2GELA

2.05a crystal structure of salmonella typhimurium yeaz, form b
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
218
structure length
218
Chain Sequence
MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Gram negative resuscitation promoting factor
publication title Structural Characterization of Salmonella typhimurium YeaZ, an M22 O-Sialoglycoprotein Endopeptidase Homolog
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
total genus 66
structure length 218
sequence length 218
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gelA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gelA02
4FO0A 4FWRA 3ID8A 3H1VX 4Y0WA 2P9KA 1MA9B 3H46O 3EKSA 3LDQA 4IJAA 3WUHA 1X3MA 1DEJA 4EAHD 1GLDG 4BRMA 3DXKB 2FSNA 1H1VA 2IVOA 4RWTA 5AFUH 3CJ7A 1NGFA 1Z6RA 2E88A 3EN9A 3ATUA 2QXLA 2ZF5O 4XEIA 5AFUA 3BF3A 3QFPA 4YDUA 4BQZA 1YVNA 1Z05A 2QWNA 3BF1A 1NMDA 4PL7A 1NGIA 4RCHA 1JCFA 4H0YB 5AQMA 1E4FT 1GLAG 2FSKA 3BP8A 3GOIA 4BC5A 3HSCA 2ZWHA 1U2VA 2A5XA 4BRLA 4EFHA 5B8HA 5F1XA 2UYTA 1GLFO 3HBTA 1P8ZA 3O80A 1XC3A 4JHDA 4BVPA 1NM1A 3VOVA 3O4WA 3U8XA 4BC4A 3EKUA 3ZX2A 5CE3A 4FWKA 1NGHA 4IO8A 1BA1A 2GTDA 4CJ7A 5AQSA 1TUYA 3CIPA 3WQTA 1YUWA 4PKHA 2QWRA 4C23A 1LCUA 2P9KB 4BGAA 4PKIA 5AZIA 2D4WA 4MO5A 4BRDA 3SLCA 4FOIA 2P9UA 4H0PA 1YXQA 4PKGA 4H5WA 3DXMA 3AAQA 4A2AA 3F9MA 4EHTA 5BR9A 3M1FA 1XQSC 2Q31A 1J6ZA 1G99A 1YAGA 1HKGA 3VEYA 3VF2A 3HM8A 3FGUA 4K42A 3CI5A 3MN5A 1X9JA 1ATNA 1U2VB 2ASPA 4XH5A 1XUPO 2P9SA 3G25A 3EL2A 4H03B 4JHDB 3DJCA 4B1ZA 2Q0UA 1NGDA 4IJNA 1C0FA 5AQPA 4BROA 3ENOA 4QS8A 3EZWA 4IWVA 5F2RA 3CHWA 2V7YA 3MN6A 4CZIA 1V4TA 3LDLA 4FWOA 2Q2RA 3LDNA 1QQMA 3A5OC 4H0TB 1SAZA 3ZETA 1HKBA 3VERA 5AZIB 3WEEA 2HMPA 4FWMA 4O5FA 4L3QA 4B1XB 1D4XA 3H1QA 4MLHA 2P9UB 2CGLA 3MK6A 3R8EA 3WXIA 3HTVA 4NO7A 3DXMB 2QWMA 4CZGA 2IVPA 1LOTB 2EWSA 3WXKA 3L4IA 4RTFD 5KQ8A 5EVZA 5EX5A 1MWKA 3CETA 1GLLO 1TUUA 2P9LB 5AQHA 1RFQA 2E1ZA 4I6MB 1KXPA 2OANA 3M3ZA 5BPMA 4BRQA 3MDQA 3DWLA 1KAZA 1HPMA 1E4GT 1KAXA 4LC9B 2YHYA 4Z94A 5AZJA 4QS9A 1NGAA 5BRHA 2VYPA 4BR2A 2P9SB 2F9TA 3A8YA 1NGJA 2VWBA 3I33A 4BRHA 4H5NA 3QB0A 5AQQA 4CZKA 5AQKA 5E84A 2HF3A 1Q18A 3ZX3A 4M7YA 4DB3A 4BRKA 5AQJA 3FLCO 1EQYA 4MLEA 4AM6A 4ISEA 2FF3B 1NGCA 2V52B 3O08A 1SQKA 3QICA 1K8KA 1NLVA 2GEMA 4KBOA 3ZETB 4B1UB 3D2FA 5BREA 3U4LA 3A5MC 3VEOA 4K25A 3WEEB 4CD1A 4BC3A 3W3DA 1IJJA 1GLCG 5FPMA 1ZXOA 3L6QA 2V51B 1HKCA 3BUZB 4M63C 3JXUA 4CZLA 4CBWA 1MWMA 2J4RA 2E8AA 3KHYA 3ZX0A 4GY2B 1QQOA 4XH4A 4QS7A 5AQVA 3KVGA 1U6ZA 4A61A 2QM1A 3VF6A 5KQDA 4PL8A 5AZJB 2NRHA 1ATSA 3H6EA 3LL3A 3VENA 2P9PA 3VEZA 2CGKA 3QFUA 5EOYA 4FWLA 3BEXA 2QW9A 4FOEA 4JN4A 2QWPA 2WUSA 2H3GX 3GBTA 3QBXA 1R59O 2PAVA 4NB4A 1BDGA 4CD3A 3MN7A 5AQXA 3R6MA 4FL9A 3O6WA 2GELA 2P9LA 2A40A 4I6MA 3CJ9A 2F9WA 1DGKN 1K8KB 3FZLA 2Q36A 3D2FB 2BTFA 1HUXA 3ZEUA 2HOEA 3GG4A 3KZBA 2AA4A 4O8KA 1QQNA 3SK3A 4IXCA 2P9IA 1BWFO 1X3NA 4BG9A 4EIAA 3U9DA 3IUCA 2AP1A 3D7EO 3UB5A 4E1JA 2HF4A 3VGLA 3C7NB 4CBXA 4H0VB 3AAPA 2Q0RA 4M7XA 4A2BA 2YJEA 2CGJA 3CJBA 3W0LA 1NBWA 3LDOA 4BRCA 3GDQA 5AQNA 3L0QA 2ASMA 4H0OA 3JS6A 5TKYA 3MMVA 2FSJA 5JLFA 1TYQA 2Q97A 3RSEA 2P9PB 3A5LC 2NZTA 3S41A 2FF6A 2GWJA 4CI6A 1S3XA 4HWIA 3WT0A 3WXLA 5E26A 5KPZA 5AQWA 3TPQA 3ULEB 3FZFA 3VEVA 1RDWX 3B8AX 3FZKA 3IFRA 4BRFA 3EO3A 3O8MA 3O1BA 2W41A 4EHUA 1HJOA 2ZGYA 1BO5O 2D0OA 2IIRA 3I8BA 1ATRA 5AQGA 3LM9A 3TU5A 4FPAA 3VGMA 4DCHA 5BN8A 3A5NC 4B1YB 3A0IX 3QDKA 3CQYA 3SMPA 4XH1A 4BRIA 4BRPA 5JICA 3UKRA 3O5BA 3VETA 3ZEUB 3ENHA 1QZ5A 1IG8A 3U9ZA 2ASOA 4FWNA 3HI0A 2GWKA 1ESVA 2P9IB 2IVNA 4CZFA 4CZJA 4JD2A 3AY9A 4BR9A 4ISGA 5ADXH 2Q1NA 2NLXA 2YHWA 4IZ9A 3WXJA 2E1YA 5ADXA 3UKUA 1NGBA 1V4SA 3H45C 5ELZA 3MCPA 5KPRA 4YDUC 3R9PA 3UE5A 3VGKA 4H5VA 4CZHA 2ZGZA 3D2EA 4H5RA 4BRGA 3H3OB 4ISFA 5KPTA 1TYQB 2FLOA 4WQ4C 1DKGD 3RSEB 3AARA 2E2NA 5AQOA 4JAXA 3SMSA 3QBWA 4BG8A 2BUPA 4BR0A 4B1WB 3CQXA 4WQ4A 3SJHA 1S22A 2CH6A 1BU6O 3C7NA 1OKJA 2P9NA 2A3ZA 5FPNA 1GLBG 4CZMA 2A41A 3VEWA 4H0XB 3C0BA 4F9OA 1NWKA 1QHAA 3J8AA 4FWPA 3FR0A 2D1KA 2A6AA 2FXUA 4J8FA 3UKRB 3GL1A 5LJWA 5F0XA 2VCPA 4BGBA 1ZC6A 3ULEA 4FPBA 1SZ2A 5LY3A 2ITMA 4JD2B 1JCGA 3LM2A 5AQYA 1MDUB 1GLJO 1KAYA 1WUAA 2QWOA 4BR4A 4CBUA 4HTLA 1ZBSA 4B9QA 3FE1A 1HX1A 2E2PA 3UKUB 1RGIA 2A42A 1GLEG 4A62A 2KHOA 1CZAN 1BUPA 3MN9A 5AQRA 3VF4A 5AQIA 2I7NA 3VPZA 3D2EB 4BQLA 3GE1A 2I7PA 4DQ8A 2QWQA 1T44A 2GUPA 5AQZA 3ATVA 4WYBA 3VEXA 3CJ1A 3O1WA 5LJVA 4DHYA 4JNEA 3FZMA 4B1VA 4BC2A 1QZ6A 5JMVA 3IMXA 5AR0A 5I9EB 2P9NB 1NGGA 1NGEA 3M6GA 1BOTO 3FZHA 2QWLA 3OHRA 2YCHA 3CERA 2YHXA 3DXKA 1C0GA 5BRDA 4FWSA 2D0PA 3VESA 1JCEA 4FWQA 4MO4A 1T6DA 3QMLA 2YJFA 4BRAA 5FPEA 5AQUA 3P4IA 4CZEA 5AQLA 5BPLA 3WQUA 5BPNA 1HLUA 4AM7A 1Y64A 1WOQA 2W40A 3FFKB 4FSVA 2E20A 1T6CA 5AQFA 4WQ5C 4H5TA 3CJAA 2DPNA 4BRNA 2E2OA 3DAWA 5JLHA 4BR5A 3CJCA 4BR7A 4BREA 5EY4A 1BA0A 4K43A 5BRFA 2PBDA 3HZ6A 2V7ZA 5BN9A 4WQ5A 4K41A 5AQTA 4GNIA 2CH5A 3IDHA 4BVOA 5EXWA 3H3NO 3LDPA 2E2QA 2YI1A 5FPDA 1BG3A
chains in the Genus database with same CATH superfamily
4C8MA 4FO0A 4Y0WA 2P9KA 3WUHA 1TK5A 3NVMA 1RT2A 3DXKB 2IVOA 1EX4A 1Q82O 3MX5A 3L2WA 4W5RA 1QTMA 1IKWA 3CPEA 4NLBA 1SKRA 4EP5A 3P38A 2F7TA 1QSYA 3CCRN 3NCIA 4Y1CA 5M1KA 4E1MA 2Z1IA 1Q9YA 1JJ2M 4GVMA 2FSKA 4BC5A 2QA4N 4CHQA 1K73O 2Y1JA 1GLFO 3HBTA 1P8ZA 1KVCA 3O80A 4FLVA 5GINA 4CE9A 4YOWA 3HXMA 4ID1A 4LSLA 4CF0A 2E6MA 1LWFA 3EKUA 1R0AA 2NNWA 3VQ8A 2YHBA 5C12A 4GV6A 1BQMA 4QCLA 3NH1A 4B9NA 3PLAA 4C23A 1WAJA 1LCUA 1OH7A 3K5OA 4KHQA 4BGAA 2Z1GA 2D4WA 4RW8A 1RTDA 3SLCA 4Z4IA 3TSUA 3OVNA 4H0PA 5KI6A 3K58A 1NK5A 3NGZA 3DXMA 5HLFA 3L2UA 4CESA 3OW2M 1J6ZA 3NF7A 3ZT4A 4XIUA 4V19S 4ZHRA 1I94K 4AILC 1UOCA 2ASPA 4XH5A 4FJ8A 3SNNA 3MAQA 3LP3A 2W6LA 3RMAA 4LH5A 2JWLA 1JLEA 3VA0A 4IJNA 1VHXA 1C0FA 2F96A 5AQPA 2HHTA 1OVQA 4M3YA 3WNGA 4CJVA 5F2RA 1F21A 2V7YA 2NRRA 3HL8A 4UQGA 4CZIA 1V4TA 2W42A 4FWOA 5JVHL 4DV4K 3CCSN 3OYMA 1IKYA 4X64K 1TGOA 4FZYA 1SAZA 4PY5A 4JRPA 1VQPN 2RN2A 3EE9A 1BCOA 3PY8A 1RBVA 3H1QA 4MLHA 4FJGA 3KK1A 2HW3A 3MK6A 2LSNA 3HTVA 4E7IA 1YTAA 2PZSA 2A1RA 1LWCA 4KRFA 4YY3K 4CJRA 4CEFA 1BL3A 4DFJA 4FK2A 1RFQA 4I6MB 2G8IA 2OANA 4YOXA 3MWTA 2YNHA 3TAQA 3AVNA 1E4GT 2XY6A 4QS9A 4FM1A 3F5TA 4AQYK 1NGJA 2VWBA 4AH9A 1OH5A 5AQQA 1NKBA 3CC7N 1VQ5N 1VQ6N 5HOOA 2VG5A 4M7YA 1MU2A 4W5NA 4NYNA 3I55N 1J9AA 1CXUA 4DG1A 4F4KA 2WC9A 4OLBA 4N5SA 2Y1IA 4ELTA 3A5MC 3QNOA 3WEEB 3CD6N 4BC3A 3W3DA 3EYZA 5FPMA 1SKWA 3L6QA 4LFAK 2IGIA 2O4IA 3T7ZA 1S1WA 4N47A 1KRPA 4MDBA 1TV6A 4JKGB 4Z4GA 1MWMA 3F9KA 2E8AA 3ZX0A 1HYSA 4GY2B 1QQOA 4H8KA 3OYDA 4RW7A 1Q81O 4BY9C 3HYFA 2KW4A 5AZJB 5DM7L 4FZXC 1UAXA 3KJVA 2CGKA 3NF8A 2ZJPL 2X74A 2RE2A 1NU0A 3BEXA 4FOEA 4ILHA 2QWPA 3GBTA 1R59O 2PAVA 1QSSA 5AQXA 1E3MA 4FL9A 3O6WA 3KLIA 3SUPA 4GKJK 2GELA 2P9LA 2YNFA 1BI4A 3ZSXA 2A40A 3KD1E 4CERA 4EP4A 3V1QA 1DGKN 4IDHA 3D2FB 1HUXA 4KH5A 3RTVA 1QQNA 3HM9A 1RDAA 3OBYA 4BG9A 3U9DA 4DR4K 4E1JA 4CFBA 3KK3A 1KVAA 4BDYA 1QVFM 2YJEA 3MXJA 3RVCA 4HUEA 3MCAB 4LD0A 4BRCA 3JS6A 5TKYA 3MMVA 1S9EA 2FSJA 4E89A 3AA2A 3IS9A 2FF6A 4FJMA 3WXLA 3WT0A 5AQWA 2IDOA 1RDWX 3TAMA 3AO1A 2G8WA 3O1BA 3VQ7A 4E1NA 4O0JA 1NK7A 1TK8A 4CGJA 3TTDA 1W7AA 1B92A 3A5NC 2O8CA 2P5GA 3A0IX 3CQYA 3SMPA 1S1XA 2OPSA 1RNHA 3H08A 4AHCA 3VETA 2HHSA 4W5TA 1QZ5A 3U9ZA 5D3GA 4YNQA 1ESVA 2IVNA 3QESA 2HSTA 2YHWA 4FLWA 3VTHA 4IZ9A 4CEOA 4OPHA 4DV7K 2E1YA 2QK9A 5C42A 1NGBA 2ATQA 3AVAA 3VN5A 4DV1K 4H5VA 3L3UA 1VRUA 1SL2A 2UUBK 4H5RA 1W0HA 3H3OB 1NK6A 5KPTA 1TYQB 1C0MA 2IAJA 5AQOA 4JAXA 4F2SA 4CEQA 1JL1A 3L2QA 2XO7A 4CF9A 1OH6A 4KHYA 4B1WB 3SJHA 2CH6A 3C7NA 3AO5A 1OKJA 1JXBA 2P9NA 2A3ZA 1NK0A 1YJ9N 4H0XB 3C0BA 1QHAA 3VQBA 1REVA 3E9OA 3SV4A 1S1UA 2A6AA 2Q3SA 5JS2A 3GL1A 4PHTX 3PIOL 2ITGA 2VCPA 4BGBA 1ZC6A 3KKSA 1L3UA 4GKKK 4FJ5A 4BE0A 4DQSA 4YOUA 3THXB 2NRZA 4OGEA 1GLJO 1Q8IA 1WUAA 1M1KO 3AV9A 1ZBSA 2NRVA 4HTLA 4BWMA 4B9QA 1GOCA 2O8DA 1RGIA 1U48A 2KHOA 4M3ZA 4MQ3A 5AQIA 4WCEL 3VPZA 3D2EB 4BQLA 3T1YK 4B9UA 1WAFA 2GUPA 4ILGB 3VEXA 3V1RA 4DHYA 5KRSA 3C6HA 4B1VA 5JMVA 5AR0A 3AVGA 5M1QA 1KC8O 3O4QA 4DR7K 1JL2A 5EU7A 5BRDA 4NCBA 4G1QA 1T05A 2D0PA 4MO4A 4I2QA 1S6PA 4CJ4A 2FBXA 3QMLA 3CFPA 2YJFA 4BRAA 3F73A 3HVRA 4LF5K 4L8RB 3AVLA 2O8EA 2BH1A 3TARA 4Z4CA 4N76A 2KTQA 4JKFA 4DFKA 3AVHA 4FSVA 3TANA 5GADP 3KK2A 5AQFA 4WQ5C 4H5TA 3CJAA 3IAYA 3EEQA 4B8AB 4HVJA 4BR5A 3CJCA 1BA0A 1NJZA 5GIOA 1U45A 4I9QA 2V7ZA 1RT3A 4WQ5A 3D0PA 3SJJA 1JLAA 4TSXA 4GNIA 5HBMA 4BVOA 4C1NK 5SZTA 4DSJA 3SAFA 4DTXA 2UXBK 5FPDA 3G4SN 4FWRA 4X62K 3ID8A 3H1VX 3NH0A 1FJGK 3H46O 3AA3A 3J7AP 1Z25A 1DEJA 4EZ9A 1GLDG 4O44A 2FSNA 1H1VA 4O5BA 4RWTA 5AFUH 3CJ7A 3R1XA 1KSPA 2OTJN 5IWAK 1T3VA 2E88A 1J5EK 1EWRA 4HCBA 5AFUA 1GOBA 4M45A 2QXFA 3MEGA 4M3TA 2D0AA 3NMUA 1NJWA 4QAGA 2UXCK 4FW2A 2HHVA 4PL7A 3OYJA 1NGIA 1W97L 4KO0A 4RCHA 1JCFA 4OPAA 4F2RA 1B9FA 4LF9K 1E4FT 1GLAG 4JKBA 3BP8A 4BRLA 2A5XA 4Z4HA 4KI4A 3PUFA 3V6DA 2GV9A 5C10A 3SYZA 4DSFA 1NM1A 3VOVA 3O4WA 4CCHA 1QE1A 3RWUA 2RF2A 4CJWA 3G10A 2GBZA 4BC4A 4JI4K 4CJEA 3ZX2A 5CE3A 3ZSWA 3ZLJA 4JI5K 1BA1A 2GTDA 3FFIA 4IDKA 3CIPA 3WQTA 1Q9XA 1YUWA 1S1VA 3NF6A 3LANA 4FZZA 4BRDA 4H4OA 4IKFA 3AAQA 3M1FA 1XQSC 1M90O 1VSFA 5J2PA 1WLJA 1YAGA 3VEYA 3VF2A 3MN5A 1X9JA 4AHSA 3K5MA 2QEXN 1U2VB 3C95A 3VMFB 3ZSVA 5HRNA 1NK8A 4H03B 4JHDB 2WBNA 3DJCA 4B1ZA 1BCMA 4J2DA 3ENOA 5LMUK 3THYA 3CHWA 2RHKA 3OYKA 4LY7A 1U04A 1X9MA 2D0CA 3LDNA 3A5OC 3P83D 4DSIA 3WNFA 3ZETA 1HKBA 1QQCA 1VSJA 3KK7A 5AZIB 3D45A 4DR2K 1L3SA 4W5QA 3M8PA 1FXXA 2P9UB 1SL0A 3QLHA 3OYHA 3OY9A 3MEEA 2QWMA 4CZGA 4DR3K 1XNRK 3AO2A 4ZTFA 3U6FA 1RDCA 4RTFD 1WBDA 5EVZA 5EX5A 2YKNA 2PY5A 1HMVA 2ZJQL 3CETA 2P9LB 4AHUA 3AVFA 3AVIA 2E1ZA 1KXPA 5BPMA 1U4BA 4CJSA 3MDQA 3DWLA 1KAZA 2YHYA 4DLEA 1U49A 4BR2A 2P9SB 3OA9A 3I33A 4BRHA 4H5NA 4FJIA 4B3RK 1A5XA 5AQKA 3E01A 4KI6A 3ZX3A 2KKZA 4CJUA 1N5YA 4OGCA 3OYBA 1ZBLA 3FLCO 4MLEA 1YHQN 2P51A 2V52B 1NGCA 1K8AO 1ZBUA 2F8TA 1K8KA 4KBOA 1YJWN 1SL1A 5BREA 3U4LA 3VEOA 1BQNA 4K25A 4CD1A 1VQKN 4DSKA 1IJJA 4IBNA 4CHOA 1ZXOA 2V51B 1QHTA 4CECA 4CF2A 4CZLA 4CBWA 2J4RA 1XC9A 3KHYA 4YOYA 4KH4A 4QS7A 4J2EA 3EZ5A 4M3WA 3TR8A 2O8BB 4ZTJA 1QSLA 4FM2A 2XY5A 4CEDA 4FYDA 4DU1A 4DV0K 4DU3A 2D5RA 2DFHA 1ZYQA 4HUFA 3VEZA 1IH7A 3U3GA 4DV3K 4B3MK 3RR7A 3LP0A 3K9KA 3V9XA 2WUSA 4M41A 1S1TA 1QVGM 4JI2K 1YVUA 1WNSA 3MN7A 4JKAA 3PSFA 1YI2N 2EX3A 3L2VA 3CJ9A 4O0IA 3HJFA 3LAMA 3FZLA 4M3RA 2BTFA 3HT3A 3DLEA 3ZEUA 3TAEA 5C2FA 3KZBA 2AA4A 3SK3A 4IXCA 4CFAA 1YF5L 1RDDA 1TKZA 5M1NA 1A5VA 3C7NB 3LAKA 3MX2A 3AA4A 3THWA 2BE2A 1BIUA 3O9SA 3W0LA 3CJBA 3VQ5A 3JAMO 4ELVA 3LDOA 1IKXA 3VQEA 3GDQA 5AQNA 4JS4A 4KKOA 4N56A 3SBGA 1EKEA 2Q97A 3CCUN 3HPOA 4M3XA 3RSEA 2P9PB 3A5LC 2OCEA 5FDLA 1S3XA 1KVBA 5KPZA 3FZFA 5M1FA 3B8AX 4QOZB 3EO3A 1ZBHA 3P31A 5FLXO 2QKKA 1C6VA 4FM0A 1IBMK 1N8RO 2OYQA 1J5OA 5AQGA 3I8BA 3TU5A 5CY4A 4DCHA 3Q7CA 4R79A 4CHNA 4R5PA 4B1YB 3MXIA 1RTHA 3QDKA 1LV5A 4JS5A 4NCAA 3L3VA 4BRIA 3IG1A 4DTMA 3TAGA 3O5BA 3ENHA 2GWKA 1B9DA 2HBLA 2P9IB 3SBTA 4X66K 3ITHA 1L3TA 5M1PA 3OS0A 5ADXH 1XMOK 2O8FB 1FKOA 1ZBIA 4X65K 5C2DA 2PYJA 4DF8A 4IG3A 4CVNE 3THVA 5ADXA 3UKUA 4RW9A 2VG6A 4FW1A 3V9SA 2JWKA 1CZBA 2JLEA 5KPRA 4YDUC 4CZHA 4C1NI 2FLOA 1DKGD 4I9LA 1RBSA 4B3OA 1S5JA 3AARA 3T3FA 3DLGA 2E2NA 1SV5A 3NBPA 4K8XA 3LP1A 3QEWA 2BUPA 3V9WA 1ITGA 3CCEN 4FJLA 5T7BA 1S22A 4CJQA 5M1OA 4CZMA 3VEWA 5CYQA 1IO2A 4FCYA 3NAEA 4YFUA 1EWQA 1GOAA 3J8AA 2D1KA 3DM2A 3UKRB 1NKEA 4DV6K 5F0XA 3PV8A 3ULEA 3VQQA 4AF1A 1SZ2A 3SUQA 2KFZA 4CIEA 4JD2B 1T7PA 1JCGA 1KAYA 4BR4A 3OYFA 4KB0A 4HTUA 2ZJRL 1BUPA 2I7NA 1NKCA 1TL3A 1W2BM 1T44A 5AQZA 2UXDK 4WYBA 3CJ1A 4NXNK 3SV3A 4A5BA 3DOKA 1XMQK 4F3OA 4Q5VA 1O1WA 1OVYA 3I0SA 4KTZA 2FC0A 4LF8K 1NGGA 2QWLA 1JKHA 3QIPA 1S72N 4C8LA 3CERA 2YHXA 3DXKA 1C0GA 4CHZA 4FWSA 4NCGA 1JLQA 4CEBA 2HBKA 3HPHA 3KWIA 2RPIA 3RRHA 3ZT0A 4LSNA 2X6SA 5FPEA 5AQUA 4WF9L 3WQUA 2O4GA 4HCCA 1DT9A 1Y64A 1WOQA 4O8UA 2WFBA 2F4VK 1ZBFA 4CJKA 3FFKB 5K14A 2E20A 4OKKA 2DPNA 2E2OA 3Q7BA 2VGMA 2B6AA 4E7LA 3CFOA 5GAGP 3CCLN 1W9HA 2DFFA 5BN9A 3ZCMA 2CH5A 2G8FA 5EXWA 2OTLN 3H3NO 3LDPA 2E2QA 4BDPA 2YI1A 1BG3A 5CZ2A 3D6RA 4FVMA 5GAHP 4I7FA 4IOCL 4MFBA 1ILYA 3M8QA 1MA9B 4AHRA 3EKSA 2UUAK 2G8UA 4E19A 1X3MA 3I0RA 4B8CA 5SWMA 1I3AA 3R3LA 1DTQA 3VQ4A 3T69A 4PWDA 4JI8K 1LW0A 1RCHA 1NGFA 3EN9A 3ATUA 4XEIA 4HUGA 2UUCK 3BF3A 2KFNA 4DMNA 2ZD1A 4ELUA 1YVNA 4Q0BA 3AA5X 3NDKA 4K0KK 4JI6K 4FJKA 4JK8A 3BDPA 2E6LA 5B8HA 3J7YP 2ZWHA 5F1XA 5IT9O 2A1SA 2UYTA 1WSEA 3KWGA 3O3GA 2R7YA 1D9FA 3M8RA 3DLHA 4W5OA 1UWBA 3LDSA 3SPYA 1HNVA 1Y97A 2P5OA 1TVRA 4ILJA 3OS2A 1HPZA 4IO8A 4UY8O 4BWJA 3A2FA 4CJPA 1XI1A 4PKHA 4DTRA 2AJQA 2QWRA 1RDUA 1VRTA 1WSIA 2P9KB 3VA3A 3JSMA 1RTJA 4MO5A 1C1AA 1YXQA 4PKGA 3WNEA 3S3NA 4OPKA 3CC2N 4H5WA 4A2AA 3F9MA 3S3MA 1N32K 4A59A 3SPZA 5FROA 4FJHA 1VSMA 2VQFK 1RT1A 1VSEA 1S6QA 4Z0UA 3O9RA 4EZ6A 3HM8A 3NGYA 3WXMB 1NJXA 3ZT2A 4IO9L 4FLYA 3DLBA 3NH2A 5CYMA 3G25A 3L4QA 4E7HA 3EL2A 2BGGA 2Q0UA 4DTOA 5HROA 4DQPA 5KGWA 3O3FA 3ZYYX 4QS8A 4YHHK 2WONA 3EZWA 1A5WA 2IC3A 3MN6A 3LDLA 3C6TA 1J53A 3T1HK 1WSHA 1DLOA 3K5LA 4DFMA 3VERA 1HYVA 4DR6K 1RT5A 3WEEA 2HMPA 4FWMA 4ID5A 4O5FA 4L3QA 3R8EA 3DXMB 2IVPA 1LOTB 4JKGA 4I2PA 1N36K 2EWSA 4CGGA 1JXEA 3L4IA 3WXKA 5LL6Z 5HRPA 3L2RA 3T1AA 4B9LA 3NGIA 2FBVA 4PQUA 4PA1A 5H1SQ 4U67L 3HK2A 3M3ZA 4B08A 1HPMA 1KAXA 5AZJA 4Z94A 1NNEA 2VYPA 5KGXA 4F3TA 1KFDA 4OX9K 1HQUA 4WE1A 3ZSZA 4CZKA 3HRGA 3DLKA 5E84A 2HF3A 4DB3A 4OPJA 3KLEA 4CGIA 3I56N 4BRKA 4CJ3A 4GV3A 5AQJA 2HHQA 3KTQA 3O4NA 1TK0A 4AM6A 4ISEA 4B3TK 3MWPA 1UA1A 2FF3B 1SQKA 2P1JA 3QICA 4PUOA 1NLVA 2GEMA 4NYFA 4B1UB 3D2FA 4CJTA 3QEXA 3ZT1A 1HNIA 5HP1A 1GLCG 1XNQK 5JS1A 3BUZB 4FLTA 3AO4A 3JXUA 3AVKA 5C24A 3ULDA 2HMIA 4OO1J 4XH4A 4DF4A 3BZCA 3MXMA 1KD1O 3KVGA 3V1OA 4GV9A 4CW7B 1U6ZA 4A61A 3LZIA 4FJNA 3CPWM 4PL8A 3U3YA 3SUOA 4CGFA 4OJRA 1D5AA 3H6EA 4DTJA 3LL3A 3VENA 1S9GA 4Z4EA 2XY7A 5EOYA 3CMAN 4DU4A 4OKEA 1T03A 4JN4A 2YNGA 2H3GX 4DUZK 4KTWA 2HHHK 5J1EA 1BDGA 3NFAA 3AO3A 4OKJA 2YV0X 1CLQA 3HP9A 2I5JA 3DMJA 2F9WA 1CZ9A 4CK1A 3CQ8A 1IKVA 5DK5A 3TAPA 2Q36A 2QTDA 4CFDA 2HHXA 1HNZK 5CR4A 3SI6A 4C8NA 4IEEA 1IG9A 3DYAA 1BWFO 4YOTA 3TAFA 4EIAA 4M42A 1NK9A 3IUCA 3DRSA 2AP1A 2YNIA 3D7EO 4DV5K 3UB5A 3KIOA 2HF4A 3VGLA 1KLNA 2HHUA 4CBXA 4DR5K 4H0VB 3AAPA 2Q0RA 4A2BA 4CHYA 2CGJA 2HNYA 4B9TA 3L0QA 3S3OA 4CJLA 5A2QO 1WSJA 1TYQA 3ASMA 3AVMA 2D0BA 3S41A 1HQEA 1NOZA 4HWIA 5E26A 3ZSYA 3RMBA 3TPQA 3ULEB 1WSGA 4WFBL 3FZKA 3IFRA 2DFEA 3O8MA 3OYCA 4DTUA 4B9VA 2G8VA 2IS3A 3P5JA 3P39A 1HJOA 1LAVA 3NF9A 1ATRA 2HBJA 2KLAA 1KCFA 1BI4B 2BDPA 5GAEP 3CC4N 4XH1A 4NXMK 1RT4A 4BRPA 5JICA 1KQSM 4OVLA 4B3SK 2G8HA 1IG8A 3VQCA 4FWNA 3M8SA 3THXA 4CK2A 2Q1NA 5AJ3K 3G0ZA 5HL7L 3AGRA 1L3VA 4IFVA 3WXJA 4WFNL 5DMRA 4CJFA 3H45C 3MCPA 3UE5A 4C8OA 5LMNK 1WN7A 3D2EA 4KHSA 2X6NA 4E7JA 2VQEK 3OYGA 3QO9A 4AHTA 1BISA 4BG8A 4KH6A 1K9MO 4BR0A 4NLCA 4KHUA 3NE6A 3E9LA 4FXDA 4DV2K 3ZSRA 3S9HA 1RDBA 2O8CB 3ISNC 4F9OA 3K0SA 5I42A 3LPUA 4FWPA 3FR0A 3BY5A 4IEIA 2FXUA 3TSPA 3VQ6A 4GW6A 2DY4A 4FPBA 5LY3A 4JKHA 1SKSA 2ITMA 1NG9A 5AQYA 1MDUB 1C1BA 1I39A 1VSDA 3RR8A 2B4JA 2WTUA 1HX1A 4FLXA 1EXQA 2A42A 4CEZA 3DI6A 4A62A 3E66A 5AQRA 3VF4A 5HRRA 4E3SA 1J54A 4FJ7A 5E41A 2I7PA 3DRPA 2FBTA 2QWQA 4IOAL 3AVCA 3O1WA 5LJVA 4JNEA 3QEIA 3FZMA 4F8RA 4BC2A 1TKDA 3N4PA 2P9NB 1NGEA 3M6GA 1CXQA 2YCHA 4JKEA 3VQPA 4IOXA 3HOTA 3VESA 2YX6A 3SAHA 3CCQN 5C0YA 4LH4A 4JKCA 2QKBA 3CFRA 3OBWA 4JI1K 3PO4A 3EE8A 3P4IA 4CZEA 3SAGA 5BPLA 5BPNA 3VQ9A 3CCJN 4BE2A 1RT7A 3CM6A 5J2QA 2B5JA 3DOLA 1JLFA 1BGXT 1T6CA 2YKMA 3OYNA 2O8DB 3P1GA 3DAWA 1XHZA 3B6OA 2W6KA 4BR7A 4BREA 5EY4A 4FJXA 4K43A 2JGUA 4KV8A 2PBDA 4JK7A 1VSKA 4K41A 1VQLN 5C25A 5AQTA 3QERA 3IDHA 2HVHA 2E4LA 3O9TA 3TTFA 4KHPK 4ICLA 3E1YA 4IFYA 1BHLA 1VQNN 4CEEA 1YT3A 3RRGA 1HNWK 2Z1JA 3LDQA 4IJAA 2HB5A 4EAHD 4YORA 2RKIA 4LF7K 1NMNA 4BRMA 1ASUA 3BZKA 4WFAL 2KQ2A 1Z6RA 3G6EN 3N4QA 2QXLA 2ZF5O 3QFPA 4YDUA 4BQZA 4Y1DA 2O8EB 1VQ9N 1Z05A 2VWJA 2QWNA 3BF1A 2E5LK 1NMDA 3TWHA 1RILA 2KZZA 2WOMA 4DQRA 4H0YB 5AQMA 3K2PA 2YHAA 1Z26A 2EHGA 1XWLA 3GOIA 1KTQA 3HSCA 1U2VA 1JLBA 4EFHA 4CGDA 3CCVN 3LWMA 3KD5E 4BVPA 1XC3A 4JHDA 4H4MA 1WBBA 4DTNA 4JLHA 3LP2A 3C6AA 4J2AA 4O55A 3RMCA 2ETJA 3NVKA 3OS1A 3M5RA 3U8XA 4IG0A 3V9UA 1C0UA 4LF4K 1N33K 4DSLA 2XRIA 3C6UA 4FWKA 3HSTB 1NGHA 4CJ7A 4KREA 4RW6A 1TUYA 5AQSA 5DM6L 1T8EA 2VG7A 3LZJA 4FLUA 3IRXA 4LFCK 4PKIA 5AZIA 1DTTA 2Z1HA 4IFEA 3OYLA 4FOIA 3KLGA 1WSFA 2P9UA 3WNHA 3K9JA 3KLFA 3CG7A 1RTIA 4CJ5A 3K5NA 1SUQA 4EHTA 1JLCA 5BR9A 2HVIA 4JKDA 3DLLL 2Q31A 1G99A 1VSHA 1HKGA 3J81O 3V81A 2HBMA 5GIPA 1K6YA 1NJIO 3FGUA 4K42A 3CI5A 5MLCQ 1ATNA 1XUPO 2P9SA 4MDAA 1NGDA 5HRSA 4BROA 3TI0A 1N34K 4IWVA 4A5AA 2XY8A 4E0DA 1YIJN 1EO1A 2QI2A 4U7BA 2Q2RA 4DS4A 1QQMA 4H0TB 3AVBA 5FRNA 4DQIA 3ID6A 4JI3K 1TKXA 3OJSA 5JVGL 4B1XB 4CF8A 5J2MA 3KKRA 1D4XA 2CGLA 3TABA 3WXIA 4KPYA 4NO7A 4FK4A 4DWIA 3NHGA 2ZQBA 5KQ8A 2VGNA 2O8BA 1MWKA 4LFBK 1GLLO 1TUUA 2FBYA 1YTUA 3QEVA 5AQHA 3EY1A 3I8DA 2GUIA 4BRQA 2HNDA 4LC9B 1UA0A 1NGAA 3C65A 5BRHA 2F9TA 3A8YA 4GMJB 3OYEA 4BACA 4E7KA 2X78A 3QB0A 4CEAA 1VQ8N 2NRXA 4C8KA 1Q18A 1TKTA 3THYB 4JI7K 1EQYA 1HYZA 3C94A 2NRWA 1X1PA 4CF1A 3O08A 4DTPA 3SQ2A 3HOSA 3RMDA 3CF5L 1XHXA 1C1CA 3ZETB 1QS4A 4G9ZA 2DTUA 1BIZA 4FVUA 1VQMN 1VQ7N 1HKCA 3ALYA 4M63C 2NRTA 1FK9A 3JYTA 4B9SA 4DLGA 4K8ZA 4KFBA 5C15A 1IV0A 1VAZA 5AQVA 3G71N 2QM1A 5I3UA 3VF6A 5KQDA 2PFUA 2NRHA 1ATSA 1NK4A 4DR1K 2HHWA 2P9PA 1EP4A 3QFUA 2F8SA 3UIQA 5TKWA 5FRMA 4OLAA 4FWLA 3HP6A 2QW9A 3E9PA 5CHIA 4RG8A 3QBXA 2BANA 4NB4A 4CD3A 3QIOA 4BE1A 1X9SA 3R6MA 4FJJA 4JYAK 1SS6A 4AHVA 3PO5A 1D8YA 4I6MA 1K8KB 1VK0A 1TAQA 4CHPA 2HNZA 3ZSQA 2HOEA 3GG4A 3J80O 4O8KA 3T19A 4KAZA 2P9IA 4A57A 1VSIA 1X3NA 1LWEA 2O8FA 3AGKA 3OYIA 3LALA 2OPRA 4M7XA 3CYMA 1FW6A 2ZE2A 3SQ1A 1NBWA 2IOCA 4H0OA 2ASMA 3O3HA 5JLFA 2OPPA 1O13A 1YJNN 4JV5K 1OH8A 2NZTA 2GWJA 4CI6A 1G15A 3PSIA 1Q86O 1RBUA 3IKMA 3VEVA 4BRFA 3LPTA 3F2KA 2W41A 4EHUA 2UU9K 3VTIA 3LWLA 3SCXA 1TAUA 2ZGYA 3VGMA 1BO5O 2D0OA 2IIRA 5BN8A 3LM9A 3J7ZO 4FPAA 3SZ2A 4DFPA 1RT6A 1VSLA 4DSEA 3AVJA 2OZSA 4J2BA 1EETA 3OJUA 1N6QA 3HO1A 3UKRA 3O9QA 3ZEUB 4B9MA 3K57A 2ASOA 1RBTA 3HI0A 3ENBA 4CZFA 1D9DA 4CZJA 4JD2A 3AY9A 4BR9A 4ISGA 1L5UA 3QNNA 2NLXA 3MECA 4KTQA 1FKPA 1ASWA 3THWB 2GX9A 1V4SA 5ELZA 3PX6A 4KHWA 4FJ9A 3R9PA 3VGKA 4FK0A 2ZGZA 3HPGA 4DTSA 4BRGA 1RBRA 4ISFA 4WQ4C 2OPQA 3RSEB 4Z4FA 1HRHA 5KTQA 3SMSA 2NUBA 1LAWA 3QBWA 3CQXA 4WQ4A 1HNXK 1BU6O 3OTOK 5FPNA 1U47A 5J2NA 3O9UA 1GLBG 4DKWA 1KFSA 2A41A 3CXCM 1NWKA 3DRRA 4KHNA 5BR8K 4GVEA 4O4GA 1IBKK 3DLRA 3L8BA 5CZ1A 4CIFA 1X9WA 4J8FA 4JI0K 3PIPL 3ZSOA 1HJRA 5LJWA 2XHBA 3OYAA 4JK9A 4KB1A 1TL1A 3LM2A 4CGHA 2QWOA 4CBUA 1NOYA 1C0TA 3FE1A 5KRTA 2E2PA 3UKUB 3QEPA 1GLEG 1CZAN 3MN9A 3PX0A 1JLGA 4N41A 4JEPA 3B6PA 3CCMN 3GE1A 4DQ8A 3PX4A 3ATVA 2ZM6K 2VWKA 1Q7YO 4HHTA 3QINA 3VQDA 1P90A 1QZ6A 3IMXA 5I9EB 3HVTA 3KLHA 4DUYK 1KLMA 1BOTO 3FZHA 3OHRA 1VQON 3VQAA 3CM5A 4CIGA 2PYLA 4BDZA 4FLZA 3SQ4A 4CFCA 3ZT3A 1JCEA 4FWQA 3SUNA 1T6DA 3K59A 4JRQA 1IBLK 5AQLA 4LF6K 2OZMA 2OA8A 1HLUA 1ASVA 4AM7A 4M3UA 3MEDA 2W40A 4CK3A 1LW2A 3BGRA 3V9ZA 4DQQA 1VQ4N 1NJYA 4YOVA 3TTCA 4BRNA 2G8KA 3CMEN 5JLHA 1HR0K 2KZMA 1YITN 3TSQA 3V4IA 5BRFA 3SQ0A 3HZ6A 1WB9A 4DS5A 4RW4A 3QETA
chains in the Genus database with same CATH topology
4FO0A 4FWRA 1VQNN 3D6RA 5GAHP 3ID8A 3H1VX 4Y0WA 4IOCL 1ILYA 2P9KA 1MA9B 3H46O 3EKSA 3LDQA 4IJAA 3WUHA 1X3MA 1DEJA 3NVMA 4YORA 3R3LA 4EAHD 1GLDG 4BRMA 3DXKB 3T69A 2FSNA 1H1VA 2IVOA 4RWTA 4WFAL 5AFUH 3CJ7A 3R1XA 1Q82O 3MX5A 2OTJN 1NGFA 1Z6RA 1T3VA 2E88A 3G6EN 3EN9A 3ATUA 3N4QA 2QXLA 2ZF5O 3CPEA 4NLBA 4XEIA 5AFUA 3BF3A 3QFPA 3P38A 2F7TA 4YDUA 4BQZA 3CCRN 1YVNA 5M1KA 1VQ9N 1Z05A 2QWNA 3BF1A 3NMUA 1NMDA 4PL7A 1NGIA 1W97L 4RCHA 1JCFA 4OPAA 4H0YB 5AQMA 1JJ2M 4JK8A 1E4FT 1GLAG 2FSKA 3BP8A 3GOIA 4JKBA 3HSCA 2ZWHA 1U2VA 2A5XA 4BC5A 4BRLA 4EFHA 5B8HA 2UYTA 5F1XA 3CCVN 1K73O 1GLFO 3HBTA 3KWGA 1P8ZA 3O80A 1XC3A 4JHDA 4BVPA 5C10A 5GINA 1NM1A 3VOVA 4YOWA 3O4WA 3C6AA 3NVKA 3M5RA 3U8XA 4BC4A 4ILJA 3EKUA 2NNWA 3ZX2A 5CE3A 4FWKA 1NGHA 4IO8A 1BA1A 2GTDA 4CJ7A 5AQSA 1TUYA 5C12A 3CIPA 3WQTA 5DM6L 4UY8O 4GV6A 1YUWA 4PKHA 3PLAA 2QWRA 4C23A 1RDUA 1LCUA 2P9KB 4BGAA 4PKIA 5AZIA 4IFEA 2D4WA 4MO5A 4BRDA 3SLCA 4FOIA 2P9UA 3TSUA 4H0PA 1YXQA 3K9JA 4PKGA 3CC2N 4H5WA 3DXMA 3AAQA 4A2AA 3F9MA 4EHTA 5BR9A 3M1FA 1XQSC 4A59A 4JKDA 1M90O 3DLLL 2Q31A 1J6ZA 3OW2M 1G99A 1YAGA 1HKGA 3VEYA 2HBMA 5GIPA 3O9RA 3VF2A 3HM8A 1NJIO 3FGUA 3WXMB 4K42A 3CI5A 5MLCQ 3MN5A 1X9JA 4IO9L 1ATNA 2QEXN 1U2VB 2ASPA 4XH5A 1XUPO 3VMFB 2P9SA 3G25A 3L4QA 3EL2A 4H03B 4JHDB 2WBNA 2JWLA 3DJCA 4MDAA 4B1ZA 2Q0UA 1NGDA 4IJNA 1C0FA 5AQPA 4BROA 3ENOA 3ZYYX 4QS8A 3EZWA 4IWVA 5F2RA 4A5AA 3CHWA 2RHKA 2V7YA 2NRRA 1YIJN 3MN6A 4CZIA 1V4TA 1EO1A 2QI2A 3LDLA 4FWOA 4U7BA 5JVHL 2Q2RA 3CCSN 3LDNA 1QQMA 3A5OC 4H0TB 1SAZA 3ZETA 1HKBA 3VERA 1VQPN 3EE9A 3KK7A 5AZIB 3ID6A 3J7ZO 3WEEA 2HMPA 4FWMA 5JVGL 4O5FA 4L3QA 4B1XB 1D4XA 3H1QA 4MLHA 2P9UB 2CGLA 3MK6A 3R8EA 3WXIA 3HTVA 4NO7A 3DXMB 2QWMA 4CZGA 2IVPA 1LOTB 4JKGA 2EWSA 3WXKA 3L4IA 4RTFD 5KQ8A 2VGNA 5EVZA 5EX5A 2ZJQL 1MWKA 3CETA 1GLLO 1TUUA 2P9LB 5H1SQ 5AQHA 1RFQA 2E1ZA 4I6MB 4U67L 1KXPA 2OANA 4YOXA 3MWTA 3M3ZA 5BPMA 4BRQA 3MDQA 3DWLA 1KAZA 1HPMA 1E4GT 1KAXA 4LC9B 2YHYA 4Z94A 5AZJA 4QS9A 1NGAA 3C65A 2VYPA 5BRHA 4BR2A 2P9SB 2F9TA 3A8YA 3F5TA 1NGJA 3OA9A 2VWBA 3I33A 4BRHA 4H5NA 3QB0A 5AQQA 1VQ8N 4CZKA 1VQ5N 3CC7N 5HOOA 5AQKA 1VQ6N 3HRGA 2NRXA 5E84A 2HF3A 1Q18A 2KKZA 4M7YA 3ZX3A 4DB3A 3I56N 4BRKA 4GV3A 5AQJA 3FLCO 1EQYA 4MLEA 4AM6A 4ISEA 3MWPA 1YHQN 2NRWA 2V52B 1NGCA 2FF3B 3O08A 1SQKA 3I55N 1K8AO 3HOSA 3VGMA 3QICA 3CF5L 1K8KA 1NLVA 2GEMA 2WC9A 4KBOA 3ZETB 4B1UB 3D2FA 1YJWN 4G9ZA 5BREA 3U4LA 3A5MC 3VEOA 4K25A 3WEEB 4CD1A 3CD6N 4BC3A 3W3DA 2QA4N 1VQKN 1IJJA 4FVUA 1GLCG 5FPMA 1ZXOA 3L6QA 1VQMN 1VQ7N 2V51B 1HKCA 3BUZB 3T7ZA 4M63C 3JXUA 4CZLA 4CBWA 4MDBA 4JKGB 2NRTA 1MWMA 2J4RA 2E8AA 3KHYA 3ZX0A 4YOYA 4OO1J 4GY2B 1QQOA 4XH4A 4KH4A 4QS7A 1KD1O 5C15A 1VAZA 5AQVA 3KVGA 4GV9A 3G71N 1U6ZA 4A61A 2QM1A 1Q81O 3CPWM 4BY9C 3VF6A 5KQDA 2PFUA 4PL8A 5AZJB 2NRHA 1ATSA 5DM7L 3H6EA 3LL3A 3VENA 2P9PA 3VEZA 2CGKA 2ZJPL 3QFUA 5EOYA 3CMAN 2RE2A 5TKWA 4FWLA 3BEXA 2QW9A 3E9PA 5CHIA 3K9KA 4FOEA 4ILHA 4JN4A 2QWPA 2WUSA 2H3GX 3GBTA 3QBXA 1R59O 2PAVA 4NB4A 1QVGM 1BDGA 4CD3A 3MN7A 5AQXA 3R6MA 4JKAA 1YI2N 1SS6A 3O6WA 4FL9A 2GELA 2P9LA 2A40A 4I6MA 3CJ9A 2F9WA 1DGKN 1K8KB 3FZLA 4IDHA 2Q36A 2QTDA 3D2FB 2BTFA 1HUXA 3ZEUA 2HOEA 3GG4A 5CR4A 4KH5A 5C2FA 3KZBA 2AA4A 4O8KA 1QQNA 3SK3A 4IEEA 4IXCA 2P9IA 3OBYA 1YF5L 4A57A 1BWFO 1X3NA 4YOTA 4BG9A 4EIAA 5M1NA 3U9DA 3IUCA 2AP1A 3D7EO 3UB5A 4E1JA 3AGKA 2HF4A 3VGLA 3C7NB 4CBXA 1QVFM 4H0VB 3AAPA 2Q0RA 4M7XA 4A2BA 3MX2A 2YJEA 2CGJA 3O9SA 3CJBA 3RVCA 3W0LA 3MCAB 1NBWA 3LDOA 5AQGA 4BRCA 3GDQA 5AQNA 3L0QA 2ASMA 4H0OA 3JS6A 5TKYA 3MMVA 2FSJA 3SBGA 5JLFA 1TYQA 1O13A 2Q97A 3CCUN 1YJNN 3RSEA 2P9PB 3A5LC 2NZTA 3S41A 2FF6A 2GWJA 4CI6A 1S3XA 4HWIA 3WT0A 3WXLA 5E26A 1Q86O 5KPZA 3IKMA 5AQWA 3TPQA 3ULEB 3FZFA 3VEVA 4WFBL 1RDWX 3B8AX 3FZKA 3IFRA 3F2KA 3EO3A 4BRFA 3O8MA 5M1FA 3O1BA 3P31A 2W41A 4EHUA 3P39A 3VTIA 1N8RO 1HJOA 2ZGYA 1BO5O 2D0OA 2IIRA 3I8BA 1ATRA 2HBJA 2KLAA 3LM9A 3Q7CA 4FPAA 3TU5A 3TTDA 4DCHA 5BN8A 4R79A 3A5NC 4B1YB 3A0IX 3QDKA 5GAEP 3G4SN 3CQYA 3SMPA 3CC4N 4XH1A 4BRIA 4BRPA 5JICA 1KQSM 3UKRA 3O5BA 3O9QA 3VETA 3ZEUB 3ENHA 1QZ5A 1IG8A 3U9ZA 2ASOA 4FWNA 3HI0A 2GWKA 1ESVA 2HBLA 2P9IB 3ENBA 3SBTA 2IVNA 5M1PA 4CZFA 4CZJA 4JD2A 3AY9A 4BR9A 4ISGA 5ADXH 2Q1NA 2NLXA 2HSTA 2YHWA 5HL7L 3AGRA 3VTHA 5C2DA 4IZ9A 4OPHA 3WXJA 2E1YA 5ADXA 4WFNL 3UKUA 2GX9A 1NGBA 1V4SA 3H45C 5ELZA 2JWKA 3MCPA 5KPRA 4YDUC 3R9PA 3UE5A 3VGKA 4H5VA 4CZHA 2ZGZA 3D2EA 4H5RA 4BRGA 3H3OB 4ISFA 4C1NI 5KPTA 1TYQB 2FLOA 4WQ4C 1DKGD 3RSEB 3AARA 2E2NA 5AQOA 4JAXA 3SMSA 3QBWA 4BG8A 4KH6A 1K9MO 2BUPA 4BR0A 4B1WB 3CQXA 4NLCA 4WQ4A 3SJHA 1S22A 2CH6A 3CCEN 1BU6O 3C7NA 3E9LA 1OKJA 2P9NA 2A3ZA 5FPNA 5M1OA 3O9UA 1GLBG 4CZMA 4DKWA 2A41A 1YJ9N 3VEWA 4H0XB 3CXCM 3C0BA 4F9OA 1NWKA 1QHAA 4GVEA 3J8AA 3E9OA 4FWPA 3FR0A 2D1KA 4IEIA 2A6AA 2FXUA 4J8FA 3UKRB 3PIPL 3GL1A 3TSPA 5LJWA 4PHTX 5F0XA 3PIOL 2VCPA 4BGBA 1ZC6A 3ULEA 4JK9A 4FPBA 4AF1A 1SZ2A 5LY3A 4JKHA 2ITMA 4JD2B 4YOUA 1JCGA 3LM2A 5AQYA 2NRZA 1MDUB 1GLJO 1KAYA 1WUAA 2QWOA 4BR4A 4CBUA 1M1KO 4HTLA 1ZBSA 2NRVA 4B9QA 3FE1A 1HX1A 2E2PA 3UKUB 1RGIA 2A42A 1GLEG 4A62A 2ZJRL 2KHOA 3E66A 1CZAN 1BUPA 3MN9A 5AQRA 3VF4A 4JEPA 5AQIA 2I7NA 4WCEL 3VPZA 3D2EB 4BQLA 3CCMN 3GE1A 2I7PA 4DQ8A 1W2BM 2QWQA 1T44A 2GUPA 4ILGB 5AQZA 3ATVA 4WYBA 3VEXA 4IOAL 1Q7YO 3CJ1A 3O1WA 5LJVA 4DHYA 4A5BA 4JNEA 3C6HA 3FZMA 4B1VA 1P90A 4BC2A 1QZ6A 5JMVA 3IMXA 5AR0A 5I9EB 1OVYA 3N4PA 5M1QA 2P9NB 1NGGA 1NGEA 3M6GA 1KC8O 1BOTO 3FZHA 2QWLA 3OHRA 2YCHA 1VQON 1S72N 3CERA 4JKEA 2YHXA 3DXKA 1C0GA 5BRDA 4FWSA 4IOXA 2D0PA 3HOTA 3VESA 2YX6A 3SAHA 2HBKA 3CCQN 5C0YA 1JCEA 3KWIA 4FWQA 4MO4A 4JKCA 1T6DA 3QMLA 3OBWA 2YJFA 4BRAA 5FPEA 5AQUA 4WF9L 3EE8A 3P4IA 4CZEA 3SAGA 5AQLA 5BPLA 2BH1A 3WQUA 5BPNA 3CCJN 1HLUA 4AM7A 1DT9A 1Y64A 1WOQA 4JKFA 2W40A 4O8UA 2WFBA 3FFKB 4FSVA 2E20A 5GADP 1VQ4N 1T6CA 5AQFA 4WQ5C 4H5TA 3CJAA 4YOVA 3TTCA 2DPNA 4BRNA 3CMEN 2E2OA 3DAWA 3Q7BA 4BR5A 5JLHA 3CJCA 2VGMA 4BR7A 4BREA 5EY4A 1BA0A 4K43A 1YITN 3TSQA 5GAGP 3CCLN 5BRFA 5GIOA 2PBDA 4JK7A 3HZ6A 2V7ZA 5BN9A 4WQ5A 4K41A 1VQLN 5AQTA 4GNIA 2CH5A 3IDHA 4BVOA 5EXWA 4C1NK 3O9TA 3TTFA 2OTLN 3H3NO 3LDPA 2E2QA 3SAFA 3E1YA 2YI1A 5FPDA 1BG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FO0 A;  4FWR A;  3ID8 A;  3H1V X;  4Y0W A;  2P9K A;  1MA9 B;  3H46 O;  3EKS A;  3LDQ A;  4IJA A;  3WUH A;  1X3M A;  1DEJ A;  4EAH D;  1GLD G;  4BRM A;  3DXK B;  2FSN A;  1H1V A;  2IVO A;  4RWT A;  5AFU H;  3CJ7 A;  1NGF A;  1Z6R A;  2E88 A;  3EN9 A;  3ATU A;  2QXL A;  2ZF5 O;  4XEI A;  5AFU A;  3BF3 A;  3QFP A;  4YDU A;  4BQZ A;  1YVN A;  1Z05 A;  2QWN A;  3BF1 A;  1NMD A;  4PL7 A;  1NGI A;  4RCH A;  1JCF A;  4H0Y B;  5AQM A;  1E4F T;  1GLA G;  2FSK A;  3BP8 A;  3GOI A;  4BC5 A;  3HSC A;  2ZWH A;  1U2V A;  2A5X A;  4BRL A;  4EFH A;  5B8H A;  5F1X A;  2UYT A;  1GLF O;  3HBT A;  1P8Z A;  3O80 A;  1XC3 A;  4JHD A;  4BVP A;  1NM1 A;  3VOV A;  3O4W A;  3U8X A;  4BC4 A;  3EKU A;  3ZX2 A;  5CE3 A;  4FWK A;  1NGH A;  4IO8 A;  1BA1 A;  2GTD A;  4CJ7 A;  5AQS A;  1TUY A;  3CIP A;  3WQT A;  1YUW A;  4PKH A;  2QWR A;  4C23 A;  1LCU A;  2P9K B;  4BGA A;  4PKI A;  5AZI A;  2D4W A;  4MO5 A;  4BRD A;  3SLC A;  4FOI A;  2P9U A;  4H0P A;  1YXQ A;  4PKG A;  4H5W A;  3DXM A;  3AAQ A;  4A2A A;  3F9M A;  4EHT A;  5BR9 A;  3M1F A;  1XQS C;  2Q31 A;  1J6Z A;  1G99 A;  1YAG A;  1HKG A;  3VEY A;  3VF2 A;  3HM8 A;  3FGU A;  4K42 A;  3CI5 A;  3MN5 A;  1X9J A;  1ATN A;  1U2V B;  2ASP A;  4XH5 A;  1XUP O;  2P9S A;  3G25 A;  3EL2 A;  4H03 B;  4JHD B;  3DJC A;  4B1Z A;  2Q0U A;  1NGD A;  4IJN A;  1C0F A;  5AQP A;  4BRO A;  3ENO A;  4QS8 A;  3EZW A;  4IWV A;  5F2R A;  3CHW A;  2V7Y A;  3MN6 A;  4CZI A;  1V4T A;  3LDL A;  4FWO A;  2Q2R A;  3LDN A;  1QQM A;  3A5O C;  4H0T B;  1SAZ A;  3ZET A;  1HKB A;  3VER A;  5AZI B;  3WEE A;  2HMP A;  4FWM A;  4O5F A;  4L3Q A;  4B1X B;  1D4X A;  3H1Q A;  4MLH A;  2P9U B;  2CGL A;  3MK6 A;  3R8E A;  3WXI A;  3HTV A;  4NO7 A;  3DXM B;  2QWM A;  4CZG A;  2IVP A;  1LOT B;  2EWS A;  3WXK A;  3L4I A;  4RTF D;  5KQ8 A;  5EVZ A;  5EX5 A;  1MWK A;  3CET A;  1GLL O;  1TUU A;  2P9L B;  5AQH A;  1RFQ A;  2E1Z A;  4I6M B;  1KXP A;  2OAN A;  3M3Z A;  5BPM A;  4BRQ A;  3MDQ A;  3DWL A;  1KAZ A;  1HPM A;  1E4G T;  1KAX A;  4LC9 B;  2YHY A;  4Z94 A;  5AZJ A;  4QS9 A;  1NGA A;  5BRH A;  2VYP A;  4BR2 A;  2P9S B;  2F9T A;  3A8Y A;  1NGJ A;  2VWB A;  3I33 A;  4BRH A;  4H5N A;  3QB0 A;  5AQQ A;  4CZK A;  5AQK A;  5E84 A;  2HF3 A;  1Q18 A;  3ZX3 A;  4M7Y A;  4DB3 A;  4BRK A;  5AQJ A;  3FLC O;  1EQY A;  4MLE A;  4AM6 A;  4ISE A;  2FF3 B;  1NGC A;  2V52 B;  3O08 A;  1SQK A;  3QIC A;  1K8K A;  1NLV A;  2GEM A;  4KBO A;  3ZET B;  4B1U B;  3D2F A;  5BRE A;  3U4L A;  3A5M C;  3VEO A;  4K25 A;  3WEE B;  4CD1 A;  4BC3 A;  3W3D A;  1IJJ A;  1GLC G;  5FPM A;  1ZXO A;  3L6Q A;  2V51 B;  1HKC A;  3BUZ B;  4M63 C;  3JXU A;  4CZL A;  4CBW A;  1MWM A;  2J4R A;  2E8A A;  3KHY A;  3ZX0 A;  4GY2 B;  1QQO A;  4XH4 A;  4QS7 A;  5AQV A;  3KVG A;  1U6Z A;  4A61 A;  2QM1 A;  3VF6 A;  5KQD A;  4PL8 A;  5AZJ B;  2NRH A;  1ATS A;  3H6E A;  3LL3 A;  3VEN A;  2P9P A;  3VEZ A;  2CGK A;  3QFU A;  5EOY A;  4FWL A;  3BEX A;  2QW9 A;  4FOE A;  4JN4 A;  2QWP A;  2WUS A;  2H3G X;  3GBT A;  3QBX A;  1R59 O;  2PAV A;  4NB4 A;  1BDG A;  4CD3 A;  3MN7 A;  5AQX A;  3R6M A;  4FL9 A;  3O6W A;  2GEL A;  2P9L A;  2A40 A;  4I6M A;  3CJ9 A;  2F9W A;  1DGK N;  1K8K B;  3FZL A;  2Q36 A;  3D2F B;  2BTF A;  1HUX A;  3ZEU A;  2HOE A;  3GG4 A;  3KZB A;  2AA4 A;  4O8K A;  1QQN A;  3SK3 A;  4IXC A;  2P9I A;  1BWF O;  1X3N A;  4BG9 A;  4EIA A;  3U9D A;  3IUC A;  2AP1 A;  3D7E O;  3UB5 A;  4E1J A;  2HF4 A;  3VGL A;  3C7N B;  4CBX A;  4H0V B;  3AAP A;  2Q0R A;  4M7X A;  4A2B A;  2YJE A;  2CGJ A;  3CJB A;  3W0L A;  1NBW A;  3LDO A;  4BRC A;  3GDQ A;  5AQN A;  3L0Q A;  2ASM A;  4H0O A;  3JS6 A;  5TKY A;  3MMV A;  2FSJ A;  5JLF A;  1TYQ A;  2Q97 A;  3RSE A;  2P9P B;  3A5L C;  2NZT A;  3S41 A;  2FF6 A;  2GWJ A;  4CI6 A;  1S3X A;  4HWI A;  3WT0 A;  3WXL A;  5E26 A;  5KPZ A;  5AQW A;  3TPQ A;  3ULE B;  3FZF A;  3VEV A;  1RDW X;  3B8A X;  3FZK A;  3IFR A;  4BRF A;  3EO3 A;  3O8M A;  3O1B A;  2W41 A;  4EHU A;  1HJO A;  2ZGY A;  1BO5 O;  2D0O A;  2IIR A;  3I8B A;  1ATR A;  5AQG A;  3LM9 A;  3TU5 A;  4FPA A;  3VGM A;  4DCH A;  5BN8 A;  3A5N C;  4B1Y B;  3A0I X;  3QDK A;  3CQY A;  3SMP A;  4XH1 A;  4BRI A;  4BRP A;  5JIC A;  3UKR A;  3O5B A;  3VET A;  3ZEU B;  3ENH A;  1QZ5 A;  1IG8 A;  3U9Z A;  2ASO A;  4FWN A;  3HI0 A;  2GWK A;  1ESV A;  2P9I B;  2IVN A;  4CZF A;  4CZJ A;  4JD2 A;  3AY9 A;  4BR9 A;  4ISG A;  5ADX H;  2Q1N A;  2NLX A;  2YHW A;  4IZ9 A;  3WXJ A;  2E1Y A;  5ADX A;  3UKU A;  1NGB A;  1V4S A;  3H45 C;  5ELZ A;  3MCP A;  5KPR A;  4YDU C;  3R9P A;  3UE5 A;  3VGK A;  4H5V A;  4CZH A;  2ZGZ A;  3D2E A;  4H5R A;  4BRG A;  3H3O B;  4ISF A;  5KPT A;  1TYQ B;  2FLO A;  4WQ4 C;  1DKG D;  3RSE B;  3AAR A;  2E2N A;  5AQO A;  4JAX A;  3SMS A;  3QBW A;  4BG8 A;  2BUP A;  4BR0 A;  4B1W B;  3CQX A;  4WQ4 A;  3SJH A;  1S22 A;  2CH6 A;  1BU6 O;  3C7N A;  1OKJ A;  2P9N A;  2A3Z A;  5FPN A;  1GLB G;  4CZM A;  2A41 A;  3VEW A;  4H0X B;  3C0B A;  4F9O A;  1NWK A;  1QHA A;  3J8A A;  4FWP A;  3FR0 A;  2D1K A;  2A6A A;  2FXU A;  4J8F A;  3UKR B;  3GL1 A;  5LJW A;  5F0X A;  2VCP A;  4BGB A;  1ZC6 A;  3ULE A;  4FPB A;  1SZ2 A;  5LY3 A;  2ITM A;  4JD2 B;  1JCG A;  3LM2 A;  5AQY A;  1MDU B;  1GLJ O;  1KAY A;  1WUA A;  2QWO A;  4BR4 A;  4CBU A;  4HTL A;  1ZBS A;  4B9Q A;  3FE1 A;  1HX1 A;  2E2P A;  3UKU B;  1RGI A;  2A42 A;  1GLE G;  4A62 A;  2KHO A;  1CZA N;  1BUP A;  3MN9 A;  5AQR A;  3VF4 A;  5AQI A;  2I7N A;  3VPZ A;  3D2E B;  4BQL A;  3GE1 A;  2I7P A;  4DQ8 A;  2QWQ A;  1T44 A;  2GUP A;  5AQZ A;  3ATV A;  4WYB A;  3VEX A;  3CJ1 A;  3O1W A;  5LJV A;  4DHY A;  4JNE A;  3FZM A;  4B1V A;  4BC2 A;  1QZ6 A;  5JMV A;  3IMX A;  5AR0 A;  5I9E B;  2P9N B;  1NGG A;  1NGE A;  3M6G A;  1BOT O;  3FZH A;  2QWL A;  3OHR A;  2YCH A;  3CER A;  2YHX A;  3DXK A;  1C0G A;  5BRD A;  4FWS A;  2D0P A;  3VES A;  1JCE A;  4FWQ A;  4MO4 A;  1T6D A;  3QML A;  2YJF A;  4BRA A;  5FPE A;  5AQU A;  3P4I A;  4CZE A;  5AQL A;  5BPL A;  3WQU A;  5BPN A;  1HLU A;  4AM7 A;  1Y64 A;  1WOQ A;  2W40 A;  3FFK B;  4FSV A;  2E20 A;  1T6C A;  5AQF A;  4WQ5 C;  4H5T A;  3CJA A;  2DPN A;  4BRN A;  2E2O A;  3DAW A;  5JLH A;  4BR5 A;  3CJC A;  4BR7 A;  4BRE A;  5EY4 A;  1BA0 A;  4K43 A;  5BRF A;  2PBD A;  3HZ6 A;  2V7Z A;  5BN9 A;  4WQ5 A;  4K41 A;  5AQT A;  4GNI A;  2CH5 A;  3IDH A;  4BVO A;  5EXW A;  3H3N O;  3LDP A;  2E2Q A;  2YI1 A;  5FPD A;  1BG3 A; 
#chains in the Genus database with same CATH topology
 4C8M A;  4FO0 A;  4Y0W A;  2P9K A;  3WUH A;  1TK5 A;  3NVM A;  1RT2 A;  3DXK B;  2IVO A;  1EX4 A;  1Q82 O;  3MX5 A;  3L2W A;  4W5R A;  1QTM A;  1IKW A;  3CPE A;  4NLB A;  1SKR A;  4EP5 A;  3P38 A;  2F7T A;  1QSY A;  3CCR N;  3NCI A;  4Y1C A;  5M1K A;  4E1M A;  2Z1I A;  1Q9Y A;  1JJ2 M;  4GVM A;  2FSK A;  4BC5 A;  2QA4 N;  4CHQ A;  1K73 O;  2Y1J A;  1GLF O;  3HBT A;  1P8Z A;  1KVC A;  3O80 A;  4FLV A;  5GIN A;  4CE9 A;  4YOW A;  3HXM A;  4ID1 A;  4LSL A;  4CF0 A;  2E6M A;  1LWF A;  3EKU A;  1R0A A;  2NNW A;  3VQ8 A;  2YHB A;  5C12 A;  4GV6 A;  1BQM A;  4QCL A;  3NH1 A;  4B9N A;  3PLA A;  4C23 A;  1WAJ A;  1LCU A;  1OH7 A;  3K5O A;  4KHQ A;  4BGA A;  2Z1G A;  2D4W A;  4RW8 A;  1RTD A;  3SLC A;  4Z4I A;  3TSU A;  3OVN A;  4H0P A;  5KI6 A;  3K58 A;  1NK5 A;  3NGZ A;  3DXM A;  5HLF A;  3L2U A;  4CES A;  3OW2 M;  1J6Z A;  3NF7 A;  3ZT4 A;  4XIU A;  4V19 S;  4ZHR A;  1I94 K;  4AIL C;  1UOC A;  2ASP A;  4XH5 A;  4FJ8 A;  3SNN A;  3MAQ A;  3LP3 A;  2W6L A;  3RMA A;  4LH5 A;  2JWL A;  1JLE A;  3VA0 A;  4IJN A;  1VHX A;  1C0F A;  2F96 A;  5AQP A;  2HHT A;  1OVQ A;  4M3Y A;  3WNG A;  4CJV A;  5F2R A;  1F21 A;  2V7Y A;  2NRR A;  3HL8 A;  4UQG A;  4CZI A;  1V4T A;  2W42 A;  4FWO A;  5JVH L;  4DV4 K;  3CCS N;  3OYM A;  1IKY A;  4X64 K;  1TGO A;  4FZY A;  1SAZ A;  4PY5 A;  4JRP A;  1VQP N;  2RN2 A;  3EE9 A;  1BCO A;  3PY8 A;  1RBV A;  3H1Q A;  4MLH A;  4FJG A;  3KK1 A;  2HW3 A;  3MK6 A;  2LSN A;  3HTV A;  4E7I A;  1YTA A;  2PZS A;  2A1R A;  1LWC A;  4KRF A;  4YY3 K;  4CJR A;  4CEF A;  1BL3 A;  4DFJ A;  4FK2 A;  1RFQ A;  4I6M B;  2G8I A;  2OAN A;  4YOX A;  3MWT A;  2YNH A;  3TAQ A;  3AVN A;  1E4G T;  2XY6 A;  4QS9 A;  4FM1 A;  3F5T A;  4AQY K;  1NGJ A;  2VWB A;  4AH9 A;  1OH5 A;  5AQQ A;  1NKB A;  3CC7 N;  1VQ5 N;  1VQ6 N;  5HOO A;  2VG5 A;  4M7Y A;  1MU2 A;  4W5N A;  4NYN A;  3I55 N;  1J9A A;  1CXU A;  4DG1 A;  4F4K A;  2WC9 A;  4OLB A;  4N5S A;  2Y1I A;  4ELT A;  3A5M C;  3QNO A;  3WEE B;  3CD6 N;  4BC3 A;  3W3D A;  3EYZ A;  5FPM A;  1SKW A;  3L6Q A;  4LFA K;  2IGI A;  2O4I A;  3T7Z A;  1S1W A;  4N47 A;  1KRP A;  4MDB A;  1TV6 A;  4JKG B;  4Z4G A;  1MWM A;  3F9K A;  2E8A A;  3ZX0 A;  1HYS A;  4GY2 B;  1QQO A;  4H8K A;  3OYD A;  4RW7 A;  1Q81 O;  4BY9 C;  3HYF A;  2KW4 A;  5AZJ B;  5DM7 L;  4FZX C;  1UAX A;  3KJV A;  2CGK A;  3NF8 A;  2ZJP L;  2X74 A;  2RE2 A;  1NU0 A;  3BEX A;  4FOE A;  4ILH A;  2QWP A;  3GBT A;  1R59 O;  2PAV A;  1QSS A;  5AQX A;  1E3M A;  4FL9 A;  3O6W A;  3KLI A;  3SUP A;  4GKJ K;  2GEL A;  2P9L A;  2YNF A;  1BI4 A;  3ZSX A;  2A40 A;  3KD1 E;  4CER A;  4EP4 A;  3V1Q A;  1DGK N;  4IDH A;  3D2F B;  1HUX A;  4KH5 A;  3RTV A;  1QQN A;  3HM9 A;  1RDA A;  3OBY A;  4BG9 A;  3U9D A;  4DR4 K;  4E1J A;  4CFB A;  3KK3 A;  1KVA A;  4BDY A;  1QVF M;  2YJE A;  3MXJ A;  3RVC A;  4HUE A;  3MCA B;  4LD0 A;  4BRC A;  3JS6 A;  5TKY A;  3MMV A;  1S9E A;  2FSJ A;  4E89 A;  3AA2 A;  3IS9 A;  2FF6 A;  4FJM A;  3WXL A;  3WT0 A;  5AQW A;  2IDO A;  1RDW X;  3TAM A;  3AO1 A;  2G8W A;  3O1B A;  3VQ7 A;  4E1N A;  4O0J A;  1NK7 A;  1TK8 A;  4CGJ A;  3TTD A;  1W7A A;  1B92 A;  3A5N C;  2O8C A;  2P5G A;  3A0I X;  3CQY A;  3SMP A;  1S1X A;  2OPS A;  1RNH A;  3H08 A;  4AHC A;  3VET A;  2HHS A;  4W5T A;  1QZ5 A;  3U9Z A;  5D3G A;  4YNQ A;  1ESV A;  2IVN A;  3QES A;  2HST A;  2YHW A;  4FLW A;  3VTH A;  4IZ9 A;  4CEO A;  4OPH A;  4DV7 K;  2E1Y A;  2QK9 A;  5C42 A;  1NGB A;  2ATQ A;  3AVA A;  3VN5 A;  4DV1 K;  4H5V A;  3L3U A;  1VRU A;  1SL2 A;  2UUB K;  4H5R A;  1W0H A;  3H3O B;  1NK6 A;  5KPT A;  1TYQ B;  1C0M A;  2IAJ A;  5AQO A;  4JAX A;  4F2S A;  4CEQ A;  1JL1 A;  3L2Q A;  2XO7 A;  4CF9 A;  1OH6 A;  4KHY A;  4B1W B;  3SJH A;  2CH6 A;  3C7N A;  3AO5 A;  1OKJ A;  1JXB A;  2P9N A;  2A3Z A;  1NK0 A;  1YJ9 N;  4H0X B;  3C0B A;  1QHA A;  3VQB A;  1REV A;  3E9O A;  3SV4 A;  1S1U A;  2A6A A;  2Q3S A;  5JS2 A;  3GL1 A;  4PHT X;  3PIO L;  2ITG A;  2VCP A;  4BGB A;  1ZC6 A;  3KKS A;  1L3U A;  4GKK K;  4FJ5 A;  4BE0 A;  4DQS A;  4YOU A;  3THX B;  2NRZ A;  4OGE A;  1GLJ O;  1Q8I A;  1WUA A;  1M1K O;  3AV9 A;  1ZBS A;  2NRV A;  4HTL A;  4BWM A;  4B9Q A;  1GOC A;  2O8D A;  1RGI A;  1U48 A;  2KHO A;  4M3Z A;  4MQ3 A;  5AQI A;  4WCE L;  3VPZ A;  3D2E B;  4BQL A;  3T1Y K;  4B9U A;  1WAF A;  2GUP A;  4ILG B;  3VEX A;  3V1R A;  4DHY A;  5KRS A;  3C6H A;  4B1V A;  5JMV A;  5AR0 A;  3AVG A;  5M1Q A;  1KC8 O;  3O4Q A;  4DR7 K;  1JL2 A;  5EU7 A;  5BRD A;  4NCB A;  4G1Q A;  1T05 A;  2D0P A;  4MO4 A;  4I2Q A;  1S6P A;  4CJ4 A;  2FBX A;  3QML A;  3CFP A;  2YJF A;  4BRA A;  3F73 A;  3HVR A;  4LF5 K;  4L8R B;  3AVL A;  2O8E A;  2BH1 A;  3TAR A;  4Z4C A;  4N76 A;  2KTQ A;  4JKF A;  4DFK A;  3AVH A;  4FSV A;  3TAN A;  5GAD P;  3KK2 A;  5AQF A;  4WQ5 C;  4H5T A;  3CJA A;  3IAY A;  3EEQ A;  4B8A B;  4HVJ A;  4BR5 A;  3CJC A;  1BA0 A;  1NJZ A;  5GIO A;  1U45 A;  4I9Q A;  2V7Z A;  1RT3 A;  4WQ5 A;  3D0P A;  3SJJ A;  1JLA A;  4TSX A;  4GNI A;  5HBM A;  4BVO A;  4C1N K;  5SZT A;  4DSJ A;  3SAF A;  4DTX A;  2UXB K;  5FPD A;  3G4S N;  4FWR A;  4X62 K;  3ID8 A;  3H1V X;  3NH0 A;  1FJG K;  3H46 O;  3AA3 A;  3J7A P;  1Z25 A;  1DEJ A;  4EZ9 A;  1GLD G;  4O44 A;  2FSN A;  1H1V A;  4O5B A;  4RWT A;  5AFU H;  3CJ7 A;  3R1X A;  1KSP A;  2OTJ N;  5IWA K;  1T3V A;  2E88 A;  1J5E K;  1EWR A;  4HCB A;  5AFU A;  1GOB A;  4M45 A;  2QXF A;  3MEG A;  4M3T A;  2D0A A;  3NMU A;  1NJW A;  4QAG A;  2UXC K;  4FW2 A;  2HHV A;  4PL7 A;  3OYJ A;  1NGI A;  1W97 L;  4KO0 A;  4RCH A;  1JCF A;  4OPA A;  4F2R A;  1B9F A;  4LF9 K;  1E4F T;  1GLA G;  4JKB A;  3BP8 A;  4BRL A;  2A5X A;  4Z4H A;  4KI4 A;  3PUF A;  3V6D A;  2GV9 A;  5C10 A;  3SYZ A;  4DSF A;  1NM1 A;  3VOV A;  3O4W A;  4CCH A;  1QE1 A;  3RWU A;  2RF2 A;  4CJW A;  3G10 A;  2GBZ A;  4BC4 A;  4JI4 K;  4CJE A;  3ZX2 A;  5CE3 A;  3ZSW A;  3ZLJ A;  4JI5 K;  1BA1 A;  2GTD A;  3FFI A;  4IDK A;  3CIP A;  3WQT A;  1Q9X A;  1YUW A;  1S1V A;  3NF6 A;  3LAN A;  4FZZ A;  4BRD A;  4H4O A;  4IKF A;  3AAQ A;  3M1F A;  1XQS C;  1M90 O;  1VSF A;  5J2P A;  1WLJ A;  1YAG A;  3VEY A;  3VF2 A;  3MN5 A;  1X9J A;  4AHS A;  3K5M A;  2QEX N;  1U2V B;  3C95 A;  3VMF B;  3ZSV A;  5HRN A;  1NK8 A;  4H03 B;  4JHD B;  2WBN A;  3DJC A;  4B1Z A;  1BCM A;  4J2D A;  3ENO A;  5LMU K;  3THY A;  3CHW A;  2RHK A;  3OYK A;  4LY7 A;  1U04 A;  1X9M A;  2D0C A;  3LDN A;  3A5O C;  3P83 D;  4DSI A;  3WNF A;  3ZET A;  1HKB A;  1QQC A;  1VSJ A;  3KK7 A;  5AZI B;  3D45 A;  4DR2 K;  1L3S A;  4W5Q A;  3M8P A;  1FXX A;  2P9U B;  1SL0 A;  3QLH A;  3OYH A;  3OY9 A;  3MEE A;  2QWM A;  4CZG A;  4DR3 K;  1XNR K;  3AO2 A;  4ZTF A;  3U6F A;  1RDC A;  4RTF D;  1WBD A;  5EVZ A;  5EX5 A;  2YKN A;  2PY5 A;  1HMV A;  2ZJQ L;  3CET A;  2P9L B;  4AHU A;  3AVF A;  3AVI A;  2E1Z A;  1KXP A;  5BPM A;  1U4B A;  4CJS A;  3MDQ A;  3DWL A;  1KAZ A;  2YHY A;  4DLE A;  1U49 A;  4BR2 A;  2P9S B;  3OA9 A;  3I33 A;  4BRH A;  4H5N A;  4FJI A;  4B3R K;  1A5X A;  5AQK A;  3E01 A;  4KI6 A;  3ZX3 A;  2KKZ A;  4CJU A;  1N5Y A;  4OGC A;  3OYB A;  1ZBL A;  3FLC O;  4MLE A;  1YHQ N;  2P51 A;  2V52 B;  1NGC A;  1K8A O;  1ZBU A;  2F8T A;  1K8K A;  4KBO A;  1YJW N;  1SL1 A;  5BRE A;  3U4L A;  3VEO A;  1BQN A;  4K25 A;  4CD1 A;  1VQK N;  4DSK A;  1IJJ A;  4IBN A;  4CHO A;  1ZXO A;  2V51 B;  1QHT A;  4CEC A;  4CF2 A;  4CZL A;  4CBW A;  2J4R A;  1XC9 A;  3KHY A;  4YOY A;  4KH4 A;  4QS7 A;  4J2E A;  3EZ5 A;  4M3W A;  3TR8 A;  2O8B B;  4ZTJ A;  1QSL A;  4FM2 A;  2XY5 A;  4CED A;  4FYD A;  4DU1 A;  4DV0 K;  4DU3 A;  2D5R A;  2DFH A;  1ZYQ A;  4HUF A;  3VEZ A;  1IH7 A;  3U3G A;  4DV3 K;  4B3M K;  3RR7 A;  3LP0 A;  3K9K A;  3V9X A;  2WUS A;  4M41 A;  1S1T A;  1QVG M;  4JI2 K;  1YVU A;  1WNS A;  3MN7 A;  4JKA A;  3PSF A;  1YI2 N;  2EX3 A;  3L2V A;  3CJ9 A;  4O0I A;  3HJF A;  3LAM A;  3FZL A;  4M3R A;  2BTF A;  3HT3 A;  3DLE A;  3ZEU A;  3TAE A;  5C2F A;  3KZB A;  2AA4 A;  3SK3 A;  4IXC A;  4CFA A;  1YF5 L;  1RDD A;  1TKZ A;  5M1N A;  1A5V A;  3C7N B;  3LAK A;  3MX2 A;  3AA4 A;  3THW A;  2BE2 A;  1BIU A;  3O9S A;  3W0L A;  3CJB A;  3VQ5 A;  3JAM O;  4ELV A;  3LDO A;  1IKX A;  3VQE A;  3GDQ A;  5AQN A;  4JS4 A;  4KKO A;  4N56 A;  3SBG A;  1EKE A;  2Q97 A;  3CCU N;  3HPO A;  4M3X A;  3RSE A;  2P9P B;  3A5L C;  2OCE A;  5FDL A;  1S3X A;  1KVB A;  5KPZ A;  3FZF A;  5M1F A;  3B8A X;  4QOZ B;  3EO3 A;  1ZBH A;  3P31 A;  5FLX O;  2QKK A;  1C6V A;  4FM0 A;  1IBM K;  1N8R O;  2OYQ A;  1J5O A;  5AQG A;  3I8B A;  3TU5 A;  5CY4 A;  4DCH A;  3Q7C A;  4R79 A;  4CHN A;  4R5P A;  4B1Y B;  3MXI A;  1RTH A;  3QDK A;  1LV5 A;  4JS5 A;  4NCA A;  3L3V A;  4BRI A;  3IG1 A;  4DTM A;  3TAG A;  3O5B A;  3ENH A;  2GWK A;  1B9D A;  2HBL A;  2P9I B;  3SBT A;  4X66 K;  3ITH A;  1L3T A;  5M1P A;  3OS0 A;  5ADX H;  1XMO K;  2O8F B;  1FKO A;  1ZBI A;  4X65 K;  5C2D A;  2PYJ A;  4DF8 A;  4IG3 A;  4CVN E;  3THV A;  5ADX A;  3UKU A;  4RW9 A;  2VG6 A;  4FW1 A;  3V9S A;  2JWK A;  1CZB A;  2JLE A;  5KPR A;  4YDU C;  4CZH A;  4C1N I;  2FLO A;  1DKG D;  4I9L A;  1RBS A;  4B3O A;  1S5J A;  3AAR A;  3T3F A;  3DLG A;  2E2N A;  1SV5 A;  3NBP A;  4K8X A;  3LP1 A;  3QEW A;  2BUP A;  3V9W A;  1ITG A;  3CCE N;  4FJL A;  5T7B A;  1S22 A;  4CJQ A;  5M1O A;  4CZM A;  3VEW A;  5CYQ A;  1IO2 A;  4FCY A;  3NAE A;  4YFU A;  1EWQ A;  1GOA A;  3J8A A;  2D1K A;  3DM2 A;  3UKR B;  1NKE A;  4DV6 K;  5F0X A;  3PV8 A;  3ULE A;  3VQQ A;  4AF1 A;  1SZ2 A;  3SUQ A;  2KFZ A;  4CIE A;  4JD2 B;  1T7P A;  1JCG A;  1KAY A;  4BR4 A;  3OYF A;  4KB0 A;  4HTU A;  2ZJR L;  1BUP A;  2I7N A;  1NKC A;  1TL3 A;  1W2B M;  1T44 A;  5AQZ A;  2UXD K;  4WYB A;  3CJ1 A;  4NXN K;  3SV3 A;  4A5B A;  3DOK A;  1XMQ K;  4F3O A;  4Q5V A;  1O1W A;  1OVY A;  3I0S A;  4KTZ A;  2FC0 A;  4LF8 K;  1NGG A;  2QWL A;  1JKH A;  3QIP A;  1S72 N;  4C8L A;  3CER A;  2YHX A;  3DXK A;  1C0G A;  4CHZ A;  4FWS A;  4NCG A;  1JLQ A;  4CEB A;  2HBK A;  3HPH A;  3KWI A;  2RPI A;  3RRH A;  3ZT0 A;  4LSN A;  2X6S A;  5FPE A;  5AQU A;  4WF9 L;  3WQU A;  2O4G A;  4HCC A;  1DT9 A;  1Y64 A;  1WOQ A;  4O8U A;  2WFB A;  2F4V K;  1ZBF A;  4CJK A;  3FFK B;  5K14 A;  2E20 A;  4OKK A;  2DPN A;  2E2O A;  3Q7B A;  2VGM A;  2B6A A;  4E7L A;  3CFO A;  5GAG P;  3CCL N;  1W9H A;  2DFF A;  5BN9 A;  3ZCM A;  2CH5 A;  2G8F A;  5EXW A;  2OTL N;  3H3N O;  3LDP A;  2E2Q A;  4BDP A;  2YI1 A;  1BG3 A;  5CZ2 A;  3D6R A;  4FVM A;  5GAH P;  4I7F A;  4IOC L;  4MFB A;  1ILY A;  3M8Q A;  1MA9 B;  4AHR A;  3EKS A;  2UUA K;  2G8U A;  4E19 A;  1X3M A;  3I0R A;  4B8C A;  5SWM A;  1I3A A;  3R3L A;  1DTQ A;  3VQ4 A;  3T69 A;  4PWD A;  4JI8 K;  1LW0 A;  1RCH A;  1NGF A;  3EN9 A;  3ATU A;  4XEI A;  4HUG A;  2UUC K;  3BF3 A;  2KFN A;  4DMN A;  2ZD1 A;  4ELU A;  1YVN A;  4Q0B A;  3AA5 X;  3NDK A;  4K0K K;  4JI6 K;  4FJK A;  4JK8 A;  3BDP A;  2E6L A;  5B8H A;  3J7Y P;  2ZWH A;  5F1X A;  5IT9 O;  2A1S A;  2UYT A;  1WSE A;  3KWG A;  3O3G A;  2R7Y A;  1D9F A;  3M8R A;  3DLH A;  4W5O A;  1UWB A;  3LDS A;  3SPY A;  1HNV A;  1Y97 A;  2P5O A;  1TVR A;  4ILJ A;  3OS2 A;  1HPZ A;  4IO8 A;  4UY8 O;  4BWJ A;  3A2F A;  4CJP A;  1XI1 A;  4PKH A;  4DTR A;  2AJQ A;  2QWR A;  1RDU A;  1VRT A;  1WSI A;  2P9K B;  3VA3 A;  3JSM A;  1RTJ A;  4MO5 A;  1C1A A;  1YXQ A;  4PKG A;  3WNE A;  3S3N A;  4OPK A;  3CC2 N;  4H5W A;  4A2A A;  3F9M A;  3S3M A;  1N32 K;  4A59 A;  3SPZ A;  5FRO A;  4FJH A;  1VSM A;  2VQF K;  1RT1 A;  1VSE A;  1S6Q A;  4Z0U A;  3O9R A;  4EZ6 A;  3HM8 A;  3NGY A;  3WXM B;  1NJX A;  3ZT2 A;  4IO9 L;  4FLY A;  3DLB A;  3NH2 A;  5CYM A;  3G25 A;  3L4Q A;  4E7H A;  3EL2 A;  2BGG A;  2Q0U A;  4DTO A;  5HRO A;  4DQP A;  5KGW A;  3O3F A;  3ZYY X;  4QS8 A;  4YHH K;  2WON A;  3EZW A;  1A5W A;  2IC3 A;  3MN6 A;  3LDL A;  3C6T A;  1J53 A;  3T1H K;  1WSH A;  1DLO A;  3K5L A;  4DFM A;  3VER A;  1HYV A;  4DR6 K;  1RT5 A;  3WEE A;  2HMP A;  4FWM A;  4ID5 A;  4O5F A;  4L3Q A;  3R8E A;  3DXM B;  2IVP A;  1LOT B;  4JKG A;  4I2P A;  1N36 K;  2EWS A;  4CGG A;  1JXE A;  3L4I A;  3WXK A;  5LL6 Z;  5HRP A;  3L2R A;  3T1A A;  4B9L A;  3NGI A;  2FBV A;  4PQU A;  4PA1 A;  5H1S Q;  4U67 L;  3HK2 A;  3M3Z A;  4B08 A;  1HPM A;  1KAX A;  5AZJ A;  4Z94 A;  1NNE A;  2VYP A;  5KGX A;  4F3T A;  1KFD A;  4OX9 K;  1HQU A;  4WE1 A;  3ZSZ A;  4CZK A;  3HRG A;  3DLK A;  5E84 A;  2HF3 A;  4DB3 A;  4OPJ A;  3KLE A;  4CGI A;  3I56 N;  4BRK A;  4CJ3 A;  4GV3 A;  5AQJ A;  2HHQ A;  3KTQ A;  3O4N A;  1TK0 A;  4AM6 A;  4ISE A;  4B3T K;  3MWP A;  1UA1 A;  2FF3 B;  1SQK A;  2P1J A;  3QIC A;  4PUO A;  1NLV A;  2GEM A;  4NYF A;  4B1U B;  3D2F A;  4CJT A;  3QEX A;  3ZT1 A;  1HNI A;  5HP1 A;  1GLC G;  1XNQ K;  5JS1 A;  3BUZ B;  4FLT A;  3AO4 A;  3JXU A;  3AVK A;  5C24 A;  3ULD A;  2HMI A;  4OO1 J;  4XH4 A;  4DF4 A;  3BZC A;  3MXM A;  1KD1 O;  3KVG A;  3V1O A;  4GV9 A;  4CW7 B;  1U6Z A;  4A61 A;  3LZI A;  4FJN A;  3CPW M;  4PL8 A;  3U3Y A;  3SUO A;  4CGF A;  4OJR A;  1D5A A;  3H6E A;  4DTJ A;  3LL3 A;  3VEN A;  1S9G A;  4Z4E A;  2XY7 A;  5EOY A;  3CMA N;  4DU4 A;  4OKE A;  1T03 A;  4JN4 A;  2YNG A;  2H3G X;  4DUZ K;  4KTW A;  2HHH K;  5J1E A;  1BDG A;  3NFA A;  3AO3 A;  4OKJ A;  2YV0 X;  1CLQ A;  3HP9 A;  2I5J A;  3DMJ A;  2F9W A;  1CZ9 A;  4CK1 A;  3CQ8 A;  1IKV A;  5DK5 A;  3TAP A;  2Q36 A;  2QTD A;  4CFD A;  2HHX A;  1HNZ K;  5CR4 A;  3SI6 A;  4C8N A;  4IEE A;  1IG9 A;  3DYA A;  1BWF O;  4YOT A;  3TAF A;  4EIA A;  4M42 A;  1NK9 A;  3IUC A;  3DRS A;  2AP1 A;  2YNI A;  3D7E O;  4DV5 K;  3UB5 A;  3KIO A;  2HF4 A;  3VGL A;  1KLN A;  2HHU A;  4CBX A;  4DR5 K;  4H0V B;  3AAP A;  2Q0R A;  4A2B A;  4CHY A;  2CGJ A;  2HNY A;  4B9T A;  3L0Q A;  3S3O A;  4CJL A;  5A2Q O;  1WSJ A;  1TYQ A;  3ASM A;  3AVM A;  2D0B A;  3S41 A;  1HQE A;  1NOZ A;  4HWI A;  5E26 A;  3ZSY A;  3RMB A;  3TPQ A;  3ULE B;  1WSG A;  4WFB L;  3FZK A;  3IFR A;  2DFE A;  3O8M A;  3OYC A;  4DTU A;  4B9V A;  2G8V A;  2IS3 A;  3P5J A;  3P39 A;  1HJO A;  1LAV A;  3NF9 A;  1ATR A;  2HBJ A;  2KLA A;  1KCF A;  1BI4 B;  2BDP A;  5GAE P;  3CC4 N;  4XH1 A;  4NXM K;  1RT4 A;  4BRP A;  5JIC A;  1KQS M;  4OVL A;  4B3S K;  2G8H A;  1IG8 A;  3VQC A;  4FWN A;  3M8S A;  3THX A;  4CK2 A;  2Q1N A;  5AJ3 K;  3G0Z A;  5HL7 L;  3AGR A;  1L3V A;  4IFV A;  3WXJ A;  4WFN L;  5DMR A;  4CJF A;  3H45 C;  3MCP A;  3UE5 A;  4C8O A;  5LMN K;  1WN7 A;  3D2E A;  4KHS A;  2X6N A;  4E7J A;  2VQE K;  3OYG A;  3QO9 A;  4AHT A;  1BIS A;  4BG8 A;  4KH6 A;  1K9M O;  4BR0 A;  4NLC A;  4KHU A;  3NE6 A;  3E9L A;  4FXD A;  4DV2 K;  3ZSR A;  3S9H A;  1RDB A;  2O8C B;  3ISN C;  4F9O A;  3K0S A;  5I42 A;  3LPU A;  4FWP A;  3FR0 A;  3BY5 A;  4IEI A;  2FXU A;  3TSP A;  3VQ6 A;  4GW6 A;  2DY4 A;  4FPB A;  5LY3 A;  4JKH A;  1SKS A;  2ITM A;  1NG9 A;  5AQY A;  1MDU B;  1C1B A;  1I39 A;  1VSD A;  3RR8 A;  2B4J A;  2WTU A;  1HX1 A;  4FLX A;  1EXQ A;  2A42 A;  4CEZ A;  3DI6 A;  4A62 A;  3E66 A;  5AQR A;  3VF4 A;  5HRR A;  4E3S A;  1J54 A;  4FJ7 A;  5E41 A;  2I7P A;  3DRP A;  2FBT A;  2QWQ A;  4IOA L;  3AVC A;  3O1W A;  5LJV A;  4JNE A;  3QEI A;  3FZM A;  4F8R A;  4BC2 A;  1TKD A;  3N4P A;  2P9N B;  1NGE A;  3M6G A;  1CXQ A;  2YCH A;  4JKE A;  3VQP A;  4IOX A;  3HOT A;  3VES A;  2YX6 A;  3SAH A;  3CCQ N;  5C0Y A;  4LH4 A;  4JKC A;  2QKB A;  3CFR A;  3OBW A;  4JI1 K;  3PO4 A;  3EE8 A;  3P4I A;  4CZE A;  3SAG A;  5BPL A;  5BPN A;  3VQ9 A;  3CCJ N;  4BE2 A;  1RT7 A;  3CM6 A;  5J2Q A;  2B5J A;  3DOL A;  1JLF A;  1BGX T;  1T6C A;  2YKM A;  3OYN A;  2O8D B;  3P1G A;  3DAW A;  1XHZ A;  3B6O A;  2W6K A;  4BR7 A;  4BRE A;  5EY4 A;  4FJX A;  4K43 A;  2JGU A;  4KV8 A;  2PBD A;  4JK7 A;  1VSK A;  4K41 A;  1VQL N;  5C25 A;  5AQT A;  3QER A;  3IDH A;  2HVH A;  2E4L A;  3O9T A;  3TTF A;  4KHP K;  4ICL A;  3E1Y A;  4IFY A;  1BHL A;  1VQN N;  4CEE A;  1YT3 A;  3RRG A;  1HNW K;  2Z1J A;  3LDQ A;  4IJA A;  2HB5 A;  4EAH D;  4YOR A;  2RKI A;  4LF7 K;  1NMN A;  4BRM A;  1ASU A;  3BZK A;  4WFA L;  2KQ2 A;  1Z6R A;  3G6E N;  3N4Q A;  2QXL A;  2ZF5 O;  3QFP A;  4YDU A;  4BQZ A;  4Y1D A;  2O8E B;  1VQ9 N;  1Z05 A;  2VWJ A;  2QWN A;  3BF1 A;  2E5L K;  1NMD A;  3TWH A;  1RIL A;  2KZZ A;  2WOM A;  4DQR A;  4H0Y B;  5AQM A;  3K2P A;  2YHA A;  1Z26 A;  2EHG A;  1XWL A;  3GOI A;  1KTQ A;  3HSC A;  1U2V A;  1JLB A;  4EFH A;  4CGD A;  3CCV N;  3LWM A;  3KD5 E;  4BVP A;  1XC3 A;  4JHD A;  4H4M A;  1WBB A;  4DTN A;  4JLH A;  3LP2 A;  3C6A A;  4J2A A;  4O55 A;  3RMC A;  2ETJ A;  3NVK A;  3OS1 A;  3M5R A;  3U8X A;  4IG0 A;  3V9U A;  1C0U A;  4LF4 K;  1N33 K;  4DSL A;  2XRI A;  3C6U A;  4FWK A;  3HST B;  1NGH A;  4CJ7 A;  4KRE A;  4RW6 A;  1TUY A;  5AQS A;  5DM6 L;  1T8E A;  2VG7 A;  3LZJ A;  4FLU A;  3IRX A;  4LFC K;  4PKI A;  5AZI A;  1DTT A;  2Z1H A;  4IFE A;  3OYL A;  4FOI A;  3KLG A;  1WSF A;  2P9U A;  3WNH A;  3K9J A;  3KLF A;  3CG7 A;  1RTI A;  4CJ5 A;  3K5N A;  1SUQ A;  4EHT A;  1JLC A;  5BR9 A;  2HVI A;  4JKD A;  3DLL L;  2Q31 A;  1G99 A;  1VSH A;  1HKG A;  3J81 O;  3V81 A;  2HBM A;  5GIP A;  1K6Y A;  1NJI O;  3FGU A;  4K42 A;  3CI5 A;  5MLC Q;  1ATN A;  1XUP O;  2P9S A;  4MDA A;  1NGD A;  5HRS A;  4BRO A;  3TI0 A;  1N34 K;  4IWV A;  4A5A A;  2XY8 A;  4E0D A;  1YIJ N;  1EO1 A;  2QI2 A;  4U7B A;  2Q2R A;  4DS4 A;  1QQM A;  4H0T B;  3AVB A;  5FRN A;  4DQI A;  3ID6 A;  4JI3 K;  1TKX A;  3OJS A;  5JVG L;  4B1X B;  4CF8 A;  5J2M A;  3KKR A;  1D4X A;  2CGL A;  3TAB A;  3WXI A;  4KPY A;  4NO7 A;  4FK4 A;  4DWI A;  3NHG A;  2ZQB A;  5KQ8 A;  2VGN A;  2O8B A;  1MWK A;  4LFB K;  1GLL O;  1TUU A;  2FBY A;  1YTU A;  3QEV A;  5AQH A;  3EY1 A;  3I8D A;  2GUI A;  4BRQ A;  2HND A;  4LC9 B;  1UA0 A;  1NGA A;  3C65 A;  5BRH A;  2F9T A;  3A8Y A;  4GMJ B;  3OYE A;  4BAC A;  4E7K A;  2X78 A;  3QB0 A;  4CEA A;  1VQ8 N;  2NRX A;  4C8K A;  1Q18 A;  1TKT A;  3THY B;  4JI7 K;  1EQY A;  1HYZ A;  3C94 A;  2NRW A;  1X1P A;  4CF1 A;  3O08 A;  4DTP A;  3SQ2 A;  3HOS A;  3RMD A;  3CF5 L;  1XHX A;  1C1C A;  3ZET B;  1QS4 A;  4G9Z A;  2DTU A;  1BIZ A;  4FVU A;  1VQM N;  1VQ7 N;  1HKC A;  3ALY A;  4M63 C;  2NRT A;  1FK9 A;  3JYT A;  4B9S A;  4DLG A;  4K8Z A;  4KFB A;  5C15 A;  1IV0 A;  1VAZ A;  5AQV A;  3G71 N;  2QM1 A;  5I3U A;  3VF6 A;  5KQD A;  2PFU A;  2NRH A;  1ATS A;  1NK4 A;  4DR1 K;  2HHW A;  2P9P A;  1EP4 A;  3QFU A;  2F8S A;  3UIQ A;  5TKW A;  5FRM A;  4OLA A;  4FWL A;  3HP6 A;  2QW9 A;  3E9P A;  5CHI A;  4RG8 A;  3QBX A;  2BAN A;  4NB4 A;  4CD3 A;  3QIO A;  4BE1 A;  1X9S A;  3R6M A;  4FJJ A;  4JYA K;  1SS6 A;  4AHV A;  3PO5 A;  1D8Y A;  4I6M A;  1K8K B;  1VK0 A;  1TAQ A;  4CHP A;  2HNZ A;  3ZSQ A;  2HOE A;  3GG4 A;  3J80 O;  4O8K A;  3T19 A;  4KAZ A;  2P9I A;  4A57 A;  1VSI A;  1X3N A;  1LWE A;  2O8F A;  3AGK A;  3OYI A;  3LAL A;  2OPR A;  4M7X A;  3CYM A;  1FW6 A;  2ZE2 A;  3SQ1 A;  1NBW A;  2IOC A;  4H0O A;  2ASM A;  3O3H A;  5JLF A;  2OPP A;  1O13 A;  1YJN N;  4JV5 K;  1OH8 A;  2NZT A;  2GWJ A;  4CI6 A;  1G15 A;  3PSI A;  1Q86 O;  1RBU A;  3IKM A;  3VEV A;  4BRF A;  3LPT A;  3F2K A;  2W41 A;  4EHU A;  2UU9 K;  3VTI A;  3LWL A;  3SCX A;  1TAU A;  2ZGY A;  3VGM A;  1BO5 O;  2D0O A;  2IIR A;  5BN8 A;  3LM9 A;  3J7Z O;  4FPA A;  3SZ2 A;  4DFP A;  1RT6 A;  1VSL A;  4DSE A;  3AVJ A;  2OZS A;  4J2B A;  1EET A;  3OJU A;  1N6Q A;  3HO1 A;  3UKR A;  3O9Q A;  3ZEU B;  4B9M A;  3K57 A;  2ASO A;  1RBT A;  3HI0 A;  3ENB A;  4CZF A;  1D9D A;  4CZJ A;  4JD2 A;  3AY9 A;  4BR9 A;  4ISG A;  1L5U A;  3QNN A;  2NLX A;  3MEC A;  4KTQ A;  1FKP A;  1ASW A;  3THW B;  2GX9 A;  1V4S A;  5ELZ A;  3PX6 A;  4KHW A;  4FJ9 A;  3R9P A;  3VGK A;  4FK0 A;  2ZGZ A;  3HPG A;  4DTS A;  4BRG A;  1RBR A;  4ISF A;  4WQ4 C;  2OPQ A;  3RSE B;  4Z4F A;  1HRH A;  5KTQ A;  3SMS A;  2NUB A;  1LAW A;  3QBW A;  3CQX A;  4WQ4 A;  1HNX K;  1BU6 O;  3OTO K;  5FPN A;  1U47 A;  5J2N A;  3O9U A;  1GLB G;  4DKW A;  1KFS A;  2A41 A;  3CXC M;  1NWK A;  3DRR A;  4KHN A;  5BR8 K;  4GVE A;  4O4G A;  1IBK K;  3DLR A;  3L8B A;  5CZ1 A;  4CIF A;  1X9W A;  4J8F A;  4JI0 K;  3PIP L;  3ZSO A;  1HJR A;  5LJW A;  2XHB A;  3OYA A;  4JK9 A;  4KB1 A;  1TL1 A;  3LM2 A;  4CGH A;  2QWO A;  4CBU A;  1NOY A;  1C0T A;  3FE1 A;  5KRT A;  2E2P A;  3UKU B;  3QEP A;  1GLE G;  1CZA N;  3MN9 A;  3PX0 A;  1JLG A;  4N41 A;  4JEP A;  3B6P A;  3CCM N;  3GE1 A;  4DQ8 A;  3PX4 A;  3ATV A;  2ZM6 K;  2VWK A;  1Q7Y O;  4HHT A;  3QIN A;  3VQD A;  1P90 A;  1QZ6 A;  3IMX A;  5I9E B;  3HVT A;  3KLH A;  4DUY K;  1KLM A;  1BOT O;  3FZH A;  3OHR A;  1VQO N;  3VQA A;  3CM5 A;  4CIG A;  2PYL A;  4BDZ A;  4FLZ A;  3SQ4 A;  4CFC A;  3ZT3 A;  1JCE A;  4FWQ A;  3SUN A;  1T6D A;  3K59 A;  4JRQ A;  1IBL K;  5AQL A;  4LF6 K;  2OZM A;  2OA8 A;  1HLU A;  1ASV A;  4AM7 A;  4M3U A;  3MED A;  2W40 A;  4CK3 A;  1LW2 A;  3BGR A;  3V9Z A;  4DQQ A;  1VQ4 N;  1NJY A;  4YOV A;  3TTC A;  4BRN A;  2G8K A;  3CME N;  5JLH A;  1HR0 K;  2KZM A;  1YIT N;  3TSQ A;  3V4I A;  5BRF A;  3SQ0 A;  3HZ6 A;  1WB9 A;  4DS5 A;  4RW4 A;  3QET A; 
#chains in the Genus database with same CATH homology
 4FO0 A;  4FWR A;  1VQN N;  3D6R A;  5GAH P;  3ID8 A;  3H1V X;  4Y0W A;  4IOC L;  1ILY A;  2P9K A;  1MA9 B;  3H46 O;  3EKS A;  3LDQ A;  4IJA A;  3WUH A;  1X3M A;  1DEJ A;  3NVM A;  4YOR A;  3R3L A;  4EAH D;  1GLD G;  4BRM A;  3DXK B;  3T69 A;  2FSN A;  1H1V A;  2IVO A;  4RWT A;  4WFA L;  5AFU H;  3CJ7 A;  3R1X A;  1Q82 O;  3MX5 A;  2OTJ N;  1NGF A;  1Z6R A;  1T3V A;  2E88 A;  3G6E N;  3EN9 A;  3ATU A;  3N4Q A;  2QXL A;  2ZF5 O;  3CPE A;  4NLB A;  4XEI A;  5AFU A;  3BF3 A;  3QFP A;  3P38 A;  2F7T A;  4YDU A;  4BQZ A;  3CCR N;  1YVN A;  5M1K A;  1VQ9 N;  1Z05 A;  2QWN A;  3BF1 A;  3NMU A;  1NMD A;  4PL7 A;  1NGI A;  1W97 L;  4RCH A;  1JCF A;  4OPA A;  4H0Y B;  5AQM A;  1JJ2 M;  4JK8 A;  1E4F T;  1GLA G;  2FSK A;  3BP8 A;  3GOI A;  4JKB A;  3HSC A;  2ZWH A;  1U2V A;  2A5X A;  4BC5 A;  4BRL A;  4EFH A;  5B8H A;  2UYT A;  5F1X A;  3CCV N;  1K73 O;  1GLF O;  3HBT A;  3KWG A;  1P8Z A;  3O80 A;  1XC3 A;  4JHD A;  4BVP A;  5C10 A;  5GIN A;  1NM1 A;  3VOV A;  4YOW A;  3O4W A;  3C6A A;  3NVK A;  3M5R A;  3U8X A;  4BC4 A;  4ILJ A;  3EKU A;  2NNW A;  3ZX2 A;  5CE3 A;  4FWK A;  1NGH A;  4IO8 A;  1BA1 A;  2GTD A;  4CJ7 A;  5AQS A;  1TUY A;  5C12 A;  3CIP A;  3WQT A;  5DM6 L;  4UY8 O;  4GV6 A;  1YUW A;  4PKH A;  3PLA A;  2QWR A;  4C23 A;  1RDU A;  1LCU A;  2P9K B;  4BGA A;  4PKI A;  5AZI A;  4IFE A;  2D4W A;  4MO5 A;  4BRD A;  3SLC A;  4FOI A;  2P9U A;  3TSU A;  4H0P A;  1YXQ A;  3K9J A;  4PKG A;  3CC2 N;  4H5W A;  3DXM A;  3AAQ A;  4A2A A;  3F9M A;  4EHT A;  5BR9 A;  3M1F A;  1XQS C;  4A59 A;  4JKD A;  1M90 O;  3DLL L;  2Q31 A;  1J6Z A;  3OW2 M;  1G99 A;  1YAG A;  1HKG A;  3VEY A;  2HBM A;  5GIP A;  3O9R A;  3VF2 A;  3HM8 A;  1NJI O;  3FGU A;  3WXM B;  4K42 A;  3CI5 A;  5MLC Q;  3MN5 A;  1X9J A;  4IO9 L;  1ATN A;  2QEX N;  1U2V B;  2ASP A;  4XH5 A;  1XUP O;  3VMF B;  2P9S A;  3G25 A;  3L4Q A;  3EL2 A;  4H03 B;  4JHD B;  2WBN A;  2JWL A;  3DJC A;  4MDA A;  4B1Z A;  2Q0U A;  1NGD A;  4IJN A;  1C0F A;  5AQP A;  4BRO A;  3ENO A;  3ZYY X;  4QS8 A;  3EZW A;  4IWV A;  5F2R A;  4A5A A;  3CHW A;  2RHK A;  2V7Y A;  2NRR A;  1YIJ N;  3MN6 A;  4CZI A;  1V4T A;  1EO1 A;  2QI2 A;  3LDL A;  4FWO A;  4U7B A;  5JVH L;  2Q2R A;  3CCS N;  3LDN A;  1QQM A;  3A5O C;  4H0T B;  1SAZ A;  3ZET A;  1HKB A;  3VER A;  1VQP N;  3EE9 A;  3KK7 A;  5AZI B;  3ID6 A;  3J7Z O;  3WEE A;  2HMP A;  4FWM A;  5JVG L;  4O5F A;  4L3Q A;  4B1X B;  1D4X A;  3H1Q A;  4MLH A;  2P9U B;  2CGL A;  3MK6 A;  3R8E A;  3WXI A;  3HTV A;  4NO7 A;  3DXM B;  2QWM A;  4CZG A;  2IVP A;  1LOT B;  4JKG A;  2EWS A;  3WXK A;  3L4I A;  4RTF D;  5KQ8 A;  2VGN A;  5EVZ A;  5EX5 A;  2ZJQ L;  1MWK A;  3CET A;  1GLL O;  1TUU A;  2P9L B;  5H1S Q;  5AQH A;  1RFQ A;  2E1Z A;  4I6M B;  4U67 L;  1KXP A;  2OAN A;  4YOX A;  3MWT A;  3M3Z A;  5BPM A;  4BRQ A;  3MDQ A;  3DWL A;  1KAZ A;  1HPM A;  1E4G T;  1KAX A;  4LC9 B;  2YHY A;  4Z94 A;  5AZJ A;  4QS9 A;  1NGA A;  3C65 A;  2VYP A;  5BRH A;  4BR2 A;  2P9S B;  2F9T A;  3A8Y A;  3F5T A;  1NGJ A;  3OA9 A;  2VWB A;  3I33 A;  4BRH A;  4H5N A;  3QB0 A;  5AQQ A;  1VQ8 N;  4CZK A;  1VQ5 N;  3CC7 N;  5HOO A;  5AQK A;  1VQ6 N;  3HRG A;  2NRX A;  5E84 A;  2HF3 A;  1Q18 A;  2KKZ A;  4M7Y A;  3ZX3 A;  4DB3 A;  3I56 N;  4BRK A;  4GV3 A;  5AQJ A;  3FLC O;  1EQY A;  4MLE A;  4AM6 A;  4ISE A;  3MWP A;  1YHQ N;  2NRW A;  2V52 B;  1NGC A;  2FF3 B;  3O08 A;  1SQK A;  3I55 N;  1K8A O;  3HOS A;  3VGM A;  3QIC A;  3CF5 L;  1K8K A;  1NLV A;  2GEM A;  2WC9 A;  4KBO A;  3ZET B;  4B1U B;  3D2F A;  1YJW N;  4G9Z A;  5BRE A;  3U4L A;  3A5M C;  3VEO A;  4K25 A;  3WEE B;  4CD1 A;  3CD6 N;  4BC3 A;  3W3D A;  2QA4 N;  1VQK N;  1IJJ A;  4FVU A;  1GLC G;  5FPM A;  1ZXO A;  3L6Q A;  1VQM N;  1VQ7 N;  2V51 B;  1HKC A;  3BUZ B;  3T7Z A;  4M63 C;  3JXU A;  4CZL A;  4CBW A;  4MDB A;  4JKG B;  2NRT A;  1MWM A;  2J4R A;  2E8A A;  3KHY A;  3ZX0 A;  4YOY A;  4OO1 J;  4GY2 B;  1QQO A;  4XH4 A;  4KH4 A;  4QS7 A;  1KD1 O;  5C15 A;  1VAZ A;  5AQV A;  3KVG A;  4GV9 A;  3G71 N;  1U6Z A;  4A61 A;  2QM1 A;  1Q81 O;  3CPW M;  4BY9 C;  3VF6 A;  5KQD A;  2PFU A;  4PL8 A;  5AZJ B;  2NRH A;  1ATS A;  5DM7 L;  3H6E A;  3LL3 A;  3VEN A;  2P9P A;  3VEZ A;  2CGK A;  2ZJP L;  3QFU A;  5EOY A;  3CMA N;  2RE2 A;  5TKW A;  4FWL A;  3BEX A;  2QW9 A;  3E9P A;  5CHI A;  3K9K A;  4FOE A;  4ILH A;  4JN4 A;  2QWP A;  2WUS A;  2H3G X;  3GBT A;  3QBX A;  1R59 O;  2PAV A;  4NB4 A;  1QVG M;  1BDG A;  4CD3 A;  3MN7 A;  5AQX A;  3R6M A;  4JKA A;  1YI2 N;  1SS6 A;  3O6W A;  4FL9 A;  2GEL A;  2P9L A;  2A40 A;  4I6M A;  3CJ9 A;  2F9W A;  1DGK N;  1K8K B;  3FZL A;  4IDH A;  2Q36 A;  2QTD A;  3D2F B;  2BTF A;  1HUX A;  3ZEU A;  2HOE A;  3GG4 A;  5CR4 A;  4KH5 A;  5C2F A;  3KZB A;  2AA4 A;  4O8K A;  1QQN A;  3SK3 A;  4IEE A;  4IXC A;  2P9I A;  3OBY A;  1YF5 L;  4A57 A;  1BWF O;  1X3N A;  4YOT A;  4BG9 A;  4EIA A;  5M1N A;  3U9D A;  3IUC A;  2AP1 A;  3D7E O;  3UB5 A;  4E1J A;  3AGK A;  2HF4 A;  3VGL A;  3C7N B;  4CBX A;  1QVF M;  4H0V B;  3AAP A;  2Q0R A;  4M7X A;  4A2B A;  3MX2 A;  2YJE A;  2CGJ A;  3O9S A;  3CJB A;  3RVC A;  3W0L A;  3MCA B;  1NBW A;  3LDO A;  5AQG A;  4BRC A;  3GDQ A;  5AQN A;  3L0Q A;  2ASM A;  4H0O A;  3JS6 A;  5TKY A;  3MMV A;  2FSJ A;  3SBG A;  5JLF A;  1TYQ A;  1O13 A;  2Q97 A;  3CCU N;  1YJN N;  3RSE A;  2P9P B;  3A5L C;  2NZT A;  3S41 A;  2FF6 A;  2GWJ A;  4CI6 A;  1S3X A;  4HWI A;  3WT0 A;  3WXL A;  5E26 A;  1Q86 O;  5KPZ A;  3IKM A;  5AQW A;  3TPQ A;  3ULE B;  3FZF A;  3VEV A;  4WFB L;  1RDW X;  3B8A X;  3FZK A;  3IFR A;  3F2K A;  3EO3 A;  4BRF A;  3O8M A;  5M1F A;  3O1B A;  3P31 A;  2W41 A;  4EHU A;  3P39 A;  3VTI A;  1N8R O;  1HJO A;  2ZGY A;  1BO5 O;  2D0O A;  2IIR A;  3I8B A;  1ATR A;  2HBJ A;  2KLA A;  3LM9 A;  3Q7C A;  4FPA A;  3TU5 A;  3TTD A;  4DCH A;  5BN8 A;  4R79 A;  3A5N C;  4B1Y B;  3A0I X;  3QDK A;  5GAE P;  3G4S N;  3CQY A;  3SMP A;  3CC4 N;  4XH1 A;  4BRI A;  4BRP A;  5JIC A;  1KQS M;  3UKR A;  3O5B A;  3O9Q A;  3VET A;  3ZEU B;  3ENH A;  1QZ5 A;  1IG8 A;  3U9Z A;  2ASO A;  4FWN A;  3HI0 A;  2GWK A;  1ESV A;  2HBL A;  2P9I B;  3ENB A;  3SBT A;  2IVN A;  5M1P A;  4CZF A;  4CZJ A;  4JD2 A;  3AY9 A;  4BR9 A;  4ISG A;  5ADX H;  2Q1N A;  2NLX A;  2HST A;  2YHW A;  5HL7 L;  3AGR A;  3VTH A;  5C2D A;  4IZ9 A;  4OPH A;  3WXJ A;  2E1Y A;  5ADX A;  4WFN L;  3UKU A;  2GX9 A;  1NGB A;  1V4S A;  3H45 C;  5ELZ A;  2JWK A;  3MCP A;  5KPR A;  4YDU C;  3R9P A;  3UE5 A;  3VGK A;  4H5V A;  4CZH A;  2ZGZ A;  3D2E A;  4H5R A;  4BRG A;  3H3O B;  4ISF A;  4C1N I;  5KPT A;  1TYQ B;  2FLO A;  4WQ4 C;  1DKG D;  3RSE B;  3AAR A;  2E2N A;  5AQO A;  4JAX A;  3SMS A;  3QBW A;  4BG8 A;  4KH6 A;  1K9M O;  2BUP A;  4BR0 A;  4B1W B;  3CQX A;  4NLC A;  4WQ4 A;  3SJH A;  1S22 A;  2CH6 A;  3CCE N;  1BU6 O;  3C7N A;  3E9L A;  1OKJ A;  2P9N A;  2A3Z A;  5FPN A;  5M1O A;  3O9U A;  1GLB G;  4CZM A;  4DKW A;  2A41 A;  1YJ9 N;  3VEW A;  4H0X B;  3CXC M;  3C0B A;  4F9O A;  1NWK A;  1QHA A;  4GVE A;  3J8A A;  3E9O A;  4FWP A;  3FR0 A;  2D1K A;  4IEI A;  2A6A A;  2FXU A;  4J8F A;  3UKR B;  3PIP L;  3GL1 A;  3TSP A;  5LJW A;  4PHT X;  5F0X A;  3PIO L;  2VCP A;  4BGB A;  1ZC6 A;  3ULE A;  4JK9 A;  4FPB A;  4AF1 A;  1SZ2 A;  5LY3 A;  4JKH A;  2ITM A;  4JD2 B;  4YOU A;  1JCG A;  3LM2 A;  5AQY A;  2NRZ A;  1MDU B;  1GLJ O;  1KAY A;  1WUA A;  2QWO A;  4BR4 A;  4CBU A;  1M1K O;  4HTL A;  1ZBS A;  2NRV A;  4B9Q A;  3FE1 A;  1HX1 A;  2E2P A;  3UKU B;  1RGI A;  2A42 A;  1GLE G;  4A62 A;  2ZJR L;  2KHO A;  3E66 A;  1CZA N;  1BUP A;  3MN9 A;  5AQR A;  3VF4 A;  4JEP A;  5AQI A;  2I7N A;  4WCE L;  3VPZ A;  3D2E B;  4BQL A;  3CCM N;  3GE1 A;  2I7P A;  4DQ8 A;  1W2B M;  2QWQ A;  1T44 A;  2GUP A;  4ILG B;  5AQZ A;  3ATV A;  4WYB A;  3VEX A;  4IOA L;  1Q7Y O;  3CJ1 A;  3O1W A;  5LJV A;  4DHY A;  4A5B A;  4JNE A;  3C6H A;  3FZM A;  4B1V A;  1P90 A;  4BC2 A;  1QZ6 A;  5JMV A;  3IMX A;  5AR0 A;  5I9E B;  1OVY A;  3N4P A;  5M1Q A;  2P9N B;  1NGG A;  1NGE A;  3M6G A;  1KC8 O;  1BOT O;  3FZH A;  2QWL A;  3OHR A;  2YCH A;  1VQO N;  1S72 N;  3CER A;  4JKE A;  2YHX A;  3DXK A;  1C0G A;  5BRD A;  4FWS A;  4IOX A;  2D0P A;  3HOT A;  3VES A;  2YX6 A;  3SAH A;  2HBK A;  3CCQ N;  5C0Y A;  1JCE A;  3KWI A;  4FWQ A;  4MO4 A;  4JKC A;  1T6D A;  3QML A;  3OBW A;  2YJF A;  4BRA A;  5FPE A;  5AQU A;  4WF9 L;  3EE8 A;  3P4I A;  4CZE A;  3SAG A;  5AQL A;  5BPL A;  2BH1 A;  3WQU A;  5BPN A;  3CCJ N;  1HLU A;  4AM7 A;  1DT9 A;  1Y64 A;  1WOQ A;  4JKF A;  2W40 A;  4O8U A;  2WFB A;  3FFK B;  4FSV A;  2E20 A;  5GAD P;  1VQ4 N;  1T6C A;  5AQF A;  4WQ5 C;  4H5T A;  3CJA A;  4YOV A;  3TTC A;  2DPN A;  4BRN A;  3CME N;  2E2O A;  3DAW A;  3Q7B A;  4BR5 A;  5JLH A;  3CJC A;  2VGM A;  4BR7 A;  4BRE A;  5EY4 A;  1BA0 A;  4K43 A;  1YIT N;  3TSQ A;  5GAG P;  3CCL N;  5BRF A;  5GIO A;  2PBD A;  4JK7 A;  3HZ6 A;  2V7Z A;  5BN9 A;  4WQ5 A;  4K41 A;  1VQL N;  5AQT A;  4GNI A;  2CH5 A;  3IDH A;  4BVO A;  5EXW A;  4C1N K;  3O9T A;  3TTF A;  2OTL N;  3H3N O;  3LDP A;  2E2Q A;  3SAF A;  3E1Y A;  2YI1 A;  5FPD A;  1BG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...