2GELA

2.05a crystal structure of salmonella typhimurium yeaz, form b
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
218
structure length
218
Chain Sequence
MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Gram negative resuscitation promoting factor
publication title Structural Characterization of Salmonella typhimurium YeaZ, an M22 O-Sialoglycoprotein Endopeptidase Homolog
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
total genus 66
structure length 218
sequence length 218
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gelA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gelA02
5AZJA 2YJFA 3ZX3A 5AQFA 4B1XB 3IMXA 3CQYA 3AAPA 3I8BA 1QQNA 5E26A 3WEEA 2A40A 3FZMA 5AQXA 4BR0A 2HF3A 4L3QA 4CJ7A 1HKCA 3VENA 3R9PA 2E2OA 4IO8A 4A2AA 4BRHA 1ATRA 2QWPA 5AQPA 2Q97A 2QXLA 1H1VA 1QHAA 1BG3A 3CETA 3KHYA 2QWOA 1MWKA 3EN9A 3EZWA 3MN7A 4EHUA 3CIPA 3ZX2A 3GOIA 1XUPO 3MN9A 3H45C 4NO7A 3M3ZA 3SK3A 3D2EA 5AQRA 3RSEA 2GEMA 4XH5A 2D4WA 4BQLA 4IZ9A 2ASMA 1ATSA 1NLVA 4BC3A 2UYTA 2YHXA 3CI5A 3C0BA 3HBTA 2V7YA 5AQUA 2W40A 3ZX0A 1X9JA 4MO4A 5BREA 1T44A 3VETA 3ULEB 3WQUA 2AP1A 4C23A 2CH6A 5KPZA 2P9NB 4CZEA 3ZETA 4BRGA 1SZ2A 5E84A 3CJ1A 1D4XA 2A6AA 4ISEA 4B1VA 4MLHA 3FLCO 2GWJA 3VGKA 5JLHA 1E4FT 4JAXA 1GLEG 1ZXOA 2FXUA 4KBOA 1V4TA 4JD2A 3CJ9A 1BDGA 4RCHA 2ASPA 3GL1A 4EAHD 4BR9A 4WQ5C 3GBTA 1NGJA 4M63C 2FLOA 5AQSA 5EY4A 2CH5A 3SMSA 2FSKA 4BR4A 4EIAA 2P9IB 3A8YA 2ASOA 4BQZA 4FWPA 3GG4A 3MCPA 2J4RA 4RTFD 3BUZB 3LDOA 4BRIA 2Q2RA 1YUWA 3GDQA 1QZ6A 5BPMA 4BRMA 3VPZA 1S3XA 4CBXA 4H0YB 4CD3A 5CE3A 2QM1A 4LC9B 3LM9A 3IUCA 4BVOA 2V52B 4BC4A 4PL8A 5AZJB 4CZMA 2QWMA 3UKRA 2FSJA 1LOTB 2I7NA 3ATUA 2Q1NA 4BRFA 3WT0A 4CZLA 5ELZA 4CZGA 3WEEB 3L6QA 3ENOA 2VCPA 5AQJA 2FSNA 3VOVA 1NBWA 1NM1A 5AQTA 5BRDA 2I7PA 3ENHA 4IWVA 5FPNA 4BG9A 3HZ6A 4DCHA 4YDUA 4PKHA 3U9ZA 1GLFO 4DQ8A 3D2EB 3RSEB 2PBDA 5TKYA 2KHOA 1GLJO 4XH1A 1SAZA 4JHDA 4CD1A 1MA9B 2E88A 1NGCA 3O8MA 5KQDA 2YI1A 3FZLA 3BF3A 1DEJA 2E1YA 5ADXH 5AR0A 3SLCA 3H3NO 4BG8A 1HJOA 3ZETB 3UE5A 1BUPA 4BGBA 5F2RA 5LY3A 2D0PA 4PKIA 5JLFA 4H5TA 5ADXA 1ZBSA 3CJAA 4QS8A 3WQTA 2P9KA 4CI6A 3WXKA 3VEXA 2NLXA 4K43A 1LCUA 4WQ4A 2CGLA 3EKUA 1BU6O 2BUPA 3O4WA 3O6WA 4JD2B 1Y64A 3DXMA 1GLDG 3D7EO 3QMLA 4HTLA 2E2NA 3VF4A 5AQIA 4B1WB 3P4IA 1YAGA 1NGEA 1P8ZA 4O5FA 4RWTA 2ZGYA 2WUSA 1YXQA 2CGKA 2V51B 4H5VA 3D2FA 1RDWX 3QBXA 1BWFO 4FWNA 2Q36A 3F9MA 1GLAG 3HI0A 2P9LA 3DXKA 3FFKB 3VF2A 1RGIA 3BP8A 3CJ7A 2ITMA 1JCFA 4O8KA 5JICA 1EQYA 3LDPA 4GNIA 1TUUA 5EOYA 4ISGA 3UKRB 3ID8A 3QICA 1V4SA 2QWLA 1BA0A 4XH4A 3OHRA 4JNEA 2ZGZA 4H0PA 3A0IX 1ZC6A 3L4IA 2FF6A 4IJAA 3J8AA 5FPEA 3M1FA 3AY9A 4GY2B 2VWBA 2E2PA 2P9UA 4H5RA 2IVOA 1XQSC 4MO5A 4A2BA 2QWNA 3FZHA 1Q18A 1NGGA 5AQNA 5I9EB 2CGJA 2GUPA 3S41A 3QBWA 4H0XB 4B1UB 2FF3B 2VYPA 2HF4A 2P9PA 2ZF5O 5AQYA 3W0LA 3BEXA 3LDQA 1JCEA 3H3OB 4JHDB 1K8KB 4NB4A 4BGAA 3VEOA 4PL7A 4AM7A 5F0XA 5AQOA 2NRHA 1HPMA 2F9TA 3CJBA 2QW9A 1HUXA 1U6ZA 5AQHA 1S22A 5BN9A 3WXIA 4BREA 1U2VA 4H5NA 5AQWA 1NGFA 2IVNA 3O08A 3VEVA 3IFRA 4CZJA 3QDKA 4CZKA 5AQKA 1NGDA 2E2QA 5BPLA 4FWOA 3EL2A 3WUHA 3W3DA 5LJWA 3FGUA 3VF6A 4Z94A 4I6MA 4J8FA 1OKJA 2P9SA 4QS7A 2QWRA 3GE1A 2YJEA 4FPBA 4Y0WA 4WQ5A 5AQVA 3QFPA 4FPAA 3LDNA 3WXLA 1IJJA 4FOIA 3DXMB 4ISFA 5BRFA 3HTVA 1Z6RA 4BR7A 1IG8A 2ZWHA 3KVGA 5B8HA 1TYQA 4B1YB 3FE1A 3D2FB 3VEYA 3H46O 5AQGA 3C7NA 1GLLO 1DGKN 3MN6A 1WUAA 5BPNA 4IXCA 2BTFA 2PAVA 1X3MA 2P9LB 3DXKB 1GLBG 4QS9A 3CHWA 4A61A 2E1ZA 2IIRA 3CQXA 2D0OA 1ATNA 3EKSA 3O1WA 3MMVA 2F9WA 1HLUA 2Q0RA 1MDUB 3A5LC 4PKGA 5AQQA 5AZIA 3ZEUA 3CJCA 4BRCA 5BN8A 4B9QA 2IVPA 3CERA 3MK6A 3IDHA 1J6ZA 2H3GX 4EFHA 4FO0A 2A41A 1SQKA 3L0QA 1QZ5A 2P9UB 1QQMA 1NGHA 3R8EA 3AARA 4BC5A 2HOEA 4K42A 2E20A 3R6MA 4B1ZA 4FWMA 4BC2A 1YVNA 4A62A 3DJCA 4CZFA 1HX1A 3DAWA 3LL3A 3MDQA 3VEZA 2AA4A 2QWQA 4FL9A 3U8XA 3WXJA 4H5WA 2P9PB 4BRAA 5AQLA 3HSCA 3UKUA 3FZKA 2DPNA 1Z05A 3UB5A 1HKGA 2YHYA 2Q31A 3QFUA 4BVPA 4M7YA 5KPTA 3BF1A 1KAZA 5KQ8A 3FZFA 1HKBA 2HMPA 4BRQA 1BOTO 1QQOA 2NZTA 1U2VB 3B8AX 3A5NC 5JMVA 3VESA 1C0GA 4K25A 4FWQA 3O1BA 1CZAN 3FR0A 5EX5A 3ATVA 4H03B 4MLEA 4CBUA 2D1KA 1ESVA 3AAQA 2V7ZA 1NWKA 4I6MB 2P9SB 3A5OC 4DHYA 4JN4A 3EO3A 2EWSA 3VGMA 2A3ZA 1R59O 3H6EA 4BR2A 4DB3A 1NGIA 5AQMA 3U9DA 1KXPA 1WOQA 2GELA 4BRPA 1NGAA 4AM6A 5F1XA 1BO5O 5FPMA 1TYQB 1E4GT 4BRKA 1RFQA 4BR5A 4CZIA 4YDUC 3LM2A 1T6CA 3C7NB 2W41A 2GWKA 3O80A 3TPQA 3QB0A 4FSVA 5EXWA 4FWKA 3ULEA 3A5MC 4CZHA 1X3NA 5BR9A 2P9NA 4FOEA 1NGBA 3M6GA 5LJVA 1KAXA 3VGLA 2OANA 5AZIB 2A42A 3SMPA 3ZEUB 2Q0UA 2YCHA 2P9KB 1NMDA 3G25A 4BRLA 3JS6A 4FWSA 4CBWA 3LDLA 4H0TB 4XEIA 4WYBA 4BROA 1MWMA 4FWRA 1KAYA 4H0OA 5AFUH 2YHWA 4K41A 1DKGD 4IJNA 3KZBA 4E1JA 4F9OA 1T6DA 4EHTA 3VEWA 1TUYA 4WQ4C 5BRHA 1C0FA 3I33A 4FWLA 3MN5A 2GTDA 1JCGA 4BRDA 5AFUA 3H1QA 1BA1A 3HM8A 3SJHA 3DWLA 2P9IA 1G99A 5AQZA 5KPRA 5EVZA 5FPDA 4M7XA 3O5BA 3VERA 3H1VX 1XC3A 3UKUB 4HWIA 2A5XA 3U4LA 4BRNA 2E8AA 3TU5A 1GLCG 4H0VB 1K8KA 3JXUA
chains in the Genus database with same CATH superfamily
1GOAA 3CC4N 3ZX3A 1VSLA 1W97L 3OYIA 5M1PA 1QQNA 3FZMA 4KTZA 4CJ7A 4GV9A 4DV7K 3VENA 3R9PA 2E2OA 3QEIA 5DMRA 1REVA 4JV5K 3K9KA 1EWQA 4DV0K 3G4SN 2QWOA 1NK5A 2OYQA 3ZX2A 3B6PA 4NO7A 3H45C 1NK8A 3SK3A 3D2EA 5AQRA 3WNGA 1NLVA 2YHXA 3CI5A 4I9LA 4N5SA 2D0BA 5HRSA 3HBTA 3OYHA 5AQUA 3SUQA 3ZX0A 1KVBA 3ID6A 3RVCA 2HHQA 2UXBK 3HVTA 1ZBLA 1ZBHA 3TSQA 3BDPA 3ZSQA 4E3SA 4C23A 4Z4EA 2CH6A 2KFNA 2P9NB 4HTUA 2ZJQL 4DS4A 4JAXA 4LH5A 1GLEG 2WBNA 4F8RA 4JD2A 3HT3A 1VSEA 2ASPA 4CW7B 3GL1A 3RR7A 4WQ5C 2PYLA 5EU7A 4LF8K 1NGJA 1Q9YA 2BE2A 4JI5K 3OTOK 1IG9A 4JI1K 1QVFM 1SV5A 2OZSA 3GG4A 4YY3K 1HRHA 3VQAA 4FW1A 1VQNN 2Q2RA 1YUWA 3FFIA 4DU3A 5BPMA 3QEXA 3T1HK 4LC9B 2D0AA 3IUCA 4BC4A 1JKHA 1TKZA 2O8DA 4PL8A 5AZJB 3UKRA 4CECA 2I7NA 2P5OA 4MDBA 4C8LA 3WEEB 1WBBA 2VCPA 4CEDA 3VOVA 4M42A 4E7KA 3RMAA 5C2DA 4FLZA 2XO7A 4W5OA 2HVIA 4IWVA 4U7BA 4CEQA 2JWKA 4BG9A 4B9NA 4JYAK 5H1SQ 3D6RA 4PKHA 3L2UA 3U9ZA 3VQCA 4AF1A 1GLFO 3RSEB 2B4JA 2PBDA 4J2AA 2ZM6K 2KHOA 1SAZA 4FVMA 4JHDA 3ZT0A 1KLNA 4FJNA 4JRQA 1P90A 1WAFA 3NE6A 3AGKA 4C1NI 1A5XA 2Z1GA 1VQMN 4CFDA 3FZLA 1NK6A 1BIUA 4ELVA 1XHXA 1DT9A 3TR8A 5C42A 3SLCA 3H3NO 3ZETB 3J80O 5C25A 3VA3A 1WN7A 3QEWA 1L3UA 3P1GA 3L8BA 4YOWA 4H5TA 1ZBSA 3L3VA 1NJIO 4QCLA 3WXKA 3E9OA 4K43A 1LCUA 1I94K 4CJRA 4DV4K 1BU6O 5GAEP 3NDKA 1TGOA 2BUPA 3KD1E 4CF1A 4CF2A 1VRUA 3K5OA 1VQLN 3AVFA 3D7EO 3VF4A 3HP9A 3P4IA 1WSEA 1J54A 3LZJA 2WUSA 2V51B 2KZMA 4IEEA 4WCEL 3KLGA 3D2FA 2DY4A 1BWFO 4FWNA 2Q36A 3CMEN 4F4KA 1FXXA 3ZLJA 3AVMA 1ASUA 1Q9XA 2P9LA 3VF2A 3BP8A 4JEPA 1VSFA 4O8KA 1RDAA 3AA2A 4CIGA 4GNIA 1WSIA 5C24A 4KFBA 3U3GA 2BGGA 2R7YA 3QICA 1ILYA 1V4SA 1BA0A 3EE9A 4GKKK 4JNEA 3EYZA 4CEEA 3A0IX 1ZC6A 2VGMA 3JSMA 2P9UA 1WAJA 3RRHA 4LSLA 3FZHA 1IBKK 2Z1HA 1NGGA 5I9EB 1D5AA 3NGIA 4NLCA 1UA0A 2VYPA 3P38A 2P9PA 4RW4A 4H8KA 2VG7A 4CIEA 3W0LA 1NK7A 3V81A 3LDQA 1JCEA 3DLLL 1C6VA 1U04A 4AH9A 2NRRA 3THXB 5AQHA 1HUXA 1S22A 2GV9A 3WXIA 3T3FA 2QEXN 4RW8A 2IVNA 3VEVA 3N4PA 1W0HA 4ILHA 1HNZK 2O8EA 4IOXA 3WUHA 4CK2A 5LJWA 4DR4K 4GV6A 3VF6A 3R3LA 1VQ7N 4IEIA 4DV3K 2P9SA 3TAEA 2QWRA 4Z0UA 1LW2A 1HNWK 4DV1K 4Z4IA 1RBSA 2HB5A 5BRFA 1BGXT 4BR7A 5C12A 3TAPA 3JAMO 2O8CA 2DFHA 4CEAA 1N5YA 3IG1A 3WXMB 2RKIA 2DTUA 1DGKN 3MN6A 1WUAA 4AHTA 2BTFA 1JLFA 3SV4A 1EP4A 2PAVA 4HCBA 1X3MA 1RBUA 1GLBG 4QS9A 3NH1A 3CHWA 2YHBA 4A61A 2VQFK 3CQXA 3G10A 1ATNA 3EKSA 3O1WA 1JL2A 3MMVA 4WFNL 2F9WA 2Q0RA 1MDUB 4PKGA 5M1FA 3SQ2A 4KKOA 5BN8A 2P5GA 3AVNA 3HRGA 5HRNA 1TAUA 1A5WA 4FO0A 3WNEA 2W6KA 3SNNA 3MCAB 2D5RA 4CCHA 2IAJA 4FJKA 1NGHA 4I2QA 4BC5A 4JS5A 4K42A 3SV3A 3HK2A 3LALA 2O8FB 3M8SA 3NVMA 1HX1A 4B9SA 3QEPA 2QWQA 1VQON 1OVYA 1TKDA 3SCXA 4FL9A 3HYFA 4QOZB 2RE2A 3WXJA 1HNIA 1FKOA 4BRAA 3CG7A 3VQ8A 1Z05A 4JKGB 2OPRA 1XC9A 2Q31A 4FJ7A 5M1QA 4M7YA 1KSPA 1HKBA 2HMPA 4BRQA 1BOTO 3D0PA 3L2QA 4BE0A 1BHLA 3RMDA 2YNIA 4CEZA 4F3OA 1A5VA 3O1BA 1CZAN 3K59A 4CFAA 3I56N 1NKCA 4I6MB 1IKWA 4JN4A 1RDDA 5LMNK 4GKJK 5BR8K 4JI0K 2X6SA 4KH6A 1HMVA 1XI1A 1NGIA 5AQMA 4ELUA 1WOQA 4CHQA 4BRPA 3QNNA 3MECA 1S72N 3VQQA 1BO5O 3NMUA 2D0CA 4DUZK 4BRKA 4CZIA 4YDUC 3H08A 2GWKA 4FSVA 3SUNA 3OVNA 4DR7K 5C15A 4CFBA 2JWLA 1JLAA 3QESA 4DR1K 5JS2A 2P9NA 3NCIA 4LH4A 4B3SK 1VSMA 1C0UA 2A42A 5AZIB 2Q0UA 2YCHA 3F73A 3LAKA 4KHYA 3SQ0A 2XY5A 4BRLA 3PLAA 1RT5A 1W2BM 1IV0A 3LDLA 4XEIA 4W5NA 4EP4A 2KZZA 3DLHA 4IO9L 3AVKA 1T6DA 3PUFA 1DTQA 5BRHA 4FWLA 3I33A 4AHUA 4A57A 4Y1CA 4EZ6A 1BA1A 4A5AA 3RWUA 3ULDA 1OVQA 5GINA 3DWLA 5EVZA 4U67L 2PYJA 3HM9A 4W5QA 4HWIA 4BRNA 3LAMA 4M3RA 3OYLA 3TU5A 1GLCG 4H0VB 4XIUA 3O3GA 1K8KA 3KTQA 3OS2A 3Q7CA 5AZJA 1NKEA 3TWHA 3IMXA 3CQYA 1LAWA 4V19S 3AAPA 5J2MA 3AVLA 3WEEA 5E26A 3CFPA 3TAGA 4CESA 3T7ZA 2ZE2A 4YOYA 1QQCA 1Q82O 4I9QA 4AQYK 1N34K 5AQPA 4FK4A 1BG3A 3OYDA 1MWKA 3EZWA 3MN7A 4EHUA 3MN9A 4E1NA 3ZT4A 3RSEA 1XHZA 2XRIA 4FYDA 1C1BA 2KKZA 4DQIA 1IH7A 4OKEA 2W40A 3KK7A 1X9JA 4MO4A 5BREA 1T44A 1TV6A 1WB9A 1J53A 3NF8A 2AP1A 1IKVA 4CZEA 3PIOL 3ZETA 1SZ2A 1D4XA 2A6AA 2VGNA 3VQDA 1KQSM 2E5LK 4MLHA 3FLCO 2GWJA 2UUBK 3LPTA 1NJXA 4PWDA 3TI0A 4N41A 4PY5A 3CJ9A 4KHUA 3DI6A 3S9HA 3G71N 4M63C 2FLOA 5AQSA 3T1AA 4DFJA 2Z1JA 3ZT1A 3VTHA 3NAEA 1VQ8N 4ID1A 3A8YA 3O9SA 4C8NA 1HJRA 3MCPA 5HRRA 4RTFD 4RW9A 4BRIA 4YOUA 2F8TA 1IKXA 2HHWA 3IKMA 4CD3A 4IBNA 5MLCQ 4FM2A 4DQPA 3LM9A 5GIOA 3NFAA 4UY8O 3OYBA 4CK3A 3SPYA 4KB1A 1LOTB 1NK4A 2XHBA 3ATUA 3V6DA 3EEQA 4OGEA 4M3XA 1C1CA 4CF0A 4X65K 1N6QA 3WT0A 5ELZA 4CZGA 4GV3A 2FSNA 1NBWA 3KWIA 1RBTA 3MWPA 4ID5A 1B9FA 3NGYA 3HZ6A 4IFYA 3P31A 3T1YK 2VWJA 4FLYA 4PA1A 1UA1A 4YOVA 1OH6A 4N76A 4E7IA 1GLJO 4XH1A 3MEDA 3PSIA 1YT3A 3THXA 2HHUA 2E88A 5KQDA 2WONA 2HHSA 3OBYA 3HOSA 1K73O 1BQNA 4CJKA 1BUPA 4BGBA 1SKRA 5F2RA 4CIFA 2D0PA 4PKIA 5JLFA 5ADXA 3CJAA 4DUYK 4B9VA 2QKBA 2Y1IA 4BDZA 4LF5K 3VEXA 4JKHA 3OYEA 1IO2A 2IGIA 5IWAK 3O4WA 1Y64A 3SBTA 5AQIA 2G8HA 2G8UA 4IDHA 4DFMA 3NF7A 4OKKA 5CYMA 3AO2A 1KFSA 3LDSA 3SQ4A 2F7TA 3CYMA 1JJ2M 3BY5A 3Q7BA 5JVGL 1WSGA 3I8DA 4I2PA 2ZJPL 3SBGA 3FFKB 3LP3A 3PX4A 3K5NA 3ZSRA 5JICA 4CJFA 3DLEA 1XMQK 3TAFA 5GAHP 4KI4A 4ISGA 3OJSA 2F4VK 2GX9A 4H0PA 3ZSZA 3OS1A 3J8AA 3DRSA 2E2PA 4RG8A 4JS4A 4CGIA 2EX3A 4NCAA 5AQNA 4KTQA 5KRTA 3O3FA 4JKAA 2O8FA 3KIOA 2YNFA 4C8KA 2HF4A 4ZTJA 1EO1A 2F96A 3BEXA 5C10A 1VQ6N 4JKGA 1K8KB 4ZHRA 2HBMA 4K8ZA 4PL7A 4AM7A 4FM0A 4LD0A 4DSLA 2G8VA 1IBMK 1J9AA 2QW9A 3CJBA 3VN5A 4FZYA 1RTJA 4YFUA 5AQWA 3ZSWA 4HUGA 2G8FA 3O08A 3G0ZA 4CZJA 4NCGA 3SPZA 5AQKA 1M90O 5LMUK 5BPLA 4FWOA 3V9UA 3R1XA 1ZYQA 1CXQA 4I6MA 4M45A 3F5TA 2JLEA 5C2FA 2YJEA 5AQVA 2AJQA 4ELTA 3LDNA 4IOAL 1L3VA 1IJJA 1X9WA 4FOIA 3DXMB 5LL6Z 3DLRA 3HTVA 1W7AA 1EXQA 1IG8A 3AVBA 2G8WA 4GVMA 2ZWHA 5B8HA 1WSHA 4B9LA 4PUOA 5AQGA 5M1NA 5IT9O 4RW7A 4N56A 5BPNA 4FJMA 4FLXA 2DFFA 3DXKB 3DM2A 2O4IA 1D8YA 4LY7A 2D0OA 1YIJN 1S1TA 3V1OA 5AZIA 2NRTA 3WNHA 3DOLA 2P51A 3MK6A 4W5TA 3L2VA 1QE1A 1TK8A 1C0MA 1QZ5A 4MQ3A 4CHPA 4HUEA 3VTIA 4L8RB 4H4MA 1FKPA 2HOEA 3OS0A 2YHAA 1NK9A 1YVNA 2E4LA 4A62A 3MXMA 4CZFA 3VEZA 4F2RA 2UXCK 3V1RA 1F21A 3U8XA 5HOOA 3THWB 1T05A 5AQLA 1ITGA 3KD5E 1XMOK 1XNQK 3PV8A 3FZKA 2DPNA 3QFUA 3CCVN 2PZSA 3BF1A 2OPQA 4J2EA 3TTFA 3HPGA 1QQOA 1U2VB 3B8AX 1Q86O 5JMVA 4DF8A 2X6NA 3ZSOA 1C0GA 4O4GA 1T8EA 4C8MA 5EX5A 4H03B 4KHWA 2D1KA 5J1EA 1VSDA 3BZKA 2V7ZA 1NWKA 4DR6K 4DTUA 3EO3A 3N4QA 2HBJA 1HQUA 2O4GA 2A3ZA 4DLGA 3KLEA 1JLQA 1YTAA 1XWLA 4JLHA 2E6MA 1FW6A 4AM6A 2G8KA 2FBYA 2HSTA 3CXCM 1SL2A 1RFQA 1ZBIA 3KLHA 3ISNC 3C7NB 2W41A 2B6AA 2QA4N 5EXWA 2YV0X 4OJRA 3QERA 4FWKA 3JYTA 3A5MC 4WE1A 4CZHA 1QTMA 3KKSA 1X3NA 1X9SA 3M6GA 5LJVA 1KAXA 2HBKA 4CGDA 3K57A 3ZEUB 3OYGA 3C6AA 4CGGA 2KQ2A 5J2QA 4JK7A 4CBWA 4OPAA 4H0TB 3CCMN 4WYBA 4BROA 3TANA 4CEFA 1NG9A 4FWRA 3V1QA 3C65A 4CERA 1LV5A 4H0OA 3CC7N 2DFEA 3SI6A 1DKGD 4IJNA 3KZBA 3MEEA 4JKDA 4DFKA 3VEWA 1TUYA 1T3VA 1JCGA 2VG6A 1TKXA 4FLVA 3SJHA 4GMJB 1EWRA 4B9MA 1G99A 1S1WA 4KHNA 3AV9A 5FPDA 4M7XA 1JXBA 3VERA 4MFBA 3UKUB 3U4LA 4E19A 3JXUA 2YJFA 4B1XB 3IRXA 3PO5A 2HHTA 1BISA 4FCYA 4KI6A 2HF3A 4L3QA 2XY7A 1HKCA 4YOTA 3L4QA 2IOCA 4FLUA 3D45A 3ALYA 5M1OA 2Y1JA 1KLMA 1ATRA 4R5PA 1TAQA 3DLBA 3SAGA 2Q97A 4HCCA 2YNHA 1H1VA 3CETA 3THVA 3EN9A 1X9MA 4DSJA 4FZZA 1VSJA 3AVCA 3OW2M 3M3ZA 1N36K 3VA0A 3DOKA 4CGHA 2GEMA 4XH5A 2D4WA 4BQLA 1EETA 2ASMA 1KC8O 4CEBA 1RT6A 4HVJA 4DKWA 4KPYA 2V7YA 3DRRA 4DWIA 1NU0A 4M3TA 5DM6L 3QNOA 3VETA 3ULEB 2IDOA 2NRXA 5CYQA 4BWJA 3OJUA 4BRGA 3LZIA 5E84A 4DU4A 1RTHA 2XY6A 3M8PA 4M3YA 4M3UA 4ISEA 1BL3A 4G1QA 1JLGA 1LW0A 3NH0A 4B1VA 4JI4K 3DLGA 4OPHA 3I55N 4DV5K 2ETJA 4DSEA 3VGKA 5JLHA 1QSYA 4CHZA 4WFBL 1ZXOA 3WNFA 2FXUA 4OLBA 1RT7A 1N33K 2VG5A 1BDGA 4F2SA 4FM1A 4RCHA 4EAHD 4BR9A 3GBTA 3NF6A 1DTTA 5EY4A 4BY9C 3ZSXA 2CH5A 2ZD1A 1JLCA 3SMSA 4EIAA 4JK8A 1HYZA 2P9IB 2ASOA 2F8SA 2NRWA 4IG3A 4BQZA 2J4RA 3BUZB 1S9GA 4DTRA 3CC2N 3GDQA 4CBXA 3VPZA 1VSIA 4KH5A 1U4BA 4KREA 3SUPA 2BH1A 4BVOA 5HROA 1CZ9A 1TK0A 4BRFA 4B3OA 2KW4A 4O44A 2ZJRL 4MDAA 2WFBA 5CR4A 3ENOA 4KRFA 1ASWA 3AGRA 5BRDA 3S3NA 4FJIA 1BQMA 3AVJA 3ZSYA 4AILC 5FPNA 5GADP 3RTVA 3V4IA 1VQPN 4JI3K 1CXUA 1VK0A 5HRPA 4YORA 4LFAK 4J2BA 3A2FA 2FBVA 1U47A 1WNSA 3VQBA 5TKYA 2QKKA 5M1KA 4OPKA 3EY1A 4JKCA 3TSPA 4NCBA 4KHSA 4Q5VA 4KHPK 3VQ5A 1RBVA 4FLWA 1YJNN 3THYB 2JGUA 3RR8A 4DQQA 1NGCA 3O8MA 2WTUA 4NYNA 2YI1A 4OX9K 4EZ9A 1DEJA 5ADXH 4E7JA 1HJOA 3UE5A 3EE8A 1JLBA 5LY3A 4J2DA 1HNXK 3TSUA 3U6FA 3VQ6A 2P9KA 4CI6A 2NLXA 3ASMA 3P83D 3CM5A 3K58A 4WQ4A 2CGLA 3QLHA 1DLOA 4CJ3A 2GBZA 3DXMA 1GLDG 3QMLA 4HTLA 2E2NA 4B1WB 2KLAA 3OA9A 4TSXA 1XNRK 3NHGA 1JLEA 1P8ZA 4O5FA 4RWTA 1VSHA 3OYCA 1YXQA 4H5VA 1RDWX 5E41A 2HNDA 4AHCA 3QBXA 2ITGA 2FC0A 4CFCA 3TTDA 3KK3A 4PQUA 4FW2A 3F9MA 1GLAG 1R0AA 3DXKA 4C1NK 1RGIA 2ITMA 1KRPA 4EP5A 2OZMA 3K9JA 5EOYA 4DG1A 3O3HA 3HOTA 3J81O 5HL7L 2QWLA 4JKFA 3P39A 3LANA 3K5LA 3L4IA 4IJAA 5FPEA 3CF5L 2HW3A 3M1FA 5I3UA 4GY2B 3P5JA 4LSNA 3MX5A 4H5RA 1U49A 2IVOA 2P1JA 4JKEA 4MO5A 1J5OA 2WOMA 1RTIA 2QWNA 1Q18A 1EX4A 3AO3A 4DSIA 3HJFA 3V9XA 5HLFA 4F3TA 4B08A 3SUOA 2ZF5O 3THWA 1BI4B 3VQ4A 1M1KO 1K6YA 3H3OB 5SZTA 4BGAA 3ZT3A 1GOCA 4DTOA 4CF8A 5F0XA 1NJWA 1SKSA 4B3MK 5BN9A 3MXIA 3CPWM 3F2KA 4BREA 1U2VA 5JVHL 5A2QO 1TK5A 3K2PA 4KHQA 3IFRA 1VQ5N 3QDKA 4CGFA 4CE9A 4CJUA 1OH5A 2E2QA 3T19A 1TVRA 3W3DA 4DR3K 4Z94A 3RMCA 4J8FA 4QS7A 3LP0A 4CGJA 3GE1A 2VQEK 4Y0WA 4WQ5A 3VQPA 3NF9A 5JS1A 4OVLA 4X64K 4ISFA 3NVKA 1Z6RA 4DTSA 3C94A 3KVGA 4GVEA 4CHNA 1QHTA 3MEGA 3C7NA 1VAZA 2Z1IA 3LWLA 4IXCA 1HNVA 4CJ4A 3CFRA 4KO0A 1NNEA 4YHHK 1O13A 4Y1DA 2GUIA 2E1ZA 2IIRA 4FJ9A 2NRVA 4IDKA 4CVNE 3VMFB 3V9SA 3A5LC 3KKRA 5AQQA 3ZEUA 4BRCA 5KRSA 4B9QA 1B92A 3PO4A 2KTQA 2IVPA 3QIPA 3O4NA 3IAYA 1J6ZA 1RT2A 3KWGA 2H3GX 4EFHA 5CZ1A 4OGCA 1S9EA 2LSNA 1SQKA 2BDPA 4M3WA 4AHRA 4B9TA 1QQMA 3R8EA 3AARA 1RT3A 3R6MA 4BC2A 1SKWA 3TABA 2HHVA 3TARA 3SQ1A 1YI2N 1HQEA 3HVRA 4DV2K 4FZXC 1JL1A 1Z26A 2YNGA 4PHTX 4H5WA 3ZYYX 2UXDK 3HSCA 3M8QA 3UKUA 2NRZA 2YHYA 4BVPA 1O1WA 5KPTA 4IKFA 1KAZA 4A5BA 4CF9A 1S5JA 3AVHA 4CJSA 4ILGB 3AA3A 4O55A 5DK5A 5I42A 4K25A 4FWQA 3FR0A 2B5JA 1KD1O 4ZTFA 2BANA 4DHYA 3SAHA 3NGZA 2W6LA 4H4OA 2EWSA 4B8AB 1NOYA 3VGMA 2OPSA 2ZQBA 4OLAA 4BR2A 4DB3A 1LWFA 5KGXA 4O0IA 1QSLA 1SUQA 5F1XA 1TYQB 3AA4A 1E4GT 3F9KA 3VQ7A 1SL1A 3LM2A 2G8IA 1T6CA 3QIOA 3NBPA 2HVHA 3TPQA 3QB0A 4DTPA 4JI8K 1NKBA 3RRGA 3CPEA 5CY4A 3OYFA 1K8AO 3ULEA 4CJTA 1IBLK 4B3TK 4LF6K 4LFBK 3E01A 5BR9A 2OANA 4BDPA 4E7HA 3QINA 2P9KB 3ZT2A 3G25A 1VRTA 2QTDA 5K14A 1FK9A 5FDLA 4X66K 2YHWA 2QK9A 4CJLA 4BE2A 2RPIA 2OTJN 4E0DA 1LWCA 4EHTA 1T7PA 3HO1A 3O4QA 4JK9A 1C0FA 2UU9K 4FJ8A 3HL8A 2GTDA 3E1YA 3VQ9A 4BRDA 5AFUA 3H1QA 3HM8A 4DFPA 2P9IA 3T69A 1D9DA 3H1VX 2A5XA 4YNQA 1YJ9N 2E8AA 3L2WA 1CLQA 1HYVA 2HHXA 3HPOA 5AQFA 3SAFA 3KJVA 1OH7A 3I8BA 1J5EK 4LF4K 2A40A 5AQXA 4BR0A 2O8BB 1EKEA 3AO4A 4X62K 2IS3A 4ILJA 3E66A 3LP1A 4JRPA 4IO8A 4A2AA 4BRHA 2QWPA 2XY8A 1LAVA 2QXLA 3KHYA 1QHAA 3K5MA 4DSFA 3AVIA 4M41A 4FXDA 3CIPA 1SS6A 3GOIA 1XUPO 4HHTA 1RILA 1N8RO 1RBRA 4DR5K 2YKNA 4IZ9A 1ATSA 5KGWA 4BC3A 2UYTA 1NJZA 3C0BA 3RMBA 4FJHA 3V9WA 1E3MA 5KTQA 4OO1J 3J7ZO 3THYA 1UWBA 5KI6A 4R79A 1VQKN 3WQUA 3E9LA 5KPZA 3NH2A 4KH4A 1HYSA 1QSSA 3CJ1A 4Z4GA 2ATQA 4O8UA 4C8OA 1E4FT 1NJYA 1U48A 4KBOA 1V4TA 1I3AA 1S6QA 3MX2A 3AVGA 1S1VA 3AVAA 4N47A 1IKYA 2PY5A 3CCSN 3M5RA 3QO9A 2FSKA 4BR4A 1Y97A 4DU1A 4CJ5A 4FWPA 3LDOA 1QZ6A 4Z4HA 4BRMA 1S3XA 3LP2A 4H0YB 5HBMA 5CE3A 2QM1A 2V52B 1YF5L 4CZMA 4W5RA 2W42A 2QWMA 5T7BA 2OPPA 2FSJA 4QAGA 3UIQA 2Q1NA 3HPHA 3S3OA 1Q7YO 4IFEA 1W9HA 4CZLA 5D3GA 3L6QA 5AQJA 4Z4FA 4YOXA 1YITN 1OH8A 1NM1A 5AQTA 2I7PA 3L3UA 3QETA 3ENHA 2OCEA 3DLKA 3ENBA 3O9TA 5AJ3K 5C0YA 1B9DA 1KVCA 5HP1A 4IFVA 4DCHA 2HNYA 1ASVA 3KK2A 4YDUA 2FBXA 4DQ8A 3D2EB 4WF9L 3AO5A 1WLJA 4FJGA 1NOZA 1BI4A 4OKJA 1KFDA 1JXEA 4CJQA 1RT4A 4CD1A 4K8XA 3B6OA 3S3MA 1MA9B 4CJEA 2VWKA 3BF3A 3ZSVA 2E1YA 2UUCK 5AR0A 1NMNA 4BG8A 4M3ZA 4A59A 5TKWA 4JI6K 3C6UA 4B3RK 4QS8A 3WQTA 3OYAA 1YJWN 2QI2A 1BIZA 2PFUA 3EKUA 1I39A 4BDYA 3MAQA 3O6WA 4JD2B 3CCUN 3OYKA 2A1SA 1YAGA 1NGEA 4Z4CA 3OBWA 2ZGYA 1HPZA 2CGKA 1CZBA 3KLFA 2YKMA 4FJJA 4RW6A 1L3SA 1RDUA 3HI0A 3CJ7A 1G15A 1JCFA 5FRMA 5FROA 1EQYA 3LDPA 1TL3A 2O8DB 3CQ8A 4KB0A 1TUUA 3UKRB 4FLTA 3ID8A 3O9QA 3V9ZA 2HHHK 3C6HA 1LWEA 4XH4A 1T03A 3OHRA 4JI7K 2ZGZA 1RTDA 1SL0A 2FF6A 1YHQN 3PX6A 1QS4A 3AY9A 3SZ2A 4CEOA 2VWBA 2RF2A 1C1AA 4KTWA 1XQSC 2NUBA 4CHOA 4DS5A 3HSTB 2HNZA 3HP6A 4A2BA 4IG0A 4CHYA 4BACA 2CGJA 3BZCA 2GUPA 3OY9A 3S41A 3QBWA 4K0KK 4H0XB 4B1UB 3K0SA 2FF3B 5GAGP 4BE1A 1Q81O 4FVUA 5AQYA 3CCQN 1YTUA 4JHDB 3ZCMA 4DSKA 4NB4A 3VEOA 4KV8A 2A1RA 1S1XA 5AQOA 3QEVA 2NRHA 1HPMA 2F9TA 1U6ZA 4H5NA 1NGFA 4O0JA 4NXMK 1L3TA 1L5UA 4CZKA 4AHVA 1D9FA 1KCFA 1NGDA 1UAXA 1ZBUA 3L2RA 2EHGA 3EL2A 3AA5X 3C6TA 3FGUA 1OKJA 4FPBA 1KTQA 3QFPA 4FPAA 4ICLA 1WSJA 3WXLA 1WBDA 4Q0BA 2Q3SA 4GW6A 4DTNA 3J7AP 3PSFA 3AO1A 2IC3A 3DMJA 3TAQA 1TYQA 4B1YB 4LF9K 3FE1A 1YVUA 1C0TA 3D2FB 3VEYA 3H46O 4NYFA 2FBTA 3C95A 1MU2A 1GLLO 1K9MO 4BWMA 3SYZA 4DTJA 1RT1A 2P9LB 3M8RA 3MWTA 3CD6N 5SWMA 1N32K 2NNWA 1S6PA 1HLUA 4AHSA 4DQRA 3CCRN 1NK0A 3CJCA 3EZ5A 3PX0A 1RDBA 3CERA 3U3YA 3IDHA 3I0RA 4KAZA 4FJ5A 3CCJN 2A41A 3O9RA 3J7YP 3TAMA 3L0QA 2P9UB 3OYJA 4JKBA 1VSKA 3O9UA 2E20A 4B1ZA 4FWMA 4NXNK 3E9PA 3DJCA 3KLIA 3DAWA 3LL3A 3LPUA 3MDQA 1VQ9N 2AA4A 3TTCA 1RNHA 3MXJA 4FK2A 5J2NA 5CHIA 1TKTA 2P9PB 2I5JA 4DF4A 5FLXO 3IS9A 4B9UA 3UB5A 1U45A 1HKGA 3CCLN 1VHXA 3HXMA 4LF7K 5KQ8A 3FZFA 4DMNA 4E7LA 4E89A 1RCHA 4FK0A 3I0SA 4FJLA 2NZTA 1RDCA 1Q8IA 3A5NC 3LWMA 2RN2A 1X1PA 2X78A 3VESA 5CZ2A 1TL1A 2O8BA 3ATVA 2O8EB 4MLEA 4CBUA 1ESVA 1GOBA 4DV6K 3AAQA 1HR0K 3CFOA 2P9SB 3A5OC 4B8CA 3ITHA 2HMIA 4O5BA 2KFZA 1R59O 1BCMA 3H6EA 4UQGA 3U9DA 1KXPA 2GELA 3OYNA 1NGAA 1FJGK 2OA8A 5FPMA 1S1UA 2O8CB 4BR5A 2HBLA 4HUFA 3O80A 4DTXA 3DRPA 4CJPA 4DLEA 4G9ZA 1BCOA 2YX6A 4WFAL 3DYAA 3G6EN 1UOCA 4LFCK 3SJJA 3CCEN 1ZBFA 1WSFA 4DTMA 3PY8A 3CM6A 3PIPL 4FOEA 1NGBA 3VGLA 3SMPA 5FRNA 1NMDA 3OYMA 3JS6A 4FWSA 4CK1A 4DQSA 4OPJA 2QXFA 4I7FA 2X74A 3VQEA 1MWMA 1KAYA 5AFUH 1VQ4N 4CJWA 4K41A 4F9OA 4E1JA 2OTLN 1KVAA 2E6LA 4WQ4C 1QVGM 3MN5A 5J2PA 4DR2K 4NLBA 5GIPA 3KK1A 2RHKA 4IOCL 2UUAK 5AQZA 5KPRA 3CMAN 3BGRA 3O5BA 1XC3A 4FJXA 4E1MA 5DM7L 4JI2K 2WC9A 1Z25A 4CJVA
chains in the Genus database with same CATH topology
3Q7CA 5AZJA 3CC4N 2YJFA 3ZX3A 5AQFA 3SAFA 4B1XB 3IMXA 3CQYA 1W97L 3AAPA 3I8BA 5M1PA 1QQNA 5E26A 3WEEA 2A40A 3FZMA 5AQXA 4BR0A 2HF3A 4L3QA 4CJ7A 1HKCA 4YOTA 3L4QA 4GV9A 3T7ZA 3VENA 3R9PA 2E2OA 4ILJA 4YOYA 3E66A 5M1OA 1Q82O 3K9KA 4IO8A 4A2AA 4BRHA 1ATRA 2QWPA 3SAGA 5AQPA 2Q97A 2QXLA 1H1VA 1QHAA 1BG3A 3CETA 3KHYA 2QWOA 1MWKA 3EN9A 3EZWA 3MN7A 4EHUA 3CIPA 1SS6A 3ZX2A 3GOIA 1XUPO 3MN9A 3H45C 4NO7A 3M3ZA 3OW2M 3SK3A 3D2EA 5AQRA 3RSEA 2GEMA 4XH5A 1N8RO 2D4WA 4BQLA 4IZ9A 2ASMA 1ATSA 1NLVA 4BC3A 1KC8O 2UYTA 2YHXA 3CI5A 3C0BA 2KKZA 4DKWA 3HBTA 2V7YA 5AQUA 2W40A 4OO1J 3KK7A 3RVCA 3ID6A 3ZX0A 5DM6L 1X9JA 3J7ZO 4MO4A 5BREA 1T44A 3VETA 3ULEB 4R79A 1VQKN 3TSQA 3WQUA 2NRXA 2AP1A 3E9LA 4C23A 2CH6A 5KPZA 2P9NB 4CZEA 4KH4A 3PIOL 3ZETA 4BRGA 1SZ2A 5E84A 3CJ1A 1D4XA 2A6AA 2VGNA 4ISEA 2ZJQL 1KQSM 4O8UA 4MLHA 4OPHA 4B1VA 3FLCO 3I55N 2GWJA 3VGKA 5JLHA 1E4FT 4JAXA 1GLEG 2WBNA 4WFBL 1ZXOA 2FXUA 4KBOA 1V4TA 4JD2A 3CJ9A 1BDGA 3MX2A 4RCHA 2ASPA 3GL1A 4EAHD 4BR9A 4WQ5C 3GBTA 3G71N 1NGJA 4M63C 2FLOA 5AQSA 5EY4A 4BY9C 3CCSN 2CH5A 3SMSA 3M5RA 3VTHA 2FSKA 4BR4A 4EIAA 1VQ8N 4JK8A 2P9IB 3A8YA 1QVFM 2ASOA 3O9SA 2NRWA 4BQZA 4FWPA 3GG4A 3MCPA 2J4RA 4RTFD 3BUZB 1VQNN 3LDOA 4BRIA 4YOUA 2Q2RA 1YUWA 3GDQA 1QZ6A 5BPMA 3CC2N 4BRMA 3VPZA 1S3XA 3IKMA 4H0YB 4KH5A 4CBXA 4CD3A 5CE3A 2QM1A 5MLCQ 4LC9B 2BH1A 3IUCA 3LM9A 4BVOA 2V52B 4BC4A 5GIOA 4UY8O 4PL8A 5AZJB 1YF5L 4CZMA 2QWMA 3UKRA 2FSJA 1LOTB 2I7NA 3ATUA 2Q1NA 4BRFA 4MDBA 1Q7YO 4IFEA 2ZJRL 3WT0A 4CZLA 5ELZA 4CZGA 4MDAA 2WFBA 3L6QA 5CR4A 2VCPA 3ENOA 3WEEB 4GV3A 5AQJA 4YOXA 2FSNA 3AGRA 1YITN 3VOVA 1NBWA 1NM1A 5AQTA 5BRDA 2I7PA 3KWIA 3MWPA 5C2DA 3ENHA 3ENBA 3O9TA 5C0YA 4IWVA 4U7BA 5FPNA 2JWKA 3HZ6A 4BG9A 5GADP 5H1SQ 1VQPN 4DCHA 3D6RA 3P31A 4YORA 4YDUA 4PKHA 3U9ZA 4AF1A 1GLFO 4DQ8A 3D2EB 3RSEB 4YOVA 2PBDA 4WF9L 5TKYA 2KHOA 1GLJO 5M1KA 4XH1A 1SAZA 4JKCA 3TSPA 4JHDA 4CD1A 1P90A 3AGKA 4C1NI 1YJNN 1MA9B 2E88A 1NGCA 3O8MA 1VQMN 5KQDA 2YI1A 3FZLA 3OBYA 3BF3A 1DEJA 2E1YA 5ADXH 1DT9A 5AR0A 3HOSA 3SLCA 3H3NO 4BG8A 1K73O 1HJOA 3ZETB 3UE5A 1BUPA 4A59A 5TKWA 4BGBA 3EE8A 5F2RA 5LY3A 2D0PA 4PKIA 5JLFA 4H5TA 4YOWA 5ADXA 1ZBSA 3CJAA 3TSUA 4QS8A 3WQTA 1NJIO 2P9KA 4CI6A 3WXKA 1YJWN 3E9OA 2NLXA 3VEXA 4K43A 4JKHA 1LCUA 4WQ4A 2CGLA 2PFUA 2QI2A 3EKUA 1BU6O 5GAEP 2BUPA 3O4WA 3O6WA 4JD2B 1VQLN 1Y64A 3DXMA 1GLDG 3D7EO 3QMLA 4HTLA 3SBTA 2E2NA 3VF4A 2KLAA 3OA9A 5AQIA 4B1WB 3P4IA 1YAGA 1NGEA 1P8ZA 4IDHA 4O5FA 4RWTA 3OBWA 2ZGYA 2WUSA 1YXQA 2CGKA 2V51B 4IEEA 4WCEL 2F7TA 4H5VA 1JJ2M 3D2FA 1RDWX 3Q7BA 3QBXA 1BWFO 4FWNA 2Q36A 5JVGL 3TTDA 3CMEN 3F9MA 1GLAG 1RDUA 3HI0A 2P9LA 3DXKA 3SBGA 2ZJPL 3FFKB 3VF2A 4C1NK 1RGIA 3BP8A 4JEPA 3CJ7A 2ITMA 1JCFA 4O8KA 5JICA 1EQYA 3LDPA 4GNIA 1TUUA 5GAHP 3K9JA 5EOYA 4ISGA 3UKRB 3HOTA 3ID8A 3O9QA 5HL7L 3QICA 1ILYA 1V4SA 2QWLA 1BA0A 3C6HA 3EE9A 4JKFA 4XH4A 3P39A 3OHRA 2GX9A 4JNEA 2ZGZA 4H0PA 3A0IX 1ZC6A 2VGMA 2FF6A 3L4IA 3J8AA 4IJAA 5FPEA 3M1FA 3CF5L 3AY9A 1YHQN 4GY2B 2VWBA 2E2PA 2P9UA 3MX5A 4H5RA 2IVOA 1XQSC 4JKEA 4MO5A 4A2BA 2QWNA 3FZHA 1Q18A 1NGGA 5AQNA 4JKAA 5I9EB 2CGJA 2GUPA 3S41A 3QBWA 4NLCA 4H0XB 4B1UB 2FF3B 2VYPA 5GAGP 2HF4A 3P38A 1Q81O 4FVUA 2P9PA 2ZF5O 1EO1A 5AQYA 3W0LA 3CCQN 3BEXA 1M1KO 3LDQA 5C10A 1VQ6N 1JCEA 3H3OB 4JHDB 3DLLL 4JKGA 1K8KB 3CCUN 4NB4A 4BGAA 3VEOA 2HBMA 4PL7A 2NRRA 4AM7A 5F0XA 5AQOA 2NRHA 1HPMA 2F9TA 2QW9A 3CJBA 1HUXA 1U6ZA 5AQHA 1S22A 5BN9A 3WXIA 3F2KA 4BREA 3CPWM 1U2VA 4H5NA 5AQWA 1NGFA 5JVHL 2QEXN 2IVNA 3O08A 3VEVA 3IFRA 4CZJA 1VQ5N 3QDKA 4CZKA 5AQKA 3N4PA 1M90O 4ILHA 1NGDA 2E2QA 5BPLA 4FWOA 4IOXA 3EL2A 3WUHA 3W3DA 5LJWA 4GV6A 3FGUA 3R1XA 3VF6A 3R3LA 4Z94A 4I6MA 4IEIA 4J8FA 1OKJA 2P9SA 1VQ7N 3F5TA 4QS7A 2QWRA 5C2FA 3GE1A 2YJEA 4FPBA 4Y0WA 4WQ5A 5AQVA 3QFPA 4FPAA 3LDNA 3WXLA 4IOAL 1IJJA 4FOIA 3DXMB 4ISFA 5BRFA 3NVKA 3HTVA 1Z6RA 4BR7A 1IG8A 2ZWHA 3KVGA 5B8HA 1TYQA 4B1YB 5C12A 3FE1A 4GVEA 3D2FB 3VEYA 3H46O 5AQGA 3C7NA 1VAZA 3WXMB 5M1NA 1GLLO 1DGKN 1K9MO 3MN6A 1WUAA 5BPNA 4IXCA 2BTFA 2PAVA 3G4SN 1X3MA 2P9LB 3DXKB 1GLBG 4QS9A 1O13A 3CHWA 4A61A 3MWTA 2E1ZA 2IIRA 3CQXA 2NRVA 3CD6N 2D0OA 1ATNA 3EKSA 2NNWA 3O1WA 1YIJN 3MMVA 3VMFB 2F9WA 4WFNL 1HLUA 2Q0RA 1MDUB 3A5LC 4PKGA 5AQQA 5AZIA 3ZEUA 5M1FA 2NRTA 3CCRN 3CJCA 4BRCA 5BN8A 4B9QA 2IVPA 3CERA 3MK6A 3IDHA 1J6ZA 3HRGA 3KWGA 2H3GX 4EFHA 3CCJN 4FO0A 2A41A 3O9RA 1SQKA 3MCAB 3L0QA 1QZ5A 2P9UB 3VTIA 1QQMA 4JKBA 1NGHA 3R8EA 3AARA 4BC5A 2HOEA 4K42A 3O9UA 2E20A 3R6MA 4B1ZA 4FWMA 4BC2A 1YVNA 4A62A 3E9PA 3DJCA 4CZFA 3NVMA 1HX1A 3DAWA 3LL3A 3MDQA 3VEZA 2AA4A 3TTCA 1YI2N 1VQ9N 2QWQA 1VQON 1OVYA 4FL9A 3U8XA 2RE2A 4PHTX 3WXJA 5CHIA 4H5WA 3ZYYX 2P9PB 5HOOA 4BRAA 5AQLA 3HSCA 3UKUA 3FZKA 2DPNA 1Z05A 4JKGB 3UB5A 1HKGA 3CCLN 2NRZA 2YHYA 2Q31A 3QFUA 4BVPA 3CCVN 5M1QA 4M7YA 5KPTA 3BF1A 1KAZA 5KQ8A 3FZFA 4A5BA 1HKBA 2HMPA 4BRQA 1BOTO 3TTFA 1QQOA 2NZTA 1U2VB 3B8AX 1Q86O 3A5NC 4ILGB 5JMVA 3VESA 1C0GA 4K25A 4FWQA 3O1BA 1CZAN 3FR0A 5EX5A 3ATVA 4H03B 4MLEA 4CBUA 2D1KA 3I56N 1KD1O 1ESVA 3AAQA 2V7ZA 1NWKA 4I6MB 2P9SB 3A5OC 4DHYA 3SAHA 4JN4A 3EO3A 2EWSA 3N4QA 2HBJA 3VGMA 2A3ZA 4KH6A 1R59O 3H6EA 4BR2A 4DB3A 1NGIA 5AQMA 3U9DA 1KXPA 1WOQA 2GELA 4BRPA 1NGAA 4AM6A 5F1XA 1S72N 1BO5O 5FPMA 1TYQB 3NMUA 2HSTA 1E4GT 4BRKA 3CXCM 1RFQA 4BR5A 4CZIA 4YDUC 3LM2A 1T6CA 2HBLA 3C7NB 2W41A 2GWKA 3O80A 3TPQA 3QB0A 4FSVA 5EXWA 2QA4N 4G9ZA 3CPEA 2YX6A 4WFAL 1K8AO 5C15A 3G6EN 4FWKA 3ULEA 3A5MC 2JWLA 4CZHA 3CCEN 1X3NA 5BR9A 3PIPL 2P9NA 4FOEA 1NGBA 3M6GA 5LJVA 1KAXA 2HBKA 3VGLA 2OANA 5AZIB 2A42A 3SMPA 3ZEUB 2Q0UA 2YCHA 2P9KB 1NMDA 3C6AA 3G25A 2QTDA 4BRLA 3JS6A 3PLAA 4FWSA 4JK7A 1W2BM 4CBWA 4OPAA 3LDLA 4H0TB 4XEIA 3CCMN 4WYBA 4BROA 1MWMA 4FWRA 1KAYA 3C65A 4H0OA 5AFUH 2YHWA 1VQ4N 3CC7N 4K41A 1DKGD 4IO9L 4IJNA 3KZBA 4E1JA 4F9OA 2OTLN 2OTJN 1T6DA 4JKDA 4EHTA 3VEWA 1TUYA 4JK9A 1T3VA 4WQ4C 5BRHA 1C0FA 3I33A 4FWLA 3MN5A 2GTDA 1QVGM 1JCGA 3E1YA 4BRDA 4A57A 5AFUA 3H1QA 1BA1A 4A5AA 4NLBA 3HM8A 5GIPA 5GINA 3SJHA 2RHKA 3DWLA 4IOCL 2P9IA 1G99A 5AQZA 5KPRA 5EVZA 3T69A 4U67L 5FPDA 4M7XA 3CMAN 3O5BA 3VERA 3H1VX 1XC3A 3UKUB 4HWIA 2A5XA 3U4LA 4BRNA 1YJ9N 2E8AA 3TU5A 5DM7L 1GLCG 4H0VB 2WC9A 1K8KA 3JXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AZJ A;  2YJF A;  3ZX3 A;  5AQF A;  4B1X B;  3IMX A;  3CQY A;  3AAP A;  3I8B A;  1QQN A;  5E26 A;  3WEE A;  2A40 A;  3FZM A;  5AQX A;  4BR0 A;  2HF3 A;  4L3Q A;  4CJ7 A;  1HKC A;  3VEN A;  3R9P A;  2E2O A;  4IO8 A;  4A2A A;  4BRH A;  1ATR A;  2QWP A;  5AQP A;  2Q97 A;  2QXL A;  1H1V A;  1QHA A;  1BG3 A;  3CET A;  3KHY A;  2QWO A;  1MWK A;  3EN9 A;  3EZW A;  3MN7 A;  4EHU A;  3CIP A;  3ZX2 A;  3GOI A;  1XUP O;  3MN9 A;  3H45 C;  4NO7 A;  3M3Z A;  3SK3 A;  3D2E A;  5AQR A;  3RSE A;  2GEM A;  4XH5 A;  2D4W A;  4BQL A;  4IZ9 A;  2ASM A;  1ATS A;  1NLV A;  4BC3 A;  2UYT A;  2YHX A;  3CI5 A;  3C0B A;  3HBT A;  2V7Y A;  5AQU A;  2W40 A;  3ZX0 A;  1X9J A;  4MO4 A;  5BRE A;  1T44 A;  3VET A;  3ULE B;  3WQU A;  2AP1 A;  4C23 A;  2CH6 A;  5KPZ A;  2P9N B;  4CZE A;  3ZET A;  4BRG A;  1SZ2 A;  5E84 A;  3CJ1 A;  1D4X A;  2A6A A;  4ISE A;  4B1V A;  4MLH A;  3FLC O;  2GWJ A;  3VGK A;  5JLH A;  1E4F T;  4JAX A;  1GLE G;  1ZXO A;  2FXU A;  4KBO A;  1V4T A;  4JD2 A;  3CJ9 A;  1BDG A;  4RCH A;  2ASP A;  3GL1 A;  4EAH D;  4BR9 A;  4WQ5 C;  3GBT A;  1NGJ A;  4M63 C;  2FLO A;  5AQS A;  5EY4 A;  2CH5 A;  3SMS A;  2FSK A;  4BR4 A;  4EIA A;  2P9I B;  3A8Y A;  2ASO A;  4BQZ A;  4FWP A;  3GG4 A;  3MCP A;  2J4R A;  4RTF D;  3BUZ B;  3LDO A;  4BRI A;  2Q2R A;  1YUW A;  3GDQ A;  1QZ6 A;  5BPM A;  4BRM A;  3VPZ A;  1S3X A;  4CBX A;  4H0Y B;  4CD3 A;  5CE3 A;  2QM1 A;  4LC9 B;  3LM9 A;  3IUC A;  4BVO A;  2V52 B;  4BC4 A;  4PL8 A;  5AZJ B;  4CZM A;  2QWM A;  3UKR A;  2FSJ A;  1LOT B;  2I7N A;  3ATU A;  2Q1N A;  4BRF A;  3WT0 A;  4CZL A;  5ELZ A;  4CZG A;  3WEE B;  3L6Q A;  3ENO A;  2VCP A;  5AQJ A;  2FSN A;  3VOV A;  1NBW A;  1NM1 A;  5AQT A;  5BRD A;  2I7P A;  3ENH A;  4IWV A;  5FPN A;  4BG9 A;  3HZ6 A;  4DCH A;  4YDU A;  4PKH A;  3U9Z A;  1GLF O;  4DQ8 A;  3D2E B;  3RSE B;  2PBD A;  5TKY A;  2KHO A;  1GLJ O;  4XH1 A;  1SAZ A;  4JHD A;  4CD1 A;  1MA9 B;  2E88 A;  1NGC A;  3O8M A;  5KQD A;  2YI1 A;  3FZL A;  3BF3 A;  1DEJ A;  2E1Y A;  5ADX H;  5AR0 A;  3SLC A;  3H3N O;  4BG8 A;  1HJO A;  3ZET B;  3UE5 A;  1BUP A;  4BGB A;  5F2R A;  5LY3 A;  2D0P A;  4PKI A;  5JLF A;  4H5T A;  5ADX A;  1ZBS A;  3CJA A;  4QS8 A;  3WQT A;  2P9K A;  4CI6 A;  3WXK A;  3VEX A;  2NLX A;  4K43 A;  1LCU A;  4WQ4 A;  2CGL A;  3EKU A;  1BU6 O;  2BUP A;  3O4W A;  3O6W A;  4JD2 B;  1Y64 A;  3DXM A;  1GLD G;  3D7E O;  3QML A;  4HTL A;  2E2N A;  3VF4 A;  5AQI A;  4B1W B;  3P4I A;  1YAG A;  1NGE A;  1P8Z A;  4O5F A;  4RWT A;  2ZGY A;  2WUS A;  1YXQ A;  2CGK A;  2V51 B;  4H5V A;  3D2F A;  1RDW X;  3QBX A;  1BWF O;  4FWN A;  2Q36 A;  3F9M A;  1GLA G;  3HI0 A;  2P9L A;  3DXK A;  3FFK B;  3VF2 A;  1RGI A;  3BP8 A;  3CJ7 A;  2ITM A;  1JCF A;  4O8K A;  5JIC A;  1EQY A;  3LDP A;  4GNI A;  1TUU A;  5EOY A;  4ISG A;  3UKR B;  3ID8 A;  3QIC A;  1V4S A;  2QWL A;  1BA0 A;  4XH4 A;  3OHR A;  4JNE A;  2ZGZ A;  4H0P A;  3A0I X;  1ZC6 A;  3L4I A;  2FF6 A;  4IJA A;  3J8A A;  5FPE A;  3M1F A;  3AY9 A;  4GY2 B;  2VWB A;  2E2P A;  2P9U A;  4H5R A;  2IVO A;  1XQS C;  4MO5 A;  4A2B A;  2QWN A;  3FZH A;  1Q18 A;  1NGG A;  5AQN A;  5I9E B;  2CGJ A;  2GUP A;  3S41 A;  3QBW A;  4H0X B;  4B1U B;  2FF3 B;  2VYP A;  2HF4 A;  2P9P A;  2ZF5 O;  5AQY A;  3W0L A;  3BEX A;  3LDQ A;  1JCE A;  3H3O B;  4JHD B;  1K8K B;  4NB4 A;  4BGA A;  3VEO A;  4PL7 A;  4AM7 A;  5F0X A;  5AQO A;  2NRH A;  1HPM A;  2F9T A;  3CJB A;  2QW9 A;  1HUX A;  1U6Z A;  5AQH A;  1S22 A;  5BN9 A;  3WXI A;  4BRE A;  1U2V A;  4H5N A;  5AQW A;  1NGF A;  2IVN A;  3O08 A;  3VEV A;  3IFR A;  4CZJ A;  3QDK A;  4CZK A;  5AQK A;  1NGD A;  2E2Q A;  5BPL A;  4FWO A;  3EL2 A;  3WUH A;  3W3D A;  5LJW A;  3FGU A;  3VF6 A;  4Z94 A;  4I6M A;  4J8F A;  1OKJ A;  2P9S A;  4QS7 A;  2QWR A;  3GE1 A;  2YJE A;  4FPB A;  4Y0W A;  4WQ5 A;  5AQV A;  3QFP A;  4FPA A;  3LDN A;  3WXL A;  1IJJ A;  4FOI A;  3DXM B;  4ISF A;  5BRF A;  3HTV A;  1Z6R A;  4BR7 A;  1IG8 A;  2ZWH A;  3KVG A;  5B8H A;  1TYQ A;  4B1Y B;  3FE1 A;  3D2F B;  3VEY A;  3H46 O;  5AQG A;  3C7N A;  1GLL O;  1DGK N;  3MN6 A;  1WUA A;  5BPN A;  4IXC A;  2BTF A;  2PAV A;  1X3M A;  2P9L B;  3DXK B;  1GLB G;  4QS9 A;  3CHW A;  4A61 A;  2E1Z A;  2IIR A;  3CQX A;  2D0O A;  1ATN A;  3EKS A;  3O1W A;  3MMV A;  2F9W A;  1HLU A;  2Q0R A;  1MDU B;  3A5L C;  4PKG A;  5AQQ A;  5AZI A;  3ZEU A;  3CJC A;  4BRC A;  5BN8 A;  4B9Q A;  2IVP A;  3CER A;  3MK6 A;  3IDH A;  1J6Z A;  2H3G X;  4EFH A;  4FO0 A;  2A41 A;  1SQK A;  3L0Q A;  1QZ5 A;  2P9U B;  1QQM A;  1NGH A;  3R8E A;  3AAR A;  4BC5 A;  2HOE A;  4K42 A;  2E20 A;  3R6M A;  4B1Z A;  4FWM A;  4BC2 A;  1YVN A;  4A62 A;  3DJC A;  4CZF A;  1HX1 A;  3DAW A;  3LL3 A;  3MDQ A;  3VEZ A;  2AA4 A;  2QWQ A;  4FL9 A;  3U8X A;  3WXJ A;  4H5W A;  2P9P B;  4BRA A;  5AQL A;  3HSC A;  3UKU A;  3FZK A;  2DPN A;  1Z05 A;  3UB5 A;  1HKG A;  2YHY A;  2Q31 A;  3QFU A;  4BVP A;  4M7Y A;  5KPT A;  3BF1 A;  1KAZ A;  5KQ8 A;  3FZF A;  1HKB A;  2HMP A;  4BRQ A;  1BOT O;  1QQO A;  2NZT A;  1U2V B;  3B8A X;  3A5N C;  5JMV A;  3VES A;  1C0G A;  4K25 A;  4FWQ A;  3O1B A;  1CZA N;  3FR0 A;  5EX5 A;  3ATV A;  4H03 B;  4MLE A;  4CBU A;  2D1K A;  1ESV A;  3AAQ A;  2V7Z A;  1NWK A;  4I6M B;  2P9S B;  3A5O C;  4DHY A;  4JN4 A;  3EO3 A;  2EWS A;  3VGM A;  2A3Z A;  1R59 O;  3H6E A;  4BR2 A;  4DB3 A;  1NGI A;  5AQM A;  3U9D A;  1KXP A;  1WOQ A;  2GEL A;  4BRP A;  1NGA A;  4AM6 A;  5F1X A;  1BO5 O;  5FPM A;  1TYQ B;  1E4G T;  4BRK A;  1RFQ A;  4BR5 A;  4CZI A;  4YDU C;  3LM2 A;  1T6C A;  3C7N B;  2W41 A;  2GWK A;  3O80 A;  3TPQ A;  3QB0 A;  4FSV A;  5EXW A;  4FWK A;  3ULE A;  3A5M C;  4CZH A;  1X3N A;  5BR9 A;  2P9N A;  4FOE A;  1NGB A;  3M6G A;  5LJV A;  1KAX A;  3VGL A;  2OAN A;  5AZI B;  2A42 A;  3SMP A;  3ZEU B;  2Q0U A;  2YCH A;  2P9K B;  1NMD A;  3G25 A;  4BRL A;  3JS6 A;  4FWS A;  4CBW A;  3LDL A;  4H0T B;  4XEI A;  4WYB A;  4BRO A;  1MWM A;  4FWR A;  1KAY A;  4H0O A;  5AFU H;  2YHW A;  4K41 A;  1DKG D;  4IJN A;  3KZB A;  4E1J A;  4F9O A;  1T6D A;  4EHT A;  3VEW A;  1TUY A;  4WQ4 C;  5BRH A;  1C0F A;  3I33 A;  4FWL A;  3MN5 A;  2GTD A;  1JCG A;  4BRD A;  5AFU A;  3H1Q A;  1BA1 A;  3HM8 A;  3SJH A;  3DWL A;  2P9I A;  1G99 A;  5AQZ A;  5KPR A;  5EVZ A;  5FPD A;  4M7X A;  3O5B A;  3VER A;  3H1V X;  1XC3 A;  3UKU B;  4HWI A;  2A5X A;  3U4L A;  4BRN A;  2E8A A;  3TU5 A;  1GLC G;  4H0V B;  1K8K A;  3JXU A; 
#chains in the Genus database with same CATH topology
 1GOA A;  3CC4 N;  3ZX3 A;  1VSL A;  1W97 L;  3OYI A;  5M1P A;  1QQN A;  3FZM A;  4KTZ A;  4CJ7 A;  4GV9 A;  4DV7 K;  3VEN A;  3R9P A;  2E2O A;  3QEI A;  5DMR A;  1REV A;  4JV5 K;  3K9K A;  1EWQ A;  4DV0 K;  3G4S N;  2QWO A;  1NK5 A;  2OYQ A;  3ZX2 A;  3B6P A;  4NO7 A;  3H45 C;  1NK8 A;  3SK3 A;  3D2E A;  5AQR A;  3WNG A;  1NLV A;  2YHX A;  3CI5 A;  4I9L A;  4N5S A;  2D0B A;  5HRS A;  3HBT A;  3OYH A;  5AQU A;  3SUQ A;  3ZX0 A;  1KVB A;  3ID6 A;  3RVC A;  2HHQ A;  2UXB K;  3HVT A;  1ZBL A;  1ZBH A;  3TSQ A;  3BDP A;  3ZSQ A;  4E3S A;  4C23 A;  4Z4E A;  2CH6 A;  2KFN A;  2P9N B;  4HTU A;  2ZJQ L;  4DS4 A;  4JAX A;  4LH5 A;  1GLE G;  2WBN A;  4F8R A;  4JD2 A;  3HT3 A;  1VSE A;  2ASP A;  4CW7 B;  3GL1 A;  3RR7 A;  4WQ5 C;  2PYL A;  5EU7 A;  4LF8 K;  1NGJ A;  1Q9Y A;  2BE2 A;  4JI5 K;  3OTO K;  1IG9 A;  4JI1 K;  1QVF M;  1SV5 A;  2OZS A;  3GG4 A;  4YY3 K;  1HRH A;  3VQA A;  4FW1 A;  1VQN N;  2Q2R A;  1YUW A;  3FFI A;  4DU3 A;  5BPM A;  3QEX A;  3T1H K;  4LC9 B;  2D0A A;  3IUC A;  4BC4 A;  1JKH A;  1TKZ A;  2O8D A;  4PL8 A;  5AZJ B;  3UKR A;  4CEC A;  2I7N A;  2P5O A;  4MDB A;  4C8L A;  3WEE B;  1WBB A;  2VCP A;  4CED A;  3VOV A;  4M42 A;  4E7K A;  3RMA A;  5C2D A;  4FLZ A;  2XO7 A;  4W5O A;  2HVI A;  4IWV A;  4U7B A;  4CEQ A;  2JWK A;  4BG9 A;  4B9N A;  4JYA K;  5H1S Q;  3D6R A;  4PKH A;  3L2U A;  3U9Z A;  3VQC A;  4AF1 A;  1GLF O;  3RSE B;  2B4J A;  2PBD A;  4J2A A;  2ZM6 K;  2KHO A;  1SAZ A;  4FVM A;  4JHD A;  3ZT0 A;  1KLN A;  4FJN A;  4JRQ A;  1P90 A;  1WAF A;  3NE6 A;  3AGK A;  4C1N I;  1A5X A;  2Z1G A;  1VQM N;  4CFD A;  3FZL A;  1NK6 A;  1BIU A;  4ELV A;  1XHX A;  1DT9 A;  3TR8 A;  5C42 A;  3SLC A;  3H3N O;  3ZET B;  3J80 O;  5C25 A;  3VA3 A;  1WN7 A;  3QEW A;  1L3U A;  3P1G A;  3L8B A;  4YOW A;  4H5T A;  1ZBS A;  3L3V A;  1NJI O;  4QCL A;  3WXK A;  3E9O A;  4K43 A;  1LCU A;  1I94 K;  4CJR A;  4DV4 K;  1BU6 O;  5GAE P;  3NDK A;  1TGO A;  2BUP A;  3KD1 E;  4CF1 A;  4CF2 A;  1VRU A;  3K5O A;  1VQL N;  3AVF A;  3D7E O;  3VF4 A;  3HP9 A;  3P4I A;  1WSE A;  1J54 A;  3LZJ A;  2WUS A;  2V51 B;  2KZM A;  4IEE A;  4WCE L;  3KLG A;  3D2F A;  2DY4 A;  1BWF O;  4FWN A;  2Q36 A;  3CME N;  4F4K A;  1FXX A;  3ZLJ A;  3AVM A;  1ASU A;  1Q9X A;  2P9L A;  3VF2 A;  3BP8 A;  4JEP A;  1VSF A;  4O8K A;  1RDA A;  3AA2 A;  4CIG A;  4GNI A;  1WSI A;  5C24 A;  4KFB A;  3U3G A;  2BGG A;  2R7Y A;  3QIC A;  1ILY A;  1V4S A;  1BA0 A;  3EE9 A;  4GKK K;  4JNE A;  3EYZ A;  4CEE A;  3A0I X;  1ZC6 A;  2VGM A;  3JSM A;  2P9U A;  1WAJ A;  3RRH A;  4LSL A;  3FZH A;  1IBK K;  2Z1H A;  1NGG A;  5I9E B;  1D5A A;  3NGI A;  4NLC A;  1UA0 A;  2VYP A;  3P38 A;  2P9P A;  4RW4 A;  4H8K A;  2VG7 A;  4CIE A;  3W0L A;  1NK7 A;  3V81 A;  3LDQ A;  1JCE A;  3DLL L;  1C6V A;  1U04 A;  4AH9 A;  2NRR A;  3THX B;  5AQH A;  1HUX A;  1S22 A;  2GV9 A;  3WXI A;  3T3F A;  2QEX N;  4RW8 A;  2IVN A;  3VEV A;  3N4P A;  1W0H A;  4ILH A;  1HNZ K;  2O8E A;  4IOX A;  3WUH A;  4CK2 A;  5LJW A;  4DR4 K;  4GV6 A;  3VF6 A;  3R3L A;  1VQ7 N;  4IEI A;  4DV3 K;  2P9S A;  3TAE A;  2QWR A;  4Z0U A;  1LW2 A;  1HNW K;  4DV1 K;  4Z4I A;  1RBS A;  2HB5 A;  5BRF A;  1BGX T;  4BR7 A;  5C12 A;  3TAP A;  3JAM O;  2O8C A;  2DFH A;  4CEA A;  1N5Y A;  3IG1 A;  3WXM B;  2RKI A;  2DTU A;  1DGK N;  3MN6 A;  1WUA A;  4AHT A;  2BTF A;  1JLF A;  3SV4 A;  1EP4 A;  2PAV A;  4HCB A;  1X3M A;  1RBU A;  1GLB G;  4QS9 A;  3NH1 A;  3CHW A;  2YHB A;  4A61 A;  2VQF K;  3CQX A;  3G10 A;  1ATN A;  3EKS A;  3O1W A;  1JL2 A;  3MMV A;  4WFN L;  2F9W A;  2Q0R A;  1MDU B;  4PKG A;  5M1F A;  3SQ2 A;  4KKO A;  5BN8 A;  2P5G A;  3AVN A;  3HRG A;  5HRN A;  1TAU A;  1A5W A;  4FO0 A;  3WNE A;  2W6K A;  3SNN A;  3MCA B;  2D5R A;  4CCH A;  2IAJ A;  4FJK A;  1NGH A;  4I2Q A;  4BC5 A;  4JS5 A;  4K42 A;  3SV3 A;  3HK2 A;  3LAL A;  2O8F B;  3M8S A;  3NVM A;  1HX1 A;  4B9S A;  3QEP A;  2QWQ A;  1VQO N;  1OVY A;  1TKD A;  3SCX A;  4FL9 A;  3HYF A;  4QOZ B;  2RE2 A;  3WXJ A;  1HNI A;  1FKO A;  4BRA A;  3CG7 A;  3VQ8 A;  1Z05 A;  4JKG B;  2OPR A;  1XC9 A;  2Q31 A;  4FJ7 A;  5M1Q A;  4M7Y A;  1KSP A;  1HKB A;  2HMP A;  4BRQ A;  1BOT O;  3D0P A;  3L2Q A;  4BE0 A;  1BHL A;  3RMD A;  2YNI A;  4CEZ A;  4F3O A;  1A5V A;  3O1B A;  1CZA N;  3K59 A;  4CFA A;  3I56 N;  1NKC A;  4I6M B;  1IKW A;  4JN4 A;  1RDD A;  5LMN K;  4GKJ K;  5BR8 K;  4JI0 K;  2X6S A;  4KH6 A;  1HMV A;  1XI1 A;  1NGI A;  5AQM A;  4ELU A;  1WOQ A;  4CHQ A;  4BRP A;  3QNN A;  3MEC A;  1S72 N;  3VQQ A;  1BO5 O;  3NMU A;  2D0C A;  4DUZ K;  4BRK A;  4CZI A;  4YDU C;  3H08 A;  2GWK A;  4FSV A;  3SUN A;  3OVN A;  4DR7 K;  5C15 A;  4CFB A;  2JWL A;  1JLA A;  3QES A;  4DR1 K;  5JS2 A;  2P9N A;  3NCI A;  4LH4 A;  4B3S K;  1VSM A;  1C0U A;  2A42 A;  5AZI B;  2Q0U A;  2YCH A;  3F73 A;  3LAK A;  4KHY A;  3SQ0 A;  2XY5 A;  4BRL A;  3PLA A;  1RT5 A;  1W2B M;  1IV0 A;  3LDL A;  4XEI A;  4W5N A;  4EP4 A;  2KZZ A;  3DLH A;  4IO9 L;  3AVK A;  1T6D A;  3PUF A;  1DTQ A;  5BRH A;  4FWL A;  3I33 A;  4AHU A;  4A57 A;  4Y1C A;  4EZ6 A;  1BA1 A;  4A5A A;  3RWU A;  3ULD A;  1OVQ A;  5GIN A;  3DWL A;  5EVZ A;  4U67 L;  2PYJ A;  3HM9 A;  4W5Q A;  4HWI A;  4BRN A;  3LAM A;  4M3R A;  3OYL A;  3TU5 A;  1GLC G;  4H0V B;  4XIU A;  3O3G A;  1K8K A;  3KTQ A;  3OS2 A;  3Q7C A;  5AZJ A;  1NKE A;  3TWH A;  3IMX A;  3CQY A;  1LAW A;  4V19 S;  3AAP A;  5J2M A;  3AVL A;  3WEE A;  5E26 A;  3CFP A;  3TAG A;  4CES A;  3T7Z A;  2ZE2 A;  4YOY A;  1QQC A;  1Q82 O;  4I9Q A;  4AQY K;  1N34 K;  5AQP A;  4FK4 A;  1BG3 A;  3OYD A;  1MWK A;  3EZW A;  3MN7 A;  4EHU A;  3MN9 A;  4E1N A;  3ZT4 A;  3RSE A;  1XHZ A;  2XRI A;  4FYD A;  1C1B A;  2KKZ A;  4DQI A;  1IH7 A;  4OKE A;  2W40 A;  3KK7 A;  1X9J A;  4MO4 A;  5BRE A;  1T44 A;  1TV6 A;  1WB9 A;  1J53 A;  3NF8 A;  2AP1 A;  1IKV A;  4CZE A;  3PIO L;  3ZET A;  1SZ2 A;  1D4X A;  2A6A A;  2VGN A;  3VQD A;  1KQS M;  2E5L K;  4MLH A;  3FLC O;  2GWJ A;  2UUB K;  3LPT A;  1NJX A;  4PWD A;  3TI0 A;  4N41 A;  4PY5 A;  3CJ9 A;  4KHU A;  3DI6 A;  3S9H A;  3G71 N;  4M63 C;  2FLO A;  5AQS A;  3T1A A;  4DFJ A;  2Z1J A;  3ZT1 A;  3VTH A;  3NAE A;  1VQ8 N;  4ID1 A;  3A8Y A;  3O9S A;  4C8N A;  1HJR A;  3MCP A;  5HRR A;  4RTF D;  4RW9 A;  4BRI A;  4YOU A;  2F8T A;  1IKX A;  2HHW A;  3IKM A;  4CD3 A;  4IBN A;  5MLC Q;  4FM2 A;  4DQP A;  3LM9 A;  5GIO A;  3NFA A;  4UY8 O;  3OYB A;  4CK3 A;  3SPY A;  4KB1 A;  1LOT B;  1NK4 A;  2XHB A;  3ATU A;  3V6D A;  3EEQ A;  4OGE A;  4M3X A;  1C1C A;  4CF0 A;  4X65 K;  1N6Q A;  3WT0 A;  5ELZ A;  4CZG A;  4GV3 A;  2FSN A;  1NBW A;  3KWI A;  1RBT A;  3MWP A;  4ID5 A;  1B9F A;  3NGY A;  3HZ6 A;  4IFY A;  3P31 A;  3T1Y K;  2VWJ A;  4FLY A;  4PA1 A;  1UA1 A;  4YOV A;  1OH6 A;  4N76 A;  4E7I A;  1GLJ O;  4XH1 A;  3MED A;  3PSI A;  1YT3 A;  3THX A;  2HHU A;  2E88 A;  5KQD A;  2WON A;  2HHS A;  3OBY A;  3HOS A;  1K73 O;  1BQN A;  4CJK A;  1BUP A;  4BGB A;  1SKR A;  5F2R A;  4CIF A;  2D0P A;  4PKI A;  5JLF A;  5ADX A;  3CJA A;  4DUY K;  4B9V A;  2QKB A;  2Y1I A;  4BDZ A;  4LF5 K;  3VEX A;  4JKH A;  3OYE A;  1IO2 A;  2IGI A;  5IWA K;  3O4W A;  1Y64 A;  3SBT A;  5AQI A;  2G8H A;  2G8U A;  4IDH A;  4DFM A;  3NF7 A;  4OKK A;  5CYM A;  3AO2 A;  1KFS A;  3LDS A;  3SQ4 A;  2F7T A;  3CYM A;  1JJ2 M;  3BY5 A;  3Q7B A;  5JVG L;  1WSG A;  3I8D A;  4I2P A;  2ZJP L;  3SBG A;  3FFK B;  3LP3 A;  3PX4 A;  3K5N A;  3ZSR A;  5JIC A;  4CJF A;  3DLE A;  1XMQ K;  3TAF A;  5GAH P;  4KI4 A;  4ISG A;  3OJS A;  2F4V K;  2GX9 A;  4H0P A;  3ZSZ A;  3OS1 A;  3J8A A;  3DRS A;  2E2P A;  4RG8 A;  4JS4 A;  4CGI A;  2EX3 A;  4NCA A;  5AQN A;  4KTQ A;  5KRT A;  3O3F A;  4JKA A;  2O8F A;  3KIO A;  2YNF A;  4C8K A;  2HF4 A;  4ZTJ A;  1EO1 A;  2F96 A;  3BEX A;  5C10 A;  1VQ6 N;  4JKG A;  1K8K B;  4ZHR A;  2HBM A;  4K8Z A;  4PL7 A;  4AM7 A;  4FM0 A;  4LD0 A;  4DSL A;  2G8V A;  1IBM K;  1J9A A;  2QW9 A;  3CJB A;  3VN5 A;  4FZY A;  1RTJ A;  4YFU A;  5AQW A;  3ZSW A;  4HUG A;  2G8F A;  3O08 A;  3G0Z A;  4CZJ A;  4NCG A;  3SPZ A;  5AQK A;  1M90 O;  5LMU K;  5BPL A;  4FWO A;  3V9U A;  3R1X A;  1ZYQ A;  1CXQ A;  4I6M A;  4M45 A;  3F5T A;  2JLE A;  5C2F A;  2YJE A;  5AQV A;  2AJQ A;  4ELT A;  3LDN A;  4IOA L;  1L3V A;  1IJJ A;  1X9W A;  4FOI A;  3DXM B;  5LL6 Z;  3DLR A;  3HTV A;  1W7A A;  1EXQ A;  1IG8 A;  3AVB A;  2G8W A;  4GVM A;  2ZWH A;  5B8H A;  1WSH A;  4B9L A;  4PUO A;  5AQG A;  5M1N A;  5IT9 O;  4RW7 A;  4N56 A;  5BPN A;  4FJM A;  4FLX A;  2DFF A;  3DXK B;  3DM2 A;  2O4I A;  1D8Y A;  4LY7 A;  2D0O A;  1YIJ N;  1S1T A;  3V1O A;  5AZI A;  2NRT A;  3WNH A;  3DOL A;  2P51 A;  3MK6 A;  4W5T A;  3L2V A;  1QE1 A;  1TK8 A;  1C0M A;  1QZ5 A;  4MQ3 A;  4CHP A;  4HUE A;  3VTI A;  4L8R B;  4H4M A;  1FKP A;  2HOE A;  3OS0 A;  2YHA A;  1NK9 A;  1YVN A;  2E4L A;  4A62 A;  3MXM A;  4CZF A;  3VEZ A;  4F2R A;  2UXC K;  3V1R A;  1F21 A;  3U8X A;  5HOO A;  3THW B;  1T05 A;  5AQL A;  1ITG A;  3KD5 E;  1XMO K;  1XNQ K;  3PV8 A;  3FZK A;  2DPN A;  3QFU A;  3CCV N;  2PZS A;  3BF1 A;  2OPQ A;  4J2E A;  3TTF A;  3HPG A;  1QQO A;  1U2V B;  3B8A X;  1Q86 O;  5JMV A;  4DF8 A;  2X6N A;  3ZSO A;  1C0G A;  4O4G A;  1T8E A;  4C8M A;  5EX5 A;  4H03 B;  4KHW A;  2D1K A;  5J1E A;  1VSD A;  3BZK A;  2V7Z A;  1NWK A;  4DR6 K;  4DTU A;  3EO3 A;  3N4Q A;  2HBJ A;  1HQU A;  2O4G A;  2A3Z A;  4DLG A;  3KLE A;  1JLQ A;  1YTA A;  1XWL A;  4JLH A;  2E6M A;  1FW6 A;  4AM6 A;  2G8K A;  2FBY A;  2HST A;  3CXC M;  1SL2 A;  1RFQ A;  1ZBI A;  3KLH A;  3ISN C;  3C7N B;  2W41 A;  2B6A A;  2QA4 N;  5EXW A;  2YV0 X;  4OJR A;  3QER A;  4FWK A;  3JYT A;  3A5M C;  4WE1 A;  4CZH A;  1QTM A;  3KKS A;  1X3N A;  1X9S A;  3M6G A;  5LJV A;  1KAX A;  2HBK A;  4CGD A;  3K57 A;  3ZEU B;  3OYG A;  3C6A A;  4CGG A;  2KQ2 A;  5J2Q A;  4JK7 A;  4CBW A;  4OPA A;  4H0T B;  3CCM N;  4WYB A;  4BRO A;  3TAN A;  4CEF A;  1NG9 A;  4FWR A;  3V1Q A;  3C65 A;  4CER A;  1LV5 A;  4H0O A;  3CC7 N;  2DFE A;  3SI6 A;  1DKG D;  4IJN A;  3KZB A;  3MEE A;  4JKD A;  4DFK A;  3VEW A;  1TUY A;  1T3V A;  1JCG A;  2VG6 A;  1TKX A;  4FLV A;  3SJH A;  4GMJ B;  1EWR A;  4B9M A;  1G99 A;  1S1W A;  4KHN A;  3AV9 A;  5FPD A;  4M7X A;  1JXB A;  3VER A;  4MFB A;  3UKU B;  3U4L A;  4E19 A;  3JXU A;  2YJF A;  4B1X B;  3IRX A;  3PO5 A;  2HHT A;  1BIS A;  4FCY A;  4KI6 A;  2HF3 A;  4L3Q A;  2XY7 A;  1HKC A;  4YOT A;  3L4Q A;  2IOC A;  4FLU A;  3D45 A;  3ALY A;  5M1O A;  2Y1J A;  1KLM A;  1ATR A;  4R5P A;  1TAQ A;  3DLB A;  3SAG A;  2Q97 A;  4HCC A;  2YNH A;  1H1V A;  3CET A;  3THV A;  3EN9 A;  1X9M A;  4DSJ A;  4FZZ A;  1VSJ A;  3AVC A;  3OW2 M;  3M3Z A;  1N36 K;  3VA0 A;  3DOK A;  4CGH A;  2GEM A;  4XH5 A;  2D4W A;  4BQL A;  1EET A;  2ASM A;  1KC8 O;  4CEB A;  1RT6 A;  4HVJ A;  4DKW A;  4KPY A;  2V7Y A;  3DRR A;  4DWI A;  1NU0 A;  4M3T A;  5DM6 L;  3QNO A;  3VET A;  3ULE B;  2IDO A;  2NRX A;  5CYQ A;  4BWJ A;  3OJU A;  4BRG A;  3LZI A;  5E84 A;  4DU4 A;  1RTH A;  2XY6 A;  3M8P A;  4M3Y A;  4M3U A;  4ISE A;  1BL3 A;  4G1Q A;  1JLG A;  1LW0 A;  3NH0 A;  4B1V A;  4JI4 K;  3DLG A;  4OPH A;  3I55 N;  4DV5 K;  2ETJ A;  4DSE A;  3VGK A;  5JLH A;  1QSY A;  4CHZ A;  4WFB L;  1ZXO A;  3WNF A;  2FXU A;  4OLB A;  1RT7 A;  1N33 K;  2VG5 A;  1BDG A;  4F2S A;  4FM1 A;  4RCH A;  4EAH D;  4BR9 A;  3GBT A;  3NF6 A;  1DTT A;  5EY4 A;  4BY9 C;  3ZSX A;  2CH5 A;  2ZD1 A;  1JLC A;  3SMS A;  4EIA A;  4JK8 A;  1HYZ A;  2P9I B;  2ASO A;  2F8S A;  2NRW A;  4IG3 A;  4BQZ A;  2J4R A;  3BUZ B;  1S9G A;  4DTR A;  3CC2 N;  3GDQ A;  4CBX A;  3VPZ A;  1VSI A;  4KH5 A;  1U4B A;  4KRE A;  3SUP A;  2BH1 A;  4BVO A;  5HRO A;  1CZ9 A;  1TK0 A;  4BRF A;  4B3O A;  2KW4 A;  4O44 A;  2ZJR L;  4MDA A;  2WFB A;  5CR4 A;  3ENO A;  4KRF A;  1ASW A;  3AGR A;  5BRD A;  3S3N A;  4FJI A;  1BQM A;  3AVJ A;  3ZSY A;  4AIL C;  5FPN A;  5GAD P;  3RTV A;  3V4I A;  1VQP N;  4JI3 K;  1CXU A;  1VK0 A;  5HRP A;  4YOR A;  4LFA K;  4J2B A;  3A2F A;  2FBV A;  1U47 A;  1WNS A;  3VQB A;  5TKY A;  2QKK A;  5M1K A;  4OPK A;  3EY1 A;  4JKC A;  3TSP A;  4NCB A;  4KHS A;  4Q5V A;  4KHP K;  3VQ5 A;  1RBV A;  4FLW A;  1YJN N;  3THY B;  2JGU A;  3RR8 A;  4DQQ A;  1NGC A;  3O8M A;  2WTU A;  4NYN A;  2YI1 A;  4OX9 K;  4EZ9 A;  1DEJ A;  5ADX H;  4E7J A;  1HJO A;  3UE5 A;  3EE8 A;  1JLB A;  5LY3 A;  4J2D A;  1HNX K;  3TSU A;  3U6F A;  3VQ6 A;  2P9K A;  4CI6 A;  2NLX A;  3ASM A;  3P83 D;  3CM5 A;  3K58 A;  4WQ4 A;  2CGL A;  3QLH A;  1DLO A;  4CJ3 A;  2GBZ A;  3DXM A;  1GLD G;  3QML A;  4HTL A;  2E2N A;  4B1W B;  2KLA A;  3OA9 A;  4TSX A;  1XNR K;  3NHG A;  1JLE A;  1P8Z A;  4O5F A;  4RWT A;  1VSH A;  3OYC A;  1YXQ A;  4H5V A;  1RDW X;  5E41 A;  2HND A;  4AHC A;  3QBX A;  2ITG A;  2FC0 A;  4CFC A;  3TTD A;  3KK3 A;  4PQU A;  4FW2 A;  3F9M A;  1GLA G;  1R0A A;  3DXK A;  4C1N K;  1RGI A;  2ITM A;  1KRP A;  4EP5 A;  2OZM A;  3K9J A;  5EOY A;  4DG1 A;  3O3H A;  3HOT A;  3J81 O;  5HL7 L;  2QWL A;  4JKF A;  3P39 A;  3LAN A;  3K5L A;  3L4I A;  4IJA A;  5FPE A;  3CF5 L;  2HW3 A;  3M1F A;  5I3U A;  4GY2 B;  3P5J A;  4LSN A;  3MX5 A;  4H5R A;  1U49 A;  2IVO A;  2P1J A;  4JKE A;  4MO5 A;  1J5O A;  2WOM A;  1RTI A;  2QWN A;  1Q18 A;  1EX4 A;  3AO3 A;  4DSI A;  3HJF A;  3V9X A;  5HLF A;  4F3T A;  4B08 A;  3SUO A;  2ZF5 O;  3THW A;  1BI4 B;  3VQ4 A;  1M1K O;  1K6Y A;  3H3O B;  5SZT A;  4BGA A;  3ZT3 A;  1GOC A;  4DTO A;  4CF8 A;  5F0X A;  1NJW A;  1SKS A;  4B3M K;  5BN9 A;  3MXI A;  3CPW M;  3F2K A;  4BRE A;  1U2V A;  5JVH L;  5A2Q O;  1TK5 A;  3K2P A;  4KHQ A;  3IFR A;  1VQ5 N;  3QDK A;  4CGF A;  4CE9 A;  4CJU A;  1OH5 A;  2E2Q A;  3T19 A;  1TVR A;  3W3D A;  4DR3 K;  4Z94 A;  3RMC A;  4J8F A;  4QS7 A;  3LP0 A;  4CGJ A;  3GE1 A;  2VQE K;  4Y0W A;  4WQ5 A;  3VQP A;  3NF9 A;  5JS1 A;  4OVL A;  4X64 K;  4ISF A;  3NVK A;  1Z6R A;  4DTS A;  3C94 A;  3KVG A;  4GVE A;  4CHN A;  1QHT A;  3MEG A;  3C7N A;  1VAZ A;  2Z1I A;  3LWL A;  4IXC A;  1HNV A;  4CJ4 A;  3CFR A;  4KO0 A;  1NNE A;  4YHH K;  1O13 A;  4Y1D A;  2GUI A;  2E1Z A;  2IIR A;  4FJ9 A;  2NRV A;  4IDK A;  4CVN E;  3VMF B;  3V9S A;  3A5L C;  3KKR A;  5AQQ A;  3ZEU A;  4BRC A;  5KRS A;  4B9Q A;  1B92 A;  3PO4 A;  2KTQ A;  2IVP A;  3QIP A;  3O4N A;  3IAY A;  1J6Z A;  1RT2 A;  3KWG A;  2H3G X;  4EFH A;  5CZ1 A;  4OGC A;  1S9E A;  2LSN A;  1SQK A;  2BDP A;  4M3W A;  4AHR A;  4B9T A;  1QQM A;  3R8E A;  3AAR A;  1RT3 A;  3R6M A;  4BC2 A;  1SKW A;  3TAB A;  2HHV A;  3TAR A;  3SQ1 A;  1YI2 N;  1HQE A;  3HVR A;  4DV2 K;  4FZX C;  1JL1 A;  1Z26 A;  2YNG A;  4PHT X;  4H5W A;  3ZYY X;  2UXD K;  3HSC A;  3M8Q A;  3UKU A;  2NRZ A;  2YHY A;  4BVP A;  1O1W A;  5KPT A;  4IKF A;  1KAZ A;  4A5B A;  4CF9 A;  1S5J A;  3AVH A;  4CJS A;  4ILG B;  3AA3 A;  4O55 A;  5DK5 A;  5I42 A;  4K25 A;  4FWQ A;  3FR0 A;  2B5J A;  1KD1 O;  4ZTF A;  2BAN A;  4DHY A;  3SAH A;  3NGZ A;  2W6L A;  4H4O A;  2EWS A;  4B8A B;  1NOY A;  3VGM A;  2OPS A;  2ZQB A;  4OLA A;  4BR2 A;  4DB3 A;  1LWF A;  5KGX A;  4O0I A;  1QSL A;  1SUQ A;  5F1X A;  1TYQ B;  3AA4 A;  1E4G T;  3F9K A;  3VQ7 A;  1SL1 A;  3LM2 A;  2G8I A;  1T6C A;  3QIO A;  3NBP A;  2HVH A;  3TPQ A;  3QB0 A;  4DTP A;  4JI8 K;  1NKB A;  3RRG A;  3CPE A;  5CY4 A;  3OYF A;  1K8A O;  3ULE A;  4CJT A;  1IBL K;  4B3T K;  4LF6 K;  4LFB K;  3E01 A;  5BR9 A;  2OAN A;  4BDP A;  4E7H A;  3QIN A;  2P9K B;  3ZT2 A;  3G25 A;  1VRT A;  2QTD A;  5K14 A;  1FK9 A;  5FDL A;  4X66 K;  2YHW A;  2QK9 A;  4CJL A;  4BE2 A;  2RPI A;  2OTJ N;  4E0D A;  1LWC A;  4EHT A;  1T7P A;  3HO1 A;  3O4Q A;  4JK9 A;  1C0F A;  2UU9 K;  4FJ8 A;  3HL8 A;  2GTD A;  3E1Y A;  3VQ9 A;  4BRD A;  5AFU A;  3H1Q A;  3HM8 A;  4DFP A;  2P9I A;  3T69 A;  1D9D A;  3H1V X;  2A5X A;  4YNQ A;  1YJ9 N;  2E8A A;  3L2W A;  1CLQ A;  1HYV A;  2HHX A;  3HPO A;  5AQF A;  3SAF A;  3KJV A;  1OH7 A;  3I8B A;  1J5E K;  4LF4 K;  2A40 A;  5AQX A;  4BR0 A;  2O8B B;  1EKE A;  3AO4 A;  4X62 K;  2IS3 A;  4ILJ A;  3E66 A;  3LP1 A;  4JRP A;  4IO8 A;  4A2A A;  4BRH A;  2QWP A;  2XY8 A;  1LAV A;  2QXL A;  3KHY A;  1QHA A;  3K5M A;  4DSF A;  3AVI A;  4M41 A;  4FXD A;  3CIP A;  1SS6 A;  3GOI A;  1XUP O;  4HHT A;  1RIL A;  1N8R O;  1RBR A;  4DR5 K;  2YKN A;  4IZ9 A;  1ATS A;  5KGW A;  4BC3 A;  2UYT A;  1NJZ A;  3C0B A;  3RMB A;  4FJH A;  3V9W A;  1E3M A;  5KTQ A;  4OO1 J;  3J7Z O;  3THY A;  1UWB A;  5KI6 A;  4R79 A;  1VQK N;  3WQU A;  3E9L A;  5KPZ A;  3NH2 A;  4KH4 A;  1HYS A;  1QSS A;  3CJ1 A;  4Z4G A;  2ATQ A;  4O8U A;  4C8O A;  1E4F T;  1NJY A;  1U48 A;  4KBO A;  1V4T A;  1I3A A;  1S6Q A;  3MX2 A;  3AVG A;  1S1V A;  3AVA A;  4N47 A;  1IKY A;  2PY5 A;  3CCS N;  3M5R A;  3QO9 A;  2FSK A;  4BR4 A;  1Y97 A;  4DU1 A;  4CJ5 A;  4FWP A;  3LDO A;  1QZ6 A;  4Z4H A;  4BRM A;  1S3X A;  3LP2 A;  4H0Y B;  5HBM A;  5CE3 A;  2QM1 A;  2V52 B;  1YF5 L;  4CZM A;  4W5R A;  2W42 A;  2QWM A;  5T7B A;  2OPP A;  2FSJ A;  4QAG A;  3UIQ A;  2Q1N A;  3HPH A;  3S3O A;  1Q7Y O;  4IFE A;  1W9H A;  4CZL A;  5D3G A;  3L6Q A;  5AQJ A;  4Z4F A;  4YOX A;  1YIT N;  1OH8 A;  1NM1 A;  5AQT A;  2I7P A;  3L3U A;  3QET A;  3ENH A;  2OCE A;  3DLK A;  3ENB A;  3O9T A;  5AJ3 K;  5C0Y A;  1B9D A;  1KVC A;  5HP1 A;  4IFV A;  4DCH A;  2HNY A;  1ASV A;  3KK2 A;  4YDU A;  2FBX A;  4DQ8 A;  3D2E B;  4WF9 L;  3AO5 A;  1WLJ A;  4FJG A;  1NOZ A;  1BI4 A;  4OKJ A;  1KFD A;  1JXE A;  4CJQ A;  1RT4 A;  4CD1 A;  4K8X A;  3B6O A;  3S3M A;  1MA9 B;  4CJE A;  2VWK A;  3BF3 A;  3ZSV A;  2E1Y A;  2UUC K;  5AR0 A;  1NMN A;  4BG8 A;  4M3Z A;  4A59 A;  5TKW A;  4JI6 K;  3C6U A;  4B3R K;  4QS8 A;  3WQT A;  3OYA A;  1YJW N;  2QI2 A;  1BIZ A;  2PFU A;  3EKU A;  1I39 A;  4BDY A;  3MAQ A;  3O6W A;  4JD2 B;  3CCU N;  3OYK A;  2A1S A;  1YAG A;  1NGE A;  4Z4C A;  3OBW A;  2ZGY A;  1HPZ A;  2CGK A;  1CZB A;  3KLF A;  2YKM A;  4FJJ A;  4RW6 A;  1L3S A;  1RDU A;  3HI0 A;  3CJ7 A;  1G15 A;  1JCF A;  5FRM A;  5FRO A;  1EQY A;  3LDP A;  1TL3 A;  2O8D B;  3CQ8 A;  4KB0 A;  1TUU A;  3UKR B;  4FLT A;  3ID8 A;  3O9Q A;  3V9Z A;  2HHH K;  3C6H A;  1LWE A;  4XH4 A;  1T03 A;  3OHR A;  4JI7 K;  2ZGZ A;  1RTD A;  1SL0 A;  2FF6 A;  1YHQ N;  3PX6 A;  1QS4 A;  3AY9 A;  3SZ2 A;  4CEO A;  2VWB A;  2RF2 A;  1C1A A;  4KTW A;  1XQS C;  2NUB A;  4CHO A;  4DS5 A;  3HST B;  2HNZ A;  3HP6 A;  4A2B A;  4IG0 A;  4CHY A;  4BAC A;  2CGJ A;  3BZC A;  2GUP A;  3OY9 A;  3S41 A;  3QBW A;  4K0K K;  4H0X B;  4B1U B;  3K0S A;  2FF3 B;  5GAG P;  4BE1 A;  1Q81 O;  4FVU A;  5AQY A;  3CCQ N;  1YTU A;  4JHD B;  3ZCM A;  4DSK A;  4NB4 A;  3VEO A;  4KV8 A;  2A1R A;  1S1X A;  5AQO A;  3QEV A;  2NRH A;  1HPM A;  2F9T A;  1U6Z A;  4H5N A;  1NGF A;  4O0J A;  4NXM K;  1L3T A;  1L5U A;  4CZK A;  4AHV A;  1D9F A;  1KCF A;  1NGD A;  1UAX A;  1ZBU A;  3L2R A;  2EHG A;  3EL2 A;  3AA5 X;  3C6T A;  3FGU A;  1OKJ A;  4FPB A;  1KTQ A;  3QFP A;  4FPA A;  4ICL A;  1WSJ A;  3WXL A;  1WBD A;  4Q0B A;  2Q3S A;  4GW6 A;  4DTN A;  3J7A P;  3PSF A;  3AO1 A;  2IC3 A;  3DMJ A;  3TAQ A;  1TYQ A;  4B1Y B;  4LF9 K;  3FE1 A;  1YVU A;  1C0T A;  3D2F B;  3VEY A;  3H46 O;  4NYF A;  2FBT A;  3C95 A;  1MU2 A;  1GLL O;  1K9M O;  4BWM A;  3SYZ A;  4DTJ A;  1RT1 A;  2P9L B;  3M8R A;  3MWT A;  3CD6 N;  5SWM A;  1N32 K;  2NNW A;  1S6P A;  1HLU A;  4AHS A;  4DQR A;  3CCR N;  1NK0 A;  3CJC A;  3EZ5 A;  3PX0 A;  1RDB A;  3CER A;  3U3Y A;  3IDH A;  3I0R A;  4KAZ A;  4FJ5 A;  3CCJ N;  2A41 A;  3O9R A;  3J7Y P;  3TAM A;  3L0Q A;  2P9U B;  3OYJ A;  4JKB A;  1VSK A;  3O9U A;  2E20 A;  4B1Z A;  4FWM A;  4NXN K;  3E9P A;  3DJC A;  3KLI A;  3DAW A;  3LL3 A;  3LPU A;  3MDQ A;  1VQ9 N;  2AA4 A;  3TTC A;  1RNH A;  3MXJ A;  4FK2 A;  5J2N A;  5CHI A;  1TKT A;  2P9P B;  2I5J A;  4DF4 A;  5FLX O;  3IS9 A;  4B9U A;  3UB5 A;  1U45 A;  1HKG A;  3CCL N;  1VHX A;  3HXM A;  4LF7 K;  5KQ8 A;  3FZF A;  4DMN A;  4E7L A;  4E89 A;  1RCH A;  4FK0 A;  3I0S A;  4FJL A;  2NZT A;  1RDC A;  1Q8I A;  3A5N C;  3LWM A;  2RN2 A;  1X1P A;  2X78 A;  3VES A;  5CZ2 A;  1TL1 A;  2O8B A;  3ATV A;  2O8E B;  4MLE A;  4CBU A;  1ESV A;  1GOB A;  4DV6 K;  3AAQ A;  1HR0 K;  3CFO A;  2P9S B;  3A5O C;  4B8C A;  3ITH A;  2HMI A;  4O5B A;  2KFZ A;  1R59 O;  1BCM A;  3H6E A;  4UQG A;  3U9D A;  1KXP A;  2GEL A;  3OYN A;  1NGA A;  1FJG K;  2OA8 A;  5FPM A;  1S1U A;  2O8C B;  4BR5 A;  2HBL A;  4HUF A;  3O80 A;  4DTX A;  3DRP A;  4CJP A;  4DLE A;  4G9Z A;  1BCO A;  2YX6 A;  4WFA L;  3DYA A;  3G6E N;  1UOC A;  4LFC K;  3SJJ A;  3CCE N;  1ZBF A;  1WSF A;  4DTM A;  3PY8 A;  3CM6 A;  3PIP L;  4FOE A;  1NGB A;  3VGL A;  3SMP A;  5FRN A;  1NMD A;  3OYM A;  3JS6 A;  4FWS A;  4CK1 A;  4DQS A;  4OPJ A;  2QXF A;  4I7F A;  2X74 A;  3VQE A;  1MWM A;  1KAY A;  5AFU H;  1VQ4 N;  4CJW A;  4K41 A;  4F9O A;  4E1J A;  2OTL N;  1KVA A;  2E6L A;  4WQ4 C;  1QVG M;  3MN5 A;  5J2P A;  4DR2 K;  4NLB A;  5GIP A;  3KK1 A;  2RHK A;  4IOC L;  2UUA K;  5AQZ A;  5KPR A;  3CMA N;  3BGR A;  3O5B A;  1XC3 A;  4FJX A;  4E1M A;  5DM7 L;  4JI2 K;  2WC9 A;  1Z25 A;  4CJV A; 
#chains in the Genus database with same CATH homology
 3Q7C A;  5AZJ A;  3CC4 N;  2YJF A;  3ZX3 A;  5AQF A;  3SAF A;  4B1X B;  3IMX A;  3CQY A;  1W97 L;  3AAP A;  3I8B A;  5M1P A;  1QQN A;  5E26 A;  3WEE A;  2A40 A;  3FZM A;  5AQX A;  4BR0 A;  2HF3 A;  4L3Q A;  4CJ7 A;  1HKC A;  4YOT A;  3L4Q A;  4GV9 A;  3T7Z A;  3VEN A;  3R9P A;  2E2O A;  4ILJ A;  4YOY A;  3E66 A;  5M1O A;  1Q82 O;  3K9K A;  4IO8 A;  4A2A A;  4BRH A;  1ATR A;  2QWP A;  3SAG A;  5AQP A;  2Q97 A;  2QXL A;  1H1V A;  1QHA A;  1BG3 A;  3CET A;  3KHY A;  2QWO A;  1MWK A;  3EN9 A;  3EZW A;  3MN7 A;  4EHU A;  3CIP A;  1SS6 A;  3ZX2 A;  3GOI A;  1XUP O;  3MN9 A;  3H45 C;  4NO7 A;  3M3Z A;  3OW2 M;  3SK3 A;  3D2E A;  5AQR A;  3RSE A;  2GEM A;  4XH5 A;  1N8R O;  2D4W A;  4BQL A;  4IZ9 A;  2ASM A;  1ATS A;  1NLV A;  4BC3 A;  1KC8 O;  2UYT A;  2YHX A;  3CI5 A;  3C0B A;  2KKZ A;  4DKW A;  3HBT A;  2V7Y A;  5AQU A;  2W40 A;  4OO1 J;  3KK7 A;  3RVC A;  3ID6 A;  3ZX0 A;  5DM6 L;  1X9J A;  3J7Z O;  4MO4 A;  5BRE A;  1T44 A;  3VET A;  3ULE B;  4R79 A;  1VQK N;  3TSQ A;  3WQU A;  2NRX A;  2AP1 A;  3E9L A;  4C23 A;  2CH6 A;  5KPZ A;  2P9N B;  4CZE A;  4KH4 A;  3PIO L;  3ZET A;  4BRG A;  1SZ2 A;  5E84 A;  3CJ1 A;  1D4X A;  2A6A A;  2VGN A;  4ISE A;  2ZJQ L;  1KQS M;  4O8U A;  4MLH A;  4OPH A;  4B1V A;  3FLC O;  3I55 N;  2GWJ A;  3VGK A;  5JLH A;  1E4F T;  4JAX A;  1GLE G;  2WBN A;  4WFB L;  1ZXO A;  2FXU A;  4KBO A;  1V4T A;  4JD2 A;  3CJ9 A;  1BDG A;  3MX2 A;  4RCH A;  2ASP A;  3GL1 A;  4EAH D;  4BR9 A;  4WQ5 C;  3GBT A;  3G71 N;  1NGJ A;  4M63 C;  2FLO A;  5AQS A;  5EY4 A;  4BY9 C;  3CCS N;  2CH5 A;  3SMS A;  3M5R A;  3VTH A;  2FSK A;  4BR4 A;  4EIA A;  1VQ8 N;  4JK8 A;  2P9I B;  3A8Y A;  1QVF M;  2ASO A;  3O9S A;  2NRW A;  4BQZ A;  4FWP A;  3GG4 A;  3MCP A;  2J4R A;  4RTF D;  3BUZ B;  1VQN N;  3LDO A;  4BRI A;  4YOU A;  2Q2R A;  1YUW A;  3GDQ A;  1QZ6 A;  5BPM A;  3CC2 N;  4BRM A;  3VPZ A;  1S3X A;  3IKM A;  4H0Y B;  4KH5 A;  4CBX A;  4CD3 A;  5CE3 A;  2QM1 A;  5MLC Q;  4LC9 B;  2BH1 A;  3IUC A;  3LM9 A;  4BVO A;  2V52 B;  4BC4 A;  5GIO A;  4UY8 O;  4PL8 A;  5AZJ B;  1YF5 L;  4CZM A;  2QWM A;  3UKR A;  2FSJ A;  1LOT B;  2I7N A;  3ATU A;  2Q1N A;  4BRF A;  4MDB A;  1Q7Y O;  4IFE A;  2ZJR L;  3WT0 A;  4CZL A;  5ELZ A;  4CZG A;  4MDA A;  2WFB A;  3L6Q A;  5CR4 A;  2VCP A;  3ENO A;  3WEE B;  4GV3 A;  5AQJ A;  4YOX A;  2FSN A;  3AGR A;  1YIT N;  3VOV A;  1NBW A;  1NM1 A;  5AQT A;  5BRD A;  2I7P A;  3KWI A;  3MWP A;  5C2D A;  3ENH A;  3ENB A;  3O9T A;  5C0Y A;  4IWV A;  4U7B A;  5FPN A;  2JWK A;  3HZ6 A;  4BG9 A;  5GAD P;  5H1S Q;  1VQP N;  4DCH A;  3D6R A;  3P31 A;  4YOR A;  4YDU A;  4PKH A;  3U9Z A;  4AF1 A;  1GLF O;  4DQ8 A;  3D2E B;  3RSE B;  4YOV A;  2PBD A;  4WF9 L;  5TKY A;  2KHO A;  1GLJ O;  5M1K A;  4XH1 A;  1SAZ A;  4JKC A;  3TSP A;  4JHD A;  4CD1 A;  1P90 A;  3AGK A;  4C1N I;  1YJN N;  1MA9 B;  2E88 A;  1NGC A;  3O8M A;  1VQM N;  5KQD A;  2YI1 A;  3FZL A;  3OBY A;  3BF3 A;  1DEJ A;  2E1Y A;  5ADX H;  1DT9 A;  5AR0 A;  3HOS A;  3SLC A;  3H3N O;  4BG8 A;  1K73 O;  1HJO A;  3ZET B;  3UE5 A;  1BUP A;  4A59 A;  5TKW A;  4BGB A;  3EE8 A;  5F2R A;  5LY3 A;  2D0P A;  4PKI A;  5JLF A;  4H5T A;  4YOW A;  5ADX A;  1ZBS A;  3CJA A;  3TSU A;  4QS8 A;  3WQT A;  1NJI O;  2P9K A;  4CI6 A;  3WXK A;  1YJW N;  3E9O A;  2NLX A;  3VEX A;  4K43 A;  4JKH A;  1LCU A;  4WQ4 A;  2CGL A;  2PFU A;  2QI2 A;  3EKU A;  1BU6 O;  5GAE P;  2BUP A;  3O4W A;  3O6W A;  4JD2 B;  1VQL N;  1Y64 A;  3DXM A;  1GLD G;  3D7E O;  3QML A;  4HTL A;  3SBT A;  2E2N A;  3VF4 A;  2KLA A;  3OA9 A;  5AQI A;  4B1W B;  3P4I A;  1YAG A;  1NGE A;  1P8Z A;  4IDH A;  4O5F A;  4RWT A;  3OBW A;  2ZGY A;  2WUS A;  1YXQ A;  2CGK A;  2V51 B;  4IEE A;  4WCE L;  2F7T A;  4H5V A;  1JJ2 M;  3D2F A;  1RDW X;  3Q7B A;  3QBX A;  1BWF O;  4FWN A;  2Q36 A;  5JVG L;  3TTD A;  3CME N;  3F9M A;  1GLA G;  1RDU A;  3HI0 A;  2P9L A;  3DXK A;  3SBG A;  2ZJP L;  3FFK B;  3VF2 A;  4C1N K;  1RGI A;  3BP8 A;  4JEP A;  3CJ7 A;  2ITM A;  1JCF A;  4O8K A;  5JIC A;  1EQY A;  3LDP A;  4GNI A;  1TUU A;  5GAH P;  3K9J A;  5EOY A;  4ISG A;  3UKR B;  3HOT A;  3ID8 A;  3O9Q A;  5HL7 L;  3QIC A;  1ILY A;  1V4S A;  2QWL A;  1BA0 A;  3C6H A;  3EE9 A;  4JKF A;  4XH4 A;  3P39 A;  3OHR A;  2GX9 A;  4JNE A;  2ZGZ A;  4H0P A;  3A0I X;  1ZC6 A;  2VGM A;  2FF6 A;  3L4I A;  3J8A A;  4IJA A;  5FPE A;  3M1F A;  3CF5 L;  3AY9 A;  1YHQ N;  4GY2 B;  2VWB A;  2E2P A;  2P9U A;  3MX5 A;  4H5R A;  2IVO A;  1XQS C;  4JKE A;  4MO5 A;  4A2B A;  2QWN A;  3FZH A;  1Q18 A;  1NGG A;  5AQN A;  4JKA A;  5I9E B;  2CGJ A;  2GUP A;  3S41 A;  3QBW A;  4NLC A;  4H0X B;  4B1U B;  2FF3 B;  2VYP A;  5GAG P;  2HF4 A;  3P38 A;  1Q81 O;  4FVU A;  2P9P A;  2ZF5 O;  1EO1 A;  5AQY A;  3W0L A;  3CCQ N;  3BEX A;  1M1K O;  3LDQ A;  5C10 A;  1VQ6 N;  1JCE A;  3H3O B;  4JHD B;  3DLL L;  4JKG A;  1K8K B;  3CCU N;  4NB4 A;  4BGA A;  3VEO A;  2HBM A;  4PL7 A;  2NRR A;  4AM7 A;  5F0X A;  5AQO A;  2NRH A;  1HPM A;  2F9T A;  2QW9 A;  3CJB A;  1HUX A;  1U6Z A;  5AQH A;  1S22 A;  5BN9 A;  3WXI A;  3F2K A;  4BRE A;  3CPW M;  1U2V A;  4H5N A;  5AQW A;  1NGF A;  5JVH L;  2QEX N;  2IVN A;  3O08 A;  3VEV A;  3IFR A;  4CZJ A;  1VQ5 N;  3QDK A;  4CZK A;  5AQK A;  3N4P A;  1M90 O;  4ILH A;  1NGD A;  2E2Q A;  5BPL A;  4FWO A;  4IOX A;  3EL2 A;  3WUH A;  3W3D A;  5LJW A;  4GV6 A;  3FGU A;  3R1X A;  3VF6 A;  3R3L A;  4Z94 A;  4I6M A;  4IEI A;  4J8F A;  1OKJ A;  2P9S A;  1VQ7 N;  3F5T A;  4QS7 A;  2QWR A;  5C2F A;  3GE1 A;  2YJE A;  4FPB A;  4Y0W A;  4WQ5 A;  5AQV A;  3QFP A;  4FPA A;  3LDN A;  3WXL A;  4IOA L;  1IJJ A;  4FOI A;  3DXM B;  4ISF A;  5BRF A;  3NVK A;  3HTV A;  1Z6R A;  4BR7 A;  1IG8 A;  2ZWH A;  3KVG A;  5B8H A;  1TYQ A;  4B1Y B;  5C12 A;  3FE1 A;  4GVE A;  3D2F B;  3VEY A;  3H46 O;  5AQG A;  3C7N A;  1VAZ A;  3WXM B;  5M1N A;  1GLL O;  1DGK N;  1K9M O;  3MN6 A;  1WUA A;  5BPN A;  4IXC A;  2BTF A;  2PAV A;  3G4S N;  1X3M A;  2P9L B;  3DXK B;  1GLB G;  4QS9 A;  1O13 A;  3CHW A;  4A61 A;  3MWT A;  2E1Z A;  2IIR A;  3CQX A;  2NRV A;  3CD6 N;  2D0O A;  1ATN A;  3EKS A;  2NNW A;  3O1W A;  1YIJ N;  3MMV A;  3VMF B;  2F9W A;  4WFN L;  1HLU A;  2Q0R A;  1MDU B;  3A5L C;  4PKG A;  5AQQ A;  5AZI A;  3ZEU A;  5M1F A;  2NRT A;  3CCR N;  3CJC A;  4BRC A;  5BN8 A;  4B9Q A;  2IVP A;  3CER A;  3MK6 A;  3IDH A;  1J6Z A;  3HRG A;  3KWG A;  2H3G X;  4EFH A;  3CCJ N;  4FO0 A;  2A41 A;  3O9R A;  1SQK A;  3MCA B;  3L0Q A;  1QZ5 A;  2P9U B;  3VTI A;  1QQM A;  4JKB A;  1NGH A;  3R8E A;  3AAR A;  4BC5 A;  2HOE A;  4K42 A;  3O9U A;  2E20 A;  3R6M A;  4B1Z A;  4FWM A;  4BC2 A;  1YVN A;  4A62 A;  3E9P A;  3DJC A;  4CZF A;  3NVM A;  1HX1 A;  3DAW A;  3LL3 A;  3MDQ A;  3VEZ A;  2AA4 A;  3TTC A;  1YI2 N;  1VQ9 N;  2QWQ A;  1VQO N;  1OVY A;  4FL9 A;  3U8X A;  2RE2 A;  4PHT X;  3WXJ A;  5CHI A;  4H5W A;  3ZYY X;  2P9P B;  5HOO A;  4BRA A;  5AQL A;  3HSC A;  3UKU A;  3FZK A;  2DPN A;  1Z05 A;  4JKG B;  3UB5 A;  1HKG A;  3CCL N;  2NRZ A;  2YHY A;  2Q31 A;  3QFU A;  4BVP A;  3CCV N;  5M1Q A;  4M7Y A;  5KPT A;  3BF1 A;  1KAZ A;  5KQ8 A;  3FZF A;  4A5B A;  1HKB A;  2HMP A;  4BRQ A;  1BOT O;  3TTF A;  1QQO A;  2NZT A;  1U2V B;  3B8A X;  1Q86 O;  3A5N C;  4ILG B;  5JMV A;  3VES A;  1C0G A;  4K25 A;  4FWQ A;  3O1B A;  1CZA N;  3FR0 A;  5EX5 A;  3ATV A;  4H03 B;  4MLE A;  4CBU A;  2D1K A;  3I56 N;  1KD1 O;  1ESV A;  3AAQ A;  2V7Z A;  1NWK A;  4I6M B;  2P9S B;  3A5O C;  4DHY A;  3SAH A;  4JN4 A;  3EO3 A;  2EWS A;  3N4Q A;  2HBJ A;  3VGM A;  2A3Z A;  4KH6 A;  1R59 O;  3H6E A;  4BR2 A;  4DB3 A;  1NGI A;  5AQM A;  3U9D A;  1KXP A;  1WOQ A;  2GEL A;  4BRP A;  1NGA A;  4AM6 A;  5F1X A;  1S72 N;  1BO5 O;  5FPM A;  1TYQ B;  3NMU A;  2HST A;  1E4G T;  4BRK A;  3CXC M;  1RFQ A;  4BR5 A;  4CZI A;  4YDU C;  3LM2 A;  1T6C A;  2HBL A;  3C7N B;  2W41 A;  2GWK A;  3O80 A;  3TPQ A;  3QB0 A;  4FSV A;  5EXW A;  2QA4 N;  4G9Z A;  3CPE A;  2YX6 A;  4WFA L;  1K8A O;  5C15 A;  3G6E N;  4FWK A;  3ULE A;  3A5M C;  2JWL A;  4CZH A;  3CCE N;  1X3N A;  5BR9 A;  3PIP L;  2P9N A;  4FOE A;  1NGB A;  3M6G A;  5LJV A;  1KAX A;  2HBK A;  3VGL A;  2OAN A;  5AZI B;  2A42 A;  3SMP A;  3ZEU B;  2Q0U A;  2YCH A;  2P9K B;  1NMD A;  3C6A A;  3G25 A;  2QTD A;  4BRL A;  3JS6 A;  3PLA A;  4FWS A;  4JK7 A;  1W2B M;  4CBW A;  4OPA A;  3LDL A;  4H0T B;  4XEI A;  3CCM N;  4WYB A;  4BRO A;  1MWM A;  4FWR A;  1KAY A;  3C65 A;  4H0O A;  5AFU H;  2YHW A;  1VQ4 N;  3CC7 N;  4K41 A;  1DKG D;  4IO9 L;  4IJN A;  3KZB A;  4E1J A;  4F9O A;  2OTL N;  2OTJ N;  1T6D A;  4JKD A;  4EHT A;  3VEW A;  1TUY A;  4JK9 A;  1T3V A;  4WQ4 C;  5BRH A;  1C0F A;  3I33 A;  4FWL A;  3MN5 A;  2GTD A;  1QVG M;  1JCG A;  3E1Y A;  4BRD A;  4A57 A;  5AFU A;  3H1Q A;  1BA1 A;  4A5A A;  4NLB A;  3HM8 A;  5GIP A;  5GIN A;  3SJH A;  2RHK A;  3DWL A;  4IOC L;  2P9I A;  1G99 A;  5AQZ A;  5KPR A;  5EVZ A;  3T69 A;  4U67 L;  5FPD A;  4M7X A;  3CMA N;  3O5B A;  3VER A;  3H1V X;  1XC3 A;  3UKU B;  4HWI A;  2A5X A;  3U4L A;  4BRN A;  1YJ9 N;  2E8A A;  3TU5 A;  5DM7 L;  1GLC G;  4H0V B;  2WC9 A;  1K8K A;  3JXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...