2GELA

2.05a crystal structure of salmonella typhimurium yeaz, form b
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
218
structure length
218
Chain Sequence
MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Salmonella typhimurium YeaZ, an M22 O-Sialoglycoprotein Endopeptidase Homolog
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
molecule keywords Putative Gram negative resuscitation promoting factor
total genus 66
structure length 218
sequence length 218
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gelA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gelA02
1U6ZA 4BRFA 5BN8A 3C0BA 2ASPA 3WUHA 1IG8A 4NB4A 5AQGA 3ZEUB 3LM9A 5EY4A 3O5BA 2GUPA 3P4IA 4DQ8A 3CJ9A 1LCUA 3LDPA 1C0FA 3D2FA 3TU5A 4O5FA 4EHUA 1T6DA 2QXLA 4QS7A 1GLBG 2QWMA 3M6GA 4I6MA 4CD1A 4BR2A 3CJBA 4M7YA 5KPRA 1XC3A 2CGJA 4BVOA 2FSJA 2E8AA 3CJCA 5FPMA 3W0LA 1SQKA 5LJVA 2IVPA 1T44A 2Q97A 4BRIA 3IDHA 3BUZB 4K43A 3ATUA 4M63C 3WXKA 2DPNA 4BREA 3O08A 1IJJA 1GLLO 4CZEA 4BROA 4BRNA 3SK3A 3QBWA 3FZHA 4PKIA 3LM2A 1RGIA 3CIPA 2V7ZA 2VYPA 3ZEUA 1HX1A 5JLHA 1C0GA 2E2QA 1DEJA 2P9PA 4CZGA 3S41A 2P9SA 5FPDA 1NGJA 3H1VX 1NGIA 1KAZA 3QFUA 2YCHA 4IO8A 5JMVA 3HSCA 3D2FB 1SAZA 2P9KA 4RWTA 3L0QA 5AQRA 2E2PA 2YHXA 4PKHA 3EL2A 3AARA 1U2VA 2P9PB 5AZIA 2I7NA 3FFKB 4H5NA 4JN4A 4K42A 4A2AA 2ZGZA 1MWMA 3AAQA 4IZ9A 2E2NA 1E4GT 4Z94A 4JD2A 3KHYA 4BR7A 4H5TA 4BRLA 2GEMA 4MLEA 4WQ4C 4Y0WA 5EOYA 3IMXA 1DGKN 3OHRA 3IUCA 5BR9A 2GTDA 4FWSA 3FLCO 1XQSC 3R8EA 1QHAA 5BPLA 2A40A 1DKGD 1QQNA 3KZBA 3J8AA 3MN7A 4FPAA 4DHYA 3SMSA 1NGHA 1HPMA 1NGGA 3GBTA 1S3XA 1YAGA 3DXMB 3D7EO 1V4TA 2EWSA 3H3OB 3HM8A 4IWVA 4HWIA 4CBUA 5EXWA 4BC2A 4CD3A 1HKCA 2ITMA 3GE1A 4C23A 1J6ZA 3VOVA 4BRCA 3BF1A 5BRFA 1NGCA 3B8AX 1HJOA 2A3ZA 3KVGA 3L4IA 5F2RA 4BRAA 4B1VA 3O1WA 2QWOA 4WYBA 3O1BA 1HKBA 3O4WA 1BA1A 3VEOA 5AZIB 1T6CA 3M3ZA 4H0YB 3CJ1A 3MMVA 4FWQA 1NBWA 2Q2RA 3ZX2A 4ISEA 1BG3A 3DXKA 3HI0A 5KPTA 1HUXA 2HMPA 4BC3A 4J8FA 1GLFO 3FR0A 2YHWA 4H0TB 5BRDA 3RSEA 3JS6A 4BC4A 5AQPA 3VESA 3U9ZA 2ZWHA 4CBWA 1NMDA 2E20A 3JXUA 3HZ6A 4BRDA 5AZJB 2P9UB 2P9KB 2YI1A 4FWLA 2YHYA 4JNEA 3CQYA 4PKGA 1SZ2A 5BPMA 2YJEA 3A5MC 4F9OA 3F9MA 3ZETB 2P9SB 3L6QA 5AQKA 4E1JA 2D4WA 4BR9A 1NWKA 1Z6RA 4CJ7A 1WUAA 3WXIA 5AQYA 5JLFA 2VWBA 3QBXA 3BEXA 4B1ZA 4BG9A 1K8KA 1QQMA 2NZTA 3AAPA 3CJAA 4CI6A 4BRKA 2W41A 5B8HA 3EZWA 1QZ5A 3FZMA 4GNIA 3VGLA 1BOTO 4AM6A 4A2BA 4K41A 4DCHA 2IVOA 3D2EB 4CZJA 2GELA 1GLJO 4M7XA 3IFRA 5E26A 5AQOA 3UKUA 4FL9A 1BUPA 5F1XA 4WQ5A 4BVPA 1YVNA 1BWFO 1U2VB 2NLXA 3MN9A 4CZLA 4BGBA 5KPZA 3I33A 3VETA 1R59O 2P9LB 4XEIA 1JCGA 5ADXA 4FWRA 1TUUA 3FGUA 3WXLA 4B1XB 2VCPA 2E1YA 1TUYA 3W3DA 4H0VB 3SMPA 1Q18A 3QDKA 1YXQA 4EAHD 3A5LC 1ZXOA 3DWLA 3LL3A 4YDUC 5ELZA 5BPNA 5AQLA 2P9NB 3CETA 2V7YA 1HLUA 1X3MA 1XUPO 3UKRA 3H46O 2YJFA 1NGFA 4BRPA 4BG8A 2BTFA 1NGBA 1QZ6A 4YDUA 4FWMA 1K8KB 2E2OA 4B1WB 3RSEB 3AY9A 3DXMA 5AQQA 2Q36A 4RCHA 3VENA 4H5VA 4B9QA 4EIAA 2IIRA 4FWKA 4O8KA 2HF3A 1ATNA 5AQZA 5AQWA 1RDWX 3FE1A 1TYQB 5AQFA 4BRMA 4BRQA 3EKUA 3H3NO 2A5XA 4KBOA 2D0OA 1BU6O 4BQZA 2P9UA 4QS9A 3CJ7A 5AQNA 3MN5A 2NRHA 1CZAN 2FF3B 3ID8A 5BN9A 1YUWA 4QS8A 4CZFA 3WT0A 3BP8A 4CZMA 2CH6A 2KHOA 3A0IX 2PAVA 4BRGA 1KXPA 3ULEB 4BQLA 5F0XA 3O6WA 3ENHA 1ATSA 3WEEB 4K25A 3EN9A 4XH5A 1E4FT 3WXJA 1G99A 1QQOA 4MLHA 3LDNA 3WEEA 2P9LA 3MN6A 2ASMA 2QW9A 5KQDA 4FWNA 3QFPA 3U9DA 2P9IA 2QWNA 3MCPA 5BREA 5AQTA 3UKUB 2OANA 3VEYA 5AFUA 4FSVA 5FPNA 2WUSA 5AR0A 3A8YA 1P8ZA 3ATVA 4ISFA 2F9WA 2H3GX 1ATRA 3VF4A 5AQMA 3VEZA 2AP1A 3DAWA 1MA9B 5AZJA 4PL8A 3UKRB 4XH1A 2F9TA 4JD2B 5ADXH 4FWOA 4BC5A 4FOIA 3FZKA 1NGAA 2P9NA 1NGDA 1V4SA 3G25A 2W40A 3R9PA 2FXUA 2PBDA 1MDUB 3LDOA 1ESVA 4H0OA 4IXCA 2UYTA 4H0XB 5AQVA 3VF6A 1GLCG 2AA4A 2V52B 4DB3A 4JAXA 1HKGA 2QWQA 4B1UB 4WQ4A 2FLOA 3H1QA 2Q31A 5CE3A 2GWKA 4A61A 3HBTA 2CH5A 3ENOA 5FPEA 4FOEA 4BR4A 1OKJA 1S22A 3EKSA 3VGMA 5JICA 1X3NA 4ISGA 5EVZA 1NM1A 3DXKB 3GG4A 4IJAA 3A5NC 3ZX3A 1JCFA 2GWJA 3O8MA 1TYQA 1H1VA 4BGAA 5AQUA 5I9EB 3QMLA 4H5WA 2HF4A 3ULEA 2CGLA 2FF6A 4CZHA 3VEXA 4L3QA 2ASOA 3CI5A 4EFHA 3H45C 3GL1A 3FZFA 1LOTB 4LC9B 2I7PA 3CQXA 1MWKA 3R6MA 2Q1NA 2E1ZA 2QWLA 5AQXA 3WQTA 3GDQA 4BRHA 1RFQA 5E84A 3LDQA 3I8BA 2P9IB 3BF3A 3VEVA 1Y64A 4MO4A 5KQ8A 4I6MB 4MO5A 4A62A 3MDQA 4CZKA 4FPBA 2FSKA 1KAXA 3VERA 2A42A 3GOIA 3C7NB 4NO7A 3DJCA 5AQSA 3HTVA 1GLAG 2A41A 1ZC6A 3CERA 4XH4A 3SJHA 2ZGYA 3ZX0A 4FWPA 3CHWA 3D2EA 1Z05A 5EX5A 3VF2A 3VEWA 3U8XA 5AQIA 1NLVA 4HTLA 2BUPA 3O80A 2CGKA 5AQHA 5TKYA 1NGEA 2ZF5O 3MK6A 3VPZA 1X9JA 1ZBSA 3LDLA 3QICA 2E88A 5LY3A 4CZIA 3UB5A 5AQJA 4GY2B 3UE5A 3U4LA 4EHTA 3TPQA 1GLEG 4H0PA 5BRHA 2D0PA 2J4RA 3VGKA 3FZLA 3ZETA 2IVNA 2FSNA 3A5OC 3M1FA 4IJNA 1D4XA 1KAYA 2Q0UA 2Q0RA 4FO0A 4JHDA 1WOQA 4JHDB 3WQUA 4H5RA 2D1KA 4BR5A 4WQ5C 2A6AA 3QB0A 4AM7A 1BA0A 1EQYA 4RTFD 4H03B 2QWRA 4BR0A 1JCEA 4PL7A 1BO5O 3C7NA 3H6EA 5AFUH 5LJWA 2QM1A 1BDGA 2QWPA 1GLDG 4CBXA 4B1YB 3SLCA 2V51B 2HOEA 3EO3A
chains in the Genus database with same CATH superfamily
1RDBA 1OVQA 1QHTA 3H08A 3MXMA 4DFMA 1I39A 3N4PA 3WUHA 4NB4A 3S9HA 3MWPA 2ZJRL 3I8DA 1U49A 1LAVA 1VQ9N 4FZZA 3P4IA 1VSLA 3LDPA 3TU5A 4HHTA 4QS7A 3M6GA 5A2QO 5KPRA 4OLAA 3AO2A 4CJSA 1S9EA 2FSJA 3CJCA 4F2SA 3OW2M 3U3YA 2Q97A 3IDHA 3ISNC 3ID6A 4K43A 4NLBA 4I2PA 1GLLO 3QLHA 1L3VA 4CZEA 3THYB 4BRNA 3SK3A 1FKPA 2V7ZA 4DV4K 5JLHA 3E9LA 1NJIO 3CFRA 4CK2A 3L2WA 4DKWA 4HUGA 3VQ7A 5C24A 1SAZA 2P9KA 3L0QA 3QETA 4M42A 2QEXN 4PKHA 3EL2A 4UQGA 2HBKA 4JKFA 2GX9A 3FFKB 3VA3A 4JN4A 5GAEP 2ZGZA 4A5BA 1CXQA 3C95A 4UY8O 2W6LA 1VSKA 4JD2A 3KHYA 1VHXA 2GEMA 4Y0WA 3NCIA 4E89A 3IMXA 3M8SA 3F5TA 1DGKN 2OPPA 1IV0A 3IUCA 5BR9A 4FWSA 3R8EA 3K0SA 1RBVA 1DKGD 4K8ZA 3SBTA 3MN7A 4FPAA 5BR8K 4F4KA 4IG3A 1VQLN 4DSEA 1VQNN 1S3XA 1YAGA 3QO9A 4M45A 3OS0A 2EWSA 3OBWA 1UA1A 4HWIA 2HSTA 1TKXA 4AHTA 2ITMA 3OYEA 4I7FA 4Y1DA 1J6ZA 4ILJA 1Q8IA 5F2RA 4BRAA 4FJIA 4WFAL 4WYBA 4JI8K 3O1BA 1HKBA 3CM5A 4JI7K 2FBXA 1ITGA 3M3ZA 4H0YB 3WXMB 1BIZA 3CJ1A 1JLEA 3C6HA 4HVJA 3I55N 3K58A 2HMPA 4BC3A 3SUNA 2DFEA 4H0TB 3NH1A 4EP4A 2F8TA 3RSEA 3JS6A 4BC4A 5AQPA 3TTDA 3VESA 4E0DA 1TAUA 4CBWA 3TABA 2GUIA 3SV3A 2E20A 4KO0A 3NGZA 1NK7A 2UXCK 4BRDA 3AVBA 2O8DB 4KH6A 3CQYA 3A5MC 2XY5A 3LZIA 3SZ2A 4V19S 3L6QA 1QE1A 4BR9A 4CJ7A 3ZT2A 1Z6RA 3WXIA 2FBYA 2BANA 3BEXA 3HL8A 5HOOA 3MEGA 4CJPA 4DR5K 3CJAA 4CI6A 1VSJA 1VQON 3EZWA 1QZ5A 4CEDA 4JI1K 3L2VA 2BH1A 4GV3A 4MDBA 1YT3A 4KREA 1T05A 3LDSA 4DUYK 4FM2A 2GELA 3IKMA 3SBGA 4AHRA 4M7XA 3IFRA 5E26A 5AQOA 4E7LA 4FLYA 1BUPA 2P51A 1K8AO 1RT6A 4DTOA 3OYBA 1TV6A 5GAGP 5C15A 1TGOA 4CCHA 2KFNA 1LWFA 1R59O 4B3MK 5ADXA 5DM6L 4DU3A 3VQPA 4DTUA 4X64K 1K73O 1HMVA 3KD1E 4XIUA 4I9QA 5K14A 4DTRA 5HLFA 4EAHD 1ZXOA 3LL3A 2HHTA 5BPNA 2P9NB 3AVMA 1GOCA 2V7YA 4JKAA 3RMAA 4B9TA 1RBUA 1JLBA 1S1WA 1KTQA 4CJ4A 4CIEA 2PY5A 1NGBA 4YDUA 2E2OA 3V1OA 4B1WB 3V9SA 4RCHA 3VENA 3AVFA 3EE9A 2X74A 2HF3A 4IKFA 5AQZA 2QKKA 1BL3A 3M8PA 1WSGA 1TYQB 3SAHA 1BI4A 3LP3A 5AQFA 4BRQA 3E66A 1QSYA 2YNHA 2P9UA 4QS9A 4NLCA 2FF3B 3ZSZA 4MFBA 4NYFA 4CZMA 2OPRA 3A0IX 2PAVA 2RE2A 3EYZA 3VQEA 3O6WA 4IG0A 1OH5A 1ATSA 4MQ3A 2Y1IA 3WEEB 1NNEA 1VQ6N 3EN9A 5CY4A 4YOTA 5GADP 3AA5X 1XI1A 4M3TA 4MLHA 3LDNA 2P9LA 3MN6A 1VQ5N 4CGHA 4FWNA 3QFPA 2ZQBA 4FW2A 4RG8A 5BREA 1EX4A 5AQTA 3UKUB 2OANA 3JYTA 4JEPA 3C65A 3A8YA 3DLBA 4DUZK 2F9WA 3PX0A 4NYNA 1WSFA 3DAWA 2FBVA 1MA9B 3PIOL 4XH1A 3R3LA 3HPHA 2OA8A 4BC5A 4OPAA 4FOIA 3FZKA 3R9PA 1L3SA 2FXUA 4HTUA 1L3UA 3TSPA 4JV5K 1KVBA 4LSNA 2HMIA 3SUOA 4JRQA 1M90O 3LWMA 5CZ2A 3VF6A 5JS1A 2AA4A 1JXEA 2HHHK 3H1QA 4CEZA 4C8LA 3CC4N 2GWKA 4C1NK 4A61A 5FPEA 2XO7A 5FROA 1JLAA 1OKJA 1S22A 4PHTX 4ISGA 3NGIA 4ILGB 4YFUA 1SKRA 4FVUA 3LANA 1LWEA 1JCFA 2GWJA 4FYDA 4HCBA 1TYQA 4CIFA 1H1VA 4DS4A 3QMLA 4PA1A 2G8HA 4KV8A 4CZHA 1YI2N 3VEXA 2Z1IA 4L3QA 1JL1A 4CEOA 4K0KK 3KWGA 1L3TA 3CQXA 1S6PA 3EY1A 4PY5A 3QNOA 3ASMA 4CF2A 5GIPA 4J2DA 2HW3A 3OY9A 2Q1NA 3E9PA 1BCOA 4BDPA 3GDQA 4BRHA 4DV3K 1RFQA 5E84A 3I8BA 4BDYA 2P9IB 3BF3A 4DSKA 4BE0A 1ZBHA 3LWLA 3LZJA 4A62A 3E9OA 1IKVA 3NH0A 3AVJA 5MLCQ 5CYMA 3IG1A 2HHUA 4FXDA 3V81A 4NO7A 1GLAG 3M8QA 3MX5A 3QEVA 3S3NA 2ZGYA 1QQCA 3HVRA 4KHSA 1RT3A 4TSXA 2BDPA 1NLVA 3IS9A 4CK3A 1YVUA 3OYCA 3AVHA 3MK6A 4FJGA 4CZIA 1FK9A 1J5OA 4GY2B 3UE5A 3LAMA 4NCAA 4CECA 2D0PA 1WLJA 2IVNA 2KQ2A 4O44A 4DU1A 4IJNA 3S3OA 3SNNA 3OYLA 2F8SA 3E1YA 3T19A 4CEFA 2A6AA 2I5JA 3QB0A 3F9KA 4H03B 3VQQA 2QWRA 1W2BM 1L5UA 1BO5O 4W5QA 2Z1HA 4X65K 2YNIA 3H6EA 1RNHA 3OA9A 1FJGK 1UAXA 4JK8A 2QWPA 1GLDG 3PSFA 4CBXA 2QKBA 2V51B 2HOEA 3EO3A 1HNWK 2KKZA 1VQMN 3LPUA 4B9VA 4ID1A 5BN8A 3A2FA 5JS2A 3V9XA 2W42A 3ZLJA 4OPKA 4M3ZA 1KCFA 1ZBIA 1RDUA 3LM9A 4DU4A 5EY4A 3O5BA 5J2MA 4CIGA 1NKCA 3CJ9A 4DMNA 4E1MA 2XRIA 2A1RA 1T3VA 4O5FA 4EHUA 5KRTA 4C1NI 1QSLA 4CVNE 1GLBG 2VQEK 4BR2A 2NRWA 4A59A 1Z25A 1QSSA 1HNXK 3C6TA 1I3AA 4GKJK 5FPMA 2QI2A 4LSLA 2UU9K 2O8FA 3Q7BA 3BUZB 3DLGA 3ATUA 3G4SN 1IKXA 3AVIA 4CF8A 3DMJA 2KTQA 3K57A 1EO1A 3V6DA 3AV9A 4BROA 4CFCA 3FZHA 4PKIA 4RW9A 4CJUA 1C0GA 3T7ZA 1DEJA 4O55A 2IS3A 3AVKA 3D45A 1NGJA 3H1VX 1NGIA 4CESA 2YCHA 3KK7A 3KK1A 1KQSM 3D2FB 3K5MA 3ZT0A 4DV6K 1HNVA 1BGXT 2G8KA 2E2PA 3Q7CA 3SI6A 1S9GA 3UIQA 3KLIA 2B6AA 4LH4A 5AZIA 3OS2A 4H5NA 4A2AA 3N4QA 1MWMA 4FM1A 4IZ9A 4CEAA 3NVKA 1YJNN 2E2NA 1E4GT 1N33K 4E19A 4BR7A 4H5TA 4MLEA 1YJWN 3V9ZA 2UXBK 4G9ZA 4QCLA 4Y1CA 4DR1K 3OHRA 2BE2A 3RMDA 2KZZA 4IEEA 1XQSC 3ITHA 1QHAA 5HRRA 2VG5A 2LSNA 3KZBA 3O4QA 3J8AA 3OYGA 3QEPA 4DHYA 3OBYA 1NGHA 1HPMA 1NGGA 5M1KA 4JKBA 4R5PA 3K59A 4AH9A 3D7EO 3THYA 1XNRK 1V4TA 3R1XA 3HM8A 1HYZA 4CBUA 3IAYA 3LP1A 4CD3A 3GE1A 3CCUN 5BRFA 4HCCA 1JLGA 4NXNK 4LFBK 1HJOA 3KVGA 3L4IA 1NJWA 3KK2A 3O1WA 4FM0A 4A57A 1OH6A 4DV0K 1W9HA 4FJJA 1X9WA 5CHIA 5KPTA 1OVYA 2RHKA 3DM2A 3FR0A 3TI0A 3C6UA 1HNIA 2IC3A 1B9FA 1SKSA 1GOAA 2ZWHA 1FXXA 4AHVA 3HZ6A 3NF8A 5AZJB 2HHSA 2P9UB 2P9KB 4FWLA 3WNHA 2YHYA 1ZYQA 4PKGA 1DT9A 3CF5L 1REVA 1I94K 4BE2A 4IOCL 1ZBFA 2HHXA 4E1JA 5JLFA 3KKRA 1FKOA 4ELUA 2UUBK 3B6OA 3ENBA 3CC2N 2EHGA 2NNWA 4GV9A 4DTSA 4A2BA 4DCHA 2HBMA 4CZJA 2X6NA 3HRGA 3I0SA 3WNFA 4CFBA 4DR6K 3UKUA 4L8RB 4RW7A 5F1XA 4C8KA 4J2AA 5E41A 2ETJA 4BVPA 4DF8A 1U2VB 3MN9A 4NCBA 4CHOA 3I33A 4AHSA 1X9MA 4IFVA 1TUUA 1Q86O 1LWCA 3WXLA 3FFIA 1IKWA 4B1XB 1WSEA 2VCPA 2E1YA 4IOXA 4H0VB 4A5AA 1Q18A 4DR2K 4AILC 3DWLA 3WNGA 5ELZA 3G10A 3O9TA 5AQLA 3L2UA 4FJKA 3OYHA 2F7TA 3NGYA 2YJFA 1NGFA 4KHWA 1XMOK 3DRSA 4FWMA 1HJRA 1T7PA 1UWBA 1RBRA 2NRTA 2Q36A 1N6QA 4B9QA 4QOZB 4DSFA 4FWKA 1Q81O 1O13A 3J81O 3FE1A 3NMUA 1GOBA 4BRMA 3EKUA 3H3NO 2A5XA 4B3TK 4BQZA 3L3UA 4N47A 2DY4A 1JL2A 4B3SK 4YOYA 3CCMN 4BDZA 3ID8A 5AJ3K 4LF5K 5BN9A 3RWUA 2WC9A 2B4JA 3BP8A 3OYIA 5C25A 2KHOA 3KK3A 3ULEB 4BQLA 1EP4A 2YNGA 3VQCA 2NRXA 4R79A 2O4IA 5I42A 4DFJA 4JK7A 4XH5A 1E4FT 1G99A 3P38A 1SS6A 5LMNK 1YTAA 2ASMA 2QW9A 3RR8A 3EEQA 4FJLA 3MCPA 4B9LA 3QIPA 3VEYA 3SUPA 2WUSA 5AR0A 4JI4K 1P8ZA 5DK5A 2H3GX 3KLEA 2XHBA 1ATRA 3VEZA 4O8UA 3KD5E 1JLQA 4PL8A 1YJ9N 3DI6A 5ADXH 4CJWA 2P9NA 1OH8A 1V4SA 3HO1A 1VQ7N 2O4GA 2PBDA 2NUBA 3LDOA 4W5NA 2QK9A 2DFFA 1VQ8N 4JKGA 4DQSA 3IRXA 4H0XB 2D0CA 5IT9O 1YHQN 4C8NA 1GLCG 2OZMA 4DB3A 1HKGA 4CFAA 4WF9L 4WQ4A 4DR3K 1VAZA 3P83D 5I3UA 3SQ4A 4BACA 5SZTA 1J9AA 4QAGA 4BR4A 4E7HA 3EKSA 2QTDA 5EVZA 3CPEA 2P5GA 1K6YA 3U3GA 3S3MA 4I9LA 4DG1A 2PZSA 3V9WA 1RT2A 3O8MA 3SJJA 4KB0A 5AQUA 5I9EB 4M3RA 4FZYA 3MEEA 2FF6A 3ZSWA 4KHYA 3SCXA 4EFHA 1TK8A 1NJXA 4ILHA 4O5BA 4DV7K 3NF7A 4LC9B 1WAFA 2I7PA 5M1FA 4JI3K 3R6MA 1CXUA 1BIUA 4KHUA 4DF4A 2E1ZA 2D0AA 2KLAA 5AQXA 3WQTA 4X66K 2G8VA 3NFAA 1IBLK 4KHNA 4IEIA 3K5OA 4CEQA 4DV1K 4DTMA 2P5OA 1N32K 2Z1JA 3T3FA 4MO5A 3J7AP 2HVIA 1TK5A 1UOCA 3BY5A 4CJ3A 2A42A 1MU2A 1RDCA 3J7ZO 3DJCA 1VRTA 3CYMA 3G0ZA 3VTIA 1ZC6A 1F21A 4BY9C 3SPZA 4XH4A 2RF2A 3SJHA 4FWPA 3CHWA 4DR7K 3AVNA 5EX5A 3JAMO 2UUCK 4KI6A 3KIOA 5AQIA 4HTLA 4FLTA 4DLEA 3O80A 5AQHA 4B3RK 1X9JA 3QICA 2E88A 2GBZA 2FC0A 3U4LA 4EHTA 5KGWA 2OTJN 3TANA 3OYKA 3D6RA 3VGKA 3OYJA 3O4NA 1TVRA 3SQ2A 3A5OC 4PUOA 4DTJA 2Q0UA 4FO0A 4JHDA 1WOQA 4CERA 5M1NA 5J2QA 2O8DA 2D1KA 2P1JA 3ZT1A 4AM7A 4YHHK 2O8FB 2ZD1A 4BR0A 4PL7A 4M3YA 4NCGA 3HP9A 2HHQA 5LJWA 2QM1A 4ICLA 4AHUA 1BDGA 4DLGA 4LFAK 5JVHL 3CMAN 3SLCA 4JYAK 1U6ZA 4BRFA 3HPGA 3O3HA 3TARA 3NF9A 3C0BA 4RW8A 3CFPA 1VSHA 2ASPA 4FJ9A 2ZE2A 3ZEUB 3TSQA 1KSPA 1IBKK 1XWLA 3PIPL 1A5VA 1KVAA 4DQ8A 1JLFA 1IH7A 1O1WA 5J2PA 5LMUK 1C0FA 1TK0A 1T6DA 2QXLA 2HHWA 3CJBA 4M7YA 1XC3A 3TAMA 1SL1A 2WFBA 4BVOA 4O0IA 2UXDK 5C12A 1D5AA 3W0LA 5LJVA 2G8IA 3T1AA 3RVCA 2IVPA 3AVCA 3WXKA 4KB1A 3OYMA 1LW2A 1KVCA 1X1PA 2DPNA 4BREA 1IJJA 3TTFA 4YOXA 2G8UA 3OYAA 3LP2A 3QBWA 3LM2A 1HX1A 1A5WA 2OZSA 2E2QA 1RDDA 4G1QA 3MX2A 2HNZA 4CZGA 2ITGA 2P9SA 3S41A 1OH7A 3V1RA 1KAZA 4KH5A 4KTWA 4FZXC 4IO8A 4H8KA 3HSCA 5M1PA 4CEEA 2W6KA 4RWTA 1N34K 4FLWA 3SQ1A 2YHXA 4GW6A 4DTNA 4GV6A 3THWA 3LAKA 1WNSA 4ELTA 1JLCA 4Z94A 4CJLA 4BRLA 4WQ4C 3C6AA 3TWHA 3T1HK 1RDAA 3VQ8A 1YITN 2GTDA 2WBNA 2B5JA 5BPLA 2A40A 1QQNA 2HBLA 3SMSA 3AA4A 3ZYYX 4FCYA 1WSHA 3H3OB 4CJTA 1VSMA 5EXWA 4BC2A 4NXMK 5DM7L 5D3GA 3TAPA 3AO4A 1NOZA 4C23A 1NK8A 4BRCA 3BF1A 4OX9K 1NGCA 3CXCM 4DSIA 2A3ZA 3CCJN 3BDPA 3OTOK 3P39A 3O4WA 1BA1A 5AZIB 3VQ4A 4JK9A 2KZMA 1KLMA 4FWQA 3CCEN 2Q2RA 3ZX2A 1EETA 2OCEA 1TL3A 1BG3A 4J8FA 1GLFO 1WBBA 1K9MO 2YHWA 3MAQA 4PQUA 5BRDA 3NE6A 4FVMA 2NRZA 1T03A 3OYNA 3JXUA 3NF6A 1NK6A 4WFBL 3I0RA 4JNEA 1SZ2A 3ZSQA 4CE9A 4H4OA 4F9OA 3ZETB 3VQBA 2D4WA 1NWKA 2JGUA 1VQPN 3BZKA 5AQYA 3ZSVA 3QBXA 1HYSA 1EXQA 4X62K 1K8KA 4CJFA 4BRKA 3THXB 3PLAA 3WNEA 4K41A 3DYAA 1C0UA 3D2EB 4DTPA 4OKJA 1GLJO 3J7YP 1VK0A 4FL9A 3CCVN 1QVGM 3O9QA 1YVNA 4DQRA 2NLXA 1RTIA 5KPZA 4BWJA 3RRGA 1C0MA 3VETA 1QTMA 2P9LB 4XEIA 5KTQA 4FWRA 3RMCA 4YORA 4CK1A 2KW4A 2A1SA 3L2RA 5FRNA 4OLBA 1HNZK 3SMPA 5J1EA 3CCQN 3QDKA 3TTCA 4N5SA 1Q9XA 2YNFA 1YXQA 4KHQA 3A5LC 4C8OA 4YDUC 1XC9A 4IO9L 4HUEA 3O9SA 1XHZA 3CETA 1HLUA 3TSUA 4HUFA 1UA0A 4O4GA 1XUPO 3UKRA 3MCAB 3SUQA 4BRPA 3QIOA 2UUAK 4JI5K 1QZ6A 1BI4B 1TAQA 3RSEB 5KI6A 3VMFB 4FK0A 3AY9A 3DXMA 5AQQA 2OTLN 4H5VA 4IOAL 4JI2K 4B8CA 4O8KA 2G8WA 1ATNA 5AQWA 4E7KA 1HR0K 4IFYA 1R0AA 4DR4K 2HNYA 1Q7YO 3CC7N 4KBOA 2D0OA 1BU6O 5C2FA 3DRPA 1Q82O 4JLHA 3CJ7A 2PYJA 3MN5A 5IWAK 2NRHA 1CZAN 3KTQA 5FDLA 3OYDA 3TAEA 4CZFA 3PV8A 4FLUA 4BRGA 5HP1A 1KXPA 5F0XA 3ENHA 3V9UA 2JWKA 3BGRA 1RTDA 4Z4FA 4J2EA 2PFUA 1WBDA 1W0HA 3EE8A 1VSIA 4LY7A 1CLQA 4AF1A 5KQDA 5CYQA 3U9DA 2P9IA 2QWNA 3MXIA 4ZTJA 3HOTA 5AFUA 5FPNA 1JJ2M 2GV9A 3VTHA 3VA0A 4ISFA 3QESA 1S1VA 1KRPA 3VF4A 2D0BA 5AQMA 2YHAA 3NDKA 2AP1A 2PYLA 5AZJA 4Z4GA 2O8BB 3UKRB 3AA2A 3K5NA 5DMRA 4FWOA 4DTXA 1HYVA 1NGDA 3DLEA 1NK4A 1D8YA 4OPJA 4H0OA 2JWLA 3V4IA 2ZJQL 4DV2K 1RTHA 1YF5L 2O8CA 5HRSA 4JAXA 1SKWA 2FLOA 3HT3A 5CE3A 1KFSA 1ZBLA 1M1KO 2IDOA 1IG9A 3VGMA 1U45A 1U47A 3OVNA 2F96A 5SWMA 1NM1A 3DXKB 3GG4A 4IJAA 3ZX3A 3EZ5A 3VQAA 3DOLA 4DV5K 3LPTA 1RT7A 5C42A 4W5OA 4H5WA 2HF4A 4IBNA 1IO2A 1NJZA 2ASOA 3H45C 4YOWA 4FJHA 3FZFA 4WE1A 3VQDA 1LOTB 5C0YA 3ULDA 3T69A 2JLEA 5HRNA 1S1XA 1RT4A 2Y1JA 1E3MA 2QWLA 2VGNA 4KHPK 4FLZA 4FK2A 4W5RA 3MECA 3MWTA 3NAEA 3LDQA 2BGGA 1Y64A 2ZJPL 2ATQA 4I6MB 3VQ9A 3QERA 3SV4A 3K9JA 4FPBA 3RMBA 3OJSA 2FSKA 1D9DA 4CHNA 1W7AA 3HTVA 4JS4A 5C10A 3ZX0A 4B3OA 3CD6N 1Z05A 3VEWA 3SPYA 3U8XA 5CR4A 2BUPA 4OJRA 3PX4A 4JS5A 1NGEA 2ZF5O 3VPZA 3P1GA 1ZBSA 3LDLA 5CZ1A 5LY3A 3QINA 2VQFK 1JKHA 3UB5A 5AQJA 3KLGA 3DOKA 4H0PA 5BRHA 2RPIA 3ZETA 1KC8O 3JSMA 2FSNA 4RW4A 3M1FA 4FLXA 4B9SA 3TAGA 1VRUA 3OS1A 3DLRA 1KAYA 3QEWA 4LF6K 4BR5A 4CGDA 3THXA 1EQYA 4RTFD 4Z4EA 4JKHA 2E6LA 4I2QA 4DQIA 1KFDA 3TAQA 3C7NA 4KPYA 4CF9A 5AFUH 4CHYA 5KRSA 4Z4CA 1WSIA 4Z0UA 5KGXA 4B1YB 1WSJA 3L4QA 4CEBA 4OO1J 1NKEA 3U6FA 1IG8A 5AQGA 1NOYA 4CHQA 3HPOA 1LAWA 4CFDA 2GUPA 3AVAA 1LCUA 1IKYA 3OYFA 2O8CB 3D2FA 3RTVA 3SQ0A 4GKKK 1LW0A 2XY8A 2QWMA 4I6MA 4CD1A 1SUQA 5HRPA 3NVMA 4K8XA 2CGJA 2E8AA 1U04A 4M3WA 1QVFM 1SQKA 4BWMA 1RT1A 1T44A 4BRIA 4M63C 2X6SA 1HPZA 3O08A 4GVMA 4DQPA 4Z4IA 3AGRA 1U48A 2E5LK 3F73A 3ZCMA 4N41A 1RGIA 3CIPA 3ZEUA 2VYPA 4IDHA 3K2PA 5GAHP 3AO3A 4CJEA 2P9PA 3SAFA 4KTZA 5FPDA 3G71N 3QFUA 5H1SQ 4OGEA 4U7BA 1NJYA 5JMVA 3ZT4A 1DLOA 1J54A 2QA4N 3ALYA 5AQRA 2HHVA 4CJRA 4FJXA 2IAJA 1U2VA 2P9PB 3AARA 2XY6A 2I7NA 2HBJA 4K42A 3M8RA 3F2KA 3RRHA 3AAQA 4CF1A 1RCHA 2VGMA 3KWIA 4GMJB 5EOYA 2DFHA 2WTUA 4O0JA 1JXBA 1NK5A 1SL0A 1NG9A 4FJMA 2WOMA 4EZ6A 3FLCO 4MDAA 3VN5A 2IGIA 4CHZA 3PSIA 2OPQA 4KTQA 3HYFA 4JRPA 2WONA 3GBTA 3DXMB 1X9SA 4IWVA 4GVEA 4B9NA 1C6VA 1C1CA 1HKCA 4KAZA 3VOVA 1ASUA 1TKTA 4JI6K 1C1BA 4WCEL 3B8AX 1NKBA 4ID5A 4B1VA 2QWOA 1YIJN 4FJ8A 3VEOA 1T6CA 4DS5A 3MMVA 1NBWA 3VQ5A 3HOSA 1VSEA 4ISEA 2VWJA 3DXKA 3HI0A 4F3TA 1HRHA 1HUXA 4JKGB 1DTTA 4LF9K 5FLXO 4BE1A 3ZSXA 1RTJA 1G15A 3THVA 3U9ZA 3I56N 1NMDA 2Q3SA 4LF7K 5HROA 3TR8A 4Z4HA 2OPSA 1WAJA 2YI1A 1J53A 4KH4A 5BPMA 2YJEA 1BHLA 3F9MA 2P9SB 1XHXA 2Z1GA 3CPWM 3DRRA 5AQKA 2YX6A 3QNNA 1WUAA 4YOVA 2VWBA 3PX6A 1QS4A 4B1ZA 4YNQA 2KFZA 4EZ9A 1NMNA 1C0TA 3P31A 1ASVA 4BG9A 1LV5A 1QQMA 1ZBUA 2NZTA 3AAPA 4CGIA 5FRMA 4LF4K 2W41A 4PWDA 5B8HA 4ZTFA 1S1TA 2HVHA 3FZMA 4GNIA 5HBMA 1BOTO 3VGLA 4AM6A 2IVOA 5HL7L 3QEXA 3P5JA 2G8FA 1CZBA 5TKWA 1ILYA 3NH2A 1CZ9A 1Z26A 4WQ5A 3G6EN 3CG7A 1BWFO 4JKEA 3HXMA 5JVGL 4CZLA 4BGBA 3RR7A 3ZSOA 3L2QA 3DLKA 3HM9A 3PY8A 1JCGA 1BQMA 4DQQA 4DFPA 4J2BA 3FGUA 1TKDA 2E4LA 1TUYA 3C94A 3W3DA 3J80O 4Q0BA 3NHGA 3SAGA 3M5RA 2F4VK 4CGFA 3KLFA 2DTUA 4B9MA 1KD1O 1X3MA 5M1QA 4RW6A 2NRRA 3H46O 1XMQK 3TAFA 1TKZA 2XY7A 4BG8A 3O9RA 3HSTB 2BTFA 3PO4A 1FW6A 4DSLA 1RBTA 1K8KB 1B92A 3SYZA 1U4BA 3KKSA 2NRVA 3K9KA 2YV0X 3CMEN 3HJFA 4OKKA 3CQ8A 4EIAA 2IIRA 4E7IA 2VG7A 4E3SA 1N8RO 1ASWA 1RDWX 4OKEA 4B08A 4M3UA 1YTUA 4OGCA 2AJQA 4FJNA 5AQNA 5M1OA 3AO1A 3AA3A 1C1AA 3OJUA 1YUWA 4W5TA 1A5XA 1WN7A 1S72N 4QS8A 5T7BA 3WT0A 1S5JA 2O8EA 1RT5A 2CH6A 2D5RA 4CGGA 3HK2A 3O3FA 4E7JA 2ZM6K 4K25A 3WXJA 1QQOA 3WEEA 3HVTA 4U67L 1VQ4N 3QEIA 2VG6A 4YY3K 4OPHA 4FSVA 2QXFA 3ATVA 4DWIA 3ZSRA 5GINA 2O8BA 2YKNA 4M41A 4FJ7A 1XNQK 1SL2A 4B9UA 2F9TA 4JD2B 3MEDA 3CCSN 3L3VA 1NGAA 4CHPA 3G25A 4IDKA 2W40A 4M3XA 1TL1A 1Y97A 2YKMA 4Q5VA 1WB9A 4JI0K 5GIOA 1MDUB 1NK0A 1J5EK 1ESVA 3NBPA 4IXCA 2UYTA 4ZHRA 1N5YA 2FBTA 4F8RA 5AQVA 3O9UA 1BISA 2V52B 2QWQA 4B1UB 4JKDA 3DLHA 2Q31A 1T8EA 1VQKN 3HBTA 2CH5A 3ENOA 1HQEA 4FOEA 4WFNL 5JICA 1X3NA 2O8EB 3T1YK 4F3OA 4FJ5A 4CF0A 1P90A 1DTQA 3A5NC 2YHBA 1B9DA 3LALA 4YOUA 4DSJA 3E01A 4N56A 3CCRN 4BGAA 2R7YA 4DFKA 4H4MA 3B6PA 3ULEA 2CGLA 4F2RA 4LF8K 1BQNA 3HP6A 1Q9YA 3AO5A 1VSFA 5J2NA 4FK4A 4E1NA 1EWQA 3CI5A 2EX3A 3GL1A 3AGKA 3CFOA 3K5LA 3MXJA 1MWKA 1EKEA 1KLNA 4FLVA 3PUFA 5LL6Z 3KLHA 4B8AB 3KJVA 2HNDA 4KI4A 4AQYK 3V1QA 1N36K 3VEVA 3PO5A 5C2DA 4MO4A 4CJVA 5KQ8A 3VQ6A 4KFBA 4CJ5A 3CCLN 3MDQA 4CZKA 1SV5A 3AVGA 1KAXA 3VERA 3GOIA 3C7NB 2OYQA 2IOCA 5AQSA 2A41A 3ZSYA 4OVLA 3ZT3A 4ELVA 3CERA 2RKIA 3VF2A 3D2EA 4LFCK 5EU7A 3L8BA 3O3GA 4FW1A 4KRFA 2CGKA 5TKYA 4JKCA 1NU0A 1RBSA 4LH5A 4AHCA 1RILA 3TPQA 1W97L 3AVLA 1GLEG 4LD0A 2J4RA 3FZLA 3BZCA 2E6MA 1D9FA 1D4XA 1HQUA 4N76A 2Q0RA 2RN2A 4JHDB 1S6QA 2HB5A 3WQUA 4CGJA 4H5RA 4CJQA 4WQ5C 1BA0A 3LP0A 3D0PA 4EP5A 2VWKA 1NK9A 3THWB 4C8MA 4KKOA 1JCEA 4CW7B 1EWRA 1BCMA 4CJKA 3CM6A 1S1UA 4IFEA 2X78A 3DLLL 1IBMK 1VSDA
chains in the Genus database with same CATH topology
2KKZA 1VQMN 1U6ZA 4BRFA 3L4QA 5BN8A 4OO1J 3C0BA 2ASPA 3N4PA 3WUHA 1IG8A 4NB4A 5AQGA 3MWPA 3ZEUB 3TSQA 2ZJRL 1RDUA 3LM9A 5EY4A 3O5BA 3PIPL 1VQ9N 2GUPA 3P4IA 4DQ8A 3CJ9A 1LCUA 3LDPA 1C0FA 3D2FA 3TU5A 1T3VA 4O5FA 4EHUA 4C1NI 1T6DA 2QXLA 4QS7A 1GLBG 2QWMA 3M6GA 4I6MA 4CD1A 4BR2A 3CJBA 4M7YA 2NRWA 4A59A 5KPRA 1XC3A 3NVMA 2WFBA 2CGJA 4BVOA 2FSJA 5C12A 2E8AA 3CJCA 5FPMA 2QI2A 3W0LA 1SQKA 5LJVA 3OW2M 1QVFM 3RVCA 2IVPA 1T44A 2Q97A 4BRIA 3IDHA 3Q7BA 3BUZB 3ID6A 3ATUA 4K43A 4M63C 3WXKA 3G4SN 2DPNA 4BREA 3O08A 1IJJA 1EO1A 4NLBA 1GLLO 3TTFA 4YOXA 3AGRA 4CZEA 4BROA 4BRNA 3SK3A 3QBWA 3FZHA 4PKIA 3LM2A 1RGIA 3CIPA 2V7ZA 2VYPA 3ZEUA 1HX1A 5JLHA 3E9LA 4IDHA 1C0GA 2E2QA 3T7ZA 5GAHP 1DEJA 2P9PA 3MX2A 4CZGA 3S41A 2P9SA 5FPDA 3SAFA 3G71N 1NJIO 1NGJA 3H1VX 1NGIA 1KAZA 3QFUA 4KH5A 2YCHA 5H1SQ 4U7BA 4DKWA 3KK7A 4IO8A 5JMVA 3HSCA 3D2FB 5M1PA 1KQSM 2QA4N 1SAZA 2P9KA 4RWTA 3L0QA 5AQRA 2E2PA 3Q7CA 2QEXN 2YHXA 4PKHA 3EL2A 3AARA 1U2VA 2HBKA 2P9PB 5AZIA 2I7NA 4JKFA 2GX9A 2HBJA 3FFKB 4H5NA 4GV6A 4JN4A 4K42A 4A2AA 5GAEP 2ZGZA 3F2KA 3N4QA 4A5BA 1MWMA 4UY8O 3AAQA 4IZ9A 2VGMA 3NVKA 1YJNN 2E2NA 1E4GT 3KWIA 4Z94A 4JD2A 3KHYA 4BR7A 4H5TA 4BRLA 2GEMA 4MLEA 4WQ4C 3C6AA 4Y0WA 5EOYA 1YJWN 3IMXA 4G9ZA 3F5TA 1DGKN 1YITN 3OHRA 3IUCA 5BR9A 2GTDA 4FWSA 4IEEA 2WBNA 1XQSC 3FLCO 1QHAA 4MDAA 3R8EA 5BPLA 2A40A 1DKGD 3SBTA 1QQNA 3KZBA 3J8AA 3MN7A 4FPAA 2HBLA 4DHYA 3OBYA 3SMSA 1NGHA 1HPMA 1NGGA 5M1KA 4JKBA 1VQLN 3ZYYX 1VQNN 3GBTA 1S3XA 1YAGA 3DXMB 3D7EO 1V4TA 2EWSA 3H3OB 3HM8A 3OBWA 3R1XA 4GVEA 4HWIA 4IWVA 4CBUA 5EXWA 4BC2A 4CD3A 2HSTA 1HKCA 5DM7L 2ITMA 3GE1A 4C23A 1J6ZA 3VOVA 4ILJA 3CCUN 4BRCA 3BF1A 5BRFA 1NGCA 4WCEL 3CXCM 3B8AX 1HJOA 2A3ZA 3KVGA 3L4IA 5F2RA 4BRAA 3CCJN 3P39A 4B1VA 3O1WA 2QWOA 4WYBA 4WFAL 3O1BA 1HKBA 3O4WA 1YIJN 1BA1A 4A57A 3VEOA 5AZIB 1T6CA 4JK9A 3M3ZA 4H0YB 3WXMB 3CJ1A 3MMVA 4FWQA 3CCEN 1NBWA 2Q2RA 3ZX2A 3C6HA 3HOSA 3I55N 4ISEA 1BG3A 5CHIA 3DXKA 3HI0A 5KPTA 1HUXA 1OVYA 2HMPA 2RHKA 4J8FA 4JKGB 4BC3A 1GLFO 3FR0A 1K9MO 2YHWA 4H0TB 5BRDA 3RSEA 2NRZA 3JS6A 4BC4A 5AQPA 3TTDA 3VESA 3U9ZA 3I56N 2ZWHA 4CBWA 1NMDA 2E20A 3JXUA 3HZ6A 4BRDA 5AZJB 4WFBL 2P9UB 2YI1A 2P9KB 4FWLA 2YHYA 4JNEA 4KH6A 3CQYA 4PKGA 1SZ2A 1DT9A 4KH4A 5BPMA 3CF5L 2YJEA 3A5MC 4F9OA 3F9MA 3ZETB 2P9SB 4IOCL 3L6QA 3CPWM 5AQKA 2YX6A 4E1JA 2D4WA 4BR9A 1NWKA 1Z6RA 4CJ7A 1WUAA 3WXIA 5AQYA 5JLFA 2VWBA 4YOVA 3QBXA 1VQPN 3BEXA 4B1ZA 5HOOA 3ENBA 4BG9A 3P31A 3CC2N 1K8KA 1QQMA 2NZTA 3AAPA 3CJAA 4CI6A 2NNWA 4BRKA 2W41A 5B8HA 1VQON 3EZWA 4GV9A 3PLAA 1QZ5A 3FZMA 4GNIA 2BH1A 4GV3A 3VGLA 1BOTO 4MDBA 4AM6A 4A2BA 4K41A 4DCHA 2HBMA 2IVOA 3D2EB 5HL7L 4CZJA 2GELA 3HRGA 1GLJO 3IKMA 3SBGA 4M7XA 3IFRA 5E26A 5TKWA 5AQOA 3UKUA 1ILYA 4FL9A 1BUPA 5F1XA 3G6EN 4WQ5A 3CCVN 1QVGM 3O9QA 1K8AO 4BVPA 1YVNA 1BWFO 1U2VB 2NLXA 3MN9A 4JKEA 5JVGL 4CZLA 4BGBA 5KPZA 5GAGP 5C15A 3I33A 3VETA 1R59O 2P9LB 4XEIA 1JCGA 5ADXA 4FWRA 1TUUA 5DM6L 4YORA 1Q86O 3FGUA 3WXLA 1K73O 4B1XB 2VCPA 2E1YA 1TUYA 4IOXA 3W3DA 4H0VB 4A5AA 3SAGA 3SMPA 3CCQN 1Q18A 3QDKA 3M5RA 3TTCA 1YXQA 4EAHD 3A5LC 1ZXOA 3DWLA 3LL3A 4YDUC 5ELZA 5BPNA 3O9TA 5AQLA 4IO9L 3O9SA 2F7TA 2P9NB 3CETA 4JKAA 2V7YA 1KD1O 1HLUA 1X3MA 3TSUA 1XUPO 5M1QA 3UKRA 3MCAB 2NRRA 2YJFA 1NGFA 3H46O 4BRPA 4BG8A 3O9RA 2BTFA 1NGBA 1QZ6A 4YDUA 4FWMA 1K8KB 2E2OA 4B1WB 3RSEB 2NRTA 3VMFB 2NRVA 3AY9A 3DXMA 3K9KA 2Q36A 4RCHA 5AQQA 3VENA 2OTLN 4H5VA 3EE9A 3CMEN 4B9QA 4IOAL 4EIAA 2IIRA 4FWKA 4O8KA 2HF3A 1Q81O 1ATNA 5AQZA 5AQWA 1O13A 1N8RO 1RDWX 3FE1A 3NMUA 1TYQB 3SAHA 5AQFA 4BRMA 4BRQA 1Q7YO 3E66A 3EKUA 2A5XA 3H3NO 4KBOA 2D0OA 1BU6O 4BQZA 3CC7N 2P9UA 4QS9A 5C2FA 1Q82O 4YOYA 3CJ7A 5AQNA 4NLCA 5M1OA 3CCMN 3MN5A 2NRHA 1CZAN 2FF3B 3ID8A 5BN9A 1YUWA 1S72N 4QS8A 2WC9A 4CZFA 3WT0A 3BP8A 4CZMA 2CH6A 2KHOA 3A0IX 2PAVA 2RE2A 4BRGA 1KXPA 3ULEB 4BQLA 2NRXA 4R79A 5F0XA 3O6WA 3ENHA 2JWKA 1ATSA 3WEEB 4JK7A 1VQ6N 4K25A 3EN9A 4XH5A 4YOTA 1E4FT 3WXJA 5GADP 2PFUA 1G99A 1QQOA 3P38A 3LDNA 4MLHA 3WEEA 1SS6A 2P9LA 3EE8A 3MN6A 2ASMA 4AF1A 1VQ5N 2QW9A 5KQDA 4U67L 4FWNA 3QFPA 3U9DA 2P9IA 2QWNA 3MCPA 1VQ4N 5BREA 5AQTA 3UKUB 3HOTA 2OANA 3VEYA 4OPHA 5AFUA 4FSVA 5FPNA 2WUSA 4JEPA 3C65A 3VTHA 5AR0A 1JJ2M 3A8YA 1P8ZA 3ATVA 4ISFA 2F9WA 2H3GX 1ATRA 3VF4A 5AQMA 5GINA 3VEZA 4O8UA 2AP1A 3DAWA 1MA9B 5AZJA 3PIOL 4PL8A 3UKRB 4XH1A 2F9TA 3R3LA 1YJ9N 4JD2B 5ADXH 4FWOA 3CCSN 4BC5A 4OPAA 4FOIA 3FZKA 1NGAA 2P9NA 1NGDA 1V4SA 3G25A 2W40A 3R9PA 2FXUA 1VQ7N 2PBDA 5GIOA 3TSPA 1MDUB 3LDOA 1ESVA 4H0OA 4IXCA 1VQ8N 4JKGA 2UYTA 2JWLA 4H0XB 1M90O 2ZJQL 5AQVA 3O9UA 3VF6A 1YHQN 1GLCG 2AA4A 1YF5L 2V52B 4DB3A 4JAXA 1HKGA 2QWQA 4B1UB 4WF9L 4WQ4A 4JKDA 1VAZA 2FLOA 3H1QA 2Q31A 5CE3A 3CC4N 2GWKA 4C1NK 4A61A 1VQKN 3HBTA 2CH5A 3ENOA 5FPEA 4FOEA 4BR4A 4WFNL 1M1KO 1OKJA 1S22A 3EKSA 3VGMA 4PHTX 5JICA 1X3NA 4ISGA 2QTDA 5EVZA 3CPEA 1NM1A 4ILGB 1P90A 3DXKB 3GG4A 4IJAA 4FVUA 3A5NC 3ZX3A 4YOUA 1JCFA 2GWJA 3O8MA 1TYQA 3CCRN 1H1VA 4BGAA 5AQUA 5I9EB 3QMLA 4H5WA 2HF4A 3ULEA 2CGLA 2FF6A 4CZHA 1YI2N 3VEXA 4L3QA 2ASOA 3CI5A 4EFHA 3H45C 4YOWA 3GL1A 3FZFA 3KWGA 1LOTB 4ILHA 3AGKA 4LC9B 5C0YA 2I7PA 5M1FA 3T69A 3CQXA 1MWKA 3R6MA 5GIPA 2Q1NA 2E1ZA 2QWLA 3E9PA 2KLAA 2VGNA 5AQXA 3WQTA 3GDQA 4BRHA 1RFQA 3MWTA 4IEIA 5E84A 3LDQA 3I8BA 2P9IB 3BF3A 3VEVA 5C2DA 1Y64A 2ZJPL 4MO4A 5KQ8A 4I6MB 4MO5A 4A62A 3E9OA 3CCLN 3K9JA 3MDQA 4CZKA 4FPBA 2FSKA 5MLCQ 1KAXA 3VERA 2A42A 3GOIA 3C7NB 3J7ZO 4NO7A 3DJCA 5AQSA 3HTVA 1GLAG 2A41A 4BY9C 3VTIA 3MX5A 1ZC6A 3CERA 4XH4A 5C10A 3SJHA 2ZGYA 3ZX0A 4FWPA 3CHWA 3D2EA 1Z05A 5EX5A 3VF2A 3CD6N 3VEWA 3U8XA 5AQIA 1NLVA 4HTLA 5CR4A 2BUPA 3O80A 2CGKA 5AQHA 5TKYA 1NGEA 2ZF5O 3MK6A 4JKCA 3VPZA 1X9JA 1ZBSA 3LDLA 3QICA 2E88A 5LY3A 4CZIA 3UB5A 5AQJA 4GY2B 3UE5A 3U4LA 4EHTA 2OTJN 3TPQA 1W97L 1GLEG 3D6RA 4H0PA 5BRHA 2D0PA 2J4RA 3VGKA 3FZLA 3ZETA 2IVNA 1KC8O 2FSNA 3A5OC 3M1FA 4IJNA 1D4XA 2Q0UA 1KAYA 2Q0RA 4FO0A 4JHDA 1WOQA 4JHDB 3WQUA 5M1NA 4H5RA 2D1KA 3E1YA 4BR5A 4WQ5C 2A6AA 3QB0A 4AM7A 1BA0A 1EQYA 4RTFD 4H03B 4JKHA 2QWRA 1W2BM 4BR0A 1JCEA 4PL7A 1BO5O 3C7NA 3H6EA 3OA9A 5AFUH 5LJWA 2QM1A 4IFEA 3DLLL 1BDGA 4JK8A 2QWPA 5JVHL 1GLDG 4CBXA 4B1YB 3CMAN 3SLCA 2V51B 2HOEA 3EO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U6Z A;  4BRF A;  5BN8 A;  3C0B A;  2ASP A;  3WUH A;  1IG8 A;  4NB4 A;  5AQG A;  3ZEU B;  3LM9 A;  5EY4 A;  3O5B A;  2GUP A;  3P4I A;  4DQ8 A;  3CJ9 A;  1LCU A;  3LDP A;  1C0F A;  3D2F A;  3TU5 A;  4O5F A;  4EHU A;  1T6D A;  2QXL A;  4QS7 A;  1GLB G;  2QWM A;  3M6G A;  4I6M A;  4CD1 A;  4BR2 A;  3CJB A;  4M7Y A;  5KPR A;  1XC3 A;  2CGJ A;  4BVO A;  2FSJ A;  2E8A A;  3CJC A;  5FPM A;  3W0L A;  1SQK A;  5LJV A;  2IVP A;  1T44 A;  2Q97 A;  4BRI A;  3IDH A;  3BUZ B;  4K43 A;  3ATU A;  4M63 C;  3WXK A;  2DPN A;  4BRE A;  3O08 A;  1IJJ A;  1GLL O;  4CZE A;  4BRO A;  4BRN A;  3SK3 A;  3QBW A;  3FZH A;  4PKI A;  3LM2 A;  1RGI A;  3CIP A;  2V7Z A;  2VYP A;  3ZEU A;  1HX1 A;  5JLH A;  1C0G A;  2E2Q A;  1DEJ A;  2P9P A;  4CZG A;  3S41 A;  2P9S A;  5FPD A;  1NGJ A;  3H1V X;  1NGI A;  1KAZ A;  3QFU A;  2YCH A;  4IO8 A;  5JMV A;  3HSC A;  3D2F B;  1SAZ A;  2P9K A;  4RWT A;  3L0Q A;  5AQR A;  2E2P A;  2YHX A;  4PKH A;  3EL2 A;  3AAR A;  1U2V A;  2P9P B;  5AZI A;  2I7N A;  3FFK B;  4H5N A;  4JN4 A;  4K42 A;  4A2A A;  2ZGZ A;  1MWM A;  3AAQ A;  4IZ9 A;  2E2N A;  1E4G T;  4Z94 A;  4JD2 A;  3KHY A;  4BR7 A;  4H5T A;  4BRL A;  2GEM A;  4MLE A;  4WQ4 C;  4Y0W A;  5EOY A;  3IMX A;  1DGK N;  3OHR A;  3IUC A;  5BR9 A;  2GTD A;  4FWS A;  3FLC O;  1XQS C;  3R8E A;  1QHA A;  5BPL A;  2A40 A;  1DKG D;  1QQN A;  3KZB A;  3J8A A;  3MN7 A;  4FPA A;  4DHY A;  3SMS A;  1NGH A;  1HPM A;  1NGG A;  3GBT A;  1S3X A;  1YAG A;  3DXM B;  3D7E O;  1V4T A;  2EWS A;  3H3O B;  3HM8 A;  4IWV A;  4HWI A;  4CBU A;  5EXW A;  4BC2 A;  4CD3 A;  1HKC A;  2ITM A;  3GE1 A;  4C23 A;  1J6Z A;  3VOV A;  4BRC A;  3BF1 A;  5BRF A;  1NGC A;  3B8A X;  1HJO A;  2A3Z A;  3KVG A;  3L4I A;  5F2R A;  4BRA A;  4B1V A;  3O1W A;  2QWO A;  4WYB A;  3O1B A;  1HKB A;  3O4W A;  1BA1 A;  3VEO A;  5AZI B;  1T6C A;  3M3Z A;  4H0Y B;  3CJ1 A;  3MMV A;  4FWQ A;  1NBW A;  2Q2R A;  3ZX2 A;  4ISE A;  1BG3 A;  3DXK A;  3HI0 A;  5KPT A;  1HUX A;  2HMP A;  4BC3 A;  4J8F A;  1GLF O;  3FR0 A;  2YHW A;  4H0T B;  5BRD A;  3RSE A;  3JS6 A;  4BC4 A;  5AQP A;  3VES A;  3U9Z A;  2ZWH A;  4CBW A;  1NMD A;  2E20 A;  3JXU A;  3HZ6 A;  4BRD A;  5AZJ B;  2P9U B;  2P9K B;  2YI1 A;  4FWL A;  2YHY A;  4JNE A;  3CQY A;  4PKG A;  1SZ2 A;  5BPM A;  2YJE A;  3A5M C;  4F9O A;  3F9M A;  3ZET B;  2P9S B;  3L6Q A;  5AQK A;  4E1J A;  2D4W A;  4BR9 A;  1NWK A;  1Z6R A;  4CJ7 A;  1WUA A;  3WXI A;  5AQY A;  5JLF A;  2VWB A;  3QBX A;  3BEX A;  4B1Z A;  4BG9 A;  1K8K A;  1QQM A;  2NZT A;  3AAP A;  3CJA A;  4CI6 A;  4BRK A;  2W41 A;  5B8H A;  3EZW A;  1QZ5 A;  3FZM A;  4GNI A;  3VGL A;  1BOT O;  4AM6 A;  4A2B A;  4K41 A;  4DCH A;  2IVO A;  3D2E B;  4CZJ A;  2GEL A;  1GLJ O;  4M7X A;  3IFR A;  5E26 A;  5AQO A;  3UKU A;  4FL9 A;  1BUP A;  5F1X A;  4WQ5 A;  4BVP A;  1YVN A;  1BWF O;  1U2V B;  2NLX A;  3MN9 A;  4CZL A;  4BGB A;  5KPZ A;  3I33 A;  3VET A;  1R59 O;  2P9L B;  4XEI A;  1JCG A;  5ADX A;  4FWR A;  1TUU A;  3FGU A;  3WXL A;  4B1X B;  2VCP A;  2E1Y A;  1TUY A;  3W3D A;  4H0V B;  3SMP A;  1Q18 A;  3QDK A;  1YXQ A;  4EAH D;  3A5L C;  1ZXO A;  3DWL A;  3LL3 A;  4YDU C;  5ELZ A;  5BPN A;  5AQL A;  2P9N B;  3CET A;  2V7Y A;  1HLU A;  1X3M A;  1XUP O;  3UKR A;  3H46 O;  2YJF A;  1NGF A;  4BRP A;  4BG8 A;  2BTF A;  1NGB A;  1QZ6 A;  4YDU A;  4FWM A;  1K8K B;  2E2O A;  4B1W B;  3RSE B;  3AY9 A;  3DXM A;  5AQQ A;  2Q36 A;  4RCH A;  3VEN A;  4H5V A;  4B9Q A;  4EIA A;  2IIR A;  4FWK A;  4O8K A;  2HF3 A;  1ATN A;  5AQZ A;  5AQW A;  1RDW X;  3FE1 A;  1TYQ B;  5AQF A;  4BRM A;  4BRQ A;  3EKU A;  3H3N O;  2A5X A;  4KBO A;  2D0O A;  1BU6 O;  4BQZ A;  2P9U A;  4QS9 A;  3CJ7 A;  5AQN A;  3MN5 A;  2NRH A;  1CZA N;  2FF3 B;  3ID8 A;  5BN9 A;  1YUW A;  4QS8 A;  4CZF A;  3WT0 A;  3BP8 A;  4CZM A;  2CH6 A;  2KHO A;  3A0I X;  2PAV A;  4BRG A;  1KXP A;  3ULE B;  4BQL A;  5F0X A;  3O6W A;  3ENH A;  1ATS A;  3WEE B;  4K25 A;  3EN9 A;  4XH5 A;  1E4F T;  3WXJ A;  1G99 A;  1QQO A;  4MLH A;  3LDN A;  3WEE A;  2P9L A;  3MN6 A;  2ASM A;  2QW9 A;  5KQD A;  4FWN A;  3QFP A;  3U9D A;  2P9I A;  2QWN A;  3MCP A;  5BRE A;  5AQT A;  3UKU B;  2OAN A;  3VEY A;  5AFU A;  4FSV A;  5FPN A;  2WUS A;  5AR0 A;  3A8Y A;  1P8Z A;  3ATV A;  4ISF A;  2F9W A;  2H3G X;  1ATR A;  3VF4 A;  5AQM A;  3VEZ A;  2AP1 A;  3DAW A;  1MA9 B;  5AZJ A;  4PL8 A;  3UKR B;  4XH1 A;  2F9T A;  4JD2 B;  5ADX H;  4FWO A;  4BC5 A;  4FOI A;  3FZK A;  1NGA A;  2P9N A;  1NGD A;  1V4S A;  3G25 A;  2W40 A;  3R9P A;  2FXU A;  2PBD A;  1MDU B;  3LDO A;  1ESV A;  4H0O A;  4IXC A;  2UYT A;  4H0X B;  5AQV A;  3VF6 A;  1GLC G;  2AA4 A;  2V52 B;  4DB3 A;  4JAX A;  1HKG A;  2QWQ A;  4B1U B;  4WQ4 A;  2FLO A;  3H1Q A;  2Q31 A;  5CE3 A;  2GWK A;  4A61 A;  3HBT A;  2CH5 A;  3ENO A;  5FPE A;  4FOE A;  4BR4 A;  1OKJ A;  1S22 A;  3EKS A;  3VGM A;  5JIC A;  1X3N A;  4ISG A;  5EVZ A;  1NM1 A;  3DXK B;  3GG4 A;  4IJA A;  3A5N C;  3ZX3 A;  1JCF A;  2GWJ A;  3O8M A;  1TYQ A;  1H1V A;  4BGA A;  5AQU A;  5I9E B;  3QML A;  4H5W A;  2HF4 A;  3ULE A;  2CGL A;  2FF6 A;  4CZH A;  3VEX A;  4L3Q A;  2ASO A;  3CI5 A;  4EFH A;  3H45 C;  3GL1 A;  3FZF A;  1LOT B;  4LC9 B;  2I7P A;  3CQX A;  1MWK A;  3R6M A;  2Q1N A;  2E1Z A;  2QWL A;  5AQX A;  3WQT A;  3GDQ A;  4BRH A;  1RFQ A;  5E84 A;  3LDQ A;  3I8B A;  2P9I B;  3BF3 A;  3VEV A;  1Y64 A;  4MO4 A;  5KQ8 A;  4I6M B;  4MO5 A;  4A62 A;  3MDQ A;  4CZK A;  4FPB A;  2FSK A;  1KAX A;  3VER A;  2A42 A;  3GOI A;  3C7N B;  4NO7 A;  3DJC A;  5AQS A;  3HTV A;  1GLA G;  2A41 A;  1ZC6 A;  3CER A;  4XH4 A;  3SJH A;  2ZGY A;  3ZX0 A;  4FWP A;  3CHW A;  3D2E A;  1Z05 A;  5EX5 A;  3VF2 A;  3VEW A;  3U8X A;  5AQI A;  1NLV A;  4HTL A;  2BUP A;  3O80 A;  2CGK A;  5AQH A;  5TKY A;  1NGE A;  2ZF5 O;  3MK6 A;  3VPZ A;  1X9J A;  1ZBS A;  3LDL A;  3QIC A;  2E88 A;  5LY3 A;  4CZI A;  3UB5 A;  5AQJ A;  4GY2 B;  3UE5 A;  3U4L A;  4EHT A;  3TPQ A;  1GLE G;  4H0P A;  5BRH A;  2D0P A;  2J4R A;  3VGK A;  3FZL A;  3ZET A;  2IVN A;  2FSN A;  3A5O C;  3M1F A;  4IJN A;  1D4X A;  1KAY A;  2Q0U A;  2Q0R A;  4FO0 A;  4JHD A;  1WOQ A;  4JHD B;  3WQU A;  4H5R A;  2D1K A;  4BR5 A;  4WQ5 C;  2A6A A;  3QB0 A;  4AM7 A;  1BA0 A;  1EQY A;  4RTF D;  4H03 B;  2QWR A;  4BR0 A;  1JCE A;  4PL7 A;  1BO5 O;  3C7N A;  3H6E A;  5AFU H;  5LJW A;  2QM1 A;  1BDG A;  2QWP A;  1GLD G;  4CBX A;  4B1Y B;  3SLC A;  2V51 B;  2HOE A;  3EO3 A; 
#chains in the Genus database with same CATH topology
 1RDB A;  1OVQ A;  1QHT A;  3H08 A;  3MXM A;  4DFM A;  1I39 A;  3N4P A;  3WUH A;  4NB4 A;  3S9H A;  3MWP A;  2ZJR L;  3I8D A;  1U49 A;  1LAV A;  1VQ9 N;  4FZZ A;  3P4I A;  1VSL A;  3LDP A;  3TU5 A;  4HHT A;  4QS7 A;  3M6G A;  5A2Q O;  5KPR A;  4OLA A;  3AO2 A;  4CJS A;  1S9E A;  2FSJ A;  3CJC A;  4F2S A;  3OW2 M;  3U3Y A;  2Q97 A;  3IDH A;  3ISN C;  3ID6 A;  4K43 A;  4NLB A;  4I2P A;  1GLL O;  3QLH A;  1L3V A;  4CZE A;  3THY B;  4BRN A;  3SK3 A;  1FKP A;  2V7Z A;  4DV4 K;  5JLH A;  3E9L A;  1NJI O;  3CFR A;  4CK2 A;  3L2W A;  4DKW A;  4HUG A;  3VQ7 A;  5C24 A;  1SAZ A;  2P9K A;  3L0Q A;  3QET A;  4M42 A;  2QEX N;  4PKH A;  3EL2 A;  4UQG A;  2HBK A;  4JKF A;  2GX9 A;  3FFK B;  3VA3 A;  4JN4 A;  5GAE P;  2ZGZ A;  4A5B A;  1CXQ A;  3C95 A;  4UY8 O;  2W6L A;  1VSK A;  4JD2 A;  3KHY A;  1VHX A;  2GEM A;  4Y0W A;  3NCI A;  4E89 A;  3IMX A;  3M8S A;  3F5T A;  1DGK N;  2OPP A;  1IV0 A;  3IUC A;  5BR9 A;  4FWS A;  3R8E A;  3K0S A;  1RBV A;  1DKG D;  4K8Z A;  3SBT A;  3MN7 A;  4FPA A;  5BR8 K;  4F4K A;  4IG3 A;  1VQL N;  4DSE A;  1VQN N;  1S3X A;  1YAG A;  3QO9 A;  4M45 A;  3OS0 A;  2EWS A;  3OBW A;  1UA1 A;  4HWI A;  2HST A;  1TKX A;  4AHT A;  2ITM A;  3OYE A;  4I7F A;  4Y1D A;  1J6Z A;  4ILJ A;  1Q8I A;  5F2R A;  4BRA A;  4FJI A;  4WFA L;  4WYB A;  4JI8 K;  3O1B A;  1HKB A;  3CM5 A;  4JI7 K;  2FBX A;  1ITG A;  3M3Z A;  4H0Y B;  3WXM B;  1BIZ A;  3CJ1 A;  1JLE A;  3C6H A;  4HVJ A;  3I55 N;  3K58 A;  2HMP A;  4BC3 A;  3SUN A;  2DFE A;  4H0T B;  3NH1 A;  4EP4 A;  2F8T A;  3RSE A;  3JS6 A;  4BC4 A;  5AQP A;  3TTD A;  3VES A;  4E0D A;  1TAU A;  4CBW A;  3TAB A;  2GUI A;  3SV3 A;  2E20 A;  4KO0 A;  3NGZ A;  1NK7 A;  2UXC K;  4BRD A;  3AVB A;  2O8D B;  4KH6 A;  3CQY A;  3A5M C;  2XY5 A;  3LZI A;  3SZ2 A;  4V19 S;  3L6Q A;  1QE1 A;  4BR9 A;  4CJ7 A;  3ZT2 A;  1Z6R A;  3WXI A;  2FBY A;  2BAN A;  3BEX A;  3HL8 A;  5HOO A;  3MEG A;  4CJP A;  4DR5 K;  3CJA A;  4CI6 A;  1VSJ A;  1VQO N;  3EZW A;  1QZ5 A;  4CED A;  4JI1 K;  3L2V A;  2BH1 A;  4GV3 A;  4MDB A;  1YT3 A;  4KRE A;  1T05 A;  3LDS A;  4DUY K;  4FM2 A;  2GEL A;  3IKM A;  3SBG A;  4AHR A;  4M7X A;  3IFR A;  5E26 A;  5AQO A;  4E7L A;  4FLY A;  1BUP A;  2P51 A;  1K8A O;  1RT6 A;  4DTO A;  3OYB A;  1TV6 A;  5GAG P;  5C15 A;  1TGO A;  4CCH A;  2KFN A;  1LWF A;  1R59 O;  4B3M K;  5ADX A;  5DM6 L;  4DU3 A;  3VQP A;  4DTU A;  4X64 K;  1K73 O;  1HMV A;  3KD1 E;  4XIU A;  4I9Q A;  5K14 A;  4DTR A;  5HLF A;  4EAH D;  1ZXO A;  3LL3 A;  2HHT A;  5BPN A;  2P9N B;  3AVM A;  1GOC A;  2V7Y A;  4JKA A;  3RMA A;  4B9T A;  1RBU A;  1JLB A;  1S1W A;  1KTQ A;  4CJ4 A;  4CIE A;  2PY5 A;  1NGB A;  4YDU A;  2E2O A;  3V1O A;  4B1W B;  3V9S A;  4RCH A;  3VEN A;  3AVF A;  3EE9 A;  2X74 A;  2HF3 A;  4IKF A;  5AQZ A;  2QKK A;  1BL3 A;  3M8P A;  1WSG A;  1TYQ B;  3SAH A;  1BI4 A;  3LP3 A;  5AQF A;  4BRQ A;  3E66 A;  1QSY A;  2YNH A;  2P9U A;  4QS9 A;  4NLC A;  2FF3 B;  3ZSZ A;  4MFB A;  4NYF A;  4CZM A;  2OPR A;  3A0I X;  2PAV A;  2RE2 A;  3EYZ A;  3VQE A;  3O6W A;  4IG0 A;  1OH5 A;  1ATS A;  4MQ3 A;  2Y1I A;  3WEE B;  1NNE A;  1VQ6 N;  3EN9 A;  5CY4 A;  4YOT A;  5GAD P;  3AA5 X;  1XI1 A;  4M3T A;  4MLH A;  3LDN A;  2P9L A;  3MN6 A;  1VQ5 N;  4CGH A;  4FWN A;  3QFP A;  2ZQB A;  4FW2 A;  4RG8 A;  5BRE A;  1EX4 A;  5AQT A;  3UKU B;  2OAN A;  3JYT A;  4JEP A;  3C65 A;  3A8Y A;  3DLB A;  4DUZ K;  2F9W A;  3PX0 A;  4NYN A;  1WSF A;  3DAW A;  2FBV A;  1MA9 B;  3PIO L;  4XH1 A;  3R3L A;  3HPH A;  2OA8 A;  4BC5 A;  4OPA A;  4FOI A;  3FZK A;  3R9P A;  1L3S A;  2FXU A;  4HTU A;  1L3U A;  3TSP A;  4JV5 K;  1KVB A;  4LSN A;  2HMI A;  3SUO A;  4JRQ A;  1M90 O;  3LWM A;  5CZ2 A;  3VF6 A;  5JS1 A;  2AA4 A;  1JXE A;  2HHH K;  3H1Q A;  4CEZ A;  4C8L A;  3CC4 N;  2GWK A;  4C1N K;  4A61 A;  5FPE A;  2XO7 A;  5FRO A;  1JLA A;  1OKJ A;  1S22 A;  4PHT X;  4ISG A;  3NGI A;  4ILG B;  4YFU A;  1SKR A;  4FVU A;  3LAN A;  1LWE A;  1JCF A;  2GWJ A;  4FYD A;  4HCB A;  1TYQ A;  4CIF A;  1H1V A;  4DS4 A;  3QML A;  4PA1 A;  2G8H A;  4KV8 A;  4CZH A;  1YI2 N;  3VEX A;  2Z1I A;  4L3Q A;  1JL1 A;  4CEO A;  4K0K K;  3KWG A;  1L3T A;  3CQX A;  1S6P A;  3EY1 A;  4PY5 A;  3QNO A;  3ASM A;  4CF2 A;  5GIP A;  4J2D A;  2HW3 A;  3OY9 A;  2Q1N A;  3E9P A;  1BCO A;  4BDP A;  3GDQ A;  4BRH A;  4DV3 K;  1RFQ A;  5E84 A;  3I8B A;  4BDY A;  2P9I B;  3BF3 A;  4DSK A;  4BE0 A;  1ZBH A;  3LWL A;  3LZJ A;  4A62 A;  3E9O A;  1IKV A;  3NH0 A;  3AVJ A;  5MLC Q;  5CYM A;  3IG1 A;  2HHU A;  4FXD A;  3V81 A;  4NO7 A;  1GLA G;  3M8Q A;  3MX5 A;  3QEV A;  3S3N A;  2ZGY A;  1QQC A;  3HVR A;  4KHS A;  1RT3 A;  4TSX A;  2BDP A;  1NLV A;  3IS9 A;  4CK3 A;  1YVU A;  3OYC A;  3AVH A;  3MK6 A;  4FJG A;  4CZI A;  1FK9 A;  1J5O A;  4GY2 B;  3UE5 A;  3LAM A;  4NCA A;  4CEC A;  2D0P A;  1WLJ A;  2IVN A;  2KQ2 A;  4O44 A;  4DU1 A;  4IJN A;  3S3O A;  3SNN A;  3OYL A;  2F8S A;  3E1Y A;  3T19 A;  4CEF A;  2A6A A;  2I5J A;  3QB0 A;  3F9K A;  4H03 B;  3VQQ A;  2QWR A;  1W2B M;  1L5U A;  1BO5 O;  4W5Q A;  2Z1H A;  4X65 K;  2YNI A;  3H6E A;  1RNH A;  3OA9 A;  1FJG K;  1UAX A;  4JK8 A;  2QWP A;  1GLD G;  3PSF A;  4CBX A;  2QKB A;  2V51 B;  2HOE A;  3EO3 A;  1HNW K;  2KKZ A;  1VQM N;  3LPU A;  4B9V A;  4ID1 A;  5BN8 A;  3A2F A;  5JS2 A;  3V9X A;  2W42 A;  3ZLJ A;  4OPK A;  4M3Z A;  1KCF A;  1ZBI A;  1RDU A;  3LM9 A;  4DU4 A;  5EY4 A;  3O5B A;  5J2M A;  4CIG A;  1NKC A;  3CJ9 A;  4DMN A;  4E1M A;  2XRI A;  2A1R A;  1T3V A;  4O5F A;  4EHU A;  5KRT A;  4C1N I;  1QSL A;  4CVN E;  1GLB G;  2VQE K;  4BR2 A;  2NRW A;  4A59 A;  1Z25 A;  1QSS A;  1HNX K;  3C6T A;  1I3A A;  4GKJ K;  5FPM A;  2QI2 A;  4LSL A;  2UU9 K;  2O8F A;  3Q7B A;  3BUZ B;  3DLG A;  3ATU A;  3G4S N;  1IKX A;  3AVI A;  4CF8 A;  3DMJ A;  2KTQ A;  3K57 A;  1EO1 A;  3V6D A;  3AV9 A;  4BRO A;  4CFC A;  3FZH A;  4PKI A;  4RW9 A;  4CJU A;  1C0G A;  3T7Z A;  1DEJ A;  4O55 A;  2IS3 A;  3AVK A;  3D45 A;  1NGJ A;  3H1V X;  1NGI A;  4CES A;  2YCH A;  3KK7 A;  3KK1 A;  1KQS M;  3D2F B;  3K5M A;  3ZT0 A;  4DV6 K;  1HNV A;  1BGX T;  2G8K A;  2E2P A;  3Q7C A;  3SI6 A;  1S9G A;  3UIQ A;  3KLI A;  2B6A A;  4LH4 A;  5AZI A;  3OS2 A;  4H5N A;  4A2A A;  3N4Q A;  1MWM A;  4FM1 A;  4IZ9 A;  4CEA A;  3NVK A;  1YJN N;  2E2N A;  1E4G T;  1N33 K;  4E19 A;  4BR7 A;  4H5T A;  4MLE A;  1YJW N;  3V9Z A;  2UXB K;  4G9Z A;  4QCL A;  4Y1C A;  4DR1 K;  3OHR A;  2BE2 A;  3RMD A;  2KZZ A;  4IEE A;  1XQS C;  3ITH A;  1QHA A;  5HRR A;  2VG5 A;  2LSN A;  3KZB A;  3O4Q A;  3J8A A;  3OYG A;  3QEP A;  4DHY A;  3OBY A;  1NGH A;  1HPM A;  1NGG A;  5M1K A;  4JKB A;  4R5P A;  3K59 A;  4AH9 A;  3D7E O;  3THY A;  1XNR K;  1V4T A;  3R1X A;  3HM8 A;  1HYZ A;  4CBU A;  3IAY A;  3LP1 A;  4CD3 A;  3GE1 A;  3CCU N;  5BRF A;  4HCC A;  1JLG A;  4NXN K;  4LFB K;  1HJO A;  3KVG A;  3L4I A;  1NJW A;  3KK2 A;  3O1W A;  4FM0 A;  4A57 A;  1OH6 A;  4DV0 K;  1W9H A;  4FJJ A;  1X9W A;  5CHI A;  5KPT A;  1OVY A;  2RHK A;  3DM2 A;  3FR0 A;  3TI0 A;  3C6U A;  1HNI A;  2IC3 A;  1B9F A;  1SKS A;  1GOA A;  2ZWH A;  1FXX A;  4AHV A;  3HZ6 A;  3NF8 A;  5AZJ B;  2HHS A;  2P9U B;  2P9K B;  4FWL A;  3WNH A;  2YHY A;  1ZYQ A;  4PKG A;  1DT9 A;  3CF5 L;  1REV A;  1I94 K;  4BE2 A;  4IOC L;  1ZBF A;  2HHX A;  4E1J A;  5JLF A;  3KKR A;  1FKO A;  4ELU A;  2UUB K;  3B6O A;  3ENB A;  3CC2 N;  2EHG A;  2NNW A;  4GV9 A;  4DTS A;  4A2B A;  4DCH A;  2HBM A;  4CZJ A;  2X6N A;  3HRG A;  3I0S A;  3WNF A;  4CFB A;  4DR6 K;  3UKU A;  4L8R B;  4RW7 A;  5F1X A;  4C8K A;  4J2A A;  5E41 A;  2ETJ A;  4BVP A;  4DF8 A;  1U2V B;  3MN9 A;  4NCB A;  4CHO A;  3I33 A;  4AHS A;  1X9M A;  4IFV A;  1TUU A;  1Q86 O;  1LWC A;  3WXL A;  3FFI A;  1IKW A;  4B1X B;  1WSE A;  2VCP A;  2E1Y A;  4IOX A;  4H0V B;  4A5A A;  1Q18 A;  4DR2 K;  4AIL C;  3DWL A;  3WNG A;  5ELZ A;  3G10 A;  3O9T A;  5AQL A;  3L2U A;  4FJK A;  3OYH A;  2F7T A;  3NGY A;  2YJF A;  1NGF A;  4KHW A;  1XMO K;  3DRS A;  4FWM A;  1HJR A;  1T7P A;  1UWB A;  1RBR A;  2NRT A;  2Q36 A;  1N6Q A;  4B9Q A;  4QOZ B;  4DSF A;  4FWK A;  1Q81 O;  1O13 A;  3J81 O;  3FE1 A;  3NMU A;  1GOB A;  4BRM A;  3EKU A;  3H3N O;  2A5X A;  4B3T K;  4BQZ A;  3L3U A;  4N47 A;  2DY4 A;  1JL2 A;  4B3S K;  4YOY A;  3CCM N;  4BDZ A;  3ID8 A;  5AJ3 K;  4LF5 K;  5BN9 A;  3RWU A;  2WC9 A;  2B4J A;  3BP8 A;  3OYI A;  5C25 A;  2KHO A;  3KK3 A;  3ULE B;  4BQL A;  1EP4 A;  2YNG A;  3VQC A;  2NRX A;  4R79 A;  2O4I A;  5I42 A;  4DFJ A;  4JK7 A;  4XH5 A;  1E4F T;  1G99 A;  3P38 A;  1SS6 A;  5LMN K;  1YTA A;  2ASM A;  2QW9 A;  3RR8 A;  3EEQ A;  4FJL A;  3MCP A;  4B9L A;  3QIP A;  3VEY A;  3SUP A;  2WUS A;  5AR0 A;  4JI4 K;  1P8Z A;  5DK5 A;  2H3G X;  3KLE A;  2XHB A;  1ATR A;  3VEZ A;  4O8U A;  3KD5 E;  1JLQ A;  4PL8 A;  1YJ9 N;  3DI6 A;  5ADX H;  4CJW A;  2P9N A;  1OH8 A;  1V4S A;  3HO1 A;  1VQ7 N;  2O4G A;  2PBD A;  2NUB A;  3LDO A;  4W5N A;  2QK9 A;  2DFF A;  1VQ8 N;  4JKG A;  4DQS A;  3IRX A;  4H0X B;  2D0C A;  5IT9 O;  1YHQ N;  4C8N A;  1GLC G;  2OZM A;  4DB3 A;  1HKG A;  4CFA A;  4WF9 L;  4WQ4 A;  4DR3 K;  1VAZ A;  3P83 D;  5I3U A;  3SQ4 A;  4BAC A;  5SZT A;  1J9A A;  4QAG A;  4BR4 A;  4E7H A;  3EKS A;  2QTD A;  5EVZ A;  3CPE A;  2P5G A;  1K6Y A;  3U3G A;  3S3M A;  4I9L A;  4DG1 A;  2PZS A;  3V9W A;  1RT2 A;  3O8M A;  3SJJ A;  4KB0 A;  5AQU A;  5I9E B;  4M3R A;  4FZY A;  3MEE A;  2FF6 A;  3ZSW A;  4KHY A;  3SCX A;  4EFH A;  1TK8 A;  1NJX A;  4ILH A;  4O5B A;  4DV7 K;  3NF7 A;  4LC9 B;  1WAF A;  2I7P A;  5M1F A;  4JI3 K;  3R6M A;  1CXU A;  1BIU A;  4KHU A;  4DF4 A;  2E1Z A;  2D0A A;  2KLA A;  5AQX A;  3WQT A;  4X66 K;  2G8V A;  3NFA A;  1IBL K;  4KHN A;  4IEI A;  3K5O A;  4CEQ A;  4DV1 K;  4DTM A;  2P5O A;  1N32 K;  2Z1J A;  3T3F A;  4MO5 A;  3J7A P;  2HVI A;  1TK5 A;  1UOC A;  3BY5 A;  4CJ3 A;  2A42 A;  1MU2 A;  1RDC A;  3J7Z O;  3DJC A;  1VRT A;  3CYM A;  3G0Z A;  3VTI A;  1ZC6 A;  1F21 A;  4BY9 C;  3SPZ A;  4XH4 A;  2RF2 A;  3SJH A;  4FWP A;  3CHW A;  4DR7 K;  3AVN A;  5EX5 A;  3JAM O;  2UUC K;  4KI6 A;  3KIO A;  5AQI A;  4HTL A;  4FLT A;  4DLE A;  3O80 A;  5AQH A;  4B3R K;  1X9J A;  3QIC A;  2E88 A;  2GBZ A;  2FC0 A;  3U4L A;  4EHT A;  5KGW A;  2OTJ N;  3TAN A;  3OYK A;  3D6R A;  3VGK A;  3OYJ A;  3O4N A;  1TVR A;  3SQ2 A;  3A5O C;  4PUO A;  4DTJ A;  2Q0U A;  4FO0 A;  4JHD A;  1WOQ A;  4CER A;  5M1N A;  5J2Q A;  2O8D A;  2D1K A;  2P1J A;  3ZT1 A;  4AM7 A;  4YHH K;  2O8F B;  2ZD1 A;  4BR0 A;  4PL7 A;  4M3Y A;  4NCG A;  3HP9 A;  2HHQ A;  5LJW A;  2QM1 A;  4ICL A;  4AHU A;  1BDG A;  4DLG A;  4LFA K;  5JVH L;  3CMA N;  3SLC A;  4JYA K;  1U6Z A;  4BRF A;  3HPG A;  3O3H A;  3TAR A;  3NF9 A;  3C0B A;  4RW8 A;  3CFP A;  1VSH A;  2ASP A;  4FJ9 A;  2ZE2 A;  3ZEU B;  3TSQ A;  1KSP A;  1IBK K;  1XWL A;  3PIP L;  1A5V A;  1KVA A;  4DQ8 A;  1JLF A;  1IH7 A;  1O1W A;  5J2P A;  5LMU K;  1C0F A;  1TK0 A;  1T6D A;  2QXL A;  2HHW A;  3CJB A;  4M7Y A;  1XC3 A;  3TAM A;  1SL1 A;  2WFB A;  4BVO A;  4O0I A;  2UXD K;  5C12 A;  1D5A A;  3W0L A;  5LJV A;  2G8I A;  3T1A A;  3RVC A;  2IVP A;  3AVC A;  3WXK A;  4KB1 A;  3OYM A;  1LW2 A;  1KVC A;  1X1P A;  2DPN A;  4BRE A;  1IJJ A;  3TTF A;  4YOX A;  2G8U A;  3OYA A;  3LP2 A;  3QBW A;  3LM2 A;  1HX1 A;  1A5W A;  2OZS A;  2E2Q A;  1RDD A;  4G1Q A;  3MX2 A;  2HNZ A;  4CZG A;  2ITG A;  2P9S A;  3S41 A;  1OH7 A;  3V1R A;  1KAZ A;  4KH5 A;  4KTW A;  4FZX C;  4IO8 A;  4H8K A;  3HSC A;  5M1P A;  4CEE A;  2W6K A;  4RWT A;  1N34 K;  4FLW A;  3SQ1 A;  2YHX A;  4GW6 A;  4DTN A;  4GV6 A;  3THW A;  3LAK A;  1WNS A;  4ELT A;  1JLC A;  4Z94 A;  4CJL A;  4BRL A;  4WQ4 C;  3C6A A;  3TWH A;  3T1H K;  1RDA A;  3VQ8 A;  1YIT N;  2GTD A;  2WBN A;  2B5J A;  5BPL A;  2A40 A;  1QQN A;  2HBL A;  3SMS A;  3AA4 A;  3ZYY X;  4FCY A;  1WSH A;  3H3O B;  4CJT A;  1VSM A;  5EXW A;  4BC2 A;  4NXM K;  5DM7 L;  5D3G A;  3TAP A;  3AO4 A;  1NOZ A;  4C23 A;  1NK8 A;  4BRC A;  3BF1 A;  4OX9 K;  1NGC A;  3CXC M;  4DSI A;  2A3Z A;  3CCJ N;  3BDP A;  3OTO K;  3P39 A;  3O4W A;  1BA1 A;  5AZI B;  3VQ4 A;  4JK9 A;  2KZM A;  1KLM A;  4FWQ A;  3CCE N;  2Q2R A;  3ZX2 A;  1EET A;  2OCE A;  1TL3 A;  1BG3 A;  4J8F A;  1GLF O;  1WBB A;  1K9M O;  2YHW A;  3MAQ A;  4PQU A;  5BRD A;  3NE6 A;  4FVM A;  2NRZ A;  1T03 A;  3OYN A;  3JXU A;  3NF6 A;  1NK6 A;  4WFB L;  3I0R A;  4JNE A;  1SZ2 A;  3ZSQ A;  4CE9 A;  4H4O A;  4F9O A;  3ZET B;  3VQB A;  2D4W A;  1NWK A;  2JGU A;  1VQP N;  3BZK A;  5AQY A;  3ZSV A;  3QBX A;  1HYS A;  1EXQ A;  4X62 K;  1K8K A;  4CJF A;  4BRK A;  3THX B;  3PLA A;  3WNE A;  4K41 A;  3DYA A;  1C0U A;  3D2E B;  4DTP A;  4OKJ A;  1GLJ O;  3J7Y P;  1VK0 A;  4FL9 A;  3CCV N;  1QVG M;  3O9Q A;  1YVN A;  4DQR A;  2NLX A;  1RTI A;  5KPZ A;  4BWJ A;  3RRG A;  1C0M A;  3VET A;  1QTM A;  2P9L B;  4XEI A;  5KTQ A;  4FWR A;  3RMC A;  4YOR A;  4CK1 A;  2KW4 A;  2A1S A;  3L2R A;  5FRN A;  4OLB A;  1HNZ K;  3SMP A;  5J1E A;  3CCQ N;  3QDK A;  3TTC A;  4N5S A;  1Q9X A;  2YNF A;  1YXQ A;  4KHQ A;  3A5L C;  4C8O A;  4YDU C;  1XC9 A;  4IO9 L;  4HUE A;  3O9S A;  1XHZ A;  3CET A;  1HLU A;  3TSU A;  4HUF A;  1UA0 A;  4O4G A;  1XUP O;  3UKR A;  3MCA B;  3SUQ A;  4BRP A;  3QIO A;  2UUA K;  4JI5 K;  1QZ6 A;  1BI4 B;  1TAQ A;  3RSE B;  5KI6 A;  3VMF B;  4FK0 A;  3AY9 A;  3DXM A;  5AQQ A;  2OTL N;  4H5V A;  4IOA L;  4JI2 K;  4B8C A;  4O8K A;  2G8W A;  1ATN A;  5AQW A;  4E7K A;  1HR0 K;  4IFY A;  1R0A A;  4DR4 K;  2HNY A;  1Q7Y O;  3CC7 N;  4KBO A;  2D0O A;  1BU6 O;  5C2F A;  3DRP A;  1Q82 O;  4JLH A;  3CJ7 A;  2PYJ A;  3MN5 A;  5IWA K;  2NRH A;  1CZA N;  3KTQ A;  5FDL A;  3OYD A;  3TAE A;  4CZF A;  3PV8 A;  4FLU A;  4BRG A;  5HP1 A;  1KXP A;  5F0X A;  3ENH A;  3V9U A;  2JWK A;  3BGR A;  1RTD A;  4Z4F A;  4J2E A;  2PFU A;  1WBD A;  1W0H A;  3EE8 A;  1VSI A;  4LY7 A;  1CLQ A;  4AF1 A;  5KQD A;  5CYQ A;  3U9D A;  2P9I A;  2QWN A;  3MXI A;  4ZTJ A;  3HOT A;  5AFU A;  5FPN A;  1JJ2 M;  2GV9 A;  3VTH A;  3VA0 A;  4ISF A;  3QES A;  1S1V A;  1KRP A;  3VF4 A;  2D0B A;  5AQM A;  2YHA A;  3NDK A;  2AP1 A;  2PYL A;  5AZJ A;  4Z4G A;  2O8B B;  3UKR B;  3AA2 A;  3K5N A;  5DMR A;  4FWO A;  4DTX A;  1HYV A;  1NGD A;  3DLE A;  1NK4 A;  1D8Y A;  4OPJ A;  4H0O A;  2JWL A;  3V4I A;  2ZJQ L;  4DV2 K;  1RTH A;  1YF5 L;  2O8C A;  5HRS A;  4JAX A;  1SKW A;  2FLO A;  3HT3 A;  5CE3 A;  1KFS A;  1ZBL A;  1M1K O;  2IDO A;  1IG9 A;  3VGM A;  1U45 A;  1U47 A;  3OVN A;  2F96 A;  5SWM A;  1NM1 A;  3DXK B;  3GG4 A;  4IJA A;  3ZX3 A;  3EZ5 A;  3VQA A;  3DOL A;  4DV5 K;  3LPT A;  1RT7 A;  5C42 A;  4W5O A;  4H5W A;  2HF4 A;  4IBN A;  1IO2 A;  1NJZ A;  2ASO A;  3H45 C;  4YOW A;  4FJH A;  3FZF A;  4WE1 A;  3VQD A;  1LOT B;  5C0Y A;  3ULD A;  3T69 A;  2JLE A;  5HRN A;  1S1X A;  1RT4 A;  2Y1J A;  1E3M A;  2QWL A;  2VGN A;  4KHP K;  4FLZ A;  4FK2 A;  4W5R A;  3MEC A;  3MWT A;  3NAE A;  3LDQ A;  2BGG A;  1Y64 A;  2ZJP L;  2ATQ A;  4I6M B;  3VQ9 A;  3QER A;  3SV4 A;  3K9J A;  4FPB A;  3RMB A;  3OJS A;  2FSK A;  1D9D A;  4CHN A;  1W7A A;  3HTV A;  4JS4 A;  5C10 A;  3ZX0 A;  4B3O A;  3CD6 N;  1Z05 A;  3VEW A;  3SPY A;  3U8X A;  5CR4 A;  2BUP A;  4OJR A;  3PX4 A;  4JS5 A;  1NGE A;  2ZF5 O;  3VPZ A;  3P1G A;  1ZBS A;  3LDL A;  5CZ1 A;  5LY3 A;  3QIN A;  2VQF K;  1JKH A;  3UB5 A;  5AQJ A;  3KLG A;  3DOK A;  4H0P A;  5BRH A;  2RPI A;  3ZET A;  1KC8 O;  3JSM A;  2FSN A;  4RW4 A;  3M1F A;  4FLX A;  4B9S A;  3TAG A;  1VRU A;  3OS1 A;  3DLR A;  1KAY A;  3QEW A;  4LF6 K;  4BR5 A;  4CGD A;  3THX A;  1EQY A;  4RTF D;  4Z4E A;  4JKH A;  2E6L A;  4I2Q A;  4DQI A;  1KFD A;  3TAQ A;  3C7N A;  4KPY A;  4CF9 A;  5AFU H;  4CHY A;  5KRS A;  4Z4C A;  1WSI A;  4Z0U A;  5KGX A;  4B1Y B;  1WSJ A;  3L4Q A;  4CEB A;  4OO1 J;  1NKE A;  3U6F A;  1IG8 A;  5AQG A;  1NOY A;  4CHQ A;  3HPO A;  1LAW A;  4CFD A;  2GUP A;  3AVA A;  1LCU A;  1IKY A;  3OYF A;  2O8C B;  3D2F A;  3RTV A;  3SQ0 A;  4GKK K;  1LW0 A;  2XY8 A;  2QWM A;  4I6M A;  4CD1 A;  1SUQ A;  5HRP A;  3NVM A;  4K8X A;  2CGJ A;  2E8A A;  1U04 A;  4M3W A;  1QVF M;  1SQK A;  4BWM A;  1RT1 A;  1T44 A;  4BRI A;  4M63 C;  2X6S A;  1HPZ A;  3O08 A;  4GVM A;  4DQP A;  4Z4I A;  3AGR A;  1U48 A;  2E5L K;  3F73 A;  3ZCM A;  4N41 A;  1RGI A;  3CIP A;  3ZEU A;  2VYP A;  4IDH A;  3K2P A;  5GAH P;  3AO3 A;  4CJE A;  2P9P A;  3SAF A;  4KTZ A;  5FPD A;  3G71 N;  3QFU A;  5H1S Q;  4OGE A;  4U7B A;  1NJY A;  5JMV A;  3ZT4 A;  1DLO A;  1J54 A;  2QA4 N;  3ALY A;  5AQR A;  2HHV A;  4CJR A;  4FJX A;  2IAJ A;  1U2V A;  2P9P B;  3AAR A;  2XY6 A;  2I7N A;  2HBJ A;  4K42 A;  3M8R A;  3F2K A;  3RRH A;  3AAQ A;  4CF1 A;  1RCH A;  2VGM A;  3KWI A;  4GMJ B;  5EOY A;  2DFH A;  2WTU A;  4O0J A;  1JXB A;  1NK5 A;  1SL0 A;  1NG9 A;  4FJM A;  2WOM A;  4EZ6 A;  3FLC O;  4MDA A;  3VN5 A;  2IGI A;  4CHZ A;  3PSI A;  2OPQ A;  4KTQ A;  3HYF A;  4JRP A;  2WON A;  3GBT A;  3DXM B;  1X9S A;  4IWV A;  4GVE A;  4B9N A;  1C6V A;  1C1C A;  1HKC A;  4KAZ A;  3VOV A;  1ASU A;  1TKT A;  4JI6 K;  1C1B A;  4WCE L;  3B8A X;  1NKB A;  4ID5 A;  4B1V A;  2QWO A;  1YIJ N;  4FJ8 A;  3VEO A;  1T6C A;  4DS5 A;  3MMV A;  1NBW A;  3VQ5 A;  3HOS A;  1VSE A;  4ISE A;  2VWJ A;  3DXK A;  3HI0 A;  4F3T A;  1HRH A;  1HUX A;  4JKG B;  1DTT A;  4LF9 K;  5FLX O;  4BE1 A;  3ZSX A;  1RTJ A;  1G15 A;  3THV A;  3U9Z A;  3I56 N;  1NMD A;  2Q3S A;  4LF7 K;  5HRO A;  3TR8 A;  4Z4H A;  2OPS A;  1WAJ A;  2YI1 A;  1J53 A;  4KH4 A;  5BPM A;  2YJE A;  1BHL A;  3F9M A;  2P9S B;  1XHX A;  2Z1G A;  3CPW M;  3DRR A;  5AQK A;  2YX6 A;  3QNN A;  1WUA A;  4YOV A;  2VWB A;  3PX6 A;  1QS4 A;  4B1Z A;  4YNQ A;  2KFZ A;  4EZ9 A;  1NMN A;  1C0T A;  3P31 A;  1ASV A;  4BG9 A;  1LV5 A;  1QQM A;  1ZBU A;  2NZT A;  3AAP A;  4CGI A;  5FRM A;  4LF4 K;  2W41 A;  4PWD A;  5B8H A;  4ZTF A;  1S1T A;  2HVH A;  3FZM A;  4GNI A;  5HBM A;  1BOT O;  3VGL A;  4AM6 A;  2IVO A;  5HL7 L;  3QEX A;  3P5J A;  2G8F A;  1CZB A;  5TKW A;  1ILY A;  3NH2 A;  1CZ9 A;  1Z26 A;  4WQ5 A;  3G6E N;  3CG7 A;  1BWF O;  4JKE A;  3HXM A;  5JVG L;  4CZL A;  4BGB A;  3RR7 A;  3ZSO A;  3L2Q A;  3DLK A;  3HM9 A;  3PY8 A;  1JCG A;  1BQM A;  4DQQ A;  4DFP A;  4J2B A;  3FGU A;  1TKD A;  2E4L A;  1TUY A;  3C94 A;  3W3D A;  3J80 O;  4Q0B A;  3NHG A;  3SAG A;  3M5R A;  2F4V K;  4CGF A;  3KLF A;  2DTU A;  4B9M A;  1KD1 O;  1X3M A;  5M1Q A;  4RW6 A;  2NRR A;  3H46 O;  1XMQ K;  3TAF A;  1TKZ A;  2XY7 A;  4BG8 A;  3O9R A;  3HST B;  2BTF A;  3PO4 A;  1FW6 A;  4DSL A;  1RBT A;  1K8K B;  1B92 A;  3SYZ A;  1U4B A;  3KKS A;  2NRV A;  3K9K A;  2YV0 X;  3CME N;  3HJF A;  4OKK A;  3CQ8 A;  4EIA A;  2IIR A;  4E7I A;  2VG7 A;  4E3S A;  1N8R O;  1ASW A;  1RDW X;  4OKE A;  4B08 A;  4M3U A;  1YTU A;  4OGC A;  2AJQ A;  4FJN A;  5AQN A;  5M1O A;  3AO1 A;  3AA3 A;  1C1A A;  3OJU A;  1YUW A;  4W5T A;  1A5X A;  1WN7 A;  1S72 N;  4QS8 A;  5T7B A;  3WT0 A;  1S5J A;  2O8E A;  1RT5 A;  2CH6 A;  2D5R A;  4CGG A;  3HK2 A;  3O3F A;  4E7J A;  2ZM6 K;  4K25 A;  3WXJ A;  1QQO A;  3WEE A;  3HVT A;  4U67 L;  1VQ4 N;  3QEI A;  2VG6 A;  4YY3 K;  4OPH A;  4FSV A;  2QXF A;  3ATV A;  4DWI A;  3ZSR A;  5GIN A;  2O8B A;  2YKN A;  4M41 A;  4FJ7 A;  1XNQ K;  1SL2 A;  4B9U A;  2F9T A;  4JD2 B;  3MED A;  3CCS N;  3L3V A;  1NGA A;  4CHP A;  3G25 A;  4IDK A;  2W40 A;  4M3X A;  1TL1 A;  1Y97 A;  2YKM A;  4Q5V A;  1WB9 A;  4JI0 K;  5GIO A;  1MDU B;  1NK0 A;  1J5E K;  1ESV A;  3NBP A;  4IXC A;  2UYT A;  4ZHR A;  1N5Y A;  2FBT A;  4F8R A;  5AQV A;  3O9U A;  1BIS A;  2V52 B;  2QWQ A;  4B1U B;  4JKD A;  3DLH A;  2Q31 A;  1T8E A;  1VQK N;  3HBT A;  2CH5 A;  3ENO A;  1HQE A;  4FOE A;  4WFN L;  5JIC A;  1X3N A;  2O8E B;  3T1Y K;  4F3O A;  4FJ5 A;  4CF0 A;  1P90 A;  1DTQ A;  3A5N C;  2YHB A;  1B9D A;  3LAL A;  4YOU A;  4DSJ A;  3E01 A;  4N56 A;  3CCR N;  4BGA A;  2R7Y A;  4DFK A;  4H4M A;  3B6P A;  3ULE A;  2CGL A;  4F2R A;  4LF8 K;  1BQN A;  3HP6 A;  1Q9Y A;  3AO5 A;  1VSF A;  5J2N A;  4FK4 A;  4E1N A;  1EWQ A;  3CI5 A;  2EX3 A;  3GL1 A;  3AGK A;  3CFO A;  3K5L A;  3MXJ A;  1MWK A;  1EKE A;  1KLN A;  4FLV A;  3PUF A;  5LL6 Z;  3KLH A;  4B8A B;  3KJV A;  2HND A;  4KI4 A;  4AQY K;  3V1Q A;  1N36 K;  3VEV A;  3PO5 A;  5C2D A;  4MO4 A;  4CJV A;  5KQ8 A;  3VQ6 A;  4KFB A;  4CJ5 A;  3CCL N;  3MDQ A;  4CZK A;  1SV5 A;  3AVG A;  1KAX A;  3VER A;  3GOI A;  3C7N B;  2OYQ A;  2IOC A;  5AQS A;  2A41 A;  3ZSY A;  4OVL A;  3ZT3 A;  4ELV A;  3CER A;  2RKI A;  3VF2 A;  3D2E A;  4LFC K;  5EU7 A;  3L8B A;  3O3G A;  4FW1 A;  4KRF A;  2CGK A;  5TKY A;  4JKC A;  1NU0 A;  1RBS A;  4LH5 A;  4AHC A;  1RIL A;  3TPQ A;  1W97 L;  3AVL A;  1GLE G;  4LD0 A;  2J4R A;  3FZL A;  3BZC A;  2E6M A;  1D9F A;  1D4X A;  1HQU A;  4N76 A;  2Q0R A;  2RN2 A;  4JHD B;  1S6Q A;  2HB5 A;  3WQU A;  4CGJ A;  4H5R A;  4CJQ A;  4WQ5 C;  1BA0 A;  3LP0 A;  3D0P A;  4EP5 A;  2VWK A;  1NK9 A;  3THW B;  4C8M A;  4KKO A;  1JCE A;  4CW7 B;  1EWR A;  1BCM A;  4CJK A;  3CM6 A;  1S1U A;  4IFE A;  2X78 A;  3DLL L;  1IBM K;  1VSD A; 
#chains in the Genus database with same CATH homology
 2KKZ A;  1VQM N;  1U6Z A;  4BRF A;  3L4Q A;  5BN8 A;  4OO1 J;  3C0B A;  2ASP A;  3N4P A;  3WUH A;  1IG8 A;  4NB4 A;  5AQG A;  3MWP A;  3ZEU B;  3TSQ A;  2ZJR L;  1RDU A;  3LM9 A;  5EY4 A;  3O5B A;  3PIP L;  1VQ9 N;  2GUP A;  3P4I A;  4DQ8 A;  3CJ9 A;  1LCU A;  3LDP A;  1C0F A;  3D2F A;  3TU5 A;  1T3V A;  4O5F A;  4EHU A;  4C1N I;  1T6D A;  2QXL A;  4QS7 A;  1GLB G;  2QWM A;  3M6G A;  4I6M A;  4CD1 A;  4BR2 A;  3CJB A;  4M7Y A;  2NRW A;  4A59 A;  5KPR A;  1XC3 A;  3NVM A;  2WFB A;  2CGJ A;  4BVO A;  2FSJ A;  5C12 A;  2E8A A;  3CJC A;  5FPM A;  2QI2 A;  3W0L A;  1SQK A;  5LJV A;  3OW2 M;  1QVF M;  3RVC A;  2IVP A;  1T44 A;  2Q97 A;  4BRI A;  3IDH A;  3Q7B A;  3BUZ B;  3ID6 A;  3ATU A;  4K43 A;  4M63 C;  3WXK A;  3G4S N;  2DPN A;  4BRE A;  3O08 A;  1IJJ A;  1EO1 A;  4NLB A;  1GLL O;  3TTF A;  4YOX A;  3AGR A;  4CZE A;  4BRO A;  4BRN A;  3SK3 A;  3QBW A;  3FZH A;  4PKI A;  3LM2 A;  1RGI A;  3CIP A;  2V7Z A;  2VYP A;  3ZEU A;  1HX1 A;  5JLH A;  3E9L A;  4IDH A;  1C0G A;  2E2Q A;  3T7Z A;  5GAH P;  1DEJ A;  2P9P A;  3MX2 A;  4CZG A;  3S41 A;  2P9S A;  5FPD A;  3SAF A;  3G71 N;  1NJI O;  1NGJ A;  3H1V X;  1NGI A;  1KAZ A;  3QFU A;  4KH5 A;  2YCH A;  5H1S Q;  4U7B A;  4DKW A;  3KK7 A;  4IO8 A;  5JMV A;  3HSC A;  3D2F B;  5M1P A;  1KQS M;  2QA4 N;  1SAZ A;  2P9K A;  4RWT A;  3L0Q A;  5AQR A;  2E2P A;  3Q7C A;  2QEX N;  2YHX A;  4PKH A;  3EL2 A;  3AAR A;  1U2V A;  2HBK A;  2P9P B;  5AZI A;  2I7N A;  4JKF A;  2GX9 A;  2HBJ A;  3FFK B;  4H5N A;  4GV6 A;  4JN4 A;  4K42 A;  4A2A A;  5GAE P;  2ZGZ A;  3F2K A;  3N4Q A;  4A5B A;  1MWM A;  4UY8 O;  3AAQ A;  4IZ9 A;  2VGM A;  3NVK A;  1YJN N;  2E2N A;  1E4G T;  3KWI A;  4Z94 A;  4JD2 A;  3KHY A;  4BR7 A;  4H5T A;  4BRL A;  2GEM A;  4MLE A;  4WQ4 C;  3C6A A;  4Y0W A;  5EOY A;  1YJW N;  3IMX A;  4G9Z A;  3F5T A;  1DGK N;  1YIT N;  3OHR A;  3IUC A;  5BR9 A;  2GTD A;  4FWS A;  4IEE A;  2WBN A;  1XQS C;  3FLC O;  1QHA A;  4MDA A;  3R8E A;  5BPL A;  2A40 A;  1DKG D;  3SBT A;  1QQN A;  3KZB A;  3J8A A;  3MN7 A;  4FPA A;  2HBL A;  4DHY A;  3OBY A;  3SMS A;  1NGH A;  1HPM A;  1NGG A;  5M1K A;  4JKB A;  1VQL N;  3ZYY X;  1VQN N;  3GBT A;  1S3X A;  1YAG A;  3DXM B;  3D7E O;  1V4T A;  2EWS A;  3H3O B;  3HM8 A;  3OBW A;  3R1X A;  4GVE A;  4HWI A;  4IWV A;  4CBU A;  5EXW A;  4BC2 A;  4CD3 A;  2HST A;  1HKC A;  5DM7 L;  2ITM A;  3GE1 A;  4C23 A;  1J6Z A;  3VOV A;  4ILJ A;  3CCU N;  4BRC A;  3BF1 A;  5BRF A;  1NGC A;  4WCE L;  3CXC M;  3B8A X;  1HJO A;  2A3Z A;  3KVG A;  3L4I A;  5F2R A;  4BRA A;  3CCJ N;  3P39 A;  4B1V A;  3O1W A;  2QWO A;  4WYB A;  4WFA L;  3O1B A;  1HKB A;  3O4W A;  1YIJ N;  1BA1 A;  4A57 A;  3VEO A;  5AZI B;  1T6C A;  4JK9 A;  3M3Z A;  4H0Y B;  3WXM B;  3CJ1 A;  3MMV A;  4FWQ A;  3CCE N;  1NBW A;  2Q2R A;  3ZX2 A;  3C6H A;  3HOS A;  3I55 N;  4ISE A;  1BG3 A;  5CHI A;  3DXK A;  3HI0 A;  5KPT A;  1HUX A;  1OVY A;  2HMP A;  2RHK A;  4J8F A;  4JKG B;  4BC3 A;  1GLF O;  3FR0 A;  1K9M O;  2YHW A;  4H0T B;  5BRD A;  3RSE A;  2NRZ A;  3JS6 A;  4BC4 A;  5AQP A;  3TTD A;  3VES A;  3U9Z A;  3I56 N;  2ZWH A;  4CBW A;  1NMD A;  2E20 A;  3JXU A;  3HZ6 A;  4BRD A;  5AZJ B;  4WFB L;  2P9U B;  2YI1 A;  2P9K B;  4FWL A;  2YHY A;  4JNE A;  4KH6 A;  3CQY A;  4PKG A;  1SZ2 A;  1DT9 A;  4KH4 A;  5BPM A;  3CF5 L;  2YJE A;  3A5M C;  4F9O A;  3F9M A;  3ZET B;  2P9S B;  4IOC L;  3L6Q A;  3CPW M;  5AQK A;  2YX6 A;  4E1J A;  2D4W A;  4BR9 A;  1NWK A;  1Z6R A;  4CJ7 A;  1WUA A;  3WXI A;  5AQY A;  5JLF A;  2VWB A;  4YOV A;  3QBX A;  1VQP N;  3BEX A;  4B1Z A;  5HOO A;  3ENB A;  4BG9 A;  3P31 A;  3CC2 N;  1K8K A;  1QQM A;  2NZT A;  3AAP A;  3CJA A;  4CI6 A;  2NNW A;  4BRK A;  2W41 A;  5B8H A;  1VQO N;  3EZW A;  4GV9 A;  3PLA A;  1QZ5 A;  3FZM A;  4GNI A;  2BH1 A;  4GV3 A;  3VGL A;  1BOT O;  4MDB A;  4AM6 A;  4A2B A;  4K41 A;  4DCH A;  2HBM A;  2IVO A;  3D2E B;  5HL7 L;  4CZJ A;  2GEL A;  3HRG A;  1GLJ O;  3IKM A;  3SBG A;  4M7X A;  3IFR A;  5E26 A;  5TKW A;  5AQO A;  3UKU A;  1ILY A;  4FL9 A;  1BUP A;  5F1X A;  3G6E N;  4WQ5 A;  3CCV N;  1QVG M;  3O9Q A;  1K8A O;  4BVP A;  1YVN A;  1BWF O;  1U2V B;  2NLX A;  3MN9 A;  4JKE A;  5JVG L;  4CZL A;  4BGB A;  5KPZ A;  5GAG P;  5C15 A;  3I33 A;  3VET A;  1R59 O;  2P9L B;  4XEI A;  1JCG A;  5ADX A;  4FWR A;  1TUU A;  5DM6 L;  4YOR A;  1Q86 O;  3FGU A;  3WXL A;  1K73 O;  4B1X B;  2VCP A;  2E1Y A;  1TUY A;  4IOX A;  3W3D A;  4H0V B;  4A5A A;  3SAG A;  3SMP A;  3CCQ N;  1Q18 A;  3QDK A;  3M5R A;  3TTC A;  1YXQ A;  4EAH D;  3A5L C;  1ZXO A;  3DWL A;  3LL3 A;  4YDU C;  5ELZ A;  5BPN A;  3O9T A;  5AQL A;  4IO9 L;  3O9S A;  2F7T A;  2P9N B;  3CET A;  4JKA A;  2V7Y A;  1KD1 O;  1HLU A;  1X3M A;  3TSU A;  1XUP O;  5M1Q A;  3UKR A;  3MCA B;  2NRR A;  2YJF A;  1NGF A;  3H46 O;  4BRP A;  4BG8 A;  3O9R A;  2BTF A;  1NGB A;  1QZ6 A;  4YDU A;  4FWM A;  1K8K B;  2E2O A;  4B1W B;  3RSE B;  2NRT A;  3VMF B;  2NRV A;  3AY9 A;  3DXM A;  3K9K A;  2Q36 A;  4RCH A;  5AQQ A;  3VEN A;  2OTL N;  4H5V A;  3EE9 A;  3CME N;  4B9Q A;  4IOA L;  4EIA A;  2IIR A;  4FWK A;  4O8K A;  2HF3 A;  1Q81 O;  1ATN A;  5AQZ A;  5AQW A;  1O13 A;  1N8R O;  1RDW X;  3FE1 A;  3NMU A;  1TYQ B;  3SAH A;  5AQF A;  4BRM A;  4BRQ A;  1Q7Y O;  3E66 A;  3EKU A;  2A5X A;  3H3N O;  4KBO A;  2D0O A;  1BU6 O;  4BQZ A;  3CC7 N;  2P9U A;  4QS9 A;  5C2F A;  1Q82 O;  4YOY A;  3CJ7 A;  5AQN A;  4NLC A;  5M1O A;  3CCM N;  3MN5 A;  2NRH A;  1CZA N;  2FF3 B;  3ID8 A;  5BN9 A;  1YUW A;  1S72 N;  4QS8 A;  2WC9 A;  4CZF A;  3WT0 A;  3BP8 A;  4CZM A;  2CH6 A;  2KHO A;  3A0I X;  2PAV A;  2RE2 A;  4BRG A;  1KXP A;  3ULE B;  4BQL A;  2NRX A;  4R79 A;  5F0X A;  3O6W A;  3ENH A;  2JWK A;  1ATS A;  3WEE B;  4JK7 A;  1VQ6 N;  4K25 A;  3EN9 A;  4XH5 A;  4YOT A;  1E4F T;  3WXJ A;  5GAD P;  2PFU A;  1G99 A;  1QQO A;  3P38 A;  3LDN A;  4MLH A;  3WEE A;  1SS6 A;  2P9L A;  3EE8 A;  3MN6 A;  2ASM A;  4AF1 A;  1VQ5 N;  2QW9 A;  5KQD A;  4U67 L;  4FWN A;  3QFP A;  3U9D A;  2P9I A;  2QWN A;  3MCP A;  1VQ4 N;  5BRE A;  5AQT A;  3UKU B;  3HOT A;  2OAN A;  3VEY A;  4OPH A;  5AFU A;  4FSV A;  5FPN A;  2WUS A;  4JEP A;  3C65 A;  3VTH A;  5AR0 A;  1JJ2 M;  3A8Y A;  1P8Z A;  3ATV A;  4ISF A;  2F9W A;  2H3G X;  1ATR A;  3VF4 A;  5AQM A;  5GIN A;  3VEZ A;  4O8U A;  2AP1 A;  3DAW A;  1MA9 B;  5AZJ A;  3PIO L;  4PL8 A;  3UKR B;  4XH1 A;  2F9T A;  3R3L A;  1YJ9 N;  4JD2 B;  5ADX H;  4FWO A;  3CCS N;  4BC5 A;  4OPA A;  4FOI A;  3FZK A;  1NGA A;  2P9N A;  1NGD A;  1V4S A;  3G25 A;  2W40 A;  3R9P A;  2FXU A;  1VQ7 N;  2PBD A;  5GIO A;  3TSP A;  1MDU B;  3LDO A;  1ESV A;  4H0O A;  4IXC A;  1VQ8 N;  4JKG A;  2UYT A;  2JWL A;  4H0X B;  1M90 O;  2ZJQ L;  5AQV A;  3O9U A;  3VF6 A;  1YHQ N;  1GLC G;  2AA4 A;  1YF5 L;  2V52 B;  4DB3 A;  4JAX A;  1HKG A;  2QWQ A;  4B1U B;  4WF9 L;  4WQ4 A;  4JKD A;  1VAZ A;  2FLO A;  3H1Q A;  2Q31 A;  5CE3 A;  3CC4 N;  2GWK A;  4C1N K;  4A61 A;  1VQK N;  3HBT A;  2CH5 A;  3ENO A;  5FPE A;  4FOE A;  4BR4 A;  4WFN L;  1M1K O;  1OKJ A;  1S22 A;  3EKS A;  3VGM A;  4PHT X;  5JIC A;  1X3N A;  4ISG A;  2QTD A;  5EVZ A;  3CPE A;  1NM1 A;  4ILG B;  1P90 A;  3DXK B;  3GG4 A;  4IJA A;  4FVU A;  3A5N C;  3ZX3 A;  4YOU A;  1JCF A;  2GWJ A;  3O8M A;  1TYQ A;  3CCR N;  1H1V A;  4BGA A;  5AQU A;  5I9E B;  3QML A;  4H5W A;  2HF4 A;  3ULE A;  2CGL A;  2FF6 A;  4CZH A;  1YI2 N;  3VEX A;  4L3Q A;  2ASO A;  3CI5 A;  4EFH A;  3H45 C;  4YOW A;  3GL1 A;  3FZF A;  3KWG A;  1LOT B;  4ILH A;  3AGK A;  4LC9 B;  5C0Y A;  2I7P A;  5M1F A;  3T69 A;  3CQX A;  1MWK A;  3R6M A;  5GIP A;  2Q1N A;  2E1Z A;  2QWL A;  3E9P A;  2KLA A;  2VGN A;  5AQX A;  3WQT A;  3GDQ A;  4BRH A;  1RFQ A;  3MWT A;  4IEI A;  5E84 A;  3LDQ A;  3I8B A;  2P9I B;  3BF3 A;  3VEV A;  5C2D A;  1Y64 A;  2ZJP L;  4MO4 A;  5KQ8 A;  4I6M B;  4MO5 A;  4A62 A;  3E9O A;  3CCL N;  3K9J A;  3MDQ A;  4CZK A;  4FPB A;  2FSK A;  5MLC Q;  1KAX A;  3VER A;  2A42 A;  3GOI A;  3C7N B;  3J7Z O;  4NO7 A;  3DJC A;  5AQS A;  3HTV A;  1GLA G;  2A41 A;  4BY9 C;  3VTI A;  3MX5 A;  1ZC6 A;  3CER A;  4XH4 A;  5C10 A;  3SJH A;  2ZGY A;  3ZX0 A;  4FWP A;  3CHW A;  3D2E A;  1Z05 A;  5EX5 A;  3VF2 A;  3CD6 N;  3VEW A;  3U8X A;  5AQI A;  1NLV A;  4HTL A;  5CR4 A;  2BUP A;  3O80 A;  2CGK A;  5AQH A;  5TKY A;  1NGE A;  2ZF5 O;  3MK6 A;  4JKC A;  3VPZ A;  1X9J A;  1ZBS A;  3LDL A;  3QIC A;  2E88 A;  5LY3 A;  4CZI A;  3UB5 A;  5AQJ A;  4GY2 B;  3UE5 A;  3U4L A;  4EHT A;  2OTJ N;  3TPQ A;  1W97 L;  1GLE G;  3D6R A;  4H0P A;  5BRH A;  2D0P A;  2J4R A;  3VGK A;  3FZL A;  3ZET A;  2IVN A;  1KC8 O;  2FSN A;  3A5O C;  3M1F A;  4IJN A;  1D4X A;  2Q0U A;  1KAY A;  2Q0R A;  4FO0 A;  4JHD A;  1WOQ A;  4JHD B;  3WQU A;  5M1N A;  4H5R A;  2D1K A;  3E1Y A;  4BR5 A;  4WQ5 C;  2A6A A;  3QB0 A;  4AM7 A;  1BA0 A;  1EQY A;  4RTF D;  4H03 B;  4JKH A;  2QWR A;  1W2B M;  4BR0 A;  1JCE A;  4PL7 A;  1BO5 O;  3C7N A;  3H6E A;  3OA9 A;  5AFU H;  5LJW A;  2QM1 A;  4IFE A;  3DLL L;  1BDG A;  4JK8 A;  2QWP A;  5JVH L;  1GLD G;  4CBX A;  4B1Y B;  3CMA N;  3SLC A;  2V51 B;  2HOE A;  3EO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...