3D0PA

Insights into rna/dna hybrid recognition and processing by rnase h from the crystal structure of a non-specific enzyme-dsdna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease H
publication title Insights into RNA/DNA hybrid recognition and processing by RNase H from the crystal structure of a non-specific enzyme-dsDNA complex.
pubmed rcsb
total genus 43
structure length 134
sequence length 134
chains with identical sequence C
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3d0pA00
3HXMA 3AO5A 2P1JA 3L3UA 4OKJA 3NF7A 4CGFA 3OJSA 4M3RA 3VQQA 3NGZA 1S9EA 1RBVA 2D0AA 4N56A 1ZBLA 4AHRA 4CJUA 4K8ZA 4CJQA 4DTJA 3DYAA 2G8IA 5HRRA 2IOCA 3D45A 4CIEA 4HVJA 5E41A 2D0CA 2XRIA 4I2QA 3UIQA 3ZSWA 3OYGA 2A1RA 3V1OA 1SKSA 1JLQA 3ITHA 4CGGA 4B3OA 1SKRA 4W5NA 3L2RA 3PX6A 2QXFA 4CERA 3RMBA 5C42A 3ZT4A 4RW8A 2O4GA 1HRHA 3QEPA 2YNGA 2OZMA 4Z4HA 3AO3A 3K59A 1BHLA 2YKNA 3ALYA 1BIZA 1NOZA 3MECA 3V9SA 5HP1A 3TR8A 4CEOA 4PQUA 1HQUA 1C6VA 2Y1IA 1RT2A 3NH0A 4KREA 5JS1A 3LALA 1TAQA 4CJ5A 2RF2A 3L2WA 4TSXA 3HP6A 5CYMA 3KK3A 4DSLA 3NF6A 4CHPA 4LH5A 3S3OA 1I3AA 4DFMA 1REVA 1VSIA 1SL0A 4CF0A 1YTAA 2BANA 2EX3A 4FVMA 4B8AB 2A1SA 4DTUA 1NK4A 1WNSA 2Z1JA 1RT7A 4FZZA 2XY8A 4I9LA 4C8LA 3KKSA 3O4QA 5JS2A 2PYJA 2DFFA 1RCHA 3VQ9A 3AVFA 1IKWA 3VA3A 1T8EA 4FZXC 1RT6A 3LANA 2HVIA 3OYFA 4IBNA 4H4MA 4DQPA 2IGIA 3HSTB 4DLGA 4FJXA 4B9LA 4JRQA 3WNGA 4Q0BA 2HHWA 4KRFA 3AVIA 3K2PA 4O0IA 4DTMA 1XHZA 3QEXA 4CE9A 1S5JA 2ZD1A 4CGHA 1LWCA 4JLHA 4DFPA 1T7PA 4Q5VA 1R0AA 1ZBFA 2B5JA 2B4JA 3LZJA 1YTUA 4YNQA 2Z1IA 3DRRA 3PX0A 1XC9A 1D9DA 1KSPA 2HHSA 2ATQA 1JL1A 5EU7A 2KZZA 4FLWA 3OYAA 4HUEA 4DF8A 3KK2A 5DK5A 4DSJA 1CXQA 1NK8A 2F8SA 1WAJA 1DTQA 2E6MA 3HPGA 4FJLA 1DTTA 1RT1A 4RW6A 4KHUA 4ZHRA 4FLXA 3LZIA 3NGIA 3TAPA 2PYLA 1KFDA 3LWMA 3TAQA 4KKOA 4N5SA 1NKBA 4CIFA 5FDLA 2I5JA 4KO0A 2ETJA 4AHCA 2KZMA 1RBRA 1U04A 3LDSA 1ZYQA 3RR7A 1VSDA 4QCLA 4O55A 3SUNA 1HYSA 1RBSA 4CEAA 4R5PA 4F3OA 3AVBA 5FRMA 4QOZB 1T05A 1JLBA 3DLKA 2VG6A 2HHQA 3V9WA 3M8RA 2XO7A 1MU2A 1SV5A 4RW9A 2QKKA 4LSLA 3HT3A 4O5BA 1U48A 3QINA 3TANA 2QKBA 3DLRA 2HNYA 3CFOA 1JXBA 3KLGA 3NFAA 1BCMA 4F8RA 1VSMA 2IDOA 3B6PA 4IG3A 1HNIA 1FK9A 2OPQA 4UQGA 3PY8A 5FRNA 3DLBA 4CHYA 1VSEA 1D9FA 1ITGA 3S3NA 5KI6A 3L3VA 1NJXA 3PUFA 1U47A 4DTNA 2O4IA 4ELTA 4FJIA 3K5NA 3RRHA 1LAVA 3OJUA 3OYBA 1NJZA 3IAYA 3WNEA 5I3UA 2P5GA 1SL1A 3BGRA 4FJNA 2FC0A 4B8CA 3TAFA 1IO2A 3SPYA 4N47A 3AVLA 2ITGA 3SQ0A 4J2DA 1QSYA 1VSFA 1B92A 2IC3A 4QAGA 4CK2A 4CK1A 1QQCA 4KHWA 3QNOA 1BQNA 3MAQA 1BQMA 1QE1A 3WNHA 4DQQA 4M3TA 1JLGA 4NYNA 3AV9A 1BCOA 1HMVA 4DQIA 4YFUA 2F96A 3ZSQA 3QETA 3OY9A 4ID1A 4CFCA 1XWLA 1UWBA 3KKRA 4JS4A 1S9GA 4E7IA 4ZTJA 2KTQA 1RT4A 1S6PA 4OPJA 3T19A 3OYHA 1UA1A 4FJHA 2HHTA 4DFJA 1UOCA 3BDPA 1Q9YA 1RTHA 1NKCA 4M41A 3F73A 4GW6A 4B9TA 1G15A 1L3TA 4CF8A 5HBMA 3SUQA 3M8SA 3F9KA 3P1GA 2XY7A 2G8VA 2DY4A 2DTUA 1VRTA 4DF4A 1TGOA 4JS5A 1Q9XA 3MXIA 4CJLA 4F4KA 1L5UA 3SQ1A 3AVMA 1SUQA 3MEDA 3EYZA 2G8HA 4F3TA 1S6QA 5SWMA 4DSFA 4I9QA 3FFIA 4CGIA 1NK6A 1RT3A 3K5MA 3TAMA 3NHGA 4AILC 3LPUA 5HRNA 1WSGA 3AO1A 3OYJA 1RILA 1S1XA 4H8KA 4DLEA 3I0RA 3U3YA 5HLFA 3DMJA 3M8QA 3H08A 3RMCA 3V6DA 3PV8A 1S1TA 4OLAA 1BGXT 3HL8A 3U3GA 3K58A 4JRPA 4KFBA 3TWHA 1NKEA 4B08A 2KQ2A 2P5OA 4E0DA 2HW3A 4LH4A 1ASWA 2BE2A 2GV9A 3SPZA 2EHGA 1Z26A 3RR8A 3ASMA 1ZBUA 3ZSYA 2Y1JA 4AHUA 2FBVA 1KCFA 3T1AA 4CJTA 4CHZA 4DG1A 1S1WA 1D5AA 4CHOA 4CGJA 4NYFA 3V81A 1A5VA 3G0ZA 4BE0A 1KLNA 4KHQA 4O4GA 3KLIA 3V1QA 3TAEA 2PZSA 3ULDA 1U49A 1U4BA 1IH7A 4CEFA 2XY6A 1VRUA 1NK5A 4J2BA 3QLHA 1NK7A 1CZBA 3E01A 3ZT2A 4ZTFA 4Z4IA 4DS4A 2Z1GA 4L8RB 1JLFA 1GOBA 3KD5E 3M8PA 1EX4A 4B9SA 2YNHA 4NCAA 1IKVA 4DU3A 3HPOA 4CJWA 3AO2A 4KV8A 4CJFA 2HVHA 4FLUA 4HCCA 4OLBA 3HO1A 2X6NA 1WSIA 2RKIA 4CEZA 3SV4A 1WSJA 1J54A 4B9MA 1F21A 1TVRA 3SYZA 1TL1A 3O3GA 1DLOA 2E4LA 3LAKA 3TABA 3MEEA 1QTMA 3SQ2A 2F8TA 4FJ7A 3HPHA 4W5RA 2HHVA 3RMDA 3ZCMA 2JLEA 3NE6A 3ZSVA 2XY5A 4ID5A 3CG7A 3QEVA 4PA1A 4KPYA 4Y1DA 3IRXA 3V9UA 4GVMA 4BWMA 2OYQA 1C0UA 3PO5A 3NF9A 3OYMA 2XHBA 3QEIA 4DWIA 1BI4B 4Z0UA 2HHUA 1L3UA 1KTQA 2BDPA 4DTXA 3KTQA 1LW2A 4MQ3A 1VSLA 5C24A 4C8NA 5HRPA 3CFPA 5J2PA 2HHXA 1LW0A 4IDKA 1HNVA 1BL3A 1S1VA 5I42A 4E7HA 4KB0A 4Z4FA 4PY5A 4M3WA 3ZSRA 4DSIA 2X6SA 2WONA 3DOLA 4DQRA 1TK8A 4RW4A 1QHTA 1JLCA 3OS1A 5FROA 4FYDA 3NGYA 4E19A 4FK0A 2B6AA 2NUBA 4FJ9A 3CYMA 4CJRA 1B9DA 2ZE2A 3IS9A 1UA0A 1ASUA 1U45A 4F2RA 3NDKA 3MEGA 1TAUA 4BE2A 1IKYA 1C0TA 4KB1A 3CM5A 4CJEA 5C25A 1NJYA 1QS4A 1X9MA 1JLEA 3K5OA 1JL2A 4AHTA 3AVJA 3AA3A 1FKPA 1BISA 3QEWA 3OYKA 1KFSA 4M3YA 3L2UA 2D0BA 3VQPA 3I8DA 1VK0A 3WNFA 3ZT1A 3V4IA 3TARA 4FJGA 5CZ2A 4ELVA 3AO4A 1J53A 4CEBA 4M3XA 1WN7A 1RTIA 3NAEA 2YKMA 1EXQA 3VQCA 3O3FA 3OYEA 5KGXA 3O4NA 4MFBA 3SZ2A 1QSLA 3HJFA 4PWDA 2E6LA 3NF8A 3CM6A 4K8XA 4CGDA 3SNNA 4Z4GA 1HQEA 2KFZA 4FLTA 3DLGA 1FKOA 1YVUA 1C0MA 2HNDA 2LSNA 4CJPA 3KJVA 4FLZA 5T7BA 3SI6A 1X9WA 1ZBHA 2G8FA 4IKFA 3OVNA 3A2FA 2G8WA 1KRPA 4KTZA 1RTJA 4KTQA 3P83D 3NH1A 3HYFA 4FLYA 3SQ4A 1JXEA 4CESA 1TK0A 1GOCA 1SKWA 3LWLA 3RWUA 3C6TA 3EY1A 1LWEA 3C94A 3MXJA 4OVLA 1VSKA 3C6UA 5J1EA 5CY4A 1TKXA 3OYCA 1K6YA 3OYLA 3JSMA 3G10A 3RTVA 4FLVA 3K57A 3NCIA 2DFEA 1HJRA 4CEDA 4IFYA 2IS3A 4E1MA 4KHSA 4KHYA 2BGGA 4CF2A 4FM2A 3S3MA 3KD1E 4KHNA 1VSJA 3C95A 4C8MA 4I7FA 2W42A 5KRTA 2OPPA 1A5WA 3SUOA 4CF9A 4NCBA 4CCHA 4DTSA 1EKEA 4CIGA 2P51A 5J2MA 4OPKA 1C1BA 1WAFA 3DRPA 3LP2A 4CJVA 4BDPA 2HMIA 3ZSZA 1UAXA 4CJ3A 3VQAA 3O3HA 4CJSA 3RMAA 1A5XA 3AA5X 4M45A 4DU1A 1BI4A 3VQ5A 3VQ6A 3P5JA 4H4OA 4FCYA 4N76A 5SZTA 1TKDA 3AVGA 3CFRA 1RBTA 4DTOA 3ZT3A 2IAJA 4FJ8A 4EP5A 2OA8A 3KLFA 1NK0A 4B9NA 1JLAA 1KVAA 1Z25A 5KGWA 4KTWA 1T03A 1HPZA 4Z4CA 4E89A 4PUOA 4M3UA 4W5QA 3DLEA 4OGEA 4WE1A 4CJ4A 1NK9A 5KRSA 3L2QA 3MXMA 4M3ZA 3KLHA 3QERA 2VG7A 4FK4A 5K14A 3LPTA 1FXXA 2YNFA 3DM2A 3VQ7A 2VWKA 3NH2A 3JYTA 4LD0A 3S9HA 4DTRA 4DSKA 1TKTA 1CLQA 2RPIA 3VQDA 4IG0A 1L3VA 2KFNA 1RDBA 1D8YA 3AA2A 3VQ4A 3KK1A 5J2NA 4DQSA 4EZ6A 4GMJB 3RRGA 3OS2A 1CXUA 3U6FA 3V1RA 4O0JA 4BACA 4DS5A 1BIUA 4OJRA 3DRSA 4E7JA 3L2VA 2YNIA 2VWJA 1N6QA 4ELUA 4J2EA 1C1AA 3AVHA 3DLHA 4FM1A 2HB5A 3QO9A 4ICLA 1RDDA 2AJQA 3L8BA 2VG5A 5HRSA 2FBYA 2Q3SA 3ZSOA 3VQBA 4DMNA 1W9HA 2YV0X 4IFVA 3SV3A 4F2SA 3QIPA 1ASVA 4AHSA 4OGCA 4CHNA 4Z4EA 3AVAA 3ZSXA 1XI1A 4FK2A 1RNHA 3THVA 3LAMA 1VSHA 2OPSA 4RG8A 5J2QA 3LP3A 2OZSA 2PY5A 4EP4A 2R7YA 5KTQA 1JKHA 1SL2A 1W0HA 1EP4A 4CF1A 3D0PA 4B9VA 2KW4A 5CYQA 4E1NA 3QESA 1TK5A 4BWJA 4E7LA 1QSSA 1KLMA 4CFDA 4HUGA 1Y97A 1RTDA 1TV6A 5DMRA 1C1CA 1I39A 1KVCA 3NBPA 4DSEA 4DU4A 4G1QA 3CQ8A 1YT3A 4W5TA 2D5RA 4KI4A 3HVRA 1S1UA 4AHVA 4I2PA 3K5LA 4EZ9A 4FZYA 1Q8IA 3HM9A 4FXDA 2G8KA 2GBZA 4HCBA 3HK2A 1N5YA 1WSEA 3AVCA 3HVTA 4CECA 4BE1A 4E7KA 3LP1A 3OYNA 3OYIA 1IG9A 3VQEA 2FBXA 3VQ8A 3TAGA 1L3SA 1LWFA 4OKKA 4E3SA 3I0SA 1GOAA 4AH9A 1HYZA 4J2AA 3LP0A 1ZBIA 3T3FA 1RT5A 3V9ZA 1J5OA 4CHQA 3EZ5A 3KLEA 4FJ5A 3AA4A 2ZQBA 4HUFA 2YHBA 3AVNA 2Z1HA 3VN5A 4FJKA 3DI6A 4W5OA 3B6OA 1RDAA 4LY7A 4C8OA 4Y1CA 4OKEA 3OYDA 4XIUA 4FJJA 4FJMA 5D3GA 1J9AA 4N41A 2FBTA 2RN2A 4BDZA 2G8UA 1X1PA 4KI6A 4CK3A 1RBUA 4FW2A 1WSFA 2DFHA 3DOKA 4C8KA 3PO4A 1KVBA 3SUPA 4CJKA 4B9UA 1LAWA 4HHTA 2GUIA 4CFAA 4NCGA 1XHXA 2JGUA 3KIOA 4KAZA 1O1WA 4CFBA 3V9XA 4DTPA 4FW1A 3SJJA 3TI0A 1EETA 1IKXA 3IG1A 3VA0A 3ZT0A 3PX4A 1HYVA 4LSNA 1TKZA 1LV5A 4M42A 2X74A 4RW7A 3OS0A 4FM0A 1X9SA 1NOYA 4HTUA 4BDYA 2X78A 3HP9A 4DFKA 1WLJA 3SCXA 5CZ1A 4CEEA 4CEQA 2QK9A 3ISNC 1CZ9A 2HNZA 1TL3A 2OPRA 2YHAA 4O44A 2WOMA 3AVKA 3QIOA 5HROA 1B9FA 3QNNA 1NJWA 1WSHA 1RDCA
chains in the Genus database with same CATH superfamily
3L3UA 2P1JA 3IMXA 4CGFA 3HZ6A 2PFUA 3NGZA 1LCUA 3CPWM 2O8EA 2D0AA 2ZWHA 4CJUA 4E1JA 4K8ZA 3FE1A 5F2RA 4A57A 2IOCA 3CIPA 3AAQA 4CZHA 4HVJA 1YVNA 2J4RA 5E41A 3SLCA 3ZSWA 4B3OA 1MDUB 1SKRA 4W5NA 3L2RA 3RMBA 1WUAA 1HRHA 3HOTA 2OZMA 4Z4HA 2YKNA 4BRPA 1BIZA 1NOZA 3V9SA 3AY9A 4IDHA 1HR0K 1HQUA 5JS1A 1RT2A 1TAQA 2F4VK 4H0PA 3HP6A 3A5LC 4LH5A 2ITMA 1VSIA 2GTDA 4AF1A 1FW6A 5BREA 2GWJA 2XY8A 1VQPN 3VQ9A 3AVFA 1IKWA 1T8EA 4FZXC 1BWFO 4DQPA 3WNGA 3OBWA 4BC5A 3MN7A 4DFPA 1R0AA 2B4JA 1D9DA 3PX0A 2HHSA 2ATQA 1JL1A 3FLCO 1HNZK 2I7NA 3KZBA 2HOEA 4DF8A 3KK2A 5DK5A 4BC3A 4KHUA 2A42A 3BEXA 3CHWA 5BR9A 2YI1A 3NGIA 3LZIA 2WUSA 2PYLA 4KH4A 4FVUA 4JKAA 4GV3A 1NKBA 5FDLA 4KO0A 3E9PA 1N33K 1RBRA 4JV5K 3MK6A 1ZYQA 3RR7A 4QCLA 4A62A 4O55A 1HYSA 3D2EB 1RBSA 5FRMA 4F3OA 3AVBA 1VQ8N 4QOZB 2E8AA 1JLBA 1KQSM 2VG6A 3J7ZO 4KH6A 3ATUA 4RW9A 2QKKA 4LSLA 2NZTA 3MWTA 2QKBA 3EEQA 2HNYA 2IDOA 1HNIA 1FK9A 4UQGA 3PY8A 2PAVA 3L3VA 2NNWA 1NJXA 1NGHA 1X3NA 3FR0A 1U47A 4DTNA 5BPMA 3O9TA 3LM2A 2NRVA 4JHDB 5I3UA 4B8CA 3RSEB 5GINA 3BF1A 4OPAA 3SQ0A 4LFBK 1VSFA 3H3NO 4KHWA 5AQIA 4DV7K 3WNHA 1NWKA 4NYNA 4YFUA 3ZSQA 2OCEA 1XWLA 3CJ9A 3KKRA 1S9GA 4JS4A 1UA1A 4OPJA 3VF6A 1NKCA 1XNQK 4GW6A 4B9TA 1G15A 3SUQA 1MWMA 3F9KA 1XQSC 2EWSA 1L5UA 2BTFA 3AVMA 3EYZA 3SQ1A 4CZEA 4C23A 1NMNA 3FFKB 4CGIA 1RT3A 4X64K 3AO1A 1RILA 3I0RA 3PV8A 4JK7A 3U3GA 3TWHA 1OH5A 5CR4A 4FWPA 1Z26A 3ZSYA 2RE2A 2Y1JA 3MMVA 4AHUA 4BC2A 1TYQB 4NYFA 3V81A 4KHQA 2HBLA 5BRDA 3KLIA 3TAEA 2XY6A 4JYAK 4FWKA 1NK5A 1CZBA 1BOTO 3MX5A 4DV4K 4ZTFA 4Z4IA 1Y64A 1GOBA 4B9SA 2YNHA 4BR7A 1XC3A 4JHDA 3HPOA 2HVHA 2QA4N 3VF4A 2GWKA 2A41A 1WSIA 3RSEA 2P9SB 4A2AA 4FL9A 4DR3K 2HHVA 4W5RA 2UUBK 2JLEA 3NE6A 2XY5A 4Y1DA 3IRXA 1QVGM 1NGDA 2Q36A 3OYMA 4MO5A 1BG3A 4NLBA 1NGFA 3QEIA 1KTQA 4BG9A 4C8NA 1LW0A 4IDKA 1HNVA 4PY5A 4B3SK 4DSIA 3VGMA 1QHTA 5FROA 3VTIA 3NGYA 4FK0A 2NUBA 3HRGA 2WC9A 1U45A 4F2RA 3F2KA 3MEGA 4BE2A 4KB1A 2A40A 5AZIB 3BUZB 3AVJA 1BISA 5TKYA 1Z05A 4JAXA 3OYKA 4M3YA 3EKSA 3WNFA 5AQQA 3V4IA 3P39A 3NAEA 1ATSA 1TYQA 3O3FA 4PWDA 1BO5O 1MA9B 2NRTA 2E6LA 3TSQA 4CJ7A 4GV6A 3I56N 1X9WA 4IKFA 3CMAN 3OVNA 3A2FA 4JK8A 3G4SN 4DR4K 4KTZA 3P83D 1TK0A 4FLYA 4CESA 5EOYA 4CZIA 3RWUA 1LWEA 3MXJA 1VSKA 2FXUA 4FWLA 3OYCA 1T44A 4FLVA 1N34K 1DEJA 2VYPA 4KHYA 1HJRA 2P9SA 3IFRA 1E4GT 1R59O 1Q82O 3S3MA 1VSJA 3C95A 4BVOA 4I7FA 4BR2A 4WF9L 1TUUA 4NCBA 3VETA 4DTSA 3B8AX 4OPKA 1WAFA 4CJ3A 1IBMK 1A5XA 3SI6A 3VQ5A 4FCYA 1YAGA 1GLFO 3CFRA 4DTOA 5DM7L 4PHTX 3ZEUB 4KTWA 1T03A 4W5QA 2QXLA 2HBJA 4CJ4A 3L2QA 5CHIA 3MXMA 3M1FA 3KLHA 1JCFA 3QERA 4FK4A 3JYTA 3VQ7A 1BUPA 1G99A 3S9HA 1CLQA 4IOXA 4NB4A 3ZLJA 4IG0A 2KFNA 1D8YA 5LJVA 5AZIA 5J2NA 3QBXA 4GMJB 4JI5K 4O0JA 4BACA 4F9OA 4DS5A 3DRSA 2VWJA 4OPHA 3AVHA 3TU5A 4FM1A 4O8UA 3CCLN 3L8BA 5HRSA 3THWB 3ZSOA 3HJFA 1WBBA 5FPNA 3QIPA 4YOYA 4Z4EA 3AGKA 2Q31A 4RG8A 3LP3A 5KTQA 3MX2A 1Q81O 1W0HA 1EP4A 3D0PA 5CYQA 2KLAA 4BWJA 1QSSA 1KLMA 4HUGA 5DMRA 3F9MA 4AQYK 3NBPA 3WT0A 1YT3A 4AHVA 2JWLA 1YI2N 2Q1NA 3CJ7A 1Q8IA 1SZ2A 3HM9A 4HCBA 3VPZA 1WSEA 3IDHA 5M1KA 1EQYA 5AQWA 4PKGA 4BE1A 3OYNA 3L4IA 3MCAB 1IG9A 3QFPA 3J8AA 1LWFA 4E3SA 4PKIA 3I0SA 1GOAA 4J2AA 1RT5A 4WQ5A 4HUFA 2Z1HA 5FPMA 3JS6A 4WQ4C 4JNEA 3ZEUA 4LY7A 4IO8A 4OKEA 4Y1CA 4FJMA 4FWNA 4NLCA 3HTVA 1YJ9N 1WSFA 2DFHA 4C8KA 3SUPA 3WXIA 1NG9A 1IBKK 3J7AP 4BY9C 3TI0A 4LF6K 1EETA 1IKXA 3IG1A 4QS9A 5BRHA 4M42A 4JKEA 5C12A 2ZJQL 4HTUA 3THWA 1KAYA 2WBNA 3FZLA 3SCXA 1IV0A 1CZ9A 1TL3A 4G9ZA 4O44A 2WOMA 3C6AA 3QIOA 1NJWA 1EO1A 3ULEB 3CC7N 2UUAK 2OANA 4M3RA 3VQQA 1RBVA 1ZBLA 2UU9K 2D0OA 4WFBL 4B3RK 3H6EA 4DHYA 2D0CA 3UIQA 3OYGA 2A1RA 3ITHA 5BR8K 3PX6A 4B1ZA 4RW8A 2O4GA 1NJIO 4FWMA 5EY4A 1LOTB 3K59A 1BHLA 1ILYA 3M6GA 4DV1K 5HP1A 4CEOA 4KREA 2Y1IA 3NH0A 2QWQA 3SJHA 5KPTA 2O8DB 3QICA 3NF6A 4CHPA 3EE8A 3S3OA 1I3AA 3BP8A 1NK4A 3ZX3A 2BANA 3M3ZA 2A1SA 1WNSA 2Z1JA 5BPLA 2PYJA 3UKUB 1BU6O 3VA3A 1RT6A 3LANA 1EWQA 3OYFA 2F7TA 4H4MA 3HSTB 4JRQA 3CPEA 1HNXK 3K2PA 2IVPA 1LWCA 4Q5VA 1ZBFA 3LZJA 4YNQA 1KSPA 2NRRA 1ATRA 5EU7A 2KZZA 5AFUA 3QBWA 3WXKA 4FLWA 4HUEA 2BH1A 1CXQA 1WAJA 3HPGA 2E1ZA 3ULEA 1HJOA 5F0XA 3TAQA 1FJGK 2NRXA 3AARA 4CIFA 2ETJA 2KZMA 1U04A 4H5RA 3SUNA 3CF5L 3EZWA 4R5PA 4CEAA 4FPBA 2V51B 2HHQA 2PBDA 3O6WA 3V9WA 1SV5A 4O5BA 1U48A 3QINA 2O8BB 3CFOA 1JXBA 3KLGA 1BCMA 1VSMA 1P8ZA 4IG3A 5FRNA 3DLBA 4CHYA 1SQKA 1ITGA 4JI1K 3VOVA 1W2BM 5AQSA 2V52B 4IEIA 4ELTA 2O8DA 1LAVA 1VQMN 3A0IX 4M7YA 3IAYA 3WNEA 1SL1A 2FC0A 4AM6A 3SPYA 3AVLA 3UKUA 4YY3K 1QQCA 1BQMA 1QE1A 4DQQA 1JLGA 1SS6A 3AV9A 1BCOA 4B1VA 3EO3A 3BY5A 3QDKA 3OY9A 5AQZA 1UWBA 1D4XA 3OYHA 1S6PA 2UXDK 2P9NA 3BDPA 1Q9YA 3UKRB 4H0YB 4LF9K 4ILJA 2XY7A 2DY4A 2DTUA 2YHYA 1VRTA 4A61A 1Q9XA 4BR0A 2W40A 5MLCQ 2YX6A 5SWMA 3CD6N 3K5MA 3NHGA 3LPUA 5HRNA 4BR9A 3OYJA 4DLEA 3DWLA 3M8QA 4LFCK 1S1TA 3T1HK 1DKGD 3RVCA 2P5OA 4CZLA 1C0FA 4BRMA 4E0DA 1ASWA 2GV9A 1ZBUA 1VHXA 5AQPA 2FBVA 5JVGL 3IKMA 4CJTA 4ILHA 4DG1A 2O8BA 3SK3A 1NBWA 2AP1A 4DQ8A 4O4GA 3MWPA 2PZSA 3ULDA 1U49A 1U4BA 1IH7A 4CEFA 1NK7A 2HSTA 4QS8A 3CJCA 4DS4A 2Z1GA 4JEPA 1JLFA 4X66K 1IKVA 3E66A 2OTLN 5BRFA 4CJWA 4FLUA 4OLBA 2P9UB 2X6NA 3HO1A 1WSJA 1J54A 4CW7B 3MCPA 1F21A 3SYZA 3TABA 1NGBA 3MEEA 3M5RA 3ZCMA 4ID5A 1ESVA 4U67L 1VQ7N 4KPYA 4BWMA 5H1SQ 1VQNN 2D0PA 3R9PA 4Z0UA 3U4LA 3GOIA 4BQLA 2HHUA 4DTXA 3T69A 5C24A 3UKRA 5HRPA 4YOVA 4IZ9A 1BL3A 1S1VA 1Z6RA 4E7HA 5IWAK 4WFAL 3ZSRA 2GUPA 1S72N 1TUYA 2WONA 1RGIA 4BRNA 3CYMA 2ZE2A 3PSIA 4WCEL 2Q97A 2FSJA 2ZJPL 4BVPA 1OVYA 1QS4A 3SBGA 1K73O 2YCHA 1JL2A 3C0BA 4AHTA 3D6RA 3AA3A 1FKPA 1KFSA 1K8AO 1BDGA 3ZT1A 3THYB 4FJGA 5CZ2A 4CEBA 1RTIA 3CC2N 1EXQA 4IOCL 5KGXA 3O4NA 3SZ2A 1QSLA 3CCRN 2KFZA 4FLTA 2LSNA 4CJPA 5ADXH 3KJVA 4PL8A 2NRWA 3O80A 1RTJA 3C7NB 3HYFA 3NH1A 3SQ4A 1GOCA 1KC8O 3GG4A 3C94A 4OVLA 3C6UA 1NGIA 5CY4A 1K6YA 4L3QA 2P9UA 4B1YB 3RTVA 2DFEA 4IJNA 3ZX2A 2BGGA 4RTFD 4OX9K 4FM2A 2UYTA 4C8MA 5KRTA 2OPPA 1A5WA 1GLCG 5AQLA 1OVQA 1EKEA 4CIGA 2P51A 1C1BA 4B1XB 4CJVA 3O08A 1C0GA 3PSFA 3RMAA 4CJSA 3VQ6A 3D7EO 1J5EK 2IAJA 2FF6A 3D2EA 1S22A 4FWRA 1E3MA 1JLAA 3WXLA 4AM7A 5KGWA 4HWIA 4FWQA 3N4PA 4WE1A 1ZXOA 2VG7A 2YNFA 4DSKA 3A5NC 4KH5A 4A59A 4DQSA 4B1UB 3V1RA 4LF5K 4EHTA 1BIUA 4OJRA 5M1NA 2YNIA 3CCQN 3W3DA 3DLHA 2E88A 3THYA 1RDDA 2AJQA 2VG5A 2FBYA 2QTDA 3VQBA 4F2SA 2YV0X 2A5XA 3SAHA 3G71N 4OGCA 5F1XA 3EN9A 4FK2A 2OPSA 4PL7A 3D2FB 4B9VA 4E1NA 3C7NA 4CFDA 4DV3K 2CGLA 1C1CA 1KVCA 1YITN 3CQ8A 2D5RA 4RCHA 5LMUK 4WQ4A 2ZM6K 5ELZA 1I94K 2V7YA 4B3TK 5BN8A 1HKCA 4JN4A 1VQLN 3VQ8A 5FLXO 1L3SA 5LY3A 3Q7BA 1YJWN 1HYZA 4HTLA 3LP0A 3T3FA 3V9ZA 1J5OA 3VEVA 2YHBA 5B8HA 4JD2B 4C8OA 3OYDA 4XIUA 1NU0A 3N4QA 4FJJA 5GADP 4YDUC 4DV2K 4BREA 3VGLA 1J9AA 4ISEA 4N41A 1X1PA 3CJAA 4CK3A 4FW2A 2VWBA 3PO4A 4IO9L 1LAWA 2GUIA 4NCGA 4BGAA 2E2PA 1XHXA 1GLAG 2JGUA 3FZHA 3KIOA 4KAZA 1O1WA 3V9XA 1U6ZA 3LDPA 3U9ZA 3O1WA 3VEZA 3VA0A 3ZT0A 4LSNA 1TKZA 2HF3A 2VGMA 3WXJA 1DGKN 1NOYA 4BDYA 4A5AA 4CEEA 2QK9A 4FWOA 3AVKA 3D2FA 5HROA 1B9FA 3QNNA 1K8KB 1WSHA 1RDCA 3HXMA 4B1WB 4IFEA 3OJSA 4OKJA 3NF7A 2A6AA 4N56A 4DTJA 3VEOA 3DYAA 2G8IA 3D45A 3LDQA 5LJWA 2Q0RA 2XRIA 1HX1A 3V1OA 2ZJRL 1Q18A 1MWKA 2QXFA 4CERA 3ZT4A 4U7BA 1YHQN 4JKCA 5KQ8A 3K9KA 3ALYA 2E2QA 3KWGA 3OBYA 3TR8A 3O8MA 3HI0A 2I7PA 3OA9A 3LALA 4JD2A 3CERA 2RF2A 3L2WA 4WFNL 2QWLA 4TSXA 5CYMA 3KK3A 4DSLA 2E5LK 4IJAA 2V7ZA 4JKGB 4CF0A 1YTAA 4FVMA 4FZZA 4FSVA 4I9LA 3KKSA 5JS2A 5AQJA 1RCHA 4CBWA 5C2FA 5GAEP 4DLGA 4FJXA 4B9LA 4XH4A 4KRFA 4RWTA 4O0IA 1NLVA 3QEXA 5E26A 5GIOA 1T7PA 3ZETB 5I9EB 2Z1IA 1XC9A 4BC4A 4R79A 5AQRA 1QVFM 5AQXA 3ENOA 2F8SA 1NK8A 1DTQA 1DTTA 1RT1A 4RW6A 3CJ1A 4ZHRA 3P38A 4CZKA 3TAPA 1KFDA 2RHKA 1Q7YO 5C15A 2H3GX 4ILGB 3WXMB 2I5JA 5IT9O 2IIRA 2O8CB 5C10A 2IVNA 1VSDA 4JI3K 4A5BA 3DLKA 3NVKA 1M90O 3M8RA 2XO7A 1XNRK 1IG8A 4GVEA 3HT3A 2ZGZA 3FZKA 2W6KA 3B6PA 2OPQA 1VSEA 1D9FA 3S3NA 5KI6A 2QWPA 3E9LA 1W7AA 2O4IA 3K5NA 3RRHA 3OJUA 5AQYA 1NJZA 3H3OB 4JKGA 2FF3B 2P5GA 3BGRA 1IO2A 3GBTA 4N47A 1N8RO 3G25A 2ITGA 5GAGP 4BR5A 3TPQA 1B92A 2IC3A 4QAGA 3P31A 3CCVN 4DQIA 3KHYA 3ID6A 5A2QO 3MDQA 4ID1A 4CFCA 1ZBSA 2NRZA 4LF4K 2KTQA 3VMFB 5AQOA 4DFJA 4FPAA 3I33A 4M41A 3F73A 1L3TA 4LF7K 5HBMA 3M8SA 2G8VA 4K41A 5KPRA 4DF4A 3GDQA 4JS5A 3H45C 3MXIA 4CJLA 1YUWA 3EKUA 2QWOA 1V4SA 2G8HA 4F3TA 1QZ6A 3TTCA 4DSFA 3FFIA 3VERA 1NK6A 3CI5A 4MO4A 3TAMA 4I6MB 3SAGA 3O9RA 1S1XA 3DMJA 2QW9A 3H08A 3E9OA 3J81O 3RMCA 4BRCA 3V6DA 5AJ3K 2VQFK 1BGXT 3K58A 4JRPA 4OLAA 4KFBA 4B08A 2KQ2A 3R6MA 2BE2A 3SPZA 3RR8A 2EHGA 2KKZA 4K42A 3C6HA 1Q86O 1VQ9N 1A5VA 3BF3A 3G0ZA 2BUPA 4BE0A 1KLNA 1NGAA 4CZMA 3F5TA 2ASOA 3QLHA 1NGJA 3ZT2A 2D4WA 4L8RB 1EX4A 5BN9A 4KV8A 4CJFA 2ASPA 2RKIA 4CEZA 3SV4A 4B9MA 1TVRA 1TL1A 3O3GA 1DLOA 3AGRA 3LAKA 1QTMA 3LDNA 3RMDA 4DV6K 4K25A 3ZSVA 5HOOA 5LL6Z 1YXQA 3VF2A 3BZKA 4CD3A 1C0UA 3PO5A 3NF9A 5E84A 2XHBA 4DWIA 1BI4B 1IJJA 1ZC6A 1VSLA 3CFPA 5J2PA 2HHXA 1QQMA 5I42A 4KB0A 3PIOL 4M3WA 3WQUA 1TK8A 2P9LB 5FPDA 1JLCA 4ISGA 3OS1A 4IWVA 4FYDA 4E19A 2B6AA 4QS7A 4FJ9A 4B3MK 4CJRA 1B9DA 3IS9A 1IBLK 1ASUA 3OW2M 1TAUA 1IKYA 4I6MA 2VQEK 3CM5A 3SMSA 4CJEA 1NJYA 3SMPA 1JLEA 3K5OA 3O4WA 3U9DA 3QEWA 4BRGA 2D0BA 1VK0A 5TKWA 3CQXA 1K9MO 1J53A 2YKMA 3VQCA 1QHAA 3OYEA 4K8XA 4CGDA 1HQEA 1YVUA 2HNDA 1BA0A 1ZBHA 2CH5A 4WQ5C 2G8WA 1KRPA 5ADXA 4KTQA 3LWLA 1OH8A 3C6TA 5J1EA 3MN9A 3K57A 3NCIA 4CEDA 4C1NK 1HUXA 4IFYA 5C2DA 1NMDA 4E1MA 5AQHA 3MN5A 1YJNN 4CF2A 4KHSA 3KD1E 2FSKA 5FPEA 4CF9A 3OTOK 4DR5K 1WOQA 4KHPK 5J2MA 3DRPA 3LP2A 4BDPA 3ZSZA 4YHHK 1UAXA 3VQAA 4FJLA 3TSPA 3AA5X 1BI4A 1VQON 4N76A 4H4OA 5SZTA 5JMVA 1TKDA 3AVGA 3E1YA 3R1XA 4FJ8A 4EP5A 1P90A 4B9NA 1Z25A 1HPZA 4PUOA 4A2BA 4YOWA 1VAZA 4OGEA 3ENHA 3GE1A 2P9LA 1NK9A 5KRSA 4FWSA 5EX5A 5K14A 1FXXA 3OHRA 3NH2A 2VWKA 4LD0A 4DTRA 3KK7A 4M63C 4IEEA 4JI7K 3VQDA 3AA2A 3VQ4A 2FSNA 4EZ6A 3QB0A 4JKFA 1CXUA 2YJFA 3U6FA 3NVMA 4ELUA 1J6ZA 4JI4K 4E7JA 1WBDA 4ICLA 1XMQK 2Q3SA 4CZJA 3SV3A 1W9HA 4IFVA 1ASVA 3T1YK 4CHNA 5GAHP 3ZSXA 1XI1A 3THVA 3FZFA 3DAWA 1O13A 2R7YA 1HNWK 4CF1A 2O8FB 3QESA 5AQMA 1RTDA 1TV6A 1M1KO 4NXMK 4G1QA 4W5TA 5AFUH 4KI4A 3HVRA 2GX9A 2CGJA 5GIPA 2G8KA 4XH1A 2GBZA 4JKHA 1N5YA 3SBTA 4YDUA 4YOTA 4CECA 3LP1A 3VQEA 2FBXA 2NRHA 3THXB 4JKBA 4OKKA 5M1PA 3L6QA 4MDAA 5AR0A 1RFQA 1ZBIA 3J7YP 1WB9A 3EZ5A 3KLEA 3CQYA 3AVNA 3VN5A 3DI6A 2HBMA 4BRIA 5D3GA 2QEXN 3CXCM 4BGBA 4BDZA 1RBUA 2IVOA 3WQTA 2YHWA 3O9SA 3Q7CA 2ZF5O 4CFBA 3SJJA 4V19S 4FW1A 4H0TB 3PX4A 1HYVA 3ZYYX 2X74A 3OS0A 1X9SA 1XUPO 4DFKA 2CH6A 4CEQA 2VGNA 3ISNC 2HNZA 4JI6K 2YHAA 2O8FA 3WEEB 1V4TA 3AO5A 3DJCA 3IUCA 3A5OC 1CZAN 1S9EA 1QZ5A 2ZGYA 1DT9A 2P9IB 4AHRA 4GKKK 4CJQA 3I8BA 1S3XA 3O9QA 3R8EA 5HRRA 3O9UA 2E2OA 4CIEA 4DUZK 3WUHA 4I2QA 3BZCA 4GY2B 1SKSA 1JLQA 4CGGA 4H5NA 5C42A 3THXA 4BG8A 3QEPA 3TTFA 4DR7K 2YNGA 2GELA 3AO3A 1EWRA 1YF5L 3MECA 4O8KA 4BROA 4GNIA 4X62K 4PQUA 1C6VA 1N36K 1JJ2M 4CJ5A 3QFUA 4YOXA 3PLAA 3K0SA 4IOAL 4DFMA 1REVA 1KD1O 3R3LA 1SL0A 4CBUA 2EX3A 4B8AB 4DTUA 4M3XA 1RT7A 4C8LA 3EE9A 3O4QA 2DFFA 4MLHA 3HOSA 2HF4A 2HVIA 2HBKA 4IBNA 4UY8O 4PKHA 2IGIA 4CBXA 4CD1A 3ZX0A 4Q0BA 2HHWA 5EXWA 3AVIA 4DTMA 1XHZA 4CE9A 1S5JA 2ZD1A 4CGHA 2E1YA 4JLHA 3LL3A 5JICA 1RDWX 2B5JA 3A8YA 1YTUA 3DRRA 4DR6K 3DLLL 3OYAA 3SAFA 4XEIA 3T7ZA 4DSJA 2E6MA 3WEEA 4FLXA 3LWMA 4DB3A 3G6EN 4DUYK 4KKOA 4N5SA 2P9IA 4AHCA 1ATNA 3LDSA 3CETA 4H0VB 5AQUA 3LDOA 1T05A 3FZMA 3VEYA 4BRQA 1MU2A 1KAXA 3TANA 3DLRA 1GLDG 3NFAA 4F8RA 4BRKA 1U2VB 3PUFA 3L0QA 3JAMO 4EHUA 4FJIA 2UXBK 3OYBA 4FJNA 3TAFA 2QWMA 3DXMB 4J2DA 1QSYA 5KPZA 3UE5A 4CK2A 4IXCA 4CK1A 4EAHD 5AQTA 3VESA 2KHOA 3QNOA 1BQNA 3MAQA 4BRDA 3CCSN 2UXCK 1HMVA 1XMOK 2F96A 3QETA 3I55N 3H46O 4EFHA 4ZTJA 1YIJN 4XH5A 4E7IA 1RT4A 2P9KB 3T19A 4J8FA 4FJHA 2HHTA 3A5MC 1UOCA 1NGEA 1RTHA 3CCEN 4CF8A 3UB5A 1VQ6N 4H5WA 5AQGA 3P1GA 1TGOA 1T3VA 5CE3A 4F4KA 1E4FT 1SUQA 3MEDA 1GLEG 1S6QA 3H1VX 2QWRA 4I9QA 1X3MA 4AILC 1WSGA 2AA4A 3U3YA 4H8KA 5HLFA 4JI0K 4K0KK 4JKDA 3HL8A 1NKEA 2HW3A 2Q2RA 2W6LA 4LH4A 3O1BA 1OKJA 3ASMA 3CCJN 1KCFA 4MLEA 3T1AA 2Q0UA 4CHZA 3CMEN 1S1WA 1D5AA 4CHOA 4CGJA 1KAZA 1X9JA 4MDBA 3V1QA 1NM1A 4YOUA 1U2VA 1VRUA 5DM6L 4J2BA 3E01A 3KD5E 4H03B 3M8PA 4NCAA 4M7XA 4OO1J 1W97L 4DU3A 3AO2A 3CCUN 4HCCA 2YHXA 2JWKA 4JI8K 3DXMA 2E4LA 1OH6A 2F8TA 3SQ2A 5AQKA 4FJ7A 3HPHA 1K8KA 2WTUA 3LM9A 3CG7A 3QEVA 4PA1A 1KXPA 4CVNE 5EVZA 2YJEA 4GVMA 4DCHA 3V9UA 1OH7A 2HHHK 2OYQA 4DV0K 2WFBA 2P9KA 1L3UA 2BDPA 3KTQA 1LW2A 4MQ3A 3JXUA 3GL1A 3ATVA 3TSUA 1GLJO 4Z4FA 2X6SA 3DOLA 4DQRA 4RW4A 3C65A 4ISFA 4CZGA 1UA0A 2F9WA 3NDKA 1C0TA 1X9MA 1NNEA 5C25A 5LMNK 2DPNA 4BRAA 3L2UA 3VEXA 3VQPA 5M1OA 3I8DA 3TARA 4CZFA 1SAZA 4ELVA 3AO4A 4WYBA 1WN7A 4MFBA 4NXNK 3NF8A 3CM6A 3SNNA 2W41A 4Z4GA 3DLGA 1FKOA 3CCMN 1C0MA 4FLZA 1GLLO 4FZYA 5T7BA 3W0LA 2G8FA 5AQVA 2VCPA 1SKWA 5JLHA 1JXEA 3H1QA 1VQ4N 3ZETA 3EY1A 4Z94A 3P4IA 4H0OA 1TKXA 2UUCK 3OYLA 3JSMA 3G10A 5C0YA 1HLUA 3LDLA 2IS3A 3VENA 4JK9A 2GEMA 3ENBA 1T6CA 3FGUA 3O5BA 4KHNA 2W42A 3HSCA 5AZJB 5M1QA 3SUOA 4CCHA 4CI6A 3CC4N 2HMIA 3O3HA 1VQKN 4FOEA 4M45A 4BQZA 4DU1A 3P5JA 1QQNA 4FO0A 2O8CA 1RBTA 2ASMA 2P9PB 3ZT3A 4EIAA 4X65K 2NLXA 2FLOA 2OA8A 3KLFA 1NK0A 1KVAA 5BPNA 4Z4CA 4E89A 4M3UA 3DLEA 4BR4A 4M3ZA 1NGCA 5M1FA 1H1VA 3S41A 4LFAK 3LPTA 3DM2A 4M3TA 5AQNA 1TKTA 2HMPA 2RPIA 4H5VA 4BRFA 1L3VA 1RDBA 4GKJK 3KK1A 3J80O 3RRGA 3ID8A 3OS2A 1N6QA 4NO7A 3L2VA 4J2EA 1C1AA 2F9TA 2HB5A 3QO9A 2E20A 2E2NA 1RDUA 3K9JA 4DMNA 3DXKB 4AHSA 3AVAA 1RNHA 3LAMA 1VSHA 4O5FA 5J2QA 2OZSA 4LC9B 2PY5A 2QI2A 4EP4A 1JKHA 3KVGA 1SL2A 4KBOA 2KW4A 4JI2K 1TK5A 4E7LA 4LF8K 1Y97A 4Y0WA 5HL7L 2O8EB 1I39A 4DSEA 4DU4A 1N32K 2P9NB 3VTHA 3L4QA 1S1UA 4I2PA 3K5LA 4EZ9A 3QMLA 4FXDA 3TTDA 4DKWA 3HK2A 3CJBA 1JCGA 3AVCA 3HVTA 5AZJA 4E7KA 3OYIA 4C1NI 4H5TA 3TAGA 3NMUA 1HPMA 4AH9A 4GV9A 1GLBG 2QWNA 3EL2A 4YORA 4DR2K 2P9PA 4DV5K 2A3ZA 4CHQA 4BRHA 4FJ5A 3AA4A 2ZQBA 4FJKA 4W5OA 3B6OA 2D1KA 1RDAA 1NGGA 3VEWA 2QM1A 4BRLA 3U8XA 2FBTA 2RN2A 2G8UA 4KI6A 5JVHL 3PIPL 2OTJN 3DOKA 3HM8A 1KVBA 4FOIA 4CJKA 4DR1K 4B9UA 4H0XB 4HHTA 4CFAA 1BA1A 4DTPA 1HKBA 1VQ5N 2CGKA 3MN6A 5KQDA 3KWIA 4B9QA 1LV5A 4K43A 4RW7A 1JCEA 5AQFA 4FM0A 1HKGA 1T6DA 2X78A 3HP9A 3AAPA 1WLJA 3DXKA 5CZ1A 5JLFA 2OPRA 3VGKA 1QQOA 3HBTA
chains in the Genus database with same CATH topology
3HXMA 3AO5A 2P1JA 3L3UA 4OKJA 3NF7A 4CGFA 3OJSA 4M3RA 3VQQA 3NGZA 1S9EA 1RBVA 2D0AA 4N56A 1ZBLA 4AHRA 4CJUA 4K8ZA 4CJQA 4DTJA 3DYAA 2G8IA 5HRRA 2IOCA 3D45A 4CIEA 4HVJA 5E41A 2D0CA 2XRIA 4I2QA 3UIQA 3ZSWA 3OYGA 2A1RA 3V1OA 1SKSA 1JLQA 3ITHA 4CGGA 4B3OA 1SKRA 4W5NA 3L2RA 3PX6A 2QXFA 4CERA 3RMBA 5C42A 3ZT4A 4RW8A 2O4GA 1HRHA 3QEPA 2YNGA 2OZMA 4Z4HA 3AO3A 3K59A 1BHLA 2YKNA 3ALYA 1BIZA 1NOZA 3MECA 3V9SA 5HP1A 3TR8A 4CEOA 4PQUA 1HQUA 1C6VA 2Y1IA 1RT2A 3NH0A 4KREA 5JS1A 3LALA 1TAQA 4CJ5A 2RF2A 3L2WA 4TSXA 3HP6A 5CYMA 3KK3A 4DSLA 3NF6A 4CHPA 4LH5A 3S3OA 1I3AA 4DFMA 1REVA 1VSIA 1SL0A 4CF0A 1YTAA 2BANA 2EX3A 4FVMA 4B8AB 2A1SA 4DTUA 1NK4A 1WNSA 2Z1JA 1RT7A 4FZZA 2XY8A 4I9LA 4C8LA 3KKSA 3O4QA 5JS2A 2PYJA 2DFFA 1RCHA 3VQ9A 3AVFA 1IKWA 3VA3A 1T8EA 4FZXC 1RT6A 3LANA 2HVIA 3OYFA 4IBNA 4H4MA 4DQPA 2IGIA 3HSTB 4DLGA 4FJXA 4B9LA 4JRQA 3WNGA 4Q0BA 2HHWA 4KRFA 3AVIA 3K2PA 4O0IA 4DTMA 1XHZA 3QEXA 4CE9A 1S5JA 2ZD1A 4CGHA 1LWCA 4JLHA 4DFPA 1T7PA 4Q5VA 1R0AA 1ZBFA 2B5JA 2B4JA 3LZJA 1YTUA 4YNQA 2Z1IA 3DRRA 3PX0A 1XC9A 1D9DA 1KSPA 2HHSA 2ATQA 1JL1A 5EU7A 2KZZA 4FLWA 3OYAA 4HUEA 4DF8A 3KK2A 5DK5A 4DSJA 1CXQA 1NK8A 2F8SA 1WAJA 1DTQA 2E6MA 3HPGA 4FJLA 1DTTA 1RT1A 4RW6A 4KHUA 4ZHRA 4FLXA 3LZIA 3NGIA 3TAPA 2PYLA 1KFDA 3LWMA 3TAQA 4KKOA 4N5SA 1NKBA 4CIFA 5FDLA 2I5JA 4KO0A 2ETJA 4AHCA 2KZMA 1RBRA 1U04A 3LDSA 1ZYQA 3RR7A 1VSDA 4QCLA 4O55A 3SUNA 1HYSA 1RBSA 4CEAA 4R5PA 4F3OA 3AVBA 5FRMA 4QOZB 1T05A 1JLBA 3DLKA 2VG6A 2HHQA 3V9WA 3M8RA 2XO7A 1MU2A 1SV5A 4RW9A 2QKKA 4LSLA 3HT3A 4O5BA 1U48A 3QINA 3TANA 2QKBA 3DLRA 2HNYA 3CFOA 1JXBA 3KLGA 3NFAA 1BCMA 4F8RA 1VSMA 2IDOA 3B6PA 4IG3A 1HNIA 1FK9A 2OPQA 4UQGA 3PY8A 5FRNA 3DLBA 4CHYA 1VSEA 1D9FA 1ITGA 3S3NA 5KI6A 3L3VA 1NJXA 3PUFA 1U47A 4DTNA 2O4IA 4ELTA 4FJIA 3K5NA 3RRHA 1LAVA 3OJUA 3OYBA 1NJZA 3IAYA 3WNEA 5I3UA 2P5GA 1SL1A 3BGRA 4FJNA 2FC0A 4B8CA 3TAFA 1IO2A 3SPYA 4N47A 3AVLA 2ITGA 3SQ0A 4J2DA 1QSYA 1VSFA 1B92A 2IC3A 4QAGA 4CK2A 4CK1A 1QQCA 4KHWA 3QNOA 1BQNA 3MAQA 1BQMA 1QE1A 3WNHA 4DQQA 4M3TA 1JLGA 4NYNA 3AV9A 1BCOA 1HMVA 4DQIA 4YFUA 2F96A 3ZSQA 3QETA 3OY9A 4ID1A 4CFCA 1XWLA 1UWBA 3KKRA 4JS4A 1S9GA 4E7IA 4ZTJA 2KTQA 1RT4A 1S6PA 4OPJA 3T19A 3OYHA 1UA1A 4FJHA 2HHTA 4DFJA 1UOCA 3BDPA 1Q9YA 1RTHA 1NKCA 4M41A 3F73A 4GW6A 4B9TA 1G15A 1L3TA 4CF8A 5HBMA 3SUQA 3M8SA 3F9KA 3P1GA 2XY7A 2G8VA 2DY4A 2DTUA 1VRTA 4DF4A 1TGOA 4JS5A 1Q9XA 3MXIA 4CJLA 4F4KA 1L5UA 3SQ1A 3AVMA 1SUQA 3MEDA 3EYZA 2G8HA 4F3TA 1S6QA 5SWMA 4DSFA 4I9QA 3FFIA 4CGIA 1NK6A 1RT3A 3K5MA 3TAMA 3NHGA 4AILC 3LPUA 5HRNA 1WSGA 3AO1A 3OYJA 1RILA 1S1XA 4H8KA 4DLEA 3I0RA 3U3YA 5HLFA 3DMJA 3M8QA 3H08A 3RMCA 3V6DA 3PV8A 1S1TA 4OLAA 1BGXT 3HL8A 3U3GA 3K58A 4JRPA 4KFBA 3TWHA 1NKEA 4B08A 2KQ2A 2P5OA 4E0DA 2HW3A 4LH4A 1ASWA 2BE2A 2GV9A 3SPZA 2EHGA 1Z26A 3RR8A 3ASMA 1ZBUA 3ZSYA 2Y1JA 4AHUA 2FBVA 1KCFA 3T1AA 4CJTA 4CHZA 4DG1A 1S1WA 1D5AA 4CHOA 4CGJA 4NYFA 3V81A 1A5VA 3G0ZA 4BE0A 1KLNA 4KHQA 4O4GA 3KLIA 3V1QA 3TAEA 2PZSA 3ULDA 1U49A 1U4BA 1IH7A 4CEFA 2XY6A 1VRUA 1NK5A 4J2BA 3QLHA 1NK7A 1CZBA 3E01A 3ZT2A 4ZTFA 4Z4IA 4DS4A 2Z1GA 4L8RB 1JLFA 1GOBA 3KD5E 3M8PA 1EX4A 4B9SA 2YNHA 4NCAA 1IKVA 4DU3A 3HPOA 4CJWA 3AO2A 4KV8A 4CJFA 2HVHA 4FLUA 4HCCA 4OLBA 3HO1A 2X6NA 1WSIA 2RKIA 4CEZA 3SV4A 1WSJA 1J54A 4B9MA 1F21A 1TVRA 3SYZA 1TL1A 3O3GA 1DLOA 2E4LA 3LAKA 3TABA 3MEEA 1QTMA 3SQ2A 2F8TA 4FJ7A 3HPHA 4W5RA 2HHVA 3RMDA 3ZCMA 2JLEA 3NE6A 3ZSVA 2XY5A 4ID5A 3CG7A 3QEVA 4PA1A 4KPYA 4Y1DA 3IRXA 3V9UA 4GVMA 4BWMA 2OYQA 1C0UA 3PO5A 3NF9A 3OYMA 2XHBA 3QEIA 4DWIA 1BI4B 4Z0UA 2HHUA 1L3UA 1KTQA 2BDPA 4DTXA 3KTQA 1LW2A 4MQ3A 1VSLA 5C24A 4C8NA 5HRPA 3CFPA 5J2PA 2HHXA 1LW0A 4IDKA 1HNVA 1BL3A 1S1VA 5I42A 4E7HA 4KB0A 4Z4FA 4PY5A 4M3WA 3ZSRA 4DSIA 2X6SA 2WONA 3DOLA 4DQRA 1TK8A 4RW4A 1QHTA 1JLCA 3OS1A 5FROA 4FYDA 3NGYA 4E19A 4FK0A 2B6AA 2NUBA 4FJ9A 3CYMA 4CJRA 1B9DA 2ZE2A 3IS9A 1UA0A 1ASUA 1U45A 4F2RA 3NDKA 3MEGA 1TAUA 4BE2A 1IKYA 1C0TA 4KB1A 3CM5A 4CJEA 5C25A 1NJYA 1QS4A 1X9MA 1JLEA 3K5OA 1JL2A 4AHTA 3AVJA 3AA3A 1FKPA 1BISA 3QEWA 3OYKA 1KFSA 4M3YA 3L2UA 2D0BA 3VQPA 3I8DA 1VK0A 3WNFA 3ZT1A 3V4IA 3TARA 4FJGA 5CZ2A 4ELVA 3AO4A 1J53A 4CEBA 4M3XA 1WN7A 1RTIA 3NAEA 2YKMA 1EXQA 3VQCA 3O3FA 3OYEA 5KGXA 3O4NA 4MFBA 3SZ2A 1QSLA 3HJFA 4PWDA 2E6LA 3NF8A 3CM6A 4K8XA 4CGDA 3SNNA 4Z4GA 1HQEA 2KFZA 4FLTA 3DLGA 1FKOA 1YVUA 1C0MA 2HNDA 2LSNA 4CJPA 3KJVA 4FLZA 5T7BA 3SI6A 1X9WA 1ZBHA 2G8FA 4IKFA 3OVNA 3A2FA 2G8WA 1KRPA 4KTZA 1RTJA 4KTQA 3P83D 3NH1A 3HYFA 4FLYA 3SQ4A 1JXEA 4CESA 1TK0A 1GOCA 1SKWA 3LWLA 3RWUA 3C6TA 3EY1A 1LWEA 3C94A 3MXJA 4OVLA 1VSKA 3C6UA 5J1EA 5CY4A 1TKXA 3OYCA 1K6YA 3OYLA 3JSMA 3G10A 3RTVA 4FLVA 3K57A 3NCIA 2DFEA 1HJRA 4CEDA 4IFYA 2IS3A 4E1MA 4KHSA 4KHYA 2BGGA 4CF2A 4FM2A 3S3MA 3KD1E 4KHNA 1VSJA 3C95A 4C8MA 4I7FA 2W42A 5KRTA 2OPPA 1A5WA 3SUOA 4CF9A 4NCBA 4CCHA 4DTSA 1EKEA 4CIGA 2P51A 5J2MA 4OPKA 1C1BA 1WAFA 3DRPA 3LP2A 4CJVA 4BDPA 2HMIA 3ZSZA 1UAXA 4CJ3A 3VQAA 3O3HA 4CJSA 3RMAA 1A5XA 3AA5X 4M45A 4DU1A 1BI4A 3VQ5A 3VQ6A 3P5JA 4H4OA 4FCYA 4N76A 5SZTA 1TKDA 3AVGA 3CFRA 1RBTA 4DTOA 3ZT3A 2IAJA 4FJ8A 4EP5A 2OA8A 3KLFA 1NK0A 4B9NA 1JLAA 1KVAA 1Z25A 5KGWA 4KTWA 1T03A 1HPZA 4Z4CA 4E89A 4PUOA 4M3UA 4W5QA 3DLEA 4OGEA 4WE1A 4CJ4A 1NK9A 5KRSA 3L2QA 3MXMA 4M3ZA 3KLHA 3QERA 2VG7A 4FK4A 5K14A 3LPTA 1FXXA 2YNFA 3DM2A 3VQ7A 2VWKA 3NH2A 3JYTA 4LD0A 3S9HA 4DTRA 4DSKA 1TKTA 1CLQA 2RPIA 3VQDA 4IG0A 1L3VA 2KFNA 1RDBA 1D8YA 3AA2A 3VQ4A 3KK1A 5J2NA 4DQSA 4EZ6A 4GMJB 3RRGA 3OS2A 1CXUA 3U6FA 3V1RA 4O0JA 4BACA 4DS5A 1BIUA 4OJRA 3DRSA 4E7JA 3L2VA 2YNIA 2VWJA 1N6QA 4ELUA 4J2EA 1C1AA 3AVHA 3DLHA 4FM1A 2HB5A 3QO9A 4ICLA 1RDDA 2AJQA 3L8BA 2VG5A 5HRSA 2FBYA 2Q3SA 3ZSOA 3VQBA 4DMNA 1W9HA 2YV0X 4IFVA 3SV3A 4F2SA 3QIPA 1ASVA 4AHSA 4OGCA 4CHNA 4Z4EA 3AVAA 3ZSXA 1XI1A 4FK2A 1RNHA 3THVA 3LAMA 1VSHA 2OPSA 4RG8A 5J2QA 3LP3A 2OZSA 2PY5A 4EP4A 2R7YA 5KTQA 1JKHA 1SL2A 1W0HA 1EP4A 4CF1A 3D0PA 4B9VA 2KW4A 5CYQA 4E1NA 3QESA 1TK5A 4BWJA 4E7LA 1QSSA 1KLMA 4CFDA 4HUGA 1Y97A 1RTDA 1TV6A 5DMRA 1C1CA 1I39A 1KVCA 3NBPA 4DSEA 4DU4A 4G1QA 3CQ8A 1YT3A 4W5TA 2D5RA 4KI4A 3HVRA 1S1UA 4AHVA 4I2PA 3K5LA 4EZ9A 4FZYA 1Q8IA 3HM9A 4FXDA 2G8KA 2GBZA 4HCBA 3HK2A 1N5YA 1WSEA 3AVCA 3HVTA 4CECA 4BE1A 4E7KA 3LP1A 3OYNA 3OYIA 1IG9A 3VQEA 2FBXA 3VQ8A 3TAGA 1L3SA 1LWFA 4OKKA 4E3SA 3I0SA 1GOAA 4AH9A 1HYZA 4J2AA 3LP0A 1ZBIA 3T3FA 1RT5A 3V9ZA 1J5OA 4CHQA 3EZ5A 3KLEA 4FJ5A 3AA4A 2ZQBA 4HUFA 2YHBA 3AVNA 2Z1HA 3VN5A 4FJKA 3DI6A 4W5OA 3B6OA 1RDAA 4LY7A 4C8OA 4Y1CA 4OKEA 3OYDA 4XIUA 4FJJA 4FJMA 5D3GA 1J9AA 4N41A 2FBTA 2RN2A 4BDZA 2G8UA 1X1PA 4KI6A 4CK3A 1RBUA 4FW2A 1WSFA 2DFHA 3DOKA 4C8KA 3PO4A 1KVBA 3SUPA 4CJKA 4B9UA 1LAWA 4HHTA 2GUIA 4CFAA 4NCGA 1XHXA 2JGUA 3KIOA 4KAZA 1O1WA 4CFBA 3V9XA 4DTPA 4FW1A 3SJJA 3TI0A 1EETA 1IKXA 3IG1A 3VA0A 3ZT0A 3PX4A 1HYVA 4LSNA 1TKZA 1LV5A 4M42A 2X74A 4RW7A 3OS0A 4FM0A 1X9SA 1NOYA 4HTUA 4BDYA 2X78A 3HP9A 4DFKA 1WLJA 3SCXA 5CZ1A 4CEEA 4CEQA 2QK9A 3ISNC 1CZ9A 2HNZA 1TL3A 2OPRA 2YHAA 4O44A 2WOMA 3AVKA 3QIOA 5HROA 1B9FA 3QNNA 1NJWA 1WSHA 1RDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXM A;  3AO5 A;  2P1J A;  3L3U A;  4OKJ A;  3NF7 A;  4CGF A;  3OJS A;  4M3R A;  3VQQ A;  3NGZ A;  1S9E A;  1RBV A;  2D0A A;  4N56 A;  1ZBL A;  4AHR A;  4CJU A;  4K8Z A;  4CJQ A;  4DTJ A;  3DYA A;  2G8I A;  5HRR A;  2IOC A;  3D45 A;  4CIE A;  4HVJ A;  5E41 A;  2D0C A;  2XRI A;  4I2Q A;  3UIQ A;  3ZSW A;  3OYG A;  2A1R A;  3V1O A;  1SKS A;  1JLQ A;  3ITH A;  4CGG A;  4B3O A;  1SKR A;  4W5N A;  3L2R A;  3PX6 A;  2QXF A;  4CER A;  3RMB A;  5C42 A;  3ZT4 A;  4RW8 A;  2O4G A;  1HRH A;  3QEP A;  2YNG A;  2OZM A;  4Z4H A;  3AO3 A;  3K59 A;  1BHL A;  2YKN A;  3ALY A;  1BIZ A;  1NOZ A;  3MEC A;  3V9S A;  5HP1 A;  3TR8 A;  4CEO A;  4PQU A;  1HQU A;  1C6V A;  2Y1I A;  1RT2 A;  3NH0 A;  4KRE A;  5JS1 A;  3LAL A;  1TAQ A;  4CJ5 A;  2RF2 A;  3L2W A;  4TSX A;  3HP6 A;  5CYM A;  3KK3 A;  4DSL A;  3NF6 A;  4CHP A;  4LH5 A;  3S3O A;  1I3A A;  4DFM A;  1REV A;  1VSI A;  1SL0 A;  4CF0 A;  1YTA A;  2BAN A;  2EX3 A;  4FVM A;  4B8A B;  2A1S A;  4DTU A;  1NK4 A;  1WNS A;  2Z1J A;  1RT7 A;  4FZZ A;  2XY8 A;  4I9L A;  4C8L A;  3KKS A;  3O4Q A;  5JS2 A;  2PYJ A;  2DFF A;  1RCH A;  3VQ9 A;  3AVF A;  1IKW A;  3VA3 A;  1T8E A;  4FZX C;  1RT6 A;  3LAN A;  2HVI A;  3OYF A;  4IBN A;  4H4M A;  4DQP A;  2IGI A;  3HST B;  4DLG A;  4FJX A;  4B9L A;  4JRQ A;  3WNG A;  4Q0B A;  2HHW A;  4KRF A;  3AVI A;  3K2P A;  4O0I A;  4DTM A;  1XHZ A;  3QEX A;  4CE9 A;  1S5J A;  2ZD1 A;  4CGH A;  1LWC A;  4JLH A;  4DFP A;  1T7P A;  4Q5V A;  1R0A A;  1ZBF A;  2B5J A;  2B4J A;  3LZJ A;  1YTU A;  4YNQ A;  2Z1I A;  3DRR A;  3PX0 A;  1XC9 A;  1D9D A;  1KSP A;  2HHS A;  2ATQ A;  1JL1 A;  5EU7 A;  2KZZ A;  4FLW A;  3OYA A;  4HUE A;  4DF8 A;  3KK2 A;  5DK5 A;  4DSJ A;  1CXQ A;  1NK8 A;  2F8S A;  1WAJ A;  1DTQ A;  2E6M A;  3HPG A;  4FJL A;  1DTT A;  1RT1 A;  4RW6 A;  4KHU A;  4ZHR A;  4FLX A;  3LZI A;  3NGI A;  3TAP A;  2PYL A;  1KFD A;  3LWM A;  3TAQ A;  4KKO A;  4N5S A;  1NKB A;  4CIF A;  5FDL A;  2I5J A;  4KO0 A;  2ETJ A;  4AHC A;  2KZM A;  1RBR A;  1U04 A;  3LDS A;  1ZYQ A;  3RR7 A;  1VSD A;  4QCL A;  4O55 A;  3SUN A;  1HYS A;  1RBS A;  4CEA A;  4R5P A;  4F3O A;  3AVB A;  5FRM A;  4QOZ B;  1T05 A;  1JLB A;  3DLK A;  2VG6 A;  2HHQ A;  3V9W A;  3M8R A;  2XO7 A;  1MU2 A;  1SV5 A;  4RW9 A;  2QKK A;  4LSL A;  3HT3 A;  4O5B A;  1U48 A;  3QIN A;  3TAN A;  2QKB A;  3DLR A;  2HNY A;  3CFO A;  1JXB A;  3KLG A;  3NFA A;  1BCM A;  4F8R A;  1VSM A;  2IDO A;  3B6P A;  4IG3 A;  1HNI A;  1FK9 A;  2OPQ A;  4UQG A;  3PY8 A;  5FRN A;  3DLB A;  4CHY A;  1VSE A;  1D9F A;  1ITG A;  3S3N A;  5KI6 A;  3L3V A;  1NJX A;  3PUF A;  1U47 A;  4DTN A;  2O4I A;  4ELT A;  4FJI A;  3K5N A;  3RRH A;  1LAV A;  3OJU A;  3OYB A;  1NJZ A;  3IAY A;  3WNE A;  5I3U A;  2P5G A;  1SL1 A;  3BGR A;  4FJN A;  2FC0 A;  4B8C A;  3TAF A;  1IO2 A;  3SPY A;  4N47 A;  3AVL A;  2ITG A;  3SQ0 A;  4J2D A;  1QSY A;  1VSF A;  1B92 A;  2IC3 A;  4QAG A;  4CK2 A;  4CK1 A;  1QQC A;  4KHW A;  3QNO A;  1BQN A;  3MAQ A;  1BQM A;  1QE1 A;  3WNH A;  4DQQ A;  4M3T A;  1JLG A;  4NYN A;  3AV9 A;  1BCO A;  1HMV A;  4DQI A;  4YFU A;  2F96 A;  3ZSQ A;  3QET A;  3OY9 A;  4ID1 A;  4CFC A;  1XWL A;  1UWB A;  3KKR A;  4JS4 A;  1S9G A;  4E7I A;  4ZTJ A;  2KTQ A;  1RT4 A;  1S6P A;  4OPJ A;  3T19 A;  3OYH A;  1UA1 A;  4FJH A;  2HHT A;  4DFJ A;  1UOC A;  3BDP A;  1Q9Y A;  1RTH A;  1NKC A;  4M41 A;  3F73 A;  4GW6 A;  4B9T A;  1G15 A;  1L3T A;  4CF8 A;  5HBM A;  3SUQ A;  3M8S A;  3F9K A;  3P1G A;  2XY7 A;  2G8V A;  2DY4 A;  2DTU A;  1VRT A;  4DF4 A;  1TGO A;  4JS5 A;  1Q9X A;  3MXI A;  4CJL A;  4F4K A;  1L5U A;  3SQ1 A;  3AVM A;  1SUQ A;  3MED A;  3EYZ A;  2G8H A;  4F3T A;  1S6Q A;  5SWM A;  4DSF A;  4I9Q A;  3FFI A;  4CGI A;  1NK6 A;  1RT3 A;  3K5M A;  3TAM A;  3NHG A;  4AIL C;  3LPU A;  5HRN A;  1WSG A;  3AO1 A;  3OYJ A;  1RIL A;  1S1X A;  4H8K A;  4DLE A;  3I0R A;  3U3Y A;  5HLF A;  3DMJ A;  3M8Q A;  3H08 A;  3RMC A;  3V6D A;  3PV8 A;  1S1T A;  4OLA A;  1BGX T;  3HL8 A;  3U3G A;  3K58 A;  4JRP A;  4KFB A;  3TWH A;  1NKE A;  4B08 A;  2KQ2 A;  2P5O A;  4E0D A;  2HW3 A;  4LH4 A;  1ASW A;  2BE2 A;  2GV9 A;  3SPZ A;  2EHG A;  1Z26 A;  3RR8 A;  3ASM A;  1ZBU A;  3ZSY A;  2Y1J A;  4AHU A;  2FBV A;  1KCF A;  3T1A A;  4CJT A;  4CHZ A;  4DG1 A;  1S1W A;  1D5A A;  4CHO A;  4CGJ A;  4NYF A;  3V81 A;  1A5V A;  3G0Z A;  4BE0 A;  1KLN A;  4KHQ A;  4O4G A;  3KLI A;  3V1Q A;  3TAE A;  2PZS A;  3ULD A;  1U49 A;  1U4B A;  1IH7 A;  4CEF A;  2XY6 A;  1VRU A;  1NK5 A;  4J2B A;  3QLH A;  1NK7 A;  1CZB A;  3E01 A;  3ZT2 A;  4ZTF A;  4Z4I A;  4DS4 A;  2Z1G A;  4L8R B;  1JLF A;  1GOB A;  3KD5 E;  3M8P A;  1EX4 A;  4B9S A;  2YNH A;  4NCA A;  1IKV A;  4DU3 A;  3HPO A;  4CJW A;  3AO2 A;  4KV8 A;  4CJF A;  2HVH A;  4FLU A;  4HCC A;  4OLB A;  3HO1 A;  2X6N A;  1WSI A;  2RKI A;  4CEZ A;  3SV4 A;  1WSJ A;  1J54 A;  4B9M A;  1F21 A;  1TVR A;  3SYZ A;  1TL1 A;  3O3G A;  1DLO A;  2E4L A;  3LAK A;  3TAB A;  3MEE A;  1QTM A;  3SQ2 A;  2F8T A;  4FJ7 A;  3HPH A;  4W5R A;  2HHV A;  3RMD A;  3ZCM A;  2JLE A;  3NE6 A;  3ZSV A;  2XY5 A;  4ID5 A;  3CG7 A;  3QEV A;  4PA1 A;  4KPY A;  4Y1D A;  3IRX A;  3V9U A;  4GVM A;  4BWM A;  2OYQ A;  1C0U A;  3PO5 A;  3NF9 A;  3OYM A;  2XHB A;  3QEI A;  4DWI A;  1BI4 B;  4Z0U A;  2HHU A;  1L3U A;  1KTQ A;  2BDP A;  4DTX A;  3KTQ A;  1LW2 A;  4MQ3 A;  1VSL A;  5C24 A;  4C8N A;  5HRP A;  3CFP A;  5J2P A;  2HHX A;  1LW0 A;  4IDK A;  1HNV A;  1BL3 A;  1S1V A;  5I42 A;  4E7H A;  4KB0 A;  4Z4F A;  4PY5 A;  4M3W A;  3ZSR A;  4DSI A;  2X6S A;  2WON A;  3DOL A;  4DQR A;  1TK8 A;  4RW4 A;  1QHT A;  1JLC A;  3OS1 A;  5FRO A;  4FYD A;  3NGY A;  4E19 A;  4FK0 A;  2B6A A;  2NUB A;  4FJ9 A;  3CYM A;  4CJR A;  1B9D A;  2ZE2 A;  3IS9 A;  1UA0 A;  1ASU A;  1U45 A;  4F2R A;  3NDK A;  3MEG A;  1TAU A;  4BE2 A;  1IKY A;  1C0T A;  4KB1 A;  3CM5 A;  4CJE A;  5C25 A;  1NJY A;  1QS4 A;  1X9M A;  1JLE A;  3K5O A;  1JL2 A;  4AHT A;  3AVJ A;  3AA3 A;  1FKP A;  1BIS A;  3QEW A;  3OYK A;  1KFS A;  4M3Y A;  3L2U A;  2D0B A;  3VQP A;  3I8D A;  1VK0 A;  3WNF A;  3ZT1 A;  3V4I A;  3TAR A;  4FJG A;  5CZ2 A;  4ELV A;  3AO4 A;  1J53 A;  4CEB A;  4M3X A;  1WN7 A;  1RTI A;  3NAE A;  2YKM A;  1EXQ A;  3VQC A;  3O3F A;  3OYE A;  5KGX A;  3O4N A;  4MFB A;  3SZ2 A;  1QSL A;  3HJF A;  4PWD A;  2E6L A;  3NF8 A;  3CM6 A;  4K8X A;  4CGD A;  3SNN A;  4Z4G A;  1HQE A;  2KFZ A;  4FLT A;  3DLG A;  1FKO A;  1YVU A;  1C0M A;  2HND A;  2LSN A;  4CJP A;  3KJV A;  4FLZ A;  5T7B A;  3SI6 A;  1X9W A;  1ZBH A;  2G8F A;  4IKF A;  3OVN A;  3A2F A;  2G8W A;  1KRP A;  4KTZ A;  1RTJ A;  4KTQ A;  3P83 D;  3NH1 A;  3HYF A;  4FLY A;  3SQ4 A;  1JXE A;  4CES A;  1TK0 A;  1GOC A;  1SKW A;  3LWL A;  3RWU A;  3C6T A;  3EY1 A;  1LWE A;  3C94 A;  3MXJ A;  4OVL A;  1VSK A;  3C6U A;  5J1E A;  5CY4 A;  1TKX A;  3OYC A;  1K6Y A;  3OYL A;  3JSM A;  3G10 A;  3RTV A;  4FLV A;  3K57 A;  3NCI A;  2DFE A;  1HJR A;  4CED A;  4IFY A;  2IS3 A;  4E1M A;  4KHS A;  4KHY A;  2BGG A;  4CF2 A;  4FM2 A;  3S3M A;  3KD1 E;  4KHN A;  1VSJ A;  3C95 A;  4C8M A;  4I7F A;  2W42 A;  5KRT A;  2OPP A;  1A5W A;  3SUO A;  4CF9 A;  4NCB A;  4CCH A;  4DTS A;  1EKE A;  4CIG A;  2P51 A;  5J2M A;  4OPK A;  1C1B A;  1WAF A;  3DRP A;  3LP2 A;  4CJV A;  4BDP A;  2HMI A;  3ZSZ A;  1UAX A;  4CJ3 A;  3VQA A;  3O3H A;  4CJS A;  3RMA A;  1A5X A;  3AA5 X;  4M45 A;  4DU1 A;  1BI4 A;  3VQ5 A;  3VQ6 A;  3P5J A;  4H4O A;  4FCY A;  4N76 A;  5SZT A;  1TKD A;  3AVG A;  3CFR A;  1RBT A;  4DTO A;  3ZT3 A;  2IAJ A;  4FJ8 A;  4EP5 A;  2OA8 A;  3KLF A;  1NK0 A;  4B9N A;  1JLA A;  1KVA A;  1Z25 A;  5KGW A;  4KTW A;  1T03 A;  1HPZ A;  4Z4C A;  4E89 A;  4PUO A;  4M3U A;  4W5Q A;  3DLE A;  4OGE A;  4WE1 A;  4CJ4 A;  1NK9 A;  5KRS A;  3L2Q A;  3MXM A;  4M3Z A;  3KLH A;  3QER A;  2VG7 A;  4FK4 A;  5K14 A;  3LPT A;  1FXX A;  2YNF A;  3DM2 A;  3VQ7 A;  2VWK A;  3NH2 A;  3JYT A;  4LD0 A;  3S9H A;  4DTR A;  4DSK A;  1TKT A;  1CLQ A;  2RPI A;  3VQD A;  4IG0 A;  1L3V A;  2KFN A;  1RDB A;  1D8Y A;  3AA2 A;  3VQ4 A;  3KK1 A;  5J2N A;  4DQS A;  4EZ6 A;  4GMJ B;  3RRG A;  3OS2 A;  1CXU A;  3U6F A;  3V1R A;  4O0J A;  4BAC A;  4DS5 A;  1BIU A;  4OJR A;  3DRS A;  4E7J A;  3L2V A;  2YNI A;  2VWJ A;  1N6Q A;  4ELU A;  4J2E A;  1C1A A;  3AVH A;  3DLH A;  4FM1 A;  2HB5 A;  3QO9 A;  4ICL A;  1RDD A;  2AJQ A;  3L8B A;  2VG5 A;  5HRS A;  2FBY A;  2Q3S A;  3ZSO A;  3VQB A;  4DMN A;  1W9H A;  2YV0 X;  4IFV A;  3SV3 A;  4F2S A;  3QIP A;  1ASV A;  4AHS A;  4OGC A;  4CHN A;  4Z4E A;  3AVA A;  3ZSX A;  1XI1 A;  4FK2 A;  1RNH A;  3THV A;  3LAM A;  1VSH A;  2OPS A;  4RG8 A;  5J2Q A;  3LP3 A;  2OZS A;  2PY5 A;  4EP4 A;  2R7Y A;  5KTQ A;  1JKH A;  1SL2 A;  1W0H A;  1EP4 A;  4CF1 A;  3D0P A;  4B9V A;  2KW4 A;  5CYQ A;  4E1N A;  3QES A;  1TK5 A;  4BWJ A;  4E7L A;  1QSS A;  1KLM A;  4CFD A;  4HUG A;  1Y97 A;  1RTD A;  1TV6 A;  5DMR A;  1C1C A;  1I39 A;  1KVC A;  3NBP A;  4DSE A;  4DU4 A;  4G1Q A;  3CQ8 A;  1YT3 A;  4W5T A;  2D5R A;  4KI4 A;  3HVR A;  1S1U A;  4AHV A;  4I2P A;  3K5L A;  4EZ9 A;  4FZY A;  1Q8I A;  3HM9 A;  4FXD A;  2G8K A;  2GBZ A;  4HCB A;  3HK2 A;  1N5Y A;  1WSE A;  3AVC A;  3HVT A;  4CEC A;  4BE1 A;  4E7K A;  3LP1 A;  3OYN A;  3OYI A;  1IG9 A;  3VQE A;  2FBX A;  3VQ8 A;  3TAG A;  1L3S A;  1LWF A;  4OKK A;  4E3S A;  3I0S A;  1GOA A;  4AH9 A;  1HYZ A;  4J2A A;  3LP0 A;  1ZBI A;  3T3F A;  1RT5 A;  3V9Z A;  1J5O A;  4CHQ A;  3EZ5 A;  3KLE A;  4FJ5 A;  3AA4 A;  2ZQB A;  4HUF A;  2YHB A;  3AVN A;  2Z1H A;  3VN5 A;  4FJK A;  3DI6 A;  4W5O A;  3B6O A;  1RDA A;  4LY7 A;  4C8O A;  4Y1C A;  4OKE A;  3OYD A;  4XIU A;  4FJJ A;  4FJM A;  5D3G A;  1J9A A;  4N41 A;  2FBT A;  2RN2 A;  4BDZ A;  2G8U A;  1X1P A;  4KI6 A;  4CK3 A;  1RBU A;  4FW2 A;  1WSF A;  2DFH A;  3DOK A;  4C8K A;  3PO4 A;  1KVB A;  3SUP A;  4CJK A;  4B9U A;  1LAW A;  4HHT A;  2GUI A;  4CFA A;  4NCG A;  1XHX A;  2JGU A;  3KIO A;  4KAZ A;  1O1W A;  4CFB A;  3V9X A;  4DTP A;  4FW1 A;  3SJJ A;  3TI0 A;  1EET A;  1IKX A;  3IG1 A;  3VA0 A;  3ZT0 A;  3PX4 A;  1HYV A;  4LSN A;  1TKZ A;  1LV5 A;  4M42 A;  2X74 A;  4RW7 A;  3OS0 A;  4FM0 A;  1X9S A;  1NOY A;  4HTU A;  4BDY A;  2X78 A;  3HP9 A;  4DFK A;  1WLJ A;  3SCX A;  5CZ1 A;  4CEE A;  4CEQ A;  2QK9 A;  3ISN C;  1CZ9 A;  2HNZ A;  1TL3 A;  2OPR A;  2YHA A;  4O44 A;  2WOM A;  3AVK A;  3QIO A;  5HRO A;  1B9F A;  3QNN A;  1NJW A;  1WSH A;  1RDC A; 
#chains in the Genus database with same CATH topology
 3L3U A;  2P1J A;  3IMX A;  4CGF A;  3HZ6 A;  2PFU A;  3NGZ A;  1LCU A;  3CPW M;  2O8E A;  2D0A A;  2ZWH A;  4CJU A;  4E1J A;  4K8Z A;  3FE1 A;  5F2R A;  4A57 A;  2IOC A;  3CIP A;  3AAQ A;  4CZH A;  4HVJ A;  1YVN A;  2J4R A;  5E41 A;  3SLC A;  3ZSW A;  4B3O A;  1MDU B;  1SKR A;  4W5N A;  3L2R A;  3RMB A;  1WUA A;  1HRH A;  3HOT A;  2OZM A;  4Z4H A;  2YKN A;  4BRP A;  1BIZ A;  1NOZ A;  3V9S A;  3AY9 A;  4IDH A;  1HR0 K;  1HQU A;  5JS1 A;  1RT2 A;  1TAQ A;  2F4V K;  4H0P A;  3HP6 A;  3A5L C;  4LH5 A;  2ITM A;  1VSI A;  2GTD A;  4AF1 A;  1FW6 A;  5BRE A;  2GWJ A;  2XY8 A;  1VQP N;  3VQ9 A;  3AVF A;  1IKW A;  1T8E A;  4FZX C;  1BWF O;  4DQP A;  3WNG A;  3OBW A;  4BC5 A;  3MN7 A;  4DFP A;  1R0A A;  2B4J A;  1D9D A;  3PX0 A;  2HHS A;  2ATQ A;  1JL1 A;  3FLC O;  1HNZ K;  2I7N A;  3KZB A;  2HOE A;  4DF8 A;  3KK2 A;  5DK5 A;  4BC3 A;  4KHU A;  2A42 A;  3BEX A;  3CHW A;  5BR9 A;  2YI1 A;  3NGI A;  3LZI A;  2WUS A;  2PYL A;  4KH4 A;  4FVU A;  4JKA A;  4GV3 A;  1NKB A;  5FDL A;  4KO0 A;  3E9P A;  1N33 K;  1RBR A;  4JV5 K;  3MK6 A;  1ZYQ A;  3RR7 A;  4QCL A;  4A62 A;  4O55 A;  1HYS A;  3D2E B;  1RBS A;  5FRM A;  4F3O A;  3AVB A;  1VQ8 N;  4QOZ B;  2E8A A;  1JLB A;  1KQS M;  2VG6 A;  3J7Z O;  4KH6 A;  3ATU A;  4RW9 A;  2QKK A;  4LSL A;  2NZT A;  3MWT A;  2QKB A;  3EEQ A;  2HNY A;  2IDO A;  1HNI A;  1FK9 A;  4UQG A;  3PY8 A;  2PAV A;  3L3V A;  2NNW A;  1NJX A;  1NGH A;  1X3N A;  3FR0 A;  1U47 A;  4DTN A;  5BPM A;  3O9T A;  3LM2 A;  2NRV A;  4JHD B;  5I3U A;  4B8C A;  3RSE B;  5GIN A;  3BF1 A;  4OPA A;  3SQ0 A;  4LFB K;  1VSF A;  3H3N O;  4KHW A;  5AQI A;  4DV7 K;  3WNH A;  1NWK A;  4NYN A;  4YFU A;  3ZSQ A;  2OCE A;  1XWL A;  3CJ9 A;  3KKR A;  1S9G A;  4JS4 A;  1UA1 A;  4OPJ A;  3VF6 A;  1NKC A;  1XNQ K;  4GW6 A;  4B9T A;  1G15 A;  3SUQ A;  1MWM A;  3F9K A;  1XQS C;  2EWS A;  1L5U A;  2BTF A;  3AVM A;  3EYZ A;  3SQ1 A;  4CZE A;  4C23 A;  1NMN A;  3FFK B;  4CGI A;  1RT3 A;  4X64 K;  3AO1 A;  1RIL A;  3I0R A;  3PV8 A;  4JK7 A;  3U3G A;  3TWH A;  1OH5 A;  5CR4 A;  4FWP A;  1Z26 A;  3ZSY A;  2RE2 A;  2Y1J A;  3MMV A;  4AHU A;  4BC2 A;  1TYQ B;  4NYF A;  3V81 A;  4KHQ A;  2HBL A;  5BRD A;  3KLI A;  3TAE A;  2XY6 A;  4JYA K;  4FWK A;  1NK5 A;  1CZB A;  1BOT O;  3MX5 A;  4DV4 K;  4ZTF A;  4Z4I A;  1Y64 A;  1GOB A;  4B9S A;  2YNH A;  4BR7 A;  1XC3 A;  4JHD A;  3HPO A;  2HVH A;  2QA4 N;  3VF4 A;  2GWK A;  2A41 A;  1WSI A;  3RSE A;  2P9S B;  4A2A A;  4FL9 A;  4DR3 K;  2HHV A;  4W5R A;  2UUB K;  2JLE A;  3NE6 A;  2XY5 A;  4Y1D A;  3IRX A;  1QVG M;  1NGD A;  2Q36 A;  3OYM A;  4MO5 A;  1BG3 A;  4NLB A;  1NGF A;  3QEI A;  1KTQ A;  4BG9 A;  4C8N A;  1LW0 A;  4IDK A;  1HNV A;  4PY5 A;  4B3S K;  4DSI A;  3VGM A;  1QHT A;  5FRO A;  3VTI A;  3NGY A;  4FK0 A;  2NUB A;  3HRG A;  2WC9 A;  1U45 A;  4F2R A;  3F2K A;  3MEG A;  4BE2 A;  4KB1 A;  2A40 A;  5AZI B;  3BUZ B;  3AVJ A;  1BIS A;  5TKY A;  1Z05 A;  4JAX A;  3OYK A;  4M3Y A;  3EKS A;  3WNF A;  5AQQ A;  3V4I A;  3P39 A;  3NAE A;  1ATS A;  1TYQ A;  3O3F A;  4PWD A;  1BO5 O;  1MA9 B;  2NRT A;  2E6L A;  3TSQ A;  4CJ7 A;  4GV6 A;  3I56 N;  1X9W A;  4IKF A;  3CMA N;  3OVN A;  3A2F A;  4JK8 A;  3G4S N;  4DR4 K;  4KTZ A;  3P83 D;  1TK0 A;  4FLY A;  4CES A;  5EOY A;  4CZI A;  3RWU A;  1LWE A;  3MXJ A;  1VSK A;  2FXU A;  4FWL A;  3OYC A;  1T44 A;  4FLV A;  1N34 K;  1DEJ A;  2VYP A;  4KHY A;  1HJR A;  2P9S A;  3IFR A;  1E4G T;  1R59 O;  1Q82 O;  3S3M A;  1VSJ A;  3C95 A;  4BVO A;  4I7F A;  4BR2 A;  4WF9 L;  1TUU A;  4NCB A;  3VET A;  4DTS A;  3B8A X;  4OPK A;  1WAF A;  4CJ3 A;  1IBM K;  1A5X A;  3SI6 A;  3VQ5 A;  4FCY A;  1YAG A;  1GLF O;  3CFR A;  4DTO A;  5DM7 L;  4PHT X;  3ZEU B;  4KTW A;  1T03 A;  4W5Q A;  2QXL A;  2HBJ A;  4CJ4 A;  3L2Q A;  5CHI A;  3MXM A;  3M1F A;  3KLH A;  1JCF A;  3QER A;  4FK4 A;  3JYT A;  3VQ7 A;  1BUP A;  1G99 A;  3S9H A;  1CLQ A;  4IOX A;  4NB4 A;  3ZLJ A;  4IG0 A;  2KFN A;  1D8Y A;  5LJV A;  5AZI A;  5J2N A;  3QBX A;  4GMJ B;  4JI5 K;  4O0J A;  4BAC A;  4F9O A;  4DS5 A;  3DRS A;  2VWJ A;  4OPH A;  3AVH A;  3TU5 A;  4FM1 A;  4O8U A;  3CCL N;  3L8B A;  5HRS A;  3THW B;  3ZSO A;  3HJF A;  1WBB A;  5FPN A;  3QIP A;  4YOY A;  4Z4E A;  3AGK A;  2Q31 A;  4RG8 A;  3LP3 A;  5KTQ A;  3MX2 A;  1Q81 O;  1W0H A;  1EP4 A;  3D0P A;  5CYQ A;  2KLA A;  4BWJ A;  1QSS A;  1KLM A;  4HUG A;  5DMR A;  3F9M A;  4AQY K;  3NBP A;  3WT0 A;  1YT3 A;  4AHV A;  2JWL A;  1YI2 N;  2Q1N A;  3CJ7 A;  1Q8I A;  1SZ2 A;  3HM9 A;  4HCB A;  3VPZ A;  1WSE A;  3IDH A;  5M1K A;  1EQY A;  5AQW A;  4PKG A;  4BE1 A;  3OYN A;  3L4I A;  3MCA B;  1IG9 A;  3QFP A;  3J8A A;  1LWF A;  4E3S A;  4PKI A;  3I0S A;  1GOA A;  4J2A A;  1RT5 A;  4WQ5 A;  4HUF A;  2Z1H A;  5FPM A;  3JS6 A;  4WQ4 C;  4JNE A;  3ZEU A;  4LY7 A;  4IO8 A;  4OKE A;  4Y1C A;  4FJM A;  4FWN A;  4NLC A;  3HTV A;  1YJ9 N;  1WSF A;  2DFH A;  4C8K A;  3SUP A;  3WXI A;  1NG9 A;  1IBK K;  3J7A P;  4BY9 C;  3TI0 A;  4LF6 K;  1EET A;  1IKX A;  3IG1 A;  4QS9 A;  5BRH A;  4M42 A;  4JKE A;  5C12 A;  2ZJQ L;  4HTU A;  3THW A;  1KAY A;  2WBN A;  3FZL A;  3SCX A;  1IV0 A;  1CZ9 A;  1TL3 A;  4G9Z A;  4O44 A;  2WOM A;  3C6A A;  3QIO A;  1NJW A;  1EO1 A;  3ULE B;  3CC7 N;  2UUA K;  2OAN A;  4M3R A;  3VQQ A;  1RBV A;  1ZBL A;  2UU9 K;  2D0O A;  4WFB L;  4B3R K;  3H6E A;  4DHY A;  2D0C A;  3UIQ A;  3OYG A;  2A1R A;  3ITH A;  5BR8 K;  3PX6 A;  4B1Z A;  4RW8 A;  2O4G A;  1NJI O;  4FWM A;  5EY4 A;  1LOT B;  3K59 A;  1BHL A;  1ILY A;  3M6G A;  4DV1 K;  5HP1 A;  4CEO A;  4KRE A;  2Y1I A;  3NH0 A;  2QWQ A;  3SJH A;  5KPT A;  2O8D B;  3QIC A;  3NF6 A;  4CHP A;  3EE8 A;  3S3O A;  1I3A A;  3BP8 A;  1NK4 A;  3ZX3 A;  2BAN A;  3M3Z A;  2A1S A;  1WNS A;  2Z1J A;  5BPL A;  2PYJ A;  3UKU B;  1BU6 O;  3VA3 A;  1RT6 A;  3LAN A;  1EWQ A;  3OYF A;  2F7T A;  4H4M A;  3HST B;  4JRQ A;  3CPE A;  1HNX K;  3K2P A;  2IVP A;  1LWC A;  4Q5V A;  1ZBF A;  3LZJ A;  4YNQ A;  1KSP A;  2NRR A;  1ATR A;  5EU7 A;  2KZZ A;  5AFU A;  3QBW A;  3WXK A;  4FLW A;  4HUE A;  2BH1 A;  1CXQ A;  1WAJ A;  3HPG A;  2E1Z A;  3ULE A;  1HJO A;  5F0X A;  3TAQ A;  1FJG K;  2NRX A;  3AAR A;  4CIF A;  2ETJ A;  2KZM A;  1U04 A;  4H5R A;  3SUN A;  3CF5 L;  3EZW A;  4R5P A;  4CEA A;  4FPB A;  2V51 B;  2HHQ A;  2PBD A;  3O6W A;  3V9W A;  1SV5 A;  4O5B A;  1U48 A;  3QIN A;  2O8B B;  3CFO A;  1JXB A;  3KLG A;  1BCM A;  1VSM A;  1P8Z A;  4IG3 A;  5FRN A;  3DLB A;  4CHY A;  1SQK A;  1ITG A;  4JI1 K;  3VOV A;  1W2B M;  5AQS A;  2V52 B;  4IEI A;  4ELT A;  2O8D A;  1LAV A;  1VQM N;  3A0I X;  4M7Y A;  3IAY A;  3WNE A;  1SL1 A;  2FC0 A;  4AM6 A;  3SPY A;  3AVL A;  3UKU A;  4YY3 K;  1QQC A;  1BQM A;  1QE1 A;  4DQQ A;  1JLG A;  1SS6 A;  3AV9 A;  1BCO A;  4B1V A;  3EO3 A;  3BY5 A;  3QDK A;  3OY9 A;  5AQZ A;  1UWB A;  1D4X A;  3OYH A;  1S6P A;  2UXD K;  2P9N A;  3BDP A;  1Q9Y A;  3UKR B;  4H0Y B;  4LF9 K;  4ILJ A;  2XY7 A;  2DY4 A;  2DTU A;  2YHY A;  1VRT A;  4A61 A;  1Q9X A;  4BR0 A;  2W40 A;  5MLC Q;  2YX6 A;  5SWM A;  3CD6 N;  3K5M A;  3NHG A;  3LPU A;  5HRN A;  4BR9 A;  3OYJ A;  4DLE A;  3DWL A;  3M8Q A;  4LFC K;  1S1T A;  3T1H K;  1DKG D;  3RVC A;  2P5O A;  4CZL A;  1C0F A;  4BRM A;  4E0D A;  1ASW A;  2GV9 A;  1ZBU A;  1VHX A;  5AQP A;  2FBV A;  5JVG L;  3IKM A;  4CJT A;  4ILH A;  4DG1 A;  2O8B A;  3SK3 A;  1NBW A;  2AP1 A;  4DQ8 A;  4O4G A;  3MWP A;  2PZS A;  3ULD A;  1U49 A;  1U4B A;  1IH7 A;  4CEF A;  1NK7 A;  2HST A;  4QS8 A;  3CJC A;  4DS4 A;  2Z1G A;  4JEP A;  1JLF A;  4X66 K;  1IKV A;  3E66 A;  2OTL N;  5BRF A;  4CJW A;  4FLU A;  4OLB A;  2P9U B;  2X6N A;  3HO1 A;  1WSJ A;  1J54 A;  4CW7 B;  3MCP A;  1F21 A;  3SYZ A;  3TAB A;  1NGB A;  3MEE A;  3M5R A;  3ZCM A;  4ID5 A;  1ESV A;  4U67 L;  1VQ7 N;  4KPY A;  4BWM A;  5H1S Q;  1VQN N;  2D0P A;  3R9P A;  4Z0U A;  3U4L A;  3GOI A;  4BQL A;  2HHU A;  4DTX A;  3T69 A;  5C24 A;  3UKR A;  5HRP A;  4YOV A;  4IZ9 A;  1BL3 A;  1S1V A;  1Z6R A;  4E7H A;  5IWA K;  4WFA L;  3ZSR A;  2GUP A;  1S72 N;  1TUY A;  2WON A;  1RGI A;  4BRN A;  3CYM A;  2ZE2 A;  3PSI A;  4WCE L;  2Q97 A;  2FSJ A;  2ZJP L;  4BVP A;  1OVY A;  1QS4 A;  3SBG A;  1K73 O;  2YCH A;  1JL2 A;  3C0B A;  4AHT A;  3D6R A;  3AA3 A;  1FKP A;  1KFS A;  1K8A O;  1BDG A;  3ZT1 A;  3THY B;  4FJG A;  5CZ2 A;  4CEB A;  1RTI A;  3CC2 N;  1EXQ A;  4IOC L;  5KGX A;  3O4N A;  3SZ2 A;  1QSL A;  3CCR N;  2KFZ A;  4FLT A;  2LSN A;  4CJP A;  5ADX H;  3KJV A;  4PL8 A;  2NRW A;  3O80 A;  1RTJ A;  3C7N B;  3HYF A;  3NH1 A;  3SQ4 A;  1GOC A;  1KC8 O;  3GG4 A;  3C94 A;  4OVL A;  3C6U A;  1NGI A;  5CY4 A;  1K6Y A;  4L3Q A;  2P9U A;  4B1Y B;  3RTV A;  2DFE A;  4IJN A;  3ZX2 A;  2BGG A;  4RTF D;  4OX9 K;  4FM2 A;  2UYT A;  4C8M A;  5KRT A;  2OPP A;  1A5W A;  1GLC G;  5AQL A;  1OVQ A;  1EKE A;  4CIG A;  2P51 A;  1C1B A;  4B1X B;  4CJV A;  3O08 A;  1C0G A;  3PSF A;  3RMA A;  4CJS A;  3VQ6 A;  3D7E O;  1J5E K;  2IAJ A;  2FF6 A;  3D2E A;  1S22 A;  4FWR A;  1E3M A;  1JLA A;  3WXL A;  4AM7 A;  5KGW A;  4HWI A;  4FWQ A;  3N4P A;  4WE1 A;  1ZXO A;  2VG7 A;  2YNF A;  4DSK A;  3A5N C;  4KH5 A;  4A59 A;  4DQS A;  4B1U B;  3V1R A;  4LF5 K;  4EHT A;  1BIU A;  4OJR A;  5M1N A;  2YNI A;  3CCQ N;  3W3D A;  3DLH A;  2E88 A;  3THY A;  1RDD A;  2AJQ A;  2VG5 A;  2FBY A;  2QTD A;  3VQB A;  4F2S A;  2YV0 X;  2A5X A;  3SAH A;  3G71 N;  4OGC A;  5F1X A;  3EN9 A;  4FK2 A;  2OPS A;  4PL7 A;  3D2F B;  4B9V A;  4E1N A;  3C7N A;  4CFD A;  4DV3 K;  2CGL A;  1C1C A;  1KVC A;  1YIT N;  3CQ8 A;  2D5R A;  4RCH A;  5LMU K;  4WQ4 A;  2ZM6 K;  5ELZ A;  1I94 K;  2V7Y A;  4B3T K;  5BN8 A;  1HKC A;  4JN4 A;  1VQL N;  3VQ8 A;  5FLX O;  1L3S A;  5LY3 A;  3Q7B A;  1YJW N;  1HYZ A;  4HTL A;  3LP0 A;  3T3F A;  3V9Z A;  1J5O A;  3VEV A;  2YHB A;  5B8H A;  4JD2 B;  4C8O A;  3OYD A;  4XIU A;  1NU0 A;  3N4Q A;  4FJJ A;  5GAD P;  4YDU C;  4DV2 K;  4BRE A;  3VGL A;  1J9A A;  4ISE A;  4N41 A;  1X1P A;  3CJA A;  4CK3 A;  4FW2 A;  2VWB A;  3PO4 A;  4IO9 L;  1LAW A;  2GUI A;  4NCG A;  4BGA A;  2E2P A;  1XHX A;  1GLA G;  2JGU A;  3FZH A;  3KIO A;  4KAZ A;  1O1W A;  3V9X A;  1U6Z A;  3LDP A;  3U9Z A;  3O1W A;  3VEZ A;  3VA0 A;  3ZT0 A;  4LSN A;  1TKZ A;  2HF3 A;  2VGM A;  3WXJ A;  1DGK N;  1NOY A;  4BDY A;  4A5A A;  4CEE A;  2QK9 A;  4FWO A;  3AVK A;  3D2F A;  5HRO A;  1B9F A;  3QNN A;  1K8K B;  1WSH A;  1RDC A;  3HXM A;  4B1W B;  4IFE A;  3OJS A;  4OKJ A;  3NF7 A;  2A6A A;  4N56 A;  4DTJ A;  3VEO A;  3DYA A;  2G8I A;  3D45 A;  3LDQ A;  5LJW A;  2Q0R A;  2XRI A;  1HX1 A;  3V1O A;  2ZJR L;  1Q18 A;  1MWK A;  2QXF A;  4CER A;  3ZT4 A;  4U7B A;  1YHQ N;  4JKC A;  5KQ8 A;  3K9K A;  3ALY A;  2E2Q A;  3KWG A;  3OBY A;  3TR8 A;  3O8M A;  3HI0 A;  2I7P A;  3OA9 A;  3LAL A;  4JD2 A;  3CER A;  2RF2 A;  3L2W A;  4WFN L;  2QWL A;  4TSX A;  5CYM A;  3KK3 A;  4DSL A;  2E5L K;  4IJA A;  2V7Z A;  4JKG B;  4CF0 A;  1YTA A;  4FVM A;  4FZZ A;  4FSV A;  4I9L A;  3KKS A;  5JS2 A;  5AQJ A;  1RCH A;  4CBW A;  5C2F A;  5GAE P;  4DLG A;  4FJX A;  4B9L A;  4XH4 A;  4KRF A;  4RWT A;  4O0I A;  1NLV A;  3QEX A;  5E26 A;  5GIO A;  1T7P A;  3ZET B;  5I9E B;  2Z1I A;  1XC9 A;  4BC4 A;  4R79 A;  5AQR A;  1QVF M;  5AQX A;  3ENO A;  2F8S A;  1NK8 A;  1DTQ A;  1DTT A;  1RT1 A;  4RW6 A;  3CJ1 A;  4ZHR A;  3P38 A;  4CZK A;  3TAP A;  1KFD A;  2RHK A;  1Q7Y O;  5C15 A;  2H3G X;  4ILG B;  3WXM B;  2I5J A;  5IT9 O;  2IIR A;  2O8C B;  5C10 A;  2IVN A;  1VSD A;  4JI3 K;  4A5B A;  3DLK A;  3NVK A;  1M90 O;  3M8R A;  2XO7 A;  1XNR K;  1IG8 A;  4GVE A;  3HT3 A;  2ZGZ A;  3FZK A;  2W6K A;  3B6P A;  2OPQ A;  1VSE A;  1D9F A;  3S3N A;  5KI6 A;  2QWP A;  3E9L A;  1W7A A;  2O4I A;  3K5N A;  3RRH A;  3OJU A;  5AQY A;  1NJZ A;  3H3O B;  4JKG A;  2FF3 B;  2P5G A;  3BGR A;  1IO2 A;  3GBT A;  4N47 A;  1N8R O;  3G25 A;  2ITG A;  5GAG P;  4BR5 A;  3TPQ A;  1B92 A;  2IC3 A;  4QAG A;  3P31 A;  3CCV N;  4DQI A;  3KHY A;  3ID6 A;  5A2Q O;  3MDQ A;  4ID1 A;  4CFC A;  1ZBS A;  2NRZ A;  4LF4 K;  2KTQ A;  3VMF B;  5AQO A;  4DFJ A;  4FPA A;  3I33 A;  4M41 A;  3F73 A;  1L3T A;  4LF7 K;  5HBM A;  3M8S A;  2G8V A;  4K41 A;  5KPR A;  4DF4 A;  3GDQ A;  4JS5 A;  3H45 C;  3MXI A;  4CJL A;  1YUW A;  3EKU A;  2QWO A;  1V4S A;  2G8H A;  4F3T A;  1QZ6 A;  3TTC A;  4DSF A;  3FFI A;  3VER A;  1NK6 A;  3CI5 A;  4MO4 A;  3TAM A;  4I6M B;  3SAG A;  3O9R A;  1S1X A;  3DMJ A;  2QW9 A;  3H08 A;  3E9O A;  3J81 O;  3RMC A;  4BRC A;  3V6D A;  5AJ3 K;  2VQF K;  1BGX T;  3K58 A;  4JRP A;  4OLA A;  4KFB A;  4B08 A;  2KQ2 A;  3R6M A;  2BE2 A;  3SPZ A;  3RR8 A;  2EHG A;  2KKZ A;  4K42 A;  3C6H A;  1Q86 O;  1VQ9 N;  1A5V A;  3BF3 A;  3G0Z A;  2BUP A;  4BE0 A;  1KLN A;  1NGA A;  4CZM A;  3F5T A;  2ASO A;  3QLH A;  1NGJ A;  3ZT2 A;  2D4W A;  4L8R B;  1EX4 A;  5BN9 A;  4KV8 A;  4CJF A;  2ASP A;  2RKI A;  4CEZ A;  3SV4 A;  4B9M A;  1TVR A;  1TL1 A;  3O3G A;  1DLO A;  3AGR A;  3LAK A;  1QTM A;  3LDN A;  3RMD A;  4DV6 K;  4K25 A;  3ZSV A;  5HOO A;  5LL6 Z;  1YXQ A;  3VF2 A;  3BZK A;  4CD3 A;  1C0U A;  3PO5 A;  3NF9 A;  5E84 A;  2XHB A;  4DWI A;  1BI4 B;  1IJJ A;  1ZC6 A;  1VSL A;  3CFP A;  5J2P A;  2HHX A;  1QQM A;  5I42 A;  4KB0 A;  3PIO L;  4M3W A;  3WQU A;  1TK8 A;  2P9L B;  5FPD A;  1JLC A;  4ISG A;  3OS1 A;  4IWV A;  4FYD A;  4E19 A;  2B6A A;  4QS7 A;  4FJ9 A;  4B3M K;  4CJR A;  1B9D A;  3IS9 A;  1IBL K;  1ASU A;  3OW2 M;  1TAU A;  1IKY A;  4I6M A;  2VQE K;  3CM5 A;  3SMS A;  4CJE A;  1NJY A;  3SMP A;  1JLE A;  3K5O A;  3O4W A;  3U9D A;  3QEW A;  4BRG A;  2D0B A;  1VK0 A;  5TKW A;  3CQX A;  1K9M O;  1J53 A;  2YKM A;  3VQC A;  1QHA A;  3OYE A;  4K8X A;  4CGD A;  1HQE A;  1YVU A;  2HND A;  1BA0 A;  1ZBH A;  2CH5 A;  4WQ5 C;  2G8W A;  1KRP A;  5ADX A;  4KTQ A;  3LWL A;  1OH8 A;  3C6T A;  5J1E A;  3MN9 A;  3K57 A;  3NCI A;  4CED A;  4C1N K;  1HUX A;  4IFY A;  5C2D A;  1NMD A;  4E1M A;  5AQH A;  3MN5 A;  1YJN N;  4CF2 A;  4KHS A;  3KD1 E;  2FSK A;  5FPE A;  4CF9 A;  3OTO K;  4DR5 K;  1WOQ A;  4KHP K;  5J2M A;  3DRP A;  3LP2 A;  4BDP A;  3ZSZ A;  4YHH K;  1UAX A;  3VQA A;  4FJL A;  3TSP A;  3AA5 X;  1BI4 A;  1VQO N;  4N76 A;  4H4O A;  5SZT A;  5JMV A;  1TKD A;  3AVG A;  3E1Y A;  3R1X A;  4FJ8 A;  4EP5 A;  1P90 A;  4B9N A;  1Z25 A;  1HPZ A;  4PUO A;  4A2B A;  4YOW A;  1VAZ A;  4OGE A;  3ENH A;  3GE1 A;  2P9L A;  1NK9 A;  5KRS A;  4FWS A;  5EX5 A;  5K14 A;  1FXX A;  3OHR A;  3NH2 A;  2VWK A;  4LD0 A;  4DTR A;  3KK7 A;  4M63 C;  4IEE A;  4JI7 K;  3VQD A;  3AA2 A;  3VQ4 A;  2FSN A;  4EZ6 A;  3QB0 A;  4JKF A;  1CXU A;  2YJF A;  3U6F A;  3NVM A;  4ELU A;  1J6Z A;  4JI4 K;  4E7J A;  1WBD A;  4ICL A;  1XMQ K;  2Q3S A;  4CZJ A;  3SV3 A;  1W9H A;  4IFV A;  1ASV A;  3T1Y K;  4CHN A;  5GAH P;  3ZSX A;  1XI1 A;  3THV A;  3FZF A;  3DAW A;  1O13 A;  2R7Y A;  1HNW K;  4CF1 A;  2O8F B;  3QES A;  5AQM A;  1RTD A;  1TV6 A;  1M1K O;  4NXM K;  4G1Q A;  4W5T A;  5AFU H;  4KI4 A;  3HVR A;  2GX9 A;  2CGJ A;  5GIP A;  2G8K A;  4XH1 A;  2GBZ A;  4JKH A;  1N5Y A;  3SBT A;  4YDU A;  4YOT A;  4CEC A;  3LP1 A;  3VQE A;  2FBX A;  2NRH A;  3THX B;  4JKB A;  4OKK A;  5M1P A;  3L6Q A;  4MDA A;  5AR0 A;  1RFQ A;  1ZBI A;  3J7Y P;  1WB9 A;  3EZ5 A;  3KLE A;  3CQY A;  3AVN A;  3VN5 A;  3DI6 A;  2HBM A;  4BRI A;  5D3G A;  2QEX N;  3CXC M;  4BGB A;  4BDZ A;  1RBU A;  2IVO A;  3WQT A;  2YHW A;  3O9S A;  3Q7C A;  2ZF5 O;  4CFB A;  3SJJ A;  4V19 S;  4FW1 A;  4H0T B;  3PX4 A;  1HYV A;  3ZYY X;  2X74 A;  3OS0 A;  1X9S A;  1XUP O;  4DFK A;  2CH6 A;  4CEQ A;  2VGN A;  3ISN C;  2HNZ A;  4JI6 K;  2YHA A;  2O8F A;  3WEE B;  1V4T A;  3AO5 A;  3DJC A;  3IUC A;  3A5O C;  1CZA N;  1S9E A;  1QZ5 A;  2ZGY A;  1DT9 A;  2P9I B;  4AHR A;  4GKK K;  4CJQ A;  3I8B A;  1S3X A;  3O9Q A;  3R8E A;  5HRR A;  3O9U A;  2E2O A;  4CIE A;  4DUZ K;  3WUH A;  4I2Q A;  3BZC A;  4GY2 B;  1SKS A;  1JLQ A;  4CGG A;  4H5N A;  5C42 A;  3THX A;  4BG8 A;  3QEP A;  3TTF A;  4DR7 K;  2YNG A;  2GEL A;  3AO3 A;  1EWR A;  1YF5 L;  3MEC A;  4O8K A;  4BRO A;  4GNI A;  4X62 K;  4PQU A;  1C6V A;  1N36 K;  1JJ2 M;  4CJ5 A;  3QFU A;  4YOX A;  3PLA A;  3K0S A;  4IOA L;  4DFM A;  1REV A;  1KD1 O;  3R3L A;  1SL0 A;  4CBU A;  2EX3 A;  4B8A B;  4DTU A;  4M3X A;  1RT7 A;  4C8L A;  3EE9 A;  3O4Q A;  2DFF A;  4MLH A;  3HOS A;  2HF4 A;  2HVI A;  2HBK A;  4IBN A;  4UY8 O;  4PKH A;  2IGI A;  4CBX A;  4CD1 A;  3ZX0 A;  4Q0B A;  2HHW A;  5EXW A;  3AVI A;  4DTM A;  1XHZ A;  4CE9 A;  1S5J A;  2ZD1 A;  4CGH A;  2E1Y A;  4JLH A;  3LL3 A;  5JIC A;  1RDW X;  2B5J A;  3A8Y A;  1YTU A;  3DRR A;  4DR6 K;  3DLL L;  3OYA A;  3SAF A;  4XEI A;  3T7Z A;  4DSJ A;  2E6M A;  3WEE A;  4FLX A;  3LWM A;  4DB3 A;  3G6E N;  4DUY K;  4KKO A;  4N5S A;  2P9I A;  4AHC A;  1ATN A;  3LDS A;  3CET A;  4H0V B;  5AQU A;  3LDO A;  1T05 A;  3FZM A;  3VEY A;  4BRQ A;  1MU2 A;  1KAX A;  3TAN A;  3DLR A;  1GLD G;  3NFA A;  4F8R A;  4BRK A;  1U2V B;  3PUF A;  3L0Q A;  3JAM O;  4EHU A;  4FJI A;  2UXB K;  3OYB A;  4FJN A;  3TAF A;  2QWM A;  3DXM B;  4J2D A;  1QSY A;  5KPZ A;  3UE5 A;  4CK2 A;  4IXC A;  4CK1 A;  4EAH D;  5AQT A;  3VES A;  2KHO A;  3QNO A;  1BQN A;  3MAQ A;  4BRD A;  3CCS N;  2UXC K;  1HMV A;  1XMO K;  2F96 A;  3QET A;  3I55 N;  3H46 O;  4EFH A;  4ZTJ A;  1YIJ N;  4XH5 A;  4E7I A;  1RT4 A;  2P9K B;  3T19 A;  4J8F A;  4FJH A;  2HHT A;  3A5M C;  1UOC A;  1NGE A;  1RTH A;  3CCE N;  4CF8 A;  3UB5 A;  1VQ6 N;  4H5W A;  5AQG A;  3P1G A;  1TGO A;  1T3V A;  5CE3 A;  4F4K A;  1E4F T;  1SUQ A;  3MED A;  1GLE G;  1S6Q A;  3H1V X;  2QWR A;  4I9Q A;  1X3M A;  4AIL C;  1WSG A;  2AA4 A;  3U3Y A;  4H8K A;  5HLF A;  4JI0 K;  4K0K K;  4JKD A;  3HL8 A;  1NKE A;  2HW3 A;  2Q2R A;  2W6L A;  4LH4 A;  3O1B A;  1OKJ A;  3ASM A;  3CCJ N;  1KCF A;  4MLE A;  3T1A A;  2Q0U A;  4CHZ A;  3CME N;  1S1W A;  1D5A A;  4CHO A;  4CGJ A;  1KAZ A;  1X9J A;  4MDB A;  3V1Q A;  1NM1 A;  4YOU A;  1U2V A;  1VRU A;  5DM6 L;  4J2B A;  3E01 A;  3KD5 E;  4H03 B;  3M8P A;  4NCA A;  4M7X A;  4OO1 J;  1W97 L;  4DU3 A;  3AO2 A;  3CCU N;  4HCC A;  2YHX A;  2JWK A;  4JI8 K;  3DXM A;  2E4L A;  1OH6 A;  2F8T A;  3SQ2 A;  5AQK A;  4FJ7 A;  3HPH A;  1K8K A;  2WTU A;  3LM9 A;  3CG7 A;  3QEV A;  4PA1 A;  1KXP A;  4CVN E;  5EVZ A;  2YJE A;  4GVM A;  4DCH A;  3V9U A;  1OH7 A;  2HHH K;  2OYQ A;  4DV0 K;  2WFB A;  2P9K A;  1L3U A;  2BDP A;  3KTQ A;  1LW2 A;  4MQ3 A;  3JXU A;  3GL1 A;  3ATV A;  3TSU A;  1GLJ O;  4Z4F A;  2X6S A;  3DOL A;  4DQR A;  4RW4 A;  3C65 A;  4ISF A;  4CZG A;  1UA0 A;  2F9W A;  3NDK A;  1C0T A;  1X9M A;  1NNE A;  5C25 A;  5LMN K;  2DPN A;  4BRA A;  3L2U A;  3VEX A;  3VQP A;  5M1O A;  3I8D A;  3TAR A;  4CZF A;  1SAZ A;  4ELV A;  3AO4 A;  4WYB A;  1WN7 A;  4MFB A;  4NXN K;  3NF8 A;  3CM6 A;  3SNN A;  2W41 A;  4Z4G A;  3DLG A;  1FKO A;  3CCM N;  1C0M A;  4FLZ A;  1GLL O;  4FZY A;  5T7B A;  3W0L A;  2G8F A;  5AQV A;  2VCP A;  1SKW A;  5JLH A;  1JXE A;  3H1Q A;  1VQ4 N;  3ZET A;  3EY1 A;  4Z94 A;  3P4I A;  4H0O A;  1TKX A;  2UUC K;  3OYL A;  3JSM A;  3G10 A;  5C0Y A;  1HLU A;  3LDL A;  2IS3 A;  3VEN A;  4JK9 A;  2GEM A;  3ENB A;  1T6C A;  3FGU A;  3O5B A;  4KHN A;  2W42 A;  3HSC A;  5AZJ B;  5M1Q A;  3SUO A;  4CCH A;  4CI6 A;  3CC4 N;  2HMI A;  3O3H A;  1VQK N;  4FOE A;  4M45 A;  4BQZ A;  4DU1 A;  3P5J A;  1QQN A;  4FO0 A;  2O8C A;  1RBT A;  2ASM A;  2P9P B;  3ZT3 A;  4EIA A;  4X65 K;  2NLX A;  2FLO A;  2OA8 A;  3KLF A;  1NK0 A;  1KVA A;  5BPN A;  4Z4C A;  4E89 A;  4M3U A;  3DLE A;  4BR4 A;  4M3Z A;  1NGC A;  5M1F A;  1H1V A;  3S41 A;  4LFA K;  3LPT A;  3DM2 A;  4M3T A;  5AQN A;  1TKT A;  2HMP A;  2RPI A;  4H5V A;  4BRF A;  1L3V A;  1RDB A;  4GKJ K;  3KK1 A;  3J80 O;  3RRG A;  3ID8 A;  3OS2 A;  1N6Q A;  4NO7 A;  3L2V A;  4J2E A;  1C1A A;  2F9T A;  2HB5 A;  3QO9 A;  2E20 A;  2E2N A;  1RDU A;  3K9J A;  4DMN A;  3DXK B;  4AHS A;  3AVA A;  1RNH A;  3LAM A;  1VSH A;  4O5F A;  5J2Q A;  2OZS A;  4LC9 B;  2PY5 A;  2QI2 A;  4EP4 A;  1JKH A;  3KVG A;  1SL2 A;  4KBO A;  2KW4 A;  4JI2 K;  1TK5 A;  4E7L A;  4LF8 K;  1Y97 A;  4Y0W A;  5HL7 L;  2O8E B;  1I39 A;  4DSE A;  4DU4 A;  1N32 K;  2P9N B;  3VTH A;  3L4Q A;  1S1U A;  4I2P A;  3K5L A;  4EZ9 A;  3QML A;  4FXD A;  3TTD A;  4DKW A;  3HK2 A;  3CJB A;  1JCG A;  3AVC A;  3HVT A;  5AZJ A;  4E7K A;  3OYI A;  4C1N I;  4H5T A;  3TAG A;  3NMU A;  1HPM A;  4AH9 A;  4GV9 A;  1GLB G;  2QWN A;  3EL2 A;  4YOR A;  4DR2 K;  2P9P A;  4DV5 K;  2A3Z A;  4CHQ A;  4BRH A;  4FJ5 A;  3AA4 A;  2ZQB A;  4FJK A;  4W5O A;  3B6O A;  2D1K A;  1RDA A;  1NGG A;  3VEW A;  2QM1 A;  4BRL A;  3U8X A;  2FBT A;  2RN2 A;  2G8U A;  4KI6 A;  5JVH L;  3PIP L;  2OTJ N;  3DOK A;  3HM8 A;  1KVB A;  4FOI A;  4CJK A;  4DR1 K;  4B9U A;  4H0X B;  4HHT A;  4CFA A;  1BA1 A;  4DTP A;  1HKB A;  1VQ5 N;  2CGK A;  3MN6 A;  5KQD A;  3KWI A;  4B9Q A;  1LV5 A;  4K43 A;  4RW7 A;  1JCE A;  5AQF A;  4FM0 A;  1HKG A;  1T6D A;  2X78 A;  3HP9 A;  3AAP A;  1WLJ A;  3DXK A;  5CZ1 A;  5JLF A;  2OPR A;  3VGK A;  1QQO A;  3HBT A; 
#chains in the Genus database with same CATH homology
 3HXM A;  3AO5 A;  2P1J A;  3L3U A;  4OKJ A;  3NF7 A;  4CGF A;  3OJS A;  4M3R A;  3VQQ A;  3NGZ A;  1S9E A;  1RBV A;  2D0A A;  4N56 A;  1ZBL A;  4AHR A;  4CJU A;  4K8Z A;  4CJQ A;  4DTJ A;  3DYA A;  2G8I A;  5HRR A;  2IOC A;  3D45 A;  4CIE A;  4HVJ A;  5E41 A;  2D0C A;  2XRI A;  4I2Q A;  3UIQ A;  3ZSW A;  3OYG A;  2A1R A;  3V1O A;  1SKS A;  1JLQ A;  3ITH A;  4CGG A;  4B3O A;  1SKR A;  4W5N A;  3L2R A;  3PX6 A;  2QXF A;  4CER A;  3RMB A;  5C42 A;  3ZT4 A;  4RW8 A;  2O4G A;  1HRH A;  3QEP A;  2YNG A;  2OZM A;  4Z4H A;  3AO3 A;  3K59 A;  1BHL A;  2YKN A;  3ALY A;  1BIZ A;  1NOZ A;  3MEC A;  3V9S A;  5HP1 A;  3TR8 A;  4CEO A;  4PQU A;  1HQU A;  1C6V A;  2Y1I A;  1RT2 A;  3NH0 A;  4KRE A;  5JS1 A;  3LAL A;  1TAQ A;  4CJ5 A;  2RF2 A;  3L2W A;  4TSX A;  3HP6 A;  5CYM A;  3KK3 A;  4DSL A;  3NF6 A;  4CHP A;  4LH5 A;  3S3O A;  1I3A A;  4DFM A;  1REV A;  1VSI A;  1SL0 A;  4CF0 A;  1YTA A;  2BAN A;  2EX3 A;  4FVM A;  4B8A B;  2A1S A;  4DTU A;  1NK4 A;  1WNS A;  2Z1J A;  1RT7 A;  4FZZ A;  2XY8 A;  4I9L A;  4C8L A;  3KKS A;  3O4Q A;  5JS2 A;  2PYJ A;  2DFF A;  1RCH A;  3VQ9 A;  3AVF A;  1IKW A;  3VA3 A;  1T8E A;  4FZX C;  1RT6 A;  3LAN A;  2HVI A;  3OYF A;  4IBN A;  4H4M A;  4DQP A;  2IGI A;  3HST B;  4DLG A;  4FJX A;  4B9L A;  4JRQ A;  3WNG A;  4Q0B A;  2HHW A;  4KRF A;  3AVI A;  3K2P A;  4O0I A;  4DTM A;  1XHZ A;  3QEX A;  4CE9 A;  1S5J A;  2ZD1 A;  4CGH A;  1LWC A;  4JLH A;  4DFP A;  1T7P A;  4Q5V A;  1R0A A;  1ZBF A;  2B5J A;  2B4J A;  3LZJ A;  1YTU A;  4YNQ A;  2Z1I A;  3DRR A;  3PX0 A;  1XC9 A;  1D9D A;  1KSP A;  2HHS A;  2ATQ A;  1JL1 A;  5EU7 A;  2KZZ A;  4FLW A;  3OYA A;  4HUE A;  4DF8 A;  3KK2 A;  5DK5 A;  4DSJ A;  1CXQ A;  1NK8 A;  2F8S A;  1WAJ A;  1DTQ A;  2E6M A;  3HPG A;  4FJL A;  1DTT A;  1RT1 A;  4RW6 A;  4KHU A;  4ZHR A;  4FLX A;  3LZI A;  3NGI A;  3TAP A;  2PYL A;  1KFD A;  3LWM A;  3TAQ A;  4KKO A;  4N5S A;  1NKB A;  4CIF A;  5FDL A;  2I5J A;  4KO0 A;  2ETJ A;  4AHC A;  2KZM A;  1RBR A;  1U04 A;  3LDS A;  1ZYQ A;  3RR7 A;  1VSD A;  4QCL A;  4O55 A;  3SUN A;  1HYS A;  1RBS A;  4CEA A;  4R5P A;  4F3O A;  3AVB A;  5FRM A;  4QOZ B;  1T05 A;  1JLB A;  3DLK A;  2VG6 A;  2HHQ A;  3V9W A;  3M8R A;  2XO7 A;  1MU2 A;  1SV5 A;  4RW9 A;  2QKK A;  4LSL A;  3HT3 A;  4O5B A;  1U48 A;  3QIN A;  3TAN A;  2QKB A;  3DLR A;  2HNY A;  3CFO A;  1JXB A;  3KLG A;  3NFA A;  1BCM A;  4F8R A;  1VSM A;  2IDO A;  3B6P A;  4IG3 A;  1HNI A;  1FK9 A;  2OPQ A;  4UQG A;  3PY8 A;  5FRN A;  3DLB A;  4CHY A;  1VSE A;  1D9F A;  1ITG A;  3S3N A;  5KI6 A;  3L3V A;  1NJX A;  3PUF A;  1U47 A;  4DTN A;  2O4I A;  4ELT A;  4FJI A;  3K5N A;  3RRH A;  1LAV A;  3OJU A;  3OYB A;  1NJZ A;  3IAY A;  3WNE A;  5I3U A;  2P5G A;  1SL1 A;  3BGR A;  4FJN A;  2FC0 A;  4B8C A;  3TAF A;  1IO2 A;  3SPY A;  4N47 A;  3AVL A;  2ITG A;  3SQ0 A;  4J2D A;  1QSY A;  1VSF A;  1B92 A;  2IC3 A;  4QAG A;  4CK2 A;  4CK1 A;  1QQC A;  4KHW A;  3QNO A;  1BQN A;  3MAQ A;  1BQM A;  1QE1 A;  3WNH A;  4DQQ A;  4M3T A;  1JLG A;  4NYN A;  3AV9 A;  1BCO A;  1HMV A;  4DQI A;  4YFU A;  2F96 A;  3ZSQ A;  3QET A;  3OY9 A;  4ID1 A;  4CFC A;  1XWL A;  1UWB A;  3KKR A;  4JS4 A;  1S9G A;  4E7I A;  4ZTJ A;  2KTQ A;  1RT4 A;  1S6P A;  4OPJ A;  3T19 A;  3OYH A;  1UA1 A;  4FJH A;  2HHT A;  4DFJ A;  1UOC A;  3BDP A;  1Q9Y A;  1RTH A;  1NKC A;  4M41 A;  3F73 A;  4GW6 A;  4B9T A;  1G15 A;  1L3T A;  4CF8 A;  5HBM A;  3SUQ A;  3M8S A;  3F9K A;  3P1G A;  2XY7 A;  2G8V A;  2DY4 A;  2DTU A;  1VRT A;  4DF4 A;  1TGO A;  4JS5 A;  1Q9X A;  3MXI A;  4CJL A;  4F4K A;  1L5U A;  3SQ1 A;  3AVM A;  1SUQ A;  3MED A;  3EYZ A;  2G8H A;  4F3T A;  1S6Q A;  5SWM A;  4DSF A;  4I9Q A;  3FFI A;  4CGI A;  1NK6 A;  1RT3 A;  3K5M A;  3TAM A;  3NHG A;  4AIL C;  3LPU A;  5HRN A;  1WSG A;  3AO1 A;  3OYJ A;  1RIL A;  1S1X A;  4H8K A;  4DLE A;  3I0R A;  3U3Y A;  5HLF A;  3DMJ A;  3M8Q A;  3H08 A;  3RMC A;  3V6D A;  3PV8 A;  1S1T A;  4OLA A;  1BGX T;  3HL8 A;  3U3G A;  3K58 A;  4JRP A;  4KFB A;  3TWH A;  1NKE A;  4B08 A;  2KQ2 A;  2P5O A;  4E0D A;  2HW3 A;  4LH4 A;  1ASW A;  2BE2 A;  2GV9 A;  3SPZ A;  2EHG A;  1Z26 A;  3RR8 A;  3ASM A;  1ZBU A;  3ZSY A;  2Y1J A;  4AHU A;  2FBV A;  1KCF A;  3T1A A;  4CJT A;  4CHZ A;  4DG1 A;  1S1W A;  1D5A A;  4CHO A;  4CGJ A;  4NYF A;  3V81 A;  1A5V A;  3G0Z A;  4BE0 A;  1KLN A;  4KHQ A;  4O4G A;  3KLI A;  3V1Q A;  3TAE A;  2PZS A;  3ULD A;  1U49 A;  1U4B A;  1IH7 A;  4CEF A;  2XY6 A;  1VRU A;  1NK5 A;  4J2B A;  3QLH A;  1NK7 A;  1CZB A;  3E01 A;  3ZT2 A;  4ZTF A;  4Z4I A;  4DS4 A;  2Z1G A;  4L8R B;  1JLF A;  1GOB A;  3KD5 E;  3M8P A;  1EX4 A;  4B9S A;  2YNH A;  4NCA A;  1IKV A;  4DU3 A;  3HPO A;  4CJW A;  3AO2 A;  4KV8 A;  4CJF A;  2HVH A;  4FLU A;  4HCC A;  4OLB A;  3HO1 A;  2X6N A;  1WSI A;  2RKI A;  4CEZ A;  3SV4 A;  1WSJ A;  1J54 A;  4B9M A;  1F21 A;  1TVR A;  3SYZ A;  1TL1 A;  3O3G A;  1DLO A;  2E4L A;  3LAK A;  3TAB A;  3MEE A;  1QTM A;  3SQ2 A;  2F8T A;  4FJ7 A;  3HPH A;  4W5R A;  2HHV A;  3RMD A;  3ZCM A;  2JLE A;  3NE6 A;  3ZSV A;  2XY5 A;  4ID5 A;  3CG7 A;  3QEV A;  4PA1 A;  4KPY A;  4Y1D A;  3IRX A;  3V9U A;  4GVM A;  4BWM A;  2OYQ A;  1C0U A;  3PO5 A;  3NF9 A;  3OYM A;  2XHB A;  3QEI A;  4DWI A;  1BI4 B;  4Z0U A;  2HHU A;  1L3U A;  1KTQ A;  2BDP A;  4DTX A;  3KTQ A;  1LW2 A;  4MQ3 A;  1VSL A;  5C24 A;  4C8N A;  5HRP A;  3CFP A;  5J2P A;  2HHX A;  1LW0 A;  4IDK A;  1HNV A;  1BL3 A;  1S1V A;  5I42 A;  4E7H A;  4KB0 A;  4Z4F A;  4PY5 A;  4M3W A;  3ZSR A;  4DSI A;  2X6S A;  2WON A;  3DOL A;  4DQR A;  1TK8 A;  4RW4 A;  1QHT A;  1JLC A;  3OS1 A;  5FRO A;  4FYD A;  3NGY A;  4E19 A;  4FK0 A;  2B6A A;  2NUB A;  4FJ9 A;  3CYM A;  4CJR A;  1B9D A;  2ZE2 A;  3IS9 A;  1UA0 A;  1ASU A;  1U45 A;  4F2R A;  3NDK A;  3MEG A;  1TAU A;  4BE2 A;  1IKY A;  1C0T A;  4KB1 A;  3CM5 A;  4CJE A;  5C25 A;  1NJY A;  1QS4 A;  1X9M A;  1JLE A;  3K5O A;  1JL2 A;  4AHT A;  3AVJ A;  3AA3 A;  1FKP A;  1BIS A;  3QEW A;  3OYK A;  1KFS A;  4M3Y A;  3L2U A;  2D0B A;  3VQP A;  3I8D A;  1VK0 A;  3WNF A;  3ZT1 A;  3V4I A;  3TAR A;  4FJG A;  5CZ2 A;  4ELV A;  3AO4 A;  1J53 A;  4CEB A;  4M3X A;  1WN7 A;  1RTI A;  3NAE A;  2YKM A;  1EXQ A;  3VQC A;  3O3F A;  3OYE A;  5KGX A;  3O4N A;  4MFB A;  3SZ2 A;  1QSL A;  3HJF A;  4PWD A;  2E6L A;  3NF8 A;  3CM6 A;  4K8X A;  4CGD A;  3SNN A;  4Z4G A;  1HQE A;  2KFZ A;  4FLT A;  3DLG A;  1FKO A;  1YVU A;  1C0M A;  2HND A;  2LSN A;  4CJP A;  3KJV A;  4FLZ A;  5T7B A;  3SI6 A;  1X9W A;  1ZBH A;  2G8F A;  4IKF A;  3OVN A;  3A2F A;  2G8W A;  1KRP A;  4KTZ A;  1RTJ A;  4KTQ A;  3P83 D;  3NH1 A;  3HYF A;  4FLY A;  3SQ4 A;  1JXE A;  4CES A;  1TK0 A;  1GOC A;  1SKW A;  3LWL A;  3RWU A;  3C6T A;  3EY1 A;  1LWE A;  3C94 A;  3MXJ A;  4OVL A;  1VSK A;  3C6U A;  5J1E A;  5CY4 A;  1TKX A;  3OYC A;  1K6Y A;  3OYL A;  3JSM A;  3G10 A;  3RTV A;  4FLV A;  3K57 A;  3NCI A;  2DFE A;  1HJR A;  4CED A;  4IFY A;  2IS3 A;  4E1M A;  4KHS A;  4KHY A;  2BGG A;  4CF2 A;  4FM2 A;  3S3M A;  3KD1 E;  4KHN A;  1VSJ A;  3C95 A;  4C8M A;  4I7F A;  2W42 A;  5KRT A;  2OPP A;  1A5W A;  3SUO A;  4CF9 A;  4NCB A;  4CCH A;  4DTS A;  1EKE A;  4CIG A;  2P51 A;  5J2M A;  4OPK A;  1C1B A;  1WAF A;  3DRP A;  3LP2 A;  4CJV A;  4BDP A;  2HMI A;  3ZSZ A;  1UAX A;  4CJ3 A;  3VQA A;  3O3H A;  4CJS A;  3RMA A;  1A5X A;  3AA5 X;  4M45 A;  4DU1 A;  1BI4 A;  3VQ5 A;  3VQ6 A;  3P5J A;  4H4O A;  4FCY A;  4N76 A;  5SZT A;  1TKD A;  3AVG A;  3CFR A;  1RBT A;  4DTO A;  3ZT3 A;  2IAJ A;  4FJ8 A;  4EP5 A;  2OA8 A;  3KLF A;  1NK0 A;  4B9N A;  1JLA A;  1KVA A;  1Z25 A;  5KGW A;  4KTW A;  1T03 A;  1HPZ A;  4Z4C A;  4E89 A;  4PUO A;  4M3U A;  4W5Q A;  3DLE A;  4OGE A;  4WE1 A;  4CJ4 A;  1NK9 A;  5KRS A;  3L2Q A;  3MXM A;  4M3Z A;  3KLH A;  3QER A;  2VG7 A;  4FK4 A;  5K14 A;  3LPT A;  1FXX A;  2YNF A;  3DM2 A;  3VQ7 A;  2VWK A;  3NH2 A;  3JYT A;  4LD0 A;  3S9H A;  4DTR A;  4DSK A;  1TKT A;  1CLQ A;  2RPI A;  3VQD A;  4IG0 A;  1L3V A;  2KFN A;  1RDB A;  1D8Y A;  3AA2 A;  3VQ4 A;  3KK1 A;  5J2N A;  4DQS A;  4EZ6 A;  4GMJ B;  3RRG A;  3OS2 A;  1CXU A;  3U6F A;  3V1R A;  4O0J A;  4BAC A;  4DS5 A;  1BIU A;  4OJR A;  3DRS A;  4E7J A;  3L2V A;  2YNI A;  2VWJ A;  1N6Q A;  4ELU A;  4J2E A;  1C1A A;  3AVH A;  3DLH A;  4FM1 A;  2HB5 A;  3QO9 A;  4ICL A;  1RDD A;  2AJQ A;  3L8B A;  2VG5 A;  5HRS A;  2FBY A;  2Q3S A;  3ZSO A;  3VQB A;  4DMN A;  1W9H A;  2YV0 X;  4IFV A;  3SV3 A;  4F2S A;  3QIP A;  1ASV A;  4AHS A;  4OGC A;  4CHN A;  4Z4E A;  3AVA A;  3ZSX A;  1XI1 A;  4FK2 A;  1RNH A;  3THV A;  3LAM A;  1VSH A;  2OPS A;  4RG8 A;  5J2Q A;  3LP3 A;  2OZS A;  2PY5 A;  4EP4 A;  2R7Y A;  5KTQ A;  1JKH A;  1SL2 A;  1W0H A;  1EP4 A;  4CF1 A;  3D0P A;  4B9V A;  2KW4 A;  5CYQ A;  4E1N A;  3QES A;  1TK5 A;  4BWJ A;  4E7L A;  1QSS A;  1KLM A;  4CFD A;  4HUG A;  1Y97 A;  1RTD A;  1TV6 A;  5DMR A;  1C1C A;  1I39 A;  1KVC A;  3NBP A;  4DSE A;  4DU4 A;  4G1Q A;  3CQ8 A;  1YT3 A;  4W5T A;  2D5R A;  4KI4 A;  3HVR A;  1S1U A;  4AHV A;  4I2P A;  3K5L A;  4EZ9 A;  4FZY A;  1Q8I A;  3HM9 A;  4FXD A;  2G8K A;  2GBZ A;  4HCB A;  3HK2 A;  1N5Y A;  1WSE A;  3AVC A;  3HVT A;  4CEC A;  4BE1 A;  4E7K A;  3LP1 A;  3OYN A;  3OYI A;  1IG9 A;  3VQE A;  2FBX A;  3VQ8 A;  3TAG A;  1L3S A;  1LWF A;  4OKK A;  4E3S A;  3I0S A;  1GOA A;  4AH9 A;  1HYZ A;  4J2A A;  3LP0 A;  1ZBI A;  3T3F A;  1RT5 A;  3V9Z A;  1J5O A;  4CHQ A;  3EZ5 A;  3KLE A;  4FJ5 A;  3AA4 A;  2ZQB A;  4HUF A;  2YHB A;  3AVN A;  2Z1H A;  3VN5 A;  4FJK A;  3DI6 A;  4W5O A;  3B6O A;  1RDA A;  4LY7 A;  4C8O A;  4Y1C A;  4OKE A;  3OYD A;  4XIU A;  4FJJ A;  4FJM A;  5D3G A;  1J9A A;  4N41 A;  2FBT A;  2RN2 A;  4BDZ A;  2G8U A;  1X1P A;  4KI6 A;  4CK3 A;  1RBU A;  4FW2 A;  1WSF A;  2DFH A;  3DOK A;  4C8K A;  3PO4 A;  1KVB A;  3SUP A;  4CJK A;  4B9U A;  1LAW A;  4HHT A;  2GUI A;  4CFA A;  4NCG A;  1XHX A;  2JGU A;  3KIO A;  4KAZ A;  1O1W A;  4CFB A;  3V9X A;  4DTP A;  4FW1 A;  3SJJ A;  3TI0 A;  1EET A;  1IKX A;  3IG1 A;  3VA0 A;  3ZT0 A;  3PX4 A;  1HYV A;  4LSN A;  1TKZ A;  1LV5 A;  4M42 A;  2X74 A;  4RW7 A;  3OS0 A;  4FM0 A;  1X9S A;  1NOY A;  4HTU A;  4BDY A;  2X78 A;  3HP9 A;  4DFK A;  1WLJ A;  3SCX A;  5CZ1 A;  4CEE A;  4CEQ A;  2QK9 A;  3ISN C;  1CZ9 A;  2HNZ A;  1TL3 A;  2OPR A;  2YHA A;  4O44 A;  2WOM A;  3AVK A;  3QIO A;  5HRO A;  1B9F A;  3QNN A;  1NJW A;  1WSH A;  1RDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...