4NXNK

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4nxnK00
4X62K 1HNXK 3JAMO 5LMNK 1XMOK 4AQYK 4V19S 1IBMK 4DR6K 2UXBK 4JI7K 3J81O 1HNZK 4JYAK 5BR8K 1HR0K 5IWAK 4LFAK 2VQEK 4B3MK 1XNQK 2UXCK 1IBLK 4LF9K 4JI3K 1IBKK 4B3RK 4YHHK 5LL6Z 4DR2K 1N36K 2UUBK 1XNRK 5AJ3K 2UUCK 4JI0K 4DR1K 1J5EK 4YY3K 2HHHK 4LF8K 3T1HK 4DV1K 5IT9O 1N33K 4DUZK 5FLXO 4OX9K 5A2QO 4DV7K 4GKKK 4LFBK 4DV0K 2UUAK 4LF4K 4LFCK 4DR5K 4KHPK 2E5LK 4B3TK 4X65K 4DV3K 4JI5K 3J7AP 4LF5K 4DV2K 4NXMK 4CW7B 4K0KK 1FJGK 3OTOK 4JI2K 1HNWK 2VQFK 4DR3K 4GKJK 4DUYK 4JI8K 1N32K 2F4VK 4LF7K 2ZM6K 2UXDK 3J80O 4DR4K 4DV5K 3J7YP 4JI6K 4JI4K 1N34K 4B3SK 2UU9K 4X64K 1XMQK 4CVNE 3T1YK 4JI1K 4DV6K 4LF6K 4DV4K 4DR7K 1I94K 4X66K 5LMUK 4NXNK 4JV5K
chains in the Genus database with same CATH superfamily
4FM0A 1HNXK 4CHPA 1QZ5A 4I6MA 5TKWA 4CJWA 3KJVA 1GLDG 4LC9B 5CE3A 4FSVA 5EVZA 1YITN 1NK6A 2KFNA 3CMEN 3NF9A 4CF9A 4C8LA 2HBMA 4HUGA 4FWRA 4CBUA 4B3OA 1BI4A 4FL9A 4CZIA 4CF1A 5AJ3K 4BRCA 1VQPN 4B1ZA 3HPGA 3PY8A 1CZAN 3V4IA 4E7IA 3CQ8A 3LZIA 5KGWA 4AM7A 1YI2N 4OX9K 1NG9A 1S1XA 4ELTA 2X6SA 4DV0K 4IWVA 5AQMA 4DQSA 3NDKA 1Z26A 4RG8A 4YORA 2PYJA 4CJPA 2PY5A 1B92A 4O0JA 1LWCA 2BUPA 4XEIA 4BRGA 1QQOA 3RTVA 1U04A 2F96A 3SZ2A 4FZXC 1BA1A 3NVKA 4EZ6A 3WXLA 5BR9A 2O8FA 3QFPA 4O4GA 2IAJA 4FW2A 1IH7A 4OVLA 3KK2A 2ZJRL 2YHBA 5GAGP 4AILC 1T6CA 4KO0A 3M8SA 3S41A 4FWLA 1D5AA 5CZ1A 4IOCL 1EXQA 4AF1A 4A62A 2HF4A 4CFCA 3ENOA 3NCIA 5KI6A 1IKWA 4CJ4A 1LCUA 3MCPA 3RR8A 4R5PA 1NM1A 3CMAN 2CH5A 4FLZA 4DB3A 3V81A 3OVNA 4Z94A 2HW3A 2FSKA 1NLVA 3SAHA 4EP5A 1UAXA 2HHQA 4H5VA 1IKYA 4DMNA 3O4NA 3B8AX 3HPHA 4I2PA 4X62K 2HHSA 4CGFA 2D5RA 1RTIA 4BR7A 4DTPA 5K14A 1N6QA 1RBRA 4QAGA 3CI5A 3SAFA 3OYLA 3EYZA 2XHBA 3WUHA 4KTQA 5I3UA 4KI4A 1DT9A 1HYZA 4LF9K 3O9SA 1RTJA 2NRWA 3CETA 2OPRA 4PL8A 4U67L 3LDQA 3TWHA 1Q9YA 4BG8A 4YHHK 1JL2A 3GBTA 2H3GX 3KK7A 4JRQA 1OH6A 4IOAL 4CD3A 4ELUA 5AQTA 4PY5A 4B9UA 3H6EA 2X74A 4IDKA 4CZFA 3FFIA 1JLCA 3LP3A 2E8AA 3PV8A 3HZ6A 4H4MA 3KLFA 4DU3A 3O80A 3FGUA 2O8CB 4H0PA 4KB1A 1CXUA 1KRPA 2UUAK 4WQ4C 4GW6A 1ASVA 4LF4K 3CCRN 4OKKA 3QIOA 4PA1A 3CCQN 2GX9A 2IDOA 5C10A 2DFHA 1TL1A 3UKRB 1QZ6A 3A5NC 4IO8A 1HX1A 3ZCMA 5HRPA 4E7KA 2G8VA 3TU5A 3NGZA 2Q36A 2HBLA 4WQ4A 3VA3A 3V9ZA 4JKGB 1QVFM 3L8BA 1T44A 5T7BA 4DSFA 1NOYA 3LDNA 2V52B 5CZ2A 2V51B 4JKEA 3CJ9A 1HPZA 3VQ7A 2VQFK 2P9IA 1J6ZA 4NYFA 1GLCG 2A1SA 4K43A 1ZBHA 3K0SA 3CJAA 2P5OA 4JHDA 1NGFA 1KTQA 1I39A 3IMXA 4AHCA 3H46O 1MWKA 3WEEA 1DLOA 1TUYA 1NMNA 4XH4A 1BIZA 2DY4A 2J4RA 2P9NB 3VEYA 4BR4A 1R59O 3CCSN 1N5YA 1EWRA 1SV5A 5EY4A 3R8EA 1RT2A 1XMOK 4AQYK 3VENA 3AVLA 3OYBA 4BROA 2IS3A 2D0BA 3IAYA 1HQUA 1XHXA 1WSFA 3I0RA 2E4LA 4JYAK 3ZT1A 2HHWA 1TL3A 3DRSA 1MWMA 3G4SN 4FLTA 3M1FA 4M7YA 3SQ1A 3OBWA 4C23A 3RWUA 3MX2A 3OYKA 4DSJA 4IFVA 4O5FA 4CEAA 2P9PA 2B5JA 4JK8A 3NH1A 3THXA 4FJ8A 4K42A 3AGKA 2G8KA 2RHKA 4F2SA 4L8RB 4LF8K 2VWBA 1B9FA 4DV1K 3P5JA 4BE0A 5JLHA 4FK0A 4IOXA 4M3XA 3THYB 4FLUA 1UA1A 3TI0A 4FJ9A 1JLQA 4FLVA 5KTQA 2FF6A 3BZKA 3KK3A 1NK0A 4BRKA 3V9UA 3M8QA 4LFCK 4JKCA 4Z4IA 2QKBA 1JCEA 2VGMA 4CGGA 4BDZA 4O5BA 3DWLA 2P1JA 3OBYA 3TR8A 4JI5K 5ADXA 2VYPA 2FBTA 4J8FA 4H4OA 4DV2K 1HKCA 3DXKB 3EZWA 1K8AO 3OYFA 3S3MA 4PKHA 1BDGA 3T7ZA 4FWSA 2P9KA 4JI8K 3BF3A 3DLRA 5KPZA 2ZGZA 1W0HA 4CEZA 4K8XA 2YX6A 3CYMA 1C6VA 4DTXA 1IO2A 1N34K 2QW9A 2JWLA 3HYFA 4XIUA 4OGCA 1NK4A 4CHYA 3AA2A 1RDUA 4JKBA 3NHGA 5FPMA 3TAMA 3AVIA 3CQYA 3CJ7A 3C65A 4OJRA 4PQUA 3F5TA 1C1AA 1K6YA 1OKJA 4V19S 3P38A 3TAGA 4M3WA 4EIAA 2YNHA 1YXQA 2QWRA 4IG3A 2AJQA 4BC2A 3KKSA 2HOEA 4KHYA 1XUPO 4GMJB 5EOYA 4KTZA 4J2BA 1NGIA 4H5RA 4PKGA 3MN6A 3CD6N 1S5JA 1HPMA 2G8IA 5I9EB 1NKBA 4LD0A 4BACA 3O6WA 2Q97A 1V4SA 3V6DA 3TANA 1GOBA 5TKYA 1KVCA 1YVUA 1L5UA 4AHRA 4Q5VA 1RILA 3WNEA 1HNVA 4DWIA 2YJEA 4CJUA 2YKNA 4CFBA 1E4FT 1TK8A 3MN5A 3ZEUA 3IFRA 3QEPA 3ZSYA 4FJXA 1A5WA 4J2AA 3ZX0A 1DKGD 3S9HA 3VGKA 3ZSRA 2YHWA 4JKHA 5CYMA 2YNGA 4B3TK 3L2VA 3CPEA 1K8KA 3O9RA 3FZHA 5HL7L 2UYTA 1NBWA 1YF5L 4DKWA 4F3TA 1VAZA 4LF5K 4G1QA 3TPQA 3KIOA 5J2QA 1GLLO 1D9FA 1WSIA 1DTQA 3VF4A 1Z05A 2OA8A 4FJLA 5DM7L 3K57A 5AQPA 4HTUA 3A8YA 5B8HA 1UOCA 1C0GA 1C0FA 3O9TA 5EX5A 3E66A 2A40A 1JL1A 1WAFA 3WXKA 4NCAA 5D3GA 2G8FA 1T05A 3SNNA 1L3UA 2DFFA 2F9WA 2OANA 3L3VA 4B8CA 4EHUA 3V1RA 1MDUB 5HP1A 4CGDA 1VQ5N 3ZX3A 3TARA 2XY6A 3VQCA 3A0IX 5AQWA 1D9DA 3I33A 1C0UA 3VEZA 2IVPA 4CJEA 4R79A 3SQ0A 4CJ5A 2WC9A 4Z4GA 3VGMA 3CC7N 5IWAK 4FLXA 1HNIA 3W3DA 3SPYA 4DFPA 4QS9A 3WXJA 1TGOA 4DTNA 2KFZA 1O1WA 4BREA 4E0DA 3R9PA 3AO1A 4GV6A 2BGGA 1XC3A 3VQ4A 2W6KA 5AQGA 1C0MA 3VQ8A 3MMVA 3H45C 2HBKA 3ZSXA 4JKFA 3RR7A 5AQZA 3A2FA 4H5TA 3KLIA 1TK0A 4A5BA 3EE9A 3MCAB 4DSKA 2NUBA 5M1PA 4DV7K 4CJSA 3QESA 1RDAA 4JD2A 3HM8A 1IKVA 4BC5A 3AO5A 3C7NB 3D2FA 5AQRA 3SQ4A 2GTDA 4FZYA 4FJIA 4DTJA 1FKOA 4N5SA 1NNEA 4KTWA 4O8UA 2AA4A 3VQDA 4BR2A 2KKZA 3HT3A 1QHAA 1VSFA 3QO9A 3ATUA 2V7YA 5FROA 4BE1A 4I9QA 3OS1A 3CQXA 1EWQA 2NRZA 2EX3A 3ZT4A 4FK2A 1VQ8N 3H1VX 2QK9A 2O8EA 4GKJK 3SQ2A 2YHYA 1JJ2M 2YNFA 4CI6A 3J7YP 5HRNA 2ZJPL 3D2EB 3C6UA 2RN2A 3DXMA 4CZEA 5AQJA 5C42A 1X3MA 3B6OA 4H8KA 2F7TA 3IG1A 1U47A 4KPYA 4OLAA 1BISA 1KAXA 1KCFA 4KKOA 3IRXA 4CEBA 4DU1A 2YV0X 3U4LA 4M41A 5C15A 1VSLA 2YNIA 5LMNK 4OPHA 1OVYA 1KLNA 3MXJA 1NGGA 1ZBUA 1W9HA 1BHLA 3SUNA 4Z4HA 5HOOA 2UXBK 2E6LA 3FZKA 2NRHA 1HR0K 4O0IA 4N76A 4Y1CA 1S6PA 1NU0A 4ELVA 2D0OA 3QEIA 4GNIA 4CCHA 1NJYA 3L4QA 2PBDA 3V1QA 1VQ7N 1SAZA 4JAXA 2P5GA 4RTFD 2P9SB 2YHXA 5GINA 3UKUB 3OJUA 3SMSA 1SS6A 4CHOA 5BPNA 4BRQA 4E19A 5DK5A 3L2UA 1Q9XA 4HTLA 3CPWM 3PO5A 1S3XA 1A5XA 1QE1A 4OGEA 5SWMA 3K58A 3KZBA 3PIOL 3RRGA 1E4GT 5DM6L 1VQ6N 3VERA 2E6MA 5HROA 3LM2A 1NK7A 2E5LK 1WUAA 1VHXA 3KLGA 2Q0UA 1ZBFA 1BU6O 3EN9A 1GLEG 3HBTA 3CC2N 4PUOA 3LALA 5EXWA 1QSLA 4YOTA 5C24A 3Q7BA 2OPSA 3VQPA 1KQSM 5GADP 4H0TB 2QEXN 1VSIA 3LDSA 3F2KA 2ZJQL 3DLEA 4IJNA 3SBTA 4C8NA 2ZM6K 3VQQA 3E9PA 1OH7A 4A61A 4B9SA 4FWPA 1HRHA 3MN9A 4JI6K 2QWNA 3CERA 2HVIA 2QM1A 3HRGA 3HI0A 5H1SQ 3WQUA 3AGRA 1NGHA 4JRPA 3FZFA 3G25A 4BRPA 3THWB 4BGAA 5M1NA 3SYZA 1U6ZA 4B8AB 3LAMA 2OZSA 1W2BM 4Q0BA 1IKXA 2OZMA 3OYJA 3ZSQA 2HF3A 1BCMA 4BQZA 5BR8K 4FM2A 2A41A 4CZJA 1YJ9N 1RBTA 4FLYA 4IKFA 3NH2A 1LW0A 5M1OA 4JI3K 2WONA 1G99A 4RW7A 3BF1A 3E01A 2VG5A 1N36K 1KLMA 5AFUH 2JWKA 1RDDA 1TYQB 3PSIA 5KPRA 3VA0A 3AARA 3D6RA 2R7YA 1S6QA 1GLJO 2Q1NA 3DI6A 2LSNA 4KHNA 3FZLA 4BRMA 3HP9A 3O1WA 4HUEA 2IIRA 2D0PA 1NGBA 3WNFA 3SMPA 3THVA 3MX5A 3AO2A 3C94A 1L3TA 3L3UA 1ASUA 2RF2A 3IKMA 2KLAA 4BRIA 3ZT3A 4W5QA 4CEDA 2HHTA 1KAZA 4XH5A 3RSEB 2PAVA 2Z1GA 4QS8A 4O8KA 2E1ZA 4MO5A 5AQVA 1YUWA 3VGLA 4WFBL 1VQKN 4B9MA 1CLQA 2E2QA 4IFYA 2QTDA 3CJCA 3R1XA 3ULDA 2ZE2A 4NYNA 3KLHA 3ZSZA 4NXMK 1JCFA 3D7EO 3O9UA 3U8XA 3KTQA 4ID5A 3F9MA 3SAGA 3ID8A 4H0YB 1ATNA 2RKIA 1EX4A 4DTRA 1ATSA 4FYDA 1NWKA 3ZSWA 3T3FA 2E2OA 5F2RA 2O8DA 4Z4EA 4WFAL 1N32K 3L0QA 2F4VK 1GLBG 2GWJA 4DV5K 1NK9A 3QBXA 3H1QA 1C1BA 4AHTA 1YTAA 2P9LA 2ZQBA 3TAPA 1BCOA 1FK9A 5AQYA 2PZSA 1WOQA 3SV3A 3LWLA 5JVGL 3ULEA 3FZMA 4KB0A 3LDOA 2HNZA 1NGDA 5AQSA 4CF2A 4CF0A 3MEEA 5LJVA 1IG8A 4YOWA 1XC9A 4AH9A 4JV5K 1WSGA 3L4IA 3HOSA 4BR0A 1KVAA 4N56A 3PUFA 5AQKA 5M1FA 3SJJA 5JVHL 2ZGYA 4CHZA 3VEOA 5BRFA 5ELZA 3AA3A 5J2MA 5AQHA 2BTFA 4JKAA 3O8MA 4XH1A 3HO1A 2UXCK 1S1WA 3HTVA 3JSMA 1SKRA 5AQLA 3VQBA 1L3SA 3CM6A 1MA9B 2QA4N 2GUIA 3U9DA 3QEVA 3UIQA 4WE1A 4A57A 5J2PA 4I6MB 4CHNA 3Q7CA 3T69A 3MXIA 2KTQA 1J5EK 1YAGA 3EKSA 4AHVA 2Q2RA 3T1HK 2P9UA 3FE1A 3BUZB 2XY8A 2DFEA 5F0XA 1RGIA 1BGXT 1F21A 4ZTJA 3QEWA 1BI4B 4NO7A 2HNYA 3SV4A 5AQXA 4DQPA 3VEWA 3EY1A 1TKTA 1W7AA 4FVUA 3MEDA 5BPMA 1NGCA 4JLHA 4DR5K 4WYBA 3O5BA 2DTUA 4PKIA 4KBOA 2EWSA 1KC8O 4HVJA 3EE8A 1Q81O 3AY9A 4BRHA 4JS5A 1JLEA 2Y1IA 2O8BB 1SQKA 1HJOA 1JLFA 5C0YA 4DTSA 1YJWN 1FJGK 3OTOK 4CJ3A 4H0OA 4N41A 3LL3A 5GIOA 2XY5A 3VPZA 2W40A 1U2VB 3CIPA 3L2WA 3VQ9A 4NCGA 1VQNN 1U49A 4MO4A 5F1XA 4W5NA 3DLGA 4TSXA 1R0AA 1ZYQA 2CH6A 2O8FB 4GY2B 4FJGA 4F4KA 1TAUA 1QHTA 4FJHA 2QWLA 3CCVN 1I94K 4X66K 4B1XB 4BDYA 5GIPA 5AZJB 1RT7A 1J54A 3MK6A 4M3RA 2B4JA 4N47A 4YNQA 1SL1A 1ATRA 1X9MA 3HJFA 2JGUA 1HLUA 3O9QA 4E1MA 1NMDA 2QWPA 2QXLA 3ISNC 3U3YA 4FK4A 1M1KO 4CJTA 4C1NI 4PWDA 5AZIA 4M3ZA 3U9ZA 4B9LA 3AVCA 3HL8A 2NRTA 3ZYYX 3ZT0A 5HLFA 1WAJA 4OPAA 1SKWA 4DR2K 4B1VA 5M1QA 1ESVA 2WTUA 2IC3A 3L6QA 2V7ZA 3BZCA 3SJHA 4OPKA 5E26A 1FKPA 4A2AA 1WBBA 1P8ZA 4CE9A 1Z6RA 4OKEA 2VGNA 4GKKK 4E1NA 3A5MC 4JNEA 4OLBA 1KSPA 3SBGA 3LPTA 3K9KA 3B6PA 5GAEP 3PX6A 1VRTA 3HK2A 3E1YA 4RCHA 4LH4A 3C0BA 4E1JA 4IEEA 1EETA 4BR5A 3AVMA 1S9GA 4OO1J 4YFUA 1S9EA 3A5LC 3QICA 4DQIA 3PX4A 4EZ9A 4FW1A 2VWKA 3KD1E 3CM5A 3F9KA 3MAQA 1ITGA 1GOAA 1U45A 3M5RA 2GUPA 4BRFA 4CZLA 4CIEA 3ZETA 4EHTA 3LZJA 3DLHA 4CJVA 1NGJA 1BL3A 3CHWA 4DUYK 5DMRA 4IFEA 4DR4K 4Z4CA 1K9MO 1HKBA 3OYMA 4E7LA 3MEGA 3J7ZO 3DYAA 4ZTFA 5J1EA 3CCMN 5EU7A 4FWNA 1RDBA 4DR7K 3O3GA 2BH1A 1RBSA 4FZZA 2HBJA 4NB4A 3DLKA 2P9IB 4DG1A 4W5OA 3M3ZA 4JHDB 4C8KA 3VEVA 4WFNL 2F8SA 4DF4A 3WEEB 4E7HA 4CEOA 1KXPA 4C8MA 2FC0A 2RPIA 3QBWA 3QNOA 2CGJA 4AHUA 3TAQA 3E9LA 2VQEK 4LH5A 3VQ6A 2P51A 2UUBK 3M6GA 3HVRA 3K59A 2ETJA 3KK1A 3BEXA 2B6AA 3QINA 4BWJA 3V9XA 1EO1A 2YJFA 4M3TA 3ATVA 1Z25A 3VOVA 5AFUA 4DUZK 4RWTA 2QXFA 3MWPA 5I42A 3FR0A 4A59A 2E1YA 1XQSC 3FFKB 3H3NO 2HNDA 2I7NA 1WSJA 3HP6A 3PLAA 2D4WA 1T6DA 2P9PB 4MFBA 2F9TA 3K5MA 1QVGM 1WSEA 4BWMA 3GE1A 3OJSA 4MDBA 2I5JA 4BE2A 3THXB 4L3QA 3U6FA 4BVPA 3AVNA 2BDPA 4YDUC 2OYQA 3CCEN 4CFAA 4DQQA 1NGAA 1KFDA 1T3VA 3SUOA 1LOTB 4I7FA 1HYSA 5LY3A 2A5XA 4DU4A 2HHUA 1VSJA 3KKRA 4JI2K 3K5OA 1VQON 2G8HA 4YDUA 1WN7A 5FDLA 2OCEA 3P1GA 3I56N 5M1KA 4KHWA 1N8RO 4FVMA 2FSJA 4DFMA 4B9TA 4JN4A 1C0TA 1YT3A 3VQEA 3PIPL 3LPUA 1XMQK 4K25A 1X9WA 3NF8A 4DSIA 1X9JA 1G15A 1RDCA 5JS1A 1JXBA 1VSKA 3C6TA 1JXEA 4ILGB 4GVMA 1YHQN 3RRHA 4IXCA 3EL2A 4FPBA 3OYHA 1ZBSA 4E7JA 2HMIA 2WFBA 1U4BA 3G0ZA 4RW6A 1ZBLA 4DTUA 3NGIA 4CZKA 3CCUN 5GAHP 4FWMA 4BG9A 2ATQA 3PX0A 3AO4A 4B3RK 4CECA 5BPLA 1P90A 5FPEA 2O8CA 4CJ7A 3VESA 4GVEA 2HMPA 4B9VA 4DLEA 1Q82O 3TTDA 3IUCA 2HVHA 2NRVA 2GWKA 3UKRA 4YOUA 4M63C 3NE6A 4CZMA 3WXIA 4JKGA 3VF2A 1TUUA 5KQDA 3E9OA 3PO4A 3LAKA 2X6NA 1SZ2A 2IGIA 1NK8A 4CK2A 3BY5A 1SKSA 1LWFA 1Q86O 4ISEA 4FOIA 1FXXA 4CHQA 4G9ZA 2ITGA 3VN5A 4F2RA 5KPTA 4H0XB 4HWIA 4KH4A 1TKZA 4U7BA 3WT0A 4F8RA 2Q3SA 4DV3K 1IG9A 3AAQA 4Z4FA 4I2QA 4EFHA 4BRAA 2P9NA 3ZEUB 4DQ8A 3TSQA 5LJWA 1EQYA 1SL0A 4H03B 1RTDA 4K8ZA 4WQ5C 1NKCA 3K5NA 4LF7K 2UXDK 4IJAA 3J80O 1K8KB 1JLAA 3P83D 4A5AA 2Q0RA 3KHYA 4JI4K 4B1UB 1LW2A 4CJLA 3N4QA 1J53A 4WQ5A 2XO7A 3OYDA 4BR9A 4FLWA 3A5OC 4DV4K 5KQ8A 3AAPA 1NJWA 3DMJA 4KHQA 3DLBA 3JYTA 3O4WA 1X3NA 1JKHA 2HB5A 2ZWHA 2QKKA 1IBMK 1BUPA 3OYEA 4AHSA 2PYLA 4EP4A 2Z1IA 4DS4A 2G8WA 1HUXA 4LFAK 4IG0A 2D0AA 2VCPA 4B3MK 2O8BA 1BA0A 1GLAG 3TAFA 3THYA 1TKXA 3CC4N 1JCGA 1VQ9N 1LWEA 3WNHA 4NLCA 3P39A 3NAEA 3SUPA 1Y64A 1KVBA 3HXMA 1GOCA 3GG4A 3LM9A 1U2VA 1S1VA 1WB9A 2UUCK 2D1KA 3AVAA 4FWKA 4PHTX 1L3VA 1QSSA 4BRDA 5JLFA 4DSEA 3LP1A 5FLXO 1NKEA 1C1CA 2F8TA 3DXKA 3CCLN 2QWOA 1RFQA 3EEQA 3NH0A 3R6MA 5AZJA 3H3OB 3OW2M 5C2DA 3DRRA 3V9WA 3D0PA 5KRTA 1CXQA 4DHYA 3OS0A 4GV3A 1K73O 3NF6A 1HKGA 4FJJA 3U3GA 4F3OA 2WOMA 2O4IA 5KRSA 4JD2B 5HBMA 3G71N 4RW9A 3TSPA 4UY8O 4LY7A 3D2FB 1RNHA 4JKDA 3H08A 4QS7A 1YIJN 3MDQA 4DTOA 1IV0A 2Y1JA 1GLFO 3AV9A 2UU9K 1NJXA 4ICLA 4X64K 1I3AA 2OTLN 1DEJA 4JI1K 1ASWA 4CJFA 2O8EB 3AVGA 1LV5A 4KFBA 4NXNK 5BREA 5FRNA 4WF9L 5AQQA 3DXMB 1OVQA 3MN7A 2XRIA 3DLLL 1HNZK 3LDPA 5CHIA 3MWTA 3T1AA 5HRSA 3AVKA 4DTMA 3L2RA 4NLBA 3SLCA 4ZHRA 1TK5A 5HRRA 2YI1A 5LL6Z 3LWMA 1NJZA 3BDPA 4C1NK 2A42A 3P4IA 2AP1A 3OYGA 4FM1A 1LAWA 4HCBA 2Q31A 3NFAA 4CZGA 3EKUA 4EAHD 4M7XA 3QMLA 2HHHK 3QETA 3UB5A 4F9OA 1J5OA 5IT9O 2ASMA 1EP4A 5C12A 4DFJA 1N33K 4CEQA 2HHVA 3AVBA 4W5RA 2FXUA 2A1RA 2A3ZA 1QTMA 2GEMA 3SCXA 4FJ5A 4JK9A 4HCCA 1QSYA 3D45A 1YVNA 5AQNA 3V9SA 4ILJA 5BRHA 1NGEA 4B9NA 3R3LA 4IZ9A 1A5VA 1KAYA 3HSTB 3CCJN 1V4TA 4X65K 4FJMA 3VQAA 3CFPA 5J2NA 4RW4A 4BC3A 2IOCA 1KD1O 3ZT2A 4CW7B 1CZ9A 1WLJA 3BGRA 1WSHA 3DRPA 3SI6A 3S3OA 1HNWK 1T03A 3QIPA 1S72N 3PSFA 4FXDA 5MLCQ 4DSLA 3NVMA 3VQ5A 4GV9A 1QQMA 1XWLA 2FF3B 3EO3A 3LANA 4BGBA 4M42A 3I8BA 1RT5A 3RVCA 3QERA 2Z1HA 4FPAA 2HHXA 4DF8A 3IDHA 3UE5A 1MU2A 2DPNA 2NRXA 2A6AA 4IO9L 3KWIA 1HMVA 4BRLA 5C2FA 2PFUA 1S22A 2KHOA 3JAMO 1JLBA 4KV8A 4BRNA 1Q7YO 3WNGA 1T7PA 3CFRA 3CF5L 3C6HA 5JICA 2O4GA 1BQMA 3J81O 1BG3A 2CGKA 2KZZA 2ITMA 1QQCA 2QWQA 1OH5A 3OYNA 2ASPA 3CJ1A 1YJNN 1IBKK 2D0CA 3WXMB 1VQ4N 4MLHA 2G8UA 3VTIA 1BO5O 4DLGA 4PL7A 3C7NA 1QS4A 2E20A 1RT1A 4FJNA 3DOKA 4LSLA 2FBVA 4YY3K 5BN9A 2E88A 4KREA 2QWMA 2KW4A 3RMBA 3WQTA 3OY9A 3OYCA 2ASOA 3I0SA 4I9LA 1D4XA 3OYIA 1E3MA 4CGHA 3QNNA 1ILYA 3SK3A 3VTHA 3C95A 1H1VA 1WBDA 2NNWA 3NGYA 3C6AA 5CR4A 1BQNA 5CYQA 3SUQA 1VSHA 4QOZB 1UWBA 4FWOA 5JS2A 2JLEA 3AA5X 4H5WA 3D2EA 2OPQA 5AQFA 2YHAA 3J7AP 3ZSOA 4JS4A 1TV6A 4Z0UA 1VSEA 4BDPA 3FLCO 4K0KK 2W41A 3CXCM 2E2PA 4BC4A 4FWQA 4J2EA 3LP0A 3VF6A 5AQIA 4M3YA 2YCHA 3OHRA 4KHUA 4B08A 4IBNA 1RCHA 2OTJN 2IVOA 3I8DA 3TTCA 4CBXA 5E41A 3KD5E 4YOVA 1S1TA 3DJCA 4FOEA 2X78A 2CGLA 1OH8A 4B1WB 2E2NA 1EKEA 4CZHA 1TVRA 3ALYA 5KGXA 4MLEA 3ASMA 3IS9A 4O44A 5C25A 1TAQA 4BY9C 4KHSA 3TABA 1VSMA 4RW8A 4UQGA 2O8DB 3LP2A 1HQEA 4ISGA 2P9SA 1JLGA 5AQOA 4H0VB 3UKUA 3QB0A 2P9LB 5E84A 3NF7A 4CFDA 1J9AA 5BN8A 3I55N 1VQLN 4JI7K 4CK3A 4FJ7A 3CJBA 3M8RA 3HSCA 4AM6A 3TAEA 3ULEB 1IBLK 3AVJA 1NK5A 3O08A 5AQUA 3P31A 1REVA 3AA4A 1RDWX 1BWFO 4CBWA 1QQNA 4BVOA 1SUQA 3O3HA 3ZSVA 3VETA 1HJRA 4KAZA 4A2BA 4E3SA 3KVGA 1HYVA 2VG6A 4MQ3A 4HHTA 3ENHA 5JMVA 3O4QA 3JS6A 3AO3A 2NZTA 4LFBK 3HOTA 2ZF5O 4DCHA 4CESA 3DOLA 4B1YB 4CEFA 1VRUA 2FBXA 3M8PA 3MXMA 2IVNA 2GELA 1IJJA 5FPNA 4KHPK 4IDHA 1X1PA 2P9UB 3CFOA 4HUFA 4LSNA 3QLHA 2ZD1A 3QDKA 3CG7A 3HPOA 1XHZA 3N4PA 4CD1A 3KLEA 2Z1JA 2VG7A 1RBVA 3KWGA 3ITHA 4MDAA 2NRRA 3AVHA 4E89A 3F73A 3RMCA 1M90O 3THWA 3BP8A 4O55A 4DS5A 4OPJA 3OYAA 4ILHA 5CY4A 3RMAA 2FSNA 3T1YK 3HVTA 2EHGA 1FW6A 1RTHA 1BOTO 3S3NA 4KH5A 3DAWA 3NBPA 4M45A 3GOIA 3J8AA 3AVFA 3T19A 2W42A 4CJQA 4CF8A 3SPZA 3O3FA 1RT4A 2GBZA 4W5TA 2QI2A 1TYQA 2KQ2A 3RMDA 1X9SA 3GDQA 4CIGA 4M3UA 4CGIA 5SZTA 2WBNA 3L2QA 3TSUA 2VWJA 4DR6K 1KFSA 1NJIO 1B9DA 3HM9A 3LDLA 4KH6A 1XNQK 4JK7A 2KZMA 3VMFB 4KRFA 1DTTA 2FLOA 2YKMA 3O1BA 4Y0WA 4BQLA 4CGJA 4JEPA 1XNRK 2P9KB 1S1UA 3ZX2A 1VQMN 1Q8IA 3K9JA 5FPDA 1Y97A 3RSEA 4CIFA 5AR0A 2I7PA 4WCEL 4JI0K 1NOZA 4H5NA 4DR1K 4IEIA 3OA9A 2HSTA 5AZIB 3NMUA 1D8YA 3DM2A 3OS2A 5A2QO 1ZBIA 4NCBA 1T8EA 1SL2A 4Y1DA 3QEXA 2BANA 4OKJA 1RT6A 2WUSA 4ISFA 3ID6A 4CJRA 4QCLA 4C8OA 4FJKA 5ADXH 1XI1A 2W6LA 4KI6A 1Q18A 1W97L 1UA0A 1VSDA 2FBYA 3ZLJA 1TKDA 1DGKN 5BRDA 1ZC6A 3G6EN 4ID1A 3G10A 2NLXA 3MECA 4DFKA 3ENBA 4CEEA 2XY7A 3K2PA 3K5LA 1BIUA 3V1OA 4CERA 3EZ5A 4CK1A 1RBUA 3JXUA 1ZXOA 3VEXA 4K41A 1CZBA 5FRMA 4DR3K 4DQRA 1YTUA 2BE2A 2RE2A 3TTFA 4FCYA 4YOXA 4B9QA 3W0LA 4B3SK 1VK0A 2OPPA 4YOYA 3QFUA 4CVNE 4FO0A 3GL1A 2GV9A 3ZETB 4DV6K 1O13A 4LF6K 1RT3A 4J2DA 4CJKA 1LAVA 1WNSA 1U48A 5LMUK
chains in the Genus database with same CATH topology
4X62K 1HNXK 3JAMO 5LMNK 1XMOK 4AQYK 4V19S 1IBMK 4DR6K 2UXBK 4JI7K 3J81O 1HNZK 4JYAK 5BR8K 1HR0K 5IWAK 4LFAK 2VQEK 4B3MK 1XNQK 2UXCK 1IBLK 4LF9K 4JI3K 1IBKK 4B3RK 4YHHK 5LL6Z 4DR2K 1N36K 2UUBK 1XNRK 5AJ3K 2UUCK 4JI0K 4DR1K 1J5EK 4YY3K 2HHHK 4LF8K 3T1HK 4DV1K 5IT9O 1N33K 4DUZK 5FLXO 4OX9K 5A2QO 4DV7K 4GKKK 4LFBK 4DV0K 2UUAK 4LF4K 4LFCK 4DR5K 4KHPK 2E5LK 4B3TK 4X65K 4DV3K 4JI5K 3J7AP 4LF5K 4DV2K 4NXMK 4CW7B 4K0KK 1FJGK 3OTOK 4JI2K 1HNWK 2VQFK 4DR3K 4GKJK 4DUYK 4JI8K 1N32K 2F4VK 4LF7K 2ZM6K 2UXDK 3J80O 4DR4K 4DV5K 3J7YP 4JI6K 4JI4K 1N34K 4B3SK 2UU9K 4X64K 1XMQK 4CVNE 3T1YK 4JI1K 4DV6K 4LF6K 4DV4K 4DR7K 1I94K 4X66K 5LMUK 4NXNK 4JV5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 K;  1HNX K;  3JAM O;  5LMN K;  1XMO K;  4AQY K;  4V19 S;  1IBM K;  4DR6 K;  2UXB K;  4JI7 K;  3J81 O;  1HNZ K;  4JYA K;  5BR8 K;  1HR0 K;  5IWA K;  4LFA K;  2VQE K;  4B3M K;  1XNQ K;  2UXC K;  1IBL K;  4LF9 K;  4JI3 K;  1IBK K;  4B3R K;  4YHH K;  5LL6 Z;  4DR2 K;  1N36 K;  2UUB K;  1XNR K;  5AJ3 K;  2UUC K;  4JI0 K;  4DR1 K;  1J5E K;  4YY3 K;  2HHH K;  4LF8 K;  3T1H K;  4DV1 K;  5IT9 O;  1N33 K;  4DUZ K;  5FLX O;  4OX9 K;  5A2Q O;  4DV7 K;  4GKK K;  4LFB K;  4DV0 K;  2UUA K;  4LF4 K;  4LFC K;  4DR5 K;  4KHP K;  2E5L K;  4B3T K;  4X65 K;  4DV3 K;  4JI5 K;  3J7A P;  4LF5 K;  4DV2 K;  4NXM K;  4CW7 B;  4K0K K;  1FJG K;  3OTO K;  4JI2 K;  1HNW K;  2VQF K;  4DR3 K;  4GKJ K;  4DUY K;  4JI8 K;  1N32 K;  2F4V K;  4LF7 K;  2ZM6 K;  2UXD K;  3J80 O;  4DR4 K;  4DV5 K;  3J7Y P;  4JI6 K;  4JI4 K;  1N34 K;  4B3S K;  2UU9 K;  4X64 K;  1XMQ K;  4CVN E;  3T1Y K;  4JI1 K;  4DV6 K;  4LF6 K;  4DV4 K;  4DR7 K;  1I94 K;  4X66 K;  5LMU K;  4NXN K;  4JV5 K; 
#chains in the Genus database with same CATH topology
 4FM0 A;  1HNX K;  4CHP A;  1QZ5 A;  4I6M A;  5TKW A;  4CJW A;  3KJV A;  1GLD G;  4LC9 B;  5CE3 A;  4FSV A;  5EVZ A;  1YIT N;  1NK6 A;  2KFN A;  3CME N;  3NF9 A;  4CF9 A;  4C8L A;  2HBM A;  4HUG A;  4FWR A;  4CBU A;  4B3O A;  1BI4 A;  4FL9 A;  4CZI A;  4CF1 A;  5AJ3 K;  4BRC A;  1VQP N;  4B1Z A;  3HPG A;  3PY8 A;  1CZA N;  3V4I A;  4E7I A;  3CQ8 A;  3LZI A;  5KGW A;  4AM7 A;  1YI2 N;  4OX9 K;  1NG9 A;  1S1X A;  4ELT A;  2X6S A;  4DV0 K;  4IWV A;  5AQM A;  4DQS A;  3NDK A;  1Z26 A;  4RG8 A;  4YOR A;  2PYJ A;  4CJP A;  2PY5 A;  1B92 A;  4O0J A;  1LWC A;  2BUP A;  4XEI A;  4BRG A;  1QQO A;  3RTV A;  1U04 A;  2F96 A;  3SZ2 A;  4FZX C;  1BA1 A;  3NVK A;  4EZ6 A;  3WXL A;  5BR9 A;  2O8F A;  3QFP A;  4O4G A;  2IAJ A;  4FW2 A;  1IH7 A;  4OVL A;  3KK2 A;  2ZJR L;  2YHB A;  5GAG P;  4AIL C;  1T6C A;  4KO0 A;  3M8S A;  3S41 A;  4FWL A;  1D5A A;  5CZ1 A;  4IOC L;  1EXQ A;  4AF1 A;  4A62 A;  2HF4 A;  4CFC A;  3ENO A;  3NCI A;  5KI6 A;  1IKW A;  4CJ4 A;  1LCU A;  3MCP A;  3RR8 A;  4R5P A;  1NM1 A;  3CMA N;  2CH5 A;  4FLZ A;  4DB3 A;  3V81 A;  3OVN A;  4Z94 A;  2HW3 A;  2FSK A;  1NLV A;  3SAH A;  4EP5 A;  1UAX A;  2HHQ A;  4H5V A;  1IKY A;  4DMN A;  3O4N A;  3B8A X;  3HPH A;  4I2P A;  4X62 K;  2HHS A;  4CGF A;  2D5R A;  1RTI A;  4BR7 A;  4DTP A;  5K14 A;  1N6Q A;  1RBR A;  4QAG A;  3CI5 A;  3SAF A;  3OYL A;  3EYZ A;  2XHB A;  3WUH A;  4KTQ A;  5I3U A;  4KI4 A;  1DT9 A;  1HYZ A;  4LF9 K;  3O9S A;  1RTJ A;  2NRW A;  3CET A;  2OPR A;  4PL8 A;  4U67 L;  3LDQ A;  3TWH A;  1Q9Y A;  4BG8 A;  4YHH K;  1JL2 A;  3GBT A;  2H3G X;  3KK7 A;  4JRQ A;  1OH6 A;  4IOA L;  4CD3 A;  4ELU A;  5AQT A;  4PY5 A;  4B9U A;  3H6E A;  2X74 A;  4IDK A;  4CZF A;  3FFI A;  1JLC A;  3LP3 A;  2E8A A;  3PV8 A;  3HZ6 A;  4H4M A;  3KLF A;  4DU3 A;  3O80 A;  3FGU A;  2O8C B;  4H0P A;  4KB1 A;  1CXU A;  1KRP A;  2UUA K;  4WQ4 C;  4GW6 A;  1ASV A;  4LF4 K;  3CCR N;  4OKK A;  3QIO A;  4PA1 A;  3CCQ N;  2GX9 A;  2IDO A;  5C10 A;  2DFH A;  1TL1 A;  3UKR B;  1QZ6 A;  3A5N C;  4IO8 A;  1HX1 A;  3ZCM A;  5HRP A;  4E7K A;  2G8V A;  3TU5 A;  3NGZ A;  2Q36 A;  2HBL A;  4WQ4 A;  3VA3 A;  3V9Z A;  4JKG B;  1QVF M;  3L8B A;  1T44 A;  5T7B A;  4DSF A;  1NOY A;  3LDN A;  2V52 B;  5CZ2 A;  2V51 B;  4JKE A;  3CJ9 A;  1HPZ A;  3VQ7 A;  2VQF K;  2P9I A;  1J6Z A;  4NYF A;  1GLC G;  2A1S A;  4K43 A;  1ZBH A;  3K0S A;  3CJA A;  2P5O A;  4JHD A;  1NGF A;  1KTQ A;  1I39 A;  3IMX A;  4AHC A;  3H46 O;  1MWK A;  3WEE A;  1DLO A;  1TUY A;  1NMN A;  4XH4 A;  1BIZ A;  2DY4 A;  2J4R A;  2P9N B;  3VEY A;  4BR4 A;  1R59 O;  3CCS N;  1N5Y A;  1EWR A;  1SV5 A;  5EY4 A;  3R8E A;  1RT2 A;  1XMO K;  4AQY K;  3VEN A;  3AVL A;  3OYB A;  4BRO A;  2IS3 A;  2D0B A;  3IAY A;  1HQU A;  1XHX A;  1WSF A;  3I0R A;  2E4L A;  4JYA K;  3ZT1 A;  2HHW A;  1TL3 A;  3DRS A;  1MWM A;  3G4S N;  4FLT A;  3M1F A;  4M7Y A;  3SQ1 A;  3OBW A;  4C23 A;  3RWU A;  3MX2 A;  3OYK A;  4DSJ A;  4IFV A;  4O5F A;  4CEA A;  2P9P A;  2B5J A;  4JK8 A;  3NH1 A;  3THX A;  4FJ8 A;  4K42 A;  3AGK A;  2G8K A;  2RHK A;  4F2S A;  4L8R B;  4LF8 K;  2VWB A;  1B9F A;  4DV1 K;  3P5J A;  4BE0 A;  5JLH A;  4FK0 A;  4IOX A;  4M3X A;  3THY B;  4FLU A;  1UA1 A;  3TI0 A;  4FJ9 A;  1JLQ A;  4FLV A;  5KTQ A;  2FF6 A;  3BZK A;  3KK3 A;  1NK0 A;  4BRK A;  3V9U A;  3M8Q A;  4LFC K;  4JKC A;  4Z4I A;  2QKB A;  1JCE A;  2VGM A;  4CGG A;  4BDZ A;  4O5B A;  3DWL A;  2P1J A;  3OBY A;  3TR8 A;  4JI5 K;  5ADX A;  2VYP A;  2FBT A;  4J8F A;  4H4O A;  4DV2 K;  1HKC A;  3DXK B;  3EZW A;  1K8A O;  3OYF A;  3S3M A;  4PKH A;  1BDG A;  3T7Z A;  4FWS A;  2P9K A;  4JI8 K;  3BF3 A;  3DLR A;  5KPZ A;  2ZGZ A;  1W0H A;  4CEZ A;  4K8X A;  2YX6 A;  3CYM A;  1C6V A;  4DTX A;  1IO2 A;  1N34 K;  2QW9 A;  2JWL A;  3HYF A;  4XIU A;  4OGC A;  1NK4 A;  4CHY A;  3AA2 A;  1RDU A;  4JKB A;  3NHG A;  5FPM A;  3TAM A;  3AVI A;  3CQY A;  3CJ7 A;  3C65 A;  4OJR A;  4PQU A;  3F5T A;  1C1A A;  1K6Y A;  1OKJ A;  4V19 S;  3P38 A;  3TAG A;  4M3W A;  4EIA A;  2YNH A;  1YXQ A;  2QWR A;  4IG3 A;  2AJQ A;  4BC2 A;  3KKS A;  2HOE A;  4KHY A;  1XUP O;  4GMJ B;  5EOY A;  4KTZ A;  4J2B A;  1NGI A;  4H5R A;  4PKG A;  3MN6 A;  3CD6 N;  1S5J A;  1HPM A;  2G8I A;  5I9E B;  1NKB A;  4LD0 A;  4BAC A;  3O6W A;  2Q97 A;  1V4S A;  3V6D A;  3TAN A;  1GOB A;  5TKY A;  1KVC A;  1YVU A;  1L5U A;  4AHR A;  4Q5V A;  1RIL A;  3WNE A;  1HNV A;  4DWI A;  2YJE A;  4CJU A;  2YKN A;  4CFB A;  1E4F T;  1TK8 A;  3MN5 A;  3ZEU A;  3IFR A;  3QEP A;  3ZSY A;  4FJX A;  1A5W A;  4J2A A;  3ZX0 A;  1DKG D;  3S9H A;  3VGK A;  3ZSR A;  2YHW A;  4JKH A;  5CYM A;  2YNG A;  4B3T K;  3L2V A;  3CPE A;  1K8K A;  3O9R A;  3FZH A;  5HL7 L;  2UYT A;  1NBW A;  1YF5 L;  4DKW A;  4F3T A;  1VAZ A;  4LF5 K;  4G1Q A;  3TPQ A;  3KIO A;  5J2Q A;  1GLL O;  1D9F A;  1WSI A;  1DTQ A;  3VF4 A;  1Z05 A;  2OA8 A;  4FJL A;  5DM7 L;  3K57 A;  5AQP A;  4HTU A;  3A8Y A;  5B8H A;  1UOC A;  1C0G A;  1C0F A;  3O9T A;  5EX5 A;  3E66 A;  2A40 A;  1JL1 A;  1WAF A;  3WXK A;  4NCA A;  5D3G A;  2G8F A;  1T05 A;  3SNN A;  1L3U A;  2DFF A;  2F9W A;  2OAN A;  3L3V A;  4B8C A;  4EHU A;  3V1R A;  1MDU B;  5HP1 A;  4CGD A;  1VQ5 N;  3ZX3 A;  3TAR A;  2XY6 A;  3VQC A;  3A0I X;  5AQW A;  1D9D A;  3I33 A;  1C0U A;  3VEZ A;  2IVP A;  4CJE A;  4R79 A;  3SQ0 A;  4CJ5 A;  2WC9 A;  4Z4G A;  3VGM A;  3CC7 N;  5IWA K;  4FLX A;  1HNI A;  3W3D A;  3SPY A;  4DFP A;  4QS9 A;  3WXJ A;  1TGO A;  4DTN A;  2KFZ A;  1O1W A;  4BRE A;  4E0D A;  3R9P A;  3AO1 A;  4GV6 A;  2BGG A;  1XC3 A;  3VQ4 A;  2W6K A;  5AQG A;  1C0M A;  3VQ8 A;  3MMV A;  3H45 C;  2HBK A;  3ZSX A;  4JKF A;  3RR7 A;  5AQZ A;  3A2F A;  4H5T A;  3KLI A;  1TK0 A;  4A5B A;  3EE9 A;  3MCA B;  4DSK A;  2NUB A;  5M1P A;  4DV7 K;  4CJS A;  3QES A;  1RDA A;  4JD2 A;  3HM8 A;  1IKV A;  4BC5 A;  3AO5 A;  3C7N B;  3D2F A;  5AQR A;  3SQ4 A;  2GTD A;  4FZY A;  4FJI A;  4DTJ A;  1FKO A;  4N5S A;  1NNE A;  4KTW A;  4O8U A;  2AA4 A;  3VQD A;  4BR2 A;  2KKZ A;  3HT3 A;  1QHA A;  1VSF A;  3QO9 A;  3ATU A;  2V7Y A;  5FRO A;  4BE1 A;  4I9Q A;  3OS1 A;  3CQX A;  1EWQ A;  2NRZ A;  2EX3 A;  3ZT4 A;  4FK2 A;  1VQ8 N;  3H1V X;  2QK9 A;  2O8E A;  4GKJ K;  3SQ2 A;  2YHY A;  1JJ2 M;  2YNF A;  4CI6 A;  3J7Y P;  5HRN A;  2ZJP L;  3D2E B;  3C6U A;  2RN2 A;  3DXM A;  4CZE A;  5AQJ A;  5C42 A;  1X3M A;  3B6O A;  4H8K A;  2F7T A;  3IG1 A;  1U47 A;  4KPY A;  4OLA A;  1BIS A;  1KAX A;  1KCF A;  4KKO A;  3IRX A;  4CEB A;  4DU1 A;  2YV0 X;  3U4L A;  4M41 A;  5C15 A;  1VSL A;  2YNI A;  5LMN K;  4OPH A;  1OVY A;  1KLN A;  3MXJ A;  1NGG A;  1ZBU A;  1W9H A;  1BHL A;  3SUN A;  4Z4H A;  5HOO A;  2UXB K;  2E6L A;  3FZK A;  2NRH A;  1HR0 K;  4O0I A;  4N76 A;  4Y1C A;  1S6P A;  1NU0 A;  4ELV A;  2D0O A;  3QEI A;  4GNI A;  4CCH A;  1NJY A;  3L4Q A;  2PBD A;  3V1Q A;  1VQ7 N;  1SAZ A;  4JAX A;  2P5G A;  4RTF D;  2P9S B;  2YHX A;  5GIN A;  3UKU B;  3OJU A;  3SMS A;  1SS6 A;  4CHO A;  5BPN A;  4BRQ A;  4E19 A;  5DK5 A;  3L2U A;  1Q9X A;  4HTL A;  3CPW M;  3PO5 A;  1S3X A;  1A5X A;  1QE1 A;  4OGE A;  5SWM A;  3K58 A;  3KZB A;  3PIO L;  3RRG A;  1E4G T;  5DM6 L;  1VQ6 N;  3VER A;  2E6M A;  5HRO A;  3LM2 A;  1NK7 A;  2E5L K;  1WUA A;  1VHX A;  3KLG A;  2Q0U A;  1ZBF A;  1BU6 O;  3EN9 A;  1GLE G;  3HBT A;  3CC2 N;  4PUO A;  3LAL A;  5EXW A;  1QSL A;  4YOT A;  5C24 A;  3Q7B A;  2OPS A;  3VQP A;  1KQS M;  5GAD P;  4H0T B;  2QEX N;  1VSI A;  3LDS A;  3F2K A;  2ZJQ L;  3DLE A;  4IJN A;  3SBT A;  4C8N A;  2ZM6 K;  3VQQ A;  3E9P A;  1OH7 A;  4A61 A;  4B9S A;  4FWP A;  1HRH A;  3MN9 A;  4JI6 K;  2QWN A;  3CER A;  2HVI A;  2QM1 A;  3HRG A;  3HI0 A;  5H1S Q;  3WQU A;  3AGR A;  1NGH A;  4JRP A;  3FZF A;  3G25 A;  4BRP A;  3THW B;  4BGA A;  5M1N A;  3SYZ A;  1U6Z A;  4B8A B;  3LAM A;  2OZS A;  1W2B M;  4Q0B A;  1IKX A;  2OZM A;  3OYJ A;  3ZSQ A;  2HF3 A;  1BCM A;  4BQZ A;  5BR8 K;  4FM2 A;  2A41 A;  4CZJ A;  1YJ9 N;  1RBT A;  4FLY A;  4IKF A;  3NH2 A;  1LW0 A;  5M1O A;  4JI3 K;  2WON A;  1G99 A;  4RW7 A;  3BF1 A;  3E01 A;  2VG5 A;  1N36 K;  1KLM A;  5AFU H;  2JWK A;  1RDD A;  1TYQ B;  3PSI A;  5KPR A;  3VA0 A;  3AAR A;  3D6R A;  2R7Y A;  1S6Q A;  1GLJ O;  2Q1N A;  3DI6 A;  2LSN A;  4KHN A;  3FZL A;  4BRM A;  3HP9 A;  3O1W A;  4HUE A;  2IIR A;  2D0P A;  1NGB A;  3WNF A;  3SMP A;  3THV A;  3MX5 A;  3AO2 A;  3C94 A;  1L3T A;  3L3U A;  1ASU A;  2RF2 A;  3IKM A;  2KLA A;  4BRI A;  3ZT3 A;  4W5Q A;  4CED A;  2HHT A;  1KAZ A;  4XH5 A;  3RSE B;  2PAV A;  2Z1G A;  4QS8 A;  4O8K A;  2E1Z A;  4MO5 A;  5AQV A;  1YUW A;  3VGL A;  4WFB L;  1VQK N;  4B9M A;  1CLQ A;  2E2Q A;  4IFY A;  2QTD A;  3CJC A;  3R1X A;  3ULD A;  2ZE2 A;  4NYN A;  3KLH A;  3ZSZ A;  4NXM K;  1JCF A;  3D7E O;  3O9U A;  3U8X A;  3KTQ A;  4ID5 A;  3F9M A;  3SAG A;  3ID8 A;  4H0Y B;  1ATN A;  2RKI A;  1EX4 A;  4DTR A;  1ATS A;  4FYD A;  1NWK A;  3ZSW A;  3T3F A;  2E2O A;  5F2R A;  2O8D A;  4Z4E A;  4WFA L;  1N32 K;  3L0Q A;  2F4V K;  1GLB G;  2GWJ A;  4DV5 K;  1NK9 A;  3QBX A;  3H1Q A;  1C1B A;  4AHT A;  1YTA A;  2P9L A;  2ZQB A;  3TAP A;  1BCO A;  1FK9 A;  5AQY A;  2PZS A;  1WOQ A;  3SV3 A;  3LWL A;  5JVG L;  3ULE A;  3FZM A;  4KB0 A;  3LDO A;  2HNZ A;  1NGD A;  5AQS A;  4CF2 A;  4CF0 A;  3MEE A;  5LJV A;  1IG8 A;  4YOW A;  1XC9 A;  4AH9 A;  4JV5 K;  1WSG A;  3L4I A;  3HOS A;  4BR0 A;  1KVA A;  4N56 A;  3PUF A;  5AQK A;  5M1F A;  3SJJ A;  5JVH L;  2ZGY A;  4CHZ A;  3VEO A;  5BRF A;  5ELZ A;  3AA3 A;  5J2M A;  5AQH A;  2BTF A;  4JKA A;  3O8M A;  4XH1 A;  3HO1 A;  2UXC K;  1S1W A;  3HTV A;  3JSM A;  1SKR A;  5AQL A;  3VQB A;  1L3S A;  3CM6 A;  1MA9 B;  2QA4 N;  2GUI A;  3U9D A;  3QEV A;  3UIQ A;  4WE1 A;  4A57 A;  5J2P A;  4I6M B;  4CHN A;  3Q7C A;  3T69 A;  3MXI A;  2KTQ A;  1J5E K;  1YAG A;  3EKS A;  4AHV A;  2Q2R A;  3T1H K;  2P9U A;  3FE1 A;  3BUZ B;  2XY8 A;  2DFE A;  5F0X A;  1RGI A;  1BGX T;  1F21 A;  4ZTJ A;  3QEW A;  1BI4 B;  4NO7 A;  2HNY A;  3SV4 A;  5AQX A;  4DQP A;  3VEW A;  3EY1 A;  1TKT A;  1W7A A;  4FVU A;  3MED A;  5BPM A;  1NGC A;  4JLH A;  4DR5 K;  4WYB A;  3O5B A;  2DTU A;  4PKI A;  4KBO A;  2EWS A;  1KC8 O;  4HVJ A;  3EE8 A;  1Q81 O;  3AY9 A;  4BRH A;  4JS5 A;  1JLE A;  2Y1I A;  2O8B B;  1SQK A;  1HJO A;  1JLF A;  5C0Y A;  4DTS A;  1YJW N;  1FJG K;  3OTO K;  4CJ3 A;  4H0O A;  4N41 A;  3LL3 A;  5GIO A;  2XY5 A;  3VPZ A;  2W40 A;  1U2V B;  3CIP A;  3L2W A;  3VQ9 A;  4NCG A;  1VQN N;  1U49 A;  4MO4 A;  5F1X A;  4W5N A;  3DLG A;  4TSX A;  1R0A A;  1ZYQ A;  2CH6 A;  2O8F B;  4GY2 B;  4FJG A;  4F4K A;  1TAU A;  1QHT A;  4FJH A;  2QWL A;  3CCV N;  1I94 K;  4X66 K;  4B1X B;  4BDY A;  5GIP A;  5AZJ B;  1RT7 A;  1J54 A;  3MK6 A;  4M3R A;  2B4J A;  4N47 A;  4YNQ A;  1SL1 A;  1ATR A;  1X9M A;  3HJF A;  2JGU A;  1HLU A;  3O9Q A;  4E1M A;  1NMD A;  2QWP A;  2QXL A;  3ISN C;  3U3Y A;  4FK4 A;  1M1K O;  4CJT A;  4C1N I;  4PWD A;  5AZI A;  4M3Z A;  3U9Z A;  4B9L A;  3AVC A;  3HL8 A;  2NRT A;  3ZYY X;  3ZT0 A;  5HLF A;  1WAJ A;  4OPA A;  1SKW A;  4DR2 K;  4B1V A;  5M1Q A;  1ESV A;  2WTU A;  2IC3 A;  3L6Q A;  2V7Z A;  3BZC A;  3SJH A;  4OPK A;  5E26 A;  1FKP A;  4A2A A;  1WBB A;  1P8Z A;  4CE9 A;  1Z6R A;  4OKE A;  2VGN A;  4GKK K;  4E1N A;  3A5M C;  4JNE A;  4OLB A;  1KSP A;  3SBG A;  3LPT A;  3K9K A;  3B6P A;  5GAE P;  3PX6 A;  1VRT A;  3HK2 A;  3E1Y A;  4RCH A;  4LH4 A;  3C0B A;  4E1J A;  4IEE A;  1EET A;  4BR5 A;  3AVM A;  1S9G A;  4OO1 J;  4YFU A;  1S9E A;  3A5L C;  3QIC A;  4DQI A;  3PX4 A;  4EZ9 A;  4FW1 A;  2VWK A;  3KD1 E;  3CM5 A;  3F9K A;  3MAQ A;  1ITG A;  1GOA A;  1U45 A;  3M5R A;  2GUP A;  4BRF A;  4CZL A;  4CIE A;  3ZET A;  4EHT A;  3LZJ A;  3DLH A;  4CJV A;  1NGJ A;  1BL3 A;  3CHW A;  4DUY K;  5DMR A;  4IFE A;  4DR4 K;  4Z4C A;  1K9M O;  1HKB A;  3OYM A;  4E7L A;  3MEG A;  3J7Z O;  3DYA A;  4ZTF A;  5J1E A;  3CCM N;  5EU7 A;  4FWN A;  1RDB A;  4DR7 K;  3O3G A;  2BH1 A;  1RBS A;  4FZZ A;  2HBJ A;  4NB4 A;  3DLK A;  2P9I B;  4DG1 A;  4W5O A;  3M3Z A;  4JHD B;  4C8K A;  3VEV A;  4WFN L;  2F8S A;  4DF4 A;  3WEE B;  4E7H A;  4CEO A;  1KXP A;  4C8M A;  2FC0 A;  2RPI A;  3QBW A;  3QNO A;  2CGJ A;  4AHU A;  3TAQ A;  3E9L A;  2VQE K;  4LH5 A;  3VQ6 A;  2P51 A;  2UUB K;  3M6G A;  3HVR A;  3K59 A;  2ETJ A;  3KK1 A;  3BEX A;  2B6A A;  3QIN A;  4BWJ A;  3V9X A;  1EO1 A;  2YJF A;  4M3T A;  3ATV A;  1Z25 A;  3VOV A;  5AFU A;  4DUZ K;  4RWT A;  2QXF A;  3MWP A;  5I42 A;  3FR0 A;  4A59 A;  2E1Y A;  1XQS C;  3FFK B;  3H3N O;  2HND A;  2I7N A;  1WSJ A;  3HP6 A;  3PLA A;  2D4W A;  1T6D A;  2P9P B;  4MFB A;  2F9T A;  3K5M A;  1QVG M;  1WSE A;  4BWM A;  3GE1 A;  3OJS A;  4MDB A;  2I5J A;  4BE2 A;  3THX B;  4L3Q A;  3U6F A;  4BVP A;  3AVN A;  2BDP A;  4YDU C;  2OYQ A;  3CCE N;  4CFA A;  4DQQ A;  1NGA A;  1KFD A;  1T3V A;  3SUO A;  1LOT B;  4I7F A;  1HYS A;  5LY3 A;  2A5X A;  4DU4 A;  2HHU A;  1VSJ A;  3KKR A;  4JI2 K;  3K5O A;  1VQO N;  2G8H A;  4YDU A;  1WN7 A;  5FDL A;  2OCE A;  3P1G A;  3I56 N;  5M1K A;  4KHW A;  1N8R O;  4FVM A;  2FSJ A;  4DFM A;  4B9T A;  4JN4 A;  1C0T A;  1YT3 A;  3VQE A;  3PIP L;  3LPU A;  1XMQ K;  4K25 A;  1X9W A;  3NF8 A;  4DSI A;  1X9J A;  1G15 A;  1RDC A;  5JS1 A;  1JXB A;  1VSK A;  3C6T A;  1JXE A;  4ILG B;  4GVM A;  1YHQ N;  3RRH A;  4IXC A;  3EL2 A;  4FPB A;  3OYH A;  1ZBS A;  4E7J A;  2HMI A;  2WFB A;  1U4B A;  3G0Z A;  4RW6 A;  1ZBL A;  4DTU A;  3NGI A;  4CZK A;  3CCU N;  5GAH P;  4FWM A;  4BG9 A;  2ATQ A;  3PX0 A;  3AO4 A;  4B3R K;  4CEC A;  5BPL A;  1P90 A;  5FPE A;  2O8C A;  4CJ7 A;  3VES A;  4GVE A;  2HMP A;  4B9V A;  4DLE A;  1Q82 O;  3TTD A;  3IUC A;  2HVH A;  2NRV A;  2GWK A;  3UKR A;  4YOU A;  4M63 C;  3NE6 A;  4CZM A;  3WXI A;  4JKG A;  3VF2 A;  1TUU A;  5KQD A;  3E9O A;  3PO4 A;  3LAK A;  2X6N A;  1SZ2 A;  2IGI A;  1NK8 A;  4CK2 A;  3BY5 A;  1SKS A;  1LWF A;  1Q86 O;  4ISE A;  4FOI A;  1FXX A;  4CHQ A;  4G9Z A;  2ITG A;  3VN5 A;  4F2R A;  5KPT A;  4H0X B;  4HWI A;  4KH4 A;  1TKZ A;  4U7B A;  3WT0 A;  4F8R A;  2Q3S A;  4DV3 K;  1IG9 A;  3AAQ A;  4Z4F A;  4I2Q A;  4EFH A;  4BRA A;  2P9N A;  3ZEU B;  4DQ8 A;  3TSQ A;  5LJW A;  1EQY A;  1SL0 A;  4H03 B;  1RTD A;  4K8Z A;  4WQ5 C;  1NKC A;  3K5N A;  4LF7 K;  2UXD K;  4IJA A;  3J80 O;  1K8K B;  1JLA A;  3P83 D;  4A5A A;  2Q0R A;  3KHY A;  4JI4 K;  4B1U B;  1LW2 A;  4CJL A;  3N4Q A;  1J53 A;  4WQ5 A;  2XO7 A;  3OYD A;  4BR9 A;  4FLW A;  3A5O C;  4DV4 K;  5KQ8 A;  3AAP A;  1NJW A;  3DMJ A;  4KHQ A;  3DLB A;  3JYT A;  3O4W A;  1X3N A;  1JKH A;  2HB5 A;  2ZWH A;  2QKK A;  1IBM K;  1BUP A;  3OYE A;  4AHS A;  2PYL A;  4EP4 A;  2Z1I A;  4DS4 A;  2G8W A;  1HUX A;  4LFA K;  4IG0 A;  2D0A A;  2VCP A;  4B3M K;  2O8B A;  1BA0 A;  1GLA G;  3TAF A;  3THY A;  1TKX A;  3CC4 N;  1JCG A;  1VQ9 N;  1LWE A;  3WNH A;  4NLC A;  3P39 A;  3NAE A;  3SUP A;  1Y64 A;  1KVB A;  3HXM A;  1GOC A;  3GG4 A;  3LM9 A;  1U2V A;  1S1V A;  1WB9 A;  2UUC K;  2D1K A;  3AVA A;  4FWK A;  4PHT X;  1L3V A;  1QSS A;  4BRD A;  5JLF A;  4DSE A;  3LP1 A;  5FLX O;  1NKE A;  1C1C A;  2F8T A;  3DXK A;  3CCL N;  2QWO A;  1RFQ A;  3EEQ A;  3NH0 A;  3R6M A;  5AZJ A;  3H3O B;  3OW2 M;  5C2D A;  3DRR A;  3V9W A;  3D0P A;  5KRT A;  1CXQ A;  4DHY A;  3OS0 A;  4GV3 A;  1K73 O;  3NF6 A;  1HKG A;  4FJJ A;  3U3G A;  4F3O A;  2WOM A;  2O4I A;  5KRS A;  4JD2 B;  5HBM A;  3G71 N;  4RW9 A;  3TSP A;  4UY8 O;  4LY7 A;  3D2F B;  1RNH A;  4JKD A;  3H08 A;  4QS7 A;  1YIJ N;  3MDQ A;  4DTO A;  1IV0 A;  2Y1J A;  1GLF O;  3AV9 A;  2UU9 K;  1NJX A;  4ICL A;  4X64 K;  1I3A A;  2OTL N;  1DEJ A;  4JI1 K;  1ASW A;  4CJF A;  2O8E B;  3AVG A;  1LV5 A;  4KFB A;  4NXN K;  5BRE A;  5FRN A;  4WF9 L;  5AQQ A;  3DXM B;  1OVQ A;  3MN7 A;  2XRI A;  3DLL L;  1HNZ K;  3LDP A;  5CHI A;  3MWT A;  3T1A A;  5HRS A;  3AVK A;  4DTM A;  3L2R A;  4NLB A;  3SLC A;  4ZHR A;  1TK5 A;  5HRR A;  2YI1 A;  5LL6 Z;  3LWM A;  1NJZ A;  3BDP A;  4C1N K;  2A42 A;  3P4I A;  2AP1 A;  3OYG A;  4FM1 A;  1LAW A;  4HCB A;  2Q31 A;  3NFA A;  4CZG A;  3EKU A;  4EAH D;  4M7X A;  3QML A;  2HHH K;  3QET A;  3UB5 A;  4F9O A;  1J5O A;  5IT9 O;  2ASM A;  1EP4 A;  5C12 A;  4DFJ A;  1N33 K;  4CEQ A;  2HHV A;  3AVB A;  4W5R A;  2FXU A;  2A1R A;  2A3Z A;  1QTM A;  2GEM A;  3SCX A;  4FJ5 A;  4JK9 A;  4HCC A;  1QSY A;  3D45 A;  1YVN A;  5AQN A;  3V9S A;  4ILJ A;  5BRH A;  1NGE A;  4B9N A;  3R3L A;  4IZ9 A;  1A5V A;  1KAY A;  3HST B;  3CCJ N;  1V4T A;  4X65 K;  4FJM A;  3VQA A;  3CFP A;  5J2N A;  4RW4 A;  4BC3 A;  2IOC A;  1KD1 O;  3ZT2 A;  4CW7 B;  1CZ9 A;  1WLJ A;  3BGR A;  1WSH A;  3DRP A;  3SI6 A;  3S3O A;  1HNW K;  1T03 A;  3QIP A;  1S72 N;  3PSF A;  4FXD A;  5MLC Q;  4DSL A;  3NVM A;  3VQ5 A;  4GV9 A;  1QQM A;  1XWL A;  2FF3 B;  3EO3 A;  3LAN A;  4BGB A;  4M42 A;  3I8B A;  1RT5 A;  3RVC A;  3QER A;  2Z1H A;  4FPA A;  2HHX A;  4DF8 A;  3IDH A;  3UE5 A;  1MU2 A;  2DPN A;  2NRX A;  2A6A A;  4IO9 L;  3KWI A;  1HMV A;  4BRL A;  5C2F A;  2PFU A;  1S22 A;  2KHO A;  3JAM O;  1JLB A;  4KV8 A;  4BRN A;  1Q7Y O;  3WNG A;  1T7P A;  3CFR A;  3CF5 L;  3C6H A;  5JIC A;  2O4G A;  1BQM A;  3J81 O;  1BG3 A;  2CGK A;  2KZZ A;  2ITM A;  1QQC A;  2QWQ A;  1OH5 A;  3OYN A;  2ASP A;  3CJ1 A;  1YJN N;  1IBK K;  2D0C A;  3WXM B;  1VQ4 N;  4MLH A;  2G8U A;  3VTI A;  1BO5 O;  4DLG A;  4PL7 A;  3C7N A;  1QS4 A;  2E20 A;  1RT1 A;  4FJN A;  3DOK A;  4LSL A;  2FBV A;  4YY3 K;  5BN9 A;  2E88 A;  4KRE A;  2QWM A;  2KW4 A;  3RMB A;  3WQT A;  3OY9 A;  3OYC A;  2ASO A;  3I0S A;  4I9L A;  1D4X A;  3OYI A;  1E3M A;  4CGH A;  3QNN A;  1ILY A;  3SK3 A;  3VTH A;  3C95 A;  1H1V A;  1WBD A;  2NNW A;  3NGY A;  3C6A A;  5CR4 A;  1BQN A;  5CYQ A;  3SUQ A;  1VSH A;  4QOZ B;  1UWB A;  4FWO A;  5JS2 A;  2JLE A;  3AA5 X;  4H5W A;  3D2E A;  2OPQ A;  5AQF A;  2YHA A;  3J7A P;  3ZSO A;  4JS4 A;  1TV6 A;  4Z0U A;  1VSE A;  4BDP A;  3FLC O;  4K0K K;  2W41 A;  3CXC M;  2E2P A;  4BC4 A;  4FWQ A;  4J2E A;  3LP0 A;  3VF6 A;  5AQI A;  4M3Y A;  2YCH A;  3OHR A;  4KHU A;  4B08 A;  4IBN A;  1RCH A;  2OTJ N;  2IVO A;  3I8D A;  3TTC A;  4CBX A;  5E41 A;  3KD5 E;  4YOV A;  1S1T A;  3DJC A;  4FOE A;  2X78 A;  2CGL A;  1OH8 A;  4B1W B;  2E2N A;  1EKE A;  4CZH A;  1TVR A;  3ALY A;  5KGX A;  4MLE A;  3ASM A;  3IS9 A;  4O44 A;  5C25 A;  1TAQ A;  4BY9 C;  4KHS A;  3TAB A;  1VSM A;  4RW8 A;  4UQG A;  2O8D B;  3LP2 A;  1HQE A;  4ISG A;  2P9S A;  1JLG A;  5AQO A;  4H0V B;  3UKU A;  3QB0 A;  2P9L B;  5E84 A;  3NF7 A;  4CFD A;  1J9A A;  5BN8 A;  3I55 N;  1VQL N;  4JI7 K;  4CK3 A;  4FJ7 A;  3CJB A;  3M8R A;  3HSC A;  4AM6 A;  3TAE A;  3ULE B;  1IBL K;  3AVJ A;  1NK5 A;  3O08 A;  5AQU A;  3P31 A;  1REV A;  3AA4 A;  1RDW X;  1BWF O;  4CBW A;  1QQN A;  4BVO A;  1SUQ A;  3O3H A;  3ZSV A;  3VET A;  1HJR A;  4KAZ A;  4A2B A;  4E3S A;  3KVG A;  1HYV A;  2VG6 A;  4MQ3 A;  4HHT A;  3ENH A;  5JMV A;  3O4Q A;  3JS6 A;  3AO3 A;  2NZT A;  4LFB K;  3HOT A;  2ZF5 O;  4DCH A;  4CES A;  3DOL A;  4B1Y B;  4CEF A;  1VRU A;  2FBX A;  3M8P A;  3MXM A;  2IVN A;  2GEL A;  1IJJ A;  5FPN A;  4KHP K;  4IDH A;  1X1P A;  2P9U B;  3CFO A;  4HUF A;  4LSN A;  3QLH A;  2ZD1 A;  3QDK A;  3CG7 A;  3HPO A;  1XHZ A;  3N4P A;  4CD1 A;  3KLE A;  2Z1J A;  2VG7 A;  1RBV A;  3KWG A;  3ITH A;  4MDA A;  2NRR A;  3AVH A;  4E89 A;  3F73 A;  3RMC A;  1M90 O;  3THW A;  3BP8 A;  4O55 A;  4DS5 A;  4OPJ A;  3OYA A;  4ILH A;  5CY4 A;  3RMA A;  2FSN A;  3T1Y K;  3HVT A;  2EHG A;  1FW6 A;  1RTH A;  1BOT O;  3S3N A;  4KH5 A;  3DAW A;  3NBP A;  4M45 A;  3GOI A;  3J8A A;  3AVF A;  3T19 A;  2W42 A;  4CJQ A;  4CF8 A;  3SPZ A;  3O3F A;  1RT4 A;  2GBZ A;  4W5T A;  2QI2 A;  1TYQ A;  2KQ2 A;  3RMD A;  1X9S A;  3GDQ A;  4CIG A;  4M3U A;  4CGI A;  5SZT A;  2WBN A;  3L2Q A;  3TSU A;  2VWJ A;  4DR6 K;  1KFS A;  1NJI O;  1B9D A;  3HM9 A;  3LDL A;  4KH6 A;  1XNQ K;  4JK7 A;  2KZM A;  3VMF B;  4KRF A;  1DTT A;  2FLO A;  2YKM A;  3O1B A;  4Y0W A;  4BQL A;  4CGJ A;  4JEP A;  1XNR K;  2P9K B;  1S1U A;  3ZX2 A;  1VQM N;  1Q8I A;  3K9J A;  5FPD A;  1Y97 A;  3RSE A;  4CIF A;  5AR0 A;  2I7P A;  4WCE L;  4JI0 K;  1NOZ A;  4H5N A;  4DR1 K;  4IEI A;  3OA9 A;  2HST A;  5AZI B;  3NMU A;  1D8Y A;  3DM2 A;  3OS2 A;  5A2Q O;  1ZBI A;  4NCB A;  1T8E A;  1SL2 A;  4Y1D A;  3QEX A;  2BAN A;  4OKJ A;  1RT6 A;  2WUS A;  4ISF A;  3ID6 A;  4CJR A;  4QCL A;  4C8O A;  4FJK A;  5ADX H;  1XI1 A;  2W6L A;  4KI6 A;  1Q18 A;  1W97 L;  1UA0 A;  1VSD A;  2FBY A;  3ZLJ A;  1TKD A;  1DGK N;  5BRD A;  1ZC6 A;  3G6E N;  4ID1 A;  3G10 A;  2NLX A;  3MEC A;  4DFK A;  3ENB A;  4CEE A;  2XY7 A;  3K2P A;  3K5L A;  1BIU A;  3V1O A;  4CER A;  3EZ5 A;  4CK1 A;  1RBU A;  3JXU A;  1ZXO A;  3VEX A;  4K41 A;  1CZB A;  5FRM A;  4DR3 K;  4DQR A;  1YTU A;  2BE2 A;  2RE2 A;  3TTF A;  4FCY A;  4YOX A;  4B9Q A;  3W0L A;  4B3S K;  1VK0 A;  2OPP A;  4YOY A;  3QFU A;  4CVN E;  4FO0 A;  3GL1 A;  2GV9 A;  3ZET B;  4DV6 K;  1O13 A;  4LF6 K;  1RT3 A;  4J2D A;  4CJK A;  1LAV A;  1WNS A;  1U48 A;  5LMU K; 
#chains in the Genus database with same CATH homology
 4X62 K;  1HNX K;  3JAM O;  5LMN K;  1XMO K;  4AQY K;  4V19 S;  1IBM K;  4DR6 K;  2UXB K;  4JI7 K;  3J81 O;  1HNZ K;  4JYA K;  5BR8 K;  1HR0 K;  5IWA K;  4LFA K;  2VQE K;  4B3M K;  1XNQ K;  2UXC K;  1IBL K;  4LF9 K;  4JI3 K;  1IBK K;  4B3R K;  4YHH K;  5LL6 Z;  4DR2 K;  1N36 K;  2UUB K;  1XNR K;  5AJ3 K;  2UUC K;  4JI0 K;  4DR1 K;  1J5E K;  4YY3 K;  2HHH K;  4LF8 K;  3T1H K;  4DV1 K;  5IT9 O;  1N33 K;  4DUZ K;  5FLX O;  4OX9 K;  5A2Q O;  4DV7 K;  4GKK K;  4LFB K;  4DV0 K;  2UUA K;  4LF4 K;  4LFC K;  4DR5 K;  4KHP K;  2E5L K;  4B3T K;  4X65 K;  4DV3 K;  4JI5 K;  3J7A P;  4LF5 K;  4DV2 K;  4NXM K;  4CW7 B;  4K0K K;  1FJG K;  3OTO K;  4JI2 K;  1HNW K;  2VQF K;  4DR3 K;  4GKJ K;  4DUY K;  4JI8 K;  1N32 K;  2F4V K;  4LF7 K;  2ZM6 K;  2UXD K;  3J80 O;  4DR4 K;  4DV5 K;  3J7Y P;  4JI6 K;  4JI4 K;  1N34 K;  4B3S K;  2UU9 K;  4X64 K;  1XMQ K;  4CVN E;  3T1Y K;  4JI1 K;  4DV6 K;  4LF6 K;  4DV4 K;  4DR7 K;  1I94 K;  4X66 K;  5LMU K;  4NXN K;  4JV5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...