1GOAA

Cooperative stabilization of escherichia coli ribonuclease hi by insertion of gly-80b and gly-77-> ala substitution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
b'MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQGWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Cooperative stabilization of Escherichia coli ribonuclease HI by insertion of Gly-80b and Gly-77-->Ala substitution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 48
structure length 156
sequence length 156
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1goaA00
3AVAA 3ALYA 1D9FA 1JLGA 4DQIA 2FBXA 3HVTA 3M8QA 4FJ7A 4F3TA 5I3UA 3NF7A 3VQ5A 2G8IA 1SKWA 4L8RB 1RTHA 4DQQA 2DY4A 4ELTA 3VQ7A 2YKMA 1ZBFA 2VWJA 3V1OA 3I0SA 1KSPA 1WSGA 4IKFA 4CEOA 2G8VA 3AVMA 1ASUA 1DLOA 1J9AA 2BE2A 4CIGA 3G0ZA 2PYLA 5KI6A 4K8XA 4LSLA 2OA8A 4CF8A 1CLQA 4DF4A 4H8KA 1X9WA 4E0DA 3TAFA 1UA0A 3ZSWA 3B6PA 3AVNA 1FKOA 4CHYA 1NJZA 4M3TA 4B3OA 1VSDA 3ZT2A 3S3MA 4FJMA 3LAMA 3QEPA 3IS9A 5I42A 2OYQA 5HP1A 3QEWA 4DLGA 3RMBA 4KHWA 5KTQA 2OPSA 2Y1JA 5SWMA 1L3SA 1LWCA 1VSKA 3DM2A 3H08A 4KV8A 4DFMA 4DTOA 1TVRA 1KVBA 3ITHA 3KLGA 1ZBIA 4YNQA 1BI4A 1KTQA 3HP6A 3HSTB 4DTUA 1JLFA 3RR7A 1B9DA 4KHUA 3U3YA 2HVHA 1UAXA 4JS4A 4ID1A 4IG3A 3I8DA 3T1AA 3OYIA 4DTNA 3C6TA 1YTUA 2G8FA 4OKEA 3NF6A 5J2NA 3HO1A 1B92A 4CJTA 3SQ2A 1TKTA 2I5JA 4LY7A 2B4JA 4BWJA 4FM1A 3PV8A 1JXEA 4PA1A 5CYQA 1X9SA 2HHTA 3LAKA 3ZSOA 1UWBA 1BL3A 3HP9A 3QEVA 1LAWA 3OYBA 1BQMA 5CZ1A 1NK5A 1QS4A 2ZE2A 1TK0A 1TGOA 3LALA 4CJSA 3ZSZA 2A1RA 4RG8A 3HL8A 4HCCA 2DTUA 4OKKA 1HNIA 3ZT1A 4CHOA 5HBMA 4DS4A 4BE0A 3NH2A 1NJWA 3PY8A 4KTZA 4I2QA 5HRRA 3VQDA 1XC9A 1ASVA 5EU7A 4CCHA 3ZCMA 3SQ4A 3LPTA 3T19A 3JSMA 3TAQA 1TL1A 3AO1A 3KLEA 4IG0A 5FRNA 4E3SA 1NK7A 4MQ3A 1S6PA 3HVRA 1JL2A 3JYTA 1CZ9A 1GOAA 3M8RA 1BHLA 1KFDA 3AO2A 3EYZA 3AVIA 5KGWA 1WSHA 1JLBA 1DTQA 4HVJA 1C0MA 1JLQA 2YNGA 4BE1A 4Z4CA 4FJKA 3SZ2A 1XI1A 2IAJA 4C8MA 4ZTFA 4KI4A 2HHWA 3E01A 3RRGA 4M3XA 3RTVA 2Z1HA 3OYGA 1U04A 4TSXA 4EZ9A 2ETJA 4CEBA 4C8NA 4K8ZA 1JKHA 3QNOA 4Z4FA 4RW8A 2WOMA 3TI0A 3HK2A 4B9NA 1VSJA 3RWUA 1RILA 2B5JA 1Y97A 3DOKA 1RT5A 4CHPA 4HUEA 4FK0A 4BACA 3PUFA 1WNSA 4I2PA 1NKBA 3SUOA 4F4KA 4FYDA 4DSEA 4CGHA 1NK4A 5KGXA 3PO4A 5D3GA 2HW3A 2D5RA 4AHCA 3OYHA 1SUQA 4FLUA 3RMDA 3RMAA 2GBZA 4DLEA 1VSMA 4B8AB 1NK9A 1NK0A 4GW6A 2ATQA 4FJNA 3HPOA 1KCFA 3SV4A 1RT4A 4CEDA 4DSJA 4DSKA 4FZXC 4M42A 3UIQA 1EXQA 3V9XA 5DK5A 4EP5A 2F8TA 2FC0A 2G8KA 4N76A 4CFAA 1S6QA 1KLMA 4BDPA 3DLEA 3V9ZA 3THVA 1RBUA 4FJJA 3NGIA 4CJ4A 1RTJA 4E19A 1RDAA 1L5UA 3ZSYA 2YNIA 3OYMA 3V81A 2W42A 1RDCA 1LW0A 1ZYQA 4N5SA 4FZYA 4J2AA 3OJSA 1IO2A 4ZHRA 1EKEA 1SKRA 3L8BA 3CM5A 4E1NA 1T03A 4KKOA 4CIFA 1TK8A 4B9TA 4KI6A 3OYEA 3OYKA 3L3VA 5E41A 2Z1JA 1BI4B 3TAEA 4CF1A 3WNEA 2LSNA 3IRXA 2IOCA 1VSIA 4CK1A 1U48A 3DYAA 5FRMA 5K14A 3TR8A 1Q9XA 2HHQA 4C8LA 4AHTA 4JRQA 2HHXA 1WSJA 4F3OA 2HHVA 1QSLA 1RBSA 3LANA 1W0HA 3VQ9A 3OJUA 3K57A 3QEIA 4J2DA 1LW2A 3KK3A 3NBPA 4KB1A 2ZD1A 1RBVA 1TKZA 4GMJB 4CHNA 1RNHA 4RW9A 3OS1A 4CJUA 4DG1A 2OZSA 4M3WA 2BANA 1WSFA 1IKXA 3DOLA 1HYVA 4IFYA 1EETA 1VK0A 1TAUA 2YNFA 1TK5A 4H4OA 4CJ5A 5J1EA 4OJRA 4E7HA 5DMRA 2IS3A 3LWLA 1Q9YA 4EZ6A 4FLXA 4DSLA 2KTQA 1A5XA 5SZTA 1T8EA 3C94A 3WNFA 3NE6A 4OGCA 2ZQBA 3LZIA 3ZSVA 3SCXA 2O4IA 4FJIA 3VN5A 3U3GA 4LSNA 1BIZA 5J2QA 1HYZA 4CF9A 1LAVA 2KQ2A 4CGDA 3HYFA 3K5LA 4B9UA 5T7BA 4R5PA 2P5OA 4Z4IA 2G8UA 3VQ8A 3ISNC 4FK2A 1X1PA 4BWMA 3LP0A 3O4QA 1BQNA 1TKXA 3QESA 2RPIA 3MEDA 4HUGA 4Z4HA 1RDDA 4CFCA 3RRHA 1HYSA 1VSFA 5HRPA 2D0AA 3L3UA 3AVBA 4O44A 1VSEA 3WNGA 1VRUA 5JS2A 4CK3A 4N41A 3V1QA 3VQAA 4E89A 4IFVA 1C1BA 5FDLA 4KO0A 4FLYA 3LWMA 3SNNA 5CZ2A 2KFZA 3VQPA 2JGUA 3QIOA 2OPPA 1J5OA 2PY5A 4DQSA 1HNVA 3BGRA 4CJLA 2YV0X 3QNNA 3DLBA 4PUOA 3QETA 2QK9A 4CF0A 2A1SA 3HJFA 1VRTA 3PX4A 3TWHA 3KLIA 4DTMA 3CFRA 4DSFA 3HPHA 4NCGA 2XY5A 3G10A 3LP2A 2E4LA 4CJQA 2Y1IA 1NK8A 1IKYA 4ELUA 4OLAA 3L2UA 4N56A 2HMIA 2Z1GA 1BISA 4XIUA 2QKBA 2BGGA 3V6DA 2XY6A 1WAFA 2IDOA 4I9QA 4CHZA 2GUIA 4BDZA 1NK6A 2PYJA 1UA1A 4CJEA 3S3OA 3SPZA 2FBTA 3TAMA 4E1MA 2D0CA 3SUQA 4CEZA 3DLHA 4B9SA 3KKSA 1A5VA 4C8KA 3KTQA 1BCOA 3AVHA 3VQEA 3TAPA 2KW4A 4DFJA 3EZ5A 1YTAA 3NGYA 2QXFA 3KJVA 1S1VA 2RKIA 4E7JA 4OPJA 1HRHA 2HNZA 2YNHA 3P1GA 4W5TA 1TL3A 4DS5A 3AVGA 2OZMA 1BGXT 1RBTA 1S9GA 1JXBA 2X74A 4CGIA 4E7KA 4CJRA 3HM9A 4RW4A 3L2VA 5HRSA 4W5RA 2IGIA 2FBVA 2O4GA 2E6MA 3C95A 4CEAA 4ELVA 1GOBA 2F96A 2X78A 1JLAA 3B6OA 4WE1A 2HB5A 1B9FA 3VQQA 5J2MA 3HPGA 1N5YA 3L2RA 4B9LA 1RT7A 4KPYA 1ASWA 1QE1A 2DFEA 1Z25A 3C6UA 3OS0A 3KK2A 4E7LA 2YHBA 4ZTJA 4DQPA 1Z26A 3KIOA 3NH0A 2D0BA 3NF8A 1WN7A 3SJJA 4CGGA 1WSEA 3NCIA 3TANA 1D8YA 4O4GA 3BDPA 4IBNA 4ID5A 3OS2A 3SQ0A 4CESA 3TABA 2RN2A 4UQGA 1T05A 1KVAA 4F2RA 1EP4A 1C6VA 4FJXA 4KFBA 2HHUA 3NGZA 1HQUA 4JS5A 2B6AA 1S9EA 1QHTA 4KB0A 4M41A 3DI6A 1X9MA 2WONA 1ZBUA 4JLHA 3SPYA 3CG7A 4F8RA 4PWDA 3ZT0A 4FM0A 3KD5E 3L2WA 3A2FA 1D9DA 2X6SA 1VSLA 3IG1A 4QAGA 3VQBA 3TAGA 3RMCA 3SYZA 1SL2A 3M8PA 4FJLA 2G8WA 1BIUA 2Z1IA 3V4IA 3ZT4A 4OPKA 1ITGA 4W5QA 1CXUA 3QIPA 1IKWA 1C1AA 1CZBA 3ULDA 3AVKA 3OYCA 2E6LA 1RBRA 4AILC 3OYLA 1NOZA 4NCBA 1FK9A 3AA2A 3KLFA 3V9SA 1NKEA 4DSIA 3NF9A 1L3TA 5KRSA 1RT6A 3IAYA 4FM2A 3S3NA 1NOYA 2HNDA 1GOCA 3ASMA 1QTMA 4CGJA 3AA5X 3F9KA 3K2PA 4HHTA 3DLGA 1LWFA 3VA0A 2OPRA 4HCBA 4Q5VA 3NHGA 3MXIA 3K5NA 3DRPA 4CECA 4DMNA 4EP4A 3OYAA 4CFDA 1KFSA 1WLJA 2G8HA 3ZSXA 1ZBLA 4ICLA 2NUBA 3S9HA 3AVJA 2VG7A 4Z4GA 5KRTA 4CJPA 3PX0A 4KAZA 4NYNA 2XHBA 1J54A 4CGFA 4KREA 3OVNA 1RT1A 4Z0UA 3V1RA 3MECA 1D5AA 1JLCA 3QERA 4MFBA 3CQ8A 4N47A 3SUNA 1REVA 1S1TA 1XHXA 3ZSQA 1JLEA 3NAEA 3AO5A 3RR8A 1HJRA 4W5NA 4OVLA 4M3YA 3D45A 4G1QA 4DQRA 4KHSA 3VQ6A 3HXMA 4FJGA 3O3GA 4DFPA 3AVCA 3CFOA 4CJ3A 4DU1A 2XY7A 1YVUA 1I39A 3NDKA 2VWKA 4RW7A 2P5GA 3FFIA 4DTRA 3V9WA 5J2PA 3KD1E 2YKNA 4CIEA 4CERA 4FLZA 1XWLA 3DRSA 4J2BA 3K5OA 2DFHA 1I3AA 4DTJA 4C8OA 5CY4A 4O55A 4CF2A 4Y1CA 4JRPA 4QCLA 2KFNA 3MEEA 4GVMA 3VA3A 1R0AA 3SI6A 4FLTA 4PY5A 4DU4A 1SV5A 3MAQA 3LP3A 3I0RA 1L3VA 4CEQA 4KHYA 1WAJA 4CEEA 2IC3A 1NJXA 5HROA 2EX3A 1FKPA 1BCMA 3K58A 4NCAA 2KZZA 4M3RA 1C0UA 1WSIA 4LD0A 4FXDA 4BDYA 4AHSA 3SQ1A 2VG6A 4AHVA 4KRFA 5C42A 4AHRA 3DLKA 2XRIA 4I7FA 3WNHA 1IH7A 4O0IA 3O4NA 4OLBA 3LPUA 3K5MA 1XHZA 2QKKA 3KLHA 2ITGA 2YHAA 4NYFA 1T7PA 4FK4A 2HVIA 3QO9A 2EHGA 4FW2A 1O1WA 4LH4A 1SKSA 4FZZA 1RCHA 4B08A 4B9MA 1HQEA 4OKJA 4CE9A 5JS1A 4CJFA 3KK1A 3AA4A 3MXMA 4O5BA 1U4BA 2BDPA 4IDKA 1TV6A 2DFFA 4CK2A 4CHQA 4YFUA 3ZSRA 1YT3A 3DRRA 1RT2A 3CYMA 3K59A 2PZSA 3OY9A 3OYFA 1A5WA 4QOZB 3VQCA 3QEXA 1LWEA 3VQ4A 3OYDA 5CYMA 4FJ5A 3AVLA 1CXQA 3DMJA 4RW6A 4W5OA 3LDSA 3AO3A 1SL0A 4FJHA 4BE2A 4E7IA 3AO4A 3LZJA 1UOCA 4HUFA 4DFKA 1U47A 2X6NA 4Q0BA 3P5JA 3PX6A 4FVMA 1NKCA 4KHQA 1S1WA 3NFAA 1QQCA 5C24A 4M3ZA 4DU3A 1J53A 4KTWA 1KRPA 1DTTA 3ZT3A 3TARA 2AJQA 2VG5A 2OPQA 1KLNA 3MXJA 2HNYA 1RT3A 1Q8IA 5HLFA 3M8SA 4CJVA 1RDBA 3AA3A 5HRNA 1IG9A 2P1JA 5C25A 1QSYA 3CFPA 2R7YA 1EX4A 1RTIA 2P51A 3SUPA 1LV5A 3D0PA 1U49A 1QSSA 1C1CA 3QINA 1SL1A 1K6YA 3AV9A 4B9VA 3F73A 4DTPA 1JL1A 1ZBHA 2RF2A 3CM6A 3KKRA 4FCYA 4PQUA 2GV9A 3MEGA 1C0TA 4O0JA 1FXXA 2Q3SA 3HT3A 4FLVA 4CJWA 4AHUA 3OYJA 3NH1A 3DLRA 4FJ9A 1S1UA 2F8SA 4DTXA 1TKDA 1L3UA 2HHSA 1G15A 3P83D 3QLHA 2FBYA 2XY8A 4DTSA 3U6FA 2XO7A 3SV3A 4HTUA 1S5JA 3O3FA 4KTQA 4Y1DA 4J2EA 4CFBA 4M45A 4I9LA 3O3HA 4DF8A 1RTDA 2JLEA 1NJYA 3AVFA 3PO5A 3L2QA 4FJ8A 4OGEA 3OYNA 4CEFA 1W9HA 4F2SA 1HPZA 3LP1A 4LH5A 3EY1A 2KZMA 1VSHA 4FLWA 4KHNA 1TAQA 1S1XA 1IKVA 3T3FA 4AH9A 4M3UA 4Z4EA 1HMVA 4CJKA 1F21A 4H4MA 4FW1A 1KVCA 1N6QA 1MU2A 1U45A 4DWIA 3V9UA 4B8CA 5FROA
chains in the Genus database with same CATH superfamily
1D9FA 4OO1J 4DQIA 3GOIA 4F3TA 3VQ5A 1SKWA 1NGCA 4ELTA 3WUHA 1J5EK 1N8RO 2BTFA 1WSGA 4YOXA 1VQLN 4IKFA 4CEOA 4CD1A 3EN9A 3G71N 3QMLA 2OA8A 4CF8A 1CLQA 1X9WA 3SBGA 3AVNA 1FKOA 1VSDA 5I42A 2P9UA 3QEWA 3RMBA 2Y1JA 5SWMA 3VMFB 4DTOA 3ITHA 4YNQA 2I7PA 1KTQA 3RSEB 3H3NO 3U3YA 1HR0K 4IJNA 3HTVA 4JS4A 3L6QA 3T1AA 4WFBL 3D2EB 4DTNA 2D4WA 4V19S 3SQ2A 3GG4A 4ILJA 3CMEN 4BWJA 3MMVA 4PA1A 1ZXOA 3LAKA 3HP9A 3OYBA 1NK5A 3MN6A 1VQ6N 5AQMA 4OKKA 1ILYA 4CHOA 4ISGA 4DS4A 4BE0A 2AA4A 4KTZA 4CCHA 1ASVA 3WXIA 4JD2B 3TAQA 3T7ZA 1E4FT 3KLEA 3I8BA 2UUBK 5IT9O 4E3SA 2OANA 2PBDA 1CZ9A 5AQKA 5EOYA 1BHLA 3AVIA 4HVJA 5LMNK 2E2QA 3VEXA 4KI4A 4BRKA 1IG8A 5KPZA 1NU0A 2VQFK 4WFAL 3D7EO 4M3XA 3ID8A 2YCHA 4Z4FA 2VGNA 4C8NA 1KXPA 1X9JA 3HK2A 3MN5A 1R59O 2B5JA 1Y97A 4CHPA 3IFRA 4HUEA 3ZYYX 3VTIA 4I2PA 3SUOA 5KPTA 3NVKA 4DSEA 3H1VX 4A57A 2QWLA 4AHCA 3RMAA 4B1XB 4B8AB 4GW6A 1YJNN 3SV4A 4DSJA 3BY5A 3UIQA 2QTDA 3AARA 3V9XA 4BDPA 1N32K 4BR5A 3PSIA 4FJJA 1RDAA 4N5SA 1IO2A 2P9UB 3DAWA 4ILHA 4ZHRA 3C7NA 1WUAA 4CIFA 4KI6A 1NGBA 3L3VA 3IRXA 1VSIA 3C65A 3DYAA 4NO7A 1OVQA 2RE2A 3TR8A 5A2QO 4JRQA 2HHXA 1GLEG 3MN9A 1N36K 2UXDK 3Q7BA 3LDPA 2V7ZA 3BF1A 1RBVA 5AQSA 3CC7N 4JYAK 1IKXA 3DOLA 4IFYA 2YNFA 4IOXA 1ESVA 1GLAG 4H4OA 5J1EA 5C10A 4E7HA 3SLCA 4L3QA 1A5XA 1KD1O 5JMVA 4A61A 3C94A 3U8XA 3ZX3A 2JWLA 2ZQBA 3LZIA 2O4IA 3VN5A 3U3GA 4LSNA 3LL3A 5J2QA 4CGDA 4B9UA 4R5PA 4JHDA 3H6EA 4BWMA 1X3NA 1HKCA 3O4QA 1TKXA 3OBYA 2RPIA 3THYA 4CFCA 3CI5A 1VSFA 3QFUA 5HRPA 4O44A 3WNGA 3L8BA 1NG9A 4UY8O 3SK3A 3O9QA 1C1BA 2NRHA 4KO0A 2GWJA 3BEXA 3SNNA 5CZ2A 3H1QA 4PKIA 4A62A 1J5OA 3O8MA 3SAGA 1HNVA 4CJLA 3DLBA 3PLAA 4X65K 3LM2A 4GVEA 3HPHA 3L2UA 2FSKA 4N56A 2GUIA 1T6CA 1UA1A 1BU6O 4B3MK 3S3OA 3TAMA 3F2KA 3KTQA 3VQEA 4YORA 4IO9L 3KJVA 1S1VA 2UUCK 4OPJA 1HRHA 2HNZA 4DS5A 4J2DA 3TTDA 1YAGA 3AVGA 1BGXT 4E7KA 3RVCA 4RW4A 2E6MA 2E5LK 4MO4A 4WE1A 2HB5A 5J2MA 3HOSA 1RT7A 2NRXA 3C7NB 1DT9A 1Z26A 3NH0A 3NCIA 3K9JA 3BDPA 4CESA 2VYPA 1C6VA 1P8ZA 1BA1A 5JLFA 2HHUA 1GLBG 4JS5A 4KB0A 3DI6A 4F8RA 3ZT0A 5ADXH 4FM0A 4WQ5C 3A2FA 3ZLJA 3VQBA 2W41A 2Z1IA 3ZT4A 1K9MO 1J6ZA 3B8AX 3ULDA 4HWIA 4JI6K 4DR2K 3AA2A 3V9SA 4A2BA 4DSIA 5KRSA 1RT6A 4JHDB 2Q97A 3DXKA 4O8KA 4FM2A 1GOCA 2YX6A 3K2PA 3DLGA 5F1XA 4Q5VA 3THYB 3MXIA 3DRPA 4EP4A 3OYAA 1KFSA 1KAYA 2UUAK 4DR5K 4Z4GA 5KRTA 5BREA 4KAZA 2XHBA 3V1RA 1D5AA 4A5AA 3CQ8A 1K73O 1XHXA 3HBTA 2OTLN 3SJHA 3GE1A 4RCHA 1D4XA 1HLUA 3AVCA 4DU1A 1NGFA 3CCQN 1CZAN 5J2PA 4CZMA 4CERA 3THXB 2NNWA 2UXCK 1I3AA 4C8OA 2HBLA 3MEEA 4GVMA 3VA3A 1IBKK 3VOVA 1N33K 1SV5A 3MAQA 3KHYA 1NJXA 3K0SA 2O8DA 5LJVA 1WSIA 4BDYA 4LF5K 3CCVN 2GX9A 2VG6A 3SQ1A 3DLKA 1NGGA 4I7FA 2QWOA 4FOEA 2QKKA 4BR7A 2W6LA 2YHAA 4M7XA 3QO9A 3I55N 1OKJA 4FZZA 1RCHA 4B9MA 1T44A 3O9TA 4OKJA 4CE9A 4KHPK 4CJFA 3MXMA 3AA4A 3LM9A 4O5BA 4BRGA 2BDPA 4H0OA 4YFUA 3TAGA 1JCGA 2D1KA 3DRRA 3ZSRA 2PZSA 3CYMA 1NJIO 5EY4A 3M1FA 3VQ4A 3DMJA 4DB3A 4XEIA 3LDSA 4JK9A 4KHQA 1S1WA 1QQCA 1NLVA 4KTWA 1KRPA 3T1HK 4B1UB 3TARA 5M1QA 5HLFA 2FF6A 1HNXK 4CJVA 5B8HA 1RDBA 3AA3A 2ZJQL 3A5OC 5CE3A 3J81O 5HRNA 4IOAL 1EX4A 1BDGA 3SUPA 3EL2A 3MWPA 3QINA 1K6YA 3O9UA 1VQ7N 1HX1A 4LF4K 3E1YA 5AQOA 1WBBA 3MEGA 4O0JA 2O8CB 3BP8A 4AHUA 3DLRA 2A5XA 1XQSC 1G15A 2XY8A 4HTUA 3O3FA 4CFBA 4B1VA 4DF8A 1RTDA 2JLEA 2QW9A 3PO5A 4NXMK 1MA9B 1S1XA 5H1SQ 3T3FA 3CPEA 4AH9A 4B3RK 4CJKA 4H4MA 4EAHD 1KVCA 2BH1A 3ATUA 4J8FA 3PY8A 5FROA 1JLGA 3HVTA 3M8QA 2VGMA 1K8KA 5I3UA 2G8IA 1VQ8N 4YOTA 3WQUA 2YKMA 1ZBFA 1KSPA 3V1OA 3QDKA 3AVMA 1J9AA 2BE2A 5KI6A 5TKYA 4H8KA 3IDHA 4DF4A 1UA0A 3ZSWA 3B6PA 4CHYA 4B3OA 3O9RA 5HP1A 4DLGA 1L3SA 4YOUA 4EFHA 4KHSA 3O5BA 1KVBA 3KLGA 1ZBIA 3ENBA 4DTUA 3VESA 3RR7A 4KHUA 1T3VA 1YVNA 3CF5L 1UAXA 5HL7L 4ID1A 4IG3A 3I8DA 3OYIA 2G8FA 4OKEA 5J2NA 1VQ5N 4CJTA 1YXQA 5GAGP 3G25A 4J2AA 4LY7A 2B4JA 3E66A 3ULEB 3ZSOA 4K41A 1UWBA 4B3TK 3K9KA 1MWMA 4B1ZA 5M1NA 1TGOA 3GDQA 4JKHA 4RG8A 3HL8A 3VGLA 2DTUA 3WQTA 3AGKA 4K25A 4H5WA 4LFCK 4XH1A 5HBMA 5EXWA 5EU7A 3SQ4A 3UKRB 3LPTA 1BUPA 3IMXA 5FRNA 4JI7K 4WFNL 5BPNA 1WOQA 4BVOA 1VAZA 3ATVA 3M8RA 1YIJN 3AO2A 5KGWA 1WSHA 1DTQA 3KK7A 1JLQA 2YNGA 2E2NA 5AQHA 3SZ2A 4ZTFA 3E9OA 2Z1HA 3OYGA 2ETJA 1QVFM 1XC3A 2ZGZA 2WOMA 3FZHA 3TI0A 1VQ9N 4B9NA 3T1YK 4QS8A 1RILA 1RT5A 1VQ4N 2W6KA 3EZWA 4H0VB 4FK0A 4BACA 2P9SA 5LMUK 1NKBA 5F2RA 2D5RA 4FLUA 3RMDA 4DLEA 1VSMA 4WCEL 1NK9A 2A3ZA 4FJNA 4AF1A 1KCFA 3A5NC 4CEDA 4DV7K 1K8KB 4EP5A 4C23A 2F8TA 4CFAA 5FPNA 1S6QA 1W2BM 3DLEA 1RBUA 2V51B 3NGIA 4DQ8A 3ZSYA 2VWBA 1LW0A 4FZYA 1EKEA 3VF4A 2QWNA 3CM5A 1HNWK 1T03A 1C0GA 4B9TA 2O8FB 2IVOA 5E41A 1KQSM 3TAEA 4CF1A 5EVZA 2IOCA 4CK1A 1U48A 4H5TA 4K42A 1WSJA 1RBSA 1W0HA 3OJUA 3QEIA 2P9IA 3M6GA 1LW2A 4BRNA 5FPEA 1VQPN 4KB1A 4BRIA 4RW9A 2OZSA 4OX9K 5GADP 4M3WA 1WSFA 1N34K 1TK5A 4FWPA 1Q9YA 4ISEA 3CCLN 4GV9A 3CJBA 1T8EA 4WF9L 3CCUN 3WNFA 1Q86O 1I94K 3ZSVA 3CETA 4FJIA 4LFAK 1BIZA 3P39A 3QICA 4PL8A 4CF9A 1LAVA 4DV5K 2P5OA 2G8UA 4G9ZA 4IEEA 5FPMA 3LP0A 3QESA 3OA9A 3VEYA 4Z4HA 4DR3K 3L3UA 3E9LA 3ID6A 3LWMA 5AQPA 2KFZA 2JGUA 3G6EN 3LDLA 2OPPA 2PY5A 1VQON 2YV0X 5AQZA 4PUOA 4U67L 3KLIA 3TWHA 1WB9A 1NM1A 4DSFA 4NCGA 2ZJRL 3LP2A 2P9SB 2Y1IA 4A59A 3FFKB 2WC9A 1BISA 5AZIA 4BDZA 2PYJA 3SPZA 2FBTA 2D0CA 3SUQA 4CEZA 4B9SA 1ATNA 1GLDG 2KW4A 4YHHK 3J8AA 3EZ5A 3NGYA 2RKIA 4E7JA 3TSUA 2V52B 1TL3A 1JXBA 4DUZK 5BR8K 1YJ9N 4W5RA 2O4GA 4EHUA 3C95A 1JLAA 1HKBA 3D6RA 3VQQA 3HPGA 1N5YA 4LF8K 4B9LA 3R1XA 1ASWA 1QE1A 2DFEA 1Z25A 3C6UA 3KK2A 4ZTJA 1OH7A 4DQPA 3FZLA 2GELA 3KIOA 4BRDA 3SJJA 1WN7A 1YI2N 2O8BA 3OS2A 4ID5A 4FOIA 3SQ0A 3TABA 4BGAA 2RN2A 3KVGA 1T05A 1KVAA 3EEQA 4F2RA 4NLCA 4KFBA 3AAPA 2P9IB 1S9EA 2VQEK 4BC5A 4WQ4C 1X9MA 4JLHA 5BRDA 3CG7A 1BO5O 3HZ6A 4CZKA 1D9DA 1VSLA 3C6HA 1SL2A 1Q18A 2NZTA 3M8PA 4GNIA 2G8WA 1BIUA 2O8EA 4OPKA 1CXUA 4JKAA 2E6LA 4AILC 1JCFA 1GLFO 3OYLA 3NMUA 5DM6L 4NCBA 3D2FA 4Y0WA 3KLFA 2WTUA 4IDHA 3WEEA 5TKWA 3AA5X 3F9KA 4HHTA 3VA0A 3FLCO 3OW2M 4BR2A 3K5NA 2G8HA 1SQKA 4CFDA 2NUBA 4PL7A 2VG7A 3THWA 4NB4A 2UYTA 3PX0A 4NYNA 1J54A 4KREA 1RT1A 2NRZA 3MECA 3S41A 1JLCA 3QERA 4N47A 1S1TA 3NAEA 1JLEA 1OH8A 3AO5A 1NGHA 4K43A 4OVLA 3D45A 4NLBA 1VQMN 3A8YA 3BF3A 3HXMA 4FJGA 3CFOA 3CD6N 3LDNA 2P9KA 3NDKA 3GBTA 2HHHK 1NMNA 1YF5L 3FFIA 3KD1E 2YKNA 4FLZA 3L0QA 4J2BA 1Z6RA 4RTFD 5LY3A 5AZIB 3MDQA 4NXNK 5CY4A 1V4TA 3GL1A 4Y1CA 1OH5A 2IVPA 1R0AA 5BRHA 4FLTA 4DU4A 4CEQA 1WAJA 1G99A 3SMPA 5HROA 1BCMA 4FXDA 4AHVA 4H5VA 3THXA 2JWKA 3CC4N 2HBKA 3C6AA 4BRPA 2ZJPL 1XHZA 3KLHA 4NYFA 3JAMO 2YHYA 2HMPA 4B08A 2CGLA 3EE8A 5JS1A 3KK1A 2O8BB 2VCPA 2WFBA 4CK2A 1RT2A 4QOZB 3OY9A 3QEXA 1LWEA 2EWSA 5DM7L 1CXQA 3FR0A 3W3DA 1SL0A 4E7IA 1JJ2M 3SAFA 1UOCA 4HUFA 1DKGD 2Q31A 2Q1NA 4Q0BA 5C24A 2QM1A 1Y64A 2VG5A 1TUYA 2OPQA 1KLNA 4H0PA 2O8EB 3A5MC 1RT3A 4FWNA 3M8SA 4FVUA 3O6WA 2F4VK 1M90O 3WXMB 5ELZA 4MLEA 1W97L 4BRHA 3D2FB 2GTDA 3AV9A 2NRRA 4YDUA 3WEEB 4DTPA 1JL1A 2RF2A 3CM6A 2KHOA 2GV9A 1C0TA 1S1UA 3CJCA 1TKDA 3P83D 4JI0K 3THWB 1YHQN 2XO7A 4IXCA 1S5JA 3O3HA 4M45A 4I9LA 3ZETB 4DV6K 3AVFA 4FJ8A 4BC3A 3OYNA 2CGJA 1W9HA 2QA4N 3LP1A 4LH5A 1VSHA 4JK7A 5MLCQ 4KHNA 1GLCG 1QVGM 3UKUA 4H0XB 4FW1A 2O8CA 1MU2A 2P9KB 2E20A 5GAHP 3CCRN 3R3LA 5AQNA 3NF7A 2OTJN 4L8RB 1RTHA 3VQ7A 3I0SA 2G8VA 1YUWA 3G0ZA 5CR4A 1TYQB 4E0DA 3I56N 4BY9C 4M3TA 1NJZA 3CQYA 3ZT2A 4FJMA 4GKJK 3IS9A 1DGKN 1LWCA 4KV8A 4DFMA 1BI4A 3SBTA 3HSTB 1JLFA 2ITMA 1B9DA 1S22A 5AQYA 1T6DA 3C6TA 1YTUA 3NF6A 2YI1A 1B92A 1OH6A 4BVPA 2I5JA 4FM1A 4MO5A 1JXEA 1X9SA 2Q36A 1BL3A 3QEVA 3I33A 1BQMA 1Z05A 1QS4A 1TK0A 4QS7A 3LALA 4CJSA 3ZSZA 2A1RA 4XH5A 4DV4K 1HNIA 2IIRA 5KQ8A 3NH2A 1NJWA 4CBUA 3MWTA 3HRGA 3T19A 3AO1A 3ULEA 3HI0A 4MQ3A 1S6PA 1JL2A 3JYTA 2Q0RA 3TTFA 1KFDA 1BA0A 4BG9A 1JLBA 3UB5A 4DKWA 4Z4CA 2IAJA 4C8MA 3VF6A 4BROA 3E01A 4H0TB 3RTVA 5C12A 4TSXA 4CEBA 1QZ5A 1JKHA 4H03B 3UKRA 3FGUA 1NGAA 3CQXA 3DOKA 1NGIA 1RDUA 3P38A 3J7ZO 1WNSA 1NBWA 4MLHA 4FYDA 3KWIA 3PO4A 5KGXA 3UKUB 2GUPA 2HW3A 3OYHA 1SUQA 2GBZA 2P9PA 3FZFA 1NK0A 3HPOA 3BZKA 4BR9A 5M1OA 1EXQA 5DK5A 4CD3A 2G8KA 4N76A 1Q7YO 2GEMA 3CHWA 3THVA 2HF4A 4CW7B 1RTJA 4F9OA 1L5UA 1DEJA 4X66K 1ZYQA 4BRFA 2UU9K 1KAZA 2DPNA 3KZBA 3OJSA 1NWKA 2ZWHA 4QS9A 4E1NA 4KKOA 1YJWN 3KWGA 1E3MA 5BN8A 2YHXA 2Z1JA 1BI4B 3DXMA 3WNEA 2LSNA 1EQYA 5FRMA 1Q9XA 4CZHA 4AHTA 2HHVA 4F3OA 1QSLA 3LANA 3VQ9A 3KK3A 3NBPA 4CHNA 4DG1A 3QFPA 5BRFA 1VK0A 2ZF5O 4FO0A 5M1KA 2O8FA 3LWLA 2IS3A 4EZ6A 4FWRA 4FLXA 2KTQA 5SZTA 1P90A 4BRQA 3CJ1A 2ASMA 3NE6A 4OGCA 4GV3A 3SMSA 3CIPA 4Z4IA 5T7BA 5M1FA 3VQ8A 4PKHA 4FK2A 3O9SA 2Q0UA 3A0IX 3P31A 1BQNA 3O80A 4HUGA 5GAEP 4CJ7A 1BOTO 3RRHA 1HYSA 4XH4A 4CK3A 5JS2A 4N41A 3V1QA 1RDWX 4FLYA 4BC4A 5AZJA 3T69A 1QQOA 3VQPA 2E8AA 3QIOA 2QK9A 4LC9B 4CF0A 4JI5K 1VRTA 1VQKN 3PX4A 5GIPA 4DTMA 3TU5A 2XY5A 3G10A 3HSCA 1NK8A 1IKYA 1HJOA 2P9LB 2HMIA 2Z1GA 2HOEA 4XIUA 2QKBA 1WAFA 2IDOA 4I9QA 4CHZA 1NK6A 3MCPA 2P9PB 3F5TA 5AFUH 4JN4A 5AQWA 3DLHA 5GIOA 3KKSA 3ZX2A 1BCOA 3AVHA 3TSPA 5BN9A 2QEXN 4DFJA 1NGEA 4KH4A 4B3SK 1YTAA 3Q7CA 4LFBK 3G4SN 5E26A 4YOWA 4JI4K 1S9GA 4CJRA 3HM9A 3L2VA 5HRSA 2IGIA 2FBVA 4JKGA 5AQLA 4CEAA 4ELVA 2QWMA 1GOBA 2F96A 4LF9K 2YJFA 1GLJO 3MX5A 3L2RA 4KPYA 4E7LA 2YHBA 3OBWA 2D0BA 4CGGA 1WSEA 4DUYK 4JKCA 4OPHA 3DXMB 5GINA 4B1YB 3JXUA 4FL9A 4UQGA 4X64K 2GWKA 1NGDA 3VPZA 3JS6A 1HQUA 1U6ZA 3VEVA 1QHTA 4M41A 4PWDA 2WONA 1ZBUA 3SPYA 2HSTA 2X6SA 3IG1A 3RMCA 4HTLA 3SYZA 3MX2A 4FJLA 2ASPA 4GV6A 3V4IA 2QWRA 4W5QA 3MN7A 3QIPA 5C0YA 1XMOK 1RBRA 5LJWA 1NOZA 5AQIA 4B1WB 1FK9A 3O08A 5AQQA 4DR6K 4FWQA 3ASMA 5EX5A 4CGJA 5AQVA 5C15A 4HCBA 4K0KK 2OPRA 4H0YB 4BGBA 2NLXA 4CECA 1WLJA 3ZSXA 1ZBLA 4ICLA 2E1ZA 3PSFA 3S9HA 2A6AA 3AGRA 4BRMA 4CGFA 4PHTX 4Z0UA 2AP1A 1Q82O 5AZJB 1REVA 3ZSQA 3DLLL 2BUPA 3RR8A 1IJJA 4CI6A 1HJRA 3FE1A 3U9DA 4DFPA 4RW7A 4DTRA 2FF3B 5C2DA 1XWLA 3DRSA 3K5OA 4DTJA 3EE9A 2IVNA 4CF2A 4JRPA 4QCLA 2HBMA 5E84A 4JKBA 3I0RA 1L3VA 4KHYA 2IC3A 4BG8A 3K58A 1FKPA 4AHSA 5C42A 3TTCA 3WNHA 2F9TA 4JKGB 1IH7A 3O4NA 4OLBA 3U4LA 4YOVA 4DV0K 2EHGA 1O1WA 1QZ6A 1SKSA 4WQ5A 1HQEA 2YJEA 1XNRK 1U4BA 4IDKA 4CHQA 2DFFA 2FXUA 4JKFA 3K59A 3VQCA 1HKGA 5CYMA 1XUPO 1JCEA 4FJHA 3AO3A 4BE2A 4DFKA 3LZJA 1U47A 2X6NA 1K8AO 4FVMA 1NKCA 2UXBK 5JVHL 4DU3A 4M3ZA 4M7YA 5CHIA 4IFEA 3ZT3A 1W7AA 2AJQA 2HNYA 1Q8IA 3QBWA 4M63C 4JI2K 1IG9A 1QSYA 3CFPA 4ISFA 1RTIA 3ZEUA 5HOOA 3D0PA 1QSSA 1C1CA 1SL1A 1KC8O 3F73A 1MWKA 1C0FA 3KKRA 1S72N 4FLVA 1FXXA 2Q3SA 3NH1A 4FJ9A 3VF2A 1L3UA 3QLHA 2FBYA 3U6FA 4BC2A 3SV3A 1BWFO 4BR4A 4KTQA 1XMQK 4CZFA 1NJYA 3L2QA 4CEFA 3EY1A 4M3UA 1IBMK 1HMVA 4WYBA 3CJ9A 2QWQA 3V9UA 4EZ9A 5ADXA 3AVAA 3ALYA 2FBXA 1V4SA 4FJ7A 1SZ2A 3EKUA 4O5FA 2D0OA 4DV2K 4DQQA 2DY4A 3ZETA 2VWJA 4JNEA 4LF6K 1ASUA 1DLOA 4KH6A 4CIGA 2PYLA 4FWLA 4K8XA 4LSLA 4AM7A 1RGIA 4FWMA 3TAFA 3HM8A 3S3MA 3LAMA 3QEPA 2E1YA 2OYQA 4MDBA 2D0PA 3PIPL 4KHWA 1ZC6A 2OPSA 5KTQA 3P4IA 1VSKA 3DM2A 3H08A 4I6MA 4FWSA 4JEPA 1TVRA 1Q81O 4CZJA 4JI1K 1EO1A 3CJAA 3HP6A 2V7YA 2HVHA 2RHKA 2E88A 4BQZA 1H1VA 1LOTB 1TYQA 3HO1A 1TKTA 4JI3K 2KLAA 3PV8A 5CYQA 3WT0A 2HHTA 4X62K 2ASOA 1LAWA 5CZ1A 2ZE2A 3E9PA 4EIAA 2PFUA 2ZGYA 4HCCA 2F9WA 3ZT1A 4I2QA 5HRRA 3VQDA 3UE5A 1XC9A 3R6MA 5AQXA 3ZCMA 3OHRA 3JSMA 1HPMA 1TL1A 4IG0A 1NK7A 5C2FA 3HVRA 1IV0A 3ZEUB 4DCHA 3CCEN 4FPAA 1GOAA 4IZ9A 3EYZA 3IKMA 1NMDA 1C0MA 4DR7K 1QQNA 4BE1A 4FJKA 1XI1A 5KPRA 1M1KO 3RRGA 3PIOL 4MDAA 5FPDA 3WXKA 1U04A 4K8ZA 3QNOA 4GKKK 4RW8A 3VTHA 1BG3A 1VSJA 3RWUA 2WUSA 3PUFA 3H45C 4F4KA 1NK4A 4CGHA 5D3GA 4GY2B 3LDOA 3WXLA 3A5LC 4BREA 4U7BA 2ATQA 3VEOA 4DSKA 1RT4A 4FZXC 4M42A 4RWTA 1HUXA 2FC0A 3AY9A 3O4WA 2ZM6K 2PAVA 1QQMA 5BPLA 3TSQA 1KLMA 4FWKA 5AJ3K 3V9ZA 3QBXA 5AQRA 4CJ4A 4E1JA 4E19A 2YNIA 5AQGA 3OYMA 3V81A 2W42A 1RDCA 4FSVA 3VENA 3ENOA 1SKRA 4PKGA 1TK8A 5JLHA 4I6MB 3OYEA 3OYKA 3DWLA 2OCEA 1NNEA 5K14A 2HHQA 2YHWA 4C8LA 3DJCA 4DV1K 3CERA 2NRTA 4AM6A 3K57A 3BUZB 2ZD1A 1TKZA 4GMJB 1RNHA 3OS1A 4C1NK 4CJUA 2BANA 3SAHA 1HYVA 1EETA 1NGJA 1TAUA 3VERA 4CJ5A 4OJRA 4JAXA 5DMRA 4DV3K 4DSLA 4IO8A 1O13A 4JKEA 3SCXA 4BRLA 3BZCA 1HYZA 4LF7K 3K5LA 2KQ2A 3HYFA 5LL6Z 3ISNC 4DR1K 1X1PA 4BRCA 3MEDA 2A41A 1RDDA 2A40A 2D0AA 3VGMA 3AVBA 1VSEA 1VRUA 4BQLA 3VQAA 4E89A 4IFVA 2A42A 4H5RA 3O1WA 5FDLA 1U2VA 3AAQA 3VGKA 2W40A 4DQSA 3BGRA 3QNNA 3QETA 2A1SA 3HJFA 1SAZA 3EO3A 4JKDA 4BR0A 3J7YP 1LCUA 3W0LA 3CFRA 5AR0A 5JVGL 2I7NA 1QHAA 2E4LA 4CJQA 4ELUA 4OLAA 1OVYA 1TUUA 2BGGA 4IEIA 3V6DA 2XY6A 4H5NA 4CBXA 4CJEA 2HF3A 4CZEA 4E1MA 3F9MA 4JK8A 1A5VA 4C8KA 5M1PA 1WBDA 3H3OB 3M5RA 3TAPA 3WXJA 3NVMA 2QXFA 3VEZA 2YNHA 3P1GA 4W5TA 2OZMA 1RBTA 2X74A 4CGIA 4Z94A 1ATSA 3U9ZA 2P9LA 2QI2A 2J4RA 2X78A 3HOTA 3B6OA 5AQFA 1B9FA 2HHWA 3MK6A 3C0BA 3OS0A 5AFUA 3FZKA 3R9PA 3NF8A 2FSJA 3TANA 2H3GX 1D8YA 4O4GA 3CCJN 4B9QA 4IBNA 2P9NA 4CZGA 1EWRA 2CGKA 3ZX0A 4CZIA 1EP4A 4FJXA 3NGZA 4CZLA 2B6AA 5JICA 3DXKB 4IWVA 3KD5E 3CCSN 3CCMN 2F7TA 3L2WA 1VQNN 1RFQA 3MCAB 4QAGA 1YITN 1ITGA 3OTOK 3N4PA 1IKWA 1C1AA 1CZBA 3AVKA 3CJ7A 3OYCA 1FJGK 4DR4K 5AQTA 4CVNE 1NKEA 1XNQK 3NF9A 1L3TA 3IAYA 3S3NA 1NOYA 2HNDA 1QTMA 3CMAN 4C1NI 1LWFA 3FZMA 3NHGA 4DMNA 3VEWA 4KBOA 4A2AA 3AVJA 2Q2RA 3H46O 4IJAA 4CJPA 2NRVA 3OVNA 3ENHA 4KH5A 1VHXA 4MFBA 1U2VB 4R79A 3SUNA 2FSNA 4YDUC 3QB0A 4W5NA 4YY3K 4M3YA 4G1QA 4DQRA 3CXCM 3IUCA 3VQ6A 3O3GA 4CJ3A 1FW6A 2XY7A 2O8DB 1YVUA 1I39A 2VWKA 2P5GA 4CBWA 3V9WA 4CIEA 2NRWA 3R8EA 2DFHA 3L4IA 2QXLA 4O55A 2KFNA 3EKSA 3SI6A 2WBNA 4PY5A 2E2OA 5BPMA 3LP3A 4CEEA 2FLOA 3N4QA 2EX3A 4NCAA 2KZZA 4M3RA 1C0UA 4LD0A 5FLXO 1GLLO 1SS6A 4ILGB 4KRFA 4AHRA 3J7AP 1ATRA 2XRIA 5IWAK 4A5BA 4O0IA 5BR9A 2HBJA 3RSEA 4DHYA 3LPUA 3K5MA 2ITGA 2HVIA 4FK4A 3VETA 1T7PA 4WQ4A 4LH4A 4FW2A 4YOYA 2QWPA 2E2PA 3D2EA 4IOCL 1TV6A 2P9NB 1X3MA 1YT3A 2CH5A 3OYFA 1A5WA 2KKZA 2CH6A 1S3XA 4FPBA 3OYDA 4FJ5A 3AVLA 4FWOA 4RW6A 4W5OA 3AO4A 4AQYK 3P5JA 3PX6A 5F0XA 3NFAA 5AQUA 3TPQA 1J53A 1HNZK 1E4GT 1DTTA 1MDUB 3MXJA 4JD2A 5AQJA 3J80O 2P1JA 5C25A 2R7YA 1ZBSA 2P51A 1LV5A 1U49A 4B9VA 3L4QA 4O8UA 1ZBHA 4FCYA 4PQUA 4EHTA 3HT3A 4CJWA 3OYJA 2F8SA 4DTXA 4BRAA 2HHSA 3LDQA 4JV5K 4DTSA 5KQDA 3CC2N 5I9EB 1KAXA 4Y1DA 4J2EA 4OGEA 4F2SA 1HPZA 2KZMA 4FLWA 1EWQA 1TAQA 4JI8K 3CPWM 3O1BA 1IKVA 4Z4EA 1IBLK 1F21A 3M3ZA 4OPAA 1N6QA 1U45A 4DWIA 4B8CA
chains in the Genus database with same CATH topology
3AVAA 3ALYA 1D9FA 1JLGA 4DQIA 2FBXA 3HVTA 3M8QA 4FJ7A 4F3TA 5I3UA 3NF7A 3VQ5A 2G8IA 1SKWA 4L8RB 1RTHA 4DQQA 2DY4A 4ELTA 3VQ7A 2YKMA 1ZBFA 2VWJA 3V1OA 3I0SA 1KSPA 1WSGA 4IKFA 4CEOA 2G8VA 3AVMA 1ASUA 1DLOA 1J9AA 2BE2A 4CIGA 3G0ZA 2PYLA 5KI6A 4K8XA 4LSLA 2OA8A 4CF8A 1CLQA 4DF4A 4H8KA 1X9WA 4E0DA 3TAFA 1UA0A 3ZSWA 3B6PA 3AVNA 1FKOA 4CHYA 1NJZA 4M3TA 4B3OA 1VSDA 3ZT2A 3S3MA 4FJMA 3LAMA 3QEPA 3IS9A 5I42A 2OYQA 5HP1A 3QEWA 4DLGA 3RMBA 4KHWA 5KTQA 2OPSA 2Y1JA 5SWMA 1L3SA 1LWCA 1VSKA 3DM2A 3H08A 4KV8A 4DFMA 4DTOA 1TVRA 1KVBA 3ITHA 3KLGA 1ZBIA 4YNQA 1BI4A 1KTQA 3HP6A 3HSTB 4DTUA 1JLFA 3RR7A 1B9DA 4KHUA 3U3YA 2HVHA 1UAXA 4JS4A 4ID1A 4IG3A 3I8DA 3T1AA 3OYIA 4DTNA 3C6TA 1YTUA 2G8FA 4OKEA 3NF6A 5J2NA 3HO1A 1B92A 4CJTA 3SQ2A 1TKTA 2I5JA 4LY7A 2B4JA 4BWJA 4FM1A 3PV8A 1JXEA 4PA1A 5CYQA 1X9SA 2HHTA 3LAKA 3ZSOA 1UWBA 1BL3A 3HP9A 3QEVA 1LAWA 3OYBA 1BQMA 5CZ1A 1NK5A 1QS4A 2ZE2A 1TK0A 1TGOA 3LALA 4CJSA 3ZSZA 2A1RA 4RG8A 3HL8A 4HCCA 2DTUA 4OKKA 1HNIA 3ZT1A 4CHOA 5HBMA 4DS4A 4BE0A 3NH2A 1NJWA 3PY8A 4KTZA 4I2QA 5HRRA 3VQDA 1XC9A 1ASVA 5EU7A 4CCHA 3ZCMA 3SQ4A 3LPTA 3T19A 3JSMA 3TAQA 1TL1A 3AO1A 3KLEA 4IG0A 5FRNA 4E3SA 1NK7A 4MQ3A 1S6PA 3HVRA 1JL2A 3JYTA 1CZ9A 1GOAA 3M8RA 1BHLA 1KFDA 3AO2A 3EYZA 3AVIA 5KGWA 1WSHA 1JLBA 1DTQA 4HVJA 1C0MA 1JLQA 2YNGA 4BE1A 4Z4CA 4FJKA 3SZ2A 1XI1A 2IAJA 4C8MA 4ZTFA 4KI4A 2HHWA 3E01A 3RRGA 4M3XA 3RTVA 2Z1HA 3OYGA 1U04A 4TSXA 4EZ9A 2ETJA 4CEBA 4C8NA 4K8ZA 1JKHA 3QNOA 4Z4FA 4RW8A 2WOMA 3TI0A 3HK2A 4B9NA 1VSJA 3RWUA 1RILA 2B5JA 1Y97A 3DOKA 1RT5A 4CHPA 4HUEA 4FK0A 4BACA 3PUFA 1WNSA 4I2PA 1NKBA 3SUOA 4F4KA 4FYDA 4DSEA 4CGHA 1NK4A 5KGXA 3PO4A 5D3GA 2HW3A 2D5RA 4AHCA 3OYHA 1SUQA 4FLUA 3RMDA 3RMAA 2GBZA 4DLEA 1VSMA 4B8AB 1NK9A 1NK0A 4GW6A 2ATQA 4FJNA 3HPOA 1KCFA 3SV4A 1RT4A 4CEDA 4DSJA 4DSKA 4FZXC 4M42A 3UIQA 1EXQA 3V9XA 5DK5A 4EP5A 2F8TA 2FC0A 2G8KA 4N76A 4CFAA 1S6QA 1KLMA 4BDPA 3DLEA 3V9ZA 3THVA 1RBUA 4FJJA 3NGIA 4CJ4A 1RTJA 4E19A 1RDAA 1L5UA 3ZSYA 2YNIA 3OYMA 3V81A 2W42A 1RDCA 1LW0A 1ZYQA 4N5SA 4FZYA 4J2AA 3OJSA 1IO2A 4ZHRA 1EKEA 1SKRA 3L8BA 3CM5A 4E1NA 1T03A 4KKOA 4CIFA 1TK8A 4B9TA 4KI6A 3OYEA 3OYKA 3L3VA 5E41A 2Z1JA 1BI4B 3TAEA 4CF1A 3WNEA 2LSNA 3IRXA 2IOCA 1VSIA 4CK1A 1U48A 3DYAA 5FRMA 5K14A 3TR8A 1Q9XA 2HHQA 4C8LA 4AHTA 4JRQA 2HHXA 1WSJA 4F3OA 2HHVA 1QSLA 1RBSA 3LANA 1W0HA 3VQ9A 3OJUA 3K57A 3QEIA 4J2DA 1LW2A 3KK3A 3NBPA 4KB1A 2ZD1A 1RBVA 1TKZA 4GMJB 4CHNA 1RNHA 4RW9A 3OS1A 4CJUA 4DG1A 2OZSA 4M3WA 2BANA 1WSFA 1IKXA 3DOLA 1HYVA 4IFYA 1EETA 1VK0A 1TAUA 2YNFA 1TK5A 4H4OA 4CJ5A 5J1EA 4OJRA 4E7HA 5DMRA 2IS3A 3LWLA 1Q9YA 4EZ6A 4FLXA 4DSLA 2KTQA 1A5XA 5SZTA 1T8EA 3C94A 3WNFA 3NE6A 4OGCA 2ZQBA 3LZIA 3ZSVA 3SCXA 2O4IA 4FJIA 3VN5A 3U3GA 4LSNA 1BIZA 5J2QA 1HYZA 4CF9A 1LAVA 2KQ2A 4CGDA 3HYFA 3K5LA 4B9UA 5T7BA 4R5PA 2P5OA 4Z4IA 2G8UA 3VQ8A 3ISNC 4FK2A 1X1PA 4BWMA 3LP0A 3O4QA 1BQNA 1TKXA 3QESA 2RPIA 3MEDA 4HUGA 4Z4HA 1RDDA 4CFCA 3RRHA 1HYSA 1VSFA 5HRPA 2D0AA 3L3UA 3AVBA 4O44A 1VSEA 3WNGA 1VRUA 5JS2A 4CK3A 4N41A 3V1QA 3VQAA 4E89A 4IFVA 1C1BA 5FDLA 4KO0A 4FLYA 3LWMA 3SNNA 5CZ2A 2KFZA 3VQPA 2JGUA 3QIOA 2OPPA 1J5OA 2PY5A 4DQSA 1HNVA 3BGRA 4CJLA 2YV0X 3QNNA 3DLBA 4PUOA 3QETA 2QK9A 4CF0A 2A1SA 3HJFA 1VRTA 3PX4A 3TWHA 3KLIA 4DTMA 3CFRA 4DSFA 3HPHA 4NCGA 2XY5A 3G10A 3LP2A 2E4LA 4CJQA 2Y1IA 1NK8A 1IKYA 4ELUA 4OLAA 3L2UA 4N56A 2HMIA 2Z1GA 1BISA 4XIUA 2QKBA 2BGGA 3V6DA 2XY6A 1WAFA 2IDOA 4I9QA 4CHZA 2GUIA 4BDZA 1NK6A 2PYJA 1UA1A 4CJEA 3S3OA 3SPZA 2FBTA 3TAMA 4E1MA 2D0CA 3SUQA 4CEZA 3DLHA 4B9SA 3KKSA 1A5VA 4C8KA 3KTQA 1BCOA 3AVHA 3VQEA 3TAPA 2KW4A 4DFJA 3EZ5A 1YTAA 3NGYA 2QXFA 3KJVA 1S1VA 2RKIA 4E7JA 4OPJA 1HRHA 2HNZA 2YNHA 3P1GA 4W5TA 1TL3A 4DS5A 3AVGA 2OZMA 1BGXT 1RBTA 1S9GA 1JXBA 2X74A 4CGIA 4E7KA 4CJRA 3HM9A 4RW4A 3L2VA 5HRSA 4W5RA 2IGIA 2FBVA 2O4GA 2E6MA 3C95A 4CEAA 4ELVA 1GOBA 2F96A 2X78A 1JLAA 3B6OA 4WE1A 2HB5A 1B9FA 3VQQA 5J2MA 3HPGA 1N5YA 3L2RA 4B9LA 1RT7A 4KPYA 1ASWA 1QE1A 2DFEA 1Z25A 3C6UA 3OS0A 3KK2A 4E7LA 2YHBA 4ZTJA 4DQPA 1Z26A 3KIOA 3NH0A 2D0BA 3NF8A 1WN7A 3SJJA 4CGGA 1WSEA 3NCIA 3TANA 1D8YA 4O4GA 3BDPA 4IBNA 4ID5A 3OS2A 3SQ0A 4CESA 3TABA 2RN2A 4UQGA 1T05A 1KVAA 4F2RA 1EP4A 1C6VA 4FJXA 4KFBA 2HHUA 3NGZA 1HQUA 4JS5A 2B6AA 1S9EA 1QHTA 4KB0A 4M41A 3DI6A 1X9MA 2WONA 1ZBUA 4JLHA 3SPYA 3CG7A 4F8RA 4PWDA 3ZT0A 4FM0A 3KD5E 3L2WA 3A2FA 1D9DA 2X6SA 1VSLA 3IG1A 4QAGA 3VQBA 3TAGA 3RMCA 3SYZA 1SL2A 3M8PA 4FJLA 2G8WA 1BIUA 2Z1IA 3V4IA 3ZT4A 4OPKA 1ITGA 4W5QA 1CXUA 3QIPA 1IKWA 1C1AA 1CZBA 3ULDA 3AVKA 3OYCA 2E6LA 1RBRA 4AILC 3OYLA 1NOZA 4NCBA 1FK9A 3AA2A 3KLFA 3V9SA 1NKEA 4DSIA 3NF9A 1L3TA 5KRSA 1RT6A 3IAYA 4FM2A 3S3NA 1NOYA 2HNDA 1GOCA 3ASMA 1QTMA 4CGJA 3AA5X 3F9KA 3K2PA 4HHTA 3DLGA 1LWFA 3VA0A 2OPRA 4HCBA 4Q5VA 3NHGA 3MXIA 3K5NA 3DRPA 4CECA 4DMNA 4EP4A 3OYAA 4CFDA 1KFSA 1WLJA 2G8HA 3ZSXA 1ZBLA 4ICLA 2NUBA 3S9HA 3AVJA 2VG7A 4Z4GA 5KRTA 4CJPA 3PX0A 4KAZA 4NYNA 2XHBA 1J54A 4CGFA 4KREA 3OVNA 1RT1A 4Z0UA 3V1RA 3MECA 1D5AA 1JLCA 3QERA 4MFBA 3CQ8A 4N47A 3SUNA 1REVA 1S1TA 1XHXA 3ZSQA 1JLEA 3NAEA 3AO5A 3RR8A 1HJRA 4W5NA 4OVLA 4M3YA 3D45A 4G1QA 4DQRA 4KHSA 3VQ6A 3HXMA 4FJGA 3O3GA 4DFPA 3AVCA 3CFOA 4CJ3A 4DU1A 2XY7A 1YVUA 1I39A 3NDKA 2VWKA 4RW7A 2P5GA 3FFIA 4DTRA 3V9WA 5J2PA 3KD1E 2YKNA 4CIEA 4CERA 4FLZA 1XWLA 3DRSA 4J2BA 3K5OA 2DFHA 1I3AA 4DTJA 4C8OA 5CY4A 4O55A 4CF2A 4Y1CA 4JRPA 4QCLA 2KFNA 3MEEA 4GVMA 3VA3A 1R0AA 3SI6A 4FLTA 4PY5A 4DU4A 1SV5A 3MAQA 3LP3A 3I0RA 1L3VA 4CEQA 4KHYA 1WAJA 4CEEA 2IC3A 1NJXA 5HROA 2EX3A 1FKPA 1BCMA 3K58A 4NCAA 2KZZA 4M3RA 1C0UA 1WSIA 4LD0A 4FXDA 4BDYA 4AHSA 3SQ1A 2VG6A 4AHVA 4KRFA 5C42A 4AHRA 3DLKA 2XRIA 4I7FA 3WNHA 1IH7A 4O0IA 3O4NA 4OLBA 3LPUA 3K5MA 1XHZA 2QKKA 3KLHA 2ITGA 2YHAA 4NYFA 1T7PA 4FK4A 2HVIA 3QO9A 2EHGA 4FW2A 1O1WA 4LH4A 1SKSA 4FZZA 1RCHA 4B08A 4B9MA 1HQEA 4OKJA 4CE9A 5JS1A 4CJFA 3KK1A 3AA4A 3MXMA 4O5BA 1U4BA 2BDPA 4IDKA 1TV6A 2DFFA 4CK2A 4CHQA 4YFUA 3ZSRA 1YT3A 3DRRA 1RT2A 3CYMA 3K59A 2PZSA 3OY9A 3OYFA 1A5WA 4QOZB 3VQCA 3QEXA 1LWEA 3VQ4A 3OYDA 5CYMA 4FJ5A 3AVLA 1CXQA 3DMJA 4RW6A 4W5OA 3LDSA 3AO3A 1SL0A 4FJHA 4BE2A 4E7IA 3AO4A 3LZJA 1UOCA 4HUFA 4DFKA 1U47A 2X6NA 4Q0BA 3P5JA 3PX6A 4FVMA 1NKCA 4KHQA 1S1WA 3NFAA 1QQCA 5C24A 4M3ZA 4DU3A 1J53A 4KTWA 1KRPA 1DTTA 3ZT3A 3TARA 2AJQA 2VG5A 2OPQA 1KLNA 3MXJA 2HNYA 1RT3A 1Q8IA 5HLFA 3M8SA 4CJVA 1RDBA 3AA3A 5HRNA 1IG9A 2P1JA 5C25A 1QSYA 3CFPA 2R7YA 1EX4A 1RTIA 2P51A 3SUPA 1LV5A 3D0PA 1U49A 1QSSA 1C1CA 3QINA 1SL1A 1K6YA 3AV9A 4B9VA 3F73A 4DTPA 1JL1A 1ZBHA 2RF2A 3CM6A 3KKRA 4FCYA 4PQUA 2GV9A 3MEGA 1C0TA 4O0JA 1FXXA 2Q3SA 3HT3A 4FLVA 4CJWA 4AHUA 3OYJA 3NH1A 3DLRA 4FJ9A 1S1UA 2F8SA 4DTXA 1TKDA 1L3UA 2HHSA 1G15A 3P83D 3QLHA 2FBYA 2XY8A 4DTSA 3U6FA 2XO7A 3SV3A 4HTUA 1S5JA 3O3FA 4KTQA 4Y1DA 4J2EA 4CFBA 4M45A 4I9LA 3O3HA 4DF8A 1RTDA 2JLEA 1NJYA 3AVFA 3PO5A 3L2QA 4FJ8A 4OGEA 3OYNA 4CEFA 1W9HA 4F2SA 1HPZA 3LP1A 4LH5A 3EY1A 2KZMA 1VSHA 4FLWA 4KHNA 1TAQA 1S1XA 1IKVA 3T3FA 4AH9A 4M3UA 4Z4EA 1HMVA 4CJKA 1F21A 4H4MA 4FW1A 1KVCA 1N6QA 1MU2A 1U45A 4DWIA 3V9UA 4B8CA 5FROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVA A;  3ALY A;  1D9F A;  1JLG A;  4DQI A;  2FBX A;  3HVT A;  3M8Q A;  4FJ7 A;  4F3T A;  5I3U A;  3NF7 A;  3VQ5 A;  2G8I A;  1SKW A;  4L8R B;  1RTH A;  4DQQ A;  2DY4 A;  4ELT A;  3VQ7 A;  2YKM A;  1ZBF A;  2VWJ A;  3V1O A;  3I0S A;  1KSP A;  1WSG A;  4IKF A;  4CEO A;  2G8V A;  3AVM A;  1ASU A;  1DLO A;  1J9A A;  2BE2 A;  4CIG A;  3G0Z A;  2PYL A;  5KI6 A;  4K8X A;  4LSL A;  2OA8 A;  4CF8 A;  1CLQ A;  4DF4 A;  4H8K A;  1X9W A;  4E0D A;  3TAF A;  1UA0 A;  3ZSW A;  3B6P A;  3AVN A;  1FKO A;  4CHY A;  1NJZ A;  4M3T A;  4B3O A;  1VSD A;  3ZT2 A;  3S3M A;  4FJM A;  3LAM A;  3QEP A;  3IS9 A;  5I42 A;  2OYQ A;  5HP1 A;  3QEW A;  4DLG A;  3RMB A;  4KHW A;  5KTQ A;  2OPS A;  2Y1J A;  5SWM A;  1L3S A;  1LWC A;  1VSK A;  3DM2 A;  3H08 A;  4KV8 A;  4DFM A;  4DTO A;  1TVR A;  1KVB A;  3ITH A;  3KLG A;  1ZBI A;  4YNQ A;  1BI4 A;  1KTQ A;  3HP6 A;  3HST B;  4DTU A;  1JLF A;  3RR7 A;  1B9D A;  4KHU A;  3U3Y A;  2HVH A;  1UAX A;  4JS4 A;  4ID1 A;  4IG3 A;  3I8D A;  3T1A A;  3OYI A;  4DTN A;  3C6T A;  1YTU A;  2G8F A;  4OKE A;  3NF6 A;  5J2N A;  3HO1 A;  1B92 A;  4CJT A;  3SQ2 A;  1TKT A;  2I5J A;  4LY7 A;  2B4J A;  4BWJ A;  4FM1 A;  3PV8 A;  1JXE A;  4PA1 A;  5CYQ A;  1X9S A;  2HHT A;  3LAK A;  3ZSO A;  1UWB A;  1BL3 A;  3HP9 A;  3QEV A;  1LAW A;  3OYB A;  1BQM A;  5CZ1 A;  1NK5 A;  1QS4 A;  2ZE2 A;  1TK0 A;  1TGO A;  3LAL A;  4CJS A;  3ZSZ A;  2A1R A;  4RG8 A;  3HL8 A;  4HCC A;  2DTU A;  4OKK A;  1HNI A;  3ZT1 A;  4CHO A;  5HBM A;  4DS4 A;  4BE0 A;  3NH2 A;  1NJW A;  3PY8 A;  4KTZ A;  4I2Q A;  5HRR A;  3VQD A;  1XC9 A;  1ASV A;  5EU7 A;  4CCH A;  3ZCM A;  3SQ4 A;  3LPT A;  3T19 A;  3JSM A;  3TAQ A;  1TL1 A;  3AO1 A;  3KLE A;  4IG0 A;  5FRN A;  4E3S A;  1NK7 A;  4MQ3 A;  1S6P A;  3HVR A;  1JL2 A;  3JYT A;  1CZ9 A;  1GOA A;  3M8R A;  1BHL A;  1KFD A;  3AO2 A;  3EYZ A;  3AVI A;  5KGW A;  1WSH A;  1JLB A;  1DTQ A;  4HVJ A;  1C0M A;  1JLQ A;  2YNG A;  4BE1 A;  4Z4C A;  4FJK A;  3SZ2 A;  1XI1 A;  2IAJ A;  4C8M A;  4ZTF A;  4KI4 A;  2HHW A;  3E01 A;  3RRG A;  4M3X A;  3RTV A;  2Z1H A;  3OYG A;  1U04 A;  4TSX A;  4EZ9 A;  2ETJ A;  4CEB A;  4C8N A;  4K8Z A;  1JKH A;  3QNO A;  4Z4F A;  4RW8 A;  2WOM A;  3TI0 A;  3HK2 A;  4B9N A;  1VSJ A;  3RWU A;  1RIL A;  2B5J A;  1Y97 A;  3DOK A;  1RT5 A;  4CHP A;  4HUE A;  4FK0 A;  4BAC A;  3PUF A;  1WNS A;  4I2P A;  1NKB A;  3SUO A;  4F4K A;  4FYD A;  4DSE A;  4CGH A;  1NK4 A;  5KGX A;  3PO4 A;  5D3G A;  2HW3 A;  2D5R A;  4AHC A;  3OYH A;  1SUQ A;  4FLU A;  3RMD A;  3RMA A;  2GBZ A;  4DLE A;  1VSM A;  4B8A B;  1NK9 A;  1NK0 A;  4GW6 A;  2ATQ A;  4FJN A;  3HPO A;  1KCF A;  3SV4 A;  1RT4 A;  4CED A;  4DSJ A;  4DSK A;  4FZX C;  4M42 A;  3UIQ A;  1EXQ A;  3V9X A;  5DK5 A;  4EP5 A;  2F8T A;  2FC0 A;  2G8K A;  4N76 A;  4CFA A;  1S6Q A;  1KLM A;  4BDP A;  3DLE A;  3V9Z A;  3THV A;  1RBU A;  4FJJ A;  3NGI A;  4CJ4 A;  1RTJ A;  4E19 A;  1RDA A;  1L5U A;  3ZSY A;  2YNI A;  3OYM A;  3V81 A;  2W42 A;  1RDC A;  1LW0 A;  1ZYQ A;  4N5S A;  4FZY A;  4J2A A;  3OJS A;  1IO2 A;  4ZHR A;  1EKE A;  1SKR A;  3L8B A;  3CM5 A;  4E1N A;  1T03 A;  4KKO A;  4CIF A;  1TK8 A;  4B9T A;  4KI6 A;  3OYE A;  3OYK A;  3L3V A;  5E41 A;  2Z1J A;  1BI4 B;  3TAE A;  4CF1 A;  3WNE A;  2LSN A;  3IRX A;  2IOC A;  1VSI A;  4CK1 A;  1U48 A;  3DYA A;  5FRM A;  5K14 A;  3TR8 A;  1Q9X A;  2HHQ A;  4C8L A;  4AHT A;  4JRQ A;  2HHX A;  1WSJ A;  4F3O A;  2HHV A;  1QSL A;  1RBS A;  3LAN A;  1W0H A;  3VQ9 A;  3OJU A;  3K57 A;  3QEI A;  4J2D A;  1LW2 A;  3KK3 A;  3NBP A;  4KB1 A;  2ZD1 A;  1RBV A;  1TKZ A;  4GMJ B;  4CHN A;  1RNH A;  4RW9 A;  3OS1 A;  4CJU A;  4DG1 A;  2OZS A;  4M3W A;  2BAN A;  1WSF A;  1IKX A;  3DOL A;  1HYV A;  4IFY A;  1EET A;  1VK0 A;  1TAU A;  2YNF A;  1TK5 A;  4H4O A;  4CJ5 A;  5J1E A;  4OJR A;  4E7H A;  5DMR A;  2IS3 A;  3LWL A;  1Q9Y A;  4EZ6 A;  4FLX A;  4DSL A;  2KTQ A;  1A5X A;  5SZT A;  1T8E A;  3C94 A;  3WNF A;  3NE6 A;  4OGC A;  2ZQB A;  3LZI A;  3ZSV A;  3SCX A;  2O4I A;  4FJI A;  3VN5 A;  3U3G A;  4LSN A;  1BIZ A;  5J2Q A;  1HYZ A;  4CF9 A;  1LAV A;  2KQ2 A;  4CGD A;  3HYF A;  3K5L A;  4B9U A;  5T7B A;  4R5P A;  2P5O A;  4Z4I A;  2G8U A;  3VQ8 A;  3ISN C;  4FK2 A;  1X1P A;  4BWM A;  3LP0 A;  3O4Q A;  1BQN A;  1TKX A;  3QES A;  2RPI A;  3MED A;  4HUG A;  4Z4H A;  1RDD A;  4CFC A;  3RRH A;  1HYS A;  1VSF A;  5HRP A;  2D0A A;  3L3U A;  3AVB A;  4O44 A;  1VSE A;  3WNG A;  1VRU A;  5JS2 A;  4CK3 A;  4N41 A;  3V1Q A;  3VQA A;  4E89 A;  4IFV A;  1C1B A;  5FDL A;  4KO0 A;  4FLY A;  3LWM A;  3SNN A;  5CZ2 A;  2KFZ A;  3VQP A;  2JGU A;  3QIO A;  2OPP A;  1J5O A;  2PY5 A;  4DQS A;  1HNV A;  3BGR A;  4CJL A;  2YV0 X;  3QNN A;  3DLB A;  4PUO A;  3QET A;  2QK9 A;  4CF0 A;  2A1S A;  3HJF A;  1VRT A;  3PX4 A;  3TWH A;  3KLI A;  4DTM A;  3CFR A;  4DSF A;  3HPH A;  4NCG A;  2XY5 A;  3G10 A;  3LP2 A;  2E4L A;  4CJQ A;  2Y1I A;  1NK8 A;  1IKY A;  4ELU A;  4OLA A;  3L2U A;  4N56 A;  2HMI A;  2Z1G A;  1BIS A;  4XIU A;  2QKB A;  2BGG A;  3V6D A;  2XY6 A;  1WAF A;  2IDO A;  4I9Q A;  4CHZ A;  2GUI A;  4BDZ A;  1NK6 A;  2PYJ A;  1UA1 A;  4CJE A;  3S3O A;  3SPZ A;  2FBT A;  3TAM A;  4E1M A;  2D0C A;  3SUQ A;  4CEZ A;  3DLH A;  4B9S A;  3KKS A;  1A5V A;  4C8K A;  3KTQ A;  1BCO A;  3AVH A;  3VQE A;  3TAP A;  2KW4 A;  4DFJ A;  3EZ5 A;  1YTA A;  3NGY A;  2QXF A;  3KJV A;  1S1V A;  2RKI A;  4E7J A;  4OPJ A;  1HRH A;  2HNZ A;  2YNH A;  3P1G A;  4W5T A;  1TL3 A;  4DS5 A;  3AVG A;  2OZM A;  1BGX T;  1RBT A;  1S9G A;  1JXB A;  2X74 A;  4CGI A;  4E7K A;  4CJR A;  3HM9 A;  4RW4 A;  3L2V A;  5HRS A;  4W5R A;  2IGI A;  2FBV A;  2O4G A;  2E6M A;  3C95 A;  4CEA A;  4ELV A;  1GOB A;  2F96 A;  2X78 A;  1JLA A;  3B6O A;  4WE1 A;  2HB5 A;  1B9F A;  3VQQ A;  5J2M A;  3HPG A;  1N5Y A;  3L2R A;  4B9L A;  1RT7 A;  4KPY A;  1ASW A;  1QE1 A;  2DFE A;  1Z25 A;  3C6U A;  3OS0 A;  3KK2 A;  4E7L A;  2YHB A;  4ZTJ A;  4DQP A;  1Z26 A;  3KIO A;  3NH0 A;  2D0B A;  3NF8 A;  1WN7 A;  3SJJ A;  4CGG A;  1WSE A;  3NCI A;  3TAN A;  1D8Y A;  4O4G A;  3BDP A;  4IBN A;  4ID5 A;  3OS2 A;  3SQ0 A;  4CES A;  3TAB A;  2RN2 A;  4UQG A;  1T05 A;  1KVA A;  4F2R A;  1EP4 A;  1C6V A;  4FJX A;  4KFB A;  2HHU A;  3NGZ A;  1HQU A;  4JS5 A;  2B6A A;  1S9E A;  1QHT A;  4KB0 A;  4M41 A;  3DI6 A;  1X9M A;  2WON A;  1ZBU A;  4JLH A;  3SPY A;  3CG7 A;  4F8R A;  4PWD A;  3ZT0 A;  4FM0 A;  3KD5 E;  3L2W A;  3A2F A;  1D9D A;  2X6S A;  1VSL A;  3IG1 A;  4QAG A;  3VQB A;  3TAG A;  3RMC A;  3SYZ A;  1SL2 A;  3M8P A;  4FJL A;  2G8W A;  1BIU A;  2Z1I A;  3V4I A;  3ZT4 A;  4OPK A;  1ITG A;  4W5Q A;  1CXU A;  3QIP A;  1IKW A;  1C1A A;  1CZB A;  3ULD A;  3AVK A;  3OYC A;  2E6L A;  1RBR A;  4AIL C;  3OYL A;  1NOZ A;  4NCB A;  1FK9 A;  3AA2 A;  3KLF A;  3V9S A;  1NKE A;  4DSI A;  3NF9 A;  1L3T A;  5KRS A;  1RT6 A;  3IAY A;  4FM2 A;  3S3N A;  1NOY A;  2HND A;  1GOC A;  3ASM A;  1QTM A;  4CGJ A;  3AA5 X;  3F9K A;  3K2P A;  4HHT A;  3DLG A;  1LWF A;  3VA0 A;  2OPR A;  4HCB A;  4Q5V A;  3NHG A;  3MXI A;  3K5N A;  3DRP A;  4CEC A;  4DMN A;  4EP4 A;  3OYA A;  4CFD A;  1KFS A;  1WLJ A;  2G8H A;  3ZSX A;  1ZBL A;  4ICL A;  2NUB A;  3S9H A;  3AVJ A;  2VG7 A;  4Z4G A;  5KRT A;  4CJP A;  3PX0 A;  4KAZ A;  4NYN A;  2XHB A;  1J54 A;  4CGF A;  4KRE A;  3OVN A;  1RT1 A;  4Z0U A;  3V1R A;  3MEC A;  1D5A A;  1JLC A;  3QER A;  4MFB A;  3CQ8 A;  4N47 A;  3SUN A;  1REV A;  1S1T A;  1XHX A;  3ZSQ A;  1JLE A;  3NAE A;  3AO5 A;  3RR8 A;  1HJR A;  4W5N A;  4OVL A;  4M3Y A;  3D45 A;  4G1Q A;  4DQR A;  4KHS A;  3VQ6 A;  3HXM A;  4FJG A;  3O3G A;  4DFP A;  3AVC A;  3CFO A;  4CJ3 A;  4DU1 A;  2XY7 A;  1YVU A;  1I39 A;  3NDK A;  2VWK A;  4RW7 A;  2P5G A;  3FFI A;  4DTR A;  3V9W A;  5J2P A;  3KD1 E;  2YKN A;  4CIE A;  4CER A;  4FLZ A;  1XWL A;  3DRS A;  4J2B A;  3K5O A;  2DFH A;  1I3A A;  4DTJ A;  4C8O A;  5CY4 A;  4O55 A;  4CF2 A;  4Y1C A;  4JRP A;  4QCL A;  2KFN A;  3MEE A;  4GVM A;  3VA3 A;  1R0A A;  3SI6 A;  4FLT A;  4PY5 A;  4DU4 A;  1SV5 A;  3MAQ A;  3LP3 A;  3I0R A;  1L3V A;  4CEQ A;  4KHY A;  1WAJ A;  4CEE A;  2IC3 A;  1NJX A;  5HRO A;  2EX3 A;  1FKP A;  1BCM A;  3K58 A;  4NCA A;  2KZZ A;  4M3R A;  1C0U A;  1WSI A;  4LD0 A;  4FXD A;  4BDY A;  4AHS A;  3SQ1 A;  2VG6 A;  4AHV A;  4KRF A;  5C42 A;  4AHR A;  3DLK A;  2XRI A;  4I7F A;  3WNH A;  1IH7 A;  4O0I A;  3O4N A;  4OLB A;  3LPU A;  3K5M A;  1XHZ A;  2QKK A;  3KLH A;  2ITG A;  2YHA A;  4NYF A;  1T7P A;  4FK4 A;  2HVI A;  3QO9 A;  2EHG A;  4FW2 A;  1O1W A;  4LH4 A;  1SKS A;  4FZZ A;  1RCH A;  4B08 A;  4B9M A;  1HQE A;  4OKJ A;  4CE9 A;  5JS1 A;  4CJF A;  3KK1 A;  3AA4 A;  3MXM A;  4O5B A;  1U4B A;  2BDP A;  4IDK A;  1TV6 A;  2DFF A;  4CK2 A;  4CHQ A;  4YFU A;  3ZSR A;  1YT3 A;  3DRR A;  1RT2 A;  3CYM A;  3K59 A;  2PZS A;  3OY9 A;  3OYF A;  1A5W A;  4QOZ B;  3VQC A;  3QEX A;  1LWE A;  3VQ4 A;  3OYD A;  5CYM A;  4FJ5 A;  3AVL A;  1CXQ A;  3DMJ A;  4RW6 A;  4W5O A;  3LDS A;  3AO3 A;  1SL0 A;  4FJH A;  4BE2 A;  4E7I A;  3AO4 A;  3LZJ A;  1UOC A;  4HUF A;  4DFK A;  1U47 A;  2X6N A;  4Q0B A;  3P5J A;  3PX6 A;  4FVM A;  1NKC A;  4KHQ A;  1S1W A;  3NFA A;  1QQC A;  5C24 A;  4M3Z A;  4DU3 A;  1J53 A;  4KTW A;  1KRP A;  1DTT A;  3ZT3 A;  3TAR A;  2AJQ A;  2VG5 A;  2OPQ A;  1KLN A;  3MXJ A;  2HNY A;  1RT3 A;  1Q8I A;  5HLF A;  3M8S A;  4CJV A;  1RDB A;  3AA3 A;  5HRN A;  1IG9 A;  2P1J A;  5C25 A;  1QSY A;  3CFP A;  2R7Y A;  1EX4 A;  1RTI A;  2P51 A;  3SUP A;  1LV5 A;  3D0P A;  1U49 A;  1QSS A;  1C1C A;  3QIN A;  1SL1 A;  1K6Y A;  3AV9 A;  4B9V A;  3F73 A;  4DTP A;  1JL1 A;  1ZBH A;  2RF2 A;  3CM6 A;  3KKR A;  4FCY A;  4PQU A;  2GV9 A;  3MEG A;  1C0T A;  4O0J A;  1FXX A;  2Q3S A;  3HT3 A;  4FLV A;  4CJW A;  4AHU A;  3OYJ A;  3NH1 A;  3DLR A;  4FJ9 A;  1S1U A;  2F8S A;  4DTX A;  1TKD A;  1L3U A;  2HHS A;  1G15 A;  3P83 D;  3QLH A;  2FBY A;  2XY8 A;  4DTS A;  3U6F A;  2XO7 A;  3SV3 A;  4HTU A;  1S5J A;  3O3F A;  4KTQ A;  4Y1D A;  4J2E A;  4CFB A;  4M45 A;  4I9L A;  3O3H A;  4DF8 A;  1RTD A;  2JLE A;  1NJY A;  3AVF A;  3PO5 A;  3L2Q A;  4FJ8 A;  4OGE A;  3OYN A;  4CEF A;  1W9H A;  4F2S A;  1HPZ A;  3LP1 A;  4LH5 A;  3EY1 A;  2KZM A;  1VSH A;  4FLW A;  4KHN A;  1TAQ A;  1S1X A;  1IKV A;  3T3F A;  4AH9 A;  4M3U A;  4Z4E A;  1HMV A;  4CJK A;  1F21 A;  4H4M A;  4FW1 A;  1KVC A;  1N6Q A;  1MU2 A;  1U45 A;  4DWI A;  3V9U A;  4B8C A;  5FRO A; 
#chains in the Genus database with same CATH topology
 1D9F A;  4OO1 J;  4DQI A;  3GOI A;  4F3T A;  3VQ5 A;  1SKW A;  1NGC A;  4ELT A;  3WUH A;  1J5E K;  1N8R O;  2BTF A;  1WSG A;  4YOX A;  1VQL N;  4IKF A;  4CEO A;  4CD1 A;  3EN9 A;  3G71 N;  3QML A;  2OA8 A;  4CF8 A;  1CLQ A;  1X9W A;  3SBG A;  3AVN A;  1FKO A;  1VSD A;  5I42 A;  2P9U A;  3QEW A;  3RMB A;  2Y1J A;  5SWM A;  3VMF B;  4DTO A;  3ITH A;  4YNQ A;  2I7P A;  1KTQ A;  3RSE B;  3H3N O;  3U3Y A;  1HR0 K;  4IJN A;  3HTV A;  4JS4 A;  3L6Q A;  3T1A A;  4WFB L;  3D2E B;  4DTN A;  2D4W A;  4V19 S;  3SQ2 A;  3GG4 A;  4ILJ A;  3CME N;  4BWJ A;  3MMV A;  4PA1 A;  1ZXO A;  3LAK A;  3HP9 A;  3OYB A;  1NK5 A;  3MN6 A;  1VQ6 N;  5AQM A;  4OKK A;  1ILY A;  4CHO A;  4ISG A;  4DS4 A;  4BE0 A;  2AA4 A;  4KTZ A;  4CCH A;  1ASV A;  3WXI A;  4JD2 B;  3TAQ A;  3T7Z A;  1E4F T;  3KLE A;  3I8B A;  2UUB K;  5IT9 O;  4E3S A;  2OAN A;  2PBD A;  1CZ9 A;  5AQK A;  5EOY A;  1BHL A;  3AVI A;  4HVJ A;  5LMN K;  2E2Q A;  3VEX A;  4KI4 A;  4BRK A;  1IG8 A;  5KPZ A;  1NU0 A;  2VQF K;  4WFA L;  3D7E O;  4M3X A;  3ID8 A;  2YCH A;  4Z4F A;  2VGN A;  4C8N A;  1KXP A;  1X9J A;  3HK2 A;  3MN5 A;  1R59 O;  2B5J A;  1Y97 A;  4CHP A;  3IFR A;  4HUE A;  3ZYY X;  3VTI A;  4I2P A;  3SUO A;  5KPT A;  3NVK A;  4DSE A;  3H1V X;  4A57 A;  2QWL A;  4AHC A;  3RMA A;  4B1X B;  4B8A B;  4GW6 A;  1YJN N;  3SV4 A;  4DSJ A;  3BY5 A;  3UIQ A;  2QTD A;  3AAR A;  3V9X A;  4BDP A;  1N32 K;  4BR5 A;  3PSI A;  4FJJ A;  1RDA A;  4N5S A;  1IO2 A;  2P9U B;  3DAW A;  4ILH A;  4ZHR A;  3C7N A;  1WUA A;  4CIF A;  4KI6 A;  1NGB A;  3L3V A;  3IRX A;  1VSI A;  3C65 A;  3DYA A;  4NO7 A;  1OVQ A;  2RE2 A;  3TR8 A;  5A2Q O;  4JRQ A;  2HHX A;  1GLE G;  3MN9 A;  1N36 K;  2UXD K;  3Q7B A;  3LDP A;  2V7Z A;  3BF1 A;  1RBV A;  5AQS A;  3CC7 N;  4JYA K;  1IKX A;  3DOL A;  4IFY A;  2YNF A;  4IOX A;  1ESV A;  1GLA G;  4H4O A;  5J1E A;  5C10 A;  4E7H A;  3SLC A;  4L3Q A;  1A5X A;  1KD1 O;  5JMV A;  4A61 A;  3C94 A;  3U8X A;  3ZX3 A;  2JWL A;  2ZQB A;  3LZI A;  2O4I A;  3VN5 A;  3U3G A;  4LSN A;  3LL3 A;  5J2Q A;  4CGD A;  4B9U A;  4R5P A;  4JHD A;  3H6E A;  4BWM A;  1X3N A;  1HKC A;  3O4Q A;  1TKX A;  3OBY A;  2RPI A;  3THY A;  4CFC A;  3CI5 A;  1VSF A;  3QFU A;  5HRP A;  4O44 A;  3WNG A;  3L8B A;  1NG9 A;  4UY8 O;  3SK3 A;  3O9Q A;  1C1B A;  2NRH A;  4KO0 A;  2GWJ A;  3BEX A;  3SNN A;  5CZ2 A;  3H1Q A;  4PKI A;  4A62 A;  1J5O A;  3O8M A;  3SAG A;  1HNV A;  4CJL A;  3DLB A;  3PLA A;  4X65 K;  3LM2 A;  4GVE A;  3HPH A;  3L2U A;  2FSK A;  4N56 A;  2GUI A;  1T6C A;  1UA1 A;  1BU6 O;  4B3M K;  3S3O A;  3TAM A;  3F2K A;  3KTQ A;  3VQE A;  4YOR A;  4IO9 L;  3KJV A;  1S1V A;  2UUC K;  4OPJ A;  1HRH A;  2HNZ A;  4DS5 A;  4J2D A;  3TTD A;  1YAG A;  3AVG A;  1BGX T;  4E7K A;  3RVC A;  4RW4 A;  2E6M A;  2E5L K;  4MO4 A;  4WE1 A;  2HB5 A;  5J2M A;  3HOS A;  1RT7 A;  2NRX A;  3C7N B;  1DT9 A;  1Z26 A;  3NH0 A;  3NCI A;  3K9J A;  3BDP A;  4CES A;  2VYP A;  1C6V A;  1P8Z A;  1BA1 A;  5JLF A;  2HHU A;  1GLB G;  4JS5 A;  4KB0 A;  3DI6 A;  4F8R A;  3ZT0 A;  5ADX H;  4FM0 A;  4WQ5 C;  3A2F A;  3ZLJ A;  3VQB A;  2W41 A;  2Z1I A;  3ZT4 A;  1K9M O;  1J6Z A;  3B8A X;  3ULD A;  4HWI A;  4JI6 K;  4DR2 K;  3AA2 A;  3V9S A;  4A2B A;  4DSI A;  5KRS A;  1RT6 A;  4JHD B;  2Q97 A;  3DXK A;  4O8K A;  4FM2 A;  1GOC A;  2YX6 A;  3K2P A;  3DLG A;  5F1X A;  4Q5V A;  3THY B;  3MXI A;  3DRP A;  4EP4 A;  3OYA A;  1KFS A;  1KAY A;  2UUA K;  4DR5 K;  4Z4G A;  5KRT A;  5BRE A;  4KAZ A;  2XHB A;  3V1R A;  1D5A A;  4A5A A;  3CQ8 A;  1K73 O;  1XHX A;  3HBT A;  2OTL N;  3SJH A;  3GE1 A;  4RCH A;  1D4X A;  1HLU A;  3AVC A;  4DU1 A;  1NGF A;  3CCQ N;  1CZA N;  5J2P A;  4CZM A;  4CER A;  3THX B;  2NNW A;  2UXC K;  1I3A A;  4C8O A;  2HBL A;  3MEE A;  4GVM A;  3VA3 A;  1IBK K;  3VOV A;  1N33 K;  1SV5 A;  3MAQ A;  3KHY A;  1NJX A;  3K0S A;  2O8D A;  5LJV A;  1WSI A;  4BDY A;  4LF5 K;  3CCV N;  2GX9 A;  2VG6 A;  3SQ1 A;  3DLK A;  1NGG A;  4I7F A;  2QWO A;  4FOE A;  2QKK A;  4BR7 A;  2W6L A;  2YHA A;  4M7X A;  3QO9 A;  3I55 N;  1OKJ A;  4FZZ A;  1RCH A;  4B9M A;  1T44 A;  3O9T A;  4OKJ A;  4CE9 A;  4KHP K;  4CJF A;  3MXM A;  3AA4 A;  3LM9 A;  4O5B A;  4BRG A;  2BDP A;  4H0O A;  4YFU A;  3TAG A;  1JCG A;  2D1K A;  3DRR A;  3ZSR A;  2PZS A;  3CYM A;  1NJI O;  5EY4 A;  3M1F A;  3VQ4 A;  3DMJ A;  4DB3 A;  4XEI A;  3LDS A;  4JK9 A;  4KHQ A;  1S1W A;  1QQC A;  1NLV A;  4KTW A;  1KRP A;  3T1H K;  4B1U B;  3TAR A;  5M1Q A;  5HLF A;  2FF6 A;  1HNX K;  4CJV A;  5B8H A;  1RDB A;  3AA3 A;  2ZJQ L;  3A5O C;  5CE3 A;  3J81 O;  5HRN A;  4IOA L;  1EX4 A;  1BDG A;  3SUP A;  3EL2 A;  3MWP A;  3QIN A;  1K6Y A;  3O9U A;  1VQ7 N;  1HX1 A;  4LF4 K;  3E1Y A;  5AQO A;  1WBB A;  3MEG A;  4O0J A;  2O8C B;  3BP8 A;  4AHU A;  3DLR A;  2A5X A;  1XQS C;  1G15 A;  2XY8 A;  4HTU A;  3O3F A;  4CFB A;  4B1V A;  4DF8 A;  1RTD A;  2JLE A;  2QW9 A;  3PO5 A;  4NXM K;  1MA9 B;  1S1X A;  5H1S Q;  3T3F A;  3CPE A;  4AH9 A;  4B3R K;  4CJK A;  4H4M A;  4EAH D;  1KVC A;  2BH1 A;  3ATU A;  4J8F A;  3PY8 A;  5FRO A;  1JLG A;  3HVT A;  3M8Q A;  2VGM A;  1K8K A;  5I3U A;  2G8I A;  1VQ8 N;  4YOT A;  3WQU A;  2YKM A;  1ZBF A;  1KSP A;  3V1O A;  3QDK A;  3AVM A;  1J9A A;  2BE2 A;  5KI6 A;  5TKY A;  4H8K A;  3IDH A;  4DF4 A;  1UA0 A;  3ZSW A;  3B6P A;  4CHY A;  4B3O A;  3O9R A;  5HP1 A;  4DLG A;  1L3S A;  4YOU A;  4EFH A;  4KHS A;  3O5B A;  1KVB A;  3KLG A;  1ZBI A;  3ENB A;  4DTU A;  3VES A;  3RR7 A;  4KHU A;  1T3V A;  1YVN A;  3CF5 L;  1UAX A;  5HL7 L;  4ID1 A;  4IG3 A;  3I8D A;  3OYI A;  2G8F A;  4OKE A;  5J2N A;  1VQ5 N;  4CJT A;  1YXQ A;  5GAG P;  3G25 A;  4J2A A;  4LY7 A;  2B4J A;  3E66 A;  3ULE B;  3ZSO A;  4K41 A;  1UWB A;  4B3T K;  3K9K A;  1MWM A;  4B1Z A;  5M1N A;  1TGO A;  3GDQ A;  4JKH A;  4RG8 A;  3HL8 A;  3VGL A;  2DTU A;  3WQT A;  3AGK A;  4K25 A;  4H5W A;  4LFC K;  4XH1 A;  5HBM A;  5EXW A;  5EU7 A;  3SQ4 A;  3UKR B;  3LPT A;  1BUP A;  3IMX A;  5FRN A;  4JI7 K;  4WFN L;  5BPN A;  1WOQ A;  4BVO A;  1VAZ A;  3ATV A;  3M8R A;  1YIJ N;  3AO2 A;  5KGW A;  1WSH A;  1DTQ A;  3KK7 A;  1JLQ A;  2YNG A;  2E2N A;  5AQH A;  3SZ2 A;  4ZTF A;  3E9O A;  2Z1H A;  3OYG A;  2ETJ A;  1QVF M;  1XC3 A;  2ZGZ A;  2WOM A;  3FZH A;  3TI0 A;  1VQ9 N;  4B9N A;  3T1Y K;  4QS8 A;  1RIL A;  1RT5 A;  1VQ4 N;  2W6K A;  3EZW A;  4H0V B;  4FK0 A;  4BAC A;  2P9S A;  5LMU K;  1NKB A;  5F2R A;  2D5R A;  4FLU A;  3RMD A;  4DLE A;  1VSM A;  4WCE L;  1NK9 A;  2A3Z A;  4FJN A;  4AF1 A;  1KCF A;  3A5N C;  4CED A;  4DV7 K;  1K8K B;  4EP5 A;  4C23 A;  2F8T A;  4CFA A;  5FPN A;  1S6Q A;  1W2B M;  3DLE A;  1RBU A;  2V51 B;  3NGI A;  4DQ8 A;  3ZSY A;  2VWB A;  1LW0 A;  4FZY A;  1EKE A;  3VF4 A;  2QWN A;  3CM5 A;  1HNW K;  1T03 A;  1C0G A;  4B9T A;  2O8F B;  2IVO A;  5E41 A;  1KQS M;  3TAE A;  4CF1 A;  5EVZ A;  2IOC A;  4CK1 A;  1U48 A;  4H5T A;  4K42 A;  1WSJ A;  1RBS A;  1W0H A;  3OJU A;  3QEI A;  2P9I A;  3M6G A;  1LW2 A;  4BRN A;  5FPE A;  1VQP N;  4KB1 A;  4BRI A;  4RW9 A;  2OZS A;  4OX9 K;  5GAD P;  4M3W A;  1WSF A;  1N34 K;  1TK5 A;  4FWP A;  1Q9Y A;  4ISE A;  3CCL N;  4GV9 A;  3CJB A;  1T8E A;  4WF9 L;  3CCU N;  3WNF A;  1Q86 O;  1I94 K;  3ZSV A;  3CET A;  4FJI A;  4LFA K;  1BIZ A;  3P39 A;  3QIC A;  4PL8 A;  4CF9 A;  1LAV A;  4DV5 K;  2P5O A;  2G8U A;  4G9Z A;  4IEE A;  5FPM A;  3LP0 A;  3QES A;  3OA9 A;  3VEY A;  4Z4H A;  4DR3 K;  3L3U A;  3E9L A;  3ID6 A;  3LWM A;  5AQP A;  2KFZ A;  2JGU A;  3G6E N;  3LDL A;  2OPP A;  2PY5 A;  1VQO N;  2YV0 X;  5AQZ A;  4PUO A;  4U67 L;  3KLI A;  3TWH A;  1WB9 A;  1NM1 A;  4DSF A;  4NCG A;  2ZJR L;  3LP2 A;  2P9S B;  2Y1I A;  4A59 A;  3FFK B;  2WC9 A;  1BIS A;  5AZI A;  4BDZ A;  2PYJ A;  3SPZ A;  2FBT A;  2D0C A;  3SUQ A;  4CEZ A;  4B9S A;  1ATN A;  1GLD G;  2KW4 A;  4YHH K;  3J8A A;  3EZ5 A;  3NGY A;  2RKI A;  4E7J A;  3TSU A;  2V52 B;  1TL3 A;  1JXB A;  4DUZ K;  5BR8 K;  1YJ9 N;  4W5R A;  2O4G A;  4EHU A;  3C95 A;  1JLA A;  1HKB A;  3D6R A;  3VQQ A;  3HPG A;  1N5Y A;  4LF8 K;  4B9L A;  3R1X A;  1ASW A;  1QE1 A;  2DFE A;  1Z25 A;  3C6U A;  3KK2 A;  4ZTJ A;  1OH7 A;  4DQP A;  3FZL A;  2GEL A;  3KIO A;  4BRD A;  3SJJ A;  1WN7 A;  1YI2 N;  2O8B A;  3OS2 A;  4ID5 A;  4FOI A;  3SQ0 A;  3TAB A;  4BGA A;  2RN2 A;  3KVG A;  1T05 A;  1KVA A;  3EEQ A;  4F2R A;  4NLC A;  4KFB A;  3AAP A;  2P9I B;  1S9E A;  2VQE K;  4BC5 A;  4WQ4 C;  1X9M A;  4JLH A;  5BRD A;  3CG7 A;  1BO5 O;  3HZ6 A;  4CZK A;  1D9D A;  1VSL A;  3C6H A;  1SL2 A;  1Q18 A;  2NZT A;  3M8P A;  4GNI A;  2G8W A;  1BIU A;  2O8E A;  4OPK A;  1CXU A;  4JKA A;  2E6L A;  4AIL C;  1JCF A;  1GLF O;  3OYL A;  3NMU A;  5DM6 L;  4NCB A;  3D2F A;  4Y0W A;  3KLF A;  2WTU A;  4IDH A;  3WEE A;  5TKW A;  3AA5 X;  3F9K A;  4HHT A;  3VA0 A;  3FLC O;  3OW2 M;  4BR2 A;  3K5N A;  2G8H A;  1SQK A;  4CFD A;  2NUB A;  4PL7 A;  2VG7 A;  3THW A;  4NB4 A;  2UYT A;  3PX0 A;  4NYN A;  1J54 A;  4KRE A;  1RT1 A;  2NRZ A;  3MEC A;  3S41 A;  1JLC A;  3QER A;  4N47 A;  1S1T A;  3NAE A;  1JLE A;  1OH8 A;  3AO5 A;  1NGH A;  4K43 A;  4OVL A;  3D45 A;  4NLB A;  1VQM N;  3A8Y A;  3BF3 A;  3HXM A;  4FJG A;  3CFO A;  3CD6 N;  3LDN A;  2P9K A;  3NDK A;  3GBT A;  2HHH K;  1NMN A;  1YF5 L;  3FFI A;  3KD1 E;  2YKN A;  4FLZ A;  3L0Q A;  4J2B A;  1Z6R A;  4RTF D;  5LY3 A;  5AZI B;  3MDQ A;  4NXN K;  5CY4 A;  1V4T A;  3GL1 A;  4Y1C A;  1OH5 A;  2IVP A;  1R0A A;  5BRH A;  4FLT A;  4DU4 A;  4CEQ A;  1WAJ A;  1G99 A;  3SMP A;  5HRO A;  1BCM A;  4FXD A;  4AHV A;  4H5V A;  3THX A;  2JWK A;  3CC4 N;  2HBK A;  3C6A A;  4BRP A;  2ZJP L;  1XHZ A;  3KLH A;  4NYF A;  3JAM O;  2YHY A;  2HMP A;  4B08 A;  2CGL A;  3EE8 A;  5JS1 A;  3KK1 A;  2O8B B;  2VCP A;  2WFB A;  4CK2 A;  1RT2 A;  4QOZ B;  3OY9 A;  3QEX A;  1LWE A;  2EWS A;  5DM7 L;  1CXQ A;  3FR0 A;  3W3D A;  1SL0 A;  4E7I A;  1JJ2 M;  3SAF A;  1UOC A;  4HUF A;  1DKG D;  2Q31 A;  2Q1N A;  4Q0B A;  5C24 A;  2QM1 A;  1Y64 A;  2VG5 A;  1TUY A;  2OPQ A;  1KLN A;  4H0P A;  2O8E B;  3A5M C;  1RT3 A;  4FWN A;  3M8S A;  4FVU A;  3O6W A;  2F4V K;  1M90 O;  3WXM B;  5ELZ A;  4MLE A;  1W97 L;  4BRH A;  3D2F B;  2GTD A;  3AV9 A;  2NRR A;  4YDU A;  3WEE B;  4DTP A;  1JL1 A;  2RF2 A;  3CM6 A;  2KHO A;  2GV9 A;  1C0T A;  1S1U A;  3CJC A;  1TKD A;  3P83 D;  4JI0 K;  3THW B;  1YHQ N;  2XO7 A;  4IXC A;  1S5J A;  3O3H A;  4M45 A;  4I9L A;  3ZET B;  4DV6 K;  3AVF A;  4FJ8 A;  4BC3 A;  3OYN A;  2CGJ A;  1W9H A;  2QA4 N;  3LP1 A;  4LH5 A;  1VSH A;  4JK7 A;  5MLC Q;  4KHN A;  1GLC G;  1QVG M;  3UKU A;  4H0X B;  4FW1 A;  2O8C A;  1MU2 A;  2P9K B;  2E20 A;  5GAH P;  3CCR N;  3R3L A;  5AQN A;  3NF7 A;  2OTJ N;  4L8R B;  1RTH A;  3VQ7 A;  3I0S A;  2G8V A;  1YUW A;  3G0Z A;  5CR4 A;  1TYQ B;  4E0D A;  3I56 N;  4BY9 C;  4M3T A;  1NJZ A;  3CQY A;  3ZT2 A;  4FJM A;  4GKJ K;  3IS9 A;  1DGK N;  1LWC A;  4KV8 A;  4DFM A;  1BI4 A;  3SBT A;  3HST B;  1JLF A;  2ITM A;  1B9D A;  1S22 A;  5AQY A;  1T6D A;  3C6T A;  1YTU A;  3NF6 A;  2YI1 A;  1B92 A;  1OH6 A;  4BVP A;  2I5J A;  4FM1 A;  4MO5 A;  1JXE A;  1X9S A;  2Q36 A;  1BL3 A;  3QEV A;  3I33 A;  1BQM A;  1Z05 A;  1QS4 A;  1TK0 A;  4QS7 A;  3LAL A;  4CJS A;  3ZSZ A;  2A1R A;  4XH5 A;  4DV4 K;  1HNI A;  2IIR A;  5KQ8 A;  3NH2 A;  1NJW A;  4CBU A;  3MWT A;  3HRG A;  3T19 A;  3AO1 A;  3ULE A;  3HI0 A;  4MQ3 A;  1S6P A;  1JL2 A;  3JYT A;  2Q0R A;  3TTF A;  1KFD A;  1BA0 A;  4BG9 A;  1JLB A;  3UB5 A;  4DKW A;  4Z4C A;  2IAJ A;  4C8M A;  3VF6 A;  4BRO A;  3E01 A;  4H0T B;  3RTV A;  5C12 A;  4TSX A;  4CEB A;  1QZ5 A;  1JKH A;  4H03 B;  3UKR A;  3FGU A;  1NGA A;  3CQX A;  3DOK A;  1NGI A;  1RDU A;  3P38 A;  3J7Z O;  1WNS A;  1NBW A;  4MLH A;  4FYD A;  3KWI A;  3PO4 A;  5KGX A;  3UKU B;  2GUP A;  2HW3 A;  3OYH A;  1SUQ A;  2GBZ A;  2P9P A;  3FZF A;  1NK0 A;  3HPO A;  3BZK A;  4BR9 A;  5M1O A;  1EXQ A;  5DK5 A;  4CD3 A;  2G8K A;  4N76 A;  1Q7Y O;  2GEM A;  3CHW A;  3THV A;  2HF4 A;  4CW7 B;  1RTJ A;  4F9O A;  1L5U A;  1DEJ A;  4X66 K;  1ZYQ A;  4BRF A;  2UU9 K;  1KAZ A;  2DPN A;  3KZB A;  3OJS A;  1NWK A;  2ZWH A;  4QS9 A;  4E1N A;  4KKO A;  1YJW N;  3KWG A;  1E3M A;  5BN8 A;  2YHX A;  2Z1J A;  1BI4 B;  3DXM A;  3WNE A;  2LSN A;  1EQY A;  5FRM A;  1Q9X A;  4CZH A;  4AHT A;  2HHV A;  4F3O A;  1QSL A;  3LAN A;  3VQ9 A;  3KK3 A;  3NBP A;  4CHN A;  4DG1 A;  3QFP A;  5BRF A;  1VK0 A;  2ZF5 O;  4FO0 A;  5M1K A;  2O8F A;  3LWL A;  2IS3 A;  4EZ6 A;  4FWR A;  4FLX A;  2KTQ A;  5SZT A;  1P90 A;  4BRQ A;  3CJ1 A;  2ASM A;  3NE6 A;  4OGC A;  4GV3 A;  3SMS A;  3CIP A;  4Z4I A;  5T7B A;  5M1F A;  3VQ8 A;  4PKH A;  4FK2 A;  3O9S A;  2Q0U A;  3A0I X;  3P31 A;  1BQN A;  3O80 A;  4HUG A;  5GAE P;  4CJ7 A;  1BOT O;  3RRH A;  1HYS A;  4XH4 A;  4CK3 A;  5JS2 A;  4N41 A;  3V1Q A;  1RDW X;  4FLY A;  4BC4 A;  5AZJ A;  3T69 A;  1QQO A;  3VQP A;  2E8A A;  3QIO A;  2QK9 A;  4LC9 B;  4CF0 A;  4JI5 K;  1VRT A;  1VQK N;  3PX4 A;  5GIP A;  4DTM A;  3TU5 A;  2XY5 A;  3G10 A;  3HSC A;  1NK8 A;  1IKY A;  1HJO A;  2P9L B;  2HMI A;  2Z1G A;  2HOE A;  4XIU A;  2QKB A;  1WAF A;  2IDO A;  4I9Q A;  4CHZ A;  1NK6 A;  3MCP A;  2P9P B;  3F5T A;  5AFU H;  4JN4 A;  5AQW A;  3DLH A;  5GIO A;  3KKS A;  3ZX2 A;  1BCO A;  3AVH A;  3TSP A;  5BN9 A;  2QEX N;  4DFJ A;  1NGE A;  4KH4 A;  4B3S K;  1YTA A;  3Q7C A;  4LFB K;  3G4S N;  5E26 A;  4YOW A;  4JI4 K;  1S9G A;  4CJR A;  3HM9 A;  3L2V A;  5HRS A;  2IGI A;  2FBV A;  4JKG A;  5AQL A;  4CEA A;  4ELV A;  2QWM A;  1GOB A;  2F96 A;  4LF9 K;  2YJF A;  1GLJ O;  3MX5 A;  3L2R A;  4KPY A;  4E7L A;  2YHB A;  3OBW A;  2D0B A;  4CGG A;  1WSE A;  4DUY K;  4JKC A;  4OPH A;  3DXM B;  5GIN A;  4B1Y B;  3JXU A;  4FL9 A;  4UQG A;  4X64 K;  2GWK A;  1NGD A;  3VPZ A;  3JS6 A;  1HQU A;  1U6Z A;  3VEV A;  1QHT A;  4M41 A;  4PWD A;  2WON A;  1ZBU A;  3SPY A;  2HST A;  2X6S A;  3IG1 A;  3RMC A;  4HTL A;  3SYZ A;  3MX2 A;  4FJL A;  2ASP A;  4GV6 A;  3V4I A;  2QWR A;  4W5Q A;  3MN7 A;  3QIP A;  5C0Y A;  1XMO K;  1RBR A;  5LJW A;  1NOZ A;  5AQI A;  4B1W B;  1FK9 A;  3O08 A;  5AQQ A;  4DR6 K;  4FWQ A;  3ASM A;  5EX5 A;  4CGJ A;  5AQV A;  5C15 A;  4HCB A;  4K0K K;  2OPR A;  4H0Y B;  4BGB A;  2NLX A;  4CEC A;  1WLJ A;  3ZSX A;  1ZBL A;  4ICL A;  2E1Z A;  3PSF A;  3S9H A;  2A6A A;  3AGR A;  4BRM A;  4CGF A;  4PHT X;  4Z0U A;  2AP1 A;  1Q82 O;  5AZJ B;  1REV A;  3ZSQ A;  3DLL L;  2BUP A;  3RR8 A;  1IJJ A;  4CI6 A;  1HJR A;  3FE1 A;  3U9D A;  4DFP A;  4RW7 A;  4DTR A;  2FF3 B;  5C2D A;  1XWL A;  3DRS A;  3K5O A;  4DTJ A;  3EE9 A;  2IVN A;  4CF2 A;  4JRP A;  4QCL A;  2HBM A;  5E84 A;  4JKB A;  3I0R A;  1L3V A;  4KHY A;  2IC3 A;  4BG8 A;  3K58 A;  1FKP A;  4AHS A;  5C42 A;  3TTC A;  3WNH A;  2F9T A;  4JKG B;  1IH7 A;  3O4N A;  4OLB A;  3U4L A;  4YOV A;  4DV0 K;  2EHG A;  1O1W A;  1QZ6 A;  1SKS A;  4WQ5 A;  1HQE A;  2YJE A;  1XNR K;  1U4B A;  4IDK A;  4CHQ A;  2DFF A;  2FXU A;  4JKF A;  3K59 A;  3VQC A;  1HKG A;  5CYM A;  1XUP O;  1JCE A;  4FJH A;  3AO3 A;  4BE2 A;  4DFK A;  3LZJ A;  1U47 A;  2X6N A;  1K8A O;  4FVM A;  1NKC A;  2UXB K;  5JVH L;  4DU3 A;  4M3Z A;  4M7Y A;  5CHI A;  4IFE A;  3ZT3 A;  1W7A A;  2AJQ A;  2HNY A;  1Q8I A;  3QBW A;  4M63 C;  4JI2 K;  1IG9 A;  1QSY A;  3CFP A;  4ISF A;  1RTI A;  3ZEU A;  5HOO A;  3D0P A;  1QSS A;  1C1C A;  1SL1 A;  1KC8 O;  3F73 A;  1MWK A;  1C0F A;  3KKR A;  1S72 N;  4FLV A;  1FXX A;  2Q3S A;  3NH1 A;  4FJ9 A;  3VF2 A;  1L3U A;  3QLH A;  2FBY A;  3U6F A;  4BC2 A;  3SV3 A;  1BWF O;  4BR4 A;  4KTQ A;  1XMQ K;  4CZF A;  1NJY A;  3L2Q A;  4CEF A;  3EY1 A;  4M3U A;  1IBM K;  1HMV A;  4WYB A;  3CJ9 A;  2QWQ A;  3V9U A;  4EZ9 A;  5ADX A;  3AVA A;  3ALY A;  2FBX A;  1V4S A;  4FJ7 A;  1SZ2 A;  3EKU A;  4O5F A;  2D0O A;  4DV2 K;  4DQQ A;  2DY4 A;  3ZET A;  2VWJ A;  4JNE A;  4LF6 K;  1ASU A;  1DLO A;  4KH6 A;  4CIG A;  2PYL A;  4FWL A;  4K8X A;  4LSL A;  4AM7 A;  1RGI A;  4FWM A;  3TAF A;  3HM8 A;  3S3M A;  3LAM A;  3QEP A;  2E1Y A;  2OYQ A;  4MDB A;  2D0P A;  3PIP L;  4KHW A;  1ZC6 A;  2OPS A;  5KTQ A;  3P4I A;  1VSK A;  3DM2 A;  3H08 A;  4I6M A;  4FWS A;  4JEP A;  1TVR A;  1Q81 O;  4CZJ A;  4JI1 K;  1EO1 A;  3CJA A;  3HP6 A;  2V7Y A;  2HVH A;  2RHK A;  2E88 A;  4BQZ A;  1H1V A;  1LOT B;  1TYQ A;  3HO1 A;  1TKT A;  4JI3 K;  2KLA A;  3PV8 A;  5CYQ A;  3WT0 A;  2HHT A;  4X62 K;  2ASO A;  1LAW A;  5CZ1 A;  2ZE2 A;  3E9P A;  4EIA A;  2PFU A;  2ZGY A;  4HCC A;  2F9W A;  3ZT1 A;  4I2Q A;  5HRR A;  3VQD A;  3UE5 A;  1XC9 A;  3R6M A;  5AQX A;  3ZCM A;  3OHR A;  3JSM A;  1HPM A;  1TL1 A;  4IG0 A;  1NK7 A;  5C2F A;  3HVR A;  1IV0 A;  3ZEU B;  4DCH A;  3CCE N;  4FPA A;  1GOA A;  4IZ9 A;  3EYZ A;  3IKM A;  1NMD A;  1C0M A;  4DR7 K;  1QQN A;  4BE1 A;  4FJK A;  1XI1 A;  5KPR A;  1M1K O;  3RRG A;  3PIO L;  4MDA A;  5FPD A;  3WXK A;  1U04 A;  4K8Z A;  3QNO A;  4GKK K;  4RW8 A;  3VTH A;  1BG3 A;  1VSJ A;  3RWU A;  2WUS A;  3PUF A;  3H45 C;  4F4K A;  1NK4 A;  4CGH A;  5D3G A;  4GY2 B;  3LDO A;  3WXL A;  3A5L C;  4BRE A;  4U7B A;  2ATQ A;  3VEO A;  4DSK A;  1RT4 A;  4FZX C;  4M42 A;  4RWT A;  1HUX A;  2FC0 A;  3AY9 A;  3O4W A;  2ZM6 K;  2PAV A;  1QQM A;  5BPL A;  3TSQ A;  1KLM A;  4FWK A;  5AJ3 K;  3V9Z A;  3QBX A;  5AQR A;  4CJ4 A;  4E1J A;  4E19 A;  2YNI A;  5AQG A;  3OYM A;  3V81 A;  2W42 A;  1RDC A;  4FSV A;  3VEN A;  3ENO A;  1SKR A;  4PKG A;  1TK8 A;  5JLH A;  4I6M B;  3OYE A;  3OYK A;  3DWL A;  2OCE A;  1NNE A;  5K14 A;  2HHQ A;  2YHW A;  4C8L A;  3DJC A;  4DV1 K;  3CER A;  2NRT A;  4AM6 A;  3K57 A;  3BUZ B;  2ZD1 A;  1TKZ A;  4GMJ B;  1RNH A;  3OS1 A;  4C1N K;  4CJU A;  2BAN A;  3SAH A;  1HYV A;  1EET A;  1NGJ A;  1TAU A;  3VER A;  4CJ5 A;  4OJR A;  4JAX A;  5DMR A;  4DV3 K;  4DSL A;  4IO8 A;  1O13 A;  4JKE A;  3SCX A;  4BRL A;  3BZC A;  1HYZ A;  4LF7 K;  3K5L A;  2KQ2 A;  3HYF A;  5LL6 Z;  3ISN C;  4DR1 K;  1X1P A;  4BRC A;  3MED A;  2A41 A;  1RDD A;  2A40 A;  2D0A A;  3VGM A;  3AVB A;  1VSE A;  1VRU A;  4BQL A;  3VQA A;  4E89 A;  4IFV A;  2A42 A;  4H5R A;  3O1W A;  5FDL A;  1U2V A;  3AAQ A;  3VGK A;  2W40 A;  4DQS A;  3BGR A;  3QNN A;  3QET A;  2A1S A;  3HJF A;  1SAZ A;  3EO3 A;  4JKD A;  4BR0 A;  3J7Y P;  1LCU A;  3W0L A;  3CFR A;  5AR0 A;  5JVG L;  2I7N A;  1QHA A;  2E4L A;  4CJQ A;  4ELU A;  4OLA A;  1OVY A;  1TUU A;  2BGG A;  4IEI A;  3V6D A;  2XY6 A;  4H5N A;  4CBX A;  4CJE A;  2HF3 A;  4CZE A;  4E1M A;  3F9M A;  4JK8 A;  1A5V A;  4C8K A;  5M1P A;  1WBD A;  3H3O B;  3M5R A;  3TAP A;  3WXJ A;  3NVM A;  2QXF A;  3VEZ A;  2YNH A;  3P1G A;  4W5T A;  2OZM A;  1RBT A;  2X74 A;  4CGI A;  4Z94 A;  1ATS A;  3U9Z A;  2P9L A;  2QI2 A;  2J4R A;  2X78 A;  3HOT A;  3B6O A;  5AQF A;  1B9F A;  2HHW A;  3MK6 A;  3C0B A;  3OS0 A;  5AFU A;  3FZK A;  3R9P A;  3NF8 A;  2FSJ A;  3TAN A;  2H3G X;  1D8Y A;  4O4G A;  3CCJ N;  4B9Q A;  4IBN A;  2P9N A;  4CZG A;  1EWR A;  2CGK A;  3ZX0 A;  4CZI A;  1EP4 A;  4FJX A;  3NGZ A;  4CZL A;  2B6A A;  5JIC A;  3DXK B;  4IWV A;  3KD5 E;  3CCS N;  3CCM N;  2F7T A;  3L2W A;  1VQN N;  1RFQ A;  3MCA B;  4QAG A;  1YIT N;  1ITG A;  3OTO K;  3N4P A;  1IKW A;  1C1A A;  1CZB A;  3AVK A;  3CJ7 A;  3OYC A;  1FJG K;  4DR4 K;  5AQT A;  4CVN E;  1NKE A;  1XNQ K;  3NF9 A;  1L3T A;  3IAY A;  3S3N A;  1NOY A;  2HND A;  1QTM A;  3CMA N;  4C1N I;  1LWF A;  3FZM A;  3NHG A;  4DMN A;  3VEW A;  4KBO A;  4A2A A;  3AVJ A;  2Q2R A;  3H46 O;  4IJA A;  4CJP A;  2NRV A;  3OVN A;  3ENH A;  4KH5 A;  1VHX A;  4MFB A;  1U2V B;  4R79 A;  3SUN A;  2FSN A;  4YDU C;  3QB0 A;  4W5N A;  4YY3 K;  4M3Y A;  4G1Q A;  4DQR A;  3CXC M;  3IUC A;  3VQ6 A;  3O3G A;  4CJ3 A;  1FW6 A;  2XY7 A;  2O8D B;  1YVU A;  1I39 A;  2VWK A;  2P5G A;  4CBW A;  3V9W A;  4CIE A;  2NRW A;  3R8E A;  2DFH A;  3L4I A;  2QXL A;  4O55 A;  2KFN A;  3EKS A;  3SI6 A;  2WBN A;  4PY5 A;  2E2O A;  5BPM A;  3LP3 A;  4CEE A;  2FLO A;  3N4Q A;  2EX3 A;  4NCA A;  2KZZ A;  4M3R A;  1C0U A;  4LD0 A;  5FLX O;  1GLL O;  1SS6 A;  4ILG B;  4KRF A;  4AHR A;  3J7A P;  1ATR A;  2XRI A;  5IWA K;  4A5B A;  4O0I A;  5BR9 A;  2HBJ A;  3RSE A;  4DHY A;  3LPU A;  3K5M A;  2ITG A;  2HVI A;  4FK4 A;  3VET A;  1T7P A;  4WQ4 A;  4LH4 A;  4FW2 A;  4YOY A;  2QWP A;  2E2P A;  3D2E A;  4IOC L;  1TV6 A;  2P9N B;  1X3M A;  1YT3 A;  2CH5 A;  3OYF A;  1A5W A;  2KKZ A;  2CH6 A;  1S3X A;  4FPB A;  3OYD A;  4FJ5 A;  3AVL A;  4FWO A;  4RW6 A;  4W5O A;  3AO4 A;  4AQY K;  3P5J A;  3PX6 A;  5F0X A;  3NFA A;  5AQU A;  3TPQ A;  1J53 A;  1HNZ K;  1E4G T;  1DTT A;  1MDU B;  3MXJ A;  4JD2 A;  5AQJ A;  3J80 O;  2P1J A;  5C25 A;  2R7Y A;  1ZBS A;  2P51 A;  1LV5 A;  1U49 A;  4B9V A;  3L4Q A;  4O8U A;  1ZBH A;  4FCY A;  4PQU A;  4EHT A;  3HT3 A;  4CJW A;  3OYJ A;  2F8S A;  4DTX A;  4BRA A;  2HHS A;  3LDQ A;  4JV5 K;  4DTS A;  5KQD A;  3CC2 N;  5I9E B;  1KAX A;  4Y1D A;  4J2E A;  4OGE A;  4F2S A;  1HPZ A;  2KZM A;  4FLW A;  1EWQ A;  1TAQ A;  4JI8 K;  3CPW M;  3O1B A;  1IKV A;  4Z4E A;  1IBL K;  1F21 A;  3M3Z A;  4OPA A;  1N6Q A;  1U45 A;  4DWI A;  4B8C A; 
#chains in the Genus database with same CATH homology
 3AVA A;  3ALY A;  1D9F A;  1JLG A;  4DQI A;  2FBX A;  3HVT A;  3M8Q A;  4FJ7 A;  4F3T A;  5I3U A;  3NF7 A;  3VQ5 A;  2G8I A;  1SKW A;  4L8R B;  1RTH A;  4DQQ A;  2DY4 A;  4ELT A;  3VQ7 A;  2YKM A;  1ZBF A;  2VWJ A;  3V1O A;  3I0S A;  1KSP A;  1WSG A;  4IKF A;  4CEO A;  2G8V A;  3AVM A;  1ASU A;  1DLO A;  1J9A A;  2BE2 A;  4CIG A;  3G0Z A;  2PYL A;  5KI6 A;  4K8X A;  4LSL A;  2OA8 A;  4CF8 A;  1CLQ A;  4DF4 A;  4H8K A;  1X9W A;  4E0D A;  3TAF A;  1UA0 A;  3ZSW A;  3B6P A;  3AVN A;  1FKO A;  4CHY A;  1NJZ A;  4M3T A;  4B3O A;  1VSD A;  3ZT2 A;  3S3M A;  4FJM A;  3LAM A;  3QEP A;  3IS9 A;  5I42 A;  2OYQ A;  5HP1 A;  3QEW A;  4DLG A;  3RMB A;  4KHW A;  5KTQ A;  2OPS A;  2Y1J A;  5SWM A;  1L3S A;  1LWC A;  1VSK A;  3DM2 A;  3H08 A;  4KV8 A;  4DFM A;  4DTO A;  1TVR A;  1KVB A;  3ITH A;  3KLG A;  1ZBI A;  4YNQ A;  1BI4 A;  1KTQ A;  3HP6 A;  3HST B;  4DTU A;  1JLF A;  3RR7 A;  1B9D A;  4KHU A;  3U3Y A;  2HVH A;  1UAX A;  4JS4 A;  4ID1 A;  4IG3 A;  3I8D A;  3T1A A;  3OYI A;  4DTN A;  3C6T A;  1YTU A;  2G8F A;  4OKE A;  3NF6 A;  5J2N A;  3HO1 A;  1B92 A;  4CJT A;  3SQ2 A;  1TKT A;  2I5J A;  4LY7 A;  2B4J A;  4BWJ A;  4FM1 A;  3PV8 A;  1JXE A;  4PA1 A;  5CYQ A;  1X9S A;  2HHT A;  3LAK A;  3ZSO A;  1UWB A;  1BL3 A;  3HP9 A;  3QEV A;  1LAW A;  3OYB A;  1BQM A;  5CZ1 A;  1NK5 A;  1QS4 A;  2ZE2 A;  1TK0 A;  1TGO A;  3LAL A;  4CJS A;  3ZSZ A;  2A1R A;  4RG8 A;  3HL8 A;  4HCC A;  2DTU A;  4OKK A;  1HNI A;  3ZT1 A;  4CHO A;  5HBM A;  4DS4 A;  4BE0 A;  3NH2 A;  1NJW A;  3PY8 A;  4KTZ A;  4I2Q A;  5HRR A;  3VQD A;  1XC9 A;  1ASV A;  5EU7 A;  4CCH A;  3ZCM A;  3SQ4 A;  3LPT A;  3T19 A;  3JSM A;  3TAQ A;  1TL1 A;  3AO1 A;  3KLE A;  4IG0 A;  5FRN A;  4E3S A;  1NK7 A;  4MQ3 A;  1S6P A;  3HVR A;  1JL2 A;  3JYT A;  1CZ9 A;  1GOA A;  3M8R A;  1BHL A;  1KFD A;  3AO2 A;  3EYZ A;  3AVI A;  5KGW A;  1WSH A;  1JLB A;  1DTQ A;  4HVJ A;  1C0M A;  1JLQ A;  2YNG A;  4BE1 A;  4Z4C A;  4FJK A;  3SZ2 A;  1XI1 A;  2IAJ A;  4C8M A;  4ZTF A;  4KI4 A;  2HHW A;  3E01 A;  3RRG A;  4M3X A;  3RTV A;  2Z1H A;  3OYG A;  1U04 A;  4TSX A;  4EZ9 A;  2ETJ A;  4CEB A;  4C8N A;  4K8Z A;  1JKH A;  3QNO A;  4Z4F A;  4RW8 A;  2WOM A;  3TI0 A;  3HK2 A;  4B9N A;  1VSJ A;  3RWU A;  1RIL A;  2B5J A;  1Y97 A;  3DOK A;  1RT5 A;  4CHP A;  4HUE A;  4FK0 A;  4BAC A;  3PUF A;  1WNS A;  4I2P A;  1NKB A;  3SUO A;  4F4K A;  4FYD A;  4DSE A;  4CGH A;  1NK4 A;  5KGX A;  3PO4 A;  5D3G A;  2HW3 A;  2D5R A;  4AHC A;  3OYH A;  1SUQ A;  4FLU A;  3RMD A;  3RMA A;  2GBZ A;  4DLE A;  1VSM A;  4B8A B;  1NK9 A;  1NK0 A;  4GW6 A;  2ATQ A;  4FJN A;  3HPO A;  1KCF A;  3SV4 A;  1RT4 A;  4CED A;  4DSJ A;  4DSK A;  4FZX C;  4M42 A;  3UIQ A;  1EXQ A;  3V9X A;  5DK5 A;  4EP5 A;  2F8T A;  2FC0 A;  2G8K A;  4N76 A;  4CFA A;  1S6Q A;  1KLM A;  4BDP A;  3DLE A;  3V9Z A;  3THV A;  1RBU A;  4FJJ A;  3NGI A;  4CJ4 A;  1RTJ A;  4E19 A;  1RDA A;  1L5U A;  3ZSY A;  2YNI A;  3OYM A;  3V81 A;  2W42 A;  1RDC A;  1LW0 A;  1ZYQ A;  4N5S A;  4FZY A;  4J2A A;  3OJS A;  1IO2 A;  4ZHR A;  1EKE A;  1SKR A;  3L8B A;  3CM5 A;  4E1N A;  1T03 A;  4KKO A;  4CIF A;  1TK8 A;  4B9T A;  4KI6 A;  3OYE A;  3OYK A;  3L3V A;  5E41 A;  2Z1J A;  1BI4 B;  3TAE A;  4CF1 A;  3WNE A;  2LSN A;  3IRX A;  2IOC A;  1VSI A;  4CK1 A;  1U48 A;  3DYA A;  5FRM A;  5K14 A;  3TR8 A;  1Q9X A;  2HHQ A;  4C8L A;  4AHT A;  4JRQ A;  2HHX A;  1WSJ A;  4F3O A;  2HHV A;  1QSL A;  1RBS A;  3LAN A;  1W0H A;  3VQ9 A;  3OJU A;  3K57 A;  3QEI A;  4J2D A;  1LW2 A;  3KK3 A;  3NBP A;  4KB1 A;  2ZD1 A;  1RBV A;  1TKZ A;  4GMJ B;  4CHN A;  1RNH A;  4RW9 A;  3OS1 A;  4CJU A;  4DG1 A;  2OZS A;  4M3W A;  2BAN A;  1WSF A;  1IKX A;  3DOL A;  1HYV A;  4IFY A;  1EET A;  1VK0 A;  1TAU A;  2YNF A;  1TK5 A;  4H4O A;  4CJ5 A;  5J1E A;  4OJR A;  4E7H A;  5DMR A;  2IS3 A;  3LWL A;  1Q9Y A;  4EZ6 A;  4FLX A;  4DSL A;  2KTQ A;  1A5X A;  5SZT A;  1T8E A;  3C94 A;  3WNF A;  3NE6 A;  4OGC A;  2ZQB A;  3LZI A;  3ZSV A;  3SCX A;  2O4I A;  4FJI A;  3VN5 A;  3U3G A;  4LSN A;  1BIZ A;  5J2Q A;  1HYZ A;  4CF9 A;  1LAV A;  2KQ2 A;  4CGD A;  3HYF A;  3K5L A;  4B9U A;  5T7B A;  4R5P A;  2P5O A;  4Z4I A;  2G8U A;  3VQ8 A;  3ISN C;  4FK2 A;  1X1P A;  4BWM A;  3LP0 A;  3O4Q A;  1BQN A;  1TKX A;  3QES A;  2RPI A;  3MED A;  4HUG A;  4Z4H A;  1RDD A;  4CFC A;  3RRH A;  1HYS A;  1VSF A;  5HRP A;  2D0A A;  3L3U A;  3AVB A;  4O44 A;  1VSE A;  3WNG A;  1VRU A;  5JS2 A;  4CK3 A;  4N41 A;  3V1Q A;  3VQA A;  4E89 A;  4IFV A;  1C1B A;  5FDL A;  4KO0 A;  4FLY A;  3LWM A;  3SNN A;  5CZ2 A;  2KFZ A;  3VQP A;  2JGU A;  3QIO A;  2OPP A;  1J5O A;  2PY5 A;  4DQS A;  1HNV A;  3BGR A;  4CJL A;  2YV0 X;  3QNN A;  3DLB A;  4PUO A;  3QET A;  2QK9 A;  4CF0 A;  2A1S A;  3HJF A;  1VRT A;  3PX4 A;  3TWH A;  3KLI A;  4DTM A;  3CFR A;  4DSF A;  3HPH A;  4NCG A;  2XY5 A;  3G10 A;  3LP2 A;  2E4L A;  4CJQ A;  2Y1I A;  1NK8 A;  1IKY A;  4ELU A;  4OLA A;  3L2U A;  4N56 A;  2HMI A;  2Z1G A;  1BIS A;  4XIU A;  2QKB A;  2BGG A;  3V6D A;  2XY6 A;  1WAF A;  2IDO A;  4I9Q A;  4CHZ A;  2GUI A;  4BDZ A;  1NK6 A;  2PYJ A;  1UA1 A;  4CJE A;  3S3O A;  3SPZ A;  2FBT A;  3TAM A;  4E1M A;  2D0C A;  3SUQ A;  4CEZ A;  3DLH A;  4B9S A;  3KKS A;  1A5V A;  4C8K A;  3KTQ A;  1BCO A;  3AVH A;  3VQE A;  3TAP A;  2KW4 A;  4DFJ A;  3EZ5 A;  1YTA A;  3NGY A;  2QXF A;  3KJV A;  1S1V A;  2RKI A;  4E7J A;  4OPJ A;  1HRH A;  2HNZ A;  2YNH A;  3P1G A;  4W5T A;  1TL3 A;  4DS5 A;  3AVG A;  2OZM A;  1BGX T;  1RBT A;  1S9G A;  1JXB A;  2X74 A;  4CGI A;  4E7K A;  4CJR A;  3HM9 A;  4RW4 A;  3L2V A;  5HRS A;  4W5R A;  2IGI A;  2FBV A;  2O4G A;  2E6M A;  3C95 A;  4CEA A;  4ELV A;  1GOB A;  2F96 A;  2X78 A;  1JLA A;  3B6O A;  4WE1 A;  2HB5 A;  1B9F A;  3VQQ A;  5J2M A;  3HPG A;  1N5Y A;  3L2R A;  4B9L A;  1RT7 A;  4KPY A;  1ASW A;  1QE1 A;  2DFE A;  1Z25 A;  3C6U A;  3OS0 A;  3KK2 A;  4E7L A;  2YHB A;  4ZTJ A;  4DQP A;  1Z26 A;  3KIO A;  3NH0 A;  2D0B A;  3NF8 A;  1WN7 A;  3SJJ A;  4CGG A;  1WSE A;  3NCI A;  3TAN A;  1D8Y A;  4O4G A;  3BDP A;  4IBN A;  4ID5 A;  3OS2 A;  3SQ0 A;  4CES A;  3TAB A;  2RN2 A;  4UQG A;  1T05 A;  1KVA A;  4F2R A;  1EP4 A;  1C6V A;  4FJX A;  4KFB A;  2HHU A;  3NGZ A;  1HQU A;  4JS5 A;  2B6A A;  1S9E A;  1QHT A;  4KB0 A;  4M41 A;  3DI6 A;  1X9M A;  2WON A;  1ZBU A;  4JLH A;  3SPY A;  3CG7 A;  4F8R A;  4PWD A;  3ZT0 A;  4FM0 A;  3KD5 E;  3L2W A;  3A2F A;  1D9D A;  2X6S A;  1VSL A;  3IG1 A;  4QAG A;  3VQB A;  3TAG A;  3RMC A;  3SYZ A;  1SL2 A;  3M8P A;  4FJL A;  2G8W A;  1BIU A;  2Z1I A;  3V4I A;  3ZT4 A;  4OPK A;  1ITG A;  4W5Q A;  1CXU A;  3QIP A;  1IKW A;  1C1A A;  1CZB A;  3ULD A;  3AVK A;  3OYC A;  2E6L A;  1RBR A;  4AIL C;  3OYL A;  1NOZ A;  4NCB A;  1FK9 A;  3AA2 A;  3KLF A;  3V9S A;  1NKE A;  4DSI A;  3NF9 A;  1L3T A;  5KRS A;  1RT6 A;  3IAY A;  4FM2 A;  3S3N A;  1NOY A;  2HND A;  1GOC A;  3ASM A;  1QTM A;  4CGJ A;  3AA5 X;  3F9K A;  3K2P A;  4HHT A;  3DLG A;  1LWF A;  3VA0 A;  2OPR A;  4HCB A;  4Q5V A;  3NHG A;  3MXI A;  3K5N A;  3DRP A;  4CEC A;  4DMN A;  4EP4 A;  3OYA A;  4CFD A;  1KFS A;  1WLJ A;  2G8H A;  3ZSX A;  1ZBL A;  4ICL A;  2NUB A;  3S9H A;  3AVJ A;  2VG7 A;  4Z4G A;  5KRT A;  4CJP A;  3PX0 A;  4KAZ A;  4NYN A;  2XHB A;  1J54 A;  4CGF A;  4KRE A;  3OVN A;  1RT1 A;  4Z0U A;  3V1R A;  3MEC A;  1D5A A;  1JLC A;  3QER A;  4MFB A;  3CQ8 A;  4N47 A;  3SUN A;  1REV A;  1S1T A;  1XHX A;  3ZSQ A;  1JLE A;  3NAE A;  3AO5 A;  3RR8 A;  1HJR A;  4W5N A;  4OVL A;  4M3Y A;  3D45 A;  4G1Q A;  4DQR A;  4KHS A;  3VQ6 A;  3HXM A;  4FJG A;  3O3G A;  4DFP A;  3AVC A;  3CFO A;  4CJ3 A;  4DU1 A;  2XY7 A;  1YVU A;  1I39 A;  3NDK A;  2VWK A;  4RW7 A;  2P5G A;  3FFI A;  4DTR A;  3V9W A;  5J2P A;  3KD1 E;  2YKN A;  4CIE A;  4CER A;  4FLZ A;  1XWL A;  3DRS A;  4J2B A;  3K5O A;  2DFH A;  1I3A A;  4DTJ A;  4C8O A;  5CY4 A;  4O55 A;  4CF2 A;  4Y1C A;  4JRP A;  4QCL A;  2KFN A;  3MEE A;  4GVM A;  3VA3 A;  1R0A A;  3SI6 A;  4FLT A;  4PY5 A;  4DU4 A;  1SV5 A;  3MAQ A;  3LP3 A;  3I0R A;  1L3V A;  4CEQ A;  4KHY A;  1WAJ A;  4CEE A;  2IC3 A;  1NJX A;  5HRO A;  2EX3 A;  1FKP A;  1BCM A;  3K58 A;  4NCA A;  2KZZ A;  4M3R A;  1C0U A;  1WSI A;  4LD0 A;  4FXD A;  4BDY A;  4AHS A;  3SQ1 A;  2VG6 A;  4AHV A;  4KRF A;  5C42 A;  4AHR A;  3DLK A;  2XRI A;  4I7F A;  3WNH A;  1IH7 A;  4O0I A;  3O4N A;  4OLB A;  3LPU A;  3K5M A;  1XHZ A;  2QKK A;  3KLH A;  2ITG A;  2YHA A;  4NYF A;  1T7P A;  4FK4 A;  2HVI A;  3QO9 A;  2EHG A;  4FW2 A;  1O1W A;  4LH4 A;  1SKS A;  4FZZ A;  1RCH A;  4B08 A;  4B9M A;  1HQE A;  4OKJ A;  4CE9 A;  5JS1 A;  4CJF A;  3KK1 A;  3AA4 A;  3MXM A;  4O5B A;  1U4B A;  2BDP A;  4IDK A;  1TV6 A;  2DFF A;  4CK2 A;  4CHQ A;  4YFU A;  3ZSR A;  1YT3 A;  3DRR A;  1RT2 A;  3CYM A;  3K59 A;  2PZS A;  3OY9 A;  3OYF A;  1A5W A;  4QOZ B;  3VQC A;  3QEX A;  1LWE A;  3VQ4 A;  3OYD A;  5CYM A;  4FJ5 A;  3AVL A;  1CXQ A;  3DMJ A;  4RW6 A;  4W5O A;  3LDS A;  3AO3 A;  1SL0 A;  4FJH A;  4BE2 A;  4E7I A;  3AO4 A;  3LZJ A;  1UOC A;  4HUF A;  4DFK A;  1U47 A;  2X6N A;  4Q0B A;  3P5J A;  3PX6 A;  4FVM A;  1NKC A;  4KHQ A;  1S1W A;  3NFA A;  1QQC A;  5C24 A;  4M3Z A;  4DU3 A;  1J53 A;  4KTW A;  1KRP A;  1DTT A;  3ZT3 A;  3TAR A;  2AJQ A;  2VG5 A;  2OPQ A;  1KLN A;  3MXJ A;  2HNY A;  1RT3 A;  1Q8I A;  5HLF A;  3M8S A;  4CJV A;  1RDB A;  3AA3 A;  5HRN A;  1IG9 A;  2P1J A;  5C25 A;  1QSY A;  3CFP A;  2R7Y A;  1EX4 A;  1RTI A;  2P51 A;  3SUP A;  1LV5 A;  3D0P A;  1U49 A;  1QSS A;  1C1C A;  3QIN A;  1SL1 A;  1K6Y A;  3AV9 A;  4B9V A;  3F73 A;  4DTP A;  1JL1 A;  1ZBH A;  2RF2 A;  3CM6 A;  3KKR A;  4FCY A;  4PQU A;  2GV9 A;  3MEG A;  1C0T A;  4O0J A;  1FXX A;  2Q3S A;  3HT3 A;  4FLV A;  4CJW A;  4AHU A;  3OYJ A;  3NH1 A;  3DLR A;  4FJ9 A;  1S1U A;  2F8S A;  4DTX A;  1TKD A;  1L3U A;  2HHS A;  1G15 A;  3P83 D;  3QLH A;  2FBY A;  2XY8 A;  4DTS A;  3U6F A;  2XO7 A;  3SV3 A;  4HTU A;  1S5J A;  3O3F A;  4KTQ A;  4Y1D A;  4J2E A;  4CFB A;  4M45 A;  4I9L A;  3O3H A;  4DF8 A;  1RTD A;  2JLE A;  1NJY A;  3AVF A;  3PO5 A;  3L2Q A;  4FJ8 A;  4OGE A;  3OYN A;  4CEF A;  1W9H A;  4F2S A;  1HPZ A;  3LP1 A;  4LH5 A;  3EY1 A;  2KZM A;  1VSH A;  4FLW A;  4KHN A;  1TAQ A;  1S1X A;  1IKV A;  3T3F A;  4AH9 A;  4M3U A;  4Z4E A;  1HMV A;  4CJK A;  1F21 A;  4H4M A;  4FW1 A;  1KVC A;  1N6Q A;  1MU2 A;  1U45 A;  4DWI A;  3V9U A;  4B8C A;  5FRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...