3D0PA

Insights into rna/dna hybrid recognition and processing by rnase h from the crystal structure of a non-specific enzyme-dsdna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into RNA/DNA hybrid recognition and processing by RNase H from the crystal structure of a non-specific enzyme-dsDNA complex.
pubmed rcsb
molecule tags Hydrolase/dna
molecule keywords Ribonuclease H
total genus 43
structure length 134
sequence length 134
chains with identical sequence C
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3d0pA00
3WNFA 1RT7A 3HM9A 1WSEA 3F9KA 1NK7A 1RBRA 1D9DA 4FLVA 1KVBA 3IG1A 2F96A 1HJRA 1TAQA 4Z4FA 1ASWA 4OKJA 3TR8A 3SUQA 3SQ2A 4W5QA 4M3RA 2W42A 4FJ5A 3KLGA 4CECA 4M45A 4EP4A 3V81A 1LW2A 3D45A 1NK0A 2Z1HA 3O4QA 1CXUA 4I9LA 5CYMA 2G8UA 2FBYA 1LAVA 1JLAA 1VSHA 2XHBA 1SKSA 2BDPA 3IAYA 4N76A 4PA1A 3NDKA 3CM6A 1UA0A 1VSKA 2PYJA 1JKHA 4GMJB 1Q8IA 4I2QA 4CJUA 1RBUA 4CJKA 4OLAA 4KV8A 1R0AA 4CCHA 1UWBA 3V6DA 3NH2A 4PWDA 4IG3A 1B9DA 4DQQA 4M3TA 4HUFA 2O4IA 4H8KA 4HCBA 3AO2A 3DRPA 4ZTFA 1Q9YA 1JXBA 1DLOA 1TKTA 1IKXA 3AO3A 5T7BA 1W0HA 4B9NA 4CHOA 3T1AA 4E1MA 1HQEA 5CZ2A 5HP1A 3SPYA 4CFCA 3U6FA 3TWHA 1BISA 3OS2A 3OS0A 1KTQA 4IFYA 3B6PA 3QEVA 3VQPA 1DTTA 3AVBA 2HNZA 3OYMA 1NKCA 4M42A 2KFZA 3DI6A 5DK5A 3U3GA 3SPZA 3VQEA 2Y1IA 3SQ0A 1S1UA 3ISNC 4F2SA 1CLQA 3MXMA 3DLKA 2NUBA 2YNHA 4LY7A 4Z4CA 4FM0A 3VA0A 1ZBLA 4E0DA 2ZE2A 3EYZA 5KGXA 3O3FA 3HT3A 1ITGA 3ZSRA 1RT5A 1TK0A 4W5NA 1TV6A 4Y1DA 1BI4A 1WSHA 5J2QA 1L3TA 4CGIA 2DY4A 1RDAA 1MU2A 5E41A 2X78A 1IKWA 3C94A 3SYZA 2E6MA 2WOMA 3ZT1A 4KREA 2HHXA 1LWEA 4AHUA 3LPTA 4N56A 4Q0BA 5FRNA 4IBNA 1A5WA 1D5AA 3L3UA 3L8BA 1LWCA 2Z1IA 2IAJA 4Z4HA 2OPQA 3TAMA 1NOYA 3KLHA 2IDOA 3TABA 4CERA 4PQUA 2B4JA 2X74A 3LAKA 5HRNA 2HHTA 4KHYA 2ZQBA 3VQAA 4I2PA 2VG6A 4CJWA 1U49A 1RT4A 3K59A 4I7FA 1B92A 4HUGA 4DQPA 3TAPA 1TGOA 4FVMA 4DFJA 1U4BA 3RWUA 3PO4A 4J2EA 4AHVA 1ZBIA 3ZT0A 4KKOA 1BL3A 4CEAA 4B9VA 4ID1A 3MAQA 1HQUA 3K5NA 4M3WA 2YHBA 2ETJA 2IS3A 5KRTA 2G8HA 1TAUA 3LAMA 4BE1A 1X1PA 1HYZA 1X9WA 1NK9A 4F3TA 3BGRA 1JLBA 4BE2A 4FLUA 4FZYA 3M8QA 1SUQA 4FK0A 4DSIA 3QNOA 3BDPA 4BE0A 4YNQA 4N5SA 4DTSA 2D0CA 3WNEA 3E01A 3SUPA 3PY8A 4ELVA 3S3NA 1RDBA 4H4OA 1C0TA 3ZSYA 3TARA 4FM1A 1RDDA 3MECA 3D0PA 2OZSA 4RW9A 4CEDA 4OGCA 2PY5A 3LPUA 2KZZA 1BCMA 3MEGA 3NF9A 3MXIA 1BQNA 3OYKA 3OJUA 2ZD1A 5EU7A 4AHRA 2HW3A 1RT2A 3K5OA 3TAQA 4DTJA 1S6QA 1S1VA 3VQBA 2OPPA 5K14A 1W9HA 3KK1A 3LDSA 3SUNA 1SKWA 4KHQA 4FK4A 4QCLA 3PX0A 4G1QA 3JYTA 5I3UA 4O0JA 2I5JA 1LV5A 4CFBA 1J5OA 4FM2A 1VRUA 3AVFA 5HRRA 3OYGA 4CEOA 3DRRA 4Z0UA 4CEQA 4HUEA 1WLJA 2RF2A 3CM5A 1YTUA 4CJ4A 1BI4B 3QEIA 4KPYA 2BGGA 4J2BA 4DTNA 4NYFA 1K6YA 1SL0A 4E7IA 2P5OA 3DYAA 3P83D 4F4KA 1BIUA 4IG0A 3K58A 3LP1A 5KGWA 3VQ6A 3QEPA 4GVMA 1NJZA 3ZSZA 1WN7A 1WSGA 4OPJA 3DOLA 3HP6A 1SL1A 4FJ8A 1C0UA 3QERA 4BWMA 3C6TA 2BANA 1LW0A 1QQCA 3ASMA 1L3VA 1A5XA 3KKSA 4E7LA 3THVA 1HYVA 1S5JA 4CHPA 4KTQA 3NF7A 1KFDA 3TI0A 3ZSWA 3V9XA 2VG5A 3AV9A 3U3YA 1YVUA 4OJRA 3O3GA 1S6PA 1ZYQA 4LD0A 3HYFA 3DLBA 4CJVA 4CEZA 3DLRA 4W5OA 1VSLA 1XC9A 1Z25A 3AVGA 3NHGA 4L8RB 2IOCA 3SUOA 1DTQA 1Q9XA 1KLNA 1TKXA 4RW7A 4I9QA 4NYNA 3C95A 1D9FA 3V9WA 1RT3A 4CEEA 1EP4A 3AA5X 3CFPA 4FJNA 3EZ5A 3VA3A 1X9MA 3AO1A 3NF8A 1YT3A 4C8MA 1HYSA 2DTUA 1QTMA 4DLGA 5SZTA 5DMRA 4CEFA 3K5MA 4DTMA 4ZHRA 4BACA 4KB1A 4CK2A 4LSNA 1VK0A 4O5BA 3NH1A 2VWJA 3KK3A 3OVNA 5J2PA 5J1EA 4CJQA 2D0BA 3PX4A 4JRQA 3HO1A 4FXDA 3V9ZA 3HL8A 4M3UA 4E7HA 4M41A 1FK9A 1RBSA 4E1NA 4CHNA 3L2WA 3HSTB 1WSJA 3TANA 4UQGA 3SJJA 1T7PA 4F3OA 1QE1A 4HVJA 3V1QA 2IC3A 2X6NA 4LSLA 3M8SA 4JS4A 1TK8A 2HHSA 1S1WA 3KD5E 4FJMA 4KO0A 1REVA 4HCCA 4H4MA 3AVCA 1XHXA 3MXJA 5FDLA 1VSEA 4CIFA 4FW2A 4IDKA 2F8SA 4OPKA 4CHQA 2HNYA 2XO7A 3VQ9A 1HNIA 2G8IA 4FLXA 3S3OA 3CG7A 4FW1A 3NH0A 1BQMA 1JLCA 1RCHA 3WNHA 1QSLA 2JLEA 3LZJA 3RMCA 2QKKA 3P1GA 4CF2A 3MEDA 2AJQA 4QOZB 3NBPA 2RPIA 3NE6A 2O4GA 2R7YA 5HBMA 3VQQA 3O4NA 3ZCMA 3DLGA 3QEXA 3HVRA 4BDZA 1L5UA 1Y97A 4BWJA 5FROA 4DQIA 2HVIA 3OYFA 1NK4A 1BGXT 4PY5A 4B3OA 1VSIA 3ZT2A 5J2MA 4QAGA 4FJIA 1J54A 4NCGA 5CYQA 1HMVA 2EHGA 3VN5A 1S9EA 1QS4A 2WONA 4CF9A 4E89A 3OJSA 4DU1A 1T8EA 3DLHA 2IGIA 4KB0A 4CJFA 3VQ7A 4FJXA 3QINA 5KRSA 3ZSQA 4DFMA 4Q5VA 4Z4EA 4DG1A 1RDCA 4OVLA 4RW6A 4B9TA 1VRTA 5HRSA 2P5GA 4LH4A 2ATQA 4DSEA 3ZSXA 1ZBFA 2Z1GA 1J9AA 4FLTA 2FBTA 4C8NA 4CJTA 4DSJA 4K8ZA 1EXQA 1KLMA 3DOKA 2E6LA 4CIEA 2KQ2A 1UOCA 4BDPA 4EP5A 4EZ9A 4DTRA 1NKEA 4FJGA 4JS5A 2A1RA 4FZZA 4ID5A 3LZIA 4FJ9A 3VQ5A 4FYDA 1EX4A 5FRMA 4B9SA 1KVCA 3SV4A 2DFFA 3CYMA 5HROA 2YNGA 5SWMA 1EETA 1N6QA 2ITGA 1NK6A 1ZBHA 3L2VA 4FLYA 2B6AA 2PYLA 2G8KA 4IKFA 4E19A 3RR7A 2QKBA 1ZBUA 1KVAA 3KIOA 4JRPA 4DF4A 1SKRA 2P1JA 2JGUA 3SV3A 1KCFA 3AO5A 4KTZA 1RT1A 3OS1A 3HJFA 2XRIA 1U04A 4J2AA 1TKZA 1ASVA 1JLFA 3DLEA 4CFDA 3KJVA 1Z26A 2E4LA 3LWMA 3ITHA 4KAZA 3PO5A 1VSFA 3K5LA 2OA8A 3RRGA 4B9LA 4EZ6A 2HHQA 1WSIA 3SZ2A 4O55A 2HVHA 4YFUA 1I39A 3AVJA 3SQ1A 4C8LA 3OYNA 1GOCA 3TAGA 3SI6A 1WNSA 4DMNA 1C1BA 4DFKA 1IH7A 4C8OA 4CGFA 4KHNA 2YKNA 4Z4GA 4O44A 4E7JA 2FBXA 1UA1A 4OLBA 4OKEA 3QO9A 2P51A 4BDYA 3T3FA 3SCXA 1XI1A 3FFIA 4M3YA 3ALYA 1F21A 3OYEA 1FXXA 2DFEA 2G8VA 3RMDA 3RRHA 1RILA 2XY7A 3QIPA 1FKPA 2F8TA 3MEEA 1FKOA 4Y1CA 3KTQA 5HRPA 3EY1A 3CFRA 3QIOA 2Z1JA 3DM2A 1KRPA 4DQSA 4DTPA 3P5JA 4KRFA 1JLEA 1JLQA 1IKVA 3VQDA 2RKIA 1XHZA 1HNVA 3QEWA 4MFBA 5J2NA 4CHYA 4B9UA 1S9GA 4AH9A 5JS2A 1JXEA 4DQRA 4DLEA 4OGEA 4CJSA 2OPRA 3L2QA 4DTXA 2XY6A 3ULDA 4K8XA 3ZSVA 3ZSOA 4DWIA 4CGHA 4RW8A 2OYQA 3VQ8A 3DMJA 3A2FA 3I0SA 3QNNA 1X9SA 4E7KA 3HVTA 3L2RA 3HK2A 1C1AA 1WSFA 3V4IA 4R5PA 3M8PA 2GV9A 2HB5A 4B08A 1JL1A 1D8YA 1GOAA 3OYJA 3PV8A 1SL2A 4CJ5A 4RG8A 4DU4A 4NCBA 1BIZA 1U45A 4N47A 1IG9A 4CF8A 1NJWA 5KTQA 4KI6A 1RNHA 3AVIA 2X6SA 2XY5A 1NOZA 1ASUA 3AA4A 4DTOA 1L3UA 4NCAA 2YKMA 2YNIA 3G10A 2A1SA 3NGYA 2XY8A 5CY4A 2KW4A 1RTJA 1RT6A 3AVNA 4O0IA 2OZMA 3VQCA 1TL1A 2YV0X 4CF1A 4DU3A 2KFNA 1HRHA 1XWLA 1T05A 4FZXC 4PUOA 1GOBA 2QK9A 3M8RA 4FJ7A 1TKDA 4CHZA 4JLHA 3L3VA 1JLGA 1NKBA 4KI4A 1EKEA 3S9HA 1I3AA 4KFBA 3KLEA 1RBVA 1L3SA 4ICLA 3HPOA 1NJYA 3V1OA 3QESA 4FK2A 3DRSA 4ELTA 4J2DA 1VSJA 3KK2A 3QETA 2G8FA 1BHLA 4FJKA 3RR8A 1YTAA 5C24A 4CJPA 4HTUA 2FC0A 3NFAA 1U47A 3OY9A 4C8KA 3AVKA 2D0AA 3VQ4A 3LALA 4MQ3A 3SNNA 1C1CA 3IRXA 3KKRA 4AHCA 3NGIA 3TAEA 1RTDA 3HXMA 4CJ3A 1C6VA 3HPHA 1QSSA 4KHSA 3OYBA 4DS4A 4KHWA 1IKYA 3AVLA 3K2PA 3LP0A 4DSFA 1WAFA 1TL3A 4CEBA 1NK5A 4O4GA 2PZSA 3C6UA 2KTQA 3RMAA 2GBZA 3PX6A 1CXQA 1KSPA 2D5RA 3AA2A 4CIGA 3L2UA 3JSMA 4KHUA 1JL2A 5D3GA 1VSMA 1CZ9A 3G0ZA 4GW6A 3K57A 2Q3SA 5JS1A 3I8DA 2QXFA 2HMIA 2LSNA 4CJLA 3NF6A 3AVMA 1VSDA 2HHVA 2OPSA 4CJRA 3UIQA 3H08A 3O3HA 1S1TA 4CK1A 3OYHA 2FBVA 1RTHA 1LAWA 2VWKA 4CK3A 3ZT3A 1NJXA 1HPZA 1G15A 1QHTA 3AVAA 4AHTA 1CZBA 3RMBA 4DSKA 4OKKA 4DF8A 1U48A 3HP9A 4CGDA 4W5RA 3OYLA 3NGZA 3OYDA 1A5VA 5C25A 2HHUA 1LWFA 4Z4IA 3NCIA 3ZT4A 2B5JA 2HNDA 1B9FA 1J53A 4B8CA 3OYAA 1T03A 4DS5A 4AHSA 5KI6A 4LH5A 1SV5A 3I0RA 3RTVA 3AO4A 2EX3A 4RW4A 4WE1A 4AILC 3KD1E 3V9UA 4W5TA 5CZ1A 1C0MA 4DTUA 4F2RA 3LP3A 1TVRA 2GUIA 3KLFA 4CGJA 5I42A 4FJLA 2YNFA 4CF0A 1TK5A 3V1RA 3AA3A 3SQ4A 4M3ZA 4XIUA 4ZTJA 4CFAA 2HHWA 3LANA 3OYIA 4F8RA 3B6OA 1S1XA 1UAXA 1N5YA 4E3SA 4M3XA 4DSLA 2BE2A 1NK8A 3HPGA 5HLFA 3CQ8A 4CESA 3TAFA 3NAEA 4FJHA 2KZMA 2DFHA 3QLHA 4IFVA 4KTWA 3T19A 4CE9A 3LWLA 3F73A 3OYCA 1BCOA 2G8WA 4CGGA 4FCYA 4FLZA 1O1WA 1IO2A 3PUFA 3WNGA 1WAJA 2VG7A 2YHAA 3CFOA 3IS9A 4B8AB 4DFPA 1RTIA 1KFSA 1RBTA 4CJEA 3V9SA 4B9MA 3S3MA 5C42A 4HHTA 4FLWA 4ELUA 3LP2A 2Y1JA 1QSYA 4FJJA 4N41A 3AVHA 4TSXA 3KLIA 2RN2A
chains in the Genus database with same CATH superfamily
1D9DA 1RBRA 5FPDA 3IG1A 2F96A 4MDAA 3TR8A 3LL3A 4W5QA 3KLGA 2AA4A 3D45A 5CYMA 5AQGA 4IO8A 2G8UA 2FBYA 4PA1A 4OX9K 3O08A 4I2QA 1VQKN 4JK8A 3NH2A 4DQQA 1HNZK 3AO2A 4BQLA 1DLOA 3AO3A 1IKXA 4IOAL 4KBOA 4WYBA 4A5BA 3OS0A 2A6AA 5DM7L 4FWOA 1N36K 1DTTA 5DK5A 3U3GA 2ZJQL 3J7AP 4F2SA 2P9NB 4IZ9A 1KAYA 2QI2A 4LY7A 4Z4CA 3VA0A 1ZBLA 1K73O 4EFHA 2ZE2A 1XUPO 3EYZA 2I7PA 3VEOA 3ZSRA 1TK0A 4JAXA 1L3TA 1WSHA 1BWFO 2NLXA 4FVUA 2X78A 3SYZA 4FWNA 1V4SA 2E6MA 3ENHA 4IWVA 2HHXA 4N56A 3MWPA 3VGLA 4IBNA 5AQMA 1LWCA 4JKDA 4Z4HA 5GAEP 2OPQA 2IDOA 2B4JA 4KHYA 3VQAA 4CJWA 2VG6A 3B8AX 3FLCO 1RT4A 2P9IA 1KAXA 2E1ZA 3MAQA 1HQUA 4HTLA 3CJ7A 2ETJA 4BR4A 1EWRA 3BGRA 1JLBA 4FOIA 3CJAA 3M8QA 4DSIA 2ZGZA 4YOTA 4G9ZA 3TARA 4KH6A 2PY5A 4NLBA 3MEGA 1BQNA 3OYKA 1RT2A 4DV6K 4DTJA 1W9HA 3KK1A 1NGJA 4FK4A 4DCHA 4QCLA 4G1QA 2I5JA 4CFBA 1SAZA 5HRRA 4FPBA 4CZLA 3OYGA 4CEQA 4X66K 1BOTO 3W3DA 3ZEUA 1KXPA 2QWPA 2BGGA 4NYFA 1K6YA 2P5OA 4EHUA 3TSQA 1WN7A 4H5TA 3HP6A 3A5MC 2BANA 1L3VA 1A5XA 3KKSA 1KFDA 1Z6RA 5LY3A 4ISEA 3AV9A 4JKAA 3O3GA 1ZYQA 3AAPA 4LD0A 3HYFA 4CEZA 3DLRA 4W5OA 3TSUA 1GLJO 1NU0A 3G4SN 1KLNA 1Q9XA 1N33K 3C95A 2D4WA 5H1SQ 3EZ5A 4B3TK 2O8BA 4YOYA 1YT3A 5AQUA 3W0LA 5B8HA 3DXKA 3VGMA 5DMRA 4CEFA 5AZJB 4LSNA 2VWJA 3OVNA 5J1EA 2HMPA 3OTOK 3HO1A 3HL8A 4CHNA 4F3OA 4UQGA 1XMOK 2IC3A 3M8SA 4JS4A 1S1WA 3CCSN 4KO0A 1REVA 1XHXA 3PSFA 5FDLA 4CIFA 4YOUA 5KPZA 1C0FA 4OPKA 3VQ9A 4OPAA 2G8IA 1QSLA 2GWKA 4FW1A 2YI1A 3GBTA 3S3OA 1JLCA 3F9MA 2JLEA 5LL6Z 3P1GA 4BY9C 3MEDA 1I94K 2AJQA 4AF1A 3NE6A 2O4GA 3O4NA 3WEEB 4K43A 1L5UA 1VQ9N 4DQIA 1NK4A 3T1YK 1QZ5A 3SBGA 4PY5A 4B3OA 1H1VA 4WFBL 4U7BA 4QAGA 1IBKK 3THVA 2EHGA 2I7NA 1S9EA 2WONA 3EO3A 4B1UB 4CF9A 4DU1A 1T8EA 2IGIA 3R8EA 3QINA 2EWSA 3IMXA 4DFMA 2WUSA 4Z4EA 5AQOA 5HRSA 2ATQA 1JCFA 2GELA 4CIEA 4H0YB 2O8EB 5BR9A 4GKKK 4FJ9A 4WQ4C 1EX4A 4CZMA 2Q2RA 4RCHA 3JAMO 3SV4A 1EETA 3VF2A 1N6QA 2ITGA 3CQYA 1YAGA 2B6AA 5BN9A 2PYLA 2QEXN 2QKBA 1KVAA 4JRPA 4DF4A 2P1JA 3AO5A 3SK3A 3OS1A 1U04A 4J2AA 1ASVA 4BGAA 1Z26A 2E4LA 3LWMA 3ITHA 2CGJA 1X3MA 2OA8A 2HHQA 1EO1A 3AVJA 3CJ1A 3TAGA 3SI6A 1WNSA 4DMNA 1C1BA 5LMUK 3THXA 4KHNA 4O44A 5BRHA 4EHTA 4OKEA 2P51A 4JHDA 4LC9B 3O6WA 1QQMA 4YOXA 1FXXA 2NRVA 1JJ2M 3KZBA 3QIPA 1FKPA 2UXDK 3KTQA 3QIOA 2Z1JA 4JNEA 4DKWA 4DQSA 1JLQA 5M1FA 5M1NA 4JKCA 3VQDA 1HNVA 3THYB 2PAVA 4MFBA 2VQEK 3L6QA 4AH9A 4DQRA 4YORA 4K8XA 4B1YB 1HR0K 2OYQA 3VQ8A 4MLEA 1IV0A 3A2FA 3QNNA 1X9SA 2ZJPL 4E7KA 5ELZA 3V4IA 4R5PA 2GV9A 2O8EA 4FPAA 1EWQA 2IVNA 1U45A 2NNWA 2VGMA 4KI6A 4BG9A 4LF4K 4RTFD 2YNIA 2A1SA 1JCEA 3TTDA 1TAUA 3R3LA 2KW4A 2OZMA 3O8MA 4IDHA 4CD1A 2D1KA 4DU3A 2UUBK 3I33A 4PUOA 2QK9A 2HF3A 1TKDA 1OH5A 3SBTA 1JLGA 5HOOA 1VQ7N 4J8FA 1NKBA 1EKEA 2GUPA 3S9HA 2D0OA 3N4PA 2V7YA 1I3AA 2QTDA 4ICLA 4B1XB 3QESA 4ELTA 2P9PA 1X3NA 3KK2A 4B1VA 4FJKA 2FC0A 1U47A 3IFRA 3BUZB 3KKRA 3DJCA 4ISGA 2PFUA 1C6VA 3M3ZA 4KHWA 1OVQA 1QVFM 3AVLA 4DSFA 1NK5A 4O4GA 2PZSA 2GBZA 3MCAB 3AGKA 3FE1A 2D5RA 3AA2A 5EX5A 1XC3A 3WXMB 3HRGA 4GW6A 1NGCA 3H1QA 4DR6K 3MDQA 3NF6A 1VSDA 5TKYA 2HBJA 3C7NA 4DV3K 3O3HA 3BZKA 1RTHA 2VWKA 3CQXA 1Q18A 1G15A 4AHTA 3AVAA 1J6ZA 4OKKA 4CGDA 3OYLA 1NGDA 4BRFA 3OYDA 2HHUA 4HWIA 2B5JA 1B9FA 1QHAA 4A5AA 4WQ4A 1HKCA 1NMDA 4M7YA 4W5TA 1FJGK 4FJLA 2YNFA 4I6MB 4QS9A 2HHWA 4CFAA 4GKJK 3LANA 4FOEA 3OYIA 2NRHA 3ATUA 4FWLA 4E3SA 3EL2A 4CESA 4JI7K 1YJ9N 4KTWA 3LWLA 4CE9A 3ZEUB 3O4WA 3F73A 3A5NC 4CGGA 3O9SA 4FLZA 3CFOA 3PSIA 4CJEA 3V9SA 4AQYK 4IFEA 5AFUA 1VQ5N 3LP2A 1ZXOA 4JI3K 3AVHA 3EE9A 3WNFA 3HM9A 1WSEA 3F9KA 3O5BA 4YOWA 3MN7A 1ILYA 1HJRA 4WFAL 1TAQA 4Z4FA 4OKJA 3SUQA 4FO0A 4BC4A 2W42A 3TTCA 4FWKA 4JKBA 4EP4A 3V81A 3VEVA 3WQTA 2Z1HA 4I9LA 4PQUA 3ZYYX 3EEQA 2CH6A 3NDKA 1UA0A 2PYJA 3TU5A 2IIRA 4CJUA 4CJKA 1RBUA 1R0AA 4YHHK 4CCHA 1UWBA 3V6DA 4AM7A 1B9DA 5M1OA 1Q9YA 1SZ2A 4A62A 4ZTFA 3WXKA 3CC2N 4CHOA 5CZ2A 5CE3A 3U6FA 3TWHA 1BISA 1KTQA 3QEVA 2E20A 3VTHA 4M42A 3D6RA 4CZFA 3SPZA 2Y1IA 1ATRA 3MN9A 1CLQA 3O9TA 4FM0A 1VHXA 3PLAA 2O8FA 4W5NA 1OH6A 5JVGL 4CGIA 3NVMA 1Z05A 5E41A 3DWLA 4LF7K 3J7ZO 1FW6A 4BRPA 4BR2A 2W40A 4IO9L 4AHUA 1A5WA 1D5AA 3L8BA 2J4RA 2IAJA 3TAMA 3HOTA 2X74A 3VF4A 2ZQBA 4U67L 4I2PA 4H5WA 1B92A 4HUGA 1NGHA 1TGOA 3PO4A 4J2EA 3ZT0A 4CEAA 1IBLK 4B9VA 4ID1A 2YHBA 3VEXA 4DUZK 2IS3A 2G8HA 4BE1A 1HYZA 1X9WA 4BE2A 1SUQA 4BE0A 4DTSA 2D0CA 2Q97A 3WNEA 1RDBA 2HHHK 3MECA 3D0PA 3GDQA 2OZSA 2RE2A 2BTFA 3LM2A 4JI1K 3LPUA 1BCMA 2HSTA 3MXIA 3VGKA 3THYA 2HW3A 3CCQN 3K5OA 1S6QA 3QB0A 1HKGA 5I3UA 5LJVA 3E9LA 4DV7K 4H5NA 3KVGA 2P9SA 3WUHA 3KHYA 4HUEA 3CM5A 3R9PA 1BI4B 5FPNA 4J2BA 4DTNA 3O1WA 5AQZA 5AQLA 5F1XA 3LP1A 3VQ6A 3QEPA 2YJFA 3ZSZA 3KK7A 1LW0A 3ASMA 3ZX2A 4FJ7A 1N8RO 4KTQA 3FZKA 4PKHA 1YVUA 1S6PA 3DLBA 4CJVA 1VSLA 3EKUA 3AVGA 5EOYA 5I9EB 1IBMK 4H0PA 3SUOA 3T69A 3MCPA 4NO7A 4CD3A 1EP4A 3AA5X 4A61A 3VA3A 2UUAK 1X9MA 3NF8A 4C8MA 2DTUA 2BH1A 1DGKN 4DTMA 4ZHRA 4BACA 3CC4N 3EE8A 3KK3A 4PHTX 4UY8O 2QWNA 1T3VA 4BRAA 3THWA 4M41A 1RBSA 4E1NA 2Q36A 1Q7YO 3SMSA 4HVJA 3V1QA 1Y64A 1VQPN 3KD5E 4H4MA 3AVCA 1VSEA 3CMAN 5KQDA 2HNYA 3AGRA 2XO7A 4BVPA 3ULEA 3HSCA 3TTFA 4N76A 2FLOA 4JKGA 3SMPA 1ZC6A 3LZJA 2W6LA 4QOZB 2RPIA 3VQQA 3M5RA 3QEXA 3HVRA 4GV9A 5FROA 4JI4K 3OYFA 1BGXT 1VSIA 2F4VK 2VGNA 4BRIA 4NCGA 5CYQA 1HMVA 1QS4A 1S3XA 4H0OA 3ZETA 4CJFA 3ZSQA 4Q5VA 4GY2B 3BF1A 1Q86O 2P5GA 3H6EA 1ZBFA 2Z1GA 1J9AA 4DV2K 4DR5K 4DSJA 4K8ZA 1OH8A 3AAQA 1UOCA 1QQOA 5BRFA 4EZ9A 1NKEA 1TUUA 4JS5A 4Z94A 3CJ9A 2P9SB 3VQ5A 3SAHA 1ZBSA 3U9DA 1KVCA 3CPEA 3CYMA 3J8AA 5HL7L 1NK6A 1U2VA 4BRKA 1O13A 1WBBA 2O8CA 3EN9A 3T7ZA 3EKSA 3MN6A 2JGUA 3WXIA 3SV3A 4EAHD 1RT1A 4JHDB 3HJFA 2XRIA 4CFDA 1XNRK 5AJ3K 3THXB 1VSFA 3K5LA 4AM6A 1Q81O 4GVEA 1BDGA 4YY3K 3SQ1A 4DR2K 4YDUC 1IH7A 1YUWA 4C8OA 4IEIA 4CGFA 1WBDA 4JYAK 2F7TA 1UA1A 2FBXA 1GLCG 3T3FA 3SCXA 1XI1A 3CMEN 4M3YA 3CCMN 1F21A 4GNIA 4FWRA 3RMDA 1RILA 2XY7A 2F8TA 3MEEA 1FKOA 4Y1CA 5AQJA 5HRPA 1YIJN 4JI6K 5FPMA 1IKVA 2RKIA 4KH5A 4B9QA 1CZAN 3WT0A 5J2NA 3FGUA 4CHYA 1S9GA 4CJSA 3ULDA 4FL9A 1NNEA 1GLDG 1W97L 3P38A 4NLCA 4BQZA 2QWRA 3L2RA 3M8PA 2HB5A 1D8YA 1GOAA 3PV8A 4CJ5A 5KQ8A 1BIZA 4IJNA 1IG9A 4LF8K 1YJWN 1BO5O 5KTQA 1HUXA 3AVIA 2X6SA 5C0YA 2XY8A 1RTJA 2YV0X 2KFNA 4FZXC 3P31A 4CHZA 4JLHA 3AARA 3CHWA 1IG8A 3VTIA 4KI4A 2PBDA 3D2EA 5AQPA 3O9RA 4KFBA 2HBMA 1L3SA 4JI0K 3HPOA 1NJYA 2RHKA 5KPRA 3DRSA 4J2DA 2G8FA 5C24A 1VQ4N 3ZX0A 1RDUA 4MQ3A 3SNNA 1C1CA 4FWSA 1RTDA 4BG8A 1IJJA 3HPHA 5GINA 3OYBA 1IKYA 1KD1O 2FXUA 1N32K 2Q1NA 3DXMB 4ILGB 4BGBA 1NGIA 3PX6A 2E88A 5EVZA 2HBLA 3JSMA 5LMNK 2QWOA 3G6EN 3I8DA 2QXFA 2HHVA 4CK1A 1QZ6A 3LDNA 2FBVA 1HPZA 1QHTA 3R6MA 1CZBA 4PKIA 3RMBA 3FFKB 3HP9A 4W5RA 3NGZA 4DB3A 2HNDA 1J53A 4B8CA 3OYAA 4AHSA 4CZIA 4LH5A 1RGIA 4WE1A 5E84A 3V9UA 2QA4N 5CZ1A 1C0MA 4F2RA 3RVCA 3LP3A 1TVRA 3C0BA 5I42A 4CF0A 1TK5A 2W6KA 3AA3A 5AFUH 4CBWA 4M3ZA 4O8KA 3B6OA 4WQ5C 1NGBA 5HLFA 1GLAG 3CQ8A 1KC8O 4JK7A 3TAFA 3NAEA 4FJHA 3J7YP 2DFHA 3C7NB 3QLHA 3OA9A 1T6DA 4MLHA 4B1WB 4FCYA 2YHXA 3E9OA 2D0PA 3IS9A 4CI6A 1RBTA 4B9MA 3S3MA 3CC7N 4O5FA 4FJJA 5JLHA 3KLIA 1RT7A 1NK7A 2QXLA 4FLVA 1KVBA 1ASWA 2CH5A 4M3RA 4CECA 1LW2A 2YHYA 1CXUA 1JLAA 1SKSA 3IAYA 3CM6A 4BRMA 4OLAA 1VQLN 3HM8A 2ITMA 4XH4A 1M90O 2CGLA 4ISFA 3DAWA 5F2RA 1VQ8N 4HUFA 2ASPA 2V52B 3DRPA 1R59O 1JXBA 5T7BA 1W0HA 4B9NA 4E1MA 5HP1A 3OS2A 2BUPA 3B6PA 3VQPA 2V7ZA 2A5XA 2Q31A 3QBWA 3OYMA 1NKCA 3VQEA 1S1UA 4IEEA 3DLKA 4E0DA 4C1NI 3QMLA 5KGXA 3HT3A 1ITGA 1RT5A 2E1YA 1TV6A 4Y1DA 1BI4A 4H0XB 2DY4A 1RDAA 1MU2A 1S72N 2JWLA 4K41A 5C10A 3O1BA 1WOQA 5CHIA 4O8UA 1IKWA 3C94A 3GG4A 5LJWA 3VPZA 3ZT1A 4KREA 1LWEA 3QFPA 2A42A 2Z1IA 1NOYA 3KLHA 4CERA 3LAKA 3U9ZA 5HRNA 2HHTA 1U49A 4I7FA 4DQPA 1QVGM 4AHVA 4M3WA 4CZJA 3DXMA 3K5NA 1BA1A 3C6HA 5KRTA 1YVNA 3LAMA 1X1PA 4R79A 2YJEA 4FLUA 2FF6A 3QNOA 1EQYA 3PY8A 1HNXK 3E01A 4DV4K 4H4OA 3RSEA 3ZSYA 5KPTA 3GE1A 1DKGD 4RW9A 5E26A 4CEDA 2YCHA 3Q7CA 3CCLN 4Y0WA 3NF9A 4AHRA 5EU7A 5AQRA 3TAQA 2FF3B 2P9KA 1S1VA 5K14A 5JMVA 3SUNA 1SKWA 1OH7A 4LFAK 3QFUA 4M7XA 3NVKA 3JYTA 3TPQA 1LV5A 1J5OA 5ADXH 4DR3K 2HOEA 3AVFA 4FM2A 3OBYA 3DRRA 4Z0UA 1WLJA 1NGAA 1SQKA 2H3GX 1YTUA 1BA0A 4CJ4A 3QEIA 4KPYA 2UXBK 1SL0A 1GLFO 3DYAA 3P83D 5KGWA 4GVMA 3NMUA 3DOLA 3JXUA 4CJ7A 5C12A 4BWMA 3C6TA 3VF6A 1HYVA 1S5JA 4CHPA 3NF7A 4KHPK 3V9XA 2VG5A 5ADXA 3U3YA 3ZLJA 4XH5A 3D2EB 4OJRA 3O80A 3U8XA 1XC9A 1Z25A 3NHGA 4H5RA 2UUCK 4CZEA 4L8RB 2OCEA 2P9PB 1DTQA 4RW7A 4I9QA 2P9LA 4FJNA 3CFPA 3H45C 3ID6A 1RDWX 3AO1A 1TYQA 1HYSA 4DLGA 3ENBA 5SZTA 2A40A 4X62K 2F9TA 3HOSA 4O5BA 3NH1A 5AQKA 5J2PA 5C2DA 4CJQA 2D0BA 1RFQA 1M1KO 4LF9K 4JKHA 1T7PA 1OKJA 3HSTB 1WSJA 3L2WA 3TANA 3SJJA 1TK8A 3CCJN 4FJMA 1NMNA 4HCCA 3MXJA 1BUPA 3U4LA 2UYTA 4FW2A 5AZJA 4CHQA 4BRGA 4FLXA 3NH0A 4BR0A 4DR4K 1BQMA 4BC2A 4NXMK 4FWPA 2QKKA 4CF2A 3UKUB 1K8KB 5HBMA 2FSNA 3DLGA 2CGKA 2HVIA 1XQSC 5J2MA 3OW2M 1J54A 3LDPA 3VN5A 4E89A 4KB0A 3PIOL 3VQ7A 4XH1A 2QM1A 4EIAA 3J80O 4DUYK 3CF5L 3BP8A 4DG1A 4OVLA 4RW6A 4B9TA 1VRTA 3L4IA 4LH4A 3I55N 4DSEA 2FBTA 4C8NA 4H5VA 1KLMA 2E6LA 5C2FA 3FR0A 3H1VX 3ZETB 4BDPA 1E3MA 4BRHA 4EP5A 3T1HK 1VQON 2A1RA 4FWMA 3UKRA 4ID5A 3LZIA 4FYDA 4B9SA 4JI5K 3MK6A 1ZBHA 5TKWA 4DQ8A 3L2VA 1U6ZA 2QWQA 2AP1A 4IKFA 4E19A 3CCRN 3RR7A 1ZBUA 3KIOA 1KQSM 4C23A 3ULEB 4LFCK 1YITN 5JICA 2GX9A 3DLEA 1W2BM 3FZLA 4FWQA 1WSIA 3SZ2A 3PIPL 4O55A 2HVHA 4YFUA 1I39A 1K9MO 4C8LA 1GOCA 2ASOA 3TSPA 4DFKA 3D2FA 2YKNA 3QDKA 4Z4GA 4E7JA 3QO9A 4BDYA 3FFIA 5AQFA 3ALYA 3OYEA 4F9OA 2ZJRL 4QS7A 3ATVA 3SLCA 3DLLL 1VAZA 5CR4A 3EY1A 3CFRA 3DM2A 1KRPA 4DTPA 3P5JA 2KHOA 4KRFA 1JLEA 1XHZA 2P9UA 3GL1A 3QEWA 3WEEA 3WQUA 1XMQK 4BR5A 4OGEA 4DTXA 2OPRA 3L2QA 4GV6A 2QWMA 3ZSVA 4DWIA 3THWB 2GWJA 4RW8A 3A0IX 4PKGA 3HVTA 2FSJA 3QBXA 1C1AA 1WSFA 3VOVA 1JL1A 3OYJA 3HTVA 2A41A 4JKEA 4RG8A 4DU4A 4NCBA 5BPMA 1NJWA 1RNHA 4NCAA 5JS1A 1ASUA 2OTJN 1KAZA 3NGYA 3G10A 5CY4A 1RT6A 3AVNA 4CF1A 1HRHA 1XWLA 2QW9A 5BRDA 4IOXA 4YOVA 3VETA 2ZWHA 5GADP 2IVOA 3D7EO 3CIPA 4FK2A 5AZIA 1NM1A 5M1PA 1VSJA 3QETA 1BHLA 3A5LC 3RR8A 4HTUA 3OY9A 2D0AA 5IWAK 2NRRA 4AHCA 2VWBA 3NGIA 3HXMA 4KHSA 4DS4A 4QS8A 3ENOA 3I8BA 1NGGA 4A2AA 1WAFA 4JN4A 5GAHP 1KSPA 3LDOA 3L2UA 1VSMA 3K57A 2E2QA 2HMIA 2O8DA 4CJRA 3I56N 4WFNL 3H3NO 1LAWA 4BRLA 2OTLN 1YJNN 2P9LB 1A5VA 3VEYA 5C25A 4Z4IA 3NCIA 3S41A 3ZT4A 1T03A 5AQVA 2JWKA 5KI6A 1SV5A 3I0RA 3RTVA 3AO4A 2EX3A 4AILC 1MWMA 5AQYA 3K9JA 5JVHL 2GUIA 3IDHA 4CVNE 4CGJA 1LOTB 2P9UB 4ZTJA 4F8RA 4WCEL 4H0TB 1S1XA 2BE2A 3HPGA 1SS6A 1YI2N 4JI2K 1MDUB 2NRTA 2WC9A 4MDBA 3FZHA 4IFVA 3T19A 1S22A 3CD6N 2G8WA 4B3SK 3CI5A 1WAJA 4B8AB 1W7AA 3G71N 3MX2A 1ESVA 3ID8A 5C42A 4FLWA 2ZM6K 5BR8K 1QSYA 4TSXA 4A2BA 4L3QA 3SJHA 1GLEG 5F0XA 3SQ2A 4FJ5A 4M45A 1QQNA 1NK0A 5AQSA 3O4QA 1ATSA 3JS6A 3RSEB 1LAVA 1VSHA 2XHBA 2BDPA 3UE5A 1VSKA 2IVPA 3K0SA 1JKHA 1DT9A 1Q8IA 4GMJB 4KV8A 5AQIA 4PWDA 2O8DB 4FSVA 3LDLA 4IG3A 4M3TA 2NZTA 4H8KA 4HCBA 3MN5A 4OPHA 3DXKB 3N4QA 3CJCA 1TKTA 2O8CB 3T1AA 2YHWA 1HQEA 2GTDA 3SPYA 4CFCA 4JV5K 4IFYA 2P9KB 4JD2B 3L0QA 3AVBA 2HNZA 2KFZA 3DI6A 3SQ0A 3ISNC 4I6MA 4BVOA 3MXMA 2NUBA 2YNHA 2ASMA 2HF4A 4MO5A 3L4QA 5AQHA 1N34K 3M1FA 5C15A 3O3FA 3MX5A 3HI0A 5J2QA 4BC3A 4KH4A 2WBNA 2W41A 2DPNA 5EY4A 2WOMA 4Q0BA 3LPTA 5FRNA 3L3UA 2KKZA 4DV0K 3TABA 3BEXA 4C1NK 3K9KA 3K59A 1VQNN 1HKBA 4OO1J 3TAPA 4FVMA 3CJBA 4DFJA 1U4BA 3RWUA 3SAGA 1ZBIA 3KWIA 4KKOA 1BL3A 2WFBA 3WXLA 1G99A 1E4GT 4CZKA 1NK9A 4F3TA 4NXNK 4FZYA 4FK0A 3BDPA 4YNQA 4N5SA 3SUPA 4ELVA 3S3NA 1C0TA 4FM1A 1RDDA 4DV1K 4XEIA 3H3OB 1BG3A 2V51B 4OGCA 1TUYA 3A5OC 3GOIA 2KZZA 3QICA 3OJUA 2ZD1A 3VQBA 2OPPA 4BRQA 3LDSA 4KHQA 4JKGB 3PX0A 4O0JA 5AR0A 4A57A 1T6CA 1VRUA 4CBUA 3VEZA 4BREA 4CEOA 4LFBK 2RF2A 3C65A 4BROA 5BPLA 3BF3A 1HPMA 3R1XA 4E7IA 4IOCL 2E8AA 4F4KA 1BIUA 2E2PA 4IG0A 3K58A 1NJZA 1SL1A 4OPJA 1WSGA 4FJ8A 1C0UA 2NRXA 3QERA 2E2NA 1QQCA 3M6GA 2O4IA 4E7LA 3TI0A 3ZSWA 4CZGA 5DM6L 4RWTA 3H46O 4V19S 3O9QA 2VCPA 1V4TA 3VESA 4X64K 2A3ZA 5BREA 3G25A 2IOCA 1TKXA 3ZX3A 4NYNA 1P8ZA 1D9FA 1RT3A 4CEEA 3UKRB 4X65K 2VYPA 5GIPA 3CCEN 5M1KA 5AQWA 4CBXA 4GV3A 4ILHA 1QTMA 2O8BB 3K5MA 1E4FT 4KB1A 4CK2A 1VK0A 3UB5A 3PX4A 4JRQA 4FXDA 3V9ZA 4M3UA 4E7HA 1FK9A 1MA9B 1ATNA 3CERA 4BRCA 3MMVA 4JEPA 1QE1A 2X6NA 4LSLA 2HHSA 3F5TA 1OVYA 5AZIB 3OHRA 4IDKA 2F8SA 3VERA 4JD2A 1GLBG 1NGFA 1HNIA 3UKUA 3CG7A 2HBKA 3WNHA 1RCHA 5IT9O 3CCUN 3RMCA 3NBPA 4CZHA 2R7YA 3ZCMA 3E9PA 1DEJA 1LCUA 4BR7A 4BDZA 1Y97A 4BWJA 1HLUA 4DR1K 4PL8A 3ZT2A 1C0GA 4FJIA 3HBTA 3OJSA 3DLHA 1NWKA 3O9UA 5FLXO 4FJXA 4B1ZA 5KRSA 3BY5A 1RDCA 4WQ5A 4A59A 1YXQA 3ZSXA 4CW7B 4FLTA 4CJTA 1EXQA 2QWLA 3J81O 3DOKA 2FSKA 2KQ2A 2ZF5O 4H0VB 4DTRA 1HNWK 4K0KK 1TYQB 4FJGA 4FZZA 5FRMA 3FZFA 4LF5K 1D4XA 2DFFA 3E1YA 3EZWA 2YNGA 5SWMA 5HROA 3WXJA 5EXWA 4FLYA 2G8KA 1T44A 1SKRA 5AQXA 1KCFA 3LM9A 4KTZA 4H03B 3P4IA 5BPNA 1TKZA 1JLFA 2O8FB 3KJVA 4KAZA 4LF6K 1XNQK 3PO5A 3RRGA 4B9LA 4EZ6A 3F2KA 5AQNA 4K42A 5AQQA 3OYNA 4BC5A 3HZ6A 3IKMA 4OLBA 3KWGA 2VQFK 2DFEA 2G8VA 1K8AO 4IXCA 3RRHA 1X9JA 1NG9A 1JCGA 2P9NA 5MLCQ 3VMFB 5M1QA 4JK9A 2E2OA 2F9WA 4B9UA 4E1JA 4NB4A 1JXEA 5JS2A 4DLEA 2XY6A 3ZSOA 4DHYA 3Q7BA 4CGHA 3VEWA 3DMJA 3CXCM 3I0SA 5BN8A 4DR7K 3C6AA 3HK2A 4B08A 1SL2A 4N47A 4CF8A 3AY9A 2XY5A 1NOZA 3AA4A 4DTOA 1L3UA 2YKMA 1P90A 4O0IA 3VQCA 1TL1A 1NJIO 2OANA 4IJAA 1VQMN 1T05A 3CCVN 1K8KA 1GOBA 3M8RA 4BR9A 1U2VB 3L3VA 1HX1A 2KLAA 3IUCA 4MO4A 3KLEA 1RBVA 4BRNA 3V1OA 1YTAA 3E66A 4CJPA 4C8KA 3NFAA 3AVKA 3VQ4A 3LALA 2GEMA 4BRDA 3IRXA 3TAEA 1HJOA 4CJ3A 4WF9L 2WTUA 1QSSA 4DV5K 3K2PA 4B3RK 3LP0A 3VENA 1TL3A 4CEBA 4JKFA 4YDUA 1WUAA 2YX6A 3C6UA 2KTQA 3RMAA 2E5LK 1CXQA 5AQTA 4CIGA 4KHUA 1JL2A 5D3GA 5A2QO 4B3MK 2NRWA 1Q82O 1CZ9A 3G0ZA 1J5EK 5FPEA 2Q3SA 2LSNA 4CJLA 3AVMA 4JI8K 2OPSA 3UIQA 3H08A 3LDQA 1S1TA 3OYHA 2NRZA 2Q0UA 4ILJA 4CK3A 3ZT3A 1NJXA 2Q0RA 3CPWM 4DSKA 4DF8A 1U48A 1LWFA 1NGEA 4DS5A 2ZGYA 1YF5L 3D2FB 4RW4A 2UU9K 3KD1E 1NLVA 4DTUA 4PL7A 2P9IB 3MWTA 3KLFA 3V1RA 3SQ4A 4XIUA 1NBWA 5GIOA 1UAXA 1N5YA 4M3XA 3OBWA 4DSLA 1NK8A 1GLLO 3SAFA 2KZMA 1WB9A 2UXCK 1MWKA 1YHQN 5GAGP 1BCOA 3OYCA 1VQ6N 3A8YA 1O1WA 1IO2A 3PUFA 3WNGA 2VG7A 2YHAA 3BZCA 4DFPA 4M63C 1RTIA 1KFSA 4HHTA 4ELUA 1BU6O 3CETA 2Y1JA 3FZMA 3P39A 5JLFA 4N41A 3V9WA 4K25A 2RN2A
chains in the Genus database with same CATH topology
3WNFA 1RT7A 3HM9A 1WSEA 3F9KA 1NK7A 1RBRA 1D9DA 4FLVA 1KVBA 3IG1A 2F96A 1HJRA 1TAQA 4Z4FA 1ASWA 4OKJA 3TR8A 3SUQA 3SQ2A 4W5QA 4M3RA 2W42A 4FJ5A 3KLGA 4CECA 4M45A 4EP4A 3V81A 1LW2A 3D45A 1NK0A 2Z1HA 3O4QA 1CXUA 4I9LA 5CYMA 2G8UA 2FBYA 1LAVA 1JLAA 1VSHA 2XHBA 1SKSA 2BDPA 3IAYA 4N76A 4PA1A 3NDKA 3CM6A 1UA0A 1VSKA 2PYJA 1JKHA 4GMJB 1Q8IA 4I2QA 4CJUA 1RBUA 4CJKA 4OLAA 4KV8A 1R0AA 4CCHA 1UWBA 3V6DA 3NH2A 4PWDA 4IG3A 1B9DA 4DQQA 4M3TA 4HUFA 2O4IA 4H8KA 4HCBA 3AO2A 3DRPA 4ZTFA 1Q9YA 1JXBA 1DLOA 1TKTA 1IKXA 3AO3A 5T7BA 1W0HA 4B9NA 4CHOA 3T1AA 4E1MA 1HQEA 5CZ2A 5HP1A 3SPYA 4CFCA 3U6FA 3TWHA 1BISA 3OS2A 3OS0A 1KTQA 4IFYA 3B6PA 3QEVA 3VQPA 1DTTA 3AVBA 2HNZA 3OYMA 1NKCA 4M42A 2KFZA 3DI6A 5DK5A 3U3GA 3SPZA 3VQEA 2Y1IA 3SQ0A 1S1UA 3ISNC 4F2SA 1CLQA 3MXMA 3DLKA 2NUBA 2YNHA 4LY7A 4Z4CA 4FM0A 3VA0A 1ZBLA 4E0DA 2ZE2A 3EYZA 5KGXA 3O3FA 3HT3A 1ITGA 3ZSRA 1RT5A 1TK0A 4W5NA 1TV6A 4Y1DA 1BI4A 1WSHA 5J2QA 1L3TA 4CGIA 2DY4A 1RDAA 1MU2A 5E41A 2X78A 1IKWA 3C94A 3SYZA 2E6MA 2WOMA 3ZT1A 4KREA 2HHXA 1LWEA 4AHUA 3LPTA 4N56A 4Q0BA 5FRNA 4IBNA 1A5WA 1D5AA 3L3UA 3L8BA 1LWCA 2Z1IA 2IAJA 4Z4HA 2OPQA 3TAMA 1NOYA 3KLHA 2IDOA 3TABA 4CERA 4PQUA 2B4JA 2X74A 3LAKA 5HRNA 2HHTA 4KHYA 2ZQBA 3VQAA 4I2PA 2VG6A 4CJWA 1U49A 1RT4A 3K59A 4I7FA 1B92A 4HUGA 4DQPA 3TAPA 1TGOA 4FVMA 4DFJA 1U4BA 3RWUA 3PO4A 4J2EA 4AHVA 1ZBIA 3ZT0A 4KKOA 1BL3A 4CEAA 4B9VA 4ID1A 3MAQA 1HQUA 3K5NA 4M3WA 2YHBA 2ETJA 2IS3A 5KRTA 2G8HA 1TAUA 3LAMA 4BE1A 1X1PA 1HYZA 1X9WA 1NK9A 4F3TA 3BGRA 1JLBA 4BE2A 4FLUA 4FZYA 3M8QA 1SUQA 4FK0A 4DSIA 3QNOA 3BDPA 4BE0A 4YNQA 4N5SA 4DTSA 2D0CA 3WNEA 3E01A 3SUPA 3PY8A 4ELVA 3S3NA 1RDBA 4H4OA 1C0TA 3ZSYA 3TARA 4FM1A 1RDDA 3MECA 3D0PA 2OZSA 4RW9A 4CEDA 4OGCA 2PY5A 3LPUA 2KZZA 1BCMA 3MEGA 3NF9A 3MXIA 1BQNA 3OYKA 3OJUA 2ZD1A 5EU7A 4AHRA 2HW3A 1RT2A 3K5OA 3TAQA 4DTJA 1S6QA 1S1VA 3VQBA 2OPPA 5K14A 1W9HA 3KK1A 3LDSA 3SUNA 1SKWA 4KHQA 4FK4A 4QCLA 3PX0A 4G1QA 3JYTA 5I3UA 4O0JA 2I5JA 1LV5A 4CFBA 1J5OA 4FM2A 1VRUA 3AVFA 5HRRA 3OYGA 4CEOA 3DRRA 4Z0UA 4CEQA 4HUEA 1WLJA 2RF2A 3CM5A 1YTUA 4CJ4A 1BI4B 3QEIA 4KPYA 2BGGA 4J2BA 4DTNA 4NYFA 1K6YA 1SL0A 4E7IA 2P5OA 3DYAA 3P83D 4F4KA 1BIUA 4IG0A 3K58A 3LP1A 5KGWA 3VQ6A 3QEPA 4GVMA 1NJZA 3ZSZA 1WN7A 1WSGA 4OPJA 3DOLA 3HP6A 1SL1A 4FJ8A 1C0UA 3QERA 4BWMA 3C6TA 2BANA 1LW0A 1QQCA 3ASMA 1L3VA 1A5XA 3KKSA 4E7LA 3THVA 1HYVA 1S5JA 4CHPA 4KTQA 3NF7A 1KFDA 3TI0A 3ZSWA 3V9XA 2VG5A 3AV9A 3U3YA 1YVUA 4OJRA 3O3GA 1S6PA 1ZYQA 4LD0A 3HYFA 3DLBA 4CJVA 4CEZA 3DLRA 4W5OA 1VSLA 1XC9A 1Z25A 3AVGA 3NHGA 4L8RB 2IOCA 3SUOA 1DTQA 1Q9XA 1KLNA 1TKXA 4RW7A 4I9QA 4NYNA 3C95A 1D9FA 3V9WA 1RT3A 4CEEA 1EP4A 3AA5X 3CFPA 4FJNA 3EZ5A 3VA3A 1X9MA 3AO1A 3NF8A 1YT3A 4C8MA 1HYSA 2DTUA 1QTMA 4DLGA 5SZTA 5DMRA 4CEFA 3K5MA 4DTMA 4ZHRA 4BACA 4KB1A 4CK2A 4LSNA 1VK0A 4O5BA 3NH1A 2VWJA 3KK3A 3OVNA 5J2PA 5J1EA 4CJQA 2D0BA 3PX4A 4JRQA 3HO1A 4FXDA 3V9ZA 3HL8A 4M3UA 4E7HA 4M41A 1FK9A 1RBSA 4E1NA 4CHNA 3L2WA 3HSTB 1WSJA 3TANA 4UQGA 3SJJA 1T7PA 4F3OA 1QE1A 4HVJA 3V1QA 2IC3A 2X6NA 4LSLA 3M8SA 4JS4A 1TK8A 2HHSA 1S1WA 3KD5E 4FJMA 4KO0A 1REVA 4HCCA 4H4MA 3AVCA 1XHXA 3MXJA 5FDLA 1VSEA 4CIFA 4FW2A 4IDKA 2F8SA 4OPKA 4CHQA 2HNYA 2XO7A 3VQ9A 1HNIA 2G8IA 4FLXA 3S3OA 3CG7A 4FW1A 3NH0A 1BQMA 1JLCA 1RCHA 3WNHA 1QSLA 2JLEA 3LZJA 3RMCA 2QKKA 3P1GA 4CF2A 3MEDA 2AJQA 4QOZB 3NBPA 2RPIA 3NE6A 2O4GA 2R7YA 5HBMA 3VQQA 3O4NA 3ZCMA 3DLGA 3QEXA 3HVRA 4BDZA 1L5UA 1Y97A 4BWJA 5FROA 4DQIA 2HVIA 3OYFA 1NK4A 1BGXT 4PY5A 4B3OA 1VSIA 3ZT2A 5J2MA 4QAGA 4FJIA 1J54A 4NCGA 5CYQA 1HMVA 2EHGA 3VN5A 1S9EA 1QS4A 2WONA 4CF9A 4E89A 3OJSA 4DU1A 1T8EA 3DLHA 2IGIA 4KB0A 4CJFA 3VQ7A 4FJXA 3QINA 5KRSA 3ZSQA 4DFMA 4Q5VA 4Z4EA 4DG1A 1RDCA 4OVLA 4RW6A 4B9TA 1VRTA 5HRSA 2P5GA 4LH4A 2ATQA 4DSEA 3ZSXA 1ZBFA 2Z1GA 1J9AA 4FLTA 2FBTA 4C8NA 4CJTA 4DSJA 4K8ZA 1EXQA 1KLMA 3DOKA 2E6LA 4CIEA 2KQ2A 1UOCA 4BDPA 4EP5A 4EZ9A 4DTRA 1NKEA 4FJGA 4JS5A 2A1RA 4FZZA 4ID5A 3LZIA 4FJ9A 3VQ5A 4FYDA 1EX4A 5FRMA 4B9SA 1KVCA 3SV4A 2DFFA 3CYMA 5HROA 2YNGA 5SWMA 1EETA 1N6QA 2ITGA 1NK6A 1ZBHA 3L2VA 4FLYA 2B6AA 2PYLA 2G8KA 4IKFA 4E19A 3RR7A 2QKBA 1ZBUA 1KVAA 3KIOA 4JRPA 4DF4A 1SKRA 2P1JA 2JGUA 3SV3A 1KCFA 3AO5A 4KTZA 1RT1A 3OS1A 3HJFA 2XRIA 1U04A 4J2AA 1TKZA 1ASVA 1JLFA 3DLEA 4CFDA 3KJVA 1Z26A 2E4LA 3LWMA 3ITHA 4KAZA 3PO5A 1VSFA 3K5LA 2OA8A 3RRGA 4B9LA 4EZ6A 2HHQA 1WSIA 3SZ2A 4O55A 2HVHA 4YFUA 1I39A 3AVJA 3SQ1A 4C8LA 3OYNA 1GOCA 3TAGA 3SI6A 1WNSA 4DMNA 1C1BA 4DFKA 1IH7A 4C8OA 4CGFA 4KHNA 2YKNA 4Z4GA 4O44A 4E7JA 2FBXA 1UA1A 4OLBA 4OKEA 3QO9A 2P51A 4BDYA 3T3FA 3SCXA 1XI1A 3FFIA 4M3YA 3ALYA 1F21A 3OYEA 1FXXA 2DFEA 2G8VA 3RMDA 3RRHA 1RILA 2XY7A 3QIPA 1FKPA 2F8TA 3MEEA 1FKOA 4Y1CA 3KTQA 5HRPA 3EY1A 3CFRA 3QIOA 2Z1JA 3DM2A 1KRPA 4DQSA 4DTPA 3P5JA 4KRFA 1JLEA 1JLQA 1IKVA 3VQDA 2RKIA 1XHZA 1HNVA 3QEWA 4MFBA 5J2NA 4CHYA 4B9UA 1S9GA 4AH9A 5JS2A 1JXEA 4DQRA 4DLEA 4OGEA 4CJSA 2OPRA 3L2QA 4DTXA 2XY6A 3ULDA 4K8XA 3ZSVA 3ZSOA 4DWIA 4CGHA 4RW8A 2OYQA 3VQ8A 3DMJA 3A2FA 3I0SA 3QNNA 1X9SA 4E7KA 3HVTA 3L2RA 3HK2A 1C1AA 1WSFA 3V4IA 4R5PA 3M8PA 2GV9A 2HB5A 4B08A 1JL1A 1D8YA 1GOAA 3OYJA 3PV8A 1SL2A 4CJ5A 4RG8A 4DU4A 4NCBA 1BIZA 1U45A 4N47A 1IG9A 4CF8A 1NJWA 5KTQA 4KI6A 1RNHA 3AVIA 2X6SA 2XY5A 1NOZA 1ASUA 3AA4A 4DTOA 1L3UA 4NCAA 2YKMA 2YNIA 3G10A 2A1SA 3NGYA 2XY8A 5CY4A 2KW4A 1RTJA 1RT6A 3AVNA 4O0IA 2OZMA 3VQCA 1TL1A 2YV0X 4CF1A 4DU3A 2KFNA 1HRHA 1XWLA 1T05A 4FZXC 4PUOA 1GOBA 2QK9A 3M8RA 4FJ7A 1TKDA 4CHZA 4JLHA 3L3VA 1JLGA 1NKBA 4KI4A 1EKEA 3S9HA 1I3AA 4KFBA 3KLEA 1RBVA 1L3SA 4ICLA 3HPOA 1NJYA 3V1OA 3QESA 4FK2A 3DRSA 4ELTA 4J2DA 1VSJA 3KK2A 3QETA 2G8FA 1BHLA 4FJKA 3RR8A 1YTAA 5C24A 4CJPA 4HTUA 2FC0A 3NFAA 1U47A 3OY9A 4C8KA 3AVKA 2D0AA 3VQ4A 3LALA 4MQ3A 3SNNA 1C1CA 3IRXA 3KKRA 4AHCA 3NGIA 3TAEA 1RTDA 3HXMA 4CJ3A 1C6VA 3HPHA 1QSSA 4KHSA 3OYBA 4DS4A 4KHWA 1IKYA 3AVLA 3K2PA 3LP0A 4DSFA 1WAFA 1TL3A 4CEBA 1NK5A 4O4GA 2PZSA 3C6UA 2KTQA 3RMAA 2GBZA 3PX6A 1CXQA 1KSPA 2D5RA 3AA2A 4CIGA 3L2UA 3JSMA 4KHUA 1JL2A 5D3GA 1VSMA 1CZ9A 3G0ZA 4GW6A 3K57A 2Q3SA 5JS1A 3I8DA 2QXFA 2HMIA 2LSNA 4CJLA 3NF6A 3AVMA 1VSDA 2HHVA 2OPSA 4CJRA 3UIQA 3H08A 3O3HA 1S1TA 4CK1A 3OYHA 2FBVA 1RTHA 1LAWA 2VWKA 4CK3A 3ZT3A 1NJXA 1HPZA 1G15A 1QHTA 3AVAA 4AHTA 1CZBA 3RMBA 4DSKA 4OKKA 4DF8A 1U48A 3HP9A 4CGDA 4W5RA 3OYLA 3NGZA 3OYDA 1A5VA 5C25A 2HHUA 1LWFA 4Z4IA 3NCIA 3ZT4A 2B5JA 2HNDA 1B9FA 1J53A 4B8CA 3OYAA 1T03A 4DS5A 4AHSA 5KI6A 4LH5A 1SV5A 3I0RA 3RTVA 3AO4A 2EX3A 4RW4A 4WE1A 4AILC 3KD1E 3V9UA 4W5TA 5CZ1A 1C0MA 4DTUA 4F2RA 3LP3A 1TVRA 2GUIA 3KLFA 4CGJA 5I42A 4FJLA 2YNFA 4CF0A 1TK5A 3V1RA 3AA3A 3SQ4A 4M3ZA 4XIUA 4ZTJA 4CFAA 2HHWA 3LANA 3OYIA 4F8RA 3B6OA 1S1XA 1UAXA 1N5YA 4E3SA 4M3XA 4DSLA 2BE2A 1NK8A 3HPGA 5HLFA 3CQ8A 4CESA 3TAFA 3NAEA 4FJHA 2KZMA 2DFHA 3QLHA 4IFVA 4KTWA 3T19A 4CE9A 3LWLA 3F73A 3OYCA 1BCOA 2G8WA 4CGGA 4FCYA 4FLZA 1O1WA 1IO2A 3PUFA 3WNGA 1WAJA 2VG7A 2YHAA 3CFOA 3IS9A 4B8AB 4DFPA 1RTIA 1KFSA 1RBTA 4CJEA 3V9SA 4B9MA 3S3MA 5C42A 4HHTA 4FLWA 4ELUA 3LP2A 2Y1JA 1QSYA 4FJJA 4N41A 3AVHA 4TSXA 3KLIA 2RN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNF A;  1RT7 A;  3HM9 A;  1WSE A;  3F9K A;  1NK7 A;  1RBR A;  1D9D A;  4FLV A;  1KVB A;  3IG1 A;  2F96 A;  1HJR A;  1TAQ A;  4Z4F A;  1ASW A;  4OKJ A;  3TR8 A;  3SUQ A;  3SQ2 A;  4W5Q A;  4M3R A;  2W42 A;  4FJ5 A;  3KLG A;  4CEC A;  4M45 A;  4EP4 A;  3V81 A;  1LW2 A;  3D45 A;  1NK0 A;  2Z1H A;  3O4Q A;  1CXU A;  4I9L A;  5CYM A;  2G8U A;  2FBY A;  1LAV A;  1JLA A;  1VSH A;  2XHB A;  1SKS A;  2BDP A;  3IAY A;  4N76 A;  4PA1 A;  3NDK A;  3CM6 A;  1UA0 A;  1VSK A;  2PYJ A;  1JKH A;  4GMJ B;  1Q8I A;  4I2Q A;  4CJU A;  1RBU A;  4CJK A;  4OLA A;  4KV8 A;  1R0A A;  4CCH A;  1UWB A;  3V6D A;  3NH2 A;  4PWD A;  4IG3 A;  1B9D A;  4DQQ A;  4M3T A;  4HUF A;  2O4I A;  4H8K A;  4HCB A;  3AO2 A;  3DRP A;  4ZTF A;  1Q9Y A;  1JXB A;  1DLO A;  1TKT A;  1IKX A;  3AO3 A;  5T7B A;  1W0H A;  4B9N A;  4CHO A;  3T1A A;  4E1M A;  1HQE A;  5CZ2 A;  5HP1 A;  3SPY A;  4CFC A;  3U6F A;  3TWH A;  1BIS A;  3OS2 A;  3OS0 A;  1KTQ A;  4IFY A;  3B6P A;  3QEV A;  3VQP A;  1DTT A;  3AVB A;  2HNZ A;  3OYM A;  1NKC A;  4M42 A;  2KFZ A;  3DI6 A;  5DK5 A;  3U3G A;  3SPZ A;  3VQE A;  2Y1I A;  3SQ0 A;  1S1U A;  3ISN C;  4F2S A;  1CLQ A;  3MXM A;  3DLK A;  2NUB A;  2YNH A;  4LY7 A;  4Z4C A;  4FM0 A;  3VA0 A;  1ZBL A;  4E0D A;  2ZE2 A;  3EYZ A;  5KGX A;  3O3F A;  3HT3 A;  1ITG A;  3ZSR A;  1RT5 A;  1TK0 A;  4W5N A;  1TV6 A;  4Y1D A;  1BI4 A;  1WSH A;  5J2Q A;  1L3T A;  4CGI A;  2DY4 A;  1RDA A;  1MU2 A;  5E41 A;  2X78 A;  1IKW A;  3C94 A;  3SYZ A;  2E6M A;  2WOM A;  3ZT1 A;  4KRE A;  2HHX A;  1LWE A;  4AHU A;  3LPT A;  4N56 A;  4Q0B A;  5FRN A;  4IBN A;  1A5W A;  1D5A A;  3L3U A;  3L8B A;  1LWC A;  2Z1I A;  2IAJ A;  4Z4H A;  2OPQ A;  3TAM A;  1NOY A;  3KLH A;  2IDO A;  3TAB A;  4CER A;  4PQU A;  2B4J A;  2X74 A;  3LAK A;  5HRN A;  2HHT A;  4KHY A;  2ZQB A;  3VQA A;  4I2P A;  2VG6 A;  4CJW A;  1U49 A;  1RT4 A;  3K59 A;  4I7F A;  1B92 A;  4HUG A;  4DQP A;  3TAP A;  1TGO A;  4FVM A;  4DFJ A;  1U4B A;  3RWU A;  3PO4 A;  4J2E A;  4AHV A;  1ZBI A;  3ZT0 A;  4KKO A;  1BL3 A;  4CEA A;  4B9V A;  4ID1 A;  3MAQ A;  1HQU A;  3K5N A;  4M3W A;  2YHB A;  2ETJ A;  2IS3 A;  5KRT A;  2G8H A;  1TAU A;  3LAM A;  4BE1 A;  1X1P A;  1HYZ A;  1X9W A;  1NK9 A;  4F3T A;  3BGR A;  1JLB A;  4BE2 A;  4FLU A;  4FZY A;  3M8Q A;  1SUQ A;  4FK0 A;  4DSI A;  3QNO A;  3BDP A;  4BE0 A;  4YNQ A;  4N5S A;  4DTS A;  2D0C A;  3WNE A;  3E01 A;  3SUP A;  3PY8 A;  4ELV A;  3S3N A;  1RDB A;  4H4O A;  1C0T A;  3ZSY A;  3TAR A;  4FM1 A;  1RDD A;  3MEC A;  3D0P A;  2OZS A;  4RW9 A;  4CED A;  4OGC A;  2PY5 A;  3LPU A;  2KZZ A;  1BCM A;  3MEG A;  3NF9 A;  3MXI A;  1BQN A;  3OYK A;  3OJU A;  2ZD1 A;  5EU7 A;  4AHR A;  2HW3 A;  1RT2 A;  3K5O A;  3TAQ A;  4DTJ A;  1S6Q A;  1S1V A;  3VQB A;  2OPP A;  5K14 A;  1W9H A;  3KK1 A;  3LDS A;  3SUN A;  1SKW A;  4KHQ A;  4FK4 A;  4QCL A;  3PX0 A;  4G1Q A;  3JYT A;  5I3U A;  4O0J A;  2I5J A;  1LV5 A;  4CFB A;  1J5O A;  4FM2 A;  1VRU A;  3AVF A;  5HRR A;  3OYG A;  4CEO A;  3DRR A;  4Z0U A;  4CEQ A;  4HUE A;  1WLJ A;  2RF2 A;  3CM5 A;  1YTU A;  4CJ4 A;  1BI4 B;  3QEI A;  4KPY A;  2BGG A;  4J2B A;  4DTN A;  4NYF A;  1K6Y A;  1SL0 A;  4E7I A;  2P5O A;  3DYA A;  3P83 D;  4F4K A;  1BIU A;  4IG0 A;  3K58 A;  3LP1 A;  5KGW A;  3VQ6 A;  3QEP A;  4GVM A;  1NJZ A;  3ZSZ A;  1WN7 A;  1WSG A;  4OPJ A;  3DOL A;  3HP6 A;  1SL1 A;  4FJ8 A;  1C0U A;  3QER A;  4BWM A;  3C6T A;  2BAN A;  1LW0 A;  1QQC A;  3ASM A;  1L3V A;  1A5X A;  3KKS A;  4E7L A;  3THV A;  1HYV A;  1S5J A;  4CHP A;  4KTQ A;  3NF7 A;  1KFD A;  3TI0 A;  3ZSW A;  3V9X A;  2VG5 A;  3AV9 A;  3U3Y A;  1YVU A;  4OJR A;  3O3G A;  1S6P A;  1ZYQ A;  4LD0 A;  3HYF A;  3DLB A;  4CJV A;  4CEZ A;  3DLR A;  4W5O A;  1VSL A;  1XC9 A;  1Z25 A;  3AVG A;  3NHG A;  4L8R B;  2IOC A;  3SUO A;  1DTQ A;  1Q9X A;  1KLN A;  1TKX A;  4RW7 A;  4I9Q A;  4NYN A;  3C95 A;  1D9F A;  3V9W A;  1RT3 A;  4CEE A;  1EP4 A;  3AA5 X;  3CFP A;  4FJN A;  3EZ5 A;  3VA3 A;  1X9M A;  3AO1 A;  3NF8 A;  1YT3 A;  4C8M A;  1HYS A;  2DTU A;  1QTM A;  4DLG A;  5SZT A;  5DMR A;  4CEF A;  3K5M A;  4DTM A;  4ZHR A;  4BAC A;  4KB1 A;  4CK2 A;  4LSN A;  1VK0 A;  4O5B A;  3NH1 A;  2VWJ A;  3KK3 A;  3OVN A;  5J2P A;  5J1E A;  4CJQ A;  2D0B A;  3PX4 A;  4JRQ A;  3HO1 A;  4FXD A;  3V9Z A;  3HL8 A;  4M3U A;  4E7H A;  4M41 A;  1FK9 A;  1RBS A;  4E1N A;  4CHN A;  3L2W A;  3HST B;  1WSJ A;  3TAN A;  4UQG A;  3SJJ A;  1T7P A;  4F3O A;  1QE1 A;  4HVJ A;  3V1Q A;  2IC3 A;  2X6N A;  4LSL A;  3M8S A;  4JS4 A;  1TK8 A;  2HHS A;  1S1W A;  3KD5 E;  4FJM A;  4KO0 A;  1REV A;  4HCC A;  4H4M A;  3AVC A;  1XHX A;  3MXJ A;  5FDL A;  1VSE A;  4CIF A;  4FW2 A;  4IDK A;  2F8S A;  4OPK A;  4CHQ A;  2HNY A;  2XO7 A;  3VQ9 A;  1HNI A;  2G8I A;  4FLX A;  3S3O A;  3CG7 A;  4FW1 A;  3NH0 A;  1BQM A;  1JLC A;  1RCH A;  3WNH A;  1QSL A;  2JLE A;  3LZJ A;  3RMC A;  2QKK A;  3P1G A;  4CF2 A;  3MED A;  2AJQ A;  4QOZ B;  3NBP A;  2RPI A;  3NE6 A;  2O4G A;  2R7Y A;  5HBM A;  3VQQ A;  3O4N A;  3ZCM A;  3DLG A;  3QEX A;  3HVR A;  4BDZ A;  1L5U A;  1Y97 A;  4BWJ A;  5FRO A;  4DQI A;  2HVI A;  3OYF A;  1NK4 A;  1BGX T;  4PY5 A;  4B3O A;  1VSI A;  3ZT2 A;  5J2M A;  4QAG A;  4FJI A;  1J54 A;  4NCG A;  5CYQ A;  1HMV A;  2EHG A;  3VN5 A;  1S9E A;  1QS4 A;  2WON A;  4CF9 A;  4E89 A;  3OJS A;  4DU1 A;  1T8E A;  3DLH A;  2IGI A;  4KB0 A;  4CJF A;  3VQ7 A;  4FJX A;  3QIN A;  5KRS A;  3ZSQ A;  4DFM A;  4Q5V A;  4Z4E A;  4DG1 A;  1RDC A;  4OVL A;  4RW6 A;  4B9T A;  1VRT A;  5HRS A;  2P5G A;  4LH4 A;  2ATQ A;  4DSE A;  3ZSX A;  1ZBF A;  2Z1G A;  1J9A A;  4FLT A;  2FBT A;  4C8N A;  4CJT A;  4DSJ A;  4K8Z A;  1EXQ A;  1KLM A;  3DOK A;  2E6L A;  4CIE A;  2KQ2 A;  1UOC A;  4BDP A;  4EP5 A;  4EZ9 A;  4DTR A;  1NKE A;  4FJG A;  4JS5 A;  2A1R A;  4FZZ A;  4ID5 A;  3LZI A;  4FJ9 A;  3VQ5 A;  4FYD A;  1EX4 A;  5FRM A;  4B9S A;  1KVC A;  3SV4 A;  2DFF A;  3CYM A;  5HRO A;  2YNG A;  5SWM A;  1EET A;  1N6Q A;  2ITG A;  1NK6 A;  1ZBH A;  3L2V A;  4FLY A;  2B6A A;  2PYL A;  2G8K A;  4IKF A;  4E19 A;  3RR7 A;  2QKB A;  1ZBU A;  1KVA A;  3KIO A;  4JRP A;  4DF4 A;  1SKR A;  2P1J A;  2JGU A;  3SV3 A;  1KCF A;  3AO5 A;  4KTZ A;  1RT1 A;  3OS1 A;  3HJF A;  2XRI A;  1U04 A;  4J2A A;  1TKZ A;  1ASV A;  1JLF A;  3DLE A;  4CFD A;  3KJV A;  1Z26 A;  2E4L A;  3LWM A;  3ITH A;  4KAZ A;  3PO5 A;  1VSF A;  3K5L A;  2OA8 A;  3RRG A;  4B9L A;  4EZ6 A;  2HHQ A;  1WSI A;  3SZ2 A;  4O55 A;  2HVH A;  4YFU A;  1I39 A;  3AVJ A;  3SQ1 A;  4C8L A;  3OYN A;  1GOC A;  3TAG A;  3SI6 A;  1WNS A;  4DMN A;  1C1B A;  4DFK A;  1IH7 A;  4C8O A;  4CGF A;  4KHN A;  2YKN A;  4Z4G A;  4O44 A;  4E7J A;  2FBX A;  1UA1 A;  4OLB A;  4OKE A;  3QO9 A;  2P51 A;  4BDY A;  3T3F A;  3SCX A;  1XI1 A;  3FFI A;  4M3Y A;  3ALY A;  1F21 A;  3OYE A;  1FXX A;  2DFE A;  2G8V A;  3RMD A;  3RRH A;  1RIL A;  2XY7 A;  3QIP A;  1FKP A;  2F8T A;  3MEE A;  1FKO A;  4Y1C A;  3KTQ A;  5HRP A;  3EY1 A;  3CFR A;  3QIO A;  2Z1J A;  3DM2 A;  1KRP A;  4DQS A;  4DTP A;  3P5J A;  4KRF A;  1JLE A;  1JLQ A;  1IKV A;  3VQD A;  2RKI A;  1XHZ A;  1HNV A;  3QEW A;  4MFB A;  5J2N A;  4CHY A;  4B9U A;  1S9G A;  4AH9 A;  5JS2 A;  1JXE A;  4DQR A;  4DLE A;  4OGE A;  4CJS A;  2OPR A;  3L2Q A;  4DTX A;  2XY6 A;  3ULD A;  4K8X A;  3ZSV A;  3ZSO A;  4DWI A;  4CGH A;  4RW8 A;  2OYQ A;  3VQ8 A;  3DMJ A;  3A2F A;  3I0S A;  3QNN A;  1X9S A;  4E7K A;  3HVT A;  3L2R A;  3HK2 A;  1C1A A;  1WSF A;  3V4I A;  4R5P A;  3M8P A;  2GV9 A;  2HB5 A;  4B08 A;  1JL1 A;  1D8Y A;  1GOA A;  3OYJ A;  3PV8 A;  1SL2 A;  4CJ5 A;  4RG8 A;  4DU4 A;  4NCB A;  1BIZ A;  1U45 A;  4N47 A;  1IG9 A;  4CF8 A;  1NJW A;  5KTQ A;  4KI6 A;  1RNH A;  3AVI A;  2X6S A;  2XY5 A;  1NOZ A;  1ASU A;  3AA4 A;  4DTO A;  1L3U A;  4NCA A;  2YKM A;  2YNI A;  3G10 A;  2A1S A;  3NGY A;  2XY8 A;  5CY4 A;  2KW4 A;  1RTJ A;  1RT6 A;  3AVN A;  4O0I A;  2OZM A;  3VQC A;  1TL1 A;  2YV0 X;  4CF1 A;  4DU3 A;  2KFN A;  1HRH A;  1XWL A;  1T05 A;  4FZX C;  4PUO A;  1GOB A;  2QK9 A;  3M8R A;  4FJ7 A;  1TKD A;  4CHZ A;  4JLH A;  3L3V A;  1JLG A;  1NKB A;  4KI4 A;  1EKE A;  3S9H A;  1I3A A;  4KFB A;  3KLE A;  1RBV A;  1L3S A;  4ICL A;  3HPO A;  1NJY A;  3V1O A;  3QES A;  4FK2 A;  3DRS A;  4ELT A;  4J2D A;  1VSJ A;  3KK2 A;  3QET A;  2G8F A;  1BHL A;  4FJK A;  3RR8 A;  1YTA A;  5C24 A;  4CJP A;  4HTU A;  2FC0 A;  3NFA A;  1U47 A;  3OY9 A;  4C8K A;  3AVK A;  2D0A A;  3VQ4 A;  3LAL A;  4MQ3 A;  3SNN A;  1C1C A;  3IRX A;  3KKR A;  4AHC A;  3NGI A;  3TAE A;  1RTD A;  3HXM A;  4CJ3 A;  1C6V A;  3HPH A;  1QSS A;  4KHS A;  3OYB A;  4DS4 A;  4KHW A;  1IKY A;  3AVL A;  3K2P A;  3LP0 A;  4DSF A;  1WAF A;  1TL3 A;  4CEB A;  1NK5 A;  4O4G A;  2PZS A;  3C6U A;  2KTQ A;  3RMA A;  2GBZ A;  3PX6 A;  1CXQ A;  1KSP A;  2D5R A;  3AA2 A;  4CIG A;  3L2U A;  3JSM A;  4KHU A;  1JL2 A;  5D3G A;  1VSM A;  1CZ9 A;  3G0Z A;  4GW6 A;  3K57 A;  2Q3S A;  5JS1 A;  3I8D A;  2QXF A;  2HMI A;  2LSN A;  4CJL A;  3NF6 A;  3AVM A;  1VSD A;  2HHV A;  2OPS A;  4CJR A;  3UIQ A;  3H08 A;  3O3H A;  1S1T A;  4CK1 A;  3OYH A;  2FBV A;  1RTH A;  1LAW A;  2VWK A;  4CK3 A;  3ZT3 A;  1NJX A;  1HPZ A;  1G15 A;  1QHT A;  3AVA A;  4AHT A;  1CZB A;  3RMB A;  4DSK A;  4OKK A;  4DF8 A;  1U48 A;  3HP9 A;  4CGD A;  4W5R A;  3OYL A;  3NGZ A;  3OYD A;  1A5V A;  5C25 A;  2HHU A;  1LWF A;  4Z4I A;  3NCI A;  3ZT4 A;  2B5J A;  2HND A;  1B9F A;  1J53 A;  4B8C A;  3OYA A;  1T03 A;  4DS5 A;  4AHS A;  5KI6 A;  4LH5 A;  1SV5 A;  3I0R A;  3RTV A;  3AO4 A;  2EX3 A;  4RW4 A;  4WE1 A;  4AIL C;  3KD1 E;  3V9U A;  4W5T A;  5CZ1 A;  1C0M A;  4DTU A;  4F2R A;  3LP3 A;  1TVR A;  2GUI A;  3KLF A;  4CGJ A;  5I42 A;  4FJL A;  2YNF A;  4CF0 A;  1TK5 A;  3V1R A;  3AA3 A;  3SQ4 A;  4M3Z A;  4XIU A;  4ZTJ A;  4CFA A;  2HHW A;  3LAN A;  3OYI A;  4F8R A;  3B6O A;  1S1X A;  1UAX A;  1N5Y A;  4E3S A;  4M3X A;  4DSL A;  2BE2 A;  1NK8 A;  3HPG A;  5HLF A;  3CQ8 A;  4CES A;  3TAF A;  3NAE A;  4FJH A;  2KZM A;  2DFH A;  3QLH A;  4IFV A;  4KTW A;  3T19 A;  4CE9 A;  3LWL A;  3F73 A;  3OYC A;  1BCO A;  2G8W A;  4CGG A;  4FCY A;  4FLZ A;  1O1W A;  1IO2 A;  3PUF A;  3WNG A;  1WAJ A;  2VG7 A;  2YHA A;  3CFO A;  3IS9 A;  4B8A B;  4DFP A;  1RTI A;  1KFS A;  1RBT A;  4CJE A;  3V9S A;  4B9M A;  3S3M A;  5C42 A;  4HHT A;  4FLW A;  4ELU A;  3LP2 A;  2Y1J A;  1QSY A;  4FJJ A;  4N41 A;  3AVH A;  4TSX A;  3KLI A;  2RN2 A; 
#chains in the Genus database with same CATH topology
 1D9D A;  1RBR A;  5FPD A;  3IG1 A;  2F96 A;  4MDA A;  3TR8 A;  3LL3 A;  4W5Q A;  3KLG A;  2AA4 A;  3D45 A;  5CYM A;  5AQG A;  4IO8 A;  2G8U A;  2FBY A;  4PA1 A;  4OX9 K;  3O08 A;  4I2Q A;  1VQK N;  4JK8 A;  3NH2 A;  4DQQ A;  1HNZ K;  3AO2 A;  4BQL A;  1DLO A;  3AO3 A;  1IKX A;  4IOA L;  4KBO A;  4WYB A;  4A5B A;  3OS0 A;  2A6A A;  5DM7 L;  4FWO A;  1N36 K;  1DTT A;  5DK5 A;  3U3G A;  2ZJQ L;  3J7A P;  4F2S A;  2P9N B;  4IZ9 A;  1KAY A;  2QI2 A;  4LY7 A;  4Z4C A;  3VA0 A;  1ZBL A;  1K73 O;  4EFH A;  2ZE2 A;  1XUP O;  3EYZ A;  2I7P A;  3VEO A;  3ZSR A;  1TK0 A;  4JAX A;  1L3T A;  1WSH A;  1BWF O;  2NLX A;  4FVU A;  2X78 A;  3SYZ A;  4FWN A;  1V4S A;  2E6M A;  3ENH A;  4IWV A;  2HHX A;  4N56 A;  3MWP A;  3VGL A;  4IBN A;  5AQM A;  1LWC A;  4JKD A;  4Z4H A;  5GAE P;  2OPQ A;  2IDO A;  2B4J A;  4KHY A;  3VQA A;  4CJW A;  2VG6 A;  3B8A X;  3FLC O;  1RT4 A;  2P9I A;  1KAX A;  2E1Z A;  3MAQ A;  1HQU A;  4HTL A;  3CJ7 A;  2ETJ A;  4BR4 A;  1EWR A;  3BGR A;  1JLB A;  4FOI A;  3CJA A;  3M8Q A;  4DSI A;  2ZGZ A;  4YOT A;  4G9Z A;  3TAR A;  4KH6 A;  2PY5 A;  4NLB A;  3MEG A;  1BQN A;  3OYK A;  1RT2 A;  4DV6 K;  4DTJ A;  1W9H A;  3KK1 A;  1NGJ A;  4FK4 A;  4DCH A;  4QCL A;  4G1Q A;  2I5J A;  4CFB A;  1SAZ A;  5HRR A;  4FPB A;  4CZL A;  3OYG A;  4CEQ A;  4X66 K;  1BOT O;  3W3D A;  3ZEU A;  1KXP A;  2QWP A;  2BGG A;  4NYF A;  1K6Y A;  2P5O A;  4EHU A;  3TSQ A;  1WN7 A;  4H5T A;  3HP6 A;  3A5M C;  2BAN A;  1L3V A;  1A5X A;  3KKS A;  1KFD A;  1Z6R A;  5LY3 A;  4ISE A;  3AV9 A;  4JKA A;  3O3G A;  1ZYQ A;  3AAP A;  4LD0 A;  3HYF A;  4CEZ A;  3DLR A;  4W5O A;  3TSU A;  1GLJ O;  1NU0 A;  3G4S N;  1KLN A;  1Q9X A;  1N33 K;  3C95 A;  2D4W A;  5H1S Q;  3EZ5 A;  4B3T K;  2O8B A;  4YOY A;  1YT3 A;  5AQU A;  3W0L A;  5B8H A;  3DXK A;  3VGM A;  5DMR A;  4CEF A;  5AZJ B;  4LSN A;  2VWJ A;  3OVN A;  5J1E A;  2HMP A;  3OTO K;  3HO1 A;  3HL8 A;  4CHN A;  4F3O A;  4UQG A;  1XMO K;  2IC3 A;  3M8S A;  4JS4 A;  1S1W A;  3CCS N;  4KO0 A;  1REV A;  1XHX A;  3PSF A;  5FDL A;  4CIF A;  4YOU A;  5KPZ A;  1C0F A;  4OPK A;  3VQ9 A;  4OPA A;  2G8I A;  1QSL A;  2GWK A;  4FW1 A;  2YI1 A;  3GBT A;  3S3O A;  1JLC A;  3F9M A;  2JLE A;  5LL6 Z;  3P1G A;  4BY9 C;  3MED A;  1I94 K;  2AJQ A;  4AF1 A;  3NE6 A;  2O4G A;  3O4N A;  3WEE B;  4K43 A;  1L5U A;  1VQ9 N;  4DQI A;  1NK4 A;  3T1Y K;  1QZ5 A;  3SBG A;  4PY5 A;  4B3O A;  1H1V A;  4WFB L;  4U7B A;  4QAG A;  1IBK K;  3THV A;  2EHG A;  2I7N A;  1S9E A;  2WON A;  3EO3 A;  4B1U B;  4CF9 A;  4DU1 A;  1T8E A;  2IGI A;  3R8E A;  3QIN A;  2EWS A;  3IMX A;  4DFM A;  2WUS A;  4Z4E A;  5AQO A;  5HRS A;  2ATQ A;  1JCF A;  2GEL A;  4CIE A;  4H0Y B;  2O8E B;  5BR9 A;  4GKK K;  4FJ9 A;  4WQ4 C;  1EX4 A;  4CZM A;  2Q2R A;  4RCH A;  3JAM O;  3SV4 A;  1EET A;  3VF2 A;  1N6Q A;  2ITG A;  3CQY A;  1YAG A;  2B6A A;  5BN9 A;  2PYL A;  2QEX N;  2QKB A;  1KVA A;  4JRP A;  4DF4 A;  2P1J A;  3AO5 A;  3SK3 A;  3OS1 A;  1U04 A;  4J2A A;  1ASV A;  4BGA A;  1Z26 A;  2E4L A;  3LWM A;  3ITH A;  2CGJ A;  1X3M A;  2OA8 A;  2HHQ A;  1EO1 A;  3AVJ A;  3CJ1 A;  3TAG A;  3SI6 A;  1WNS A;  4DMN A;  1C1B A;  5LMU K;  3THX A;  4KHN A;  4O44 A;  5BRH A;  4EHT A;  4OKE A;  2P51 A;  4JHD A;  4LC9 B;  3O6W A;  1QQM A;  4YOX A;  1FXX A;  2NRV A;  1JJ2 M;  3KZB A;  3QIP A;  1FKP A;  2UXD K;  3KTQ A;  3QIO A;  2Z1J A;  4JNE A;  4DKW A;  4DQS A;  1JLQ A;  5M1F A;  5M1N A;  4JKC A;  3VQD A;  1HNV A;  3THY B;  2PAV A;  4MFB A;  2VQE K;  3L6Q A;  4AH9 A;  4DQR A;  4YOR A;  4K8X A;  4B1Y B;  1HR0 K;  2OYQ A;  3VQ8 A;  4MLE A;  1IV0 A;  3A2F A;  3QNN A;  1X9S A;  2ZJP L;  4E7K A;  5ELZ A;  3V4I A;  4R5P A;  2GV9 A;  2O8E A;  4FPA A;  1EWQ A;  2IVN A;  1U45 A;  2NNW A;  2VGM A;  4KI6 A;  4BG9 A;  4LF4 K;  4RTF D;  2YNI A;  2A1S A;  1JCE A;  3TTD A;  1TAU A;  3R3L A;  2KW4 A;  2OZM A;  3O8M A;  4IDH A;  4CD1 A;  2D1K A;  4DU3 A;  2UUB K;  3I33 A;  4PUO A;  2QK9 A;  2HF3 A;  1TKD A;  1OH5 A;  3SBT A;  1JLG A;  5HOO A;  1VQ7 N;  4J8F A;  1NKB A;  1EKE A;  2GUP A;  3S9H A;  2D0O A;  3N4P A;  2V7Y A;  1I3A A;  2QTD A;  4ICL A;  4B1X B;  3QES A;  4ELT A;  2P9P A;  1X3N A;  3KK2 A;  4B1V A;  4FJK A;  2FC0 A;  1U47 A;  3IFR A;  3BUZ B;  3KKR A;  3DJC A;  4ISG A;  2PFU A;  1C6V A;  3M3Z A;  4KHW A;  1OVQ A;  1QVF M;  3AVL A;  4DSF A;  1NK5 A;  4O4G A;  2PZS A;  2GBZ A;  3MCA B;  3AGK A;  3FE1 A;  2D5R A;  3AA2 A;  5EX5 A;  1XC3 A;  3WXM B;  3HRG A;  4GW6 A;  1NGC A;  3H1Q A;  4DR6 K;  3MDQ A;  3NF6 A;  1VSD A;  5TKY A;  2HBJ A;  3C7N A;  4DV3 K;  3O3H A;  3BZK A;  1RTH A;  2VWK A;  3CQX A;  1Q18 A;  1G15 A;  4AHT A;  3AVA A;  1J6Z A;  4OKK A;  4CGD A;  3OYL A;  1NGD A;  4BRF A;  3OYD A;  2HHU A;  4HWI A;  2B5J A;  1B9F A;  1QHA A;  4A5A A;  4WQ4 A;  1HKC A;  1NMD A;  4M7Y A;  4W5T A;  1FJG K;  4FJL A;  2YNF A;  4I6M B;  4QS9 A;  2HHW A;  4CFA A;  4GKJ K;  3LAN A;  4FOE A;  3OYI A;  2NRH A;  3ATU A;  4FWL A;  4E3S A;  3EL2 A;  4CES A;  4JI7 K;  1YJ9 N;  4KTW A;  3LWL A;  4CE9 A;  3ZEU B;  3O4W A;  3F73 A;  3A5N C;  4CGG A;  3O9S A;  4FLZ A;  3CFO A;  3PSI A;  4CJE A;  3V9S A;  4AQY K;  4IFE A;  5AFU A;  1VQ5 N;  3LP2 A;  1ZXO A;  4JI3 K;  3AVH A;  3EE9 A;  3WNF A;  3HM9 A;  1WSE A;  3F9K A;  3O5B A;  4YOW A;  3MN7 A;  1ILY A;  1HJR A;  4WFA L;  1TAQ A;  4Z4F A;  4OKJ A;  3SUQ A;  4FO0 A;  4BC4 A;  2W42 A;  3TTC A;  4FWK A;  4JKB A;  4EP4 A;  3V81 A;  3VEV A;  3WQT A;  2Z1H A;  4I9L A;  4PQU A;  3ZYY X;  3EEQ A;  2CH6 A;  3NDK A;  1UA0 A;  2PYJ A;  3TU5 A;  2IIR A;  4CJU A;  4CJK A;  1RBU A;  1R0A A;  4YHH K;  4CCH A;  1UWB A;  3V6D A;  4AM7 A;  1B9D A;  5M1O A;  1Q9Y A;  1SZ2 A;  4A62 A;  4ZTF A;  3WXK A;  3CC2 N;  4CHO A;  5CZ2 A;  5CE3 A;  3U6F A;  3TWH A;  1BIS A;  1KTQ A;  3QEV A;  2E20 A;  3VTH A;  4M42 A;  3D6R A;  4CZF A;  3SPZ A;  2Y1I A;  1ATR A;  3MN9 A;  1CLQ A;  3O9T A;  4FM0 A;  1VHX A;  3PLA A;  2O8F A;  4W5N A;  1OH6 A;  5JVG L;  4CGI A;  3NVM A;  1Z05 A;  5E41 A;  3DWL A;  4LF7 K;  3J7Z O;  1FW6 A;  4BRP A;  4BR2 A;  2W40 A;  4IO9 L;  4AHU A;  1A5W A;  1D5A A;  3L8B A;  2J4R A;  2IAJ A;  3TAM A;  3HOT A;  2X74 A;  3VF4 A;  2ZQB A;  4U67 L;  4I2P A;  4H5W A;  1B92 A;  4HUG A;  1NGH A;  1TGO A;  3PO4 A;  4J2E A;  3ZT0 A;  4CEA A;  1IBL K;  4B9V A;  4ID1 A;  2YHB A;  3VEX A;  4DUZ K;  2IS3 A;  2G8H A;  4BE1 A;  1HYZ A;  1X9W A;  4BE2 A;  1SUQ A;  4BE0 A;  4DTS A;  2D0C A;  2Q97 A;  3WNE A;  1RDB A;  2HHH K;  3MEC A;  3D0P A;  3GDQ A;  2OZS A;  2RE2 A;  2BTF A;  3LM2 A;  4JI1 K;  3LPU A;  1BCM A;  2HST A;  3MXI A;  3VGK A;  3THY A;  2HW3 A;  3CCQ N;  3K5O A;  1S6Q A;  3QB0 A;  1HKG A;  5I3U A;  5LJV A;  3E9L A;  4DV7 K;  4H5N A;  3KVG A;  2P9S A;  3WUH A;  3KHY A;  4HUE A;  3CM5 A;  3R9P A;  1BI4 B;  5FPN A;  4J2B A;  4DTN A;  3O1W A;  5AQZ A;  5AQL A;  5F1X A;  3LP1 A;  3VQ6 A;  3QEP A;  2YJF A;  3ZSZ A;  3KK7 A;  1LW0 A;  3ASM A;  3ZX2 A;  4FJ7 A;  1N8R O;  4KTQ A;  3FZK A;  4PKH A;  1YVU A;  1S6P A;  3DLB A;  4CJV A;  1VSL A;  3EKU A;  3AVG A;  5EOY A;  5I9E B;  1IBM K;  4H0P A;  3SUO A;  3T69 A;  3MCP A;  4NO7 A;  4CD3 A;  1EP4 A;  3AA5 X;  4A61 A;  3VA3 A;  2UUA K;  1X9M A;  3NF8 A;  4C8M A;  2DTU A;  2BH1 A;  1DGK N;  4DTM A;  4ZHR A;  4BAC A;  3CC4 N;  3EE8 A;  3KK3 A;  4PHT X;  4UY8 O;  2QWN A;  1T3V A;  4BRA A;  3THW A;  4M41 A;  1RBS A;  4E1N A;  2Q36 A;  1Q7Y O;  3SMS A;  4HVJ A;  3V1Q A;  1Y64 A;  1VQP N;  3KD5 E;  4H4M A;  3AVC A;  1VSE A;  3CMA N;  5KQD A;  2HNY A;  3AGR A;  2XO7 A;  4BVP A;  3ULE A;  3HSC A;  3TTF A;  4N76 A;  2FLO A;  4JKG A;  3SMP A;  1ZC6 A;  3LZJ A;  2W6L A;  4QOZ B;  2RPI A;  3VQQ A;  3M5R A;  3QEX A;  3HVR A;  4GV9 A;  5FRO A;  4JI4 K;  3OYF A;  1BGX T;  1VSI A;  2F4V K;  2VGN A;  4BRI A;  4NCG A;  5CYQ A;  1HMV A;  1QS4 A;  1S3X A;  4H0O A;  3ZET A;  4CJF A;  3ZSQ A;  4Q5V A;  4GY2 B;  3BF1 A;  1Q86 O;  2P5G A;  3H6E A;  1ZBF A;  2Z1G A;  1J9A A;  4DV2 K;  4DR5 K;  4DSJ A;  4K8Z A;  1OH8 A;  3AAQ A;  1UOC A;  1QQO A;  5BRF A;  4EZ9 A;  1NKE A;  1TUU A;  4JS5 A;  4Z94 A;  3CJ9 A;  2P9S B;  3VQ5 A;  3SAH A;  1ZBS A;  3U9D A;  1KVC A;  3CPE A;  3CYM A;  3J8A A;  5HL7 L;  1NK6 A;  1U2V A;  4BRK A;  1O13 A;  1WBB A;  2O8C A;  3EN9 A;  3T7Z A;  3EKS A;  3MN6 A;  2JGU A;  3WXI A;  3SV3 A;  4EAH D;  1RT1 A;  4JHD B;  3HJF A;  2XRI A;  4CFD A;  1XNR K;  5AJ3 K;  3THX B;  1VSF A;  3K5L A;  4AM6 A;  1Q81 O;  4GVE A;  1BDG A;  4YY3 K;  3SQ1 A;  4DR2 K;  4YDU C;  1IH7 A;  1YUW A;  4C8O A;  4IEI A;  4CGF A;  1WBD A;  4JYA K;  2F7T A;  1UA1 A;  2FBX A;  1GLC G;  3T3F A;  3SCX A;  1XI1 A;  3CME N;  4M3Y A;  3CCM N;  1F21 A;  4GNI A;  4FWR A;  3RMD A;  1RIL A;  2XY7 A;  2F8T A;  3MEE A;  1FKO A;  4Y1C A;  5AQJ A;  5HRP A;  1YIJ N;  4JI6 K;  5FPM A;  1IKV A;  2RKI A;  4KH5 A;  4B9Q A;  1CZA N;  3WT0 A;  5J2N A;  3FGU A;  4CHY A;  1S9G A;  4CJS A;  3ULD A;  4FL9 A;  1NNE A;  1GLD G;  1W97 L;  3P38 A;  4NLC A;  4BQZ A;  2QWR A;  3L2R A;  3M8P A;  2HB5 A;  1D8Y A;  1GOA A;  3PV8 A;  4CJ5 A;  5KQ8 A;  1BIZ A;  4IJN A;  1IG9 A;  4LF8 K;  1YJW N;  1BO5 O;  5KTQ A;  1HUX A;  3AVI A;  2X6S A;  5C0Y A;  2XY8 A;  1RTJ A;  2YV0 X;  2KFN A;  4FZX C;  3P31 A;  4CHZ A;  4JLH A;  3AAR A;  3CHW A;  1IG8 A;  3VTI A;  4KI4 A;  2PBD A;  3D2E A;  5AQP A;  3O9R A;  4KFB A;  2HBM A;  1L3S A;  4JI0 K;  3HPO A;  1NJY A;  2RHK A;  5KPR A;  3DRS A;  4J2D A;  2G8F A;  5C24 A;  1VQ4 N;  3ZX0 A;  1RDU A;  4MQ3 A;  3SNN A;  1C1C A;  4FWS A;  1RTD A;  4BG8 A;  1IJJ A;  3HPH A;  5GIN A;  3OYB A;  1IKY A;  1KD1 O;  2FXU A;  1N32 K;  2Q1N A;  3DXM B;  4ILG B;  4BGB A;  1NGI A;  3PX6 A;  2E88 A;  5EVZ A;  2HBL A;  3JSM A;  5LMN K;  2QWO A;  3G6E N;  3I8D A;  2QXF A;  2HHV A;  4CK1 A;  1QZ6 A;  3LDN A;  2FBV A;  1HPZ A;  1QHT A;  3R6M A;  1CZB A;  4PKI A;  3RMB A;  3FFK B;  3HP9 A;  4W5R A;  3NGZ A;  4DB3 A;  2HND A;  1J53 A;  4B8C A;  3OYA A;  4AHS A;  4CZI A;  4LH5 A;  1RGI A;  4WE1 A;  5E84 A;  3V9U A;  2QA4 N;  5CZ1 A;  1C0M A;  4F2R A;  3RVC A;  3LP3 A;  1TVR A;  3C0B A;  5I42 A;  4CF0 A;  1TK5 A;  2W6K A;  3AA3 A;  5AFU H;  4CBW A;  4M3Z A;  4O8K A;  3B6O A;  4WQ5 C;  1NGB A;  5HLF A;  1GLA G;  3CQ8 A;  1KC8 O;  4JK7 A;  3TAF A;  3NAE A;  4FJH A;  3J7Y P;  2DFH A;  3C7N B;  3QLH A;  3OA9 A;  1T6D A;  4MLH A;  4B1W B;  4FCY A;  2YHX A;  3E9O A;  2D0P A;  3IS9 A;  4CI6 A;  1RBT A;  4B9M A;  3S3M A;  3CC7 N;  4O5F A;  4FJJ A;  5JLH A;  3KLI A;  1RT7 A;  1NK7 A;  2QXL A;  4FLV A;  1KVB A;  1ASW A;  2CH5 A;  4M3R A;  4CEC A;  1LW2 A;  2YHY A;  1CXU A;  1JLA A;  1SKS A;  3IAY A;  3CM6 A;  4BRM A;  4OLA A;  1VQL N;  3HM8 A;  2ITM A;  4XH4 A;  1M90 O;  2CGL A;  4ISF A;  3DAW A;  5F2R A;  1VQ8 N;  4HUF A;  2ASP A;  2V52 B;  3DRP A;  1R59 O;  1JXB A;  5T7B A;  1W0H A;  4B9N A;  4E1M A;  5HP1 A;  3OS2 A;  2BUP A;  3B6P A;  3VQP A;  2V7Z A;  2A5X A;  2Q31 A;  3QBW A;  3OYM A;  1NKC A;  3VQE A;  1S1U A;  4IEE A;  3DLK A;  4E0D A;  4C1N I;  3QML A;  5KGX A;  3HT3 A;  1ITG A;  1RT5 A;  2E1Y A;  1TV6 A;  4Y1D A;  1BI4 A;  4H0X B;  2DY4 A;  1RDA A;  1MU2 A;  1S72 N;  2JWL A;  4K41 A;  5C10 A;  3O1B A;  1WOQ A;  5CHI A;  4O8U A;  1IKW A;  3C94 A;  3GG4 A;  5LJW A;  3VPZ A;  3ZT1 A;  4KRE A;  1LWE A;  3QFP A;  2A42 A;  2Z1I A;  1NOY A;  3KLH A;  4CER A;  3LAK A;  3U9Z A;  5HRN A;  2HHT A;  1U49 A;  4I7F A;  4DQP A;  1QVG M;  4AHV A;  4M3W A;  4CZJ A;  3DXM A;  3K5N A;  1BA1 A;  3C6H A;  5KRT A;  1YVN A;  3LAM A;  1X1P A;  4R79 A;  2YJE A;  4FLU A;  2FF6 A;  3QNO A;  1EQY A;  3PY8 A;  1HNX K;  3E01 A;  4DV4 K;  4H4O A;  3RSE A;  3ZSY A;  5KPT A;  3GE1 A;  1DKG D;  4RW9 A;  5E26 A;  4CED A;  2YCH A;  3Q7C A;  3CCL N;  4Y0W A;  3NF9 A;  4AHR A;  5EU7 A;  5AQR A;  3TAQ A;  2FF3 B;  2P9K A;  1S1V A;  5K14 A;  5JMV A;  3SUN A;  1SKW A;  1OH7 A;  4LFA K;  3QFU A;  4M7X A;  3NVK A;  3JYT A;  3TPQ A;  1LV5 A;  1J5O A;  5ADX H;  4DR3 K;  2HOE A;  3AVF A;  4FM2 A;  3OBY A;  3DRR A;  4Z0U A;  1WLJ A;  1NGA A;  1SQK A;  2H3G X;  1YTU A;  1BA0 A;  4CJ4 A;  3QEI A;  4KPY A;  2UXB K;  1SL0 A;  1GLF O;  3DYA A;  3P83 D;  5KGW A;  4GVM A;  3NMU A;  3DOL A;  3JXU A;  4CJ7 A;  5C12 A;  4BWM A;  3C6T A;  3VF6 A;  1HYV A;  1S5J A;  4CHP A;  3NF7 A;  4KHP K;  3V9X A;  2VG5 A;  5ADX A;  3U3Y A;  3ZLJ A;  4XH5 A;  3D2E B;  4OJR A;  3O80 A;  3U8X A;  1XC9 A;  1Z25 A;  3NHG A;  4H5R A;  2UUC K;  4CZE A;  4L8R B;  2OCE A;  2P9P B;  1DTQ A;  4RW7 A;  4I9Q A;  2P9L A;  4FJN A;  3CFP A;  3H45 C;  3ID6 A;  1RDW X;  3AO1 A;  1TYQ A;  1HYS A;  4DLG A;  3ENB A;  5SZT A;  2A40 A;  4X62 K;  2F9T A;  3HOS A;  4O5B A;  3NH1 A;  5AQK A;  5J2P A;  5C2D A;  4CJQ A;  2D0B A;  1RFQ A;  1M1K O;  4LF9 K;  4JKH A;  1T7P A;  1OKJ A;  3HST B;  1WSJ A;  3L2W A;  3TAN A;  3SJJ A;  1TK8 A;  3CCJ N;  4FJM A;  1NMN A;  4HCC A;  3MXJ A;  1BUP A;  3U4L A;  2UYT A;  4FW2 A;  5AZJ A;  4CHQ A;  4BRG A;  4FLX A;  3NH0 A;  4BR0 A;  4DR4 K;  1BQM A;  4BC2 A;  4NXM K;  4FWP A;  2QKK A;  4CF2 A;  3UKU B;  1K8K B;  5HBM A;  2FSN A;  3DLG A;  2CGK A;  2HVI A;  1XQS C;  5J2M A;  3OW2 M;  1J54 A;  3LDP A;  3VN5 A;  4E89 A;  4KB0 A;  3PIO L;  3VQ7 A;  4XH1 A;  2QM1 A;  4EIA A;  3J80 O;  4DUY K;  3CF5 L;  3BP8 A;  4DG1 A;  4OVL A;  4RW6 A;  4B9T A;  1VRT A;  3L4I A;  4LH4 A;  3I55 N;  4DSE A;  2FBT A;  4C8N A;  4H5V A;  1KLM A;  2E6L A;  5C2F A;  3FR0 A;  3H1V X;  3ZET B;  4BDP A;  1E3M A;  4BRH A;  4EP5 A;  3T1H K;  1VQO N;  2A1R A;  4FWM A;  3UKR A;  4ID5 A;  3LZI A;  4FYD A;  4B9S A;  4JI5 K;  3MK6 A;  1ZBH A;  5TKW A;  4DQ8 A;  3L2V A;  1U6Z A;  2QWQ A;  2AP1 A;  4IKF A;  4E19 A;  3CCR N;  3RR7 A;  1ZBU A;  3KIO A;  1KQS M;  4C23 A;  3ULE B;  4LFC K;  1YIT N;  5JIC A;  2GX9 A;  3DLE A;  1W2B M;  3FZL A;  4FWQ A;  1WSI A;  3SZ2 A;  3PIP L;  4O55 A;  2HVH A;  4YFU A;  1I39 A;  1K9M O;  4C8L A;  1GOC A;  2ASO A;  3TSP A;  4DFK A;  3D2F A;  2YKN A;  3QDK A;  4Z4G A;  4E7J A;  3QO9 A;  4BDY A;  3FFI A;  5AQF A;  3ALY A;  3OYE A;  4F9O A;  2ZJR L;  4QS7 A;  3ATV A;  3SLC A;  3DLL L;  1VAZ A;  5CR4 A;  3EY1 A;  3CFR A;  3DM2 A;  1KRP A;  4DTP A;  3P5J A;  2KHO A;  4KRF A;  1JLE A;  1XHZ A;  2P9U A;  3GL1 A;  3QEW A;  3WEE A;  3WQU A;  1XMQ K;  4BR5 A;  4OGE A;  4DTX A;  2OPR A;  3L2Q A;  4GV6 A;  2QWM A;  3ZSV A;  4DWI A;  3THW B;  2GWJ A;  4RW8 A;  3A0I X;  4PKG A;  3HVT A;  2FSJ A;  3QBX A;  1C1A A;  1WSF A;  3VOV A;  1JL1 A;  3OYJ A;  3HTV A;  2A41 A;  4JKE A;  4RG8 A;  4DU4 A;  4NCB A;  5BPM A;  1NJW A;  1RNH A;  4NCA A;  5JS1 A;  1ASU A;  2OTJ N;  1KAZ A;  3NGY A;  3G10 A;  5CY4 A;  1RT6 A;  3AVN A;  4CF1 A;  1HRH A;  1XWL A;  2QW9 A;  5BRD A;  4IOX A;  4YOV A;  3VET A;  2ZWH A;  5GAD P;  2IVO A;  3D7E O;  3CIP A;  4FK2 A;  5AZI A;  1NM1 A;  5M1P A;  1VSJ A;  3QET A;  1BHL A;  3A5L C;  3RR8 A;  4HTU A;  3OY9 A;  2D0A A;  5IWA K;  2NRR A;  4AHC A;  2VWB A;  3NGI A;  3HXM A;  4KHS A;  4DS4 A;  4QS8 A;  3ENO A;  3I8B A;  1NGG A;  4A2A A;  1WAF A;  4JN4 A;  5GAH P;  1KSP A;  3LDO A;  3L2U A;  1VSM A;  3K57 A;  2E2Q A;  2HMI A;  2O8D A;  4CJR A;  3I56 N;  4WFN L;  3H3N O;  1LAW A;  4BRL A;  2OTL N;  1YJN N;  2P9L B;  1A5V A;  3VEY A;  5C25 A;  4Z4I A;  3NCI A;  3S41 A;  3ZT4 A;  1T03 A;  5AQV A;  2JWK A;  5KI6 A;  1SV5 A;  3I0R A;  3RTV A;  3AO4 A;  2EX3 A;  4AIL C;  1MWM A;  5AQY A;  3K9J A;  5JVH L;  2GUI A;  3IDH A;  4CVN E;  4CGJ A;  1LOT B;  2P9U B;  4ZTJ A;  4F8R A;  4WCE L;  4H0T B;  1S1X A;  2BE2 A;  3HPG A;  1SS6 A;  1YI2 N;  4JI2 K;  1MDU B;  2NRT A;  2WC9 A;  4MDB A;  3FZH A;  4IFV A;  3T19 A;  1S22 A;  3CD6 N;  2G8W A;  4B3S K;  3CI5 A;  1WAJ A;  4B8A B;  1W7A A;  3G71 N;  3MX2 A;  1ESV A;  3ID8 A;  5C42 A;  4FLW A;  2ZM6 K;  5BR8 K;  1QSY A;  4TSX A;  4A2B A;  4L3Q A;  3SJH A;  1GLE G;  5F0X A;  3SQ2 A;  4FJ5 A;  4M45 A;  1QQN A;  1NK0 A;  5AQS A;  3O4Q A;  1ATS A;  3JS6 A;  3RSE B;  1LAV A;  1VSH A;  2XHB A;  2BDP A;  3UE5 A;  1VSK A;  2IVP A;  3K0S A;  1JKH A;  1DT9 A;  1Q8I A;  4GMJ B;  4KV8 A;  5AQI A;  4PWD A;  2O8D B;  4FSV A;  3LDL A;  4IG3 A;  4M3T A;  2NZT A;  4H8K A;  4HCB A;  3MN5 A;  4OPH A;  3DXK B;  3N4Q A;  3CJC A;  1TKT A;  2O8C B;  3T1A A;  2YHW A;  1HQE A;  2GTD A;  3SPY A;  4CFC A;  4JV5 K;  4IFY A;  2P9K B;  4JD2 B;  3L0Q A;  3AVB A;  2HNZ A;  2KFZ A;  3DI6 A;  3SQ0 A;  3ISN C;  4I6M A;  4BVO A;  3MXM A;  2NUB A;  2YNH A;  2ASM A;  2HF4 A;  4MO5 A;  3L4Q A;  5AQH A;  1N34 K;  3M1F A;  5C15 A;  3O3F A;  3MX5 A;  3HI0 A;  5J2Q A;  4BC3 A;  4KH4 A;  2WBN A;  2W41 A;  2DPN A;  5EY4 A;  2WOM A;  4Q0B A;  3LPT A;  5FRN A;  3L3U A;  2KKZ A;  4DV0 K;  3TAB A;  3BEX A;  4C1N K;  3K9K A;  3K59 A;  1VQN N;  1HKB A;  4OO1 J;  3TAP A;  4FVM A;  3CJB A;  4DFJ A;  1U4B A;  3RWU A;  3SAG A;  1ZBI A;  3KWI A;  4KKO A;  1BL3 A;  2WFB A;  3WXL A;  1G99 A;  1E4G T;  4CZK A;  1NK9 A;  4F3T A;  4NXN K;  4FZY A;  4FK0 A;  3BDP A;  4YNQ A;  4N5S A;  3SUP A;  4ELV A;  3S3N A;  1C0T A;  4FM1 A;  1RDD A;  4DV1 K;  4XEI A;  3H3O B;  1BG3 A;  2V51 B;  4OGC A;  1TUY A;  3A5O C;  3GOI A;  2KZZ A;  3QIC A;  3OJU A;  2ZD1 A;  3VQB A;  2OPP A;  4BRQ A;  3LDS A;  4KHQ A;  4JKG B;  3PX0 A;  4O0J A;  5AR0 A;  4A57 A;  1T6C A;  1VRU A;  4CBU A;  3VEZ A;  4BRE A;  4CEO A;  4LFB K;  2RF2 A;  3C65 A;  4BRO A;  5BPL A;  3BF3 A;  1HPM A;  3R1X A;  4E7I A;  4IOC L;  2E8A A;  4F4K A;  1BIU A;  2E2P A;  4IG0 A;  3K58 A;  1NJZ A;  1SL1 A;  4OPJ A;  1WSG A;  4FJ8 A;  1C0U A;  2NRX A;  3QER A;  2E2N A;  1QQC A;  3M6G A;  2O4I A;  4E7L A;  3TI0 A;  3ZSW A;  4CZG A;  5DM6 L;  4RWT A;  3H46 O;  4V19 S;  3O9Q A;  2VCP A;  1V4T A;  3VES A;  4X64 K;  2A3Z A;  5BRE A;  3G25 A;  2IOC A;  1TKX A;  3ZX3 A;  4NYN A;  1P8Z A;  1D9F A;  1RT3 A;  4CEE A;  3UKR B;  4X65 K;  2VYP A;  5GIP A;  3CCE N;  5M1K A;  5AQW A;  4CBX A;  4GV3 A;  4ILH A;  1QTM A;  2O8B B;  3K5M A;  1E4F T;  4KB1 A;  4CK2 A;  1VK0 A;  3UB5 A;  3PX4 A;  4JRQ A;  4FXD A;  3V9Z A;  4M3U A;  4E7H A;  1FK9 A;  1MA9 B;  1ATN A;  3CER A;  4BRC A;  3MMV A;  4JEP A;  1QE1 A;  2X6N A;  4LSL A;  2HHS A;  3F5T A;  1OVY A;  5AZI B;  3OHR A;  4IDK A;  2F8S A;  3VER A;  4JD2 A;  1GLB G;  1NGF A;  1HNI A;  3UKU A;  3CG7 A;  2HBK A;  3WNH A;  1RCH A;  5IT9 O;  3CCU N;  3RMC A;  3NBP A;  4CZH A;  2R7Y A;  3ZCM A;  3E9P A;  1DEJ A;  1LCU A;  4BR7 A;  4BDZ A;  1Y97 A;  4BWJ A;  1HLU A;  4DR1 K;  4PL8 A;  3ZT2 A;  1C0G A;  4FJI A;  3HBT A;  3OJS A;  3DLH A;  1NWK A;  3O9U A;  5FLX O;  4FJX A;  4B1Z A;  5KRS A;  3BY5 A;  1RDC A;  4WQ5 A;  4A59 A;  1YXQ A;  3ZSX A;  4CW7 B;  4FLT A;  4CJT A;  1EXQ A;  2QWL A;  3J81 O;  3DOK A;  2FSK A;  2KQ2 A;  2ZF5 O;  4H0V B;  4DTR A;  1HNW K;  4K0K K;  1TYQ B;  4FJG A;  4FZZ A;  5FRM A;  3FZF A;  4LF5 K;  1D4X A;  2DFF A;  3E1Y A;  3EZW A;  2YNG A;  5SWM A;  5HRO A;  3WXJ A;  5EXW A;  4FLY A;  2G8K A;  1T44 A;  1SKR A;  5AQX A;  1KCF A;  3LM9 A;  4KTZ A;  4H03 B;  3P4I A;  5BPN A;  1TKZ A;  1JLF A;  2O8F B;  3KJV A;  4KAZ A;  4LF6 K;  1XNQ K;  3PO5 A;  3RRG A;  4B9L A;  4EZ6 A;  3F2K A;  5AQN A;  4K42 A;  5AQQ A;  3OYN A;  4BC5 A;  3HZ6 A;  3IKM A;  4OLB A;  3KWG A;  2VQF K;  2DFE A;  2G8V A;  1K8A O;  4IXC A;  3RRH A;  1X9J A;  1NG9 A;  1JCG A;  2P9N A;  5MLC Q;  3VMF B;  5M1Q A;  4JK9 A;  2E2O A;  2F9W A;  4B9U A;  4E1J A;  4NB4 A;  1JXE A;  5JS2 A;  4DLE A;  2XY6 A;  3ZSO A;  4DHY A;  3Q7B A;  4CGH A;  3VEW A;  3DMJ A;  3CXC M;  3I0S A;  5BN8 A;  4DR7 K;  3C6A A;  3HK2 A;  4B08 A;  1SL2 A;  4N47 A;  4CF8 A;  3AY9 A;  2XY5 A;  1NOZ A;  3AA4 A;  4DTO A;  1L3U A;  2YKM A;  1P90 A;  4O0I A;  3VQC A;  1TL1 A;  1NJI O;  2OAN A;  4IJA A;  1VQM N;  1T05 A;  3CCV N;  1K8K A;  1GOB A;  3M8R A;  4BR9 A;  1U2V B;  3L3V A;  1HX1 A;  2KLA A;  3IUC A;  4MO4 A;  3KLE A;  1RBV A;  4BRN A;  3V1O A;  1YTA A;  3E66 A;  4CJP A;  4C8K A;  3NFA A;  3AVK A;  3VQ4 A;  3LAL A;  2GEM A;  4BRD A;  3IRX A;  3TAE A;  1HJO A;  4CJ3 A;  4WF9 L;  2WTU A;  1QSS A;  4DV5 K;  3K2P A;  4B3R K;  3LP0 A;  3VEN A;  1TL3 A;  4CEB A;  4JKF A;  4YDU A;  1WUA A;  2YX6 A;  3C6U A;  2KTQ A;  3RMA A;  2E5L K;  1CXQ A;  5AQT A;  4CIG A;  4KHU A;  1JL2 A;  5D3G A;  5A2Q O;  4B3M K;  2NRW A;  1Q82 O;  1CZ9 A;  3G0Z A;  1J5E K;  5FPE A;  2Q3S A;  2LSN A;  4CJL A;  3AVM A;  4JI8 K;  2OPS A;  3UIQ A;  3H08 A;  3LDQ A;  1S1T A;  3OYH A;  2NRZ A;  2Q0U A;  4ILJ A;  4CK3 A;  3ZT3 A;  1NJX A;  2Q0R A;  3CPW M;  4DSK A;  4DF8 A;  1U48 A;  1LWF A;  1NGE A;  4DS5 A;  2ZGY A;  1YF5 L;  3D2F B;  4RW4 A;  2UU9 K;  3KD1 E;  1NLV A;  4DTU A;  4PL7 A;  2P9I B;  3MWT A;  3KLF A;  3V1R A;  3SQ4 A;  4XIU A;  1NBW A;  5GIO A;  1UAX A;  1N5Y A;  4M3X A;  3OBW A;  4DSL A;  1NK8 A;  1GLL O;  3SAF A;  2KZM A;  1WB9 A;  2UXC K;  1MWK A;  1YHQ N;  5GAG P;  1BCO A;  3OYC A;  1VQ6 N;  3A8Y A;  1O1W A;  1IO2 A;  3PUF A;  3WNG A;  2VG7 A;  2YHA A;  3BZC A;  4DFP A;  4M63 C;  1RTI A;  1KFS A;  4HHT A;  4ELU A;  1BU6 O;  3CET A;  2Y1J A;  3FZM A;  3P39 A;  5JLF A;  4N41 A;  3V9W A;  4K25 A;  2RN2 A; 
#chains in the Genus database with same CATH homology
 3WNF A;  1RT7 A;  3HM9 A;  1WSE A;  3F9K A;  1NK7 A;  1RBR A;  1D9D A;  4FLV A;  1KVB A;  3IG1 A;  2F96 A;  1HJR A;  1TAQ A;  4Z4F A;  1ASW A;  4OKJ A;  3TR8 A;  3SUQ A;  3SQ2 A;  4W5Q A;  4M3R A;  2W42 A;  4FJ5 A;  3KLG A;  4CEC A;  4M45 A;  4EP4 A;  3V81 A;  1LW2 A;  3D45 A;  1NK0 A;  2Z1H A;  3O4Q A;  1CXU A;  4I9L A;  5CYM A;  2G8U A;  2FBY A;  1LAV A;  1JLA A;  1VSH A;  2XHB A;  1SKS A;  2BDP A;  3IAY A;  4N76 A;  4PA1 A;  3NDK A;  3CM6 A;  1UA0 A;  1VSK A;  2PYJ A;  1JKH A;  4GMJ B;  1Q8I A;  4I2Q A;  4CJU A;  1RBU A;  4CJK A;  4OLA A;  4KV8 A;  1R0A A;  4CCH A;  1UWB A;  3V6D A;  3NH2 A;  4PWD A;  4IG3 A;  1B9D A;  4DQQ A;  4M3T A;  4HUF A;  2O4I A;  4H8K A;  4HCB A;  3AO2 A;  3DRP A;  4ZTF A;  1Q9Y A;  1JXB A;  1DLO A;  1TKT A;  1IKX A;  3AO3 A;  5T7B A;  1W0H A;  4B9N A;  4CHO A;  3T1A A;  4E1M A;  1HQE A;  5CZ2 A;  5HP1 A;  3SPY A;  4CFC A;  3U6F A;  3TWH A;  1BIS A;  3OS2 A;  3OS0 A;  1KTQ A;  4IFY A;  3B6P A;  3QEV A;  3VQP A;  1DTT A;  3AVB A;  2HNZ A;  3OYM A;  1NKC A;  4M42 A;  2KFZ A;  3DI6 A;  5DK5 A;  3U3G A;  3SPZ A;  3VQE A;  2Y1I A;  3SQ0 A;  1S1U A;  3ISN C;  4F2S A;  1CLQ A;  3MXM A;  3DLK A;  2NUB A;  2YNH A;  4LY7 A;  4Z4C A;  4FM0 A;  3VA0 A;  1ZBL A;  4E0D A;  2ZE2 A;  3EYZ A;  5KGX A;  3O3F A;  3HT3 A;  1ITG A;  3ZSR A;  1RT5 A;  1TK0 A;  4W5N A;  1TV6 A;  4Y1D A;  1BI4 A;  1WSH A;  5J2Q A;  1L3T A;  4CGI A;  2DY4 A;  1RDA A;  1MU2 A;  5E41 A;  2X78 A;  1IKW A;  3C94 A;  3SYZ A;  2E6M A;  2WOM A;  3ZT1 A;  4KRE A;  2HHX A;  1LWE A;  4AHU A;  3LPT A;  4N56 A;  4Q0B A;  5FRN A;  4IBN A;  1A5W A;  1D5A A;  3L3U A;  3L8B A;  1LWC A;  2Z1I A;  2IAJ A;  4Z4H A;  2OPQ A;  3TAM A;  1NOY A;  3KLH A;  2IDO A;  3TAB A;  4CER A;  4PQU A;  2B4J A;  2X74 A;  3LAK A;  5HRN A;  2HHT A;  4KHY A;  2ZQB A;  3VQA A;  4I2P A;  2VG6 A;  4CJW A;  1U49 A;  1RT4 A;  3K59 A;  4I7F A;  1B92 A;  4HUG A;  4DQP A;  3TAP A;  1TGO A;  4FVM A;  4DFJ A;  1U4B A;  3RWU A;  3PO4 A;  4J2E A;  4AHV A;  1ZBI A;  3ZT0 A;  4KKO A;  1BL3 A;  4CEA A;  4B9V A;  4ID1 A;  3MAQ A;  1HQU A;  3K5N A;  4M3W A;  2YHB A;  2ETJ A;  2IS3 A;  5KRT A;  2G8H A;  1TAU A;  3LAM A;  4BE1 A;  1X1P A;  1HYZ A;  1X9W A;  1NK9 A;  4F3T A;  3BGR A;  1JLB A;  4BE2 A;  4FLU A;  4FZY A;  3M8Q A;  1SUQ A;  4FK0 A;  4DSI A;  3QNO A;  3BDP A;  4BE0 A;  4YNQ A;  4N5S A;  4DTS A;  2D0C A;  3WNE A;  3E01 A;  3SUP A;  3PY8 A;  4ELV A;  3S3N A;  1RDB A;  4H4O A;  1C0T A;  3ZSY A;  3TAR A;  4FM1 A;  1RDD A;  3MEC A;  3D0P A;  2OZS A;  4RW9 A;  4CED A;  4OGC A;  2PY5 A;  3LPU A;  2KZZ A;  1BCM A;  3MEG A;  3NF9 A;  3MXI A;  1BQN A;  3OYK A;  3OJU A;  2ZD1 A;  5EU7 A;  4AHR A;  2HW3 A;  1RT2 A;  3K5O A;  3TAQ A;  4DTJ A;  1S6Q A;  1S1V A;  3VQB A;  2OPP A;  5K14 A;  1W9H A;  3KK1 A;  3LDS A;  3SUN A;  1SKW A;  4KHQ A;  4FK4 A;  4QCL A;  3PX0 A;  4G1Q A;  3JYT A;  5I3U A;  4O0J A;  2I5J A;  1LV5 A;  4CFB A;  1J5O A;  4FM2 A;  1VRU A;  3AVF A;  5HRR A;  3OYG A;  4CEO A;  3DRR A;  4Z0U A;  4CEQ A;  4HUE A;  1WLJ A;  2RF2 A;  3CM5 A;  1YTU A;  4CJ4 A;  1BI4 B;  3QEI A;  4KPY A;  2BGG A;  4J2B A;  4DTN A;  4NYF A;  1K6Y A;  1SL0 A;  4E7I A;  2P5O A;  3DYA A;  3P83 D;  4F4K A;  1BIU A;  4IG0 A;  3K58 A;  3LP1 A;  5KGW A;  3VQ6 A;  3QEP A;  4GVM A;  1NJZ A;  3ZSZ A;  1WN7 A;  1WSG A;  4OPJ A;  3DOL A;  3HP6 A;  1SL1 A;  4FJ8 A;  1C0U A;  3QER A;  4BWM A;  3C6T A;  2BAN A;  1LW0 A;  1QQC A;  3ASM A;  1L3V A;  1A5X A;  3KKS A;  4E7L A;  3THV A;  1HYV A;  1S5J A;  4CHP A;  4KTQ A;  3NF7 A;  1KFD A;  3TI0 A;  3ZSW A;  3V9X A;  2VG5 A;  3AV9 A;  3U3Y A;  1YVU A;  4OJR A;  3O3G A;  1S6P A;  1ZYQ A;  4LD0 A;  3HYF A;  3DLB A;  4CJV A;  4CEZ A;  3DLR A;  4W5O A;  1VSL A;  1XC9 A;  1Z25 A;  3AVG A;  3NHG A;  4L8R B;  2IOC A;  3SUO A;  1DTQ A;  1Q9X A;  1KLN A;  1TKX A;  4RW7 A;  4I9Q A;  4NYN A;  3C95 A;  1D9F A;  3V9W A;  1RT3 A;  4CEE A;  1EP4 A;  3AA5 X;  3CFP A;  4FJN A;  3EZ5 A;  3VA3 A;  1X9M A;  3AO1 A;  3NF8 A;  1YT3 A;  4C8M A;  1HYS A;  2DTU A;  1QTM A;  4DLG A;  5SZT A;  5DMR A;  4CEF A;  3K5M A;  4DTM A;  4ZHR A;  4BAC A;  4KB1 A;  4CK2 A;  4LSN A;  1VK0 A;  4O5B A;  3NH1 A;  2VWJ A;  3KK3 A;  3OVN A;  5J2P A;  5J1E A;  4CJQ A;  2D0B A;  3PX4 A;  4JRQ A;  3HO1 A;  4FXD A;  3V9Z A;  3HL8 A;  4M3U A;  4E7H A;  4M41 A;  1FK9 A;  1RBS A;  4E1N A;  4CHN A;  3L2W A;  3HST B;  1WSJ A;  3TAN A;  4UQG A;  3SJJ A;  1T7P A;  4F3O A;  1QE1 A;  4HVJ A;  3V1Q A;  2IC3 A;  2X6N A;  4LSL A;  3M8S A;  4JS4 A;  1TK8 A;  2HHS A;  1S1W A;  3KD5 E;  4FJM A;  4KO0 A;  1REV A;  4HCC A;  4H4M A;  3AVC A;  1XHX A;  3MXJ A;  5FDL A;  1VSE A;  4CIF A;  4FW2 A;  4IDK A;  2F8S A;  4OPK A;  4CHQ A;  2HNY A;  2XO7 A;  3VQ9 A;  1HNI A;  2G8I A;  4FLX A;  3S3O A;  3CG7 A;  4FW1 A;  3NH0 A;  1BQM A;  1JLC A;  1RCH A;  3WNH A;  1QSL A;  2JLE A;  3LZJ A;  3RMC A;  2QKK A;  3P1G A;  4CF2 A;  3MED A;  2AJQ A;  4QOZ B;  3NBP A;  2RPI A;  3NE6 A;  2O4G A;  2R7Y A;  5HBM A;  3VQQ A;  3O4N A;  3ZCM A;  3DLG A;  3QEX A;  3HVR A;  4BDZ A;  1L5U A;  1Y97 A;  4BWJ A;  5FRO A;  4DQI A;  2HVI A;  3OYF A;  1NK4 A;  1BGX T;  4PY5 A;  4B3O A;  1VSI A;  3ZT2 A;  5J2M A;  4QAG A;  4FJI A;  1J54 A;  4NCG A;  5CYQ A;  1HMV A;  2EHG A;  3VN5 A;  1S9E A;  1QS4 A;  2WON A;  4CF9 A;  4E89 A;  3OJS A;  4DU1 A;  1T8E A;  3DLH A;  2IGI A;  4KB0 A;  4CJF A;  3VQ7 A;  4FJX A;  3QIN A;  5KRS A;  3ZSQ A;  4DFM A;  4Q5V A;  4Z4E A;  4DG1 A;  1RDC A;  4OVL A;  4RW6 A;  4B9T A;  1VRT A;  5HRS A;  2P5G A;  4LH4 A;  2ATQ A;  4DSE A;  3ZSX A;  1ZBF A;  2Z1G A;  1J9A A;  4FLT A;  2FBT A;  4C8N A;  4CJT A;  4DSJ A;  4K8Z A;  1EXQ A;  1KLM A;  3DOK A;  2E6L A;  4CIE A;  2KQ2 A;  1UOC A;  4BDP A;  4EP5 A;  4EZ9 A;  4DTR A;  1NKE A;  4FJG A;  4JS5 A;  2A1R A;  4FZZ A;  4ID5 A;  3LZI A;  4FJ9 A;  3VQ5 A;  4FYD A;  1EX4 A;  5FRM A;  4B9S A;  1KVC A;  3SV4 A;  2DFF A;  3CYM A;  5HRO A;  2YNG A;  5SWM A;  1EET A;  1N6Q A;  2ITG A;  1NK6 A;  1ZBH A;  3L2V A;  4FLY A;  2B6A A;  2PYL A;  2G8K A;  4IKF A;  4E19 A;  3RR7 A;  2QKB A;  1ZBU A;  1KVA A;  3KIO A;  4JRP A;  4DF4 A;  1SKR A;  2P1J A;  2JGU A;  3SV3 A;  1KCF A;  3AO5 A;  4KTZ A;  1RT1 A;  3OS1 A;  3HJF A;  2XRI A;  1U04 A;  4J2A A;  1TKZ A;  1ASV A;  1JLF A;  3DLE A;  4CFD A;  3KJV A;  1Z26 A;  2E4L A;  3LWM A;  3ITH A;  4KAZ A;  3PO5 A;  1VSF A;  3K5L A;  2OA8 A;  3RRG A;  4B9L A;  4EZ6 A;  2HHQ A;  1WSI A;  3SZ2 A;  4O55 A;  2HVH A;  4YFU A;  1I39 A;  3AVJ A;  3SQ1 A;  4C8L A;  3OYN A;  1GOC A;  3TAG A;  3SI6 A;  1WNS A;  4DMN A;  1C1B A;  4DFK A;  1IH7 A;  4C8O A;  4CGF A;  4KHN A;  2YKN A;  4Z4G A;  4O44 A;  4E7J A;  2FBX A;  1UA1 A;  4OLB A;  4OKE A;  3QO9 A;  2P51 A;  4BDY A;  3T3F A;  3SCX A;  1XI1 A;  3FFI A;  4M3Y A;  3ALY A;  1F21 A;  3OYE A;  1FXX A;  2DFE A;  2G8V A;  3RMD A;  3RRH A;  1RIL A;  2XY7 A;  3QIP A;  1FKP A;  2F8T A;  3MEE A;  1FKO A;  4Y1C A;  3KTQ A;  5HRP A;  3EY1 A;  3CFR A;  3QIO A;  2Z1J A;  3DM2 A;  1KRP A;  4DQS A;  4DTP A;  3P5J A;  4KRF A;  1JLE A;  1JLQ A;  1IKV A;  3VQD A;  2RKI A;  1XHZ A;  1HNV A;  3QEW A;  4MFB A;  5J2N A;  4CHY A;  4B9U A;  1S9G A;  4AH9 A;  5JS2 A;  1JXE A;  4DQR A;  4DLE A;  4OGE A;  4CJS A;  2OPR A;  3L2Q A;  4DTX A;  2XY6 A;  3ULD A;  4K8X A;  3ZSV A;  3ZSO A;  4DWI A;  4CGH A;  4RW8 A;  2OYQ A;  3VQ8 A;  3DMJ A;  3A2F A;  3I0S A;  3QNN A;  1X9S A;  4E7K A;  3HVT A;  3L2R A;  3HK2 A;  1C1A A;  1WSF A;  3V4I A;  4R5P A;  3M8P A;  2GV9 A;  2HB5 A;  4B08 A;  1JL1 A;  1D8Y A;  1GOA A;  3OYJ A;  3PV8 A;  1SL2 A;  4CJ5 A;  4RG8 A;  4DU4 A;  4NCB A;  1BIZ A;  1U45 A;  4N47 A;  1IG9 A;  4CF8 A;  1NJW A;  5KTQ A;  4KI6 A;  1RNH A;  3AVI A;  2X6S A;  2XY5 A;  1NOZ A;  1ASU A;  3AA4 A;  4DTO A;  1L3U A;  4NCA A;  2YKM A;  2YNI A;  3G10 A;  2A1S A;  3NGY A;  2XY8 A;  5CY4 A;  2KW4 A;  1RTJ A;  1RT6 A;  3AVN A;  4O0I A;  2OZM A;  3VQC A;  1TL1 A;  2YV0 X;  4CF1 A;  4DU3 A;  2KFN A;  1HRH A;  1XWL A;  1T05 A;  4FZX C;  4PUO A;  1GOB A;  2QK9 A;  3M8R A;  4FJ7 A;  1TKD A;  4CHZ A;  4JLH A;  3L3V A;  1JLG A;  1NKB A;  4KI4 A;  1EKE A;  3S9H A;  1I3A A;  4KFB A;  3KLE A;  1RBV A;  1L3S A;  4ICL A;  3HPO A;  1NJY A;  3V1O A;  3QES A;  4FK2 A;  3DRS A;  4ELT A;  4J2D A;  1VSJ A;  3KK2 A;  3QET A;  2G8F A;  1BHL A;  4FJK A;  3RR8 A;  1YTA A;  5C24 A;  4CJP A;  4HTU A;  2FC0 A;  3NFA A;  1U47 A;  3OY9 A;  4C8K A;  3AVK A;  2D0A A;  3VQ4 A;  3LAL A;  4MQ3 A;  3SNN A;  1C1C A;  3IRX A;  3KKR A;  4AHC A;  3NGI A;  3TAE A;  1RTD A;  3HXM A;  4CJ3 A;  1C6V A;  3HPH A;  1QSS A;  4KHS A;  3OYB A;  4DS4 A;  4KHW A;  1IKY A;  3AVL A;  3K2P A;  3LP0 A;  4DSF A;  1WAF A;  1TL3 A;  4CEB A;  1NK5 A;  4O4G A;  2PZS A;  3C6U A;  2KTQ A;  3RMA A;  2GBZ A;  3PX6 A;  1CXQ A;  1KSP A;  2D5R A;  3AA2 A;  4CIG A;  3L2U A;  3JSM A;  4KHU A;  1JL2 A;  5D3G A;  1VSM A;  1CZ9 A;  3G0Z A;  4GW6 A;  3K57 A;  2Q3S A;  5JS1 A;  3I8D A;  2QXF A;  2HMI A;  2LSN A;  4CJL A;  3NF6 A;  3AVM A;  1VSD A;  2HHV A;  2OPS A;  4CJR A;  3UIQ A;  3H08 A;  3O3H A;  1S1T A;  4CK1 A;  3OYH A;  2FBV A;  1RTH A;  1LAW A;  2VWK A;  4CK3 A;  3ZT3 A;  1NJX A;  1HPZ A;  1G15 A;  1QHT A;  3AVA A;  4AHT A;  1CZB A;  3RMB A;  4DSK A;  4OKK A;  4DF8 A;  1U48 A;  3HP9 A;  4CGD A;  4W5R A;  3OYL A;  3NGZ A;  3OYD A;  1A5V A;  5C25 A;  2HHU A;  1LWF A;  4Z4I A;  3NCI A;  3ZT4 A;  2B5J A;  2HND A;  1B9F A;  1J53 A;  4B8C A;  3OYA A;  1T03 A;  4DS5 A;  4AHS A;  5KI6 A;  4LH5 A;  1SV5 A;  3I0R A;  3RTV A;  3AO4 A;  2EX3 A;  4RW4 A;  4WE1 A;  4AIL C;  3KD1 E;  3V9U A;  4W5T A;  5CZ1 A;  1C0M A;  4DTU A;  4F2R A;  3LP3 A;  1TVR A;  2GUI A;  3KLF A;  4CGJ A;  5I42 A;  4FJL A;  2YNF A;  4CF0 A;  1TK5 A;  3V1R A;  3AA3 A;  3SQ4 A;  4M3Z A;  4XIU A;  4ZTJ A;  4CFA A;  2HHW A;  3LAN A;  3OYI A;  4F8R A;  3B6O A;  1S1X A;  1UAX A;  1N5Y A;  4E3S A;  4M3X A;  4DSL A;  2BE2 A;  1NK8 A;  3HPG A;  5HLF A;  3CQ8 A;  4CES A;  3TAF A;  3NAE A;  4FJH A;  2KZM A;  2DFH A;  3QLH A;  4IFV A;  4KTW A;  3T19 A;  4CE9 A;  3LWL A;  3F73 A;  3OYC A;  1BCO A;  2G8W A;  4CGG A;  4FCY A;  4FLZ A;  1O1W A;  1IO2 A;  3PUF A;  3WNG A;  1WAJ A;  2VG7 A;  2YHA A;  3CFO A;  3IS9 A;  4B8A B;  4DFP A;  1RTI A;  1KFS A;  1RBT A;  4CJE A;  3V9S A;  4B9M A;  3S3M A;  5C42 A;  4HHT A;  4FLW A;  4ELU A;  3LP2 A;  2Y1J A;  1QSY A;  4FJJ A;  4N41 A;  3AVH A;  4TSX A;  3KLI A;  2RN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...