4I2QA

Crystal structure of k103n/y181c mutant of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) analogue
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
molecule keywords Gag-Pol polyprotein
total genus 144
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i2qA05
3MXJA 2IC3B 1IKYB 4NLPA 3V6JA 3PR5B 3VQ9A 4IFVB 1RBVA 3DOKB 2BANA 2V4QA 2QXFA 3OYFA 4CHPA 3QZ8A 1WSIA 1TKXA 1RDRA 4NLWA 4RUCA 5HROA 4Z0UA 4RNMA 1JL1A 4F2SA 4FS1A 1L3TA 1J54A 1XC9A 3QEIA 5FDLB 3PUFA 2X6NA 2XCAA 1HJRA 2D3UA 2IBKA 4FBUA 1KSPA 4BE1A 4FJ5A 3GIMA 1S9EA 3M9MB 2ASLA 1UA1A 5KFTA 3H4DA 3NF9A 3CFPA 4CJLA 3GYNA 1J9AA 3GIIA 4WXOA 4DMNA 4CJWA 2HNYB 3SUOA 4WE1A 2R8JA 1C1AA 4NLSA 2VG6B 3LP3A 1HPZB 3FFIA 1RBUA 1K1QA 1SL1A 3RWUA 1TAQA 3PW0A 3I5AA 1T03B 4KB0A 3S3NA 3ZSWA 4MFBB 4L8RB 2YKNA 4LSLB 5I3UB 4BACA 4OLAA 2HHVA 1LAVA 4CHOA 1XHXA 5DGBA 4U6PA 3VQ7A 3RMAA 3RBEA 1JLBA 1JLAA 1KHVA 2DPJA 4MK8A 4IR9A 3DI6A 2XI2A 2G8KA 3K5MA 3PJWA 4OGCA 5KT4A 3SV3A 3QIDA 1X9SA 1HNVA 3PJXA 1BCOA 2ILZA 1NJYA 4M45A 4ZHRB 4E7KA 3M8QB 3BSCA 2ZD1A 2FVPA 3KK3A 4CJRA 5KRSA 2FJWA 4KAIA 1S0OA 4LH5A 2OH2A 1KVAA 3U3GA 4F4YA 2IGIA 2E6MA 2XGQA 4H4MB 1RTDA 3AA4A 4ZPBA 4LH4A 3MEGB 5KFZA 4CFAA 3KD5E 5KGXA 1KRPA 3PVXA 4PQUA 2XHBA 1JLEB 3TANA 2AWZA 3RTVA 4CJQA 3VQ4A 3LP1A 1T8EA 1L3VA 1QHTA 2WB4A 1EP4A 4ECUA 3NHGA 2O4IA 1RT2A 2DFFA 3TAEA 3H5YA 1RT1B 1LWCB 2FBYA 1JKHA 3ZT2A 5I42A 3SQ0A 4NLYA 4NLRA 2P5GA 1R0AB 4TY8B 4NCGA 3OL9A 1X9MA 4CJEA 3QGHA 3O3FA 2R8HA 3KTQA 4HCBA 1MU2A 3P5JA 1REVB 1EETB 1QE1A 1BQNB 4FLYA 2FVSA 4BE2A 2WRMA 1QAIA 4EBEA 4YNQA 5KFAA 2HMIA 3NE6A 3K57A 3V81A 3Q8SB 4IRCA 2HHWA 4ZPCA 1KLMB 3ZT0A 4E7IA 1W25A 5EWGA 1QAJA 4F8RA 4EP5A 1T05A 1JLGA 2FVRA 3IGNA 3NH1A 3V6HA 4IFVA 3NGZA 4CEAA 1J5OA 4NCAA 4M3UA 3LPUA 3OL6A 4B9MA 3JYTB 5DQGA 3EZ5A 3M9OB 1N48A 5J2QA 5KI6A 3RMDA 2E9RX 1JLFA 2JC0A 2BGGA 3I5BA 4G3IA 1S1UB 1U47A 3SNNA 3DLEB 5J2PB 4FBTA 3AVMA 4FJIA 2R2RA 1C6VA 2YNGA 1S0MA 4DSKA 4GMJB 3V1RA 5SZTA 5KGWA 1IKXA 4FXDA 2Z1JA 1ZETA 1KFDA 3OYDA 1A5VA 4MK9A 3ZSXA 4H4OB 3VQBA 1D9DA 5KG1A 4IKFA 4IRKA 2ATLA 2DFHA 3NF6A 3SPZA 5KFCA 1EXQA 2HVIA 1D9FA 2IAJB 1NNDA 2GBZA 5FROA 2R8IA 4OPKA 2VG5A 5L9XA 4CEDA 4J9LA 4R8UB 4QWBA 4ZVFA 1N6QA 3PX4A 3QEPA 4FZYA 4TN2A 2BQUA 3PO4A 3EPGA 2W42A 4Z4FA 4NZ0A 4KB1A 4N56A 1YVFA 5DMRA 5F8NA 4MFBA 3KHHA 1SKRA 4K4TA 4I2PA 2WONB 4FJGA 5F8GA 4GC7A 1VK0A 4ZMMA 3TAGA 5I3UA 4FJ8A 4ZP7A 4F4KA 1ZBFA 2HWHA 3CJ5A 4AHUA 1BQMA 3MF5A 4K50A 4CK3A 3KHLA 2FLLA 3PV8A 4QWDA 1NJWA 3CIZA 5HBMB 1HYZA 4M95A 2RKIA 1IKVA 1N4LA 4J2EA 5KG3A 1RTIA 1U45A 4FVMA 4OVLA 4NYZA 4PWDB 3OYKA 3KOAA 1S1WB 3NAIA 5DGAA 1O1WA 3QESA 3QO9B 4NYNA 4Q43A 1D0EA 1JXLA 3UPFA 1L5UA 5J1EA 5KFRA 4O3RA 5DQHA 1JLCB 3UR0A 1EKEA 3CM5A 2F8SA 3Q8RB 4CEZA 4KHQA 4CJ5A 2HAIA 4FJNA 5EUHA 3BSOA 3BGRA 2DTUA 4R5PA 2OPRB 1ASVA 2QKBA 2C2EA 3VQ6A 1BHLA 4ECZA 5HLFB 4QAGA 3H2LA 4ED6A 4RNFA 4CJKA 1JLFB 3DOLB 3DLEA 5J2PA 1LWCA 3PW5A 3K5OA 4O0IA 2XI3A 5I42B 1EP4B 1RT2B 1LWFB 2W9CB 3TAMB 3AO4A 3DYAA 5FDLA 1S1VB 3BSNA 4NLOA 3H4BA 1TL3A 4O3OA 3OSPA 1CSJA 1RA7A 3Q8PB 3B6PA 1SUQA 1WN7A 3KJVA 1BQNA 5KFVA 2DFEA 4K8ZA 3SZ2A 3GV8B 2HMIB 3T5HA 5FRNA 3AA2A 3THVA 1NK5A 1NK0A 2PYJA 3OHBA 1VRUB 3V81B 3MR5A 1N6QB 4OLBA 3KHRA 2Y1IA 3KLFA 2AGOA 4O4RA 3CM6A 2BE2B 2ITGA 5KFIA 1TKZB 1YTUA 1QS4A 2WONA 2GIQA 4LY7A 4K4XA 3FQLA 4RNNA 1U49A 4O0JA 2ZE2A 4QWEA 5J2QB 3QERA 1DTQB 2O4GA 3T1AA 2UVWA 4LQ3A 4J2BA 3OYIA 4W5RA 3HP6A 4EYHB 4EYIB 4Q0BA 3DRPB 1B92A 4ED3A 4J9MA 2IM2A 4RW4A 3AVAA 4DS5A 5C24B 3QIOA 2WHOA 1Z4UA 3MR3A 1NKEA 3B6OA 4ECXA 2J6UA 1ITGA 2JLEA 4CF1A 4I9LA 4Q8FA 3UIQA 2YKMA 1C1BB 2FLNA 3SFUA 5KFPA 5D3GA 1KTQA 2D0AA 2HHTA 1WSFA 5CYMB 3LAMA 1RYRA 3V1QA 4I2QA 1FK9B 3L8BA 3MXIA 2Y1JA 2BR0A 3G10A 3OLAA 3BGRB 4CESA 3HXMA 1C0UB 3NF7A 4J9OA 3QNNA 4C8MA 3K58A 4CK2A 2F96A 3C6TA 2HNDA 1W0HA 2JEGA 3LDSA 2RKIB 5DG7A 4JS4A 4IQXA 1TL1B 3NAEA 2CKWA 2W9CA 4OKJA 5HRNA 5KG7A 4F50A 4ICLA 3JSMA 4ZP6A 3LAKA 4FLXA 3DMJB 5KFUA 4KHMA 2XO7A 1RT5A 3P83D 1TKTA 2A1SA 1RT7A 4E1MA 2KQ2A 3KLEA 2ETJA 3G6YA 1S1WA 1IKWA 1TKDA 2R2UA 1RBSA 2ATQA 3IG1B 1QE1B 3HSTB 2R7YA 3LWMA 1RYSA 4FJMA 4KB7A 3ICLA 5EU7A 2P51A 5J1EB 3DRRA 4R5PB 3N6NA 4IG0A 3IS9A 3GV5B 4DTNA 3CDEA 4H8KA 1BGXT 4PA1A 2UUTA 1NK8A 5HLFA 3I0SA 3OL7A 1RT6B 3ISND 4AHTA 4ID1A 5F8LA 3V9WA 3VA0A 3NBPB 4IRDA 4M3RA 4EP4A 1WSJA 2DY4A 1GX5A 3O4NA 3U6FA 3T3FA 3KD1E 3OYCA 1S49A 2OPSB 3VQ8A 2P1JA 3AVBA 2YNGB 4CF9A 1NK9A 1MMLA 3DRPA 1IG9A 1IKXB 1SKSA 3H5UA 4K4ZA 4FK2A 4KO0B 2BRKA 2E6LA 4H4OA 4BWJA 4N5SA 2KZZA 2XCPA 4W5OA 3HVAA 3MXMA 4CGIA 1TK5A 3S3MA 4J9RA 2XRIA 4CGDA 4FLZA 2OZMA 2X74A 3KLFB 1RNHA 4DTPA 4XPCA 4KPYA 3V4IB 4CEBA 4FM0A 2X6SA 1BCMA 3A2FA 3AVFA 4R8UA 5CZ2A 1NK6A 1HMVA 3V9SA 4ELUA 4FK0A 4FJHA 4W5TA 2IS3A 2IM1A 4FLVA 4QW8A 2ZE2B 5KG2A 4TY9A 4K4YA 1IH7A 1I6JA 5KRTA 3QNOA 3NMAA 4AHRA 3C95A 2YHBA 1SH2A 2QE5A 2I1RA 1JL2A 2R8KA 2VG7B 3DM2B 4B08A 2QKKA 4CIFA 4F4WA 1RTJB 4KAZA 5DLFA 4JS5A 4Q0BB 4KV8A 4F3OA 4RUAA 3QGGA 4NRTA 4CE9A 1HNIA 3L2WA 5JUMA 5C24A 3HT3A 3BQ1A 1VSJA 4AHSA 1BI4B 1L3SA 4N76A 3VQQA 5KG0A 4DFMA 3SPYA 4JRQA 3AV9A 3ZSVA 3HVRA 2HNZA 3OS0A 4KTZA 3MEGA 3O3GA 1GOAA 4NLGA 3DLKB 1S6QB 1T94A 1C1CA 2YNFB 4FLTA 3ITHA 2R8GA 4B3OB 3HKWA 1TGOA 3C6UA 3FSIA 3RB0A 4Q8EA 3DLGA 5EWEA 2IJNA 2I5JB 1KFSA 1SL2A 5DG9A 3U3YA 1LW0A 1TL1A 3QEXA 1K1SA 3ZSYA 1TVRB 3RBDA 4ED2A 1L3UA 3T19A 3E01A 1DTTA 4TQSA 4OL8A 1RBRA 3KLEB 2C2RA 1S9FA 5JS1A 3CWJA 1XR6A 2W9BB 2BDPA 3ISNC 3OYBA 4DFKA 4IG3A 4CJ4A 3FQKA 2YNIB 4HKQA 3ZSOA 1IKWB 3D5MA 3BQ2A 3T5KA 1U48A 4IH7A 1NJZA 4FW1A 3V4IA 4DSFA 4U7CA 3I0RA 4CEOA 1VSKA 3I0SB 3BQ0A 1HPZA 3NAHA 3OJUA 3NBPA 2B5JB 4ECQA 2R2TA 4MIBA 1SV5A 4O3PA 5KT6A 2AX1A 4DQRA 4ECVA 4KFBA 2YKNB 4LSLA 4YP3A 3DLBA 2E9ZA 4ID5A 1D1UA 1KHWA 5J2NA 4HUEA 1WSGA 4IBNA 3OS1A 2B6AA 4TLRA 3PY8A 3QETA 3AVHA 1Y97A 3G86A 3S3OA 4E3SA 2IAJA 1ZTTA 1JLAB 2XGPA 2CJQA 2C22A 2EC0A 4ECSA 2G8VA 3M8PA 4RW7A 2JGUA 3HVTA 5K14B 1UWBA 3SQ4A 2B43A 2WK4A 2RF2A 4ZHRA 1S4FA 4NLTA 4RNOA 4M3XA 3GIKA 3TABA 5F9LA 1GOBA 4ZP9A 3GILA 4O5BA 2RPIA 4QOZB 4J9KA 4MK7A 3SYZA 5KFLA 3KLHB 5T14A 3QLHA 2GIRA 3CJ2A 1HMVB 3CJ4A 3L2VA 3WNFA 1S1XA 4GVMA 2JEIA 3O3HA 2J6TA 3NFAA 3SQ2A 1A5XA 1JX4A 4E7LA 3DRSB 4RW8A 4I9QA 2I5JA 4B9VA 4LSNB 4EZ6A 4XIUA 1LW0B 3KK2B 3RRHA 1TK8A 1R0AA 4NLXA 4TY8A 1S48A 2W8LA 1I3AA 4CHQA 4HTUA 2FBXA 1MU2B 4O3SA 4E89A 3AA3A 1EETA 2XC9A 2HNZB 4K4SA 5CYQA 4IG3B 4BDPA 3KK3B 3BSAA 3VQEA 3MEDB 3VQDA 1FKPA 1S9GA 2G8WA 1RT4A 1GX6A 3L3UA 2IDOA 4KHSA 1NOYA 4DL6A 5JXSA 4QCLA 1QUVA 4B9NA 4HHTA 4H4MA 1HRHA 2KTQA 2YNFA 4CGFA 2HHUA 3VQ5A 4HVJA 3VQSA 2JEFA 3TARA 4B9LA 1JLEA 2NUBA 3TVKA 1T3NA 2IOCA 1ZBIA 4AILC 2OPQB 1J5OB 5JS2A 5KFHA 4DQSA 1XR7A 3NL0A 3AVNA 3KKSA 3E01B 3DYAB 3ZT1A 1ZBUA 4M3WA 4ZTFA 2YNHB 1RT1A 4TXSA 2W7PA 4KBIA 4DU3A 1B9FA 4ZP8A 4E7HA 1HYVA 4CF0A 1REVA 2W9BA 4Q5VA 1CXQA 5KG4A 5KFBA 2DPIA 5EDWA 2XY7A 4ECWA 4E1NA 3RR7A 1NJXA 4DQIA 3HO1A 3OS2A 1JIHA 2D7SA 1LAWA 4ZVGA 1DLOA 2RN2A 4FYDA 1F21A 4PUOA 4RW9B 3AO2A 4BDZA 2PYLA 1LWEA 4J2AA 3I0RB 3NKYA 4DEZA 2E4LA 3HPOA 3PX6A 2P5OA 3IRXB 3T5LA 3PW7A 4OKEA 2HVHA 4FJ9A 2B5JA 3V9XA 1VRTB 3HHKA 2Z1HA 1ZBHA 5KTQA 4UQGA 3O4QA 3ZSRA 2B6AB 3DDKA 4E0DA 4CERA 1QTMA 3V6KA 1BIZA 3CDWA 1Z25A 3FDSA 4Z4EA 4EEYA 4Y2CA 1SH3A 2QK9A 4CEEA 3M8PB 4AHCA 4URGA 1S10A 3AVGA 3SUNA 4QWCA 3NF8A 3AO1A 3NGDA 2D0BA 4DWIA 1FXXA 3LZIA 4IH5A 4XPEA 3ZCMA 4M3YA 4EBDA 4KREA 3MEEA 2VG5B 3SQ1A 4PWDA 3KLHA 1X1PA 4GC6A 5DG8A 2OYQA 2UVUA 3KK1B 4QPXA 3QLHB 3CVKA 1JLCA 5KFDA 3SCXA 4KHRA 4I2PB 3RMCA 3C6TB 2FC0A 1IO2A 2JC1A 2OPRA 4IFYB 5CZ1A 4RW8B 3M8SA 1WSEA 4KI6A 3KLVA 2V0NA 4Z4HA 3JSMB 2IM0A 4O44B 3TWHA 1RDDA 1NOZA 3LP2B 5J2MB 5F8IA 1SUQB 5F9NA 1U4BA 4IDKA 4H54A 1NHUA 1DTTB 1S1VA 3GIJA 4FJKA 2UVVA 4ZPDA 2G8IA 4YR3A 1FKPB 1S9GB 4CFDA 1C0MA 4IH6A 4KKOB 2FVCA 5KFYA 3CO9A 4KSEB 4FLUA 2BANB 4AH9A 2G8FA 2BE2A 2IC3A 3MR6A 4MKAA 4Y34A 3CYMA 1T03A 4OJRA 4DL4A 3LALA 3QZ7A 1VRTA 5F8HA 4FLWA 2KFNA 4ED1A 2KFZA 2ALZA 1SKWA 4C8NA 4EO8A 3HPGA 1DTQA 3DOLA 2F8EX 4Q45A 1D8YA 2OPSA 1TV6B 4RW6A 1VSFA 1A5WA 4TYAA 4FJXA 4WFYA 3CFRA 4DF4A 3OJSA 2W7OA 2WCXA 2YV0X 3K2PA 2HHSA 2ZQBA 4DQPA 1ZTWA 1KLNA 1FKOA 2GC8A 4YFUA 3HVTB 4CJVA 4DG1A 4PUOB 1VRUA 4G1QA 1GOCA 1S0NA 2E9TA 3AVKA 5KT5A 2RF2B 3WNEA 5HP1A 3AA5X 3SI6A 1XR5A 3ZT3A 3BR9A 4PQUB 1VSDA 4KHWA 3N6MA 1UOCA 4DL7A 3H5SA 4B8CA 4FW2A 3EPIA 5F8JA 2UVRA 1X9WA 1N5YA 4DFPA 4DSEA 1C0UA 2VA2A 4M42A 2O5DA 2BRLA 1RTJA 4Q44A 3MFIA 1TP7A 2AU0A 1D5AA 1RBTA 4GW6A 2KW4A 4O44A 1OS5A 3TAQA 3ULDA 4LSNA 3UQSA 4J9QA 1ZYQA 3K5LA 4M3ZA 2C2DA 4HUFA 3AVJA 4DTMA 3VA3A 1HNVB 3LANA 4M94A 3NH0A 3QIPA 5KG5A 1B9DA 1Z26A 4DU1A 4HYKA 4F4XA 4C8LA 3V1OA 1RAJA 1RT5B 3N6LA 4KHYA 1SL0A 4ED7A 4K8XA 4KKOA 2YKMB 4ZVHA 3OHAA 3MEEB 5CYQB 4OGEA 1NK4A 1T7PA 1SH0A 2WOMB 2F8TA 1JXEA 3IG1A 3FRZA 4CJSA 2JEJA 1JLQA 3ITHB 4BE0A 2AX0A 3IAYA 3H40A 3H5XA 5KG6A 1WNEA 4IG0B 3C6UB 3MAQA 1QQCA 2OPPB 3JYTA 1RT3B 2XY5A 1RT6A 3KNAA 4JV2A 4WZQA 2FBTA 4KI4A 4DTOA 3SI8A 3VQCA 2HNDB 4DLGA 1S1UA 4DL2A 2OPQA 4ELVA 3LP1B 1HQEA 1VSIA 2IA6A 4DQQA 3RB4A 4B8AB 4ZVEA 3NDKA 3V9UA 3DMJA 2HHXA 4BDYA 2GUIA 4X2BA 4KO0A 5L1KA 4XO0A 4K4WA 4FS2A 4NCBA 1RT7B 4CGHA 3AO5A 3KMSA 3PR4A 1RDAA 4WYLA 3WNGA 3QEVA 4FZXC 1C0TA 4CF2A 5DQIA 3SUPA 4OKKA 4NRUA 5KFEA 3OVNA 3MECB 2HNYA 1JLGB 1NKCA 4KE5A 3DRRB 3D0PA 4J2DA 4O3QA 3KLGB 3HJFA 3TAPA 4RW9A 1UA0A 3OYJA 4CJTA 5HRPA 5C42A 4DSLA 5KFMA 3OYHA 2G8HA 1HQUB 4DL3A 4PY5A 1TV6A 3V6DB 5HBMA 4DTRA 3OYLA 2V9WA 3TAFA 2D3ZA 1RILA 2IMWP 4YQWA 5L1LA 3RAQA 5K14A 1UWBB 4WXWA 3NGYA 1CXUA 1RTIB 4LD0A 3BREA 2VWJA 1TQLA 2PY5A 2FLPA 1I39A 4WZMA 3LZJA 4JUZA 3KHGA 4DU4A 3PZPA 3SUQA 1FKOB 4TSXA 1KCFA 1W9HA 5HP1B 4F3TA 3M8RA 3M8QA 3BJYA 3PO5A 4BWMA 3MFHA 5E41A 3QYYA 2WOMA 3K59A 4M41A 5HRSA 1S1XB 3I5CA 3VN5A 1S6QA 1S97A 2A1RA 1BISA 4FCYA 3C94A 4J9NA 3SV4A 3ZSZA 3HP9A 3PX0A 1TK0A 3CG7A 3G6XA 4Y1DA 3HK2A 4OPJA 4MQ3A 5KFSA 5FRMA 4E7JA 2EX3A 4DS4A 3DLGB 2YHAA 1N5YB 2VG7A 3DM2A 5KFOA 1IKVB 4NYFA 3KK2A 1HQEB 3TQ1A 2VWKA 4B9UA 5L1IA 3IGVA 4QWAA 4JV0A 4CHYA 5L1JA 3UDLA 4KTQA 1TVRA 5J2MA 2Z1IA 3QIPB 4W5QA 1LV5A 3HL8A 3RR8A 1QSSA 2OZSA 1XWLA 1BI4A 3RMBA 2ZKUA 4CF8A 1RT4B 2Z1GA 4K4VA 4AHVA 3NGIA 4TQRA 1RDBA 3MR2A 2UUWA 3CJ3A 4ZPAA 4K4UA 1S6PB 3ASMA 3KLIB 2IM3A 2LSNA 3HYFA 5DLGA 3CDUA 1KLMA 3DOKA 1YTAA 2OPPA 3DLKA 1JLQB 2RDJA 1K6YA 4MKBA 5CY4A 3PHEA 3SFGA 1SV5B 4CJUA 4CK1A 1RT3A 4O4GA 4R0EA 5F8MA 3EY1A 5T7BA 2XWYA 3HVWA 4YMEA 4IR1A 5C42B 3OSNA 1RTHB 1TL3B 1S9EB 1XI1A 4CGGA 1LWFA 3KMQA 4I7FB 3H08A 3KJVB 2FJXA 2WTFA 3G0ZA 4FK4A 4ID5B 5KFXA 3VQPA 1WAFA 4FJ7A 3L2UA 4RZRA 4RW4B 3QEWA 3QGIA 4M3TA 4CFBA 4Z4GA 1IM4A 4F4ZA 4DSJA 5KFNA 2ILYA 4CEFA 3AVLA 1C0TB 1CZ9A 4CHNA 2VG6A 4RW7B 3BDPA 4CGJA 3FFIB 3MECA 3G6VA 1NHVA 4DLEA 4ELTA 2AGQA 3IRXA 4G1QB 3LWLA 4EZ9A 1XHZA 1FK9A 1TKZA 3NH2A 1CZBA 1G15A 3KLGA 1NKBA 3OLBA 3RB3A 3M9NB 4E19A 4J9PA 4URSA 2HW3A 3L2RA 5KFJA 4J9SA 1VSHA 4URQU 4Y1CA 4KFBB 4CJPA 3E51A 1VSEA 3KIOA 4CFCA 1BIUA 1S1TA 3DRSA 5J2NB 1WSHA 3L3VA 1HYSB 3V6DA 3Q8QB 2HWIA 4CHZA 1U04A 4YR2A 1WLJA 5C5JA 3ZSQA 1TKTB 2GV9A 4NLQA 4NLVA 3LP0A 5D3GB 4FM2A 3KKRA 2ASDA 3D28A 4ECTA 3MEDA 4LQ9A 2AGPA 3CJ0A 2R2SA 1ASUA 3VQAA 1C1BA 5DK5A 2B4JA 3TR8A 3H59A 2AQ4A 1RTDB 5C25A 5CYMA 2BQRA 4DTUA 5KT3A 2RDIA 1VSLA 3PW2A 3L2QA 1U09A 2PZSA 2V4RA 5KFGA 4IKAA 4MH8A 3OYNA 4JRPA 1UAXA 3RAXA 1BL3A 4DSIA 1TKXB 1EX4A 3CFOA 5EWFA 1QSYA 5KFWA 1Q9YA 3P1GA 4CJFA 4DL5A 2G8UA 5SWMA 4KRFA 3EZUA 5HROB 2IJFA 4ICLB 3LP2A 1RTHA 3DLHA 1LW2A 4ZTJA 2YNHA 4N47A 2FBVA 2XY8A 4NCGB 3AO3A 3QINA 4IDKB 2W9AA 2J6SA 3WNHA 3V9ZA 3TAMA 4JV1A 3ZT4A 3S9HA 2XY6A 4ECRA 4Z4CA 1S6PA 3OYEA 3KLIA 4ED0A 4CECA 1Q9XA 4WE1B 4NLDA 3PW4A 4W5NA 5KT2A 4MIAA 3TI0A 3IS9B 1CLQA 3GQCA 2KZMA 1DLOB 1T05B 3OYAA 3MTKA 4CJ3A 3RRGA 1S5JA 1IKYA 4JLHA 3RB6A 4F2RA 4Z4IA 4NLUA 4QW9A 4CCHA 4ED8A 3K5NA 3H98A 4O4GB 5KT7A 4FM1A 2Q3SA 2BQ3A 3SJJA 1KVBA 3IN5A 2X78A 1ZBLA 4WYWA 4I7FA 4KHNA 4RW6B 5HRRA 3AVIA 4HUGA 1HYSA 3DLRA 4IOBA 1HQUA 4DF8A 1Q8IA 4FJJA 2D41A 3DI6B 4KV8B 4HCCA 3OYMA 1JLBB 1YVUA 3ALYA 3F9KA 4ECYA 2W8KA 3HPHA 4DTXA 4N41A 4CIEA 4O3NA 4O55A 2D5RA 2C28A 4DG1B 5KFKA 3HM9A 3I8DA 3D45A 5C25B 3LPTA 4EBCA 4CEQA 5KFFA 1C2PA 1LWEB 4WFZA 1QSLA 2HHQA 4RG8A 4I2QB 3AVCA 4TYBA 3EYZA 3KK1A 4RNHA 4C8OA 4KHUA 2QV6A 3OL8A 4KTWA 4B3OA 1HARA 4CIGA 4FZZA 1WNSA 1BQMB 2VA3A 3OY9A 1NK7A 4B9TA 3CQ8A 4IFYA 1JXBA 1LW2B 3T5JA 1S1TB 2ASJA 1HNIB 1N56A 4EO6A 4C8KA 3F73A 4DTJA 2HB5A 1RDCA 4B9SA 3LP0B 1WAJA 2EHGA 1JKHB 4Y3CA 3OYGA 1J53A 1KVCA 4DTSA 4Y2AA 4WFXA 4RU9A 1RCHA 1TAUA 4DFJA 3QO9A 3GV7B 2FVQA 4YR0A 2ZD1B 2FJVA 5KFQA 1ASWA 1VSMA 2YNIA 2OA8A 1YT3A 3NCIA 4FJLA 2AJQA 2D0CA 1C1CB 1RA6A
chains in the Genus database with same CATH superfamily
4NMLA 5IM0A 2IC3B 1IKYB 4NLPA 3V6JA 4IJNA 5HQMA 5JVGQ 1FCAA 4CO1A 3DOKB 3TSQA 5IC4B 2QXFA 2A0FB 5HN0A 3DLJA 1B3TA 5C2DA 2X1FA 1RDRA 1G6BA 1E6VA 3ZZOA 4F2SA 2Q97A 1J54A 1XC9A 5L46A 2O8CA 2X6NA 2XCAA 1ROFA 2D3UA 4FBUA 3TZYA 3DGPA 3GIMA 2ASLA 3M9MB 5KFTA 3KWGA 3NF9A 3TA2A 1FJ7A 3BS9A 1H98A 3X3UA 3OR1B 4K0KK 5KOWA 2HNYB 1OKJA 5DDOC 1M5KC 3Q7CA 3FVYA 4ILLA 2O8BB 3OTOJ 4ANEA 1K1QA 2OEJA 5DS7A 4KB0A 4BQLA 3S3NA 4USMA 2QI2A 1K8KB 3PLAA 4JKHA 1BHNA 1V6HA 4NYOA 4B3MJ 2C3UA 5I3UB 4BACA 2HHVA 4IZ9A 1PIEA 1D3WA 3RMAA 3QT7A 2VOPA 3RGIA 5AQVA 4X4VA 3AJ2A 1SC3B 3DI6A 2XI2A 3K5MA 2AJFE 1X9SA 1EO1A 2VPYB 2LYVA 1HD0A 2MZJA 3MPYA 3H45C 2VOOA 4KJIA 1NMDA 1VIXA 2GWJA 5KRSA 4KAIA 4LH5A 3MM8A 4F4YA 2E6MA 1UCNA 4RBTA 1KQSR 3PRDA 2K3KA 5KFZA 4BC5A 4ZLLA 1T3VA 4CLLA 1NDCA 4PQUA 1LWXA 4C11B 3O8WA 2WB1D 1K73O 3S01A 2AWZA 4DV1F 2BJ1A 1L3VA 2MKHA 1EP4A 1NXIA 2O4IA 1RT2A 2DFFA 3N4PA 2Q0UA 1UEUA 4ZVQB 1LWCB 2FBYA 5A76A 5I42A 2VQEF 4NLYA 4NLRA 3HM8A 4NCGA 3OL9A 3J81Y 3DFEA 3H20A 3KTQA 4UUXA 2N7CA 1R0BG 4IEEA 1REVB 4U95A 4DR1F 1W2BR 4BE2A 1CVJA 4YNQA 4FF4A 3K57A 2E1RA 1KLMB 4ZPCA 1W25A 3CF5L 4PRFA 1MMNA 5BJRA 2J9DE 4NCAA 4M3UA 2FC8A 2D4WA 3M6XA 3NWRA 2UXCK 2UUBF 1ZZNA 3D1QA 4CP5A 2A42A 4FKYA 3RMDA 2E9RX 1JLFA 2JC0A 3CD5A 3TEHB 4JNEA 3I5BA 4F3QA 4FBTA 1UPMB 5C0YA 1U1PA 4DX7A 4IO9L 3BZCA 3AXMA 4DSKA 4GMJB 2Z57B 2Z1JA 2VL1A 3GJRB 5A2QY 3R1XA 2YPZA 4YHHF 4MK9A 2V51B 3VQBA 4RU2A 1U0SA 4IKFA 2QLFB 1S3XA 3HHEA 2HVIA 4IO1A 4V19X 2VG5A 5L9XA 2HS0A 4HTJA 4JYAJ 2FIUA 5FPNA 5FJ4A 3PX4A 4FZYA 3EPGA 3MOZA 2ITMA 4KB1A 1YVFA 5JVGL 4ETXA 3QSIA 5F8NA 3J80O 3NVMA 4K4TA 4I2PA 2ASMA 2WONB 3T6BA 5HO4A 3GSIA 3O9SA 4FJ8A 4ZP7A 2GZOA 4OJGA 2CGLA 2HWHA 3OR2A 1Z2LA 1GXTA 4A57A 2BE7D 4K50A 2BUPA 2JZ5A 3PV8A 2FLLA 4QWDA 1BWFO 1HYZA 2DNQA 1NRKA 5HL7L 4GY2B 3J7YU 2O8EA 2DNYA 1N8RT 1VQSA 1HKGA 1T6CA 1XUPO 3O5BA 1SIWB 1HHQA 1U0HB 1HQ2A 3OXGA 4X64K 3H42A 1RAIB 4OVLA 2MQMA 2ZZMA 3KOAA 2DR7A 4FO0A 4AM6A 3B4DA 3GP9A 2KXFA 3AXKA 4ZVUB 4DUYF 3UPFA 2XYGB 1FDNA 4O3RA 3UR0A 3CM5A 3CXCM 2F8SA 3QFPA 4CH1A 3VAJA 2EC2A 2DTUA 4R5PA 1ASVA 2C2EA 2PE8A 3QB0A 4ECZA 5HLFB 1KC8O 2CQ2A 4ED6A 1BG3A 3UDVA 2E7WA 3DLEA 3ZZZA 1PYOB 3U8XA 5I42B 1T9VA 1LWFB 5FDLA 2KFYA 2YKQA 4E8UA 4NLOA 3BSNA 4CO2A 2O3DA 3OSPA 1CSJA 3Q8PB 3B6PA 1SUQA 2RU9A 3ULEB 2R7QA 2VJVA 5A0YB 2B9WA 1BQNA 2CPDA 5KFVA 2DFEA 1FNOA 3A5MC 4AQYF 2HMIB 5BRDA 3ONQA 3MOJB 1NK5A 2M70A 1UFWA 3D2FA 4BG9A 1RCXB 2PYJA 2BKNA 3CCQS 3V81B 3MR5A 4H0PA 2KM8C 4OLBA 1QHAA 3KHRA 4P2FA 1LOUA 2HFNA 1FHTA 1RP5A 2JWLA 4PXBA 3D1HA 3FK4A 1QS4A 3NG8A 1RLDA 4AL7A 1YJVA 4A8WA 4RNNA 2ZE2A 4LFBF 4GO5X 3CCUN 1DTQB 1DKGD 3HHNB 2UVWA 2LDIA 1FJGF 2DTJA 3T1HF 4EYIB 1ZM9A 4NXMF 3R7NB 3DRPB 3A3NB 4RW4A 1R3NA 3AVAA 3QIOA 2WHOA 4I6MB 1NKEA 3B6OA 2AT1B 3KYLA 4ECXA 5L38A 1ITGA 2OFHX 4I9LA 1VQLS 3R2DJ 2CZ9A 2MHEA 5LOQA 1B70B 2FD2A 2D0AA 1WSFA 5CYMB 4ISGA 3LAMA 1RYRA 1FK9B 2CPEA 2Y1JA 1RBOB 3G10A 1DQ9A 3OUYA 1LNQA 3BGRB 4CESA 3FC9A 2NUHA 4DJBA 1X4CA 2HG4A 4DV2K 2BM1A 3NCRA 2HNDA 1W0HA 3M6UA 3MM9B 3G87A 2W9CA 3KUGA 1GMVA 1P1TA 2KL8A 3D6HB 2KM8B 4ICLA 5ADXA 2IVFB 1N36F 3JSMA 3A3OB 4GVBB 4FLXA 4KHMA 1HL6A 1PC5A 3FZ2A 2LKZA 5HMZA 4DX8H 4UZCA 4DXLA 1HKBA 4OJ1A 1YKWA 2ETJA 1XBWA 2DR9A 1S1WA 4QU6A 4PYAA 4A5BA 2P51A 3PYDA 4MDBA 3JXOA 2ABYA 3P31A 4MAKA 4LBIA 4CZGA 3CCUS 2D3OR 3R7BB 1P27B 3CDEA 2YCHA 1V4TA 2QFJA 3OL7A 1RT6B 4DN9A 4AHTA 3G8SA 3BO2A 4M3RA 1KAYA 1WSJA 3W2WA 1NJIO 3FZLA 1HBNB 2XZTB 1Q8BA 2OPSB 1YX2A 2YNGB 1NK9A 3NGKA 2AMCB 1IG9A 1IKXB 2FGCA 2ZWPA 4K4ZA 2D1KA 2Q6CA 2VFSA 4H4OA 4N5SA 3G9CA 3HVAA 4X62F 4CGIA 3GCXP 4YS2A 2OZMA 4U7BA 2CAJA 1P9YA 2FJDB 4KPYA 2HURA 2ZHAA 4JI7F 4FM0A 5GIOA 3TZXA 3JQMA 4WBFA 3PYFA 4QW8A 2ZE2B 4K4YA 1IH7A 3QNOA 2MLXA 1QJHA 2FPHX 1JL2A 2VG7B 2VZ9A 2H9ZA 2VQFF 2QKKA 2ZOMA 4CIFA 2V8VA 4TKTA 4WJBA 5THWA 3IAM9 2RHSB 2ZGYA 1RTJB 3HSZA 4KAZA 2QX0A 1N8RO 4JS5A 4GV6A 4Q0BB 3CCRS 1M5HA 3DRYA 1P8ZA 4LF5K 4WF9Q 1KQFB 4PXCA 2FJAB 3BQ1A 4AHSA 2AA4A 4AUKA 5CZVA 1S7HA 4N76A 4GKJK 4CLUA 1FD2A 3VQQA 4DFMA 3IFEA 4JRQA 3AV9A 3ZSVA 2WFBA 1EAYC 2LECA 4DR6K 2FQQB 3J8AA 1T0TV 3ENOA 1KD1T 3G25A 1YITS 1U25A 2UXCF 1S6QB 2NSBA 1NGFA 1T94A 1X5TA 4LF5F 4HACA 4PAAA 1LKZA 4B3OB 1Q86T 3H8YA 1TGOA 3AJDA 2FTRA 2IJNA 3KG4A 1Q78A 4C2MA 1SL2A 4KPCA 2E5LF 1LW0A 2JWNA 3BN7A 5LT5A 1L3UA 3T19A 3I8BA 4TQSA 4OL8A 4NPOA 3E3XA 5LSLA 1VBZA 3KUHA 2EG2A 1XR6A 2OIHA 2DY9A 3ISNC 4X4SA 3ZX3A 5DDRC 2OCEA 3PHTA 4HKQA 3ZSOA 3M2UA 3D5MA 1YLXA 3BQ2A 3ZNJ1 1NJIT 1U48A 2J0WA 3MUMP 2DNOA 1NJZA 1YI2N 4DSFA 1GLBG 5D0RA 4M5KA 3NCPA 2UUAK 3AAWB 3AOAA 4UZBA 1S6UA 4ECQA 2R2TA 4MIBA 3MMBB 4UY8O 4BRKA 1X7VA 4DQRA 1RTZA 2IYGA 4KFBA 3M1VA 3DLBA 2E9ZA 1VQYA 3EZOA 5J2NA 1AXQA 3OS1A 4X4NA 3CJ8A 2H1YA 2UUBJ 3QSYB 1AUDA 2QWPA 4E3SA 2IBOA 5AQMA 1BA1A 2C22A 4KHPK 4ECSA 2G8VA 2JGUA 4JI3J 3KJNB 4A4JA 2B43A 3RW7A 3N4QA 2BA9A 2RF2A 5AFUA 3GIKA 3C6AA 3HI0A 3CJ2A 2YVSA 4KH4A 8AT1B 4HDHA 8RUCA 1SKUB 3L2VA 3WNFA 4I67A 1N54B 2R7XA 2JEIA 2LFVA 5DM7Q 1TL7B 5LJ3Y 3DRSB 5BPMA 3UD5A 3MMCB 4TVAB 4B9VA 4GV9A 2CJKA 4EZ6A 2QTDA 1QVFR 2WVCA 3G4SS 2GV1A 3UKUA 3NY0A 1YHQN 3M8YA 2AF6A 4OYIA 2W8LA 2UYTA 2XTJP 4FWQA 4N8NA 4CHQA 4O3SA 2CQHA 3O1LA 2FDNA 3GE9A 1VC5A 2ZHBA 1RT4A 2G0JA 2PEHA 2JWKA 4DL6A 5I3PA 2FZCB 4A8FA 5CE3A 2KTQA 4HACB 1WC4A 4L3KA 2HHUA 3VQ5A 3W3SA 1ITPA 1KN6A 4P7VA 4B3MF 3TARA 2JEFA 1JLEA 2IOCA 3QQCD 4YDUC 2P5VA 2Q36A 4DQSA 4CLZA 5B0DA 4YDDB 3ZT1A 1ZBUA 2NLXA 4WQ5C 2FZKB 2ZH8A 1RT1A 2P8IA 3QATA 2HBKA 4LUBA 3MN7A 1R6YA 4KBIA 3CJ1A 3ZTQA 4KH6A 1VQPS 1CLFA 1BE4A 4ZP8A 1JJCB 1VIOA 2XS2A 4E7HA 2W9BA 2YJFA 1XNRF 5KFBA 1N33K 3VVUA 1YF5L 2BBEA 4DQIA 3SQGB 1JIHA 2D7SA 4ZVGA 2C2KB 4C6AA 2NUUG 1T9WA 4RW9B 2EW9A 3VGMA 1U2FA 2YWKA 3I0RB 2PYLA 4DEZA 3HPOA 3PW7A 1FDBA 2L3MA 1NH8A 4WFNQ 1ZBHA 3O4QA 3NXZA 3ZSRA 1W7WA 1GK8A 1WELA 3OPKA 3BKUA 3HD1A 3ZLJA 2ZBRA 4Z4EA 4Y2CA 4LFBJ 1SH3A 4OYBA 4AHCA 2AD9A 1HI8A 5KAKA 2JJ4D 2C2NA 3QWUA 2G0CA 3LZIA 4IH5A 1FF2A 4W90B 4LFAF 1R0CB 4NXMJ 1N88A 2DVIA 1SXLA 3SQ1A 2A18A 3KLHA 2L9NA 3TA1A 2R7WA 2QFIA 2CQ4A 1ICEB 5AE2A 4IFEA 4ER8A 2Y1RI 1V3SA 3HHLA 5HVFA 3M2RA 3MWTA 1U1QA 1JLCA 3ID6A 4FVCA 5M1KA 4I2PB 4LREA 3TTFA 2JC1A 3MM9A 3AA8A 3O9TA 4HI1A 4KI6A 5AXLA 4ES2A 1IN0A 1X4HA 2GMJA 4O23A 1SUQB 3G71S 4BRPA 3R8YA 1IBLK 2OI2A 5AXMA 1S9GB 1IVZA 1NU0A 1NH7A 4DV2F 4M5GA 4U9RA 2XLJA 5AJ3F 2KJWA 2QWNA 4C3LA 4WP9A 3LDQA 4AH9A 2BE2A 4MKAA 3ZTRA 3F9MA 3D54A 1Q82T 4H5WA 3LALA 2XHWA 1VRTA 3R3TA 2NRTA 4ED1A 2M7SA 3MR7A 4EO8A 2H4WB 1DTQA 3DOLA 2WSFC 4Q45A 3MMJA 1N32K 3X1LB 2U1AA 2ZJPQ 3QFUA 4RO0A 7FDRA 5FLXY 1VSFA 2HBQB 3MD1A 3WEEB 3AAQA 1WKKA 3SJHA 3MM6A 2NZ4A 4E1JA 2WCXA 2OAUA 2DNGA 1XN9A 4OFZA 2AJ0A 5GAEI 2YXLA 5A2QU 1VQKS 5M1QA 1ZTWA 1RBLA 1KLNA 2P9KA 2IYIA 3ILIA 1YG0A 3HVTB 4DG1A 4C1NI 3CJ9A 4WFAQ 1HKCA 1E4FT 1SJ1A 3WNEA 4CLSA 2M52A 3C66A 4A8MP 2KYXA 4P10A 3AA5X 2ATCB 4F0HA 4BCAA 4PQUB 4WK3A 2WVDA 3EPIA 2OELA 1CG2A 3VWSA 3J7A1 4Q44A 1D5AA 2KW4A 4CZEA 2G9OA 3CI5A 2VKRA 3UVJB 2C2DA 3AVJA 4DTMA 4R25A 1H0HB 2LEAA 4IDHA 2PDAA 3NOCA 1B9DA 1EKSA 2J9DA 1Z26A 2VQFJ 4KGMA 4MLEA 4KHYA 2RILA 1C4CA 5AQJA 1IWGA 3EDRB 1ZC6A 5CCLA 1IR0A 1KD1O 3IG1A 3FRZA 2OKQA 4F0KA 3ITHB 4BE0A 1X8DA 3CJTA 3H5XA 5LMUJ 3MAQA 1QQCA 1IBMF 1RT3B 3CCLS 2Z2MA 2FBTA 2EFNA 1SQKA 1YI2S 3B8HA 3SI8A 2HHPA 3VQCA 1HBOB 2HNDB 2GEMA 1S1UA 2OPQA 5F3ZA 3ZTPA 2WC9A 4EK2A 1ZXOA 3NLCA 1K9MO 4CBWA 4LR9A 4P2XA 1U1MA 4Z7CA 2QA2A 3IP0A 4DQQA 3NDKA 4QIFA 5AE1A 2E44A 1CPZA 4B3TF 4X2BA 2GQCA 4GVLA 2UXBK 3JAMY 4X4UA 1RT7B 3KMSA 2A40A 2O8FA 4PKGA 1PKUA 1SJFA 1X3MA 4FWLA 5TKYA 1K44A 2HNYA 1VHXA 1JLGB 2OUGA 4ZPWR 5GMEA 1NKCA 3VF4A 1HFEL 1WC5A 4ZITA 2EK6A 4P7TA 3BF4A 4FWNA 3VGTA 1CJTB 3GWCA 2GQQA 2O8DA 4I64A 3ENBA 4ISFA 4OYMA 3H0PA 3OYJA 2MKYA 1KBRA 3K5PA 1XTZA 1IBLJ 2CQPA 3OYHA 2LLZA 1SPBP 3BZQA 3L95X 3I87A 3OYLA 4JI4J 2BUNA 4DR7K 2D3ZA 3AT1B 2JDJA 2N82B 1Q95G 5FIIA 3RAQA 3IBCB 1UWBB 3FNNA 3GCWP 3EVWA 1RTIB 1R8AA 3PM9A 3LZJA 2R3VA 1MROA 4DU4A 1FKOB 1KCFA 3FGUA 3PYGA 3MFHA 2FYXA 2DNLA 3K59A 3RBZA 1LXJA 2NZTA 4FPIA 1UMJA 5G0RA 2JVOA 4DV2J 2DHHA 3ZSZA 3TTCA 3C8YA 4OPJA 5KFSA 3TR5A 1NB2A 4E7JA 3D7SB 2VFVA 2Q0RA 1QQOA 3K89A 4LF5J 2VG7A 3PXGa 2N3OA 3H3OB 1FDDA 2X3DA 4BRDA 2VWKA 4C8ZA 5L1IA 2E5JA 4QWAA 4QIEA 2MKIA 4JV0A 4ZVSB 3P6YC 1VQLN 4JI7K 3D68A 3W66A 4BBYA 4KTQA 1TVRA 5J2MA 1FJGJ 3RR8A 1SJ4P 1XWLA 1WOOA 2ZKUA 1RT4B 1BMQB 2VC1A 4K4VA 1VFJA 2BXJA 1RDBA 3VZHA 4AHVA 3NGIA 2UUWA 2VV5A 2CPXA 3OTDA 1S6PB 3ASMA 3KLIB 4JI8K 2NZCA 1FD8A 3DOKA 1J5EJ 4PEOA 1RABB 4A62A 2MTLA 4HWIA 3PSIA 4MKBA 3PHEA 3SFGA 5I3QA 1YBUA 4CJUA 1X4EA 1Y3JA 4H4KC 3BEGB 3W65A 1VQ6S 5BR9A 2OSQA 2X51A 3WX8A 3EE3A 1Y5IB 4GRSA 1SC1B 2V4JA 4FDFA 2XMTA 2P6TA 2QEXS 3L7PA 3RG6A 1XI1A 2YHYA 4DPYA 2CPYA 2BJ8A 3KJVB 3PRVA 5LSRA 3LDNA 4DV4K 2R7VA 3QEWA 4UT4A 4CFBA 3OR1A 4HVZA 4CEFA 1OSCA 1SJ3P 1MWYA 1C0TB 1CZ9A 4L74A 4NZ7A 5ETTA 4M5LA 2DHXA 3MECA 1YTYA 2RRAA 1NHVA 3TVZA 4JI3F 3FBFA 1XHZA 3LPYA 4MT1A 2QWRA 1IJJA 3OLBA 4DV0J 3I33A 1WACA 1B0TA 3P4IA 3ZX2A 1X5PA 3L2RA 5KFJA 3O4WA 4KGVB 5C2CA 4KFBB 4DB3A 1VSEA 5EX3A 1RU2A 1QM9A 1S1TA 5J2NB 1HYSB 1YBAA 3V5RA 1CULA 4I1TA 3SAHA 1NB7A 3EE9A 4G1IA 3OBIA 3PIOL 1MSWD 4CT8A 5C5JA 5GAHU 1IBKF 5E26A 4LMZA 1RI7A 5FD1A 3LP0A 5CHCB 5GAGP 2HZCA 2ASDA 4GMKA 1NGJA 2B4JA 5DK5A 2AQ4A 1RTDB 3U1MA 3MDFA 1VQ6N 2QLBB 2ZH7A 3T1HK 2J7KA 1JQGA 1NDLA 2V4RA 4IKAA 3R6LB 3RAXA 4DSIA 1TKXB 5J1PA 4QQBA 2GMHA 4CJFA 4DL5A 5HROB 1RTHA 4ZTJA 2YNHA 2CDRB 2FBVA 2XY8A 2BACA 1T02A 1IBLF 3J7YP 3ZT4A 2DCUB 4LR7A 2XY6A 1YJWN 3UW1A 3UKRB 1OH5A 4P52A 3OTBA 1WHWA 2LU2A 3KLIA 4AQYK 4ED0A 4CECA 1Q9XA 4W5NA 4MIAA 1NWKA 1RWOB 1DLOB 2H5EA 4RUBA 4BC3A 3SDEA 4M5JA 3EEQA 1IKYA 3BGUA 1U2RA 1HW8A 2QW9A 4NLUA 4ED8A 2K8GA 1Q18A 1UFKA 2Q3SA 1D4XA 3W60A 3MPUB 1KVBA 3QJLA 4WYWA 4JB8B 4I7FA 4OI1A 5HRRA 2LQ5A 3LM2A 4V1Ak 4EU0A 1HQUA 2ROEA 5F0UA 4DF8A 5M1PA 1Q8IA 4LRCA 4BC2A 4WFAL 3TTDA 4ILGB 1YVUA 4DTXA 2W8KA 4O3NA 4O55A 4JK9A 1RGIA 5KFKA 3HM9A 3UI3A 1M5OC 1LFPA 3QDKA 4L72B 1FNMA 1HWIA 1YJ9N 3D2WA 3LPTA 2DNNA 4NYPA 2MLZA 1RGVA 4LF9J 1TYQB 2E2PA 5KFFA 1C2PA 5HATA 4RG8A 1H72C 2GHPA 3AVCA 4IO9Q 3G8QA 2HQGA 4C0BA 1VQ8S 3FFKB 4B3OA 2DXEA 3HCXA 1M90T 1N36J 2KT3A 3VOVA 1VHIA 1GNKA 3IMQJ 5CXTA 4FP9A 1XJWB 2IVMA 4AF1A 1X4BA 2HB5A 4H0YB 3LP0B 1WAJA 4Y3CA 2DXDA 1WI6A 1TAUA 2LP4A 4I6AA 3QO9A 4JI6F 2GJFA 3H6EA 3VESA 1VSMA 3K7RA 1A9NB 2XNRA 1FE0A 1RWNB 3FCHA 2DR5A 1YK9A 4L73A 2P9LB 3C15B 3ZETA 4DZ6A 1WG1A 3UE2A 4BHQA 1U1LA 2R7RA 1R6VA 3OYFA 4LVNP 3M05A 1WSIA 3W9IA 2J76E 4NLWA 5HROA 4RUCA 4Z0UA 4RNMA 3SAFA 2XYHB 4ZLNA 4FS1A 1L3TA 3A8JA 2UUBK 4JI2F 2UXDJ 4XK8C 2R4FA 4W4MA 3QEIA 1Q7YT 1KXPA 4OJ3A 4X62J 1IR1A 4FJ5A 4ZLJA 1UA1A 2QXLA 4CI0B 1Y3KA 5D0HA 1HNZK 1OPIA 2FC9A 5M1OA 3HSGA 3BBCA 4X4OA 1F2GA 1HBUB 2F1FA 3AODA 2ZM6K 2ZJRQ 3QAEA 2LMIA 3LP3A 1AZSA 1HPZB 3FFIA 2AV5A 1RBUA 3R5DA 3MCOA 5AT1B 5JMNA 4H0XB 3N0VA 2V2KA 3U9ZA 1Q86O 1MG7A 1FRLA 4LF7F 4EI2A 1YIJN 3H90A 2YKNA 4LSLB 2J4RA 1JNRB 3P96A 4PPDA 3CCWA 3SBMA 1LAVA 1XHXA 3N28A 1WDDA 3RBEA 2A6MA 2MKCA 2MSTA 1JLAA 1VAZA 2FF6A 2CJYB 3QT6A 4YOTA 1Y10A 1TUYA 4OGCA 5GADP 3QIDA 2O8EB 3F2KA 1HD1A 4ITSA 4FL9A 1HNVA 1AA1B 2ILZA 1NJYA 4A8OA 4ZHRB 1W2IA 1ZS6A 2ZD1A 1XMOK 3IWXA 2QG9B 2ZEJA 3BUZB 5IQQA 4USUA 3C7NA 1IG8A 1EWRA 2FJWA 3J7ZO 1KVAA 1E6YA 1PBUA 2XGQA 2AHOB 4H4MB 4HH0A 3M1FA 3KD5E 5KGXA 1UWAA 1KRPA 2JSXA 3PVXA 2XHBA 2OFGX 1JLEB 3O6WA 3QT8A 5A8KB 1FI4A 1HBOA 4BRMA 4JK8A 3HSCA 3VQ4A 1QHTA 2JH3A 2WB4A 1VQ4N 3TAEA 3H5YA 1RT1B 5D78A 3SQ0A 4HHJA 5A2QO 4TY8B 3W1YC 2VBYA 2CQIA 3O3FA 3DXMB 2KU7A 2H48B 2YX7A 1EETB 4DI6A 2HK2A 4OZ2A 1QE1A 1BQNB 4FLYA 2FVSA 3CB4A 1EIYB 3AAPA 5KFAA 2E5LK 2HMIA 2M8DB 4LRDA 5EWGA 2PD1A 4K41A 2Y0BB 4F8RA 4HT7A 5D77A 3MAAA 2CYYA 3IGNA 3NH1A 4JKAA 4TU8A 4IFVA 2HLUA 1N5TA 1TTHB 3EMTA 3FEYB 3OL6A 4B9MA 3JYTB 2DO4A 1R43A 2N4CA 3D3CJ 5DQGA 3EZ5A 3M9OB 1N48A 5J2QA 2BGGA 3FE1A 1S1UB 3LGMA 3QGPA 3DLEB 2I2YA 3AVMA 2FLOA 1C6VA 2YNGA 1WORA 4F25A 4AL5A 3V1RA 1S0VA 1ZA2B 4GKJJ 5SZTA 3ETMA 3OYDA 3D6FB 1QZ6A 2NXCA 4IRKA 2ATLA 2F5GA 3SPZA 1DHMA 1MA9B 4F67A 1X4DA 1NNDA 2GBZA 3A8IA 4OPKA 2BV3A 1U8WA 2HF4A 1VQPN 4J9LA 2RE1A 3QEPA 2CJ9A 3NMRA 2W42A 3P3DA 4Z4FA 3DWLA 1FEHA 1Y5LB 3B82A 1FXLA 2OP5A 3QICA 1NGCA 4FJGA 1UZHA 3EVOA 4GC7A 2LQ9A 1VK0A 4ZMMA 3TAGA 3PSFA 1I51B 3CJ5A 1RAOA 3M2VA 1VOMA 2VDIA 2FGOA 3CIZA 5IWAK 2CGJA 1FFWB 2RKIA 1IKVA 1U6ZA 5C15A 4J2EA 3FBBA 3WHIA 1RTIA 1U45A 1T3OA 5CH7B 2I0XA 5BYQA 4YOEA 1KTVA 1NSKL 2C2ZB 2J0QD 2FY8A 1WDTA 4Z7YA 1XMOJ 1JXLA 1YJWS 5J1EA 2LVWA 2E8AA 5EN1A 2BJDA 2J0XA 1KKHA 5EXWA 2QKBA 4YDXA 3OFEA 2P9SA 3MK6A 4GKKF 2D74B 3DXSX 4QAGA 3H2LA 1PILA 3QMLA 4JHDB 4RNFA 4LSZB 5AQQA 1FJGK 3DOLB 3P8BB 4OJHA 3HLUA 3PW5A 2ZZNA 3NRBA 3GFXA 5B0GA 1RT2B 1WKLA 3TO8A 1HWKA 1SCJB 2WSEC 3BV8A 1TL3A 4O3OA 4GVBA 1RA7A 1VYAA 1WN7A 3SCJE 2FY1A 4JYAK 5BN8A 3HZ6A 4K8ZA 3SZ2A 3GV8B 1O0PA 2UXCJ 5FRNA 1W7AA 4NI2B 2P9NB 3U7JA 2WVBA 5CR4A 5AE3A 3O44A 3OHBA 1Y7PA 2FHKA 5GIPA 4PQAA 1N6QB 3M6GA 5JLHA 2AEMA 2Y1IA 3CJKB 2N4DA 3CM6A 1BDGA 2J7UA 3FBEA 2ITGA 4PCQA 5KFIA 1F5BA 4PYDA 3R2CJ 4B3RJ 3LM9A 4K4XA 2DR8A 1WUAA 4DHVA 4QYRA 2DNPA 4QWEA 4DCJB 3N4WA 2W01A 2O4GA 4U96A 3H1QA 2QWQA 4J90A 2P6SA 4LQ3A 3W5ZA 3OYIA 1UVMA 2K06A 4A61A 5AXNA 2ZZTA 1FWLA 4CVNE 4X4TA 1XMQK 4J9MA 2IM2A 3GFYA 3Q83A 2PFUA 3VEVA 2LXIA 2DXFA 5C24B 1Z4UA 3I4HX 3MR3A 1RHMB 4N8OA 2P9EA 2J6UA 4LFAK 3EL2A 4Q8FA 2R7SA 4OHYA 3ZEUA 3UIQA 1C1BB 5D3GA 1X0PA 3ULHA 3V1QA 3L8BA 2RUSA 4DR1J 3ENQA 3OLAA 3J7YI 5B08A 5IT4A 5K8MA 2UP1A 3NF7A 4CK2A 2F96A 3CUNA 3C6TA 2JEGA 2ZOGA 2RKIB 4R79A 1FESA 4UOCA 4C3MA 4K43A 2ZUGA 4IQXA 2ALYB 3NAEA 2CKWA 3TX8A 4BY9C 2NXEA 2CPZA 4ZP6A 4K2XA 3DMJB 1RT5A 1U2VA 2A1SA 1RT7A 4UOFA 2B9YA 2B9EA 4CW7B 3H2VE 1IKWA 1TKDA 2R2UA 4WFNL 2YX6A 5DRKA 3HSTB 3LWMA 1G7CB 5AZIB 3SDEB 2U2FA 3CCJS 4JI1J 4IG0A 4BGAA 1V5IB 3GV5B 2G1HA 2CA9A 4LJMA 4H8KA 1EKRA 3TPQA 1AROP 3VF2A 2GWKA 1QAYA 2YWEA 2UUTA 5HSPA 1U1OA 2ZUAA 3ISND 1ATSA 4BRNA 5F8LA 4CZIA 3NBPB 2ADBA 3A5LC 4IRDA 4ZK7M 1WBDA 3ET6B 4B3TJ 2E1MC 5C12A 2P9CA 3OYCA 1S49A 4B1VA 3CJSA 2ZJQL 1AB8A 4EIAA 3H46O 3H5UA 4KO0B 1WG4A 4WWSA 2XCPA 4W5OA 4Q2MA 3MXMA 4DR5K 3S3MA 4CGDA 4FLZA 1H6KX 2XEXA 1OH8A 3IWLA 4CEBA 2X6SA 1VR6A 3AVFA 4R8UA 2XMJA 1HMVA 3MMVA 4FJHA 3CPEA 2IM1A 3KUEA 5KG2A 4TY9A 3G6ES 1XQSC 1N33F 4CO3A 3OW2M 2QA1A 3K0SA 3C95A 4XEIA 2QE5A 1UPPA 2I1RA 3DM2B 1I5OB 4OYWA 4QJVA 2NXUA 3MWBA 4ZCKA 5L39A 2FHOB 4NWBA 1O5JA 3GSDA 4LF6F 4JKCA 5EX0A 2ZWHA 2ZH5A 2Q66A 3VEOA 1C0FA 4ZVOB 4ISEA 4RUAA 2IVOA 4CE9A 1HNIA 3L2WA 4K42A 2QMWA 3AFGA 5KG0A 4KH1B 3SPYA 4DL0C 2HSEB 4KTZA 1H7WA 2KG0A 5ADZA 3O3GA 2RT3A 4DDFA 4ENOA 3DLKB 4Y2MA 3K8WA 2M8HA 1VQNS 4OI6A 1RSCA 4USHA 3ITHA 2K7JA 5BPNA 4WK1A 4M63C 2R8GA 3HKWA 4BRGA 4XH1A 4JKEA 3C6UA 3CGIA 1K0VA 2PMWA 2XS5A 3RB0A 5KPZA 3L3CA 3CC4S 1VQ5N 3DLGA 1MMDA 2HSTA 5EWEA 3SEOA 4JI8F 3U3YA 1WBBA 1GMWD 2XZDB 3ZSYA 3TZZA 5A8RA 2GX9A 1RBRA 2C2RA 1S9FA 2HQDA 3CWJA 3MD3A 1FFSB 3W9JA 3A8YA 1WUUA 4CJ4A 4C3KA 3T5KA 4QOTA 3IBWA 4DU7A 1IJFB 4FW1A 3V4IA 3FGVA 4FYVB 4LF4F 1NGEA 1VSKA 1G2EA 2DH8A 3I0SB 1XERA 3BQ0A 1WOQA 3NBPA 2B5JB 1Q0NA 5KT6A 3SBGA 2AX1A 2O8DB 1NPRA 4BR5A 3EZWA 2YKNB 4LSLA 3UCGA 4ID5A 5DDPC 3UNGC 5IS2A 4HUEA 1WSGA 3EICA 1VQ8N 3PY8A 2VWBA 4IEIA 3AVHA 2VFTA 3CMAN 1UW9A 2MZTA 3HFVA 2QJ3A 1T9UA 2JLGA 2MKKA 2ZH2A 3DDNA 2QEXN 3C16A 2CJQA 1EZZB 3M8PA 3B54A 1UWBA 3W7BA 5AQFA 1Z2ZA 3SQ4A 1WJ9A 3QAUA 4JP8A 2EG1A 2GVZA 4WQ4C 5EGYA 4NLTA 4L75A 3TABA 4QOZB 2RPIA 2I7NA 4HEA9 1EX8A 5KFLA 3KLHB 4LF6K 2GIRA 1Y9OA 2EBGA 1F6TA 2ZJPL 1HWLA 3O3HA 4JI5K 4C11A 2J6TA 1S22A 5HMWA 2RVJA 3SQ2A 4E7LA 4YB6A 5CD4H 4RW8A 4OX9J 3FZKA 4I9QA 2I5JA 2D0OA 1NUEA 3U27A 1SQGA 2DITA 4XIUA 3GJTB 2HKEA 2V7YA 3KNGA 1TK8A 1S48A 2A10A 3MX2A 4HTUA 2FBXA 4E89A 4XTTA 1EETA 2C3OA 2VJUA 3LDPA 2CNNB 3AARA 2GHVC 1WC3A 3IWNC 3KK3B 3BSAA 3VQEA 4KRWA 3MEDB 3VQDA 1S9GA 1VCTA 1GX6A 3VGVA 4OX7A 2IDOA 1NOYA 3F56A 4HHTA 4H4MA 2KVQE 3UCZP 3THXA 2CQDA 2HBYB 3DU5A 4HVJA 2Q43A 1OVYA 3OHRA 4IOCQ 3J81j 2YQ3A 1CJKB 4AILC 1IQTA 1J5OB 4A2BA 3KKFA 5B0CA 5IOLA 5JS2A 2XLIA 2CQGA 1NCLA 1E4GT 4CDIA 2BVZA 4KHPJ 3I9ZA 4DU3A 5F41A 3L09A 4EMDA 1HYVA 4CF0A 1CXQA 2ZM6J 3RR7A 5ITHA 3K8VA 2CGKA 1HW9A 2DNHA 2OTJS 4DN0A 2M3DA 3S7RA 3OS2A 1LAWA 1VS3A 2RN2A 4F3MA 2V94A 4ZKAA 1F21A 3ZC4A 4OHVA 3AO2A 3TVYA 5K20B 4BDZA 4J2AA 4E2FB 4FPRA 2EWHA 2QYCA 3IRXB 3T5LA 1ATRA 1NGBA 2NS1B 3V9XA 1VLOA 2A1BA 2LEBA 5IXUA 2YKAA 4CZMA 2AEJA 4YN3B 3MCMA 4E0DA 2PI5A 2XBPA 3ZZRA 3F41A 1GLLO 3CPWM 3BPDA 4CTAB 1Z25A 5AQOA 2QA4G 4FF1A 2P9UA 4EEYA 1WOPA 1LXNA 1RLCL 2EFQA 3M8PB 3QFWA 1SC6A 3SUNA 2Z2ZA 4QWCA 2D0BA 4DWIA 4YDUA 4DV3F 1SC4B 4XPEA 4KREA 3MEEA 3NGUA 1XMBA 2DNKA 2PMZD 3GB0A 5E33A 5LXYA 4GC6A 1HNWK 3AOCA 1S6OA 4YEAA 3WBZA 4LFCK 1CJUB 3KK1B 3QLHB 1TU0B 1T9XA 5KFDA 2VBXA 1UTAA 3ZNUA 3C6TB 2IHR1 2FC0A 4IFYB 2I9SA 2JFDA 4E98A 2ZWOA 4ATNA 4KY3A 2V0NA 2NPIA 4LF8K 4O44B 3TWHA 1KOOA 5LMNJ 2HBLA 3I96A 4YUDA 5F9NA 1U4BA 4IDKA 2MZQA 1DTTB 2UUCK 1S1VA 1UKUA 1EQYA 2MQQA 4YR3A 1FKPB 1C0MA 2BJEA 5AQXA 4LRFA 3THXB 4ES1A 3O9UA 5B0FA 2YHXA 3UDEA 2BANB 2RH3A 3THTA 3MCNA 2RNEA 3D7EO 4B02A 1CJKA 3W9HA 1CS4B 3CJBA 2AP1A 2KFZA 4C8NA 3CCSN 3MURP 1CQMA 3HPGA 2F8EX 1F5AA 1V5VA 1D8YA 3DGPB 3J7ZT 4FYYB 3W64A 4FWSA 2P9IA 3HHLC 1B99A 1OSDA 4OI0A 4FJXA 1N52B 4WKYA 2RIJA 2W7OA 4OI4A 5DETA 2YKPA 2HHSA 5D6GA 1SIZA 1F3FA 3W61A 2YH0A 2KRRA 2Z58B 1G4CA 2EKNA 4KQZA 2EPIA 2BOAA 2F9DA 3JTNA 3KG0A 1BLUA 5AQTA 4M7XA 1EWQA 2FB0A 2QO3A 1RAEB 4LF7J 1T11A 3D6RA 1S7IA 2GFFA 3T7ZA 2B56A 5ELZA 4CBXA 3N6MA 4DL7A 2RMLA 5A8KA 4EHUA 4B8CA 3VGLA 4ZVTB 2UVRA 3FCWA 1N5YA 3P49B 4DFPA 2E2OA 2BW2A 1C0UA 2EXUA 2MZRA 1JK9B 4GW6A 4OQJA 2F4VF 2QA4N 4LSNA 3CCMN 3UQSA 4A59A 4AQYJ 1ZYQA 3K5LA 4M3ZA 4HUFA 3LANA 2VFUA 3G2XA 4OI2A 3NH0A 3KJQB 2ZH6A 1X5OA 2V8HA 4DV5F 3V1OA 3N6LA 4UY85 1SL0A 5DO2A 1KS2A 1MROB 4ED7A 4KKOA 2YKMB 4WPAA 1HLUA 2GO9A 1LCUA 1KNZA 5CYQB 1MW7A 1NK4A 4OGEA 2QWMA 1SS6A 1SH0A 2B3TB 1JXEA 2QM1A 2VFRA 4RWTA 1GAOA 2JEJA 1BC6A 3R5AA 5G0RB 3IAYA 3H40A 4DV1J 1WNEA 3C6UB 3JYTA 3JQKA 2XY5A 1RT6A 4WZQA 4DTOA 3ZXWA 2H4YB 2W2OP 1JJ2R 3NNCA 3D9BA 4DLGA 4DL2A 4LRBA 2ROPA 4OZ1A 5EHHA 1IBKJ 1J27A 1U6FA 4BQZA 4KBOA 4A8SA 1FT8A 5RUBA 3VPZA 3P5TL 1GLAG 2B7BB 2CZ4A 1VSIA 3BO4A 4KT0C 1AW0A 4CO5A 3RB4A 4B8AB 4ZVEA 5DM6L 3V9UA 3DMJA 5E3RA 3D0GE 2M0GB 2QL5B 2RRNA 1HWJA 4KO0A 5L1KA 1QLNA 3SSRA 2M4MA 4K4WA 3JS6A 4NCBA 5CQGA 1VQ4S 4LF9K 4CGHA 3AO5A 1RE1B 5DJBA 5D4PA 4FZXC 4ANCA 5DQIA 1J2VA 3BY5A 2N3LA 3ZZUA 1PC4A 3HJFA 4DPXA 4YB1P 5C10A 4CZFA 3THWB 4X65J 4FWKA 5C42A 4DSLA 5KFMA 4IJAA 4DL3A 1WSVA 2XULA 1TV6A 2ZOFA 3V6DB 5HBMA 3GONA 1GFWB 4H03B 1LOTB 1RILA 4JI1K 4LIWA 3VTHA 3VZIA 4NX9A 3NGYA 3JAMO 2VWJA 1IV0A 2FLPA 1I39A 4JN4A 5AXKA 1H38A 4JUZA 3KHGA 3SUQA 2DH7A 1W9HA 3RU0A 3MTJA 3PO5A 2W6LA 2UUCJ 2GAGC 3QYYA 2E7XA 2WOMA 1OJ4A 1VC0A 4O5FA 4M41A 1S1XB 3VN5A 2QWOA 1S6QA 2A1RA 1BISA 3OXLA 3C94A 3MXHP 2J7WA 1TK0A 5CD4A 4C97A 4MQ3A 1M1GA 3CO0P 3IRWP 3Q2SC 3T1YK 3DM2A 4JKGB 1YRXA 4B9UA 3WUHA 2W4PA 3UDLA 3UD3P 3HL8A 2VBWA 3NEKA 2OZSA 3RMBA 2CG8A 2Z1GA 4ZPAA 4K4UA 1YAGA 3C15A 3CSKA 4WIQA 3CD6S 3N79A 5AQIA 3JQJA 1LK7A 3DLKA 1JLQB 3WQPA 2GHWA 1RZMA 4CK1A 1RT3A 4O4GA 3EY1A 3IKMA 4PABA 2XWYA 4A5AA 4ZVRB 3WC2A 1JJHA 1VK3A 2F65A 1Y5NB 3UN3A 1VQNN 3OSNA 4ALZA 4ZLPA 4CGGA 3KMQA 4I7FB 2CIMA 3IR6B 2KXNB 3NP5A 4RZRA 4EFAC 1TFYA 3MPWA 1URRA 3Q0AA 2EWSA 2DT9A 4DSJA 1M5PC 2ILYA 4JI4K 2PN6A 1S4EA 4RW7B 3BDPA 1RXOB 2R7OA 3FFIB 4CGJA 3QT5A 2YQ0A 4ELTA 2AGQA 3IRXA 4G1QB 1NGDA 2PAVA 4DV5J 5E3PA 3NH2A 1XNRJ 3KLGA 1NKBA 3M32B 1CJTA 3RB3A 4ZA1A 3THWA 3QFHA 4RUHA 4Y2IA 4J9PA 2HW3A 2H54B 3N5BA 4J9SA 4I4BA 1FNXH 4YY3F 3NVKA 1Q7YO 5L8RC 3L3VA 3SCLE 3M2VB 3Q8QB 2HWIA 4JV5F 1U04A 1FDAA 1WLJA 3GG4A 1NDPA 4CO4A 2E5IA 3KVGA 2GV9A 2GS8A 4NLQA 2UUAJ 4NLVA 1X3NA 5AQUA 4LVOP 4B3SF 3MEDA 3JSRA 3CJ0A 2R2SA 3VQAA 1JJ4A 3ID8A 3CDAA 1S72N 3VF6A 1B0VA 3MMAA 3LA0A 3Q8YA 2Y1LB 5DM6Q 3PW2A 4LC9B 4YOUA 2CG4A 4P73A 3AD7C 3CETA 3TUZC 1EX4A 4JV5K 1QSYA 1Q9YA 2ZH4A 1SQEA 3H3NO 5B0BA 2I8EA 1PJ6A 3UNYA 2F63A 4NCGB 3AO3A 4IDKB 3CCES 3K0JA 1WF1A 2RUGA 2XHCA 4PXDA 3WXLA 4DR4F 1WC0A 4WE1B 3DHWC 5KT2A 3O5TB 4PG5A 1UVKA 3OYAA 3MTKA 2FSNA 5JICA 1DJ0A 4DV6J 3DDIA 1K47A 2XZWA 3EGWB 2VH7A 1U1NA 5AQZA 2G0IA 4J5OA 4CCHA 4JAXA 2VICA 1NGHA 2N7YA 3K5NA 1NLVA 1KVKA 2X78A 3M6WA 3M8ZA 1DAXA 5E84A 4NZ6A 3AVIA 3WC0A 2V5HG 1XNQF 2ASOA 3CMQA 5AQGA 2IVNA 3ILOA 3GG0A 4JD2B 3DI6B 4KV8B 4TU7A 2PGCA 4P71A 4CIOA 2E1AA 2A5XA 1P8GA 2DCLA 3F9KA 5HOOA 4CIEA 2GW8A 2D5RA 2C28A 4UW2A 1FWKA 4CZKA 3B4MA 3D45A 1PSDA 2EFPA 4USJC 5C25B 2IDEA 2RS2A 2ADCA 3F44A 4JI5J 4WFZA 1QSLA 3T6JA 2HHQA 4I2QB 2OTJN 4TYBA 2QV6A 4KTWA 2EKYA 4LF4J 4BRQA 3GYGA 2JL9A 4FZZA 1WNSA 2W7AA 1NK7A 1HBMA 2R7UA 4DPOA 1CJVA 1CZAN 1LW2B 3T5JA 1S1TB 3I9V9 1FJEB 3LUYA 1CULB 1Q8LA 3AD9C 1N56A 3KWMA 3FSYA 3W63A 4ZVPB 3CQXA 4DTJA 1RK8A 3ATVA 1RDCA 1YJNN 1V9OA 1VMBA 1KVJA 4M5IA 3E8OA 3DGVA 4Y0WA 4NO7A 5LJWA 2E20A 1M1KT 4A8YA 2W4DA 1R8CA 4YR0A 3R6GB 2FJVA 1ASWA 3EKSA 3OTEA 3NGRA 2NCKL 3NCIA 2B4UA 4UF4A 4PR6A 2AZ3A 3J80Y 2AJQA 3TUJC 1CC7A 1KQKA 3FZHA 1C1CB 1GH8A 2IA0A 2CPJA 4OZNA 3MXJA 4GKKK 3VQ9A 1RBVA 1HNWF 3CMES 1NNEA 5G4DA 2V4QA 3FJ2A 2GNKA 2W40A 4CHPA 3SAGA 3DJCA 7AT1B 1TKXA 2QMXA 1JL1A 2IVPA 1QD1A 4WP3A 4DV3K 3QRRA 3TJAA 5AQRA 3FSXA 5E2QA 5FDLB 2D0PA 4OYOA 4NEZA 1TUWA 4EUVA 1NM1A 4BE1A 2C3PA 3G96A 4X64F 1W2BM 4A8QA 4FWOA 2F9JA 5LMNK 2QT7A 2A2DA 4CYUA 4R0JA 4DPUA 4BR4A 1Q82O 1S59A 3UFCX 1J9AA 4WXOA 5F0XA 4DMNA 4CJWA 3CC2N 2A6OA 1Y00A 3DCAA 1JMTA 3UR3C 1Q16B 2R8JA 1C1AA 2FSJA 1GQEA 3J7Z5 2OEMA 3W3DA 4U7UD 2VG6B 5ETMA 4LBPA 3VEXA 2DHSA 4UUWA 1FRXA 1SL1A 3PW0A 2AJ1A 4KH0B 1ZM3A 3I5AA 1T03B 2P9PB 3LO3A 2AKWB 1IJEB 3CF5Q 3ZSWA 2CXEA 1JCEA 2FF3B 3HHDA 2VKZG 2NYIA 2NPFA 1HNZJ 1YZ6A 2VHGA 4OLAA 1F3VA 3FZFA 5DGBA 3TA0A 1K9MT 2B7CB 4M5DB 1JLBA 3FKBA 1KHVA 4L3NA 4MK8A 4IR9A 2G8KA 5IT0A 5KT4A 3O80A 4BGBA 4G1PA 2RHQB 3PJXA 4RWWA 4M45A 4E7KA 1YGYA 3KK3A 4DR6F 1S57A 2E7VA 1MNEA 4B3RF 3G6EN 1NO8A 3U3GA 3NS7B 2IGIA 3CIMA 5IT9U 3ENVA 4PG7A 3AA4A 4LH4A 2JHEA 3MEGB 5IM0B 4CFAA 2HLTA 2JX2A 4MO4A 4AT1B 4QYZK 3TANA 1LK5A 4G6VB 4OYXA 1XMQJ 4JKGA 2GUPA 4CJQA 3TSPA 1T8EA 2EBEA 2VQFK 3OXFA 3NHGA 1KWMA 3TRGA 1UAWA 3LDOA 1X5SA 1VDHA 1R0AB 3CCQN 4CJEA 3QGHA 3NGSA 4X4RA 1MU2A 3P5JA 3FMBA 3D2FB 1YXQA 2WRMA 1QAIA 1YZ7A 4ZCLA 4EBEA 3GOIA 3NE6A 1RHRB 3Q8SB 2A2CA 4IRCA 2HHWA 4B3TK 4E7IA 5GAHI 3ZFVA 4EP5A 4X62K 1T05A 3WQTA 1JLGA 2FVRA 3VMFB 2F9TA 1U7LA 3IR7B 5IT9O 3NGZA 2DISA 5M2UA 2DNRA 2JNJA 3LPUA 2ZKTA 4UY8T 1K8KA 3W2WB 2F4VJ 2DRDA 1FERA 1A0OB 2KJVA 3U4LA 3EXYA 4ZOSA 4HI2A 3IM8A 1HBNA 3B8AX 2IRUA 1XC3A 1F2HA 1IKXA 3IBFB 1PCAA 1ZETA 1KFDA 4CI6A 1A5VA 5A6PA 3ZSXA 4H4OB 2VPWB 1VLYA 1D9DA 5KG1A 4MYUA 2DFHA 4OLOA 5KFCA 1EXQA 1D9FA 2IAJB 1V3ZA 1B4SA 2IIHA 3L9ZA 4QU7A 2C42A 2KHCA 4K5RA 3JB9k 2DK2A 1N6QA 4LF7K 3TUIC 1RKJA 4NZ0A 4N56A 2HHHF 5DMRA 2QLWA 2YKOA 4MFBA 2UUCF 3H25A 1SKRA 1X4FA 3HULA 5KOXA 3C2PA 4OV1A 2B4PA 4F4KA 1ZBFA 2ZVIA 2COLA 4LF8F 3MF5A 3G82A 4BRFA 4IOXA 5HBMB 5H9FK 4M95A 1ZAVA 3C14B 3AQPA 1RBAA 4USKA 1ZOTA 4DQ8A 4WKRA 2ZGZA 1F9HA 3CCJN 1T44A 2KH9A 3U9DA 4FVMA 2Z4PA 4PWDB 4DV7F 3SQOP 2NSCA 5E3CA 3M30B 3NAIA 5DGAA 1O1WA 4X64J 3HHLB 1L5UA 1EQMA 3TUPA 1BO5O 4HR2A 4FKXA 3VETA 1XNQK 1I94K 4CJ5A 2HAIA 6FD1A 4C0OC 5IWAJ 3BSOA 3BGRA 1N32F 2OPRB 4I56A 3VQ6A 4K8RA 2ZH9A 1BHLA 5BR8K 4CLYA 5AQYA 1UVNA 3BP8A 1JLFB 2NR0A 2LQBA 4MTPA 4CZCA 5J2PA 3K5OA 1EP4B 1NGGA 1VJWA 2W9CB 1HLWA 4NA2A 3AO4A 2LEPA 2WW4A 3H4BA 3I82A 1NLKL 3KJVA 1RAFB 5AJ3J 1VHFA 3WIVA 1YBTA 3EUNA 3T5HA 3M2UB 2MKJA 1CQNA 3AA2A 1IQZA 1NK0A 4NA3A 2NNWA 2F40A 2YHWA 3ZO7A 1PBAA 1VRUB 4PKHA 3RAMA 3HF5A 4DR4J 2AGOA 1RWWB 5GAHP 4JI8J 4J7CA 4DR2J 2VPXB 5JVHQ 2HF3A 2BJ9A 1TKZB 2PI4A 1YTUA 1VBYA 1QDUB 4LY7A 4BR2A 3FQLA 2Y0SD 3GMGA 4O0JA 1KAZA 2M2BA 4DV0F 1WHYA 2XSFA 1Q81O 4KH5A 5LY3A 3WEEA 4Y28C 1BOTO 3BPSP 4W5RA 3HP6A 2YWHA 4EYHB 5U47A 3IO1A 3UN2A 4A47A 4Q0BA 4W92B 1B92A 4ED3A 2Q6BA 2D9PA 1OPZA 4B3SK 3VALA 3BF1A 3TP2A 2YKMA 4NOHA 3SFUA 2FZGB 5KFPA 3C3LA 1KTQA 4CJ7A 1O8BA 4I2QA 3PJ9A 3SSQA 3MCPA 3MXIA 3OV7A 3M32A 3CCVS 2MHNA 3PG9A 5E3QA 4HL9A 3FLCO 4J9OA 3QNNA 4C8MA 5LSOA 3K58A 2HOEA 5DG7A 1RACB 4K7QA 1JJ2M 1TL1B 5GMKa 1VQ7S 4OKJA 3E9LA 4HTLA 5KG7A 4F50A 2MMYA 3BBBA 5LL6d 2CADA 1FFGB 2MQLA 3P83D 2DY1A 4JI4F 4E1MA 3KLEA 4DHYA 3CNQP 1F60B 3G6YA 3U1LA 2BOPA 1JWWA 1JB0C 3VF0B 3HMJG 1RYSA 3OFGA 4KB7A 1OYEA 2HQCA 3WIUA 3N6NA 4GO7X 3IS9A 2KHOA 5BR8F 3E9PA 1RDUA 1BUPA 3O1BA 1GLJO 2FSKA 2ZH1A 1BGXT 1GLCG 2HMPA 4PA1A 1KDNA 5HLFA 3I0SA 3CMAS 1CS4A 2XWXA 4ID1A 3V9WA 2NLWA 4F04B 4EP4A 3R9PA 2DY4A 3O4NA 3T3FA 3KD1E 3NWGA 2H3GX 1RHJB 4OHZA 2P1JA 1FKAF 1K0TA 3AJ1A 4WTYA 1MMLA 3GG1A 1YJTA 2AW0A 1Y11A 2ZJQQ 1SKSA 3J7AP 3EKUA 2MZSA 4DR2K 1X4GA 5LXRA 2O8FB 4FK2A 2BRKA 2Q1LA 4BWJA 3W2VB 1F9FA 5B09A 1QUPA 1SI9A 4NI2A 2X74A 4DTPA 4XPCA 1Q79A 1HR0K 1BCMA 5KQDA 1NK6A 1RCOB 4KYZA 3V9SA 4MKVA 3F0NA 3CJKA 4FK0A 4W5TA 2IS3A 2QIFA 2CVEA 3P39A 1G1XA 3AGRA 1TL7A 3MMBA 4AHRA 4UOHA 2KG1A 3OA9A 3EX7B 2XMWA 3HD2A 3ILJA 2XS7A 4F4WA 3KFWX 4GKKJ 2HWTA 3MEKA 5DLFA 4KV8A 4F3OA 1VQ5S 2HQIA 5C24A 4DR3F 3GFHA 2XO6A 1L3SA 1M90O 3Q23A 1NMNA 2B8QA 3RW6A 1CJUA 3US5A 3MEGA 2LA6A 3HX9A 3P4UB 3Q8UA 4LR8A 4ZIWA 5CCMA 3IC1A 4DCHA 5HK4A 4CM0A 1Q4RA 1R7IA 4Q8EA 1X9JA 3L4QA 3FEXB 5K5MA 1I1GA 2X1GA 3POTB 3QEXA 1K1SA 4BC9A 3RBDA 1H1VA 3E01A 2O8CB 4FVUA 1LEOA 2DHGA 3OVSA 4AXIA 3ENAA 5MAOA 4WCEQ 3D0IE 3OVAA 3TW0A 3KLEB 2HFSA 4J9VA 1QVGM 4YB5A 2BDPA 3OYBA 5A0YA 3OBYA 5T7LA 4LF9F 1ZBSA 3W5XA 3FQKA 1IKWB 5GADU 3D6TB 1T95A 4B3SJ 1DFDA 4U7CA 4UTGA 2HRYA 2HGNA 2RAQA 2P9PA 5AQPA 1HPZA 3TSUA 3OJUA 2W2MP 1TUVA 2KKHA 1SV5A 4O3PA 5LJVA 1NHKL 3M5RA 2VIHA 4H0TB 4X66K 3H2UB 2R42A 4ECVA 3BDEA 3VGKA 5GAEP 2MQNA 2GGPA 2EI5A 1NSQA 5M1FA 1LFWA 1KHWA 2Q79A 4IBNA 4WU2A 2UXDK 5EOYA 2LA4A 4TLRA 3QETA 2VYPA 4F7VA 2ZDPA 2JRSA 3S3OA 1R8HA 4LIRA 2IAJA 1ZTTA 1JLAB 2HZAA 2EC0A 4DR7F 3E9OA 3HVTA 3HT0A 1CEZA 4GKJF 4C48A 1YRTA 2DGSA 1YHQS 2P9GA 2K1RA 3Q22A 1ZH5A 1S4FA 4YOXA 4M3XA 2H3EB 5F9LA 1GOBA 4ZP9A 3GILA 4O5BA 4WQ5A 4J9KA 4MK7A 1ZM4A 5T14A 4QR2A 3HFKA 3HI9A 4DUZF 3CJ4A 3MDQA 2J9EA 1S1XA 2I38A 3D67A 4YY3J 3HRGA 1TFWA 2DH9A 2ASYA 3T69A 5D4NA 3G82B 1RWMB 1A6LA 3D1OA 4I69A 3PKYA 4LSNB 4QIVA 3C46A 2VBZA 4A48A 3CC7S 2VASA 4CTAA 1U8SA 2Y3YA 5JJBA 4KGZB 3MUVP 4OPHA 2VPZB 2BX6A 4TY8A 4RPFA 2KT5A 1FE4A 3AA3A 4M5MA 5BN9A 2HNZB 1ATNA 3LOUA 4IG3B 4Z94A 4BDPA 3IFRA 3THYB 3H7HB 1TL4A 1FKPA 1QY7A 3CCRN 4KHSA 2OD4A 2CNKB 1MWMA 5JXSA 1QUVA 4B9NA 2EK1A 4CGFA 1SAZA 4KC5A 2FHMA 4FWPA 1RWUA 2IRYA 3R6MA 2B0GA 3HZEA 4X84A 3BM7A 4B9LA 2NUBA 1XMOF 4H5TA 4DUYJ 4RJVA 3FR0A 2W1BA 2OPQB 3R9LA 1XR7A 2VDHA 4WQ4A 3CJRA 3E01B 3CD0A 4QS9A 3CEDA 4MKYA 4M3WA 4ZTFA 1REGX 2HAFA 2NRVA 2W7PA 1MWKA 1X0FA 3TU5A 4CM2A 4V19J 2P9IB 2E1ZA 2HRUA 4OX9K 1RUSA 1XIQA 2MLYA 1Q5VA 4ZCIA 3S1TA 4Q5VA 5KG4A 3GU0A 2XY7A 2DPIA 5EDWA 4ECWA 1HHTP 4LF6J 2Y9HA 4WFBQ 3Q2TC 3LGNA 3I32A 1U02A 1LWEA 4JYAF 3NKYA 3PX6A 2P5OA 2AYBA 1SBRA 5DDQC 4OKEA 2HVHA 4FJ9A 2B5JA 2KHDA 1VRTB 4K0KF 3U02A 2MY7A 2Z1HA 3WT0A 4UQGA 2HK3A 1DBDA 2B6AB 4DR2F 4CQ1A 2RU3A 1QTMA 4YORA 3CCVN 5D4LA 4P2MA 1EB0A 3V6KA 1BIZA 3CDWA 1NMEB 3CC2S 3FDSA 3Q86A 3MM6B 4NL5A 1RADB 4CEEA 1S10A 2PC6A 1I94F 4NASA 2CPIA 1RDWX 5K9FA 3VCDA 3T1HJ 3HOSA 3OD2A 3ZCMA 2HRTA 3KJFB 4JI0J 3VERA 2UVUA 3K9JA 3MMAB 2KVIA 3CVKA 4USWA 4BR7A 3UE5A 4USIA 3SCXA 1SJRA 2K7KA 3N01A 3RBXA 4MIWA 5HJXA 3OTOF 1IO2A 4LFBK 2OLWA 1UFLA 5CZ1A 2YX1A 4RW8B 1N32J 2XMAA 3M8SA 1WSEA 1RJJA 4TU9A 3KDNA 2PA8D 4F9OA 2IM0A 1RDDA 3UKUB 3C14A 1TMMA 1NOZA 5J2MB 1UVLA 1GT8A 5F8IA 3SMSA 3L0QA 4H54A 1NHUA 5JMVA 3GIJA 1GTEA 1X31C 2UVVA 4ZPDA 2G8IA 1PAEX 1RHQB 4CFDA 3GYXB 2DNMA 3T41A 4IH6A 4ETZA 3GE1A 5KFYA 2MQPA 4CLWA 1YJNS 1WOSA 5EX5A 3RYLA 4ANDA 1BU6O 4KSEB 2R9LA 3ZZ0A 1F9EB 1NGIA 1OQ6A 4QIWD