5M1KA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound magnesium
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
189
Chain Sequence
PAMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
total genus 66
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1kA00
5M1PA 5C2DA 4IDHA 5C15A 5M1NA 5M1KA 5C12A 4IEEA 5M1QA 3C6HA 4IEIA 5C2FA 5M1FA 5C10A 3CPEA 5M1OA 3C6AA 4IFEA
chains in the Genus database with same CATH superfamily
2Z1GA 2ATQA 1DKGD 4ILGB 4CCHA 4N47A 3SI6A 4AM6A 3ZX2A 4N76A 2WC9A 2ZF5O 2YNHA 5AQNA 1V4SA 3DLKA 5AQPA 1SKWA 3OBWA 3ATUA 2HBJA 3QNNA 3FE1A 4CIGA 4CJEA 4RW7A 4WQ4A 3ZSQA 3O08A 1YI2N 4KHWA 3ZX3A 3WEEB 1LWCA 1CXUA 4CD1A 3V1RA 5CZ2A 3O5BA 1T05A 4CGDA 4UY8O 2ETJA 1S72N 3SAGA 2QK9A 3AO4A 4BE0A 3AO1A 2ZGZA 1YTAA 4KHYA 4JKBA 3CFRA 2HNZA 4CJ3A 1SKRA 4CEBA 3KWIA 2PY5A 3B6OA 2WBNA 4WE1A 4Q0BA 4BRHA 2G8WA 1QHTA 4CF0A 3KK3A 3C65A 5AQTA 4JLHA 1RT1A 4CHNA 4H03B 2GUIA 1TKZA 1TL3A 4CVNE 1HPZA 3BGRA 1ZBLA 4FSVA 4M3XA 4FWNA 5FRMA 2O8FA 1JLBA 3NBPA 4JS4A 4JHDB 1ATRA 3OYAA 1J5OA 1IH7A 3M8PA 1TK0A 2E88A 4MO4A 1BU6O 2PYJA 4BRLA 3LP3A 4DFPA 2KFZA 2HB5A 5I42A 4CEQA 3D2FA 4FL9A 4A59A 3TSPA 1KTQA 1ZBSA 1EXQA 3DMJA 3D7EO 3RMAA 4DV6K 1QQNA 4JI7K 1VHXA 4C8NA 1NGFA 3VA0A 1JCEA 1S9EA 3DXKA 2QM1A 3P38A 3CCVN 1VQ4N 2IDOA 2E2QA 3MN6A 3OYDA 3OS0A 5AQOA 5AJ3K 3I8DA 3KK1A 4FWKA 3AVGA 2PBDA 2XY5A 1GLDG 2W6KA 1D9FA 3KJVA 4QOZB 4JI3K 1ZBFA 1WAJA 1UA0A 3L8BA 1BWFO 1CLQA 3OY9A 1BDGA 3V6DA 3ZYYX 3DJCA 4FJLA 1T3VA 4K25A 4KREA 3DLLL 1ZBUA 4MDBA 4GV9A 4LFCK 4BROA 2R7YA 4JKEA 4CJFA 4W5QA 3FZFA 5D3GA 3H6EA 1HYVA 4TSXA 4B3RK 1YT3A 3E9OA 4B3TK 3S41A 1NGDA 1HMVA 4JRPA 4DSFA 1HR0K 4OVLA 4DR4K 4LF7K 4KBOA 3ZSOA 4FWMA 3NH2A 1JCFA 1RDBA 3CI5A 5EXWA 2E1ZA 3CJAA 5J2QA 2GV9A 1OH6A 2ZWHA 4OLAA 4AQYK 1G15A 4DV2K 1RTHA 4U7BA 5EU7A 2GTDA 5HLFA 1HNXK 4LFBK 2YHWA 2CH5A 1RBUA 3UKRB 2NRXA 3HO1A 3FZHA 4IG0A 1BO5O 3O80A 3M3ZA 2QTDA 1XWLA 5AQXA 4KHUA 2FXUA 4C1NI 3CF5L 3VMFB 4NLCA 3H1VX 4H5RA 3PO4A 1HNIA 4CZIA 3DRPA 1E4GT 3CHWA 1XC9A 2IAJA 1HNVA 4BRGA 3IKMA 1WAFA 2I7PA 4DWIA 2A5XA 3R8EA 1FKPA 4JAXA 3SJJA 3E01A 4JKFA 5KPRA 3AAPA 3RMBA 1J5EK 4JKAA 3J7ZO 4IJNA 1U04A 4DF4A 1X1PA 3TSQA 5KRTA 1DGKN 1B92A 1IKYA 4XH4A 2IOCA 4K41A 3K5NA 4BR4A 2O8DB 1N8RO 2D0BA 3BY5A 4B9VA 2HHUA 4BRKA 4H0VB 4K8XA 2V7YA 3F9KA 3VTIA 3VEWA 3OYLA 4H0XB 3QEIA 5C15A 3F2KA 3PSFA 3QFPA 2OPSA 1IBLK 4YOWA 1BQNA 1NGEA 4EHUA 1SS6A 4IWVA 3ID8A 2D1KA 3AO2A 1A5VA 3DYAA 4IFYA 4DLEA 5IT9O 4GVMA 4IOXA 4YOTA 1J53A 4DTPA 2NNWA 3ZX0A 3VQDA 2NZTA 3HRGA 3GE1A 4H4MA 1NGHA 2P9LA 2YJFA 3QEPA 4FWPA 5DM6L 4FCYA 4JKCA 4ID5A 3EZWA 1E3MA 5BPNA 3CD6N 1IBMK 2VGMA 4HUEA 2UXCK 4HWIA 4BVPA 4I7FA 1N33K 4AHTA 1L3VA 3J80O 3ZT3A 4QS7A 3ZETA 3MX2A 4CJLA 1NM1A 4ILJA 5AQMA 3OYBA 1QSSA 3NH1A 4C8OA 3KK7A 3LANA 3O3HA 2Z1JA 1N5YA 3THXA 2ZGYA 4B9TA 4DFMA 4YY3K 2HHTA 3HT3A 4CJTA 2GEMA 4YOUA 4DSLA 4GKJK 2KW4A 3M1FA 4IOCL 3HXMA 1HKGA 4NXNK 1JLAA 4BY9C 2VG7A 2XHBA 4DQPA 4CJRA 2AP1A 4FWLA 3SPZA 3NF7A 3J7AP 2LSNA 1TAUA 1BG3A 5GAGP 3LZJA 4AHVA 3ULDA 3SQ1A 3K2PA 1SV5A 2OCEA 3VQEA 3WQUA 3O6WA 4GW6A 1YHQN 1VRUA 2FBXA 2HSTA 4BE1A 1JXBA 2QA4N 3K9JA 4FJGA 1EKEA 1BQMA 1QSYA 4KHPK 2P9IA 3SV3A 5BR9A 4OKEA 3VQQA 4CECA 3CM6A 4PWDA 3L2UA 4NO7A 4JD2A 3OYCA 3CJBA 5KPTA 4DSJA 4C8LA 3VEXA 4DCHA 2YJEA 1QZ5A 2GELA 1HKBA 4JNEA 3AVJA 4HHTA 4H5VA 1HNZK 3T19A 2NRTA 5FPNA 4M3YA 3C6AA 5C0YA 3KVGA 4HCBA 1BCMA 3QICA 4H5TA 4KAZA 5HP1A 2F9TA 4FXDA 1X3MA 3BDPA 5ELZA 2KHOA 5HRPA 1QVFM 1VQ9N 1IBKK 3R9PA 1K6YA 4HCCA 4DTJA 5AQHA 4NB4A 1K8AO 4FM2A 3HBTA 5JICA 3SJHA 1W0HA 1VSFA 3N4PA 3VEOA 3AVLA 1HLUA 2RN2A 3VQ4A 1FXXA 4MFBA 4FJ5A 4F3OA 5AQWA 4DV4K 2FF3B 3PX0A 1KRPA 2UXDK 3CQ8A 5LL6Z 4PKHA 5I3UA 1YVUA 4WQ4C 2D4WA 3VGMA 4CEDA 3SNNA 1ZBHA 3PLAA 4B3OA 2VWJA 3LAKA 2ZD1A 4OKJA 5CYQA 3MN5A 4FLYA 2Q0RA 3S3NA 3MN9A 3AVMA 3KLHA 3RVCA 1HJRA 3O1BA 4A62A 1NGBA 4O0JA 5AZJA 5CYMA 4CK3A 1QQMA 3MWPA 4H0OA 1KVCA 4WQ5C 2NUBA 3PSIA 3RSEA 1RDDA 5AFUA 4E1MA 4B9LA 1YUWA 4MDAA 4U67L 4DU3A 3T3FA 3C6TA 3KKRA 1KD1O 4M7XA 2P9UB 1S1XA 1A5WA 1ATNA 3NFAA 5AQYA 4CF8A 4NXMK 4BR2A 2O8EA 1TYQB 5BR8K 4M3ZA 1C0UA 2AA4A 4O0IA 4Y1DA 5HRNA 4EP5A 4HTLA 1JJ2M 3HM9A 2BANA 3A5NC 1XC3A 3RMDA 4I2PA 4OO1J 4XH5A 3VQ9A 3KKSA 3TAEA 3MDQA 4I6MA 3T1YK 2W41A 2IC3A 3G6EN 1NMDA 3EKUA 1C0MA 4ISFA 2HHVA 3DXMA 1R0AA 2UXBK 2IIRA 2D0OA 3SV4A 2WOMA 1I39A 3ZSYA 1H1VA 5BN8A 1XQSC 1WSIA 2BE2A 2CGJA 3ITHA 1VSIA 3KHYA 3WXIA 3CMAN 2A3ZA 3VPZA 5GINA 5J2PA 1R59O 4Z4IA 4JKGB 4W5NA 4DV5K 5FROA 5SWMA 2O8BB 4CZFA 1YAGA 4H4OA 3CC4N 4FJKA 1VQ7N 2HBKA 2O8CB 4NCGA 3A8YA 3R6MA 3CCEN 2XY7A 1TUYA 3CM5A 5KI6A 4BRPA 1Z6RA 1NBWA 5CZ1A 3HK2A 2Z1HA 4FOEA 1NJWA 5FPDA 5F1XA 4M41A 2Q0UA 3TPQA 4JEPA 3SYZA 4B1WB 2OPRA 4BR7A 3HOTA 4BDPA 4FLWA 4CERA 4PY5A 1NU0A 3NH0A 3THYA 3ZSVA 4BRQA 1TV6A 1NJZA 3THWA 3DOLA 2YV0X 2QEXN 4R79A 3MEGA 2HHHK 4N5SA 3SUOA 1ZC6A 3CC7N 4DB3A 1ATSA 4WCEL 1TUUA 4B3MK 3QETA 1K8KB 3AVHA 1GLLO 4DTUA 3U4LA 4KO0A 3SAHA 4WFAL 3M8SA 4FJNA 1WBBA 3RWUA 3NE6A 5MLCQ 1JXEA 1RDWX 2JLEA 3LDSA 3THVA 1KAXA 3T69A 3WT0A 3KK2A 3LWMA 3I0RA 4E19A 1NGJA 3TTDA 4FOIA 1KFDA 3RTVA 1C1AA 3AVNA 3NAEA 4OPJA 2QI2A 4Y0WA 4A2AA 5CE3A 5JLHA 3QERA 1EQYA 1UOCA 1J6ZA 3MCPA 1REVA 4YOYA 3FZKA 3OYEA 4OPKA 4OLBA 2Q36A 3DLHA 5CHIA 1IV0A 1ITGA 3H45C 1XMOK 4YOVA 1KCFA 4EZ9A 2KTQA 4M7YA 3V9WA 3LDQA 3CC2N 4G1QA 3U3YA 2ITMA 4FVUA 4CJ5A 1V4TA 4DR3K 2F7TA 4OKKA 1X9WA 3U9ZA 1EP4A 2UYTA 4FJ8A 5FLXO 3PO5A 1LAVA 2HF3A 2Q1NA 1Q9YA 1HYSA 3QBXA 3L4IA 3O9QA 1WN7A 4IXCA 2YX6A 3TAMA 4RW4A 1S6QA 1VQMN 3CJ9A 1L3TA 4CEZA 4LF9K 1P8ZA 3A2FA 4RW6A 2G8KA 3I56N 3V4IA 2IVOA 3P83D 1L3UA 3LZIA 4M45A 3B6PA 4DTOA 3K58A 5AQRA 2EHGA 4CW7B 3C6UA 3C94A 3BF1A 4FWQA 4CGHA 2X6SA 2A6AA 2E2OA 3FR0A 3KZBA 4M3UA 1TKXA 1FKOA 2P9PA 1A5XA 3IG1A 1ZXOA 4BG9A 3VF6A 4DKWA 5BN9A 3UE5A 3CCSN 3O4NA 2GWJA 3DRSA 3VF4A 5SZTA 4GY2B 1XUPO 1N36K 1FK9A 5HBMA 4A57A 1RTJA 3MXJA 4CGGA 5DMRA 1WNSA 3HP6A 3BP8A 2F9WA 4CJ4A 2RF2A 4NCAA 3CFPA 3NGZA 2VG5A 3DAWA 1MU2A 2P9KB 4XIUA 4CEFA 2EWSA 1KQSM 4IG3A 1C0TA 1E4FT 1NK4A 3S3MA 1C0FA 2E8AA 1NK6A 3NDKA 2Q31A 3IDHA 4JS5A 2XY6A 4FK4A 3QFUA 4E0DA 5TKYA 2E1YA 3SUNA 1WSGA 4M63C 1RBRA 3SMPA 3LM2A 2XO7A 5BRFA 4FLUA 5CY4A 3L2WA 2OPQA 4KRFA 3F9MA 4FW2A 3V9XA 2GUPA 5HRSA 4A2BA 1YJ9N 1RDUA 4BC4A 4E7LA 2E4LA 4HTUA 4CJKA 4KB1A 1VSMA 4KB0A 4WF9L 3QIPA 4FJIA 5C12A 4O4GA 4CHOA 3Q7BA 3GG4A 4JKHA 1YITN 2ZQBA 4DFJA 2XRIA 3NMUA 2VYPA 1QSLA 3AARA 4Z4HA 1BOTO 3EL2A 1ASWA 4EAHD 2X6NA 3WEEA 4BE2A 2F4VK 4CJVA 3GDQA 2BDPA 4E7IA 4LSNA 2X78A 3HP9A 3OYHA 5CR4A 3RMCA 3QB0A 2ZM6K 4M3RA 2D0CA 3QEWA 3OS1A 5KPZA 4DSKA 1TK8A 5E84A 4KHNA 3LDPA 1NMNA 3D2EB 4A61A 4BRAA 3PY8A 3LL3A 1GLCG 3AVIA 4DUYK 1RCHA 1VSHA 2IVPA 1NK7A 3C7NB 1TKDA 3DLGA 3CCUN 4B9NA 1JLGA 3GL1A 1KSPA 1NLVA 1SL0A 1T6DA 5M1NA 5KQ8A 1QE1A 1DTTA 5TKWA 4FWSA 4JHDA 3QEVA 2HNYA 1KVAA 3VEVA 3DWLA 3PV8A 4HUGA 2G8IA 4FJMA 5AZIB 2ZJRL 3TAQA 3AA2A 5ADXA 1WSFA 3MAQA 4JV5K 3HSCA 4K42A 2F8SA 4JI2K 4YOXA 2VQEK 1D8YA 2KLAA 1C1CA 1EX4A 1RT2A 3OYIA 3R3LA 3AA3A 4X64K 1TGOA 3OBYA 2UUBK 3V9UA 4CJUA 1GLJO 1KC8O 2E20A 2GWKA 5C10A 4JN4A 4B1XB 3S9HA 2UU9K 2PAVA 4MLHA 1YTUA 4IZ9A 5IWAK 3IMXA 3U6FA 1NWKA 1VQON 4OGEA 4NYNA 3VA3A 4E1JA 4CEAA 2Z1IA 4O8KA 4BRNA 2ASMA 1OKJA 1TK5A 4CZMA 3E9PA 4J2EA 2VGNA 3EN9A 3JYTA 3NHGA 4QCLA 4FZXC 3VQCA 4CZJA 2WUSA 5A2QO 2A1SA 3SUQA 5AQJA 1S1UA 3MN7A 1HYZA 4AH9A 4ZHRA 4CJQA 3CERA 2KQ2A 3OYNA 4DTMA 4PUOA 4C1NK 4GKKK 1IG9A 4KTQA 4H5NA 1HKCA 4B1VA 5FDLA 2ASPA 3ID6A 4DSIA 4EP4A 2H3GX 1YVNA 1VSJA 2P5OA 4DQRA 2FBYA 1LWEA 5EVZA 4KHQA 1VQ8N 1S3XA 3CG7A 2OPPA 4ELUA 3NGYA 1T7PA 1U47A 3MX5A 4FLZA 3M8RA 3DM2A 4DV3K 4YDUA 4B8CA 2UUAK 1KAZA 1DLOA 4ZTJA 1DTQA 4EHTA 1BHLA 1UAXA 5AQVA 2W40A 3KTQA 1BCOA 3BUZB 3O9RA 2YNIA 3VF2A 3T1HK 5C42A 3UKRA 1CXQA 3C7NA 4DFKA 3IS9A 3QINA 2PYLA 4CZGA 1DT9A 1WSEA 3LALA 1D5AA 4BDYA 1U2VB 3JAMO 5BRHA 1ESVA 3H08A 4NYFA 2B5JA 3AVFA 3O8MA 4XEIA 4F9OA 2P51A 5T7BA 2WFBA 1WUAA 4CIEA 2FSKA 4CE9A 2FSJA 2OA8A 3J8AA 3MECA 2OTLN 4BR9A 3ULEB 3HI0A 3HVRA 1HPMA 3MWTA 3E9LA 4E7KA 2B6AA 2QWNA 2P9SB 4KH4A 1BISA 3NVMA 5F2RA 4Z4GA 3VERA 4KTWA 3QNOA 1K9MO 4IOAL 5AFUH 4L3QA 4DU1A 2O8DA 2VWBA 1QS4A 4NCBA 3ISNC 1HX1A 3RR7A 4CHQA 3OYJA 1VQKN 3OTOK 4ZTFA 2IGIA 2CGLA 1K73O 2HMIA 3SQ2A 4DR7K 5JLFA 3S3OA 3NF6A 2QKKA 3EZ5A 4M3TA 3UKUB 4NLBA 5J2NA 4B9QA 3IUCA 1NKEA 1JLEA 3FFKB 3LAMA 4WFBL 2AJQA 4DU4A 4A5BA 1SL2A 5GIOA 3CXCM 5HRRA 3ZSWA 1N32K 3T7ZA 3DRRA 1DEJA 3KIOA 1OVYA 3TABA 1CZAN 1OH7A 4IEIA 3AV9A 4CGFA 3P4IA 4CZEA 5AQUA 4BDZA 3LDLA 3PIOL 1RT6A 4RW9A 1WSHA 2BH1A 5EOYA 4F8RA 4FM1A 3AVKA 4FLXA 2JGUA 2ZE2A 3H3NO 2YNGA 4CFDA 1GLFO 3IFRA 1GOBA 3WNHA 3VGLA 1UWBA 3DOKA 4DHYA 4KPYA 3TU5A 1S1TA 4FJJA 3EEQA 4FJHA 1T6CA 4FWRA 4LSLA 4Z0UA 4CJWA 4RTFD 4W5TA 1GLAG 4CJSA 4IFVA 2IVNA 3B8AX 2ASOA 1S6PA 2Q2RA 3MXMA 2BUPA 5H1SQ 3ZEUB 3U8XA 1NJXA 4LF4K 1YXQA 3QESA 1LOTB 1J9AA 4X65K 3ZT4A 4B1UB 1U48A 4JI0K 3SK3A 1SQKA 4ILHA 1QZ6A 1O13A 1RT4A 2QWOA 4B1ZA 4CEEA 3HM8A 1NKBA 2NRVA 4Z4CA 2OTJN 1ASUA 5C2DA 1BI4B 1P90A 2E6MA 3ZT0A 4FVMA 1X9MA 1T03A 2HOEA 1KAYA 4JI8K 4BQLA 4CGIA 4CEOA 3IRXA 2E2PA 2NRWA 3OW2M 3CJ7A 5KGXA 3UIQA 4E7HA 4LF8K 4LF6K 1NK5A 2Y1IA 3OS2A 1EETA 4M42A 3HL8A 3OHRA 1I3AA 3L3UA 3O9SA 4FZYA 3CFOA 1WOQA 2HVHA 3FLCO 1Z05A 4LD0A 2KFNA 4IO9L 1RT3A 1MDUB 1JL1A 1LW0A 3L4QA 1GOCA 5LY3A 3QIOA 4C8MA 1NK8A 1VSEA 2V7ZA 1RT7A 4LH4A 4V19S 4JYAK 2NRHA 3CCQN 1W9HA 1VK0A 3MK6A 3MXIA 1FJGK 4ELVA 3ZT2A 1NGAA 3ZSZA 2E5LK 1RFQA 4RWTA 1X3NA 3LP0A 3PIPL 2ZJPL 3SQ4A 3VQBA 4DTXA 1W7AA 3VENA 3AO5A 4JK9A 3TAFA 4F2RA 2P9UA 1FW6A 2O8FB 3MCAB 1EO1A 3M6GA 2D5RA 1BIZA 1OVQA 4AHUA 3UB5A 1TYQA 4DR6K 1LAWA 1W97L 4H0PA 3OYFA 1U49A 4B3SK 4BGAA 3I8BA 2HMPA 4DR1K 3CCRN 3TWHA 2DFHA 2OANA 3NF9A 4PL8A 2B4JA 3L2QA 3SUPA 4BR0A 3AO3A 5F0XA 1JL2A 3OVNA 4F3TA 3D2FB 5JS1A 4DQSA 4W5RA 2O4GA 2HHQA 5KGWA 2A40A 3CPWM 3E1YA 3WXLA 4BRDA 1IKVA 4CHYA 1QQOA 3V1OA 1HUXA 3L2RA 2W42A 1VQPN 1W2BM 4BREA 5FPMA 1VSKA 1YJWN 3SZ2A 2QW9A 5M1KA 2P5GA 2HF4A 3DXKB 1NNEA 3CIPA 1WBDA 2ITGA 4O55A 4B08A 2OZSA 3O9TA 2CH6A 1MA9B 3HVTA 1T8EA 4G9ZA 1LW2A 5AQGA 1QTMA 2XY8A 3WNFA 1OH5A 1ZYQA 2FBTA 4JKGA 2RHKA 1JCGA 2O8BA 3J7YP 3G0ZA 3SMSA 4H0TB 4CK1A 4FJXA 2O8CA 1GOAA 3HPOA 2F8TA 4HUFA 1WLJA 4CBUA 3K5MA 3AA4A 1VQ5N 3JS6A 3LP1A 3G71N 2WTUA 4R5PA 4CBXA 3SPYA 3WXJA 2UUCK 1KFSA 1Q8IA 3WXKA 1SZ2A 3AGKA 1XMQK 1KLMA 1K8KA 4LFAK 3VN5A 4CF1A 4WQ5A 5EY4A 1T44A 3C95A 5AQIA 3L2VA 4OGCA 3QMLA 4PKGA 5AQLA 4CI6A 1J54A 3SBTA 5M1FA 1QHAA 4QAGA 2PZSA 3HPHA 3VQ5A 1NGGA 5LJVA 1IO2A 3DLBA 3G4SN 4KH5A 2JWLA 4N41A 4YDUC 3WXMB 4DQQA 2FBVA 1JLQA 1LCUA 1NKCA 5C24A 3HTVA 1RNHA 2YKMA 3NGIA 1Q7YO 1D4XA 4BC5A 5HROA 2VQFK 3ENHA 3SQ0A 5LJWA 3CQXA 4PKIA 1U6ZA 4H5WA 1OH8A 5AQZA 4AF1A 2GX9A 3V81A 3D6RA 2A42A 4B8AB 3LPUA 4DSEA 3TTCA 4DR2K 2WONA 1B9DA 1HNWK 4YORA 4ISGA 5ADXH 4LC9B 3KLIA 1Q82O 2V51B 3QDKA 3I55N 1VRTA 1LV5A 3NVKA 5DK5A 1RBVA 3FZMA 5JVHL 4JKDA 3HJFA 5BPLA 5GADP 4B9UA 1NJYA 1RTDA 4BC3A 1X9JA 1Y64A 3CCJN 4KH6A 2D0PA 2YHAA 2P1JA 4GMJB 3ALYA 4O5BA 1KVBA 1VSDA 4IKFA 3AA5X 3O9UA 1NK0A 3P1GA 3OYKA 4JI5K 4HVJA 3VESA 1S1WA 1IG8A 2QXFA 5KQDA 3CPEA 4FO0A 4BWJA 4CD3A 5BRDA 4X62K 4BG8A 3P5JA 3VQ6A 4DQ8A 3QBWA 3GBTA 5EX5A 4B9MA 1ASVA 2YCHA 5M1OA 1MWKA 4IDKA 1EWRA 2F96A 4BRFA 2P9LB 1RBTA 4BC2A 3V9ZA 5JMVA 1LWFA 2HW3A 3C6HA 3TAPA 3O4QA 3Q7CA 4CFBA 3AY9A 4GNIA 2I5JA 3BF3A 4BWMA 2RKIA 3ZETB 5E41A 4JK7A 3LP2A 1RILA 1D9DA 4JI6K 1G99A 5FPEA 3F73A 4C8KA 2E2NA 1C1BA 5B8HA 3THXB 2KZZA 4FWOA 3KD1E 3E66A 3FGUA 1TKTA 4ICLA 3PUFA 1GLEG 3AVAA 4LF5K 1F21A 4E7JA 3EO3A 2P9KA 2QWPA 3R1XA 1Q18A 5J2MA 2O4IA 2HNDA 3RR8A 4FJ9A 3JSMA 4KTZA 1U4BA 2G8FA 4CJPA 4O5FA 1IJJA 4Y1CA 4KFBA 1QVGM 1Y97A 3AGRA 4YHHK 4LH5A 3V9SA 1NK9A 3CYMA 1U45A 1BA1A 2RE2A 4RW8A 4FK0A 3H3OB 1HQEA 5C2FA 1HRHA 4H0YB 4FW1A 3VETA 4JK8A 1RTIA 5J1EA 1M90O 4GV6A 2EX3A 1CZBA 3M5RA 1EWQA 5LMNK 2P9IB 2NRRA 3I33A 3U9DA 2OZMA 2GBZA 3LWLA 1XHXA 5GAEP 4DQIA 5K14A 5FRNA 4JD2B 4CGJA 2QWMA 3LM9A 4EIAA 4I9QA 1VAZA 2QWRA 3L6QA 4FK2A 1NGIA 2A41A 3WQTA 3A5LC 5M1PA 4J2DA 4YFUA 2PFUA 2W6LA 4E89A 4DV1K 1QQCA 4QS9A 3CJ1A 2HHXA 1S22A 3FZLA 3D45A 3K9KA 2HVIA 3OJSA 1BGXT 4J2BA 3VQPA 3L0QA 3CJCA 1SL1A 4Z94A 3O3FA 2I7NA 4KHSA 3D2EA 2CGKA 2Y1JA 5DM7L 4KI6A 2YHXA 2FF6A 1BL3A 2FC0A 3A5MC 4PL7A 4AHRA 1VSLA 5AQQA 3W3DA 3EYZA 1GLBG 3K57A 2DFEA 3WNEA 2D0AA 1HJOA 4L8RB 2OYQA 1BUPA 4IFEA 4RCHA 4DV0K 1NG9A 4Z4EA 4OPHA 4DV7K 5AZIA 1SUQA 2HBLA 4O44A 3TR8A 4K43A 4IO8A 4IBNA 3VGKA 4ISEA 2YNFA 1JLFA 4CJ7A 5AZJB 3HOSA 4CF2A 1N34K 3GOIA 3RSEB 3TTFA 3A5OC 3VOVA 1B9FA 4CZLA 3QEXA 2JWKA 4FZZA 3HZ6A 3ZT1A 4BACA 1S9GA 5AQSA 4DS5A 1NOZA 4CZHA 1I94K 2HHSA 4UQGA 3CMEN 3T1AA 3MMVA 5AQKA 2O8EB 1TL1A 2X74A 3K5OA 4CHPA 2DFFA 4E3SA 2HHWA 5HL7L 1WB9A 1NOYA 4BR5A 3J81O 4BRMA 1RT5A 3KD5E 3N4QA 3ZLJA 4MO5A 3QO9A 4I6MB 3WUHA 5BPMA 1TAQA 4BRIA 3D0PA 1X9SA 3O1WA 4C23A 4DR5K 4OPAA 3G10A 5AR0A 4DUZK 5JS2A 2NRZA 4DTNA 3DXMB 1RBSA 3VTHA 4IEEA 1NGCA 3SCXA 4FLVA 3MEDA 5LMUK 1RGIA 2VWKA 3LDNA 4QS8A 1YF5L 4AHCA 2FLOA 3O3GA 2NLXA 3EKSA 4FLTA 5KTQA 1TVRA 1UA1A 3NF8A 4X66K 3FFIA 3P39A 3VEZA 5AQFA 1M1KO 2Q3SA 4RG8A 4F4KA 1XNQK 2G8VA 3L3VA 3H1QA 4W5OA 2YHBA 4Q5VA 1JLCA 3LDOA 2ZJQL 1KLNA 1JKHA 3ZSXA 3THYB 2KKZA 4CHZA 3OJUA 3THWB 4GVEA 3RRHA 1YIJN 4OX9K 1CZ9A 4Z4FA 4JI1K 2DTUA 4WFNL 1RDCA 4FPAA 1U2VA 5HOOA 4DTRA 4JRQA 2KZMA 1XNRK 1XHZA 3HSTB 2YKNA 3AAQA 2DY4A 2BGGA 4K8ZA 1SAZA 3KLGA 3TANA 2VG6A 5I9EB 2P9NB 1KXPA 3JXUA 4DS4A 4H8KA 4CBWA 3ZCMA 3ULEA 4MQ3A 3VQAA 1ZBIA 3CCLN 5JVGL 2P9SA 5GAHP 1VQNN 3SAFA 3P31A 3I0SA 3H46O 4GV3A 5E26A 1BA0A 2QXLA 1L3SA 4PHTX 3RRGA 1Q81O 1Q9XA 4E1NA 5M1QA 3SBGA 4CF9A 3CCMN 4N56A 3ZSRA 1Z25A 4O8UA 3ASMA 4F2SA 3VEYA 1S1VA 4BGBA 2A1RA 3UKUA 4K0KK 2QKBA 3AVCA 3PX6A 3EE9A 4XH1A 4CFAA 3LPTA 4I2QA 3OYGA 3NCIA 3OA9A 3QLHA 5KRSA 4B9SA 2RPIA 3TAGA 3A0IX 1Q86O 4KI4A 3EY1A 4AILC 3W0LA 1O1WA 4FM0A 2QWLA 2FSNA 3F5TA 2G8HA 3VQ8A 1C6VA 3V1QA 4I9LA 5BREA 4LY7A 3VQ7A 4FPBA 4DTSA 2YI1A 4IJAA 3BZCA 4J8FA 3WNGA 4PQUA 4KKOA 3TSUA 5C25A 3AVBA 3CETA 4A5AA 1Z26A 2HBMA 4CZKA 4KV8A 1XI1A 4OJRA 4EFHA 3PX4A 4WYBA 4ELTA 3G25A 3BEXA 2V52B 3KWGA 3HYFA 1L5UA 1RDAA 2G8UA 1IKXA 2P9PB 2QWQA 4M3WA 4CFCA 3DLEA 3CQYA 4DF8A 3K0SA 3KLEA 3K5LA 1VQLN 2E6LA 3KLFA 3ATVA 1YJNN 5GIPA 3ENOA 4DLGA 3U3GA 1SKSA 4FJ7A 3BZKA 3HPGA 3C0BA 3ZEUA 4ID1A 3OYMA 4AHSA 3K59A 4J2AA 1S5JA 2P9NA 3EE8A 3TI0A 4CESA 4DMNA 3IAYA 2VCPA 2BTFA 1N6QA 4PA1A 1HQUA 2Q97A 4CK2A 1NJIO 3TARA 4FYDA 1C0GA 2IS3A 2DPNA 3O4WA 1WSJA 4IDHA 1ILYA 3DI6A 3DLRA 4MLEA 3M8QA 4JI4K 4B1YB 4DG1A 4CIFA 4AM7A 3ENBA 4BVOA 1BI4A 2YHYA 4BRCA 3SLCA 4BQZA 4YNQA 2J4RA 1BIUA 1VQ6N 1IKWA 4EZ6A 1MWMA 3MEEA
chains in the Genus database with same CATH topology
2W40A 3O9RA 3BUZB 4CD3A 1ATNA 3VF2A 5AQYA 5BRDA 4BG8A 4BR2A 1DKGD 4ILGB 1TYQB 3C7NA 3UKRA 4DQ8A 3QBWA 3GBTA 2AA4A 4AM6A 3ZX2A 5EX5A 2YCHA 4CZGA 2WC9A 1DT9A 2ZF5O 4HTLA 1MWKA 5M1OA 1JJ2M 4BRFA 1U2VB 2P9LB 3A5NC 5AQNA 1V4SA 5BRHA 1XC3A 1ESVA 4OO1J 4XH5A 4BC2A 5AQPA 5JMVA 3O8MA 4XEIA 3MDQA 3OBWA 4F9OA 3ATUA 2HBJA 4I6MA 2WFBA 1WUAA 3FE1A 3C6HA 2W41A 3Q7CA 2FSKA 2FSJA 3G6EN 1NMDA 3AY9A 4GNIA 3J8AA 3EKUA 3BF3A 4ISFA 4WQ4A 3DXMA 2OTLN 3O08A 3ZETB 1YI2N 4JK7A 4BR9A 2IIRA 2D0OA 3ZX3A 3ULEB 3HI0A 3WEEB 1HPMA 3MWTA 3E9LA 4CD1A 1G99A 5FPEA 3O5BA 1H1VA 2E2NA 2QWNA 5B8HA 2P9SB 4FWOA 4UY8O 3E66A 4KH4A 5BN8A 3FGUA 1XQSC 3NVMA 5F2RA 1S72N 3SAGA 3VERA 1K9MO 1GLEG 4IOAL 2CGJA 4L3QA 3KHYA 5AFUH 3WXIA 2ZGZA 3EO3A 2P9KA 3CMAN 2A3ZA 2VWBA 3VPZA 2QWPA 5GINA 3R1XA 4JKBA 1HX1A 1R59O 1Q18A 4JKGB 1VQKN 3KWIA 4CZFA 2CGLA 1YAGA 3CC4N 2WBNA 4BRHA 1K73O 1VQ7N 2HBKA 3A8YA 4O5FA 5JLFA 3R6MA 1IJJA 3CCEN 1TUYA 1QVGM 3AGRA 3C65A 5AQTA 3UKUB 4BRPA 1Z6RA 1NBWA 4NLBA 4H03B 1BA1A 2RE2A 4FOEA 5FPDA 4B9QA 3H3OB 5F1XA 2Q0UA 4FSVA 3TPQA 3IUCA 4H0YB 4FWNA 5C2FA 3FFKB 4JEPA 4B1WB 3VETA 4JK8A 4BR7A 4WFBL 3HOTA 1M90O 4GV6A 4JHDB 1ATRA 3M5RA 4A5BA 2P9IB 4BRQA 2E88A 5GIOA 3CXCM 4MO4A 1BU6O 2NRRA 3I33A 4BRLA 3U9DA 2QEXN 4R79A 3T7ZA 1DEJA 5GAEP 1ZC6A 3CC7N 4DB3A 4JD2B 1ATSA 1OVYA 2QWMA 1CZAN 4WCEL 1TUUA 4IEIA 1K8KB 3D2FA 3LM9A 4FL9A 1VAZA 4EIAA 3P4IA 4CZEA 2QWRA 1GLLO 5AQUA 3L6QA 3U4LA 1NGIA 3LDLA 4A59A 3TSPA 2A41A 3WQTA 3PIOL 1ZBSA 3A5LC 5M1PA 3SAHA 4WFAL 3D7EO 2PFUA 1QQNA 2BH1A 5MLCQ 5EOYA 1RDWX 4QS9A 3CJ1A 1S22A 3H3NO 3FZLA 1KAXA 3T69A 1JCEA 3DXKA 3P38A 2QM1A 3WT0A 3K9KA 3CCVN 1GLFO 3IFRA 1VQ4N 2E2QA 3MN6A 3VGLA 5AQOA 4FWKA 2PBDA 1GLDG 4DHYA 1NGJA 3TTDA 3TU5A 4FOIA 3L0QA 1BWFO 1T6CA 4FWRA 3CJCA 4Z94A 2I7NA 1BDGA 4RTFD 2QI2A 4Y0WA 1GLAG 3D2EA 3DJCA 3ZYYX 2CGKA 5DM7L 1T3VA 2YHXA 4K25A 4A2AA 5CE3A 5JLHA 1EQYA 2FF6A 2IVNA 3B8AX 2ASOA 3A5MC 2Q2RA 3DLLL 1J6ZA 2BUPA 3MCPA 4PL7A 5AQQA 4MDBA 3FZKA 5H1SQ 4YOYA 4GV9A 3W3DA 3ZEUB 2Q36A 3U8XA 4BROA 1GLBG 5CHIA 4JKEA 1YXQA 3H45C 4YOVA 3FZFA 1LOTB 3H6EA 4B1UB 1HJOA 4M7YA 3E9OA 1BUPA 3LDQA 3CC2N 4IFEA 4RCHA 2ITMA 3SK3A 4FVUA 1SQKA 4OPHA 5AZIA 1NGDA 4ILHA 1V4TA 2HBLA 2F7TA 3S41A 3U9ZA 1QZ6A 4K43A 4IO8A 1O13A 3VGKA 2UYTA 4ISEA 2QWOA 4B1ZA 3HM8A 2HF3A 2Q1NA 4KBOA 4CJ7A 5AZJB 3HOSA 2NRVA 3L4IA 3QBXA 2OTJN 3O9QA 4FWMA 5C2DA 1P90A 3GOIA 3RSEB 3TTFA 1JCFA 4IXCA 2YX6A 3A5OC 3VOVA 3CI5A 5EXWA 2E1ZA 3CJAA 4CZLA 2JWKA 2HOEA 2ZWHA 3HZ6A 1VQMN 3CJ9A 1KAYA 5AQSA 4CZHA 1P8ZA 4BQLA 4U7BA 2GTDA 2YHWA 2CH5A 3I56N 2IVOA 3CMEN 3MMVA 2E2PA 2NRWA 5AQKA 3OW2M 3UKRB 2NRXA 3CJ7A 3FZHA 5AQRA 1BO5O 5AQVA 3O80A 3BF1A 4FWQA 3M3ZA 2QTDA 5AQXA 2A6AA 2FXUA 2E2OA 4C1NI 3VMFB 3FR0A 3H1VX 3KZBA 4H5RA 4NLCA 5HL7L 3CF5L 4CZIA 1E4GT 3CHWA 4BR5A 3OHRA 2P9PA 4BRMA 4BRGA 3N4QA 4MO5A 3IKMA 1ZXOA 3O9SA 4I6MB 3WUHA 2I7PA 3VF6A 4BG9A 4DKWA 5BPMA 5BN9A 4BRIA 1WOQA 3UE5A 3O1WA 3FLCO 1Z05A 4C23A 3CCSN 2GWJA 2A5XA 3VF4A 4IO9L 1MDUB 3R8EA 3L4QA 4GY2B 4OPAA 5AR0A 5LY3A 1XUPO 2NRZA 4JAXA 3DXMB 4JKFA 3VTHA 4IEEA 5KPRA 1NGCA 4A57A 3AAPA 1RGIA 4JKAA 3J7ZO 4IJNA 3TSQA 1DGKN 3BP8A 2F9WA 2V7ZA 3LDNA 4QS8A 1YF5L 4XH4A 2FLOA 2NRHA 2NLXA 3CCQN 4K41A 3EKSA 3MK6A 4BR4A 3DAWA 1N8RO 2P9KB 4BRKA 4H0VB 2EWSA 2V7YA 1KQSM 1E4FT 1NGAA 3VTIA 3VEWA 1RFQA 4H0XB 5C15A 3F2KA 1C0FA 2E8AA 3QFPA 1X3NA 4RWTA 3PIPL 2ZJPL 3P39A 3VEZA 2Q31A 3IDHA 5AQFA 1M1KO 4YOWA 3QFUA 1NGEA 3H1QA 1SS6A 4EHUA 5TKYA 3VENA 4IWVA 3ID8A 4JK9A 2D1KA 2E1YA 2P9UA 3LDOA 2ZJQL 4M63C 3MCAB 3SMPA 1EO1A 3M6GA 4IOXA 4YOTA 2KKZA 3LM2A 5BRFA 3UB5A 1TYQA 4GVEA 1W97L 1YIJN 4H0PA 3F9MA 2NNWA 3ZX0A 4BGAA 3I8BA 2HMPA 2GUPA 4WFNL 2NZTA 3CCRN 4A2BA 3HRGA 3GE1A 1RDUA 1YJ9N 4FPAA 1U2VA 4BC4A 2P9LA 1NGHA 2YJFA 2OANA 4FWPA 4PL8A 5HOOA 5DM6L 4WF9L 4BR0A 5F0XA 4JKCA 5C12A 3EZWA 3D2FB 5BPNA 3Q7BA 3CD6N 2VGMA 3GG4A 4JKHA 4HWIA 1YITN 3AAQA 4BVPA 1SAZA 3NMUA 2A40A 3CPWM 3E1YA 2VYPA 3WXLA 3AARA 2P9NB 4BRDA 1KXPA 5I9EB 1QQOA 3JXUA 1BOTO 3EL2A 1HUXA 3MX2A 4QS7A 3ZETA 1VQPN 1W2BM 1NM1A 4ILJA 4BREA 5AQMA 5FPMA 4CBWA 4EAHD 1YJWN 2QW9A 3ULEA 3WEEA 5M1KA 2HF4A 3DXKB 3KK7A 3CIPA 3CCLN 3GDQA 5JVGL 3O9TA 2P9SA 2CH6A 2ZGYA 5GAHP 3SAFA 1VQNN 3P31A 1MA9B 4G9ZA 3H46O 5CR4A 4GV3A 3QB0A 5E26A 5AQGA 1BA0A 2GEMA 2QXLA 4PHTX 1Q81O 4YOUA 5KPZA 3M1FA 4IOCL 1HKGA 4JKGA 4BY9C 5M1QA 3SBGA 3CCMN 2RHKA 1JCGA 5E84A 3LDPA 3SMSA 4O8UA 3D2EB 4H0TB 4A61A 4BRAA 2AP1A 3LL3A 1GLCG 4FWLA 3VEYA 4BGBA 1BG3A 5GAGP 2IVPA 3UKUA 4CBUA 3EE9A 4XH1A 3C7NB 3WQUA 3O6WA 3GL1A 3CCUN 1VQ5N 1YHQN 1NLVA 3JS6A 1T6DA 2HSTA 5M1NA 5KQ8A 3G71N 5TKWA 3OA9A 2QA4N 4FWSA 3K9JA 4JHDA 3VEVA 2P9IA 3WXJA 4CBXA 5BR9A 3A0IX 3DWLA 1Q86O 3W0LA 5AZIB 2ZJRL 5ADXA 2QWLA 3HSCA 2FSNA 3F5TA 4K42A 3WXKA 4NO7A 4JD2A 1SZ2A 3CJBA 5KPTA 5BREA 4YOXA 3AGKA 3VEXA 4DCHA 1K8KA 1QZ5A 2YJEA 2GELA 1HKBA 4JNEA 2KLAA 4FPBA 4WQ5A 5EY4A 1T44A 5AQIA 3R3LA 3QMLA 2YI1A 4PKGA 5AQLA 4IJAA 4CI6A 3SBTA 4H5VA 5M1FA 1QHAA 4J8FA 3OBYA 1NGGA 5LJVA 3G4SN 2NRTA 4KH5A 2JWLA 1GLJO 1KC8O 2E20A 4YDUC 2GWKA 5FPNA 3TSUA 3WXMB 1LCUA 5C10A 4JN4A 3C6AA 5C0YA 3CETA 3KVGA 4A5AA 4B1XB 2HBMA 3HTVA 2PAVA 4MLHA 4CZKA 4IZ9A 3QICA 4H5TA 3IMXA 4EFHA 1Q7YO 4WYBA 1NWKA 1VQON 3G25A 1D4XA 2F9TA 3BEXA 4BC5A 2V52B 1X3MA 3KWGA 4E1JA 5ELZA 2KHOA 1QVFM 4O8KA 4BRNA 3ENHA 1VQ9N 2ASMA 1OKJA 3R9PA 5LJWA 2P9PB 3CQXA 2QWQA 4PKIA 1U6ZA 3CQYA 4H5WA 4CZMA 5AQZA 5AQHA 4AF1A 4NB4A 3E9PA 2GX9A 1K8AO 3HBTA 5JICA 2VGNA 3D6RA 3SJHA 2A42A 3EN9A 3N4PA 3VEOA 1VQLN 3TTCA 1HLUA 3ATVA 4CZJA 2WUSA 5AQWA 1YJNN 5GIPA 2FF3B 3ENOA 5AQJA 3MN7A 4YORA 4ISGA 5ADXH 3C0BA 3CERA 4LC9B 3ZEUA 4PKHA 1Q82O 2V51B 4WQ4C 2D4WA 3VGMA 2P9NA 3EE8A 3QDKA 4C1NK 4H5NA 3PLAA 1HKCA 3I55N 4B1VA 2VCPA 2BTFA 2ASPA 3ID6A 2H3GX 1YVNA 2Q97A 3MN5A 1NJIO 2Q0RA 3NVKA 3MN9A 1C0GA 3FZMA 5EVZA 3O4WA 2DPNA 3RVCA 3O1BA 4JKDA 5JVHL 1VQ8N 5BPLA 4IDHA 1S3XA 5GADP 1ILYA 4A62A 4MLEA 1NGBA 4B1YB 1X9JA 1Y64A 4BC3A 4KH6A 3CCJN 2D0PA 5AZJA 4AM7A 3ENBA 1QQMA 4BVOA 3MWPA 2YHYA 4H0OA 3MX5A 4WQ5C 3SLCA 3RSEA 4BRCA 4BQZA 5AFUA 2J4RA 1YUWA 4MDAA 3O9UA 4U67L 4YDUA 1VQ6N 1KAZA 3VESA 1IG8A 1KD1O 4M7XA 4EHTA 5KQDA 2P9UB 3CPEA 1MWMA 4FO0A 1NGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1P A;  5C2D A;  4IDH A;  5C15 A;  5M1N A;  5M1K A;  5C12 A;  4IEE A;  5M1Q A;  3C6H A;  4IEI A;  5C2F A;  5M1F A;  5C10 A;  3CPE A;  5M1O A;  3C6A A;  4IFE A; 
#chains in the Genus database with same CATH topology
 2Z1G A;  2ATQ A;  1DKG D;  4ILG B;  4CCH A;  4N47 A;  3SI6 A;  4AM6 A;  3ZX2 A;  4N76 A;  2WC9 A;  2ZF5 O;  2YNH A;  5AQN A;  1V4S A;  3DLK A;  5AQP A;  1SKW A;  3OBW A;  3ATU A;  2HBJ A;  3QNN A;  3FE1 A;  4CIG A;  4CJE A;  4RW7 A;  4WQ4 A;  3ZSQ A;  3O08 A;  1YI2 N;  4KHW A;  3ZX3 A;  3WEE B;  1LWC A;  1CXU A;  4CD1 A;  3V1R A;  5CZ2 A;  3O5B A;  1T05 A;  4CGD A;  4UY8 O;  2ETJ A;  1S72 N;  3SAG A;  2QK9 A;  3AO4 A;  4BE0 A;  3AO1 A;  2ZGZ A;  1YTA A;  4KHY A;  4JKB A;  3CFR A;  2HNZ A;  4CJ3 A;  1SKR A;  4CEB A;  3KWI A;  2PY5 A;  3B6O A;  2WBN A;  4WE1 A;  4Q0B A;  4BRH A;  2G8W A;  1QHT A;  4CF0 A;  3KK3 A;  3C65 A;  5AQT A;  4JLH A;  1RT1 A;  4CHN A;  4H03 B;  2GUI A;  1TKZ A;  1TL3 A;  4CVN E;  1HPZ A;  3BGR A;  1ZBL A;  4FSV A;  4M3X A;  4FWN A;  5FRM A;  2O8F A;  1JLB A;  3NBP A;  4JS4 A;  4JHD B;  1ATR A;  3OYA A;  1J5O A;  1IH7 A;  3M8P A;  1TK0 A;  2E88 A;  4MO4 A;  1BU6 O;  2PYJ A;  4BRL A;  3LP3 A;  4DFP A;  2KFZ A;  2HB5 A;  5I42 A;  4CEQ A;  3D2F A;  4FL9 A;  4A59 A;  3TSP A;  1KTQ A;  1ZBS A;  1EXQ A;  3DMJ A;  3D7E O;  3RMA A;  4DV6 K;  1QQN A;  4JI7 K;  1VHX A;  4C8N A;  1NGF A;  3VA0 A;  1JCE A;  1S9E A;  3DXK A;  2QM1 A;  3P38 A;  3CCV N;  1VQ4 N;  2IDO A;  2E2Q A;  3MN6 A;  3OYD A;  3OS0 A;  5AQO A;  5AJ3 K;  3I8D A;  3KK1 A;  4FWK A;  3AVG A;  2PBD A;  2XY5 A;  1GLD G;  2W6K A;  1D9F A;  3KJV A;  4QOZ B;  4JI3 K;  1ZBF A;  1WAJ A;  1UA0 A;  3L8B A;  1BWF O;  1CLQ A;  3OY9 A;  1BDG A;  3V6D A;  3ZYY X;  3DJC A;  4FJL A;  1T3V A;  4K25 A;  4KRE A;  3DLL L;  1ZBU A;  4MDB A;  4GV9 A;  4LFC K;  4BRO A;  2R7Y A;  4JKE A;  4CJF A;  4W5Q A;  3FZF A;  5D3G A;  3H6E A;  1HYV A;  4TSX A;  4B3R K;  1YT3 A;  3E9O A;  4B3T K;  3S41 A;  1NGD A;  1HMV A;  4JRP A;  4DSF A;  1HR0 K;  4OVL A;  4DR4 K;  4LF7 K;  4KBO A;  3ZSO A;  4FWM A;  3NH2 A;  1JCF A;  1RDB A;  3CI5 A;  5EXW A;  2E1Z A;  3CJA A;  5J2Q A;  2GV9 A;  1OH6 A;  2ZWH A;  4OLA A;  4AQY K;  1G15 A;  4DV2 K;  1RTH A;  4U7B A;  5EU7 A;  2GTD A;  5HLF A;  1HNX K;  4LFB K;  2YHW A;  2CH5 A;  1RBU A;  3UKR B;  2NRX A;  3HO1 A;  3FZH A;  4IG0 A;  1BO5 O;  3O80 A;  3M3Z A;  2QTD A;  1XWL A;  5AQX A;  4KHU A;  2FXU A;  4C1N I;  3CF5 L;  3VMF B;  4NLC A;  3H1V X;  4H5R A;  3PO4 A;  1HNI A;  4CZI A;  3DRP A;  1E4G T;  3CHW A;  1XC9 A;  2IAJ A;  1HNV A;  4BRG A;  3IKM A;  1WAF A;  2I7P A;  4DWI A;  2A5X A;  3R8E A;  1FKP A;  4JAX A;  3SJJ A;  3E01 A;  4JKF A;  5KPR A;  3AAP A;  3RMB A;  1J5E K;  4JKA A;  3J7Z O;  4IJN A;  1U04 A;  4DF4 A;  1X1P A;  3TSQ A;  5KRT A;  1DGK N;  1B92 A;  1IKY A;  4XH4 A;  2IOC A;  4K41 A;  3K5N A;  4BR4 A;  2O8D B;  1N8R O;  2D0B A;  3BY5 A;  4B9V A;  2HHU A;  4BRK A;  4H0V B;  4K8X A;  2V7Y A;  3F9K A;  3VTI A;  3VEW A;  3OYL A;  4H0X B;  3QEI A;  5C15 A;  3F2K A;  3PSF A;  3QFP A;  2OPS A;  1IBL K;  4YOW A;  1BQN A;  1NGE A;  4EHU A;  1SS6 A;  4IWV A;  3ID8 A;  2D1K A;  3AO2 A;  1A5V A;  3DYA A;  4IFY A;  4DLE A;  5IT9 O;  4GVM A;  4IOX A;  4YOT A;  1J53 A;  4DTP A;  2NNW A;  3ZX0 A;  3VQD A;  2NZT A;  3HRG A;  3GE1 A;  4H4M A;  1NGH A;  2P9L A;  2YJF A;  3QEP A;  4FWP A;  5DM6 L;  4FCY A;  4JKC A;  4ID5 A;  3EZW A;  1E3M A;  5BPN A;  3CD6 N;  1IBM K;  2VGM A;  4HUE A;  2UXC K;  4HWI A;  4BVP A;  4I7F A;  1N33 K;  4AHT A;  1L3V A;  3J80 O;  3ZT3 A;  4QS7 A;  3ZET A;  3MX2 A;  4CJL A;  1NM1 A;  4ILJ A;  5AQM A;  3OYB A;  1QSS A;  3NH1 A;  4C8O A;  3KK7 A;  3LAN A;  3O3H A;  2Z1J A;  1N5Y A;  3THX A;  2ZGY A;  4B9T A;  4DFM A;  4YY3 K;  2HHT A;  3HT3 A;  4CJT A;  2GEM A;  4YOU A;  4DSL A;  4GKJ K;  2KW4 A;  3M1F A;  4IOC L;  3HXM A;  1HKG A;  4NXN K;  1JLA A;  4BY9 C;  2VG7 A;  2XHB A;  4DQP A;  4CJR A;  2AP1 A;  4FWL A;  3SPZ A;  3NF7 A;  3J7A P;  2LSN A;  1TAU A;  1BG3 A;  5GAG P;  3LZJ A;  4AHV A;  3ULD A;  3SQ1 A;  3K2P A;  1SV5 A;  2OCE A;  3VQE A;  3WQU A;  3O6W A;  4GW6 A;  1YHQ N;  1VRU A;  2FBX A;  2HST A;  4BE1 A;  1JXB A;  2QA4 N;  3K9J A;  4FJG A;  1EKE A;  1BQM A;  1QSY A;  4KHP K;  2P9I A;  3SV3 A;  5BR9 A;  4OKE A;  3VQQ A;  4CEC A;  3CM6 A;  4PWD A;  3L2U A;  4NO7 A;  4JD2 A;  3OYC A;  3CJB A;  5KPT A;  4DSJ A;  4C8L A;  3VEX A;  4DCH A;  2YJE A;  1QZ5 A;  2GEL A;  1HKB A;  4JNE A;  3AVJ A;  4HHT A;  4H5V A;  1HNZ K;  3T19 A;  2NRT A;  5FPN A;  4M3Y A;  3C6A A;  5C0Y A;  3KVG A;  4HCB A;  1BCM A;  3QIC A;  4H5T A;  4KAZ A;  5HP1 A;  2F9T A;  4FXD A;  1X3M A;  3BDP A;  5ELZ A;  2KHO A;  5HRP A;  1QVF M;  1VQ9 N;  1IBK K;  3R9P A;  1K6Y A;  4HCC A;  4DTJ A;  5AQH A;  4NB4 A;  1K8A O;  4FM2 A;  3HBT A;  5JIC A;  3SJH A;  1W0H A;  1VSF A;  3N4P A;  3VEO A;  3AVL A;  1HLU A;  2RN2 A;  3VQ4 A;  1FXX A;  4MFB A;  4FJ5 A;  4F3O A;  5AQW A;  4DV4 K;  2FF3 B;  3PX0 A;  1KRP A;  2UXD K;  3CQ8 A;  5LL6 Z;  4PKH A;  5I3U A;  1YVU A;  4WQ4 C;  2D4W A;  3VGM A;  4CED A;  3SNN A;  1ZBH A;  3PLA A;  4B3O A;  2VWJ A;  3LAK A;  2ZD1 A;  4OKJ A;  5CYQ A;  3MN5 A;  4FLY A;  2Q0R A;  3S3N A;  3MN9 A;  3AVM A;  3KLH A;  3RVC A;  1HJR A;  3O1B A;  4A62 A;  1NGB A;  4O0J A;  5AZJ A;  5CYM A;  4CK3 A;  1QQM A;  3MWP A;  4H0O A;  1KVC A;  4WQ5 C;  2NUB A;  3PSI A;  3RSE A;  1RDD A;  5AFU A;  4E1M A;  4B9L A;  1YUW A;  4MDA A;  4U67 L;  4DU3 A;  3T3F A;  3C6T A;  3KKR A;  1KD1 O;  4M7X A;  2P9U B;  1S1X A;  1A5W A;  1ATN A;  3NFA A;  5AQY A;  4CF8 A;  4NXM K;  4BR2 A;  2O8E A;  1TYQ B;  5BR8 K;  4M3Z A;  1C0U A;  2AA4 A;  4O0I A;  4Y1D A;  5HRN A;  4EP5 A;  4HTL A;  1JJ2 M;  3HM9 A;  2BAN A;  3A5N C;  1XC3 A;  3RMD A;  4I2P A;  4OO1 J;  4XH5 A;  3VQ9 A;  3KKS A;  3TAE A;  3MDQ A;  4I6M A;  3T1Y K;  2W41 A;  2IC3 A;  3G6E N;  1NMD A;  3EKU A;  1C0M A;  4ISF A;  2HHV A;  3DXM A;  1R0A A;  2UXB K;  2IIR A;  2D0O A;  3SV4 A;  2WOM A;  1I39 A;  3ZSY A;  1H1V A;  5BN8 A;  1XQS C;  1WSI A;  2BE2 A;  2CGJ A;  3ITH A;  1VSI A;  3KHY A;  3WXI A;  3CMA N;  2A3Z A;  3VPZ A;  5GIN A;  5J2P A;  1R59 O;  4Z4I A;  4JKG B;  4W5N A;  4DV5 K;  5FRO A;  5SWM A;  2O8B B;  4CZF A;  1YAG A;  4H4O A;  3CC4 N;  4FJK A;  1VQ7 N;  2HBK A;  2O8C B;  4NCG A;  3A8Y A;  3R6M A;  3CCE N;  2XY7 A;  1TUY A;  3CM5 A;  5KI6 A;  4BRP A;  1Z6R A;  1NBW A;  5CZ1 A;  3HK2 A;  2Z1H A;  4FOE A;  1NJW A;  5FPD A;  5F1X A;  4M41 A;  2Q0U A;  3TPQ A;  4JEP A;  3SYZ A;  4B1W B;  2OPR A;  4BR7 A;  3HOT A;  4BDP A;  4FLW A;  4CER A;  4PY5 A;  1NU0 A;  3NH0 A;  3THY A;  3ZSV A;  4BRQ A;  1TV6 A;  1NJZ A;  3THW A;  3DOL A;  2YV0 X;  2QEX N;  4R79 A;  3MEG A;  2HHH K;  4N5S A;  3SUO A;  1ZC6 A;  3CC7 N;  4DB3 A;  1ATS A;  4WCE L;  1TUU A;  4B3M K;  3QET A;  1K8K B;  3AVH A;  1GLL O;  4DTU A;  3U4L A;  4KO0 A;  3SAH A;  4WFA L;  3M8S A;  4FJN A;  1WBB A;  3RWU A;  3NE6 A;  5MLC Q;  1JXE A;  1RDW X;  2JLE A;  3LDS A;  3THV A;  1KAX A;  3T69 A;  3WT0 A;  3KK2 A;  3LWM A;  3I0R A;  4E19 A;  1NGJ A;  3TTD A;  4FOI A;  1KFD A;  3RTV A;  1C1A A;  3AVN A;  3NAE A;  4OPJ A;  2QI2 A;  4Y0W A;  4A2A A;  5CE3 A;  5JLH A;  3QER A;  1EQY A;  1UOC A;  1J6Z A;  3MCP A;  1REV A;  4YOY A;  3FZK A;  3OYE A;  4OPK A;  4OLB A;  2Q36 A;  3DLH A;  5CHI A;  1IV0 A;  1ITG A;  3H45 C;  1XMO K;  4YOV A;  1KCF A;  4EZ9 A;  2KTQ A;  4M7Y A;  3V9W A;  3LDQ A;  3CC2 N;  4G1Q A;  3U3Y A;  2ITM A;  4FVU A;  4CJ5 A;  1V4T A;  4DR3 K;  2F7T A;  4OKK A;  1X9W A;  3U9Z A;  1EP4 A;  2UYT A;  4FJ8 A;  5FLX O;  3PO5 A;  1LAV A;  2HF3 A;  2Q1N A;  1Q9Y A;  1HYS A;  3QBX A;  3L4I A;  3O9Q A;  1WN7 A;  4IXC A;  2YX6 A;  3TAM A;  4RW4 A;  1S6Q A;  1VQM N;  3CJ9 A;  1L3T A;  4CEZ A;  4LF9 K;  1P8Z A;  3A2F A;  4RW6 A;  2G8K A;  3I56 N;  3V4I A;  2IVO A;  3P83 D;  1L3U A;  3LZI A;  4M45 A;  3B6P A;  4DTO A;  3K58 A;  5AQR A;  2EHG A;  4CW7 B;  3C6U A;  3C94 A;  3BF1 A;  4FWQ A;  4CGH A;  2X6S A;  2A6A A;  2E2O A;  3FR0 A;  3KZB A;  4M3U A;  1TKX A;  1FKO A;  2P9P A;  1A5X A;  3IG1 A;  1ZXO A;  4BG9 A;  3VF6 A;  4DKW A;  5BN9 A;  3UE5 A;  3CCS N;  3O4N A;  2GWJ A;  3DRS A;  3VF4 A;  5SZT A;  4GY2 B;  1XUP O;  1N36 K;  1FK9 A;  5HBM A;  4A57 A;  1RTJ A;  3MXJ A;  4CGG A;  5DMR A;  1WNS A;  3HP6 A;  3BP8 A;  2F9W A;  4CJ4 A;  2RF2 A;  4NCA A;  3CFP A;  3NGZ A;  2VG5 A;  3DAW A;  1MU2 A;  2P9K B;  4XIU A;  4CEF A;  2EWS A;  1KQS M;  4IG3 A;  1C0T A;  1E4F T;  1NK4 A;  3S3M A;  1C0F A;  2E8A A;  1NK6 A;  3NDK A;  2Q31 A;  3IDH A;  4JS5 A;  2XY6 A;  4FK4 A;  3QFU A;  4E0D A;  5TKY A;  2E1Y A;  3SUN A;  1WSG A;  4M63 C;  1RBR A;  3SMP A;  3LM2 A;  2XO7 A;  5BRF A;  4FLU A;  5CY4 A;  3L2W A;  2OPQ A;  4KRF A;  3F9M A;  4FW2 A;  3V9X A;  2GUP A;  5HRS A;  4A2B A;  1YJ9 N;  1RDU A;  4BC4 A;  4E7L A;  2E4L A;  4HTU A;  4CJK A;  4KB1 A;  1VSM A;  4KB0 A;  4WF9 L;  3QIP A;  4FJI A;  5C12 A;  4O4G A;  4CHO A;  3Q7B A;  3GG4 A;  4JKH A;  1YIT N;  2ZQB A;  4DFJ A;  2XRI A;  3NMU A;  2VYP A;  1QSL A;  3AAR A;  4Z4H A;  1BOT O;  3EL2 A;  1ASW A;  4EAH D;  2X6N A;  3WEE A;  4BE2 A;  2F4V K;  4CJV A;  3GDQ A;  2BDP A;  4E7I A;  4LSN A;  2X78 A;  3HP9 A;  3OYH A;  5CR4 A;  3RMC A;  3QB0 A;  2ZM6 K;  4M3R A;  2D0C A;  3QEW A;  3OS1 A;  5KPZ A;  4DSK A;  1TK8 A;  5E84 A;  4KHN A;  3LDP A;  1NMN A;  3D2E B;  4A61 A;  4BRA A;  3PY8 A;  3LL3 A;  1GLC G;  3AVI A;  4DUY K;  1RCH A;  1VSH A;  2IVP A;  1NK7 A;  3C7N B;  1TKD A;  3DLG A;  3CCU N;  4B9N A;  1JLG A;  3GL1 A;  1KSP A;  1NLV A;  1SL0 A;  1T6D A;  5M1N A;  5KQ8 A;  1QE1 A;  1DTT A;  5TKW A;  4FWS A;  4JHD A;  3QEV A;  2HNY A;  1KVA A;  3VEV A;  3DWL A;  3PV8 A;  4HUG A;  2G8I A;  4FJM A;  5AZI B;  2ZJR L;  3TAQ A;  3AA2 A;  5ADX A;  1WSF A;  3MAQ A;  4JV5 K;  3HSC A;  4K42 A;  2F8S A;  4JI2 K;  4YOX A;  2VQE K;  1D8Y A;  2KLA A;  1C1C A;  1EX4 A;  1RT2 A;  3OYI A;  3R3L A;  3AA3 A;  4X64 K;  1TGO A;  3OBY A;  2UUB K;  3V9U A;  4CJU A;  1GLJ O;  1KC8 O;  2E20 A;  2GWK A;  5C10 A;  4JN4 A;  4B1X B;  3S9H A;  2UU9 K;  2PAV A;  4MLH A;  1YTU A;  4IZ9 A;  5IWA K;  3IMX A;  3U6F A;  1NWK A;  1VQO N;  4OGE A;  4NYN A;  3VA3 A;  4E1J A;  4CEA A;  2Z1I A;  4O8K A;  4BRN A;  2ASM A;  1OKJ A;  1TK5 A;  4CZM A;  3E9P A;  4J2E A;  2VGN A;  3EN9 A;  3JYT A;  3NHG A;  4QCL A;  4FZX C;  3VQC A;  4CZJ A;  2WUS A;  5A2Q O;  2A1S A;  3SUQ A;  5AQJ A;  1S1U A;  3MN7 A;  1HYZ A;  4AH9 A;  4ZHR A;  4CJQ A;  3CER A;  2KQ2 A;  3OYN A;  4DTM A;  4PUO A;  4C1N K;  4GKK K;  1IG9 A;  4KTQ A;  4H5N A;  1HKC A;  4B1V A;  5FDL A;  2ASP A;  3ID6 A;  4DSI A;  4EP4 A;  2H3G X;  1YVN A;  1VSJ A;  2P5O A;  4DQR A;  2FBY A;  1LWE A;  5EVZ A;  4KHQ A;  1VQ8 N;  1S3X A;  3CG7 A;  2OPP A;  4ELU A;  3NGY A;  1T7P A;  1U47 A;  3MX5 A;  4FLZ A;  3M8R A;  3DM2 A;  4DV3 K;  4YDU A;  4B8C A;  2UUA K;  1KAZ A;  1DLO A;  4ZTJ A;  1DTQ A;  4EHT A;  1BHL A;  1UAX A;  5AQV A;  2W40 A;  3KTQ A;  1BCO A;  3BUZ B;  3O9R A;  2YNI A;  3VF2 A;  3T1H K;  5C42 A;  3UKR A;  1CXQ A;  3C7N A;  4DFK A;  3IS9 A;  3QIN A;  2PYL A;  4CZG A;  1DT9 A;  1WSE A;  3LAL A;  1D5A A;  4BDY A;  1U2V B;  3JAM O;  5BRH A;  1ESV A;  3H08 A;  4NYF A;  2B5J A;  3AVF A;  3O8M A;  4XEI A;  4F9O A;  2P51 A;  5T7B A;  2WFB A;  1WUA A;  4CIE A;  2FSK A;  4CE9 A;  2FSJ A;  2OA8 A;  3J8A A;  3MEC A;  2OTL N;  4BR9 A;  3ULE B;  3HI0 A;  3HVR A;  1HPM A;  3MWT A;  3E9L A;  4E7K A;  2B6A A;  2QWN A;  2P9S B;  4KH4 A;  1BIS A;  3NVM A;  5F2R A;  4Z4G A;  3VER A;  4KTW A;  3QNO A;  1K9M O;  4IOA L;  5AFU H;  4L3Q A;  4DU1 A;  2O8D A;  2VWB A;  1QS4 A;  4NCB A;  3ISN C;  1HX1 A;  3RR7 A;  4CHQ A;  3OYJ A;  1VQK N;  3OTO K;  4ZTF A;  2IGI A;  2CGL A;  1K73 O;  2HMI A;  3SQ2 A;  4DR7 K;  5JLF A;  3S3O A;  3NF6 A;  2QKK A;  3EZ5 A;  4M3T A;  3UKU B;  4NLB A;  5J2N A;  4B9Q A;  3IUC A;  1NKE A;  1JLE A;  3FFK B;  3LAM A;  4WFB L;  2AJQ A;  4DU4 A;  4A5B A;  1SL2 A;  5GIO A;  3CXC M;  5HRR A;  3ZSW A;  1N32 K;  3T7Z A;  3DRR A;  1DEJ A;  3KIO A;  1OVY A;  3TAB A;  1CZA N;  1OH7 A;  4IEI A;  3AV9 A;  4CGF A;  3P4I A;  4CZE A;  5AQU A;  4BDZ A;  3LDL A;  3PIO L;  1RT6 A;  4RW9 A;  1WSH A;  2BH1 A;  5EOY A;  4F8R A;  4FM1 A;  3AVK A;  4FLX A;  2JGU A;  2ZE2 A;  3H3N O;  2YNG A;  4CFD A;  1GLF O;  3IFR A;  1GOB A;  3WNH A;  3VGL A;  1UWB A;  3DOK A;  4DHY A;  4KPY A;  3TU5 A;  1S1T A;  4FJJ A;  3EEQ A;  4FJH A;  1T6C A;  4FWR A;  4LSL A;  4Z0U A;  4CJW A;  4RTF D;  4W5T A;  1GLA G;  4CJS A;  4IFV A;  2IVN A;  3B8A X;  2ASO A;  1S6P A;  2Q2R A;  3MXM A;  2BUP A;  5H1S Q;  3ZEU B;  3U8X A;  1NJX A;  4LF4 K;  1YXQ A;  3QES A;  1LOT B;  1J9A A;  4X65 K;  3ZT4 A;  4B1U B;  1U48 A;  4JI0 K;  3SK3 A;  1SQK A;  4ILH A;  1QZ6 A;  1O13 A;  1RT4 A;  2QWO A;  4B1Z A;  4CEE A;  3HM8 A;  1NKB A;  2NRV A;  4Z4C A;  2OTJ N;  1ASU A;  5C2D A;  1BI4 B;  1P90 A;  2E6M A;  3ZT0 A;  4FVM A;  1X9M A;  1T03 A;  2HOE A;  1KAY A;  4JI8 K;  4BQL A;  4CGI A;  4CEO A;  3IRX A;  2E2P A;  2NRW A;  3OW2 M;  3CJ7 A;  5KGX A;  3UIQ A;  4E7H A;  4LF8 K;  4LF6 K;  1NK5 A;  2Y1I A;  3OS2 A;  1EET A;  4M42 A;  3HL8 A;  3OHR A;  1I3A A;  3L3U A;  3O9S A;  4FZY A;  3CFO A;  1WOQ A;  2HVH A;  3FLC O;  1Z05 A;  4LD0 A;  2KFN A;  4IO9 L;  1RT3 A;  1MDU B;  1JL1 A;  1LW0 A;  3L4Q A;  1GOC A;  5LY3 A;  3QIO A;  4C8M A;  1NK8 A;  1VSE A;  2V7Z A;  1RT7 A;  4LH4 A;  4V19 S;  4JYA K;  2NRH A;  3CCQ N;  1W9H A;  1VK0 A;  3MK6 A;  3MXI A;  1FJG K;  4ELV A;  3ZT2 A;  1NGA A;  3ZSZ A;  2E5L K;  1RFQ A;  4RWT A;  1X3N A;  3LP0 A;  3PIP L;  2ZJP L;  3SQ4 A;  3VQB A;  4DTX A;  1W7A A;  3VEN A;  3AO5 A;  4JK9 A;  3TAF A;  4F2R A;  2P9U A;  1FW6 A;  2O8F B;  3MCA B;  1EO1 A;  3M6G A;  2D5R A;  1BIZ A;  1OVQ A;  4AHU A;  3UB5 A;  1TYQ A;  4DR6 K;  1LAW A;  1W97 L;  4H0P A;  3OYF A;  1U49 A;  4B3S K;  4BGA A;  3I8B A;  2HMP A;  4DR1 K;  3CCR N;  3TWH A;  2DFH A;  2OAN A;  3NF9 A;  4PL8 A;  2B4J A;  3L2Q A;  3SUP A;  4BR0 A;  3AO3 A;  5F0X A;  1JL2 A;  3OVN A;  4F3T A;  3D2F B;  5JS1 A;  4DQS A;  4W5R A;  2O4G A;  2HHQ A;  5KGW A;  2A40 A;  3CPW M;  3E1Y A;  3WXL A;  4BRD A;  1IKV A;  4CHY A;  1QQO A;  3V1O A;  1HUX A;  3L2R A;  2W42 A;  1VQP N;  1W2B M;  4BRE A;  5FPM A;  1VSK A;  1YJW N;  3SZ2 A;  2QW9 A;  5M1K A;  2P5G A;  2HF4 A;  3DXK B;  1NNE A;  3CIP A;  1WBD A;  2ITG A;  4O55 A;  4B08 A;  2OZS A;  3O9T A;  2CH6 A;  1MA9 B;  3HVT A;  1T8E A;  4G9Z A;  1LW2 A;  5AQG A;  1QTM A;  2XY8 A;  3WNF A;  1OH5 A;  1ZYQ A;  2FBT A;  4JKG A;  2RHK A;  1JCG A;  2O8B A;  3J7Y P;  3G0Z A;  3SMS A;  4H0T B;  4CK1 A;  4FJX A;  2O8C A;  1GOA A;  3HPO A;  2F8T A;  4HUF A;  1WLJ A;  4CBU A;  3K5M A;  3AA4 A;  1VQ5 N;  3JS6 A;  3LP1 A;  3G71 N;  2WTU A;  4R5P A;  4CBX A;  3SPY A;  3WXJ A;  2UUC K;  1KFS A;  1Q8I A;  3WXK A;  1SZ2 A;  3AGK A;  1XMQ K;  1KLM A;  1K8K A;  4LFA K;  3VN5 A;  4CF1 A;  4WQ5 A;  5EY4 A;  1T44 A;  3C95 A;  5AQI A;  3L2V A;  4OGC A;  3QML A;  4PKG A;  5AQL A;  4CI6 A;  1J54 A;  3SBT A;  5M1F A;  1QHA A;  4QAG A;  2PZS A;  3HPH A;  3VQ5 A;  1NGG A;  5LJV A;  1IO2 A;  3DLB A;  3G4S N;  4KH5 A;  2JWL A;  4N41 A;  4YDU C;  3WXM B;  4DQQ A;  2FBV A;  1JLQ A;  1LCU A;  1NKC A;  5C24 A;  3HTV A;  1RNH A;  2YKM A;  3NGI A;  1Q7Y O;  1D4X A;  4BC5 A;  5HRO A;  2VQF K;  3ENH A;  3SQ0 A;  5LJW A;  3CQX A;  4PKI A;  1U6Z A;  4H5W A;  1OH8 A;  5AQZ A;  4AF1 A;  2GX9 A;  3V81 A;  3D6R A;  2A42 A;  4B8A B;  3LPU A;  4DSE A;  3TTC A;  4DR2 K;  2WON A;  1B9D A;  1HNW K;  4YOR A;  4ISG A;  5ADX H;  4LC9 B;  3KLI A;  1Q82 O;  2V51 B;  3QDK A;  3I55 N;  1VRT A;  1LV5 A;  3NVK A;  5DK5 A;  1RBV A;  3FZM A;  5JVH L;  4JKD A;  3HJF A;  5BPL A;  5GAD P;  4B9U A;  1NJY A;  1RTD A;  4BC3 A;  1X9J A;  1Y64 A;  3CCJ N;  4KH6 A;  2D0P A;  2YHA A;  2P1J A;  4GMJ B;  3ALY A;  4O5B A;  1KVB A;  1VSD A;  4IKF A;  3AA5 X;  3O9U A;  1NK0 A;  3P1G A;  3OYK A;  4JI5 K;  4HVJ A;  3VES A;  1S1W A;  1IG8 A;  2QXF A;  5KQD A;  3CPE A;  4FO0 A;  4BWJ A;  4CD3 A;  5BRD A;  4X62 K;  4BG8 A;  3P5J A;  3VQ6 A;  4DQ8 A;  3QBW A;  3GBT A;  5EX5 A;  4B9M A;  1ASV A;  2YCH A;  5M1O A;  1MWK A;  4IDK A;  1EWR A;  2F96 A;  4BRF A;  2P9L B;  1RBT A;  4BC2 A;  3V9Z A;  5JMV A;  1LWF A;  2HW3 A;  3C6H A;  3TAP A;  3O4Q A;  3Q7C A;  4CFB A;  3AY9 A;  4GNI A;  2I5J A;  3BF3 A;  4BWM A;  2RKI A;  3ZET B;  5E41 A;  4JK7 A;  3LP2 A;  1RIL A;  1D9D A;  4JI6 K;  1G99 A;  5FPE A;  3F73 A;  4C8K A;  2E2N A;  1C1B A;  5B8H A;  3THX B;  2KZZ A;  4FWO A;  3KD1 E;  3E66 A;  3FGU A;  1TKT A;  4ICL A;  3PUF A;  1GLE G;  3AVA A;  4LF5 K;  1F21 A;  4E7J A;  3EO3 A;  2P9K A;  2QWP A;  3R1X A;  1Q18 A;  5J2M A;  2O4I A;  2HND A;  3RR8 A;  4FJ9 A;  3JSM A;  4KTZ A;  1U4B A;  2G8F A;  4CJP A;  4O5F A;  1IJJ A;  4Y1C A;  4KFB A;  1QVG M;  1Y97 A;  3AGR A;  4YHH K;  4LH5 A;  3V9S A;  1NK9 A;  3CYM A;  1U45 A;  1BA1 A;  2RE2 A;  4RW8 A;  4FK0 A;  3H3O B;  1HQE A;  5C2F A;  1HRH A;  4H0Y B;  4FW1 A;  3VET A;  4JK8 A;  1RTI A;  5J1E A;  1M90 O;  4GV6 A;  2EX3 A;  1CZB A;  3M5R A;  1EWQ A;  5LMN K;  2P9I B;  2NRR A;  3I33 A;  3U9D A;  2OZM A;  2GBZ A;  3LWL A;  1XHX A;  5GAE P;  4DQI A;  5K14 A;  5FRN A;  4JD2 B;  4CGJ A;  2QWM A;  3LM9 A;  4EIA A;  4I9Q A;  1VAZ A;  2QWR A;  3L6Q A;  4FK2 A;  1NGI A;  2A41 A;  3WQT A;  3A5L C;  5M1P A;  4J2D A;  4YFU A;  2PFU A;  2W6L A;  4E89 A;  4DV1 K;  1QQC A;  4QS9 A;  3CJ1 A;  2HHX A;  1S22 A;  3FZL A;  3D45 A;  3K9K A;  2HVI A;  3OJS A;  1BGX T;  4J2B A;  3VQP A;  3L0Q A;  3CJC A;  1SL1 A;  4Z94 A;  3O3F A;  2I7N A;  4KHS A;  3D2E A;  2CGK A;  2Y1J A;  5DM7 L;  4KI6 A;  2YHX A;  2FF6 A;  1BL3 A;  2FC0 A;  3A5M C;  4PL7 A;  4AHR A;  1VSL A;  5AQQ A;  3W3D A;  3EYZ A;  1GLB G;  3K57 A;  2DFE A;  3WNE A;  2D0A A;  1HJO A;  4L8R B;  2OYQ A;  1BUP A;  4IFE A;  4RCH A;  4DV0 K;  1NG9 A;  4Z4E A;  4OPH A;  4DV7 K;  5AZI A;  1SUQ A;  2HBL A;  4O44 A;  3TR8 A;  4K43 A;  4IO8 A;  4IBN A;  3VGK A;  4ISE A;  2YNF A;  1JLF A;  4CJ7 A;  5AZJ B;  3HOS A;  4CF2 A;  1N34 K;  3GOI A;  3RSE B;  3TTF A;  3A5O C;  3VOV A;  1B9F A;  4CZL A;  3QEX A;  2JWK A;  4FZZ A;  3HZ6 A;  3ZT1 A;  4BAC A;  1S9G A;  5AQS A;  4DS5 A;  1NOZ A;  4CZH A;  1I94 K;  2HHS A;  4UQG A;  3CME N;  3T1A A;  3MMV A;  5AQK A;  2O8E B;  1TL1 A;  2X74 A;  3K5O A;  4CHP A;  2DFF A;  4E3S A;  2HHW A;  5HL7 L;  1WB9 A;  1NOY A;  4BR5 A;  3J81 O;  4BRM A;  1RT5 A;  3KD5 E;  3N4Q A;  3ZLJ A;  4MO5 A;  3QO9 A;  4I6M B;  3WUH A;  5BPM A;  1TAQ A;  4BRI A;  3D0P A;  1X9S A;  3O1W A;  4C23 A;  4DR5 K;  4OPA A;  3G10 A;  5AR0 A;  4DUZ K;  5JS2 A;  2NRZ A;  4DTN A;  3DXM B;  1RBS A;  3VTH A;  4IEE A;  1NGC A;  3SCX A;  4FLV A;  3MED A;  5LMU K;  1RGI A;  2VWK A;  3LDN A;  4QS8 A;  1YF5 L;  4AHC A;  2FLO A;  3O3G A;  2NLX A;  3EKS A;  4FLT A;  5KTQ A;  1TVR A;  1UA1 A;  3NF8 A;  4X66 K;  3FFI A;  3P39 A;  3VEZ A;  5AQF A;  1M1K O;  2Q3S A;  4RG8 A;  4F4K A;  1XNQ K;  2G8V A;  3L3V A;  3H1Q A;  4W5O A;  2YHB A;  4Q5V A;  1JLC A;  3LDO A;  2ZJQ L;  1KLN A;  1JKH A;  3ZSX A;  3THY B;  2KKZ A;  4CHZ A;  3OJU A;  3THW B;  4GVE A;  3RRH A;  1YIJ N;  4OX9 K;  1CZ9 A;  4Z4F A;  4JI1 K;  2DTU A;  4WFN L;  1RDC A;  4FPA A;  1U2V A;  5HOO A;  4DTR A;  4JRQ A;  2KZM A;  1XNR K;  1XHZ A;  3HST B;  2YKN A;  3AAQ A;  2DY4 A;  2BGG A;  4K8Z A;  1SAZ A;  3KLG A;  3TAN A;  2VG6 A;  5I9E B;  2P9N B;  1KXP A;  3JXU A;  4DS4 A;  4H8K A;  4CBW A;  3ZCM A;  3ULE A;  4MQ3 A;  3VQA A;  1ZBI A;  3CCL N;  5JVG L;  2P9S A;  5GAH P;  1VQN N;  3SAF A;  3P31 A;  3I0S A;  3H46 O;  4GV3 A;  5E26 A;  1BA0 A;  2QXL A;  1L3S A;  4PHT X;  3RRG A;  1Q81 O;  1Q9X A;  4E1N A;  5M1Q A;  3SBG A;  4CF9 A;  3CCM N;  4N56 A;  3ZSR A;  1Z25 A;  4O8U A;  3ASM A;  4F2S A;  3VEY A;  1S1V A;  4BGB A;  2A1R A;  3UKU A;  4K0K K;  2QKB A;  3AVC A;  3PX6 A;  3EE9 A;  4XH1 A;  4CFA A;  3LPT A;  4I2Q A;  3OYG A;  3NCI A;  3OA9 A;  3QLH A;  5KRS A;  4B9S A;  2RPI A;  3TAG A;  3A0I X;  1Q86 O;  4KI4 A;  3EY1 A;  4AIL C;  3W0L A;  1O1W A;  4FM0 A;  2QWL A;  2FSN A;  3F5T A;  2G8H A;  3VQ8 A;  1C6V A;  3V1Q A;  4I9L A;  5BRE A;  4LY7 A;  3VQ7 A;  4FPB A;  4DTS A;  2YI1 A;  4IJA A;  3BZC A;  4J8F A;  3WNG A;  4PQU A;  4KKO A;  3TSU A;  5C25 A;  3AVB A;  3CET A;  4A5A A;  1Z26 A;  2HBM A;  4CZK A;  4KV8 A;  1XI1 A;  4OJR A;  4EFH A;  3PX4 A;  4WYB A;  4ELT A;  3G25 A;  3BEX A;  2V52 B;  3KWG A;  3HYF A;  1L5U A;  1RDA A;  2G8U A;  1IKX A;  2P9P B;  2QWQ A;  4M3W A;  4CFC A;  3DLE A;  3CQY A;  4DF8 A;  3K0S A;  3KLE A;  3K5L A;  1VQL N;  2E6L A;  3KLF A;  3ATV A;  1YJN N;  5GIP A;  3ENO A;  4DLG A;  3U3G A;  1SKS A;  4FJ7 A;  3BZK A;  3HPG A;  3C0B A;  3ZEU A;  4ID1 A;  3OYM A;  4AHS A;  3K59 A;  4J2A A;  1S5J A;  2P9N A;  3EE8 A;  3TI0 A;  4CES A;  4DMN A;  3IAY A;  2VCP A;  2BTF A;  1N6Q A;  4PA1 A;  1HQU A;  2Q97 A;  4CK2 A;  1NJI O;  3TAR A;  4FYD A;  1C0G A;  2IS3 A;  2DPN A;  3O4W A;  1WSJ A;  4IDH A;  1ILY A;  3DI6 A;  3DLR A;  4MLE A;  3M8Q A;  4JI4 K;  4B1Y B;  4DG1 A;  4CIF A;  4AM7 A;  3ENB A;  4BVO A;  1BI4 A;  2YHY A;  4BRC A;  3SLC A;  4BQZ A;  4YNQ A;  2J4R A;  1BIU A;  1VQ6 N;  1IKW A;  4EZ6 A;  1MWM A;  3MEE A; 
#chains in the Genus database with same CATH homology
 2W40 A;  3O9R A;  3BUZ B;  4CD3 A;  1ATN A;  3VF2 A;  5AQY A;  5BRD A;  4BG8 A;  4BR2 A;  1DKG D;  4ILG B;  1TYQ B;  3C7N A;  3UKR A;  4DQ8 A;  3QBW A;  3GBT A;  2AA4 A;  4AM6 A;  3ZX2 A;  5EX5 A;  2YCH A;  4CZG A;  2WC9 A;  1DT9 A;  2ZF5 O;  4HTL A;  1MWK A;  5M1O A;  1JJ2 M;  4BRF A;  1U2V B;  2P9L B;  3A5N C;  5AQN A;  1V4S A;  5BRH A;  1XC3 A;  1ESV A;  4OO1 J;  4XH5 A;  4BC2 A;  5AQP A;  5JMV A;  3O8M A;  4XEI A;  3MDQ A;  3OBW A;  4F9O A;  3ATU A;  2HBJ A;  4I6M A;  2WFB A;  1WUA A;  3FE1 A;  3C6H A;  2W41 A;  3Q7C A;  2FSK A;  2FSJ A;  3G6E N;  1NMD A;  3AY9 A;  4GNI A;  3J8A A;  3EKU A;  3BF3 A;  4ISF A;  4WQ4 A;  3DXM A;  2OTL N;  3O08 A;  3ZET B;  1YI2 N;  4JK7 A;  4BR9 A;  2IIR A;  2D0O A;  3ZX3 A;  3ULE B;  3HI0 A;  3WEE B;  1HPM A;  3MWT A;  3E9L A;  4CD1 A;  1G99 A;  5FPE A;  3O5B A;  1H1V A;  2E2N A;  2QWN A;  5B8H A;  2P9S B;  4FWO A;  4UY8 O;  3E66 A;  4KH4 A;  5BN8 A;  3FGU A;  1XQS C;  3NVM A;  5F2R A;  1S72 N;  3SAG A;  3VER A;  1K9M O;  1GLE G;  4IOA L;  2CGJ A;  4L3Q A;  3KHY A;  5AFU H;  3WXI A;  2ZGZ A;  3EO3 A;  2P9K A;  3CMA N;  2A3Z A;  2VWB A;  3VPZ A;  2QWP A;  5GIN A;  3R1X A;  4JKB A;  1HX1 A;  1R59 O;  1Q18 A;  4JKG B;  1VQK N;  3KWI A;  4CZF A;  2CGL A;  1YAG A;  3CC4 N;  2WBN A;  4BRH A;  1K73 O;  1VQ7 N;  2HBK A;  3A8Y A;  4O5F A;  5JLF A;  3R6M A;  1IJJ A;  3CCE N;  1TUY A;  1QVG M;  3AGR A;  3C65 A;  5AQT A;  3UKU B;  4BRP A;  1Z6R A;  1NBW A;  4NLB A;  4H03 B;  1BA1 A;  2RE2 A;  4FOE A;  5FPD A;  4B9Q A;  3H3O B;  5F1X A;  2Q0U A;  4FSV A;  3TPQ A;  3IUC A;  4H0Y B;  4FWN A;  5C2F A;  3FFK B;  4JEP A;  4B1W B;  3VET A;  4JK8 A;  4BR7 A;  4WFB L;  3HOT A;  1M90 O;  4GV6 A;  4JHD B;  1ATR A;  3M5R A;  4A5B A;  2P9I B;  4BRQ A;  2E88 A;  5GIO A;  3CXC M;  4MO4 A;  1BU6 O;  2NRR A;  3I33 A;  4BRL A;  3U9D A;  2QEX N;  4R79 A;  3T7Z A;  1DEJ A;  5GAE P;  1ZC6 A;  3CC7 N;  4DB3 A;  4JD2 B;  1ATS A;  1OVY A;  2QWM A;  1CZA N;  4WCE L;  1TUU A;  4IEI A;  1K8K B;  3D2F A;  3LM9 A;  4FL9 A;  1VAZ A;  4EIA A;  3P4I A;  4CZE A;  2QWR A;  1GLL O;  5AQU A;  3L6Q A;  3U4L A;  1NGI A;  3LDL A;  4A59 A;  3TSP A;  2A41 A;  3WQT A;  3PIO L;  1ZBS A;  3A5L C;  5M1P A;  3SAH A;  4WFA L;  3D7E O;  2PFU A;  1QQN A;  2BH1 A;  5MLC Q;  5EOY A;  1RDW X;  4QS9 A;  3CJ1 A;  1S22 A;  3H3N O;  3FZL A;  1KAX A;  3T69 A;  1JCE A;  3DXK A;  3P38 A;  2QM1 A;  3WT0 A;  3K9K A;  3CCV N;  1GLF O;  3IFR A;  1VQ4 N;  2E2Q A;  3MN6 A;  3VGL A;  5AQO A;  4FWK A;  2PBD A;  1GLD G;  4DHY A;  1NGJ A;  3TTD A;  3TU5 A;  4FOI A;  3L0Q A;  1BWF O;  1T6C A;  4FWR A;  3CJC A;  4Z94 A;  2I7N A;  1BDG A;  4RTF D;  2QI2 A;  4Y0W A;  1GLA G;  3D2E A;  3DJC A;  3ZYY X;  2CGK A;  5DM7 L;  1T3V A;  2YHX A;  4K25 A;  4A2A A;  5CE3 A;  5JLH A;  1EQY A;  2FF6 A;  2IVN A;  3B8A X;  2ASO A;  3A5M C;  2Q2R A;  3DLL L;  1J6Z A;  2BUP A;  3MCP A;  4PL7 A;  5AQQ A;  4MDB A;  3FZK A;  5H1S Q;  4YOY A;  4GV9 A;  3W3D A;  3ZEU B;  2Q36 A;  3U8X A;  4BRO A;  1GLB G;  5CHI A;  4JKE A;  1YXQ A;  3H45 C;  4YOV A;  3FZF A;  1LOT B;  3H6E A;  4B1U B;  1HJO A;  4M7Y A;  3E9O A;  1BUP A;  3LDQ A;  3CC2 N;  4IFE A;  4RCH A;  2ITM A;  3SK3 A;  4FVU A;  1SQK A;  4OPH A;  5AZI A;  1NGD A;  4ILH A;  1V4T A;  2HBL A;  2F7T A;  3S41 A;  3U9Z A;  1QZ6 A;  4K43 A;  4IO8 A;  1O13 A;  3VGK A;  2UYT A;  4ISE A;  2QWO A;  4B1Z A;  3HM8 A;  2HF3 A;  2Q1N A;  4KBO A;  4CJ7 A;  5AZJ B;  3HOS A;  2NRV A;  3L4I A;  3QBX A;  2OTJ N;  3O9Q A;  4FWM A;  5C2D A;  1P90 A;  3GOI A;  3RSE B;  3TTF A;  1JCF A;  4IXC A;  2YX6 A;  3A5O C;  3VOV A;  3CI5 A;  5EXW A;  2E1Z A;  3CJA A;  4CZL A;  2JWK A;  2HOE A;  2ZWH A;  3HZ6 A;  1VQM N;  3CJ9 A;  1KAY A;  5AQS A;  4CZH A;  1P8Z A;  4BQL A;  4U7B A;  2GTD A;  2YHW A;  2CH5 A;  3I56 N;  2IVO A;  3CME N;  3MMV A;  2E2P A;  2NRW A;  5AQK A;  3OW2 M;  3UKR B;  2NRX A;  3CJ7 A;  3FZH A;  5AQR A;  1BO5 O;  5AQV A;  3O80 A;  3BF1 A;  4FWQ A;  3M3Z A;  2QTD A;  5AQX A;  2A6A A;  2FXU A;  2E2O A;  4C1N I;  3VMF B;  3FR0 A;  3H1V X;  3KZB A;  4H5R A;  4NLC A;  5HL7 L;  3CF5 L;  4CZI A;  1E4G T;  3CHW A;  4BR5 A;  3OHR A;  2P9P A;  4BRM A;  4BRG A;  3N4Q A;  4MO5 A;  3IKM A;  1ZXO A;  3O9S A;  4I6M B;  3WUH A;  2I7P A;  3VF6 A;  4BG9 A;  4DKW A;  5BPM A;  5BN9 A;  4BRI A;  1WOQ A;  3UE5 A;  3O1W A;  3FLC O;  1Z05 A;  4C23 A;  3CCS N;  2GWJ A;  2A5X A;  3VF4 A;  4IO9 L;  1MDU B;  3R8E A;  3L4Q A;  4GY2 B;  4OPA A;  5AR0 A;  5LY3 A;  1XUP O;  2NRZ A;  4JAX A;  3DXM B;  4JKF A;  3VTH A;  4IEE A;  5KPR A;  1NGC A;  4A57 A;  3AAP A;  1RGI A;  4JKA A;  3J7Z O;  4IJN A;  3TSQ A;  1DGK N;  3BP8 A;  2F9W A;  2V7Z A;  3LDN A;  4QS8 A;  1YF5 L;  4XH4 A;  2FLO A;  2NRH A;  2NLX A;  3CCQ N;  4K41 A;  3EKS A;  3MK6 A;  4BR4 A;  3DAW A;  1N8R O;  2P9K B;  4BRK A;  4H0V B;  2EWS A;  2V7Y A;  1KQS M;  1E4F T;  1NGA A;  3VTI A;  3VEW A;  1RFQ A;  4H0X B;  5C15 A;  3F2K A;  1C0F A;  2E8A A;  3QFP A;  1X3N A;  4RWT A;  3PIP L;  2ZJP L;  3P39 A;  3VEZ A;  2Q31 A;  3IDH A;  5AQF A;  1M1K O;  4YOW A;  3QFU A;  1NGE A;  3H1Q A;  1SS6 A;  4EHU A;  5TKY A;  3VEN A;  4IWV A;  3ID8 A;  4JK9 A;  2D1K A;  2E1Y A;  2P9U A;  3LDO A;  2ZJQ L;  4M63 C;  3MCA B;  3SMP A;  1EO1 A;  3M6G A;  4IOX A;  4YOT A;  2KKZ A;  3LM2 A;  5BRF A;  3UB5 A;  1TYQ A;  4GVE A;  1W97 L;  1YIJ N;  4H0P A;  3F9M A;  2NNW A;  3ZX0 A;  4BGA A;  3I8B A;  2HMP A;  2GUP A;  4WFN L;  2NZT A;  3CCR N;  4A2B A;  3HRG A;  3GE1 A;  1RDU A;  1YJ9 N;  4FPA A;  1U2V A;  4BC4 A;  2P9L A;  1NGH A;  2YJF A;  2OAN A;  4FWP A;  4PL8 A;  5HOO A;  5DM6 L;  4WF9 L;  4BR0 A;  5F0X A;  4JKC A;  5C12 A;  3EZW A;  3D2F B;  5BPN A;  3Q7B A;  3CD6 N;  2VGM A;  3GG4 A;  4JKH A;  4HWI A;  1YIT N;  3AAQ A;  4BVP A;  1SAZ A;  3NMU A;  2A40 A;  3CPW M;  3E1Y A;  2VYP A;  3WXL A;  3AAR A;  2P9N B;  4BRD A;  1KXP A;  5I9E B;  1QQO A;  3JXU A;  1BOT O;  3EL2 A;  1HUX A;  3MX2 A;  4QS7 A;  3ZET A;  1VQP N;  1W2B M;  1NM1 A;  4ILJ A;  4BRE A;  5AQM A;  5FPM A;  4CBW A;  4EAH D;  1YJW N;  2QW9 A;  3ULE A;  3WEE A;  5M1K A;  2HF4 A;  3DXK B;  3KK7 A;  3CIP A;  3CCL N;  3GDQ A;  5JVG L;  3O9T A;  2P9S A;  2CH6 A;  2ZGY A;  5GAH P;  3SAF A;  1VQN N;  3P31 A;  1MA9 B;  4G9Z A;  3H46 O;  5CR4 A;  4GV3 A;  3QB0 A;  5E26 A;  5AQG A;  1BA0 A;  2GEM A;  2QXL A;  4PHT X;  1Q81 O;  4YOU A;  5KPZ A;  3M1F A;  4IOC L;  1HKG A;  4JKG A;  4BY9 C;  5M1Q A;  3SBG A;  3CCM N;  2RHK A;  1JCG A;  5E84 A;  3LDP A;  3SMS A;  4O8U A;  3D2E B;  4H0T B;  4A61 A;  4BRA A;  2AP1 A;  3LL3 A;  1GLC G;  4FWL A;  3VEY A;  4BGB A;  1BG3 A;  5GAG P;  2IVP A;  3UKU A;  4CBU A;  3EE9 A;  4XH1 A;  3C7N B;  3WQU A;  3O6W A;  3GL1 A;  3CCU N;  1VQ5 N;  1YHQ N;  1NLV A;  3JS6 A;  1T6D A;  2HST A;  5M1N A;  5KQ8 A;  3G71 N;  5TKW A;  3OA9 A;  2QA4 N;  4FWS A;  3K9J A;  4JHD A;  3VEV A;  2P9I A;  3WXJ A;  4CBX A;  5BR9 A;  3A0I X;  3DWL A;  1Q86 O;  3W0L A;  5AZI B;  2ZJR L;  5ADX A;  2QWL A;  3HSC A;  2FSN A;  3F5T A;  4K42 A;  3WXK A;  4NO7 A;  4JD2 A;  1SZ2 A;  3CJB A;  5KPT A;  5BRE A;  4YOX A;  3AGK A;  3VEX A;  4DCH A;  1K8K A;  1QZ5 A;  2YJE A;  2GEL A;  1HKB A;  4JNE A;  2KLA A;  4FPB A;  4WQ5 A;  5EY4 A;  1T44 A;  5AQI A;  3R3L A;  3QML A;  2YI1 A;  4PKG A;  5AQL A;  4IJA A;  4CI6 A;  3SBT A;  4H5V A;  5M1F A;  1QHA A;  4J8F A;  3OBY A;  1NGG A;  5LJV A;  3G4S N;  2NRT A;  4KH5 A;  2JWL A;  1GLJ O;  1KC8 O;  2E20 A;  4YDU C;  2GWK A;  5FPN A;  3TSU A;  3WXM B;  1LCU A;  5C10 A;  4JN4 A;  3C6A A;  5C0Y A;  3CET A;  3KVG A;  4A5A A;  4B1X B;  2HBM A;  3HTV A;  2PAV A;  4MLH A;  4CZK A;  4IZ9 A;  3QIC A;  4H5T A;  3IMX A;  4EFH A;  1Q7Y O;  4WYB A;  1NWK A;  1VQO N;  3G25 A;  1D4X A;  2F9T A;  3BEX A;  4BC5 A;  2V52 B;  1X3M A;  3KWG A;  4E1J A;  5ELZ A;  2KHO A;  1QVF M;  4O8K A;  4BRN A;  3ENH A;  1VQ9 N;  2ASM A;  1OKJ A;  3R9P A;  5LJW A;  2P9P B;  3CQX A;  2QWQ A;  4PKI A;  1U6Z A;  3CQY A;  4H5W A;  4CZM A;  5AQZ A;  5AQH A;  4AF1 A;  4NB4 A;  3E9P A;  2GX9 A;  1K8A O;  3HBT A;  5JIC A;  2VGN A;  3D6R A;  3SJH A;  2A42 A;  3EN9 A;  3N4P A;  3VEO A;  1VQL N;  3TTC A;  1HLU A;  3ATV A;  4CZJ A;  2WUS A;  5AQW A;  1YJN N;  5GIP A;  2FF3 B;  3ENO A;  5AQJ A;  3MN7 A;  4YOR A;  4ISG A;  5ADX H;  3C0B A;  3CER A;  4LC9 B;  3ZEU A;  4PKH A;  1Q82 O;  2V51 B;  4WQ4 C;  2D4W A;  3VGM A;  2P9N A;  3EE8 A;  3QDK A;  4C1N K;  4H5N A;  3PLA A;  1HKC A;  3I55 N;  4B1V A;  2VCP A;  2BTF A;  2ASP A;  3ID6 A;  2H3G X;  1YVN A;  2Q97 A;  3MN5 A;  1NJI O;  2Q0R A;  3NVK A;  3MN9 A;  1C0G A;  3FZM A;  5EVZ A;  3O4W A;  2DPN A;  3RVC A;  3O1B A;  4JKD A;  5JVH L;  1VQ8 N;  5BPL A;  4IDH A;  1S3X A;  5GAD P;  1ILY A;  4A62 A;  4MLE A;  1NGB A;  4B1Y B;  1X9J A;  1Y64 A;  4BC3 A;  4KH6 A;  3CCJ N;  2D0P A;  5AZJ A;  4AM7 A;  3ENB A;  1QQM A;  4BVO A;  3MWP A;  2YHY A;  4H0O A;  3MX5 A;  4WQ5 C;  3SLC A;  3RSE A;  4BRC A;  4BQZ A;  5AFU A;  2J4R A;  1YUW A;  4MDA A;  3O9U A;  4U67 L;  4YDU A;  1VQ6 N;  1KAZ A;  3VES A;  1IG8 A;  1KD1 O;  4M7X A;  4EHT A;  5KQD A;  2P9U B;  3CPE A;  1MWM A;  4FO0 A;  1NGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...