5M1KA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound magnesium
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
189
Chain Sequence
PAMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
total genus 66
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1kA00
5C2DA 4IDHA 4IFEA 4IEIA 5M1KA 5C10A 5C12A 5M1QA 5M1FA 3C6AA 5C2FA 3CPEA 5M1PA 5C15A 4IEEA 3C6HA 5M1NA 5M1OA
chains in the Genus database with same CATH superfamily
4CGGA 4FLUA 1TGOA 4F2SA 4IBNA 1RBUA 2KLAA 2E6MA 1HKBA 2HHUA 4KTZA 2Q2RA 5FDLA 3ID6A 4NLBA 4H5TA 4I6MA 1D9DA 4O44A 2ASMA 1SKWA 3SYZA 1YTUA 3O8MA 3O5BA 3TSPA 2W6KA 4C8KA 1Z25A 3AA2A 3O08A 3MEEA 2AP1A 4GVEA 5KPRA 3H1QA 1YI2N 3CM5A 2CGKA 3ENHA 4FLWA 4K0KK 1W9HA 4LH4A 4MO5A 3CIPA 5AQVA 1BCMA 4BC4A 1YAGA 3S3NA 4WQ4C 4ICLA 3IKMA 3IS9A 3AV9A 1QS4A 5HRRA 3NDKA 4BDYA 1ZBLA 3DLEA 2NRXA 1QSYA 3AVIA 4DMNA 3RRGA 3OYHA 5ELZA 3UKUB 4FM2A 3M5RA 2F7TA 4XH1A 5KQ8A 1VQON 4WFNL 3TTFA 4CJ3A 4M3ZA 4JRPA 2O8FB 4CHQA 1LAWA 1DT9A 4JKCA 5CE3A 2Q36A 3BZCA 1J9AA 1LV5A 1LWCA 3HSCA 3R8EA 1VSMA 1T6DA 1QQNA 4OJRA 4H5NA 4JKEA 3VQ5A 3AAPA 1RGIA 4CERA 2VYPA 4DSEA 3J80O 5HROA 1W7AA 4B3SK 3KVGA 2O8EA 1C0FA 4IKFA 1IKVA 3ZT2A 3PO4A 4ELTA 4HUEA 5BPLA 4O0IA 3SQ0A 3A2FA 4HVJA 3P31A 3VQ9A 3O9TA 4JKDA 4FJ9A 4FJGA 5MLCQ 3LWLA 4I6MB 4CD3A 1S1TA 3CCSN 1XHZA 3QLHA 3PY8A 3OYGA 1RT7A 3NGYA 1XHXA 4DTMA 1NMDA 4UQGA 1WSEA 1SL2A 1I94K 3AVBA 1U6ZA 2W40A 2O8DB 1TK5A 1JCFA 4YFUA 3LAMA 3AVKA 3M8RA 3T1AA 1NGFA 4CGFA 2X6NA 1TAUA 5AQQA 5LY3A 4M7YA 5SZTA 3VPZA 3WXJA 1T3VA 4OX9K 3TAEA 5J2NA 1BQMA 4CZEA 2ETJA 3AVLA 3D7EO 1WB9A 2P9LB 3E9PA 1RTHA 4F2RA 3HVTA 5C2DA 3P4IA 1VQ6N 3ZX0A 3DLLL 3OYMA 4OGEA 4E1NA 5JS2A 3P5JA 1EQYA 4AHSA 4F8RA 3VENA 4BRAA 4FLYA 3ZLJA 2ZJPL 4DTNA 3AO3A 1NGDA 4TSXA 2KTQA 3QETA 3KK1A 1IJJA 2RPIA 5HBMA 3VOVA 1XUPO 4PWDA 3MCPA 2OPRA 3D6RA 4I7FA 2ZGYA 5BR9A 3QEVA 3IUCA 4CHPA 3M6GA 4AQYK 4BY9C 4H0YB 3VGKA 3H1VX 4QOZB 2PBDA 4CF1A 1I39A 3VGMA 3I33A 3G25A 1VQMN 5GIOA 3RRHA 4FM1A 4DB3A 2XHBA 4WYBA 4IG0A 3VF2A 3UKRA 1A5WA 1V4SA 4DUYK 1RTDA 4C1NK 2P9PA 2P9KA 1VSEA 3VQQA 2WTUA 1Y64A 3AA5X 3IAYA 1HNWK 3D2FB 3QIOA 1QTMA 1ZBHA 3VEZA 3O4WA 1FJGK 3TAFA 1UWBA 3MX2A 4QS7A 4FPAA 1H1VA 2JWKA 2HNZA 3F9MA 2W41A 1N36K 3VQ4A 1XQSC 3V4IA 4J2DA 3WQUA 1RTIA 1U45A 4FLXA 1NNEA 4DV1K 1TVRA 2HSTA 2P9UA 3SUQA 1N32K 2GUIA 2CGLA 3CCVN 1KVBA 1BUPA 1ATSA 1GLDG 4IFEA 2YHYA 3CCQN 4FJHA 4DU1A 4FJ5A 4DU4A 4NCGA 2BUPA 1HMVA 1FXXA 4X66K 1C1BA 2YHXA 1VSKA 4O5BA 3THWB 3KWIA 4ISGA 3GOIA 4NCBA 4LY7A 3ZSVA 4FK4A 3CMEN 5AQUA 4DR5K 3CG7A 2OYQA 1W97L 3AVMA 5AFUH 4BR0A 2WUSA 4I2QA 4IO8A 4E1JA 3BEXA 3DWLA 3O1BA 3DI6A 3QNOA 3E1YA 3VEYA 2CH6A 3CCMN 3UKRB 1BDGA 3M8QA 3HP6A 4B1WB 1NOYA 3SV4A 4FJLA 4GMJB 5AQIA 3EO3A 4ISEA 4H5VA 3K57A 2P9PB 2FBXA 4CJKA 3MX5A 3E9OA 4CECA 3OYNA 4FCYA 2Q0UA 2LSNA 2FF6A 4CJ5A 2HF4A 3EKUA 1FKOA 4BQLA 2Z1GA 1YJNN 2HBKA 1J53A 4B08A 2KQ2A 5JICA 1FW6A 1TKZA 1WSJA 3DXKA 2RHKA 2YNHA 4N5SA 4OPJA 2P9UB 2F4VK 3CMAN 2W42A 4IOXA 1CLQA 4IO9L 3WXMB 3HRGA 5LMNK 2E5LK 4IOAL 4F3TA 3FFIA 3ZX3A 2XY7A 3V9SA 2X74A 5HL7L 4JHDA 4E7IA 2NRHA 3MXIA 2ZWHA 2R7YA 1U48A 1NOZA 4LF8K 3KLHA 3VA3A 2Q3SA 1S1XA 4O55A 1NMNA 5AQLA 5KPZA 1YJWN 5JS1A 3VQCA 1VQ5N 4ELVA 1HKCA 1KCFA 1WAFA 2F8TA 5T7BA 5AZJB 3WNHA 1EXQA 5HRSA 4PY5A 1BI4A 4FZXC 5J1EA 3FGUA 4CHNA 1I3AA 1TUYA 3HSTB 3VESA 3O9SA 5LL6Z 4CEFA 1FK9A 1YITN 4HHTA 1IV0A 3G0ZA 4DQPA 3AGRA 1WSFA 3OBYA 3M1FA 3TABA 1YTAA 3CJAA 3HOSA 2ZJQL 3HOTA 4BVPA 4X64K 1ZBFA 2E20A 3P38A 3AO2A 3QESA 1K8AO 5ADXH 1LW2A 1L3SA 3AVCA 4W5TA 1X3NA 4JS5A 1YJ9N 4BR2A 3CCJN 3DRRA 3H3NO 4M3UA 4AF1A 3OHRA 4B9NA 4E89A 4KKOA 3DM2A 3DXKB 3H6EA 3HZ6A 4JKFA 4MLHA 4M3RA 1A5VA 4JI5K 3HO1A 5KGXA 3KK3A 2X6SA 3RMBA 2FSKA 3KK2A 4DTJA 2ZF5O 5CY4A 3CHWA 3N4PA 2XY8A 1L3UA 3DLKA 2G8UA 4CI6A 2WONA 4CEAA 2HHQA 1KVAA 2IVNA 3SPZA 3A5MC 2F9TA 3ENBA 3VQPA 1UAXA 1D5AA 1S1VA 2JGUA 1DLOA 1S6QA 1A5XA 5AR0A 1CXUA 1HJRA 1KTQA 3O3GA 4Q5VA 1JLBA 3OVNA 3TTCA 4DKWA 2PYLA 1BI4B 3CFOA 2Q0RA 3V1QA 1VAZA 3L3VA 3A5OC 1N5YA 2ZM6K 4JI8K 4RCHA 3ALYA 4AH9A 4CZKA 2QWOA 4H4OA 4CZJA 5GIPA 2F8SA 4RTFD 4EHUA 4PL8A 2IDOA 2AA4A 4JI1K 1L5UA 2HHWA 3SJHA 2HHSA 4IFVA 2QI2A 4C23A 2QKBA 3OYKA 4PQUA 5HOOA 4BROA 4UY8O 4B1YB 4PKGA 3V6DA 4KREA 1YXQA 1RT5A 2XO7A 4C8MA 4OLAA 3CPEA 2ITGA 1Q9XA 3CJ1A 2ZQBA 3PO5A 3F5TA 4WQ5C 3EZWA 4BDPA 1MWKA 2Z1HA 2WC9A 1TKXA 4FK2A 3M3ZA 3C6AA 3TSQA 2YJEA 4IDHA 1N8RO 4DR4K 3G4SN 3SAGA 1GLJO 3CC7N 3RR8A 3VQ8A 3MXJA 1K73O 1S9GA 1C0TA 2YCHA 4HWIA 4DR2K 2P1JA 1Y97A 4FW1A 2NNWA 4K25A 4FOEA 4YDUA 4NYFA 1ZBSA 1YVNA 3ASMA 3FR0A 4H0OA 4KI4A 5HLFA 1ESVA 4DR3K 1VSLA 4I2PA 4AILC 2ATQA 3BF3A 2X78A 3WT0A 4IEEA 3K5MA 1T05A 1CZAN 5CZ2A 3GDQA 3ZSOA 3LP3A 3W0LA 2RE2A 1XC9A 3T1YK 3SI6A 5IWAK 2EX3A 1SUQA 2EWSA 4O0JA 3C6HA 4Z0UA 3MMVA 4NCAA 1HNZK 4YOXA 3ENOA 4Z4GA 2HNYA 3TSUA 3ZT3A 5C0YA 3OYDA 2YKNA 1NK8A 2HHTA 3NAEA 4JK8A 3WEEB 2IS3A 3QB0A 1EP4A 3DXMB 4CE9A 2KW4A 2D0CA 1N6QA 5JMVA 4CK3A 4BRGA 3K5NA 3FZMA 5EVZA 4HTLA 2PAVA 2F9WA 3J7AP 4OGCA 4KHWA 1L3VA 4R5PA 3OYJA 1J5EK 4B1ZA 2G8KA 3LZJA 2RKIA 4YOYA 3LDOA 2AJQA 2UXCK 1RT3A 3KTQA 4OO1J 4FJNA 4K41A 3EEQA 3NBPA 4OKEA 3FZFA 1S6PA 3OYLA 3CJ9A 3U9DA 3CJCA 1QHTA 4F9OA 5E41A 3OYCA 3S3OA 3MCAB 3THXA 1P8ZA 1HNIA 3HBTA 4FOIA 1NLVA 4BRHA 2DFEA 4WCEL 4CZGA 3HPGA 5C10A 1NGJA 1NJXA 4DV3K 3VEVA 4CJUA 2Z1JA 1X9JA 3SUPA 1DKGD 3MWPA 1XNQK 1U2VA 4DQRA 1OKJA 3QFUA 4G1QA 4N47A 1BG3A 3U3GA 4DCHA 2A41A 4CJVA 3L2VA 1VK0A 3I0SA 1D4XA 3FZKA 3RMCA 4CZFA 4Z4IA 1RDCA 1BIUA 2Q31A 4FVMA 1Z05A 3O1WA 3IFRA 4CEEA 1GLLO 3CQ8A 3O9RA 3C95A 1Q82O 2HW3A 2QXLA 4B3OA 2H3GX 4CF2A 3P1GA 3HI0A 3R1XA 4GNIA 1C1CA 4CEQA 4CHZA 4BDZA 1WSHA 5EY4A 2UXDK 1Q8IA 1LWFA 4M42A 3AY9A 2E8AA 1SKSA 1OH6A 2NRWA 1VQ7N 2E4LA 2GEMA 3QERA 4MQ3A 4DSFA 5AQHA 4CJEA 1J5OA 3K5OA 1JL1A 2G8FA 1HX1A 3LWMA 4IJNA 4O8KA 1RT1A 1HJOA 1D8YA 1P90A 3QINA 3T3FA 5C25A 4BGAA 3THXB 1G99A 4I9LA 4H4MA 5M1OA 1TAQA 5BRDA 3HYFA 5C12A 2KKZA 3NHGA 3DMJA 4CHYA 1ZBIA 2QK9A 1KRPA 4AHUA 1KC8O 4AHTA 5M1NA 3RMAA 1S9EA 1HPZA 5FPMA 5GAGP 1U2VB 4CFDA 2E2QA 4DV7K 4MFBA 5AQMA 3ZSZA 5A2QO 3T19A 4U67L 2EHGA 1VSJA 4ISFA 1RT4A 1TL1A 1T8EA 1YIJN 3OS2A 3EE8A 4CK1A 3RVCA 3ZCMA 5J2MA 3PSFA 3H3OB 4JKBA 2VCPA 4DUZK 3AA4A 3ITHA 1JCEA 3LDQA 3CM6A 3N4QA 3HK2A 3KK7A 3OYFA 4KHPK 5CR4A 1IO2A 1X9SA 1WBDA 1ITGA 4M45A 3SMPA 3TWHA 1KLNA 3NH1A 5BN9A 3SBTA 1JJ2M 3EL2A 4BRIA 4AHVA 4CEZA 4CK2A 1EX4A 2QA4N 4BG9A 4CESA 1F21A 4BRCA 1HYVA 4LH5A 1RBTA 3DLGA 4M41A 4BRNA 4KTWA 4FJJA 1NGHA 1Z6RA 1U04A 1ZYQA 4C8OA 4DV2K 4GVMA 4KFBA 3T1HK 5DK5A 3E66A 3V9XA 4B9UA 4JI7K 3V9WA 2QW9A 2FBTA 3MN7A 1NKEA 3S41A 3WQTA 1NJZA 4WFAL 4Q0BA 4RG8A 4B9QA 4X65K 3TANA 1K8KA 2D5RA 3D2EA 5KGWA 1VQNN 4GW6A 3U3YA 2ZJRL 4CJQA 2VGNA 4JAXA 3HT3A 4KB0A 2O8EB 1KSPA 2GWKA 4FJ8A 2O8BA 1VRUA 4ID5A 3UIQA 4DF4A 5KRTA 4IWVA 4CEOA 5BREA 3LP1A 1S22A 4KBOA 4DS5A 1RT6A 3V1OA 3VF6A 3I0RA 4PL7A 4Y1CA 3ISNC 1IKWA 1VHXA 4JK7A 4DLEA 3E01A 4B8AB 2GTDA 2IVPA 3WUHA 3C6UA 5I3UA 4LF6K 3TAGA 2YHWA 3OJSA 2D0PA 1JXBA 3FZHA 4JI6K 2FBYA 4M63C 4LF9K 1NGEA 4AM7A 4FJXA 2V7YA 4CJRA 1SZ2A 3HP9A 3SUNA 4JI0K 2NZTA 3ID8A 1OVYA 5GAEP 1TK0A 4PKHA 4OLBA 2OA8A 1EWQA 1BGXT 1R0AA 1TYQA 4DTPA 4B9TA 4RW9A 4J2EA 1HKGA 1IH7A 2VG7A 3A5NC 5AQJA 2FSNA 1T03A 5C24A 1C0MA 2GELA 4KRFA 1JCGA 3S3MA 5M1FA 3ULDA 3A8YA 3LP0A 1S1WA 1C0GA 4DF8A 1RDAA 3F2KA 3U8XA 4LF4K 3SAFA 4W5NA 3T69A 4AHCA 3HPHA 3DOLA 3BY5A 3C7NA 4DV4K 2CH5A 4DTSA 2E1YA 3BP8A 4FWPA 1NM1A 2HMIA 4KH5A 2A40A 2VWKA 1K8KB 3D2EB 5BN8A 1XI1A 2P5OA 3I56N 1IG9A 1K9MO 4OPAA 4IJAA 4CGHA 4FSVA 2O8BB 1ASWA 1LAVA 3VEWA 4BRFA 5C42A 1KQSM 4NLCA 2I7PA 4IFYA 1NGAA 2QM1A 1WLJA 2BANA 5EXWA 3PSIA 1VSHA 3KLEA 1Z26A 4JD2A 2YHBA 2UU9K 5LMUK 4CHOA 2P9KB 3ZETA 4H5RA 4CGDA 4YOWA 4N56A 5KTQA 2A3ZA 1LWEA 1KD1O 1RNHA 3QO9A 4NXNK 3O3FA 3VEOA 1G15A 4O4GA 5SWMA 3PX4A 1NBWA 4YHHK 2KZMA 2WFBA 2IGIA 4ILGB 4DV5K 2NRZA 5E84A 5I42A 2A5XA 4DTXA 1GOAA 1BCOA 1HRHA 5JVGL 5FPNA 3KKSA 4FJKA 1QE1A 2KFNA 4RW8A 4GKKK 4FXDA 1UOCA 1T6CA 4XEIA 4C1NI 4IZ9A 2PFUA 3NGZA 4F4KA 4YORA 5AQGA 4JS4A 4M3XA 3B6OA 2FF3B 2HF3A 4JLHA 4J2BA 3ZX2A 1YF5L 4EIAA 4KH6A 1QSLA 3K5LA 3SQ2A 1OH5A 4A57A 3MWTA 3C7NB 3LPUA 5HRNA 3WNEA 4V19S 1BISA 4KHSA 4PA1A 1BU6O 3K9KA 2V7ZA 3FE1A 4Z4EA 3RWUA 4CJPA 2VG6A 3VA0A 1BOTO 3IMXA 3DLBA 4B3MK 3QIPA 1KAZA 5F2RA 3F9KA 4DSJA 2GX9A 2BDPA 1ATNA 3TTDA 1WAJA 1CXQA 1XNRK 3NF9A 4Y0WA 4JD2B 3OS1A 1NK0A 3AO5A 1V4TA 1KFDA 4XIUA 4BRMA 1QQMA 4CFAA 3CD6N 4BG8A 4OPKA 4K42A 4QS9A 4JI4K 1NKCA 1VQ8N 4BQZA 2RF2A 4CW7B 2QEXN 4KHUA 4ELUA 1SQKA 2PZSA 1MDUB 1FKPA 5KPTA 2P9IA 4BACA 4FM0A 3SK3A 2I5JA 4DTRA 4JI3K 2E2NA 4WQ4A 3MXMA 3K59A 1DTQA 2J4RA 4JHDB 3MN6A 4FWKA 3PX0A 4KI6A 3AVGA 4LFAK 4A5BA 2Q1NA 3CJ7A 4FO0A 3ATUA 3VQDA 4EZ9A 2GWJA 4ZHRA 5K14A 1WSGA 2A6AA 2P51A 3O4NA 5J2PA 4H5WA 3C65A 2ZE2A 5FROA 3ULEA 3L0QA 3CQXA 1B92A 4W5RA 3GL1A 3L2QA 1VQ4N 3CQYA 3U4LA 4LSNA 1ILYA 3CFPA 1DEJA 2NLXA 5BPMA 4CD1A 4FW2A 4DR6K 3NVMA 4HCBA 4QAGA 3ZSXA 2DFFA 1X1PA 1SL1A 2A42A 5M1PA 5KI6A 1TV6A 5IT9O 2P5GA 3ZYYX 4E7KA 1YUWA 3M8PA 1HYZA 4XH5A 4JN4A 2QTDA 3HM8A 5CZ1A 1C6VA 4RW7A 2O4GA 3O6WA 2UYTA 2I7NA 5E26A 1NK7A 3WXLA 5AFUA 3ZSYA 5FPDA 2VGMA 3LAKA 1HPMA 3U9ZA 1OH8A 4JKGA 3HXMA 4H8KA 4BC3A 4KO0A 4Z4CA 3MN5A 1NJWA 1DTTA 2Q97A 2P9IB 1QVGM 3EZ5A 5BRFA 3GBTA 4B3TK 3ATVA 2E2PA 4DFPA 4CVNE 5I9EB 3O9UA 4CIEA 3D0PA 2P9NA 2HVIA 3G71N 1BQNA 4JKHA 5FLXO 4DR1K 3TU5A 2D0OA 3ZT1A 1BWFO 1E4FT 1WBBA 1NK4A 1HNVA 1KAXA 4M3TA 3SMSA 4YOVA 4HTUA 1W2BM 4CBXA 4RW4A 3CCLN 3A5LC 5LJWA 2KFZA 4B9VA 4CJ4A 1QSSA 4BC2A 2UUCK 2OTJN 4H03B 3H45C 1NGCA 3ULEB 1O13A 2W6LA 4JRQA 4G9ZA 3WXKA 2QWRA 4LC9B 4PKIA 1BA1A 4CFBA 1OVQA 2F96A 4DHYA 4HCCA 3ZSQA 4CJWA 1ASVA 2QWLA 3H08A 4BE1A 4A2BA 4FLVA 2D4WA 4GY2B 3JAMO 5GAHP 4CGIA 3KHYA 1ZBUA 4B3RK 1NJIO 5GINA 1NKBA 3R9PA 3JSMA 3CF5L 4RWTA 3B6PA 3E9LA 4FK0A 4FLTA 3P83D 5DM6L 5F1XA 1JLAA 4JKAA 4M3WA 3LP2A 4OVLA 4W5QA 4CGJA 3CETA 2YNIA 3F73A 4W5OA 2WOMA 1IG8A 2QWNA 4H0PA 3IG1A 4ILJA 1GLBG 5AQYA 3SQ1A 2G8HA 1UA0A 3G10A 2HVHA 3UKUA 1OH7A 1SAZA 4EZ6A 4CJSA 4KPYA 1HNXK 2OZMA 4AM6A 5LJVA 5AQNA 5ADXA 1NU0A 2DTUA 2B5JA 1MWMA 1Q7YO 1RDBA 1HQEA 4FWSA 5BR8K 3EYZA 1RDWX 3LANA 4O5FA 4BVOA 3MDQA 1BO5O 1X3MA 1IBMK 5B8HA 4N76A 1L3TA 3KD1E 3L3UA 4E0DA 4PUOA 3W3DA 1TK8A 1SKRA 4DQSA 4CCHA 2HOEA 3HJFA 1VQKN 1M1KO 4FPBA 4RW6A 4CJFA 3L2UA 3KKRA 1HR0K 1VSDA 1GLCG 5C2FA 1E4GT 1MU2A 3J7YP 4CZMA 4BRQA 1IKXA 3SQ4A 1QVFM 2CGJA 3SPYA 2E1ZA 4O8UA 2D0AA 4FWRA 3O3HA 2PYJA 2O8DA 1JLGA 3AVHA 2BTFA 1YVUA 3ZSWA 1BL3A 4C8NA 3LM2A 2UUBK 3SAHA 1RCHA 2KZZA 1SV5A 2GBZA 3TARA 2ASOA 1R59O 1RDDA 4X62K 1EETA 3LPTA 1VRTA 1O1WA 4JYAK 3KLFA 4A61A 2P9LA 4GV9A 4WFBL 1XMOK 3LDNA 3CXCM 2FLOA 5AQFA 4EAHD 3BGRA 5AQXA 3BF1A 2FSJA 4N41A 4F3OA 3CPWM 3MAQA 5DM7L 2OTLN 1M90O 2P9SA 4NYNA 3OA9A 4EP5A 3JYTA 3L8BA 4U7BA 1NGBA 3U6FA 2QWQA 1XWLA 2V51B 4YNQA 1U47A 4WE1A 1KVCA 2FBVA 4H0XB 2QXFA 2OANA 3T7ZA 1KAYA 1NGGA 1T7PA 3LDSA 3O9QA 5F0XA 4A59A 4E1MA 4KHQA 1NWKA 5KQDA 3LALA 4BRKA 3OYIA 4DFKA 3BZKA 3D2FA 3ZEUA 1KXPA 3L6QA 1REVA 2O4IA 4E19A 1JLEA 3EKSA 2IIRA 5TKYA 4B9SA 4KTQA 4DFJA 3PIPL 4CF0A 3NH2A 4YOTA 3VMFB 5M1QA 5AQPA 5JLHA 5JLFA 4CBWA 4JV5K 3B8AX 1GLFO 4CIFA 4MO4A 5EU7A 4YDUC 2FC0A 3AVJA 4BE0A 2HHXA 2UUAK 4GV3A 1WUAA 5FRNA 4OPHA 2D0BA 2VWBA 3OBWA 4LF7K 3NF6A 2BH1A 3THWA 4BRLA 1VSIA 2P9SB 2XY5A 4CJTA 3CJBA 3O4QA 1T44A 4B9LA 5FPEA 4KHNA 5AQZA 1IBLK 2V52B 3OYAA 3NMUA 3ZT0A 1NGIA 2VQFK 3SLCA 4FLZA 4FJIA 2IC3A 3P39A 3OTOK 3C94A 3KIOA 4DG1A 3UB5A 1JKHA 3OJUA 5BPNA 4K43A 4ILHA 4QS8A 1C1AA 1GOBA 3KLIA 3SJJA 1QQCA 2OPPA 2ZGZA 3OY9A 4YOUA 2G8IA 3TR8A 5GADP 3ZEUB 4OKKA 4DWIA 2ZD1A 4BREA 1E3MA 4DSKA 2OZSA 3RTVA 1C0UA 3ZT4A 3CERA 3TAMA 4FWMA 4A5AA 1Q9YA 4LSLA 3EY1A 1XMQK 1Q86O 3O80A 4HUGA 2A1RA 3AVAA 1HYSA 3L4QA 5AQKA 1X9MA 4WQ5A 3L2RA 3NVKA 1NK5A 2IOCA 3CI5A 3QBWA 5KRSA 3NCIA 3QEXA 1Q81O 1B9DA 2JWLA 5CYQA 4CIGA 3DLRA 5AQTA 5AQWA 3EE9A 3TPQA 1DGKN 1TKTA 1IKYA 4CZLA 4DQ8A 4L3QA 5HRPA 4GV6A 2UXBK 5EX5A 3QEWA 4BC5A 4FZZA 4DSIA 3DOKA 4JK9A 1SL0A 5JVHL 3LM9A 1LCUA 1UA1A 3TAPA 2NRVA 3M8SA 5AZJA 1J54A 4BRDA 2HMPA 4E7LA 3KD5E 2GV9A 3PLAA 4DTUA 2DPNA 4CFCA 4DLGA 3NH0A 3K2PA 3G6EN 3OYEA 1NJYA 3D45A 2IVOA 1QZ6A 1JXEA 3DRSA 3NF7A 3DJCA 3MN9A 3FLCO 1HUXA 1JLFA 1BHLA 3OYBA 4IXCA 1EKEA 4A62A 3H46O 1TYQB 4B1VA 4C8LA 4CZIA 4BGBA 3C0BA 1KFSA 2D1KA 3SZ2A 3L2WA 3VEXA 5TKWA 2QWMA 4BE2A 4JEPA 5DMRA 1GOCA 1WSIA 3QEIA 3J8AA 3L4IA 3K58A 2XY6A 1VQ9N 3HL8A 1U4BA 2NRTA 1WOQA 4DV6K 4BRPA 2Z1IA 1CZ9A 4B1UB 3HTVA 4DV0K 3OW2M 3NE6A 3PX6A 1N33K 1YHQN 3AA3A 1NG9A 3PUFA 1W0HA 3I55N 4J8FA 1GLAG 4Z94A 4OKJA 5HP1A 3V9ZA 3JS6A 1NK9A 1B9FA 1GLEG 4NB4A 2BGGA 3WXIA 1TL3A 4DU3A 3QNNA 4FL9A 4JNEA 3VQBA 3CCRN 4M7XA 3VQAA 3C6TA 3I8BA 4NXMK 4B8CA 4GKJK 4LFCK 1EO1A 2Y1IA 1XC3A 2OCEA 5H1SQ 3ZETB 1LW0A 3SNNA 4CF9A 3VGLA 3K0SA 4IEIA 1CZBA 4FYDA 3NGIA 4CJLA 1ATRA 4J2AA 5J2QA 2JLEA 1S1UA 2OPQA 3AO4A 2RN2A 2FXUA 4L8RB 1QQOA 1MA9B 2YNGA 1U49A 3CYMA 5CYMA 4BR9A 2O8CA 4DTOA 2GUPA 2E2OA 3VQ6A 2HBJA 2E88A 1BA0A 2KHOA 4H0VB 3LDPA 3QICA 5EOYA 3TAQA 4CF8A 3Q7BA 2DY4A 3CCEN 3VTHA 5C15A 3LL3A 4BR7A 4R79A 3GG4A 4FWLA 3FFKB 1S5JA 2E6LA 3SV3A 3QEPA 2YI1A 3HPOA 2Y1JA 1S3XA 3KLGA 4IOCL 4KH4A 3S9HA 2YV0X 1RBVA 1VQPN 4A2AA 3Q7CA 2WBNA 1QHAA 4K8XA 1HLUA 4B1XB 4YY3K 1S72N 3MK6A 3V1RA 5D3GA 1RILA 3FZLA 2NRRA 3NF8A 3PV8A 5AQOA 4QCLA 4B9MA 3BUZB 4E3SA 2ASPA 3NFAA 4KV8A 2HBLA 3QFPA 4MLEA 3OS0A 1RFQA 2VQEK 4I9QA 3CC4N 3CFRA 4BR4A 4LFBK 1BIZA 3R3LA 2OPSA 5AQSA 4DQQA 3THVA 1ASUA 2XRIA 1VSFA 3AGKA 3VN5A 3CCUN 4DS4A 5FRMA 4FWQA 2VG5A 3WEEA 2G8WA 3THYA 4KHYA 1RTJA 4KB1A 2O8CB 3HM9A 3J7ZO 3SUOA 1SS6A 3DXMA 2A1SA 1VQLN 4HUFA 1N34K 1IBKK 3RSEA 2HB5A 3DLHA 2QKKA 1JLCA 4IG3A 2HBMA 3MEDA 3EN9A 3K9JA 4Y1DA 3MECA 3R6MA 3CC2N 3A0IX 3V9UA 4LD0A 3ZSRA 5AZIA 3TI0A 2BE2A 4CBUA 2HHHK 1ZXOA 4K8ZA 3J81O 2PY5A 1ZC6A 2HHVA 4LF5K 1RT2A 4EFHA 4ZTFA 3DRPA 3LDLA 3WNFA 2HNDA 3I8DA 2IAJA 5AQRA 4FZYA 3RR7A 3VQEA 1WNSA 4MDBA 1D9FA 3VF4A 1Q18A 3VQ7A 4PHTX 3SCXA 4IDKA 1LOTB 2NUBA 3AO1A 4BWMA 3VERA 4ID1A 5AJ3K 4H0TB 4E7JA 4CEBA 4WF9L 3PIOL 3KJVA 1X9WA 3BDPA 4FJMA 5CHIA 2DFHA 1YT3A 3AVFA 4BWJA 1EWRA 1JL2A 3KWGA 4FWNA 2VWJA 3MEGA 1HQUA 1J6ZA 4KAZA 3THYB 4EP4A 4JKGB 4CEDA 2YHAA 4MDAA 2YKMA 2B4JA 3RSEB 5BRHA 3LZIA 4AHRA 3UE5A 2ITMA 3DAWA 2YNFA 2G8VA 4BR5A 4DQIA 4EHTA 3KZBA 2YJFA 3HVRA 3IDHA 1K6YA 4XH4A 3AARA 4FVUA 4CJ7A 1TKDA 4Z4HA 3RMDA 2P9NB 1JLQA 3QBXA 4FJ7A 3QMLA 4E7HA 2QWPA 5AZIB 4DSLA 3AVNA 1QZ5A 1RBRA 4CZHA 2O8FA 4DR7K 1RDUA 1WN7A 4NO7A 3VETA 4ZTJA 3IRXA 3DYAA 3SBGA 2B6AA 3VTIA 1RBSA 2YX6A 1TUUA 4FWOA 3V81A 3JXUA 1NK6A 4M3YA 4DFMA 3GE1A 4JI2K 3QDKA 3WNGA 1KLMA 3AAQA 4Z4FA 5M1KA
chains in the Genus database with same CATH topology
5AQGA 4OPHA 2VWBA 2FF3B 2KLAA 2QI2A 1HKBA 3OBWA 4C23A 2HF3A 2Q2RA 3ZX2A 1YF5L 3ID6A 4EIAA 4KH6A 2BH1A 4NLBA 5HOOA 4H5TA 4I6MA 4BROA 4UY8O 2ASMA 4BRLA 4B1YB 2P9SB 4PKGA 3CJBA 3O8MA 1T44A 4A57A 1YXQA 3MWTA 3O5BA 3TSPA 5FPEA 3C7NB 3CPEA 5AQZA 3CJ1A 2V52B 3O08A 3F5TA 4WQ5C 3EZWA 1MWKA 2WC9A 2AP1A 4GVEA 5KPRA 3H1QA 3M3ZA 3NMUA 1NGIA 1YI2N 3C6AA 1BU6O 2CGKA 3SLCA 3ENHA 3K9KA 2V7ZA 3FE1A 3TSQA 2YJEA 4IDHA 4MO5A 3CIPA 1N8RO 5AQVA 3G4SN 3P39A 3SAGA 1GLJO 3CC7N 1BOTO 4BC4A 3UB5A 1K73O 3IMXA 1YAGA 4WQ4C 3IKMA 5BPNA 2YCHA 4ILHA 4K43A 4HWIA 1KAZA 5F2RA 4QS8A 2NNWA 4K25A 4FOEA 4YDUA 2GX9A 2NRXA 1ZBSA 1YVNA 1ATNA 3FR0A 4H0OA 3TTDA 5LY3A 1ESVA 2ZGZA 5ELZA 3UKUB 4YOUA 3BF3A 3M5RA 3WT0A 5GADP 2F7TA 4XH1A 4Y0WA 3ZEUB 5KQ8A 4IEEA 4JD2B 4WFNL 1VQON 3TTFA 4BREA 1CZAN 1V4TA 4BRMA 3GDQA 3W0LA 2RE2A 1QQMA 1DT9A 3CERA 3CD6N 4JKCA 4BG8A 5CE3A 2Q36A 4FWMA 4K42A 4QS9A 4A5AA 2EWSA 1VQ8N 3HSCA 3C6HA 3R8EA 3O80A 4BQZA 1Q86O 3MMVA 1T6DA 1QQNA 2QEXN 3L4QA 5AQKA 3ENOA 4YOXA 4H5NA 4JKEA 4WQ5A 3AAPA 1RGIA 3TSUA 2VYPA 1SQKA 5C0YA 3NVKA 5C10A 1MDUB 3KVGA 1C0FA 3CI5A 4JK8A 3WEEB 3QBWA 1Q81O 2JWLA 3QB0A 5KPTA 5BPLA 2P9IA 5AQTA 3SK3A 5AQWA 3DXMB 3EE9A 3P31A 2E2NA 1DGKN 4WQ4A 3TPQA 4CZLA 4DQ8A 4L3QA 4GV6A 5EX5A 4BC5A 3O9TA 4JKDA 5JMVA 4JK9A 4BRGA 5MLCQ 4I6MB 4CD3A 2J4RA 3FZMA 4JHDB 5JVHL 5EVZA 3MN6A 3CCSN 4HTLA 4FWKA 3LM9A 1LCUA 2PAVA 2F9WA 2NRVA 5AZJA 4B1ZA 4BRDA 1NMDA 2HMPA 4YOYA 3LDOA 3PLAA 2DPNA 4A5BA 2Q1NA 3CJ7A 4FO0A 3ATUA 1U6ZA 4OO1J 2W40A 2GWJA 4K41A 1JCFA 3G6EN 3FZFA 1NGFA 2A6AA 5AQQA 3CJ9A 3U9DA 2IVOA 4M7YA 3CJCA 4H5WA 3VPZA 3WXJA 1QZ6A 3C65A 4F9OA 3ULEA 1T3VA 3CQXA 3L0QA 3MCAB 3DJCA 3MN9A 3FLCO 1HUXA 3GL1A 1P8ZA 1VQ4N 4CZEA 4IXCA 3CQYA 3HBTA 4FOIA 1NLVA 3U4LA 4A62A 3H46O 4BRHA 1TYQB 3D7EO 4B1VA 4CZGA 4WCEL 1ILYA 4CZIA 1DEJA 2NLXA 1NGJA 2P9LB 3C0BA 3E9PA 3VEVA 4BGBA 3NVMA 4CD1A 5BPMA 2D1KA 1X9JA 1DKGD 3MWPA 5C2DA 1U2VA 3P4IA 1OKJA 3VEXA 5TKWA 1VQ6N 3ZX0A 2A42A 2QWMA 5M1PA 3DLLL 3QFUA 4JEPA 1BG3A 3ZYYX 1EQYA 2A41A 4DCHA 3VENA 4BRAA 1YUWA 2ZJPL 1D4XA 3FZKA 3J8AA 3L4IA 4XH5A 4JN4A 2QTDA 3HM8A 1VQ9N 1NGDA 4CZFA 3O6WA 1IJJA 2NRTA 2UYTA 2I7NA 5E26A 1WOQA 2Q31A 1XUPO 3VOVA 1Z05A 3O1WA 3WXLA 3MCPA 4BRPA 5AFUA 5FPDA 3IFRA 3D6RA 1GLLO 2VGMA 1HPMA 3U9ZA 4JKGA 3O9RA 4B1UB 3HTVA 2ZGYA 5BR9A 4BC3A 3OW2M 1Q82O 3IUCA 3M6GA 2QXLA 1YHQN 4BY9C 4H0YB 3VGKA 3H1VX 2PBDA 2H3GX 3I55N 4J8FA 1GLAG 3HI0A 3MN5A 3VGMA 2Q97A 3R1XA 2P9IB 3I33A 4Z94A 1QVGM 3G25A 4GNIA 3JS6A 1VQMN 5GIOA 5BRFA 4DB3A 1GLEG 3GBTA 3ATVA 2E2PA 4NB4A 5EY4A 3WXIA 4WYBA 3AY9A 5I9EB 3O9UA 3VF2A 2E8AA 4FL9A 2NRWA 2P9NA 3UKRA 1VQ7N 4JNEA 3G71N 4IZ9A 1V4SA 4JKHA 2GEMA 3CCRN 4M7XA 3TU5A 4C1NK 2D0OA 2P9PA 1BWFO 2P9KA 1E4FT 3I8BA 5AQHA 1Y64A 1KAXA 3SMSA 4YOVA 3D2FB 1EO1A 1W2BM 4CBXA 1XC3A 5H1SQ 3VEZA 3O4WA 3CCLN 3ZETB 3A5LC 5LJWA 1HX1A 3MX2A 3VGLA 4IJNA 4FPAA 4O8KA 4QS7A 1H1VA 2JWKA 4BC2A 4IEIA 1HJOA 4GV3A 2OTJN 3F9MA 4H03B 1P90A 1ATRA 2W41A 3H45C 1NGCA 3ULEB 1XQSC 2FXUA 1O13A 3WQUA 1QQOA 1G99A 4BGAA 1MA9B 5M1OA 4BR9A 4G9ZA 5BRDA 2HSTA 2P9UA 2QWRA 3WXKA 2GUPA 5C12A 2E2OA 2KKZA 4LC9B 4PKIA 2HBJA 2CGLA 1BA1A 1BUPA 2E88A 3CCVN 1KC8O 1BA0A 5M1NA 1ATSA 1GLDG 2KHOA 4IFEA 4H0VB 5FPMA 5GAGP 2YHYA 4DHYA 3CCQN 1U2VB 3LDPA 3QICA 5EOYA 3Q7BA 2E2QA 2BUPA 2QWLA 5AQMA 4A2BA 3CCEN 2D4WA 2YHXA 3VTHA 4U67L 5C15A 3LL3A 4BR7A 4GY2B 4R79A 3KWIA 4ISFA 4ISGA 3GG4A 5GAHP 3GOIA 4FWLA 3KHYA 3FFKB 1NJIO 5GINA 1YIJN 3R9PA 3CMEN 3CF5L 4RWTA 5AQUA 3E9LA 3EE8A 1W97L 2YI1A 3RVCA 5DM6L 5F1XA 1S3XA 4JKAA 5AFUH 4BR0A 3H3OB 4JKBA 4IOCL 4KH4A 2VCPA 2WUSA 3CETA 1VQPN 1JCEA 4A2AA 4IO8A 3LDQA 3Q7CA 2WBNA 1QHAA 3N4QA 3KK7A 1IG8A 2QWNA 4E1JA 5CR4A 3BEXA 3DWLA 3O1BA 4H0PA 1HLUA 4ILJA 4B1XB 1S72N 3MK6A 3SMPA 1GLBG 5AQYA 3FZLA 3E1YA 3VEYA 2NRRA 2CH6A 5BN9A 3CCMN 5AQOA 3SBTA 3UKRB 3UKUA 1BDGA 1JJ2M 4B1WB 1SAZA 5AQIA 3EO3A 4ISEA 3EL2A 3BUZB 4BRIA 4AM6A 5LJVA 4H5VA 2ASPA 5AQNA 5ADXA 2P9PB 3MX5A 2QA4N 4BG9A 1MWMA 2HBLA 3QFPA 4BRCA 3E9OA 1Q7YO 4MLEA 2Q0UA 1RFQA 4FWSA 4BRNA 3CC4N 1NGHA 1Z6RA 2FF6A 4BR4A 1RDWX 2HF4A 4O5FA 3R3LA 4BVOA 3EKUA 3MDQA 1BO5O 1X3MA 5AQSA 4BQLA 5B8HA 1YJNN 3E66A 2HBKA 2QW9A 3MN7A 3AGKA 5JICA 3S41A 3WQTA 3CCUN 4FWQA 4WFAL 3WEEA 3DXKA 3W3DA 2RHKA 4B9QA 2HOEA 1K8KA 2P9UB 3D2EA 1VQKN 1VQNN 3J7ZO 1M1KO 4FPBA 3CMAN 2ZJRL 1SS6A 2VGNA 4IOXA 3DXMA 4JAXA 1VQLN 4IO9L 1GLCG 2GWKA 3WXMB 3HRGA 3RSEA 4IOAL 5C2FA 1E4GT 3ZX3A 2HBMA 5HL7L 4IWVA 4JHDA 5BREA 3EN9A 1S22A 3K9JA 2NRHA 4KBOA 2ZWHA 4BRQA 4CZMA 3VF6A 3R6MA 1QVFM 5AQLA 5KPZA 1YJWN 3CC2N 4PL7A 1VQ5N 2CGJA 1HKCA 2E1ZA 3A0IX 4O8UA 4FWRA 5AZIA 4JK7A 4CBUA 2GTDA 2IVPA 5AZJB 3WUHA 1ZXOA 2YHWA 2D0PA 3FZHA 1ZC6A 3FGUA 1TUYA 2BTFA 3VESA 4EFHA 4M63C 3O9SA 1NGEA 4AM7A 2V7YA 1YITN 3LDLA 3LM2A 1SZ2A 3SAHA 5AQRA 2NZTA 3ID8A 1OVYA 5GAEP 4PKHA 3AGRA 4MDBA 2ASOA 3OBYA 1R59O 3M1FA 1TYQA 3CJAA 3HOSA 2ZJQL 3VF4A 1Q18A 4A61A 3HOTA 4BVPA 2P9LA 4GV9A 4WFBL 4PHTX 1HKGA 3LDNA 3A5NC 1LOTB 5AQJA 2FSNA 3CXCM 2FLOA 5AQFA 4EAHD 5AQXA 2GELA 2E20A 3BF1A 3P38A 2FSJA 1JCGA 3VERA 3CPWM 1K8AO 5M1FA 5ADXH 4H0TB 3A8YA 5DM7L 4WF9L 1X3NA 1C0GA 3PIOL 2OTLN 1YJ9N 3F2KA 3U8XA 1M90O 3SAFA 2P9SA 5CHIA 4BR2A 3OA9A 3T69A 3CCJN 3H3NO 4U7BA 1NGBA 3C7NA 4AF1A 2QWQA 2CH5A 3KWGA 4FWNA 2E1YA 2V51B 3OHRA 1J6ZA 3BP8A 4FWPA 1NM1A 4KH5A 3DXKB 3H6EA 3HZ6A 4JKFA 2A40A 4MLHA 1K8KB 4JKGB 3D2EB 5BN8A 4H0XB 2OANA 3T7ZA 4MDAA 2FSKA 3I56N 1K9MO 2ZF5O 1KAYA 4IJAA 1NGGA 3CHWA 4OPAA 4FSVA 3RSEB 3N4PA 3VEWA 5BRHA 3O9QA 4CI6A 3UE5A 2ITMA 4BRFA 5F0XA 1KQSM 3DAWA 4NLCA 4A59A 4BR5A 2I7PA 2IVNA 4EHTA 3A5MC 1NGAA 2F9TA 2YJFA 3KZBA 3ENBA 2QM1A 1NWKA 3IDHA 4XH4A 5EXWA 3AARA 5KQDA 4BRKA 5AR0A 4FVUA 4CJ7A 2P9NB 3QBXA 3QMLA 3D2FA 2QWPA 3ZEUA 1KXPA 3L6QA 4JD2A 5AZIB 1QZ5A 2P9KB 3ZETA 4H5RA 4YOWA 3TTCA 2A3ZA 4DKWA 1KD1O 4CZHA 3EKSA 2IIRA 2Q0RA 1VAZA 5TKYA 3VEOA 3A5OC 1RDUA 3PIPL 4NO7A 3VETA 1NBWA 4YOTA 3VMFB 3SBGA 4RCHA 5M1QA 2WFBA 5AQPA 4ILGB 4CZKA 2QWOA 4CZJA 5JLHA 2NRZA 5E84A 3VTIA 2A5XA 2YX6A 1TUUA 4FWOA 5JLFA 5GIPA 4CBWA 4RTFD 3JXUA 5JVGL 4EHUA 5FPNA 3B8AX 1GLFO 4PL8A 4MO4A 4YDUC 3GE1A 2AA4A 3QDKA 1T6CA 4XEIA 3SJHA 3AAQA 2PFUA 4C1NI 5M1KA 1WUAA 4YORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C2D A;  4IDH A;  4IFE A;  4IEI A;  5M1K A;  5C10 A;  5C12 A;  5M1Q A;  5M1F A;  3C6A A;  5C2F A;  3CPE A;  5M1P A;  5C15 A;  4IEE A;  3C6H A;  5M1N A;  5M1O A; 
#chains in the Genus database with same CATH topology
 4CGG A;  4FLU A;  1TGO A;  4F2S A;  4IBN A;  1RBU A;  2KLA A;  2E6M A;  1HKB A;  2HHU A;  4KTZ A;  2Q2R A;  5FDL A;  3ID6 A;  4NLB A;  4H5T A;  4I6M A;  1D9D A;  4O44 A;  2ASM A;  1SKW A;  3SYZ A;  1YTU A;  3O8M A;  3O5B A;  3TSP A;  2W6K A;  4C8K A;  1Z25 A;  3AA2 A;  3O08 A;  3MEE A;  2AP1 A;  4GVE A;  5KPR A;  3H1Q A;  1YI2 N;  3CM5 A;  2CGK A;  3ENH A;  4FLW A;  4K0K K;  1W9H A;  4LH4 A;  4MO5 A;  3CIP A;  5AQV A;  1BCM A;  4BC4 A;  1YAG A;  3S3N A;  4WQ4 C;  4ICL A;  3IKM A;  3IS9 A;  3AV9 A;  1QS4 A;  5HRR A;  3NDK A;  4BDY A;  1ZBL A;  3DLE A;  2NRX A;  1QSY A;  3AVI A;  4DMN A;  3RRG A;  3OYH A;  5ELZ A;  3UKU B;  4FM2 A;  3M5R A;  2F7T A;  4XH1 A;  5KQ8 A;  1VQO N;  4WFN L;  3TTF A;  4CJ3 A;  4M3Z A;  4JRP A;  2O8F B;  4CHQ A;  1LAW A;  1DT9 A;  4JKC A;  5CE3 A;  2Q36 A;  3BZC A;  1J9A A;  1LV5 A;  1LWC A;  3HSC A;  3R8E A;  1VSM A;  1T6D A;  1QQN A;  4OJR A;  4H5N A;  4JKE A;  3VQ5 A;  3AAP A;  1RGI A;  4CER A;  2VYP A;  4DSE A;  3J80 O;  5HRO A;  1W7A A;  4B3S K;  3KVG A;  2O8E A;  1C0F A;  4IKF A;  1IKV A;  3ZT2 A;  3PO4 A;  4ELT A;  4HUE A;  5BPL A;  4O0I A;  3SQ0 A;  3A2F A;  4HVJ A;  3P31 A;  3VQ9 A;  3O9T A;  4JKD A;  4FJ9 A;  4FJG A;  5MLC Q;  3LWL A;  4I6M B;  4CD3 A;  1S1T A;  3CCS N;  1XHZ A;  3QLH A;  3PY8 A;  3OYG A;  1RT7 A;  3NGY A;  1XHX A;  4DTM A;  1NMD A;  4UQG A;  1WSE A;  1SL2 A;  1I94 K;  3AVB A;  1U6Z A;  2W40 A;  2O8D B;  1TK5 A;  1JCF A;  4YFU A;  3LAM A;  3AVK A;  3M8R A;  3T1A A;  1NGF A;  4CGF A;  2X6N A;  1TAU A;  5AQQ A;  5LY3 A;  4M7Y A;  5SZT A;  3VPZ A;  3WXJ A;  1T3V A;  4OX9 K;  3TAE A;  5J2N A;  1BQM A;  4CZE A;  2ETJ A;  3AVL A;  3D7E O;  1WB9 A;  2P9L B;  3E9P A;  1RTH A;  4F2R A;  3HVT A;  5C2D A;  3P4I A;  1VQ6 N;  3ZX0 A;  3DLL L;  3OYM A;  4OGE A;  4E1N A;  5JS2 A;  3P5J A;  1EQY A;  4AHS A;  4F8R A;  3VEN A;  4BRA A;  4FLY A;  3ZLJ A;  2ZJP L;  4DTN A;  3AO3 A;  1NGD A;  4TSX A;  2KTQ A;  3QET A;  3KK1 A;  1IJJ A;  2RPI A;  5HBM A;  3VOV A;  1XUP O;  4PWD A;  3MCP A;  2OPR A;  3D6R A;  4I7F A;  2ZGY A;  5BR9 A;  3QEV A;  3IUC A;  4CHP A;  3M6G A;  4AQY K;  4BY9 C;  4H0Y B;  3VGK A;  3H1V X;  4QOZ B;  2PBD A;  4CF1 A;  1I39 A;  3VGM A;  3I33 A;  3G25 A;  1VQM N;  5GIO A;  3RRH A;  4FM1 A;  4DB3 A;  2XHB A;  4WYB A;  4IG0 A;  3VF2 A;  3UKR A;  1A5W A;  1V4S A;  4DUY K;  1RTD A;  4C1N K;  2P9P A;  2P9K A;  1VSE A;  3VQQ A;  2WTU A;  1Y64 A;  3AA5 X;  3IAY A;  1HNW K;  3D2F B;  3QIO A;  1QTM A;  1ZBH A;  3VEZ A;  3O4W A;  1FJG K;  3TAF A;  1UWB A;  3MX2 A;  4QS7 A;  4FPA A;  1H1V A;  2JWK A;  2HNZ A;  3F9M A;  2W41 A;  1N36 K;  3VQ4 A;  1XQS C;  3V4I A;  4J2D A;  3WQU A;  1RTI A;  1U45 A;  4FLX A;  1NNE A;  4DV1 K;  1TVR A;  2HST A;  2P9U A;  3SUQ A;  1N32 K;  2GUI A;  2CGL A;  3CCV N;  1KVB A;  1BUP A;  1ATS A;  1GLD G;  4IFE A;  2YHY A;  3CCQ N;  4FJH A;  4DU1 A;  4FJ5 A;  4DU4 A;  4NCG A;  2BUP A;  1HMV A;  1FXX A;  4X66 K;  1C1B A;  2YHX A;  1VSK A;  4O5B A;  3THW B;  3KWI A;  4ISG A;  3GOI A;  4NCB A;  4LY7 A;  3ZSV A;  4FK4 A;  3CME N;  5AQU A;  4DR5 K;  3CG7 A;  2OYQ A;  1W97 L;  3AVM A;  5AFU H;  4BR0 A;  2WUS A;  4I2Q A;  4IO8 A;  4E1J A;  3BEX A;  3DWL A;  3O1B A;  3DI6 A;  3QNO A;  3E1Y A;  3VEY A;  2CH6 A;  3CCM N;  3UKR B;  1BDG A;  3M8Q A;  3HP6 A;  4B1W B;  1NOY A;  3SV4 A;  4FJL A;  4GMJ B;  5AQI A;  3EO3 A;  4ISE A;  4H5V A;  3K57 A;  2P9P B;  2FBX A;  4CJK A;  3MX5 A;  3E9O A;  4CEC A;  3OYN A;  4FCY A;  2Q0U A;  2LSN A;  2FF6 A;  4CJ5 A;  2HF4 A;  3EKU A;  1FKO A;  4BQL A;  2Z1G A;  1YJN N;  2HBK A;  1J53 A;  4B08 A;  2KQ2 A;  5JIC A;  1FW6 A;  1TKZ A;  1WSJ A;  3DXK A;  2RHK A;  2YNH A;  4N5S A;  4OPJ A;  2P9U B;  2F4V K;  3CMA N;  2W42 A;  4IOX A;  1CLQ A;  4IO9 L;  3WXM B;  3HRG A;  5LMN K;  2E5L K;  4IOA L;  4F3T A;  3FFI A;  3ZX3 A;  2XY7 A;  3V9S A;  2X74 A;  5HL7 L;  4JHD A;  4E7I A;  2NRH A;  3MXI A;  2ZWH A;  2R7Y A;  1U48 A;  1NOZ A;  4LF8 K;  3KLH A;  3VA3 A;  2Q3S A;  1S1X A;  4O55 A;  1NMN A;  5AQL A;  5KPZ A;  1YJW N;  5JS1 A;  3VQC A;  1VQ5 N;  4ELV A;  1HKC A;  1KCF A;  1WAF A;  2F8T A;  5T7B A;  5AZJ B;  3WNH A;  1EXQ A;  5HRS A;  4PY5 A;  1BI4 A;  4FZX C;  5J1E A;  3FGU A;  4CHN A;  1I3A A;  1TUY A;  3HST B;  3VES A;  3O9S A;  5LL6 Z;  4CEF A;  1FK9 A;  1YIT N;  4HHT A;  1IV0 A;  3G0Z A;  4DQP A;  3AGR A;  1WSF A;  3OBY A;  3M1F A;  3TAB A;  1YTA A;  3CJA A;  3HOS A;  2ZJQ L;  3HOT A;  4BVP A;  4X64 K;  1ZBF A;  2E20 A;  3P38 A;  3AO2 A;  3QES A;  1K8A O;  5ADX H;  1LW2 A;  1L3S A;  3AVC A;  4W5T A;  1X3N A;  4JS5 A;  1YJ9 N;  4BR2 A;  3CCJ N;  3DRR A;  3H3N O;  4M3U A;  4AF1 A;  3OHR A;  4B9N A;  4E89 A;  4KKO A;  3DM2 A;  3DXK B;  3H6E A;  3HZ6 A;  4JKF A;  4MLH A;  4M3R A;  1A5V A;  4JI5 K;  3HO1 A;  5KGX A;  3KK3 A;  2X6S A;  3RMB A;  2FSK A;  3KK2 A;  4DTJ A;  2ZF5 O;  5CY4 A;  3CHW A;  3N4P A;  2XY8 A;  1L3U A;  3DLK A;  2G8U A;  4CI6 A;  2WON A;  4CEA A;  2HHQ A;  1KVA A;  2IVN A;  3SPZ A;  3A5M C;  2F9T A;  3ENB A;  3VQP A;  1UAX A;  1D5A A;  1S1V A;  2JGU A;  1DLO A;  1S6Q A;  1A5X A;  5AR0 A;  1CXU A;  1HJR A;  1KTQ A;  3O3G A;  4Q5V A;  1JLB A;  3OVN A;  3TTC A;  4DKW A;  2PYL A;  1BI4 B;  3CFO A;  2Q0R A;  3V1Q A;  1VAZ A;  3L3V A;  3A5O C;  1N5Y A;  2ZM6 K;  4JI8 K;  4RCH A;  3ALY A;  4AH9 A;  4CZK A;  2QWO A;  4H4O A;  4CZJ A;  5GIP A;  2F8S A;  4RTF D;  4EHU A;  4PL8 A;  2IDO A;  2AA4 A;  4JI1 K;  1L5U A;  2HHW A;  3SJH A;  2HHS A;  4IFV A;  2QI2 A;  4C23 A;  2QKB A;  3OYK A;  4PQU A;  5HOO A;  4BRO A;  4UY8 O;  4B1Y B;  4PKG A;  3V6D A;  4KRE A;  1YXQ A;  1RT5 A;  2XO7 A;  4C8M A;  4OLA A;  3CPE A;  2ITG A;  1Q9X A;  3CJ1 A;  2ZQB A;  3PO5 A;  3F5T A;  4WQ5 C;  3EZW A;  4BDP A;  1MWK A;  2Z1H A;  2WC9 A;  1TKX A;  4FK2 A;  3M3Z A;  3C6A A;  3TSQ A;  2YJE A;  4IDH A;  1N8R O;  4DR4 K;  3G4S N;  3SAG A;  1GLJ O;  3CC7 N;  3RR8 A;  3VQ8 A;  3MXJ A;  1K73 O;  1S9G A;  1C0T A;  2YCH A;  4HWI A;  4DR2 K;  2P1J A;  1Y97 A;  4FW1 A;  2NNW A;  4K25 A;  4FOE A;  4YDU A;  4NYF A;  1ZBS A;  1YVN A;  3ASM A;  3FR0 A;  4H0O A;  4KI4 A;  5HLF A;  1ESV A;  4DR3 K;  1VSL A;  4I2P A;  4AIL C;  2ATQ A;  3BF3 A;  2X78 A;  3WT0 A;  4IEE A;  3K5M A;  1T05 A;  1CZA N;  5CZ2 A;  3GDQ A;  3ZSO A;  3LP3 A;  3W0L A;  2RE2 A;  1XC9 A;  3T1Y K;  3SI6 A;  5IWA K;  2EX3 A;  1SUQ A;  2EWS A;  4O0J A;  3C6H A;  4Z0U A;  3MMV A;  4NCA A;  1HNZ K;  4YOX A;  3ENO A;  4Z4G A;  2HNY A;  3TSU A;  3ZT3 A;  5C0Y A;  3OYD A;  2YKN A;  1NK8 A;  2HHT A;  3NAE A;  4JK8 A;  3WEE B;  2IS3 A;  3QB0 A;  1EP4 A;  3DXM B;  4CE9 A;  2KW4 A;  2D0C A;  1N6Q A;  5JMV A;  4CK3 A;  4BRG A;  3K5N A;  3FZM A;  5EVZ A;  4HTL A;  2PAV A;  2F9W A;  3J7A P;  4OGC A;  4KHW A;  1L3V A;  4R5P A;  3OYJ A;  1J5E K;  4B1Z A;  2G8K A;  3LZJ A;  2RKI A;  4YOY A;  3LDO A;  2AJQ A;  2UXC K;  1RT3 A;  3KTQ A;  4OO1 J;  4FJN A;  4K41 A;  3EEQ A;  3NBP A;  4OKE A;  3FZF A;  1S6P A;  3OYL A;  3CJ9 A;  3U9D A;  3CJC A;  1QHT A;  4F9O A;  5E41 A;  3OYC A;  3S3O A;  3MCA B;  3THX A;  1P8Z A;  1HNI A;  3HBT A;  4FOI A;  1NLV A;  4BRH A;  2DFE A;  4WCE L;  4CZG A;  3HPG A;  5C10 A;  1NGJ A;  1NJX A;  4DV3 K;  3VEV A;  4CJU A;  2Z1J A;  1X9J A;  3SUP A;  1DKG D;  3MWP A;  1XNQ K;  1U2V A;  4DQR A;  1OKJ A;  3QFU A;  4G1Q A;  4N47 A;  1BG3 A;  3U3G A;  4DCH A;  2A41 A;  4CJV A;  3L2V A;  1VK0 A;  3I0S A;  1D4X A;  3FZK A;  3RMC A;  4CZF A;  4Z4I A;  1RDC A;  1BIU A;  2Q31 A;  4FVM A;  1Z05 A;  3O1W A;  3IFR A;  4CEE A;  1GLL O;  3CQ8 A;  3O9R A;  3C95 A;  1Q82 O;  2HW3 A;  2QXL A;  4B3O A;  2H3G X;  4CF2 A;  3P1G A;  3HI0 A;  3R1X A;  4GNI A;  1C1C A;  4CEQ A;  4CHZ A;  4BDZ A;  1WSH A;  5EY4 A;  2UXD K;  1Q8I A;  1LWF A;  4M42 A;  3AY9 A;  2E8A A;  1SKS A;  1OH6 A;  2NRW A;  1VQ7 N;  2E4L A;  2GEM A;  3QER A;  4MQ3 A;  4DSF A;  5AQH A;  4CJE A;  1J5O A;  3K5O A;  1JL1 A;  2G8F A;  1HX1 A;  3LWM A;  4IJN A;  4O8K A;  1RT1 A;  1HJO A;  1D8Y A;  1P90 A;  3QIN A;  3T3F A;  5C25 A;  4BGA A;  3THX B;  1G99 A;  4I9L A;  4H4M A;  5M1O A;  1TAQ A;  5BRD A;  3HYF A;  5C12 A;  2KKZ A;  3NHG A;  3DMJ A;  4CHY A;  1ZBI A;  2QK9 A;  1KRP A;  4AHU A;  1KC8 O;  4AHT A;  5M1N A;  3RMA A;  1S9E A;  1HPZ A;  5FPM A;  5GAG P;  1U2V B;  4CFD A;  2E2Q A;  4DV7 K;  4MFB A;  5AQM A;  3ZSZ A;  5A2Q O;  3T19 A;  4U67 L;  2EHG A;  1VSJ A;  4ISF A;  1RT4 A;  1TL1 A;  1T8E A;  1YIJ N;  3OS2 A;  3EE8 A;  4CK1 A;  3RVC A;  3ZCM A;  5J2M A;  3PSF A;  3H3O B;  4JKB A;  2VCP A;  4DUZ K;  3AA4 A;  3ITH A;  1JCE A;  3LDQ A;  3CM6 A;  3N4Q A;  3HK2 A;  3KK7 A;  3OYF A;  4KHP K;  5CR4 A;  1IO2 A;  1X9S A;  1WBD A;  1ITG A;  4M45 A;  3SMP A;  3TWH A;  1KLN A;  3NH1 A;  5BN9 A;  3SBT A;  1JJ2 M;  3EL2 A;  4BRI A;  4AHV A;  4CEZ A;  4CK2 A;  1EX4 A;  2QA4 N;  4BG9 A;  4CES A;  1F21 A;  4BRC A;  1HYV A;  4LH5 A;  1RBT A;  3DLG A;  4M41 A;  4BRN A;  4KTW A;  4FJJ A;  1NGH A;  1Z6R A;  1U04 A;  1ZYQ A;  4C8O A;  4DV2 K;  4GVM A;  4KFB A;  3T1H K;  5DK5 A;  3E66 A;  3V9X A;  4B9U A;  4JI7 K;  3V9W A;  2QW9 A;  2FBT A;  3MN7 A;  1NKE A;  3S41 A;  3WQT A;  1NJZ A;  4WFA L;  4Q0B A;  4RG8 A;  4B9Q A;  4X65 K;  3TAN A;  1K8K A;  2D5R A;  3D2E A;  5KGW A;  1VQN N;  4GW6 A;  3U3Y A;  2ZJR L;  4CJQ A;  2VGN A;  4JAX A;  3HT3 A;  4KB0 A;  2O8E B;  1KSP A;  2GWK A;  4FJ8 A;  2O8B A;  1VRU A;  4ID5 A;  3UIQ A;  4DF4 A;  5KRT A;  4IWV A;  4CEO A;  5BRE A;  3LP1 A;  1S22 A;  4KBO A;  4DS5 A;  1RT6 A;  3V1O A;  3VF6 A;  3I0R A;  4PL7 A;  4Y1C A;  3ISN C;  1IKW A;  1VHX A;  4JK7 A;  4DLE A;  3E01 A;  4B8A B;  2GTD A;  2IVP A;  3WUH A;  3C6U A;  5I3U A;  4LF6 K;  3TAG A;  2YHW A;  3OJS A;  2D0P A;  1JXB A;  3FZH A;  4JI6 K;  2FBY A;  4M63 C;  4LF9 K;  1NGE A;  4AM7 A;  4FJX A;  2V7Y A;  4CJR A;  1SZ2 A;  3HP9 A;  3SUN A;  4JI0 K;  2NZT A;  3ID8 A;  1OVY A;  5GAE P;  1TK0 A;  4PKH A;  4OLB A;  2OA8 A;  1EWQ A;  1BGX T;  1R0A A;  1TYQ A;  4DTP A;  4B9T A;  4RW9 A;  4J2E A;  1HKG A;  1IH7 A;  2VG7 A;  3A5N C;  5AQJ A;  2FSN A;  1T03 A;  5C24 A;  1C0M A;  2GEL A;  4KRF A;  1JCG A;  3S3M A;  5M1F A;  3ULD A;  3A8Y A;  3LP0 A;  1S1W A;  1C0G A;  4DF8 A;  1RDA A;  3F2K A;  3U8X A;  4LF4 K;  3SAF A;  4W5N A;  3T69 A;  4AHC A;  3HPH A;  3DOL A;  3BY5 A;  3C7N A;  4DV4 K;  2CH5 A;  4DTS A;  2E1Y A;  3BP8 A;  4FWP A;  1NM1 A;  2HMI A;  4KH5 A;  2A40 A;  2VWK A;  1K8K B;  3D2E B;  5BN8 A;  1XI1 A;  2P5O A;  3I56 N;  1IG9 A;  1K9M O;  4OPA A;  4IJA A;  4CGH A;  4FSV A;  2O8B B;  1ASW A;  1LAV A;  3VEW A;  4BRF A;  5C42 A;  1KQS M;  4NLC A;  2I7P A;  4IFY A;  1NGA A;  2QM1 A;  1WLJ A;  2BAN A;  5EXW A;  3PSI A;  1VSH A;  3KLE A;  1Z26 A;  4JD2 A;  2YHB A;  2UU9 K;  5LMU K;  4CHO A;  2P9K B;  3ZET A;  4H5R A;  4CGD A;  4YOW A;  4N56 A;  5KTQ A;  2A3Z A;  1LWE A;  1KD1 O;  1RNH A;  3QO9 A;  4NXN K;  3O3F A;  3VEO A;  1G15 A;  4O4G A;  5SWM A;  3PX4 A;  1NBW A;  4YHH K;  2KZM A;  2WFB A;  2IGI A;  4ILG B;  4DV5 K;  2NRZ A;  5E84 A;  5I42 A;  2A5X A;  4DTX A;  1GOA A;  1BCO A;  1HRH A;  5JVG L;  5FPN A;  3KKS A;  4FJK A;  1QE1 A;  2KFN A;  4RW8 A;  4GKK K;  4FXD A;  1UOC A;  1T6C A;  4XEI A;  4C1N I;  4IZ9 A;  2PFU A;  3NGZ A;  4F4K A;  4YOR A;  5AQG A;  4JS4 A;  4M3X A;  3B6O A;  2FF3 B;  2HF3 A;  4JLH A;  4J2B A;  3ZX2 A;  1YF5 L;  4EIA A;  4KH6 A;  1QSL A;  3K5L A;  3SQ2 A;  1OH5 A;  4A57 A;  3MWT A;  3C7N B;  3LPU A;  5HRN A;  3WNE A;  4V19 S;  1BIS A;  4KHS A;  4PA1 A;  1BU6 O;  3K9K A;  2V7Z A;  3FE1 A;  4Z4E A;  3RWU A;  4CJP A;  2VG6 A;  3VA0 A;  1BOT O;  3IMX A;  3DLB A;  4B3M K;  3QIP A;  1KAZ A;  5F2R A;  3F9K A;  4DSJ A;  2GX9 A;  2BDP A;  1ATN A;  3TTD A;  1WAJ A;  1CXQ A;  1XNR K;  3NF9 A;  4Y0W A;  4JD2 B;  3OS1 A;  1NK0 A;  3AO5 A;  1V4T A;  1KFD A;  4XIU A;  4BRM A;  1QQM A;  4CFA A;  3CD6 N;  4BG8 A;  4OPK A;  4K42 A;  4QS9 A;  4JI4 K;  1NKC A;  1VQ8 N;  4BQZ A;  2RF2 A;  4CW7 B;  2QEX N;  4KHU A;  4ELU A;  1SQK A;  2PZS A;  1MDU B;  1FKP A;  5KPT A;  2P9I A;  4BAC A;  4FM0 A;  3SK3 A;  2I5J A;  4DTR A;  4JI3 K;  2E2N A;  4WQ4 A;  3MXM A;  3K59 A;  1DTQ A;  2J4R A;  4JHD B;  3MN6 A;  4FWK A;  3PX0 A;  4KI6 A;  3AVG A;  4LFA K;  4A5B A;  2Q1N A;  3CJ7 A;  4FO0 A;  3ATU A;  3VQD A;  4EZ9 A;  2GWJ A;  4ZHR A;  5K14 A;  1WSG A;  2A6A A;  2P51 A;  3O4N A;  5J2P A;  4H5W A;  3C65 A;  2ZE2 A;  5FRO A;  3ULE A;  3L0Q A;  3CQX A;  1B92 A;  4W5R A;  3GL1 A;  3L2Q A;  1VQ4 N;  3CQY A;  3U4L A;  4LSN A;  1ILY A;  3CFP A;  1DEJ A;  2NLX A;  5BPM A;  4CD1 A;  4FW2 A;  4DR6 K;  3NVM A;  4HCB A;  4QAG A;  3ZSX A;  2DFF A;  1X1P A;  1SL1 A;  2A42 A;  5M1P A;  5KI6 A;  1TV6 A;  5IT9 O;  2P5G A;  3ZYY X;  4E7K A;  1YUW A;  3M8P A;  1HYZ A;  4XH5 A;  4JN4 A;  2QTD A;  3HM8 A;  5CZ1 A;  1C6V A;  4RW7 A;  2O4G A;  3O6W A;  2UYT A;  2I7N A;  5E26 A;  1NK7 A;  3WXL A;  5AFU A;  3ZSY A;  5FPD A;  2VGM A;  3LAK A;  1HPM A;  3U9Z A;  1OH8 A;  4JKG A;  3HXM A;  4H8K A;  4BC3 A;  4KO0 A;  4Z4C A;  3MN5 A;  1NJW A;  1DTT A;  2Q97 A;  2P9I B;  1QVG M;  3EZ5 A;  5BRF A;  3GBT A;  4B3T K;  3ATV A;  2E2P A;  4DFP A;  4CVN E;  5I9E B;  3O9U A;  4CIE A;  3D0P A;  2P9N A;  2HVI A;  3G71 N;  1BQN A;  4JKH A;  5FLX O;  4DR1 K;  3TU5 A;  2D0O A;  3ZT1 A;  1BWF O;  1E4F T;  1WBB A;  1NK4 A;  1HNV A;  1KAX A;  4M3T A;  3SMS A;  4YOV A;  4HTU A;  1W2B M;  4CBX A;  4RW4 A;  3CCL N;  3A5L C;  5LJW A;  2KFZ A;  4B9V A;  4CJ4 A;  1QSS A;  4BC2 A;  2UUC K;  2OTJ N;  4H03 B;  3H45 C;  1NGC A;  3ULE B;  1O13 A;  2W6L A;  4JRQ A;  4G9Z A;  3WXK A;  2QWR A;  4LC9 B;  4PKI A;  1BA1 A;  4CFB A;  1OVQ A;  2F96 A;  4DHY A;  4HCC A;  3ZSQ A;  4CJW A;  1ASV A;  2QWL A;  3H08 A;  4BE1 A;  4A2B A;  4FLV A;  2D4W A;  4GY2 B;  3JAM O;  5GAH P;  4CGI A;  3KHY A;  1ZBU A;  4B3R K;  1NJI O;  5GIN A;  1NKB A;  3R9P A;  3JSM A;  3CF5 L;  4RWT A;  3B6P A;  3E9L A;  4FK0 A;  4FLT A;  3P83 D;  5DM6 L;  5F1X A;  1JLA A;  4JKA A;  4M3W A;  3LP2 A;  4OVL A;  4W5Q A;  4CGJ A;  3CET A;  2YNI A;  3F73 A;  4W5O A;  2WOM A;  1IG8 A;  2QWN A;  4H0P A;  3IG1 A;  4ILJ A;  1GLB G;  5AQY A;  3SQ1 A;  2G8H A;  1UA0 A;  3G10 A;  2HVH A;  3UKU A;  1OH7 A;  1SAZ A;  4EZ6 A;  4CJS A;  4KPY A;  1HNX K;  2OZM A;  4AM6 A;  5LJV A;  5AQN A;  5ADX A;  1NU0 A;  2DTU A;  2B5J A;  1MWM A;  1Q7Y O;  1RDB A;  1HQE A;  4FWS A;  5BR8 K;  3EYZ A;  1RDW X;  3LAN A;  4O5F A;  4BVO A;  3MDQ A;  1BO5 O;  1X3M A;  1IBM K;  5B8H A;  4N76 A;  1L3T A;  3KD1 E;  3L3U A;  4E0D A;  4PUO A;  3W3D A;  1TK8 A;  1SKR A;  4DQS A;  4CCH A;  2HOE A;  3HJF A;  1VQK N;  1M1K O;  4FPB A;  4RW6 A;  4CJF A;  3L2U A;  3KKR A;  1HR0 K;  1VSD A;  1GLC G;  5C2F A;  1E4G T;  1MU2 A;  3J7Y P;  4CZM A;  4BRQ A;  1IKX A;  3SQ4 A;  1QVF M;  2CGJ A;  3SPY A;  2E1Z A;  4O8U A;  2D0A A;  4FWR A;  3O3H A;  2PYJ A;  2O8D A;  1JLG A;  3AVH A;  2BTF A;  1YVU A;  3ZSW A;  1BL3 A;  4C8N A;  3LM2 A;  2UUB K;  3SAH A;  1RCH A;  2KZZ A;  1SV5 A;  2GBZ A;  3TAR A;  2ASO A;  1R59 O;  1RDD A;  4X62 K;  1EET A;  3LPT A;  1VRT A;  1O1W A;  4JYA K;  3KLF A;  4A61 A;  2P9L A;  4GV9 A;  4WFB L;  1XMO K;  3LDN A;  3CXC M;  2FLO A;  5AQF A;  4EAH D;  3BGR A;  5AQX A;  3BF1 A;  2FSJ A;  4N41 A;  4F3O A;  3CPW M;  3MAQ A;  5DM7 L;  2OTL N;  1M90 O;  2P9S A;  4NYN A;  3OA9 A;  4EP5 A;  3JYT A;  3L8B A;  4U7B A;  1NGB A;  3U6F A;  2QWQ A;  1XWL A;  2V51 B;  4YNQ A;  1U47 A;  4WE1 A;  1KVC A;  2FBV A;  4H0X B;  2QXF A;  2OAN A;  3T7Z A;  1KAY A;  1NGG A;  1T7P A;  3LDS A;  3O9Q A;  5F0X A;  4A59 A;  4E1M A;  4KHQ A;  1NWK A;  5KQD A;  3LAL A;  4BRK A;  3OYI A;  4DFK A;  3BZK A;  3D2F A;  3ZEU A;  1KXP A;  3L6Q A;  1REV A;  2O4I A;  4E19 A;  1JLE A;  3EKS A;  2IIR A;  5TKY A;  4B9S A;  4KTQ A;  4DFJ A;  3PIP L;  4CF0 A;  3NH2 A;  4YOT A;  3VMF B;  5M1Q A;  5AQP A;  5JLH A;  5JLF A;  4CBW A;  4JV5 K;  3B8A X;  1GLF O;  4CIF A;  4MO4 A;  5EU7 A;  4YDU C;  2FC0 A;  3AVJ A;  4BE0 A;  2HHX A;  2UUA K;  4GV3 A;  1WUA A;  5FRN A;  4OPH A;  2D0B A;  2VWB A;  3OBW A;  4LF7 K;  3NF6 A;  2BH1 A;  3THW A;  4BRL A;  1VSI A;  2P9S B;  2XY5 A;  4CJT A;  3CJB A;  3O4Q A;  1T44 A;  4B9L A;  5FPE A;  4KHN A;  5AQZ A;  1IBL K;  2V52 B;  3OYA A;  3NMU A;  3ZT0 A;  1NGI A;  2VQF K;  3SLC A;  4FLZ A;  4FJI A;  2IC3 A;  3P39 A;  3OTO K;  3C94 A;  3KIO A;  4DG1 A;  3UB5 A;  1JKH A;  3OJU A;  5BPN A;  4K43 A;  4ILH A;  4QS8 A;  1C1A A;  1GOB A;  3KLI A;  3SJJ A;  1QQC A;  2OPP A;  2ZGZ A;  3OY9 A;  4YOU A;  2G8I A;  3TR8 A;  5GAD P;  3ZEU B;  4OKK A;  4DWI A;  2ZD1 A;  4BRE A;  1E3M A;  4DSK A;  2OZS A;  3RTV A;  1C0U A;  3ZT4 A;  3CER A;  3TAM A;  4FWM A;  4A5A A;  1Q9Y A;  4LSL A;  3EY1 A;  1XMQ K;  1Q86 O;  3O80 A;  4HUG A;  2A1R A;  3AVA A;  1HYS A;  3L4Q A;  5AQK A;  1X9M A;  4WQ5 A;  3L2R A;  3NVK A;  1NK5 A;  2IOC A;  3CI5 A;  3QBW A;  5KRS A;  3NCI A;  3QEX A;  1Q81 O;  1B9D A;  2JWL A;  5CYQ A;  4CIG A;  3DLR A;  5AQT A;  5AQW A;  3EE9 A;  3TPQ A;  1DGK N;  1TKT A;  1IKY A;  4CZL A;  4DQ8 A;  4L3Q A;  5HRP A;  4GV6 A;  2UXB K;  5EX5 A;  3QEW A;  4BC5 A;  4FZZ A;  4DSI A;  3DOK A;  4JK9 A;  1SL0 A;  5JVH L;  3LM9 A;  1LCU A;  1UA1 A;  3TAP A;  2NRV A;  3M8S A;  5AZJ A;  1J54 A;  4BRD A;  2HMP A;  4E7L A;  3KD5 E;  2GV9 A;  3PLA A;  4DTU A;  2DPN A;  4CFC A;  4DLG A;  3NH0 A;  3K2P A;  3G6E N;  3OYE A;  1NJY A;  3D45 A;  2IVO A;  1QZ6 A;  1JXE A;  3DRS A;  3NF7 A;  3DJC A;  3MN9 A;  3FLC O;  1HUX A;  1JLF A;  1BHL A;  3OYB A;  4IXC A;  1EKE A;  4A62 A;  3H46 O;  1TYQ B;  4B1V A;  4C8L A;  4CZI A;  4BGB A;  3C0B A;  1KFS A;  2D1K A;  3SZ2 A;  3L2W A;  3VEX A;  5TKW A;  2QWM A;  4BE2 A;  4JEP A;  5DMR A;  1GOC A;  1WSI A;  3QEI A;  3J8A A;  3L4I A;  3K58 A;  2XY6 A;  1VQ9 N;  3HL8 A;  1U4B A;  2NRT A;  1WOQ A;  4DV6 K;  4BRP A;  2Z1I A;  1CZ9 A;  4B1U B;  3HTV A;  4DV0 K;  3OW2 M;  3NE6 A;  3PX6 A;  1N33 K;  1YHQ N;  3AA3 A;  1NG9 A;  3PUF A;  1W0H A;  3I55 N;  4J8F A;  1GLA G;  4Z94 A;  4OKJ A;  5HP1 A;  3V9Z A;  3JS6 A;  1NK9 A;  1B9F A;  1GLE G;  4NB4 A;  2BGG A;  3WXI A;  1TL3 A;  4DU3 A;  3QNN A;  4FL9 A;  4JNE A;  3VQB A;  3CCR N;  4M7X A;  3VQA A;  3C6T A;  3I8B A;  4NXM K;  4B8C A;  4GKJ K;  4LFC K;  1EO1 A;  2Y1I A;  1XC3 A;  2OCE A;  5H1S Q;  3ZET B;  1LW0 A;  3SNN A;  4CF9 A;  3VGL A;  3K0S A;  4IEI A;  1CZB A;  4FYD A;  3NGI A;  4CJL A;  1ATR A;  4J2A A;  5J2Q A;  2JLE A;  1S1U A;  2OPQ A;  3AO4 A;  2RN2 A;  2FXU A;  4L8R B;  1QQO A;  1MA9 B;  2YNG A;  1U49 A;  3CYM A;  5CYM A;  4BR9 A;  2O8C A;  4DTO A;  2GUP A;  2E2O A;  3VQ6 A;  2HBJ A;  2E88 A;  1BA0 A;  2KHO A;  4H0V B;  3LDP A;  3QIC A;  5EOY A;  3TAQ A;  4CF8 A;  3Q7B A;  2DY4 A;  3CCE N;  3VTH A;  5C15 A;  3LL3 A;  4BR7 A;  4R79 A;  3GG4 A;  4FWL A;  3FFK B;  1S5J A;  2E6L A;  3SV3 A;  3QEP A;  2YI1 A;  3HPO A;  2Y1J A;  1S3X A;  3KLG A;  4IOC L;  4KH4 A;  3S9H A;  2YV0 X;  1RBV A;  1VQP N;  4A2A A;  3Q7C A;  2WBN A;  1QHA A;  4K8X A;  1HLU A;  4B1X B;  4YY3 K;  1S72 N;  3MK6 A;  3V1R A;  5D3G A;  1RIL A;  3FZL A;  2NRR A;  3NF8 A;  3PV8 A;  5AQO A;  4QCL A;  4B9M A;  3BUZ B;  4E3S A;  2ASP A;  3NFA A;  4KV8 A;  2HBL A;  3QFP A;  4MLE A;  3OS0 A;  1RFQ A;  2VQE K;  4I9Q A;  3CC4 N;  3CFR A;  4BR4 A;  4LFB K;  1BIZ A;  3R3L A;  2OPS A;  5AQS A;  4DQQ A;  3THV A;  1ASU A;  2XRI A;  1VSF A;  3AGK A;  3VN5 A;  3CCU N;  4DS4 A;  5FRM A;  4FWQ A;  2VG5 A;  3WEE A;  2G8W A;  3THY A;  4KHY A;  1RTJ A;  4KB1 A;  2O8C B;  3HM9 A;  3J7Z O;  3SUO A;  1SS6 A;  3DXM A;  2A1S A;  1VQL N;  4HUF A;  1N34 K;  1IBK K;  3RSE A;  2HB5 A;  3DLH A;  2QKK A;  1JLC A;  4IG3 A;  2HBM A;  3MED A;  3EN9 A;  3K9J A;  4Y1D A;  3MEC A;  3R6M A;  3CC2 N;  3A0I X;  3V9U A;  4LD0 A;  3ZSR A;  5AZI A;  3TI0 A;  2BE2 A;  4CBU A;  2HHH K;  1ZXO A;  4K8Z A;  3J81 O;  2PY5 A;  1ZC6 A;  2HHV A;  4LF5 K;  1RT2 A;  4EFH A;  4ZTF A;  3DRP A;  3LDL A;  3WNF A;  2HND A;  3I8D A;  2IAJ A;  5AQR A;  4FZY A;  3RR7 A;  3VQE A;  1WNS A;  4MDB A;  1D9F A;  3VF4 A;  1Q18 A;  3VQ7 A;  4PHT X;  3SCX A;  4IDK A;  1LOT B;  2NUB A;  3AO1 A;  4BWM A;  3VER A;  4ID1 A;  5AJ3 K;  4H0T B;  4E7J A;  4CEB A;  4WF9 L;  3PIO L;  3KJV A;  1X9W A;  3BDP A;  4FJM A;  5CHI A;  2DFH A;  1YT3 A;  3AVF A;  4BWJ A;  1EWR A;  1JL2 A;  3KWG A;  4FWN A;  2VWJ A;  3MEG A;  1HQU A;  1J6Z A;  4KAZ A;  3THY B;  4EP4 A;  4JKG B;  4CED A;  2YHA A;  4MDA A;  2YKM A;  2B4J A;  3RSE B;  5BRH A;  3LZI A;  4AHR A;  3UE5 A;  2ITM A;  3DAW A;  2YNF A;  2G8V A;  4BR5 A;  4DQI A;  4EHT A;  3KZB A;  2YJF A;  3HVR A;  3IDH A;  1K6Y A;  4XH4 A;  3AAR A;  4FVU A;  4CJ7 A;  1TKD A;  4Z4H A;  3RMD A;  2P9N B;  1JLQ A;  3QBX A;  4FJ7 A;  3QML A;  4E7H A;  2QWP A;  5AZI B;  4DSL A;  3AVN A;  1QZ5 A;  1RBR A;  4CZH A;  2O8F A;  4DR7 K;  1RDU A;  1WN7 A;  4NO7 A;  3VET A;  4ZTJ A;  3IRX A;  3DYA A;  3SBG A;  2B6A A;  3VTI A;  1RBS A;  2YX6 A;  1TUU A;  4FWO A;  3V81 A;  3JXU A;  1NK6 A;  4M3Y A;  4DFM A;  3GE1 A;  4JI2 K;  3QDK A;  3WNG A;  1KLM A;  3AAQ A;  4Z4F A;  5M1K A; 
#chains in the Genus database with same CATH homology
 5AQG A;  4OPH A;  2VWB A;  2FF3 B;  2KLA A;  2QI2 A;  1HKB A;  3OBW A;  4C23 A;  2HF3 A;  2Q2R A;  3ZX2 A;  1YF5 L;  3ID6 A;  4EIA A;  4KH6 A;  2BH1 A;  4NLB A;  5HOO A;  4H5T A;  4I6M A;  4BRO A;  4UY8 O;  2ASM A;  4BRL A;  4B1Y B;  2P9S B;  4PKG A;  3CJB A;  3O8M A;  1T44 A;  4A57 A;  1YXQ A;  3MWT A;  3O5B A;  3TSP A;  5FPE A;  3C7N B;  3CPE A;  5AQZ A;  3CJ1 A;  2V52 B;  3O08 A;  3F5T A;  4WQ5 C;  3EZW A;  1MWK A;  2WC9 A;  2AP1 A;  4GVE A;  5KPR A;  3H1Q A;  3M3Z A;  3NMU A;  1NGI A;  1YI2 N;  3C6A A;  1BU6 O;  2CGK A;  3SLC A;  3ENH A;  3K9K A;  2V7Z A;  3FE1 A;  3TSQ A;  2YJE A;  4IDH A;  4MO5 A;  3CIP A;  1N8R O;  5AQV A;  3G4S N;  3P39 A;  3SAG A;  1GLJ O;  3CC7 N;  1BOT O;  4BC4 A;  3UB5 A;  1K73 O;  3IMX A;  1YAG A;  4WQ4 C;  3IKM A;  5BPN A;  2YCH A;  4ILH A;  4K43 A;  4HWI A;  1KAZ A;  5F2R A;  4QS8 A;  2NNW A;  4K25 A;  4FOE A;  4YDU A;  2GX9 A;  2NRX A;  1ZBS A;  1YVN A;  1ATN A;  3FR0 A;  4H0O A;  3TTD A;  5LY3 A;  1ESV A;  2ZGZ A;  5ELZ A;  3UKU B;  4YOU A;  3BF3 A;  3M5R A;  3WT0 A;  5GAD P;  2F7T A;  4XH1 A;  4Y0W A;  3ZEU B;  5KQ8 A;  4IEE A;  4JD2 B;  4WFN L;  1VQO N;  3TTF A;  4BRE A;  1CZA N;  1V4T A;  4BRM A;  3GDQ A;  3W0L A;  2RE2 A;  1QQM A;  1DT9 A;  3CER A;  3CD6 N;  4JKC A;  4BG8 A;  5CE3 A;  2Q36 A;  4FWM A;  4K42 A;  4QS9 A;  4A5A A;  2EWS A;  1VQ8 N;  3HSC A;  3C6H A;  3R8E A;  3O80 A;  4BQZ A;  1Q86 O;  3MMV A;  1T6D A;  1QQN A;  2QEX N;  3L4Q A;  5AQK A;  3ENO A;  4YOX A;  4H5N A;  4JKE A;  4WQ5 A;  3AAP A;  1RGI A;  3TSU A;  2VYP A;  1SQK A;  5C0Y A;  3NVK A;  5C10 A;  1MDU B;  3KVG A;  1C0F A;  3CI5 A;  4JK8 A;  3WEE B;  3QBW A;  1Q81 O;  2JWL A;  3QB0 A;  5KPT A;  5BPL A;  2P9I A;  5AQT A;  3SK3 A;  5AQW A;  3DXM B;  3EE9 A;  3P31 A;  2E2N A;  1DGK N;  4WQ4 A;  3TPQ A;  4CZL A;  4DQ8 A;  4L3Q A;  4GV6 A;  5EX5 A;  4BC5 A;  3O9T A;  4JKD A;  5JMV A;  4JK9 A;  4BRG A;  5MLC Q;  4I6M B;  4CD3 A;  2J4R A;  3FZM A;  4JHD B;  5JVH L;  5EVZ A;  3MN6 A;  3CCS N;  4HTL A;  4FWK A;  3LM9 A;  1LCU A;  2PAV A;  2F9W A;  2NRV A;  5AZJ A;  4B1Z A;  4BRD A;  1NMD A;  2HMP A;  4YOY A;  3LDO A;  3PLA A;  2DPN A;  4A5B A;  2Q1N A;  3CJ7 A;  4FO0 A;  3ATU A;  1U6Z A;  4OO1 J;  2W40 A;  2GWJ A;  4K41 A;  1JCF A;  3G6E N;  3FZF A;  1NGF A;  2A6A A;  5AQQ A;  3CJ9 A;  3U9D A;  2IVO A;  4M7Y A;  3CJC A;  4H5W A;  3VPZ A;  3WXJ A;  1QZ6 A;  3C65 A;  4F9O A;  3ULE A;  1T3V A;  3CQX A;  3L0Q A;  3MCA B;  3DJC A;  3MN9 A;  3FLC O;  1HUX A;  3GL1 A;  1P8Z A;  1VQ4 N;  4CZE A;  4IXC A;  3CQY A;  3HBT A;  4FOI A;  1NLV A;  3U4L A;  4A62 A;  3H46 O;  4BRH A;  1TYQ B;  3D7E O;  4B1V A;  4CZG A;  4WCE L;  1ILY A;  4CZI A;  1DEJ A;  2NLX A;  1NGJ A;  2P9L B;  3C0B A;  3E9P A;  3VEV A;  4BGB A;  3NVM A;  4CD1 A;  5BPM A;  2D1K A;  1X9J A;  1DKG D;  3MWP A;  5C2D A;  1U2V A;  3P4I A;  1OKJ A;  3VEX A;  5TKW A;  1VQ6 N;  3ZX0 A;  2A42 A;  2QWM A;  5M1P A;  3DLL L;  3QFU A;  4JEP A;  1BG3 A;  3ZYY X;  1EQY A;  2A41 A;  4DCH A;  3VEN A;  4BRA A;  1YUW A;  2ZJP L;  1D4X A;  3FZK A;  3J8A A;  3L4I A;  4XH5 A;  4JN4 A;  2QTD A;  3HM8 A;  1VQ9 N;  1NGD A;  4CZF A;  3O6W A;  1IJJ A;  2NRT A;  2UYT A;  2I7N A;  5E26 A;  1WOQ A;  2Q31 A;  1XUP O;  3VOV A;  1Z05 A;  3O1W A;  3WXL A;  3MCP A;  4BRP A;  5AFU A;  5FPD A;  3IFR A;  3D6R A;  1GLL O;  2VGM A;  1HPM A;  3U9Z A;  4JKG A;  3O9R A;  4B1U B;  3HTV A;  2ZGY A;  5BR9 A;  4BC3 A;  3OW2 M;  1Q82 O;  3IUC A;  3M6G A;  2QXL A;  1YHQ N;  4BY9 C;  4H0Y B;  3VGK A;  3H1V X;  2PBD A;  2H3G X;  3I55 N;  4J8F A;  1GLA G;  3HI0 A;  3MN5 A;  3VGM A;  2Q97 A;  3R1X A;  2P9I B;  3I33 A;  4Z94 A;  1QVG M;  3G25 A;  4GNI A;  3JS6 A;  1VQM N;  5GIO A;  5BRF A;  4DB3 A;  1GLE G;  3GBT A;  3ATV A;  2E2P A;  4NB4 A;  5EY4 A;  3WXI A;  4WYB A;  3AY9 A;  5I9E B;  3O9U A;  3VF2 A;  2E8A A;  4FL9 A;  2NRW A;  2P9N A;  3UKR A;  1VQ7 N;  4JNE A;  3G71 N;  4IZ9 A;  1V4S A;  4JKH A;  2GEM A;  3CCR N;  4M7X A;  3TU5 A;  4C1N K;  2D0O A;  2P9P A;  1BWF O;  2P9K A;  1E4F T;  3I8B A;  5AQH A;  1Y64 A;  1KAX A;  3SMS A;  4YOV A;  3D2F B;  1EO1 A;  1W2B M;  4CBX A;  1XC3 A;  5H1S Q;  3VEZ A;  3O4W A;  3CCL N;  3ZET B;  3A5L C;  5LJW A;  1HX1 A;  3MX2 A;  3VGL A;  4IJN A;  4FPA A;  4O8K A;  4QS7 A;  1H1V A;  2JWK A;  4BC2 A;  4IEI A;  1HJO A;  4GV3 A;  2OTJ N;  3F9M A;  4H03 B;  1P90 A;  1ATR A;  2W41 A;  3H45 C;  1NGC A;  3ULE B;  1XQS C;  2FXU A;  1O13 A;  3WQU A;  1QQO A;  1G99 A;  4BGA A;  1MA9 B;  5M1O A;  4BR9 A;  4G9Z A;  5BRD A;  2HST A;  2P9U A;  2QWR A;  3WXK A;  2GUP A;  5C12 A;  2E2O A;  2KKZ A;  4LC9 B;  4PKI A;  2HBJ A;  2CGL A;  1BA1 A;  1BUP A;  2E88 A;  3CCV N;  1KC8 O;  1BA0 A;  5M1N A;  1ATS A;  1GLD G;  2KHO A;  4IFE A;  4H0V B;  5FPM A;  5GAG P;  2YHY A;  4DHY A;  3CCQ N;  1U2V B;  3LDP A;  3QIC A;  5EOY A;  3Q7B A;  2E2Q A;  2BUP A;  2QWL A;  5AQM A;  4A2B A;  3CCE N;  2D4W A;  2YHX A;  3VTH A;  4U67 L;  5C15 A;  3LL3 A;  4BR7 A;  4GY2 B;  4R79 A;  3KWI A;  4ISF A;  4ISG A;  3GG4 A;  5GAH P;  3GOI A;  4FWL A;  3KHY A;  3FFK B;  1NJI O;  5GIN A;  1YIJ N;  3R9P A;  3CME N;  3CF5 L;  4RWT A;  5AQU A;  3E9L A;  3EE8 A;  1W97 L;  2YI1 A;  3RVC A;  5DM6 L;  5F1X A;  1S3X A;  4JKA A;  5AFU H;  4BR0 A;  3H3O B;  4JKB A;  4IOC L;  4KH4 A;  2VCP A;  2WUS A;  3CET A;  1VQP N;  1JCE A;  4A2A A;  4IO8 A;  3LDQ A;  3Q7C A;  2WBN A;  1QHA A;  3N4Q A;  3KK7 A;  1IG8 A;  2QWN A;  4E1J A;  5CR4 A;  3BEX A;  3DWL A;  3O1B A;  4H0P A;  1HLU A;  4ILJ A;  4B1X B;  1S72 N;  3MK6 A;  3SMP A;  1GLB G;  5AQY A;  3FZL A;  3E1Y A;  3VEY A;  2NRR A;  2CH6 A;  5BN9 A;  3CCM N;  5AQO A;  3SBT A;  3UKR B;  3UKU A;  1BDG A;  1JJ2 M;  4B1W B;  1SAZ A;  5AQI A;  3EO3 A;  4ISE A;  3EL2 A;  3BUZ B;  4BRI A;  4AM6 A;  5LJV A;  4H5V A;  2ASP A;  5AQN A;  5ADX A;  2P9P B;  3MX5 A;  2QA4 N;  4BG9 A;  1MWM A;  2HBL A;  3QFP A;  4BRC A;  3E9O A;  1Q7Y O;  4MLE A;  2Q0U A;  1RFQ A;  4FWS A;  4BRN A;  3CC4 N;  1NGH A;  1Z6R A;  2FF6 A;  4BR4 A;  1RDW X;  2HF4 A;  4O5F A;  3R3L A;  4BVO A;  3EKU A;  3MDQ A;  1BO5 O;  1X3M A;  5AQS A;  4BQL A;  5B8H A;  1YJN N;  3E66 A;  2HBK A;  2QW9 A;  3MN7 A;  3AGK A;  5JIC A;  3S41 A;  3WQT A;  3CCU N;  4FWQ A;  4WFA L;  3WEE A;  3DXK A;  3W3D A;  2RHK A;  4B9Q A;  2HOE A;  1K8K A;  2P9U B;  3D2E A;  1VQK N;  1VQN N;  3J7Z O;  1M1K O;  4FPB A;  3CMA N;  2ZJR L;  1SS6 A;  2VGN A;  4IOX A;  3DXM A;  4JAX A;  1VQL N;  4IO9 L;  1GLC G;  2GWK A;  3WXM B;  3HRG A;  3RSE A;  4IOA L;  5C2F A;  1E4G T;  3ZX3 A;  2HBM A;  5HL7 L;  4IWV A;  4JHD A;  5BRE A;  3EN9 A;  1S22 A;  3K9J A;  2NRH A;  4KBO A;  2ZWH A;  4BRQ A;  4CZM A;  3VF6 A;  3R6M A;  1QVF M;  5AQL A;  5KPZ A;  1YJW N;  3CC2 N;  4PL7 A;  1VQ5 N;  2CGJ A;  1HKC A;  2E1Z A;  3A0I X;  4O8U A;  4FWR A;  5AZI A;  4JK7 A;  4CBU A;  2GTD A;  2IVP A;  5AZJ B;  3WUH A;  1ZXO A;  2YHW A;  2D0P A;  3FZH A;  1ZC6 A;  3FGU A;  1TUY A;  2BTF A;  3VES A;  4EFH A;  4M63 C;  3O9S A;  1NGE A;  4AM7 A;  2V7Y A;  1YIT N;  3LDL A;  3LM2 A;  1SZ2 A;  3SAH A;  5AQR A;  2NZT A;  3ID8 A;  1OVY A;  5GAE P;  4PKH A;  3AGR A;  4MDB A;  2ASO A;  3OBY A;  1R59 O;  3M1F A;  1TYQ A;  3CJA A;  3HOS A;  2ZJQ L;  3VF4 A;  1Q18 A;  4A61 A;  3HOT A;  4BVP A;  2P9L A;  4GV9 A;  4WFB L;  4PHT X;  1HKG A;  3LDN A;  3A5N C;  1LOT B;  5AQJ A;  2FSN A;  3CXC M;  2FLO A;  5AQF A;  4EAH D;  5AQX A;  2GEL A;  2E20 A;  3BF1 A;  3P38 A;  2FSJ A;  1JCG A;  3VER A;  3CPW M;  1K8A O;  5M1F A;  5ADX H;  4H0T B;  3A8Y A;  5DM7 L;  4WF9 L;  1X3N A;  1C0G A;  3PIO L;  2OTL N;  1YJ9 N;  3F2K A;  3U8X A;  1M90 O;  3SAF A;  2P9S A;  5CHI A;  4BR2 A;  3OA9 A;  3T69 A;  3CCJ N;  3H3N O;  4U7B A;  1NGB A;  3C7N A;  4AF1 A;  2QWQ A;  2CH5 A;  3KWG A;  4FWN A;  2E1Y A;  2V51 B;  3OHR A;  1J6Z A;  3BP8 A;  4FWP A;  1NM1 A;  4KH5 A;  3DXK B;  3H6E A;  3HZ6 A;  4JKF A;  2A40 A;  4MLH A;  1K8K B;  4JKG B;  3D2E B;  5BN8 A;  4H0X B;  2OAN A;  3T7Z A;  4MDA A;  2FSK A;  3I56 N;  1K9M O;  2ZF5 O;  1KAY A;  4IJA A;  1NGG A;  3CHW A;  4OPA A;  4FSV A;  3RSE B;  3N4P A;  3VEW A;  5BRH A;  3O9Q A;  4CI6 A;  3UE5 A;  2ITM A;  4BRF A;  5F0X A;  1KQS M;  3DAW A;  4NLC A;  4A59 A;  4BR5 A;  2I7P A;  2IVN A;  4EHT A;  3A5M C;  1NGA A;  2F9T A;  2YJF A;  3KZB A;  3ENB A;  2QM1 A;  1NWK A;  3IDH A;  4XH4 A;  5EXW A;  3AAR A;  5KQD A;  4BRK A;  5AR0 A;  4FVU A;  4CJ7 A;  2P9N B;  3QBX A;  3QML A;  3D2F A;  2QWP A;  3ZEU A;  1KXP A;  3L6Q A;  4JD2 A;  5AZI B;  1QZ5 A;  2P9K B;  3ZET A;  4H5R A;  4YOW A;  3TTC A;  2A3Z A;  4DKW A;  1KD1 O;  4CZH A;  3EKS A;  2IIR A;  2Q0R A;  1VAZ A;  5TKY A;  3VEO A;  3A5O C;  1RDU A;  3PIP L;  4NO7 A;  3VET A;  1NBW A;  4YOT A;  3VMF B;  3SBG A;  4RCH A;  5M1Q A;  2WFB A;  5AQP A;  4ILG B;  4CZK A;  2QWO A;  4CZJ A;  5JLH A;  2NRZ A;  5E84 A;  3VTI A;  2A5X A;  2YX6 A;  1TUU A;  4FWO A;  5JLF A;  5GIP A;  4CBW A;  4RTF D;  3JXU A;  5JVG L;  4EHU A;  5FPN A;  3B8A X;  1GLF O;  4PL8 A;  4MO4 A;  4YDU C;  3GE1 A;  2AA4 A;  3QDK A;  1T6C A;  4XEI A;  3SJH A;  3AAQ A;  2PFU A;  4C1N I;  5M1K A;  1WUA A;  4YOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...