2GELA

2.05a crystal structure of salmonella typhimurium yeaz, form b
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
218
structure length
218
Chain Sequence
MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Putative Gram negative resuscitation promoting factor
publication title Structural Characterization of Salmonella typhimurium YeaZ, an M22 O-Sialoglycoprotein Endopeptidase Homolog
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 66
structure length 218
sequence length 218
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gelA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gelA02
3RSEB 3ID8A 1IJJA 3S41A 1XUPO 3J8AA 1CZAN 3ENOA 4PL7A 1BWFO 5AQYA 1C0GA 3A5NC 4H5RA 3A5OC 5KPRA 3EKUA 4BRGA 3FGUA 1QQMA 2D4WA 2ZGZA 1YXQA 2P9LB 4MLHA 3MN9A 1HJOA 3VEXA 3F9MA 4CBWA 1NGAA 3GG4A 4O8KA 4JD2A 1NGFA 3IUCA 3CJ9A 4BR2A 1K8KA 1SAZA 4I6MB 1ZC6A 3H45C 3P4IA 4XEIA 1E4GT 1HKBA 2D0OA 2PAVA 5BPNA 5F1XA 3O8MA 1SZ2A 4CZJA 5AQLA 4A2AA 4K43A 4C23A 1GLDG 3B8AX 3SLCA 3ATVA 4M7YA 4YDUC 4YDUA 1YAGA 1DGKN 4CZEA 1GLFO 4IO8A 4JHDA 3CJBA 5AZJA 3VETA 2GWJA 2IVOA 3WQTA 2P9PB 3KHYA 4RTFD 2VCPA 3LDPA 4BRAA 2P9SB 1JCGA 5LY3A 2NRHA 3DJCA 2IVPA 3VF6A 4BRQA 2E88A 1OKJA 3DXKA 4FOIA 1LCUA 3VGMA 3VENA 2QWMA 2V7YA 1TUYA 4RCHA 1XQSC 2PBDA 5ADXH 3LDNA 1HUXA 3CIPA 2BUPA 2QWNA 5JLFA 5BN9A 2F9WA 3D7EO 3H1QA 2QWRA 3D2EB 4H5VA 3UKRA 3UKUA 3ZX0A 1U2VA 3QDKA 3C0BA 1NGJA 5AQPA 3SJHA 1X3MA 1RFQA 3CJ1A 5AQHA 2Q31A 3UB5A 2CH5A 1QHAA 2YI1A 1NGHA 2QM1A 1NGIA 4ISFA 1ATRA 2GEMA 5AFUA 3SMSA 2ASPA 3WUHA 3KZBA 4A62A 4BRIA 4BVOA 3ULEB 3L0QA 2IIRA 4IJAA 1NLVA 4BR7A 5AQZA 1YVNA 4H0OA 4FL9A 4KBOA 4H0PA 3A5LC 2UYTA 2DPNA 4PKGA 4CZMA 1HLUA 2Q36A 2E2PA 4NO7A 4BR0A 2E2OA 1QQOA 3O08A 1ATSA 4H5TA 4CI6A 4WQ4A 4NB4A 1TUUA 1ZXOA 1G99A 4BC5A 4BREA 4LC9B 3WEEB 1TYQB 3M6GA 4CBXA 4F9OA 4IWVA 4H03B 4BVPA 3EKSA 4BRCA 3WT0A 4PL8A 1GLBG 4FPAA 4BRKA 3O1WA 1T6CA 2D1KA 3O5BA 4J8FA 4XH5A 5F2RA 5ELZA 1D4XA 3QB0A 3QFPA 3ZX2A 4B1ZA 1GLLO 2FSJA 4MO4A 3FR0A 3A0IX 2ASMA 3R6MA 2I7NA 1Z6RA 1BDGA 5AQQA 4CD3A 1BUPA 1X3NA 1H1VA 1MA9B 1V4SA 1HPMA 3CJCA 2FSNA 4EFHA 5BPMA 3H46O 4Y0WA 3FZKA 4FPBA 1JCFA 1BU6O 3CJ7A 3U8XA 4BC2A 1NGBA 5AZIB 5EX5A 4MO5A 3DWLA 4IJNA 3L6QA 2P9NB 5EY4A 2GWKA 2GELA 1QZ6A 1GLCG 3MDQA 3R9PA 5KPTA 3A5MC 3C7NB 2VYPA 3D2FA 3VEOA 2BTFA 4FWNA 2P9KA 2E1YA 2P9UA 4BC3A 3DXMA 3QFUA 2FSKA 5CE3A 2E1ZA 1GLJO 3QBWA 4O5FA 5AQMA 4FWPA 3ZX3A 4BGAA 5AQWA 3W0LA 3W3DA 4DHYA 2E8AA 4CJ7A 3ZEUA 4CZHA 3WXKA 4BR5A 3CQYA 3BP8A 1DEJA 3H3OB 1BA0A 4ISEA 4B1YB 1E4FT 2E2QA 2QW9A 2OANA 1NWKA 3VGLA 4BRDA 4FWOA 3VEYA 4H0XB 1MDUB 1Y64A 4JD2B 5BREA 1EQYA 1QZ5A 1HKCA 5AQFA 1RDWX 4HWIA 1BA1A 4AM6A 1K8KB 4M63C 2NZTA 2CGJA 3LDLA 2A40A 1RGIA 1ESVA 1XC3A 4B1UB 3G25A 1R59O 4IZ9A 2E2NA 2QWOA 4PKHA 1JCEA 2P9IA 3QICA 2F9TA 2KHOA 3H1VX 4EAHD 5KPZA 4E1JA 3FE1A 1NGCA 5EOYA 3EL2A 5KQDA 5AQNA 1KAZA 4FWMA 5BRFA 5ADXA 1MWKA 3U4LA 1Z05A 1QQNA 2FLOA 1NMDA 4H0YB 3O6WA 4JHDB 5AZJB 3GE1A 3ZETA 3MCPA 3MK6A 4QS7A 3ENHA 2J4RA 5BN8A 3QBXA 3VOVA 4CZIA 3DXKB 5JLHA 4CZGA 5JICA 1NGGA 1Q18A 3ATUA 5LJVA 4GNIA 2WUSA 4B1WB 4L3QA 3CQXA 3VF4A 2YCHA 4H0VB 3CETA 3TPQA 4AM7A 3I8BA 5AQSA 1SQKA 5AQOA 2AP1A 3FZFA 2FF3B 1DKGD 5I9EB 4WQ4C 4DCHA 1BG3A 3UKRB 3IFRA 4FWKA 1U2VB 3HM8A 4IXCA 4ISGA 4JN4A 2Q0RA 3RSEA 3WXLA 4BRMA 4DB3A 3CERA 5AQRA 4DQ8A 2W41A 3H3NO 2YJEA 4M7XA 3VEZA 1S22A 4CZKA 3L4IA 2NLXA 4FWSA 3CHWA 4FSVA 4H5WA 4MLEA 4BRPA 2V51B 5EVZA 3IDHA 5BPLA 4QS9A 3UE5A 5EXWA 2P9LA 2V7ZA 1IG8A 1T44A 3AARA 5AQVA 3EN9A 2ASOA 3H6EA 4BRHA 3O80A 2V52B 4WQ5A 5AQGA 1NM1A 4BG8A 2Q1NA 3VEWA 4BROA 2GUPA 2CGKA 3MMVA 2I7PA 3VESA 4I6MA 4JNEA 1NBWA 1BOTO 4FWRA 1V4TA 4RWTA 5AQJA 3CI5A 3FZHA 4BC4A 5AQXA 3JXUA 4JAXA 3WXJA 2ZGYA 3FZMA 3HSCA 5BRHA 3BF1A 5AQIA 5TKYA 5KQ8A 2H3GX 3QMLA 5FPNA 3JS6A 3LDQA 3OHRA 2A41A 3FLCO 3VERA 5FPMA 2FXUA 5BRDA 2YHWA 4EHUA 5F0XA 2QXLA 2A5XA 4A61A 4XH4A 2AA4A 3MN5A 2P9PA 3FZLA 3BF3A 2P9SA 5BR9A 2HF3A 1GLEG 3HBTA 5AQKA 4BQLA 5B8HA 2Q2RA 2ZWHA 2VWBA 4CZFA 4GY2B 3M3ZA 4BR4A 3M1FA 3WQUA 1NGEA 1WUAA 3R8EA 1KAXA 1LOTB 2GTDA 4H5NA 2A3ZA 3D2EA 3D2FB 1S3XA 2W40A 1ZBSA 2P9KB 2P9UB 3DXMB 3GBTA 5JMVA 2FF6A 4BRLA 3I33A 2Q97A 2ITMA 3VEVA 1YUWA 4FWLA 3ZEUB 2HMPA 3A8YA 3AAPA 4FWQA 5FPDA 3FFKB 4HTLA 2ZF5O 3ULEA 3O1BA 3LM9A 1C0FA 4BR9A 3EO3A 2YJFA 3DAWA 5AQTA 4B1VA 3GOIA 2QWQA 1J6ZA 2A42A 4PKIA 4BQZA 4EHTA 5LJWA 1GLAG 3AAQA 1HKGA 2YHYA 3LL3A 3MN7A 3SK3A 4K25A 4QS8A 4B9QA 5FPEA 5AQUA 3VGKA 4BRFA 3HZ6A 2E20A 4WYBA 5AFUH 1ATNA 3EZWA 4BG9A 4K41A 1U6ZA 3GDQA 2Q0UA 3KVGA 4H0TB 3WEEA 1TYQA 2P9IB 3LDOA 3WXIA 4FOEA 2CH6A 1KXPA 3U9DA 4A2BA 3GL1A 3VF2A 3UKUB 3VPZA 3CJAA 2HF4A 5AR0A 2QWPA 3IMXA 1NGDA 2QWLA 2A6AA 3SMPA 3BUZB 4CZLA 2EWSA 3ZETB 4BGBA 1BO5O 3O4WA 3U9ZA 1P8ZA 1X9JA 3MN6A 3HTVA 1WOQA 2CGLA 1MWMA 3BEXA 4Z94A 5AZIA 3AY9A 2IVNA 4CBUA 4WQ5C 5E26A 3TU5A 2P9NA 1T6DA 4BRNA 2YHXA 4XH1A 3HI0A 4FO0A 1KAYA 4EIAA 4K42A 4CD1A 3LM2A 4B1XB 3C7NA 2D0PA 1HX1A 5E84A 2HOEA
chains in the Genus database with same CATH superfamily
3ID8A 3S41A 1XUPO 3DLGA 3CF5L 5HRSA 4WFAL 4BWMA 3EE8A 4IFYA 4OKEA 3V9UA 1U48A 5AQYA 4WCEL 5KPRA 3HXMA 3P31A 4BRGA 1HNWK 4W5QA 3CCRN 2B6AA 2YKMA 4FJLA 1VSHA 1HJOA 3FFIA 4KHNA 3F9MA 1EXQA 3NAEA 3KLFA 1NGFA 2PYJA 2FC0A 1BL3A 3NF6A 4E7LA 3CMEN 1K8KA 3SUQA 1ZC6A 3H45C 3IAYA 1TAUA 4Y1CA 5GINA 1HKBA 2D0OA 1R0AA 3OYLA 1ILYA 3LPTA 4CVNE 5HROA 1CXUA 2KW4A 1GLDG 3T3FA 3B8AX 1Q82O 3VA0A 4E7KA 2IOCA 3TSQA 3ATVA 3J7YP 4M7YA 4JKFA 4KO0A 2PY5A 3LAMA 4OLBA 3DRRA 5AZJA 2VGMA 3DLEA 1SV5A 3AVJA 2VCPA 2P9SB 4DU4A 4BRQA 4H8KA 4FOIA 1JLBA 3VENA 4CHQA 3F5TA 4KB1A 4RCHA 2IS3A 2PBDA 4CF0A 2B4JA 1REVA 3L2WA 4OLAA 4OGCA 5J2NA 2F9WA 1NU0A 3D7EO 3E9OA 2QWRA 4RW8A 4A57A 3T19A 3UKRA 4DSIA 3UKUA 1MU2A 3QDKA 3C0BA 1L3UA 3IG1A 1X3MA 4IKFA 5AQHA 4N76A 2DY4A 4H4OA 3UB5A 1S6PA 4RW7A 5AFUA 3CMAN 3AVMA 3WUHA 2HVHA 4C1NI 3AVKA 2GX9A 2VG6A 3DLRA 1CZ9A 5AQZA 2P1JA 2XRIA 5LMUK 3PUFA 3HPGA 1IKWA 4H0OA 4FL9A 4CJQA 4KBOA 4M45A 4R5PA 3S9HA 2XY7A 3ZT4A 1K9MO 2E2PA 3K58A 2E2OA 1RTIA 1FK9A 4WQ4A 4NB4A 1ZXOA 4LC9B 3VQ9A 2ATQA 3M6GA 1HQUA 1S1TA 1S5JA 3TTCA 4W5TA 1VQNN 4H03B 4BRCA 3L4QA 3WT0A 4B9MA 4FPAA 4ID5A 4E1NA 2EX3A 4ZHRA 4Z0UA 1N5YA 4FJKA 4DR5K 3A0IX 1Z6RA 4CHOA 4E19A 2KZMA 2FSNA 1K6YA 1JXEA 3H46O 4Y0WA 1FW6A 5BR8K 1N36K 1S1VA 2O8EB 1JCFA 1N32K 3CPEA 5AZIB 1YJNN 5EX5A 2P5GA 5J1EA 4FLZA 3PX0A 3BZKA 3HOTA 4B9LA 1QZ6A 3SQ1A 1VK0A 2HNZA 2P9KA 4H4MA 4BC3A 1S9EA 3DXMA 4E3SA 1OH8A 3B6OA 3QBWA 1YITN 4FWPA 1LWCA 3ZX3A 5AQWA 4DR3K 3W3DA 4DHYA 4CJ7A 2XY8A 1I39A 3MCAB 3CM5A 3PV8A 4LSLA 4ISEA 3S3OA 2KQ2A 2E2QA 2QW9A 5LMNK 1NWKA 1JXBA 3CCVN 1RNHA 2YNHA 3ISNC 4JD2B 3OA9A 1IBKK 1TK0A 1HKCA 4B3TK 1RDWX 4CK3A 2VG5A 3LDLA 3OYHA 1RGIA 4B1UB 3Q7CA 4IZ9A 2RKIA 1JCEA 2P9IA 4LFBK 4G9ZA 4Q5VA 2G8WA 4E1MA 3DLKA 3QESA 3G10A 5EOYA 1ASWA 3L8BA 2HVIA 1ITGA 1A5XA 5BRFA 4W5RA 3HSTB 1MWKA 3K5OA 3TTFA 2Y1IA 2OPQA 1NMDA 2NRWA 3ZETA 5HLFA 2GBZA 2HBLA 1IBMK 2DTUA 5FLXO 3KKRA 3ITHA 4DTOA 3VOVA 5IWAK 1WBBA 4MFBA 3DI6A 4JKGB 1Q81O 2F8TA 4FJMA 1NG9A 4Z4GA 4YFUA 4B1WB 4X66K 5JS2A 3CQXA 3RR7A 4H0VB 2HHWA 3I8BA 1SQKA 2X74A 4JI2K 1NK8A 1VQ9N 3FZFA 2FF3B 4JK9A 1C1CA 4JKCA 1HPZA 1BIZA 4LFCK 4BRMA 3CERA 1U47A 3LWMA 2KZZA 4DQ8A 1W9HA 3H3NO 2YJEA 3VEZA 4CZKA 3VQ8A 4DQQA 4FM1A 1QVGM 5EVZA 1SL0A 4GV3A 1HYZA 5BPLA 1QSLA 3LALA 3AA5X 4ILJA 4AILC 3KWGA 4JKAA 1L5UA 4M3YA 3O80A 5AQGA 1NM1A 2Q1NA 1RTJA 4O44A 4KI6A 2I5JA 3AA2A 2GUPA 1YT3A 3F2KA 4JNEA 1NBWA 2ZM6K 4M42A 4E7HA 2DFEA 5GAGP 5AQJA 4GVEA 1QSSA 3V1RA 4KHPK 1S9GA 4B3MK 3MX5A 4CF8A 1BQNA 3BF1A 5TKYA 5DMRA 3NH2A 3NVMA 4CEOA 5FPNA 3JS6A 3VERA 5FPMA 2HHXA 2YHWA 4C8MA 2NNWA 4X64K 3ENBA 4AHVA 4FM2A 3RMDA 4B3OA 2P9PA 4CGIA 4X65K 3FZLA 4DTXA 3NH0A 4Z4CA 1DLOA 1TKZA 3NE6A 4I2QA 4BQLA 4FZXC 2VWBA 4KREA 4OVLA 3M3ZA 4BR4A 4FYDA 2HHQA 1BISA 3QEVA 3M8RA 4YOXA 3R8EA 3WNEA 3OYNA 4H5NA 4DV1K 3F73A 4CK2A 2JLEA 3TSPA 1J54A 3PY8A 3I33A 2Q97A 2ITMA 1YHQN 1XMOK 5FDLA 1HRHA 4B9UA 4FWLA 3VQ6A 3G0ZA 1T03A 3CCQN 3TAGA 1C0FA 4BR9A 3EO3A 2O8BB 2Y1JA 4KFBA 2QWQA 2Z1IA 4GKJK 5LJWA 3VTIA 4DQPA 1W2BM 1HKGA 4FK4A 4DV3K 5AQUA 4BE2A 3M8SA 5AFUH 4HCCA 3EZWA 4BG9A 3GDQA 2Q0UA 1U04A 4FOEA 4A2BA 1KCFA 1JLCA 1W97L 3GL1A 3WNGA 3AO3A 3O3FA 3KTQA 2GUIA 5DM7L 3NF9A 1NGDA 2QWLA 3SMPA 1GOCA 4DTMA 3QO9A 4ELTA 1XWLA 4Z4FA 4EZ6A 3EZ5A 3CC2N 1N8RO 4BE0A 1YI2N 3U9ZA 4CF9A 3HTVA 3RMCA 4M3UA 4QCLA 1WSEA 1Q9YA 2YHBA 4DV4K 3AY9A 1W0HA 1K8AO 1YVUA 4XH1A 1VSLA 1KAYA 4DSJA 4K42A 1FKPA 3RRGA 1SS6A 3C7NA 2D0PA 1NK7A 5E84A 4FLVA 1SKSA 2V7ZA 2HOEA 1XHXA 4DS4A 4JLHA 3L2UA 3RSEB 3D0PA 4CJ3A 3ENOA 4PL7A 5H1SQ 3MXMA 3DLBA 4CHZA 4H5RA 4FJXA 3NGIA 1SUQA 3O9UA 3OYAA 2NUBA 3AVAA 4PY5A 1QQMA 2YNGA 3U6FA 2P9LB 3MN9A 5GAEP 4A5BA 2QKBA 3VQ5A 4AHUA 1D8YA 1SAZA 1I3AA 2P5OA 5HP1A 4GMJB 4J2AA 1JLQA 3CC4N 4XEIA 1E4GT 4Q0BA 1O1WA 5TKWA 3VQEA 1SZ2A 1SKWA 2HNDA 5AQLA 3EYZA 3R1XA 4K43A 3ALYA 4C23A 1XNRK 2E4LA 5KI6A 2RF2A 3EE9A 4NYFA 2VG7A 4YDUC 2O8BA 1UA1A 3P5JA 4ZTJA 1GLFO 4IO8A 4JHDA 4JK7A 1RILA 3SV3A 5CYQA 4YOTA 4CCHA 3ZT2A 4J2DA 3WQTA 1BHLA 3K9JA 4K0KK 4CEDA 4BRAA 4FLYA 3THXB 2HHSA 2NRHA 3DXKA 1EP4A 2QWMA 1TUYA 4LH5A 2BDPA 3I56N 3LDNA 3PO4A 5BN9A 5CYMA 3H1QA 3D2EB 1GOBA 4H5VA 3ZX0A 1U2VA 5CZ2A 5I3UA 1NGJA 3QNNA 4FJ7A 1O13A 4KH6A 4LY7A 4CIGA 3MXJA 2YI1A 1QHAA 3CFOA 4W5OA 4OKKA 2QM1A 2GEMA 3VQPA 3SMSA 2UUBK 4N41A 4CGFA 3OS0A 3KZBA 1RDDA 2IIRA 4IJAA 3SPZA 5D3GA 4BR7A 4JI8K 2KTQA 3SCXA 3SZ2A 5A2QO 3NBPA 2DPNA 2XO7A 4EP5A 4H5TA 4CI6A 1KVCA 1TUUA 1IKXA 5C0YA 4BREA 3OYMA 3WEEB 1NJWA 4IWVA 2GV9A 3M8PA 4YOWA 3EKSA 1Z25A 4DSKA 4PL8A 4Z4IA 1WAFA 4HTUA 1GLBG 1WSJA 3O1WA 1OH7A 2D1KA 3NDKA 3P39A 4CGHA 4XH5A 2G8IA 5ELZA 3QFPA 4B1ZA 3QIPA 3FR0A 4GV9A 4FJNA 2I7NA 4NXMK 2WC9A 4DSEA 1I94K 2X78A 1KLNA 3JAMO 1BUPA 1C1AA 1H1VA 1V4SA 1HPMA 3CJCA 3TAMA 3QIOA 4RW4A 2W42A 4PUOA 3P38A 4BC2A 1WN7A 1NOZA 3DWLA 4JI1K 4BDYA 4KPYA 4Z4HA 2P9NB 4PWDA 1FJGK 2R7YA 1GLCG 4DTRA 4M3WA 4F2SA 1WSHA 4MQ3A 4B9NA 3THWA 1T3VA 5FRNA 1RT6A 5SWMA 3CPWM 2P9UA 2G8UA 3RMAA 4O5FA 5HRNA 3W0LA 1VHXA 1YF5L 1L3TA 1JLEA 3LP2A 3CD6N 2WTUA 3CCEN 4BR5A 3BP8A 1E4FT 2A1SA 3K5NA 4FWOA 3ZT3A 4H0XB 3MXIA 4EZ9A 1MDUB 4FJ5A 2PYLA 3HRGA 4DLGA 3SV4A 1QZ5A 3G4SN 1BA1A 2W6LA 3L2RA 2O4IA 3RWUA 3M5RA 1C6VA 3TAFA 1VRUA 2AJQA 2HHHK 5J2MA 3QICA 3H1VX 3KLHA 4DV7K 5KQDA 3EL2A 4O4GA 4C1NK 4FWMA 5ADXA 2ITGA 3U4LA 1QQNA 1J53A 3LP1A 3DMJA 2OCEA 1VQLN 1ZYQA 3GE1A 3O3HA 3VMFB 4DWIA 2J4RA 4IG3A 3LAKA 3AV9A 1RDCA 3ATUA 4HHTA 2WUSA 1GOAA 1VSKA 2BANA 3L3UA 1XC9A 4KHQA 1U49A 1VSDA 2YCHA 4AM7A 1SKRA 2QK9A 1KVAA 3AVIA 5K14A 1DKGD 4DR1K 4CJLA 4L8RB 3CYMA 1YIJN 3A2FA 3HM8A 4DQSA 3WXLA 2Q0RA 4DB3A 4DS5A 3DRSA 2O8FB 4ELUA 4CJ4A 3L4IA 1OH6A 3L2QA 3THYB 3CHWA 4QAGA 3IDHA 4N56A 4AQYK 3UE5A 1RBTA 4M3RA 1T44A 4CFCA 4NCGA 2O8CB 3AGKA 1J9AA 4DU3A 4X62K 4O55A 3H6EA 4BRHA 2V52B 4HUEA 1VQON 3OS1A 2F7TA 5E41A 3ZSOA 3BY5A 2CGKA 3MMVA 4CEEA 2I7PA 1LAWA 3RTVA 3SYZA 3I0SA 3V9XA 4FWRA 3O9QA 3OY9A 1B9DA 1ZBFA 4RWTA 2UXCK 3CI5A 4FW2A 1UAXA 3QERA 4BACA 3F9KA 4BC4A 3V9SA 3V6DA 3JXUA 3MEDA 3WXJA 2YNIA 4CEAA 3HSCA 5BRHA 2VQEK 1XHZA 4LSNA 2EHGA 3OBYA 4DSFA 3OHRA 3FLCO 2WONA 4IG0A 4YY3K 4NLBA 2KFNA 4A61A 4KKOA 2AA4A 3MN5A 2P9SA 1QVFM 2HF3A 3OYCA 4FVUA 5AQKA 5B8HA 2ZWHA 3JSMA 5KRSA 4E7JA 4DV2K 3WQUA 2IAJA 5GADP 3NGYA 1WUAA 4CFBA 1KAXA 1RBUA 2A3ZA 3SUNA 3D2FB 1S3XA 1EX4A 1VSEA 4DF8A 2FF6A 2PZSA 4LF9K 3BZCA 3D6RA 3DYAA 3ZEUB 3AVLA 1D5AA 3AAPA 5FPDA 4Y1DA 2FBXA 3MEGA 3E9PA 4CJWA 3FFKB 4HTLA 4OPHA 2ZF5O 3CCLN 3O1BA 4UQGA 4Z4EA 5AQTA 3AVFA 4RG8A 2A42A 4BQZA 4EHTA 1CZBA 3AAQA 4O0JA 4DF4A 3P1GA 2YHYA 3SK3A 4FXDA 4K25A 1YJ9N 5M1KA 1LW0A 3KK3A 4KB0A 1TK8A 1ATNA 1HNIA 1Z26A 3NGZA 1U6ZA 2KKZA 3LDOA 3CFRA 4NCAA 3WXIA 2X6SA 2CH6A 3C65A 4FCYA 1KSPA 4B9TA 4DSLA 3OW2M 1Q8IA 3THVA 5DM6L 3VF2A 2W6KA 3CJAA 1IBLK 4AHCA 4CF1A 2HF4A 3O9SA 3AVBA 4ILHA 3IMXA 2A6AA 3VQQA 5J2QA 4DUYK 3BUZB 4IOCL 4CZLA 4HCBA 1T7PA 1JLAA 4DQIA 4BGBA 1BO5O 3O4WA 4G1QA 1X9JA 3MN6A 1OVQA 1NK4A 3HOSA 1MWMA 4Z94A 2O8EA 1X1PA 3HJFA 1DTQA 5AZIA 2LSNA 2IVNA 4WQ5C 1ASUA 4BRNA 2YHXA 3C6UA 3HI0A 1YTAA 3AO5A 3TWHA 1FKOA 3NF8A 3LM2A 4B1XB 2FBVA 1HX1A 1XNQK 3MWTA 1TL1A 1BWFO 4KH4A 3EY1A 2HNYA 4KHYA 1C0GA 5KGWA 2FBTA 4LF4K 1RBSA 4XIUA 4IEIA 3E1YA 4FLWA 2D4WA 3PX4A 2ZGZA 4MLHA 1C0TA 3OTOK 3VEXA 2BH1A 4YHHK 4JD2A 2KFZA 4IOXA 3SAGA 4BR2A 4E7IA 2G8KA 1Y97A 3CCJN 4I6MB 4JYAK 1G15A 3P4IA 3OJSA 4CW7B 3BGRA 2PAVA 2O4GA 3T1AA 1NOYA 2YHAA 4FK0A 1RT2A 4GVMA 2YKNA 4CE9A 3R3LA 3SLCA 3ZSQA 5M1FA 1LWFA 4C8KA 1YAGA 1JJ2M 4CHNA 1DGKN 4IFEA 1NK9A 2HHTA 2VWKA 3KD5E 2IVOA 1UWBA 1RT7A 4A5AA 3KHYA 4RTFD 1U4BA 3LDPA 1JCGA 3DJCA 4B3SK 3M8QA 4JS4A 2DFFA 1OKJA 2V7YA 3PX6A 4JKGA 3J80O 3C6HA 1XQSC 5ADXH 2XY6A 1HUXA 3CIPA 2BUPA 2QWNA 4IBNA 5JLFA 3KJVA 4DG1A 1DTTA 4OJRA 2OPSA 1L3VA 1NKCA 5M1OA 2OTJN 4KHWA 4CGJA 5AQPA 3SJHA 4ZTFA 1JLFA 3K57A 3AVCA 3N4PA 1KRPA 3CJ1A 3V4IA 5C15A 2Q31A 2CH5A 3VQ4A 4FZZA 3G6EN 1NGIA 1ATRA 4KI4A 1HR0K 4BRIA 4BVOA 3ULEB 3L0QA 3ZLJA 1NLVA 1TKXA 3KK7A 4C8OA 1YVNA 4AHSA 4K8XA 3A5LC 4FJ9A 2UYTA 3VN5A 3ZSYA 4B08A 2WOMA 4CZMA 1HLUA 4LF8K 1QQOA 3RVCA 1ATSA 4DV6K 4FW1A 5GAHP 2RPIA 1G99A 3VQCA 5CZ1A 2UUCK 3NVKA 1TYQB 4CBXA 4F9OA 5C25A 4BVPA 2ZJQL 4FM0A 4BRKA 3ZSZA 1T6CA 1D4XA 3O3GA 1VQKN 3ZX2A 1S6QA 1LV5A 2FSJA 3QETA 1KVBA 1BDGA 4CD3A 1RCHA 4DTSA 1X3NA 1RT1A 1X9SA 4UY8O 5BPMA 3SAHA 1QTMA 3CJ7A 1BU6O 4M41A 3U8XA 2VGNA 2PFUA 4YORA 1HYSA 3V1QA 4MO5A 4DTPA 1BI4B 2HB5A 2NRXA 3LPUA 4IJNA 3L6QA 5EY4A 2GELA 3A5MC 1TL3A 3N4QA 2VYPA 4O5BA 3UIQA 2BTFA 4FWNA 5KTQA 1NK0A 1VQ4N 3B6PA 2E1YA 3K5LA 2UUAK 3OJUA 3NHGA 1QQCA 1WSFA 2E1ZA 5CE3A 2HHVA 1FXXA 5AQMA 4BGAA 4LF6K 2QA4N 2O8DB 4CHYA 2E8AA 4KTQA 3TR8A 3WXKA 4B8CA 3CQYA 4EP4A 4U67L 1DEJA 2D0CA 1BA0A 4LF7K 4CEZA 4R79A 4JS5A 3VGLA 4BRDA 3BDPA 1HJRA 3HYFA 4FJ8A 3AO1A 5BREA 3LANA 1VQ7N 1EQYA 5FRMA 5AQFA 3K2PA 3I8DA 4DTNA 4HWIA 2QXFA 4AM6A 1K8KB 2NZTA 1VQ6N 3ASMA 3TAQA 3TTDA 1VSMA 4OPJA 3ZT0A 1IV0A 1CXQA 1ESVA 4BDZA 3S3NA 3DM2A 3U3YA 1NJXA 2E2NA 1NJIO 1IG9A 5KPZA 3OYFA 4JKBA 3OYJA 4DTJA 5AQNA 4JI6K 3C6TA 1EWRA 1TGOA 4C8NA 4JKHA 1D9FA 1Z05A 5CHIA 1HNZK 4H0YB 5AZJB 1DT9A 2NRVA 3P83D 3MK6A 3ENHA 3SBGA 2QTDA 4DFPA 5C2DA 2OA8A 4JRQA 2JWKA 1N33K 5JLHA 5JICA 1NGGA 1Q18A 1VQMN 3SNNA 1IKVA 5LJVA 4GNIA 4DLEA 4L3QA 3J7ZO 4CERA 3S3MA 3TPQA 3IRXA 3CETA 3I0RA 3KIOA 4IEEA 1OVYA 1N6QA 1ZBIA 3LWLA 1BG3A 3UKRB 3IFRA 4IXCA 4ISGA 4JN4A 3RSEA 2G8HA 5AQRA 4LFAK 2ZE2A 4M7XA 1WNSA 2UXBK 1S22A 1JL2A 1Q7YO 5HRRA 3KK2A 4BDPA 4FWSA 4FSVA 4H5WA 4MLEA 4BRPA 4FJJA 3NFAA 4OKJA 1ZBHA 4B9SA 1NKEA 5EXWA 2P9LA 4CJTA 3CCSN 3AARA 5AQVA 2Q3SA 4A59A 4CECA 3O9TA 3OYDA 2ASOA 3HVTA 3KLIA 4NCBA 4CEQA 4KHUA 1E3MA 4WQ5A 4BG8A 4MDBA 4I9LA 4BROA 4DR4K 4MDAA 3SJJA 2HW3A 2KLAA 3SUOA 3VQAA 4NXNK 1V4TA 4PA1A 4BE1A 1QHTA 5SZTA 1IO2A 2O8DA 5C42A 2OPPA 3QEXA 4CIFA 1S1UA 3FZMA 4I7FA 2F4VK 5KQ8A 4JI0K 3WNFA 5IT9O 2H3GX 2JGUA 3LP0A 2A41A 3MEEA 5BRDA 4N5SA 1WBDA 3HL8A 1F21A 5F0XA 1LAVA 4GV6A 2E6LA 2A5XA 3TAPA 1N34K 4AHTA 3CQ8A 3JYTA 5HOOA 4YOUA 3BF3A 5BR9A 3THXA 4JV5K 1EKEA 3RR8A 2F8SA 2Q2RA 5C24A 3V9WA 3SQ2A 4GY2B 1Q86O 3M1FA 3J81O 4M3TA 1UOCA 3QEIA 1VAZA 2GTDA 2ZJRL 3HVRA 3D2EA 2NRZA 4DFMA 3QNOA 2P9KB 3DXMB 3GBTA 3WXMB 5JMVA 4BRLA 1EWQA 3VEVA 4F8RA 3SI6A 1YUWA 2HMPA 4YOYA 4FWQA 2JWLA 3VQBA 3WNHA 3K9KA 3LZIA 2BE2A 2A1RA 4JRPA 2YJFA 3DAWA 4DV5K 1BGXT 4B1VA 3GOIA 4JI3K 3PO5A 4FLTA 4PKIA 3KD1E 1NMNA 3LDSA 1X9MA 4LD0A 5HBMA 4KTZA 1RBRA 3MN7A 2YV0X 3IS9A 3VGKA 4BRFA 3HZ6A 2E20A 3LP3A 3AO4A 3DRPA 1RBVA 3KVGA 4DFKA 3WEEA 2P9IB 1VSFA 4CGGA 1KXPA 3U9DA 5M1NA 3VPZA 4WFNL 4OPKA 3K5MA 4FJHA 4I9QA 3NMUA 3ZCMA 3IKMA 2E5LK 3SPYA 2EWSA 2B5JA 3ZETB 2CGLA 1T05A 4OO1J 3Q7BA 4FVMA 3LZJA 3ZT1A 3HT3A 4CJFA 5E26A 3TU5A 2P9NA 3H08A 4F3TA 4HUGA 4AF1A 4FO0A 4EIAA 4C8LA 3AVGA 4O0IA 1JL1A 1JKHA 4FJGA 3VTHA 4IDKA 1VRTA 1IJJA 4CIEA 1U45A 1NJZA 3J8AA 1CZAN 3RRHA 5C10A 1QSYA 4IO9L 3A5NC 4BY9C 3KKSA 3A5OC 3ZSRA 3EKUA 5M1QA 3FGUA 3E66A 3PLAA 1YXQA 4YNQA 4IOAL 4CBWA 1NGAA 1RDUA 3GG4A 4O8KA 2ZJPL 3PIOL 4YOVA 3IUCA 3CJ9A 3DOLA 1B92A 3OVNA 4CEFA 3NH1A 1VSIA 1KFDA 4AHRA 3PIPL 4I2PA 5BPNA 5F1XA 3L2VA 4LH4A 3OYBA 3O8MA 4CZJA 4ILGB 3SQ4A 2P51A 3T69A 4A2AA 1KC8O 4JK8A 3HK2A 1VQ8N 2E6MA 1OH5A 1RTDA 4V19S 1EO1A 3V9ZA 2QKKA 3CM6A 4YDUA 4JKEA 4CZEA 4NYNA 3T1YK 3CJBA 4ICLA 5EU7A 3VETA 1IH7A 2GWJA 2OYQA 2P9PB 5LY3A 2IDOA 3PSIA 2IVPA 3VF6A 4KAZA 2E88A 3VGMA 2FBYA 4J2EA 1LCUA 4DQRA 1SL1A 2UU9K 3VA3A 1QS4A 4CGDA 2VWJA 3QEWA 4JI5K 4CJRA 1K73O 4NLCA 3G71N 1HYVA 1QE1A 3MECA 1TAQA 2XY5A 1XI1A 1RFQA 2O8FA 4WE1A 4CESA 1BCMA 1UA0A 1P90A 1NGHA 4OPAA 4KH5A 4ID1A 3THYA 4ISFA 2ASPA 1L3SA 4A62A 5T7BA 2RHKA 1HNXK 2ZQBA 5KRTA 4E0DA 2O8CA 3OBWA 1B9FA 4F2RA 5JS1A 4H0PA 3K0SA 2WBNA 4PKGA 1A5VA 2YNFA 3L3VA 2Q36A 3OYKA 4NO7A 2Z1HA 4BR0A 3AA3A 3O08A 4BC5A 3TARA 4CJ5A 4KHSA 4DKWA 3PSFA 5LL6Z 3DOKA 3KK1A 3SUPA 1NK6A 4B3RK 1TKTA 1NJYA 3O5BA 4J8FA 5F2RA 3CG7A 3QB0A 1GLLO 4MO4A 3E01A 3NCIA 2ASMA 3R6MA 1S72N 4DU1A 5AQQA 4M3ZA 4CJKA 1MA9B 1YTUA 2ETJA 4EFHA 5M1PA 3AVHA 3FZKA 4FPBA 2OTLN 4JI7K 3CCUN 1CLQA 1M1KO 1NGBA 1HNVA 4KV8A 1D9DA 3KLEA 4KRFA 1T8EA 5HL7L 1VSJA 1HMVA 4CJUA 2GWKA 3MDQA 3R9PA 4CHPA 5KPTA 1C1BA 3C6AA 5MLCQ 3OYEA 3C7NB 3D2FA 2Z1GA 3VEOA 2OZMA 3MX2A 4PHTX 1RDAA 4WFBL 3T1HK 2QI2A 3QFUA 2FSKA 1GLJO 3KWIA 3CC7N 3ZEUA 4CZHA 4IFVA 3DLLL 2G8VA 3MWPA 3H3OB 4B1YB 2OANA 3VEYA 4JEPA 3SBTA 2WFBA 1Y64A 4BWJA 4LF5K 2OZSA 4M63C 2BGGA 3QEPA 2CGJA 2UXDK 3HPHA 1NK5A 1RTHA 2A40A 1WAJA 3TANA 4M3XA 3G25A 4DTUA 1R59O 4CJVA 2QWOA 4PKHA 1BQMA 2F9TA 4O8UA 1ZBLA 2KHOA 4F4KA 4EAHD 2IGIA 4FJIA 4E1JA 3FE1A 3RMBA 2HHUA 1NGCA 4HVJA 4KTWA 3V1OA 1KAZA 4TSXA 3VQDA 3ZSWA 1BIUA 1KLMA 2DFHA 1NKBA 2FLOA 4FLUA 1M90O 3O6WA 4JHDB 4B9VA 4JKDA 1S1WA 3MCPA 5GIPA 3AO2A 1RT3A 4RW6A 4QS7A 5BN8A 3QBXA 3OS2A 3ZSVA 3O4NA 4CZIA 2RE2A 2RN2A 3DXKB 4CK1A 4CZGA 4AH9A 1SL2A 4CF2A 3ULDA 3KLGA 3VF4A 3TABA 5AQSA 5AQOA 2AP1A 5I9EB 4WQ4C 4DCHA 4FWKA 1U2VB 4PQUA 1VQ5N 5JVHL 2W41A 1TVRA 2NLXA 2ZD1A 5HRPA 5CY4A 4JI4K 1ZBUA 4CJPA 4OX9K 2D5RA 3C94A 2V51B 4W5NA 4QS9A 1IG8A 3EN9A 3QLHA 3AVNA 3O4QA 1WLJA 5KGXA 3TI0A 1RT4A 4OGEA 3VEWA 3SQ0A 3ZSXA 5J2PA 3VESA 4I6MA 3NF7A 1BOTO 3CXCM 3FZHA 5AQXA 3AGRA 3C95A 1TKDA 3D45A 4JAXA 2HBJA 2ZGYA 4K8ZA 5AQIA 3CCMN 5CR4A 5GIOA 1C0UA 3QMLA 3LDQA 3HP6A 1Q9XA 3EEQA 4E89A 3VQ7A 2FXUA 4RW9A 5I42A 2HMIA 2XHBA 4EHUA 4F3OA 2QXLA 3HM9A 1KFSA 4XH4A 3TAEA 2D0BA 4DMNA 3AA4A 1XMQK 5DK5A 1GLEG 5C12A 3HBTA 1NNEA 1WSGA 4CZFA 4DR6K 4CEBA 1NGEA 1LOTB 1TK5A 1J5OA 3THWB 2W40A 4N47A 3J7AP 1ZBSA 2HBKA 2P9UB 3T7ZA 3HPOA 4HUFA 4FLXA 4GKKK 4WF9L 5FROA 3I55N 1IKYA 2D0AA 3A8YA 4B8AB 2IC3A 2F96A 3OYGA 4FZYA 3ID6A 3ULEA 4DV0K 1LWEA 3LM9A 4DR7K 3SAFA 4DUZK 4GW6A 4DR2K 1J6ZA 5AJ3K 4DFJA 1JLGA 1GLAG 3TSUA 1LW2A 3LL3A 5C2FA 4U7BA 4J2BA 1BCOA 2NRTA 4QS8A 4B9QA 5FPEA 4CFAA 1RT5A 4WYBA 5JVGL 3QINA 4K41A 4IDHA 4H0TB 1TYQA 3K59A 1W7AA 1S1XA 1WB9A 3MAQA 3DLHA 1EETA 1A5WA 2G8FA 2HBMA 3O9RA 3UKUB 4CFDA 3E9LA 5AR0A 4FK2A 2QWPA 3HO1A 1C0MA 1TV6A 2YX6A 1X9WA 2VQFK 1ASVA 2NRRA 2X6NA 1P8ZA 3OYIA 3CFPA 3U3GA 1WOQA 2HSTA 3BEXA 4CJEA 2Z1JA 2QEXN 1HQEA 2OPRA 4ELVA 1BI4A 1VQPN 1J5EK 4CBUA 4CJSA 3HP9A 1KD1O 1T6DA 4CD1A 1KQSM 1RDBA 3V81A 1WSIA 3ZYYX 1YJWN 4QOZB 1XC3A 1KTQA
chains in the Genus database with same CATH topology
3RSEB 3ID8A 1IJJA 3S41A 1XUPO 3J8AA 1CZAN 3CF5L 4WFAL 3EE8A 3ENOA 5C10A 4PL7A 5H1SQ 4KH4A 1BWFO 4IO9L 5AQYA 1C0GA 3A5NC 4H5RA 4WCEL 4BY9C 3A5OC 5KPRA 3EKUA 3O9UA 3P31A 5M1QA 4IEIA 4BRGA 3E1YA 3FGUA 1QQMA 3E66A 1M1KO 3PLAA 2D4WA 3CCRN 2ZGZA 1YXQA 2P9LB 4MLHA 3MN9A 1HJOA 3VEXA 5GAEP 4IOAL 3F9MA 4CBWA 2BH1A 1NGAA 4A5BA 1RDUA 3GG4A 4O8KA 4JD2A 2ZJPL 3PIOL 1NGFA 4YOVA 3IUCA 4IOXA 3SAGA 3CJ9A 4BR2A 1K8KA 1SAZA 3CMEN 3CCJN 4I6MB 1ZC6A 3H45C 3PIPL 3P4IA 3CC4N 4XEIA 5GINA 1E4GT 1HKBA 2D0OA 2PAVA 5BPNA 5F1XA 5TKWA 3O8MA 1SZ2A 4CZJA 4ILGB 1ILYA 5AQLA 3R1XA 3T69A 4A2AA 1KC8O 4K43A 4JK8A 4C23A 1VQ8N 1GLDG 3B8AX 3R3LA 3SLCA 1EO1A 1Q82O 3EE9A 3TSQA 5M1FA 3ATVA 4M7YA 4YDUC 4JKFA 1YAGA 4YDUA 1JJ2M 1DGKN 4IFEA 4JKEA 4CZEA 1GLFO 4IO8A 4JHDA 3CJBA 5AZJA 4JK7A 3VETA 2GWJA 2VGMA 4YOTA 2IVOA 4A5AA 3WQTA 2P9PB 3K9JA 3KHYA 4RTFD 2VCPA 3LDPA 4BRAA 2P9SB 1JCGA 5LY3A 2NRHA 3DJCA 2IVPA 3VF6A 4BRQA 2E88A 1OKJA 3DXKA 4FOIA 1LCUA 3VGMA 3VENA 2QWMA 2V7YA 3F5TA 4JKGA 1TUYA 4RCHA 3C6HA 1XQSC 2PBDA 5ADXH 3I56N 3LDNA 1HUXA 3CIPA 2BUPA 2QWNA 5JLFA 5BN9A 2F9WA 3D7EO 3E9OA 3H1QA 2QWRA 4A57A 1K73O 5M1OA 2OTJN 3D2EB 4NLCA 4H5VA 3UKRA 3UKUA 3ZX0A 3G71N 1U2VA 3QDKA 3C0BA 1NGJA 5AQPA 3SJHA 3N4PA 1X3MA 1RFQA 1O13A 4KH6A 3CJ1A 5AQHA 5C15A 2Q31A 1P90A 3UB5A 2CH5A 1QHAA 2YI1A 1NGHA 3G6EN 4OPAA 4KH5A 2QM1A 1NGIA 4ISFA 1ATRA 2GEMA 5AFUA 3SMSA 3CMAN 2ASPA 3WUHA 3KZBA 4C1NI 4A62A 2RHKA 4BRIA 4BVOA 3ULEB 3L0QA 2GX9A 2IIRA 4IJAA 1NLVA 3KK7A 4BR7A 5AQZA 3OBWA 1YVNA 4H0OA 4FL9A 4KBOA 4H0PA 3A5LC 2UYTA 2WBNA 2DPNA 4PKGA 4CZMA 1K9MO 1HLUA 2Q36A 2E2PA 4NO7A 4BR0A 2E2OA 1QQOA 3O08A 1ATSA 4H5TA 3RVCA 4CI6A 4WQ4A 4NB4A 5GAHP 1TUUA 1ZXOA 5C0YA 1G99A 4BC5A 4BREA 4LC9B 4DKWA 3NVKA 3WEEB 1TYQB 3M6GA 3TTCA 4CBXA 4F9OA 1VQNN 4IWVA 4H03B 4BVPA 4YOWA 3EKSA 2ZJQL 4BRCA 3L4QA 3WT0A 4PL8A 1GLBG 4FPAA 4BRKA 3O1WA 1T6CA 2D1KA 3O5BA 3P39A 4J8FA 4XH5A 5F2RA 5ELZA 1D4XA 3QB0A 3QFPA 1VQKN 3ZX2A 4B1ZA 1GLLO 2FSJA 4MO4A 4GV9A 3FR0A 3A0IX 2ASMA 3R6MA 2I7NA 1Z6RA 2WC9A 1S72N 1BDGA 5AQQA 4CD3A 1BUPA 1X3NA 1H1VA 1MA9B 1V4SA 1HPMA 3CJCA 2FSNA 5M1PA 4EFHA 4UY8O 5BPMA 3H46O 4Y0WA 3FZKA 4FPBA 3SAHA 2OTLN 3CCUN 3P38A 1JCFA 1BU6O 3CJ7A 3U8XA 2VGNA 1NGBA 2PFUA 3CPEA 4YORA 5AZIB 4BC2A 1YJNN 5EX5A 4MO5A 3DWLA 5HL7L 2NRXA 4IJNA 3L6QA 2P9NB 5EY4A 2GWKA 2GELA 3HOTA 1QZ6A 1GLCG 3MDQA 3R9PA 5KPTA 3A5MC 3C6AA 5MLCQ 3C7NB 3N4QA 2VYPA 3D2FA 3VEOA 2BTFA 1T3VA 4FWNA 3MX2A 1VQ4N 2P9KA 4PHTX 2E1YA 4WFBL 3CPWM 2P9UA 4BC3A 3DXMA 2QI2A 3QFUA 2FSKA 5CE3A 2E1ZA 1GLJO 3QBWA 4O5FA 5AQMA 4FWPA 3ZX3A 4BGAA 1YITN 5AQWA 2QA4N 3W0LA 3KWIA 3CC7N 3W3DA 1YF5L 2E8AA 4CJ7A 4DHYA 3ZEUA 4CZHA 3WXKA 3MCAB 3CD6N 3DLLL 3CCEN 4BR5A 3MWPA 3CQYA 3BP8A 4U67L 1DEJA 3H3OB 1BA0A 4ISEA 4B1YB 1E4FT 2E2QA 4R79A 2QW9A 2OANA 1NWKA 3VGLA 4BRDA 4FWOA 3CCVN 3VEYA 4H0XB 1MDUB 4JEPA 3SBTA 2WFBA 1Y64A 3HRGA 4JD2B 5BREA 1EQYA 3OA9A 1VQ7N 1QZ5A 3G4SN 1HKCA 5AQFA 1RDWX 4HWIA 1BA1A 4AM6A 1K8KB 4M63C 2NZTA 1VQ6N 2CGJA 3LDLA 3TTDA 3M5RA 2A40A 1RGIA 1ESVA 1XC3A 4B1UB 3G25A 3Q7CA 1R59O 4IZ9A 2E2NA 2QWOA 4PKHA 1JCEA 2P9IA 3QICA 2F9TA 4O8UA 2KHOA 3H1VX 1NJIO 4G9ZA 4EAHD 5KPZA 4JKBA 4E1JA 3FE1A 1NGCA 5EOYA 3EL2A 5KQDA 5AQNA 1KAZA 4JKHA 4C1NK 4FWMA 5BRFA 5ADXA 1MWKA 3U4LA 3TTFA 1Z05A 5CHIA 1QQNA 2FLOA 1M90O 1NMDA 2NRWA 4H0YB 3O6WA 4JHDB 1VQLN 4JKDA 5AZJB 1DT9A 2NRVA 3GE1A 3ZETA 3MCPA 5GIPA 2HBLA 3VMFB 3MK6A 4QS7A 3ENHA 3SBGA 2J4RA 5BN8A 2QTDA 3QBXA 5C2DA 3VOVA 4CZIA 2RE2A 2JWKA 3DXKB 5JLHA 4CZGA 5JICA 1NGGA 1Q18A 1VQMN 3ATUA 4JKGB 1Q81O 5LJVA 4GNIA 2WUSA 5I9EB 4B1WB 4L3QA 3CQXA 3J7ZO 3VF4A 2YCHA 4H0VB 3CETA 3TPQA 4AM7A 3I8BA 5AQSA 1SQKA 5AQOA 1VQ9N 2AP1A 3FZFA 2FF3B 1DKGD 1OVYA 4IEEA 4JK9A 4JKCA 4WQ4C 1BG3A 3UKRB 4DCHA 1YIJN 3IFRA 4FWKA 1U2VB 3HM8A 4IXCA 4ISGA 4JN4A 2Q0RA 3RSEA 3WXLA 4BRMA 4DB3A 1VQ5N 3CERA 5JVHL 5AQRA 4DQ8A 2W41A 3H3NO 2YJEA 4M7XA 3VEZA 1S22A 4CZKA 1Q7YO 3L4IA 2NLXA 4FWSA 3CHWA 4FSVA 4H5WA 4MLEA 4BRPA 1QVGM 2V51B 5EVZA 3IDHA 4GV3A 5BPLA 4QS9A 3UE5A 5EXWA 2P9LA 2V7ZA 1IG8A 1T44A 3CCSN 3AARA 5AQVA 3EN9A 4ILJA 3AGKA 4A59A 3KWGA 3O9TA 4JKAA 2ASOA 3H6EA 4BRHA 3O80A 2V52B 4WQ5A 5AQGA 1NM1A 4BG8A 2Q1NA 1VQON 4MDBA 2F7TA 3VEWA 4BROA 2GUPA 4MDAA 3F2KA 2CGKA 3MMVA 2I7PA 3VESA 4I6MA 4JNEA 1NBWA 2KLAA 1BOTO 4FWRA 3O9QA 3CXCM 1V4TA 5GAGP 4RWTA 5AQJA 3CI5A 4GVEA 3FZHA 4BC4A 5AQXA 3AGRA 3JXUA 4JAXA 3WXJA 2HBJA 2ZGYA 3FZMA 3HSCA 3MX5A 5BRHA 3BF1A 5AQIA 5TKYA 5KQ8A 5CR4A 5GIOA 3CCMN 2H3GX 3NVMA 3QMLA 5FPNA 3OBYA 3JS6A 3LDQA 3OHRA 2A41A 3FLCO 3VERA 5FPMA 2FXUA 5BRDA 2YHWA 4NLBA 4EHUA 5F0XA 4GV6A 2QXLA 2A5XA 2NNWA 4A61A 4XH4A 2AA4A 3ENBA 5HOOA 3MN5A 2P9PA 4YOUA 3BF3A 2P9SA 3FZLA 5BR9A 2HF3A 1QVFM 4FVUA 1GLEG 5C12A 3HBTA 5AQKA 4BQLA 5B8HA 2Q2RA 2ZWHA 2VWBA 4CZFA 4GY2B 3M3ZA 4BR4A 1Q86O 3M1FA 3WQUA 5GADP 1NGEA 1WUAA 4YOXA 3R8EA 1KAXA 1LOTB 1VAZA 2GTDA 4H5NA 2A3ZA 2ZJRL 3D2EA 3D2FB 1S3XA 2NRZA 2W40A 1ZBSA 3TSPA 2P9KB 2HBKA 2P9UB 3DXMB 3GBTA 3T7ZA 3WXMB 5JMVA 2FF6A 4BRLA 3I33A 2Q97A 2ITMA 1YHQN 3VEVA 3D6RA 4WF9L 1YUWA 3I55N 4FWLA 3ZEUB 2HMPA 4YOYA 3A8YA 3AAPA 2JWLA 4FWQA 5FPDA 3K9KA 3E9PA 3CCQN 3FFKB 4HTLA 4OPHA 2ZF5O 3ID6A 3CCLN 3ULEA 3O1BA 3LM9A 1C0FA 4BR9A 3EO3A 2YJFA 3DAWA 3SAFA 5AQTA 4B1VA 3GOIA 2QWQA 1J6ZA 2A42A 4PKIA 4BQZA 4EHTA 5LJWA 1GLAG 3VTIA 3AAQA 1W2BM 1HKGA 3TSUA 2YHYA 3LL3A 3MN7A 5C2FA 3SK3A 4U7BA 4K25A 1YJ9N 2NRTA 4QS8A 4B9QA 5FPEA 5AQUA 3VGKA 5M1KA 4BRFA 3HZ6A 2E20A 4WYBA 5AFUH 5JVGL 1ATNA 3EZWA 4BG9A 4K41A 1U6ZA 3GDQA 2Q0UA 3KVGA 4IDHA 4H0TB 3WEEA 1TYQA 2P9IB 2KKZA 3LDOA 3WXIA 4FOEA 2CH6A 3C65A 1KXPA 3U9DA 4A2BA 3OW2M 1W97L 5DM6L 3GL1A 5M1NA 2HBMA 3O9RA 3VF2A 3UKUB 3VPZA 3E9LA 3CJAA 4WFNL 2HF4A 3O9SA 5AR0A 2QWPA 5DM7L 4ILHA 3IMXA 1NGDA 3NMUA 2QWLA 2A6AA 3SMPA 4IOCL 3BUZB 3IKMA 2YX6A 4CZLA 2EWSA 3ZETB 4BGBA 2NRRA 3CC2N 1N8RO 1BO5O 3O4WA 3U9ZA 1YI2N 1P8ZA 1X9JA 3MN6A 3HTVA 1WOQA 2CGLA 3HOSA 4OO1J 1MWMA 3Q7BA 2HSTA 3BEXA 4Z94A 2QEXN 5AZIA 3AY9A 2IVNA 1VQPN 4CBUA 4WQ5C 5E26A 3TU5A 1K8AO 2P9NA 1KD1O 1T6DA 4BRNA 2YHXA 4AF1A 4XH1A 3HI0A 4FO0A 1KAYA 4EIAA 4K42A 4CD1A 1KQSM 3LM2A 4B1XB 1SS6A 3C7NA 2D0PA 1HX1A 3VTHA 3ZYYX 5E84A 1YJWN 2HOEA 3MWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RSE B;  3ID8 A;  1IJJ A;  3S41 A;  1XUP O;  3J8A A;  1CZA N;  3ENO A;  4PL7 A;  1BWF O;  5AQY A;  1C0G A;  3A5N C;  4H5R A;  3A5O C;  5KPR A;  3EKU A;  4BRG A;  3FGU A;  1QQM A;  2D4W A;  2ZGZ A;  1YXQ A;  2P9L B;  4MLH A;  3MN9 A;  1HJO A;  3VEX A;  3F9M A;  4CBW A;  1NGA A;  3GG4 A;  4O8K A;  4JD2 A;  1NGF A;  3IUC A;  3CJ9 A;  4BR2 A;  1K8K A;  1SAZ A;  4I6M B;  1ZC6 A;  3H45 C;  3P4I A;  4XEI A;  1E4G T;  1HKB A;  2D0O A;  2PAV A;  5BPN A;  5F1X A;  3O8M A;  1SZ2 A;  4CZJ A;  5AQL A;  4A2A A;  4K43 A;  4C23 A;  1GLD G;  3B8A X;  3SLC A;  3ATV A;  4M7Y A;  4YDU C;  4YDU A;  1YAG A;  1DGK N;  4CZE A;  1GLF O;  4IO8 A;  4JHD A;  3CJB A;  5AZJ A;  3VET A;  2GWJ A;  2IVO A;  3WQT A;  2P9P B;  3KHY A;  4RTF D;  2VCP A;  3LDP A;  4BRA A;  2P9S B;  1JCG A;  5LY3 A;  2NRH A;  3DJC A;  2IVP A;  3VF6 A;  4BRQ A;  2E88 A;  1OKJ A;  3DXK A;  4FOI A;  1LCU A;  3VGM A;  3VEN A;  2QWM A;  2V7Y A;  1TUY A;  4RCH A;  1XQS C;  2PBD A;  5ADX H;  3LDN A;  1HUX A;  3CIP A;  2BUP A;  2QWN A;  5JLF A;  5BN9 A;  2F9W A;  3D7E O;  3H1Q A;  2QWR A;  3D2E B;  4H5V A;  3UKR A;  3UKU A;  3ZX0 A;  1U2V A;  3QDK A;  3C0B A;  1NGJ A;  5AQP A;  3SJH A;  1X3M A;  1RFQ A;  3CJ1 A;  5AQH A;  2Q31 A;  3UB5 A;  2CH5 A;  1QHA A;  2YI1 A;  1NGH A;  2QM1 A;  1NGI A;  4ISF A;  1ATR A;  2GEM A;  5AFU A;  3SMS A;  2ASP A;  3WUH A;  3KZB A;  4A62 A;  4BRI A;  4BVO A;  3ULE B;  3L0Q A;  2IIR A;  4IJA A;  1NLV A;  4BR7 A;  5AQZ A;  1YVN A;  4H0O A;  4FL9 A;  4KBO A;  4H0P A;  3A5L C;  2UYT A;  2DPN A;  4PKG A;  4CZM A;  1HLU A;  2Q36 A;  2E2P A;  4NO7 A;  4BR0 A;  2E2O A;  1QQO A;  3O08 A;  1ATS A;  4H5T A;  4CI6 A;  4WQ4 A;  4NB4 A;  1TUU A;  1ZXO A;  1G99 A;  4BC5 A;  4BRE A;  4LC9 B;  3WEE B;  1TYQ B;  3M6G A;  4CBX A;  4F9O A;  4IWV A;  4H03 B;  4BVP A;  3EKS A;  4BRC A;  3WT0 A;  4PL8 A;  1GLB G;  4FPA A;  4BRK A;  3O1W A;  1T6C A;  2D1K A;  3O5B A;  4J8F A;  4XH5 A;  5F2R A;  5ELZ A;  1D4X A;  3QB0 A;  3QFP A;  3ZX2 A;  4B1Z A;  1GLL O;  2FSJ A;  4MO4 A;  3FR0 A;  3A0I X;  2ASM A;  3R6M A;  2I7N A;  1Z6R A;  1BDG A;  5AQQ A;  4CD3 A;  1BUP A;  1X3N A;  1H1V A;  1MA9 B;  1V4S A;  1HPM A;  3CJC A;  2FSN A;  4EFH A;  5BPM A;  3H46 O;  4Y0W A;  3FZK A;  4FPB A;  1JCF A;  1BU6 O;  3CJ7 A;  3U8X A;  4BC2 A;  1NGB A;  5AZI B;  5EX5 A;  4MO5 A;  3DWL A;  4IJN A;  3L6Q A;  2P9N B;  5EY4 A;  2GWK A;  2GEL A;  1QZ6 A;  1GLC G;  3MDQ A;  3R9P A;  5KPT A;  3A5M C;  3C7N B;  2VYP A;  3D2F A;  3VEO A;  2BTF A;  4FWN A;  2P9K A;  2E1Y A;  2P9U A;  4BC3 A;  3DXM A;  3QFU A;  2FSK A;  5CE3 A;  2E1Z A;  1GLJ O;  3QBW A;  4O5F A;  5AQM A;  4FWP A;  3ZX3 A;  4BGA A;  5AQW A;  3W0L A;  3W3D A;  4DHY A;  2E8A A;  4CJ7 A;  3ZEU A;  4CZH A;  3WXK A;  4BR5 A;  3CQY A;  3BP8 A;  1DEJ A;  3H3O B;  1BA0 A;  4ISE A;  4B1Y B;  1E4F T;  2E2Q A;  2QW9 A;  2OAN A;  1NWK A;  3VGL A;  4BRD A;  4FWO A;  3VEY A;  4H0X B;  1MDU B;  1Y64 A;  4JD2 B;  5BRE A;  1EQY A;  1QZ5 A;  1HKC A;  5AQF A;  1RDW X;  4HWI A;  1BA1 A;  4AM6 A;  1K8K B;  4M63 C;  2NZT A;  2CGJ A;  3LDL A;  2A40 A;  1RGI A;  1ESV A;  1XC3 A;  4B1U B;  3G25 A;  1R59 O;  4IZ9 A;  2E2N A;  2QWO A;  4PKH A;  1JCE A;  2P9I A;  3QIC A;  2F9T A;  2KHO A;  3H1V X;  4EAH D;  5KPZ A;  4E1J A;  3FE1 A;  1NGC A;  5EOY A;  3EL2 A;  5KQD A;  5AQN A;  1KAZ A;  4FWM A;  5BRF A;  5ADX A;  1MWK A;  3U4L A;  1Z05 A;  1QQN A;  2FLO A;  1NMD A;  4H0Y B;  3O6W A;  4JHD B;  5AZJ B;  3GE1 A;  3ZET A;  3MCP A;  3MK6 A;  4QS7 A;  3ENH A;  2J4R A;  5BN8 A;  3QBX A;  3VOV A;  4CZI A;  3DXK B;  5JLH A;  4CZG A;  5JIC A;  1NGG A;  1Q18 A;  3ATU A;  5LJV A;  4GNI A;  2WUS A;  4B1W B;  4L3Q A;  3CQX A;  3VF4 A;  2YCH A;  4H0V B;  3CET A;  3TPQ A;  4AM7 A;  3I8B A;  5AQS A;  1SQK A;  5AQO A;  2AP1 A;  3FZF A;  2FF3 B;  1DKG D;  5I9E B;  4WQ4 C;  4DCH A;  1BG3 A;  3UKR B;  3IFR A;  4FWK A;  1U2V B;  3HM8 A;  4IXC A;  4ISG A;  4JN4 A;  2Q0R A;  3RSE A;  3WXL A;  4BRM A;  4DB3 A;  3CER A;  5AQR A;  4DQ8 A;  2W41 A;  3H3N O;  2YJE A;  4M7X A;  3VEZ A;  1S22 A;  4CZK A;  3L4I A;  2NLX A;  4FWS A;  3CHW A;  4FSV A;  4H5W A;  4MLE A;  4BRP A;  2V51 B;  5EVZ A;  3IDH A;  5BPL A;  4QS9 A;  3UE5 A;  5EXW A;  2P9L A;  2V7Z A;  1IG8 A;  1T44 A;  3AAR A;  5AQV A;  3EN9 A;  2ASO A;  3H6E A;  4BRH A;  3O80 A;  2V52 B;  4WQ5 A;  5AQG A;  1NM1 A;  4BG8 A;  2Q1N A;  3VEW A;  4BRO A;  2GUP A;  2CGK A;  3MMV A;  2I7P A;  3VES A;  4I6M A;  4JNE A;  1NBW A;  1BOT O;  4FWR A;  1V4T A;  4RWT A;  5AQJ A;  3CI5 A;  3FZH A;  4BC4 A;  5AQX A;  3JXU A;  4JAX A;  3WXJ A;  2ZGY A;  3FZM A;  3HSC A;  5BRH A;  3BF1 A;  5AQI A;  5TKY A;  5KQ8 A;  2H3G X;  3QML A;  5FPN A;  3JS6 A;  3LDQ A;  3OHR A;  2A41 A;  3FLC O;  3VER A;  5FPM A;  2FXU A;  5BRD A;  2YHW A;  4EHU A;  5F0X A;  2QXL A;  2A5X A;  4A61 A;  4XH4 A;  2AA4 A;  3MN5 A;  2P9P A;  3FZL A;  3BF3 A;  2P9S A;  5BR9 A;  2HF3 A;  1GLE G;  3HBT A;  5AQK A;  4BQL A;  5B8H A;  2Q2R A;  2ZWH A;  2VWB A;  4CZF A;  4GY2 B;  3M3Z A;  4BR4 A;  3M1F A;  3WQU A;  1NGE A;  1WUA A;  3R8E A;  1KAX A;  1LOT B;  2GTD A;  4H5N A;  2A3Z A;  3D2E A;  3D2F B;  1S3X A;  2W40 A;  1ZBS A;  2P9K B;  2P9U B;  3DXM B;  3GBT A;  5JMV A;  2FF6 A;  4BRL A;  3I33 A;  2Q97 A;  2ITM A;  3VEV A;  1YUW A;  4FWL A;  3ZEU B;  2HMP A;  3A8Y A;  3AAP A;  4FWQ A;  5FPD A;  3FFK B;  4HTL A;  2ZF5 O;  3ULE A;  3O1B A;  3LM9 A;  1C0F A;  4BR9 A;  3EO3 A;  2YJF A;  3DAW A;  5AQT A;  4B1V A;  3GOI A;  2QWQ A;  1J6Z A;  2A42 A;  4PKI A;  4BQZ A;  4EHT A;  5LJW A;  1GLA G;  3AAQ A;  1HKG A;  2YHY A;  3LL3 A;  3MN7 A;  3SK3 A;  4K25 A;  4QS8 A;  4B9Q A;  5FPE A;  5AQU A;  3VGK A;  4BRF A;  3HZ6 A;  2E20 A;  4WYB A;  5AFU H;  1ATN A;  3EZW A;  4BG9 A;  4K41 A;  1U6Z A;  3GDQ A;  2Q0U A;  3KVG A;  4H0T B;  3WEE A;  1TYQ A;  2P9I B;  3LDO A;  3WXI A;  4FOE A;  2CH6 A;  1KXP A;  3U9D A;  4A2B A;  3GL1 A;  3VF2 A;  3UKU B;  3VPZ A;  3CJA A;  2HF4 A;  5AR0 A;  2QWP A;  3IMX A;  1NGD A;  2QWL A;  2A6A A;  3SMP A;  3BUZ B;  4CZL A;  2EWS A;  3ZET B;  4BGB A;  1BO5 O;  3O4W A;  3U9Z A;  1P8Z A;  1X9J A;  3MN6 A;  3HTV A;  1WOQ A;  2CGL A;  1MWM A;  3BEX A;  4Z94 A;  5AZI A;  3AY9 A;  2IVN A;  4CBU A;  4WQ5 C;  5E26 A;  3TU5 A;  2P9N A;  1T6D A;  4BRN A;  2YHX A;  4XH1 A;  3HI0 A;  4FO0 A;  1KAY A;  4EIA A;  4K42 A;  4CD1 A;  3LM2 A;  4B1X B;  3C7N A;  2D0P A;  1HX1 A;  5E84 A;  2HOE A; 
#chains in the Genus database with same CATH topology
 3ID8 A;  3S41 A;  1XUP O;  3DLG A;  3CF5 L;  5HRS A;  4WFA L;  4BWM A;  3EE8 A;  4IFY A;  4OKE A;  3V9U A;  1U48 A;  5AQY A;  4WCE L;  5KPR A;  3HXM A;  3P31 A;  4BRG A;  1HNW K;  4W5Q A;  3CCR N;  2B6A A;  2YKM A;  4FJL A;  1VSH A;  1HJO A;  3FFI A;  4KHN A;  3F9M A;  1EXQ A;  3NAE A;  3KLF A;  1NGF A;  2PYJ A;  2FC0 A;  1BL3 A;  3NF6 A;  4E7L A;  3CME N;  1K8K A;  3SUQ A;  1ZC6 A;  3H45 C;  3IAY A;  1TAU A;  4Y1C A;  5GIN A;  1HKB A;  2D0O A;  1R0A A;  3OYL A;  1ILY A;  3LPT A;  4CVN E;  5HRO A;  1CXU A;  2KW4 A;  1GLD G;  3T3F A;  3B8A X;  1Q82 O;  3VA0 A;  4E7K A;  2IOC A;  3TSQ A;  3ATV A;  3J7Y P;  4M7Y A;  4JKF A;  4KO0 A;  2PY5 A;  3LAM A;  4OLB A;  3DRR A;  5AZJ A;  2VGM A;  3DLE A;  1SV5 A;  3AVJ A;  2VCP A;  2P9S B;  4DU4 A;  4BRQ A;  4H8K A;  4FOI A;  1JLB A;  3VEN A;  4CHQ A;  3F5T A;  4KB1 A;  4RCH A;  2IS3 A;  2PBD A;  4CF0 A;  2B4J A;  1REV A;  3L2W A;  4OLA A;  4OGC A;  5J2N A;  2F9W A;  1NU0 A;  3D7E O;  3E9O A;  2QWR A;  4RW8 A;  4A57 A;  3T19 A;  3UKR A;  4DSI A;  3UKU A;  1MU2 A;  3QDK A;  3C0B A;  1L3U A;  3IG1 A;  1X3M A;  4IKF A;  5AQH A;  4N76 A;  2DY4 A;  4H4O A;  3UB5 A;  1S6P A;  4RW7 A;  5AFU A;  3CMA N;  3AVM A;  3WUH A;  2HVH A;  4C1N I;  3AVK A;  2GX9 A;  2VG6 A;  3DLR A;  1CZ9 A;  5AQZ A;  2P1J A;  2XRI A;  5LMU K;  3PUF A;  3HPG A;  1IKW A;  4H0O A;  4FL9 A;  4CJQ A;  4KBO A;  4M45 A;  4R5P A;  3S9H A;  2XY7 A;  3ZT4 A;  1K9M O;  2E2P A;  3K58 A;  2E2O A;  1RTI A;  1FK9 A;  4WQ4 A;  4NB4 A;  1ZXO A;  4LC9 B;  3VQ9 A;  2ATQ A;  3M6G A;  1HQU A;  1S1T A;  1S5J A;  3TTC A;  4W5T A;  1VQN N;  4H03 B;  4BRC A;  3L4Q A;  3WT0 A;  4B9M A;  4FPA A;  4ID5 A;  4E1N A;  2EX3 A;  4ZHR A;  4Z0U A;  1N5Y A;  4FJK A;  4DR5 K;  3A0I X;  1Z6R A;  4CHO A;  4E19 A;  2KZM A;  2FSN A;  1K6Y A;  1JXE A;  3H46 O;  4Y0W A;  1FW6 A;  5BR8 K;  1N36 K;  1S1V A;  2O8E B;  1JCF A;  1N32 K;  3CPE A;  5AZI B;  1YJN N;  5EX5 A;  2P5G A;  5J1E A;  4FLZ A;  3PX0 A;  3BZK A;  3HOT A;  4B9L A;  1QZ6 A;  3SQ1 A;  1VK0 A;  2HNZ A;  2P9K A;  4H4M A;  4BC3 A;  1S9E A;  3DXM A;  4E3S A;  1OH8 A;  3B6O A;  3QBW A;  1YIT N;  4FWP A;  1LWC A;  3ZX3 A;  5AQW A;  4DR3 K;  3W3D A;  4DHY A;  4CJ7 A;  2XY8 A;  1I39 A;  3MCA B;  3CM5 A;  3PV8 A;  4LSL A;  4ISE A;  3S3O A;  2KQ2 A;  2E2Q A;  2QW9 A;  5LMN K;  1NWK A;  1JXB A;  3CCV N;  1RNH A;  2YNH A;  3ISN C;  4JD2 B;  3OA9 A;  1IBK K;  1TK0 A;  1HKC A;  4B3T K;  1RDW X;  4CK3 A;  2VG5 A;  3LDL A;  3OYH A;  1RGI A;  4B1U B;  3Q7C A;  4IZ9 A;  2RKI A;  1JCE A;  2P9I A;  4LFB K;  4G9Z A;  4Q5V A;  2G8W A;  4E1M A;  3DLK A;  3QES A;  3G10 A;  5EOY A;  1ASW A;  3L8B A;  2HVI A;  1ITG A;  1A5X A;  5BRF A;  4W5R A;  3HST B;  1MWK A;  3K5O A;  3TTF A;  2Y1I A;  2OPQ A;  1NMD A;  2NRW A;  3ZET A;  5HLF A;  2GBZ A;  2HBL A;  1IBM K;  2DTU A;  5FLX O;  3KKR A;  3ITH A;  4DTO A;  3VOV A;  5IWA K;  1WBB A;  4MFB A;  3DI6 A;  4JKG B;  1Q81 O;  2F8T A;  4FJM A;  1NG9 A;  4Z4G A;  4YFU A;  4B1W B;  4X66 K;  5JS2 A;  3CQX A;  3RR7 A;  4H0V B;  2HHW A;  3I8B A;  1SQK A;  2X74 A;  4JI2 K;  1NK8 A;  1VQ9 N;  3FZF A;  2FF3 B;  4JK9 A;  1C1C A;  4JKC A;  1HPZ A;  1BIZ A;  4LFC K;  4BRM A;  3CER A;  1U47 A;  3LWM A;  2KZZ A;  4DQ8 A;  1W9H A;  3H3N O;  2YJE A;  3VEZ A;  4CZK A;  3VQ8 A;  4DQQ A;  4FM1 A;  1QVG M;  5EVZ A;  1SL0 A;  4GV3 A;  1HYZ A;  5BPL A;  1QSL A;  3LAL A;  3AA5 X;  4ILJ A;  4AIL C;  3KWG A;  4JKA A;  1L5U A;  4M3Y A;  3O80 A;  5AQG A;  1NM1 A;  2Q1N A;  1RTJ A;  4O44 A;  4KI6 A;  2I5J A;  3AA2 A;  2GUP A;  1YT3 A;  3F2K A;  4JNE A;  1NBW A;  2ZM6 K;  4M42 A;  4E7H A;  2DFE A;  5GAG P;  5AQJ A;  4GVE A;  1QSS A;  3V1R A;  4KHP K;  1S9G A;  4B3M K;  3MX5 A;  4CF8 A;  1BQN A;  3BF1 A;  5TKY A;  5DMR A;  3NH2 A;  3NVM A;  4CEO A;  5FPN A;  3JS6 A;  3VER A;  5FPM A;  2HHX A;  2YHW A;  4C8M A;  2NNW A;  4X64 K;  3ENB A;  4AHV A;  4FM2 A;  3RMD A;  4B3O A;  2P9P A;  4CGI A;  4X65 K;  3FZL A;  4DTX A;  3NH0 A;  4Z4C A;  1DLO A;  1TKZ A;  3NE6 A;  4I2Q A;  4BQL A;  4FZX C;  2VWB A;  4KRE A;  4OVL A;  3M3Z A;  4BR4 A;  4FYD A;  2HHQ A;  1BIS A;  3QEV A;  3M8R A;  4YOX A;  3R8E A;  3WNE A;  3OYN A;  4H5N A;  4DV1 K;  3F73 A;  4CK2 A;  2JLE A;  3TSP A;  1J54 A;  3PY8 A;  3I33 A;  2Q97 A;  2ITM A;  1YHQ N;  1XMO K;  5FDL A;  1HRH A;  4B9U A;  4FWL A;  3VQ6 A;  3G0Z A;  1T03 A;  3CCQ N;  3TAG A;  1C0F A;  4BR9 A;  3EO3 A;  2O8B B;  2Y1J A;  4KFB A;  2QWQ A;  2Z1I A;  4GKJ K;  5LJW A;  3VTI A;  4DQP A;  1W2B M;  1HKG A;  4FK4 A;  4DV3 K;  5AQU A;  4BE2 A;  3M8S A;  5AFU H;  4HCC A;  3EZW A;  4BG9 A;  3GDQ A;  2Q0U A;  1U04 A;  4FOE A;  4A2B A;  1KCF A;  1JLC A;  1W97 L;  3GL1 A;  3WNG A;  3AO3 A;  3O3F A;  3KTQ A;  2GUI A;  5DM7 L;  3NF9 A;  1NGD A;  2QWL A;  3SMP A;  1GOC A;  4DTM A;  3QO9 A;  4ELT A;  1XWL A;  4Z4F A;  4EZ6 A;  3EZ5 A;  3CC2 N;  1N8R O;  4BE0 A;  1YI2 N;  3U9Z A;  4CF9 A;  3HTV A;  3RMC A;  4M3U A;  4QCL A;  1WSE A;  1Q9Y A;  2YHB A;  4DV4 K;  3AY9 A;  1W0H A;  1K8A O;  1YVU A;  4XH1 A;  1VSL A;  1KAY A;  4DSJ A;  4K42 A;  1FKP A;  3RRG A;  1SS6 A;  3C7N A;  2D0P A;  1NK7 A;  5E84 A;  4FLV A;  1SKS A;  2V7Z A;  2HOE A;  1XHX A;  4DS4 A;  4JLH A;  3L2U A;  3RSE B;  3D0P A;  4CJ3 A;  3ENO A;  4PL7 A;  5H1S Q;  3MXM A;  3DLB A;  4CHZ A;  4H5R A;  4FJX A;  3NGI A;  1SUQ A;  3O9U A;  3OYA A;  2NUB A;  3AVA A;  4PY5 A;  1QQM A;  2YNG A;  3U6F A;  2P9L B;  3MN9 A;  5GAE P;  4A5B A;  2QKB A;  3VQ5 A;  4AHU A;  1D8Y A;  1SAZ A;  1I3A A;  2P5O A;  5HP1 A;  4GMJ B;  4J2A A;  1JLQ A;  3CC4 N;  4XEI A;  1E4G T;  4Q0B A;  1O1W A;  5TKW A;  3VQE A;  1SZ2 A;  1SKW A;  2HND A;  5AQL A;  3EYZ A;  3R1X A;  4K43 A;  3ALY A;  4C23 A;  1XNR K;  2E4L A;  5KI6 A;  2RF2 A;  3EE9 A;  4NYF A;  2VG7 A;  4YDU C;  2O8B A;  1UA1 A;  3P5J A;  4ZTJ A;  1GLF O;  4IO8 A;  4JHD A;  4JK7 A;  1RIL A;  3SV3 A;  5CYQ A;  4YOT A;  4CCH A;  3ZT2 A;  4J2D A;  3WQT A;  1BHL A;  3K9J A;  4K0K K;  4CED A;  4BRA A;  4FLY A;  3THX B;  2HHS A;  2NRH A;  3DXK A;  1EP4 A;  2QWM A;  1TUY A;  4LH5 A;  2BDP A;  3I56 N;  3LDN A;  3PO4 A;  5BN9 A;  5CYM A;  3H1Q A;  3D2E B;  1GOB A;  4H5V A;  3ZX0 A;  1U2V A;  5CZ2 A;  5I3U A;  1NGJ A;  3QNN A;  4FJ7 A;  1O13 A;  4KH6 A;  4LY7 A;  4CIG A;  3MXJ A;  2YI1 A;  1QHA A;  3CFO A;  4W5O A;  4OKK A;  2QM1 A;  2GEM A;  3VQP A;  3SMS A;  2UUB K;  4N41 A;  4CGF A;  3OS0 A;  3KZB A;  1RDD A;  2IIR A;  4IJA A;  3SPZ A;  5D3G A;  4BR7 A;  4JI8 K;  2KTQ A;  3SCX A;  3SZ2 A;  5A2Q O;  3NBP A;  2DPN A;  2XO7 A;  4EP5 A;  4H5T A;  4CI6 A;  1KVC A;  1TUU A;  1IKX A;  5C0Y A;  4BRE A;  3OYM A;  3WEE B;  1NJW A;  4IWV A;  2GV9 A;  3M8P A;  4YOW A;  3EKS A;  1Z25 A;  4DSK A;  4PL8 A;  4Z4I A;  1WAF A;  4HTU A;  1GLB G;  1WSJ A;  3O1W A;  1OH7 A;  2D1K A;  3NDK A;  3P39 A;  4CGH A;  4XH5 A;  2G8I A;  5ELZ A;  3QFP A;  4B1Z A;  3QIP A;  3FR0 A;  4GV9 A;  4FJN A;  2I7N A;  4NXM K;  2WC9 A;  4DSE A;  1I94 K;  2X78 A;  1KLN A;  3JAM O;  1BUP A;  1C1A A;  1H1V A;  1V4S A;  1HPM A;  3CJC A;  3TAM A;  3QIO A;  4RW4 A;  2W42 A;  4PUO A;  3P38 A;  4BC2 A;  1WN7 A;  1NOZ A;  3DWL A;  4JI1 K;  4BDY A;  4KPY A;  4Z4H A;  2P9N B;  4PWD A;  1FJG K;  2R7Y A;  1GLC G;  4DTR A;  4M3W A;  4F2S A;  1WSH A;  4MQ3 A;  4B9N A;  3THW A;  1T3V A;  5FRN A;  1RT6 A;  5SWM A;  3CPW M;  2P9U A;  2G8U A;  3RMA A;  4O5F A;  5HRN A;  3W0L A;  1VHX A;  1YF5 L;  1L3T A;  1JLE A;  3LP2 A;  3CD6 N;  2WTU A;  3CCE N;  4BR5 A;  3BP8 A;  1E4F T;  2A1S A;  3K5N A;  4FWO A;  3ZT3 A;  4H0X B;  3MXI A;  4EZ9 A;  1MDU B;  4FJ5 A;  2PYL A;  3HRG A;  4DLG A;  3SV4 A;  1QZ5 A;  3G4S N;  1BA1 A;  2W6L A;  3L2R A;  2O4I A;  3RWU A;  3M5R A;  1C6V A;  3TAF A;  1VRU A;  2AJQ A;  2HHH K;  5J2M A;  3QIC A;  3H1V X;  3KLH A;  4DV7 K;  5KQD A;  3EL2 A;  4O4G A;  4C1N K;  4FWM A;  5ADX A;  2ITG A;  3U4L A;  1QQN A;  1J53 A;  3LP1 A;  3DMJ A;  2OCE A;  1VQL N;  1ZYQ A;  3GE1 A;  3O3H A;  3VMF B;  4DWI A;  2J4R A;  4IG3 A;  3LAK A;  3AV9 A;  1RDC A;  3ATU A;  4HHT A;  2WUS A;  1GOA A;  1VSK A;  2BAN A;  3L3U A;  1XC9 A;  4KHQ A;  1U49 A;  1VSD A;  2YCH A;  4AM7 A;  1SKR A;  2QK9 A;  1KVA A;  3AVI A;  5K14 A;  1DKG D;  4DR1 K;  4CJL A;  4L8R B;  3CYM A;  1YIJ N;  3A2F A;  3HM8 A;  4DQS A;  3WXL A;  2Q0R A;  4DB3 A;  4DS5 A;  3DRS A;  2O8F B;  4ELU A;  4CJ4 A;  3L4I A;  1OH6 A;  3L2Q A;  3THY B;  3CHW A;  4QAG A;  3IDH A;  4N56 A;  4AQY K;  3UE5 A;  1RBT A;  4M3R A;  1T44 A;  4CFC A;  4NCG A;  2O8C B;  3AGK A;  1J9A A;  4DU3 A;  4X62 K;  4O55 A;  3H6E A;  4BRH A;  2V52 B;  4HUE A;  1VQO N;  3OS1 A;  2F7T A;  5E41 A;  3ZSO A;  3BY5 A;  2CGK A;  3MMV A;  4CEE A;  2I7P A;  1LAW A;  3RTV A;  3SYZ A;  3I0S A;  3V9X A;  4FWR A;  3O9Q A;  3OY9 A;  1B9D A;  1ZBF A;  4RWT A;  2UXC K;  3CI5 A;  4FW2 A;  1UAX A;  3QER A;  4BAC A;  3F9K A;  4BC4 A;  3V9S A;  3V6D A;  3JXU A;  3MED A;  3WXJ A;  2YNI A;  4CEA A;  3HSC A;  5BRH A;  2VQE K;  1XHZ A;  4LSN A;  2EHG A;  3OBY A;  4DSF A;  3OHR A;  3FLC O;  2WON A;  4IG0 A;  4YY3 K;  4NLB A;  2KFN A;  4A61 A;  4KKO A;  2AA4 A;  3MN5 A;  2P9S A;  1QVF M;  2HF3 A;  3OYC A;  4FVU A;  5AQK A;  5B8H A;  2ZWH A;  3JSM A;  5KRS A;  4E7J A;  4DV2 K;  3WQU A;  2IAJ A;  5GAD P;  3NGY A;  1WUA A;  4CFB A;  1KAX A;  1RBU A;  2A3Z A;  3SUN A;  3D2F B;  1S3X A;  1EX4 A;  1VSE A;  4DF8 A;  2FF6 A;  2PZS A;  4LF9 K;  3BZC A;  3D6R A;  3DYA A;  3ZEU B;  3AVL A;  1D5A A;  3AAP A;  5FPD A;  4Y1D A;  2FBX A;  3MEG A;  3E9P A;  4CJW A;  3FFK B;  4HTL A;  4OPH A;  2ZF5 O;  3CCL N;  3O1B A;  4UQG A;  4Z4E A;  5AQT A;  3AVF A;  4RG8 A;  2A42 A;  4BQZ A;  4EHT A;  1CZB A;  3AAQ A;  4O0J A;  4DF4 A;  3P1G A;  2YHY A;  3SK3 A;  4FXD A;  4K25 A;  1YJ9 N;  5M1K A;  1LW0 A;  3KK3 A;  4KB0 A;  1TK8 A;  1ATN A;  1HNI A;  1Z26 A;  3NGZ A;  1U6Z A;  2KKZ A;  3LDO A;  3CFR A;  4NCA A;  3WXI A;  2X6S A;  2CH6 A;  3C65 A;  4FCY A;  1KSP A;  4B9T A;  4DSL A;  3OW2 M;  1Q8I A;  3THV A;  5DM6 L;  3VF2 A;  2W6K A;  3CJA A;  1IBL K;  4AHC A;  4CF1 A;  2HF4 A;  3O9S A;  3AVB A;  4ILH A;  3IMX A;  2A6A A;  3VQQ A;  5J2Q A;  4DUY K;  3BUZ B;  4IOC L;  4CZL A;  4HCB A;  1T7P A;  1JLA A;  4DQI A;  4BGB A;  1BO5 O;  3O4W A;  4G1Q A;  1X9J A;  3MN6 A;  1OVQ A;  1NK4 A;  3HOS A;  1MWM A;  4Z94 A;  2O8E A;  1X1P A;  3HJF A;  1DTQ A;  5AZI A;  2LSN A;  2IVN A;  4WQ5 C;  1ASU A;  4BRN A;  2YHX A;  3C6U A;  3HI0 A;  1YTA A;  3AO5 A;  3TWH A;  1FKO A;  3NF8 A;  3LM2 A;  4B1X B;  2FBV A;  1HX1 A;  1XNQ K;  3MWT A;  1TL1 A;  1BWF O;  4KH4 A;  3EY1 A;  2HNY A;  4KHY A;  1C0G A;  5KGW A;  2FBT A;  4LF4 K;  1RBS A;  4XIU A;  4IEI A;  3E1Y A;  4FLW A;  2D4W A;  3PX4 A;  2ZGZ A;  4MLH A;  1C0T A;  3OTO K;  3VEX A;  2BH1 A;  4YHH K;  4JD2 A;  2KFZ A;  4IOX A;  3SAG A;  4BR2 A;  4E7I A;  2G8K A;  1Y97 A;  3CCJ N;  4I6M B;  4JYA K;  1G15 A;  3P4I A;  3OJS A;  4CW7 B;  3BGR A;  2PAV A;  2O4G A;  3T1A A;  1NOY A;  2YHA A;  4FK0 A;  1RT2 A;  4GVM A;  2YKN A;  4CE9 A;  3R3L A;  3SLC A;  3ZSQ A;  5M1F A;  1LWF A;  4C8K A;  1YAG A;  1JJ2 M;  4CHN A;  1DGK N;  4IFE A;  1NK9 A;  2HHT A;  2VWK A;  3KD5 E;  2IVO A;  1UWB A;  1RT7 A;  4A5A A;  3KHY A;  4RTF D;  1U4B A;  3LDP A;  1JCG A;  3DJC A;  4B3S K;  3M8Q A;  4JS4 A;  2DFF A;  1OKJ A;  2V7Y A;  3PX6 A;  4JKG A;  3J80 O;  3C6H A;  1XQS C;  5ADX H;  2XY6 A;  1HUX A;  3CIP A;  2BUP A;  2QWN A;  4IBN A;  5JLF A;  3KJV A;  4DG1 A;  1DTT A;  4OJR A;  2OPS A;  1L3V A;  1NKC A;  5M1O A;  2OTJ N;  4KHW A;  4CGJ A;  5AQP A;  3SJH A;  4ZTF A;  1JLF A;  3K57 A;  3AVC A;  3N4P A;  1KRP A;  3CJ1 A;  3V4I A;  5C15 A;  2Q31 A;  2CH5 A;  3VQ4 A;  4FZZ A;  3G6E N;  1NGI A;  1ATR A;  4KI4 A;  1HR0 K;  4BRI A;  4BVO A;  3ULE B;  3L0Q A;  3ZLJ A;  1NLV A;  1TKX A;  3KK7 A;  4C8O A;  1YVN A;  4AHS A;  4K8X A;  3A5L C;  4FJ9 A;  2UYT A;  3VN5 A;  3ZSY A;  4B08 A;  2WOM A;  4CZM A;  1HLU A;  4LF8 K;  1QQO A;  3RVC A;  1ATS A;  4DV6 K;  4FW1 A;  5GAH P;  2RPI A;  1G99 A;  3VQC A;  5CZ1 A;  2UUC K;  3NVK A;  1TYQ B;  4CBX A;  4F9O A;  5C25 A;  4BVP A;  2ZJQ L;  4FM0 A;  4BRK A;  3ZSZ A;  1T6C A;  1D4X A;  3O3G A;  1VQK N;  3ZX2 A;  1S6Q A;  1LV5 A;  2FSJ A;  3QET A;  1KVB A;  1BDG A;  4CD3 A;  1RCH A;  4DTS A;  1X3N A;  1RT1 A;  1X9S A;  4UY8 O;  5BPM A;  3SAH A;  1QTM A;  3CJ7 A;  1BU6 O;  4M41 A;  3U8X A;  2VGN A;  2PFU A;  4YOR A;  1HYS A;  3V1Q A;  4MO5 A;  4DTP A;  1BI4 B;  2HB5 A;  2NRX A;  3LPU A;  4IJN A;  3L6Q A;  5EY4 A;  2GEL A;  3A5M C;  1TL3 A;  3N4Q A;  2VYP A;  4O5B A;  3UIQ A;  2BTF A;  4FWN A;  5KTQ A;  1NK0 A;  1VQ4 N;  3B6P A;  2E1Y A;  3K5L A;  2UUA K;  3OJU A;  3NHG A;  1QQC A;  1WSF A;  2E1Z A;  5CE3 A;  2HHV A;  1FXX A;  5AQM A;  4BGA A;  4LF6 K;  2QA4 N;  2O8D B;  4CHY A;  2E8A A;  4KTQ A;  3TR8 A;  3WXK A;  4B8C A;  3CQY A;  4EP4 A;  4U67 L;  1DEJ A;  2D0C A;  1BA0 A;  4LF7 K;  4CEZ A;  4R79 A;  4JS5 A;  3VGL A;  4BRD A;  3BDP A;  1HJR A;  3HYF A;  4FJ8 A;  3AO1 A;  5BRE A;  3LAN A;  1VQ7 N;  1EQY A;  5FRM A;  5AQF A;  3K2P A;  3I8D A;  4DTN A;  4HWI A;  2QXF A;  4AM6 A;  1K8K B;  2NZT A;  1VQ6 N;  3ASM A;  3TAQ A;  3TTD A;  1VSM A;  4OPJ A;  3ZT0 A;  1IV0 A;  1CXQ A;  1ESV A;  4BDZ A;  3S3N A;  3DM2 A;  3U3Y A;  1NJX A;  2E2N A;  1NJI O;  1IG9 A;  5KPZ A;  3OYF A;  4JKB A;  3OYJ A;  4DTJ A;  5AQN A;  4JI6 K;  3C6T A;  1EWR A;  1TGO A;  4C8N A;  4JKH A;  1D9F A;  1Z05 A;  5CHI A;  1HNZ K;  4H0Y B;  5AZJ B;  1DT9 A;  2NRV A;  3P83 D;  3MK6 A;  3ENH A;  3SBG A;  2QTD A;  4DFP A;  5C2D A;  2OA8 A;  4JRQ A;  2JWK A;  1N33 K;  5JLH A;  5JIC A;  1NGG A;  1Q18 A;  1VQM N;  3SNN A;  1IKV A;  5LJV A;  4GNI A;  4DLE A;  4L3Q A;  3J7Z O;  4CER A;  3S3M A;  3TPQ A;  3IRX A;  3CET A;  3I0R A;  3KIO A;  4IEE A;  1OVY A;  1N6Q A;  1ZBI A;  3LWL A;  1BG3 A;  3UKR B;  3IFR A;  4IXC A;  4ISG A;  4JN4 A;  3RSE A;  2G8H A;  5AQR A;  4LFA K;  2ZE2 A;  4M7X A;  1WNS A;  2UXB K;  1S22 A;  1JL2 A;  1Q7Y O;  5HRR A;  3KK2 A;  4BDP A;  4FWS A;  4FSV A;  4H5W A;  4MLE A;  4BRP A;  4FJJ A;  3NFA A;  4OKJ A;  1ZBH A;  4B9S A;  1NKE A;  5EXW A;  2P9L A;  4CJT A;  3CCS N;  3AAR A;  5AQV A;  2Q3S A;  4A59 A;  4CEC A;  3O9T A;  3OYD A;  2ASO A;  3HVT A;  3KLI A;  4NCB A;  4CEQ A;  4KHU A;  1E3M A;  4WQ5 A;  4BG8 A;  4MDB A;  4I9L A;  4BRO A;  4DR4 K;  4MDA A;  3SJJ A;  2HW3 A;  2KLA A;  3SUO A;  3VQA A;  4NXN K;  1V4T A;  4PA1 A;  4BE1 A;  1QHT A;  5SZT A;  1IO2 A;  2O8D A;  5C42 A;  2OPP A;  3QEX A;  4CIF A;  1S1U A;  3FZM A;  4I7F A;  2F4V K;  5KQ8 A;  4JI0 K;  3WNF A;  5IT9 O;  2H3G X;  2JGU A;  3LP0 A;  2A41 A;  3MEE A;  5BRD A;  4N5S A;  1WBD A;  3HL8 A;  1F21 A;  5F0X A;  1LAV A;  4GV6 A;  2E6L A;  2A5X A;  3TAP A;  1N34 K;  4AHT A;  3CQ8 A;  3JYT A;  5HOO A;  4YOU A;  3BF3 A;  5BR9 A;  3THX A;  4JV5 K;  1EKE A;  3RR8 A;  2F8S A;  2Q2R A;  5C24 A;  3V9W A;  3SQ2 A;  4GY2 B;  1Q86 O;  3M1F A;  3J81 O;  4M3T A;  1UOC A;  3QEI A;  1VAZ A;  2GTD A;  2ZJR L;  3HVR A;  3D2E A;  2NRZ A;  4DFM A;  3QNO A;  2P9K B;  3DXM B;  3GBT A;  3WXM B;  5JMV A;  4BRL A;  1EWQ A;  3VEV A;  4F8R A;  3SI6 A;  1YUW A;  2HMP A;  4YOY A;  4FWQ A;  2JWL A;  3VQB A;  3WNH A;  3K9K A;  3LZI A;  2BE2 A;  2A1R A;  4JRP A;  2YJF A;  3DAW A;  4DV5 K;  1BGX T;  4B1V A;  3GOI A;  4JI3 K;  3PO5 A;  4FLT A;  4PKI A;  3KD1 E;  1NMN A;  3LDS A;  1X9M A;  4LD0 A;  5HBM A;  4KTZ A;  1RBR A;  3MN7 A;  2YV0 X;  3IS9 A;  3VGK A;  4BRF A;  3HZ6 A;  2E20 A;  3LP3 A;  3AO4 A;  3DRP A;  1RBV A;  3KVG A;  4DFK A;  3WEE A;  2P9I B;  1VSF A;  4CGG A;  1KXP A;  3U9D A;  5M1N A;  3VPZ A;  4WFN L;  4OPK A;  3K5M A;  4FJH A;  4I9Q A;  3NMU A;  3ZCM A;  3IKM A;  2E5L K;  3SPY A;  2EWS A;  2B5J A;  3ZET B;  2CGL A;  1T05 A;  4OO1 J;  3Q7B A;  4FVM A;  3LZJ A;  3ZT1 A;  3HT3 A;  4CJF A;  5E26 A;  3TU5 A;  2P9N A;  3H08 A;  4F3T A;  4HUG A;  4AF1 A;  4FO0 A;  4EIA A;  4C8L A;  3AVG A;  4O0I A;  1JL1 A;  1JKH A;  4FJG A;  3VTH A;  4IDK A;  1VRT A;  1IJJ A;  4CIE A;  1U45 A;  1NJZ A;  3J8A A;  1CZA N;  3RRH A;  5C10 A;  1QSY A;  4IO9 L;  3A5N C;  4BY9 C;  3KKS A;  3A5O C;  3ZSR A;  3EKU A;  5M1Q A;  3FGU A;  3E66 A;  3PLA A;  1YXQ A;  4YNQ A;  4IOA L;  4CBW A;  1NGA A;  1RDU A;  3GG4 A;  4O8K A;  2ZJP L;  3PIO L;  4YOV A;  3IUC A;  3CJ9 A;  3DOL A;  1B92 A;  3OVN A;  4CEF A;  3NH1 A;  1VSI A;  1KFD A;  4AHR A;  3PIP L;  4I2P A;  5BPN A;  5F1X A;  3L2V A;  4LH4 A;  3OYB A;  3O8M A;  4CZJ A;  4ILG B;  3SQ4 A;  2P51 A;  3T69 A;  4A2A A;  1KC8 O;  4JK8 A;  3HK2 A;  1VQ8 N;  2E6M A;  1OH5 A;  1RTD A;  4V19 S;  1EO1 A;  3V9Z A;  2QKK A;  3CM6 A;  4YDU A;  4JKE A;  4CZE A;  4NYN A;  3T1Y K;  3CJB A;  4ICL A;  5EU7 A;  3VET A;  1IH7 A;  2GWJ A;  2OYQ A;  2P9P B;  5LY3 A;  2IDO A;  3PSI A;  2IVP A;  3VF6 A;  4KAZ A;  2E88 A;  3VGM A;  2FBY A;  4J2E A;  1LCU A;  4DQR A;  1SL1 A;  2UU9 K;  3VA3 A;  1QS4 A;  4CGD A;  2VWJ A;  3QEW A;  4JI5 K;  4CJR A;  1K73 O;  4NLC A;  3G71 N;  1HYV A;  1QE1 A;  3MEC A;  1TAQ A;  2XY5 A;  1XI1 A;  1RFQ A;  2O8F A;  4WE1 A;  4CES A;  1BCM A;  1UA0 A;  1P90 A;  1NGH A;  4OPA A;  4KH5 A;  4ID1 A;  3THY A;  4ISF A;  2ASP A;  1L3S A;  4A62 A;  5T7B A;  2RHK A;  1HNX K;  2ZQB A;  5KRT A;  4E0D A;  2O8C A;  3OBW A;  1B9F A;  4F2R A;  5JS1 A;  4H0P A;  3K0S A;  2WBN A;  4PKG A;  1A5V A;  2YNF A;  3L3V A;  2Q36 A;  3OYK A;  4NO7 A;  2Z1H A;  4BR0 A;  3AA3 A;  3O08 A;  4BC5 A;  3TAR A;  4CJ5 A;  4KHS A;  4DKW A;  3PSF A;  5LL6 Z;  3DOK A;  3KK1 A;  3SUP A;  1NK6 A;  4B3R K;  1TKT A;  1NJY A;  3O5B A;  4J8F A;  5F2R A;  3CG7 A;  3QB0 A;  1GLL O;  4MO4 A;  3E01 A;  3NCI A;  2ASM A;  3R6M A;  1S72 N;  4DU1 A;  5AQQ A;  4M3Z A;  4CJK A;  1MA9 B;  1YTU A;  2ETJ A;  4EFH A;  5M1P A;  3AVH A;  3FZK A;  4FPB A;  2OTL N;  4JI7 K;  3CCU N;  1CLQ A;  1M1K O;  1NGB A;  1HNV A;  4KV8 A;  1D9D A;  3KLE A;  4KRF A;  1T8E A;  5HL7 L;  1VSJ A;  1HMV A;  4CJU A;  2GWK A;  3MDQ A;  3R9P A;  4CHP A;  5KPT A;  1C1B A;  3C6A A;  5MLC Q;  3OYE A;  3C7N B;  3D2F A;  2Z1G A;  3VEO A;  2OZM A;  3MX2 A;  4PHT X;  1RDA A;  4WFB L;  3T1H K;  2QI2 A;  3QFU A;  2FSK A;  1GLJ O;  3KWI A;  3CC7 N;  3ZEU A;  4CZH A;  4IFV A;  3DLL L;  2G8V A;  3MWP A;  3H3O B;  4B1Y B;  2OAN A;  3VEY A;  4JEP A;  3SBT A;  2WFB A;  1Y64 A;  4BWJ A;  4LF5 K;  2OZS A;  4M63 C;  2BGG A;  3QEP A;  2CGJ A;  2UXD K;  3HPH A;  1NK5 A;  1RTH A;  2A40 A;  1WAJ A;  3TAN A;  4M3X A;  3G25 A;  4DTU A;  1R59 O;  4CJV A;  2QWO A;  4PKH A;  1BQM A;  2F9T A;  4O8U A;  1ZBL A;  2KHO A;  4F4K A;  4EAH D;  2IGI A;  4FJI A;  4E1J A;  3FE1 A;  3RMB A;  2HHU A;  1NGC A;  4HVJ A;  4KTW A;  3V1O A;  1KAZ A;  4TSX A;  3VQD A;  3ZSW A;  1BIU A;  1KLM A;  2DFH A;  1NKB A;  2FLO A;  4FLU A;  1M90 O;  3O6W A;  4JHD B;  4B9V A;  4JKD A;  1S1W A;  3MCP A;  5GIP A;  3AO2 A;  1RT3 A;  4RW6 A;  4QS7 A;  5BN8 A;  3QBX A;  3OS2 A;  3ZSV A;  3O4N A;  4CZI A;  2RE2 A;  2RN2 A;  3DXK B;  4CK1 A;  4CZG A;  4AH9 A;  1SL2 A;  4CF2 A;  3ULD A;  3KLG A;  3VF4 A;  3TAB A;  5AQS A;  5AQO A;  2AP1 A;  5I9E B;  4WQ4 C;  4DCH A;  4FWK A;  1U2V B;  4PQU A;  1VQ5 N;  5JVH L;  2W41 A;  1TVR A;  2NLX A;  2ZD1 A;  5HRP A;  5CY4 A;  4JI4 K;  1ZBU A;  4CJP A;  4OX9 K;  2D5R A;  3C94 A;  2V51 B;  4W5N A;  4QS9 A;  1IG8 A;  3EN9 A;  3QLH A;  3AVN A;  3O4Q A;  1WLJ A;  5KGX A;  3TI0 A;  1RT4 A;  4OGE A;  3VEW A;  3SQ0 A;  3ZSX A;  5J2P A;  3VES A;  4I6M A;  3NF7 A;  1BOT O;  3CXC M;  3FZH A;  5AQX A;  3AGR A;  3C95 A;  1TKD A;  3D45 A;  4JAX A;  2HBJ A;  2ZGY A;  4K8Z A;  5AQI A;  3CCM N;  5CR4 A;  5GIO A;  1C0U A;  3QML A;  3LDQ A;  3HP6 A;  1Q9X A;  3EEQ A;  4E89 A;  3VQ7 A;  2FXU A;  4RW9 A;  5I42 A;  2HMI A;  2XHB A;  4EHU A;  4F3O A;  2QXL A;  3HM9 A;  1KFS A;  4XH4 A;  3TAE A;  2D0B A;  4DMN A;  3AA4 A;  1XMQ K;  5DK5 A;  1GLE G;  5C12 A;  3HBT A;  1NNE A;  1WSG A;  4CZF A;  4DR6 K;  4CEB A;  1NGE A;  1LOT B;  1TK5 A;  1J5O A;  3THW B;  2W40 A;  4N47 A;  3J7A P;  1ZBS A;  2HBK A;  2P9U B;  3T7Z A;  3HPO A;  4HUF A;  4FLX A;  4GKK K;  4WF9 L;  5FRO A;  3I55 N;  1IKY A;  2D0A A;  3A8Y A;  4B8A B;  2IC3 A;  2F96 A;  3OYG A;  4FZY A;  3ID6 A;  3ULE A;  4DV0 K;  1LWE A;  3LM9 A;  4DR7 K;  3SAF A;  4DUZ K;  4GW6 A;  4DR2 K;  1J6Z A;  5AJ3 K;  4DFJ A;  1JLG A;  1GLA G;  3TSU A;  1LW2 A;  3LL3 A;  5C2F A;  4U7B A;  4J2B A;  1BCO A;  2NRT A;  4QS8 A;  4B9Q A;  5FPE A;  4CFA A;  1RT5 A;  4WYB A;  5JVG L;  3QIN A;  4K41 A;  4IDH A;  4H0T B;  1TYQ A;  3K59 A;  1W7A A;  1S1X A;  1WB9 A;  3MAQ A;  3DLH A;  1EET A;  1A5W A;  2G8F A;  2HBM A;  3O9R A;  3UKU B;  4CFD A;  3E9L A;  5AR0 A;  4FK2 A;  2QWP A;  3HO1 A;  1C0M A;  1TV6 A;  2YX6 A;  1X9W A;  2VQF K;  1ASV A;  2NRR A;  2X6N A;  1P8Z A;  3OYI A;  3CFP A;  3U3G A;  1WOQ A;  2HST A;  3BEX A;  4CJE A;  2Z1J A;  2QEX N;  1HQE A;  2OPR A;  4ELV A;  1BI4 A;  1VQP N;  1J5E K;  4CBU A;  4CJS A;  3HP9 A;  1KD1 O;  1T6D A;  4CD1 A;  1KQS M;  1RDB A;  3V81 A;  1WSI A;  3ZYY X;  1YJW N;  4QOZ B;  1XC3 A;  1KTQ A; 
#chains in the Genus database with same CATH homology
 3RSE B;  3ID8 A;  1IJJ A;  3S41 A;  1XUP O;  3J8A A;  1CZA N;  3CF5 L;  4WFA L;  3EE8 A;  3ENO A;  5C10 A;  4PL7 A;  5H1S Q;  4KH4 A;  1BWF O;  4IO9 L;  5AQY A;  1C0G A;  3A5N C;  4H5R A;  4WCE L;  4BY9 C;  3A5O C;  5KPR A;  3EKU A;  3O9U A;  3P31 A;  5M1Q A;  4IEI A;  4BRG A;  3E1Y A;  3FGU A;  1QQM A;  3E66 A;  1M1K O;  3PLA A;  2D4W A;  3CCR N;  2ZGZ A;  1YXQ A;  2P9L B;  4MLH A;  3MN9 A;  1HJO A;  3VEX A;  5GAE P;  4IOA L;  3F9M A;  4CBW A;  2BH1 A;  1NGA A;  4A5B A;  1RDU A;  3GG4 A;  4O8K A;  4JD2 A;  2ZJP L;  3PIO L;  1NGF A;  4YOV A;  3IUC A;  4IOX A;  3SAG A;  3CJ9 A;  4BR2 A;  1K8K A;  1SAZ A;  3CME N;  3CCJ N;  4I6M B;  1ZC6 A;  3H45 C;  3PIP L;  3P4I A;  3CC4 N;  4XEI A;  5GIN A;  1E4G T;  1HKB A;  2D0O A;  2PAV A;  5BPN A;  5F1X A;  5TKW A;  3O8M A;  1SZ2 A;  4CZJ A;  4ILG B;  1ILY A;  5AQL A;  3R1X A;  3T69 A;  4A2A A;  1KC8 O;  4K43 A;  4JK8 A;  4C23 A;  1VQ8 N;  1GLD G;  3B8A X;  3R3L A;  3SLC A;  1EO1 A;  1Q82 O;  3EE9 A;  3TSQ A;  5M1F A;  3ATV A;  4M7Y A;  4YDU C;  4JKF A;  1YAG A;  4YDU A;  1JJ2 M;  1DGK N;  4IFE A;  4JKE A;  4CZE A;  1GLF O;  4IO8 A;  4JHD A;  3CJB A;  5AZJ A;  4JK7 A;  3VET A;  2GWJ A;  2VGM A;  4YOT A;  2IVO A;  4A5A A;  3WQT A;  2P9P B;  3K9J A;  3KHY A;  4RTF D;  2VCP A;  3LDP A;  4BRA A;  2P9S B;  1JCG A;  5LY3 A;  2NRH A;  3DJC A;  2IVP A;  3VF6 A;  4BRQ A;  2E88 A;  1OKJ A;  3DXK A;  4FOI A;  1LCU A;  3VGM A;  3VEN A;  2QWM A;  2V7Y A;  3F5T A;  4JKG A;  1TUY A;  4RCH A;  3C6H A;  1XQS C;  2PBD A;  5ADX H;  3I56 N;  3LDN A;  1HUX A;  3CIP A;  2BUP A;  2QWN A;  5JLF A;  5BN9 A;  2F9W A;  3D7E O;  3E9O A;  3H1Q A;  2QWR A;  4A57 A;  1K73 O;  5M1O A;  2OTJ N;  3D2E B;  4NLC A;  4H5V A;  3UKR A;  3UKU A;  3ZX0 A;  3G71 N;  1U2V A;  3QDK A;  3C0B A;  1NGJ A;  5AQP A;  3SJH A;  3N4P A;  1X3M A;  1RFQ A;  1O13 A;  4KH6 A;  3CJ1 A;  5AQH A;  5C15 A;  2Q31 A;  1P90 A;  3UB5 A;  2CH5 A;  1QHA A;  2YI1 A;  1NGH A;  3G6E N;  4OPA A;  4KH5 A;  2QM1 A;  1NGI A;  4ISF A;  1ATR A;  2GEM A;  5AFU A;  3SMS A;  3CMA N;  2ASP A;  3WUH A;  3KZB A;  4C1N I;  4A62 A;  2RHK A;  4BRI A;  4BVO A;  3ULE B;  3L0Q A;  2GX9 A;  2IIR A;  4IJA A;  1NLV A;  3KK7 A;  4BR7 A;  5AQZ A;  3OBW A;  1YVN A;  4H0O A;  4FL9 A;  4KBO A;  4H0P A;  3A5L C;  2UYT A;  2WBN A;  2DPN A;  4PKG A;  4CZM A;  1K9M O;  1HLU A;  2Q36 A;  2E2P A;  4NO7 A;  4BR0 A;  2E2O A;  1QQO A;  3O08 A;  1ATS A;  4H5T A;  3RVC A;  4CI6 A;  4WQ4 A;  4NB4 A;  5GAH P;  1TUU A;  1ZXO A;  5C0Y A;  1G99 A;  4BC5 A;  4BRE A;  4LC9 B;  4DKW A;  3NVK A;  3WEE B;  1TYQ B;  3M6G A;  3TTC A;  4CBX A;  4F9O A;  1VQN N;  4IWV A;  4H03 B;  4BVP A;  4YOW A;  3EKS A;  2ZJQ L;  4BRC A;  3L4Q A;  3WT0 A;  4PL8 A;  1GLB G;  4FPA A;  4BRK A;  3O1W A;  1T6C A;  2D1K A;  3O5B A;  3P39 A;  4J8F A;  4XH5 A;  5F2R A;  5ELZ A;  1D4X A;  3QB0 A;  3QFP A;  1VQK N;  3ZX2 A;  4B1Z A;  1GLL O;  2FSJ A;  4MO4 A;  4GV9 A;  3FR0 A;  3A0I X;  2ASM A;  3R6M A;  2I7N A;  1Z6R A;  2WC9 A;  1S72 N;  1BDG A;  5AQQ A;  4CD3 A;  1BUP A;  1X3N A;  1H1V A;  1MA9 B;  1V4S A;  1HPM A;  3CJC A;  2FSN A;  5M1P A;  4EFH A;  4UY8 O;  5BPM A;  3H46 O;  4Y0W A;  3FZK A;  4FPB A;  3SAH A;  2OTL N;  3CCU N;  3P38 A;  1JCF A;  1BU6 O;  3CJ7 A;  3U8X A;  2VGN A;  1NGB A;  2PFU A;  3CPE A;  4YOR A;  5AZI B;  4BC2 A;  1YJN N;  5EX5 A;  4MO5 A;  3DWL A;  5HL7 L;  2NRX A;  4IJN A;  3L6Q A;  2P9N B;  5EY4 A;  2GWK A;  2GEL A;  3HOT A;  1QZ6 A;  1GLC G;  3MDQ A;  3R9P A;  5KPT A;  3A5M C;  3C6A A;  5MLC Q;  3C7N B;  3N4Q A;  2VYP A;  3D2F A;  3VEO A;  2BTF A;  1T3V A;  4FWN A;  3MX2 A;  1VQ4 N;  2P9K A;  4PHT X;  2E1Y A;  4WFB L;  3CPW M;  2P9U A;  4BC3 A;  3DXM A;  2QI2 A;  3QFU A;  2FSK A;  5CE3 A;  2E1Z A;  1GLJ O;  3QBW A;  4O5F A;  5AQM A;  4FWP A;  3ZX3 A;  4BGA A;  1YIT N;  5AQW A;  2QA4 N;  3W0L A;  3KWI A;  3CC7 N;  3W3D A;  1YF5 L;  2E8A A;  4CJ7 A;  4DHY A;  3ZEU A;  4CZH A;  3WXK A;  3MCA B;  3CD6 N;  3DLL L;  3CCE N;  4BR5 A;  3MWP A;  3CQY A;  3BP8 A;  4U67 L;  1DEJ A;  3H3O B;  1BA0 A;  4ISE A;  4B1Y B;  1E4F T;  2E2Q A;  4R79 A;  2QW9 A;  2OAN A;  1NWK A;  3VGL A;  4BRD A;  4FWO A;  3CCV N;  3VEY A;  4H0X B;  1MDU B;  4JEP A;  3SBT A;  2WFB A;  1Y64 A;  3HRG A;  4JD2 B;  5BRE A;  1EQY A;  3OA9 A;  1VQ7 N;  1QZ5 A;  3G4S N;  1HKC A;  5AQF A;  1RDW X;  4HWI A;  1BA1 A;  4AM6 A;  1K8K B;  4M63 C;  2NZT A;  1VQ6 N;  2CGJ A;  3LDL A;  3TTD A;  3M5R A;  2A40 A;  1RGI A;  1ESV A;  1XC3 A;  4B1U B;  3G25 A;  3Q7C A;  1R59 O;  4IZ9 A;  2E2N A;  2QWO A;  4PKH A;  1JCE A;  2P9I A;  3QIC A;  2F9T A;  4O8U A;  2KHO A;  3H1V X;  1NJI O;  4G9Z A;  4EAH D;  5KPZ A;  4JKB A;  4E1J A;  3FE1 A;  1NGC A;  5EOY A;  3EL2 A;  5KQD A;  5AQN A;  1KAZ A;  4JKH A;  4C1N K;  4FWM A;  5BRF A;  5ADX A;  1MWK A;  3U4L A;  3TTF A;  1Z05 A;  5CHI A;  1QQN A;  2FLO A;  1M90 O;  1NMD A;  2NRW A;  4H0Y B;  3O6W A;  4JHD B;  1VQL N;  4JKD A;  5AZJ B;  1DT9 A;  2NRV A;  3GE1 A;  3ZET A;  3MCP A;  5GIP A;  2HBL A;  3VMF B;  3MK6 A;  4QS7 A;  3ENH A;  3SBG A;  2J4R A;  5BN8 A;  2QTD A;  3QBX A;  5C2D A;  3VOV A;  4CZI A;  2RE2 A;  2JWK A;  3DXK B;  5JLH A;  4CZG A;  5JIC A;  1NGG A;  1Q18 A;  1VQM N;  3ATU A;  4JKG B;  1Q81 O;  5LJV A;  4GNI A;  2WUS A;  5I9E B;  4B1W B;  4L3Q A;  3CQX A;  3J7Z O;  3VF4 A;  2YCH A;  4H0V B;  3CET A;  3TPQ A;  4AM7 A;  3I8B A;  5AQS A;  1SQK A;  5AQO A;  1VQ9 N;  2AP1 A;  3FZF A;  2FF3 B;  1DKG D;  1OVY A;  4IEE A;  4JK9 A;  4JKC A;  4WQ4 C;  1BG3 A;  3UKR B;  4DCH A;  1YIJ N;  3IFR A;  4FWK A;  1U2V B;  3HM8 A;  4IXC A;  4ISG A;  4JN4 A;  2Q0R A;  3RSE A;  3WXL A;  4BRM A;  4DB3 A;  1VQ5 N;  3CER A;  5JVH L;  5AQR A;  4DQ8 A;  2W41 A;  3H3N O;  2YJE A;  4M7X A;  3VEZ A;  1S22 A;  4CZK A;  1Q7Y O;  3L4I A;  2NLX A;  4FWS A;  3CHW A;  4FSV A;  4H5W A;  4MLE A;  4BRP A;  1QVG M;  2V51 B;  5EVZ A;  3IDH A;  4GV3 A;  5BPL A;  4QS9 A;  3UE5 A;  5EXW A;  2P9L A;  2V7Z A;  1IG8 A;  1T44 A;  3CCS N;  3AAR A;  5AQV A;  3EN9 A;  4ILJ A;  3AGK A;  4A59 A;  3KWG A;  3O9T A;  4JKA A;  2ASO A;  3H6E A;  4BRH A;  3O80 A;  2V52 B;  4WQ5 A;  5AQG A;  1NM1 A;  4BG8 A;  2Q1N A;  1VQO N;  4MDB A;  2F7T A;  3VEW A;  4BRO A;  2GUP A;  4MDA A;  3F2K A;  2CGK A;  3MMV A;  2I7P A;  3VES A;  4I6M A;  4JNE A;  1NBW A;  2KLA A;  1BOT O;  4FWR A;  3O9Q A;  3CXC M;  1V4T A;  5GAG P;  4RWT A;  5AQJ A;  3CI5 A;  4GVE A;  3FZH A;  4BC4 A;  5AQX A;  3AGR A;  3JXU A;  4JAX A;  3WXJ A;  2HBJ A;  2ZGY A;  3FZM A;  3HSC A;  3MX5 A;  5BRH A;  3BF1 A;  5AQI A;  5TKY A;  5KQ8 A;  5CR4 A;  5GIO A;  3CCM N;  2H3G X;  3NVM A;  3QML A;  5FPN A;  3OBY A;  3JS6 A;  3LDQ A;  3OHR A;  2A41 A;  3FLC O;  3VER A;  5FPM A;  2FXU A;  5BRD A;  2YHW A;  4NLB A;  4EHU A;  5F0X A;  4GV6 A;  2QXL A;  2A5X A;  2NNW A;  4A61 A;  4XH4 A;  2AA4 A;  3ENB A;  5HOO A;  3MN5 A;  2P9P A;  4YOU A;  3BF3 A;  2P9S A;  3FZL A;  5BR9 A;  2HF3 A;  1QVF M;  4FVU A;  1GLE G;  5C12 A;  3HBT A;  5AQK A;  4BQL A;  5B8H A;  2Q2R A;  2ZWH A;  2VWB A;  4CZF A;  4GY2 B;  3M3Z A;  4BR4 A;  1Q86 O;  3M1F A;  3WQU A;  5GAD P;  1NGE A;  1WUA A;  4YOX A;  3R8E A;  1KAX A;  1LOT B;  1VAZ A;  2GTD A;  4H5N A;  2A3Z A;  2ZJR L;  3D2E A;  3D2F B;  1S3X A;  2NRZ A;  2W40 A;  1ZBS A;  3TSP A;  2P9K B;  2HBK A;  2P9U B;  3DXM B;  3GBT A;  3T7Z A;  3WXM B;  5JMV A;  2FF6 A;  4BRL A;  3I33 A;  2Q97 A;  2ITM A;  1YHQ N;  3VEV A;  3D6R A;  4WF9 L;  1YUW A;  3I55 N;  4FWL A;  3ZEU B;  2HMP A;  4YOY A;  3A8Y A;  3AAP A;  2JWL A;  4FWQ A;  5FPD A;  3K9K A;  3E9P A;  3CCQ N;  3FFK B;  4HTL A;  4OPH A;  2ZF5 O;  3ID6 A;  3CCL N;  3ULE A;  3O1B A;  3LM9 A;  1C0F A;  4BR9 A;  3EO3 A;  2YJF A;  3DAW A;  3SAF A;  5AQT A;  4B1V A;  3GOI A;  2QWQ A;  1J6Z A;  2A42 A;  4PKI A;  4BQZ A;  4EHT A;  5LJW A;  1GLA G;  3VTI A;  3AAQ A;  1W2B M;  1HKG A;  3TSU A;  2YHY A;  3LL3 A;  3MN7 A;  5C2F A;  3SK3 A;  4U7B A;  4K25 A;  1YJ9 N;  2NRT A;  4QS8 A;  4B9Q A;  5FPE A;  5AQU A;  3VGK A;  5M1K A;  4BRF A;  3HZ6 A;  2E20 A;  4WYB A;  5AFU H;  5JVG L;  1ATN A;  3EZW A;  4BG9 A;  4K41 A;  1U6Z A;  3GDQ A;  2Q0U A;  3KVG A;  4IDH A;  4H0T B;  3WEE A;  1TYQ A;  2P9I B;  2KKZ A;  3LDO A;  3WXI A;  4FOE A;  2CH6 A;  3C65 A;  1KXP A;  3U9D A;  4A2B A;  3OW2 M;  1W97 L;  5DM6 L;  3GL1 A;  5M1N A;  2HBM A;  3O9R A;  3VF2 A;  3UKU B;  3VPZ A;  3E9L A;  3CJA A;  4WFN L;  2HF4 A;  3O9S A;  5AR0 A;  2QWP A;  5DM7 L;  4ILH A;  3IMX A;  1NGD A;  3NMU A;  2QWL A;  2A6A A;  3SMP A;  4IOC L;  3BUZ B;  3IKM A;  2YX6 A;  4CZL A;  2EWS A;  3ZET B;  4BGB A;  2NRR A;  3CC2 N;  1N8R O;  1BO5 O;  3O4W A;  3U9Z A;  1YI2 N;  1P8Z A;  1X9J A;  3MN6 A;  3HTV A;  1WOQ A;  2CGL A;  3HOS A;  4OO1 J;  1MWM A;  3Q7B A;  2HST A;  3BEX A;  4Z94 A;  2QEX N;  5AZI A;  3AY9 A;  2IVN A;  1VQP N;  4CBU A;  4WQ5 C;  5E26 A;  3TU5 A;  1K8A O;  2P9N A;  1KD1 O;  1T6D A;  4BRN A;  2YHX A;  4AF1 A;  4XH1 A;  3HI0 A;  4FO0 A;  1KAY A;  4EIA A;  4K42 A;  4CD1 A;  1KQS M;  3LM2 A;  4B1X B;  1SS6 A;  3C7N A;  2D0P A;  1HX1 A;  3VTH A;  3ZYY X;  5E84 A;  1YJW N;  2HOE A;  3MWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...