4I2QA

Crystal structure of k103n/y181c mutant of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) analogue
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
total genus 144
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i2qA05
4I9QA 4WZQA 4PA1A 1U4BA 3I5BA 2ZD1A 3TAPA 1Q9YA 3M9MB 4PWDA 4OPJA 4H4MB 2HVIA 4NLTA 4ID1A 2UVRA 1YTAA 4DFPA 3AVJA 4FJLA 3EY1A 5KTQA 1GOAA 1RT4B 4I7FB 3NMAA 4HKQA 3QGHA 5L1JA 3AVCA 3KIOA 1U47A 1HYSB 4E7LA 2W7PA 4CEBA 2BQ3A 1S9EA 3BSCA 4KREA 2IBKA 3V6KA 3QINA 4B9UA 1KHVA 2OYQA 3DOLA 4KO0B 3M8RA 2FBYA 2C2DA 1FKPB 4CF0A 1SV5A 4DMNA 2W9AA 3DRRB 5DG9A 3ZSWA 2C22A 4RW8A 4JV0A 3BSAA 3V4IB 2IM1A 1LWEB 3NAHA 5HRPA 3PO4A 3BDPA 3OYGA 3LWLA 3GIKA 2G8FA 3AVHA 4FZYA 1QUVA 2RKIB 4RNFA 3UDLA 5KFBA 4OVLA 1I3AA 2RDJA 4WYLA 1RTHB 1S9GA 5JUMA 3AVBA 4W5OA 2HHQA 3TABA 1N5YB 4F4ZA 1BIZA 1RDBA 4O3QA 4O5BA 4YR3A 4E89A 1LWCA 4WFYA 1NK9A 4CCHA 1XR6A 1QSLA 4O55A 4ZP7A 5CYMA 1RYRA 4KV8A 3HT3A 3WNHA 2JEJA 4FCYA 2VG6B 2BGGA 1JLAB 1KCFA 1BI4B 3OL7A 5F8MA 1S1UB 3KTQA 5KG2A 5KG6A 1YT3A 3DM2B 2D7SA 1WSFA 1RAJA 1UA1A 3KJVB 5DGBA 4YFUA 1U48A 1KLNA 4O44A 5T14A 5CY4A 1REVA 2OPRB 4J9SA 1D8YA 2RDIA 3RMCA 2YNFA 3Q8PB 1EP4A 4K4ZA 1ZTWA 1X1PA 5EWEA 4LH4A 1S1TA 3KD5E 1HPZA 5C42A 1C0UB 4LSNA 3HKWA 2DTUA 4ECXA 1LW0A 2IC3A 2VWJA 4M45A 4EBDA 2WB4A 4FLWA 1ZBIA 2WOMB 4O4GA 4TYAA 1HYZA 1S97A 4KAIA 2ILYA 3S9HA 2C2RA 1TKTA 1XC9A 4IFVA 3SYZA 2HNDA 4E7KA 2IJFA 3G0ZA 1N6QB 3DLRA 3V9ZA 4LY7A 1RT5A 4OKEA 2ZKUA 3ZSVA 5I42B 2XO7A 4NLWA 2R2TA 3TAMB 1ASWA 5F8IA 4FBUA 1S0NA 3VQQA 1VSJA 3GIJA 1WN7A 4IKAA 4XPCA 3MEEA 1KFSA 4JRPA 3JSMA 3ZT2A 4DU4A 1IKWB 3AVGA 4FJGA 4JS5A 2V9WA 3VQ8A 4I2PA 1SUQB 3V6DB 2YNIB 3LALA 1TAUA 1T94A 4DF4A 3SV4A 3D0PA 2OPSA 3TARA 4CHOA 3G6XA 2FLPA 3L2RA 2VG7A 1SKSA 2BRLA 3Q8RB 4Q44A 2OZSA 1RBUA 2V0NA 3GIIA 5F8JA 3BQ0A 3PJXA 1NHVA 5KT2A 3NGZA 4ZPDA 3RB6A 3B6PA 3MR6A 2F8TA 2Z1IA 2W42A 3MECB 4OGEA 4ZVHA 4FLXA 3KLHB 4G3IA 3HL8A 1SL1A 4K4TA 3VQ4A 3ALYA 3QIPA 4B9VA 1DLOB 3FDSA 4GC6A 1TL3B 3H4DA 3OYCA 1IM4A 4QCLA 5SWMA 4O3PA 2HMIA 5KFIA 3HYFA 4NYNA 3M8QB 1U04A 1LAWA 1DTQA 3T5HA 2HNZB 2JEFA 3HPGA 4N5SA 4FLUA 3P1GA 4F2SA 5KFMA 2F96A 3LP1B 5HP1A 4IRCA 4CGFA 4CJVA 4J9OA 5KT6A 1SL0A 1L3UA 1LWFA 2KFZA 2V4RA 4E7IA 4CJFA 5J2MB 5FRNA 3QIDA 1IKVB 4B08A 3OS1A 3JYTA 3DYAB 4FXDA 3DRPA 4H4OA 3I5CA 4H8KA 4IG3A 4J9PA 4HVJA 4Z4IA 2VA3A 5D3GA 4DSIA 5KFGA 3AO3A 3LANA 3C94A 5L9XA 2HHXA 4EO6A 2OPQB 1UWBA 1KLMA 3SI6A 4Q8FA 4DFJA 2YNHB 3AVMA 2R8IA 1EXQA 1F21A 1N4LA 5HLFA 3DMJA 3ISNC 2W9BB 2DFEA 3HM9A 4L8RB 2X78A 5KI6A 4TSXA 5FROA 3MEGB 4WE1A 1JKHA 4FJIA 4E0DA 2HHWA 5KT3A 1ZBHA 1NJZA 2IJNA 1SKRA 3F9KA 4DL3A 5HROB 3C95A 4LD0A 1C0TA 4CFAA 1WLJA 4E7JA 4WYWA 1VSDA 1NK6A 4Z4EA 1NJXA 2E4LA 4BDPA 2C2EA 2FC0A 2YKMA 4ELUA 1JXLA 3IG1B 3A2FA 1RT7B 3BGRA 3KK3B 3KK2A 4K50A 4C8OA 1JLBA 3NBPB 4RW6A 2JLEA 2IOCA 4HUFA 4KI6A 3UPFA 1TV6B 5F8LA 4JLHA 5HRNA 4W5NA 4WFXA 1RT2A 1TL1A 4RW9B 4Q43A 1TVRA 1RT6B 2R8KA 2PYJA 1DTTA 4ZTFA 3H98A 2IA6A 5L1IA 2D0BA 1QSYA 3NKYA 1GOBA 5CZ2A 5KRTA 4CHQA 3NAEA 1NHUA 4LQ3A 3BREA 3MXIA 4FZXC 3N6MA 2G8KA 4AHUA 4CGHA 1J53A 1QSSA 4TYBA 3AA5X 4KHYA 3V9WA 4LSLB 2WCXA 4F50A 2FVPA 4MK8A 3SQ2A 3U6FA 2FLNA 3MAQA 4GC7A 5C25B 1VRUB 1RTIA 4CK1A 4DLEA 4DQIA 2VG5A 4EZ9A 3NF9A 2HWHA 3CFRA 3KLIA 3CJ4A 1C0MA 1U09A 4TXSA 2R8JA 4NCBA 3HJFA 3ZT1A 3CJ3A 3D28A 2BANA 3CFOA 3DRSA 4K4VA 1FXXA 5KFHA 4QW9A 3HPOA 1JLCA 3C6TB 3HK2A 1JLGA 4NLPA 4AH9A 3BQ2A 2KFNA 4B8AB 2G8VA 1S0OA 2R2UA 2OA8A 5KG5A 3KLEB 2J6TA 5C5JA 3SCXA 3PY8A 3O3GA 1S6QA 4Y2AA 1XHZA 3DI6B 4HHTA 1QE1A 3AA2A 3GILA 1VSFA 3CQ8A 3PX6A 5KT5A 4F3OA 1NKCA 4Z4FA 4PQUA 3OY9A 3LPTA 1R0AB 1HNIB 1RT1A 3KHRA 3DLKA 3VQ7A 1K1QA 4Q0BB 4ZTJA 3OL6A 4B9MA 3ZT4A 4KRFA 1Z4UA 3OYEA 4BE2A 3PW2A 5L1LA 3L2UA 4NYZA 4B8CA 4ZHRB 5J2NB 5T7BA 4N76A 2XY5A 1RTJA 1C1BB 4URGA 4ED3A 3IGNA 4IBNA 2UVUA 4IDKB 2HVHA 1U49A 4IG0B 4M94A 4ICLA 3WNGA 4AHTA 4M95A 1A5XA 2IAJA 5I3UB 4NLSA 4RW7B 1RT3A 4CJWA 4KB1A 2HHUA 4KHWA 1B92A 3SI8A 4EYIB 4G1QB 2O4IA 3KLGA 5KT7A 4NRUA 5FDLA 2FJVA 2FBXA 4RUCA 5CYQA 2HW3A 3DOKB 3LP0A 1YVUA 4FJXA 3EZUA 1TKDA 1RBRA 2GIQA 3D45A 2PY5A 4KB0A 3RMAA 3LP2B 3VA0A 2ZE2A 3H4BA 3MXJA 4K4SA 4OJRA 2XI3A 4R8UA 1RBTA 3TR8A 4DS4A 4DQRA 4B3OB 5HRRA 3E01B 4GMJB 4CK3A 1XHXA 4ED6A 3MR3A 3AA4A 4IQXA 4DTJA 3V1QA 2YKNA 4HYKA 4DG1A 3OYBA 3G86A 3V81A 4AHSA 3RTVA 4Y1DA 3HP9A 1BCMA 4Q5VA 3QEIA 1ZETA 3DLGA 1J5OA 1KTQA 3FSIA 3TQ1A 4EBCA 4DEZA 4LH5A 4KHRA 4ZVEA 3EYZA 3PR4A 2X6SA 4AHRA 4KFBB 2W9CB 1S1VA 2BR0A 3S3NA 1HMVA 3I0SB 3DLHA 4DL5A 1I39A 4OGCA 3PW5A 1WSIA 1VSHA 2P5GA 3L3VA 1SL2A 2B6AB 4ECWA 4DQSA 3KOAA 3B6OA 5DLFA 1S4FA 1TKXB 2BQUA 2AX1A 4YP3A 2D0CA 4Q8EA 1JXEA 5DG8A 4MKAA 2XY8A 3MFIA 4RNNA 2ASDA 1TP7A 3HO1A 1T03A 5DGAA 3QNNA 4DTUA 2G8WA 4IH6A 5J1EB 2YHBA 3OYFA 3ZT0A 5KFJA 2LSNA 3GYNA 3VQPA 1OS5A 3VA3A 3FRZA 4CEAA 4EP4A 1JL1A 2HHSA 4WZMA 3OS2A 1EETA 3CDEA 5C24A 1VRTB 1WSGA 4O4RA 4J9RA 3H08A 1JLFA 4CFCA 5DLGA 1CLQA 4NLVA 3QZ7A 1Z25A 2X74A 3V6JA 2BRKA 2FBTA 4FVMA 2WONB 3PO5A 3IS9A 1WAFA 4OKJA 4O0IA 2AU0A 1HNVA 3DLEA 2UUWA 4Y1CA 3SPZA 4FJJA 1S5JA 3FFIB 5K14B 1HQEA 3CWJA 3PV8A 2WRMA 1VK0A 1NOYA 4DSJA 4DLGA 2QV6A 4J9KA 3C6UB 3O3FA 1RDRA 3KK1B 3ITHA 3SJJA 1IKYA 1LW2A 2CJQA 1JLQA 3KLFB 1BCOA 5EDWA 3HVTA 4DWIA 3I8DA 3OSNA 3NAIA 2E9ZA 4DFKA 1MU2B 2J6UA 4Z4CA 4CGIA 4M42A 1GX5A 2IMWP 4KTZA 5HBMB 1NNDA 3IAYA 3QGGA 5JS2A 3NF8A 1BQMB 3MFHA 4ECSA 3M8PA 4C8MA 3L2QA 5KFPA 1FK9A 4R0EA 1JIHA 4DQPA 2JGUA 4DU1A 2B5JA 5KFFA 4NLGA 3CYMA 3G10A 2HHTA 3K58A 4E3SA 4YR0A 3HSTB 2RF2B 3HHKA 2XGQA 4MFBB 1S10A 3PX4A 3LPUA 1RTDA 1S6PB 4MIBA 3LZIA 4OL8A 5KG0A 3NGYA 2I5JA 2BE2B 1NJYA 1ASUA 5F9LA 4TY8B 3Q8QB 3QEPA 2R7YA 4JV2A 2DPIA 1RNHA 3L2VA 1FKOB 4PUOB 2GBZA 5J2QB 3P5JA 4CJKA 2GIRA 2ASLA 1C2PA 4RW4B 1RTIB 3H59A 3OJUA 4X2BA 2G8UA 3I0RB 4H4MA 4QWAA 2V4QA 2X6NA 1QHTA 3AV9A 1KRPA 2UVWA 3ULDA 4FYDA 1I6JA 4K4WA 4DTOA 1RT4A 4I7FA 2A1RA 4HUGA 1U45A 3DDKA 1HYSA 4KPYA 3SUQA 4ZPBA 3ZSXA 3T5KA 4ID5B 2JEGA 3NDKA 3CDWA 3OLBA 2QE5A 4CEEA 2AX0A 4CJUA 4ED7A 4NCGB 1S1WB 3MXMA 4KO0A 3RMBA 1FKPA 3DRRA 3QIOA 1N56A 4NRTA 4FJ5A 3VQBA 4CESA 4ZMMA 3RBDA 1D9FA 1KSPA 1S9FA 3V4IA 1C1CB 3ASMA 5DQHA 2F8SA 1TKZB 3KMSA 1LWEA 3IRXB 5KT4A 2QK9A 5HRSA 4QWBA 4ECUA 4FM0A 4QW8A 3VQ9A 1S1XB 2ASJA 1KVCA 3SQ4A 2RKIA 3SV3A 4OLBA 1KFDA 1D1UA 1RTHA 4CGDA 4DTSA 3F73A 3QETA 4OPKA 4FJ7A 2W7OA 5E41A 4E19A 1N5YA 1BISA 3TWHA 4J2EA 3WNEA 4CJ3A 4EBEA 3TVKA 4J9MA 4XIUA 2JC1A 4ZP9A 2GUIA 1BGXT 1XR7A 3CJ2A 2KZMA 2VG6A 2KQ2A 3OVNA 1JLAA 4NLRA 3MR2A 2AGOA 1BI4A 2BDPA 3BJYA 3SPYA 4M3WA 5KFRA 4CF8A 2XWYA 4DQQA 1HQUB 1S1UA 2FVSA 4N56A 4DL6A 3QO9B 3HVRA 3LDSA 3DM2A 4AHVA 3QLHB 1B9DA 5KG1A 2YNGB 3L3UA 4NCAA 3KJVA 1RA6A 1IKXB 3E51A 4QAGA 1NK0A 4CJTA 2OPRA 4RG8A 3P83D 4DFMA 4YR2A 2UUTA 4IFYB 3AO5A 5KFNA 4M3ZA 4ED0A 3H5XA 2EHGA 1T8EA 4BDZA 3MEDB 1EKEA 1NJWA 3T5LA 1ITGA 3KLGB 3OYIA 4K4YA 4Y3CA 4I2QB 1C0UA 4R5PB 2FJXA 2EC0A 4FLZA 1SH0A 2VWKA 2AJQA 2XCPA 1TQLA 4EEYA 3U3YA 2WOMA 2HNYB 1QS4A 1UAXA 4CEZA 4CF2A 4CFDA 2FVRA 4CHYA 4ZPCA 3SQ0A 4DTPA 3SUPA 3AVLA 4KHSA 4QOZB 2B4JA 1N6QA 2CKWA 3G6YA 2PZSA 1BQNB 3HVWA 2OPPB 4BE0A 4DTNA 4B9TA 1T05B 5J2PB 5I42A 2HWIA 2HB5A 3TAMA 1RA7A 3WNFA 3HXMA 5F8GA 4DTXA 3AVIA 2Y1JA 2ZD1B 4NYFA 2ATLA 1IKWA 4PWDB 4NLUA 1RCHA 1K6YA 2DFFA 2WTFA 2Z1JA 3NHGA 1SUQA 3V6DA 4FS1A 4DF8A 2YNIA 3V9SA 4M3TA 1T3NA 4J9NA 1S9EB 3AVKA 1B9FA 1LAVA 2P1JA 3QERA 1K1SA 5KG7A 1HMVB 2R8GA 3DOLB 4TLRA 4CERA 4NLYA 2IGIA 3OHBA 4CK2A 1SV5B 2HHVA 3L8BA 1UOCA 4RW8B 5KFDA 3RRHA 3VQEA 3OS0A 3CVKA 2JEIA 1NK8A 4FK2A 3MECA 5KFLA 3RB4A 3M8SA 4O3RA 2R2RA 4TY9A 3HPHA 3KLHA 3V1RA 4BDYA 1DLOA 3RR8A 1TL3A 1S9GB 4RUAA 4RNMA 4HCBA 1G15A 3ZSYA 4FLVA 5KFTA 4KHUA 2I1RA 1LWCB 3M8QA 3H2LA 3PJWA 2HNZA 4CJEA 3MF5A 4BACA 5CYMB 3NGIA 4J2DA 4KV8B 3LP1A 2XC9A 5EU7A 4M3UA 4N47A 1JL2A 4O3NA 4M3XA 2DPJA 1IKVA 1L3TA 1UA0A 4CJSA 3OYKA 3DYAA 1BHLA 5JS1A 3RMDA 4Z4HA 4RU9A 3THVA 1WSEA 4KSEB 3RR7A 3ZSOA 2RPIA 4CGJA 3TAQA 4IH7A 4CJLA 3M9OB 4DSKA 2OPQA 4O0JA 2G8IA 2YNHA 4O44B 5KG4A 4FJKA 3ZCMA 1RILA 1NK5A 1REVB 4ZPAA 2YNFB 3OYNA 1EP4B 2W9BA 1VSEA 1ZBFA 4KKOA 3KLVA 3SFGA 2DY4A 1KVBA 3MEGA 1SH2A 1S1TB 1HPZB 5C42B 3K5MA 4LSNB 4ZVGA 1LW0B 3HVTB 2IC3B 1RBVA 3TAFA 5FRMA 2DFHA 4LQ9A 4GVMA 4O4GB 5HROA 4XPEA 1L3VA 4JS4A 4JRQA 4ED2A 1XI1A 1TKTB 2AWZA 2XCAA 4IFVB 2ITGA 1D0EA 1BL3A 2HNDB 4F4XA 4KI4A 5KFKA 4EP5A 4RNOA 4Y2CA 1RT5B 4FJ9A 4NLQA 4NZ0A 3OYMA 3OL8A 4Q45A 1RT7A 4W5RA 3K57A 3KK3A 3N6NA 1JXBA 5CZ1A 3NBPA 4QWDA 3S3OA 1TV6A 3AO4A 3MEEB 3KKSA 3JSMB 4RW9A 4QWEA 1RT6A 3VQ5A 2FVCA 4CFBA 4M3YA 4I2PB 3TANA 5DQGA 1ASVA 3CM5A 4FJMA 2JC0A 4KBIA 4F3TA 2GV9A 3ZSZA 4CJ5A 4XO0A 4LSLA 3ZSRA 4CJPA 1D9DA 2OPSB 1QAIA 4EO8A 4IR9A 3GIMA 2VG7B 3EPIA 4IOBA 2A1SA 5C25A 4M3RA 1VRUA 4ED8A 5KFEA 3TAEA 5KFXA 3EPGA 2Z1GA 4UQGA 3BSOA 3T3FA 4F4YA 2ZQBA 3M9NB 4ZP8A 3GV5B 1ZTTA 1EX4A 3NF6A 2D5RA 1Q9XA 4MQ3A 4CEOA 1YTUA 2FJWA 1WAJA 4O3SA 3AO2A 3CO9A 2O5DA 3QIPB 3C6TA 4IRKA 1SH3A 5L1KA 3V1OA 4CECA 1ZYQA 1L5UA 2HMIB 4CJ4A 4AHCA 4K4UA 2XGPA 1S0MA 4YMEA 1DTQB 4ZVFA 4FS2A 2XRIA 3CDUA 3KLEA 4E1MA 1X9MA 5HP1B 3SZ2A 3LAMA 3KHHA 3TI0A 1IH7A 1LWFB 3DI6A 4NLXA 3CFPA 5DK5A 4MK9A 4IRDA 3JYTB 1IG9A 2OZMA 2D41A 3DRPB 4H4OB 4IG3B 4K8ZA 4CHNA 1N48A 5D3GB 4IH5A 3KMQA 4JUZA 1R0AA 1HNIA 1YVFA 2VA2A 1VSIA 4Q0BA 4OLAA 1UWBB 1LV5A 1KLMB 1QQCA 4CE9A 1NK7A 3AVFA 4CIGA 2E9TA 3I5AA 1J54A 4BE1A 1Q8IA 5HLFB 2D3ZA 3KHLA 3DMJB 4J9QA 4ZHRA 5J2NA 3KKRA 4KHNA 3PX0A 3VN5A 1KVAA 1JLEA 3BSNA 1C1BA 1C1AA 4WE1B 2ATQA 1JKHB 2J6SA 4DU3A 5DQIA 1W0HA 3NF7A 3MR5A 4CEQA 4IDKA 2UVVA 2R8HA 4FLYA 4EZ6A 3TAGA 1C0TB 3RAQA 4DS5A 4IG0A 4CGGA 1WNEA 4DL4A 5I3UA 4RW7A 3K5NA 2YKMB 4RZRA 2YHAA 2KTQA 4G1QA 3O4QA 4DSLA 4TN2A 1HJRA 3BGRB 3KK2B 4MIAA 4B9SA 2P51A 1JLBB 3DOKA 4RW6B 3UR0A 3OYLA 3ZT3A 1CXUA 3GQCA 1RDAA 3Q8SB 1Y97A 3QEVA 1RT2B 1TL1B 2IM2A 3V9UA 2QKBA 1TVRB 1DTTB 2IDOA 3QEWA 3LP2A 2P5OA 1TGOA 5KFOA 3RB3A 4C8LA 2W8KA 3FQLA 4EYHB 3KNAA 1GOCA 4W5TA 4B3OA 3KD1E 3E01A 5EUHA 2QKKA 1W9HA 3T19A 3PW7A 4FM1A 1CSJA 4J2BA 4KAZA 2VG5B 3K5OA 2WK4A 4ED1A 5KFCA 4FW1A 2QXFA 3NL0A 2Y1IA 3KLIB 3AVAA 1X9SA 4TQSA 5KFAA 3T5JA 3AO1A 4N41A 3AVNA 4FW2A 2BANB 3SFUA 1BIUA 3PVXA 3DRSB 1S48A 4KFBA 2W9CA 3QZ8A 4CEFA 3HP6A 1JLCB 3I0SA 2ETJA 3OYDA 1JLGB 1KHWA 2IM3A 2E6MA 4PY5A 2B6AA 1D5AA 1C6VA 1TKXA 4FLTA 3NH1A 5DMRA 4Y34A 3SUNA 5KFVA 4F4WA 5EWGA 3RAXA 1W25A 4I9LA 2HAIA 5KFZA 1S6QB 4ECVA 2Z1HA 5J1EA 4E7HA 3ICLA 3HVAA 4ECQA 2AGPA 4FM2A 1QE1B 2E9RX 3H5UA 4JV1A 4PQUB 3PUFA 2KW4A 1VRTA 4MK7A 4FJ8A 2OH2A 1RT1B 5KFUA 4HTUA 2E6LA 3DLKB 2XHBA 2EX3A 3G6VA 4ELVA 4GW6A 3PW4A 3O4NA 4F8RA 4E1NA 3RRGA 2FLLA 1ZBUA 3PR5B 3V9XA 3NFAA 4CF1A 2WONA 2RN2A 4FBTA 1RTJB 4DTRA 4DL7A 4ECRA 4CIEA 3QNOA 3ISND 2C28A 4J2AA 4NLDA 2IM0A 3FFIA 5K14A 4J9LA 2NUBA 1WSHA 3QGIA 3NH2A 1CZBA 4FK4A 4C8KA 2IS3A 4ICLB 4URQU 4CJRA 2IAJB 4KKOB 4FK0A 2D3UA 1RT3B 4AILC 3C6UA 4FJHA 3KK1A 3KHGA 2AGQA 1JX4A 5FDLB 3KLFA 4KE5A 4CEDA 4F4KA 3CG7A 1T7PA 2ILZA 3PZPA 1VSKA 5CYQB 1TAQA 2AQ4A 3LP0B 4KB7A 3DLBA 1MU2A 3PW0A 3NH0A 3OYHA 5HBMA 3T1AA 1NK4A 3S3MA 1BQMA 4CHZA 1NKBA 5KFWA 3OJSA 3SNNA 2ZE2B 1S49A 4KTWA 5JXSA 4R8UB 1TK5A 1TK0A 1HRHA 3IN5A 3UQSA 4ECYA 3V6HA 2XI2A 4O3OA 1GX6A 1CZ9A 3RB0A 2R2SA 4CIFA 2RF2A 2YKNB 3EZ5A 1XR5A 4DG1B 3L2WA 5F8HA 1X9WA 4MFBA 1SKWA 4WXWA 3V81B 4WFZA 1S6PA 2G8HA 4BWMA 3VQSA 1NKEA 4BWJA 2BE2A 3DLGB 1J5OB 4TY8A 3OYAA 4FJNA 5KFQA 1FKOA 4PUOA 1QAJA 5J2QA 3LAKA 3QYYA 4MKBA 1S1VB 4RW4A 2W8LA 2GC8A 1HYVA 3I0RA 1QTMA 4U7CA 3ZSQA 5F9NA 1A5VA 1XWLA 2B43A 3IGVA 2F8EX 2ALZA 2D0AA 3MTKA 3H5SA 3K59A 1T03B 4ID5A 3OHAA 3H5YA 4M41A 4NCGA 1S1WA 1RYSA 3VQAA 3BQ1A 4IKFA 1EETB 4QWCA 5C24B 2Q3SA 2XY6A 4WXOA 4B9NA 1C1CA 1TKZA 3K5LA 1RDCA 3IRXA 1A5WA 2O4GA 4DTMA 1JLFB 5KGWA 1S1XA 4DSEA 4C8NA 4DL2A 3O3HA 1RDDA 4FZZA 1HARA 1RBSA 3OLAA 4ECTA 3OSPA 1VSLA 5EWFA 5J2MA 4Z4GA 3LWMA 1WSJA 1MMLA 4W5QA 3IS9B 4KTQA 3PHEA 3NE6A 3UIQA 1HNVB 3DLEB 5KG3A 4ZP6A 3NGDA 4F2RA 2KZZA 4U6PA 3FQKA 4QPXA 4TQRA 4URSA 3OYJA 3LP3A 5SZTA 4KHMA 1WNSA 2YV0X 1ZBLA 1HQEB 5KFSA 1IO2A 1O1WA 2FVQA 4CJQA 4K8XA 3RBEA 4HUEA 3VQDA 4Z0UA 1L3SA 3CIZA 3OL9A 4MH8A 1HQUA 1JLEB 3CM6A 3ITHB 3QO9A 1VSMA 3VQ6A 1IKYB 1LW2B 1JLQB 3QLHA 4HCCA 3U3GA 2YNGA 3CJ0A 4ECZA 4CF9A 3SUOA 5KGXA 1IKXA 4CHPA 2FBVA 4YNQA 3QEXA 3N6LA 3RWUA 4IFYA 4K4XA 4DSFA 4OKKA 1TK8A 3K2PA 4KHQA 3MEDA 3NCIA 3M8PB 4B9LA 4ELTA 1FK9B 3QESA 2BQRA 2B5JB 4I2QA 3H40A 4NLOA 4R5PA 5KFYA 2WHOA 3IG1A 1Z26A 2PYLA 5DG7A 4YQWA 2HNYA 5KRSA 1J9AA 4RNHA 3SQ1A 3CJ5A 3BR9A 3AA3A 2XY7A 4H54A 1RTDB 3VQCA 3GV8B 1BQNA 5F8NA 2I5JB 2OPPA 3D5MA 4IR1A 1NOZA 3LZJA 1T05A 5J2PA 1CXQA 3GV7B
chains in the Genus database with same CATH superfamily
4WZQA 2HQGA 1DGKN 5AQGA 3OFFA 1U4BA 5BN9A 1B0TA 2GVZA 1N5VA 4FWNA 3DXKB 3HT0A 3CHWA 4OPJA 4H4MB 1FDBA 2IIRA 3GJRB 4NLTA 1YTAA 4OYAA 4DFPA 3TJ9A 2PFFB 1GOAA 1RT4B 2CPYA 4ZIWA 3GYXB 4E7LA 2VJVA 2DHSA 3IA0A 2BQ3A 1S9EA 5DZ7A 2DY9A 2G9OA 2DXFA 4K0KF 3G71N 5ETPA 4KH4A 1GLDG 3M8RA 4TLQA 2C2MB 2O1PA 3I55N 4AD6A 1VQMS 3DRRB 3FK4A 3AH6A 2C22A 4JV0A 3FZLA 3Q22A 1Y64A 3OHRA 5D77A 3KG1A 4J90A 5HRPA 3NAHA 2UZAA 3PO4A 2CWXA 5IC6B 4EHUA 2B9XA 5BYSA 2Q1NA 2G8FA 2DB1A 1QUVA 2HPUA 2DNKA 1W97L 1BMQB 3GE1A 1S9GA 2YQ3A 2P9NB 4ZK7M 4O5BA 3KNGA 5KAKA 4LF5K 3IAS9 2EBGA 2CAJA 2MPUA 3WNHA 4HACA 3D67A 3PRVA 2JEJA 4FCYA 5MLCV 2BGGA 1KCFA 3HD1A 1V9OA 2WUSA 1GFWB 2AA4A 5E3PA 3PSFA 3VAMA 4WFBQ 3AAQA 1A7GE 3UD5A 3KTQA 5I3QA 4DXLA 5KG6A 1YT3A 5AXMA 3KYLA 2D7SA 3R6GB 2F8MA 3H46O 2KM8C 1U48A 1R0BG 2KHCA 5CY4A 1WKLA 2EK6A 1Y5IB 3SAHA 2IHR1 3FZBA 2HHPA 1BWEA 2OPRB 4P2SA 2RDIA 3RMCA 2YNFA 3M6VA 5D0EA 2QLJB 1VHIA 1ZTWA 4NZ6A 2VDIA 3MUMP 1XMOJ 3KD5E 1Q5YA 1NLVA 3SSRA 2DTUA 4DOZA 2WB4A 1ZBIA 1S72S 2WOMB 3HOSA 1RK8A 1S4EA 3L95X 3WQUA 3PKMA 1KQFB 3DLRA 3V9ZA 1RT5A 2F40A 2ZKUA 3ZSVA 5I42B 2XO7A 2YWWA 1T9XA 3S41A 4KHPJ 5F8IA 4FBUA 4ZN3A 1U1RA 1AZSB 4LF5F 1VSJA 4CT8A 1WN7A 4XPCA 3AOCA 4JRPA 5A8KB 2HGMA 2YCHA 2W7AA 2WSEC 5JVGQ 1JQGA 1VQ8N 2E29A 2QM1A 4PRFA 3V6DB 3QNWB 2YNIB 3LALA 1HI0P 1U0SA 2OPSA 4DV6K 2FHJD 1SC3B 4TU9A 4L74A 1OY9A 1M1KT 2IYGA 2BRLA 4L75A 2NZCA 2X3DA 2V0NA 2SXLA 1U1OA 5F8JA 3BQ0A 4BHQA 4A5AA 2NXEA 5KT2A 3NGZA 5ETSA 3RB6A 4ZVHA 1X9JA 3HL8A 3PYDA 1QTNB 2ZHOA 2EFNA 1DLOB 2O8BA 1IM4A 4FOIA 3BN4A 4ED4A 2PO4A 1X4DA 1UWAA 3C8YA 3M8QB 1LAWA 1DTQA 2H3EB 4N5SA 4FLUA 3P1GA 4F2SA 4JI7J 2K1RB 5HP1A 2OCEA 1HWLA 2O8FB 3AXMA 4LF4J 3WZ0A 3KG0A 4E7IA 4IWVA 4CJFA 2ZOMA 3SCLE 3QIDA 1IKVB 3DYAB 3FBEA 4DV0K 3NS7B 3I5CA 3T9NA 2VA3A 1Q82O 1FRIA 4DSIA 1XNRJ 1VLOA 5RUBA 3MAHA 3AO3A 2IVFB 3EDRB 3CJ9A 4FYWB 4PR6A 2AJ1A 4EO6A 3SI6A 1ZOTA 3SBMA 5FLXU 2HIQA 4DFJA 3AVMA 4PYAA 1WWHA 2CNLB 1N4LA 3FCHA 3DMJA 4DV6F 2DFEA 4L8RB 2IBOA 3MEGB 2KYZA 3O1WA 4QYRA 3CQXA 1Q86T 4E0DA 2HHWA 4OJ1A 1ZBHA 3BY5A 3CCZA 1NJZA 1B7FA 3M8WA 1RWNB 4CT9A 3F9KA 3FSYA 4H4KA 2PFDA 4DL3A 4YB6A 1RUSA 1WLJA 2BTFA 5K8MA 1NJXA 5FLXY 3MPVA 4BRIA 3L7PA 3I4HX 3OW2M 4X4OA 2YKMA 4NA3A 1P8GA 1NH8A 2LXIA 3OW2R 3BGRA 3KK3B 4K50A 2GAGC 4C8OA 3NBPB 5CCLA 2IOCA 4HUFA 3UPFA 3RSEA 1RT2A 3D2EB 3THPA 4ZTFA 5E3CA 4ZLJA 4I4BA 2IA6A 3W63A 1MROA 3G25A 1T44A 3NKYA 5CZ2A 4CHQA 3GP9A 4LQ3A 3P4IA 1DRZA 4PL7A 1J53A 4TYBA 3V9WA 1F9HA 7AT1B 4MK8A 3SQ2A 2HYIB 1I3OB 3CTRA 4B1VA 4GC7A 5C25B 3MWTA 3ZTOA 2DNMA 5HVHA 4OHZA 4CK1A 2PFUA 4EZ9A 4ANCA 3FEYB 3AQPA 2P9KB 1FA0A 1NRKA 3SK3A 3L4QA 3KLIA 3KJQB 4LBHA 2HQDA 3MD1A 5E2QA 4OIXA 4IYQA 4NCBA 3ZT1A 4BR7A 3MHYA 1NGGA 3D28A 2ZH6A 3SQGB 3DRSA 4K4VA 2P8IA 4CLZA 1FXXA 3HPOA 1Q7YT 1JLCA 4RO0A 4JYAJ 3CNQP 4NLPA 3TRGA 5D4OA 3OFGA 1SJ4P 5E3AA 2G8VA 1SJRA 3LW5C 3KDNA 2R2UA 5KG5A 2DIUA 3KLEB 2NZTA 5C5JA 3KWGA 3SCXA 3H2VE 1S57A 4Y2AA 4FP9A 3GG0A 4QS9A 1VSFA 3CQ8A 4DV4K 4MDBA 3TYTA 3NEKA 2KXFA 3W2WB 4PQUA 2R3VA 5IV4A 3CCJN 1IBLJ 1XMQF 3LPTA 4GV9A 1R0AB 1R8HA 5LL6Z 2ZGZA 4P71A 1UPPA 3SMPA 4ZLLA 4NYZA 5FD1A 5T7BA 2XY5A 1RTJA 1GMVA 4C3KA 1C1BB 4CBUA 4X62J 2MKHA 2BW7A 1AFJA 3CETA 2UVUA 2HVHA 1O0PA 1WORA 3BO2A 1B0VA 4P52A 5CD4H 4WK1A 3WNGA 4ICLA 4M95A 2IAJA 1OJ4A 5I3UB 1FTRA 3C14B 4QPTA 4JI4J 2HHUA 1HA1A 1B92A 4CM0A 4EYIB 2XEXA 3CMAS 5LMUJ 2FD2A 5CHCB 1KC8T 2FJVA 1YIJN 2O8CB 1U7LA 2FBXA 1Q8KA 2IY5B 3DOKB 3FZ2A 1GT8A 3ZZYA 3EZUA 1RBRA 1Q53A 1JCFA 1VBKA 4IZ9A 3NNCA 3CT9A 1K73T 3QRQA 3H4BA 4DV4F 4OJRA 5A8RB 1VJWA 2XI3A 1PILA 2CGJA 3GCWP 4DS4A 3E01B 4LR8A 5C0YA 2K06A 1HNZK 4Y2KA 4P9SA 3CCEN 2D1KA 1Q16B 2JJ4D 2ZUAA 4AHSA 4Y1DA 2NSCA 3AT1B 3M30B 1KQSR 4EWTA 1EKSA 3DLGA 5AQXA 1KTQA 2HFNA 4OI1A 5AJ3J 2MQOA 2P2CB 4EBCA 1T9WA 3CJ1A 1ZBSA 4KHRA 4ZVEA 4B9QA 1PJ6A 3TEGA 4KFBB 4DUYF 2W9CB 5AZIA 1MWKA 1GK8A 1X4AA 3A1YG 2W4CA 3W60A 3DLHA 1RP5A 1I39A 3ENAA 3QBXA 1WSIA 2DEIA 1SL2A 4DQSA 4BRAA 5DLFA 5IQQA 2FLOA 4KHPK 3L7UA 2ASDA 1TP7A 3CERA 3QNNA 4FWKA 1NB2A 3ZEUB 1OS5A 3FRZA 3Q2SC 4F0MA 2DBBA 4DR6K 1JL1A 4NEZA 3UVJA 3I87A 1CJVA 1YBTA 2KO1A 4CO5A 1EETA 3KFWX 1VRTB 4WK3A 4G1PA 4M5KA 4O4RA 4M7XA 1HBNA 4KGVB 5IWAJ 5DLGA 3BDEA 1XERA 2MY8A 4IXCA 2BRKA 2WONB 4MO4A 4OKJA 4HTIA 1WEZA 4AXIA 5C2GA 1HNZF 3ONQA 1IQTA 3D2WA 2QX0A 4FJJA 4J9VA 5JJBA 2I7PA 4DR7F 1HQEA 2ZBCA 3D0IE 4DV7J 1VK0A 3SEOA 5CAAA 3EE9A 4AF1A 2YXLA 3F41A 2QV6A 1OSCA 2RE2A 4M5NA 2AYMA 2AF6A 3EGZA 1VQLN 4C3LA 1VHXA 4Z4CA 1U8SA 2AP6A 2HRUA 4KTZA 2C2NA 2XYHB 3TUPA 4PKGA 3QGGA 3VALA 2QWMA 2GQQA 3CCWA 1OVYA 3THYA 1FK9A 2N3LA 1B3TA 5F0UA 1JIHA 1WI8A 1RBLA 4DR6F 1H2VZ 3TOQA 4X65F 2B8PA 3BZCA 4FNIA 4KH1B 3ILJA 4ATNA 4YR0A 3DLLL 1P6TA 4MFBB 4LF7J 3LPUA 3QB0A 3HHEA 3NGYA 1YZ6A 4XEIA 1RE1B 4K7QA 2MEWA 1FKOB 4BGBA 3A8IA 2GIRA 2ASLA 3MCAB 2E7VA 1RTIB 2P9LA 2V4QA 2QL9B 1KRPA 4OYWA 3PCOB 4NOHA 1I6JA 5HN0A 4DTOA 2A2DA 2H51B 2J9DE 1N33J 4I7FA 2AKWB 2AZ1A 3AD8C 4HUGA 1FKAF 3DDKA 2LMIA 3SUQA 4ID5B 2PE8A 1QQOA 3NRBA 3PM9A 3PRBA 4NCGB 4KO0A 3BO4A 1FKPA 1NG9A 3ZZRA 4NRTA 4RR5A 2RQ4A 2B9YA 2P9PB 1NMNA 3U8XA 3VVTA 1S9FA 5DQHA 4RCHA 4Z2XA 4JI0K 1LWEA 3IRXB 4ID8A 3D1QA 1NGDA 3VV2B 4J5OA 2MGZB 3SQ4A 1NM2A 3Q2TC 4N8OA 4HLBA 1RTHA 3CC7S 2VFUA 4IO9L 5E41A 2A40A 4USIA 4DHVA 3PEHA 3NCRA 1RAAB 4DR2F 4EBEA 3J80Y 3POTB 4XIUA 2G1DA 4DV5K 4ZP9A 4GMKA 2NQPA 3MOZA 2OIHA 2VG6A 2XZTB 2C3PA 4JKGB 4I69A 2GHPA 3US5A 2XG8A 3BJYA 1RFQA 1EHWA 2MZTA 2HSTA 5AQKA 4M3WA 4OZJA 2HURA 2JX2A 3CSKA 3R5DA 1IBKJ 2DGQA 4JI5J 1HQUB 4JV5K 5GMDA 4N56A 1M5VC 2VPXB 1BD6A 3LDSA 3QLHB 3R5CA 3JSBA 4A8OA 4DUZK 2YNGB 1HWUA 2G2ZA 2YI1A 4CJTA 2C3MA 2UXCK 3W65A 4DFMA 3P83D 2XTJP 5KFNA 3R5GA 4ED0A 3H5XA 3BBCA 1T8EA 5CYJA 3U1LA 4WKRA 3Q0AA 3KLGB 5K8NA 2JFDA 3CQYA 2P9SB 1SH0A 1VQ5S 3MM8B 2B7BB 3BM7A 4ILLA 3M2UA 2LA4A 5D6GA 1TQLA 4RPFA 3U3YA 1QS4A 1OVQA 4JI0F 4I56A 4ZPCA 1WF1A 2ERRA 5HMXA 4IO8A 4DCHA 1RWMB 3AVLA 4ANDA 2UU9K 1N88A 1N6QA 5THWA 5CABA 3SBTA 4ZVOB 2OANA 1UEVA 4ZJLA 1LK5A 1ACMB 4C2MA 5B0CA 3WNFA 2GQ2A 3TTDA 2ACYA 4PAAA 2V2ZA 2RHQB 4OJGA 3P4UB 3UN2A 4DV5F 3JQJA 2ATLA 1IKWA 4PWDB 4NLUA 1K6YA 1IV0A 2M7SA 3NHGA 4PABA 2J7UA 1FVQA 5DETA 3O08A 3PIPL 3GCXP 4M3TA 1AYEA 3AVKA 2YKPA 3TA0A 1B9FA 1WKJA 1K1SA 5MLCQ 3MM6A 3F56A 3K2YA 2P9EA 5IQ6A 2ADBA 2VZ9A 4BC5A 5D0HA 1EX8A 3FNNA 2VONA 2UXCF 3VQEA 1RISA 3OS0A 3CVKA 1NSQA 4FK2A 3C6HA 3MECA 1HBOA 4F3QA 5KFLA 3QAUA 2F9DA 3MN5A 2R2RA 4TY9A 3HPHA 3V1RA 2GGPB 4X66J 2A18A 2ZH1A 4F9OA 2EWHA 4HCBA 1E4FT 5B0BA 4H5RA 3WC2A 4JB8B 4FLVA 4W92B 3J81O 1KD1O 4JHDA 5AJ3K 4A8YA 4CJEA 3PJWA 2HNZA 2UU9F 4HDGA 2LFVA 5CYMB 3NGIA 4J2DA 4KV8B 3LP1A 5LSOA 3FVYA 4N47A 1JL2A 1TU0B 2WW8A 4M3XA 3O1BA 2FYXA 1L3TA 4BRDA 2CQDA 5JS1A 2Z56B 3VQTA 2DY1A 4WKYA 3THVA 1WI6A 5IT9O 2RPIA 1SXLA 4B02A 4CJLA 3M9OB 2AZ3A 2OPQA 4M5DB 2UUCJ 1Z05A 4XH4A 2ZBRA 3X3UA 2HZAA 4HT5A 2JWKA 4H0PA 1EO1A 4ZPAA 1OKJA 2IRXA 2XSFA 3E9PA 2P6TA 3VHQA 4AL7A 4KKOA 4GKJJ 2V8DA 1X0PA 4ZS6A 4XTTA 3LUYA 1SH2A 1X5TA 4LSNB 5IWAK 1LW0B 3O6QA 2C1EB 5FRMA 2DFHA 5HROA 3IO1A 1L3VA 3HKZD 4ED2A 1XI1A 3H45C 3KWMA 2ROEA 1CZAN 4KI4A 2PD1A 1HD1A 1U0HB 4FJ9A 3NMUA 3OYMA 4W5RA 4KGMA 5CZ1A 4F0HA 4ANEA 4B17A 2DGWA 2L9WA 3KJNB 3AO4A 2AEFA 4RW9A 1RT6A 2MSSA 3AXKA 2D1CA 3RBXA 3VQ5A 4I2PB 4AL5A 4MLHA 3FCVA 1B70B 3C66A 3DXMB 4F3TA 3PFOA 3VF4A 2XMTA 1NDPA 1D9DA 4CJPA 1SIWB 2NNWA 4EO8A 4IR9A 3IMXA 3GIMA 4IOBA 5FJ4A 4UTGA 1VRUA 2MLZA 3EPGA 4UQGA 3M8ZA 3BSOA 3PG9A 3L7OA 3T3FA 3OQ2A 3M9NB 4ZP8A 1M1KO 1Q9XA 4MQ3A 4F3MA 4QU7A 4PWWA 3H1VX 2FJWA 2VV5A 3QT7A 4HTJA 1X4HA 3QIPB 3FRYA 1VBYA 3G8TA 1SH3A 5L1KA 1FESA 1V4SA 1O6XA 2MZ1A 1M0SA 2MKIA 3THWB 3SCIE 3N0VA 3R97A 5JMVA 2Z57B 1YJNN 1T9VA 2RILA 3DLLQ 2ZH2A 2H54B 4K4UA 2XGPA 3IBFB 1S0MA 4YMEA 3MN6A 2XRIA 4LF6J 1VC0A 1KWMA 2NLXA 4PEOA 4A8WA 3WX4A 2DHHA 2B8QA 4M8LA 2OZMA 4IG3B 2IRYA 2V9KA 5D3GB 1P9YA 3P3DA 1WD6A 4C1NI 4IH5A 4FYYB 3KMQA 2N3OA 4CO3A 2DGOA 2VBYA 2J76E 4WYBA 4BRLA 1IR1A 3SMSA 4CIGA 4IQMA 1J54A 5HLFB 3KHLA 2G1HA 4ZHRA 3KKRA 3VN5A 1KVAA 3EVOA 2GFFA 3W7BA 3W9HA 3BSNA 3H6EA 2J6SA 5A0YB 3B4MA 1W0HA 4IDKA 2ZM6J 4FVCA 4EZ6A 2F4FA 3CJKA 3TAGA 3I32A 1RU2A 1RB0A 4IG0A 2ZZTA 3QGPA 3EXCX 4Z7CA 3K5NA 3UWTA 4FPBA 4L3QA 3Q24A 3KDOA 4J37A 2P9UB 1RWVB 1RGVA 2ZWPA 4TN2A 1D4XA 3A0IX 3MMCB 1K9MT 4MYTA 1HJRA 3KK2B 3SDEB 4MIAA 4B1ZA 4GVBB 4B9SA 2P51A 3UR0A 3ZT3A 1LEOA 1SJQA 1Y97A 3NOGA 1TL1B 2FDNA 2HFZA 3NG8A 3V9UA 4CNZA 1DTTB 2CH6A 2GO8A 4PYDA 3K0JA 1NMDA 2IDOA 3AHPA 1TGOA 2ZOGA 5HL7L 4C8LA 3GONA 2W8KA 4EYHB 1WC5A 2GMLA 2A6AA 1IQZA 1GOCA 5BREA 3CJBA 4OZ2A 4B3OA 2C3YA 1J5EK 4PWUA 1GMWD 4J2BA 4U8YA 4Z94A 3NP5A 2NXUA 1N36J 2OTJN 1R3NA 5KFCA 4FW1A 5AQUA 2GS8A 3GWCA 3FGUA 4ISEA 2RRNA 3T5JA 2P9GA 4N41A 4FPIA 1EQYA 3AVNA 1ZBTA 1BIUA 3IFRA 1FD2A 2DNHA 1V6HA 4CEFA 3LOUA 2IM3A 1KHWA 3NVKA 1DJ0A 2XMKA 1C6VA 2FY8A 3NH1A 4IEEA 5KFVA 1Q7YO 4I9LA 4C8ZA 4JI8F 4CO2A 1QZ6A 9RUBA 4DV3K 3ICLA 3LGNA 4ECQA 4FM2A 4DDFA 1QE1B 4F67A 3A8EA 2VH7A 2NYHA 3C16B 4CBWA 6FDRA 3H5UA 4MKYA 4JV1A 4FN5A 4QIVA 3PUFA 1BOTO 5AQWA 4MK7A 3JTPA 1ROFA 3DLKB 3MX5A 1PJ5A 3H42A 3G4SN 3PW4A 1TELA 3O4NA 4F8RA 2LU1A 2FLLA 2DHGA 1JCEA 3PIPQ 3RYLA 2FF3B 1LOUA 3T1YK 1Q95G 4XH5A 1V3ZA 1J5EF 4FXWA 3VGTA 2Q43A 3ZZOA 2FHKA 3R5AA 5B0DA 3W61A 2WBMA 3DGVA 4NLDA 1BE4A 4PG6A 1WSHA 3NH2A 3K0SA 4URQU 4OYPA 4BRPA 1N5QA 1ELOA 1RDUA 5T7LA 2KT5A 3BP8A 4AYBD 1FJ7A 3KHGA 4A47A 1JX4A 4PPZA 4X64F 1FFSB 4USTA 1ZM3A 3D66A 2ILZA 5CYQB 5IS2A 1VSKA 3DLBA 3PW0A 3NH0A 3W5XA 1KC8O 3WXKA 3T1AA 3S3MA 1TR0A 2J7KA 1M5HA 2NUUG 4DV3F 5KFWA 5C12A 2ZE2B 1S49A 1Y7PA 3D7SB 2UUCK 1TK5A 1WHYA 2KKZA 3IN5A 3RB0A 4JEPA 2R2SA 4EGLA 4K42A 4C11B 3VEZA 4RU2A 2YKNB 1DQ8A 4DG1B 3F44A 1SKWA 4YB5A 4WFZA 3ZETB 3W1YC 4OX7A 1VQ4N 3VQSA 4EI2A 3C19A 3T1YF 4BWJA 2BE2A 3X1LB 3G96A 2H5JB 1S5ZA 4EIAA 4FJNA 4BR9A 3QT8A 4DR4F 1YJVA 2M5YA 4MKBA 1S1VB 2W8LA 3CJCA 2GC8A 3VGSA 5H9FJ 5F0XA 2DNQA 3AQOA 3TX0A 3W3DA 5F9NA 3CMEN 2B43A 2GMHA 2C2KB 2ALZA 2PEHA 2V63A 2WZ1A 3HI9A 1FRJA 3CD6S 3MM9B 5A76A 2P9IB 1JNRB 4B3RJ 4DV1J 3P8BB 3HULA 1XQSC 4NLBA 3ZTSA 4CNYA 3VQAA 4BC4A 2HBMA 3CCQN 2WVDA 3MMBA 1TKZA 3K5LA 2B4OA 5FPDA 3DN9A 1A5WA 1U2RA 1YITN 2CPJA 4ER8A 1S1XA 5ADZA 4U7UD 1X8DA 3J81U 1RBSA 3IWXA 4USHA 4Z4GA 4W5QA 5I9EB 3J7A1 4KTQA 3NE6A 3HHLB 3FBCA 3NGDA 1N8RO 2KZZA 5AE2A 4U6PA 2XS2A 4UOFA 2J5AA 3WEEB 3W66A 2FVQA 2VOPA 2BW2A 4K8XA 2UUAK 3EWGA 3JXOA 4MKVA 4HHJA 4ILGB 2PMHA 3J81Y 3CIZA 5B0GA 3OL9A 3H3NO 2BUPA 2QTWA 4ENOA 1JLEB 3VEOA 3THXB 1VR6A 3ITHB 3QO9A 1WHWA 2DR7A 4ZITA 3T1HK 3U3GA 1VQPN 1PIEA 5HO4A 2VU5A 4YDUA 3AGKA 5KGXA 3AODA 2WFBA 3NOCA 2FJBB 2F4VJ 3GSIA 2Q97A 4K4XA 2AJ0A 1TK8A 4KHQA 2GEMA 3EDQB 3GBTA 3M8PB 5AXKA 4DX7A 3VPZA 3A3PB 3KG4A 4LF9K 3I82A 2B5JB 4UY8T 2UXDK 3A5NC 3MMAA 5EN1A 1WOSA 1YTYA 4YQWA 2HNYA 2NPFA 4BVPA 3C7NA 1J9AA 2J0SD 2FC9A 3SQ1A 3M6UA 2ZH8A 2MZJA 3CJQA 4X4SA 3GV8B 4QS8A 1KQKA 5GIOA 1CXQA 4BRHA 4I9QA 1H72C 3QT6A 2EW9A 3ELHA 2CYYA 4QBUA 2ZD1A 3I33A 3VERA 1FJGK 2HVIA 2UVRA 1JB0C 2V4JB 2UUAF 3CC2N 3EKSA 3NMAA 5L1JA 4ZVQB 4CZMA 2HQIA 1XEZA 4OX8A 2LQ9A 1IG8A 4Y2MA 2IBKA 2XLJA 4UT4A 2KU7A 4B9UA 3T1HF 4UZBA 2OYQA 3DOLA 4EUVA 2HBJA 5GADP 2DRDA 3D6HB 4CF0A 4DMNA 4CDIA 4RW8A 1ZPWX 2VCPA 3PYFA 2VKRA 3BSAA 3V4IB 4YN3B 4NXMJ 4PHTX 5HL7Q 3BDPA 3EVMA 3HHLC 3LWLA 3ZNJ1 1FDAA 4LF9F 1IUJA 3AVHA 3TUJC 3C2PA 4RNFA 2UXDF 4ZKAA 3RBZA 2RDJA 1CPZA 3Q23A 1SI9A 3AVBA 2E5JA 4DR5F 1GEHA 1BIZA 4Z37A 5G0RA 1CQNA 2O3DA 4YR3A 4HVZA 1LWCA 4PG8A 5ITHA 1QSLA 4YB1P 1R8PA 4ZP7A 3JQKA 1RYRA 1KAYA 4WQ5C 2KG1A 1XMOF 2Y8YA 1S79A 1IJFB 1Q7LB 4A5BA 2CZ9A 2XSJB 3OXFA 2F7VA 4BROA 5IFMA 1S1UB 4YOWA 1VQNN 1BO5O 3DM2B 4FKXA 5A8WB 1FJGF 1KBRA 2K3IA 4R0JA 1WSFA 2ASOA 3J7YU 2RQKA 1VLYA 2E5LK 1KLNA 1U26A 2GJ2A 3CO0P 4GNIA 1F9EB 2Z30B 4JD2A 1REVA 4J9SA 1D8YA 1LXNA 1SS6A 3BZKA 5EWEA 3AARA 4WQ5A 3MCPA 5E84A 2E7WA 4LH4A 1S1TA 1C0UB 4OYXA 3HKWA 4ECXA 2DR6A 3FR0A 4M45A 3NGKA 4EBDA 5LL6d 4FLWA 3NWGA 4JI6J 1REGX 3KKFA 4O4GA 3UI3A 4TYAA 1M5KC 3MPYA 1HYZA 2J0QD 2QLXA 4DN0A 2ILYA 2HHHK 3GTYX 2C2RA 1TKTA 4GV3A 4ZCLA 2XLKA 2J8SA 2MHEA 3C46A 4NXNJ 5HJYA 4MLEA 4NLWA 2NRTA 2CNKB 3NS6A 3K9JA 4IFEA 1YDLA 2GAHC 4HTLA 3A8YA 1W26A 4H5TA 5BPMA 4DU4A 2HGLA 2NYIA 2WBRA 2VPWB 2V9WA 4NL5A 4USWA 1OY8A 2XNRA 2RQMA 1NH7A 1U1KA 1T94A 2XMJA 3D0PA 3VWSA 3G6XA 2V7YA 1VAZA 1SKSA 2BKPA 4Q44A 2OZSA 2E5LF 3EZWA 1KEKA 3Q7CA 3WT0A 1WBDA 3NGUA 2G2YA 3OPKA 3B6PA 6AT1B 4FLXA 3DHWC 3ENOA 3M1FA 3CB4A 4GC6A 4JKHA 3H4DA 1E6YA 4CP5A 2CRLA 3ISZA 2B51A 2M0GB 4JI2K 4NYNA 1U04A 4A8FA 1VC5A 1VQ9S 1EWRA 2RHKA 3JB9k 4CO4A 3LL3A 2YWKA 4J9OA 5KT6A 1XNQJ 2O8DB 3TO8A 1LWFA 5LMNJ 4ILMA 2EC2A 5J2MB 1NHKL 5FRNA 3QRRA 1Q1KA 1R6YA 3JYTA 4FXDA 2W40A 2H4YB 2OGUA 4H8KA 5IC4B 1UVKA 3R7BB 4CQ1A 3C94A 5HVGA 1KLMA 1G1XA 5L46A 1WHXA 1RHQB 1HUXA 3W0LA 2VQFJ 1F21A 1HL6A 4HT7A 3P38A 3ISNC 3DXSX 2ITMA 1S0VA 2FJDB 4TSXA 5KI6A 4LF8J 4WE1A 1JKHA 1HBUB 1KVIA 5D0GA 2UXBJ 1FRMA 1WUAA 4EU0A 2IJNA 1SKRA 1AUDA 4ED5A 2OTLS 4X4TA 3BH7B 2AW0A 2Z58B 5KOWA 1SJFA 1NK6A 4OI2A 2PAVA 2E4LA 1MW7A 4Q2LA 5AZJB 4BR0A 1U6ZA 3PSIA 3R1LA 1RT7B 1T6DA 4JI2F 5K8PA 3QFWA 2H4WB 3U4LA 1X0FA 2JLEA 2IA0A 4E1JA 5HRNA 1VYAA 3I6PA 2R8KA 3H98A 1ILYA 1QSYA 8ATCB 1K44A 4PQAA 1GOBA 2UUBK 1I94K 3NAEA 3BREA 1YLXA 4FZXC 3N6MA 1QSSA 1RHKB 2RU9A 3AA5X 4KHYA 3QMQA 2IVNA 2W1BA 4JI3K 1GLAG 3U6FA 3SLCA 1P8ZA 3MAQA 4H5WA 3N28A 1RTIA 1RWWB 1MMDA 2EFVA 4DLEA 1RQ0A 2VG5A 2HS3A 3NF9A 4A8QA 2HWHA 3QFHA 4AQYJ 2A6MA 1Q79A 3E8OA 3M2RA 2Q3PA 2R8JA 1QY7A 1RWKB 1UVMA 4M1KA 2BANA 3CFOA 1IBLF 2EI5A 5KFHA 4QW9A 2QRRA 4C98A 8RUCA 1Q0NA 5HSPA 4LRDA 4AH9A 1BLUA 4B3TJ 3TJAA 3VAIA 4U95A 1S0OA 2LKZA 2MQNA 1UW9A 3O3GA 4KRWA 4TU8A 1S6QA 2F63A 3R2CJ 4L3KA 2LDYA 3AA2A 5KT5A 1WB9A 3J7YP 3O8WA 2E1RA 1FTCA 3DOMA 5DS7A 1HNIB 1RT1A 4OHVA 3ZZPA 3VQ7A 2ZBIA 4Q0BB 1BA1A 2UUBF 4G65A 3ZT4A 4KRFA 2HK2A 3CCVN 5L1LA 1FDDA 4B8CA 4V19J 2P6SA 3OTOK 4JI3F 4N76A 2Z2LA 2XM3A 3MURP 3VF0B 3NMRA 2DCUB 3O3LA 4ED3A 2GELA 1FWKA 1YI2S 3AAPA 5AQLA 3AA9A 2Z8QA 4NLSA 2VC0A 4KHWA 4CTAA 1SJ1A 2O4IA 3SCKE 1DURA 3KLGA 5KT7A 4NRUA 5K20B 5FDLA 4J9UE 1GXUA 3MPWA 3T7ZA 3J7AN 3HOTA 3LP0A 5M1KA 4IOCQ 1TL7A 1TKDA 3N4QA 2IPOB 2GIQA 5ETRA 1SC6A 3QJLA 4FNHA 3MXJA 3R5BA 3UKRB 1QQMA 3OA9A 4R8UA 2MZQA 1NBEB 2CQBA 2R9LA 4DQRA 2K7JA 3BH6B 1HWKA 2CWKA 4GMJB 4IQXA 4H5VA 4DTJA 4OZ5A 5AQSA 2HFSA 3OYBA 2JH3A 3V81A 3RTVA 2XB2D 3P31A 3HP9A 1BCMA 4Q5VA 5CZVA 4ZPVR 1UVIA 4EFHA 5BR8J 4JI6K 5AQMA 3OTOF 2EG2A 4ZCIA 3U1NA 4QIFA 3PR4A 2B9WA 3MM7B 1PBAA 1PC4A 1IN0A 2RQCA 2BOPA 3I0SB 3DDIA 3V4MA 4OGCA 1RTZA 3PW5A 2P5GA 2B6AB 5U47A 3AB2B 2C2OB 1TKXB 2AX1A 3TSQA 1YX2A 1FE0A 4OZ1A 1HKGA 2XY8A 3MFIA 2A10A 4RNNA 2Y0BB 1T03A 2QFJA 5DGAA 2WVEA 2HVDA 5EX3A 3VQPA 4CLLA 3PEJA 3O9UA 3D6FB 1I51B 4DL0C 4WZMA 4DV7F 1R6VA 4DCOB 3CDEA 3OR1B 1XMBA 9ATCB 4J9RA 1TUWA 4K0KJ 4CFCA 1URNA 3M32B 2JOQA 3CIPA 2ZDOA 5CH7B 3QZ7A 3A3NB 4P75A 1WJ9A 1Z25A 3V6JA 4XDDA 5CZXA 5LJWA 3PO5A 1VQ7S 1QVFM 3QSYB 2R7RA 1SVDA 4DPXA 1JJ2R 1HNVA 1NSAA 1NUEA 3OBWA 2UUWA 2EPIA 4Y1CA 4YS2A 1WF0A 3SPZA 1QVFR 1S5JA 2LXFA 3M1VB 3ET6B 3FFIB 5K14B 3CWJA 2WRMA 1CVJA 2HAFA 2D69A 2BMBA 1Q81T 3WXIA 1HHTP 2W2PP 3B54A 4DJBA 4DLGA 4P7VA 3KK1B 3CJ8A 3SJJA 2QFIA 2HEKA 2GO9A 1IKYA 1LW2A 2CJQA 2F65A 5B0EA 1S76D 3KLFB 4M5MA 4DWIA 4B3MK 4UY85 4DFKA 1MU2B 4CGIA 5HI7A 1TYQB 4M42A 1GX5A 2PSZA 1HI1A 1MN7A 4QR0A 2CPFA 1BQMB 1H7WA 1NEEA 2RS2A 4C8MA 3L2QA 3BN7A 1HBMA 4AT1B 4DQPA 1YHQN 2Q36A 4ZLPA 3UKUA 2MKCA 3FKBA 3G10A 2HHTA 1M90O 3W5YA 2RF2B 4DR3K 2B7CB 3QJJA 2DIVA 1S10A 4ES3A 2QTDA 2IDLA 1RTDA 1HHSA 2O8EB 1NPPA 1HIYA 5ETKA 2I5JA 5CXTA 4TY8B 2IVOA 3MM5B 3I56N 3BF4A 4JV2A 3PIOQ 2DPIA 1RNHA 1W2IA 3O4WA 1DFDA 3KK7A 4U7BA 1KTVA 2CG4A 4OPAA 3I0RB 5JICA 3CF5L 1Z1ZA 2QWPA 3JXUA 1X31C 4FYDA 2UP1A 3EM1A 2A1RA 4LF5J 1HYSA 4ES2A 2Y1RI 4CYUA 3EZOA 1P9QC 2JEGA 3CDWA 3W2VB 3OLBA 4CEEA 5GINA 1S1WB 4OX6A 3RMBA 3GOIA 4B3MF 3LPEA 1K8KA 4FJ5A 3VQBA 4ZMMA 1LNQA 3RBDA 1FRXA 3ASMA 2MHNA 3KMSA 5KT4A 2QK9A 2M4MA 4QW8A 2AEJA 3PYEA 1ZZNA 5DDRC 2E1CA 2ZGYA 2RKIA 4OLBA 4HHUA 1D1UA 2PDAA 3BPDA 4CGDA 5ETMA 3QETA 3EMTA 4QYZK 4FJ7A 4E19A 1N5YA 5M2RA 3LQVA 1BISA 2FHOB 1BUXA 4CJ3A 4CO1A 1VQMN 2CQ3A 2I0XA 1BGXT 1XR7A 2KQ2A 4M5JA 3OVNA 1JLAA 5F41A 4OJ3A 2BDPA 3MR2A 1BI4A 3D3CJ 3O1LA 4QIWD 5KFRA 4MO5A 1UZHA 2XWYA 4B3TK 4ZVSB 4DL6A 2PT0A 2JVOA 2W2OP 1SBRA 2JDJA 1RU1A 4NCAA 3KJVA 2G13A 2DR8A 3TUIC 2ZZNA 1IKXB 4LJMA 3V2UC 4FL9A 2CPDA 2HLTA 4YR2A 2UUTA 3MCNA 1HQ2A 1XN9A 2EHGA 2F8HA 1F2HA 4BDZA 4IOAL 2GWKA 3MEDB 1EKEA 3T5LA 1ITGA 3OYIA 2W2MP 4K4YA 4I2QB 1HPMA 2EC0A 1YKWA 4M63A 2U2FA 3TTFA 2VPYB 4CFDA 4DV6J 2FVRA 4OPHA 3SQ0A 3VAJA 1YVNA 4DTPA 3SUPA 3ILIA 4UY8O 4LFCF 4AXJA 3JS6A 3HJVA 5B0AA 4NPOA 2B4JA 1VJQA 3TTCA 2GW8A 4YHHK 2OPPB 3HSJA 5J2PB 1QHAA 2HB5A 3MCMA 3TAMA 1RA7A 1PCAA 4DTXA 3QWUA 2GVZB 3AVIA 1VQKS 5E26A 4KYZA 3H25A 2NLWA 1S72N 2VIHA 3EE3A 3QPIA 3ZZZA 1SUQA 4NYPA 4JK9A 3V9SA 4U7UK 2DISA 1YF5L 1PYSB 2QGFB 3R6MA 1S9EB 2HBKA 3P5BP 1N52B 4OX9F 1HMVB 4V19X 2IGIA 3OHBA 4CK2A 1HW9A 3BKUA 2HHVA 2HZVA 2Y8WA 4O23A 4DV0J 5IM0A 3RRHA 3CULA 1K0TA 4FSVA 3M8SA 4O3RA 3KLHA 3MD3A 1CQMA 2DNYA 4WTYA 2V68A 3RR8A 1TL3A 1S9GB 1G15A 3MWPA 3B6BA 3ZSYA 4GVLA 5KFTA 2ATCB 2X3GA 2HBZB 4BQZA 2OJ3A 1A6LA 4HACB 2RS8A 2XC9A 4YHHF 5EU7A 4M3UA 2W6LA 4UW2A 4LUBA 3A12A 1HW8A 1OPZA 2AD9A 5EY4A 1AFIA 4RKUC 4RBTA 1Q8BA 4Z4HA 4BRGA 1YXQA 3QFPA 5HQLA 3RR7A 4IH7A 5F2RA 4O0JA 3VESA 2YNHA 4OV6A 5KG4A 3F9MA 5AE1A 3CXCR 2YNFB 1ZM9A 3G87A 5KPRA 3CIMA 2W9BA 2GZOA 1NO8A 4FF1A 1XMQJ 1KVBA 4ZDNA 1R8AA 3ENBA 3M3ZA 4ZVGA 3WX8A 2HBLA 1PBUA 3TAFA 4UUWA 3CCTA 4JRQA 1FO1A 4BRQA 3GFYA 4HI2A 5H1SQ 1D0EA 4BR2A 3QT5A 4OJHA 2KM8B 1G99A 4EP5A 3EKUA 4RNOA 2GIFA 1RT5B 1SQFA 3OL8A 3K57A 3N6NA 2H5EA 4BLGA 4Y0WA 2M8DB 3HFZB 3NCQA 3ID8A 5CA5A 1G6BA 1TV6A 2VD3A 3ENVA 1U1PA 3KKSA 1Y3JA 2XMMA 1FRLA 2E1YA 3ZETA 3ZXWA 1I1GA 2HFOA 2JC0A 4KBIA 4CLWA 4BRCA 2EVZA 4LSLA 2OPSB 5ADXA 1QAIA 2HRTA 1SC1B 3G9CA 2YHWA 3EPIA 2A1SA 4ED8A 3FZHA 5KFEA 4DV4J 2V51B 2Z1GA 2QA4G 3BBFA 2LEPA 4F4YA 2ZQBA 1ZAXA 1QDUB 4QQBA 4YDDB 3GV5B 3NF6A 2D0OA 4DQ8A 2Y0SD 2D5RA 4FVUA 1R0CB 4X4PA 1WAJA 4FO0A 3MAAA 5SUHA 2O8BB 5GAHU 3C6TA 2XLIA 3ZTRA 1ZYQA 3PACA 2D9PA 1L5UA 3M2VA 1F1BB 1DTQB 4ZVFA 3I96A 1FNXH 2OAUA 2H3GX 1VIXA 1X9MA 5HP1B 2A41A 1NDKA 3B82A 1IH7A 3DI6A 4LT6A 4X4RA 1EB0A 3GJTB 3G2XA 4IRDA 1IG9A 2OEKA 4M5HA 3FEXB 2C2ZB 2V50A 1KR4A 3CF5Q 1YVFA 2QIFA 1QM9A 1R89A 2VA2A 1VSIA 1FCAA 4OLAA 4CLKA 2KJVA 4W90B 1QQCA 3UW1A 1WG4A 3IXQA 3UN3A 4MTPA 5IT0A 1Q8IA 1HWIA 3DMJB 2QMWA 4J9QA 5J2NA 2YH1A 2CZ4A 3MN9A 1JLEA 3QJPA 5F0WA 1AT1B 3CUNA 3B8HA 3PFEA 4DI6A 2EFOA 2GX8A 2DH9A 4FLYA 1RI7A 3RAQA 3BKTA 2VF3A 1M1HA 2A42A 1HNZJ 2RB7A 4DL4A 3OVAA 4RW7A 3Q86A 1NMEB 2YKMB 2YHAA 1LWXA 4G1QA 5HVFA 4CLYA 3O4QA 1FEEA 3H2UB 4K59A 4DR7J 3IR5B 3BGRB 3UN5A 2G4BA 4WIQA 4CIOA 2KH9A 1K47A 5HMYA 2KLAA 1CXUA 3RSEB 2ZNYA 1RT2B 2QI2A 4L3NA 5EXWA 1FT8A 3LP2A 1MROB 3EGWB 5KFOA 3FQLA 3VGKA 1RAHB 2AMCB 1IBCB 3WIVA 4JKCA 3CMAN 2WSFC 5EUHA 1KQGB 1W9HA 3M6GA 3T19A 2EKNA 1YGYA 4OQJA 3OFEA 4JI1K 2OMOA 3R9LA 4XK8C 3K5OA 2WK4A 4DR6J 1HD0A 2QXFA 3NL0A 2Y1IA 3KLIB 4X65J 2ROPA 3AVAA 3WBZA 1NJIO 6FD1A 4S0MA 4FW2A 1WELA 3PVXA 3DRSB 3WQPA 1HR0K 1YRUA 5H9EK 1JLCB 2RVJA 3OYDA 3L3CA 1NSKL 1D5AA 4J8FA 3T6JA 1FJEB 4P6QA 4Y34A 3SUNA 3IP0A 4F4WA 1OMSA 2PC6A 1CS4B 1AROP 3RAXA 2HQCA 2CJ9A 2BJ3A 2LDIA 2OMLA 5J1EA 1CJKB 4E7HA 2AGPA 4U9RA 2E9RX 4BREA 3TQEA 3QSIA 3DRXA 1U2FA 2LQJA 4PQUB 4O5FA 3H3OB 2OH2A 5KFUA 5M2PA 5AQPA 2EX3A 2DT9A 3QDKA 4B1YB 2YY3A 1WOOA 4H4KC 3NFAA 3WHIA 3DNCA 1FERA 2RN2A 4KGZB 4FBTA 4H5NA 3UDCA 1RTJB 2N4CA 1UEKA 4ECRA 4I6MB 4CIEA 4JI1F 3MPDA 1UPMB 4LRCA 2C28A 3PNIA 4L73A 2DYAA 5LSRA 2QA4S 1JJHA 4J9LA 1B64A 1CZBA 4FK4A 4C8KA 4ICLB 5DM6Q 5M1QA 2HG4A 5B0FA 4CJRA 2IAJB 4GVEA 4YOVA 4FK0A 4RL1A 3C6UA 2MXYA 1HR0F 4FJHA 4U67Q 1XTZA 2FB0A 4J7CA 3CG7A 1T7PA 2RSQA 4KB7A 4MDAA 3HSDA 1RBAA 3OYHA 5HBMA 1X7VA 3HCXA 2ZKTA 3Q8UA 3PDNA 3DXBA 4CHZA 1NKBA 4OI6A 2QJ3A 4KTWA 4DX6A 5GMKa 2FSNA 3TWZA 4ECYA 2MDAA 1CJUA 4NZ7A 5DDOC 1XMQK 2DR5A 1X9WA 5F8HA 3TZXA 1Q8LA 4WXWA 4WBFA 1S6PA 2G8HA 4BWMA 1NKEA 3DLGB 2YH0A 3OYAA 4JI0J 4PUOA 5ETOA 3SXLA 3G6ES 5J2QA 2CPIA 3LAKA 1BU6O 1QJHA 1X5OA 5AZIB 1LOTB 4RW4A 1WF2A 2ASYA 2L08A 1DT9A 3OR2A 3O9RA 3ZSQA 2PIIA 3D6TB 2EG1A 4BY9C 4LRBA 1XWLA 5C2CA 3Q83A 3H5SA 3EGNA 1WKKA 2J8AA 4DV5J 2QWNA 1DHMA 3QBCA 4BVOA 1TFYA 3G8QA 2DITA 1KXPA 1NNEA 1P27B 2O67A 1RYSA 2C3UA 2R7XA 1XIQA 1W7WA 3UVJB 1CJVB 1DY3A 5DM7L 1PG5B 3N4WA 3SIPB 2A1BA 1EETB 2Q3SA 2UV8A 1C1CA 2V2QA 1IBMF 4JV5J 5AE3A 2DHXA 2XYPB 4CI0B 4J91A 3L09A 2KXNB 1HBNB 2DNPA 4DUZJ 3DHXA 4DSEA 2BV3A 2PGCA 2JWLA 2FIUA 1Q82T 2YPZA 1RDDA 3DWLA 3HBTA 2HK3A 3OLAA 1KN6A 3K9KA 2NZ4A 4NB4A 5J2MA 1VQSA 4H03B 2UXCJ 3LWMA 1WSJA 1MMLA 2DNZA 2VBZA 3PHEA 5J1PA 2F4VF 3O9TA 3UIQA 2CQPA 3C0BA 3MMVA 3OYJA 5SZTA 4GRSA 2YV0X 4LFBF 2EFQA 5HATA 1HQEB 5KFSA 4BRFA 2NSBA 2XYGB 3RBEA 4HUEA 2ZHAA 2MB0B 2UU9J 4RJVA 3CC7N 4DUYK 3LDLA 2NRXA 1VS3A 5M1NA 3T41A 2KHDA 4HCCA 5GIPA 1YJ7A 3SUOA 4QU6A 2O66A 1WC1A 2DTJA 3GJSB 4IFYA 5HJXA 2ASMA 3UR3C 1H6KX 3NCIA 4B9LA 3THYB 4ELTA 1FK9B 3QESA 4YOYA 3MN7A 3VGMA 2AIRB 4NLOA 4R5PA 1U6FA 3PXGa 5KFYA 5DO2A 1Z26A 5DG7A 1EQMA 2DNOA 1BG3A 2G2OA 5KRSA 5M1FA 1QVGM 2LYVA 1N0UA 2LA6A 3CCUN 3CJ5A 3AA3A 5GAHI 2XY7A 4H54A 2NRHA 3HFVA 3WXMB 1BQNA 2AJFE 1QVGR 2VOOA 3R9PA 1T05A 2I38A 1JK9B 2QLWA 3GV7B 2PI4A 1TZ0A 4BQLA 2MKJA 2G0IA 2K2PA 1CJTA 2BJ9A 4PA1A 1RCXB 1KQSM 2ZHBA 2MKYA 1VQ5N 2ROGA 3I5BA 2V34A 2P9LB 1Q9YA 3M9MB 4G6VB 1KAXA 1KVKA 4NI2A 3AVJA 4DR7K 3EY1A 4ZCKA 1V5VA 4I7FB 2RHSB 3KIOA 4CBXA 4BRNA 2W7PA 4CEBA 4BG8A 1CC8A 4KO0B 2IRUA 2CPZA 4C7QA 3R2DJ 1ULRA 1FKPB 1SV5A 2X1FA 1LWEB 4EAHD 2I2YA 1TUYA 2GTDA 3GIKA 1V5IB 2V2VA 4DKWA 2F1FA 4V19S 3UFCX 4FZYA 2HFVA 3UDLA 5KFBA 1IWGA 2HIYA 1I3AA 3D2FA 2DGUA 2GX9A 1RTHB 4WFAL 3ZLJA 2HHQA 3TABA 4X65K 2Y9HA 2KHOA 3LM2A 4F4ZA 4LIRA 4O3QA 1S7HA 4E89A 3O2IA 5BXIA 3MX2A 4WFYA 4CH1A 3I4PA 3OV7A 4O55A 3DGPA 3PLAA 1KNZA 3HT3A 1UL3A 4OHWA 1BQXA 2AYEA 2VG6B 1U1MA 2ZJPL 4ZVTB 1WSVA 1Y10A 4FOEA 2Z2YB 3ULEA 2Z2MA 5F8MA 4UOHA 1VOMA 5BRDA 2MQPA 5KG2A 4CZGA 2YJFA 1RAJA 1UA1A 2ZOFA 2O01C 1FXDA 1IR2A 4YFUA 3THTA 4O44A 5T14A 3TA2A 3ILOA 4A8SA 2JFKA 1YQHA 4C0OC 4X4UA 2LEAA 4AFFA 2Q66A 3OUYA 1MLAA 3Q8PB 1EP4A 2POKA 4K8RA 4WFNL 4QZVB 1RXOB 3EXYA 2VODA 1HPZA 5C42A 1PSDA 2R4FA 2IC3A 3FJ2A 1HX1A 3SBGA 4FWQA 2VKZG 3M2UB 5IV3A 4FZVA 4IJAA 1BY9A 1NDCA 1PJ7A 2HOEA 3DJCA 1S97A 5BYRA 4KAIA 4FF2A 3J7ZT 3S9HA 5IXUA 1B7YB 4IFVA 2HNDA 4E7KA 1N6QB 1FRKA 2RAQA 4F36A 4OKEA 1YZ7A 5AQNA 2CDQA 1U2VA 2VYPA 1F5BA 1GXTA 3VQQA 3GIJA 1LK7A 3MEEA 1KFSA 4DR2K 3JSMA 3CJ7A 3ZT2A 1IKWB 3AVGA 3CCMS 3Q8YA 1N5SA 3VQ8A 1F9FA 3OT9A 1TAUA 1SCJB 4ISGA 5EX5A 4DF4A 3SV4A 3TARA 2FLPA 4CI6A 2HMPA 2VG7A 3MM6B 4KH0B 3Q8RB 1NWKA 4OI4A 4PKIA 2CJXB 5D78A 1RBUA 3PJXA 2QXLA 2D4WA 5C7PA 1NHVA 5ADXH 4NEYA 3MR6A 2F8TA 2Z1IA 2W42A 3AFGA 3MECB 1HBOB 2BJ8A 4U8VA 3OVBA 2DHAA 1SL1A 2VFRA 3AJDA 2HBQB 3VQ4A 3TPQA 1P1TA 1BA0A 3FDSA 2VQEK 3OYCA 2MJUA 4QCLA 2VQFF 2RRBA 5SWMA 3D4JA 4O3PA 2HMIA 5KFIA 3HYFA 2YHYA 2CG8A 1VI7A 4JHDB 1WDDA 2H9ZA 4UUXA 4JKDA 2HNZB 3HPGA 1D8ZA 1SZ2A 4JKBA 3RG6A 5KFMA 3ZTPA 2QYCA 3D7EO 3KXDA 2F96A 3LP1B 2NPIA 1U1NA 4IRCA 4CGFA 3G8SA 3R6LB 3ID6A 4CJVA 2ZJRL 3CCSS 1L3UA 4ALZA 3GPAA 4EHTA 2X1GA 1KVJA 1Y4ZB 2CJAA 4B08A 1YJWN 1B99A 3DRPA 4H4OA 4CLSA 4OFZA 5LT5A 4J9PA 4Z4IA 4JP8A 5L9XA 4NYOA 2N82B 2OPQB 1UWBA 3WC0A 5DJBA 4Q8FA 1F60B 3O80A 2V8HA 3M05A 3V5RA 4WIIA 3E9OA 3MUVP 3E1YA 3BF1A 3HM9A 1FJCA 5FROA 1X3MA 2J4RA 4FPAA 5GVQA 2DPNA 3TSUA 5DM7Q 3CCUS 3CJAA 1E6VA 1YJ9S 1VQ6S 3OD2A 1J5EJ 5HROB 3A13A 4CZFA 3C95A 1C0TA 3EX7B 4CFAA 4WYWA 3LH2S 2VPZB 4OYOA 2FY1A 4F4AA 3S1TA 3I8BA 2QWQA 1CULA 2VQEF 1T9YA 1B4SA 4NWBA 4BR4A 3I9V9 4AQYF 2DK2A 3DC2A 1G4CA 2BX6A 1JLBA 4RW6A 4KI6A 4DR1F 4QJVA 3W9JA 4W5NA 5E3QA 4RW9B 2CA9A 4Q43A 1TVRA 1RT6B 2FSKA 4X64J 5L1IA 2D0BA 1Q4RA 5KRTA 3HI0A 3MXIA 1WSRA 1NCLA 2XHWA 4YOXA 4D3HA 4DV3J 1DQAA 3D0GE 1VRUB 1PC5A 3NVMA 3QMLA 1ZAVA 3GE9A 3CFRA 2NRZA 3CJ4A 3A4TA 4RUBA 1C0MA 1U09A 1RACB 3HJFA 3CJ3A 5ETNA 3KJFB 3M6XA 2EK1A 1N34F 4B1UB 3Q8VA 2ZITA 3QATA 2XO6A 3HK2A 4G9ZA 2HVEA 4K2JA 3T1YJ 1JLGA 1IVZA 1X4BA 3BQ2A 2V8GA 3R7SB 4B8AB 1FWPA 2J0WA 2J6TA 2R7UA 4DR4J 2NRRA 1X4FA 2Q6CA 1O51A 4HHTA 2L3MA 2LCWA 3GILA 2J9EA 3PX6A 2PI5A 2H65B 4F3OA 4AM7A 1NKCA 3D6RA 4USKA 2KJWA 2Q31A 4V1Ak 4JBCA 4A8XA 4C9DA 3JTNA 1NGBA 1K1QA 1WOQA 4NE9C 2LLZA 3OXLA 2JWNA 4BE2A 3PW2A 4ES1A 3IWLA 3L2UA 4ZHRB 1LXJA 1NDLA 1PAUB 3H1QA 2GVDA 1V3SA 4OZLA 3UE5A 3IGNA 4IBNA 3HLUA 4DB3A 4IDKB 3O9QA 2V8VA 3A8JA 4K5RA 3CJKB 1S77D 4QOTA 1OH6A 4IG0B 4M94A 1HKAA 4AHTA 2APOA 1A5XA 1RT3A 1QLNA 3H8YA 3OTDA 1UP1A 4WFAQ 1S3XA 1QD1A 3SSQA 2CQ2A 2FJAB 4RUCA 4D3GA 3VEVA 3J81j 4DX5A 1YVUA 1VDHA 3JAMO 4FJXA 1LFPA 1HNWK 1TMJA 1D09B 2PY5A 4KB0A 1VQOS 3MI7X 4ETZA 4PCQA 3TSPA 1ATRA 5AXNA 4K4SA 3F0NA 2E1PA 1NZAA 4C6AA 2MQMA 2DEJA 3CC4S 1RBTA 1SQKA 3TR8A 4B3OB 5HRRA 4K5SA 4CK3A 1XHXA 5AR0A 1TL5A 3GG4A 3V1QA 5D15A 4HYKA 2WBNA 4F04B 4JK7A 2CXEA 3DU6A 1J5OA 3TQ1A 4WFNQ 2YQ1A 4LH5A 1VK8A 1MWZA 1NGEA 3E66A 1YJTA 5LOQA 2BUNA 3EYZA 4AHRA 2BR0A 3IAM9 1HMVA 3M7VA 4DL5A 4RWTA 1VSHA 1X3NA 2NREA 4ECWA 5BPNA 1S4FA 1WC6A 3S6EA 2D0CA 4Q8EA 1FHTA 4YORA 1JXEA 5DG8A 4MKAA 2JZ5A 3HO1A 4DTUA 1YJWS 2DXEA 4IH6A 3U7JA 1KD1T 3ZT0A 3OYFA 5KFJA 3VA3A 4CEAA 2UUAJ 3KUHA 3LM9A 3U9DA 1HNWF 1T95A 5C24A 1WSGA 1Z6RA 4OO1J 2AEMA 2V94A 4ERDA 2HQ3A 5E3RA 3H08A 1JLFA 1F3VA 3FMWA 3T1HJ 4ZJOA 4YY3K 4LFAK 4FWOA 3LGHA 3L0QA 4DV2K 3W64A 1U1QA 2QSFA 3CD6N 3GFHA 1EQ0A 4FVMA 2WB1D 3IS9A 3ILLA 1J2VA 2AU0A 3DLEA 4OZ3A 1SQGA 4HHHA 4E8UA 1N32K 4LF9J 2NS1B 3IR6B 2FF6A 2UXDJ 4NASA 3DCAA 4EFAC 4KBOA 3C15A 4DR5J 1NXIA 4XH1A 4P72A 2XMUA 4DSJA 1WEYA 4J9KA 3O3FA 5T7LB 2YJEA 1RDWX 3ZO7A 5AQVA 1JLQA 1BCOA 5LJVA 1C4CA 3FLCO 3I8DA 2XS5A 5BJRA 1NU4A 5LXYA 3GJQB 3G82A 3BGLA 2IMWP 1Q86O 3BGOP 2QG9B 2ZJRQ 1F2GA 3NF8A 3CD7A 4CH0S 1M1GA 4JK8A 4JI8K 4ECSA 1FJGJ 4ISFA 5KFPA 4IO9Q 1H3DA 2JGUA 4DU1A 1Y11A 2F7TA 5ETVA 4F25A 1FNMA 3FCWA 3CYMA 1Y3KA 4DZ6A 2M70A 3HSTB 1WTFA 3H7HB 3AJ2A 3HHKA 4YY3F 3PX4A 4LFAF 2E2OA 1RAEB 4MIBA 4DV2F 3JQMA 1FFWB 5KG0A 2BE2B 3IBWA 3FZFA 4DPUA 1JCGA 2A2CA 5EVZA 2MZRA 3WUHA 3L2VA 2GBZA 4KR0B 2ADCA 3CCLS 3P5JA 4HL9A 4DCJB 1C2PA 1JWWA 3DXKA 1N32F 5I4MA 3AY0A 3CDBA 3H59A 3OJUA 3FFKB 2G8UA 1OH7A 4H4MA 2X6NA 1QHTA 3AV9A 1R8CA 2BBEA 4EMDA 1UFKA 2UVWA 1URRA 1GXLA 5KQDA 4K4WA 3OFHA 3CE8A 1HNXK 1RT4A 3T9ZA 1U45A 2B4UA 4CW7B 2C42A 4ZPBA 3ZSXA 3J80O 3GG1A 5C15A 3NDKA 3QBWA 3MK6A 5ELZA 2NUHA 4ED7A 4X64K 3MXMA 2EFGA 1SIZA 1U1LA 4ILHA 2Y1LB 3DRRA 3QIOA 4CESA 3MMBB 1D9FA 1KSPA 2XZDB 1TKZB 4QWBA 3VENA 2EFPA 1S1XB 2ASJA 2E5LJ 2VB6A 2FGCA 2HBRB 3N5FA 1KFDA 3VVUA 2FHJA 3F73A 4OPKA 2W7OA 2P9NA 1H2TZ 4LMZA 1UJ5A 5D4NA 1NM1A 4CZIA 4WJBA 4J9MA 3I31A 1DZ5A 2GUIA 2Z2ZA 1RABB 3CJ2A 4GKKK 4NLRA 3M4XA 3SPYA 1AUSL 4WTOB 3RJMB 3K7RA 4HWIA 2WTUA 4CF8A 1TUGB 2HHHJ 4B3SK 3QO9B 3HVRA 4DR4K 4WPAA 1B9DA 4N77A 5KG1A 3IMQJ 3NGRA 3L3UA 2IJRA 1IXKA 1HNXF 1RA6A 3E51A 1NK0A 4QAGA 1H7XA 2GMJA 4FDFA 2OPRA 4RG8A 4M3ZA 3AO5A 1OPIA 1S6OA 1NJWA 1B0PA 3O9SA 1X5PA 3J7Z5 2OP5A 1HJOA 1ATSA 2F9JA 2FJXA 2HGNA 1QAYA 2D0PA 3MMAB 3ATUA 2VWKA 4JAXA 2ZH7A 4EEYA 2WOMA 2HNYB 1UAXA 4CEZA 3C7NB 4CHYA 2EXUA 4FPRA 1U25A 2NXJA 1Y5NB 3G6YA 4GO7X 3HVWA 2P5VA 4K41A 4B9TA 4BE0A 5CCMA 5I42A 3G71S 2VHGA 1XJWB 3EGVA 1K73O 3BGFA 5F8GA 4DV0F 3I55S 1AZSA 1PYTA 2Y1JA 5L39A 2ZD1B 4NYFA 1X5SA 2DD8S 5A8KA 1OSDA 4GKKF 5M1PA 1RCHA 3P49B 1EKRA 2WTFA 2DGSA 4JI2J 3V6DA 5BRHA 4FS1A 4DF8A 2YNIA 2DNLA 2HZCA 3BGUA 2IDEA 2WW4A 4J9NA 1T3NA 4B3SF 2D3O1 3RRKA 3QERA 1ATNA 2KN4A 5E7OB 2KVQE 2R8GA 3DOLB 4TLRA 4CERA 4NLYA 3IR7B 4RW8B 3VTHA 2ZBPA 2ZJQL 5KFDA 2FHMA 2YKAA 5TKWA 4HI1A 1CS4A 5M1OA 1HHQA 3GFXA 4HH0A 1Y9OA 4WWSA 3IKMA 1DLOA 1CJKA 4ZA1A 1ITPA 3S7RA 3SCJE 2EWSA 2HF4A 1KDNA <