3D0PA

Insights into rna/dna hybrid recognition and processing by rnase h from the crystal structure of a non-specific enzyme-dsdna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
b'EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Insights into RNA/DNA hybrid recognition and processing by RNase H from the crystal structure of a non-specific enzyme-dsDNA complex.
pubmed rcsb
molecule tags Hydrolase/dna
total genus 43
structure length 134
sequence length 134
chains with identical sequence C
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3d0pA00
1L3UA 2YNIA 4J2EA 2F8TA 2KW4A 4DS5A 3O3HA 3AA4A 1ZBHA 1C0TA 4NYFA 3KK3A 1JLQA 3QETA 4B3OA 4IDKA 1WAFA 1TV6A 4O0JA 4Z4CA 3HM9A 4DSFA 3VQCA 3U6FA 4E0DA 2Z1GA 4I9LA 4B8AB 3LWMA 3OS2A 4I2PA 5FRNA 1Y97A 3HPHA 4BWMA 1JKHA 3T1AA 1TKDA 1WLJA 2ZQBA 4BDPA 3THVA 5C25A 2RPIA 4Z4IA 5FROA 1QTMA 4DTNA 3AVKA 1FKPA 4BDZA 3IRXA 1B92A 3HSTB 4J2AA 4FJ8A 1IKWA 4FK0A 4M3UA 1CZ9A 3OYNA 1A5WA 4O4GA 5DK5A 4JRQA 3CG7A 3SQ0A 3RMAA 1A5VA 3QEIA 3LPUA 3P5JA 4IBNA 3SI6A 1QSSA 3V1QA 1C0UA 4K8ZA 2G8HA 1RBTA 5K14A 2WONA 4BACA 4AHRA 4BE1A 1T7PA 2GUIA 2XRIA 3T3FA 1S6PA 1ASWA 4CJLA 1TK8A 1U4BA 3OYJA 2QKKA 1X9SA 3KD5E 1CLQA 4O0IA 2BDPA 1U04A 2NUBA 2YKMA 1RDCA 3G10A 1ASVA 4FJHA 1TVRA 3AVIA 1YTAA 3CFRA 5J2NA 4KI4A 1RNHA 1QS4A 3DLGA 3RMBA 1B9FA 3DM2A 2VWJA 4DTMA 2HNYA 4KAZA 1KSPA 3ZT4A 4HUGA 4KRFA 1IKXA 2Z1HA 2QKBA 3DI6A 4FZZA 4LH4A 3S3OA 4FLVA 4ID5A 2IGIA 4E7LA 3KLFA 1DLOA 5C42A 1SL0A 1ITGA 1C1BA 4LY7A 1LV5A 1QSLA 1RBRA 2YKNA 2X74A 1RTHA 4GMJB 4CJ3A 4CHPA 3LP2A 3TI0A 4E19A 5HP1A 1J9AA 3CYMA 3AVGA 1LAWA 3WNFA 1LAVA 4EP4A 4HTUA 2RF2A 2Q3SA 4W5OA 1NOYA 4KPYA 4FLZA 4FLYA 1D9FA 4CK3A 4XIUA 3VQQA 1ZBIA 1TK0A 2G8KA 3HO1A 4KHQA 5HRNA 2FBXA 1NK9A 4Z4EA 1VSLA 3AVJA 3RWUA 2HHXA 5D3GA 4HHTA 4BE2A 2YHBA 3M8RA 1N5YA 2OYQA 1XHXA 3MEDA 3L2RA 3EY1A 4CFCA 1NK8A 3PV8A 2EX3A 2G8UA 4CIFA 1EXQA 1REVA 3F9KA 3V9SA 1D9DA 4CGHA 3SPYA 1S1TA 4CJQA 4ELTA 3KK1A 2ZE2A 1IO2A 4KHSA 4KB1A 2YV0X 4CIGA 3MXJA 4Q0BA 4GVMA 4C8OA 4CJUA 3AVNA 5CZ2A 2Y1JA 1TAUA 1JLCA 3C95A 1RTDA 3VQ6A 1BISA 4CHYA 1RT2A 3I0RA 1CXUA 1RDBA 4CGFA 4J2BA 2EHGA 2Z1IA 4HCBA 3WNGA 1BQNA 3ZT2A 4KB0A 3LP0A 4KTWA 1TK5A 3LZJA 4PWDA 1KFDA 4QAGA 4KREA 4CJ4A 2GV9A 2RKIA 4YNQA 4Z0UA 1HQEA 1Z26A 4CHZA 2IS3A 2OPRA 3AV9A 3UIQA 3ISNC 4RW7A 1C0MA 1C1AA 3ZSOA 3BDPA 2OPQA 1JXBA 1NK5A 3AA3A 1KFSA 3DLRA 1VRTA 4Z4HA 1BHLA 3M8SA 4QOZB 3LDSA 3A2FA 3RRHA 4DSKA 5FRMA 1HRHA 4FJXA 3LAMA 1TGOA 4DQRA 2YHAA 3D0PA 1Q9YA 1KRPA 4PQUA 1WSGA 5JS1A 1RTJA 1Z25A 3AVLA 1SV5A 4AHVA 3C6TA 3SQ1A 3HK2A 3NH2A 1TL1A 3SUNA 4F4KA 5HRPA 2HHWA 4CEQA 2XY8A 3L8BA 2VG5A 1VSFA 2D0CA 4CCHA 4AHCA 5KRSA 4M42A 3AO3A 2I5JA 3WNHA 4B9UA 4HUEA 1I3AA 2FC0A 5KGXA 1CZBA 3NF7A 2A1SA 3QESA 4DSLA 2QK9A 5I42A 1RT6A 1XWLA 3DRPA 3QIOA 3CM5A 4ZHRA 5KTQA 3NFAA 3MXMA 3IAYA 1L3VA 1JXEA 3OY9A 4JS4A 4C8LA 1DTTA 1G15A 4NCGA 1VSJA 4B08A 3VQAA 4CF8A 3V4IA 2PZSA 1HMVA 3VQDA 1UA0A 4M3ZA 4PY5A 5CYMA 3V1RA 3TABA 3QIPA 3U3GA 4CEEA 3AVHA 2P1JA 2Z1JA 4LSNA 4C8NA 3AVMA 3NH0A 5C24A 1S1XA 2ATQA 1TKTA 3K58A 3SV4A 2VG7A 3EYZA 4OKEA 5CY4A 1W0HA 4M45A 1SKRA 3G0ZA 1TAQA 3AA2A 1QHTA 5E41A 1KCFA 4OKJA 1YVUA 4OVLA 1UAXA 4DLGA 3V6DA 1HYZA 3OVNA 1S9EA 4F3OA 3SYZA 1U47A 1D8YA 1SKSA 1VSEA 3I0SA 3KLIA 4ID1A 3OYBA 4KTQA 2O4GA 1RT1A 4CHNA 4E7KA 1NOZA 4N47A 4DQPA 2B4JA 2HNDA 4AHUA 2HMIA 4ICLA 2A1RA 3OJUA 3LP1A 1NKEA 2HVHA 2DFFA 3T19A 3HVRA 2HHTA 3KKRA 2KZZA 1K6YA 1RBVA 4KKOA 3RMCA 3NF9A 5HRSA 3OJSA 1NJWA 2G8FA 3AO5A 4Q5VA 1LW2A 4R5PA 4IFYA 2KFZA 1RT7A 4KO0A 2B5JA 2OPPA 5SZTA 3JSMA 1VSIA 4CHQA 1NKBA 4ZTFA 3PY8A 1JLEA 1RDAA 3ZSWA 4HCCA 2G8IA 3O3GA 3OS0A 1ZBFA 3S3MA 2D0BA 3QEVA 4FK2A 3OYAA 2FBTA 4WE1A 1ZBLA 4YFUA 4RW9A 3CQ8A 1S1VA 3TAMA 4DFPA 2OZSA 3VA0A 2X6SA 1T8EA 3NGYA 1J54A 4ELUA 3HPGA 4CJFA 4OKKA 4CJSA 1IKVA 4CJPA 3QINA 3ZSZA 3MEEA 3TWHA 3P83D 1EP4A 3DYAA 4DFKA 3MECA 1HYSA 3VN5A 5T7BA 3KJVA 4FK4A 4Z4GA 2KFNA 3HP9A 2W42A 3O3FA 3TAPA 4IFVA 2PYLA 3B6OA 1SL1A 4FZYA 3HL8A 4J2DA 1A5XA 3HP6A 4CF0A 4DF4A 4B9NA 2X6NA 2DY4A 3TR8A 4B9TA 3SPZA 3AVCA 2PY5A 4KHYA 4DSEA 3U3YA 2HHQA 3K5LA 5HRRA 1LW0A 3K59A 3V81A 1S6QA 4BDYA 3P1GA 4B9LA 3NE6A 2VWKA 4K8XA 2FBYA 3NF6A 5FDLA 4FLWA 3QLHA 4OPJA 4DLEA 1DTQA 1JLFA 1UA1A 2G8WA 4FJJA 1U45A 2KZMA 4F8RA 1BI4A 1R0AA 4AHTA 3SNNA 2ITGA 4CFDA 1B9DA 1JLAA 3K57A 2R7YA 1NJZA 1L3TA 1L5UA 3VQ4A 1Q9XA 2E4LA 4FYDA 1BIZA 2HW3A 1KVCA 3MEGA 4I2QA 1T05A 3RMDA 3PX4A 1VSKA 4F3TA 1ASUA 3OYDA 4JS5A 3TAGA 3K2PA 4C8MA 3KLHA 2JLEA 3V9XA 5HROA 3DLHA 5JS2A 4O44A 4FXDA 1FKOA 4RW8A 1LWCA 1WNSA 1S1WA 4CERA 4M3WA 4CJVA 1QE1A 2BE2A 3LZIA 3TAQA 4NYNA 2LSNA 3E01A 1T03A 1NK6A 4DSJA 4N76A 4CEDA 1JL1A 3AVBA 4W5NA 2VG6A 4LH5A 3QO9A 3AVFA 1GOAA 3NDKA 2BANA 1SL2A 4DU1A 1RDDA 1NK0A 2E6MA 2HB5A 4CK2A 3DLBA 4M3XA 5CYQA 4W5TA 2HNZA 2E6LA 3CFPA 3DLKA 4M3TA 4JLHA 3HJFA 4DTRA 1X9WA 3MXIA 4CFBA 2YNFA 2JGUA 4E1MA 1VRUA 3NGZA 4FW2A 4G1QA 2XO7A 4BWJA 4KHNA 2HHSA 3K5NA 4CEZA 4AILC 2PYJA 2FBVA 4LSLA 1VK0A 3HYFA 3LPTA 1KLMA 1WSFA 1L3SA 3AA5X 5J2QA 4EZ9A 4EP5A 1HPZA 1Q8IA 1W9HA 4H8KA 2QXFA 3S9HA 1KTQA 2B6AA 2GBZA 2WOMA 2XHBA 2KQ2A 3D45A 1EX4A 4CJKA 1WSIA 2DFEA 4RW4A 3ZT0A 4O5BA 4CF1A 2BGGA 4M3YA 4CGJA 1JL2A 4Y1DA 4C8KA 1J53A 3OYCA 4DS4A 3ZCMA 3QEPA 3RR8A 2HHVA 3VQ8A 3NH1A 1J5OA 2XY6A 4F2SA 1NKCA 3L2QA 4IG3A 4HUFA 4FJKA 4CGGA 2DTUA 3KK2A 3M8PA 3NAEA 3DRRA 1X1PA 4DTOA 2YNHA 1HQUA 1C1CA 3DRSA 1VSDA 4CJTA 3LWLA 5KI6A 1S9GA 4NCBA 1U49A 4UQGA 3ZSYA 4TSXA 4DQSA 3F73A 4FJIA 1VSHA 4OLAA 4FLUA 4CF9A 1GOBA 2F8SA 1RT3A 4DTSA 3HPOA 4DTPA 5J2PA 4IKFA 3ASMA 3VQ5A 1LWFA 1RILA 3HXMA 3FFIA 4CEBA 4FJGA 4DMNA 3KIOA 4DTXA 2OZMA 4H4OA 3ZSRA 3KKSA 3NGIA 4FM2A 1FK9A 3CFOA 4I9QA 3LAKA 5CZ1A 4DU4A 4M3RA 2OPSA 3TARA 5DMRA 3SQ4A 4FJMA 3IG1A 1BCMA 3RTVA 3DOLA 4FZXC 1EETA 1HJRA 3DLEA 4CEAA 3SJJA 1NK7A 3RR7A 3SCXA 3QEXA 3L3VA 3HT3A 1QSYA 1FXXA 3V1OA 3O4QA 1RBSA 3L2WA 4EZ6A 3SZ2A 3S3NA 1CXQA 4KHUA 2Y1IA 4CHOA 3V9ZA 4MQ3A 3L3UA 1BL3A 4DTJA 4ELVA 1BQMA 3AVAA 4CGDA 4E7JA 2DFHA 3ZSVA 1KVBA 4E7HA 4IG0A 4BE0A 4H4MA 1GOCA 4DG1A 3EZ5A 3KD1E 1SUQA 1RT4A 4CIEA 3ULDA 2ETJA 4GW6A 3MAQA 2F96A 3L2UA 4ZTJA 4FJ9A 4KV8A 4W5RA 3PX6A 3DOKA 3WNEA 4E3SA 3K5OA 4DFMA 4B9MA 3KTQA 3NHGA 3PUFA 1XHZA 4FVMA 1SKWA 4DWIA 4FJNA 3SV3A 1VSMA 4FJ7A 3C6UA 3CM6A 2HHUA 4RW6A 1NJYA 1D5AA 2P51A 3VQBA 2IOCA 3I8DA 4OGCA 1KLNA 1EKEA 4DF8A 4L8RB 2D0AA 4DU3A 1JLBA 1TL3A 1WSJA 2YNGA 3DMJA 4MFBA 3AO1A 3VQEA 2XY7A 1UOCA 5EU7A 1RCHA 3VA3A 3ZT1A 1BCOA 2IAJA 3LP3A 3OYHA 1XC9A 1TKXA 4KFBA 2P5GA 2HVIA 3PO5A 1U48A 3QNNA 5SWMA 3OYMA 4CECA 4FLXA 3V9UA 4KTZA 1MU2A 2XY5A 1YTUA 1HYVA 4OPKA 4DQQA 4AH9A 3V9WA 1NK4A 4KHWA 1I39A 3SUPA 1WAJA 4CJRA 3TANA 4CJEA 4N56A 2O4IA 3B6PA 1BGXT 4CEOA 1WSHA 4FLTA 2IDOA 4KI6A 4CEFA 4HVJA 5I3UA 4F2RA 1N6QA 4I7FA 2G8VA 1X9MA 1JLGA 1QQCA 3K5MA 2P5OA 3IS9A 3LANA 3PX0A 1TKZA 4JRPA 4PA1A 4FJ5A 3NF8A 3KLEA 1XI1A 3AO2A 3SUOA 4CE9A 5J1EA 2KTQA 3OYKA 3O4NA 4LD0A 1IH7A 3ITHA 4M41A 3AO4A 1F21A 1RBUA 4AHSA 1ZYQA 4FJLA 1C6VA 1RT5A 3OYGA 3TAEA 3ZSXA 4W5QA 2RN2A 3SQ2A 3SUQA 4DSIA 2AJQA 1HNVA 4FM1A 1S5JA 3NBPA 3HVTA 3L2VA 4E89A 3VQPA 4N5SA 1O1WA 1LWEA 4B9SA 2D5RA 3H08A 4N41A 4RG8A 4CJ5A 4Y1CA 1ZBUA 4CK1A 3OYEA 5J2MA 1UWBA 1BIUA 5HLFA 3OS1A 3ZT3A 3M8QA 4CESA 3KLGA 3NCIA 3JYTA 1HNIA 1BI4B 1RTIA 4FM0A 1WSEA 2ZD1A 4Z4FA 3QERA 4B9VA 3C94A 3VQ9A 2IC3A 3BGRA 4DQIA 1IKYA 4CGIA 4FCYA 1YT3A 2X78A 4E7IA 3PO4A 3RRGA 2OA8A 3OYLA 3QEWA 4E1NA 4DFJA 4QCLA 3QNOA 3ALYA 4OLBA 3OYIA 3LALA 4OJRA 1IG9A 4DTUA 1NJXA 3ZSQA 4CFAA 1KVAA 4OGEA 4PUOA 4NCAA 5HBMA 3OYFA 4CF2A 3VQ7A 5KRTA 1S1UA 1WN7A 4O55A 4CJWA 5KGWA 4FW1A 3TAFA 4B8CA
chains in the Genus database with same CATH superfamily
1L3UA 4EHTA 2D0OA 4J2EA 3O3HA 1ZC6A 1ZBHA 4ISGA 4NYFA 4O0JA 2Z1GA 1XC3A 4JKGB 4B8AB 3BEXA 4LF5K 4I2PA 3HPHA 3T1AA 1TKDA 3THVA 3BP8A 3CC2N 4JI5K 1BA1A 3HSTB 4BRCA 2OANA 1IKWA 3QDKA 3N4QA 1BDGA 4JRQA 3BF3A 3SQ0A 3RMAA 3QEIA 3SI6A 4IBNA 4K8ZA 2G8HA 5K14A 1NGDA 5AQXA 4AHRA 3T3FA 1Q81O 1S6PA 4CJLA 2P9KB 1TK8A 1CLQA 3KD5E 4O0IA 2NUBA 4BGBA 1TVRA 3KVGA 1YTAA 2E88A 3CD6N 4JKHA 1B9FA 3ULEB 3K0SA 2VWJA 1SAZA 1NGJA 5BREA 1IKXA 3I56N 4H5RA 4FLVA 5KPRA 4ID5A 2O8EB 2V52B 3TTDA 4LFAK 1SS6A 2P9UB 3THYB 3WNFA 1LAWA 1TYQA 1LAVA 3TTCA 4KPYA 2YCHA 4BRHA 4XIUA 4IFEA 1VSLA 5JVHL 3J8AA 4IOXA 2HHXA 5D3GA 3PV8A 2PBDA 2V7ZA 2G8UA 4CIFA 3F9KA 3V9SA 1D9DA 4CGHA 2D4WA 1S1TA 4CJQA 4JK7A 4KHSA 4Q0BA 4C8OA 4DV7K 5M1NA 5CZ2A 3EKUA 4J2BA 3VF6A 2VGMA 1V4TA 1Z26A 4CHZA 3VGMA 2IS3A 2OPRA 1C1AA 3H45C 3ZSOA 3BDPA 2OPQA 3VTIA 1KFSA 2P9SA 4IWVA 1BHLA 4QOZB 3HOTA 1IV0A 2YHAA 4LF6K 1WSGA 1EQYA 4BR5A 2RHKA 4FWQA 4AHVA 2UYTA 4ILGB 3SK3A 2O8CB 3DXMB 2QWPA 4DCHA 3GBTA 3QESA 2QK9A 4MLEA 3D2FA 1XWLA 3IAYA 3QIOA 3CM5A 5KTQA 3NFAA 3A5MC 1JXEA 3R8EA 5ADXH 4BC4A 4M3ZA 4B08A 3CJ9A 3H3NO 3VQAA 4PY5A 1HMVA 1UA0A 4LSNA 3AVMA 1K73O 5C24A 1NU0A 1TKTA 3EYZA 3R3LA 1Q86O 1T6CA 3SMPA 1KCFA 4X64K 2OTLN 1JJ2M 5TKWA 3V6DA 1HYZA 4H0VB 1S72N 2F7TA 1D8YA 1NGIA 4E7KA 4IO8A 2UU9K 2HNDA 4BC5A 2KZZA 5HRSA 3OJSA 3O4WA 1NJWA 1BUPA 5AQPA 2W41A 3AO5A 4Q5VA 4R5PA 2KFZA 4KO0A 1Q7YO 3J80O 3MMVA 5SZTA 1NG9A 4ZTFA 3PY8A 1HNXK 3M1FA 3UKUA 3D2EA 3OS0A 4DUYK 3OYAA 4M7YA 3L4IA 1ZBLA 3CQ8A 1S1VA 3SAGA 4DR4K 1HJOA 2HBLA 4BVOA 1J54A 1IKVA 4JK8A 1EP4A 4DFKA 1HYSA 3KJVA 5T7BA 3VGKA 3O3FA 1GLLO 2DY4A 3TR8A 2NNWA 2PY5A 4KHYA 4DSEA 1S6QA 4WQ4A 4BDYA 1KAYA 1BU6O 2VWKA 3PIOL 4FLWA 3B8AX 2ZJPL 4AHTA 4BDPA 4K42A 1W2BM 2E4LA 1BIZA 4BC3A 3TPQA 4I2QA 2UUAK 2Q0UA 2O8BB 3O08A 3DLHA 4O44A 2JWLA 4M3WA 4DUZK 4CJVA 1ATNA 3P39A 2LSNA 3E01A 3ENOA 3KZBA 4DSJA 3IKMA 2W6LA 3AVFA 1GOAA 1RDDA 4PKHA 1NK0A 2E6MA 4M3TA 4K43A 4DTRA 4FW2A 4BWJA 1YF5L 1KQSM 2FBVA 4LSLA 1VK0A 1RDUA 3LPTA 4BRKA 2UUCK 5J2QA 3FFKB 2O8FA 2GBZA 4FVUA 4IOCL 2HF3A 3VEYA 4L3QA 5AQSA 4CJKA 2DFEA 4FO0A 4ISFA 3ZT0A 3CMEN 1NJIO 3OYCA 1J5OA 2DTUA 3NAEA 3J7YP 5AQNA 3DRSA 2V51B 5KI6A 1U49A 4BGAA 4DQSA 5GIOA 4FLUA 2F8SA 4DTPA 2Q97A 1LWFA 4ISEA 3FFIA 3VENA 3VEVA 1MWMA 3NGIA 1FK9A 3LAKA 5CZ1A 5DMRA 5AQJA 3VGLA 3WQTA 1HKGA 3DOLA 3SJJA 3SCXA 1FJGK 3D2FB 1QSYA 4OO1J 2ZGYA 1VQON 4YOYA 3V1OA 1T6DA 3K9KA 4YY3K 4CHOA 3L3UA 1BL3A 5FLXO 3AVAA 3QB0A 3ZSVA 3PSIA 3VEZA 2HHHK 3ENHA 4M7XA 4DG1A 5KPTA 1U6ZA 1RT4A 3ULDA 4GW6A 2DPNA 3IFRA 3CCVN 4FJ9A 3DOKA 4YOUA 3WNEA 2VQEK 1X3MA 5FPNA 4A5BA 4FSVA 3C6UA 4PL7A 3VQBA 3I8DA 5C15A 1KLNA 4IEEA 3BZCA 1WSJA 2XY7A 5M1QA 1RCHA 3VA3A 1WBDA 4XH4A 3LP3A 3F9MA 3GE1A 1TKXA 2P5GA 5C2FA 3BUZB 3V9UA 2KLAA 1MU2A 1ZBSA 1HYVA 4WQ4C 3V9WA 4KHWA 1I39A 1KAXA 3CQXA 1GLAG 3I33A 3PIPL 5I9EB 1VHXA 2IDOA 1NGFA 4CEFA 2VYPA 3G71N 3O6WA 4I7FA 4B1WB 1ATSA 1JLGA 1QQCA 3O9TA 4DV0K 1Y64A 4DV4K 4M41A 3ZEUB 2HVIA 1F21A 3HBTA 1ZYQA 1X9JA 3SUQA 3TAEA 1HX1A 3HRGA 3SJHA 1S5JA 3HVTA 3L2VA 2FSJA 1WUAA 4JI8K 2ASMA 4YDUA 2A6AA 5J2MA 3OS1A 4JKBA 5FPEA 1XNQK 2ZD1A 4B9VA 2QWOA 5IWAK 4CGIA 4FCYA 1YT3A 2BH1A 4BC2A 2VGNA 3OYIA 4OJRA 4DTUA 1NJXA 5AQUA 5C10A 5FPMA 4NCAA 5HBMA 3VERA 4MDBA 4CF2A 4B3SK 4O55A 5FDLA 4A62A 1S3XA 3U6FA 4Z4CA 1NNEA 3VQCA 4E0DA 4FWSA 3LWMA 2RPIA 1K8KB 1KAZA 3RSEA 1QTMA 4BDZA 1FKPA 5FPDA 3J7AP 1B92A 2NRZA 3LPUA 5F1XA 2E5LK 4WFBL 4BE1A 4NLBA 1T7PA 4MDAA 2E2NA 4B9QA 1ASWA 5EXWA 4YOVA 5LJWA 1EO1A 1U04A 3CC7N 5A2QO 3AVIA 3CFRA 3E9OA 3THXB 2NRVA 4GV6A 2QI2A 1RNHA 1QS4A 3DXKA 2HNYA 4BR2A 1YXQA 5EY4A 3TU5A 2F9TA 3GL1A 4LH4A 4LF8K 3TSUA 3KLFA 4R79A 1SL0A 1ITGA 1KD1O 1RBRA 2X74A 1RTHA 4BQZA 4CHPA 4DR6K 4DV1K 1NGGA 5HP1A 2YJFA 4HTUA 3U9DA 2Q3SA 5H1SQ 1NOYA 4FLZA 3EEQA 4JNEA 4FLYA 1ZBIA 1Z6RA 1TK0A 4BR4A 1GLEG 1NK9A 3AVJA 5CR4A 3BY5A 3VEWA 4BE2A 1OH5A 1N5YA 3L2RA 3EY1A 2OTJN 3M3ZA 1REVA 3RVCA 3W3DA 1XNRK 5BPNA 3VMFB 1YIJN 2ZE2A 3ATUA 3O1WA 3MXJA 4GVMA 2QXLA 3AVNA 2Y1JA 1JLCA 3C95A 1RTDA 3VQ6A 3CCUN 1GLJO 3LM9A 1CXUA 4CGFA 3MK6A 4KB0A 3LP0A 4KTWA 4KREA 4LFCK 1KC8O 2HBMA 1HQEA 5KQ8A 1C0MA 2YX6A 3AA3A 3GDQA 2UXCK 3DLRA 1VRTA 1BWFO 4Z4HA 5GINA 4NXNK 3RRHA 3LAMA 4DQRA 1YJ9N 5JLFA 3D0PA 4PQUA 1RTJA 3BF1A 3A8YA 3K9JA 2A5XA 4CEQA 2HHWA 2XY8A 3L8BA 2VG5A 4YDUC 3C0BA 5AZJA 1NGAA 4AHCA 1I3AA 4DV3K 1CZBA 3NF7A 4FWRA 4DSLA 3U9ZA 3DRPA 1XUPO 4CZKA 1VQ6N 3EZWA 4CF8A 1VSJA 3EKSA 3MDQA 3O9UA 2P1JA 2Z1JA 3NH0A 3H1QA 1S1XA 2ATQA 2P9PA 1OH8A 1SKRA 2BUPA 1TAQA 3AA2A 4GV3A 1TUUA 1YVUA 4BRDA 4NB4A 4AM6A 2QW9A 3KLIA 1N33K 3C7NB 1RT1A 3O1BA 4CHNA 1NOZA 3H6EA 3OHRA 3OJUA 2HVHA 2FSNA 3WEEA 4DR2K 3KKRA 1RBVA 3RMCA 3QBXA 4CZEA 1NGEA 4H0TB 1NKBA 3JSMA 4BRLA 4RTFD 5TKYA 5LMNK 2G8IA 1DGKN 3JS6A 2E1ZA 4FK2A 2FBTA 5DM7L 4RW9A 3LDLA 1T8EA 2P9NB 3NGYA 4ELUA 2P9IA 4CJPA 3QINA 2EWSA 5AR0A 1ZXOA 3TAPA 4DF4A 4JI2K 3SPZA 3R9PA 2A41A 5HRRA 1LW0A 2ZJQL 4JI6K 3P1GA 4K8XA 3J81O 2FBYA 3SAHA 1W97L 5BPMA 1JLFA 2KZMA 1RFQA 2YHYA 1R0AA 4F8RA 1NJZA 1B9DA 1Q9XA 1T05A 2QTDA 3LDPA 4XH5A 4F3TA 1ASUA 4IDHA 3SMSA 4JS5A 3TAGA 3NVMA 3TTFA 4C8MA 3KLHA 2JLEA 3V9XA 5C0YA 5JS2A 4FXDA 1FKOA 4KH6A 4RW8A 1WNSA 4CERA 1VQPN 1MDUB 1IBKK 5AQKA 3AVBA 3QO9A 4DQ8A 1C0GA 1SL2A 3O80A 2HNZA 2E6LA 3DLKA 3MCAB 3MXIA 2JGUA 1TUYA 1VRUA 3VPZA 3NGZA 3K5NA 1QHAA 4AILC 4BR0A 3HYFA 5BN8A 2YHWA 4CD1A 5BPLA 1L3SA 1VQ4N 4DV6K 1M90O 3QICA 3OBWA 3HZ6A 1Q8IA 3S9HA 4H8KA 4LF9K 2B6AA 2WOMA 3O8MA 3D45A 3ZX3A 1WSIA 5HOOA 2BGGA 4RW4A 2GELA 1XMOK 4C8KA 1J53A 3RR8A 3HI0A 3Q7BA 3NH1A 2XY6A 4F2SA 4FJKA 4JD2B 3E66A 1QVGM 1S9GA 3C6AA 4NLCA 5BRDA 4TSXA 1JCEA 3F73A 1VAZA 1MWKA 5J2PA 3MN9A 3ASMA 5M1OA 5CE3A 3UB5A 3CERA 2OZMA 2QWNA 1CZAN 5AZJB 3C65A 4DU4A 3IG1A 1BCMA 3DLEA 4FWPA 5EVZA 4CJ7A 3MN7A 5EX5A 3QEXA 3ID8A 1WB9A 2HBKA 3WUHA 2IVPA 4PHTX 2FF3B 1BQMA 2DFHA 2P9PB 1KVBA 4E7HA 1OVYA 4BE0A 2ITMA 4OPAA 1GOCA 1GLCG 4OPHA 2NRHA 3KD1E 4YOWA 2ETJA 3MAQA 4A5AA 4W5RA 1K9MO 3K5OA 4FOIA 4B9MA 3E1YA 3KTQA 3NHGA 4IOAL 3PUFA 3PSFA 1SZ2A 1HNWK 2HHUA 2IOCA 4OGCA 2ASOA 2D0AA 4DU3A 1JLBA 1TL3A 4MFBA 1UOCA 3VF4A 3ENBA 2CGLA 3ZT1A 3H1VX 1XMQK 1IBMK 3EL2A 1U48A 5SWMA 3MWPA 3CIPA 4CECA 4FLXA 4KTZA 2XY5A 4OPKA 4DQQA 4AH9A 1WAJA 4CJEA 3B6PA 1BG3A 1TYQB 3FZKA 4CEOA 4KI6A 4IXCA 1X9MA 3A5NC 2I7NA 3UKRA 1TKZA 5KPZA 4FJ5A 1LCUA 3NF8A 1XI1A 3FZLA 4CE9A 3OYKA 4JN4A 1IH7A 1ESVA 4JKEA 4AHSA 2HHTA 1C6VA 1RT5A 2CH5A 4DSIA 5GIPA 2RN2A 4W5QA 3SQ2A 3GOIA 2O8DA 4FM1A 3NBPA 1P8ZA 2ASPA 3THWA 1LWEA 4IO9L 4KHPK 2D5RA 3H08A 4N41A 4RG8A 4CBXA 3JAMO 4F9OA 3C6HA 4AF1A 5F0XA 1BIUA 4U67L 3NCIA 4BRGA 3JYTA 4K41A 4DKWA 1WSEA 4A2AA 4Z4FA 3C94A 4JKCA 3J7ZO 4DQIA 2D0PA 3FLCO 2OA8A 4E1NA 2E2OA 4X62K 3ZSQA 4CFAA 4OGEA 1T44A 5DM6L 3EE9A 3VQ7A 2P9SB 3TAFA 2YNIA 1N34K 3D6RA 2KW4A 4EIAA 1C0TA 3QETA 1JLQA 4B3OA 1WAFA 1TV6A 1VQMN 4DSFA 3HM9A 4M63C 3PLAA 2RE2A 4JI0K 4I9LA 1BO5O 3OS2A 3A5LC 2W40A 2HMPA 4BRIA 1WLJA 4KH5A 5FROA 4BQLA 4FJ8A 2I7PA 4FWLA 5DK5A 2IIRA 4FWOA 1A5VA 3P5JA 1N36K 1C0UA 2WONA 4BACA 1RDWX 2GUIA 2QWLA 2XRIA 3EO3A 2YKMA 3G10A 1ASVA 4KI4A 5J2NA 3Q7CA 3DLGA 1HUXA 1NGHA 4KAZA 4HUGA 4KRFA 2QKBA 3KWGA 1SQKA 3DI6A 4FZZA 1U2VA 5E26A 4E7LA 1DLOA 5C42A 1C1BA 1N8RO 1IG8A 2NRRA 3R1XA 2YKNA 4GMJB 4BR9A 3KWIA 4JHDA 4CJ3A 3LP2A 1E4FT 3AY9A 3TI0A 2QEXN 4E19A 2UUBK 4EP4A 2RF2A 3CJ1A 1HKBA 2F9WA 1NBWA 4EFHA 5E84A 3VQQA 2G8KA 3HO1A 1E4GT 2FBXA 4Z4EA 3RWUA 1ATRA 3HSCA 3FGUA 4HHTA 2YHBA 1NWKA 3M8RA 1XHXA 3MEDA 4CFCA 3UKUB 3D2EB 2CH6A 2Q2RA 1ILYA 3SPYA 4ELTA 3CCRN 3DWLA 2YV0X 4CIGA 4OX9K 3VESA 1BISA 4CHYA 1RT2A 4AQYK 1RDBA 3LL3A 3WNGA 1BQNA 3ZT2A 1TK5A 3LZJA 4PWDA 4QAGA 1IJJA 5B8HA 3UIQA 3CF5L 1NGCA 1JXBA 1NK5A 4G9ZA 3UE5A 5BRHA 3LDSA 3A2FA 4DSKA 1HRHA 1TGOA 5HL7L 1KRPA 1HPMA 3FE1A 3SBGA 5AQIA 1Z25A 3AVLA 3EN9A 4O5FA 4JKGA 1RGIA 3C6TA 3HK2A 3NH2A 2FLOA 4F4KA 3SUNA 2D0CA 5AQVA 4CCHA 4JKDA 5KRSA 4HUEA 2FC0A 2A1SA 5I42A 2KHOA 1RT6A 3OBYA 3MXMA 1P90A 3CCEN 4JS4A 3OY9A 4C8LA 2BTFA 4NCGA 3TABA 3QIPA 4CEEA 3AVHA 3K58A 4C8NA 2VG7A 4WQ5A 4OKEA 5CY4A 1W0HA 3ULEA 1R59O 4H0XB 4OVLA 1UAXA 4DLGA 1W7AA 1FW6A 1VQ8N 3OVNA 1S9EA 5AQLA 2O8FB 3MCPA 1SKSA 1VSEA 3I0SA 4ID1A 3OYBA 3CPEA 2Q1NA 4A57A 1JCFA 4N47A 2WBNA 2B4JA 4I6MA 4IJNA 4AHUA 4CVNE 3THYA 2A1RA 1DKGD 3LP1A 3WXMB 4HTLA 4KKOA 4GKKK 3VF2A 3ID6A 4BRFA 1RT7A 2WC9A 1VSIA 4CHQA 1VQ5N 1JLEA 3ZSWA 1KXPA 4B1YB 1ZBFA 3S3MA 2D0BA 4KBOA 2H3GX 4YFUA 4DR5K 3VA0A 2X6SA 4CJFA 3HOSA 1D4XA 4CJSA 3MEEA 5F2RA 2HF4A 3P83D 3MECA 3ZETA 3VN5A 3LDOA 4Z4GA 3HP9A 2PYLA 4IFVA 3B6OA 1SL1A 3HL8A 1OH6A 3HP6A 4CF0A 1BOTO 2X6NA 4B9TA 3U3YA 4C23A 3K5LA 3FR0A 1DT9A 3K59A 3V81A 2NZTA 5C2DA 3NE6A 3OW2M 3MN5A 3NF6A 2G8WA 4OPJA 4DLEA 4FJJA 1U45A 5M1KA 2ITGA 4CFDA 2R7YA 4JI3K 4FYDA 1L3TA 1L5UA 3IDHA 4H5TA 3CCLN 5AQTA 3MEGA 4QS8A 3RMDA 4GV9A 2GEMA 3PX4A 1VSKA 3OYDA 3P31A 5AQWA 3K2PA 1LWCA 4JHDB 2O8CA 3DXMA 4EHUA 3TAQA 4NYNA 1T03A 3QMLA 1NK6A 2FXUA 4FL9A 4CEDA 1QQMA 1JL1A 1NLVA 4W5NA 2VG6A 4LH5A 4DHYA 4EAHD 2D1KA 4DU1A 2IVOA 2HB5A 3DLBA 5CYQA 4JLHA 3JXUA 2Q36A 5AQHA 4CFBA 4CI6A 2XO7A 4KHNA 2PYJA 2VWBA 1NM1A 2FSKA 4X65K 1WSFA 4NO7A 2GWKA 1YHQN 4YHHK 1HPZA 4CZMA 2F4VK 2KQ2A 1EX4A 4DR3K 5AQYA 1G99A 4DB3A 2ZF5O 4M3YA 2ZWHA 4Y1DA 4DS4A 3ZCMA 3WXIA 3QEPA 3VQ8A 1NKCA 2FF6A 3AGRA 4FOEA 3T1HK 2ZJRL 3WXLA 1X1PA 4DTOA 2YNHA 2E2PA 4CJTA 3M5RA 4UQGA 3ZSYA 3MX2A 1J6ZA 1VSHA 4CF9A 4FWKA 1X3NA 1RT3A 3F2KA 1RILA 4B1VA 4DR1K 3VTHA 4CEBA 4K0KK 3KIOA 2GUPA 4CZFA 4H4OA 4WQ5C 1XQSC 4DTXA 4FM2A 1BA0A 2KKZA 4I9QA 3TARA 4FJMA 4FZXC 1NK7A 3CJBA 3G6EN 3L3VA 4H03B 1QQNA 2HOEA 1RBSA 3S3NA 4KHUA 5LJVA 1VQLN 1QVFM 4DTJA 4ELVA 1NMDA 1VQ7N 5BR9A 4IG0A 1C0FA 4PKGA 2QWMA 3RSEB 5IT9O 4CIEA 2F96A 3L2UA 4KV8A 4E3SA 2O8BA 4FVMA 1SKWA 4DWIA 2PAVA 3SV3A 1VSMA 4I6MB 4FJ7A 1NJYA 4C1NK 5AQOA 4PKIA 3TSQA 4BROA 1EKEA 3AAQA 4L8RB 2V7YA 3DXKB 2VQFK 3KK7A 3DMJA 1YUWA 3AO1A 3VQEA 2IAJA 3OYHA 1OH7A 3KHYA 1XC9A 4KFBA 1J5EK 5GADP 3QNNA 4BRMA 1VQNN 4QS9A 2AA4A 2GX9A 3U8XA 1YTUA 4WFNL 3SUPA 4CJRA 1HNZK 4N56A 2O4IA 1BGXT 1WSHA 4FLTA 1IBLK 3W0LA 5AQMA 4B3TK 1YJNN 3CCQN 4GY2B 4HVJA 1N6QA 1Z05A 1WOQA 3IS9A 3PX0A 4UY8O 3LDNA 4JRPA 4PA1A 4JI4K 3ZETB 4BRQA 3AO2A 3SUOA 2YI1A 2KTQA 5J1EA 4LD0A 3ITHA 3AO4A 4FJLA 2AJQA 1HNVA 1O1WA 4B9SA 4ILHA 5M1FA 3OTOK 1UWBA 4CESA 5GAEP 4RCHA 5AZIA 2HSTA 3A0IX 3FZMA 3ZYYX 4B1XB 4CBUA 2CGKA 3QERA 5ELZA 3BGRA 1IKYA 4JEPA 4J8FA 5AFUA 4E7IA 3PO4A 3OYLA 2HBJA 4QCLA 3QNOA 3CETA 4OLBA 5JLHA 3CMAN 4FWMA 4BRAA 2ZM6K 3WT0A 4Y0WA 5JMVA 5KRTA 1WN7A 5KGWA 4FW1A 4B8CA 4WCEL 2F8TA 4DS5A 3AA4A 3KK3A 4IDKA 1HKCA 1QQOA 2NRXA 2YJEA 4Z94A 3G4SN 4BG9A 3DJCA 5FRNA 1Y97A 4PL8A 4BWMA 1JKHA 3ZX2A 2ZQBA 3ZLJA 5C25A 4Z4IA 4DTNA 3AVKA 3IRXA 4J2AA 3LDQA 4FK0A 4M3UA 1CZ9A 3OYNA 1A5WA 4O4GA 3CG7A 1GLBG 1QSSA 3V1QA 1RBTA 3HM8A 1OKJA 4IJAA 3G25A 2QKKA 1U4BA 3CJCA 3OYJA 1X9SA 2BDPA 1LOTB 1RDCA 4FJHA 3RMBA 3DM2A 4DTMA 3NMUA 4CZLA 1KSPA 3ZT4A 1M1KO 4WF9L 2Z1HA 4WFAL 2NRTA 3S3OA 4XEIA 2IGIA 2NRWA 4MLHA 1QSLA 4LY7A 3P4IA 1LV5A 1EWQA 4H5VA 1J9AA 3CYMA 3AVGA 4H0YB 3WEEB 1YI2N 4W5OA 5LMUK 1D9FA 4CK3A 5AQGA 3SBTA 4KHQA 5HRNA 2PFUA 2OYQA 3ZEUA 1NK8A 4NXMK 4CD3A 5MLCQ 2EX3A 4BY9C 5AQQA 1EXQA 2QM1A 2WUSA 3KK1A 1IO2A 3VETA 3VOVA 4CZGA 4KB1A 4BRPA 2P9IB 4CJUA 1TAUA 4X66K 3I0RA 1DEJA 1NGBA 2EHGA 2Z1IA 4HCBA 4GNIA 3CCMN 1KFDA 1Q82O 4CJ4A 5GAHP 2GV9A 2RKIA 4YNQA 4Z0UA 3AV9A 4O8UA 2W6KA 3ISNC 4RW7A 3MX5A 3ATVA 2NLXA 2E1YA 5BRFA 3M8SA 4E1JA 5FRMA 4FJXA 3AAPA 3P38A 1Q9YA 5KQDA 2UXDK 5JS1A 2YHXA 1SV5A 3SQ1A 1TL1A 5HRPA 3CC4N 1E3MA 3CCSN 3L4QA 1VSFA 1K8KA 2AP1A 4M42A 3O9RA 3AO3A 2I5JA 3WNHA 4B9UA 4V19S 1OVQA 5KGXA 2GTDA 4ZHRA 5C12A 3DAWA 1L3VA 4B1ZA 2E2QA 1DTTA 1G15A 4B9LA 2PZSA 3V4IA 3VQDA 5ADXA 5CYMA 3V1RA 3U3GA 4BRNA 4FM0A 2VCPA 4H5WA 3SV4A 4H5NA 3THXA 4M45A 1T3VA 4H0OA 3G0ZA 5JICA 3F5TA 1QHTA 5E41A 3N4PA 4OKJA 4WYBA 3EE8A 5AZIB 4F3OA 3SYZA 1U47A 4KTQA 2O4GA 4DQPA 2HMIA 4ICLA 1NKEA 2DFFA 3T19A 3HVRA 1GLFO 2UXBK 4KH4A 1K6YA 3NF9A 2G8FA 5AJ3K 1LW2A 4IFYA 2ZGZA 1QZ6A 2B5JA 2OPPA 4HCCA 1Q18A 1RDAA 4BVPA 1QZ5A 3O3GA 2P9LA 3QEVA 5EOYA 3T69A 4H0PA 4WE1A 3SAFA 3TAMA 4BREA 4DFPA 2OZSA 4B3MK 3S41A 3HPGA 4OKKA 3TWHA 3ZSZA 5LL6Z 3DYAA 4FK4A 2KFNA 3T7ZA 2W42A 4FZYA 4J2DA 1A5XA 4B9NA 3AVCA 4O8KA 3CI5A 4YORA 2HHQA 3QFPA 1MA9B 3QLHA 3H46O 1DTQA 1UA1A 4FPBA 3IUCA 1BI4A 3CJAA 3SNNA 3K57A 1JLAA 2HW3A 3VQ4A 1KVCA 5BR8K 1HLUA 2E20A 4JKAA 5AQFA 5HROA 2WTUA 1S1WA 3AARA 1QE1A 2BE2A 3ZX0A 4AM7A 4RWTA 3LZIA 1S22A 4N76A 5LY3A 1VQKN 3DLLL 1WBBA 4A61A 3NDKA 2BANA 2IVNA 3BZKA 2QWRA 4CK2A 4M3XA 4W5TA 3CFPA 3HJFA 4A59A 1X9WA 2YNFA 4E1MA 5GAGP 4QS7A 2HHSA 4G1QA 2Q31A 4B3RK 4CEZA 4LFBK 1KLMA 3AA5X 4GKJK 1O13A 4EZ9A 4YOTA 3LM2A 4EP5A 2A3ZA 1W9HA 2QXFA 4JAXA 1KTQA 2XHBA 3UKRB 3C7NA 4HWIA 1H1VA 1EWRA 3O9SA 4CF1A 4O5BA 1N32K 4CGJA 4CZIA 1JL2A 2P9KA 2HHVA 1V4SA 3VEXA 2O8DB 5CHIA 3L2QA 3FZFA 4IG3A 1I94K 4HUFA 3THWB 4CGGA 3KK2A 4DV5K 3M8PA 3DRRA 3E9LA 2QWQA 1HQUA 1C1CA 4ILJA 1VSDA 4CBWA 3LWLA 3CQYA 4C1NI 4NCBA 3T1YK 2O8EA 4FJIA 4OLAA 3WXKA 1GOBA 3NVKA 3TSPA 4DTSA 3HPOA 4BG8A 4DR7K 4IKFA 3VQ5A 5BN9A 2CGJA 3HXMA 4JK9A 3WQUA 2P9UA 4FJGA 3D7EO 4DMNA 3ZSRA 3KKSA 3QBWA 5AQRA 4B1UB 2P9NA 3CFOA 4M3RA 2OPSA 1VQ9N 3CCJN 3SQ4A 1HR0K 3GG4A 3RTVA 5AQZA 1EETA 1HJRA 4CEAA 2QA4N 1NMNA 3RR7A 3SLCA 3HT3A 1FXXA 3O4QA 3L2WA 4EZ6A 3SZ2A 1CXQA 2Y1IA 3V9ZA 4MQ3A 4CGDA 1YAGA 3CXCM 4E7JA 3MWTA 3L0QA 3M6GA 4H4MA 2A40A 4K25A 3EZ5A 1SUQA 2Q0RA 3CHWA 4ZTJA 3PX6A 3I55N 5M1PA 3CPWM 4IEIA 4DFMA 4JI1K 1YJWN 1XHZA 4MO4A 3CJ7A 4FJNA 5JVGL 3CM6A 4RW6A 1D5AA 2P51A 2A42A 3VEOA 3L6QA 4DF8A 4DV2K 3E9PA 4FWNA 4LC9B 2YNGA 5EU7A 2JWKA 1BCOA 3QFUA 3O5BA 1U2VB 3PO5A 3OYMA 1K8AO 2P9LB 4LF7K 3OA9A 2OCEA 4JKFA 1NK4A 3MN6A 3TANA 3IMXA 4LF4K 3HTVA 5I3UA 4F2RA 2G8VA 4IZ9A 3K5MA 1YVNA 2P5OA 4JYAK 3I8BA 3LANA 4GVEA 3KLEA 3A5OC 3O4NA 2WFBA 1RBUA 3OYGA 3ZSXA 4YOXA 4CZHA 1GLDG 4E89A 3VQPA 4N5SA 3O9QA 4JD2A 4CZJA 4CJ5A 4FPAA 4Y1CA 1ZBUA 4CK1A 3OYEA 4JV5K 5HLFA 3KLGA 3ZT3A 3M8QA 1HNIA 1BI4B 1RTIA 2GWJA 4MO5A 3FZHA 3VQ9A 2E8AA 2IC3A 1YITN 5AFUH 2J4RA 2X78A 3RRGA 3QEWA 4DFJA 3ALYA 3LALA 1IG9A 3H3OB 4JI7K 4CW7B 1KVAA 4PUOA 3AGKA 3WXJA 4XH1A 3OYFA 4BR7A 1S1UA 4A2BA 1JCGA 4CJWA 4U7BA 3U4LA 3R6MA
chains in the Genus database with same CATH topology
1L3UA 2YNIA 4J2EA 2F8TA 2KW4A 4DS5A 3O3HA 3AA4A 1ZBHA 1C0TA 4NYFA 3KK3A 1JLQA 3QETA 4B3OA 4IDKA 1WAFA 1TV6A 4O0JA 4Z4CA 3HM9A 4DSFA 3VQCA 3U6FA 4E0DA 2Z1GA 4I9LA 4B8AB 3LWMA 3OS2A 4I2PA 5FRNA 1Y97A 3HPHA 4BWMA 1JKHA 3T1AA 1TKDA 1WLJA 2ZQBA 4BDPA 3THVA 5C25A 2RPIA 4Z4IA 5FROA 1QTMA 4DTNA 3AVKA 1FKPA 4BDZA 3IRXA 1B92A 3HSTB 4J2AA 4FJ8A 1IKWA 4FK0A 4M3UA 1CZ9A 3OYNA 1A5WA 4O4GA 5DK5A 4JRQA 3CG7A 3SQ0A 3RMAA 1A5VA 3QEIA 3LPUA 3P5JA 4IBNA 3SI6A 1QSSA 3V1QA 1C0UA 4K8ZA 2G8HA 1RBTA 5K14A 2WONA 4BACA 4AHRA 4BE1A 1T7PA 2GUIA 2XRIA 3T3FA 1S6PA 1ASWA 4CJLA 1TK8A 1U4BA 3OYJA 2QKKA 1X9SA 3KD5E 1CLQA 4O0IA 2BDPA 1U04A 2NUBA 2YKMA 1RDCA 3G10A 1ASVA 4FJHA 1TVRA 3AVIA 1YTAA 3CFRA 5J2NA 4KI4A 1RNHA 1QS4A 3DLGA 3RMBA 1B9FA 3DM2A 2VWJA 4DTMA 2HNYA 4KAZA 1KSPA 3ZT4A 4HUGA 4KRFA 1IKXA 2Z1HA 2QKBA 3DI6A 4FZZA 4LH4A 3S3OA 4FLVA 4ID5A 2IGIA 4E7LA 3KLFA 1DLOA 5C42A 1SL0A 1ITGA 1C1BA 4LY7A 1LV5A 1QSLA 1RBRA 2YKNA 2X74A 1RTHA 4GMJB 4CJ3A 4CHPA 3LP2A 3TI0A 4E19A 5HP1A 1J9AA 3CYMA 3AVGA 1LAWA 3WNFA 1LAVA 4EP4A 4HTUA 2RF2A 2Q3SA 4W5OA 1NOYA 4KPYA 4FLZA 4FLYA 1D9FA 4CK3A 4XIUA 3VQQA 1ZBIA 1TK0A 2G8KA 3HO1A 4KHQA 5HRNA 2FBXA 1NK9A 4Z4EA 1VSLA 3AVJA 3RWUA 2HHXA 5D3GA 4HHTA 4BE2A 2YHBA 3M8RA 1N5YA 2OYQA 1XHXA 3MEDA 3L2RA 3EY1A 4CFCA 1NK8A 3PV8A 2EX3A 2G8UA 4CIFA 1EXQA 1REVA 3F9KA 3V9SA 1D9DA 4CGHA 3SPYA 1S1TA 4CJQA 4ELTA 3KK1A 2ZE2A 1IO2A 4KHSA 4KB1A 2YV0X 4CIGA 3MXJA 4Q0BA 4GVMA 4C8OA 4CJUA 3AVNA 5CZ2A 2Y1JA 1TAUA 1JLCA 3C95A 1RTDA 3VQ6A 1BISA 4CHYA 1RT2A 3I0RA 1CXUA 1RDBA 4CGFA 4J2BA 2EHGA 2Z1IA 4HCBA 3WNGA 1BQNA 3ZT2A 4KB0A 3LP0A 4KTWA 1TK5A 3LZJA 4PWDA 1KFDA 4QAGA 4KREA 4CJ4A 2GV9A 2RKIA 4YNQA 4Z0UA 1HQEA 1Z26A 4CHZA 2IS3A 2OPRA 3AV9A 3UIQA 3ISNC 4RW7A 1C0MA 1C1AA 3ZSOA 3BDPA 2OPQA 1JXBA 1NK5A 3AA3A 1KFSA 3DLRA 1VRTA 4Z4HA 1BHLA 3M8SA 4QOZB 3LDSA 3A2FA 3RRHA 4DSKA 5FRMA 1HRHA 4FJXA 3LAMA 1TGOA 4DQRA 2YHAA 3D0PA 1Q9YA 1KRPA 4PQUA 1WSGA 5JS1A 1RTJA 1Z25A 3AVLA 1SV5A 4AHVA 3C6TA 3SQ1A 3HK2A 3NH2A 1TL1A 3SUNA 4F4KA 5HRPA 2HHWA 4CEQA 2XY8A 3L8BA 2VG5A 1VSFA 2D0CA 4CCHA 4AHCA 5KRSA 4M42A 3AO3A 2I5JA 3WNHA 4B9UA 4HUEA 1I3AA 2FC0A 5KGXA 1CZBA 3NF7A 2A1SA 3QESA 4DSLA 2QK9A 5I42A 1RT6A 1XWLA 3DRPA 3QIOA 3CM5A 4ZHRA 5KTQA 3NFAA 3MXMA 3IAYA 1L3VA 1JXEA 3OY9A 4JS4A 4C8LA 1DTTA 1G15A 4NCGA 1VSJA 4B08A 3VQAA 4CF8A 3V4IA 2PZSA 1HMVA 3VQDA 1UA0A 4M3ZA 4PY5A 5CYMA 3V1RA 3TABA 3QIPA 3U3GA 4CEEA 3AVHA 2P1JA 2Z1JA 4LSNA 4C8NA 3AVMA 3NH0A 5C24A 1S1XA 2ATQA 1TKTA 3K58A 3SV4A 2VG7A 3EYZA 4OKEA 5CY4A 1W0HA 4M45A 1SKRA 3G0ZA 1TAQA 3AA2A 1QHTA 5E41A 1KCFA 4OKJA 1YVUA 4OVLA 1UAXA 4DLGA 3V6DA 1HYZA 3OVNA 1S9EA 4F3OA 3SYZA 1U47A 1D8YA 1SKSA 1VSEA 3I0SA 3KLIA 4ID1A 3OYBA 4KTQA 2O4GA 1RT1A 4CHNA 4E7KA 1NOZA 4N47A 4DQPA 2B4JA 2HNDA 4AHUA 2HMIA 4ICLA 2A1RA 3OJUA 3LP1A 1NKEA 2HVHA 2DFFA 3T19A 3HVRA 2HHTA 3KKRA 2KZZA 1K6YA 1RBVA 4KKOA 3RMCA 3NF9A 5HRSA 3OJSA 1NJWA 2G8FA 3AO5A 4Q5VA 1LW2A 4R5PA 4IFYA 2KFZA 1RT7A 4KO0A 2B5JA 2OPPA 5SZTA 3JSMA 1VSIA 4CHQA 1NKBA 4ZTFA 3PY8A 1JLEA 1RDAA 3ZSWA 4HCCA 2G8IA 3O3GA 3OS0A 1ZBFA 3S3MA 2D0BA 3QEVA 4FK2A 3OYAA 2FBTA 4WE1A 1ZBLA 4YFUA 4RW9A 3CQ8A 1S1VA 3TAMA 4DFPA 2OZSA 3VA0A 2X6SA 1T8EA 3NGYA 1J54A 4ELUA 3HPGA 4CJFA 4OKKA 4CJSA 1IKVA 4CJPA 3QINA 3ZSZA 3MEEA 3TWHA 3P83D 1EP4A 3DYAA 4DFKA 3MECA 1HYSA 3VN5A 5T7BA 3KJVA 4FK4A 4Z4GA 2KFNA 3HP9A 2W42A 3O3FA 3TAPA 4IFVA 2PYLA 3B6OA 1SL1A 4FZYA 3HL8A 4J2DA 1A5XA 3HP6A 4CF0A 4DF4A 4B9NA 2X6NA 2DY4A 3TR8A 4B9TA 3SPZA 3AVCA 2PY5A 4KHYA 4DSEA 3U3YA 2HHQA 3K5LA 5HRRA 1LW0A 3K59A 3V81A 1S6QA 4BDYA 3P1GA 4B9LA 3NE6A 2VWKA 4K8XA 2FBYA 3NF6A 5FDLA 4FLWA 3QLHA 4OPJA 4DLEA 1DTQA 1JLFA 1UA1A 2G8WA 4FJJA 1U45A 2KZMA 4F8RA 1BI4A 1R0AA 4AHTA 3SNNA 2ITGA 4CFDA 1B9DA 1JLAA 3K57A 2R7YA 1NJZA 1L3TA 1L5UA 3VQ4A 1Q9XA 2E4LA 4FYDA 1BIZA 2HW3A 1KVCA 3MEGA 4I2QA 1T05A 3RMDA 3PX4A 1VSKA 4F3TA 1ASUA 3OYDA 4JS5A 3TAGA 3K2PA 4C8MA 3KLHA 2JLEA 3V9XA 5HROA 3DLHA 5JS2A 4O44A 4FXDA 1FKOA 4RW8A 1LWCA 1WNSA 1S1WA 4CERA 4M3WA 4CJVA 1QE1A 2BE2A 3LZIA 3TAQA 4NYNA 2LSNA 3E01A 1T03A 1NK6A 4DSJA 4N76A 4CEDA 1JL1A 3AVBA 4W5NA 2VG6A 4LH5A 3QO9A 3AVFA 1GOAA 3NDKA 2BANA 1SL2A 4DU1A 1RDDA 1NK0A 2E6MA 2HB5A 4CK2A 3DLBA 4M3XA 5CYQA 4W5TA 2HNZA 2E6LA 3CFPA 3DLKA 4M3TA 4JLHA 3HJFA 4DTRA 1X9WA 3MXIA 4CFBA 2YNFA 2JGUA 4E1MA 1VRUA 3NGZA 4FW2A 4G1QA 2XO7A 4BWJA 4KHNA 2HHSA 3K5NA 4CEZA 4AILC 2PYJA 2FBVA 4LSLA 1VK0A 3HYFA 3LPTA 1KLMA 1WSFA 1L3SA 3AA5X 5J2QA 4EZ9A 4EP5A 1HPZA 1Q8IA 1W9HA 4H8KA 2QXFA 3S9HA 1KTQA 2B6AA 2GBZA 2WOMA 2XHBA 2KQ2A 3D45A 1EX4A 4CJKA 1WSIA 2DFEA 4RW4A 3ZT0A 4O5BA 4CF1A 2BGGA 4M3YA 4CGJA 1JL2A 4Y1DA 4C8KA 1J53A 3OYCA 4DS4A 3ZCMA 3QEPA 3RR8A 2HHVA 3VQ8A 3NH1A 1J5OA 2XY6A 4F2SA 1NKCA 3L2QA 4IG3A 4HUFA 4FJKA 4CGGA 2DTUA 3KK2A 3M8PA 3NAEA 3DRRA 1X1PA 4DTOA 2YNHA 1HQUA 1C1CA 3DRSA 1VSDA 4CJTA 3LWLA 5KI6A 1S9GA 4NCBA 1U49A 4UQGA 3ZSYA 4TSXA 4DQSA 3F73A 4FJIA 1VSHA 4OLAA 4FLUA 4CF9A 1GOBA 2F8SA 1RT3A 4DTSA 3HPOA 4DTPA 5J2PA 4IKFA 3ASMA 3VQ5A 1LWFA 1RILA 3HXMA 3FFIA 4CEBA 4FJGA 4DMNA 3KIOA 4DTXA 2OZMA 4H4OA 3ZSRA 3KKSA 3NGIA 4FM2A 1FK9A 3CFOA 4I9QA 3LAKA 5CZ1A 4DU4A 4M3RA 2OPSA 3TARA 5DMRA 3SQ4A 4FJMA 3IG1A 1BCMA 3RTVA 3DOLA 4FZXC 1EETA 1HJRA 3DLEA 4CEAA 3SJJA 1NK7A 3RR7A 3SCXA 3QEXA 3L3VA 3HT3A 1QSYA 1FXXA 3V1OA 3O4QA 1RBSA 3L2WA 4EZ6A 3SZ2A 3S3NA 1CXQA 4KHUA 2Y1IA 4CHOA 3V9ZA 4MQ3A 3L3UA 1BL3A 4DTJA 4ELVA 1BQMA 3AVAA 4CGDA 4E7JA 2DFHA 3ZSVA 1KVBA 4E7HA 4IG0A 4BE0A 4H4MA 1GOCA 4DG1A 3EZ5A 3KD1E 1SUQA 1RT4A 4CIEA 3ULDA 2ETJA 4GW6A 3MAQA 2F96A 3L2UA 4ZTJA 4FJ9A 4KV8A 4W5RA 3PX6A 3DOKA 3WNEA 4E3SA 3K5OA 4DFMA 4B9MA 3KTQA 3NHGA 3PUFA 1XHZA 4FVMA 1SKWA 4DWIA 4FJNA 3SV3A 1VSMA 4FJ7A 3C6UA 3CM6A 2HHUA 4RW6A 1NJYA 1D5AA 2P51A 3VQBA 2IOCA 3I8DA 4OGCA 1KLNA 1EKEA 4DF8A 4L8RB 2D0AA 4DU3A 1JLBA 1TL3A 1WSJA 2YNGA 3DMJA 4MFBA 3AO1A 3VQEA 2XY7A 1UOCA 5EU7A 1RCHA 3VA3A 3ZT1A 1BCOA 2IAJA 3LP3A 3OYHA 1XC9A 1TKXA 4KFBA 2P5GA 2HVIA 3PO5A 1U48A 3QNNA 5SWMA 3OYMA 4CECA 4FLXA 3V9UA 4KTZA 1MU2A 2XY5A 1YTUA 1HYVA 4OPKA 4DQQA 4AH9A 3V9WA 1NK4A 4KHWA 1I39A 3SUPA 1WAJA 4CJRA 3TANA 4CJEA 4N56A 2O4IA 3B6PA 1BGXT 4CEOA 1WSHA 4FLTA 2IDOA 4KI6A 4CEFA 4HVJA 5I3UA 4F2RA 1N6QA 4I7FA 2G8VA 1X9MA 1JLGA 1QQCA 3K5MA 2P5OA 3IS9A 3LANA 3PX0A 1TKZA 4JRPA 4PA1A 4FJ5A 3NF8A 3KLEA 1XI1A 3AO2A 3SUOA 4CE9A 5J1EA 2KTQA 3OYKA 3O4NA 4LD0A 1IH7A 3ITHA 4M41A 3AO4A 1F21A 1RBUA 4AHSA 1ZYQA 4FJLA 1C6VA 1RT5A 3OYGA 3TAEA 3ZSXA 4W5QA 2RN2A 3SQ2A 3SUQA 4DSIA 2AJQA 1HNVA 4FM1A 1S5JA 3NBPA 3HVTA 3L2VA 4E89A 3VQPA 4N5SA 1O1WA 1LWEA 4B9SA 2D5RA 3H08A 4N41A 4RG8A 4CJ5A 4Y1CA 1ZBUA 4CK1A 3OYEA 5J2MA 1UWBA 1BIUA 5HLFA 3OS1A 3ZT3A 3M8QA 4CESA 3KLGA 3NCIA 3JYTA 1HNIA 1BI4B 1RTIA 4FM0A 1WSEA 2ZD1A 4Z4FA 3QERA 4B9VA 3C94A 3VQ9A 2IC3A 3BGRA 4DQIA 1IKYA 4CGIA 4FCYA 1YT3A 2X78A 4E7IA 3PO4A 3RRGA 2OA8A 3OYLA 3QEWA 4E1NA 4DFJA 4QCLA 3QNOA 3ALYA 4OLBA 3OYIA 3LALA 4OJRA 1IG9A 4DTUA 1NJXA 3ZSQA 4CFAA 1KVAA 4OGEA 4PUOA 4NCAA 5HBMA 3OYFA 4CF2A 3VQ7A 5KRTA 1S1UA 1WN7A 4O55A 4CJWA 5KGWA 4FW1A 3TAFA 4B8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3U A;  2YNI A;  4J2E A;  2F8T A;  2KW4 A;  4DS5 A;  3O3H A;  3AA4 A;  1ZBH A;  1C0T A;  4NYF A;  3KK3 A;  1JLQ A;  3QET A;  4B3O A;  4IDK A;  1WAF A;  1TV6 A;  4O0J A;  4Z4C A;  3HM9 A;  4DSF A;  3VQC A;  3U6F A;  4E0D A;  2Z1G A;  4I9L A;  4B8A B;  3LWM A;  3OS2 A;  4I2P A;  5FRN A;  1Y97 A;  3HPH A;  4BWM A;  1JKH A;  3T1A A;  1TKD A;  1WLJ A;  2ZQB A;  4BDP A;  3THV A;  5C25 A;  2RPI A;  4Z4I A;  5FRO A;  1QTM A;  4DTN A;  3AVK A;  1FKP A;  4BDZ A;  3IRX A;  1B92 A;  3HST B;  4J2A A;  4FJ8 A;  1IKW A;  4FK0 A;  4M3U A;  1CZ9 A;  3OYN A;  1A5W A;  4O4G A;  5DK5 A;  4JRQ A;  3CG7 A;  3SQ0 A;  3RMA A;  1A5V A;  3QEI A;  3LPU A;  3P5J A;  4IBN A;  3SI6 A;  1QSS A;  3V1Q A;  1C0U A;  4K8Z A;  2G8H A;  1RBT A;  5K14 A;  2WON A;  4BAC A;  4AHR A;  4BE1 A;  1T7P A;  2GUI A;  2XRI A;  3T3F A;  1S6P A;  1ASW A;  4CJL A;  1TK8 A;  1U4B A;  3OYJ A;  2QKK A;  1X9S A;  3KD5 E;  1CLQ A;  4O0I A;  2BDP A;  1U04 A;  2NUB A;  2YKM A;  1RDC A;  3G10 A;  1ASV A;  4FJH A;  1TVR A;  3AVI A;  1YTA A;  3CFR A;  5J2N A;  4KI4 A;  1RNH A;  1QS4 A;  3DLG A;  3RMB A;  1B9F A;  3DM2 A;  2VWJ A;  4DTM A;  2HNY A;  4KAZ A;  1KSP A;  3ZT4 A;  4HUG A;  4KRF A;  1IKX A;  2Z1H A;  2QKB A;  3DI6 A;  4FZZ A;  4LH4 A;  3S3O A;  4FLV A;  4ID5 A;  2IGI A;  4E7L A;  3KLF A;  1DLO A;  5C42 A;  1SL0 A;  1ITG A;  1C1B A;  4LY7 A;  1LV5 A;  1QSL A;  1RBR A;  2YKN A;  2X74 A;  1RTH A;  4GMJ B;  4CJ3 A;  4CHP A;  3LP2 A;  3TI0 A;  4E19 A;  5HP1 A;  1J9A A;  3CYM A;  3AVG A;  1LAW A;  3WNF A;  1LAV A;  4EP4 A;  4HTU A;  2RF2 A;  2Q3S A;  4W5O A;  1NOY A;  4KPY A;  4FLZ A;  4FLY A;  1D9F A;  4CK3 A;  4XIU A;  3VQQ A;  1ZBI A;  1TK0 A;  2G8K A;  3HO1 A;  4KHQ A;  5HRN A;  2FBX A;  1NK9 A;  4Z4E A;  1VSL A;  3AVJ A;  3RWU A;  2HHX A;  5D3G A;  4HHT A;  4BE2 A;  2YHB A;  3M8R A;  1N5Y A;  2OYQ A;  1XHX A;  3MED A;  3L2R A;  3EY1 A;  4CFC A;  1NK8 A;  3PV8 A;  2EX3 A;  2G8U A;  4CIF A;  1EXQ A;  1REV A;  3F9K A;  3V9S A;  1D9D A;  4CGH A;  3SPY A;  1S1T A;  4CJQ A;  4ELT A;  3KK1 A;  2ZE2 A;  1IO2 A;  4KHS A;  4KB1 A;  2YV0 X;  4CIG A;  3MXJ A;  4Q0B A;  4GVM A;  4C8O A;  4CJU A;  3AVN A;  5CZ2 A;  2Y1J A;  1TAU A;  1JLC A;  3C95 A;  1RTD A;  3VQ6 A;  1BIS A;  4CHY A;  1RT2 A;  3I0R A;  1CXU A;  1RDB A;  4CGF A;  4J2B A;  2EHG A;  2Z1I A;  4HCB A;  3WNG A;  1BQN A;  3ZT2 A;  4KB0 A;  3LP0 A;  4KTW A;  1TK5 A;  3LZJ A;  4PWD A;  1KFD A;  4QAG A;  4KRE A;  4CJ4 A;  2GV9 A;  2RKI A;  4YNQ A;  4Z0U A;  1HQE A;  1Z26 A;  4CHZ A;  2IS3 A;  2OPR A;  3AV9 A;  3UIQ A;  3ISN C;  4RW7 A;  1C0M A;  1C1A A;  3ZSO A;  3BDP A;  2OPQ A;  1JXB A;  1NK5 A;  3AA3 A;  1KFS A;  3DLR A;  1VRT A;  4Z4H A;  1BHL A;  3M8S A;  4QOZ B;  3LDS A;  3A2F A;  3RRH A;  4DSK A;  5FRM A;  1HRH A;  4FJX A;  3LAM A;  1TGO A;  4DQR A;  2YHA A;  3D0P A;  1Q9Y A;  1KRP A;  4PQU A;  1WSG A;  5JS1 A;  1RTJ A;  1Z25 A;  3AVL A;  1SV5 A;  4AHV A;  3C6T A;  3SQ1 A;  3HK2 A;  3NH2 A;  1TL1 A;  3SUN A;  4F4K A;  5HRP A;  2HHW A;  4CEQ A;  2XY8 A;  3L8B A;  2VG5 A;  1VSF A;  2D0C A;  4CCH A;  4AHC A;  5KRS A;  4M42 A;  3AO3 A;  2I5J A;  3WNH A;  4B9U A;  4HUE A;  1I3A A;  2FC0 A;  5KGX A;  1CZB A;  3NF7 A;  2A1S A;  3QES A;  4DSL A;  2QK9 A;  5I42 A;  1RT6 A;  1XWL A;  3DRP A;  3QIO A;  3CM5 A;  4ZHR A;  5KTQ A;  3NFA A;  3MXM A;  3IAY A;  1L3V A;  1JXE A;  3OY9 A;  4JS4 A;  4C8L A;  1DTT A;  1G15 A;  4NCG A;  1VSJ A;  4B08 A;  3VQA A;  4CF8 A;  3V4I A;  2PZS A;  1HMV A;  3VQD A;  1UA0 A;  4M3Z A;  4PY5 A;  5CYM A;  3V1R A;  3TAB A;  3QIP A;  3U3G A;  4CEE A;  3AVH A;  2P1J A;  2Z1J A;  4LSN A;  4C8N A;  3AVM A;  3NH0 A;  5C24 A;  1S1X A;  2ATQ A;  1TKT A;  3K58 A;  3SV4 A;  2VG7 A;  3EYZ A;  4OKE A;  5CY4 A;  1W0H A;  4M45 A;  1SKR A;  3G0Z A;  1TAQ A;  3AA2 A;  1QHT A;  5E41 A;  1KCF A;  4OKJ A;  1YVU A;  4OVL A;  1UAX A;  4DLG A;  3V6D A;  1HYZ A;  3OVN A;  1S9E A;  4F3O A;  3SYZ A;  1U47 A;  1D8Y A;  1SKS A;  1VSE A;  3I0S A;  3KLI A;  4ID1 A;  3OYB A;  4KTQ A;  2O4G A;  1RT1 A;  4CHN A;  4E7K A;  1NOZ A;  4N47 A;  4DQP A;  2B4J A;  2HND A;  4AHU A;  2HMI A;  4ICL A;  2A1R A;  3OJU A;  3LP1 A;  1NKE A;  2HVH A;  2DFF A;  3T19 A;  3HVR A;  2HHT A;  3KKR A;  2KZZ A;  1K6Y A;  1RBV A;  4KKO A;  3RMC A;  3NF9 A;  5HRS A;  3OJS A;  1NJW A;  2G8F A;  3AO5 A;  4Q5V A;  1LW2 A;  4R5P A;  4IFY A;  2KFZ A;  1RT7 A;  4KO0 A;  2B5J A;  2OPP A;  5SZT A;  3JSM A;  1VSI A;  4CHQ A;  1NKB A;  4ZTF A;  3PY8 A;  1JLE A;  1RDA A;  3ZSW A;  4HCC A;  2G8I A;  3O3G A;  3OS0 A;  1ZBF A;  3S3M A;  2D0B A;  3QEV A;  4FK2 A;  3OYA A;  2FBT A;  4WE1 A;  1ZBL A;  4YFU A;  4RW9 A;  3CQ8 A;  1S1V A;  3TAM A;  4DFP A;  2OZS A;  3VA0 A;  2X6S A;  1T8E A;  3NGY A;  1J54 A;  4ELU A;  3HPG A;  4CJF A;  4OKK A;  4CJS A;  1IKV A;  4CJP A;  3QIN A;  3ZSZ A;  3MEE A;  3TWH A;  3P83 D;  1EP4 A;  3DYA A;  4DFK A;  3MEC A;  1HYS A;  3VN5 A;  5T7B A;  3KJV A;  4FK4 A;  4Z4G A;  2KFN A;  3HP9 A;  2W42 A;  3O3F A;  3TAP A;  4IFV A;  2PYL A;  3B6O A;  1SL1 A;  4FZY A;  3HL8 A;  4J2D A;  1A5X A;  3HP6 A;  4CF0 A;  4DF4 A;  4B9N A;  2X6N A;  2DY4 A;  3TR8 A;  4B9T A;  3SPZ A;  3AVC A;  2PY5 A;  4KHY A;  4DSE A;  3U3Y A;  2HHQ A;  3K5L A;  5HRR A;  1LW0 A;  3K59 A;  3V81 A;  1S6Q A;  4BDY A;  3P1G A;  4B9L A;  3NE6 A;  2VWK A;  4K8X A;  2FBY A;  3NF6 A;  5FDL A;  4FLW A;  3QLH A;  4OPJ A;  4DLE A;  1DTQ A;  1JLF A;  1UA1 A;  2G8W A;  4FJJ A;  1U45 A;  2KZM A;  4F8R A;  1BI4 A;  1R0A A;  4AHT A;  3SNN A;  2ITG A;  4CFD A;  1B9D A;  1JLA A;  3K57 A;  2R7Y A;  1NJZ A;  1L3T A;  1L5U A;  3VQ4 A;  1Q9X A;  2E4L A;  4FYD A;  1BIZ A;  2HW3 A;  1KVC A;  3MEG A;  4I2Q A;  1T05 A;  3RMD A;  3PX4 A;  1VSK A;  4F3T A;  1ASU A;  3OYD A;  4JS5 A;  3TAG A;  3K2P A;  4C8M A;  3KLH A;  2JLE A;  3V9X A;  5HRO A;  3DLH A;  5JS2 A;  4O44 A;  4FXD A;  1FKO A;  4RW8 A;  1LWC A;  1WNS A;  1S1W A;  4CER A;  4M3W A;  4CJV A;  1QE1 A;  2BE2 A;  3LZI A;  3TAQ A;  4NYN A;  2LSN A;  3E01 A;  1T03 A;  1NK6 A;  4DSJ A;  4N76 A;  4CED A;  1JL1 A;  3AVB A;  4W5N A;  2VG6 A;  4LH5 A;  3QO9 A;  3AVF A;  1GOA A;  3NDK A;  2BAN A;  1SL2 A;  4DU1 A;  1RDD A;  1NK0 A;  2E6M A;  2HB5 A;  4CK2 A;  3DLB A;  4M3X A;  5CYQ A;  4W5T A;  2HNZ A;  2E6L A;  3CFP A;  3DLK A;  4M3T A;  4JLH A;  3HJF A;  4DTR A;  1X9W A;  3MXI A;  4CFB A;  2YNF A;  2JGU A;  4E1M A;  1VRU A;  3NGZ A;  4FW2 A;  4G1Q A;  2XO7 A;  4BWJ A;  4KHN A;  2HHS A;  3K5N A;  4CEZ A;  4AIL C;  2PYJ A;  2FBV A;  4LSL A;  1VK0 A;  3HYF A;  3LPT A;  1KLM A;  1WSF A;  1L3S A;  3AA5 X;  5J2Q A;  4EZ9 A;  4EP5 A;  1HPZ A;  1Q8I A;  1W9H A;  4H8K A;  2QXF A;  3S9H A;  1KTQ A;  2B6A A;  2GBZ A;  2WOM A;  2XHB A;  2KQ2 A;  3D45 A;  1EX4 A;  4CJK A;  1WSI A;  2DFE A;  4RW4 A;  3ZT0 A;  4O5B A;  4CF1 A;  2BGG A;  4M3Y A;  4CGJ A;  1JL2 A;  4Y1D A;  4C8K A;  1J53 A;  3OYC A;  4DS4 A;  3ZCM A;  3QEP A;  3RR8 A;  2HHV A;  3VQ8 A;  3NH1 A;  1J5O A;  2XY6 A;  4F2S A;  1NKC A;  3L2Q A;  4IG3 A;  4HUF A;  4FJK A;  4CGG A;  2DTU A;  3KK2 A;  3M8P A;  3NAE A;  3DRR A;  1X1P A;  4DTO A;  2YNH A;  1HQU A;  1C1C A;  3DRS A;  1VSD A;  4CJT A;  3LWL A;  5KI6 A;  1S9G A;  4NCB A;  1U49 A;  4UQG A;  3ZSY A;  4TSX A;  4DQS A;  3F73 A;  4FJI A;  1VSH A;  4OLA A;  4FLU A;  4CF9 A;  1GOB A;  2F8S A;  1RT3 A;  4DTS A;  3HPO A;  4DTP A;  5J2P A;  4IKF A;  3ASM A;  3VQ5 A;  1LWF A;  1RIL A;  3HXM A;  3FFI A;  4CEB A;  4FJG A;  4DMN A;  3KIO A;  4DTX A;  2OZM A;  4H4O A;  3ZSR A;  3KKS A;  3NGI A;  4FM2 A;  1FK9 A;  3CFO A;  4I9Q A;  3LAK A;  5CZ1 A;  4DU4 A;  4M3R A;  2OPS A;  3TAR A;  5DMR A;  3SQ4 A;  4FJM A;  3IG1 A;  1BCM A;  3RTV A;  3DOL A;  4FZX C;  1EET A;  1HJR A;  3DLE A;  4CEA A;  3SJJ A;  1NK7 A;  3RR7 A;  3SCX A;  3QEX A;  3L3V A;  3HT3 A;  1QSY A;  1FXX A;  3V1O A;  3O4Q A;  1RBS A;  3L2W A;  4EZ6 A;  3SZ2 A;  3S3N A;  1CXQ A;  4KHU A;  2Y1I A;  4CHO A;  3V9Z A;  4MQ3 A;  3L3U A;  1BL3 A;  4DTJ A;  4ELV A;  1BQM A;  3AVA A;  4CGD A;  4E7J A;  2DFH A;  3ZSV A;  1KVB A;  4E7H A;  4IG0 A;  4BE0 A;  4H4M A;  1GOC A;  4DG1 A;  3EZ5 A;  3KD1 E;  1SUQ A;  1RT4 A;  4CIE A;  3ULD A;  2ETJ A;  4GW6 A;  3MAQ A;  2F96 A;  3L2U A;  4ZTJ A;  4FJ9 A;  4KV8 A;  4W5R A;  3PX6 A;  3DOK A;  3WNE A;  4E3S A;  3K5O A;  4DFM A;  4B9M A;  3KTQ A;  3NHG A;  3PUF A;  1XHZ A;  4FVM A;  1SKW A;  4DWI A;  4FJN A;  3SV3 A;  1VSM A;  4FJ7 A;  3C6U A;  3CM6 A;  2HHU A;  4RW6 A;  1NJY A;  1D5A A;  2P51 A;  3VQB A;  2IOC A;  3I8D A;  4OGC A;  1KLN A;  1EKE A;  4DF8 A;  4L8R B;  2D0A A;  4DU3 A;  1JLB A;  1TL3 A;  1WSJ A;  2YNG A;  3DMJ A;  4MFB A;  3AO1 A;  3VQE A;  2XY7 A;  1UOC A;  5EU7 A;  1RCH A;  3VA3 A;  3ZT1 A;  1BCO A;  2IAJ A;  3LP3 A;  3OYH A;  1XC9 A;  1TKX A;  4KFB A;  2P5G A;  2HVI A;  3PO5 A;  1U48 A;  3QNN A;  5SWM A;  3OYM A;  4CEC A;  4FLX A;  3V9U A;  4KTZ A;  1MU2 A;  2XY5 A;  1YTU A;  1HYV A;  4OPK A;  4DQQ A;  4AH9 A;  3V9W A;  1NK4 A;  4KHW A;  1I39 A;  3SUP A;  1WAJ A;  4CJR A;  3TAN A;  4CJE A;  4N56 A;  2O4I A;  3B6P A;  1BGX T;  4CEO A;  1WSH A;  4FLT A;  2IDO A;  4KI6 A;  4CEF A;  4HVJ A;  5I3U A;  4F2R A;  1N6Q A;  4I7F A;  2G8V A;  1X9M A;  1JLG A;  1QQC A;  3K5M A;  2P5O A;  3IS9 A;  3LAN A;  3PX0 A;  1TKZ A;  4JRP A;  4PA1 A;  4FJ5 A;  3NF8 A;  3KLE A;  1XI1 A;  3AO2 A;  3SUO A;  4CE9 A;  5J1E A;  2KTQ A;  3OYK A;  3O4N A;  4LD0 A;  1IH7 A;  3ITH A;  4M41 A;  3AO4 A;  1F21 A;  1RBU A;  4AHS A;  1ZYQ A;  4FJL A;  1C6V A;  1RT5 A;  3OYG A;  3TAE A;  3ZSX A;  4W5Q A;  2RN2 A;  3SQ2 A;  3SUQ A;  4DSI A;  2AJQ A;  1HNV A;  4FM1 A;  1S5J A;  3NBP A;  3HVT A;  3L2V A;  4E89 A;  3VQP A;  4N5S A;  1O1W A;  1LWE A;  4B9S A;  2D5R A;  3H08 A;  4N41 A;  4RG8 A;  4CJ5 A;  4Y1C A;  1ZBU A;  4CK1 A;  3OYE A;  5J2M A;  1UWB A;  1BIU A;  5HLF A;  3OS1 A;  3ZT3 A;  3M8Q A;  4CES A;  3KLG A;  3NCI A;  3JYT A;  1HNI A;  1BI4 B;  1RTI A;  4FM0 A;  1WSE A;  2ZD1 A;  4Z4F A;  3QER A;  4B9V A;  3C94 A;  3VQ9 A;  2IC3 A;  3BGR A;  4DQI A;  1IKY A;  4CGI A;  4FCY A;  1YT3 A;  2X78 A;  4E7I A;  3PO4 A;  3RRG A;  2OA8 A;  3OYL A;  3QEW A;  4E1N A;  4DFJ A;  4QCL A;  3QNO A;  3ALY A;  4OLB A;  3OYI A;  3LAL A;  4OJR A;  1IG9 A;  4DTU A;  1NJX A;  3ZSQ A;  4CFA A;  1KVA A;  4OGE A;  4PUO A;  4NCA A;  5HBM A;  3OYF A;  4CF2 A;  3VQ7 A;  5KRT A;  1S1U A;  1WN7 A;  4O55 A;  4CJW A;  5KGW A;  4FW1 A;  3TAF A;  4B8C A; 
#chains in the Genus database with same CATH topology
 1L3U A;  4EHT A;  2D0O A;  4J2E A;  3O3H A;  1ZC6 A;  1ZBH A;  4ISG A;  4NYF A;  4O0J A;  2Z1G A;  1XC3 A;  4JKG B;  4B8A B;  3BEX A;  4LF5 K;  4I2P A;  3HPH A;  3T1A A;  1TKD A;  3THV A;  3BP8 A;  3CC2 N;  4JI5 K;  1BA1 A;  3HST B;  4BRC A;  2OAN A;  1IKW A;  3QDK A;  3N4Q A;  1BDG A;  4JRQ A;  3BF3 A;  3SQ0 A;  3RMA A;  3QEI A;  3SI6 A;  4IBN A;  4K8Z A;  2G8H A;  5K14 A;  1NGD A;  5AQX A;  4AHR A;  3T3F A;  1Q81 O;  1S6P A;  4CJL A;  2P9K B;  1TK8 A;  1CLQ A;  3KD5 E;  4O0I A;  2NUB A;  4BGB A;  1TVR A;  3KVG A;  1YTA A;  2E88 A;  3CD6 N;  4JKH A;  1B9F A;  3ULE B;  3K0S A;  2VWJ A;  1SAZ A;  1NGJ A;  5BRE A;  1IKX A;  3I56 N;  4H5R A;  4FLV A;  5KPR A;  4ID5 A;  2O8E B;  2V52 B;  3TTD A;  4LFA K;  1SS6 A;  2P9U B;  3THY B;  3WNF A;  1LAW A;  1TYQ A;  1LAV A;  3TTC A;  4KPY A;  2YCH A;  4BRH A;  4XIU A;  4IFE A;  1VSL A;  5JVH L;  3J8A A;  4IOX A;  2HHX A;  5D3G A;  3PV8 A;  2PBD A;  2V7Z A;  2G8U A;  4CIF A;  3F9K A;  3V9S A;  1D9D A;  4CGH A;  2D4W A;  1S1T A;  4CJQ A;  4JK7 A;  4KHS A;  4Q0B A;  4C8O A;  4DV7 K;  5M1N A;  5CZ2 A;  3EKU A;  4J2B A;  3VF6 A;  2VGM A;  1V4T A;  1Z26 A;  4CHZ A;  3VGM A;  2IS3 A;  2OPR A;  1C1A A;  3H45 C;  3ZSO A;  3BDP A;  2OPQ A;  3VTI A;  1KFS A;  2P9S A;  4IWV A;  1BHL A;  4QOZ B;  3HOT A;  1IV0 A;  2YHA A;  4LF6 K;  1WSG A;  1EQY A;  4BR5 A;  2RHK A;  4FWQ A;  4AHV A;  2UYT A;  4ILG B;  3SK3 A;  2O8C B;  3DXM B;  2QWP A;  4DCH A;  3GBT A;  3QES A;  2QK9 A;  4MLE A;  3D2F A;  1XWL A;  3IAY A;  3QIO A;  3CM5 A;  5KTQ A;  3NFA A;  3A5M C;  1JXE A;  3R8E A;  5ADX H;  4BC4 A;  4M3Z A;  4B08 A;  3CJ9 A;  3H3N O;  3VQA A;  4PY5 A;  1HMV A;  1UA0 A;  4LSN A;  3AVM A;  1K73 O;  5C24 A;  1NU0 A;  1TKT A;  3EYZ A;  3R3L A;  1Q86 O;  1T6C A;  3SMP A;  1KCF A;  4X64 K;  2OTL N;  1JJ2 M;  5TKW A;  3V6D A;  1HYZ A;  4H0V B;  1S72 N;  2F7T A;  1D8Y A;  1NGI A;  4E7K A;  4IO8 A;  2UU9 K;  2HND A;  4BC5 A;  2KZZ A;  5HRS A;  3OJS A;  3O4W A;  1NJW A;  1BUP A;  5AQP A;  2W41 A;  3AO5 A;  4Q5V A;  4R5P A;  2KFZ A;  4KO0 A;  1Q7Y O;  3J80 O;  3MMV A;  5SZT A;  1NG9 A;  4ZTF A;  3PY8 A;  1HNX K;  3M1F A;  3UKU A;  3D2E A;  3OS0 A;  4DUY K;  3OYA A;  4M7Y A;  3L4I A;  1ZBL A;  3CQ8 A;  1S1V A;  3SAG A;  4DR4 K;  1HJO A;  2HBL A;  4BVO A;  1J54 A;  1IKV A;  4JK8 A;  1EP4 A;  4DFK A;  1HYS A;  3KJV A;  5T7B A;  3VGK A;  3O3F A;  1GLL O;  2DY4 A;  3TR8 A;  2NNW A;  2PY5 A;  4KHY A;  4DSE A;  1S6Q A;  4WQ4 A;  4BDY A;  1KAY A;  1BU6 O;  2VWK A;  3PIO L;  4FLW A;  3B8A X;  2ZJP L;  4AHT A;  4BDP A;  4K42 A;  1W2B M;  2E4L A;  1BIZ A;  4BC3 A;  3TPQ A;  4I2Q A;  2UUA K;  2Q0U A;  2O8B B;  3O08 A;  3DLH A;  4O44 A;  2JWL A;  4M3W A;  4DUZ K;  4CJV A;  1ATN A;  3P39 A;  2LSN A;  3E01 A;  3ENO A;  3KZB A;  4DSJ A;  3IKM A;  2W6L A;  3AVF A;  1GOA A;  1RDD A;  4PKH A;  1NK0 A;  2E6M A;  4M3T A;  4K43 A;  4DTR A;  4FW2 A;  4BWJ A;  1YF5 L;  1KQS M;  2FBV A;  4LSL A;  1VK0 A;  1RDU A;  3LPT A;  4BRK A;  2UUC K;  5J2Q A;  3FFK B;  2O8F A;  2GBZ A;  4FVU A;  4IOC L;  2HF3 A;  3VEY A;  4L3Q A;  5AQS A;  4CJK A;  2DFE A;  4FO0 A;  4ISF A;  3ZT0 A;  3CME N;  1NJI O;  3OYC A;  1J5O A;  2DTU A;  3NAE A;  3J7Y P;  5AQN A;  3DRS A;  2V51 B;  5KI6 A;  1U49 A;  4BGA A;  4DQS A;  5GIO A;  4FLU A;  2F8S A;  4DTP A;  2Q97 A;  1LWF A;  4ISE A;  3FFI A;  3VEN A;  3VEV A;  1MWM A;  3NGI A;  1FK9 A;  3LAK A;  5CZ1 A;  5DMR A;  5AQJ A;  3VGL A;  3WQT A;  1HKG A;  3DOL A;  3SJJ A;  3SCX A;  1FJG K;  3D2F B;  1QSY A;  4OO1 J;  2ZGY A;  1VQO N;  4YOY A;  3V1O A;  1T6D A;  3K9K A;  4YY3 K;  4CHO A;  3L3U A;  1BL3 A;  5FLX O;  3AVA A;  3QB0 A;  3ZSV A;  3PSI A;  3VEZ A;  2HHH K;  3ENH A;  4M7X A;  4DG1 A;  5KPT A;  1U6Z A;  1RT4 A;  3ULD A;  4GW6 A;  2DPN A;  3IFR A;  3CCV N;  4FJ9 A;  3DOK A;  4YOU A;  3WNE A;  2VQE K;  1X3M A;  5FPN A;  4A5B A;  4FSV A;  3C6U A;  4PL7 A;  3VQB A;  3I8D A;  5C15 A;  1KLN A;  4IEE A;  3BZC A;  1WSJ A;  2XY7 A;  5M1Q A;  1RCH A;  3VA3 A;  1WBD A;  4XH4 A;  3LP3 A;  3F9M A;  3GE1 A;  1TKX A;  2P5G A;  5C2F A;  3BUZ B;  3V9U A;  2KLA A;  1MU2 A;  1ZBS A;  1HYV A;  4WQ4 C;  3V9W A;  4KHW A;  1I39 A;  1KAX A;  3CQX A;  1GLA G;  3I33 A;  3PIP L;  5I9E B;  1VHX A;  2IDO A;  1NGF A;  4CEF A;  2VYP A;  3G71 N;  3O6W A;  4I7F A;  4B1W B;  1ATS A;  1JLG A;  1QQC A;  3O9T A;  4DV0 K;  1Y64 A;  4DV4 K;  4M41 A;  3ZEU B;  2HVI A;  1F21 A;  3HBT A;  1ZYQ A;  1X9J A;  3SUQ A;  3TAE A;  1HX1 A;  3HRG A;  3SJH A;  1S5J A;  3HVT A;  3L2V A;  2FSJ A;  1WUA A;  4JI8 K;  2ASM A;  4YDU A;  2A6A A;  5J2M A;  3OS1 A;  4JKB A;  5FPE A;  1XNQ K;  2ZD1 A;  4B9V A;  2QWO A;  5IWA K;  4CGI A;  4FCY A;  1YT3 A;  2BH1 A;  4BC2 A;  2VGN A;  3OYI A;  4OJR A;  4DTU A;  1NJX A;  5AQU A;  5C10 A;  5FPM A;  4NCA A;  5HBM A;  3VER A;  4MDB A;  4CF2 A;  4B3S K;  4O55 A;  5FDL A;  4A62 A;  1S3X A;  3U6F A;  4Z4C A;  1NNE A;  3VQC A;  4E0D A;  4FWS A;  3LWM A;  2RPI A;  1K8K B;  1KAZ A;  3RSE A;  1QTM A;  4BDZ A;  1FKP A;  5FPD A;  3J7A P;  1B92 A;  2NRZ A;  3LPU A;  5F1X A;  2E5L K;  4WFB L;  4BE1 A;  4NLB A;  1T7P A;  4MDA A;  2E2N A;  4B9Q A;  1ASW A;  5EXW A;  4YOV A;  5LJW A;  1EO1 A;  1U04 A;  3CC7 N;  5A2Q O;  3AVI A;  3CFR A;  3E9O A;  3THX B;  2NRV A;  4GV6 A;  2QI2 A;  1RNH A;  1QS4 A;  3DXK A;  2HNY A;  4BR2 A;  1YXQ A;  5EY4 A;  3TU5 A;  2F9T A;  3GL1 A;  4LH4 A;  4LF8 K;  3TSU A;  3KLF A;  4R79 A;  1SL0 A;  1ITG A;  1KD1 O;  1RBR A;  2X74 A;  1RTH A;  4BQZ A;  4CHP A;  4DR6 K;  4DV1 K;  1NGG A;  5HP1 A;  2YJF A;  4HTU A;  3U9D A;  2Q3S A;  5H1S Q;  1NOY A;  4FLZ A;  3EEQ A;  4JNE A;  4FLY A;  1ZBI A;  1Z6R A;  1TK0 A;  4BR4 A;  1GLE G;  1NK9 A;  3AVJ A;  5CR4 A;  3BY5 A;  3VEW A;  4BE2 A;  1OH5 A;  1N5Y A;  3L2R A;  3EY1 A;  2OTJ N;  3M3Z A;  1REV A;  3RVC A;  3W3D A;  1XNR K;  5BPN A;  3VMF B;  1YIJ N;  2ZE2 A;  3ATU A;  3O1W A;  3MXJ A;  4GVM A;  2QXL A;  3AVN A;  2Y1J A;  1JLC A;  3C95 A;  1RTD A;  3VQ6 A;  3CCU N;  1GLJ O;  3LM9 A;  1CXU A;  4CGF A;  3MK6 A;  4KB0 A;  3LP0 A;  4KTW A;  4KRE A;  4LFC K;  1KC8 O;  2HBM A;  1HQE A;  5KQ8 A;  1C0M A;  2YX6 A;  3AA3 A;  3GDQ A;  2UXC K;  3DLR A;  1VRT A;  1BWF O;  4Z4H A;  5GIN A;  4NXN K;  3RRH A;  3LAM A;  4DQR A;  1YJ9 N;  5JLF A;  3D0P A;  4PQU A;  1RTJ A;  3BF1 A;  3A8Y A;  3K9J A;  2A5X A;  4CEQ A;  2HHW A;  2XY8 A;  3L8B A;  2VG5 A;  4YDU C;  3C0B A;  5AZJ A;  1NGA A;  4AHC A;  1I3A A;  4DV3 K;  1CZB A;  3NF7 A;  4FWR A;  4DSL A;  3U9Z A;  3DRP A;  1XUP O;  4CZK A;  1VQ6 N;  3EZW A;  4CF8 A;  1VSJ A;  3EKS A;  3MDQ A;  3O9U A;  2P1J A;  2Z1J A;  3NH0 A;  3H1Q A;  1S1X A;  2ATQ A;  2P9P A;  1OH8 A;  1SKR A;  2BUP A;  1TAQ A;  3AA2 A;  4GV3 A;  1TUU A;  1YVU A;  4BRD A;  4NB4 A;  4AM6 A;  2QW9 A;  3KLI A;  1N33 K;  3C7N B;  1RT1 A;  3O1B A;  4CHN A;  1NOZ A;  3H6E A;  3OHR A;  3OJU A;  2HVH A;  2FSN A;  3WEE A;  4DR2 K;  3KKR A;  1RBV A;  3RMC A;  3QBX A;  4CZE A;  1NGE A;  4H0T B;  1NKB A;  3JSM A;  4BRL A;  4RTF D;  5TKY A;  5LMN K;  2G8I A;  1DGK N;  3JS6 A;  2E1Z A;  4FK2 A;  2FBT A;  5DM7 L;  4RW9 A;  3LDL A;  1T8E A;  2P9N B;  3NGY A;  4ELU A;  2P9I A;  4CJP A;  3QIN A;  2EWS A;  5AR0 A;  1ZXO A;  3TAP A;  4DF4 A;  4JI2 K;  3SPZ A;  3R9P A;  2A41 A;  5HRR A;  1LW0 A;  2ZJQ L;  4JI6 K;  3P1G A;  4K8X A;  3J81 O;  2FBY A;  3SAH A;  1W97 L;  5BPM A;  1JLF A;  2KZM A;  1RFQ A;  2YHY A;  1R0A A;  4F8R A;  1NJZ A;  1B9D A;  1Q9X A;  1T05 A;  2QTD A;  3LDP A;  4XH5 A;  4F3T A;  1ASU A;  4IDH A;  3SMS A;  4JS5 A;  3TAG A;  3NVM A;  3TTF A;  4C8M A;  3KLH A;  2JLE A;  3V9X A;  5C0Y A;  5JS2 A;  4FXD A;  1FKO A;  4KH6 A;  4RW8 A;  1WNS A;  4CER A;  1VQP N;  1MDU B;  1IBK K;  5AQK A;  3AVB A;  3QO9 A;  4DQ8 A;  1C0G A;  1SL2 A;  3O80 A;  2HNZ A;  2E6L A;  3DLK A;  3MCA B;  3MXI A;  2JGU A;  1TUY A;  1VRU A;  3VPZ A;  3NGZ A;  3K5N A;  1QHA A;  4AIL C;  4BR0 A;  3HYF A;  5BN8 A;  2YHW A;  4CD1 A;  5BPL A;  1L3S A;  1VQ4 N;  4DV6 K;  1M90 O;  3QIC A;  3OBW A;  3HZ6 A;  1Q8I A;  3S9H A;  4H8K A;  4LF9 K;  2B6A A;  2WOM A;  3O8M A;  3D45 A;  3ZX3 A;  1WSI A;  5HOO A;  2BGG A;  4RW4 A;  2GEL A;  1XMO K;  4C8K A;  1J53 A;  3RR8 A;  3HI0 A;  3Q7B A;  3NH1 A;  2XY6 A;  4F2S A;  4FJK A;  4JD2 B;  3E66 A;  1QVG M;  1S9G A;  3C6A A;  4NLC A;  5BRD A;  4TSX A;  1JCE A;  3F73 A;  1VAZ A;  1MWK A;  5J2P A;  3MN9 A;  3ASM A;  5M1O A;  5CE3 A;  3UB5 A;  3CER A;  2OZM A;  2QWN A;  1CZA N;  5AZJ B;  3C65 A;  4DU4 A;  3IG1 A;  1BCM A;  3DLE A;  4FWP A;  5EVZ A;  4CJ7 A;  3MN7 A;  5EX5 A;  3QEX A;  3ID8 A;  1WB9 A;  2HBK A;  3WUH A;  2IVP A;  4PHT X;  2FF3 B;  1BQM A;  2DFH A;  2P9P B;  1KVB A;  4E7H A;  1OVY A;  4BE0 A;  2ITM A;  4OPA A;  1GOC A;  1GLC G;  4OPH A;  2NRH A;  3KD1 E;  4YOW A;  2ETJ A;  3MAQ A;  4A5A A;  4W5R A;  1K9M O;  3K5O A;  4FOI A;  4B9M A;  3E1Y A;  3KTQ A;  3NHG A;  4IOA L;  3PUF A;  3PSF A;  1SZ2 A;  1HNW K;  2HHU A;  2IOC A;  4OGC A;  2ASO A;  2D0A A;  4DU3 A;  1JLB A;  1TL3 A;  4MFB A;  1UOC A;  3VF4 A;  3ENB A;  2CGL A;  3ZT1 A;  3H1V X;  1XMQ K;  1IBM K;  3EL2 A;  1U48 A;  5SWM A;  3MWP A;  3CIP A;  4CEC A;  4FLX A;  4KTZ A;  2XY5 A;  4OPK A;  4DQQ A;  4AH9 A;  1WAJ A;  4CJE A;  3B6P A;  1BG3 A;  1TYQ B;  3FZK A;  4CEO A;  4KI6 A;  4IXC A;  1X9M A;  3A5N C;  2I7N A;  3UKR A;  1TKZ A;  5KPZ A;  4FJ5 A;  1LCU A;  3NF8 A;  1XI1 A;  3FZL A;  4CE9 A;  3OYK A;  4JN4 A;  1IH7 A;  1ESV A;  4JKE A;  4AHS A;  2HHT A;  1C6V A;  1RT5 A;  2CH5 A;  4DSI A;  5GIP A;  2RN2 A;  4W5Q A;  3SQ2 A;  3GOI A;  2O8D A;  4FM1 A;  3NBP A;  1P8Z A;  2ASP A;  3THW A;  1LWE A;  4IO9 L;  4KHP K;  2D5R A;  3H08 A;  4N41 A;  4RG8 A;  4CBX A;  3JAM O;  4F9O A;  3C6H A;  4AF1 A;  5F0X A;  1BIU A;  4U67 L;  3NCI A;  4BRG A;  3JYT A;  4K41 A;  4DKW A;  1WSE A;  4A2A A;  4Z4F A;  3C94 A;  4JKC A;  3J7Z O;  4DQI A;  2D0P A;  3FLC O;  2OA8 A;  4E1N A;  2E2O A;  4X62 K;  3ZSQ A;  4CFA A;  4OGE A;  1T44 A;  5DM6 L;  3EE9 A;  3VQ7 A;  2P9S B;  3TAF A;  2YNI A;  1N34 K;  3D6R A;  2KW4 A;  4EIA A;  1C0T A;  3QET A;  1JLQ A;  4B3O A;  1WAF A;  1TV6 A;  1VQM N;  4DSF A;  3HM9 A;  4M63 C;  3PLA A;  2RE2 A;  4JI0 K;  4I9L A;  1BO5 O;  3OS2 A;  3A5L C;  2W40 A;  2HMP A;  4BRI A;  1WLJ A;  4KH5 A;  5FRO A;  4BQL A;  4FJ8 A;  2I7P A;  4FWL A;  5DK5 A;  2IIR A;  4FWO A;  1A5V A;  3P5J A;  1N36 K;  1C0U A;  2WON A;  4BAC A;  1RDW X;  2GUI A;  2QWL A;  2XRI A;  3EO3 A;  2YKM A;  3G10 A;  1ASV A;  4KI4 A;  5J2N A;  3Q7C A;  3DLG A;  1HUX A;  1NGH A;  4KAZ A;  4HUG A;  4KRF A;  2QKB A;  3KWG A;  1SQK A;  3DI6 A;  4FZZ A;  1U2V A;  5E26 A;  4E7L A;  1DLO A;  5C42 A;  1C1B A;  1N8R O;  1IG8 A;  2NRR A;  3R1X A;  2YKN A;  4GMJ B;  4BR9 A;  3KWI A;  4JHD A;  4CJ3 A;  3LP2 A;  1E4F T;  3AY9 A;  3TI0 A;  2QEX N;  4E19 A;  2UUB K;  4EP4 A;  2RF2 A;  3CJ1 A;  1HKB A;  2F9W A;  1NBW A;  4EFH A;  5E84 A;  3VQQ A;  2G8K A;  3HO1 A;  1E4G T;  2FBX A;  4Z4E A;  3RWU A;  1ATR A;  3HSC A;  3FGU A;  4HHT A;  2YHB A;  1NWK A;  3M8R A;  1XHX A;  3MED A;  4CFC A;  3UKU B;  3D2E B;  2CH6 A;  2Q2R A;  1ILY A;  3SPY A;  4ELT A;  3CCR N;  3DWL A;  2YV0 X;  4CIG A;  4OX9 K;  3VES A;  1BIS A;  4CHY A;  1RT2 A;  4AQY K;  1RDB A;  3LL3 A;  3WNG A;  1BQN A;  3ZT2 A;  1TK5 A;  3LZJ A;  4PWD A;  4QAG A;  1IJJ A;  5B8H A;  3UIQ A;  3CF5 L;  1NGC A;  1JXB A;  1NK5 A;  4G9Z A;  3UE5 A;  5BRH A;  3LDS A;  3A2F A;  4DSK A;  1HRH A;  1TGO A;  5HL7 L;  1KRP A;  1HPM A;  3FE1 A;  3SBG A;  5AQI A;  1Z25 A;  3AVL A;  3EN9 A;  4O5F A;  4JKG A;  1RGI A;  3C6T A;  3HK2 A;  3NH2 A;  2FLO A;  4F4K A;  3SUN A;  2D0C A;  5AQV A;  4CCH A;  4JKD A;  5KRS A;  4HUE A;  2FC0 A;  2A1S A;  5I42 A;  2KHO A;  1RT6 A;  3OBY A;  3MXM A;  1P90 A;  3CCE N;  4JS4 A;  3OY9 A;  4C8L A;  2BTF A;  4NCG A;  3TAB A;  3QIP A;  4CEE A;  3AVH A;  3K58 A;  4C8N A;  2VG7 A;  4WQ5 A;  4OKE A;  5CY4 A;  1W0H A;  3ULE A;  1R59 O;  4H0X B;  4OVL A;  1UAX A;  4DLG A;  1W7A A;  1FW6 A;  1VQ8 N;  3OVN A;  1S9E A;  5AQL A;  2O8F B;  3MCP A;  1SKS A;  1VSE A;  3I0S A;  4ID1 A;  3OYB A;  3CPE A;  2Q1N A;  4A57 A;  1JCF A;  4N47 A;  2WBN A;  2B4J A;  4I6M A;  4IJN A;  4AHU A;  4CVN E;  3THY A;  2A1R A;  1DKG D;  3LP1 A;  3WXM B;  4HTL A;  4KKO A;  4GKK K;  3VF2 A;  3ID6 A;  4BRF A;  1RT7 A;  2WC9 A;  1VSI A;  4CHQ A;  1VQ5 N;  1JLE A;  3ZSW A;  1KXP A;  4B1Y B;  1ZBF A;  3S3M A;  2D0B A;  4KBO A;  2H3G X;  4YFU A;  4DR5 K;  3VA0 A;  2X6S A;  4CJF A;  3HOS A;  1D4X A;  4CJS A;  3MEE A;  5F2R A;  2HF4 A;  3P83 D;  3MEC A;  3ZET A;  3VN5 A;  3LDO A;  4Z4G A;  3HP9 A;  2PYL A;  4IFV A;  3B6O A;  1SL1 A;  3HL8 A;  1OH6 A;  3HP6 A;  4CF0 A;  1BOT O;  2X6N A;  4B9T A;  3U3Y A;  4C23 A;  3K5L A;  3FR0 A;  1DT9 A;  3K59 A;  3V81 A;  2NZT A;  5C2D A;  3NE6 A;  3OW2 M;  3MN5 A;  3NF6 A;  2G8W A;  4OPJ A;  4DLE A;  4FJJ A;  1U45 A;  5M1K A;  2ITG A;  4CFD A;  2R7Y A;  4JI3 K;  4FYD A;  1L3T A;  1L5U A;  3IDH A;  4H5T A;  3CCL N;  5AQT A;  3MEG A;  4QS8 A;  3RMD A;  4GV9 A;  2GEM A;  3PX4 A;  1VSK A;  3OYD A;  3P31 A;  5AQW A;  3K2P A;  1LWC A;  4JHD B;  2O8C A;  3DXM A;  4EHU A;  3TAQ A;  4NYN A;  1T03 A;  3QML A;  1NK6 A;  2FXU A;  4FL9 A;  4CED A;  1QQM A;  1JL1 A;  1NLV A;  4W5N A;  2VG6 A;  4LH5 A;  4DHY A;  4EAH D;  2D1K A;  4DU1 A;  2IVO A;  2HB5 A;  3DLB A;  5CYQ A;  4JLH A;  3JXU A;  2Q36 A;  5AQH A;  4CFB A;  4CI6 A;  2XO7 A;  4KHN A;  2PYJ A;  2VWB A;  1NM1 A;  2FSK A;  4X65 K;  1WSF A;  4NO7 A;  2GWK A;  1YHQ N;  4YHH K;  1HPZ A;  4CZM A;  2F4V K;  2KQ2 A;  1EX4 A;  4DR3 K;  5AQY A;  1G99 A;  4DB3 A;  2ZF5 O;  4M3Y A;  2ZWH A;  4Y1D A;  4DS4 A;  3ZCM A;  3WXI A;  3QEP A;  3VQ8 A;  1NKC A;  2FF6 A;  3AGR A;  4FOE A;  3T1H K;  2ZJR L;  3WXL A;  1X1P A;  4DTO A;  2YNH A;  2E2P A;  4CJT A;  3M5R A;  4UQG A;  3ZSY A;  3MX2 A;  1J6Z A;  1VSH A;  4CF9 A;  4FWK A;  1X3N A;  1RT3 A;  3F2K A;  1RIL A;  4B1V A;  4DR1 K;  3VTH A;  4CEB A;  4K0K K;  3KIO A;  2GUP A;  4CZF A;  4H4O A;  4WQ5 C;  1XQS C;  4DTX A;  4FM2 A;  1BA0 A;  2KKZ A;  4I9Q A;  3TAR A;  4FJM A;  4FZX C;  1NK7 A;  3CJB A;  3G6E N;  3L3V A;  4H03 B;  1QQN A;  2HOE A;  1RBS A;  3S3N A;  4KHU A;  5LJV A;  1VQL N;  1QVF M;  4DTJ A;  4ELV A;  1NMD A;  1VQ7 N;  5BR9 A;  4IG0 A;  1C0F A;  4PKG A;  2QWM A;  3RSE B;  5IT9 O;  4CIE A;  2F96 A;  3L2U A;  4KV8 A;  4E3S A;  2O8B A;  4FVM A;  1SKW A;  4DWI A;  2PAV A;  3SV3 A;  1VSM A;  4I6M B;  4FJ7 A;  1NJY A;  4C1N K;  5AQO A;  4PKI A;  3TSQ A;  4BRO A;  1EKE A;  3AAQ A;  4L8R B;  2V7Y A;  3DXK B;  2VQF K;  3KK7 A;  3DMJ A;  1YUW A;  3AO1 A;  3VQE A;  2IAJ A;  3OYH A;  1OH7 A;  3KHY A;  1XC9 A;  4KFB A;  1J5E K;  5GAD P;  3QNN A;  4BRM A;  1VQN N;  4QS9 A;  2AA4 A;  2GX9 A;  3U8X A;  1YTU A;  4WFN L;  3SUP A;  4CJR A;  1HNZ K;  4N56 A;  2O4I A;  1BGX T;  1WSH A;  4FLT A;  1IBL K;  3W0L A;  5AQM A;  4B3T K;  1YJN N;  3CCQ N;  4GY2 B;  4HVJ A;  1N6Q A;  1Z05 A;  1WOQ A;  3IS9 A;  3PX0 A;  4UY8 O;  3LDN A;  4JRP A;  4PA1 A;  4JI4 K;  3ZET B;  4BRQ A;  3AO2 A;  3SUO A;  2YI1 A;  2KTQ A;  5J1E A;  4LD0 A;  3ITH A;  3AO4 A;  4FJL A;  2AJQ A;  1HNV A;  1O1W A;  4B9S A;  4ILH A;  5M1F A;  3OTO K;  1UWB A;  4CES A;  5GAE P;  4RCH A;  5AZI A;  2HST A;  3A0I X;  3FZM A;  3ZYY X;  4B1X B;  4CBU A;  2CGK A;  3QER A;  5ELZ A;  3BGR A;  1IKY A;  4JEP A;  4J8F A;  5AFU A;  4E7I A;  3PO4 A;  3OYL A;  2HBJ A;  4QCL A;  3QNO A;  3CET A;  4OLB A;  5JLH A;  3CMA N;  4FWM A;  4BRA A;  2ZM6 K;  3WT0 A;  4Y0W A;  5JMV A;  5KRT A;  1WN7 A;  5KGW A;  4FW1 A;  4B8C A;  4WCE L;  2F8T A;  4DS5 A;  3AA4 A;  3KK3 A;  4IDK A;  1HKC A;  1QQO A;  2NRX A;  2YJE A;  4Z94 A;  3G4S N;  4BG9 A;  3DJC A;  5FRN A;  1Y97 A;  4PL8 A;  4BWM A;  1JKH A;  3ZX2 A;  2ZQB A;  3ZLJ A;  5C25 A;  4Z4I A;  4DTN A;  3AVK A;  3IRX A;  4J2A A;  3LDQ A;  4FK0 A;  4M3U A;  1CZ9 A;  3OYN A;  1A5W A;  4O4G A;  3CG7 A;  1GLB G;  1QSS A;  3V1Q A;  1RBT A;  3HM8 A;  1OKJ A;  4IJA A;  3G25 A;  2QKK A;  1U4B A;  3CJC A;  3OYJ A;  1X9S A;  2BDP A;  1LOT B;  1RDC A;  4FJH A;  3RMB A;  3DM2 A;  4DTM A;  3NMU A;  4CZL A;  1KSP A;  3ZT4 A;  1M1K O;  4WF9 L;  2Z1H A;  4WFA L;  2NRT A;  3S3O A;  4XEI A;  2IGI A;  2NRW A;  4MLH A;  1QSL A;  4LY7 A;  3P4I A;  1LV5 A;  1EWQ A;  4H5V A;  1J9A A;  3CYM A;  3AVG A;  4H0Y B;  3WEE B;  1YI2 N;  4W5O A;  5LMU K;  1D9F A;  4CK3 A;  5AQG A;  3SBT A;  4KHQ A;  5HRN A;  2PFU A;  2OYQ A;  3ZEU A;  1NK8 A;  4NXM K;  4CD3 A;  5MLC Q;  2EX3 A;  4BY9 C;  5AQQ A;  1EXQ A;  2QM1 A;  2WUS A;  3KK1 A;  1IO2 A;  3VET A;  3VOV A;  4CZG A;  4KB1 A;  4BRP A;  2P9I B;  4CJU A;  1TAU A;  4X66 K;  3I0R A;  1DEJ A;  1NGB A;  2EHG A;  2Z1I A;  4HCB A;  4GNI A;  3CCM N;  1KFD A;  1Q82 O;  4CJ4 A;  5GAH P;  2GV9 A;  2RKI A;  4YNQ A;  4Z0U A;  3AV9 A;  4O8U A;  2W6K A;  3ISN C;  4RW7 A;  3MX5 A;  3ATV A;  2NLX A;  2E1Y A;  5BRF A;  3M8S A;  4E1J A;  5FRM A;  4FJX A;  3AAP A;  3P38 A;  1Q9Y A;  5KQD A;  2UXD K;  5JS1 A;  2YHX A;  1SV5 A;  3SQ1 A;  1TL1 A;  5HRP A;  3CC4 N;  1E3M A;  3CCS N;  3L4Q A;  1VSF A;  1K8K A;  2AP1 A;  4M42 A;  3O9R A;  3AO3 A;  2I5J A;  3WNH A;  4B9U A;  4V19 S;  1OVQ A;  5KGX A;  2GTD A;  4ZHR A;  5C12 A;  3DAW A;  1L3V A;  4B1Z A;  2E2Q A;  1DTT A;  1G15 A;  4B9L A;  2PZS A;  3V4I A;  3VQD A;  5ADX A;  5CYM A;  3V1R A;  3U3G A;  4BRN A;  4FM0 A;  2VCP A;  4H5W A;  3SV4 A;  4H5N A;  3THX A;  4M45 A;  1T3V A;  4H0O A;  3G0Z A;  5JIC A;  3F5T A;  1QHT A;  5E41 A;  3N4P A;  4OKJ A;  4WYB A;  3EE8 A;  5AZI B;  4F3O A;  3SYZ A;  1U47 A;  4KTQ A;  2O4G A;  4DQP A;  2HMI A;  4ICL A;  1NKE A;  2DFF A;  3T19 A;  3HVR A;  1GLF O;  2UXB K;  4KH4 A;  1K6Y A;  3NF9 A;  2G8F A;  5AJ3 K;  1LW2 A;  4IFY A;  2ZGZ A;  1QZ6 A;  2B5J A;  2OPP A;  4HCC A;  1Q18 A;  1RDA A;  4BVP A;  1QZ5 A;  3O3G A;  2P9L A;  3QEV A;  5EOY A;  3T69 A;  4H0P A;  4WE1 A;  3SAF A;  3TAM A;  4BRE A;  4DFP A;  2OZS A;  4B3M K;  3S41 A;  3HPG A;  4OKK A;  3TWH A;  3ZSZ A;  5LL6 Z;  3DYA A;  4FK4 A;  2KFN A;  3T7Z A;  2W42 A;  4FZY A;  4J2D A;  1A5X A;  4B9N A;  3AVC A;  4O8K A;  3CI5 A;  4YOR A;  2HHQ A;  3QFP A;  1MA9 B;  3QLH A;  3H46 O;  1DTQ A;  1UA1 A;  4FPB A;  3IUC A;  1BI4 A;  3CJA A;  3SNN A;  3K57 A;  1JLA A;  2HW3 A;  3VQ4 A;  1KVC A;  5BR8 K;  1HLU A;  2E20 A;  4JKA A;  5AQF A;  5HRO A;  2WTU A;  1S1W A;  3AAR A;  1QE1 A;  2BE2 A;  3ZX0 A;  4AM7 A;  4RWT A;  3LZI A;  1S22 A;  4N76 A;  5LY3 A;  1VQK N;  3DLL L;  1WBB A;  4A61 A;  3NDK A;  2BAN A;  2IVN A;  3BZK A;  2QWR A;  4CK2 A;  4M3X A;  4W5T A;  3CFP A;  3HJF A;  4A59 A;  1X9W A;  2YNF A;  4E1M A;  5GAG P;  4QS7 A;  2HHS A;  4G1Q A;  2Q31 A;  4B3R K;  4CEZ A;  4LFB K;  1KLM A;  3AA5 X;  4GKJ K;  1O13 A;  4EZ9 A;  4YOT A;  3LM2 A;  4EP5 A;  2A3Z A;  1W9H A;  2QXF A;  4JAX A;  1KTQ A;  2XHB A;  3UKR B;  3C7N A;  4HWI A;  1H1V A;  1EWR A;  3O9S A;  4CF1 A;  4O5B A;  1N32 K;  4CGJ A;  4CZI A;  1JL2 A;  2P9K A;  2HHV A;  1V4S A;  3VEX A;  2O8D B;  5CHI A;  3L2Q A;  3FZF A;  4IG3 A;  1I94 K;  4HUF A;  3THW B;  4CGG A;  3KK2 A;  4DV5 K;  3M8P A;  3DRR A;  3E9L A;  2QWQ A;  1HQU A;  1C1C A;  4ILJ A;  1VSD A;  4CBW A;  3LWL A;  3CQY A;  4C1N I;  4NCB A;  3T1Y K;  2O8E A;  4FJI A;  4OLA A;  3WXK A;  1GOB A;  3NVK A;  3TSP A;  4DTS A;  3HPO A;  4BG8 A;  4DR7 K;  4IKF A;  3VQ5 A;  5BN9 A;  2CGJ A;  3HXM A;  4JK9 A;  3WQU A;  2P9U A;  4FJG A;  3D7E O;  4DMN A;  3ZSR A;  3KKS A;  3QBW A;  5AQR A;  4B1U B;  2P9N A;  3CFO A;  4M3R A;  2OPS A;  1VQ9 N;  3CCJ N;  3SQ4 A;  1HR0 K;  3GG4 A;  3RTV A;  5AQZ A;  1EET A;  1HJR A;  4CEA A;  2QA4 N;  1NMN A;  3RR7 A;  3SLC A;  3HT3 A;  1FXX A;  3O4Q A;  3L2W A;  4EZ6 A;  3SZ2 A;  1CXQ A;  2Y1I A;  3V9Z A;  4MQ3 A;  4CGD A;  1YAG A;  3CXC M;  4E7J A;  3MWT A;  3L0Q A;  3M6G A;  4H4M A;  2A40 A;  4K25 A;  3EZ5 A;  1SUQ A;  2Q0R A;  3CHW A;  4ZTJ A;  3PX6 A;  3I55 N;  5M1P A;  3CPW M;  4IEI A;  4DFM A;  4JI1 K;  1YJW N;  1XHZ A;  4MO4 A;  3CJ7 A;  4FJN A;  5JVG L;  3CM6 A;  4RW6 A;  1D5A A;  2P51 A;  2A42 A;  3VEO A;  3L6Q A;  4DF8 A;  4DV2 K;  3E9P A;  4FWN A;  4LC9 B;  2YNG A;  5EU7 A;  2JWK A;  1BCO A;  3QFU A;  3O5B A;  1U2V B;  3PO5 A;  3OYM A;  1K8A O;  2P9L B;  4LF7 K;  3OA9 A;  2OCE A;  4JKF A;  1NK4 A;  3MN6 A;  3TAN A;  3IMX A;  4LF4 K;  3HTV A;  5I3U A;  4F2R A;  2G8V A;  4IZ9 A;  3K5M A;  1YVN A;  2P5O A;  4JYA K;  3I8B A;  3LAN A;  4GVE A;  3KLE A;  3A5O C;  3O4N A;  2WFB A;  1RBU A;  3OYG A;  3ZSX A;  4YOX A;  4CZH A;  1GLD G;  4E89 A;  3VQP A;  4N5S A;  3O9Q A;  4JD2 A;  4CZJ A;  4CJ5 A;  4FPA A;  4Y1C A;  1ZBU A;  4CK1 A;  3OYE A;  4JV5 K;  5HLF A;  3KLG A;  3ZT3 A;  3M8Q A;  1HNI A;  1BI4 B;  1RTI A;  2GWJ A;  4MO5 A;  3FZH A;  3VQ9 A;  2E8A A;  2IC3 A;  1YIT N;  5AFU H;  2J4R A;  2X78 A;  3RRG A;  3QEW A;  4DFJ A;  3ALY A;  3LAL A;  1IG9 A;  3H3O B;  4JI7 K;  4CW7 B;  1KVA A;  4PUO A;  3AGK A;  3WXJ A;  4XH1 A;  3OYF A;  4BR7 A;  1S1U A;  4A2B A;  1JCG A;  4CJW A;  4U7B A;  3U4L A;  3R6M A; 
#chains in the Genus database with same CATH homology
 1L3U A;  2YNI A;  4J2E A;  2F8T A;  2KW4 A;  4DS5 A;  3O3H A;  3AA4 A;  1ZBH A;  1C0T A;  4NYF A;  3KK3 A;  1JLQ A;  3QET A;  4B3O A;  4IDK A;  1WAF A;  1TV6 A;  4O0J A;  4Z4C A;  3HM9 A;  4DSF A;  3VQC A;  3U6F A;  4E0D A;  2Z1G A;  4I9L A;  4B8A B;  3LWM A;  3OS2 A;  4I2P A;  5FRN A;  1Y97 A;  3HPH A;  4BWM A;  1JKH A;  3T1A A;  1TKD A;  1WLJ A;  2ZQB A;  4BDP A;  3THV A;  5C25 A;  2RPI A;  4Z4I A;  5FRO A;  1QTM A;  4DTN A;  3AVK A;  1FKP A;  4BDZ A;  3IRX A;  1B92 A;  3HST B;  4J2A A;  4FJ8 A;  1IKW A;  4FK0 A;  4M3U A;  1CZ9 A;  3OYN A;  1A5W A;  4O4G A;  5DK5 A;  4JRQ A;  3CG7 A;  3SQ0 A;  3RMA A;  1A5V A;  3QEI A;  3LPU A;  3P5J A;  4IBN A;  3SI6 A;  1QSS A;  3V1Q A;  1C0U A;  4K8Z A;  2G8H A;  1RBT A;  5K14 A;  2WON A;  4BAC A;  4AHR A;  4BE1 A;  1T7P A;  2GUI A;  2XRI A;  3T3F A;  1S6P A;  1ASW A;  4CJL A;  1TK8 A;  1U4B A;  3OYJ A;  2QKK A;  1X9S A;  3KD5 E;  1CLQ A;  4O0I A;  2BDP A;  1U04 A;  2NUB A;  2YKM A;  1RDC A;  3G10 A;  1ASV A;  4FJH A;  1TVR A;  3AVI A;  1YTA A;  3CFR A;  5J2N A;  4KI4 A;  1RNH A;  1QS4 A;  3DLG A;  3RMB A;  1B9F A;  3DM2 A;  2VWJ A;  4DTM A;  2HNY A;  4KAZ A;  1KSP A;  3ZT4 A;  4HUG A;  4KRF A;  1IKX A;  2Z1H A;  2QKB A;  3DI6 A;  4FZZ A;  4LH4 A;  3S3O A;  4FLV A;  4ID5 A;  2IGI A;  4E7L A;  3KLF A;  1DLO A;  5C42 A;  1SL0 A;  1ITG A;  1C1B A;  4LY7 A;  1LV5 A;  1QSL A;  1RBR A;  2YKN A;  2X74 A;  1RTH A;  4GMJ B;  4CJ3 A;  4CHP A;  3LP2 A;  3TI0 A;  4E19 A;  5HP1 A;  1J9A A;  3CYM A;  3AVG A;  1LAW A;  3WNF A;  1LAV A;  4EP4 A;  4HTU A;  2RF2 A;  2Q3S A;  4W5O A;  1NOY A;  4KPY A;  4FLZ A;  4FLY A;  1D9F A;  4CK3 A;  4XIU A;  3VQQ A;  1ZBI A;  1TK0 A;  2G8K A;  3HO1 A;  4KHQ A;  5HRN A;  2FBX A;  1NK9 A;  4Z4E A;  1VSL A;  3AVJ A;  3RWU A;  2HHX A;  5D3G A;  4HHT A;  4BE2 A;  2YHB A;  3M8R A;  1N5Y A;  2OYQ A;  1XHX A;  3MED A;  3L2R A;  3EY1 A;  4CFC A;  1NK8 A;  3PV8 A;  2EX3 A;  2G8U A;  4CIF A;  1EXQ A;  1REV A;  3F9K A;  3V9S A;  1D9D A;  4CGH A;  3SPY A;  1S1T A;  4CJQ A;  4ELT A;  3KK1 A;  2ZE2 A;  1IO2 A;  4KHS A;  4KB1 A;  2YV0 X;  4CIG A;  3MXJ A;  4Q0B A;  4GVM A;  4C8O A;  4CJU A;  3AVN A;  5CZ2 A;  2Y1J A;  1TAU A;  1JLC A;  3C95 A;  1RTD A;  3VQ6 A;  1BIS A;  4CHY A;  1RT2 A;  3I0R A;  1CXU A;  1RDB A;  4CGF A;  4J2B A;  2EHG A;  2Z1I A;  4HCB A;  3WNG A;  1BQN A;  3ZT2 A;  4KB0 A;  3LP0 A;  4KTW A;  1TK5 A;  3LZJ A;  4PWD A;  1KFD A;  4QAG A;  4KRE A;  4CJ4 A;  2GV9 A;  2RKI A;  4YNQ A;  4Z0U A;  1HQE A;  1Z26 A;  4CHZ A;  2IS3 A;  2OPR A;  3AV9 A;  3UIQ A;  3ISN C;  4RW7 A;  1C0M A;  1C1A A;  3ZSO A;  3BDP A;  2OPQ A;  1JXB A;  1NK5 A;  3AA3 A;  1KFS A;  3DLR A;  1VRT A;  4Z4H A;  1BHL A;  3M8S A;  4QOZ B;  3LDS A;  3A2F A;  3RRH A;  4DSK A;  5FRM A;  1HRH A;  4FJX A;  3LAM A;  1TGO A;  4DQR A;  2YHA A;  3D0P A;  1Q9Y A;  1KRP A;  4PQU A;  1WSG A;  5JS1 A;  1RTJ A;  1Z25 A;  3AVL A;  1SV5 A;  4AHV A;  3C6T A;  3SQ1 A;  3HK2 A;  3NH2 A;  1TL1 A;  3SUN A;  4F4K A;  5HRP A;  2HHW A;  4CEQ A;  2XY8 A;  3L8B A;  2VG5 A;  1VSF A;  2D0C A;  4CCH A;  4AHC A;  5KRS A;  4M42 A;  3AO3 A;  2I5J A;  3WNH A;  4B9U A;  4HUE A;  1I3A A;  2FC0 A;  5KGX A;  1CZB A;  3NF7 A;  2A1S A;  3QES A;  4DSL A;  2QK9 A;  5I42 A;  1RT6 A;  1XWL A;  3DRP A;  3QIO A;  3CM5 A;  4ZHR A;  5KTQ A;  3NFA A;  3MXM A;  3IAY A;  1L3V A;  1JXE A;  3OY9 A;  4JS4 A;  4C8L A;  1DTT A;  1G15 A;  4NCG A;  1VSJ A;  4B08 A;  3VQA A;  4CF8 A;  3V4I A;  2PZS A;  1HMV A;  3VQD A;  1UA0 A;  4M3Z A;  4PY5 A;  5CYM A;  3V1R A;  3TAB A;  3QIP A;  3U3G A;  4CEE A;  3AVH A;  2P1J A;  2Z1J A;  4LSN A;  4C8N A;  3AVM A;  3NH0 A;  5C24 A;  1S1X A;  2ATQ A;  1TKT A;  3K58 A;  3SV4 A;  2VG7 A;  3EYZ A;  4OKE A;  5CY4 A;  1W0H A;  4M45 A;  1SKR A;  3G0Z A;  1TAQ A;  3AA2 A;  1QHT A;  5E41 A;  1KCF A;  4OKJ A;  1YVU A;  4OVL A;  1UAX A;  4DLG A;  3V6D A;  1HYZ A;  3OVN A;  1S9E A;  4F3O A;  3SYZ A;  1U47 A;  1D8Y A;  1SKS A;  1VSE A;  3I0S A;  3KLI A;  4ID1 A;  3OYB A;  4KTQ A;  2O4G A;  1RT1 A;  4CHN A;  4E7K A;  1NOZ A;  4N47 A;  4DQP A;  2B4J A;  2HND A;  4AHU A;  2HMI A;  4ICL A;  2A1R A;  3OJU A;  3LP1 A;  1NKE A;  2HVH A;  2DFF A;  3T19 A;  3HVR A;  2HHT A;  3KKR A;  2KZZ A;  1K6Y A;  1RBV A;  4KKO A;  3RMC A;  3NF9 A;  5HRS A;  3OJS A;  1NJW A;  2G8F A;  3AO5 A;  4Q5V A;  1LW2 A;  4R5P A;  4IFY A;  2KFZ A;  1RT7 A;  4KO0 A;  2B5J A;  2OPP A;  5SZT A;  3JSM A;  1VSI A;  4CHQ A;  1NKB A;  4ZTF A;  3PY8 A;  1JLE A;  1RDA A;  3ZSW A;  4HCC A;  2G8I A;  3O3G A;  3OS0 A;  1ZBF A;  3S3M A;  2D0B A;  3QEV A;  4FK2 A;  3OYA A;  2FBT A;  4WE1 A;  1ZBL A;  4YFU A;  4RW9 A;  3CQ8 A;  1S1V A;  3TAM A;  4DFP A;  2OZS A;  3VA0 A;  2X6S A;  1T8E A;  3NGY A;  1J54 A;  4ELU A;  3HPG A;  4CJF A;  4OKK A;  4CJS A;  1IKV A;  4CJP A;  3QIN A;  3ZSZ A;  3MEE A;  3TWH A;  3P83 D;  1EP4 A;  3DYA A;  4DFK A;  3MEC A;  1HYS A;  3VN5 A;  5T7B A;  3KJV A;  4FK4 A;  4Z4G A;  2KFN A;  3HP9 A;  2W42 A;  3O3F A;  3TAP A;  4IFV A;  2PYL A;  3B6O A;  1SL1 A;  4FZY A;  3HL8 A;  4J2D A;  1A5X A;  3HP6 A;  4CF0 A;  4DF4 A;  4B9N A;  2X6N A;  2DY4 A;  3TR8 A;  4B9T A;  3SPZ A;  3AVC A;  2PY5 A;  4KHY A;  4DSE A;  3U3Y A;  2HHQ A;  3K5L A;  5HRR A;  1LW0 A;  3K59 A;  3V81 A;  1S6Q A;  4BDY A;  3P1G A;  4B9L A;  3NE6 A;  2VWK A;  4K8X A;  2FBY A;  3NF6 A;  5FDL A;  4FLW A;  3QLH A;  4OPJ A;  4DLE A;  1DTQ A;  1JLF A;  1UA1 A;  2G8W A;  4FJJ A;  1U45 A;  2KZM A;  4F8R A;  1BI4 A;  1R0A A;  4AHT A;  3SNN A;  2ITG A;  4CFD A;  1B9D A;  1JLA A;  3K57 A;  2R7Y A;  1NJZ A;  1L3T A;  1L5U A;  3VQ4 A;  1Q9X A;  2E4L A;  4FYD A;  1BIZ A;  2HW3 A;  1KVC A;  3MEG A;  4I2Q A;  1T05 A;  3RMD A;  3PX4 A;  1VSK A;  4F3T A;  1ASU A;  3OYD A;  4JS5 A;  3TAG A;  3K2P A;  4C8M A;  3KLH A;  2JLE A;  3V9X A;  5HRO A;  3DLH A;  5JS2 A;  4O44 A;  4FXD A;  1FKO A;  4RW8 A;  1LWC A;  1WNS A;  1S1W A;  4CER A;  4M3W A;  4CJV A;  1QE1 A;  2BE2 A;  3LZI A;  3TAQ A;  4NYN A;  2LSN A;  3E01 A;  1T03 A;  1NK6 A;  4DSJ A;  4N76 A;  4CED A;  1JL1 A;  3AVB A;  4W5N A;  2VG6 A;  4LH5 A;  3QO9 A;  3AVF A;  1GOA A;  3NDK A;  2BAN A;  1SL2 A;  4DU1 A;  1RDD A;  1NK0 A;  2E6M A;  2HB5 A;  4CK2 A;  3DLB A;  4M3X A;  5CYQ A;  4W5T A;  2HNZ A;  2E6L A;  3CFP A;  3DLK A;  4M3T A;  4JLH A;  3HJF A;  4DTR A;  1X9W A;  3MXI A;  4CFB A;  2YNF A;  2JGU A;  4E1M A;  1VRU A;  3NGZ A;  4FW2 A;  4G1Q A;  2XO7 A;  4BWJ A;  4KHN A;  2HHS A;  3K5N A;  4CEZ A;  4AIL C;  2PYJ A;  2FBV A;  4LSL A;  1VK0 A;  3HYF A;  3LPT A;  1KLM A;  1WSF A;  1L3S A;  3AA5 X;  5J2Q A;  4EZ9 A;  4EP5 A;  1HPZ A;  1Q8I A;  1W9H A;  4H8K A;  2QXF A;  3S9H A;  1KTQ A;  2B6A A;  2GBZ A;  2WOM A;  2XHB A;  2KQ2 A;  3D45 A;  1EX4 A;  4CJK A;  1WSI A;  2DFE A;  4RW4 A;  3ZT0 A;  4O5B A;  4CF1 A;  2BGG A;  4M3Y A;  4CGJ A;  1JL2 A;  4Y1D A;  4C8K A;  1J53 A;  3OYC A;  4DS4 A;  3ZCM A;  3QEP A;  3RR8 A;  2HHV A;  3VQ8 A;  3NH1 A;  1J5O A;  2XY6 A;  4F2S A;  1NKC A;  3L2Q A;  4IG3 A;  4HUF A;  4FJK A;  4CGG A;  2DTU A;  3KK2 A;  3M8P A;  3NAE A;  3DRR A;  1X1P A;  4DTO A;  2YNH A;  1HQU A;  1C1C A;  3DRS A;  1VSD A;  4CJT A;  3LWL A;  5KI6 A;  1S9G A;  4NCB A;  1U49 A;  4UQG A;  3ZSY A;  4TSX A;  4DQS A;  3F73 A;  4FJI A;  1VSH A;  4OLA A;  4FLU A;  4CF9 A;  1GOB A;  2F8S A;  1RT3 A;  4DTS A;  3HPO A;  4DTP A;  5J2P A;  4IKF A;  3ASM A;  3VQ5 A;  1LWF A;  1RIL A;  3HXM A;  3FFI A;  4CEB A;  4FJG A;  4DMN A;  3KIO A;  4DTX A;  2OZM A;  4H4O A;  3ZSR A;  3KKS A;  3NGI A;  4FM2 A;  1FK9 A;  3CFO A;  4I9Q A;  3LAK A;  5CZ1 A;  4DU4 A;  4M3R A;  2OPS A;  3TAR A;  5DMR A;  3SQ4 A;  4FJM A;  3IG1 A;  1BCM A;  3RTV A;  3DOL A;  4FZX C;  1EET A;  1HJR A;  3DLE A;  4CEA A;  3SJJ A;  1NK7 A;  3RR7 A;  3SCX A;  3QEX A;  3L3V A;  3HT3 A;  1QSY A;  1FXX A;  3V1O A;  3O4Q A;  1RBS A;  3L2W A;  4EZ6 A;  3SZ2 A;  3S3N A;  1CXQ A;  4KHU A;  2Y1I A;  4CHO A;  3V9Z A;  4MQ3 A;  3L3U A;  1BL3 A;  4DTJ A;  4ELV A;  1BQM A;  3AVA A;  4CGD A;  4E7J A;  2DFH A;  3ZSV A;  1KVB A;  4E7H A;  4IG0 A;  4BE0 A;  4H4M A;  1GOC A;  4DG1 A;  3EZ5 A;  3KD1 E;  1SUQ A;  1RT4 A;  4CIE A;  3ULD A;  2ETJ A;  4GW6 A;  3MAQ A;  2F96 A;  3L2U A;  4ZTJ A;  4FJ9 A;  4KV8 A;  4W5R A;  3PX6 A;  3DOK A;  3WNE A;  4E3S A;  3K5O A;  4DFM A;  4B9M A;  3KTQ A;  3NHG A;  3PUF A;  1XHZ A;  4FVM A;  1SKW A;  4DWI A;  4FJN A;  3SV3 A;  1VSM A;  4FJ7 A;  3C6U A;  3CM6 A;  2HHU A;  4RW6 A;  1NJY A;  1D5A A;  2P51 A;  3VQB A;  2IOC A;  3I8D A;  4OGC A;  1KLN A;  1EKE A;  4DF8 A;  4L8R B;  2D0A A;  4DU3 A;  1JLB A;  1TL3 A;  1WSJ A;  2YNG A;  3DMJ A;  4MFB A;  3AO1 A;  3VQE A;  2XY7 A;  1UOC A;  5EU7 A;  1RCH A;  3VA3 A;  3ZT1 A;  1BCO A;  2IAJ A;  3LP3 A;  3OYH A;  1XC9 A;  1TKX A;  4KFB A;  2P5G A;  2HVI A;  3PO5 A;  1U48 A;  3QNN A;  5SWM A;  3OYM A;  4CEC A;  4FLX A;  3V9U A;  4KTZ A;  1MU2 A;  2XY5 A;  1YTU A;  1HYV A;  4OPK A;  4DQQ A;  4AH9 A;  3V9W A;  1NK4 A;  4KHW A;  1I39 A;  3SUP A;  1WAJ A;  4CJR A;  3TAN A;  4CJE A;  4N56 A;  2O4I A;  3B6P A;  1BGX T;  4CEO A;  1WSH A;  4FLT A;  2IDO A;  4KI6 A;  4CEF A;  4HVJ A;  5I3U A;  4F2R A;  1N6Q A;  4I7F A;  2G8V A;  1X9M A;  1JLG A;  1QQC A;  3K5M A;  2P5O A;  3IS9 A;  3LAN A;  3PX0 A;  1TKZ A;  4JRP A;  4PA1 A;  4FJ5 A;  3NF8 A;  3KLE A;  1XI1 A;  3AO2 A;  3SUO A;  4CE9 A;  5J1E A;  2KTQ A;  3OYK A;  3O4N A;  4LD0 A;  1IH7 A;  3ITH A;  4M41 A;  3AO4 A;  1F21 A;  1RBU A;  4AHS A;  1ZYQ A;  4FJL A;  1C6V A;  1RT5 A;  3OYG A;  3TAE A;  3ZSX A;  4W5Q A;  2RN2 A;  3SQ2 A;  3SUQ A;  4DSI A;  2AJQ A;  1HNV A;  4FM1 A;  1S5J A;  3NBP A;  3HVT A;  3L2V A;  4E89 A;  3VQP A;  4N5S A;  1O1W A;  1LWE A;  4B9S A;  2D5R A;  3H08 A;  4N41 A;  4RG8 A;  4CJ5 A;  4Y1C A;  1ZBU A;  4CK1 A;  3OYE A;  5J2M A;  1UWB A;  1BIU A;  5HLF A;  3OS1 A;  3ZT3 A;  3M8Q A;  4CES A;  3KLG A;  3NCI A;  3JYT A;  1HNI A;  1BI4 B;  1RTI A;  4FM0 A;  1WSE A;  2ZD1 A;  4Z4F A;  3QER A;  4B9V A;  3C94 A;  3VQ9 A;  2IC3 A;  3BGR A;  4DQI A;  1IKY A;  4CGI A;  4FCY A;  1YT3 A;  2X78 A;  4E7I A;  3PO4 A;  3RRG A;  2OA8 A;  3OYL A;  3QEW A;  4E1N A;  4DFJ A;  4QCL A;  3QNO A;  3ALY A;  4OLB A;  3OYI A;  3LAL A;  4OJR A;  1IG9 A;  4DTU A;  1NJX A;  3ZSQ A;  4CFA A;  1KVA A;  4OGE A;  4PUO A;  4NCA A;  5HBM A;  3OYF A;  4CF2 A;  3VQ7 A;  5KRT A;  1S1U A;  1WN7 A;  4O55 A;  4CJW A;  5KGW A;  4FW1 A;  3TAF A;  4B8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...