3D0PA

Insights into rna/dna hybrid recognition and processing by rnase h from the crystal structure of a non-specific enzyme-dsdna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
b'EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
molecule tags Hydrolase/dna
publication title Insights into RNA/DNA hybrid recognition and processing by RNase H from the crystal structure of a non-specific enzyme-dsDNA complex.
pubmed rcsb
total genus 43
structure length 134
sequence length 134
chains with identical sequence C
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3d0pA00
1ZYQA 4JLHA 3FFIA 4E7HA 4DSKA 4CK2A 3OYBA 5DK5A 1YVUA 2KZMA 1MU2A 2GUIA 4OVLA 2XO7A 1KFDA 1FXXA 4LD0A 4LY7A 3CQ8A 4DWIA 1D8YA 2BANA 3DLEA 1BL3A 3DRRA 4M3RA 3OYEA 3KLGA 3F73A 4NCGA 3OYCA 3K57A 2P5GA 2EHGA 4FK4A 1RBUA 3M8QA 4F2RA 2YNHA 3THVA 1LWCA 3M8RA 4KPYA 3AVIA 4FM1A 2D5RA 3SV3A 4DSJA 4FJLA 4KHWA 1BCMA 2G8WA 1SL0A 1SL2A 2O4IA 1JLEA 1D9DA 4BDZA 1KCFA 4FXDA 1ZBLA 4CFBA 3V9WA 4CGFA 1RTIA 4LH5A 2XY7A 1ASVA 3QEVA 3QLHA 4CECA 1QS4A 1Z25A 3SQ4A 1SKWA 1X9SA 3HVRA 3LAKA 1NK9A 5JS1A 1A5XA 3SQ2A 1F21A 2KZZA 3DOLA 2PZSA 4OGCA 1G15A 3I0RA 1NOZA 3OS1A 4CGGA 1RT2A 5KGWA 3ZT2A 1C1AA 1VRUA 1YTAA 4O0IA 4FLZA 4L8RB 4FZZA 1TKTA 2KFZA 1HJRA 3MEEA 3VQEA 3T1AA 2IC3A 2YNFA 2Z1GA 1C0UA 3OYAA 3KK2A 4DTMA 4DU1A 1U47A 4J2DA 4Z4FA 1REVA 3EYZA 1UA1A 4FYDA 4LSLA 2KTQA 3ZSQA 5HRSA 3VQAA 1IKXA 1U04A 3LP1A 3SQ0A 1HNIA 4C8MA 1VK0A 3K5OA 2JLEA 3RMDA 1WSJA 3EZ5A 3LZIA 4CJ3A 4KI4A 2R7YA 1BHLA 4Z4CA 3U3GA 3TAMA 4C8OA 4AHVA 1CZBA 2RF2A 2HHWA 3VA3A 2ZQBA 3ZSYA 1TGOA 4OPKA 4FLXA 4K8ZA 1VSEA 2G8HA 4FJIA 1VRTA 5K14A 4PA1A 2F8TA 2Z1HA 1W0HA 1VSHA 3LPTA 3T19A 3KKSA 3KLHA 3L8BA 4BE1A 3DLHA 4RW7A 4C8KA 4Z4EA 4AHRA 3IAYA 1Y97A 4CJUA 3NF8A 3RTVA 3TAFA 3NFAA 1C0TA 3OY9A 1IH7A 4CEEA 3OYKA 3U3YA 2P5OA 4FJ8A 4NYFA 4DF8A 2W42A 3IS9A 3LALA 2X6SA 1VSJA 4Z0UA 2F96A 3BGRA 3QIOA 3NGYA 4CFDA 3QEXA 3TANA 1XHZA 2G8KA 3O4QA 4F3TA 2HHQA 4KKOA 4I9QA 3LANA 3ULDA 3ALYA 1S6QA 4CHPA 3SV4A 1ZBUA 1HQEA 1KVAA 3AVHA 1TK5A 1KFSA 3VQ5A 4FJJA 1VSKA 4GW6A 2YKMA 4CJ5A 3L3UA 4N5SA 2DFFA 5HRPA 4FW1A 4E3SA 1RNHA 3VQPA 5C25A 3WNGA 1IKVA 3TABA 1T03A 4CHOA 4CGHA 1ITGA 1LW0A 4HCBA 3KTQA 3OJUA 3A2FA 1W9HA 2X74A 3AO5A 3AVJA 1QSLA 4OLBA 1JKHA 1VSDA 2GV9A 1BIUA 4W5TA 4F8RA 5I3UA 5SWMA 3ZSXA 3QEWA 1DLOA 4JS5A 3ZSRA 2VWJA 4I9LA 4QCLA 1TKZA 1GOCA 1DTQA 3MXIA 4B9UA 4W5NA 3HL8A 3L2QA 1KLNA 2E4LA 3CG7A 2ETJA 3QERA 3LWMA 1VSIA 5FRMA 3NAEA 4IG3A 4BDYA 3CM6A 1S1VA 1LV5A 3I0SA 1VSFA 4NYNA 3KLEA 3DM2A 1IG9A 4KHUA 3HVTA 1L5UA 3VA0A 5CYQA 2G8IA 3V9SA 3OS2A 4CGIA 4CJVA 4DG1A 3OYDA 3QEPA 1RILA 5DMRA 3DRSA 4OKJA 2PYJA 4M3XA 4OJRA 4LH4A 3SQ1A 3RR7A 1O1WA 4R5PA 4E7LA 2E6MA 1UWBA 4KREA 4J2BA 2FC0A 4E7JA 3QEIA 1FK9A 4CCHA 3WNEA 3P5JA 4HVJA 2WOMA 2YNGA 1S5JA 1UA0A 4KAZA 4CF0A 4KTQA 1TL1A 3KIOA 3NE6A 1J54A 1B92A 4RW4A 4E0DA 2IDOA 4B9LA 3AO4A 1Q9XA 1Z26A 1WLJA 3C94A 3HP6A 4UQGA 3OS0A 2OPPA 3NF6A 4IDKA 5KI6A 2PY5A 5EU7A 4IFVA 4E1NA 3O3GA 1WN7A 4WE1A 2YHAA 4CGJA 1JL2A 3DOKA 3OYMA 2P51A 3TAEA 1NK6A 3AVGA 3ZT4A 1GOBA 4DSLA 1UOCA 4PY5A 2BE2A 1JLCA 4CEQA 3K59A 1ZBIA 4CJTA 2HW3A 3C6TA 4KFBA 3ASMA 4J2AA 1VSMA 3CFRA 3M8PA 2O4GA 4DQQA 3AV9A 2Y1IA 2FBXA 4CIEA 2HVHA 1QHTA 4XIUA 3NF9A 3VQBA 4KB0A 2QKBA 1NK7A 1KLMA 1NKEA 3IRXA 3NHGA 1X1PA 3V9UA 3K5MA 4CIGA 4FCYA 2XRIA 3AA3A 4B08A 3OYNA 3AVCA 3VQ9A 4CJQA 3AO2A 1R0AA 2YHBA 2P1JA 4JRQA 1QSSA 4N41A 2E6LA 1KVBA 1Q8IA 4Z4GA 1NJZA 3HPOA 3HYFA 3NDKA 2XY8A 4FLYA 4DFPA 5I42A 2Q3SA 1C1CA 1I3AA 1BQMA 4I2PA 1VSLA 1TAUA 2XY6A 1ASUA 3SPYA 3S3MA 3PO5A 3AVBA 1RT1A 2VWKA 3G0ZA 3C95A 3L2WA 4DQRA 1WAFA 4N76A 5J2MA 4HUFA 1QE1A 4NCBA 4G1QA 1HYVA 4YNQA 3SNNA 4F3OA 4FJ5A 3OJSA 4DQSA 1UAXA 3O3HA 1RTJA 4ELUA 3WNHA 3L3VA 1RDAA 1RCHA 4AHSA 1LWFA 1S6PA 4DTPA 1XHXA 1S1TA 5E41A 1CXUA 3AA4A 3C6UA 4PUOA 1NJWA 3ZT1A 1NJXA 1JLBA 3D0PA 2QKKA 1WSHA 3RR8A 4FZYA 1WSGA 1XWLA 4KTWA 4CJLA 4FJ7A 4CJWA 3L2VA 4AH9A 1A5VA 1DTTA 4J2EA 1T8EA 3RRHA 4EZ9A 3H08A 3PX6A 4FZXC 2HHSA 2OA8A 3K58A 3HSTB 3DMJA 1T05A 1HYSA 1C0MA 4HTUA 4I2QA 2YNIA 1N5YA 2XY5A 3ZCMA 3S3NA 3B6PA 2HNDA 2OPQA 1FKPA 4DTNA 4DTXA 3ZSOA 3AVNA 2WONA 2LSNA 3KD5E 2D0BA 3VQ7A 3OYFA 3CM5A 4I7FA 3V1QA 2JGUA 4DU3A 1BI4A 4B9VA 2HVIA 5KGXA 3SZ2A 3CFPA 4W5QA 1KSPA 4DS4A 4CK1A 2FBVA 4H4OA 1S1WA 3KD1E 1RT7A 4DS5A 1SUQA 3U6FA 4Q0BA 4O5BA 4DFKA 3ISNC 5D3GA 1CLQA 4M3WA 4DLEA 4B9SA 1TL3A 4FJXA 4QOZB 2HHVA 1LAWA 2G8UA 1LWEA 4DSEA 4DSFA 2HNZA 2KQ2A 1RT6A 4C8LA 3LZJA 1JXEA 2NUBA 4CEBA 3RWUA 3AVKA 2EX3A 3OYHA 4PWDA 2D0CA 4IBNA 3ZSWA 4YFUA 4CJKA 2HHTA 4FJHA 4IKFA 4MFBA 4O4GA 1RBTA 3M8SA 4Y1DA 3F9KA 1U48A 1LAVA 4M45A 1NJYA 3VN5A 1JLAA 4W5RA 5J2QA 4OLAA 4IG0A 1EXQA 3KJVA 4DFJA 3LP3A 4FLTA 1ZBHA 5T7BA 4O44A 1BGXT 3V6DA 4E19A 1YTUA 1EETA 3SUQA 3TAQA 5KRSA 2VG6A 3SYZA 4ICLA 3JYTA 1KTQA 1S1UA 2HB5A 4CJRA 1CXQA 4CEAA 1TK8A 4CF8A 4HUEA 3V9ZA 3AO3A 4FJNA 3HJFA 3TI0A 3RMBA 4KI6A 4BE0A 1WNSA 2DTUA 2RN2A 4ID1A 5FROA 3PO4A 4KB1A 1RBVA 3OYGA 1RDBA 4FM2A 3B6OA 5CYMA 1U45A 1SKRA 4CERA 2BDPA 4DMNA 4CHQA 4CJEA 3JSMA 2BGGA 4TSXA 3P1GA 1SKSA 2D0AA 4PQUA 3SUOA 1LW2A 3OVNA 4BACA 5J2PA 1XC9A 1JLQA 5JS2A 3D45A 4RW9A 4DTRA 4ELVA 4BWMA 1JXBA 3AA2A 1IKYA 4BWJA 4OKEA 3ZT3A 3OYIA 3MXJA 3QO9A 1HRHA 3DYAA 3IG1A 3SJJA 3UIQA 1I39A 2FBYA 3AVFA 4KTZA 4QAGA 4CFAA 1QQCA 3NBPA 4CHNA 3I8DA 5HLFA 2YV0X 4M3ZA 3EY1A 1NK0A 4CHZA 1NKCA 3O3FA 1EKEA 3SUNA 4ELTA 2OYQA 4KHQA 5KTQA 4ZHRA 4W5OA 4Q5VA 1TKDA 1QSYA 3VQDA 4HCCA 1RDCA 4FW2A 4CJSA 4B8CA 4LSNA 1BISA 4OPJA 2XHBA 4FLVA 4AHTA 3V4IA 1T7PA 3RRGA 2FBTA 5C24A 1ZBFA 4NCAA 4Y1CA 3TR8A 3PX0A 2GBZA 3VQ8A 1KVCA 4CHYA 3LDSA 1NK5A 3TAGA 2Z1IA 4B9NA 2IOCA 3DI6A 2ZE2A 3KLFA 2IS3A 4DTJA 3G10A 1BCOA 4M3YA 2B5JA 4H8KA 5J2NA 4B9MA 4DSIA 1TKXA 3HPGA 4CEDA 4FLUA 5CY4A 2OZMA 4CJFA 5J1EA 4F2SA 4MQ3A 3DLBA 3DRPA 3QNOA 4FK0A 3V1OA 1B9FA 3QINA 4B3OA 3ZSVA 3BDPA 4Z4IA 3SPZA 1NOYA 4CEZA 4BDPA 4KV8A 1C6VA 3HXMA 3HPHA 1U49A 3RMAA 4EP5A 1U4BA 4C8NA 4EZ6A 3V1RA 1TVRA 4CF9A 1RBRA 3MAQA 3HM9A 2IGIA 4N47A 3MEGA 4O0JA 3PUFA 3O4NA 1XI1A 3VQQA 4M42A 4N56A 3K5LA 4CF1A 2KW4A 1L3TA 3SCXA 1C1BA 2PYLA 5HBMA 3WNFA 3V9XA 5HP1A 4GMJB 3HO1A 3P83D 1HYZA 4E7KA 4AHUA 3PV8A 4GVMA 3TAPA 1A5WA 4KHSA 4KHYA 2VG5A 1L3UA 3QIPA 3NGZA 1S1XA 1HPZA 3SUPA 4KHNA 3NH1A 5HRNA 2QXFA 3MECA 2G8FA 1TV6A 4DTOA 5HRRA 4DF4A 4RW6A 4FM0A 3TARA 1NK4A 3E01A 4DTSA 3QESA 2F8SA 3S3OA 1HNVA 3LP0A 1TK0A 3MXMA 1RDDA 1B9DA 3CYMA 3K2PA 3VQCA 4CFCA 4E7IA 4DQPA 3SI6A 1N6QA 1EX4A 5FRNA 3QNNA 1JLGA 2G8VA 4CF2A 1S9EA 2DFEA 4CESA 1YT3A 4ZTJA 4CEFA 1KRPA 1IKWA 2VG7A 1L3VA 2I5JA 2ZD1A 4BE2A 1BIZA 4IFYA 4FJGA 3HK2A 4JS4A 3LWLA 1JLFA 2B6AA 4DLGA 2RPIA 3AA5X 3DLGA 2OPRA 4RW8A 3NH0A 3OYLA 3ZSZA 5SZTA 4DU4A 3RMCA 4DTUA 4K8XA 1JL1A 2ATQA 4CJ4A 2OPSA 4HUGA 1D9FA 1HQUA 4EP4A 3LPUA 3KK1A 2ITGA 4E89A 4DFMA 1Q9YA 4H4MA 4HHTA 3L2RA 3CFOA 1RTDA 3TWHA 4E1MA 2HHUA 3DLKA 1WSIA 4O55A 1BQNA 3KKRA 4M3UA 4M3TA 4KO0A 4CIFA 3VQ6A 1BI4B 4CK3A 3QETA 3LAMA 2DY4A 4FLWA 3NH2A 5FDLA 3DLRA 4B8AB 1D5AA 1S9GA 3AVAA 2A1SA 3HP9A 1NK8A 4OGEA 1WAJA 4RG8A 2HHXA 1J9AA 3ITHA 3NCIA 3PX4A 1L3SA 1X9MA 2HMIA 4ID5A 2DFHA 1EP4A 1CZ9A 3VQ4A 4CE9A 4Z4HA 3T3FA 4FJ9A 4AILC 4CJPA 3MEDA 1J5OA 1X9WA 4FK2A 1J53A 3PY8A 2Y1JA 3NGIA 1RT3A 3HT3A 1RBSA 2HNYA 2Z1JA 3KK3A 2KFNA 1WSFA 2OZSA 3KLIA 4ZTFA 4B9TA 4F4KA 2X78A 1SL1A 1HMVA 1NKBA 3L2UA 1ASWA 4DQIA 1RT5A 4JRPA 1TAQA 1QTMA 4KRFA 2RKIA 1K6YA 1IO2A 1SV5A 2X6NA 5HROA 3AVMA 1GOAA 5CZ1A 5C42A 4FVMA 2YKNA 1WSEA 5KRTA 4OKKA 2IAJA 2AJQA 1RT4A 3V81A 3S9HA 1RTHA 3AVLA 4CEOA 4CGDA 2B4JA 4FJKA 4M41A 3LP2A 5CZ2A 3OYJA 3AO1A 3ZT0A 3K5NA 4AHCA 4FJMA 3NF7A 2QK9A 2A1RA 1FKOA
chains in the Genus database with same CATH superfamily
1ZYQA 1QZ6A 4CK2A 3OYBA 1O13A 4OVLA 4JI6K 3MCAB 1D8YA 4JAXA 3KLGA 4NCGA 3AVIA 1DGKN 1SL0A 1D9DA 3MDQA 1GLEG 4CGFA 1X3NA 5JLHA 3QLHA 4CECA 1QS4A 1Z25A 4IO9L 3S41A 3G6EN 5JS1A 5BRHA 1G15A 3I0RA 1NOZA 5AQMA 3UKUB 3AGKA 3ZT2A 3THXA 4L8RB 2KFZA 1U2VA 3VQEA 4DTMA 2YNFA 1C0UA 2VQFK 2QWNA 4BQZA 4DU1A 3EYZA 4B3RK 2KTQA 1NGJA 3HRGA 4FWPA 3SQ0A 3K5OA 2JLEA 3RMDA 4KI4A 2R7YA 1BHLA 3KVGA 1J5EK 3U3GA 2I7PA 3ATVA 3NVKA 2RF2A 1TGOA 4LFCK 1T3VA 2VGNA 3N4PA 3LPTA 3KLHA 5AQTA 4LF7K 1IBLK 3AARA 4NLBA 4BR0A 3CCRN 3NF8A 1D4XA 3U8XA 3MN5A 4FJ8A 1C0TA 3OYKA 4DF8A 3QIOA 3TANA 3NGYA 4CFDA 3QEXA 4BRDA 3SBGA 3ULDA 3SV4A 2Q0UA 4FJJA 2YKMA 3R8EA 2W6KA 3L3UA 5M1OA 4E3SA 3WNGA 4CGHA 1ITGA 1LW0A 3G71N 3OJUA 3A2FA 2FSJA 1VSDA 2GV9A 1BIUA 2QXLA 4F8RA 5SWMA 3ZSRA 3HBTA 2UU9K 1ESVA 4W5NA 2E1YA 3L2QA 1KLNA 2HBJA 3DWLA 3K9JA 2E2QA 3CM6A 3I0SA 1VSFA 3KLEA 3DM2A 1IG9A 3WXMB 2G8IA 4CGIA 4CJVA 2PYJA 4OJRA 4FO0A 4Y0WA 1UWBA 4E7JA 3WT0A 3P5JA 2YNGA 1S5JA 4JI2K 1J54A 3ZEUA 3TPQA 1JCGA 2VCPA 3EL2A 3CCUN 2P9NB 1BUPA 3UKRB 2PY5A 4E1NA 4IFVA 1NK6A 3OYMA 3AVGA 2GX9A 2KZMA 1ZBIA 5EX5A 3CFRA 2KHOA 2VWBA 5F2RA 3CIPA 4CIEA 1KLMA 5M1NA 4BGAA 3V9UA 3VGLA 2XRIA 3AA3A 4B08A 3AVCA 4CJQA 3MX2A 4GV9A 3LM9A 3SAHA 3HPOA 2FF3B 1QVFM 1C1CA 4KBOA 4NO7A 1VSLA 4GKJK 1TAUA 2XY6A 3S3MA 1RT1A 2O8CB 3O9UA 4N76A 3RSEB 4HUFA 4G1QA 3CCVN 4DQSA 1RTJA 2NRVA 1NGIA 1RDAA 4BG8A 3AA4A 1QZ5A 1X9JA 1WSGA 1XWLA 4H0XB 5AQWA 3L2VA 4BVOA 3FE1A 4J2EA 1T8EA 3H08A 3Q7BA 4KH6A 3DMJA 4CJ7A 5TKYA 3ZCMA 2UXBK 4DTNA 5C15A 3ZSOA 2O8CA 3OYFA 4B9VA 3SZ2A 4CK1A 3THWA 4YHHK 5BRFA 4DS5A 3U6FA 4O5BA 4B9SA 1TL3A 1LWEA 4DSEA 5DM6L 1RDUA 3AVKA 4C23A 3OYHA 4FWOA 1M1KO 4IBNA 4YFUA 2HHTA 5FPMA 4IJAA 4FJHA 4IKFA 5AQOA 1JJ2M 3F9KA 4IZ9A 1U48A 5J2QA 4OLAA 1EXQA 3LP3A 4O44A 2CH6A 3ZYYX 1EO1A 3TAQA 5KRSA 4ICLA 3JYTA 1S1UA 2HB5A 5AQXA 1N34K 1CXQA 4CEAA 4X62K 4CF8A 3TI0A 2RN2A 3OYGA 4FM2A 1SKRA 3TTDA 3VERA 3CJAA 4J8FA 2OTJN 4Z94A 1LW2A 3E9OA 1JLQA 1IKYA 3ZT3A 3MXJA 4BRLA 3DYAA 2UUAK 3SJJA 1I39A 4QAGA 4CFAA 3I8DA 5HLFA 4M3ZA 3K0SA 3E1YA 1GLCG 1Z6RA 3O5BA 4CZHA 1QSYA 4FWRA 4FW2A 2F9WA 4LSNA 3RRGA 2FBTA 1ZBFA 3VETA 3TR8A 4BG9A 5BR8K 2ITMA 3LDPA 3TAGA 5AQRA 2HOEA 2ZE2A 4A61A 3KLFA 1HKBA 3CJ9A 2NLXA 3G10A 3C7NA 3HPGA 5KPTA 2YHWA 1IG8A 4PKIA 5BREA 2GEMA 1YJNN 3ZEUB 3QINA 1YITN 3ZSVA 3SPZA 1NOYA 4CEZA 5M1KA 2D1KA 4ILGB 1U49A 3RMAA 2VQEK 3P38A 3EO3A 4O0JA 3TU5A 1HKCA 5AJ3K 3FZFA 4H5NA 4N56A 5AQNA 4WFBL 1G99A 1L3TA 3WNFA 3V9XA 2ZJQL 4H5RA 4HWIA 4BRHA 5AZIA 1VQ6N 5LMUK 4AHUA 4DR2K 2GTDA 3TAPA 1YIJN 1HPMA 3CERA 2QXFA 3MECA 2G8FA 3THYB 5IWAK 2AP1A 5EOYA 3TARA 4A2BA 1NWKA 4JKFA 1CZAN 1NBWA 1RDDA 5AZJB 2YI1A 3QBXA 3CYMA 3OHRA 3M3ZA 4DQPA 4QS7A 3PIPL 3H1QA 3AAPA 1BG3A 1YT3A 4JKGB 3VF2A 4ZTJA 1IKWA 3J7ZO 4FJGA 3QFUA 3O9RA 3CC4N 4DU4A 1JL1A 4HUGA 4EP4A 3LPUA 1K73O 2QW9A 5AQSA 4DFMA 5LJWA 4H4MA 2NZTA 3LM2A 2WBNA 4KO0A 1XC3A 4CIFA 5ADXH 2E88A 3IUCA 1MA9B 4FLWA 1YXQA 1OH8A 1N33K 4OGEA 2YJFA 4BRAA 3NCIA 4OX9K 1C0FA 3JS6A 3T3FA 4FJ9A 4CJPA 1J5OA 3PY8A 3F9MA 3MN6A 2Y1JA 1T44A 4WCEL 2Z1JA 2HNYA 2GELA 4DQ8A 2OZSA 3KLIA 4ZTFA 2P9LB 1YHQN 1GLDG 4DQIA 2X6NA 3G25A 5CZ1A 5C42A 3E9LA 4BRPA 2YKNA 1FJGK 1WBBA 1T6CA 3AVLA 2B4JA 3LP2A 4YOTA 5CZ2A 3OYJA 5FLXO 3K5NA 3NF7A 4JLHA 3FFIA 4E7HA 3CCEN 1KXPA 1R59O 4DSKA 5DK5A 1YVUA 4A59A 2GUIA 4DB3A 5CHIA 4H5TA 4X66K 4LY7A 3DRRA 1RBUA 4ILHA 1HKGA 3M8RA 2P9SA 3J8AA 3SV3A 4FJLA 4BY9C 4KHWA 1BCMA 2G8WA 3U9ZA 3WXKA 1KCFA 3U9DA 4IXCA 1RTIA 3U4LA 4LH5A 3SQ4A 3CD6N 3M5RA 1X9SA 4LFBK 5E26A 4OGCA 3FZHA 1RT2A 3BZCA 5KGWA 1VRUA 1TKTA 3T1AA 3OYAA 3KK2A 1BWFO 1UA1A 1SS6A 3LP1A 2V7YA 3EZ5A 2IVNA 3LZIA 2HBMA 4BRCA 2EWSA 3LDLA 2O8EA 1K8KA 3CCJN 4Z4CA 3TAMA 3CPWM 4AHVA 5AZIB 3VA3A 2ZQBA 1VSEA 3SBTA 2I7NA 1J6ZA 3T19A 3DJCA 4JD2B 3DLHA 4RW7A 4CZFA 4AHRA 1JCFA 1Y97A 5M1FA 3RTVA 3TAFA 3NFAA 3TTFA 3LALA 2X6SA 1VSJA 3OBYA 2G8KA 4KKOA 1S6QA 4CHPA 3ID6A 1HQEA 3AVHA 3THXB 5AQVA 4GW6A 3QDKA 4BRMA 5BPMA 4CJ5A 4N5SA 2DFFA 3TABA 2BUPA 1IKVA 1OH6A 4BC2A 3KTQA 4XH1A 5AQZA 3L6QA 4PL7A 4FPAA 3VEWA 1W9HA 5IT9O 2X74A 1RDWX 3GDQA 3P4IA 3E66A 3ZSXA 1RGIA 4FWMA 1DLOA 4JS5A 2E5LK 3QFPA 4I9LA 3DXMB 1ILYA 1TKZA 1LOTB 1DTQA 3AY9A 3VMFB 3KWIA 3CG7A 3NAEA 1ZC6A 3UB5A 3OW2M 3BEXA 1Q18A 1L5UA 3WEEB 3V9SA 4JV5K 4DG1A 3QEPA 1VQ9N 3DRSA 4OKJA 3O9TA 4LH4A 3CC2N 4E7LA 2E6MA 4J2BA 2FC0A 1FK9A 4CCHA 4HVJA 3J81O 4FWQA 4BRIA 3FZMA 4CZMA 3KIOA 3NE6A 1NGAA 2NRWA 4E0DA 5GIOA 4JKDA 4B9LA 3C94A 3HP6A 2NRXA 1E4FT 3P39A 3O3GA 1I94K 4QCLA 2YHAA 4H5WA 4PKHA 3TAEA 5FPNA 3ZT4A 4PY5A 3QB0A 1UOCA 2BE2A 4BREA 3C6TA 1VSMA 2QKBA 1NK7A 1NKEA 3IRXA 3NHGA 1X1PA 4CIGA 1XNQK 5MLCQ 3OYNA 4X65K 3AO2A 4BR9A 2E6LA 4H0OA 1KVBA 4Z4GA 1TUUA 3BF3A 2QWPA 3HOTA 4IJNA 4FLYA 1IBMK 3IDHA 3AVBA 2VWKA 3G0ZA 1LCUA 1WAFA 4FJ5A 4F3OA 1HJOA 3A5NC 4E1JA 1UAXA 3I33A 3WNHA 3L3VA 2JWKA 3WXLA 2V7ZA 1JCEA 4PUOA 3O8MA 3R1XA 1JLBA 4FJ7A 4CJWA 3THYA 2QWMA 1NGHA 4DUZK 4EZ9A 5M1QA 2HHSA 1BOTO 3G4SN 2HSTA 4JK7A 3HSTB 3CMAN 1HYSA 1GLJO 5AQHA 1C0MA 1N5YA 1BDGA 1VQ4N 4V19S 3CCQN 3VEOA 2LSNA 1EQYA 3VQ7A 3CM5A 2JGUA 1ZBSA 5KGXA 2FBVA 4H4OA 4JKEA 3ENOA 3DAWA 4Q0BA 4DFKA 3KWGA 1VQLN 4DLEA 4FJXA 4FWKA 3IKMA 4C8LA 4PWDA 2NUBA 4DV2K 3RWUA 4JI3K 2D0PA 3WUHA 4IWVA 1EWRA 4MFBA 4O4GA 3M8SA 3R3LA 5EXWA 2W6LA 5KQ8A 1NJYA 3CI5A 4DFJA 5C10A 4FLTA 1S72N 3VENA 5T7BA 4E19A 1EETA 4DHYA 3TSQA 1KTQA 1E3MA 4CJRA 1TK8A 4EFHA 3V9ZA 4CVNE 2UUCK 4JI7K 5FROA 3NMUA 1RBVA 1RDBA 5CYMA 4CERA 5GAHP 4GKKK 4DMNA 4CJEA 2BGGA 1SKSA 3PSIA 3SUOA 3D45A 4RW9A 1HX1A 4JEPA 3VEZA 4ELVA 4BWJA 4OKEA 3LL3A 3OYIA 2W41A 2A40A 2ZF5O 4CHNA 4KTZA 2F4VK 1NK0A 1SAZA 2H3GX 3O9SA 5KTQA 4ZHRA 3SMPA 4Q5VA 2QTDA 5AQPA 4HCCA 1T7PA 3M6GA 5C24A 4Y1CA 4I6MA 3SLCA 4OPAA 3EN9A 3VQ8A 1NK5A 3B8AX 3FLCO 2IOCA 1U6ZA 4JKGA 3VTHA 4K25A 1BCOA 3OBWA 2B5JA 4K43A 1TKXA 4JK8A 5I9EB 4CEDA 4FLUA 4MQ3A 1YJ9N 4FK0A 3QBWA 4A2AA 3CQYA 3O4WA 1VQON 4B3OA 2V52B 3AAQA 2Q31A 4BDPA 4KV8A 3HPHA 4BR5A 4EP5A 4C8NA 2VGMA 3T69A 4EZ6A 5AFUA 3MAQA 3HM9A 3MEGA 1NG9A 2BH1A 3PUFA 3H6EA 5JLFA 3MWTA 4M42A 3VGKA 3SCXA 3LDOA 3C6HA 1KAXA 5HP1A 4GMJB 3HO1A 3LDQA 3PV8A 4GVMA 4KHSA 4DV5K 3I8BA 3D7EO 4XEIA 3NGZA 1BU6O 4YOVA 3CMEN 5HRNA 4GY2B 1YUWA 1P8ZA 3J80O 2E2PA 1FW6A 4FM0A 4CD3A 5F1XA 4DTSA 4YOYA 1B9DA 4QS8A 4DR5K 3K2PA 2JWLA 3VQCA 4E7IA 5FRNA 5AQJA 1NGFA 3C7NB 1S9EA 2DFEA 1KRPA 1BIZA 3LWLA 1ZXOA 3QMLA 2RPIA 2OPRA 4RW8A 2A3ZA 3ENHA 3ZSZA 5SZTA 3RMCA 4CJ4A 2ATQA 3RVCA 3D2EA 1D9FA 3ULEA 3A5MC 2ITGA 1RTDA 2HHUA 3DLKA 3A8YA 4M3UA 3WQTA 3CCMN 3D6RA 1BI4B 4CK3A 5JMVA 3LAMA 4BC5A 4JKHA 4B8AB 1D5AA 3AVAA 1NK8A 4RG8A 2HHXA 5BPLA 3ITHA 3E9PA 1VQ7N 4F9OA 1CZ9A 3VQ4A 3ATUA 2P9NA 1X9WA 3FZKA 1J53A 3T1HK 1RBSA 3KK3A 4A62A 4CZLA 4MO4A 1HMVA 1XUPO 4JRPA 2FXUA 2RKIA 4A5AA 3AVMA 1GOAA 3QICA 1WSEA 4FJKA 2P9UB 5HL7L 4B1ZA 4BQLA 4IOXA 3AO1A 2QK9A 2IIRA 4H0VB 2GWJA 3VEXA 4FWNA 2Q97A 2ZJRL 1FXXA 3CJ7A 4LD0A 3CQ8A 4DWIA 4I6MB 2BANA 1BL3A 3OYEA 4MLEA 3K57A 2P5GA 2EHGA 2P9SB 3CJBA 4FK4A 4F2RA 2YNHA 1LWCA 3SAGA 1SL2A 1NMNA 3A5OC 1NJIO 5BR9A 4CFBA 3V9WA 2W40A 3QEVA 1SKWA 1N8RO 3HVRA 2J4RA 1NK9A 1A5XA 3SQ2A 4YDUA 1F21A 2KZZA 3DOLA 2P9UA 4CGGA 4HTLA 4FZZA 4FLZA 1VQNN 1HJRA 3MEEA 4J2DA 2Z1GA 4Z4FA 1REVA 4LSLA 3ZSQA 3VQAA 1U04A 4C8MA 4ISEA 4CJ3A 4FOIA 3THWB 5E84A 3GOIA 4DKWA 2KLAA 4C8OA 3VGMA 1CZBA 2HHWA 1GLBG 3ZSYA 4OPKA 3TSUA 4KHPK 2G8HA 5C2DA 5C12A 5K14A 4PA1A 2F8TA 1DKGD 3O1BA 4Z4EA 4BE1A 4C8KA 2PAVA 4CJUA 1MWKA 3T1YK 3EZWA 3HZ6A 3U3YA 1IH7A 4CEEA 2QWQA 4NYFA 5GADP 3IS9A 2W42A 4Z0UA 4CZJA 3BGRA 4F3TA 2HHQA 5ADXA 1C0GA 1KFSA 3VQ5A 5GIPA 4FOEA 4FW1A 1RNHA 5C25A 1T03A 1NMDA 4CHOA 4FPBA 3SJHA 4YORA 4OPHA 1QSLA 3AO5A 3AVJA 4PL8A 4OLBA 1JKHA 4WYBA 3T7ZA 5I3UA 2E8AA 2VWJA 1KC8O 4GV6A 1GOCA 3MXIA 4B9UA 3VEVA 2ETJA 1OVQA 4IG3A 1S1VA 1LV5A 3HVTA 3VA0A 5CYQA 2O8DA 3OS2A 3OYDA 1RILA 4DV4K 4WQ4C 2Q36A 3RR7A 1O1WA 3VEYA 4WQ5A 4DR4K 4KREA 5JVGL 1VQ8N 3WNEA 1K8AO 2WOMA 1UA0A 4KAZA 4KH4A 4KTQA 1TL1A 2GWKA 2IDOA 1Q82O 2DPNA 3AO4A 1Z26A 5EVZA 4UQGA 2Q0RA 3OS0A 4B1XB 2OPPA 3NF6A 4IDKA 3HTVA 5KI6A 5EU7A 4WE1A 4M7XA 1JL2A 3DOKA 4K41A 1GOBA 4CW7B 3VESA 4CJTA 4KFBA 3ASMA 4B3MK 4J2AA 4DQQA 3AV9A 2FBXA 4CBUA 2HVHA 4KB0A 1V4SA 3A5LC 1N32K 1HLUA 2YHBA 2P1JA 1IJJA 4JRQA 2P9PB 4OO1J 1Q8IA 4CZGA 2YJEA 3HYFA 3NDKA 2XY8A 1BQMA 1IBKK 4JKBA 3SPYA 4B1UB 3C95A 3WEEA 5J2MA 1NU0A 1P90A 5AQKA 4NCBA 1E4GT 3MWPA 1HYVA 3SNNA 3OJSA 4ELUA 4YOXA 3O9QA 4DV7K 1ATRA 1RCHA 4DV1K 3IFRA 5E41A 1CXUA 3C6UA 1T6DA 2QKKA 3D0PA 1WSHA 3RR8A 4B1YB 1OH5A 4FZYA 4KTWA 5KPZA 1DTTA 3RRHA 3K58A 3FFKB 3KZBA 2HNDA 2OPQA 1FKPA 2ASMA 3M1FA 1SZ2A 4DTXA 3AVNA 2WONA 3EE8A 2D0BA 4C1NK 4DU3A 2HVIA 4ISGA 3CFPA 4DS4A 1S1WA 2P9KA 3ISNC 5D3GA 1CLQA 4M3WA 5AQUA 3ULEB 5LL6Z 4JN4A 4LFAK 1LAWA 4RTFD 2G8UA 2HBKA 2HNZA 4B3TK 2KQ2A 3DXMA 1JXEA 1GLLO 2BTFA 2O8FB 3ZSWA 4CJKA 2RE2A 5LY3A 2IVPA 3OA9A 3P31A 4Y1DA 4AM6A 3MX5A 3C6AA 3VN5A 1JLAA 1ZBHA 4QS9A 3C0BA 3R9PA 1BGXT 1YTUA 3SUQA 2VG6A 3SYZA 4O8UA 1QHAA 2A41A 3HJFA 4FL9A 4HUEA 4FJNA 2E20A 4YDUC 4BE0A 4ID1A 1K9MO 3PO4A 4KB1A 1U45A 2BDPA 4DV0K 1WOQA 3MN7A 3EKSA 3JSMA 3W3DA 4TSXA 5FPEA 2D0AA 3OVNA 4BACA 5KQDA 1XC9A 4EAHD 5JS2A 4BWMA 1JXBA 3AA2A 4CD1A 1HUXA 3QO9A 1HRHA 3UIQA 2O8FA 3AVFA 2P5OA 2UYTA 1QQCA 3NBPA 3FR0A 2YV0X 3EY1A 3SUNA 4KHQA 2OYQA 4W5OA 4JI4K 4BVPA 1TKDA 3VQDA 3V4IA 4OPJA 4KHUA 4FLVA 2XHBA 1U2VB 3PX0A 2OTLN 3LDSA 4CHYA 2YCHA 4DCHA 2Z1IA 4B9NA 1ATSA 2IS3A 2AA4A 4DTJA 4M3YA 1Z05A 4DV3K 3H3NO 5CY4A 2OZMA 4XH5A 4BROA 4CJFA 5J1EA 3DLBA 3CQXA 4BGBA 4BR7A 2VYPA 1NGDA 4YOUA 1B9FA 4EIAA 3TSPA 4Z4IA 1C6VA 3CCSN 4JYAK 4ISFA 3UKRA 2P9LA 1TVRA 1RBRA 2IGIA 1GLAG 3VF6A 3O4NA 2Q2RA 2ZJPL 2O8BB 2KW4A 3AGRA 2PYLA 5HBMA 4FVUA 3SMSA 3P83D 1OH7A 4JHDB 4LF6K 4KHYA 2VG5A 4B1VA 1S1XA 1HPZA 4KHNA 3WXIA 4A5BA 1TV6A 4DTOA 4DF4A 1M90O 4RW6A 3LDNA 1BO5O 2PFUA 1YAGA 4WQ4A 2WTUA 3O80A 2D4WA 3E01A 2WC9A 2F8SA 2O8BA 4CZKA 3LP0A 3MXMA 2IVOA 4ILJA 4IOCL 5AQFA 3SI6A 2KKZA 2HBLA 2G8VA 3D2FA 4CF2A 5AFUH 4CESA 4CEFA 2VG7A 1L3VA 2ZD1A 4FWLA 4BE2A 4IFYA 2WFBA 4JS4A 5LJVA 4CI6A 2QA4N 2B6AA 3AA5X 3DLGA 4DSJA 4DV6K 3PIOL 3GL1A 2HMPA 5AZJA 1WBDA 1HQUA 4H0YB 2YHXA 4E89A 4DUYK 5AQLA 3BP8A 3CFOA 4O55A 5TKWA 1QQNA 3EEQA 2E2OA 3KKRA 2E2NA 4M3TA 3J7AP 3VOVA 3VTIA 3QETA 1K8KB 2O8EB 2HF4A 3HP9A 4H0TB 1J9AA 2QWOA 1L3SA 1EP4A 5BN9A 4CE9A 3C65A 4AILC 3MEDA 1VQ5N 1RT3A 3HT3A 2KFNA 1WSFA 4NLCA 3ZETA 3WQUA 2X78A 4M63C 2NRHA 4O8KA 3O08A 4O5FA 1QTMA 1TAQA 4KRFA 4UY8O 4RCHA 1MWMA 1IO2A 1SV5A 5HROA 4WFAL 4FVMA 1TYQB 1IV0A 5BPNA 1QQMA 2IAJA 4JKCA 1RT4A 3S9HA 3GG4A 4CGDA 4M41A 1YF5L 4BRNA 1Q81O 4FJMA 3HM8A 3J7YP 1FKOA 1XNRK 4FWSA 3K9KA 4AM7A 1MU2A 4CBXA 2XO7A 1KFDA 4JK9A 4GNIA 3JXUA 3F73A 3DLEA 3BDPA 3DXKB 4M3RA 2A42A 2FSNA 3OYCA 3M8QA 3THVA 4KPYA 4IO8A 4FM1A 2D5RA 2P9KB 4MO5A 2O4IA 4FSVA 1JLEA 2V51B 5KPRA 4BDZA 5GAEP 3CETA 3F2KA 3UKUA 4FXDA 1ZBLA 3FZLA 1Y64A 4NXMK 1Q7YO 2XY7A 1NGCA 1ASVA 2OANA 5C0YA 3LAKA 2CH5A 4U67L 2PZSA 1Q86O 3OS1A 4DR3K 4KH5A 4O0IA 1C1AA 1YTAA 2F9TA 3TTCA 3IMXA 4G9ZA 3V6DA 2IC3A 1U47A 4FYDA 4NB4A 2QWRA 3UE5A 2HF3A 5HRSA 1IKXA 1HNIA 1VK0A 4JKAA 1WSJA 1KAYA 1ATNA 4MLHA 4H03B 3ZLJA 3CJCA 3EKUA 4K8ZA 4FLXA 4FJIA 1VRTA 2UUBK 1OKJA 2Z1HA 1W0HA 1VSHA 3L8BA 1HNZK 3KKSA 2D0OA 4C1NI 1HNWK 3IAYA 3OY9A 2QWLA 2F96A 4B3SK 1XHZA 3O4QA 4I9QA 3LANA 3ALYA 1ZBUA 1KVAA 5BRDA 1TK5A 1VSKA 3ENBA 5HRPA 5JICA 3VQPA 1X3MA 1TYQA 4HCBA 2ZGYA 5H1SQ 3DLLL 2CGLA 2OCEA 4W5TA 4DR7K 3QEWA 1N36K 3I55N 3KK7A 3MCPA 4JD2A 3HL8A 5ELZA 2E4LA 3QERA 3LWMA 4JI0K 1VSIA 2NRTA 4BRKA 5FRMA 4LC9B 4BDYA 1OVYA 4NYNA 2YHYA 4DR1K 1S22A 3ZX2A 3VF4A 4AF1A 5AQYA 5DMRA 4M3XA 3SQ1A 4R5PA 1RFQA 3QEIA 4IDHA 3BY5A 4YOWA 4CF0A 4LF9K 4IOAL 1XMOK 1B92A 4RW4A 4H0PA 1Q9XA 1WLJA 2E1ZA 1NGGA 3WXJA 1WN7A 4CGJA 2P51A 4DSLA 2UXDK 1JLCA 4CEQA 3K59A 2HW3A 1BA0A 1DT9A 4BR4A 3M8PA 1WUAA 2O4GA 2Y1IA 3W0LA 1NGEA 1QHTA 4XIUA 3NF9A 3VQBA 3H46O 1GLFO 5A2QO 2ZM6K 1W97L 4BRGA 4B1WB 3K5MA 4JI5K 4FCYA 3VQ9A 1R0AA 4N41A 2QEXN 1QSSA 2P9IA 5CR4A 2FLOA 1V4TA 4XH4A 1NJZA 4LF8K 4DFPA 5I42A 2Q3SA 4I2PA 1I3AA 1ASUA 3PO5A 3O6WA 3CJ1A 2PBDA 3L2WA 4DQRA 5HOOA 3R6MA 1QE1A 1YJWN 3SAFA 4YNQA 3O3HA 3OTOK 4AHSA 1LWFA 1S6PA 2NNWA 4DTPA 1XHXA 1S1TA 3A0IX 1NJWA 3ZT1A 4M7YA 1NJXA 4CJLA 1W7AA 4AH9A 1A5VA 5GINA 3I56N 4X64K 3CCLN 3GBTA 3CHWA 3PX6A 4FZXC 2OA8A 3NVMA 3BF1A 3HSCA 1T05A 2ASOA 4HTUA 4I2QA 2YNIA 2XY5A 3S3NA 1XQSC 3B6PA 4A57A 4BR2A 3KD5E 1KD1O 4LF4K 1TUYA 4I7FA 3V1QA 1BI4A 4W5QA 1KSPA 3Q7CA 3KD1E 4GV3A 1RT7A 4JI8K 5EY4A 1SUQA 5GAGP 4MDAA 2QM1A 3PSFA 4PKGA 4QOZB 2HHVA 3DXKA 4DSFA 1RT6A 3LZJA 1VQKN 4CEBA 2EX3A 2D0CA 4NXNK 1VQPN 1RBTA 2ZGZA 1LAVA 4M45A 4WQ5C 4W5RA 4IG0A 3KJVA 1H1VA 1VQMN 2FF6A 1S3XA 1XMQK 3SK3A 3AO3A 3RMBA 4KI6A 2DTUA 1WNSA 2WUSA 3B6OA 4CHQA 1KAZA 3P1GA 5AQQA 4BRQA 1NGBA 4U7BA 4PQUA 5J2PA 4GVEA 2RHKA 3CXCM 4DTRA 2NRZA 3H45C 4JNEA 3H1VX 4JHDA 1QVGM 3IG1A 4EHTA 2FBYA 4CHZA 1NKCA 1VAZA 3O3FA 1EKEA 4ELTA 3CPEA 3L4IA 4CZIA 4CJSA 1RDCA 5B8HA 4B8CA 5F0XA 1BISA 3N4QA 4AHTA 4NCAA 3D2EB 2HHHK 2GBZA 4IEEA 4L3QA 1KVCA 5AR0A 4EHUA 3MMVA 3DI6A 4LF5K 5CE3A 3CF5L 1NLVA 2A6AA 2F7TA 4H8KA 5J2NA 4B9MA 4DSIA 4BC3A 4F2SA 2GUPA 3DRPA 3QNOA 3BUZB 3RSEA 1QQOA 4JI1K 3V1OA 1HR0K 5AQGA 5M1PA 1EWQA 3HXMA 1YI2N 5AQIA 1U4BA 2YX6A 5DM7L 3V1RA 4CF9A 4N47A 5JVHL 1NNEA 1XI1A 3VQQA 1W2BM 2P9IB 3K5LA 4CZEA 4AQYK 4CF1A 3O1WA 1C1BA 2Q1NA 4B9QA 1HYZA 4E7KA 2FSKA 4WF9L 1A5WA 1L3UA 4K42A 2QI2A 3HI0A 3QIPA 3SUPA 3NH1A 2ASPA 5HRRA 3HOSA 1NK4A 5BN8A 3JAMO 3QESA 3S3OA 1HNVA 2A5XA 1TK0A 3ID8A 3H3OB 2CGKA 1HNXK 4CFCA 1N6QA 1EX4A 4BRFA 4R79A 3PLAA 3QNNA 1JLGA 3ZETB 3MK6A 4YY3K 4IFEA 2I5JA 5LMNK 3HK2A 1YVNA 5C2FA 1NM1A 1JLFA 4DLGA 3NH0A 3OYLA 1WB9A 4K0KK 4DTUA 3FGUA 3VPZA 4IEIA 4K8XA 2OPSA 3CC7N 2P9PA 4PHTX 3KK1A 2CGJA 2UXCK 3MN9A 1Q9YA 4HHTA 3L2RA 3TWHA 3KHYA 1BA1A 4E1MA 1WSIA 1SQKA 1BQNA 3VQ6A 5FPDA 3ZX0A 3F5TA 2DY4A 3NH2A 5FDLA 3DLRA 2O8DB 1S9GA 2A1SA 4RWTA 1WAJA 1MDUB 3PX4A 4H5VA 3ZX3A 1X9MA 2HMIA 4ID5A 2DFHA 3GE1A 3L0QA 4Z4HA 4FK2A 3NGIA 2NRRA 3D2FB 4B9TA 4F4KA 1VHXA 1SL1A 1NKBA 3L2UA 1ASWA 1RT5A 3EE9A 1K6YA 4BC4A 2ZWHA 5KRTA 4OKKA 2AJQA 4MDBA 3V81A 3L4QA 1RTHA 4CEOA 4WFNL 1KQSM 1DEJA 3BZKA 4CBWA 4DR6K 3ZT0A 4AHCA 2A1RA
chains in the Genus database with same CATH topology
1ZYQA 4JLHA 3FFIA 4E7HA 4DSKA 4CK2A 3OYBA 5DK5A 1YVUA 2KZMA 1MU2A 2GUIA 4OVLA 2XO7A 1KFDA 1FXXA 4LD0A 4LY7A 3CQ8A 4DWIA 1D8YA 2BANA 3DLEA 1BL3A 3DRRA 4M3RA 3OYEA 3KLGA 3F73A 4NCGA 3OYCA 3K57A 2P5GA 2EHGA 4FK4A 1RBUA 3M8QA 4F2RA 2YNHA 3THVA 1LWCA 3M8RA 4KPYA 3AVIA 4FM1A 2D5RA 3SV3A 4DSJA 4FJLA 4KHWA 1BCMA 2G8WA 1SL0A 1SL2A 2O4IA 1JLEA 1D9DA 4BDZA 1KCFA 4FXDA 1ZBLA 4CFBA 3V9WA 4CGFA 1RTIA 4LH5A 2XY7A 1ASVA 3QEVA 3QLHA 4CECA 1QS4A 1Z25A 3SQ4A 1SKWA 1X9SA 3HVRA 3LAKA 1NK9A 5JS1A 1A5XA 3SQ2A 1F21A 2KZZA 3DOLA 2PZSA 4OGCA 1G15A 3I0RA 1NOZA 3OS1A 4CGGA 1RT2A 5KGWA 3ZT2A 1C1AA 1VRUA 1YTAA 4O0IA 4FLZA 4L8RB 4FZZA 1TKTA 2KFZA 1HJRA 3MEEA 3VQEA 3T1AA 2IC3A 2YNFA 2Z1GA 1C0UA 3OYAA 3KK2A 4DTMA 4DU1A 1U47A 4J2DA 4Z4FA 1REVA 3EYZA 1UA1A 4FYDA 4LSLA 2KTQA 3ZSQA 5HRSA 3VQAA 1IKXA 1U04A 3LP1A 3SQ0A 1HNIA 4C8MA 1VK0A 3K5OA 2JLEA 3RMDA 1WSJA 3EZ5A 3LZIA 4CJ3A 4KI4A 2R7YA 1BHLA 4Z4CA 3U3GA 3TAMA 4C8OA 4AHVA 1CZBA 2RF2A 2HHWA 3VA3A 2ZQBA 3ZSYA 1TGOA 4OPKA 4FLXA 4K8ZA 1VSEA 2G8HA 4FJIA 1VRTA 5K14A 4PA1A 2F8TA 2Z1HA 1W0HA 1VSHA 3LPTA 3T19A 3KKSA 3KLHA 3L8BA 4BE1A 3DLHA 4RW7A 4C8KA 4Z4EA 4AHRA 3IAYA 1Y97A 4CJUA 3NF8A 3RTVA 3TAFA 3NFAA 1C0TA 3OY9A 1IH7A 4CEEA 3OYKA 3U3YA 2P5OA 4FJ8A 4NYFA 4DF8A 2W42A 3IS9A 3LALA 2X6SA 1VSJA 4Z0UA 2F96A 3BGRA 3QIOA 3NGYA 4CFDA 3QEXA 3TANA 1XHZA 2G8KA 3O4QA 4F3TA 2HHQA 4KKOA 4I9QA 3LANA 3ULDA 3ALYA 1S6QA 4CHPA 3SV4A 1ZBUA 1HQEA 1KVAA 3AVHA 1TK5A 1KFSA 3VQ5A 4FJJA 1VSKA 4GW6A 2YKMA 4CJ5A 3L3UA 4N5SA 2DFFA 5HRPA 4FW1A 4E3SA 1RNHA 3VQPA 5C25A 3WNGA 1IKVA 3TABA 1T03A 4CHOA 4CGHA 1ITGA 1LW0A 4HCBA 3KTQA 3OJUA 3A2FA 1W9HA 2X74A 3AO5A 3AVJA 1QSLA 4OLBA 1JKHA 1VSDA 2GV9A 1BIUA 4W5TA 4F8RA 5I3UA 5SWMA 3ZSXA 3QEWA 1DLOA 4JS5A 3ZSRA 2VWJA 4I9LA 4QCLA 1TKZA 1GOCA 1DTQA 3MXIA 4B9UA 4W5NA 3HL8A 3L2QA 1KLNA 2E4LA 3CG7A 2ETJA 3QERA 3LWMA 1VSIA 5FRMA 3NAEA 4IG3A 4BDYA 3CM6A 1S1VA 1LV5A 3I0SA 1VSFA 4NYNA 3KLEA 3DM2A 1IG9A 4KHUA 3HVTA 1L5UA 3VA0A 5CYQA 2G8IA 3V9SA 3OS2A 4CGIA 4CJVA 4DG1A 3OYDA 3QEPA 1RILA 5DMRA 3DRSA 4OKJA 2PYJA 4M3XA 4OJRA 4LH4A 3SQ1A 3RR7A 1O1WA 4R5PA 4E7LA 2E6MA 1UWBA 4KREA 4J2BA 2FC0A 4E7JA 3QEIA 1FK9A 4CCHA 3WNEA 3P5JA 4HVJA 2WOMA 2YNGA 1S5JA 1UA0A 4KAZA 4CF0A 4KTQA 1TL1A 3KIOA 3NE6A 1J54A 1B92A 4RW4A 4E0DA 2IDOA 4B9LA 3AO4A 1Q9XA 1Z26A 1WLJA 3C94A 3HP6A 4UQGA 3OS0A 2OPPA 3NF6A 4IDKA 5KI6A 2PY5A 5EU7A 4IFVA 4E1NA 3O3GA 1WN7A 4WE1A 2YHAA 4CGJA 1JL2A 3DOKA 3OYMA 2P51A 3TAEA 1NK6A 3AVGA 3ZT4A 1GOBA 4DSLA 1UOCA 4PY5A 2BE2A 1JLCA 4CEQA 3K59A 1ZBIA 4CJTA 2HW3A 3C6TA 4KFBA 3ASMA 4J2AA 1VSMA 3CFRA 3M8PA 2O4GA 4DQQA 3AV9A 2Y1IA 2FBXA 4CIEA 2HVHA 1QHTA 4XIUA 3NF9A 3VQBA 4KB0A 2QKBA 1NK7A 1KLMA 1NKEA 3IRXA 3NHGA 1X1PA 3V9UA 3K5MA 4CIGA 4FCYA 2XRIA 3AA3A 4B08A 3OYNA 3AVCA 3VQ9A 4CJQA 3AO2A 1R0AA 2YHBA 2P1JA 4JRQA 1QSSA 4N41A 2E6LA 1KVBA 1Q8IA 4Z4GA 1NJZA 3HPOA 3HYFA 3NDKA 2XY8A 4FLYA 4DFPA 5I42A 2Q3SA 1C1CA 1I3AA 1BQMA 4I2PA 1VSLA 1TAUA 2XY6A 1ASUA 3SPYA 3S3MA 3PO5A 3AVBA 1RT1A 2VWKA 3G0ZA 3C95A 3L2WA 4DQRA 1WAFA 4N76A 5J2MA 4HUFA 1QE1A 4NCBA 4G1QA 1HYVA 4YNQA 3SNNA 4F3OA 4FJ5A 3OJSA 4DQSA 1UAXA 3O3HA 1RTJA 4ELUA 3WNHA 3L3VA 1RDAA 1RCHA 4AHSA 1LWFA 1S6PA 4DTPA 1XHXA 1S1TA 5E41A 1CXUA 3AA4A 3C6UA 4PUOA 1NJWA 3ZT1A 1NJXA 1JLBA 3D0PA 2QKKA 1WSHA 3RR8A 4FZYA 1WSGA 1XWLA 4KTWA 4CJLA 4FJ7A 4CJWA 3L2VA 4AH9A 1A5VA 1DTTA 4J2EA 1T8EA 3RRHA 4EZ9A 3H08A 3PX6A 4FZXC 2HHSA 2OA8A 3K58A 3HSTB 3DMJA 1T05A 1HYSA 1C0MA 4HTUA 4I2QA 2YNIA 1N5YA 2XY5A 3ZCMA 3S3NA 3B6PA 2HNDA 2OPQA 1FKPA 4DTNA 4DTXA 3ZSOA 3AVNA 2WONA 2LSNA 3KD5E 2D0BA 3VQ7A 3OYFA 3CM5A 4I7FA 3V1QA 2JGUA 4DU3A 1BI4A 4B9VA 2HVIA 5KGXA 3SZ2A 3CFPA 4W5QA 1KSPA 4DS4A 4CK1A 2FBVA 4H4OA 1S1WA 3KD1E 1RT7A 4DS5A 1SUQA 3U6FA 4Q0BA 4O5BA 4DFKA 3ISNC 5D3GA 1CLQA 4M3WA 4DLEA 4B9SA 1TL3A 4FJXA 4QOZB 2HHVA 1LAWA 2G8UA 1LWEA 4DSEA 4DSFA 2HNZA 2KQ2A 1RT6A 4C8LA 3LZJA 1JXEA 2NUBA 4CEBA 3RWUA 3AVKA 2EX3A 3OYHA 4PWDA 2D0CA 4IBNA 3ZSWA 4YFUA 4CJKA 2HHTA 4FJHA 4IKFA 4MFBA 4O4GA 1RBTA 3M8SA 4Y1DA 3F9KA 1U48A 1LAVA 4M45A 1NJYA 3VN5A 1JLAA 4W5RA 5J2QA 4OLAA 4IG0A 1EXQA 3KJVA 4DFJA 3LP3A 4FLTA 1ZBHA 5T7BA 4O44A 1BGXT 3V6DA 4E19A 1YTUA 1EETA 3SUQA 3TAQA 5KRSA 2VG6A 3SYZA 4ICLA 3JYTA 1KTQA 1S1UA 2HB5A 4CJRA 1CXQA 4CEAA 1TK8A 4CF8A 4HUEA 3V9ZA 3AO3A 4FJNA 3HJFA 3TI0A 3RMBA 4KI6A 4BE0A 1WNSA 2DTUA 2RN2A 4ID1A 5FROA 3PO4A 4KB1A 1RBVA 3OYGA 1RDBA 4FM2A 3B6OA 5CYMA 1U45A 1SKRA 4CERA 2BDPA 4DMNA 4CHQA 4CJEA 3JSMA 2BGGA 4TSXA 3P1GA 1SKSA 2D0AA 4PQUA 3SUOA 1LW2A 3OVNA 4BACA 5J2PA 1XC9A 1JLQA 5JS2A 3D45A 4RW9A 4DTRA 4ELVA 4BWMA 1JXBA 3AA2A 1IKYA 4BWJA 4OKEA 3ZT3A 3OYIA 3MXJA 3QO9A 1HRHA 3DYAA 3IG1A 3SJJA 3UIQA 1I39A 2FBYA 3AVFA 4KTZA 4QAGA 4CFAA 1QQCA 3NBPA 4CHNA 3I8DA 5HLFA 2YV0X 4M3ZA 3EY1A 1NK0A 4CHZA 1NKCA 3O3FA 1EKEA 3SUNA 4ELTA 2OYQA 4KHQA 5KTQA 4ZHRA 4W5OA 4Q5VA 1TKDA 1QSYA 3VQDA 4HCCA 1RDCA 4FW2A 4CJSA 4B8CA 4LSNA 1BISA 4OPJA 2XHBA 4FLVA 4AHTA 3V4IA 1T7PA 3RRGA 2FBTA 5C24A 1ZBFA 4NCAA 4Y1CA 3TR8A 3PX0A 2GBZA 3VQ8A 1KVCA 4CHYA 3LDSA 1NK5A 3TAGA 2Z1IA 4B9NA 2IOCA 3DI6A 2ZE2A 3KLFA 2IS3A 4DTJA 3G10A 1BCOA 4M3YA 2B5JA 4H8KA 5J2NA 4B9MA 4DSIA 1TKXA 3HPGA 4CEDA 4FLUA 5CY4A 2OZMA 4CJFA 5J1EA 4F2SA 4MQ3A 3DLBA 3DRPA 3QNOA 4FK0A 3V1OA 1B9FA 3QINA 4B3OA 3ZSVA 3BDPA 4Z4IA 3SPZA 1NOYA 4CEZA 4BDPA 4KV8A 1C6VA 3HXMA 3HPHA 1U49A 3RMAA 4EP5A 1U4BA 4C8NA 4EZ6A 3V1RA 1TVRA 4CF9A 1RBRA 3MAQA 3HM9A 2IGIA 4N47A 3MEGA 4O0JA 3PUFA 3O4NA 1XI1A 3VQQA 4M42A 4N56A 3K5LA 4CF1A 2KW4A 1L3TA 3SCXA 1C1BA 2PYLA 5HBMA 3WNFA 3V9XA 5HP1A 4GMJB 3HO1A 3P83D 1HYZA 4E7KA 4AHUA 3PV8A 4GVMA 3TAPA 1A5WA 4KHSA 4KHYA 2VG5A 1L3UA 3QIPA 3NGZA 1S1XA 1HPZA 3SUPA 4KHNA 3NH1A 5HRNA 2QXFA 3MECA 2G8FA 1TV6A 4DTOA 5HRRA 4DF4A 4RW6A 4FM0A 3TARA 1NK4A 3E01A 4DTSA 3QESA 2F8SA 3S3OA 1HNVA 3LP0A 1TK0A 3MXMA 1RDDA 1B9DA 3CYMA 3K2PA 3VQCA 4CFCA 4E7IA 4DQPA 3SI6A 1N6QA 1EX4A 5FRNA 3QNNA 1JLGA 2G8VA 4CF2A 1S9EA 2DFEA 4CESA 1YT3A 4ZTJA 4CEFA 1KRPA 1IKWA 2VG7A 1L3VA 2I5JA 2ZD1A 4BE2A 1BIZA 4IFYA 4FJGA 3HK2A 4JS4A 3LWLA 1JLFA 2B6AA 4DLGA 2RPIA 3AA5X 3DLGA 2OPRA 4RW8A 3NH0A 3OYLA 3ZSZA 5SZTA 4DU4A 3RMCA 4DTUA 4K8XA 1JL1A 2ATQA 4CJ4A 2OPSA 4HUGA 1D9FA 1HQUA 4EP4A 3LPUA 3KK1A 2ITGA 4E89A 4DFMA 1Q9YA 4H4MA 4HHTA 3L2RA 3CFOA 1RTDA 3TWHA 4E1MA 2HHUA 3DLKA 1WSIA 4O55A 1BQNA 3KKRA 4M3UA 4M3TA 4KO0A 4CIFA 3VQ6A 1BI4B 4CK3A 3QETA 3LAMA 2DY4A 4FLWA 3NH2A 5FDLA 3DLRA 4B8AB 1D5AA 1S9GA 3AVAA 2A1SA 3HP9A 1NK8A 4OGEA 1WAJA 4RG8A 2HHXA 1J9AA 3ITHA 3NCIA 3PX4A 1L3SA 1X9MA 2HMIA 4ID5A 2DFHA 1EP4A 1CZ9A 3VQ4A 4CE9A 4Z4HA 3T3FA 4FJ9A 4AILC 4CJPA 3MEDA 1J5OA 1X9WA 4FK2A 1J53A 3PY8A 2Y1JA 3NGIA 1RT3A 3HT3A 1RBSA 2HNYA 2Z1JA 3KK3A 2KFNA 1WSFA 2OZSA 3KLIA 4ZTFA 4B9TA 4F4KA 2X78A 1SL1A 1HMVA 1NKBA 3L2UA 1ASWA 4DQIA 1RT5A 4JRPA 1TAQA 1QTMA 4KRFA 2RKIA 1K6YA 1IO2A 1SV5A 2X6NA 5HROA 3AVMA 1GOAA 5CZ1A 5C42A 4FVMA 2YKNA 1WSEA 5KRTA 4OKKA 2IAJA 2AJQA 1RT4A 3V81A 3S9HA 1RTHA 3AVLA 4CEOA 4CGDA 2B4JA 4FJKA 4M41A 3LP2A 5CZ2A 3OYJA 3AO1A 3ZT0A 3K5NA 4AHCA 4FJMA 3NF7A 2QK9A 2A1RA 1FKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYQ A;  4JLH A;  3FFI A;  4E7H A;  4DSK A;  4CK2 A;  3OYB A;  5DK5 A;  1YVU A;  2KZM A;  1MU2 A;  2GUI A;  4OVL A;  2XO7 A;  1KFD A;  1FXX A;  4LD0 A;  4LY7 A;  3CQ8 A;  4DWI A;  1D8Y A;  2BAN A;  3DLE A;  1BL3 A;  3DRR A;  4M3R A;  3OYE A;  3KLG A;  3F73 A;  4NCG A;  3OYC A;  3K57 A;  2P5G A;  2EHG A;  4FK4 A;  1RBU A;  3M8Q A;  4F2R A;  2YNH A;  3THV A;  1LWC A;  3M8R A;  4KPY A;  3AVI A;  4FM1 A;  2D5R A;  3SV3 A;  4DSJ A;  4FJL A;  4KHW A;  1BCM A;  2G8W A;  1SL0 A;  1SL2 A;  2O4I A;  1JLE A;  1D9D A;  4BDZ A;  1KCF A;  4FXD A;  1ZBL A;  4CFB A;  3V9W A;  4CGF A;  1RTI A;  4LH5 A;  2XY7 A;  1ASV A;  3QEV A;  3QLH A;  4CEC A;  1QS4 A;  1Z25 A;  3SQ4 A;  1SKW A;  1X9S A;  3HVR A;  3LAK A;  1NK9 A;  5JS1 A;  1A5X A;  3SQ2 A;  1F21 A;  2KZZ A;  3DOL A;  2PZS A;  4OGC A;  1G15 A;  3I0R A;  1NOZ A;  3OS1 A;  4CGG A;  1RT2 A;  5KGW A;  3ZT2 A;  1C1A A;  1VRU A;  1YTA A;  4O0I A;  4FLZ A;  4L8R B;  4FZZ A;  1TKT A;  2KFZ A;  1HJR A;  3MEE A;  3VQE A;  3T1A A;  2IC3 A;  2YNF A;  2Z1G A;  1C0U A;  3OYA A;  3KK2 A;  4DTM A;  4DU1 A;  1U47 A;  4J2D A;  4Z4F A;  1REV A;  3EYZ A;  1UA1 A;  4FYD A;  4LSL A;  2KTQ A;  3ZSQ A;  5HRS A;  3VQA A;  1IKX A;  1U04 A;  3LP1 A;  3SQ0 A;  1HNI A;  4C8M A;  1VK0 A;  3K5O A;  2JLE A;  3RMD A;  1WSJ A;  3EZ5 A;  3LZI A;  4CJ3 A;  4KI4 A;  2R7Y A;  1BHL A;  4Z4C A;  3U3G A;  3TAM A;  4C8O A;  4AHV A;  1CZB A;  2RF2 A;  2HHW A;  3VA3 A;  2ZQB A;  3ZSY A;  1TGO A;  4OPK A;  4FLX A;  4K8Z A;  1VSE A;  2G8H A;  4FJI A;  1VRT A;  5K14 A;  4PA1 A;  2F8T A;  2Z1H A;  1W0H A;  1VSH A;  3LPT A;  3T19 A;  3KKS A;  3KLH A;  3L8B A;  4BE1 A;  3DLH A;  4RW7 A;  4C8K A;  4Z4E A;  4AHR A;  3IAY A;  1Y97 A;  4CJU A;  3NF8 A;  3RTV A;  3TAF A;  3NFA A;  1C0T A;  3OY9 A;  1IH7 A;  4CEE A;  3OYK A;  3U3Y A;  2P5O A;  4FJ8 A;  4NYF A;  4DF8 A;  2W42 A;  3IS9 A;  3LAL A;  2X6S A;  1VSJ A;  4Z0U A;  2F96 A;  3BGR A;  3QIO A;  3NGY A;  4CFD A;  3QEX A;  3TAN A;  1XHZ A;  2G8K A;  3O4Q A;  4F3T A;  2HHQ A;  4KKO A;  4I9Q A;  3LAN A;  3ULD A;  3ALY A;  1S6Q A;  4CHP A;  3SV4 A;  1ZBU A;  1HQE A;  1KVA A;  3AVH A;  1TK5 A;  1KFS A;  3VQ5 A;  4FJJ A;  1VSK A;  4GW6 A;  2YKM A;  4CJ5 A;  3L3U A;  4N5S A;  2DFF A;  5HRP A;  4FW1 A;  4E3S A;  1RNH A;  3VQP A;  5C25 A;  3WNG A;  1IKV A;  3TAB A;  1T03 A;  4CHO A;  4CGH A;  1ITG A;  1LW0 A;  4HCB A;  3KTQ A;  3OJU A;  3A2F A;  1W9H A;  2X74 A;  3AO5 A;  3AVJ A;  1QSL A;  4OLB A;  1JKH A;  1VSD A;  2GV9 A;  1BIU A;  4W5T A;  4F8R A;  5I3U A;  5SWM A;  3ZSX A;  3QEW A;  1DLO A;  4JS5 A;  3ZSR A;  2VWJ A;  4I9L A;  4QCL A;  1TKZ A;  1GOC A;  1DTQ A;  3MXI A;  4B9U A;  4W5N A;  3HL8 A;  3L2Q A;  1KLN A;  2E4L A;  3CG7 A;  2ETJ A;  3QER A;  3LWM A;  1VSI A;  5FRM A;  3NAE A;  4IG3 A;  4BDY A;  3CM6 A;  1S1V A;  1LV5 A;  3I0S A;  1VSF A;  4NYN A;  3KLE A;  3DM2 A;  1IG9 A;  4KHU A;  3HVT A;  1L5U A;  3VA0 A;  5CYQ A;  2G8I A;  3V9S A;  3OS2 A;  4CGI A;  4CJV A;  4DG1 A;  3OYD A;  3QEP A;  1RIL A;  5DMR A;  3DRS A;  4OKJ A;  2PYJ A;  4M3X A;  4OJR A;  4LH4 A;  3SQ1 A;  3RR7 A;  1O1W A;  4R5P A;  4E7L A;  2E6M A;  1UWB A;  4KRE A;  4J2B A;  2FC0 A;  4E7J A;  3QEI A;  1FK9 A;  4CCH A;  3WNE A;  3P5J A;  4HVJ A;  2WOM A;  2YNG A;  1S5J A;  1UA0 A;  4KAZ A;  4CF0 A;  4KTQ A;  1TL1 A;  3KIO A;  3NE6 A;  1J54 A;  1B92 A;  4RW4 A;  4E0D A;  2IDO A;  4B9L A;  3AO4 A;  1Q9X A;  1Z26 A;  1WLJ A;  3C94 A;  3HP6 A;  4UQG A;  3OS0 A;  2OPP A;  3NF6 A;  4IDK A;  5KI6 A;  2PY5 A;  5EU7 A;  4IFV A;  4E1N A;  3O3G A;  1WN7 A;  4WE1 A;  2YHA A;  4CGJ A;  1JL2 A;  3DOK A;  3OYM A;  2P51 A;  3TAE A;  1NK6 A;  3AVG A;  3ZT4 A;  1GOB A;  4DSL A;  1UOC A;  4PY5 A;  2BE2 A;  1JLC A;  4CEQ A;  3K59 A;  1ZBI A;  4CJT A;  2HW3 A;  3C6T A;  4KFB A;  3ASM A;  4J2A A;  1VSM A;  3CFR A;  3M8P A;  2O4G A;  4DQQ A;  3AV9 A;  2Y1I A;  2FBX A;  4CIE A;  2HVH A;  1QHT A;  4XIU A;  3NF9 A;  3VQB A;  4KB0 A;  2QKB A;  1NK7 A;  1KLM A;  1NKE A;  3IRX A;  3NHG A;  1X1P A;  3V9U A;  3K5M A;  4CIG A;  4FCY A;  2XRI A;  3AA3 A;  4B08 A;  3OYN A;  3AVC A;  3VQ9 A;  4CJQ A;  3AO2 A;  1R0A A;  2YHB A;  2P1J A;  4JRQ A;  1QSS A;  4N41 A;  2E6L A;  1KVB A;  1Q8I A;  4Z4G A;  1NJZ A;  3HPO A;  3HYF A;  3NDK A;  2XY8 A;  4FLY A;  4DFP A;  5I42 A;  2Q3S A;  1C1C A;  1I3A A;  1BQM A;  4I2P A;  1VSL A;  1TAU A;  2XY6 A;  1ASU A;  3SPY A;  3S3M A;  3PO5 A;  3AVB A;  1RT1 A;  2VWK A;  3G0Z A;  3C95 A;  3L2W A;  4DQR A;  1WAF A;  4N76 A;  5J2M A;  4HUF A;  1QE1 A;  4NCB A;  4G1Q A;  1HYV A;  4YNQ A;  3SNN A;  4F3O A;  4FJ5 A;  3OJS A;  4DQS A;  1UAX A;  3O3H A;  1RTJ A;  4ELU A;  3WNH A;  3L3V A;  1RDA A;  1RCH A;  4AHS A;  1LWF A;  1S6P A;  4DTP A;  1XHX A;  1S1T A;  5E41 A;  1CXU A;  3AA4 A;  3C6U A;  4PUO A;  1NJW A;  3ZT1 A;  1NJX A;  1JLB A;  3D0P A;  2QKK A;  1WSH A;  3RR8 A;  4FZY A;  1WSG A;  1XWL A;  4KTW A;  4CJL A;  4FJ7 A;  4CJW A;  3L2V A;  4AH9 A;  1A5V A;  1DTT A;  4J2E A;  1T8E A;  3RRH A;  4EZ9 A;  3H08 A;  3PX6 A;  4FZX C;  2HHS A;  2OA8 A;  3K58 A;  3HST B;  3DMJ A;  1T05 A;  1HYS A;  1C0M A;  4HTU A;  4I2Q A;  2YNI A;  1N5Y A;  2XY5 A;  3ZCM A;  3S3N A;  3B6P A;  2HND A;  2OPQ A;  1FKP A;  4DTN A;  4DTX A;  3ZSO A;  3AVN A;  2WON A;  2LSN A;  3KD5 E;  2D0B A;  3VQ7 A;  3OYF A;  3CM5 A;  4I7F A;  3V1Q A;  2JGU A;  4DU3 A;  1BI4 A;  4B9V A;  2HVI A;  5KGX A;  3SZ2 A;  3CFP A;  4W5Q A;  1KSP A;  4DS4 A;  4CK1 A;  2FBV A;  4H4O A;  1S1W A;  3KD1 E;  1RT7 A;  4DS5 A;  1SUQ A;  3U6F A;  4Q0B A;  4O5B A;  4DFK A;  3ISN C;  5D3G A;  1CLQ A;  4M3W A;  4DLE A;  4B9S A;  1TL3 A;  4FJX A;  4QOZ B;  2HHV A;  1LAW A;  2G8U A;  1LWE A;  4DSE A;  4DSF A;  2HNZ A;  2KQ2 A;  1RT6 A;  4C8L A;  3LZJ A;  1JXE A;  2NUB A;  4CEB A;  3RWU A;  3AVK A;  2EX3 A;  3OYH A;  4PWD A;  2D0C A;  4IBN A;  3ZSW A;  4YFU A;  4CJK A;  2HHT A;  4FJH A;  4IKF A;  4MFB A;  4O4G A;  1RBT A;  3M8S A;  4Y1D A;  3F9K A;  1U48 A;  1LAV A;  4M45 A;  1NJY A;  3VN5 A;  1JLA A;  4W5R A;  5J2Q A;  4OLA A;  4IG0 A;  1EXQ A;  3KJV A;  4DFJ A;  3LP3 A;  4FLT A;  1ZBH A;  5T7B A;  4O44 A;  1BGX T;  3V6D A;  4E19 A;  1YTU A;  1EET A;  3SUQ A;  3TAQ A;  5KRS A;  2VG6 A;  3SYZ A;  4ICL A;  3JYT A;  1KTQ A;  1S1U A;  2HB5 A;  4CJR A;  1CXQ A;  4CEA A;  1TK8 A;  4CF8 A;  4HUE A;  3V9Z A;  3AO3 A;  4FJN A;  3HJF A;  3TI0 A;  3RMB A;  4KI6 A;  4BE0 A;  1WNS A;  2DTU A;  2RN2 A;  4ID1 A;  5FRO A;  3PO4 A;  4KB1 A;  1RBV A;  3OYG A;  1RDB A;  4FM2 A;  3B6O A;  5CYM A;  1U45 A;  1SKR A;  4CER A;  2BDP A;  4DMN A;  4CHQ A;  4CJE A;  3JSM A;  2BGG A;  4TSX A;  3P1G A;  1SKS A;  2D0A A;  4PQU A;  3SUO A;  1LW2 A;  3OVN A;  4BAC A;  5J2P A;  1XC9 A;  1JLQ A;  5JS2 A;  3D45 A;  4RW9 A;  4DTR A;  4ELV A;  4BWM A;  1JXB A;  3AA2 A;  1IKY A;  4BWJ A;  4OKE A;  3ZT3 A;  3OYI A;  3MXJ A;  3QO9 A;  1HRH A;  3DYA A;  3IG1 A;  3SJJ A;  3UIQ A;  1I39 A;  2FBY A;  3AVF A;  4KTZ A;  4QAG A;  4CFA A;  1QQC A;  3NBP A;  4CHN A;  3I8D A;  5HLF A;  2YV0 X;  4M3Z A;  3EY1 A;  1NK0 A;  4CHZ A;  1NKC A;  3O3F A;  1EKE A;  3SUN A;  4ELT A;  2OYQ A;  4KHQ A;  5KTQ A;  4ZHR A;  4W5O A;  4Q5V A;  1TKD A;  1QSY A;  3VQD A;  4HCC A;  1RDC A;  4FW2 A;  4CJS A;  4B8C A;  4LSN A;  1BIS A;  4OPJ A;  2XHB A;  4FLV A;  4AHT A;  3V4I A;  1T7P A;  3RRG A;  2FBT A;  5C24 A;  1ZBF A;  4NCA A;  4Y1C A;  3TR8 A;  3PX0 A;  2GBZ A;  3VQ8 A;  1KVC A;  4CHY A;  3LDS A;  1NK5 A;  3TAG A;  2Z1I A;  4B9N A;  2IOC A;  3DI6 A;  2ZE2 A;  3KLF A;  2IS3 A;  4DTJ A;  3G10 A;  1BCO A;  4M3Y A;  2B5J A;  4H8K A;  5J2N A;  4B9M A;  4DSI A;  1TKX A;  3HPG A;  4CED A;  4FLU A;  5CY4 A;  2OZM A;  4CJF A;  5J1E A;  4F2S A;  4MQ3 A;  3DLB A;  3DRP A;  3QNO A;  4FK0 A;  3V1O A;  1B9F A;  3QIN A;  4B3O A;  3ZSV A;  3BDP A;  4Z4I A;  3SPZ A;  1NOY A;  4CEZ A;  4BDP A;  4KV8 A;  1C6V A;  3HXM A;  3HPH A;  1U49 A;  3RMA A;  4EP5 A;  1U4B A;  4C8N A;  4EZ6 A;  3V1R A;  1TVR A;  4CF9 A;  1RBR A;  3MAQ A;  3HM9 A;  2IGI A;  4N47 A;  3MEG A;  4O0J A;  3PUF A;  3O4N A;  1XI1 A;  3VQQ A;  4M42 A;  4N56 A;  3K5L A;  4CF1 A;  2KW4 A;  1L3T A;  3SCX A;  1C1B A;  2PYL A;  5HBM A;  3WNF A;  3V9X A;  5HP1 A;  4GMJ B;  3HO1 A;  3P83 D;  1HYZ A;  4E7K A;  4AHU A;  3PV8 A;  4GVM A;  3TAP A;  1A5W A;  4KHS A;  4KHY A;  2VG5 A;  1L3U A;  3QIP A;  3NGZ A;  1S1X A;  1HPZ A;  3SUP A;  4KHN A;  3NH1 A;  5HRN A;  2QXF A;  3MEC A;  2G8F A;  1TV6 A;  4DTO A;  5HRR A;  4DF4 A;  4RW6 A;  4FM0 A;  3TAR A;  1NK4 A;  3E01 A;  4DTS A;  3QES A;  2F8S A;  3S3O A;  1HNV A;  3LP0 A;  1TK0 A;  3MXM A;  1RDD A;  1B9D A;  3CYM A;  3K2P A;  3VQC A;  4CFC A;  4E7I A;  4DQP A;  3SI6 A;  1N6Q A;  1EX4 A;  5FRN A;  3QNN A;  1JLG A;  2G8V A;  4CF2 A;  1S9E A;  2DFE A;  4CES A;  1YT3 A;  4ZTJ A;  4CEF A;  1KRP A;  1IKW A;  2VG7 A;  1L3V A;  2I5J A;  2ZD1 A;  4BE2 A;  1BIZ A;  4IFY A;  4FJG A;  3HK2 A;  4JS4 A;  3LWL A;  1JLF A;  2B6A A;  4DLG A;  2RPI A;  3AA5 X;  3DLG A;  2OPR A;  4RW8 A;  3NH0 A;  3OYL A;  3ZSZ A;  5SZT A;  4DU4 A;  3RMC A;  4DTU A;  4K8X A;  1JL1 A;  2ATQ A;  4CJ4 A;  2OPS A;  4HUG A;  1D9F A;  1HQU A;  4EP4 A;  3LPU A;  3KK1 A;  2ITG A;  4E89 A;  4DFM A;  1Q9Y A;  4H4M A;  4HHT A;  3L2R A;  3CFO A;  1RTD A;  3TWH A;  4E1M A;  2HHU A;  3DLK A;  1WSI A;  4O55 A;  1BQN A;  3KKR A;  4M3U A;  4M3T A;  4KO0 A;  4CIF A;  3VQ6 A;  1BI4 B;  4CK3 A;  3QET A;  3LAM A;  2DY4 A;  4FLW A;  3NH2 A;  5FDL A;  3DLR A;  4B8A B;  1D5A A;  1S9G A;  3AVA A;  2A1S A;  3HP9 A;  1NK8 A;  4OGE A;  1WAJ A;  4RG8 A;  2HHX A;  1J9A A;  3ITH A;  3NCI A;  3PX4 A;  1L3S A;  1X9M A;  2HMI A;  4ID5 A;  2DFH A;  1EP4 A;  1CZ9 A;  3VQ4 A;  4CE9 A;  4Z4H A;  3T3F A;  4FJ9 A;  4AIL C;  4CJP A;  3MED A;  1J5O A;  1X9W A;  4FK2 A;  1J53 A;  3PY8 A;  2Y1J A;  3NGI A;  1RT3 A;  3HT3 A;  1RBS A;  2HNY A;  2Z1J A;  3KK3 A;  2KFN A;  1WSF A;  2OZS A;  3KLI A;  4ZTF A;  4B9T A;  4F4K A;  2X78 A;  1SL1 A;  1HMV A;  1NKB A;  3L2U A;  1ASW A;  4DQI A;  1RT5 A;  4JRP A;  1TAQ A;  1QTM A;  4KRF A;  2RKI A;  1K6Y A;  1IO2 A;  1SV5 A;  2X6N A;  5HRO A;  3AVM A;  1GOA A;  5CZ1 A;  5C42 A;  4FVM A;  2YKN A;  1WSE A;  5KRT A;  4OKK A;  2IAJ A;  2AJQ A;  1RT4 A;  3V81 A;  3S9H A;  1RTH A;  3AVL A;  4CEO A;  4CGD A;  2B4J A;  4FJK A;  4M41 A;  3LP2 A;  5CZ2 A;  3OYJ A;  3AO1 A;  3ZT0 A;  3K5N A;  4AHC A;  4FJM A;  3NF7 A;  2QK9 A;  2A1R A;  1FKO A; 
#chains in the Genus database with same CATH topology
 1ZYQ A;  1QZ6 A;  4CK2 A;  3OYB A;  1O13 A;  4OVL A;  4JI6 K;  3MCA B;  1D8Y A;  4JAX A;  3KLG A;  4NCG A;  3AVI A;  1DGK N;  1SL0 A;  1D9D A;  3MDQ A;  1GLE G;  4CGF A;  1X3N A;  5JLH A;  3QLH A;  4CEC A;  1QS4 A;  1Z25 A;  4IO9 L;  3S41 A;  3G6E N;  5JS1 A;  5BRH A;  1G15 A;  3I0R A;  1NOZ A;  5AQM A;  3UKU B;  3AGK A;  3ZT2 A;  3THX A;  4L8R B;  2KFZ A;  1U2V A;  3VQE A;  4DTM A;  2YNF A;  1C0U A;  2VQF K;  2QWN A;  4BQZ A;  4DU1 A;  3EYZ A;  4B3R K;  2KTQ A;  1NGJ A;  3HRG A;  4FWP A;  3SQ0 A;  3K5O A;  2JLE A;  3RMD A;  4KI4 A;  2R7Y A;  1BHL A;  3KVG A;  1J5E K;  3U3G A;  2I7P A;  3ATV A;  3NVK A;  2RF2 A;  1TGO A;  4LFC K;  1T3V A;  2VGN A;  3N4P A;  3LPT A;  3KLH A;  5AQT A;  4LF7 K;  1IBL K;  3AAR A;  4NLB A;  4BR0 A;  3CCR N;  3NF8 A;  1D4X A;  3U8X A;  3MN5 A;  4FJ8 A;  1C0T A;  3OYK A;  4DF8 A;  3QIO A;  3TAN A;  3NGY A;  4CFD A;  3QEX A;  4BRD A;  3SBG A;  3ULD A;  3SV4 A;  2Q0U A;  4FJJ A;  2YKM A;  3R8E A;  2W6K A;  3L3U A;  5M1O A;  4E3S A;  3WNG A;  4CGH A;  1ITG A;  1LW0 A;  3G71 N;  3OJU A;  3A2F A;  2FSJ A;  1VSD A;  2GV9 A;  1BIU A;  2QXL A;  4F8R A;  5SWM A;  3ZSR A;  3HBT A;  2UU9 K;  1ESV A;  4W5N A;  2E1Y A;  3L2Q A;  1KLN A;  2HBJ A;  3DWL A;  3K9J A;  2E2Q A;  3CM6 A;  3I0S A;  1VSF A;  3KLE A;  3DM2 A;  1IG9 A;  3WXM B;  2G8I A;  4CGI A;  4CJV A;  2PYJ A;  4OJR A;  4FO0 A;  4Y0W A;  1UWB A;  4E7J A;  3WT0 A;  3P5J A;  2YNG A;  1S5J A;  4JI2 K;  1J54 A;  3ZEU A;  3TPQ A;  1JCG A;  2VCP A;  3EL2 A;  3CCU N;  2P9N B;  1BUP A;  3UKR B;  2PY5 A;  4E1N A;  4IFV A;  1NK6 A;  3OYM A;  3AVG A;  2GX9 A;  2KZM A;  1ZBI A;  5EX5 A;  3CFR A;  2KHO A;  2VWB A;  5F2R A;  3CIP A;  4CIE A;  1KLM A;  5M1N A;  4BGA A;  3V9U A;  3VGL A;  2XRI A;  3AA3 A;  4B08 A;  3AVC A;  4CJQ A;  3MX2 A;  4GV9 A;  3LM9 A;  3SAH A;  3HPO A;  2FF3 B;  1QVF M;  1C1C A;  4KBO A;  4NO7 A;  1VSL A;  4GKJ K;  1TAU A;  2XY6 A;  3S3M A;  1RT1 A;  2O8C B;  3O9U A;  4N76 A;  3RSE B;  4HUF A;  4G1Q A;  3CCV N;  4DQS A;  1RTJ A;  2NRV A;  1NGI A;  1RDA A;  4BG8 A;  3AA4 A;  1QZ5 A;  1X9J A;  1WSG A;  1XWL A;  4H0X B;  5AQW A;  3L2V A;  4BVO A;  3FE1 A;  4J2E A;  1T8E A;  3H08 A;  3Q7B A;  4KH6 A;  3DMJ A;  4CJ7 A;  5TKY A;  3ZCM A;  2UXB K;  4DTN A;  5C15 A;  3ZSO A;  2O8C A;  3OYF A;  4B9V A;  3SZ2 A;  4CK1 A;  3THW A;  4YHH K;  5BRF A;  4DS5 A;  3U6F A;  4O5B A;  4B9S A;  1TL3 A;  1LWE A;  4DSE A;  5DM6 L;  1RDU A;  3AVK A;  4C23 A;  3OYH A;  4FWO A;  1M1K O;  4IBN A;  4YFU A;  2HHT A;  5FPM A;  4IJA A;  4FJH A;  4IKF A;  5AQO A;  1JJ2 M;  3F9K A;  4IZ9 A;  1U48 A;  5J2Q A;  4OLA A;  1EXQ A;  3LP3 A;  4O44 A;  2CH6 A;  3ZYY X;  1EO1 A;  3TAQ A;  5KRS A;  4ICL A;  3JYT A;  1S1U A;  2HB5 A;  5AQX A;  1N34 K;  1CXQ A;  4CEA A;  4X62 K;  4CF8 A;  3TI0 A;  2RN2 A;  3OYG A;  4FM2 A;  1SKR A;  3TTD A;  3VER A;  3CJA A;  4J8F A;  2OTJ N;  4Z94 A;  1LW2 A;  3E9O A;  1JLQ A;  1IKY A;  3ZT3 A;  3MXJ A;  4BRL A;  3DYA A;  2UUA K;  3SJJ A;  1I39 A;  4QAG A;  4CFA A;  3I8D A;  5HLF A;  4M3Z A;  3K0S A;  3E1Y A;  1GLC G;  1Z6R A;  3O5B A;  4CZH A;  1QSY A;  4FWR A;  4FW2 A;  2F9W A;  4LSN A;  3RRG A;  2FBT A;  1ZBF A;  3VET A;  3TR8 A;  4BG9 A;  5BR8 K;  2ITM A;  3LDP A;  3TAG A;  5AQR A;  2HOE A;  2ZE2 A;  4A61 A;  3KLF A;  1HKB A;  3CJ9 A;  2NLX A;  3G10 A;  3C7N A;  3HPG A;  5KPT A;  2YHW A;  1IG8 A;  4PKI A;  5BRE A;  2GEM A;  1YJN N;  3ZEU B;  3QIN A;  1YIT N;  3ZSV A;  3SPZ A;  1NOY A;  4CEZ A;  5M1K A;  2D1K A;  4ILG B;  1U49 A;  3RMA A;  2VQE K;  3P38 A;  3EO3 A;  4O0J A;  3TU5 A;  1HKC A;  5AJ3 K;  3FZF A;  4H5N A;  4N56 A;  5AQN A;  4WFB L;  1G99 A;  1L3T A;  3WNF A;  3V9X A;  2ZJQ L;  4H5R A;  4HWI A;  4BRH A;  5AZI A;  1VQ6 N;  5LMU K;  4AHU A;  4DR2 K;  2GTD A;  3TAP A;  1YIJ N;  1HPM A;  3CER A;  2QXF A;  3MEC A;  2G8F A;  3THY B;  5IWA K;  2AP1 A;  5EOY A;  3TAR A;  4A2B A;  1NWK A;  4JKF A;  1CZA N;  1NBW A;  1RDD A;  5AZJ B;  2YI1 A;  3QBX A;  3CYM A;  3OHR A;  3M3Z A;  4DQP A;  4QS7 A;  3PIP L;  3H1Q A;  3AAP A;  1BG3 A;  1YT3 A;  4JKG B;  3VF2 A;  4ZTJ A;  1IKW A;  3J7Z O;  4FJG A;  3QFU A;  3O9R A;  3CC4 N;  4DU4 A;  1JL1 A;  4HUG A;  4EP4 A;  3LPU A;  1K73 O;  2QW9 A;  5AQS A;  4DFM A;  5LJW A;  4H4M A;  2NZT A;  3LM2 A;  2WBN A;  4KO0 A;  1XC3 A;  4CIF A;  5ADX H;  2E88 A;  3IUC A;  1MA9 B;  4FLW A;  1YXQ A;  1OH8 A;  1N33 K;  4OGE A;  2YJF A;  4BRA A;  3NCI A;  4OX9 K;  1C0F A;  3JS6 A;  3T3F A;  4FJ9 A;  4CJP A;  1J5O A;  3PY8 A;  3F9M A;  3MN6 A;  2Y1J A;  1T44 A;  4WCE L;  2Z1J A;  2HNY A;  2GEL A;  4DQ8 A;  2OZS A;  3KLI A;  4ZTF A;  2P9L B;  1YHQ N;  1GLD G;  4DQI A;  2X6N A;  3G25 A;  5CZ1 A;  5C42 A;  3E9L A;  4BRP A;  2YKN A;  1FJG K;  1WBB A;  1T6C A;  3AVL A;  2B4J A;  3LP2 A;  4YOT A;  5CZ2 A;  3OYJ A;  5FLX O;  3K5N A;  3NF7 A;  4JLH A;  3FFI A;  4E7H A;  3CCE N;  1KXP A;  1R59 O;  4DSK A;  5DK5 A;  1YVU A;  4A59 A;  2GUI A;  4DB3 A;  5CHI A;  4H5T A;  4X66 K;  4LY7 A;  3DRR A;  1RBU A;  4ILH A;  1HKG A;  3M8R A;  2P9S A;  3J8A A;  3SV3 A;  4FJL A;  4BY9 C;  4KHW A;  1BCM A;  2G8W A;  3U9Z A;  3WXK A;  1KCF A;  3U9D A;  4IXC A;  1RTI A;  3U4L A;  4LH5 A;  3SQ4 A;  3CD6 N;  3M5R A;  1X9S A;  4LFB K;  5E26 A;  4OGC A;  3FZH A;  1RT2 A;  3BZC A;  5KGW A;  1VRU A;  1TKT A;  3T1A A;  3OYA A;  3KK2 A;  1BWF O;  1UA1 A;  1SS6 A;  3LP1 A;  2V7Y A;  3EZ5 A;  2IVN A;  3LZI A;  2HBM A;  4BRC A;  2EWS A;  3LDL A;  2O8E A;  1K8K A;  3CCJ N;  4Z4C A;  3TAM A;  3CPW M;  4AHV A;  5AZI B;  3VA3 A;  2ZQB A;  1VSE A;  3SBT A;  2I7N A;  1J6Z A;  3T19 A;  3DJC A;  4JD2 B;  3DLH A;  4RW7 A;  4CZF A;  4AHR A;  1JCF A;  1Y97 A;  5M1F A;  3RTV A;  3TAF A;  3NFA A;  3TTF A;  3LAL A;  2X6S A;  1VSJ A;  3OBY A;  2G8K A;  4KKO A;  1S6Q A;  4CHP A;  3ID6 A;  1HQE A;  3AVH A;  3THX B;  5AQV A;  4GW6 A;  3QDK A;  4BRM A;  5BPM A;  4CJ5 A;  4N5S A;  2DFF A;  3TAB A;  2BUP A;  1IKV A;  1OH6 A;  4BC2 A;  3KTQ A;  4XH1 A;  5AQZ A;  3L6Q A;  4PL7 A;  4FPA A;  3VEW A;  1W9H A;  5IT9 O;  2X74 A;  1RDW X;  3GDQ A;  3P4I A;  3E66 A;  3ZSX A;  1RGI A;  4FWM A;  1DLO A;  4JS5 A;  2E5L K;  3QFP A;  4I9L A;  3DXM B;  1ILY A;  1TKZ A;  1LOT B;  1DTQ A;  3AY9 A;  3VMF B;  3KWI A;  3CG7 A;  3NAE A;  1ZC6 A;  3UB5 A;  3OW2 M;  3BEX A;  1Q18 A;  1L5U A;  3WEE B;  3V9S A;  4JV5 K;  4DG1 A;  3QEP A;  1VQ9 N;  3DRS A;  4OKJ A;  3O9T A;  4LH4 A;  3CC2 N;  4E7L A;  2E6M A;  4J2B A;  2FC0 A;  1FK9 A;  4CCH A;  4HVJ A;  3J81 O;  4FWQ A;  4BRI A;  3FZM A;  4CZM A;  3KIO A;  3NE6 A;  1NGA A;  2NRW A;  4E0D A;  5GIO A;  4JKD A;  4B9L A;  3C94 A;  3HP6 A;  2NRX A;  1E4F T;  3P39 A;  3O3G A;  1I94 K;  4QCL A;  2YHA A;  4H5W A;  4PKH A;  3TAE A;  5FPN A;  3ZT4 A;  4PY5 A;  3QB0 A;  1UOC A;  2BE2 A;  4BRE A;  3C6T A;  1VSM A;  2QKB A;  1NK7 A;  1NKE A;  3IRX A;  3NHG A;  1X1P A;  4CIG A;  1XNQ K;  5MLC Q;  3OYN A;  4X65 K;  3AO2 A;  4BR9 A;  2E6L A;  4H0O A;  1KVB A;  4Z4G A;  1TUU A;  3BF3 A;  2QWP A;  3HOT A;  4IJN A;  4FLY A;  1IBM K;  3IDH A;  3AVB A;  2VWK A;  3G0Z A;  1LCU A;  1WAF A;  4FJ5 A;  4F3O A;  1HJO A;  3A5N C;  4E1J A;  1UAX A;  3I33 A;  3WNH A;  3L3V A;  2JWK A;  3WXL A;  2V7Z A;  1JCE A;  4PUO A;  3O8M A;  3R1X A;  1JLB A;  4FJ7 A;  4CJW A;  3THY A;  2QWM A;  1NGH A;  4DUZ K;  4EZ9 A;  5M1Q A;  2HHS A;  1BOT O;  3G4S N;  2HST A;  4JK7 A;  3HST B;  3CMA N;  1HYS A;  1GLJ O;  5AQH A;  1C0M A;  1N5Y A;  1BDG A;  1VQ4 N;  4V19 S;  3CCQ N;  3VEO A;  2LSN A;  1EQY A;  3VQ7 A;  3CM5 A;  2JGU A;  1ZBS A;  5KGX A;  2FBV A;  4H4O A;  4JKE A;  3ENO A;  3DAW A;  4Q0B A;  4DFK A;  3KWG A;  1VQL N;  4DLE A;  4FJX A;  4FWK A;  3IKM A;  4C8L A;  4PWD A;  2NUB A;  4DV2 K;  3RWU A;  4JI3 K;  2D0P A;  3WUH A;  4IWV A;  1EWR A;  4MFB A;  4O4G A;  3M8S A;  3R3L A;  5EXW A;  2W6L A;  5KQ8 A;  1NJY A;  3CI5 A;  4DFJ A;  5C10 A;  4FLT A;  1S72 N;  3VEN A;  5T7B A;  4E19 A;  1EET A;  4DHY A;  3TSQ A;  1KTQ A;  1E3M A;  4CJR A;  1TK8 A;  4EFH A;  3V9Z A;  4CVN E;  2UUC K;  4JI7 K;  5FRO A;  3NMU A;  1RBV A;  1RDB A;  5CYM A;  4CER A;  5GAH P;  4GKK K;  4DMN A;  4CJE A;  2BGG A;  1SKS A;  3PSI A;  3SUO A;  3D45 A;  4RW9 A;  1HX1 A;  4JEP A;  3VEZ A;  4ELV A;  4BWJ A;  4OKE A;  3LL3 A;  3OYI A;  2W41 A;  2A40 A;  2ZF5 O;  4CHN A;  4KTZ A;  2F4V K;  1NK0 A;  1SAZ A;  2H3G X;  3O9S A;  5KTQ A;  4ZHR A;  3SMP A;  4Q5V A;  2QTD A;  5AQP A;  4HCC A;  1T7P A;  3M6G A;  5C24 A;  4Y1C A;  4I6M A;  3SLC A;  4OPA A;  3EN9 A;  3VQ8 A;  1NK5 A;  3B8A X;  3FLC O;  2IOC A;  1U6Z A;  4JKG A;  3VTH A;  4K25 A;  1BCO A;  3OBW A;  2B5J A;  4K43 A;  1TKX A;  4JK8 A;  5I9E B;  4CED A;  4FLU A;  4MQ3 A;  1YJ9 N;  4FK0 A;  3QBW A;  4A2A A;  3CQY A;  3O4W A;  1VQO N;  4B3O A;  2V52 B;  3AAQ A;  2Q31 A;  4BDP A;  4KV8 A;  3HPH A;  4BR5 A;  4EP5 A;  4C8N A;  2VGM A;  3T69 A;  4EZ6 A;  5AFU A;  3MAQ A;  3HM9 A;  3MEG A;  1NG9 A;  2BH1 A;  3PUF A;  3H6E A;  5JLF A;  3MWT A;  4M42 A;  3VGK A;  3SCX A;  3LDO A;  3C6H A;  1KAX A;  5HP1 A;  4GMJ B;  3HO1 A;  3LDQ A;  3PV8 A;  4GVM A;  4KHS A;  4DV5 K;  3I8B A;  3D7E O;  4XEI A;  3NGZ A;  1BU6 O;  4YOV A;  3CME N;  5HRN A;  4GY2 B;  1YUW A;  1P8Z A;  3J80 O;  2E2P A;  1FW6 A;  4FM0 A;  4CD3 A;  5F1X A;  4DTS A;  4YOY A;  1B9D A;  4QS8 A;  4DR5 K;  3K2P A;  2JWL A;  3VQC A;  4E7I A;  5FRN A;  5AQJ A;  1NGF A;  3C7N B;  1S9E A;  2DFE A;  1KRP A;  1BIZ A;  3LWL A;  1ZXO A;  3QML A;  2RPI A;  2OPR A;  4RW8 A;  2A3Z A;  3ENH A;  3ZSZ A;  5SZT A;  3RMC A;  4CJ4 A;  2ATQ A;  3RVC A;  3D2E A;  1D9F A;  3ULE A;  3A5M C;  2ITG A;  1RTD A;  2HHU A;  3DLK A;  3A8Y A;  4M3U A;  3WQT A;  3CCM N;  3D6R A;  1BI4 B;  4CK3 A;  5JMV A;  3LAM A;  4BC5 A;  4JKH A;  4B8A B;  1D5A A;  3AVA A;  1NK8 A;  4RG8 A;  2HHX A;  5BPL A;  3ITH A;  3E9P A;  1VQ7 N;  4F9O A;  1CZ9 A;  3VQ4 A;  3ATU A;  2P9N A;  1X9W A;  3FZK A;  1J53 A;  3T1H K;  1RBS A;  3KK3 A;  4A62 A;  4CZL A;  4MO4 A;  1HMV A;  1XUP O;  4JRP A;  2FXU A;  2RKI A;  4A5A A;  3AVM A;  1GOA A;  3QIC A;  1WSE A;  4FJK A;  2P9U B;  5HL7 L;  4B1Z A;  4BQL A;  4IOX A;  3AO1 A;  2QK9 A;  2IIR A;  4H0V B;  2GWJ A;  3VEX A;  4FWN A;  2Q97 A;  2ZJR L;  1FXX A;  3CJ7 A;  4LD0 A;  3CQ8 A;  4DWI A;  4I6M B;  2BAN A;  1BL3 A;  3OYE A;  4MLE A;  3K57 A;  2P5G A;  2EHG A;  2P9S B;  3CJB A;  4FK4 A;  4F2R A;  2YNH A;  1LWC A;  3SAG A;  1SL2 A;  1NMN A;  3A5O C;  1NJI O;  5BR9 A;  4CFB A;  3V9W A;  2W40 A;  3QEV A;  1SKW A;  1N8R O;  3HVR A;  2J4R A;  1NK9 A;  1A5X A;  3SQ2 A;  4YDU A;  1F21 A;  2KZZ A;  3DOL A;  2P9U A;  4CGG A;  4HTL A;  4FZZ A;  4FLZ A;  1VQN N;  1HJR A;  3MEE A;  4J2D A;  2Z1G A;  4Z4F A;  1REV A;  4LSL A;  3ZSQ A;  3VQA A;  1U04 A;  4C8M A;  4ISE A;  4CJ3 A;  4FOI A;  3THW B;  5E84 A;  3GOI A;  4DKW A;  2KLA A;  4C8O A;  3VGM A;  1CZB A;  2HHW A;  1GLB G;  3ZSY A;  4OPK A;  3TSU A;  4KHP K;  2G8H A;  5C2D A;  5C12 A;  5K14 A;  4PA1 A;  2F8T A;  1DKG D;  3O1B A;  4Z4E A;  4BE1 A;  4C8K A;  2PAV A;  4CJU A;  1MWK A;  3T1Y K;  3EZW A;  3HZ6 A;  3U3Y A;  1IH7 A;  4CEE A;  2QWQ A;  4NYF A;  5GAD P;  3IS9 A;  2W42 A;  4Z0U A;  4CZJ A;  3BGR A;  4F3T A;  2HHQ A;  5ADX A;  1C0G A;  1KFS A;  3VQ5 A;  5GIP A;  4FOE A;  4FW1 A;  1RNH A;  5C25 A;  1T03 A;  1NMD A;  4CHO A;  4FPB A;  3SJH A;  4YOR A;  4OPH A;  1QSL A;  3AO5 A;  3AVJ A;  4PL8 A;  4OLB A;  1JKH A;  4WYB A;  3T7Z A;  5I3U A;  2E8A A;  2VWJ A;  1KC8 O;  4GV6 A;  1GOC A;  3MXI A;  4B9U A;  3VEV A;  2ETJ A;  1OVQ A;  4IG3 A;  1S1V A;  1LV5 A;  3HVT A;  3VA0 A;  5CYQ A;  2O8D A;  3OS2 A;  3OYD A;  1RIL A;  4DV4 K;  4WQ4 C;  2Q36 A;  3RR7 A;  1O1W A;  3VEY A;  4WQ5 A;  4DR4 K;  4KRE A;  5JVG L;  1VQ8 N;  3WNE A;  1K8A O;  2WOM A;  1UA0 A;  4KAZ A;  4KH4 A;  4KTQ A;  1TL1 A;  2GWK A;  2IDO A;  1Q82 O;  2DPN A;  3AO4 A;  1Z26 A;  5EVZ A;  4UQG A;  2Q0R A;  3OS0 A;  4B1X B;  2OPP A;  3NF6 A;  4IDK A;  3HTV A;  5KI6 A;  5EU7 A;  4WE1 A;  4M7X A;  1JL2 A;  3DOK A;  4K41 A;  1GOB A;  4CW7 B;  3VES A;  4CJT A;  4KFB A;  3ASM A;  4B3M K;  4J2A A;  4DQQ A;  3AV9 A;  2FBX A;  4CBU A;  2HVH A;  4KB0 A;  1V4S A;  3A5L C;  1N32 K;  1HLU A;  2YHB A;  2P1J A;  1IJJ A;  4JRQ A;  2P9P B;  4OO1 J;  1Q8I A;  4CZG A;  2YJE A;  3HYF A;  3NDK A;  2XY8 A;  1BQM A;  1IBK K;  4JKB A;  3SPY A;  4B1U B;  3C95 A;  3WEE A;  5J2M A;  1NU0 A;  1P90 A;  5AQK A;  4NCB A;  1E4G T;  3MWP A;  1HYV A;  3SNN A;  3OJS A;  4ELU A;  4YOX A;  3O9Q A;  4DV7 K;  1ATR A;  1RCH A;  4DV1 K;  3IFR A;  5E41 A;  1CXU A;  3C6U A;  1T6D A;  2QKK A;  3D0P A;  1WSH A;  3RR8 A;  4B1Y B;  1OH5 A;  4FZY A;  4KTW A;  5KPZ A;  1DTT A;  3RRH A;  3K58 A;  3FFK B;  3KZB A;  2HND A;  2OPQ A;  1FKP A;  2ASM A;  3M1F A;  1SZ2 A;  4DTX A;  3AVN A;  2WON A;  3EE8 A;  2D0B A;  4C1N K;  4DU3 A;  2HVI A;  4ISG A;  3CFP A;  4DS4 A;  1S1W A;  2P9K A;  3ISN C;  5D3G A;  1CLQ A;  4M3W A;  5AQU A;  3ULE B;  5LL6 Z;  4JN4 A;  4LFA K;  1LAW A;  4RTF D;  2G8U A;  2HBK A;  2HNZ A;  4B3T K;  2KQ2 A;  3DXM A;  1JXE A;  1GLL O;  2BTF A;  2O8F B;  3ZSW A;  4CJK A;  2RE2 A;  5LY3 A;  2IVP A;  3OA9 A;  3P31 A;  4Y1D A;  4AM6 A;  3MX5 A;  3C6A A;  3VN5 A;  1JLA A;  1ZBH A;  4QS9 A;  3C0B A;  3R9P A;  1BGX T;  1YTU A;  3SUQ A;  2VG6 A;  3SYZ A;  4O8U A;  1QHA A;  2A41 A;  3HJF A;  4FL9 A;  4HUE A;  4FJN A;  2E20 A;  4YDU C;  4BE0 A;  4ID1 A;  1K9M O;  3PO4 A;  4KB1 A;  1U45 A;  2BDP A;  4DV0 K;  1WOQ A;  3MN7 A;  3EKS A;  3JSM A;  3W3D A;  4TSX A;  5FPE A;  2D0A A;  3OVN A;  4BAC A;  5KQD A;  1XC9 A;  4EAH D;  5JS2 A;  4BWM A;  1JXB A;  3AA2 A;  4CD1 A;  1HUX A;  3QO9 A;  1HRH A;  3UIQ A;  2O8F A;  3AVF A;  2P5O A;  2UYT A;  1QQC A;  3NBP A;  3FR0 A;  2YV0 X;  3EY1 A;  3SUN A;  4KHQ A;  2OYQ A;  4W5O A;  4JI4 K;  4BVP A;  1TKD A;  3VQD A;  3V4I A;  4OPJ A;  4KHU A;  4FLV A;  2XHB A;  1U2V B;  3PX0 A;  2OTL N;  3LDS A;  4CHY A;  2YCH A;  4DCH A;  2Z1I A;  4B9N A;  1ATS A;  2IS3 A;  2AA4 A;  4DTJ A;  4M3Y A;  1Z05 A;  4DV3 K;  3H3N O;  5CY4 A;  2OZM A;  4XH5 A;  4BRO A;  4CJF A;  5J1E A;  3DLB A;  3CQX A;  4BGB A;  4BR7 A;  2VYP A;  1NGD A;  4YOU A;  1B9F A;  4EIA A;  3TSP A;  4Z4I A;  1C6V A;  3CCS N;  4JYA K;  4ISF A;  3UKR A;  2P9L A;  1TVR A;  1RBR A;  2IGI A;  1GLA G;  3VF6 A;  3O4N A;  2Q2R A;  2ZJP L;  2O8B B;  2KW4 A;  3AGR A;  2PYL A;  5HBM A;  4FVU A;  3SMS A;  3P83 D;  1OH7 A;  4JHD B;  4LF6 K;  4KHY A;  2VG5 A;  4B1V A;  1S1X A;  1HPZ A;  4KHN A;  3WXI A;  4A5B A;  1TV6 A;  4DTO A;  4DF4 A;  1M90 O;  4RW6 A;  3LDN A;  1BO5 O;  2PFU A;  1YAG A;  4WQ4 A;  2WTU A;  3O80 A;  2D4W A;  3E01 A;  2WC9 A;  2F8S A;  2O8B A;  4CZK A;  3LP0 A;  3MXM A;  2IVO A;  4ILJ A;  4IOC L;  5AQF A;  3SI6 A;  2KKZ A;  2HBL A;  2G8V A;  3D2F A;  4CF2 A;  5AFU H;  4CES A;  4CEF A;  2VG7 A;  1L3V A;  2ZD1 A;  4FWL A;  4BE2 A;  4IFY A;  2WFB A;  4JS4 A;  5LJV A;  4CI6 A;  2QA4 N;  2B6A A;  3AA5 X;  3DLG A;  4DSJ A;  4DV6 K;  3PIO L;  3GL1 A;  2HMP A;  5AZJ A;  1WBD A;  1HQU A;  4H0Y B;  2YHX A;  4E89 A;  4DUY K;  5AQL A;  3BP8 A;  3CFO A;  4O55 A;  5TKW A;  1QQN A;  3EEQ A;  2E2O A;  3KKR A;  2E2N A;  4M3T A;  3J7A P;  3VOV A;  3VTI A;  3QET A;  1K8K B;  2O8E B;  2HF4 A;  3HP9 A;  4H0T B;  1J9A A;  2QWO A;  1L3S A;  1EP4 A;  5BN9 A;  4CE9 A;  3C65 A;  4AIL C;  3MED A;  1VQ5 N;  1RT3 A;  3HT3 A;  2KFN A;  1WSF A;  4NLC A;  3ZET A;  3WQU A;  2X78 A;  4M63 C;  2NRH A;  4O8K A;  3O08 A;  4O5F A;  1QTM A;  1TAQ A;  4KRF A;  4UY8 O;  4RCH A;  1MWM A;  1IO2 A;  1SV5 A;  5HRO A;  4WFA L;  4FVM A;  1TYQ B;  1IV0 A;  5BPN A;  1QQM A;  2IAJ A;  4JKC A;  1RT4 A;  3S9H A;  3GG4 A;  4CGD A;  4M41 A;  1YF5 L;  4BRN A;  1Q81 O;  4FJM A;  3HM8 A;  3J7Y P;  1FKO A;  1XNR K;  4FWS A;  3K9K A;  4AM7 A;  1MU2 A;  4CBX A;  2XO7 A;  1KFD A;  4JK9 A;  4GNI A;  3JXU A;  3F73 A;  3DLE A;  3BDP A;  3DXK B;  4M3R A;  2A42 A;  2FSN A;  3OYC A;  3M8Q A;  3THV A;  4KPY A;  4IO8 A;  4FM1 A;  2D5R A;  2P9K B;  4MO5 A;  2O4I A;  4FSV A;  1JLE A;  2V51 B;  5KPR A;  4BDZ A;  5GAE P;  3CET A;  3F2K A;  3UKU A;  4FXD A;  1ZBL A;  3FZL A;  1Y64 A;  4NXM K;  1Q7Y O;  2XY7 A;  1NGC A;  1ASV A;  2OAN A;  5C0Y A;  3LAK A;  2CH5 A;  4U67 L;  2PZS A;  1Q86 O;  3OS1 A;  4DR3 K;  4KH5 A;  4O0I A;  1C1A A;  1YTA A;  2F9T A;  3TTC A;  3IMX A;  4G9Z A;  3V6D A;  2IC3 A;  1U47 A;  4FYD A;  4NB4 A;  2QWR A;  3UE5 A;  2HF3 A;  5HRS A;  1IKX A;  1HNI A;  1VK0 A;  4JKA A;  1WSJ A;  1KAY A;  1ATN A;  4MLH A;  4H03 B;  3ZLJ A;  3CJC A;  3EKU A;  4K8Z A;  4FLX A;  4FJI A;  1VRT A;  2UUB K;  1OKJ A;  2Z1H A;  1W0H A;  1VSH A;  3L8B A;  1HNZ K;  3KKS A;  2D0O A;  4C1N I;  1HNW K;  3IAY A;  3OY9 A;  2QWL A;  2F96 A;  4B3S K;  1XHZ A;  3O4Q A;  4I9Q A;  3LAN A;  3ALY A;  1ZBU A;  1KVA A;  5BRD A;  1TK5 A;  1VSK A;  3ENB A;  5HRP A;  5JIC A;  3VQP A;  1X3M A;  1TYQ A;  4HCB A;  2ZGY A;  5H1S Q;  3DLL L;  2CGL A;  2OCE A;  4W5T A;  4DR7 K;  3QEW A;  1N36 K;  3I55 N;  3KK7 A;  3MCP A;  4JD2 A;  3HL8 A;  5ELZ A;  2E4L A;  3QER A;  3LWM A;  4JI0 K;  1VSI A;  2NRT A;  4BRK A;  5FRM A;  4LC9 B;  4BDY A;  1OVY A;  4NYN A;  2YHY A;  4DR1 K;  1S22 A;  3ZX2 A;  3VF4 A;  4AF1 A;  5AQY A;  5DMR A;  4M3X A;  3SQ1 A;  4R5P A;  1RFQ A;  3QEI A;  4IDH A;  3BY5 A;  4YOW A;  4CF0 A;  4LF9 K;  4IOA L;  1XMO K;  1B92 A;  4RW4 A;  4H0P A;  1Q9X A;  1WLJ A;  2E1Z A;  1NGG A;  3WXJ A;  1WN7 A;  4CGJ A;  2P51 A;  4DSL A;  2UXD K;  1JLC A;  4CEQ A;  3K59 A;  2HW3 A;  1BA0 A;  1DT9 A;  4BR4 A;  3M8P A;  1WUA A;  2O4G A;  2Y1I A;  3W0L A;  1NGE A;  1QHT A;  4XIU A;  3NF9 A;  3VQB A;  3H46 O;  1GLF O;  5A2Q O;  2ZM6 K;  1W97 L;  4BRG A;  4B1W B;  3K5M A;  4JI5 K;  4FCY A;  3VQ9 A;  1R0A A;  4N41 A;  2QEX N;  1QSS A;  2P9I A;  5CR4 A;  2FLO A;  1V4T A;  4XH4 A;  1NJZ A;  4LF8 K;  4DFP A;  5I42 A;  2Q3S A;  4I2P A;  1I3A A;  1ASU A;  3PO5 A;  3O6W A;  3CJ1 A;  2PBD A;  3L2W A;  4DQR A;  5HOO A;  3R6M A;  1QE1 A;  1YJW N;  3SAF A;  4YNQ A;  3O3H A;  3OTO K;  4AHS A;  1LWF A;  1S6P A;  2NNW A;  4DTP A;  1XHX A;  1S1T A;  3A0I X;  1NJW A;  3ZT1 A;  4M7Y A;  1NJX A;  4CJL A;  1W7A A;  4AH9 A;  1A5V A;  5GIN A;  3I56 N;  4X64 K;  3CCL N;  3GBT A;  3CHW A;  3PX6 A;  4FZX C;  2OA8 A;  3NVM A;  3BF1 A;  3HSC A;  1T05 A;  2ASO A;  4HTU A;  4I2Q A;  2YNI A;  2XY5 A;  3S3N A;  1XQS C;  3B6P A;  4A57 A;  4BR2 A;  3KD5 E;  1KD1 O;  4LF4 K;  1TUY A;  4I7F A;  3V1Q A;  1BI4 A;  4W5Q A;  1KSP A;  3Q7C A;  3KD1 E;  4GV3 A;  1RT7 A;  4JI8 K;  5EY4 A;  1SUQ A;  5GAG P;  4MDA A;  2QM1 A;  3PSF A;  4PKG A;  4QOZ B;  2HHV A;  3DXK A;  4DSF A;  1RT6 A;  3LZJ A;  1VQK N;  4CEB A;  2EX3 A;  2D0C A;  4NXN K;  1VQP N;  1RBT A;  2ZGZ A;  1LAV A;  4M45 A;  4WQ5 C;  4W5R A;  4IG0 A;  3KJV A;  1H1V A;  1VQM N;  2FF6 A;  1S3X A;  1XMQ K;  3SK3 A;  3AO3 A;  3RMB A;  4KI6 A;  2DTU A;  1WNS A;  2WUS A;  3B6O A;  4CHQ A;  1KAZ A;  3P1G A;  5AQQ A;  4BRQ A;  1NGB A;  4U7B A;  4PQU A;  5J2P A;  4GVE A;  2RHK A;  3CXC M;  4DTR A;  2NRZ A;  3H45 C;  4JNE A;  3H1V X;  4JHD A;  1QVG M;  3IG1 A;  4EHT A;  2FBY A;  4CHZ A;  1NKC A;  1VAZ A;  3O3F A;  1EKE A;  4ELT A;  3CPE A;  3L4I A;  4CZI A;  4CJS A;  1RDC A;  5B8H A;  4B8C A;  5F0X A;  1BIS A;  3N4Q A;  4AHT A;  4NCA A;  3D2E B;  2HHH K;  2GBZ A;  4IEE A;  4L3Q A;  1KVC A;  5AR0 A;  4EHU A;  3MMV A;  3DI6 A;  4LF5 K;  5CE3 A;  3CF5 L;  1NLV A;  2A6A A;  2F7T A;  4H8K A;  5J2N A;  4B9M A;  4DSI A;  4BC3 A;  4F2S A;  2GUP A;  3DRP A;  3QNO A;  3BUZ B;  3RSE A;  1QQO A;  4JI1 K;  3V1O A;  1HR0 K;  5AQG A;  5M1P A;  1EWQ A;  3HXM A;  1YI2 N;  5AQI A;  1U4B A;  2YX6 A;  5DM7 L;  3V1R A;  4CF9 A;  4N47 A;  5JVH L;  1NNE A;  1XI1 A;  3VQQ A;  1W2B M;  2P9I B;  3K5L A;  4CZE A;  4AQY K;  4CF1 A;  3O1W A;  1C1B A;  2Q1N A;  4B9Q A;  1HYZ A;  4E7K A;  2FSK A;  4WF9 L;  1A5W A;  1L3U A;  4K42 A;  2QI2 A;  3HI0 A;  3QIP A;  3SUP A;  3NH1 A;  2ASP A;  5HRR A;  3HOS A;  1NK4 A;  5BN8 A;  3JAM O;  3QES A;  3S3O A;  1HNV A;  2A5X A;  1TK0 A;  3ID8 A;  3H3O B;  2CGK A;  1HNX K;  4CFC A;  1N6Q A;  1EX4 A;  4BRF A;  4R79 A;  3PLA A;  3QNN A;  1JLG A;  3ZET B;  3MK6 A;  4YY3 K;  4IFE A;  2I5J A;  5LMN K;  3HK2 A;  1YVN A;  5C2F A;  1NM1 A;  1JLF A;  4DLG A;  3NH0 A;  3OYL A;  1WB9 A;  4K0K K;  4DTU A;  3FGU A;  3VPZ A;  4IEI A;  4K8X A;  2OPS A;  3CC7 N;  2P9P A;  4PHT X;  3KK1 A;  2CGJ A;  2UXC K;  3MN9 A;  1Q9Y A;  4HHT A;  3L2R A;  3TWH A;  3KHY A;  1BA1 A;  4E1M A;  1WSI A;  1SQK A;  1BQN A;  3VQ6 A;  5FPD A;  3ZX0 A;  3F5T A;  2DY4 A;  3NH2 A;  5FDL A;  3DLR A;  2O8D B;  1S9G A;  2A1S A;  4RWT A;  1WAJ A;  1MDU B;  3PX4 A;  4H5V A;  3ZX3 A;  1X9M A;  2HMI A;  4ID5 A;  2DFH A;  3GE1 A;  3L0Q A;  4Z4H A;  4FK2 A;  3NGI A;  2NRR A;  3D2F B;  4B9T A;  4F4K A;  1VHX A;  1SL1 A;  1NKB A;  3L2U A;  1ASW A;  1RT5 A;  3EE9 A;  1K6Y A;  4BC4 A;  2ZWH A;  5KRT A;  4OKK A;  2AJQ A;  4MDB A;  3V81 A;  3L4Q A;  1RTH A;  4CEO A;  4WFN L;  1KQS M;  1DEJ A;  3BZK A;  4CBW A;  4DR6 K;  3ZT0 A;  4AHC A;  2A1R A; 
#chains in the Genus database with same CATH homology
 1ZYQ A;  4JLH A;  3FFI A;  4E7H A;  4DSK A;  4CK2 A;  3OYB A;  5DK5 A;  1YVU A;  2KZM A;  1MU2 A;  2GUI A;  4OVL A;  2XO7 A;  1KFD A;  1FXX A;  4LD0 A;  4LY7 A;  3CQ8 A;  4DWI A;  1D8Y A;  2BAN A;  3DLE A;  1BL3 A;  3DRR A;  4M3R A;  3OYE A;  3KLG A;  3F73 A;  4NCG A;  3OYC A;  3K57 A;  2P5G A;  2EHG A;  4FK4 A;  1RBU A;  3M8Q A;  4F2R A;  2YNH A;  3THV A;  1LWC A;  3M8R A;  4KPY A;  3AVI A;  4FM1 A;  2D5R A;  3SV3 A;  4DSJ A;  4FJL A;  4KHW A;  1BCM A;  2G8W A;  1SL0 A;  1SL2 A;  2O4I A;  1JLE A;  1D9D A;  4BDZ A;  1KCF A;  4FXD A;  1ZBL A;  4CFB A;  3V9W A;  4CGF A;  1RTI A;  4LH5 A;  2XY7 A;  1ASV A;  3QEV A;  3QLH A;  4CEC A;  1QS4 A;  1Z25 A;  3SQ4 A;  1SKW A;  1X9S A;  3HVR A;  3LAK A;  1NK9 A;  5JS1 A;  1A5X A;  3SQ2 A;  1F21 A;  2KZZ A;  3DOL A;  2PZS A;  4OGC A;  1G15 A;  3I0R A;  1NOZ A;  3OS1 A;  4CGG A;  1RT2 A;  5KGW A;  3ZT2 A;  1C1A A;  1VRU A;  1YTA A;  4O0I A;  4FLZ A;  4L8R B;  4FZZ A;  1TKT A;  2KFZ A;  1HJR A;  3MEE A;  3VQE A;  3T1A A;  2IC3 A;  2YNF A;  2Z1G A;  1C0U A;  3OYA A;  3KK2 A;  4DTM A;  4DU1 A;  1U47 A;  4J2D A;  4Z4F A;  1REV A;  3EYZ A;  1UA1 A;  4FYD A;  4LSL A;  2KTQ A;  3ZSQ A;  5HRS A;  3VQA A;  1IKX A;  1U04 A;  3LP1 A;  3SQ0 A;  1HNI A;  4C8M A;  1VK0 A;  3K5O A;  2JLE A;  3RMD A;  1WSJ A;  3EZ5 A;  3LZI A;  4CJ3 A;  4KI4 A;  2R7Y A;  1BHL A;  4Z4C A;  3U3G A;  3TAM A;  4C8O A;  4AHV A;  1CZB A;  2RF2 A;  2HHW A;  3VA3 A;  2ZQB A;  3ZSY A;  1TGO A;  4OPK A;  4FLX A;  4K8Z A;  1VSE A;  2G8H A;  4FJI A;  1VRT A;  5K14 A;  4PA1 A;  2F8T A;  2Z1H A;  1W0H A;  1VSH A;  3LPT A;  3T19 A;  3KKS A;  3KLH A;  3L8B A;  4BE1 A;  3DLH A;  4RW7 A;  4C8K A;  4Z4E A;  4AHR A;  3IAY A;  1Y97 A;  4CJU A;  3NF8 A;  3RTV A;  3TAF A;  3NFA A;  1C0T A;  3OY9 A;  1IH7 A;  4CEE A;  3OYK A;  3U3Y A;  2P5O A;  4FJ8 A;  4NYF A;  4DF8 A;  2W42 A;  3IS9 A;  3LAL A;  2X6S A;  1VSJ A;  4Z0U A;  2F96 A;  3BGR A;  3QIO A;  3NGY A;  4CFD A;  3QEX A;  3TAN A;  1XHZ A;  2G8K A;  3O4Q A;  4F3T A;  2HHQ A;  4KKO A;  4I9Q A;  3LAN A;  3ULD A;  3ALY A;  1S6Q A;  4CHP A;  3SV4 A;  1ZBU A;  1HQE A;  1KVA A;  3AVH A;  1TK5 A;  1KFS A;  3VQ5 A;  4FJJ A;  1VSK A;  4GW6 A;  2YKM A;  4CJ5 A;  3L3U A;  4N5S A;  2DFF A;  5HRP A;  4FW1 A;  4E3S A;  1RNH A;  3VQP A;  5C25 A;  3WNG A;  1IKV A;  3TAB A;  1T03 A;  4CHO A;  4CGH A;  1ITG A;  1LW0 A;  4HCB A;  3KTQ A;  3OJU A;  3A2F A;  1W9H A;  2X74 A;  3AO5 A;  3AVJ A;  1QSL A;  4OLB A;  1JKH A;  1VSD A;  2GV9 A;  1BIU A;  4W5T A;  4F8R A;  5I3U A;  5SWM A;  3ZSX A;  3QEW A;  1DLO A;  4JS5 A;  3ZSR A;  2VWJ A;  4I9L A;  4QCL A;  1TKZ A;  1GOC A;  1DTQ A;  3MXI A;  4B9U A;  4W5N A;  3HL8 A;  3L2Q A;  1KLN A;  2E4L A;  3CG7 A;  2ETJ A;  3QER A;  3LWM A;  1VSI A;  5FRM A;  3NAE A;  4IG3 A;  4BDY A;  3CM6 A;  1S1V A;  1LV5 A;  3I0S A;  1VSF A;  4NYN A;  3KLE A;  3DM2 A;  1IG9 A;  4KHU A;  3HVT A;  1L5U A;  3VA0 A;  5CYQ A;  2G8I A;  3V9S A;  3OS2 A;  4CGI A;  4CJV A;  4DG1 A;  3OYD A;  3QEP A;  1RIL A;  5DMR A;  3DRS A;  4OKJ A;  2PYJ A;  4M3X A;  4OJR A;  4LH4 A;  3SQ1 A;  3RR7 A;  1O1W A;  4R5P A;  4E7L A;  2E6M A;  1UWB A;  4KRE A;  4J2B A;  2FC0 A;  4E7J A;  3QEI A;  1FK9 A;  4CCH A;  3WNE A;  3P5J A;  4HVJ A;  2WOM A;  2YNG A;  1S5J A;  1UA0 A;  4KAZ A;  4CF0 A;  4KTQ A;  1TL1 A;  3KIO A;  3NE6 A;  1J54 A;  1B92 A;  4RW4 A;  4E0D A;  2IDO A;  4B9L A;  3AO4 A;  1Q9X A;  1Z26 A;  1WLJ A;  3C94 A;  3HP6 A;  4UQG A;  3OS0 A;  2OPP A;  3NF6 A;  4IDK A;  5KI6 A;  2PY5 A;  5EU7 A;  4IFV A;  4E1N A;  3O3G A;  1WN7 A;  4WE1 A;  2YHA A;  4CGJ A;  1JL2 A;  3DOK A;  3OYM A;  2P51 A;  3TAE A;  1NK6 A;  3AVG A;  3ZT4 A;  1GOB A;  4DSL A;  1UOC A;  4PY5 A;  2BE2 A;  1JLC A;  4CEQ A;  3K59 A;  1ZBI A;  4CJT A;  2HW3 A;  3C6T A;  4KFB A;  3ASM A;  4J2A A;  1VSM A;  3CFR A;  3M8P A;  2O4G A;  4DQQ A;  3AV9 A;  2Y1I A;  2FBX A;  4CIE A;  2HVH A;  1QHT A;  4XIU A;  3NF9 A;  3VQB A;  4KB0 A;  2QKB A;  1NK7 A;  1KLM A;  1NKE A;  3IRX A;  3NHG A;  1X1P A;  3V9U A;  3K5M A;  4CIG A;  4FCY A;  2XRI A;  3AA3 A;  4B08 A;  3OYN A;  3AVC A;  3VQ9 A;  4CJQ A;  3AO2 A;  1R0A A;  2YHB A;  2P1J A;  4JRQ A;  1QSS A;  4N41 A;  2E6L A;  1KVB A;  1Q8I A;  4Z4G A;  1NJZ A;  3HPO A;  3HYF A;  3NDK A;  2XY8 A;  4FLY A;  4DFP A;  5I42 A;  2Q3S A;  1C1C A;  1I3A A;  1BQM A;  4I2P A;  1VSL A;  1TAU A;  2XY6 A;  1ASU A;  3SPY A;  3S3M A;  3PO5 A;  3AVB A;  1RT1 A;  2VWK A;  3G0Z A;  3C95 A;  3L2W A;  4DQR A;  1WAF A;  4N76 A;  5J2M A;  4HUF A;  1QE1 A;  4NCB A;  4G1Q A;  1HYV A;  4YNQ A;  3SNN A;  4F3O A;  4FJ5 A;  3OJS A;  4DQS A;  1UAX A;  3O3H A;  1RTJ A;  4ELU A;  3WNH A;  3L3V A;  1RDA A;  1RCH A;  4AHS A;  1LWF A;  1S6P A;  4DTP A;  1XHX A;  1S1T A;  5E41 A;  1CXU A;  3AA4 A;  3C6U A;  4PUO A;  1NJW A;  3ZT1 A;  1NJX A;  1JLB A;  3D0P A;  2QKK A;  1WSH A;  3RR8 A;  4FZY A;  1WSG A;  1XWL A;  4KTW A;  4CJL A;  4FJ7 A;  4CJW A;  3L2V A;  4AH9 A;  1A5V A;  1DTT A;  4J2E A;  1T8E A;  3RRH A;  4EZ9 A;  3H08 A;  3PX6 A;  4FZX C;  2HHS A;  2OA8 A;  3K58 A;  3HST B;  3DMJ A;  1T05 A;  1HYS A;  1C0M A;  4HTU A;  4I2Q A;  2YNI A;  1N5Y A;  2XY5 A;  3ZCM A;  3S3N A;  3B6P A;  2HND A;  2OPQ A;  1FKP A;  4DTN A;  4DTX A;  3ZSO A;  3AVN A;  2WON A;  2LSN A;  3KD5 E;  2D0B A;  3VQ7 A;  3OYF A;  3CM5 A;  4I7F A;  3V1Q A;  2JGU A;  4DU3 A;  1BI4 A;  4B9V A;  2HVI A;  5KGX A;  3SZ2 A;  3CFP A;  4W5Q A;  1KSP A;  4DS4 A;  4CK1 A;  2FBV A;  4H4O A;  1S1W A;  3KD1 E;  1RT7 A;  4DS5 A;  1SUQ A;  3U6F A;  4Q0B A;  4O5B A;  4DFK A;  3ISN C;  5D3G A;  1CLQ A;  4M3W A;  4DLE A;  4B9S A;  1TL3 A;  4FJX A;  4QOZ B;  2HHV A;  1LAW A;  2G8U A;  1LWE A;  4DSE A;  4DSF A;  2HNZ A;  2KQ2 A;  1RT6 A;  4C8L A;  3LZJ A;  1JXE A;  2NUB A;  4CEB A;  3RWU A;  3AVK A;  2EX3 A;  3OYH A;  4PWD A;  2D0C A;  4IBN A;  3ZSW A;  4YFU A;  4CJK A;  2HHT A;  4FJH A;  4IKF A;  4MFB A;  4O4G A;  1RBT A;  3M8S A;  4Y1D A;  3F9K A;  1U48 A;  1LAV A;  4M45 A;  1NJY A;  3VN5 A;  1JLA A;  4W5R A;  5J2Q A;  4OLA A;  4IG0 A;  1EXQ A;  3KJV A;  4DFJ A;  3LP3 A;  4FLT A;  1ZBH A;  5T7B A;  4O44 A;  1BGX T;  3V6D A;  4E19 A;  1YTU A;  1EET A;  3SUQ A;  3TAQ A;  5KRS A;  2VG6 A;  3SYZ A;  4ICL A;  3JYT A;  1KTQ A;  1S1U A;  2HB5 A;  4CJR A;  1CXQ A;  4CEA A;  1TK8 A;  4CF8 A;  4HUE A;  3V9Z A;  3AO3 A;  4FJN A;  3HJF A;  3TI0 A;  3RMB A;  4KI6 A;  4BE0 A;  1WNS A;  2DTU A;  2RN2 A;  4ID1 A;  5FRO A;  3PO4 A;  4KB1 A;  1RBV A;  3OYG A;  1RDB A;  4FM2 A;  3B6O A;  5CYM A;  1U45 A;  1SKR A;  4CER A;  2BDP A;  4DMN A;  4CHQ A;  4CJE A;  3JSM A;  2BGG A;  4TSX A;  3P1G A;  1SKS A;  2D0A A;  4PQU A;  3SUO A;  1LW2 A;  3OVN A;  4BAC A;  5J2P A;  1XC9 A;  1JLQ A;  5JS2 A;  3D45 A;  4RW9 A;  4DTR A;  4ELV A;  4BWM A;  1JXB A;  3AA2 A;  1IKY A;  4BWJ A;  4OKE A;  3ZT3 A;  3OYI A;  3MXJ A;  3QO9 A;  1HRH A;  3DYA A;  3IG1 A;  3SJJ A;  3UIQ A;  1I39 A;  2FBY A;  3AVF A;  4KTZ A;  4QAG A;  4CFA A;  1QQC A;  3NBP A;  4CHN A;  3I8D A;  5HLF A;  2YV0 X;  4M3Z A;  3EY1 A;  1NK0 A;  4CHZ A;  1NKC A;  3O3F A;  1EKE A;  3SUN A;  4ELT A;  2OYQ A;  4KHQ A;  5KTQ A;  4ZHR A;  4W5O A;  4Q5V A;  1TKD A;  1QSY A;  3VQD A;  4HCC A;  1RDC A;  4FW2 A;  4CJS A;  4B8C A;  4LSN A;  1BIS A;  4OPJ A;  2XHB A;  4FLV A;  4AHT A;  3V4I A;  1T7P A;  3RRG A;  2FBT A;  5C24 A;  1ZBF A;  4NCA A;  4Y1C A;  3TR8 A;  3PX0 A;  2GBZ A;  3VQ8 A;  1KVC A;  4CHY A;  3LDS A;  1NK5 A;  3TAG A;  2Z1I A;  4B9N A;  2IOC A;  3DI6 A;  2ZE2 A;  3KLF A;  2IS3 A;  4DTJ A;  3G10 A;  1BCO A;  4M3Y A;  2B5J A;  4H8K A;  5J2N A;  4B9M A;  4DSI A;  1TKX A;  3HPG A;  4CED A;  4FLU A;  5CY4 A;  2OZM A;  4CJF A;  5J1E A;  4F2S A;  4MQ3 A;  3DLB A;  3DRP A;  3QNO A;  4FK0 A;  3V1O A;  1B9F A;  3QIN A;  4B3O A;  3ZSV A;  3BDP A;  4Z4I A;  3SPZ A;  1NOY A;  4CEZ A;  4BDP A;  4KV8 A;  1C6V A;  3HXM A;  3HPH A;  1U49 A;  3RMA A;  4EP5 A;  1U4B A;  4C8N A;  4EZ6 A;  3V1R A;  1TVR A;  4CF9 A;  1RBR A;  3MAQ A;  3HM9 A;  2IGI A;  4N47 A;  3MEG A;  4O0J A;  3PUF A;  3O4N A;  1XI1 A;  3VQQ A;  4M42 A;  4N56 A;  3K5L A;  4CF1 A;  2KW4 A;  1L3T A;  3SCX A;  1C1B A;  2PYL A;  5HBM A;  3WNF A;  3V9X A;  5HP1 A;  4GMJ B;  3HO1 A;  3P83 D;  1HYZ A;  4E7K A;  4AHU A;  3PV8 A;  4GVM A;  3TAP A;  1A5W A;  4KHS A;  4KHY A;  2VG5 A;  1L3U A;  3QIP A;  3NGZ A;  1S1X A;  1HPZ A;  3SUP A;  4KHN A;  3NH1 A;  5HRN A;  2QXF A;  3MEC A;  2G8F A;  1TV6 A;  4DTO A;  5HRR A;  4DF4 A;  4RW6 A;  4FM0 A;  3TAR A;  1NK4 A;  3E01 A;  4DTS A;  3QES A;  2F8S A;  3S3O A;  1HNV A;  3LP0 A;  1TK0 A;  3MXM A;  1RDD A;  1B9D A;  3CYM A;  3K2P A;  3VQC A;  4CFC A;  4E7I A;  4DQP A;  3SI6 A;  1N6Q A;  1EX4 A;  5FRN A;  3QNN A;  1JLG A;  2G8V A;  4CF2 A;  1S9E A;  2DFE A;  4CES A;  1YT3 A;  4ZTJ A;  4CEF A;  1KRP A;  1IKW A;  2VG7 A;  1L3V A;  2I5J A;  2ZD1 A;  4BE2 A;  1BIZ A;  4IFY A;  4FJG A;  3HK2 A;  4JS4 A;  3LWL A;  1JLF A;  2B6A A;  4DLG A;  2RPI A;  3AA5 X;  3DLG A;  2OPR A;  4RW8 A;  3NH0 A;  3OYL A;  3ZSZ A;  5SZT A;  4DU4 A;  3RMC A;  4DTU A;  4K8X A;  1JL1 A;  2ATQ A;  4CJ4 A;  2OPS A;  4HUG A;  1D9F A;  1HQU A;  4EP4 A;  3LPU A;  3KK1 A;  2ITG A;  4E89 A;  4DFM A;  1Q9Y A;  4H4M A;  4HHT A;  3L2R A;  3CFO A;  1RTD A;  3TWH A;  4E1M A;  2HHU A;  3DLK A;  1WSI A;  4O55 A;  1BQN A;  3KKR A;  4M3U A;  4M3T A;  4KO0 A;  4CIF A;  3VQ6 A;  1BI4 B;  4CK3 A;  3QET A;  3LAM A;  2DY4 A;  4FLW A;  3NH2 A;  5FDL A;  3DLR A;  4B8A B;  1D5A A;  1S9G A;  3AVA A;  2A1S A;  3HP9 A;  1NK8 A;  4OGE A;  1WAJ A;  4RG8 A;  2HHX A;  1J9A A;  3ITH A;  3NCI A;  3PX4 A;  1L3S A;  1X9M A;  2HMI A;  4ID5 A;  2DFH A;  1EP4 A;  1CZ9 A;  3VQ4 A;  4CE9 A;  4Z4H A;  3T3F A;  4FJ9 A;  4AIL C;  4CJP A;  3MED A;  1J5O A;  1X9W A;  4FK2 A;  1J53 A;  3PY8 A;  2Y1J A;  3NGI A;  1RT3 A;  3HT3 A;  1RBS A;  2HNY A;  2Z1J A;  3KK3 A;  2KFN A;  1WSF A;  2OZS A;  3KLI A;  4ZTF A;  4B9T A;  4F4K A;  2X78 A;  1SL1 A;  1HMV A;  1NKB A;  3L2U A;  1ASW A;  4DQI A;  1RT5 A;  4JRP A;  1TAQ A;  1QTM A;  4KRF A;  2RKI A;  1K6Y A;  1IO2 A;  1SV5 A;  2X6N A;  5HRO A;  3AVM A;  1GOA A;  5CZ1 A;  5C42 A;  4FVM A;  2YKN A;  1WSE A;  5KRT A;  4OKK A;  2IAJ A;  2AJQ A;  1RT4 A;  3V81 A;  3S9H A;  1RTH A;  3AVL A;  4CEO A;  4CGD A;  2B4J A;  4FJK A;  4M41 A;  3LP2 A;  5CZ2 A;  3OYJ A;  3AO1 A;  3ZT0 A;  3K5N A;  4AHC A;  4FJM A;  3NF7 A;  2QK9 A;  2A1R A;  1FKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...