4I2QA

Crystal structure of k103n/y181c mutant of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) analogue
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transferase/inhibitor
molecule keywords Gag-Pol polyprotein
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 144
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i2qA05
4NLXA 4ED8A 5DG7A 1YVFA 3O4NA 3KK1A 3OYBA 4MK9A 3M8QA 5K14A 4K4ZA 3NF6A 1IO2A 4ECZA 2ZE2B 4IDKA 3UR0A 1C2PA 4YMEA 4TLRA 2YHBA 3PV8A 4KTZA 4MFBA 4Z4GA 2BE2A 1U47A 4U7CA 3T5LA 4XO0A 4CE9A 1L3VA 4J9LA 3SQ4A 1JLBB 3SQ1A 3QGIA 4O4GB 1LAWA 4K4VA 1NKCA 4M42A 3DI6A 3QO9A 3TVKA 1RCHA 3RB3A 2XY5A 3IG1A 1KVBA 3BSCA 1RT7B 2IC3B 1VSJA 3DOLA 5KFLA 1C0UA 5KFKA 3CFPA 4AHVA 4E7IA 5HRNA 3KTQA 4CEBA 4CJWA 1XHZA 1JLAA 5J2QA 2HHWA 4WFZA 2IA6A 1B9DA 3U3YA 1KTQA 4YFUA 3VQ8A 2VA3A 4F3TA 3DLGA 2GC8A 4CJLA 3K5LA 4FLXA 4B9LA 2IJNA 2G8WA 1VSHA 4E3SA 3RR7A 5L1IA 2XI2A 4HCBA 2F8SA 4LSLB 4J9PA 4ECSA 3EYZA 2DPIA 3ISNC 2HNZA 4IH7A 2YNIA 4YR2A 1BIUA 3M8SA 4OKEA 1T03B 2X74A 1ZBFA 3TAPA 1GOAA 3HVRA 4OVLA 4KSEB 1D9FA 1FKOB 5KG5A 4KO0B 4CGGA 4LQ9A 2KFNA 2GBZA 1N56A 3F73A 4FJ9A 2WTFA 4W5OA 1N5YB 5J2MB 5F8JA 3NH0A 3KLIB 5HROA 2Z1GA 4B9SA 2I5JA 5EUHA 4ZVEA 1O1WA 3CDEA 5KRSA 4M3WA 2HHVA 4DSFA 3G6YA 3AA3A 3HSTB 3NKYA 2AGQA 1BQNB 3U3GA 1IG9A 3NF7A 1A5WA 5KTQA 3KHRA 4DFJA 1TK5A 2FLLA 1HJRA 3BSAA 3V9UA 1JX4A 1VRUA 4KHNA 1C0MA 1XC9A 4ZVGA 2YNGB 4IFYB 4KKOA 2QK9A 4M41A 3H08A 3DLKB 3MEEA 2R8KA 2D41A 4FM1A 3QZ8A 3LWLA 1LWFA 5HP1A 2JEIA 4E89A 4DS4A 4CJKA 4DTMA 5JS2A 3ZT1A 3HO1A 4CK1A 4K8ZA 5HLFB 1KVAA 3L2RA 4CGHA 4NLVA 1REVA 3GIKA 5KT6A 4FYDA 1NOYA 1NK6A 3JYTA 2OPQB 4CF1A 3KHHA 3V4IB 1NJXA 4YNQA 1UOCA 4NYFA 3QEVA 1TK8A 2D3ZA 3SCXA 1TKTB 3UPFA 3TWHA 2P5OA 3RTVA 3H5UA 4Q0BB 4CGDA 1EKEA 4FJ5A 4F4ZA 3OHBA 4AH9A 2X6NA 1S1UB 4DLGA 4XPCA 4E7JA 2AX0A 1XR7A 4FZYA 4RNMA 1ZYQA 3PUFA 2IM0A 3SFGA 4DSEA 3V81A 2BANB 1GX5A 4ED1A 4OJRA 1X9SA 2Q3SA 3FRZA 4J2BA 2HHTA 4CEDA 2ILZA 5FDLB 4QOZB 4DG1A 3HVAA 3RB6A 3KLVA 2C2RA 1S9FA 3KMSA 1TV6B 2Z1JA 1JLFA 1N4LA 4DL3A 4AHSA 1NK4A 1IKVB 3NH1A 2W8LA 4O3PA 1FKPA 3H40A 2RDJA 3DM2A 3K58A 1RDRA 5KFYA 3RR8A 1UA0A 5CY4A 4M94A 4PUOA 3F9KA 4Y2CA 3T5HA 2UVVA 1NHVA 3AA5X 3KK3A 1RBSA 2B4JA 3NCIA 4M3TA 1C1CA 5KFHA 2D0BA 3CIZA 3SNNA 4FW2A 4IG3A 4KV8A 4E7KA 3G0ZA 1DTQA 4ECQA 3I0SA 4K50A 2J6TA 3ZSVA 1EXQA 3DYAB 4K4YA 3FFIA 1BGXT 3KLFB 3HPHA 1DLOA 4O4RA 4FJIA 2HHXA 2BDPA 4I2PA 4ID5A 2IAJA 1LV5A 4H4OA 2C28A 1D9DA 4IH5A 3QGHA 4O3RA 3RMAA 3K2PA 1IKWB 4FJ7A 4I2QB 1TL1B 1ZBIA 5EDWA 2R7YA 3LP2A 2FVQA 1N48A 3EY1A 2F8TA 3DLRA 2NUBA 3L2WA 4FCYA 5JUMA 5KG4A 2AQ4A 3KK2B 2E9ZA 4F50A 2HWHA 2W7OA 3CJ3A 2VWJA 3N6LA 5KFNA 1HMVB 3QIOA 2ATQA 4DQPA 2YKMA 3LDSA 2ZD1A 2D3UA 4QWEA 5L1KA 4HUEA 3EPGA 1VSMA 4M3ZA 3B6PA 4ZPCA 2BQUA 5C42B 4C8KA 4ELTA 4EBDA 4J9MA 4NCGA 1T8EA 2HB5A 4CJVA 5F9NA 3VQ6A 1YTUA 5JS1A 4CEFA 4Z4HA 3SQ0A 1JLQB 4DL6A 4IFVB 1JXEA 4AHCA 4Q45A 3KIOA 3WNGA 3N6NA 1VK0A 4IBNA 3KHLA 4EYHB 3KOAA 3S9HA 3ZSQA 5L9XA 4X2BA 5I3UA 2OH2A 1FXXA 1VSKA 2WONB 1HNVA 1S6PB 2B5JB 2YNFA 1S9EB 4Z4CA 4CHQA 4KI4A 3NAEA 1HPZA 4RW4B 1VSIA 3C95A 3C6UA 3EPIA 1RTIA 4ZHRB 2E9RX 4CGIA 1RA7A 3M8RA 4F4XA 3TR8A 4NLWA 4BWJA 1WN7A 4ZVFA 3P1GA 1GOBA 3RMBA 1RTDA 1YVUA 2FVPA 3SQ2A 4OPJA 3K5OA 3ITHB 2FC0A 1NHUA 3V9WA 2RKIB 4RW6B 5F9LA 1S9GB 4B3OA 2IGIA 3CG7A 4EP5A 2G8UA 1BQMB 1T7PA 1HYSA 4MKBA 2BQRA 2F96A 3D0PA 3PY8A 3MAQA 1S10A 1IM4A 5C25A 4K4WA 4G3IA 1JL2A 1JXBA 4KFBB 3D28A 3QESA 5E41A 2IM2A 4FJLA 2XGQA 2J6UA 1SL1A 1CXUA 4CJ3A 2OPRB 4J9OA 3AVMA 3ZSXA 4DL4A 3V9SA 3H5SA 4N76A 4Q43A 1A5XA 4Z4FA 3OYMA 3HPOA 4M3YA 4ECTA 3DRPA 4ECRA 1NOZA 5J1EB 2OPPB 4FJNA 4NRTA 3MEDA 3PW7A 4ICLB 3JSMA 1JLGB 1CXQA 3QLHB 5KFWA 4QWBA 2R2TA 4IOBA 3PO5A 4J9RA 2W9AA 3V1OA 2QE5A 4DQQA 4BDZA 2AGPA 1S49A 3MECA 4W5NA 1ASUA 4CHOA 1RT4A 1TL3B 4J9NA 3Q8RB 2KZZA 2O4GA 4OLAA 4KTQA 3TAGA 1S6QA 4ZP7A 1J5OA 1RILA 5J2NB 2UUTA 2HHSA 3C94A 3AVFA 1LW2B 5CYQB 3MR6A 4DTUA 3TAMA 4CIFA 4O3OA 4FVMA 3MF5A 2FJVA 3KKSA 2ILYA 2GIRA 3CDUA 1RNHA 4BE2A 1GOCA 2HVIA 1LWEA 2QKBA 3HPGA 3AA2A 4K4UA 4ZP8A 4ED3A 5DG9A 3OSPA 2HNDA 4ZP9A 4CF0A 3VA0A 1XR6A 1ASWA 1X9WA 2JEGA 4DTJA 4TQSA 3OL9A 1S5JA 3ASMA 2IJFA 4K4XA 1ITGA 3T19A 4PWDA 3KJVB 3WNEA 2HMIA 1HQEA 4R8UB 4E7HA 1XI1A 4W5QA 1RAJA 4L8RB 4KHQA 4KRFA 1S1XB 3DLBA 4FJGA 1TKXB 1XWLA 3EZ5A 4Z0UA 3IS9B 3OYLA 3DRRA 4DQRA 1IKYB 1R0AB 3MFHA 2P5GA 1QHTA 4FK2A 4LSNB 4DL2A 4K8XA 1I6JA 4CEOA 3DLHA 4FJ8A 3BJYA 1LW0A 2QXFA 4F4KA 4FLVA 1N6QB 4IR1A 1D1UA 1W9HA 4CJSA 4ECYA 4B08A 1WSEA 3B6OA 3KLGB 5DQGA 2VG6A 4Q44A 2P1JA 4NLDA 4KHMA 3CDWA 1NNDA 1S1VA 2VG7A 4EO6A 2CJQA 3E51A 3K57A 2XWYA 2VG5B 2VWKA 4EP4A 3HT3A 4FS1A 2W9CB 3OYGA 1U4BA 1HNIA 1RTJA 1LWCA 3KK1B 1S1WA 1VSFA 2FJWA 2PYJA 3M8QB 5K14B 3D5MA 3DLEA 4CCHA 3PJWA 2D5RA 4IDKB 2GIQA 2UVUA 4XIUA 2UVWA 5L1JA 4MFBB 3DRSA 5KFXA 2IDOA 3H2LA 4ELVA 1JLCA 2BE2B 4B9VA 4JRPA 5KFMA 4R0EA 1JLEA 1NK9A 2OZSA 3MXJA 3DI6B 3QO9B 3BSNA 3BDPA 3LP1A 4NYNA 4CERA 4BE1A 4IKAA 2RDIA 1XHXA 3CJ0A 4YQWA 3OYKA 2RF2A 3SUOA 2XY6A 3DOLB 3SYZA 1C0UB 4IRKA 2HWIA 4KAIA 1ZTWA 2JC1A 4ELUA 5DQHA 3IN5A 5DK5A 1JLAB 5J2QB 5KFUA 4DTOA 1KHVA 3RAXA 4C8MA 3DLGB 1WSHA 4MQ3A 3V1QA 1NJWA 1IKXA 3HVTA 2HNYA 1RBUA 1BHLA 4DL7A 4FJMA 1QS4A 2AGOA 4QW9A 4EBCA 4WFYA 4KHUA 1SL0A 2HNZB 3GYNA 2YNIB 1WSGA 2RPIA 5D3GA 4ZVHA 1TAQA 3OYNA 3N6MA 2B6AA 3KLIA 2HAIA 5EWFA 3D45A 4FBUA 5KG2A 3IGNA 5KT4A 4E1MA 1SKWA 2JEJA 4B8AB 5KG7A 4Q8FA 2LSNA 4DSJA 3GIIA 2FBTA 2YKNA 3KLEA 3GV7B 1SH3A 4FK4A 2IOCA 2W7PA 1KLMA 2XC9A 3LAMA 5HROB 2I5JB 4R5PA 1SKSA 5KT7A 4DF4A 1JKHA 3IRXA 2R8IA 4JV2A 1WSJA 4HCCA 3VQ5A 1BISA 4J9SA 1RDBA 4M3RA 1KLNA 1QE1A 4QW8A 1VSLA 1VRUB 3NBPA 4C8OA 3MFIA 3CYMA 2YNHA 3ISND 4FZZA 4ZTFA 4KKOB 1K6YA 2AX1A 5HLFA 2X6SA 3MEEB 4CESA 1LWFB 5HP1B 2OPSA 3L2QA 4TSXA 4O3SA 3ICLA 1SUQA 4M45A 1TGOA 1NK5A 3NAHA 1TKZA 4N47A 3NGZA 4RNOA 4B9NA 3KD1E 4NYZA 4Y1CA 2P51A 1TKTA 3S3MA 4IQXA 1REVB 2G8IA 4EEYA 3JYTB 2CKWA 2XHBA 1S1UA 2RN2A 3CVKA 4TYBA 2BQ3A 3A2FA 4DSLA 3OJUA 4EZ6A 4ZPDA 1S1TA 3CQ8A 1FK9A 4FJJA 4IH6A 2E6LA 3QEIA 4CGJA 3RB4A 3I8DA 4GVMA 2G8FA 3MEGA 3AVLA 4UQGA 3NAIA 1BI4A 1L3UA 3H4BA 5HBMA 5KT5A 5DGBA 3BR9A 1C6VA 2R2RA 4DG1B 3NF8A 5F8GA 4H54A 4QPXA 4B8CA 1X9MA 1JLFB 3SV4A 3M9NB 3I0RA 5KFOA 1RT1A 4O44A 3QETA 3OS1A 1RT6A 1RT5B 3ZT0A 1CSJA 1FKPB 3DM2B 4WYLA 4E7LA 3PHEA 3OS0A 3HJFA 3VQSA 1WLJA 3S3OA 2E4LA 2W9BB 2AJQA 4TXSA 1D0EA 5DQIA 2VA2A 3KK3B 4RW9B 3OYEA 3PVXA 4CK2A 1C0TA 1C1CB 1UA1A 2XI3A 3OJSA 3OYIA 4JS4A 2V0NA 5C5JA 5KFRA 3ZSOA 4G1QA 1L3TA 4IG3B 4QWCA 4KV8B 2WHOA 1T05A 4O55A 1DTQB 4CHYA 4J2AA 4WYWA 3I0SB 5DLFA 2A1SA 4KREA 3M8PA 3OYHA 4W5TA 4TY8A 1DLOB 1IKWA 1VRTA 1JIHA 4NCAA 4KAZA 1RBRA 3HVWA 1NJYA 4CJPA 4I2PB 1S0MA 4YR0A 4ID5B 4IG0B 1KFDA 2IAJB 4GW6A 3OYFA 4H4OB 2FBVA 5KFDA 4PY5A 1SL2A 2KZMA 4I7FA 1Y97A 4TN2A 1RTHB 4CF8A 1NJZA 3LP2B 3BQ1A 3ZSZA 3NH2A 2FBYA 4JV0A 5I42A 1RBTA 4AILC 3OYAA 3QERA 3PX4A 3CJ5A 2ETJA 2AU0A 4KB7A 3Q8QB 1Z4UA 4Y3CA 4OPKA 2YKMB 4U6PA 2ZD1B 3AO1A 3TI0A 4XPEA 2WB4A 3VQCA 4DTSA 3SFUA 4LD0A 3VN5A 4CJFA 4IR9A 4RW7B 3PZPA 4KHSA 1WSFA 3QYYA 3QIPA 1KRPA 4FXDA 1U09A 3V6DA 2W42A 4TYAA 4PQUA 2WONA 4Y2AA 4HYKA 4ZMMA 3RAQA 1W0HA 3H5YA 3QIDA 4NLUA 1S9EA 3ZT3A 4WFXA 4E0DA 4EBEA 1KFSA 4QWDA 5I3UB 2ASLA 4CK3A 4DQSA 1EP4A 3G6XA 1DTTA 4FLWA 1HNVB 4OKJA 5KGXA 2YNFB 4DU4A 4DMNA 1HPZB 1EX4A 3QEWA 3C6UB 4M95A 5KRTA 2RKIA 1RTIB 4WE1B 3CM6A 3QEPA 4ZPBA 3DOKA 4Y1DA 3ZSYA 1RTDB 3RB0A 4Q5VA 2Y1IA 3ZSRA 3T5JA 4RG8A 4FZXC 2DTUA 2YV0X 3KLHA 2BGGA 5KFSA 1QAIA 3QEXA 3BQ0A 2PZSA 4B3OB 4ECXA 3VA3A 4URQU 1MU2B 1RT3A 3O4QA 5J2PA 1HYSB 4OGCA 1EETA 3E01A 3V6HA 2V4QA 1Z25A 4DSIA 2C22A 3KKRA 3C6TA 2DFFA 4EO8A 3WNFA 4RW8A 4FS2A 1S97A 3SJJA 3QNOA 1KVCA 4HHTA 1QSYA 4KB1A 5CYMA 1T3NA 1ZBUA 3BQ2A 1VSDA 1YTAA 4ED7A 5KFBA 3H59A 3VQEA 5DMRA 2F8EX 3NHGA 3LAKA 3P5JA 3OVNA 4FJXA 3FSIA 4Y34A 5FRMA 2ASDA 1HYZA 3ZCMA 2KFZA 3DRPB 3TABA 2ATLA 3MEDB 3JSMB 1I39A 3CM5A 5HRSA 3SUQA 1RDDA 4RNNA 3L2UA 3RBEA 4O3QA 1Q9XA 4LH5A 5L1LA 3LP0A 3AVHA 3NGDA 4FM2A 4O0IA 3MECB 1A5VA 2ALZA 3MXMA 1RT4B 4O0JA 4RNFA 1J9AA 1S6QB 3PW4A 5HRRA 4B9MA 1J5OB 4JLHA 3P83D 1GX6A 4CHZA 1NK0A 4RNHA 3TAMB 3DMJA 3AVCA 4HUFA 1NK7A 1C1BA 4FJHA 3UIQA 5KFAA 3T1AA 2J6SA 3NF9A 4J2DA 4OKKA 3LPUA 2R2SA 3GQCA 4BDPA 4CJ4A 1Q8IA 1LWEB 2EHGA 4B9UA 4CJRA 1B92A 4NCBA 2HNDB 3KHGA 3GIJA 1SH2A 1HQUA 2FLPA 2FVRA 4KHRA 1Q9YA 2E6MA 1BCMA 2DFEA 1SV5B 2R8JA 1TVRA 1UWBA 5C24A 4KPYA 1WAJA 3AO2A 1TAUA 4CEZA 4H4MA 5KG0A 2WOMA 1RYSA 4LSNA 1RT2A 4MK7A 2R2UA 2IMWP 3GV8B 5F8LA 1WNEA 3GIMA 1TQLA 3BGRB 4J9KA 2ZE2A 2XY8A 4ECWA 3GILA 3PW5A 4NLQA 4ZP6A 2G8KA 1LW0B 3LZJA 4AHRA 1K1QA 3CJ4A 4HTUA 2XGPA 1WAFA 4KHWA 1U49A 1L3SA 1JLBA 1J53A 4O4GA 2VG6B 3EZUA 3PR5B 4C8NA 1S1VB 2VG7B 3DDKA 3QINA 2XCAA 1J54A 4NLRA 1RBVA 5DG8A 1HNIB 1RTJB 4DL5A 1RT7A 1LWCB 3AVJA 2IC3A 3L3UA 1S1WB 4F8RA 2BRLA 3DLEB 4KB0A 2JLEA 3RRHA 4MIBA 3TARA 2R8HA 4E19A 1G15A 3TAQA 4BWMA 3DRSB 3IG1B 1JLCB 1WNSA 2XCPA 4DF8A 4F3OA 4CHNA 3PW0A 2Y1JA 1D5AA 3KD5E 1JLEB 4ZTJA 1OS5A 3PX0A 4FM0A 3ALYA 3LP1B 3LALA 2HW3A 4LSLA 3FQKA 4K4TA 3M9OB 2RF2B 4ED6A 3AA4A 3AVAA 3CFOA 3SZ2A 4KHYA 1T03A 4CJTA 4BE0A 1B9FA 3CJ2A 4RZRA 4URGA 3HK2A 3RMDA 1FKOA 4KO0A 4CJ5A 1X1PA 1S0OA 3O3GA 3HHKA 1IKXB 3HVTB 1N5YA 5J2MA 2HNYB 4CJQA 4ZPAA 1RA6A 3VQPA 2I1RA 2W8KA 3OL8A 3OHAA 4FLTA 3CO9A 3HM9A 3AO4A 4TY9A 4F2RA 1BQNA 5D3GB 4CIGA 5CZ1A 2B6AB 2KQ2A 3SUPA 2ZKUA 3QGGA 2OA8A 1JL1A 3K59A 3NDKA 1S48A 3NE6A 2YNGA 1S4FA 2YKNB 4IFYA 3KLEB 2Z1HA 3VQDA 3DLKA 2BRKA 5EWGA 1KLMB 3HXMA 2A1RA 3MXIA 3NGYA 2JGUA 3H5XA 4CEQA 2D0CA 4QAGA 4R5PB 4ECVA 1JKHB 3IRXB 3V9XA 4N41A 1QE1B 5F8NA 4LH4A 5F8HA 1RDAA 1QTMA 2OPQA 5DLGA 3NBPB 5KFQA 4ED0A 3V6KA 3V4IA 2YHAA 4FBTA 3KMQA 2YNHB 4DTNA 3OYJA 4N5SA 4CEAA 4F4YA 2AWZA 1Z26A 4FLYA 1L5UA 4QCLA 4RU9A 4CEEA 3PX6A 4Q0BA 3FDSA 2OPSB 3H4DA 4Q8EA 1U45A 4DQIA 4M3XA 2DY4A 1SUQB 3OSNA 1S0NA 4NLTA 1TKZB 4DSKA 4PA1A 5KG6A 2BANA 2XRIA 2QV6A 2B43A 3WNHA 3O3HA 2PYLA 5FDLA 4EYIB 4YR3A 3AO5A 1TV6A 4KI6A 3V81B 5KT2A 3O3FA 5KFVA 1CZBA 1IKVA 3LANA 4ID1A 4ED2A 1S1TB 3TAFA 1HARA 4DFMA 1FK9B 5T14A 2XO7A 3I5AA 3AVBA 4WXOA 3UDLA 4NZ0A 4IRDA 2WK4A 3MEGB 5F8MA 1BIZA 1BI4B 1SH0A 2HVHA 3IAYA 1RT5A 2HHQA 3HP6A 4LQ3A 5HBMB 2C2EA 4JUZA 2ASJA 3I5BA 3Q8PB 4H8KA 4M3UA 3THVA 4OGEA 4KTWA 2W9BA 3LP3A 4FLUA 3NGIA 4PUOB 3AVGA 4HKQA 3RRGA 3I0RB 1RT1B 4O44B 3S3NA 1RT6B 4RW9A 3BSOA 4J9QA 4DFPA 2QKKA 4JV1A 2GUIA 3UQSA 3QNNA 3SPYA 5KFCA 3DYAA 3RBDA 3K5MA 3RWUA 3KLFA 4E1NA 3I5CA 2G8VA 2IS3A 4FJKA 3MTKA 4C8LA 4Z4EA 3CWJA 1ZTTA 4KE5A 1C0TB 4CFAA 4N56A 3FFIB 1BCOA 3OL6A 4G1QB 3L2VA 3T5KA 1T05B 3VQ4A 4I2QA 1TL1A 3NFAA 2D7SA 1D8YA 4BDYA 4IG0A 4DU1A 3M8PB 3OLAA 3G6VA 4HUGA 1XR5A 2V9WA 3KK2A 3L8BA 2JEFA 4TY8B 4FK0A 1RTHA 1VRTB 2C2DA 5CZ2A 1HMVA 2FJXA 3IGVA 4AHTA 1CLQA 3L3VA 4GMJB 4JS5A 2OZMA 2KTQA 3G86A 3RMCA 1NKEA 5KT3A 4I7FB 5C42A 3GV5B 4O5BA 2X78A 1CZ9A 3ZSWA 3HYFA 2EC0A 2IM1A 1VSEA 4CFDA 5JXSA 1JLQA 4IFVA 3U6FA 1ZBHA 3OS2A 2Z1IA 5I42B 3VQAA 4FW1A 4NCGB 4CGFA 2OYQA 2V4RA 4DTPA 5KFIA 4J2EA 5EWEA 4RW7A 4KBIA 2D0AA 4CFBA 1S6PA 2B5JA 5KFFA 4DEZA 4DU3A 5KFJA 1SKRA 1ZBLA 4MIAA 3HP9A 4RW4A 3PR4A 4IKFA 4OL8A 2EX3A 4ZHRA 3MR5A 3M9MB 1QQCA 3QIPB 4CJUA 5KG3A 4WZMA 3V6DB 1HYVA 4Z4IA 1MMLA 4PQUB 2IBKA 4I9QA 4CHPA 4DTXA 3HKWA 3AV9A 3V9ZA 4K4SA 1F21A 3ITHA 2BR0A 4RW6A 4CECA 4WE1A 1S9GA 1TK0A 4WXWA 1EP4B 1BQMA 3V6JA 4GC6A 1DTTB 1RYRA 2UUWA 1QAJA 3Q8SB 1RDCA 3AVNA 3DOKB 2O4IA 4NLSA 1MU2A 4KFBA 2KW4A 1QSLA 3ULDA 3FQLA 3PW2A 2PY5A 3KLHB 2OPRA 3TANA 2WRMA 4CF9A 4O3NA 4CFCA 4MKAA 5C25B 3AVKA 2E9TA 1RT3B 3LPTA 1U48A 2DPJA 5J2PB 5DGAA 1T94A 1EETB 2XY7A 3OL7A 4DTRA 4DLEA 4MH8A 3HL8A 5J1EA 2OPPA 4CF2A 3E01B 1NKBA 1WSIA 4ICLA 3VQQA 1JLGA 4NRUA 3QLHA 3T3FA 3G10A 3C6TB 1UAXA 5KGWA 2WCXA 1KSPA 3SI8A 4NLGA 4FLZA 4RW8B 5KFZA 4HVJA 3MR3A 5CYMB 4NLPA 2GV9A 2HHUA 1TL3A 4QWAA 2O5DA 3NL0A 3NMAA 1I3AA 5J2NA 3ZT4A 1YT3A 4GC7A 1KCFA 1LW2A 5CYQA 5FROA 1JXLA 3SI6A 3K5NA 3VQBA 3SV3A 2ZQBA 1HRHA 3SPZA 1ASVA 4AHUA 4TQRA 1KHWA 1W25A 4DWIA 1C1AA 5FRNA 3LP0B 3BREA 3AO3A 1TKDA 4IRCA 2FVCA 4RUAA 3OLBA 4YP3A 3TQ1A 4NLOA 4CIEA 4EZ9A 2FLNA 3OYDA 4CJEA 2JC0A 3PJXA 2R8GA 5KG1A 1TP7A 4DS5A 4WZQA 3CFRA 5KFPA 3DMJB 4URSA 3OY9A 1C1BB 3VQ9A 3MR2A 1BL3A 4B9TA 1U04A 1QSSA 5KI6A 4RUCA 2FBXA 3KJVA 2DFHA 4LY7A 5KFGA 5EU7A 4MK8A 4NLYA 5SWMA 3V1RA 4R8UA 3KNAA 4F4WA 1SV5A 1S1XA 5SZTA 2FVSA 1TKXA 3ZT2A 3VQ7A 3LWMA 1IH7A 4OLBA 5KFTA 3IS9A 4PWDB 1IKYA 4BACA 3TAEA 2HMIB 1HQUB 1HQEB 3H98A 1R0AA 5HRPA 3OYCA 5F8IA 4W5RA 5T7BA 2G8HA 4JRQA 1N6QA 1NK8A 4ECUA 1TVRB 1UWBB 3KLGA 3DRRB 5C24B 3QZ7A 3LZIA 3SUNA 3PO4A 3BGRA 4I9LA 4F2SA 3AVIA 2IM3A 4H4MB 1QUVA 2ITGA 5KFEA 2VG5A 1ZETA 2WOMB 4DFKA 1LAVA 1RT2B 2UVRA 2W9CA 1K1SA
chains in the Genus database with same CATH superfamily
4WWSA 4NLXA 4ED8A 4DV3J 2FPHX 3OYBA 3AT1B 1TMMA 3M8QA 3NF6A 2AMCB 2ZE2B 4YMEA 5JLFA 4KTZA 4Z4GA 2D9OA 4DZDA 3T5LA 3D0HE 3EVWA 4OX8A 1NKCA 1LAWA 4CP5A 4KR0B 3JB9k 3UNYA 3SSQA 5E26A 3RB3A 3MXHP 3BN7A 3BSCA 3O9TA 3EGZA 4GVBB 2NRHA 4A8OA 5KFKA 3CFPA 4AL6A 2MZSA 4AHVA 3DU6A 4CEBA 4DL0C 1KQKA 2NYIA 2OGUA 1X9JA 2W2MP 2IA6A 4PXBA 5AZIA 1XNQF 3AOAA 3DLGA 1G7CB 2BYCA 1U26A 1FKAF 4E3SA 5A2QO 2EFOA 1M5HA 2BW7A 2UZAA 2G1DA 4LSLB 4ECSA 4QU6A 1MN9A 3ISNC 2QO3A 4K43A 4I6YA 3IR5B 1BIUA 2A1BA 4BGBA 1ZBFA 4DUYK 3HVRA 3C14A 4CGGA 2O8EB 3VZIA 2GBZA 3GE9A 4DXLA 2WTFA 4RO0A 5AQZA 2R42A 3NH0A 2GJFA 1YKWA 2I5JA 3O6QA 3AAPA 3H90A 4ZVEA 5KRSA 1Q78A 2HHVA 4AM6A 3G6YA 3NKYA 3CC4N 1BQNB 1S6OA 4WP3A 3U3GA 1A5WA 3PDNA 3KHRA 1RP5A 1VRUA 3T9ZA 5D0HA 1X4GA 3VGVA 2CZVC 3EEQA 4RWTA 4C0HA 1I94K 3WZ0A 1XNQJ 3FKBA 3H08A 4FOIA 4M41A 3MEEA 1KDNA 4FM1A 3QZ8A 1R8AA 3LWLA 5HP1A 2JEIA 3NS6A 2ATCB 4X66F 1SC4B 3LH2S 2HIQA 3O9UA 3L2RA 4IOCQ 3Q2TC 2CQ4A 4L76A 1NOYA 2CQDA 2B7CB 4Y6IA 4DR1F 3JYTA 2AEJA 4JD2A 1NJXA 1KQSM 4YNQA 4YB7A 3RTVA 1PYOB 4AH9A 4X4TA 5LM7E 3UN2A 2W2PP 4XPCA 4E7JA 2AX0A 4BR9A 4P2FA 4UY8O 4FZYA 4RNMA 3G4SN 3ZZTA 1GX5A 5CQGA 1S6UA 3FRZA 2HHTA 2OHDA 6AT1B 3WQTA 1DT9A 1S0VA 3KDOA 3OUYB 3HVAA 3X3UA 1TV6B 1JLFA 2DHGA 4DL3A 3MHYA 1YLXA 4X65F 1IKVB 3DLLL 4UW2A 4K0KF 3DM2A 2C1EB 1EARA 2J9DE 3TUIC 3GU0A 3J8AA 1RDRA 4DR4K 3R27A 4X66J 4B1ZA 4M94A 2I2YA 3ETMA 4LF5K 3T5HA 3D67A 2UVVA 1NHVA 4OZ2A 1X4AA 1RBSA 4DN0A 2B4JA 4P2SA 4M3TA 4OZ0A 3GZ7A 1C1CA 2D0BA 3CIZA 5M1NA 3SNNA 2CWKA 3MPVA 4DR1J 1S57A 4IG3A 4KV8A 2YKAA 4E7KA 3ATVA 3G0ZA 1UFWA 4K50A 2J6TA 4LSZB 3DYAB 3PYFA 4K4YA 3FFIA 1BGXT 3KLFB 2MQPA 2AJFE 2CNNB 4QS7A 2IVNA 4CBXA 2MJUA 4M5LA 3C66A 2NXEA 3JAMO 1LV5A 1HKAA 1D9DA 3H6EA 3RMAA 2ZNZA 1VLOA 3OFHA 3N9UC 2ROPA 4I2QB 2N3OA 2VQFK 1H0HB 3LP2A 3EY1A 4V19X 4F3QA 3K0JA 4BRFA 3L2WA 3KG0A 4X65J 4FWPA 2YH0A 3CJQA 5K8MA 4MIWA 2P9UA 3R7SB 3KK7A 3ZTRA 3CJ3A 1YI2N 2HQCA 3K2YA 3ZEUB 2GIFA 4HUEA 1VSMA 4M3ZA 4ZPCA 1F6TA 1KVIA 4EBDA 4J9MA 1QUPA 4OZ5A 2KJWA 5DM7L 3CC4S 4Z4HA 2B9WA 5AE3A 2QWMA 4UT4A 4WFBL 2QA4S 3TQEA 3KIOA 1HR0K 3RZAA 4QJVA 3THTA 4IBNA 4EYHB 2A41A 4CW7B 4ZCIA 1FW6A 4B1UB 1FXXA 5AE1A 2WONB 3R8YA 1S9EB 4CHQA 2ADBA 5KPTA 1HPZA 2Q3PA 3OFEA 3C95A 1KKHA 1BOTO 3EPIA 2E9RX 1RA7A 2CG4A 2W4CA 4CQ1A 4MDAA 3FGUA 3W7BA 2HFSA 1GMVA 4DUYF 3RMBA 1WTFA 1F5AA 3K5OA 3OPKA 3CIMA 4QZVB 5D0GA 4B3OA 3UKUB 4F0KA 4AF1A 4MKBA 1NMEB 3M8WA 3O9QA 1ZC6A 1LCUA 1HWKA 2QWNA 3T1HK 5T7LA 4K4WA 1IR2A 3D28A 3HSDA 1KQFB 4Y00A 4L6V3 2LA4A 1CXUA 2IFXA 1I94F 4JYAK 3SCLE 4N76A 2V2KA 3SQGB 4L75A 1Q82O 3TJ9A 4Z4FA 3OYMA 4M3YA 4OYAA 2OPPB 3QRPA 3AD9C 1JLGB 3OXGA 2FF3B 5H1SQ 3V5RA 3PO5A 2QFIA 1YIJN 1YAGA 3B6BA 5EXWA 3VEVA 1S49A 4DUYJ 4W5NA 1ASUA 4FP9A 1RT4A 2O4GA 2ZBPA 3MMJA 2B4OA 4P74A 5M2PA 3K5PA 1RILA 5FLXO 3MR6A 4NASA 1IM6A 2M7SA 1CS4A 1PJ6A 2HBRB 5JJBA 4O3OA 1B64A 3D2FB 3MF5A 1MG7A 1SQFA 2GFFA 2MZ1A 2CPEA 3M05A 3NLCA 2LLZA 1CJUA 1GQEA 3AA2A 1K44A 1WACA 4ZP9A 2J4RA 1VQ8N 3VAKA 1NUEA 3EZWA 4CF0A 3H42A 1I94J 3D3CJ 3CULA 1XR6A 1ASWA 4GMKA 1WD6A 2ZHAA 3A4TA 4OHVA 3IBWA 1S5JA 2NRVA 1E6YB 2BJ1A 1ITGA 4LF5F 1VQYA 1HQEA 2J0SD 4RX6A 4QR1A 4E7HA 2XS7A 4QU7A 3TA0A 1GH8A 2GX9A 3QAUA 4FJGA 1RK8A 5JICA 1XWLA 4KQZA 1X5SA 1ICEB 3OYLA 3V4MA 3R6LB 1CEZA 1QHTA 4FK2A 4LSNB 4K8XA 4UY8T 1I6JA 2VOPA 1WOQA 1LW0A 2QXFA 1N6QB 3EWGA 4HHHA 1QZ5A 2W2QP 4B08A 4ECYA 1WSEA 1FE0A 3KLGB 2C2KB 4Q44A 4NLDA 4MO5A 1NNDA 1S1VA 2VG7A 3K57A 1WUUA 2VG5B 2VWKA 2PFFB 4LRBA 1YZ6A 2W9CB 4KH4A 4CO3A 2FSJA 1LWCA 1S1WA 4EAHD 2FJWA 4AE5A 4CCHA 2XO6A 4IDKB 1NLKL 2VQFF 1RACB 2UVWA 1DRZA 3HOSA 3T6BA 4MFBB 5KFXA 1BA0A 2BE2B 3QWPA 4I64A 2PO4A 5GMDA 2EBEA 2QEXS 2VF3A 2OZSA 5F41A 4DV2K 3BR8A 1NWKA 3BDPA 2NRTA 5D0EA 3DXBA 4CERA 4LF5J 3W65A 4IKAA 4G9ZA 2RDIA 2J8AA 4GO5X 2FGCA 2JVRA 5AQHA 1C0UB 2OD4A 3M2UA 4JOUA 1HD1A 4KAIA 3D6TB 1JLAB 5J2QB 3VF4A 4MLEA 1KHVA 3RAXA 4RBUA 3M30A 3V1QA 1WTBA 4QIWD 3HVTA 1BHLA 1HPMA 2OAUA 1KOHA 3FFKB 4EBCA 5JLHA 1SL0A 2HNZB 1VQ5N 2YNIB 1YITN 1RWUA 4LVNP 4ZVHA 1FRLA 3OBWA 1RGIA 3OYNA 3N6MA 3NG8A 4BRNA 3MCNA 8AT1B 5KT4A 2VQFJ 3UD4P 2V68A 5KG7A 2LSNA 4CLSA 5L9NA 2FBTA 2YKNA 1WI8A 2W7PA 3OHRA 1S72N 2ERRA 4GY2B 2LYVA 1DJ0A 1AZSB 4R5PA 1Q7LB 1SKSA 2IVPA 5KT7A 2E29A 1JKHA 2BTFA 2LECA 4HCCA 3IFRA 3H8YA 1SQEA 4BY9C 3L9ZA 4QW8A 2QLFB 1VSLA 4DDFA 3MFIA 3UB5A 3DFEA 3ISND 4ZTFA 3BPSP 2CNLB 4MT1A 5HO4A 3J7AP 4BRQA 1LWFB 2OPSA 4JYAF 5FPNA 4TSXA 4O3SA 4M45A 3PIPL 3RG6A 2KM8B 1S79A 1VQ4S 4N47A 3LPEA 1S99A 3M6GA 2P51A 3S3MA 2VH7A 4FYYB 2M52A 4KYZA 2CKWA 2VDIA 2GO8A 2Z57B 5GIPA 1FFWB 2RN2A 5HQ8A 2HWTA 4DSLA 5D15A 4XH1A 3QPIA 4ZPDA 1S1TA 4FJJA 2NRWA 4IH6A 3ENHA 4AYBD 3JSYA 3MEGA 3CCTA 3NAIA 1K8KB 4OI6A 2NPIA 5HBMA 4YUDA 1D09B 3DJCA 3DGPA 3NF8A 4DG1B 5D4NA 1VQPN 3CT9A 1Q82T 2DNMA 2FJDB 1RT5B 2IMOA 1WKLA 4R79A 4WYLA 1RUSA 4A8WA 3VQSA 2DHAA 3ID8A 3S3OA 1CJVA 4XH4A 1SVDA 2W9BB 2AJQA 4TXSA 1YHQN 2PSZA 3OTBA 3OYEA 2WVBA 1HIYA 2XI3A 4JS4A 3OYIA 2ZWOA 5KFRA 3AQOA 3ZSOA 1L3TA 5EVZA 2WHOA 1FNOA 2XMMA 4CHYA 2IVFB 4J9UE 1YJ7A 3CJSA 1Z6RA 4M1KA 3M8PA 2BEFA 2DNNA 4W5TA 1DLOB 1VRTA 2RB7A 2KRBA 1RBRA 2DISA 2OEKA 4H4OB 2VPZB 3C8YA 4FZVA 3Q7BA 4PY5A 2RMLA 4HI1A 2DRAA 4G1IA 3I33A 5IXUA 4CF8A 1RE1B 4DCOB 1YITS 3ZSZA 3NH2A 4ANDA 2KXNB 1NSAA 4JV0A 1VQLS 5I42A 1ZAXA 3CJ5A 3VAHA 2AU0A 4CO1A 3Q8QB 3CC7S 1Z4UA 1SAZA 5K8PA 4DV2F 5GAHU 4DV5K 2ZD1B 1RHMB 1HI8A 4A2AA 1VHIA 3KG1A 1C4AA 1FRJA 4DTSA 2X3GA 4JKCA 3VN5A 3G82A 4OZJA 4BRDA 4FF3A 1WSFA 3HFZB 1S7HA 5LXRA 3EXCX 2CIMA 4KJIA 3QRQA 3JQKA 2WONA 4HYKA 4ZMMA 3RAQA 4LIRA 3H5YA 1SJ3P 4NLUA 1S9EA 4BG8A 4EBEA 2QYGA 4CI6A 5ETMA 3QT5A 4QWDA 4G65A 5I3UB 4CK3A 2CZ4A 2K1RA 3G96A 3G2XA 3G6XA 4FLWA 1HNVB 2J7UA 4DU4A 4DMNA 4PXDA 1EX4A 1BWVA 1Q1KA 5KRTA 4WE1B 3QEPA 5JMNA 4ZPTR 3NGTA 2E44A 1RTDB 3MAAB 5LJ5Y 4NL5A 3ZSRA 2VUGA 1AXQA 2E2QA 2HYIB 2DKOB 2E5JA 2Q1NA 2BGGA 1VQ6S 3CCSS 5J1PA 3HI9A 1NGHA 4NOHA 2GQCA 7AT1B 2CNKB 1HYSB 4YY3K 4DV2J 1EETA 5CH7B 1EWQA 4IO9Q 5BN8A 1UFLA 5A0YB 2OI2A 4EGLA 1Z25A 4HR2A 4DSIA 2C22A 1UKUA 2DFFA 1S97A 5C2FA 4D3GA 1QSYA 1X5OA 5A2QY 1AA1B 1QAXA 5CYMA 1DQ9A 1VSDA 1S3XA 1YTAA 2VJVA 5A76A 5E5NA 4DR2K 9RUBA 1RKIA 1VQPS 3HULA 2DHXA 3H59A 3W9IA 3VQEA 4OMFG 3CQXA 5DMRA 4ISFA 1KD1O 3O8MA 2F65A 1NXIA 3HBTA 1SQKA 1UPPA 1B4SA 2ASDA 2CGJA 3K17A 3JSMB 3PJ9A 1VQ7N 1YBAA 1JK9B 4WU2A 2QZ8A 3H45C 4RNNA 1I51B 3RBEA 3L2UA 2APOA 1Q8BA 2N4CA 2P9IB 4IZ9A 3W8GA 5M1OA 2ALZA 4WKRA 4O0JA 1J9AA 4B9MA 1J5OB 4LT6A 4E8UA 1NH7A 2AZ1A 3UR3C 1GX6A 3HFKA 4WIIA 1H2UX 1BY9A 1DARA 4PKIA 3DMJA 3QBXA 4HUFA 1SC6A 2HBJA 3UIQA 5KFAA 3TX0A 4J2DA 2D1KA 2R2SA 1CJTA 4LBIA 3GQCA 4CJ4A 3W2WA 4EMDA 4CBWA 3CCVS 3NY0A 1GLDG 2HIYA 3GB0A 3D3BJ 2QX0A 1FESA 1ULRA 1AROP 3WXLA 2FVRA 1Q9YA 2O8BA 1PJ5A 3CJ1A 1FRXA 2RRNA 1SV5B 2MB0B 3HT0A 1UWBA 1RADB 4NPOA 2QFJA 4CZEA 1TAUA 2WOMA 1ATSA 3UFCX 1RYSA 4LSNA 5A8WA 1V6HA 1FEEA 2MLYA 1S5ZA 2DNLA 3BH7B 3VESA 1TQLA 3QAEA 3BGRB 2DNYA 3H0PA 1UWAA 4NLQA 3MN7A 3MWBA 3PKMA 1IWAA 4AHRA 3ZLJA 4ITSA 2DR9A 4CZGA 4O4GA 1YXQA 5ETNA 2CQ0A 2VG6B 1OWXA 5GIOA 2ZZMA 1RBLA 3DDKA 5DS7A 6FDRA 3D1HA 5DG8A 2VOOA 2HLUA 1RT7A 3AVJA 2IC3A 3L3UA 5ETOA 4AUKA 4F8RA 3P38A 5HN0A 3RRHA 2P9LB 2QA4G 4MIBA 3CGIA 2R8HA 4E19A 4H5WA 1NNEA 1D5AA 3O4WA 2WTUA 4ZTJA 3PIOL 3PX0A 2V69A 1VQ9N 3M2VA 1F9FA 3FQKA 4K4TA 3P6YC 3B4DA 1ZA2B 4ED6A 3TW0A 3MM5B 1VS3A 3PYDA 2A2CA 2K3KA 1T03A 4FWKA 4BE0A 2P6SA 1RU2A 1B9FA 1VR6A 4RZRA 5E3QA 3HSGA 3FMWA 3HK2A 1HI1A 1U1KA 2QGFB 3RMDA 2ROGA 3AODA 1GLEG 5J2MA 2HNYB 2KDOA 1KR4A 2ZM6K 2I7PA 4YDDB 3A8IA 3VQPA 2V2QA 1H6KX 2XBPA 4FLTA 3HM9A 3AO4A 4ZDNA 1VISA 5ADXH 3VTIA 2MZJA 4CIGA 2W01A 3SUPA 2H54B 1AZSA 4CLWA 4K41A 1JL1A 3VALA 1SB6A 3NGSA 2YNGA 1KQSR 2IIRA 2Z1HA 3VQDA 2YVSA 2BRKA 3HXMA 1MWMA 3H5XA 4CEQA 4HACA 4FPRA 3D6MB 1T44A 4YY3F 1Y5NB 3IRXB 2YWGA 4A8XA 3M7VA 1OIAA 3Q8VA 4MDBA 5F8NA 4LH4A 1NO8A 5HQLA 1U0HB 3V6KA 4USJC 3V4IA 4DTNA 4N5SA 2ZWHA 3C65A 4DR2F 1Z26A 2B8PA 3IUCA 4CEEA 2PAVA 3PX6A 3H4DA 4Q8EA 1WJ9A 3AOBA 4HDGA 3OSNA 5ITHA 2G2ZA 3QMQA 3O44A 4NLTA 3IR6B 3DRXA 1H1VA 3FBCA 3D2EA 4OHYA 2QWQA 2KHDA 4Z7CA 1YJ9S 2PMWA 5FDLA 4EYIB 1V3SA 2H3GX 5KQDA 3I55S 5AXMA 1RDUA 3V81B 3O3FA 5F2RA 1CZBA 2GEMA 3F0NA 5IWAJ 2J9EA 4ED2A 3CCQN 4UUWA 1FK9B 1YTYA 2MQMA 4WXOA 4IRDA 4YY3J 1SC1B 2QL9B 1NJIO 4JI4K 1GNKA 1BI4B 2QWRA 1SH0A 1HI0P 5FPMA 5H9EJ 2MKKA 1RT5A 3IAYA 3PSIA 1EAYC 2C2EA 3S6EA 4H8KA 4C8YA 3Q8PB 3F5TA 3HF5A 2CQGA 1KD1T 5I3QA 2W9BA 4PUOB 2NR0A 3RRGA 3I0RB 1DHMA 2OELA 4O44B 4AXJA 5ETSA 3S3NA 2JWNA 1RT6B 4DR2J 3BSOA 1PG5B 4J9QA 3QNNA 5KFCA 2RS8A 2YX4A 2E5GA 4P75A 4I1TA 2NUHA 1B3TA 3RWUA 4E1NA 4Q2LA 4U8YA 1P9QC 2G8VA 3QFWA 4ZCKA 1TUWA 1IJJA 3BP8A 2HBZB 1C0TB 4CFAA 3AD8C 2LQJA 2QLXA 3VQTA 3BS9A 3MD1A 1YDLA 1T05B 3VQ4A 1D8YA 4BDYA 3HRGA 2DXFA 2QN6B 4DU1A 4JP8A 3G6VA 2HBLA 1OY6A 2JEFA 3R9PA 4TY8B 4FK0A 5EGYA 2EKYA 2FJXA 4DR5K 3IGVA 1FDNA 1CLQA 3W2VA 3FZFA 3L3VA 3RVCA 2HS4A 4JS5A 5ETLA 4HH0A 5KT3A 4I7FB 1YJWN 2X78A 5AQIA 3UD5A 1CZ9A 3HYFA 2QMXA 1BUPA 2N7YA 3PSFA 2VCPA 3KUGA 2V4RA 4ZJOA 4DTPA 4NEYA 1S76D 1A0OB 3OD2A 4CFBA 2B5JA 2I38A 4A48A 5E7OB 4DEZA 5KFJA 2R7WA 3N5FA 4C0BA 4AD6A 3HP9A 4RW4A 1WOSA 3P5TL 4CJUA 4WZMA 3ZX2A 3V6DB 3M8YA 3U7JA 2IBKA 4I9QA 2RQ4A 1U24A 1PIEA 2CQ3A 3JTNA 2AYGA 3LDLA 4WE1A 1S9GA 3SMPA 1TK0A 3G9CA 4ANEA 2W6KA 1Q81O 1WHWA 5K9FA 1OPIA 1RYRA 1HKCA 2VICA 1WG5A 2O4IA 3RU0A 4KFBA 4HHJA 4DR3K 3FBEA 2BJDA 4KH1B 3KWIA 3FQLA 3CJCA 3KLHB 2OPRA 2ZZTA 3CD0A 4CFCA 1SPBP 4MKAA 2E9TA 1RT3B 3LPTA 1U48A 3VHQA 1HWJA 1NGGA 2V8VA 2XWXA 5A8KB 4DTRA 1B0PA 1WBDA 2B51A 1WC0A 5J1EA 4DJBA 3BF1A 2B56A 1NKBA 2MQ8A 4NRUA 2GMJA 1FXLA 3C6TB 1UAXA 4H5VA 5KGWA 4NLGA 5KFZA 4HVJA 4NLPA 4U67Q 1JJCB 4QWAA 1GK8A 2VBWA 2O5DA 3VWSA 2AP1A 1QVFM 3R3TA 1T9YA 1YT3A 3W61A 3HHDA 1NB2A 2J0WA 5CYQA 2BV3A 4A61A 2EC2A 4F02A 3SI6A 3MDQA 1M5VC 4NI2A 3UCGA 2LDIA 4QOTA 1C1AA 1LK5A 2ZZNA 1TKDA 3QSYB 3MUMP 4NLOA 5AQNA 5JMVA 2FLNA 2V63A 2FUG9 4JB8B 4L3NA 1U6FA 2R8GA 3GJQB 2KKHA 1XEZA 2QMUB 3CFRA 2KHOA 3I6PA 3OY9A 1IN0A 3VQ9A 5C0YA 4F9OA 4DV1K 4ERDA 3BKFA 2DGOA 3M2RA 3KJVA 1CVJA 3VETA 2DFHA 4LY7A 4DPOA 4G6VB 4DR7F 2P9KB 3HJVA 3KNAA 4F4WA 5AZJA 2RHQB 1SV5A 2CPFA 4D3HA 1KVKA 1S1XA 2JSXA 2HBYB 2FVSA 5SZTA 3ZT2A 3VQ7A 4U7UD 4OLBA 3IS9A 1FRHA 2XZDB 4M5GA 1VLYA 2HMIB 2VD3A 3I56S 1HQUB 5C7PA 4WP8A 3MM9A 2QA1A 5F8IA 1PGZA 7FDRA 1UETA 1JB0C 3E2EA 3GPAA 1HWLA 1QD1A 3DNCA 1F5CA 4IXCA 1FHTA 1BD6A 3BGRA 4ES3A 4H0YB 1QUVA 2O1PA 3CMEN 2HS3A 4RR5A 4UOCA 1RT2B 4BR0A 1FF2A 5B8HA 5DG7A 1U2VB 3KVGA 3KK1A 4Q2MA 5K14A 4K4ZA 2OJ3A 2ZHOA 4X4UA 5KPZA 2IRYA 1C2PA 3VZHA 4ED4A 4TLRA 2HFOA 4LF2A 1NJIT 3ZX0A 4XO0A 1UEUA 5LY3A 4QYZK 2VC1A 1L3VA 4KHPF 2ZHBA 3C15B 3QGIA 4UOFA 1K0VA 1T9UA 4M42A 3DI6A 2P9LA 3QO9A 3TVKA 4DR5F 4MKYA 1B7FA 1QHAA 3I9V9 4DR7J 3CCUN 1VSJA 3DOLA 2XZWA 3BZKA 3TEHB 3H1QA 3GJSB 3KJNB 3S8SA 5AFUA 2VC0A 4CJWA 2ASOA 2O8CB 2AW0A 4WFZA 1N54B 1B9DA 3U3YA 2ZOFA 3BB5A 4F3TA 2B9EA 2E5IA 4PWWA 4CZHA 2CG8A 5CXTA 1NGAA 2G8WA 2JVOA 4F04B 5L1IA 2XI2A 3IXQA 4H5TA 1ATRA 4IH7A 3R7NB 2X74A 5L46A 5CHCB 3O8WA 4H0XB 3KHYA 4OVLA 4ILGB 3VEZA 1FKOB 4LQ9A 1N56A 3MN5A 3FMBA 4FJ9A 2HBMA 4OV1A 3TR5A 1N5YB 3SCIE 2V8HA 3SAGA 3MZIA 4KHPJ 5HROA 4H0TB 1SJ4P 4DR5J 1O1WA 4A8SA 5EX5A 4DSFA 1RLDA 2P9SA 4TNOA 1U1PA 5KTQA 3M5RA 2E5HA 2QI2A 3BSAA 3V9UA 2GVZA 4OJHA 5B7WA 5HATA 1IR0A 2CPJA 4DR3F 4FYXB 4KKOA 2EFGA 1E4FT 3DLKB 2D41A 3OW2M 3QBWA 4DTMA 1YJNN 1U0HA 1UFKA 2FDNA 3HO1A 3JS9A 2DVIA 1P27B 5HLFB 4CD1A 3DXMB 4CO5A 4FWNA 2BOPA 1KC8O 4I6WA 1REVA 3GIKA 2OPQB 2CUYA 3PNIA 2P5VA 1WB9A 1VOMA 1Q81T 2F9TA 4NYFA 4GRSA 4ZLPA 4CLTA 3VAGA 2QT7A 2M4MA 4WTYA 1TKTB 3UPFA 2Q43A 2P5OA 1HJOA 3H5UA 2R4FA 1P1TA 3RW7A 1B0TA 2AEFA 4J37A 4IOAQ 2ASMA 3MPUB 1S1UB 2A18A 3MWPA 3HHLB 1XR7A 3CTRA 3C16A 1Q53A 2IM0A 4DSEA 3V81A 4I69A 3PTWA 4OJRA 4J2BA 2Q3SA 1K8AO 1X0PA 4CEDA 2ILZA 5C2GA 4X64K 1WWHA 3CE8A 4DR3J 2EFQA 3FBBA 1T0TV 3FZKA 5B0FA 2F63A 4AHSA 3UNGC 3BYPA 3I4PA 3U27A 2CNOB 2RDJA 2E20A 3FEZA 3K58A 3DHWC 2DH8A 3ENAA 3NGUA 3BM7A 4QR0A 4PUOA 3DXKB 3AAQA 4DV1F 3MUTP 3KK3A 2A6MA 4FYWB 3NCIA 3G6ES 5F3TA 4FW2A 1OH6A 4JK8A 3US5A 3L7UA 3W9JA 1ZS6A 2VV5A 4OX6A 3CCUS 1GXTA 1DTQA 1RAIB 5C2CA 2YHYA 1ZA1B 3T6JA 1XQIA 3I0SA 2GGPB 3CCJS 5IT9Y 4CH7A 1R3NA 2F4VK 4PXEA 4ZPVR 3P45B 3EVMA 3MURP 3HPHA 3SSRA 3RGIA 3LDPA 2MJNA 4BC3A 4O4RA 4FJIA 1E6VA 1V5VA 4KBOA 2BDPA 4I2PA 2IAJA 4FF4A 1QQOA 3CCLN 2C28A 3AH6A 4AL7A 2CDQA 4ILMA 4FJ7A 3MX5A 4YDXA 2YKQA 3CEDA 1TL1B 2AP6A 2W24A 5EDWA 3MEKA 3BV8A 2F8TA 4DU8A 4BG9A 3DLRA 2NUBA 3NCRA 2OEJA 4KGMA 3DAWA 1NDKA 1NZ8A 9ATCB 2WW4A 4F50A 1T3OA 1YGYA 2QTWA 4XTTA 3THXA 1Q0NA 4QWEA 4DV1J 2AJ1A 3UW1A 2BQUA 5C42B 4USTA 2UUAK 2OP5A 3M32B 1WUAA 5F9NA 2O3DA 4EUVA 3VQ6A 2FTRA 2HLTA 1YTUA 3SQ0A 3AXMA 1YBUA 2JLGA 1JLQB 5AXLA 4IFVB 2BJEA 4Q45A 3S9HA 3VPZA 3GJTB 2BJ8A 2OH2A 1VSKA 2YNFA 3OR2A 4LFCK 4C11B 4KI4A 2WBRA 3NAEA 4OYZA 1SIZA 3BO4A 1TL4A 3WEEA 2L41A 1RTIA 4F4XA 1Y11A 2H9ZA 4PL8A 3TUZC 1WN7A 3H3OB 3P1GA 1GOBA 1AUSL 3NCQA 3SQ2A 4OPJA 3UE2A 4ZCLA 4RPFA 2IGIA 4EP5A 4QYZJ 2RIJA 4NLCA 3NVKA 1T7PA 1B70B 3U9ZA 4OI1A 4FO0A 5DM6L 4KGKA 4FF1A 2F96A 2FSNA 3PY8A 2CPYA 3CDAA 5IS2A 1IBCB 5E41A 1SJFA 4FJLA 2XGQA 3TU5A 2J6UA 3H2VE 1SL1A 2AZ3A 1YF5L 2KLAA 3UVJA 4LF7J 1WBBA 1JCEA 3GL1A 4L73A 4Z37A 3NS7B 4CLZA 2R7UA 2YQ3A 4Q43A 3UD3P 2HHPA 5D8HB 3HPOA 3TEGA 2R7XA 1WKKA 1Q16B 4NRTA 3MEDA 3U9DA 3E3XA 3POTB 1HHSA 2R2TA 4IOBA 3U8XA 3PHTA 2XSJA 3U02A 4J9RA 3V1OA 1RQ0A 1TYQB 3JXOA 4DQQA 3HM8A 2AGPA 3MMCA 1UPMB 1TL3B 3L4QA 3Q8RB 1KXPA 2W1BA 3TAGA 1JJ4A 1I3OB 2O67A 4ZP7A 4I0WA 3ENVA 1HQ2A 3ELHA 4LF1A 2YTCA 2DGXA 1LW2B 3I9ZA 3D7EO 3TAMA 1U25A 3MM7B 1L3KA 4BR2A 4CIFA 3UI3A 3KKSA 5HL7Q 2ILYA 2GIRA 3FZLA 1Y64A 4BE2A 1QM9A 4ZIWA 2F8MA 3HPGA 2I9SA 3AJ1A 4ZP8A 3EJMA 5DG9A 5BRDA 3OSPA 2HNDA 2F1FA 2A6AA 2RQKA 4PG4A 3R5AA 2X7IA 2DGWA 4JI7F 3EX7B 2JEGA 1M1GA 4DTJA 1XIQA 4CO2A 4USUA 3A0IX 3C46A 1FE4A 1KC8T 5CE3A 3GSDA 2J8SA 2HMIA 5IV3A 2E1RA 3M1VA 2J7KA 3W5YA 4R8UB 2ZJQL 3MMBB 2M8DB 1RAJA 1FD2A 4KRFA 2Q0UA 2V5HG 1TKXB 3EZ5A 3THYB 5TKWA 2E1ZA 4Z0UA 1YX2A 2B0GA 3X1LB 3WBZA 2JH3A 2JOQA 1R0AB 3MFHA 5IQQA 4ID8A 3FZBA 5DDQC 2F4VF 3BJYA 4F4KA 4U7BA 1U1MA 1K8AT 4MLHA 1ITPA 5CZVA 4CTAA 4KHMA 4JI8K 4EO6A 2XWYA 4EP4A 3NGKA 2MY7A 5A8RA 2HURA 1JJHA 5HOOA 3GE1A 4Z7YA 4LR8A 3M8QB 2FY8A 3DLEA 2DGQA 2D5RA 2GIQA 2KYZA 4XIUA 3DRSA 1JLCA 2AF6A 4B9VA 4ZVOB 4JI7J 1JLEA 3DRYA 1VBYA 4NYNA 4EFAC 3BBCA 2CAJA 4USKA 1OH5A 2D1CA 1T9WA 2BM0A 3R2CJ 4YQWA 3A5MC 2OO4A 2RF2A 3SUOA 3SYZA 3I4HX 2UUAF 4IRKA 5BPMA 2EXUA 1ZTWA 2JC1A 2Z2MA 3LM2A 1RAAB 1OY8A 4OIXA 4ZLLA 1EWRA 4JNEA 5KFUA 4CZLA 5AZIB 4C9DA 4C8MA 2JDJA 2LU2A 3DLGB 4JN4A 2F4VJ 2IYGA 4LIWA 3D4JA 3MGJA 4PWUA 1W26A 4PR6A 4F7VA 2AT1B 2AGOA 4WFYA 4A5AA 3VR1A 4LFCF 2V51B 3GYNA 3NOCA 2AHOB 1OO0B 2RPIA 1WF2A 5D3GA 3H3NO 2F9WA 4LRDA 1Q8LA 3D2WA 2FSKA 2B6AA 2HAIA 3CCMS 5A2QU 4CM2A 3F41A 3D45A 2MXYA 4E1MA 4AQYJ 3C14B 4B8AB 1I5OB 4Q8FA 1IBMK 4DSJA 3NNCA 1EKSA 3ILLA 3KLEA 3VF0B 1SH3A 2IOCA 3RYLA 2XC9A 3LAMA 5D4LA 2I5JB 2ZJPQ 1KP6A 5CA5A 3G71N 1UL3A 3GFXA 5E33A 3R1HA 3VQ5A 1RDBA 4J9SA 3W0LA 2UUAJ 2CH6A 1KLNA 1QE1A 2XM3A 1VRUB 2PD1A 3NBPA 2NLWA 1YQHA 2AX1A 5HLFA 2ZH8A 1VQNN 3MEEB 4J5OA 2K3IA 3IM9A 5HP1B 2R7OA 4DV4F 1X4DA 3N28A 1SUQA 2C3MA 1NK5A 4ISGA 2HG4A 3NGZA 4LFCJ 4B9NA 1NB7A 1TKTA 4ZVSB 1ZAWA 3PM9A 3JYTB 4HT5A 4JD2B 1S1UA 4NXNK 3ONQA 3HHLA 2YKOA 1QQMA 1KBRA 4EZ6A 4OHZA 1DURA 3CQ8A 3TVZA 2KT2A 2KO1A 2E6LA 3QEIA 1HNWF 3EXYA 4CGJA 5CABA 3O9SA 2EFNA 1V9OA 5BN9A 3K89A 3AJ2A 2BE9B 3D68A 4LBHA 2VWBA 3BR9A 2RU9A 4HL9A 3JQJA 4QPXA 4B8CA 2AKWB 1JLFB 2YHWA 2JX2A 3WXMB 5CYJA 3QETA 2XZTB 3DM2B 2E2NA 2YY3A 4C8ZA 3PHEA 4DV4J 1TFWA 1OSDA 4ES1A 2IDEA 2E4LA 2MQNA 2E2OA 4TVAB 2GGPA 1AB8A 4CM0A 3PVXA 4CK2A 5D4PA 2W6LA 1C1CB 3OJSA 3GBTA 4HTLA 4G1QA 4IG3B 4KV8B 2GNKA 2HF3A 5C15A 3VAMA 4WYWA 4KREA 1VHXA 4R25A 1G6BA 4WF9L 3S01A 1N5QA 2HVDA 3C7NA 1OYDA 4J7CA 4NCAA 4KAZA 1HNWJ 3HVWA 1NJYA 4CO4A 1KFDA 4GW6A 3OYFA 3O1BA 2PI5A 5KFDA 1SL2A 1V3RA 1Y97A 2XEXA 1Y0HA 5KQ8A 1NJZA 3LP2B 2OD6A 2FBYA 1IV0A 1MLAA 2HF4A 3W60A 4HI2A 1RBTA 3OYAA 3H46O 3QERA 2P9NA 1FRIA 2H5EA 3PX4A 2P9UB 4IFEA 4KB7A 1EJ7L 3NXZA 4HT7A 4OPKA 3J81Y 3TI0A 4XPEA 2J76E 1XMQK 2XNRA 5CZXA 4IR9A 3DKDA 3QIPA 1KRPA 1GMUA 2VKRA 4BGAA 1QQNA 4TYAA 3R5GA 4PQUA 1JXVA 3QIDA 1NDCA 3ZT3A 4WFXA 3KZBA 4FWMA 3Q8UA 2GJ2A 3TUPA 1FERA 4E1JA 4DPUA 2JFKA 4DQSA 1EP4A 3CMAN 3LM9A 4OKJA 5KGXA 2RHKA 1HPZB 3VTHA 2DGSA 5LMUK 4M95A 4NWBA 3CM6A 3B54A 4ZPBA 3UWTA 5JVHL 3IBCB 4CH1A 3VGTA 4Y1DA 1M5PC 1URRA 3D9BA 2A3JA 4B17A 4RG8A 4CO0A 3FK4A 4V1Ak 1QAIA 3BQ0A 2PZSA 4B3OB 3ZO7A 5IM0A 1MU2B 2N3LA 1QVFR 5GMKa 4BRMA 2CA9A 4PKDB 2MSSA 4ZJLA 5H9FK 1GTEA 3E01A 2QXLA 5T7LB 5IT4A 4P10A 1PYTA 2EWSA 3WNFA 2CGKA 3VOVA 1KVCA 5B0GA 4BRIA 3HZGA 1BE4A 1EB0A 1KN6A 4CYUB 4GV9A 2ZFHA 2QWOA 3P8BB 1NRKA 5KFBA 2EK1A 3L09A 3A3OB 1RISA 3OTOF 4BVOA 3OTCA 3TWZA 3P5JA 3FSIA 3CB4A 1XTZA 3ZCMA 5U47A 2ATLA 3BYRA 3U4LA 3JSBA 3CM5A 1U1LA 4YOTA 1BWFO 2LCWA 1RAEB 1E4GT 2HVZA 4LH5A 3LP0A 1A5VA 1RT4B 4G1PA 3MM7A 4NXNF 1HKGA 4H03B 1NZAA 5B0AA 4TLQA 3W9HA 4QS8A 3ZTPA 3ZETB 1CS4B 3AVCA 3QT8A 5BJRA 4FJHA 1Q18A 5MLCV 4ILHA 1KS2A 2J6SA 1YRUA 2C42A 4O0NA 4KPCA 4LFBK 3GJRB 2BKPA 3LPUA 1BDGA 1Q8IA 2NRXA 1FJGK 1CJUB 4B9UA 4CJRA 2QL7B 1OKJA 3LTOA 5LOQA 4ZVTB 2ADCA 2PN6A 3KHGA 1VQMN 1RWVB 3CI5A 3P39A 4UY85 1VJQA 4PG7A 4KHRA 2E6MA 3OTOJ 1BCMA 4HDHA 4ZCMA 4F0MA 3GCXP 3QJPA 2FHJA 1FO1A 5C24A 2IHR1 3TTDA 4AM7A 3RUBL 2LQBA 4H4MA 5KG0A 4OJGA 1XJWB 4WFAL 2R2UA 2C2MB 1H74A 4NXNJ 4J9KA 3J7YP 5EX3A 3GILA 2FHMA 1FWPA 2MKJA 4JI5J 3M6UA 2G8KA 3W66A 3FLCO 1LW0B 2MKHA 4KGXB 3LZJA 3CJ4A 1RKJA 4HTUA 5AQWA 1H7XA 1L3SA 1JLBA 1VC6A 1J53A 4JHDA 4KGVB 2A3ZA 1U1QA 3IA0A 1S1VB 2VG7B 1UVIA 4BRPA 1T02A 2XCAA 3J7ZO 1H38A 4NLRA 3CMAS 1RBVA 2Q97A 2WVDA 3CO0P 1LWCB 1S1WB 1K47A 2HQDA 4B3TK 4QPTA 3SJHA 3CD7A 3BBBA 2LEPA 3TRGA 4TKTA 3TUJC 1WNSA 3IDHA 1SKUB 1LEOA 3AARA 2MHEA 5IZHA 2GAGC 2MLXA 4KH0B 2MKIA 3ALYA 1RAGB 4H4KC 2HW3A 3HHLD 1DQ8A 2M2BA 4DMZA 1NSKL 2BX6A 3CFOA 1XMQF 2Y9HA 3M2UB 4PPZA 1CBKA 4X4VA 1QDUB 4URGA 4GO7X 2EVZA 3SBMA 4A47A 4KO0A 4CJ5A 2HRTA 3M30B 4YN3B 3HHKA 3E8OA 3HVTB 1D4XA 2PE8A 1O51A 2XLJA 3OW2R 1YJUA 1N8RO 2I1RA 4TU7A 2Q6CA 4TY9A 5LMUF 2Q0RA 3J81j 1B7YB 5CD4A 1WOOA 1SZ2A 2KQ2A 2DGVA 3L3CA 3O1WA 2OA8A 3N0VA 3NDKA 3E9OA 1Y10A 1WHXA 1S4FA 2YKNB 4IFYA 3HD2A 4OI2A 5EWGA 2A1RA 2JZ5A 1JNZB 3NRBA 3TNVA 3MXIA 3NGYA 2JGUA 1BWEA 4QAGA 4R5PB 3K9JA 3DOMA 1SI9A 3BGFA 3PCOB 1JKHB 3V9XA 1FXRA 4NXMF 2DNRA 3THPA 4QR2A 1YK9A 2FF6A 1XMQJ 1FXDA 5EX0A 4N41A 2K8GA 5F8HA 1QTMA 5DLGA 2YHAA 4FBTA 1R6YA 2NRRA 4ZA1A 2C3UA 4PXCA 3GDQA 4Q0BA 2OPSB 1VQSA 3PYEA 1UJ4A 3ZZRA 4FPAA 4DSKA 4CZMA 3N5BA 4OYIA 5KG6A 2Q6BA 2BANA 5LMUJ 4V19S 2QV6A 3MOJB 4ZVRB 2PYLA 1RHUB 5LSRA 4DN9A 2GHPA 1XMOK 2DNQA 4JI2K 4B3RK 1S1TB 4DFMA 3I5AA 3AVBA 1QJHA 1WG4A 3NMUA 4NZ0A 2WK4A 2YX7A 5H9FJ 2RSQA 3MEGB 2IYIA 4NXMJ 2GW8A 2K7KA 2Z4PA 5HMWA 3KG4A 2DH7A 5AFUH 4F25A 4LQ3A 5HBMB 5F0XA 4FWQA 2ASJA 3THVA 3DGPB 4RU2A 4A46A 4OGEA 5AQJA 5CR4A 3LP3A 2V8GA 4FLUA 3AVGA 3EUNA 1MDUB 4YOVA 4OYXA 3MUVP 4OX7A 1UMJA 3HX9A 4CZCA 2LEAA 1ACMB 4ZOSA 2PFDA 4CJ7A 4M8LA 1CJVB 2FIUA 3MM8B 1F9EB 2IS3A 2M9KA 4FJKA 4H4KA 4OYPA 4C8LA 3BY5A 1FVSA 1R8BA 3CDBA 4P6QA 4IWVA 2V52B 2R7RA 1D8ZA 3L2VA 2RQMA 1KWMA 1VCTA 1X7VA 1XQSC 3O5TB 4CLFA 3NCPA 5D77A 3M8PB 1BG3A 3OLAA 4HUGA 2V9WA 3KK2A 4WP9A 1VRTB 1RAHB 5CZ2A 1HMVA 4AHTA 1XC3A 3ENBA 4MKVA 2FY1A 1NKEA 5D4OA 5D6GA 4B9QA 4K0KJ 1WELA 4DV7K 4RWXA 2CRLA 1VSEA 4CFDA 4B3TF 2C2ZB 2QTDA 3U6FA 3ENQA 1ZBHA 2V7ZA 5I42B 2BZ2A 3P4UB 4ZVPB 3IWXA 2ZH3A 3LA0A 2HQFA 4QIGA 5KFIA 4J2EA 2DHSA 2HQ3A 3MMAA 1GFWB 4RBTA 1WHYA 3AA8A 2A0FB 1S6PA 4DU3A 3PLAA 1SKRA 2OKQA 4I56A 3G82B 2R7VA 4ZHRA 1HD0A 3OQ2A 2FXUA 2PEBA 3AY9A 1YJTA 3MWTA 1HYVA 1YRTA 2QWLA 1C0GA 3AV9A 1OVQA 3EL2A 4K4SA 4FWLA 3ITHA 5C12A 2KVQE 4RW6A 3J7ZT 2K1RB 3QNWB 4WXWA 1BQMA 3CF5Q 3FZMA 2CADA 4DHVA 1FNXH 2I0XA 1GXUA 2LXFA 4YHHK 1HWIA 2AV5A 2HBQB 2FGOA 1MU2A 2DY9A 2KW4A 3JTOA 3I96A 4YOUA 1QSLA 4HEA9 3PW2A 2PY5A 4CD3A 2O8FA 3IKMA 5C25B 3W3DA 4C23A 2PA3A 3G4SS 1EETB 2CXEA 4DU7A 2LQ5A 3OL7A 1HA1A 3HL8A 4CYUA 2CPIA 5B0EA 4ICLA 1U8WA 1IJFB 3QLHA 2BKNA 3T3FA 5AQGA 1DFDA 1KSPA 2WCXA 1C4CA 3SI8A 4FLZA 1DZ5A 5ELZA 5CYMB 2OIHA 2M88A 3A1YG 3AJDA 4YDUC 1N8RT 3NL0A 2ZBCA 2Z2ZA 1KAYA 5J2NA 4PG5A 3ZT4A 2E66A 1R43A 4GC7A 1Q5VA 4DZ6A 4WBFA 5FROA 1JXLA 1R7IA 2ZJRQ 3VEXA 3QMLA 3K5NA 1U8SA 2I7NA 3VQBA 2ZQBA 3KUEA 1HRHA 3SPZA 1W2BM 2BABA 4AHUA 4TQRA 1W25A 5FRNA 3ZETA 3IWNC 4IRCA 2QM1A 4RUAA 3OLBA 4YP3A 3N4WA 2HMPA 3FNNA 4CIEA 2RE2A 1J27A 5IT9U 1HNZK 2UUBK 4Y0WA 2Q2RA 1XMOF 4JI2F 5KG1A 4B3RF 5RUBA 4DS5A 1WSRA 4DPWA 2Y1LB 3DMJB 4IOCL 2DB1A 4A2BA 2VHGA 3GR1A 1U04A 4UF4A 2M8HA 5KI6A 1YRXA 1NDLA 2PGCA 5KFGA 1CJTB 3U1LA 5SWMA 4DCHA 3W2WB 2VYPA 2V94A 4DR4F 3LWMA 1IH7A 5KFTA 4PWDB 1IKYA 4BACA 3H98A 1YI2S 3OYCA 2H4WB 3NNAA 2O8BB 3KJFB 5LJ3Y 2BW2A 4JRQA 4C1NK 1UWBB 3D0IE 5FD1A 3DU5A 3DRRB 4USWA 3QZ7A 2D0PA 4F2SA 4I9LA 3JXUA 1VQON 2RRBA 1LNQA 3B8HA 4C3LA 2IM3A 3W3SA 2WOMB 2DIVA 2K7JA 5A8WB 1K1SA 1TU0B 3SDEB 2KI2A 4IUFA 1YVFA 4MK9A 3RAMA 2NS1B 1IO2A 2AYBA 2YHBA 3A5OC 1XMOJ 1U47A 2YQ0A 4B3RJ 4CE9A 4J9LA 3D6RA 3T1YK 4O4GB 1HBNA 2XG8A 1RCHA 2PDAA 3ZZ0A 5AXKA 1CC7A 1UP1A 1M90O 1BLUA 1R89A 2XY5A 1RT7B 2YXLA 3IFEA 5ETVA 3ATUA 1FA0A 2IC3B 5KFLA 3L7PA 4ANCA 4E7IA 4DV7F 1TTHB 3KTQA 4DR4J 3PYGA 5GAHP 2W4DA 2RU3A 2L08A 3OR1A 4WFNQ 2OUGA 4YFUA 5E2QA 2V2VA 1RHJB 2GC8A 4CJLA 4FLXA 4BBYA 3PEHA 4B9LA 3TOQA 2IJNA 1XNRK 2IA0A 3NWGA 1VSHA 1FFSB 2FHOB 3WXKA 2EFVA 3M2VB 1FDBA 1R8PA 1XERA 1F0XA 2V7YA 4A5BA 2P8IA 1HR0F 2W2OP 4NA1A 3GTYX 5BR8K 4YR2A 5GADP 3DWLA 4JI1K 3M8SA 1T03B 3SCKE 3CCEN 2RH3A 3TAPA 2DD8S 1D9FA 2KFNA 1FCAA 1P1LA 1G4CA 4YDUA 4I68A 1ZXOA 1LKZA 5J2MB 1T11A 1HBUB 4PQAA 2KVIA 1NH8A 2Z1GA 4NYOA 5EUHA 3CDEA 2G4BA 4M3WA 3TVYA 2IVMA 1YIJS 3KJQB 3HSTB 3LDNA 4BR4A 5KPRA 2CJYB 2AGQA 3NF7A 4YHHF 1H73A 4DFJA 4BRAA 1TK5A 5A6PA 2FLLA 1TMJA 1HJRA 1YWXA 2PMZD 4DV7J 3CD5A 4IOXA 5GAEI 1XC9A 2YNGB 3PACA 4WCEQ 2CQCA 2OTLN 2R8KA 1D9AA 2EW9A 3T1HF 3P5BP 4CRJA 3LOUA 4HACB 4CJKA 5JS2A 1FX4A 1YSJA 4CK1A 5AQXA 1MW7A 2KL8A 1KVAA 2VFSA 3THWA 5AR0A 4CGHA 1F60B 1HR0J 2PC6A 4NLVA 5K5MA 5KT6A 2LA6A 4X4PA 1VQ8S 3JTPA 1NK6A 4X4NA 4CF1A 2VPXB 3RW6A 4K2XA 3EDRB 3GOIA 3V4IB 3SBGA 2MHNA 1UOCA 1YBTA 3QEVA 1TK8A 3UDCA 2HS0A 2D3ZA 3C3LA 2KKZA 5AQPA 1TUGB 4LR7A 4DV3K 3TSPA 3BDEA 2VBXA 3FCWA 1WC4A 2GJIA 2X6NA 4DLGA 2G9OA 5JVGQ 2VFVA 1BMQB 1ZYQA 3PUFA 4EFHA 3SFGA 3D2EB 4ED1A 3W64A 1IBKK 2P9CA 1M5KC 1VQOS 2GMHA 4DUZK 5FDLB 4QOZB 2ABYA 1S9FA 3KMSA 2Y1RI 3UN5A 1N4LA 2CQIA 4M7XA 1HNZF 2UUBF 2W8LA 2DNGA 2KXFA 1FKPA 4AL5A 2ZVSA 3T1HJ 3H40A 4OX9K 2WB1D 2VZ9A 2DIUA 3CJKA 5KFYA 3RR8A 1UA0A 3DHXA 5HMYA 1WEYA 3QDKA 3T41A 2XTJP 1AFJA 1RB0A 4OZLA 2NSCA 4YB6A 2VB6A 4JYAJ 4USVA 2XYPB 3MM8A 2YJFA 5AQYA 2VJUA 2PIIA 2Y0BB 4K5RA 5FIIA 2E7XA 5B09A 3ZSVA 1EXQA 3P49B 3MCMA 4W98A 2B9YA 2BUNA 4L3KA 2DH9A 2F40A 4BVPA 2K06A 4ID5A 3QFPA 4IH5A 1LXNA 3TO8A 5THWA 4JK7A 3K2PA 1IKWB 1GAOA 2VFTA 1ZBIA 2R7YA 1QVGM 1N48A 3A8YA 3NGRA 3AB4B 3CCES 2ZDOA 5JUMA 1HNZJ 2UUBJ 2JRSA 2KT3A 5KG4A 1KQGB 1XMBA 2AQ4A 4GNIA 1TFYA 3R1XA 3VVTA 4DHYA 5HK4A 2ZUGA 2HWHA 2W7OA 5EHHA 4ZITA 1WF0A 3T1YF 2VWJA 3N6LA 5KFNA 1VQ5S 3QIOA 2DRDA 3W2VB 4PRFA 2ATQA 3IRWP 2YKMA 5L1KA 2ZH5A 4UTGA 3EPGA 1URNA 3G87A 1XNQK 2CJXB 4U96A 5HAOA 1NGFA 3AGRA 3C6AA 3LL3A 4BRCA 1VI7A 2WVCA 4E2FB 1HX1A 4H5RA 4CJVA 5JS1A 5H1SV 1SS6A 3GP9A 3J7YI 4DL6A 1JXEA 4AHCA 1S72S 5HJXA 1MNEA 3MD3A 4PKHA 4HLBA 3N6NA 3QJJA 4NMLA 2NLXA 3KOAA 2DBBA 3QT6A 3Q0AA 3AAWB 1XNRF 4X2BA 1PO6A 3KXDA 3W63A 5SUHA 2B5JB 4Z4CA 2DCUB 5E3CA 4RW4B 3C6UA 1HBMA 4A62A 3ILJA 5BR8F 3M8RA 4JI1F 3TR8A 2MQOA 2CDRB 4BWJA 4BHQA 2OANA 4ZVFA 5HSPA 2XMAA 1YVUA 2FVPA 2OEMA 3ZTSA 3J80O 2FC0A 1NHUA 1MROA 1VDHA 5F9LA 4DPTA 1M90T 2MGZA 5F0WA 1F5BA 1S9GB 3CG7A 2G8UA 1S59A 3T1YJ 3ZTQA 1EIYB 5D78A 2Q36A 2ACYA 3GYXB 2HFZA 4DX5A 2RDDA 5I4MA 3NVMA 5C25A 4G3IA 1JL2A 1JXBA 3OXLA 4XK8C 3CJBA 2GCFA 4KFBB 3UN3A 3ID6A 4X66K 2ITMA 2QG9B 2P2CB 2X1AA 3B82A 1YVNA 4CJ3A 4A8KA 2OPRB 4J9VA 4JK9A 4A4JA 2HZAA 4RCHA 1P6TA 3AVMA 1B0VA 4XH5A 2HFNA 1H3DA 2B4VA 4OYBA 3V9SA 1XNRJ 3H5SA 1MMNA 1A5XA 4PCQA 1VK3A 3DLLQ 3KWMA 2FC8A 3DRPA 1NOZA 3IR7B 5J1EB 2M5YA 4FJNA 2J9CA 3OTEA 1F9HA 1PKUA 1WC5A 3PRDA 5KFWA 3GG0A 5BR8J 4ATNA 4JI1J 1NBWA 2W9AA 1X3NA 2QE5A 3ENOA 3MECA 4M7YA 4J9NA 2KZZA 4OLAA 1S6QA 2GVDA 5M1QA 2UP1A 5IT9O 2FYXA 1BA1A 2WAQD 4MJKA 2HHSA 3C94A 1YHQS 5CYQB 1BHNA 5HMXA 5FPDA 4A8FA 1HHQA 4QIFA 1VAZA 4NI2B 2N7CA 4B02A 1RNHA 1IBKF 2HVIA 4GV3A 2Y3YA 1LWEA 1T6CA 4EHTA 2VBYA 5AQSA 2VKZG 4M5DA 4K4UA 4DUZF 1FWKA 2QLWA 3MN6A 1S4EA 2E7VA 3SQOP 3VA0A 1Y9OA 1X9WA 4J91A 1OH7A 4OX9F 4TQSA 3OL9A 3ASMA 3KFWX 2B8QA 3T19A 2MLZA 4ISEA 4PWDA 3M2RB 3KJVB 2HHHK 2G13A 7FD1A 2ALYB 2XS2A 4W5QA 4L8RB 4KHQA 5AZJB 1S1XB 2SXLA 3IS9B 4WQ5C 3DRRA 1NDPA 3L6QA 3S7RA 3PRBA 4DL2A 3MM9B 5DM7Q 4B1YB 1Q95G 4C0OC 2RUSA 2MY8A 1Y4ZB 1R8CA 5HQMA 4FLVA 2DTJA 4RUHA 3SDEA 4MYTA 1D1UA 3C6HA 1W9HA 4WFBQ 3O5BA 4CJSA 1WHVA 3J81U 5DQGA 4OPAA 1GLCG 2P1JA 1RGVA 4UOHA 2CJQA 3E51A 4YB5A 2Q79A 3DN9A 3OFGA 3VCDA 4FS1A 1U4BA 1IBKJ 4I6MA 1NGBA 1HNIA 3CETA 1RTJA 3KK1B 3BH6B 1VSFA 5K14B 4DUZJ 3MCSA 2UVUA 4ZLJA 5L1JA 1TUVA 5F1XA 3EKSA 5CCMA 5HVFA 4R0EA 4OX9J 1NK9A 3DI6B 3QO9B 2XQCA 3O08A 3LP1A 2WUSA 4BE1A 3OYKA 2A6OA 2XY6A 3DOLB 4JV5K 3Q89A 1DAXA 3UKRA 3QB0A 4UZCA 4ELUA 5GAEU 1R0CB 4DV5F 1FDAA 4UOGA 4DTOA 2D3O1 1RXOB 1IVZA 4DBQA 2EG2A 2AYEA 1WSHA 4MQ3A 1IKXA 2RRAA 3OVSA 5LJVA 1RBUA 4J90A 5IOLA 4FJMA 5BYRA 2E1YA 1UW4A 4JI6K 1YG0A 3M8ZA 1WSGA 2Y8WA 2MMYA 5BR9A 1HBUA 2AJ0A 1Z2ZA 4FBUA 4ZPWR 3IGNA 3UDEA 1SKWA 2JEJA 2W41A 3D1QA 4U8VA 2HGNA 4H5NA 4CLLA 1FTRA 4IEEA 1WC1A 5LSLA 1KLMA 2Z56B 5HROB 3NOGA 2QA4N 1VQ7S 5ETTA 4LBPA 3LDOA 3AQPA 3ZFVA 4DF4A 2N82B 1YJVA 2R8IA 2P9SB 1SJRA 4NYPA 1Y7PA 1BISA 3EKUA 4P72A 4B3MK 2P9PA 4FXWA 2GVZB 1GTHA 2HAFA 4LF6K 5DRKA 3NP5A 4C8OA 4LRAA 2Y8YA 4DV5J 3J7AN 2YNHA 3CYMA 4FZZA 4KKOB 1K6YA 3IP0A 3BO2A 5ETQA 1NM1A 2M0GB 1Y3JA 4O8UA 2NXUA 2HZVA 3TA1A 3O2IA 4OLOA 1MWQA 4BRGA 1TKZA 4RNOA 3KD1E 4NYZA 3TSQA 4CLYA 4Y1CA 2N4DA 1REVB 2C3OA 1M1KO 2G8IA 4L72B 5LJWA 4EEYA 4ILRA 4CIOA 2BH1A 3WHIA 4IEIA 4WQ5A 4TYBA 2BQ3A 3A2FA 4B3SK 4MTPA 3OJUA 1IXKA 4JBCA 4IO9L 1HBOA 2ZBRA 3AFGA 2C2NA 2AEMA 3CNQP 3C16B 1ZM9A 3AVLA 2BOAA 5AQQA 1CJKA 5E84A 3H4BA 2XHWA 2AJ2A 5KT5A 3A3NB 5DGBA 3HMJG 3O1LA 4FN5A 4M5HA 3B4MA 2COLA 3M9NB 1RT1A 1Q8KA 1BQXA 2DXDA 1CSJA 3BEXA 4ZS6A 2V8PA 3OS0A 3HJFA 4MAKA 1WLJA 4FVCA 2NXCA 5BREA 2HGMA 4NX9A 5G0RA 1A9NB 3M4XA 2H3EB 4C6AA 5DQIA 3KK3B 1FEHA 1MWZA 3LO3A 3KYLA 2HHHF 1F3FA 1UA1A 2Q1LA 4PEOA 4IJAA 3AOCA 2O8DA 3O6WA 1TL7B 2OCEA 1FRMA 4FOEA 4O55A 1U2RA 3J7YU 1DTQB 5B08A 3I0SB 2A1SA 1APSA 1BXNA 3OYHA 1VQ9S 1GLJO 1JMTA 4ZLNA 1IKWA 4BR7A 2HK2A 1E6VB 2YI1A 4CJPA 5GMEA 4W4MA 4I2PB 1S0MA 5CD4H 3O80A 4IG0B 1CZAN 2IAJB 1HW9A 5AXNA 2FD2A 3TTFA 3WQPA 1LOTB 2KZMA 1HHTP 2V8DA 3VGMA 3QBCA 4LR9A 1NMDA 4OV6A 5B0BA 3DXSX 1RDWX 2ETJA 3H25A 3BGUA 3ADAC 2YPYA 3THXB 4U6PA 3EZOA 3AO1A 2CWXA 3VQCA 3D54A 2Z30B 2HHHJ 4H0PA 4LD0A 4CJFA 3LW5C 4JV5F 3RSEA 4RW7B 4C97A 4KHSA 2LVWA 2E2PA 2Z2LA 4K8RA 1Z1ZA 4FXDA 2BXJA 2HQIA 2W42A 1HLUA 3HFVA 4N7TA 1W0HA 4FYVB 2VL1A 3HLUA 2J7WA 4E0DA 1A7GE 4CZIA 3IAM9 3DGVA 1KFSA 1S7IA 2CVIA 2ASLA 2KU7A 1HLWA 1DTTA 5B0CA 2YNFB 2IRUA 2FLOA 3OR2B 4JI6F 2QEXN 3M6VA 3WX4A 3WEEB 1Y00A 1RTIB 3PIPQ 3DOKA 3JS6A 1RWXB 4DI6A 3H7HB 2A42A 4C98A 2ZM6F 3ZSYA 4Q5VA 2Y1IA 4BQLA 2HRYA 5GAHI 2IIHA 2X1GA 3FRYA 3T5JA 4FZXC 2GHWA 2YV0X 3ZX3A 5ETPA 1O6XA 1Q79A 5KFSA 2LDYA 1MSWD 4ECXA 2A5XA 3VA3A 2GHVC 3O4QA 5J2PA 2DR8A 5BPLA 2CJKA 2F4FA 4HTIA 4DX8H 2V4QA 1XN9A 4ZJQA 5GADI 4NMXA 2KG0A 2IPOB 2UV8G 4JV5J 1YZ7A 2XMJA 1W2BR 4B3MF 3KKRA 1HFEL 3BZQA 4RW8A 4FS2A 3SJJA 3N01A 1DQAA 2LEBA 4HHTA 4LF6F