3L3UA

Crystal structure of the hiv-1 integrase core domain to 1.4a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
151
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords POL polyprotein
publication title Crystal structure of the HIV-1 integrase core domain in complex with sucrose reveals details of an allosteric inhibitory binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l3uA00
3OJUA 1S5JA 2DTUA 4KHNA 3M8RA 4FLWA 4CEDA 5JS2A 1T05A 3L2VA 1BQNA 1L5UA 4NYNA 4M3YA 5HRSA 3PX0A 3VQPA 3OYGA 3ZT1A 1UOCA 4MQ3A 4Z0UA 1DLOA 3P5JA 4CEBA 4PY5A 4I9QA 4OLAA 1WAFA 1VSHA 2OPSA 3A2FA 2YNHA 1QSYA 1TKXA 4AHUA 1S1XA 3HSTB 3HYFA 3MXMA 1Z25A 1U49A 3DLBA 4KV8A 4B9VA 5D3GA 1LV5A 4O0JA 3VQBA 3OYCA 4JLHA 3QNOA 4BE1A 3KIOA 4KTWA 3M8SA 4BE0A 4DF4A 3TAQA 2Q3SA 5JS1A 3U6FA 4IFVA 5HLFA 1SKRA 4CGHA 5C25A 4I9LA 3NDKA 4DFJA 3KLGA 2X6NA 3NGZA 3LP3A 1NKCA 1FK9A 4B8AB 4RW8A 1JLEA 4KTQA 5KTQA 4FZZA 3DOKA 1LWCA 2VG6A 3LAKA 3NE6A 5HROA 4KTZA 4M42A 4CF0A 4IG3A 3ZSVA 1NOYA 3L8BA 2F96A 3ZSWA 4Z4IA 2VWJA 4DSJA 3KLFA 4C8MA 4DU3A 3BDPA 3H08A 3SI6A 4FZYA 2ZQBA 3DLKA 4M41A 5J2NA 2XY6A 4W5NA 1ASWA 1QHTA 2HHVA 1A5VA 3V9WA 3ZCMA 1T03A 3QINA 2DFEA 1XC9A 4EP5A 3QNNA 3SJJA 3VQ5A 1KFSA 1YTAA 4DMNA 4XIUA 4Z4EA 1BCMA 3C94A 2VG7A 1JKHA 1DTTA 1J9AA 2GBZA 4DTNA 3S3MA 4I2QA 3HT3A 3V4IA 4DQSA 2X78A 2KQ2A 2XO7A 1NK5A 1LWFA 4BWJA 3KKRA 1VRUA 2BANA 3AO3A 3DLEA 3NF8A 2HHWA 3VQ9A 1HRHA 1BIUA 5J2QA 5J2PA 4KHSA 3SQ2A 2Z1JA 1VRTA 1TAQA 4DF8A 1KTQA 3L3UA 2GV9A 3HM9A 4W5RA 4CK2A 5CY4A 2D0BA 2HHQA 2BGGA 3LP0A 4ZHRA 3S9HA 4RW4A 3SPYA 4FZXC 3F73A 4ID5A 2P5OA 4B9SA 4O44A 3MEGA 1SL2A 3HJFA 3M8PA 4HUGA 2YV0X 4FLUA 2ATQA 2D0CA 2IOCA 3VQ8A 2XHBA 1BGXT 4DFMA 1X1PA 1IKYA 2YNFA 4E89A 4CEQA 1EP4A 1NOZA 1VSIA 3OYDA 4CIGA 3JSMA 4IFYA 3AVAA 3O3HA 3QESA 3K5OA 4QCLA 1Z26A 3OYJA 5CYQA 2JGUA 4E7LA 1VSDA 4F4KA 4CJEA 1XWLA 2YHBA 3KK2A 1FKPA 3EYZA 1T8EA 1VSFA 4FJNA 1WLJA 4H4MA 3ZSQA 4O55A 1HMVA 3VQDA 4NYFA 5KRSA 4UQGA 3KK3A 4FK2A 3CFRA 1KLNA 1TVRA 4WE1A 3K5MA 3PX6A 4C8NA 3K59A 4B9MA 2G8IA 4CJTA 1F21A 2B4JA 2KFZA 4FM2A 3MXIA 4DLGA 3QIPA 4IKFA 4RW9A 4EZ9A 4FCYA 4B9NA 4FJKA 2RKIA 3MAQA 3ZSOA 3OYBA 3V1RA 4AHTA 4CESA 1JLAA 3UIQA 2WOMA 4CFAA 1IG9A 3LZJA 3RR7A 2B5JA 3L3VA 4Y1DA 2P1JA 3L2UA 2OA8A 2F8SA 1LW2A 3BGRA 3VQ6A 3PO4A 3M8QA 4Z4CA 1Q8IA 1RT3A 2ETJA 4J2AA 4M3TA 1C0MA 4H4OA 3DM2A 1D9FA 3SNNA 3VQAA 4OGEA 3O4NA 1EXQA 3OYKA 4E7KA 1S9GA 4F3OA 1ZBHA 4FVMA 4KB1A 4H8KA 1ZBUA 3OYFA 3ZT4A 1NK9A 4E7IA 1KRPA 2RN2A 3I0RA 4C8OA 1RDBA 1U4BA 1RTHA 2EHGA 3CM6A 1ASUA 4E1MA 1Q9XA 4HVJA 4OLBA 4FJHA 4GMJB 4FW2A 1GOCA 1LAWA 4N56A 3I8DA 3PX4A 4HUFA 3RRGA 4CJKA 3KLIA 5CZ2A 4K8XA 1IO2A 2DY4A 1L3TA 4KRFA 3QLHA 1RTIA 1S6PA 3HPHA 1NKEA 1RT4A 4CJUA 4YFUA 1ASVA 1VSKA 2G8UA 4KI4A 4DFKA 4FJJA 3HO1A 1JL1A 1UWBA 4M3WA 3MEEA 4CJFA 4CJWA 4N47A 4BACA 4FJ7A 2E6LA 2YNGA 3T3FA 3SUQA 4C8KA 3DOLA 4FLZA 3I0SA 4N76A 3TI0A 4RW6A 1S1VA 1L3SA 1FKOA 4CGJA 4Q5VA 4CF8A 1RBUA 3AVHA 4CHYA 3IS9A 1TL1A 4DTSA 4KKOA 3O3GA 4KHWA 5I42A 4CEFA 3SZ2A 2YNIA 5DMRA 4KREA 2BDPA 4GVMA 4CECA 1XI1A 1QS4A 3V6DA 3QERA 3AO1A 3HP6A 3V9UA 4CJLA 1N6QA 2A1RA 4CF1A 4DWIA 2HHSA 1VSJA 2QKKA 3C6TA 3QEPA 1JLCA 4RW7A 4DQRA 4DTPA 3EZ5A 4BE2A 3NH2A 3LWLA 4DU1A 3QEXA 3TAFA 2Y1IA 3B6PA 4K8ZA 1RBRA 1SKWA 3SUPA 1VSLA 1ITGA 2ZE2A 2XRIA 1VK0A 4JS4A 3SUNA 1NK0A 4LH5A 1RTJA 1L3UA 1CLQA 3AA3A 1S1WA 4HUEA 3SV4A 2LSNA 1JXEA 3OYHA 2OPRA 5HP1A 1BI4A 1LAVA 1RT7A 5CZ1A 4W5OA 4I2PA 4JS5A 4FM0A 1WAJA 5HBMA 5C24A 4CEOA 5I3UA 2OZMA 2OZSA 4E19A 4FXDA 3IRXA 1KVBA 2G8HA 2VG5A 2G8FA 3OY9A 4M45A 4CE9A 3L2RA 2KZZA 4DTMA 1RDCA 1NJWA 4DSLA 1HNIA 3KKSA 3P1GA 2FBYA 3TAGA 1EETA 1IKXA 1U04A 2XY7A 4FK4A 3TAPA 1FXXA 1S6QA 1RBTA 4DSFA 1WSEA 3SV3A 3NGIA 2HHTA 3OYLA 1NK4A 1RT1A 3LALA 1JL2A 3QIOA 3E01A 4BWMA 1BISA 3NH1A 1J54A 4KPYA 4B3OA 4HCCA 1B9FA 4YNQA 2A1SA 4O0IA 4OJRA 1C0TA 3AVLA 1ZBLA 3B6OA 4PWDA 1BIZA 4ELTA 1KFDA 4OGCA 3AA2A 3HP9A 4Z4HA 2KZMA 4W5QA 1NKBA 3OJSA 2ZD1A 4CJ3A 2O4GA 3NF9A 1CXUA 1S1UA 1TKTA 4F8RA 3LP2A 3MEDA 1X9WA 4CJVA 2D0AA 2P5GA 3WNGA 3LWMA 4DTRA 1ZYQA 1IH7A 3MXJA 4CK1A 3NCIA 1KSPA 3RMDA 3TR8A 2HB5A 3V9XA 1GOAA 1WN7A 1RT6A 4LH4A 4Y1CA 1SL0A 1IKWA 4CIFA 2PY5A 4J2DA 3VN5A 1RNHA 1D9DA 3SQ4A 1G15A 1J5OA 3DLHA 4CIEA 3V81A 1RBVA 3T19A 3CFPA 1HYSA 2KTQA 4AILC 4JRPA 4G1QA 1HQUA 2WONA 3OYMA 1CZ9A 5HRPA 2IGIA 3K5LA 4CJRA 1TK5A 2PYLA 3KD5E 3SQ1A 2HNYA 3TABA 3TARA 4FYDA 1HNVA 3AVNA 1X9SA 4N41A 1LWEA 3QEVA 4F3TA 2YHAA 1JLBA 4DTJA 2VWKA 4AHRA 1YVUA 2FBTA 2BE2A 1TV6A 1QSSA 2NUBA 2HW3A 1CZBA 3QEIA 4NCBA 2R7YA 3V9SA 4FW1A 3OS0A 1WNSA 3KLEA 2OYQA 4CHOA 3NHGA 2G8KA 5FDLA 3VQEA 4CEZA 1K6YA 1B9DA 3C6UA 3S3OA 1C1BA 1DTQA 4CJ5A 4FJXA 2QXFA 3VQ7A 5SWMA 5FRMA 1BCOA 5HRRA 3U3GA 3NAEA 3VA3A 4DTUA 3L2WA 3MECA 4CF9A 1NK7A 1SL1A 2HHUA 3V9ZA 3KK1A 3HL8A 3AVMA 3ZSYA 3ZT2A 1JLGA 2QKBA 4KO0A 4ID1A 4ZTJA 2HNZA 3ASMA 3NF6A 4DQQA 3LPTA 3NF7A 1T7PA 1C0UA 4KHUA 3CYMA 1BI4B 4MFBA 2IAJA 3D45A 2G8VA 4PUOA 2HVIA 3LPUA 2FBXA 3DRSA 3DYAA 1JLQA 3AO4A 5DK5A 4CFDA 1U48A 4AHCA 3ULDA 2IC3A 3VQCA 4KI6A 1A5WA 3LANA 1O1WA 1D5AA 4B9TA 3DRRA 2HVHA 4IDKA 3ZSZA 1TGOA 2DFHA 4DSIA 3CG7A 1TK0A 1RBSA 4CHQA 4HCBA 2E6MA 3THVA 4DTXA 4KB0A 4W5TA 1KLMA 2AJQA 1JXBA 3CQ8A 2X74A 3RRHA 3ALYA 1W9HA 1WSGA 1YT3A 3CFOA 3FFIA 1TK8A 3WNFA 4B9UA 4L8RB 4Q0BA 2IS3A 4FLYA 4C8LA 2RPIA 3V1QA 1XHZA 5C42A 2OPPA 3U3YA 1ZBIA 1RT2A 4CGDA 4E7HA 4F2RA 3AVJA 4IBNA 4E7JA 3ITHA 5KGXA 2F8TA 4E0DA 4FJ9A 4CERA 2XY8A 3G10A 3NBPA 4CGFA 1TKDA 1S1TA 5J1EA 4DQPA 2EX3A 3AVFA 5EU7A 4Z4GA 1WSFA 3RMBA 1L3VA 4LY7A 3KLHA 3JYTA 3TAEA 1X9MA 4LSNA 4FLXA 4B9LA 4DS4A 3TAMA 3VQQA 4B8CA 2JLEA 2HMIA 3AVIA 2O4IA 3KTQA 1BL3A 4DS5A 4O4GA 1EX4A 2KFNA 3OS1A 4E3SA 4O5BA 3CM5A 3O4QA 3SQ0A 3HVRA 1NJXA 3HPOA 1TAUA 3AO5A 2Z1GA 1VSMA 4OPJA 2FC0A 3AVBA 1EKEA 3OYAA 4ELUA 4ELVA 3AVCA 3ZSRA 3QETA 3OYEA 3OS2A 1U47A 4AH9A 1NJZA 3AVGA 2PYJA 1RT5A 2GUIA 1HQEA 1NK6A 3PV8A 1RCHA 1NJYA 2ITGA 4I7FA 3LP1A 4CJPA 3RMAA 2YKNA 2G8WA 4KHQA 1N5YA 4FM1A 4FJMA 4AHSA 4M3RA 4FJ8A 2HHXA 3F9KA 3AV9A 1RDAA 1KVAA 2D5RA 1J53A 2HNDA 4CHNA 1I39A 3EY1A 1WSIA 3WNEA 1QE1A 3HPGA 3NH0A 2XY5A 2FBVA 4F2SA 4OKJA 5J2MA 4LSLA 3K57A 1W0HA 5CYMA 4FJGA 4DG1A 4CF2A 4DSKA 1QQCA 1REVA 2DFFA 1WSJA 3OVNA 1KCFA 3ZT3A 1TKZA 1ZBFA 4PQUA 4FJLA 4TSXA 1U45A 3K2PA 4KFBA 3ZT0A 2QK9A 2B6AA 3QO9A 3L2QA 3HVTA 4FK0A 4M3XA 4IG0A 4DSEA 3TANA 4CCHA 3IAYA 4CEAA 4QOZB 1RILA 3DMJA 4KHYA 4BDPA 3DI6A 3K5NA 3RTVA 2Z1IA 4CEEA 1IKVA 3HK2A 4DFPA 1YTUA 1C1AA 5KGWA 4DTOA 4LD0A 3HXMA 3S3NA 3ZSXA 1Q9YA 4DLEA 3K58A 4OKKA 1JLFA 1UA0A 3NGYA 1HYVA 4CFCA 3C95A 1SUQA 3NFAA 4N5SA 4HTUA 2X6SA 3QEWA 1QSLA 4QAGA 4Z4FA 2KW4A 3P83D 1MU2A 4E1NA 1C1CA 3SCXA 4ZTFA 3O3FA 3TWHA 1R0AA 1CXQA 4CJ4A 4FLVA 2RF2A 3V1OA 4OPKA 1KVCA 4CJQA 4FLTA 3PUFA 4AHVA 3PO5A 1XHXA 4OVLA 4CFBA 4FJIA 1B92A 3RMCA 4CGGA 1A5XA 1SKSA 1TL3A 4NCGA 4J2BA 4ICLA 3AA4A 4OKEA 3VQ4A 3SUOA 3T1AA 1HYZA 2P51A 5E41A 3D0PA 1BHLA 4GW6A 4CHPA 3SYZA 1QTMA 4EZ6A 4PA1A 1BQMA 3ISNC 5FROA 5T7BA 4BDZA 2IDOA 3OYNA 1UAXA 3VA0A 1LW0A 1UA1A 3LDSA 4J2EA 4NCAA 4RG8A 3KD1E 4KAZA 4CJSA 5HRNA 5K14A 3RWUA 1C6VA 4BDYA 3RR8A 2Y1JA 1NK8A 1Y97A 4CHZA 2YKMA 4FJ5A 1GOBA 4B08A 4JRQA 3WNHA 3SPZA 5FRNA 5SZTA 4R5PA 3OYIA 1S9EA 1HJRA 2E4LA 5KRTA 4DU4A 3PY8A 2I5JA 3AVKA 5KI6A 1I3AA 2PZSA 1RTDA 3DLGA 2Z1HA 3IG1A 4DQIA 3LAMA 4M3ZA 3DRPA 3LZIA 3AO2A 3KJVA 4CGIA 4EP4A 2W42A 1WSHA 1VSEA 1D8YA 1SV5A 3AA5X 3G0ZA 3DLRA 2OPQA 4M3UA 4HHTA 4CK3A 1HPZA 1RDDA
chains in the Genus database with same CATH superfamily
3OJUA 1NNEA 4KHNA 1T05A 3PLAA 1RDWX 1L5UA 4M3YA 4PKHA 4CBXA 1DLOA 1M1KO 1WAFA 2OPSA 2YNHA 1S1XA 3HSTB 3CIPA 3TSPA 3OYCA 4BE1A 3KIOA 3M8SA 3ID6A 5BR8K 5AQQA 4DF4A 5JS1A 1WOQA 4IFVA 5HLFA 3NDKA 5C25A 5M1KA 3CCLN 2X6NA 3CERA 3HSCA 4B8AB 4PHTX 1Z05A 3THYB 5KTQA 5HROA 4M42A 4CF0A 4IWVA 3ENOA 3L8BA 3O08A 4Z4IA 1W7AA 3SI6A 1J5EK 2ZQBA 1VQNN 5J2NA 1QHTA 3A0IX 4BVPA 1A5VA 3V9WA 1T03A 3QNNA 3VQ5A 1YTAA 4XIUA 4Z4EA 2KLAA 3O9TA 4B3MK 2Q31A 4JHDB 1J9AA 2GBZA 3VPZA 1W97L 5TKYA 3S3MA 1CZAN 3HT3A 4DV7K 5AR0A 4IOCL 4YDUC 2HBMA 2BANA 3AO3A 3DLEA 1V4SA 3NF8A 3KHYA 3G71N 5J2PA 1VRTA 2NLXA 3M5RA 4CK2A 5CY4A 2Q2RA 5BRDA 3CJ7A 4J8FA 4ZHRA 4B3RK 4FZXC 2P9KA 4ID5A 2E1ZA 5DM6L 4B9SA 4WQ5C 4FWRA 4M7YA 3M8PA 4FLUA 2IOCA 4CEQA 3GBTA 3DXMA 3VEXA 3DLLL 4IFYA 3K5OA 1BU6O 3CC4N 2JGUA 1VSDA 4F4KA 1VQ6N 4H4MA 4O55A 4NYFA 1TVRA 3K59A 2V7YA 4CJTA 4Y0WA 2B4JA 3SAGA 4GNIA 3BF1A 4IKFA 3FE1A 4RW9A 3CJBA 2RKIA 4JI7K 5E26A 3V1RA 3VGKA 5EVZA 4CFAA 5F1XA 2A3ZA 2B5JA 3L3VA 3L2UA 3K0SA 3BGRA 4JK8A 4Z4CA 1Q8IA 4J2AA 3I33A 4H4OA 3DM2A 3TPQA 1EXQA 3NMUA 4F3OA 1S9GA 4DR4K 1ZBUA 3ZT4A 3GDQA 4IZ9A 5C12A 1Q9XA 2YI1A 4FW2A 2F4VK 3FZHA 4BRDA 3L0QA 1YJNN 4A61A 3I8DA 4HUFA 3RRGA 2QI2A 4KRFA 4FOEA 1RTIA 4A5AA 1RT4A 4CJUA 2PFUA 3EKUA 2NRRA 4JKFA 2G8UA 1U2VB 4FJJA 1JL1A 1UWBA 3VGMA 4BACA 2E6LA 4CJ7A 3EN9A 3P4IA 4RW6A 1NGGA 1BUPA 1TL1A 1ZC6A 3LM9A 3EEQA 3VF2A 3O3GA 4KHWA 2YNIA 4KREA 3O9SA 4H0VB 4GVMA 3QERA 4BR4A 1VHXA 1VSJA 3FZFA 3J7YP 4KBOA 3WXMB 3QEXA 4BE2A 4K8ZA 4DU1A 2E5LK 2Y1IA 5HOOA 1HNWK 2ZE2A 1NK0A 1S1WA 4DR5K 1JXEA 3OYHA 5CZ1A 4NXMK 5C24A 4CEOA 3SBTA 4E19A 1OH6A 2G8FA 3OY9A 1NJWA 3RVCA 1HNIA 3CCJN 3P1GA 1IKXA 4EHUA 3NGIA 2HHTA 3OYLA 1RT1A 3UE5A 3QIOA 4H5NA 1J54A 1XNRK 4YNQA 3J80O 4O0IA 5FPDA 1ZBLA 5AQLA 4PWDA 4ELTA 1KFDA 4O5FA 1NMNA 3TSQA 3LDNA 3OJSA 2ZD1A 2I7NA 4B3TK 3ZLJA 4NXNK 2HBKA 1TKTA 2VCPA 3MEDA 5DM7L 4BRAA 1RFQA 3NCIA 3MXJA 4CK1A 3RMDA 4Y1CA 1RT6A 1G99A 4CIFA 3J7ZO 2PY5A 4J2DA 1RNHA 1XNQK 4CIEA 1HYSA 4UY8O 3SAHA 4JRPA 1HQUA 2IGIA 1TK5A 4MLHA 4IJNA 3L4QA 5CR4A 2Q0UA 3AVNA 3Q7BA 2YHAA 1TV6A 4DR7K 1QSSA 2KKZA 1Z6RA 3V9SA 2OTLN 2OYQA 1K6YA 5AQWA 1C1BA 4CJ5A 2QXFA 5HRRA 3MECA 4CF9A 2HHUA 2CGKA 3CJ1A 3JAMO 3AVMA 3ZX3A 4XH4A 4JHDA 1JCEA 2QKBA 1T6DA 4ZTJA 3O1BA 4K42A 4X66K 3NF7A 3PSIA 3TSUA 3U4LA 1MWKA 3CYMA 1S22A 1YVNA 1GLFO 3DRSA 3DYAA 4CFDA 4K41A 4MDAA 4BR7A 2GELA 1A5WA 1D5AA 3DRRA 2HVHA 4WCEL 1T6CA 5C0YA 4CHQA 1JXBA 3CQ8A 3RRHA 3CFOA 4Q0BA 5AQUA 4FLYA 4FWNA 4C8LA 4A2BA 1XHZA 4GV3A 4YOWA 4IBNA 4BRKA 3ITHA 4IFEA 3WEEB 2XY8A 1Q7YO 3NBPA 3TU5A 2JWKA 4EHTA 1VQKN 4DQPA 3AVFA 5EU7A 4LSNA 4DS4A 2HMIA 3O9UA 3KTQA 4XH1A 4K25A 2KFNA 3OS1A 3CC7N 3HPOA 3AO5A 3OYAA 2ZM6K 3VENA 4ELUA 3AVCA 1NM1A 3AGKA 5AZIB 2JWLA 1RT5A 3THXA 1HQEA 1NK6A 1RCHA 1QVGM 4I7FA 3RMAA 4WFAL 2HHXA 3I8BA 2GEMA 3AV9A 2O8CB 1YITN 1I39A 3WNEA 1QE1A 3HPGA 1ZBSA 1OH7A 4OKJA 5J2MA 1W0HA 2AA4A 5AQTA 4YOYA 2DFFA 4B1UB 1WSJA 3W0LA 1ZBFA 3LDQA 3GE1A 3OBWA 4TSXA 4DV2K 1U45A 3L2QA 1X9JA 4FO0A 4M3XA 3TANA 4QOZB 1RILA 1U2VA 3DMJA 3SMSA 4BDPA 3O1WA 5F0XA 3DI6A 2E8AA 4QS9A 4GKJK 1IKVA 4DHYA 5M1OA 2J4RA 4BRLA 3QBWA 3QBXA 4EIAA 4DLEA 4HTUA 3QEWA 2X6SA 4A57A 4BRNA 1QSLA 3P83D 1MU2A 4E1NA 4ZTFA 4WFNL 4CJ4A 1KD1O 3PO5A 4OVLA 4FJIA 3RMCA 1SKSA 3VQ4A 3AA4A 4ICLA 4OKEA 3A5NC 1HYZA 2P51A 3T1AA 4Z94A 4U7BA 1YJ9N 4GW6A 2ASPA 1EO1A 3ISNC 3J81O 2IDOA 1UAXA 3T7ZA 1LW0A 4C1NI 3THWB 5HRNA 3O80A 5K14A 3RWUA 4BDYA 3RR8A 2Y1JA 1NK8A 4FJ5A 5FRNA 3I55N 4MO4A 4MLEA 3OYIA 2VYPA 2E4LA 4DU4A 5LJWA 4JKGA 4BG9A 4DR1K 4HTLA 4JI0K 2EWSA 2Q1NA 2YHXA 5KI6A 1YF5L 4CBUA 3DLGA 2YHYA 5AQKA 4DQIA 2FXUA 3CMAN 1K9MO 1XC3A 4CGIA 2W40A 1VSEA 4CVNE 3RSEA 4YOXA 3AA5X 3DLRA 3NVMA 4M3UA 4CK3A 3ZX2A 4B1ZA 1RDDA 1S5JA 2DTUA 3M8RA 5BPMA 1C0FA 5HRSA 2F9TA 3PX0A 5KQDA 3ZT1A 4Z0UA 3P5JA 2V52B 3D7EO 1YI2N 1QSYA 4AHUA 3MXMA 4JKAA 1U49A 4KV8A 1NU0A 1LV5A 2YCHA 4O0JA 4WQ4A 5JVGL 3PIPL 4BE0A 1GLLO 2Q3SA 3U6FA 1EWQA 4CGHA 1FK9A 3DOKA 1LWCA 3NE6A 3BDPA 4FZYA 2XY6A 1OKJA 2P9UB 2DFEA 4EP5A 1YUWA 1KFSA 4KH6A 2IVOA 3VERA 3ZYYX 1DTTA 1NGEA 3M3ZA 4DTNA 2X78A 2KQ2A 2XO7A 1LWFA 3KKRA 1VQLN 4JNEA 4RTFD 2HHWA 1HRHA 4KHSA 3SJHA 3HI0A 3MWPA 3HM9A 4W5RA 3CJCA 1X3MA 5C10A 3E1YA 3LP0A 3F73A 3MEGA 1RGIA 1NGAA 3CXCM 4JI1K 3SBGA 2D0CA 2XHBA 3OHRA 3EKSA 4DKWA 3ZEUA 1VSIA 3OYDA 3QESA 4QCLA 5AQRA 4FWPA 5CYQA 4E7LA 5GIPA 4U67L 1T8EA 2QXLA 4FJNA 3VQDA 1HMVA 3CFRA 3FGUA 1F21A 2OCEA 2KFZA 3MXIA 3C7NB 3MDQA 4JN4A 1OVYA 4FCYA 5AZIA 5BPLA 2OA8A 2F8SA 1LW2A 2O8CA 4FOIA 4OX9K 3SNNA 1SQKA 1DKGD 3O4NA 1GLDG 3OYKA 2A40A 3D6RA 3WQTA 1N32K 4H8KA 1NK9A 2NZTA 4C8OA 4H5WA 1U4BA 2EHGA 3CM6A 4OLBA 4HVJA 1LAWA 3CD6N 3KVGA 3UKRB 2E1YA 2A6AA 3HPHA 1NKEA 4GVEA 1ASVA 4KI4A 4YOVA 5ELZA 1HNXK 3QDKA 2W6KA 5FPEA 3H46O 3VMFB 3CCVN 4N76A 2V7ZA 5JMVA 1TYQB 2P9PB 1S1VA 2E88A 1L3SA 1FKOA 4CGJA 1RBUA 4BRIA 3AVHA 4CHYA 4BGAA 5AZJA 4DTSA 4KKOA 1QZ5A 3LDPA 5I42A 4R79A 2BDPA 5BN9A 1XI1A 1QS4A 1M90O 2WBNA 5BREA 1JLCA 5BRFA 4RW7A 4DQRA 2PAVA 3B6PA 1RBRA 5GADP 1SKWA 4LC9B 3L4IA 1VSLA 1ITGA 2XRIA 2GWJA 4FWOA 4BG8A 1L3UA 1VQPN 4HUEA 4W5OA 4JS5A 2D0PA 4FM0A 5I3UA 3FZLA 1S3XA 1KVBA 2FSKA 2VG5A 3L2RA 4CE9A 1RDCA 5JLHA 4JKEA 2FBYA 1EETA 4BR5A 1WSEA 3SV3A 1NK4A 2P9SB 4QS8A 3E01A 4BREA 1BISA 3NH1A 4KPYA 4HCCA 4H0PA 2A1SA 5AFUA 3OW2M 2O8BB 4OJRA 3AVLA 3IFRA 4FWKA 3B6OA 1YXQA 3CJ9A 3HP9A 2IVNA 2VWBA 4W5QA 1NKBA 3WUHA 4CJ3A 4WF9L 1S1UA 3LP2A 2D0AA 3LWMA 1ZYQA 1KSPA 2Q97A 1BO5O 2HB5A 3V9XA 1YAGA 1GOAA 4LH4A 4FPBA 3V81A 3CETA 1RBVA 2KTQA 3CFPA 3CI5A 3OYMA 2PYLA 1CZ9A 3FR0A 2HNYA 3TABA 4FYDA 1Q18A 4DTJA 2E2QA 1YVUA 2NUBA 4NCBA 2R7YA 2NRWA 1HPMA 3OS0A 1WNSA 3NHGA 1MWMA 3A5MC 4FJXA 2P9UA 5SWMA 2VQEK 3UKUB 3ZT2A 5AQPA 4CW7B 4ID1A 2HNZA 1BI4B 4MFBA 4PUOA 4B1VA 2HF4A 4JI2K 1TUUA 4AHCA 3ULDA 3QFPA 2NRTA 2IC3A 2QWNA 4KI6A 3F2KA 1P8ZA 5AQMA 4BC3A 4DV6K 4DSIA 3PSFA 3CG7A 3VTHA 2E6MA 4DTXA 5KPTA 4X65K 1W9HA 3E9LA 3WNFA 2IS3A 2HBJA 4RWTA 2OPPA 1ZBIA 1RT2A 4E7HA 1K8KB 4YOUA 1HUXA 2F8TA 2FF3B 4BC4A 1E4FT 4K43A 3G10A 3MCPA 5GIOA 3K9KA 4Z4GA 3TTFA 3RMBA 3NVKA 4FLXA 3ENHA 4B9LA 3C7NA 3DXKB 3AVIA 3FLCO 1OVQA 4O4GA 2BH1A 5GAHP 2WFBA 3O4QA 3SQ0A 1NJXA 4E1JA 1EKEA 3AVBA 4DUZK 1VQ4N 4ELVA 3ZSRA 4BR0A 2GUIA 5M1NA 4AQYK 2P9NA 1N5YA 4FM1A 4FJMA 4FJ8A 3ZETB 2QWLA 2D5RA 1IG8A 4B1XB 5FPMA 3EY1A 4B1YB 3CCRN 4EAHD 4LSLA 3K57A 5CYMA 4FJGA 4CF2A 1QZ6A 4DSKA 3OVNA 3HRGA 4FJLA 4PL7A 3WXJA 4H5TA 3H1QA 4DFPA 1YTUA 4X62K 3CQYA 2P9PA 3O9RA 2D4WA 3HXMA 3ZSXA 1Q9YA 1NGIA 3K58A 4KHUA 3NGYA 4CFCA 3C95A 3NFAA 4Z4FA 1R0AA 1C1CA 3O3FA 3THYA 3CPWM 5AQZA 2RF2A 1P90A 3M1FA 3IDHA 1KVCA 3AARA 4O8UA 4AHVA 4CFBA 2Q36A 3N4PA 4CGGA 3VEYA 4IO8A 4NCGA 5AQOA 3SUOA 4BR9A 5E41A 2I7PA 1BHLA 1XQSC 1C0GA 4CHPA 4EZ6A 3SCXA 3ULEB 4BDZA 2G8VA 1UA1A 3K9JA 3VEOA 4CJSA 1GLJO 4JRQA 3WNHA 5LMUK 4R5PA 2NRXA 3C0BA 1E3MA 2I5JA 1NLVA 1T44A 1EQYA 1I3AA 1S72N 2O8BA 4CD3A 2ZJPL 3LAMA 1QVFM 3DRPA 3LZIA 3U9ZA 1V4TA 3AO2A 4EP4A 2O8FB 2OPQA 4HHTA 4FLWA 1BQNA 4FVUA 3QB0A 4PKGA 3VQPA 4CEBA 4PY5A 4I9QA 2YX6A 1VSHA 5AQNA 3VF4A 1TKXA 3HYFA 5D3GA 1Z25A 4B9VA 3VQBA 1XUPO 3TAQA 2QWOA 4I9LA 4DFJA 3KLGA 3NGZA 3BP8A 4IXCA 4RW8A 3WXIA 4KTQA 3LL3A 4FZZA 4KTZA 3WXLA 1DGKN 1HJOA 3KLFA 2F9WA 1NGCA 4DU3A 3UKUA 2QWRA 4M41A 3CJAA 4W5NA 1OH8A 2HHVA 3ZCMA 5FLXO 1XC9A 4DQ8A 3QFUA 4JYAK 3MK6A 5E84A 3C94A 3VEVA 4IDHA 1NMDA 3V4IA 4OPAA 4DQSA 1NK5A 5BN8A 1VRUA 1HR0K 1BIUA 3SQ2A 2Z1JA 5MLCQ 1TAQA 2GV9A 5BR9A 1FJGK 4H5RA 1VQ7N 2HHQA 5M1FA 1IBKK 3SPYA 3CMEN 4O44A 4BGBA 4HUGA 3VF6A 2P9IB 1BGXT 4DFMA 1X1PA 2YNFA 3T69A 4DV5K 4LF8K 4CIGA 3AVAA 2GUPA 1Z26A 3OYJA 4LF4K 4EFHA 3KK2A 2YHBA 1FKPA 1VSFA 3HOSA 3ZSQA 3AAPA 4FK2A 3KK3A 1EWRA 2HF3A 4WE1A 3K5MA 2G8IA 4B9MA 3R3LA 2ZWHA 4FM2A 1JJ2M 1WUAA 3U9DA 4YDUA 4K0KK 3MAQA 3OYBA 3MWTA 5AQVA 3UIQA 2WOMA 1IG9A 3LZJA 3RR7A 3MX5A 3VQ6A 3PO4A 3ATVA 3EO3A 4M3TA 2ZF5O 1XMQK 4WQ5A 1D9FA 1XMOK 3GL1A 1ZBHA 4ISFA 4FVMA 4WFBL 4GKKK 4KB1A 3OYFA 1KRPA 1MDUB 4E7IA 2RN2A 4ILHA 3I0RA 3MCAB 4BRQA 2UXDK 4KH5A 4E1MA 2QEXN 5KPRA 4FJHA 1BG3A 3UB5A 2CGJA 2E2NA 4N56A 4CJKA 5GINA 3KLIA 5CZ2A 2H3GX 4K8XA 2DY4A 3QLHA 4RCHA 1VSKA 4BRGA 1VQ9N 4M3WA 5ADXA 4CJFA 4CJWA 4FJ7A 3T3FA 3H45C 3I0SA 3CCSN 3TI0A 4WYBA 4Q5VA 4CF8A 4YHHK 3N4QA 3IS9A 1NGJA 4CEFA 3ID8A 5DMRA 2KHOA 4LFAK 3AO1A 3G4SN 3V9UA 3EZWA 4CJLA 4DV4K 4CF1A 2A1RA 3QEPA 4DTPA 1KLNA 3TAFA 3SUNA 4JS4A 3BUZB 4BY9C 5JLFA 1RTJA 4YY3K 2O8EB 3SV4A 2LSNA 3D2EB 3O6WA 5HP1A 1LAVA 4IO9L 4I2PA 2ZGZA 5CE3A 3WT0A 1Q81O 2OANA 3D2FB 4M45A 2AP1A 4DTMA 4DSLA 3KKSA 3TAGA 3CF5L 2XY7A 4FK4A 3TAPA 3LALA 2NRZA 4BWMA 3LDOA 2ZGYA 4DCHA 3W3DA 1LOTB 4OGCA 3AA2A 4KH4A 1YHQN 4XH5A 3WEEA 1CXUA 4F8RA 1FW6A 3GOIA 2P5GA 5C2DA 4CZLA 4DTRA 1Q82O 4DV1K 4JK7A 5LJVA 1WB9A 4IEIA 1IJJA 1WN7A 2BTFA 1IKWA 5AQGA 1G15A 3SQ4A 5AQYA 3T19A 2CH5A 4AILC 3J7AP 3K5LA 5HRPA 2W6LA 3JS6A 4CJRA 3KD5E 4FWQA 5GAGP 3MN7A 5BPNA 3I56N 4F3TA 2VWKA 4AHRA 3SAFA 1HNZK 4C1NK 5AQXA 2HW3A 1CZBA 4QS7A 5I9EB 4FW1A 3KLEA 3P39A 4H0XB 3VQEA 4CEZA 3C6UA 3ATUA 1DTQA 2PBDA 5FRMA 2O8DB 3VQ7A 5BRHA 1BCOA 3U3GA 4DTUA 3R9PA 3KK1A 3HL8A 4CBWA 4KO0A 2D0OA 2UYTA 4BQLA 1K8AO 2IIRA 3SLCA 3ASMA 3LPTA 1T7PA 3FFKB 3D45A 3U8XA 3OTOK 2FBXA 1U48A 5A2QO 1Q86O 3VQCA 1VAZA 5B8HA 3LANA 1O1WA 4IDKA 5AQHA 1TGOA 2UXCK 3E9OA 3THVA 3SK3A 4W5TA 1KLMA 1KAZA 2X74A 2P9IA 1YT3A 5JVHL 2RPIA 3V1QA 4LF5K 2QWMA 3U3YA 4CGDA 4F2RA 4FWSA 5KGXA 4FJ9A 4CERA 1NGFA 3A5OC 4M63C 1S1TA 1W2BM 2EX3A 4H0OA 1WSFA 3KLHA 3JYTA 4BROA 5LMNK 3BY5A 4B8CA 3THWA 2UXBK 1BL3A 1DT9A 2Q0RA 4BRPA 4O5BA 1HKBA 3CM5A 2QW9A 2WC9A 1QQOA 3KWIA 4OPJA 3HOTA 3OS2A 3DWLA 1NJYA 1J6ZA 2ITGA 1BDGA 3LP1A 2YKNA 2G8WA 4AHSA 3F9KA 1KVAA 4PKIA 2HOEA 4GV6A 4CHNA 1WSIA 3NH0A 2XY5A 3JXUA 2FBVA 4F2SA 5C15A 1NGBA 3ZT3A 1KQSM 4MO5A 5GAEP 2B6AA 5HL7L 4FK0A 4ILJA 4DSEA 3CHWA 4IOXA 4CCHA 2HHHK 4KHYA 4PL8A 5KQ8A 4CEEA 4NLCA 3HZ6A 3OA9A 1KC8O 2A42A 3LM2A 5KGWA 1HKCA 2IVPA 4LD0A 1N36K 1X3NA 4OKKA 1UA0A 1HYVA 1SUQA 3MX2A 3WQUA 3TWHA 3ENBA 2WTUA 1CXQA 3ZX0A 4CD1A 2ZJQL 4OPKA 4C23A 4LF7K 3PUFA 1XHXA 2P9LB 1H1VA 1A5XA 1TL3A 4CI6A 2QTDA 4BC5A 1IV0A 4BRHA 3B8AX 1QTMA 2O8EA 3D2EA 4PA1A 3VA0A 3OYNA 4NCAA 3KD1E 3D2FA 4ILGB 4B1WB 4CHZA 2YKMA 4WQ4C 3VETA 1QHAA 4JV5K 5KRTA 3PY8A 3THXB 2Z1HA 1BOTO 3F5TA 4XEIA 3VTIA 3KJVA 4DV3K 1WSHA 1D8YA 4CZKA 2BUPA 5ADXH 3G0ZA 4FWLA 3DLKA 2E20A 3QMLA 4JI4K 4CEDA 5JS2A 3L2VA 4NYNA 1VQON 3OYGA 4LFBK 1UOCA 4MQ3A 3KZBA 4OLAA 3A2FA 2RE2A 3FZMA 3R8EA 3DLBA 4NLBA 4BRMA 4JLHA 4A2AA 2QM1A 3QNOA 4KTWA 1SKRA 4DR6K 3O4WA 1NKCA 3LP3A 1JLEA 3LAKA 2VG6A 4A5BA 4IG3A 2O8DA 3ZSVA 1NOYA 2UUBK 1WBDA 2F96A 3ZSWA 2VWJA 4DSJA 4C8MA 2E2PA 4NB4A 3H08A 3HM8A 3HBTA 1ASWA 1SAZA 4O8KA 2FSNA 4CZHA 3QINA 3SJJA 5M1PA 4DMNA 1BCMA 1TUYA 2VG7A 1JKHA 3UKRA 3T1YK 5LL6Z 4I2QA 3H3OB 4L3QA 2HMPA 4BWJA 4BC2A 1OH5A 3VQ9A 3T1HK 5J2QA 3IMXA 1KXPA 3KK7A 4JKGB 2OTJN 4DF8A 1KTQA 3L3UA 4YOTA 4JI5K 2D0BA 2BGGA 1NJIO 3S9HA 1I94K 4RW4A 1VQ5N 1ILYA 3EE8A 1TYQA 2UU9K 2P5OA 4OPHA 3P38A 1SL2A 3FZKA 2YV0X 2HSTA 2QWPA 3CCUN 2ATQA 3RSEB 3VQ8A 2VGMA 4BQZA 3DAWA 1IKYA 4E89A 1EP4A 1NOZA 4JKCA 1YIJN 1GLEG 4I6MB 3JSMA 4JD2B 3O3HA 3E66A 4JKBA 3C6AA 4AF1A 4CJEA 1XWLA 3EYZA 1GLCG 1WLJA 5KRSA 4UQGA 4B3SK 3WXKA 3G25A 1SZ2A 3C65A 4C8NA 3PX6A 1HX1A 1YJWN 4CZMA 4DV0K 4DLGA 3QIPA 4EZ9A 4B9NA 4H0YB 4FJKA 3BZCA 4AM7A 2QWQA 3ZSOA 1RDUA 3VGLA 4AHTA 4CESA 1JLAA 5KPZA 3VOVA 3SMPA 4Y1DA 2P1JA 4V19S 2P9SA 1HLUA 3M8QA 1IBMK 3IKMA 2ETJA 1RT3A 3F9MA 1C0MA 4IOAL 3VQAA 4OGEA 4E7KA 4DR2K 4AM6A 1RDBA 1RTHA 1NWKA 1ASUA 4GMJB 1GOCA 1U6ZA 3CQXA 3PX4A 4JI6K 4IEEA 1IO2A 2ITMA 1L3TA 2FLOA 1S6PA 1WBBA 4BVOA 1NG9A 4YFUA 3CCEN 1VQ8N 3HO1A 4JK9A 4DFKA 5EX5A 3CCQN 4LF6K 4FWMA 3MEEA 4H03B 4N47A 2YNGA 3SUQA 4C8KA 3DOLA 3R1XA 4FLZA 4FPAA 3O8MA 3VESA 1D4XA 3TTDA 1O13A 3Q7CA 3SZ2A 3EE9A 2P9LA 4CECA 2UUAK 3ZEUB 3V6DA 3HP6A 1N6QA 2A41A 2NRHA 4DWIA 2HHSA 2QKKA 3C6TA 4JKHA 1ZXOA 3EZ5A 3NH2A 3LWLA 2A5XA 4A59A 5EXWA 3SUPA 1VK0A 4LH5A 1CLQA 2NRVA 3AA3A 2HBLA 2OPRA 4NO7A 1BI4A 3MMVA 1RT7A 4JI3K 5IT9O 5AFUH 1WAJA 3A5LC 5HBMA 2OZMA 4FXDA 3IRXA 4MDBA 2G8HA 2NNWA 2F7TA 2KZZA 4DUYK 2CGLA 3CC2N 1U04A 1FXXA 1S6QA 1RBTA 4DSFA 3DJCA 2RHKA 1JL2A 3KWGA 5AJ3K 1LCUA 4B3OA 1B9FA 5AQSA 1N8RO 4GV9A 1C0TA 1BIZA 4Z4HA 2KZMA 1Y64A 1K8KA 2CH6A 2O4GA 3NF9A 2W41A 1X9WA 4CJVA 1ATSA 3WNGA 1KAXA 4LFCK 1IH7A 3C6HA 2YJEA 3TR8A 5TKWA 4BR2A 3EL2A 1SL0A 4JI8K 3DXKA 3VN5A 1DEJA 1D9DA 1J5OA 3DLHA 1SS6A 4G1QA 2WONA 4H5VA 4JKDA 3SQ1A 3TARA 1T3VA 1HNVA 1X9SA 4N41A 1LWEA 3QEVA 1JLBA 2FBTA 2BE2A 4BRFA 3QEIA 5AZJB 3P31A 3ZETA 2D1KA 4CHOA 2G8KA 1E4GT 5FDLA 3A8YA 1B9DA 3S3OA 2GWKA 3S41A 3M6GA 3NAEA 3VA3A 1SL1A 3L2WA 4DB3A 1NK7A 5EOYA 3V9ZA 3ZSYA 2VGNA 1JLGA 2WUSA 1GLAG 3BF3A 3NF6A 4DQQA 1C0UA 5JICA 3J8AA 2IAJA 5EY4A 2HVIA 3LPUA 1JLQA 3AO4A 5DK5A 3G6EN 3H1VX 5M1QA 1HKGA 1BA1A 1N34K 4LF9K 4B9TA 5AQIA 1BA0A 3ZSZA 2DFHA 1BWFO 1TK0A 1RBSA 4HCBA 4KB0A 2AJQA 4ISGA 2DPNA 3MN5A 3ALYA 3FFIA 1WSGA 2P9KB 3BEXA 1R59O 3MN6A 1TK8A 4OO1J 4B9UA 4L8RB 3PIOL 4I6MA 4JD2A 5C42A 3AVJA 4E7JA 4B9QA 3VEWA 4E0DA 2FSJA 3GG4A 4JEPA 4CGFA 1IBLK 1TKDA 5J1EA 3DXMB 1NGDA 1L3VA 4LY7A 1QQNA 3TAEA 3ULEA 1X9MA 3MN9A 3TAMA 3VQQA 5FPNA 2JLEA 2O4IA 3BZKA 4DS5A 5CHIA 1EX4A 4E3SA 4IJAA 5LY3A 1TAUA 3HVRA 4YORA 2Z1GA 1VSMA 2FC0A 4FSVA 3QETA 2GX9A 3OYEA 1U47A 1NJZA 4AH9A 2PYJA 3AVGA 2UUCK 3AGRA 3PV8A 4CJPA 3H6EA 4KHQA 4M3RA 1RDAA 1J53A 2HNDA 2QA4N 2O8FA 4CZEA 4DG1A 1QQCA 1REVA 3H3NO 4M7XA 1KCFA 3CPEA 1TKZA 4PQUA 1QQMA 3CCMN 3K2PA 4KFBA 1ESVA 3ZT0A 2QK9A 3QO9A 3HVTA 2ASOA 4IG0A 5IWAK 1VQMN 3IAYA 2GTDA 4CEAA 2E2OA 3TTCA 4A62A 3K5NA 2Z1IA 3OBYA 2ZJRL 3RTVA 3HK2A 4F9OA 3AAQA 5AQFA 1C1AA 4CZIA 2ASMA 4DTOA 3S3NA 4KHPK 3LDLA 3HJFA 1JLFA 4DR3K 4N5SA 4QAGA 2KW4A 4JAXA 5F2RA 4HWIA 4FLVA 3V1OA 1GLBG 3AY9A 2YHWA 1NBWA 5AQJA 4CJQA 4FLTA 4G9ZA 1B92A 3QICA 4J2BA 1JCFA 1NGHA 3E9PA 3D0PA 3VEZA 4CZFA 2V51B 3SYZA 1BQMA 5FROA 5T7BA 2OZSA 1ATNA 4FL9A 3LDSA 1JCGA 4J2EA 5H1SQ 4RG8A 4KAZA 4CZGA 1C6VA 1Y97A 4BRCA 1GOBA 4B08A 1N33K 3SPZA 3R6MA 5SZTA 3O5BA 1S9EA 1HJRA 3L6QA 2VQFK 1K73O 3AVKA 3HTVA 4CZJA 1MA9B 2P9NB 1KAYA 1ATRA 2PZSA 1RTDA 3IUCA 3IG1A 2FF6A 4H0TB 4X64K 4ISEA 4M3ZA 4GY2B 2W42A 3O9QA 1SV5A 2YJFA 5C2FA 1HPZA
chains in the Genus database with same CATH topology
3OJUA 1S5JA 2DTUA 4KHNA 3M8RA 4FLWA 4CEDA 5JS2A 1T05A 3L2VA 1BQNA 1L5UA 4NYNA 4M3YA 5HRSA 3PX0A 3VQPA 3OYGA 3ZT1A 1UOCA 4MQ3A 4Z0UA 1DLOA 3P5JA 4CEBA 4PY5A 4I9QA 4OLAA 1WAFA 1VSHA 2OPSA 3A2FA 2YNHA 1QSYA 1TKXA 4AHUA 1S1XA 3HSTB 3HYFA 3MXMA 1Z25A 1U49A 3DLBA 4KV8A 4B9VA 5D3GA 1LV5A 4O0JA 3VQBA 3OYCA 4JLHA 3QNOA 4BE1A 3KIOA 4KTWA 3M8SA 4BE0A 4DF4A 3TAQA 2Q3SA 5JS1A 3U6FA 4IFVA 5HLFA 1SKRA 4CGHA 5C25A 4I9LA 3NDKA 4DFJA 3KLGA 2X6NA 3NGZA 3LP3A 1NKCA 1FK9A 4B8AB 4RW8A 1JLEA 4KTQA 5KTQA 4FZZA 3DOKA 1LWCA 2VG6A 3LAKA 3NE6A 5HROA 4KTZA 4M42A 4CF0A 4IG3A 3ZSVA 1NOYA 3L8BA 2F96A 3ZSWA 4Z4IA 2VWJA 4DSJA 3KLFA 4C8MA 4DU3A 3BDPA 3H08A 3SI6A 4FZYA 2ZQBA 3DLKA 4M41A 5J2NA 2XY6A 4W5NA 1ASWA 1QHTA 2HHVA 1A5VA 3V9WA 3ZCMA 1T03A 3QINA 2DFEA 1XC9A 4EP5A 3QNNA 3SJJA 3VQ5A 1KFSA 1YTAA 4DMNA 4XIUA 4Z4EA 1BCMA 3C94A 2VG7A 1JKHA 1DTTA 1J9AA 2GBZA 4DTNA 3S3MA 4I2QA 3HT3A 3V4IA 4DQSA 2X78A 2KQ2A 2XO7A 1NK5A 1LWFA 4BWJA 3KKRA 1VRUA 2BANA 3AO3A 3DLEA 3NF8A 2HHWA 3VQ9A 1HRHA 1BIUA 5J2QA 5J2PA 4KHSA 3SQ2A 2Z1JA 1VRTA 1TAQA 4DF8A 1KTQA 3L3UA 2GV9A 3HM9A 4W5RA 4CK2A 5CY4A 2D0BA 2HHQA 2BGGA 3LP0A 4ZHRA 3S9HA 4RW4A 3SPYA 4FZXC 3F73A 4ID5A 2P5OA 4B9SA 4O44A 3MEGA 1SL2A 3HJFA 3M8PA 4HUGA 2YV0X 4FLUA 2ATQA 2D0CA 2IOCA 3VQ8A 2XHBA 1BGXT 4DFMA 1X1PA 1IKYA 2YNFA 4E89A 4CEQA 1EP4A 1NOZA 1VSIA 3OYDA 4CIGA 3JSMA 4IFYA 3AVAA 3O3HA 3QESA 3K5OA 4QCLA 1Z26A 3OYJA 5CYQA 2JGUA 4E7LA 1VSDA 4F4KA 4CJEA 1XWLA 2YHBA 3KK2A 1FKPA 3EYZA 1T8EA 1VSFA 4FJNA 1WLJA 4H4MA 3ZSQA 4O55A 1HMVA 3VQDA 4NYFA 5KRSA 4UQGA 3KK3A 4FK2A 3CFRA 1KLNA 1TVRA 4WE1A 3K5MA 3PX6A 4C8NA 3K59A 4B9MA 2G8IA 4CJTA 1F21A 2B4JA 2KFZA 4FM2A 3MXIA 4DLGA 3QIPA 4IKFA 4RW9A 4EZ9A 4FCYA 4B9NA 4FJKA 2RKIA 3MAQA 3ZSOA 3OYBA 3V1RA 4AHTA 4CESA 1JLAA 3UIQA 2WOMA 4CFAA 1IG9A 3LZJA 3RR7A 2B5JA 3L3VA 4Y1DA 2P1JA 3L2UA 2OA8A 2F8SA 1LW2A 3BGRA 3VQ6A 3PO4A 3M8QA 4Z4CA 1Q8IA 1RT3A 2ETJA 4J2AA 4M3TA 1C0MA 4H4OA 3DM2A 1D9FA 3SNNA 3VQAA 4OGEA 3O4NA 1EXQA 3OYKA 4E7KA 1S9GA 4F3OA 1ZBHA 4FVMA 4KB1A 4H8KA 1ZBUA 3OYFA 3ZT4A 1NK9A 4E7IA 1KRPA 2RN2A 3I0RA 4C8OA 1RDBA 1U4BA 1RTHA 2EHGA 3CM6A 1ASUA 4E1MA 1Q9XA 4HVJA 4OLBA 4FJHA 4GMJB 4FW2A 1GOCA 1LAWA 4N56A 3I8DA 3PX4A 4HUFA 3RRGA 4CJKA 3KLIA 5CZ2A 4K8XA 1IO2A 2DY4A 1L3TA 4KRFA 3QLHA 1RTIA 1S6PA 3HPHA 1NKEA 1RT4A 4CJUA 4YFUA 1ASVA 1VSKA 2G8UA 4KI4A 4DFKA 4FJJA 3HO1A 1JL1A 1UWBA 4M3WA 3MEEA 4CJFA 4CJWA 4N47A 4BACA 4FJ7A 2E6LA 2YNGA 3T3FA 3SUQA 4C8KA 3DOLA 4FLZA 3I0SA 4N76A 3TI0A 4RW6A 1S1VA 1L3SA 1FKOA 4CGJA 4Q5VA 4CF8A 1RBUA 3AVHA 4CHYA 3IS9A 1TL1A 4DTSA 4KKOA 3O3GA 4KHWA 5I42A 4CEFA 3SZ2A 2YNIA 5DMRA 4KREA 2BDPA 4GVMA 4CECA 1XI1A 1QS4A 3V6DA 3QERA 3AO1A 3HP6A 3V9UA 4CJLA 1N6QA 2A1RA 4CF1A 4DWIA 2HHSA 1VSJA 2QKKA 3C6TA 3QEPA 1JLCA 4RW7A 4DQRA 4DTPA 3EZ5A 4BE2A 3NH2A 3LWLA 4DU1A 3QEXA 3TAFA 2Y1IA 3B6PA 4K8ZA 1RBRA 1SKWA 3SUPA 1VSLA 1ITGA 2ZE2A 2XRIA 1VK0A 4JS4A 3SUNA 1NK0A 4LH5A 1RTJA 1L3UA 1CLQA 3AA3A 1S1WA 4HUEA 3SV4A 2LSNA 1JXEA 3OYHA 2OPRA 5HP1A 1BI4A 1LAVA 1RT7A 5CZ1A 4W5OA 4I2PA 4JS5A 4FM0A 1WAJA 5HBMA 5C24A 4CEOA 5I3UA 2OZMA 2OZSA 4E19A 4FXDA 3IRXA 1KVBA 2G8HA 2VG5A 2G8FA 3OY9A 4M45A 4CE9A 3L2RA 2KZZA 4DTMA 1RDCA 1NJWA 4DSLA 1HNIA 3KKSA 3P1GA 2FBYA 3TAGA 1EETA 1IKXA 1U04A 2XY7A 4FK4A 3TAPA 1FXXA 1S6QA 1RBTA 4DSFA 1WSEA 3SV3A 3NGIA 2HHTA 3OYLA 1NK4A 1RT1A 3LALA 1JL2A 3QIOA 3E01A 4BWMA 1BISA 3NH1A 1J54A 4KPYA 4B3OA 4HCCA 1B9FA 4YNQA 2A1SA 4O0IA 4OJRA 1C0TA 3AVLA 1ZBLA 3B6OA 4PWDA 1BIZA 4ELTA 1KFDA 4OGCA 3AA2A 3HP9A 4Z4HA 2KZMA 4W5QA 1NKBA 3OJSA 2ZD1A 4CJ3A 2O4GA 3NF9A 1CXUA 1S1UA 1TKTA 4F8RA 3LP2A 3MEDA 1X9WA 4CJVA 2D0AA 2P5GA 3WNGA 3LWMA 4DTRA 1ZYQA 1IH7A 3MXJA 4CK1A 3NCIA 1KSPA 3RMDA 3TR8A 2HB5A 3V9XA 1GOAA 1WN7A 1RT6A 4LH4A 4Y1CA 1SL0A 1IKWA 4CIFA 2PY5A 4J2DA 3VN5A 1RNHA 1D9DA 3SQ4A 1G15A 1J5OA 3DLHA 4CIEA 3V81A 1RBVA 3T19A 3CFPA 1HYSA 2KTQA 4AILC 4JRPA 4G1QA 1HQUA 2WONA 3OYMA 1CZ9A 5HRPA 2IGIA 3K5LA 4CJRA 1TK5A 2PYLA 3KD5E 3SQ1A 2HNYA 3TABA 3TARA 4FYDA 1HNVA 3AVNA 1X9SA 4N41A 1LWEA 3QEVA 4F3TA 2YHAA 1JLBA 4DTJA 2VWKA 4AHRA 1YVUA 2FBTA 2BE2A 1TV6A 1QSSA 2NUBA 2HW3A 1CZBA 3QEIA 4NCBA 2R7YA 3V9SA 4FW1A 3OS0A 1WNSA 3KLEA 2OYQA 4CHOA 3NHGA 2G8KA 5FDLA 3VQEA 4CEZA 1K6YA 1B9DA 3C6UA 3S3OA 1C1BA 1DTQA 4CJ5A 4FJXA 2QXFA 3VQ7A 5SWMA 5FRMA 1BCOA 5HRRA 3U3GA 3NAEA 3VA3A 4DTUA 3L2WA 3MECA 4CF9A 1NK7A 1SL1A 2HHUA 3V9ZA 3KK1A 3HL8A 3AVMA 3ZSYA 3ZT2A 1JLGA 2QKBA 4KO0A 4ID1A 4ZTJA 2HNZA 3ASMA 3NF6A 4DQQA 3LPTA 3NF7A 1T7PA 1C0UA 4KHUA 3CYMA 1BI4B 4MFBA 2IAJA 3D45A 2G8VA 4PUOA 2HVIA 3LPUA 2FBXA 3DRSA 3DYAA 1JLQA 3AO4A 5DK5A 4CFDA 1U48A 4AHCA 3ULDA 2IC3A 3VQCA 4KI6A 1A5WA 3LANA 1O1WA 1D5AA 4B9TA 3DRRA 2HVHA 4IDKA 3ZSZA 1TGOA 2DFHA 4DSIA 3CG7A 1TK0A 1RBSA 4CHQA 4HCBA 2E6MA 3THVA 4DTXA 4KB0A 4W5TA 1KLMA 2AJQA 1JXBA 3CQ8A 2X74A 3RRHA 3ALYA 1W9HA 1WSGA 1YT3A 3CFOA 3FFIA 1TK8A 3WNFA 4B9UA 4L8RB 4Q0BA 2IS3A 4FLYA 4C8LA 2RPIA 3V1QA 1XHZA 5C42A 2OPPA 3U3YA 1ZBIA 1RT2A 4CGDA 4E7HA 4F2RA 3AVJA 4IBNA 4E7JA 3ITHA 5KGXA 2F8TA 4E0DA 4FJ9A 4CERA 2XY8A 3G10A 3NBPA 4CGFA 1TKDA 1S1TA 5J1EA 4DQPA 2EX3A 3AVFA 5EU7A 4Z4GA 1WSFA 3RMBA 1L3VA 4LY7A 3KLHA 3JYTA 3TAEA 1X9MA 4LSNA 4FLXA 4B9LA 4DS4A 3TAMA 3VQQA 4B8CA 2JLEA 2HMIA 3AVIA 2O4IA 3KTQA 1BL3A 4DS5A 4O4GA 1EX4A 2KFNA 3OS1A 4E3SA 4O5BA 3CM5A 3O4QA 3SQ0A 3HVRA 1NJXA 3HPOA 1TAUA 3AO5A 2Z1GA 1VSMA 4OPJA 2FC0A 3AVBA 1EKEA 3OYAA 4ELUA 4ELVA 3AVCA 3ZSRA 3QETA 3OYEA 3OS2A 1U47A 4AH9A 1NJZA 3AVGA 2PYJA 1RT5A 2GUIA 1HQEA 1NK6A 3PV8A 1RCHA 1NJYA 2ITGA 4I7FA 3LP1A 4CJPA 3RMAA 2YKNA 2G8WA 4KHQA 1N5YA 4FM1A 4FJMA 4AHSA 4M3RA 4FJ8A 2HHXA 3F9KA 3AV9A 1RDAA 1KVAA 2D5RA 1J53A 2HNDA 4CHNA 1I39A 3EY1A 1WSIA 3WNEA 1QE1A 3HPGA 3NH0A 2XY5A 2FBVA 4F2SA 4OKJA 5J2MA 4LSLA 3K57A 1W0HA 5CYMA 4FJGA 4DG1A 4CF2A 4DSKA 1QQCA 1REVA 2DFFA 1WSJA 3OVNA 1KCFA 3ZT3A 1TKZA 1ZBFA 4PQUA 4FJLA 4TSXA 1U45A 3K2PA 4KFBA 3ZT0A 2QK9A 2B6AA 3QO9A 3L2QA 3HVTA 4FK0A 4M3XA 4IG0A 4DSEA 3TANA 4CCHA 3IAYA 4CEAA 4QOZB 1RILA 3DMJA 4KHYA 4BDPA 3DI6A 3K5NA 3RTVA 2Z1IA 4CEEA 1IKVA 3HK2A 4DFPA 1YTUA 1C1AA 5KGWA 4DTOA 4LD0A 3HXMA 3S3NA 3ZSXA 1Q9YA 4DLEA 3K58A 4OKKA 1JLFA 1UA0A 3NGYA 1HYVA 4CFCA 3C95A 1SUQA 3NFAA 4N5SA 4HTUA 2X6SA 3QEWA 1QSLA 4QAGA 4Z4FA 2KW4A 3P83D 1MU2A 4E1NA 1C1CA 3SCXA 4ZTFA 3O3FA 3TWHA 1R0AA 1CXQA 4CJ4A 4FLVA 2RF2A 3V1OA 4OPKA 1KVCA 4CJQA 4FLTA 3PUFA 4AHVA 3PO5A 1XHXA 4OVLA 4CFBA 4FJIA 1B92A 3RMCA 4CGGA 1A5XA 1SKSA 1TL3A 4NCGA 4J2BA 4ICLA 3AA4A 4OKEA 3VQ4A 3SUOA 3T1AA 1HYZA 2P51A 5E41A 3D0PA 1BHLA 4GW6A 4CHPA 3SYZA 1QTMA 4EZ6A 4PA1A 1BQMA 3ISNC 5FROA 5T7BA 4BDZA 2IDOA 3OYNA 1UAXA 3VA0A 1LW0A 1UA1A 3LDSA 4J2EA 4NCAA 4RG8A 3KD1E 4KAZA 4CJSA 5HRNA 5K14A 3RWUA 1C6VA 4BDYA 3RR8A 2Y1JA 1NK8A 1Y97A 4CHZA 2YKMA 4FJ5A 1GOBA 4B08A 4JRQA 3WNHA 3SPZA 5FRNA 5SZTA 4R5PA 3OYIA 1S9EA 1HJRA 2E4LA 5KRTA 4DU4A 3PY8A 2I5JA 3AVKA 5KI6A 1I3AA 2PZSA 1RTDA 3DLGA 2Z1HA 3IG1A 4DQIA 3LAMA 4M3ZA 3DRPA 3LZIA 3AO2A 3KJVA 4CGIA 4EP4A 2W42A 1WSHA 1VSEA 1D8YA 1SV5A 3AA5X 3G0ZA 3DLRA 2OPQA 4M3UA 4HHTA 4CK3A 1HPZA 1RDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJU A;  1S5J A;  2DTU A;  4KHN A;  3M8R A;  4FLW A;  4CED A;  5JS2 A;  1T05 A;  3L2V A;  1BQN A;  1L5U A;  4NYN A;  4M3Y A;  5HRS A;  3PX0 A;  3VQP A;  3OYG A;  3ZT1 A;  1UOC A;  4MQ3 A;  4Z0U A;  1DLO A;  3P5J A;  4CEB A;  4PY5 A;  4I9Q A;  4OLA A;  1WAF A;  1VSH A;  2OPS A;  3A2F A;  2YNH A;  1QSY A;  1TKX A;  4AHU A;  1S1X A;  3HST B;  3HYF A;  3MXM A;  1Z25 A;  1U49 A;  3DLB A;  4KV8 A;  4B9V A;  5D3G A;  1LV5 A;  4O0J A;  3VQB A;  3OYC A;  4JLH A;  3QNO A;  4BE1 A;  3KIO A;  4KTW A;  3M8S A;  4BE0 A;  4DF4 A;  3TAQ A;  2Q3S A;  5JS1 A;  3U6F A;  4IFV A;  5HLF A;  1SKR A;  4CGH A;  5C25 A;  4I9L A;  3NDK A;  4DFJ A;  3KLG A;  2X6N A;  3NGZ A;  3LP3 A;  1NKC A;  1FK9 A;  4B8A B;  4RW8 A;  1JLE A;  4KTQ A;  5KTQ A;  4FZZ A;  3DOK A;  1LWC A;  2VG6 A;  3LAK A;  3NE6 A;  5HRO A;  4KTZ A;  4M42 A;  4CF0 A;  4IG3 A;  3ZSV A;  1NOY A;  3L8B A;  2F96 A;  3ZSW A;  4Z4I A;  2VWJ A;  4DSJ A;  3KLF A;  4C8M A;  4DU3 A;  3BDP A;  3H08 A;  3SI6 A;  4FZY A;  2ZQB A;  3DLK A;  4M41 A;  5J2N A;  2XY6 A;  4W5N A;  1ASW A;  1QHT A;  2HHV A;  1A5V A;  3V9W A;  3ZCM A;  1T03 A;  3QIN A;  2DFE A;  1XC9 A;  4EP5 A;  3QNN A;  3SJJ A;  3VQ5 A;  1KFS A;  1YTA A;  4DMN A;  4XIU A;  4Z4E A;  1BCM A;  3C94 A;  2VG7 A;  1JKH A;  1DTT A;  1J9A A;  2GBZ A;  4DTN A;  3S3M A;  4I2Q A;  3HT3 A;  3V4I A;  4DQS A;  2X78 A;  2KQ2 A;  2XO7 A;  1NK5 A;  1LWF A;  4BWJ A;  3KKR A;  1VRU A;  2BAN A;  3AO3 A;  3DLE A;  3NF8 A;  2HHW A;  3VQ9 A;  1HRH A;  1BIU A;  5J2Q A;  5J2P A;  4KHS A;  3SQ2 A;  2Z1J A;  1VRT A;  1TAQ A;  4DF8 A;  1KTQ A;  3L3U A;  2GV9 A;  3HM9 A;  4W5R A;  4CK2 A;  5CY4 A;  2D0B A;  2HHQ A;  2BGG A;  3LP0 A;  4ZHR A;  3S9H A;  4RW4 A;  3SPY A;  4FZX C;  3F73 A;  4ID5 A;  2P5O A;  4B9S A;  4O44 A;  3MEG A;  1SL2 A;  3HJF A;  3M8P A;  4HUG A;  2YV0 X;  4FLU A;  2ATQ A;  2D0C A;  2IOC A;  3VQ8 A;  2XHB A;  1BGX T;  4DFM A;  1X1P A;  1IKY A;  2YNF A;  4E89 A;  4CEQ A;  1EP4 A;  1NOZ A;  1VSI A;  3OYD A;  4CIG A;  3JSM A;  4IFY A;  3AVA A;  3O3H A;  3QES A;  3K5O A;  4QCL A;  1Z26 A;  3OYJ A;  5CYQ A;  2JGU A;  4E7L A;  1VSD A;  4F4K A;  4CJE A;  1XWL A;  2YHB A;  3KK2 A;  1FKP A;  3EYZ A;  1T8E A;  1VSF A;  4FJN A;  1WLJ A;  4H4M A;  3ZSQ A;  4O55 A;  1HMV A;  3VQD A;  4NYF A;  5KRS A;  4UQG A;  3KK3 A;  4FK2 A;  3CFR A;  1KLN A;  1TVR A;  4WE1 A;  3K5M A;  3PX6 A;  4C8N A;  3K59 A;  4B9M A;  2G8I A;  4CJT A;  1F21 A;  2B4J A;  2KFZ A;  4FM2 A;  3MXI A;  4DLG A;  3QIP A;  4IKF A;  4RW9 A;  4EZ9 A;  4FCY A;  4B9N A;  4FJK A;  2RKI A;  3MAQ A;  3ZSO A;  3OYB A;  3V1R A;  4AHT A;  4CES A;  1JLA A;  3UIQ A;  2WOM A;  4CFA A;  1IG9 A;  3LZJ A;  3RR7 A;  2B5J A;  3L3V A;  4Y1D A;  2P1J A;  3L2U A;  2OA8 A;  2F8S A;  1LW2 A;  3BGR A;  3VQ6 A;  3PO4 A;  3M8Q A;  4Z4C A;  1Q8I A;  1RT3 A;  2ETJ A;  4J2A A;  4M3T A;  1C0M A;  4H4O A;  3DM2 A;  1D9F A;  3SNN A;  3VQA A;  4OGE A;  3O4N A;  1EXQ A;  3OYK A;  4E7K A;  1S9G A;  4F3O A;  1ZBH A;  4FVM A;  4KB1 A;  4H8K A;  1ZBU A;  3OYF A;  3ZT4 A;  1NK9 A;  4E7I A;  1KRP A;  2RN2 A;  3I0R A;  4C8O A;  1RDB A;  1U4B A;  1RTH A;  2EHG A;  3CM6 A;  1ASU A;  4E1M A;  1Q9X A;  4HVJ A;  4OLB A;  4FJH A;  4GMJ B;  4FW2 A;  1GOC A;  1LAW A;  4N56 A;  3I8D A;  3PX4 A;  4HUF A;  3RRG A;  4CJK A;  3KLI A;  5CZ2 A;  4K8X A;  1IO2 A;  2DY4 A;  1L3T A;  4KRF A;  3QLH A;  1RTI A;  1S6P A;  3HPH A;  1NKE A;  1RT4 A;  4CJU A;  4YFU A;  1ASV A;  1VSK A;  2G8U A;  4KI4 A;  4DFK A;  4FJJ A;  3HO1 A;  1JL1 A;  1UWB A;  4M3W A;  3MEE A;  4CJF A;  4CJW A;  4N47 A;  4BAC A;  4FJ7 A;  2E6L A;  2YNG A;  3T3F A;  3SUQ A;  4C8K A;  3DOL A;  4FLZ A;  3I0S A;  4N76 A;  3TI0 A;  4RW6 A;  1S1V A;  1L3S A;  1FKO A;  4CGJ A;  4Q5V A;  4CF8 A;  1RBU A;  3AVH A;  4CHY A;  3IS9 A;  1TL1 A;  4DTS A;  4KKO A;  3O3G A;  4KHW A;  5I42 A;  4CEF A;  3SZ2 A;  2YNI A;  5DMR A;  4KRE A;  2BDP A;  4GVM A;  4CEC A;  1XI1 A;  1QS4 A;  3V6D A;  3QER A;  3AO1 A;  3HP6 A;  3V9U A;  4CJL A;  1N6Q A;  2A1R A;  4CF1 A;  4DWI A;  2HHS A;  1VSJ A;  2QKK A;  3C6T A;  3QEP A;  1JLC A;  4RW7 A;  4DQR A;  4DTP A;  3EZ5 A;  4BE2 A;  3NH2 A;  3LWL A;  4DU1 A;  3QEX A;  3TAF A;  2Y1I A;  3B6P A;  4K8Z A;  1RBR A;  1SKW A;  3SUP A;  1VSL A;  1ITG A;  2ZE2 A;  2XRI A;  1VK0 A;  4JS4 A;  3SUN A;  1NK0 A;  4LH5 A;  1RTJ A;  1L3U A;  1CLQ A;  3AA3 A;  1S1W A;  4HUE A;  3SV4 A;  2LSN A;  1JXE A;  3OYH A;  2OPR A;  5HP1 A;  1BI4 A;  1LAV A;  1RT7 A;  5CZ1 A;  4W5O A;  4I2P A;  4JS5 A;  4FM0 A;  1WAJ A;  5HBM A;  5C24 A;  4CEO A;  5I3U A;  2OZM A;  2OZS A;  4E19 A;  4FXD A;  3IRX A;  1KVB A;  2G8H A;  2VG5 A;  2G8F A;  3OY9 A;  4M45 A;  4CE9 A;  3L2R A;  2KZZ A;  4DTM A;  1RDC A;  1NJW A;  4DSL A;  1HNI A;  3KKS A;  3P1G A;  2FBY A;  3TAG A;  1EET A;  1IKX A;  1U04 A;  2XY7 A;  4FK4 A;  3TAP A;  1FXX A;  1S6Q A;  1RBT A;  4DSF A;  1WSE A;  3SV3 A;  3NGI A;  2HHT A;  3OYL A;  1NK4 A;  1RT1 A;  3LAL A;  1JL2 A;  3QIO A;  3E01 A;  4BWM A;  1BIS A;  3NH1 A;  1J54 A;  4KPY A;  4B3O A;  4HCC A;  1B9F A;  4YNQ A;  2A1S A;  4O0I A;  4OJR A;  1C0T A;  3AVL A;  1ZBL A;  3B6O A;  4PWD A;  1BIZ A;  4ELT A;  1KFD A;  4OGC A;  3AA2 A;  3HP9 A;  4Z4H A;  2KZM A;  4W5Q A;  1NKB A;  3OJS A;  2ZD1 A;  4CJ3 A;  2O4G A;  3NF9 A;  1CXU A;  1S1U A;  1TKT A;  4F8R A;  3LP2 A;  3MED A;  1X9W A;  4CJV A;  2D0A A;  2P5G A;  3WNG A;  3LWM A;  4DTR A;  1ZYQ A;  1IH7 A;  3MXJ A;  4CK1 A;  3NCI A;  1KSP A;  3RMD A;  3TR8 A;  2HB5 A;  3V9X A;  1GOA A;  1WN7 A;  1RT6 A;  4LH4 A;  4Y1C A;  1SL0 A;  1IKW A;  4CIF A;  2PY5 A;  4J2D A;  3VN5 A;  1RNH A;  1D9D A;  3SQ4 A;  1G15 A;  1J5O A;  3DLH A;  4CIE A;  3V81 A;  1RBV A;  3T19 A;  3CFP A;  1HYS A;  2KTQ A;  4AIL C;  4JRP A;  4G1Q A;  1HQU A;  2WON A;  3OYM A;  1CZ9 A;  5HRP A;  2IGI A;  3K5L A;  4CJR A;  1TK5 A;  2PYL A;  3KD5 E;  3SQ1 A;  2HNY A;  3TAB A;  3TAR A;  4FYD A;  1HNV A;  3AVN A;  1X9S A;  4N41 A;  1LWE A;  3QEV A;  4F3T A;  2YHA A;  1JLB A;  4DTJ A;  2VWK A;  4AHR A;  1YVU A;  2FBT A;  2BE2 A;  1TV6 A;  1QSS A;  2NUB A;  2HW3 A;  1CZB A;  3QEI A;  4NCB A;  2R7Y A;  3V9S A;  4FW1 A;  3OS0 A;  1WNS A;  3KLE A;  2OYQ A;  4CHO A;  3NHG A;  2G8K A;  5FDL A;  3VQE A;  4CEZ A;  1K6Y A;  1B9D A;  3C6U A;  3S3O A;  1C1B A;  1DTQ A;  4CJ5 A;  4FJX A;  2QXF A;  3VQ7 A;  5SWM A;  5FRM A;  1BCO A;  5HRR A;  3U3G A;  3NAE A;  3VA3 A;  4DTU A;  3L2W A;  3MEC A;  4CF9 A;  1NK7 A;  1SL1 A;  2HHU A;  3V9Z A;  3KK1 A;  3HL8 A;  3AVM A;  3ZSY A;  3ZT2 A;  1JLG A;  2QKB A;  4KO0 A;  4ID1 A;  4ZTJ A;  2HNZ A;  3ASM A;  3NF6 A;  4DQQ A;  3LPT A;  3NF7 A;  1T7P A;  1C0U A;  4KHU A;  3CYM A;  1BI4 B;  4MFB A;  2IAJ A;  3D45 A;  2G8V A;  4PUO A;  2HVI A;  3LPU A;  2FBX A;  3DRS A;  3DYA A;  1JLQ A;  3AO4 A;  5DK5 A;  4CFD A;  1U48 A;  4AHC A;  3ULD A;  2IC3 A;  3VQC A;  4KI6 A;  1A5W A;  3LAN A;  1O1W A;  1D5A A;  4B9T A;  3DRR A;  2HVH A;  4IDK A;  3ZSZ A;  1TGO A;  2DFH A;  4DSI A;  3CG7 A;  1TK0 A;  1RBS A;  4CHQ A;  4HCB A;  2E6M A;  3THV A;  4DTX A;  4KB0 A;  4W5T A;  1KLM A;  2AJQ A;  1JXB A;  3CQ8 A;  2X74 A;  3RRH A;  3ALY A;  1W9H A;  1WSG A;  1YT3 A;  3CFO A;  3FFI A;  1TK8 A;  3WNF A;  4B9U A;  4L8R B;  4Q0B A;  2IS3 A;  4FLY A;  4C8L A;  2RPI A;  3V1Q A;  1XHZ A;  5C42 A;  2OPP A;  3U3Y A;  1ZBI A;  1RT2 A;  4CGD A;  4E7H A;  4F2R A;  3AVJ A;  4IBN A;  4E7J A;  3ITH A;  5KGX A;  2F8T A;  4E0D A;  4FJ9 A;  4CER A;  2XY8 A;  3G10 A;  3NBP A;  4CGF A;  1TKD A;  1S1T A;  5J1E A;  4DQP A;  2EX3 A;  3AVF A;  5EU7 A;  4Z4G A;  1WSF A;  3RMB A;  1L3V A;  4LY7 A;  3KLH A;  3JYT A;  3TAE A;  1X9M A;  4LSN A;  4FLX A;  4B9L A;  4DS4 A;  3TAM A;  3VQQ A;  4B8C A;  2JLE A;  2HMI A;  3AVI A;  2O4I A;  3KTQ A;  1BL3 A;  4DS5 A;  4O4G A;  1EX4 A;  2KFN A;  3OS1 A;  4E3S A;  4O5B A;  3CM5 A;  3O4Q A;  3SQ0 A;  3HVR A;  1NJX A;  3HPO A;  1TAU A;  3AO5 A;  2Z1G A;  1VSM A;  4OPJ A;  2FC0 A;  3AVB A;  1EKE A;  3OYA A;  4ELU A;  4ELV A;  3AVC A;  3ZSR A;  3QET A;  3OYE A;  3OS2 A;  1U47 A;  4AH9 A;  1NJZ A;  3AVG A;  2PYJ A;  1RT5 A;  2GUI A;  1HQE A;  1NK6 A;  3PV8 A;  1RCH A;  1NJY A;  2ITG A;  4I7F A;  3LP1 A;  4CJP A;  3RMA A;  2YKN A;  2G8W A;  4KHQ A;  1N5Y A;  4FM1 A;  4FJM A;  4AHS A;  4M3R A;  4FJ8 A;  2HHX A;  3F9K A;  3AV9 A;  1RDA A;  1KVA A;  2D5R A;  1J53 A;  2HND A;  4CHN A;  1I39 A;  3EY1 A;  1WSI A;  3WNE A;  1QE1 A;  3HPG A;  3NH0 A;  2XY5 A;  2FBV A;  4F2S A;  4OKJ A;  5J2M A;  4LSL A;  3K57 A;  1W0H A;  5CYM A;  4FJG A;  4DG1 A;  4CF2 A;  4DSK A;  1QQC A;  1REV A;  2DFF A;  1WSJ A;  3OVN A;  1KCF A;  3ZT3 A;  1TKZ A;  1ZBF A;  4PQU A;  4FJL A;  4TSX A;  1U45 A;  3K2P A;  4KFB A;  3ZT0 A;  2QK9 A;  2B6A A;  3QO9 A;  3L2Q A;  3HVT A;  4FK0 A;  4M3X A;  4IG0 A;  4DSE A;  3TAN A;  4CCH A;  3IAY A;  4CEA A;  4QOZ B;  1RIL A;  3DMJ A;  4KHY A;  4BDP A;  3DI6 A;  3K5N A;  3RTV A;  2Z1I A;  4CEE A;  1IKV A;  3HK2 A;  4DFP A;  1YTU A;  1C1A A;  5KGW A;  4DTO A;  4LD0 A;  3HXM A;  3S3N A;  3ZSX A;  1Q9Y A;  4DLE A;  3K58 A;  4OKK A;  1JLF A;  1UA0 A;  3NGY A;  1HYV A;  4CFC A;  3C95 A;  1SUQ A;  3NFA A;  4N5S A;  4HTU A;  2X6S A;  3QEW A;  1QSL A;  4QAG A;  4Z4F A;  2KW4 A;  3P83 D;  1MU2 A;  4E1N A;  1C1C A;  3SCX A;  4ZTF A;  3O3F A;  3TWH A;  1R0A A;  1CXQ A;  4CJ4 A;  4FLV A;  2RF2 A;  3V1O A;  4OPK A;  1KVC A;  4CJQ A;  4FLT A;  3PUF A;  4AHV A;  3PO5 A;  1XHX A;  4OVL A;  4CFB A;  4FJI A;  1B92 A;  3RMC A;  4CGG A;  1A5X A;  1SKS A;  1TL3 A;  4NCG A;  4J2B A;  4ICL A;  3AA4 A;  4OKE A;  3VQ4 A;  3SUO A;  3T1A A;  1HYZ A;  2P51 A;  5E41 A;  3D0P A;  1BHL A;  4GW6 A;  4CHP A;  3SYZ A;  1QTM A;  4EZ6 A;  4PA1 A;  1BQM A;  3ISN C;  5FRO A;  5T7B A;  4BDZ A;  2IDO A;  3OYN A;  1UAX A;  3VA0 A;  1LW0 A;  1UA1 A;  3LDS A;  4J2E A;  4NCA A;  4RG8 A;  3KD1 E;  4KAZ A;  4CJS A;  5HRN A;  5K14 A;  3RWU A;  1C6V A;  4BDY A;  3RR8 A;  2Y1J A;  1NK8 A;  1Y97 A;  4CHZ A;  2YKM A;  4FJ5 A;  1GOB A;  4B08 A;  4JRQ A;  3WNH A;  3SPZ A;  5FRN A;  5SZT A;  4R5P A;  3OYI A;  1S9E A;  1HJR A;  2E4L A;  5KRT A;  4DU4 A;  3PY8 A;  2I5J A;  3AVK A;  5KI6 A;  1I3A A;  2PZS A;  1RTD A;  3DLG A;  2Z1H A;  3IG1 A;  4DQI A;  3LAM A;  4M3Z A;  3DRP A;  3LZI A;  3AO2 A;  3KJV A;  4CGI A;  4EP4 A;  2W42 A;  1WSH A;  1VSE A;  1D8Y A;  1SV5 A;  3AA5 X;  3G0Z A;  3DLR A;  2OPQ A;  4M3U A;  4HHT A;  4CK3 A;  1HPZ A;  1RDD A; 
#chains in the Genus database with same CATH topology
 3OJU A;  1NNE A;  4KHN A;  1T05 A;  3PLA A;  1RDW X;  1L5U A;  4M3Y A;  4PKH A;  4CBX A;  1DLO A;  1M1K O;  1WAF A;  2OPS A;  2YNH A;  1S1X A;  3HST B;  3CIP A;  3TSP A;  3OYC A;  4BE1 A;  3KIO A;  3M8S A;  3ID6 A;  5BR8 K;  5AQQ A;  4DF4 A;  5JS1 A;  1WOQ A;  4IFV A;  5HLF A;  3NDK A;  5C25 A;  5M1K A;  3CCL N;  2X6N A;  3CER A;  3HSC A;  4B8A B;  4PHT X;  1Z05 A;  3THY B;  5KTQ A;  5HRO A;  4M42 A;  4CF0 A;  4IWV A;  3ENO A;  3L8B A;  3O08 A;  4Z4I A;  1W7A A;  3SI6 A;  1J5E K;  2ZQB A;  1VQN N;  5J2N A;  1QHT A;  3A0I X;  4BVP A;  1A5V A;  3V9W A;  1T03 A;  3QNN A;  3VQ5 A;  1YTA A;  4XIU A;  4Z4E A;  2KLA A;  3O9T A;  4B3M K;  2Q31 A;  4JHD B;  1J9A A;  2GBZ A;  3VPZ A;  1W97 L;  5TKY A;  3S3M A;  1CZA N;  3HT3 A;  4DV7 K;  5AR0 A;  4IOC L;  4YDU C;  2HBM A;  2BAN A;  3AO3 A;  3DLE A;  1V4S A;  3NF8 A;  3KHY A;  3G71 N;  5J2P A;  1VRT A;  2NLX A;  3M5R A;  4CK2 A;  5CY4 A;  2Q2R A;  5BRD A;  3CJ7 A;  4J8F A;  4ZHR A;  4B3R K;  4FZX C;  2P9K A;  4ID5 A;  2E1Z A;  5DM6 L;  4B9S A;  4WQ5 C;  4FWR A;  4M7Y A;  3M8P A;  4FLU A;  2IOC A;  4CEQ A;  3GBT A;  3DXM A;  3VEX A;  3DLL L;  4IFY A;  3K5O A;  1BU6 O;  3CC4 N;  2JGU A;  1VSD A;  4F4K A;  1VQ6 N;  4H4M A;  4O55 A;  4NYF A;  1TVR A;  3K59 A;  2V7Y A;  4CJT A;  4Y0W A;  2B4J A;  3SAG A;  4GNI A;  3BF1 A;  4IKF A;  3FE1 A;  4RW9 A;  3CJB A;  2RKI A;  4JI7 K;  5E26 A;  3V1R A;  3VGK A;  5EVZ A;  4CFA A;  5F1X A;  2A3Z A;  2B5J A;  3L3V A;  3L2U A;  3K0S A;  3BGR A;  4JK8 A;  4Z4C A;  1Q8I A;  4J2A A;  3I33 A;  4H4O A;  3DM2 A;  3TPQ A;  1EXQ A;  3NMU A;  4F3O A;  1S9G A;  4DR4 K;  1ZBU A;  3ZT4 A;  3GDQ A;  4IZ9 A;  5C12 A;  1Q9X A;  2YI1 A;  4FW2 A;  2F4V K;  3FZH A;  4BRD A;  3L0Q A;  1YJN N;  4A61 A;  3I8D A;  4HUF A;  3RRG A;  2QI2 A;  4KRF A;  4FOE A;  1RTI A;  4A5A A;  1RT4 A;  4CJU A;  2PFU A;  3EKU A;  2NRR A;  4JKF A;  2G8U A;  1U2V B;  4FJJ A;  1JL1 A;  1UWB A;  3VGM A;  4BAC A;  2E6L A;  4CJ7 A;  3EN9 A;  3P4I A;  4RW6 A;  1NGG A;  1BUP A;  1TL1 A;  1ZC6 A;  3LM9 A;  3EEQ A;  3VF2 A;  3O3G A;  4KHW A;  2YNI A;  4KRE A;  3O9S A;  4H0V B;  4GVM A;  3QER A;  4BR4 A;  1VHX A;  1VSJ A;  3FZF A;  3J7Y P;  4KBO A;  3WXM B;  3QEX A;  4BE2 A;  4K8Z A;  4DU1 A;  2E5L K;  2Y1I A;  5HOO A;  1HNW K;  2ZE2 A;  1NK0 A;  1S1W A;  4DR5 K;  1JXE A;  3OYH A;  5CZ1 A;  4NXM K;  5C24 A;  4CEO A;  3SBT A;  4E19 A;  1OH6 A;  2G8F A;  3OY9 A;  1NJW A;  3RVC A;  1HNI A;  3CCJ N;  3P1G A;  1IKX A;  4EHU A;  3NGI A;  2HHT A;  3OYL A;  1RT1 A;  3UE5 A;  3QIO A;  4H5N A;  1J54 A;  1XNR K;  4YNQ A;  3J80 O;  4O0I A;  5FPD A;  1ZBL A;  5AQL A;  4PWD A;  4ELT A;  1KFD A;  4O5F A;  1NMN A;  3TSQ A;  3LDN A;  3OJS A;  2ZD1 A;  2I7N A;  4B3T K;  3ZLJ A;  4NXN K;  2HBK A;  1TKT A;  2VCP A;  3MED A;  5DM7 L;  4BRA A;  1RFQ A;  3NCI A;  3MXJ A;  4CK1 A;  3RMD A;  4Y1C A;  1RT6 A;  1G99 A;  4CIF A;  3J7Z O;  2PY5 A;  4J2D A;  1RNH A;  1XNQ K;  4CIE A;  1HYS A;  4UY8 O;  3SAH A;  4JRP A;  1HQU A;  2IGI A;  1TK5 A;  4MLH A;  4IJN A;  3L4Q A;  5CR4 A;  2Q0U A;  3AVN A;  3Q7B A;  2YHA A;  1TV6 A;  4DR7 K;  1QSS A;  2KKZ A;  1Z6R A;  3V9S A;  2OTL N;  2OYQ A;  1K6Y A;  5AQW A;  1C1B A;  4CJ5 A;  2QXF A;  5HRR A;  3MEC A;  4CF9 A;  2HHU A;  2CGK A;  3CJ1 A;  3JAM O;  3AVM A;  3ZX3 A;  4XH4 A;  4JHD A;  1JCE A;  2QKB A;  1T6D A;  4ZTJ A;  3O1B A;  4K42 A;  4X66 K;  3NF7 A;  3PSI A;  3TSU A;  3U4L A;  1MWK A;  3CYM A;  1S22 A;  1YVN A;  1GLF O;  3DRS A;  3DYA A;  4CFD A;  4K41 A;  4MDA A;  4BR7 A;  2GEL A;  1A5W A;  1D5A A;  3DRR A;  2HVH A;  4WCE L;  1T6C A;  5C0Y A;  4CHQ A;  1JXB A;  3CQ8 A;  3RRH A;  3CFO A;  4Q0B A;  5AQU A;  4FLY A;  4FWN A;  4C8L A;  4A2B A;  1XHZ A;  4GV3 A;  4YOW A;  4IBN A;  4BRK A;  3ITH A;  4IFE A;  3WEE B;  2XY8 A;  1Q7Y O;  3NBP A;  3TU5 A;  2JWK A;  4EHT A;  1VQK N;  4DQP A;  3AVF A;  5EU7 A;  4LSN A;  4DS4 A;  2HMI A;  3O9U A;  3KTQ A;  4XH1 A;  4K25 A;  2KFN A;  3OS1 A;  3CC7 N;  3HPO A;  3AO5 A;  3OYA A;  2ZM6 K;  3VEN A;  4ELU A;  3AVC A;  1NM1 A;  3AGK A;  5AZI B;  2JWL A;  1RT5 A;  3THX A;  1HQE A;  1NK6 A;  1RCH A;  1QVG M;  4I7F A;  3RMA A;  4WFA L;  2HHX A;  3I8B A;  2GEM A;  3AV9 A;  2O8C B;  1YIT N;  1I39 A;  3WNE A;  1QE1 A;  3HPG A;  1ZBS A;  1OH7 A;  4OKJ A;  5J2M A;  1W0H A;  2AA4 A;  5AQT A;  4YOY A;  2DFF A;  4B1U B;  1WSJ A;  3W0L A;  1ZBF A;  3LDQ A;  3GE1 A;  3OBW A;  4TSX A;  4DV2 K;  1U45 A;  3L2Q A;  1X9J A;  4FO0 A;  4M3X A;  3TAN A;  4QOZ B;  1RIL A;  1U2V A;  3DMJ A;  3SMS A;  4BDP A;  3O1W A;  5F0X A;  3DI6 A;  2E8A A;  4QS9 A;  4GKJ K;  1IKV A;  4DHY A;  5M1O A;  2J4R A;  4BRL A;  3QBW A;  3QBX A;  4EIA A;  4DLE A;  4HTU A;  3QEW A;  2X6S A;  4A57 A;  4BRN A;  1QSL A;  3P83 D;  1MU2 A;  4E1N A;  4ZTF A;  4WFN L;  4CJ4 A;  1KD1 O;  3PO5 A;  4OVL A;  4FJI A;  3RMC A;  1SKS A;  3VQ4 A;  3AA4 A;  4ICL A;  4OKE A;  3A5N C;  1HYZ A;  2P51 A;  3T1A A;  4Z94 A;  4U7B A;  1YJ9 N;  4GW6 A;  2ASP A;  1EO1 A;  3ISN C;  3J81 O;  2IDO A;  1UAX A;  3T7Z A;  1LW0 A;  4C1N I;  3THW B;  5HRN A;  3O80 A;  5K14 A;  3RWU A;  4BDY A;  3RR8 A;  2Y1J A;  1NK8 A;  4FJ5 A;  5FRN A;  3I55 N;  4MO4 A;  4MLE A;  3OYI A;  2VYP A;  2E4L A;  4DU4 A;  5LJW A;  4JKG A;  4BG9 A;  4DR1 K;  4HTL A;  4JI0 K;  2EWS A;  2Q1N A;  2YHX A;  5KI6 A;  1YF5 L;  4CBU A;  3DLG A;  2YHY A;  5AQK A;  4DQI A;  2FXU A;  3CMA N;  1K9M O;  1XC3 A;  4CGI A;  2W40 A;  1VSE A;  4CVN E;  3RSE A;  4YOX A;  3AA5 X;  3DLR A;  3NVM A;  4M3U A;  4CK3 A;  3ZX2 A;  4B1Z A;  1RDD A;  1S5J A;  2DTU A;  3M8R A;  5BPM A;  1C0F A;  5HRS A;  2F9T A;  3PX0 A;  5KQD A;  3ZT1 A;  4Z0U A;  3P5J A;  2V52 B;  3D7E O;  1YI2 N;  1QSY A;  4AHU A;  3MXM A;  4JKA A;  1U49 A;  4KV8 A;  1NU0 A;  1LV5 A;  2YCH A;  4O0J A;  4WQ4 A;  5JVG L;  3PIP L;  4BE0 A;  1GLL O;  2Q3S A;  3U6F A;  1EWQ A;  4CGH A;  1FK9 A;  3DOK A;  1LWC A;  3NE6 A;  3BDP A;  4FZY A;  2XY6 A;  1OKJ A;  2P9U B;  2DFE A;  4EP5 A;  1YUW A;  1KFS A;  4KH6 A;  2IVO A;  3VER A;  3ZYY X;  1DTT A;  1NGE A;  3M3Z A;  4DTN A;  2X78 A;  2KQ2 A;  2XO7 A;  1LWF A;  3KKR A;  1VQL N;  4JNE A;  4RTF D;  2HHW A;  1HRH A;  4KHS A;  3SJH A;  3HI0 A;  3MWP A;  3HM9 A;  4W5R A;  3CJC A;  1X3M A;  5C10 A;  3E1Y A;  3LP0 A;  3F73 A;  3MEG A;  1RGI A;  1NGA A;  3CXC M;  4JI1 K;  3SBG A;  2D0C A;  2XHB A;  3OHR A;  3EKS A;  4DKW A;  3ZEU A;  1VSI A;  3OYD A;  3QES A;  4QCL A;  5AQR A;  4FWP A;  5CYQ A;  4E7L A;  5GIP A;  4U67 L;  1T8E A;  2QXL A;  4FJN A;  3VQD A;  1HMV A;  3CFR A;  3FGU A;  1F21 A;  2OCE A;  2KFZ A;  3MXI A;  3C7N B;  3MDQ A;  4JN4 A;  1OVY A;  4FCY A;  5AZI A;  5BPL A;  2OA8 A;  2F8S A;  1LW2 A;  2O8C A;  4FOI A;  4OX9 K;  3SNN A;  1SQK A;  1DKG D;  3O4N A;  1GLD G;  3OYK A;  2A40 A;  3D6R A;  3WQT A;  1N32 K;  4H8K A;  1NK9 A;  2NZT A;  4C8O A;  4H5W A;  1U4B A;  2EHG A;  3CM6 A;  4OLB A;  4HVJ A;  1LAW A;  3CD6 N;  3KVG A;  3UKR B;  2E1Y A;  2A6A A;  3HPH A;  1NKE A;  4GVE A;  1ASV A;  4KI4 A;  4YOV A;  5ELZ A;  1HNX K;  3QDK A;  2W6K A;  5FPE A;  3H46 O;  3VMF B;  3CCV N;  4N76 A;  2V7Z A;  5JMV A;  1TYQ B;  2P9P B;  1S1V A;  2E88 A;  1L3S A;  1FKO A;  4CGJ A;  1RBU A;  4BRI A;  3AVH A;  4CHY A;  4BGA A;  5AZJ A;  4DTS A;  4KKO A;  1QZ5 A;  3LDP A;  5I42 A;  4R79 A;  2BDP A;  5BN9 A;  1XI1 A;  1QS4 A;  1M90 O;  2WBN A;  5BRE A;  1JLC A;  5BRF A;  4RW7 A;  4DQR A;  2PAV A;  3B6P A;  1RBR A;  5GAD P;  1SKW A;  4LC9 B;  3L4I A;  1VSL A;  1ITG A;  2XRI A;  2GWJ A;  4FWO A;  4BG8 A;  1L3U A;  1VQP N;  4HUE A;  4W5O A;  4JS5 A;  2D0P A;  4FM0 A;  5I3U A;  3FZL A;  1S3X A;  1KVB A;  2FSK A;  2VG5 A;  3L2R A;  4CE9 A;  1RDC A;  5JLH A;  4JKE A;  2FBY A;  1EET A;  4BR5 A;  1WSE A;  3SV3 A;  1NK4 A;  2P9S B;  4QS8 A;  3E01 A;  4BRE A;  1BIS A;  3NH1 A;  4KPY A;  4HCC A;  4H0P A;  2A1S A;  5AFU A;  3OW2 M;  2O8B B;  4OJR A;  3AVL A;  3IFR A;  4FWK A;  3B6O A;  1YXQ A;  3CJ9 A;  3HP9 A;  2IVN A;  2VWB A;  4W5Q A;  1NKB A;  3WUH A;  4CJ3 A;  4WF9 L;  1S1U A;  3LP2 A;  2D0A A;  3LWM A;  1ZYQ A;  1KSP A;  2Q97 A;  1BO5 O;  2HB5 A;  3V9X A;  1YAG A;  1GOA A;  4LH4 A;  4FPB A;  3V81 A;  3CET A;  1RBV A;  2KTQ A;  3CFP A;  3CI5 A;  3OYM A;  2PYL A;  1CZ9 A;  3FR0 A;  2HNY A;  3TAB A;  4FYD A;  1Q18 A;  4DTJ A;  2E2Q A;  1YVU A;  2NUB A;  4NCB A;  2R7Y A;  2NRW A;  1HPM A;  3OS0 A;  1WNS A;  3NHG A;  1MWM A;  3A5M C;  4FJX A;  2P9U A;  5SWM A;  2VQE K;  3UKU B;  3ZT2 A;  5AQP A;  4CW7 B;  4ID1 A;  2HNZ A;  1BI4 B;  4MFB A;  4PUO A;  4B1V A;  2HF4 A;  4JI2 K;  1TUU A;  4AHC A;  3ULD A;  3QFP A;  2NRT A;  2IC3 A;  2QWN A;  4KI6 A;  3F2K A;  1P8Z A;  5AQM A;  4BC3 A;  4DV6 K;  4DSI A;  3PSF A;  3CG7 A;  3VTH A;  2E6M A;  4DTX A;  5KPT A;  4X65 K;  1W9H A;  3E9L A;  3WNF A;  2IS3 A;  2HBJ A;  4RWT A;  2OPP A;  1ZBI A;  1RT2 A;  4E7H A;  1K8K B;  4YOU A;  1HUX A;  2F8T A;  2FF3 B;  4BC4 A;  1E4F T;  4K43 A;  3G10 A;  3MCP A;  5GIO A;  3K9K A;  4Z4G A;  3TTF A;  3RMB A;  3NVK A;  4FLX A;  3ENH A;  4B9L A;  3C7N A;  3DXK B;  3AVI A;  3FLC O;  1OVQ A;  4O4G A;  2BH1 A;  5GAH P;  2WFB A;  3O4Q A;  3SQ0 A;  1NJX A;  4E1J A;  1EKE A;  3AVB A;  4DUZ K;  1VQ4 N;  4ELV A;  3ZSR A;  4BR0 A;  2GUI A;  5M1N A;  4AQY K;  2P9N A;  1N5Y A;  4FM1 A;  4FJM A;  4FJ8 A;  3ZET B;  2QWL A;  2D5R A;  1IG8 A;  4B1X B;  5FPM A;  3EY1 A;  4B1Y B;  3CCR N;  4EAH D;  4LSL A;  3K57 A;  5CYM A;  4FJG A;  4CF2 A;  1QZ6 A;  4DSK A;  3OVN A;  3HRG A;  4FJL A;  4PL7 A;  3WXJ A;  4H5T A;  3H1Q A;  4DFP A;  1YTU A;  4X62 K;  3CQY A;  2P9P A;  3O9R A;  2D4W A;  3HXM A;  3ZSX A;  1Q9Y A;  1NGI A;  3K58 A;  4KHU A;  3NGY A;  4CFC A;  3C95 A;  3NFA A;  4Z4F A;  1R0A A;  1C1C A;  3O3F A;  3THY A;  3CPW M;  5AQZ A;  2RF2 A;  1P90 A;  3M1F A;  3IDH A;  1KVC A;  3AAR A;  4O8U A;  4AHV A;  4CFB A;  2Q36 A;  3N4P A;  4CGG A;  3VEY A;  4IO8 A;  4NCG A;  5AQO A;  3SUO A;  4BR9 A;  5E41 A;  2I7P A;  1BHL A;  1XQS C;  1C0G A;  4CHP A;  4EZ6 A;  3SCX A;  3ULE B;  4BDZ A;  2G8V A;  1UA1 A;  3K9J A;  3VEO A;  4CJS A;  1GLJ O;  4JRQ A;  3WNH A;  5LMU K;  4R5P A;  2NRX A;  3C0B A;  1E3M A;  2I5J A;  1NLV A;  1T44 A;  1EQY A;  1I3A A;  1S72 N;  2O8B A;  4CD3 A;  2ZJP L;  3LAM A;  1QVF M;  3DRP A;  3LZI A;  3U9Z A;  1V4T A;  3AO2 A;  4EP4 A;  2O8F B;  2OPQ A;  4HHT A;  4FLW A;  1BQN A;  4FVU A;  3QB0 A;  4PKG A;  3VQP A;  4CEB A;  4PY5 A;  4I9Q A;  2YX6 A;  1VSH A;  5AQN A;  3VF4 A;  1TKX A;  3HYF A;  5D3G A;  1Z25 A;  4B9V A;  3VQB A;  1XUP O;  3TAQ A;  2QWO A;  4I9L A;  4DFJ A;  3KLG A;  3NGZ A;  3BP8 A;  4IXC A;  4RW8 A;  3WXI A;  4KTQ A;  3LL3 A;  4FZZ A;  4KTZ A;  3WXL A;  1DGK N;  1HJO A;  3KLF A;  2F9W A;  1NGC A;  4DU3 A;  3UKU A;  2QWR A;  4M41 A;  3CJA A;  4W5N A;  1OH8 A;  2HHV A;  3ZCM A;  5FLX O;  1XC9 A;  4DQ8 A;  3QFU A;  4JYA K;  3MK6 A;  5E84 A;  3C94 A;  3VEV A;  4IDH A;  1NMD A;  3V4I A;  4OPA A;  4DQS A;  1NK5 A;  5BN8 A;  1VRU A;  1HR0 K;  1BIU A;  3SQ2 A;  2Z1J A;  5MLC Q;  1TAQ A;  2GV9 A;  5BR9 A;  1FJG K;  4H5R A;  1VQ7 N;  2HHQ A;  5M1F A;  1IBK K;  3SPY A;  3CME N;  4O44 A;  4BGB A;  4HUG A;  3VF6 A;  2P9I B;  1BGX T;  4DFM A;  1X1P A;  2YNF A;  3T69 A;  4DV5 K;  4LF8 K;  4CIG A;  3AVA A;  2GUP A;  1Z26 A;  3OYJ A;  4LF4 K;  4EFH A;  3KK2 A;  2YHB A;  1FKP A;  1VSF A;  3HOS A;  3ZSQ A;  3AAP A;  4FK2 A;  3KK3 A;  1EWR A;  2HF3 A;  4WE1 A;  3K5M A;  2G8I A;  4B9M A;  3R3L A;  2ZWH A;  4FM2 A;  1JJ2 M;  1WUA A;  3U9D A;  4YDU A;  4K0K K;  3MAQ A;  3OYB A;  3MWT A;  5AQV A;  3UIQ A;  2WOM A;  1IG9 A;  3LZJ A;  3RR7 A;  3MX5 A;  3VQ6 A;  3PO4 A;  3ATV A;  3EO3 A;  4M3T A;  2ZF5 O;  1XMQ K;  4WQ5 A;  1D9F A;  1XMO K;  3GL1 A;  1ZBH A;  4ISF A;  4FVM A;  4WFB L;  4GKK K;  4KB1 A;  3OYF A;  1KRP A;  1MDU B;  4E7I A;  2RN2 A;  4ILH A;  3I0R A;  3MCA B;  4BRQ A;  2UXD K;  4KH5 A;  4E1M A;  2QEX N;  5KPR A;  4FJH A;  1BG3 A;  3UB5 A;  2CGJ A;  2E2N A;  4N56 A;  4CJK A;  5GIN A;  3KLI A;  5CZ2 A;  2H3G X;  4K8X A;  2DY4 A;  3QLH A;  4RCH A;  1VSK A;  4BRG A;  1VQ9 N;  4M3W A;  5ADX A;  4CJF A;  4CJW A;  4FJ7 A;  3T3F A;  3H45 C;  3I0S A;  3CCS N;  3TI0 A;  4WYB A;  4Q5V A;  4CF8 A;  4YHH K;  3N4Q A;  3IS9 A;  1NGJ A;  4CEF A;  3ID8 A;  5DMR A;  2KHO A;  4LFA K;  3AO1 A;  3G4S N;  3V9U A;  3EZW A;  4CJL A;  4DV4 K;  4CF1 A;  2A1R A;  3QEP A;  4DTP A;  1KLN A;  3TAF A;  3SUN A;  4JS4 A;  3BUZ B;  4BY9 C;  5JLF A;  1RTJ A;  4YY3 K;  2O8E B;  3SV4 A;  2LSN A;  3D2E B;  3O6W A;  5HP1 A;  1LAV A;  4IO9 L;  4I2P A;  2ZGZ A;  5CE3 A;  3WT0 A;  1Q81 O;  2OAN A;  3D2F B;  4M45 A;  2AP1 A;  4DTM A;  4DSL A;  3KKS A;  3TAG A;  3CF5 L;  2XY7 A;  4FK4 A;  3TAP A;  3LAL A;  2NRZ A;  4BWM A;  3LDO A;  2ZGY A;  4DCH A;  3W3D A;  1LOT B;  4OGC A;  3AA2 A;  4KH4 A;  1YHQ N;  4XH5 A;  3WEE A;  1CXU A;  4F8R A;  1FW6 A;  3GOI A;  2P5G A;  5C2D A;  4CZL A;  4DTR A;  1Q82 O;  4DV1 K;  4JK7 A;  5LJV A;  1WB9 A;  4IEI A;  1IJJ A;  1WN7 A;  2BTF A;  1IKW A;  5AQG A;  1G15 A;  3SQ4 A;  5AQY A;  3T19 A;  2CH5 A;  4AIL C;  3J7A P;  3K5L A;  5HRP A;  2W6L A;  3JS6 A;  4CJR A;  3KD5 E;  4FWQ A;  5GAG P;  3MN7 A;  5BPN A;  3I56 N;  4F3T A;  2VWK A;  4AHR A;  3SAF A;  1HNZ K;  4C1N K;  5AQX A;  2HW3 A;  1CZB A;  4QS7 A;  5I9E B;  4FW1 A;  3KLE A;  3P39 A;  4H0X B;  3VQE A;  4CEZ A;  3C6U A;  3ATU A;  1DTQ A;  2PBD A;  5FRM A;  2O8D B;  3VQ7 A;  5BRH A;  1BCO A;  3U3G A;  4DTU A;  3R9P A;  3KK1 A;  3HL8 A;  4CBW A;  4KO0 A;  2D0O A;  2UYT A;  4BQL A;  1K8A O;  2IIR A;  3SLC A;  3ASM A;  3LPT A;  1T7P A;  3FFK B;  3D45 A;  3U8X A;  3OTO K;  2FBX A;  1U48 A;  5A2Q O;  1Q86 O;  3VQC A;  1VAZ A;  5B8H A;  3LAN A;  1O1W A;  4IDK A;  5AQH A;  1TGO A;  2UXC K;  3E9O A;  3THV A;  3SK3 A;  4W5T A;  1KLM A;  1KAZ A;  2X74 A;  2P9I A;  1YT3 A;  5JVH L;  2RPI A;  3V1Q A;  4LF5 K;  2QWM A;  3U3Y A;  4CGD A;  4F2R A;  4FWS A;  5KGX A;  4FJ9 A;  4CER A;  1NGF A;  3A5O C;  4M63 C;  1S1T A;  1W2B M;  2EX3 A;  4H0O A;  1WSF A;  3KLH A;  3JYT A;  4BRO A;  5LMN K;  3BY5 A;  4B8C A;  3THW A;  2UXB K;  1BL3 A;  1DT9 A;  2Q0R A;  4BRP A;  4O5B A;  1HKB A;  3CM5 A;  2QW9 A;  2WC9 A;  1QQO A;  3KWI A;  4OPJ A;  3HOT A;  3OS2 A;  3DWL A;  1NJY A;  1J6Z A;  2ITG A;  1BDG A;  3LP1 A;  2YKN A;  2G8W A;  4AHS A;  3F9K A;  1KVA A;  4PKI A;  2HOE A;  4GV6 A;  4CHN A;  1WSI A;  3NH0 A;  2XY5 A;  3JXU A;  2FBV A;  4F2S A;  5C15 A;  1NGB A;  3ZT3 A;  1KQS M;  4MO5 A;  5GAE P;  2B6A A;  5HL7 L;  4FK0 A;  4ILJ A;  4DSE A;  3CHW A;  4IOX A;  4CCH A;  2HHH K;  4KHY A;  4PL8 A;  5KQ8 A;  4CEE A;  4NLC A;  3HZ6 A;  3OA9 A;  1KC8 O;  2A42 A;  3LM2 A;  5KGW A;  1HKC A;  2IVP A;  4LD0 A;  1N36 K;  1X3N A;  4OKK A;  1UA0 A;  1HYV A;  1SUQ A;  3MX2 A;  3WQU A;  3TWH A;  3ENB A;  2WTU A;  1CXQ A;  3ZX0 A;  4CD1 A;  2ZJQ L;  4OPK A;  4C23 A;  4LF7 K;  3PUF A;  1XHX A;  2P9L B;  1H1V A;  1A5X A;  1TL3 A;  4CI6 A;  2QTD A;  4BC5 A;  1IV0 A;  4BRH A;  3B8A X;  1QTM A;  2O8E A;  3D2E A;  4PA1 A;  3VA0 A;  3OYN A;  4NCA A;  3KD1 E;  3D2F A;  4ILG B;  4B1W B;  4CHZ A;  2YKM A;  4WQ4 C;  3VET A;  1QHA A;  4JV5 K;  5KRT A;  3PY8 A;  3THX B;  2Z1H A;  1BOT O;  3F5T A;  4XEI A;  3VTI A;  3KJV A;  4DV3 K;  1WSH A;  1D8Y A;  4CZK A;  2BUP A;  5ADX H;  3G0Z A;  4FWL A;  3DLK A;  2E20 A;  3QML A;  4JI4 K;  4CED A;  5JS2 A;  3L2V A;  4NYN A;  1VQO N;  3OYG A;  4LFB K;  1UOC A;  4MQ3 A;  3KZB A;  4OLA A;  3A2F A;  2RE2 A;  3FZM A;  3R8E A;  3DLB A;  4NLB A;  4BRM A;  4JLH A;  4A2A A;  2QM1 A;  3QNO A;  4KTW A;  1SKR A;  4DR6 K;  3O4W A;  1NKC A;  3LP3 A;  1JLE A;  3LAK A;  2VG6 A;  4A5B A;  4IG3 A;  2O8D A;  3ZSV A;  1NOY A;  2UUB K;  1WBD A;  2F96 A;  3ZSW A;  2VWJ A;  4DSJ A;  4C8M A;  2E2P A;  4NB4 A;  3H08 A;  3HM8 A;  3HBT A;  1ASW A;  1SAZ A;  4O8K A;  2FSN A;  4CZH A;  3QIN A;  3SJJ A;  5M1P A;  4DMN A;  1BCM A;  1TUY A;  2VG7 A;  1JKH A;  3UKR A;  3T1Y K;  5LL6 Z;  4I2Q A;  3H3O B;  4L3Q A;  2HMP A;  4BWJ A;  4BC2 A;  1OH5 A;  3VQ9 A;  3T1H K;  5J2Q A;  3IMX A;  1KXP A;  3KK7 A;  4JKG B;  2OTJ N;  4DF8 A;  1KTQ A;  3L3U A;  4YOT A;  4JI5 K;  2D0B A;  2BGG A;  1NJI O;  3S9H A;  1I94 K;  4RW4 A;  1VQ5 N;  1ILY A;  3EE8 A;  1TYQ A;  2UU9 K;  2P5O A;  4OPH A;  3P38 A;  1SL2 A;  3FZK A;  2YV0 X;  2HST A;  2QWP A;  3CCU N;  2ATQ A;  3RSE B;  3VQ8 A;  2VGM A;  4BQZ A;  3DAW A;  1IKY A;  4E89 A;  1EP4 A;  1NOZ A;  4JKC A;  1YIJ N;  1GLE G;  4I6M B;  3JSM A;  4JD2 B;  3O3H A;  3E66 A;  4JKB A;  3C6A A;  4AF1 A;  4CJE A;  1XWL A;  3EYZ A;  1GLC G;  1WLJ A;  5KRS A;  4UQG A;  4B3S K;  3WXK A;  3G25 A;  1SZ2 A;  3C65 A;  4C8N A;  3PX6 A;  1HX1 A;  1YJW N;  4CZM A;  4DV0 K;  4DLG A;  3QIP A;  4EZ9 A;  4B9N A;  4H0Y B;  4FJK A;  3BZC A;  4AM7 A;  2QWQ A;  3ZSO A;  1RDU A;  3VGL A;  4AHT A;  4CES A;  1JLA A;  5KPZ A;  3VOV A;  3SMP A;  4Y1D A;  2P1J A;  4V19 S;  2P9S A;  1HLU A;  3M8Q A;  1IBM K;  3IKM A;  2ETJ A;  1RT3 A;  3F9M A;  1C0M A;  4IOA L;  3VQA A;  4OGE A;  4E7K A;  4DR2 K;  4AM6 A;  1RDB A;  1RTH A;  1NWK A;  1ASU A;  4GMJ B;  1GOC A;  1U6Z A;  3CQX A;  3PX4 A;  4JI6 K;  4IEE A;  1IO2 A;  2ITM A;  1L3T A;  2FLO A;  1S6P A;  1WBB A;  4BVO A;  1NG9 A;  4YFU A;  3CCE N;  1VQ8 N;  3HO1 A;  4JK9 A;  4DFK A;  5EX5 A;  3CCQ N;  4LF6 K;  4FWM A;  3MEE A;  4H03 B;  4N47 A;  2YNG A;  3SUQ A;  4C8K A;  3DOL A;  3R1X A;  4FLZ A;  4FPA A;  3O8M A;  3VES A;  1D4X A;  3TTD A;  1O13 A;  3Q7C A;  3SZ2 A;  3EE9 A;  2P9L A;  4CEC A;  2UUA K;  3ZEU B;  3V6D A;  3HP6 A;  1N6Q A;  2A41 A;  2NRH A;  4DWI A;  2HHS A;  2QKK A;  3C6T A;  4JKH A;  1ZXO A;  3EZ5 A;  3NH2 A;  3LWL A;  2A5X A;  4A59 A;  5EXW A;  3SUP A;  1VK0 A;  4LH5 A;  1CLQ A;  2NRV A;  3AA3 A;  2HBL A;  2OPR A;  4NO7 A;  1BI4 A;  3MMV A;  1RT7 A;  4JI3 K;  5IT9 O;  5AFU H;  1WAJ A;  3A5L C;  5HBM A;  2OZM A;  4FXD A;  3IRX A;  4MDB A;  2G8H A;  2NNW A;  2F7T A;  2KZZ A;  4DUY K;  2CGL A;  3CC2 N;  1U04 A;  1FXX A;  1S6Q A;  1RBT A;  4DSF A;  3DJC A;  2RHK A;  1JL2 A;  3KWG A;  5AJ3 K;  1LCU A;  4B3O A;  1B9F A;  5AQS A;  1N8R O;  4GV9 A;  1C0T A;  1BIZ A;  4Z4H A;  2KZM A;  1Y64 A;  1K8K A;  2CH6 A;  2O4G A;  3NF9 A;  2W41 A;  1X9W A;  4CJV A;  1ATS A;  3WNG A;  1KAX A;  4LFC K;  1IH7 A;  3C6H A;  2YJE A;  3TR8 A;  5TKW A;  4BR2 A;  3EL2 A;  1SL0 A;  4JI8 K;  3DXK A;  3VN5 A;  1DEJ A;  1D9D A;  1J5O A;  3DLH A;  1SS6 A;  4G1Q A;  2WON A;  4H5V A;  4JKD A;  3SQ1 A;  3TAR A;  1T3V A;  1HNV A;  1X9S A;  4N41 A;  1LWE A;  3QEV A;  1JLB A;  2FBT A;  2BE2 A;  4BRF A;  3QEI A;  5AZJ B;  3P31 A;  3ZET A;  2D1K A;  4CHO A;  2G8K A;  1E4G T;  5FDL A;  3A8Y A;  1B9D A;  3S3O A;  2GWK A;  3S41 A;  3M6G A;  3NAE A;  3VA3 A;  1SL1 A;  3L2W A;  4DB3 A;  1NK7 A;  5EOY A;  3V9Z A;  3ZSY A;  2VGN A;  1JLG A;  2WUS A;  1GLA G;  3BF3 A;  3NF6 A;  4DQQ A;  1C0U A;  5JIC A;  3J8A A;  2IAJ A;  5EY4 A;  2HVI A;  3LPU A;  1JLQ A;  3AO4 A;  5DK5 A;  3G6E N;  3H1V X;  5M1Q A;  1HKG A;  1BA1 A;  1N34 K;  4LF9 K;  4B9T A;  5AQI A;  1BA0 A;  3ZSZ A;  2DFH A;  1BWF O;  1TK0 A;  1RBS A;  4HCB A;  4KB0 A;  2AJQ A;  4ISG A;  2DPN A;  3MN5 A;  3ALY A;  3FFI A;  1WSG A;  2P9K B;  3BEX A;  1R59 O;  3MN6 A;  1TK8 A;  4OO1 J;  4B9U A;  4L8R B;  3PIO L;  4I6M A;  4JD2 A;  5C42 A;  3AVJ A;  4E7J A;  4B9Q A;  3VEW A;  4E0D A;  2FSJ A;  3GG4 A;  4JEP A;  4CGF A;  1IBL K;  1TKD A;  5J1E A;  3DXM B;  1NGD A;  1L3V A;  4LY7 A;  1QQN A;  3TAE A;  3ULE A;  1X9M A;  3MN9 A;  3TAM A;  3VQQ A;  5FPN A;  2JLE A;  2O4I A;  3BZK A;  4DS5 A;  5CHI A;  1EX4 A;  4E3S A;  4IJA A;  5LY3 A;  1TAU A;  3HVR A;  4YOR A;  2Z1G A;  1VSM A;  2FC0 A;  4FSV A;  3QET A;  2GX9 A;  3OYE A;  1U47 A;  1NJZ A;  4AH9 A;  2PYJ A;  3AVG A;  2UUC K;  3AGR A;  3PV8 A;  4CJP A;  3H6E A;  4KHQ A;  4M3R A;  1RDA A;  1J53 A;  2HND A;  2QA4 N;  2O8F A;  4CZE A;  4DG1 A;  1QQC A;  1REV A;  3H3N O;  4M7X A;  1KCF A;  3CPE A;  1TKZ A;  4PQU A;  1QQM A;  3CCM N;  3K2P A;  4KFB A;  1ESV A;  3ZT0 A;  2QK9 A;  3QO9 A;  3HVT A;  2ASO A;  4IG0 A;  5IWA K;  1VQM N;  3IAY A;  2GTD A;  4CEA A;  2E2O A;  3TTC A;  4A62 A;  3K5N A;  2Z1I A;  3OBY A;  2ZJR L;  3RTV A;  3HK2 A;  4F9O A;  3AAQ A;  5AQF A;  1C1A A;  4CZI A;  2ASM A;  4DTO A;  3S3N A;  4KHP K;  3LDL A;  3HJF A;  1JLF A;  4DR3 K;  4N5S A;  4QAG A;  2KW4 A;  4JAX A;  5F2R A;  4HWI A;  4FLV A;  3V1O A;  1GLB G;  3AY9 A;  2YHW A;  1NBW A;  5AQJ A;  4CJQ A;  4FLT A;  4G9Z A;  1B92 A;  3QIC A;  4J2B A;  1JCF A;  1NGH A;  3E9P A;  3D0P A;  3VEZ A;  4CZF A;  2V51 B;  3SYZ A;  1BQM A;  5FRO A;  5T7B A;  2OZS A;  1ATN A;  4FL9 A;  3LDS A;  1JCG A;  4J2E A;  5H1S Q;  4RG8 A;  4KAZ A;  4CZG A;  1C6V A;  1Y97 A;  4BRC A;  1GOB A;  4B08 A;  1N33 K;  3SPZ A;  3R6M A;  5SZT A;  3O5B A;  1S9E A;  1HJR A;  3L6Q A;  2VQF K;  1K73 O;  3AVK A;  3HTV A;  4CZJ A;  1MA9 B;  2P9N B;  1KAY A;  1ATR A;  2PZS A;  1RTD A;  3IUC A;  3IG1 A;  2FF6 A;  4H0T B;  4X64 K;  4ISE A;  4M3Z A;  4GY2 B;  2W42 A;  3O9Q A;  1SV5 A;  2YJF A;  5C2F A;  1HPZ A; 
#chains in the Genus database with same CATH homology
 3OJU A;  1S5J A;  2DTU A;  4KHN A;  3M8R A;  4FLW A;  4CED A;  5JS2 A;  1T05 A;  3L2V A;  1BQN A;  1L5U A;  4NYN A;  4M3Y A;  5HRS A;  3PX0 A;  3VQP A;  3OYG A;  3ZT1 A;  1UOC A;  4MQ3 A;  4Z0U A;  1DLO A;  3P5J A;  4CEB A;  4PY5 A;  4I9Q A;  4OLA A;  1WAF A;  1VSH A;  2OPS A;  3A2F A;  2YNH A;  1QSY A;  1TKX A;  4AHU A;  1S1X A;  3HST B;  3HYF A;  3MXM A;  1Z25 A;  1U49 A;  3DLB A;  4KV8 A;  4B9V A;  5D3G A;  1LV5 A;  4O0J A;  3VQB A;  3OYC A;  4JLH A;  3QNO A;  4BE1 A;  3KIO A;  4KTW A;  3M8S A;  4BE0 A;  4DF4 A;  3TAQ A;  2Q3S A;  5JS1 A;  3U6F A;  4IFV A;  5HLF A;  1SKR A;  4CGH A;  5C25 A;  4I9L A;  3NDK A;  4DFJ A;  3KLG A;  2X6N A;  3NGZ A;  3LP3 A;  1NKC A;  1FK9 A;  4B8A B;  4RW8 A;  1JLE A;  4KTQ A;  5KTQ A;  4FZZ A;  3DOK A;  1LWC A;  2VG6 A;  3LAK A;  3NE6 A;  5HRO A;  4KTZ A;  4M42 A;  4CF0 A;  4IG3 A;  3ZSV A;  1NOY A;  3L8B A;  2F96 A;  3ZSW A;  4Z4I A;  2VWJ A;  4DSJ A;  3KLF A;  4C8M A;  4DU3 A;  3BDP A;  3H08 A;  3SI6 A;  4FZY A;  2ZQB A;  3DLK A;  4M41 A;  5J2N A;  2XY6 A;  4W5N A;  1ASW A;  1QHT A;  2HHV A;  1A5V A;  3V9W A;  3ZCM A;  1T03 A;  3QIN A;  2DFE A;  1XC9 A;  4EP5 A;  3QNN A;  3SJJ A;  3VQ5 A;  1KFS A;  1YTA A;  4DMN A;  4XIU A;  4Z4E A;  1BCM A;  3C94 A;  2VG7 A;  1JKH A;  1DTT A;  1J9A A;  2GBZ A;  4DTN A;  3S3M A;  4I2Q A;  3HT3 A;  3V4I A;  4DQS A;  2X78 A;  2KQ2 A;  2XO7 A;  1NK5 A;  1LWF A;  4BWJ A;  3KKR A;  1VRU A;  2BAN A;  3AO3 A;  3DLE A;  3NF8 A;  2HHW A;  3VQ9 A;  1HRH A;  1BIU A;  5J2Q A;  5J2P A;  4KHS A;  3SQ2 A;  2Z1J A;  1VRT A;  1TAQ A;  4DF8 A;  1KTQ A;  3L3U A;  2GV9 A;  3HM9 A;  4W5R A;  4CK2 A;  5CY4 A;  2D0B A;  2HHQ A;  2BGG A;  3LP0 A;  4ZHR A;  3S9H A;  4RW4 A;  3SPY A;  4FZX C;  3F73 A;  4ID5 A;  2P5O A;  4B9S A;  4O44 A;  3MEG A;  1SL2 A;  3HJF A;  3M8P A;  4HUG A;  2YV0 X;  4FLU A;  2ATQ A;  2D0C A;  2IOC A;  3VQ8 A;  2XHB A;  1BGX T;  4DFM A;  1X1P A;  1IKY A;  2YNF A;  4E89 A;  4CEQ A;  1EP4 A;  1NOZ A;  1VSI A;  3OYD A;  4CIG A;  3JSM A;  4IFY A;  3AVA A;  3O3H A;  3QES A;  3K5O A;  4QCL A;  1Z26 A;  3OYJ A;  5CYQ A;  2JGU A;  4E7L A;  1VSD A;  4F4K A;  4CJE A;  1XWL A;  2YHB A;  3KK2 A;  1FKP A;  3EYZ A;  1T8E A;  1VSF A;  4FJN A;  1WLJ A;  4H4M A;  3ZSQ A;  4O55 A;  1HMV A;  3VQD A;  4NYF A;  5KRS A;  4UQG A;  3KK3 A;  4FK2 A;  3CFR A;  1KLN A;  1TVR A;  4WE1 A;  3K5M A;  3PX6 A;  4C8N A;  3K59 A;  4B9M A;  2G8I A;  4CJT A;  1F21 A;  2B4J A;  2KFZ A;  4FM2 A;  3MXI A;  4DLG A;  3QIP A;  4IKF A;  4RW9 A;  4EZ9 A;  4FCY A;  4B9N A;  4FJK A;  2RKI A;  3MAQ A;  3ZSO A;  3OYB A;  3V1R A;  4AHT A;  4CES A;  1JLA A;  3UIQ A;  2WOM A;  4CFA A;  1IG9 A;  3LZJ A;  3RR7 A;  2B5J A;  3L3V A;  4Y1D A;  2P1J A;  3L2U A;  2OA8 A;  2F8S A;  1LW2 A;  3BGR A;  3VQ6 A;  3PO4 A;  3M8Q A;  4Z4C A;  1Q8I A;  1RT3 A;  2ETJ A;  4J2A A;  4M3T A;  1C0M A;  4H4O A;  3DM2 A;  1D9F A;  3SNN A;  3VQA A;  4OGE A;  3O4N A;  1EXQ A;  3OYK A;  4E7K A;  1S9G A;  4F3O A;  1ZBH A;  4FVM A;  4KB1 A;  4H8K A;  1ZBU A;  3OYF A;  3ZT4 A;  1NK9 A;  4E7I A;  1KRP A;  2RN2 A;  3I0R A;  4C8O A;  1RDB A;  1U4B A;  1RTH A;  2EHG A;  3CM6 A;  1ASU A;  4E1M A;  1Q9X A;  4HVJ A;  4OLB A;  4FJH A;  4GMJ B;  4FW2 A;  1GOC A;  1LAW A;  4N56 A;  3I8D A;  3PX4 A;  4HUF A;  3RRG A;  4CJK A;  3KLI A;  5CZ2 A;  4K8X A;  1IO2 A;  2DY4 A;  1L3T A;  4KRF A;  3QLH A;  1RTI A;  1S6P A;  3HPH A;  1NKE A;  1RT4 A;  4CJU A;  4YFU A;  1ASV A;  1VSK A;  2G8U A;  4KI4 A;  4DFK A;  4FJJ A;  3HO1 A;  1JL1 A;  1UWB A;  4M3W A;  3MEE A;  4CJF A;  4CJW A;  4N47 A;  4BAC A;  4FJ7 A;  2E6L A;  2YNG A;  3T3F A;  3SUQ A;  4C8K A;  3DOL A;  4FLZ A;  3I0S A;  4N76 A;  3TI0 A;  4RW6 A;  1S1V A;  1L3S A;  1FKO A;  4CGJ A;  4Q5V A;  4CF8 A;  1RBU A;  3AVH A;  4CHY A;  3IS9 A;  1TL1 A;  4DTS A;  4KKO A;  3O3G A;  4KHW A;  5I42 A;  4CEF A;  3SZ2 A;  2YNI A;  5DMR A;  4KRE A;  2BDP A;  4GVM A;  4CEC A;  1XI1 A;  1QS4 A;  3V6D A;  3QER A;  3AO1 A;  3HP6 A;  3V9U A;  4CJL A;  1N6Q A;  2A1R A;  4CF1 A;  4DWI A;  2HHS A;  1VSJ A;  2QKK A;  3C6T A;  3QEP A;  1JLC A;  4RW7 A;  4DQR A;  4DTP A;  3EZ5 A;  4BE2 A;  3NH2 A;  3LWL A;  4DU1 A;  3QEX A;  3TAF A;  2Y1I A;  3B6P A;  4K8Z A;  1RBR A;  1SKW A;  3SUP A;  1VSL A;  1ITG A;  2ZE2 A;  2XRI A;  1VK0 A;  4JS4 A;  3SUN A;  1NK0 A;  4LH5 A;  1RTJ A;  1L3U A;  1CLQ A;  3AA3 A;  1S1W A;  4HUE A;  3SV4 A;  2LSN A;  1JXE A;  3OYH A;  2OPR A;  5HP1 A;  1BI4 A;  1LAV A;  1RT7 A;  5CZ1 A;  4W5O A;  4I2P A;  4JS5 A;  4FM0 A;  1WAJ A;  5HBM A;  5C24 A;  4CEO A;  5I3U A;  2OZM A;  2OZS A;  4E19 A;  4FXD A;  3IRX A;  1KVB A;  2G8H A;  2VG5 A;  2G8F A;  3OY9 A;  4M45 A;  4CE9 A;  3L2R A;  2KZZ A;  4DTM A;  1RDC A;  1NJW A;  4DSL A;  1HNI A;  3KKS A;  3P1G A;  2FBY A;  3TAG A;  1EET A;  1IKX A;  1U04 A;  2XY7 A;  4FK4 A;  3TAP A;  1FXX A;  1S6Q A;  1RBT A;  4DSF A;  1WSE A;  3SV3 A;  3NGI A;  2HHT A;  3OYL A;  1NK4 A;  1RT1 A;  3LAL A;  1JL2 A;  3QIO A;  3E01 A;  4BWM A;  1BIS A;  3NH1 A;  1J54 A;  4KPY A;  4B3O A;  4HCC A;  1B9F A;  4YNQ A;  2A1S A;  4O0I A;  4OJR A;  1C0T A;  3AVL A;  1ZBL A;  3B6O A;  4PWD A;  1BIZ A;  4ELT A;  1KFD A;  4OGC A;  3AA2 A;  3HP9 A;  4Z4H A;  2KZM A;  4W5Q A;  1NKB A;  3OJS A;  2ZD1 A;  4CJ3 A;  2O4G A;  3NF9 A;  1CXU A;  1S1U A;  1TKT A;  4F8R A;  3LP2 A;  3MED A;  1X9W A;  4CJV A;  2D0A A;  2P5G A;  3WNG A;  3LWM A;  4DTR A;  1ZYQ A;  1IH7 A;  3MXJ A;  4CK1 A;  3NCI A;  1KSP A;  3RMD A;  3TR8 A;  2HB5 A;  3V9X A;  1GOA A;  1WN7 A;  1RT6 A;  4LH4 A;  4Y1C A;  1SL0 A;  1IKW A;  4CIF A;  2PY5 A;  4J2D A;  3VN5 A;  1RNH A;  1D9D A;  3SQ4 A;  1G15 A;  1J5O A;  3DLH A;  4CIE A;  3V81 A;  1RBV A;  3T19 A;  3CFP A;  1HYS A;  2KTQ A;  4AIL C;  4JRP A;  4G1Q A;  1HQU A;  2WON A;  3OYM A;  1CZ9 A;  5HRP A;  2IGI A;  3K5L A;  4CJR A;  1TK5 A;  2PYL A;  3KD5 E;  3SQ1 A;  2HNY A;  3TAB A;  3TAR A;  4FYD A;  1HNV A;  3AVN A;  1X9S A;  4N41 A;  1LWE A;  3QEV A;  4F3T A;  2YHA A;  1JLB A;  4DTJ A;  2VWK A;  4AHR A;  1YVU A;  2FBT A;  2BE2 A;  1TV6 A;  1QSS A;  2NUB A;  2HW3 A;  1CZB A;  3QEI A;  4NCB A;  2R7Y A;  3V9S A;  4FW1 A;  3OS0 A;  1WNS A;  3KLE A;  2OYQ A;  4CHO A;  3NHG A;  2G8K A;  5FDL A;  3VQE A;  4CEZ A;  1K6Y A;  1B9D A;  3C6U A;  3S3O A;  1C1B A;  1DTQ A;  4CJ5 A;  4FJX A;  2QXF A;  3VQ7 A;  5SWM A;  5FRM A;  1BCO A;  5HRR A;  3U3G A;  3NAE A;  3VA3 A;  4DTU A;  3L2W A;  3MEC A;  4CF9 A;  1NK7 A;  1SL1 A;  2HHU A;  3V9Z A;  3KK1 A;  3HL8 A;  3AVM A;  3ZSY A;  3ZT2 A;  1JLG A;  2QKB A;  4KO0 A;  4ID1 A;  4ZTJ A;  2HNZ A;  3ASM A;  3NF6 A;  4DQQ A;  3LPT A;  3NF7 A;  1T7P A;  1C0U A;  4KHU A;  3CYM A;  1BI4 B;  4MFB A;  2IAJ A;  3D45 A;  2G8V A;  4PUO A;  2HVI A;  3LPU A;  2FBX A;  3DRS A;  3DYA A;  1JLQ A;  3AO4 A;  5DK5 A;  4CFD A;  1U48 A;  4AHC A;  3ULD A;  2IC3 A;  3VQC A;  4KI6 A;  1A5W A;  3LAN A;  1O1W A;  1D5A A;  4B9T A;  3DRR A;  2HVH A;  4IDK A;  3ZSZ A;  1TGO A;  2DFH A;  4DSI A;  3CG7 A;  1TK0 A;  1RBS A;  4CHQ A;  4HCB A;  2E6M A;  3THV A;  4DTX A;  4KB0 A;  4W5T A;  1KLM A;  2AJQ A;  1JXB A;  3CQ8 A;  2X74 A;  3RRH A;  3ALY A;  1W9H A;  1WSG A;  1YT3 A;  3CFO A;  3FFI A;  1TK8 A;  3WNF A;  4B9U A;  4L8R B;  4Q0B A;  2IS3 A;  4FLY A;  4C8L A;  2RPI A;  3V1Q A;  1XHZ A;  5C42 A;  2OPP A;  3U3Y A;  1ZBI A;  1RT2 A;  4CGD A;  4E7H A;  4F2R A;  3AVJ A;  4IBN A;  4E7J A;  3ITH A;  5KGX A;  2F8T A;  4E0D A;  4FJ9 A;  4CER A;  2XY8 A;  3G10 A;  3NBP A;  4CGF A;  1TKD A;  1S1T A;  5J1E A;  4DQP A;  2EX3 A;  3AVF A;  5EU7 A;  4Z4G A;  1WSF A;  3RMB A;  1L3V A;  4LY7 A;  3KLH A;  3JYT A;  3TAE A;  1X9M A;  4LSN A;  4FLX A;  4B9L A;  4DS4 A;  3TAM A;  3VQQ A;  4B8C A;  2JLE A;  2HMI A;  3AVI A;  2O4I A;  3KTQ A;  1BL3 A;  4DS5 A;  4O4G A;  1EX4 A;  2KFN A;  3OS1 A;  4E3S A;  4O5B A;  3CM5 A;  3O4Q A;  3SQ0 A;  3HVR A;  1NJX A;  3HPO A;  1TAU A;  3AO5 A;  2Z1G A;  1VSM A;  4OPJ A;  2FC0 A;  3AVB A;  1EKE A;  3OYA A;  4ELU A;  4ELV A;  3AVC A;  3ZSR A;  3QET A;  3OYE A;  3OS2 A;  1U47 A;  4AH9 A;  1NJZ A;  3AVG A;  2PYJ A;  1RT5 A;  2GUI A;  1HQE A;  1NK6 A;  3PV8 A;  1RCH A;  1NJY A;  2ITG A;  4I7F A;  3LP1 A;  4CJP A;  3RMA A;  2YKN A;  2G8W A;  4KHQ A;  1N5Y A;  4FM1 A;  4FJM A;  4AHS A;  4M3R A;  4FJ8 A;  2HHX A;  3F9K A;  3AV9 A;  1RDA A;  1KVA A;  2D5R A;  1J53 A;  2HND A;  4CHN A;  1I39 A;  3EY1 A;  1WSI A;  3WNE A;  1QE1 A;  3HPG A;  3NH0 A;  2XY5 A;  2FBV A;  4F2S A;  4OKJ A;  5J2M A;  4LSL A;  3K57 A;  1W0H A;  5CYM A;  4FJG A;  4DG1 A;  4CF2 A;  4DSK A;  1QQC A;  1REV A;  2DFF A;  1WSJ A;  3OVN A;  1KCF A;  3ZT3 A;  1TKZ A;  1ZBF A;  4PQU A;  4FJL A;  4TSX A;  1U45 A;  3K2P A;  4KFB A;  3ZT0 A;  2QK9 A;  2B6A A;  3QO9 A;  3L2Q A;  3HVT A;  4FK0 A;  4M3X A;  4IG0 A;  4DSE A;  3TAN A;  4CCH A;  3IAY A;  4CEA A;  4QOZ B;  1RIL A;  3DMJ A;  4KHY A;  4BDP A;  3DI6 A;  3K5N A;  3RTV A;  2Z1I A;  4CEE A;  1IKV A;  3HK2 A;  4DFP A;  1YTU A;  1C1A A;  5KGW A;  4DTO A;  4LD0 A;  3HXM A;  3S3N A;  3ZSX A;  1Q9Y A;  4DLE A;  3K58 A;  4OKK A;  1JLF A;  1UA0 A;  3NGY A;  1HYV A;  4CFC A;  3C95 A;  1SUQ A;  3NFA A;  4N5S A;  4HTU A;  2X6S A;  3QEW A;  1QSL A;  4QAG A;  4Z4F A;  2KW4 A;  3P83 D;  1MU2 A;  4E1N A;  1C1C A;  3SCX A;  4ZTF A;  3O3F A;  3TWH A;  1R0A A;  1CXQ A;  4CJ4 A;  4FLV A;  2RF2 A;  3V1O A;  4OPK A;  1KVC A;  4CJQ A;  4FLT A;  3PUF A;  4AHV A;  3PO5 A;  1XHX A;  4OVL A;  4CFB A;  4FJI A;  1B92 A;  3RMC A;  4CGG A;  1A5X A;  1SKS A;  1TL3 A;  4NCG A;  4J2B A;  4ICL A;  3AA4 A;  4OKE A;  3VQ4 A;  3SUO A;  3T1A A;  1HYZ A;  2P51 A;  5E41 A;  3D0P A;  1BHL A;  4GW6 A;  4CHP A;  3SYZ A;  1QTM A;  4EZ6 A;  4PA1 A;  1BQM A;  3ISN C;  5FRO A;  5T7B A;  4BDZ A;  2IDO A;  3OYN A;  1UAX A;  3VA0 A;  1LW0 A;  1UA1 A;  3LDS A;  4J2E A;  4NCA A;  4RG8 A;  3KD1 E;  4KAZ A;  4CJS A;  5HRN A;  5K14 A;  3RWU A;  1C6V A;  4BDY A;  3RR8 A;  2Y1J A;  1NK8 A;  1Y97 A;  4CHZ A;  2YKM A;  4FJ5 A;  1GOB A;  4B08 A;  4JRQ A;  3WNH A;  3SPZ A;  5FRN A;  5SZT A;  4R5P A;  3OYI A;  1S9E A;  1HJR A;  2E4L A;  5KRT A;  4DU4 A;  3PY8 A;  2I5J A;  3AVK A;  5KI6 A;  1I3A A;  2PZS A;  1RTD A;  3DLG A;  2Z1H A;  3IG1 A;  4DQI A;  3LAM A;  4M3Z A;  3DRP A;  3LZI A;  3AO2 A;  3KJV A;  4CGI A;  4EP4 A;  2W42 A;  1WSH A;  1VSE A;  1D8Y A;  1SV5 A;  3AA5 X;  3G0Z A;  3DLR A;  2OPQ A;  4M3U A;  4HHT A;  4CK3 A;  1HPZ A;  1RDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...