5M1KA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound magnesium
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
189
Chain Sequence
PAMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
total genus 66
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1kA00
5C10A 4IDHA 3CPEA 3C6AA 3C6HA 5C2FA 4IEEA 5M1FA 5M1KA 4IEIA 5C12A 5M1PA 5C2DA 5M1QA 5C15A 5M1OA 4IFEA 5M1NA
chains in the Genus database with same CATH superfamily
3HSCA 4F3TA 4ELVA 1VQKN 4C8LA 1BGXT 2J4RA 4X64K 4A2AA 2ZGYA 2NRVA 1S1VA 3PIPL 3BUZB 3NCIA 3VESA 1JKHA 1NGGA 1NJZA 3L0QA 4X66K 4Z4EA 4CBXA 2OZMA 1N6QA 3EE8A 4NYFA 4KHYA 2D1KA 3K57A 3MX2A 3C6UA 2QEXN 3QMLA 3OYCA 4CJQA 3OVNA 1NOZA 1CXQA 2DTUA 1HX1A 1GLCG 3CJ7A 1SV5A 4ID1A 1NKBA 5AQMA 4OJRA 2UUBK 3ULDA 1A5WA 3SQ2A 3THXB 4B3RK 2QKKA 2YNFA 4WQ5A 3B8AX 4FWKA 3A0IX 3OYDA 4OVLA 4LFCK 3TAGA 2F8SA 2HHTA 2P9PA 2PZSA 4B9LA 1KVCA 4CERA 2P9UA 2A40A 2Q97A 5ADXA 4CBWA 1K9MO 2A1RA 3VQ6A 4A5AA 4AF1A 1HYZA 4QAGA 3WXKA 3E66A 2ASMA 1NM1A 2OPPA 3MDQA 3V81A 2KTQA 4M3RA 1T6CA 2HNZA 3SUPA 1NK4A 4DV6K 1HPZA 1GLBG 1S22A 1N8RO 4O4GA 2WBNA 2YNHA 1XNRK 2KKZA 2E8AA 3OYIA 3O9TA 3FR0A 4A62A 2XO7A 4DF4A 4BRIA 4DV4K 5BR8K 3MWTA 4DQRA 5CE3A 5TKWA 1B9DA 3SMSA 3GE1A 4CF1A 4Z4FA 3PX6A 2JLEA 1FKPA 2OA8A 5C24A 3RSEA 4CD1A 4BRDA 3K5NA 3MN6A 4B3SK 4WYBA 3H6EA 4CFAA 1VRUA 3M1FA 4CECA 2QWNA 4CD3A 2AJQA 3NHGA 3ENOA 4O44A 1KRPA 4LH4A 1BU6O 3EEQA 1C6VA 4IG0A 1YJWN 1KTQA 4JK8A 5AQTA 4J2AA 2HMPA 1NGDA 4RW9A 4ZTFA 5ADXH 1CZ9A 1TK8A 2OPQA 3K58A 4CHZA 4U7BA 3HP6A 1SL0A 4DTJA 2QM1A 5AQVA 3LWMA 2GELA 1RNHA 3PX4A 3QBXA 2YHAA 3I0SA 3KK7A 4RW8A 3KLEA 4IO9L 5EOYA 2D5RA 3TSQA 4ISGA 1ZBHA 1NG9A 3OYBA 4E89A 4V19S 1IKXA 4F3OA 4CIEA 4CVNE 4E19A 4CHQA 3O8MA 4JKGA 3KWIA 3HVTA 3ENBA 4YOWA 3LL3A 3MCAB 1YXQA 1WSJA 1NMNA 4N76A 2QKBA 2RHKA 2P9SA 4JD2A 1VSLA 3O3GA 1KAYA 3UB5A 4IFVA 2YKNA 5AQPA 2YX6A 3M8SA 3IG1A 1Q8IA 4JHDA 5KQDA 3DWLA 2WONA 4LF8K 1KFDA 1VQ6N 2P9LB 4KHPK 3V1OA 1NNEA 3THYB 1U6ZA 1EKEA 5JMVA 3P31A 1TYQA 4EHTA 4CIGA 1B9FA 3TABA 3TR8A 3KK3A 4PUOA 1L3VA 3HM8A 3CMAN 5FRMA 4BE1A 4B3OA 3ASMA 1BIZA 3HJFA 4LF4K 4BACA 3FZHA 3M6GA 1VK0A 2A6AA 2OYQA 1W2BM 4B9SA 2IDOA 3QB0A 3VGLA 4CI6A 4YOTA 2R7YA 3BP8A 1HNXK 3D2FB 1XC9A 3DLRA 1JL1A 2BDPA 3KLGA 1Q81O 1W97L 2P9KA 4WFBL 2ATQA 1U47A 2O8DA 5AQFA 3LDNA 3T69A 5JVGL 5J1EA 3M8QA 1WSIA 1HRHA 3VEVA 1OH5A 4FSVA 4A61A 4FLTA 1K8KA 4AHTA 3OS0A 4H5NA 3TAQA 2Z1IA 3PIOL 4M3TA 1GLEG 3QEPA 1EWQA 3AARA 5AQRA 1RFQA 1TL3A 4WQ4C 4DR2K 5BPNA 3VA3A 4KHSA 4JEPA 4NCGA 2G8FA 4BR4A 4DV3K 2PYJA 4IDHA 3LAKA 4IG3A 3KZBA 2F9WA 3EY1A 2QA4N 3OHRA 4CJ4A 4C23A 1WSHA 3N4PA 3RVCA 3B6OA 1NJWA 2BGGA 1DLOA 2E2QA 1WN7A 1EO1A 2HNDA 3EZ5A 4DTSA 3CETA 4CGGA 4E7LA 3U3GA 4AH9A 4DV2K 4DV7K 1RBTA 3KK2A 3VQPA 1B92A 3TARA 1ZBLA 1C0FA 3N4QA 4BRFA 4DFPA 4CFBA 4OGCA 4CZMA 3MN9A 1J5EK 1RCHA 1DTQA 2XY7A 2ZJRL 4GMJB 4BDPA 3EE9A 2E20A 4DTNA 1TKZA 1X9SA 1QQNA 4HCBA 1I39A 2A42A 3ZSZA 3O4NA 3FZMA 2XHBA 3QFPA 3QLHA 4DSEA 4WQ4A 4CZJA 1Q9YA 3D2EA 2P9PB 3K5MA 3AA5X 3GBTA 1GLLO 4KH4A 4LSNA 4BROA 4ILJA 2P9UB 4B1ZA 4ZHRA 1L3SA 3U3YA 3V9UA 5J2QA 1LAWA 2NRHA 5AQQA 3OYEA 3CC2N 4FK2A 2X78A 3DOLA 3HOSA 3HPHA 3DXMA 4PKIA 1JCFA 1XUPO 4KTWA 1C1BA 2ZF5O 3GG4A 3LANA 1GLFO 1I3AA 2ZGZA 4BRLA 2QK9A 1KLNA 1TL1A 4C8MA 1FXXA 5BRFA 4CJPA 5F2RA 3MEEA 3TU5A 1XHZA 1JXBA 4CZFA 1JLQA 1RILA 3VENA 1D9FA 4H5VA 5E41A 3OBYA 4FLVA 3HP9A 4K8ZA 1VQON 5AQWA 4Z4GA 2PY5A 4C8KA 4DFMA 3QFUA 3Q7CA 3PSIA 4H0VB 3RSEB 5AQKA 5AQXA 4E1MA 3QEXA 1NK0A 3MXJA 3ZT2A 2VGNA 4FWRA 5EXWA 4BR5A 3L2UA 2HSTA 3PLAA 3TAEA 3KWGA 3M8PA 5CHIA 4IOCL 3OYMA 3VETA 5AQOA 4DHYA 3SUOA 4CGFA 3CCRN 3LM9A 3LP3A 1QSLA 1VAZA 2ASOA 5GIOA 5CYMA 3VGMA 2ITGA 4BC2A 4CEFA 1R0AA 1LV5A 4AILC 4BRPA 1HQUA 3KHYA 2P9IA 4JI5K 3C0BA 3FZFA 3I8DA 3CCUN 4B8AB 3ZSVA 3PUFA 2QWMA 1BL3A 1NKEA 3HT3A 4DMNA 4NLCA 1R59O 1ATRA 3PSFA 4DSKA 4JKGB 4FZYA 4H0XB 1XNQK 1XMOK 1Z6RA 4BR7A 4F2RA 4IDKA 4CGHA 3DLGA 4FVUA 2I7PA 4FCYA 5AQJA 2Y1IA 5EU7A 1KFSA 1UOCA 2P9SB 4JD2B 4JKCA 1IJJA 3ZT1A 4BR2A 1ZBUA 1RBRA 1YJNN 1ASVA 1OH8A 3WUHA 4BG9A 1YVNA 3I56N 5KGWA 3OTOK 4JHDB 2V7YA 5BREA 3WQTA 4E7IA 3I33A 1RDBA 3TPQA 5AFUA 4YOVA 4BGBA 2CH5A 3VQ5A 4F9OA 2RPIA 3V9WA 1RDCA 3EN9A 5JLFA 1MWKA 1TYQB 2OZSA 3H1QA 3K9KA 2W40A 3SV3A 4JYAK 3UKRA 3OYHA 4H5WA 5CR4A 1M90O 4FWNA 2RF2A 2ZE2A 1GOCA 3J80O 1S3XA 4DLEA 4BRNA 3TANA 1TKXA 3THWA 1BWFO 1KVBA 2FSNA 1U2VA 3DJCA 4JAXA 3AO4A 2NNWA 3TTDA 2UXBK 3VMFB 3C6AA 4OPAA 5AQYA 3ATUA 3F9KA 3SUQA 2NUBA 3A5MC 5HBMA 1HR0K 4DKWA 5C0YA 2O8DB 3E01A 4CEAA 2ZJPL 4BR0A 4JKFA 3EZWA 1U4BA 4DQPA 2G8IA 1ZBFA 1K8KB 1E4FT 2FSJA 1U45A 4FJHA 5BR9A 4O0JA 3CHWA 1UA1A 1D8YA 1RT5A 2Z1GA 1NK7A 4DQQA 3LALA 3WQUA 2KZMA 3I8BA 3OYGA 1RBSA 1T7PA 4FK4A 1MU2A 3DYAA 3AVKA 2O8CA 5FPEA 3IS9A 2P5GA 1JLGA 4KO0A 4EP4A 1QSSA 2Q2RA 3P5JA 4N41A 3O3FA 5I3UA 3O5BA 4KAZA 4FM0A 4H0YB 4FO0A 1Q18A 1IO2A 4W5RA 4CEEA 5KRTA 3DI6A 1SL1A 4MDBA 4BRMA 1IBMK 2HF3A 4DB3A 3B6PA 4Z4HA 3WXLA 3ZSOA 5HP1A 3L6QA 4BC3A 4KHNA 3CCLN 3AVHA 4EP5A 3NVKA 1GOAA 3EL2A 2HBMA 1YT3A 4CF8A 3HZ6A 1S72N 3FGUA 4LY7A 3CMEN 3R3LA 3NVMA 4DFKA 5C2FA 3O1WA 2OPRA 2JGUA 3P38A 4H5RA 1TV6A 3RMDA 1JJ2M 3NFAA 3E9LA 3MEGA 1EP4A 5M1PA 1BHLA 3RR7A 2P5OA 3D2EB 5KI6A 3HPOA 3E9OA 3NH0A 4E0DA 1N32K 3GL1A 4DV0K 1CLQA 2YHWA 3L3VA 3MCPA 3HPGA 1CZAN 2F8TA 1RDWX 4N56A 1ATNA 3ZETA 1T3VA 2DFHA 4DSIA 1IBLK 3DXMB 4DLGA 4OGEA 4KV8A 3VEWA 1NGCA 1WOQA 3QNNA 1QS4A 1NLVA 3NMUA 2QWRA 4AM6A 2Q0UA 4K8XA 3FFIA 2X6SA 3AO2A 4JKDA 2VQFK 2B6AA 2PFUA 3FE1A 3R8EA 5GAHP 3IKMA 2HNYA 3LZJA 1KLMA 5GIPA 1WBBA 3C95A 3CM6A 1WSEA 5EY4A 4WFAL 4CZKA 3CQXA 3AO5A 4CJ5A 3OBWA 4CEOA 4EAHD 2G8VA 3VQ9A 1Y64A 1FK9A 3NBPA 3HRGA 4HUGA 2V7ZA 4Y0WA 3V9SA 3E1YA 5FPDA 1N34K 4IKFA 5CZ1A 2HF4A 1W7AA 1C0MA 1YJ9N 4BC5A 4KHQA 2Z1HA 3AVCA 4Q0BA 1D5AA 1RT4A 1YITN 4KPYA 2Q1NA 4EZ6A 3HO1A 4QS9A 4B1WB 1XHXA 3ENHA 4H0TB 1X3NA 1U49A 2WFBA 1YI2N 1WSGA 3ITHA 3SNNA 3SCXA 3BZCA 4A57A 2P9IB 2Q3SA 1YIJN 1IG8A 2E5LK 4TSXA 1QVFM 1S1WA 3OW2M 1EXQA 3NAEA 1HNZK 2OTLN 4CK3A 2AP1A 4B08A 4KHWA 4PL7A 1H1VA 2G8UA 3WNHA 4IOXA 3VN5A 1HKGA 3V9ZA 2EWSA 3VQ4A 4JI3K 3J81O 1J9AA 3M5RA 2I5JA 2YNIA 1TVRA 2QXFA 5CY4A 4CJKA 1ZYQA 1XQSC 3M3ZA 4B9MA 4XIUA 4MLEA 1K6YA 1LW0A 2NRZA 2O8EB 4OLAA 3CD6N 3NF8A 4B9NA 2CH6A 2D0CA 4LF7K 4O8KA 5AJ3K 3W0LA 1OH6A 3UKRB 3IAYA 3KVGA 3A5OC 4K43A 4O5BA 5D3GA 3BDPA 1GLDG 2YCHA 1S1TA 4CJRA 5IWAK 5CZ2A 3TAMA 3VF2A 4JK7A 4C1NK 3THWB 2F96A 3QICA 2UXCK 2BE2A 1S6QA 1U2VB 2IVPA 3VQBA 3SUNA 4LF9K 4IZ9A 1S6PA 1IV0A 3PO5A 1VHXA 3F5TA 4HTUA 1TK5A 4B3TK 4UQGA 5F1XA 4IJAA 3HVRA 1HLUA 4RTFD 3RMBA 2UUCK 4MO4A 3CQ8A 4RWTA 3G6EN 1NU0A 4M63C 2GEMA 4IJNA 1CXUA 3OYAA 2HHVA 4HUEA 3C94A 4CJUA 3UIQA 1BDGA 3KJVA 4R79A 4OO1J 4CK1A 2O8CB 3CIPA 5HOOA 2VGMA 2WTUA 1RT1A 2VWKA 1RT7A 1NK6A 3SAHA 1KD1O 4YFUA 4ILGB 3AVJA 4C8NA 3QINA 4JI8K 3TTCA 5BN9A 3AGRA 5FDLA 4H03B 1DT9A 1QQOA 3CM5A 3QESA 2XRIA 4BGAA 5I42A 1YTAA 1KAZA 2CGLA 4ZTJA 4F2SA 1YTUA 2HVHA 3CFPA 4JRPA 3O80A 4PY5A 3BGRA 4FM2A 4DFJA 4IOAL 1XI1A 5J2PA 4DV5K 3LP2A 1NBWA 1S9GA 1BCOA 3DM2A 3ZT4A 4DTUA 5AZJA 3BZKA 2W41A 3U8XA 1VQMN 2BANA 4KTZA 3ZT0A 4CZIA 4Z4CA 4CE9A 3CF5L 1SAZA 4GKKK 1TKDA 4DR5K 1VSEA 1SUQA 4B9QA 4A5BA 4B9UA 3VF6A 1S5JA 5M1KA 3LDPA 4OLBA 2BH1A 2FF3B 3BEXA 4GV9A 3ZETB 4PKGA 1W0HA 4FXDA 5M1FA 4CFDA 2B5JA 3AA2A 5E26A 3L4QA 5EVZA 4O55A 5FROA 4BE0A 2WOMA 4G9ZA 3CCVN 1GOBA 2YI1A 3G0ZA 3MXIA 5HL7L 3SQ4A 2PAVA 1G99A 5LJWA 1VRTA 5KGXA 4YY3K 4B3MK 3NH1A 2HVIA 5C12A 4AHSA 4CJLA 3P1GA 1RTIA 3OYKA 4WE1A 4CESA 2DY4A 4K0KK 1EWRA 3SQ0A 5DMRA 3DRSA 1NGFA 4DU3A 3CJBA 1KVAA 2KW4A 2VG6A 2KFNA 4IEIA 3LPTA 3J8AA 4BG8A 4J8FA 2VWBA 1JXEA 1OVYA 1RDUA 2QWOA 3G25A 1N33K 3HXMA 4JKEA 3L2QA 3RMCA 2ASPA 2B4JA 3CPEA 3T7ZA 4M3WA 3UE5A 2YV0X 2HHUA 2D4WA 4CJFA 4J2EA 1DKGD 3H08A 3VERA 3DXKA 3PO4A 2D0OA 2O8BA 4BRAA 4M3XA 5BRDA 1YF5L 3CCQN 4CF2A 2E2PA 1C1CA 1HMVA 1RT2A 3KLIA 4FWPA 4CW7B 4DQ8A 3G10A 2VG5A 3P39A 2FSKA 4CZLA 1JLAA 4AHRA 1KCFA 1RDDA 2IOCA 4FWLA 1E3MA 4YOUA 4Y1DA 4W5QA 1SQKA 3NE6A 1M1KO 1OVQA 4H0OA 1F21A 4O0IA 5A2QO 2PYLA 3VQAA 4HVJA 3O3HA 1LW2A 4I6MA 3SJJA 2Z1JA 5SZTA 2GUPA 1XC3A 4FJJA 3E9PA 4FW2A 1LOTB 4L3QA 4KH5A 3JAMO 4CCHA 1ASUA 4YNQA 3JS6A 3QDKA 3QIOA 4JKAA 3HOTA 1BA0A 5AQHA 1S1UA 1C0TA 3CJCA 4XH5A 3SJHA 1HNIA 4JN4A 5BPMA 3CFRA 5HRNA 4FLWA 3J7ZO 1RT3A 5JLHA 4A2BA 1IBKK 4BC4A 5H1SQ 4FLYA 5IT9O 3AVIA 5AQUA 2NZTA 1N36K 3I0RA 5FPMA 2IS3A 1ATSA 3TTFA 2GBZA 1SKRA 4FJ9A 3R1XA 3GDQA 2VWJA 4CHOA 1NK5A 2FBVA 3U9DA 4KHUA 4CGDA 5AQIA 4FK0A 1S1XA 4CF9A 3H46O 1DGKN 4H4MA 3WT0A 5LMNK 4FVMA 3RRGA 1Z25A 4DSLA 1WNSA 4PQUA 2DPNA 1HNVA 3MN7A 3DLEA 3LWLA 1L3UA 4NYNA 1J54A 4ILHA 4ICLA 4B1YB 2O8EA 5T7BA 3A8YA 4HUFA 2HW3A 4FL9A 3TWHA 1SKSA 2FF6A 3KKRA 4FWSA 4CZGA 4IXCA 4BY9C 4RG8A 2FBYA 1I94K 3AVLA 3L2RA 3AVNA 1SKWA 4BREA 3ZSYA 4LSLA 2A41A 4K41A 4OKEA 4NLBA 3T1HK 4DS5A 4PWDA 1NGHA 4LH5A 3KKSA 2F4VK 2O8FB 4GNIA 4E7HA 5FRNA 4OKKA 5HLFA 4I9QA 4EZ9A 5GAEP 1HJRA 5AZJB 4CEQA 3PX0A 1X9JA 1HPMA 5LMUK 2O4IA 4NXMK 4Q5VA 3H1VX 5GADP 4B9TA 3AO1A 1S9EA 2E4LA 2A3ZA 5KQ8A 3SLCA 4OKJA 4FJ5A 2Q31A 3AVAA 4LD0A 1VSJA 3S3MA 1TKTA 1WBDA 4XEIA 3D7EO 3AA4A 5HROA 1HKCA 1KAXA 4MQ3A 1NGJA 3CJ9A 3NH2A 4EHUA 3SPYA 4JV5K 5AFUH 3QETA 3DLHA 4JRQA 4DU4A 4BE2A 4QOZB 5JS2A 3G71N 1D9DA 1MA9B 4BVOA 1WAJA 5AQLA 2KLAA 3P83D 3TSUA 4DR4K 3G4SN 3DRRA 1JCGA 4O8UA 4KBOA 3CERA 4FZXC 1LCUA 1BUPA 4DWIA 4IWVA 4KRFA 4DR1K 3MN5A 4RCHA 2XY6A 1VQNN 4CZHA 3NGIA 4HHTA 4JI0K 3SK3A 1RGIA 3RRHA 1QSYA 4J2DA 2ZQBA 5C10A 4B8CA 2E1YA 2YNGA 1RTJA 4BR9A 2RE2A 3NF7A 3C7NA 3QEVA 1J53A 3K0SA 1VSHA 2F7TA 4JNEA 3O6WA 2GWJA 4Y1CA 4CGIA 4N47A 4BRCA 4B9VA 3F73A 3LDQA 4Z0UA 3ULEA 1ZBIA 4M7XA 1FJGK 1OH7A 4MO5A 3ZX0A 5C2DA 2E2NA 2XY5A 4H5TA 1NK9A 1FKOA 2O8BB 3DXKB 4FJKA 4KREA 2WC9A 2OCEA 4M3ZA 3WNEA 1GLAG 4IO8A 1XMQK 4NCBA 4DF8A 3H45C 1JLFA 3HI0A 3WXJA 4DR6K 5LL6Z 2A1SA 2Q0RA 1BI4A 2KZZA 4LFBK 4FJGA 3DLKA 3O1BA 3SI6A 1IKWA 2XY8A 1X3MA 2IVOA 3L2WA 4PKHA 3CCEN 3SPZA 2V51B 4FWMA 3VEZA 2OPSA 4GVEA 2HBLA 2AA4A 1EX4A 4KB0A 4FOIA 1X9MA 4DSJA 1XWLA 4FJXA 3C6HA 1UAXA 1W9HA 4A59A 2JWKA 3KD5E 1Y97A 4I6MB 3A2FA 2P9NA 3FZKA 2IVNA 3U9ZA 5JS1A 1KSPA 2HBJA 3ZEUA 5KPRA 1VSKA 2X6NA 4JKBA 3MAQA 2RKIA 1NJIO 1NGEA 4E1NA 3TAPA 3CC7N 3NDKA 4YORA 4DTMA 1A5XA 2HB5A 1MDUB 5F0XA 1WSFA 1RT6A 1DEJA 1NGIA 4BRQA 3LDLA 2W42A 4OPKA 1HYSA 3NGYA 2FLOA 4LC9B 3CJ1A 1KQSM 4WF9L 1J6ZA 3MWPA 5M1OA 1BIUA 3DLBA 2EHGA 4BDYA 3MMVA 4X62K 3SQ1A 3CCSN 4BQLA 4CJVA 3RTVA 1E4GT 4KI4A 3ZCMA 4AHUA 3WXIA 1T8EA 3KLHA 4CBUA 3SAGA 3P4IA 1JLBA 3PV8A 4I2PA 2F9TA 1U04A 3KK1A 2ZD1A 3H3OB 5BRHA 3THVA 3L8BA 4NO7A 3S3NA 2FBXA 4ISEA 4U67L 3QBWA 2LSNA 3CCMN 3DAWA 2P51A 4FPBA 3CQYA 2OTJN 3MK6A 1T44A 4E3SA 1EETA 2UU9K 4KB1A 4M3UA 3ID6A 1VSDA 1VQ8N 5J2NA 4LFAK 3D6RA 2DFEA 4DTRA 3NGZA 3AY9A 4FLXA 1SS6A 1VQ9N 1LWEA 3DOKA 2YKMA 4CF0A 4GKJK 3L4IA 4AHCA 1TUYA 5KTQA 4OPHA 4LF5K 4BQZA 3K9JA 1RTDA 4KFBA 3I55N 3VPZA 3VQEA 5DM6L 3M8RA 1CZBA 4FM1A 3BY5A 4JI4K 3W3DA 4PA1A 1JCEA 4AQYK 3KD1E 4CEDA 4HCCA 1O13A 1BCMA 5KRSA 3VTHA 2QWLA 5HRPA 2GX9A 3CYMA 1ILYA 4GW6A 4CHPA 3SAFA 3UKUA 5AQGA 2YHBA 1DTTA 3CC4N 1O1WA 3EKUA 5DK5A 4MDAA 1QHAA 4FWOA 2ZWHA 4IBNA 4YHHK 2VQEK 3CFOA 4DUYK 3VQQA 2G8WA 2NRXA 4CHNA 2QW9A 1J5OA 2VCPA 4M3YA 4O5FA 1T6DA 3JYTA 1OKJA 4FJ7A 1ESVA 4JI6K 3ZX3A 1BO5O 3OY9A 4E1JA 1WB9A 4KTQA 1VQPN 3MXMA 3VOVA 2JWLA 3AGKA 1T03A 4F8RA 3S3OA 1RDAA 1QHTA 4IEEA 3QNOA 3QEIA 4W5TA 3BF1A 4DCHA 2QWPA 3NF9A 1NGAA 1QQMA 3O9RA 1VQ4N 1LWCA 2UUAK 4GY2B 4GV6A 5B8HA 2QTDA 1HQEA 4FPAA 4NB4A 3DMJA 3LZIA 2ITMA 3WEEA 3C65A 4EFHA 3ISNC 2O8FA 1K8AO 4QS7A 3CG7A 4CEBA 4LF6K 2FXUA 3T1YK 4KH6A 5SWMA 3SV4A 3ZLJA 4F4KA 4DTXA 3C7NB 1QTMA 3U6FA 5AZIA 1YHQN 2D0BA 3V4IA 1VSFA 1SL2A 4CJ7A 4DR3K 4CZEA 3VQ8A 4XH4A 3FFKB 3QO9A 4B1VA 3V1RA 1X9WA 3ULEB 4H4OA 3HBTA 4I7FA 4JS4A 3IDHA 4W5NA 2E88A 4NCAA 3SZ2A 2UYTA 1V4SA 3S41A 2BUPA 2IIRA 1WAFA 3LM2A 1BI4B 3VQCA 1U48A 1Z05A 1Z26A 4CFCA 3TSPA 3SMPA 4FOEA 3ZYYX 1ZBSA 2G8KA 2KFZA 4CEZA 1D4XA 4ID5A 3ZX2A 1G15A 3A5LC 3KTQA 4JKHA 3VEYA 3AVFA 3ALYA 3VQDA 2CGJA 5DM7L 3VGKA 4JI7K 1KC8O 3VEOA 3VQ7A 4BRKA 2HHQA 3R6MA 2P9NB 4CJWA 5FPNA 1RBUA 2DFFA 1IKVA 4H0PA 3ZEUB 2IGIA 3LDSA 4CIFA 4K42A 4FJMA 4XH1A 2X74A 4M42A 2YHYA 1HUXA 4DU1A 2PBDA 3R9PA 3VTIA 1HNWK 4DUZK 1SZ2A 3OS2A 4HTLA 1NMDA 3AA3A 1NOYA 4CK2A 2RN2A 4K25A 3QEWA 2OANA 1TGOA 4JK9A 4OX9K 4AM7A 3K2PA 1VQ5N 1A5VA 4DV1K 2P1JA 4GV3A 2BTFA 3JXUA 3S9HA 3T1AA 1IKYA 5AQSA 4CGJA 5CYQA 2W6LA 3HYFA 4I9LA 4X65K 3IFRA 5HRRA 3O9UA 4CHYA 3OYFA 2KHOA 3O4QA 5K14A 3ID8A 3ZSWA 1V4TA 3V9XA 3GOIA 2IAJA 3EYZA 4WCEL 1P90A 5GINA 1UWBA 3PY8A 3JSMA 3AVBA 1TUUA 1MWMA 2NRWA 1JLEA 2E6MA 1QE1A 2VG7A 3BF3A 4FJLA 3OJUA 4NXNK 4RW6A 5M1NA 3KLFA 5ELZA 5I9EB 2IC3A 4DQSA 5MLCQ 3C6TA 5C15A 3L2VA 4M41A 1Q82O 1BG3A 3AO3A 4PL8A 5AR0A 2YJEA 5J2MA 3ZT3A 3RR8A 3U4LA 4YDUC 3TI0A 1BISA 4QCLA 1YUWA 4YOXA 2G8HA 4BWMA 4DS4A 4ELTA 4L8RB 2Q36A 4DQIA 1VSIA 4BVPA 2HMIA 2QI2A 5HRSA 1QZ5A 4EIAA 3EO3A 1FW6A 3THXA 3T19A 2O4GA 3SYZA 4UY8O 4RW7A 4E7KA 3AVGA 5EX5A 5KPZA 5LJVA 3RWUA 1Q7YO 2HHWA 3UKUB 3VA0A 4AHVA 2UXDK 2E2OA 1ZXOA 1ASWA 3DRPA 3O08A 1KXPA 4JI2K 4N5SA 3MX5A 1LAVA 3O4WA 1C1AA 4CJSA 1QVGM 4KKOA 2WUSA 3RMAA 2H3GX 4B1XB 3O9QA 2HBKA 4IFYA 3OA9A 4PHTX 3T3FA 1UA0A 1NKCA 3VF4A 2Y1JA 4OPJA 4FYDA 2EX3A 1LWFA 4YDUA 1YVUA 5GAGP 1TK0A 1NK8A 3WXMB 2V52B 5BPLA 3AAPA 3D0PA 1BOTO 3LP0A 4G1QA 4MLHA 2YJFA 3SBGA 5TKYA 4M7YA 2W6KA 1ZC6A 1WLJA 1IH7A 3KIOA 2NRTA 3LPUA 2D0AA 3OYLA 3WEEB 3CPWM 1RTHA 1TAQA 2CGKA 3CXCM 3DLLL 4FJ8A 2FBTA 1L5UA 2I7NA 4M45A 2E6LA 4FLUA 4YOYA 2GWKA 5C25A 2HHXA 4GVMA 4QS8A 1T05A 4W5OA 1N5YA 4JS5A 3OJSA 3CI5A 1NJYA 1RBVA 2E1ZA 5AZIB 3L3UA 4ELUA 2GUIA 2ZJQL 4IFEA 1NWKA 4BDZA 4J2BA 3HSTB 1L3TA 1HJOA 3OS1A 3TAFA 1WUAA 4RW4A 2D0PA 5BN8A 3K59A 3IRXA 3EKSA 2P9KB 2NRRA 4DR7K 3O9SA 4FZZA 5M1QA 1Q86O 4FJIA 3LDOA 5C42A 4MFBA 3AV9A 5AQZA 3SBTA 5AQNA 4Z94A 2HHHK 3HL8A 1C0GA 3FZLA 1BQMA 4Z4IA 3Q7BA 4FLZA 2HHSA 3WNFA 3CCJN 3ATVA 1EQYA 4JLHA 1YAGA 3K5LA 4KI6A 2FC0A 1X1PA 1HYVA 1QQCA 5JICA 5LY3A 3LAMA 1NGBA 1QZ6A 2P9LA 5JVHL 3MEDA 4ISFA 3THYA 3QIPA 1VSMA 3K5OA 4BRHA 1VQ7N 1VQLN 4FWQA 3HM9A 3OYNA 4FJNA 3OYJA 1NJXA 4H8KA 3J7YP 1Q9XA 3AAQA 1C0UA 1TAUA 1BA1A 2A5XA 2QXLA 3VEXA 4DTPA 3FLCO 1JLCA 3QERA 1JL2A 3AVMA 3MECA 2ETJA 4C8OA 4WFNL 2VYPA 3D45A 3HK2A 3V6DA 3HTVA 4BWJA 4BRGA 4R5PA 4DSFA 4HWIA 3D2FA 3WNGA 3ZSXA 2GTDA 1BQNA 4E7JA 4FW1A 1IG9A 3F2KA 2YHXA 4C1NI 5FLXO 2ZM6K 1REVA 5E84A 1GLJO 2NLXA 3J7AP 3ZSQA 3ZSRA 2QWQA 3CJAA 3A5NC 1HKBA 2KQ2A 3F9MA 4CJ3A 3NF6A 4CJTA 5KPTA 1K73O 4B1UB 4CJEA 3IUCA 1P8ZA 2GV9A 3LP1A 4WQ5C 4JI1K 3V1QA 4DTOA 3H3NO 1ITGA 3IMXA 2HOEA 4DG1A 4I2QA
chains in the Genus database with same CATH topology
3HSCA 1TYQB 3H1QA 2VWBA 3K9KA 1OVYA 2W40A 4J8FA 1RDUA 2NRXA 2QWOA 1VQKN 3G25A 2QW9A 2J4RA 2VCPA 4O5FA 1T6DA 4JKEA 3UKRA 4A2AA 2ZGYA 2ASPA 3CPEA 4H5WA 5CR4A 2NRVA 3T7ZA 1OKJA 3UE5A 1ESVA 1M90O 4FWNA 3PIPL 2D4WA 3BUZB 3ZX3A 3VESA 1BO5O 1DKGD 1S3XA 4BRNA 1NGGA 3VERA 3DXKA 2D0OA 4BRAA 4E1JA 3L0QA 1VQPN 1BWFO 3VOVA 5BRDA 1YF5L 2FSNA 1U2VA 4CBXA 2JWLA 3CCQN 3AGKA 3DJCA 2E2PA 4JAXA 3EE8A 4FWPA 2NNWA 3TTDA 3VMFB 2D1KA 3MX2A 3C6AA 4OPAA 5AQYA 4IEEA 4DQ8A 3ATUA 2QEXN 3P39A 3BF1A 3QMLA 4DCHA 2FSKA 4CZLA 3A5MC 2QWPA 1NGAA 4DKWA 1QQMA 3O9RA 5C0YA 1HX1A 1VQ4N 1GLCG 4FWLA 3CJ7A 2ZJPL 4BR0A 4GY2B 4YOUA 4GV6A 5B8HA 2QTDA 4JKFA 5AQMA 4FPAA 4NB4A 3EZWA 1SQKA 1M1KO 4WQ5A 3B8AX 2ITMA 4FWKA 3A0IX 4H0OA 1K8KB 1E4FT 2FSJA 3C65A 3WEEA 4EFHA 1K8AO 5BR9A 4QS7A 3CHWA 2P9PA 2FXUA 3WQUA 3I8BA 4KH6A 3C7NB 4I6MA 2P9UA 2A40A 2GUPA 1XC3A 2Q97A 5ADXA 3E9PA 4CBWA 1LOTB 4L3QA 5AZIA 4KH5A 5FPEA 1YHQN 1K9MO 3JS6A 3QDKA 4A5AA 4AF1A 4CJ7A 4CZEA 4JKAA 3HOTA 1BA0A 2Q2RA 4XH4A 3WXKA 3FFKB 3E66A 5AQHA 4B1VA 2ASMA 3CJCA 1NM1A 3O5BA 4XH5A 3SJHA 2OTJN 4JN4A 3MDQA 5BPMA 3ULEB 4H0YB 3HBTA 4FO0A 1Q18A 3J7ZO 1T6CA 5JLHA 4A2BA 1GLBG 4BC4A 1S22A 3IDHA 5H1SQ 1N8RO 4MDBA 5AQUA 2WBNA 4BRMA 2HF3A 2E88A 2NZTA 4DB3A 2KKZA 2E8AA 5FPMA 3O9TA 3FR0A 4A62A 1ATSA 2UYTA 1V4SA 3S41A 2BUPA 3TTFA 2IIRA 3LM2A 4BRIA 3WXLA 3MWTA 3R1XA 3L6QA 4BC3A 3GDQA 1Z05A 5CE3A 5TKWA 3CCLN 3SMSA 3NVKA 3TSPA 3GE1A 3SMPA 4FOEA 3ZYYX 1ZBSA 3EL2A 3U9DA 2HBMA 5AQIA 1S72N 3HZ6A 3CMEN 3FGUA 3R3LA 3NVMA 1D4XA 5C2FA 3O1WA 3RSEA 3ZX2A 3H46O 3A5LC 3P38A 4H5RA 4BRDA 4CD1A 1DGKN 3MN6A 4WYBA 3WT0A 3H6EA 4JKHA 3VEYA 1JJ2M 3E9LA 5M1PA 3M1FA 2CGJA 3D2EB 2QWNA 5DM7L 3VGKA 4CD3A 1KC8O 2DPNA 3ENOA 3E9OA 3VEOA 3GL1A 2YHWA 1BU6O 3MCPA 1YJWN 3MN7A 4BRKA 1CZAN 3R6MA 2P9NB 4JK8A 5FPNA 5AQTA 4ILHA 1RDWX 2HMPA 1ATNA 1NGDA 4H0PA 3ZEUB 4B1YB 5ADXH 3ZETA 3A8YA 1T3VA 4U7BA 4BG8A 4FL9A 2QM1A 3DXMB 5AQVA 2FF6A 2GELA 4K42A 3VEWA 1NGCA 4XH1A 4FWSA 3QBXA 1WOQA 2YHYA 3KK7A 1HUXA 4IO9L 1NLVA 4CZGA 2PBDA 5EOYA 3R9PA 3TSQA 3VTIA 3NMUA 4IXCA 2QWRA 4ISGA 4AM6A 4BY9C 1SZ2A 2Q0UA 4HTLA 1NMDA 4K25A 4BREA 2OANA 2A41A 4K41A 4JK9A 4NLBA 4JKDA 4AM7A 1NGHA 1VQ5N 2PFUA 3FE1A 3O8MA 4JKGA 3R8EA 3KWIA 5GAHP 3ENBA 3IKMA 4YOWA 3LL3A 3MCAB 4GV3A 2BTFA 3JXUA 4GNIA 1YXQA 5AQSA 5GIPA 5GAEP 2RHKA 2P9SA 4JD2A 3IFRA 5EY4A 3O9UA 5AZJB 4WFAL 4CZKA 1KAYA 3UB5A 5AQPA 1X9JA 1HPMA 2YX6A 3CQXA 2KHOA 3OBWA 4JHDA 3ID8A 4EAHD 5KQDA 1V4TA 3DWLA 3H1VX 5GADP 1Y64A 3GOIA 3HRGA 1VQ6N 2P9LB 2V7ZA 4Y0WA 4WCEL 3E1YA 5KQ8A 2A3ZA 1U6ZA 3SLCA 5FPDA 1P90A 5GINA 5JMVA 2HF4A 3P31A 1TYQA 4EHTA 1YJ9N 2Q31A 1TUUA 4BC5A 1MWMA 2NRWA 1YITN 4XEIA 3HM8A 3CMAN 2Q1NA 3D7EO 4QS9A 3BF3A 4B1WB 1HKCA 1KAXA 3ENHA 5M1NA 1NGJA 3CJ9A 4H0TB 5ELZA 5I9EB 1X3NA 4EHUA 2WFBA 5AFUH 1YI2N 3FZHA 3M6GA 4A57A 5MLCQ 2A6AA 2P9IB 5C15A 1YIJN 1IG8A 3G71N 1Q82O 1MA9B 1BG3A 1QVFM 3OW2M 1W2BM 2OTLN 3QB0A 3VGLA 4BVOA 4PL8A 4CI6A 5AQLA 5AR0A 2AP1A 2KLAA 2YJEA 4YOTA 4PL7A 3BP8A 3TSUA 1H1VA 3U4LA 4YDUC 3D2FB 3G4SN 1YUWA 4IOXA 4YOXA 1JCGA 4O8UA 1HKGA 4KBOA 2Q36A 2EWSA 3CERA 1Q81O 1W97L 4BVPA 1LCUA 1BUPA 2P9KA 3M5RA 4WFBL 2QI2A 4IWVA 5AQFA 3LDNA 3T69A 1QZ5A 5JVGL 4EIAA 3EO3A 3MN5A 4RCHA 1VQNN 3VEVA 4CZHA 1XQSC 3M3ZA 4FSVA 4A61A 1K8KA 4UY8O 4H5NA 5EX5A 1RGIA 4MLEA 3SK3A 5KPZA 5LJVA 3PIOL 1GLEG 1Q7YO 5C10A 3UKUB 2E1YA 2NRZA 3AARA 4BR9A 3CD6N 5AQRA 2E2OA 1ZXOA 1RFQA 2RE2A 3C7NA 4WQ4C 2CH6A 3O08A 5BPNA 1KXPA 2F7TA 4JNEA 4JEPA 3MX5A 3O6WA 4O8KA 2GWJA 4BR4A 3O4WA 3W0LA 4IDHA 1QVGM 2QA4N 3KZBA 2F9WA 3OHRA 3UKRB 4BRCA 3KVGA 2WUSA 3A5OC 4K43A 4C23A 2H3GX 4B1XB 3O9QA 3N4PA 2HBKA 3OA9A 3LDQA 3RVCA 4PHTX 1GLDG 3ULEA 2YCHA 4M7XA 4MO5A 3ZX0A 5C2DA 2E2QA 2E2NA 4H5TA 1EO1A 3VF4A 3CETA 3DXKB 3VF2A 4JK7A 4C1NK 3QICA 4YDUA 2WC9A 1U2VB 2IVPA 5GAGP 4IZ9A 3WXMB 1GLAG 2V52B 4IO8A 1C0FA 3H45C 3N4QA 5BPLA 4BRFA 3HI0A 3WXJA 3AAPA 2Q0RA 1BOTO 4CZMA 3MN9A 3F5TA 4MLHA 2YJFA 3SBGA 2ZJRL 3EE9A 3O1BA 5TKYA 4M7YA 5F1XA 4IJAA 1X3MA 2E20A 2IVOA 1QQNA 1ZC6A 2A42A 1HLUA 4RTFD 4PKHA 3CCEN 3FZMA 2NRTA 2V51B 4FWMA 4MO4A 3VEZA 3QFPA 4RWTA 3WEEB 4GVEA 2CGKA 3CPWM 3G6EN 2HBLA 3CXCM 3DLLL 2AA4A 4WQ4A 4CZJA 2I7NA 4FOIA 2GEMA 4M63C 4IJNA 4YOYA 2GWKA 3D2EA 2P9PB 3C6HA 3GBTA 4QS8A 4A59A 1GLLO 1BDGA 2JWKA 4KH4A 4R79A 4I6MB 4ILJA 4BROA 2P9UB 4OO1J 3CI5A 4B1ZA 2P9NA 3FZKA 2IVNA 2E1ZA 5AZIB 3CIPA 3U9ZA 5HOOA 2VGMA 5AQQA 2NRHA 3CC2N 2HBJA 3ZEUA 5KPRA 2ZJQL 4JKBA 3HOSA 3SAHA 4IFEA 1NJIO 1NGEA 1KD1O 3DXMA 4PKIA 3CC7N 1NWKA 4ILGB 4YORA 1JCFA 1XUPO 1HJOA 2ZF5O 1WUAA 3TTCA 3GG4A 5BN9A 1GLFO 2D0PA 2ZGZA 3AGRA 1MDUB 5F0XA 4BRLA 4H03B 5BN8A 1DT9A 1QQOA 1DEJA 1NGIA 3EKSA 4BRQA 5BRFA 5F2RA 4BGAA 3LDLA 1KAZA 2CGLA 2NRRA 2P9KB 3O9SA 3TU5A 2FLOA 4LC9B 3CJ1A 5M1QA 4CZFA 1Q86O 1KQSM 3LDOA 3O80A 4WF9L 5AQZA 3SBTA 5AQNA 1J6ZA 3VENA 4Z94A 3MWPA 5M1OA 4H5VA 4IOAL 1C0GA 3FZLA 3MMVA 3OBYA 3Q7BA 1NBWA 1VQON 5AQWA 3CCSN 4BQLA 3QFUA 3Q7CA 3CCJN 4H0VB 5AZJA 3RSEB 3ATVA 1EQYA 2W41A 5AQKA 1E4GT 5AQXA 1YAGA 3U8XA 1VQMN 3WXIA 4CZIA 3CF5L 1SAZA 4CBUA 3SAGA 5JICA 3P4IA 5LY3A 2VGNA 1NGBA 4FWRA 1QZ6A 5EXWA 2P9LA 2F9TA 4BR5A 2HSTA 3PLAA 3H3OB 5BRHA 4B9QA 5JVHL 4ISFA 4A5BA 3VF6A 3KWGA 1VQ7N 4BRHA 4NO7A 5CHIA 1VQLN 4FWQA 5M1KA 4IOCL 3VETA 3LDPA 4ISEA 5AQOA 4U67L 4DHYA 3QBWA 3CCMN 3CCRN 3DAWA 3LM9A 4FPBA 3CQYA 2BH1A 1VAZA 1T44A 2ASOA 2FF3B 3BEXA 3AAQA 3MK6A 3VGMA 5GIOA 4GV9A 1BA1A 2A5XA 3ZETB 3ID6A 4BC2A 4PKGA 2QXLA 1VQ8N 3VEXA 4BRPA 3FLCO 5M1FA 3KHYA 3D6RA 3AY9A 1VQ9N 1SS6A 2P9IA 3C0BA 3FZFA 5E26A 3L4IA 3CCUN 3L4QA 5EVZA 1TUYA 4OPHA 2QWMA 4BQZA 3K9JA 4WFNL 4G9ZA 2VYPA 3CCVN 2YI1A 5HL7L 3HTVA 4NLCA 4BRGA 3I55N 3VPZA 1R59O 4HWIA 1ATRA 3D2FA 5DM6L 2GTDA 2PAVA 1G99A 4JKGB 4H0XB 5LJWA 1Z6RA 4BR7A 3F2KA 4FVUA 2I7PA 3W3DA 2YHXA 4C1NI 1JCEA 5AQJA 5C12A 4MDAA 1O13A 2P9SB 4JKCA 4JD2B 5E84A 1IJJA 1GLJO 2NLXA 4BR2A 4FWOA 3VTHA 1YJNN 2QWQA 2QWLA 3CJAA 3A5NC 1HKBA 3WUHA 2GX9A 1YVNA 3F9MA 4BG9A 1ILYA 3I56N 1NGFA 5KPTA 4JHDB 1K73O 2V7YA 5BREA 4B1UB 3SAFA 3WQTA 3CJBA 1P8ZA 3IUCA 3UKUA 3I33A 3TPQA 5AFUA 4WQ5C 4YOVA 5AQGA 4BGBA 2CH5A 3H3NO 4F9OA 3CC4N 3EKUA 4IEIA 3EN9A 5JLFA 3IMXA 2HOEA 1QHAA 3J8AA 1MWKA 2ZWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C10 A;  4IDH A;  3CPE A;  3C6A A;  3C6H A;  5C2F A;  4IEE A;  5M1F A;  5M1K A;  4IEI A;  5C12 A;  5M1P A;  5C2D A;  5M1Q A;  5C15 A;  5M1O A;  4IFE A;  5M1N A; 
#chains in the Genus database with same CATH topology
 3HSC A;  4F3T A;  4ELV A;  1VQK N;  4C8L A;  1BGX T;  2J4R A;  4X64 K;  4A2A A;  2ZGY A;  2NRV A;  1S1V A;  3PIP L;  3BUZ B;  3NCI A;  3VES A;  1JKH A;  1NGG A;  1NJZ A;  3L0Q A;  4X66 K;  4Z4E A;  4CBX A;  2OZM A;  1N6Q A;  3EE8 A;  4NYF A;  4KHY A;  2D1K A;  3K57 A;  3MX2 A;  3C6U A;  2QEX N;  3QML A;  3OYC A;  4CJQ A;  3OVN A;  1NOZ A;  1CXQ A;  2DTU A;  1HX1 A;  1GLC G;  3CJ7 A;  1SV5 A;  4ID1 A;  1NKB A;  5AQM A;  4OJR A;  2UUB K;  3ULD A;  1A5W A;  3SQ2 A;  3THX B;  4B3R K;  2QKK A;  2YNF A;  4WQ5 A;  3B8A X;  4FWK A;  3A0I X;  3OYD A;  4OVL A;  4LFC K;  3TAG A;  2F8S A;  2HHT A;  2P9P A;  2PZS A;  4B9L A;  1KVC A;  4CER A;  2P9U A;  2A40 A;  2Q97 A;  5ADX A;  4CBW A;  1K9M O;  2A1R A;  3VQ6 A;  4A5A A;  4AF1 A;  1HYZ A;  4QAG A;  3WXK A;  3E66 A;  2ASM A;  1NM1 A;  2OPP A;  3MDQ A;  3V81 A;  2KTQ A;  4M3R A;  1T6C A;  2HNZ A;  3SUP A;  1NK4 A;  4DV6 K;  1HPZ A;  1GLB G;  1S22 A;  1N8R O;  4O4G A;  2WBN A;  2YNH A;  1XNR K;  2KKZ A;  2E8A A;  3OYI A;  3O9T A;  3FR0 A;  4A62 A;  2XO7 A;  4DF4 A;  4BRI A;  4DV4 K;  5BR8 K;  3MWT A;  4DQR A;  5CE3 A;  5TKW A;  1B9D A;  3SMS A;  3GE1 A;  4CF1 A;  4Z4F A;  3PX6 A;  2JLE A;  1FKP A;  2OA8 A;  5C24 A;  3RSE A;  4CD1 A;  4BRD A;  3K5N A;  3MN6 A;  4B3S K;  4WYB A;  3H6E A;  4CFA A;  1VRU A;  3M1F A;  4CEC A;  2QWN A;  4CD3 A;  2AJQ A;  3NHG A;  3ENO A;  4O44 A;  1KRP A;  4LH4 A;  1BU6 O;  3EEQ A;  1C6V A;  4IG0 A;  1YJW N;  1KTQ A;  4JK8 A;  5AQT A;  4J2A A;  2HMP A;  1NGD A;  4RW9 A;  4ZTF A;  5ADX H;  1CZ9 A;  1TK8 A;  2OPQ A;  3K58 A;  4CHZ A;  4U7B A;  3HP6 A;  1SL0 A;  4DTJ A;  2QM1 A;  5AQV A;  3LWM A;  2GEL A;  1RNH A;  3PX4 A;  3QBX A;  2YHA A;  3I0S A;  3KK7 A;  4RW8 A;  3KLE A;  4IO9 L;  5EOY A;  2D5R A;  3TSQ A;  4ISG A;  1ZBH A;  1NG9 A;  3OYB A;  4E89 A;  4V19 S;  1IKX A;  4F3O A;  4CIE A;  4CVN E;  4E19 A;  4CHQ A;  3O8M A;  4JKG A;  3KWI A;  3HVT A;  3ENB A;  4YOW A;  3LL3 A;  3MCA B;  1YXQ A;  1WSJ A;  1NMN A;  4N76 A;  2QKB A;  2RHK A;  2P9S A;  4JD2 A;  1VSL A;  3O3G A;  1KAY A;  3UB5 A;  4IFV A;  2YKN A;  5AQP A;  2YX6 A;  3M8S A;  3IG1 A;  1Q8I A;  4JHD A;  5KQD A;  3DWL A;  2WON A;  4LF8 K;  1KFD A;  1VQ6 N;  2P9L B;  4KHP K;  3V1O A;  1NNE A;  3THY B;  1U6Z A;  1EKE A;  5JMV A;  3P31 A;  1TYQ A;  4EHT A;  4CIG A;  1B9F A;  3TAB A;  3TR8 A;  3KK3 A;  4PUO A;  1L3V A;  3HM8 A;  3CMA N;  5FRM A;  4BE1 A;  4B3O A;  3ASM A;  1BIZ A;  3HJF A;  4LF4 K;  4BAC A;  3FZH A;  3M6G A;  1VK0 A;  2A6A A;  2OYQ A;  1W2B M;  4B9S A;  2IDO A;  3QB0 A;  3VGL A;  4CI6 A;  4YOT A;  2R7Y A;  3BP8 A;  1HNX K;  3D2F B;  1XC9 A;  3DLR A;  1JL1 A;  2BDP A;  3KLG A;  1Q81 O;  1W97 L;  2P9K A;  4WFB L;  2ATQ A;  1U47 A;  2O8D A;  5AQF A;  3LDN A;  3T69 A;  5JVG L;  5J1E A;  3M8Q A;  1WSI A;  1HRH A;  3VEV A;  1OH5 A;  4FSV A;  4A61 A;  4FLT A;  1K8K A;  4AHT A;  3OS0 A;  4H5N A;  3TAQ A;  2Z1I A;  3PIO L;  4M3T A;  1GLE G;  3QEP A;  1EWQ A;  3AAR A;  5AQR A;  1RFQ A;  1TL3 A;  4WQ4 C;  4DR2 K;  5BPN A;  3VA3 A;  4KHS A;  4JEP A;  4NCG A;  2G8F A;  4BR4 A;  4DV3 K;  2PYJ A;  4IDH A;  3LAK A;  4IG3 A;  3KZB A;  2F9W A;  3EY1 A;  2QA4 N;  3OHR A;  4CJ4 A;  4C23 A;  1WSH A;  3N4P A;  3RVC A;  3B6O A;  1NJW A;  2BGG A;  1DLO A;  2E2Q A;  1WN7 A;  1EO1 A;  2HND A;  3EZ5 A;  4DTS A;  3CET A;  4CGG A;  4E7L A;  3U3G A;  4AH9 A;  4DV2 K;  4DV7 K;  1RBT A;  3KK2 A;  3VQP A;  1B92 A;  3TAR A;  1ZBL A;  1C0F A;  3N4Q A;  4BRF A;  4DFP A;  4CFB A;  4OGC A;  4CZM A;  3MN9 A;  1J5E K;  1RCH A;  1DTQ A;  2XY7 A;  2ZJR L;  4GMJ B;  4BDP A;  3EE9 A;  2E20 A;  4DTN A;  1TKZ A;  1X9S A;  1QQN A;  4HCB A;  1I39 A;  2A42 A;  3ZSZ A;  3O4N A;  3FZM A;  2XHB A;  3QFP A;  3QLH A;  4DSE A;  4WQ4 A;  4CZJ A;  1Q9Y A;  3D2E A;  2P9P B;  3K5M A;  3AA5 X;  3GBT A;  1GLL O;  4KH4 A;  4LSN A;  4BRO A;  4ILJ A;  2P9U B;  4B1Z A;  4ZHR A;  1L3S A;  3U3Y A;  3V9U A;  5J2Q A;  1LAW A;  2NRH A;  5AQQ A;  3OYE A;  3CC2 N;  4FK2 A;  2X78 A;  3DOL A;  3HOS A;  3HPH A;  3DXM A;  4PKI A;  1JCF A;  1XUP O;  4KTW A;  1C1B A;  2ZF5 O;  3GG4 A;  3LAN A;  1GLF O;  1I3A A;  2ZGZ A;  4BRL A;  2QK9 A;  1KLN A;  1TL1 A;  4C8M A;  1FXX A;  5BRF A;  4CJP A;  5F2R A;  3MEE A;  3TU5 A;  1XHZ A;  1JXB A;  4CZF A;  1JLQ A;  1RIL A;  3VEN A;  1D9F A;  4H5V A;  5E41 A;  3OBY A;  4FLV A;  3HP9 A;  4K8Z A;  1VQO N;  5AQW A;  4Z4G A;  2PY5 A;  4C8K A;  4DFM A;  3QFU A;  3Q7C A;  3PSI A;  4H0V B;  3RSE B;  5AQK A;  5AQX A;  4E1M A;  3QEX A;  1NK0 A;  3MXJ A;  3ZT2 A;  2VGN A;  4FWR A;  5EXW A;  4BR5 A;  3L2U A;  2HST A;  3PLA A;  3TAE A;  3KWG A;  3M8P A;  5CHI A;  4IOC L;  3OYM A;  3VET A;  5AQO A;  4DHY A;  3SUO A;  4CGF A;  3CCR N;  3LM9 A;  3LP3 A;  1QSL A;  1VAZ A;  2ASO A;  5GIO A;  5CYM A;  3VGM A;  2ITG A;  4BC2 A;  4CEF A;  1R0A A;  1LV5 A;  4AIL C;  4BRP A;  1HQU A;  3KHY A;  2P9I A;  4JI5 K;  3C0B A;  3FZF A;  3I8D A;  3CCU N;  4B8A B;  3ZSV A;  3PUF A;  2QWM A;  1BL3 A;  1NKE A;  3HT3 A;  4DMN A;  4NLC A;  1R59 O;  1ATR A;  3PSF A;  4DSK A;  4JKG B;  4FZY A;  4H0X B;  1XNQ K;  1XMO K;  1Z6R A;  4BR7 A;  4F2R A;  4IDK A;  4CGH A;  3DLG A;  4FVU A;  2I7P A;  4FCY A;  5AQJ A;  2Y1I A;  5EU7 A;  1KFS A;  1UOC A;  2P9S B;  4JD2 B;  4JKC A;  1IJJ A;  3ZT1 A;  4BR2 A;  1ZBU A;  1RBR A;  1YJN N;  1ASV A;  1OH8 A;  3WUH A;  4BG9 A;  1YVN A;  3I56 N;  5KGW A;  3OTO K;  4JHD B;  2V7Y A;  5BRE A;  3WQT A;  4E7I A;  3I33 A;  1RDB A;  3TPQ A;  5AFU A;  4YOV A;  4BGB A;  2CH5 A;  3VQ5 A;  4F9O A;  2RPI A;  3V9W A;  1RDC A;  3EN9 A;  5JLF A;  1MWK A;  1TYQ B;  2OZS A;  3H1Q A;  3K9K A;  2W40 A;  3SV3 A;  4JYA K;  3UKR A;  3OYH A;  4H5W A;  5CR4 A;  1M90 O;  4FWN A;  2RF2 A;  2ZE2 A;  1GOC A;  3J80 O;  1S3X A;  4DLE A;  4BRN A;  3TAN A;  1TKX A;  3THW A;  1BWF O;  1KVB A;  2FSN A;  1U2V A;  3DJC A;  4JAX A;  3AO4 A;  2NNW A;  3TTD A;  2UXB K;  3VMF B;  3C6A A;  4OPA A;  5AQY A;  3ATU A;  3F9K A;  3SUQ A;  2NUB A;  3A5M C;  5HBM A;  1HR0 K;  4DKW A;  5C0Y A;  2O8D B;  3E01 A;  4CEA A;  2ZJP L;  4BR0 A;  4JKF A;  3EZW A;  1U4B A;  4DQP A;  2G8I A;  1ZBF A;  1K8K B;  1E4F T;  2FSJ A;  1U45 A;  4FJH A;  5BR9 A;  4O0J A;  3CHW A;  1UA1 A;  1D8Y A;  1RT5 A;  2Z1G A;  1NK7 A;  4DQQ A;  3LAL A;  3WQU A;  2KZM A;  3I8B A;  3OYG A;  1RBS A;  1T7P A;  4FK4 A;  1MU2 A;  3DYA A;  3AVK A;  2O8C A;  5FPE A;  3IS9 A;  2P5G A;  1JLG A;  4KO0 A;  4EP4 A;  1QSS A;  2Q2R A;  3P5J A;  4N41 A;  3O3F A;  5I3U A;  3O5B A;  4KAZ A;  4FM0 A;  4H0Y B;  4FO0 A;  1Q18 A;  1IO2 A;  4W5R A;  4CEE A;  5KRT A;  3DI6 A;  1SL1 A;  4MDB A;  4BRM A;  1IBM K;  2HF3 A;  4DB3 A;  3B6P A;  4Z4H A;  3WXL A;  3ZSO A;  5HP1 A;  3L6Q A;  4BC3 A;  4KHN A;  3CCL N;  3AVH A;  4EP5 A;  3NVK A;  1GOA A;  3EL2 A;  2HBM A;  1YT3 A;  4CF8 A;  3HZ6 A;  1S72 N;  3FGU A;  4LY7 A;  3CME N;  3R3L A;  3NVM A;  4DFK A;  5C2F A;  3O1W A;  2OPR A;  2JGU A;  3P38 A;  4H5R A;  1TV6 A;  3RMD A;  1JJ2 M;  3NFA A;  3E9L A;  3MEG A;  1EP4 A;  5M1P A;  1BHL A;  3RR7 A;  2P5O A;  3D2E B;  5KI6 A;  3HPO A;  3E9O A;  3NH0 A;  4E0D A;  1N32 K;  3GL1 A;  4DV0 K;  1CLQ A;  2YHW A;  3L3V A;  3MCP A;  3HPG A;  1CZA N;  2F8T A;  1RDW X;  4N56 A;  1ATN A;  3ZET A;  1T3V A;  2DFH A;  4DSI A;  1IBL K;  3DXM B;  4DLG A;  4OGE A;  4KV8 A;  3VEW A;  1NGC A;  1WOQ A;  3QNN A;  1QS4 A;  1NLV A;  3NMU A;  2QWR A;  4AM6 A;  2Q0U A;  4K8X A;  3FFI A;  2X6S A;  3AO2 A;  4JKD A;  2VQF K;  2B6A A;  2PFU A;  3FE1 A;  3R8E A;  5GAH P;  3IKM A;  2HNY A;  3LZJ A;  1KLM A;  5GIP A;  1WBB A;  3C95 A;  3CM6 A;  1WSE A;  5EY4 A;  4WFA L;  4CZK A;  3CQX A;  3AO5 A;  4CJ5 A;  3OBW A;  4CEO A;  4EAH D;  2G8V A;  3VQ9 A;  1Y64 A;  1FK9 A;  3NBP A;  3HRG A;  4HUG A;  2V7Z A;  4Y0W A;  3V9S A;  3E1Y A;  5FPD A;  1N34 K;  4IKF A;  5CZ1 A;  2HF4 A;  1W7A A;  1C0M A;  1YJ9 N;  4BC5 A;  4KHQ A;  2Z1H A;  3AVC A;  4Q0B A;  1D5A A;  1RT4 A;  1YIT N;  4KPY A;  2Q1N A;  4EZ6 A;  3HO1 A;  4QS9 A;  4B1W B;  1XHX A;  3ENH A;  4H0T B;  1X3N A;  1U49 A;  2WFB A;  1YI2 N;  1WSG A;  3ITH A;  3SNN A;  3SCX A;  3BZC A;  4A57 A;  2P9I B;  2Q3S A;  1YIJ N;  1IG8 A;  2E5L K;  4TSX A;  1QVF M;  1S1W A;  3OW2 M;  1EXQ A;  3NAE A;  1HNZ K;  2OTL N;  4CK3 A;  2AP1 A;  4B08 A;  4KHW A;  4PL7 A;  1H1V A;  2G8U A;  3WNH A;  4IOX A;  3VN5 A;  1HKG A;  3V9Z A;  2EWS A;  3VQ4 A;  4JI3 K;  3J81 O;  1J9A A;  3M5R A;  2I5J A;  2YNI A;  1TVR A;  2QXF A;  5CY4 A;  4CJK A;  1ZYQ A;  1XQS C;  3M3Z A;  4B9M A;  4XIU A;  4MLE A;  1K6Y A;  1LW0 A;  2NRZ A;  2O8E B;  4OLA A;  3CD6 N;  3NF8 A;  4B9N A;  2CH6 A;  2D0C A;  4LF7 K;  4O8K A;  5AJ3 K;  3W0L A;  1OH6 A;  3UKR B;  3IAY A;  3KVG A;  3A5O C;  4K43 A;  4O5B A;  5D3G A;  3BDP A;  1GLD G;  2YCH A;  1S1T A;  4CJR A;  5IWA K;  5CZ2 A;  3TAM A;  3VF2 A;  4JK7 A;  4C1N K;  3THW B;  2F96 A;  3QIC A;  2UXC K;  2BE2 A;  1S6Q A;  1U2V B;  2IVP A;  3VQB A;  3SUN A;  4LF9 K;  4IZ9 A;  1S6P A;  1IV0 A;  3PO5 A;  1VHX A;  3F5T A;  4HTU A;  1TK5 A;  4B3T K;  4UQG A;  5F1X A;  4IJA A;  3HVR A;  1HLU A;  4RTF D;  3RMB A;  2UUC K;  4MO4 A;  3CQ8 A;  4RWT A;  3G6E N;  1NU0 A;  4M63 C;  2GEM A;  4IJN A;  1CXU A;  3OYA A;  2HHV A;  4HUE A;  3C94 A;  4CJU A;  3UIQ A;  1BDG A;  3KJV A;  4R79 A;  4OO1 J;  4CK1 A;  2O8C B;  3CIP A;  5HOO A;  2VGM A;  2WTU A;  1RT1 A;  2VWK A;  1RT7 A;  1NK6 A;  3SAH A;  1KD1 O;  4YFU A;  4ILG B;  3AVJ A;  4C8N A;  3QIN A;  4JI8 K;  3TTC A;  5BN9 A;  3AGR A;  5FDL A;  4H03 B;  1DT9 A;  1QQO A;  3CM5 A;  3QES A;  2XRI A;  4BGA A;  5I42 A;  1YTA A;  1KAZ A;  2CGL A;  4ZTJ A;  4F2S A;  1YTU A;  2HVH A;  3CFP A;  4JRP A;  3O80 A;  4PY5 A;  3BGR A;  4FM2 A;  4DFJ A;  4IOA L;  1XI1 A;  5J2P A;  4DV5 K;  3LP2 A;  1NBW A;  1S9G A;  1BCO A;  3DM2 A;  3ZT4 A;  4DTU A;  5AZJ A;  3BZK A;  2W41 A;  3U8X A;  1VQM N;  2BAN A;  4KTZ A;  3ZT0 A;  4CZI A;  4Z4C A;  4CE9 A;  3CF5 L;  1SAZ A;  4GKK K;  1TKD A;  4DR5 K;  1VSE A;  1SUQ A;  4B9Q A;  4A5B A;  4B9U A;  3VF6 A;  1S5J A;  5M1K A;  3LDP A;  4OLB A;  2BH1 A;  2FF3 B;  3BEX A;  4GV9 A;  3ZET B;  4PKG A;  1W0H A;  4FXD A;  5M1F A;  4CFD A;  2B5J A;  3AA2 A;  5E26 A;  3L4Q A;  5EVZ A;  4O55 A;  5FRO A;  4BE0 A;  2WOM A;  4G9Z A;  3CCV N;  1GOB A;  2YI1 A;  3G0Z A;  3MXI A;  5HL7 L;  3SQ4 A;  2PAV A;  1G99 A;  5LJW A;  1VRT A;  5KGX A;  4YY3 K;  4B3M K;  3NH1 A;  2HVI A;  5C12 A;  4AHS A;  4CJL A;  3P1G A;  1RTI A;  3OYK A;  4WE1 A;  4CES A;  2DY4 A;  4K0K K;  1EWR A;  3SQ0 A;  5DMR A;  3DRS A;  1NGF A;  4DU3 A;  3CJB A;  1KVA A;  2KW4 A;  2VG6 A;  2KFN A;  4IEI A;  3LPT A;  3J8A A;  4BG8 A;  4J8F A;  2VWB A;  1JXE A;  1OVY A;  1RDU A;  2QWO A;  3G25 A;  1N33 K;  3HXM A;  4JKE A;  3L2Q A;  3RMC A;  2ASP A;  2B4J A;  3CPE A;  3T7Z A;  4M3W A;  3UE5 A;  2YV0 X;  2HHU A;  2D4W A;  4CJF A;  4J2E A;  1DKG D;  3H08 A;  3VER A;  3DXK A;  3PO4 A;  2D0O A;  2O8B A;  4BRA A;  4M3X A;  5BRD A;  1YF5 L;  3CCQ N;  4CF2 A;  2E2P A;  1C1C A;  1HMV A;  1RT2 A;  3KLI A;  4FWP A;  4CW7 B;  4DQ8 A;  3G10 A;  2VG5 A;  3P39 A;  2FSK A;  4CZL A;  1JLA A;  4AHR A;  1KCF A;  1RDD A;  2IOC A;  4FWL A;  1E3M A;  4YOU A;  4Y1D A;  4W5Q A;  1SQK A;  3NE6 A;  1M1K O;  1OVQ A;  4H0O A;  1F21 A;  4O0I A;  5A2Q O;  2PYL A;  3VQA A;  4HVJ A;  3O3H A;  1LW2 A;  4I6M A;  3SJJ A;  2Z1J A;  5SZT A;  2GUP A;  1XC3 A;  4FJJ A;  3E9P A;  4FW2 A;  1LOT B;  4L3Q A;  4KH5 A;  3JAM O;  4CCH A;  1ASU A;  4YNQ A;  3JS6 A;  3QDK A;  3QIO A;  4JKA A;  3HOT A;  1BA0 A;  5AQH A;  1S1U A;  1C0T A;  3CJC A;  4XH5 A;  3SJH A;  1HNI A;  4JN4 A;  5BPM A;  3CFR A;  5HRN A;  4FLW A;  3J7Z O;  1RT3 A;  5JLH A;  4A2B A;  1IBK K;  4BC4 A;  5H1S Q;  4FLY A;  5IT9 O;  3AVI A;  5AQU A;  2NZT A;  1N36 K;  3I0R A;  5FPM A;  2IS3 A;  1ATS A;  3TTF A;  2GBZ A;  1SKR A;  4FJ9 A;  3R1X A;  3GDQ A;  2VWJ A;  4CHO A;  1NK5 A;  2FBV A;  3U9D A;  4KHU A;  4CGD A;  5AQI A;  4FK0 A;  1S1X A;  4CF9 A;  3H46 O;  1DGK N;  4H4M A;  3WT0 A;  5LMN K;  4FVM A;  3RRG A;  1Z25 A;  4DSL A;  1WNS A;  4PQU A;  2DPN A;  1HNV A;  3MN7 A;  3DLE A;  3LWL A;  1L3U A;  4NYN A;  1J54 A;  4ILH A;  4ICL A;  4B1Y B;  2O8E A;  5T7B A;  3A8Y A;  4HUF A;  2HW3 A;  4FL9 A;  3TWH A;  1SKS A;  2FF6 A;  3KKR A;  4FWS A;  4CZG A;  4IXC A;  4BY9 C;  4RG8 A;  2FBY A;  1I94 K;  3AVL A;  3L2R A;  3AVN A;  1SKW A;  4BRE A;  3ZSY A;  4LSL A;  2A41 A;  4K41 A;  4OKE A;  4NLB A;  3T1H K;  4DS5 A;  4PWD A;  1NGH A;  4LH5 A;  3KKS A;  2F4V K;  2O8F B;  4GNI A;  4E7H A;  5FRN A;  4OKK A;  5HLF A;  4I9Q A;  4EZ9 A;  5GAE P;  1HJR A;  5AZJ B;  4CEQ A;  3PX0 A;  1X9J A;  1HPM A;  5LMU K;  2O4I A;  4NXM K;  4Q5V A;  3H1V X;  5GAD P;  4B9T A;  3AO1 A;  1S9E A;  2E4L A;  2A3Z A;  5KQ8 A;  3SLC A;  4OKJ A;  4FJ5 A;  2Q31 A;  3AVA A;  4LD0 A;  1VSJ A;  3S3M A;  1TKT A;  1WBD A;  4XEI A;  3D7E O;  3AA4 A;  5HRO A;  1HKC A;  1KAX A;  4MQ3 A;  1NGJ A;  3CJ9 A;  3NH2 A;  4EHU A;  3SPY A;  4JV5 K;  5AFU H;  3QET A;  3DLH A;  4JRQ A;  4DU4 A;  4BE2 A;  4QOZ B;  5JS2 A;  3G71 N;  1D9D A;  1MA9 B;  4BVO A;  1WAJ A;  5AQL A;  2KLA A;  3P83 D;  3TSU A;  4DR4 K;  3G4S N;  3DRR A;  1JCG A;  4O8U A;  4KBO A;  3CER A;  4FZX C;  1LCU A;  1BUP A;  4DWI A;  4IWV A;  4KRF A;  4DR1 K;  3MN5 A;  4RCH A;  2XY6 A;  1VQN N;  4CZH A;  3NGI A;  4HHT A;  4JI0 K;  3SK3 A;  1RGI A;  3RRH A;  1QSY A;  4J2D A;  2ZQB A;  5C10 A;  4B8C A;  2E1Y A;  2YNG A;  1RTJ A;  4BR9 A;  2RE2 A;  3NF7 A;  3C7N A;  3QEV A;  1J53 A;  3K0S A;  1VSH A;  2F7T A;  4JNE A;  3O6W A;  2GWJ A;  4Y1C A;  4CGI A;  4N47 A;  4BRC A;  4B9V A;  3F73 A;  3LDQ A;  4Z0U A;  3ULE A;  1ZBI A;  4M7X A;  1FJG K;  1OH7 A;  4MO5 A;  3ZX0 A;  5C2D A;  2E2N A;  2XY5 A;  4H5T A;  1NK9 A;  1FKO A;  2O8B B;  3DXK B;  4FJK A;  4KRE A;  2WC9 A;  2OCE A;  4M3Z A;  3WNE A;  1GLA G;  4IO8 A;  1XMQ K;  4NCB A;  4DF8 A;  3H45 C;  1JLF A;  3HI0 A;  3WXJ A;  4DR6 K;  5LL6 Z;  2A1S A;  2Q0R A;  1BI4 A;  2KZZ A;  4LFB K;  4FJG A;  3DLK A;  3O1B A;  3SI6 A;  1IKW A;  2XY8 A;  1X3M A;  2IVO A;  3L2W A;  4PKH A;  3CCE N;  3SPZ A;  2V51 B;  4FWM A;  3VEZ A;  2OPS A;  4GVE A;  2HBL A;  2AA4 A;  1EX4 A;  4KB0 A;  4FOI A;  1X9M A;  4DSJ A;  1XWL A;  4FJX A;  3C6H A;  1UAX A;  1W9H A;  4A59 A;  2JWK A;  3KD5 E;  1Y97 A;  4I6M B;  3A2F A;  2P9N A;  3FZK A;  2IVN A;  3U9Z A;  5JS1 A;  1KSP A;  2HBJ A;  3ZEU A;  5KPR A;  1VSK A;  2X6N A;  4JKB A;  3MAQ A;  2RKI A;  1NJI O;  1NGE A;  4E1N A;  3TAP A;  3CC7 N;  3NDK A;  4YOR A;  4DTM A;  1A5X A;  2HB5 A;  1MDU B;  5F0X A;  1WSF A;  1RT6 A;  1DEJ A;  1NGI A;  4BRQ A;  3LDL A;  2W42 A;  4OPK A;  1HYS A;  3NGY A;  2FLO A;  4LC9 B;  3CJ1 A;  1KQS M;  4WF9 L;  1J6Z A;  3MWP A;  5M1O A;  1BIU A;  3DLB A;  2EHG A;  4BDY A;  3MMV A;  4X62 K;  3SQ1 A;  3CCS N;  4BQL A;  4CJV A;  3RTV A;  1E4G T;  4KI4 A;  3ZCM A;  4AHU A;  3WXI A;  1T8E A;  3KLH A;  4CBU A;  3SAG A;  3P4I A;  1JLB A;  3PV8 A;  4I2P A;  2F9T A;  1U04 A;  3KK1 A;  2ZD1 A;  3H3O B;  5BRH A;  3THV A;  3L8B A;  4NO7 A;  3S3N A;  2FBX A;  4ISE A;  4U67 L;  3QBW A;  2LSN A;  3CCM N;  3DAW A;  2P51 A;  4FPB A;  3CQY A;  2OTJ N;  3MK6 A;  1T44 A;  4E3S A;  1EET A;  2UU9 K;  4KB1 A;  4M3U A;  3ID6 A;  1VSD A;  1VQ8 N;  5J2N A;  4LFA K;  3D6R A;  2DFE A;  4DTR A;  3NGZ A;  3AY9 A;  4FLX A;  1SS6 A;  1VQ9 N;  1LWE A;  3DOK A;  2YKM A;  4CF0 A;  4GKJ K;  3L4I A;  4AHC A;  1TUY A;  5KTQ A;  4OPH A;  4LF5 K;  4BQZ A;  3K9J A;  1RTD A;  4KFB A;  3I55 N;  3VPZ A;  3VQE A;  5DM6 L;  3M8R A;  1CZB A;  4FM1 A;  3BY5 A;  4JI4 K;  3W3D A;  4PA1 A;  1JCE A;  4AQY K;  3KD1 E;  4CED A;  4HCC A;  1O13 A;  1BCM A;  5KRS A;  3VTH A;  2QWL A;  5HRP A;  2GX9 A;  3CYM A;  1ILY A;  4GW6 A;  4CHP A;  3SAF A;  3UKU A;  5AQG A;  2YHB A;  1DTT A;  3CC4 N;  1O1W A;  3EKU A;  5DK5 A;  4MDA A;  1QHA A;  4FWO A;  2ZWH A;  4IBN A;  4YHH K;  2VQE K;  3CFO A;  4DUY K;  3VQQ A;  2G8W A;  2NRX A;  4CHN A;  2QW9 A;  1J5O A;  2VCP A;  4M3Y A;  4O5F A;  1T6D A;  3JYT A;  1OKJ A;  4FJ7 A;  1ESV A;  4JI6 K;  3ZX3 A;  1BO5 O;  3OY9 A;  4E1J A;  1WB9 A;  4KTQ A;  1VQP N;  3MXM A;  3VOV A;  2JWL A;  3AGK A;  1T03 A;  4F8R A;  3S3O A;  1RDA A;  1QHT A;  4IEE A;  3QNO A;  3QEI A;  4W5T A;  3BF1 A;  4DCH A;  2QWP A;  3NF9 A;  1NGA A;  1QQM A;  3O9R A;  1VQ4 N;  1LWC A;  2UUA K;  4GY2 B;  4GV6 A;  5B8H A;  2QTD A;  1HQE A;  4FPA A;  4NB4 A;  3DMJ A;  3LZI A;  2ITM A;  3WEE A;  3C65 A;  4EFH A;  3ISN C;  2O8F A;  1K8A O;  4QS7 A;  3CG7 A;  4CEB A;  4LF6 K;  2FXU A;  3T1Y K;  4KH6 A;  5SWM A;  3SV4 A;  3ZLJ A;  4F4K A;  4DTX A;  3C7N B;  1QTM A;  3U6F A;  5AZI A;  1YHQ N;  2D0B A;  3V4I A;  1VSF A;  1SL2 A;  4CJ7 A;  4DR3 K;  4CZE A;  3VQ8 A;  4XH4 A;  3FFK B;  3QO9 A;  4B1V A;  3V1R A;  1X9W A;  3ULE B;  4H4O A;  3HBT A;  4I7F A;  4JS4 A;  3IDH A;  4W5N A;  2E88 A;  4NCA A;  3SZ2 A;  2UYT A;  1V4S A;  3S41 A;  2BUP A;  2IIR A;  1WAF A;  3LM2 A;  1BI4 B;  3VQC A;  1U48 A;  1Z05 A;  1Z26 A;  4CFC A;  3TSP A;  3SMP A;  4FOE A;  3ZYY X;  1ZBS A;  2G8K A;  2KFZ A;  4CEZ A;  1D4X A;  4ID5 A;  3ZX2 A;  1G15 A;  3A5L C;  3KTQ A;  4JKH A;  3VEY A;  3AVF A;  3ALY A;  3VQD A;  2CGJ A;  5DM7 L;  3VGK A;  4JI7 K;  1KC8 O;  3VEO A;  3VQ7 A;  4BRK A;  2HHQ A;  3R6M A;  2P9N B;  4CJW A;  5FPN A;  1RBU A;  2DFF A;  1IKV A;  4H0P A;  3ZEU B;  2IGI A;  3LDS A;  4CIF A;  4K42 A;  4FJM A;  4XH1 A;  2X74 A;  4M42 A;  2YHY A;  1HUX A;  4DU1 A;  2PBD A;  3R9P A;  3VTI A;  1HNW K;  4DUZ K;  1SZ2 A;  3OS2 A;  4HTL A;  1NMD A;  3AA3 A;  1NOY A;  4CK2 A;  2RN2 A;  4K25 A;  3QEW A;  2OAN A;  1TGO A;  4JK9 A;  4OX9 K;  4AM7 A;  3K2P A;  1VQ5 N;  1A5V A;  4DV1 K;  2P1J A;  4GV3 A;  2BTF A;  3JXU A;  3S9H A;  3T1A A;  1IKY A;  5AQS A;  4CGJ A;  5CYQ A;  2W6L A;  3HYF A;  4I9L A;  4X65 K;  3IFR A;  5HRR A;  3O9U A;  4CHY A;  3OYF A;  2KHO A;  3O4Q A;  5K14 A;  3ID8 A;  3ZSW A;  1V4T A;  3V9X A;  3GOI A;  2IAJ A;  3EYZ A;  4WCE L;  1P90 A;  5GIN A;  1UWB A;  3PY8 A;  3JSM A;  3AVB A;  1TUU A;  1MWM A;  2NRW A;  1JLE A;  2E6M A;  1QE1 A;  2VG7 A;  3BF3 A;  4FJL A;  3OJU A;  4NXN K;  4RW6 A;  5M1N A;  3KLF A;  5ELZ A;  5I9E B;  2IC3 A;  4DQS A;  5MLC Q;  3C6T A;  5C15 A;  3L2V A;  4M41 A;  1Q82 O;  1BG3 A;  3AO3 A;  4PL8 A;  5AR0 A;  2YJE A;  5J2M A;  3ZT3 A;  3RR8 A;  3U4L A;  4YDU C;  3TI0 A;  1BIS A;  4QCL A;  1YUW A;  4YOX A;  2G8H A;  4BWM A;  4DS4 A;  4ELT A;  4L8R B;  2Q36 A;  4DQI A;  1VSI A;  4BVP A;  2HMI A;  2QI2 A;  5HRS A;  1QZ5 A;  4EIA A;  3EO3 A;  1FW6 A;  3THX A;  3T19 A;  2O4G A;  3SYZ A;  4UY8 O;  4RW7 A;  4E7K A;  3AVG A;  5EX5 A;  5KPZ A;  5LJV A;  3RWU A;  1Q7Y O;  2HHW A;  3UKU B;  3VA0 A;  4AHV A;  2UXD K;  2E2O A;  1ZXO A;  1ASW A;  3DRP A;  3O08 A;  1KXP A;  4JI2 K;  4N5S A;  3MX5 A;  1LAV A;  3O4W A;  1C1A A;  4CJS A;  1QVG M;  4KKO A;  2WUS A;  3RMA A;  2H3G X;  4B1X B;  3O9Q A;  2HBK A;  4IFY A;  3OA9 A;  4PHT X;  3T3F A;  1UA0 A;  1NKC A;  3VF4 A;  2Y1J A;  4OPJ A;  4FYD A;  2EX3 A;  1LWF A;  4YDU A;  1YVU A;  5GAG P;  1TK0 A;  1NK8 A;  3WXM B;  2V52 B;  5BPL A;  3AAP A;  3D0P A;  1BOT O;  3LP0 A;  4G1Q A;  4MLH A;  2YJF A;  3SBG A;  5TKY A;  4M7Y A;  2W6K A;  1ZC6 A;  1WLJ A;  1IH7 A;  3KIO A;  2NRT A;  3LPU A;  2D0A A;  3OYL A;  3WEE B;  3CPW M;  1RTH A;  1TAQ A;  2CGK A;  3CXC M;  3DLL L;  4FJ8 A;  2FBT A;  1L5U A;  2I7N A;  4M45 A;  2E6L A;  4FLU A;  4YOY A;  2GWK A;  5C25 A;  2HHX A;  4GVM A;  4QS8 A;  1T05 A;  4W5O A;  1N5Y A;  4JS5 A;  3OJS A;  3CI5 A;  1NJY A;  1RBV A;  2E1Z A;  5AZI B;  3L3U A;  4ELU A;  2GUI A;  2ZJQ L;  4IFE A;  1NWK A;  4BDZ A;  4J2B A;  3HST B;  1L3T A;  1HJO A;  3OS1 A;  3TAF A;  1WUA A;  4RW4 A;  2D0P A;  5BN8 A;  3K59 A;  3IRX A;  3EKS A;  2P9K B;  2NRR A;  4DR7 K;  3O9S A;  4FZZ A;  5M1Q A;  1Q86 O;  4FJI A;  3LDO A;  5C42 A;  4MFB A;  3AV9 A;  5AQZ A;  3SBT A;  5AQN A;  4Z94 A;  2HHH K;  3HL8 A;  1C0G A;  3FZL A;  1BQM A;  4Z4I A;  3Q7B A;  4FLZ A;  2HHS A;  3WNF A;  3CCJ N;  3ATV A;  1EQY A;  4JLH A;  1YAG A;  3K5L A;  4KI6 A;  2FC0 A;  1X1P A;  1HYV A;  1QQC A;  5JIC A;  5LY3 A;  3LAM A;  1NGB A;  1QZ6 A;  2P9L A;  5JVH L;  3MED A;  4ISF A;  3THY A;  3QIP A;  1VSM A;  3K5O A;  4BRH A;  1VQ7 N;  1VQL N;  4FWQ A;  3HM9 A;  3OYN A;  4FJN A;  3OYJ A;  1NJX A;  4H8K A;  3J7Y P;  1Q9X A;  3AAQ A;  1C0U A;  1TAU A;  1BA1 A;  2A5X A;  2QXL A;  3VEX A;  4DTP A;  3FLC O;  1JLC A;  3QER A;  1JL2 A;  3AVM A;  3MEC A;  2ETJ A;  4C8O A;  4WFN L;  2VYP A;  3D45 A;  3HK2 A;  3V6D A;  3HTV A;  4BWJ A;  4BRG A;  4R5P A;  4DSF A;  4HWI A;  3D2F A;  3WNG A;  3ZSX A;  2GTD A;  1BQN A;  4E7J A;  4FW1 A;  1IG9 A;  3F2K A;  2YHX A;  4C1N I;  5FLX O;  2ZM6 K;  1REV A;  5E84 A;  1GLJ O;  2NLX A;  3J7A P;  3ZSQ A;  3ZSR A;  2QWQ A;  3CJA A;  3A5N C;  1HKB A;  2KQ2 A;  3F9M A;  4CJ3 A;  3NF6 A;  4CJT A;  5KPT A;  1K73 O;  4B1U B;  4CJE A;  3IUC A;  1P8Z A;  2GV9 A;  3LP1 A;  4WQ5 C;  4JI1 K;  3V1Q A;  4DTO A;  3H3N O;  1ITG A;  3IMX A;  2HOE A;  4DG1 A;  4I2Q A; 
#chains in the Genus database with same CATH homology
 3HSC A;  1TYQ B;  3H1Q A;  2VWB A;  3K9K A;  1OVY A;  2W40 A;  4J8F A;  1RDU A;  2NRX A;  2QWO A;  1VQK N;  3G25 A;  2QW9 A;  2J4R A;  2VCP A;  4O5F A;  1T6D A;  4JKE A;  3UKR A;  4A2A A;  2ZGY A;  2ASP A;  3CPE A;  4H5W A;  5CR4 A;  2NRV A;  3T7Z A;  1OKJ A;  3UE5 A;  1ESV A;  1M90 O;  4FWN A;  3PIP L;  2D4W A;  3BUZ B;  3ZX3 A;  3VES A;  1BO5 O;  1DKG D;  1S3X A;  4BRN A;  1NGG A;  3VER A;  3DXK A;  2D0O A;  4BRA A;  4E1J A;  3L0Q A;  1VQP N;  1BWF O;  3VOV A;  5BRD A;  1YF5 L;  2FSN A;  1U2V A;  4CBX A;  2JWL A;  3CCQ N;  3AGK A;  3DJC A;  2E2P A;  4JAX A;  3EE8 A;  4FWP A;  2NNW A;  3TTD A;  3VMF B;  2D1K A;  3MX2 A;  3C6A A;  4OPA A;  5AQY A;  4IEE A;  4DQ8 A;  3ATU A;  2QEX N;  3P39 A;  3BF1 A;  3QML A;  4DCH A;  2FSK A;  4CZL A;  3A5M C;  2QWP A;  1NGA A;  4DKW A;  1QQM A;  3O9R A;  5C0Y A;  1HX1 A;  1VQ4 N;  1GLC G;  4FWL A;  3CJ7 A;  2ZJP L;  4BR0 A;  4GY2 B;  4YOU A;  4GV6 A;  5B8H A;  2QTD A;  4JKF A;  5AQM A;  4FPA A;  4NB4 A;  3EZW A;  1SQK A;  1M1K O;  4WQ5 A;  3B8A X;  2ITM A;  4FWK A;  3A0I X;  4H0O A;  1K8K B;  1E4F T;  2FSJ A;  3C65 A;  3WEE A;  4EFH A;  1K8A O;  5BR9 A;  4QS7 A;  3CHW A;  2P9P A;  2FXU A;  3WQU A;  3I8B A;  4KH6 A;  3C7N B;  4I6M A;  2P9U A;  2A40 A;  2GUP A;  1XC3 A;  2Q97 A;  5ADX A;  3E9P A;  4CBW A;  1LOT B;  4L3Q A;  5AZI A;  4KH5 A;  5FPE A;  1YHQ N;  1K9M O;  3JS6 A;  3QDK A;  4A5A A;  4AF1 A;  4CJ7 A;  4CZE A;  4JKA A;  3HOT A;  1BA0 A;  2Q2R A;  4XH4 A;  3WXK A;  3FFK B;  3E66 A;  5AQH A;  4B1V A;  2ASM A;  3CJC A;  1NM1 A;  3O5B A;  4XH5 A;  3SJH A;  2OTJ N;  4JN4 A;  3MDQ A;  5BPM A;  3ULE B;  4H0Y B;  3HBT A;  4FO0 A;  1Q18 A;  3J7Z O;  1T6C A;  5JLH A;  4A2B A;  1GLB G;  4BC4 A;  1S22 A;  3IDH A;  5H1S Q;  1N8R O;  4MDB A;  5AQU A;  2WBN A;  4BRM A;  2HF3 A;  2E88 A;  2NZT A;  4DB3 A;  2KKZ A;  2E8A A;  5FPM A;  3O9T A;  3FR0 A;  4A62 A;  1ATS A;  2UYT A;  1V4S A;  3S41 A;  2BUP A;  3TTF A;  2IIR A;  3LM2 A;  4BRI A;  3WXL A;  3MWT A;  3R1X A;  3L6Q A;  4BC3 A;  3GDQ A;  1Z05 A;  5CE3 A;  5TKW A;  3CCL N;  3SMS A;  3NVK A;  3TSP A;  3GE1 A;  3SMP A;  4FOE A;  3ZYY X;  1ZBS A;  3EL2 A;  3U9D A;  2HBM A;  5AQI A;  1S72 N;  3HZ6 A;  3CME N;  3FGU A;  3R3L A;  3NVM A;  1D4X A;  5C2F A;  3O1W A;  3RSE A;  3ZX2 A;  3H46 O;  3A5L C;  3P38 A;  4H5R A;  4BRD A;  4CD1 A;  1DGK N;  3MN6 A;  4WYB A;  3WT0 A;  3H6E A;  4JKH A;  3VEY A;  1JJ2 M;  3E9L A;  5M1P A;  3M1F A;  2CGJ A;  3D2E B;  2QWN A;  5DM7 L;  3VGK A;  4CD3 A;  1KC8 O;  2DPN A;  3ENO A;  3E9O A;  3VEO A;  3GL1 A;  2YHW A;  1BU6 O;  3MCP A;  1YJW N;  3MN7 A;  4BRK A;  1CZA N;  3R6M A;  2P9N B;  4JK8 A;  5FPN A;  5AQT A;  4ILH A;  1RDW X;  2HMP A;  1ATN A;  1NGD A;  4H0P A;  3ZEU B;  4B1Y B;  5ADX H;  3ZET A;  3A8Y A;  1T3V A;  4U7B A;  4BG8 A;  4FL9 A;  2QM1 A;  3DXM B;  5AQV A;  2FF6 A;  2GEL A;  4K42 A;  3VEW A;  1NGC A;  4XH1 A;  4FWS A;  3QBX A;  1WOQ A;  2YHY A;  3KK7 A;  1HUX A;  4IO9 L;  1NLV A;  4CZG A;  2PBD A;  5EOY A;  3R9P A;  3TSQ A;  3VTI A;  3NMU A;  4IXC A;  2QWR A;  4ISG A;  4AM6 A;  4BY9 C;  1SZ2 A;  2Q0U A;  4HTL A;  1NMD A;  4K25 A;  4BRE A;  2OAN A;  2A41 A;  4K41 A;  4JK9 A;  4NLB A;  4JKD A;  4AM7 A;  1NGH A;  1VQ5 N;  2PFU A;  3FE1 A;  3O8M A;  4JKG A;  3R8E A;  3KWI A;  5GAH P;  3ENB A;  3IKM A;  4YOW A;  3LL3 A;  3MCA B;  4GV3 A;  2BTF A;  3JXU A;  4GNI A;  1YXQ A;  5AQS A;  5GIP A;  5GAE P;  2RHK A;  2P9S A;  4JD2 A;  3IFR A;  5EY4 A;  3O9U A;  5AZJ B;  4WFA L;  4CZK A;  1KAY A;  3UB5 A;  5AQP A;  1X9J A;  1HPM A;  2YX6 A;  3CQX A;  2KHO A;  3OBW A;  4JHD A;  3ID8 A;  4EAH D;  5KQD A;  1V4T A;  3DWL A;  3H1V X;  5GAD P;  1Y64 A;  3GOI A;  3HRG A;  1VQ6 N;  2P9L B;  2V7Z A;  4Y0W A;  4WCE L;  3E1Y A;  5KQ8 A;  2A3Z A;  1U6Z A;  3SLC A;  5FPD A;  1P90 A;  5GIN A;  5JMV A;  2HF4 A;  3P31 A;  1TYQ A;  4EHT A;  1YJ9 N;  2Q31 A;  1TUU A;  4BC5 A;  1MWM A;  2NRW A;  1YIT N;  4XEI A;  3HM8 A;  3CMA N;  2Q1N A;  3D7E O;  4QS9 A;  3BF3 A;  4B1W B;  1HKC A;  1KAX A;  3ENH A;  5M1N A;  1NGJ A;  3CJ9 A;  4H0T B;  5ELZ A;  5I9E B;  1X3N A;  4EHU A;  2WFB A;  5AFU H;  1YI2 N;  3FZH A;  3M6G A;  4A57 A;  5MLC Q;  2A6A A;  2P9I B;  5C15 A;  1YIJ N;  1IG8 A;  3G71 N;  1Q82 O;  1MA9 B;  1BG3 A;  1QVF M;  3OW2 M;  1W2B M;  2OTL N;  3QB0 A;  3VGL A;  4BVO A;  4PL8 A;  4CI6 A;  5AQL A;  5AR0 A;  2AP1 A;  2KLA A;  2YJE A;  4YOT A;  4PL7 A;  3BP8 A;  3TSU A;  1H1V A;  3U4L A;  4YDU C;  3D2F B;  3G4S N;  1YUW A;  4IOX A;  4YOX A;  1JCG A;  4O8U A;  1HKG A;  4KBO A;  2Q36 A;  2EWS A;  3CER A;  1Q81 O;  1W97 L;  4BVP A;  1LCU A;  1BUP A;  2P9K A;  3M5R A;  4WFB L;  2QI2 A;  4IWV A;  5AQF A;  3LDN A;  3T69 A;  1QZ5 A;  5JVG L;  4EIA A;  3EO3 A;  3MN5 A;  4RCH A;  1VQN N;  3VEV A;  4CZH A;  1XQS C;  3M3Z A;  4FSV A;  4A61 A;  1K8K A;  4UY8 O;  4H5N A;  5EX5 A;  1RGI A;  4MLE A;  3SK3 A;  5KPZ A;  5LJV A;  3PIO L;  1GLE G;  1Q7Y O;  5C10 A;  3UKU B;  2E1Y A;  2NRZ A;  3AAR A;  4BR9 A;  3CD6 N;  5AQR A;  2E2O A;  1ZXO A;  1RFQ A;  2RE2 A;  3C7N A;  4WQ4 C;  2CH6 A;  3O08 A;  5BPN A;  1KXP A;  2F7T A;  4JNE A;  4JEP A;  3MX5 A;  3O6W A;  4O8K A;  2GWJ A;  4BR4 A;  3O4W A;  3W0L A;  4IDH A;  1QVG M;  2QA4 N;  3KZB A;  2F9W A;  3OHR A;  3UKR B;  4BRC A;  3KVG A;  2WUS A;  3A5O C;  4K43 A;  4C23 A;  2H3G X;  4B1X B;  3O9Q A;  3N4P A;  2HBK A;  3OA9 A;  3LDQ A;  3RVC A;  4PHT X;  1GLD G;  3ULE A;  2YCH A;  4M7X A;  4MO5 A;  3ZX0 A;  5C2D A;  2E2Q A;  2E2N A;  4H5T A;  1EO1 A;  3VF4 A;  3CET A;  3DXK B;  3VF2 A;  4JK7 A;  4C1N K;  3QIC A;  4YDU A;  2WC9 A;  1U2V B;  2IVP A;  5GAG P;  4IZ9 A;  3WXM B;  1GLA G;  2V52 B;  4IO8 A;  1C0F A;  3H45 C;  3N4Q A;  5BPL A;  4BRF A;  3HI0 A;  3WXJ A;  3AAP A;  2Q0R A;  1BOT O;  4CZM A;  3MN9 A;  3F5T A;  4MLH A;  2YJF A;  3SBG A;  2ZJR L;  3EE9 A;  3O1B A;  5TKY A;  4M7Y A;  5F1X A;  4IJA A;  1X3M A;  2E20 A;  2IVO A;  1QQN A;  1ZC6 A;  2A42 A;  1HLU A;  4RTF D;  4PKH A;  3CCE N;  3FZM A;  2NRT A;  2V51 B;  4FWM A;  4MO4 A;  3VEZ A;  3QFP A;  4RWT A;  3WEE B;  4GVE A;  2CGK A;  3CPW M;  3G6E N;  2HBL A;  3CXC M;  3DLL L;  2AA4 A;  4WQ4 A;  4CZJ A;  2I7N A;  4FOI A;  2GEM A;  4M63 C;  4IJN A;  4YOY A;  2GWK A;  3D2E A;  2P9P B;  3C6H A;  3GBT A;  4QS8 A;  4A59 A;  1GLL O;  1BDG A;  2JWK A;  4KH4 A;  4R79 A;  4I6M B;  4ILJ A;  4BRO A;  2P9U B;  4OO1 J;  3CI5 A;  4B1Z A;  2P9N A;  3FZK A;  2IVN A;  2E1Z A;  5AZI B;  3CIP A;  3U9Z A;  5HOO A;  2VGM A;  5AQQ A;  2NRH A;  3CC2 N;  2HBJ A;  3ZEU A;  5KPR A;  2ZJQ L;  4JKB A;  3HOS A;  3SAH A;  4IFE A;  1NJI O;  1NGE A;  1KD1 O;  3DXM A;  4PKI A;  3CC7 N;  1NWK A;  4ILG B;  4YOR A;  1JCF A;  1XUP O;  1HJO A;  2ZF5 O;  1WUA A;  3TTC A;  3GG4 A;  5BN9 A;  1GLF O;  2D0P A;  2ZGZ A;  3AGR A;  1MDU B;  5F0X A;  4BRL A;  4H03 B;  5BN8 A;  1DT9 A;  1QQO A;  1DEJ A;  1NGI A;  3EKS A;  4BRQ A;  5BRF A;  5F2R A;  4BGA A;  3LDL A;  1KAZ A;  2CGL A;  2NRR A;  2P9K B;  3O9S A;  3TU5 A;  2FLO A;  4LC9 B;  3CJ1 A;  5M1Q A;  4CZF A;  1Q86 O;  1KQS M;  3LDO A;  3O80 A;  4WF9 L;  5AQZ A;  3SBT A;  5AQN A;  1J6Z A;  3VEN A;  4Z94 A;  3MWP A;  5M1O A;  4H5V A;  4IOA L;  1C0G A;  3FZL A;  3MMV A;  3OBY A;  3Q7B A;  1NBW A;  1VQO N;  5AQW A;  3CCS N;  4BQL A;  3QFU A;  3Q7C A;  3CCJ N;  4H0V B;  5AZJ A;  3RSE B;  3ATV A;  1EQY A;  2W41 A;  5AQK A;  1E4G T;  5AQX A;  1YAG A;  3U8X A;  1VQM N;  3WXI A;  4CZI A;  3CF5 L;  1SAZ A;  4CBU A;  3SAG A;  5JIC A;  3P4I A;  5LY3 A;  2VGN A;  1NGB A;  4FWR A;  1QZ6 A;  5EXW A;  2P9L A;  2F9T A;  4BR5 A;  2HST A;  3PLA A;  3H3O B;  5BRH A;  4B9Q A;  5JVH L;  4ISF A;  4A5B A;  3VF6 A;  3KWG A;  1VQ7 N;  4BRH A;  4NO7 A;  5CHI A;  1VQL N;  4FWQ A;  5M1K A;  4IOC L;  3VET A;  3LDP A;  4ISE A;  5AQO A;  4U67 L;  4DHY A;  3QBW A;  3CCM N;  3CCR N;  3DAW A;  3LM9 A;  4FPB A;  3CQY A;  2BH1 A;  1VAZ A;  1T44 A;  2ASO A;  2FF3 B;  3BEX A;  3AAQ A;  3MK6 A;  3VGM A;  5GIO A;  4GV9 A;  1BA1 A;  2A5X A;  3ZET B;  3ID6 A;  4BC2 A;  4PKG A;  2QXL A;  1VQ8 N;  3VEX A;  4BRP A;  3FLC O;  5M1F A;  3KHY A;  3D6R A;  3AY9 A;  1VQ9 N;  1SS6 A;  2P9I A;  3C0B A;  3FZF A;  5E26 A;  3L4I A;  3CCU N;  3L4Q A;  5EVZ A;  1TUY A;  4OPH A;  2QWM A;  4BQZ A;  3K9J A;  4WFN L;  4G9Z A;  2VYP A;  3CCV N;  2YI1 A;  5HL7 L;  3HTV A;  4NLC A;  4BRG A;  3I55 N;  3VPZ A;  1R59 O;  4HWI A;  1ATR A;  3D2F A;  5DM6 L;  2GTD A;  2PAV A;  1G99 A;  4JKG B;  4H0X B;  5LJW A;  1Z6R A;  4BR7 A;  3F2K A;  4FVU A;  2I7P A;  3W3D A;  2YHX A;  4C1N I;  1JCE A;  5AQJ A;  5C12 A;  4MDA A;  1O13 A;  2P9S B;  4JKC A;  4JD2 B;  5E84 A;  1IJJ A;  1GLJ O;  2NLX A;  4BR2 A;  4FWO A;  3VTH A;  1YJN N;  2QWQ A;  2QWL A;  3CJA A;  3A5N C;  1HKB A;  3WUH A;  2GX9 A;  1YVN A;  3F9M A;  4BG9 A;  1ILY A;  3I56 N;  1NGF A;  5KPT A;  4JHD B;  1K73 O;  2V7Y A;  5BRE A;  4B1U B;  3SAF A;  3WQT A;  3CJB A;  1P8Z A;  3IUC A;  3UKU A;  3I33 A;  3TPQ A;  5AFU A;  4WQ5 C;  4YOV A;  5AQG A;  4BGB A;  2CH5 A;  3H3N O;  4F9O A;  3CC4 N;  3EKU A;  4IEI A;  3EN9 A;  5JLF A;  3IMX A;  2HOE A;  1QHA A;  3J8A A;  1MWK A;  2ZWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...