1ITGA

Crystal structure of the catalytic domain of hiv-1 integrase: similarity to other polynucleotidyl transferases
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
142
Chain Sequence
b'DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Crystal structure of the catalytic domain of HIV-1 integrase: similarity to other polynucleotidyl transferases.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 44
structure length 142
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1itgA00
1S6QA 1QE1A 4HUGA 1RT5A 1SV5A 1TAQA 1U04A 1NK8A 4ID1A 1GOAA 3AO1A 4GVMA 4KKOA 2Q3SA 4KRFA 1S1VA 4OVLA 4M3ZA 1RNHA 2JLEA 3EZ5A 2QKBA 4B9LA 2X74A 3WNEA 4BWJA 2Z1GA 2OPRA 4CJWA 2HHSA 2OPSA 3LP3A 3T19A 4FM0A 1D8YA 1JLCA 3DLBA 4Q0BA 3ULDA 1W9HA 3K5OA 3AVFA 4N41A 4HHTA 4DTSA 3C6TA 1NK7A 4O4GA 4E7KA 3CYMA 3AVIA 3VQ7A 2GBZA 2YKMA 1JLQA 3MEDA 4CERA 1VRUA 3QINA 4H8KA 3LP2A 3ZSQA 2GUIA 1RT4A 2D0BA 3TAFA 4B9TA 4K8XA 3L2QA 3KK1A 1IKWA 5I42A 2G8IA 3KD1E 1L3SA 1KLNA 3ZT0A 1CXUA 4DTNA 1TK0A 1NKEA 3O4NA 4B8AB 3QNOA 2XY8A 1IO2A 4Z4FA 4ELVA 3OYHA 1BI4A 1SL2A 4ZTJA 5KI6A 1RTIA 2D0CA 1HYSA 1XC9A 4LH5A 1NJYA 3TI0A 2ZD1A 4NCBA 2PYJA 4CFCA 4DFJA 4CJQA 2XO7A 4E7JA 1NK9A 4CF1A 2HHWA 1ZBFA 3LP1A 4KB1A 1ZBUA 5C24A 4W5QA 3QEIA 2HHTA 1KLMA 3C95A 1RBUA 4FJKA 4DU3A 1JLFA 2G8WA 4DSKA 4CHZA 5HROA 1GOCA 1S1WA 4DG1A 1CZBA 5J2PA 3ZSRA 5HBMA 3ZT2A 4CJKA 3L2UA 3TWHA 3CQ8A 1U4BA 4KHNA 1A5VA 4M45A 1FKOA 4OJRA 3MXMA 3AVBA 4FJ7A 4FK0A 1TAUA 3TAPA 4AHVA 1J54A 1LAVA 3LP0A 4ID5A 4OKKA 3VA3A 4DFMA 4PA1A 3HL8A 1RT2A 4YFUA 3SNNA 1U49A 1FXXA 4IKFA 4O55A 4AHCA 1RDAA 1C1AA 1DTQA 4CGDA 4J2AA 4DTPA 3MXIA 2D5RA 2BDPA 3AVHA 2OZSA 3TR8A 3PO4A 5J2QA 3F9KA 2AJQA 3VQEA 5J1EA 1Q8IA 2G8VA 3IAYA 1VSMA 1RTDA 3OY9A 3BGRA 4FZZA 3DLRA 3DMJA 4OPKA 3OYEA 4EZ6A 2RF2A 4CJEA 4CHNA 4ZHRA 1NJZA 3HJFA 2I5JA 3KK3A 4B08A 1K6YA 1YT3A 3AA3A 3OJSA 1LW2A 3K5LA 4OKEA 3RRGA 3D45A 3M8SA 4CJ5A 2DFFA 4CF0A 4FJ8A 1IKYA 3O3FA 1KRPA 3L2RA 4CCHA 4CGGA 3PUFA 4FLVA 1VSIA 3RMAA 1KVAA 4JRQA 1DLOA 3T1AA 4DF8A 3RMBA 4KHUA 4NYNA 4E89A 3HP6A 4FJIA 2KZZA 4RW6A 1QQCA 3QERA 4N76A 2QKKA 4CEQA 3L8BA 2OZMA 4OKJA 5FDLA 1BQNA 4CIGA 3SPZA 1TK8A 1X1PA 2JGUA 3QIPA 4BDZA 4J2BA 3SQ4A 1B92A 4NCAA 4OLBA 4M3UA 3NF7A 1S1TA 4PUOA 1CLQA 3VN5A 5FRNA 4KTZA 4CIEA 5C25A 5HRNA 2HNZA 1BISA 5FRMA 1Y97A 3IRXA 4DTJA 4AILC 4CJRA 3S9HA 3WNHA 4DSLA 2G8UA 4KI6A 3AVMA 4CK3A 4B9VA 3LAMA 1LV5A 3K5NA 2FBVA 4BE2A 3V9ZA 4E1NA 1WSGA 2O4GA 4CEDA 4CJLA 4OPJA 3F73A 1LWCA 1MU2A 1ASVA 5D3GA 2WOMA 4KV8A 4KHWA 4O44A 4E1MA 4RW7A 3AA2A 4LY7A 4CJ3A 2NUBA 3NGIA 2P1JA 2F96A 4K8ZA 1YVUA 2HNDA 3B6OA 3RMDA 1L3UA 2YNHA 3QLHA 2FBTA 3V9WA 4CFAA 3CM5A 1QSLA 3OVNA 1J9AA 3SV3A 4CFBA 1VSLA 1RT1A 3AA4A 5DMRA 1XI1A 2ETJA 4CEFA 4CJTA 4CEOA 3OJUA 4FCYA 1L3TA 4CGFA 3A2FA 1J53A 4C8OA 4AHSA 4EP5A 2DY4A 4DMNA 1WLJA 1HPZA 3U3GA 4FVMA 4Y1DA 3OS2A 3ZSYA 4FLXA 4E7IA 4KO0A 2YNFA 4QAGA 3ZT1A 1TKDA 2HHVA 1NKBA 3SUPA 4TSXA 3MXJA 3P1GA 2HHXA 2IS3A 1EXQA 1C1BA 3NF6A 2Z1IA 3KLIA 3OYIA 3ZSXA 3QESA 3VQ8A 4CECA 2A1RA 3I0RA 4M3XA 1VSEA 2BE2A 4AH9A 4DU1A 4F3OA 2F8TA 4M3RA 4DWIA 1RT3A 3MECA 5KRTA 4KB0A 1C0UA 3OYNA 3JSMA 4DQIA 5FROA 3HXMA 3NF8A 1RTHA 3OYCA 2G8HA 2HHQA 4W5RA 4FLZA 3H08A 3SUOA 1QSSA 3QEXA 3DRPA 4YNQA 2QK9A 3LALA 2E6LA 5CZ1A 1RBRA 4CHQA 4LSNA 3SPYA 2IC3A 2FC0A 5C42A 3TAQA 1UOCA 1LWFA 2RPIA 4DSEA 4GW6A 4KREA 1Z25A 1JL1A 3BDPA 1VSHA 4IG3A 2OYQA 3HO1A 4BE1A 2RN2A 2KZMA 1RBVA 1HQEA 3P83D 4LD0A 3LWMA 2EX3A 5SWMA 2A1SA 4M41A 3AO2A 2FBYA 4W5OA 4FM2A 2HW3A 1WAFA 2YNGA 3V9SA 3NCIA 4DQPA 4FJHA 1ITGA 1BI4B 1SKWA 1NKCA 3VQQA 2WONA 2XRIA 4CE9A 3RR7A 1RT6A 3TABA 3KJVA 1Q9XA 4LH4A 4DTOA 2O4IA 1HMVA 1L5UA 1EX4A 1BHLA 1X9MA 3LPTA 1VK0A 3LANA 3QIOA 3NH2A 2E4LA 4JS5A 3EY1A 3VQ5A 2Y1JA 2X78A 3KIOA 4FJLA 4DLEA 4F3TA 3VQ4A 3K57A 1QSYA 3AVKA 3L3UA 4FZXC 3WNFA 3OS1A 3O4QA 1RDCA 2XY5A 4DU4A 1J5OA 4F2SA 1BIZA 1VSKA 2HNYA 2OPPA 4HCBA 2GV9A 4C8LA 1FK9A 4W5TA 4PQUA 1IKXA 1KFDA 1WSEA 1NK4A 4FXDA 4CFDA 3IG1A 5K14A 4CJFA 4O0IA 1EETA 3ZT4A 4DFKA 2BANA 3DRSA 2HHUA 3B6PA 4DTMA 1BQMA 4Z4IA 1C0MA 2G8KA 3KTQA 4OLAA 1VSDA 3WNGA 3TAMA 3KLFA 4E19A 5HRPA 3V9XA 3VA0A 1N5YA 1NJWA 2PZSA 4FJNA 3SCXA 3V9UA 1ZYQA 2FBXA 1WSHA 3NDKA 2RKIA 5HRRA 2IAJA 3NAEA 2ATQA 4E0DA 3C6UA 1WN7A 1FKPA 4AHRA 4WE1A 1S6PA 1TGOA 1I3AA 1ZBLA 1BIUA 2E6MA 1L3VA 4FZYA 3HP9A 3V1QA 1IH7A 1U47A 4F4KA 4DF4A 3OYKA 3K58A 4DTUA 4FW1A 3OYJA 4HUEA 3SQ2A 4J2EA 5SZTA 1KVBA 1RBSA 2DFHA 3KKSA 3RWUA 3DM2A 4FJ5A 4FJXA 2DTUA 1VRTA 4B3OA 4CGIA 4DLGA 4ELUA 3DRRA 1W0HA 1HJRA 3NHGA 5J2MA 1HYVA 3TAGA 1IG9A 3P5JA 1KCFA 3QO9A 1XHZA 4FW2A 4C8NA 3K2PA 4CHOA 4BDPA 1RDBA 3ZSVA 4CEEA 5HLFA 3OYMA 2YV0X 3ZT3A 4Z4HA 3ZCMA 1T8EA 4DQSA 5CYQA 1SUQA 3M8PA 1WNSA 2ITGA 1NK0A 4CHPA 4GMJB 3AO5A 1HYZA 1TKXA 1B9DA 4AHTA 4FLWA 1Z26A 3QEPA 4CEBA 4B9SA 2IOCA 4H4OA 1G15A 4E7HA 1O1WA 3KD5E 2Z1HA 4C8KA 4JLHA 4I9LA 3THVA 4HTUA 4KTWA 4KFBA 3O3GA 1ZBIA 1S5JA 1RILA 1TL1A 4CJUA 1SL0A 1NJXA 5T7BA 4CIFA 2W42A 4CEZA 4RW4A 1HQUA 2VG7A 4E7LA 1T03A 2F8SA 2B4JA 5JS2A 4CJSA 3SUNA 2BGGA 3ASMA 1CXQA 1UA1A 3M8QA 3LAKA 3HPGA 4G1QA 3LZJA 1N6QA 2PY5A 4OGCA 4IDKA 3DLKA 4UQGA 3MEEA 4MFBA 4CEAA 4CGHA 3S3NA 3HPOA 3HK2A 3PX6A 3AVAA 2B6AA 4F8RA 3RTVA 1RDDA 2HB5A 4E3SA 3PX0A 4MQ3A 2YHAA 4IBNA 3SV4A 4JS4A 4CJVA 3V4IA 4CJ4A 1HNIA 1JKHA 1WAJA 3KKRA 3ALYA 4FJ9A 1TK5A 1A5XA 4HVJA 1DTTA 1S9EA 2LSNA 1C6VA 1I39A 5KTQA 2VG6A 3RR8A 3M8RA 4IFYA 4C8MA 4HCCA 2DFEA 4LSLA 3HVRA 4BE0A 4FJMA 1JL2A 2Z1JA 3QETA 4DSJA 4KAZA 4EP4A 1ASUA 4W5NA 3AVLA 3DLGA 1NK6A 1TKZA 1KTQA 2OPQA 3VQ9A 3L2WA 4IFVA 1U45A 3HYFA 1BCOA 4DSFA 4CJPA 4M3YA 3OYBA 1JXEA 3L3VA 3CFPA 3LZIA 4DTXA 4KPYA 2ZQBA 4DS5A 1C1CA 4F2RA 1TV6A 4Z4CA 2YNIA 2KQ2A 3VQDA 3NGZA 3S3OA 1NK5A 3DLHA 5E41A 4CESA 1VSJA 3VQPA 4Z0UA 3OS0A 1SKSA 3I8DA 2Y1IA 5KRSA 3O3HA 1BL3A 3HM9A 4RW9A 4N47A 4NCGA 3AA5X 5HRSA 3D0PA 4DS4A 4R5PA 3T3FA 3V81A 4CK2A 2XHBA 4B9NA 4M3WA 3SZ2A 3PO5A 3V1OA 3E01A 3AVCA 4QCLA 3G10A 3U6FA 1IKVA 1UAXA 4FYDA 3U3YA 3CM6A 4ZTFA 4DFPA 4B9UA 4N5SA 1RT7A 3ITHA 3ZSZA 3K5MA 1T7PA 4KHYA 1YTAA 1RTJA 3AVJA 4CF8A 3DOKA 3NGYA 3NE6A 3QEVA 2QXFA 2YHBA 2ZE2A 3CFRA 2D0AA 1CZ9A 4FJGA 1X9SA 1S1XA 1JLBA 1WSFA 4M3TA 3OYLA 1JLAA 4PWDA 3RRHA 3V1RA 3HVTA 1JXBA 4O0JA 4B8CA 3LDSA 5KGWA 3HPHA 3VQBA 2VG5A 2VWKA 2HVHA 2IGIA 2KW4A 1RBTA 1KFSA 3CG7A 2IDOA 3DOLA 4Q5VA 3HT3A 3SYZA 5JS1A 5CY4A 3KK2A 1TVRA 4CHYA 5CYMA 3G0ZA 4NYFA 2P5OA 4FJJA 3SUQA 4IG0A 2OA8A 2EHGA 4OGEA 5I3UA 3NF9A 3OYFA 4KTQA 1REVA 3PX4A 3EYZA 2P51A 4DQQA 4O5BA 3AO3A 1NOYA 1QHTA 4Z4EA 4KHSA 4H4MA 1C0TA 1LW0A 3TARA 3NFAA 2XY6A 3QNNA 4Z4GA 4I7FA 3NH0A 4I2QA 1D9FA 3C94A 1XWLA 2R7YA 4QOZB 1X9WA 1F21A 4BDYA 4DSIA 5KGXA 4FK2A 2PYLA 1JLGA 3ZSOA 4CF9A 4L8RB 3SQ0A 3ZSWA 1EKEA 3FFIA 1ASWA 1HNVA 1D9DA 4BACA 5HP1A 4RW8A 3AVGA 4ICLA 3OYGA 1SKRA 4DQRA 3HSTB 4AHUA 4CK1A 5DK5A 4N56A 4FLYA 3PV8A 2B5JA 3KLEA 4EZ9A 3TAEA 1TL3A 4I9QA 1YTUA 4RG8A 3JYTA 3AO4A 1R0AA 1S9GA 1GOBA 1QS4A 1LWEA 1BCMA 5CZ2A 2VWJA 3PY8A 2XY7A 1RCHA 2KFZA 1XHXA 3NBPA 1A5WA 4KHQA 1ZBHA 3OYAA 1NOZA 1B9FA 3UIQA 2P5GA 4J2DA 2X6NA 2KTQA 4DTRA 3VQCA 3RMCA 3VQAA 1VSFA 1T05A 1WSJA 1QTMA 1UWBA 1UA0A 3TANA 1TKTA 1EP4A 3DI6A 3DLEA 1U48A 3OYDA 4CF2A 2X6SA 4B9MA 1LAWA 4I2PA 4XIUA 2G8FA 4KI4A 3S3MA 4FK4A 4CGJA 2HVIA 4ELTA 3MEGA 3K59A 3LPUA 1HRHA 5EU7A 3DYAA 4JRPA 1S1UA 3MAQA 3SI6A 1BGXT 1KSPA 4Y1CA 4FLUA 2HMIA 3VQ6A 3KLGA 1JLEA 4FLTA 2KFNA 1SL1A 4BWMA 3NH1A 4FM1A 1KVCA 1D5AA 4HUFA 3SQ1A 3SJJA 4M42A 1WSIA 4PY5A 2YKNA 3AVNA 1Q9YA 3ISNC 3I0SA 3IS9A 3L2VA 3LWLA 3QEWA 3V6DA 5J2NA 3KLHA 3CFOA 3AV9A
chains in the Genus database with same CATH superfamily
1S6QA 1TUUA 1RT5A 1U04A 1NK8A 1V4TA 3AO1A 4KKOA 1RNHA 2JLEA 4B9LA 1HPMA 2HHSA 2OPRA 2OPSA 2RE2A 4N41A 3K5OA 4DTSA 3CYMA 1LCUA 1JLQA 1QQMA 3TAFA 1RT4A 4BRDA 3L2QA 3KK1A 3VF6A 2G8IA 1KLNA 4LFCK 3ZT0A 1NKEA 3QNOA 2XY8A 3M3ZA 5AJ3K 1IO2A 1SL2A 4JI5K 5KI6A 4DCHA 3VPZA 4X64K 1HYSA 4LH5A 2NRVA 4CFCA 4DFJA 2XO7A 3LP1A 3QFUA 5C24A 3VERA 4W5QA 5AZIA 1GOCA 1VQ8N 1VHXA 4DG1A 3CC4N 2O8CA 4MO5A 4EIAA 5HBMA 2OTLN 1XNQK 5B8HA 1U4BA 4FK0A 1TAUA 1LAVA 2QW9A 3VOVA 4PA1A 3HL8A 3O4WA 3SNNA 4M63C 1ILYA 2YI1A 2O8BB 2ZGYA 5BPNA 2D5RA 5LY3A 4CW7B 2OZSA 5M1FA 3PO4A 2VYPA 3UKRB 1XNRK 5J1EA 3AGRA 5KPZA 1RTDA 5BRDA 2O8CB 2ASOA 3DMJA 4CZJA 4EZ6A 2RF2A 4GVEA 1JJ2M 1DEJA 4ZHRA 1NJZA 3HJFA 3CC7N 1K6YA 3BF1A 3RRGA 1KAXA 3D45A 3M8SA 4CJ5A 3VMFB 3CC2N 2W41A 2P9SA 1IKYA 3O3FA 3CCRN 1KRPA 3PUFA 4I6MA 5M1QA 1YHQN 2IVPA 4DF8A 4KHUA 2KZZA 4E89A 3VF4A 1QQCA 5KQDA 2NRRA 1BQNA 2FF3B 2JGUA 3QIPA 3SQ4A 5EVZA 4CJ7A 3P39A 5FRNA 4KTZA 2F7TA 2P9SB 3NVMA 4H0OA 4DTJA 1VQLN 4I6MB 2G8UA 1XUPO 3AVMA 4DV2K 3V9ZA 4OPJA 3ID8A 1MU2A 3CJCA 2WOMA 4QS7A 4KV8A 4O44A 4CZIA 3CCUN 4B1VA 2E2OA 4CJ3A 4CBWA 2P1JA 3G4SN 4B1UB 2HNDA 2A41A 2GWKA 2FF6A 3V9WA 3CM5A 4PKHA 1VSLA 1RT1A 1XI1A 4CJTA 4CEOA 3OJUA 1HJOA 2RHKA 4CZFA 4CGFA 4HWIA 1HPZA 2HBKA 4FLXA 4PL8A 4E7IA 2YNFA 4QAGA 4YORA 2IS3A 1EXQA 3KLIA 1W2BM 2Q1NA 1K8AO 2JWKA 2A1RA 1VSEA 4DWIA 4DR7K 4JD2B 3OYNA 3CERA 2QWRA 2HHQA 4W5RA 2O8DA 5LMNK 3E9OA 5JICA 2WBNA 1HKGA 4BRPA 4BRHA 3DRPA 2WUSA 3PIOL 2QK9A 3LALA 1RBRA 4CHQA 4LSNA 1YUWA 3SPYA 2FC0A 3TAQA 1UOCA 1Z25A 1I94K 4JN4A 1JL1A 1OVQA 3HO1A 1HQEA 2A1SA 1V4SA 4FM2A 3R8EA 2HW3A 1WAFA 3V9SA 3NCIA 1BI4B 1SKWA 3VQQA 2AA4A 3W3DA 4CE9A 4YOYA 3ENHA 3KJVA 3O9RA 3BZCA 2O4IA 1TK5A 3LANA 2NRTA 4JS5A 4F3TA 4A2BA 4L3QA 1E4FT 3OS1A 3O4QA 4BRAA 4RWTA 4F2SA 1G99A 4HCBA 4W5TA 1IKXA 1JCGA 4CFDA 2UXCK 3R1XA 2BANA 4JI1K 1VQ4N 2HHUA 2IVOA 1C0MA 1S3XA 2QXLA 4E19A 3V9UA 3WXKA 4K42A 3E9LA 3DAWA 3L0QA 2ATQA 2ASMA 2P9IA 4R79A 1TGOA 5AFUH 5ADXH 2E6MA 3HP9A 1N36K 4DTUA 1VQ9N 3SQ2A 2DFHA 4JK7A 1VRTA 1O13A 4A2AA 3NHGA 4O5FA 3TSPA 1HYVA 1IG9A 3QO9A 2QWLA 2QWOA 4ISEA 1KD1O 4H0XB 3E66A 3ZSVA 3A5NC 1T8EA 3ZT3A 4Z4HA 1IBMK 1HYZA 1TKXA 1Z26A 4LFBK 4DR3K 2E2QA 4E7HA 4C8KA 4JLHA 4I9LA 4CD3A 4HTUA 4KFBA 1BA1A 1TL1A 1RILA 1HR0K 4CJUA 1HQUA 1X3MA 2F8SA 2HF4A 2PY5A 3HPGA 4OGCA 4MFBA 3WXJA 3HPOA 1VQ7N 5KQ8A 3RTVA 4E3SA 3PX0A 5JLFA 3UKUA 4IBNA 2A42A 1Z6RA 4JS4A 2FSNA 4CJ4A 1HNIA 1JKHA 4UY8O 1N33K 1DTTA 1S9EA 4FWOA 2LSNA 2JWLA 5KTQA 5AQHA 4JI4K 4LSLA 4IOCL 2VQFK 4WFNL 4W5NA 1OH7A 2Q2RA 3UKUB 3L2WA 4YHHK 3OYBA 4IJAA 3HSCA 3LZIA 2ZQBA 1C1CA 3VEVA 2KQ2A 3VQDA 3O8MA 1NK5A 3DLHA 2Q31A 3C0BA 3OS0A 3I8DA 3O3HA 5C0YA 2E5LK 3U4LA 3MCAB 3FFKB 3WXIA 5AQOA 5IWAK 3SZ2A 3MMVA 3AVCA 3U6FA 3U3YA 3CM6A 4PHTX 4DFPA 4DV3K 3A8YA 3UE5A 3Q7CA 3CFRA 4FJGA 1JLBA 1ZXOA 3O6WA 4B8CA 1TYQA 2IGIA 2V7ZA 2NRHA 4JKBA 4YOXA 1VQMN 4B3RK 4LF5K 1TVRA 4FJJA 4MLHA 5CYMA 1OH6A 3SUQA 3VEWA 3THXA 1Q7YO 4KTQA 4O5BA 3AO3A 4WFBL 4JKEA 2AP1A 4H4MA 2E20A 2A6AA 3LDOA 4XH1A 4I7FA 4I2QA 5AQRA 4QOZB 1F21A 4BDYA 1RDWX 3CF5L 2PYLA 1OVYA 2QA4N 1YITN 3SQ0A 3THXB 3ZSWA 1HNVA 1NNEA 3AVGA 3OYGA 4AHUA 1BDGA 5DK5A 3MX2A 4EZ9A 2F8TA 4FXDA 3TAEA 1TL3A 3AO4A 4BQLA 1ATNA 1LWEA 5CZ2A 2KFZA 1XHXA 1NOZA 4J2DA 3HM8A 1C0GA 3VQCA 1QTMA 3DLEA 4KBOA 4DV1K 4YOWA 1KAYA 1NGGA 1NBWA 3CJ1A 5AQPA 3S3MA 2FXUA 2HVIA 3MEGA 3LPUA 2D0OA 5EU7A 3DYAA 1KSPA 4Y1CA 4FLUA 3VQ6A 5GADP 3LDLA 1SL1A 4BWMA 4PY5A 4JAXA 1Q9YA 3QEWA 1VQPN 2A3ZA 1VQ5N 4U67L 4H0PA 3W0LA 1QE1A 1SV5A 1SS6A 3E1YA 2P9LA 4ID1A 1E4GT 3WXMB 4BGAA 3U9DA 4OVLA 5JMVA 2YHYA 4M3ZA 1EQYA 3LDNA 4BWJA 2Z1GA 3LP3A 4ILGB 2BH1A 3DLBA 4Q0BA 1W9HA 2ZWHA 1YVNA 4O4GA 4ILHA 4GY2B 3AVIA 3HOSA 4JKDA 2GBZA 2YKMA 4CERA 3MEDA 3D2EA 4H8KA 2ZGZA 2P9LB 5M1NA 2D0BA 4B9TA 3K9KA 3O4NA 3CJAA 4Z4FA 1GLCG 3EO3A 1HLUA 2HHWA 4KB1A 2HHTA 3MK6A 3D2EB 3QEIA 3A5MC 3CHWA 1KLMA 3C95A 4MLEA 1RBUA 4IZ9A 3WUHA 1JLFA 2NRZA 1S1WA 3ZT2A 3L2UA 4KHNA 3CQ8A 4DHYA 1A5VA 4M45A 3TAPA 1J54A 3LP0A 4ID5A 4QS9A 5E84A 4IKFA 4O55A 3CMEN 2DPNA 4CGDA 1DTQA 4DTPA 1Q86O 2BDPA 2HHHK 1Q8IA 1VSMA 3DLRA 4OPKA 4K25A 4CJEA 2I5JA 3KK3A 1XMOK 1YT3A 3AA3A 3K5LA 1FW6A 2P9PA 5LJVA 2DFFA 1YJNN 3G71N 4FJ8A 4JKHA 4CCHA 3R3LA 4CGGA 4FLVA 3SBTA 4JRQA 3T1AA 3VETA 4G9ZA 4FJIA 3QERA 1IJJA 1BOTO 2QKKA 2OZMA 4H0YB 3R9PA 5KPRA 3E9PA 4BVOA 1X1PA 1QQOA 3I56N 4PUOA 1VQ6N 5HRNA 1BISA 4JI8K 4AILC 3S9HA 4LFAK 4NXMK 3WNHA 4DSLA 4KI6A 3GDQA 4CK3A 4DR4K 3P31A 3K5NA 2FBVA 3LM2A 4BE2A 2V51B 1T6DA 1WSGA 3JAMO 4CJLA 5JVHL 3F73A 4KHWA 4E1MA 3Q7BA 5BN9A 5KPTA 2F96A 4K8ZA 3RMDA 1HKBA 3B6OA 1L3UA 2YNHA 4YOUA 3OVNA 1J9AA 3SV3A 3AA4A 5DMRA 2ETJA 5FPEA 4FCYA 1L3TA 3EN9A 4DMNA 4FVMA 4AF1A 3LDPA 2HHVA 3VGKA 3SUPA 1GLLO 3SAHA 1NGBA 3MXJA 3OYIA 3NF6A 3IFRA 2YCHA 3QESA 3FZHA 4M3XA 3QBXA 2F9TA 4BGBA 5BRHA 4F3OA 1RT3A 3MECA 3VF2A 1HUXA 1JCEA 4DQIA 4DQ8A 5DM7L 1RTHA 4FLZA 3SUOA 3NVKA 2E6LA 4H5NA 5CZ1A 4YY3K 5MLCQ 1K9MO 1S22A 3J8AA 4JI6K 4IG3A 4BE1A 3P83D 1YIJN 3AO2A 2FBYA 5GAGP 4BRGA 4O8UA 3H3OB 4BR5A 3KHYA 1NKCA 1QZ5A 2E88A 3MWPA 4FWPA 3U8XA 2VGMA 3TABA 2W6KA 3C6HA 4LH4A 4A5AA 5JS1A 1BHLA 1X9MA 1VK0A 3NH2A 3QIOA 3EY1A 1RFQA 3VQ5A 3KIOA 3VQ4A 5AZIB 3AVKA 4FZXC 4FPBA 1BIZA 3J7YP 2HNYA 4PQUA 1WSEA 1NK4A 3IG1A 4JNEA 3TPQA 4DTMA 4LF9K 3DLLL 1HNWK 4BVPA 2G8KA 1VSDA 3WNGA 3V9XA 3KLFA 3VA0A 4FJNA 1K8KA 4FWMA 1ZYQA 1WSHA 3T69A 2RKIA 2UXBK 1J5EK 3NAEA 1CZAN 3OTOK 1WN7A 5HOOA 1NGDA 4WE1A 1S6PA 4H5VA 5JVGL 4BG8A 1ZBLA 3AAQA 4BR2A 1YJ9N 3F2KA 3OYKA 1VAZA 4FW1A 3WEEA 4J2EA 3IMXA 3RWUA 4FJXA 3DM2A 1E3MA 1SZ2A 4CGIA 4DLGA 4B3OA 4BRIA 4ELUA 1ZBSA 3DRRA 5AQIA 4NB4A 3C7NA 1KCFA 1YF5L 5H1SQ 3K2PA 4CHOA 4B9QA 4WYBA 4DQSA 3WEEB 1SUQA 3M8PA 4X65K 3AO5A 3QEPA 1B9DA 4DV6K 4DKWA 4BC4A 4H4OA 1G15A 3KD5E 2WFBA 4CI6A 3M1FA 3C7NB 3O3GA 5T7BA 2W42A 4BRQA 3O08A 2B4JA 5JS2A 4FWSA 1CXQA 5M1OA 4G1QA 3LAKA 3CETA 4BQZA 4BR0A 1UA1A 1FJGK 3O1BA 4DUZK 1NGEA 1YI2N 4LF6K 5BR9A 3AVAA 2HB5A 5LMUK 3ZLJA 1WOQA 3SV4A 1U2VA 2GWJA 1X3NA 4DR2K 4CJVA 3KKRA 4KHPK 4JKAA 4HVJA 1HNZK 3RR8A 3FZKA 5AQJA 4IFYA 4HCCA 3IUCA 4NO7A 4YOTA 4BE0A 4FJMA 4WQ4C 3QETA 3WQUA 4EP4A 1ASUA 1ATSA 3AVLA 1NK6A 4FOEA 2P9UA 2OPQA 1NJIO 3VQ9A 3BUZB 3HYFA 3QMLA 1HKCA 3O9UA 5EOYA 3AARA 4DS5A 4Z4CA 1QZ6A 2O8DB 3K0SA 3S3OA 5E41A 2UUAK 1VSJA 3FLCO 1SKSA 4NXNK 1U6ZA 2P9UB 3U9ZA 3AA5X 3QDKA 2QWQA 5LL6Z 4DR5K 2ZF5O 5AQFA 4QCLA 3G10A 1IKVA 1TUYA 3MX5A 3THWA 2Q0RA 4KHYA 1SAZA 3MN5A 3H45C 3NGYA 2YHBA 2D0AA 1CZ9A 1X9SA 3OYLA 1JLAA 1NG9A 4PWDA 3RRHA 1JXBA 1NGHA 5KGWA 3T1YK 1IBLK 2HVHA 2VWKA 3O9QA 1RBTA 3CG7A 3SYZA 3KK2A 2AJQA 4NYFA 4KH5A 2EHGA 3OYFA 2QTDA 3KWIA 1NOYA 1MDUB 3EE9A 5TKWA 3ZEUA 4KH4A 1GLBG 3NFAA 2VQEK 3QNNA 4Z4GA 3NH0A 3QFPA 1X9WA 2D0PA 4B1YB 1NWKA 4H5WA 3CJBA 2P9IB 3ZSOA 2UYTA 4L8RB 1ASWA 4IEEA 4BACA 5HP1A 4ICLA 3N4QA 1RGIA 3ZEUB 3R6MA 4I9QA 3JYTA 4FSVA 1BCMA 3VEOA 1RCHA 2H3GX 3NBPA 1A5WA 3DXMA 1ZBHA 4CZHA 4FWQA 4K43A 4DV7K 4BRLA 1WBBA 3VQAA 1T05A 1WSJA 1UWBA 1W7AA 3OYDA 4I2PA 2G8FA 4KI4A 3ENBA 5CE3A 4DB3A 1HRHA 3SI6A 2KFNA 3BEXA 3HRGA 2W40A 3KLGA 3DXMB 4FLTA 3SJJA 1WSIA 4AM7A 3FGUA 3L2VA 2HF3A 5J2NA 4H0TB 1KC8O 1WBDA 1TAQA 3WXLA 1GOAA 4GVMA 4KRFA 1S1VA 4A62A 5BN8A 3H46O 4WFAL 2X74A 4YDUA 3WNEA 1JLCA 2NZTA 3AVFA 3EE8A 1NK7A 4E7KA 3CCSN 1XQSC 5AQMA 3VQ7A 5C15A 4ISFA 3ATVA 3QINA 3BP8A 3LP2A 1YAGA 3ZSQA 3J80O 1L3SA 4IFEA 4KH6A 1NLVA 4B8AB 4U7BA 1LOTB 2EWSA 3OYHA 4ELVA 4BY9C 4C23A 4ZTJA 1RTIA 2D0CA 1DGKN 1XC9A 1NJYA 5F1XA 5AQNA 3OW2M 1ZBFA 2P9KA 1ZBUA 5AR0A 4X62K 4DU3A 1IG8A 3SBGA 4DSKA 5HROA 1CZBA 5J2PA 4CJKA 3TWHA 4B3MK 3LL3A 1FKOA 3MXMA 3UB5A 4FJ7A 4F9OA 1QQNA 4AHVA 4DFMA 1U49A 1NM1A 4YFUA 1RT2A 1FXXA 3TU5A 4OPHA 2P9KB 1C1AA 4J2AA 3MXIA 4A61A 1OH5A 3TR8A 2BTFA 4FWNA 4A59A 5J2QA 3F9KA 3VQEA 3IAYA 3P38A 2G8VA 5ELZA 3BGRA 3CPWM 5FPMA 3MCPA 3C65A 4B08A 3CCLN 3OJSA 3OBWA 4OKEA 4DV4K 5GIOA 1TYQB 4PL7A 3HI0A 1NGCA 4CF0A 5C2DA 1GLJO 3L2RA 3CIPA 3CCMN 1VSIA 3RMAA 2F4VK 1DLOA 3RMBA 3HP6A 2HBLA 4RW6A 2E8AA 1VQKN 4BRMA 2GEMA 4XH5A 3SPZA 3J7ZO 4BDZA 4FWKA 4OLBA 1B92A 4M3UA 1T44A 1S1TA 3NF7A 4CIEA 5C25A 2HNZA 1Y97A 4CJRA 1D4XA 4B9VA 3KZBA 3LAMA 1BA0A 1LV5A 4E1NA 4CEDA 1LWCA 1ASVA 5CHIA 4MDBA 3OHRA 1J6ZA 5JLHA 2CH5A 4BRKA 4RW7A 2HSTA 3AA2A 4GNIA 4LY7A 3M5RA 1T3VA 2QM1A 1QSLA 3FR0A 4OO1J 4E1JA 4O8KA 4CEFA 2VWBA 3CQXA 4IO9L 3A2FA 1J53A 5CR4A 4AHSA 4EP5A 4JK9A 5TKYA 1WLJA 5AQXA 3J7AP 4Y1DA 3ZT1A 1TKDA 4JI7K 4TSXA 5FPDA 3P1GA 1C1BA 3CCVN 4FL9A 4CECA 3P4IA 2BE2A 4AH9A 4BG9A 4DU1A 4M3RA 5I9EB 1C0UA 3JSMA 2G8HA 3A0IX 3A5OC 4A57A 3QEXA 4YNQA 2KKZA 5M1PA 2CGKA 3GOIA 5AFUA 5ADXA 2O8FA 1NGJA 1NGIA 4GW6A 2PFUA 4C1NK 4KREA 4JI3K 1DT9A 1VSHA 3L4QA 2OYQA 2RN2A 1RBVA 4LD0A 3LWMA 4JEPA 2HOEA 4M41A 4W5OA 2YNGA 4DQPA 1ITGA 3G6EN 2XRIA 4J8FA 1NGFA 3CMAN 2O8FB 5EXWA 4CZLA 4DTOA 1HMVA 1EO1A 2Y1JA 4DLEA 1P8ZA 3GL1A 1QSYA 3WNFA 2XY5A 1BO5O 2OPPA 2GV9A 1FK9A 3LM9A 3KWGA 3EKSA 3NMUA 4CJFA 1EETA 4BROA 4DFKA 3DRSA 3B6PA 5AZJA 1BQMA 3ATUA 3KTQA 5HRPA 3I8BA 1NJWA 1M90O 3VEZA 2FBXA 1GLAG 4FOIA 2IAJA 4E0DA 2NRXA 1H1VA 1FKPA 4AHRA 4BC2A 3S41A 1VQON 4FZYA 1L3VA 2E1YA 3RSEA 4DUYK 4CZMA 2P9PB 1RBSA 3KKSA 4RTFD 4FJ5A 1Q18A 1W0HA 5AQQA 1MWMA 3DJCA 4FW2A 4C8NA 5A2QO 1RDBA 4CD1A 3RSEB 5HLFA 3OYMA 2YV0X 3ZCMA 5AQLA 1MA9B 2E1ZA 1WNSA 2ITGA 2KLAA 4GMJB 1K73O 4GKKK 5M1KA 4CEBA 5C2FA 3J81O 5BREA 3ID6A 1O1WA 2Z1HA 1ZBIA 2V52B 3ZX3A 4CEZA 4GV9A 4H5TA 4BRCA 4E7LA 1T03A 3SUNA 2BGGA 3M8QA 1N6QA 3HOTA 3DLKA 4UQGA 4B3TK 1KAZA 3SMPA 4CEAA 3S3NA 1GLDG 3HK2A 4GV6A 2B6AA 4F8RA 3A5LC 4MQ3A 2YHAA 4DV0K 2CGJA 1IV0A 1S72N 1R59O 3MN6A 1Q82O 1WAJA 4FJ9A 1OH8A 3SAGA 1A5XA 3EEQA 2VG6A 3M8RA 5F0XA 4DR1K 2Z1JA 3FZMA 4DSJA 4KAZA 3ZX0A 3VEYA 3DLGA 1TKZA 1KTQA 1XC3A 3O9TA 5GINA 4IFVA 3G25A 4CJPA 1GLFO 3CFPA 4FO0A 5C10A 4DTXA 4FVUA 2UUCK 4K41A 2KHOA 4LC9B 3O5BA 4CESA 3VQPA 2A40A 3QB0A 2Y1IA 4XH4A 1BL3A 4RW9A 4NCGA 2NRWA 4MDAA 4DS4A 3D0PA 3T3FA 4CK2A 2XHBA 4K0KK 3PO5A 2O8BA 3V1OA 4FYDA 4ZTFA 3UKRA 4N5SA 1RT7A 2VGNA 3K5MA 1T7PA 3CJ7A 1RTJA 4CF8A 3DOKA 3NE6A 3QEVA 4BRNA 2ZE2A 4M3TA 4IDHA 4WF9L 3V1RA 4O0JA 3HPHA 3VQBA 1KFSA 4Q5VA 4BR7A 2P5OA 1WUAA 3VESA 3VGMA 4OGEA 5I3UA 3PX4A 3EYZA 2P51A 4DQQA 1QHTA 3TTCA 2GTDA 4KHSA 4X66K 1C0TA 1LW0A 3TARA 1K8KB 4LF7K 1D9FA 3C94A 1XWLA 3PSFA 2Q0UA 2R7YA 3CCQN 1Q81O 4DV5K 4FK2A 3JS6A 2I7NA 4BC5A 1YJWN 5FPNA 3TSUA 4CZKA 2IVNA 3EKUA 2OTJN 1D9DA 3O1WA 4CVNE 3HSTB 2VCPA 4CK1A 3PV8A 3KLEA 1TK0A 3MWTA 3O9SA 1GOBA 2VWJA 1VQNN 3VGLA 4MO4A 4M7XA 2KTQA 1P90A 1C0FA 4DTRA 4PKGA 1TKTA 1EP4A 4LF4K 4B9MA 1LAWA 3CJ9A 4XIUA 4CGJA 3DWLA 3O80A 4IEIA 4PKIA 3L4IA 2HMIA 1S1UA 1BGXT 4YOVA 4FM1A 3NH1A 2QWMA 1KVCA 1D5AA 2YHXA 4HUFA 2YKNA 3AVNA 4IWVA 3I0SA 3IS9A 3HTVA 4A5BA 3KLHA 3CFOA 3AV9A 4FPAA 4JD2A 4HUGA 4JI2K 1OKJA 4B3SK 2Q3SA 4IXCA 5AQYA 3EZ5A 3FZFA 3D6RA 2QKBA 4B1WB 4Z94A 4CJWA 2HBJA 2I7PA 4FM0A 3T19A 3MDQA 1D8YA 3SLCA 2YJEA 2Q97A 3ULDA 1KXPA 4HHTA 3C6TA 1U2VB 2F9WA 2FSKA 4BR4A 2GELA 5AQSA 1VRUA 2GUIA 4EAHD 4K8XA 1NMDA 1NGAA 1IKWA 3CXCM 5I42A 3KD1E 1CXUA 4XEIA 4DTNA 4JV5K 5AQUA 3AGKA 1BI4A 3N4PA 4JKGA 3ENOA 2ZD1A 3TI0A 4NCBA 2PYJA 3CQYA 4CJQA 4E7JA 1NK9A 4ILJA 4CF1A 1KQSM 3SK3A 3VEXA 4FJKA 2G8WA 4CHZA 3ZSRA 5IT9O 3T7ZA 4OJRA 3AVBA 5F2RA 4JKGB 4OKKA 3VA3A 5DM6L 4AHCA 4ISGA 1RDAA 2GUPA 3AVHA 2D1KA 3THWB 2OANA 4BC3A 3OY9A 4FZZA 2UUBK 1M1KO 3OYEA 3H3NO 4CHNA 5BPLA 4WQ5A 2Q36A 4JK8A 1YXQA 1LW2A 4B1XB 2QWPA 1NU0A 1BWFO 5EY4A 3VENA 3D7EO 1KVAA 3K9JA 5GIPA 4BR9A 4NYNA 1NMNA 4N76A 4CEQA 1ESVA 3L8BA 4OKJA 5FDLA 4CIGA 1TK8A 3BY5A 4EFHA 4J2BA 3H6EA 2YX6A 4NCAA 1CLQA 3VN5A 1Y64A 1Z05A 1QVGM 3IRXA 4M7YA 5HL7L 2PAVA 1T6CA 4GV3A 4H0VB 2CGLA 2O4GA 4CBUA 3H1QA 3TTFA 5BRFA 5D3GA 3MN7A 2NUBA 3I55N 3NGIA 3PLAA 2ITMA 1YVUA 3ZX2A 1SQKA 3QLHA 2FBTA 5AQVA 4CFAA 4CFBA 4C8OA 2DY4A 3U3GA 3OS2A 3ZSYA 4KO0A 4DR6K 1NKBA 2HHXA 2J4RA 2Z1IA 3M6GA 3ZSXA 1HNXK 3CPEA 3VQ8A 3FE1A 3F9MA 3I0RA 3CCEN 1EWQA 4KB0A 5KRTA 5FROA 3HXMA 3NF8A 3JXUA 3OYCA 3H08A 4IOXA 1QSSA 4JKCA 2OCEA 3VTHA 3C6AA 4JKFA 4H5RA 2IC3A 5C42A 4DSEA 1LWFA 2RPIA 2P9NA 3BDPA 2D4WA 2NNWA 1N32K 2KZMA 1NJXA 5FRMA 2EX3A 5SWMA 2UU9K 3CI5A 1MWKA 4FJHA 5BPMA 2WONA 3RR7A 3GE1A 5GAHP 3ZETA 1RT6A 3H1VX 2QEXN 1Q9XA 5GAEP 1L5UA 2YHWA 1EX4A 3LPTA 3TSQA 2P9NB 2E4LA 4FJLA 2X78A 1HX1A 3K57A 3HZ6A 3L3UA 2V7YA 1J5OA 1RDCA 4RCHA 4DU4A 1VSKA 3DXKA 4NLCA 3VTIA 2ZM6K 4C8LA 1KFDA 4O0IA 3AY9A 5K14A 3ZT4A 3EZWA 2FSJA 3ZETB 4LF8K 4Z4IA 5AQGA 4OLAA 3MN9A 3TAMA 1XMQK 3CCJN 4WCEL 3T1HK 1N5YA 2PZSA 3SCXA 5LJWA 2GX9A 3NDKA 3ZYYX 4EHUA 5HRRA 4V19S 3WQTA 1W97L 3C6UA 5FLXO 3L6QA 4CZEA 3THYA 2NLXA 2ASPA 3DXKB 1I3AA 2W6LA 3WT0A 1BIUA 3V1QA 1IH7A 1U47A 4F4KA 4DF4A 2HMPA 3QICA 3K58A 3OYJA 4HUEA 3SAFA 5SZTA 1KVBA 2DTUA 4Y0WA 1HJRA 5J2MA 3TAGA 3P5JA 3FZLA 3THYB 1QVFM 4QS8A 1XHZA 4BDPA 4JHDA 4CEEA 5AQZA 5CYQA 4C1NI 1ATRA 1NK0A 4CHPA 4AHTA 4FLWA 4B9SA 3EL2A 4JI0K 2IOCA 1BU6O 3PIPL 3THVA 4KTWA 1S5JA 1SL0A 2HBMA 4CIFA 3OA9A 4RW4A 2VG7A 4JHDB 4BREA 3BF3A 3IKMA 4CJSA 3ASMA 3LZJA 4B1ZA 5EX5A 4IDKA 4OX9K 3SMSA 3MEEA 4CGHA 2QWNA 3PX6A 4CBXA 1RDDA 1RDUA 2FLOA 2ZJPL 4FWLA 5AQWA 3V4IA 3ALYA 4BRFA 1DKGD 1C6VA 3OBYA 1I39A 4CZGA 4C8MA 1N8RO 3KK7A 3LDQA 2DFEA 1GLEG 3HVRA 2WTUA 3F5TA 4IJNA 1JL2A 3SJHA 2O8EA 4WQ5C 1U45A 1BCOA 3ULEA 4DSFA 4M3YA 1JXEA 3L3VA 4KPYA 5BR8K 4F2RA 1TV6A 2YNIA 3NGZA 1X9JA 1ZC6A 4FWRA 4Z0UA 2BUPA 5KRSA 2O8EB 3HM9A 4N47A 3ULEB 5HRSA 4M3WA 4R5PA 4HTLA 3V81A 4B9NA 2ZJRL 1BUPA 1IBKK 3E01A 1UAXA 4B9UA 3ITHA 3ZSZA 1YTAA 3AVJA 3I33A 2CH6A 2QXFA 2ZJQL 1S1XA 1WSFA 2E2PA 3HVTA 3LDSA 3GBTA 4IOAL 2VG5A 2KW4A 3RVCA 3AAPA 2QI2A 2WC9A 3DOLA 2IDOA 3HT3A 2UXDK 5CY4A 3D2FA 4CHYA 3G0ZA 3B8AX 3CD6N 4IG0A 2OA8A 4WQ4A 1WB9A 3NF9A 2PBDA 1REVA 2YJFA 2IIRA 5AZJB 4Z4EA 4NLBA 4AQYK 2XY6A 3BZKA 4YDUC 5E26A 4GKJK 4DSIA 3TTDA 5KGXA 1QHAA 3D2FB 1BG3A 1JLGA 4CF9A 3KVGA 1EKEA 4JYAK 3FFIA 3QBWA 4RW8A 5C12A 1SKRA 4DQRA 4IO8A 4N56A 1YTUA 4FLYA 2B5JA 4RG8A 1R0AA 1S9GA 4AM6A 1QS4A 4OPAA 3PY8A 2XY7A 3IDHA 4H03B 4KHQA 3OYAA 2E2NA 1B9FA 3UIQA 2P5GA 2X6NA 3RMCA 1VSFA 5AQKA 1UA0A 3TANA 3DI6A 1U48A 1N34K 4CF2A 2X6SA 5AQTA 3PSIA 4FK4A 4EHTA 4ELTA 2A5XA 3K59A 1JCFA 4JRPA 3MAQA 1JLEA 1EWRA 4M42A 3SQ1A 3HBTA 3ISNC 3LWLA 3V6DA 3GG4A
chains in the Genus database with same CATH topology
1S6QA 1QE1A 4HUGA 1RT5A 1SV5A 1TAQA 1U04A 1NK8A 4ID1A 1GOAA 3AO1A 4GVMA 4KKOA 2Q3SA 4KRFA 1S1VA 4OVLA 4M3ZA 1RNHA 2JLEA 3EZ5A 2QKBA 4B9LA 2X74A 3WNEA 4BWJA 2Z1GA 2OPRA 4CJWA 2HHSA 2OPSA 3LP3A 3T19A 4FM0A 1D8YA 1JLCA 3DLBA 4Q0BA 3ULDA 1W9HA 3K5OA 3AVFA 4N41A 4HHTA 4DTSA 3C6TA 1NK7A 4O4GA 4E7KA 3CYMA 3AVIA 3VQ7A 2GBZA 2YKMA 1JLQA 3MEDA 4CERA 1VRUA 3QINA 4H8KA 3LP2A 3ZSQA 2GUIA 1RT4A 2D0BA 3TAFA 4B9TA 4K8XA 3L2QA 3KK1A 1IKWA 5I42A 2G8IA 3KD1E 1L3SA 1KLNA 3ZT0A 1CXUA 4DTNA 1TK0A 1NKEA 3O4NA 4B8AB 3QNOA 2XY8A 1IO2A 4Z4FA 4ELVA 3OYHA 1BI4A 1SL2A 4ZTJA 5KI6A 1RTIA 2D0CA 1HYSA 1XC9A 4LH5A 1NJYA 3TI0A 2ZD1A 4NCBA 2PYJA 4CFCA 4DFJA 4CJQA 2XO7A 4E7JA 1NK9A 4CF1A 2HHWA 1ZBFA 3LP1A 4KB1A 1ZBUA 5C24A 4W5QA 3QEIA 2HHTA 1KLMA 3C95A 1RBUA 4FJKA 4DU3A 1JLFA 2G8WA 4DSKA 4CHZA 5HROA 1GOCA 1S1WA 4DG1A 1CZBA 5J2PA 3ZSRA 5HBMA 3ZT2A 4CJKA 3L2UA 3TWHA 3CQ8A 1U4BA 4KHNA 1A5VA 4M45A 1FKOA 4OJRA 3MXMA 3AVBA 4FJ7A 4FK0A 1TAUA 3TAPA 4AHVA 1J54A 1LAVA 3LP0A 4ID5A 4OKKA 3VA3A 4DFMA 4PA1A 3HL8A 1RT2A 4YFUA 3SNNA 1U49A 1FXXA 4IKFA 4O55A 4AHCA 1RDAA 1C1AA 1DTQA 4CGDA 4J2AA 4DTPA 3MXIA 2D5RA 2BDPA 3AVHA 2OZSA 3TR8A 3PO4A 5J2QA 3F9KA 2AJQA 3VQEA 5J1EA 1Q8IA 2G8VA 3IAYA 1VSMA 1RTDA 3OY9A 3BGRA 4FZZA 3DLRA 3DMJA 4OPKA 3OYEA 4EZ6A 2RF2A 4CJEA 4CHNA 4ZHRA 1NJZA 3HJFA 2I5JA 3KK3A 4B08A 1K6YA 1YT3A 3AA3A 3OJSA 1LW2A 3K5LA 4OKEA 3RRGA 3D45A 3M8SA 4CJ5A 2DFFA 4CF0A 4FJ8A 1IKYA 3O3FA 1KRPA 3L2RA 4CCHA 4CGGA 3PUFA 4FLVA 1VSIA 3RMAA 1KVAA 4JRQA 1DLOA 3T1AA 4DF8A 3RMBA 4KHUA 4NYNA 4E89A 3HP6A 4FJIA 2KZZA 4RW6A 1QQCA 3QERA 4N76A 2QKKA 4CEQA 3L8BA 2OZMA 4OKJA 5FDLA 1BQNA 4CIGA 3SPZA 1TK8A 1X1PA 2JGUA 3QIPA 4BDZA 4J2BA 3SQ4A 1B92A 4NCAA 4OLBA 4M3UA 3NF7A 1S1TA 4PUOA 1CLQA 3VN5A 5FRNA 4KTZA 4CIEA 5C25A 5HRNA 2HNZA 1BISA 5FRMA 1Y97A 3IRXA 4DTJA 4AILC 4CJRA 3S9HA 3WNHA 4DSLA 2G8UA 4KI6A 3AVMA 4CK3A 4B9VA 3LAMA 1LV5A 3K5NA 2FBVA 4BE2A 3V9ZA 4E1NA 1WSGA 2O4GA 4CEDA 4CJLA 4OPJA 3F73A 1LWCA 1MU2A 1ASVA 5D3GA 2WOMA 4KV8A 4KHWA 4O44A 4E1MA 4RW7A 3AA2A 4LY7A 4CJ3A 2NUBA 3NGIA 2P1JA 2F96A 4K8ZA 1YVUA 2HNDA 3B6OA 3RMDA 1L3UA 2YNHA 3QLHA 2FBTA 3V9WA 4CFAA 3CM5A 1QSLA 3OVNA 1J9AA 3SV3A 4CFBA 1VSLA 1RT1A 3AA4A 5DMRA 1XI1A 2ETJA 4CEFA 4CJTA 4CEOA 3OJUA 4FCYA 1L3TA 4CGFA 3A2FA 1J53A 4C8OA 4AHSA 4EP5A 2DY4A 4DMNA 1WLJA 1HPZA 3U3GA 4FVMA 4Y1DA 3OS2A 3ZSYA 4FLXA 4E7IA 4KO0A 2YNFA 4QAGA 3ZT1A 1TKDA 2HHVA 1NKBA 3SUPA 4TSXA 3MXJA 3P1GA 2HHXA 2IS3A 1EXQA 1C1BA 3NF6A 2Z1IA 3KLIA 3OYIA 3ZSXA 3QESA 3VQ8A 4CECA 2A1RA 3I0RA 4M3XA 1VSEA 2BE2A 4AH9A 4DU1A 4F3OA 2F8TA 4M3RA 4DWIA 1RT3A 3MECA 5KRTA 4KB0A 1C0UA 3OYNA 3JSMA 4DQIA 5FROA 3HXMA 3NF8A 1RTHA 3OYCA 2G8HA 2HHQA 4W5RA 4FLZA 3H08A 3SUOA 1QSSA 3QEXA 3DRPA 4YNQA 2QK9A 3LALA 2E6LA 5CZ1A 1RBRA 4CHQA 4LSNA 3SPYA 2IC3A 2FC0A 5C42A 3TAQA 1UOCA 1LWFA 2RPIA 4DSEA 4GW6A 4KREA 1Z25A 1JL1A 3BDPA 1VSHA 4IG3A 2OYQA 3HO1A 4BE1A 2RN2A 2KZMA 1RBVA 1HQEA 3P83D 4LD0A 3LWMA 2EX3A 5SWMA 2A1SA 4M41A 3AO2A 2FBYA 4W5OA 4FM2A 2HW3A 1WAFA 2YNGA 3V9SA 3NCIA 4DQPA 4FJHA 1ITGA 1BI4B 1SKWA 1NKCA 3VQQA 2WONA 2XRIA 4CE9A 3RR7A 1RT6A 3TABA 3KJVA 1Q9XA 4LH4A 4DTOA 2O4IA 1HMVA 1L5UA 1EX4A 1BHLA 1X9MA 3LPTA 1VK0A 3LANA 3QIOA 3NH2A 2E4LA 4JS5A 3EY1A 3VQ5A 2Y1JA 2X78A 3KIOA 4FJLA 4DLEA 4F3TA 3VQ4A 3K57A 1QSYA 3AVKA 3L3UA 4FZXC 3WNFA 3OS1A 3O4QA 1RDCA 2XY5A 4DU4A 1J5OA 4F2SA 1BIZA 1VSKA 2HNYA 2OPPA 4HCBA 2GV9A 4C8LA 1FK9A 4W5TA 4PQUA 1IKXA 1KFDA 1WSEA 1NK4A 4FXDA 4CFDA 3IG1A 5K14A 4CJFA 4O0IA 1EETA 3ZT4A 4DFKA 2BANA 3DRSA 2HHUA 3B6PA 4DTMA 1BQMA 4Z4IA 1C0MA 2G8KA 3KTQA 4OLAA 1VSDA 3WNGA 3TAMA 3KLFA 4E19A 5HRPA 3V9XA 3VA0A 1N5YA 1NJWA 2PZSA 4FJNA 3SCXA 3V9UA 1ZYQA 2FBXA 1WSHA 3NDKA 2RKIA 5HRRA 2IAJA 3NAEA 2ATQA 4E0DA 3C6UA 1WN7A 1FKPA 4AHRA 4WE1A 1S6PA 1TGOA 1I3AA 1ZBLA 1BIUA 2E6MA 1L3VA 4FZYA 3HP9A 3V1QA 1IH7A 1U47A 4F4KA 4DF4A 3OYKA 3K58A 4DTUA 4FW1A 3OYJA 4HUEA 3SQ2A 4J2EA 5SZTA 1KVBA 1RBSA 2DFHA 3KKSA 3RWUA 3DM2A 4FJ5A 4FJXA 2DTUA 1VRTA 4B3OA 4CGIA 4DLGA 4ELUA 3DRRA 1W0HA 1HJRA 3NHGA 5J2MA 1HYVA 3TAGA 1IG9A 3P5JA 1KCFA 3QO9A 1XHZA 4FW2A 4C8NA 3K2PA 4CHOA 4BDPA 1RDBA 3ZSVA 4CEEA 5HLFA 3OYMA 2YV0X 3ZT3A 4Z4HA 3ZCMA 1T8EA 4DQSA 5CYQA 1SUQA 3M8PA 1WNSA 2ITGA 1NK0A 4CHPA 4GMJB 3AO5A 1HYZA 1TKXA 1B9DA 4AHTA 4FLWA 1Z26A 3QEPA 4CEBA 4B9SA 2IOCA 4H4OA 1G15A 4E7HA 1O1WA 3KD5E 2Z1HA 4C8KA 4JLHA 4I9LA 3THVA 4HTUA 4KTWA 4KFBA 3O3GA 1ZBIA 1S5JA 1RILA 1TL1A 4CJUA 1SL0A 1NJXA 5T7BA 4CIFA 2W42A 4CEZA 4RW4A 1HQUA 2VG7A 4E7LA 1T03A 2F8SA 2B4JA 5JS2A 4CJSA 3SUNA 2BGGA 3ASMA 1CXQA 1UA1A 3M8QA 3LAKA 3HPGA 4G1QA 3LZJA 1N6QA 2PY5A 4OGCA 4IDKA 3DLKA 4UQGA 3MEEA 4MFBA 4CEAA 4CGHA 3S3NA 3HPOA 3HK2A 3PX6A 3AVAA 2B6AA 4F8RA 3RTVA 1RDDA 2HB5A 4E3SA 3PX0A 4MQ3A 2YHAA 4IBNA 3SV4A 4JS4A 4CJVA 3V4IA 4CJ4A 1HNIA 1JKHA 1WAJA 3KKRA 3ALYA 4FJ9A 1TK5A 1A5XA 4HVJA 1DTTA 1S9EA 2LSNA 1C6VA 1I39A 5KTQA 2VG6A 3RR8A 3M8RA 4IFYA 4C8MA 4HCCA 2DFEA 4LSLA 3HVRA 4BE0A 4FJMA 1JL2A 2Z1JA 3QETA 4DSJA 4KAZA 4EP4A 1ASUA 4W5NA 3AVLA 3DLGA 1NK6A 1TKZA 1KTQA 2OPQA 3VQ9A 3L2WA 4IFVA 1U45A 3HYFA 1BCOA 4DSFA 4CJPA 4M3YA 3OYBA 1JXEA 3L3VA 3CFPA 3LZIA 4DTXA 4KPYA 2ZQBA 4DS5A 1C1CA 4F2RA 1TV6A 4Z4CA 2YNIA 2KQ2A 3VQDA 3NGZA 3S3OA 1NK5A 3DLHA 5E41A 4CESA 1VSJA 3VQPA 4Z0UA 3OS0A 1SKSA 3I8DA 2Y1IA 5KRSA 3O3HA 1BL3A 3HM9A 4RW9A 4N47A 4NCGA 3AA5X 5HRSA 3D0PA 4DS4A 4R5PA 3T3FA 3V81A 4CK2A 2XHBA 4B9NA 4M3WA 3SZ2A 3PO5A 3V1OA 3E01A 3AVCA 4QCLA 3G10A 3U6FA 1IKVA 1UAXA 4FYDA 3U3YA 3CM6A 4ZTFA 4DFPA 4B9UA 4N5SA 1RT7A 3ITHA 3ZSZA 3K5MA 1T7PA 4KHYA 1YTAA 1RTJA 3AVJA 4CF8A 3DOKA 3NGYA 3NE6A 3QEVA 2QXFA 2YHBA 2ZE2A 3CFRA 2D0AA 1CZ9A 4FJGA 1X9SA 1S1XA 1JLBA 1WSFA 4M3TA 3OYLA 1JLAA 4PWDA 3RRHA 3V1RA 3HVTA 1JXBA 4O0JA 4B8CA 3LDSA 5KGWA 3HPHA 3VQBA 2VG5A 2VWKA 2HVHA 2IGIA 2KW4A 1RBTA 1KFSA 3CG7A 2IDOA 3DOLA 4Q5VA 3HT3A 3SYZA 5JS1A 5CY4A 3KK2A 1TVRA 4CHYA 5CYMA 3G0ZA 4NYFA 2P5OA 4FJJA 3SUQA 4IG0A 2OA8A 2EHGA 4OGEA 5I3UA 3NF9A 3OYFA 4KTQA 1REVA 3PX4A 3EYZA 2P51A 4DQQA 4O5BA 3AO3A 1NOYA 1QHTA 4Z4EA 4KHSA 4H4MA 1C0TA 1LW0A 3TARA 3NFAA 2XY6A 3QNNA 4Z4GA 4I7FA 3NH0A 4I2QA 1D9FA 3C94A 1XWLA 2R7YA 4QOZB 1X9WA 1F21A 4BDYA 4DSIA 5KGXA 4FK2A 2PYLA 1JLGA 3ZSOA 4CF9A 4L8RB 3SQ0A 3ZSWA 1EKEA 3FFIA 1ASWA 1HNVA 1D9DA 4BACA 5HP1A 4RW8A 3AVGA 4ICLA 3OYGA 1SKRA 4DQRA 3HSTB 4AHUA 4CK1A 5DK5A 4N56A 4FLYA 3PV8A 2B5JA 3KLEA 4EZ9A 3TAEA 1TL3A 4I9QA 1YTUA 4RG8A 3JYTA 3AO4A 1R0AA 1S9GA 1GOBA 1QS4A 1LWEA 1BCMA 5CZ2A 2VWJA 3PY8A 2XY7A 1RCHA 2KFZA 1XHXA 3NBPA 1A5WA 4KHQA 1ZBHA 3OYAA 1NOZA 1B9FA 3UIQA 2P5GA 4J2DA 2X6NA 2KTQA 4DTRA 3VQCA 3RMCA 3VQAA 1VSFA 1T05A 1WSJA 1QTMA 1UWBA 1UA0A 3TANA 1TKTA 1EP4A 3DI6A 3DLEA 1U48A 3OYDA 4CF2A 2X6SA 4B9MA 1LAWA 4I2PA 4XIUA 2G8FA 4KI4A 3S3MA 4FK4A 4CGJA 2HVIA 4ELTA 3MEGA 3K59A 3LPUA 1HRHA 5EU7A 3DYAA 4JRPA 1S1UA 3MAQA 3SI6A 1BGXT 1KSPA 4Y1CA 4FLUA 2HMIA 3VQ6A 3KLGA 1JLEA 4FLTA 2KFNA 1SL1A 4BWMA 3NH1A 4FM1A 1KVCA 1D5AA 4HUFA 3SQ1A 3SJJA 4M42A 1WSIA 4PY5A 2YKNA 3AVNA 1Q9YA 3ISNC 3I0SA 3IS9A 3L2VA 3LWLA 3QEWA 3V6DA 5J2NA 3KLHA 3CFOA 3AV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S6Q A;  1QE1 A;  4HUG A;  1RT5 A;  1SV5 A;  1TAQ A;  1U04 A;  1NK8 A;  4ID1 A;  1GOA A;  3AO1 A;  4GVM A;  4KKO A;  2Q3S A;  4KRF A;  1S1V A;  4OVL A;  4M3Z A;  1RNH A;  2JLE A;  3EZ5 A;  2QKB A;  4B9L A;  2X74 A;  3WNE A;  4BWJ A;  2Z1G A;  2OPR A;  4CJW A;  2HHS A;  2OPS A;  3LP3 A;  3T19 A;  4FM0 A;  1D8Y A;  1JLC A;  3DLB A;  4Q0B A;  3ULD A;  1W9H A;  3K5O A;  3AVF A;  4N41 A;  4HHT A;  4DTS A;  3C6T A;  1NK7 A;  4O4G A;  4E7K A;  3CYM A;  3AVI A;  3VQ7 A;  2GBZ A;  2YKM A;  1JLQ A;  3MED A;  4CER A;  1VRU A;  3QIN A;  4H8K A;  3LP2 A;  3ZSQ A;  2GUI A;  1RT4 A;  2D0B A;  3TAF A;  4B9T A;  4K8X A;  3L2Q A;  3KK1 A;  1IKW A;  5I42 A;  2G8I A;  3KD1 E;  1L3S A;  1KLN A;  3ZT0 A;  1CXU A;  4DTN A;  1TK0 A;  1NKE A;  3O4N A;  4B8A B;  3QNO A;  2XY8 A;  1IO2 A;  4Z4F A;  4ELV A;  3OYH A;  1BI4 A;  1SL2 A;  4ZTJ A;  5KI6 A;  1RTI A;  2D0C A;  1HYS A;  1XC9 A;  4LH5 A;  1NJY A;  3TI0 A;  2ZD1 A;  4NCB A;  2PYJ A;  4CFC A;  4DFJ A;  4CJQ A;  2XO7 A;  4E7J A;  1NK9 A;  4CF1 A;  2HHW A;  1ZBF A;  3LP1 A;  4KB1 A;  1ZBU A;  5C24 A;  4W5Q A;  3QEI A;  2HHT A;  1KLM A;  3C95 A;  1RBU A;  4FJK A;  4DU3 A;  1JLF A;  2G8W A;  4DSK A;  4CHZ A;  5HRO A;  1GOC A;  1S1W A;  4DG1 A;  1CZB A;  5J2P A;  3ZSR A;  5HBM A;  3ZT2 A;  4CJK A;  3L2U A;  3TWH A;  3CQ8 A;  1U4B A;  4KHN A;  1A5V A;  4M45 A;  1FKO A;  4OJR A;  3MXM A;  3AVB A;  4FJ7 A;  4FK0 A;  1TAU A;  3TAP A;  4AHV A;  1J54 A;  1LAV A;  3LP0 A;  4ID5 A;  4OKK A;  3VA3 A;  4DFM A;  4PA1 A;  3HL8 A;  1RT2 A;  4YFU A;  3SNN A;  1U49 A;  1FXX A;  4IKF A;  4O55 A;  4AHC A;  1RDA A;  1C1A A;  1DTQ A;  4CGD A;  4J2A A;  4DTP A;  3MXI A;  2D5R A;  2BDP A;  3AVH A;  2OZS A;  3TR8 A;  3PO4 A;  5J2Q A;  3F9K A;  2AJQ A;  3VQE A;  5J1E A;  1Q8I A;  2G8V A;  3IAY A;  1VSM A;  1RTD A;  3OY9 A;  3BGR A;  4FZZ A;  3DLR A;  3DMJ A;  4OPK A;  3OYE A;  4EZ6 A;  2RF2 A;  4CJE A;  4CHN A;  4ZHR A;  1NJZ A;  3HJF A;  2I5J A;  3KK3 A;  4B08 A;  1K6Y A;  1YT3 A;  3AA3 A;  3OJS A;  1LW2 A;  3K5L A;  4OKE A;  3RRG A;  3D45 A;  3M8S A;  4CJ5 A;  2DFF A;  4CF0 A;  4FJ8 A;  1IKY A;  3O3F A;  1KRP A;  3L2R A;  4CCH A;  4CGG A;  3PUF A;  4FLV A;  1VSI A;  3RMA A;  1KVA A;  4JRQ A;  1DLO A;  3T1A A;  4DF8 A;  3RMB A;  4KHU A;  4NYN A;  4E89 A;  3HP6 A;  4FJI A;  2KZZ A;  4RW6 A;  1QQC A;  3QER A;  4N76 A;  2QKK A;  4CEQ A;  3L8B A;  2OZM A;  4OKJ A;  5FDL A;  1BQN A;  4CIG A;  3SPZ A;  1TK8 A;  1X1P A;  2JGU A;  3QIP A;  4BDZ A;  4J2B A;  3SQ4 A;  1B92 A;  4NCA A;  4OLB A;  4M3U A;  3NF7 A;  1S1T A;  4PUO A;  1CLQ A;  3VN5 A;  5FRN A;  4KTZ A;  4CIE A;  5C25 A;  5HRN A;  2HNZ A;  1BIS A;  5FRM A;  1Y97 A;  3IRX A;  4DTJ A;  4AIL C;  4CJR A;  3S9H A;  3WNH A;  4DSL A;  2G8U A;  4KI6 A;  3AVM A;  4CK3 A;  4B9V A;  3LAM A;  1LV5 A;  3K5N A;  2FBV A;  4BE2 A;  3V9Z A;  4E1N A;  1WSG A;  2O4G A;  4CED A;  4CJL A;  4OPJ A;  3F73 A;  1LWC A;  1MU2 A;  1ASV A;  5D3G A;  2WOM A;  4KV8 A;  4KHW A;  4O44 A;  4E1M A;  4RW7 A;  3AA2 A;  4LY7 A;  4CJ3 A;  2NUB A;  3NGI A;  2P1J A;  2F96 A;  4K8Z A;  1YVU A;  2HND A;  3B6O A;  3RMD A;  1L3U A;  2YNH A;  3QLH A;  2FBT A;  3V9W A;  4CFA A;  3CM5 A;  1QSL A;  3OVN A;  1J9A A;  3SV3 A;  4CFB A;  1VSL A;  1RT1 A;  3AA4 A;  5DMR A;  1XI1 A;  2ETJ A;  4CEF A;  4CJT A;  4CEO A;  3OJU A;  4FCY A;  1L3T A;  4CGF A;  3A2F A;  1J53 A;  4C8O A;  4AHS A;  4EP5 A;  2DY4 A;  4DMN A;  1WLJ A;  1HPZ A;  3U3G A;  4FVM A;  4Y1D A;  3OS2 A;  3ZSY A;  4FLX A;  4E7I A;  4KO0 A;  2YNF A;  4QAG A;  3ZT1 A;  1TKD A;  2HHV A;  1NKB A;  3SUP A;  4TSX A;  3MXJ A;  3P1G A;  2HHX A;  2IS3 A;  1EXQ A;  1C1B A;  3NF6 A;  2Z1I A;  3KLI A;  3OYI A;  3ZSX A;  3QES A;  3VQ8 A;  4CEC A;  2A1R A;  3I0R A;  4M3X A;  1VSE A;  2BE2 A;  4AH9 A;  4DU1 A;  4F3O A;  2F8T A;  4M3R A;  4DWI A;  1RT3 A;  3MEC A;  5KRT A;  4KB0 A;  1C0U A;  3OYN A;  3JSM A;  4DQI A;  5FRO A;  3HXM A;  3NF8 A;  1RTH A;  3OYC A;  2G8H A;  2HHQ A;  4W5R A;  4FLZ A;  3H08 A;  3SUO A;  1QSS A;  3QEX A;  3DRP A;  4YNQ A;  2QK9 A;  3LAL A;  2E6L A;  5CZ1 A;  1RBR A;  4CHQ A;  4LSN A;  3SPY A;  2IC3 A;  2FC0 A;  5C42 A;  3TAQ A;  1UOC A;  1LWF A;  2RPI A;  4DSE A;  4GW6 A;  4KRE A;  1Z25 A;  1JL1 A;  3BDP A;  1VSH A;  4IG3 A;  2OYQ A;  3HO1 A;  4BE1 A;  2RN2 A;  2KZM A;  1RBV A;  1HQE A;  3P83 D;  4LD0 A;  3LWM A;  2EX3 A;  5SWM A;  2A1S A;  4M41 A;  3AO2 A;  2FBY A;  4W5O A;  4FM2 A;  2HW3 A;  1WAF A;  2YNG A;  3V9S A;  3NCI A;  4DQP A;  4FJH A;  1ITG A;  1BI4 B;  1SKW A;  1NKC A;  3VQQ A;  2WON A;  2XRI A;  4CE9 A;  3RR7 A;  1RT6 A;  3TAB A;  3KJV A;  1Q9X A;  4LH4 A;  4DTO A;  2O4I A;  1HMV A;  1L5U A;  1EX4 A;  1BHL A;  1X9M A;  3LPT A;  1VK0 A;  3LAN A;  3QIO A;  3NH2 A;  2E4L A;  4JS5 A;  3EY1 A;  3VQ5 A;  2Y1J A;  2X78 A;  3KIO A;  4FJL A;  4DLE A;  4F3T A;  3VQ4 A;  3K57 A;  1QSY A;  3AVK A;  3L3U A;  4FZX C;  3WNF A;  3OS1 A;  3O4Q A;  1RDC A;  2XY5 A;  4DU4 A;  1J5O A;  4F2S A;  1BIZ A;  1VSK A;  2HNY A;  2OPP A;  4HCB A;  2GV9 A;  4C8L A;  1FK9 A;  4W5T A;  4PQU A;  1IKX A;  1KFD A;  1WSE A;  1NK4 A;  4FXD A;  4CFD A;  3IG1 A;  5K14 A;  4CJF A;  4O0I A;  1EET A;  3ZT4 A;  4DFK A;  2BAN A;  3DRS A;  2HHU A;  3B6P A;  4DTM A;  1BQM A;  4Z4I A;  1C0M A;  2G8K A;  3KTQ A;  4OLA A;  1VSD A;  3WNG A;  3TAM A;  3KLF A;  4E19 A;  5HRP A;  3V9X A;  3VA0 A;  1N5Y A;  1NJW A;  2PZS A;  4FJN A;  3SCX A;  3V9U A;  1ZYQ A;  2FBX A;  1WSH A;  3NDK A;  2RKI A;  5HRR A;  2IAJ A;  3NAE A;  2ATQ A;  4E0D A;  3C6U A;  1WN7 A;  1FKP A;  4AHR A;  4WE1 A;  1S6P A;  1TGO A;  1I3A A;  1ZBL A;  1BIU A;  2E6M A;  1L3V A;  4FZY A;  3HP9 A;  3V1Q A;  1IH7 A;  1U47 A;  4F4K A;  4DF4 A;  3OYK A;  3K58 A;  4DTU A;  4FW1 A;  3OYJ A;  4HUE A;  3SQ2 A;  4J2E A;  5SZT A;  1KVB A;  1RBS A;  2DFH A;  3KKS A;  3RWU A;  3DM2 A;  4FJ5 A;  4FJX A;  2DTU A;  1VRT A;  4B3O A;  4CGI A;  4DLG A;  4ELU A;  3DRR A;  1W0H A;  1HJR A;  3NHG A;  5J2M A;  1HYV A;  3TAG A;  1IG9 A;  3P5J A;  1KCF A;  3QO9 A;  1XHZ A;  4FW2 A;  4C8N A;  3K2P A;  4CHO A;  4BDP A;  1RDB A;  3ZSV A;  4CEE A;  5HLF A;  3OYM A;  2YV0 X;  3ZT3 A;  4Z4H A;  3ZCM A;  1T8E A;  4DQS A;  5CYQ A;  1SUQ A;  3M8P A;  1WNS A;  2ITG A;  1NK0 A;  4CHP A;  4GMJ B;  3AO5 A;  1HYZ A;  1TKX A;  1B9D A;  4AHT A;  4FLW A;  1Z26 A;  3QEP A;  4CEB A;  4B9S A;  2IOC A;  4H4O A;  1G15 A;  4E7H A;  1O1W A;  3KD5 E;  2Z1H A;  4C8K A;  4JLH A;  4I9L A;  3THV A;  4HTU A;  4KTW A;  4KFB A;  3O3G A;  1ZBI A;  1S5J A;  1RIL A;  1TL1 A;  4CJU A;  1SL0 A;  1NJX A;  5T7B A;  4CIF A;  2W42 A;  4CEZ A;  4RW4 A;  1HQU A;  2VG7 A;  4E7L A;  1T03 A;  2F8S A;  2B4J A;  5JS2 A;  4CJS A;  3SUN A;  2BGG A;  3ASM A;  1CXQ A;  1UA1 A;  3M8Q A;  3LAK A;  3HPG A;  4G1Q A;  3LZJ A;  1N6Q A;  2PY5 A;  4OGC A;  4IDK A;  3DLK A;  4UQG A;  3MEE A;  4MFB A;  4CEA A;  4CGH A;  3S3N A;  3HPO A;  3HK2 A;  3PX6 A;  3AVA A;  2B6A A;  4F8R A;  3RTV A;  1RDD A;  2HB5 A;  4E3S A;  3PX0 A;  4MQ3 A;  2YHA A;  4IBN A;  3SV4 A;  4JS4 A;  4CJV A;  3V4I A;  4CJ4 A;  1HNI A;  1JKH A;  1WAJ A;  3KKR A;  3ALY A;  4FJ9 A;  1TK5 A;  1A5X A;  4HVJ A;  1DTT A;  1S9E A;  2LSN A;  1C6V A;  1I39 A;  5KTQ A;  2VG6 A;  3RR8 A;  3M8R A;  4IFY A;  4C8M A;  4HCC A;  2DFE A;  4LSL A;  3HVR A;  4BE0 A;  4FJM A;  1JL2 A;  2Z1J A;  3QET A;  4DSJ A;  4KAZ A;  4EP4 A;  1ASU A;  4W5N A;  3AVL A;  3DLG A;  1NK6 A;  1TKZ A;  1KTQ A;  2OPQ A;  3VQ9 A;  3L2W A;  4IFV A;  1U45 A;  3HYF A;  1BCO A;  4DSF A;  4CJP A;  4M3Y A;  3OYB A;  1JXE A;  3L3V A;  3CFP A;  3LZI A;  4DTX A;  4KPY A;  2ZQB A;  4DS5 A;  1C1C A;  4F2R A;  1TV6 A;  4Z4C A;  2YNI A;  2KQ2 A;  3VQD A;  3NGZ A;  3S3O A;  1NK5 A;  3DLH A;  5E41 A;  4CES A;  1VSJ A;  3VQP A;  4Z0U A;  3OS0 A;  1SKS A;  3I8D A;  2Y1I A;  5KRS A;  3O3H A;  1BL3 A;  3HM9 A;  4RW9 A;  4N47 A;  4NCG A;  3AA5 X;  5HRS A;  3D0P A;  4DS4 A;  4R5P A;  3T3F A;  3V81 A;  4CK2 A;  2XHB A;  4B9N A;  4M3W A;  3SZ2 A;  3PO5 A;  3V1O A;  3E01 A;  3AVC A;  4QCL A;  3G10 A;  3U6F A;  1IKV A;  1UAX A;  4FYD A;  3U3Y A;  3CM6 A;  4ZTF A;  4DFP A;  4B9U A;  4N5S A;  1RT7 A;  3ITH A;  3ZSZ A;  3K5M A;  1T7P A;  4KHY A;  1YTA A;  1RTJ A;  3AVJ A;  4CF8 A;  3DOK A;  3NGY A;  3NE6 A;  3QEV A;  2QXF A;  2YHB A;  2ZE2 A;  3CFR A;  2D0A A;  1CZ9 A;  4FJG A;  1X9S A;  1S1X A;  1JLB A;  1WSF A;  4M3T A;  3OYL A;  1JLA A;  4PWD A;  3RRH A;  3V1R A;  3HVT A;  1JXB A;  4O0J A;  4B8C A;  3LDS A;  5KGW A;  3HPH A;  3VQB A;  2VG5 A;  2VWK A;  2HVH A;  2IGI A;  2KW4 A;  1RBT A;  1KFS A;  3CG7 A;  2IDO A;  3DOL A;  4Q5V A;  3HT3 A;  3SYZ A;  5JS1 A;  5CY4 A;  3KK2 A;  1TVR A;  4CHY A;  5CYM A;  3G0Z A;  4NYF A;  2P5O A;  4FJJ A;  3SUQ A;  4IG0 A;  2OA8 A;  2EHG A;  4OGE A;  5I3U A;  3NF9 A;  3OYF A;  4KTQ A;  1REV A;  3PX4 A;  3EYZ A;  2P51 A;  4DQQ A;  4O5B A;  3AO3 A;  1NOY A;  1QHT A;  4Z4E A;  4KHS A;  4H4M A;  1C0T A;  1LW0 A;  3TAR A;  3NFA A;  2XY6 A;  3QNN A;  4Z4G A;  4I7F A;  3NH0 A;  4I2Q A;  1D9F A;  3C94 A;  1XWL A;  2R7Y A;  4QOZ B;  1X9W A;  1F21 A;  4BDY A;  4DSI A;  5KGX A;  4FK2 A;  2PYL A;  1JLG A;  3ZSO A;  4CF9 A;  4L8R B;  3SQ0 A;  3ZSW A;  1EKE A;  3FFI A;  1ASW A;  1HNV A;  1D9D A;  4BAC A;  5HP1 A;  4RW8 A;  3AVG A;  4ICL A;  3OYG A;  1SKR A;  4DQR A;  3HST B;  4AHU A;  4CK1 A;  5DK5 A;  4N56 A;  4FLY A;  3PV8 A;  2B5J A;  3KLE A;  4EZ9 A;  3TAE A;  1TL3 A;  4I9Q A;  1YTU A;  4RG8 A;  3JYT A;  3AO4 A;  1R0A A;  1S9G A;  1GOB A;  1QS4 A;  1LWE A;  1BCM A;  5CZ2 A;  2VWJ A;  3PY8 A;  2XY7 A;  1RCH A;  2KFZ A;  1XHX A;  3NBP A;  1A5W A;  4KHQ A;  1ZBH A;  3OYA A;  1NOZ A;  1B9F A;  3UIQ A;  2P5G A;  4J2D A;  2X6N A;  2KTQ A;  4DTR A;  3VQC A;  3RMC A;  3VQA A;  1VSF A;  1T05 A;  1WSJ A;  1QTM A;  1UWB A;  1UA0 A;  3TAN A;  1TKT A;  1EP4 A;  3DI6 A;  3DLE A;  1U48 A;  3OYD A;  4CF2 A;  2X6S A;  4B9M A;  1LAW A;  4I2P A;  4XIU A;  2G8F A;  4KI4 A;  3S3M A;  4FK4 A;  4CGJ A;  2HVI A;  4ELT A;  3MEG A;  3K59 A;  3LPU A;  1HRH A;  5EU7 A;  3DYA A;  4JRP A;  1S1U A;  3MAQ A;  3SI6 A;  1BGX T;  1KSP A;  4Y1C A;  4FLU A;  2HMI A;  3VQ6 A;  3KLG A;  1JLE A;  4FLT A;  2KFN A;  1SL1 A;  4BWM A;  3NH1 A;  4FM1 A;  1KVC A;  1D5A A;  4HUF A;  3SQ1 A;  3SJJ A;  4M42 A;  1WSI A;  4PY5 A;  2YKN A;  3AVN A;  1Q9Y A;  3ISN C;  3I0S A;  3IS9 A;  3L2V A;  3LWL A;  3QEW A;  3V6D A;  5J2N A;  3KLH A;  3CFO A;  3AV9 A; 
#chains in the Genus database with same CATH topology
 1S6Q A;  1TUU A;  1RT5 A;  1U04 A;  1NK8 A;  1V4T A;  3AO1 A;  4KKO A;  1RNH A;  2JLE A;  4B9L A;  1HPM A;  2HHS A;  2OPR A;  2OPS A;  2RE2 A;  4N41 A;  3K5O A;  4DTS A;  3CYM A;  1LCU A;  1JLQ A;  1QQM A;  3TAF A;  1RT4 A;  4BRD A;  3L2Q A;  3KK1 A;  3VF6 A;  2G8I A;  1KLN A;  4LFC K;  3ZT0 A;  1NKE A;  3QNO A;  2XY8 A;  3M3Z A;  5AJ3 K;  1IO2 A;  1SL2 A;  4JI5 K;  5KI6 A;  4DCH A;  3VPZ A;  4X64 K;  1HYS A;  4LH5 A;  2NRV A;  4CFC A;  4DFJ A;  2XO7 A;  3LP1 A;  3QFU A;  5C24 A;  3VER A;  4W5Q A;  5AZI A;  1GOC A;  1VQ8 N;  1VHX A;  4DG1 A;  3CC4 N;  2O8C A;  4MO5 A;  4EIA A;  5HBM A;  2OTL N;  1XNQ K;  5B8H A;  1U4B A;  4FK0 A;  1TAU A;  1LAV A;  2QW9 A;  3VOV A;  4PA1 A;  3HL8 A;  3O4W A;  3SNN A;  4M63 C;  1ILY A;  2YI1 A;  2O8B B;  2ZGY A;  5BPN A;  2D5R A;  5LY3 A;  4CW7 B;  2OZS A;  5M1F A;  3PO4 A;  2VYP A;  3UKR B;  1XNR K;  5J1E A;  3AGR A;  5KPZ A;  1RTD A;  5BRD A;  2O8C B;  2ASO A;  3DMJ A;  4CZJ A;  4EZ6 A;  2RF2 A;  4GVE A;  1JJ2 M;  1DEJ A;  4ZHR A;  1NJZ A;  3HJF A;  3CC7 N;  1K6Y A;  3BF1 A;  3RRG A;  1KAX A;  3D45 A;  3M8S A;  4CJ5 A;  3VMF B;  3CC2 N;  2W41 A;  2P9S A;  1IKY A;  3O3F A;  3CCR N;  1KRP A;  3PUF A;  4I6M A;  5M1Q A;  1YHQ N;  2IVP A;  4DF8 A;  4KHU A;  2KZZ A;  4E89 A;  3VF4 A;  1QQC A;  5KQD A;  2NRR A;  1BQN A;  2FF3 B;  2JGU A;  3QIP A;  3SQ4 A;  5EVZ A;  4CJ7 A;  3P39 A;  5FRN A;  4KTZ A;  2F7T A;  2P9S B;  3NVM A;  4H0O A;  4DTJ A;  1VQL N;  4I6M B;  2G8U A;  1XUP O;  3AVM A;  4DV2 K;  3V9Z A;  4OPJ A;  3ID8 A;  1MU2 A;  3CJC A;  2WOM A;  4QS7 A;  4KV8 A;  4O44 A;  4CZI A;  3CCU N;  4B1V A;  2E2O A;  4CJ3 A;  4CBW A;  2P1J A;  3G4S N;  4B1U B;  2HND A;  2A41 A;  2GWK A;  2FF6 A;  3V9W A;  3CM5 A;  4PKH A;  1VSL A;  1RT1 A;  1XI1 A;  4CJT A;  4CEO A;  3OJU A;  1HJO A;  2RHK A;  4CZF A;  4CGF A;  4HWI A;  1HPZ A;  2HBK A;  4FLX A;  4PL8 A;  4E7I A;  2YNF A;  4QAG A;  4YOR A;  2IS3 A;  1EXQ A;  3KLI A;  1W2B M;  2Q1N A;  1K8A O;  2JWK A;  2A1R A;  1VSE A;  4DWI A;  4DR7 K;  4JD2 B;  3OYN A;  3CER A;  2QWR A;  2HHQ A;  4W5R A;  2O8D A;  5LMN K;  3E9O A;  5JIC A;  2WBN A;  1HKG A;  4BRP A;  4BRH A;  3DRP A;  2WUS A;  3PIO L;  2QK9 A;  3LAL A;  1RBR A;  4CHQ A;  4LSN A;  1YUW A;  3SPY A;  2FC0 A;  3TAQ A;  1UOC A;  1Z25 A;  1I94 K;  4JN4 A;  1JL1 A;  1OVQ A;  3HO1 A;  1HQE A;  2A1S A;  1V4S A;  4FM2 A;  3R8E A;  2HW3 A;  1WAF A;  3V9S A;  3NCI A;  1BI4 B;  1SKW A;  3VQQ A;  2AA4 A;  3W3D A;  4CE9 A;  4YOY A;  3ENH A;  3KJV A;  3O9R A;  3BZC A;  2O4I A;  1TK5 A;  3LAN A;  2NRT A;  4JS5 A;  4F3T A;  4A2B A;  4L3Q A;  1E4F T;  3OS1 A;  3O4Q A;  4BRA A;  4RWT A;  4F2S A;  1G99 A;  4HCB A;  4W5T A;  1IKX A;  1JCG A;  4CFD A;  2UXC K;  3R1X A;  2BAN A;  4JI1 K;  1VQ4 N;  2HHU A;  2IVO A;  1C0M A;  1S3X A;  2QXL A;  4E19 A;  3V9U A;  3WXK A;  4K42 A;  3E9L A;  3DAW A;  3L0Q A;  2ATQ A;  2ASM A;  2P9I A;  4R79 A;  1TGO A;  5AFU H;  5ADX H;  2E6M A;  3HP9 A;  1N36 K;  4DTU A;  1VQ9 N;  3SQ2 A;  2DFH A;  4JK7 A;  1VRT A;  1O13 A;  4A2A A;  3NHG A;  4O5F A;  3TSP A;  1HYV A;  1IG9 A;  3QO9 A;  2QWL A;  2QWO A;  4ISE A;  1KD1 O;  4H0X B;  3E66 A;  3ZSV A;  3A5N C;  1T8E A;  3ZT3 A;  4Z4H A;  1IBM K;  1HYZ A;  1TKX A;  1Z26 A;  4LFB K;  4DR3 K;  2E2Q A;  4E7H A;  4C8K A;  4JLH A;  4I9L A;  4CD3 A;  4HTU A;  4KFB A;  1BA1 A;  1TL1 A;  1RIL A;  1HR0 K;  4CJU A;  1HQU A;  1X3M A;  2F8S A;  2HF4 A;  2PY5 A;  3HPG A;  4OGC A;  4MFB A;  3WXJ A;  3HPO A;  1VQ7 N;  5KQ8 A;  3RTV A;  4E3S A;  3PX0 A;  5JLF A;  3UKU A;  4IBN A;  2A42 A;  1Z6R A;  4JS4 A;  2FSN A;  4CJ4 A;  1HNI A;  1JKH A;  4UY8 O;  1N33 K;  1DTT A;  1S9E A;  4FWO A;  2LSN A;  2JWL A;  5KTQ A;  5AQH A;  4JI4 K;  4LSL A;  4IOC L;  2VQF K;  4WFN L;  4W5N A;  1OH7 A;  2Q2R A;  3UKU B;  3L2W A;  4YHH K;  3OYB A;  4IJA A;  3HSC A;  3LZI A;  2ZQB A;  1C1C A;  3VEV A;  2KQ2 A;  3VQD A;  3O8M A;  1NK5 A;  3DLH A;  2Q31 A;  3C0B A;  3OS0 A;  3I8D A;  3O3H A;  5C0Y A;  2E5L K;  3U4L A;  3MCA B;  3FFK B;  3WXI A;  5AQO A;  5IWA K;  3SZ2 A;  3MMV A;  3AVC A;  3U6F A;  3U3Y A;  3CM6 A;  4PHT X;  4DFP A;  4DV3 K;  3A8Y A;  3UE5 A;  3Q7C A;  3CFR A;  4FJG A;  1JLB A;  1ZXO A;  3O6W A;  4B8C A;  1TYQ A;  2IGI A;  2V7Z A;  2NRH A;  4JKB A;  4YOX A;  1VQM N;  4B3R K;  4LF5 K;  1TVR A;  4FJJ A;  4MLH A;  5CYM A;  1OH6 A;  3SUQ A;  3VEW A;  3THX A;  1Q7Y O;  4KTQ A;  4O5B A;  3AO3 A;  4WFB L;  4JKE A;  2AP1 A;  4H4M A;  2E20 A;  2A6A A;  3LDO A;  4XH1 A;  4I7F A;  4I2Q A;  5AQR A;  4QOZ B;  1F21 A;  4BDY A;  1RDW X;  3CF5 L;  2PYL A;  1OVY A;  2QA4 N;  1YIT N;  3SQ0 A;  3THX B;  3ZSW A;  1HNV A;  1NNE A;  3AVG A;  3OYG A;  4AHU A;  1BDG A;  5DK5 A;  3MX2 A;  4EZ9 A;  2F8T A;  4FXD A;  3TAE A;  1TL3 A;  3AO4 A;  4BQL A;  1ATN A;  1LWE A;  5CZ2 A;  2KFZ A;  1XHX A;  1NOZ A;  4J2D A;  3HM8 A;  1C0G A;  3VQC A;  1QTM A;  3DLE A;  4KBO A;  4DV1 K;  4YOW A;  1KAY A;  1NGG A;  1NBW A;  3CJ1 A;  5AQP A;  3S3M A;  2FXU A;  2HVI A;  3MEG A;  3LPU A;  2D0O A;  5EU7 A;  3DYA A;  1KSP A;  4Y1C A;  4FLU A;  3VQ6 A;  5GAD P;  3LDL A;  1SL1 A;  4BWM A;  4PY5 A;  4JAX A;  1Q9Y A;  3QEW A;  1VQP N;  2A3Z A;  1VQ5 N;  4U67 L;  4H0P A;  3W0L A;  1QE1 A;  1SV5 A;  1SS6 A;  3E1Y A;  2P9L A;  4ID1 A;  1E4G T;  3WXM B;  4BGA A;  3U9D A;  4OVL A;  5JMV A;  2YHY A;  4M3Z A;  1EQY A;  3LDN A;  4BWJ A;  2Z1G A;  3LP3 A;  4ILG B;  2BH1 A;  3DLB A;  4Q0B A;  1W9H A;  2ZWH A;  1YVN A;  4O4G A;  4ILH A;  4GY2 B;  3AVI A;  3HOS A;  4JKD A;  2GBZ A;  2YKM A;  4CER A;  3MED A;  3D2E A;  4H8K A;  2ZGZ A;  2P9L B;  5M1N A;  2D0B A;  4B9T A;  3K9K A;  3O4N A;  3CJA A;  4Z4F A;  1GLC G;  3EO3 A;  1HLU A;  2HHW A;  4KB1 A;  2HHT A;  3MK6 A;  3D2E B;  3QEI A;  3A5M C;  3CHW A;  1KLM A;  3C95 A;  4MLE A;  1RBU A;  4IZ9 A;  3WUH A;  1JLF A;  2NRZ A;  1S1W A;  3ZT2 A;  3L2U A;  4KHN A;  3CQ8 A;  4DHY A;  1A5V A;  4M45 A;  3TAP A;  1J54 A;  3LP0 A;  4ID5 A;  4QS9 A;  5E84 A;  4IKF A;  4O55 A;  3CME N;  2DPN A;  4CGD A;  1DTQ A;  4DTP A;  1Q86 O;  2BDP A;  2HHH K;  1Q8I A;  1VSM A;  3DLR A;  4OPK A;  4K25 A;  4CJE A;  2I5J A;  3KK3 A;  1XMO K;  1YT3 A;  3AA3 A;  3K5L A;  1FW6 A;  2P9P A;  5LJV A;  2DFF A;  1YJN N;  3G71 N;  4FJ8 A;  4JKH A;  4CCH A;  3R3L A;  4CGG A;  4FLV A;  3SBT A;  4JRQ A;  3T1A A;  3VET A;  4G9Z A;  4FJI A;  3QER A;  1IJJ A;  1BOT O;  2QKK A;  2OZM A;  4H0Y B;  3R9P A;  5KPR A;  3E9P A;  4BVO A;  1X1P A;  1QQO A;  3I56 N;  4PUO A;  1VQ6 N;  5HRN A;  1BIS A;  4JI8 K;  4AIL C;  3S9H A;  4LFA K;  4NXM K;  3WNH A;  4DSL A;  4KI6 A;  3GDQ A;  4CK3 A;  4DR4 K;  3P31 A;  3K5N A;  2FBV A;  3LM2 A;  4BE2 A;  2V51 B;  1T6D A;  1WSG A;  3JAM O;  4CJL A;  5JVH L;  3F73 A;  4KHW A;  4E1M A;  3Q7B A;  5BN9 A;  5KPT A;  2F96 A;  4K8Z A;  3RMD A;  1HKB A;  3B6O A;  1L3U A;  2YNH A;  4YOU A;  3OVN A;  1J9A A;  3SV3 A;  3AA4 A;  5DMR A;  2ETJ A;  5FPE A;  4FCY A;  1L3T A;  3EN9 A;  4DMN A;  4FVM A;  4AF1 A;  3LDP A;  2HHV A;  3VGK A;  3SUP A;  1GLL O;  3SAH A;  1NGB A;  3MXJ A;  3OYI A;  3NF6 A;  3IFR A;  2YCH A;  3QES A;  3FZH A;  4M3X A;  3QBX A;  2F9T A;  4BGB A;  5BRH A;  4F3O A;  1RT3 A;  3MEC A;  3VF2 A;  1HUX A;  1JCE A;  4DQI A;  4DQ8 A;  5DM7 L;  1RTH A;  4FLZ A;  3SUO A;  3NVK A;  2E6L A;  4H5N A;  5CZ1 A;  4YY3 K;  5MLC Q;  1K9M O;  1S22 A;  3J8A A;  4JI6 K;  4IG3 A;  4BE1 A;  3P83 D;  1YIJ N;  3AO2 A;  2FBY A;  5GAG P;  4BRG A;  4O8U A;  3H3O B;  4BR5 A;  3KHY A;  1NKC A;  1QZ5 A;  2E88 A;  3MWP A;  4FWP A;  3U8X A;  2VGM A;  3TAB A;  2W6K A;  3C6H A;  4LH4 A;  4A5A A;  5JS1 A;  1BHL A;  1X9M A;  1VK0 A;  3NH2 A;  3QIO A;  3EY1 A;  1RFQ A;  3VQ5 A;  3KIO A;  3VQ4 A;  5AZI B;  3AVK A;  4FZX C;  4FPB A;  1BIZ A;  3J7Y P;  2HNY A;  4PQU A;  1WSE A;  1NK4 A;  3IG1 A;  4JNE A;  3TPQ A;  4DTM A;  4LF9 K;  3DLL L;  1HNW K;  4BVP A;  2G8K A;  1VSD A;  3WNG A;  3V9X A;  3KLF A;  3VA0 A;  4FJN A;  1K8K A;  4FWM A;  1ZYQ A;  1WSH A;  3T69 A;  2RKI A;  2UXB K;  1J5E K;  3NAE A;  1CZA N;  3OTO K;  1WN7 A;  5HOO A;  1NGD A;  4WE1 A;  1S6P A;  4H5V A;  5JVG L;  4BG8 A;  1ZBL A;  3AAQ A;  4BR2 A;  1YJ9 N;  3F2K A;  3OYK A;  1VAZ A;  4FW1 A;  3WEE A;  4J2E A;  3IMX A;  3RWU A;  4FJX A;  3DM2 A;  1E3M A;  1SZ2 A;  4CGI A;  4DLG A;  4B3O A;  4BRI A;  4ELU A;  1ZBS A;  3DRR A;  5AQI A;  4NB4 A;  3C7N A;  1KCF A;  1YF5 L;  5H1S Q;  3K2P A;  4CHO A;  4B9Q A;  4WYB A;  4DQS A;  3WEE B;  1SUQ A;  3M8P A;  4X65 K;  3AO5 A;  3QEP A;  1B9D A;  4DV6 K;  4DKW A;  4BC4 A;  4H4O A;  1G15 A;  3KD5 E;  2WFB A;  4CI6 A;  3M1F A;  3C7N B;  3O3G A;  5T7B A;  2W42 A;  4BRQ A;  3O08 A;  2B4J A;  5JS2 A;  4FWS A;  1CXQ A;  5M1O A;  4G1Q A;  3LAK A;  3CET A;  4BQZ A;  4BR0 A;  1UA1 A;  1FJG K;  3O1B A;  4DUZ K;  1NGE A;  1YI2 N;  4LF6 K;  5BR9 A;  3AVA A;  2HB5 A;  5LMU K;  3ZLJ A;  1WOQ A;  3SV4 A;  1U2V A;  2GWJ A;  1X3N A;  4DR2 K;  4CJV A;  3KKR A;  4KHP K;  4JKA A;  4HVJ A;  1HNZ K;  3RR8 A;  3FZK A;  5AQJ A;  4IFY A;  4HCC A;  3IUC A;  4NO7 A;  4YOT A;  4BE0 A;  4FJM A;  4WQ4 C;  3QET A;  3WQU A;  4EP4 A;  1ASU A;  1ATS A;  3AVL A;  1NK6 A;  4FOE A;  2P9U A;  2OPQ A;  1NJI O;  3VQ9 A;  3BUZ B;  3HYF A;  3QML A;  1HKC A;  3O9U A;  5EOY A;  3AAR A;  4DS5 A;  4Z4C A;  1QZ6 A;  2O8D B;  3K0S A;  3S3O A;  5E41 A;  2UUA K;  1VSJ A;  3FLC O;  1SKS A;  4NXN K;  1U6Z A;  2P9U B;  3U9Z A;  3AA5 X;  3QDK A;  2QWQ A;  5LL6 Z;  4DR5 K;  2ZF5 O;  5AQF A;  4QCL A;  3G10 A;  1IKV A;  1TUY A;  3MX5 A;  3THW A;  2Q0R A;  4KHY A;  1SAZ A;  3MN5 A;  3H45 C;  3NGY A;  2YHB A;  2D0A A;  1CZ9 A;  1X9S A;  3OYL A;  1JLA A;  1NG9 A;  4PWD A;  3RRH A;  1JXB A;  1NGH A;  5KGW A;  3T1Y K;  1IBL K;  2HVH A;  2VWK A;  3O9Q A;  1RBT A;  3CG7 A;  3SYZ A;  3KK2 A;  2AJQ A;  4NYF A;  4KH5 A;  2EHG A;  3OYF A;  2QTD A;  3KWI A;  1NOY A;  1MDU B;  3EE9 A;  5TKW A;  3ZEU A;  4KH4 A;  1GLB G;  3NFA A;  2VQE K;  3QNN A;  4Z4G A;  3NH0 A;  3QFP A;  1X9W A;  2D0P A;  4B1Y B;  1NWK A;  4H5W A;  3CJB A;  2P9I B;  3ZSO A;  2UYT A;  4L8R B;  1ASW A;  4IEE A;  4BAC A;  5HP1 A;  4ICL A;  3N4Q A;  1RGI A;  3ZEU B;  3R6M A;  4I9Q A;  3JYT A;  4FSV A;  1BCM A;  3VEO A;  1RCH A;  2H3G X;  3NBP A;  1A5W A;  3DXM A;  1ZBH A;  4CZH A;  4FWQ A;  4K43 A;  4DV7 K;  4BRL A;  1WBB A;  3VQA A;  1T05 A;  1WSJ A;  1UWB A;  1W7A A;  3OYD A;  4I2P A;  2G8F A;  4KI4 A;  3ENB A;  5CE3 A;  4DB3 A;  1HRH A;  3SI6 A;  2KFN A;  3BEX A;  3HRG A;  2W40 A;  3KLG A;  3DXM B;  4FLT A;  3SJJ A;  1WSI A;  4AM7 A;  3FGU A;  3L2V A;  2HF3 A;  5J2N A;  4H0T B;  1KC8 O;  1WBD A;  1TAQ A;  3WXL A;  1GOA A;  4GVM A;  4KRF A;  1S1V A;  4A62 A;  5BN8 A;  3H46 O;  4WFA L;  2X74 A;  4YDU A;  3WNE A;  1JLC A;  2NZT A;  3AVF A;  3EE8 A;  1NK7 A;  4E7K A;  3CCS N;  1XQS C;  5AQM A;  3VQ7 A;  5C15 A;  4ISF A;  3ATV A;  3QIN A;  3BP8 A;  3LP2 A;  1YAG A;  3ZSQ A;  3J80 O;  1L3S A;  4IFE A;  4KH6 A;  1NLV A;  4B8A B;  4U7B A;  1LOT B;  2EWS A;  3OYH A;  4ELV A;  4BY9 C;  4C23 A;  4ZTJ A;  1RTI A;  2D0C A;  1DGK N;  1XC9 A;  1NJY A;  5F1X A;  5AQN A;  3OW2 M;  1ZBF A;  2P9K A;  1ZBU A;  5AR0 A;  4X62 K;  4DU3 A;  1IG8 A;  3SBG A;  4DSK A;  5HRO A;  1CZB A;  5J2P A;  4CJK A;  3TWH A;  4B3M K;  3LL3 A;  1FKO A;  3MXM A;  3UB5 A;  4FJ7 A;  4F9O A;  1QQN A;  4AHV A;  4DFM A;  1U49 A;  1NM1 A;  4YFU A;  1RT2 A;  1FXX A;  3TU5 A;  4OPH A;  2P9K B;  1C1A A;  4J2A A;  3MXI A;  4A61 A;  1OH5 A;  3TR8 A;  2BTF A;  4FWN A;  4A59 A;  5J2Q A;  3F9K A;  3VQE A;  3IAY A;  3P38 A;  2G8V A;  5ELZ A;  3BGR A;  3CPW M;  5FPM A;  3MCP A;  3C65 A;  4B08 A;  3CCL N;  3OJS A;  3OBW A;  4OKE A;  4DV4 K;  5GIO A;  1TYQ B;  4PL7 A;  3HI0 A;  1NGC A;  4CF0 A;  5C2D A;  1GLJ O;  3L2R A;  3CIP A;  3CCM N;  1VSI A;  3RMA A;  2F4V K;  1DLO A;  3RMB A;  3HP6 A;  2HBL A;  4RW6 A;  2E8A A;  1VQK N;  4BRM A;  2GEM A;  4XH5 A;  3SPZ A;  3J7Z O;  4BDZ A;  4FWK A;  4OLB A;  1B92 A;  4M3U A;  1T44 A;  1S1T A;  3NF7 A;  4CIE A;  5C25 A;  2HNZ A;  1Y97 A;  4CJR A;  1D4X A;  4B9V A;  3KZB A;  3LAM A;  1BA0 A;  1LV5 A;  4E1N A;  4CED A;  1LWC A;  1ASV A;  5CHI A;  4MDB A;  3OHR A;  1J6Z A;  5JLH A;  2CH5 A;  4BRK A;  4RW7 A;  2HST A;  3AA2 A;  4GNI A;  4LY7 A;  3M5R A;  1T3V A;  2QM1 A;  1QSL A;  3FR0 A;  4OO1 J;  4E1J A;  4O8K A;  4CEF A;  2VWB A;  3CQX A;  4IO9 L;  3A2F A;  1J53 A;  5CR4 A;  4AHS A;  4EP5 A;  4JK9 A;  5TKY A;  1WLJ A;  5AQX A;  3J7A P;  4Y1D A;  3ZT1 A;  1TKD A;  4JI7 K;  4TSX A;  5FPD A;  3P1G A;  1C1B A;  3CCV N;  4FL9 A;  4CEC A;  3P4I A;  2BE2 A;  4AH9 A;  4BG9 A;  4DU1 A;  4M3R A;  5I9E B;  1C0U A;  3JSM A;  2G8H A;  3A0I X;  3A5O C;  4A57 A;  3QEX A;  4YNQ A;  2KKZ A;  5M1P A;  2CGK A;  3GOI A;  5AFU A;  5ADX A;  2O8F A;  1NGJ A;  1NGI A;  4GW6 A;  2PFU A;  4C1N K;  4KRE A;  4JI3 K;  1DT9 A;  1VSH A;  3L4Q A;  2OYQ A;  2RN2 A;  1RBV A;  4LD0 A;  3LWM A;  4JEP A;  2HOE A;  4M41 A;  4W5O A;  2YNG A;  4DQP A;  1ITG A;  3G6E N;  2XRI A;  4J8F A;  1NGF A;  3CMA N;  2O8F B;  5EXW A;  4CZL A;  4DTO A;  1HMV A;  1EO1 A;  2Y1J A;  4DLE A;  1P8Z A;  3GL1 A;  1QSY A;  3WNF A;  2XY5 A;  1BO5 O;  2OPP A;  2GV9 A;  1FK9 A;  3LM9 A;  3KWG A;  3EKS A;  3NMU A;  4CJF A;  1EET A;  4BRO A;  4DFK A;  3DRS A;  3B6P A;  5AZJ A;  1BQM A;  3ATU A;  3KTQ A;  5HRP A;  3I8B A;  1NJW A;  1M90 O;  3VEZ A;  2FBX A;  1GLA G;  4FOI A;  2IAJ A;  4E0D A;  2NRX A;  1H1V A;  1FKP A;  4AHR A;  4BC2 A;  3S41 A;  1VQO N;  4FZY A;  1L3V A;  2E1Y A;  3RSE A;  4DUY K;  4CZM A;  2P9P B;  1RBS A;  3KKS A;  4RTF D;  4FJ5 A;  1Q18 A;  1W0H A;  5AQQ A;  1MWM A;  3DJC A;  4FW2 A;  4C8N A;  5A2Q O;  1RDB A;  4CD1 A;  3RSE B;  5HLF A;  3OYM A;  2YV0 X;  3ZCM A;  5AQL A;  1MA9 B;  2E1Z A;  1WNS A;  2ITG A;  2KLA A;  4GMJ B;  1K73 O;  4GKK K;  5M1K A;  4CEB A;  5C2F A;  3J81 O;  5BRE A;  3ID6 A;  1O1W A;  2Z1H A;  1ZBI A;  2V52 B;  3ZX3 A;  4CEZ A;  4GV9 A;  4H5T A;  4BRC A;  4E7L A;  1T03 A;  3SUN A;  2BGG A;  3M8Q A;  1N6Q A;  3HOT A;  3DLK A;  4UQG A;  4B3T K;  1KAZ A;  3SMP A;  4CEA A;  3S3N A;  1GLD G;  3HK2 A;  4GV6 A;  2B6A A;  4F8R A;  3A5L C;  4MQ3 A;  2YHA A;  4DV0 K;  2CGJ A;  1IV0 A;  1S72 N;  1R59 O;  3MN6 A;  1Q82 O;  1WAJ A;  4FJ9 A;  1OH8 A;  3SAG A;  1A5X A;  3EEQ A;  2VG6 A;  3M8R A;  5F0X A;  4DR1 K;  2Z1J A;  3FZM A;  4DSJ A;  4KAZ A;  3ZX0 A;  3VEY A;  3DLG A;  1TKZ A;  1KTQ A;  1XC3 A;  3O9T A;  5GIN A;  4IFV A;  3G25 A;  4CJP A;  1GLF O;  3CFP A;  4FO0 A;  5C10 A;  4DTX A;  4FVU A;  2UUC K;  4K41 A;  2KHO A;  4LC9 B;  3O5B A;  4CES A;  3VQP A;  2A40 A;  3QB0 A;  2Y1I A;  4XH4 A;  1BL3 A;  4RW9 A;  4NCG A;  2NRW A;  4MDA A;  4DS4 A;  3D0P A;  3T3F A;  4CK2 A;  2XHB A;  4K0K K;  3PO5 A;  2O8B A;  3V1O A;  4FYD A;  4ZTF A;  3UKR A;  4N5S A;  1RT7 A;  2VGN A;  3K5M A;  1T7P A;  3CJ7 A;  1RTJ A;  4CF8 A;  3DOK A;  3NE6 A;  3QEV A;  4BRN A;  2ZE2 A;  4M3T A;  4IDH A;  4WF9 L;  3V1R A;  4O0J A;  3HPH A;  3VQB A;  1KFS A;  4Q5V A;  4BR7 A;  2P5O A;  1WUA A;  3VES A;  3VGM A;  4OGE A;  5I3U A;  3PX4 A;  3EYZ A;  2P51 A;  4DQQ A;  1QHT A;  3TTC A;  2GTD A;  4KHS A;  4X66 K;  1C0T A;  1LW0 A;  3TAR A;  1K8K B;  4LF7 K;  1D9F A;  3C94 A;  1XWL A;  3PSF A;  2Q0U A;  2R7Y A;  3CCQ N;  1Q81 O;  4DV5 K;  4FK2 A;  3JS6 A;  2I7N A;  4BC5 A;  1YJW N;  5FPN A;  3TSU A;  4CZK A;  2IVN A;  3EKU A;  2OTJ N;  1D9D A;  3O1W A;  4CVN E;  3HST B;  2VCP A;  4CK1 A;  3PV8 A;  3KLE A;  1TK0 A;  3MWT A;  3O9S A;  1GOB A;  2VWJ A;  1VQN N;  3VGL A;  4MO4 A;  4M7X A;  2KTQ A;  1P90 A;  1C0F A;  4DTR A;  4PKG A;  1TKT A;  1EP4 A;  4LF4 K;  4B9M A;  1LAW A;  3CJ9 A;  4XIU A;  4CGJ A;  3DWL A;  3O80 A;  4IEI A;  4PKI A;  3L4I A;  2HMI A;  1S1U A;  1BGX T;  4YOV A;  4FM1 A;  3NH1 A;  2QWM A;  1KVC A;  1D5A A;  2YHX A;  4HUF A;  2YKN A;  3AVN A;  4IWV A;  3I0S A;  3IS9 A;  3HTV A;  4A5B A;  3KLH A;  3CFO A;  3AV9 A;  4FPA A;  4JD2 A;  4HUG A;  4JI2 K;  1OKJ A;  4B3S K;  2Q3S A;  4IXC A;  5AQY A;  3EZ5 A;  3FZF A;  3D6R A;  2QKB A;  4B1W B;  4Z94 A;  4CJW A;  2HBJ A;  2I7P A;  4FM0 A;  3T19 A;  3MDQ A;  1D8Y A;  3SLC A;  2YJE A;  2Q97 A;  3ULD A;  1KXP A;  4HHT A;  3C6T A;  1U2V B;  2F9W A;  2FSK A;  4BR4 A;  2GEL A;  5AQS A;  1VRU A;  2GUI A;  4EAH D;  4K8X A;  1NMD A;  1NGA A;  1IKW A;  3CXC M;  5I42 A;  3KD1 E;  1CXU A;  4XEI A;  4DTN A;  4JV5 K;  5AQU A;  3AGK A;  1BI4 A;  3N4P A;  4JKG A;  3ENO A;  2ZD1 A;  3TI0 A;  4NCB A;  2PYJ A;  3CQY A;  4CJQ A;  4E7J A;  1NK9 A;  4ILJ A;  4CF1 A;  1KQS M;  3SK3 A;  3VEX A;  4FJK A;  2G8W A;  4CHZ A;  3ZSR A;  5IT9 O;  3T7Z A;  4OJR A;  3AVB A;  5F2R A;  4JKG B;  4OKK A;  3VA3 A;  5DM6 L;  4AHC A;  4ISG A;  1RDA A;  2GUP A;  3AVH A;  2D1K A;  3THW B;  2OAN A;  4BC3 A;  3OY9 A;  4FZZ A;  2UUB K;  1M1K O;  3OYE A;  3H3N O;  4CHN A;  5BPL A;  4WQ5 A;  2Q36 A;  4JK8 A;  1YXQ A;  1LW2 A;  4B1X B;  2QWP A;  1NU0 A;  1BWF O;  5EY4 A;  3VEN A;  3D7E O;  1KVA A;  3K9J A;  5GIP A;  4BR9 A;  4NYN A;  1NMN A;  4N76 A;  4CEQ A;  1ESV A;  3L8B A;  4OKJ A;  5FDL A;  4CIG A;  1TK8 A;  3BY5 A;  4EFH A;  4J2B A;  3H6E A;  2YX6 A;  4NCA A;  1CLQ A;  3VN5 A;  1Y64 A;  1Z05 A;  1QVG M;  3IRX A;  4M7Y A;  5HL7 L;  2PAV A;  1T6C A;  4GV3 A;  4H0V B;  2CGL A;  2O4G A;  4CBU A;  3H1Q A;  3TTF A;  5BRF A;  5D3G A;  3MN7 A;  2NUB A;  3I55 N;  3NGI A;  3PLA A;  2ITM A;  1YVU A;  3ZX2 A;  1SQK A;  3QLH A;  2FBT A;  5AQV A;  4CFA A;  4CFB A;  4C8O A;  2DY4 A;  3U3G A;  3OS2 A;  3ZSY A;  4KO0 A;  4DR6 K;  1NKB A;  2HHX A;  2J4R A;  2Z1I A;  3M6G A;  3ZSX A;  1HNX K;  3CPE A;  3VQ8 A;  3FE1 A;  3F9M A;  3I0R A;  3CCE N;  1EWQ A;  4KB0 A;  5KRT A;  5FRO A;  3HXM A;  3NF8 A;  3JXU A;  3OYC A;  3H08 A;  4IOX A;  1QSS A;  4JKC A;  2OCE A;  3VTH A;  3C6A A;  4JKF A;  4H5R A;  2IC3 A;  5C42 A;  4DSE A;  1LWF A;  2RPI A;  2P9N A;  3BDP A;  2D4W A;  2NNW A;  1N32 K;  2KZM A;  1NJX A;  5FRM A;  2EX3 A;  5SWM A;  2UU9 K;  3CI5 A;  1MWK A;  4FJH A;  5BPM A;  2WON A;  3RR7 A;  3GE1 A;  5GAH P;  3ZET A;  1RT6 A;  3H1V X;  2QEX N;  1Q9X A;  5GAE P;  1L5U A;  2YHW A;  1EX4 A;  3LPT A;  3TSQ A;  2P9N B;  2E4L A;  4FJL A;  2X78 A;  1HX1 A;  3K57 A;  3HZ6 A;  3L3U A;  2V7Y A;  1J5O A;  1RDC A;  4RCH A;  4DU4 A;  1VSK A;  3DXK A;  4NLC A;  3VTI A;  2ZM6 K;  4C8L A;  1KFD A;  4O0I A;  3AY9 A;  5K14 A;  3ZT4 A;  3EZW A;  2FSJ A;  3ZET B;  4LF8 K;  4Z4I A;  5AQG A;  4OLA A;  3MN9 A;  3TAM A;  1XMQ K;  3CCJ N;  4WCE L;  3T1H K;  1N5Y A;  2PZS A;  3SCX A;  5LJW A;  2GX9 A;  3NDK A;  3ZYY X;  4EHU A;  5HRR A;  4V19 S;  3WQT A;  1W97 L;  3C6U A;  5FLX O;  3L6Q A;  4CZE A;  3THY A;  2NLX A;  2ASP A;  3DXK B;  1I3A A;  2W6L A;  3WT0 A;  1BIU A;  3V1Q A;  1IH7 A;  1U47 A;  4F4K A;  4DF4 A;  2HMP A;  3QIC A;  3K58 A;  3OYJ A;  4HUE A;  3SAF A;  5SZT A;  1KVB A;  2DTU A;  4Y0W A;  1HJR A;  5J2M A;  3TAG A;  3P5J A;  3FZL A;  3THY B;  1QVF M;  4QS8 A;  1XHZ A;  4BDP A;  4JHD A;  4CEE A;  5AQZ A;  5CYQ A;  4C1N I;  1ATR A;  1NK0 A;  4CHP A;  4AHT A;  4FLW A;  4B9S A;  3EL2 A;  4JI0 K;  2IOC A;  1BU6 O;  3PIP L;  3THV A;  4KTW A;  1S5J A;  1SL0 A;  2HBM A;  4CIF A;  3OA9 A;  4RW4 A;  2VG7 A;  4JHD B;  4BRE A;  3BF3 A;  3IKM A;  4CJS A;  3ASM A;  3LZJ A;  4B1Z A;  5EX5 A;  4IDK A;  4OX9 K;  3SMS A;  3MEE A;  4CGH A;  2QWN A;  3PX6 A;  4CBX A;  1RDD A;  1RDU A;  2FLO A;  2ZJP L;  4FWL A;  5AQW A;  3V4I A;  3ALY A;  4BRF A;  1DKG D;  1C6V A;  3OBY A;  1I39 A;  4CZG A;  4C8M A;  1N8R O;  3KK7 A;  3LDQ A;  2DFE A;  1GLE G;  3HVR A;  2WTU A;  3F5T A;  4IJN A;  1JL2 A;  3SJH A;  2O8E A;  4WQ5 C;  1U45 A;  1BCO A;  3ULE A;  4DSF A;  4M3Y A;  1JXE A;  3L3V A;  4KPY A;  5BR8 K;  4F2R A;  1TV6 A;  2YNI A;  3NGZ A;  1X9J A;  1ZC6 A;  4FWR A;  4Z0U A;  2BUP A;  5KRS A;  2O8E B;  3HM9 A;  4N47 A;  3ULE B;  5HRS A;  4M3W A;  4R5P A;  4HTL A;  3V81 A;  4B9N A;  2ZJR L;  1BUP A;  1IBK K;  3E01 A;  1UAX A;  4B9U A;  3ITH A;  3ZSZ A;  1YTA A;  3AVJ A;  3I33 A;  2CH6 A;  2QXF A;  2ZJQ L;  1S1X A;  1WSF A;  2E2P A;  3HVT A;  3LDS A;  3GBT A;  4IOA L;  2VG5 A;  2KW4 A;  3RVC A;  3AAP A;  2QI2 A;  2WC9 A;  3DOL A;  2IDO A;  3HT3 A;  2UXD K;  5CY4 A;  3D2F A;  4CHY A;  3G0Z A;  3B8A X;  3CD6 N;  4IG0 A;  2OA8 A;  4WQ4 A;  1WB9 A;  3NF9 A;  2PBD A;  1REV A;  2YJF A;  2IIR A;  5AZJ B;  4Z4E A;  4NLB A;  4AQY K;  2XY6 A;  3BZK A;  4YDU C;  5E26 A;  4GKJ K;  4DSI A;  3TTD A;  5KGX A;  1QHA A;  3D2F B;  1BG3 A;  1JLG A;  4CF9 A;  3KVG A;  1EKE A;  4JYA K;  3FFI A;  3QBW A;  4RW8 A;  5C12 A;  1SKR A;  4DQR A;  4IO8 A;  4N56 A;  1YTU A;  4FLY A;  2B5J A;  4RG8 A;  1R0A A;  1S9G A;  4AM6 A;  1QS4 A;  4OPA A;  3PY8 A;  2XY7 A;  3IDH A;  4H03 B;  4KHQ A;  3OYA A;  2E2N A;  1B9F A;  3UIQ A;  2P5G A;  2X6N A;  3RMC A;  1VSF A;  5AQK A;  1UA0 A;  3TAN A;  3DI6 A;  1U48 A;  1N34 K;  4CF2 A;  2X6S A;  5AQT A;  3PSI A;  4FK4 A;  4EHT A;  4ELT A;  2A5X A;  3K59 A;  1JCF A;  4JRP A;  3MAQ A;  1JLE A;  1EWR A;  4M42 A;  3SQ1 A;  3HBT A;  3ISN C;  3LWL A;  3V6D A;  3GG4 A; 
#chains in the Genus database with same CATH homology
 1S6Q A;  1QE1 A;  4HUG A;  1RT5 A;  1SV5 A;  1TAQ A;  1U04 A;  1NK8 A;  4ID1 A;  1GOA A;  3AO1 A;  4GVM A;  4KKO A;  2Q3S A;  4KRF A;  1S1V A;  4OVL A;  4M3Z A;  1RNH A;  2JLE A;  3EZ5 A;  2QKB A;  4B9L A;  2X74 A;  3WNE A;  4BWJ A;  2Z1G A;  2OPR A;  4CJW A;  2HHS A;  2OPS A;  3LP3 A;  3T19 A;  4FM0 A;  1D8Y A;  1JLC A;  3DLB A;  4Q0B A;  3ULD A;  1W9H A;  3K5O A;  3AVF A;  4N41 A;  4HHT A;  4DTS A;  3C6T A;  1NK7 A;  4O4G A;  4E7K A;  3CYM A;  3AVI A;  3VQ7 A;  2GBZ A;  2YKM A;  1JLQ A;  3MED A;  4CER A;  1VRU A;  3QIN A;  4H8K A;  3LP2 A;  3ZSQ A;  2GUI A;  1RT4 A;  2D0B A;  3TAF A;  4B9T A;  4K8X A;  3L2Q A;  3KK1 A;  1IKW A;  5I42 A;  2G8I A;  3KD1 E;  1L3S A;  1KLN A;  3ZT0 A;  1CXU A;  4DTN A;  1TK0 A;  1NKE A;  3O4N A;  4B8A B;  3QNO A;  2XY8 A;  1IO2 A;  4Z4F A;  4ELV A;  3OYH A;  1BI4 A;  1SL2 A;  4ZTJ A;  5KI6 A;  1RTI A;  2D0C A;  1HYS A;  1XC9 A;  4LH5 A;  1NJY A;  3TI0 A;  2ZD1 A;  4NCB A;  2PYJ A;  4CFC A;  4DFJ A;  4CJQ A;  2XO7 A;  4E7J A;  1NK9 A;  4CF1 A;  2HHW A;  1ZBF A;  3LP1 A;  4KB1 A;  1ZBU A;  5C24 A;  4W5Q A;  3QEI A;  2HHT A;  1KLM A;  3C95 A;  1RBU A;  4FJK A;  4DU3 A;  1JLF A;  2G8W A;  4DSK A;  4CHZ A;  5HRO A;  1GOC A;  1S1W A;  4DG1 A;  1CZB A;  5J2P A;  3ZSR A;  5HBM A;  3ZT2 A;  4CJK A;  3L2U A;  3TWH A;  3CQ8 A;  1U4B A;  4KHN A;  1A5V A;  4M45 A;  1FKO A;  4OJR A;  3MXM A;  3AVB A;  4FJ7 A;  4FK0 A;  1TAU A;  3TAP A;  4AHV A;  1J54 A;  1LAV A;  3LP0 A;  4ID5 A;  4OKK A;  3VA3 A;  4DFM A;  4PA1 A;  3HL8 A;  1RT2 A;  4YFU A;  3SNN A;  1U49 A;  1FXX A;  4IKF A;  4O55 A;  4AHC A;  1RDA A;  1C1A A;  1DTQ A;  4CGD A;  4J2A A;  4DTP A;  3MXI A;  2D5R A;  2BDP A;  3AVH A;  2OZS A;  3TR8 A;  3PO4 A;  5J2Q A;  3F9K A;  2AJQ A;  3VQE A;  5J1E A;  1Q8I A;  2G8V A;  3IAY A;  1VSM A;  1RTD A;  3OY9 A;  3BGR A;  4FZZ A;  3DLR A;  3DMJ A;  4OPK A;  3OYE A;  4EZ6 A;  2RF2 A;  4CJE A;  4CHN A;  4ZHR A;  1NJZ A;  3HJF A;  2I5J A;  3KK3 A;  4B08 A;  1K6Y A;  1YT3 A;  3AA3 A;  3OJS A;  1LW2 A;  3K5L A;  4OKE A;  3RRG A;  3D45 A;  3M8S A;  4CJ5 A;  2DFF A;  4CF0 A;  4FJ8 A;  1IKY A;  3O3F A;  1KRP A;  3L2R A;  4CCH A;  4CGG A;  3PUF A;  4FLV A;  1VSI A;  3RMA A;  1KVA A;  4JRQ A;  1DLO A;  3T1A A;  4DF8 A;  3RMB A;  4KHU A;  4NYN A;  4E89 A;  3HP6 A;  4FJI A;  2KZZ A;  4RW6 A;  1QQC A;  3QER A;  4N76 A;  2QKK A;  4CEQ A;  3L8B A;  2OZM A;  4OKJ A;  5FDL A;  1BQN A;  4CIG A;  3SPZ A;  1TK8 A;  1X1P A;  2JGU A;  3QIP A;  4BDZ A;  4J2B A;  3SQ4 A;  1B92 A;  4NCA A;  4OLB A;  4M3U A;  3NF7 A;  1S1T A;  4PUO A;  1CLQ A;  3VN5 A;  5FRN A;  4KTZ A;  4CIE A;  5C25 A;  5HRN A;  2HNZ A;  1BIS A;  5FRM A;  1Y97 A;  3IRX A;  4DTJ A;  4AIL C;  4CJR A;  3S9H A;  3WNH A;  4DSL A;  2G8U A;  4KI6 A;  3AVM A;  4CK3 A;  4B9V A;  3LAM A;  1LV5 A;  3K5N A;  2FBV A;  4BE2 A;  3V9Z A;  4E1N A;  1WSG A;  2O4G A;  4CED A;  4CJL A;  4OPJ A;  3F73 A;  1LWC A;  1MU2 A;  1ASV A;  5D3G A;  2WOM A;  4KV8 A;  4KHW A;  4O44 A;  4E1M A;  4RW7 A;  3AA2 A;  4LY7 A;  4CJ3 A;  2NUB A;  3NGI A;  2P1J A;  2F96 A;  4K8Z A;  1YVU A;  2HND A;  3B6O A;  3RMD A;  1L3U A;  2YNH A;  3QLH A;  2FBT A;  3V9W A;  4CFA A;  3CM5 A;  1QSL A;  3OVN A;  1J9A A;  3SV3 A;  4CFB A;  1VSL A;  1RT1 A;  3AA4 A;  5DMR A;  1XI1 A;  2ETJ A;  4CEF A;  4CJT A;  4CEO A;  3OJU A;  4FCY A;  1L3T A;  4CGF A;  3A2F A;  1J53 A;  4C8O A;  4AHS A;  4EP5 A;  2DY4 A;  4DMN A;  1WLJ A;  1HPZ A;  3U3G A;  4FVM A;  4Y1D A;  3OS2 A;  3ZSY A;  4FLX A;  4E7I A;  4KO0 A;  2YNF A;  4QAG A;  3ZT1 A;  1TKD A;  2HHV A;  1NKB A;  3SUP A;  4TSX A;  3MXJ A;  3P1G A;  2HHX A;  2IS3 A;  1EXQ A;  1C1B A;  3NF6 A;  2Z1I A;  3KLI A;  3OYI A;  3ZSX A;  3QES A;  3VQ8 A;  4CEC A;  2A1R A;  3I0R A;  4M3X A;  1VSE A;  2BE2 A;  4AH9 A;  4DU1 A;  4F3O A;  2F8T A;  4M3R A;  4DWI A;  1RT3 A;  3MEC A;  5KRT A;  4KB0 A;  1C0U A;  3OYN A;  3JSM A;  4DQI A;  5FRO A;  3HXM A;  3NF8 A;  1RTH A;  3OYC A;  2G8H A;  2HHQ A;  4W5R A;  4FLZ A;  3H08 A;  3SUO A;  1QSS A;  3QEX A;  3DRP A;  4YNQ A;  2QK9 A;  3LAL A;  2E6L A;  5CZ1 A;  1RBR A;  4CHQ A;  4LSN A;  3SPY A;  2IC3 A;  2FC0 A;  5C42 A;  3TAQ A;  1UOC A;  1LWF A;  2RPI A;  4DSE A;  4GW6 A;  4KRE A;  1Z25 A;  1JL1 A;  3BDP A;  1VSH A;  4IG3 A;  2OYQ A;  3HO1 A;  4BE1 A;  2RN2 A;  2KZM A;  1RBV A;  1HQE A;  3P83 D;  4LD0 A;  3LWM A;  2EX3 A;  5SWM A;  2A1S A;  4M41 A;  3AO2 A;  2FBY A;  4W5O A;  4FM2 A;  2HW3 A;  1WAF A;  2YNG A;  3V9S A;  3NCI A;  4DQP A;  4FJH A;  1ITG A;  1BI4 B;  1SKW A;  1NKC A;  3VQQ A;  2WON A;  2XRI A;  4CE9 A;  3RR7 A;  1RT6 A;  3TAB A;  3KJV A;  1Q9X A;  4LH4 A;  4DTO A;  2O4I A;  1HMV A;  1L5U A;  1EX4 A;  1BHL A;  1X9M A;  3LPT A;  1VK0 A;  3LAN A;  3QIO A;  3NH2 A;  2E4L A;  4JS5 A;  3EY1 A;  3VQ5 A;  2Y1J A;  2X78 A;  3KIO A;  4FJL A;  4DLE A;  4F3T A;  3VQ4 A;  3K57 A;  1QSY A;  3AVK A;  3L3U A;  4FZX C;  3WNF A;  3OS1 A;  3O4Q A;  1RDC A;  2XY5 A;  4DU4 A;  1J5O A;  4F2S A;  1BIZ A;  1VSK A;  2HNY A;  2OPP A;  4HCB A;  2GV9 A;  4C8L A;  1FK9 A;  4W5T A;  4PQU A;  1IKX A;  1KFD A;  1WSE A;  1NK4 A;  4FXD A;  4CFD A;  3IG1 A;  5K14 A;  4CJF A;  4O0I A;  1EET A;  3ZT4 A;  4DFK A;  2BAN A;  3DRS A;  2HHU A;  3B6P A;  4DTM A;  1BQM A;  4Z4I A;  1C0M A;  2G8K A;  3KTQ A;  4OLA A;  1VSD A;  3WNG A;  3TAM A;  3KLF A;  4E19 A;  5HRP A;  3V9X A;  3VA0 A;  1N5Y A;  1NJW A;  2PZS A;  4FJN A;  3SCX A;  3V9U A;  1ZYQ A;  2FBX A;  1WSH A;  3NDK A;  2RKI A;  5HRR A;  2IAJ A;  3NAE A;  2ATQ A;  4E0D A;  3C6U A;  1WN7 A;  1FKP A;  4AHR A;  4WE1 A;  1S6P A;  1TGO A;  1I3A A;  1ZBL A;  1BIU A;  2E6M A;  1L3V A;  4FZY A;  3HP9 A;  3V1Q A;  1IH7 A;  1U47 A;  4F4K A;  4DF4 A;  3OYK A;  3K58 A;  4DTU A;  4FW1 A;  3OYJ A;  4HUE A;  3SQ2 A;  4J2E A;  5SZT A;  1KVB A;  1RBS A;  2DFH A;  3KKS A;  3RWU A;  3DM2 A;  4FJ5 A;  4FJX A;  2DTU A;  1VRT A;  4B3O A;  4CGI A;  4DLG A;  4ELU A;  3DRR A;  1W0H A;  1HJR A;  3NHG A;  5J2M A;  1HYV A;  3TAG A;  1IG9 A;  3P5J A;  1KCF A;  3QO9 A;  1XHZ A;  4FW2 A;  4C8N A;  3K2P A;  4CHO A;  4BDP A;  1RDB A;  3ZSV A;  4CEE A;  5HLF A;  3OYM A;  2YV0 X;  3ZT3 A;  4Z4H A;  3ZCM A;  1T8E A;  4DQS A;  5CYQ A;  1SUQ A;  3M8P A;  1WNS A;  2ITG A;  1NK0 A;  4CHP A;  4GMJ B;  3AO5 A;  1HYZ A;  1TKX A;  1B9D A;  4AHT A;  4FLW A;  1Z26 A;  3QEP A;  4CEB A;  4B9S A;  2IOC A;  4H4O A;  1G15 A;  4E7H A;  1O1W A;  3KD5 E;  2Z1H A;  4C8K A;  4JLH A;  4I9L A;  3THV A;  4HTU A;  4KTW A;  4KFB A;  3O3G A;  1ZBI A;  1S5J A;  1RIL A;  1TL1 A;  4CJU A;  1SL0 A;  1NJX A;  5T7B A;  4CIF A;  2W42 A;  4CEZ A;  4RW4 A;  1HQU A;  2VG7 A;  4E7L A;  1T03 A;  2F8S A;  2B4J A;  5JS2 A;  4CJS A;  3SUN A;  2BGG A;  3ASM A;  1CXQ A;  1UA1 A;  3M8Q A;  3LAK A;  3HPG A;  4G1Q A;  3LZJ A;  1N6Q A;  2PY5 A;  4OGC A;  4IDK A;  3DLK A;  4UQG A;  3MEE A;  4MFB A;  4CEA A;  4CGH A;  3S3N A;  3HPO A;  3HK2 A;  3PX6 A;  3AVA A;  2B6A A;  4F8R A;  3RTV A;  1RDD A;  2HB5 A;  4E3S A;  3PX0 A;  4MQ3 A;  2YHA A;  4IBN A;  3SV4 A;  4JS4 A;  4CJV A;  3V4I A;  4CJ4 A;  1HNI A;  1JKH A;  1WAJ A;  3KKR A;  3ALY A;  4FJ9 A;  1TK5 A;  1A5X A;  4HVJ A;  1DTT A;  1S9E A;  2LSN A;  1C6V A;  1I39 A;  5KTQ A;  2VG6 A;  3RR8 A;  3M8R A;  4IFY A;  4C8M A;  4HCC A;  2DFE A;  4LSL A;  3HVR A;  4BE0 A;  4FJM A;  1JL2 A;  2Z1J A;  3QET A;  4DSJ A;  4KAZ A;  4EP4 A;  1ASU A;  4W5N A;  3AVL A;  3DLG A;  1NK6 A;  1TKZ A;  1KTQ A;  2OPQ A;  3VQ9 A;  3L2W A;  4IFV A;  1U45 A;  3HYF A;  1BCO A;  4DSF A;  4CJP A;  4M3Y A;  3OYB A;  1JXE A;  3L3V A;  3CFP A;  3LZI A;  4DTX A;  4KPY A;  2ZQB A;  4DS5 A;  1C1C A;  4F2R A;  1TV6 A;  4Z4C A;  2YNI A;  2KQ2 A;  3VQD A;  3NGZ A;  3S3O A;  1NK5 A;  3DLH A;  5E41 A;  4CES A;  1VSJ A;  3VQP A;  4Z0U A;  3OS0 A;  1SKS A;  3I8D A;  2Y1I A;  5KRS A;  3O3H A;  1BL3 A;  3HM9 A;  4RW9 A;  4N47 A;  4NCG A;  3AA5 X;  5HRS A;  3D0P A;  4DS4 A;  4R5P A;  3T3F A;  3V81 A;  4CK2 A;  2XHB A;  4B9N A;  4M3W A;  3SZ2 A;  3PO5 A;  3V1O A;  3E01 A;  3AVC A;  4QCL A;  3G10 A;  3U6F A;  1IKV A;  1UAX A;  4FYD A;  3U3Y A;  3CM6 A;  4ZTF A;  4DFP A;  4B9U A;  4N5S A;  1RT7 A;  3ITH A;  3ZSZ A;  3K5M A;  1T7P A;  4KHY A;  1YTA A;  1RTJ A;  3AVJ A;  4CF8 A;  3DOK A;  3NGY A;  3NE6 A;  3QEV A;  2QXF A;  2YHB A;  2ZE2 A;  3CFR A;  2D0A A;  1CZ9 A;  4FJG A;  1X9S A;  1S1X A;  1JLB A;  1WSF A;  4M3T A;  3OYL A;  1JLA A;  4PWD A;  3RRH A;  3V1R A;  3HVT A;  1JXB A;  4O0J A;  4B8C A;  3LDS A;  5KGW A;  3HPH A;  3VQB A;  2VG5 A;  2VWK A;  2HVH A;  2IGI A;  2KW4 A;  1RBT A;  1KFS A;  3CG7 A;  2IDO A;  3DOL A;  4Q5V A;  3HT3 A;  3SYZ A;  5JS1 A;  5CY4 A;  3KK2 A;  1TVR A;  4CHY A;  5CYM A;  3G0Z A;  4NYF A;  2P5O A;  4FJJ A;  3SUQ A;  4IG0 A;  2OA8 A;  2EHG A;  4OGE A;  5I3U A;  3NF9 A;  3OYF A;  4KTQ A;  1REV A;  3PX4 A;  3EYZ A;  2P51 A;  4DQQ A;  4O5B A;  3AO3 A;  1NOY A;  1QHT A;  4Z4E A;  4KHS A;  4H4M A;  1C0T A;  1LW0 A;  3TAR A;  3NFA A;  2XY6 A;  3QNN A;  4Z4G A;  4I7F A;  3NH0 A;  4I2Q A;  1D9F A;  3C94 A;  1XWL A;  2R7Y A;  4QOZ B;  1X9W A;  1F21 A;  4BDY A;  4DSI A;  5KGX A;  4FK2 A;  2PYL A;  1JLG A;  3ZSO A;  4CF9 A;  4L8R B;  3SQ0 A;  3ZSW A;  1EKE A;  3FFI A;  1ASW A;  1HNV A;  1D9D A;  4BAC A;  5HP1 A;  4RW8 A;  3AVG A;  4ICL A;  3OYG A;  1SKR A;  4DQR A;  3HST B;  4AHU A;  4CK1 A;  5DK5 A;  4N56 A;  4FLY A;  3PV8 A;  2B5J A;  3KLE A;  4EZ9 A;  3TAE A;  1TL3 A;  4I9Q A;  1YTU A;  4RG8 A;  3JYT A;  3AO4 A;  1R0A A;  1S9G A;  1GOB A;  1QS4 A;  1LWE A;  1BCM A;  5CZ2 A;  2VWJ A;  3PY8 A;  2XY7 A;  1RCH A;  2KFZ A;  1XHX A;  3NBP A;  1A5W A;  4KHQ A;  1ZBH A;  3OYA A;  1NOZ A;  1B9F A;  3UIQ A;  2P5G A;  4J2D A;  2X6N A;  2KTQ A;  4DTR A;  3VQC A;  3RMC A;  3VQA A;  1VSF A;  1T05 A;  1WSJ A;  1QTM A;  1UWB A;  1UA0 A;  3TAN A;  1TKT A;  1EP4 A;  3DI6 A;  3DLE A;  1U48 A;  3OYD A;  4CF2 A;  2X6S A;  4B9M A;  1LAW A;  4I2P A;  4XIU A;  2G8F A;  4KI4 A;  3S3M A;  4FK4 A;  4CGJ A;  2HVI A;  4ELT A;  3MEG A;  3K59 A;  3LPU A;  1HRH A;  5EU7 A;  3DYA A;  4JRP A;  1S1U A;  3MAQ A;  3SI6 A;  1BGX T;  1KSP A;  4Y1C A;  4FLU A;  2HMI A;  3VQ6 A;  3KLG A;  1JLE A;  4FLT A;  2KFN A;  1SL1 A;  4BWM A;  3NH1 A;  4FM1 A;  1KVC A;  1D5A A;  4HUF A;  3SQ1 A;  3SJJ A;  4M42 A;  1WSI A;  4PY5 A;  2YKN A;  3AVN A;  1Q9Y A;  3ISN C;  3I0S A;  3IS9 A;  3L2V A;  3LWL A;  3QEW A;  3V6D A;  5J2N A;  3KLH A;  3CFO A;  3AV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...