3L3UA

Crystal structure of the hiv-1 integrase core domain to 1.4a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
151
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Crystal structure of the HIV-1 integrase core domain in complex with sucrose reveals details of an allosteric inhibitory binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 54
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l3uA00
3V4IA 1C6VA 2B6AA 4JRQA 3DI6A 3VQEA 1R0AA 3ZT2A 3HM9A 1NKCA 2QXFA 3M8RA 4CEBA 4FLTA 4B9UA 2OZSA 4NYNA 4CJKA 1RT3A 5J2PA 1G15A 3AVAA 5FROA 3MEDA 1NOZA 3V9WA 1C0TA 1J54A 3KKSA 3CM6A 1VSMA 4QAGA 4CJ3A 4CIGA 4DG1A 3AA5X 4C8MA 1IG9A 1TL1A 3ZT1A 4RW8A 1KVCA 3AV9A 4AHCA 4CGFA 3SQ2A 1A5VA 4DMNA 4HCBA 1TVRA 4ICLA 2KZMA 4ZTFA 4KHWA 4O4GA 1L3SA 1JLGA 2QK9A 2YNIA 1IKVA 3I0RA 3DLGA 4BE2A 5HROA 4DSFA 2Y1IA 1JKHA 4AILC 4CECA 1I39A 3WNEA 4HUEA 4CJLA 1Z25A 4JS5A 1ZBIA 3HJFA 1IKXA 3MEGA 2P5GA 4B08A 5J2NA 1X1PA 1S1WA 3JYTA 1LW0A 3NGIA 4BACA 3DLBA 3TANA 3KJVA 3OS2A 1GOBA 1LAVA 2YKMA 1ZBHA 2KZZA 2DY4A 4O44A 1L3TA 4Z4FA 1S5JA 1QE1A 3A2FA 3D0PA 1EETA 4KKOA 3OYDA 3M8SA 1FXXA 4E7IA 5HP1A 3TAQA 1FK9A 4M45A 1HQUA 1VSEA 2GV9A 3LANA 4CGJA 4E1MA 3PO5A 4CFAA 1L3UA 1BQMA 3RTVA 1U04A 1KFDA 2RF2A 3L2WA 3L2VA 3DLRA 1C1AA 2XY8A 3MXJA 4BE0A 1X9MA 3ZSZA 4NYFA 4B9NA 4LSLA 3B6OA 2FBYA 2P51A 3TI0A 1U45A 2HNDA 1HQEA 1KVAA 1CLQA 1KFSA 1JL1A 4E19A 4Q5VA 4FLVA 3NH1A 3HSTB 4IG3A 4EZ9A 3U6FA 4KTQA 4FK0A 3K5LA 3TARA 4DTMA 4RW7A 3OYCA 3EYZA 1BI4A 3VQQA 3OYLA 3NF8A 3VQCA 4FXDA 3SCXA 1SKWA 3G10A 4KI6A 4HCCA 3ALYA 3LP1A 4RW9A 4BDYA 1SL0A 4DFPA 1NK4A 5KTQA 4N41A 3S3NA 3VQ4A 3CM5A 4F2SA 2OPQA 1VSLA 4FW1A 2LSNA 5HRSA 3QO9A 4CEFA 1KLNA 4KAZA 4LH4A 2R7YA 3MEEA 1LV5A 4DTOA 4CHOA 3AO1A 1D5AA 4DQSA 4FK4A 1BISA 2O4GA 4O55A 4OKEA 3DOLA 3P1GA 5KI6A 4AHSA 3SYZA 3RR8A 4W5OA 3QERA 2IOCA 1S6QA 3RRHA 1WAJA 3VQPA 2IAJA 4K8XA 4M3WA 1Q8IA 2OZMA 2HHVA 3HVRA 3DRRA 3ZSQA 3DRPA 4HTUA 4DU1A 4C8KA 1UAXA 4KI4A 1ZBFA 1U4BA 3RMCA 3AVFA 4DFJA 4J2AA 2O4IA 1S1TA 4NCAA 3DLHA 3NF6A 4E7KA 1BI4B 1RT6A 3AVJA 4F4KA 1JLBA 3ZT3A 4DTRA 1WSHA 2Y1JA 1XHXA 3WNGA 3AVNA 2OPRA 3CYMA 4E89A 3RMDA 1U49A 1TGOA 1BHLA 5JS2A 4CJTA 3OY9A 4CEDA 1S9EA 1S1XA 1CXQA 3LWMA 4DFMA 3L2QA 2JLEA 2XHBA 3OYIA 3QETA 1S9GA 1KTQA 1RTDA 3VQ9A 1TK5A 2HHQA 1WSIA 2YKNA 4DTNA 3U3YA 2VG7A 3L2RA 4K8ZA 4UQGA 2YHAA 5HLFA 2HVIA 2XRIA 3VQ6A 4CJQA 4I7FA 4KPYA 4CCHA 1LW2A 2B4JA 3IRXA 4CJWA 5FDLA 4CJ4A 2PYJA 3VA0A 3AVGA 4CJSA 4IKFA 3ZSVA 2F96A 3SUQA 4N47A 1Z26A 1WSJA 3T3FA 4FLUA 3TAPA 4FZYA 1JLAA 1SKRA 4KHSA 3M8QA 4KV8A 3VQBA 3FFIA 3NE6A 4KRFA 1RBVA 4FLXA 4Z4GA 2P1JA 1DTTA 3ZSWA 2BANA 2X6NA 2E6MA 4RG8A 1L3VA 2HVHA 4CJVA 2DTUA 1NK5A 4CF8A 4CHPA 3BGRA 3PV8A 3HPHA 3OYJA 3IG1A 4M3YA 4HUFA 2HHXA 4W5TA 1T05A 4DTPA 4CK2A 1BCMA 3SI6A 1J53A 3TWHA 3RMAA 1RTJA 5K14A 3AVBA 3ZCMA 4YFUA 1K6YA 2HMIA 3SNNA 4Z0UA 2IC3A 1QHTA 1ITGA 4OKKA 1JLQA 1QS4A 4DTJA 1JLEA 1WSEA 1T7PA 1BQNA 5I42A 1U47A 4DWIA 3H08A 3I8DA 3MAQA 3ZSRA 2OA8A 1LWEA 1GOCA 1RDDA 3PO4A 4J2DA 4G1QA 4FYDA 1JLFA 1HMVA 4M42A 4EZ6A 1BIUA 4CGGA 4I2PA 3TAGA 4CJ5A 1D8YA 1TV6A 1JL2A 1VSDA 1VSFA 3K5MA 1HRHA 4F3OA 2W42A 3QEWA 3NH2A 3QNNA 5JS1A 1HNIA 3ULDA 1VRTA 2HHUA 3SQ1A 3AVMA 4CHZA 4E7HA 2P5OA 1BL3A 4H8KA 4Z4CA 4DTUA 2KTQA 1WSFA 2HHTA 4DU4A 1SKSA 2DFHA 3SZ2A 4CEQA 3PX6A 4J2EA 2X74A 3OS0A 3L3VA 3CFPA 3K2PA 3ZSOA 4CEEA 3C6UA 1NKEA 2G8KA 2GUIA 3KLGA 4FK2A 1EXQA 3C94A 1LWFA 5SWMA 4DLGA 3SV4A 1NOYA 3P5JA 3KLFA 1RT7A 3CG7A 3DLKA 3V9UA 5J2QA 4B9VA 3SQ0A 2FC0A 3UIQA 4B9SA 4DS4A 3AVCA 5D3GA 1C0MA 1W0HA 4CE9A 1SL1A 4FJNA 3HO1A 4O5BA 3U3GA 1RBSA 2YNFA 4AHTA 4KHYA 1JXEA 4FJ5A 2HNZA 2GBZA 3HPOA 4FJGA 2DFEA 2RPIA 3KLIA 3QESA 2AJQA 4FJLA 3NFAA 4M3TA 3QINA 4XIUA 2RKIA 2PY5A 3ZT0A 1IO2A 4KTWA 4CF9A 2NUBA 3HPGA 3OYFA 4Y1DA 3RMBA 1TKTA 4J2BA 1S1VA 3KD1E 1VK0A 3LALA 1VSHA 3CFRA 5C25A 3KK2A 4KREA 1TL3A 1Q9YA 3CQ8A 2D0CA 3AA2A 4QOZB 2Z1GA 1HYSA 4PY5A 3KIOA 3S9HA 4CFCA 3NAEA 2G8WA 4CJEA 1I3AA 3V1QA 4E3SA 1KVBA 3V1RA 4R5PA 1TK0A 1RT4A 3K59A 4EP4A 1N6QA 3DOKA 3QLHA 4DSJA 4KB0A 2G8FA 4FZZA 2ETJA 4W5RA 1RTHA 4ID5A 3K58A 5J2MA 2G8UA 3OVNA 4RW6A 1ZBLA 4IFYA 3ZT4A 4W5NA 3KKRA 1D9FA 1YT3A 4DTSA 1TAQA 2XY7A 1NKBA 4DS5A 4CF1A 2KW4A 4CEAA 2JGUA 2YHBA 4DQQA 1A5XA 3O3FA 3QEVA 4C8NA 4FJKA 4N76A 3NGZA 1RDAA 2D0AA 1RT2A 4LSNA 5HRRA 1QSLA 1ZYQA 3MECA 1F21A 3HVTA 1VSIA 3NBPA 3BDPA 4FLZA 2E6LA 1GOAA 1VRUA 3DYAA 5KRSA 1NK6A 3ISNC 5CZ1A 2VWJA 1IKWA 2BGGA 3AO2A 3T1AA 1KRPA 1L5UA 3O3GA 5KRTA 3K5NA 3C95A 1U48A 1KLMA 4CHNA 4E0DA 3HT3A 3D45A 1VSKA 1RDBA 2RN2A 3B6PA 4MQ3A 4PWDA 3THVA 3OYMA 1YTAA 4FJXA 4PQUA 1RTIA 2Z1HA 4B9MA 4FJIA 4O0IA 1ASWA 3QIOA 3PX4A 3V9SA 2WOMA 1WLJA 4AHVA 4CIEA 3NH0A 2X6SA 3OS1A 3RWUA 4NCBA 3KK3A 2X78A 1UA0A 4DLEA 4OJRA 1T8EA 3PY8A 3ZSXA 3QEIA 3SUNA 1J5OA 2EX3A 3HK2A 4F3TA 4Y1CA 4FM2A 3LAMA 3AO5A 3EY1A 4CJUA 4CK1A 1W9HA 4CK3A 1B9FA 1RBUA 4CJRA 4FLYA 3SUOA 3HP9A 4ZTJA 2YV0X 1LAWA 3AVHA 5E41A 3V81A 3TAEA 1NK7A 4HUGA 4BWJA 2OPPA 3V9XA 2OPSA 3QNOA 3OYBA 5FRNA 5HRPA 3VQDA 1XWLA 2FBTA 3NCIA 2VG6A 1HYVA 3O4QA 4DFKA 2XY6A 3QEPA 2HHSA 1FKPA 4GMJB 4KB1A 2ZE2A 4B9LA 2E4LA 4I2QA 1QTMA 1HYZA 4CGDA 2B5JA 4CF2A 4E7JA 1Q9XA 3KTQA 3ITHA 4LD0A 2YNGA 3L8BA 2HHWA 4CFBA 4CHYA 1C1CA 3VQ5A 3V1OA 3LWLA 1QSSA 1S1UA 1X9WA 1NJXA 2KFNA 1EX4A 2XO7A 3T19A 4HVJA 3JSMA 1NK8A 1J9AA 4YNQA 1ASUA 4CIFA 1FKOA 3HYFA 3MXIA 1KCFA 2VWKA 5C24A 1N5YA 3IS9A 1XHZA 1TK8A 4FJJA 3LPUA 3KD5E 1NK0A 1DLOA 4RW4A 1TKDA 1EKEA 2QKBA 3LPTA 5CYMA 1BGXT 3HP6A 4OKJA 1ZBUA 3SPYA 3VN5A 3ASMA 3KLHA 4GW6A 4AHRA 3O3HA 3KLEA 2Q3SA 3L2UA 4DQRA 4F8RA 4W5QA 3PX0A 4Z4EA 4TSXA 2WONA 4NCGA 3WNHA 3RR7A 1C1BA 2A1SA 4B8AB 1BCOA 3AVKA 4N56A 4DF8A 4ELTA 4M3ZA 4CGHA 2I5JA 3TAMA 3EZ5A 1WAFA 3SUPA 3OYGA 1UA1A 3RRGA 4GVMA 2ZQBA 4DQIA 2D0BA 4DSLA 2BE2A 4M3RA 3DLEA 3OYAA 1QSYA 2KQ2A 4L8RB 3KK1A 3OJSA 5KGXA 1RT5A 4HHTA 1XI1A 3S3OA 5CYQA 5T7BA 4FJ8A 2IS3A 4KHNA 4E1NA 5EU7A 4FJ7A 4BWMA 2G8IA 4JLHA 2VG5A 1DTQA 4FJHA 1TKXA 4KFBA 4H4MA 4OPJA 4C8LA 4B9TA 4ELUA 1YTUA 4FM1A 4DQPA 4OGCA 4FCYA 3OYKA 2ATQA 2FBVA 3NF9A 4CJPA 3LZIA 4DU3A 3QEXA 4FZXC 1D9DA 1SUQA 2QKKA 2A1RA 3SV3A 1B92A 1NJWA 3F9KA 5HBMA 4AH9A 4BE1A 3WNFA 1SL2A 1WN7A 3SJJA 3S3MA 4FVMA 1IH7A 5DK5A 3NDKA 2ITGA 4FLWA 3VA3A 3G0ZA 1S6PA 2ZD1A 3HL8A 4IDKA 2PYLA 4MFBA 1HPZA 1UOCA 4ZHRA 1REVA 3E01A 1T03A 2DFFA 3LAKA 3TR8A 5KGWA 4O0JA 3OJUA 1HNVA 4DTXA 1VSJA 3AO4A 3NHGA 4I9LA 4OGEA 4FJMA 3PUFA 3AA3A 1WSGA 4H4OA 4AHUA 3C6TA 4QCLA 1RNHA 3DMJA 2HB5A 1B9DA 4KHQA 2G8HA 1TKZA 4FJ9A 4M3XA 5HRNA 1RILA 4CESA 3LP0A 5CZ2A 4B3OA 4CERA 3K5OA 1RDCA 1NJZA 2IDOA 2HNYA 3LP2A 4FW2A 4LH5A 2G8VA 4ID1A 4M3UA 1IKYA 4FM0A 3I0SA 4Z4IA 5J1EA 4OLAA 1BIZA 2BDPA 3NGYA 3AVIA 4ELVA 3M8PA 4DSIA 4OVLA 3ZSYA 4Z4HA 1KSPA 3TABA 1SV5A 4I9QA 4N5SA 2PZSA 1WNSA 1X9SA 2KFZA 1RBTA 4CEOA 4KO0A 1EP4A 3K57A 4F2RA 1RCHA 3HXMA 3OYNA 2Z1JA 2FBXA 4OPKA 1JXBA 3TAFA 1XC9A 4B8CA 3LP3A 4WE1A 3O4NA 1NJYA 3AVLA 2F8TA 2HW3A 3OYHA 4BDPA 1O1WA 4CFDA 1TAUA 1CZBA 1YVUA 3QIPA 4EP5A 4JRPA 3CFOA 4PUOA 3L3UA 4CEZA 5C42A 1QQCA 5SZTA 5FRMA 1LWCA 2F8SA 5DMRA 1UWBA 1MU2A 4IG0A 4M41A 2OYQA 1JLCA 1RBRA 1Y97A 3V9ZA 4Q0BA 3SQ4A 4OLBA 4CJFA 4IBNA 1CXUA 1HJRA 3AA4A 4LY7A 3SPZA 2D5RA 3IAYA 4CGIA 3F73A 3AO3A 4JS4A 5I3UA 1NK9A 4KHUA 4CHQA 4IFVA 1ASVA 4KTZA 3NF7A 4C8OA 3MXMA 3VQ7A 1RT1A 5CY4A 3LDSA 3VQ8A 4CF0A 3LZJA 4DSEA 3VQAA 2EHGA 4E7LA 2YNHA 1CZ9A 3OYEA 4DF4A 2XY5A 3DM2A 3DRSA 1C0UA 4PA1A 1A5WA 2Z1IA 4BDZA 3V6DA 2IGIA 3P83D 4DSKA
chains in the Genus database with same CATH superfamily
3VQEA 1IG8A 1R0AA 3HM9A 1NKCA 3M8RA 1Z05A 3N4QA 2YHWA 4KH6A 2OZSA 3J7AP 5DM6L 5FROA 2O8FA 3V9WA 2HHUA 3CCVN 1VSMA 4QAGA 4CIGA 1IG9A 3ZT1A 4RW8A 1KVCA 3AV9A 4JKBA 3SQ2A 1TVRA 4ICLA 2YCHA 4QS8A 2GWJA 1QVFM 3ZX3A 4CBUA 1JLGA 1HKBA 2NRTA 2NNWA 4IJAA 4U7BA 3A5NC 4BE2A 2QK9A 5HROA 4CW7B 5AQJA 2OANA 3VEWA 1ZBIA 3AY9A 2P5GA 3ZEUA 4B08A 5J2NA 3KWIA 3NGIA 3KJVA 3OS2A 2YKMA 1ZBHA 4FPAA 4O44A 1L3TA 1S5JA 3O9QA 3OYDA 1FXXA 3O5BA 3NVMA 5GINA 1FK9A 4M45A 1HQUA 1VSEA 2GV9A 4CGJA 2O8FB 3AARA 3MMVA 2FF3B 2RF2A 1X9MA 2XY8A 4WF9L 4BE0A 4B9NA 2NZTA 3WXKA 4LF8K 4A61A 5C0YA 5M1OA 4Q5VA 4FLVA 3HSTB 4IG3A 4JK7A 1TYQA 3G6EN 1HLUA 3VQQA 3NF8A 3VQCA 2ZF5O 3ZEUB 4YY3K 4RW9A 4J8FA 4F2SA 2OPQA 2F7TA 4FW1A 1KLNA 1BISA 4AHSA 3RRHA 2OZMA 5AQSA 3CCJN 4C8KA 4KI4A 5FPMA 3AVFA 2IVNA 3AVJA 5BRDA 2Y1JA 3O6WA 5JLHA 3WNGA 1JCEA 4I6MA 1TGOA 2HF3A 5JS2A 3HRGA 1X3NA 1HKGA 2XHBA 3OYIA 3QETA 4MLHA 1HKCA 1S9GA 3VQ9A 3U3YA 4K8ZA 2HVIA 2XRIA 1Q82O 4OO1J 4A59A 1LW2A 4CJWA 1IBKK 4CJ4A 3HBTA 2PYJA 3VA0A 4IZ9A 3AVGA 4IKFA 2ZM6K 4N47A 1Z26A 2A6AA 5LJWA 4KHSA 2CGKA 3FFIA 3PIOL 4KRFA 4Z4GA 2P1JA 1DTTA 2X6NA 1XQSC 4K42A 4I6MB 1DT9A 1NK5A 5AFUH 4CF8A 3CJBA 3VMFB 4JI7K 2HBKA 2E1ZA 3HPHA 3OYJA 2CGJA 4HUFA 4BRDA 4W5TA 1T05A 4DTPA 4CK2A 3SI6A 4FWLA 4EAHD 3TWHA 3TTFA 2YJFA 3AVBA 3I8BA 3ZCMA 4X65K 4YORA 1E4FT 2IC3A 4OKKA 3SMSA 1WSEA 3L6QA 5EXWA 3I8DA 1LWEA 4FYDA 4CJ5A 1QVGM 4IWVA 1VSDA 3K5MA 1VSFA 3NH2A 3QNNA 5C12A 4LFAK 3U9ZA 4E7HA 4GKJK 1BL3A 4Z4CA 1WSFA 3LDOA 2QEXN 5GAGP 1NKEA 3ZSOA 3BEXA 3W3DA 3KLGA 3C94A 1LWFA 4BC4A 1BOTO 1RT7A 5J2QA 4B9VA 3UIQA 4DS4A 3SAGA 2P9SA 5E84A 3OTOK 2F9WA 3U3GA 1RBSA 3MN6A 3R9PA 4AHTA 4KHYA 1JXEA 5FPEA 4JK9A 4FJ5A 1M90O 2GBZA 2DFEA 2AJQA 3NFAA 1QZ5A 3OYFA 2CGLA 4IXCA 4Y1DA 3RMBA 1TKTA 4J2BA 4EHUA 3LALA 3VEYA 1TL3A 1Q9YA 2D0CA 3H3OB 2Z1GA 3ZX2A 3S9HA 5BN8A 3V1QA 2ZJRL 4DSJA 4LF5K 4KB0A 4YOUA 2ETJA 2HOEA 2P9SB 4ID5A 4WQ5A 3GOIA 4CVNE 2G8UA 3OVNA 4RCHA 3ZT4A 4W5NA 3WT0A 1TAQA 1NKBA 5EY4A 4DS5A 4BRFA 4KHPK 1ATNA 4LF7K 2V52B 1RDAA 2D0AA 4LSNA 3F5TA 1ZYQA 5JLFA 1SS6A 4FLZA 3BDPA 1VRUA 1NK6A 5KRSA 1M1KO 4LF6K 4ISFA 4B9QA 1YJ9N 3MN5A 1Z6RA 4H0TB 4CHNA 1K8AO 3HT3A 1S72N 1RDBA 4MQ3A 4CZFA 4PWDA 1YITN 2IGIA 1U6ZA 3QIOA 3PX4A 2H3GX 3CQXA 5AQMA 4GV6A 2X6SA 3WQUA 1X9JA 3VF6A 3PY8A 2EX3A 4CJUA 4BVOA 4CK1A 3J7ZO 3HP9A 2YV0X 4FL9A 2A40A 3AVHA 3TPQA 3TAEA 4JEPA 3QNOA 4A62A 3VF4A 4JD2A 4B1UB 2FXUA 3NCIA 2D0OA 1N33K 2HHSA 1Q7YO 4I2QA 4CGDA 4E7JA 4GNIA 3SAHA 2YNGA 3L8BA 2HHWA 3ID6A 1NJXA 1EX4A 3MN9A 3T19A 2XO7A 4CIFA 3HYFA 1KCFA 2CH6A 3DXKA 4OPAA 3LPUA 1DLOA 2IIRA 4YOXA 4BY9C 4OKJA 5LMUK 3SPYA 4H5TA 3KLEA 3L2UA 1VQPN 4JD2B 1K8KA 2W6LA 5GADP 4Z4EA 4BREA 1C1BA 2A1SA 4XEIA 1VQ6N 1NGHA 2BTFA 4FWOA 3OYGA 1UA1A 2A3ZA 2WTUA 4DSLA 3CI5A 1BA1A 2I7NA 1NGDA 1RT5A 1XI1A 4MLEA 2Q2RA 5CYQA 5T7BA 4KHNA 3S41A 3CC7N 4FJ7A 5B8HA 3A5MC 3MDQA 2NRVA 3G4SN 1TKXA 1GLEG 4FWMA 3OYKA 2ATQA 4CJPA 2O8CA 3UKRA 1K8KB 2HSTA 4DHYA 3I55N 1IH7A 5DK5A 2ITGA 2PYLA 1S6PA 4BR4A 1UOCA 4DV0K 1T03A 2DFFA 4O0JA 1VAZA 1VSJA 4FJMA 4H4OA 3QB0A 3A8YA 3SBTA 4AHUA 2A5XA 2HB5A 1B9DA 1VQ4N 4CESA 1G99A 3LP0A 4JKFA 4B3OA 4CERA 3MCPA 2ASPA 1IKYA 4FM0A 3I0SA 4Z4IA 4OLAA 4OX9K 1HX1A 2O8CB 4DKWA 4DSIA 4OVLA 1TUYA 3D2FA 3UKRB 3TABA 2PZSA 2KFZA 1J5EK 1RBTA 4F2RA 3THXA 4IEIA 1NJYA 1HNWK 1K73O 3QIPA 3D2EA 3WUHA 4BRMA 4JRPA 4H5NA 4CEZA 1QQCA 3R3LA 4IG0A 2D0PA 3V9ZA 4CJFA 4IBNA 1HJRA 2GTDA 4LY7A 3SPZA 2D5RA 3F73A 3EKSA 4M7XA 1VQ9N 2QTDA 3D2FB 1OH6A 1RT1A 5CY4A 3LDSA 3J8AA 5AQHA 2EHGA 1NGEA 3OYEA 3F9MA 4CI6A 3THXB 4B3SK 3DRSA 4J2DA 2NRWA 3V4IA 4PKGA 2B6AA 3D2EB 2NRHA 4CEBA 4FLTA 4B9UA 4NYNA 4CJKA 1VQ7N 5J2PA 1G15A 3ATVA 5BRHA 3MEDA 1NOZA 1C0TA 1J54A 4B1ZA 4CJ3A 2UUCK 1ZC6A 3AA5X 4C8MA 1TL1A 4NB4A 1VQLN 3PLAA 4DMNA 1ATRA 4KHWA 2P9PA 2FSKA 3KWGA 2Y1IA 1HNZK 1I39A 3WNEA 4HUEA 4JS5A 1IKXA 3GL1A 1S1WA 3JYTA 3ENHA 1LW0A 3R8EA 1LAVA 2KZZA 4LFCK 1QE1A 3TARA 1EETA 1BG3A 1YXQA 1BQMA 2WC9A 3VEOA 3L2WA 3L2VA 3DLRA 1Q81O 5BRFA 4LSLA 5AQFA 2P51A 2HNDA 2F4VK 1HQEA 2P9PB 4E19A 3C6HA 3NH1A 1XNRK 4GKKK 5AQXA 1DEJA 4DTMA 3OYCA 4HCCA 3LP1A 1NK4A 3VQ4A 1NU0A 1VQKN 2HHHK 3H6EA 5AQYA 2LSNA 5HRSA 4JI2K 3AO1A 2O4GA 4OKEA 3DOLA 5FPNA 4H0OA 3RR8A 4W5OA 3AAQA 3QERA 4K8XA 5TKWA 3VENA 3HVRA 4HTUA 4CZJA 1P8ZA 2D1KA 4DFJA 1MDUB 2O4IA 3RSEA 3NF6A 4DR2K 1V4TA 4Z94A 4F4KA 3JAMO 3O9UA 5AQZA 1BHLA 5M1KA 4CJTA 4JI3K 3OY9A 4CZGA 4ILGB 2ZJQL 3PSFA 4QS9A 3L2QA 3GBTA 1GLDG 2HHQA 4DTNA 2VG7A 5HLFA 5EX5A 4CJQA 3IRXA 5FDLA 2E2QA 3O1BA 1JJ2M 2Q36A 5FLXO 3ZSVA 2F96A 3LDQA 3T3FA 4FLUA 4K43A 3TAPA 4FZYA 1JLAA 4DV6K 1SKRA 3M8QA 1KAZA 3VQBA 4ISGA 3M5RA 2O8BB 2E6MA 4JKAA 3PV8A 4O8UA 4M3YA 3IMXA 3EZWA 3CXCM 1J53A 2Q0UA 2W6KA 1RTJA 3O1WA 4EFHA 1QHTA 4DTJA 1U47A 4B1WB 1GOCA 3PO4A 5CR4A 4G1QA 4WFAL 1JLFA 4EZ6A 4JHDB 4DR4K 1TV6A 2QWNA 1JL2A 3UE5A 2W42A 3QEWA 1HNIA 3ULDA 1VRTA 3SK3A 1KXPA 4JKCA 4DTUA 3CQYA 1SKSA 4CEQA 4J2EA 1QQOA 3LDNA 3CFPA 3L3VA 3C6UA 2QWQA 1EXQA 4A5AA 3K0SA 2ITMA 1KD1O 2GELA 2YJEA 1NOYA 3O4WA 5F1XA 3CG7A 5AQRA 2QWPA 3SQ0A 5D3GA 3CJ1A 4CE9A 2V7ZA 1SL1A 3DJCA 1NLVA 3AGRA 2GX9A 2YNFA 1HR0K 1IBLK 4EIAA 5CE3A 2KHOA 5A2QO 3CCMN 4FJGA 3QESA 4FJLA 4XIUA 5AQKA 4DR7K 3PSIA 1IO2A 4KTWA 3E9LA 1EWRA 4DR6K 1S1VA 3KD1E 1VSHA 1ILYA 3NAEA 1WBDA 3V1RA 3SJHA 3K59A 4EP4A 3ZLJA 2G8FA 1VQNN 1NGAA 5FPDA 1ZBLA 4RW6A 3RVCA 2XY7A 2YHBA 3QEVA 5GIOA 3O3FA 4A2BA 3L4QA 5HRRA 1RT2A 3MECA 1F21A 3DYAA 5M1FA 3ISNC 2OTLN 5CZ1A 1T3VA 3B8AX 3T1AA 1R59O 4FWKA 1U48A 4E0DA 2RN2A 1OVQA 1VQ8N 5BPLA 3OYMA 4PQUA 1RTIA 5I9EB 4FJIA 5AQTA 1BUPA 4O0IA 2Q31A 3NH0A 3RWUA 4NCBA 3KK3A 2P9LB 4GY2B 2X78A 1NGCA 3SAFA 4OJRA 1T8EA 5HP1A 3AO5A 3MX2A 2FSNA 4ZTJA 4CK3A 1RBUA 4FLYA 2E8AA 2UXCK 4WCEL 1LAWA 1O13A 3QICA 3QFUA 3V81A 1NK7A 4HUGA 3V9XA 3J81O 1NG9A 4BR5A 4YOYA 4AM7A 1HYVA 4MO4A 3BZCA 3VERA 3ENOA 1HYZA 4CF2A 2B5JA 3ITHA 4FOEA 4LD0A 4CHYA 3VQ5A 3V1OA 3TSQA 3LWLA 1X9WA 2KFNA 1HJOA 1J9AA 3CCSN 3O80A 4XH1A 3CERA 1LCUA 3KD5E 2RHKA 3Q7BA 1NBWA 1TKDA 4BR9A 2QKBA 1ZBSA 3VN5A 2PAVA 4F8RA 2Q3SA 3U8XA 4W5QA 2QWMA 3I56N 3PX0A 3CCQN 4B8AB 3A0IX 1BCOA 4N56A 3DLLL 4DV3K 2I5JA 3L0QA 4E1JA 4BG8A 3VETA 3RRGA 5AQGA 2ZQBA 2BE2A 3DLEA 2I7PA 2KQ2A 4IO9L 3KK1A 1WUAA 2F9TA 2E88A 2QXLA 4FJ8A 2IS3A 3T69A 2ZJPL 5EU7A 4BWMA 2G8IA 4JLHA 1DTQA 3UB5A 4DR5K 3LM2A 4GVEA 4H4MA 4ELUA 3LZIA 2KLAA 4FZXC 1D9DA 1NJWA 5IT9O 2GEMA 3F9KA 1WN7A 1YVNA 3GE1A 4JI0K 2FSJA 3G0ZA 4IDKA 2O8EA 5TKYA 4ZHRA 3TR8A 5KGWA 4FK4A 3NHGA 4I9LA 3C6AA 3PUFA 3AA3A 1WSGA 1OVYA 4KHQA 2G8HA 1TKZA 3CIPA 4FJ9A 5HRNA 3KZBA 1OH7A 1NJZA 1HNXK 2IDOA 4LH5A 4FW2A 5J1EA 3CJ9A 3NGYA 3CD6N 2ASMA 3M8PA 1N32K 1BO5O 1SV5A 4N5SA 3P38A 5KQ8A 5DM7L 1RCHA 3HXMA 2FBXA 2O8EB 4WE1A 3O4NA 4F9OA 4G9ZA 1YJWN 3AVLA 1FW6A 2HW3A 3OYHA 4H03B 2E2OA 4H0PA 4PUOA 5SZTA 5FRMA 3BY5A 3HI0A 1UWBA 1MU2A 1JLCA 1Y97A 1CXUA 5EOYA 3CETA 2WBNA 3IAYA 4KHUA 3WXIA 4CHQA 4IFVA 4KTZA 3TTDA 3NF7A 5AQWA 4C8OA 4DV2K 4CF0A 3VQAA 2ASOA 4E7LA 4EHTA 3LDLA 4PA1A 2Z1IA 3P83D 1NWKA 1N36K 3OBWA 1Y64A 4BR2A 4JRQA 1OH5A 2QXFA 4XH4A 2BH1A 1XMOK 3G25A 2FF6A 3D7EO 4FWNA 1DKGD 3CCRN 3KKSA 3RMCA 3CM6A 4DG1A 3ZYYX 3QDKA 1GLAG 4OPHA 4LF9K 4AHCA 4L3QA 5IWAK 4HCBA 1RDWX 4PL7A 1KQSM 1XMQK 2YNIA 1IKVA 3I0RA 3DLGA 5M1NA 5AQVA 4DSFA 3QMLA 4BC3A 4CZKA 4CJLA 4H5VA 1X1PA 4YHHK 3BP8A 3TANA 5LMNK 1LOTB 4C23A 5F0XA 4BGBA 3MCAB 2DY4A 2OTJN 4FO0A 4Z4FA 3M8SA 4E7IA 3BUZB 3TAQA 4E1MA 3PO5A 4CFAA 1L3UA 3VEZA 3MXJA 3MWTA 1VQMN 3B6OA 2FBYA 2HF4A 1U45A 4WYBA 1QQNA 1KVAA 3E1YA 1W7AA 1CLQA 1JL1A 4X64K 1WOQA 4EZ9A 3U6FA 3EYZA 1BI4A 3OYLA 4FXDA 3SCXA 1SKWA 3ALYA 4DFPA 5KTQA 3CM5A 4XH5A 1VSLA 4NLCA 3QO9A 4KAZA 3MEEA 1LV5A 3SBGA 1D5AA 4DQSA 5KI6A 4IEEA 4JKHA 4H0VB 2RE2A 5AQPA 4M3WA 1WAJA 3VQPA 1Q8IA 2HHVA 3P39A 5KPZA 4DU1A 1U4BA 3OHRA 4J2AA 3BZKA 4NCAA 3CC2N 4LC9B 1BI4B 3ID8A 1RT6A 4WQ4A 1S3XA 3ZT3A 3P31A 4BQLA 4DTRA 1WSHA 4E89A 3AVNA 3CYMA 2NRRA 4AF1A 4BRAA 1S9EA 3C7NA 4DFMA 4FWQA 2JLEA 2P9UA 4BVPA 2ZGZA 1EWQA 1WSIA 2AA4A 2YKNA 3L2RA 2YHAA 2B4JA 3ZX0A 4BRPA 4CD3A 4BC2A 3NMUA 4RWTA 3J80O 4KV8A 3LM9A 4K41A 3ZSWA 2BANA 1L3VA 2HVHA 4CJVA 2DTUA 4CZIA 4CHPA 3BGRA 2HBLA 3E9OA 1MWMA 3C7NB 2HHXA 2P9UB 2E5LK 1IBMK 3RMAA 3VOVA 1XC3A 1Q18A 2KKZA 3K9JA 4Z0UA 1QHAA 1QS4A 4CZHA 4WQ4C 1JLEA 1T7PA 4DWIA 1VQON 3H08A 4QS7A 3MAQA 3ZSRA 2OA8A 4KH5A 4O8KA 4H5RA 3CCEN 3WQTA 5AQUA 5AQNA 4M42A 1BIUA 3LL3A 4I2PA 4CGGA 1D8YA 4K0KK 4B3TK 4F3OA 1HRHA 5JS1A 1ATSA 2PFUA 3GG4A 3K9KA 5HL7L 2HHTA 2KTQA 2NRZA 4DU4A 2DFHA 3SZ2A 3PX6A 2X74A 1N8RO 5LY3A 4PKIA 3SLCA 5LJVA 2GUIA 2YHXA 3FZLA 1EO1A 3UKUA 1C0GA 3ENBA 3CC4N 3KLFA 3IDHA 3DLKA 3N4PA 3V9UA 2FC0A 4FJNA 4O5BA 4U67L 3GDQA 2HNZA 2O8DB 3HPOA 3KLIA 4M3TA 1YAGA 3QINA 2PY5A 2CH5A 4DV4K 2NUBA 1VK0A 4B1VA 3TTCA 3CFRA 2Q0RA 1X3MA 3KK2A 1YI2N 4BRCA 4KREA 4QOZB 4PY5A 3KIOA 1I3AA 4E3SA 4R5PA 3UKUB 1TK0A 1N6QA 3DOKA 4PHTX 1NGIA 5JMVA 1IJJA 4KH4A 4FZZA 4W5RA 1RTHA 1ESVA 3K58A 5J2MA 3O9RA 4JK8A 4IFYA 1OH8A 2W41A 4X62K 4MDAA 4CF1A 2KW4A 4CEAA 5KQDA 4JKEA 2O8BA 4C8NA 3VTIA 4FJKA 5H1SQ 4N76A 3NGZA 3VF2A 5KPTA 1VSIA 3NBPA 5JVGL 4GV9A 1IKWA 3AO2A 1KRPA 1L5UA 3QFPA 4FWPA 3K5NA 3W0LA 2V7YA 3D45A 1VSKA 4MO5A 3THVA 1YTAA 3M1FA 2Z1HA 3T7ZA 4B9MA 4V19S 2WOMA 3LDPA 4AHVA 3WEEA 1XNQK 4BGAA 4JHDA 4H0YB 4CZMA 4DLEA 3MN7A 1J5OA 4BRQA 4Y1CA 4FM2A 3HK2A 3EY1A 1W9HA 3SUOA 5ADXA 5E41A 2BUPA 2GWKA 2OPPA 2OPSA 5HRPA 3VQDA 2IVOA 4YDUA 4AQYK 2FBTA 3H46O 2VG6A 3FZFA 2XY6A 3QEPA 1FKPA 3AGKA 4GMJB 3HZ6A 2ZE2A 4BR0A 5M1PA 4BROA 4JI8K 3O9TA 3KTQA 3L4IA 2HMPA 3CPEA 3WEEB 1C1CA 3CMEN 1QSSA 1S1UA 2E20A 2VCPA 3JSMA 1NK8A 4YNQA 4BQZA 1W2BM 5C24A 1N5YA 3IS9A 1XHZA 1TK8A 4FJJA 1NK0A 2ZGYA 4C1NI 1EKEA 3LPTA 5CYMA 1BGXT 3HP6A 4DR3K 1ZBUA 4GW6A 4AHRA 4DQRA 5F2RA 1WBBA 2P9IA 5AZIB 3DWLA 3J7YP 2WONA 3WNHA 4C1NK 3RR7A 4UY8O 5HOOA 3CJ7A 4CGHA 3TAMA 3EZ5A 1WAFA 1GLCG 1T6DA 1RFQA 4JI4K 5AJ3K 4IFEA 2UXDK 4IJNA 3C65A 1QSYA 3OYAA 3VGMA 5KGXA 3U4LA 3DAWA 4E1NA 2NRXA 2VG5A 1KAXA 3Q7CA 3VGLA 4FJHA 4JKDA 2VGNA 4YDUC 4C8LA 4OPJA 3VTHA 2JWKA 4OGCA 3NF9A 1N34K 2NLXA 4DU3A 3QEXA 1YF5L 3SV3A 1B92A 2P9IB 4BE1A 1SL2A 3SJJA 4FVMA 5KPRA 3NDKA 3HL8A 4MFBA 3H1QA 3E01A 2UYTA 2D4WA 4DTXA 1HNVA 4OGEA 2P9LA 4YOVA 4DCHA 5CZ2A 4BRLA 2YHYA 4M3UA 2G8VA 3CJAA 4ID1A 2QWOA 3AVIA 2QWRA 4Z4HA 4I9QA 1IV0A 5E26A 1WNSA 2QI2A 4KO0A 1EP4A 1TYQB 2P9KA 3WXLA 2FLOA 3K57A 4B3RK 3TSUA 4OPKA 3TAFA 2HBJA 3G71N 3QBWA 1O1WA 1W97L 4CFDA 1CZBA 1YVUA 2QA4N 3CFOA 3L3UA 5C42A 3JXUA 4K25A 4CD1A 2F8SA 5DMRA 4M41A 4Q0BA 5EVZA 3SQ4A 5GAEP 4OLBA 4BRIA 4CZEA 4A5BA 3HOTA 5I3UA 3AO3A 1ASVA 3MXMA 3LZJA 2P9KB 1A5WA 2OCEA 4DSKA 4LF4K 3OW2M 1C6VA 3DI6A 3MWPA 4BC5A 3ZT2A 3H1VX 2PBDA 4JI1K 1YIJN 1MWKA 3BF1A 1RT3A 4NLBA 3AVAA 1YJNN 3TSPA 5I42A 3PIPL 4HWIA 2Q97A 4DV5K 3E9PA 3VEXA 5AQIA 4CGFA 1A5VA 4JNEA 2KZMA 4ZTFA 2UUAK 3EO3A 4O4GA 1L3SA 4FPBA 1HPMA 1JKHA 4AILC 4CECA 1Z25A 3HJFA 3MEGA 1H1VA 3R1XA 5BR9A 4BRKA 4BACA 3DLBA 2P9NA 1GOBA 1VQ5N 2EWSA 2WFBA 3A2FA 2DPNA 3D0PA 1NGBA 4KKOA 1RDUA 3LANA 4PKHA 3RTVA 1U04A 1KFDA 5AQLA 1C1AA 3FZKA 3EL2A 3ZSZA 4NYFA 5C2DA 3TI0A 4B1YB 3EKUA 4JI6K 3CF5L 1KFSA 3KK7A 3MK6A 3EEQA 4FK0A 4KTQA 3K5LA 4RW7A 4WFBL 2Q1NA 3G10A 4KI6A 1C0FA 4DQ8A 5C10A 4BDYA 1SL0A 1GLBG 4N41A 2P9NB 3S3NA 4BR7A 4JN4A 4CEFA 1GLFO 2UU9K 2QW9A 1T6CA 3CHWA 1OKJA 4LH4A 2R7YA 3HM8A 4CHOA 4DTOA 1T44A 4O55A 3P1GA 1EQYA 4M63C 3SYZA 4DB3A 2YX6A 2IOCA 1S6QA 2IAJA 4O5FA 5AZJA 3DRRA 4X66K 2J4RA 3DRPA 3ZSQA 1V4SA 1UAXA 3WXJA 1ZBFA 4JYAK 1FJGK 1S1TA 5C2FA 4HTLA 3DLHA 4E7KA 1E4GT 4R79A 3O08A 1SZ2A 4ILJA 1JLBA 3VEVA 1XHXA 2OPRA 3RMDA 2YI1A 1U49A 3CJCA 4YOWA 4CEDA 1S1XA 1CXQA 1NGJA 5JICA 3LWMA 3IFRA 1GLJO 1KTQA 1RTDA 1TK5A 4UQGA 3MX5A 3VQ6A 4KPYA 4I7FA 5AZJB 5GIPA 4CCHA 5BPMA 4CJSA 1ZXOA 3SUQA 1WSJA 1NMNA 3CPWM 3ZETA 3NE6A 1RBVA 4FLXA 3FZMA 3I33A 4RG8A 4H5WA 5CHIA 5ADXH 3IG1A 1BCMA 4WQ5C 5K14A 1BWFO 4YFUA 1K6YA 2HMIA 4AM6A 3SNNA 1ITGA 1JLQA 1NGFA 3HSCA 3A5LC 4BRGA 1BQNA 1Q86O 2VQEK 1RDDA 4CBWA 1HMVA 3TAGA 3ZETB 4BRHA 3DXMA 5LL6Z 1GLLO 2ZWHA 3AVMA 3HTVA 3SQ1A 4CHZA 3EE9A 5BN9A 2P5OA 4M7YA 4H8KA 3ATUA 3OS0A 2G8KA 3K2PA 4CEEA 3FR0A 4FK2A 4DLGA 5SWMA 3SV4A 3F2KA 3P5JA 4FOIA 3M3ZA 4B9SA 5GAHP 3AVCA 4WFNL 1C0MA 1W0HA 4JAXA 2QM1A 3HO1A 4DUYK 1BDGA 4A57A 2UUBK 2JWLA 4FWRA 1S22A 2RPIA 3DXMB 1NJIO 3DXKB 3KHYA 2RKIA 2WUSA 4IOCL 3BF3A 3ZT0A 2HBMA 4CF9A 3HPGA 1XUPO 2A41A 2W40A 5C25A 3CQ8A 3AA2A 1HYSA 4LFBK 2AP1A 4CFCA 2G8WA 3M6GA 4CJEA 2E2PA 1KVBA 3P4IA 1RT4A 4Y0WA 3QLHA 1WB9A 1QQMA 1BU6O 4IOXA 1HUXA 1J6ZA 1RGIA 1VHXA 4DV1K 2GUPA 3WXMB 3KKRA 1D9FA 1YT3A 4DTSA 1SQKA 3U9DA 3FGUA 2JGUA 4DQQA 1A5XA 2VGMA 1QSLA 3HVTA 2E6LA 1GOAA 2VWJA 1I94K 2E2NA 2BGGA 3O3GA 5KRTA 4CZLA 3C95A 1KLMA 3JS6A 3B6PA 1YHQN 3T1YK 4FJXA 1ASWA 3A5OC 3V9SA 4PL8A 3EN9A 1NM1A 1WLJA 4CIEA 1P90A 1TUUA 3OS1A 5BREA 3OA9A 1UA0A 4ISEA 3ZSXA 3QEIA 3SUNA 3H3NO 4F3TA 2VWBA 3LAMA 3TU5A 4CJRA 1B9FA 3O8MA 5AFUA 4FVUA 4JKGA 1K9MO 4ILHA 4BWJA 3AAPA 2QWLA 4CJ7A 3OYBA 5FRNA 5AR0A 1XWLA 3FFKB 4DR1K 5MLCQ 3O4QA 4DFKA 3OBYA 1NMDA 4H0XB 4KB1A 2E1YA 4B9LA 2E4LA 1QTMA 2UXBK 1Q9XA 3THWA 1U2VA 4CFBA 3T1HK 4HVJA 2O8DA 1ASUA 1FKOA 3MXIA 2VWKA 4B1XB 5M1QA 4JKGB 4RW4A 1NNEA 1KC8O 3ASMA 1QZ6A 3KLHA 3O3HA 5C15A 3HOSA 3FLCO 4TSXA 1YUWA 3E66A 1JCGA 4NCGA 4GV3A 4DF8A 3AVKA 4ELTA 4M3ZA 4RTFD 3SUPA 4GVMA 3ULEA 3THWB 4DQIA 2D0BA 1U2VB 4M3RA 4L8RB 3O9SA 3OJSA 4HHTA 1MA9B 3C0BA 1NGGA 3S3OA 1KAYA 5JVHL 4KFBA 4JI5K 4B9TA 4DV7K 1YTUA 4FM1A 4DQPA 5BPNA 1DGKN 4FCYA 2FBVA 4A2AA 1SUQA 2QKKA 2A1RA 3VGKA 4NXNK 5HBMA 4AH9A 3WNFA 4BG9A 3FE1A 3S3MA 3VA3A 4FLWA 2ZD1A 3R6MA 3FZHA 4IOAL 1HPZA 4NXMK 3ULEB 3NVKA 1REVA 4BRNA 3LAKA 2A42A 3OJUA 3AO4A 3C6TA 4QCLA 5AQOA 1RNHA 3DMJA 4M3XA 1RILA 1D4XA 3IUCA 3K5OA 3CCLN 1RDCA 4JV5K 2HNYA 3LP2A 4IO8A 3CMAN 1BIZA 2BDPA 4ELVA 1BA0A 3ZSYA 1JCFA 1KSPA 2V51B 5BR8K 3H45C 1X9SA 4CEOA 2IVPA 4B3MK 3OYNA 2VQFK 2Z1JA 1XC9A 1JXBA 4B8CA 1CZAN 3LP3A 1E3MA 3THYA 4MDBA 2F8TA 4BDPA 3VESA 5ELZA 1TAUA 5AQQA 4EP5A 3D6RA 1LWCA 4IDHA 3SMPA 3CCUN 4NO7A 2OYQA 1RBRA 3EE8A 4CBXA 1SAZA 3AA4A 3QBXA 4CGIA 4JS4A 1NK9A 4FWSA 3IKMA 3VQ7A 4KBOA 3VQ8A 4DSEA 5AZIA 2YNHA 1CZ9A 4DF4A 3RSEB 2XY5A 3DM2A 3VPZA 1C0UA 4FSVA 4YOTA 4DUZK 3V6DA 4BDZA 2VYPA 3KVGA 3THYB
chains in the Genus database with same CATH topology
3V4IA 1C6VA 2B6AA 4JRQA 3DI6A 3VQEA 1R0AA 3ZT2A 3HM9A 1NKCA 2QXFA 3M8RA 4CEBA 4FLTA 4B9UA 2OZSA 4NYNA 4CJKA 1RT3A 5J2PA 1G15A 3AVAA 5FROA 3MEDA 1NOZA 3V9WA 1C0TA 1J54A 3KKSA 3CM6A 1VSMA 4QAGA 4CJ3A 4CIGA 4DG1A 3AA5X 4C8MA 1IG9A 1TL1A 3ZT1A 4RW8A 1KVCA 3AV9A 4AHCA 4CGFA 3SQ2A 1A5VA 4DMNA 4HCBA 1TVRA 4ICLA 2KZMA 4ZTFA 4KHWA 4O4GA 1L3SA 1JLGA 2QK9A 2YNIA 1IKVA 3I0RA 3DLGA 4BE2A 5HROA 4DSFA 2Y1IA 1JKHA 4AILC 4CECA 1I39A 3WNEA 4HUEA 4CJLA 1Z25A 4JS5A 1ZBIA 3HJFA 1IKXA 3MEGA 2P5GA 4B08A 5J2NA 1X1PA 1S1WA 3JYTA 1LW0A 3NGIA 4BACA 3DLBA 3TANA 3KJVA 3OS2A 1GOBA 1LAVA 2YKMA 1ZBHA 2KZZA 2DY4A 4O44A 1L3TA 4Z4FA 1S5JA 1QE1A 3A2FA 3D0PA 1EETA 4KKOA 3OYDA 3M8SA 1FXXA 4E7IA 5HP1A 3TAQA 1FK9A 4M45A 1HQUA 1VSEA 2GV9A 3LANA 4CGJA 4E1MA 3PO5A 4CFAA 1L3UA 1BQMA 3RTVA 1U04A 1KFDA 2RF2A 3L2WA 3L2VA 3DLRA 1C1AA 2XY8A 3MXJA 4BE0A 1X9MA 3ZSZA 4NYFA 4B9NA 4LSLA 3B6OA 2FBYA 2P51A 3TI0A 1U45A 2HNDA 1HQEA 1KVAA 1CLQA 1KFSA 1JL1A 4E19A 4Q5VA 4FLVA 3NH1A 3HSTB 4IG3A 4EZ9A 3U6FA 4KTQA 4FK0A 3K5LA 3TARA 4DTMA 4RW7A 3OYCA 3EYZA 1BI4A 3VQQA 3OYLA 3NF8A 3VQCA 4FXDA 3SCXA 1SKWA 3G10A 4KI6A 4HCCA 3ALYA 3LP1A 4RW9A 4BDYA 1SL0A 4DFPA 1NK4A 5KTQA 4N41A 3S3NA 3VQ4A 3CM5A 4F2SA 2OPQA 1VSLA 4FW1A 2LSNA 5HRSA 3QO9A 4CEFA 1KLNA 4KAZA 4LH4A 2R7YA 3MEEA 1LV5A 4DTOA 4CHOA 3AO1A 1D5AA 4DQSA 4FK4A 1BISA 2O4GA 4O55A 4OKEA 3DOLA 3P1GA 5KI6A 4AHSA 3SYZA 3RR8A 4W5OA 3QERA 2IOCA 1S6QA 3RRHA 1WAJA 3VQPA 2IAJA 4K8XA 4M3WA 1Q8IA 2OZMA 2HHVA 3HVRA 3DRRA 3ZSQA 3DRPA 4HTUA 4DU1A 4C8KA 1UAXA 4KI4A 1ZBFA 1U4BA 3RMCA 3AVFA 4DFJA 4J2AA 2O4IA 1S1TA 4NCAA 3DLHA 3NF6A 4E7KA 1BI4B 1RT6A 3AVJA 4F4KA 1JLBA 3ZT3A 4DTRA 1WSHA 2Y1JA 1XHXA 3WNGA 3AVNA 2OPRA 3CYMA 4E89A 3RMDA 1U49A 1TGOA 1BHLA 5JS2A 4CJTA 3OY9A 4CEDA 1S9EA 1S1XA 1CXQA 3LWMA 4DFMA 3L2QA 2JLEA 2XHBA 3OYIA 3QETA 1S9GA 1KTQA 1RTDA 3VQ9A 1TK5A 2HHQA 1WSIA 2YKNA 4DTNA 3U3YA 2VG7A 3L2RA 4K8ZA 4UQGA 2YHAA 5HLFA 2HVIA 2XRIA 3VQ6A 4CJQA 4I7FA 4KPYA 4CCHA 1LW2A 2B4JA 3IRXA 4CJWA 5FDLA 4CJ4A 2PYJA 3VA0A 3AVGA 4CJSA 4IKFA 3ZSVA 2F96A 3SUQA 4N47A 1Z26A 1WSJA 3T3FA 4FLUA 3TAPA 4FZYA 1JLAA 1SKRA 4KHSA 3M8QA 4KV8A 3VQBA 3FFIA 3NE6A 4KRFA 1RBVA 4FLXA 4Z4GA 2P1JA 1DTTA 3ZSWA 2BANA 2X6NA 2E6MA 4RG8A 1L3VA 2HVHA 4CJVA 2DTUA 1NK5A 4CF8A 4CHPA 3BGRA 3PV8A 3HPHA 3OYJA 3IG1A 4M3YA 4HUFA 2HHXA 4W5TA 1T05A 4DTPA 4CK2A 1BCMA 3SI6A 1J53A 3TWHA 3RMAA 1RTJA 5K14A 3AVBA 3ZCMA 4YFUA 1K6YA 2HMIA 3SNNA 4Z0UA 2IC3A 1QHTA 1ITGA 4OKKA 1JLQA 1QS4A 4DTJA 1JLEA 1WSEA 1T7PA 1BQNA 5I42A 1U47A 4DWIA 3H08A 3I8DA 3MAQA 3ZSRA 2OA8A 1LWEA 1GOCA 1RDDA 3PO4A 4J2DA 4G1QA 4FYDA 1JLFA 1HMVA 4M42A 4EZ6A 1BIUA 4CGGA 4I2PA 3TAGA 4CJ5A 1D8YA 1TV6A 1JL2A 1VSDA 1VSFA 3K5MA 1HRHA 4F3OA 2W42A 3QEWA 3NH2A 3QNNA 5JS1A 1HNIA 3ULDA 1VRTA 2HHUA 3SQ1A 3AVMA 4CHZA 4E7HA 2P5OA 1BL3A 4H8KA 4Z4CA 4DTUA 2KTQA 1WSFA 2HHTA 4DU4A 1SKSA 2DFHA 3SZ2A 4CEQA 3PX6A 4J2EA 2X74A 3OS0A 3L3VA 3CFPA 3K2PA 3ZSOA 4CEEA 3C6UA 1NKEA 2G8KA 2GUIA 3KLGA 4FK2A 1EXQA 3C94A 1LWFA 5SWMA 4DLGA 3SV4A 1NOYA 3P5JA 3KLFA 1RT7A 3CG7A 3DLKA 3V9UA 5J2QA 4B9VA 3SQ0A 2FC0A 3UIQA 4B9SA 4DS4A 3AVCA 5D3GA 1C0MA 1W0HA 4CE9A 1SL1A 4FJNA 3HO1A 4O5BA 3U3GA 1RBSA 2YNFA 4AHTA 4KHYA 1JXEA 4FJ5A 2HNZA 2GBZA 3HPOA 4FJGA 2DFEA 2RPIA 3KLIA 3QESA 2AJQA 4FJLA 3NFAA 4M3TA 3QINA 4XIUA 2RKIA 2PY5A 3ZT0A 1IO2A 4KTWA 4CF9A 2NUBA 3HPGA 3OYFA 4Y1DA 3RMBA 1TKTA 4J2BA 1S1VA 3KD1E 1VK0A 3LALA 1VSHA 3CFRA 5C25A 3KK2A 4KREA 1TL3A 1Q9YA 3CQ8A 2D0CA 3AA2A 4QOZB 2Z1GA 1HYSA 4PY5A 3KIOA 3S9HA 4CFCA 3NAEA 2G8WA 4CJEA 1I3AA 3V1QA 4E3SA 1KVBA 3V1RA 4R5PA 1TK0A 1RT4A 3K59A 4EP4A 1N6QA 3DOKA 3QLHA 4DSJA 4KB0A 2G8FA 4FZZA 2ETJA 4W5RA 1RTHA 4ID5A 3K58A 5J2MA 2G8UA 3OVNA 4RW6A 1ZBLA 4IFYA 3ZT4A 4W5NA 3KKRA 1D9FA 1YT3A 4DTSA 1TAQA 2XY7A 1NKBA 4DS5A 4CF1A 2KW4A 4CEAA 2JGUA 2YHBA 4DQQA 1A5XA 3O3FA 3QEVA 4C8NA 4FJKA 4N76A 3NGZA 1RDAA 2D0AA 1RT2A 4LSNA 5HRRA 1QSLA 1ZYQA 3MECA 1F21A 3HVTA 1VSIA 3NBPA 3BDPA 4FLZA 2E6LA 1GOAA 1VRUA 3DYAA 5KRSA 1NK6A 3ISNC 5CZ1A 2VWJA 1IKWA 2BGGA 3AO2A 3T1AA 1KRPA 1L5UA 3O3GA 5KRTA 3K5NA 3C95A 1U48A 1KLMA 4CHNA 4E0DA 3HT3A 3D45A 1VSKA 1RDBA 2RN2A 3B6PA 4MQ3A 4PWDA 3THVA 3OYMA 1YTAA 4FJXA 4PQUA 1RTIA 2Z1HA 4B9MA 4FJIA 4O0IA 1ASWA 3QIOA 3PX4A 3V9SA 2WOMA 1WLJA 4AHVA 4CIEA 3NH0A 2X6SA 3OS1A 3RWUA 4NCBA 3KK3A 2X78A 1UA0A 4DLEA 4OJRA 1T8EA 3PY8A 3ZSXA 3QEIA 3SUNA 1J5OA 2EX3A 3HK2A 4F3TA 4Y1CA 4FM2A 3LAMA 3AO5A 3EY1A 4CJUA 4CK1A 1W9HA 4CK3A 1B9FA 1RBUA 4CJRA 4FLYA 3SUOA 3HP9A 4ZTJA 2YV0X 1LAWA 3AVHA 5E41A 3V81A 3TAEA 1NK7A 4HUGA 4BWJA 2OPPA 3V9XA 2OPSA 3QNOA 3OYBA 5FRNA 5HRPA 3VQDA 1XWLA 2FBTA 3NCIA 2VG6A 1HYVA 3O4QA 4DFKA 2XY6A 3QEPA 2HHSA 1FKPA 4GMJB 4KB1A 2ZE2A 4B9LA 2E4LA 4I2QA 1QTMA 1HYZA 4CGDA 2B5JA 4CF2A 4E7JA 1Q9XA 3KTQA 3ITHA 4LD0A 2YNGA 3L8BA 2HHWA 4CFBA 4CHYA 1C1CA 3VQ5A 3V1OA 3LWLA 1QSSA 1S1UA 1X9WA 1NJXA 2KFNA 1EX4A 2XO7A 3T19A 4HVJA 3JSMA 1NK8A 1J9AA 4YNQA 1ASUA 4CIFA 1FKOA 3HYFA 3MXIA 1KCFA 2VWKA 5C24A 1N5YA 3IS9A 1XHZA 1TK8A 4FJJA 3LPUA 3KD5E 1NK0A 1DLOA 4RW4A 1TKDA 1EKEA 2QKBA 3LPTA 5CYMA 1BGXT 3HP6A 4OKJA 1ZBUA 3SPYA 3VN5A 3ASMA 3KLHA 4GW6A 4AHRA 3O3HA 3KLEA 2Q3SA 3L2UA 4DQRA 4F8RA 4W5QA 3PX0A 4Z4EA 4TSXA 2WONA 4NCGA 3WNHA 3RR7A 1C1BA 2A1SA 4B8AB 1BCOA 3AVKA 4N56A 4DF8A 4ELTA 4M3ZA 4CGHA 2I5JA 3TAMA 3EZ5A 1WAFA 3SUPA 3OYGA 1UA1A 3RRGA 4GVMA 2ZQBA 4DQIA 2D0BA 4DSLA 2BE2A 4M3RA 3DLEA 3OYAA 1QSYA 2KQ2A 4L8RB 3KK1A 3OJSA 5KGXA 1RT5A 4HHTA 1XI1A 3S3OA 5CYQA 5T7BA 4FJ8A 2IS3A 4KHNA 4E1NA 5EU7A 4FJ7A 4BWMA 2G8IA 4JLHA 2VG5A 1DTQA 4FJHA 1TKXA 4KFBA 4H4MA 4OPJA 4C8LA 4B9TA 4ELUA 1YTUA 4FM1A 4DQPA 4OGCA 4FCYA 3OYKA 2ATQA 2FBVA 3NF9A 4CJPA 3LZIA 4DU3A 3QEXA 4FZXC 1D9DA 1SUQA 2QKKA 2A1RA 3SV3A 1B92A 1NJWA 3F9KA 5HBMA 4AH9A 4BE1A 3WNFA 1SL2A 1WN7A 3SJJA 3S3MA 4FVMA 1IH7A 5DK5A 3NDKA 2ITGA 4FLWA 3VA3A 3G0ZA 1S6PA 2ZD1A 3HL8A 4IDKA 2PYLA 4MFBA 1HPZA 1UOCA 4ZHRA 1REVA 3E01A 1T03A 2DFFA 3LAKA 3TR8A 5KGWA 4O0JA 3OJUA 1HNVA 4DTXA 1VSJA 3AO4A 3NHGA 4I9LA 4OGEA 4FJMA 3PUFA 3AA3A 1WSGA 4H4OA 4AHUA 3C6TA 4QCLA 1RNHA 3DMJA 2HB5A 1B9DA 4KHQA 2G8HA 1TKZA 4FJ9A 4M3XA 5HRNA 1RILA 4CESA 3LP0A 5CZ2A 4B3OA 4CERA 3K5OA 1RDCA 1NJZA 2IDOA 2HNYA 3LP2A 4FW2A 4LH5A 2G8VA 4ID1A 4M3UA 1IKYA 4FM0A 3I0SA 4Z4IA 5J1EA 4OLAA 1BIZA 2BDPA 3NGYA 3AVIA 4ELVA 3M8PA 4DSIA 4OVLA 3ZSYA 4Z4HA 1KSPA 3TABA 1SV5A 4I9QA 4N5SA 2PZSA 1WNSA 1X9SA 2KFZA 1RBTA 4CEOA 4KO0A 1EP4A 3K57A 4F2RA 1RCHA 3HXMA 3OYNA 2Z1JA 2FBXA 4OPKA 1JXBA 3TAFA 1XC9A 4B8CA 3LP3A 4WE1A 3O4NA 1NJYA 3AVLA 2F8TA 2HW3A 3OYHA 4BDPA 1O1WA 4CFDA 1TAUA 1CZBA 1YVUA 3QIPA 4EP5A 4JRPA 3CFOA 4PUOA 3L3UA 4CEZA 5C42A 1QQCA 5SZTA 5FRMA 1LWCA 2F8SA 5DMRA 1UWBA 1MU2A 4IG0A 4M41A 2OYQA 1JLCA 1RBRA 1Y97A 3V9ZA 4Q0BA 3SQ4A 4OLBA 4CJFA 4IBNA 1CXUA 1HJRA 3AA4A 4LY7A 3SPZA 2D5RA 3IAYA 4CGIA 3F73A 3AO3A 4JS4A 5I3UA 1NK9A 4KHUA 4CHQA 4IFVA 1ASVA 4KTZA 3NF7A 4C8OA 3MXMA 3VQ7A 1RT1A 5CY4A 3LDSA 3VQ8A 4CF0A 3LZJA 4DSEA 3VQAA 2EHGA 4E7LA 2YNHA 1CZ9A 3OYEA 4DF4A 2XY5A 3DM2A 3DRSA 1C0UA 4PA1A 1A5WA 2Z1IA 4BDZA 3V6DA 2IGIA 3P83D 4DSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4I A;  1C6V A;  2B6A A;  4JRQ A;  3DI6 A;  3VQE A;  1R0A A;  3ZT2 A;  3HM9 A;  1NKC A;  2QXF A;  3M8R A;  4CEB A;  4FLT A;  4B9U A;  2OZS A;  4NYN A;  4CJK A;  1RT3 A;  5J2P A;  1G15 A;  3AVA A;  5FRO A;  3MED A;  1NOZ A;  3V9W A;  1C0T A;  1J54 A;  3KKS A;  3CM6 A;  1VSM A;  4QAG A;  4CJ3 A;  4CIG A;  4DG1 A;  3AA5 X;  4C8M A;  1IG9 A;  1TL1 A;  3ZT1 A;  4RW8 A;  1KVC A;  3AV9 A;  4AHC A;  4CGF A;  3SQ2 A;  1A5V A;  4DMN A;  4HCB A;  1TVR A;  4ICL A;  2KZM A;  4ZTF A;  4KHW A;  4O4G A;  1L3S A;  1JLG A;  2QK9 A;  2YNI A;  1IKV A;  3I0R A;  3DLG A;  4BE2 A;  5HRO A;  4DSF A;  2Y1I A;  1JKH A;  4AIL C;  4CEC A;  1I39 A;  3WNE A;  4HUE A;  4CJL A;  1Z25 A;  4JS5 A;  1ZBI A;  3HJF A;  1IKX A;  3MEG A;  2P5G A;  4B08 A;  5J2N A;  1X1P A;  1S1W A;  3JYT A;  1LW0 A;  3NGI A;  4BAC A;  3DLB A;  3TAN A;  3KJV A;  3OS2 A;  1GOB A;  1LAV A;  2YKM A;  1ZBH A;  2KZZ A;  2DY4 A;  4O44 A;  1L3T A;  4Z4F A;  1S5J A;  1QE1 A;  3A2F A;  3D0P A;  1EET A;  4KKO A;  3OYD A;  3M8S A;  1FXX A;  4E7I A;  5HP1 A;  3TAQ A;  1FK9 A;  4M45 A;  1HQU A;  1VSE A;  2GV9 A;  3LAN A;  4CGJ A;  4E1M A;  3PO5 A;  4CFA A;  1L3U A;  1BQM A;  3RTV A;  1U04 A;  1KFD A;  2RF2 A;  3L2W A;  3L2V A;  3DLR A;  1C1A A;  2XY8 A;  3MXJ A;  4BE0 A;  1X9M A;  3ZSZ A;  4NYF A;  4B9N A;  4LSL A;  3B6O A;  2FBY A;  2P51 A;  3TI0 A;  1U45 A;  2HND A;  1HQE A;  1KVA A;  1CLQ A;  1KFS A;  1JL1 A;  4E19 A;  4Q5V A;  4FLV A;  3NH1 A;  3HST B;  4IG3 A;  4EZ9 A;  3U6F A;  4KTQ A;  4FK0 A;  3K5L A;  3TAR A;  4DTM A;  4RW7 A;  3OYC A;  3EYZ A;  1BI4 A;  3VQQ A;  3OYL A;  3NF8 A;  3VQC A;  4FXD A;  3SCX A;  1SKW A;  3G10 A;  4KI6 A;  4HCC A;  3ALY A;  3LP1 A;  4RW9 A;  4BDY A;  1SL0 A;  4DFP A;  1NK4 A;  5KTQ A;  4N41 A;  3S3N A;  3VQ4 A;  3CM5 A;  4F2S A;  2OPQ A;  1VSL A;  4FW1 A;  2LSN A;  5HRS A;  3QO9 A;  4CEF A;  1KLN A;  4KAZ A;  4LH4 A;  2R7Y A;  3MEE A;  1LV5 A;  4DTO A;  4CHO A;  3AO1 A;  1D5A A;  4DQS A;  4FK4 A;  1BIS A;  2O4G A;  4O55 A;  4OKE A;  3DOL A;  3P1G A;  5KI6 A;  4AHS A;  3SYZ A;  3RR8 A;  4W5O A;  3QER A;  2IOC A;  1S6Q A;  3RRH A;  1WAJ A;  3VQP A;  2IAJ A;  4K8X A;  4M3W A;  1Q8I A;  2OZM A;  2HHV A;  3HVR A;  3DRR A;  3ZSQ A;  3DRP A;  4HTU A;  4DU1 A;  4C8K A;  1UAX A;  4KI4 A;  1ZBF A;  1U4B A;  3RMC A;  3AVF A;  4DFJ A;  4J2A A;  2O4I A;  1S1T A;  4NCA A;  3DLH A;  3NF6 A;  4E7K A;  1BI4 B;  1RT6 A;  3AVJ A;  4F4K A;  1JLB A;  3ZT3 A;  4DTR A;  1WSH A;  2Y1J A;  1XHX A;  3WNG A;  3AVN A;  2OPR A;  3CYM A;  4E89 A;  3RMD A;  1U49 A;  1TGO A;  1BHL A;  5JS2 A;  4CJT A;  3OY9 A;  4CED A;  1S9E A;  1S1X A;  1CXQ A;  3LWM A;  4DFM A;  3L2Q A;  2JLE A;  2XHB A;  3OYI A;  3QET A;  1S9G A;  1KTQ A;  1RTD A;  3VQ9 A;  1TK5 A;  2HHQ A;  1WSI A;  2YKN A;  4DTN A;  3U3Y A;  2VG7 A;  3L2R A;  4K8Z A;  4UQG A;  2YHA A;  5HLF A;  2HVI A;  2XRI A;  3VQ6 A;  4CJQ A;  4I7F A;  4KPY A;  4CCH A;  1LW2 A;  2B4J A;  3IRX A;  4CJW A;  5FDL A;  4CJ4 A;  2PYJ A;  3VA0 A;  3AVG A;  4CJS A;  4IKF A;  3ZSV A;  2F96 A;  3SUQ A;  4N47 A;  1Z26 A;  1WSJ A;  3T3F A;  4FLU A;  3TAP A;  4FZY A;  1JLA A;  1SKR A;  4KHS A;  3M8Q A;  4KV8 A;  3VQB A;  3FFI A;  3NE6 A;  4KRF A;  1RBV A;  4FLX A;  4Z4G A;  2P1J A;  1DTT A;  3ZSW A;  2BAN A;  2X6N A;  2E6M A;  4RG8 A;  1L3V A;  2HVH A;  4CJV A;  2DTU A;  1NK5 A;  4CF8 A;  4CHP A;  3BGR A;  3PV8 A;  3HPH A;  3OYJ A;  3IG1 A;  4M3Y A;  4HUF A;  2HHX A;  4W5T A;  1T05 A;  4DTP A;  4CK2 A;  1BCM A;  3SI6 A;  1J53 A;  3TWH A;  3RMA A;  1RTJ A;  5K14 A;  3AVB A;  3ZCM A;  4YFU A;  1K6Y A;  2HMI A;  3SNN A;  4Z0U A;  2IC3 A;  1QHT A;  1ITG A;  4OKK A;  1JLQ A;  1QS4 A;  4DTJ A;  1JLE A;  1WSE A;  1T7P A;  1BQN A;  5I42 A;  1U47 A;  4DWI A;  3H08 A;  3I8D A;  3MAQ A;  3ZSR A;  2OA8 A;  1LWE A;  1GOC A;  1RDD A;  3PO4 A;  4J2D A;  4G1Q A;  4FYD A;  1JLF A;  1HMV A;  4M42 A;  4EZ6 A;  1BIU A;  4CGG A;  4I2P A;  3TAG A;  4CJ5 A;  1D8Y A;  1TV6 A;  1JL2 A;  1VSD A;  1VSF A;  3K5M A;  1HRH A;  4F3O A;  2W42 A;  3QEW A;  3NH2 A;  3QNN A;  5JS1 A;  1HNI A;  3ULD A;  1VRT A;  2HHU A;  3SQ1 A;  3AVM A;  4CHZ A;  4E7H A;  2P5O A;  1BL3 A;  4H8K A;  4Z4C A;  4DTU A;  2KTQ A;  1WSF A;  2HHT A;  4DU4 A;  1SKS A;  2DFH A;  3SZ2 A;  4CEQ A;  3PX6 A;  4J2E A;  2X74 A;  3OS0 A;  3L3V A;  3CFP A;  3K2P A;  3ZSO A;  4CEE A;  3C6U A;  1NKE A;  2G8K A;  2GUI A;  3KLG A;  4FK2 A;  1EXQ A;  3C94 A;  1LWF A;  5SWM A;  4DLG A;  3SV4 A;  1NOY A;  3P5J A;  3KLF A;  1RT7 A;  3CG7 A;  3DLK A;  3V9U A;  5J2Q A;  4B9V A;  3SQ0 A;  2FC0 A;  3UIQ A;  4B9S A;  4DS4 A;  3AVC A;  5D3G A;  1C0M A;  1W0H A;  4CE9 A;  1SL1 A;  4FJN A;  3HO1 A;  4O5B A;  3U3G A;  1RBS A;  2YNF A;  4AHT A;  4KHY A;  1JXE A;  4FJ5 A;  2HNZ A;  2GBZ A;  3HPO A;  4FJG A;  2DFE A;  2RPI A;  3KLI A;  3QES A;  2AJQ A;  4FJL A;  3NFA A;  4M3T A;  3QIN A;  4XIU A;  2RKI A;  2PY5 A;  3ZT0 A;  1IO2 A;  4KTW A;  4CF9 A;  2NUB A;  3HPG A;  3OYF A;  4Y1D A;  3RMB A;  1TKT A;  4J2B A;  1S1V A;  3KD1 E;  1VK0 A;  3LAL A;  1VSH A;  3CFR A;  5C25 A;  3KK2 A;  4KRE A;  1TL3 A;  1Q9Y A;  3CQ8 A;  2D0C A;  3AA2 A;  4QOZ B;  2Z1G A;  1HYS A;  4PY5 A;  3KIO A;  3S9H A;  4CFC A;  3NAE A;  2G8W A;  4CJE A;  1I3A A;  3V1Q A;  4E3S A;  1KVB A;  3V1R A;  4R5P A;  1TK0 A;  1RT4 A;  3K59 A;  4EP4 A;  1N6Q A;  3DOK A;  3QLH A;  4DSJ A;  4KB0 A;  2G8F A;  4FZZ A;  2ETJ A;  4W5R A;  1RTH A;  4ID5 A;  3K58 A;  5J2M A;  2G8U A;  3OVN A;  4RW6 A;  1ZBL A;  4IFY A;  3ZT4 A;  4W5N A;  3KKR A;  1D9F A;  1YT3 A;  4DTS A;  1TAQ A;  2XY7 A;  1NKB A;  4DS5 A;  4CF1 A;  2KW4 A;  4CEA A;  2JGU A;  2YHB A;  4DQQ A;  1A5X A;  3O3F A;  3QEV A;  4C8N A;  4FJK A;  4N76 A;  3NGZ A;  1RDA A;  2D0A A;  1RT2 A;  4LSN A;  5HRR A;  1QSL A;  1ZYQ A;  3MEC A;  1F21 A;  3HVT A;  1VSI A;  3NBP A;  3BDP A;  4FLZ A;  2E6L A;  1GOA A;  1VRU A;  3DYA A;  5KRS A;  1NK6 A;  3ISN C;  5CZ1 A;  2VWJ A;  1IKW A;  2BGG A;  3AO2 A;  3T1A A;  1KRP A;  1L5U A;  3O3G A;  5KRT A;  3K5N A;  3C95 A;  1U48 A;  1KLM A;  4CHN A;  4E0D A;  3HT3 A;  3D45 A;  1VSK A;  1RDB A;  2RN2 A;  3B6P A;  4MQ3 A;  4PWD A;  3THV A;  3OYM A;  1YTA A;  4FJX A;  4PQU A;  1RTI A;  2Z1H A;  4B9M A;  4FJI A;  4O0I A;  1ASW A;  3QIO A;  3PX4 A;  3V9S A;  2WOM A;  1WLJ A;  4AHV A;  4CIE A;  3NH0 A;  2X6S A;  3OS1 A;  3RWU A;  4NCB A;  3KK3 A;  2X78 A;  1UA0 A;  4DLE A;  4OJR A;  1T8E A;  3PY8 A;  3ZSX A;  3QEI A;  3SUN A;  1J5O A;  2EX3 A;  3HK2 A;  4F3T A;  4Y1C A;  4FM2 A;  3LAM A;  3AO5 A;  3EY1 A;  4CJU A;  4CK1 A;  1W9H A;  4CK3 A;  1B9F A;  1RBU A;  4CJR A;  4FLY A;  3SUO A;  3HP9 A;  4ZTJ A;  2YV0 X;  1LAW A;  3AVH A;  5E41 A;  3V81 A;  3TAE A;  1NK7 A;  4HUG A;  4BWJ A;  2OPP A;  3V9X A;  2OPS A;  3QNO A;  3OYB A;  5FRN A;  5HRP A;  3VQD A;  1XWL A;  2FBT A;  3NCI A;  2VG6 A;  1HYV A;  3O4Q A;  4DFK A;  2XY6 A;  3QEP A;  2HHS A;  1FKP A;  4GMJ B;  4KB1 A;  2ZE2 A;  4B9L A;  2E4L A;  4I2Q A;  1QTM A;  1HYZ A;  4CGD A;  2B5J A;  4CF2 A;  4E7J A;  1Q9X A;  3KTQ A;  3ITH A;  4LD0 A;  2YNG A;  3L8B A;  2HHW A;  4CFB A;  4CHY A;  1C1C A;  3VQ5 A;  3V1O A;  3LWL A;  1QSS A;  1S1U A;  1X9W A;  1NJX A;  2KFN A;  1EX4 A;  2XO7 A;  3T19 A;  4HVJ A;  3JSM A;  1NK8 A;  1J9A A;  4YNQ A;  1ASU A;  4CIF A;  1FKO A;  3HYF A;  3MXI A;  1KCF A;  2VWK A;  5C24 A;  1N5Y A;  3IS9 A;  1XHZ A;  1TK8 A;  4FJJ A;  3LPU A;  3KD5 E;  1NK0 A;  1DLO A;  4RW4 A;  1TKD A;  1EKE A;  2QKB A;  3LPT A;  5CYM A;  1BGX T;  3HP6 A;  4OKJ A;  1ZBU A;  3SPY A;  3VN5 A;  3ASM A;  3KLH A;  4GW6 A;  4AHR A;  3O3H A;  3KLE A;  2Q3S A;  3L2U A;  4DQR A;  4F8R A;  4W5Q A;  3PX0 A;  4Z4E A;  4TSX A;  2WON A;  4NCG A;  3WNH A;  3RR7 A;  1C1B A;  2A1S A;  4B8A B;  1BCO A;  3AVK A;  4N56 A;  4DF8 A;  4ELT A;  4M3Z A;  4CGH A;  2I5J A;  3TAM A;  3EZ5 A;  1WAF A;  3SUP A;  3OYG A;  1UA1 A;  3RRG A;  4GVM A;  2ZQB A;  4DQI A;  2D0B A;  4DSL A;  2BE2 A;  4M3R A;  3DLE A;  3OYA A;  1QSY A;  2KQ2 A;  4L8R B;  3KK1 A;  3OJS A;  5KGX A;  1RT5 A;  4HHT A;  1XI1 A;  3S3O A;  5CYQ A;  5T7B A;  4FJ8 A;  2IS3 A;  4KHN A;  4E1N A;  5EU7 A;  4FJ7 A;  4BWM A;  2G8I A;  4JLH A;  2VG5 A;  1DTQ A;  4FJH A;  1TKX A;  4KFB A;  4H4M A;  4OPJ A;  4C8L A;  4B9T A;  4ELU A;  1YTU A;  4FM1 A;  4DQP A;  4OGC A;  4FCY A;  3OYK A;  2ATQ A;  2FBV A;  3NF9 A;  4CJP A;  3LZI A;  4DU3 A;  3QEX A;  4FZX C;  1D9D A;  1SUQ A;  2QKK A;  2A1R A;  3SV3 A;  1B92 A;  1NJW A;  3F9K A;  5HBM A;  4AH9 A;  4BE1 A;  3WNF A;  1SL2 A;  1WN7 A;  3SJJ A;  3S3M A;  4FVM A;  1IH7 A;  5DK5 A;  3NDK A;  2ITG A;  4FLW A;  3VA3 A;  3G0Z A;  1S6P A;  2ZD1 A;  3HL8 A;  4IDK A;  2PYL A;  4MFB A;  1HPZ A;  1UOC A;  4ZHR A;  1REV A;  3E01 A;  1T03 A;  2DFF A;  3LAK A;  3TR8 A;  5KGW A;  4O0J A;  3OJU A;  1HNV A;  4DTX A;  1VSJ A;  3AO4 A;  3NHG A;  4I9L A;  4OGE A;  4FJM A;  3PUF A;  3AA3 A;  1WSG A;  4H4O A;  4AHU A;  3C6T A;  4QCL A;  1RNH A;  3DMJ A;  2HB5 A;  1B9D A;  4KHQ A;  2G8H A;  1TKZ A;  4FJ9 A;  4M3X A;  5HRN A;  1RIL A;  4CES A;  3LP0 A;  5CZ2 A;  4B3O A;  4CER A;  3K5O A;  1RDC A;  1NJZ A;  2IDO A;  2HNY A;  3LP2 A;  4FW2 A;  4LH5 A;  2G8V A;  4ID1 A;  4M3U A;  1IKY A;  4FM0 A;  3I0S A;  4Z4I A;  5J1E A;  4OLA A;  1BIZ A;  2BDP A;  3NGY A;  3AVI A;  4ELV A;  3M8P A;  4DSI A;  4OVL A;  3ZSY A;  4Z4H A;  1KSP A;  3TAB A;  1SV5 A;  4I9Q A;  4N5S A;  2PZS A;  1WNS A;  1X9S A;  2KFZ A;  1RBT A;  4CEO A;  4KO0 A;  1EP4 A;  3K57 A;  4F2R A;  1RCH A;  3HXM A;  3OYN A;  2Z1J A;  2FBX A;  4OPK A;  1JXB A;  3TAF A;  1XC9 A;  4B8C A;  3LP3 A;  4WE1 A;  3O4N A;  1NJY A;  3AVL A;  2F8T A;  2HW3 A;  3OYH A;  4BDP A;  1O1W A;  4CFD A;  1TAU A;  1CZB A;  1YVU A;  3QIP A;  4EP5 A;  4JRP A;  3CFO A;  4PUO A;  3L3U A;  4CEZ A;  5C42 A;  1QQC A;  5SZT A;  5FRM A;  1LWC A;  2F8S A;  5DMR A;  1UWB A;  1MU2 A;  4IG0 A;  4M41 A;  2OYQ A;  1JLC A;  1RBR A;  1Y97 A;  3V9Z A;  4Q0B A;  3SQ4 A;  4OLB A;  4CJF A;  4IBN A;  1CXU A;  1HJR A;  3AA4 A;  4LY7 A;  3SPZ A;  2D5R A;  3IAY A;  4CGI A;  3F73 A;  3AO3 A;  4JS4 A;  5I3U A;  1NK9 A;  4KHU A;  4CHQ A;  4IFV A;  1ASV A;  4KTZ A;  3NF7 A;  4C8O A;  3MXM A;  3VQ7 A;  1RT1 A;  5CY4 A;  3LDS A;  3VQ8 A;  4CF0 A;  3LZJ A;  4DSE A;  3VQA A;  2EHG A;  4E7L A;  2YNH A;  1CZ9 A;  3OYE A;  4DF4 A;  2XY5 A;  3DM2 A;  3DRS A;  1C0U A;  4PA1 A;  1A5W A;  2Z1I A;  4BDZ A;  3V6D A;  2IGI A;  3P83 D;  4DSK A; 
#chains in the Genus database with same CATH topology
 3VQE A;  1IG8 A;  1R0A A;  3HM9 A;  1NKC A;  3M8R A;  1Z05 A;  3N4Q A;  2YHW A;  4KH6 A;  2OZS A;  3J7A P;  5DM6 L;  5FRO A;  2O8F A;  3V9W A;  2HHU A;  3CCV N;  1VSM A;  4QAG A;  4CIG A;  1IG9 A;  3ZT1 A;  4RW8 A;  1KVC A;  3AV9 A;  4JKB A;  3SQ2 A;  1TVR A;  4ICL A;  2YCH A;  4QS8 A;  2GWJ A;  1QVF M;  3ZX3 A;  4CBU A;  1JLG A;  1HKB A;  2NRT A;  2NNW A;  4IJA A;  4U7B A;  3A5N C;  4BE2 A;  2QK9 A;  5HRO A;  4CW7 B;  5AQJ A;  2OAN A;  3VEW A;  1ZBI A;  3AY9 A;  2P5G A;  3ZEU A;  4B08 A;  5J2N A;  3KWI A;  3NGI A;  3KJV A;  3OS2 A;  2YKM A;  1ZBH A;  4FPA A;  4O44 A;  1L3T A;  1S5J A;  3O9Q A;  3OYD A;  1FXX A;  3O5B A;  3NVM A;  5GIN A;  1FK9 A;  4M45 A;  1HQU A;  1VSE A;  2GV9 A;  4CGJ A;  2O8F B;  3AAR A;  3MMV A;  2FF3 B;  2RF2 A;  1X9M A;  2XY8 A;  4WF9 L;  4BE0 A;  4B9N A;  2NZT A;  3WXK A;  4LF8 K;  4A61 A;  5C0Y A;  5M1O A;  4Q5V A;  4FLV A;  3HST B;  4IG3 A;  4JK7 A;  1TYQ A;  3G6E N;  1HLU A;  3VQQ A;  3NF8 A;  3VQC A;  2ZF5 O;  3ZEU B;  4YY3 K;  4RW9 A;  4J8F A;  4F2S A;  2OPQ A;  2F7T A;  4FW1 A;  1KLN A;  1BIS A;  4AHS A;  3RRH A;  2OZM A;  5AQS A;  3CCJ N;  4C8K A;  4KI4 A;  5FPM A;  3AVF A;  2IVN A;  3AVJ A;  5BRD A;  2Y1J A;  3O6W A;  5JLH A;  3WNG A;  1JCE A;  4I6M A;  1TGO A;  2HF3 A;  5JS2 A;  3HRG A;  1X3N A;  1HKG A;  2XHB A;  3OYI A;  3QET A;  4MLH A;  1HKC A;  1S9G A;  3VQ9 A;  3U3Y A;  4K8Z A;  2HVI A;  2XRI A;  1Q82 O;  4OO1 J;  4A59 A;  1LW2 A;  4CJW A;  1IBK K;  4CJ4 A;  3HBT A;  2PYJ A;  3VA0 A;  4IZ9 A;  3AVG A;  4IKF A;  2ZM6 K;  4N47 A;  1Z26 A;  2A6A A;  5LJW A;  4KHS A;  2CGK A;  3FFI A;  3PIO L;  4KRF A;  4Z4G A;  2P1J A;  1DTT A;  2X6N A;  1XQS C;  4K42 A;  4I6M B;  1DT9 A;  1NK5 A;  5AFU H;  4CF8 A;  3CJB A;  3VMF B;  4JI7 K;  2HBK A;  2E1Z A;  3HPH A;  3OYJ A;  2CGJ A;  4HUF A;  4BRD A;  4W5T A;  1T05 A;  4DTP A;  4CK2 A;  3SI6 A;  4FWL A;  4EAH D;  3TWH A;  3TTF A;  2YJF A;  3AVB A;  3I8B A;  3ZCM A;  4X65 K;  4YOR A;  1E4F T;  2IC3 A;  4OKK A;  3SMS A;  1WSE A;  3L6Q A;  5EXW A;  3I8D A;  1LWE A;  4FYD A;  4CJ5 A;  1QVG M;  4IWV A;  1VSD A;  3K5M A;  1VSF A;  3NH2 A;  3QNN A;  5C12 A;  4LFA K;  3U9Z A;  4E7H A;  4GKJ K;  1BL3 A;  4Z4C A;  1WSF A;  3LDO A;  2QEX N;  5GAG P;  1NKE A;  3ZSO A;  3BEX A;  3W3D A;  3KLG A;  3C94 A;  1LWF A;  4BC4 A;  1BOT O;  1RT7 A;  5J2Q A;  4B9V A;  3UIQ A;  4DS4 A;  3SAG A;  2P9S A;  5E84 A;  3OTO K;  2F9W A;  3U3G A;  1RBS A;  3MN6 A;  3R9P A;  4AHT A;  4KHY A;  1JXE A;  5FPE A;  4JK9 A;  4FJ5 A;  1M90 O;  2GBZ A;  2DFE A;  2AJQ A;  3NFA A;  1QZ5 A;  3OYF A;  2CGL A;  4IXC A;  4Y1D A;  3RMB A;  1TKT A;  4J2B A;  4EHU A;  3LAL A;  3VEY A;  1TL3 A;  1Q9Y A;  2D0C A;  3H3O B;  2Z1G A;  3ZX2 A;  3S9H A;  5BN8 A;  3V1Q A;  2ZJR L;  4DSJ A;  4LF5 K;  4KB0 A;  4YOU A;  2ETJ A;  2HOE A;  2P9S B;  4ID5 A;  4WQ5 A;  3GOI A;  4CVN E;  2G8U A;  3OVN A;  4RCH A;  3ZT4 A;  4W5N A;  3WT0 A;  1TAQ A;  1NKB A;  5EY4 A;  4DS5 A;  4BRF A;  4KHP K;  1ATN A;  4LF7 K;  2V52 B;  1RDA A;  2D0A A;  4LSN A;  3F5T A;  1ZYQ A;  5JLF A;  1SS6 A;  4FLZ A;  3BDP A;  1VRU A;  1NK6 A;  5KRS A;  1M1K O;  4LF6 K;  4ISF A;  4B9Q A;  1YJ9 N;  3MN5 A;  1Z6R A;  4H0T B;  4CHN A;  1K8A O;  3HT3 A;  1S72 N;  1RDB A;  4MQ3 A;  4CZF A;  4PWD A;  1YIT N;  2IGI A;  1U6Z A;  3QIO A;  3PX4 A;  2H3G X;  3CQX A;  5AQM A;  4GV6 A;  2X6S A;  3WQU A;  1X9J A;  3VF6 A;  3PY8 A;  2EX3 A;  4CJU A;  4BVO A;  4CK1 A;  3J7Z O;  3HP9 A;  2YV0 X;  4FL9 A;  2A40 A;  3AVH A;  3TPQ A;  3TAE A;  4JEP A;  3QNO A;  4A62 A;  3VF4 A;  4JD2 A;  4B1U B;  2FXU A;  3NCI A;  2D0O A;  1N33 K;  2HHS A;  1Q7Y O;  4I2Q A;  4CGD A;  4E7J A;  4GNI A;  3SAH A;  2YNG A;  3L8B A;  2HHW A;  3ID6 A;  1NJX A;  1EX4 A;  3MN9 A;  3T19 A;  2XO7 A;  4CIF A;  3HYF A;  1KCF A;  2CH6 A;  3DXK A;  4OPA A;  3LPU A;  1DLO A;  2IIR A;  4YOX A;  4BY9 C;  4OKJ A;  5LMU K;  3SPY A;  4H5T A;  3KLE A;  3L2U A;  1VQP N;  4JD2 B;  1K8K A;  2W6L A;  5GAD P;  4Z4E A;  4BRE A;  1C1B A;  2A1S A;  4XEI A;  1VQ6 N;  1NGH A;  2BTF A;  4FWO A;  3OYG A;  1UA1 A;  2A3Z A;  2WTU A;  4DSL A;  3CI5 A;  1BA1 A;  2I7N A;  1NGD A;  1RT5 A;  1XI1 A;  4MLE A;  2Q2R A;  5CYQ A;  5T7B A;  4KHN A;  3S41 A;  3CC7 N;  4FJ7 A;  5B8H A;  3A5M C;  3MDQ A;  2NRV A;  3G4S N;  1TKX A;  1GLE G;  4FWM A;  3OYK A;  2ATQ A;  4CJP A;  2O8C A;  3UKR A;  1K8K B;  2HST A;  4DHY A;  3I55 N;  1IH7 A;  5DK5 A;  2ITG A;  2PYL A;  1S6P A;  4BR4 A;  1UOC A;  4DV0 K;  1T03 A;  2DFF A;  4O0J A;  1VAZ A;  1VSJ A;  4FJM A;  4H4O A;  3QB0 A;  3A8Y A;  3SBT A;  4AHU A;  2A5X A;  2HB5 A;  1B9D A;  1VQ4 N;  4CES A;  1G99 A;  3LP0 A;  4JKF A;  4B3O A;  4CER A;  3MCP A;  2ASP A;  1IKY A;  4FM0 A;  3I0S A;  4Z4I A;  4OLA A;  4OX9 K;  1HX1 A;  2O8C B;  4DKW A;  4DSI A;  4OVL A;  1TUY A;  3D2F A;  3UKR B;  3TAB A;  2PZS A;  2KFZ A;  1J5E K;  1RBT A;  4F2R A;  3THX A;  4IEI A;  1NJY A;  1HNW K;  1K73 O;  3QIP A;  3D2E A;  3WUH A;  4BRM A;  4JRP A;  4H5N A;  4CEZ A;  1QQC A;  3R3L A;  4IG0 A;  2D0P A;  3V9Z A;  4CJF A;  4IBN A;  1HJR A;  2GTD A;  4LY7 A;  3SPZ A;  2D5R A;  3F73 A;  3EKS A;  4M7X A;  1VQ9 N;  2QTD A;  3D2F B;  1OH6 A;  1RT1 A;  5CY4 A;  3LDS A;  3J8A A;  5AQH A;  2EHG A;  1NGE A;  3OYE A;  3F9M A;  4CI6 A;  3THX B;  4B3S K;  3DRS A;  4J2D A;  2NRW A;  3V4I A;  4PKG A;  2B6A A;  3D2E B;  2NRH A;  4CEB A;  4FLT A;  4B9U A;  4NYN A;  4CJK A;  1VQ7 N;  5J2P A;  1G15 A;  3ATV A;  5BRH A;  3MED A;  1NOZ A;  1C0T A;  1J54 A;  4B1Z A;  4CJ3 A;  2UUC K;  1ZC6 A;  3AA5 X;  4C8M A;  1TL1 A;  4NB4 A;  1VQL N;  3PLA A;  4DMN A;  1ATR A;  4KHW A;  2P9P A;  2FSK A;  3KWG A;  2Y1I A;  1HNZ K;  1I39 A;  3WNE A;  4HUE A;  4JS5 A;  1IKX A;  3GL1 A;  1S1W A;  3JYT A;  3ENH A;  1LW0 A;  3R8E A;  1LAV A;  2KZZ A;  4LFC K;  1QE1 A;  3TAR A;  1EET A;  1BG3 A;  1YXQ A;  1BQM A;  2WC9 A;  3VEO A;  3L2W A;  3L2V A;  3DLR A;  1Q81 O;  5BRF A;  4LSL A;  5AQF A;  2P51 A;  2HND A;  2F4V K;  1HQE A;  2P9P B;  4E19 A;  3C6H A;  3NH1 A;  1XNR K;  4GKK K;  5AQX A;  1DEJ A;  4DTM A;  3OYC A;  4HCC A;  3LP1 A;  1NK4 A;  3VQ4 A;  1NU0 A;  1VQK N;  2HHH K;  3H6E A;  5AQY A;  2LSN A;  5HRS A;  4JI2 K;  3AO1 A;  2O4G A;  4OKE A;  3DOL A;  5FPN A;  4H0O A;  3RR8 A;  4W5O A;  3AAQ A;  3QER A;  4K8X A;  5TKW A;  3VEN A;  3HVR A;  4HTU A;  4CZJ A;  1P8Z A;  2D1K A;  4DFJ A;  1MDU B;  2O4I A;  3RSE A;  3NF6 A;  4DR2 K;  1V4T A;  4Z94 A;  4F4K A;  3JAM O;  3O9U A;  5AQZ A;  1BHL A;  5M1K A;  4CJT A;  4JI3 K;  3OY9 A;  4CZG A;  4ILG B;  2ZJQ L;  3PSF A;  4QS9 A;  3L2Q A;  3GBT A;  1GLD G;  2HHQ A;  4DTN A;  2VG7 A;  5HLF A;  5EX5 A;  4CJQ A;  3IRX A;  5FDL A;  2E2Q A;  3O1B A;  1JJ2 M;  2Q36 A;  5FLX O;  3ZSV A;  2F96 A;  3LDQ A;  3T3F A;  4FLU A;  4K43 A;  3TAP A;  4FZY A;  1JLA A;  4DV6 K;  1SKR A;  3M8Q A;  1KAZ A;  3VQB A;  4ISG A;  3M5R A;  2O8B B;  2E6M A;  4JKA A;  3PV8 A;  4O8U A;  4M3Y A;  3IMX A;  3EZW A;  3CXC M;  1J53 A;  2Q0U A;  2W6K A;  1RTJ A;  3O1W A;  4EFH A;  1QHT A;  4DTJ A;  1U47 A;  4B1W B;  1GOC A;  3PO4 A;  5CR4 A;  4G1Q A;  4WFA L;  1JLF A;  4EZ6 A;  4JHD B;  4DR4 K;  1TV6 A;  2QWN A;  1JL2 A;  3UE5 A;  2W42 A;  3QEW A;  1HNI A;  3ULD A;  1VRT A;  3SK3 A;  1KXP A;  4JKC A;  4DTU A;  3CQY A;  1SKS A;  4CEQ A;  4J2E A;  1QQO A;  3LDN A;  3CFP A;  3L3V A;  3C6U A;  2QWQ A;  1EXQ A;  4A5A A;  3K0S A;  2ITM A;  1KD1 O;  2GEL A;  2YJE A;  1NOY A;  3O4W A;  5F1X A;  3CG7 A;  5AQR A;  2QWP A;  3SQ0 A;  5D3G A;  3CJ1 A;  4CE9 A;  2V7Z A;  1SL1 A;  3DJC A;  1NLV A;  3AGR A;  2GX9 A;  2YNF A;  1HR0 K;  1IBL K;  4EIA A;  5CE3 A;  2KHO A;  5A2Q O;  3CCM N;  4FJG A;  3QES A;  4FJL A;  4XIU A;  5AQK A;  4DR7 K;  3PSI A;  1IO2 A;  4KTW A;  3E9L A;  1EWR A;  4DR6 K;  1S1V A;  3KD1 E;  1VSH A;  1ILY A;  3NAE A;  1WBD A;  3V1R A;  3SJH A;  3K59 A;  4EP4 A;  3ZLJ A;  2G8F A;  1VQN N;  1NGA A;  5FPD A;  1ZBL A;  4RW6 A;  3RVC A;  2XY7 A;  2YHB A;  3QEV A;  5GIO A;  3O3F A;  4A2B A;  3L4Q A;  5HRR A;  1RT2 A;  3MEC A;  1F21 A;  3DYA A;  5M1F A;  3ISN C;  2OTL N;  5CZ1 A;  1T3V A;  3B8A X;  3T1A A;  1R59 O;  4FWK A;  1U48 A;  4E0D A;  2RN2 A;  1OVQ A;  1VQ8 N;  5BPL A;  3OYM A;  4PQU A;  1RTI A;  5I9E B;  4FJI A;  5AQT A;  1BUP A;  4O0I A;  2Q31 A;  3NH0 A;  3RWU A;  4NCB A;  3KK3 A;  2P9L B;  4GY2 B;  2X78 A;  1NGC A;  3SAF A;  4OJR A;  1T8E A;  5HP1 A;  3AO5 A;  3MX2 A;  2FSN A;  4ZTJ A;  4CK3 A;  1RBU A;  4FLY A;  2E8A A;  2UXC K;  4WCE L;  1LAW A;  1O13 A;  3QIC A;  3QFU A;  3V81 A;  1NK7 A;  4HUG A;  3V9X A;  3J81 O;  1NG9 A;  4BR5 A;  4YOY A;  4AM7 A;  1HYV A;  4MO4 A;  3BZC A;  3VER A;  3ENO A;  1HYZ A;  4CF2 A;  2B5J A;  3ITH A;  4FOE A;  4LD0 A;  4CHY A;  3VQ5 A;  3V1O A;  3TSQ A;  3LWL A;  1X9W A;  2KFN A;  1HJO A;  1J9A A;  3CCS N;  3O80 A;  4XH1 A;  3CER A;  1LCU A;  3KD5 E;  2RHK A;  3Q7B A;  1NBW A;  1TKD A;  4BR9 A;  2QKB A;  1ZBS A;  3VN5 A;  2PAV A;  4F8R A;  2Q3S A;  3U8X A;  4W5Q A;  2QWM A;  3I56 N;  3PX0 A;  3CCQ N;  4B8A B;  3A0I X;  1BCO A;  4N56 A;  3DLL L;  4DV3 K;  2I5J A;  3L0Q A;  4E1J A;  4BG8 A;  3VET A;  3RRG A;  5AQG A;  2ZQB A;  2BE2 A;  3DLE A;  2I7P A;  2KQ2 A;  4IO9 L;  3KK1 A;  1WUA A;  2F9T A;  2E88 A;  2QXL A;  4FJ8 A;  2IS3 A;  3T69 A;  2ZJP L;  5EU7 A;  4BWM A;  2G8I A;  4JLH A;  1DTQ A;  3UB5 A;  4DR5 K;  3LM2 A;  4GVE A;  4H4M A;  4ELU A;  3LZI A;  2KLA A;  4FZX C;  1D9D A;  1NJW A;  5IT9 O;  2GEM A;  3F9K A;  1WN7 A;  1YVN A;  3GE1 A;  4JI0 K;  2FSJ A;  3G0Z A;  4IDK A;  2O8E A;  5TKY A;  4ZHR A;  3TR8 A;  5KGW A;  4FK4 A;  3NHG A;  4I9L A;  3C6A A;  3PUF A;  3AA3 A;  1WSG A;  1OVY A;  4KHQ A;  2G8H A;  1TKZ A;  3CIP A;  4FJ9 A;  5HRN A;  3KZB A;  1OH7 A;  1NJZ A;  1HNX K;  2IDO A;  4LH5 A;  4FW2 A;  5J1E A;  3CJ9 A;  3NGY A;  3CD6 N;  2ASM A;  3M8P A;  1N32 K;  1BO5 O;  1SV5 A;  4N5S A;  3P38 A;  5KQ8 A;  5DM7 L;  1RCH A;  3HXM A;  2FBX A;  2O8E B;  4WE1 A;  3O4N A;  4F9O A;  4G9Z A;  1YJW N;  3AVL A;  1FW6 A;  2HW3 A;  3OYH A;  4H03 B;  2E2O A;  4H0P A;  4PUO A;  5SZT A;  5FRM A;  3BY5 A;  3HI0 A;  1UWB A;  1MU2 A;  1JLC A;  1Y97 A;  1CXU A;  5EOY A;  3CET A;  2WBN A;  3IAY A;  4KHU A;  3WXI A;  4CHQ A;  4IFV A;  4KTZ A;  3TTD A;  3NF7 A;  5AQW A;  4C8O A;  4DV2 K;  4CF0 A;  3VQA A;  2ASO A;  4E7L A;  4EHT A;  3LDL A;  4PA1 A;  2Z1I A;  3P83 D;  1NWK A;  1N36 K;  3OBW A;  1Y64 A;  4BR2 A;  4JRQ A;  1OH5 A;  2QXF A;  4XH4 A;  2BH1 A;  1XMO K;  3G25 A;  2FF6 A;  3D7E O;  4FWN A;  1DKG D;  3CCR N;  3KKS A;  3RMC A;  3CM6 A;  4DG1 A;  3ZYY X;  3QDK A;  1GLA G;  4OPH A;  4LF9 K;  4AHC A;  4L3Q A;  5IWA K;  4HCB A;  1RDW X;  4PL7 A;  1KQS M;  1XMQ K;  2YNI A;  1IKV A;  3I0R A;  3DLG A;  5M1N A;  5AQV A;  4DSF A;  3QML A;  4BC3 A;  4CZK A;  4CJL A;  4H5V A;  1X1P A;  4YHH K;  3BP8 A;  3TAN A;  5LMN K;  1LOT B;  4C23 A;  5F0X A;  4BGB A;  3MCA B;  2DY4 A;  2OTJ N;  4FO0 A;  4Z4F A;  3M8S A;  4E7I A;  3BUZ B;  3TAQ A;  4E1M A;  3PO5 A;  4CFA A;  1L3U A;  3VEZ A;  3MXJ A;  3MWT A;  1VQM N;  3B6O A;  2FBY A;  2HF4 A;  1U45 A;  4WYB A;  1QQN A;  1KVA A;  3E1Y A;  1W7A A;  1CLQ A;  1JL1 A;  4X64 K;  1WOQ A;  4EZ9 A;  3U6F A;  3EYZ A;  1BI4 A;  3OYL A;  4FXD A;  3SCX A;  1SKW A;  3ALY A;  4DFP A;  5KTQ A;  3CM5 A;  4XH5 A;  1VSL A;  4NLC A;  3QO9 A;  4KAZ A;  3MEE A;  1LV5 A;  3SBG A;  1D5A A;  4DQS A;  5KI6 A;  4IEE A;  4JKH A;  4H0V B;  2RE2 A;  5AQP A;  4M3W A;  1WAJ A;  3VQP A;  1Q8I A;  2HHV A;  3P39 A;  5KPZ A;  4DU1 A;  1U4B A;  3OHR A;  4J2A A;  3BZK A;  4NCA A;  3CC2 N;  4LC9 B;  1BI4 B;  3ID8 A;  1RT6 A;  4WQ4 A;  1S3X A;  3ZT3 A;  3P31 A;  4BQL A;  4DTR A;  1WSH A;  4E89 A;  3AVN A;  3CYM A;  2NRR A;  4AF1 A;  4BRA A;  1S9E A;  3C7N A;  4DFM A;  4FWQ A;  2JLE A;  2P9U A;  4BVP A;  2ZGZ A;  1EWQ A;  1WSI A;  2AA4 A;  2YKN A;  3L2R A;  2YHA A;  2B4J A;  3ZX0 A;  4BRP A;  4CD3 A;  4BC2 A;  3NMU A;  4RWT A;  3J80 O;  4KV8 A;  3LM9 A;  4K41 A;  3ZSW A;  2BAN A;  1L3V A;  2HVH A;  4CJV A;  2DTU A;  4CZI A;  4CHP A;  3BGR A;  2HBL A;  3E9O A;  1MWM A;  3C7N B;  2HHX A;  2P9U B;  2E5L K;  1IBM K;  3RMA A;  3VOV A;  1XC3 A;  1Q18 A;  2KKZ A;  3K9J A;  4Z0U A;  1QHA A;  1QS4 A;  4CZH A;  4WQ4 C;  1JLE A;  1T7P A;  4DWI A;  1VQO N;  3H08 A;  4QS7 A;  3MAQ A;  3ZSR A;  2OA8 A;  4KH5 A;  4O8K A;  4H5R A;  3CCE N;  3WQT A;  5AQU A;  5AQN A;  4M42 A;  1BIU A;  3LL3 A;  4I2P A;  4CGG A;  1D8Y A;  4K0K K;  4B3T K;  4F3O A;  1HRH A;  5JS1 A;  1ATS A;  2PFU A;  3GG4 A;  3K9K A;  5HL7 L;  2HHT A;  2KTQ A;  2NRZ A;  4DU4 A;  2DFH A;  3SZ2 A;  3PX6 A;  2X74 A;  1N8R O;  5LY3 A;  4PKI A;  3SLC A;  5LJV A;  2GUI A;  2YHX A;  3FZL A;  1EO1 A;  3UKU A;  1C0G A;  3ENB A;  3CC4 N;  3KLF A;  3IDH A;  3DLK A;  3N4P A;  3V9U A;  2FC0 A;  4FJN A;  4O5B A;  4U67 L;  3GDQ A;  2HNZ A;  2O8D B;  3HPO A;  3KLI A;  4M3T A;  1YAG A;  3QIN A;  2PY5 A;  2CH5 A;  4DV4 K;  2NUB A;  1VK0 A;  4B1V A;  3TTC A;  3CFR A;  2Q0R A;  1X3M A;  3KK2 A;  1YI2 N;  4BRC A;  4KRE A;  4QOZ B;  4PY5 A;  3KIO A;  1I3A A;  4E3S A;  4R5P A;  3UKU B;  1TK0 A;  1N6Q A;  3DOK A;  4PHT X;  1NGI A;  5JMV A;  1IJJ A;  4KH4 A;  4FZZ A;  4W5R A;  1RTH A;  1ESV A;  3K58 A;  5J2M A;  3O9R A;  4JK8 A;  4IFY A;  1OH8 A;  2W41 A;  4X62 K;  4MDA A;  4CF1 A;  2KW4 A;  4CEA A;  5KQD A;  4JKE A;  2O8B A;  4C8N A;  3VTI A;  4FJK A;  5H1S Q;  4N76 A;  3NGZ A;  3VF2 A;  5KPT A;  1VSI A;  3NBP A;  5JVG L;  4GV9 A;  1IKW A;  3AO2 A;  1KRP A;  1L5U A;  3QFP A;  4FWP A;  3K5N A;  3W0L A;  2V7Y A;  3D45 A;  1VSK A;  4MO5 A;  3THV A;  1YTA A;  3M1F A;  2Z1H A;  3T7Z A;  4B9M A;  4V19 S;  2WOM A;  3LDP A;  4AHV A;  3WEE A;  1XNQ K;  4BGA A;  4JHD A;  4H0Y B;  4CZM A;  4DLE A;  3MN7 A;  1J5O A;  4BRQ A;  4Y1C A;  4FM2 A;  3HK2 A;  3EY1 A;  1W9H A;  3SUO A;  5ADX A;  5E41 A;  2BUP A;  2GWK A;  2OPP A;  2OPS A;  5HRP A;  3VQD A;  2IVO A;  4YDU A;  4AQY K;  2FBT A;  3H46 O;  2VG6 A;  3FZF A;  2XY6 A;  3QEP A;  1FKP A;  3AGK A;  4GMJ B;  3HZ6 A;  2ZE2 A;  4BR0 A;  5M1P A;  4BRO A;  4JI8 K;  3O9T A;  3KTQ A;  3L4I A;  2HMP A;  3CPE A;  3WEE B;  1C1C A;  3CME N;  1QSS A;  1S1U A;  2E20 A;  2VCP A;  3JSM A;  1NK8 A;  4YNQ A;  4BQZ A;  1W2B M;  5C24 A;  1N5Y A;  3IS9 A;  1XHZ A;  1TK8 A;  4FJJ A;  1NK0 A;  2ZGY A;  4C1N I;  1EKE A;  3LPT A;  5CYM A;  1BGX T;  3HP6 A;  4DR3 K;  1ZBU A;  4GW6 A;  4AHR A;  4DQR A;  5F2R A;  1WBB A;  2P9I A;  5AZI B;  3DWL A;  3J7Y P;  2WON A;  3WNH A;  4C1N K;  3RR7 A;  4UY8 O;  5HOO A;  3CJ7 A;  4CGH A;  3TAM A;  3EZ5 A;  1WAF A;  1GLC G;  1T6D A;  1RFQ A;  4JI4 K;  5AJ3 K;  4IFE A;  2UXD K;  4IJN A;  3C65 A;  1QSY A;  3OYA A;  3VGM A;  5KGX A;  3U4L A;  3DAW A;  4E1N A;  2NRX A;  2VG5 A;  1KAX A;  3Q7C A;  3VGL A;  4FJH A;  4JKD A;  2VGN A;  4YDU C;  4C8L A;  4OPJ A;  3VTH A;  2JWK A;  4OGC A;  3NF9 A;  1N34 K;  2NLX A;  4DU3 A;  3QEX A;  1YF5 L;  3SV3 A;  1B92 A;  2P9I B;  4BE1 A;  1SL2 A;  3SJJ A;  4FVM A;  5KPR A;  3NDK A;  3HL8 A;  4MFB A;  3H1Q A;  3E01 A;  2UYT A;  2D4W A;  4DTX A;  1HNV A;  4OGE A;  2P9L A;  4YOV A;  4DCH A;  5CZ2 A;  4BRL A;  2YHY A;  4M3U A;  2G8V A;  3CJA A;  4ID1 A;  2QWO A;  3AVI A;  2QWR A;  4Z4H A;  4I9Q A;  1IV0 A;  5E26 A;  1WNS A;  2QI2 A;  4KO0 A;  1EP4 A;  1TYQ B;  2P9K A;  3WXL A;  2FLO A;  3K57 A;  4B3R K;  3TSU A;  4OPK A;  3TAF A;  2HBJ A;  3G71 N;  3QBW A;  1O1W A;  1W97 L;  4CFD A;  1CZB A;  1YVU A;  2QA4 N;  3CFO A;  3L3U A;  5C42 A;  3JXU A;  4K25 A;  4CD1 A;  2F8S A;  5DMR A;  4M41 A;  4Q0B A;  5EVZ A;  3SQ4 A;  5GAE P;  4OLB A;  4BRI A;  4CZE A;  4A5B A;  3HOT A;  5I3U A;  3AO3 A;  1ASV A;  3MXM A;  3LZJ A;  2P9K B;  1A5W A;  2OCE A;  4DSK A;  4LF4 K;  3OW2 M;  1C6V A;  3DI6 A;  3MWP A;  4BC5 A;  3ZT2 A;  3H1V X;  2PBD A;  4JI1 K;  1YIJ N;  1MWK A;  3BF1 A;  1RT3 A;  4NLB A;  3AVA A;  1YJN N;  3TSP A;  5I42 A;  3PIP L;  4HWI A;  2Q97 A;  4DV5 K;  3E9P A;  3VEX A;  5AQI A;  4CGF A;  1A5V A;  4JNE A;  2KZM A;  4ZTF A;  2UUA K;  3EO3 A;  4O4G A;  1L3S A;  4FPB A;  1HPM A;  1JKH A;  4AIL C;  4CEC A;  1Z25 A;  3HJF A;  3MEG A;  1H1V A;  3R1X A;  5BR9 A;  4BRK A;  4BAC A;  3DLB A;  2P9N A;  1GOB A;  1VQ5 N;  2EWS A;  2WFB A;  3A2F A;  2DPN A;  3D0P A;  1NGB A;  4KKO A;  1RDU A;  3LAN A;  4PKH A;  3RTV A;  1U04 A;  1KFD A;  5AQL A;  1C1A A;  3FZK A;  3EL2 A;  3ZSZ A;  4NYF A;  5C2D A;  3TI0 A;  4B1Y B;  3EKU A;  4JI6 K;  3CF5 L;  1KFS A;  3KK7 A;  3MK6 A;  3EEQ A;  4FK0 A;  4KTQ A;  3K5L A;  4RW7 A;  4WFB L;  2Q1N A;  3G10 A;  4KI6 A;  1C0F A;  4DQ8 A;  5C10 A;  4BDY A;  1SL0 A;  1GLB G;  4N41 A;  2P9N B;  3S3N A;  4BR7 A;  4JN4 A;  4CEF A;  1GLF O;  2UU9 K;  2QW9 A;  1T6C A;  3CHW A;  1OKJ A;  4LH4 A;  2R7Y A;  3HM8 A;  4CHO A;  4DTO A;  1T44 A;  4O55 A;  3P1G A;  1EQY A;  4M63 C;  3SYZ A;  4DB3 A;  2YX6 A;  2IOC A;  1S6Q A;  2IAJ A;  4O5F A;  5AZJ A;  3DRR A;  4X66 K;  2J4R A;  3DRP A;  3ZSQ A;  1V4S A;  1UAX A;  3WXJ A;  1ZBF A;  4JYA K;  1FJG K;  1S1T A;  5C2F A;  4HTL A;  3DLH A;  4E7K A;  1E4G T;  4R79 A;  3O08 A;  1SZ2 A;  4ILJ A;  1JLB A;  3VEV A;  1XHX A;  2OPR A;  3RMD A;  2YI1 A;  1U49 A;  3CJC A;  4YOW A;  4CED A;  1S1X A;  1CXQ A;  1NGJ A;  5JIC A;  3LWM A;  3IFR A;  1GLJ O;  1KTQ A;  1RTD A;  1TK5 A;  4UQG A;  3MX5 A;  3VQ6 A;  4KPY A;  4I7F A;  5AZJ B;  5GIP A;  4CCH A;  5BPM A;  4CJS A;  1ZXO A;  3SUQ A;  1WSJ A;  1NMN A;  3CPW M;  3ZET A;  3NE6 A;  1RBV A;  4FLX A;  3FZM A;  3I33 A;  4RG8 A;  4H5W A;  5CHI A;  5ADX H;  3IG1 A;  1BCM A;  4WQ5 C;  5K14 A;  1BWF O;  4YFU A;  1K6Y A;  2HMI A;  4AM6 A;  3SNN A;  1ITG A;  1JLQ A;  1NGF A;  3HSC A;  3A5L C;  4BRG A;  1BQN A;  1Q86 O;  2VQE K;  1RDD A;  4CBW A;  1HMV A;  3TAG A;  3ZET B;  4BRH A;  3DXM A;  5LL6 Z;  1GLL O;  2ZWH A;  3AVM A;  3HTV A;  3SQ1 A;  4CHZ A;  3EE9 A;  5BN9 A;  2P5O A;  4M7Y A;  4H8K A;  3ATU A;  3OS0 A;  2G8K A;  3K2P A;  4CEE A;  3FR0 A;  4FK2 A;  4DLG A;  5SWM A;  3SV4 A;  3F2K A;  3P5J A;  4FOI A;  3M3Z A;  4B9S A;  5GAH P;  3AVC A;  4WFN L;  1C0M A;  1W0H A;  4JAX A;  2QM1 A;  3HO1 A;  4DUY K;  1BDG A;  4A57 A;  2UUB K;  2JWL A;  4FWR A;  1S22 A;  2RPI A;  3DXM B;  1NJI O;  3DXK B;  3KHY A;  2RKI A;  2WUS A;  4IOC L;  3BF3 A;  3ZT0 A;  2HBM A;  4CF9 A;  3HPG A;  1XUP O;  2A41 A;  2W40 A;  5C25 A;  3CQ8 A;  3AA2 A;  1HYS A;  4LFB K;  2AP1 A;  4CFC A;  2G8W A;  3M6G A;  4CJE A;  2E2P A;  1KVB A;  3P4I A;  1RT4 A;  4Y0W A;  3QLH A;  1WB9 A;  1QQM A;  1BU6 O;  4IOX A;  1HUX A;  1J6Z A;  1RGI A;  1VHX A;  4DV1 K;  2GUP A;  3WXM B;  3KKR A;  1D9F A;  1YT3 A;  4DTS A;  1SQK A;  3U9D A;  3FGU A;  2JGU A;  4DQQ A;  1A5X A;  2VGM A;  1QSL A;  3HVT A;  2E6L A;  1GOA A;  2VWJ A;  1I94 K;  2E2N A;  2BGG A;  3O3G A;  5KRT A;  4CZL A;  3C95 A;  1KLM A;  3JS6 A;  3B6P A;  1YHQ N;  3T1Y K;  4FJX A;  1ASW A;  3A5O C;  3V9S A;  4PL8 A;  3EN9 A;  1NM1 A;  1WLJ A;  4CIE A;  1P90 A;  1TUU A;  3OS1 A;  5BRE A;  3OA9 A;  1UA0 A;  4ISE A;  3ZSX A;  3QEI A;  3SUN A;  3H3N O;  4F3T A;  2VWB A;  3LAM A;  3TU5 A;  4CJR A;  1B9F A;  3O8M A;  5AFU A;  4FVU A;  4JKG A;  1K9M O;  4ILH A;  4BWJ A;  3AAP A;  2QWL A;  4CJ7 A;  3OYB A;  5FRN A;  5AR0 A;  1XWL A;  3FFK B;  4DR1 K;  5MLC Q;  3O4Q A;  4DFK A;  3OBY A;  1NMD A;  4H0X B;  4KB1 A;  2E1Y A;  4B9L A;  2E4L A;  1QTM A;  2UXB K;  1Q9X A;  3THW A;  1U2V A;  4CFB A;  3T1H K;  4HVJ A;  2O8D A;  1ASU A;  1FKO A;  3MXI A;  2VWK A;  4B1X B;  5M1Q A;  4JKG B;  4RW4 A;  1NNE A;  1KC8 O;  3ASM A;  1QZ6 A;  3KLH A;  3O3H A;  5C15 A;  3HOS A;  3FLC O;  4TSX A;  1YUW A;  3E66 A;  1JCG A;  4NCG A;  4GV3 A;  4DF8 A;  3AVK A;  4ELT A;  4M3Z A;  4RTF D;  3SUP A;  4GVM A;  3ULE A;  3THW B;  4DQI A;  2D0B A;  1U2V B;  4M3R A;  4L8R B;  3O9S A;  3OJS A;  4HHT A;  1MA9 B;  3C0B A;  1NGG A;  3S3O A;  1KAY A;  5JVH L;  4KFB A;  4JI5 K;  4B9T A;  4DV7 K;  1YTU A;  4FM1 A;  4DQP A;  5BPN A;  1DGK N;  4FCY A;  2FBV A;  4A2A A;  1SUQ A;  2QKK A;  2A1R A;  3VGK A;  4NXN K;  5HBM A;  4AH9 A;  3WNF A;  4BG9 A;  3FE1 A;  3S3M A;  3VA3 A;  4FLW A;  2ZD1 A;  3R6M A;  3FZH A;  4IOA L;  1HPZ A;  4NXM K;  3ULE B;  3NVK A;  1REV A;  4BRN A;  3LAK A;  2A42 A;  3OJU A;  3AO4 A;  3C6T A;  4QCL A;  5AQO A;  1RNH A;  3DMJ A;  4M3X A;  1RIL A;  1D4X A;  3IUC A;  3K5O A;  3CCL N;  1RDC A;  4JV5 K;  2HNY A;  3LP2 A;  4IO8 A;  3CMA N;  1BIZ A;  2BDP A;  4ELV A;  1BA0 A;  3ZSY A;  1JCF A;  1KSP A;  2V51 B;  5BR8 K;  3H45 C;  1X9S A;  4CEO A;  2IVP A;  4B3M K;  3OYN A;  2VQF K;  2Z1J A;  1XC9 A;  1JXB A;  4B8C A;  1CZA N;  3LP3 A;  1E3M A;  3THY A;  4MDB A;  2F8T A;  4BDP A;  3VES A;  5ELZ A;  1TAU A;  5AQQ A;  4EP5 A;  3D6R A;  1LWC A;  4IDH A;  3SMP A;  3CCU N;  4NO7 A;  2OYQ A;  1RBR A;  3EE8 A;  4CBX A;  1SAZ A;  3AA4 A;  3QBX A;  4CGI A;  4JS4 A;  1NK9 A;  4FWS A;  3IKM A;  3VQ7 A;  4KBO A;  3VQ8 A;  4DSE A;  5AZI A;  2YNH A;  1CZ9 A;  4DF4 A;  3RSE B;  2XY5 A;  3DM2 A;  3VPZ A;  1C0U A;  4FSV A;  4YOT A;  4DUZ K;  3V6D A;  4BDZ A;  2VYP A;  3KVG A;  3THY B; 
#chains in the Genus database with same CATH homology
 3V4I A;  1C6V A;  2B6A A;  4JRQ A;  3DI6 A;  3VQE A;  1R0A A;  3ZT2 A;  3HM9 A;  1NKC A;  2QXF A;  3M8R A;  4CEB A;  4FLT A;  4B9U A;  2OZS A;  4NYN A;  4CJK A;  1RT3 A;  5J2P A;  1G15 A;  3AVA A;  5FRO A;  3MED A;  1NOZ A;  3V9W A;  1C0T A;  1J54 A;  3KKS A;  3CM6 A;  1VSM A;  4QAG A;  4CJ3 A;  4CIG A;  4DG1 A;  3AA5 X;  4C8M A;  1IG9 A;  1TL1 A;  3ZT1 A;  4RW8 A;  1KVC A;  3AV9 A;  4AHC A;  4CGF A;  3SQ2 A;  1A5V A;  4DMN A;  4HCB A;  1TVR A;  4ICL A;  2KZM A;  4ZTF A;  4KHW A;  4O4G A;  1L3S A;  1JLG A;  2QK9 A;  2YNI A;  1IKV A;  3I0R A;  3DLG A;  4BE2 A;  5HRO A;  4DSF A;  2Y1I A;  1JKH A;  4AIL C;  4CEC A;  1I39 A;  3WNE A;  4HUE A;  4CJL A;  1Z25 A;  4JS5 A;  1ZBI A;  3HJF A;  1IKX A;  3MEG A;  2P5G A;  4B08 A;  5J2N A;  1X1P A;  1S1W A;  3JYT A;  1LW0 A;  3NGI A;  4BAC A;  3DLB A;  3TAN A;  3KJV A;  3OS2 A;  1GOB A;  1LAV A;  2YKM A;  1ZBH A;  2KZZ A;  2DY4 A;  4O44 A;  1L3T A;  4Z4F A;  1S5J A;  1QE1 A;  3A2F A;  3D0P A;  1EET A;  4KKO A;  3OYD A;  3M8S A;  1FXX A;  4E7I A;  5HP1 A;  3TAQ A;  1FK9 A;  4M45 A;  1HQU A;  1VSE A;  2GV9 A;  3LAN A;  4CGJ A;  4E1M A;  3PO5 A;  4CFA A;  1L3U A;  1BQM A;  3RTV A;  1U04 A;  1KFD A;  2RF2 A;  3L2W A;  3L2V A;  3DLR A;  1C1A A;  2XY8 A;  3MXJ A;  4BE0 A;  1X9M A;  3ZSZ A;  4NYF A;  4B9N A;  4LSL A;  3B6O A;  2FBY A;  2P51 A;  3TI0 A;  1U45 A;  2HND A;  1HQE A;  1KVA A;  1CLQ A;  1KFS A;  1JL1 A;  4E19 A;  4Q5V A;  4FLV A;  3NH1 A;  3HST B;  4IG3 A;  4EZ9 A;  3U6F A;  4KTQ A;  4FK0 A;  3K5L A;  3TAR A;  4DTM A;  4RW7 A;  3OYC A;  3EYZ A;  1BI4 A;  3VQQ A;  3OYL A;  3NF8 A;  3VQC A;  4FXD A;  3SCX A;  1SKW A;  3G10 A;  4KI6 A;  4HCC A;  3ALY A;  3LP1 A;  4RW9 A;  4BDY A;  1SL0 A;  4DFP A;  1NK4 A;  5KTQ A;  4N41 A;  3S3N A;  3VQ4 A;  3CM5 A;  4F2S A;  2OPQ A;  1VSL A;  4FW1 A;  2LSN A;  5HRS A;  3QO9 A;  4CEF A;  1KLN A;  4KAZ A;  4LH4 A;  2R7Y A;  3MEE A;  1LV5 A;  4DTO A;  4CHO A;  3AO1 A;  1D5A A;  4DQS A;  4FK4 A;  1BIS A;  2O4G A;  4O55 A;  4OKE A;  3DOL A;  3P1G A;  5KI6 A;  4AHS A;  3SYZ A;  3RR8 A;  4W5O A;  3QER A;  2IOC A;  1S6Q A;  3RRH A;  1WAJ A;  3VQP A;  2IAJ A;  4K8X A;  4M3W A;  1Q8I A;  2OZM A;  2HHV A;  3HVR A;  3DRR A;  3ZSQ A;  3DRP A;  4HTU A;  4DU1 A;  4C8K A;  1UAX A;  4KI4 A;  1ZBF A;  1U4B A;  3RMC A;  3AVF A;  4DFJ A;  4J2A A;  2O4I A;  1S1T A;  4NCA A;  3DLH A;  3NF6 A;  4E7K A;  1BI4 B;  1RT6 A;  3AVJ A;  4F4K A;  1JLB A;  3ZT3 A;  4DTR A;  1WSH A;  2Y1J A;  1XHX A;  3WNG A;  3AVN A;  2OPR A;  3CYM A;  4E89 A;  3RMD A;  1U49 A;  1TGO A;  1BHL A;  5JS2 A;  4CJT A;  3OY9 A;  4CED A;  1S9E A;  1S1X A;  1CXQ A;  3LWM A;  4DFM A;  3L2Q A;  2JLE A;  2XHB A;  3OYI A;  3QET A;  1S9G A;  1KTQ A;  1RTD A;  3VQ9 A;  1TK5 A;  2HHQ A;  1WSI A;  2YKN A;  4DTN A;  3U3Y A;  2VG7 A;  3L2R A;  4K8Z A;  4UQG A;  2YHA A;  5HLF A;  2HVI A;  2XRI A;  3VQ6 A;  4CJQ A;  4I7F A;  4KPY A;  4CCH A;  1LW2 A;  2B4J A;  3IRX A;  4CJW A;  5FDL A;  4CJ4 A;  2PYJ A;  3VA0 A;  3AVG A;  4CJS A;  4IKF A;  3ZSV A;  2F96 A;  3SUQ A;  4N47 A;  1Z26 A;  1WSJ A;  3T3F A;  4FLU A;  3TAP A;  4FZY A;  1JLA A;  1SKR A;  4KHS A;  3M8Q A;  4KV8 A;  3VQB A;  3FFI A;  3NE6 A;  4KRF A;  1RBV A;  4FLX A;  4Z4G A;  2P1J A;  1DTT A;  3ZSW A;  2BAN A;  2X6N A;  2E6M A;  4RG8 A;  1L3V A;  2HVH A;  4CJV A;  2DTU A;  1NK5 A;  4CF8 A;  4CHP A;  3BGR A;  3PV8 A;  3HPH A;  3OYJ A;  3IG1 A;  4M3Y A;  4HUF A;  2HHX A;  4W5T A;  1T05 A;  4DTP A;  4CK2 A;  1BCM A;  3SI6 A;  1J53 A;  3TWH A;  3RMA A;  1RTJ A;  5K14 A;  3AVB A;  3ZCM A;  4YFU A;  1K6Y A;  2HMI A;  3SNN A;  4Z0U A;  2IC3 A;  1QHT A;  1ITG A;  4OKK A;  1JLQ A;  1QS4 A;  4DTJ A;  1JLE A;  1WSE A;  1T7P A;  1BQN A;  5I42 A;  1U47 A;  4DWI A;  3H08 A;  3I8D A;  3MAQ A;  3ZSR A;  2OA8 A;  1LWE A;  1GOC A;  1RDD A;  3PO4 A;  4J2D A;  4G1Q A;  4FYD A;  1JLF A;  1HMV A;  4M42 A;  4EZ6 A;  1BIU A;  4CGG A;  4I2P A;  3TAG A;  4CJ5 A;  1D8Y A;  1TV6 A;  1JL2 A;  1VSD A;  1VSF A;  3K5M A;  1HRH A;  4F3O A;  2W42 A;  3QEW A;  3NH2 A;  3QNN A;  5JS1 A;  1HNI A;  3ULD A;  1VRT A;  2HHU A;  3SQ1 A;  3AVM A;  4CHZ A;  4E7H A;  2P5O A;  1BL3 A;  4H8K A;  4Z4C A;  4DTU A;  2KTQ A;  1WSF A;  2HHT A;  4DU4 A;  1SKS A;  2DFH A;  3SZ2 A;  4CEQ A;  3PX6 A;  4J2E A;  2X74 A;  3OS0 A;  3L3V A;  3CFP A;  3K2P A;  3ZSO A;  4CEE A;  3C6U A;  1NKE A;  2G8K A;  2GUI A;  3KLG A;  4FK2 A;  1EXQ A;  3C94 A;  1LWF A;  5SWM A;  4DLG A;  3SV4 A;  1NOY A;  3P5J A;  3KLF A;  1RT7 A;  3CG7 A;  3DLK A;  3V9U A;  5J2Q A;  4B9V A;  3SQ0 A;  2FC0 A;  3UIQ A;  4B9S A;  4DS4 A;  3AVC A;  5D3G A;  1C0M A;  1W0H A;  4CE9 A;  1SL1 A;  4FJN A;  3HO1 A;  4O5B A;  3U3G A;  1RBS A;  2YNF A;  4AHT A;  4KHY A;  1JXE A;  4FJ5 A;  2HNZ A;  2GBZ A;  3HPO A;  4FJG A;  2DFE A;  2RPI A;  3KLI A;  3QES A;  2AJQ A;  4FJL A;  3NFA A;  4M3T A;  3QIN A;  4XIU A;  2RKI A;  2PY5 A;  3ZT0 A;  1IO2 A;  4KTW A;  4CF9 A;  2NUB A;  3HPG A;  3OYF A;  4Y1D A;  3RMB A;  1TKT A;  4J2B A;  1S1V A;  3KD1 E;  1VK0 A;  3LAL A;  1VSH A;  3CFR A;  5C25 A;  3KK2 A;  4KRE A;  1TL3 A;  1Q9Y A;  3CQ8 A;  2D0C A;  3AA2 A;  4QOZ B;  2Z1G A;  1HYS A;  4PY5 A;  3KIO A;  3S9H A;  4CFC A;  3NAE A;  2G8W A;  4CJE A;  1I3A A;  3V1Q A;  4E3S A;  1KVB A;  3V1R A;  4R5P A;  1TK0 A;  1RT4 A;  3K59 A;  4EP4 A;  1N6Q A;  3DOK A;  3QLH A;  4DSJ A;  4KB0 A;  2G8F A;  4FZZ A;  2ETJ A;  4W5R A;  1RTH A;  4ID5 A;  3K58 A;  5J2M A;  2G8U A;  3OVN A;  4RW6 A;  1ZBL A;  4IFY A;  3ZT4 A;  4W5N A;  3KKR A;  1D9F A;  1YT3 A;  4DTS A;  1TAQ A;  2XY7 A;  1NKB A;  4DS5 A;  4CF1 A;  2KW4 A;  4CEA A;  2JGU A;  2YHB A;  4DQQ A;  1A5X A;  3O3F A;  3QEV A;  4C8N A;  4FJK A;  4N76 A;  3NGZ A;  1RDA A;  2D0A A;  1RT2 A;  4LSN A;  5HRR A;  1QSL A;  1ZYQ A;  3MEC A;  1F21 A;  3HVT A;  1VSI A;  3NBP A;  3BDP A;  4FLZ A;  2E6L A;  1GOA A;  1VRU A;  3DYA A;  5KRS A;  1NK6 A;  3ISN C;  5CZ1 A;  2VWJ A;  1IKW A;  2BGG A;  3AO2 A;  3T1A A;  1KRP A;  1L5U A;  3O3G A;  5KRT A;  3K5N A;  3C95 A;  1U48 A;  1KLM A;  4CHN A;  4E0D A;  3HT3 A;  3D45 A;  1VSK A;  1RDB A;  2RN2 A;  3B6P A;  4MQ3 A;  4PWD A;  3THV A;  3OYM A;  1YTA A;  4FJX A;  4PQU A;  1RTI A;  2Z1H A;  4B9M A;  4FJI A;  4O0I A;  1ASW A;  3QIO A;  3PX4 A;  3V9S A;  2WOM A;  1WLJ A;  4AHV A;  4CIE A;  3NH0 A;  2X6S A;  3OS1 A;  3RWU A;  4NCB A;  3KK3 A;  2X78 A;  1UA0 A;  4DLE A;  4OJR A;  1T8E A;  3PY8 A;  3ZSX A;  3QEI A;  3SUN A;  1J5O A;  2EX3 A;  3HK2 A;  4F3T A;  4Y1C A;  4FM2 A;  3LAM A;  3AO5 A;  3EY1 A;  4CJU A;  4CK1 A;  1W9H A;  4CK3 A;  1B9F A;  1RBU A;  4CJR A;  4FLY A;  3SUO A;  3HP9 A;  4ZTJ A;  2YV0 X;  1LAW A;  3AVH A;  5E41 A;  3V81 A;  3TAE A;  1NK7 A;  4HUG A;  4BWJ A;  2OPP A;  3V9X A;  2OPS A;  3QNO A;  3OYB A;  5FRN A;  5HRP A;  3VQD A;  1XWL A;  2FBT A;  3NCI A;  2VG6 A;  1HYV A;  3O4Q A;  4DFK A;  2XY6 A;  3QEP A;  2HHS A;  1FKP A;  4GMJ B;  4KB1 A;  2ZE2 A;  4B9L A;  2E4L A;  4I2Q A;  1QTM A;  1HYZ A;  4CGD A;  2B5J A;  4CF2 A;  4E7J A;  1Q9X A;  3KTQ A;  3ITH A;  4LD0 A;  2YNG A;  3L8B A;  2HHW A;  4CFB A;  4CHY A;  1C1C A;  3VQ5 A;  3V1O A;  3LWL A;  1QSS A;  1S1U A;  1X9W A;  1NJX A;  2KFN A;  1EX4 A;  2XO7 A;  3T19 A;  4HVJ A;  3JSM A;  1NK8 A;  1J9A A;  4YNQ A;  1ASU A;  4CIF A;  1FKO A;  3HYF A;  3MXI A;  1KCF A;  2VWK A;  5C24 A;  1N5Y A;  3IS9 A;  1XHZ A;  1TK8 A;  4FJJ A;  3LPU A;  3KD5 E;  1NK0 A;  1DLO A;  4RW4 A;  1TKD A;  1EKE A;  2QKB A;  3LPT A;  5CYM A;  1BGX T;  3HP6 A;  4OKJ A;  1ZBU A;  3SPY A;  3VN5 A;  3ASM A;  3KLH A;  4GW6 A;  4AHR A;  3O3H A;  3KLE A;  2Q3S A;  3L2U A;  4DQR A;  4F8R A;  4W5Q A;  3PX0 A;  4Z4E A;  4TSX A;  2WON A;  4NCG A;  3WNH A;  3RR7 A;  1C1B A;  2A1S A;  4B8A B;  1BCO A;  3AVK A;  4N56 A;  4DF8 A;  4ELT A;  4M3Z A;  4CGH A;  2I5J A;  3TAM A;  3EZ5 A;  1WAF A;  3SUP A;  3OYG A;  1UA1 A;  3RRG A;  4GVM A;  2ZQB A;  4DQI A;  2D0B A;  4DSL A;  2BE2 A;  4M3R A;  3DLE A;  3OYA A;  1QSY A;  2KQ2 A;  4L8R B;  3KK1 A;  3OJS A;  5KGX A;  1RT5 A;  4HHT A;  1XI1 A;  3S3O A;  5CYQ A;  5T7B A;  4FJ8 A;  2IS3 A;  4KHN A;  4E1N A;  5EU7 A;  4FJ7 A;  4BWM A;  2G8I A;  4JLH A;  2VG5 A;  1DTQ A;  4FJH A;  1TKX A;  4KFB A;  4H4M A;  4OPJ A;  4C8L A;  4B9T A;  4ELU A;  1YTU A;  4FM1 A;  4DQP A;  4OGC A;  4FCY A;  3OYK A;  2ATQ A;  2FBV A;  3NF9 A;  4CJP A;  3LZI A;  4DU3 A;  3QEX A;  4FZX C;  1D9D A;  1SUQ A;  2QKK A;  2A1R A;  3SV3 A;  1B92 A;  1NJW A;  3F9K A;  5HBM A;  4AH9 A;  4BE1 A;  3WNF A;  1SL2 A;  1WN7 A;  3SJJ A;  3S3M A;  4FVM A;  1IH7 A;  5DK5 A;  3NDK A;  2ITG A;  4FLW A;  3VA3 A;  3G0Z A;  1S6P A;  2ZD1 A;  3HL8 A;  4IDK A;  2PYL A;  4MFB A;  1HPZ A;  1UOC A;  4ZHR A;  1REV A;  3E01 A;  1T03 A;  2DFF A;  3LAK A;  3TR8 A;  5KGW A;  4O0J A;  3OJU A;  1HNV A;  4DTX A;  1VSJ A;  3AO4 A;  3NHG A;  4I9L A;  4OGE A;  4FJM A;  3PUF A;  3AA3 A;  1WSG A;  4H4O A;  4AHU A;  3C6T A;  4QCL A;  1RNH A;  3DMJ A;  2HB5 A;  1B9D A;  4KHQ A;  2G8H A;  1TKZ A;  4FJ9 A;  4M3X A;  5HRN A;  1RIL A;  4CES A;  3LP0 A;  5CZ2 A;  4B3O A;  4CER A;  3K5O A;  1RDC A;  1NJZ A;  2IDO A;  2HNY A;  3LP2 A;  4FW2 A;  4LH5 A;  2G8V A;  4ID1 A;  4M3U A;  1IKY A;  4FM0 A;  3I0S A;  4Z4I A;  5J1E A;  4OLA A;  1BIZ A;  2BDP A;  3NGY A;  3AVI A;  4ELV A;  3M8P A;  4DSI A;  4OVL A;  3ZSY A;  4Z4H A;  1KSP A;  3TAB A;  1SV5 A;  4I9Q A;  4N5S A;  2PZS A;  1WNS A;  1X9S A;  2KFZ A;  1RBT A;  4CEO A;  4KO0 A;  1EP4 A;  3K57 A;  4F2R A;  1RCH A;  3HXM A;  3OYN A;  2Z1J A;  2FBX A;  4OPK A;  1JXB A;  3TAF A;  1XC9 A;  4B8C A;  3LP3 A;  4WE1 A;  3O4N A;  1NJY A;  3AVL A;  2F8T A;  2HW3 A;  3OYH A;  4BDP A;  1O1W A;  4CFD A;  1TAU A;  1CZB A;  1YVU A;  3QIP A;  4EP5 A;  4JRP A;  3CFO A;  4PUO A;  3L3U A;  4CEZ A;  5C42 A;  1QQC A;  5SZT A;  5FRM A;  1LWC A;  2F8S A;  5DMR A;  1UWB A;  1MU2 A;  4IG0 A;  4M41 A;  2OYQ A;  1JLC A;  1RBR A;  1Y97 A;  3V9Z A;  4Q0B A;  3SQ4 A;  4OLB A;  4CJF A;  4IBN A;  1CXU A;  1HJR A;  3AA4 A;  4LY7 A;  3SPZ A;  2D5R A;  3IAY A;  4CGI A;  3F73 A;  3AO3 A;  4JS4 A;  5I3U A;  1NK9 A;  4KHU A;  4CHQ A;  4IFV A;  1ASV A;  4KTZ A;  3NF7 A;  4C8O A;  3MXM A;  3VQ7 A;  1RT1 A;  5CY4 A;  3LDS A;  3VQ8 A;  4CF0 A;  3LZJ A;  4DSE A;  3VQA A;  2EHG A;  4E7L A;  2YNH A;  1CZ9 A;  3OYE A;  4DF4 A;  2XY5 A;  3DM2 A;  3DRS A;  1C0U A;  4PA1 A;  1A5W A;  2Z1I A;  4BDZ A;  3V6D A;  2IGI A;  3P83 D;  4DSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...