4I2QA

Crystal structure of k103n/y181c mutant of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) analogue
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
556
structure length
556
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title A comparison of the ability of rilpivirine (TMC278) and selected analogues to inhibit clinically relevant HIV-1 reverse transcriptase mutants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase, transferase/inhibitor
total genus 144
structure length 556
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4i2qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i2qA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4i2qA05
1WAJA 1IKWA 2XY6A 2GBZA 1D1UA 4RW4B 3QETA 5J2MB 1O1WA 1B9FA 4E7IA 1QAIA 2ATLA 4I2QA 1Z4UA 1EETB 3SQ0A 4ZP8A 1EXQA 4NRUA 1X1PA 4CE9A 3ALYA 3PW5A 4Z4CA 3G6VA 4Q45A 2QE5A 5FRNA 1SV5B 2X6NA 3RAXA 4DTPA 2WCXA 2HHWA 5FDLA 4NCGB 4KKOA 4DSIA 3NAHA 3ZCMA 1FKPB 4Q0BB 3EZ5A 4JUZA 2B43A 1VSDA 4ED8A 3S3OA 1TKZA 1J5OA 4YR2A 1W9HA 3LALA 5C42A 4CCHA 4F2SA 1RA7A 4F50A 3KTQA 2XHBA 1G15A 4RNHA 4O3QA 4O3OA 1S6PB 2AJQA 1NK7A 3P5JA 2WB4A 1NK9A 5EWFA 3M9MB 4DFKA 1XWLA 2GV9A 1VSJA 5KFUA 3IS9A 1SL2A 4DLGA 1GX5A 3LZIA 2R8JA 4O55A 4C8KA 2UVWA 2WOMB 5KFEA 2G8WA 3S3MA 2FBTA 1IKVA 4KTWA 3DRSA 1S1TA 2OPPA 1S9EB 2W9AA 4M95A 2ATQA 3NDKA 3Q8QB 4KAZA 5DGBA 3SV4A 1YT3A 2PZSA 3MR5A 1XHZA 2V4RA 3G10A 2JC1A 4J2EA 3K59A 4NLOA 4RW4A 1N5YB 1JLCB 5J2MA 2IA6A 2UVUA 4LSLA 2UUTA 1EETA 2KFNA 4IKFA 2X6SA 4B3OA 2ZE2B 5J2PB 2FVQA 3DDKA 4CF0A 4FW2A 3HM9A 1EP4B 4I2PA 3RMAA 1NOZA 5EUHA 3MECB 1L3VA 3DMJB 1SV5A 3M9OB 4ED6A 3QESA 2XI2A 3N6NA 5KGWA 3M9NB 2P5GA 4TY8A 1ZYQA 2GIRA 1ASWA 5KFNA 4HVJA 3UDLA 3AVIA 4Q0BA 3OS1A 4QWAA 3TAMB 4F3TA 3OYKA 1IKXB 4Y3CA 4FLYA 3AVFA 3OYCA 4DU1A 1HPZB 4E7LA 1S6PA 1RTJA 1QSYA 4E7KA 3AA4A 1U45A 3DRRB 5KG6A 2V9WA 4C8MA 3VQSA 1VK0A 3G0ZA 3OL7A 1JL1A 1VSFA 1WLJA 2QV6A 1QSLA 1FKOB 3OS2A 4ZMMA 5EWEA 1Q8IA 3KJVB 4FS2A 3VQEA 3AO2A 2UUWA 2R2SA 3Q8SB 3QIPA 1S9EA 2B4JA 1HNIB 2EHGA 4OPKA 5E41A 1ZBFA 3I0SA 4RG8A 1HNVB 1T03B 4ED0A 4CF1A 4KRFA 5CYQB 1RBUA 1KLMA 4ZVFA 4DTNA 4H4OA 1S10A 3CG7A 4DQSA 1S4FA 1K6YA 4AHTA 3V6DA 1LWFB 2D3ZA 1JKHA 3C94A 4Q44A 3VQ4A 2XY8A 2E6MA 3KLHB 3QYYA 1I3AA 2VWKA 3NE6A 4FYDA 3QEWA 3N6LA 4AHUA 1NK5A 1X9MA 5C25A 3MECA 4CHQA 1RDBA 4PY5A 4XO0A 5KFTA 3LDSA 2FJWA 4EBEA 2W8LA 2BQUA 3K2PA 3TAPA 3VA0A 3TAMA 1SL1A 1NK4A 1BCMA 2HVIA 5KT5A 3H5XA 2OPRA 3IN5A 2V0NA 3QLHB 4RW8A 3LAMA 2R8HA 3OS0A 2FC0A 3RB0A 5HP1B 4CFDA 4EO8A 2YKMB 3MEDA 2J6SA 3PY8A 4ECZA 4KHWA 1U48A 2I5JB 3CJ0A 3BQ2A 2HWIA 1RT4B 1IH7A 4JS4A 4ZHRB 4IRDA 1C0TB 1ZBLA 4E0DA 3LP2B 1C1CB 4H4MB 2XRIA 3V9ZA 4ECQA 4NYFA 3ICLA 4PQUB 1RCHA 1CZBA 2WTFA 4DG1A 3FDSA 5KG0A 3OY9A 1VSHA 4BWJA 1FXXA 2DTUA 1NJXA 1HNVA 3GV7B 2PY5A 3DLEB 1TL3A 4FJNA 5SZTA 2YKNB 3TWHA 4RUAA 1LV5A 5KFGA 4IG3A 4HHTA 3DM2B 3HXMA 4AHCA 4CJWA 1LWFA 1WSFA 4W5OA 2ZD1B 4M3RA 1N56A 2B6AB 4RW9B 2HNDB 3KLHA 3FFIB 4EEYA 4OGEA 3HP6A 3I5BA 4M3XA 4ZP9A 3I5AA 2X74A 2W9BB 3VQDA 2E9ZA 3GYNA 4Y2AA 1S6QB 3OSPA 2A1RA 2R7YA 1T7PA 2JEIA 1RBSA 3QGGA 2DFFA 1N6QA 4NCAA 2J6UA 4DTJA 2O5DA 1D5AA 3QLHA 4DSJA 3D28A 4CHNA 1HQEA 3LP1B 5KRSA 4IH5A 2YKMA 3S3NA 4DQQA 4K4TA 3RB6A 4DL4A 4IFVB 4Q8EA 1QHTA 3EY1A 3M8SA 2FBYA 1BI4A 3LPTA 3KHGA 4QWDA 1LWEA 1RDRA 4NYZA 1RNHA 4ZHRA 1C6VA 3RBDA 2KTQA 4KV8B 1JLBB 1WN7A 2CJQA 1C1CA 3PVXA 1QAJA 4XPCA 5KFPA 4M3TA 4PQUA 1KFSA 3BREA 1DLOB 4CJEA 3OL6A 3BGRA 4WYWA 4YFUA 4ED2A 4J9RA 4CEQA 5KT2A 3RMDA 3DLEA 3CIZA 3LP0B 3EYZA 3SI6A 4CJUA 4ECXA 2YKNA 4J2AA 3TQ1A 2KZMA 3O4NA 5KG5A 3A2FA 1QS4A 4Y2CA 2D7SA 4TQRA 3ZSWA 3G6XA 4DQIA 2B6AA 4G1QB 3L2RA 4AHSA 1A5XA 1LAWA 2HNDA 2YNGA 4Y34A 4DTXA 3DLHA 3DRPB 4DL6A 1CSJA 4LY7A 3IG1B 4ZPAA 5DG9A 2IMWP 4ZVHA 3LZJA 3BJYA 4ECSA 4KFBA 1S6QA 1VSLA 4ZPBA 1VSIA 4K4YA 2ILZA 4DSKA 4ECVA 1JLAA 2R8KA 4CK2A 3NH2A 2AWZA 4ZVEA 4FJHA 2IAJB 5CYMA 4MK7A 1TKDA 4OLBA 4RNOA 3QO9A 4ICLB 4TN2A 1B9DA 4G3IA 3LP1A 3OYIA 1CXQA 3ZT1A 4L8RB 5D3GB 1T94A 4E19A 2VG6A 1JXBA 3HK2A 1LAVA 3NHGA 1GOBA 5KFQA 1TV6B 4IFVA 4K4ZA 4ZP6A 4TY9A 3P83D 1C0UA 2OZSA 2DFHA 1RYSA 2HW3A 4YR0A 5F9LA 3KLIB 3KK3B 4O5BA 4KV8A 2RDJA 3U6FA 4NYNA 4ZPDA 3VN5A 3KLFB 4DTSA 3NMAA 4AHVA 4OPJA 4N76A 4CHZA 2V4QA 1F21A 3GIKA 1WNSA 3PZPA 3ZSRA 3V9UA 4M41A 4DS5A 2YNIB 1J54A 5HROB 5KFIA 4K8XA 4RW6A 2G8VA 3KNAA 4DF4A 4G1QA 1BHLA 3ASMA 1WNEA 4J9OA 5KT7A 1NKEA 3DRPA 4YR3A 3H98A 1Y97A 1J53A 3IG1A 4FLTA 5KFRA 4E1MA 5FRMA 3KLEB 4NLVA 3CDWA 3OYEA 3UQSA 3OYBA 5T14A 3HKWA 5KFMA 1NJWA 1HYZA 4PUOB 4FZXC 2VG5B 1WSGA 3KK1B 4F4KA 3GV5B 1XHXA 4CGIA 1LW2A 1T05B 4BWMA 2G8IA 5L1KA 3RMBA 3F73A 1ZTWA 2IAJA 1N48A 4BE0A 3GIJA 4HUEA 3FRZA 3H40A 3U3GA 4ICLA 3PW4A 3NCIA 5J2NB 5D3GA 4BDZA 1VRTA 2HWHA 3V1RA 2GIQA 4NLSA 3DOLA 1WSIA 1S9GA 4J9SA 4IKAA 1U04A 4C8OA 3M8QB 1RTIB 3BQ1A 4F8RA 3DYAA 2Y1IA 4ZPCA 1BCOA 2HB5A 4Q8FA 2D0AA 5KFWA 3VQAA 3KLIA 3PJWA 4CK3A 4MK9A 4HCCA 3FQLA 3ITHA 1LW0A 4Z4GA 4IRCA 4IDKB 2HMIA 4NLTA 4FVMA 1RILA 3IRXA 3TVKA 4RNFA 4O0JA 1SL0A 4EP4A 4AH9A 5KG2A 2FVPA 4CJLA 4ZTJA 2YNIA 4IG0A 4LSNB 4N47A 5HROA 3V9SA 4FLWA 2JEFA 3AVAA 3B6PA 4DU4A 5I42B 4OVLA 1HQUB 1RT7B 3AVGA 3V9XA 5EWGA 2BDPA 2VA2A 3CJ4A 5KFXA 1XR7A 1EKEA 3QIOA 1LWCB 2XI3A 4IR1A 4ECUA 3TAFA 4CK1A 4UQGA 2BE2B 2F8TA 2HHTA 1VSMA 1KTQA 3KLEA 2OYQA 2ASJA 5DG7A 5DLFA 4FLXA 1REVA 4PUOA 2VG5A 1RTDB 5DLGA 2BQRA 4NCBA 3KK1A 3AA3A 1T05A 3HPHA 1JLQB 3EPGA 4F4YA 2AX1A 5KG1A 3K57A 1IKYB 2LSNA 3MTKA 2ITGA 2Z1GA 2PYLA 2FVRA 1JX4A 3OLBA 3D45A 3NBPB 2D0BA 2ASDA 3GILA 5DQHA 4E89A 1D9DA 4KHYA 1MMLA 4QW8A 4CJSA 4FK2A 5F8HA 3M8QA 1RTIA 2RN2A 2E4LA 4XPEA 3DLKB 4FJJA 2QKBA 4NCGA 2JGUA 4WYLA 1KSPA 1FKPA 2IM0A 3SI8A 2XGQA 5KFJA 3D0PA 4YMEA 1JXLA 3TABA 4IDKA 3QGIA 4B9TA 3VQPA 4CIGA 3RRGA 4F2RA 3JSMB 4FJ5A 1ZTTA 3LAKA 4CEEA 4B9MA 1U09A 3O3GA 2IM1A 2C2RA 4Y1CA 2IOCA 2EX3A 3KHLA 3HYFA 2A1SA 4FZZA 4J9MA 4KB1A 1BL3A 3SYZA 1T3NA 2O4GA 2WOMA 4RZRA 3QIDA 2DFEA 3LANA 4F4ZA 3AV9A 4MFBB 2F8EX 1RT1B 3K5NA 3I0RB 2W9CB 2BE2A 3PV8A 2IGIA 5HRRA 4DFMA 3QNNA 2J6TA 1Q9YA 5EDWA 1D8YA 2XCAA 3PO4A 1ZETA 2Z1IA 4HKQA 4FBUA 1S1XB 1A5VA 4RW7B 5J2QB 1D0EA 1RTDA 5K14B 3TANA 3V6KA 1L5UA 4N56A 4E7HA 4CEFA 4GMJB 3QEXA 1CXUA 4B9UA 4FBTA 1N5YA 1JLCA 2HNZB 1JIHA 4EZ6A 1U47A 3NAIA 3CM5A 1JXEA 3O3HA 3RWUA 3F9KA 1FK9B 2DY4A 2QXFA 2ZE2A 5J2PA 4FM0A 4CGFA 3C6TB 1EP4A 3AO3A 4NLGA 4CEBA 4URSA 3DMJA 4CECA 4EYIB 3KMQA 1KRPA 1CLQA 4KTQA 5KFSA 3SFUA 4ECWA 4ZVGA 3CFPA 1SKWA 1TAUA 2FVCA 4CHOA 3Q8PB 2BGGA 1IKXA 3H4BA 4O3PA 1HPZA 1YTAA 1RA6A 4YNQA 5KFOA 3OYJA 4CF9A 4J9LA 3JSMA 3TI0A 5CY4A 3DRRA 4FJ7A 4KHQA 5KTQA 5F8MA 1WAFA 4FLZA 2YNFB 4NLWA 4RNMA 4LH5A 3T19A 1RT6B 3SPZA 3V6HA 4E3SA 1OS5A 1VRUB 1FKOA 1JLEB 1S1UB 4GC6A 3PO5A 1ZBIA 3AO1A 5KFYA 3QEVA 1Z25A 2OZMA 2YV0X 2IJNA 1TK8A 1QSSA 4MFBA 3KOAA 3KJVA 1RT1A 2XO7A 3NF7A 4QWBA 1L3TA 4CJVA 1NK6A 1T8EA 4RU9A 4B9NA 4I9QA 1HNIA 2W9CA 3OHAA 4CEOA 4EP5A 3AVNA 4M3UA 3SQ4A 5F8GA 4WXWA 1U49A 1RDCA 3N6MA 4AILC 4FZYA 2Z1HA 1T03A 4CFCA 4RW7A 5CYQA 3SUOA 3L2QA 4NLUA 5L9XA 2HNZA 1SH0A 2FLNA 2WONB 1GOCA 3P1GA 1GOAA 1J9AA 3SQ2A 1FK9A 1RT5B 2HHVA 3LPUA 3I5CA 3EZUA 2JEGA 1X9WA 1UA0A 4PWDB 2C2EA 1RT3B 4FW1A 1ZBHA 2BQ3A 4R8UB 1TP7A 4Z4HA 3DOKB 3HT3A 3AVMA 1CZ9A 3KMSA 3CO9A 5KT6A 3VA3A 4B9VA 4R5PB 4U6PA 3ZSOA 4FM2A 3CFOA 3DLGB 3AA2A 1RYRA 1Z26A 4FXDA 5HP1A 3GIMA 4I9LA 4TXSA 3HP9A 1SH2A 4NLQA 2IJFA 1QTMA 4HTUA 3VQ5A 2IBKA 1NKCA 3NGYA 2I5JA 3T5JA 3M8RA 5F8NA 1S0MA 1RT6A 5L1IA 2QK9A 2C22A 1VRUA 1RT4A 1JLEA 1RTHB 4MKAA 2NUBA 4CHYA 4DTMA 1C0TA 4CGHA 4NZ0A 4J9NA 3LP2A 2AGQA 4H4MA 5KG7A 4KREA 4DTOA 4DSLA 3H5UA 3RAQA 3DI6B 2JC0A 2IC3B 4W5RA 1TKTB 4CERA 5KI6A 1K1SA 1BQNB 2ASLA 2R8GA 2BANB 1TL1B 2OH2A 3OL8A 1BQMB 3MFIA 5DG8A 2FJXA 5KFHA 3TR8A 3CJ2A 4Q5VA 4ECYA 3SUQA 3VQ6A 4DL3A 4WE1B 3DM2A 2ZD1A 2BR0A 1JLFB 3THVA 4RW9A 4Z4EA 1HARA 3FFIA 1JL2A 1RT5A 4BE1A 4IQXA 4LH4A 3ZT3A 4PA1A 2W9BA 1ITGA 4O4GB 3T5HA 1KCFA 1HYVA 1NK8A 3T3FA 4EO6A 1YVFA 1S1WB 4WFYA 1YVUA 3DOKA 2AGPA 4B8AB 4FJGA 1RBVA 1NKBA 3L3VA 2OA8A 1NOYA 4R5PA 5KFAA 3HVTB 2P1JA 4M3ZA 4DL5A 3B6OA 3HPOA 2PYJA 4CGDA 4ID5B 1YTUA 4MIAA 1U4BA 3MEEB 4QWCA 4HUFA 5KT4A 3O3FA 2R2RA 2XY7A 4DQPA 5C5JA 1KHWA 4CJQA 4I2QB 3CWJA 3SZ2A 5HBMB 3IGNA 4DL7A 4DF8A 3OYAA 3CJ3A 3BSCA 1JLBA 2BRLA 5KFBA 1NJZA 1HMVB 5C24B 2W7PA 4LQ9A 3V81B 3CDUA 2XGPA 2HNYB 1RAJA 2IC3A 3OYNA 1TKTA 1IM4A 5F8IA 5CZ1A 3MAQA 3HVAA 3L8BA 1KVCA 1DLOA 4DS4A 5FDLB 4FJXA 1TL1A 3UIQA 3Q8RB 4MIBA 1BQMA 1W0HA 4KE5A 3OYHA 1TKZB 1J5OB 3LP0A 3QZ8A 5HRNA 3HL8A 4URGA 1C1AA 5C42B 1VSKA 4CJRA 3SJJA 3HSTB 4WE1A 3IAYA 4K4UA 1HYSB 4KO0B 4H54A 4FLUA 1JLFA 3ZT0A 4CEZA 4K50A 1S0NA 3PX4A 5JS1A 3IS9B 3H08A 2Z1JA 2YNHB 1B92A 4JRQA 2RPIA 2RKIB 1HJRA 4O4GA 3AA5X 1L3UA 3KD1E 3QNOA 3PHEA 4BDYA 4M45A 3AVJA 4CF2A 1S1WA 3CM6A 4EZ9A 4CJTA 3DRSB 4DSEA 2QKKA 1S1TB 2OPPB 1WSJA 3QEPA 1NJYA 4QCLA 1WSHA 4ZTFA 4DEZA 1S49A 3HVTA 5KFCA 1KVBA 3DLBA 4ID5A 4DFPA 1S48A 2ALZA 2VA3A 4FCYA 2D0CA 1UAXA 4KSEB 4FM1A 3PX6A 3SCXA 2HVHA 1TV6A 3BR9A 3EPIA 2G8UA 2F8SA 5EU7A 3RR8A 3QGHA 2WRMA 4EYHB 4TSXA 3KKSA 4LSLB 3NGIA 1A5WA 1SUQB 2F96A 5DMRA 5HBMA 1ASVA 3TARA 3OJUA 4B3OB 3KK3A 3OYGA 2AQ4A 3MR2A 4W5TA 4I2PB 1HMVA 5C24A 5KFLA 3OL9A 3V81A 1ASUA 3KLFA 3MR3A 3MXJA 2HNYA 3G6YA 3L2WA 4KPYA 1JLGB 4TY8B 5L1LA 4CJFA 2YHBA 2E6LA 3AVLA 4O3SA 3DLRA 1RDDA 3SFGA 4TYAA 4B9LA 4FLVA 3H2LA 1QE1B 1HYSA 1RTJB 4HUGA 2RF2B 4KO0A 4DQRA 4E1NA 1NHVA 4HCBA 1BGXT 4FJMA 3M8PB 5F9NA 4DL2A 2C28A 2YNHA 2P5OA 3KHHA 2W42A 2DPJA 1NNDA 2RKIA 2VG7B 3AVKA 4O44B 3MF5A 4X2BA 2HAIA 4QWEA 4FJ9A 1SKSA 4EBCA 3RTVA 3QZ7A 4CIEA 2HHUA 3AO5A 4OLAA 3QIPB 1ZBUA 4OKJA 4M94A 4N41A 2IM3A 4TQSA 2D5RA 4DTUA 1TK5A 2BRKA 4KHSA 3NH1A 3I0SB 4RNNA 1X9SA 3RB3A 5J2NA 2GC8A 1KLMB 4H4OB 3V1OA 4ZP7A 3K58A 3V6DB 2KW4A 1DTTB 1JKHB 1R0AB 3HVWA 3AO4A 1UWBB 3ZSYA 3HPGA 1SUQA 5JUMA 3FSIA 2DPIA 4CJ5A 4BACA 4FJ8A 4JLHA 3NF6A 2ETJA 5C25B 4QW9A 2OPSB 3S9HA 3VQCA 1W25A 1RDAA 3MXIA 1JLGA 4IBNA 3MEGB 2KZZA 1S1VB 3MXMA 4O0IA 3CQ8A 3RBEA 4LSNA 3PJXA 4K4SA 4B08A 2OPQB 2OPRB 4F4XA 4XIUA 4KTZA 4NLRA 1QE1A 4RW8B 2G8KA 1I6JA 4C8NA 5I42A 1HQUA 1RT7A 2RF2A 4GVMA 1NK0A 1S9FA 3KK2B 2AX0A 2YHAA 5DGAA 3MEDB 4N5SA 3M8PA 1LWCA 3JYTB 4CEDA 2FVSA 3TAGA 3UPFA 1EX4A 3GIIA 3CVKA 2G8FA 4TLRA 2FBXA 2VG7A 4B9SA 4DMNA 4O44A 4AHRA 1QQCA 3PR5B 5DQGA 3OJSA 4IOBA 3PX0A 4O3RA 1TKXB 4KI4A 4YP3A 4QOZB 3G86A 4DG1B 5KFVA 1JLQA 3L2VA 5KFKA 4C8LA 5J1EB 2JEJA 1IKYA 3NH0A 4MH8A 4WXOA 1S0OA 3OSNA 4J9KA 5SWMA 1TL3B 3NBPA 3VQBA 4KHNA 4W5QA 2XY5A 4FJLA 4IFYB 4IG3B 1DTTA 3CDEA 2Q3SA 3BDPA 1R0AA 1TVRB 1UWBA 4IH6A 3U3YA 4JRPA 3RMCA 3DLKA 5JXSA 3KIOA 1IO2A 3C95A 4DU3A 4IH7A 2HHQA 1N4LA 3OYFA 3GV8B 3KLGB 2E9TA 3SPYA 3ISND 4NRTA 3V6JA 1NHUA 4DLEA 2OPSA 2C2DA 4CJ4A 3OVNA 4Q43A 2O4IA 2Y1JA 3MEGA 4WZMA 1S1VA 4CF8A 3WNEA 5F8LA 2IM2A 4JV0A 1N6QB 3C6UB 4NLXA 3H4DA 2OPQA 1DTQB 5DQIA 1UA1A 1HQEB 4ELVA 4IRKA 3KK2A 4I7FB 3ISNC 1L3SA 3JYTA 3I0RA 3OYDA 1SH3A 3NGDA 3KHRA 4KB0A 4Z0UA 1BI4B 5KG4A 3WNFA 5FROA 1IG9A 1LWEB 3CYMA 4DTRA 4J9PA 4ID1A 1S1XA 5J2QA 4FJKA 5K14A 3GQCA 2FJVA 4ED1A 4M42A 4CGJA 4KHRA 1TKXA 4M3WA 2I1RA 2IS3A 2VWJA 3WNGA 3ZSZA 4HYKA 2WK4A 1C0MA 3NAEA 3BGRB 5J1EA 5KGXA 1KHVA 4Z4FA 3SNNA 5JS2A 3SV3A 3UR0A 2GUIA 3AVBA 3C6TA 1S5JA 4JV1A 1C2PA 4IFYA 4K4XA 2XC9A 4F4WA 4H8KA 1C1BB 1TVRA 3IGVA 2X78A 4MK8A 4J9QA 4QPXA 4O3NA 4FS1A 2YNGB 2WHOA 3D5MA 5KFDA 4FK4A 3PR4A 1S97A 4OKKA 2E9RX 4JS5A 4CFAA 1VSEA 3KLGA 4FK0A 2D41A 3QINA 4KFBB 4FJIA 2R2UA 4CHPA 4NLPA 2ZQBA 2AGOA 2YNFA 3NL0A 3BSOA 2W8KA 4NLDA 1JLAB 5DK5A 3QERA 2FBVA 4KHUA 3C6UA 3CFRA 5CYMB 3SQ1A 1DTQA 3ZSQA 1D9FA 5HLFB 3VQ9A 4NLYA 3VQ8A 1S1UA 3QO9B 1RBTA 3WNHA 4CESA 3MFHA 3NKYA 1XR6A 2VG6B 4E7JA 3AVCA 4I7FA 3V1QA 4K4WA 1K1QA 2RDIA 3ZT4A 4WFXA 1QUVA 3NGZA 5KG3A 3HJFA 5F8JA 2G8HA 4JV2A 4OJRA 4CEAA 3T1AA 2XCPA 1C0UB 1I39A 3VQQA 4CIFA 1TQLA 4ECTA 2B5JB 4J2BA 2AU0A 5L1JA 3E01B 1MU2B 3FQKA 4YQWA 4KAIA 5T7BA 4KI6A 4WZQA 2KFZA 4TYBA 4MQ3A 4WFZA 1TAQA 2D3UA 2WONA 3TAEA 4RUCA 3NF8A 4QAGA 1TK0A 4U7CA 2UVRA 5HRPA 4K8ZA 3QEIA 4ECRA 4PWDA 3ZSXA 1RT2B 3L2UA 3K5LA 3KLVA 3AVHA 4RW6B 1RT3A 3ULDA 5I3UB 1HRHA 3KKRA 1C1BA 5KFFA 4GW6A 4R8UA 3OLAA 4CJ3A 2JLEA 4ELUA 1KFDA 3ZSVA 1XC9A 3PUFA 1KLNA 4CJPA 3SUPA 4CFBA 3KD5E 3V4IB 3RRHA 3OHBA 3MR6A 3L3UA 3DLGA 1BISA 3OYLA 1BIUA 3PW0A 3E51A 3O4QA 3LWMA 3H59A 4DSFA 4CGGA 2R8IA 1IKWB 4EBDA 5KT3A 4M3YA 3TAQA 3LWLA 1LW2B 3BSAA 3T5LA 2W7OA 2KQ2A 4KB7A 5HLFA 2ZKUA 1RTHA 3NFAA 4R0EA 1UOCA 2P51A 3HO1A 2CKWA 4IR9A 2UVVA 3SUNA 2ILYA 3RR7A 1VRTB 4O4RA 4KBIA 3K5OA 1GX6A 3DI6A 3DOLB 1S9GB 3BSNA 1SKRA 3NF9A 3HVRA 4GC7A 3K5MA 3PW7A 4K4VA 3DYAB 1BQNA 3T5KA 4KKOB 4OGCA 2BANA 2B5JA 3I8DA 2R2TA 4OL8A 4ED7A 4DWIA 4KHMA 4Y1DA 3E01A 4ELTA 1MU2A 4F3OA 3ITHB 1LW0B 1XI1A 1TGOA 4URQU 3ZT2A 3OYMA 3RB4A 2HMIB 4J2DA 3IRXB 2FLLA 3BQ0A 4OKEA 4ED3A 4B8CA 3H5SA 2IDOA 2EC0A 4IG0B 4DFJA 2HHSA 1RT2A 1XR5A 4BE2A 3V9WA 3VQ7A 3CJ5A 4LQ3A 4Z4IA 4MKBA 3H5YA 4CJKA 5I3UA 1RBRA 1IKVB 5HRSA 5KRTA 2FLPA 3LP3A 3HHKA 1BIZA 4W5NA 5KFZA 3PW2A 1KVAA 2HHXA 3V4IA 2XWYA 4BDPA 1WSEA 1REVB 5CZ2A 3MEEA 4LD0A 1Q9XA
chains in the Genus database with same CATH superfamily
2H4YB 2C1EB 2V8VA 1OWXA 2QA4S 5J2MB 5BJRA 2MKYA 3PSIA 2XQCA 3B4MA 3BF1A 4CO1A 4CE9A 3ALYA 3A8JA 1FDDA 3JTPA 1UFKA 4CH0S 4DUTA 4M63A 3SDEB 3J80O 4JK9A 1VQON 4GKKK 2WFBA 2QE5A 2KJWA 4M1KA 4YB7A 2EVZA 4USMA 1NSQA 2WCXA 2PA3A 1FDAA 5FDLA 3IWLA 1I94F 3MPWA 2KDOA 1FKPB 1MMDA 3WIVA 3S3OA 1TKZA 4K59A 2ZH8A 3LALA 5C42A 1RA7A 3MMAB 2K3IA 5B0BA 3KTQA 5A8KA 3CIPA 4O3OA 1S6PB 2NYHA 1NK7A 3THWB 2WB4A 2OFGX 2GV9A 1Y5IB 2RILA 2CPXA 1ZA1B 3EEQA 3QAUA 3PHTA 3J80Y 3O1WA 5LMNK 2FZKB 4R79A 2OCEA 2APOA 2G8WA 3S3MA 3OD2A 2CQGA 2FHJD 4KTWA 4XK8C 2DRDA 3IM8A 3VPZA 1KOOA 2DPNA 3RAMA 3Q8QB 3QJLA 1YT3A 2ZKTA 2PZSA 3MR5A 3D7SB 4NXMK 3SJHA 5D4LA 1VIXA 2OAUA 3G10A 4CDIA 2YQ3A 2BTFA 1N5YB 3J7YU 2LQJA 1IR0A 1UEKA 2UVUA 1T9XA 4IWVA 2ZH2A 3VGSA 2UUTA 1EETA 2KFNA 2HQFA 1MWZA 1HFEL 4B3OA 3DDKA 4CF0A 4O0NA 1W2BR 2KXFA 1EP4B 4I2PA 4PYDA 4C97A 3ETMA 1R31A 3A8IA 5CZXA 3DMJB 3UFCX 4FWKA 2XLJA 3M9OB 4ED6A 2C2NA 1YRTA 3G71N 4DXLA 1WELA 3CPWM 2E5IA 4G1PA 4QWAA 1TELA 4QR0A 3T41A 2GWJA 4F3TA 3OYKA 2I7PA 3AVFA 3OYCA 5D77A 2H1YA 1KTVA 2EK6A 2NRVA 1UZDA 2V9WA 2PO4A 3A3NB 5GAGP 1NWKA 3VQSA 3MCAB 2YWKA 3GL1A 4C0BA 1M1KT 2B0GA 1F1BB 1S57A 1WLJA 2QV6A 1X7VA 2E5JA 5TKWA 3HSCA 2C2ZB 1Q8IA 3D6RA 3ENVA 3AO2A 3IAM9 2LXUA 3A12A 5CH7B 1VFJA 2CJYB 2B4JA 5E41A 1ZBFA 1LOUA 4X65J 1Q7YT 4RG8A 4ED0A 2YKAA 4KRFA 3SMPA 1CBKA 5AQPA 1S4FA 3L0QA 4FSVA 2D3ZA 1YRUA 3OXLA 3C94A 2OUGA 4Q44A 2PN6A 4DR5J 2ZF5O 3QMQA 3QYYA 3GOIA 2VWKA 4FYDA 1HR0F 2PFDA 4JV5K 4MAKA 1NK5A 5C25A 3TA2A 1VC6A 2ZBCA 2J9EA 4BRQA 3Q89A 4EBEA 3TZWA 2N4CA 2UXDK 5CA5A 2VDHA 3M6XA 5BXIA 4P9SA 2OPRA 1ZS6A 4JI5F 5RUBA 5A6WA 2PMZD 3TZYA 1EIYB 2R8HA 1JCEA 4DV0K 1ZBSA 1XERA 2YKMB 2P9IA 4A2BA 1LKZA 3MEDA 4OJ1A 3MM7A 4ECZA 4JHDA 4ALZA 4ZCIA 2E5LF 2ACYA 3BQ2A 3MAHA 3LL3A 2HWIA 2ZWHA 1RGVA 2W2QP 1IH7A 4JS4A 1BOTO 3ZTSA 1SJQA 4IRDA 4YY3F 1C1CB 4DX7A 3W9JA 2Q66A 1AFIA 5KOWA 1V4SA 5C2FA 2AJ0A 3PRVA 4ZLNA 1RU2A 3Q2SC 3CCQN 4I6MA 2UXBF 3AJ1A 3HZEA 3CO0P 2MPUA 3GV7B 1TL3A 3HHEA 4GNIA 2YKPA 2PDAA 2CFXA 2HVZA 4DR2K 3FMBA 2GZOA 4CJWA 2ZD1B 1MWQA 4K41A 3SBGA 1J5EK 1OVQA 2R7XA 2HNDB 3KLHA 3MN9A 1UCNA 2O8FB 3VZHA 2E5HA 4OGEA 1D09B 1RWXB 3I5AA 5A2QO 2DGTA 1QVFM 4UY85 4OYIA 4Y2AA 2GAHC 4CI0B 2MMYA 2R7UA 4M7YA 3R2DJ 3CJBA 2BYCA 3KJFB 4AXIA 4USUA 5CXTA 4NEZA 2KVQE 1NO8A 4QBUA 2P6TA 3VEZA 1C4CA 2O5DA 3JXOA 2F40A 1D5AA 2MQOA 1Y64A 1HNWF 3M2VA 3MCOA 5M1OA 1HQEA 2A5XA 3A4TA 3HHLD 4NLBA 2KU7A 1PYSB 3C15A 2OFHX 2GAGC 2Q1NA 2QXLA 3GSDA 1M5KC 4K25A 3M8SA 2FBYA 1WSRA 3L7OA 3IP0A 3B78A 4JKBA 4QWDA 1GLEG 4DV7K 1FRIA 1JLBB 2DGXA 1XNRK 1NSPA 3FBFA 5B0CA 3H0PA 3RYLA 2QWNA 3J7AP 1I94J 4A48A 1DLOB 4CJEA 3OL6A 3BGRA 4WYWA 3MCPA 4CLTA 3C6AA 1Q7LB 2CDQA 4UOCA 3SI6A 2YKNA 3TQ1A 3JTNA 3ZLJA 1QS4A 3KG1A 2HF4A 4H0XB 3ZSWA 3D1OA 4DQIA 2P9NA 5BREA 1G7CB 4Y34A 3DRPB 1NDPA 3AD8C 3DU5A 3C65A 2Z2ZA 2F65A 2ASYA 4OHXA 1X60A 1ZPWX 2E1CA 1WC4A 5D4OA 3MN5A 4ZVEA 1D3WA 1TKDA 4OLBA 3MM9B 2QL9B 4OPAA 1SJ3P 2A10A 4G3IA 4CNYA 2MHEA 4CLUA 1CXQA 4NXMF 3HK2A 1LAVA 4CI6A 1GOBA 3OW2M 4X64F 4IFVA 1OYEA 1N32J 3S41A 3QQCD 4TY9A 3BP8A 2WVCA 1RYSA 3PIOL 5F9LA 5IZHA 3KK3B 1RCXB 4KV8A 2RDJA 1VQSA 3U6FA 4ZPDA 3CJ1A 3VN5A 3KLFB 5FLXU 2A2DA 2PSZA 4CZKA 3NMAA 3HFVA 1HWLA 1OPZA 1OIAA 4N76A 2O8BB 2V4QA 1F21A 3M32B 4JNEA 1WNSA 4ILLA 3QT8A 3ZSRA 2XSJB 4DS5A 1J54A 2AA4A 6FD1A 4IXCA 2A0FB 5AQOA 4H4KA 2G8VA 2V8DA 4WQ5C 5HMYA 2HRUA 3VAMA 1CJVA 3GB0A 1NKEA 4YR3A 2CQCA 4I68A 3I55N 4F36A 4KGMA 3IG1A 6AT1B 4B1YB 5B0FA 2DIVA 4WK1A 2OMOA 4OYWA 4X66K 1HNXK 3HKWA 2W2OP 2VG5B 2XMTA 5IC6B 3TRGA 4CGIA 1LW2A 1T05B 1BA0A 2V34A 2G8IA 2OELA 3F73A 3RW7A 4ILMA 2E88A 4XH5A 2MLYA 1EQ0A 1NGAA 3PW4A 3NCIA 2GMJA 2JOQA 1SIWB 3M8WA 3OTOJ 3P5BP 3V1RA 1Q82O 3ENWA 5E0OA 2NUUG 1UVIA 3M8QB 3BQ1A 1CJKA 1BCOA 1URRA 4P75A 1PO6A 5KFWA 3VQAA 4ES3A 4WU3A 2FGCA 2LXIA 4GMKA 3FQLA 3KUGA 1LW0A 4A8WA 4IDKB 2Q0RA 1DGKN 4BRAA 4DJBA 3EUNA 4RNFA 3EKUA 3CQYA 1EX8A 3MPYA 3LM2A 3G2XA 4JI5J 2FVPA 4ZTJA 2UXDF 3G8SA 3Q7BA 4Y65A 3SMSA 4FLWA 1RLDA 4DUYK 5I42B 4OVLA 1HQUB 1RT7B 4WBFA 4P52A 4DV0F 2V69A 2E5LJ 1QLNA 2KT5A 2OEMA 5BRFA 3UD5A 4E2FB 1LWCB 2XI3A 4IR1A 4ECUA 5FPMA 3TAFA 2F8TA 3R2CJ 4YY3J 1YUWA 3UD4P 5DLGA 3KK1A 4M8LA 2RB7A 2KYZA 3KWMA 3J7YI 1X8DA 2HSEB 2B4UA 4YB1P 3MCNA 4F4YA 4ZA1A 5F0UA 1A6LA 5KG1A 1NCLA 3IR7B 3UDVA 5B08A 1DEJA 2R9LA 2C3OA 3GILA 2P9PA 2E1YA 4DR2F 2QW9A 3RSEB 4BLGA 5F8HA 3CC4S 1RTIA 2E4LA 2RN2A 3UWTA 4WYLA 3FCHA 4ZPWR 1X4GA 4L3NA 2XGQA 5KFJA 3D0PA 2RJZA 3MGJA 3O8WA 5AT1B 4BG8A 4PKIA 4OHVA 3J80U 4F2RA 4D3HA 4QZVB 1OKJA 4C2MA 2HURA 1X0FA 3LAKA 4ZLJA 3IFRA 4CEEA 2P9CA 1FF2A 4B9MA 2WBMA 4M5DB 4Y1CA 2IOCA 3L4BC 1HNWJ 3KHLA 4DR7K 3OVSA 2NZTA 3SYZA 2K7KA 4U7BA 2WOMA 2AZ1A 3QIDA 5ETLA 3LANA 1C0FA 4OYMA 4GO7X 1PC5A 1RT1B 3MURP 3D3CJ 1RHRB 3RRKA 3PIPL 2C3UA 2OI2A 3K89A 3KVGA 2BE2A 3QNNA 2J6TA 5AZIA 4KY3A 2XMAA 1U1KA 4HKQA 1S1XB 4DV7F 1A5VA 4RW7B 1D0EA 4BR4A 5K14B 4JBCA 4FWRA 1WKKA 1XNRF 1T3VA 1U2VB 4GKKJ 4E7HA 1CXUA 4B9UA 4FBTA 4LUBA 2GELA 2BXJA 2QXFA 2M8HA 3AO3A 2AV5A 2UUAK 1P6TA 3PIOQ 3MPVA 3H20A 2DNKA 4FKYA 4DV4K 4LRAA 2Z8QA 4LFBF 2YH0A 4A4JA 2ITMA 3ZZ0A 3PYDA 2FVCA 5LMNJ 3T1YK 3VR1A 1AT1B 1HPZA 2J7KA 2BJ1A 1RA6A 1VRQC 4YNQA 4CF9A 3JSMA 3TI0A 4J91A 4ZCKA 3DRRA 4FJ7A 3O1LA 1WAFA 2QA4N 4LH5A 3T19A 1EARA 3SPZA 4E3SA 1OS5A 2RQMA 4NXMJ 2MY8A 3AO1A 3FZKA 3QWPA 4LBHA 3KOAA 2XSFA 5K20B 3K7RA 4QWBA 5BR8K 4H5VA 3ID6A 4DPOA 2MKIA 2X1AA 1HNIA 4CEOA 4M3UA 1KR4A 2WSCC 5F8GA 4WXWA 2MZQA 1RDCA 3POTA 1T03A 2P8IA 3SUOA 1Q7YO 4NLUA 2W2MP 1REGX 3E1YA 1NMEB 4F25A 2Y8YA 4CD3A 4C11A 4RBVA 4ITSA 4LT6A 5CABA 4F9OA 2LMIA 1FK9A 1T02A 3DGPB 2GJIA 3JSRA 4PQAA 3NGSA 3OR2A 2JLGA 4ETXA 1RT3B 4FW1A 5BRHA 3QB0A 1B0VA 1TP7A 4RWTA 3DOKB 1JNZB 3CO9A 2FDNA 1V6HA 3ZSOA 1WUAA 1YJRA 5EY4A 3CFOA 4CTAA 4DL0C 1IG8A 1RYRA 3J7A1 1Z26A 1HNXF 3C3LA 4ZPVR 1SH2A 4NLQA 2Q31A 3IUCA 3IKMA 4ZLPA 4HTUA 1ZAVA 2IBKA 3C14B 1NKCA 3M8RA 5F8NA 1S0MA 1CJUB 4ISEA 1CC8A 2FY1A 1JLEA 2NUBA 3K5PA 2YWFA 1SQEA 4B3RF 1GLLO 3EX7B 3WIUA 2WBNA 5KG7A 4KREA 4W98A 4JD2A 2FJAB 4NWBA 3JS9A 2N3LA 5EX5A 4KJIA 1O13A 1E4GT 2IC3B 4QYZK 4DPTA 4K43A 3GONA 1HHTP 2R8GA 2BANB 2OH2A 4LF8K 4NI2A 1FE4A 4WFAQ 4JV5J 2FJXA 1Z2LA 3AJ2A 1P8GA 3CJ2A 3M1VA 4IDHA 3VQ6A 1GAOA 3VVUA 4WE1B 4UT4A 2G0IA 3MD1A 3CCES 1AW0A 2BR0A 2QMWA 2A1BA 3THVA 4Z4EA 2UXDJ 1JL2A 1RT5A 4BE1A 4JI4K 4C3LA 1W2BM 4EHTA 4N7TA 3AY0A 1FA0A 4NOHA 2W9BA 3R6LB 4F04B 1DFDA 4DV0J 1KCFA 1QZ6A 2CQHA 4Y0FA 2Z2LA 2JWNA 4EO6A 3VGUA 4WFYA 1W26A 2AGPA 1YVUA 1RBVA 1IN0A 4TU7A 3AJDA 3ZETA 2CQIA 3GYGA 4R5PA 3HVTB 2P1JA 1N8RT 2PYJA 3UR3C 1YTUA 1NM1A 2HLTA 5A2QU 1U4BA 4AYBD 3MEEB 4HUFA 4PKHA 2XY7A 2O66A 5LJWA 4RUBA 1XMQK 2E7XA 4DPXA 1GK8A 3PIPQ 2G0JA 2R3VA 5HBMB 2CJ9A 2HHPA 3CJ3A 3P45B 2AYBA 2X1FA 1HMVB 5C24B 2W7PA 3VETA 3BY5A 4DR2J 5GMEA 5M1NA 2XGPA 3JQJA 1IM4A 5F8IA 5CZ1A 1J5EJ 3BKUA 1KD1T 5FDLB 1TL1A 2ZH1A 3UIQA 5B0DA 3ZTPA 1TKZB 3LP0A 2XMKA 1XMBA 5HRNA 3HL8A 1C1AA 5C42B 2AKWB 1VSKA 2GJ2A 1T6CA 3CJCA 5BYQA 3M6GA 2XMWA 3CF5L 4OX8A 3P4IA 1KQFB 3HTVA 2BEFA 3FNNA 5J1PA 4IJNA 1U1PA 2FHOB 2YNHB 4DN0A 1S76D 2RKIB 4LR7A 1HJRA 4O4GA 4DR7F 2HFZA 3PHEA 3AVJA 4CF2A 1S1WA 2N7CA 4EZ9A 3FZBA 3WT0A 4DCJB 3HI0A 4B3TJ 4ZTFA 5D0EA 3MAAA 2VBXA 4DV7J 4B1WB 2FHKA 3DLBA 4UOHA 2HGLA 1XNRJ 2VA3A 2GS8A 4KSEB 1TV6A 3BR9A 4QIFA 4LF5K 1HI0P 4I69A 4P72A 2WRMA 4EYHB 4TSXA 3IDHA 5DMRA 1U8WA 2Y3YA 4OZ5A 1EJ7L 4B3OB 2AMCB 1PYTA 4I2PB 3MZIA 3MR3A 2UUAF 3MXJA 3Q7CA 3G6YA 5FPNA 2NR0A 1JJCB 3F2KA 4UZCA 1HBMA 2YHBA 4DV4F 3KXDA 2FQQB 3NVKA 5AJ3K 4RLEA 3I9ZA 4RL1A 5L9NA 2QTWA 1B70B 1SZ2A 2LU2A 3SFGA 2QO3A 4TYAA 4BR2A 2VFRA 3T6BA 4TU9A 4KO0A 3J81j 1M90T 4E1NA 3JXUA 3R3TA 1RDWX 2GNKA 4NASA 1I5OB 2WC9A 4I6WA 4DZDA 3MF5A 2Q97A 2HAIA 3MOJB 1K73T 4HEA9 5AE1A 4CLFA 4MLHA 3AO5A 4B3MF 5BR8F 4OKJA 4C0HA 4N41A 5CHIA 1RSCA 1U1MA 1HHSA 4YS2A 1TK5A 1ZXOA 3FMWA 2L9DA 2FC9A 1I1GA 3MR7A 5BYRA 5ETPA 2PGCA 2DD8S 2DO0A 3DHXA 4A8OA 1D8ZA 3AO4A 3ZSYA 1RAHB 5JUMA 3FSIA 2ZGYA 4OYPA 4WK3A 1FJGF 5C12A 2GGPA 3K0SA 3ZX0A 4FJ8A 5A8WA 3HZGA 2OHDA 2ETJA 5C25B 4C98A 1WWHA 2PFUA 3CCVS 1P9YA 1S1VB 1NGJA 4FPAA 4MDAA 1H74A 2H51B 1XJWB 2RT3A 4K4SA 4LSNA 4B08A 2MZ1A 2OPQB 2OPRB 4X66J 1HNXJ 4KTZA 4NLRA 1I6JA 4C8NA 2DHSA 1B4SA 5CCLA 1IR1A 2YHAA 3MEDB 3MM7B 2YJFA 4N5SA 2NQPA 2JH3A 1NSKL 1WBBA 1U1NA 3UVJA 3KK7A 1U2RA 3QBCA 5A8RA 4KQZA 2FYXA 1YJWN 3EGZA 4OFZA 2FBXA 4ZIVA 1ICEB 2GMLA 2AEFA 2WTUA 1U1LA 1R8CA 3PX0A 4B1UB 1VQ4N 4FOIA 3G86A 1JLQA 3W64A 3K8WA 1ZA2B 4C8LA 3PJ9A 4NO7A 2JEJA 1IKYA 3VAGA 3NH0A 1HX1A 2KO1A 5H1SV 2ZH3A 4LF8F 2WVEA 2XO6A 1TL3B 3NBPA 2XY5A 4PZVA 1A7GE 4LSZB 2YWWA 2Q3SA 3BDPA 2NUHA 2U1AA 2VONA 1UWBA 3DLKA 1IO2A 1EQMA 2CRLA 1JJ2R 3C95A 4JI4F 2HHQA 1UP1A 1CG2A 4ZN1A 3BEGB 4DUYJ 4RKUC 2E9TA 2W6LA 3SPYA 4WIQA 3V6JA 4DLEA 2DHAA 3R8EA 2C2DA 4CJ4A 4WZMA 3VHQA 3LF0A 2FLOA 4OHWA 3CF5Q 2RE1A 4ZPTR 3LDPA 1WC6A 1SJRA 2DVIA 4NLXA 3H4DA 1HQ2A 3CJRA 1QUPA 1UA1A 2YKQA 4GRSA 1HQEB 4Z37A 1KAZA 1VMBA 2ZM6K 4ELVA 4IRKA 1L3SA 3C15B 2A42A 3NGDA 4KB0A 2BE9B 3WNFA 1XMQF 2F4VK 3QNWB 1E6VB 1E3MA 1SS6A 4W4MA 1ZZFA 1U2CA 4LF7K 4A8XA 1VBKA 1TKXA 2CQ1A 4AD6A 4A8FA 2VWJA 3WNGA 3ZSZA 4YUDA 4EFAC 2ZH7A 2WK4A 3BO4A 3BGRB 5J1EA 5KGXA 2EWSA 3SNNA 2HS4A 4FF4A 3PFOA 2DR6A 1Y5LB 1RLCL 1B0PA 1I3OB 5HMWA 5K8PA 3MUVP 2J8SA 2DEIA 3AQPA 1VQPS 2CDRB 4MK8A 4J9QA 4NA2A 5B8HA 3UKRA 2C2OB 3V2UC 1VYAA 4DR7J 4AM6A 1C4AA 2YVSA 3QINA 2ZZMA 4FJIA 2QLJB 2VHGA 1TUWA 1RDUA 2YNFA 3NL0A 2KL8A 2W8KA 4NLDA 3QERA 2ZBPA 3DNCA 4Z2XA 5SUHA 2O01C 5HLFB 2HF3A 1UVLA 3QJPA 3WNHA 2HQ3A 1YZ7A 1WC0A 3MFHA 3NKYA 4I7FA 4CM2A 1JNRB 4K4WA 1HKAA 1S79A 1Y7PA 4DCPB 3K9KA 4OO1J 4KH5A 4NXNK 1IBMK 2KN4A 2E1RA 2G8HA 3CC4N 3GG1A 4LF5F 4OJRA 1SQKA 4MJKA 3VOVA 3OUYB 1SQFA 2ZFHA 3VQQA 5F2RA 4CIFA 2B5JB 5AQWA 2UUAJ 4J2BA 4QS9A 2BUPA 3UD3P 3FQKA 4YQWA 5T7BA 2VQEF 5BN8A 2K1RB 2R7OA 4BS2A 1S6UA 4NA1A 4DV4J 1PBAA 4JI0F 5B7WA 4FXWA 4MQ3A 2D3UA 2WONA 1QQMA 1QTNB 3H2VE 3NF8A 1Q1KA 4QAGA 3VAKA 3D6HB 4U7CA 3T1YJ 3R5DA 3VESA 2ZZTA 1MN9A 5AJ3F 3L2UA 2IDLA 3D0HE 3AVHA 4H0VB 2DISA 3NOCA 4PXBA 3KKRA 5KFFA 4KRWA 1IM6A 4R8UA 4GW6A 3TTFA 3OLAA 3AB2B 2JLEA 1CJVB 3A5MC 1TMJA 3PUFA 2W41A 1KLNA 2Y9HA 4CFBA 3KD5E 2NZ4A 3OHBA 3TW0A 1ZH5A 5GAGI 2H9ZA 4DV1K 4PL8A 3DLGA 1BISA 3OYLA 4HHHA 3PW0A 3O4QA 1SJ1A 5E84A 1PJ7A 2KT3A 4CGGA 5BR8J 5ETRA 1IKWB 4DKWA 3N28A 2RVJA 2PT0A 3I87A 3KNGA 3KDNA 5D0RA 1LW2B 2B8QA 3UE5A 3T5LA 3TEGA 2VIHA 3A8YA 4J7CA 2P9GA 1KXPA 3NFAA 5AQUA 1UOCA 1RKIA 4KYZA 3CMAS 3WC2A 3S8SA 2NRRA 2PA8D 1Q4RA 2V4JB 2EEYA 1GX6A 1BG3A 2DYAA 4CZGA 4BC3A 3MTJA 2M5YA 3LUYA 4LF4K 3NF9A 2X7IA 3U1MA 3HVRA 3VF0B 1BQNA 3T5KA 2R4FA 4KKOB 4OGCA 5EX3A 4CO0A 3R27A 3ETOA 3I8DA 2R2TA 4DWIA 3EWGA 3E01A 1MU2A 2GJFA 1LW0B 2AW0A 2HKEA 4URQU 1U24A 4AM7A 2DIUA 1LWXA 3UCUP 1UFWA 3MOZA 1N36K 4ED3A 5MLCQ 3RBZA 2D4WA 2EC0A 4DFJA 1XR5A 1AA1B 3R7NB 2VOPA 3D2EA 5I3UA 3CCLS 1WTFA 4U9RA 2CH6A 3LP3A 2IDEA 1BIZA 5JLHA 4HTLA 1G4CA 3V4IA 1JMTA 5LXYA 3CJ8A 3DXKA 3JQMA 2HQGA 2VV5A 1N8RO 1Q9XA 3BZQA 5D78A 3C7NA 1F0XA 3GZ7A 4QYZJ 1RQ0A 1U8SA 2HBQB 4E7IA 4QR1A 4GV6A 4LF8J 1Z4UA 3J7Z5 4M5IA 4C3MA 2NRHA 2ROEA 1EXQA 2KM8C 3PW5A 1FFGB 2NRWA 1F3FA 2CJKA 1SV5B 4DZ6A 4WP9A 2HHWA 1B0TA 1V3RA 4DSIA 4DV2K 4JI4J 1O8BA 1KD1O 4Q0BB 1Y3KA 4JUZA 1DZ5A 5C10A 1VSDA 1J5OA 1FDBA 1FXRA 1W9HA 2ASMA 4USJC 4E8UA 4CCHA 2CNNB 1N33K 4F50A 2DNMA 1RHKB 4O3QA 1NGBA 2E2PA 2V68A 3FVYA 2CPJA 2XYHB 1YQHA 3HOTA 3DXSX 3HMJG 1XWLA 5KFUA 3IS9A 2GX8A 1GX5A 4YHHF 2HBLA 3LZIA 2BA9A 2R8JA 1VQ5S 2UVWA 2WOMB 3SSSA 3I4HX 3R5CA 2RQKA 3OV7A 1XMQJ 2OPPA 2W9AA 3N4QA 4M95A 1QAYA 8ATCB 2RE2A 3DKDA 5AZIB 1TUUA 4XAKA 2V4RA 5HQ8A 4ATNA 2H5JB 2BOAA 3C46A 4ID8A 2JC1A 3W5XA 2DH7A 5MAOA 4A2AA 4LF7F 3T69A 3CCEN 5J2MA 4OYZA 2O8CA 1HWJA 4LSLA 4N8OA 2CPYA 5DETA 3BKTA 3Q0AA 2F7VA 3EVMA 1HUXA 4IKFA 1F9FA 5AR0A 3RMAA 1A0OB 5IV3A 4BGBA 1BE4A 4JI7J 3CJSA 3LGMA 3OT9A 2XI2A 5KGWA 5GINA 3AOCA 3QGPA 2BV3A 3M9NB 2P5GA 1ZYQA 3BO2A 4EK2A 2GIRA 3AVIA 1YX2A 4LFAK 3NRBA 3TAMB 3U9ZA 2L08A 4Y3CA 4FLYA 4B1ZA 1OSCA 3MMAA 4DU1A 1HPZB 4E7LA 4OIXA 1S6PA 1RTJA 3F9MA 3DRRB 3TEHB 4C8MA 1DARA 1M90O 1VK0A 1MW7A 2AP6A 3HFKA 4YDXA 4PL7A 2FHMA 4ZMMA 3IFEA 4GV3A 2ZHAA 4FS2A 1VHXA 3VQEA 1K73O 4LF5J 4I6YA 2IY5B 1WC1A 1PAEX 1HNIB 3B82A 4L3KA 2EHGA 4GV9A 4NXNF 3CGIA 1IBMF 4USIA 2XLKA 4CZJA 3POTB 1T03B 2RRAA 2XBPA 2ZDOA 4CLKA 4PYAA 1S10A 2D74B 3CG7A 4DQSA 1K6YA 3ZZOA 3BEXA 2HFNA 1LWFB 1OY6A 1JKHA 2MZTA 4I67A 4ES1A 4C11B 3VQ4A 1MG7A 2D0PA 2XY8A 5AJ3J 2A6OA 1KQSM 1S7HA 4OYOA 2PEBA 4AHUA 3OR2B 4ZVSB 4GVLA 1X9MA 2W7AA 3ILOA 3GIRA 4PY5A 4IOCL 1H7WA 3NNCA 5KFTA 2FJWA 1Q53A 2GO9A 1X31C 3MEKA 3M4XA 1XNQJ 1CJTA 3SCKE 3QLHB 4RW8A 4CJ7A 3OS0A 2FC0A 4DV1F 3RB0A 4EO8A 3A13A 4OI0A 3WBZA 2IYIA 1VI7A 3CJ0A 2IVYA 4Y2MA 3A5NC 2AJ1A 2ALYB 1ZBLA 4CH1A 4PXEA 2DHXA 4E0DA 5LL6d 3M6WA 1CC7A 3MWBA 3V9ZA 1XQIA 3OBIA 4NYFA 4PQUB 3SQGA 4FP9A 2WTFA 4DG1A 3FDSA 2ZBQA 3TUZC 4LF4F 3MMCB 2DTUA 3TQEA 4NI2B 3A0IX 1YLXA 3ENBA 3DLEB 4FJNA 2XZWA 5SZTA 3TWHA 3M1VB 2QLBB 1SB6A 1U1RA 5KFGA 3ULHA 4AHCA 4RWXA 4W5OA 2DNZA 1N34F 3ZNUA 3D68A 1NGFA 1BC6A 1N36F 3WXJA 3I5BA 4ZP9A 4HI1A 2HYIB 1ZAWA 4Q2MA 4KH4A 3PKMA 2W9BB 3VQDA 2E9ZA 3GCWP 2VBZA 1K0VA 4PCQA 3QSYB 1S6QB 3OSPA 4BQLA 5D0GA 4CLWA 3H46O 1RBSA 3ZETB 1FX4A 4Y6IA 2Q2RA 2DNLA 1M5HA 4NCAA 2J6UA 5GMKa 4DTJA 3LM9A 2NREA 3LW5C 4LF6K 1J27A 2W4PA 2DGQA 2WVDA 2YKMA 3GBTA 4RR5A 4K4TA 4DL4A 1R0BG 3ZZRA 2VPXB 4BRIA 4BC2A 1G2EA 2NLWA 3BF3A 3LPTA 2D0OA 2NNWA 2N7YA 1FT8A 4NYZA 2BBEA 2JVOA 3KG4A 2XS7A 1RNHA 2NCKL 2KTQA 1FCAA 2QC3A 1WN7A 2CJQA 1C1CA 3CI5A 1WI6A 1K44A 4M3TA 3H1QA 4CLZA 3AH6A 3CCVN 3AY9A 2CJAA 3HHLC 3UCGA 2GV1A 4H0YB 2XM3A 1UVJA 4CEQA 8AT1B 3FGUA 3LP0B 3AQOA 2V67A 2GW8A 1T44A 2RQCA 1N33F 2KHOA 1T3OA 2AYEA 2HVEA 3G6XA 3MWPA 3LDNA 3L2RA 4AL7A 2HNDA 2YNGA 1Z6RA 1FXDA 2DGOA 4ZCMA 1R7IA 2ZUAA 3LDQA 4DTXA 2FJEB 2DKOB 3PACA 2IMWP 4K42A 2ZM6J 1JCFA 4ECSA 2DGVA 4K4YA 3VEXA 2WAQD 3F5TA 4IFEA 4ECVA 3ILLA 2GO8A 2R8KA 2FJDB 3P3DA 1WD6A 3BZCA 1RWVB 3MAAB 3NWGA 2F4VJ 3VAHA 4D3GA 1CVJA 3Q86A 4JAXA 2XYGB 3C8YA 2BOPA 3CD7A 3OYIA 1T11A 5D3GB 1DQ8A 4LF7J 2VG6A 1JXBA 3FZLA 3NHGA 1YJNS 5T7LA 3M1FA 2V7YA 1TV6B 2B9YA 2AHOB 4K4ZA 3ET6B 1PIEA 2M4MA 2F8MA 2FF3B 1C0UA 3KLIB 1X4EA 4OHZA 4O5BA 5TKYA 3CCRN 4DBQA 4JB8B 2JJ4D 2F9JA 2ZDPA 3GU0A 2IVPA 2VD3A 3J7AN 1HBMB 1UVMA 3GIKA 1FNOA 2D9OA 4K0KK 3V9UA 3DHWC 2QWMA 2QRRA 5HROB 1F9EB 1RHJB 3H45C 4K8XA 4FZVA 1S3XA 4ANCA 2CQ4A 3IR6B 1BHLA 4IOCQ 4J9OA 4YOYA 1NUEA 3DRPA 1JJ2M 3H98A 4QOTA 1G6BA 1Y97A 2RU3A 3SIPB 5KFRA 4E1MA 4X4OA 4DMZA 3KLEB 3FLCO 4B3SK 3PRDA 3UQSA 2FIUA 5KFMA 1NJWA 4PUOB 4FZXC 3G9CA 4L75A 4F4KA 1Q81T 4NXNJ 2GVZB 4ZDNA 1RBOB 4CO3A 5L1KA 4GY2B 1ZTWA 3HSDA 3FRZA 1WBDA 3U3GA 2BJEA 3GE9A 2GIQA 4JKDA 1YSJA 4YDUC 1RFQA 3DOLA 1S9GA 2B9EA 3R9LA 4FWNA 5HO4A 4IKAA 4C8OA 1VQPN 1BLUA 2LA4A 5ADXA 1ZAXA 2G2OA 3AODA 5BPMA 3I9V9 4PG6A 3TVYA 2QTDA 4CK3A 4F0KA 3VENA 4Z4GA 1QVFR 4IRCA 2CH5A 2HMIA 4FVMA 2DNYA 4EWTA 1EB0A 1NPPA 1OH5A 1TFYA 4O0JA 4N8NA 1SL0A 3DLLQ 2MKJA 3TJ9A 2XSJA 2QMUB 4WYBA 4IG0A 4LSNB 4N47A 4DV1J 2V50A 1WF0A 4PWWA 4QIGA 2QN6B 5CYJA 3GJQB 2UU9K 2P9LB 2AEMA 3V9XA 2BDPA 3CJ4A 5KFXA 3QFHA 4MO5A 1XR7A 1EKEA 3QIOA 2B9WA 5L39A 3N4WA 4G65A 5AQXA 1VCTA 4W90B 4MKYA 3BS9A 3B6BA 4UQGA 4CK1A 1KTQA 4L74A 3O2IA 2OYQA 5DG7A 5DLFA 2PI5A 3AGRA 3HD2A 2VG5A 1RTDB 2BQRA 3DJCA 3D4JA 3FEXB 1T05A 3HKZD 3HPHA 5CAAA 5IFMA 2EFVA 1AXQA 1JLQB 4DPYA 2AX1A 1NB2A 2M52A 1IKYB 3D54A 2G1HA 2Z1GA 1JX4A 5AQLA 3NBPB 4B02A 2D0BA 2ASDA 4BG9A 1X4CA 1VIOA 5DQHA 1D9DA 4KHYA 1OMSA 4XDCA 3VEVA 4MYUA 1N36J 3M8QA 5IT9O 4XPEA 3DLKB 4NCGA 2RS2A 4Y28C 3SI8A 2OSQA 3TABA 4IDKA 2M3DA 3VALA 1YKWA 3EGVA 4LIRA 3VQPA 2M88A 3RRGA 4CIGA 4FOEA 4C6AA 2CJXB 1ZTTA 3O3GA 5AQVA 3HYFA 2EC2A 4KB1A 1BL3A 2F9TA 2CADA 2LQ9A 3CMAN 3WHIA 4LF6F 3VF2A 4MFBB 5M1KA 2LFVA 2AJ4A 3C19A 1NJIT 4P2MA 3E9LA 4DR4K 4WKRA 1NBEB 4AQYK 3UW1A 4ZN3A 2CPDA 3U02A 4IUFA 5DDQC 5EDWA 3PO4A 2DBBA 1NXIA 2D69A 3V6KA 4N56A 4PG8A 2UXCF 3T9ZA 3W9HA 4LBPA 1VBXA 4GMJB 5GADP 1JLCA 2HNZB 2ZH4A 1JIHA 5JMNA 4DV2J 3CM5A 1JXEA 3E66A 2ZE2A 4FM0A 4NLGA 1N33J 3U4LA 2KH9A 2GTDA 5K8MA 1N5VA 3CCLN 3RSEA 3L4IA 2W2PP 1CQMA 1CLQA 3RG6A 5KFSA 2H5IB 5KPRA 3LPEA 4ZJOA 4ZVGA 3UKRB 2UUCK 4CHOA 3MCMA 3Q8PB 1YTAA 1RWUA 4PAAA 5KFOA 2M70A 5KTQA 2YNFB 3THXB 4M5DA 5JMVA 4RNMA 1GFWB 3G25A 3BGLA 5M2PA 2X3GA 5C2GA 2IVNA 4U7UD 3QEVA 3NCQA 4DR3J 2VFSA 2IJNA 1QSSA 2MYFA 3ILIA 1RT1A 2LEPA 4QIWD 3S01A 2VPZB 4FN5A 4B9NA 4I9QA 3OHAA 3H8YA 2FF6A 3EGNA 3CULA 2VF3A 1MWMA 5IC4B 3SQ4A 4HDHA 3QFPA 9RUBA 4EU0A 4LF9K 2CUYA 3M8ZA 2KHCA 5K8NA 5AQZA 3Q2TC 4RW7A 4A57A 3TO8A 1RAAB 1QAXA 1U2VA 1VQLS 3BKFA 4CT8A 1QQNA 3P4UB 4YOVA 5C0YA 1CLFA 2FLNA 2WONB 3P1GA 3SQ2A 4LFAJ 2AJFE 3CW2C 2LECA 3VEYA 4K0KF 4V1Ak 1X9WA 2MLXA 2C2EA 1VQ5N 5HMZA 5AQNA 4R8UB 3HT3A 5CHCB 1CZ9A 1WEZA 4A8QA 5L38A 2YPZA 1SC4B 2D9PA 3DLGB 4BVPA 4B3SF 1FERA 4I9LA 3VEWA 2KRBA 5BYSA 4EHUA 5IQQA 3VQ5A 1HHQA 3T5JA 2ATCB 5BR9A 2V2VA 4CHYA 1VLYA 1Y11A 1LXNA 2J8AA 3P8BB 4FYWB 3VERA 4H4MA 4DTOA 4JI1K 5CD4H 2JC0A 1RGIA 2HQCA 5KI6A 1K1SA 3CDAA 1BQNB 3NWRA 3IM9A 3OL8A 3O3LA 5KFHA 3TR8A 4X65F 1OH8A 3SUQA 3M05A 4Y0WA 1SAZA 1VHIA 5AQIA 1GMWD 1CPZA 4PG5A 3I33A 1JLFB 1ZOTA 4RW9A 4RTFD 5FLXY 2VOOA 3DGPA 3B54A 3OPKA 1XQSC 5AXNA 3TZXA 2KT2A 2HK3A 1MSWD 5E7OB 2IRUA 1MN7A 3DOKA 1NKBA 3L3VA 2OA8A 2A6AA 4OI3A 4M5NA 2FY8A 2IFXA 1H3DA 1A9NB 2H4WB 4HVZA 4HHJA 3NGRA 3KJQB 4DL5A 3W3DA 1AROP 3DXKB 4CGDA 3MM8A 3R7SB 5HOOA 3TUIC 1RTZA 3O3FA 3VGKA 4DQPA 1OY8A 2HK2A 4Y2KA 2LQ8A 2QEXS 4KH0B 1CJUA 2J0SD 3SZ2A 5DZ6A 3W5YA 2MJNA 3PLAA 1YBTA 3BSCA 4DPUA 3R1HA 1B3TA 1NJZA 3UKUB 1N5TA 4BRPA 3CDUA 1SXLA 1R8HA 1TUYA 4CBXA 5IQ6A 2DRBA 2HNYB 2JRSA 2J4RA 2IC3A 1KAXA 3L8BA 4QR2A 1KVCA 3GPAA 4DS4A 1D4XA 4FJXA 2CZ9A 3Q8RB 1IBLK 1J5OB 4PKGA 4URGA 3MX5A 4LF1A 3SJJA 3D1QA 1F3VA 4WE1A 2U2FA 1P1LA 4K4UA 2ZGZA 1APSA 4H54A 5E3AA 2BJ7A 3ZT0A 3T7ZA 3CMES 3CHWA 3VTIA 2G0CA 4BRFA 3IS9B 3H08A 2RHSB 1G1XA 3ZZUA 4LF6J 4PPZA 3M2UB 3I31A 4BDYA 3GJRB 4CJTA 2OPPB 3QEPA 1NJYA 4DR4F 3PTWA 1S49A 3HVTA 1UKUA 1BQXA 5KFCA 1RAEB 2YHYA 4P7TA 2D0CA 1LCUA 3PX6A 2JDJA 4X62K 2YJEA 3BO3A 1KAYA 2WW4A 2QLWA 3EPIA 2EFQA 2F8SA 3QGHA 2O8CB 3AA8A 3KKSA 4LSLB 3NGIA 1SUQB 2F96A 3HLUA 3KG0A 5HBMA 3TARA 1ASVA 3BGUA 1V9OA 4BR7A 4H0OA 1HMVA 5C24A 2CQ2A 2LXFA 3VQTA 4E98A 1MLAA 4WF9L 3IMQJ 3WZ0A 4WFNL 1KKHA 4C8YA 3AVLA 4KHPK 3J81O 2ABYA 3DLRA 4FO0A 1LQ9A 4B9LA 4FDFA 1RTJB 4HUGA 1BGXT 3TP2A 3M8PB 4DI6A 2H65B 3KKFA 1U02A 1NH7A 2YNHA 3UDEA 4AL5A 2W42A 1NNDA 2RKIA 2IIRA 4O44B 3CCMS 2ZJRL 2E1MC 4QWEA 4FJ9A 1UZHA 3JSYA 1NPKA 2HHUA 3EE8A 4CIEA 3H2UB 2H3EB 4UZBA 3SAHA 1S7IA 4FNIA 3EDQB 1HKBA 1ZBUA 1Q81O 3EGWB 7FDRA 3NGUA 4TQSA 3NH1A 4OLOA 2CQBA 4LRFA 4RNNA 2E1ZA 4LF9F 4ZP7A 3K58A 3H90A 3FCWA 1DTTB 4LMZA 1JKHB 3W63A 2ZITA 1QJHA 1N32F 4K0KJ 2DPIA 2C3PA 4U67L 4JLHA 2DXFA 1H1VA 1DT9A 3W0LA 2RQ4A 1T95A 5ETSA 2OPSB 3D6MB 3S9HA 4RBUA 1RDAA 2AZ3A 3ZX2A 2KZZA 2Z4PA 4P2XA 4O0IA 4ZVUB 1ZM2A 3RBEA 1Q18A 1CJTB 4F4XA 4B3SJ 4XIUA 4OYBA 4ZIWA 4RW8B 3L95X 2G8KA 5T41A 3BF4A 4IO9L 1FEHA 2ROPA 5ETTA 1X4FA 3KK2B 2AX0A 1YJNN 4OI6A 4J9UE 4CEDA 1DJ0A 4U8YA 1EX4A 2VC0A 3CJAA 2RSQA 1HA1A 3GIIA 3CVKA 2G8FA 3MM6B 1U6FA 2CVIA 1MNEA 2ZOGA 2QYCA 4X84A 1JXVA 2B51A 2BM1A 1M5PC 4JI1F 3SQGB 4XH1A 4YP3A 4DG1B 3E8OA 3NS7B 2IRXA 4MH8A 2KG0A 1S0OA 3VMFB 3F44A 4J9KA 4JOUA 3CJ9A 1TL7A 4K8RA 4IFYB 3SMZA 2I9SA 1WDTA 3OTOF 3CDEA 1TVRB 3RMCA 1OJ4A 4FKXA 2DY9A 1NGCA 3L6QA 1AZSA 2FGOA 1HIYA 5DM7L 3TA0A 3WEEA 3GV8B 3W1YC 2UU9J 1F5CA 5ADXH 2HGMA 2O4IA 3GJSB 1S1VA 5F8LA 3TJAA 2DJWA 5IT9U 4FPBA 4L72B 2OPQA 1HBOA 3BBBA 3VF6A 1NBWA 4OI1A 3SK3A 3RVCA 1U1QA 2B56A 4M63C 3O6QA 3NVMA 4CQ1A 3OYDA 3PFEA 1NJIO 4Z0UA 3U1NA 1FWKA 5FROA 3MWTA 3QT5A 4JP8A 4FJKA 2K2PA 2EFGA 2I6WA 1U0HB 1TYQB 3PYEA 3NAEA 1LXJA 4Z4FA 1KHVA 2RMLA 3SV3A 5KQ8A 3UR0A 5KPTA 5U47A 3C6TA 1IBLF 1WDDA 2CG4A 4JV1A 2E66A 3DDNA 4ENOA 4U95A 4YDUA 2IHR1 4FF2A 4YDDB 1KQGB 1M1GA 4F4WA 3IGVA 1T9YA 3I82A 1EKSA 4O3NA 1EZZB 2YNGB 2PIIA 4WF9Q 3CNQP 3PR4A 1VS3A 4CFAA 1VSEA 2XNRA 2CXEA 4C3KA 2DNGA 1UJ4A 2Q0UA 2Q1LA 1HBNB 1RAIB 3C66A 2ASOA 1DQAA 1HW9A 2EG1A 4CHPA 3EM1A 2B7CB 1EWRA 3EE3A 4DR4J 4AQYJ 2V6AA 3CFRA 1NZAA 3FKBA 1D9FA 4NLYA 3VQ8A 1S1UA 2VG6B 3THPA 4E7JA 3AVCA 3V1QA 4OHYA 5T7LB 2ZJRQ 1DQ9A 3ZT4A 1XK8A 5A2QY 3NMRA 1QUVA 1HNZJ 4P7VA 3HJFA 4B1XB 4P74A 4B3TK 1C0UB 1Q5YA 4TNOA 4DDFA 1E6VA 4AXJA 3K2YA 1I39A 1TQLA 5FPDA 1YG0A 2AU0A 4ZITA 3H6EA 2ZVIA 1VISA 1H38A 4KI6A 2ZBIA 4GKKF 1Y4ZB 4M5JA 2JLFA 2F8HA 2DT9A 4J8FA 1TAQA 3R1LA 1NDCA 2HFOA 1FNMA 3AD7C 5I3QA 2UUCJ 2UVRA 4KHPF 3QEIA 4PWDA 3A1YG 3K5LA 4U67Q 3ZSXA 1T0TV 2OSRA 3KLVA 4AUKA 3UN5A 3CCUS 1BMQB 2CWXA 2RS8A 3CXCM 3LO3A 3W8PA 4CYUA 5M1PA 1UW9A 4L73A 1KFDA 3KDOA 1XC9A 3O1BA 2JX2A 2JL9A 3MR6A 3B8HA 5LMNF 5AQSA 3GFYA 1BIUA 1RZMA 3E51A 5LSOA 2MTLA 3R5GA 1YDLA 4IO9Q 3TAQA 5AZJB 4DHYA 4ERDA 3BSAA 1F9HA 4KB7A 5HLFA 5HL7L 2KB2A 1RTHA 4LF9J 3NNAA 1FO1A 4R0EA 2P51A 2F63A 4IR9A 2UVVA 4O4RA 4KBIA 3BBFA 1PAUB 4OX7A 3DI6A 3DOLB 1S9GB 1SKRA 1JJ4A 4GC7A 3PW7A 9ATCB 3OUYA 4CLPA 2B3TB 2B5JA 4OL8A 5GADU 4KHMA 4F3OA 3LPYA 3I56N 1XI1A 1TGOA 4IEIA 4LF2A 3M8YA 4X4PA 4NL5A 3KWIA 2K1RA 2HMIB 4BR0A 5KQDA 2DHHA 4OKEA 4B8CA 3H5SA 2A2CA 3UE2A 3ONQA 2DRAA 2YQ1A 4IG0B 1N0VC 4BE2A 3O9RA 3V9WA 2LLZA 1UPPA 3H5YA 1U6BA 5DM7Q 1IKVB 3D6FB 2FLPA 3GP9A 1V3ZA 4OJ3A 5KFZA 2BKPA 4W5NA 4FYXB 1MWYA 2RRNA 2NRZA 3NGKA 2JVRA 2CPEA 4DCOB 4JI1J 1IKWA 1VQLN 2CJBA 2XY6A 2F9WA 1D1UA 1DURA 2B9XA 4RW4B 3VV2B 2OTLS 3QETA 3E2EA 2LEBA 2Q6CA 3PRBA 2ATLA 1RADB 4I2QA 4CNZA 1X1PA 3WDOA 1M0SA 4Z4CA 4Q45A 2JFDA 2V4JA 4UOGA 5FRNA 2X6NA 3RAXA 4PXCA 2Z0GA 1ILYA 1FWLA 4BC7A 1R8AA 2R7TA 4NCGB 4KKOA 4CLYA 3NAHA 3FZ2A 3EZ5A 2B43A 4ILHA 4KIAA 2M0GB 3MM5A 4JV5F 3MPUB 2XHBA 3HJVA 2AJQA 3ATUA 3Q23A 4J9VA 1N5QA 3R6MA 1FTCA 2FZGB 1VSJA 1ZM4A 2WW8A 1SL2A 3MX2A 4DLGA 1HWUA 4HWIA 2OANA 1R43A 1BHNA 4WIIA 4C8KA 5HVFA 5HJXA 1RISA 3BN4A 2FBTA 2E2OA 3IMXA 2PI4A 5ETOA 2W4DA 5LJ5Y 5IWAK 1S9EB 2DGSA 3ADAC 4KAZA 2GQQA 5DGBA 4YORA 4DV5K 3SV4A 2GMHA 3H3NO 2BJ9A 1FJEB 4CZLA 2BJDA 5JVHL 1XHZA 2ZH9A 4FL9A 1KC8T 2AF6A 2JWKA 3K59A 4NLOA 1B99A 1JLCB 5E5NA 2YHXA 4ZVTB 3TWZA 1RBLA 1NSAA 1JWWA 1IBLJ 2X6SA 2ZE2B 4FW2A 1DAXA 3DCAA 3LTOA 1NOZA 3SCIE 5EUHA 3MECB 4BRGA 1KBRA 2I8EA 1SV5A 3QESA 1X0PA 3R7BB 2VUGA 4BRNA 4PABA 2NYIA 1ASWA 1J5EF 1GT8A 4Q0BA 3OS1A 3HHDA 5KAKA 2R7SA 4DV6K 4AE5A 4YOWA 1FRHA 2VFUA 4BQZA 1VDHA 2O8DB 4FPRA 1QSYA 4TKTA 2UUBK 4G9ZA 2GIFA 3UI3A 5LJ3Y 3G0ZA 2ZC4A 1MWKA 5GAEU 1VSFA 3FR0A 1QSLA 3J81U 2E1AA 1NDLA 5EWEA 1BY9A 4X62J 5L8RC 5IS2A 2UUWA 4BC5A 4PG7A 2ZOFA 3OR1A 4OPKA 5M2UA 4R25A 1LFPA 1U7LA 4B3TF 3I0SA 1HNVB 1UL3A 2DR5A 4CF1A 5HL7Q 1YF5L 3OFFA 1RBUA 4MYTA 1KLMA 4ZVFA 1EWQA 1YXQA 1V4TA 4AHTA 3V6DA 5CR4A 4Q7AA 3VAIA 3I96A 5CQGA 2OLWA 2LA6A 3GJTB 4KHPJ 3CMEN 5A0YB 2KM8B 1VC5A 4RUHA 4X4SA 3GSIA 3QEWA 4O23A 3N6LA 1X5SA 4CHQA 1RDBA 4XO0A 4F3QA 1LOTB 1V5IB 3EN9A 1KDNA 4IOXA 3VF4A 1MDUB 2V7ZA 4P10A 3LDSA 2W01A 2DH8A 3L7PA 3CCWA 5JVGL 1VQNN 2BQUA 2CNLB 3TAMA 1NK4A 1BCMA 2WBRA 2X1BA 2HVIA 3H5XA 1OVYA 1YTYA 3LAMA 4KH1B 3TR5A 3MDFA 1B64A 3GFZA 4KHWA 3ID8A 2HWTA 1WTBA 4KPCA 3L09A 4I0WA 2FB0A 2QL7B 4JN4A 1M1KO 3DOMB 4ZHRB 2I38A 2Y8WA 1SIZA 4H4MB 3S6EA 2QI2A 1GMUA 2RAQA 4BWJA 1FXXA 1W97L 1G99A 4BREA 2L3MA 2MKSA 2G2ZA 3H7HB 3QRRA 1AYEA 5D15A 2YKOA 1FNXH 2WZ1A 1HL6A 2PY5A 3BN7A 1I51B 2O8EA 2J5AA 3HXMA 3IBWA 1FW6A 4JI3K 1LWFA 1WSFA 4LRBA 2IVOA 3ZEUB 2V2ZA 2B6AB 3FGVA 1FI4A 1KONA 4RW9B 3NP5A 3R3LA 3HP6A 3FCVA 4I4BA 2QYGA 2X74A 4WJBA 2DCLA 3W9IA 2H48B 1R27B 2DNQA 3CCMN 2HBJA 2ZVSA 2A1RA 3HOSA 2R7YA 4QYRA 4H5NA 2VZ9A 4TU8A 5AXKA 4HACB 5AXMA 2DFFA 1N6QA 2V2QA 4BROA 5H1SQ 3QLHA 3TX8A 1E4FT 2YX6A 1BO5O 3EICA 4CRJA 3MM8B 3D28A 4ZLLA 3LP1B 4X66F 2CGJA 4IH5A 4Z94A 2VICA 4I64A 3GG0A 4DQQA 1HBUA 1X5TA 4Q8EA 1QHTA 5AE2A 1NGHA 3BBCA 5LMUK 4PG4A 3KHGA 1LWEA 2IPOB 3RBDA 3PVXA 2BUNA 5JVHQ 4BRDA 4PQUA 1WKJA 1KFSA 1WI8A 3CUNA 3BREA 2ZJPL 2RHKA 2VU5A 3MMCA 1WEYA 3WXLA 4ED2A 2V5HG 3PEJA 1HR0K 3RMDA 2MSSA 1IJJA 3ZXWA 3DLEA 3CIZA 3EYZA 4CJUA 1Z1ZA 2I2YA 3MN6A 3L7UA 2RIJA 3O4NA 1UMJA 2HZAA 3OTCA 5KG5A 3A2FA 4Y2CA 3KYLA 2D7SA 4TQRA 5ETQA 1NGEA 4G1QB 1A5XA 4IZ9A 1LAWA 1IWAA 4S0MA 3EKSA 3HD1A 4LY7A 4ZPAA 5DZ7A 3D0IE 3RZAA 4KFBA 1S6QA 4DUYF 1IJFB 2EW9A 1VSLA 4ZPBA 2DNPA 3CT9A 2XLIA 4DSKA 2FSJA 3FJ2A 2J0WA 3FEYB 1JLAA 4CK2A 2AWZA 4FJHA 2IRYA 2IAJB 4MK7A 3THYB 4KGXB 1WKLA 2YCHA 3QO9A 5GAGU 4IOAL 4ICLB 4K5RA 4TN2A 1B9DA 1WHWA 2JSXA 1T94A 3AB4B 4E19A 1P1TA 2B4VA 3HSZA 5KFQA 3M6UA 4ZP6A 2MGZA 2I7NA 2UXBK 2IVFB 2DFHA 5GADI 1FX2A 2HW3A 1KQSR 2ERRA 1RB0A 4C23A 4QIVA 1Y3JA 2CPFA 1WG4A 3Q8VA 1GXUA 1TL4A 3HULA 4OPJA 1UAWA 4X4TA 2NRTA 1S77D 1BDGA 3PZPA 4M41A 2HQDA 1RABB 2YNIB 2XNQA 4DV6F 4L6V3 1WSVA 3HF5A 1Y9OA 3BYRA 4JK8A 2MKCA 1Y5NB 4JI7K 3FZHA 2JFKA 1G3OA 3NGTA 3ASMA 4CZIA 1WNEA 1ACMB 3N5FA 4ED5A 1NLKL 5KT7A 1KEKA 3W3SA 3IBFB 3AAWB 3K17A 5AXLA 1ITPA 5JVGQ 1J53A 4Z7CA 1U26A 5FRMA 1VQMS 3PDNA 3CDWA 3OYBA 5DM6L 1HYZA 3OTDA 1V5VA 1WSGA 1FDNA 3O9QA 1YHQS 1H7XA 3GV5B 1WHYA 4BWMA 1AFJA 2YX1A 4M5GA 2IYGA 1P27B 3NCPA 4HUEA 4BRMA 3H40A 3BYPA 1VLOA 2J9CA 2VFVA 2QMXA 5D3GA 4BDZA 1VRTA 2HWHA 4H03B 4IEEA 1WSIA 4J9SA 3ET6A 1U04A 2MKHA 1J6ZA 3DYAA 3TOQA 2ZC3A 3BM7A 2HB5A 4JI8K 5HI7A 4Q8FA 3R9PA 3KLIA 3PJWA 4HCCA 1RBAA 1XUPO 3ZTOA 3ITHA 3EXCX 4ZKAA 1ROFA 3ELHA 4BVOA 2OP5A 4L76A 3HHLB 2UV8A 4CIOA 4EP4A 4KBOA 3ENQA 4AH9A 5KG2A 2V9KA 4CJLA 1QDUB 2V52B 5HROA 3T1YF 2V63A 1R6YA 2VFTA 2DXDA 2JEFA 1BUPA 3AVAA 3B6PA 3ZNJ1 3A3PB 3AVGA 2VA2A 4DB3A 1RHUB 4BRCA 2Z56B 2NZCA 3GDQA 3FZMA 3QWUA 2CWKA 2EXUA 5KOXA 3GE1A 2CVEA 3G87A 1XNQK 3W8GA 3KLEA 3K8VA 5AQKA 3R8YA 2Z30B 4PUOA 1KVKA 4NCBA 4KR0B 2VASA 4X64K 3RBXA 2GVZA 2P9UB 1S72S 3N4PA 3IAS9 3EPGA 3L4QA 3K57A 2B4OA 3ZX3A 3MTKA 1GLAG 2POKA 2ITGA 2PYLA 1GMVA 2FVRA 2M9KA 3OLBA 1TL7B 3PXGa 1F6TA 2MQMA 2COLA 2IVMA 4E89A 1ATNA 1TUVA 4CO4A 5GIPA 4JI3F 3CCUN 4FK2A 2AJ2A 2VL1A 2V51B 5F41A 4FJJA 2QKBA 2JGUA 1KSPA 2J0QD 4EGLA 2D1KA 2ZJPQ 1AZSB 4NZ6A 1SC6A 3WEEB 3QGIA 4B9TA 2KJVA 1F5BA 4OI4A 4KGVB 4OYAA 4K5SA 2EK1A 5GAEI 2E5GA 3UO0A 1NGIA 2GEMA 3D3BJ 4CZFA 4FZZA 2A1SA 2XULA 1XN9A 1HBOB 1VQ8S 1T3NA 2H5EA 4M7XA 2DFEA 1FWPA 3E3XA 2P9LA 2D3OR 1UFLA 4A8YA 1UEUA 2O3DA 2W9CB 2MQLA 4EAHD 2DEJA 4Q2LA 4ES2A 2IGIA 5HRRA 3AOAA 4DFMA 1K8AT 3IRWP 1Q9YA 2N3OA 2Z1IA 5LMUF 4LRCA 2AEJA 1RTDA 1L5UA 2R7RA 2GQCA 4IOAQ 2DNOA 4HTJA 3QEXA 3RGIA 2CA9A 1KC8O 3NAIA 5C7PA 4PRFA 3F9KA 2DY4A 5J2PA 3C6TB 1MROA 2VBWA 1YJUA 1XMOK 2G4BA 4URSA 4QU6A 4CECA 5HK4A 3KMQA 2FPHX 3BB5A 2WVBA 1KRPA 3EJMA 5ETKA 3SFUA 1Q79A 1GTHA 1O5JA 2HSTA 3CFPA 1YVNA 2IJRA 1IKXA 3V4MA 3HT0A 3UCZP 3X1LB 4WU2A 3EE9A 1YGYA 2ZWOA 4J9LA 2QG9B 4QJVA 2MQ8A 1KVJA 2AP1A 5F8MA 1GLDG 5IWAJ 3QICA 4NLWA 4ZVOB 2KFYA 5K9FA 3ILJA 2GX9A 3E9PA 2OTLN 1BWVA 4DV5J 1VQ6S 1ULRA 1RT6B 3S1TA 3V6HA 1WG1A 1VRUB 5F0XA 1FKOA 1S1UB 1NHKL 5KFYA 4WQ5A 1U2FA 2OZMA 2XTJP 2YV0X 4MFBA 1NM2A 3KJVA 4F3MA 5DM6Q 1L3TA 4JKGB 1NK6A 1T8EA 4RU9A 1OPIA 1OSDA 4EP5A 1HKGA 4OZNA 3AVNA 1U49A 3NEKA 1GLCG 3N6MA 4V19S 2LKZA 5CYQA 2Z2MA 1YI2S 1LK5A 5L9XA 2Y0SD 2HNZA 1SH0A 1S12A 1GOCA 4JKCA 1GOAA 2HHVA 4DV6J 3LPUA 2YWEA 1NEEA 1GXTA 2PFFB 3R1XA 3EMTA 4PWDB 2NLXA 1WC3A 2RU9A 5A6PA 1PG5B 4A59A 1HLWA 4USKA 3G4SS 5DDRC 1U25A 1ZBHA 4Z4HA 2GA7A 2UUBJ 3TTDA 1VAZA 4JI7F 3AVMA 1WOSA 3TX0A 5D6GA 4CYUB 3KMSA 4B9VA 3GFXA 1RJJA 1X3NA 2MSTA 2QT7A 4U6PA 4J5OA 4FM2A 4GVBA 4J37A 5M1FA 1W2IA 4FXDA 5HP1A 3GIMA 3U9DA 4TXSA 2ZHOA 3THXA 2J7WA 5IT4A 1AUSL 1Y0HA 3K0JA 3KWGA 3ZZPA 2I5JA 3PYGA 1HD0A 4FWOA 2E8AA 5L1IA 2QK9A 2C22A 3TJ8A 1RT4A 1RTHB 1RU1A 4MKAA 1C0TA 5DDPC 4NZ0A 4J9NA 3LP2A 4UUXA 4DSLA 5IV4A 1H98A 4BCAA 1K47A 3DI6B 2XHWA 4W5RA 1TKTB 4CERA 1FD8A 2LQBA 2N4DA 3U27A 3VVTA 2ASLA 1NRKA 4QS7A 3P49B 4JI8F 1W7AA 1WC5A 4X4QA 1BQMB 3MFIA 4FF3A 3H25A 2MXYA 4ECYA 1IBCB 4F67A 3DM2A 3PNIA 1FRLA 4ED4A 3LA0A <