5M1KA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound magnesium
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
189
Chain Sequence
PAMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
molecule keywords Phage terminase large subunit
total genus 66
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1kA00
5M1FA 5M1KA 5C15A 4IEEA 3C6HA 3C6AA 4IDHA 4IEIA 5M1OA 5M1QA 4IFEA 5M1NA 5M1PA 5C12A 5C2DA 5C2FA 3CPEA 5C10A
chains in the Genus database with same CATH superfamily
5KPRA 3QNNA 4CHQA 3DLBA 4OGCA 4NO7A 3O5BA 5KTQA 3CCEN 3CJ7A 2A41A 4M3TA 4J8FA 1WAFA 1JLAA 2NUBA 2O8FA 2FF3B 3SMPA 4BACA 4ISEA 3HXMA 5BPLA 1M90O 3SQ0A 4CEQA 2NRHA 1VSFA 3ZSOA 3EO3A 1GLFO 3L3VA 1NMNA 2KZMA 4WQ4C 3F5TA 3P39A 3ZX2A 1EKEA 3G71N 1VRTA 5HRPA 4EP5A 4W5OA 1I3AA 3TWHA 1NKCA 1X9MA 1D9FA 3H6EA 2VWBA 4CFCA 4HCCA 3IFRA 5DMRA 3RSEA 1QZ5A 1HNIA 3KLFA 3MECA 1ZBLA 5AZJB 1SL2A 1RBUA 3ZSYA 1RBTA 3EYZA 3V1OA 1CZ9A 3O4NA 1IV0A 5CHIA 4H0VB 2HNYA 1NGGA 4DTXA 1NWKA 1BOTO 3QNOA 5I3UA 2KHOA 3HRGA 4KHSA 3TPQA 3OYHA 4FWMA 4JI0K 4F9OA 4NLCA 5KQ8A 1MWKA 1FJGK 4DWIA 3I33A 2Q36A 3LALA 3MCAB 5JICA 2P9UA 4FW1A 1A5XA 3Q7BA 3A0IX 3AVAA 4B8AB 1TAUA 5SZTA 3VQDA 4QOZB 1S1TA 4CHZA 4Y1CA 3V9WA 4F3TA 2UUBK 2X6SA 3U4LA 1RT5A 1NK5A 1VQ5N 4DV7K 1N6QA 3ATUA 4JRQA 3OS1A 3NF9A 4O4GA 4BRNA 3LP3A 4R5PA 2I7NA 4MO5A 2VWJA 4C8NA 4Y1DA 4CJFA 4N47A 4Z4EA 5GAGP 1FK9A 1RDDA 3CCRN 1N33K 2OYQA 1KC8O 2E2PA 4CVNE 3WNGA 3WQUA 3NDKA 3QEIA 4YORA 4Z4GA 1NGIA 2BGGA 3OYNA 5AQMA 5KRTA 4LH5A 2VYPA 1T3VA 1VHXA 3CCJN 2BTFA 2PZSA 2IDOA 5JS2A 3C6UA 4JKBA 3PSIA 4N76A 4CJ5A 2R7YA 1NJWA 3WUHA 1NOYA 1SL1A 2HVHA 1HNZK 3QICA 5HOOA 1WBDA 1TK5A 3U9ZA 4HUFA 3KK7A 5HL7L 3WNFA 1OH7A 1JJ2M 4J2EA 4BC4A 1XMQK 3V9SA 1XHXA 5AQHA 2JWLA 1TGOA 1QS4A 5JVHL 3HOSA 1ITGA 1D4XA 3L6QA 4IXCA 4CHNA 4EHUA 4AILC 4DFPA 3LL3A 4DS4A 2JWKA 4BE0A 2QWMA 1LAWA 3PO4A 3K5NA 4FZYA 1XQSC 4CF8A 3VQ8A 1YJ9N 4FWPA 3M8SA 3EZWA 1VSMA 3UKRA 4FJKA 1QZ6A 3NGZA 4LF4K 4EZ6A 2F4VK 3N4PA 2QWLA 3A8YA 1VQ4N 2HOEA 3WXLA 4IO8A 1W2BM 4LF9K 5TKWA 1TL3A 2YHWA 2ZGYA 5HRSA 2F9WA 3WXJA 4BRGA 1NK7A 1HKCA 2IC3A 4DQRA 2BH1A 3AVIA 4ELUA 3TAEA 2E2OA 3MMVA 4NCAA 2YHYA 3VESA 3AO5A 1VRUA 3NF8A 1HNXK 3J8AA 3OTOK 3IUCA 3VQCA 3CMEN 3DRSA 2G8IA 3TTCA 3KKSA 2E1ZA 3ZSRA 1J54A 4CFDA 4RWTA 4CGJA 5BRFA 4DTMA 3TAGA 4EFHA 4EHTA 2AP1A 2E8AA 3SUNA 3QBXA 3SQ4A 3G6EN 4MLHA 1LOTB 5J2NA 1BISA 4A5AA 4BVOA 1C0UA 2P9KB 4DV0K 3SZ2A 3MEDA 3LM2A 1N5YA 3PX0A 3LZJA 3MXJA 3I56N 1HJRA 1C6VA 5AQXA 2YKNA 3FE1A 4FL9A 1MA9B 3AO2A 4YOYA 3IKMA 3E9LA 3KK1A 4JKGB 3AVCA 3M8RA 2A5XA 3OS2A 1QQCA 2X6NA 1GLLO 3MCPA 3EN9A 3AO1A 4X64K 5M1FA 1NK0A 1GLBG 4LH4A 3RRHA 3OYMA 1T6DA 4FXDA 3AARA 2GX9A 4M45A 4OGEA 1VSIA 5I42A 1TKZA 5FPNA 3NH0A 2QKKA 2GELA 4CEDA 4CJPA 1MDUB 5HLFA 1QQNA 1QSYA 1JLGA 2QI2A 4CK2A 3DXKB 4NLBA 1QHTA 3CETA 2LSNA 5AQKA 3CXCM 3THXB 1MU2A 5AQSA 3ZLJA 3OBWA 4CGGA 3ENHA 3OVNA 4OX9K 1JXBA 3AVGA 4CJRA 3SNNA 3CHWA 3OBYA 4JHDA 3VEOA 2UU9K 2VGMA 4KHPK 4DU4A 1W97L 3U8XA 3PX6A 2UYTA 2P9LA 3THWB 3M3ZA 3M8QA 3S3OA 3LDNA 3HK2A 3O9SA 1WSJA 4CD1A 1VSJA 4CJVA 3ENBA 1X9JA 4H5NA 1RTHA 2E88A 1NKBA 1IKYA 2PAVA 3DLKA 1YAGA 3E9OA 4BWJA 3N4QA 2OPSA 4KB0A 4BRDA 5K14A 1VQMN 4DQQA 5B8HA 1UWBA 2QXLA 3HPHA 2P9NB 4N5SA 2G8WA 4IZ9A 3RR8A 1GLAG 1YJWN 2UUCK 4LFCK 4AM6A 1ESVA 3KTQA 3QBWA 1WLJA 4IFEA 3ISNC 4PL7A 3OYFA 2Q1NA 4PKIA 1SQKA 4YFUA 1IH7A 2YX6A 3QB0A 1OVYA 1HRHA 3AAQA 1QE1A 1QSSA 3OJUA 3CJAA 3QDKA 1RTDA 2O4IA 3DOKA 1KRPA 3C7NA 1T03A 3CC2N 3QEPA 3HPOA 1JCEA 4FWNA 4HCBA 4WYBA 3P38A 4B3OA 4HTUA 3K9KA 2NRRA 4ZTFA 4O8UA 3NGIA 5LMUK 1RFQA 1NBWA 3K9JA 1HLUA 3WEEB 3G4SN 4A62A 2VG7A 5AZJA 3O08A 1ILYA 2HHWA 2CH6A 1KTQA 3ZT2A 5C25A 4B9UA 4YNQA 1SKRA 3D0PA 3DOLA 4BY9C 3F9KA 2O8EA 2D1KA 5JVGL 3I8DA 3ZT4A 4FLUA 2HW3A 1VSHA 1Q8IA 5HROA 3AVBA 3AA5X 1LWCA 3O9TA 3VOVA 3AO3A 1KVAA 3CD6N 1RT1A 4AF1A 4H0XB 2KQ2A 1Y64A 4JI5K 5C15A 2OCEA 4CJTA 4DQIA 4CERA 2HHUA 5J2MA 3TANA 4GV3A 1CXUA 3ID8A 4CJ7A 4M3WA 4L3QA 4AHRA 3CC4N 1KXPA 3AVKA 1FXXA 3UKUA 3VENA 3MXMA 3O80A 4KV8A 5D3GA 1W9HA 3EY1A 4B08A 5BR8K 1YF5L 2E4LA 4PWDA 2QXFA 4AHTA 5JS1A 3L4IA 1C1BA 5J2PA 1NGEA 4FJXA 4BE1A 4CJSA 1NGAA 5GAEP 4A2BA 1NOZA 3O1BA 4FJNA 4A57A 2A1RA 3NAEA 4CZMA 3SJHA 4CEBA 2B6AA 5SWMA 3TABA 4XEIA 1E4GT 3OYKA 4UY8O 4M3RA 4JKEA 3LP0A 4CK3A 3MXIA 3TTFA 3MEEA 4A2AA 5AQNA 3CFOA 5CE3A 3DM2A 3DLGA 5CYQA 2IVOA 1VQKN 3VQPA 1WSIA 3D2FA 5KI6A 5GIOA 4BR9A 4NXNK 4HHTA 1RTJA 3IRXA 4FWLA 3C0BA 4O5FA 5HRRA 3DLRA 1JKHA 1QVFM 1LWFA 1RDAA 1L3VA 4FWSA 2WFBA 5AJ3K 5TKYA 3CPEA 1NMDA 1Y97A 4DQPA 4E1NA 2VG5A 4RW8A 5BN8A 2HBLA 3TAMA 3GOIA 3HT3A 4FPBA 4AM7A 4K42A 4YDUC 2HHTA 3PV8A 4DTJA 1VQ9N 1LW2A 1NGJA 1ASUA 2HHHK 3V81A 3H45C 3JYTA 3ALYA 4OPHA 3QO9A 4B9VA 1Q82O 4DV1K 1UA0A 4WQ5C 3ZSXA 1JLBA 4JAXA 3ZT3A 2HMPA 4X66K 1VQNN 4MLEA 3VQ9A 4Y0WA 4EZ9A 4KI4A 4H4OA 5BPMA 2JLEA 4ISGA 3SBTA 4ELVA 2HF3A 3TTDA 3HOTA 3NGYA 4E7KA 2CGKA 1ZBSA 3C65A 2D5RA 2WBNA 3JXUA 1U2VA 3U6FA 1S5JA 1G15A 5AQRA 3OW2M 3NF6A 1A5VA 3CF5L 5FPEA 4KBOA 1IKXA 1NGFA 2YHXA 3T1AA 4HWIA 2IVPA 1K73O 3VF4A 1RBVA 2XY5A 4IG3A 4H4MA 4JI7K 4H0TB 1ATRA 5KQDA 2PYJA 4LSNA 1RDBA 4F2SA 2P51A 4OLAA 1TUYA 4LF5K 3TI0A 4DSLA 1O13A 1ZXOA 4LFBK 3V9UA 5LL6Z 3SAGA 3FFIA 1HKGA 3CQ8A 1BWFO 3HPGA 4DF8A 3FZMA 3MWTA 3CPWM 1RDCA 1N8RO 4JV5K 2HBMA 1CLQA 3VQ6A 3DMJA 4CJWA 3UE5A 4KHQA 1X9SA 1TK0A 4CF2A 1WB9A 4U7BA 2YNGA 2P1JA 1N34K 3SCXA 3QFUA 3C94A 4I6MA 2RE2A 4WFNL 3T1YK 4DSIA 3WXMB 1VSLA 4Z0UA 4OJRA 3ID6A 1XMOK 3SPZA 2IGIA 1TKXA 3G0ZA 1DT9A 3OY9A 3LDPA 3DWLA 1YITN 2YJEA 3A5NC 1VSKA 4JD2A 4H0OA 4FPAA 1XHZA 2YKMA 2BANA 3AA3A 3OHRA 1BI4A 1TVRA 2QA4N 1BIUA 1ZYQA 2G8FA 1NGDA 4B1XB 4IKFA 4JS4A 2ZM6K 2Q0RA 2G8UA 4DR3K 1OH8A 5M1PA 4TSXA 3ATVA 1FKOA 3J7ZO 4KH5A 1L3SA 4CJ4A 2KKZA 4NYNA 1S9GA 1NK4A 1VQPN 3HM9A 3NCIA 3MEGA 3LPUA 3THWA 4FJIA 4CIFA 1TAQA 1EO1A 3PO5A 5GAHP 2NRVA 2A42A 1BL3A 1Q18A 4BDPA 5JMVA 3HP6A 1L3UA 1I39A 3VQAA 1GLJO 3P5JA 3SLCA 1D8YA 3BGRA 2YNFA 2GWJA 2DPNA 4KHWA 3KVGA 3TARA 4JRPA 1I94K 2JGUA 5E84A 1C1CA 3ZYYX 3BP8A 4BG9A 1GLDG 2GUPA 3VEYA 4B3RK 3RR7A 3KHYA 4DQSA 3C6HA 3O4WA 4KREA 2VQFK 4A61A 1ZBUA 2NLXA 2PY5A 2H3GX 5EX5A 4IWVA 2YV0X 4O0IA 2UUAK 1S1UA 1S9EA 1QVGM 3HBTA 4BRLA 4LY7A 4JNEA 4RW6A 1SKWA 4CGHA 2DTUA 1BI4B 3FLCO 1XC3A 1WUAA 3CCUN 2EHGA 4FWKA 3O3HA 4FLTA 3K5LA 1UAXA 4PHTX 2XY6A 3DAWA 2OA8A 1GOBA 3EKUA 3VQ4A 4YOUA 3LDSA 1T05A 2HNDA 3TAPA 1C0MA 5ADXA 1KCFA 3V4IA 2Y1IA 3B8AX 2QKBA 3F9MA 3TSQA 4IOAL 1S72N 2O8EB 4BR7A 1YTAA 4FVUA 3RMAA 3NBPA 4K8XA 1REVA 4YOXA 4G9ZA 2O8BA 2YJFA 4K8ZA 1EX4A 3F2KA 5C0YA 5EOYA 2E1YA 1G99A 3O3GA 5M1OA 4OPJA 3ZSWA 1NNEA 4E1MA 2ASPA 1NK6A 1TKTA 1JCGA 5J1EA 2RN2A 1VAZA 4IG0A 5AQTA 3JS6A 3BF1A 3P4IA 3P83D 3CQXA 4FWOA 3TSPA 3HTVA 4DSJA 2QWNA 4BDYA 1ATNA 3MN7A 4CF0A 4H5TA 4E0DA 2QK9A 4E7JA 2OTJN 2ZWHA 1U2VB 3RMDA 1K9MO 2FSKA 1WNSA 3FZHA 2FF6A 4XH5A 3IG1A 4IEIA 5AQIA 2D0OA 3A2FA 3VA0A 1U48A 2P9NA 4KHYA 2VQEK 2ASOA 1RT3A 3HM8A 1HUXA 1OH6A 2IIRA 4BQLA 3R6MA 1QQOA 3ZX0A 2W40A 3VF6A 5GADP 3QEVA 4J2AA 2FXUA 4LF8K 4FJ8A 4CZIA 3SAHA 4B9MA 4F8RA 4NCBA 2GTDA 2FBTA 5EXWA 2P9PA 1YTUA 1GLEG 4DV5K 1HQEA 3P31A 4DU1A 4E7HA 2P5GA 4DQ8A 3SUOA 3J81O 4DSEA 4CEEA 2UXCK 4DUYK 3EL2A 4DSKA 4B9TA 1E3MA 4CZKA 3SQ1A 2CGLA 3CFRA 3THXA 2BDPA 2O8DB 5BN9A 4CEZA 4CE9A 4FO0A 1V4SA 2OPQA 1DTTA 1U6ZA 3CMAN 3IMXA 3CJ9A 4FZXC 1KAXA 1VSDA 5LJWA 4JI2K 3CJCA 4DFMA 2Z1GA 4BWMA 3O6WA 3OYAA 3AY9A 3L2WA 4WFBL 3QMLA 5AQVA 3CCMN 3IS9A 1IKWA 4CIEA 3UIQA 4IOCL 3VQ5A 2HHSA 3QINA 3VMFB 2D0AA 3O9QA 1KFDA 4WFAL 1KAYA 5AQYA 1BGXT 3ZETA 2O8DA 2QM1A 4GY2B 2P9IA 3P1GA 3AVFA 1Q81O 2YI1A 3I0SA 1KVBA 4LD0A 5C12A 5C2DA 4IEEA 2V52B 5CYMA 3ULDA 3EZ5A 4I7FA 1W7AA 4OKKA 2PFUA 2IS3A 1NGCA 1TYQB 2P9PB 1YHQN 2B5JA 4JN4A 4DF4A 4PKHA 2WTUA 1QSLA 4NB4A 3SPYA 4I9QA 4M3ZA 4U67L 2WUSA 2FSNA 3QLHA 4LF6K 4CEFA 2G8VA 2WONA 4CI6A 1RTIA 3KIOA 3S3NA 1A5WA 3CJ1A 3QFPA 4B1UB 4CK1A 5DM6L 3E1YA 4R79A 1XNRK 3AVJA 4C8LA 1CZBA 4RG8A 4BRIA 4DKWA 5LY3A 1C0GA 4DFKA 1NM1A 4YY3K 3SUPA 3PY8A 2HHXA 3VQ7A 4DG1A 4W5TA 3GE1A 1KAZA 2P9KA 3HL8A 3SQ2A 1BCMA 4M3XA 4FLVA 4A59A 4CFBA 3JSMA 1MWMA 1SS6A 2GUIA 4J2BA 3DLHA 1HYZA 4ZTJA 3GDQA 5EVZA 4CZHA 4CJKA 1Q9YA 1LV5A 4B9LA 3H1QA 1QTMA 4GV9A 4BRQA 3AGRA 3VA3A 3LM9A 2OZSA 2EX3A 1RT6A 3J7AP 2A40A 3PSFA 5EU7A 1S6QA 2QWPA 3S9HA 3ZSQA 4CZGA 2W6LA 3DLLL 4AHVA 3G10A 1T44A 3C6AA 1DGKN 3D6RA 3VQQA 3I0RA 3S41A 4CFAA 1SAZA 3VGLA 3ASMA 4JKCA 3MN9A 3GL1A 4FM0A 3ITHA 3OYJA 5C2FA 3K59A 3KZBA 4FJHA 4CJQA 4KHNA 3R3LA 4JK9A 5AQFA 5AQZA 2B4JA 4B1ZA 5FROA 4OPAA 3RRGA 2UXDK 3M8PA 3HVRA 2A6AA 2F7TA 4JKAA 1M1KO 3QIPA 3QESA 4BREA 4FCYA 3TSUA 3M1FA 1BDGA 1BHLA 4ICLA 1X3MA 4IOXA 4DV2K 4FYDA 4IBNA 2VCPA 4B3TK 1J5OA 2ZJPL 1N36K 2ZJRL 3KKRA 5CZ1A 1L5UA 4C1NI 3TAQA 5AFUH 3KLIA 3OYBA 1VQON 1GLCG 3CCLN 4FLXA 1YVNA 4QS7A 2E20A 4JEPA 4B1YB 3K2PA 1TV6A 3CIPA 4DV4K 4X62K 4KB1A 2DY4A 4B1WB 4JI6K 4O8KA 4CBWA 2ZD1A 4DR5K 4EIAA 3IAYA 4CJLA 3ZCMA 1HNVA 1IBKK 3VGMA 3DLEA 4DTRA 4JI3K 3M5RA 2Q97A 4M63C 2GBZA 4J2DA 2E6MA 2O4GA 1RT4A 2YHAA 3CCSN 1YIJN 4LC9B 2FLOA 1RBRA 3OYCA 3NF7A 3THVA 3HP9A 3V6DA 3QIOA 2E2QA 2UXBK 4FK0A 3FZLA 2Q2RA 4OVLA 4FM2A 3DXKA 2IOCA 4JK8A 1UA1A 4YDUA 3BY5A 5FPMA 3QEXA 2P9UB 3ZSVA 4DFJA 2QWQA 1HNWK 1CZAN 3MN5A 3W0LA 3WNEA 3H3OB 3K0SA 4IJAA 3HI0A 5FDLA 1HPMA 2NRXA 3TU5A 3WT0A 3W3DA 1KSPA 1HKBA 2OPRA 4BGBA 3U3GA 4M42A 3AGKA 3QERA 3I55N 2XRIA 3VGKA 2ITGA 3BEXA 4CJEA 4PKGA 2CH5A 4JKGA 1S1XA 4CHOA 1Q7YO 1WSHA 1JCFA 2Z1IA 1NG9A 4H03B 4CESA 5CZ2A 5FRNA 3A5OC 4E89A 3O9RA 4FJ9A 2Z1JA 1DEJA 3SAFA 2HBJA 4HTLA 1JLCA 4ILHA 1YXQA 2ZE2A 3CM5A 2CGJA 3ZT0A 1NJYA 4DS5A 4CIGA 4WE1A 3NMUA 1IG9A 2VGNA 1BIZA 4DU3A 4A5BA 4H8KA 2D0PA 3CCVN 1R59O 1SL0A 4CGDA 2FBYA 4E3SA 1HX1A 1RGIA 4W5RA 3L2VA 3U9DA 1S6PA 2ASMA 1O1WA 4OPKA 1VQ7N 4RCHA 1DKGD 1V4TA 1FW6A 3LAKA 2XHBA 1NK8A 4QCLA 4CCHA 1RT2A 5E26A 3RSEB 3LPTA 4C8KA 2ZGZA 5BRDA 3EEQA 3OS0A 2F96A 3B6OA 5M1KA 4JI4K 4FWRA 1IJJA 4ZHRA 3VEWA 1J53A 1KLNA 5AQLA 2FBVA 4Z4CA 2J4RA 3LWMA 4LFAK 3ENOA 4BE2A 4CEOA 4E19A 4AHUA 2O8FB 3DXMB 3HJFA 3R8EA 2BUPA 1F21A 3J80O 4DTSA 1OKJA 4F3OA 4CZLA 2ZQBA 3MK6A 2F8TA 1QHAA 1GOAA 1HYVA 2VG6A 4G1QA 3SI6A 3OA9A 3C95A 4FOIA 2NRZA 2P9SA 3O3FA 1Z25A 4CGIA 1NJZA 5AQPA 1S1WA 5AZIB 1KD1O 5ELZA 4BR0A 2KW4A 3K5OA 3RVCA 3LAMA 1EETA 3SK3A 4JS5A 1XWLA 2DFFA 1CXQA 4H0YB 3RMBA 2ATQA 2Z1HA 4NXMK 1RT7A 2BE2A 4PUOA 2P5OA 4H5WA 2OANA 3SBGA 3O8MA 1LCUA 4FJLA 4E7IA 2W42A 3U3YA 4RW7A 4FM1A 3CI5A 1VQ8N 2XY8A 1NGBA 2A3ZA 3MN6A 3KD5E 2OTLN 4BRFA 4W5QA 2HHQA 3VTIA 3L8BA 4O44A 3BUZB 4B9QA 5F1XA 1WSFA 3AV9A 3HZ6A 4CF1A 1Z26A 2FSJA 1XI1A 1KLMA 4CBUA 1BCOA 1XC9A 3D45A 2HBKA 5DK5A 4BGAA 4AQYK 4EP4A 1BQMA 2D4WA 3KLHA 4AH9A 1ATSA 3ZX3A 5M1NA 4WF9L 2ZJQL 2Y1JA 1U45A 4BG8A 3NVMA 4JK7A 3JAMO 4AHCA 3J7YP 3B6PA 3UB5A 4K41A 3WQTA 1GOCA 3KJVA 4K25A 1BQNA 2RHKA 3LDOA 4FJ7A 2RPIA 1K8AO 4Z4FA 2V51B 4GVEA 3D2EA 4FLZA 5HP1A 1FKPA 4FJ5A 3NH2A 1WAJA 3HVTA 1JLQA 5AR0A 4DR4K 3R1XA 3HSTB 4BR5A 4LSLA 4JKDA 4YHHK 4ILGB 1J9AA 4F2RA 1RCHA 4N56A 1KVCA 3DRRA 1HR0K 4LF7K 1BA0A 3CM6A 1ASVA 1N32K 4KPYA 3OYDA 3T7ZA 4CZJA 3IDHA 4FVMA 4OO1J 4PA1A 4IFVA 4BDZA 1R0AA 5KPTA 3I8BA 5AQJA 3L2UA 2PYLA 1D5AA 1TYQA 1S3XA 3L4QA 1NJIO 2HMIA 4BRPA 3QETA 4QS9A 1Z05A 2KZZA 5AQWA 1D9DA 3ZT1A 5GIPA 1HYSA 2P9IB 4KRFA 2W6KA 1JLEA 4MQ3A 3TR8A 1SV5A 4E1JA 5A2QO 4CF9A 4B3SK 1WN7A 3K58A 4GVMA 4BR4A 2YHBA 2DFHA 3VQBA 4DR2K 4HVJA 5T7BA 5LMNK 4M7XA 3VEXA 3HYFA 2DFEA 1J5EK 4KH6A 3VEZA 3VERA 4JKFA 2G8HA 3BF3A 4X65K 4I2PA 1EWQA 4DR6K 3LDQA 3M6GA 3KLGA 1HPZA 2GEMA 2WC9A 4ILJA 2ZF5O 2QTDA 2HHVA 4I2QA 3VEVA 3NE6A 4GV6A 3AAPA 3T3FA 5LJVA 2A1SA 2QEXN 4IDKA 3WNHA 3Q7CA 5AFUA 1TL1A 3AA2A 1SZ2A 2I5JA 3CFPA 1IKVA 1RBSA 3ZEUB 3V1QA 2YCHA 1X1PA 4DUZK 4Q0BA 3GG4A 4DMNA 1B9FA 1S22A 3A5LC 4XIUA 1K6YA 3NHGA 1VQ6N 4DV3K 2FC0A 1JLFA 3THYB 3MX2A 3T69A 3LP1A 4DV6K 3CCQN 1BU6O 4DTOA 1QQMA 2IVNA 5C10A 1SUQA 2P9LB 4CHYA 5CY4A 1T7PA 4QS8A 1RNHA 3LZIA 2HSTA 3K57A 5BPNA 2NNWA 3SJJA 4NYFA 3DJCA 4DB3A 2XO7A 1U49A 2F9TA 4NCGA 3KK2A 4DLEA 2V7YA 4DSFA 1YI2N 2QWRA 3LDLA 1DTQA 4GW6A 4H5VA 5DM7L 4XH1A 1WSGA 3EKSA 4B1VA 4CZEA 4BQZA 3UKUB 4B9NA 4O0JA 1DLOA 5AQUA 1NJXA 3H08A 2O8BB 1T6CA 4MDBA 1JL2A 1L3TA 4K0KK 1YT3A 3NVKA 1Z6RA 2E5LK 4KH4A 1U4BA 4B9SA 4CGFA 1UOCA 4B3MK 3AVNA 3KWIA 3FR0A 4GNIA 4GKJK 2ITMA 4WCEL 4BR2A 2WOMA 1IBLK 1HMVA 3E01A 4O55A 5BR9A 4KKOA 4RW4A 4HUEA 3E66A 2G8KA 4F4KA 4FOEA 2AA4A 3SUQA 5KGWA 1C0TA 5F2RA 5IWAK 2YNIA 1BO5O 4IJNA 4BC2A 3C6TA 1BG3A 1KQSM 3DRPA 3PIPL 3AVLA 2HF4A 1KFSA 3L2RA 4ISFA 3ZETB 4FJMA 4M3YA 4RW9A 3AO4A 5BRHA 3WXKA 1RDWX 2GWKA 4C1NK 1K8KA 4IFYA 4FZZA 3S3MA 5AQOA 1B92A 3WEEA 1U47A 3MX5A 5M1QA 3ULEA 5FPDA 2RKIA 4C8OA 3OYIA 3RTVA 4FSVA 3C7NB 2E2NA 4DR1K 3T1HK 4C23A 1Q9XA 2KLAA 4MDAA 3LWLA 4JLHA 3LP2A 4FJJA 4OKEA 3L2QA 4H0PA 3ZEUA 1B9DA 5J2QA 4BROA 3FZFA 5FRMA 5GINA 3G25A 2NRTA 3O9UA 4CECA 4PY5A 3T19A 1NKEA 1LW0A 4V19S 2Q31A 1S1VA 3GBTA 4K43A 1VQLN 4YOTA 1TUUA 3HO1A 5EY4A 4AHSA 3UKRB 3NFAA 1P90A 2X74A 2FBXA 3K5MA 3R9PA 1IG8A 4BRCA 1X9WA 3VTHA 2AJQA 4KTQA 1RDUA 3FGUA 3OYEA 1BUPA 1NU0A 2EWSA 2I7PA 4EAHD 1Q86O 3DI6A 1JXEA 1NGHA 2YNHA 3H1VX 5F0XA 3KK3A 3A5MC 5KRSA 4H5RA 4CEAA 4FJGA 1TK8A 3VF2A 1X3NA 4JD2B 2NRWA 1BA1A 4HUGA 3F73A 2QW9A 3BZCA 3SMSA 4Q5VA 3OYLA 1LAVA 4JHDB 5FLXO 4YOWA 2QWOA 4CJUA 2Q3SA 4OKJA 4XH4A 1NK9A 2W41A 2OPPA 3AA4A 4ID5A 3CERA 4M7YA 4Z4IA 3V9ZA 5C24A 3PIOL 4FW2A 3CQYA 4Z94A 4ELTA 3FFKB 4CHPA 1U04A 1ZBIA 3AVHA 1H1VA 1YUWA 1YVUA 4MFBA 3L0QA 5AQGA 5AQQA 3ULEB 5I9EB 3AVMA 1ASWA 1EQYA 4PQUA 4KO0A 1P8ZA 4JKHA 4BRAA 4RTFD 1K8KB 3O4QA 4M3UA 1E4FT 3CYMA 5KGXA 4Z4HA 1W0HA 3FZKA 4FLWA 3MWPA 4QAGA 1VSEA 4JI1K 3MDQA 3BDPA 3D2EB 4JI8K 1HJOA 3DYAA 5H1SQ 2XY7A 2HNZA 1HQUA 4L8RB 3VPZA 2D0CA 3H3NO 3OYGA 3QEWA 3L3UA 3CG7A 5E41A 5HBMA 2IAJA 1C0FA 1XNQK 4DTNA 4KFBA 3PLAA 5JLFA 4FK2A 3VN5A 4KHUA 4DR7K 3D7EO 4FWQA 2OZMA 1J6ZA 2KFNA 2NZTA 3KWGA 3VETA 2D0BA 4GKKK 5HRNA 3KLEA 3MAQA 1IO2A 2KTQA 1EXQA 4DTUA 3H46O 1JL1A 4MO4A 4KAZA 4DHYA 3SYZA 2RF2A 4IO9L 3CC7N 3E9PA 5KPZA 5C42A 4CD3A 1VK0A 2PBDA 1EWRA 1YJNN 3OJSA 5BREA 3SV4A 3NH1A 4BRHA 1OVQA 4WQ5A 5JLHA 1LWEA 4BC5A 1OH5A 1EP4A 1RILA 4CBXA 4B8CA 1TKDA 5IT9O 3V1RA 4C8MA 3CJBA 4OLBA 4FK4A 4CJ3A 2ETJA 5MLCQ 4UQGA 4BVPA 3EE9A 2X78A 3RMCA 3WXIA 1WBBA 4JYAK 2Q0UA 4CW7B 4ID1A 1ZBFA 3O1WA 5ADXH 5AZIA 2F8SA 3D2FB 3THYA 2V7ZA 2P9SB 1T8EA 4PL8A 4DTPA 2VWKA 1C1AA 3BZKA 2E6LA 4BRMA 4GMJB 3SV3A 1WOQA 4O5BA 3V9XA 4DLGA 2KFZA 4E7LA 3HSCA 4WQ4A 3PUFA 3RWUA 4I9LA 1ZBHA 4BC3A 3DXMA 2HVIA 4CZFA 4BRKA 1ZC6A 4IDHA 4KTZA 3PX4A 1XUPO 3EE8A 5CR4A 3KD1E 3TAFA 2O8CA 1IBMK 4N41A 2O8CB 2GV9A 3ZSZA 3VQEA 3LANA 1SKSA 4KI6A 4KTWA 4DCHA 4W5NA 1WSEA 4FLYA 1NLVA 4M41A 4I6MB 2HB5A 4YOVA
chains in the Genus database with same CATH topology
4GV3A 1KAYA 2P9IB 5AQYA 5KPRA 3ID8A 3ZETA 4NO7A 4CJ7A 4L3QA 2QM1A 3O5BA 3CC4N 1KXPA 2P9IA 4GY2B 1Q81O 4E1JA 2YI1A 3UKUA 3VENA 3CCEN 5C12A 5C2DA 3O80A 3CJ7A 2A41A 4IEEA 4BR4A 4J8FA 1YF5L 2V52B 3L4IA 2FF3B 3SMPA 1NGEA 2PFUA 4ISEA 1M90O 5BPLA 1NGCA 1TYQB 2P9PB 4M7XA 2NRHA 1NGAA 3VEXA 4A2BA 4JN4A 5GAEP 4PKHA 1YHQN 3O1BA 3EO3A 4NB4A 4A57A 1GLFO 4KH6A 4CZMA 3SJHA 3VEZA 4WQ4C 2WUSA 2FSNA 4JKFA 3BF3A 3F5TA 3VERA 4U67L 3P39A 3ZX2A 3G71N 4XEIA 1E4GT 4UY8O 3LDQA 3M6GA 4JKEA 2GEMA 2WC9A 4ILJA 4CI6A 2ZF5O 2QTDA 3TTFA 3H6EA 2VWBA 4A2AA 5AQNA 5CE3A 3VEVA 4GV6A 3IFRA 3AAPA 3CJ1A 3QFPA 4B1UB 5DM6L 3E1YA 4R79A 3RSEA 1QZ5A 2IVOA 5LJVA 1VQKN 3D2FA 4BRIA 4DKWA 5GIOA 4BR9A 2QEXN 5AZJB 3Q7CA 5AFUA 5LY3A 1C0GA 4FWLA 1NM1A 1SZ2A 3C0BA 4O5FA 3GE1A 1KAZA 5CHIA 1QVFM 2P9KA 3ZEUB 4FWSA 4H0VB 2WFBA 5TKYA 4A59A 3CPEA 2YCHA 1NGGA 1MWMA 1NMDA 1SS6A 3GG4A 1NWKA 3GDQA 5EVZA 4CZHA 1S22A 3A5LC 1BOTO 3H1QA 5BN8A 2HBLA 2KHOA 3HRGA 3GOIA 4BRQA 4GV9A 4FPBA 3AGRA 3TPQA 4AM7A 4FWMA 4K42A 3LM9A 1VQ6N 4YDUC 4F9OA 4NLCA 5KQ8A 1MWKA 3MX2A 3T69A 1VQ9N 2A40A 3I33A 2Q36A 3CCQN 2QWPA 4CZGA 1BU6O 1NGJA 3DLLL 1QQMA 2IVNA 3MCAB 5C10A 5JICA 2P9UA 1T44A 3C6AA 2P9LB 3Q7BA 3A0IX 1DGKN 3D6RA 4QS8A 3H45C 4OPHA 3S41A 1SAZA 3VGLA 4JKCA 3MN9A 3U4LA 3GL1A 2HSTA 1Q82O 1VQ5N 5C2FA 5BPNA 4WQ5C 3KZBA 2NNWA 3ATUA 3R3LA 4JK9A 5AQFA 5AQZA 4B1ZA 3DJCA 4JAXA 4OPAA 4DB3A 2HMPA 1VQNN 4MLEA 4Y0WA 2F9TA 5BPMA 2V7YA 4ISGA 2A6AA 2F7TA 4BRNA 1YI2N 3SBTA 2QWRA 3LDLA 2I7NA 4MO5A 4JKAA 2HF3A 3TTDA 4H5VA 1M1KO 5DM7L 3HOTA 5GAGP 2CGKA 1ZBSA 4XH1A 3C65A 4BREA 3CCRN 2WBNA 3JXUA 1U2VA 2E2PA 3EKSA 1KC8O 3WQUA 5AQRA 3TSUA 3OW2M 3M1FA 1BDGA 4YORA 1NGIA 4B1VA 4CZEA 4BQZA 3UKUB 3CF5L 5FPEA 4KBOA 1X3MA 5AQMA 4IOXA 5AQUA 1NGFA 2VYPA 2YHXA 1T3VA 1T6CA 2IVPA 4HWIA 4MDBA 1K73O 3NVKA 3CCJN 2BTFA 3VF4A 2VCPA 1Z6RA 2ZJPL 4KH4A 2ZJRL 4JKBA 4C1NI 3KWIA 4H0TB 3FR0A 4GNIA 1ATRA 5AFUH 5KQDA 1VQON 1GLCG 2ITMA 3WUHA 4BR2A 4WCEL 3CCLN 1TUYA 5BR9A 3QICA 1YVNA 5HOOA 1O13A 1ZXOA 2E20A 4QS7A 4JEPA 3U9ZA 4B1YB 3E66A 3CIPA 4FOEA 2AA4A 3KK7A 3SAGA 4B1WB 4O8KA 4CBWA 5HL7L 4EIAA 1HKGA 5F2RA 1JJ2M 4BC4A 1BWFO 3VGMA 1BO5O 4IJNA 4BC2A 1KQSM 1BG3A 3M5RA 2Q97A 3FZMA 3MWTA 4M63C 2HF4A 2JWLA 5AQHA 3PIPL 3CPWM 3CCSN 2HBMA 1N8RO 5JVHL 1YIJN 3HOSA 4LC9B 3UE5A 1D4XA 2FLOA 3L6QA 4ISFA 4IXCA 3ZETB 4EHUA 4U7BA 3LL3A 2E2QA 2JWKA 3FZLA 3QFUA 5BRHA 2Q2RA 1RDWX 2QWMA 2GWKA 2RE2A 1K8KA 3DXKA 4I6MA 3WXKA 4C1NK 4WFNL 4JK8A 3WXMB 1XQSC 5AQOA 4YDUA 3ID6A 5FPMA 1YJ9N 2P9UB 1DT9A 4FWPA 3EZWA 3LDPA 3UKRA 3DWLA 3WEEA 1YITN 3MX5A 1QZ6A 2QWQA 5M1QA 2YJEA 3ULEA 5FPDA 1CZAN 3A5NC 3MN5A 3W0LA 4JD2A 4H0OA 3H3OB 4FPAA 3N4PA 4IJAA 4FSVA 3C7NB 2E2NA 3HI0A 3OHRA 1HPMA 2NRXA 3TU5A 3WT0A 3W3DA 2QA4N 4C23A 2QWLA 3A8YA 1VQ4N 1HKBA 2HOEA 1NGDA 2KLAA 4MDAA 3WXLA 4BGBA 4B1XB 4IO8A 3AGKA 1W2BM 2Q0RA 5TKWA 3I55N 2ZGYA 2YHWA 2F9WA 4H0PA 5M1PA 3ZEUA 3WXJA 3VGKA 4BROA 3BEXA 3FZFA 4BRGA 1HKCA 3ATVA 2CH5A 2BH1A 3G25A 4JKGA 4PKGA 2NRTA 3O9UA 4KH5A 5GINA 4YOVA 3J7ZO 2KKZA 2E2OA 1Q7YO 3MMVA 2YHYA 3VESA 2Q31A 1JCFA 3GBTA 4K43A 1VQLN 1VQPN 4H03B 3J8AA 4YOTA 3IUCA 1TUUA 3CMEN 5EY4A 3TTCA 3UKRB 1P90A 3A5OC 3O9RA 2E1ZA 1EO1A 3R9PA 1IG8A 4RWTA 4BRCA 1DEJA 3SAFA 2HBJA 4HTLA 4ILHA 2NRVA 5GAHP 1YXQA 2A42A 3VTHA 1Q18A 5JMVA 5BRFA 2CGJA 1RDUA 3FGUA 4EFHA 4EHTA 2AP1A 2E8AA 3NMUA 2VGNA 3QBXA 1BUPA 4A5BA 1GLJO 3G6EN 4MLHA 2D0PA 2EWSA 2I7PA 3SLCA 1R59O 4EAHD 1LOTB 3CCVN 1Q86O 1HX1A 2GWJA 1NGHA 2DPNA 1RGIA 4A5AA 4BVOA 3KVGA 2P9KB 3H1VX 5F0XA 3A5MC 4H5RA 2ASMA 3LM2A 3U9DA 1VQ7N 4RCHA 1DKGD 1V4TA 3VF2A 1X3NA 5E84A 4JD2B 3ZYYX 2NRWA 3BP8A 4BG9A 3I56N 1BA1A 1GLDG 2GUPA 3VEYA 2QW9A 3SMSA 5AQXA 3FE1A 3KHYA 4JHDB 3C6HA 1MA9B 3O4WA 4FL9A 4YOYA 3IKMA 2QWOA 5E26A 3E9LA 4A61A 3RSEB 4JKGB 4XH4A 2NLXA 2W41A 2A5XA 2H3GX 2ZGZA 3CERA 5BRDA 5EX5A 4IWVA 4M7YA 1GLLO 3MCPA 3EN9A 1QVGM 3PIOL 5M1FA 3HBTA 4BRLA 4Z94A 1GLBG 3CQYA 4JNEA 3FFKB 5M1KA 3FLCO 1T6DA 1XC3A 3AARA 1WUAA 3CCUN 4FWRA 1IJJA 4FWKA 2GX9A 3VEWA 1H1VA 5AQLA 1YUWA 2J4RA 4PHTX 3ENOA 3L0QA 3DAWA 5AQGA 5AQQA 3ULEB 5FPNA 3EKUA 5I9EB 3DXMB 4YOUA 1EQYA 2GELA 3R8EA 2BUPA 1MDUB 1K8AO 1P8ZA 4JKHA 1QQNA 4BRAA 4RTFD 5ADXA 3B8AX 2QI2A 1K8KB 3DXKB 3F9MA 1OKJA 4NLBA 3TSQA 4IOAL 1S72N 3CETA 5AQKA 3CXCM 4CZLA 3MK6A 5AQSA 1QHAA 1E4FT 3OBWA 4BR7A 4FVUA 3ENHA 3OA9A 3FZKA 3MWPA 4FOIA 2NRZA 2P9SA 4YOXA 4G9ZA 3CHWA 3MDQA 3OBYA 4JHDA 3VEOA 4YOWA 5AQPA 5AZIB 2YJFA 3D2EB 2VGMA 1HJOA 1W97L 3U8XA 3F2KA 1KD1O 2UYTA 5C0YA 5EOYA 2E1YA 2P9LA 5ELZA 1G99A 3M3ZA 4BR0A 5H1SQ 5M1OA 3VPZA 3H3NO 3LDNA 3O9SA 3RVCA 4CD1A 1C0FA 3SK3A 3ENBA 2ASPA 1X9JA 4H5NA 2E88A 4H0YB 3PLAA 1JCGA 2PAVA 5JLFA 1YAGA 3E9OA 1VAZA 3JS6A 3D7EO 3BF1A 3P4IA 4FWQA 5AQTA 3CQXA 4FWOA 1J6ZA 3N4QA 3HTVA 3TSPA 4BRDA 2NZTA 4H5WA 1VQMN 2QWNA 2OANA 3SBGA 3O8MA 1LCUA 5B8HA 3KWGA 2QXLA 3VETA 2P9NB 1ATNA 3MN7A 3CI5A 4H5TA 4IZ9A 1VQ8N 1GLAG 1NGBA 2A3ZA 3MN6A 2ZWHA 1U2VB 4AM6A 1ESVA 1YJWN 1K9MO 2OTJN 2FSKA 3H46O 4MO4A 2OTLN 3FZHA 4BRFA 4DHYA 2FF6A 4XH5A 4IEIA 3QBWA 2D0OA 5AQIA 4IFEA 4PL7A 4IO9L 3CC7N 3E9PA 3VTIA 5KPZA 2Q1NA 4PKIA 1SQKA 2P9NA 3BUZB 4B9QA 5F1XA 4CD3A 2PBDA 2ASOA 2YX6A 3HZ6A 3HM8A 1HUXA 1OVYA 3QB0A 3AAQA 5BREA 1YJNN 2IIRA 2FSJA 4BQLA 4CBUA 3R6MA 4BRHA 4WQ5A 1QQOA 5JLHA 2HBKA 4BGAA 3ZX0A 4BC5A 2W40A 3CJAA 2D4WA 3QDKA 3VF6A 4CBXA 5GADP 1ATSA 3ZX3A 5M1NA 4WF9L 2ZJQL 2FXUA 3C7NA 4BG8A 3CJBA 3NVMA 4JK7A 3CC2N 5MLCQ 4CZIA 3SAHA 4BVPA 3EE9A 1JCEA 4FWNA 3UB5A 4WYBA 3P38A 2GTDA 3WXIA 4K41A 2P9PA 2NRRA 3K9KA 5EXWA 3WQTA 2Q0UA 1GLEG 4O8UA 4K25A 3P31A 2RHKA 1RFQA 3LDOA 1NBWA 3K9JA 1HLUA 3WEEB 3G4SN 4A62A 3O1WA 2V51B 4DQ8A 5ADXH 4GVEA 3D2EA 5AZIA 5AZJA 3D2FB 2V7ZA 2P9SB 3O08A 5AR0A 1ILYA 3R1XA 4PL8A 2CH6A 4BR5A 4BRMA 3EL2A 4JKDA 4ILGB 4BY9C 4CZKA 2CGLA 2D1KA 1WOQA 1BA0A 5BN9A 5JVGL 3T7ZA 4CZJA 4FO0A 3HSCA 3IDHA 4WQ4A 1V4SA 4OO1J 4BC3A 1U6ZA 3DXMA 3CMAN 3IMXA 4CZFA 5KPTA 3I8BA 3CJ9A 1ZC6A 4IDHA 5AQJA 4BRKA 1KAXA 1XUPO 3EE8A 3O9TA 5CR4A 1TYQA 3VOVA 3CJCA 5LJWA 1S3XA 3L4QA 1NJIO 3CD6N 3O6WA 3AY9A 4WFBL 4BRPA 3QMLA 5AQVA 4AF1A 4H0XB 4QS9A 3CCMN 1Y64A 1Z05A 4IOCL 5C15A 4DCHA 5AQWA 3VMFB 1NLVA 3O9QA 4I6MB 5GIPA 4WFAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1F A;  5M1K A;  5C15 A;  4IEE A;  3C6H A;  3C6A A;  4IDH A;  4IEI A;  5M1O A;  5M1Q A;  4IFE A;  5M1N A;  5M1P A;  5C12 A;  5C2D A;  5C2F A;  3CPE A;  5C10 A; 
#chains in the Genus database with same CATH topology
 5KPR A;  3QNN A;  4CHQ A;  3DLB A;  4OGC A;  4NO7 A;  3O5B A;  5KTQ A;  3CCE N;  3CJ7 A;  2A41 A;  4M3T A;  4J8F A;  1WAF A;  1JLA A;  2NUB A;  2O8F A;  2FF3 B;  3SMP A;  4BAC A;  4ISE A;  3HXM A;  5BPL A;  1M90 O;  3SQ0 A;  4CEQ A;  2NRH A;  1VSF A;  3ZSO A;  3EO3 A;  1GLF O;  3L3V A;  1NMN A;  2KZM A;  4WQ4 C;  3F5T A;  3P39 A;  3ZX2 A;  1EKE A;  3G71 N;  1VRT A;  5HRP A;  4EP5 A;  4W5O A;  1I3A A;  3TWH A;  1NKC A;  1X9M A;  1D9F A;  3H6E A;  2VWB A;  4CFC A;  4HCC A;  3IFR A;  5DMR A;  3RSE A;  1QZ5 A;  1HNI A;  3KLF A;  3MEC A;  1ZBL A;  5AZJ B;  1SL2 A;  1RBU A;  3ZSY A;  1RBT A;  3EYZ A;  3V1O A;  1CZ9 A;  3O4N A;  1IV0 A;  5CHI A;  4H0V B;  2HNY A;  1NGG A;  4DTX A;  1NWK A;  1BOT O;  3QNO A;  5I3U A;  2KHO A;  3HRG A;  4KHS A;  3TPQ A;  3OYH A;  4FWM A;  4JI0 K;  4F9O A;  4NLC A;  5KQ8 A;  1MWK A;  1FJG K;  4DWI A;  3I33 A;  2Q36 A;  3LAL A;  3MCA B;  5JIC A;  2P9U A;  4FW1 A;  1A5X A;  3Q7B A;  3A0I X;  3AVA A;  4B8A B;  1TAU A;  5SZT A;  3VQD A;  4QOZ B;  1S1T A;  4CHZ A;  4Y1C A;  3V9W A;  4F3T A;  2UUB K;  2X6S A;  3U4L A;  1RT5 A;  1NK5 A;  1VQ5 N;  4DV7 K;  1N6Q A;  3ATU A;  4JRQ A;  3OS1 A;  3NF9 A;  4O4G A;  4BRN A;  3LP3 A;  4R5P A;  2I7N A;  4MO5 A;  2VWJ A;  4C8N A;  4Y1D A;  4CJF A;  4N47 A;  4Z4E A;  5GAG P;  1FK9 A;  1RDD A;  3CCR N;  1N33 K;  2OYQ A;  1KC8 O;  2E2P A;  4CVN E;  3WNG A;  3WQU A;  3NDK A;  3QEI A;  4YOR A;  4Z4G A;  1NGI A;  2BGG A;  3OYN A;  5AQM A;  5KRT A;  4LH5 A;  2VYP A;  1T3V A;  1VHX A;  3CCJ N;  2BTF A;  2PZS A;  2IDO A;  5JS2 A;  3C6U A;  4JKB A;  3PSI A;  4N76 A;  4CJ5 A;  2R7Y A;  1NJW A;  3WUH A;  1NOY A;  1SL1 A;  2HVH A;  1HNZ K;  3QIC A;  5HOO A;  1WBD A;  1TK5 A;  3U9Z A;  4HUF A;  3KK7 A;  5HL7 L;  3WNF A;  1OH7 A;  1JJ2 M;  4J2E A;  4BC4 A;  1XMQ K;  3V9S A;  1XHX A;  5AQH A;  2JWL A;  1TGO A;  1QS4 A;  5JVH L;  3HOS A;  1ITG A;  1D4X A;  3L6Q A;  4IXC A;  4CHN A;  4EHU A;  4AIL C;  4DFP A;  3LL3 A;  4DS4 A;  2JWK A;  4BE0 A;  2QWM A;  1LAW A;  3PO4 A;  3K5N A;  4FZY A;  1XQS C;  4CF8 A;  3VQ8 A;  1YJ9 N;  4FWP A;  3M8S A;  3EZW A;  1VSM A;  3UKR A;  4FJK A;  1QZ6 A;  3NGZ A;  4LF4 K;  4EZ6 A;  2F4V K;  3N4P A;  2QWL A;  3A8Y A;  1VQ4 N;  2HOE A;  3WXL A;  4IO8 A;  1W2B M;  4LF9 K;  5TKW A;  1TL3 A;  2YHW A;  2ZGY A;  5HRS A;  2F9W A;  3WXJ A;  4BRG A;  1NK7 A;  1HKC A;  2IC3 A;  4DQR A;  2BH1 A;  3AVI A;  4ELU A;  3TAE A;  2E2O A;  3MMV A;  4NCA A;  2YHY A;  3VES A;  3AO5 A;  1VRU A;  3NF8 A;  1HNX K;  3J8A A;  3OTO K;  3IUC A;  3VQC A;  3CME N;  3DRS A;  2G8I A;  3TTC A;  3KKS A;  2E1Z A;  3ZSR A;  1J54 A;  4CFD A;  4RWT A;  4CGJ A;  5BRF A;  4DTM A;  3TAG A;  4EFH A;  4EHT A;  2AP1 A;  2E8A A;  3SUN A;  3QBX A;  3SQ4 A;  3G6E N;  4MLH A;  1LOT B;  5J2N A;  1BIS A;  4A5A A;  4BVO A;  1C0U A;  2P9K B;  4DV0 K;  3SZ2 A;  3MED A;  3LM2 A;  1N5Y A;  3PX0 A;  3LZJ A;  3MXJ A;  3I56 N;  1HJR A;  1C6V A;  5AQX A;  2YKN A;  3FE1 A;  4FL9 A;  1MA9 B;  3AO2 A;  4YOY A;  3IKM A;  3E9L A;  3KK1 A;  4JKG B;  3AVC A;  3M8R A;  2A5X A;  3OS2 A;  1QQC A;  2X6N A;  1GLL O;  3MCP A;  3EN9 A;  3AO1 A;  4X64 K;  5M1F A;  1NK0 A;  1GLB G;  4LH4 A;  3RRH A;  3OYM A;  1T6D A;  4FXD A;  3AAR A;  2GX9 A;  4M45 A;  4OGE A;  1VSI A;  5I42 A;  1TKZ A;  5FPN A;  3NH0 A;  2QKK A;  2GEL A;  4CED A;  4CJP A;  1MDU B;  5HLF A;  1QQN A;  1QSY A;  1JLG A;  2QI2 A;  4CK2 A;  3DXK B;  4NLB A;  1QHT A;  3CET A;  2LSN A;  5AQK A;  3CXC M;  3THX B;  1MU2 A;  5AQS A;  3ZLJ A;  3OBW A;  4CGG A;  3ENH A;  3OVN A;  4OX9 K;  1JXB A;  3AVG A;  4CJR A;  3SNN A;  3CHW A;  3OBY A;  4JHD A;  3VEO A;  2UU9 K;  2VGM A;  4KHP K;  4DU4 A;  1W97 L;  3U8X A;  3PX6 A;  2UYT A;  2P9L A;  3THW B;  3M3Z A;  3M8Q A;  3S3O A;  3LDN A;  3HK2 A;  3O9S A;  1WSJ A;  4CD1 A;  1VSJ A;  4CJV A;  3ENB A;  1X9J A;  4H5N A;  1RTH A;  2E88 A;  1NKB A;  1IKY A;  2PAV A;  3DLK A;  1YAG A;  3E9O A;  4BWJ A;  3N4Q A;  2OPS A;  4KB0 A;  4BRD A;  5K14 A;  1VQM N;  4DQQ A;  5B8H A;  1UWB A;  2QXL A;  3HPH A;  2P9N B;  4N5S A;  2G8W A;  4IZ9 A;  3RR8 A;  1GLA G;  1YJW N;  2UUC K;  4LFC K;  4AM6 A;  1ESV A;  3KTQ A;  3QBW A;  1WLJ A;  4IFE A;  3ISN C;  4PL7 A;  3OYF A;  2Q1N A;  4PKI A;  1SQK A;  4YFU A;  1IH7 A;  2YX6 A;  3QB0 A;  1OVY A;  1HRH A;  3AAQ A;  1QE1 A;  1QSS A;  3OJU A;  3CJA A;  3QDK A;  1RTD A;  2O4I A;  3DOK A;  1KRP A;  3C7N A;  1T03 A;  3CC2 N;  3QEP A;  3HPO A;  1JCE A;  4FWN A;  4HCB A;  4WYB A;  3P38 A;  4B3O A;  4HTU A;  3K9K A;  2NRR A;  4ZTF A;  4O8U A;  3NGI A;  5LMU K;  1RFQ A;  1NBW A;  3K9J A;  1HLU A;  3WEE B;  3G4S N;  4A62 A;  2VG7 A;  5AZJ A;  3O08 A;  1ILY A;  2HHW A;  2CH6 A;  1KTQ A;  3ZT2 A;  5C25 A;  4B9U A;  4YNQ A;  1SKR A;  3D0P A;  3DOL A;  4BY9 C;  3F9K A;  2O8E A;  2D1K A;  5JVG L;  3I8D A;  3ZT4 A;  4FLU A;  2HW3 A;  1VSH A;  1Q8I A;  5HRO A;  3AVB A;  3AA5 X;  1LWC A;  3O9T A;  3VOV A;  3AO3 A;  1KVA A;  3CD6 N;  1RT1 A;  4AF1 A;  4H0X B;  2KQ2 A;  1Y64 A;  4JI5 K;  5C15 A;  2OCE A;  4CJT A;  4DQI A;  4CER A;  2HHU A;  5J2M A;  3TAN A;  4GV3 A;  1CXU A;  3ID8 A;  4CJ7 A;  4M3W A;  4L3Q A;  4AHR A;  3CC4 N;  1KXP A;  3AVK A;  1FXX A;  3UKU A;  3VEN A;  3MXM A;  3O80 A;  4KV8 A;  5D3G A;  1W9H A;  3EY1 A;  4B08 A;  5BR8 K;  1YF5 L;  2E4L A;  4PWD A;  2QXF A;  4AHT A;  5JS1 A;  3L4I A;  1C1B A;  5J2P A;  1NGE A;  4FJX A;  4BE1 A;  4CJS A;  1NGA A;  5GAE P;  4A2B A;  1NOZ A;  3O1B A;  4FJN A;  4A57 A;  2A1R A;  3NAE A;  4CZM A;  3SJH A;  4CEB A;  2B6A A;  5SWM A;  3TAB A;  4XEI A;  1E4G T;  3OYK A;  4UY8 O;  4M3R A;  4JKE A;  3LP0 A;  4CK3 A;  3MXI A;  3TTF A;  3MEE A;  4A2A A;  5AQN A;  3CFO A;  5CE3 A;  3DM2 A;  3DLG A;  5CYQ A;  2IVO A;  1VQK N;  3VQP A;  1WSI A;  3D2F A;  5KI6 A;  5GIO A;  4BR9 A;  4NXN K;  4HHT A;  1RTJ A;  3IRX A;  4FWL A;  3C0B A;  4O5F A;  5HRR A;  3DLR A;  1JKH A;  1QVF M;  1LWF A;  1RDA A;  1L3V A;  4FWS A;  2WFB A;  5AJ3 K;  5TKY A;  3CPE A;  1NMD A;  1Y97 A;  4DQP A;  4E1N A;  2VG5 A;  4RW8 A;  5BN8 A;  2HBL A;  3TAM A;  3GOI A;  3HT3 A;  4FPB A;  4AM7 A;  4K42 A;  4YDU C;  2HHT A;  3PV8 A;  4DTJ A;  1VQ9 N;  1LW2 A;  1NGJ A;  1ASU A;  2HHH K;  3V81 A;  3H45 C;  3JYT A;  3ALY A;  4OPH A;  3QO9 A;  4B9V A;  1Q82 O;  4DV1 K;  1UA0 A;  4WQ5 C;  3ZSX A;  1JLB A;  4JAX A;  3ZT3 A;  2HMP A;  4X66 K;  1VQN N;  4MLE A;  3VQ9 A;  4Y0W A;  4EZ9 A;  4KI4 A;  4H4O A;  5BPM A;  2JLE A;  4ISG A;  3SBT A;  4ELV A;  2HF3 A;  3TTD A;  3HOT A;  3NGY A;  4E7K A;  2CGK A;  1ZBS A;  3C65 A;  2D5R A;  2WBN A;  3JXU A;  1U2V A;  3U6F A;  1S5J A;  1G15 A;  5AQR A;  3OW2 M;  3NF6 A;  1A5V A;  3CF5 L;  5FPE A;  4KBO A;  1IKX A;  1NGF A;  2YHX A;  3T1A A;  4HWI A;  2IVP A;  1K73 O;  3VF4 A;  1RBV A;  2XY5 A;  4IG3 A;  4H4M A;  4JI7 K;  4H0T B;  1ATR A;  5KQD A;  2PYJ A;  4LSN A;  1RDB A;  4F2S A;  2P51 A;  4OLA A;  1TUY A;  4LF5 K;  3TI0 A;  4DSL A;  1O13 A;  1ZXO A;  4LFB K;  3V9U A;  5LL6 Z;  3SAG A;  3FFI A;  1HKG A;  3CQ8 A;  1BWF O;  3HPG A;  4DF8 A;  3FZM A;  3MWT A;  3CPW M;  1RDC A;  1N8R O;  4JV5 K;  2HBM A;  1CLQ A;  3VQ6 A;  3DMJ A;  4CJW A;  3UE5 A;  4KHQ A;  1X9S A;  1TK0 A;  4CF2 A;  1WB9 A;  4U7B A;  2YNG A;  2P1J A;  1N34 K;  3SCX A;  3QFU A;  3C94 A;  4I6M A;  2RE2 A;  4WFN L;  3T1Y K;  4DSI A;  3WXM B;  1VSL A;  4Z0U A;  4OJR A;  3ID6 A;  1XMO K;  3SPZ A;  2IGI A;  1TKX A;  3G0Z A;  1DT9 A;  3OY9 A;  3LDP A;  3DWL A;  1YIT N;  2YJE A;  3A5N C;  1VSK A;  4JD2 A;  4H0O A;  4FPA A;  1XHZ A;  2YKM A;  2BAN A;  3AA3 A;  3OHR A;  1BI4 A;  1TVR A;  2QA4 N;  1BIU A;  1ZYQ A;  2G8F A;  1NGD A;  4B1X B;  4IKF A;  4JS4 A;  2ZM6 K;  2Q0R A;  2G8U A;  4DR3 K;  1OH8 A;  5M1P A;  4TSX A;  3ATV A;  1FKO A;  3J7Z O;  4KH5 A;  1L3S A;  4CJ4 A;  2KKZ A;  4NYN A;  1S9G A;  1NK4 A;  1VQP N;  3HM9 A;  3NCI A;  3MEG A;  3LPU A;  3THW A;  4FJI A;  4CIF A;  1TAQ A;  1EO1 A;  3PO5 A;  5GAH P;  2NRV A;  2A42 A;  1BL3 A;  1Q18 A;  4BDP A;  5JMV A;  3HP6 A;  1L3U A;  1I39 A;  3VQA A;  1GLJ O;  3P5J A;  3SLC A;  1D8Y A;  3BGR A;  2YNF A;  2GWJ A;  2DPN A;  4KHW A;  3KVG A;  3TAR A;  4JRP A;  1I94 K;  2JGU A;  5E84 A;  1C1C A;  3ZYY X;  3BP8 A;  4BG9 A;  1GLD G;  2GUP A;  3VEY A;  4B3R K;  3RR7 A;  3KHY A;  4DQS A;  3C6H A;  3O4W A;  4KRE A;  2VQF K;  4A61 A;  1ZBU A;  2NLX A;  2PY5 A;  2H3G X;  5EX5 A;  4IWV A;  2YV0 X;  4O0I A;  2UUA K;  1S1U A;  1S9E A;  1QVG M;  3HBT A;  4BRL A;  4LY7 A;  4JNE A;  4RW6 A;  1SKW A;  4CGH A;  2DTU A;  1BI4 B;  3FLC O;  1XC3 A;  1WUA A;  3CCU N;  2EHG A;  4FWK A;  3O3H A;  4FLT A;  3K5L A;  1UAX A;  4PHT X;  2XY6 A;  3DAW A;  2OA8 A;  1GOB A;  3EKU A;  3VQ4 A;  4YOU A;  3LDS A;  1T05 A;  2HND A;  3TAP A;  1C0M A;  5ADX A;  1KCF A;  3V4I A;  2Y1I A;  3B8A X;  2QKB A;  3F9M A;  3TSQ A;  4IOA L;  1S72 N;  2O8E B;  4BR7 A;  1YTA A;  4FVU A;  3RMA A;  3NBP A;  4K8X A;  1REV A;  4YOX A;  4G9Z A;  2O8B A;  2YJF A;  4K8Z A;  1EX4 A;  3F2K A;  5C0Y A;  5EOY A;  2E1Y A;  1G99 A;  3O3G A;  5M1O A;  4OPJ A;  3ZSW A;  1NNE A;  4E1M A;  2ASP A;  1NK6 A;  1TKT A;  1JCG A;  5J1E A;  2RN2 A;  1VAZ A;  4IG0 A;  5AQT A;  3JS6 A;  3BF1 A;  3P4I A;  3P83 D;  3CQX A;  4FWO A;  3TSP A;  3HTV A;  4DSJ A;  2QWN A;  4BDY A;  1ATN A;  3MN7 A;  4CF0 A;  4H5T A;  4E0D A;  2QK9 A;  4E7J A;  2OTJ N;  2ZWH A;  1U2V B;  3RMD A;  1K9M O;  2FSK A;  1WNS A;  3FZH A;  2FF6 A;  4XH5 A;  3IG1 A;  4IEI A;  5AQI A;  2D0O A;  3A2F A;  3VA0 A;  1U48 A;  2P9N A;  4KHY A;  2VQE K;  2ASO A;  1RT3 A;  3HM8 A;  1HUX A;  1OH6 A;  2IIR A;  4BQL A;  3R6M A;  1QQO A;  3ZX0 A;  2W40 A;  3VF6 A;  5GAD P;  3QEV A;  4J2A A;  2FXU A;  4LF8 K;  4FJ8 A;  4CZI A;  3SAH A;  4B9M A;  4F8R A;  4NCB A;  2GTD A;  2FBT A;  5EXW A;  2P9P A;  1YTU A;  1GLE G;  4DV5 K;  1HQE A;  3P31 A;  4DU1 A;  4E7H A;  2P5G A;  4DQ8 A;  3SUO A;  3J81 O;  4DSE A;  4CEE A;  2UXC K;  4DUY K;  3EL2 A;  4DSK A;  4B9T A;  1E3M A;  4CZK A;  3SQ1 A;  2CGL A;  3CFR A;  3THX A;  2BDP A;  2O8D B;  5BN9 A;  4CEZ A;  4CE9 A;  4FO0 A;  1V4S A;  2OPQ A;  1DTT A;  1U6Z A;  3CMA N;  3IMX A;  3CJ9 A;  4FZX C;  1KAX A;  1VSD A;  5LJW A;  4JI2 K;  3CJC A;  4DFM A;  2Z1G A;  4BWM A;  3O6W A;  3OYA A;  3AY9 A;  3L2W A;  4WFB L;  3QML A;  5AQV A;  3CCM N;  3IS9 A;  1IKW A;  4CIE A;  3UIQ A;  4IOC L;  3VQ5 A;  2HHS A;  3QIN A;  3VMF B;  2D0A A;  3O9Q A;  1KFD A;  4WFA L;  1KAY A;  5AQY A;  1BGX T;  3ZET A;  2O8D A;  2QM1 A;  4GY2 B;  2P9I A;  3P1G A;  3AVF A;  1Q81 O;  2YI1 A;  3I0S A;  1KVB A;  4LD0 A;  5C12 A;  5C2D A;  4IEE A;  2V52 B;  5CYM A;  3ULD A;  3EZ5 A;  4I7F A;  1W7A A;  4OKK A;  2PFU A;  2IS3 A;  1NGC A;  1TYQ B;  2P9P B;  1YHQ N;  2B5J A;  4JN4 A;  4DF4 A;  4PKH A;  2WTU A;  1QSL A;  4NB4 A;  3SPY A;  4I9Q A;  4M3Z A;  4U67 L;  2WUS A;  2FSN A;  3QLH A;  4LF6 K;  4CEF A;  2G8V A;  2WON A;  4CI6 A;  1RTI A;  3KIO A;  3S3N A;  1A5W A;  3CJ1 A;  3QFP A;  4B1U B;  4CK1 A;  5DM6 L;  3E1Y A;  4R79 A;  1XNR K;  3AVJ A;  4C8L A;  1CZB A;  4RG8 A;  4BRI A;  4DKW A;  5LY3 A;  1C0G A;  4DFK A;  1NM1 A;  4YY3 K;  3SUP A;  3PY8 A;  2HHX A;  3VQ7 A;  4DG1 A;  4W5T A;  3GE1 A;  1KAZ A;  2P9K A;  3HL8 A;  3SQ2 A;  1BCM A;  4M3X A;  4FLV A;  4A59 A;  4CFB A;  3JSM A;  1MWM A;  1SS6 A;  2GUI A;  4J2B A;  3DLH A;  1HYZ A;  4ZTJ A;  3GDQ A;  5EVZ A;  4CZH A;  4CJK A;  1Q9Y A;  1LV5 A;  4B9L A;  3H1Q A;  1QTM A;  4GV9 A;  4BRQ A;  3AGR A;  3VA3 A;  3LM9 A;  2OZS A;  2EX3 A;  1RT6 A;  3J7A P;  2A40 A;  3PSF A;  5EU7 A;  1S6Q A;  2QWP A;  3S9H A;  3ZSQ A;  4CZG A;  2W6L A;  3DLL L;  4AHV A;  3G10 A;  1T44 A;  3C6A A;  1DGK N;  3D6R A;  3VQQ A;  3I0R A;  3S41 A;  4CFA A;  1SAZ A;  3VGL A;  3ASM A;  4JKC A;  3MN9 A;  3GL1 A;  4FM0 A;  3ITH A;  3OYJ A;  5C2F A;  3K59 A;  3KZB A;  4FJH A;  4CJQ A;  4KHN A;  3R3L A;  4JK9 A;  5AQF A;  5AQZ A;  2B4J A;  4B1Z A;  5FRO A;  4OPA A;  3RRG A;  2UXD K;  3M8P A;  3HVR A;  2A6A A;  2F7T A;  4JKA A;  1M1K O;  3QIP A;  3QES A;  4BRE A;  4FCY A;  3TSU A;  3M1F A;  1BDG A;  1BHL A;  4ICL A;  1X3M A;  4IOX A;  4DV2 K;  4FYD A;  4IBN A;  2VCP A;  4B3T K;  1J5O A;  2ZJP L;  1N36 K;  2ZJR L;  3KKR A;  5CZ1 A;  1L5U A;  4C1N I;  3TAQ A;  5AFU H;  3KLI A;  3OYB A;  1VQO N;  1GLC G;  3CCL N;  4FLX A;  1YVN A;  4QS7 A;  2E20 A;  4JEP A;  4B1Y B;  3K2P A;  1TV6 A;  3CIP A;  4DV4 K;  4X62 K;  4KB1 A;  2DY4 A;  4B1W B;  4JI6 K;  4O8K A;  4CBW A;  2ZD1 A;  4DR5 K;  4EIA A;  3IAY A;  4CJL A;  3ZCM A;  1HNV A;  1IBK K;  3VGM A;  3DLE A;  4DTR A;  4JI3 K;  3M5R A;  2Q97 A;  4M63 C;  2GBZ A;  4J2D A;  2E6M A;  2O4G A;  1RT4 A;  2YHA A;  3CCS N;  1YIJ N;  4LC9 B;  2FLO A;  1RBR A;  3OYC A;  3NF7 A;  3THV A;  3HP9 A;  3V6D A;  3QIO A;  2E2Q A;  2UXB K;  4FK0 A;  3FZL A;  2Q2R A;  4OVL A;  4FM2 A;  3DXK A;  2IOC A;  4JK8 A;  1UA1 A;  4YDU A;  3BY5 A;  5FPM A;  3QEX A;  2P9U B;  3ZSV A;  4DFJ A;  2QWQ A;  1HNW K;  1CZA N;  3MN5 A;  3W0L A;  3WNE A;  3H3O B;  3K0S A;  4IJA A;  3HI0 A;  5FDL A;  1HPM A;  2NRX A;  3TU5 A;  3WT0 A;  3W3D A;  1KSP A;  1HKB A;  2OPR A;  4BGB A;  3U3G A;  4M42 A;  3AGK A;  3QER A;  3I55 N;  2XRI A;  3VGK A;  2ITG A;  3BEX A;  4CJE A;  4PKG A;  2CH5 A;  4JKG A;  1S1X A;  4CHO A;  1Q7Y O;  1WSH A;  1JCF A;  2Z1I A;  1NG9 A;  4H03 B;  4CES A;  5CZ2 A;  5FRN A;  3A5O C;  4E89 A;  3O9R A;  4FJ9 A;  2Z1J A;  1DEJ A;  3SAF A;  2HBJ A;  4HTL A;  1JLC A;  4ILH A;  1YXQ A;  2ZE2 A;  3CM5 A;  2CGJ A;  3ZT0 A;  1NJY A;  4DS5 A;  4CIG A;  4WE1 A;  3NMU A;  1IG9 A;  2VGN A;  1BIZ A;  4DU3 A;  4A5B A;  4H8K A;  2D0P A;  3CCV N;  1R59 O;  1SL0 A;  4CGD A;  2FBY A;  4E3S A;  1HX1 A;  1RGI A;  4W5R A;  3L2V A;  3U9D A;  1S6P A;  2ASM A;  1O1W A;  4OPK A;  1VQ7 N;  4RCH A;  1DKG D;  1V4T A;  1FW6 A;  3LAK A;  2XHB A;  1NK8 A;  4QCL A;  4CCH A;  1RT2 A;  5E26 A;  3RSE B;  3LPT A;  4C8K A;  2ZGZ A;  5BRD A;  3EEQ A;  3OS0 A;  2F96 A;  3B6O A;  5M1K A;  4JI4 K;  4FWR A;  1IJJ A;  4ZHR A;  3VEW A;  1J53 A;  1KLN A;  5AQL A;  2FBV A;  4Z4C A;  2J4R A;  3LWM A;  4LFA K;  3ENO A;  4BE2 A;  4CEO A;  4E19 A;  4AHU A;  2O8F B;  3DXM B;  3HJF A;  3R8E A;  2BUP A;  1F21 A;  3J80 O;  4DTS A;  1OKJ A;  4F3O A;  4CZL A;  2ZQB A;  3MK6 A;  2F8T A;  1QHA A;  1GOA A;  1HYV A;  2VG6 A;  4G1Q A;  3SI6 A;  3OA9 A;  3C95 A;  4FOI A;  2NRZ A;  2P9S A;  3O3F A;  1Z25 A;  4CGI A;  1NJZ A;  5AQP A;  1S1W A;  5AZI B;  1KD1 O;  5ELZ A;  4BR0 A;  2KW4 A;  3K5O A;  3RVC A;  3LAM A;  1EET A;  3SK3 A;  4JS5 A;  1XWL A;  2DFF A;  1CXQ A;  4H0Y B;  3RMB A;  2ATQ A;  2Z1H A;  4NXM K;  1RT7 A;  2BE2 A;  4PUO A;  2P5O A;  4H5W A;  2OAN A;  3SBG A;  3O8M A;  1LCU A;  4FJL A;  4E7I A;  2W42 A;  3U3Y A;  4RW7 A;  4FM1 A;  3CI5 A;  1VQ8 N;  2XY8 A;  1NGB A;  2A3Z A;  3MN6 A;  3KD5 E;  2OTL N;  4BRF A;  4W5Q A;  2HHQ A;  3VTI A;  3L8B A;  4O44 A;  3BUZ B;  4B9Q A;  5F1X A;  1WSF A;  3AV9 A;  3HZ6 A;  4CF1 A;  1Z26 A;  2FSJ A;  1XI1 A;  1KLM A;  4CBU A;  1BCO A;  1XC9 A;  3D45 A;  2HBK A;  5DK5 A;  4BGA A;  4AQY K;  4EP4 A;  1BQM A;  2D4W A;  3KLH A;  4AH9 A;  1ATS A;  3ZX3 A;  5M1N A;  4WF9 L;  2ZJQ L;  2Y1J A;  1U45 A;  4BG8 A;  3NVM A;  4JK7 A;  3JAM O;  4AHC A;  3J7Y P;  3B6P A;  3UB5 A;  4K41 A;  3WQT A;  1GOC A;  3KJV A;  4K25 A;  1BQN A;  2RHK A;  3LDO A;  4FJ7 A;  2RPI A;  1K8A O;  4Z4F A;  2V51 B;  4GVE A;  3D2E A;  4FLZ A;  5HP1 A;  1FKP A;  4FJ5 A;  3NH2 A;  1WAJ A;  3HVT A;  1JLQ A;  5AR0 A;  4DR4 K;  3R1X A;  3HST B;  4BR5 A;  4LSL A;  4JKD A;  4YHH K;  4ILG B;  1J9A A;  4F2R A;  1RCH A;  4N56 A;  1KVC A;  3DRR A;  1HR0 K;  4LF7 K;  1BA0 A;  3CM6 A;  1ASV A;  1N32 K;  4KPY A;  3OYD A;  3T7Z A;  4CZJ A;  3IDH A;  4FVM A;  4OO1 J;  4PA1 A;  4IFV A;  4BDZ A;  1R0A A;  5KPT A;  3I8B A;  5AQJ A;  3L2U A;  2PYL A;  1D5A A;  1TYQ A;  1S3X A;  3L4Q A;  1NJI O;  2HMI A;  4BRP A;  3QET A;  4QS9 A;  1Z05 A;  2KZZ A;  5AQW A;  1D9D A;  3ZT1 A;  5GIP A;  1HYS A;  2P9I B;  4KRF A;  2W6K A;  1JLE A;  4MQ3 A;  3TR8 A;  1SV5 A;  4E1J A;  5A2Q O;  4CF9 A;  4B3S K;  1WN7 A;  3K58 A;  4GVM A;  4BR4 A;  2YHB A;  2DFH A;  3VQB A;  4DR2 K;  4HVJ A;  5T7B A;  5LMN K;  4M7X A;  3VEX A;  3HYF A;  2DFE A;  1J5E K;  4KH6 A;  3VEZ A;  3VER A;  4JKF A;  2G8H A;  3BF3 A;  4X65 K;  4I2P A;  1EWQ A;  4DR6 K;  3LDQ A;  3M6G A;  3KLG A;  1HPZ A;  2GEM A;  2WC9 A;  4ILJ A;  2ZF5 O;  2QTD A;  2HHV A;  4I2Q A;  3VEV A;  3NE6 A;  4GV6 A;  3AAP A;  3T3F A;  5LJV A;  2A1S A;  2QEX N;  4IDK A;  3WNH A;  3Q7C A;  5AFU A;  1TL1 A;  3AA2 A;  1SZ2 A;  2I5J A;  3CFP A;  1IKV A;  1RBS A;  3ZEU B;  3V1Q A;  2YCH A;  1X1P A;  4DUZ K;  4Q0B A;  3GG4 A;  4DMN A;  1B9F A;  1S22 A;  3A5L C;  4XIU A;  1K6Y A;  3NHG A;  1VQ6 N;  4DV3 K;  2FC0 A;  1JLF A;  3THY B;  3MX2 A;  3T69 A;  3LP1 A;  4DV6 K;  3CCQ N;  1BU6 O;  4DTO A;  1QQM A;  2IVN A;  5C10 A;  1SUQ A;  2P9L B;  4CHY A;  5CY4 A;  1T7P A;  4QS8 A;  1RNH A;  3LZI A;  2HST A;  3K57 A;  5BPN A;  2NNW A;  3SJJ A;  4NYF A;  3DJC A;  4DB3 A;  2XO7 A;  1U49 A;  2F9T A;  4NCG A;  3KK2 A;  4DLE A;  2V7Y A;  4DSF A;  1YI2 N;  2QWR A;  3LDL A;  1DTQ A;  4GW6 A;  4H5V A;  5DM7 L;  4XH1 A;  1WSG A;  3EKS A;  4B1V A;  4CZE A;  4BQZ A;  3UKU B;  4B9N A;  4O0J A;  1DLO A;  5AQU A;  1NJX A;  3H08 A;  2O8B B;  1T6C A;  4MDB A;  1JL2 A;  1L3T A;  4K0K K;  1YT3 A;  3NVK A;  1Z6R A;  2E5L K;  4KH4 A;  1U4B A;  4B9S A;  4CGF A;  1UOC A;  4B3M K;  3AVN A;  3KWI A;  3FR0 A;  4GNI A;  4GKJ K;  2ITM A;  4WCE L;  4BR2 A;  2WOM A;  1IBL K;  1HMV A;  3E01 A;  4O55 A;  5BR9 A;  4KKO A;  4RW4 A;  4HUE A;  3E66 A;  2G8K A;  4F4K A;  4FOE A;  2AA4 A;  3SUQ A;  5KGW A;  1C0T A;  5F2R A;  5IWA K;  2YNI A;  1BO5 O;  4IJN A;  4BC2 A;  3C6T A;  1BG3 A;  1KQS M;  3DRP A;  3PIP L;  3AVL A;  2HF4 A;  1KFS A;  3L2R A;  4ISF A;  3ZET B;  4FJM A;  4M3Y A;  4RW9 A;  3AO4 A;  5BRH A;  3WXK A;  1RDW X;  2GWK A;  4C1N K;  1K8K A;  4IFY A;  4FZZ A;  3S3M A;  5AQO A;  1B92 A;  3WEE A;  1U47 A;  3MX5 A;  5M1Q A;  3ULE A;  5FPD A;  2RKI A;  4C8O A;  3OYI A;  3RTV A;  4FSV A;  3C7N B;  2E2N A;  4DR1 K;  3T1H K;  4C23 A;  1Q9X A;  2KLA A;  4MDA A;  3LWL A;  4JLH A;  3LP2 A;  4FJJ A;  4OKE A;  3L2Q A;  4H0P A;  3ZEU A;  1B9D A;  5J2Q A;  4BRO A;  3FZF A;  5FRM A;  5GIN A;  3G25 A;  2NRT A;  3O9U A;  4CEC A;  4PY5 A;  3T19 A;  1NKE A;  1LW0 A;  4V19 S;  2Q31 A;  1S1V A;  3GBT A;  4K43 A;  1VQL N;  4YOT A;  1TUU A;  3HO1 A;  5EY4 A;  4AHS A;  3UKR B;  3NFA A;  1P90 A;  2X74 A;  2FBX A;  3K5M A;  3R9P A;  1IG8 A;  4BRC A;  1X9W A;  3VTH A;  2AJQ A;  4KTQ A;  1RDU A;  3FGU A;  3OYE A;  1BUP A;  1NU0 A;  2EWS A;  2I7P A;  4EAH D;  1Q86 O;  3DI6 A;  1JXE A;  1NGH A;  2YNH A;  3H1V X;  5F0X A;  3KK3 A;  3A5M C;  5KRS A;  4H5R A;  4CEA A;  4FJG A;  1TK8 A;  3VF2 A;  1X3N A;  4JD2 B;  2NRW A;  1BA1 A;  4HUG A;  3F73 A;  2QW9 A;  3BZC A;  3SMS A;  4Q5V A;  3OYL A;  1LAV A;  4JHD B;  5FLX O;  4YOW A;  2QWO A;  4CJU A;  2Q3S A;  4OKJ A;  4XH4 A;  1NK9 A;  2W41 A;  2OPP A;  3AA4 A;  4ID5 A;  3CER A;  4M7Y A;  4Z4I A;  3V9Z A;  5C24 A;  3PIO L;  4FW2 A;  3CQY A;  4Z94 A;  4ELT A;  3FFK B;  4CHP A;  1U04 A;  1ZBI A;  3AVH A;  1H1V A;  1YUW A;  1YVU A;  4MFB A;  3L0Q A;  5AQG A;  5AQQ A;  3ULE B;  5I9E B;  3AVM A;  1ASW A;  1EQY A;  4PQU A;  4KO0 A;  1P8Z A;  4JKH A;  4BRA A;  4RTF D;  1K8K B;  3O4Q A;  4M3U A;  1E4F T;  3CYM A;  5KGX A;  4Z4H A;  1W0H A;  3FZK A;  4FLW A;  3MWP A;  4QAG A;  1VSE A;  4JI1 K;  3MDQ A;  3BDP A;  3D2E B;  4JI8 K;  1HJO A;  3DYA A;  5H1S Q;  2XY7 A;  2HNZ A;  1HQU A;  4L8R B;  3VPZ A;  2D0C A;  3H3N O;  3OYG A;  3QEW A;  3L3U A;  3CG7 A;  5E41 A;  5HBM A;  2IAJ A;  1C0F A;  1XNQ K;  4DTN A;  4KFB A;  3PLA A;  5JLF A;  4FK2 A;  3VN5 A;  4KHU A;  4DR7 K;  3D7E O;  4FWQ A;  2OZM A;  1J6Z A;  2KFN A;  2NZT A;  3KWG A;  3VET A;  2D0B A;  4GKK K;  5HRN A;  3KLE A;  3MAQ A;  1IO2 A;  2KTQ A;  1EXQ A;  4DTU A;  3H46 O;  1JL1 A;  4MO4 A;  4KAZ A;  4DHY A;  3SYZ A;  2RF2 A;  4IO9 L;  3CC7 N;  3E9P A;  5KPZ A;  5C42 A;  4CD3 A;  1VK0 A;  2PBD A;  1EWR A;  1YJN N;  3OJS A;  5BRE A;  3SV4 A;  3NH1 A;  4BRH A;  1OVQ A;  4WQ5 A;  5JLH A;  1LWE A;  4BC5 A;  1OH5 A;  1EP4 A;  1RIL A;  4CBX A;  4B8C A;  1TKD A;  5IT9 O;  3V1R A;  4C8M A;  3CJB A;  4OLB A;  4FK4 A;  4CJ3 A;  2ETJ A;  5MLC Q;  4UQG A;  4BVP A;  3EE9 A;  2X78 A;  3RMC A;  3WXI A;  1WBB A;  4JYA K;  2Q0U A;  4CW7 B;  4ID1 A;  1ZBF A;  3O1W A;  5ADX H;  5AZI A;  2F8S A;  3D2F B;  3THY A;  2V7Z A;  2P9S B;  1T8E A;  4PL8 A;  4DTP A;  2VWK A;  1C1A A;  3BZK A;  2E6L A;  4BRM A;  4GMJ B;  3SV3 A;  1WOQ A;  4O5B A;  3V9X A;  4DLG A;  2KFZ A;  4E7L A;  3HSC A;  4WQ4 A;  3PUF A;  3RWU A;  4I9L A;  1ZBH A;  4BC3 A;  3DXM A;  2HVI A;  4CZF A;  4BRK A;  1ZC6 A;  4IDH A;  4KTZ A;  3PX4 A;  1XUP O;  3EE8 A;  5CR4 A;  3KD1 E;  3TAF A;  2O8C A;  1IBM K;  4N41 A;  2O8C B;  2GV9 A;  3ZSZ A;  3VQE A;  3LAN A;  1SKS A;  4KI6 A;  4KTW A;  4DCH A;  4W5N A;  1WSE A;  4FLY A;  1NLV A;  4M41 A;  4I6M B;  2HB5 A;  4YOV A; 
#chains in the Genus database with same CATH homology
 4GV3 A;  1KAY A;  2P9I B;  5AQY A;  5KPR A;  3ID8 A;  3ZET A;  4NO7 A;  4CJ7 A;  4L3Q A;  2QM1 A;  3O5B A;  3CC4 N;  1KXP A;  2P9I A;  4GY2 B;  1Q81 O;  4E1J A;  2YI1 A;  3UKU A;  3VEN A;  3CCE N;  5C12 A;  5C2D A;  3O80 A;  3CJ7 A;  2A41 A;  4IEE A;  4BR4 A;  4J8F A;  1YF5 L;  2V52 B;  3L4I A;  2FF3 B;  3SMP A;  1NGE A;  2PFU A;  4ISE A;  1M90 O;  5BPL A;  1NGC A;  1TYQ B;  2P9P B;  4M7X A;  2NRH A;  1NGA A;  3VEX A;  4A2B A;  4JN4 A;  5GAE P;  4PKH A;  1YHQ N;  3O1B A;  3EO3 A;  4NB4 A;  4A57 A;  1GLF O;  4KH6 A;  4CZM A;  3SJH A;  3VEZ A;  4WQ4 C;  2WUS A;  2FSN A;  4JKF A;  3BF3 A;  3F5T A;  3VER A;  4U67 L;  3P39 A;  3ZX2 A;  3G71 N;  4XEI A;  1E4G T;  4UY8 O;  3LDQ A;  3M6G A;  4JKE A;  2GEM A;  2WC9 A;  4ILJ A;  4CI6 A;  2ZF5 O;  2QTD A;  3TTF A;  3H6E A;  2VWB A;  4A2A A;  5AQN A;  5CE3 A;  3VEV A;  4GV6 A;  3IFR A;  3AAP A;  3CJ1 A;  3QFP A;  4B1U B;  5DM6 L;  3E1Y A;  4R79 A;  3RSE A;  1QZ5 A;  2IVO A;  5LJV A;  1VQK N;  3D2F A;  4BRI A;  4DKW A;  5GIO A;  4BR9 A;  2QEX N;  5AZJ B;  3Q7C A;  5AFU A;  5LY3 A;  1C0G A;  4FWL A;  1NM1 A;  1SZ2 A;  3C0B A;  4O5F A;  3GE1 A;  1KAZ A;  5CHI A;  1QVF M;  2P9K A;  3ZEU B;  4FWS A;  4H0V B;  2WFB A;  5TKY A;  4A59 A;  3CPE A;  2YCH A;  1NGG A;  1MWM A;  1NMD A;  1SS6 A;  3GG4 A;  1NWK A;  3GDQ A;  5EVZ A;  4CZH A;  1S22 A;  3A5L C;  1BOT O;  3H1Q A;  5BN8 A;  2HBL A;  2KHO A;  3HRG A;  3GOI A;  4BRQ A;  4GV9 A;  4FPB A;  3AGR A;  3TPQ A;  4AM7 A;  4FWM A;  4K42 A;  3LM9 A;  1VQ6 N;  4YDU C;  4F9O A;  4NLC A;  5KQ8 A;  1MWK A;  3MX2 A;  3T69 A;  1VQ9 N;  2A40 A;  3I33 A;  2Q36 A;  3CCQ N;  2QWP A;  4CZG A;  1BU6 O;  1NGJ A;  3DLL L;  1QQM A;  2IVN A;  3MCA B;  5C10 A;  5JIC A;  2P9U A;  1T44 A;  3C6A A;  2P9L B;  3Q7B A;  3A0I X;  1DGK N;  3D6R A;  4QS8 A;  3H45 C;  4OPH A;  3S41 A;  1SAZ A;  3VGL A;  4JKC A;  3MN9 A;  3U4L A;  3GL1 A;  2HST A;  1Q82 O;  1VQ5 N;  5C2F A;  5BPN A;  4WQ5 C;  3KZB A;  2NNW A;  3ATU A;  3R3L A;  4JK9 A;  5AQF A;  5AQZ A;  4B1Z A;  3DJC A;  4JAX A;  4OPA A;  4DB3 A;  2HMP A;  1VQN N;  4MLE A;  4Y0W A;  2F9T A;  5BPM A;  2V7Y A;  4ISG A;  2A6A A;  2F7T A;  4BRN A;  1YI2 N;  3SBT A;  2QWR A;  3LDL A;  2I7N A;  4MO5 A;  4JKA A;  2HF3 A;  3TTD A;  4H5V A;  1M1K O;  5DM7 L;  3HOT A;  5GAG P;  2CGK A;  1ZBS A;  4XH1 A;  3C65 A;  4BRE A;  3CCR N;  2WBN A;  3JXU A;  1U2V A;  2E2P A;  3EKS A;  1KC8 O;  3WQU A;  5AQR A;  3TSU A;  3OW2 M;  3M1F A;  1BDG A;  4YOR A;  1NGI A;  4B1V A;  4CZE A;  4BQZ A;  3UKU B;  3CF5 L;  5FPE A;  4KBO A;  1X3M A;  5AQM A;  4IOX A;  5AQU A;  1NGF A;  2VYP A;  2YHX A;  1T3V A;  1T6C A;  2IVP A;  4HWI A;  4MDB A;  1K73 O;  3NVK A;  3CCJ N;  2BTF A;  3VF4 A;  2VCP A;  1Z6R A;  2ZJP L;  4KH4 A;  2ZJR L;  4JKB A;  4C1N I;  3KWI A;  4H0T B;  3FR0 A;  4GNI A;  1ATR A;  5AFU H;  5KQD A;  1VQO N;  1GLC G;  2ITM A;  3WUH A;  4BR2 A;  4WCE L;  3CCL N;  1TUY A;  5BR9 A;  3QIC A;  1YVN A;  5HOO A;  1O13 A;  1ZXO A;  2E20 A;  4QS7 A;  4JEP A;  3U9Z A;  4B1Y B;  3E66 A;  3CIP A;  4FOE A;  2AA4 A;  3KK7 A;  3SAG A;  4B1W B;  4O8K A;  4CBW A;  5HL7 L;  4EIA A;  1HKG A;  5F2R A;  1JJ2 M;  4BC4 A;  1BWF O;  3VGM A;  1BO5 O;  4IJN A;  4BC2 A;  1KQS M;  1BG3 A;  3M5R A;  2Q97 A;  3FZM A;  3MWT A;  4M63 C;  2HF4 A;  2JWL A;  5AQH A;  3PIP L;  3CPW M;  3CCS N;  2HBM A;  1N8R O;  5JVH L;  1YIJ N;  3HOS A;  4LC9 B;  3UE5 A;  1D4X A;  2FLO A;  3L6Q A;  4ISF A;  4IXC A;  3ZET B;  4EHU A;  4U7B A;  3LL3 A;  2E2Q A;  2JWK A;  3FZL A;  3QFU A;  5BRH A;  2Q2R A;  1RDW X;  2QWM A;  2GWK A;  2RE2 A;  1K8K A;  3DXK A;  4I6M A;  3WXK A;  4C1N K;  4WFN L;  4JK8 A;  3WXM B;  1XQS C;  5AQO A;  4YDU A;  3ID6 A;  5FPM A;  1YJ9 N;  2P9U B;  1DT9 A;  4FWP A;  3EZW A;  3LDP A;  3UKR A;  3DWL A;  3WEE A;  1YIT N;  3MX5 A;  1QZ6 A;  2QWQ A;  5M1Q A;  2YJE A;  3ULE A;  5FPD A;  1CZA N;  3A5N C;  3MN5 A;  3W0L A;  4JD2 A;  4H0O A;  3H3O B;  4FPA A;  3N4P A;  4IJA A;  4FSV A;  3C7N B;  2E2N A;  3HI0 A;  3OHR A;  1HPM A;  2NRX A;  3TU5 A;  3WT0 A;  3W3D A;  2QA4 N;  4C23 A;  2QWL A;  3A8Y A;  1VQ4 N;  1HKB A;  2HOE A;  1NGD A;  2KLA A;  4MDA A;  3WXL A;  4BGB A;  4B1X B;  4IO8 A;  3AGK A;  1W2B M;  2Q0R A;  5TKW A;  3I55 N;  2ZGY A;  2YHW A;  2F9W A;  4H0P A;  5M1P A;  3ZEU A;  3WXJ A;  3VGK A;  4BRO A;  3BEX A;  3FZF A;  4BRG A;  1HKC A;  3ATV A;  2CH5 A;  2BH1 A;  3G25 A;  4JKG A;  4PKG A;  2NRT A;  3O9U A;  4KH5 A;  5GIN A;  4YOV A;  3J7Z O;  2KKZ A;  2E2O A;  1Q7Y O;  3MMV A;  2YHY A;  3VES A;  2Q31 A;  1JCF A;  3GBT A;  4K43 A;  1VQL N;  1VQP N;  4H03 B;  3J8A A;  4YOT A;  3IUC A;  1TUU A;  3CME N;  5EY4 A;  3TTC A;  3UKR B;  1P90 A;  3A5O C;  3O9R A;  2E1Z A;  1EO1 A;  3R9P A;  1IG8 A;  4RWT A;  4BRC A;  1DEJ A;  3SAF A;  2HBJ A;  4HTL A;  4ILH A;  2NRV A;  5GAH P;  1YXQ A;  2A42 A;  3VTH A;  1Q18 A;  5JMV A;  5BRF A;  2CGJ A;  1RDU A;  3FGU A;  4EFH A;  4EHT A;  2AP1 A;  2E8A A;  3NMU A;  2VGN A;  3QBX A;  1BUP A;  4A5B A;  1GLJ O;  3G6E N;  4MLH A;  2D0P A;  2EWS A;  2I7P A;  3SLC A;  1R59 O;  4EAH D;  1LOT B;  3CCV N;  1Q86 O;  1HX1 A;  2GWJ A;  1NGH A;  2DPN A;  1RGI A;  4A5A A;  4BVO A;  3KVG A;  2P9K B;  3H1V X;  5F0X A;  3A5M C;  4H5R A;  2ASM A;  3LM2 A;  3U9D A;  1VQ7 N;  4RCH A;  1DKG D;  1V4T A;  3VF2 A;  1X3N A;  5E84 A;  4JD2 B;  3ZYY X;  2NRW A;  3BP8 A;  4BG9 A;  3I56 N;  1BA1 A;  1GLD G;  2GUP A;  3VEY A;  2QW9 A;  3SMS A;  5AQX A;  3FE1 A;  3KHY A;  4JHD B;  3C6H A;  1MA9 B;  3O4W A;  4FL9 A;  4YOY A;  3IKM A;  2QWO A;  5E26 A;  3E9L A;  4A61 A;  3RSE B;  4JKG B;  4XH4 A;  2NLX A;  2W41 A;  2A5X A;  2H3G X;  2ZGZ A;  3CER A;  5BRD A;  5EX5 A;  4IWV A;  4M7Y A;  1GLL O;  3MCP A;  3EN9 A;  1QVG M;  3PIO L;  5M1F A;  3HBT A;  4BRL A;  4Z94 A;  1GLB G;  3CQY A;  4JNE A;  3FFK B;  5M1K A;  3FLC O;  1T6D A;  1XC3 A;  3AAR A;  1WUA A;  3CCU N;  4FWR A;  1IJJ A;  4FWK A;  2GX9 A;  3VEW A;  1H1V A;  5AQL A;  1YUW A;  2J4R A;  4PHT X;  3ENO A;  3L0Q A;  3DAW A;  5AQG A;  5AQQ A;  3ULE B;  5FPN A;  3EKU A;  5I9E B;  3DXM B;  4YOU A;  1EQY A;  2GEL A;  3R8E A;  2BUP A;  1MDU B;  1K8A O;  1P8Z A;  4JKH A;  1QQN A;  4BRA A;  4RTF D;  5ADX A;  3B8A X;  2QI2 A;  1K8K B;  3DXK B;  3F9M A;  1OKJ A;  4NLB A;  3TSQ A;  4IOA L;  1S72 N;  3CET A;  5AQK A;  3CXC M;  4CZL A;  3MK6 A;  5AQS A;  1QHA A;  1E4F T;  3OBW A;  4BR7 A;  4FVU A;  3ENH A;  3OA9 A;  3FZK A;  3MWP A;  4FOI A;  2NRZ A;  2P9S A;  4YOX A;  4G9Z A;  3CHW A;  3MDQ A;  3OBY A;  4JHD A;  3VEO A;  4YOW A;  5AQP A;  5AZI B;  2YJF A;  3D2E B;  2VGM A;  1HJO A;  1W97 L;  3U8X A;  3F2K A;  1KD1 O;  2UYT A;  5C0Y A;  5EOY A;  2E1Y A;  2P9L A;  5ELZ A;  1G99 A;  3M3Z A;  4BR0 A;  5H1S Q;  5M1O A;  3VPZ A;  3H3N O;  3LDN A;  3O9S A;  3RVC A;  4CD1 A;  1C0F A;  3SK3 A;  3ENB A;  2ASP A;  1X9J A;  4H5N A;  2E88 A;  4H0Y B;  3PLA A;  1JCG A;  2PAV A;  5JLF A;  1YAG A;  3E9O A;  1VAZ A;  3JS6 A;  3D7E O;  3BF1 A;  3P4I A;  4FWQ A;  5AQT A;  3CQX A;  4FWO A;  1J6Z A;  3N4Q A;  3HTV A;  3TSP A;  4BRD A;  2NZT A;  4H5W A;  1VQM N;  2QWN A;  2OAN A;  3SBG A;  3O8M A;  1LCU A;  5B8H A;  3KWG A;  2QXL A;  3VET A;  2P9N B;  1ATN A;  3MN7 A;  3CI5 A;  4H5T A;  4IZ9 A;  1VQ8 N;  1GLA G;  1NGB A;  2A3Z A;  3MN6 A;  2ZWH A;  1U2V B;  4AM6 A;  1ESV A;  1YJW N;  1K9M O;  2OTJ N;  2FSK A;  3H46 O;  4MO4 A;  2OTL N;  3FZH A;  4BRF A;  4DHY A;  2FF6 A;  4XH5 A;  4IEI A;  3QBW A;  2D0O A;  5AQI A;  4IFE A;  4PL7 A;  4IO9 L;  3CC7 N;  3E9P A;  3VTI A;  5KPZ A;  2Q1N A;  4PKI A;  1SQK A;  2P9N A;  3BUZ B;  4B9Q A;  5F1X A;  4CD3 A;  2PBD A;  2ASO A;  2YX6 A;  3HZ6 A;  3HM8 A;  1HUX A;  1OVY A;  3QB0 A;  3AAQ A;  5BRE A;  1YJN N;  2IIR A;  2FSJ A;  4BQL A;  4CBU A;  3R6M A;  4BRH A;  4WQ5 A;  1QQO A;  5JLH A;  2HBK A;  4BGA A;  3ZX0 A;  4BC5 A;  2W40 A;  3CJA A;  2D4W A;  3QDK A;  3VF6 A;  4CBX A;  5GAD P;  1ATS A;  3ZX3 A;  5M1N A;  4WF9 L;  2ZJQ L;  2FXU A;  3C7N A;  4BG8 A;  3CJB A;  3NVM A;  4JK7 A;  3CC2 N;  5MLC Q;  4CZI A;  3SAH A;  4BVP A;  3EE9 A;  1JCE A;  4FWN A;  3UB5 A;  4WYB A;  3P38 A;  2GTD A;  3WXI A;  4K41 A;  2P9P A;  2NRR A;  3K9K A;  5EXW A;  3WQT A;  2Q0U A;  1GLE G;  4O8U A;  4K25 A;  3P31 A;  2RHK A;  1RFQ A;  3LDO A;  1NBW A;  3K9J A;  1HLU A;  3WEE B;  3G4S N;  4A62 A;  3O1W A;  2V51 B;  4DQ8 A;  5ADX H;  4GVE A;  3D2E A;  5AZI A;  5AZJ A;  3D2F B;  2V7Z A;  2P9S B;  3O08 A;  5AR0 A;  1ILY A;  3R1X A;  4PL8 A;  2CH6 A;  4BR5 A;  4BRM A;  3EL2 A;  4JKD A;  4ILG B;  4BY9 C;  4CZK A;  2CGL A;  2D1K A;  1WOQ A;  1BA0 A;  5BN9 A;  5JVG L;  3T7Z A;  4CZJ A;  4FO0 A;  3HSC A;  3IDH A;  4WQ4 A;  1V4S A;  4OO1 J;  4BC3 A;  1U6Z A;  3DXM A;  3CMA N;  3IMX A;  4CZF A;  5KPT A;  3I8B A;  3CJ9 A;  1ZC6 A;  4IDH A;  5AQJ A;  4BRK A;  1KAX A;  1XUP O;  3EE8 A;  3O9T A;  5CR4 A;  1TYQ A;  3VOV A;  3CJC A;  5LJW A;  1S3X A;  3L4Q A;  1NJI O;  3CD6 N;  3O6W A;  3AY9 A;  4WFB L;  4BRP A;  3QML A;  5AQV A;  4AF1 A;  4H0X B;  4QS9 A;  3CCM N;  1Y64 A;  1Z05 A;  4IOC L;  5C15 A;  4DCH A;  5AQW A;  3VMF B;  1NLV A;  3O9Q A;  4I6M B;  5GIP A;  4WFA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...