ A;  3AA4 A;  4KRF A;  1UA0 A;  3K5O A;  2KFZ A;  4E7I A;  3V1Q A;  4I9Q A;  4PWD A;  2DTU A;  1B9D A;  3AVI A;  1RT6 A;  4CFD A;  1ZYQ A;  3UIQ A;  3IAY A;  3ZT1 A;  3ZSR A;  2HHV A;  4IFV A;  3PY8 A;  3LAN A;  4CJU A;  4KB0 A;  4CCH A;  3AVB A;  4OKE A;  2XY7 A;  2HHW A;  4Z4G A;  4EZ9 A;  3OYI A;  1JLB A;  3QO9 A;  4NCG A;  1YVU A;  2XHB A;  4HUG A;  3S3O A;  3NDK A;  4E7J A;  2QKB A;  4BDP A;  4DTM A;  1C1C A;  4KB1 A;  3DI6 A;  3AVM A;  1TKZ A;  4M3X A;  4CK2 A;  4FCY A;  4G1Q A;  3V9X A;  1L3T A;  1XI1 A;  3V9Z A;  4I7F A;  1NK6 A;  2PZS A;  4FJ8 A;  2KZM A;  1RBV A;  3SPY A;  2OPS A;  3QIO A;  4JS5 A;  3F9K A;  3OYE A;  1TVR A;  4AHT A;  1ZBL A;  1S5J A;  1LWC A;  1D5A A;  3KLH A;  2XO7 A;  2HW3 A;  1Q9X A;  1L3S A;  4ELU A;  4IG3 A;  4KI6 A;  1BGX T;  5T7B A;  1XHX A;  3NF9 A;  5KRT A;  4M3Z A;  1BCO A;  3HT3 A;  1KVA A;  1G15 A;  4M45 A;  4DTR A;  4AH9 A;  4K8Z A;  4KHQ A;  4R5P A;  1S1U A;  1TK8 A;  3SQ0 A;  3KK3 A;  4DS4 A;  1Z25 A;  3AO2 A;  1Z26 A;  4JS4 A;  3QEP A;  3K5M A;  3KKS A;  3AVJ A;  1NJW A;  2VG6 A;  4DWI A;  1SKS A;  4BE2 A;  3LZI A;  4CF0 A;  1JL2 A;  4KFB A;  3DLK A;  4IFY A;  5E41 A;  4O4G A;  3AO5 A;  3LWM A;  1S1T A;  4FYD A;  4Z0U A;  4I9L A;  3TAN A;  2X6S A;  1S6Q A;  4M3R A;  1NKE A;  2BGG A;  4AIL C;  3DLG A;  3OVN A;  3C95 A;  4OVL A;  2YHA A;  3VQ8 A;  4DFP A;  2FBY A;  3VQA A;  2QKK A;  4DSL A;  1LW0 A;  1JXB A;  3LPU A;  5HP1 A;  3AA2 A;  4KV8 A;  3SZ2 A;  3KIO A;  2KZZ A;  1RTD A;  4DU1 A;  2ITG A;  1C0T A;  2P1J A;  4GW6 A;  4CJF A;  3K58 A;  3CFR A;  1C1B A;  1RCH A;  3OYB A;  1U45 A;  3FFI A;  3RMC A;  3MXM A;  4N56 A;  4MQ3 A;  1VSI A;  1LAW A;  3NE6 A;  1VK0 A;  4B8C A;  3RMA A;  1HJR A;  4CGG A;  1TK0 A;  3SUP A;  2G8U A;  4FJK A;  4KO0 A;  2OPQ A;  3MXJ A;  3M8S A;  3EZ5 A;  5DMR A;  4DQR A;  3L3U A;  3V6D A;  2Z1J A;  4KHN A;  3KKR A;  3D45 A;  3OS1 A;  4NCB A;  1L5U A;  3S9H A;  1T03 A;  4DS5 A;  3CG7 A;  3HJF A;  1BHL A;  1CXU A;  4OKK A;  4W5T A;  3DRP A;  3TAF A;  4DTN A;  3LP3 A;  4DQS A;  4DU4 A;  4DSJ A;  4DLE A;  3S3N A;  1CZB A;  3OYG A;  4C8L A;  4E7K A;  1NKC A;  1LWE A;  4O0I A;  4FLT A;  3VQ7 A;  3NGY A;  4CGD A;  2HHU A;  4YNQ A;  4WE1 A;  3HVT A;  2HHT A;  3P1G A;  3QEX A;  4E1M A;  2YKM A;  4NYN A;  1RT3 A;  1FKO A;  3L2W A;  4BE1 A;  4KHU A;  2X78 A;  1TK5 A;  3TAG A;  3KTQ A;  4J2A A;  3QNN A;  3I8D A;  3MEE A;  3OY9 A;  3M8Q A;  3VQ6 A;  1BI4 B;  1VSL A;  3HO1 A;  3VQE A;  2XY6 A;  2B6A A;  3ZT3 A;  1WSF A;  1WSI A;  3MXI A;  4KI4 A;  1RDB A;  5FRO A;  3SV4 A;  4B8A B;  1YTU A;  4DQP A;  4NCA A;  3NHG A;  1KTQ A;  4CGF A;  2PY5 A;  4CJ4 A;  4CJW A;  3ZCM A;  1KVC A;  3VQB A;  4CFB A;  1VSJ A;  3L2Q A;  2QXF A;  1FK9 A;  3V9S A;  1D9F A;  2OYQ A;  4KAZ A;  3VQ9 A;  3HK2 A;  1CZ9 A;  1TGO A;  5K14 A;  1QSL A;  2D0C A;  3NF7 A;  3V1O A;  1GOC A;  1UAX A;  4OPK A;  3AA3 A;  1QSS A;  3B6O A;  3VQP A;  4LH4 A;  1SL2 A;  2HNY A;  4O0J A;  4O5B A;  4CEZ A;  4FVM A;  1LV5 A;  2HVI A;  1KFS A;  3NH0 A;  1BI4 A;  1JKH A;  1B92 A;  4DF8 A;  3ISN C;  3O3H A;  5CZ2 A;  1VSH A;  1EKE A;  4O55 A;  3SJJ A;  1WSJ A;  2HHX A;  4CJR A;  3VA0 A;  2D0A A;  3ITH A;  2ETJ A;  3AA5 X;  4FJL A;  3L3V A;  1QS4 A;  1NK4 A;  4KPY A;  4CF1 A;  4W5O A;  1BQN A;  4ZTJ A;  2E6L A;  3C94 A;  4CES A;  4DSK A;  4LD0 A;  1KCF A;  1RNH A;  1SV5 A;  4CE9 A;  4PUO A;  3B6P A;  4CEC A;  4CEQ A;  3OYH A;  3RMB A;  2Y1J A;  3TI0 A;  4FJN A;  1UOC A;  1TKT A;  4RG8 A;  4FJH A;  4CHN A;  2PYJ A;  3T19 A;  1S6P A;  3VQ5 A;  2IGI A;  4FLW A;  3RR8 A;  3OS2 A;  2XRI A;  3K59 A;  3KLF A;  4DMN A;  1CLQ A;  3IS9 A;  1VSK A;  3G10 A;  4Y1C A;  3NFA A;  4YFU A;  3NGI A;  3K57 A;  1WN7 A;  1D9D A;  1UA1 A;  4RW7 A;  3O4Q A;  4CJ5 A;  3OYM A;  1UWB A;  4CJK A;  4M3U A;  2HHQ A;  1BIU A;  2FC0 A;  1S1W A;  4BAC A;  4AHC A;  3VQQ A;  3KD5 E;  3HL8 A;  4CHP A;  5C42 A;  3QET A;  1TL3 A;  3VA3 A;  4FZY A;  2X6N A;  3QLH A;  1WSG A;  3HVR A;  4DFJ A;  4F3O A;  4TSX A;  3RRH A;  4HUE A;  3AVN A;  4FK0 A;  4FLZ A;  1W9H A;  3SI6 A;  4DTP A;  5HLF A;  4HCC A;  1D8Y A;  4Z4H A;  1J5O A;  2YNF A;  1NK7 A;  2RN2 A;  4DTS A;  3ZSX A;  3HYF A;  4CIF A;  4F4K A;  2Q3S A;  2HHS A;  2P51 A;  3U3Y A;  3IRX A;  4CJE A;  3O3G A;  3SQ2 A;  1JL1 A;  4IG0 A;  1KSP A;  3QNO A;  5CYM A;  3NAE A;  4CJ3 A;  2KW4 A;  3L2V A;  3O3F A;  2NUB A;  2ATQ A;  1YT3 A;  4HTU A;  4ZTF A;  2G8K A;  1HYZ A;  4KRE A;  4E1N A;  4E7L A;  2D0B A;  3AVF A;  3C6T A;  4BE0 A;  3S3M A;  4CGI A;  4CEE A;  3D0P A;  4KHS A;  3DRR A;  3OYN A;  1S9G A;  1RIL A;  4BWM A;  3U3G A;  2R7Y A;  1Q9Y A;  1B9F A;  4CF9 A;  4E89 A;  1Q8I A;  1DTT A;  2OA8 A;  4C8O A;  5KI6 A;  1GOB A;  4F8R A;  2HNZ A;  4CK1 A;  4KHW A;  1RT2 A;  1JLE A;  1X1P A;  3KK1 A;  4RW9 A;  4FZX C;  3K5L A;  3SUQ A;  4Q0B A;  2IS3 A;  1RDA A;  1EET A;  1NOZ A;  1QE1 A;  3ZSV A;  3ZT4 A;  1L3V A;  2D5R A;  1EXQ A;  4FLU A;  1JLA A;  3NGZ A;  1WLJ A;  2VWK A;  4DSF A;  1WAF A;  4B9L A;  1C1A A;  2IAJ A;  1QTM A;  3TR8 A;  2G8W A;  1CXQ A;  4FJM A;  1EX4 A;  3CM5 A;  1VSE A;  3JSM A;  2HMI A;  1LAV A;  1RDD A;  2P5O A;  3NCI A;  3NH2 A;  1JLF A;  3PX6 A;  3WNE A;  4OJR A;  1NOY A;  4K8X A;  3ZSW A;  3ZSZ A;  1XHZ A;  5CZ1 A;  1NK5 A;  4J2E A;  3OYD A;  3DYA A;  4KHY A;  1ZBI A;  1SKW A;  4IDK A;  1LWF A;  3NF6 A;  1KLN A;  4FJJ A;  2AJQ A;  4JLH A;  3AVG A;  3OJS A;  1IH7 A;  4KTW A;  4CFA A;  3NBP A;  3DLH A;  4PQU A;  4EP4 A;  1KRP A;  2HVH A;  1QSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...