2GELA

2.05a crystal structure of salmonella typhimurium yeaz, form b
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
218
structure length
218
Chain Sequence
b'MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Gram negative resuscitation promoting factor
publication title Structural Characterization of Salmonella typhimurium YeaZ, an M22 O-Sialoglycoprotein Endopeptidase Homolog
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
total genus 66
structure length 218
sequence length 218
chains with identical sequence G
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gelA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2gelA02
5EX5A 4XH1A 3ZX3A 2PBDA 3CIPA 3VF6A 4EFHA 2FF3B 4B9QA 1YVNA 3A5OC 4NB4A 1YAGA 3BF1A 2CH6A 5BN8A 5ADXA 4RCHA 5KPTA 4MO4A 2P9SB 4WQ4C 1NGGA 2I7NA 4I6MB 3WT0A 5JMVA 3IFRA 3WQUA 4H0YB 3A5MC 3VGMA 4B1UB 3UKUB 1U2VA 4RWTA 4XH4A 1BOTO 3H3NO 4BRPA 1MWMA 3QMLA 1GLDG 3LM9A 2P9NB 2QWOA 4E1JA 4M63C 3DXMA 5AQWA 1TYQA 3L4IA 5FPMA 2ASPA 5E84A 3I8BA 3H6EA 2D1KA 4H0OA 3HI0A 1HKCA 3CJBA 2ASOA 4CZGA 4PKIA 3VPZA 3U8XA 3O80A 1QQMA 2VCPA 4CZJA 3M1FA 5AFUA 3C0BA 5BRFA 4H5NA 5F2RA 5F1XA 5FPDA 4MLEA 4A2BA 4BRQA 1C0GA 5AQRA 3ZX2A 1KAZA 4HWIA 5AQMA 1NLVA 3HBTA 2V51B 4PL8A 3LDOA 3D7EO 3LL3A 1NGFA 4CZMA 3QFUA 1U6ZA 2A42A 1GLJO 3CERA 3VF2A 1BA1A 3JS6A 1X3NA 1QZ5A 2CGJA 3VEWA 3IUCA 5AQHA 1X3MA 4BQLA 2CGKA 3H1VX 2QWRA 4ISGA 3QFPA 4NO7A 4EAHD 1BA0A 4B1YB 3CI5A 2E2QA 3OHRA 2GUPA 2A5XA 2HF4A 5BN9A 4XEIA 1SQKA 5AQOA 3G25A 2DPNA 4CZLA 3A5LC 3DJCA 5B8HA 1SZ2A 5BR9A 1RFQA 5LJVA 4XH5A 4B1WB 5AR0A 3CJAA 2IVOA 3CJ7A 2E8AA 3R9PA 4YDUC 5LJWA 4MO5A 3JXUA 3FZFA 3VEVA 2BTFA 3FE1A 1XUPO 4FWNA 3O08A 3P4IA 1NGJA 1NBWA 5AZIA 4BRAA 3UE5A 1HUXA 3MMVA 4BRNA 2P9UB 1OKJA 3EL2A 4F9OA 1HKGA 3VENA 3W0LA 3WXJA 2FSKA 4B1VA 2IVNA 4JD2A 4FL9A 3MN9A 3CJ9A 4IZ9A 1QQOA 4FSVA 4LC9B 3ZX0A 3ENOA 5BPNA 3HZ6A 4M7YA 3U4LA 3FGUA 3TPQA 1IG8A 3KHYA 4H5TA 3GG4A 4K42A 3CJCA 1C0FA 4BRHA 5AQLA 1ZBSA 4FO0A 1BU6O 5AQVA 5EXWA 3GL1A 2NRHA 2V7YA 5BPMA 4H0VB 2Q2RA 1QZ6A 1ATSA 3QB0A 1NM1A 5TKYA 1JCFA 3LDPA 2H3GX 4BVPA 5JICA 2P9IA 3EN9A 3O5BA 4H0XB 2YHWA 3AARA 1K8KB 1RGIA 3D2EA 2I7PA 2P9PA 2P9LA 1WOQA 3VEZA 1DEJA 4B1XB 2FXUA 2ZF5O 2W40A 3GDQA 4FWQA 4H5VA 3C7NA 3S41A 5AQXA 3UKRA 4FPAA 1XC3A 2ASMA 4BR5A 2A40A 4A62A 4CI6A 4BRLA 2AP1A 3FLCO 3M3ZA 3SK3A 4ISFA 4M7XA 1ESVA 1MA9B 2QWNA 3BF3A 4FWMA 1KAYA 3F9MA 2YJFA 4CZIA 4WQ4A 2Q0RA 2Q31A 2YCHA 3MN5A 4A2AA 3BP8A 4CZHA 2QWLA 5FPNA 4EHUA 3QDKA 4QS7A 2W41A 4BR4A 5AQGA 3DWLA 4BC5A 2FLOA 4BG9A 4BC2A 5ADXH 1TYQB 3CHWA 4HTLA 3H45C 3H1QA 3SJHA 4JN4A 3O8MA 2QXLA 4FWKA 4BR2A 2EWSA 2HF3A 5AQTA 2P9NA 4FPBA 2OANA 2QWPA 1QHAA 3CJ1A 2FSJA 2VYPA 3VF4A 1IJJA 3WXIA 4DQ8A 4CBUA 3FZMA 3LDNA 2A6AA 3MN7A 5BRHA 5AZJB 3EKUA 3L0QA 2BUPA 4L3QA 4BRCA 2YJEA 4BGBA 2D0OA 2HMPA 5AFUH 4AM7A 3SMPA 3MDQA 2E1YA 2ITMA 2GELA 4BRDA 4CZKA 3ATUA 3O6WA 4CZEA 1KAXA 3WQTA 4CBXA 3LDQA 3WUHA 3O1BA 5AQNA 2FSNA 3VEXA 4IJAA 4K25A 2NLXA 2D0PA 2QW9A 4PL7A 3DAWA 4DCHA 1HJOA 5AQPA 1R59O 2AA4A 1T6CA 3HM8A 2E2OA 2E20A 1YXQA 1EQYA 1NGIA 3MN6A 5AQIA 1QQNA 2V52B 3FFKB 3W3DA 3DXKB 3ZEUB 3AAPA 3ZETA 4BGAA 4PKGA 1GLCG 4YDUA 5JLFA 3SLCA 5AZIB 1T6DA 3QBWA 1S22A 2IIRA 5KPRA 3HTVA 1TUUA 5KQDA 3GBTA 4QS9A 1Z6RA 3ULEB 1WUAA 4JD2B 4WQ5A 2Q36A 2P9KA 1MDUB 2ZGZA 3FR0A 2QWQA 5EOYA 3I33A 3FZLA 3RSEB 2KHOA 2P9UA 4J8FA 4FWLA 3WEEA 4BG8A 4JHDA 1LOTB 3D2FA 1BG3A 1HLUA 3VGKA 2GEMA 3VGLA 5AQSA 1BUPA 3R6MA 4BC4A 4B1ZA 1GLFO 3UB5A 2V7ZA 3BUZB 4CD3A 5EVZA 1HX1A 4BR9A 2P9IB 3A0IX 4BRKA 4IWVA 3A8YA 4K43A 2E2NA 2HOEA 2GWJA 2VWBA 1LCUA 1ZXOA 4JAXA 2P9PB 1BWFO 2P9LB 1RDWX 5FPEA 1E4GT 5CE3A 3WXKA 1K8KA 3VERA 1V4TA 5EY4A 3VEYA 3R8EA 4H5RA 4BQZA 1CZAN 3ENHA 4DHYA 3IDHA 2A41A 1H1VA 4CBWA 1NGHA 1SAZA 3H46O 1Q18A 1NGBA 1DKGD 5AQFA 1NGDA 2P9SA 1X9JA 2E1ZA 1U2VB 5E26A 2QM1A 5LY3A 4O8KA 1NGAA 2E88A 4FWSA 4I6MA 3SMSA 5AQJA 3QBXA 3EKSA 3DXMB 3ID8A 4FWRA 3UKUA 4H0TB 3GOIA 3WXLA 3FZKA 1NMDA 4DB3A 5KPZA 1MWKA 3EZWA 5AQZA 4BVOA 2UYTA 1Y64A 4QS8A 4BROA 2YHXA 4KBOA 1J6ZA 2F9WA 2Q97A 4H5WA 2IVPA 2QWMA 1HPMA 1XQSC 3CETA 1GLAG 5KQ8A 4O5FA 3A5NC 1BDGA 2GWKA 3B8AX 4C23A 4AM6A 1ZC6A 4Y0WA 5AZJA 1E4FT 4EIAA 2YHYA 2PAVA 5JLHA 5AQUA 4H03B 4BRIA 1Z05A 3KZBA 4CD1A 3GE1A 1T44A 3M6GA 1JCEA 2D4WA 1ATNA 4FOIA 4RTFD 3VOVA 3VEOA 3KVGA 3L6QA 4BC3A 1P8ZA 3O4WA 3VETA 3U9ZA 4CJ7A 5BRDA 1HKBA 4GNIA 1GLBG 2A3ZA 1NGCA 3LDLA 4A61A 5BREA 3LM2A 4GY2B 3VESA 3ATVA 2NZTA 2F9TA 3ZETB 1DGKN 1KXPA 1V4SA 2FF6A 1ATRA 1GLEG 1JCGA 3TU5A 2YI1A 3DXKA 3ZEUA 4WYBA 4BRMA 4CZFA 4BREA 2P9KB 4H0PA 2ZGYA 4IXCA 4BRFA 4PKHA 5AQQA 5I9EB 1YUWA 4WQ5C 1NGEA 3WEEB 4IJNA 3AY9A 3H3OB 3ULEA 1G99A 5F0XA 4ISEA 4FWOA 4JHDB 3D2FB 5AQKA 3RSEA 3BEXA 1NWKA 4EHTA 2E2PA 3MK6A 2WUSA 3HSCA 3O1WA 4IO8A 2J4RA 1TUYA 4FWPA 4BRGA 4FOEA 3CQYA 3U9DA 2CH5A 3AAQA 3CQXA 1GLLO 3D2EB 5ELZA 3QICA 5AQYA 3IMXA 1BO5O 4K41A 5BPLA 4BR7A 3J8AA 2ZWHA 4MLHA 2Q1NA 2Q0UA 4JNEA 4BR0A 3C7NB 3UKRB 3MCPA 3FZHA 2CGLA 3EO3A 1S3XA 1D4XA 2GTDA 4Z94A
chains in the Genus database with same CATH superfamily
1RT3A 3AVAA 4DR2K 3TTCA 1NJYA 1VQ7N 3VQBA 4JI7K 2CH6A 2IDOA 3K5OA 4RCHA 3P39A 1T05A 5JS2A 5M1PA 4I6MB 3AVNA 4H0YB 4KI6A 4RWTA 4JEPA 1L5UA 1WB9A 3LM9A 4DSLA 1EWQA 3L4IA 3I8BA 3WNFA 4H0OA 3HI0A 4CJPA 4CZGA 4DS5A 1SS6A 4CZJA 3M1FA 4CF1A 5BRFA 2O8CA 4UY8O 1KVBA 4BRQA 5AQRA 3VQ6A 3ZX2A 1KAZA 2B4JA 4HWIA 2V51B 4GVMA 3K5MA 4BE0A 1SKRA 3LL3A 4CZMA 1N33K 3QFUA 4U67L 4KHPK 1GLJO 3CCLN 3CERA 3M8RA 3HP9A 3JS6A 4O44A 2CGJA 3VEWA 3IUCA 4J2EA 4LF4K 4AHSA 2WTUA 4BQLA 5FLXO 3H1VX 3SBTA 4B1YB 3CI5A 2E2QA 1YVUA 3THWB 3LDSA 2HF4A 4CJRA 1SQKA 1HNZK 2NNWA 3DRSA 4DV3K 1N32K 3DM2A 5BR9A 4XH5A 4DV0K 1VSLA 4M3UA 1N34K 1IKWA 2NUBA 3R9PA 4YDUC 5LJWA 4F8RA 4C1NK 1WSFA 2DFEA 4A5BA 4BRAA 4FZXC 4JK9A 4FYDA 4FJGA 4DTJA 1D8YA 4KV8A 3W0LA 4B1VA 2FSKA 4AILC 1TK5A 4FJIA 1RDDA 2IVNA 4JD2A 3CJ9A 4FSVA 3OVNA 3ZT0A 3CC4N 3HZ6A 1F21A 3KHYA 4H5TA 3GG4A 1HR0K 3PIPL 1C0FA 4BRHA 4U7BA 4E7HA 5AQVA 1BU6O 2NRHA 3ZSZA 4YFUA 3OYKA 2Q2RA 1HYVA 4F2RA 3IRXA 1VQ8N 1NK4A 2H3GX 3HXMA 4H0XB 3ENBA 1RGIA 1TAQA 1RBSA 2I7PA 3NF8A 1RNHA 1NK0A 4F2SA 2FXUA 4W5OA 3SUNA 1RT4A 1WBDA 4GV9A 3GDQA 4E89A 4B9VA 3C7NA 3QIOA 5AQXA 2UXCK 3UKRA 1VSKA 2A40A 2ZE2A 4NCBA 3LANA 4ISFA 4CF2A 4FJHA 4FWMA 2P5GA 3HOTA 4B9SA 2Q31A 2YNFA 5FPNA 5DM6L 3DWLA 4BC5A 1NK7A 5J2PA 1S9EA 3KK7A 4ZTJA 3Q7CA 3SYZA 3AA2A 3H1QA 1WAFA 4JN4A 3SBGA 4E7KA 4FWKA 4BR2A 1WAJA 3CPWM 5AQTA 2FBXA 3BZCA 2F96A 1UWBA 4FPBA 4FZZA 2FSJA 2VYPA 5M1KA 3VQPA 3T69A 3WXIA 1NKCA 4N76A 5BRHA 3MN7A 3D6RA 2RN2A 4DTXA 2OCEA 4DS4A 4M3TA 1NOZA 4Z4IA 4GV6A 1HRHA 2GELA 3VQ7A 4CZEA 4CBXA 3WUHA 5AQNA 3TWHA 3NH0A 4K25A 3HPGA 1QQCA 2QW9A 3DLBA 5C10A 4DF4A 4FLZA 1T6CA 1ITGA 2E20A 2OTLN 3EZ5A 4Z4FA 1B92A 3FFKB 3W3DA 1DT9A 3CYMA 1NK9A 1M90O 3ZETA 3HP6A 4F3OA 1RTJA 3SQ0A 5JLFA 3LPUA 3DLEA 2IGIA 3SLCA 5AZIB 2F4VK 5KPRA 2E4LA 4CJFA 4OX9K 1S1VA 3ULEB 5HRRA 3N4QA 3FR0A 3I33A 2XY5A 3RSEB 3ZSVA 1JKHA 1HPZA 4DFMA 3VQ8A 2XY6A 3OYCA 4CHPA 3ZLJA 5SZTA 4FM0A 1FK9A 4YHHK 1ZBIA 3VN5A 3ZSXA 4KB0A 3L2WA 1HLUA 2HHSA 3VGKA 3VGLA 1BUPA 1Q7YO 4BC4A 2KQ2A 4CESA 3BUZB 4DTPA 3AO5A 5EVZA 4DR4K 3SUOA 3BZKA 4IWVA 3G4SN 3ZT3A 1NK6A 4DSJA 3LZJA 5FRNA 2HOEA 4LFBK 2GWJA 2VWBA 1QSSA 1BWFO 2P9LB 1SKWA 3F9KA 3VQ5A 5FPEA 4BE2A 3F2KA 1M1KO 3RRGA 5CE3A 1K8KA 5EY4A 3VEYA 3ZCMA 1ZBLA 4CF8A 4IOAL 1CZAN 3PSFA 4PWDA 3TTFA 2HBLA 2P51A 1NGHA 3H46O 3E9OA 3ITHA 3TAQA 1YTAA 2A1SA 3MWPA 4FJ7A 4DQQA 1RBRA 1J9AA 1X9JA 4JKBA 3AA5X 4IFYA 4I6MA 3NE6A 1EXQA 4HHTA 2G8FA 1YT3A 2I5JA 1HJRA 4DKWA 4OPKA 3LWMA 1NMDA 4DB3A 3MX2A 2XRIA 1IBKK 3J7ZO 3EZWA 5AQZA 4BWMA 2UYTA 2O8CB 4OGCA 3TAGA 1VQ9N 1EETA 2YHXA 4KBOA 1J6ZA 4B3TK 5CHIA 4PQUA 3AVBA 2IVPA 4H5WA 4EP4A 1HQUA 3VA3A 1XQSC 4X65K 3NH1A 5KQ8A 4O5FA 4M41A 4NLCA 1IBMK 4FK4A 1BDGA 2GWKA 4CERA 1RT2A 4AM6A 2X6NA 3C6UA 3DYAA 1ZC6A 3ASMA 2YHYA 4LF8K 4Q5VA 5HROA 2FC0A 1KLMA 4G1QA 4Q0BA 1ILYA 4BRIA 2VG7A 1Z05A 2YV0X 2D0BA 3V81A 4N47A 1LAWA 4FK0A 2D4WA 4GKKK 2FBTA 4FOIA 3VOVA 3THWA 4CGDA 1XWLA 3K9JA 3VEOA 1OH8A 4O0IA 1TL1A 4K8ZA 1D9FA 3OYEA 2A3ZA 3LDLA 4CEFA 5BREA 4DWIA 3E66A 4FJKA 2AJQA 2QTDA 2Z1JA 1OH5A 4KHYA 4KREA 3R1XA 1GLEG 3SPYA 4JI6K 3TU5A 3DRRA 1ZBUA 3DXKA 3ZEUA 3L3VA 4WE1A 4Z0UA 2D0CA 1FKOA 2VQEK 1D5AA 2WONA 4OPJA 4IXCA 4BRFA 1YUWA 4KFBA 4WQ5C 3WEEB 3AVIA 1RCHA 3AY9A 1S5JA 2HB5A 1TGOA 5D3GA 4KH4A 4JHDB 1WLJA 1S1XA 5HP1A 3H08A 4C8KA 3BEXA 2RE2A 4EHTA 1VQNN 2WUSA 3HSCA 3O1WA 5GINA 4FWPA 5HRNA 2CH5A 3AAQA 1VQ5N 1NG9A 3VMFB 1Q81O 3SV3A 3T1AA 3NAEA 3QICA 3OA9A 3V1RA 3IMXA 3ISNC 5BPLA 5I3UA 4C8LA 4FLXA 1J54A 3DLKA 4IDKA 4JNEA 4BR0A 3C7NB 1T3VA 3UKRB 1L3TA 2CGLA 1D4XA 4YOWA 1BCMA 5EX5A 3CF5L 3AVMA 3IG1A 3ZX3A 3RTVA 3CIPA 3VF6A 2HMIA 3HVRA 5JVHL 1YAGA 3BF1A 1K9MO 5ADXA 4FLWA 1S6QA 1BGXT 4FJXA 3AVHA 4O5BA 4N56A 4DV5K 2I7NA 1EWRA 3MCAB 1ZBHA 3NVMA 3TAFA 4A5AA 1HNXK 1C0TA 2LSNA 3A5MC 2O8EA 3OTOK 4B1UB 4XH4A 4BRPA 3OYLA 3KLFA 3QMLA 2HBKA 3LZIA 4AQYK 3ZYYX 2WBNA 1O1WA 4LH4A 1W9HA 5E84A 1RT7A 4JRPA 4B9TA 2KTQA 4N5SA 4FXDA 4W5NA 2ASOA 1C0UA 5HBMA 4KHSA 3VPZA 3U8XA 3ZSRA 2VCPA 5FPDA 4MLEA 4OJRA 1A5WA 1VSDA 4FJ5A 1U4BA 3E9PA 3NF6A 3PSIA 3HBTA 3KLGA 3QEIA 1OVYA 1XNQK 3OYGA 4W5RA 2OPPA 3N4PA 1CZBA 3TTDA 1J5EK 4I2PA 1C1AA 4DTNA 3HK2A 1BA1A 4FJLA 4DV6K 5FRMA 3O9RA 2P5OA 1X3MA 3LP2A 4HVJA 4KHWA 4JI8K 3HSTB 4NO7A 1BA0A 1QVFM 5C2FA 5GAHP 3T7ZA 1BQMA 2A5XA 5BN9A 4XEIA 1RDUA 3G25A 4CZLA 3A5LC 2E6LA 4DV2K 3S3OA 1K8AO 5AR0A 3CJAA 1G15A 1O13A 2IVOA 4MO5A 3JXUA 3FZFA 4KH6A 5KI6A 1RBTA 4CEOA 2NRVA 2VQFK 5AZIA 1NBWA 4LF7K 4RW4A 1HUXA 1OKJA 3EL2A 4F9OA 4Y1DA 1KCFA 3S9HA 4FL9A 3L2VA 4LC9B 2HHHK 3ZX0A 1S6PA 4M7YA 1BIZA 2YNIA 4EP5A 2YNHA 1RTDA 1IKVA 2BGGA 2O8BA 1NJXA 3BDPA 3VQAA 3K57A 2VWJA 1CXQA 2O4GA 1R0AA 3NVKA 4BY9C 1QS4A 4PA1A 4FLYA 1QZ6A 1ATSA 5CY4A 5TKYA 3TSUA 3VTIA 1JCFA 4KHQA 3TI0A 3THYB 5E41A 1YITN 1KLNA 1JLCA 2VG5A 3O5BA 1KFSA 4CFDA 3AARA 1K8KB 4OLBA 3D2EA 5HOOA 2P9LA 4WFBL 1DEJA 1JLQA 3THVA 3AO2A 1U04A 1I39A 2ZF5O 2W40A 1K6YA 3DOLA 1S1UA 3S41A 4BRLA 4BACA 3FLCO 3SQ4A 3KKSA 4CEEA 2QWNA 3K58A 1KAYA 4O4GA 4CZHA 2Q0RA 4A2AA 3BP8A 2W42A 2ZM6K 3T19A 3SQ2A 3AVKA 2W41A 3CCUN 3KK2A 1S1WA 3SUQA 5FROA 4BG9A 3SPZA 5GAEP 5ADXH 4FLUA 3CCMN 4JI3K 3CHWA 3ZT4A 1QSYA 4K8XA 3SJHA 4YOXA 5TKWA 3VQCA 4QAGA 3ID6A 2RKIA 3KTQA 4CJLA 1VRTA 2EWSA 2HF3A 4B3MK 1YIJN 1U45A 3PV8A 1NJZA 3AVCA 2OANA 2QWPA 4Z4HA 5DMRA 4CK1A 3VF4A 4GMJB 4IDHA 2G8KA 2YKMA 2FBVA 3L2RA 3CMAN 2YJEA 3LP3A 2D0OA 4CGHA 4JV5K 1TK0A 4AM7A 3MDQA 3V9XA 1UA0A 3O6WA 1KAXA 3QEXA 5AJ3K 3O1BA 2NRRA 1VQ6N 2NLXA 2D0PA 3OW2M 4PL7A 2QEXN 5C25A 2Y1IA 2UU9K 1R59O 1XHZA 2NRWA 3KD5E 5C0YA 1K73O 3HM8A 3WNHA 4W5TA 4H4MA 1QQNA 2V52B 3D0PA 3DXKB 3ZEUB 4IEIA 3AAPA 2XY7A 4CVNE 1T6DA 3QBWA 1S22A 2JWKA 2IC3A 5KQDA 2EX3A 2UUAK 4CJWA 4QS9A 2B5JA 1Z6RA 1W7AA 1WUAA 4WQ5A 4A57A 1HNVA 4JKFA 1SL0A 4DQRA 2KHOA 2P9UA 2HHWA 1A5XA 1QSLA 3WEEA 4JI4K 3J7YP 3RWUA 1N5YA 4DU3A 1T8EA 4JHDA 4IOCL 4KTQA 4JI0K 5HL7L 1BG3A 4IFEA 2E6MA 5AQSA 3IS9A 3PY8A 1GLFO 4KI4A 4LY7A 3OYHA 1Q9XA 3JYTA 4YOVA 2ZJPL 2HHQA 4CD3A 4JLHA 3OS2A 4BR9A 2P9IB 2RHKA 3TR8A 5LMUK 2E2NA 2YKNA 4IFVA 3QIPA 4CE9A 1LCUA 1ZXOA 1IO2A 4AHUA 1NKBA 1JXEA 4K0KK 4DQPA 4B9LA 1SL1A 4DTRA 4Z4EA 4KKOA 3DOKA 3KWIA 3M8SA 4O55A 4H5RA 4CK3A 3SAGA 1UA1A 3ENHA 1KC8O 4KTWA 4X62K 4CBWA 3J81O 3LAMA 4FCYA 1TKDA 1NGBA 1DKGD 3EE8A 2O8EB 1NGDA 1X1PA 1NKEA 3TSPA 2QA4N 2ZD1A 2E88A 4FWSA 1X9MA 3QNNA 1JLEA 3ID8A 2WFBA 2HNYA 4MDBA 1SL2A 1VSFA 3GOIA 5A2QO 3SJJA 5KPZA 3CFPA 3TANA 3L8BA 1WN7A 1LAVA 1JJ2M 4C8OA 2OTJN 4JI5K 1UAXA 3EYZA 2F9WA 4GV3A 4DTUA 4BWJA 3CXCM 4JI1K 3LWLA 4JI2K 1GOAA 3NGYA 1GOCA 3CETA 3SNNA 2HHVA 3V9SA 1GLAG 3V4IA 2G8IA 3T3FA 5CYQA 3B8AX 4C23A 2DY4A 1YF5L 3KK3A 3QEWA 1BIUA 2DFFA 2BDPA 1YHQN 2OYQA 4M3WA 3K0SA 1WSEA 5C42A 1ASWA 1XC9A 4CJSA 1P8ZA 2UXDK 3O4WA 5BRDA 2OPQA 3LPTA 4NYNA 3VESA 2KLAA 5CZ1A 2F9TA 4DMNA 1U49A 1KXPA 2UUCK 1ATRA 4LFAK 1JCGA 4BDYA 2YI1A 1TKXA 5HRPA 1W2BM 1KQSM 4BRMA 4J2AA 2P9KB 1VSHA 2ZGYA 3F73A 4BE1A 4AHRA 4KH5A 4PKHA 2HBJA 2O8BB 1NGEA 1YJ9N 1OH7A 4FJ8A 3H3OB 3JSMA 3K2PA 5BR8K 3OJUA 4RW8A 5KGXA 4CJEA 2R7YA 2YX6A 5GIPA 2XO7A 4JKCA 3S3MA 1NNEA 1VRUA 3ZT1A 3V1QA 3OYFA 4FOEA 1DLOA 3CQYA 4A59A 4LSLA 3T1HK 3CQXA 3D2EB 4B9MA 4CJ5A 1KRPA 5FDLA 4O8UA 3THYA 2WC9A 1WSGA 3D45A 4FLVA 2XY8A 4CEAA 3IAYA 4IOXA 4JKEA 3EO3A 3AA3A 4B3SK 4XH1A 4CJ4A 3RVCA 4EFHA 3TARA 2FF3B 1YVNA 3A5OC 1HYSA 3DRPA 4NB4A 3E01A 5KPTA 3LALA 2P9SB 3B6PA 1NGGA 1RT5A 4G9ZA 1IKYA 4CHZA 1JL2A 5JMVA 4M3XA 3THXA 3WQUA 2D5RA 4DV7K 4IKFA 1RDAA 3VGMA 3UKUB 1BOTO 2O8FB 3MWTA 3MXJA 3HJFA 1HNIA 1KD1O 4E1NA 4F4KA 2QWOA 2VWKA 4E1JA 4M63C 2QI2A 2G8HA 3MX5A 4CEDA 1HKCA 3CJBA 4CJTA 5MLCQ 4F3TA 3NGZA 4PKIA 4HUFA 5AFUA 4M45A 2Z1GA 3C0BA 4H5NA 5F2RA 4A2BA 5C12A 4CGJA 3DI6A 2KFNA 4CIGA 3D7EO 4FVUA 4CIFA 2NRXA 2A42A 2VG6A 5SWMA 4NXMK 4M3ZA 1QZ5A 4IO9L 1VQMN 2ITGA 5AQHA 3VA0A 2CGKA 3QNOA 2QWRA 3QFPA 4B8AB 4W5QA 4EAHD 4DU1A 1Y97A 3M8PA 3OHRA 2GUPA 4ZHRA 5AQOA 1IBLK 4KB1A 3DJCA 1S9GA 1SZ2A 2ATQA 3MXMA 1RFQA 4FM1A 3AVFA 4X66K 4DSKA 2E8AA 4AF1A 3VEVA 4E7LA 3P4IA 1NGJA 3MMVA 3PUFA 2P9UB 1HKGA 1UOCA 3VENA 2VGNA 3WXJA 4ILHA 3O9QA 3MN9A 4E0DA 4IZ9A 1QQOA 4LSNA 4CEQA 3ENOA 3U3GA 2DFHA 2OA8A 4MQ3A 3FGUA 4B9UA 2ZQBA 3CQ8A 3CJCA 3VQEA 1Q86O 3V1OA 4KRFA 3V9UA 4FO0A 5EXWA 4JKDA 3GL1A 3L2UA 3J7AP 4H0VB 3HYFA 2HBMA 3QB0A 5GADP 3HOSA 1WBBA 4AHCA 2RF2A 3LDPA 4BVPA 2P9IA 2P1JA 1NK8A 2YHWA 3NHGA 4DR5K 1XI1A 3VEZA 4HCCA 3CM5A 1ASVA 1TV6A 3HRGA 4FK2A 1XC3A 3ZSYA 4CI6A 2PYJA 5C15A 3QEPA 3K5NA 4M7XA 4CJQA 3BF3A 2G8WA 3F9MA 2YJFA 4CZIA 4WQ4A 3MN5A 4E3SA 4EHUA 1NJIO 3QDKA 4QS7A 3KD1E 4IBNA 5T7BA 3AO3A 2FLOA 4BC2A 2Z1HA 4YNQA 1TYQB 4HTLA 3H45C 2PYLA 3KLHA 3AA4A 2P9NA 1SKSA 4WFNL 5DK5A 3WNGA 3G71N 3KKRA 2HHTA 2W6KA 1IJJA 4DQ8A 4DV4K 3LDNA 4CHYA 2XHBA 3EKUA 3KLIA 3L0QA 4L3QA 4BRCA 4BGBA 3RR7A 5AFUH 1VSIA 3SMPA 1VHXA 2ITMA 4BRDA 4WFAL 4PHTX 3WQTA 4FJJA 3VEXA 3M5RA 4IJAA 1RT1A 3PIOL 3A2FA 1HJOA 5AQPA 3V6DA 3BGRA 4CJUA 3CCSN 3FFIA 5J1EA 4DSFA 1NMNA 4PKGA 4BGAA 3E9LA 3RRHA 4DR6K 3AO1A 4NCAA 2IIRA 1KSPA 4CIEA 3KJVA 2HHXA 2ETJA 4R5PA 4AHVA 3OYJA 3O3HA 4ID1A 1X9WA 2Q36A 2P9KA 4ID5A 3NF7A 4J2BA 5EOYA 2QWQA 3FZLA 4LF9K 4R79A 2HNDA 2KZZA 4OKJA 4UQGA 1RILA 3V9ZA 4Y1CA 1D9DA 3VQ9A 3OYBA 3PX4A 3VTHA 4B1ZA 1LWCA 3UB5A 3OS1A 3EEQA 4JK8A 2RPIA 2V7ZA 1LV5A 2KZMA 3T1YK 3CCRN 3AVJA 3A0IX 4BRKA 3HT3A 4JK7A 3A8YA 4E1MA 1OH6A 4CFAA 2P9PB 2Z1IA 4DR1K 4C8MA 3RMDA 4MFBA 1TKTA 2BANA 4OKKA 4WCEL 3WXKA 1FW6A 1V4TA 3CMEN 1QE1A 1S1TA 1VSEA 3THXB 1Q18A 5AQFA 3KK1A 4YORA 3O3GA 3OYNA 2P9SA 2YHBA 2QM1A 5LY3A 4O8KA 4KHNA 2F8SA 3SMSA 5AQJA 1EX4A 4BDZA 1U47A 3UKUA 1QVGM 4E7JA 4GKJK 4H0TB 3S3NA 2O8FA 4KAZA 4FJ9A 3OJSA 3MXIA 4BVOA 4ELVA 2DTUA 4LF6K 1Y64A 4QS8A 4IG0A 4JS5A 4E19A 1QTMA 4FJNA 1IKXA 4GVEA 4CHOA 3NGIA 1C0MA 4JKAA 2IS3A 1N6QA 3MEGA 1DTTA 2GX9A 1IH7A 3A5NC 1SV5A 4RG8A 2UUBK 1TKZA 1VQKN 1VQON 1FJGK 4Y0WA 5AZJA 1E4FT 2PAVA 5CYMA 5AQUA 5JLHA 4CGIA 4H03B 5KTQA 1ASUA 3NFAA 1T44A 3M6GA 1A5VA 1JCEA 3HM9A 1N36K 1Q9YA 4RTFD 3L6QA 5M1OA 2F8TA 4E7IA 3AVGA 3VETA 2B6AA 1S72N 3CD6N 4DFKA 1EP4A 1NGCA 1LWEA 4DF8A 2FF6A 2PFUA 5HLFA 3CC7N 2O8DA 4WYBA 3RR8A 3R3LA 4OKEA 4PY5A 4L8RB 2QKBA 5AQQA 5I9EB 4JKHA 4TSXA 3V9WA 3C6HA 5LL6Z 4IJNA 3L3UA 4LH5A 1JLBA 1G99A 5F0XA 4FWOA 1L3UA 3D2FB 1RBVA 5AQKA 3PO5A 4DLGA 4DFJA 2E2PA 1DTQA 3MK6A 2OZMA 4IO8A 1E3MA 2J4RA 1BISA 2WOMA 4DQIA 1HMVA 3U9DA 4I9LA 3KLEA 3O4NA 1GLLO 1ZYQA 3QLHA 3DLRA 3HL8A 1TVRA 4DTOA 4DG1A 5AQYA 4K41A 1XHXA 2PY5A 4J2DA 4BR7A 3J8AA 2ZWHA 4H4OA 2Q1NA 3O9SA 3RMAA 1OVQA 3FZHA 5M1FA 2GTDA 4CFCA 3QERA 4CGFA 2G8VA 1X9SA 4KTZA 4OVLA 2PBDA 4B9QA 4FZYA 3NH2A 3TSQA 4HTUA 5BN8A 1HYZA 1REVA 5DM7L 4HUEA 4MO4A 4WQ4C 2OZSA 4CF9A 4V19S 2W6LA 3CFRA 3WT0A 3IFRA 1B9FA 1CLQA 1CZ9A 3G0ZA 1U2VA 3H3NO 4LF5K 3QINA 1JXBA 1MWMA 1GLDG 4DUZK 2P9NB 3CPEA 3DXMA 5AQWA 1TYQA 4RW7A 5FPMA 2ASPA 3O4QA 3LAKA 3H6EA 2D1KA 1W0HA 3ALYA 3F5TA 3O80A 1QQMA 5F1XA 4DR7K 3C6AA 2OPRA 3O9TA 1C0GA 1XMOK 4IG3A 1LWFA 5AQMA 1NLVA 3C94A 4IEEA 3PX6A 2BH1A 3SV4A 4PL8A 3LDOA 5K14A 1NGFA 1C6VA 3TABA 2PZSA 3MAQA 1YTUA 1NK5A 1U6ZA 4Z4GA 3J80O 3VF2A 1X3NA 4OO1J 1YJWN 4NXNK 4ISGA 5CR4A 4LFCK 3DLLL 4B3OA 3ZSWA 4OLAA 1BI4B 4B3RK 4I2QA 2IOCA 2DPNA 4ICLA 4CW7B 5B8HA 3KIOA 3DLHA 5LJVA 4B1WB 3NCIA 4YY3K 3OBWA 3CJ7A 4AH9A 2A1RA 4JKGA 2BTFA 1Q82O 3NDKA 5CZ2A 3VQQA 1T7PA 3FE1A 1XUPO 4FWNA 1Z25A 3O08A 3I55N 1FXXA 2HVIA 2HW3A 4B08A 3UE5A 3K59A 3RMCA 4BRNA 1U48A 4YOYA 3BY5A 4N41A 1HQEA 1GOBA 3G6EN 4ZTFA 2HSTA 4ELUA 1TAUA 4RW9A 3TAMA 5BPNA 3U4LA 3TPQA 1IG8A 4K42A 4CHNA 2GV9A 1XMQK 4ELTA 3I0SA 3UIQA 5AQLA 1ZBSA 5EU7A 4DTSA 2KKZA 4CJ3A 5IT9O 3PLAA 2V7YA 4PUOA 2QK9A 1WSJA 2YHAA 5BPMA 4CECA 3LP0A 1NM1A 3SQ1A 3C65A 4O0JA 4MDAA 1RTIA 5JICA 4Z4CA 2GBZA 5KRSA 3EN9A 3QEVA 3CM6A 2Y1JA 4B9NA 2P9PA 1WOQA 4B8CA 1I94K 3G10A 4B1XB 2NRZA 3L4QA 5HRSA 1BQNA 4FWQA 4H5VA 4FPAA 1JLFA 2OPSA 4CJVA 2JLEA 2ASMA 4BR5A 4A62A 2AP1A 4JRQA 1WSIA 3M3ZA 3SK3A 3U3YA 3EY1A 1TK8A 1ESVA 1MA9B 3HO1A 4FVMA 3B6OA 2YCHA 2QXFA 4FM2A 2QWLA 3SAHA 3K9KA 4BR4A 4AHTA 5AQGA 4XIUA 2YNGA 3ULDA 5J2QA 5KRTA 3OYIA 2JWLA 2UXBK 3O8MA 2QXLA 1YI2N 5LMNK 4CGGA 2NRTA 1QHAA 3CJ1A 1VK0A 5GIOA 5IWAK 4CBUA 3E1YA 3FZMA 1J5OA 1VQ4N 2BE2A 2A6AA 5AZJB 2BUPA 1WNSA 4OGEA 3ZSOA 2HMPA 3MEEA 1JL1A 1NU0A 2E1YA 4CZKA 1BL3A 2G8UA 3OBYA 2X78A 3ATUA 5JVGL 3P5JA 3LDQA 2FSNA 3MECA 3JAMO 4KHUA 4OPAA 1KVAA 3DMJA 3DAWA 4DCHA 3OYAA 2AA4A 3I0RA 1NJWA 5GAGP 2E2OA 1YXQA 1EQYA 1NGIA 3MN6A 3VQDA 3K5LA 5JS1A 5AQIA 2IAJA 4HUGA 5C2DA 1KFDA 1BHLA 4GW6A 2O8DB 2Q3SA 4NLBA 1GLCG 4YDUA 4DSEA 1SUQA 3M8QA 3HTVA 1TUUA 3SUPA 2D0AA 1QHTA 3GBTA 1XNRK 4NYFA 3SZ2A 4JD2B 1VSJA 1MDUB 4YOTA 2ZGZA 3CG7A 4J8FA 4FWLA 3HVTA 4BG8A 1J53A 4CHQA 3P1GA 1RTHA 1C1BA 4OPHA 1L3VA 3SCXA 1NOYA 5H1SQ 3I56N 1LOTB 3D2FA 4I9QA 4M42A 2X74A 3AV9A 3PX0A 3WNEA 3CCEN 2GEMA 4BDPA 3R6MA 4DUYK 4RW6A 1Q8IA 1VQLN 1YJNN 1JLGA 3NMUA 2HNZA 3CCVN 1HX1A 4DFPA 4QCLA 4K43A 4C8NA 1I3AA 4JAXA 1RDWX 1TL3A 1B9DA 1E4GT 1VSMA 5C24A 1LW2A 4KPYA 3EE9A 3VERA 4DQSA 3R8EA 4BQZA 4DV1K 4DHYA 3IDHA 2A41A 4QOZB 1H1VA 1SAZA 3RMBA 5I42A 4HCBA 3LP1A 4FLTA 2E1ZA 1U2VB 5E26A 3QETA 3C95A 1RBUA 5KGWA 1NGAA 4EZ6A 1RDBA 3QBXA 3EKSA 3DXMB 3OY9A 4DR3K 1KVCA 2JGUA 2VGMA 3Q7BA 4FWRA 2ZJQL 1IV0A 3AGRA 1HNWK 3WXLA 3CFOA 3FZKA 5M1NA 1MWKA 3I8DA 2FBYA 3AO4A 3C6TA 4BROA 4NCGA 4DTMA 4ILJA 2Q97A 3CCQN 1CXUA 1C1CA 3WXMB 2EHGA 1N8RO 2O4IA 2QWMA 1HPMA 3TAEA 4M3YA 3MEDA 3ZT2A 5J2MA 1JLAA 3U6FA 4ILGB 4FW2A 1Z26A 3ZSQA 4JYAK 1VAZA 4M3RA 3TAPA 1LW0A 4EIAA 3PO4A 3VQ4A 3KZBA 4CD1A 3GE1A 4WF9L 3AGKA 4CFBA 1ATNA 3P83D 2KW4A 3QO9A 3OS0A 1W97L 1BI4A 4BC3A 3KVGA 1VQPN 3IKMA 3U9ZA 4JKGB 4CJ7A 1HKBA 4GNIA 1GLBG 4CCHA 4A61A 1WSHA 4FJMA 3LM2A 4GY2B 4C1NI 3ATVA 2NZTA 3ZETB 1L3SA 1DGKN 1V4SA 5M1QA 4EZ9A 4CEBA 4LD0A 1EKEA 4CK2A 1KTQA 4DSIA 3CC2N 2ZJRL 3SI6A 4CZFA 3QESA 3P38A 4JS4A 4BREA 2KFZA 4H0PA 3HPHA 4CEZA 2E5LK 4CJKA 1RT6A 4CF0A 2QKKA 4X64K 3DLGA 3ULEA 4DU4A 4ISEA 4H8KA 3HPOA 3RSEA 1EO1A 1IG9A 4DLEA 5J2NA 1NWKA 4YOUA 1FKPA 4KO0A 3P31A 1TUYA 4BRGA 3OYMA 3NF9A 2HVHA 3L2QA 3SAFA 5ELZA 1T03A 2F7TA 3NBPA 1MU2A 3O3FA 1BO5O 1ZBFA 2X6SA 1P90A 1RDCA 2GUIA 3O9UA 4MLHA 3OYDA 2Q0UA 3CCJN 3AVLA 1BCOA 4FW1A 3MCPA 4I7FA 3KWGA 1S3XA 2HHUA 4Z94A
chains in the Genus database with same CATH topology
5EX5A 3TTCA 3CF5L 4XH1A 1VQ7N 3RVCA 3ZX3A 2PBDA 3CIPA 3VF6A 4EFHA 2FF3B 4B9QA 1YVNA 3A5OC 5JVHL 4NB4A 3TSQA 1YAGA 3BF1A 2CH6A 5BN8A 1K9MO 5ADXA 4RCHA 5KPTA 5DM7L 3P39A 4MO4A 2P9SB 4WQ4C 1NGGA 5M1PA 2I7NA 3MCAB 4G9ZA 3NVMA 4I6MB 3WT0A 5JMVA 4A5AA 3IFRA 3WQUA 4H0YB 3A5MC 3VGMA 4B1UB 3UKUB 1U2VA 4RWTA 4XH4A 4JEPA 1BOTO 3H3NO 4BRPA 3MWTA 1MWMA 3QMLA 2HBKA 1GLDG 1KD1O 3LM9A 2P9NB 2QWOA 3CPEA 3ZYYX 4M63C 2QI2A 3DXMA 5AQWA 1TYQA 2WBNA 3L4IA 5FPMA 2ASPA 5E84A 3I8BA 3H6EA 2D1KA 3MX5A 4H0OA 3HI0A 1HKCA 3CJBA 5MLCQ 2ASOA 4CZGA 4PKIA 3F5TA 1SS6A 3U8XA 3O80A 1QQMA 2VCPA 3VPZA 3M1FA 4CZJA 3C0BA 5AFUA 4H5NA 5F2RA 5BRFA 5FPDA 3C6AA 4MLEA 4UY8O 3O9TA 4A2BA 4BRQA 1C0GA 5AQRA 3ZX2A 1KAZA 3E9PA 5C12A 4HWIA 5AQMA 1NLVA 3HBTA 2V51B 4IEEA 2BH1A 1OVYA 4PL8A 3LDOA 3D7EO 3LL3A 4FVUA 1NGFA 3N4PA 2NRXA 3TTDA 4CZMA 3QFUA 4U67L 1U6ZA 2A42A 1GLJO 3CCLN 3CERA 3VF2A 1BA1A 3JS6A 1X3NA 1QZ5A 2CGJA 4OO1J 4IO9L 3VEWA 3IUCA 1VQMN 5AQHA 1YJWN 3O9RA 1X3MA 4BQLA 2CGKA 3H1VX 3SBTA 2QWRA 4ISGA 5CR4A 3QFPA 4NO7A 3DLLL 4EAHD 1BA0A 4B1YB 3CI5A 1QVFM 2E2QA 3OHRA 5C2FA 5GAHP 3T7ZA 2GUPA 2A5XA 2HF4A 5BN9A 4XEIA 1SQKA 5AQOA 1RDUA 3G25A 2DPNA 4CZLA 3A5LC 3DJCA 2NNWA 5B8HA 1SZ2A 5BR9A 1RFQA 5LJVA 4XH5A 4B1WB 1K8AO 5AR0A 3CJAA 3OBWA 1O13A 2IVOA 3CJ7A 2E8AA 4AF1A 3R9PA 4YDUC 5LJWA 4MO5A 3JXUA 3FZFA 4JKGA 3VEVA 2BTFA 4KH6A 1Q82O 3FE1A 1XUPO 2NRVA 4FWNA 3O08A 4C1NK 3I55N 4A5BA 3P4IA 1NGJA 1NBWA 5AZIA 4BRAA 4JK9A 1HUXA 3MMVA 3UE5A 4BRNA 2P9UB 1OKJA 3EL2A 4F9OA 1HKGA 3VENA 2VGNA 4YOYA 3W0LA 3WXJA 2FSKA 4B1VA 2IVNA 4ILHA 4JD2A 4FL9A 3O9QA 3MN9A 3G6EN 3CJ9A 4IZ9A 1QQOA 2HSTA 4FSVA 4LC9B 3ZX0A 3ENOA 5BPNA 3CC4N 3HZ6A 4M7YA 3U4LA 3FGUA 3TPQA 1IG8A 3KHYA 4H5TA 3GG4A 4K42A 3CJCA 1Q86O 3PIPL 1C0FA 4BRHA 4U7BA 5AQLA 1ZBSA 4FO0A 1BU6O 5AQVA 5EXWA 4JKDA 2KKZA 3GL1A 2NRHA 3PLAA 2V7YA 5BPMA 3NVKA 4BY9C 4H0VB 2Q2RA 2HBMA 1QZ6A 1ATSA 3QB0A 1NM1A 5TKYA 3TSUA 1JCFA 3C65A 3VTIA 5GADP 3HOSA 1VQ8N 3LDPA 2H3GX 4MDAA 4BVPA 5JICA 1YITN 2P9IA 3EN9A 3O5BA 4H0XB 2YHWA 3AARA 3ENBA 1K8KB 1RGIA 3D2EA 2I7PA 2P9PA 5HOOA 2P9LA 1WOQA 3VEZA 4WFBL 1DEJA 4B1XB 2FXUA 2NRZA 3L4QA 2ZF5O 4GV9A 2W40A 3GDQA 4FWQA 4H5VA 3C7NA 3S41A 5AQXA 3UKRA 3HRGA 4FPAA 1XC3A 2ASMA 4BR5A 2A40A 4A62A 4CI6A 4BRLA 2AP1A 3FLCO 5C15A 3M3ZA 3SK3A 4ISFA 4M7XA 1ESVA 1MA9B 2QWNA 3BF3A 4FWMA 1KAYA 3F9MA 3HOTA 2YJFA 4CZIA 4WQ4A 2Q0RA 2Q31A 2YCHA 3MN5A 4A2AA 3BP8A 4CZHA 2QWLA 5FPNA 4EHUA 1NJIO 3QDKA 4QS7A 2W41A 3SAHA 3K9KA 3CCUN 4BR4A 5DM6L 5AQGA 3DWLA 4BC5A 2FLOA 4BG9A 3KK7A 4BC2A 5GAEP 5ADXH 3CCMN 1TYQB 3CHWA 3Q7CA 3H45C 4HTLA 3H1QA 3SJHA 4YOXA 5TKWA 2JWLA 3ID6A 4JN4A 3O8MA 3SBGA 2QXLA 4FWKA 4BR2A 1YI2N 2EWSA 3CPWM 2HF3A 5AQTA 1YIJN 2P9NA 4FPBA 2NRTA 2OANA 2QWPA 1QHAA 3CJ1A 5GIOA 4WFNL 2FSJA 2VYPA 3G71N 5M1KA 3VF4A 1IJJA 3T69A 3WXIA 4DQ8A 4IDHA 4CBUA 3E1YA 3FZMA 1VQ4N 3LDNA 2A6AA 3MN7A 5BRHA 5AZJB 3EKUA 3D6RA 3L0QA 2BUPA 4L3QA 4BRCA 3CMAN 2YJEA 4BGBA 2D0OA 2HMPA 5AFUH 4AM7A 3SMPA 3MDQA 4GV6A 2E1YA 2ITMA 2GELA 4BRDA 4CZKA 4WFAL 3OBYA 3ATUA 3O6WA 4CZEA 1KAXA 4PHTX 3WQTA 4CBXA 5JVGL 3LDQA 3WUHA 3O1BA 2NRRA 5AQNA 2FSNA 1VQ6N 3VEXA 3M5RA 4IJAA 4K25A 2NLXA 3PIOL 4OPAA 2D0PA 2QW9A 3OW2M 4PL7A 2QEXN 3DAWA 4DCHA 5C10A 1HJOA 5AQPA 1R59O 2NRWA 2AA4A 5C0YA 1T6CA 1K73O 3HM8A 5GAGP 2E2OA 2E20A 2OTLN 1YXQA 1EQYA 1NGIA 3MN6A 3CCSN 5AQIA 1QQNA 2V52B 3FFKB 5C2DA 3W3DA 1DT9A 3DXKB 3ZEUB 4IEIA 4NLBA 3AAPA 3ZETA 4BGAA 4PKGA 1GLCG 4YDUA 3E9LA 5JLFA 1M90O 3SLCA 5AZIB 1T6DA 3QBWA 1S22A 2IIRA 5KPRA 3HTVA 2JWKA 1TUUA 5KQDA 3GBTA 4QS9A 1Z6RA 3ULEB 1WUAA 4JD2B 4WQ5A 2Q36A 4A57A 2P9KA 4JKFA 3N4QA 1MDUB 4YOTA 2ZGZA 3FR0A 2QWQA 5EOYA 3I33A 3FZLA 3RSEB 2KHOA 2P9UA 4J8FA 4R79A 4FWLA 3WEEA 4BG8A 4OPHA 5H1SQ 4JHDA 3I56N 1LOTB 4IOCL 3D2FA 5HL7L 1BG3A 3CCEN 4IFEA 1HLUA 3VGKA 2GEMA 3VGLA 5AQSA 1BUPA 1Q7YO 3R6MA 4BC4A 3VTHA 4B1ZA 1VQLN 1GLFO 1YJNN 3UB5A 4JK8A 4YOVA 2V7ZA 2ZJPL 3BUZB 4CD3A 3NMUA 3CCVN 5EVZA 1HX1A 3CCRN 4BR9A 2P9IB 2RHKA 3A0IX 4IWVA 4JK7A 3A8YA 4K43A 4BRKA 3G4SN 2E2NA 2HOEA 2GWJA 2VWBA 1LCUA 1ZXOA 4JAXA 2P9PB 1BWFO 2P9LB 1RDWX 5FPEA 1E4GT 3F2KA 1M1KO 4WCEL 5CE3A 3WXKA 3EE9A 1K8KA 3VERA 1V4TA 5EY4A 3VEYA 3R8EA 3KWIA 3CMEN 4H5RA 3SAGA 4IOAL 4BQZA 1CZAN 3ENHA 4DHYA 3IDHA 1KC8O 2A41A 1H1VA 3TTFA 2HBLA 4CBWA 1NGHA 1SAZA 3E9OA 3H46O 1Q18A 1NGBA 1DKGD 3EE8A 5AQFA 1NGDA 4YORA 3MWPA 2P9SA 1X9JA 2E1ZA 1U2VB 3TSPA 4JKBA 2QA4N 5E26A 2QM1A 5LY3A 4O8KA 1NGAA 2E88A 4FWSA 4I6MA 3SMSA 5AQJA 3QBXA 3EKSA 3DXMB 3ID8A 3Q7BA 2WFBA 2VGMA 1QVGM 4FWRA 4MDBA 3UKUA 2ZJQL 3AGRA 4H0TB 4DKWA 3GOIA 3WXLA 3FZKA 1NMDA 4DB3A 5KPZA 5M1NA 1MWKA 3MX2A 3J7ZO 3EZWA 5AQZA 4BVOA 2UYTA 1JJ2M 2OTJN 1Y64A 4QS8A 4BROA 1VQ9N 2YHXA 4KBOA 1J6ZA 4ILJA 2F9WA 2Q97A 4GVEA 3CCQN 4GV3A 5CHIA 3WXMB 1N8RO 4H5WA 2IVPA 2QWMA 4JKAA 3CXCM 1HPMA 4YOWA 1XQSC 3CETA 2GX9A 1GLAG 4ILGB 5KQ8A 4O5FA 3A5NC 4NLCA 1BDGA 2GWKA 3B8AX 1VAZA 4C23A 4AM6A 1VQKN 1VQON 1ZC6A 4Y0WA 5AZJA 1E4FT 1YF5L 4EIAA 2YHYA 2PAVA 5JLHA 5AQUA 1ILYA 4H03B 4BRIA 1Z05A 1YHQN 3KZBA 4CD1A 3GE1A 1T44A 3M6GA 1JCEA 4WF9L 2D4WA 3AGKA 5F1XA 1ATNA 4FOIA 4RTFD 3VOVA 1W97L 3K9JA 3VEOA 3KVGA 3L6QA 5M1OA 4BC3A 1P8ZA 1VQPN 3IKMA 3O4WA 3VETA 3U9ZA 4JKGB 4CJ7A 5BRDA 1S72N 3CD6N 1HKBA 4GNIA 1GLBG 2A3ZA 1NGCA 3LDLA 4A61A 5BREA 3LM2A 4GY2B 3VESA 4C1NI 3ATVA 3E66A 2KLAA 2NZTA 2F9TA 3ZETB 2QTDA 1DGKN 1KXPA 1V4SA 5M1QA 2FF6A 2PFUA 3R1XA 1ATRA 1GLEG 1JCGA 3TU5A 2YI1A 3DXKA 3ZEUA 3CC2N 2ZJRL 1W2BM 3CC7N 1KQSM 4WYBA 4BRMA 4CZFA 3P38A 4BREA 2P9KB 4H0PA 2ZGYA 3R3LA 4KH5A 4IXCA 4BRFA 4PKHA 5AQQA 5I9EB 4JKHA 1YUWA 2HBJA 3C6HA 4WQ5C 1NGEA 3WEEB 1YJ9N 4IJNA 3AY9A 3H3OB 3ULEA 1G99A 5F0XA 4ISEA 4KH4A 4FWOA 4JHDB 3D2FB 5AQKA 2YX6A 3RSEA 5GIPA 1EO1A 4E1JA 3BEXA 4JKCA 1NWKA 2RE2A 4EHTA 2E2PA 1VQNN 3MK6A 4YOUA 2WUSA 3P31A 3HSCA 3O1WA 4IO8A 5GINA 2J4RA 1TUYA 4FWPA 4BRGA 4FOEA 3CQYA 3U9DA 4A59A 2CH5A 3AAQA 3CQXA 1GLLO 1VQ5N 3D2EB 3VMFB 1Q81O 3SAFA 5ELZA 2F7TA 4O8UA 3QICA 3OA9A 3IMXA 1BO5O 2WC9A 4K41A 5AQYA 5BPLA 1P90A 3O9UA 4BR7A 3J8AA 2ZWHA 4MLHA 2Q1NA 2Q0UA 3O9SA 4IOXA 4JNEA 4BR0A 3CCJN 3C7NB 1T3VA 4JKEA 3UKRB 3MCPA 3KWGA 3FZHA 2CGLA 3EO3A 1S3XA 5M1FA 1D4XA 2GTDA 4Z94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EX5 A;  4XH1 A;  3ZX3 A;  2PBD A;  3CIP A;  3VF6 A;  4EFH A;  2FF3 B;  4B9Q A;  1YVN A;  3A5O C;  4NB4 A;  1YAG A;  3BF1 A;  2CH6 A;  5BN8 A;  5ADX A;  4RCH A;  5KPT A;  4MO4 A;  2P9S B;  4WQ4 C;  1NGG A;  2I7N A;  4I6M B;  3WT0 A;  5JMV A;  3IFR A;  3WQU A;  4H0Y B;  3A5M C;  3VGM A;  4B1U B;  3UKU B;  1U2V A;  4RWT A;  4XH4 A;  1BOT O;  3H3N O;  4BRP A;  1MWM A;  3QML A;  1GLD G;  3LM9 A;  2P9N B;  2QWO A;  4E1J A;  4M63 C;  3DXM A;  5AQW A;  1TYQ A;  3L4I A;  5FPM A;  2ASP A;  5E84 A;  3I8B A;  3H6E A;  2D1K A;  4H0O A;  3HI0 A;  1HKC A;  3CJB A;  2ASO A;  4CZG A;  4PKI A;  3VPZ A;  3U8X A;  3O80 A;  1QQM A;  2VCP A;  4CZJ A;  3M1F A;  5AFU A;  3C0B A;  5BRF A;  4H5N A;  5F2R A;  5F1X A;  5FPD A;  4MLE A;  4A2B A;  4BRQ A;  1C0G A;  5AQR A;  3ZX2 A;  1KAZ A;  4HWI A;  5AQM A;  1NLV A;  3HBT A;  2V51 B;  4PL8 A;  3LDO A;  3D7E O;  3LL3 A;  1NGF A;  4CZM A;  3QFU A;  1U6Z A;  2A42 A;  1GLJ O;  3CER A;  3VF2 A;  1BA1 A;  3JS6 A;  1X3N A;  1QZ5 A;  2CGJ A;  3VEW A;  3IUC A;  5AQH A;  1X3M A;  4BQL A;  2CGK A;  3H1V X;  2QWR A;  4ISG A;  3QFP A;  4NO7 A;  4EAH D;  1BA0 A;  4B1Y B;  3CI5 A;  2E2Q A;  3OHR A;  2GUP A;  2A5X A;  2HF4 A;  5BN9 A;  4XEI A;  1SQK A;  5AQO A;  3G25 A;  2DPN A;  4CZL A;  3A5L C;  3DJC A;  5B8H A;  1SZ2 A;  5BR9 A;  1RFQ A;  5LJV A;  4XH5 A;  4B1W B;  5AR0 A;  3CJA A;  2IVO A;  3CJ7 A;  2E8A A;  3R9P A;  4YDU C;  5LJW A;  4MO5 A;  3JXU A;  3FZF A;  3VEV A;  2BTF A;  3FE1 A;  1XUP O;  4FWN A;  3O08 A;  3P4I A;  1NGJ A;  1NBW A;  5AZI A;  4BRA A;  3UE5 A;  1HUX A;  3MMV A;  4BRN A;  2P9U B;  1OKJ A;  3EL2 A;  4F9O A;  1HKG A;  3VEN A;  3W0L A;  3WXJ A;  2FSK A;  4B1V A;  2IVN A;  4JD2 A;  4FL9 A;  3MN9 A;  3CJ9 A;  4IZ9 A;  1QQO A;  4FSV A;  4LC9 B;  3ZX0 A;  3ENO A;  5BPN A;  3HZ6 A;  4M7Y A;  3U4L A;  3FGU A;  3TPQ A;  1IG8 A;  3KHY A;  4H5T A;  3GG4 A;  4K42 A;  3CJC A;  1C0F A;  4BRH A;  5AQL A;  1ZBS A;  4FO0 A;  1BU6 O;  5AQV A;  5EXW A;  3GL1 A;  2NRH A;  2V7Y A;  5BPM A;  4H0V B;  2Q2R A;  1QZ6 A;  1ATS A;  3QB0 A;  1NM1 A;  5TKY A;  1JCF A;  3LDP A;  2H3G X;  4BVP A;  5JIC A;  2P9I A;  3EN9 A;  3O5B A;  4H0X B;  2YHW A;  3AAR A;  1K8K B;  1RGI A;  3D2E A;  2I7P A;  2P9P A;  2P9L A;  1WOQ A;  3VEZ A;  1DEJ A;  4B1X B;  2FXU A;  2ZF5 O;  2W40 A;  3GDQ A;  4FWQ A;  4H5V A;  3C7N A;  3S41 A;  5AQX A;  3UKR A;  4FPA A;  1XC3 A;  2ASM A;  4BR5 A;  2A40 A;  4A62 A;  4CI6 A;  4BRL A;  2AP1 A;  3FLC O;  3M3Z A;  3SK3 A;  4ISF A;  4M7X A;  1ESV A;  1MA9 B;  2QWN A;  3BF3 A;  4FWM A;  1KAY A;  3F9M A;  2YJF A;  4CZI A;  4WQ4 A;  2Q0R A;  2Q31 A;  2YCH A;  3MN5 A;  4A2A A;  3BP8 A;  4CZH A;  2QWL A;  5FPN A;  4EHU A;  3QDK A;  4QS7 A;  2W41 A;  4BR4 A;  5AQG A;  3DWL A;  4BC5 A;  2FLO A;  4BG9 A;  4BC2 A;  5ADX H;  1TYQ B;  3CHW A;  4HTL A;  3H45 C;  3H1Q A;  3SJH A;  4JN4 A;  3O8M A;  2QXL A;  4FWK A;  4BR2 A;  2EWS A;  2HF3 A;  5AQT A;  2P9N A;  4FPB A;  2OAN A;  2QWP A;  1QHA A;  3CJ1 A;  2FSJ A;  2VYP A;  3VF4 A;  1IJJ A;  3WXI A;  4DQ8 A;  4CBU A;  3FZM A;  3LDN A;  2A6A A;  3MN7 A;  5BRH A;  5AZJ B;  3EKU A;  3L0Q A;  2BUP A;  4L3Q A;  4BRC A;  2YJE A;  4BGB A;  2D0O A;  2HMP A;  5AFU H;  4AM7 A;  3SMP A;  3MDQ A;  2E1Y A;  2ITM A;  2GEL A;  4BRD A;  4CZK A;  3ATU A;  3O6W A;  4CZE A;  1KAX A;  3WQT A;  4CBX A;  3LDQ A;  3WUH A;  3O1B A;  5AQN A;  2FSN A;  3VEX A;  4IJA A;  4K25 A;  2NLX A;  2D0P A;  2QW9 A;  4PL7 A;  3DAW A;  4DCH A;  1HJO A;  5AQP A;  1R59 O;  2AA4 A;  1T6C A;  3HM8 A;  2E2O A;  2E20 A;  1YXQ A;  1EQY A;  1NGI A;  3MN6 A;  5AQI A;  1QQN A;  2V52 B;  3FFK B;  3W3D A;  3DXK B;  3ZEU B;  3AAP A;  3ZET A;  4BGA A;  4PKG A;  1GLC G;  4YDU A;  5JLF A;  3SLC A;  5AZI B;  1T6D A;  3QBW A;  1S22 A;  2IIR A;  5KPR A;  3HTV A;  1TUU A;  5KQD A;  3GBT A;  4QS9 A;  1Z6R A;  3ULE B;  1WUA A;  4JD2 B;  4WQ5 A;  2Q36 A;  2P9K A;  1MDU B;  2ZGZ A;  3FR0 A;  2QWQ A;  5EOY A;  3I33 A;  3FZL A;  3RSE B;  2KHO A;  2P9U A;  4J8F A;  4FWL A;  3WEE A;  4BG8 A;  4JHD A;  1LOT B;  3D2F A;  1BG3 A;  1HLU A;  3VGK A;  2GEM A;  3VGL A;  5AQS A;  1BUP A;  3R6M A;  4BC4 A;  4B1Z A;  1GLF O;  3UB5 A;  2V7Z A;  3BUZ B;  4CD3 A;  5EVZ A;  1HX1 A;  4BR9 A;  2P9I B;  3A0I X;  4BRK A;  4IWV A;  3A8Y A;  4K43 A;  2E2N A;  2HOE A;  2GWJ A;  2VWB A;  1LCU A;  1ZXO A;  4JAX A;  2P9P B;  1BWF O;  2P9L B;  1RDW X;  5FPE A;  1E4G T;  5CE3 A;  3WXK A;  1K8K A;  3VER A;  1V4T A;  5EY4 A;  3VEY A;  3R8E A;  4H5R A;  4BQZ A;  1CZA N;  3ENH A;  4DHY A;  3IDH A;  2A41 A;  1H1V A;  4CBW A;  1NGH A;  1SAZ A;  3H46 O;  1Q18 A;  1NGB A;  1DKG D;  5AQF A;  1NGD A;  2P9S A;  1X9J A;  2E1Z A;  1U2V B;  5E26 A;  2QM1 A;  5LY3 A;  4O8K A;  1NGA A;  2E88 A;  4FWS A;  4I6M A;  3SMS A;  5AQJ A;  3QBX A;  3EKS A;  3DXM B;  3ID8 A;  4FWR A;  3UKU A;  4H0T B;  3GOI A;  3WXL A;  3FZK A;  1NMD A;  4DB3 A;  5KPZ A;  1MWK A;  3EZW A;  5AQZ A;  4BVO A;  2UYT A;  1Y64 A;  4QS8 A;  4BRO A;  2YHX A;  4KBO A;  1J6Z A;  2F9W A;  2Q97 A;  4H5W A;  2IVP A;  2QWM A;  1HPM A;  1XQS C;  3CET A;  1GLA G;  5KQ8 A;  4O5F A;  3A5N C;  1BDG A;  2GWK A;  3B8A X;  4C23 A;  4AM6 A;  1ZC6 A;  4Y0W A;  5AZJ A;  1E4F T;  4EIA A;  2YHY A;  2PAV A;  5JLH A;  5AQU A;  4H03 B;  4BRI A;  1Z05 A;  3KZB A;  4CD1 A;  3GE1 A;  1T44 A;  3M6G A;  1JCE A;  2D4W A;  1ATN A;  4FOI A;  4RTF D;  3VOV A;  3VEO A;  3KVG A;  3L6Q A;  4BC3 A;  1P8Z A;  3O4W A;  3VET A;  3U9Z A;  4CJ7 A;  5BRD A;  1HKB A;  4GNI A;  1GLB G;  2A3Z A;  1NGC A;  3LDL A;  4A61 A;  5BRE A;  3LM2 A;  4GY2 B;  3VES A;  3ATV A;  2NZT A;  2F9T A;  3ZET B;  1DGK N;  1KXP A;  1V4S A;  2FF6 A;  1ATR A;  1GLE G;  1JCG A;  3TU5 A;  2YI1 A;  3DXK A;  3ZEU A;  4WYB A;  4BRM A;  4CZF A;  4BRE A;  2P9K B;  4H0P A;  2ZGY A;  4IXC A;  4BRF A;  4PKH A;  5AQQ A;  5I9E B;  1YUW A;  4WQ5 C;  1NGE A;  3WEE B;  4IJN A;  3AY9 A;  3H3O B;  3ULE A;  1G99 A;  5F0X A;  4ISE A;  4FWO A;  4JHD B;  3D2F B;  5AQK A;  3RSE A;  3BEX A;  1NWK A;  4EHT A;  2E2P A;  3MK6 A;  2WUS A;  3HSC A;  3O1W A;  4IO8 A;  2J4R A;  1TUY A;  4FWP A;  4BRG A;  4FOE A;  3CQY A;  3U9D A;  2CH5 A;  3AAQ A;  3CQX A;  1GLL O;  3D2E B;  5ELZ A;  3QIC A;  5AQY A;  3IMX A;  1BO5 O;  4K41 A;  5BPL A;  4BR7 A;  3J8A A;  2ZWH A;  4MLH A;  2Q1N A;  2Q0U A;  4JNE A;  4BR0 A;  3C7N B;  3UKR B;  3MCP A;  3FZH A;  2CGL A;  3EO3 A;  1S3X A;  1D4X A;  2GTD A;  4Z94 A; 
#chains in the Genus database with same CATH topology
 1RT3 A;  3AVA A;  4DR2 K;  3TTC A;  1NJY A;  1VQ7 N;  3VQB A;  4JI7 K;  2CH6 A;  2IDO A;  3K5O A;  4RCH A;  3P39 A;  1T05 A;  5JS2 A;  5M1P A;  4I6M B;  3AVN A;  4H0Y B;  4KI6 A;  4RWT A;  4JEP A;  1L5U A;  1WB9 A;  3LM9 A;  4DSL A;  1EWQ A;  3L4I A;  3I8B A;  3WNF A;  4H0O A;  3HI0 A;  4CJP A;  4CZG A;  4DS5 A;  1SS6 A;  4CZJ A;  3M1F A;  4CF1 A;  5BRF A;  2O8C A;  4UY8 O;  1KVB A;  4BRQ A;  5AQR A;  3VQ6 A;  3ZX2 A;  1KAZ A;  2B4J A;  4HWI A;  2V51 B;  4GVM A;  3K5M A;  4BE0 A;  1SKR A;  3LL3 A;  4CZM A;  1N33 K;  3QFU A;  4U67 L;  4KHP K;  1GLJ O;  3CCL N;  3CER A;  3M8R A;  3HP9 A;  3JS6 A;  4O44 A;  2CGJ A;  3VEW A;  3IUC A;  4J2E A;  4LF4 K;  4AHS A;  2WTU A;  4BQL A;  5FLX O;  3H1V X;  3SBT A;  4B1Y B;  3CI5 A;  2E2Q A;  1YVU A;  3THW B;  3LDS A;  2HF4 A;  4CJR A;  1SQK A;  1HNZ K;  2NNW A;  3DRS A;  4DV3 K;  1N32 K;  3DM2 A;  5BR9 A;  4XH5 A;  4DV0 K;  1VSL A;  4M3U A;  1N34 K;  1IKW A;  2NUB A;  3R9P A;  4YDU C;  5LJW A;  4F8R A;  4C1N K;  1WSF A;  2DFE A;  4A5B A;  4BRA A;  4FZX C;  4JK9 A;  4FYD A;  4FJG A;  4DTJ A;  1D8Y A;  4KV8 A;  3W0L A;  4B1V A;  2FSK A;  4AIL C;  1TK5 A;  4FJI A;  1RDD A;  2IVN A;  4JD2 A;  3CJ9 A;  4FSV A;  3OVN A;  3ZT0 A;  3CC4 N;  3HZ6 A;  1F21 A;  3KHY A;  4H5T A;  3GG4 A;  1HR0 K;  3PIP L;  1C0F A;  4BRH A;  4U7B A;  4E7H A;  5AQV A;  1BU6 O;  2NRH A;  3ZSZ A;  4YFU A;  3OYK A;  2Q2R A;  1HYV A;  4F2R A;  3IRX A;  1VQ8 N;  1NK4 A;  2H3G X;  3HXM A;  4H0X B;  3ENB A;  1RGI A;  1TAQ A;  1RBS A;  2I7P A;  3NF8 A;  1RNH A;  1NK0 A;  4F2S A;  2FXU A;  4W5O A;  3SUN A;  1RT4 A;  1WBD A;  4GV9 A;  3GDQ A;  4E89 A;  4B9V A;  3C7N A;  3QIO A;  5AQX A;  2UXC K;  3UKR A;  1VSK A;  2A40 A;  2ZE2 A;  4NCB A;  3LAN A;  4ISF A;  4CF2 A;  4FJH A;  4FWM A;  2P5G A;  3HOT A;  4B9S A;  2Q31 A;  2YNF A;  5FPN A;  5DM6 L;  3DWL A;  4BC5 A;  1NK7 A;  5J2P A;  1S9E A;  3KK7 A;  4ZTJ A;  3Q7C A;  3SYZ A;  3AA2 A;  3H1Q A;  1WAF A;  4JN4 A;  3SBG A;  4E7K A;  4FWK A;  4BR2 A;  1WAJ A;  3CPW M;  5AQT A;  2FBX A;  3BZC A;  2F96 A;  1UWB A;  4FPB A;  4FZZ A;  2FSJ A;  2VYP A;  5M1K A;  3VQP A;  3T69 A;  3WXI A;  1NKC A;  4N76 A;  5BRH A;  3MN7 A;  3D6R A;  2RN2 A;  4DTX A;  2OCE A;  4DS4 A;  4M3T A;  1NOZ A;  4Z4I A;  4GV6 A;  1HRH A;  2GEL A;  3VQ7 A;  4CZE A;  4CBX A;  3WUH A;  5AQN A;  3TWH A;  3NH0 A;  4K25 A;  3HPG A;  1QQC A;  2QW9 A;  3DLB A;  5C10 A;  4DF4 A;  4FLZ A;  1T6C A;  1ITG A;  2E20 A;  2OTL N;  3EZ5 A;  4Z4F A;  1B92 A;  3FFK B;  3W3D A;  1DT9 A;  3CYM A;  1NK9 A;  1M90 O;  3ZET A;  3HP6 A;  4F3O A;  1RTJ A;  3SQ0 A;  5JLF A;  3LPU A;  3DLE A;  2IGI A;  3SLC A;  5AZI B;  2F4V K;  5KPR A;  2E4L A;  4CJF A;  4OX9 K;  1S1V A;  3ULE B;  5HRR A;  3N4Q A;  3FR0 A;  3I33 A;  2XY5 A;  3RSE B;  3ZSV A;  1JKH A;  1HPZ A;  4DFM A;  3VQ8 A;  2XY6 A;  3OYC A;  4CHP A;  3ZLJ A;  5SZT A;  4FM0 A;  1FK9 A;  4YHH K;  1ZBI A;  3VN5 A;  3ZSX A;  4KB0 A;  3L2W A;  1HLU A;  2HHS A;  3VGK A;  3VGL A;  1BUP A;  1Q7Y O;  4BC4 A;  2KQ2 A;  4CES A;  3BUZ B;  4DTP A;  3AO5 A;  5EVZ A;  4DR4 K;  3SUO A;  3BZK A;  4IWV A;  3G4S N;  3ZT3 A;  1NK6 A;  4DSJ A;  3LZJ A;  5FRN A;  2HOE A;  4LFB K;  2GWJ A;  2VWB A;  1QSS A;  1BWF O;  2P9L B;  1SKW A;  3F9K A;  3VQ5 A;  5FPE A;  4BE2 A;  3F2K A;  1M1K O;  3RRG A;  5CE3 A;  1K8K A;  5EY4 A;  3VEY A;  3ZCM A;  1ZBL A;  4CF8 A;  4IOA L;  1CZA N;  3PSF A;  4PWD A;  3TTF A;  2HBL A;  2P51 A;  1NGH A;  3H46 O;  3E9O A;  3ITH A;  3TAQ A;  1YTA A;  2A1S A;  3MWP A;  4FJ7 A;  4DQQ A;  1RBR A;  1J9A A;  1X9J A;  4JKB A;  3AA5 X;  4IFY A;  4I6M A;  3NE6 A;  1EXQ A;  4HHT A;  2G8F A;  1YT3 A;  2I5J A;  1HJR A;  4DKW A;  4OPK A;  3LWM A;  1NMD A;  4DB3 A;  3MX2 A;  2XRI A;  1IBK K;  3J7Z O;  3EZW A;  5AQZ A;  4BWM A;  2UYT A;  2O8C B;  4OGC A;  3TAG A;  1VQ9 N;  1EET A;  2YHX A;  4KBO A;  1J6Z A;  4B3T K;  5CHI A;  4PQU A;  3AVB A;  2IVP A;  4H5W A;  4EP4 A;  1HQU A;  3VA3 A;  1XQS C;  4X65 K;  3NH1 A;  5KQ8 A;  4O5F A;  4M41 A;  4NLC A;  1IBM K;  4FK4 A;  1BDG A;  2GWK A;  4CER A;  1RT2 A;  4AM6 A;  2X6N A;  3C6U A;  3DYA A;  1ZC6 A;  3ASM A;  2YHY A;  4LF8 K;  4Q5V A;  5HRO A;  2FC0 A;  1KLM A;  4G1Q A;  4Q0B A;  1ILY A;  4BRI A;  2VG7 A;  1Z05 A;  2YV0 X;  2D0B A;  3V81 A;  4N47 A;  1LAW A;  4FK0 A;  2D4W A;  4GKK K;  2FBT A;  4FOI A;  3VOV A;  3THW A;  4CGD A;  1XWL A;  3K9J A;  3VEO A;  1OH8 A;  4O0I A;  1TL1 A;  4K8Z A;  1D9F A;  3OYE A;  2A3Z A;  3LDL A;  4CEF A;  5BRE A;  4DWI A;  3E66 A;  4FJK A;  2AJQ A;  2QTD A;  2Z1J A;  1OH5 A;  4KHY A;  4KRE A;  3R1X A;  1GLE G;  3SPY A;  4JI6 K;  3TU5 A;  3DRR A;  1ZBU A;  3DXK A;  3ZEU A;  3L3V A;  4WE1 A;  4Z0U A;  2D0C A;  1FKO A;  2VQE K;  1D5A A;  2WON A;  4OPJ A;  4IXC A;  4BRF A;  1YUW A;  4KFB A;  4WQ5 C;  3WEE B;  3AVI A;  1RCH A;  3AY9 A;  1S5J A;  2HB5 A;  1TGO A;  5D3G A;  4KH4 A;  4JHD B;  1WLJ A;  1S1X A;  5HP1 A;  3H08 A;  4C8K A;  3BEX A;  2RE2 A;  4EHT A;  1VQN N;  2WUS A;  3HSC A;  3O1W A;  5GIN A;  4FWP A;  5HRN A;  2CH5 A;  3AAQ A;  1VQ5 N;  1NG9 A;  3VMF B;  1Q81 O;  3SV3 A;  3T1A A;  3NAE A;  3QIC A;  3OA9 A;  3V1R A;  3IMX A;  3ISN C;  5BPL A;  5I3U A;  4C8L A;  4FLX A;  1J54 A;  3DLK A;  4IDK A;  4JNE A;  4BR0 A;  3C7N B;  1T3V A;  3UKR B;  1L3T A;  2CGL A;  1D4X A;  4YOW A;  1BCM A;  5EX5 A;  3CF5 L;  3AVM A;  3IG1 A;  3ZX3 A;  3RTV A;  3CIP A;  3VF6 A;  2HMI A;  3HVR A;  5JVH L;  1YAG A;  3BF1 A;  1K9M O;  5ADX A;  4FLW A;  1S6Q A;  1BGX T;  4FJX A;  3AVH A;  4O5B A;  4N56 A;  4DV5 K;  2I7N A;  1EWR A;  3MCA B;  1ZBH A;  3NVM A;  3TAF A;  4A5A A;  1HNX K;  1C0T A;  2LSN A;  3A5M C;  2O8E A;  3OTO K;  4B1U B;  4XH4 A;  4BRP A;  3OYL A;  3KLF A;  3QML A;  2HBK A;  3LZI A;  4AQY K;  3ZYY X;  2WBN A;  1O1W A;  4LH4 A;  1W9H A;  5E84 A;  1RT7 A;  4JRP A;  4B9T A;  2KTQ A;  4N5S A;  4FXD A;  4W5N A;  2ASO A;  1C0U A;  5HBM A;  4KHS A;  3VPZ A;  3U8X A;  3ZSR A;  2VCP A;  5FPD A;  4MLE A;  4OJR A;  1A5W A;  1VSD A;  4FJ5 A;  1U4B A;  3E9P A;  3NF6 A;  3PSI A;  3HBT A;  3KLG A;  3QEI A;  1OVY A;  1XNQ K;  3OYG A;  4W5R A;  2OPP A;  3N4P A;  1CZB A;  3TTD A;  1J5E K;  4I2P A;  1C1A A;  4DTN A;  3HK2 A;  1BA1 A;  4FJL A;  4DV6 K;  5FRM A;  3O9R A;  2P5O A;  1X3M A;  3LP2 A;  4HVJ A;  4KHW A;  4JI8 K;  3HST B;  4NO7 A;  1BA0 A;  1QVF M;  5C2F A;  5GAH P;  3T7Z A;  1BQM A;  2A5X A;  5BN9 A;  4XEI A;  1RDU A;  3G25 A;  4CZL A;  3A5L C;  2E6L A;  4DV2 K;  3S3O A;  1K8A O;  5AR0 A;  3CJA A;  1G15 A;  1O13 A;  2IVO A;  4MO5 A;  3JXU A;  3FZF A;  4KH6 A;  5KI6 A;  1RBT A;  4CEO A;  2NRV A;  2VQF K;  5AZI A;  1NBW A;  4LF7 K;  4RW4 A;  1HUX A;  1OKJ A;  3EL2 A;  4F9O A;  4Y1D A;  1KCF A;  3S9H A;  4FL9 A;  3L2V A;  4LC9 B;  2HHH K;  3ZX0 A;  1S6P A;  4M7Y A;  1BIZ A;  2YNI A;  4EP5 A;  2YNH A;  1RTD A;  1IKV A;  2BGG A;  2O8B A;  1NJX A;  3BDP A;  3VQA A;  3K57 A;  2VWJ A;  1CXQ A;  2O4G A;  1R0A A;  3NVK A;  4BY9 C;  1QS4 A;  4PA1 A;  4FLY A;  1QZ6 A;  1ATS A;  5CY4 A;  5TKY A;  3TSU A;  3VTI A;  1JCF A;  4KHQ A;  3TI0 A;  3THY B;  5E41 A;  1YIT N;  1KLN A;  1JLC A;  2VG5 A;  3O5B A;  1KFS A;  4CFD A;  3AAR A;  1K8K B;  4OLB A;  3D2E A;  5HOO A;  2P9L A;  4WFB L;  1DEJ A;  1JLQ A;  3THV A;  3AO2 A;  1U04 A;  1I39 A;  2ZF5 O;  2W40 A;  1K6Y A;  3DOL A;  1S1U A;  3S41 A;  4BRL A;  4BAC A;  3FLC O;  3SQ4 A;  3KKS A;  4CEE A;  2QWN A;  3K58 A;  1KAY A;  4O4G A;  4CZH A;  2Q0R A;  4A2A A;  3BP8 A;  2W42 A;  2ZM6 K;  3T19 A;  3SQ2 A;  3AVK A;  2W41 A;  3CCU N;  3KK2 A;  1S1W A;  3SUQ A;  5FRO A;  4BG9 A;  3SPZ A;  5GAE P;  5ADX H;  4FLU A;  3CCM N;  4JI3 K;  3CHW A;  3ZT4 A;  1QSY A;  4K8X A;  3SJH A;  4YOX A;  5TKW A;  3VQC A;  4QAG A;  3ID6 A;  2RKI A;  3KTQ A;  4CJL A;  1VRT A;  2EWS A;  2HF3 A;  4B3M K;  1YIJ N;  1U45 A;  3PV8 A;  1NJZ A;  3AVC A;  2OAN A;  2QWP A;  4Z4H A;  5DMR A;  4CK1 A;  3VF4 A;  4GMJ B;  4IDH A;  2G8K A;  2YKM A;  2FBV A;  3L2R A;  3CMA N;  2YJE A;  3LP3 A;  2D0O A;  4CGH A;  4JV5 K;  1TK0 A;  4AM7 A;  3MDQ A;  3V9X A;  1UA0 A;  3O6W A;  1KAX A;  3QEX A;  5AJ3 K;  3O1B A;  2NRR A;  1VQ6 N;  2NLX A;  2D0P A;  3OW2 M;  4PL7 A;  2QEX N;  5C25 A;  2Y1I A;  2UU9 K;  1R59 O;  1XHZ A;  2NRW A;  3KD5 E;  5C0Y A;  1K73 O;  3HM8 A;  3WNH A;  4W5T A;  4H4M A;  1QQN A;  2V52 B;  3D0P A;  3DXK B;  3ZEU B;  4IEI A;  3AAP A;  2XY7 A;  4CVN E;  1T6D A;  3QBW A;  1S22 A;  2JWK A;  2IC3 A;  5KQD A;  2EX3 A;  2UUA K;  4CJW A;  4QS9 A;  2B5J A;  1Z6R A;  1W7A A;  1WUA A;  4WQ5 A;  4A57 A;  1HNV A;  4JKF A;  1SL0 A;  4DQR A;  2KHO A;  2P9U A;  2HHW A;  1A5X A;  1QSL A;  3WEE A;  4JI4 K;  3J7Y P;  3RWU A;  1N5Y A;  4DU3 A;  1T8E A;  4JHD A;  4IOC L;  4KTQ A;  4JI0 K;  5HL7 L;  1BG3 A;  4IFE A;  2E6M A;  5AQS A;  3IS9 A;  3PY8 A;  1GLF O;  4KI4 A;  4LY7 A;  3OYH A;  1Q9X A;  3JYT A;  4YOV A;  2ZJP L;  2HHQ A;  4CD3 A;  4JLH A;  3OS2 A;  4BR9 A;  2P9I B;  2RHK A;  3TR8 A;  5LMU K;  2E2N A;  2YKN A;  4IFV A;  3QIP A;  4CE9 A;  1LCU A;  1ZXO A;  1IO2 A;  4AHU A;  1NKB A;  1JXE A;  4K0K K;  4DQP A;  4B9L A;  1SL1 A;  4DTR A;  4Z4E A;  4KKO A;  3DOK A;  3KWI A;  3M8S A;  4O55 A;  4H5R A;  4CK3 A;  3SAG A;  1UA1 A;  3ENH A;  1KC8 O;  4KTW A;  4X62 K;  4CBW A;  3J81 O;  3LAM A;  4FCY A;  1TKD A;  1NGB A;  1DKG D;  3EE8 A;  2O8E B;  1NGD A;  1X1P A;  1NKE A;  3TSP A;  2QA4 N;  2ZD1 A;  2E88 A;  4FWS A;  1X9M A;  3QNN A;  1JLE A;  3ID8 A;  2WFB A;  2HNY A;  4MDB A;  1SL2 A;  1VSF A;  3GOI A;  5A2Q O;  3SJJ A;  5KPZ A;  3CFP A;  3TAN A;  3L8B A;  1WN7 A;  1LAV A;  1JJ2 M;  4C8O A;  2OTJ N;  4JI5 K;  1UAX A;  3EYZ A;  2F9W A;  4GV3 A;  4DTU A;  4BWJ A;  3CXC M;  4JI1 K;  3LWL A;  4JI2 K;  1GOA A;  3NGY A;  1GOC A;  3CET A;  3SNN A;  2HHV A;  3V9S A;  1GLA G;  3V4I A;  2G8I A;  3T3F A;  5CYQ A;  3B8A X;  4C23 A;  2DY4 A;  1YF5 L;  3KK3 A;  3QEW A;  1BIU A;  2DFF A;  2BDP A;  1YHQ N;  2OYQ A;  4M3W A;  3K0S A;  1WSE A;  5C42 A;  1ASW A;  1XC9 A;  4CJS A;  1P8Z A;  2UXD K;  3O4W A;  5BRD A;  2OPQ A;  3LPT A;  4NYN A;  3VES A;  2KLA A;  5CZ1 A;  2F9T A;  4DMN A;  1U49 A;  1KXP A;  2UUC K;  1ATR A;  4LFA K;  1JCG A;  4BDY A;  2YI1 A;  1TKX A;  5HRP A;  1W2B M;  1KQS M;  4BRM A;  4J2A A;  2P9K B;  1VSH A;  2ZGY A;  3F73 A;  4BE1 A;  4AHR A;  4KH5 A;  4PKH A;  2HBJ A;  2O8B B;  1NGE A;  1YJ9 N;  1OH7 A;  4FJ8 A;  3H3O B;  3JSM A;  3K2P A;  5BR8 K;  3OJU A;  4RW8 A;  5KGX A;  4CJE A;  2R7Y A;  2YX6 A;  5GIP A;  2XO7 A;  4JKC A;  3S3M A;  1NNE A;  1VRU A;  3ZT1 A;  3V1Q A;  3OYF A;  4FOE A;  1DLO A;  3CQY A;  4A59 A;  4LSL A;  3T1H K;  3CQX A;  3D2E B;  4B9M A;  4CJ5 A;  1KRP A;  5FDL A;  4O8U A;  3THY A;  2WC9 A;  1WSG A;  3D45 A;  4FLV A;  2XY8 A;  4CEA A;  3IAY A;  4IOX A;  4JKE A;  3EO3 A;  3AA3 A;  4B3S K;  4XH1 A;  4CJ4 A;  3RVC A;  4EFH A;  3TAR A;  2FF3 B;  1YVN A;  3A5O C;  1HYS A;  3DRP A;  4NB4 A;  3E01 A;  5KPT A;  3LAL A;  2P9S B;  3B6P A;  1NGG A;  1RT5 A;  4G9Z A;  1IKY A;  4CHZ A;  1JL2 A;  5JMV A;  4M3X A;  3THX A;  3WQU A;  2D5R A;  4DV7 K;  4IKF A;  1RDA A;  3VGM A;  3UKU B;  1BOT O;  2O8F B;  3MWT A;  3MXJ A;  3HJF A;  1HNI A;  1KD1 O;  4E1N A;  4F4K A;  2QWO A;  2VWK A;  4E1J A;  4M63 C;  2QI2 A;  2G8H A;  3MX5 A;  4CED A;  1HKC A;  3CJB A;  4CJT A;  5MLC Q;  4F3T A;  3NGZ A;  4PKI A;  4HUF A;  5AFU A;  4M45 A;  2Z1G A;  3C0B A;  4H5N A;  5F2R A;  4A2B A;  5C12 A;  4CGJ A;  3DI6 A;  2KFN A;  4CIG A;  3D7E O;  4FVU A;  4CIF A;  2NRX A;  2A42 A;  2VG6 A;  5SWM A;  4NXM K;  4M3Z A;  1QZ5 A;  4IO9 L;  1VQM N;  2ITG A;  5AQH A;  3VA0 A;  2CGK A;  3QNO A;  2QWR A;  3QFP A;  4B8A B;  4W5Q A;  4EAH D;  4DU1 A;  1Y97 A;  3M8P A;  3OHR A;  2GUP A;  4ZHR A;  5AQO A;  1IBL K;  4KB1 A;  3DJC A;  1S9G A;  1SZ2 A;  2ATQ A;  3MXM A;  1RFQ A;  4FM1 A;  3AVF A;  4X66 K;  4DSK A;  2E8A A;  4AF1 A;  3VEV A;  4E7L A;  3P4I A;  1NGJ A;  3MMV A;  3PUF A;  2P9U B;  1HKG A;  1UOC A;  3VEN A;  2VGN A;  3WXJ A;  4ILH A;  3O9Q A;  3MN9 A;  4E0D A;  4IZ9 A;  1QQO A;  4LSN A;  4CEQ A;  3ENO A;  3U3G A;  2DFH A;  2OA8 A;  4MQ3 A;  3FGU A;  4B9U A;  2ZQB A;  3CQ8 A;  3CJC A;  3VQE A;  1Q86 O;  3V1O A;  4KRF A;  3V9U A;  4FO0 A;  5EXW A;  4JKD A;  3GL1 A;  3L2U A;  3J7A P;  4H0V B;  3HYF A;  2HBM A;  3QB0 A;  5GAD P;  3HOS A;  1WBB A;  4AHC A;  2RF2 A;  3LDP A;  4BVP A;  2P9I A;  2P1J A;  1NK8 A;  2YHW A;  3NHG A;  4DR5 K;  1XI1 A;  3VEZ A;  4HCC A;  3CM5 A;  1ASV A;  1TV6 A;  3HRG A;  4FK2 A;  1XC3 A;  3ZSY A;  4CI6 A;  2PYJ A;  5C15 A;  3QEP A;  3K5N A;  4M7X A;  4CJQ A;  3BF3 A;  2G8W A;  3F9M A;  2YJF A;  4CZI A;  4WQ4 A;  3MN5 A;  4E3S A;  4EHU A;  1NJI O;  3QDK A;  4QS7 A;  3KD1 E;  4IBN A;  5T7B A;  3AO3 A;  2FLO A;  4BC2 A;  2Z1H A;  4YNQ A;  1TYQ B;  4HTL A;  3H45 C;  2PYL A;  3KLH A;  3AA4 A;  2P9N A;  1SKS A;  4WFN L;  5DK5 A;  3WNG A;  3G71 N;  3KKR A;  2HHT A;  2W6K A;  1IJJ A;  4DQ8 A;  4DV4 K;  3LDN A;  4CHY A;  2XHB A;  3EKU A;  3KLI A;  3L0Q A;  4L3Q A;  4BRC A;  4BGB A;  3RR7 A;  5AFU H;  1VSI A;  3SMP A;  1VHX A;  2ITM A;  4BRD A;  4WFA L;  4PHT X;  3WQT A;  4FJJ A;  3VEX A;  3M5R A;  4IJA A;  1RT1 A;  3PIO L;  3A2F A;  1HJO A;  5AQP A;  3V6D A;  3BGR A;  4CJU A;  3CCS N;  3FFI A;  5J1E A;  4DSF A;  1NMN A;  4PKG A;  4BGA A;  3E9L A;  3RRH A;  4DR6 K;  3AO1 A;  4NCA A;  2IIR A;  1KSP A;  4CIE A;  3KJV A;  2HHX A;  2ETJ A;  4R5P A;  4AHV A;  3OYJ A;  3O3H A;  4ID1 A;  1X9W A;  2Q36 A;  2P9K A;  4ID5 A;  3NF7 A;  4J2B A;  5EOY A;  2QWQ A;  3FZL A;  4LF9 K;  4R79 A;  2HND A;  2KZZ A;  4OKJ A;  4UQG A;  1RIL A;  3V9Z A;  4Y1C A;  1D9D A;  3VQ9 A;  3OYB A;  3PX4 A;  3VTH A;  4B1Z A;  1LWC A;  3UB5 A;  3OS1 A;  3EEQ A;  4JK8 A;  2RPI A;  2V7Z A;  1LV5 A;  2KZM A;  3T1Y K;  3CCR N;  3AVJ A;  3A0I X;  4BRK A;  3HT3 A;  4JK7 A;  3A8Y A;  4E1M A;  1OH6 A;  4CFA A;  2P9P B;  2Z1I A;  4DR1 K;  4C8M A;  3RMD A;  4MFB A;  1TKT A;  2BAN A;  4OKK A;  4WCE L;  3WXK A;  1FW6 A;  1V4T A;  3CME N;  1QE1 A;  1S1T A;  1VSE A;  3THX B;  1Q18 A;  5AQF A;  3KK1 A;  4YOR A;  3O3G A;  3OYN A;  2P9S A;  2YHB A;  2QM1 A;  5LY3 A;  4O8K A;  4KHN A;  2F8S A;  3SMS A;  5AQJ A;  1EX4 A;  4BDZ A;  1U47 A;  3UKU A;  1QVG M;  4E7J A;  4GKJ K;  4H0T B;  3S3N A;  2O8F A;  4KAZ A;  4FJ9 A;  3OJS A;  3MXI A;  4BVO A;  4ELV A;  2DTU A;  4LF6 K;  1Y64 A;  4QS8 A;  4IG0 A;  4JS5 A;  4E19 A;  1QTM A;  4FJN A;  1IKX A;  4GVE A;  4CHO A;  3NGI A;  1C0M A;  4JKA A;  2IS3 A;  1N6Q A;  3MEG A;  1DTT A;  2GX9 A;  1IH7 A;  3A5N C;  1SV5 A;  4RG8 A;  2UUB K;  1TKZ A;  1VQK N;  1VQO N;  1FJG K;  4Y0W A;  5AZJ A;  1E4F T;  2PAV A;  5CYM A;  5AQU A;  5JLH A;  4CGI A;  4H03 B;  5KTQ A;  1ASU A;  3NFA A;  1T44 A;  3M6G A;  1A5V A;  1JCE A;  3HM9 A;  1N36 K;  1Q9Y A;  4RTF D;  3L6Q A;  5M1O A;  2F8T A;  4E7I A;  3AVG A;  3VET A;  2B6A A;  1S72 N;  3CD6 N;  4DFK A;  1EP4 A;  1NGC A;  1LWE A;  4DF8 A;  2FF6 A;  2PFU A;  5HLF A;  3CC7 N;  2O8D A;  4WYB A;  3RR8 A;  3R3L A;  4OKE A;  4PY5 A;  4L8R B;  2QKB A;  5AQQ A;  5I9E B;  4JKH A;  4TSX A;  3V9W A;  3C6H A;  5LL6 Z;  4IJN A;  3L3U A;  4LH5 A;  1JLB A;  1G99 A;  5F0X A;  4FWO A;  1L3U A;  3D2F B;  1RBV A;  5AQK A;  3PO5 A;  4DLG A;  4DFJ A;  2E2P A;  1DTQ A;  3MK6 A;  2OZM A;  4IO8 A;  1E3M A;  2J4R A;  1BIS A;  2WOM A;  4DQI A;  1HMV A;  3U9D A;  4I9L A;  3KLE A;  3O4N A;  1GLL O;  1ZYQ A;  3QLH A;  3DLR A;  3HL8 A;  1TVR A;  4DTO A;  4DG1 A;  5AQY A;  4K41 A;  1XHX A;  2PY5 A;  4J2D A;  4BR7 A;  3J8A A;  2ZWH A;  4H4O A;  2Q1N A;  3O9S A;  3RMA A;  1OVQ A;  3FZH A;  5M1F A;  2GTD A;  4CFC A;  3QER A;  4CGF A;  2G8V A;  1X9S A;  4KTZ A;  4OVL A;  2PBD A;  4B9Q A;  4FZY A;  3NH2 A;  3TSQ A;  4HTU A;  5BN8 A;  1HYZ A;  1REV A;  5DM7 L;  4HUE A;  4MO4 A;  4WQ4 C;  2OZS A;  4CF9 A;  4V19 S;  2W6L A;  3CFR A;  3WT0 A;  3IFR A;  1B9F A;  1CLQ A;  1CZ9 A;  3G0Z A;  1U2V A;  3H3N O;  4LF5 K;  3QIN A;  1JXB A;  1MWM A;  1GLD G;  4DUZ K;  2P9N B;  3CPE A;  3DXM A;  5AQW A;  1TYQ A;  4RW7 A;  5FPM A;  2ASP A;  3O4Q A;  3LAK A;  3H6E A;  2D1K A;  1W0H A;  3ALY A;  3F5T A;  3O80 A;  1QQM A;  5F1X A;  4DR7 K;  3C6A A;  2OPR A;  3O9T A;  1C0G A;  1XMO K;  4IG3 A;  1LWF A;  5AQM A;  1NLV A;  3C94 A;  4IEE A;  3PX6 A;  2BH1 A;  3SV4 A;  4PL8 A;  3LDO A;  5K14 A;  1NGF A;  1C6V A;  3TAB A;  2PZS A;  3MAQ A;  1YTU A;  1NK5 A;  1U6Z A;  4Z4G A;  3J80 O;  3VF2 A;  1X3N A;  4OO1 J;  1YJW N;  4NXN K;  4ISG A;  5CR4 A;  4LFC K;  3DLL L;  4B3O A;  3ZSW A;  4OLA A;  1BI4 B;  4B3R K;  4I2Q A;  2IOC A;  2DPN A;  4ICL A;  4CW7 B;  5B8H A;  3KIO A;  3DLH A;  5LJV A;  4B1W B;  3NCI A;  4YY3 K;  3OBW A;  3CJ7 A;  4AH9 A;  2A1R A;  4JKG A;  2BTF A;  1Q82 O;  3NDK A;  5CZ2 A;  3VQQ A;  1T7P A;  3FE1 A;  1XUP O;  4FWN A;  1Z25 A;  3O08 A;  3I55 N;  1FXX A;  2HVI A;  2HW3 A;  4B08 A;  3UE5 A;  3K59 A;  3RMC A;  4BRN A;  1U48 A;  4YOY A;  3BY5 A;  4N41 A;  1HQE A;  1GOB A;  3G6E N;  4ZTF A;  2HST A;  4ELU A;  1TAU A;  4RW9 A;  3TAM A;  5BPN A;  3U4L A;  3TPQ A;  1IG8 A;  4K42 A;  4CHN A;  2GV9 A;  1XMQ K;  4ELT A;  3I0S A;  3UIQ A;  5AQL A;  1ZBS A;  5EU7 A;  4DTS A;  2KKZ A;  4CJ3 A;  5IT9 O;  3PLA A;  2V7Y A;  4PUO A;  2QK9 A;  1WSJ A;  2YHA A;  5BPM A;  4CEC A;  3LP0 A;  1NM1 A;  3SQ1 A;  3C65 A;  4O0J A;  4MDA A;  1RTI A;  5JIC A;  4Z4C A;  2GBZ A;  5KRS A;  3EN9 A;  3QEV A;  3CM6 A;  2Y1J A;  4B9N A;  2P9P A;  1WOQ A;  4B8C A;  1I94 K;  3G10 A;  4B1X B;  2NRZ A;  3L4Q A;  5HRS A;  1BQN A;  4FWQ A;  4H5V A;  4FPA A;  1JLF A;  2OPS A;  4CJV A;  2JLE A;  2ASM A;  4BR5 A;  4A62 A;  2AP1 A;  4JRQ A;  1WSI A;  3M3Z A;  3SK3 A;  3U3Y A;  3EY1 A;  1TK8 A;  1ESV A;  1MA9 B;  3HO1 A;  4FVM A;  3B6O A;  2YCH A;  2QXF A;  4FM2 A;  2QWL A;  3SAH A;  3K9K A;  4BR4 A;  4AHT A;  5AQG A;  4XIU A;  2YNG A;  3ULD A;  5J2Q A;  5KRT A;  3OYI A;  2JWL A;  2UXB K;  3O8M A;  2QXL A;  1YI2 N;  5LMN K;  4CGG A;  2NRT A;  1QHA A;  3CJ1 A;  1VK0 A;  5GIO A;  5IWA K;  4CBU A;  3E1Y A;  3FZM A;  1J5O A;  1VQ4 N;  2BE2 A;  2A6A A;  5AZJ B;  2BUP A;  1WNS A;  4OGE A;  3ZSO A;  2HMP A;  3MEE A;  1JL1 A;  1NU0 A;  2E1Y A;  4CZK A;  1BL3 A;  2G8U A;  3OBY A;  2X78 A;  3ATU A;  5JVG L;  3P5J A;  3LDQ A;  2FSN A;  3MEC A;  3JAM O;  4KHU A;  4OPA A;  1KVA A;  3DMJ A;  3DAW A;  4DCH A;  3OYA A;  2AA4 A;  3I0R A;  1NJW A;  5GAG P;  2E2O A;  1YXQ A;  1EQY A;  1NGI A;  3MN6 A;  3VQD A;  3K5L A;  5JS1 A;  5AQI A;  2IAJ A;  4HUG A;  5C2D A;  1KFD A;  1BHL A;  4GW6 A;  2O8D B;  2Q3S A;  4NLB A;  1GLC G;  4YDU A;  4DSE A;  1SUQ A;  3M8Q A;  3HTV A;  1TUU A;  3SUP A;  2D0A A;  1QHT A;  3GBT A;  1XNR K;  4NYF A;  3SZ2 A;  4JD2 B;  1VSJ A;  1MDU B;  4YOT A;  2ZGZ A;  3CG7 A;  4J8F A;  4FWL A;  3HVT A;  4BG8 A;  1J53 A;  4CHQ A;  3P1G A;  1RTH A;  1C1B A;  4OPH A;  1L3V A;  3SCX A;  1NOY A;  5H1S Q;  3I56 N;  1LOT B;  3D2F A;  4I9Q A;  4M42 A;  2X74 A;  3AV9 A;  3PX0 A;  3WNE A;  3CCE N;  2GEM A;  4BDP A;  3R6M A;  4DUY K;  4RW6 A;  1Q8I A;  1VQL N;  1YJN N;  1JLG A;  3NMU A;  2HNZ A;  3CCV N;  1HX1 A;  4DFP A;  4QCL A;  4K43 A;  4C8N A;  1I3A A;  4JAX A;  1RDW X;  1TL3 A;  1B9D A;  1E4G T;  1VSM A;  5C24 A;  1LW2 A;  4KPY A;  3EE9 A;  3VER A;  4DQS A;  3R8E A;  4BQZ A;  4DV1 K;  4DHY A;  3IDH A;  2A41 A;  4QOZ B;  1H1V A;  1SAZ A;  3RMB A;  5I42 A;  4HCB A;  3LP1 A;  4FLT A;  2E1Z A;  1U2V B;  5E26 A;  3QET A;  3C95 A;  1RBU A;  5KGW A;  1NGA A;  4EZ6 A;  1RDB A;  3QBX A;  3EKS A;  3DXM B;  3OY9 A;  4DR3 K;  1KVC A;  2JGU A;  2VGM A;  3Q7B A;  4FWR A;  2ZJQ L;  1IV0 A;  3AGR A;  1HNW K;  3WXL A;  3CFO A;  3FZK A;  5M1N A;  1MWK A;  3I8D A;  2FBY A;  3AO4 A;  3C6T A;  4BRO A;  4NCG A;  4DTM A;  4ILJ A;  2Q97 A;  3CCQ N;  1CXU A;  1C1C A;  3WXM B;  2EHG A;  1N8R O;  2O4I A;  2QWM A;  1HPM A;  3TAE A;  4M3Y A;  3MED A;  3ZT2 A;  5J2M A;  1JLA A;  3U6F A;  4ILG B;  4FW2 A;  1Z26 A;  3ZSQ A;  4JYA K;  1VAZ A;  4M3R A;  3TAP A;  1LW0 A;  4EIA A;  3PO4 A;  3VQ4 A;  3KZB A;  4CD1 A;  3GE1 A;  4WF9 L;  3AGK A;  4CFB A;  1ATN A;  3P83 D;  2KW4 A;  3QO9 A;  3OS0 A;  1W97 L;  1BI4 A;  4BC3 A;  3KVG A;  1VQP N;  3IKM A;  3U9Z A;  4JKG B;  4CJ7 A;  1HKB A;  4GNI A;  1GLB G;  4CCH A;  4A61 A;  1WSH A;  4FJM A;  3LM2 A;  4GY2 B;  4C1N I;  3ATV A;  2NZT A;  3ZET B;  1L3S A;  1DGK N;  1V4S A;  5M1Q A;  4EZ9 A;  4CEB A;  4LD0 A;  1EKE A;  4CK2 A;  1KTQ A;  4DSI A;  3CC2 N;  2ZJR L;  3SI6 A;  4CZF A;  3QES A;  3P38 A;  4JS4 A;  4BRE A;  2KFZ A;  4H0P A;  3HPH A;  4CEZ A;  2E5L K;  4CJK A;  1RT6 A;  4CF0 A;  2QKK A;  4X64 K;  3DLG A;  3ULE A;  4DU4 A;  4ISE A;  4H8K A;  3HPO A;  3RSE A;  1EO1 A;  1IG9 A;  4DLE A;  5J2N A;  1NWK A;  4YOU A;  1FKP A;  4KO0 A;  3P31 A;  1TUY A;  4BRG A;  3OYM A;  3NF9 A;  2HVH A;  3L2Q A;  3SAF A;  5ELZ A;  1T03 A;  2F7T A;  3NBP A;  1MU2 A;  3O3F A;  1BO5 O;  1ZBF A;  2X6S A;  1P90 A;  1RDC A;  2GUI A;  3O9U A;  4MLH A;  3OYD A;  2Q0U A;  3CCJ N;  3AVL A;  1BCO A;  4FW1 A;  3MCP A;  4I7F A;  3KWG A;  1S3X A;  2HHU A;  4Z94 A; 
#chains in the Genus database with same CATH homology
 5EX5 A;  3TTC A;  3CF5 L;  4XH1 A;  1VQ7 N;  3RVC A;  3ZX3 A;  2PBD A;  3CIP A;  3VF6 A;  4EFH A;  2FF3 B;  4B9Q A;  1YVN A;  3A5O C;  5JVH L;  4NB4 A;  3TSQ A;  1YAG A;  3BF1 A;  2CH6 A;  5BN8 A;  1K9M O;  5ADX A;  4RCH A;  5KPT A;  5DM7 L;  3P39 A;  4MO4 A;  2P9S B;  4WQ4 C;  1NGG A;  5M1P A;  2I7N A;  3MCA B;  4G9Z A;  3NVM A;  4I6M B;  3WT0 A;  5JMV A;  4A5A A;  3IFR A;  3WQU A;  4H0Y B;  3A5M C;  3VGM A;  4B1U B;  3UKU B;  1U2V A;  4RWT A;  4XH4 A;  4JEP A;  1BOT O;  3H3N O;  4BRP A;  3MWT A;  1MWM A;  3QML A;  2HBK A;  1GLD G;  1KD1 O;  3LM9 A;  2P9N B;  2QWO A;  3CPE A;  3ZYY X;  4M63 C;  2QI2 A;  3DXM A;  5AQW A;  1TYQ A;  2WBN A;  3L4I A;  5FPM A;  2ASP A;  5E84 A;  3I8B A;  3H6E A;  2D1K A;  3MX5 A;  4H0O A;  3HI0 A;  1HKC A;  3CJB A;  5MLC Q;  2ASO A;  4CZG A;  4PKI A;  3F5T A;  1SS6 A;  3U8X A;  3O80 A;  1QQM A;  2VCP A;  3VPZ A;  3M1F A;  4CZJ A;  3C0B A;  5AFU A;  4H5N A;  5F2R A;  5BRF A;  5FPD A;  3C6A A;  4MLE A;  4UY8 O;  3O9T A;  4A2B A;  4BRQ A;  1C0G A;  5AQR A;  3ZX2 A;  1KAZ A;  3E9P A;  5C12 A;  4HWI A;  5AQM A;  1NLV A;  3HBT A;  2V51 B;  4IEE A;  2BH1 A;  1OVY A;  4PL8 A;  3LDO A;  3D7E O;  3LL3 A;  4FVU A;  1NGF A;  3N4P A;  2NRX A;  3TTD A;  4CZM A;  3QFU A;  4U67 L;  1U6Z A;  2A42 A;  1GLJ O;  3CCL N;  3CER A;  3VF2 A;  1BA1 A;  3JS6 A;  1X3N A;  1QZ5 A;  2CGJ A;  4OO1 J;  4IO9 L;  3VEW A;  3IUC A;  1VQM N;  5AQH A;  1YJW N;  3O9R A;  1X3M A;  4BQL A;  2CGK A;  3H1V X;  3SBT A;  2QWR A;  4ISG A;  5CR4 A;  3QFP A;  4NO7 A;  3DLL L;  4EAH D;  1BA0 A;  4B1Y B;  3CI5 A;  1QVF M;  2E2Q A;  3OHR A;  5C2F A;  5GAH P;  3T7Z A;  2GUP A;  2A5X A;  2HF4 A;  5BN9 A;  4XEI A;  1SQK A;  5AQO A;  1RDU A;  3G25 A;  2DPN A;  4CZL A;  3A5L C;  3DJC A;  2NNW A;  5B8H A;  1SZ2 A;  5BR9 A;  1RFQ A;  5LJV A;  4XH5 A;  4B1W B;  1K8A O;  5AR0 A;  3CJA A;  3OBW A;  1O13 A;  2IVO A;  3CJ7 A;  2E8A A;  4AF1 A;  3R9P A;  4YDU C;  5LJW A;  4MO5 A;  3JXU A;  3FZF A;  4JKG A;  3VEV A;  2BTF A;  4KH6 A;  1Q82 O;  3FE1 A;  1XUP O;  2NRV A;  4FWN A;  3O08 A;  4C1N K;  3I55 N;  4A5B A;  3P4I A;  1NGJ A;  1NBW A;  5AZI A;  4BRA A;  4JK9 A;  1HUX A;  3MMV A;  3UE5 A;  4BRN A;  2P9U B;  1OKJ A;  3EL2 A;  4F9O A;  1HKG A;  3VEN A;  2VGN A;  4YOY A;  3W0L A;  3WXJ A;  2FSK A;  4B1V A;  2IVN A;  4ILH A;  4JD2 A;  4FL9 A;  3O9Q A;  3MN9 A;  3G6E N;  3CJ9 A;  4IZ9 A;  1QQO A;  2HST A;  4FSV A;  4LC9 B;  3ZX0 A;  3ENO A;  5BPN A;  3CC4 N;  3HZ6 A;  4M7Y A;  3U4L A;  3FGU A;  3TPQ A;  1IG8 A;  3KHY A;  4H5T A;  3GG4 A;  4K42 A;  3CJC A;  1Q86 O;  3PIP L;  1C0F A;  4BRH A;  4U7B A;  5AQL A;  1ZBS A;  4FO0 A;  1BU6 O;  5AQV A;  5EXW A;  4JKD A;  2KKZ A;  3GL1 A;  2NRH A;  3PLA A;  2V7Y A;  5BPM A;  3NVK A;  4BY9 C;  4H0V B;  2Q2R A;  2HBM A;  1QZ6 A;  1ATS A;  3QB0 A;  1NM1 A;  5TKY A;  3TSU A;  1JCF A;  3C65 A;  3VTI A;  5GAD P;  3HOS A;  1VQ8 N;  3LDP A;  2H3G X;  4MDA A;  4BVP A;  5JIC A;  1YIT N;  2P9I A;  3EN9 A;  3O5B A;  4H0X B;  2YHW A;  3AAR A;  3ENB A;  1K8K B;  1RGI A;  3D2E A;  2I7P A;  2P9P A;  5HOO A;  2P9L A;  1WOQ A;  3VEZ A;  4WFB L;  1DEJ A;  4B1X B;  2FXU A;  2NRZ A;  3L4Q A;  2ZF5 O;  4GV9 A;  2W40 A;  3GDQ A;  4FWQ A;  4H5V A;  3C7N A;  3S41 A;  5AQX A;  3UKR A;  3HRG A;  4FPA A;  1XC3 A;  2ASM A;  4BR5 A;  2A40 A;  4A62 A;  4CI6 A;  4BRL A;  2AP1 A;  3FLC O;  5C15 A;  3M3Z A;  3SK3 A;  4ISF A;  4M7X A;  1ESV A;  1MA9 B;  2QWN A;  3BF3 A;  4FWM A;  1KAY A;  3F9M A;  3HOT A;  2YJF A;  4CZI A;  4WQ4 A;  2Q0R A;  2Q31 A;  2YCH A;  3MN5 A;  4A2A A;  3BP8 A;  4CZH A;  2QWL A;  5FPN A;  4EHU A;  1NJI O;  3QDK A;  4QS7 A;  2W41 A;  3SAH A;  3K9K A;  3CCU N;  4BR4 A;  5DM6 L;  5AQG A;  3DWL A;  4BC5 A;  2FLO A;  4BG9 A;  3KK7 A;  4BC2 A;  5GAE P;  5ADX H;  3CCM N;  1TYQ B;  3CHW A;  3Q7C A;  3H45 C;  4HTL A;  3H1Q A;  3SJH A;  4YOX A;  5TKW A;  2JWL A;  3ID6 A;  4JN4 A;  3O8M A;  3SBG A;  2QXL A;  4FWK A;  4BR2 A;  1YI2 N;  2EWS A;  3CPW M;  2HF3 A;  5AQT A;  1YIJ N;  2P9N A;  4FPB A;  2NRT A;  2OAN A;  2QWP A;  1QHA A;  3CJ1 A;  5GIO A;  4WFN L;  2FSJ A;  2VYP A;  3G71 N;  5M1K A;  3VF4 A;  1IJJ A;  3T69 A;  3WXI A;  4DQ8 A;  4IDH A;  4CBU A;  3E1Y A;  3FZM A;  1VQ4 N;  3LDN A;  2A6A A;  3MN7 A;  5BRH A;  5AZJ B;  3EKU A;  3D6R A;  3L0Q A;  2BUP A;  4L3Q A;  4BRC A;  3CMA N;  2YJE A;  4BGB A;  2D0O A;  2HMP A;  5AFU H;  4AM7 A;  3SMP A;  3MDQ A;  4GV6 A;  2E1Y A;  2ITM A;  2GEL A;  4BRD A;  4CZK A;  4WFA L;  3OBY A;  3ATU A;  3O6W A;  4CZE A;  1KAX A;  4PHT X;  3WQT A;  4CBX A;  5JVG L;  3LDQ A;  3WUH A;  3O1B A;  2NRR A;  5AQN A;  2FSN A;  1VQ6 N;  3VEX A;  3M5R A;  4IJA A;  4K25 A;  2NLX A;  3PIO L;  4OPA A;  2D0P A;  2QW9 A;  3OW2 M;  4PL7 A;  2QEX N;  3DAW A;  4DCH A;  5C10 A;  1HJO A;  5AQP A;  1R59 O;  2NRW A;  2AA4 A;  5C0Y A;  1T6C A;  1K73 O;  3HM8 A;  5GAG P;  2E2O A;  2E20 A;  2OTL N;  1YXQ A;  1EQY A;  1NGI A;  3MN6 A;  3CCS N;  5AQI A;  1QQN A;  2V52 B;  3FFK B;  5C2D A;  3W3D A;  1DT9 A;  3DXK B;  3ZEU B;  4IEI A;  4NLB A;  3AAP A;  3ZET A;  4BGA A;  4PKG A;  1GLC G;  4YDU A;  3E9L A;  5JLF A;  1M90 O;  3SLC A;  5AZI B;  1T6D A;  3QBW A;  1S22 A;  2IIR A;  5KPR A;  3HTV A;  2JWK A;  1TUU A;  5KQD A;  3GBT A;  4QS9 A;  1Z6R A;  3ULE B;  1WUA A;  4JD2 B;  4WQ5 A;  2Q36 A;  4A57 A;  2P9K A;  4JKF A;  3N4Q A;  1MDU B;  4YOT A;  2ZGZ A;  3FR0 A;  2QWQ A;  5EOY A;  3I33 A;  3FZL A;  3RSE B;  2KHO A;  2P9U A;  4J8F A;  4R79 A;  4FWL A;  3WEE A;  4BG8 A;  4OPH A;  5H1S Q;  4JHD A;  3I56 N;  1LOT B;  4IOC L;  3D2F A;  5HL7 L;  1BG3 A;  3CCE N;  4IFE A;  1HLU A;  3VGK A;  2GEM A;  3VGL A;  5AQS A;  1BUP A;  1Q7Y O;  3R6M A;  4BC4 A;  3VTH A;  4B1Z A;  1VQL N;  1GLF O;  1YJN N;  3UB5 A;  4JK8 A;  4YOV A;  2V7Z A;  2ZJP L;  3BUZ B;  4CD3 A;  3NMU A;  3CCV N;  5EVZ A;  1HX1 A;  3CCR N;  4BR9 A;  2P9I B;  2RHK A;  3A0I X;  4IWV A;  4JK7 A;  3A8Y A;  4K43 A;  4BRK A;  3G4S N;  2E2N A;  2HOE A;  2GWJ A;  2VWB A;  1LCU A;  1ZXO A;  4JAX A;  2P9P B;  1BWF O;  2P9L B;  1RDW X;  5FPE A;  1E4G T;  3F2K A;  1M1K O;  4WCE L;  5CE3 A;  3WXK A;  3EE9 A;  1K8K A;  3VER A;  1V4T A;  5EY4 A;  3VEY A;  3R8E A;  3KWI A;  3CME N;  4H5R A;  3SAG A;  4IOA L;  4BQZ A;  1CZA N;  3ENH A;  4DHY A;  3IDH A;  1KC8 O;  2A41 A;  1H1V A;  3TTF A;  2HBL A;  4CBW A;  1NGH A;  1SAZ A;  3E9O A;  3H46 O;  1Q18 A;  1NGB A;  1DKG D;  3EE8 A;  5AQF A;  1NGD A;  4YOR A;  3MWP A;  2P9S A;  1X9J A;  2E1Z A;  1U2V B;  3TSP A;  4JKB A;  2QA4 N;  5E26 A;  2QM1 A;  5LY3 A;  4O8K A;  1NGA A;  2E88 A;  4FWS A;  4I6M A;  3SMS A;  5AQJ A;  3QBX A;  3EKS A;  3DXM B;  3ID8 A;  3Q7B A;  2WFB A;  2VGM A;  1QVG M;  4FWR A;  4MDB A;  3UKU A;  2ZJQ L;  3AGR A;  4H0T B;  4DKW A;  3GOI A;  3WXL A;  3FZK A;  1NMD A;  4DB3 A;  5KPZ A;  5M1N A;  1MWK A;  3MX2 A;  3J7Z O;  3EZW A;  5AQZ A;  4BVO A;  2UYT A;  1JJ2 M;  2OTJ N;  1Y64 A;  4QS8 A;  4BRO A;  1VQ9 N;  2YHX A;  4KBO A;  1J6Z A;  4ILJ A;  2F9W A;  2Q97 A;  4GVE A;  3CCQ N;  4GV3 A;  5CHI A;  3WXM B;  1N8R O;  4H5W A;  2IVP A;  2QWM A;  4JKA A;  3CXC M;  1HPM A;  4YOW A;  1XQS C;  3CET A;  2GX9 A;  1GLA G;  4ILG B;  5KQ8 A;  4O5F A;  3A5N C;  4NLC A;  1BDG A;  2GWK A;  3B8A X;  1VAZ A;  4C23 A;  4AM6 A;  1VQK N;  1VQO N;  1ZC6 A;  4Y0W A;  5AZJ A;  1E4F T;  1YF5 L;  4EIA A;  2YHY A;  2PAV A;  5JLH A;  5AQU A;  1ILY A;  4H03 B;  4BRI A;  1Z05 A;  1YHQ N;  3KZB A;  4CD1 A;  3GE1 A;  1T44 A;  3M6G A;  1JCE A;  4WF9 L;  2D4W A;  3AGK A;  5F1X A;  1ATN A;  4FOI A;  4RTF D;  3VOV A;  1W97 L;  3K9J A;  3VEO A;  3KVG A;  3L6Q A;  5M1O A;  4BC3 A;  1P8Z A;  1VQP N;  3IKM A;  3O4W A;  3VET A;  3U9Z A;  4JKG B;  4CJ7 A;  5BRD A;  1S72 N;  3CD6 N;  1HKB A;  4GNI A;  1GLB G;  2A3Z A;  1NGC A;  3LDL A;  4A61 A;  5BRE A;  3LM2 A;  4GY2 B;  3VES A;  4C1N I;  3ATV A;  3E66 A;  2KLA A;  2NZT A;  2F9T A;  3ZET B;  2QTD A;  1DGK N;  1KXP A;  1V4S A;  5M1Q A;  2FF6 A;  2PFU A;  3R1X A;  1ATR A;  1GLE G;  1JCG A;  3TU5 A;  2YI1 A;  3DXK A;  3ZEU A;  3CC2 N;  2ZJR L;  1W2B M;  3CC7 N;  1KQS M;  4WYB A;  4BRM A;  4CZF A;  3P38 A;  4BRE A;  2P9K B;  4H0P A;  2ZGY A;  3R3L A;  4KH5 A;  4IXC A;  4BRF A;  4PKH A;  5AQQ A;  5I9E B;  4JKH A;  1YUW A;  2HBJ A;  3C6H A;  4WQ5 C;  1NGE A;  3WEE B;  1YJ9 N;  4IJN A;  3AY9 A;  3H3O B;  3ULE A;  1G99 A;  5F0X A;  4ISE A;  4KH4 A;  4FWO A;  4JHD B;  3D2F B;  5AQK A;  2YX6 A;  3RSE A;  5GIP A;  1EO1 A;  4E1J A;  3BEX A;  4JKC A;  1NWK A;  2RE2 A;  4EHT A;  2E2P A;  1VQN N;  3MK6 A;  4YOU A;  2WUS A;  3P31 A;  3HSC A;  3O1W A;  4IO8 A;  5GIN A;  2J4R A;  1TUY A;  4FWP A;  4BRG A;  4FOE A;  3CQY A;  3U9D A;  4A59 A;  2CH5 A;  3AAQ A;  3CQX A;  1GLL O;  1VQ5 N;  3D2E B;  3VMF B;  1Q81 O;  3SAF A;  5ELZ A;  2F7T A;  4O8U A;  3QIC A;  3OA9 A;  3IMX A;  1BO5 O;  2WC9 A;  4K41 A;  5AQY A;  5BPL A;  1P90 A;  3O9U A;  4BR7 A;  3J8A A;  2ZWH A;  4MLH A;  2Q1N A;  2Q0U A;  3O9S A;  4IOX A;  4JNE A;  4BR0 A;  3CCJ N;  3C7N B;  1T3V A;  4JKE A;  3UKR B;  3MCP A;  3KWG A;  3FZH A;  2CGL A;  3EO3 A;  1S3X A;  5M1F A;  1D4X A;  2GTD A;  4Z94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...