4NXNK

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4nxnK00
5LL6Z 4V19S 4CVNE 4DUZK 3J7AP 1IBKK 2UU9K 4AQYK 5BR8K 2HHHK 2UXDK 4JI1K 4KHPK 4LF5K 1I94K 4DUYK 3JAMO 4NXMK 5FLXO 1XMQK 3J80O 4LFBK 5AJ3K 4B3MK 4LF4K 4JI4K 4JV5K 3J7YP 3T1HK 4JI2K 4JYAK 4DR3K 2ZM6K 4B3TK 1N32K 4DR7K 1HNZK 4GKKK 1N33K 4LFCK 4DV0K 2F4VK 1HNXK 1HR0K 4DV3K 4DV1K 5LMUK 4DR2K 4LF9K 1XNQK 4GKJK 4K0KK 1IBLK 2VQFK 4DV4K 4DV2K 4LF8K 4X66K 4JI3K 1N36K 2UUCK 2UUAK 1N34K 4JI5K 1FJGK 5A2QO 1XNRK 1XMOK 2UUBK 4YY3K 4DV6K 4NXNK 4DV5K 5IT9O 4X64K 4X65K 4B3RK 4CW7B 4B3SK 4OX9K 1HNWK 4DR1K 4JI0K 4JI6K 4DR4K 2VQEK 5LMNK 3OTOK 4LFAK 4YHHK 4X62K 1J5EK 4JI7K 3T1YK 4DV7K 2UXBK 5IWAK 3J81O 2E5LK 4DR6K 4LF6K 4LF7K 2UXCK 1IBMK 4JI8K 4DR5K
chains in the Genus database with same CATH superfamily
4B9MA 3H3NO 4BC3A 1KC8O 1YTUA 1TK0A 3ZCMA 3B8AX 3NF7A 4RWTA 4DTPA 2WONA 3SJJA 2EHGA 3AGRA 2DPNA 2O4IA 5CYMA 1XC9A 3K5LA 2D0CA 5EXWA 2WUSA 3F9KA 3CCEN 2E1ZA 4IFVA 3OS1A 3NE6A 4E1JA 1NGJA 3F5TA 4CHZA 1K9MO 4W5RA 3FLCO 4H5TA 3QEIA 4KO0A 2WTUA 1VHXA 2QM1A 2VYPA 3CD6N 4WFAL 1WSIA 1J6ZA 4OGCA 3KHYA 1IH7A 4DR3K 4IJNA 3SQ4A 1Q9YA 1X9SA 1UOCA 2AA4A 1NJWA 1XHZA 1BU6O 4ISEA 4AM6A 4JEPA 3V9UA 3HPGA 4OKJA 5I9EB 2X6NA 1WBBA 3A5OC 1FW6A 1NK0A 5C0YA 2AP1A 3VESA 2VG6A 1BDGA 5AQRA 1RDBA 5EX5A 3SBTA 4EHTA 4IJAA 3OS0A 3CMEN 3O6WA 3H45C 4FJNA 3NF9A 5FPEA 4F2RA 2UUCK 3CPEA 3FE1A 2RE2A 2DFEA 3OYNA 4I9LA 4YOTA 3H1VX 3QIOA 1L5UA 2FBTA 2FF6A 4I2QA 3BGRA 2ZQBA 4BRFA 1R0AA 1RT4A 1EETA 4O5BA 3RRHA 4CHPA 2NRVA 1YITN 3DOLA 4CBXA 2YX6A 2KZMA 4WQ4A 1TK5A 4B9QA 3MEEA 3OTOK 3PSFA 4AF1A 1BCOA 5AQMA 3C6TA 3SUPA 2O8DA 1Z6RA 3VEWA 1GOBA 1T3VA 4FLWA 4CZMA 4OO1J 3SZ2A 3G71N 5E84A 4I7FA 3ZSYA 3CC2N 4ELTA 4IDKA 4KB0A 3C6HA 2Z1GA 1BO5O 3CYMA 4WQ4C 4NYNA 4H0XB 4J2EA 4W5OA 4KHYA 1T05A 2B5JA 3CQYA 4XH1A 4L8RB 1TV6A 3IAYA 4DU1A 1NK9A 4CJ3A 4CIFA 4LSLA 3KVGA 2PZSA 3VEXA 1SL0A 4FSVA 4Z4IA 3AVJA 4DTXA 3HK2A 2XY6A 3L2QA 3ZSWA 3P5JA 3VQAA 5JLFA 3I56N 3HBTA 1VQ8N 1Q8IA 2HB5A 3CXCM 4UY8O 2D1KA 3OYGA 4CI6A 4JI4K 2ASOA 1HYSA 3T1HK 3RSEA 4NYFA 2QXLA 1W0HA 3OHRA 4B3TK 3F9MA 5KRTA 3EN9A 4DSEA 2D0AA 2IC3A 2IS3A 3J8AA 3VF2A 3NMUA 1KFDA 2JWKA 2CGKA 1KRPA 3LDSA 1JLAA 2OZSA 3D2FA 3V6DA 1SKWA 3V9SA 2HF3A 3KK3A 3AV9A 4NCGA 1V4SA 2BUPA 1S1UA 3CCLN 2F96A 1QS4A 2P9SA 2RKIA 3E1YA 3K5OA 1ASWA 3MCPA 5KQDA 3KWIA 4CJ7A 3DM2A 4CZKA 2O8BA 3HTVA 4EZ6A 4CECA 1QTMA 5SWMA 1QQOA 4KBOA 3WQUA 1YTAA 4FJ7A 1RBUA 1VSIA 3AAPA 5TKYA 4H0YB 3N4PA 3MN9A 1YIJN 4ID5A 3SQ0A 4FWOA 3O08A 1VSDA 3DXMB 4IWVA 5D3GA 2EX3A 3MEDA 4G1QA 3OBWA 4YHHK 3CJCA 4HTLA 5GIPA 3VENA 3NGIA 2ZWHA 1ZBIA 1L3VA 1B9DA 3CCJN 5IWAK 3J81O 3MXMA 3L8BA 1WN7A 4CIGA 1BG3A 4FJKA 4DSJA 2E6MA 5LL6Z 3K0SA 4H5RA 4WFBL 4OLBA 5C10A 1RTHA 3VQEA 4DWIA 1B9FA 3DLGA 3WT0A 4JI1K 1S1WA 3G0ZA 2GUIA 2QTDA 3TSQA 5AFUA 2YNIA 3VEZA 4BVPA 3NBPA 3GOIA 2KQ2A 4HUFA 3M1FA 1SAZA 3OYFA 2PFUA 3PUFA 1Q7YO 3IS9A 4B3MK 2RN2A 3DLEA 4KKOA 1C1CA 3LANA 2VG7A 3VQ9A 1KVBA 1ZBUA 4H5VA 4DQIA 4B3OA 1CZAN 1HJRA 5DM7L 4HUGA 1NJIO 4FVMA 2DFFA 1N5YA 1HNZK 4GKKK 4LFCK 3ALYA 4KH5A 4FJLA 1VQ7N 4FM1A 1S6QA 3I33A 3HJFA 1SV5A 1HQEA 4GVMA 3CCRN 2IGIA 1SKRA 1HYZA 2O8DB 4K41A 2ETJA 2D0BA 3R8EA 2HNYA 4JI3K 3NDKA 3AVKA 2UUAK 3FZMA 3H6EA 1N8RO 4PWDA 4B9NA 1WSJA 2A6AA 4DV5K 1ATRA 4LSNA 4DG1A 4CZGA 3QFPA 4ID1A 5MLCQ 5BRDA 1VQLN 1VQ6N 3AA2A 4OPAA 1IKVA 4BWJA 2E88A 3ID8A 4CBUA 5LJVA 1NJZA 3PIOL 2W42A 2NZTA 3D7EO 1VQPN 4FW1A 2PAVA 3AVBA 3KKRA 4KPYA 1WBDA 2F9TA 2LSNA 3QICA 1BA1A 4FWKA 4Y1DA 2HSTA 1BISA 3TPQA 2Q36A 4H5WA 1IBKK 3VQDA 3QBWA 4V19S 3HM8A 3MWTA 3VGMA 4WF9L 1BA0A 3M8PA 3TARA 1XI1A 2GV9A 3ULEA 3L2RA 3P38A 2E2QA 4DQ8A 1NBWA 3ZT4A 4KFBA 3P31A 1WOQA 1H1VA 1HKGA 1I3AA 4NLCA 3AO3A 3FZHA 4K8ZA 3D2FB 4CEOA 4Z4EA 2P9UA 3PO4A 4O8KA 1X9MA 4CJ5A 4JKHA 3AGKA 3CM5A 1WLJA 4LD0A 3MX2A 4NCAA 3OW2M 1J53A 1VAZA 1S9EA 4CZHA 4FOIA 3VN5A 1LAWA 4M3XA 1RT6A 4MDBA 1J5OA 1GLAG 5FRNA 2VWBA 1LWCA 1U2VB 4OKKA 2E4LA 2QWRA 5JS2A 2HHTA 4RG8A 1NK4A 5HRSA 2YNHA 2O8FA 2QKKA 2R7YA 2NRHA 3O8MA 3VA3A 4GW6A 4KHWA 2CGLA 3BZKA 1X3MA 2A5XA 4CF1A 4FZZA 1N34K 4CJKA 3CJ1A 3SV4A 3BUZB 3MX5A 1IO2A 5GAHP 2WC9A 2UUBK 5HRRA 4YY3K 5JVGL 4W5NA 2VGNA 3V4IA 4O55A 4BDZA 1QQCA 3I0SA 4YOWA 4FWNA 5ELZA 3HOTA 1YXQA 1LWEA 1D9DA 5C25A 4LH4A 4DR4K 2GELA 3TTCA 4QOZB 3WNGA 3RTVA 2YHXA 3HVTA 1RDWX 1JXEA 1HKCA 5EVZA 1OH6A 4BR7A 4X62K 4GMJB 4CD3A 4CZLA 3CHWA 1BGXT 2HHXA 1S72N 1Q86O 4KI6A 4DKWA 1QE1A 5CHIA 4DFPA 3J7AP 1VSKA 5HROA 4EP5A 3HPOA 4FJXA 1E4GT 1DKGD 3TI0A 3ZT1A 4M3RA 2KFNA 3OYMA 4FWQA 3HXMA 4FK0A 4JD2B 5ADXH 4DFMA 2KLAA 5FLXO 5GADP 4JS4A 3IG1A 4H0TB 5BREA 3OJUA 3A0IX 5AQHA 3SLCA 3VQPA 4CF9A 2QWLA 2X74A 4IOXA 5FPDA 3KD1E 4CEZA 3LDNA 4B1ZA 3ZETA 3SUOA 4E19A 3SQ1A 3U6FA 4FLVA 1IG8A 4DV0K 2HBJA 1C6VA 2E8AA 4GKJK 3CETA 3ENHA 4DV4K 3T69A 4LC9B 4CJTA 3O3HA 4CIEA 4DSIA 4BRAA 4KHQA 2HBKA 1KAZA 2B4JA 3CM6A 1RFQA 3O1BA 1JL2A 1C0MA 2V7ZA 3WXKA 2FBYA 2XRIA 4FJMA 3G4SN 4DQSA 2P9IA 3OYAA 1YVNA 4OJRA 2AJQA 3ULEB 4CGHA 4W5QA 4DTMA 4FM2A 5AQSA 2G8FA 3LP1A 4CJ4A 3AA5X 3H1QA 3L2VA 1UWBA 3C94A 3O4WA 1M90O 2NNWA 4JK8A 3PV8A 4JKCA 4CFDA 4J2AA 2P9UB 3T3FA 1X9JA 2HVIA 3Q7BA 4JI7K 1S6PA 2IDOA 5AQZA 1BIUA 3HYFA 4CGIA 2E5LK 4DR6K 4QS9A 1FKPA 3OYJA 2OYQA 4J2BA 4O44A 2PYLA 3L4IA 2HNZA 3BF1A 3VF4A 1ZXOA 3K57A 5AQQA 3LP3A 1UA0A 2RPIA 5GAEP 2HMPA 1TAUA 4MO5A 4FLUA 4KHPK 4CJRA 1NGHA 3IMXA 1VK0A 1K8AO 3SAFA 2O8FB 4CF2A 3OBYA 4B1YB 2I7PA 4CK2A 3A5LC 2VG5A 4F8RA 4O5FA 3C0BA 4LF4K 4KHNA 1N6QA 3VEYA 4BR9A 3SMPA 3QNOA 1GOCA 5C2DA 4EZ9A 2YNGA 3DXMA 1N33K 5AQNA 1VRTA 3W0LA 3JYTA 2XY8A 4KTZA 1CZBA 4DV3K 4DU4A 3T19A 4Z4HA 1QZ5A 4E7HA 4C8NA 4FLYA 3DLRA 5HOOA 3LWMA 4DTRA 4RW8A 2VWJA 3SCXA 4LF8K 4ISFA 2BGGA 2YKMA 3I8BA 1RBTA 5KGWA 4BQLA 4DHYA 1CZ9A 3KLEA 3O1WA 3CF5L 4C8KA 1XNRK 4GV9A 2GTDA 4FJ5A 4DV6K 3KTQA 3RVCA 5B8HA 1NJXA 2KTQA 4DSKA 4B3RK 1TVRA 4H03B 1TKZA 2OPRA 3V81A 4CEQA 1JXBA 1L3TA 2YJEA 2V52B 1C0TA 2KFZA 3NVMA 1MWKA 3FGUA 4H5NA 1HNIA 4FZXC 1LOTB 4JK7A 1NMDA 1ZC6A 2UXCK 4NCBA 3QERA 3FZKA 4PKIA 2JGUA 4DR5K 3O9UA 5AQLA 3U9DA 1GLDG 3ZETB 1MU2A 4YNQA 3OS2A 3PX6A 4RTFD 3JXUA 4RW7A 5CZ1A 2FF3B 1NG9A 3SPYA 3QB0A 3VEOA 4A61A 2OTLN 2P5OA 4CHOA 4BE2A 1TL1A 4EIAA 1JLEA 1W97L 4U67L 1G15A 1NGGA 3V9XA 4CJUA 4ILHA 4GV6A 4WYBA 4CEEA 1U6ZA 5AQTA 5CYQA 3U4LA 4IEIA 1BQNA 4CZEA 3E01A 1RT3A 4CD1A 3UIQA 4MFBA 3NFAA 3R1XA 4K25A 3ZSXA 3Q7CA 5CY4A 4MLHA 2P9IB 3U9ZA 4FWMA 2YI1A 3SI6A 1ATSA 1UA1A 3KWGA 5M1FA 3CFPA 1SL1A 4NO7A 2W6KA 4A2BA 3K5NA 3V1QA 1NK5A 1KAXA 1S9GA 4HTUA 2X6SA 4LF9K 1LCUA 3HSCA 3DLBA 3ATUA 1RT2A 1IBLK 1EXQA 4KB1A 3MDQA 3VPZA 4C1NI 1NKCA 4HHTA 5AQYA 4M41A 1T03A 3HPHA 3A5NC 2OPQA 4DTNA 4FWRA 4A2AA 1QZ6A 4MDAA 4IO9L 4X65K 1BIZA 4WFNL 1KAYA 4AHCA 2QK9A 1HNWK 1I39A 1T8EA 1O1WA 4ZHRA 5J2PA 5BN8A 4E7IA 1A5VA 1KCFA 4JHDA 2XHBA 2Y1JA 3TANA 3TR8A 4Z94A 3MK6A 4CJFA 4LFAK 4FOEA 1DLOA 3DOKA 1LWFA 4FZYA 4M45A 2FSJA 5SZTA 4AHTA 1K73O 1IG9A 2A41A 4YOXA 3VERA 4LY7A 3F73A 1K6YA 4LF7K 4M3TA 3SJHA 3O4NA 4JI8K 1EP4A 4JNEA 5KPZA 3ZSRA 2Q97A 3UKUA 1QHAA 3CMAN 1U2VA 4BDPA 2YHYA 1ILYA 3M5RA 3ZSOA 3M6GA 3QMLA 4EP4A 3TSPA 4O4GA 3QEPA 3ZEUA 1HUXA 2CH6A 1NLVA 3VQ5A 3ZSZA 1T44A 4HWIA 3ZX0A 2G8UA 4BRQA 1NWKA 5F1XA 4NXMK 4CGDA 4M3UA 2YHBA 3AVLA 4M3YA 3L0QA 2HHVA 5AJ3K 2XY5A 1X3NA 4JKFA 3HOSA 1RGIA 4JKEA 4YOVA 3CJAA 4JYAK 3SAHA 2FSKA 1YHQN 3AVIA 4A5AA 3RR7A 3OYIA 1ZBLA 1HRHA 4CK1A 1BWFO 5KPRA 4XH5A 3VA0A 2FBVA 4E0DA 2DTUA 4LH5A 1TYQA 1F21A 3VQBA 3KLGA 3HRGA 4MLEA 5HBMA 3OJSA 4OPJA 3GG4A 2G8KA 4H8KA 4DS5A 3OA9A 4AHSA 1FJGK 4DS4A 1KVCA 1RTJA 3C95A 4WE1A 4TSXA 2W41A 5AQIA 3U3YA 3QESA 1C0UA 4JD2A 3IUCA 2D5RA 3BEXA 3VQ7A 3VGLA 1D4XA 3UKRB 4R79A 4AHRA 3QNNA 3WXJA 2D4WA 3C65A 2IVNA 5AQKA 4PY5A 1ZYQA 1OH8A 2GWKA 2OCEA 4FXDA 3MCAB 2J4RA 1RDDA 2HW3A 3S9HA 3NF6A 4AILC 5JICA 2A1SA 2W40A 1GLJO 4EAHD 4CVNE 3ULDA 2E2PA 3GDQA 2YNFA 3VQ4A 1X1PA 3L3UA 3TABA 2UXDK 5JS1A 3D0PA 3SPZA 3HL8A 2HHWA 3NCIA 4BRHA 1Z26A 4LF5K 1EX4A 4E7LA 3RMBA 3P39A 5M1KA 3AVAA 1NK8A 5KQ8A 3OYKA 3V1RA 3ZSVA 5GIOA 3OYBA 3V9WA 3DAWA 1OVQA 2W6LA 1KTQA 3AVCA 4E1NA 3SUQA 1VSMA 4FVUA 4B8CA 3LZIA 2Z1IA 4JI2K 1GLBG 4CGFA 1TAQA 3V9ZA 1JCGA 4B1XB 2ZE2A 4N47A 4BRLA 3DWLA 2Q3SA 4FYDA 1ASUA 4L3QA 1HKBA 4XH4A 3EE9A 3WXMB 4FK4A 3A2FA 1JJ2M 4WCEL 1FXXA 4JHDB 2NRXA 4CGJA 5C24A 1W9HA 3QO9A 4BDYA 3RR8A 1YT3A 3LP2A 3DLLL 1QVGM 1OH7A 2KHOA 1P8ZA 4PKHA 3L2UA 4OPKA 1MA9B 5AQOA 3CG7A 4CBWA 5CR4A 3K9KA 4CGGA 5I42A 3U3GA 1KLMA 3VF6A 4NB4A 5M1OA 3UKUB 1ATNA 4GNIA 3AO4A 4Y0WA 4IOCL 3RMCA 3VQ8A 4CK3A 3GE1A 1FKOA 1Q9XA 1BCMA 3HP9A 1BHLA 4OKEA 3NH2A 3ZEUB 3LDOA 3PLAA 1RBVA 3AVFA 1HX1A 3HP6A 3WUHA 4M63C 1J5EK 1QSSA 3MWPA 4DV7K 4U7BA 3NGYA 4BQZA 3THXA 2Q2RA 4XEIA 4QAGA 2NRTA 4CEFA 3NF8A 3R6MA 4O8UA 2Q31A 4CHNA 1DT9A 5AQVA 1HPZA 2QA4N 3OYEA 3ZT3A 4KRFA 3QEVA 2QXFA 3WNFA 1QSLA 5T7BA 1JCFA 4FPAA 5AZIB 1TYQB 2WFBA 2Z1JA 5JMVA 4DMNA 4FLTA 1WUAA 1YUWA 4FWLA 1VRUA 4KH4A 2NUBA 4Y1CA 4PUOA 2ZJQL 2ZJPL 4IBNA 3ZYYX 5HRNA 4I6MA 4ILGB 1YJ9N 1BUPA 5AQGA 2YV0X 2ZF5O 4BRNA 4GY2B 1Z05A 4M3WA 5E41A 1VSHA 2QWMA 4DR7K 5HRPA 3CC4N 2G8HA 1CXQA 4DU3A 2O8CA 4ISGA 1HR0K 4XIUA 5BPMA 3DLHA 2CGJA 3LDLA 4CZIA 2QWQA 3ZT0A 2VQFK 1U45A 3UE5A 2QKBA 2GUPA 4A57A 4YDUC 1NGCA 5I3UA 2ASPA 2YJFA 3H46O 3WNEA 3S3OA 2V51B 3L6QA 3QEWA 1QQMA 3MN5A 3EE8A 3MN7A 4A59A 4CZJA 1TGOA 3THWA 4M7XA 1CLQA 3TWHA 3DRPA 1NKEA 5F2RA 4DTOA 1D9FA 4CW7B 1NK7A 4B3SK 1KFSA 3FZFA 4B08A 4JI0K 1D8YA 1NGEA 1ZBFA 4JKDA 3C7NA 1RDUA 4FJHA 4M3ZA 3P4IA 2HHQA 1A5WA 4FJIA 3O9QA 3SV3A 3EZ5A 2YHWA 5AQFA 4I2PA 4J2DA 2XY7A 4FCYA 1HYVA 2FXUA 1K8KB 5LY3A 2PBDA 3LAMA 4DSLA 4DF8A 1Q82O 4B8AB 2OA8A 3EYZA 4BR2A 4CCHA 4I9QA 5GAGP 4FM0A 2JLEA 4BE1A 4DQRA 2HF4A 4BRKA 3JSMA 4BROA 4BWMA 3WXIA 4BRCA 5C12A 1KSPA 1ZBSA 3VQCA 1XMQK 4B9VA 1RILA 3VGKA 3KK2A 3D2EA 4Z4FA 4H0OA 4BRGA 4KAZA 4H4OA 2IIRA 3OYCA 3VQQA 1XQSC 4IXCA 2OTJN 5FPMA 4CFAA 4BACA 2VWKA 4C23A 2A3ZA 2ZM6K 2Q1NA 4Z0UA 1NGBA 4BE0A 3TAEA 4DLEA 1YI2N 5GINA 2F4VK 4Z4GA 1HNXK 3LDPA 3ZT2A 2QW9A 1NJYA 2GEMA 4QS7A 1MDUB 5HP1A 4KTWA 4K43A 1S1VA 2P9PA 1N36K 3DLKA 3A8YA 4UQGA 3THXB 1TL3A 1NU0A 1NMNA 1TK8A 2Q0RA 1C1BA 1GLFO 1XMOK 2G8IA 1ZBHA 4M42A 3QFUA 4KH6A 4CEDA 4JLHA 3WNHA 2WBNA 1CXUA 4ILJA 1XC3A 1LW2A 1NGIA 1GLEG 3MXIA 4OLAA 4DF4A 5AFUH 3BDPA 4B9SA 1KLNA 1JLQA 3DMJA 4JRQA 3MMVA 4RW4A 4F2SA 3ISNC 4AM7A 3ID6A 4DTJA 2IVPA 1KD1O 4RW6A 4DCHA 3VOVA 1NKBA 4I6MB 4DB3A 1JLBA 1T6DA 3CJ7A 1DGKN 1Q18A 2KW4A 2V7YA 5J1EA 1L3UA 4A5BA 3KKSA 3TAFA 4AHVA 5KTQA 4BREA 1HNVA 4IDHA 3E9OA 4BC5A 1KQSM 2F8SA 5CZ2A 1D5AA 3ENOA 2O8CB 3WEEA 1Q81O 3HM9A 2ASMA 3M8SA 4CHYA 4KHSA 2F9WA 4FWSA 4FJ8A 4HCBA 3O3FA 3I55N 4N76A 1DTTA 5BN9A 2Z1HA 3P83D 1QHTA 3J80O 3G6EN 3EKUA 1E4FT 3KLIA 4YOYA 4IG0A 4G9ZA 3LM2A 1GOAA 3J7ZO 4JV5K 5AZJA 4JRPA 1REVA 4BC4A 4C8LA 5AQXA 3LPUA 4DQQA 3UKRA 3CCUN 1N32K 4OPHA 2JWLA 3THWB 5HL7L 3LDQA 2HNDA 1BI4B 3F2KA 3I8DA 4PQUA 1GLCG 1C0GA 3AO1A 2QEXN 3KLFA 1EKEA 4JAXA 4DV1K 3PX0A 2QWOA 5FRMA 3ITHA 2GX9A 3C7NB 4BR5A 2E6LA 1S3XA 1WNSA 5ADXA 4H4MA 4NLBA 4BC2A 1T6CA 3OY9A 3ZSQA 4CHQA 1EWRA 3E9LA 2G8VA 3HZ6A 4JKBA 4O0JA 1IKYA 3EEQA 1RT7A 1SKSA 2VCPA 5DMRA 1OVYA 4JS5A 2ZD1A 2PY5A 2OPPA 3CCQN 1X9WA 3PO5A 4OVLA 3O4QA 1JLGA 4B1WB 3OYHA 1VQ5N 1WSGA 4DR1K 3M8RA 4R5PA 1RBRA 2A40A 2E2OA 1JCEA 3KIOA 2VQEK 3BY5A 3AA3A 4YFUA 4W5TA 3OYDA 2KKZA 2H3GX 4BR0A 3AO5A 3TAGA 2HBMA 3RRGA 3D2EB 3DJCA 5J2MA 3LZJA 1IBMK 4B9UA 2NRWA 2UYTA 1JLCA 1JL1A 3UB5A 5FDLA 2OZMA 1XHXA 1VQON 1HLUA 2HHHK 1C0FA 3VTIA 3RWUA 1B92A 3VMFB 4N41A 2P9NA 4E1MA 3FR0A 1SQKA 4AH9A 5J2QA 2RF2A 3R9PA 1JLFA 2BE2A 3H08A 3K5MA 3TAPA 1SL2A 2P9PB 5C42A 1VSEA 1RTIA 4K42A 1IJJA 3SMSA 4JKGB 4BVOA 3K59A 4C8OA 1IKWA 5FPNA 2D0OA 2ITGA 3TAMA 1ITGA 4HVJA 3CQXA 3MN6A 2FSNA 3D45A 3BZCA 3KK7A 2NLXA 2HHUA 5BR9A 3CPWM 2P51A 4CJWA 3L3VA 3S3MA 3KLHA 3QETA 5LJWA 4FLZA 1RTDA 1XNQK 4FJGA 4H0VB 3LWLA 1M1KO 2EWSA 4FW2A 4B1VA 1YVUA 4DSFA 1NOZA 1Y64A 4DV2K 2Q0UA 3OVNA 5F0XA 1C1AA 3MECA 4CF0A 1LW0A 1HMVA 2BANA 1NM1A 3RMDA 1W2BM 2P5GA 1NK6A 3C6AA 1WSEA 4H0PA 2A42A 4FK2A 5AZIA 5CE3A 5AQWA 4BRDA 1NNEA 3THVA 3K58A 2YCHA 2E20A 4IFEA 1DTQA 4ELVA 3WEEB 2YKNA 3O9RA 3HSTB 3LP0A 3AVGA 3IRXA 1WSHA 1L3SA 1JKHA 3W3DA 3EY1A 5KRSA 3N4QA 3IKMA 3T1YK 4BY9C 4FO0A 4N5SA 4CEBA 3NHGA 3G10A 4M7YA 3PSIA 3DXKA 5AZJB 1TUUA 2HHSA 1E3MA 3EZWA 4HCCA 2UU9K 4GVEA 4CEAA 3B6OA 1W7AA 1BOTO 2G8WA 1TKXA 2QWNA 1UAXA 2O8EA 1A5XA 3OYLA 2I7NA 2F7TA 5BPLA 1RT5A 2Y1IA 3R3LA 4CFCA 2VGMA 1IV0A 4CJVA 4CJPA 1S1TA 1VQ4N 1IKXA 4IOAL 1VQ9N 2DY4A 5AR0A 3S3NA 1J9AA 3JS6A 3O80A 2BH1A 4EHUA 1TUYA 2E1YA 3CCVN 4Q5VA 2KZZA 3CI5A 3S41A 2QWPA 4CF8A 3E9PA 5LMUK 4DR2K 1YF5L 4E89A 4JKAA 3AA4A 1QVFM 3KZBA 3ENBA 4FPBA 1YJWN 3K2PA 1K8KA 4DFKA 3TTDA 4C8MA 1Z25A 2A1RA 3PIPL 1RNHA 4CFBA 2PYJA 1QQNA 3CFOA 3O3GA 4E7KA 3PX4A 3CC7N 3CIPA 3QINA 3THYA 1FK9A 4E3SA 3CCMN 3VETA 2HVHA 5E26A 4CERA 4BGAA 4CJQA 3DI6A 2B6AA 4BRIA 5KI6A 3RSEB 3M3ZA 1GLLO 1ASVA 3VTHA 2P1JA 1MWMA 4Z4CA 4QS8A 3O9SA 4B9LA 3AARA 2P9NB 3G25A 2NRZA 1HPMA 2DFHA 4BG8A 3GL1A 3NAEA 1OH5A 4IEEA 3M8QA 2UXBK 4BGBA 2O4GA 2QI2A 3HT3A 4LF6K 3U8XA 1XWLA 5H1SQ 1RBSA 4Q0BA 2E2NA 5EOYA 1DEJA 1KXPA 4BG9A 1OKJA 2P9SB 2IAJA 4MO4A 4AQYK 3O5BA 1V4TA 2O8BB 3V1OA 3SUNA 3MXJA 4YORA 2X78A 5J2NA 2IVOA 4FWPA 1HJOA 1SS6A 3LM9A 1I94K 1RCHA 4A62A 3JAMO 4CZFA 5DM6L 3WXLA 4ZTFA 1S22A 1LAVA 3QBXA 1VQNN 4F3TA 1RDCA 4LFBK 2P9LA 5DK5A 4ZTJA 1WAJA 5TKWA 1NOYA 2OANA 1KVAA 4IG3A 5JLHA 2P9KA 3HVRA 1NGAA 2ATQA 4IKFA 4CESA 3VQ6A 4F3OA 1LV5A 1S5JA 3SYZA 1VQMN 3FZLA 3EO3A 3LL3A 3K9JA 3ATVA 5C2FA 2NRRA 4KHUA 3QEXA 4ELUA 3SNNA 5AQJA 3T1AA 3SAGA 4K0KK 1O13A 3ASMA 3NGZA 2WOMA 3FFIA 3TU5A 3ZX3A 4YDUA 1QSYA 4X66K 5C15A 1U04A 3CCSN 3TSUA 4CE9A 1NGDA 1SZ2A 3P1GA 5EU7A 5M1QA 5HLFA 3VEVA 1EO1A 3T7ZA 1BQMA 3DXKB 4AHUA 3I0RA 5A2QO 1R59O 4KI4A 1S1XA 3C6UA 5AQPA 4K8XA 4B1UB 3AY9A 4OGEA 5IT9O 4X64K 3CQ8A 3KK1A 4KV8A 4FL9A 4OX9K 1YAGA 2O8EB 2FLOA 3NVKA 3NH0A 3MEGA 3WQTA 1BL3A 4F9OA 5M1NA 5LMNK 4C1NK 3H3OB 2CH5A 2HBLA 3DRSA 3L2WA 4ICLA 4DQPA 3AAQA 3KD5E 1WSFA 3TAQA 4YOUA 4PHTX 4E7JA 4J8FA 4DFJA 1RDAA 4FJJA 1VSLA 3B6PA 1BI4A 5BRFA 4PKGA 4DTUA 1WB9A 4DUZK 4QCLA 3AVNA 2I5JA 5AQUA 1NGFA 2IOCA 5BR8K 4CJEA 3LAKA 2FBXA 3D6RA 3DYAA 3GBTA 4CJLA 1U49A 3BP8A 3ZX2A 4N56A 3QIPA 3NH1A 4DTSA 4DUYK 2ZGZA 1T7PA 1U48A 3RMAA 4BR4A 4O0IA 3AVMA 1VSJA 4JN4A 4PL7A 1Y97A 1G99A 3LALA 5EY4A 3CJBA 2ZJRL 1TKDA 3FFKB 1RT1A 4BRMA 3J7YP 4EFHA 1U47A 5FROA 3THYB 5BPNA 4KTQA 4RCHA 1U4BA 3LPTA 4HUEA 1YJNN 3EKSA 3SBGA 1EWQA 3DRRA 4IFYA 3CJ9A 3PY8A 2FC0A 3EL2A 3BF3A 2D0PA 1TKTA 2YHAA 3QLHA 1ESVA 3E66A 3IDHA 1VQKN 5KPTA 3KJVA 4JI5K 3AO2A 3SK3A 4GV3A 5M1PA 3L4QA 4CJSA 2HOEA 4WQ5A 3MAQA 4FJ9A 5BRHA 1WAFA 1VSFA 4BRPA 1HQUA 2F8TA 1J54A 4NXNK 3TTFA 3CFRA 2ITMA 3A5MC 3HO1A 3O9TA 4JK9A 3AVHA 4MQ3A 5JVHL 1SUQA 4PA1A 1EQYA 3SQ2A 4JI6K 2HMIA 2RHKA 4PL8A 2XO7A 2BDPA 4RW9A 3HI0A 4IZ9A 1XUPO 2GBZA 2GWJA 1P90A 2ZGYA 2OPSA 4KREA 3IFRA 3ZLJA 4JKGA 4IO8A 4WQ5C 4B9TA 4F4KA 5K14A 2P9LB 4FLXA 4DLGA 3QDKA 2BTFA 5KGXA 2P9KB 3CERA
chains in the Genus database with same CATH topology
5LL6Z 4V19S 4CVNE 4DUZK 3J7AP 1IBKK 2UU9K 4AQYK 5BR8K 2HHHK 2UXDK 4JI1K 4KHPK 4LF5K 1I94K 4DUYK 3JAMO 4NXMK 5FLXO 1XMQK 3J80O 4LFBK 5AJ3K 4B3MK 4LF4K 4JI4K 4JV5K 3J7YP 3T1HK 4JI2K 4JYAK 4DR3K 2ZM6K 4B3TK 1N32K 4DR7K 1HNZK 4GKKK 1N33K 4LFCK 4DV0K 2F4VK 1HNXK 1HR0K 4DV3K 4DV1K 5LMUK 4DR2K 4LF9K 1XNQK 4GKJK 4K0KK 1IBLK 2VQFK 4DV4K 4DV2K 4LF8K 4X66K 4JI3K 1N36K 2UUCK 2UUAK 1N34K 4JI5K 1FJGK 5A2QO 1XNRK 1XMOK 2UUBK 4YY3K 4DV6K 4NXNK 4DV5K 5IT9O 4X64K 4X65K 4B3RK 4CW7B 4B3SK 4OX9K 1HNWK 4DR1K 4JI0K 4JI6K 4DR4K 2VQEK 5LMNK 3OTOK 4LFAK 4YHHK 4X62K 1J5EK 4JI7K 3T1YK 4DV7K 2UXBK 5IWAK 3J81O 2E5LK 4DR6K 4LF6K 4LF7K 2UXCK 1IBMK 4JI8K 4DR5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LL6 Z;  4V19 S;  4CVN E;  4DUZ K;  3J7A P;  1IBK K;  2UU9 K;  4AQY K;  5BR8 K;  2HHH K;  2UXD K;  4JI1 K;  4KHP K;  4LF5 K;  1I94 K;  4DUY K;  3JAM O;  4NXM K;  5FLX O;  1XMQ K;  3J80 O;  4LFB K;  5AJ3 K;  4B3M K;  4LF4 K;  4JI4 K;  4JV5 K;  3J7Y P;  3T1H K;  4JI2 K;  4JYA K;  4DR3 K;  2ZM6 K;  4B3T K;  1N32 K;  4DR7 K;  1HNZ K;  4GKK K;  1N33 K;  4LFC K;  4DV0 K;  2F4V K;  1HNX K;  1HR0 K;  4DV3 K;  4DV1 K;  5LMU K;  4DR2 K;  4LF9 K;  1XNQ K;  4GKJ K;  4K0K K;  1IBL K;  2VQF K;  4DV4 K;  4DV2 K;  4LF8 K;  4X66 K;  4JI3 K;  1N36 K;  2UUC K;  2UUA K;  1N34 K;  4JI5 K;  1FJG K;  5A2Q O;  1XNR K;  1XMO K;  2UUB K;  4YY3 K;  4DV6 K;  4NXN K;  4DV5 K;  5IT9 O;  4X64 K;  4X65 K;  4B3R K;  4CW7 B;  4B3S K;  4OX9 K;  1HNW K;  4DR1 K;  4JI0 K;  4JI6 K;  4DR4 K;  2VQE K;  5LMN K;  3OTO K;  4LFA K;  4YHH K;  4X62 K;  1J5E K;  4JI7 K;  3T1Y K;  4DV7 K;  2UXB K;  5IWA K;  3J81 O;  2E5L K;  4DR6 K;  4LF6 K;  4LF7 K;  2UXC K;  1IBM K;  4JI8 K;  4DR5 K; 
#chains in the Genus database with same CATH topology
 4B9M A;  3H3N O;  4BC3 A;  1KC8 O;  1YTU A;  1TK0 A;  3ZCM A;  3B8A X;  3NF7 A;  4RWT A;  4DTP A;  2WON A;  3SJJ A;  2EHG A;  3AGR A;  2DPN A;  2O4I A;  5CYM A;  1XC9 A;  3K5L A;  2D0C A;  5EXW A;  2WUS A;  3F9K A;  3CCE N;  2E1Z A;  4IFV A;  3OS1 A;  3NE6 A;  4E1J A;  1NGJ A;  3F5T A;  4CHZ A;  1K9M O;  4W5R A;  3FLC O;  4H5T A;  3QEI A;  4KO0 A;  2WTU A;  1VHX A;  2QM1 A;  2VYP A;  3CD6 N;  4WFA L;  1WSI A;  1J6Z A;  4OGC A;  3KHY A;  1IH7 A;  4DR3 K;  4IJN A;  3SQ4 A;  1Q9Y A;  1X9S A;  1UOC A;  2AA4 A;  1NJW A;  1XHZ A;  1BU6 O;  4ISE A;  4AM6 A;  4JEP A;  3V9U A;  3HPG A;  4OKJ A;  5I9E B;  2X6N A;  1WBB A;  3A5O C;  1FW6 A;  1NK0 A;  5C0Y A;  2AP1 A;  3VES A;  2VG6 A;  1BDG A;  5AQR A;  1RDB A;  5EX5 A;  3SBT A;  4EHT A;  4IJA A;  3OS0 A;  3CME N;  3O6W A;  3H45 C;  4FJN A;  3NF9 A;  5FPE A;  4F2R A;  2UUC K;  3CPE A;  3FE1 A;  2RE2 A;  2DFE A;  3OYN A;  4I9L A;  4YOT A;  3H1V X;  3QIO A;  1L5U A;  2FBT A;  2FF6 A;  4I2Q A;  3BGR A;  2ZQB A;  4BRF A;  1R0A A;  1RT4 A;  1EET A;  4O5B A;  3RRH A;  4CHP A;  2NRV A;  1YIT N;  3DOL A;  4CBX A;  2YX6 A;  2KZM A;  4WQ4 A;  1TK5 A;  4B9Q A;  3MEE A;  3OTO K;  3PSF A;  4AF1 A;  1BCO A;  5AQM A;  3C6T A;  3SUP A;  2O8D A;  1Z6R A;  3VEW A;  1GOB A;  1T3V A;  4FLW A;  4CZM A;  4OO1 J;  3SZ2 A;  3G71 N;  5E84 A;  4I7F A;  3ZSY A;  3CC2 N;  4ELT A;  4IDK A;  4KB0 A;  3C6H A;  2Z1G A;  1BO5 O;  3CYM A;  4WQ4 C;  4NYN A;  4H0X B;  4J2E A;  4W5O A;  4KHY A;  1T05 A;  2B5J A;  3CQY A;  4XH1 A;  4L8R B;  1TV6 A;  3IAY A;  4DU1 A;  1NK9 A;  4CJ3 A;  4CIF A;  4LSL A;  3KVG A;  2PZS A;  3VEX A;  1SL0 A;  4FSV A;  4Z4I A;  3AVJ A;  4DTX A;  3HK2 A;  2XY6 A;  3L2Q A;  3ZSW A;  3P5J A;  3VQA A;  5JLF A;  3I56 N;  3HBT A;  1VQ8 N;  1Q8I A;  2HB5 A;  3CXC M;  4UY8 O;  2D1K A;  3OYG A;  4CI6 A;  4JI4 K;  2ASO A;  1HYS A;  3T1H K;  3RSE A;  4NYF A;  2QXL A;  1W0H A;  3OHR A;  4B3T K;  3F9M A;  5KRT A;  3EN9 A;  4DSE A;  2D0A A;  2IC3 A;  2IS3 A;  3J8A A;  3VF2 A;  3NMU A;  1KFD A;  2JWK A;  2CGK A;  1KRP A;  3LDS A;  1JLA A;  2OZS A;  3D2F A;  3V6D A;  1SKW A;  3V9S A;  2HF3 A;  3KK3 A;  3AV9 A;  4NCG A;  1V4S A;  2BUP A;  1S1U A;  3CCL N;  2F96 A;  1QS4 A;  2P9S A;  2RKI A;  3E1Y A;  3K5O A;  1ASW A;  3MCP A;  5KQD A;  3KWI A;  4CJ7 A;  3DM2 A;  4CZK A;  2O8B A;  3HTV A;  4EZ6 A;  4CEC A;  1QTM A;  5SWM A;  1QQO A;  4KBO A;  3WQU A;  1YTA A;  4FJ7 A;  1RBU A;  1VSI A;  3AAP A;  5TKY A;  4H0Y B;  3N4P A;  3MN9 A;  1YIJ N;  4ID5 A;  3SQ0 A;  4FWO A;  3O08 A;  1VSD A;  3DXM B;  4IWV A;  5D3G A;  2EX3 A;  3MED A;  4G1Q A;  3OBW A;  4YHH K;  3CJC A;  4HTL A;  5GIP A;  3VEN A;  3NGI A;  2ZWH A;  1ZBI A;  1L3V A;  1B9D A;  3CCJ N;  5IWA K;  3J81 O;  3MXM A;  3L8B A;  1WN7 A;  4CIG A;  1BG3 A;  4FJK A;  4DSJ A;  2E6M A;  5LL6 Z;  3K0S A;  4H5R A;  4WFB L;  4OLB A;  5C10 A;  1RTH A;  3VQE A;  4DWI A;  1B9F A;  3DLG A;  3WT0 A;  4JI1 K;  1S1W A;  3G0Z A;  2GUI A;  2QTD A;  3TSQ A;  5AFU A;  2YNI A;  3VEZ A;  4BVP A;  3NBP A;  3GOI A;  2KQ2 A;  4HUF A;  3M1F A;  1SAZ A;  3OYF A;  2PFU A;  3PUF A;  1Q7Y O;  3IS9 A;  4B3M K;  2RN2 A;  3DLE A;  4KKO A;  1C1C A;  3LAN A;  2VG7 A;  3VQ9 A;  1KVB A;  1ZBU A;  4H5V A;  4DQI A;  4B3O A;  1CZA N;  1HJR A;  5DM7 L;  4HUG A;  1NJI O;  4FVM A;  2DFF A;  1N5Y A;  1HNZ K;  4GKK K;  4LFC K;  3ALY A;  4KH5 A;  4FJL A;  1VQ7 N;  4FM1 A;  1S6Q A;  3I33 A;  3HJF A;  1SV5 A;  1HQE A;  4GVM A;  3CCR N;  2IGI A;  1SKR A;  1HYZ A;  2O8D B;  4K41 A;  2ETJ A;  2D0B A;  3R8E A;  2HNY A;  4JI3 K;  3NDK A;  3AVK A;  2UUA K;  3FZM A;  3H6E A;  1N8R O;  4PWD A;  4B9N A;  1WSJ A;  2A6A A;  4DV5 K;  1ATR A;  4LSN A;  4DG1 A;  4CZG A;  3QFP A;  4ID1 A;  5MLC Q;  5BRD A;  1VQL N;  1VQ6 N;  3AA2 A;  4OPA A;  1IKV A;  4BWJ A;  2E88 A;  3ID8 A;  4CBU A;  5LJV A;  1NJZ A;  3PIO L;  2W42 A;  2NZT A;  3D7E O;  1VQP N;  4FW1 A;  2PAV A;  3AVB A;  3KKR A;  4KPY A;  1WBD A;  2F9T A;  2LSN A;  3QIC A;  1BA1 A;  4FWK A;  4Y1D A;  2HST A;  1BIS A;  3TPQ A;  2Q36 A;  4H5W A;  1IBK K;  3VQD A;  3QBW A;  4V19 S;  3HM8 A;  3MWT A;  3VGM A;  4WF9 L;  1BA0 A;  3M8P A;  3TAR A;  1XI1 A;  2GV9 A;  3ULE A;  3L2R A;  3P38 A;  2E2Q A;  4DQ8 A;  1NBW A;  3ZT4 A;  4KFB A;  3P31 A;  1WOQ A;  1H1V A;  1HKG A;  1I3A A;  4NLC A;  3AO3 A;  3FZH A;  4K8Z A;  3D2F B;  4CEO A;  4Z4E A;  2P9U A;  3PO4 A;  4O8K A;  1X9M A;  4CJ5 A;  4JKH A;  3AGK A;  3CM5 A;  1WLJ A;  4LD0 A;  3MX2 A;  4NCA A;  3OW2 M;  1J53 A;  1VAZ A;  1S9E A;  4CZH A;  4FOI A;  3VN5 A;  1LAW A;  4M3X A;  1RT6 A;  4MDB A;  1J5O A;  1GLA G;  5FRN A;  2VWB A;  1LWC A;  1U2V B;  4OKK A;  2E4L A;  2QWR A;  5JS2 A;  2HHT A;  4RG8 A;  1NK4 A;  5HRS A;  2YNH A;  2O8F A;  2QKK A;  2R7Y A;  2NRH A;  3O8M A;  3VA3 A;  4GW6 A;  4KHW A;  2CGL A;  3BZK A;  1X3M A;  2A5X A;  4CF1 A;  4FZZ A;  1N34 K;  4CJK A;  3CJ1 A;  3SV4 A;  3BUZ B;  3MX5 A;  1IO2 A;  5GAH P;  2WC9 A;  2UUB K;  5HRR A;  4YY3 K;  5JVG L;  4W5N A;  2VGN A;  3V4I A;  4O55 A;  4BDZ A;  1QQC A;  3I0S A;  4YOW A;  4FWN A;  5ELZ A;  3HOT A;  1YXQ A;  1LWE A;  1D9D A;  5C25 A;  4LH4 A;  4DR4 K;  2GEL A;  3TTC A;  4QOZ B;  3WNG A;  3RTV A;  2YHX A;  3HVT A;  1RDW X;  1JXE A;  1HKC A;  5EVZ A;  1OH6 A;  4BR7 A;  4X62 K;  4GMJ B;  4CD3 A;  4CZL A;  3CHW A;  1BGX T;  2HHX A;  1S72 N;  1Q86 O;  4KI6 A;  4DKW A;  1QE1 A;  5CHI A;  4DFP A;  3J7A P;  1VSK A;  5HRO A;  4EP5 A;  3HPO A;  4FJX A;  1E4G T;  1DKG D;  3TI0 A;  3ZT1 A;  4M3R A;  2KFN A;  3OYM A;  4FWQ A;  3HXM A;  4FK0 A;  4JD2 B;  5ADX H;  4DFM A;  2KLA A;  5FLX O;  5GAD P;  4JS4 A;  3IG1 A;  4H0T B;  5BRE A;  3OJU A;  3A0I X;  5AQH A;  3SLC A;  3VQP A;  4CF9 A;  2QWL A;  2X74 A;  4IOX A;  5FPD A;  3KD1 E;  4CEZ A;  3LDN A;  4B1Z A;  3ZET A;  3SUO A;  4E19 A;  3SQ1 A;  3U6F A;  4FLV A;  1IG8 A;  4DV0 K;  2HBJ A;  1C6V A;  2E8A A;  4GKJ K;  3CET A;  3ENH A;  4DV4 K;  3T69 A;  4LC9 B;  4CJT A;  3O3H A;  4CIE A;  4DSI A;  4BRA A;  4KHQ A;  2HBK A;  1KAZ A;  2B4J A;  3CM6 A;  1RFQ A;  3O1B A;  1JL2 A;  1C0M A;  2V7Z A;  3WXK A;  2FBY A;  2XRI A;  4FJM A;  3G4S N;  4DQS A;  2P9I A;  3OYA A;  1YVN A;  4OJR A;  2AJQ A;  3ULE B;  4CGH A;  4W5Q A;  4DTM A;  4FM2 A;  5AQS A;  2G8F A;  3LP1 A;  4CJ4 A;  3AA5 X;  3H1Q A;  3L2V A;  1UWB A;  3C94 A;  3O4W A;  1M90 O;  2NNW A;  4JK8 A;  3PV8 A;  4JKC A;  4CFD A;  4J2A A;  2P9U B;  3T3F A;  1X9J A;  2HVI A;  3Q7B A;  4JI7 K;  1S6P A;  2IDO A;  5AQZ A;  1BIU A;  3HYF A;  4CGI A;  2E5L K;  4DR6 K;  4QS9 A;  1FKP A;  3OYJ A;  2OYQ A;  4J2B A;  4O44 A;  2PYL A;  3L4I A;  2HNZ A;  3BF1 A;  3VF4 A;  1ZXO A;  3K57 A;  5AQQ A;  3LP3 A;  1UA0 A;  2RPI A;  5GAE P;  2HMP A;  1TAU A;  4MO5 A;  4FLU A;  4KHP K;  4CJR A;  1NGH A;  3IMX A;  1VK0 A;  1K8A O;  3SAF A;  2O8F B;  4CF2 A;  3OBY A;  4B1Y B;  2I7P A;  4CK2 A;  3A5L C;  2VG5 A;  4F8R A;  4O5F A;  3C0B A;  4LF4 K;  4KHN A;  1N6Q A;  3VEY A;  4BR9 A;  3SMP A;  3QNO A;  1GOC A;  5C2D A;  4EZ9 A;  2YNG A;  3DXM A;  1N33 K;  5AQN A;  1VRT A;  3W0L A;  3JYT A;  2XY8 A;  4KTZ A;  1CZB A;  4DV3 K;  4DU4 A;  3T19 A;  4Z4H A;  1QZ5 A;  4E7H A;  4C8N A;  4FLY A;  3DLR A;  5HOO A;  3LWM A;  4DTR A;  4RW8 A;  2VWJ A;  3SCX A;  4LF8 K;  4ISF A;  2BGG A;  2YKM A;  3I8B A;  1RBT A;  5KGW A;  4BQL A;  4DHY A;  1CZ9 A;  3KLE A;  3O1W A;  3CF5 L;  4C8K A;  1XNR K;  4GV9 A;  2GTD A;  4FJ5 A;  4DV6 K;  3KTQ A;  3RVC A;  5B8H A;  1NJX A;  2KTQ A;  4DSK A;  4B3R K;  1TVR A;  4H03 B;  1TKZ A;  2OPR A;  3V81 A;  4CEQ A;  1JXB A;  1L3T A;  2YJE A;  2V52 B;  1C0T A;  2KFZ A;  3NVM A;  1MWK A;  3FGU A;  4H5N A;  1HNI A;  4FZX C;  1LOT B;  4JK7 A;  1NMD A;  1ZC6 A;  2UXC K;  4NCB A;  3QER A;  3FZK A;  4PKI A;  2JGU A;  4DR5 K;  3O9U A;  5AQL A;  3U9D A;  1GLD G;  3ZET B;  1MU2 A;  4YNQ A;  3OS2 A;  3PX6 A;  4RTF D;  3JXU A;  4RW7 A;  5CZ1 A;  2FF3 B;  1NG9 A;  3SPY A;  3QB0 A;  3VEO A;  4A61 A;  2OTL N;  2P5O A;  4CHO A;  4BE2 A;  1TL1 A;  4EIA A;  1JLE A;  1W97 L;  4U67 L;  1G15 A;  1NGG A;  3V9X A;  4CJU A;  4ILH A;  4GV6 A;  4WYB A;  4CEE A;  1U6Z A;  5AQT A;  5CYQ A;  3U4L A;  4IEI A;  1BQN A;  4CZE A;  3E01 A;  1RT3 A;  4CD1 A;  3UIQ A;  4MFB A;  3NFA A;  3R1X A;  4K25 A;  3ZSX A;  3Q7C A;  5CY4 A;  4MLH A;  2P9I B;  3U9Z A;  4FWM A;  2YI1 A;  3SI6 A;  1ATS A;  1UA1 A;  3KWG A;  5M1F A;  3CFP A;  1SL1 A;  4NO7 A;  2W6K A;  4A2B A;  3K5N A;  3V1Q A;  1NK5 A;  1KAX A;  1S9G A;  4HTU A;  2X6S A;  4LF9 K;  1LCU A;  3HSC A;  3DLB A;  3ATU A;  1RT2 A;  1IBL K;  1EXQ A;  4KB1 A;  3MDQ A;  3VPZ A;  4C1N I;  1NKC A;  4HHT A;  5AQY A;  4M41 A;  1T03 A;  3HPH A;  3A5N C;  2OPQ A;  4DTN A;  4FWR A;  4A2A A;  1QZ6 A;  4MDA A;  4IO9 L;  4X65 K;  1BIZ A;  4WFN L;  1KAY A;  4AHC A;  2QK9 A;  1HNW K;  1I39 A;  1T8E A;  1O1W A;  4ZHR A;  5J2P A;  5BN8 A;  4E7I A;  1A5V A;  1KCF A;  4JHD A;  2XHB A;  2Y1J A;  3TAN A;  3TR8 A;  4Z94 A;  3MK6 A;  4CJF A;  4LFA K;  4FOE A;  1DLO A;  3DOK A;  1LWF A;  4FZY A;  4M45 A;  2FSJ A;  5SZT A;  4AHT A;  1K73 O;  1IG9 A;  2A41 A;  4YOX A;  3VER A;  4LY7 A;  3F73 A;  1K6Y A;  4LF7 K;  4M3T A;  3SJH A;  3O4N A;  4JI8 K;  1EP4 A;  4JNE A;  5KPZ A;  3ZSR A;  2Q97 A;  3UKU A;  1QHA A;  3CMA N;  1U2V A;  4BDP A;  2YHY A;  1ILY A;  3M5R A;  3ZSO A;  3M6G A;  3QML A;  4EP4 A;  3TSP A;  4O4G A;  3QEP A;  3ZEU A;  1HUX A;  2CH6 A;  1NLV A;  3VQ5 A;  3ZSZ A;  1T44 A;  4HWI A;  3ZX0 A;  2G8U A;  4BRQ A;  1NWK A;  5F1X A;  4NXM K;  4CGD A;  4M3U A;  2YHB A;  3AVL A;  4M3Y A;  3L0Q A;  2HHV A;  5AJ3 K;  2XY5 A;  1X3N A;  4JKF A;  3HOS A;  1RGI A;  4JKE A;  4YOV A;  3CJA A;  4JYA K;  3SAH A;  2FSK A;  1YHQ N;  3AVI A;  4A5A A;  3RR7 A;  3OYI A;  1ZBL A;  1HRH A;  4CK1 A;  1BWF O;  5KPR A;  4XH5 A;  3VA0 A;  2FBV A;  4E0D A;  2DTU A;  4LH5 A;  1TYQ A;  1F21 A;  3VQB A;  3KLG A;  3HRG A;  4MLE A;  5HBM A;  3OJS A;  4OPJ A;  3GG4 A;  2G8K A;  4H8K A;  4DS5 A;  3OA9 A;  4AHS A;  1FJG K;  4DS4 A;  1KVC A;  1RTJ A;  3C95 A;  4WE1 A;  4TSX A;  2W41 A;  5AQI A;  3U3Y A;  3QES A;  1C0U A;  4JD2 A;  3IUC A;  2D5R A;  3BEX A;  3VQ7 A;  3VGL A;  1D4X A;  3UKR B;  4R79 A;  4AHR A;  3QNN A;  3WXJ A;  2D4W A;  3C65 A;  2IVN A;  5AQK A;  4PY5 A;  1ZYQ A;  1OH8 A;  2GWK A;  2OCE A;  4FXD A;  3MCA B;  2J4R A;  1RDD A;  2HW3 A;  3S9H A;  3NF6 A;  4AIL C;  5JIC A;  2A1S A;  2W40 A;  1GLJ O;  4EAH D;  4CVN E;  3ULD A;  2E2P A;  3GDQ A;  2YNF A;  3VQ4 A;  1X1P A;  3L3U A;  3TAB A;  2UXD K;  5JS1 A;  3D0P A;  3SPZ A;  3HL8 A;  2HHW A;  3NCI A;  4BRH A;  1Z26 A;  4LF5 K;  1EX4 A;  4E7L A;  3RMB A;  3P39 A;  5M1K A;  3AVA A;  1NK8 A;  5KQ8 A;  3OYK A;  3V1R A;  3ZSV A;  5GIO A;  3OYB A;  3V9W A;  3DAW A;  1OVQ A;  2W6L A;  1KTQ A;  3AVC A;  4E1N A;  3SUQ A;  1VSM A;  4FVU A;  4B8C A;  3LZI A;  2Z1I A;  4JI2 K;  1GLB G;  4CGF A;  1TAQ A;  3V9Z A;  1JCG A;  4B1X B;  2ZE2 A;  4N47 A;  4BRL A;  3DWL A;  2Q3S A;  4FYD A;  1ASU A;  4L3Q A;  1HKB A;  4XH4 A;  3EE9 A;  3WXM B;  4FK4 A;  3A2F A;  1JJ2 M;  4WCE L;  1FXX A;  4JHD B;  2NRX A;  4CGJ A;  5C24 A;  1W9H A;  3QO9 A;  4BDY A;  3RR8 A;  1YT3 A;  3LP2 A;  3DLL L;  1QVG M;  1OH7 A;  2KHO A;  1P8Z A;  4PKH A;  3L2U A;  4OPK A;  1MA9 B;  5AQO A;  3CG7 A;  4CBW A;  5CR4 A;  3K9K A;  4CGG A;  5I42 A;  3U3G A;  1KLM A;  3VF6 A;  4NB4 A;  5M1O A;  3UKU B;  1ATN A;  4GNI A;  3AO4 A;  4Y0W A;  4IOC L;  3RMC A;  3VQ8 A;  4CK3 A;  3GE1 A;  1FKO A;  1Q9X A;  1BCM A;  3HP9 A;  1BHL A;  4OKE A;  3NH2 A;  3ZEU B;  3LDO A;  3PLA A;  1RBV A;  3AVF A;  1HX1 A;  3HP6 A;  3WUH A;  4M63 C;  1J5E K;  1QSS A;  3MWP A;  4DV7 K;  4U7B A;  3NGY A;  4BQZ A;  3THX A;  2Q2R A;  4XEI A;  4QAG A;  2NRT A;  4CEF A;  3NF8 A;  3R6M A;  4O8U A;  2Q31 A;  4CHN A;  1DT9 A;  5AQV A;  1HPZ A;  2QA4 N;  3OYE A;  3ZT3 A;  4KRF A;  3QEV A;  2QXF A;  3WNF A;  1QSL A;  5T7B A;  1JCF A;  4FPA A;  5AZI B;  1TYQ B;  2WFB A;  2Z1J A;  5JMV A;  4DMN A;  4FLT A;  1WUA A;  1YUW A;  4FWL A;  1VRU A;  4KH4 A;  2NUB A;  4Y1C A;  4PUO A;  2ZJQ L;  2ZJP L;  4IBN A;  3ZYY X;  5HRN A;  4I6M A;  4ILG B;  1YJ9 N;  1BUP A;  5AQG A;  2YV0 X;  2ZF5 O;  4BRN A;  4GY2 B;  1Z05 A;  4M3W A;  5E41 A;  1VSH A;  2QWM A;  4DR7 K;  5HRP A;  3CC4 N;  2G8H A;  1CXQ A;  4DU3 A;  2O8C A;  4ISG A;  1HR0 K;  4XIU A;  5BPM A;  3DLH A;  2CGJ A;  3LDL A;  4CZI A;  2QWQ A;  3ZT0 A;  2VQF K;  1U45 A;  3UE5 A;  2QKB A;  2GUP A;  4A57 A;  4YDU C;  1NGC A;  5I3U A;  2ASP A;  2YJF A;  3H46 O;  3WNE A;  3S3O A;  2V51 B;  3L6Q A;  3QEW A;  1QQM A;  3MN5 A;  3EE8 A;  3MN7 A;  4A59 A;  4CZJ A;  1TGO A;  3THW A;  4M7X A;  1CLQ A;  3TWH A;  3DRP A;  1NKE A;  5F2R A;  4DTO A;  1D9F A;  4CW7 B;  1NK7 A;  4B3S K;  1KFS A;  3FZF A;  4B08 A;  4JI0 K;  1D8Y A;  1NGE A;  1ZBF A;  4JKD A;  3C7N A;  1RDU A;  4FJH A;  4M3Z A;  3P4I A;  2HHQ A;  1A5W A;  4FJI A;  3O9Q A;  3SV3 A;  3EZ5 A;  2YHW A;  5AQF A;  4I2P A;  4J2D A;  2XY7 A;  4FCY A;  1HYV A;  2FXU A;  1K8K B;  5LY3 A;  2PBD A;  3LAM A;  4DSL A;  4DF8 A;  1Q82 O;  4B8A B;  2OA8 A;  3EYZ A;  4BR2 A;  4CCH A;  4I9Q A;  5GAG P;  4FM0 A;  2JLE A;  4BE1 A;  4DQR A;  2HF4 A;  4BRK A;  3JSM A;  4BRO A;  4BWM A;  3WXI A;  4BRC A;  5C12 A;  1KSP A;  1ZBS A;  3VQC A;  1XMQ K;  4B9V A;  1RIL A;  3VGK A;  3KK2 A;  3D2E A;  4Z4F A;  4H0O A;  4BRG A;  4KAZ A;  4H4O A;  2IIR A;  3OYC A;  3VQQ A;  1XQS C;  4IXC A;  2OTJ N;  5FPM A;  4CFA A;  4BAC A;  2VWK A;  4C23 A;  2A3Z A;  2ZM6 K;  2Q1N A;  4Z0U A;  1NGB A;  4BE0 A;  3TAE A;  4DLE A;  1YI2 N;  5GIN A;  2F4V K;  4Z4G A;  1HNX K;  3LDP A;  3ZT2 A;  2QW9 A;  1NJY A;  2GEM A;  4QS7 A;  1MDU B;  5HP1 A;  4KTW A;  4K43 A;  1S1V A;  2P9P A;  1N36 K;  3DLK A;  3A8Y A;  4UQG A;  3THX B;  1TL3 A;  1NU0 A;  1NMN A;  1TK8 A;  2Q0R A;  1C1B A;  1GLF O;  1XMO K;  2G8I A;  1ZBH A;  4M42 A;  3QFU A;  4KH6 A;  4CED A;  4JLH A;  3WNH A;  2WBN A;  1CXU A;  4ILJ A;  1XC3 A;  1LW2 A;  1NGI A;  1GLE G;  3MXI A;  4OLA A;  4DF4 A;  5AFU H;  3BDP A;  4B9S A;  1KLN A;  1JLQ A;  3DMJ A;  4JRQ A;  3MMV A;  4RW4 A;  4F2S A;  3ISN C;  4AM7 A;  3ID6 A;  4DTJ A;  2IVP A;  1KD1 O;  4RW6 A;  4DCH A;  3VOV A;  1NKB A;  4I6M B;  4DB3 A;  1JLB A;  1T6D A;  3CJ7 A;  1DGK N;  1Q18 A;  2KW4 A;  2V7Y A;  5J1E A;  1L3U A;  4A5B A;  3KKS A;  3TAF A;  4AHV A;  5KTQ A;  4BRE A;  1HNV A;  4IDH A;  3E9O A;  4BC5 A;  1KQS M;  2F8S A;  5CZ2 A;  1D5A A;  3ENO A;  2O8C B;  3WEE A;  1Q81 O;  3HM9 A;  2ASM A;  3M8S A;  4CHY A;  4KHS A;  2F9W A;  4FWS A;  4FJ8 A;  4HCB A;  3O3F A;  3I55 N;  4N76 A;  1DTT A;  5BN9 A;  2Z1H A;  3P83 D;  1QHT A;  3J80 O;  3G6E N;  3EKU A;  1E4F T;  3KLI A;  4YOY A;  4IG0 A;  4G9Z A;  3LM2 A;  1GOA A;  3J7Z O;  4JV5 K;  5AZJ A;  4JRP A;  1REV A;  4BC4 A;  4C8L A;  5AQX A;  3LPU A;  4DQQ A;  3UKR A;  3CCU N;  1N32 K;  4OPH A;  2JWL A;  3THW B;  5HL7 L;  3LDQ A;  2HND A;  1BI4 B;  3F2K A;  3I8D A;  4PQU A;  1GLC G;  1C0G A;  3AO1 A;  2QEX N;  3KLF A;  1EKE A;  4JAX A;  4DV1 K;  3PX0 A;  2QWO A;  5FRM A;  3ITH A;  2GX9 A;  3C7N B;  4BR5 A;  2E6L A;  1S3X A;  1WNS A;  5ADX A;  4H4M A;  4NLB A;  4BC2 A;  1T6C A;  3OY9 A;  3ZSQ A;  4CHQ A;  1EWR A;  3E9L A;  2G8V A;  3HZ6 A;  4JKB A;  4O0J A;  1IKY A;  3EEQ A;  1RT7 A;  1SKS A;  2VCP A;  5DMR A;  1OVY A;  4JS5 A;  2ZD1 A;  2PY5 A;  2OPP A;  3CCQ N;  1X9W A;  3PO5 A;  4OVL A;  3O4Q A;  1JLG A;  4B1W B;  3OYH A;  1VQ5 N;  1WSG A;  4DR1 K;  3M8R A;  4R5P A;  1RBR A;  2A40 A;  2E2O A;  1JCE A;  3KIO A;  2VQE K;  3BY5 A;  3AA3 A;  4YFU A;  4W5T A;  3OYD A;  2KKZ A;  2H3G X;  4BR0 A;  3AO5 A;  3TAG A;  2HBM A;  3RRG A;  3D2E B;  3DJC A;  5J2M A;  3LZJ A;  1IBM K;  4B9U A;  2NRW A;  2UYT A;  1JLC A;  1JL1 A;  3UB5 A;  5FDL A;  2OZM A;  1XHX A;  1VQO N;  1HLU A;  2HHH K;  1C0F A;  3VTI A;  3RWU A;  1B92 A;  3VMF B;  4N41 A;  2P9N A;  4E1M A;  3FR0 A;  1SQK A;  4AH9 A;  5J2Q A;  2RF2 A;  3R9P A;  1JLF A;  2BE2 A;  3H08 A;  3K5M A;  3TAP A;  1SL2 A;  2P9P B;  5C42 A;  1VSE A;  1RTI A;  4K42 A;  1IJJ A;  3SMS A;  4JKG B;  4BVO A;  3K59 A;  4C8O A;  1IKW A;  5FPN A;  2D0O A;  2ITG A;  3TAM A;  1ITG A;  4HVJ A;  3CQX A;  3MN6 A;  2FSN A;  3D45 A;  3BZC A;  3KK7 A;  2NLX A;  2HHU A;  5BR9 A;  3CPW M;  2P51 A;  4CJW A;  3L3V A;  3S3M A;  3KLH A;  3QET A;  5LJW A;  4FLZ A;  1RTD A;  1XNQ K;  4FJG A;  4H0V B;  3LWL A;  1M1K O;  2EWS A;  4FW2 A;  4B1V A;  1YVU A;  4DSF A;  1NOZ A;  1Y64 A;  4DV2 K;  2Q0U A;  3OVN A;  5F0X A;  1C1A A;  3MEC A;  4CF0 A;  1LW0 A;  1HMV A;  2BAN A;  1NM1 A;  3RMD A;  1W2B M;  2P5G A;  1NK6 A;  3C6A A;  1WSE A;  4H0P A;  2A42 A;  4FK2 A;  5AZI A;  5CE3 A;  5AQW A;  4BRD A;  1NNE A;  3THV A;  3K58 A;  2YCH A;  2E20 A;  4IFE A;  1DTQ A;  4ELV A;  3WEE B;  2YKN A;  3O9R A;  3HST B;  3LP0 A;  3AVG A;  3IRX A;  1WSH A;  1L3S A;  1JKH A;  3W3D A;  3EY1 A;  5KRS A;  3N4Q A;  3IKM A;  3T1Y K;  4BY9 C;  4FO0 A;  4N5S A;  4CEB A;  3NHG A;  3G10 A;  4M7Y A;  3PSI A;  3DXK A;  5AZJ B;  1TUU A;  2HHS A;  1E3M A;  3EZW A;  4HCC A;  2UU9 K;  4GVE A;  4CEA A;  3B6O A;  1W7A A;  1BOT O;  2G8W A;  1TKX A;  2QWN A;  1UAX A;  2O8E A;  1A5X A;  3OYL A;  2I7N A;  2F7T A;  5BPL A;  1RT5 A;  2Y1I A;  3R3L A;  4CFC A;  2VGM A;  1IV0 A;  4CJV A;  4CJP A;  1S1T A;  1VQ4 N;  1IKX A;  4IOA L;  1VQ9 N;  2DY4 A;  5AR0 A;  3S3N A;  1J9A A;  3JS6 A;  3O80 A;  2BH1 A;  4EHU A;  1TUY A;  2E1Y A;  3CCV N;  4Q5V A;  2KZZ A;  3CI5 A;  3S41 A;  2QWP A;  4CF8 A;  3E9P A;  5LMU K;  4DR2 K;  1YF5 L;  4E89 A;  4JKA A;  3AA4 A;  1QVF M;  3KZB A;  3ENB A;  4FPB A;  1YJW N;  3K2P A;  1K8K A;  4DFK A;  3TTD A;  4C8M A;  1Z25 A;  2A1R A;  3PIP L;  1RNH A;  4CFB A;  2PYJ A;  1QQN A;  3CFO A;  3O3G A;  4E7K A;  3PX4 A;  3CC7 N;  3CIP A;  3QIN A;  3THY A;  1FK9 A;  4E3S A;  3CCM N;  3VET A;  2HVH A;  5E26 A;  4CER A;  4BGA A;  4CJQ A;  3DI6 A;  2B6A A;  4BRI A;  5KI6 A;  3RSE B;  3M3Z A;  1GLL O;  1ASV A;  3VTH A;  2P1J A;  1MWM A;  4Z4C A;  4QS8 A;  3O9S A;  4B9L A;  3AAR A;  2P9N B;  3G25 A;  2NRZ A;  1HPM A;  2DFH A;  4BG8 A;  3GL1 A;  3NAE A;  1OH5 A;  4IEE A;  3M8Q A;  2UXB K;  4BGB A;  2O4G A;  2QI2 A;  3HT3 A;  4LF6 K;  3U8X A;  1XWL A;  5H1S Q;  1RBS A;  4Q0B A;  2E2N A;  5EOY A;  1DEJ A;  1KXP A;  4BG9 A;  1OKJ A;  2P9S B;  2IAJ A;  4MO4 A;  4AQY K;  3O5B A;  1V4T A;  2O8B B;  3V1O A;  3SUN A;  3MXJ A;  4YOR A;  2X78 A;  5J2N A;  2IVO A;  4FWP A;  1HJO A;  1SS6 A;  3LM9 A;  1I94 K;  1RCH A;  4A62 A;  3JAM O;  4CZF A;  5DM6 L;  3WXL A;  4ZTF A;  1S22 A;  1LAV A;  3QBX A;  1VQN N;  4F3T A;  1RDC A;  4LFB K;  2P9L A;  5DK5 A;  4ZTJ A;  1WAJ A;  5TKW A;  1NOY A;  2OAN A;  1KVA A;  4IG3 A;  5JLH A;  2P9K A;  3HVR A;  1NGA A;  2ATQ A;  4IKF A;  4CES A;  3VQ6 A;  4F3O A;  1LV5 A;  1S5J A;  3SYZ A;  1VQM N;  3FZL A;  3EO3 A;  3LL3 A;  3K9J A;  3ATV A;  5C2F A;  2NRR A;  4KHU A;  3QEX A;  4ELU A;  3SNN A;  5AQJ A;  3T1A A;  3SAG A;  4K0K K;  1O13 A;  3ASM A;  3NGZ A;  2WOM A;  3FFI A;  3TU5 A;  3ZX3 A;  4YDU A;  1QSY A;  4X66 K;  5C15 A;  1U04 A;  3CCS N;  3TSU A;  4CE9 A;  1NGD A;  1SZ2 A;  3P1G A;  5EU7 A;  5M1Q A;  5HLF A;  3VEV A;  1EO1 A;  3T7Z A;  1BQM A;  3DXK B;  4AHU A;  3I0R A;  5A2Q O;  1R59 O;  4KI4 A;  1S1X A;  3C6U A;  5AQP A;  4K8X A;  4B1U B;  3AY9 A;  4OGE A;  5IT9 O;  4X64 K;  3CQ8 A;  3KK1 A;  4KV8 A;  4FL9 A;  4OX9 K;  1YAG A;  2O8E B;  2FLO A;  3NVK A;  3NH0 A;  3MEG A;  3WQT A;  1BL3 A;  4F9O A;  5M1N A;  5LMN K;  4C1N K;  3H3O B;  2CH5 A;  2HBL A;  3DRS A;  3L2W A;  4ICL A;  4DQP A;  3AAQ A;  3KD5 E;  1WSF A;  3TAQ A;  4YOU A;  4PHT X;  4E7J A;  4J8F A;  4DFJ A;  1RDA A;  4FJJ A;  1VSL A;  3B6P A;  1BI4 A;  5BRF A;  4PKG A;  4DTU A;  1WB9 A;  4DUZ K;  4QCL A;  3AVN A;  2I5J A;  5AQU A;  1NGF A;  2IOC A;  5BR8 K;  4CJE A;  3LAK A;  2FBX A;  3D6R A;  3DYA A;  3GBT A;  4CJL A;  1U49 A;  3BP8 A;  3ZX2 A;  4N56 A;  3QIP A;  3NH1 A;  4DTS A;  4DUY K;  2ZGZ A;  1T7P A;  1U48 A;  3RMA A;  4BR4 A;  4O0I A;  3AVM A;  1VSJ A;  4JN4 A;  4PL7 A;  1Y97 A;  1G99 A;  3LAL A;  5EY4 A;  3CJB A;  2ZJR L;  1TKD A;  3FFK B;  1RT1 A;  4BRM A;  3J7Y P;  4EFH A;  1U47 A;  5FRO A;  3THY B;  5BPN A;  4KTQ A;  4RCH A;  1U4B A;  3LPT A;  4HUE A;  1YJN N;  3EKS A;  3SBG A;  1EWQ A;  3DRR A;  4IFY A;  3CJ9 A;  3PY8 A;  2FC0 A;  3EL2 A;  3BF3 A;  2D0P A;  1TKT A;  2YHA A;  3QLH A;  1ESV A;  3E66 A;  3IDH A;  1VQK N;  5KPT A;  3KJV A;  4JI5 K;  3AO2 A;  3SK3 A;  4GV3 A;  5M1P A;  3L4Q A;  4CJS A;  2HOE A;  4WQ5 A;  3MAQ A;  4FJ9 A;  5BRH A;  1WAF A;  1VSF A;  4BRP A;  1HQU A;  2F8T A;  1J54 A;  4NXN K;  3TTF A;  3CFR A;  2ITM A;  3A5M C;  3HO1 A;  3O9T A;  4JK9 A;  3AVH A;  4MQ3 A;  5JVH L;  1SUQ A;  4PA1 A;  1EQY A;  3SQ2 A;  4JI6 K;  2HMI A;  2RHK A;  4PL8 A;  2XO7 A;  2BDP A;  4RW9 A;  3HI0 A;  4IZ9 A;  1XUP O;  2GBZ A;  2GWJ A;  1P90 A;  2ZGY A;  2OPS A;  4KRE A;  3IFR A;  3ZLJ A;  4JKG A;  4IO8 A;  4WQ5 C;  4B9T A;  4F4K A;  5K14 A;  2P9L B;  4FLX A;  4DLG A;  3QDK A;  2BTF A;  5KGX A;  2P9K B;  3CER A; 
#chains in the Genus database with same CATH homology
 5LL6 Z;  4V19 S;  4CVN E;  4DUZ K;  3J7A P;  1IBK K;  2UU9 K;  4AQY K;  5BR8 K;  2HHH K;  2UXD K;  4JI1 K;  4KHP K;  4LF5 K;  1I94 K;  4DUY K;  3JAM O;  4NXM K;  5FLX O;  1XMQ K;  3J80 O;  4LFB K;  5AJ3 K;  4B3M K;  4LF4 K;  4JI4 K;  4JV5 K;  3J7Y P;  3T1H K;  4JI2 K;  4JYA K;  4DR3 K;  2ZM6 K;  4B3T K;  1N32 K;  4DR7 K;  1HNZ K;  4GKK K;  1N33 K;  4LFC K;  4DV0 K;  2F4V K;  1HNX K;  1HR0 K;  4DV3 K;  4DV1 K;  5LMU K;  4DR2 K;  4LF9 K;  1XNQ K;  4GKJ K;  4K0K K;  1IBL K;  2VQF K;  4DV4 K;  4DV2 K;  4LF8 K;  4X66 K;  4JI3 K;  1N36 K;  2UUC K;  2UUA K;  1N34 K;  4JI5 K;  1FJG K;  5A2Q O;  1XNR K;  1XMO K;  2UUB K;  4YY3 K;  4DV6 K;  4NXN K;  4DV5 K;  5IT9 O;  4X64 K;  4X65 K;  4B3R K;  4CW7 B;  4B3S K;  4OX9 K;  1HNW K;  4DR1 K;  4JI0 K;  4JI6 K;  4DR4 K;  2VQE K;  5LMN K;  3OTO K;  4LFA K;  4YHH K;  4X62 K;  1J5E K;  4JI7 K;  3T1Y K;  4DV7 K;  2UXB K;  5IWA K;  3J81 O;  2E5L K;  4DR6 K;  4LF6 K;  4LF7 K;  2UXC K;  1IBM K;  4JI8 K;  4DR5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...