3L3UA

Crystal structure of the hiv-1 integrase core domain to 1.4a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
151
structure length
151
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Crystal structure of the HIV-1 integrase core domain in complex with sucrose reveals details of an allosteric inhibitory binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 54
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l3uA00
2BE2A 3MXJA 4FK4A 4IG0A 4Z4FA 3QEPA 1GOAA 4I2PA 3DMJA 3RMDA 1LW0A 1R0AA 1XC9A 3AVKA 1VSDA 3P5JA 3HJFA 2HHQA 3SQ1A 1S9GA 1WSFA 1SKWA 5I3UA 4E7LA 2DFHA 1QTMA 1KFDA 3EY1A 3G10A 4HVJA 2Z1JA 4FJLA 1RTJA 2YV0X 3KK1A 2P5GA 3OYNA 4KHWA 4DMNA 3M8QA 2X74A 4CF2A 1F21A 3I8DA 3NBPA 4DU1A 1TL1A 3AA2A 2G8IA 4ELVA 2IOCA 4E89A 3SPYA 4R5PA 1RDBA 5C42A 4XIUA 3AV9A 1S1WA 3AVIA 2LSNA 5K14A 2G8KA 2G8UA 3OS2A 4N41A 3AVFA 1TKZA 4B8AB 4FLYA 4EZ9A 2Z1IA 3ZT1A 4Y1CA 1U49A 1JLCA 2X78A 1D9DA 1VSHA 3KLEA 5HBMA 1NJZA 4K8ZA 4JS4A 1U4BA 3LWMA 3SQ0A 3RMAA 3NCIA 4CIFA 1VSLA 4CHQA 4B9TA 2VWJA 3KD5E 4GVMA 3SUQA 4DF4A 1QHTA 1SUQA 1HPZA 2JGUA 2XO7A 4FJ7A 2XHBA 4RW6A 3LP1A 3L3VA 4E7KA 3AVLA 3I0SA 1ITGA 4CEBA 5I42A 1KVAA 3WNHA 4QOZB 1L3SA 4QCLA 4CF9A 1X1PA 1JLBA 2IC3A 3L3UA 4TSXA 4FVMA 4CHYA 2Y1IA 3ZCMA 4DSFA 1W0HA 4GMJB 2B5JA 1LV5A 3RR8A 2FBXA 3QEIA 3L2QA 3M8SA 4NYNA 4CECA 4NYFA 3V4IA 2RPIA 1QQCA 4OJRA 4DTOA 4F2SA 4IFVA 4FJ8A 3TR8A 3OYLA 5FRMA 4DFKA 5KGXA 3AO3A 5CZ2A 4DTPA 1NOZA 5HROA 4W5OA 1N6QA 4IKFA 4M3YA 3NGIA 1DTQA 4F3OA 1DTTA 4KREA 4NCGA 3NGZA 2RKIA 4Z4IA 4E3SA 4DG1A 1KFSA 1CXUA 4FJNA 5HRPA 1TV6A 5D3GA 3MAQA 2E6LA 1S1UA 1T05A 2GV9A 4NCBA 2AJQA 4KB1A 3V9ZA 2O4GA 3S3NA 3MEGA 5CZ1A 4OKJA 3K58A 1NKEA 4M45A 3LALA 3IRXA 3OVNA 1YVUA 1VRTA 3VQ4A 1T8EA 2DTUA 3AVJA 3C94A 2DFEA 1KVBA 4CEDA 3C6UA 3CM6A 1NKCA 3U3YA 5HP1A 4DFJA 4E0DA 1Z25A 2P5OA 4CJ5A 4KHQA 4AHUA 3VQ8A 4OPKA 3AO4A 2OZSA 2ATQA 1YT3A 4B9LA 4M3ZA 3HPGA 2KTQA 3MECA 3QIPA 1NJYA 3PX0A 3BDPA 3KK2A 1KTQA 3KLHA 4C8MA 4DF8A 3K5NA 3SQ2A 3PX4A 4KI4A 1TAUA 1JL2A 4CJ3A 1BI4A 4CGDA 4EP4A 2KQ2A 3V81A 4F4KA 4CJQA 3LZIA 4CGFA 3KKRA 1TKTA 1JLAA 1I39A 1RDCA 1KVCA 3AO1A 3ZSQA 3OYKA 5CYMA 1EKEA 3I0RA 4CJLA 4N47A 1WSEA 3HP9A 1A5VA 2E4LA 4FJMA 2KZZA 1IH7A 1WAFA 1O1WA 4DTJA 4Z4HA 3AVHA 1A5XA 4H4OA 3OY9A 3TARA 3MEDA 4Q5VA 4PUOA 1RT5A 1HRHA 1JXBA 3O4NA 4C8NA 4KAZA 1T03A 3V9SA 2X6NA 5CY4A 3SCXA 2OPRA 1S1VA 5DMRA 4CFCA 3QERA 3KTQA 3AVAA 1X9SA 1ZYQA 3ZSVA 3O4QA 4RW9A 1RBRA 1SV5A 4CERA 4CHZA 3DLRA 1JLQA 2FBTA 3DYAA 2F8SA 1LWFA 3AVCA 3VQQA 3QESA 2KFNA 2ZE2A 3SJJA 4CESA 3DLBA 4I9QA 3EZ5A 1RBSA 2OYQA 3LPTA 4CIEA 1RDDA 1Y97A 4EP5A 1VSMA 4FLWA 4FLUA 3OYHA 3SZ2A 4I7FA 5JS1A 3QEWA 1RT4A 4DTMA 1ASWA 3LP0A 3WNEA 4CHOA 1XHZA 2Z1GA 2FBYA 4DWIA 3RTVA 3S3OA 4CJPA 3JSMA 4M42A 1WAJA 1CZBA 1ZBUA 4RW4A 5C25A 4W5QA 4KPYA 2YKNA 1TK5A 3ZT2A 1ZBLA 1NKBA 2D0CA 2HMIA 4FJHA 1UA1A 5J2NA 3LAKA 4L8RB 1HMVA 2YNIA 4HTUA 4KB0A 4O55A 4B9NA 4CF1A 3KKSA 1RT6A 2HHTA 3RMBA 1FK9A 3OYMA 3UIQA 3RMCA 3TI0A 1WSIA 3NF9A 3O3GA 1T7PA 2G8VA 3AA4A 3HVTA 3AA3A 4LD0A 1DLOA 3B6PA 4BACA 4CK2A 3DLGA 3NF7A 2ZQBA 4FLZA 1LAVA 2YKMA 1NOYA 5JS2A 1LAWA 3CFOA 2EX3A 4LSNA 5J2PA 4C8LA 3FFIA 1TKDA 3RR7A 3SV4A 1X9MA 3OYFA 3ALYA 5J1EA 1NJWA 1UA0A 1SKRA 1RT1A 3HSTB 5FRNA 5DK5A 4LY7A 4KFBA 1L3TA 4Z0UA 1HQEA 1WSGA 3VQPA 1NK6A 3K5OA 1G15A 2YNGA 4K8XA 1EETA 2PYLA 4LH4A 5HRSA 3L8BA 4Z4CA 1MU2A 4CGIA 1FKOA 4O44A 1NK9A 2IAJA 4FK0A 3VA3A 2PZSA 3F9KA 2ZD1A 3KLGA 5EU7A 1NJXA 3VQEA 1CLQA 3AVGA 1IKXA 2VG5A 5HRNA 3NDKA 2G8HA 3QNOA 1HYSA 3PUFA 4CFAA 3DRRA 4J2AA 1IKVA 1HJRA 3ZT4A 1JLFA 4CF8A 3CM5A 3SV3A 4M3UA 3NH1A 4DTRA 1S9EA 3VQ5A 3OYDA 3SUPA 1RCHA 2NUBA 1WN7A 4FJGA 4KHSA 3VQ9A 3ITHA 4CJFA 3L2UA 2KZMA 3DLHA 1L3UA 4F3TA 2JLEA 1B9DA 4I2QA 1IKYA 1D9FA 2EHGA 3K57A 3V6DA 4ZTJA 1KLNA 4H4MA 2DY4A 1JLGA 4IG3A 4BE1A 3DRSA 4BWMA 1BGXT 4YFUA 3QEVA 2OA8A 1UOCA 3RRGA 2E6MA 4CIGA 3LANA 2VWKA 2P1JA 1HNVA 2OPSA 2WOMA 3BGRA 3WNGA 3HPOA 5J2QA 2RF2A 3VN5A 3THVA 3OS1A 2I5JA 1WNSA 3TABA 3KD1E 2HB5A 3C95A 3ZT0A 1J5OA 2IGIA 4KHNA 3K5LA 3OYGA 1TK0A 4GW6A 4FJKA 1C6VA 4ID1A 4BE0A 4FM1A 3HO1A 5KRTA 3T1AA 1SL2A 3KK3A 4DFPA 2HHWA 1SL1A 4O0JA 4B08A 3HPHA 5HRRA 3HT3A 3ISNC 4LH5A 3TAMA 5KTQA 4JLHA 3VQCA 4OKKA 3TWHA 3U6FA 1LW2A 3L2VA 3T3FA 3SQ4A 3AO2A 4FK2A 3DLEA 2OPQA 1TL3A 3TAQA 2HHVA 1J54A 3WNFA 3HP6A 4BE2A 1YTUA 2HNYA 3ZSYA 3L2WA 1QSLA 1UAXA 3ZSRA 1FKPA 1IKWA 3AVMA 4PA1A 2D5RA 2HW3A 2Q3SA 2HVIA 4HCBA 4ELUA 4BDYA 1BI4B 1VK0A 3NFAA 3OYAA 3KJVA 4CJSA 1ASVA 3VQAA 1C0MA 3CG7A 4ICLA 1ZBHA 1J53A 1K6YA 3A2FA 2FBVA 1KSPA 1U47A 3LP2A 3SYZA 1BQNA 3IG1A 4M3WA 3DI6A 3KLIA 5SWMA 4W5TA 1VRUA 5T7BA 3V1OA 4CEEA 3OYIA 1REVA 4DLGA 3KLFA 2O4IA 3S9HA 4BWJA 4Q0BA 2B4JA 3LDSA 4FM0A 4AHRA 1S5JA 4E7HA 4CEAA 4DSEA 2YNFA 4CK3A 1VSKA 4Z4GA 3ZT3A 4HUFA 4PQUA 1BHLA 3O3HA 3ZSOA 3NH2A 3V9UA 1NK4A 2G8WA 4F8RA 3T19A 1TKXA 4DTUA 4OLAA 4DU3A 3HM9A 1C0UA 1BQMA 1RDAA 1S1TA 4OGCA 4E19A 3LWLA 1QS4A 4B9SA 1U04A 3PX6A 2HHUA 1BCMA 2XY6A 4DQIA 3VQDA 4CEQA 4YNQA 1D8YA 1LWEA 3QEXA 1WLJA 4JRQA 3B6OA 3LAMA 4BDZA 3V1QA 3SI6A 4KTZA 4FLVA 4CHNA 3F73A 1RBUA 4KKOA 2VG6A 3CFPA 1TGOA 4OVLA 3NF8A 3NGYA 2KW4A 5KI6A 2YNHA 3OJUA 1XWLA 4HUGA 4ELTA 1NK8A 4QAGA 2RN2A 4E1MA 2Y1JA 4MFBA 1JL1A 1HQUA 2D0BA 4CEZA 1VSJA 4CGJA 2F8TA 3QINA 2WONA 1VSFA 2YHAA 1RBVA 2HNDA 4DS5A 3OYCA 4BDPA 3AVBA 3TAFA 3IS9A 4WE1A 4N56A 3D0PA 3RWUA 4CJWA 4FJIA 2HHXA 1HNIA 4E7IA 3L2RA 3ZSXA 3IAYA 3DRPA 4FCYA 2PYJA 4OLBA 1EXQA 3PY8A 3K2PA 3M8RA 2HVHA 4RW8A 4CJKA 4AHCA 3U3GA 4FJXA 4DTSA 1D5AA 3CFRA 5E41A 1JKHA 4NCAA 3C6TA 3QO9A 1RTHA 3NAEA 4CCHA 1Z26A 3AVNA 1SKSA 4W5RA 3PO4A 5KRSA 4B9VA 3OYJA 2IS3A 2VG7A 4CJ4A 3NH0A 4JRPA 3DLKA 4HHTA 3M8PA 1J9AA 1UWBA 4H8KA 4B8CA 4Z4EA 1IO2A 4OKEA 3VQ6A 2XY7A 1B9FA 3CQ8A 1VSIA 4KI6A 2A1RA 1EP4A 1RBTA 4CJUA 4DFMA 3P1GA 3OJSA 1BL3A 1QSSA 4KTQA 1C1BA 5FROA 1L3VA 4CEOA 3K59A 4J2BA 1XHXA 2GUIA 4G1QA 4CGGA 4IDKA 3HXMA 2ETJA 3SNNA 1NK7A 1BIZA 1IG9A 4Y1DA 3VA0A 3TAPA 1NK0A 1VSEA 4AILC 4CK1A 1KLMA 4CE9A 3NHGA 2IDOA 2G8FA 3V9XA 4KRFA 1U48A 4LSLA 4IBNA 4CGHA 3D45A 4PWDA 4AHTA 1C0TA 3LPUA 4FYDA 3NE6A 4O0IA 3K5MA 4J2DA 2OZMA 4DQSA 2YHBA 4KO0A 4ZTFA 3QLHA 5C24A 1ZBFA 1JLEA 1S6PA 4CJRA 1L5UA 1C1AA 1KRPA 1ASUA 2BDPA 4HUEA 4E7JA 3ASMA 4DSIA 1FXXA 1WSHA 3S3MA 1Q9XA 1GOBA 2PY5A 3ZSWA 4HCCA 1CXQA 4FLXA 2HNZA 3ULDA 4FZZA 3HYFA 3OS0A 2F96A 4CEFA 4DS4A 4FW1A 3DOLA 4CJEA 1BIUA 4OGEA 4FZYA 4FW2A 3ZSZA 2GBZA 4FLTA 2R7YA 4M3TA 1RT2A 4DQRA 2ITGA 3QETA 3DM2A 4AHVA 4CF0A 1CZ9A 2QKBA 4DQPA 4FJ5A 4M3RA 4EZ6A 4ID5A 4DTNA 1SL0A 4F2RA 5KGWA 4CFBA 3LP3A 1YTAA 2BANA 3AO5A 3JYTA 3RRHA 4DSJA 2HHSA 2KFZA 4CJVA 4DLEA 5J2MA 2QK9A 3SUOA 4FM2A 4E1NA 4IFYA 1Q9YA 4B9UA 4O5BA 2OPPA 3E01A 2W42A 1X9WA 4I9LA 3P83D 1S1XA 4KV8A 3CYMA 4DSKA 4MQ3A 4N5SA 1RNHA 1I3AA 4KHUA 2QXFA 4AHSA 4B9MA 3MXIA 2Z1HA 3VQ7A 1BCOA 1TAQA 1RT3A 4DTXA 3LZJA 4C8OA 4N76A 2BGGA 3V9WA 4JS5A 4DU4A 1U45A 1XI1A 3OYEA 4W5NA 4M41A 2A1SA 3KIOA 4RG8A 1C1CA 5CYQA 4CHPA 4KHYA 1HYVA 1W9HA 2DFFA 4M3XA 4OPJA 4KTWA 3TANA 1EX4A 4CJTA 4ZHRA 3SPZA 1N5YA 1QSYA 4FZXC 4B3OA 3PO5A 3VQBA 4AH9A 2XY5A 3TAGA 4FJJA 3PV8A 4O4GA 3EYZA 1NK5A 2QKKA 3QIOA 1TK8A 4PY5A 4FXDA 3AA5X 3TAEA 1Q8IA 1RT7A 1LWCA 5FDLA 1BISA 1RTIA 2X6SA 3DOKA 3G0ZA 4UQGA 2XRIA 4C8KA 1A5WA 2FC0A 3MXMA 2P51A 1KCFA 3QNNA 4DQQA 5HLFA 3HK2A 2B6AA 3HL8A 1WSJA 1B92A 1GOCA 1JXEA 3O3FA 4CFDA 1ZBIA 1RILA 1S6QA 3NF6A 3V1RA 3HVRA 4J2EA 3OYBA 4FJ9A 1RTDA 2XY8A 2D0AA 3MEEA 1TVRA 1HYZA 3H08A 3SUNA 5SZTA 4RW7A 4DSLA 1QE1A
chains in the Genus database with same CATH superfamily
2BE2A 3MXJA 3J80O 4IG0A 4FK4A 3ENHA 3DMJA 4DV5K 4M7XA 3AVKA 1VSDA 1WSFA 4WYBA 1QTMA 4A57A 2YV0X 2P5GA 2P9LB 4JD2B 4X66K 3UE5A 2G8IA 5JLHA 3SPYA 4R5PA 1RDBA 2G8UA 2LSNA 4OO1J 4N41A 4EZ9A 4Y1CA 4K8ZA 2X78A 3KLEA 5HBMA 4JS4A 3LWMA 3WXKA 3C65A 2VWJA 3KD5E 4A61A 3M5RA 4NO7A 1HNXK 2XO7A 4IOXA 4E7KA 3L3VA 3T69A 4Z94A 1ITGA 4CEBA 3HOTA 1KVAA 4QS9A 1X1PA 3TSPA 3L3UA 4M7YA 4C23A 2YX6A 3MCPA 4GMJB 2B5JA 2FBXA 2RPIA 3OYLA 3EKSA 3AO3A 5CZ2A 1YITN 4JI8K 4CVNE 4FPBA 2RKIA 5AQNA 5KPZA 1KFSA 1CXUA 5D3GA 5FPDA 4FOEA 3VEZA 1S1UA 4YDUA 4NCBA 3TU5A 5EX5A 3V9ZA 5BN8A 4JI7K 4OKJA 5AQGA 4M45A 2F7TA 1VQPN 2KHOA 3AVJA 5GADP 3C6UA 5BPNA 4MO5A 4YOVA 3U3YA 5AQFA 5HP1A 4DFJA 4WQ4C 1Z25A 4DV0K 4OPKA 3AO4A 4B9LA 1YT3A 3O1WA 3T1YK 2KTQA 3BDPA 3PX0A 4BGAA 2W6KA 3SQ2A 3PX4A 1TAUA 2W41A 3BZKA 4F4KA 4CJQA 2P9KB 3LZIA 3BF1A 1TKTA 1RDCA 3AO1A 5CYMA 3CIPA 3W3DA 4I6MA 1NGAA 4N47A 5ADXH 2VWBA 4K0KK 1RFQA 3K9JA 1S3XA 3MCAB 4DR3K 3ZETB 1A5XA 4H4OA 2GTDA 4Q5VA 1C0GA 1U6ZA 3D2FA 1WBDA 2I7NA 1HRHA 3O4NA 3V9SA 3SCXA 1JCEA 2YJFA 4FO0A 4H0TB 5FPMA 1RBRA 4BG8A 3DLRA 5GAHP 2F8SA 3VQQA 2KFNA 3O9QA 4I9QA 3VPZA 5AQWA 1RDDA 4YOYA 4DTMA 4CZMA 1ASWA 3WNEA 2FBYA 1WAJA 1ZBSA 5C25A 4RW4A 4H03B 3CPWM 3VF2A 3ZT2A 1NKBA 2D0CA 4F9OA 2HMIA 4L8RB 4HTUA 4JK9A 1W97L 1RT6A 3RMBA 3UIQA 1KAXA 3O3GA 3NF9A 3HVTA 3AA3A 4LD0A 3O9RA 4BVOA 3CCVN 3NF7A 5JS2A 4C8LA 1TKDA 1QZ6A 3PIOL 4FL9A 3RR7A 3UKRB 1OH5A 3ALYA 5J1EA 4K41A 4CD1A 3U9ZA 3HSTB 4LY7A 1L3TA 1Z05A 1HQEA 3K5OA 4K8XA 4B1ZA 1JCGA 3L8BA 3AAPA 1MU2A 4Z4CA 4CGIA 5GIOA 2IAJA 4FK0A 3CERA 2PZSA 3LDLA 1NJXA 3U9DA 3WUHA 2YJEA 2VG5A 3N4PA 2ITMA 2G8HA 5IWAK 4IJNA 2O8EB 3DRRA 4CF8A 5EXWA 3SV3A 3DAWA 3VQ5A 4KHSA 1NGFA 1WN7A 4FJGA 3VQ9A 3ITHA 5KPTA 3C6AA 2KZMA 1L3UA 1YI2N 5AR0A 3MDQA 2EHGA 4H4MA 3DRSA 1BGXT 3CQXA 4XEIA 3WNGA 4HTLA 4H0VB 1QQNA 3H3OB 2P9UA 3UKUA 4JI5K 1KXPA 2E1YA 3WQUA 3ZT0A 4KHNA 1KD1O 4FJKA 3THWB 3L6QA 2E1ZA 5AFUA 3F9MA 4DFPA 4BQLA 4DB3A 2D4WA 3HOSA 3L2VA 3T3FA 3RSEB 3SQ4A 4FK2A 2E20A 2YCHA 2HHVA 4BE2A 3SMPA 1T6CA 2HNYA 3ZSYA 3L2WA 1QSLA 1UAXA 4AM6A 3HI0A 3AVMA 2D5RA 4HCBA 4ELUA 1BI4B 3E9PA 3T1HK 3OYAA 5BRDA 3GG4A 2VYPA 3CG7A 2V51B 1MWKA 1KSPA 3SYZA 1M1KO 3ID8A 3DI6A 1DKGD 3OTOK 1Q86O 3V1OA 4CEEA 1REVA 2GUPA 1SQKA 4Q0BA 2WC9A 4DUYK 4DSEA 4WFBL 1C0FA 1BWFO 4PQUA 1BHLA 3PSFA 1OKJA 1NK4A 4IXCA 2G8WA 3T19A 5AZIA 4DKWA 4DU3A 1C0UA 4ILGB 4YDUC 4E19A 4OGCA 3O9UA 4NXNK 4B9SA 2NRVA 3O9TA 3VESA 2A3ZA 1YF5L 2PFUA 3B6OA 2Q31A 1U2VB 4FLVA 4C1NK 4KKOA 5AQVA 3CMAN 2D0OA 2HBKA 2VG6A 4OVLA 1GLJO 2UU9K 3NGYA 5A2QO 2KW4A 2YNHA 4ELTA 3IMXA 4MFBA 1HQUA 2D0BA 4IOAL 2F8TA 4IJAA 3QINA 3VETA 2WONA 1NGEA 1VSFA 3WEEA 4DS5A 2NNWA 3OYCA 3H45C 3AVBA 3KZBA 2GX9A 1K8KA 4FJIA 2HHXA 4E7IA 3IAYA 3ZSXA 4OLBA 3FZFA 1DEJA 3CJCA 3DXKB 3U3GA 4CJKA 4CZHA 5FPNA 1RTHA 1Z26A 3O08A 1SKSA 4B9VA 2VG7A 3DLKA 3EZWA 4H8KA 1UWBA 4Z4EA 3VGKA 4JNEA 3VQ6A 5LMUK 3EKUA 2XY7A 1B9FA 5F2RA 2WBNA 1QVFM 4BR5A 1EP4A 4DFMA 1BL3A 3KHYA 4CEOA 5BREA 4J2BA 4CGGA 2ETJA 3OW2M 1NK7A 5AZJB 1IG9A 2E88A 4B3MK 3NHGA 2IDOA 2G8FA 4FOIA 4DV7K 3CI5A 3K5MA 3MN7A 3BP8A 2V7ZA 3QLHA 2O8BB 4CJRA 1GLEG 2H3GX 4CBXA 1ASUA 3ATUA 4DSIA 1FXXA 4HCCA 1CXQA 3ULDA 2F96A 2YHYA 1DGKN 1BIUA 3H3NO 2R7YA 3QETA 3H46O 4JI4K 4M3RA 4DTNA 4JKAA 4BR2A 3CCUN 4CJVA 5J2MA 4FM2A 1Q9YA 4IFYA 4B9UA 2EWSA 4I9LA 1GLBG 4MQ3A 4N5SA 1I3AA 3CPEA 4OLAA 1BCOA 1TAQA 4N76A 2BGGA 3LZJA 5AQJA 3ZX2A 4DU4A 2ASMA 3P31A 2O8DA 4OPAA 4BRAA 4M41A 1YXQA 2HBMA 4RG8A 4DV1K 1HYVA 3D2EB 4KTWA 3TANA 4DUZK 2YHWA 4BRDA 2XY5A 2F4VK 3IFRA 4O4GA 3EYZA 1NK5A 3THYB 3QIOA 1TK8A 3TAEA 4K43A 2FSKA 3G0ZA 2XRIA 1A5WA 3MXMA 1KCFA 5B8HA 3QNNA 4DQQA 5HLFA 3HK2A 3HL8A 1RDWX 1B92A 1GOCA 1HUXA 1RILA 3I8BA 1YJNN 1Q81O 2UUAK 1RTDA 3MEEA 1TVRA 1HYZA 3SUNA 2NLXA 5SZTA 1QQOA 3CCEN 3EE8A 3FR0A 3VOVA 3RMDA 2QWRA 1R0AA 3HJFA 1IBLK 3VTIA 2ASPA 1KFDA 3G10A 3OYNA 4CF2A 5EOYA 4JKFA 1NLVA 1QQMA 4QS7A 3AA2A 2IOCA 4WQ4A 3SK3A 4E89A 4JHDB 1VQ9N 5C42A 3AV9A 1E4GT 2E2OA 1TKZA 4FLYA 2Z1IA 2G8VA 1U49A 1VQ5N 1NJZA 1V4TA 1U4BA 3SQ0A 4CIFA 4CHQA 2RHKA 3AAQA 4DF4A 1QHTA 2P9SA 1SUQA 4B3SK 4RW6A 3I0SA 4BR4A 2AP1A 5I42A 2QXLA 4RTFD 4DR2K 1KC8O 1L3SA 4CF9A 2HBJA 4O5FA 1JLBA 4FVMA 4EFHA 3QEIA 4BRCA 3M8SA 4NYFA 4F2SA 4IFVA 5KGXA 4DTPA 5MLCQ 4IKFA 4BC2A 2VQEK 3NGIA 1ESVA 1DTQA 4F3OA 2ZGZA 4NCGA 3NGZA 2HMPA 4E3SA 4DG1A 2E2QA 3VF4A 2HHHK 4FJNA 1TV6A 4JKGA 3QICA 5AQQA 4KB1A 2O4GA 1J6ZA 5EVZA 3S3NA 3K58A 1NKEA 4YHHK 1K9MO 3IRXA 3FZKA 3OVNA 1BA0A 3VQ4A 2V7YA 1T8EA 2DTUA 4CZLA 2DFEA 1KVBA 5AQHA 4E0DA 3CJ7A 1HJOA 1YVNA 4AHUA 3K0SA 3M6GA 4M3ZA 4FPAA 1NJYA 3KK2A 3KLHA 4DF8A 4O8UA 3AY9A 3HM8A 3CC7N 3O8MA 1M90O 4CJ3A 2KQ2A 3C0BA 1JLAA 1HX1A 1KVCA 3ZSQA 3OYKA 4FWRA 4CJLA 2OCEA 3DXMB 3I0RA 1ATSA 4H5RA 3R6MA 1A5VA 4YOWA 1YJ9N 4FJMA 4IDHA 1WAFA 5AFUH 4Z4HA 1XQSC 3GOIA 3TARA 3MEDA 2KLAA 3VF6A 4DV2K 4X64K 1RT5A 1NU0A 4C8NA 4OPHA 4BY9C 1E3MA 3KTQA 1S1VA 4CFCA 3AVAA 1X9SA 1SV5A 3PLAA 1JLQA 3D2FB 3SJJA 4DR6K 3A5LC 3DLBA 1RBSA 3LPTA 4CIEA 4X65K 4EP5A 4FLUA 3SZ2A 1VSMA 4H0XB 2Q36A 3FZMA 1TUYA 3I56N 3O9SA 2Z1GA 3CCQN 3TTCA 4CJPA 3JS6A 1CZBA 1JCFA 4KPYA 2YKNA 2QW9A 2Q0UA 1OH7A 1HMVA 2YNIA 3CJAA 4KB0A 2OTJN 5E84A 4CF1A 3KKSA 1FK9A 1T7PA 1MWMA 3AA4A 3E9OA 1SZ2A 4M63C 3VENA 1S22A 1BU6O 2ZQBA 1NOYA 1QZ5A 3SV4A 2O8CB 3EN9A 1UA0A 5HL7L 1SKRA 1RT1A 5FRNA 2F9TA 3VGLA 1WSGA 1NK6A 2YNGA 1EETA 1N32K 3C6HA 1NGIA 2BTFA 3ZX0A 1FKOA 5LY3A 3H1QA 3KLGA 5EU7A 1ILYA 1IKXA 5HRNA 4CFAA 2UXDK 1HJRA 1JLFA 3R1XA 3ENBA 4MLHA 4DTRA 3OYDA 2NUBA 4CJFA 3L2UA 3T7ZA 4F3TA 3IUCA 1IKYA 3V6DA 4ZTJA 1VQ6N 3CXCM 4BWMA 1UOCA 5M1QA 2CH6A 3HPOA 5BPLA 1HNVA 2OPSA 1GLDG 3BGRA 4BRLA 5J2QA 2RF2A 3THVA 1Y64A 2P9NB 5AQZA 3TABA 3W0LA 2Q1NA 3C95A 1J5OA 3K5LA 3OYGA 4GW6A 4ID1A 4FM1A 2UXCK 3KK3A 4O0JA 3ZEUB 3KWIA 5HRRA 3ZX3A 2P9UB 5KTQA 4OKKA 5M1OA 2OTLN 1LW2A 3AO2A 3HP6A 3WNFA 1YTUA 4BR0A 2E5LK 4Y0WA 3ZSRA 1IKWA 1BDGA 4BDYA 4IO9L 3NFAA 1HLUA 4CJSA 1C0MA 5BN9A 2FBVA 3O1BA 3QMLA 1U47A 3LP2A 5F0XA 1BQNA 1R59O 5SWMA 4W5TA 1VRUA 5T7BA 3CC2N 2O4IA 5ELZA 1P8ZA 2B4JA 3LM9A 4AHRA 4FM0A 4CEAA 4NLBA 4CK3A 4Z4GA 3ZT3A 4HUFA 3CCMN 4F8RA 4DTUA 4R79A 3FZLA 1Q7YO 1LWEA 4LC9B 4JRQA 3LAMA 4CHNA 3F73A 4B3RK 1XNQK 3K9KA 2FSNA 3CFPA 1TGOA 4DR5K 2DPNA 3CD6N 1JL1A 4JYAK 4LF4K 1VSJA 3BF3A 4LF7K 2P9LA 5GAEP 1HNWK 4L3QA 4CZJA 4B1XB 3U8XA 4DV3K 4H0PA 3G6EN 4XH4A 5LJWA 1TYQA 3D0PA 1GLAG 3DWLA 3RWUA 1HNIA 4LFCK 1NGDA 1ZC6A 3L2RA 1T6DA 3DRPA 2PYJA 2YI1A 3WEEB 3K2PA 3PY8A 3D6RA 1NGBA 3OBYA 4FJXA 2HOEA 5EY4A 1NWKA 1YHQN 1K8KB 3VEVA 3C6TA 2WFBA 3AVNA 3CJ9A 2I7PA 3OYJA 3NH0A 4H0OA 1BOTO 1IO2A 3QB0A 4WQ5C 3FLCO 3CQ8A 2PBDA 4CJUA 1RBTA 5C12A 3OJSA 1K8AO 1QSSA 4KTQA 5FROA 4H5TA 4X62K 3K59A 2ZGYA 1XHXA 2GUIA 4G1QA 4IDKA 3HXMA 1BIZA 4JV5K 3TAPA 4AILC 3GE1A 1KLMA 3V9XA 1U48A 1WOQA 2P9IB 4PWDA 4AHTA 3LPUA 4FYDA 3NE6A 4O0IA 3JAMO 4O8KA 4J2DA 3ULEB 1ZBFA 1C1AA 1ZXOA 4HUEA 5JLFA 3S3MA 1GOBA 1IG8A 4B3TK 3GBTA 5AQLA 4OGEA 2GBZA 3D7EO 1HKGA 4CF0A 1CZ9A 4DQPA 4ID5A 1SL0A 5KGWA 3LP3A 1YTAA 2BANA 3AO5A 3JYTA 4CZFA 2P9KA 4DSJA 2KFZA 3A0IX 2HF3A 4O5BA 2W42A 3E01A 1SAZA 3EEQA 3IKMA 3ZETA 4BROA 3MXIA 1RT3A 1U45A 1CZAN 4CBUA 2ZM6K 1XI1A 3CMEN 3OYEA 2A1SA 3P4IA 2DFFA 4M3XA 3HSCA 4B3OA 1RDUA 3VQBA 2O8DB 4PY5A 4FXDA 1BISA 5M1NA 2P51A 1N33K 3MX2A 1WSJA 1JXEA 4XH1A 4FWSA 2NZTA 3O3FA 4J8FA 3NF6A 3FGUA 3V1RA 3OYBA 3H08A 3G71N 4JI2K 1WB9A 3CCLN 4FSVA 4Z4FA 3Q7CA 3QEPA 3THXB 4I2PA 1XC9A 2O8FA 3HTVA 3SQ1A 1S9GA 4WF9L 4GY2B 1SKWA 5I3UA 4E7LA 2DFHA 1X9JA 2Z1JA 4FJLA 1RTJA 2HW3A 4KHWA 2X74A 3SAFA 4B1UB 4BVPA 3NBPA 4JKDA 1NBWA 1TL1A 1NMDA 3AVIA 1S1WA 2G8KA 2UUCK 3AVFA 3SAHA 1LOTB 1JLCA 1VSHA 3RMAA 4GVMA 2VGNA 1HPZA 2VGMA 4AF1A 2XHBA 4FJ7A 2FSJA 3AVLA 5M1KA 4QCLA 2IC3A 3LDOA 4TSXA 3SAGA 4CHYA 3ZCMA 4DSFA 1W0HA 3VMFB 2P9SB 1LV5A 4YY3K 3RR8A 4YOUA 3B8AX 1EO1A 3V4IA 4OJRA 1QQCA 4BRMA 4DTOA 3TR8A 3DLLL 4DFKA 2QWMA 5HROA 1N6QA 3MWTA 1NOZA 4W5OA 4XH5A 4BREA 4JK7A 4KREA 4Z4IA 1H1VA 1HKCA 1HNZK 4CZKA 5HRPA 3MAQA 2E6LA 1T05A 4DHYA 2AJQA 5AQOA 3CCSN 1LCUA 3MEGA 3SBGA 1S72N 1T44A 4BRPA 3THWA 4FWLA 1BA1A 4KBOA 3NVKA 3C94A 4E1JA 4FVUA 4UY8O 2Q0RA 3AGRA 3G25A 5ADXA 3J7YP 3VQ8A 2OZSA 2ATQA 4CJ7A 4JI0K 3MECA 1NG9A 4BRQA 4C8MA 3K5NA 1O13A 3G4SN 4KI4A 4FWKA 1JL2A 5F1XA 1XMOK 5KQDA 1BI4A 4CGDA 3V81A 4CGFA 2HF4A 3KKRA 4BRGA 1XUPO 1EKEA 2NRZA 1WSEA 3HP9A 2E4LA 3OHRA 1IH7A 2FLOA 1O1WA 4DTJA 3RVCA 3AVHA 2D1KA 4H5VA 3U4LA 4LF5K 1T03A 2NRXA 2X6NA 5CY4A 5CHIA 2OPRA 3SBTA 3QERA 3ZSVA 4YOXA 3DYAA 2FBTA 3ENOA 4JAXA 1LWFA 3QESA 2HSTA 4CESA 2OYQA 1V4SA 3A5OC 4FWQA 1ATNA 3MX5A 3OYHA 4I7FA 5JS1A 4CHOA 1XHZA 3S3OA 3BEXA 3MWPA 3CJBA 4RCHA 1TK5A 3J8AA 5J2NA 3LAKA 4O55A 4BRIA 3VERA 3OYMA 5H1SQ 5KPRA 3TI0A 1WSIA 3VEXA 3C7NA 1DLOA 4JKCA 4BACA 4CK2A 3DLGA 4A5BA 1G99A 5GINA 1LAVA 2YKMA 1LAWA 2A41A 1KAZA 3CFOA 2EX3A 2IVOA 2QTDA 3OYFA 2JWKA 5BRFA 1NJWA 1VQKN 5DK5A 1QVGM 3VQPA 3CCJN 2QWPA 2PYLA 4LH4A 5BR9A 4MO4A 3VA3A 1X3MA 4A2BA 4WFAL 3J7AP 1CLQA 3AVGA 3DJCA 3VTHA 3QNOA 1HYSA 1IKVA 3CM5A 5AZJA 5TKWA 3NH1A 2OANA 4EHTA 1S9EA 2NRTA 1RCHA 2Q2RA 4IWVA 2JLEA 1B9DA 2YHXA 1D9FA 1BO5O 3QDKA 1KLNA 1NGHA 2GWJA 4IG3A 4BR9A 2E6MA 4CIGA 2BH1A 3CF5L 2P1JA 2ZWHA 3OS1A 3VEWA 1WNSA 2HB5A 2FF6A 5M1PA 4ILJA 2IGIA 1VQLN 4BE0A 5C10A 1NGJA 2PAVA 1SL1A 3HPHA 4JK8A 3HT3A 4LH5A 4JLHA 3TWHA 3QBXA 1FW6A 4A5AA 4GKKK 5AQXA 3TSQA 3DLEA 2OPQA 1TL3A 3KK7A 3TAQA 3E1YA 1TUUA 4BC4A 1N36K 3FFKB 1NGGA 4ISGA 1FKPA 4PA1A 2Q3SA 2HVIA 3KJVA 4PL7A 1ASVA 3VQAA 1J53A 1I94K 3IG1A 3KLIA 4DCHA 3OYIA 4I6MB 3ZLJA 3KLFA 3S9HA 1ATRA 3D2EA 4BWJA 3F5TA 4E7HA 2ZJQL 3WXJA 3FE1A 2YNFA 4KH6A 3THYA 4WQ5A 1VSKA 4GVEA 3ZSOA 3V9UA 5TKYA 1E4FT 1XMQK 1BQMA 1RDAA 3LWLA 1BCMA 3GDQA 2XY6A 3VQDA 4CEQA 4YNQA 4DQIA 1D8YA 1VQ4N 4BDZA 4DR4K 2J4RA 3TTDA 3OJUA 1XWLA 2AA4A 4E1MA 4AM7A 2Y1JA 4JKBA 2RE2A 4CEZA 1OH6A 3IDHA 4CGJA 2YHAA 4AQYK 2HNDA 3CHWA 1N34K 1EWRA 3TAFA 3IS9A 4N56A 4JHDA 3A5MC 4FWPA 4CJWA 4KHPK 3EE9A 5AQIA 5GAGP 1EXQA 4RW8A 4BC3A 1T3VA 3VEOA 4AHCA 1TYQB 4DTSA 1D5AA 3CFRA 4BGBA 5E41A 1KQSM 4GV3A 3QO9A 4NCAA 3NAEA 4CCHA 3F2KA 4W5RA 5KRSA 1MA9B 4CJ4A 5AQYA 4JRPA 4DQ8A 2QI2A 3M8PA 4IEEA 4B8CA 4LF9K 4OKEA 1VSIA 5AQMA 4JKHA 4BQZA 3FZHA 4JN4A 2Q97A 2FXUA 3SNNA 4GNIA 1NK0A 1VSEA 4WFNL 4CZGA 4B9QA 5C2FA 1YJWN 1J5EK 4LSLA 1IV0A 4CGHA 3D45A 1C0TA 2OZMA 4DQSA 2YHBA 4KO0A 4PHTX 4ZTFA 1S6PA 4B1YB 1L5UA 3CC4N 4E7JA 2P9PA 3ASMA 1WSHA 4U7BA 1Q9XA 3MN9A 5BPMA 2PY5A 3UKUB 4FLXA 2NRRA 2ZF5O 4DS4A 4FW2A 3ID6A 1RT2A 4DQRA 2ITGA 4AHVA 3LL3A 4FJ5A 1XC3A 4EZ6A 2GEMA 2GWKA 3MMVA 2HHSA 2BUPA 5DM6L 2QWLA 3SUOA 4E1NA 5E26A 3DXMA 5AQRA 1X9WA 1S1XA 3CYMA 4DSKA 1RNHA 4B9MA 2Z1HA 3OA9A 3WT0A 4C8OA 3V9WA 4JS5A 4WCEL 3SLCA 4GV6A 3KIOA 4CHPA 1W9HA 3LDQA 3SPZA 4JI6K 4ZHRA 4FZXC 3JXUA 3PO5A 4AH9A 3TAGA 3PV8A 3KWGA 3ATVA 4KI6A 1Q8IA 1RT7A 2W6LA 5FDLA 2X6SA 4UQGA 4C8KA 5AZIB 2FC0A 5LMNK 2B6AA 5JVHL 4CFDA 4A62A 4FJ9A 2D0AA 2XY8A 4RW7A 5LJVA 2E2PA 4B1WB 1W2BM 1HPMA 1GOAA 4JD2A 1LW0A 1K73O 1GLLO 2JWLA 3P5JA 2HHQA 3NMUA 1VQNN 3EY1A 4HVJA 3KK1A 4DMNA 2ASOA 3M8QA 3WXIA 1F21A 3I8DA 3HZ6A 4DU1A 3I55N 4ELVA 2O8FB 2HBLA 4CZEA 4YOTA 2ZJRL 4XIUA 5K14A 3OBWA 3OS2A 2O8CA 2V52B 4B8AB 5DM7L 1JJ2M 2VQFK 3ZT1A 1D9DA 4KHYA 2QEXN 3NCIA 3CQYA 1VSLA 1HKBA 4B9TA 3H1VX 3SUQA 2QWOA 2JGUA 3LP1A 3MK6A 4BRHA 4LFBK 3WNHA 4QOZB 3I33A 3O80A 2Y1IA 3VEYA 4EHUA 3L2QA 1SS6A 1OH8A 4NYNA 4CECA 4FJ8A 5FRMA 1HR0K 4M3YA 1NJIO 3SMSA 3BZCA 4PKHA 3L4QA 4JEPA 1DTTA 3EO3A 5AQTA 3LDPA 3ZYYX 4G9ZA 3GL1A 3NVMA 4DV4K 2P9NA 2GV9A 2VCPA 5CZ1A 2A5XA 3LALA 5GIPA 1YVUA 1VRTA 3UB5A 3ZEUA 4CEDA 3R8EA 3CM6A 3O5BA 1NKCA 3BY5A 1QHAA 3E9LA 2P5OA 4CJ5A 3E66A 4KHQA 3MN6A 3P39A 2UUBK 3HPGA 3QIPA 4MLEA 1KTQA 3MN5A 2IVPA 1N8RO 4IO8A 4EP4A 2UYTA 5AQUA 1I39A 4LF8K 4CD3A 3PSIA 1BG3A 3R3LA 2KZZA 3TPQA 4JI3K 5AJ3K 1VQ8N 3OY9A 4PUOA 5BR8K 4KAZA 1JXBA 3WQTA 5DMRA 1ZYQA 3O4QA 4RW9A 4CERA 4CHZA 3AVCA 2ZE2A 3EZ5A 5KQ8A 3BUZB 1GLFO 1Y97A 4H0YB 4FLWA 2IIRA 3QEWA 1RT4A 3LP0A 5AQPA 4DWIA 3RTVA 4RWTA 2D0PA 3JSMA 4M42A 1YUWA 1ZBUA 4A59A 4B1VA 4W5QA 2A42A 1ZBLA 1NMNA 4FJHA 1UA1A 1DT9A 4KH5A 2CH5A 1W7AA 4B9NA 2HHTA 3WXMB 3RMCA 5I9EB 3UKRA 3B6PA 4DV6K 1MDUB 4FLZA 4IOCL 4LSNA 5J2PA 3FFIA 1XNRK 1X9MA 3C7NB 4KFBA 4Z0UA 3EL2A 1G15A 4YORA 2O8EA 5HRSA 3KVGA 1YIJN 4O44A 1NK9A 3AGKA 3PIPL 2UXBK 3F9KA 2ZD1A 4OX9K 4ILHA 3VQEA 4U67L 2W40A 3NDKA 3PUFA 4J2AA 3ZT4A 4K25A 1NNEA 4K42A 4M3UA 1NGCA 4CI6A 5C2DA 1VHXA 3SUPA 3DLHA 2P9IA 4PKGA 4I2QA 3K57A 3ULEA 2DY4A 1JLGA 5JICA 4BE1A 2QM1A 3QBWA 2OA8A 4YFUA 3QEVA 1YAGA 4PKIA 3RRGA 3J7ZO 3LANA 2VWKA 2WOMA 3VN5A 4JKGB 2CGKA 1GLCG 1D4XA 2I5JA 3KD1E 4BRKA 1TK0A 3RSEA 1C6VA 2GELA 4NB4A 3HO1A 5KRTA 3T1AA 1SL2A 4BC5A 2HHWA 4HWIA 4B08A 4NLCA 3SJHA 3ISNC 3TAMA 3VQCA 1WBBA 3U6FA 2WUSA 4JKEA 3Q7BA 1J54A 3HRGA 1OVQA 2ZJPL 2E2NA 3QFUA 2NRWA 2CGLA 1VK0A 1X3NA 1ZBHA 3M3ZA 4ICLA 3A2FA 1K6YA 3L0QA 4CW7B 3H6EA 5LL6Z 4M3WA 4DLGA 4BRFA 4C1NI 3LDSA 1S5JA 1VQ7N 3O4WA 3AARA 4NXMK 1OVYA 3O3HA 3LDNA 1U2VA 3NH2A 1TKXA 3HM9A 4KH4A 5BRHA 1S1TA 1QS4A 1U04A 3PX6A 2HHUA 5IT9O 5C15A 3QEXA 1WLJA 3SI6A 3V1QA 4EAHD 4KTZA 1RBUA 3S41A 1NM1A 3LM2A 1IJJA 1IBMK 3NF8A 2QWQA 5KI6A 4HUGA 3THXA 1NK8A 4IEIA 4QAGA 2RN2A 4BG9A 1VQMN 1P90A 2QA4N 1RBVA 5AQKA 4DR1K 4BDPA 3DXKA 4WE1A 4GV9A 4CBWA 4FWMA 4H5WA 4FCYA 4GKJK 2IVNA 1Q18A 2HVHA 3M8RA 2A40A 4LF6K 4V19S 1JKHA 3L4IA 3QFPA 3CETA 3PO4A 2IS3A 3O6WA 4HHTA 1J9AA 4FWOA 1KAYA 3CCRN 5CE3A 2A6AA 3A5NC 4BRNA 4LFAK 2A1RA 5FLXO 3P1GA 4BR7A 3TTFA 1C1BA 1L3VA 4ISFA 1RGIA 4Y1DA 3VA0A 3HBTA 5JVGL 2O8BA 4CK1A 3N4QA 4CE9A 4KRFA 4DR7K 3CJ1A 4IBNA 5FPEA 4EIAA 2F9WA 5C24A 3M1FA 1JLEA 2KKZA 4FWNA 1KRPA 2BDPA 3J81O 4MDAA 3ZSWA 5JMVA 2HNZA 4FZZA 3HYFA 3OS0A 4CEFA 4FW1A 3DOLA 4CJEA 4FZYA 3ZSZA 4FLTA 2NRHA 4M3TA 2E8AA 3DM2A 2P9PB 2QKBA 4F2RA 5HOOA 4CFBA 3RRHA 1BUPA 4DLEA 2QK9A 4PL8A 4H5NA 3A8YA 2OPPA 5AQSA 3R9PA 3P83D 3WXLA 4KV8A 5C0YA 4KHUA 2QXFA 4AHSA 1VAZA 3VGMA 3VQ7A 4DTXA 1EWQA 5M1FA 1Z6RA 4A2AA 1WUAA 4W5NA 2FF3B 5CYQA 1Q82O 1C1CA 4ISEA 4MDBA 1IBKK 3TSUA 4OPJA 1N5YA 1EX4A 4CJTA 1QSYA 2CGJA 1FJGK 4FJJA 4QS8A 2QKKA 4IZ9A 1EQYA 3AA5X 1LWCA 1RTIA 2WTUA 3DOKA 4IFEA 2QWNA 3P38A 1ZBIA 4JI1K 4CZIA 5CR4A 4J2EA 1S6QA 3HVRA 1VQON 4DSLA 1QE1A
chains in the Genus database with same CATH topology
2BE2A 3MXJA 4FK4A 4IG0A 4Z4FA 3QEPA 1GOAA 4I2PA 3DMJA 3RMDA 1LW0A 1R0AA 1XC9A 3AVKA 1VSDA 3P5JA 3HJFA 2HHQA 3SQ1A 1S9GA 1WSFA 1SKWA 5I3UA 4E7LA 2DFHA 1QTMA 1KFDA 3EY1A 3G10A 4HVJA 2Z1JA 4FJLA 1RTJA 2YV0X 3KK1A 2P5GA 3OYNA 4KHWA 4DMNA 3M8QA 2X74A 4CF2A 1F21A 3I8DA 3NBPA 4DU1A 1TL1A 3AA2A 2G8IA 4ELVA 2IOCA 4E89A 3SPYA 4R5PA 1RDBA 5C42A 4XIUA 3AV9A 1S1WA 3AVIA 2LSNA 5K14A 2G8KA 2G8UA 3OS2A 4N41A 3AVFA 1TKZA 4B8AB 4FLYA 4EZ9A 2Z1IA 3ZT1A 4Y1CA 1U49A 1JLCA 2X78A 1D9DA 1VSHA 3KLEA 5HBMA 1NJZA 4K8ZA 4JS4A 1U4BA 3LWMA 3SQ0A 3RMAA 3NCIA 4CIFA 1VSLA 4CHQA 4B9TA 2VWJA 3KD5E 4GVMA 3SUQA 4DF4A 1QHTA 1SUQA 1HPZA 2JGUA 2XO7A 4FJ7A 2XHBA 4RW6A 3LP1A 3L3VA 4E7KA 3AVLA 3I0SA 1ITGA 4CEBA 5I42A 1KVAA 3WNHA 4QOZB 1L3SA 4QCLA 4CF9A 1X1PA 1JLBA 2IC3A 3L3UA 4TSXA 4FVMA 4CHYA 2Y1IA 3ZCMA 4DSFA 1W0HA 4GMJB 2B5JA 1LV5A 3RR8A 2FBXA 3QEIA 3L2QA 3M8SA 4NYNA 4CECA 4NYFA 3V4IA 2RPIA 1QQCA 4OJRA 4DTOA 4F2SA 4IFVA 4FJ8A 3TR8A 3OYLA 5FRMA 4DFKA 5KGXA 3AO3A 5CZ2A 4DTPA 1NOZA 5HROA 4W5OA 1N6QA 4IKFA 4M3YA 3NGIA 1DTQA 4F3OA 1DTTA 4KREA 4NCGA 3NGZA 2RKIA 4Z4IA 4E3SA 4DG1A 1KFSA 1CXUA 4FJNA 5HRPA 1TV6A 5D3GA 3MAQA 2E6LA 1S1UA 1T05A 2GV9A 4NCBA 2AJQA 4KB1A 3V9ZA 2O4GA 3S3NA 3MEGA 5CZ1A 4OKJA 3K58A 1NKEA 4M45A 3LALA 3IRXA 3OVNA 1YVUA 1VRTA 3VQ4A 1T8EA 2DTUA 3AVJA 3C94A 2DFEA 1KVBA 4CEDA 3C6UA 3CM6A 1NKCA 3U3YA 5HP1A 4DFJA 4E0DA 1Z25A 2P5OA 4CJ5A 4KHQA 4AHUA 3VQ8A 4OPKA 3AO4A 2OZSA 2ATQA 1YT3A 4B9LA 4M3ZA 3HPGA 2KTQA 3MECA 3QIPA 1NJYA 3PX0A 3BDPA 3KK2A 1KTQA 3KLHA 4C8MA 4DF8A 3K5NA 3SQ2A 3PX4A 4KI4A 1TAUA 1JL2A 4CJ3A 1BI4A 4CGDA 4EP4A 2KQ2A 3V81A 4F4KA 4CJQA 3LZIA 4CGFA 3KKRA 1TKTA 1JLAA 1I39A 1RDCA 1KVCA 3AO1A 3ZSQA 3OYKA 5CYMA 1EKEA 3I0RA 4CJLA 4N47A 1WSEA 3HP9A 1A5VA 2E4LA 4FJMA 2KZZA 1IH7A 1WAFA 1O1WA 4DTJA 4Z4HA 3AVHA 1A5XA 4H4OA 3OY9A 3TARA 3MEDA 4Q5VA 4PUOA 1RT5A 1HRHA 1JXBA 3O4NA 4C8NA 4KAZA 1T03A 3V9SA 2X6NA 5CY4A 3SCXA 2OPRA 1S1VA 5DMRA 4CFCA 3QERA 3KTQA 3AVAA 1X9SA 1ZYQA 3ZSVA 3O4QA 4RW9A 1RBRA 1SV5A 4CERA 4CHZA 3DLRA 1JLQA 2FBTA 3DYAA 2F8SA 1LWFA 3AVCA 3VQQA 3QESA 2KFNA 2ZE2A 3SJJA 4CESA 3DLBA 4I9QA 3EZ5A 1RBSA 2OYQA 3LPTA 4CIEA 1RDDA 1Y97A 4EP5A 1VSMA 4FLWA 4FLUA 3OYHA 3SZ2A 4I7FA 5JS1A 3QEWA 1RT4A 4DTMA 1ASWA 3LP0A 3WNEA 4CHOA 1XHZA 2Z1GA 2FBYA 4DWIA 3RTVA 3S3OA 4CJPA 3JSMA 4M42A 1WAJA 1CZBA 1ZBUA 4RW4A 5C25A 4W5QA 4KPYA 2YKNA 1TK5A 3ZT2A 1ZBLA 1NKBA 2D0CA 2HMIA 4FJHA 1UA1A 5J2NA 3LAKA 4L8RB 1HMVA 2YNIA 4HTUA 4KB0A 4O55A 4B9NA 4CF1A 3KKSA 1RT6A 2HHTA 3RMBA 1FK9A 3OYMA 3UIQA 3RMCA 3TI0A 1WSIA 3NF9A 3O3GA 1T7PA 2G8VA 3AA4A 3HVTA 3AA3A 4LD0A 1DLOA 3B6PA 4BACA 4CK2A 3DLGA 3NF7A 2ZQBA 4FLZA 1LAVA 2YKMA 1NOYA 5JS2A 1LAWA 3CFOA 2EX3A 4LSNA 5J2PA 4C8LA 3FFIA 1TKDA 3RR7A 3SV4A 1X9MA 3OYFA 3ALYA 5J1EA 1NJWA 1UA0A 1SKRA 1RT1A 3HSTB 5FRNA 5DK5A 4LY7A 4KFBA 1L3TA 4Z0UA 1HQEA 1WSGA 3VQPA 1NK6A 3K5OA 1G15A 2YNGA 4K8XA 1EETA 2PYLA 4LH4A 5HRSA 3L8BA 4Z4CA 1MU2A 4CGIA 1FKOA 4O44A 1NK9A 2IAJA 4FK0A 3VA3A 2PZSA 3F9KA 2ZD1A 3KLGA 5EU7A 1NJXA 3VQEA 1CLQA 3AVGA 1IKXA 2VG5A 5HRNA 3NDKA 2G8HA 3QNOA 1HYSA 3PUFA 4CFAA 3DRRA 4J2AA 1IKVA 1HJRA 3ZT4A 1JLFA 4CF8A 3CM5A 3SV3A 4M3UA 3NH1A 4DTRA 1S9EA 3VQ5A 3OYDA 3SUPA 1RCHA 2NUBA 1WN7A 4FJGA 4KHSA 3VQ9A 3ITHA 4CJFA 3L2UA 2KZMA 3DLHA 1L3UA 4F3TA 2JLEA 1B9DA 4I2QA 1IKYA 1D9FA 2EHGA 3K57A 3V6DA 4ZTJA 1KLNA 4H4MA 2DY4A 1JLGA 4IG3A 4BE1A 3DRSA 4BWMA 1BGXT 4YFUA 3QEVA 2OA8A 1UOCA 3RRGA 2E6MA 4CIGA 3LANA 2VWKA 2P1JA 1HNVA 2OPSA 2WOMA 3BGRA 3WNGA 3HPOA 5J2QA 2RF2A 3VN5A 3THVA 3OS1A 2I5JA 1WNSA 3TABA 3KD1E 2HB5A 3C95A 3ZT0A 1J5OA 2IGIA 4KHNA 3K5LA 3OYGA 1TK0A 4GW6A 4FJKA 1C6VA 4ID1A 4BE0A 4FM1A 3HO1A 5KRTA 3T1AA 1SL2A 3KK3A 4DFPA 2HHWA 1SL1A 4O0JA 4B08A 3HPHA 5HRRA 3HT3A 3ISNC 4LH5A 3TAMA 5KTQA 4JLHA 3VQCA 4OKKA 3TWHA 3U6FA 1LW2A 3L2VA 3T3FA 3SQ4A 3AO2A 4FK2A 3DLEA 2OPQA 1TL3A 3TAQA 2HHVA 1J54A 3WNFA 3HP6A 4BE2A 1YTUA 2HNYA 3ZSYA 3L2WA 1QSLA 1UAXA 3ZSRA 1FKPA 1IKWA 3AVMA 4PA1A 2D5RA 2HW3A 2Q3SA 2HVIA 4HCBA 4ELUA 4BDYA 1BI4B 1VK0A 3NFAA 3OYAA 3KJVA 4CJSA 1ASVA 3VQAA 1C0MA 3CG7A 4ICLA 1ZBHA 1J53A 1K6YA 3A2FA 2FBVA 1KSPA 1U47A 3LP2A 3SYZA 1BQNA 3IG1A 4M3WA 3DI6A 3KLIA 5SWMA 4W5TA 1VRUA 5T7BA 3V1OA 4CEEA 3OYIA 1REVA 4DLGA 3KLFA 2O4IA 3S9HA 4BWJA 4Q0BA 2B4JA 3LDSA 4FM0A 4AHRA 1S5JA 4E7HA 4CEAA 4DSEA 2YNFA 4CK3A 1VSKA 4Z4GA 3ZT3A 4HUFA 4PQUA 1BHLA 3O3HA 3ZSOA 3NH2A 3V9UA 1NK4A 2G8WA 4F8RA 3T19A 1TKXA 4DTUA 4OLAA 4DU3A 3HM9A 1C0UA 1BQMA 1RDAA 1S1TA 4OGCA 4E19A 3LWLA 1QS4A 4B9SA 1U04A 3PX6A 2HHUA 1BCMA 2XY6A 4DQIA 3VQDA 4CEQA 4YNQA 1D8YA 1LWEA 3QEXA 1WLJA 4JRQA 3B6OA 3LAMA 4BDZA 3V1QA 3SI6A 4KTZA 4FLVA 4CHNA 3F73A 1RBUA 4KKOA 2VG6A 3CFPA 1TGOA 4OVLA 3NF8A 3NGYA 2KW4A 5KI6A 2YNHA 3OJUA 1XWLA 4HUGA 4ELTA 1NK8A 4QAGA 2RN2A 4E1MA 2Y1JA 4MFBA 1JL1A 1HQUA 2D0BA 4CEZA 1VSJA 4CGJA 2F8TA 3QINA 2WONA 1VSFA 2YHAA 1RBVA 2HNDA 4DS5A 3OYCA 4BDPA 3AVBA 3TAFA 3IS9A 4WE1A 4N56A 3D0PA 3RWUA 4CJWA 4FJIA 2HHXA 1HNIA 4E7IA 3L2RA 3ZSXA 3IAYA 3DRPA 4FCYA 2PYJA 4OLBA 1EXQA 3PY8A 3K2PA 3M8RA 2HVHA 4RW8A 4CJKA 4AHCA 3U3GA 4FJXA 4DTSA 1D5AA 3CFRA 5E41A 1JKHA 4NCAA 3C6TA 3QO9A 1RTHA 3NAEA 4CCHA 1Z26A 3AVNA 1SKSA 4W5RA 3PO4A 5KRSA 4B9VA 3OYJA 2IS3A 2VG7A 4CJ4A 3NH0A 4JRPA 3DLKA 4HHTA 3M8PA 1J9AA 1UWBA 4H8KA 4B8CA 4Z4EA 1IO2A 4OKEA 3VQ6A 2XY7A 1B9FA 3CQ8A 1VSIA 4KI6A 2A1RA 1EP4A 1RBTA 4CJUA 4DFMA 3P1GA 3OJSA 1BL3A 1QSSA 4KTQA 1C1BA 5FROA 1L3VA 4CEOA 3K59A 4J2BA 1XHXA 2GUIA 4G1QA 4CGGA 4IDKA 3HXMA 2ETJA 3SNNA 1NK7A 1BIZA 1IG9A 4Y1DA 3VA0A 3TAPA 1NK0A 1VSEA 4AILC 4CK1A 1KLMA 4CE9A 3NHGA 2IDOA 2G8FA 3V9XA 4KRFA 1U48A 4LSLA 4IBNA 4CGHA 3D45A 4PWDA 4AHTA 1C0TA 3LPUA 4FYDA 3NE6A 4O0IA 3K5MA 4J2DA 2OZMA 4DQSA 2YHBA 4KO0A 4ZTFA 3QLHA 5C24A 1ZBFA 1JLEA 1S6PA 4CJRA 1L5UA 1C1AA 1KRPA 1ASUA 2BDPA 4HUEA 4E7JA 3ASMA 4DSIA 1FXXA 1WSHA 3S3MA 1Q9XA 1GOBA 2PY5A 3ZSWA 4HCCA 1CXQA 4FLXA 2HNZA 3ULDA 4FZZA 3HYFA 3OS0A 2F96A 4CEFA 4DS4A 4FW1A 3DOLA 4CJEA 1BIUA 4OGEA 4FZYA 4FW2A 3ZSZA 2GBZA 4FLTA 2R7YA 4M3TA 1RT2A 4DQRA 2ITGA 3QETA 3DM2A 4AHVA 4CF0A 1CZ9A 2QKBA 4DQPA 4FJ5A 4M3RA 4EZ6A 4ID5A 4DTNA 1SL0A 4F2RA 5KGWA 4CFBA 3LP3A 1YTAA 2BANA 3AO5A 3JYTA 3RRHA 4DSJA 2HHSA 2KFZA 4CJVA 4DLEA 5J2MA 2QK9A 3SUOA 4FM2A 4E1NA 4IFYA 1Q9YA 4B9UA 4O5BA 2OPPA 3E01A 2W42A 1X9WA 4I9LA 3P83D 1S1XA 4KV8A 3CYMA 4DSKA 4MQ3A 4N5SA 1RNHA 1I3AA 4KHUA 2QXFA 4AHSA 4B9MA 3MXIA 2Z1HA 3VQ7A 1BCOA 1TAQA 1RT3A 4DTXA 3LZJA 4C8OA 4N76A 2BGGA 3V9WA 4JS5A 4DU4A 1U45A 1XI1A 3OYEA 4W5NA 4M41A 2A1SA 3KIOA 4RG8A 1C1CA 5CYQA 4CHPA 4KHYA 1HYVA 1W9HA 2DFFA 4M3XA 4OPJA 4KTWA 3TANA 1EX4A 4CJTA 4ZHRA 3SPZA 1N5YA 1QSYA 4FZXC 4B3OA 3PO5A 3VQBA 4AH9A 2XY5A 3TAGA 4FJJA 3PV8A 4O4GA 3EYZA 1NK5A 2QKKA 3QIOA 1TK8A 4PY5A 4FXDA 3AA5X 3TAEA 1Q8IA 1RT7A 1LWCA 5FDLA 1BISA 1RTIA 2X6SA 3DOKA 3G0ZA 4UQGA 2XRIA 4C8KA 1A5WA 2FC0A 3MXMA 2P51A 1KCFA 3QNNA 4DQQA 5HLFA 3HK2A 2B6AA 3HL8A 1WSJA 1B92A 1GOCA 1JXEA 3O3FA 4CFDA 1ZBIA 1RILA 1S6QA 3NF6A 3V1RA 3HVRA 4J2EA 3OYBA 4FJ9A 1RTDA 2XY8A 2D0AA 3MEEA 1TVRA 1HYZA 3H08A 3SUNA 5SZTA 4RW7A 4DSLA 1QE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE2 A;  3MXJ A;  4FK4 A;  4IG0 A;  4Z4F A;  3QEP A;  1GOA A;  4I2P A;  3DMJ A;  3RMD A;  1LW0 A;  1R0A A;  1XC9 A;  3AVK A;  1VSD A;  3P5J A;  3HJF A;  2HHQ A;  3SQ1 A;  1S9G A;  1WSF A;  1SKW A;  5I3U A;  4E7L A;  2DFH A;  1QTM A;  1KFD A;  3EY1 A;  3G10 A;  4HVJ A;  2Z1J A;  4FJL A;  1RTJ A;  2YV0 X;  3KK1 A;  2P5G A;  3OYN A;  4KHW A;  4DMN A;  3M8Q A;  2X74 A;  4CF2 A;  1F21 A;  3I8D A;  3NBP A;  4DU1 A;  1TL1 A;  3AA2 A;  2G8I A;  4ELV A;  2IOC A;  4E89 A;  3SPY A;  4R5P A;  1RDB A;  5C42 A;  4XIU A;  3AV9 A;  1S1W A;  3AVI A;  2LSN A;  5K14 A;  2G8K A;  2G8U A;  3OS2 A;  4N41 A;  3AVF A;  1TKZ A;  4B8A B;  4FLY A;  4EZ9 A;  2Z1I A;  3ZT1 A;  4Y1C A;  1U49 A;  1JLC A;  2X78 A;  1D9D A;  1VSH A;  3KLE A;  5HBM A;  1NJZ A;  4K8Z A;  4JS4 A;  1U4B A;  3LWM A;  3SQ0 A;  3RMA A;  3NCI A;  4CIF A;  1VSL A;  4CHQ A;  4B9T A;  2VWJ A;  3KD5 E;  4GVM A;  3SUQ A;  4DF4 A;  1QHT A;  1SUQ A;  1HPZ A;  2JGU A;  2XO7 A;  4FJ7 A;  2XHB A;  4RW6 A;  3LP1 A;  3L3V A;  4E7K A;  3AVL A;  3I0S A;  1ITG A;  4CEB A;  5I42 A;  1KVA A;  3WNH A;  4QOZ B;  1L3S A;  4QCL A;  4CF9 A;  1X1P A;  1JLB A;  2IC3 A;  3L3U A;  4TSX A;  4FVM A;  4CHY A;  2Y1I A;  3ZCM A;  4DSF A;  1W0H A;  4GMJ B;  2B5J A;  1LV5 A;  3RR8 A;  2FBX A;  3QEI A;  3L2Q A;  3M8S A;  4NYN A;  4CEC A;  4NYF A;  3V4I A;  2RPI A;  1QQC A;  4OJR A;  4DTO A;  4F2S A;  4IFV A;  4FJ8 A;  3TR8 A;  3OYL A;  5FRM A;  4DFK A;  5KGX A;  3AO3 A;  5CZ2 A;  4DTP A;  1NOZ A;  5HRO A;  4W5O A;  1N6Q A;  4IKF A;  4M3Y A;  3NGI A;  1DTQ A;  4F3O A;  1DTT A;  4KRE A;  4NCG A;  3NGZ A;  2RKI A;  4Z4I A;  4E3S A;  4DG1 A;  1KFS A;  1CXU A;  4FJN A;  5HRP A;  1TV6 A;  5D3G A;  3MAQ A;  2E6L A;  1S1U A;  1T05 A;  2GV9 A;  4NCB A;  2AJQ A;  4KB1 A;  3V9Z A;  2O4G A;  3S3N A;  3MEG A;  5CZ1 A;  4OKJ A;  3K58 A;  1NKE A;  4M45 A;  3LAL A;  3IRX A;  3OVN A;  1YVU A;  1VRT A;  3VQ4 A;  1T8E A;  2DTU A;  3AVJ A;  3C94 A;  2DFE A;  1KVB A;  4CED A;  3C6U A;  3CM6 A;  1NKC A;  3U3Y A;  5HP1 A;  4DFJ A;  4E0D A;  1Z25 A;  2P5O A;  4CJ5 A;  4KHQ A;  4AHU A;  3VQ8 A;  4OPK A;  3AO4 A;  2OZS A;  2ATQ A;  1YT3 A;  4B9L A;  4M3Z A;  3HPG A;  2KTQ A;  3MEC A;  3QIP A;  1NJY A;  3PX0 A;  3BDP A;  3KK2 A;  1KTQ A;  3KLH A;  4C8M A;  4DF8 A;  3K5N A;  3SQ2 A;  3PX4 A;  4KI4 A;  1TAU A;  1JL2 A;  4CJ3 A;  1BI4 A;  4CGD A;  4EP4 A;  2KQ2 A;  3V81 A;  4F4K A;  4CJQ A;  3LZI A;  4CGF A;  3KKR A;  1TKT A;  1JLA A;  1I39 A;  1RDC A;  1KVC A;  3AO1 A;  3ZSQ A;  3OYK A;  5CYM A;  1EKE A;  3I0R A;  4CJL A;  4N47 A;  1WSE A;  3HP9 A;  1A5V A;  2E4L A;  4FJM A;  2KZZ A;  1IH7 A;  1WAF A;  1O1W A;  4DTJ A;  4Z4H A;  3AVH A;  1A5X A;  4H4O A;  3OY9 A;  3TAR A;  3MED A;  4Q5V A;  4PUO A;  1RT5 A;  1HRH A;  1JXB A;  3O4N A;  4C8N A;  4KAZ A;  1T03 A;  3V9S A;  2X6N A;  5CY4 A;  3SCX A;  2OPR A;  1S1V A;  5DMR A;  4CFC A;  3QER A;  3KTQ A;  3AVA A;  1X9S A;  1ZYQ A;  3ZSV A;  3O4Q A;  4RW9 A;  1RBR A;  1SV5 A;  4CER A;  4CHZ A;  3DLR A;  1JLQ A;  2FBT A;  3DYA A;  2F8S A;  1LWF A;  3AVC A;  3VQQ A;  3QES A;  2KFN A;  2ZE2 A;  3SJJ A;  4CES A;  3DLB A;  4I9Q A;  3EZ5 A;  1RBS A;  2OYQ A;  3LPT A;  4CIE A;  1RDD A;  1Y97 A;  4EP5 A;  1VSM A;  4FLW A;  4FLU A;  3OYH A;  3SZ2 A;  4I7F A;  5JS1 A;  3QEW A;  1RT4 A;  4DTM A;  1ASW A;  3LP0 A;  3WNE A;  4CHO A;  1XHZ A;  2Z1G A;  2FBY A;  4DWI A;  3RTV A;  3S3O A;  4CJP A;  3JSM A;  4M42 A;  1WAJ A;  1CZB A;  1ZBU A;  4RW4 A;  5C25 A;  4W5Q A;  4KPY A;  2YKN A;  1TK5 A;  3ZT2 A;  1ZBL A;  1NKB A;  2D0C A;  2HMI A;  4FJH A;  1UA1 A;  5J2N A;  3LAK A;  4L8R B;  1HMV A;  2YNI A;  4HTU A;  4KB0 A;  4O55 A;  4B9N A;  4CF1 A;  3KKS A;  1RT6 A;  2HHT A;  3RMB A;  1FK9 A;  3OYM A;  3UIQ A;  3RMC A;  3TI0 A;  1WSI A;  3NF9 A;  3O3G A;  1T7P A;  2G8V A;  3AA4 A;  3HVT A;  3AA3 A;  4LD0 A;  1DLO A;  3B6P A;  4BAC A;  4CK2 A;  3DLG A;  3NF7 A;  2ZQB A;  4FLZ A;  1LAV A;  2YKM A;  1NOY A;  5JS2 A;  1LAW A;  3CFO A;  2EX3 A;  4LSN A;  5J2P A;  4C8L A;  3FFI A;  1TKD A;  3RR7 A;  3SV4 A;  1X9M A;  3OYF A;  3ALY A;  5J1E A;  1NJW A;  1UA0 A;  1SKR A;  1RT1 A;  3HST B;  5FRN A;  5DK5 A;  4LY7 A;  4KFB A;  1L3T A;  4Z0U A;  1HQE A;  1WSG A;  3VQP A;  1NK6 A;  3K5O A;  1G15 A;  2YNG A;  4K8X A;  1EET A;  2PYL A;  4LH4 A;  5HRS A;  3L8B A;  4Z4C A;  1MU2 A;  4CGI A;  1FKO A;  4O44 A;  1NK9 A;  2IAJ A;  4FK0 A;  3VA3 A;  2PZS A;  3F9K A;  2ZD1 A;  3KLG A;  5EU7 A;  1NJX A;  3VQE A;  1CLQ A;  3AVG A;  1IKX A;  2VG5 A;  5HRN A;  3NDK A;  2G8H A;  3QNO A;  1HYS A;  3PUF A;  4CFA A;  3DRR A;  4J2A A;  1IKV A;  1HJR A;  3ZT4 A;  1JLF A;  4CF8 A;  3CM5 A;  3SV3 A;  4M3U A;  3NH1 A;  4DTR A;  1S9E A;  3VQ5 A;  3OYD A;  3SUP A;  1RCH A;  2NUB A;  1WN7 A;  4FJG A;  4KHS A;  3VQ9 A;  3ITH A;  4CJF A;  3L2U A;  2KZM A;  3DLH A;  1L3U A;  4F3T A;  2JLE A;  1B9D A;  4I2Q A;  1IKY A;  1D9F A;  2EHG A;  3K57 A;  3V6D A;  4ZTJ A;  1KLN A;  4H4M A;  2DY4 A;  1JLG A;  4IG3 A;  4BE1 A;  3DRS A;  4BWM A;  1BGX T;  4YFU A;  3QEV A;  2OA8 A;  1UOC A;  3RRG A;  2E6M A;  4CIG A;  3LAN A;  2VWK A;  2P1J A;  1HNV A;  2OPS A;  2WOM A;  3BGR A;  3WNG A;  3HPO A;  5J2Q A;  2RF2 A;  3VN5 A;  3THV A;  3OS1 A;  2I5J A;  1WNS A;  3TAB A;  3KD1 E;  2HB5 A;  3C95 A;  3ZT0 A;  1J5O A;  2IGI A;  4KHN A;  3K5L A;  3OYG A;  1TK0 A;  4GW6 A;  4FJK A;  1C6V A;  4ID1 A;  4BE0 A;  4FM1 A;  3HO1 A;  5KRT A;  3T1A A;  1SL2 A;  3KK3 A;  4DFP A;  2HHW A;  1SL1 A;  4O0J A;  4B08 A;  3HPH A;  5HRR A;  3HT3 A;  3ISN C;  4LH5 A;  3TAM A;  5KTQ A;  4JLH A;  3VQC A;  4OKK A;  3TWH A;  3U6F A;  1LW2 A;  3L2V A;  3T3F A;  3SQ4 A;  3AO2 A;  4FK2 A;  3DLE A;  2OPQ A;  1TL3 A;  3TAQ A;  2HHV A;  1J54 A;  3WNF A;  3HP6 A;  4BE2 A;  1YTU A;  2HNY A;  3ZSY A;  3L2W A;  1QSL A;  1UAX A;  3ZSR A;  1FKP A;  1IKW A;  3AVM A;  4PA1 A;  2D5R A;  2HW3 A;  2Q3S A;  2HVI A;  4HCB A;  4ELU A;  4BDY A;  1BI4 B;  1VK0 A;  3NFA A;  3OYA A;  3KJV A;  4CJS A;  1ASV A;  3VQA A;  1C0M A;  3CG7 A;  4ICL A;  1ZBH A;  1J53 A;  1K6Y A;  3A2F A;  2FBV A;  1KSP A;  1U47 A;  3LP2 A;  3SYZ A;  1BQN A;  3IG1 A;  4M3W A;  3DI6 A;  3KLI A;  5SWM A;  4W5T A;  1VRU A;  5T7B A;  3V1O A;  4CEE A;  3OYI A;  1REV A;  4DLG A;  3KLF A;  2O4I A;  3S9H A;  4BWJ A;  4Q0B A;  2B4J A;  3LDS A;  4FM0 A;  4AHR A;  1S5J A;  4E7H A;  4CEA A;  4DSE A;  2YNF A;  4CK3 A;  1VSK A;  4Z4G A;  3ZT3 A;  4HUF A;  4PQU A;  1BHL A;  3O3H A;  3ZSO A;  3NH2 A;  3V9U A;  1NK4 A;  2G8W A;  4F8R A;  3T19 A;  1TKX A;  4DTU A;  4OLA A;  4DU3 A;  3HM9 A;  1C0U A;  1BQM A;  1RDA A;  1S1T A;  4OGC A;  4E19 A;  3LWL A;  1QS4 A;  4B9S A;  1U04 A;  3PX6 A;  2HHU A;  1BCM A;  2XY6 A;  4DQI A;  3VQD A;  4CEQ A;  4YNQ A;  1D8Y A;  1LWE A;  3QEX A;  1WLJ A;  4JRQ A;  3B6O A;  3LAM A;  4BDZ A;  3V1Q A;  3SI6 A;  4KTZ A;  4FLV A;  4CHN A;  3F73 A;  1RBU A;  4KKO A;  2VG6 A;  3CFP A;  1TGO A;  4OVL A;  3NF8 A;  3NGY A;  2KW4 A;  5KI6 A;  2YNH A;  3OJU A;  1XWL A;  4HUG A;  4ELT A;  1NK8 A;  4QAG A;  2RN2 A;  4E1M A;  2Y1J A;  4MFB A;  1JL1 A;  1HQU A;  2D0B A;  4CEZ A;  1VSJ A;  4CGJ A;  2F8T A;  3QIN A;  2WON A;  1VSF A;  2YHA A;  1RBV A;  2HND A;  4DS5 A;  3OYC A;  4BDP A;  3AVB A;  3TAF A;  3IS9 A;  4WE1 A;  4N56 A;  3D0P A;  3RWU A;  4CJW A;  4FJI A;  2HHX A;  1HNI A;  4E7I A;  3L2R A;  3ZSX A;  3IAY A;  3DRP A;  4FCY A;  2PYJ A;  4OLB A;  1EXQ A;  3PY8 A;  3K2P A;  3M8R A;  2HVH A;  4RW8 A;  4CJK A;  4AHC A;  3U3G A;  4FJX A;  4DTS A;  1D5A A;  3CFR A;  5E41 A;  1JKH A;  4NCA A;  3C6T A;  3QO9 A;  1RTH A;  3NAE A;  4CCH A;  1Z26 A;  3AVN A;  1SKS A;  4W5R A;  3PO4 A;  5KRS A;  4B9V A;  3OYJ A;  2IS3 A;  2VG7 A;  4CJ4 A;  3NH0 A;  4JRP A;  3DLK A;  4HHT A;  3M8P A;  1J9A A;  1UWB A;  4H8K A;  4B8C A;  4Z4E A;  1IO2 A;  4OKE A;  3VQ6 A;  2XY7 A;  1B9F A;  3CQ8 A;  1VSI A;  4KI6 A;  2A1R A;  1EP4 A;  1RBT A;  4CJU A;  4DFM A;  3P1G A;  3OJS A;  1BL3 A;  1QSS A;  4KTQ A;  1C1B A;  5FRO A;  1L3V A;  4CEO A;  3K59 A;  4J2B A;  1XHX A;  2GUI A;  4G1Q A;  4CGG A;  4IDK A;  3HXM A;  2ETJ A;  3SNN A;  1NK7 A;  1BIZ A;  1IG9 A;  4Y1D A;  3VA0 A;  3TAP A;  1NK0 A;  1VSE A;  4AIL C;  4CK1 A;  1KLM A;  4CE9 A;  3NHG A;  2IDO A;  2G8F A;  3V9X A;  4KRF A;  1U48 A;  4LSL A;  4IBN A;  4CGH A;  3D45 A;  4PWD A;  4AHT A;  1C0T A;  3LPU A;  4FYD A;  3NE6 A;  4O0I A;  3K5M A;  4J2D A;  2OZM A;  4DQS A;  2YHB A;  4KO0 A;  4ZTF A;  3QLH A;  5C24 A;  1ZBF A;  1JLE A;  1S6P A;  4CJR A;  1L5U A;  1C1A A;  1KRP A;  1ASU A;  2BDP A;  4HUE A;  4E7J A;  3ASM A;  4DSI A;  1FXX A;  1WSH A;  3S3M A;  1Q9X A;  1GOB A;  2PY5 A;  3ZSW A;  4HCC A;  1CXQ A;  4FLX A;  2HNZ A;  3ULD A;  4FZZ A;  3HYF A;  3OS0 A;  2F96 A;  4CEF A;  4DS4 A;  4FW1 A;  3DOL A;  4CJE A;  1BIU A;  4OGE A;  4FZY A;  4FW2 A;  3ZSZ A;  2GBZ A;  4FLT A;  2R7Y A;  4M3T A;  1RT2 A;  4DQR A;  2ITG A;  3QET A;  3DM2 A;  4AHV A;  4CF0 A;  1CZ9 A;  2QKB A;  4DQP A;  4FJ5 A;  4M3R A;  4EZ6 A;  4ID5 A;  4DTN A;  1SL0 A;  4F2R A;  5KGW A;  4CFB A;  3LP3 A;  1YTA A;  2BAN A;  3AO5 A;  3JYT A;  3RRH A;  4DSJ A;  2HHS A;  2KFZ A;  4CJV A;  4DLE A;  5J2M A;  2QK9 A;  3SUO A;  4FM2 A;  4E1N A;  4IFY A;  1Q9Y A;  4B9U A;  4O5B A;  2OPP A;  3E01 A;  2W42 A;  1X9W A;  4I9L A;  3P83 D;  1S1X A;  4KV8 A;  3CYM A;  4DSK A;  4MQ3 A;  4N5S A;  1RNH A;  1I3A A;  4KHU A;  2QXF A;  4AHS A;  4B9M A;  3MXI A;  2Z1H A;  3VQ7 A;  1BCO A;  1TAQ A;  1RT3 A;  4DTX A;  3LZJ A;  4C8O A;  4N76 A;  2BGG A;  3V9W A;  4JS5 A;  4DU4 A;  1U45 A;  1XI1 A;  3OYE A;  4W5N A;  4M41 A;  2A1S A;  3KIO A;  4RG8 A;  1C1C A;  5CYQ A;  4CHP A;  4KHY A;  1HYV A;  1W9H A;  2DFF A;  4M3X A;  4OPJ A;  4KTW A;  3TAN A;  1EX4 A;  4CJT A;  4ZHR A;  3SPZ A;  1N5Y A;  1QSY A;  4FZX C;  4B3O A;  3PO5 A;  3VQB A;  4AH9 A;  2XY5 A;  3TAG A;  4FJJ A;  3PV8 A;  4O4G A;  3EYZ A;  1NK5 A;  2QKK A;  3QIO A;  1TK8 A;  4PY5 A;  4FXD A;  3AA5 X;  3TAE A;  1Q8I A;  1RT7 A;  1LWC A;  5FDL A;  1BIS A;  1RTI A;  2X6S A;  3DOK A;  3G0Z A;  4UQG A;  2XRI A;  4C8K A;  1A5W A;  2FC0 A;  3MXM A;  2P51 A;  1KCF A;  3QNN A;  4DQQ A;  5HLF A;  3HK2 A;  2B6A A;  3HL8 A;  1WSJ A;  1B92 A;  1GOC A;  1JXE A;  3O3F A;  4CFD A;  1ZBI A;  1RIL A;  1S6Q A;  3NF6 A;  3V1R A;  3HVR A;  4J2E A;  3OYB A;  4FJ9 A;  1RTD A;  2XY8 A;  2D0A A;  3MEE A;  1TVR A;  1HYZ A;  3H08 A;  3SUN A;  5SZT A;  4RW7 A;  4DSL A;  1QE1 A; 
#chains in the Genus database with same CATH topology
 2BE2 A;  3MXJ A;  3J80 O;  4IG0 A;  4FK4 A;  3ENH A;  3DMJ A;  4DV5 K;  4M7X A;  3AVK A;  1VSD A;  1WSF A;  4WYB A;  1QTM A;  4A57 A;  2YV0 X;  2P5G A;  2P9L B;  4JD2 B;  4X66 K;  3UE5 A;  2G8I A;  5JLH A;  3SPY A;  4R5P A;  1RDB A;  2G8U A;  2LSN A;  4OO1 J;  4N41 A;  4EZ9 A;  4Y1C A;  4K8Z A;  2X78 A;  3KLE A;  5HBM A;  4JS4 A;  3LWM A;  3WXK A;  3C65 A;  2VWJ A;  3KD5 E;  4A61 A;  3M5R A;  4NO7 A;  1HNX K;  2XO7 A;  4IOX A;  4E7K A;  3L3V A;  3T69 A;  4Z94 A;  1ITG A;  4CEB A;  3HOT A;  1KVA A;  4QS9 A;  1X1P A;  3TSP A;  3L3U A;  4M7Y A;  4C23 A;  2YX6 A;  3MCP A;  4GMJ B;  2B5J A;  2FBX A;  2RPI A;  3OYL A;  3EKS A;  3AO3 A;  5CZ2 A;  1YIT N;  4JI8 K;  4CVN E;  4FPB A;  2RKI A;  5AQN A;  5KPZ A;  1KFS A;  1CXU A;  5D3G A;  5FPD A;  4FOE A;  3VEZ A;  1S1U A;  4YDU A;  4NCB A;  3TU5 A;  5EX5 A;  3V9Z A;  5BN8 A;  4JI7 K;  4OKJ A;  5AQG A;  4M45 A;  2F7T A;  1VQP N;  2KHO A;  3AVJ A;  5GAD P;  3C6U A;  5BPN A;  4MO5 A;  4YOV A;  3U3Y A;  5AQF A;  5HP1 A;  4DFJ A;  4WQ4 C;  1Z25 A;  4DV0 K;  4OPK A;  3AO4 A;  4B9L A;  1YT3 A;  3O1W A;  3T1Y K;  2KTQ A;  3BDP A;  3PX0 A;  4BGA A;  2W6K A;  3SQ2 A;  3PX4 A;  1TAU A;  2W41 A;  3BZK A;  4F4K A;  4CJQ A;  2P9K B;  3LZI A;  3BF1 A;  1TKT A;  1RDC A;  3AO1 A;  5CYM A;  3CIP A;  3W3D A;  4I6M A;  1NGA A;  4N47 A;  5ADX H;  2VWB A;  4K0K K;  1RFQ A;  3K9J A;  1S3X A;  3MCA B;  4DR3 K;  3ZET B;  1A5X A;  4H4O A;  2GTD A;  4Q5V A;  1C0G A;  1U6Z A;  3D2F A;  1WBD A;  2I7N A;  1HRH A;  3O4N A;  3V9S A;  3SCX A;  1JCE A;  2YJF A;  4FO0 A;  4H0T B;  5FPM A;  1RBR A;  4BG8 A;  3DLR A;  5GAH P;  2F8S A;  3VQQ A;  2KFN A;  3O9Q A;  4I9Q A;  3VPZ A;  5AQW A;  1RDD A;  4YOY A;  4DTM A;  4CZM A;  1ASW A;  3WNE A;  2FBY A;  1WAJ A;  1ZBS A;  5C25 A;  4RW4 A;  4H03 B;  3CPW M;  3VF2 A;  3ZT2 A;  1NKB A;  2D0C A;  4F9O A;  2HMI A;  4L8R B;  4HTU A;  4JK9 A;  1W97 L;  1RT6 A;  3RMB A;  3UIQ A;  1KAX A;  3O3G A;  3NF9 A;  3HVT A;  3AA3 A;  4LD0 A;  3O9R A;  4BVO A;  3CCV N;  3NF7 A;  5JS2 A;  4C8L A;  1TKD A;  1QZ6 A;  3PIO L;  4FL9 A;  3RR7 A;  3UKR B;  1OH5 A;  3ALY A;  5J1E A;  4K41 A;  4CD1 A;  3U9Z A;  3HST B;  4LY7 A;  1L3T A;  1Z05 A;  1HQE A;  3K5O A;  4K8X A;  4B1Z A;  1JCG A;  3L8B A;  3AAP A;  1MU2 A;  4Z4C A;  4CGI A;  5GIO A;  2IAJ A;  4FK0 A;  3CER A;  2PZS A;  3LDL A;  1NJX A;  3U9D A;  3WUH A;  2YJE A;  2VG5 A;  3N4P A;  2ITM A;  2G8H A;  5IWA K;  4IJN A;  2O8E B;  3DRR A;  4CF8 A;  5EXW A;  3SV3 A;  3DAW A;  3VQ5 A;  4KHS A;  1NGF A;  1WN7 A;  4FJG A;  3VQ9 A;  3ITH A;  5KPT A;  3C6A A;  2KZM A;  1L3U A;  1YI2 N;  5AR0 A;  3MDQ A;  2EHG A;  4H4M A;  3DRS A;  1BGX T;  3CQX A;  4XEI A;  3WNG A;  4HTL A;  4H0V B;  1QQN A;  3H3O B;  2P9U A;  3UKU A;  4JI5 K;  1KXP A;  2E1Y A;  3WQU A;  3ZT0 A;  4KHN A;  1KD1 O;  4FJK A;  3THW B;  3L6Q A;  2E1Z A;  5AFU A;  3F9M A;  4DFP A;  4BQL A;  4DB3 A;  2D4W A;  3HOS A;  3L2V A;  3T3F A;  3RSE B;  3SQ4 A;  4FK2 A;  2E20 A;  2YCH A;  2HHV A;  4BE2 A;  3SMP A;  1T6C A;  2HNY A;  3ZSY A;  3L2W A;  1QSL A;  1UAX A;  4AM6 A;  3HI0 A;  3AVM A;  2D5R A;  4HCB A;  4ELU A;  1BI4 B;  3E9P A;  3T1H K;  3OYA A;  5BRD A;  3GG4 A;  2VYP A;  3CG7 A;  2V51 B;  1MWK A;  1KSP A;  3SYZ A;  1M1K O;  3ID8 A;  3DI6 A;  1DKG D;  3OTO K;  1Q86 O;  3V1O A;  4CEE A;  1REV A;  2GUP A;  1SQK A;  4Q0B A;  2WC9 A;  4DUY K;  4DSE A;  4WFB L;  1C0F A;  1BWF O;  4PQU A;  1BHL A;  3PSF A;  1OKJ A;  1NK4 A;  4IXC A;  2G8W A;  3T19 A;  5AZI A;  4DKW A;  4DU3 A;  1C0U A;  4ILG B;  4YDU C;  4E19 A;  4OGC A;  3O9U A;  4NXN K;  4B9S A;  2NRV A;  3O9T A;  3VES A;  2A3Z A;  1YF5 L;  2PFU A;  3B6O A;  2Q31 A;  1U2V B;  4FLV A;  4C1N K;  4KKO A;  5AQV A;  3CMA N;  2D0O A;  2HBK A;  2VG6 A;  4OVL A;  1GLJ O;  2UU9 K;  3NGY A;  5A2Q O;  2KW4 A;  2YNH A;  4ELT A;  3IMX A;  4MFB A;  1HQU A;  2D0B A;  4IOA L;  2F8T A;  4IJA A;  3QIN A;  3VET A;  2WON A;  1NGE A;  1VSF A;  3WEE A;  4DS5 A;  2NNW A;  3OYC A;  3H45 C;  3AVB A;  3KZB A;  2GX9 A;  1K8K A;  4FJI A;  2HHX A;  4E7I A;  3IAY A;  3ZSX A;  4OLB A;  3FZF A;  1DEJ A;  3CJC A;  3DXK B;  3U3G A;  4CJK A;  4CZH A;  5FPN A;  1RTH A;  1Z26 A;  3O08 A;  1SKS A;  4B9V A;  2VG7 A;  3DLK A;  3EZW A;  4H8K A;  1UWB A;  4Z4E A;  3VGK A;  4JNE A;  3VQ6 A;  5LMU K;  3EKU A;  2XY7 A;  1B9F A;  5F2R A;  2WBN A;  1QVF M;  4BR5 A;  1EP4 A;  4DFM A;  1BL3 A;  3KHY A;  4CEO A;  5BRE A;  4J2B A;  4CGG A;  2ETJ A;  3OW2 M;  1NK7 A;  5AZJ B;  1IG9 A;  2E88 A;  4B3M K;  3NHG A;  2IDO A;  2G8F A;  4FOI A;  4DV7 K;  3CI5 A;  3K5M A;  3MN7 A;  3BP8 A;  2V7Z A;  3QLH A;  2O8B B;  4CJR A;  1GLE G;  2H3G X;  4CBX A;  1ASU A;  3ATU A;  4DSI A;  1FXX A;  4HCC A;  1CXQ A;  3ULD A;  2F96 A;  2YHY A;  1DGK N;  1BIU A;  3H3N O;  2R7Y A;  3QET A;  3H46 O;  4JI4 K;  4M3R A;  4DTN A;  4JKA A;  4BR2 A;  3CCU N;  4CJV A;  5J2M A;  4FM2 A;  1Q9Y A;  4IFY A;  4B9U A;  2EWS A;  4I9L A;  1GLB G;  4MQ3 A;  4N5S A;  1I3A A;  3CPE A;  4OLA A;  1BCO A;  1TAQ A;  4N76 A;  2BGG A;  3LZJ A;  5AQJ A;  3ZX2 A;  4DU4 A;  2ASM A;  3P31 A;  2O8D A;  4OPA A;  4BRA A;  4M41 A;  1YXQ A;  2HBM A;  4RG8 A;  4DV1 K;  1HYV A;  3D2E B;  4KTW A;  3TAN A;  4DUZ K;  2YHW A;  4BRD A;  2XY5 A;  2F4V K;  3IFR A;  4O4G A;  3EYZ A;  1NK5 A;  3THY B;  3QIO A;  1TK8 A;  3TAE A;  4K43 A;  2FSK A;  3G0Z A;  2XRI A;  1A5W A;  3MXM A;  1KCF A;  5B8H A;  3QNN A;  4DQQ A;  5HLF A;  3HK2 A;  3HL8 A;  1RDW X;  1B92 A;  1GOC A;  1HUX A;  1RIL A;  3I8B A;  1YJN N;  1Q81 O;  2UUA K;  1RTD A;  3MEE A;  1TVR A;  1HYZ A;  3SUN A;  2NLX A;  5SZT A;  1QQO A;  3CCE N;  3EE8 A;  3FR0 A;  3VOV A;  3RMD A;  2QWR A;  1R0A A;  3HJF A;  1IBL K;  3VTI A;  2ASP A;  1KFD A;  3G10 A;  3OYN A;  4CF2 A;  5EOY A;  4JKF A;  1NLV A;  1QQM A;  4QS7 A;  3AA2 A;  2IOC A;  4WQ4 A;  3SK3 A;  4E89 A;  4JHD B;  1VQ9 N;  5C42 A;  3AV9 A;  1E4G T;  2E2O A;  1TKZ A;  4FLY A;  2Z1I A;  2G8V A;  1U49 A;  1VQ5 N;  1NJZ A;  1V4T A;  1U4B A;  3SQ0 A;  4CIF A;  4CHQ A;  2RHK A;  3AAQ A;  4DF4 A;  1QHT A;  2P9S A;  1SUQ A;  4B3S K;  4RW6 A;  3I0S A;  4BR4 A;  2AP1 A;  5I42 A;  2QXL A;  4RTF D;  4DR2 K;  1KC8 O;  1L3S A;  4CF9 A;  2HBJ A;  4O5F A;  1JLB A;  4FVM A;  4EFH A;  3QEI A;  4BRC A;  3M8S A;  4NYF A;  4F2S A;  4IFV A;  5KGX A;  4DTP A;  5MLC Q;  4IKF A;  4BC2 A;  2VQE K;  3NGI A;  1ESV A;  1DTQ A;  4F3O A;  2ZGZ A;  4NCG A;  3NGZ A;  2HMP A;  4E3S A;  4DG1 A;  2E2Q A;  3VF4 A;  2HHH K;  4FJN A;  1TV6 A;  4JKG A;  3QIC A;  5AQQ A;  4KB1 A;  2O4G A;  1J6Z A;  5EVZ A;  3S3N A;  3K58 A;  1NKE A;  4YHH K;  1K9M O;  3IRX A;  3FZK A;  3OVN A;  1BA0 A;  3VQ4 A;  2V7Y A;  1T8E A;  2DTU A;  4CZL A;  2DFE A;  1KVB A;  5AQH A;  4E0D A;  3CJ7 A;  1HJO A;  1YVN A;  4AHU A;  3K0S A;  3M6G A;  4M3Z A;  4FPA A;  1NJY A;  3KK2 A;  3KLH A;  4DF8 A;  4O8U A;  3AY9 A;  3HM8 A;  3CC7 N;  3O8M A;  1M90 O;  4CJ3 A;  2KQ2 A;  3C0B A;  1JLA A;  1HX1 A;  1KVC A;  3ZSQ A;  3OYK A;  4FWR A;  4CJL A;  2OCE A;  3DXM B;  3I0R A;  1ATS A;  4H5R A;  3R6M A;  1A5V A;  4YOW A;  1YJ9 N;  4FJM A;  4IDH A;  1WAF A;  5AFU H;  4Z4H A;  1XQS C;  3GOI A;  3TAR A;  3MED A;  2KLA A;  3VF6 A;  4DV2 K;  4X64 K;  1RT5 A;  1NU0 A;  4C8N A;  4OPH A;  4BY9 C;  1E3M A;  3KTQ A;  1S1V A;  4CFC A;  3AVA A;  1X9S A;  1SV5 A;  3PLA A;  1JLQ A;  3D2F B;  3SJJ A;  4DR6 K;  3A5L C;  3DLB A;  1RBS A;  3LPT A;  4CIE A;  4X65 K;  4EP5 A;  4FLU A;  3SZ2 A;  1VSM A;  4H0X B;  2Q36 A;  3FZM A;  1TUY A;  3I56 N;  3O9S A;  2Z1G A;  3CCQ N;  3TTC A;  4CJP A;  3JS6 A;  1CZB A;  1JCF A;  4KPY A;  2YKN A;  2QW9 A;  2Q0U A;  1OH7 A;  1HMV A;  2YNI A;  3CJA A;  4KB0 A;  2OTJ N;  5E84 A;  4CF1 A;  3KKS A;  1FK9 A;  1T7P A;  1MWM A;  3AA4 A;  3E9O A;  1SZ2 A;  4M63 C;  3VEN A;  1S22 A;  1BU6 O;  2ZQB A;  1NOY A;  1QZ5 A;  3SV4 A;  2O8C B;  3EN9 A;  1UA0 A;  5HL7 L;  1SKR A;  1RT1 A;  5FRN A;  2F9T A;  3VGL A;  1WSG A;  1NK6 A;  2YNG A;  1EET A;  1N32 K;  3C6H A;  1NGI A;  2BTF A;  3ZX0 A;  1FKO A;  5LY3 A;  3H1Q A;  3KLG A;  5EU7 A;  1ILY A;  1IKX A;  5HRN A;  4CFA A;  2UXD K;  1HJR A;  1JLF A;  3R1X A;  3ENB A;  4MLH A;  4DTR A;  3OYD A;  2NUB A;  4CJF A;  3L2U A;  3T7Z A;  4F3T A;  3IUC A;  1IKY A;  3V6D A;  4ZTJ A;  1VQ6 N;  3CXC M;  4BWM A;  1UOC A;  5M1Q A;  2CH6 A;  3HPO A;  5BPL A;  1HNV A;  2OPS A;  1GLD G;  3BGR A;  4BRL A;  5J2Q A;  2RF2 A;  3THV A;  1Y64 A;  2P9N B;  5AQZ A;  3TAB A;  3W0L A;  2Q1N A;  3C95 A;  1J5O A;  3K5L A;  3OYG A;  4GW6 A;  4ID1 A;  4FM1 A;  2UXC K;  3KK3 A;  4O0J A;  3ZEU B;  3KWI A;  5HRR A;  3ZX3 A;  2P9U B;  5KTQ A;  4OKK A;  5M1O A;  2OTL N;  1LW2 A;  3AO2 A;  3HP6 A;  3WNF A;  1YTU A;  4BR0 A;  2E5L K;  4Y0W A;  3ZSR A;  1IKW A;  1BDG A;  4BDY A;  4IO9 L;  3NFA A;  1HLU A;  4CJS A;  1C0M A;  5BN9 A;  2FBV A;  3O1B A;  3QML A;  1U47 A;  3LP2 A;  5F0X A;  1BQN A;  1R59 O;  5SWM A;  4W5T A;  1VRU A;  5T7B A;  3CC2 N;  2O4I A;  5ELZ A;  1P8Z A;  2B4J A;  3LM9 A;  4AHR A;  4FM0 A;  4CEA A;  4NLB A;  4CK3 A;  4Z4G A;  3ZT3 A;  4HUF A;  3CCM N;  4F8R A;  4DTU A;  4R79 A;  3FZL A;  1Q7Y O;  1LWE A;  4LC9 B;  4JRQ A;  3LAM A;  4CHN A;  3F73 A;  4B3R K;  1XNQ K;  3K9K A;  2FSN A;  3CFP A;  1TGO A;  4DR5 K;  2DPN A;  3CD6 N;  1JL1 A;  4JYA K;  4LF4 K;  1VSJ A;  3BF3 A;  4LF7 K;  2P9L A;  5GAE P;  1HNW K;  4L3Q A;  4CZJ A;  4B1X B;  3U8X A;  4DV3 K;  4H0P A;  3G6E N;  4XH4 A;  5LJW A;  1TYQ A;  3D0P A;  1GLA G;  3DWL A;  3RWU A;  1HNI A;  4LFC K;  1NGD A;  1ZC6 A;  3L2R A;  1T6D A;  3DRP A;  2PYJ A;  2YI1 A;  3WEE B;  3K2P A;  3PY8 A;  3D6R A;  1NGB A;  3OBY A;  4FJX A;  2HOE A;  5EY4 A;  1NWK A;  1YHQ N;  1K8K B;  3VEV A;  3C6T A;  2WFB A;  3AVN A;  3CJ9 A;  2I7P A;  3OYJ A;  3NH0 A;  4H0O A;  1BOT O;  1IO2 A;  3QB0 A;  4WQ5 C;  3FLC O;  3CQ8 A;  2PBD A;  4CJU A;  1RBT A;  5C12 A;  3OJS A;  1K8A O;  1QSS A;  4KTQ A;  5FRO A;  4H5T A;  4X62 K;  3K59 A;  2ZGY A;  1XHX A;  2GUI A;  4G1Q A;  4IDK A;  3HXM A;  1BIZ A;  4JV5 K;  3TAP A;  4AIL C;  3GE1 A;  1KLM A;  3V9X A;  1U48 A;  1WOQ A;  2P9I B;  4PWD A;  4AHT A;  3LPU A;  4FYD A;  3NE6 A;  4O0I A;  3JAM O;  4O8K A;  4J2D A;  3ULE B;  1ZBF A;  1C1A A;  1ZXO A;  4HUE A;  5JLF A;  3S3M A;  1GOB A;  1IG8 A;  4B3T K;  3GBT A;  5AQL A;  4OGE A;  2GBZ A;  3D7E O;  1HKG A;  4CF0 A;  1CZ9 A;  4DQP A;  4ID5 A;  1SL0 A;  5KGW A;  3LP3 A;  1YTA A;  2BAN A;  3AO5 A;  3JYT A;  4CZF A;  2P9K A;  4DSJ A;  2KFZ A;  3A0I X;  2HF3 A;  4O5B A;  2W42 A;  3E01 A;  1SAZ A;  3EEQ A;  3IKM A;  3ZET A;  4BRO A;  3MXI A;  1RT3 A;  1U45 A;  1CZA N;  4CBU A;  2ZM6 K;  1XI1 A;  3CME N;  3OYE A;  2A1S A;  3P4I A;  2DFF A;  4M3X A;  3HSC A;  4B3O A;  1RDU A;  3VQB A;  2O8D B;  4PY5 A;  4FXD A;  1BIS A;  5M1N A;  2P51 A;  1N33 K;  3MX2 A;  1WSJ A;  1JXE A;  4XH1 A;  4FWS A;  2NZT A;  3O3F A;  4J8F A;  3NF6 A;  3FGU A;  3V1R A;  3OYB A;  3H08 A;  3G71 N;  4JI2 K;  1WB9 A;  3CCL N;  4FSV A;  4Z4F A;  3Q7C A;  3QEP A;  3THX B;  4I2P A;  1XC9 A;  2O8F A;  3HTV A;  3SQ1 A;  1S9G A;  4WF9 L;  4GY2 B;  1SKW A;  5I3U A;  4E7L A;  2DFH A;  1X9J A;  2Z1J A;  4FJL A;  1RTJ A;  2HW3 A;  4KHW A;  2X74 A;  3SAF A;  4B1U B;  4BVP A;  3NBP A;  4JKD A;  1NBW A;  1TL1 A;  1NMD A;  3AVI A;  1S1W A;  2G8K A;  2UUC K;  3AVF A;  3SAH A;  1LOT B;  1JLC A;  1VSH A;  3RMA A;  4GVM A;  2VGN A;  1HPZ A;  2VGM A;  4AF1 A;  2XHB A;  4FJ7 A;  2FSJ A;  3AVL A;  5M1K A;  4QCL A;  2IC3 A;  3LDO A;  4TSX A;  3SAG A;  4CHY A;  3ZCM A;  4DSF A;  1W0H A;  3VMF B;  2P9S B;  1LV5 A;  4YY3 K;  3RR8 A;  4YOU A;  3B8A X;  1EO1 A;  3V4I A;  4OJR A;  1QQC A;  4BRM A;  4DTO A;  3TR8 A;  3DLL L;  4DFK A;  2QWM A;  5HRO A;  1N6Q A;  3MWT A;  1NOZ A;  4W5O A;  4XH5 A;  4BRE A;  4JK7 A;  4KRE A;  4Z4I A;  1H1V A;  1HKC A;  1HNZ K;  4CZK A;  5HRP A;  3MAQ A;  2E6L A;  1T05 A;  4DHY A;  2AJQ A;  5AQO A;  3CCS N;  1LCU A;  3MEG A;  3SBG A;  1S72 N;  1T44 A;  4BRP A;  3THW A;  4FWL A;  1BA1 A;  4KBO A;  3NVK A;  3C94 A;  4E1J A;  4FVU A;  4UY8 O;  2Q0R A;  3AGR A;  3G25 A;  5ADX A;  3J7Y P;  3VQ8 A;  2OZS A;  2ATQ A;  4CJ7 A;  4JI0 K;  3MEC A;  1NG9 A;  4BRQ A;  4C8M A;  3K5N A;  1O13 A;  3G4S N;  4KI4 A;  4FWK A;  1JL2 A;  5F1X A;  1XMO K;  5KQD A;  1BI4 A;  4CGD A;  3V81 A;  4CGF A;  2HF4 A;  3KKR A;  4BRG A;  1XUP O;  1EKE A;  2NRZ A;  1WSE A;  3HP9 A;  2E4L A;  3OHR A;  1IH7 A;  2FLO A;  1O1W A;  4DTJ A;  3RVC A;  3AVH A;  2D1K A;  4H5V A;  3U4L A;  4LF5 K;  1T03 A;  2NRX A;  2X6N A;  5CY4 A;  5CHI A;  2OPR A;  3SBT A;  3QER A;  3ZSV A;  4YOX A;  3DYA A;  2FBT A;  3ENO A;  4JAX A;  1LWF A;  3QES A;  2HST A;  4CES A;  2OYQ A;  1V4S A;  3A5O C;  4FWQ A;  1ATN A;  3MX5 A;  3OYH A;  4I7F A;  5JS1 A;  4CHO A;  1XHZ A;  3S3O A;  3BEX A;  3MWP A;  3CJB A;  4RCH A;  1TK5 A;  3J8A A;  5J2N A;  3LAK A;  4O55 A;  4BRI A;  3VER A;  3OYM A;  5H1S Q;  5KPR A;  3TI0 A;  1WSI A;  3VEX A;  3C7N A;  1DLO A;  4JKC A;  4BAC A;  4CK2 A;  3DLG A;  4A5B A;  1G99 A;  5GIN A;  1LAV A;  2YKM A;  1LAW A;  2A41 A;  1KAZ A;  3CFO A;  2EX3 A;  2IVO A;  2QTD A;  3OYF A;  2JWK A;  5BRF A;  1NJW A;  1VQK N;  5DK5 A;  1QVG M;  3VQP A;  3CCJ N;  2QWP A;  2PYL A;  4LH4 A;  5BR9 A;  4MO4 A;  3VA3 A;  1X3M A;  4A2B A;  4WFA L;  3J7A P;  1CLQ A;  3AVG A;  3DJC A;  3VTH A;  3QNO A;  1HYS A;  1IKV A;  3CM5 A;  5AZJ A;  5TKW A;  3NH1 A;  2OAN A;  4EHT A;  1S9E A;  2NRT A;  1RCH A;  2Q2R A;  4IWV A;  2JLE A;  1B9D A;  2YHX A;  1D9F A;  1BO5 O;  3QDK A;  1KLN A;  1NGH A;  2GWJ A;  4IG3 A;  4BR9 A;  2E6M A;  4CIG A;  2BH1 A;  3CF5 L;  2P1J A;  2ZWH A;  3OS1 A;  3VEW A;  1WNS A;  2HB5 A;  2FF6 A;  5M1P A;  4ILJ A;  2IGI A;  1VQL N;  4BE0 A;  5C10 A;  1NGJ A;  2PAV A;  1SL1 A;  3HPH A;  4JK8 A;  3HT3 A;  4LH5 A;  4JLH A;  3TWH A;  3QBX A;  1FW6 A;  4A5A A;  4GKK K;  5AQX A;  3TSQ A;  3DLE A;  2OPQ A;  1TL3 A;  3KK7 A;  3TAQ A;  3E1Y A;  1TUU A;  4BC4 A;  1N36 K;  3FFK B;  1NGG A;  4ISG A;  1FKP A;  4PA1 A;  2Q3S A;  2HVI A;  3KJV A;  4PL7 A;  1ASV A;  3VQA A;  1J53 A;  1I94 K;  3IG1 A;  3KLI A;  4DCH A;  3OYI A;  4I6M B;  3ZLJ A;  3KLF A;  3S9H A;  1ATR A;  3D2E A;  4BWJ A;  3F5T A;  4E7H A;  2ZJQ L;  3WXJ A;  3FE1 A;  2YNF A;  4KH6 A;  3THY A;  4WQ5 A;  1VSK A;  4GVE A;  3ZSO A;  3V9U A;  5TKY A;  1E4F T;  1XMQ K;  1BQM A;  1RDA A;  3LWL A;  1BCM A;  3GDQ A;  2XY6 A;  3VQD A;  4CEQ A;  4YNQ A;  4DQI A;  1D8Y A;  1VQ4 N;  4BDZ A;  4DR4 K;  2J4R A;  3TTD A;  3OJU A;  1XWL A;  2AA4 A;  4E1M A;  4AM7 A;  2Y1J A;  4JKB A;  2RE2 A;  4CEZ A;  1OH6 A;  3IDH A;  4CGJ A;  2YHA A;  4AQY K;  2HND A;  3CHW A;  1N34 K;  1EWR A;  3TAF A;  3IS9 A;  4N56 A;  4JHD A;  3A5M C;  4FWP A;  4CJW A;  4KHP K;  3EE9 A;  5AQI A;  5GAG P;  1EXQ A;  4RW8 A;  4BC3 A;  1T3V A;  3VEO A;  4AHC A;  1TYQ B;  4DTS A;  1D5A A;  3CFR A;  4BGB A;  5E41 A;  1KQS M;  4GV3 A;  3QO9 A;  4NCA A;  3NAE A;  4CCH A;  3F2K A;  4W5R A;  5KRS A;  1MA9 B;  4CJ4 A;  5AQY A;  4JRP A;  4DQ8 A;  2QI2 A;  3M8P A;  4IEE A;  4B8C A;  4LF9 K;  4OKE A;  1VSI A;  5AQM A;  4JKH A;  4BQZ A;  3FZH A;  4JN4 A;  2Q97 A;  2FXU A;  3SNN A;  4GNI A;  1NK0 A;  1VSE A;  4WFN L;  4CZG A;  4B9Q A;  5C2F A;  1YJW N;  1J5E K;  4LSL A;  1IV0 A;  4CGH A;  3D45 A;  1C0T A;  2OZM A;  4DQS A;  2YHB A;  4KO0 A;  4PHT X;  4ZTF A;  1S6P A;  4B1Y B;  1L5U A;  3CC4 N;  4E7J A;  2P9P A;  3ASM A;  1WSH A;  4U7B A;  1Q9X A;  3MN9 A;  5BPM A;  2PY5 A;  3UKU B;  4FLX A;  2NRR A;  2ZF5 O;  4DS4 A;  4FW2 A;  3ID6 A;  1RT2 A;  4DQR A;  2ITG A;  4AHV A;  3LL3 A;  4FJ5 A;  1XC3 A;  4EZ6 A;  2GEM A;  2GWK A;  3MMV A;  2HHS A;  2BUP A;  5DM6 L;  2QWL A;  3SUO A;  4E1N A;  5E26 A;  3DXM A;  5AQR A;  1X9W A;  1S1X A;  3CYM A;  4DSK A;  1RNH A;  4B9M A;  2Z1H A;  3OA9 A;  3WT0 A;  4C8O A;  3V9W A;  4JS5 A;  4WCE L;  3SLC A;  4GV6 A;  3KIO A;  4CHP A;  1W9H A;  3LDQ A;  3SPZ A;  4JI6 K;  4ZHR A;  4FZX C;  3JXU A;  3PO5 A;  4AH9 A;  3TAG A;  3PV8 A;  3KWG A;  3ATV A;  4KI6 A;  1Q8I A;  1RT7 A;  2W6L A;  5FDL A;  2X6S A;  4UQG A;  4C8K A;  5AZI B;  2FC0 A;  5LMN K;  2B6A A;  5JVH L;  4CFD A;  4A62 A;  4FJ9 A;  2D0A A;  2XY8 A;  4RW7 A;  5LJV A;  2E2P A;  4B1W B;  1W2B M;  1HPM A;  1GOA A;  4JD2 A;  1LW0 A;  1K73 O;  1GLL O;  2JWL A;  3P5J A;  2HHQ A;  3NMU A;  1VQN N;  3EY1 A;  4HVJ A;  3KK1 A;  4DMN A;  2ASO A;  3M8Q A;  3WXI A;  1F21 A;  3I8D A;  3HZ6 A;  4DU1 A;  3I55 N;  4ELV A;  2O8F B;  2HBL A;  4CZE A;  4YOT A;  2ZJR L;  4XIU A;  5K14 A;  3OBW A;  3OS2 A;  2O8C A;  2V52 B;  4B8A B;  5DM7 L;  1JJ2 M;  2VQF K;  3ZT1 A;  1D9D A;  4KHY A;  2QEX N;  3NCI A;  3CQY A;  1VSL A;  1HKB A;  4B9T A;  3H1V X;  3SUQ A;  2QWO A;  2JGU A;  3LP1 A;  3MK6 A;  4BRH A;  4LFB K;  3WNH A;  4QOZ B;  3I33 A;  3O80 A;  2Y1I A;  3VEY A;  4EHU A;  3L2Q A;  1SS6 A;  1OH8 A;  4NYN A;  4CEC A;  4FJ8 A;  5FRM A;  1HR0 K;  4M3Y A;  1NJI O;  3SMS A;  3BZC A;  4PKH A;  3L4Q A;  4JEP A;  1DTT A;  3EO3 A;  5AQT A;  3LDP A;  3ZYY X;  4G9Z A;  3GL1 A;  3NVM A;  4DV4 K;  2P9N A;  2GV9 A;  2VCP A;  5CZ1 A;  2A5X A;  3LAL A;  5GIP A;  1YVU A;  1VRT A;  3UB5 A;  3ZEU A;  4CED A;  3R8E A;  3CM6 A;  3O5B A;  1NKC A;  3BY5 A;  1QHA A;  3E9L A;  2P5O A;  4CJ5 A;  3E66 A;  4KHQ A;  3MN6 A;  3P39 A;  2UUB K;  3HPG A;  3QIP A;  4MLE A;  1KTQ A;  3MN5 A;  2IVP A;  1N8R O;  4IO8 A;  4EP4 A;  2UYT A;  5AQU A;  1I39 A;  4LF8 K;  4CD3 A;  3PSI A;  1BG3 A;  3R3L A;  2KZZ A;  3TPQ A;  4JI3 K;  5AJ3 K;  1VQ8 N;  3OY9 A;  4PUO A;  5BR8 K;  4KAZ A;  1JXB A;  3WQT A;  5DMR A;  1ZYQ A;  3O4Q A;  4RW9 A;  4CER A;  4CHZ A;  3AVC A;  2ZE2 A;  3EZ5 A;  5KQ8 A;  3BUZ B;  1GLF O;  1Y97 A;  4H0Y B;  4FLW A;  2IIR A;  3QEW A;  1RT4 A;  3LP0 A;  5AQP A;  4DWI A;  3RTV A;  4RWT A;  2D0P A;  3JSM A;  4M42 A;  1YUW A;  1ZBU A;  4A59 A;  4B1V A;  4W5Q A;  2A42 A;  1ZBL A;  1NMN A;  4FJH A;  1UA1 A;  1DT9 A;  4KH5 A;  2CH5 A;  1W7A A;  4B9N A;  2HHT A;  3WXM B;  3RMC A;  5I9E B;  3UKR A;  3B6P A;  4DV6 K;  1MDU B;  4FLZ A;  4IOC L;  4LSN A;  5J2P A;  3FFI A;  1XNR K;  1X9M A;  3C7N B;  4KFB A;  4Z0U A;  3EL2 A;  1G15 A;  4YOR A;  2O8E A;  5HRS A;  3KVG A;  1YIJ N;  4O44 A;  1NK9 A;  3AGK A;  3PIP L;  2UXB K;  3F9K A;  2ZD1 A;  4OX9 K;  4ILH A;  3VQE A;  4U67 L;  2W40 A;  3NDK A;  3PUF A;  4J2A A;  3ZT4 A;  4K25 A;  1NNE A;  4K42 A;  4M3U A;  1NGC A;  4CI6 A;  5C2D A;  1VHX A;  3SUP A;  3DLH A;  2P9I A;  4PKG A;  4I2Q A;  3K57 A;  3ULE A;  2DY4 A;  1JLG A;  5JIC A;  4BE1 A;  2QM1 A;  3QBW A;  2OA8 A;  4YFU A;  3QEV A;  1YAG A;  4PKI A;  3RRG A;  3J7Z O;  3LAN A;  2VWK A;  2WOM A;  3VN5 A;  4JKG B;  2CGK A;  1GLC G;  1D4X A;  2I5J A;  3KD1 E;  4BRK A;  1TK0 A;  3RSE A;  1C6V A;  2GEL A;  4NB4 A;  3HO1 A;  5KRT A;  3T1A A;  1SL2 A;  4BC5 A;  2HHW A;  4HWI A;  4B08 A;  4NLC A;  3SJH A;  3ISN C;  3TAM A;  3VQC A;  1WBB A;  3U6F A;  2WUS A;  4JKE A;  3Q7B A;  1J54 A;  3HRG A;  1OVQ A;  2ZJP L;  2E2N A;  3QFU A;  2NRW A;  2CGL A;  1VK0 A;  1X3N A;  1ZBH A;  3M3Z A;  4ICL A;  3A2F A;  1K6Y A;  3L0Q A;  4CW7 B;  3H6E A;  5LL6 Z;  4M3W A;  4DLG A;  4BRF A;  4C1N I;  3LDS A;  1S5J A;  1VQ7 N;  3O4W A;  3AAR A;  4NXM K;  1OVY A;  3O3H A;  3LDN A;  1U2V A;  3NH2 A;  1TKX A;  3HM9 A;  4KH4 A;  5BRH A;  1S1T A;  1QS4 A;  1U04 A;  3PX6 A;  2HHU A;  5IT9 O;  5C15 A;  3QEX A;  1WLJ A;  3SI6 A;  3V1Q A;  4EAH D;  4KTZ A;  1RBU A;  3S41 A;  1NM1 A;  3LM2 A;  1IJJ A;  1IBM K;  3NF8 A;  2QWQ A;  5KI6 A;  4HUG A;  3THX A;  1NK8 A;  4IEI A;  4QAG A;  2RN2 A;  4BG9 A;  1VQM N;  1P90 A;  2QA4 N;  1RBV A;  5AQK A;  4DR1 K;  4BDP A;  3DXK A;  4WE1 A;  4GV9 A;  4CBW A;  4FWM A;  4H5W A;  4FCY A;  4GKJ K;  2IVN A;  1Q18 A;  2HVH A;  3M8R A;  2A40 A;  4LF6 K;  4V19 S;  1JKH A;  3L4I A;  3QFP A;  3CET A;  3PO4 A;  2IS3 A;  3O6W A;  4HHT A;  1J9A A;  4FWO A;  1KAY A;  3CCR N;  5CE3 A;  2A6A A;  3A5N C;  4BRN A;  4LFA K;  2A1R A;  5FLX O;  3P1G A;  4BR7 A;  3TTF A;  1C1B A;  1L3V A;  4ISF A;  1RGI A;  4Y1D A;  3VA0 A;  3HBT A;  5JVG L;  2O8B A;  4CK1 A;  3N4Q A;  4CE9 A;  4KRF A;  4DR7 K;  3CJ1 A;  4IBN A;  5FPE A;  4EIA A;  2F9W A;  5C24 A;  3M1F A;  1JLE A;  2KKZ A;  4FWN A;  1KRP A;  2BDP A;  3J81 O;  4MDA A;  3ZSW A;  5JMV A;  2HNZ A;  4FZZ A;  3HYF A;  3OS0 A;  4CEF A;  4FW1 A;  3DOL A;  4CJE A;  4FZY A;  3ZSZ A;  4FLT A;  2NRH A;  4M3T A;  2E8A A;  3DM2 A;  2P9P B;  2QKB A;  4F2R A;  5HOO A;  4CFB A;  3RRH A;  1BUP A;  4DLE A;  2QK9 A;  4PL8 A;  4H5N A;  3A8Y A;  2OPP A;  5AQS A;  3R9P A;  3P83 D;  3WXL A;  4KV8 A;  5C0Y A;  4KHU A;  2QXF A;  4AHS A;  1VAZ A;  3VGM A;  3VQ7 A;  4DTX A;  1EWQ A;  5M1F A;  1Z6R A;  4A2A A;  1WUA A;  4W5N A;  2FF3 B;  5CYQ A;  1Q82 O;  1C1C A;  4ISE A;  4MDB A;  1IBK K;  3TSU A;  4OPJ A;  1N5Y A;  1EX4 A;  4CJT A;  1QSY A;  2CGJ A;  1FJG K;  4FJJ A;  4QS8 A;  2QKK A;  4IZ9 A;  1EQY A;  3AA5 X;  1LWC A;  1RTI A;  2WTU A;  3DOK A;  4IFE A;  2QWN A;  3P38 A;  1ZBI A;  4JI1 K;  4CZI A;  5CR4 A;  4J2E A;  1S6Q A;  3HVR A;  1VQO N;  4DSL A;  1QE1 A; 
#chains in the Genus database with same CATH homology
 2BE2 A;  3MXJ A;  4FK4 A;  4IG0 A;  4Z4F A;  3QEP A;  1GOA A;  4I2P A;  3DMJ A;  3RMD A;  1LW0 A;  1R0A A;  1XC9 A;  3AVK A;  1VSD A;  3P5J A;  3HJF A;  2HHQ A;  3SQ1 A;  1S9G A;  1WSF A;  1SKW A;  5I3U A;  4E7L A;  2DFH A;  1QTM A;  1KFD A;  3EY1 A;  3G10 A;  4HVJ A;  2Z1J A;  4FJL A;  1RTJ A;  2YV0 X;  3KK1 A;  2P5G A;  3OYN A;  4KHW A;  4DMN A;  3M8Q A;  2X74 A;  4CF2 A;  1F21 A;  3I8D A;  3NBP A;  4DU1 A;  1TL1 A;  3AA2 A;  2G8I A;  4ELV A;  2IOC A;  4E89 A;  3SPY A;  4R5P A;  1RDB A;  5C42 A;  4XIU A;  3AV9 A;  1S1W A;  3AVI A;  2LSN A;  5K14 A;  2G8K A;  2G8U A;  3OS2 A;  4N41 A;  3AVF A;  1TKZ A;  4B8A B;  4FLY A;  4EZ9 A;  2Z1I A;  3ZT1 A;  4Y1C A;  1U49 A;  1JLC A;  2X78 A;  1D9D A;  1VSH A;  3KLE A;  5HBM A;  1NJZ A;  4K8Z A;  4JS4 A;  1U4B A;  3LWM A;  3SQ0 A;  3RMA A;  3NCI A;  4CIF A;  1VSL A;  4CHQ A;  4B9T A;  2VWJ A;  3KD5 E;  4GVM A;  3SUQ A;  4DF4 A;  1QHT A;  1SUQ A;  1HPZ A;  2JGU A;  2XO7 A;  4FJ7 A;  2XHB A;  4RW6 A;  3LP1 A;  3L3V A;  4E7K A;  3AVL A;  3I0S A;  1ITG A;  4CEB A;  5I42 A;  1KVA A;  3WNH A;  4QOZ B;  1L3S A;  4QCL A;  4CF9 A;  1X1P A;  1JLB A;  2IC3 A;  3L3U A;  4TSX A;  4FVM A;  4CHY A;  2Y1I A;  3ZCM A;  4DSF A;  1W0H A;  4GMJ B;  2B5J A;  1LV5 A;  3RR8 A;  2FBX A;  3QEI A;  3L2Q A;  3M8S A;  4NYN A;  4CEC A;  4NYF A;  3V4I A;  2RPI A;  1QQC A;  4OJR A;  4DTO A;  4F2S A;  4IFV A;  4FJ8 A;  3TR8 A;  3OYL A;  5FRM A;  4DFK A;  5KGX A;  3AO3 A;  5CZ2 A;  4DTP A;  1NOZ A;  5HRO A;  4W5O A;  1N6Q A;  4IKF A;  4M3Y A;  3NGI A;  1DTQ A;  4F3O A;  1DTT A;  4KRE A;  4NCG A;  3NGZ A;  2RKI A;  4Z4I A;  4E3S A;  4DG1 A;  1KFS A;  1CXU A;  4FJN A;  5HRP A;  1TV6 A;  5D3G A;  3MAQ A;  2E6L A;  1S1U A;  1T05 A;  2GV9 A;  4NCB A;  2AJQ A;  4KB1 A;  3V9Z A;  2O4G A;  3S3N A;  3MEG A;  5CZ1 A;  4OKJ A;  3K58 A;  1NKE A;  4M45 A;  3LAL A;  3IRX A;  3OVN A;  1YVU A;  1VRT A;  3VQ4 A;  1T8E A;  2DTU A;  3AVJ A;  3C94 A;  2DFE A;  1KVB A;  4CED A;  3C6U A;  3CM6 A;  1NKC A;  3U3Y A;  5HP1 A;  4DFJ A;  4E0D A;  1Z25 A;  2P5O A;  4CJ5 A;  4KHQ A;  4AHU A;  3VQ8 A;  4OPK A;  3AO4 A;  2OZS A;  2ATQ A;  1YT3 A;  4B9L A;  4M3Z A;  3HPG A;  2KTQ A;  3MEC A;  3QIP A;  1NJY A;  3PX0 A;  3BDP A;  3KK2 A;  1KTQ A;  3KLH A;  4C8M A;  4DF8 A;  3K5N A;  3SQ2 A;  3PX4 A;  4KI4 A;  1TAU A;  1JL2 A;  4CJ3 A;  1BI4 A;  4CGD A;  4EP4 A;  2KQ2 A;  3V81 A;  4F4K A;  4CJQ A;  3LZI A;  4CGF A;  3KKR A;  1TKT A;  1JLA A;  1I39 A;  1RDC A;  1KVC A;  3AO1 A;  3ZSQ A;  3OYK A;  5CYM A;  1EKE A;  3I0R A;  4CJL A;  4N47 A;  1WSE A;  3HP9 A;  1A5V A;  2E4L A;  4FJM A;  2KZZ A;  1IH7 A;  1WAF A;  1O1W A;  4DTJ A;  4Z4H A;  3AVH A;  1A5X A;  4H4O A;  3OY9 A;  3TAR A;  3MED A;  4Q5V A;  4PUO A;  1RT5 A;  1HRH A;  1JXB A;  3O4N A;  4C8N A;  4KAZ A;  1T03 A;  3V9S A;  2X6N A;  5CY4 A;  3SCX A;  2OPR A;  1S1V A;  5DMR A;  4CFC A;  3QER A;  3KTQ A;  3AVA A;  1X9S A;  1ZYQ A;  3ZSV A;  3O4Q A;  4RW9 A;  1RBR A;  1SV5 A;  4CER A;  4CHZ A;  3DLR A;  1JLQ A;  2FBT A;  3DYA A;  2F8S A;  1LWF A;  3AVC A;  3VQQ A;  3QES A;  2KFN A;  2ZE2 A;  3SJJ A;  4CES A;  3DLB A;  4I9Q A;  3EZ5 A;  1RBS A;  2OYQ A;  3LPT A;  4CIE A;  1RDD A;  1Y97 A;  4EP5 A;  1VSM A;  4FLW A;  4FLU A;  3OYH A;  3SZ2 A;  4I7F A;  5JS1 A;  3QEW A;  1RT4 A;  4DTM A;  1ASW A;  3LP0 A;  3WNE A;  4CHO A;  1XHZ A;  2Z1G A;  2FBY A;  4DWI A;  3RTV A;  3S3O A;  4CJP A;  3JSM A;  4M42 A;  1WAJ A;  1CZB A;  1ZBU A;  4RW4 A;  5C25 A;  4W5Q A;  4KPY A;  2YKN A;  1TK5 A;  3ZT2 A;  1ZBL A;  1NKB A;  2D0C A;  2HMI A;  4FJH A;  1UA1 A;  5J2N A;  3LAK A;  4L8R B;  1HMV A;  2YNI A;  4HTU A;  4KB0 A;  4O55 A;  4B9N A;  4CF1 A;  3KKS A;  1RT6 A;  2HHT A;  3RMB A;  1FK9 A;  3OYM A;  3UIQ A;  3RMC A;  3TI0 A;  1WSI A;  3NF9 A;  3O3G A;  1T7P A;  2G8V A;  3AA4 A;  3HVT A;  3AA3 A;  4LD0 A;  1DLO A;  3B6P A;  4BAC A;  4CK2 A;  3DLG A;  3NF7 A;  2ZQB A;  4FLZ A;  1LAV A;  2YKM A;  1NOY A;  5JS2 A;  1LAW A;  3CFO A;  2EX3 A;  4LSN A;  5J2P A;  4C8L A;  3FFI A;  1TKD A;  3RR7 A;  3SV4 A;  1X9M A;  3OYF A;  3ALY A;  5J1E A;  1NJW A;  1UA0 A;  1SKR A;  1RT1 A;  3HST B;  5FRN A;  5DK5 A;  4LY7 A;  4KFB A;  1L3T A;  4Z0U A;  1HQE A;  1WSG A;  3VQP A;  1NK6 A;  3K5O A;  1G15 A;  2YNG A;  4K8X A;  1EET A;  2PYL A;  4LH4 A;  5HRS A;  3L8B A;  4Z4C A;  1MU2 A;  4CGI A;  1FKO A;  4O44 A;  1NK9 A;  2IAJ A;  4FK0 A;  3VA3 A;  2PZS A;  3F9K A;  2ZD1 A;  3KLG A;  5EU7 A;  1NJX A;  3VQE A;  1CLQ A;  3AVG A;  1IKX A;  2VG5 A;  5HRN A;  3NDK A;  2G8H A;  3QNO A;  1HYS A;  3PUF A;  4CFA A;  3DRR A;  4J2A A;  1IKV A;  1HJR A;  3ZT4 A;  1JLF A;  4CF8 A;  3CM5 A;  3SV3 A;  4M3U A;  3NH1 A;  4DTR A;  1S9E A;  3VQ5 A;  3OYD A;  3SUP A;  1RCH A;  2NUB A;  1WN7 A;  4FJG A;  4KHS A;  3VQ9 A;  3ITH A;  4CJF A;  3L2U A;  2KZM A;  3DLH A;  1L3U A;  4F3T A;  2JLE A;  1B9D A;  4I2Q A;  1IKY A;  1D9F A;  2EHG A;  3K57 A;  3V6D A;  4ZTJ A;  1KLN A;  4H4M A;  2DY4 A;  1JLG A;  4IG3 A;  4BE1 A;  3DRS A;  4BWM A;  1BGX T;  4YFU A;  3QEV A;  2OA8 A;  1UOC A;  3RRG A;  2E6M A;  4CIG A;  3LAN A;  2VWK A;  2P1J A;  1HNV A;  2OPS A;  2WOM A;  3BGR A;  3WNG A;  3HPO A;  5J2Q A;  2RF2 A;  3VN5 A;  3THV A;  3OS1 A;  2I5J A;  1WNS A;  3TAB A;  3KD1 E;  2HB5 A;  3C95 A;  3ZT0 A;  1J5O A;  2IGI A;  4KHN A;  3K5L A;  3OYG A;  1TK0 A;  4GW6 A;  4FJK A;  1C6V A;  4ID1 A;  4BE0 A;  4FM1 A;  3HO1 A;  5KRT A;  3T1A A;  1SL2 A;  3KK3 A;  4DFP A;  2HHW A;  1SL1 A;  4O0J A;  4B08 A;  3HPH A;  5HRR A;  3HT3 A;  3ISN C;  4LH5 A;  3TAM A;  5KTQ A;  4JLH A;  3VQC A;  4OKK A;  3TWH A;  3U6F A;  1LW2 A;  3L2V A;  3T3F A;  3SQ4 A;  3AO2 A;  4FK2 A;  3DLE A;  2OPQ A;  1TL3 A;  3TAQ A;  2HHV A;  1J54 A;  3WNF A;  3HP6 A;  4BE2 A;  1YTU A;  2HNY A;  3ZSY A;  3L2W A;  1QSL A;  1UAX A;  3ZSR A;  1FKP A;  1IKW A;  3AVM A;  4PA1 A;  2D5R A;  2HW3 A;  2Q3S A;  2HVI A;  4HCB A;  4ELU A;  4BDY A;  1BI4 B;  1VK0 A;  3NFA A;  3OYA A;  3KJV A;  4CJS A;  1ASV A;  3VQA A;  1C0M A;  3CG7 A;  4ICL A;  1ZBH A;  1J53 A;  1K6Y A;  3A2F A;  2FBV A;  1KSP A;  1U47 A;  3LP2 A;  3SYZ A;  1BQN A;  3IG1 A;  4M3W A;  3DI6 A;  3KLI A;  5SWM A;  4W5T A;  1VRU A;  5T7B A;  3V1O A;  4CEE A;  3OYI A;  1REV A;  4DLG A;  3KLF A;  2O4I A;  3S9H A;  4BWJ A;  4Q0B A;  2B4J A;  3LDS A;  4FM0 A;  4AHR A;  1S5J A;  4E7H A;  4CEA A;  4DSE A;  2YNF A;  4CK3 A;  1VSK A;  4Z4G A;  3ZT3 A;  4HUF A;  4PQU A;  1BHL A;  3O3H A;  3ZSO A;  3NH2 A;  3V9U A;  1NK4 A;  2G8W A;  4F8R A;  3T19 A;  1TKX A;  4DTU A;  4OLA A;  4DU3 A;  3HM9 A;  1C0U A;  1BQM A;  1RDA A;  1S1T A;  4OGC A;  4E19 A;  3LWL A;  1QS4 A;  4B9S A;  1U04 A;  3PX6 A;  2HHU A;  1BCM A;  2XY6 A;  4DQI A;  3VQD A;  4CEQ A;  4YNQ A;  1D8Y A;  1LWE A;  3QEX A;  1WLJ A;  4JRQ A;  3B6O A;  3LAM A;  4BDZ A;  3V1Q A;  3SI6 A;  4KTZ A;  4FLV A;  4CHN A;  3F73 A;  1RBU A;  4KKO A;  2VG6 A;  3CFP A;  1TGO A;  4OVL A;  3NF8 A;  3NGY A;  2KW4 A;  5KI6 A;  2YNH A;  3OJU A;  1XWL A;  4HUG A;  4ELT A;  1NK8 A;  4QAG A;  2RN2 A;  4E1M A;  2Y1J A;  4MFB A;  1JL1 A;  1HQU A;  2D0B A;  4CEZ A;  1VSJ A;  4CGJ A;  2F8T A;  3QIN A;  2WON A;  1VSF A;  2YHA A;  1RBV A;  2HND A;  4DS5 A;  3OYC A;  4BDP A;  3AVB A;  3TAF A;  3IS9 A;  4WE1 A;  4N56 A;  3D0P A;  3RWU A;  4CJW A;  4FJI A;  2HHX A;  1HNI A;  4E7I A;  3L2R A;  3ZSX A;  3IAY A;  3DRP A;  4FCY A;  2PYJ A;  4OLB A;  1EXQ A;  3PY8 A;  3K2P A;  3M8R A;  2HVH A;  4RW8 A;  4CJK A;  4AHC A;  3U3G A;  4FJX A;  4DTS A;  1D5A A;  3CFR A;  5E41 A;  1JKH A;  4NCA A;  3C6T A;  3QO9 A;  1RTH A;  3NAE A;  4CCH A;  1Z26 A;  3AVN A;  1SKS A;  4W5R A;  3PO4 A;  5KRS A;  4B9V A;  3OYJ A;  2IS3 A;  2VG7 A;  4CJ4 A;  3NH0 A;  4JRP A;  3DLK A;  4HHT A;  3M8P A;  1J9A A;  1UWB A;  4H8K A;  4B8C A;  4Z4E A;  1IO2 A;  4OKE A;  3VQ6 A;  2XY7 A;  1B9F A;  3CQ8 A;  1VSI A;  4KI6 A;  2A1R A;  1EP4 A;  1RBT A;  4CJU A;  4DFM A;  3P1G A;  3OJS A;  1BL3 A;  1QSS A;  4KTQ A;  1C1B A;  5FRO A;  1L3V A;  4CEO A;  3K59 A;  4J2B A;  1XHX A;  2GUI A;  4G1Q A;  4CGG A;  4IDK A;  3HXM A;  2ETJ A;  3SNN A;  1NK7 A;  1BIZ A;  1IG9 A;  4Y1D A;  3VA0 A;  3TAP A;  1NK0 A;  1VSE A;  4AIL C;  4CK1 A;  1KLM A;  4CE9 A;  3NHG A;  2IDO A;  2G8F A;  3V9X A;  4KRF A;  1U48 A;  4LSL A;  4IBN A;  4CGH A;  3D45 A;  4PWD A;  4AHT A;  1C0T A;  3LPU A;  4FYD A;  3NE6 A;  4O0I A;  3K5M A;  4J2D A;  2OZM A;  4DQS A;  2YHB A;  4KO0 A;  4ZTF A;  3QLH A;  5C24 A;  1ZBF A;  1JLE A;  1S6P A;  4CJR A;  1L5U A;  1C1A A;  1KRP A;  1ASU A;  2BDP A;  4HUE A;  4E7J A;  3ASM A;  4DSI A;  1FXX A;  1WSH A;  3S3M A;  1Q9X A;  1GOB A;  2PY5 A;  3ZSW A;  4HCC A;  1CXQ A;  4FLX A;  2HNZ A;  3ULD A;  4FZZ A;  3HYF A;  3OS0 A;  2F96 A;  4CEF A;  4DS4 A;  4FW1 A;  3DOL A;  4CJE A;  1BIU A;  4OGE A;  4FZY A;  4FW2 A;  3ZSZ A;  2GBZ A;  4FLT A;  2R7Y A;  4M3T A;  1RT2 A;  4DQR A;  2ITG A;  3QET A;  3DM2 A;  4AHV A;  4CF0 A;  1CZ9 A;  2QKB A;  4DQP A;  4FJ5 A;  4M3R A;  4EZ6 A;  4ID5 A;  4DTN A;  1SL0 A;  4F2R A;  5KGW A;  4CFB A;  3LP3 A;  1YTA A;  2BAN A;  3AO5 A;  3JYT A;  3RRH A;  4DSJ A;  2HHS A;  2KFZ A;  4CJV A;  4DLE A;  5J2M A;  2QK9 A;  3SUO A;  4FM2 A;  4E1N A;  4IFY A;  1Q9Y A;  4B9U A;  4O5B A;  2OPP A;  3E01 A;  2W42 A;  1X9W A;  4I9L A;  3P83 D;  1S1X A;  4KV8 A;  3CYM A;  4DSK A;  4MQ3 A;  4N5S A;  1RNH A;  1I3A A;  4KHU A;  2QXF A;  4AHS A;  4B9M A;  3MXI A;  2Z1H A;  3VQ7 A;  1BCO A;  1TAQ A;  1RT3 A;  4DTX A;  3LZJ A;  4C8O A;  4N76 A;  2BGG A;  3V9W A;  4JS5 A;  4DU4 A;  1U45 A;  1XI1 A;  3OYE A;  4W5N A;  4M41 A;  2A1S A;  3KIO A;  4RG8 A;  1C1C A;  5CYQ A;  4CHP A;  4KHY A;  1HYV A;  1W9H A;  2DFF A;  4M3X A;  4OPJ A;  4KTW A;  3TAN A;  1EX4 A;  4CJT A;  4ZHR A;  3SPZ A;  1N5Y A;  1QSY A;  4FZX C;  4B3O A;  3PO5 A;  3VQB A;  4AH9 A;  2XY5 A;  3TAG A;  4FJJ A;  3PV8 A;  4O4G A;  3EYZ A;  1NK5 A;  2QKK A;  3QIO A;  1TK8 A;  4PY5 A;  4FXD A;  3AA5 X;  3TAE A;  1Q8I A;  1RT7 A;  1LWC A;  5FDL A;  1BIS A;  1RTI A;  2X6S A;  3DOK A;  3G0Z A;  4UQG A;  2XRI A;  4C8K A;  1A5W A;  2FC0 A;  3MXM A;  2P51 A;  1KCF A;  3QNN A;  4DQQ A;  5HLF A;  3HK2 A;  2B6A A;  3HL8 A;  1WSJ A;  1B92 A;  1GOC A;  1JXE A;  3O3F A;  4CFD A;  1ZBI A;  1RIL A;  1S6Q A;  3NF6 A;  3V1R A;  3HVR A;  4J2E A;  3OYB A;  4FJ9 A;  1RTD A;  2XY8 A;  2D0A A;  3MEE A;  1TVR A;  1HYZ A;  3H08 A;  3SUN A;  5SZT A;  4RW7 A;  4DSL A;  1QE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...