4KTZA

Lactococcus phage 67 ruvc
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
160
structure length
160
Chain Sequence
MKKILAINFSTASKKGEGTGYAFRKDGQVYVGSIKAYNPKKTAWERTFDIVNAIKDIIDEFDLKGYHLAIETPIMGRNRKHSITLANCNGYFIGAIDGLVNGYTFIDNSKWCSYHLISGKREQRKEESLELLKATGLVDSNCKDDNIADAYNILTYCEHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutants of phage bIL67 RuvC with enhanced Holliday junction binding selectivity and resolution symmetry.
pubmed doi rcsb
source organism Lactococcus phage bil67
molecule tags Hydrolase
molecule keywords RuvC endonuclease
total genus 57
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07066 DUF3882 Lactococcus phage M3 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ktzA00
1UWBA 3WNGA 1WN7A 3M8QA 2HNYA 3S3OA 3L2QA 4JS4A 4DSEA 4AHSA 4CGGA 4ZHRA 3QEPA 3TAPA 4N41A 4FJKA 1LAVA 1HPZA 3HSTB 4J2EA 1WSFA 3K5LA 3NAEA 2X6NA 2PZSA 3PX6A 5C25A 1TK8A 3CM5A 5KRTA 4K8XA 3RMDA 4PY5A 4EP5A 3CYMA 3C6TA 4CJPA 3L2RA 4BACA 3MXMA 2NUBA 3O4NA 1UA1A 3BDPA 4W5QA 3EZ5A 2PYJA 1GOAA 3AVAA 2A1RA 1HYSA 1EX4A 2W42A 4BE2A 3S3MA 3V81A 5J2NA 2BGGA 3QERA 1S6QA 1BQNA 2ETJA 3QIOA 5KRSA 4HUFA 1JLGA 4B9TA 3CM6A 4HCBA 4CJRA 1RT6A 1T03A 2QKKA 4B8CA 5C42A 4CJLA 1TKXA 3V1QA 1RDDA 1ASWA 1C0MA 1GOCA 2DFEA 1LW2A 4DLGA 1JL1A 3RMCA 3TARA 4B9VA 4IKFA 2O4IA 4KI4A 4CJ5A 2VWKA 4DTXA 3V1OA 1DLOA 4EZ6A 1ZBLA 4BWMA 3TI0A 2GV9A 3PO4A 1RDCA 3SUNA 1L3VA 3RMAA 1A5XA 3NF8A 1QE1A 4B9MA 4DQIA 3ZT0A 4JRPA 3HP9A 4DTSA 5D3GA 1RCHA 4I7FA 5HLFA 1NJZA 3HO1A 4C8NA 3AVGA 3SV3A 4Z4GA 1HYVA 4LH4A 4NYNA 2KQ2A 3V9WA 2G8IA 4DMNA 4AHCA 5HBMA 4HUEA 4E7KA 3DOKA 3HPHA 4RW6A 3THVA 1NKCA 1Q9YA 1N5YA 2KFNA 1S6PA 1VSIA 1WNSA 2OPSA 4B3OA 4DF4A 3D45A 1BHLA 3LWLA 4FJ8A 4M3XA 5KGWA 2IGIA 1TGOA 4CJVA 1SL0A 1ZBHA 2QKBA 4KKOA 3QNOA 3I8DA 3AO4A 2OZMA 1LV5A 3KTQA 1RBSA 2D0AA 3LAMA 3AO1A 4F2RA 3V9XA 3ZSRA 2D0BA 1RT1A 4I9QA 3NH0A 4CF9A 4O0IA 2OZSA 2F8TA 4OKKA 3S3NA 1KLNA 3RR8A 3SJJA 2YNHA 4GW6A 3OJSA 1SL1A 3V9UA 4FK0A 4M3WA 4DTNA 4CCHA 1A5WA 4O44A 1KRPA 4PA1A 4CK3A 4E19A 1NOZA 4BE1A 2A1SA 1I3AA 2E6MA 3M8PA 4CHNA 1NK4A 4L8RB 4FYDA 2HHSA 1RT3A 1BIUA 1W9HA 3QNNA 1LW0A 1IKYA 3P1GA 5FROA 3QIPA 4AHUA 1IO2A 4FJJA 3PY8A 2F8SA 4QOZB 1XHZA 3VQDA 4XIUA 1JLQA 3FFIA 3QLHA 4CJTA 1UOCA 3MEGA 1RBTA 4BDYA 4FW2A 1D9DA 4N5SA 4E7IA 4DFPA 2BDPA 3PX0A 5JS2A 3ITHA 1JXBA 1REVA 1CZBA 2RN2A 4CJEA 3KLEA 3HL8A 4DU4A 2BANA 3IG1A 2B4JA 2OPPA 5HRPA 1R0AA 1TKZA 4ELTA 4O5BA 4EZ9A 3AVCA 2Z1GA 4FJ5A 1L3TA 1RTDA 2AJQA 3OYNA 2FBVA 1F21A 2YHBA 1BCMA 4OKEA 3VN5A 1BI4B 3OYDA 3L2WA 3TAFA 1HRHA 4NCAA 1YVUA 4HTUA 2YKNA 4YNQA 3KIOA 3ZSOA 2B5JA 4AHRA 2I5JA 1J54A 1D5AA 3NF9A 3OY9A 3KLFA 1KSPA 2G8UA 1T7PA 4KHUA 4LH5A 4CF0A 4Z4HA 1QHTA 3QEWA 4OVLA 2HB5A 1BQMA 4YFUA 3LWMA 3NGIA 4AH9A 1C1AA 4KO0A 1WSIA 1IKXA 4HVJA 1ZBUA 4CFDA 4M3YA 3VQ5A 1S1VA 2FBYA 3ZCMA 3U3GA 3OYEA 3KK2A 3SUQA 1KVBA 3BGRA 5K14A 4CIGA 1JLFA 1SUQA 1NK9A 1TKTA 4TSXA 4JLHA 4J2DA 3WNFA 3QO9A 4DU1A 3TR8A 3ZSYA 4CK1A 4IBNA 1KVCA 3RWUA 2YNGA 1WSHA 3O3GA 5CZ1A 5DK5A 4PWDA 3LP0A 4KRFA 3P83D 2DFHA 4E1NA 3I0SA 3K58A 3AVIA 3LDSA 3AV9A 4N56A 1WSJA 4M3ZA 1QS4A 1Z26A 4DTMA 2HNDA 1KFDA 2HHTA 3DLEA 3OYBA 1J9AA 4QAGA 1S1XA 4CEZA 3CQ8A 1WAFA 1BI4A 1FK9A 2IC3A 4FVMA 5DMRA 4CECA 4G1QA 1VRUA 4I2PA 2P5OA 3OVNA 1S1TA 3NCIA 3ASMA 4CGDA 3NH2A 1JLAA 4Y1CA 3QESA 3M8SA 4BDPA 4FK4A 3VQAA 4KPYA 3NGZA 4J2AA 4PUOA 4KV8A 1EXQA 3AA3A 1BCOA 4C8MA 4KHSA 1O1WA 2HVHA 4IG3A 2FC0A 1C1CA 4IFYA 3V4IA 1ZBFA 4LD0A 3ZT3A 3ZSVA 4FZXC 1JL2A 1A5VA 2GBZA 3C94A 2XO7A 4E7HA 3AVFA 1SV5A 4FJ9A 4M3TA 4FM2A 5I42A 3SNNA 3QEXA 2XY5A 3D0PA 4DG1A 4E3SA 4GMJB 4KHNA 2OPQA 3ZT1A 5E41A 2D0CA 2P51A 1YTAA 1HYZA 4W5TA 4DWIA 1LWCA 4HHTA 4DTPA 5JS1A 1RT2A 3PO5A 3RRGA 2ITGA 1EKEA 3JYTA 1WSEA 3HVTA 4OGEA 3EYZA 4FLXA 4DTJA 4O4GA 4Z4FA 4CJUA 1X9MA 1LAWA 1RILA 3TAEA 2HHUA 4IDKA 1QSLA 1DTQA 4CF8A 4RW7A 4F3OA 1U04A 3RTVA 4O55A 4B9UA 1KCFA 4IG0A 4CJ3A 4CEFA 1VSJA 3K2PA 3MEEA 1VSEA 1S1WA 3WNHA 4J2BA 1KVAA 3LP1A 4IFVA 5FDLA 1FKPA 4DQQA 4LY7A 4M3RA 3C95A 4BDZA 2WONA 3L3VA 1HQEA 4C8LA 1NOYA 1ZBIA 1BGXT 3PUFA 3AO2A 4FJNA 3P5JA 2EHGA 4B08A 3MXIA 1XI1A 1B9FA 4FZYA 4CHOA 2JGUA 3HVRA 2P5GA 1CZ9A 3HPGA 3KKSA 3OYHA 3KLGA 4ID1A 1U45A 4W5RA 3SV4A 3HPOA 3L3UA 1RNHA 3LAKA 3NBPA 2OYQA 3QINA 4RW8A 4Z4IA 2DTUA 4NCBA 1VSLA 2O4GA 1WAJA 3KKRA 4NYFA 4CF1A 3L8BA 4CJWA 3SQ1A 3U3YA 4KREA 3QEVA 1LWFA 2KZZA 3KJVA 3NDKA 4W5NA 1TL1A 3RRHA 1RBVA 3RMBA 1RT5A 3SQ2A 1G15A 3DRPA 4OPJA 1XC9A 1CXQA 2OA8A 2QK9A 1IG9A 4DSFA 1DTTA 1Y97A 3LP2A 1S1UA 1VK0A 2ZE2A 1B92A 1TV6A 4M41A 3B6OA 1NK5A 3ZT2A 2KTQA 2HHWA 1X1PA 2RPIA 3T3FA 1EP4A 4CIFA 1TL3A 3F73A 3U6FA 4F2SA 3LANA 3OYMA 1VSKA 1X9WA 4CEOA 3NHGA 4M45A 4JS5A 1TAUA 1JKHA 3AO5A 3SQ0A 4FLUA 2ZD1A 3DRRA 2VG6A 4R5PA 2OPRA 4OLBA 4DTOA 1JLCA 1C0TA 1TVRA 4DSIA 4F8RA 5EU7A 4N47A 4FLTA 3QETA 4DTRA 2VG5A 4QCLA 1IKWA 1L3UA 4ELUA 3DI6A 4B9SA 4DSLA 5I3UA 3T1AA 1C6VA 1J5OA 3AVHA 4DFMA 4CE9A 4CEEA 4GVMA 1HNIA 4CFAA 4MQ3A 3K57A 2XY8A 4H8KA 1RDAA 4B8AB 3PV8A 3C6UA 2VWJA 2LSNA 3MECA 1HJRA 1JLEA 3SQ4A 3OS1A 3SUOA 1RTJA 4C8KA 3TABA 3KD5E 3AVBA 3DYAA 5FRMA 4CIEA 4KHQA 3VQ6A 1TK5A 1JLBA 1SKRA 3KK1A 2PYLA 3TAMA 1L5UA 3OYAA 3T19A 2XY6A 3VQQA 4K8ZA 4ICLA 3IRXA 4RG8A 4Q0BA 1BIZA 1QSYA 3DM2A 2YV0X 4CEAA 4KB1A 4CGJA 2WOMA 2FBTA 4CEBA 4DLEA 2BE2A 2Y1IA 1L3SA 2DY4A 5CZ2A 5T7BA 4H4MA 4O0JA 3VQ7A 4EP4A 3NE6A 4FM0A 3AA5X 4KTWA 1MU2A 3UIQA 1KFSA 2Z1JA 3DOLA 2X78A 3TANA 4KB0A 3HK2A 4H4OA 2E4LA 5HROA 3O4QA 4CJSA 1CLQA 4NCGA 4FLZA 1C0UA 3DRSA 3AVKA 2XHBA 1ASUA 4N76A 1XWLA 3LPUA 2JLEA 4DTUA 2HMIA 1HMVA 3JSMA 3TAGA 4F4KA 1RTHA 5CY4A 3OYKA 2ZQBA 3NGYA 2YNFA 1FKOA 4WE1A 4JRQA 3M8RA 3S9HA 1XHXA 3A2FA 4LSLA 1TK0A 4CJFA 2VG7A 3DLKA 3NF6A 3AA2A 4CHYA 3AVLA 5SWMA 1VSHA 5CYMA 1Q9XA 4DF8A 2D5RA 1NJWA 2IDOA 3G0ZA 1J53A 4CJ4A 3F9KA 3VQCA 3WNEA 2XY7A 5HRRA 2G8HA 1S9GA 3EY1A 3V9SA 3DLGA 4CEQA 3VQBA 2Y1JA 1ZYQA 1NJXA 4M3UA 3KK3A 3KD1E 3DMJA 4CF2A 1VSDA 3KLIA 2Q3SA 1QSSA 4B9NA 4DS5A 4ZTFA 2EX3A 3K5OA 3OJUA 4Q5VA 5HRSA 3TWHA 3TAQA 1YT3A 3B6PA 1N6QA 1QTMA 4KI6A 4FJMA 4CGIA 2P1JA 1I39A 3H08A 4AHTA 4CFBA 1KLMA 1SKSA 1NK8A 1RBUA 1SKWA 4Z4EA 1HQUA 3L2UA 4CGHA 3OS2A 3LPTA 4KHYA 4DSJA 4FJXA 2G8WA 2IOCA 3MXJA 3HXMA 1VSMA 2KFZA 3NF7A 3ISNC 3SPZA 1KTQA 3QEIA 2IS3A 4CHQA 3K5MA 3ZSXA 4CEDA 3SI6A 3L2VA 1NKEA 4FW1A 3O3FA 4DU3A 3LALA 3DLHA 4FJHA 4PQUA 3MAQA 1D9FA 3KLHA 2YNIA 4FJIA 1IH7A 2B6AA 4E7JA 1SL2A 3VQ8A 4FLVA 3V1RA 5FRNA 1YTUA 4ID5A 2E6LA 3CFOA 5SZTA 1NKBA 1IKVA 2RF2A 3VQ4A 3DLBA 1LWEA 3ZT4A 4CJQA 3OYGA 4AHVA 3OYLA 1K6YA 4LSNA 3OYCA 2KW4A 2G8FA 2G8KA 4I2QA 3LZIA 5KGXA 3IS9A 4DFKA 4AILC 3SUPA 4FZZA 4Z0UA 3ZSWA 5CYQA 4CK2A 4Z4CA 4FCYA 5C24A 4BWJA 4DSKA 4HCCA 2HHVA 2KZMA 4E89A 3OYFA 2HHQA 2HW3A 3CFRA 3NFAA 4RW4A 1RTIA 3LZJA 3AO3A 4FM1A 4BE0A 4OKJA 4DQPA 4CFCA 3HP6A 2X6SA 4OLAA 2YKMA 3AVJA 3O3HA 4M42A 1QQCA 2X74A 4CESA 3HT3A 3ALYA 5J2MA 1W0HA 1Q8IA 1WSGA 4OGCA 3SZ2A 4ZTJA 1X9SA 3RR7A 4FK2A 1ASVA 1S9EA 1UAXA 3OYJA 4KHWA 3VA3A 4OJRA 1JXEA 1NJYA 1TAQA 2FBXA 2G8VA 4CERA 4HUGA 4CHPA 2RKIA 1CXUA 4E7LA 3SCXA 1UA0A 1VSFA 3ULDA 2PY5A 4CHZA 1BISA 3K5NA 2QXFA 4FJ7A 3HJFA 3AA4A 4UQGA 1RBRA 1U4BA 2HNZA 4FLYA 1RT7A 3CG7A 3LP3A 1D8YA 3V6DA 3G10A 4C8OA 4ELVA 4KTQA 4Y1DA 3K59A 2Z1HA 2F96A 5J2QA 4KAZA 3I0RA 4KFBA 2YHAA 5KTQA 3NH1A 4FXDA 1FXXA 2GUIA 2DFFA 1RT4A 5J1EA 3E01A 4FJGA 1BL3A 1RDBA 4W5OA 3ZSQA 5HRNA 5KI6A 2R7YA 4FLWA 3CFPA 2Z1IA 1NK0A 4F3TA 1U48A 2XRIA 3V9ZA 3SPYA 2HVIA 2HHXA 2ATQA 1Z25A 3OS0A 3PX4A 3VQ9A 1VRTA 1GOBA 1T05A 1WLJA 1ITGA 1C1BA 3AVNA 4MFBA 1NK6A 1B9DA 4FJLA 1U47A 3VQPA 4KTZA 4DQSA 1EETA 4OPKA 5J2PA 4CJKA 4CGFA 4B9LA 3AVMA 4DS4A 3MEDA 4DQRA 3HYFA 3SYZA 3IAYA 4DFJA 4RW9A 1U49A 4E0DA 3HM9A 5HP1A 1HNVA 3OYIA 4I9LA 3VQEA 1S5JA 1NK7A 3ZSZA 4E1MA 1T8EA 2IAJA 3DLRA 1TKDA 3VA0A
chains in the Genus database with same CATH superfamily
1UWBA 3WNGA 3W0LA 4LF9K 2HBKA 3PIPL 2UXBK 4AHSA 2P9PA 3TAPA 4N41A 3HSTB 1YVNA 4FPBA 3RMDA 1VQPN 3C6TA 3L2RA 1HNWK 2NUBA 1UA1A 1T44A 3EZ5A 2F9WA 2A6AA 2W42A 1EWRA 3S3MA 4ILGB 3ZEUB 3D6RA 3HBTA 1BQNA 2ETJA 3OBWA 1Z05A 4A62A 3THYA 4HCBA 1T03A 3V1QA 1RDDA 2DFEA 4IKFA 3D2FB 3TARA 4B9VA 5F2RA 3VENA 4H0XB 3V1OA 1DLOA 1S3XA 4EZ6A 1ZBLA 4BWMA 4I6MB 3TI0A 3SUNA 1QE1A 4H0TB 3HO1A 5D3GA 1DT9A 4GVEA 4K0KK 4KH6A 4NLBA 5AQQA 5GADP 2G8IA 4JI4K 3DOKA 1VQLN 3HPHA 4RW6A 4YDUC 1NKCA 3CC4N 3VERA 1S6PA 1VSIA 4B3OA 2OPSA 5C15A 4DF4A 1VQ8N 4FJ8A 1YI2N 1ZBHA 3QBXA 2GX9A 1LV5A 3QB0A 5KQDA 3GE1A 1ZC6A 3RR8A 5EXWA 1KLNA 3SJJA 4DTNA 3J7AP 4PA1A 4B1YB 4BRFA 1I3AA 1TYQB 3M8PA 4DR2K 4CZKA 5FROA 4GKKK 4DUZK 4FJJA 3PY8A 3MN9A 4BY9C 4AF1A 3MEGA 5AQHA 4E7IA 1J5EK 5CR4A 5C2DA 2BDPA 4IO9L 4G9ZA 1CZBA 2P9UB 4DU4A 4O5BA 4JD2A 2Z1GA 1L3TA 2HBMA 2YHBA 3OYDA 1BI4B 3L2WA 4HTUA 4U7BA 4YNQA 3CJ1A 3ZSOA 4AHRA 2I5JA 3NF9A 1NM1A 2G8UA 5BN9A 4BRNA 2O8CA 4KHUA 3QEWA 3VETA 4XEIA 2HB5A 4YFUA 3NGIA 1ZXOA 4AH9A 2CH6A 2ZGZA 1ZBUA 1S1VA 3VTIA 3SUQA 4CIGA 4DV1K 3D2FA 1SUQA 1NGCA 4TSXA 2H3GX 4JKDA 3TR8A 3GDQA 4Z94A 3O4WA 1QQOA 4I6MA 3O3GA 4PWDA 3LP0A 3ZLJA 3ENOA 3I0SA 5IWAK 4N56A 1QS4A 5BR8K 2HHTA 3DLEA 5GAGP 2QWLA 4CEZA 3VTHA 2HBLA 4G1QA 1N36K 2V7YA 2ZJQL 4QS7A 3M8SA 1VQKN 3S41A 3AA3A 1BCOA 2HVHA 2FC0A 3V4IA 2NRVA 4FZXC 1JL2A 4AM6A 3C94A 2XO7A 1SV5A 3SNNA 4LFAK 5BRHA 2RE2A 4DG1A 3SAFA 4KHNA 5E41A 3ZT1A 2P51A 4DWIA 1LWCA 2P9SB 5JS1A 1T6CA 4OO1J 1WSEA 4OGEA 3EYZA 4FLXA 4DTJA 4Z4FA 4DR1K 2F4VK 4CF8A 2FSJA 4RW7A 1KCFA 4J2BA 1LCUA 4MO5A 4DQQA 4LY7A 2WONA 1SZ2A 3D7EO 4EIAA 3BP8A 3E66A 1NOYA 2YJFA 4IZ9A 1D4XA 3CJ7A 3ZX3A 4IDHA 3QMLA 3MXIA 4BR9A 4FZYA 4CHOA 3HVRA 2P5GA 2VQEK 4JN4A 5MLCQ 2D0PA 1U45A 1NJIO 3H3OB 3NBPA 2OYQA 4NCBA 3KKRA 1N32K 4LFCK 5IT9O 3L8BA 3SQ1A 1S22A 4A5AA 3AAQA 4W5NA 3I8BA 3SK3A 2QK9A 4A2BA 2A5XA 1DTTA 1B92A 2UYTA 5GIPA 2RPIA 4B1UB 4CBUA 3U9ZA 4CIFA 1SAZA 3F73A 3LANA 1OKJA 4JS5A 2E8AA 4FLUA 2ZD1A 3TU5A 2VG6A 4DTOA 4DSIA 1TVRA 3ZETA 4N47A 3ID6A 2VG5A 5GINA 1U2VA 1L3UA 3DI6A 1DEJA 1ZBSA 1BOTO 1C6VA 1IG8A 4CE9A 4CFAA 4CI6A 4HTLA 4C23A 4B8AB 3BF1A 2VWJA 1HJRA 4C1NK 3OS1A 4C8KA 3DYAA 4CIEA 4BC5A 4H5VA 2PYLA 2O8FA 2UUBK 2Q2RA 3O9UA 3VQQA 2QW9A 4NO7A 3QICA 4CEAA 4KB1A 4JD2B 3J7ZO 5T7BA 3DXKA 4KTWA 4JKCA 3G25A 3LDNA 1Q18A 4KB0A 4H4OA 4DR5K 1IBMK 3O4QA 5BR9A 1K8KA 4CJSA 5LJVA 1GLDG 3CXCM 2XHBA 4A59A 2JLEA 4DTUA 5AQTA 4F4KA 2GWJA 5CY4A 2ZQBA 2BH1A 3UKUB 3VOVA 3M8RA 1KQSM 4J8FA 3S9HA 2VQFK 3NF6A 3AA2A 1VSHA 1Q9XA 3P38A 4DF8A 3U8XA 3CCQN 3F9KA 4BR7A 2FF3B 4NB4A 1JCGA 4CEQA 2Y1JA 4GKJK 4FVUA 1QSSA 2P5OA 4DS5A 4ZTFA 2EX3A 2OTLN 1N6QA 3CCSN 4KI6A 3BY5A 2QM1A 4AHTA 4FWPA 1VAZA 2O8CB 3WEEB 2GUPA 3A5NC 5C2FA 1MWKA 5FPNA 4CGHA 3OS2A 3LPTA 3WUHA 1GLCG 2QWNA 1VSMA 3HXMA 3NF7A 3SPZA 4MDBA 3VF2A 4CHQA 3ZSXA 4CEDA 3SI6A 3L2VA 4DU3A 3MMVA 1JCFA 1QVFM 4E7JA 1YUWA 3IFRA 3V1RA 2WC9A 1NKBA 3MX2A 3DLLL 1IKVA 3ULEA 2O8DA 1SS6A 4Y0WA 5F1XA 3MN5A 3D2EA 4IOXA 1IV0A 5FPEA 2G8KA 5CE3A 3EL2A 4AILC 3ZSWA 5C24A 4BWJA 4DSKA 2HW3A 4YOUA 4JYAK 1RTIA 3LZJA 3IMXA 3L6QA 2OTJN 3HP6A 4H0VB 4FWNA 4BG9A 1QQCA 4DCHA 4CESA 5AFUH 2BUPA 3ALYA 1W0HA 1Q8IA 4FK2A 3M3ZA 4MLHA 3OYJA 3VGLA 4KHWA 2FXUA 1MA9B 3CERA 1JXEA 2FBXA 4CERA 4CHPA 4E7LA 3ULDA 4CHZA 1BISA 4FJ7A 4CVNE 4B1XB 1RT7A 5C12A 1D8YA 4KTQA 4JKAA 4KAZA 3K59A 5AQJA 2Z1HA 4K43A 5J2QA 2YHYA 4KFBA 2YHAA 3O9SA 1RT4A 5J1EA 4FJGA 3QBWA 1T3VA 3BZKA 5KI6A 4CZHA 1NK0A 4F3TA 1U48A 2ZJPL 4IO8A 1GOBA 3L0QA 4JHDA 3AVNA 1C1BA 1NK6A 3UKRB 1Q82O 4FJLA 2A42A 3VQPA 5J2PA 3FLCO 1YJNN 4CZLA 5CHIA 4B3SK 5HP1A 1YF5L 4ILJA 1NK7A 4E1MA 1T8EA 1NGIA 1WN7A 3M8QA 2HNYA 4IEEA 5AZIA 4NXMK 2Q0UA 4H5TA 1HKCA 1XUPO 4FJKA 1HPZA 2NRWA 2WFBA 1WSFA 2P9IB 3NAEA 2X6NA 3PX6A 4WYBA 5C25A 1TK8A 2DPNA 5KRTA 3CJCA 4EHTA 3CYMA 4BRLA 3MXMA 4W5QA 1GOAA 1HYSA 2A1RA 4O8UA 5J2NA 4WCEL 1JLGA 3C65A 2QA4N 3CCLN 4CJRA 1RT6A 5C42A 1TKXA 1GOCA 1QQMA 3DJCA 3SMPA 4KI4A 4DTXA 3SAGA 2PBDA 2GV9A 3PO4A 1RDCA 3ENHA 4BG8A 1L3VA 1A5XA 4JRPA 3HP9A 4QS8A 4BQLA 5HLFA 5M1PA 3SV3A 4BR4A 5E84A 2KQ2A 3V9WA 3ATVA 4NXNK 4AHCA 4E7KA 4HUEA 4LF5K 4H0OA 1RGIA 1XNQK 1BG3A 1IJJA 4FSVA 4H5WA 4BVOA 1N5YA 2KFNA 4B9QA 3CETA 1BHLA 2IGIA 1TGOA 1RBSA 3LAMA 2IIRA 3V9XA 1GLLO 2D0BA 1RT1A 4CF9A 2NLXA 2PFUA 2OZSA 3S3NA 3VF4A 1SL1A 3QFUA 4F9OA 2P9KB 4CCHA 1Y64A 1E3MA 1KRPA 1QQNA 4E19A 1NOZA 1NK4A 2HHSA 2OANA 4BGAA 1W9HA 3VEZA 4BROA 1CZAN 2V52B 3QFPA 4XIUA 1JLQA 3M5RA 4BR5A 3FFIA 4CJTA 5LMNK 1UOCA 2O8EA 2O8DB 4BDYA 4FW2A 3H1QA 3WXIA 1M1KO 4ILHA 3WXKA 4LF8K 1R0AA 2O8EB 4EZ9A 2CH5A 3AVCA 1K8AO 4FJ5A 3VESA 1YXQA 1F21A 1RDUA 4KHPK 4WFAL 4CBXA 3KIOA 1NBWA 1KSPA 1J54A 3LM2A 1T7PA 4BC3A 1O13A 4CF0A 4OVLA 1QZ5A 4KO0A 1IKXA 2D0OA 3VEYA 4HVJA 3U3GA 3BGRA 1NK9A 4J2DA 3WNFA 2UUAK 3ZSYA 3I33A 4HWIA 1KVCA 3RWUA 5JVHL 4BRIA 5AQUA 4JNEA 5CZ1A 3DXKB 2J4RA 3LL3A 3LDSA 3AVIA 3AV9A 1WSJA 4DTMA 3CCUN 3OYBA 3CCMN 1J9AA 3A5OC 4FVMA 1BI4A 3G4SN 4CECA 1KAZA 4I2PA 3GG4A 4Y1CA 3CHWA 3MN7A 3QESA 4DR4K 2NRZA 3CCEN 1J6ZA 4KV8A 4JKGA 4IG3A 3NVMA 5DM6L 3ZT3A 3ZSVA 1WBBA 1A5VA 4XH5A 2GBZA 4E7HA 2GEMA 3E9OA 4DV2K 5AQXA 4E3SA 4GMJB 2OPQA 1N33K 4W5TA 1RDWX 1YTAA 3RRGA 2E2PA 4DV6K 1NWKA 4CJUA 2I7NA 4EFHA 1LAWA 4JKBA 2P9SA 4IDKA 1X9JA 1U04A 4DV4K 4JHDB 4IG0A 2FLOA 3MEEA 3NVKA 3GL1A 3WNHA 2HF4A 1KVAA 3LP1A 4IFVA 5FDLA 3FR0A 3MDQA 5EOYA 3A5MC 1HQEA 4C8LA 1ZBIA 3U4LA 1OH8A 1OH7A 3AO2A 4B08A 5TKYA 3OYHA 3KLGA 2YI1A 4W5RA 3SV4A 3HPOA 2QTDA 3L3UA 1RNHA 1VSLA 2O4GA 2GWKA 1LWFA 3KJVA 1TL1A 1RBVA 1RT5A 1G15A 4CJ7A 1CXQA 4DR3K 4RTFD 1IG9A 4JKFA 1X3MA 1Y97A 3GOIA 4O5FA 1N34K 1VK0A 5AQWA 4JI5K 2EWSA 4M41A 2WTUA 4FWMA 3ZT2A 1NK5A 5DM7L 4PHTX 3T3FA 2Q31A 4F2SA 3OYMA 1VSKA 4M45A 3J81O 1TAUA 1JKHA 2QEXN 4R5PA 4XH4A 4FLTA 1IKWA 4FOIA 4ELUA 2VWBA 4YOYA 3AVHA 4DFMA 2CGJA 1HNIA 3CCJN 3EN9A 4H8KA 3O08A 4WFBL 3C6UA 3THWA 3MECA 1JLEA 4C1NI 3SUOA 3VEVA 3TABA 5FRMA 4IJNA 1OVQA 1L5UA 4CZJA 1V4TA 2IVOA 4MO4A 3TTCA 2XY6A 5AQYA 5BREA 4Q0BA 1QSYA 3DM2A 2WOMA 3JXUA 2BE2A 2Y1IA 4DR6K 2DY4A 5CZ2A 3AGRA 4H4MA 3VQ7A 4DV0K 4FM0A 3BZCA 1W97L 3AA5X 5M1QA 3UIQA 5GAHP 1VQMN 3SBTA 3TANA 5HROA 1HJOA 1CLQA 4K25A 4NCGA 1E4GT 3CIPA 1TYQA 3OW2M 3AVKA 2NRTA 1ASUA 3LPUA 4ISFA 3W3DA 3DWLA 1WOQA 4ISGA 5KPTA 5JMVA 1C0FA 2GTDA 3A2FA 4LSLA 2F8TA 3DLKA 4CHYA 5SWMA 3AVLA 5CYMA 4JI7K 3C6HA 3C6AA 3CF5L 1NJWA 3CJBA 3VQCA 4LF4K 3T1HK 2XY7A 1W7AA 3V9SA 3J7YP 3VQBA 1ZYQA 1NJXA 4M3UA 3C7NA 3DMJA 1VSDA 1X3NA 4YDUA 2Q3SA 4K42A 4B9NA 3K5OA 2P9LB 2ZM6K 2HBJA 4CGIA 1I39A 1KLMA 3KZBA 3WXMB 3L2UA 3LM9A 4E1JA 4KHYA 5AQKA 2G8WA 2HF3A 4YHHK 2P9KA 2KFZA 4K41A 4GV9A 5AZJA 2KHOA 2IS3A 4DB3A 3P39A 3A0IX 4PQUA 2UUCK 3F2KA 3VGMA 3KLHA 2B6AA 1SL2A 3VQ8A 4FLVA 3O1BA 2E1YA 2RF2A 3VQ4A 1YITN 3ZT4A 4CJQA 4GNIA 3OYGA 4AHVA 1MWMA 4WQ5A 5AZIB 3OYCA 2G8FA 3TTDA 5KGXA 4DFKA 4Z0UA 2HHVA 4Z4CA 4HCCA 2KZMA 4E89A 4QS9A 2NZTA 4BE0A 4OKJA 3FZKA 4OLAA 1XNRK 3O3HA 3H45C 2X74A 2UXCK 4ZTJA 2HHXA 5J2MA 5I9EB 5AQSA 2HSTA 3FZFA 2Q1NA 5EVZA 1NJYA 2G8VA 4DQ8A 1CXUA 3I56N 3PIOL 2QXFA 3K5NA 2D4WA 2HNZA 3WQTA 3V6DA 2F96A 4M63C 3I0RA 3NH1A 2GUIA 2IVPA 2W41A 2Z1IA 2XRIA 3SPYA 2HVIA 1NG9A 2ATQA 5C0YA 3VQ9A 3E9LA 2UU9K 1WLJA 4MFBA 1KXPA 5C10A 1B9DA 1HUXA 1U47A 4KTZA 1EETA 3AY9A 4CJKA 4CGFA 4B9LA 3AVMA 4IFEA 3HYFA 1QVGM 3IAYA 4KBOA 4DFJA 1U49A 4FOEA 3WQUA 3ZSZA 1TKDA 1S72N 3QDKA 1VQ5N 4RCHA 2VCPA 3MCAB 2QI2A 1YJWN 4JS4A 3L4IA 4CGGA 1R59O 4ZHRA 3QEPA 3VEOA 2PZSA 1FW6A 3FZHA 4K8XA 4PY5A 4EP5A 3I55N 3R3LA 4CJPA 4BACA 3O4NA 3R6MA 3JAMO 2WUSA 5ADXH 3AVAA 4XH1A 1EO1A 1EX4A 4R79A 4BE2A 1OVYA 2F7TA 1YHQN 5JLFA 3QERA 2ZGYA 5JVGL 1S6QA 1FJGK 3QIOA 4B9TA 2UXDK 4CJLA 1U6ZA 5LL6Z 4YORA 1NNEA 4BRHA 4CJ5A 4CZEA 1NLVA 3CC2N 2P9PB 4B9MA 4DQIA 3ZT0A 4KH5A 1EWQA 3LDQA 1RCHA 4I7FA 2P9IA 3VMFB 4C8NA 4JI1K 2QXLA 2E2QA 3M1FA 4DMNA 5HBMA 1W2BM 3CI5A 1VHXA 2YHWA 3THVA 1Q9YA 1WNSA 4WQ4C 3LWLA 2QKBA 4M3XA 1SL0A 3LDPA 4KKOA 3QNOA 3EZWA 4BRDA 4F2RA 1ILYA 4JK7A 2YNHA 3OJSA 3V9UA 4FK0A 4M3WA 4JI2K 3TTFA 2YHXA 4IOCL 1A5WA 4CK3A 4JK8A 4BE1A 2QWOA 3K9JA 4CHNA 4FYDA 3QNNA 1LW0A 1IKYA 3P1GA 3QIPA 1IO2A 4QOZB 1P8ZA 1VQ9N 3VQDA 3H1VX 3OTOK 3NMUA 3WXJA 2AA4A 5HL7L 4BR2A 4MDAA 2E88A 5JS2A 1REVA 4CJEA 3KLEA 2ASMA 2BANA 5HRPA 1P90A 2NRXA 1RTDA 2AJQA 3OYNA 2FBVA 3A5LC 3TAFA 1BCMA 3VN5A 1HRHA 1NU0A 2VGNA 4NCAA 3LDLA 3G6EN 2B5JA 5ELZA 3R9PA 1HNZK 3OY9A 3SJHA 4Z4HA 3CMAN 3OBYA 1DGKN 1C1AA 1WSIA 4JV5K 4CFDA 4M3YA 2FBYA 3GBTA 5K14A 1JLFA 1WUAA 4JLHA 5BN8A 2YNGA 5KPRA 1WSHA 4KRFA 1GLAG 1OH6A 3K58A 1Z26A 1KFDA 4DUYK 4DV3K 2HOEA 3CQ8A 5DMRA 3KWGA 5AQIA 1VRUA 3OVNA 3ASMA 4CGDA 3NH2A 1JLAA 3EKUA 1BA1A 4BDPA 4FK4A 4KPYA 3NGZA 1Q81O 4PUOA 1EXQA 3O9QA 1GLJO 4IFYA 1Q7YO 4LD0A 1NGJA 1IBKK 3WT0A 3L4QA 4FJ9A 4FM2A 2O8BA 1QHAA 4CZMA 1M90O 3CCRN 2P9UA 5AQRA 3HZ6A 1HKBA 3CQXA 1RT2A 5TKWA 3PO5A 2ITGA 3JYTA 4L3QA 4O4GA 1QZ6A 4PKGA 5M1NA 4DR7K 1DTQA 3RTVA 3LDOA 4CJ3A 3CD6N 4CEFA 1VSJA 3K2PA 1VSEA 4MLEA 5AZJB 1FKPA 3C95A 3L3VA 3VGKA 1WBDA 3K0SA 3VEWA 3PUFA 4FJNA 2QWPA 2EHGA 2JGUA 4WQ5C 3HPGA 3KKSA 1JJ2M 2E5LK 3ULEB 3LAKA 4H0YB 4Z4IA 3QINA 1VQ6N 1WAJA 4CF1A 4CD3A 3D2EB 1XQSC 4KREA 3QEVA 2KZZA 4ISEA 3NDKA 3RMBA 3H46O 3SQ2A 1XC9A 5AJ3K 4IJAA 4LC9B 4DV5K 3LP2A 5M1OA 3UB5A 4PKHA 2ZE2A 3M6GA 5AQPA 2HHWA 3AAPA 1EP4A 1TL3A 3UE5A 4CEOA 5AFUA 5AR0A 3AO5A 3SQ0A 3DRRA 3P31A 2OPRA 1JLCA 3QETA 4DTRA 3O80A 1NGDA 4QCLA 3O5BA 4BC4A 5I3UA 3T1AA 1J5OA 4CEEA 4X65K 4BC2A 5AQLA 4MQ3A 3DXMA 3UKUA 2LSNA 3THYB 1YIJN 3CQYA 3KD5E 2E1ZA 5EY4A 4KHQA 1JLBA 1SKRA 1GLFO 3KK1A 2QWMA 3TAMA 4JK9A 2W40A 3T19A 4K8ZA 4ICLA 3IRXA 2YV0X 4CGJA 4DLEA 1L3SA 4EP4A 4OPAA 3FE1A 1IBLK 3ZETB 4JKGB 2X78A 1V4SA 3HK2A 4FLZA 5BRFA 3DRSA 3CCVN 4H5NA 2W6LA 1YAGA 2HMIA 1HMVA 3JSMA 1RTHA 2YNFA 3WXLA 4JRQA 4CD1A 1XHXA 3G71N 4CJFA 2VG7A 3CPEA 4H0PA 2D5RA 2IDOA 4CJ4A 4JI3K 5HRRA 2G8HA 1S9GA 3EY1A 4OX9K 1XMOK 4PL7A 3ZX0A 3THXA 3KD1E 4CF2A 2VGMA 3OJUA 4Q5VA 5HRSA 3TAQA 3B6PA 3ATUA 4AM7A 4FJMA 2P1JA 3H08A 4CFBA 2ASPA 4RWTA 1NK8A 1NGFA 1HLUA 3MX5A 3IUCA 3MXJA 4B1ZA 4PL8A 3QEIA 3K5MA 3O3FA 3DLHA 3LALA 1D9FA 4YY3K 2YNIA 4DKWA 5JLHA 3THWB 4JI6K 5FRNA 3CFOA 5E26A 5SZTA 2HHHK 1VQ4N 2GELA 3OYLA 1K6YA 4LSNA 3A8YA 2KW4A 3C7NB 4I2QA 1VQON 3IS9A 2P9LA 1TUUA 5M1FA 3BF3A 4CK2A 1I94K 3OYFA 4GV6A 4FM1A 2A3ZA 2YKMA 3AVJA 2FF6A 4O8KA 1BA0A 2AP1A 1WSGA 3RR7A 1S9EA 3OA9A 4OJRA 4B1VA 2OCEA 1TAQA 3C0BA 4HUGA 3SCXA 2RKIA 2PY5A 4WF9L 3CJAA 2FSNA 3AA4A 4FLYA 4C8OA 3G10A 4FXDA 5KTQA 5BPLA 4GY2B 1BL3A 1RDBA 4W5OA 5HRNA 2R7YA 3CFPA 3V9ZA 1VQNN 3OS0A 3PX4A 3E9PA 2V7ZA 1NGGA 3N4PA 1Z6RA 3VEXA 4DQSA 3TSUA 3ID8A 4OPKA 4PKIA 1ATRA 4DQRA 3SYZA 1HNVA 3OYIA 4I9LA 4UY8O 4DHYA 1S5JA 3F5TA 3DLRA 3HOSA 4A57A 1GLEG 1NGEA 3VA0A 1KAXA 3S3OA 3L2QA 4DSEA 5BRDA 3J8AA 4A61A 1LAVA 4J2EA 4YOVA 3K5LA 3BUZB 3CM5A 2HMPA 1BO5O 1K73O 3BDPA 2PYJA 4X64K 4YOWA 2FSKA 4H03B 3V81A 2BGGA 3CPWM 4H5RA 5KRSA 4HUFA 4BRQA 3CM6A 2KLAA 3FZMA 2QKKA 4B8CA 3WEEA 3EEQA 1U2VB 1ASWA 1C0MA 4DLGA 1LW2A 3RMCA 1JL1A 2O4IA 2VWKA 3P4IA 1VQ7N 4JKEA 3ZYYX 2YJEA 3HI0A 3RMAA 3NF8A 3EE8A 3KHYA 3KK7A 4DTSA 3T7ZA 1NJZA 4CZIA 3AVGA 4Z4GA 1HYVA 4LH4A 4NYNA 1ATNA 4BREA 2NRRA 3ENBA 2O8FB 4KH4A 4X66K 3O9RA 4JKHA 1ESVA 3TSQA 3E1YA 3EKSA 3EE9A 4IXCA 3D45A 5KGWA 4CJVA 3I8DA 3AO4A 1XC3A 3KTQA 2OZMA 2D0AA 3AO1A 5M1KA 3ZSRA 4BGBA 3NH0A 2E2NA 4O0IA 4I9QA 4OKKA 4FWLA 4IWVA 4IEIA 4GW6A 3VPZA 1KAYA 3O6WA 4O44A 3PSFA 2A1SA 2E6MA 4L8RB 1RT3A 1BIUA 1NMDA 4B1WB 4FWSA 4FPAA 4AHUA 5LY3A 1YJ9N 2F8SA 4FWQA 1XHZA 2QWQA 3FFKB 3QLHA 1SQKA 5ADXA 3CJ9A 4FWRA 1RBTA 1D9DA 4N5SA 4DFPA 3PX0A 5KQ8A 3ITHA 1JXBA 2RN2A 4OPHA 3HL8A 4ELTA 3IG1A 3R8EA 2B4JA 2OPPA 1TKZA 2P9NA 3TPQA 4OKEA 1NGAA 4BRKA 1YVUA 2YKNA 4BRPA 3R1XA 3Q7CA 1D5AA 3KLFA 3JS6A 4LH5A 1QHTA 3TSPA 3PSIA 3EO3A 1BQMA 3LWMA 5FLXO 4BRAA 3VQ5A 3ZCMA 3KK2A 5B8HA 3OYEA 1KVBA 1TKTA 4DU1A 3QO9A 4CK1A 4FO0A 1NMNA 1RFQA 4IBNA 2A40A 1OH5A 1BUPA 3SLCA 1LOTB 5DK5A 5KPZA 3P83D 1MDUB 2DFHA 4E1NA 3CC7N 2PAVA 4M3ZA 1HX1A 2HNDA 4QAGA 1S1XA 1WAFA 1FK9A 2IC3A 3O1WA 4LF7K 2YCHA 3MCPA 1S1TA 3NCIA 3Q7BA 3VQAA 4J2AA 4C8MA 4KHSA 1O1WA 1C1CA 2IVNA 4GV3A 1ZBFA 4V19S 3T1YK 3SBGA 3MN6A 4WQ4A 3AVFA 4M3TA 5I42A 3QEXA 2XY5A 3D0PA 5AQGA 1XMQK 4B3MK 5F0XA 2D0CA 1HYZA 5JICA 5HOOA 4HHTA 4DTPA 5AQMA 4X62K 1EKEA 3HVTA 1C0GA 4A5BA 1X9MA 1RILA 2HHUA 3TAEA 1QSLA 5LMUK 5AQVA 4F3OA 1TUYA 4O55A 4B9UA 1HPMA 4JEPA 1S1WA 3HTVA 2KKZA 3H6EA 3RSEA 4CBWA 3ZEUA 4M3RA 4BDZA 1BGXT 3CMEN 5AQFA 3P5JA 3O8MA 1XI1A 1G99A 1B9FA 3U9DA 1CZ9A 1N8RO 3RVCA 4ID1A 4EAHD 4NLCA 4FWKA 3SAHA 4M7XA 3AARA 4RW8A 2DTUA 4NYFA 4CJWA 3U3YA 5LJWA 3RRHA 4B3RK 3DRPA 4OPJA 2OA8A 3K9KA 4DSFA 1H1VA 1S1UA 1TV6A 1HR0K 3B6OA 4BVPA 2KTQA 1X1PA 2ASOA 2ZWHA 2CGLA 3U6FA 3MWPA 1X9WA 3NHGA 4BRMA 5GAEP 5FPDA 4OLBA 1C0TA 4F8RA 5EU7A 4B9SA 4DSLA 4GVMA 3T69A 4CZFA 3K57A 2XY8A 3PV8A 1RDAA 4U67L 4CW7B 1BWFO 3SQ4A 1RTJA 3AVBA 2O8BB 3VQ6A 2Q36A 1TK5A 1DKGD 1T6DA 3OYAA 3B8AX 3F9MA 5H1SQ 4RG8A 1BIZA 1WB9A 3ZX2A 5AQNA 5A2QO 2FBTA 4CEBA 1Q86O 3NE6A 3HM8A 4O0JA 4YOXA 1HNXK 2E20A 1MU2A 2V51B 2VYPA 1KFSA 2Z1JA 3DOLA 2E4LA 3RSEB 5GIOA 5EX5A 4BRCA 1C0UA 3BEXA 4N76A 1XWLA 3DXMB 3TAGA 2A41A 3OYKA 3NGYA 4WE1A 1FKOA 3HSCA 2Q0RA 1TK0A 1NGBA 2NRHA 3G0ZA 1J53A 4B3TK 3WNEA 2NNWA 2P9NB 2D1KA 4JI0K 3DLGA 4JAXA 3KK3A 4JI8K 3KLIA 4DV7K 3TWHA 1QTMA 1YT3A 4IOAL 4A2AA 1SKSA 1SKWA 1RBUA 4Z4EA 1HQUA 1KD1O 2CGKA 4DSJA 4FJXA 1BU6O 2E2OA 2IOCA 1NGHA 3ISNC 4M7YA 1KTQA 2Q97A 1NKEA 5BPNA 1EQYA 4FW1A 4FJHA 3MAQA 2YX6A 4FJIA 2RHKA 1IH7A 5BPMA 1YTUA 3DAWA 4ID5A 2E6LA 3N4QA 3DLBA 1LWEA 4BRGA 3KVGA 3H3NO 3HRGA 4EHUA 3THXB 3LZIA 3J80O 1K9MO 1KC8O 1HKGA 3SUPA 1GLBG 4FZZA 5CYQA 4FCYA 2HHQA 3CFRA 3NFAA 4RW4A 1ATSA 3AO3A 3AGKA 5AQOA 4DQPA 4CFCA 2X6SA 4FL9A 4M42A 1E4FT 3MWTA 3HT3A 4OGCA 3SZ2A 1X9SA 3HOTA 5AQZA 1ASVA 1UAXA 3VA3A 2ZJRL 2WBNA 5FPMA 2I7PA 4LF6K 2F9TA 1UA0A 3OHRA 2JWLA 1VSFA 4LFBK 4FWOA 2ZF5O 3HJFA 4UQGA 1RBRA 1U4BA 2BTFA 3CG7A 3LP3A 1JCEA 4ELVA 4CZGA 4WFNL 4Y1DA 3SMSA 4YOTA 3FGUA 2W6KA 1FXXA 2DFFA 3E01A 3O9TA 4BR0A 3MK6A 4BQZA 3ZSQA 4FLWA 1BDGA 3UKRA 1Z25A 1VRTA 1T05A 1ITGA 2JWKA 2ITMA 3PLAA 2QWRA 3IDHA 4DS4A 3MEDA 4RW9A 3FZLA 4E0DA 3IKMA 3HM9A 4AQYK 3VQEA 3VF6A 1K8KB 2IAJA 3KWIA
chains in the Genus database with same CATH topology
1UWBA 3WNGA 1WN7A 3M8QA 2HNYA 3S3OA 3L2QA 4JS4A 4DSEA 4AHSA 4CGGA 4ZHRA 3QEPA 3TAPA 4N41A 4FJKA 1LAVA 1HPZA 3HSTB 4J2EA 1WSFA 3K5LA 3NAEA 2X6NA 2PZSA 3PX6A 5C25A 1TK8A 3CM5A 5KRTA 4K8XA 3RMDA 4PY5A 4EP5A 3CYMA 3C6TA 4CJPA 3L2RA 4BACA 3MXMA 2NUBA 3O4NA 1UA1A 3BDPA 4W5QA 3EZ5A 2PYJA 1GOAA 3AVAA 2A1RA 1HYSA 1EX4A 2W42A 4BE2A 3S3MA 3V81A 5J2NA 2BGGA 3QERA 1S6QA 1BQNA 2ETJA 3QIOA 5KRSA 4HUFA 1JLGA 4B9TA 3CM6A 4HCBA 4CJRA 1RT6A 1T03A 2QKKA 4B8CA 5C42A 4CJLA 1TKXA 3V1QA 1RDDA 1ASWA 1C0MA 1GOCA 2DFEA 1LW2A 4DLGA 1JL1A 3RMCA 3TARA 4B9VA 4IKFA 2O4IA 4KI4A 4CJ5A 2VWKA 4DTXA 3V1OA 1DLOA 4EZ6A 1ZBLA 4BWMA 3TI0A 2GV9A 3PO4A 1RDCA 3SUNA 1L3VA 3RMAA 1A5XA 3NF8A 1QE1A 4B9MA 4DQIA 3ZT0A 4JRPA 3HP9A 4DTSA 5D3GA 1RCHA 4I7FA 5HLFA 1NJZA 3HO1A 4C8NA 3AVGA 3SV3A 4Z4GA 1HYVA 4LH4A 4NYNA 2KQ2A 3V9WA 2G8IA 4DMNA 4AHCA 5HBMA 4HUEA 4E7KA 3DOKA 3HPHA 4RW6A 3THVA 1NKCA 1Q9YA 1N5YA 2KFNA 1S6PA 1VSIA 1WNSA 2OPSA 4B3OA 4DF4A 3D45A 1BHLA 3LWLA 4FJ8A 4M3XA 5KGWA 2IGIA 1TGOA 4CJVA 1SL0A 1ZBHA 2QKBA 4KKOA 3QNOA 3I8DA 3AO4A 2OZMA 1LV5A 3KTQA 1RBSA 2D0AA 3LAMA 3AO1A 4F2RA 3V9XA 3ZSRA 2D0BA 1RT1A 4I9QA 3NH0A 4CF9A 4O0IA 2OZSA 2F8TA 4OKKA 3S3NA 1KLNA 3RR8A 3SJJA 2YNHA 4GW6A 3OJSA 1SL1A 3V9UA 4FK0A 4M3WA 4DTNA 4CCHA 1A5WA 4O44A 1KRPA 4PA1A 4CK3A 4E19A 1NOZA 4BE1A 2A1SA 1I3AA 2E6MA 3M8PA 4CHNA 1NK4A 4L8RB 4FYDA 2HHSA 1RT3A 1BIUA 1W9HA 3QNNA 1LW0A 1IKYA 3P1GA 5FROA 3QIPA 4AHUA 1IO2A 4FJJA 3PY8A 2F8SA 4QOZB 1XHZA 3VQDA 4XIUA 1JLQA 3FFIA 3QLHA 4CJTA 1UOCA 3MEGA 1RBTA 4BDYA 4FW2A 1D9DA 4N5SA 4E7IA 4DFPA 2BDPA 3PX0A 5JS2A 3ITHA 1JXBA 1REVA 1CZBA 2RN2A 4CJEA 3KLEA 3HL8A 4DU4A 2BANA 3IG1A 2B4JA 2OPPA 5HRPA 1R0AA 1TKZA 4ELTA 4O5BA 4EZ9A 3AVCA 2Z1GA 4FJ5A 1L3TA 1RTDA 2AJQA 3OYNA 2FBVA 1F21A 2YHBA 1BCMA 4OKEA 3VN5A 1BI4B 3OYDA 3L2WA 3TAFA 1HRHA 4NCAA 1YVUA 4HTUA 2YKNA 4YNQA 3KIOA 3ZSOA 2B5JA 4AHRA 2I5JA 1J54A 1D5AA 3NF9A 3OY9A 3KLFA 1KSPA 2G8UA 1T7PA 4KHUA 4LH5A 4CF0A 4Z4HA 1QHTA 3QEWA 4OVLA 2HB5A 1BQMA 4YFUA 3LWMA 3NGIA 4AH9A 1C1AA 4KO0A 1WSIA 1IKXA 4HVJA 1ZBUA 4CFDA 4M3YA 3VQ5A 1S1VA 2FBYA 3ZCMA 3U3GA 3OYEA 3KK2A 3SUQA 1KVBA 3BGRA 5K14A 4CIGA 1JLFA 1SUQA 1NK9A 1TKTA 4TSXA 4JLHA 4J2DA 3WNFA 3QO9A 4DU1A 3TR8A 3ZSYA 4CK1A 4IBNA 1KVCA 3RWUA 2YNGA 1WSHA 3O3GA 5CZ1A 5DK5A 4PWDA 3LP0A 4KRFA 3P83D 2DFHA 4E1NA 3I0SA 3K58A 3AVIA 3LDSA 3AV9A 4N56A 1WSJA 4M3ZA 1QS4A 1Z26A 4DTMA 2HNDA 1KFDA 2HHTA 3DLEA 3OYBA 1J9AA 4QAGA 1S1XA 4CEZA 3CQ8A 1WAFA 1BI4A 1FK9A 2IC3A 4FVMA 5DMRA 4CECA 4G1QA 1VRUA 4I2PA 2P5OA 3OVNA 1S1TA 3NCIA 3ASMA 4CGDA 3NH2A 1JLAA 4Y1CA 3QESA 3M8SA 4BDPA 4FK4A 3VQAA 4KPYA 3NGZA 4J2AA 4PUOA 4KV8A 1EXQA 3AA3A 1BCOA 4C8MA 4KHSA 1O1WA 2HVHA 4IG3A 2FC0A 1C1CA 4IFYA 3V4IA 1ZBFA 4LD0A 3ZT3A 3ZSVA 4FZXC 1JL2A 1A5VA 2GBZA 3C94A 2XO7A 4E7HA 3AVFA 1SV5A 4FJ9A 4M3TA 4FM2A 5I42A 3SNNA 3QEXA 2XY5A 3D0PA 4DG1A 4E3SA 4GMJB 4KHNA 2OPQA 3ZT1A 5E41A 2D0CA 2P51A 1YTAA 1HYZA 4W5TA 4DWIA 1LWCA 4HHTA 4DTPA 5JS1A 1RT2A 3PO5A 3RRGA 2ITGA 1EKEA 3JYTA 1WSEA 3HVTA 4OGEA 3EYZA 4FLXA 4DTJA 4O4GA 4Z4FA 4CJUA 1X9MA 1LAWA 1RILA 3TAEA 2HHUA 4IDKA 1QSLA 1DTQA 4CF8A 4RW7A 4F3OA 1U04A 3RTVA 4O55A 4B9UA 1KCFA 4IG0A 4CJ3A 4CEFA 1VSJA 3K2PA 3MEEA 1VSEA 1S1WA 3WNHA 4J2BA 1KVAA 3LP1A 4IFVA 5FDLA 1FKPA 4DQQA 4LY7A 4M3RA 3C95A 4BDZA 2WONA 3L3VA 1HQEA 4C8LA 1NOYA 1ZBIA 1BGXT 3PUFA 3AO2A 4FJNA 3P5JA 2EHGA 4B08A 3MXIA 1XI1A 1B9FA 4FZYA 4CHOA 2JGUA 3HVRA 2P5GA 1CZ9A 3HPGA 3KKSA 3OYHA 3KLGA 4ID1A 1U45A 4W5RA 3SV4A 3HPOA 3L3UA 1RNHA 3LAKA 3NBPA 2OYQA 3QINA 4RW8A 4Z4IA 2DTUA 4NCBA 1VSLA 2O4GA 1WAJA 3KKRA 4NYFA 4CF1A 3L8BA 4CJWA 3SQ1A 3U3YA 4KREA 3QEVA 1LWFA 2KZZA 3KJVA 3NDKA 4W5NA 1TL1A 3RRHA 1RBVA 3RMBA 1RT5A 3SQ2A 1G15A 3DRPA 4OPJA 1XC9A 1CXQA 2OA8A 2QK9A 1IG9A 4DSFA 1DTTA 1Y97A 3LP2A 1S1UA 1VK0A 2ZE2A 1B92A 1TV6A 4M41A 3B6OA 1NK5A 3ZT2A 2KTQA 2HHWA 1X1PA 2RPIA 3T3FA 1EP4A 4CIFA 1TL3A 3F73A 3U6FA 4F2SA 3LANA 3OYMA 1VSKA 1X9WA 4CEOA 3NHGA 4M45A 4JS5A 1TAUA 1JKHA 3AO5A 3SQ0A 4FLUA 2ZD1A 3DRRA 2VG6A 4R5PA 2OPRA 4OLBA 4DTOA 1JLCA 1C0TA 1TVRA 4DSIA 4F8RA 5EU7A 4N47A 4FLTA 3QETA 4DTRA 2VG5A 4QCLA 1IKWA 1L3UA 4ELUA 3DI6A 4B9SA 4DSLA 5I3UA 3T1AA 1C6VA 1J5OA 3AVHA 4DFMA 4CE9A 4CEEA 4GVMA 1HNIA 4CFAA 4MQ3A 3K57A 2XY8A 4H8KA 1RDAA 4B8AB 3PV8A 3C6UA 2VWJA 2LSNA 3MECA 1HJRA 1JLEA 3SQ4A 3OS1A 3SUOA 1RTJA 4C8KA 3TABA 3KD5E 3AVBA 3DYAA 5FRMA 4CIEA 4KHQA 3VQ6A 1TK5A 1JLBA 1SKRA 3KK1A 2PYLA 3TAMA 1L5UA 3OYAA 3T19A 2XY6A 3VQQA 4K8ZA 4ICLA 3IRXA 4RG8A 4Q0BA 1BIZA 1QSYA 3DM2A 2YV0X 4CEAA 4KB1A 4CGJA 2WOMA 2FBTA 4CEBA 4DLEA 2BE2A 2Y1IA 1L3SA 2DY4A 5CZ2A 5T7BA 4H4MA 4O0JA 3VQ7A 4EP4A 3NE6A 4FM0A 3AA5X 4KTWA 1MU2A 3UIQA 1KFSA 2Z1JA 3DOLA 2X78A 3TANA 4KB0A 3HK2A 4H4OA 2E4LA 5HROA 3O4QA 4CJSA 1CLQA 4NCGA 4FLZA 1C0UA 3DRSA 3AVKA 2XHBA 1ASUA 4N76A 1XWLA 3LPUA 2JLEA 4DTUA 2HMIA 1HMVA 3JSMA 3TAGA 4F4KA 1RTHA 5CY4A 3OYKA 2ZQBA 3NGYA 2YNFA 1FKOA 4WE1A 4JRQA 3M8RA 3S9HA 1XHXA 3A2FA 4LSLA 1TK0A 4CJFA 2VG7A 3DLKA 3NF6A 3AA2A 4CHYA 3AVLA 5SWMA 1VSHA 5CYMA 1Q9XA 4DF8A 2D5RA 1NJWA 2IDOA 3G0ZA 1J53A 4CJ4A 3F9KA 3VQCA 3WNEA 2XY7A 5HRRA 2G8HA 1S9GA 3EY1A 3V9SA 3DLGA 4CEQA 3VQBA 2Y1JA 1ZYQA 1NJXA 4M3UA 3KK3A 3KD1E 3DMJA 4CF2A 1VSDA 3KLIA 2Q3SA 1QSSA 4B9NA 4DS5A 4ZTFA 2EX3A 3K5OA 3OJUA 4Q5VA 5HRSA 3TWHA 3TAQA 1YT3A 3B6PA 1N6QA 1QTMA 4KI6A 4FJMA 4CGIA 2P1JA 1I39A 3H08A 4AHTA 4CFBA 1KLMA 1SKSA 1NK8A 1RBUA 1SKWA 4Z4EA 1HQUA 3L2UA 4CGHA 3OS2A 3LPTA 4KHYA 4DSJA 4FJXA 2G8WA 2IOCA 3MXJA 3HXMA 1VSMA 2KFZA 3NF7A 3ISNC 3SPZA 1KTQA 3QEIA 2IS3A 4CHQA 3K5MA 3ZSXA 4CEDA 3SI6A 3L2VA 1NKEA 4FW1A 3O3FA 4DU3A 3LALA 3DLHA 4FJHA 4PQUA 3MAQA 1D9FA 3KLHA 2YNIA 4FJIA 1IH7A 2B6AA 4E7JA 1SL2A 3VQ8A 4FLVA 3V1RA 5FRNA 1YTUA 4ID5A 2E6LA 3CFOA 5SZTA 1NKBA 1IKVA 2RF2A 3VQ4A 3DLBA 1LWEA 3ZT4A 4CJQA 3OYGA 4AHVA 3OYLA 1K6YA 4LSNA 3OYCA 2KW4A 2G8FA 2G8KA 4I2QA 3LZIA 5KGXA 3IS9A 4DFKA 4AILC 3SUPA 4FZZA 4Z0UA 3ZSWA 5CYQA 4CK2A 4Z4CA 4FCYA 5C24A 4BWJA 4DSKA 4HCCA 2HHVA 2KZMA 4E89A 3OYFA 2HHQA 2HW3A 3CFRA 3NFAA 4RW4A 1RTIA 3LZJA 3AO3A 4FM1A 4BE0A 4OKJA 4DQPA 4CFCA 3HP6A 2X6SA 4OLAA 2YKMA 3AVJA 3O3HA 4M42A 1QQCA 2X74A 4CESA 3HT3A 3ALYA 5J2MA 1W0HA 1Q8IA 1WSGA 4OGCA 3SZ2A 4ZTJA 1X9SA 3RR7A 4FK2A 1ASVA 1S9EA 1UAXA 3OYJA 4KHWA 3VA3A 4OJRA 1JXEA 1NJYA 1TAQA 2FBXA 2G8VA 4CERA 4HUGA 4CHPA 2RKIA 1CXUA 4E7LA 3SCXA 1UA0A 1VSFA 3ULDA 2PY5A 4CHZA 1BISA 3K5NA 2QXFA 4FJ7A 3HJFA 3AA4A 4UQGA 1RBRA 1U4BA 2HNZA 4FLYA 1RT7A 3CG7A 3LP3A 1D8YA 3V6DA 3G10A 4C8OA 4ELVA 4KTQA 4Y1DA 3K59A 2Z1HA 2F96A 5J2QA 4KAZA 3I0RA 4KFBA 2YHAA 5KTQA 3NH1A 4FXDA 1FXXA 2GUIA 2DFFA 1RT4A 5J1EA 3E01A 4FJGA 1BL3A 1RDBA 4W5OA 3ZSQA 5HRNA 5KI6A 2R7YA 4FLWA 3CFPA 2Z1IA 1NK0A 4F3TA 1U48A 2XRIA 3V9ZA 3SPYA 2HVIA 2HHXA 2ATQA 1Z25A 3OS0A 3PX4A 3VQ9A 1VRTA 1GOBA 1T05A 1WLJA 1ITGA 1C1BA 3AVNA 4MFBA 1NK6A 1B9DA 4FJLA 1U47A 3VQPA 4KTZA 4DQSA 1EETA 4OPKA 5J2PA 4CJKA 4CGFA 4B9LA 3AVMA 4DS4A 3MEDA 4DQRA 3HYFA 3SYZA 3IAYA 4DFJA 4RW9A 1U49A 4E0DA 3HM9A 5HP1A 1HNVA 3OYIA 4I9LA 3VQEA 1S5JA 1NK7A 3ZSZA 4E1MA 1T8EA 2IAJA 3DLRA 1TKDA 3VA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWB A;  3WNG A;  1WN7 A;  3M8Q A;  2HNY A;  3S3O A;  3L2Q A;  4JS4 A;  4DSE A;  4AHS A;  4CGG A;  4ZHR A;  3QEP A;  3TAP A;  4N41 A;  4FJK A;  1LAV A;  1HPZ A;  3HST B;  4J2E A;  1WSF A;  3K5L A;  3NAE A;  2X6N A;  2PZS A;  3PX6 A;  5C25 A;  1TK8 A;  3CM5 A;  5KRT A;  4K8X A;  3RMD A;  4PY5 A;  4EP5 A;  3CYM A;  3C6T A;  4CJP A;  3L2R A;  4BAC A;  3MXM A;  2NUB A;  3O4N A;  1UA1 A;  3BDP A;  4W5Q A;  3EZ5 A;  2PYJ A;  1GOA A;  3AVA A;  2A1R A;  1HYS A;  1EX4 A;  2W42 A;  4BE2 A;  3S3M A;  3V81 A;  5J2N A;  2BGG A;  3QER A;  1S6Q A;  1BQN A;  2ETJ A;  3QIO A;  5KRS A;  4HUF A;  1JLG A;  4B9T A;  3CM6 A;  4HCB A;  4CJR A;  1RT6 A;  1T03 A;  2QKK A;  4B8C A;  5C42 A;  4CJL A;  1TKX A;  3V1Q A;  1RDD A;  1ASW A;  1C0M A;  1GOC A;  2DFE A;  1LW2 A;  4DLG A;  1JL1 A;  3RMC A;  3TAR A;  4B9V A;  4IKF A;  2O4I A;  4KI4 A;  4CJ5 A;  2VWK A;  4DTX A;  3V1O A;  1DLO A;  4EZ6 A;  1ZBL A;  4BWM A;  3TI0 A;  2GV9 A;  3PO4 A;  1RDC A;  3SUN A;  1L3V A;  3RMA A;  1A5X A;  3NF8 A;  1QE1 A;  4B9M A;  4DQI A;  3ZT0 A;  4JRP A;  3HP9 A;  4DTS A;  5D3G A;  1RCH A;  4I7F A;  5HLF A;  1NJZ A;  3HO1 A;  4C8N A;  3AVG A;  3SV3 A;  4Z4G A;  1HYV A;  4LH4 A;  4NYN A;  2KQ2 A;  3V9W A;  2G8I A;  4DMN A;  4AHC A;  5HBM A;  4HUE A;  4E7K A;  3DOK A;  3HPH A;  4RW6 A;  3THV A;  1NKC A;  1Q9Y A;  1N5Y A;  2KFN A;  1S6P A;  1VSI A;  1WNS A;  2OPS A;  4B3O A;  4DF4 A;  3D45 A;  1BHL A;  3LWL A;  4FJ8 A;  4M3X A;  5KGW A;  2IGI A;  1TGO A;  4CJV A;  1SL0 A;  1ZBH A;  2QKB A;  4KKO A;  3QNO A;  3I8D A;  3AO4 A;  2OZM A;  1LV5 A;  3KTQ A;  1RBS A;  2D0A A;  3LAM A;  3AO1 A;  4F2R A;  3V9X A;  3ZSR A;  2D0B A;  1RT1 A;  4I9Q A;  3NH0 A;  4CF9 A;  4O0I A;  2OZS A;  2F8T A;  4OKK A;  3S3N A;  1KLN A;  3RR8 A;  3SJJ A;  2YNH A;  4GW6 A;  3OJS A;  1SL1 A;  3V9U A;  4FK0 A;  4M3W A;  4DTN A;  4CCH A;  1A5W A;  4O44 A;  1KRP A;  4PA1 A;  4CK3 A;  4E19 A;  1NOZ A;  4BE1 A;  2A1S A;  1I3A A;  2E6M A;  3M8P A;  4CHN A;  1NK4 A;  4L8R B;  4FYD A;  2HHS A;  1RT3 A;  1BIU A;  1W9H A;  3QNN A;  1LW0 A;  1IKY A;  3P1G A;  5FRO A;  3QIP A;  4AHU A;  1IO2 A;  4FJJ A;  3PY8 A;  2F8S A;  4QOZ B;  1XHZ A;  3VQD A;  4XIU A;  1JLQ A;  3FFI A;  3QLH A;  4CJT A;  1UOC A;  3MEG A;  1RBT A;  4BDY A;  4FW2 A;  1D9D A;  4N5S A;  4E7I A;  4DFP A;  2BDP A;  3PX0 A;  5JS2 A;  3ITH A;  1JXB A;  1REV A;  1CZB A;  2RN2 A;  4CJE A;  3KLE A;  3HL8 A;  4DU4 A;  2BAN A;  3IG1 A;  2B4J A;  2OPP A;  5HRP A;  1R0A A;  1TKZ A;  4ELT A;  4O5B A;  4EZ9 A;  3AVC A;  2Z1G A;  4FJ5 A;  1L3T A;  1RTD A;  2AJQ A;  3OYN A;  2FBV A;  1F21 A;  2YHB A;  1BCM A;  4OKE A;  3VN5 A;  1BI4 B;  3OYD A;  3L2W A;  3TAF A;  1HRH A;  4NCA A;  1YVU A;  4HTU A;  2YKN A;  4YNQ A;  3KIO A;  3ZSO A;  2B5J A;  4AHR A;  2I5J A;  1J54 A;  1D5A A;  3NF9 A;  3OY9 A;  3KLF A;  1KSP A;  2G8U A;  1T7P A;  4KHU A;  4LH5 A;  4CF0 A;  4Z4H A;  1QHT A;  3QEW A;  4OVL A;  2HB5 A;  1BQM A;  4YFU A;  3LWM A;  3NGI A;  4AH9 A;  1C1A A;  4KO0 A;  1WSI A;  1IKX A;  4HVJ A;  1ZBU A;  4CFD A;  4M3Y A;  3VQ5 A;  1S1V A;  2FBY A;  3ZCM A;  3U3G A;  3OYE A;  3KK2 A;  3SUQ A;  1KVB A;  3BGR A;  5K14 A;  4CIG A;  1JLF A;  1SUQ A;  1NK9 A;  1TKT A;  4TSX A;  4JLH A;  4J2D A;  3WNF A;  3QO9 A;  4DU1 A;  3TR8 A;  3ZSY A;  4CK1 A;  4IBN A;  1KVC A;  3RWU A;  2YNG A;  1WSH A;  3O3G A;  5CZ1 A;  5DK5 A;  4PWD A;  3LP0 A;  4KRF A;  3P83 D;  2DFH A;  4E1N A;  3I0S A;  3K58 A;  3AVI A;  3LDS A;  3AV9 A;  4N56 A;  1WSJ A;  4M3Z A;  1QS4 A;  1Z26 A;  4DTM A;  2HND A;  1KFD A;  2HHT A;  3DLE A;  3OYB A;  1J9A A;  4QAG A;  1S1X A;  4CEZ A;  3CQ8 A;  1WAF A;  1BI4 A;  1FK9 A;  2IC3 A;  4FVM A;  5DMR A;  4CEC A;  4G1Q A;  1VRU A;  4I2P A;  2P5O A;  3OVN A;  1S1T A;  3NCI A;  3ASM A;  4CGD A;  3NH2 A;  1JLA A;  4Y1C A;  3QES A;  3M8S A;  4BDP A;  4FK4 A;  3VQA A;  4KPY A;  3NGZ A;  4J2A A;  4PUO A;  4KV8 A;  1EXQ A;  3AA3 A;  1BCO A;  4C8M A;  4KHS A;  1O1W A;  2HVH A;  4IG3 A;  2FC0 A;  1C1C A;  4IFY A;  3V4I A;  1ZBF A;  4LD0 A;  3ZT3 A;  3ZSV A;  4FZX C;  1JL2 A;  1A5V A;  2GBZ A;  3C94 A;  2XO7 A;  4E7H A;  3AVF A;  1SV5 A;  4FJ9 A;  4M3T A;  4FM2 A;  5I42 A;  3SNN A;  3QEX A;  2XY5 A;  3D0P A;  4DG1 A;  4E3S A;  4GMJ B;  4KHN A;  2OPQ A;  3ZT1 A;  5E41 A;  2D0C A;  2P51 A;  1YTA A;  1HYZ A;  4W5T A;  4DWI A;  1LWC A;  4HHT A;  4DTP A;  5JS1 A;  1RT2 A;  3PO5 A;  3RRG A;  2ITG A;  1EKE A;  3JYT A;  1WSE A;  3HVT A;  4OGE A;  3EYZ A;  4FLX A;  4DTJ A;  4O4G A;  4Z4F A;  4CJU A;  1X9M A;  1LAW A;  1RIL A;  3TAE A;  2HHU A;  4IDK A;  1QSL A;  1DTQ A;  4CF8 A;  4RW7 A;  4F3O A;  1U04 A;  3RTV A;  4O55 A;  4B9U A;  1KCF A;  4IG0 A;  4CJ3 A;  4CEF A;  1VSJ A;  3K2P A;  3MEE A;  1VSE A;  1S1W A;  3WNH A;  4J2B A;  1KVA A;  3LP1 A;  4IFV A;  5FDL A;  1FKP A;  4DQQ A;  4LY7 A;  4M3R A;  3C95 A;  4BDZ A;  2WON A;  3L3V A;  1HQE A;  4C8L A;  1NOY A;  1ZBI A;  1BGX T;  3PUF A;  3AO2 A;  4FJN A;  3P5J A;  2EHG A;  4B08 A;  3MXI A;  1XI1 A;  1B9F A;  4FZY A;  4CHO A;  2JGU A;  3HVR A;  2P5G A;  1CZ9 A;  3HPG A;  3KKS A;  3OYH A;  3KLG A;  4ID1 A;  1U45 A;  4W5R A;  3SV4 A;  3HPO A;  3L3U A;  1RNH A;  3LAK A;  3NBP A;  2OYQ A;  3QIN A;  4RW8 A;  4Z4I A;  2DTU A;  4NCB A;  1VSL A;  2O4G A;  1WAJ A;  3KKR A;  4NYF A;  4CF1 A;  3L8B A;  4CJW A;  3SQ1 A;  3U3Y A;  4KRE A;  3QEV A;  1LWF A;  2KZZ A;  3KJV A;  3NDK A;  4W5N A;  1TL1 A;  3RRH A;  1RBV A;  3RMB A;  1RT5 A;  3SQ2 A;  1G15 A;  3DRP A;  4OPJ A;  1XC9 A;  1CXQ A;  2OA8 A;  2QK9 A;  1IG9 A;  4DSF A;  1DTT A;  1Y97 A;  3LP2 A;  1S1U A;  1VK0 A;  2ZE2 A;  1B92 A;  1TV6 A;  4M41 A;  3B6O A;  1NK5 A;  3ZT2 A;  2KTQ A;  2HHW A;  1X1P A;  2RPI A;  3T3F A;  1EP4 A;  4CIF A;  1TL3 A;  3F73 A;  3U6F A;  4F2S A;  3LAN A;  3OYM A;  1VSK A;  1X9W A;  4CEO A;  3NHG A;  4M45 A;  4JS5 A;  1TAU A;  1JKH A;  3AO5 A;  3SQ0 A;  4FLU A;  2ZD1 A;  3DRR A;  2VG6 A;  4R5P A;  2OPR A;  4OLB A;  4DTO A;  1JLC A;  1C0T A;  1TVR A;  4DSI A;  4F8R A;  5EU7 A;  4N47 A;  4FLT A;  3QET A;  4DTR A;  2VG5 A;  4QCL A;  1IKW A;  1L3U A;  4ELU A;  3DI6 A;  4B9S A;  4DSL A;  5I3U A;  3T1A A;  1C6V A;  1J5O A;  3AVH A;  4DFM A;  4CE9 A;  4CEE A;  4GVM A;  1HNI A;  4CFA A;  4MQ3 A;  3K57 A;  2XY8 A;  4H8K A;  1RDA A;  4B8A B;  3PV8 A;  3C6U A;  2VWJ A;  2LSN A;  3MEC A;  1HJR A;  1JLE A;  3SQ4 A;  3OS1 A;  3SUO A;  1RTJ A;  4C8K A;  3TAB A;  3KD5 E;  3AVB A;  3DYA A;  5FRM A;  4CIE A;  4KHQ A;  3VQ6 A;  1TK5 A;  1JLB A;  1SKR A;  3KK1 A;  2PYL A;  3TAM A;  1L5U A;  3OYA A;  3T19 A;  2XY6 A;  3VQQ A;  4K8Z A;  4ICL A;  3IRX A;  4RG8 A;  4Q0B A;  1BIZ A;  1QSY A;  3DM2 A;  2YV0 X;  4CEA A;  4KB1 A;  4CGJ A;  2WOM A;  2FBT A;  4CEB A;  4DLE A;  2BE2 A;  2Y1I A;  1L3S A;  2DY4 A;  5CZ2 A;  5T7B A;  4H4M A;  4O0J A;  3VQ7 A;  4EP4 A;  3NE6 A;  4FM0 A;  3AA5 X;  4KTW A;  1MU2 A;  3UIQ A;  1KFS A;  2Z1J A;  3DOL A;  2X78 A;  3TAN A;  4KB0 A;  3HK2 A;  4H4O A;  2E4L A;  5HRO A;  3O4Q A;  4CJS A;  1CLQ A;  4NCG A;  4FLZ A;  1C0U A;  3DRS A;  3AVK A;  2XHB A;  1ASU A;  4N76 A;  1XWL A;  3LPU A;  2JLE A;  4DTU A;  2HMI A;  1HMV A;  3JSM A;  3TAG A;  4F4K A;  1RTH A;  5CY4 A;  3OYK A;  2ZQB A;  3NGY A;  2YNF A;  1FKO A;  4WE1 A;  4JRQ A;  3M8R A;  3S9H A;  1XHX A;  3A2F A;  4LSL A;  1TK0 A;  4CJF A;  2VG7 A;  3DLK A;  3NF6 A;  3AA2 A;  4CHY A;  3AVL A;  5SWM A;  1VSH A;  5CYM A;  1Q9X A;  4DF8 A;  2D5R A;  1NJW A;  2IDO A;  3G0Z A;  1J53 A;  4CJ4 A;  3F9K A;  3VQC A;  3WNE A;  2XY7 A;  5HRR A;  2G8H A;  1S9G A;  3EY1 A;  3V9S A;  3DLG A;  4CEQ A;  3VQB A;  2Y1J A;  1ZYQ A;  1NJX A;  4M3U A;  3KK3 A;  3KD1 E;  3DMJ A;  4CF2 A;  1VSD A;  3KLI A;  2Q3S A;  1QSS A;  4B9N A;  4DS5 A;  4ZTF A;  2EX3 A;  3K5O A;  3OJU A;  4Q5V A;  5HRS A;  3TWH A;  3TAQ A;  1YT3 A;  3B6P A;  1N6Q A;  1QTM A;  4KI6 A;  4FJM A;  4CGI A;  2P1J A;  1I39 A;  3H08 A;  4AHT A;  4CFB A;  1KLM A;  1SKS A;  1NK8 A;  1RBU A;  1SKW A;  4Z4E A;  1HQU A;  3L2U A;  4CGH A;  3OS2 A;  3LPT A;  4KHY A;  4DSJ A;  4FJX A;  2G8W A;  2IOC A;  3MXJ A;  3HXM A;  1VSM A;  2KFZ A;  3NF7 A;  3ISN C;  3SPZ A;  1KTQ A;  3QEI A;  2IS3 A;  4CHQ A;  3K5M A;  3ZSX A;  4CED A;  3SI6 A;  3L2V A;  1NKE A;  4FW1 A;  3O3F A;  4DU3 A;  3LAL A;  3DLH A;  4FJH A;  4PQU A;  3MAQ A;  1D9F A;  3KLH A;  2YNI A;  4FJI A;  1IH7 A;  2B6A A;  4E7J A;  1SL2 A;  3VQ8 A;  4FLV A;  3V1R A;  5FRN A;  1YTU A;  4ID5 A;  2E6L A;  3CFO A;  5SZT A;  1NKB A;  1IKV A;  2RF2 A;  3VQ4 A;  3DLB A;  1LWE A;  3ZT4 A;  4CJQ A;  3OYG A;  4AHV A;  3OYL A;  1K6Y A;  4LSN A;  3OYC A;  2KW4 A;  2G8F A;  2G8K A;  4I2Q A;  3LZI A;  5KGX A;  3IS9 A;  4DFK A;  4AIL C;  3SUP A;  4FZZ A;  4Z0U A;  3ZSW A;  5CYQ A;  4CK2 A;  4Z4C A;  4FCY A;  5C24 A;  4BWJ A;  4DSK A;  4HCC A;  2HHV A;  2KZM A;  4E89 A;  3OYF A;  2HHQ A;  2HW3 A;  3CFR A;  3NFA A;  4RW4 A;  1RTI A;  3LZJ A;  3AO3 A;  4FM1 A;  4BE0 A;  4OKJ A;  4DQP A;  4CFC A;  3HP6 A;  2X6S A;  4OLA A;  2YKM A;  3AVJ A;  3O3H A;  4M42 A;  1QQC A;  2X74 A;  4CES A;  3HT3 A;  3ALY A;  5J2M A;  1W0H A;  1Q8I A;  1WSG A;  4OGC A;  3SZ2 A;  4ZTJ A;  1X9S A;  3RR7 A;  4FK2 A;  1ASV A;  1S9E A;  1UAX A;  3OYJ A;  4KHW A;  3VA3 A;  4OJR A;  1JXE A;  1NJY A;  1TAQ A;  2FBX A;  2G8V A;  4CER A;  4HUG A;  4CHP A;  2RKI A;  1CXU A;  4E7L A;  3SCX A;  1UA0 A;  1VSF A;  3ULD A;  2PY5 A;  4CHZ A;  1BIS A;  3K5N A;  2QXF A;  4FJ7 A;  3HJF A;  3AA4 A;  4UQG A;  1RBR A;  1U4B A;  2HNZ A;  4FLY A;  1RT7 A;  3CG7 A;  3LP3 A;  1D8Y A;  3V6D A;  3G10 A;  4C8O A;  4ELV A;  4KTQ A;  4Y1D A;  3K59 A;  2Z1H A;  2F96 A;  5J2Q A;  4KAZ A;  3I0R A;  4KFB A;  2YHA A;  5KTQ A;  3NH1 A;  4FXD A;  1FXX A;  2GUI A;  2DFF A;  1RT4 A;  5J1E A;  3E01 A;  4FJG A;  1BL3 A;  1RDB A;  4W5O A;  3ZSQ A;  5HRN A;  5KI6 A;  2R7Y A;  4FLW A;  3CFP A;  2Z1I A;  1NK0 A;  4F3T A;  1U48 A;  2XRI A;  3V9Z A;  3SPY A;  2HVI A;  2HHX A;  2ATQ A;  1Z25 A;  3OS0 A;  3PX4 A;  3VQ9 A;  1VRT A;  1GOB A;  1T05 A;  1WLJ A;  1ITG A;  1C1B A;  3AVN A;  4MFB A;  1NK6 A;  1B9D A;  4FJL A;  1U47 A;  3VQP A;  4KTZ A;  4DQS A;  1EET A;  4OPK A;  5J2P A;  4CJK A;  4CGF A;  4B9L A;  3AVM A;  4DS4 A;  3MED A;  4DQR A;  3HYF A;  3SYZ A;  3IAY A;  4DFJ A;  4RW9 A;  1U49 A;  4E0D A;  3HM9 A;  5HP1 A;  1HNV A;  3OYI A;  4I9L A;  3VQE A;  1S5J A;  1NK7 A;  3ZSZ A;  4E1M A;  1T8E A;  2IAJ A;  3DLR A;  1TKD A;  3VA0 A; 
#chains in the Genus database with same CATH topology
 1UWB A;  3WNG A;  3W0L A;  4LF9 K;  2HBK A;  3PIP L;  2UXB K;  4AHS A;  2P9P A;  3TAP A;  4N41 A;  3HST B;  1YVN A;  4FPB A;  3RMD A;  1VQP N;  3C6T A;  3L2R A;  1HNW K;  2NUB A;  1UA1 A;  1T44 A;  3EZ5 A;  2F9W A;  2A6A A;  2W42 A;  1EWR A;  3S3M A;  4ILG B;  3ZEU B;  3D6R A;  3HBT A;  1BQN A;  2ETJ A;  3OBW A;  1Z05 A;  4A62 A;  3THY A;  4HCB A;  1T03 A;  3V1Q A;  1RDD A;  2DFE A;  4IKF A;  3D2F B;  3TAR A;  4B9V A;  5F2R A;  3VEN A;  4H0X B;  3V1O A;  1DLO A;  1S3X A;  4EZ6 A;  1ZBL A;  4BWM A;  4I6M B;  3TI0 A;  3SUN A;  1QE1 A;  4H0T B;  3HO1 A;  5D3G A;  1DT9 A;  4GVE A;  4K0K K;  4KH6 A;  4NLB A;  5AQQ A;  5GAD P;  2G8I A;  4JI4 K;  3DOK A;  1VQL N;  3HPH A;  4RW6 A;  4YDU C;  1NKC A;  3CC4 N;  3VER A;  1S6P A;  1VSI A;  4B3O A;  2OPS A;  5C15 A;  4DF4 A;  1VQ8 N;  4FJ8 A;  1YI2 N;  1ZBH A;  3QBX A;  2GX9 A;  1LV5 A;  3QB0 A;  5KQD A;  3GE1 A;  1ZC6 A;  3RR8 A;  5EXW A;  1KLN A;  3SJJ A;  4DTN A;  3J7A P;  4PA1 A;  4B1Y B;  4BRF A;  1I3A A;  1TYQ B;  3M8P A;  4DR2 K;  4CZK A;  5FRO A;  4GKK K;  4DUZ K;  4FJJ A;  3PY8 A;  3MN9 A;  4BY9 C;  4AF1 A;  3MEG A;  5AQH A;  4E7I A;  1J5E K;  5CR4 A;  5C2D A;  2BDP A;  4IO9 L;  4G9Z A;  1CZB A;  2P9U B;  4DU4 A;  4O5B A;  4JD2 A;  2Z1G A;  1L3T A;  2HBM A;  2YHB A;  3OYD A;  1BI4 B;  3L2W A;  4HTU A;  4U7B A;  4YNQ A;  3CJ1 A;  3ZSO A;  4AHR A;  2I5J A;  3NF9 A;  1NM1 A;  2G8U A;  5BN9 A;  4BRN A;  2O8C A;  4KHU A;  3QEW A;  3VET A;  4XEI A;  2HB5 A;  4YFU A;  3NGI A;  1ZXO A;  4AH9 A;  2CH6 A;  2ZGZ A;  1ZBU A;  1S1V A;  3VTI A;  3SUQ A;  4CIG A;  4DV1 K;  3D2F A;  1SUQ A;  1NGC A;  4TSX A;  2H3G X;  4JKD A;  3TR8 A;  3GDQ A;  4Z94 A;  3O4W A;  1QQO A;  4I6M A;  3O3G A;  4PWD A;  3LP0 A;  3ZLJ A;  3ENO A;  3I0S A;  5IWA K;  4N56 A;  1QS4 A;  5BR8 K;  2HHT A;  3DLE A;  5GAG P;  2QWL A;  4CEZ A;  3VTH A;  2HBL A;  4G1Q A;  1N36 K;  2V7Y A;  2ZJQ L;  4QS7 A;  3M8S A;  1VQK N;  3S41 A;  3AA3 A;  1BCO A;  2HVH A;  2FC0 A;  3V4I A;  2NRV A;  4FZX C;  1JL2 A;  4AM6 A;  3C94 A;  2XO7 A;  1SV5 A;  3SNN A;  4LFA K;  5BRH A;  2RE2 A;  4DG1 A;  3SAF A;  4KHN A;  5E41 A;  3ZT1 A;  2P51 A;  4DWI A;  1LWC A;  2P9S B;  5JS1 A;  1T6C A;  4OO1 J;  1WSE A;  4OGE A;  3EYZ A;  4FLX A;  4DTJ A;  4Z4F A;  4DR1 K;  2F4V K;  4CF8 A;  2FSJ A;  4RW7 A;  1KCF A;  4J2B A;  1LCU A;  4MO5 A;  4DQQ A;  4LY7 A;  2WON A;  1SZ2 A;  3D7E O;  4EIA A;  3BP8 A;  3E66 A;  1NOY A;  2YJF A;  4IZ9 A;  1D4X A;  3CJ7 A;  3ZX3 A;  4IDH A;  3QML A;  3MXI A;  4BR9 A;  4FZY A;  4CHO A;  3HVR A;  2P5G A;  2VQE K;  4JN4 A;  5MLC Q;  2D0P A;  1U45 A;  1NJI O;  3H3O B;  3NBP A;  2OYQ A;  4NCB A;  3KKR A;  1N32 K;  4LFC K;  5IT9 O;  3L8B A;  3SQ1 A;  1S22 A;  4A5A A;  3AAQ A;  4W5N A;  3I8B A;  3SK3 A;  2QK9 A;  4A2B A;  2A5X A;  1DTT A;  1B92 A;  2UYT A;  5GIP A;  2RPI A;  4B1U B;  4CBU A;  3U9Z A;  4CIF A;  1SAZ A;  3F73 A;  3LAN A;  1OKJ A;  4JS5 A;  2E8A A;  4FLU A;  2ZD1 A;  3TU5 A;  2VG6 A;  4DTO A;  4DSI A;  1TVR A;  3ZET A;  4N47 A;  3ID6 A;  2VG5 A;  5GIN A;  1U2V A;  1L3U A;  3DI6 A;  1DEJ A;  1ZBS A;  1BOT O;  1C6V A;  1IG8 A;  4CE9 A;  4CFA A;  4CI6 A;  4HTL A;  4C23 A;  4B8A B;  3BF1 A;  2VWJ A;  1HJR A;  4C1N K;  3OS1 A;  4C8K A;  3DYA A;  4CIE A;  4BC5 A;  4H5V A;  2PYL A;  2O8F A;  2UUB K;  2Q2R A;  3O9U A;  3VQQ A;  2QW9 A;  4NO7 A;  3QIC A;  4CEA A;  4KB1 A;  4JD2 B;  3J7Z O;  5T7B A;  3DXK A;  4KTW A;  4JKC A;  3G25 A;  3LDN A;  1Q18 A;  4KB0 A;  4H4O A;  4DR5 K;  1IBM K;  3O4Q A;  5BR9 A;  1K8K A;  4CJS A;  5LJV A;  1GLD G;  3CXC M;  2XHB A;  4A59 A;  2JLE A;  4DTU A;  5AQT A;  4F4K A;  2GWJ A;  5CY4 A;  2ZQB A;  2BH1 A;  3UKU B;  3VOV A;  3M8R A;  1KQS M;  4J8F A;  3S9H A;  2VQF K;  3NF6 A;  3AA2 A;  1VSH A;  1Q9X A;  3P38 A;  4DF8 A;  3U8X A;  3CCQ N;  3F9K A;  4BR7 A;  2FF3 B;  4NB4 A;  1JCG A;  4CEQ A;  2Y1J A;  4GKJ K;  4FVU A;  1QSS A;  2P5O A;  4DS5 A;  4ZTF A;  2EX3 A;  2OTL N;  1N6Q A;  3CCS N;  4KI6 A;  3BY5 A;  2QM1 A;  4AHT A;  4FWP A;  1VAZ A;  2O8C B;  3WEE B;  2GUP A;  3A5N C;  5C2F A;  1MWK A;  5FPN A;  4CGH A;  3OS2 A;  3LPT A;  3WUH A;  1GLC G;  2QWN A;  1VSM A;  3HXM A;  3NF7 A;  3SPZ A;  4MDB A;  3VF2 A;  4CHQ A;  3ZSX A;  4CED A;  3SI6 A;  3L2V A;  4DU3 A;  3MMV A;  1JCF A;  1QVF M;  4E7J A;  1YUW A;  3IFR A;  3V1R A;  2WC9 A;  1NKB A;  3MX2 A;  3DLL L;  1IKV A;  3ULE A;  2O8D A;  1SS6 A;  4Y0W A;  5F1X A;  3MN5 A;  3D2E A;  4IOX A;  1IV0 A;  5FPE A;  2G8K A;  5CE3 A;  3EL2 A;  4AIL C;  3ZSW A;  5C24 A;  4BWJ A;  4DSK A;  2HW3 A;  4YOU A;  4JYA K;  1RTI A;  3LZJ A;  3IMX A;  3L6Q A;  2OTJ N;  3HP6 A;  4H0V B;  4FWN A;  4BG9 A;  1QQC A;  4DCH A;  4CES A;  5AFU H;  2BUP A;  3ALY A;  1W0H A;  1Q8I A;  4FK2 A;  3M3Z A;  4MLH A;  3OYJ A;  3VGL A;  4KHW A;  2FXU A;  1MA9 B;  3CER A;  1JXE A;  2FBX A;  4CER A;  4CHP A;  4E7L A;  3ULD A;  4CHZ A;  1BIS A;  4FJ7 A;  4CVN E;  4B1X B;  1RT7 A;  5C12 A;  1D8Y A;  4KTQ A;  4JKA A;  4KAZ A;  3K59 A;  5AQJ A;  2Z1H A;  4K43 A;  5J2Q A;  2YHY A;  4KFB A;  2YHA A;  3O9S A;  1RT4 A;  5J1E A;  4FJG A;  3QBW A;  1T3V A;  3BZK A;  5KI6 A;  4CZH A;  1NK0 A;  4F3T A;  1U48 A;  2ZJP L;  4IO8 A;  1GOB A;  3L0Q A;  4JHD A;  3AVN A;  1C1B A;  1NK6 A;  3UKR B;  1Q82 O;  4FJL A;  2A42 A;  3VQP A;  5J2P A;  3FLC O;  1YJN N;  4CZL A;  5CHI A;  4B3S K;  5HP1 A;  1YF5 L;  4ILJ A;  1NK7 A;  4E1M A;  1T8E A;  1NGI A;  1WN7 A;  3M8Q A;  2HNY A;  4IEE A;  5AZI A;  4NXM K;  2Q0U A;  4H5T A;  1HKC A;  1XUP O;  4FJK A;  1HPZ A;  2NRW A;  2WFB A;  1WSF A;  2P9I B;  3NAE A;  2X6N A;  3PX6 A;  4WYB A;  5C25 A;  1TK8 A;  2DPN A;  5KRT A;  3CJC A;  4EHT A;  3CYM A;  4BRL A;  3MXM A;  4W5Q A;  1GOA A;  1HYS A;  2A1R A;  4O8U A;  5J2N A;  4WCE L;  1JLG A;  3C65 A;  2QA4 N;  3CCL N;  4CJR A;  1RT6 A;  5C42 A;  1TKX A;  1GOC A;  1QQM A;  3DJC A;  3SMP A;  4KI4 A;  4DTX A;  3SAG A;  2PBD A;  2GV9 A;  3PO4 A;  1RDC A;  3ENH A;  4BG8 A;  1L3V A;  1A5X A;  4JRP A;  3HP9 A;  4QS8 A;  4BQL A;  5HLF A;  5M1P A;  3SV3 A;  4BR4 A;  5E84 A;  2KQ2 A;  3V9W A;  3ATV A;  4NXN K;  4AHC A;  4E7K A;  4HUE A;  4LF5 K;  4H0O A;  1RGI A;  1XNQ K;  1BG3 A;  1IJJ A;  4FSV A;  4H5W A;  4BVO A;  1N5Y A;  2KFN A;  4B9Q A;  3CET A;  1BHL A;  2IGI A;  1TGO A;  1RBS A;  3LAM A;  2IIR A;  3V9X A;  1GLL O;  2D0B A;  1RT1 A;  4CF9 A;  2NLX A;  2PFU A;  2OZS A;  3S3N A;  3VF4 A;  1SL1 A;  3QFU A;  4F9O A;  2P9K B;  4CCH A;  1Y64 A;  1E3M A;  1KRP A;  1QQN A;  4E19 A;  1NOZ A;  1NK4 A;  2HHS A;  2OAN A;  4BGA A;  1W9H A;  3VEZ A;  4BRO A;  1CZA N;  2V52 B;  3QFP A;  4XIU A;  1JLQ A;  3M5R A;  4BR5 A;  3FFI A;  4CJT A;  5LMN K;  1UOC A;  2O8E A;  2O8D B;  4BDY A;  4FW2 A;  3H1Q A;  3WXI A;  1M1K O;  4ILH A;  3WXK A;  4LF8 K;  1R0A A;  2O8E B;  4EZ9 A;  2CH5 A;  3AVC A;  1K8A O;  4FJ5 A;  3VES A;  1YXQ A;  1F21 A;  1RDU A;  4KHP K;  4WFA L;  4CBX A;  3KIO A;  1NBW A;  1KSP A;  1J54 A;  3LM2 A;  1T7P A;  4BC3 A;  1O13 A;  4CF0 A;  4OVL A;  1QZ5 A;  4KO0 A;  1IKX A;  2D0O A;  3VEY A;  4HVJ A;  3U3G A;  3BGR A;  1NK9 A;  4J2D A;  3WNF A;  2UUA K;  3ZSY A;  3I33 A;  4HWI A;  1KVC A;  3RWU A;  5JVH L;  4BRI A;  5AQU A;  4JNE A;  5CZ1 A;  3DXK B;  2J4R A;  3LL3 A;  3LDS A;  3AVI A;  3AV9 A;  1WSJ A;  4DTM A;  3CCU N;  3OYB A;  3CCM N;  1J9A A;  3A5O C;  4FVM A;  1BI4 A;  3G4S N;  4CEC A;  1KAZ A;  4I2P A;  3GG4 A;  4Y1C A;  3CHW A;  3MN7 A;  3QES A;  4DR4 K;  2NRZ A;  3CCE N;  1J6Z A;  4KV8 A;  4JKG A;  4IG3 A;  3NVM A;  5DM6 L;  3ZT3 A;  3ZSV A;  1WBB A;  1A5V A;  4XH5 A;  2GBZ A;  4E7H A;  2GEM A;  3E9O A;  4DV2 K;  5AQX A;  4E3S A;  4GMJ B;  2OPQ A;  1N33 K;  4W5T A;  1RDW X;  1YTA A;  3RRG A;  2E2P A;  4DV6 K;  1NWK A;  4CJU A;  2I7N A;  4EFH A;  1LAW A;  4JKB A;  2P9S A;  4IDK A;  1X9J A;  1U04 A;  4DV4 K;  4JHD B;  4IG0 A;  2FLO A;  3MEE A;  3NVK A;  3GL1 A;  3WNH A;  2HF4 A;  1KVA A;  3LP1 A;  4IFV A;  5FDL A;  3FR0 A;  3MDQ A;  5EOY A;  3A5M C;  1HQE A;  4C8L A;  1ZBI A;  3U4L A;  1OH8 A;  1OH7 A;  3AO2 A;  4B08 A;  5TKY A;  3OYH A;  3KLG A;  2YI1 A;  4W5R A;  3SV4 A;  3HPO A;  2QTD A;  3L3U A;  1RNH A;  1VSL A;  2O4G A;  2GWK A;  1LWF A;  3KJV A;  1TL1 A;  1RBV A;  1RT5 A;  1G15 A;  4CJ7 A;  1CXQ A;  4DR3 K;  4RTF D;  1IG9 A;  4JKF A;  1X3M A;  1Y97 A;  3GOI A;  4O5F A;  1N34 K;  1VK0 A;  5AQW A;  4JI5 K;  2EWS A;  4M41 A;  2WTU A;  4FWM A;  3ZT2 A;  1NK5 A;  5DM7 L;  4PHT X;  3T3F A;  2Q31 A;  4F2S A;  3OYM A;  1VSK A;  4M45 A;  3J81 O;  1TAU A;  1JKH A;  2QEX N;  4R5P A;  4XH4 A;  4FLT A;  1IKW A;  4FOI A;  4ELU A;  2VWB A;  4YOY A;  3AVH A;  4DFM A;  2CGJ A;  1HNI A;  3CCJ N;  3EN9 A;  4H8K A;  3O08 A;  4WFB L;  3C6U A;  3THW A;  3MEC A;  1JLE A;  4C1N I;  3SUO A;  3VEV A;  3TAB A;  5FRM A;  4IJN A;  1OVQ A;  1L5U A;  4CZJ A;  1V4T A;  2IVO A;  4MO4 A;  3TTC A;  2XY6 A;  5AQY A;  5BRE A;  4Q0B A;  1QSY A;  3DM2 A;  2WOM A;  3JXU A;  2BE2 A;  2Y1I A;  4DR6 K;  2DY4 A;  5CZ2 A;  3AGR A;  4H4M A;  3VQ7 A;  4DV0 K;  4FM0 A;  3BZC A;  1W97 L;  3AA5 X;  5M1Q A;  3UIQ A;  5GAH P;  1VQM N;  3SBT A;  3TAN A;  5HRO A;  1HJO A;  1CLQ A;  4K25 A;  4NCG A;  1E4G T;  3CIP A;  1TYQ A;  3OW2 M;  3AVK A;  2NRT A;  1ASU A;  3LPU A;  4ISF A;  3W3D A;  3DWL A;  1WOQ A;  4ISG A;  5KPT A;  5JMV A;  1C0F A;  2GTD A;  3A2F A;  4LSL A;  2F8T A;  3DLK A;  4CHY A;  5SWM A;  3AVL A;  5CYM A;  4JI7 K;  3C6H A;  3C6A A;  3CF5 L;  1NJW A;  3CJB A;  3VQC A;  4LF4 K;  3T1H K;  2XY7 A;  1W7A A;  3V9S A;  3J7Y P;  3VQB A;  1ZYQ A;  1NJX A;  4M3U A;  3C7N A;  3DMJ A;  1VSD A;  1X3N A;  4YDU A;  2Q3S A;  4K42 A;  4B9N A;  3K5O A;  2P9L B;  2ZM6 K;  2HBJ A;  4CGI A;  1I39 A;  1KLM A;  3KZB A;  3WXM B;  3L2U A;  3LM9 A;  4E1J A;  4KHY A;  5AQK A;  2G8W A;  2HF3 A;  4YHH K;  2P9K A;  2KFZ A;  4K41 A;  4GV9 A;  5AZJ A;  2KHO A;  2IS3 A;  4DB3 A;  3P39 A;  3A0I X;  4PQU A;  2UUC K;  3F2K A;  3VGM A;  3KLH A;  2B6A A;  1SL2 A;  3VQ8 A;  4FLV A;  3O1B A;  2E1Y A;  2RF2 A;  3VQ4 A;  1YIT N;  3ZT4 A;  4CJQ A;  4GNI A;  3OYG A;  4AHV A;  1MWM A;  4WQ5 A;  5AZI B;  3OYC A;  2G8F A;  3TTD A;  5KGX A;  4DFK A;  4Z0U A;  2HHV A;  4Z4C A;  4HCC A;  2KZM A;  4E89 A;  4QS9 A;  2NZT A;  4BE0 A;  4OKJ A;  3FZK A;  4OLA A;  1XNR K;  3O3H A;  3H45 C;  2X74 A;  2UXC K;  4ZTJ A;  2HHX A;  5J2M A;  5I9E B;  5AQS A;  2HST A;  3FZF A;  2Q1N A;  5EVZ A;  1NJY A;  2G8V A;  4DQ8 A;  1CXU A;  3I56 N;  3PIO L;  2QXF A;  3K5N A;  2D4W A;  2HNZ A;  3WQT A;  3V6D A;  2F96 A;  4M63 C;  3I0R A;  3NH1 A;  2GUI A;  2IVP A;  2W41 A;  2Z1I A;  2XRI A;  3SPY A;  2HVI A;  1NG9 A;  2ATQ A;  5C0Y A;  3VQ9 A;  3E9L A;  2UU9 K;  1WLJ A;  4MFB A;  1KXP A;  5C10 A;  1B9D A;  1HUX A;  1U47 A;  4KTZ A;  1EET A;  3AY9 A;  4CJK A;  4CGF A;  4B9L A;  3AVM A;  4IFE A;  3HYF A;  1QVG M;  3IAY A;  4KBO A;  4DFJ A;  1U49 A;  4FOE A;  3WQU A;  3ZSZ A;  1TKD A;  1S72 N;  3QDK A;  1VQ5 N;  4RCH A;  2VCP A;  3MCA B;  2QI2 A;  1YJW N;  4JS4 A;  3L4I A;  4CGG A;  1R59 O;  4ZHR A;  3QEP A;  3VEO A;  2PZS A;  1FW6 A;  3FZH A;  4K8X A;  4PY5 A;  4EP5 A;  3I55 N;  3R3L A;  4CJP A;  4BAC A;  3O4N A;  3R6M A;  3JAM O;  2WUS A;  5ADX H;  3AVA A;  4XH1 A;  1EO1 A;  1EX4 A;  4R79 A;  4BE2 A;  1OVY A;  2F7T A;  1YHQ N;  5JLF A;  3QER A;  2ZGY A;  5JVG L;  1S6Q A;  1FJG K;  3QIO A;  4B9T A;  2UXD K;  4CJL A;  1U6Z A;  5LL6 Z;  4YOR A;  1NNE A;  4BRH A;  4CJ5 A;  4CZE A;  1NLV A;  3CC2 N;  2P9P B;  4B9M A;  4DQI A;  3ZT0 A;  4KH5 A;  1EWQ A;  3LDQ A;  1RCH A;  4I7F A;  2P9I A;  3VMF B;  4C8N A;  4JI1 K;  2QXL A;  2E2Q A;  3M1F A;  4DMN A;  5HBM A;  1W2B M;  3CI5 A;  1VHX A;  2YHW A;  3THV A;  1Q9Y A;  1WNS A;  4WQ4 C;  3LWL A;  2QKB A;  4M3X A;  1SL0 A;  3LDP A;  4KKO A;  3QNO A;  3EZW A;  4BRD A;  4F2R A;  1ILY A;  4JK7 A;  2YNH A;  3OJS A;  3V9U A;  4FK0 A;  4M3W A;  4JI2 K;  3TTF A;  2YHX A;  4IOC L;  1A5W A;  4CK3 A;  4JK8 A;  4BE1 A;  2QWO A;  3K9J A;  4CHN A;  4FYD A;  3QNN A;  1LW0 A;  1IKY A;  3P1G A;  3QIP A;  1IO2 A;  4QOZ B;  1P8Z A;  1VQ9 N;  3VQD A;  3H1V X;  3OTO K;  3NMU A;  3WXJ A;  2AA4 A;  5HL7 L;  4BR2 A;  4MDA A;  2E88 A;  5JS2 A;  1REV A;  4CJE A;  3KLE A;  2ASM A;  2BAN A;  5HRP A;  1P90 A;  2NRX A;  1RTD A;  2AJQ A;  3OYN A;  2FBV A;  3A5L C;  3TAF A;  1BCM A;  3VN5 A;  1HRH A;  1NU0 A;  2VGN A;  4NCA A;  3LDL A;  3G6E N;  2B5J A;  5ELZ A;  3R9P A;  1HNZ K;  3OY9 A;  3SJH A;  4Z4H A;  3CMA N;  3OBY A;  1DGK N;  1C1A A;  1WSI A;  4JV5 K;  4CFD A;  4M3Y A;  2FBY A;  3GBT A;  5K14 A;  1JLF A;  1WUA A;  4JLH A;  5BN8 A;  2YNG A;  5KPR A;  1WSH A;  4KRF A;  1GLA G;  1OH6 A;  3K58 A;  1Z26 A;  1KFD A;  4DUY K;  4DV3 K;  2HOE A;  3CQ8 A;  5DMR A;  3KWG A;  5AQI A;  1VRU A;  3OVN A;  3ASM A;  4CGD A;  3NH2 A;  1JLA A;  3EKU A;  1BA1 A;  4BDP A;  4FK4 A;  4KPY A;  3NGZ A;  1Q81 O;  4PUO A;  1EXQ A;  3O9Q A;  1GLJ O;  4IFY A;  1Q7Y O;  4LD0 A;  1NGJ A;  1IBK K;  3WT0 A;  3L4Q A;  4FJ9 A;  4FM2 A;  2O8B A;  1QHA A;  4CZM A;  1M90 O;  3CCR N;  2P9U A;  5AQR A;  3HZ6 A;  1HKB A;  3CQX A;  1RT2 A;  5TKW A;  3PO5 A;  2ITG A;  3JYT A;  4L3Q A;  4O4G A;  1QZ6 A;  4PKG A;  5M1N A;  4DR7 K;  1DTQ A;  3RTV A;  3LDO A;  4CJ3 A;  3CD6 N;  4CEF A;  1VSJ A;  3K2P A;  1VSE A;  4MLE A;  5AZJ B;  1FKP A;  3C95 A;  3L3V A;  3VGK A;  1WBD A;  3K0S A;  3VEW A;  3PUF A;  4FJN A;  2QWP A;  2EHG A;  2JGU A;  4WQ5 C;  3HPG A;  3KKS A;  1JJ2 M;  2E5L K;  3ULE B;  3LAK A;  4H0Y B;  4Z4I A;  3QIN A;  1VQ6 N;  1WAJ A;  4CF1 A;  4CD3 A;  3D2E B;  1XQS C;  4KRE A;  3QEV A;  2KZZ A;  4ISE A;  3NDK A;  3RMB A;  3H46 O;  3SQ2 A;  1XC9 A;  5AJ3 K;  4IJA A;  4LC9 B;  4DV5 K;  3LP2 A;  5M1O A;  3UB5 A;  4PKH A;  2ZE2 A;  3M6G A;  5AQP A;  2HHW A;  3AAP A;  1EP4 A;  1TL3 A;  3UE5 A;  4CEO A;  5AFU A;  5AR0 A;  3AO5 A;  3SQ0 A;  3DRR A;  3P31 A;  2OPR A;  1JLC A;  3QET A;  4DTR A;  3O80 A;  1NGD A;  4QCL A;  3O5B A;  4BC4 A;  5I3U A;  3T1A A;  1J5O A;  4CEE A;  4X65 K;  4BC2 A;  5AQL A;  4MQ3 A;  3DXM A;  3UKU A;  2LSN A;  3THY B;  1YIJ N;  3CQY A;  3KD5 E;  2E1Z A;  5EY4 A;  4KHQ A;  1JLB A;  1SKR A;  1GLF O;  3KK1 A;  2QWM A;  3TAM A;  4JK9 A;  2W40 A;  3T19 A;  4K8Z A;  4ICL A;  3IRX A;  2YV0 X;  4CGJ A;  4DLE A;  1L3S A;  4EP4 A;  4OPA A;  3FE1 A;  1IBL K;  3ZET B;  4JKG B;  2X78 A;  1V4S A;  3HK2 A;  4FLZ A;  5BRF A;  3DRS A;  3CCV N;  4H5N A;  2W6L A;  1YAG A;  2HMI A;  1HMV A;  3JSM A;  1RTH A;  2YNF A;  3WXL A;  4JRQ A;  4CD1 A;  1XHX A;  3G71 N;  4CJF A;  2VG7 A;  3CPE A;  4H0P A;  2D5R A;  2IDO A;  4CJ4 A;  4JI3 K;  5HRR A;  2G8H A;  1S9G A;  3EY1 A;  4OX9 K;  1XMO K;  4PL7 A;  3ZX0 A;  3THX A;  3KD1 E;  4CF2 A;  2VGM A;  3OJU A;  4Q5V A;  5HRS A;  3TAQ A;  3B6P A;  3ATU A;  4AM7 A;  4FJM A;  2P1J A;  3H08 A;  4CFB A;  2ASP A;  4RWT A;  1NK8 A;  1NGF A;  1HLU A;  3MX5 A;  3IUC A;  3MXJ A;  4B1Z A;  4PL8 A;  3QEI A;  3K5M A;  3O3F A;  3DLH A;  3LAL A;  1D9F A;  4YY3 K;  2YNI A;  4DKW A;  5JLH A;  3THW B;  4JI6 K;  5FRN A;  3CFO A;  5E26 A;  5SZT A;  2HHH K;  1VQ4 N;  2GEL A;  3OYL A;  1K6Y A;  4LSN A;  3A8Y A;  2KW4 A;  3C7N B;  4I2Q A;  1VQO N;  3IS9 A;  2P9L A;  1TUU A;  5M1F A;  3BF3 A;  4CK2 A;  1I94 K;  3OYF A;  4GV6 A;  4FM1 A;  2A3Z A;  2YKM A;  3AVJ A;  2FF6 A;  4O8K A;  1BA0 A;  2AP1 A;  1WSG A;  3RR7 A;  1S9E A;  3OA9 A;  4OJR A;  4B1V A;  2OCE A;  1TAQ A;  3C0B A;  4HUG A;  3SCX A;  2RKI A;  2PY5 A;  4WF9 L;  3CJA A;  2FSN A;  3AA4 A;  4FLY A;  4C8O A;  3G10 A;  4FXD A;  5KTQ A;  5BPL A;  4GY2 B;  1BL3 A;  1RDB A;  4W5O A;  5HRN A;  2R7Y A;  3CFP A;  3V9Z A;  1VQN N;  3OS0 A;  3PX4 A;  3E9P A;  2V7Z A;  1NGG A;  3N4P A;  1Z6R A;  3VEX A;  4DQS A;  3TSU A;  3ID8 A;  4OPK A;  4PKI A;  1ATR A;  4DQR A;  3SYZ A;  1HNV A;  3OYI A;  4I9L A;  4UY8 O;  4DHY A;  1S5J A;  3F5T A;  3DLR A;  3HOS A;  4A57 A;  1GLE G;  1NGE A;  3VA0 A;  1KAX A;  3S3O A;  3L2Q A;  4DSE A;  5BRD A;  3J8A A;  4A61 A;  1LAV A;  4J2E A;  4YOV A;  3K5L A;  3BUZ B;  3CM5 A;  2HMP A;  1BO5 O;  1K73 O;  3BDP A;  2PYJ A;  4X64 K;  4YOW A;  2FSK A;  4H03 B;  3V81 A;  2BGG A;  3CPW M;  4H5R A;  5KRS A;  4HUF A;  4BRQ A;  3CM6 A;  2KLA A;  3FZM A;  2QKK A;  4B8C A;  3WEE A;  3EEQ A;  1U2V B;  1ASW A;  1C0M A;  4DLG A;  1LW2 A;  3RMC A;  1JL1 A;  2O4I A;  2VWK A;  3P4I A;  1VQ7 N;  4JKE A;  3ZYY X;  2YJE A;  3HI0 A;  3RMA A;  3NF8 A;  3EE8 A;  3KHY A;  3KK7 A;  4DTS A;  3T7Z A;  1NJZ A;  4CZI A;  3AVG A;  4Z4G A;  1HYV A;  4LH4 A;  4NYN A;  1ATN A;  4BRE A;  2NRR A;  3ENB A;  2O8F B;  4KH4 A;  4X66 K;  3O9R A;  4JKH A;  1ESV A;  3TSQ A;  3E1Y A;  3EKS A;  3EE9 A;  4IXC A;  3D45 A;  5KGW A;  4CJV A;  3I8D A;  3AO4 A;  1XC3 A;  3KTQ A;  2OZM A;  2D0A A;  3AO1 A;  5M1K A;  3ZSR A;  4BGB A;  3NH0 A;  2E2N A;  4O0I A;  4I9Q A;  4OKK A;  4FWL A;  4IWV A;  4IEI A;  4GW6 A;  3VPZ A;  1KAY A;  3O6W A;  4O44 A;  3PSF A;  2A1S A;  2E6M A;  4L8R B;  1RT3 A;  1BIU A;  1NMD A;  4B1W B;  4FWS A;  4FPA A;  4AHU A;  5LY3 A;  1YJ9 N;  2F8S A;  4FWQ A;  1XHZ A;  2QWQ A;  3FFK B;  3QLH A;  1SQK A;  5ADX A;  3CJ9 A;  4FWR A;  1RBT A;  1D9D A;  4N5S A;  4DFP A;  3PX0 A;  5KQ8 A;  3ITH A;  1JXB A;  2RN2 A;  4OPH A;  3HL8 A;  4ELT A;  3IG1 A;  3R8E A;  2B4J A;  2OPP A;  1TKZ A;  2P9N A;  3TPQ A;  4OKE A;  1NGA A;  4BRK A;  1YVU A;  2YKN A;  4BRP A;  3R1X A;  3Q7C A;  1D5A A;  3KLF A;  3JS6 A;  4LH5 A;  1QHT A;  3TSP A;  3PSI A;  3EO3 A;  1BQM A;  3LWM A;  5FLX O;  4BRA A;  3VQ5 A;  3ZCM A;  3KK2 A;  5B8H A;  3OYE A;  1KVB A;  1TKT A;  4DU1 A;  3QO9 A;  4CK1 A;  4FO0 A;  1NMN A;  1RFQ A;  4IBN A;  2A40 A;  1OH5 A;  1BUP A;  3SLC A;  1LOT B;  5DK5 A;  5KPZ A;  3P83 D;  1MDU B;  2DFH A;  4E1N A;  3CC7 N;  2PAV A;  4M3Z A;  1HX1 A;  2HND A;  4QAG A;  1S1X A;  1WAF A;  1FK9 A;  2IC3 A;  3O1W A;  4LF7 K;  2YCH A;  3MCP A;  1S1T A;  3NCI A;  3Q7B A;  3VQA A;  4J2A A;  4C8M A;  4KHS A;  1O1W A;  1C1C A;  2IVN A;  4GV3 A;  1ZBF A;  4V19 S;  3T1Y K;  3SBG A;  3MN6 A;  4WQ4 A;  3AVF A;  4M3T A;  5I42 A;  3QEX A;  2XY5 A;  3D0P A;  5AQG A;  1XMQ K;  4B3M K;  5F0X A;  2D0C A;  1HYZ A;  5JIC A;  5HOO A;  4HHT A;  4DTP A;  5AQM A;  4X62 K;  1EKE A;  3HVT A;  1C0G A;  4A5B A;  1X9M A;  1RIL A;  2HHU A;  3TAE A;  1QSL A;  5LMU K;  5AQV A;  4F3O A;  1TUY A;  4O55 A;  4B9U A;  1HPM A;  4JEP A;  1S1W A;  3HTV A;  2KKZ A;  3H6E A;  3RSE A;  4CBW A;  3ZEU A;  4M3R A;  4BDZ A;  1BGX T;  3CME N;  5AQF A;  3P5J A;  3O8M A;  1XI1 A;  1G99 A;  1B9F A;  3U9D A;  1CZ9 A;  1N8R O;  3RVC A;  4ID1 A;  4EAH D;  4NLC A;  4FWK A;  3SAH A;  4M7X A;  3AAR A;  4RW8 A;  2DTU A;  4NYF A;  4CJW A;  3U3Y A;  5LJW A;  3RRH A;  4B3R K;  3DRP A;  4OPJ A;  2OA8 A;  3K9K A;  4DSF A;  1H1V A;  1S1U A;  1TV6 A;  1HR0 K;  3B6O A;  4BVP A;  2KTQ A;  1X1P A;  2ASO A;  2ZWH A;  2CGL A;  3U6F A;  3MWP A;  1X9W A;  3NHG A;  4BRM A;  5GAE P;  5FPD A;  4OLB A;  1C0T A;  4F8R A;  5EU7 A;  4B9S A;  4DSL A;  4GVM A;  3T69 A;  4CZF A;  3K57 A;  2XY8 A;  3PV8 A;  1RDA A;  4U67 L;  4CW7 B;  1BWF O;  3SQ4 A;  1RTJ A;  3AVB A;  2O8B B;  3VQ6 A;  2Q36 A;  1TK5 A;  1DKG D;  1T6D A;  3OYA A;  3B8A X;  3F9M A;  5H1S Q;  4RG8 A;  1BIZ A;  1WB9 A;  3ZX2 A;  5AQN A;  5A2Q O;  2FBT A;  4CEB A;  1Q86 O;  3NE6 A;  3HM8 A;  4O0J A;  4YOX A;  1HNX K;  2E20 A;  1MU2 A;  2V51 B;  2VYP A;  1KFS A;  2Z1J A;  3DOL A;  2E4L A;  3RSE B;  5GIO A;  5EX5 A;  4BRC A;  1C0U A;  3BEX A;  4N76 A;  1XWL A;  3DXM B;  3TAG A;  2A41 A;  3OYK A;  3NGY A;  4WE1 A;  1FKO A;  3HSC A;  2Q0R A;  1TK0 A;  1NGB A;  2NRH A;  3G0Z A;  1J53 A;  4B3T K;  3WNE A;  2NNW A;  2P9N B;  2D1K A;  4JI0 K;  3DLG A;  4JAX A;  3KK3 A;  4JI8 K;  3KLI A;  4DV7 K;  3TWH A;  1QTM A;  1YT3 A;  4IOA L;  4A2A A;  1SKS A;  1SKW A;  1RBU A;  4Z4E A;  1HQU A;  1KD1 O;  2CGK A;  4DSJ A;  4FJX A;  1BU6 O;  2E2O A;  2IOC A;  1NGH A;  3ISN C;  4M7Y A;  1KTQ A;  2Q97 A;  1NKE A;  5BPN A;  1EQY A;  4FW1 A;  4FJH A;  3MAQ A;  2YX6 A;  4FJI A;  2RHK A;  1IH7 A;  5BPM A;  1YTU A;  3DAW A;  4ID5 A;  2E6L A;  3N4Q A;  3DLB A;  1LWE A;  4BRG A;  3KVG A;  3H3N O;  3HRG A;  4EHU A;  3THX B;  3LZI A;  3J80 O;  1K9M O;  1KC8 O;  1HKG A;  3SUP A;  1GLB G;  4FZZ A;  5CYQ A;  4FCY A;  2HHQ A;  3CFR A;  3NFA A;  4RW4 A;  1ATS A;  3AO3 A;  3AGK A;  5AQO A;  4DQP A;  4CFC A;  2X6S A;  4FL9 A;  4M42 A;  1E4F T;  3MWT A;  3HT3 A;  4OGC A;  3SZ2 A;  1X9S A;  3HOT A;  5AQZ A;  1ASV A;  1UAX A;  3VA3 A;  2ZJR L;  2WBN A;  5FPM A;  2I7P A;  4LF6 K;  2F9T A;  1UA0 A;  3OHR A;  2JWL A;  1VSF A;  4LFB K;  4FWO A;  2ZF5 O;  3HJF A;  4UQG A;  1RBR A;  1U4B A;  2BTF A;  3CG7 A;  3LP3 A;  1JCE A;  4ELV A;  4CZG A;  4WFN L;  4Y1D A;  3SMS A;  4YOT A;  3FGU A;  2W6K A;  1FXX A;  2DFF A;  3E01 A;  3O9T A;  4BR0 A;  3MK6 A;  4BQZ A;  3ZSQ A;  4FLW A;  1BDG A;  3UKR A;  1Z25 A;  1VRT A;  1T05 A;  1ITG A;  2JWK A;  2ITM A;  3PLA A;  2QWR A;  3IDH A;  4DS4 A;  3MED A;  4RW9 A;  3FZL A;  4E0D A;  3IKM A;  3HM9 A;  4AQY K;  3VQE A;  3VF6 A;  1K8K B;  2IAJ A;  3KWI A; 
#chains in the Genus database with same CATH homology
 1UWB A;  3WNG A;  1WN7 A;  3M8Q A;  2HNY A;  3S3O A;  3L2Q A;  4JS4 A;  4DSE A;  4AHS A;  4CGG A;  4ZHR A;  3QEP A;  3TAP A;  4N41 A;  4FJK A;  1LAV A;  1HPZ A;  3HST B;  4J2E A;  1WSF A;  3K5L A;  3NAE A;  2X6N A;  2PZS A;  3PX6 A;  5C25 A;  1TK8 A;  3CM5 A;  5KRT A;  4K8X A;  3RMD A;  4PY5 A;  4EP5 A;  3CYM A;  3C6T A;  4CJP A;  3L2R A;  4BAC A;  3MXM A;  2NUB A;  3O4N A;  1UA1 A;  3BDP A;  4W5Q A;  3EZ5 A;  2PYJ A;  1GOA A;  3AVA A;  2A1R A;  1HYS A;  1EX4 A;  2W42 A;  4BE2 A;  3S3M A;  3V81 A;  5J2N A;  2BGG A;  3QER A;  1S6Q A;  1BQN A;  2ETJ A;  3QIO A;  5KRS A;  4HUF A;  1JLG A;  4B9T A;  3CM6 A;  4HCB A;  4CJR A;  1RT6 A;  1T03 A;  2QKK A;  4B8C A;  5C42 A;  4CJL A;  1TKX A;  3V1Q A;  1RDD A;  1ASW A;  1C0M A;  1GOC A;  2DFE A;  1LW2 A;  4DLG A;  1JL1 A;  3RMC A;  3TAR A;  4B9V A;  4IKF A;  2O4I A;  4KI4 A;  4CJ5 A;  2VWK A;  4DTX A;  3V1O A;  1DLO A;  4EZ6 A;  1ZBL A;  4BWM A;  3TI0 A;  2GV9 A;  3PO4 A;  1RDC A;  3SUN A;  1L3V A;  3RMA A;  1A5X A;  3NF8 A;  1QE1 A;  4B9M A;  4DQI A;  3ZT0 A;  4JRP A;  3HP9 A;  4DTS A;  5D3G A;  1RCH A;  4I7F A;  5HLF A;  1NJZ A;  3HO1 A;  4C8N A;  3AVG A;  3SV3 A;  4Z4G A;  1HYV A;  4LH4 A;  4NYN A;  2KQ2 A;  3V9W A;  2G8I A;  4DMN A;  4AHC A;  5HBM A;  4HUE A;  4E7K A;  3DOK A;  3HPH A;  4RW6 A;  3THV A;  1NKC A;  1Q9Y A;  1N5Y A;  2KFN A;  1S6P A;  1VSI A;  1WNS A;  2OPS A;  4B3O A;  4DF4 A;  3D45 A;  1BHL A;  3LWL A;  4FJ8 A;  4M3X A;  5KGW A;  2IGI A;  1TGO A;  4CJV A;  1SL0 A;  1ZBH A;  2QKB A;  4KKO A;  3QNO A;  3I8D A;  3AO4 A;  2OZM A;  1LV5 A;  3KTQ A;  1RBS A;  2D0A A;  3LAM A;  3AO1 A;  4F2R A;  3V9X A;  3ZSR A;  2D0B A;  1RT1 A;  4I9Q A;  3NH0 A;  4CF9 A;  4O0I A;  2OZS A;  2F8T A;  4OKK A;  3S3N A;  1KLN A;  3RR8 A;  3SJJ A;  2YNH A;  4GW6 A;  3OJS A;  1SL1 A;  3V9U A;  4FK0 A;  4M3W A;  4DTN A;  4CCH A;  1A5W A;  4O44 A;  1KRP A;  4PA1 A;  4CK3 A;  4E19 A;  1NOZ A;  4BE1 A;  2A1S A;  1I3A A;  2E6M A;  3M8P A;  4CHN A;  1NK4 A;  4L8R B;  4FYD A;  2HHS A;  1RT3 A;  1BIU A;  1W9H A;  3QNN A;  1LW0 A;  1IKY A;  3P1G A;  5FRO A;  3QIP A;  4AHU A;  1IO2 A;  4FJJ A;  3PY8 A;  2F8S A;  4QOZ B;  1XHZ A;  3VQD A;  4XIU A;  1JLQ A;  3FFI A;  3QLH A;  4CJT A;  1UOC A;  3MEG A;  1RBT A;  4BDY A;  4FW2 A;  1D9D A;  4N5S A;  4E7I A;  4DFP A;  2BDP A;  3PX0 A;  5JS2 A;  3ITH A;  1JXB A;  1REV A;  1CZB A;  2RN2 A;  4CJE A;  3KLE A;  3HL8 A;  4DU4 A;  2BAN A;  3IG1 A;  2B4J A;  2OPP A;  5HRP A;  1R0A A;  1TKZ A;  4ELT A;  4O5B A;  4EZ9 A;  3AVC A;  2Z1G A;  4FJ5 A;  1L3T A;  1RTD A;  2AJQ A;  3OYN A;  2FBV A;  1F21 A;  2YHB A;  1BCM A;  4OKE A;  3VN5 A;  1BI4 B;  3OYD A;  3L2W A;  3TAF A;  1HRH A;  4NCA A;  1YVU A;  4HTU A;  2YKN A;  4YNQ A;  3KIO A;  3ZSO A;  2B5J A;  4AHR A;  2I5J A;  1J54 A;  1D5A A;  3NF9 A;  3OY9 A;  3KLF A;  1KSP A;  2G8U A;  1T7P A;  4KHU A;  4LH5 A;  4CF0 A;  4Z4H A;  1QHT A;  3QEW A;  4OVL A;  2HB5 A;  1BQM A;  4YFU A;  3LWM A;  3NGI A;  4AH9 A;  1C1A A;  4KO0 A;  1WSI A;  1IKX A;  4HVJ A;  1ZBU A;  4CFD A;  4M3Y A;  3VQ5 A;  1S1V A;  2FBY A;  3ZCM A;  3U3G A;  3OYE A;  3KK2 A;  3SUQ A;  1KVB A;  3BGR A;  5K14 A;  4CIG A;  1JLF A;  1SUQ A;  1NK9 A;  1TKT A;  4TSX A;  4JLH A;  4J2D A;  3WNF A;  3QO9 A;  4DU1 A;  3TR8 A;  3ZSY A;  4CK1 A;  4IBN A;  1KVC A;  3RWU A;  2YNG A;  1WSH A;  3O3G A;  5CZ1 A;  5DK5 A;  4PWD A;  3LP0 A;  4KRF A;  3P83 D;  2DFH A;  4E1N A;  3I0S A;  3K58 A;  3AVI A;  3LDS A;  3AV9 A;  4N56 A;  1WSJ A;  4M3Z A;  1QS4 A;  1Z26 A;  4DTM A;  2HND A;  1KFD A;  2HHT A;  3DLE A;  3OYB A;  1J9A A;  4QAG A;  1S1X A;  4CEZ A;  3CQ8 A;  1WAF A;  1BI4 A;  1FK9 A;  2IC3 A;  4FVM A;  5DMR A;  4CEC A;  4G1Q A;  1VRU A;  4I2P A;  2P5O A;  3OVN A;  1S1T A;  3NCI A;  3ASM A;  4CGD A;  3NH2 A;  1JLA A;  4Y1C A;  3QES A;  3M8S A;  4BDP A;  4FK4 A;  3VQA A;  4KPY A;  3NGZ A;  4J2A A;  4PUO A;  4KV8 A;  1EXQ A;  3AA3 A;  1BCO A;  4C8M A;  4KHS A;  1O1W A;  2HVH A;  4IG3 A;  2FC0 A;  1C1C A;  4IFY A;  3V4I A;  1ZBF A;  4LD0 A;  3ZT3 A;  3ZSV A;  4FZX C;  1JL2 A;  1A5V A;  2GBZ A;  3C94 A;  2XO7 A;  4E7H A;  3AVF A;  1SV5 A;  4FJ9 A;  4M3T A;  4FM2 A;  5I42 A;  3SNN A;  3QEX A;  2XY5 A;  3D0P A;  4DG1 A;  4E3S A;  4GMJ B;  4KHN A;  2OPQ A;  3ZT1 A;  5E41 A;  2D0C A;  2P51 A;  1YTA A;  1HYZ A;  4W5T A;  4DWI A;  1LWC A;  4HHT A;  4DTP A;  5JS1 A;  1RT2 A;  3PO5 A;  3RRG A;  2ITG A;  1EKE A;  3JYT A;  1WSE A;  3HVT A;  4OGE A;  3EYZ A;  4FLX A;  4DTJ A;  4O4G A;  4Z4F A;  4CJU A;  1X9M A;  1LAW A;  1RIL A;  3TAE A;  2HHU A;  4IDK A;  1QSL A;  1DTQ A;  4CF8 A;  4RW7 A;  4F3O A;  1U04 A;  3RTV A;  4O55 A;  4B9U A;  1KCF A;  4IG0 A;  4CJ3 A;  4CEF A;  1VSJ A;  3K2P A;  3MEE A;  1VSE A;  1S1W A;  3WNH A;  4J2B A;  1KVA A;  3LP1 A;  4IFV A;  5FDL A;  1FKP A;  4DQQ A;  4LY7 A;  4M3R A;  3C95 A;  4BDZ A;  2WON A;  3L3V A;  1HQE A;  4C8L A;  1NOY A;  1ZBI A;  1BGX T;  3PUF A;  3AO2 A;  4FJN A;  3P5J A;  2EHG A;  4B08 A;  3MXI A;  1XI1 A;  1B9F A;  4FZY A;  4CHO A;  2JGU A;  3HVR A;  2P5G A;  1CZ9 A;  3HPG A;  3KKS A;  3OYH A;  3KLG A;  4ID1 A;  1U45 A;  4W5R A;  3SV4 A;  3HPO A;  3L3U A;  1RNH A;  3LAK A;  3NBP A;  2OYQ A;  3QIN A;  4RW8 A;  4Z4I A;  2DTU A;  4NCB A;  1VSL A;  2O4G A;  1WAJ A;  3KKR A;  4NYF A;  4CF1 A;  3L8B A;  4CJW A;  3SQ1 A;  3U3Y A;  4KRE A;  3QEV A;  1LWF A;  2KZZ A;  3KJV A;  3NDK A;  4W5N A;  1TL1 A;  3RRH A;  1RBV A;  3RMB A;  1RT5 A;  3SQ2 A;  1G15 A;  3DRP A;  4OPJ A;  1XC9 A;  1CXQ A;  2OA8 A;  2QK9 A;  1IG9 A;  4DSF A;  1DTT A;  1Y97 A;  3LP2 A;  1S1U A;  1VK0 A;  2ZE2 A;  1B92 A;  1TV6 A;  4M41 A;  3B6O A;  1NK5 A;  3ZT2 A;  2KTQ A;  2HHW A;  1X1P A;  2RPI A;  3T3F A;  1EP4 A;  4CIF A;  1TL3 A;  3F73 A;  3U6F A;  4F2S A;  3LAN A;  3OYM A;  1VSK A;  1X9W A;  4CEO A;  3NHG A;  4M45 A;  4JS5 A;  1TAU A;  1JKH A;  3AO5 A;  3SQ0 A;  4FLU A;  2ZD1 A;  3DRR A;  2VG6 A;  4R5P A;  2OPR A;  4OLB A;  4DTO A;  1JLC A;  1C0T A;  1TVR A;  4DSI A;  4F8R A;  5EU7 A;  4N47 A;  4FLT A;  3QET A;  4DTR A;  2VG5 A;  4QCL A;  1IKW A;  1L3U A;  4ELU A;  3DI6 A;  4B9S A;  4DSL A;  5I3U A;  3T1A A;  1C6V A;  1J5O A;  3AVH A;  4DFM A;  4CE9 A;  4CEE A;  4GVM A;  1HNI A;  4CFA A;  4MQ3 A;  3K57 A;  2XY8 A;  4H8K A;  1RDA A;  4B8A B;  3PV8 A;  3C6U A;  2VWJ A;  2LSN A;  3MEC A;  1HJR A;  1JLE A;  3SQ4 A;  3OS1 A;  3SUO A;  1RTJ A;  4C8K A;  3TAB A;  3KD5 E;  3AVB A;  3DYA A;  5FRM A;  4CIE A;  4KHQ A;  3VQ6 A;  1TK5 A;  1JLB A;  1SKR A;  3KK1 A;  2PYL A;  3TAM A;  1L5U A;  3OYA A;  3T19 A;  2XY6 A;  3VQQ A;  4K8Z A;  4ICL A;  3IRX A;  4RG8 A;  4Q0B A;  1BIZ A;  1QSY A;  3DM2 A;  2YV0 X;  4CEA A;  4KB1 A;  4CGJ A;  2WOM A;  2FBT A;  4CEB A;  4DLE A;  2BE2 A;  2Y1I A;  1L3S A;  2DY4 A;  5CZ2 A;  5T7B A;  4H4M A;  4O0J A;  3VQ7 A;  4EP4 A;  3NE6 A;  4FM0 A;  3AA5 X;  4KTW A;  1MU2 A;  3UIQ A;  1KFS A;  2Z1J A;  3DOL A;  2X78 A;  3TAN A;  4KB0 A;  3HK2 A;  4H4O A;  2E4L A;  5HRO A;  3O4Q A;  4CJS A;  1CLQ A;  4NCG A;  4FLZ A;  1C0U A;  3DRS A;  3AVK A;  2XHB A;  1ASU A;  4N76 A;  1XWL A;  3LPU A;  2JLE A;  4DTU A;  2HMI A;  1HMV A;  3JSM A;  3TAG A;  4F4K A;  1RTH A;  5CY4 A;  3OYK A;  2ZQB A;  3NGY A;  2YNF A;  1FKO A;  4WE1 A;  4JRQ A;  3M8R A;  3S9H A;  1XHX A;  3A2F A;  4LSL A;  1TK0 A;  4CJF A;  2VG7 A;  3DLK A;  3NF6 A;  3AA2 A;  4CHY A;  3AVL A;  5SWM A;  1VSH A;  5CYM A;  1Q9X A;  4DF8 A;  2D5R A;  1NJW A;  2IDO A;  3G0Z A;  1J53 A;  4CJ4 A;  3F9K A;  3VQC A;  3WNE A;  2XY7 A;  5HRR A;  2G8H A;  1S9G A;  3EY1 A;  3V9S A;  3DLG A;  4CEQ A;  3VQB A;  2Y1J A;  1ZYQ A;  1NJX A;  4M3U A;  3KK3 A;  3KD1 E;  3DMJ A;  4CF2 A;  1VSD A;  3KLI A;  2Q3S A;  1QSS A;  4B9N A;  4DS5 A;  4ZTF A;  2EX3 A;  3K5O A;  3OJU A;  4Q5V A;  5HRS A;  3TWH A;  3TAQ A;  1YT3 A;  3B6P A;  1N6Q A;  1QTM A;  4KI6 A;  4FJM A;  4CGI A;  2P1J A;  1I39 A;  3H08 A;  4AHT A;  4CFB A;  1KLM A;  1SKS A;  1NK8 A;  1RBU A;  1SKW A;  4Z4E A;  1HQU A;  3L2U A;  4CGH A;  3OS2 A;  3LPT A;  4KHY A;  4DSJ A;  4FJX A;  2G8W A;  2IOC A;  3MXJ A;  3HXM A;  1VSM A;  2KFZ A;  3NF7 A;  3ISN C;  3SPZ A;  1KTQ A;  3QEI A;  2IS3 A;  4CHQ A;  3K5M A;  3ZSX A;  4CED A;  3SI6 A;  3L2V A;  1NKE A;  4FW1 A;  3O3F A;  4DU3 A;  3LAL A;  3DLH A;  4FJH A;  4PQU A;  3MAQ A;  1D9F A;  3KLH A;  2YNI A;  4FJI A;  1IH7 A;  2B6A A;  4E7J A;  1SL2 A;  3VQ8 A;  4FLV A;  3V1R A;  5FRN A;  1YTU A;  4ID5 A;  2E6L A;  3CFO A;  5SZT A;  1NKB A;  1IKV A;  2RF2 A;  3VQ4 A;  3DLB A;  1LWE A;  3ZT4 A;  4CJQ A;  3OYG A;  4AHV A;  3OYL A;  1K6Y A;  4LSN A;  3OYC A;  2KW4 A;  2G8F A;  2G8K A;  4I2Q A;  3LZI A;  5KGX A;  3IS9 A;  4DFK A;  4AIL C;  3SUP A;  4FZZ A;  4Z0U A;  3ZSW A;  5CYQ A;  4CK2 A;  4Z4C A;  4FCY A;  5C24 A;  4BWJ A;  4DSK A;  4HCC A;  2HHV A;  2KZM A;  4E89 A;  3OYF A;  2HHQ A;  2HW3 A;  3CFR A;  3NFA A;  4RW4 A;  1RTI A;  3LZJ A;  3AO3 A;  4FM1 A;  4BE0 A;  4OKJ A;  4DQP A;  4CFC A;  3HP6 A;  2X6S A;  4OLA A;  2YKM A;  3AVJ A;  3O3H A;  4M42 A;  1QQC A;  2X74 A;  4CES A;  3HT3 A;  3ALY A;  5J2M A;  1W0H A;  1Q8I A;  1WSG A;  4OGC A;  3SZ2 A;  4ZTJ A;  1X9S A;  3RR7 A;  4FK2 A;  1ASV A;  1S9E A;  1UAX A;  3OYJ A;  4KHW A;  3VA3 A;  4OJR A;  1JXE A;  1NJY A;  1TAQ A;  2FBX A;  2G8V A;  4CER A;  4HUG A;  4CHP A;  2RKI A;  1CXU A;  4E7L A;  3SCX A;  1UA0 A;  1VSF A;  3ULD A;  2PY5 A;  4CHZ A;  1BIS A;  3K5N A;  2QXF A;  4FJ7 A;  3HJF A;  3AA4 A;  4UQG A;  1RBR A;  1U4B A;  2HNZ A;  4FLY A;  1RT7 A;  3CG7 A;  3LP3 A;  1D8Y A;  3V6D A;  3G10 A;  4C8O A;  4ELV A;  4KTQ A;  4Y1D A;  3K59 A;  2Z1H A;  2F96 A;  5J2Q A;  4KAZ A;  3I0R A;  4KFB A;  2YHA A;  5KTQ A;  3NH1 A;  4FXD A;  1FXX A;  2GUI A;  2DFF A;  1RT4 A;  5J1E A;  3E01 A;  4FJG A;  1BL3 A;  1RDB A;  4W5O A;  3ZSQ A;  5HRN A;  5KI6 A;  2R7Y A;  4FLW A;  3CFP A;  2Z1I A;  1NK0 A;  4F3T A;  1U48 A;  2XRI A;  3V9Z A;  3SPY A;  2HVI A;  2HHX A;  2ATQ A;  1Z25 A;  3OS0 A;  3PX4 A;  3VQ9 A;  1VRT A;  1GOB A;  1T05 A;  1WLJ A;  1ITG A;  1C1B A;  3AVN A;  4MFB A;  1NK6 A;  1B9D A;  4FJL A;  1U47 A;  3VQP A;  4KTZ A;  4DQS A;  1EET A;  4OPK A;  5J2P A;  4CJK A;  4CGF A;  4B9L A;  3AVM A;  4DS4 A;  3MED A;  4DQR A;  3HYF A;  3SYZ A;  3IAY A;  4DFJ A;  4RW9 A;  1U49 A;  4E0D A;  3HM9 A;  5HP1 A;  1HNV A;  3OYI A;  4I9L A;  3VQE A;  1S5J A;  1NK7 A;  3ZSZ A;  4E1M A;  1T8E A;  2IAJ A;  3DLR A;  1TKD A;  3VA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...