4NXNK

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4nxnK00
5LL6Z 4X66K 4DV5K 4LFBK 3J7YP 4LF9K 4YHHK 1I94K 4JI0K 2F4VK 4LF6K 2VQEK 4DR1K 2UXBK 2UU9K 4DV6K 4JV5K 4DR5K 2UXCK 1XMOK 1XNRK 3OTOK 4DR7K 4X65K 4NXMK 4DR6K 4B3RK 4GKKK 4CW7B 4DUZK 1IBLK 4DUYK 4JI8K 4CVNE 2UUAK 4JI2K 2UUCK 2HHHK 4LF4K 4JI4K 4LFCK 3J81O 5LMUK 4JYAK 4GKJK 3J7AP 3T1YK 4DR2K 2ZM6K 4DV3K 3J80O 4X62K 4NXNK 4LF7K 5FLXO 4JI5K 4X64K 4B3MK 4YY3K 4JI1K 4DV0K 4B3TK 4LF5K 5AJ3K 4DV2K 5IWAK 1XMQK 1N32K 4LFAK 4DR3K 4B3SK 3JAMO 2UUBK 4AQYK 3T1HK 1N33K 4JI3K 2E5LK 1HNWK 4DV4K 1HNZK 5IT9O 1IBKK 1HR0K 4JI6K 4OX9K 4DV1K 4K0KK 2UXDK 5LMNK 4DV7K 1FJGK 1N34K 1HNXK 4V19S 5BR8K 1N36K 4DR4K 4KHPK 2VQFK 1XNQK 5A2QO 1J5EK 4LF8K 1IBMK 4JI7K
chains in the Genus database with same CATH superfamily
4GY2B 2EHGA 3IUCA 4DV5K 3KKSA 2ETJA 4DF8A 3CFPA 3KD5E 2IGIA 1WBDA 3SK3A 4AHVA 2RE2A 3CM6A 2UXBK 3CJ1A 3RMBA 1BQMA 3P1GA 1T8EA 3ULEB 3KK1A 5ELZA 1YJNN 4FM2A 3ZEUB 3IMXA 3MDQA 3HOTA 4GKKK 1IBLK 1U2VB 3L2UA 2QWLA 4B3OA 1IKVA 4CVNE 4AH9A 1JLCA 3ZSXA 1NJWA 2BH1A 4BVPA 3QNNA 4LF4K 3ZEUA 1L3UA 1R0AA 2XO7A 3NBPA 2HOEA 3R8EA 1RDAA 4FSVA 5M1OA 1DT9A 5C25A 3KK3A 1U2VA 1WNSA 3IKMA 4CHOA 5AQKA 3CYMA 3SMPA 1XI1A 2VGMA 2F8SA 3NF9A 2HBJA 3MEGA 1RT1A 3ZSRA 3BZKA 3KWGA 3QDKA 2X74A 4Z4CA 2KKZA 3FFIA 2OA8A 1FK9A 1I3AA 3C0BA 3ZX0A 1NOYA 4BR4A 3F9MA 2B6AA 3QIOA 4PHTX 1C1AA 4IO8A 1UWBA 3FZHA 2P9UB 5J1EA 1FKPA 4CERA 1KC8O 5I3UA 3VQBA 5AQGA 3T1HK 3HP6A 4F2SA 3V9XA 1CXQA 4FWOA 4CEOA 4CJTA 3RTVA 1X9WA 3L3UA 1HLUA 3RR7A 1Q8IA 5BR9A 1HNVA 1IBKK 4BDZA 2P9UA 1EXQA 1P8ZA 3A2FA 4J2AA 3QB0A 4Z0UA 4DQRA 2W6KA 2O8FB 1UAXA 3CCJN 3K5NA 4FK0A 2RKIA 1IBMK 2W41A 5LL6Z 1KCFA 1E3MA 4X66K 4CZGA 4OPAA 3QEWA 3NGYA 4H4MA 1I94K 3PX0A 4CZFA 3U4LA 2O8FA 3AVJA 1ATNA 1LOTB 4Z4FA 2WONA 3G10A 3M8PA 2ASPA 2FC0A 4KHNA 4FJGA 4HUGA 5CYQA 4CJSA 1HNIA 4OLAA 4G9ZA 2Z1IA 1X9JA 2E1ZA 4PL8A 3ZLJA 5JVGL 4B9LA 5EU7A 3VGKA 3NH1A 4Z4GA 3JXUA 4CF2A 2G8WA 1BHLA 1HRHA 1VSIA 4BRLA 4JI4K 4YORA 3WNFA 4H0YB 3VN5A 1HJRA 3F2KA 5AZIB 2Y1JA 3S3NA 4FOIA 1VAZA 1NNEA 4B9TA 3ZT2A 4CD1A 4K8XA 1U6ZA 1JLQA 1NJYA 4BVOA 1KAYA 3D6RA 4LSLA 3TARA 3P39A 1UA1A 2BDPA 1BO5O 4OVLA 4QS7A 1VSJA 5AZIA 1YHQN 1BI4B 1QVGM 4CZEA 4JI1K 3LP3A 3SUQA 4JHDB 2D0CA 4CBXA 3L2QA 2QEXN 3E1YA 1MU2A 3K0SA 2NRVA 3MWTA 3A5LC 4FJKA 3S3MA 2PFUA 4A61A 4OPJA 1VQKN 2EX3A 5C10A 4M42A 3D2EB 2PYLA 2UUBK 1BI4A 2IS3A 4BRPA 2GEMA 5M1KA 4JHDA 1WSJA 2GX9A 1C1BA 3GG4A 3VERA 3L2WA 1DEJA 5T7BA 1GLEG 1GLLO 5LMNK 3O9QA 2G8VA 1QHTA 3LZIA 2E6LA 3D2EA 4M7XA 5BR8K 1K8AO 4MLHA 4B1UB 1XNQK 1NJZA 3DM2A 4KB1A 1WLJA 4DQPA 5BN9A 3C6TA 5AQJA 3TWHA 4E89A 2A6AA 3MXJA 4E1JA 2F7TA 3PX4A 4LF9K 1DLOA 2V7YA 4CZIA 2GTDA 3WT0A 4A2AA 1JLFA 4BRMA 3EYZA 3CFRA 4ZTJA 2OPSA 1A5VA 1S3XA 5BRFA 1HKGA 2DFFA 4B3RK 2P51A 2CGJA 1S1WA 4IOCL 4OPHA 4DTXA 2X6NA 1YVNA 2D0PA 3MAQA 2HHHK 1BA0A 1ATSA 4BACA 4FJHA 4J2BA 3K5LA 4F3OA 3J81O 1RCHA 4H5NA 3QFPA 3K2PA 1ZBFA 4WQ4C 3VENA 4Y0WA 1B9FA 4FM0A 4I9QA 4M45A 4NLCA 4NO7A 3ZT1A 3T1YK 2IC3A 5AQYA 2IVNA 1ITGA 3ZSOA 4BE1A 5HRPA 3RWUA 1GLBG 1VSKA 3CCQN 1MWMA 1TUYA 1C1CA 4X64K 1XQSC 3ALYA 4B3MK 4YY3K 3PO5A 3BF3A 1R59O 4KTQA 3QEPA 2BUPA 3U9ZA 1S72N 1RDBA 4QS9A 2P9IB 5IWAK 4DU3A 1HUXA 1RDDA 3SQ1A 3UIQA 4DSLA 4DR3K 3ISNC 3U8XA 1U04A 4KAZA 3ATVA 3V1QA 4LD0A 1NK9A 1KAZA 4DFPA 1NGBA 4O55A 2E4LA 3KD1E 2P9IA 3VF2A 1JCEA 4PKHA 3HTVA 2FSNA 4JAXA 1D8YA 3P38A 3ID6A 4DF4A 5AQLA 2YKMA 4FJ9A 3QICA 3ZSQA 5E26A 5AZJB 2QTDA 2P5OA 3BF1A 4F4KA 4LFBK 2Z1JA 4DTNA 5KGXA 2QWPA 4OKJA 5F2RA 3DWLA 5HLFA 1NGEA 1X3NA 1IV0A 1TUUA 3SAGA 2NRTA 4CGGA 4BRIA 2KTQA 1KVCA 5AZJA 1VHXA 1Q9YA 5JS1A 3LDNA 1QS4A 1YXQA 2Q36A 3MEEA 3G4SN 4GV6A 1TGOA 4IFEA 1YI2N 3GE1A 1VQ8N 1J53A 3K59A 5FROA 2AA4A 4PA1A 3WXMB 3O6WA 3I55N 4WQ4A 4CJUA 1U4BA 3VEVA 5DM7L 2HF3A 1BUPA 3AVMA 4CIEA 4BY9C 3QEXA 4LFCK 3L8BA 3CG7A 2D5RA 3I56N 2ZQBA 2ITGA 1TK5A 3SV4A 2G8HA 2HHUA 4DTMA 2WFBA 2KZZA 3CFOA 1UOCA 2B5JA 3CCLN 4X62K 2O4GA 3PY8A 2NRXA 3H08A 4PUOA 2B4JA 4KH5A 3JYTA 3E01A 2HVIA 3CJAA 4KV8A 1T6DA 3TAGA 3SPZA 4NCGA 4M3UA 3HI0A 4AHSA 3HL8A 3JAMO 3SV3A 1D5AA 4L8RB 4E7LA 3UE5A 4ID5A 3A0IX 3AVHA 1GLFO 2IAJA 3T1AA 3DLKA 4CD3A 4YNQA 3ZSWA 3AVNA 4JNEA 4K42A 4KH4A 1L3VA 2OTLN 3P5JA 2HNDA 1N34K 2QKKA 2X6SA 4N56A 4ELTA 3A8YA 4WE1A 5KQDA 4YFUA 3I8BA 3ZT4A 3OYJA 4CGDA 1NK0A 4CECA 4DQSA 4F9OA 4W5OA 5GIOA 4BGAA 3R6MA 3EY1A 3E9OA 3O3FA 4E7KA 2JGUA 3DRPA 3TSUA 3OS0A 4DR5K 3HVRA 4RW8A 4QAGA 4KHYA 3HPHA 3NGIA 2HHQA 4FZZA 1MA9B 3MN6A 1TK0A 3VQ6A 3QINA 1W2BM 4B9MA 4PL7A 3DOKA 1BDGA 2HHVA 4FLXA 4Z94A 3DLHA 5C42A 3ZSYA 1JLGA 4JYAK 2Q2RA 4OLBA 4DV3K 4FXDA 4PKGA 3OYHA 4BE2A 3GOIA 4MQ3A 4BRDA 4B3TK 4OKKA 5KPTA 1BQNA 4I2QA 4B1YB 5FPMA 4JK9A 1N32K 3GL1A 3HSCA 3ZSVA 2ZD1A 1Q7YO 3FE1A 3HPOA 4GVEA 3AGRA 3QFUA 5CY4A 1TAQA 1RILA 3FZLA 5FRNA 1D4XA 3VQ5A 3IG1A 1ILYA 4CZKA 3WXLA 3M5RA 3MX5A 4CK1A 2GV9A 5IT9O 2XY8A 4DFKA 4FPAA 4ILHA 2GWKA 5TKWA 1N36K 1BA1A 1VQ9N 2P9NB 3PV8A 3SBGA 4I7FA 3ZSZA 4LF8K 5GINA 3KK2A 4IKFA 3CC7N 4RW4A 3ZT3A 3CHWA 4JI0K 2HNYA 4J2DA 2F4VK 2P9NA 2HHWA 2WTUA 1NJIO 4DS5A 1NU0A 2W6LA 4HHTA 3KLIA 4F2RA 2W42A 1JLEA 1YTAA 5KTQA 3G6EN 4DWIA 5E84A 1CZ9A 3Q7BA 4FM1A 4DR7K 4FLVA 1SL0A 1Q9XA 2YHBA 1QZ5A 4JN4A 1A5WA 1EO1A 2DTUA 5C2FA 3KHYA 3O9RA 5EVZA 4CZMA 2HBLA 3O9SA 4E7HA 4FJNA 1VQ6N 4BRFA 3RSEB 4FO0A 2HF4A 3FGUA 2A1RA 1M1KO 3WUHA 2BTFA 3LL3A 4H0PA 1KLNA 3AO2A 1VQMN 2F9WA 1OH5A 1IG9A 2JWKA 3DAWA 4DQ8A 2RHKA 3WQUA 1OH7A 4M3YA 4CGJA 4MLEA 3EKSA 5LJWA 1KRPA 4O8KA 3RSEA 2XY6A 4CJPA 4M3WA 4ELUA 2CH5A 2FSJA 3THVA 4H5RA 4H0XB 2JLEA 3C6AA 1IG8A 4GV3A 4CJWA 4BGBA 4B8AB 3SNNA 3AY9A 1N8RO 3F5TA 4FZYA 3O4QA 4DLEA 3AVBA 1NKEA 1O1WA 4IEEA 5H1SQ 3VF4A 1IKWA 4AHUA 4XH5A 4DTRA 1NG9A 1U49A 2V51B 4DMNA 1HPMA 1ASVA 1EWRA 4DR4K 2VCPA 5A2QO 1WAFA 3SI6A 1RBRA 4CJEA 4DV2K 4EHUA 2D4WA 1YF5L 4YOUA 1VQON 1RT4A 2HSTA 1XWLA 5M1NA 4YHHK 1L5UA 3M8SA 1C0UA 3V9ZA 3L2VA 2WUSA 3QBWA 1NK4A 4WQ5A 3R1XA 4WCEL 3SAHA 4A2BA 4FCYA 3VETA 4BRNA 1RGIA 1FW6A 1VRTA 2HB5A 3TTCA 4JRPA 1WBBA 3M1FA 3TAFA 1XNRK 3T3FA 1KFSA 2BE2A 3DOLA 1T44A 3KZBA 4BG8A 3EN9A 3OYGA 4B9QA 3Q7CA 1OKJA 2FBXA 2I7NA 3HZ6A 5FRMA 3O8MA 1BL3A 3DLBA 3QETA 3ID8A 1J6ZA 5AQPA 3OYAA 4CEDA 3SPYA 4FLZA 3I0SA 3OS1A 3VQQA 4ELVA 3KVGA 3QERA 2IOCA 4FJ7A 4KHUA 4JKGB 1NGIA 1T05A 4QS8A 3CPWM 1JKHA 1GLDG 4IZ9A 2KQ2A 1Z05A 5AQWA 2VG5A 1T03A 1TKXA 3NVMA 5FPDA 2FBTA 1HYVA 3IRXA 4QCLA 3P31A 5AQRA 3VQDA 4JKGA 4LFAK 1NMNA 2DFEA 4CJ3A 2X78A 4CHYA 4BQZA 5BPMA 4JS4A 5FPNA 4XH4A 4WYBA 2YJEA 4DS4A 2GUPA 3AAQA 3KLGA 2OPQA 5HOOA 3RMCA 4CF8A 1LWEA 3KK7A 3H6EA 4JKCA 4XIUA 2OCEA 1LCUA 3PSIA 1TVRA 3DLLL 5J2QA 4KTZA 3T7ZA 1ZBHA 4Z4HA 4CBUA 1FKOA 5B8HA 3CCSN 5HBMA 4CFCA 5AQFA 4DQIA 1T6CA 2ZF5O 1RT2A 5HP1A 4KH6A 5C0YA 4JLHA 4G1QA 3C6UA 4TSXA 4DU1A 5AQOA 1YJWN 2G8UA 2FXUA 2PAVA 2D0AA 2W40A 4B1ZA 4FL9A 3K57A 2DPNA 1ZBUA 3CPEA 4FJXA 5KRSA 3CF5L 2UXCK 4OPKA 4BWMA 4Q0BA 3C95A 4B1WB 3LWMA 2G8FA 1HQEA 3TPQA 4DUZK 1T3VA 3H3OB 5C15A 4DUYK 3PIOL 2FLOA 4CEFA 4ISGA 4CZLA 4JI2K 1IKYA 3MN9A 1LAVA 2GUIA 4KB0A 4L3QA 3CXCM 3OYBA 3TAEA 2ZE2A 3AVAA 1YAGA 2ZWHA 4K25A 3HOSA 3RVCA 3TANA 3HJFA 1SKWA 4FWQA 2OZSA 3KKRA 1S1VA 2ZJQL 4IFYA 3QEVA 3J7AP 1B92A 2ZM6K 5JVHL 1S1UA 4FW2A 4DHYA 2LSNA 4DU4A 5BRDA 3D45A 4JI5K 5JLFA 3B6PA 1W0HA 3FZFA 2QI2A 2NRZA 4CHZA 3KJVA 1BGXT 4AHCA 4C1NI 1DTTA 2E1YA 3V9WA 3AVCA 3EE9A 4H4OA 2HVHA 3EL2A 4NCBA 3KLFA 3LDSA 1VSLA 3VOVA 3THXA 3AA5X 2VWBA 1TYQB 1SKSA 1YT3A 5M1FA 1HNZK 1C0MA 1HMVA 4BDYA 3NCIA 4CJVA 4GVMA 4BG9A 4CF0A 5FPEA 2E2NA 1EX4A 2QK9A 2VGNA 4UY8O 3O08A 4NYFA 1SS6A 1SL1A 3FLCO 2VWKA 1TYQA 3M3ZA 1G99A 3O4WA 1HPZA 1NBWA 3AO3A 4O8UA 1QQOA 2QW9A 4CIFA 3HT3A 1N5YA 3LANA 4ICLA 2A3ZA 1C0GA 3AGKA 1HYSA 2G8IA 4IWVA 3O4NA 4KHWA 2KHOA 4MDAA 2KLAA 3HM9A 4KHQA 1JL2A 3MN7A 1WOQA 3DLGA 2I7PA 1QQMA 4BC2A 3R9PA 4KRFA 3J7ZO 4RW9A 1Q18A 3W0LA 3DXMB 1S22A 4N76A 1P90A 2ASOA 1LW2A 5M1QA 3BUZB 3AV9A 2FSKA 2YHAA 4FWLA 3M6GA 3KTQA 1NGFA 3CCRN 2DY4A 3QEIA 2I5JA 2ZJPL 3VQAA 3CJCA 1DTQA 3DXMA 3V1OA 3T19A 4CHQA 1J9AA 3LDQA 4M41A 5AQVA 3DLRA 2PBDA 4B08A 3OYEA 5I9EB 4CEAA 4AM7A 5KRTA 2NUBA 4FLTA 1SKRA 4E3SA 2GELA 4IXCA 3OYIA 5BN8A 4E7IA 4FJ5A 1NLVA 1Z26A 3D7EO 5C2DA 4OGCA 3OVNA 3CJ9A 2CGKA 3KLEA 4IOAL 4CGHA 2Y1IA 4LH4A 3D0PA 1V4TA 3OBYA 4IBNA 2QXFA 1J5OA 4CK3A 5CZ1A 1Q86O 1Q81O 3O5BA 4YOYA 4Y1CA 3A5OC 3O3GA 4JI3K 4FOEA 4CJKA 2RN2A 4JI6K 3MN5A 4LY7A 3PLAA 4FWMA 3O1WA 5BRHA 3HPGA 1BOTO 3AA4A 4CEBA 3MXMA 1W97L 3QLHA 3OHRA 4FJJA 4CIGA 3VA3A 3DRSA 3SAFA 4DTPA 4BREA 1JL1A 3EEQA 2V52B 3AO5A 2F96A 3KWIA 1T7PA 1QHAA 1SQKA 1VSHA 1KVAA 3UB5A 1KQSM 1GLCG 4HCCA 2ASMA 3NH2A 2PZSA 4DKWA 2E8AA 4DFJA 4FJIA 5HRNA 2ATQA 5LJVA 1WB9A 3SLCA 1BIZA 1C0FA 5AQUA 3MX2A 5K14A 3BEXA 1Z25A 3MCPA 4PKIA 4B9UA 3ZCMA 5J2PA 4OKEA 3NF7A 3VEYA 3AO1A 4A5BA 4IFVA 3LM9A 3RMDA 1S1XA 1WSGA 4JKHA 3AA2A 2Q1NA 4UQGA 3T69A 2VWJA 1LWCA 1X9SA 3CJBA 1I39A 2AP1A 1QSLA 3F9KA 3TSPA 1CLQA 4HUEA 3LP2A 2A42A 3E66A 3AARA 1OVQA 2PY5A 4FVUA 4DR2K 2YV0X 2EWSA 4FJMA 4BC4A 1JLAA 4WFNL 1JJ2M 2F9TA 4W5RA 1NMDA 4O0JA 3QMLA 3OJUA 3ZX2A 1XC9A 4IOXA 4JKAA 4J2EA 3VMFB 4R5PA 3B8AX 1TKZA 4C8KA 4O44A 4YOXA 4WFAL 1KAXA 2ZGZA 2J4RA 4B3SK 4BROA 2NZTA 1U48A 3WNGA 1LW0A 1RT5A 1NGJA 4IJNA 3O1BA 4DV4K 3E9PA 4FWRA 1NGGA 1X3MA 4FWNA 4DV1K 1FJGK 3BY5A 3CIPA 2O8EB 2VQFK 4A5AA 1MDUB 4DSFA 4JK8A 3CC2N 1WN7A 1NOZA 3LDPA 3FFKB 5I42A 2YX6A 4O4GA 4BDPA 4KBOA 1KTQA 1HYZA 4M3ZA 1OH8A 2O8EA 4JD2B 4FZXC 5GIPA 3EO3A 1X1PA 1REVA 4CGFA 4EP4A 1XMOK 3KLHA 3NMUA 3CCMN 2HNZA 4DB3A 4F8RA 3OTOK 4FJ8A 4X65K 2QWMA 4DTOA 3NVKA 4DR6K 4PY5A 1RDWX 2ZGYA 1S9GA 4JKDA 3HXMA 1E4GT 3LPTA 5AQXA 4GV9A 1KSPA 4JD2A 5AQMA 2H3GX 3O9TA 3VF6A 3NFAA 2UUCK 2QWNA 2WBNA 3DI6A 3DLEA 3WXIA 3ATUA 3A5MC 1TV6A 1VRUA 4CJRA 4CJ5A 4CE9A 3VQEA 4E1NA 3NHGA 4PQUA 5MLCQ 5BPNA 3QBXA 4C8NA 4IDKA 1RDUA 3S3OA 5KPRA 1VSMA 2OPPA 1BCOA 2Q0UA 3UKRB 3LPUA 1YIJN 4CJ7A 3VQPA 1W7AA 3JS6A 2CGLA 2ITMA 3OYNA 3WNEA 1YITN 3L4QA 4CFAA 1EP4A 3I0RA 4LF5K 5AJ3K 3V6DA 4H8KA 5GAEP 3F73A 3UKRA 1XMQK 4HWIA 3WXKA 2E88A 3TSQA 3C6HA 5AQQA 3P83D 1XHZA 3SQ2A 2XRIA 4AQYK 4DG1A 1WAJA 1IJJA 4RWTA 4IEIA 4J8FA 1EWQA 2Z1GA 4RW6A 3CMEN 3IDHA 1VSDA 2E5LK 4BC3A 3CQYA 4XH1A 1HR0K 1VQNN 4H03B 3VQ9A 4EZ6A 4LC9B 2VG6A 1BG3A 4OGEA 1BISA 3RRHA 1HNXK 4V19S 3TR8A 3TAPA 3IFRA 3KIOA 1J5EK 4H5TA 3S41A 4CI6A 1BCMA 4QOZB 4FWSA 1K8KB 3LAKA 5M1PA 4EZ9A 4N47A 5DK5A 1Q82O 2NRRA 5AQNA 3ULEA 3CM5A 1SL2A 1ZBIA 3CI5A 2HBKA 4FPBA 1FXXA 4BR9A 5BPLA 4JV5K 4KFBA 5J2MA 1RT7A 3EKUA 1K8KA 1KVBA 3AO4A 4H5VA 4NXMK 3QO9A 4AILC 4O5FA 2KFZA 4JI8K 3QNOA 3OYLA 3IAYA 4AF1A 3LDOA 3MEDA 4ZTFA 4AHRA 2YJFA 4KTWA 1QE1A 1NJXA 4FWPA 5ADXA 2HW3A 4DSKA 3NAEA 1EQYA 2E6MA 4OJRA 1TKDA 4CZHA 1RBVA 4BRQA 1L3TA 2YHWA 5KPZA 4FLYA 1ASUA 1SZ2A 5LY3A 1VQ7N 1VQPN 3J80O 3K5MA 3L0QA 4RG8A 3VQ4A 1C0TA 3K9KA 2O8DB 2HMPA 4MO4A 1F21A 3CCVN 3B6OA 2FF6A 4CBWA 1EKEA 5EXWA 4CF9A 4BR0A 1D9DA 3C65A 4BR2A 4DSIA 1IKXA 2QKBA 3ZETB 4DFMA 1YJ9N 2O8DA 5HROA 3N4QA 3OYDA 5C24A 5SZTA 1RDCA 3OW2M 1RTIA 1GOBA 1HNWK 2HHSA 4XEIA 1U45A 1YTUA 4DTJA 1LWFA 2QXLA 1H1VA 2KFNA 4K0KK 1C6VA 3ZETA 5D3GA 4W5NA 5AQTA 1GOCA 1NKCA 1M90O 1EETA 2RF2A 3QESA 1BWFO 3H3NO 3CMAN 4BWJA 2P5GA 1S6QA 3HRGA 4ILGB 4JI7K 3OBWA 4BRAA 3THWB 5J2NA 4CHNA 4H0TB 4FYDA 3J7YP 4O5BA 3OYFA 1TL3A 3SUPA 1GOAA 3SCXA 1HX1A 3TU5A 3VQ8A 2VQEK 4CJLA 2UU9K 4DV6K 3K5OA 2XHBA 4A62A 4HVJA 2YHYA 1K73O 1NGHA 2IIRA 2QM1A 3THWA 2Q97A 1DKGD 1XHXA 3LP1A 2AJQA 2YNHA 4CZJA 1RFQA 1K9MO 5JICA 2NRHA 1NGDA 3DXKB 2GWJA 1GLJO 3OS2A 4Y1DA 5TKYA 4M3TA 3LWLA 4BR7A 3SBTA 4NB4A 4C8MA 1V4SA 3AVLA 2F8TA 1JCFA 5HRRA 1WSEA 2YNFA 4EP5A 1KFDA 2YCHA 3DXKA 4FK4A 3MK6A 3V1RA 3D2FB 4CEZA 2IDOA 3AA3A 4LSNA 3TTDA 3TAQA 4HCBA 2A41A 1O13A 3VESA 3OJSA 1RTHA 4JKFA 2ZJRL 4DV0K 3H1QA 2BGGA 2FBVA 3D2FA 4FJLA 1ZC6A 1TK8A 4ISFA 3EZWA 3VQ7A 3M8RA 5AQIA 1RT6A 2KW4A 3HSTB 3P4IA 3ASMA 3PIPL 2E20A 2OANA 3NF6A 1HQUA 2P9LB 2IVPA 3THXB 2UXDK 4CEEA 4WF9L 4OO1J 3DJCA 1ZBLA 4Q5VA 4ID1A 3U3GA 5C12A 4KPYA 4U7BA 3AVFA 4B1VA 4JKEA 4CFDA 3CERA 3VPZA 2P9LA 4DLGA 3SZ2A 3VQCA 4EAHD 1BU6O 4ZHRA 1N6QA 4RCHA 3V9SA 2YKNA 1VQ5N 3VEWA 3HVTA 4KKOA 4M3XA 3JSMA 3MECA 3VGLA 3NH0A 4JK7A 4BC5A 3OYKA 4CGIA 5F0XA 4Z4EA 5JMVA 3QIPA 1SAZA 2R7YA 2OZMA 3LDLA 3J8AA 3CC4N 4EFHA 1YVUA 4HUFA 4NYNA 1ASWA 4WFBL 3H1VX 4CJ4A 2Q0RA 3GBTA 3CCUN 4Z4IA 5FDLA 2A1SA 3SMSA 4CESA 3G25A 2CH6A 4YDUC 2QA4N 4HTUA 1QSYA 1BIUA 2QWRA 2A5XA 2P9SB 5LMUK 3AVIA 1ATRA 2FBYA 4CFBA 4C23A 1WUAA 5AFUA 1RNHA 1NM1A 1TAUA 3U9DA 1LAWA 3ZT0A 3A5NC 1JXEA 1WSIA 4DSJA 5AQZA 3VA0A 5EY4A 3I8DA 1Z6RA 3PSFA 3RR8A 3GDQA 3CJ7A 3C94A 4E19A 2P9SA 3S9HA 3IS9A 3CETA 4NXNK 1NKBA 3ENOA 3L2RA 3CQ8A 3BZCA 3FZKA 3I33A 4BRCA 5E41A 3NE6A 5ADXH 2D0BA 5CYMA 2NRWA 1KD1O 4YOWA 2Z1HA 5DMRA 1HJOA 3H45C 1RBSA 3VEZA 3SUNA 5KI6A 2NNWA 1VSEA 2GBZA 2OTJN 1NK7A 1K6YA 2XY7A 3OA9A 3V9UA 4HTLA 1VK0A 1ZBSA 1QQNA 3BP8A 3C7NB 3LALA 5GAHP 3SYZA 1A5XA 4A57A 1NK8A 2XY5A 1G15A 4CJQA 3K9JA 4DSEA 2D0OA 4OX9K 3WQTA 1S5JA 4KI4A 4EHTA 1LV5A 3LM2A 4AHTA 5HL7L 3CD6N 1VQ4N 4A59A 1QSSA 3DMJA 3C7NA 4BQLA 4CJFA 3NGZA 3SUOA 1HKBA 3ENBA 3WNHA 1J54A 1Y97A 1X9MA 2A40A 4H0VB 1WSHA 3V4IA 3FR0A 2OYQA 3SJJA 3VGMA 4IJAA 3H46O 4FLWA 1OVYA 5JS2A 5F1XA 4LF6K 4DR1K 4JS5A 1XUPO 1RT3A 1S1TA 1RBTA 5CE3A 1RBUA 3MXIA 1L3SA 4BE0A 2VYPA 4MO5A 3M8QA 3RRGA 4CK2A 4YOVA 4E0DA 4YDUA 3U3YA 4MFBA 3DRRA 3L3VA 1KXPA 4MDBA 4CW7B 4FK2A 4W5TA 1TKTA 3LZJA 4FWKA 4M3RA 1B9DA 2VG7A 4JKBA 4AM6A 3FZMA 4H5WA 3BGRA 3ENHA 3SQ0A 4BR5A 4FVMA 2BANA 3R3LA 1QZ6A 3L4IA 4KI6A 2HHXA 1JCGA 1WSFA 4FW1A 3HM8A 1S6PA 4GKJK 4F3TA 1ZXOA 3WXJA 3O3HA 5KQ8A 4CEQA 4E1MA 1Y64A 4E7JA 1JXBA 2JWLA 2P9PB 2O8CB 1RTDA 3HO1A 4GW6A 4B1XB 4NCAA 3NDKA 4LF7K 4U67L 2YNGA 4BRHA 4CCHA 3G71N 5AR0A 3HK2A 4RTFD 3CCEN 3ULDA 2O8BB 3ZYYX 3THYB 4I9LA 3LP0A 2HMIA 2P9PA 4N5SA 2O8CA 3OYMA 1NK6A 3ITHA 5AQHA 5JLHA 4K41A 3K58A 2E2OA 1QVFM 4I6MB 1NGAA 5GAGP 3BDPA 1KLMA 3EZ5A 3MWPA 4DTSA 2HBMA 5SWMA 2O8BA 4K43A 3TAMA 3VTHA 1DGKN 3THYA 4ILJA 4C8OA 3N4PA 4M63C 1CXUA 1CZBA 3AVKA 5CZ2A 4I6MA 4PWDA 5CHIA 4CHPA 4BRKA 3WEEB 3DYAA 5HRSA 4B9SA 1SV5A 3VTIA 1JLBA 5EX5A 3VEOA 1GLAG 4KHSA 3ZX3A 1IO2A 3W3DA 1S9EA 1MWKA 4ISEA 1NK5A 5GADP 5KGWA 1D9FA 4FLUA 3WEEA 4C1NK 4DQQA 1W9HA 3EE8A 1ESVA 4H0OA 2PYJA 4W5QA 4LH5A 3UKUB 1HKCA 3PUFA 3SQ4A 4DCHA 2YNIA 1NGCA 1SUQA 4BRGA 1QTMA 4IG0A 2KZMA 1TL1A 2UUAK 3HP9A 5EOYA 3UKUA 2HHTA 3OYCA 4IG3A 3HYFA 3PX6A 1NWKA 5CR4A 4K8ZA 4YOTA 4IDHA 2Q31A 3OY9A 1IH7A 4JRQA 1XC3A 3U6FA 2P1JA 2QWQA 5BREA 2YHXA 3G0ZA 3CQXA 2NLXA 4C8LA 4R79A 4N41A 2YI1A 3AAPA 2E2QA 2G8KA 5FLXO 4B8CA 3RMAA 1VSFA 3PO4A 4NLBA 4B9NA 3O9UA 3TABA 3AVGA 4B9VA 4KO0A 3TI0A 1OH6A 2RPIA 1YUWA 4RW7A 3TTFA 2P9KB 5AFUH 2QWOA 2WC9A 4JEPA 2IVOA 5AQSA 2OPRA 3SJHA 1N33K 4GMJB 3MMVA 2Q3SA 1UA0A 3L6QA 1QQCA 3E9LA 4CF1A 4KREA 2P9KA 5DM6L 1RTJA 1CZAN 3HBTA 4O0IA 2UYTA 3LAMA 3MCAB 1VQLN 4DV7K 4I2PA 2DFHA 3O80A 4DTUA 1ZYQA 2V7ZA 2FF3B 4M7YA 4KHPK 3VEXA 3NF8A 4WQ5C 4IO9L 2E2PA 2WOMA 2D1KA 4GNIA 1U47A 3V81A 1E4FT 2O4IA 4EIAA
chains in the Genus database with same CATH topology
5LL6Z 4X66K 4DV5K 4LFBK 3J7YP 4LF9K 4YHHK 1I94K 4JI0K 2F4VK 4LF6K 2VQEK 4DR1K 2UXBK 2UU9K 4DV6K 4JV5K 4DR5K 2UXCK 1XMOK 1XNRK 3OTOK 4DR7K 4X65K 4NXMK 4DR6K 4B3RK 4GKKK 4CW7B 4DUZK 1IBLK 4DUYK 4JI8K 4CVNE 2UUAK 4JI2K 2UUCK 2HHHK 4LF4K 4JI4K 4LFCK 3J81O 5LMUK 4JYAK 4GKJK 3J7AP 3T1YK 4DR2K 2ZM6K 4DV3K 3J80O 4X62K 4NXNK 4LF7K 5FLXO 4JI5K 4X64K 4B3MK 4YY3K 4JI1K 4DV0K 4B3TK 4LF5K 5AJ3K 4DV2K 5IWAK 1XMQK 1N32K 4LFAK 4DR3K 4B3SK 3JAMO 2UUBK 4AQYK 3T1HK 1N33K 4JI3K 2E5LK 1HNWK 4DV4K 1HNZK 5IT9O 1IBKK 1HR0K 4JI6K 4OX9K 4DV1K 4K0KK 2UXDK 5LMNK 4DV7K 1FJGK 1N34K 1HNXK 4V19S 5BR8K 1N36K 4DR4K 4KHPK 2VQFK 1XNQK 5A2QO 1J5EK 4LF8K 1IBMK 4JI7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 Z;  4X66 K;  4DV5 K;  4LFB K;  3J7Y P;  4LF9 K;  4YHH K;  1I94 K;  4JI0 K;  2F4V K;  4LF6 K;  2VQE K;  4DR1 K;  2UXB K;  2UU9 K;  4DV6 K;  4JV5 K;  4DR5 K;  2UXC K;  1XMO K;  1XNR K;  3OTO K;  4DR7 K;  4X65 K;  4NXM K;  4DR6 K;  4B3R K;  4GKK K;  4CW7 B;  4DUZ K;  1IBL K;  4DUY K;  4JI8 K;  4CVN E;  2UUA K;  4JI2 K;  2UUC K;  2HHH K;  4LF4 K;  4JI4 K;  4LFC K;  3J81 O;  5LMU K;  4JYA K;  4GKJ K;  3J7A P;  3T1Y K;  4DR2 K;  2ZM6 K;  4DV3 K;  3J80 O;  4X62 K;  4NXN K;  4LF7 K;  5FLX O;  4JI5 K;  4X64 K;  4B3M K;  4YY3 K;  4JI1 K;  4DV0 K;  4B3T K;  4LF5 K;  5AJ3 K;  4DV2 K;  5IWA K;  1XMQ K;  1N32 K;  4LFA K;  4DR3 K;  4B3S K;  3JAM O;  2UUB K;  4AQY K;  3T1H K;  1N33 K;  4JI3 K;  2E5L K;  1HNW K;  4DV4 K;  1HNZ K;  5IT9 O;  1IBK K;  1HR0 K;  4JI6 K;  4OX9 K;  4DV1 K;  4K0K K;  2UXD K;  5LMN K;  4DV7 K;  1FJG K;  1N34 K;  1HNX K;  4V19 S;  5BR8 K;  1N36 K;  4DR4 K;  4KHP K;  2VQF K;  1XNQ K;  5A2Q O;  1J5E K;  4LF8 K;  1IBM K;  4JI7 K; 
#chains in the Genus database with same CATH topology
 4GY2 B;  2EHG A;  3IUC A;  4DV5 K;  3KKS A;  2ETJ A;  4DF8 A;  3CFP A;  3KD5 E;  2IGI A;  1WBD A;  3SK3 A;  4AHV A;  2RE2 A;  3CM6 A;  2UXB K;  3CJ1 A;  3RMB A;  1BQM A;  3P1G A;  1T8E A;  3ULE B;  3KK1 A;  5ELZ A;  1YJN N;  4FM2 A;  3ZEU B;  3IMX A;  3MDQ A;  3HOT A;  4GKK K;  1IBL K;  1U2V B;  3L2U A;  2QWL A;  4B3O A;  1IKV A;  4CVN E;  4AH9 A;  1JLC A;  3ZSX A;  1NJW A;  2BH1 A;  4BVP A;  3QNN A;  4LF4 K;  3ZEU A;  1L3U A;  1R0A A;  2XO7 A;  3NBP A;  2HOE A;  3R8E A;  1RDA A;  4FSV A;  5M1O A;  1DT9 A;  5C25 A;  3KK3 A;  1U2V A;  1WNS A;  3IKM A;  4CHO A;  5AQK A;  3CYM A;  3SMP A;  1XI1 A;  2VGM A;  2F8S A;  3NF9 A;  2HBJ A;  3MEG A;  1RT1 A;  3ZSR A;  3BZK A;  3KWG A;  3QDK A;  2X74 A;  4Z4C A;  2KKZ A;  3FFI A;  2OA8 A;  1FK9 A;  1I3A A;  3C0B A;  3ZX0 A;  1NOY A;  4BR4 A;  3F9M A;  2B6A A;  3QIO A;  4PHT X;  1C1A A;  4IO8 A;  1UWB A;  3FZH A;  2P9U B;  5J1E A;  1FKP A;  4CER A;  1KC8 O;  5I3U A;  3VQB A;  5AQG A;  3T1H K;  3HP6 A;  4F2S A;  3V9X A;  1CXQ A;  4FWO A;  4CEO A;  4CJT A;  3RTV A;  1X9W A;  3L3U A;  1HLU A;  3RR7 A;  1Q8I A;  5BR9 A;  1HNV A;  1IBK K;  4BDZ A;  2P9U A;  1EXQ A;  1P8Z A;  3A2F A;  4J2A A;  3QB0 A;  4Z0U A;  4DQR A;  2W6K A;  2O8F B;  1UAX A;  3CCJ N;  3K5N A;  4FK0 A;  2RKI A;  1IBM K;  2W41 A;  5LL6 Z;  1KCF A;  1E3M A;  4X66 K;  4CZG A;  4OPA A;  3QEW A;  3NGY A;  4H4M A;  1I94 K;  3PX0 A;  4CZF A;  3U4L A;  2O8F A;  3AVJ A;  1ATN A;  1LOT B;  4Z4F A;  2WON A;  3G10 A;  3M8P A;  2ASP A;  2FC0 A;  4KHN A;  4FJG A;  4HUG A;  5CYQ A;  4CJS A;  1HNI A;  4OLA A;  4G9Z A;  2Z1I A;  1X9J A;  2E1Z A;  4PL8 A;  3ZLJ A;  5JVG L;  4B9L A;  5EU7 A;  3VGK A;  3NH1 A;  4Z4G A;  3JXU A;  4CF2 A;  2G8W A;  1BHL A;  1HRH A;  1VSI A;  4BRL A;  4JI4 K;  4YOR A;  3WNF A;  4H0Y B;  3VN5 A;  1HJR A;  3F2K A;  5AZI B;  2Y1J A;  3S3N A;  4FOI A;  1VAZ A;  1NNE A;  4B9T A;  3ZT2 A;  4CD1 A;  4K8X A;  1U6Z A;  1JLQ A;  1NJY A;  4BVO A;  1KAY A;  3D6R A;  4LSL A;  3TAR A;  3P39 A;  1UA1 A;  2BDP A;  1BO5 O;  4OVL A;  4QS7 A;  1VSJ A;  5AZI A;  1YHQ N;  1BI4 B;  1QVG M;  4CZE A;  4JI1 K;  3LP3 A;  3SUQ A;  4JHD B;  2D0C A;  4CBX A;  3L2Q A;  2QEX N;  3E1Y A;  1MU2 A;  3K0S A;  2NRV A;  3MWT A;  3A5L C;  4FJK A;  3S3M A;  2PFU A;  4A61 A;  4OPJ A;  1VQK N;  2EX3 A;  5C10 A;  4M42 A;  3D2E B;  2PYL A;  2UUB K;  1BI4 A;  2IS3 A;  4BRP A;  2GEM A;  5M1K A;  4JHD A;  1WSJ A;  2GX9 A;  1C1B A;  3GG4 A;  3VER A;  3L2W A;  1DEJ A;  5T7B A;  1GLE G;  1GLL O;  5LMN K;  3O9Q A;  2G8V A;  1QHT A;  3LZI A;  2E6L A;  3D2E A;  4M7X A;  5BR8 K;  1K8A O;  4MLH A;  4B1U B;  1XNQ K;  1NJZ A;  3DM2 A;  4KB1 A;  1WLJ A;  4DQP A;  5BN9 A;  3C6T A;  5AQJ A;  3TWH A;  4E89 A;  2A6A A;  3MXJ A;  4E1J A;  2F7T A;  3PX4 A;  4LF9 K;  1DLO A;  2V7Y A;  4CZI A;  2GTD A;  3WT0 A;  4A2A A;  1JLF A;  4BRM A;  3EYZ A;  3CFR A;  4ZTJ A;  2OPS A;  1A5V A;  1S3X A;  5BRF A;  1HKG A;  2DFF A;  4B3R K;  2P51 A;  2CGJ A;  1S1W A;  4IOC L;  4OPH A;  4DTX A;  2X6N A;  1YVN A;  2D0P A;  3MAQ A;  2HHH K;  1BA0 A;  1ATS A;  4BAC A;  4FJH A;  4J2B A;  3K5L A;  4F3O A;  3J81 O;  1RCH A;  4H5N A;  3QFP A;  3K2P A;  1ZBF A;  4WQ4 C;  3VEN A;  4Y0W A;  1B9F A;  4FM0 A;  4I9Q A;  4M45 A;  4NLC A;  4NO7 A;  3ZT1 A;  3T1Y K;  2IC3 A;  5AQY A;  2IVN A;  1ITG A;  3ZSO A;  4BE1 A;  5HRP A;  3RWU A;  1GLB G;  1VSK A;  3CCQ N;  1MWM A;  1TUY A;  1C1C A;  4X64 K;  1XQS C;  3ALY A;  4B3M K;  4YY3 K;  3PO5 A;  3BF3 A;  1R59 O;  4KTQ A;  3QEP A;  2BUP A;  3U9Z A;  1S72 N;  1RDB A;  4QS9 A;  2P9I B;  5IWA K;  4DU3 A;  1HUX A;  1RDD A;  3SQ1 A;  3UIQ A;  4DSL A;  4DR3 K;  3ISN C;  3U8X A;  1U04 A;  4KAZ A;  3ATV A;  3V1Q A;  4LD0 A;  1NK9 A;  1KAZ A;  4DFP A;  1NGB A;  4O55 A;  2E4L A;  3KD1 E;  2P9I A;  3VF2 A;  1JCE A;  4PKH A;  3HTV A;  2FSN A;  4JAX A;  1D8Y A;  3P38 A;  3ID6 A;  4DF4 A;  5AQL A;  2YKM A;  4FJ9 A;  3QIC A;  3ZSQ A;  5E26 A;  5AZJ B;  2QTD A;  2P5O A;  3BF1 A;  4F4K A;  4LFB K;  2Z1J A;  4DTN A;  5KGX A;  2QWP A;  4OKJ A;  5F2R A;  3DWL A;  5HLF A;  1NGE A;  1X3N A;  1IV0 A;  1TUU A;  3SAG A;  2NRT A;  4CGG A;  4BRI A;  2KTQ A;  1KVC A;  5AZJ A;  1VHX A;  1Q9Y A;  5JS1 A;  3LDN A;  1QS4 A;  1YXQ A;  2Q36 A;  3MEE A;  3G4S N;  4GV6 A;  1TGO A;  4IFE A;  1YI2 N;  3GE1 A;  1VQ8 N;  1J53 A;  3K59 A;  5FRO A;  2AA4 A;  4PA1 A;  3WXM B;  3O6W A;  3I55 N;  4WQ4 A;  4CJU A;  1U4B A;  3VEV A;  5DM7 L;  2HF3 A;  1BUP A;  3AVM A;  4CIE A;  4BY9 C;  3QEX A;  4LFC K;  3L8B A;  3CG7 A;  2D5R A;  3I56 N;  2ZQB A;  2ITG A;  1TK5 A;  3SV4 A;  2G8H A;  2HHU A;  4DTM A;  2WFB A;  2KZZ A;  3CFO A;  1UOC A;  2B5J A;  3CCL N;  4X62 K;  2O4G A;  3PY8 A;  2NRX A;  3H08 A;  4PUO A;  2B4J A;  4KH5 A;  3JYT A;  3E01 A;  2HVI A;  3CJA A;  4KV8 A;  1T6D A;  3TAG A;  3SPZ A;  4NCG A;  4M3U A;  3HI0 A;  4AHS A;  3HL8 A;  3JAM O;  3SV3 A;  1D5A A;  4L8R B;  4E7L A;  3UE5 A;  4ID5 A;  3A0I X;  3AVH A;  1GLF O;  2IAJ A;  3T1A A;  3DLK A;  4CD3 A;  4YNQ A;  3ZSW A;  3AVN A;  4JNE A;  4K42 A;  4KH4 A;  1L3V A;  2OTL N;  3P5J A;  2HND A;  1N34 K;  2QKK A;  2X6S A;  4N56 A;  4ELT A;  3A8Y A;  4WE1 A;  5KQD A;  4YFU A;  3I8B A;  3ZT4 A;  3OYJ A;  4CGD A;  1NK0 A;  4CEC A;  4DQS A;  4F9O A;  4W5O A;  5GIO A;  4BGA A;  3R6M A;  3EY1 A;  3E9O A;  3O3F A;  4E7K A;  2JGU A;  3DRP A;  3TSU A;  3OS0 A;  4DR5 K;  3HVR A;  4RW8 A;  4QAG A;  4KHY A;  3HPH A;  3NGI A;  2HHQ A;  4FZZ A;  1MA9 B;  3MN6 A;  1TK0 A;  3VQ6 A;  3QIN A;  1W2B M;  4B9M A;  4PL7 A;  3DOK A;  1BDG A;  2HHV A;  4FLX A;  4Z94 A;  3DLH A;  5C42 A;  3ZSY A;  1JLG A;  4JYA K;  2Q2R A;  4OLB A;  4DV3 K;  4FXD A;  4PKG A;  3OYH A;  4BE2 A;  3GOI A;  4MQ3 A;  4BRD A;  4B3T K;  4OKK A;  5KPT A;  1BQN A;  4I2Q A;  4B1Y B;  5FPM A;  4JK9 A;  1N32 K;  3GL1 A;  3HSC A;  3ZSV A;  2ZD1 A;  1Q7Y O;  3FE1 A;  3HPO A;  4GVE A;  3AGR A;  3QFU A;  5CY4 A;  1TAQ A;  1RIL A;  3FZL A;  5FRN A;  1D4X A;  3VQ5 A;  3IG1 A;  1ILY A;  4CZK A;  3WXL A;  3M5R A;  3MX5 A;  4CK1 A;  2GV9 A;  5IT9 O;  2XY8 A;  4DFK A;  4FPA A;  4ILH A;  2GWK A;  5TKW A;  1N36 K;  1BA1 A;  1VQ9 N;  2P9N B;  3PV8 A;  3SBG A;  4I7F A;  3ZSZ A;  4LF8 K;  5GIN A;  3KK2 A;  4IKF A;  3CC7 N;  4RW4 A;  3ZT3 A;  3CHW A;  4JI0 K;  2HNY A;  4J2D A;  2F4V K;  2P9N A;  2HHW A;  2WTU A;  1NJI O;  4DS5 A;  1NU0 A;  2W6L A;  4HHT A;  3KLI A;  4F2R A;  2W42 A;  1JLE A;  1YTA A;  5KTQ A;  3G6E N;  4DWI A;  5E84 A;  1CZ9 A;  3Q7B A;  4FM1 A;  4DR7 K;  4FLV A;  1SL0 A;  1Q9X A;  2YHB A;  1QZ5 A;  4JN4 A;  1A5W A;  1EO1 A;  2DTU A;  5C2F A;  3KHY A;  3O9R A;  5EVZ A;  4CZM A;  2HBL A;  3O9S A;  4E7H A;  4FJN A;  1VQ6 N;  4BRF A;  3RSE B;  4FO0 A;  2HF4 A;  3FGU A;  2A1R A;  1M1K O;  3WUH A;  2BTF A;  3LL3 A;  4H0P A;  1KLN A;  3AO2 A;  1VQM N;  2F9W A;  1OH5 A;  1IG9 A;  2JWK A;  3DAW A;  4DQ8 A;  2RHK A;  3WQU A;  1OH7 A;  4M3Y A;  4CGJ A;  4MLE A;  3EKS A;  5LJW A;  1KRP A;  4O8K A;  3RSE A;  2XY6 A;  4CJP A;  4M3W A;  4ELU A;  2CH5 A;  2FSJ A;  3THV A;  4H5R A;  4H0X B;  2JLE A;  3C6A A;  1IG8 A;  4GV3 A;  4CJW A;  4BGB A;  4B8A B;  3SNN A;  3AY9 A;  1N8R O;  3F5T A;  4FZY A;  3O4Q A;  4DLE A;  3AVB A;  1NKE A;  1O1W A;  4IEE A;  5H1S Q;  3VF4 A;  1IKW A;  4AHU A;  4XH5 A;  4DTR A;  1NG9 A;  1U49 A;  2V51 B;  4DMN A;  1HPM A;  1ASV A;  1EWR A;  4DR4 K;  2VCP A;  5A2Q O;  1WAF A;  3SI6 A;  1RBR A;  4CJE A;  4DV2 K;  4EHU A;  2D4W A;  1YF5 L;  4YOU A;  1VQO N;  1RT4 A;  2HST A;  1XWL A;  5M1N A;  4YHH K;  1L5U A;  3M8S A;  1C0U A;  3V9Z A;  3L2V A;  2WUS A;  3QBW A;  1NK4 A;  4WQ5 A;  3R1X A;  4WCE L;  3SAH A;  4A2B A;  4FCY A;  3VET A;  4BRN A;  1RGI A;  1FW6 A;  1VRT A;  2HB5 A;  3TTC A;  4JRP A;  1WBB A;  3M1F A;  3TAF A;  1XNR K;  3T3F A;  1KFS A;  2BE2 A;  3DOL A;  1T44 A;  3KZB A;  4BG8 A;  3EN9 A;  3OYG A;  4B9Q A;  3Q7C A;  1OKJ A;  2FBX A;  2I7N A;  3HZ6 A;  5FRM A;  3O8M A;  1BL3 A;  3DLB A;  3QET A;  3ID8 A;  1J6Z A;  5AQP A;  3OYA A;  4CED A;  3SPY A;  4FLZ A;  3I0S A;  3OS1 A;  3VQQ A;  4ELV A;  3KVG A;  3QER A;  2IOC A;  4FJ7 A;  4KHU A;  4JKG B;  1NGI A;  1T05 A;  4QS8 A;  3CPW M;  1JKH A;  1GLD G;  4IZ9 A;  2KQ2 A;  1Z05 A;  5AQW A;  2VG5 A;  1T03 A;  1TKX A;  3NVM A;  5FPD A;  2FBT A;  1HYV A;  3IRX A;  4QCL A;  3P31 A;  5AQR A;  3VQD A;  4JKG A;  4LFA K;  1NMN A;  2DFE A;  4CJ3 A;  2X78 A;  4CHY A;  4BQZ A;  5BPM A;  4JS4 A;  5FPN A;  4XH4 A;  4WYB A;  2YJE A;  4DS4 A;  2GUP A;  3AAQ A;  3KLG A;  2OPQ A;  5HOO A;  3RMC A;  4CF8 A;  1LWE A;  3KK7 A;  3H6E A;  4JKC A;  4XIU A;  2OCE A;  1LCU A;  3PSI A;  1TVR A;  3DLL L;  5J2Q A;  4KTZ A;  3T7Z A;  1ZBH A;  4Z4H A;  4CBU A;  1FKO A;  5B8H A;  3CCS N;  5HBM A;  4CFC A;  5AQF A;  4DQI A;  1T6C A;  2ZF5 O;  1RT2 A;  5HP1 A;  4KH6 A;  5C0Y A;  4JLH A;  4G1Q A;  3C6U A;  4TSX A;  4DU1 A;  5AQO A;  1YJW N;  2G8U A;  2FXU A;  2PAV A;  2D0A A;  2W40 A;  4B1Z A;  4FL9 A;  3K57 A;  2DPN A;  1ZBU A;  3CPE A;  4FJX A;  5KRS A;  3CF5 L;  2UXC K;  4OPK A;  4BWM A;  4Q0B A;  3C95 A;  4B1W B;  3LWM A;  2G8F A;  1HQE A;  3TPQ A;  4DUZ K;  1T3V A;  3H3O B;  5C15 A;  4DUY K;  3PIO L;  2FLO A;  4CEF A;  4ISG A;  4CZL A;  4JI2 K;  1IKY A;  3MN9 A;  1LAV A;  2GUI A;  4KB0 A;  4L3Q A;  3CXC M;  3OYB A;  3TAE A;  2ZE2 A;  3AVA A;  1YAG A;  2ZWH A;  4K25 A;  3HOS A;  3RVC A;  3TAN A;  3HJF A;  1SKW A;  4FWQ A;  2OZS A;  3KKR A;  1S1V A;  2ZJQ L;  4IFY A;  3QEV A;  3J7A P;  1B92 A;  2ZM6 K;  5JVH L;  1S1U A;  4FW2 A;  4DHY A;  2LSN A;  4DU4 A;  5BRD A;  3D45 A;  4JI5 K;  5JLF A;  3B6P A;  1W0H A;  3FZF A;  2QI2 A;  2NRZ A;  4CHZ A;  3KJV A;  1BGX T;  4AHC A;  4C1N I;  1DTT A;  2E1Y A;  3V9W A;  3AVC A;  3EE9 A;  4H4O A;  2HVH A;  3EL2 A;  4NCB A;  3KLF A;  3LDS A;  1VSL A;  3VOV A;  3THX A;  3AA5 X;  2VWB A;  1TYQ B;  1SKS A;  1YT3 A;  5M1F A;  1HNZ K;  1C0M A;  1HMV A;  4BDY A;  3NCI A;  4CJV A;  4GVM A;  4BG9 A;  4CF0 A;  5FPE A;  2E2N A;  1EX4 A;  2QK9 A;  2VGN A;  4UY8 O;  3O08 A;  4NYF A;  1SS6 A;  1SL1 A;  3FLC O;  2VWK A;  1TYQ A;  3M3Z A;  1G99 A;  3O4W A;  1HPZ A;  1NBW A;  3AO3 A;  4O8U A;  1QQO A;  2QW9 A;  4CIF A;  3HT3 A;  1N5Y A;  3LAN A;  4ICL A;  2A3Z A;  1C0G A;  3AGK A;  1HYS A;  2G8I A;  4IWV A;  3O4N A;  4KHW A;  2KHO A;  4MDA A;  2KLA A;  3HM9 A;  4KHQ A;  1JL2 A;  3MN7 A;  1WOQ A;  3DLG A;  2I7P A;  1QQM A;  4BC2 A;  3R9P A;  4KRF A;  3J7Z O;  4RW9 A;  1Q18 A;  3W0L A;  3DXM B;  1S22 A;  4N76 A;  1P90 A;  2ASO A;  1LW2 A;  5M1Q A;  3BUZ B;  3AV9 A;  2FSK A;  2YHA A;  4FWL A;  3M6G A;  3KTQ A;  1NGF A;  3CCR N;  2DY4 A;  3QEI A;  2I5J A;  2ZJP L;  3VQA A;  3CJC A;  1DTQ A;  3DXM A;  3V1O A;  3T19 A;  4CHQ A;  1J9A A;  3LDQ A;  4M41 A;  5AQV A;  3DLR A;  2PBD A;  4B08 A;  3OYE A;  5I9E B;  4CEA A;  4AM7 A;  5KRT A;  2NUB A;  4FLT A;  1SKR A;  4E3S A;  2GEL A;  4IXC A;  3OYI A;  5BN8 A;  4E7I A;  4FJ5 A;  1NLV A;  1Z26 A;  3D7E O;  5C2D A;  4OGC A;  3OVN A;  3CJ9 A;  2CGK A;  3KLE A;  4IOA L;  4CGH A;  2Y1I A;  4LH4 A;  3D0P A;  1V4T A;  3OBY A;  4IBN A;  2QXF A;  1J5O A;  4CK3 A;  5CZ1 A;  1Q86 O;  1Q81 O;  3O5B A;  4YOY A;  4Y1C A;  3A5O C;  3O3G A;  4JI3 K;  4FOE A;  4CJK A;  2RN2 A;  4JI6 K;  3MN5 A;  4LY7 A;  3PLA A;  4FWM A;  3O1W A;  5BRH A;  3HPG A;  1BOT O;  3AA4 A;  4CEB A;  3MXM A;  1W97 L;  3QLH A;  3OHR A;  4FJJ A;  4CIG A;  3VA3 A;  3DRS A;  3SAF A;  4DTP A;  4BRE A;  1JL1 A;  3EEQ A;  2V52 B;  3AO5 A;  2F96 A;  3KWI A;  1T7P A;  1QHA A;  1SQK A;  1VSH A;  1KVA A;  3UB5 A;  1KQS M;  1GLC G;  4HCC A;  2ASM A;  3NH2 A;  2PZS A;  4DKW A;  2E8A A;  4DFJ A;  4FJI A;  5HRN A;  2ATQ A;  5LJV A;  1WB9 A;  3SLC A;  1BIZ A;  1C0F A;  5AQU A;  3MX2 A;  5K14 A;  3BEX A;  1Z25 A;  3MCP A;  4PKI A;  4B9U A;  3ZCM A;  5J2P A;  4OKE A;  3NF7 A;  3VEY A;  3AO1 A;  4A5B A;  4IFV A;  3LM9 A;  3RMD A;  1S1X A;  1WSG A;  4JKH A;  3AA2 A;  2Q1N A;  4UQG A;  3T69 A;  2VWJ A;  1LWC A;  1X9S A;  3CJB A;  1I39 A;  2AP1 A;  1QSL A;  3F9K A;  3TSP A;  1CLQ A;  4HUE A;  3LP2 A;  2A42 A;  3E66 A;  3AAR A;  1OVQ A;  2PY5 A;  4FVU A;  4DR2 K;  2YV0 X;  2EWS A;  4FJM A;  4BC4 A;  1JLA A;  4WFN L;  1JJ2 M;  2F9T A;  4W5R A;  1NMD A;  4O0J A;  3QML A;  3OJU A;  3ZX2 A;  1XC9 A;  4IOX A;  4JKA A;  4J2E A;  3VMF B;  4R5P A;  3B8A X;  1TKZ A;  4C8K A;  4O44 A;  4YOX A;  4WFA L;  1KAX A;  2ZGZ A;  2J4R A;  4B3S K;  4BRO A;  2NZT A;  1U48 A;  3WNG A;  1LW0 A;  1RT5 A;  1NGJ A;  4IJN A;  3O1B A;  4DV4 K;  3E9P A;  4FWR A;  1NGG A;  1X3M A;  4FWN A;  4DV1 K;  1FJG K;  3BY5 A;  3CIP A;  2O8E B;  2VQF K;  4A5A A;  1MDU B;  4DSF A;  4JK8 A;  3CC2 N;  1WN7 A;  1NOZ A;  3LDP A;  3FFK B;  5I42 A;  2YX6 A;  4O4G A;  4BDP A;  4KBO A;  1KTQ A;  1HYZ A;  4M3Z A;  1OH8 A;  2O8E A;  4JD2 B;  4FZX C;  5GIP A;  3EO3 A;  1X1P A;  1REV A;  4CGF A;  4EP4 A;  1XMO K;  3KLH A;  3NMU A;  3CCM N;  2HNZ A;  4DB3 A;  4F8R A;  3OTO K;  4FJ8 A;  4X65 K;  2QWM A;  4DTO A;  3NVK A;  4DR6 K;  4PY5 A;  1RDW X;  2ZGY A;  1S9G A;  4JKD A;  3HXM A;  1E4G T;  3LPT A;  5AQX A;  4GV9 A;  1KSP A;  4JD2 A;  5AQM A;  2H3G X;  3O9T A;  3VF6 A;  3NFA A;  2UUC K;  2QWN A;  2WBN A;  3DI6 A;  3DLE A;  3WXI A;  3ATU A;  3A5M C;  1TV6 A;  1VRU A;  4CJR A;  4CJ5 A;  4CE9 A;  3VQE A;  4E1N A;  3NHG A;  4PQU A;  5MLC Q;  5BPN A;  3QBX A;  4C8N A;  4IDK A;  1RDU A;  3S3O A;  5KPR A;  1VSM A;  2OPP A;  1BCO A;  2Q0U A;  3UKR B;  3LPU A;  1YIJ N;  4CJ7 A;  3VQP A;  1W7A A;  3JS6 A;  2CGL A;  2ITM A;  3OYN A;  3WNE A;  1YIT N;  3L4Q A;  4CFA A;  1EP4 A;  3I0R A;  4LF5 K;  5AJ3 K;  3V6D A;  4H8K A;  5GAE P;  3F73 A;  3UKR A;  1XMQ K;  4HWI A;  3WXK A;  2E88 A;  3TSQ A;  3C6H A;  5AQQ A;  3P83 D;  1XHZ A;  3SQ2 A;  2XRI A;  4AQY K;  4DG1 A;  1WAJ A;  1IJJ A;  4RWT A;  4IEI A;  4J8F A;  1EWQ A;  2Z1G A;  4RW6 A;  3CME N;  3IDH A;  1VSD A;  2E5L K;  4BC3 A;  3CQY A;  4XH1 A;  1HR0 K;  1VQN N;  4H03 B;  3VQ9 A;  4EZ6 A;  4LC9 B;  2VG6 A;  1BG3 A;  4OGE A;  1BIS A;  3RRH A;  1HNX K;  4V19 S;  3TR8 A;  3TAP A;  3IFR A;  3KIO A;  1J5E K;  4H5T A;  3S41 A;  4CI6 A;  1BCM A;  4QOZ B;  4FWS A;  1K8K B;  3LAK A;  5M1P A;  4EZ9 A;  4N47 A;  5DK5 A;  1Q82 O;  2NRR A;  5AQN A;  3ULE A;  3CM5 A;  1SL2 A;  1ZBI A;  3CI5 A;  2HBK A;  4FPB A;  1FXX A;  4BR9 A;  5BPL A;  4JV5 K;  4KFB A;  5J2M A;  1RT7 A;  3EKU A;  1K8K A;  1KVB A;  3AO4 A;  4H5V A;  4NXM K;  3QO9 A;  4AIL C;  4O5F A;  2KFZ A;  4JI8 K;  3QNO A;  3OYL A;  3IAY A;  4AF1 A;  3LDO A;  3MED A;  4ZTF A;  4AHR A;  2YJF A;  4KTW A;  1QE1 A;  1NJX A;  4FWP A;  5ADX A;  2HW3 A;  4DSK A;  3NAE A;  1EQY A;  2E6M A;  4OJR A;  1TKD A;  4CZH A;  1RBV A;  4BRQ A;  1L3T A;  2YHW A;  5KPZ A;  4FLY A;  1ASU A;  1SZ2 A;  5LY3 A;  1VQ7 N;  1VQP N;  3J80 O;  3K5M A;  3L0Q A;  4RG8 A;  3VQ4 A;  1C0T A;  3K9K A;  2O8D B;  2HMP A;  4MO4 A;  1F21 A;  3CCV N;  3B6O A;  2FF6 A;  4CBW A;  1EKE A;  5EXW A;  4CF9 A;  4BR0 A;  1D9D A;  3C65 A;  4BR2 A;  4DSI A;  1IKX A;  2QKB A;  3ZET B;  4DFM A;  1YJ9 N;  2O8D A;  5HRO A;  3N4Q A;  3OYD A;  5C24 A;  5SZT A;  1RDC A;  3OW2 M;  1RTI A;  1GOB A;  1HNW K;  2HHS A;  4XEI A;  1U45 A;  1YTU A;  4DTJ A;  1LWF A;  2QXL A;  1H1V A;  2KFN A;  4K0K K;  1C6V A;  3ZET A;  5D3G A;  4W5N A;  5AQT A;  1GOC A;  1NKC A;  1M90 O;  1EET A;  2RF2 A;  3QES A;  1BWF O;  3H3N O;  3CMA N;  4BWJ A;  2P5G A;  1S6Q A;  3HRG A;  4ILG B;  4JI7 K;  3OBW A;  4BRA A;  3THW B;  5J2N A;  4CHN A;  4H0T B;  4FYD A;  3J7Y P;  4O5B A;  3OYF A;  1TL3 A;  3SUP A;  1GOA A;  3SCX A;  1HX1 A;  3TU5 A;  3VQ8 A;  2VQE K;  4CJL A;  2UU9 K;  4DV6 K;  3K5O A;  2XHB A;  4A62 A;  4HVJ A;  2YHY A;  1K73 O;  1NGH A;  2IIR A;  2QM1 A;  3THW A;  2Q97 A;  1DKG D;  1XHX A;  3LP1 A;  2AJQ A;  2YNH A;  4CZJ A;  1RFQ A;  1K9M O;  5JIC A;  2NRH A;  1NGD A;  3DXK B;  2GWJ A;  1GLJ O;  3OS2 A;  4Y1D A;  5TKY A;  4M3T A;  3LWL A;  4BR7 A;  3SBT A;  4NB4 A;  4C8M A;  1V4S A;  3AVL A;  2F8T A;  1JCF A;  5HRR A;  1WSE A;  2YNF A;  4EP5 A;  1KFD A;  2YCH A;  3DXK A;  4FK4 A;  3MK6 A;  3V1R A;  3D2F B;  4CEZ A;  2IDO A;  3AA3 A;  4LSN A;  3TTD A;  3TAQ A;  4HCB A;  2A41 A;  1O13 A;  3VES A;  3OJS A;  1RTH A;  4JKF A;  2ZJR L;  4DV0 K;  3H1Q A;  2BGG A;  2FBV A;  3D2F A;  4FJL A;  1ZC6 A;  1TK8 A;  4ISF A;  3EZW A;  3VQ7 A;  3M8R A;  5AQI A;  1RT6 A;  2KW4 A;  3HST B;  3P4I A;  3ASM A;  3PIP L;  2E20 A;  2OAN A;  3NF6 A;  1HQU A;  2P9L B;  2IVP A;  3THX B;  2UXD K;  4CEE A;  4WF9 L;  4OO1 J;  3DJC A;  1ZBL A;  4Q5V A;  4ID1 A;  3U3G A;  5C12 A;  4KPY A;  4U7B A;  3AVF A;  4B1V A;  4JKE A;  4CFD A;  3CER A;  3VPZ A;  2P9L A;  4DLG A;  3SZ2 A;  3VQC A;  4EAH D;  1BU6 O;  4ZHR A;  1N6Q A;  4RCH A;  3V9S A;  2YKN A;  1VQ5 N;  3VEW A;  3HVT A;  4KKO A;  4M3X A;  3JSM A;  3MEC A;  3VGL A;  3NH0 A;  4JK7 A;  4BC5 A;  3OYK A;  4CGI A;  5F0X A;  4Z4E A;  5JMV A;  3QIP A;  1SAZ A;  2R7Y A;  2OZM A;  3LDL A;  3J8A A;  3CC4 N;  4EFH A;  1YVU A;  4HUF A;  4NYN A;  1ASW A;  4WFB L;  3H1V X;  4CJ4 A;  2Q0R A;  3GBT A;  3CCU N;  4Z4I A;  5FDL A;  2A1S A;  3SMS A;  4CES A;  3G25 A;  2CH6 A;  4YDU C;  2QA4 N;  4HTU A;  1QSY A;  1BIU A;  2QWR A;  2A5X A;  2P9S B;  5LMU K;  3AVI A;  1ATR A;  2FBY A;  4CFB A;  4C23 A;  1WUA A;  5AFU A;  1RNH A;  1NM1 A;  1TAU A;  3U9D A;  1LAW A;  3ZT0 A;  3A5N C;  1JXE A;  1WSI A;  4DSJ A;  5AQZ A;  3VA0 A;  5EY4 A;  3I8D A;  1Z6R A;  3PSF A;  3RR8 A;  3GDQ A;  3CJ7 A;  3C94 A;  4E19 A;  2P9S A;  3S9H A;  3IS9 A;  3CET A;  4NXN K;  1NKB A;  3ENO A;  3L2R A;  3CQ8 A;  3BZC A;  3FZK A;  3I33 A;  4BRC A;  5E41 A;  3NE6 A;  5ADX H;  2D0B A;  5CYM A;  2NRW A;  1KD1 O;  4YOW A;  2Z1H A;  5DMR A;  1HJO A;  3H45 C;  1RBS A;  3VEZ A;  3SUN A;  5KI6 A;  2NNW A;  1VSE A;  2GBZ A;  2OTJ N;  1NK7 A;  1K6Y A;  2XY7 A;  3OA9 A;  3V9U A;  4HTL A;  1VK0 A;  1ZBS A;  1QQN A;  3BP8 A;  3C7N B;  3LAL A;  5GAH P;  3SYZ A;  1A5X A;  4A57 A;  1NK8 A;  2XY5 A;  1G15 A;  4CJQ A;  3K9J A;  4DSE A;  2D0O A;  4OX9 K;  3WQT A;  1S5J A;  4KI4 A;  4EHT A;  1LV5 A;  3LM2 A;  4AHT A;  5HL7 L;  3CD6 N;  1VQ4 N;  4A59 A;  1QSS A;  3DMJ A;  3C7N A;  4BQL A;  4CJF A;  3NGZ A;  3SUO A;  1HKB A;  3ENB A;  3WNH A;  1J54 A;  1Y97 A;  1X9M A;  2A40 A;  4H0V B;  1WSH A;  3V4I A;  3FR0 A;  2OYQ A;  3SJJ A;  3VGM A;  4IJA A;  3H46 O;  4FLW A;  1OVY A;  5JS2 A;  5F1X A;  4LF6 K;  4DR1 K;  4JS5 A;  1XUP O;  1RT3 A;  1S1T A;  1RBT A;  5CE3 A;  1RBU A;  3MXI A;  1L3S A;  4BE0 A;  2VYP A;  4MO5 A;  3M8Q A;  3RRG A;  4CK2 A;  4YOV A;  4E0D A;  4YDU A;  3U3Y A;  4MFB A;  3DRR A;  3L3V A;  1KXP A;  4MDB A;  4CW7 B;  4FK2 A;  4W5T A;  1TKT A;  3LZJ A;  4FWK A;  4M3R A;  1B9D A;  2VG7 A;  4JKB A;  4AM6 A;  3FZM A;  4H5W A;  3BGR A;  3ENH A;  3SQ0 A;  4BR5 A;  4FVM A;  2BAN A;  3R3L A;  1QZ6 A;  3L4I A;  4KI6 A;  2HHX A;  1JCG A;  1WSF A;  4FW1 A;  3HM8 A;  1S6P A;  4GKJ K;  4F3T A;  1ZXO A;  3WXJ A;  3O3H A;  5KQ8 A;  4CEQ A;  4E1M A;  1Y64 A;  4E7J A;  1JXB A;  2JWL A;  2P9P B;  2O8C B;  1RTD A;  3HO1 A;  4GW6 A;  4B1X B;  4NCA A;  3NDK A;  4LF7 K;  4U67 L;  2YNG A;  4BRH A;  4CCH A;  3G71 N;  5AR0 A;  3HK2 A;  4RTF D;  3CCE N;  3ULD A;  2O8B B;  3ZYY X;  3THY B;  4I9L A;  3LP0 A;  2HMI A;  2P9P A;  4N5S A;  2O8C A;  3OYM A;  1NK6 A;  3ITH A;  5AQH A;  5JLH A;  4K41 A;  3K58 A;  2E2O A;  1QVF M;  4I6M B;  1NGA A;  5GAG P;  3BDP A;  1KLM A;  3EZ5 A;  3MWP A;  4DTS A;  2HBM A;  5SWM A;  2O8B A;  4K43 A;  3TAM A;  3VTH A;  1DGK N;  3THY A;  4ILJ A;  4C8O A;  3N4P A;  4M63 C;  1CXU A;  1CZB A;  3AVK A;  5CZ2 A;  4I6M A;  4PWD A;  5CHI A;  4CHP A;  4BRK A;  3WEE B;  3DYA A;  5HRS A;  4B9S A;  1SV5 A;  3VTI A;  1JLB A;  5EX5 A;  3VEO A;  1GLA G;  4KHS A;  3ZX3 A;  1IO2 A;  3W3D A;  1S9E A;  1MWK A;  4ISE A;  1NK5 A;  5GAD P;  5KGW A;  1D9F A;  4FLU A;  3WEE A;  4C1N K;  4DQQ A;  1W9H A;  3EE8 A;  1ESV A;  4H0O A;  2PYJ A;  4W5Q A;  4LH5 A;  3UKU B;  1HKC A;  3PUF A;  3SQ4 A;  4DCH A;  2YNI A;  1NGC A;  1SUQ A;  4BRG A;  1QTM A;  4IG0 A;  2KZM A;  1TL1 A;  2UUA K;  3HP9 A;  5EOY A;  3UKU A;  2HHT A;  3OYC A;  4IG3 A;  3HYF A;  3PX6 A;  1NWK A;  5CR4 A;  4K8Z A;  4YOT A;  4IDH A;  2Q31 A;  3OY9 A;  1IH7 A;  4JRQ A;  1XC3 A;  3U6F A;  2P1J A;  2QWQ A;  5BRE A;  2YHX A;  3G0Z A;  3CQX A;  2NLX A;  4C8L A;  4R79 A;  4N41 A;  2YI1 A;  3AAP A;  2E2Q A;  2G8K A;  5FLX O;  4B8C A;  3RMA A;  1VSF A;  3PO4 A;  4NLB A;  4B9N A;  3O9U A;  3TAB A;  3AVG A;  4B9V A;  4KO0 A;  3TI0 A;  1OH6 A;  2RPI A;  1YUW A;  4RW7 A;  3TTF A;  2P9K B;  5AFU H;  2QWO A;  2WC9 A;  4JEP A;  2IVO A;  5AQS A;  2OPR A;  3SJH A;  1N33 K;  4GMJ B;  3MMV A;  2Q3S A;  1UA0 A;  3L6Q A;  1QQC A;  3E9L A;  4CF1 A;  4KRE A;  2P9K A;  5DM6 L;  1RTJ A;  1CZA N;  3HBT A;  4O0I A;  2UYT A;  3LAM A;  3MCA B;  1VQL N;  4DV7 K;  4I2P A;  2DFH A;  3O80 A;  4DTU A;  1ZYQ A;  2V7Z A;  2FF3 B;  4M7Y A;  4KHP K;  3VEX A;  3NF8 A;  4WQ5 C;  4IO9 L;  2E2P A;  2WOM A;  2D1K A;  4GNI A;  1U47 A;  3V81 A;  1E4F T;  2O4I A;  4EIA A; 
#chains in the Genus database with same CATH homology
 5LL6 Z;  4X66 K;  4DV5 K;  4LFB K;  3J7Y P;  4LF9 K;  4YHH K;  1I94 K;  4JI0 K;  2F4V K;  4LF6 K;  2VQE K;  4DR1 K;  2UXB K;  2UU9 K;  4DV6 K;  4JV5 K;  4DR5 K;  2UXC K;  1XMO K;  1XNR K;  3OTO K;  4DR7 K;  4X65 K;  4NXM K;  4DR6 K;  4B3R K;  4GKK K;  4CW7 B;  4DUZ K;  1IBL K;  4DUY K;  4JI8 K;  4CVN E;  2UUA K;  4JI2 K;  2UUC K;  2HHH K;  4LF4 K;  4JI4 K;  4LFC K;  3J81 O;  5LMU K;  4JYA K;  4GKJ K;  3J7A P;  3T1Y K;  4DR2 K;  2ZM6 K;  4DV3 K;  3J80 O;  4X62 K;  4NXN K;  4LF7 K;  5FLX O;  4JI5 K;  4X64 K;  4B3M K;  4YY3 K;  4JI1 K;  4DV0 K;  4B3T K;  4LF5 K;  5AJ3 K;  4DV2 K;  5IWA K;  1XMQ K;  1N32 K;  4LFA K;  4DR3 K;  4B3S K;  3JAM O;  2UUB K;  4AQY K;  3T1H K;  1N33 K;  4JI3 K;  2E5L K;  1HNW K;  4DV4 K;  1HNZ K;  5IT9 O;  1IBK K;  1HR0 K;  4JI6 K;  4OX9 K;  4DV1 K;  4K0K K;  2UXD K;  5LMN K;  4DV7 K;  1FJG K;  1N34 K;  1HNX K;  4V19 S;  5BR8 K;  1N36 K;  4DR4 K;  4KHP K;  2VQF K;  1XNQ K;  5A2Q O;  1J5E K;  4LF8 K;  1IBM K;  4JI7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...