1ITGA

Crystal structure of the catalytic domain of hiv-1 integrase: similarity to other polynucleotidyl transferases
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
142
Chain Sequence
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Crystal structure of the catalytic domain of HIV-1 integrase: similarity to other polynucleotidyl transferases.
pubmed rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 44
structure length 142
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1itgA00
1UA0A 1K6YA 1S1TA 2YKMA 3ZSVA 4ZHRA 2YNIA 4DF4A 4EZ6A 2FBVA 3CFPA 4E7JA 3V9SA 4JS4A 4CERA 1RBVA 4CGIA 2BE2A 3VQ6A 1X9SA 2IGIA 3DOKA 3ZT0A 4CESA 3NF8A 3JYTA 1NK6A 4KTQA 4FJIA 3K2PA 3OYKA 1TKTA 4FLWA 3KK2A 4GW6A 1RDBA 1BGXT 3OYHA 4OKEA 3U6FA 2KW4A 3MXIA 1ZYQA 4AHSA 1QSYA 3AVKA 4DFKA 1QTMA 3KK1A 3A2FA 4ELTA 1VSDA 3OYMA 1QQCA 3DM2A 4IG3A 3LDSA 1VSLA 3ITHA 4CF1A 1RT7A 4C8NA 3ULDA 3H08A 1VRUA 1JLAA 2E4LA 1Y97A 3DRRA 4FJ7A 2Z1JA 3LZIA 3ZSQA 4FCYA 2YHAA 1C1BA 4F2SA 1BI4B 1YTAA 3LANA 1DTTA 3QLHA 1HMVA 1A5XA 1S9GA 3AVNA 5CYMA 3PX0A 1NJYA 3BDPA 4DFJA 1KFDA 1C6VA 2VG5A 3HYFA 4CJEA 4NCBA 1Z26A 3PO4A 4AHRA 4EZ9A 4AH9A 2OPRA 3CYMA 3RMCA 1NJZA 3KLIA 3L3UA 4CJTA 3HM9A 3RRHA 3SV4A 4DTMA 4B9SA 3DLKA 2IDOA 2Z1IA 2F96A 1TKZA 2HW3A 1KSPA 1JLCA 1CXQA 1B9FA 3T3FA 3SQ2A 1RTJA 3QEVA 4W5NA 3AV9A 2X78A 3THVA 4I9QA 4FJNA 3KLGA 3MECA 3OYCA 1TL3A 3TABA 1TKDA 1JLEA 4KREA 1JLQA 2Y1IA 4DTOA 3C6UA 4OGEA 2JLEA 1EP4A 1T7PA 5J2MA 4KHSA 3D0PA 4CCHA 2AJQA 4CF0A 4DSEA 3SUQA 4K8XA 1DTQA 1UAXA 2VWKA 4HUGA 1SL2A 4WE1A 2KZMA 4CK1A 3IS9A 4RW8A 2XO7A 3OYGA 4CFBA 1RBUA 4B08A 4E89A 3M8SA 1XWLA 4E7LA 4DFMA 2Y1JA 1NJWA 3RR7A 4B8AB 1J53A 4YFUA 1S1XA 1KVBA 1BCOA 1LV5A 3QESA 1WSHA 2HNDA 1Q9YA 2VG7A 2OYQA 3OYLA 1WNSA 1U4BA 1LAWA 4Y1DA 4KTZA 2I5JA 2D0AA 1L3UA 4DTSA 3HVTA 4DQQA 3C6TA 4O44A 1VSEA 1EXQA 1TAQA 4CK2A 3NGZA 1REVA 2RPIA 4CJ4A 1S5JA 1U49A 4IG0A 4NYFA 1JLBA 3VQCA 3EZ5A 4BDPA 1LW2A 2XHBA 4LSLA 3ZT1A 3SYZA 4FLTA 4CJFA 4DFPA 4E0DA 4ELUA 1HJRA 1VSKA 4DQSA 4Z4HA 1W0HA 4KI4A 1RBTA 4DSFA 4M3TA 4IFVA 4CIGA 1IH7A 3AVHA 4GMJB 1JXEA 1WSJA 3G0ZA 3DLGA 2EHGA 1CZ9A 3WNHA 3KK3A 3CG7A 1KLNA 4Z4IA 1NK4A 3OYNA 4B8CA 1NK8A 2YNHA 4BE2A 3PX4A 1HNVA 1EX4A 1HYZA 4LH4A 4E7HA 4CGJA 2P5OA 3LP1A 3VQ5A 1VSJA 4CF2A 4DTNA 1HYVA 2HVHA 1VSHA 4O55A 3LP3A 3MEGA 3OS0A 1B92A 3U3GA 1SKSA 4OLAA 2PZSA 2IOCA 2YKNA 1HQUA 1NOYA 2WOMA 4FXDA 1IG9A 4FJJA 4JLHA 1XI1A 3SCXA 3VQ8A 1YTUA 1U48A 1KFSA 2ITGA 1RT1A 4CECA 4B9VA 3DOLA 1HQEA 4LD0A 4DSIA 2HHUA 1JLGA 1Z25A 2YNFA 4E1MA 3VQ7A 4JRQA 3HT3A 1NK5A 4DSKA 4AHCA 4OPKA 4ZTJA 4CHQA 3O3FA 1BHLA 2X74A 4FZXC 3HPGA 1X1PA 4Z4EA 4CJWA 2RKIA 4CGGA 4KRFA 3P1GA 3AA5X 4RG8A 4DTUA 4KV8A 2O4GA 2OPQA 3AO5A 1LWEA 3JSMA 4IBNA 4C8OA 4IFYA 4M3WA 3AVFA 1C1CA 2HVIA 1BQMA 1HNIA 1I39A 2P1JA 3QINA 3L2VA 4BWJA 3V1OA 3HJFA 4FLXA 4N47A 4AHUA 3AA3A 5HRRA 3O3GA 1SUQA 3RRGA 4DWIA 1UA1A 4EP5A 3TARA 1ASWA 1MU2A 4H8KA 4OVLA 5KRSA 3OVNA 4O0JA 5SWMA 2HHWA 3ZSWA 3LAMA 4CJLA 4I2QA 2HHSA 4KAZA 1IKYA 5J1EA 2IC3A 1W9HA 5CY4A 4CJVA 5C42A 4FLUA 3NGIA 3HPHA 4N5SA 3DLHA 3KD1E 4CEEA 3L2WA 5JS1A 3VQPA 1Q8IA 4W5TA 1KCFA 4M41A 1RT4A 1RTDA 3SPZA 3P83D 1T8EA 3VA0A 4CHOA 3SUPA 2Z1GA 3IG1A 2PYJA 3SZ2A 1L3SA 2YV0X 3P5JA 1NK9A 3QNOA 4G1QA 3T19A 5J2PA 4DU1A 4FJHA 4Z4GA 4CHYA 1BIUA 3NE6A 2EX3A 2W42A 4KFBA 3CFRA 1QSSA 3UIQA 1TK0A 1A5WA 1BQNA 1N6QA 4C8LA 1O1WA 2DY4A 1JL2A 1RTIA 3PO5A 5HROA 1NK0A 3QERA 1KRPA 4Z0UA 1NOZA 2A1RA 5C25A 2D0BA 3KLEA 1X9WA 2YNGA 4UQGA 4H4MA 3SUNA 3DLBA 2QKBA 3V4IA 2HHXA 4E1NA 1J54A 1ZBFA 2P51A 3M8PA 2B5JA 1FK9A 2NUBA 4AHVA 4ZTFA 4BE1A 4RW4A 1G15A 3ZT4A 1ASVA 3HVRA 3C95A 3CFOA 3DRSA 4CEBA 1IO2A 3SUOA 4FLZA 1ZBHA 1BCMA 3ALYA 1QE1A 2FBYA 4FVMA 5DMRA 4CF9A 2G8VA 3WNGA 3C94A 3DMJA 3O4QA 4FM1A 4TSXA 4HVJA 1DLOA 2G8IA 3VQEA 3V81A 3QETA 2IS3A 3AO3A 4OJRA 3V1QA 4E7KA 3SNNA 1T05A 4I9LA 4PY5A 3CM5A 4HTUA 4MFBA 1S6QA 3QEWA 2KQ2A 2X6SA 1HPZA 1UOCA 4KHUA 4Y1CA 4BE0A 4R5PA 4M3XA 1BIZA 1GOAA 1C0TA 4CJSA 3K5MA 1KTQA 1IKXA 4OKJA 3ZT2A 4RW9A 4QOZB 1YT3A 3TAGA 2ZD1A 2IAJA 3OYJA 1BISA 3L3VA 3ZSZA 1JL1A 1RT6A 1J5OA 4FJXA 1WAJA 4CK3A 3PV8A 1NKCA 3TWHA 3HL8A 4N76A 3AVIA 4DF8A 4OLBA 2F8TA 4FJLA 1S1WA 4AILC 3RR8A 3LWLA 1S1UA 4O5BA 4FJ9A 2Z1HA 4I2PA 4KKOA 4E7IA 2HMIA 3QEPA 4C8MA 1X9MA 4M3UA 5DK5A 3KTQA 4DQPA 3VQDA 5HP1A 2Q3SA 4LSNA 2DFFA 4DQRA 4B9NA 1C0UA 3HPOA 2ZE2A 4CGDA 4N41A 2B4JA 5CYQA 3SQ0A 3LWMA 1NKEA 3PX6A 1GOCA 1RDCA 4LY7A 4C8KA 2WONA 4M3YA 3OJSA 2QKKA 4DTXA 2BDPA 2KZZA 4DTJA 2GUIA 4QCLA 3QO9A 3TI0A 3O3HA 3IRXA 3VQ4A 3RMDA 1TV6A 4W5OA 3AVMA 3AO4A 2GV9A 4CFCA 1ZBUA 5HRNA 2XY5A 4DLGA 3E01A 3HP9A 3VN5A 2B6AA 3ZCMA 3SJJA 3KLFA 1U47A 4FJ5A 3HXMA 4HUFA 2P5GA 1TK8A 1L3TA 3V9WA 1C1AA 4AHTA 1JKHA 1JLFA 4CJ5A 3OYAA 1WSFA 1RILA 3VA3A 1EKEA 3ASMA 4CJPA 4CHZA 4B9MA 2G8HA 2F8SA 4F4KA 2OA8A 3QIOA 4MQ3A 4E19A 3NCIA 2DTUA 1KLMA 1ASUA 2RN2A 2G8FA 2FBTA 1LWFA 3S3OA 1WSIA 3TAEA 4BWMA 2HHVA 3NH2A 4FK4A 3QEIA 3AVBA 2ZQBA 5KGWA 1N5YA 2FBXA 3QEXA 1WAFA 5SZTA 2XY7A 4FJKA 3HSTB 4CIEA 4BACA 3NH0A 3TAFA 3HK2A 4CJQA 4HCCA 1WN7A 4LH5A 5FDLA 1T03A 3OYDA 1RTHA 1KVCA 1RT2A 2FC0A 3NHGA 4OKKA 4CEFA 4J2AA 1UWBA 4DS5A 4ID5A 3KJVA 3MXJA 4FJMA 4M3RA 3V9UA 5E41A 4DTRA 4M42A 2XY8A 2HHQA 3AA2A 3HP6A 3TAQA 1JXBA 4DU4A 4H4OA 4ID1A 4DU3A 4Z4FA 3EYZA 4FM2A 3G10A 1RDDA 1QS4A 3ISNC 3KKRA 4CF8A 3L2RA 4DLEA 1VK0A 3M8RA 4FM0A 3PY8A 4KB0A 3LPTA 2D0CA 5J2NA 1VSIA 1B9DA 5HRSA 2A1SA 3M8QA 5EU7A 3V9XA 3K58A 3MEDA 4M45A 4FW1A 4EP4A 1TK5A 3TANA 1SV5A 3WNEA 4CJUA 1U45A 1D9DA 3AVCA 4DQIA 4PUOA 2BANA 3I0RA 3L8BA 1CZBA 4DTPA 4F8RA 4GVMA 4RW7A 3AA4A 3ZSXA 3MEEA 3NGYA 3QNNA 3SI6A 3VQ9A 3NBPA 1A5VA 4NCAA 3IAYA 2LSNA 1EETA 3OYEA 1D5AA 2PYLA 3RMAA 3I8DA 4B3OA 2HB5A 5HBMA 3CM6A 2KTQA 4CJRA 1ZBLA 4ICLA 3KKSA 1WSEA 4HCBA 1SKWA 2G8UA 4QAGA 1XHZA 1BL3A 4KB1A 4KO0A 1XC9A 1F21A 3DLRA 3KIOA 4CIFA 3VQQA 1IKWA 3WNFA 2GBZA 3RTVA 3OYFA 3L2UA 3TAPA 3K57A 4J2DA 3OY9A 4B9UA 3ZT3A 4KHNA 1BI4A 1YVUA 2JGUA 3V6DA 4DMNA 5D3GA 5KTQA 2PY5A 1TVRA 1FKPA 1RDAA 4FZZA 3AVJA 4CJKA 1RT3A 4I7FA 3K5NA 4FW2A 3DYAA 4KHWA 3LZJA 1CLQA 3NF9A 4CE9A 3RMBA 4KPYA 3DI6A 1RT5A 4FYDA 4W5RA 4IKFA 2BGGA 3NFAA 1RBSA 5K14A 3OYBA 4RW6A 4PQUA 3MAQA 3B6OA 3CQ8A 1D9FA 2OZMA 4J2EA 1HYSA 2D5RA 3B6PA 3EY1A 1WSGA 3OJUA 3SQ1A 3LP0A 4OPJA 5KI6A 4FK0A 3S9HA 4FJ8A 4KI6A 1XHXA 2OPPA 1HRHA 3LALA 1FKOA 1S9EA 4CHPA 4CFDA 3KD5E 1QHTA 4KTWA 4NYNA 2YHBA 1D8YA 2XRIA 1TAUA 5JS2A 1VSFA 3ZSYA 3SQ4A 3AVGA 1L3VA 3AVLA 3I0SA 3TR8A 4BDZA 4CGHA 1VSMA 3F9KA 5KGXA 2DFHA 4CEQA 1NKBA 3RWUA 4KHQA 4F3TA 5KRTA 1C0MA 3ZSOA 4IDKA 3U3YA 1TGOA 4O0IA 4HHTA 2QXFA 1RBRA 4CEOA 3VQAA 3K5LA 4K8ZA 4CHNA 3OYIA 4F3OA 3NF6A 2KFZA 4FZYA 4CJ3A 3NH1A 4FLYA 1IKVA 2E6LA 4CFAA 4HUEA 5HLFA 3F73A 4FK2A 3BGRA 1QSLA 4PWDA 5CZ2A 1WLJA 4O4GA 1TKXA 2ATQA 4JRPA 5I42A 1I3AA 1RNHA 1L5UA 4B9LA 3T1AA 3HO1A 4XIUA 4CEDA 1RCHA 2VG6A 3S3NA 3D45A 5HRPA 4OGCA 2RF2A 3NDKA 2OZSA 2DFEA 5T7BA 4DS4A 4F2RA 3OS2A 1NK7A 4J2BA 1FXXA 2G8KA 2G8WA 1LAVA 4Q5VA 5J2QA 1KVAA 1U04A 3K59A 2E6MA 4Z4CA 3LAKA 1VRTA 4NCGA 3TAMA 1SL1A 4YNQA 3KLHA 3DRPA 5FRNA 3SV3A 4KHYA 3NF7A 4Q0BA 1LWCA 4ELVA 4M3ZA 3LP2A 2OPSA 3AVAA 1S6PA 3DLEA 4FJGA 3ZSRA 1GOBA 1LW0A 4W5QA 4B9TA 3K5OA 4CEZA 5I3UA 3VQBA 1NJXA 4CGFA 4E3SA 2HNYA 1ZBIA 3AO1A 2O4IA 4DG1A 2HNZA 3AO2A 2KFNA 3QIPA 4JS5A 3V9ZA 2XY6A 2VWJA 4L8RB 3OS1A 1R0AA 1ITGA 5C24A 2R7YA 3V1RA 3PUFA 4N56A 1CXUA 3NAEA 2ETJA 1SKRA 1J9AA 3O4NA 2X6NA 3S3MA 5FRMA 3LPUA 5FROA 4BDYA 4FLVA 4PA1A 1Q9XA 5CZ1A 3SPYA 3L2QA 1SL0A 1TL1A 1S1VA 4CEAA 4DSLA 4DSJA 2QK9A 3MXMA 3FFIA 2HHTA
chains in the Genus database with same CATH superfamily
2NZTA 3CCSN 2YKMA 2YNIA 2YHXA 2FBVA 3CFPA 4LC9B 1SAZA 2IGIA 3ZT0A 3A8YA 4KTQA 5AQWA 3KK2A 3HBTA 4XH4A 2GWKA 3WXJA 4DFKA 4ELTA 3A2FA 4DUZK 5FPMA 3JS6A 4GV6A 3BF1A 3KVGA 1VSLA 3ITHA 3QDKA 3JAMO 1RT7A 3KWIA 1JLAA 2E4LA 3E9PA 4FJ7A 4JKEA 1XQSC 1C1BA 4MLHA 3HM8A 1HMVA 1A5XA 1RDWX 4EFHA 1C6VA 3HYFA 3RSEB 1Q7YO 2UXBK 4JHDB 3THYA 2QI2A 4CZIA 5BPLA 4BRNA 3M1FA 3SV4A 4DTMA 1TKZA 2HW3A 4DCHA 3PSFA 1CXQA 3SQ2A 1RTJA 4FWNA 2E20A 4KH4A 1BWFO 4I9QA 3KLGA 3MMVA 2NRHA 3OBWA 4IOCL 1TKDA 2ITMA 1JLQA 3MX5A 4GY2B 3TSPA 3C6UA 4OGEA 2OTLN 1EQYA 5J2MA 3C0BA 1XNRK 2YHYA 1DTQA 3U8XA 4HUGA 1SL2A 2XO7A 3M8SA 3ZX2A 4E89A 4DFMA 2Y1JA 4E7LA 1J53A 1KVBA 4OX9K 2HNDA 4WQ5A 3OYLA 1WNSA 1L3UA 4KTZA 5KQ8A 2P9PB 4CK2A 1S5JA 4NYFA 3VQCA 1JLBA 3ZYYX 3EZ5A 1LW2A 4DFPA 4LSLA 4FLTA 4CJFA 2JWKA 4CVNE 1NGBA 1TYQB 4ELUA 4FWOA 1RBTA 4DSFA 4IFVA 1IH7A 3AVHA 3G0ZA 5F1XA 3DLGA 1CZ9A 3WNHA 5LY3A 4Z4IA 1NK8A 4BRQA 4LH4A 1HYZA 4CGJA 5BRHA 3LP1A 1VSJA 4CF2A 1HYVA 3LP3A 3TTDA 1B92A 4BRMA 5BREA 5EVZA 3VENA 4DHYA 2WOMA 4FXDA 5AQLA 2OANA 2P9LB 1WBDA 1IG9A 5AQHA 3HRGA 3GBTA 3VGKA 2ITGA 3CETA 3DOLA 5KPTA 4E1MA 3VQ7A 3D2FA 1NK5A 3HT3A 3LDNA 3HSCA 4FZXC 3O9TA 4RG8A 3BUZB 4KV8A 3H3OB 1VQ6N 5BPMA 3O4WA 3AVFA 1XMQK 1C1CA 2HVIA 1BQMA 1DT9A 3HJFA 1DGKN 1RDUA 1NBWA 1SUQA 3N4PA 4JI1K 2HHWA 4H0VB 5AQQA 4CJLA 4CZKA 3AAQA 2IC3A 5CY4A 4B1XB 5C42A 5AQGA 4FLUA 4CZFA 4JKBA 3NGIA 5JICA 1Q8IA 3UKRB 5JLFA 4YY3K 2I7NA 2E1ZA 2VYPA 2PYJA 1NK9A 4G1QA 4FJHA 4JI2K 3F5TA 4CHYA 3AAPA 3NE6A 4KFBA 4CBUA 3CFRA 1GLEG 1NM1A 2UU9K 3CQYA 3WEEA 4M63C 1YJNN 4BRPA 3VEXA 4Z0UA 1X3NA 5C25A 2D0BA 1BU6O 2KKZA 1JCEA 4H4MA 4PL7A 3J8AA 2HHXA 2ASOA 1YJWN 1S72N 3LDPA 3EZWA 4BE1A 4RW4A 3ZT4A 5AQYA 3DRSA 1YIJN 4X66K 2Q97A 4FLZA 4CF9A 1W2BM 4FM1A 4HVJA 2G8IA 4XEIA 1K8AO 2IS3A 3V1QA 3SNNA 4I9LA 3M6GA 4MFBA 2KQ2A 3IFRA 5AZIA 4M3XA 4CJSA 3CXCM 1IKXA 1GLAG 3FR0A 1QVFM 4QOZB 3CERA 4AM6A 3L3VA 3ZSZA 2UYTA 1JL1A 4JKGA 2PAVA 3THWA 1NKCA 4JI4K 4BG8A 3WQTA 4QS7A 4QS8A 3QB0A 5GAEP 1S1UA 2AA4A 2O8DB 4KKOA 3QEPA 4C8MA 1HNXK 1NGHA 4NLBA 4LF6K 4DQRA 5AQFA 4LF7K 2B4JA 4AF1A 1IJJA 1RDCA 4LY7A 1OH6A 2WONA 3VGLA 1GLJO 4DTJA 2GUIA 4JKHA 3O3HA 2D0OA 4LF4K 3VQ4A 4W5OA 2ZJPL 3E01A 3HP9A 3ZEUA 2B6AA 4DLGA 1U47A 5AFUH 3UKUB 4JV5K 1VQ7N 4EHUA 1JKHA 1MDUB 4CJ5A 3VA3A 2G8HA 3FZLA 1KAZA 4E19A 3CC2N 1ASUA 1KLMA 2RN2A 1LWFA 1QZ6A 2P9SB 3AVBA 2XY7A 4CIEA 4BACA 4DV6K 3MN5A 3HK2A 3SAGA 4HCCA 2CGJA 1NGDA 3D2EB 1KVCA 1T6CA 5CR4A 3KJVA 1DEJA 1HNWK 3TAQA 3DWLA 4H5RA 4DU3A 3EYZA 2NRTA 3MN9A 4CF8A 3NVKA 1T6DA 1ATNA 2D0CA 5HRSA 2A1SA 3DJCA 3M8QA 1WUAA 3AVCA 3I0RA 1CZBA 3FZMA 4DTPA 4YHHK 4RW7A 2YJEA 3AA4A 4DB3A 3IAYA 3BP8A 3RMAA 3I8DA 2PYLA 3MX2A 3CM6A 3O9UA 2KTQA 4BRFA 2HF4A 1ATRA 1ZBLA 4HCBA 4FOIA 4KB1A 3BEXA 4JKFA 3WNFA 1IKWA 2GBZA 3K57A 3R8EA 3ZT3A 4PKIA 3GOIA 1YVUA 2P9UB 2PY5A 4CJKA 2FF3B 3DI6A 4BG9A 4IKFA 3E66A 1RBSA 2GELA 3QMLA 2HSTA 4IOAL 2HBMA 4FJ8A 1KC8O 3LALA 1NG9A 4CFDA 4KTWA 4NYNA 2P9IA 2VCPA 4YDUC 3F9KA 4ILGB 5KGXA 2DFHA 3UE5A 4F3TA 4GNIA 4QS9A 1C0MA 2O8CB 1MWKA 4IDKA 5GAGP 4CEOA 3R3LA 3K5LA 3OYIA 3NF6A 4FLYA 3O9SA 3BGRA 3SAFA 3VEYA 1TKXA 2IVOA 3EE8A 1L5UA 3T1AA 1M1KO 4CEDA 1RCHA 2VG6A 4BQZA 5DM6L 2F9TA 1TYQA 2OZSA 2RF2A 5CHIA 2DFEA 4DS4A 5M1KA 3OS2A 1NK7A 2G8WA 1N33K 3SLCA 5C15A 3ID8A 1KVAA 3K59A 5LJWA 4A62A 5LL6Z 4NCGA 5M1NA 4BRAA 3KLHA 5FRNA 2VQEK 4Q0BA 4M3ZA 2OPSA 3DLEA 5GIOA 2WBNA 3K5OA 4CEZA 5KPZA 4JKDA 1QHAA 3CCQN 3CJBA 4CBWA 3AO1A 3N4QA 3AO2A 4ISFA 4L3QA 1BG3A 3OS1A 1R0AA 2HMPA 4FWMA 3THXB 3VEOA 3PUFA 4X64K 4N56A 1CXUA 2ETJA 1SKRA 5FRMA 1N8RO 3CC4N 5CZ1A 3L2QA 2PBDA 3IDHA 4DSLA 4DSJA 1IBMK 1IBLK 2YCHA 4O5BA 1U2VA 4BC2A 1UA0A 3ZSVA 4DF4A 4DR5K 4E7JA 4JS4A 4CERA 1ESVA 1RBVA 3VQ6A 3PIOL 4CESA 3NF8A 1J6ZA 4FJIA 3K2PA 1OKJA 1TKTA 4IEEA 1RDBA 1BGXT 1ZYQA 3AVKA 1VSDA 3OYMA 3DM2A 4JD2B 4CF1A 3ENOA 3K9JA 4C8NA 3H08A 3ULDA 1Y97A 4FWLA 4CJ7A 2E88A 5GADP 1YTAA 3LANA 3QLHA 1KD1O 3PX0A 1NJYA 3BDPA 4DFJA 4NCBA 2VG5A 3A5OC 1Z26A 4AHRA 1RGIA 4AH9A 2QM1A 2OPRA 3CYMA 4YDUA 1VQMN 1NJZA 3L3UA 3HM9A 5A2QO 2NRXA 3VF6A 3DLKA 3CCRN 1KSPA 4DV3K 1B9FA 1E4GT 4W5NA 3QEVA 1NGEA 3CCJN 1JLEA 4DTOA 2JLEA 1EP4A 1KAYA 3LDQA 4KHSA 4CF0A 1T44A 5EXWA 2KZMA 2VWKA 4FVUA 4WE1A 4CK1A 3IS9A 1RBUA 1X3MA 1XWLA 3M3ZA 2BH1A 1S1XA 4I6MB 2W6LA 3QESA 4K0KK 3P4IA 2D1KA 1YJ9N 1U6ZA 3C6TA 1VAZA 3NGZA 3WXIA 4CJ4A 2XHBA 3SYZA 2V51B 3P31A 4DQSA 4GMJB 1GLBG 2EHGA 3VTHA 1KLNA 2D4WA 1NK4A 3OYNA 4B1YB 3CCLN 1Q18A 4C23A 1VQ9N 3QBWA 1HNVA 4E7HA 4ISGA 3VQ5A 3MEGA 1SKSA 4RTFD 2IOCA 2YKNA 1HQUA 4WF9L 1HLUA 2P9NA 4LF8K 2ZJQL 4FJJA 3SCXA 3VQ8A 1RT1A 2BTFA 1VQ5N 1HQEA 1TUYA 1W97L 4DSKA 4OPKA 3HPGA 2UUBK 3AA5X 5BRFA 4DTUA 2OPQA 3MCPA 1LWEA 4A61A 4C8OA 3MK6A 4JI6K 3CPEA 1HNIA 1I39A 5AFUA 4LFAK 4BWJA 4IOXA 1DKGD 4MDBA 4EP5A 1ASWA 2VQFK 4H8KA 4OVLA 1YXQA 3ZSWA 2NNWA 4I2QA 3VEVA 4CZJA 4Y0WA 2ASMA 4CJVA 5AQSA 2KHOA 4A2AA 3KD1E 1KCFA 1RT4A 3MN6A 3IG1A 1L3SA 5J2PA 2BUPA 4Z4GA 2V7YA 5HL7L 2EX3A 1TUUA 3LM9A 1WB9A 1QSSA 1HUXA 3W0LA 3ULEB 1BOTO 4C8LA 5BN9A 1O1WA 2DY4A 3DXMB 1NK0A 2CH5A 3W3DA 2A1RA 3O1WA 2YNGA 3DLBA 1J54A 1VQON 3M8PA 4AHVA 1K8KA 2QXLA 1G15A 3I55N 4CEBA 3R6MA 3ALYA 2FBYA 3WNGA 5LMUK 4TSXA 1DLOA 3QETA 1T05A 1Y64A 3TPQA 4HTUA 4DV7K 1P8ZA 2Q36A 2P9UA 1HPZA 1UOCA 4KHUA 4Y1CA 4R5PA 1BIZA 5ELZA 1KTQA 2QWRA 2QW9A 4RW9A 2AP1A 4IO8A 3U9ZA 2E2OA 2QWOA 3PIPL 4YOTA 4BRKA 4CK3A 3TWHA 1K73O 4N76A 4CBXA 1S1WA 1BO5O 2A3ZA 4AILC 4R79A 4FJ9A 4BR0A 2Z1HA 4I2PA 4E7IA 5HP1A 2RHKA 3HPOA 2ZE2A 4CGDA 4M7YA 3SQ0A 1XUPO 1YF5L 1BDGA 3L4IA 2UUAK 2QKKA 4DTXA 4A59A 2BDPA 4QCLA 3QO9A 3SAHA 2H3GX 3RMDA 1TV6A 3MWTA 4GV3A 4CFCA 5HRNA 4ZTJA 3SJJA 4KHWA 3CJ7A 3ZCMA 3KLFA 4MLEA 3Q7BA 4FJ5A 4HUFA 4C1NI 4WQ4C 1JCFA 4BR5A 1C1AA 4AHTA 4K42A 3TU5A 4CHZA 4DR1K 2Q31A 3H3NO 1JJ2M 2YI1A 3CQXA 3UB5A 1NGFA 3S3OA 3TAEA 4BWMA 3NH2A 4FK4A 4ILHA 1WAFA 3EO3A 3HZ6A 1WBBA 5FDLA 1T03A 2A40A 1RT2A 3U9DA 1UWBA 4DS5A 3V9UA 1V4TA 2HHQA 4H4OA 4FM2A 4NB4A 4DLEA 3LPTA 3V9XA 5EU7A 5GINA 3K58A 4YOVA 1TK5A 3E9OA 1U45A 1Q86O 2BANA 3L8BA 1OVYA 5AQOA 5JVHL 4DV4K 3CCVN 4GVMA 3ZSXA 3VF2A 3SI6A 3NBPA 4ICLA 2G8UA 4QAGA 4JD2A 4DV5K 4IJNA 1F21A 3CMEN 3DLRA 3KIOA 3G71N 4BREA 3OYFA 3A0IX 1NWKA 2JGUA 3FLCO 4DMNA 5D3GA 5KTQA 1RDAA 4FZZA 4I7FA 3K5NA 3DYAA 3NF9A 3ZX0A 4CE9A 1RT5A 1JCGA 4DR7K 3ZETB 3NFAA 4YOXA 3MAQA 3EKSA 3CQ8A 2P9KB 4J2EA 1WSGA 3LP0A 2CGKA 4OPJA 4FK0A 5BRDA 4KI6A 1HRHA 4BR2A 4WQ4A 3CJ9A 3KD5E 2YHBA 1TAUA 1VSFA 3ZSYA 4WCEL 3MCAB 3G6EN 4CGHA 4KHQA 1C0FA 3ZSOA 3F2KA 4JI8K 1TGOA 4AM7A 2QXFA 3P38A 4K43A 4DV1K 4FZYA 3NH1A 4CFAA 5HLFA 3VETA 2E2QA 3ENBA 4O4GA 5I42A 2YJFA 5JS1A 2NRZA 3D45A 5HRPA 4JI5K 5T7BA 1VQNN 4BRHA 1KXPA 2G8KA 3EL2A 3H1VX 4Q5VA 2E6MA 4DR2K 2A41A 3TAMA 3DRPA 3SV3A 4IJAA 1LWCA 4ELVA 2UXCK 3LP2A 3AVAA 4B3MK 3ZSRA 1LW0A 3T1HK 5I3UA 4E3SA 2HNYA 1ZBIA 4DG1A 4E1JA 2KFNA 5AQPA 1VQKN 3CJAA 3O5BA 2XY6A 1XNQK 1NU0A 4BRDA 3EN9A 5KPRA 3O4NA 3L0QA 3LPUA 4IZ9A 2ZM6K 2VWBA 3NMUA 1S1TA 4CI6A 4ZHRA 2HOEA 4CGIA 2ASPA 2BE2A 3DOKA 3JYTA 1NK6A 3PLAA 3FZFA 4FLWA 3A5MC 4EIAA 4GW6A 4AQYK 3U6FA 3OYHA 4OKEA 3MXIA 3DXKB 4AHSA 1QTMA 4BRCA 3KK1A 1QQCA 3LDSA 3J7ZO 4LFCK 1X9JA 1VRUA 3B8AX 2Z1JA 3LZIA 4F2SA 4H0OA 3THYB 1DTTA 1S9GA 4XH1A 4GKJK 3AVNA 4O8KA 1VQPN 3BZCA 2FSKA 3CPWM 5AQXA 1XMOK 4CJTA 3RRHA 3RSEA 3DXMA 2Z1IA 2F96A 3T3FA 2J4RA 4JHDA 2PFUA 3THVA 2Q2RA 4LF9K 1ZC6A 1TL3A 3OYCA 3TABA 2Y1IA 2ZJRL 1CZAN 4CCHA 2AJQA 4DSEA 3SUQA 4K8XA 5LJVA 4RW8A 4JKCA 3OYGA 4H03B 4CFBA 3RR7A 4B8AB 1G99A 1BCOA 3FFKB 1WSHA 1Q9YA 1U4BA 1LAWA 4Y1DA 2D0AA 4DTSA 4O44A 1VSEA 1EXQA 1TAQA 5I9EB 1REVA 2QWPA 1C0GA 2O8FB 2P9PA 4LF5K 4E0DA 2V52B 5M1FA 4Z4HA 3OHRA 1YUWA 4KI4A 4CIGA 4JKAA 1HX1A 1WSJA 3CG7A 2YX6A 2YNHA 4OPAA 4BE2A 2W41A 2E8AA 3PX4A 3D6RA 1EX4A 3O9RA 2QWLA 5E84A 4DTNA 4O55A 4CZLA 3U3GA 4OLAA 1GLCG 3TSUA 1ATSA 4JLHA 1XI1A 1YTUA 3H6EA 4A5AA 2FF6A 4CECA 4B9VA 3BZKA 1Z25A 4BROA 3A5NC 4JRQA 2P9LA 4AHCA 3WUHA 4CHQA 1BHLA 3O3FA 2NRWA 1X1PA 4IEIA 4KRFA 4V19S 1R59O 3P1GA 2NLXA 2I7PA 3SMSA 2O4GA 4BR9A 4JI0K 4BVPA 3JSMA 4IBNA 3D7EO 5AQIA 1HKCA 3V1OA 5TKWA 4FLXA 5IT9O 5HRRA 1FW6A 3RRGA 4DWIA 3TARA 4B1VA 3OVNA 5SWMA 2WUSA 5TKYA 3LAMA 4KAZA 1NGIA 1W9HA 1ILYA 3HPHA 4N5SA 3VMFB 1HJOA 3DLHA 1RTDA 4W5TA 4M41A 3P83D 4PKGA 3VA0A 4BR7A 4CHOA 2Z1GA 1ZBSA 3T19A 2HF3A 3WEEB 3QNOA 3UKRA 1BIUA 2ZWHA 2W42A 5BPNA 4BC5A 3UIQA 1TK0A 1NLVA 3CHWA 1EO1A 1RTIA 3QERA 4X62K 2ZF5O 4FSVA 4CZMA 1NOZA 1BA0A 4B3SK 1QVGM 1X9WA 1YITN 3SUNA 3HTVA 3V4IA 2GWJA 2DPNA 1ZBFA 1FK9A 4ZTFA 4EHTA 4OO1J 2VGMA 4H5NA 1ZBHA 3C95A 3K9KA 1IO2A 5FPEA 1QE1A 5DMRA 1GLLO 4EAHD 3C94A 3K0SA 3VOVA 3V81A 5AQUA 2QWQA 3VF4A 3EKUA 4PY5A 3CM5A 3R9PA 1S6QA 3QEWA 1NGCA 5CE3A 4BE0A 1C0TA 3K5MA 3THWB 4OKJA 4C1NK 4B3RK 3ZT2A 4UY8O 4FPBA 1YT3A 3TAGA 2IAJA 2ZD1A 2CGLA 1M90O 1RT6A 2O8BB 2P9KA 5AQJA 5MLCQ 3J7YP 3AVIA 2F8TA 4CD3A 4FJLA 5C2DA 5DM7L 4U67L 1E3MA 5DK5A 3OTOK 1HKBA 1NGAA 4H0PA 5C10A 3VQDA 3KTQA 4DQPA 2DFFA 4B9NA 1C0UA 4DR6K 4N41A 2O8DA 3PX6A 4JK7A 4M7XA 4JNEA 3HOSA 4NLCA 3SBTA 1IBKK 3IRXA 3AVMA 3AO4A 2GV9A 1ZBUA 4B9TA 1RFQA 4A57A 3MN7A 4IDHA 3HXMA 2P5GA 1QQOA 1NGJA 1L3TA 4B3TK 1RILA 2GEMA 5AQTA 3UKUA 4CJPA 4NXNK 2F8SA 4F4KA 2OA8A 3ATUA 3QIOA 5M1OA 1ZXOA 4BGBA 4DR3K 3KHYA 2G8FA 4IWVA 3EE9A 3QEIA 4BRIA 2ZQBA 5KGWA 1N5YA 2FBXA 3VEZA 5SZTA 4FJKA 3NH0A 3TAFA 3GG4A 1NNEA 4CJQA 1WN7A 2P9SA 4BC4A 1RTHA 3OYDA 1NJIO 5AQRA 4CEFA 4J2AA 4DR4K 3CJ1A 3HI0A 1HKGA 4M3RA 4JAXA 5GAHP 4DTRA 3D2EA 3AA2A 3HP6A 1JXBA 4DU4A 4Z4FA 3FZKA 3G10A 3KKRA 3ISNC 4KB0A 3M8RA 4FM0A 1P90A 1VSIA 2FXUA 4M45A 4FW1A 3CD6N 5AZJB 1SV5A 3WNEA 3TANA 4DQIA 4PUOA 4JYAK 1GLFO 4H0TB 3I8BA 3H46O 4F8RA 4H0XB 1BA1A 2HBJA 4NCAA 1NMDA 1D5AA 1W7AA 4GVEA 2HB5A 5HBMA 3DXKA 1MA9B 4J8FA 1WSEA 4KH5A 1SKWA 3SMPA 1BL3A 4KO0A 1XC9A 3MWPA 1HR0K 4LFBK 3TAPA 3VQQA 5JMVA 3L2UA 1KAXA 3OY9A 4KHNA 3LL3A 1FKPA 3AVJA 5AQMA 5KQDA 1RT3A 3LZJA 2RE2A 3ZLJA 4YOYA 4FYDA 4W5RA 2UUCK 2D0PA 3OYBA 4RW6A 4PQUA 3B6OA 4PHTX 2OZMA 4FWKA 3EY1A 4PKHA 3OJUA 3SQ1A 3E9LA 2CH6A 1SZ2A 2P9IB 4O5FA 1FKOA 4CHPA 1QHTA 3J7AP 3M5RA 1D8YA 3AVGA 3Q7CA 3AVLA 2IIRA 3I0SA 3TR8A 1NKBA 3RWUA 4YOUA 3I56N 5FPDA 3CI5A 3WXMB 3R1XA 4O0IA 1RBRA 3VQAA 4H5VA 4K8ZA 4F3OA 4CJ3A 1QQNA 2O8CA 1IKVA 2E6LA 4HUEA 3L4QA 3F73A 3VEWA 1T7PA 1I3AA 1LOTB 3TTFA 4B9LA 2O8FA 1Z05A 4OGCA 5ADXH 3NDKA 2Q1NA 3T1YK 1FXXA 3GL1A 1LAVA 1U04A 3L6QA 3SJHA 1VRTA 1SL1A 5C12A 1K9MO 4KHYA 3NF7A 4JI3K 1S6PA 4FJGA 3ENHA 4W5QA 5AQZA 3VQBA 1H1VA 2HNZA 4PL8A 5EY4A 4BQLA 3J80O 4DV2K 4B1ZA 2VWJA 4L8RB 3H1QA 1ITGA 5C24A 2R7YA 5C2FA 2A42A 3V1RA 2F4VK 4OPHA 3C7NB 3NAEA 4A5BA 1J9AA 2X6NA 1HNZK 1U2VB 3DAWA 3TTCA 5FROA 4BDYA 4FLVA 5IWAK 3SPYA 5E26A 1TL1A 3OBYA 3THXA 1SL0A 3CC7N 1S1VA 4CEAA 3MXMA 3FFIA 5EOYA 3CCMN 1K6YA 3KWGA 5M1QA 2HHHK 4EZ6A 1EWQA 3V9SA 2W6KA 1X9SA 5HOOA 2WTUA 3OYKA 2E1YA 5EX5A 4O8UA 2KW4A 1QSYA 3ATVA 4MDAA 4IG3A 1OH7A 4CD1A 3DRRA 3ZSQA 4FCYA 2YHAA 4FL9A 5AQNA 1BI4B 1YVNA 2IVNA 3AARA 5CYMA 3SK3A 1KFDA 4K41A 4CJEA 5LMNK 3QFPA 4HWIA 1IV0A 3PO4A 3O80A 4EZ9A 3RMCA 4FWQA 3KLIA 4B9QA 3FE1A 4B9SA 1Z6RA 3BY5A 2IDOA 3VERA 3C6AA 1JLCA 3AV9A 2X78A 2F7TA 4FJNA 3MECA 4KREA 3WQUA 4B1UB 1E4FT 3VPZA 4FPAA 3D0PA 4RCHA 1UAXA 4WFBL 3E1YA 5F2RA 3GE1A 2OCEA 4B08A 1NJWA 2O8EB 3O9QA 4YFUA 1LV5A 5F0XA 2VG7A 2OYQA 1I94K 1N32K 2I5JA 3A5LC 3HVTA 4FWPA 4DQQA 4I6MA 3WXKA 1SS6A 2RPIA 1HPMA 4IFEA 4IG0A 1U49A 1OH5A 4KBOA 4BDPA 2HBLA 3ZT1A 3SBGA 3QICA 1HJRA 1VSKA 4M3TA 1W0HA 1JXEA 3OW2M 2O8BA 4KH6A 3KK3A 3IMXA 2NRRA 4B8CA 2UXDK 3PSIA 2P9NB 2P5OA 2HVHA 1VSHA 2PZSA 4F9OA 1NOYA 1SQKA 3IKMA 1MWMA 1U48A 1KFSA 3DLLL 4LD0A 2HHUA 4DSIA 1V4SA 1JLGA 2YNFA 2W40A 2X74A 3NVMA 4Z4EA 4CJWA 2RKIA 4CGGA 5B8HA 4U7BA 3C65A 3AO5A 4RWTA 4IFYA 4M3WA 2P1JA 3QINA 3L2VA 4N47A 4AHUA 3AA3A 3O3GA 1VQ8N 2E2PA 1UA1A 1MU2A 2ZGYA 5KRSA 4NXMK 4O0JA 2HHSA 1IKYA 5J1EA 5AQKA 4KHPK 4CEEA 3L2WA 3VQPA 1IG8A 3SPZA 4FWSA 1T8EA 3SUPA 3SZ2A 2YV0X 3P5JA 5BR9A 4DV0K 5BN8A 4DU1A 2FSJA 3H45C 2YHWA 1OH8A 1A5WA 1BQNA 1N6QA 4WYBA 1J5EK 4HTLA 5C0YA 4JK9A 1JL2A 1VHXA 3PO5A 3RVCA 5HROA 1N34K 1KRPA 3GDQA 4YOWA 3ULEA 1K8KB 3KLEA 4UQGA 5AZJA 2QKBA 4E1NA 3WT0A 2P51A 2B5JA 2NUBA 2WFBA 4BRLA 1ASVA 3HVRA 3CFOA 3SUOA 1BCMA 4FVMA 4H5TA 2G8VA 4BVOA 3ID6A 4BY9C 2GUPA 3DMJA 3O4QA 2V7ZA 1GLDG 5JVGL 1EWRA 3VQEA 3AO3A 4OJRA 4E7KA 2WC9A 1VQ4N 5AQVA 5BR8K 4YORA 3FGUA 2X6SA 5JLHA 1LCUA 1GOAA 3CF5L 1S22A 4FO0A 3P39A 3QBXA 3IUCA 3OYJA 1BISA 3FZHA 1J5OA 4FJXA 3TSQA 1WAJA 3PV8A 1VQLN 2QWMA 2VGNA 3HL8A 4JI7K 4OLBA 4DF8A 2QTDA 4FOEA 3RR8A 3LWLA 1Q81O 2HMIA 1X9MA 4M3UA 2Q3SA 4LSNA 5AR0A 5CYQA 3LWMA 3LM2A 1NKEA 1GOCA 3CCEN 4C8KA 4BC3A 4M3YA 3OJSA 1YHQN 3ZX3A 2KZZA 3TI0A 1D4XA 3D2FB 2QWNA 2XY5A 3VN5A 4DKWA 4CZEA 3F9MA 3LDOA 1Q82O 1TK8A 3CIPA 3V9WA 4G9ZA 1JLFA 3OYAA 4IO9L 1WSFA 1NMNA 1EKEA 3T69A 3ASMA 3J81O 1KQSM 4B9MA 5AJ3K 2ZGZA 1N36K 4MQ3A 3NCIA 2DTUA 3CJCA 4JEPA 4DQ8A 5ADXA 2FBTA 1WSIA 2HHVA 3QEXA 3G4SN 2GX9A 3HSTB 3O8MA 4JN4A 2QA4N 4LH5A 1FJGK 2FC0A 3NHGA 2KLAA 4OKKA 3WXLA 4ID5A 3MXJA 5FPNA 4CW7B 4FJMA 1S3XA 4Z94A 5E41A 4M42A 2XY8A 3C7NA 3G25A 4ID1A 1RDDA 1QS4A 1BUPA 3L2RA 1VK0A 3PY8A 3AGKA 4A2BA 5J2NA 4MO5A 1B9DA 3KK7A 3MEDA 2FLOA 4CZGA 2IVPA 1OVQA 4EP4A 3VESA 3VTIA 4CJUA 1D9DA 3AY9A 4H0YB 2A5XA 3MEEA 3NGYA 3QNNA 3VQ9A 1A5VA 2FSNA 2LSNA 2E5LK 1EETA 3OYEA 4B3OA 4WFNL 4JK8A 4CJRA 3KKSA 2Q0UA 2JWLA 2A6AA 1XHZA 3O6WA 3U4LA 4BR4A 4CIFA 2HBKA 3RTVA 4J2DA 5H1SQ 4B9UA 1BI4A 3T7ZA 3V6DA 1TVRA 3QFUA 4ILJA 5AZIB 5FLXO 4DUYK 4BRGA 4FW2A 2NRVA 1CLQA 3RMBA 4KPYA 2BGGA 1O13A 5K14A 4CZHA 4JKGB 1YI2N 1D9FA 3BF3A 2D5RA 3B6PA 2Q0RA 3ZETA 1HYSA 4ISEA 3S41A 5KI6A 3C6HA 3S9HA 3OA9A 4FWRA 1XHXA 2OPPA 1S9EA 4NO7A 4IXCA 1NGGA 2XRIA 5JS2A 3SQ4A 4X65K 1L3VA 1WOQA 4BDZA 1VSMA 4CEQA 2OTJN 5KRTA 2O8EA 1XC3A 4XH5A 3U3YA 4HHTA 4GKKK 4CHNA 3ZEUB 2E2NA 2KFZA 4FK2A 1QSLA 4PWDA 5CZ2A 1WLJA 4JRPA 2ATQA 1RNHA 3HO1A 4XIUA 3S3NA 2F9WA 2EWSA 3AGRA 4GV9A 4F2RA 3CMAN 2GTDA 4J2BA 3JXUA 1YAGA 3I33A 5J2QA 4MO4A 4Z4CA 3LAKA 4WQ5C 4YNQA 4BGAA 1T3VA 4H5WA 1GOBA 3LDLA 1NJXA 5M1PA 4CGFA 2QEXN 1QQMA 2O4IA 3EEQA 3QIPA 3MDQA 3KZBA 4JS5A 3V9ZA 4K25A 3O08A 3O1BA 4B1WB 3CCUN 3VGMA 4WFAL 5GIPA 3S3MA 3HOTA 1QZ5A 4PA1A 1Q9XA 2QK9A 3OS0A 2HHTA
chains in the Genus database with same CATH topology
1UA0A 1K6YA 1S1TA 2YKMA 3ZSVA 4ZHRA 2YNIA 4DF4A 4EZ6A 2FBVA 3CFPA 4E7JA 3V9SA 4JS4A 4CERA 1RBVA 4CGIA 2BE2A 3VQ6A 1X9SA 2IGIA 3DOKA 3ZT0A 4CESA 3NF8A 3JYTA 1NK6A 4KTQA 4FJIA 3K2PA 3OYKA 1TKTA 4FLWA 3KK2A 4GW6A 1RDBA 1BGXT 3OYHA 4OKEA 3U6FA 2KW4A 3MXIA 1ZYQA 4AHSA 1QSYA 3AVKA 4DFKA 1QTMA 3KK1A 3A2FA 4ELTA 1VSDA 3OYMA 1QQCA 3DM2A 4IG3A 3LDSA 1VSLA 3ITHA 4CF1A 1RT7A 4C8NA 3ULDA 3H08A 1VRUA 1JLAA 2E4LA 1Y97A 3DRRA 4FJ7A 2Z1JA 3LZIA 3ZSQA 4FCYA 2YHAA 1C1BA 4F2SA 1BI4B 1YTAA 3LANA 1DTTA 3QLHA 1HMVA 1A5XA 1S9GA 3AVNA 5CYMA 3PX0A 1NJYA 3BDPA 4DFJA 1KFDA 1C6VA 2VG5A 3HYFA 4CJEA 4NCBA 1Z26A 3PO4A 4AHRA 4EZ9A 4AH9A 2OPRA 3CYMA 3RMCA 1NJZA 3KLIA 3L3UA 4CJTA 3HM9A 3RRHA 3SV4A 4DTMA 4B9SA 3DLKA 2IDOA 2Z1IA 2F96A 1TKZA 2HW3A 1KSPA 1JLCA 1CXQA 1B9FA 3T3FA 3SQ2A 1RTJA 3QEVA 4W5NA 3AV9A 2X78A 3THVA 4I9QA 4FJNA 3KLGA 3MECA 3OYCA 1TL3A 3TABA 1TKDA 1JLEA 4KREA 1JLQA 2Y1IA 4DTOA 3C6UA 4OGEA 2JLEA 1EP4A 1T7PA 5J2MA 4KHSA 3D0PA 4CCHA 2AJQA 4CF0A 4DSEA 3SUQA 4K8XA 1DTQA 1UAXA 2VWKA 4HUGA 1SL2A 4WE1A 2KZMA 4CK1A 3IS9A 4RW8A 2XO7A 3OYGA 4CFBA 1RBUA 4B08A 4E89A 3M8SA 1XWLA 4E7LA 4DFMA 2Y1JA 1NJWA 3RR7A 4B8AB 1J53A 4YFUA 1S1XA 1KVBA 1BCOA 1LV5A 3QESA 1WSHA 2HNDA 1Q9YA 2VG7A 2OYQA 3OYLA 1WNSA 1U4BA 1LAWA 4Y1DA 4KTZA 2I5JA 2D0AA 1L3UA 4DTSA 3HVTA 4DQQA 3C6TA 4O44A 1VSEA 1EXQA 1TAQA 4CK2A 3NGZA 1REVA 2RPIA 4CJ4A 1S5JA 1U49A 4IG0A 4NYFA 1JLBA 3VQCA 3EZ5A 4BDPA 1LW2A 2XHBA 4LSLA 3ZT1A 3SYZA 4FLTA 4CJFA 4DFPA 4E0DA 4ELUA 1HJRA 1VSKA 4DQSA 4Z4HA 1W0HA 4KI4A 1RBTA 4DSFA 4M3TA 4IFVA 4CIGA 1IH7A 3AVHA 4GMJB 1JXEA 1WSJA 3G0ZA 3DLGA 2EHGA 1CZ9A 3WNHA 3KK3A 3CG7A 1KLNA 4Z4IA 1NK4A 3OYNA 4B8CA 1NK8A 2YNHA 4BE2A 3PX4A 1HNVA 1EX4A 1HYZA 4LH4A 4E7HA 4CGJA 2P5OA 3LP1A 3VQ5A 1VSJA 4CF2A 4DTNA 1HYVA 2HVHA 1VSHA 4O55A 3LP3A 3MEGA 3OS0A 1B92A 3U3GA 1SKSA 4OLAA 2PZSA 2IOCA 2YKNA 1HQUA 1NOYA 2WOMA 4FXDA 1IG9A 4FJJA 4JLHA 1XI1A 3SCXA 3VQ8A 1YTUA 1U48A 1KFSA 2ITGA 1RT1A 4CECA 4B9VA 3DOLA 1HQEA 4LD0A 4DSIA 2HHUA 1JLGA 1Z25A 2YNFA 4E1MA 3VQ7A 4JRQA 3HT3A 1NK5A 4DSKA 4AHCA 4OPKA 4ZTJA 4CHQA 3O3FA 1BHLA 2X74A 4FZXC 3HPGA 1X1PA 4Z4EA 4CJWA 2RKIA 4CGGA 4KRFA 3P1GA 3AA5X 4RG8A 4DTUA 4KV8A 2O4GA 2OPQA 3AO5A 1LWEA 3JSMA 4IBNA 4C8OA 4IFYA 4M3WA 3AVFA 1C1CA 2HVIA 1BQMA 1HNIA 1I39A 2P1JA 3QINA 3L2VA 4BWJA 3V1OA 3HJFA 4FLXA 4N47A 4AHUA 3AA3A 5HRRA 3O3GA 1SUQA 3RRGA 4DWIA 1UA1A 4EP5A 3TARA 1ASWA 1MU2A 4H8KA 4OVLA 5KRSA 3OVNA 4O0JA 5SWMA 2HHWA 3ZSWA 3LAMA 4CJLA 4I2QA 2HHSA 4KAZA 1IKYA 5J1EA 2IC3A 1W9HA 5CY4A 4CJVA 5C42A 4FLUA 3NGIA 3HPHA 4N5SA 3DLHA 3KD1E 4CEEA 3L2WA 5JS1A 3VQPA 1Q8IA 4W5TA 1KCFA 4M41A 1RT4A 1RTDA 3SPZA 3P83D 1T8EA 3VA0A 4CHOA 3SUPA 2Z1GA 3IG1A 2PYJA 3SZ2A 1L3SA 2YV0X 3P5JA 1NK9A 3QNOA 4G1QA 3T19A 5J2PA 4DU1A 4FJHA 4Z4GA 4CHYA 1BIUA 3NE6A 2EX3A 2W42A 4KFBA 3CFRA 1QSSA 3UIQA 1TK0A 1A5WA 1BQNA 1N6QA 4C8LA 1O1WA 2DY4A 1JL2A 1RTIA 3PO5A 5HROA 1NK0A 3QERA 1KRPA 4Z0UA 1NOZA 2A1RA 5C25A 2D0BA 3KLEA 1X9WA 2YNGA 4UQGA 4H4MA 3SUNA 3DLBA 2QKBA 3V4IA 2HHXA 4E1NA 1J54A 1ZBFA 2P51A 3M8PA 2B5JA 1FK9A 2NUBA 4AHVA 4ZTFA 4BE1A 4RW4A 1G15A 3ZT4A 1ASVA 3HVRA 3C95A 3CFOA 3DRSA 4CEBA 1IO2A 3SUOA 4FLZA 1ZBHA 1BCMA 3ALYA 1QE1A 2FBYA 4FVMA 5DMRA 4CF9A 2G8VA 3WNGA 3C94A 3DMJA 3O4QA 4FM1A 4TSXA 4HVJA 1DLOA 2G8IA 3VQEA 3V81A 3QETA 2IS3A 3AO3A 4OJRA 3V1QA 4E7KA 3SNNA 1T05A 4I9LA 4PY5A 3CM5A 4HTUA 4MFBA 1S6QA 3QEWA 2KQ2A 2X6SA 1HPZA 1UOCA 4KHUA 4Y1CA 4BE0A 4R5PA 4M3XA 1BIZA 1GOAA 1C0TA 4CJSA 3K5MA 1KTQA 1IKXA 4OKJA 3ZT2A 4RW9A 4QOZB 1YT3A 3TAGA 2ZD1A 2IAJA 3OYJA 1BISA 3L3VA 3ZSZA 1JL1A 1RT6A 1J5OA 4FJXA 1WAJA 4CK3A 3PV8A 1NKCA 3TWHA 3HL8A 4N76A 3AVIA 4DF8A 4OLBA 2F8TA 4FJLA 1S1WA 4AILC 3RR8A 3LWLA 1S1UA 4O5BA 4FJ9A 2Z1HA 4I2PA 4KKOA 4E7IA 2HMIA 3QEPA 4C8MA 1X9MA 4M3UA 5DK5A 3KTQA 4DQPA 3VQDA 5HP1A 2Q3SA 4LSNA 2DFFA 4DQRA 4B9NA 1C0UA 3HPOA 2ZE2A 4CGDA 4N41A 2B4JA 5CYQA 3SQ0A 3LWMA 1NKEA 3PX6A 1GOCA 1RDCA 4LY7A 4C8KA 2WONA 4M3YA 3OJSA 2QKKA 4DTXA 2BDPA 2KZZA 4DTJA 2GUIA 4QCLA 3QO9A 3TI0A 3O3HA 3IRXA 3VQ4A 3RMDA 1TV6A 4W5OA 3AVMA 3AO4A 2GV9A 4CFCA 1ZBUA 5HRNA 2XY5A 4DLGA 3E01A 3HP9A 3VN5A 2B6AA 3ZCMA 3SJJA 3KLFA 1U47A 4FJ5A 3HXMA 4HUFA 2P5GA 1TK8A 1L3TA 3V9WA 1C1AA 4AHTA 1JKHA 1JLFA 4CJ5A 3OYAA 1WSFA 1RILA 3VA3A 1EKEA 3ASMA 4CJPA 4CHZA 4B9MA 2G8HA 2F8SA 4F4KA 2OA8A 3QIOA 4MQ3A 4E19A 3NCIA 2DTUA 1KLMA 1ASUA 2RN2A 2G8FA 2FBTA 1LWFA 3S3OA 1WSIA 3TAEA 4BWMA 2HHVA 3NH2A 4FK4A 3QEIA 3AVBA 2ZQBA 5KGWA 1N5YA 2FBXA 3QEXA 1WAFA 5SZTA 2XY7A 4FJKA 3HSTB 4CIEA 4BACA 3NH0A 3TAFA 3HK2A 4CJQA 4HCCA 1WN7A 4LH5A 5FDLA 1T03A 3OYDA 1RTHA 1KVCA 1RT2A 2FC0A 3NHGA 4OKKA 4CEFA 4J2AA 1UWBA 4DS5A 4ID5A 3KJVA 3MXJA 4FJMA 4M3RA 3V9UA 5E41A 4DTRA 4M42A 2XY8A 2HHQA 3AA2A 3HP6A 3TAQA 1JXBA 4DU4A 4H4OA 4ID1A 4DU3A 4Z4FA 3EYZA 4FM2A 3G10A 1RDDA 1QS4A 3ISNC 3KKRA 4CF8A 3L2RA 4DLEA 1VK0A 3M8RA 4FM0A 3PY8A 4KB0A 3LPTA 2D0CA 5J2NA 1VSIA 1B9DA 5HRSA 2A1SA 3M8QA 5EU7A 3V9XA 3K58A 3MEDA 4M45A 4FW1A 4EP4A 1TK5A 3TANA 1SV5A 3WNEA 4CJUA 1U45A 1D9DA 3AVCA 4DQIA 4PUOA 2BANA 3I0RA 3L8BA 1CZBA 4DTPA 4F8RA 4GVMA 4RW7A 3AA4A 3ZSXA 3MEEA 3NGYA 3QNNA 3SI6A 3VQ9A 3NBPA 1A5VA 4NCAA 3IAYA 2LSNA 1EETA 3OYEA 1D5AA 2PYLA 3RMAA 3I8DA 4B3OA 2HB5A 5HBMA 3CM6A 2KTQA 4CJRA 1ZBLA 4ICLA 3KKSA 1WSEA 4HCBA 1SKWA 2G8UA 4QAGA 1XHZA 1BL3A 4KB1A 4KO0A 1XC9A 1F21A 3DLRA 3KIOA 4CIFA 3VQQA 1IKWA 3WNFA 2GBZA 3RTVA 3OYFA 3L2UA 3TAPA 3K57A 4J2DA 3OY9A 4B9UA 3ZT3A 4KHNA 1BI4A 1YVUA 2JGUA 3V6DA 4DMNA 5D3GA 5KTQA 2PY5A 1TVRA 1FKPA 1RDAA 4FZZA 3AVJA 4CJKA 1RT3A 4I7FA 3K5NA 4FW2A 3DYAA 4KHWA 3LZJA 1CLQA 3NF9A 4CE9A 3RMBA 4KPYA 3DI6A 1RT5A 4FYDA 4W5RA 4IKFA 2BGGA 3NFAA 1RBSA 5K14A 3OYBA 4RW6A 4PQUA 3MAQA 3B6OA 3CQ8A 1D9FA 2OZMA 4J2EA 1HYSA 2D5RA 3B6PA 3EY1A 1WSGA 3OJUA 3SQ1A 3LP0A 4OPJA 5KI6A 4FK0A 3S9HA 4FJ8A 4KI6A 1XHXA 2OPPA 1HRHA 3LALA 1FKOA 1S9EA 4CHPA 4CFDA 3KD5E 1QHTA 4KTWA 4NYNA 2YHBA 1D8YA 2XRIA 1TAUA 5JS2A 1VSFA 3ZSYA 3SQ4A 3AVGA 1L3VA 3AVLA 3I0SA 3TR8A 4BDZA 4CGHA 1VSMA 3F9KA 5KGXA 2DFHA 4CEQA 1NKBA 3RWUA 4KHQA 4F3TA 5KRTA 1C0MA 3ZSOA 4IDKA 3U3YA 1TGOA 4O0IA 4HHTA 2QXFA 1RBRA 4CEOA 3VQAA 3K5LA 4K8ZA 4CHNA 3OYIA 4F3OA 3NF6A 2KFZA 4FZYA 4CJ3A 3NH1A 4FLYA 1IKVA 2E6LA 4CFAA 4HUEA 5HLFA 3F73A 4FK2A 3BGRA 1QSLA 4PWDA 5CZ2A 1WLJA 4O4GA 1TKXA 2ATQA 4JRPA 5I42A 1I3AA 1RNHA 1L5UA 4B9LA 3T1AA 3HO1A 4XIUA 4CEDA 1RCHA 2VG6A 3S3NA 3D45A 5HRPA 4OGCA 2RF2A 3NDKA 2OZSA 2DFEA 5T7BA 4DS4A 4F2RA 3OS2A 1NK7A 4J2BA 1FXXA 2G8KA 2G8WA 1LAVA 4Q5VA 5J2QA 1KVAA 1U04A 3K59A 2E6MA 4Z4CA 3LAKA 1VRTA 4NCGA 3TAMA 1SL1A 4YNQA 3KLHA 3DRPA 5FRNA 3SV3A 4KHYA 3NF7A 4Q0BA 1LWCA 4ELVA 4M3ZA 3LP2A 2OPSA 3AVAA 1S6PA 3DLEA 4FJGA 3ZSRA 1GOBA 1LW0A 4W5QA 4B9TA 3K5OA 4CEZA 5I3UA 3VQBA 1NJXA 4CGFA 4E3SA 2HNYA 1ZBIA 3AO1A 2O4IA 4DG1A 2HNZA 3AO2A 2KFNA 3QIPA 4JS5A 3V9ZA 2XY6A 2VWJA 4L8RB 3OS1A 1R0AA 1ITGA 5C24A 2R7YA 3V1RA 3PUFA 4N56A 1CXUA 3NAEA 2ETJA 1SKRA 1J9AA 3O4NA 2X6NA 3S3MA 5FRMA 3LPUA 5FROA 4BDYA 4FLVA 4PA1A 1Q9XA 5CZ1A 3SPYA 3L2QA 1SL0A 1TL1A 1S1VA 4CEAA 4DSLA 4DSJA 2QK9A 3MXMA 3FFIA 2HHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UA0 A;  1K6Y A;  1S1T A;  2YKM A;  3ZSV A;  4ZHR A;  2YNI A;  4DF4 A;  4EZ6 A;  2FBV A;  3CFP A;  4E7J A;  3V9S A;  4JS4 A;  4CER A;  1RBV A;  4CGI A;  2BE2 A;  3VQ6 A;  1X9S A;  2IGI A;  3DOK A;  3ZT0 A;  4CES A;  3NF8 A;  3JYT A;  1NK6 A;  4KTQ A;  4FJI A;  3K2P A;  3OYK A;  1TKT A;  4FLW A;  3KK2 A;  4GW6 A;  1RDB A;  1BGX T;  3OYH A;  4OKE A;  3U6F A;  2KW4 A;  3MXI A;  1ZYQ A;  4AHS A;  1QSY A;  3AVK A;  4DFK A;  1QTM A;  3KK1 A;  3A2F A;  4ELT A;  1VSD A;  3OYM A;  1QQC A;  3DM2 A;  4IG3 A;  3LDS A;  1VSL A;  3ITH A;  4CF1 A;  1RT7 A;  4C8N A;  3ULD A;  3H08 A;  1VRU A;  1JLA A;  2E4L A;  1Y97 A;  3DRR A;  4FJ7 A;  2Z1J A;  3LZI A;  3ZSQ A;  4FCY A;  2YHA A;  1C1B A;  4F2S A;  1BI4 B;  1YTA A;  3LAN A;  1DTT A;  3QLH A;  1HMV A;  1A5X A;  1S9G A;  3AVN A;  5CYM A;  3PX0 A;  1NJY A;  3BDP A;  4DFJ A;  1KFD A;  1C6V A;  2VG5 A;  3HYF A;  4CJE A;  4NCB A;  1Z26 A;  3PO4 A;  4AHR A;  4EZ9 A;  4AH9 A;  2OPR A;  3CYM A;  3RMC A;  1NJZ A;  3KLI A;  3L3U A;  4CJT A;  3HM9 A;  3RRH A;  3SV4 A;  4DTM A;  4B9S A;  3DLK A;  2IDO A;  2Z1I A;  2F96 A;  1TKZ A;  2HW3 A;  1KSP A;  1JLC A;  1CXQ A;  1B9F A;  3T3F A;  3SQ2 A;  1RTJ A;  3QEV A;  4W5N A;  3AV9 A;  2X78 A;  3THV A;  4I9Q A;  4FJN A;  3KLG A;  3MEC A;  3OYC A;  1TL3 A;  3TAB A;  1TKD A;  1JLE A;  4KRE A;  1JLQ A;  2Y1I A;  4DTO A;  3C6U A;  4OGE A;  2JLE A;  1EP4 A;  1T7P A;  5J2M A;  4KHS A;  3D0P A;  4CCH A;  2AJQ A;  4CF0 A;  4DSE A;  3SUQ A;  4K8X A;  1DTQ A;  1UAX A;  2VWK A;  4HUG A;  1SL2 A;  4WE1 A;  2KZM A;  4CK1 A;  3IS9 A;  4RW8 A;  2XO7 A;  3OYG A;  4CFB A;  1RBU A;  4B08 A;  4E89 A;  3M8S A;  1XWL A;  4E7L A;  4DFM A;  2Y1J A;  1NJW A;  3RR7 A;  4B8A B;  1J53 A;  4YFU A;  1S1X A;  1KVB A;  1BCO A;  1LV5 A;  3QES A;  1WSH A;  2HND A;  1Q9Y A;  2VG7 A;  2OYQ A;  3OYL A;  1WNS A;  1U4B A;  1LAW A;  4Y1D A;  4KTZ A;  2I5J A;  2D0A A;  1L3U A;  4DTS A;  3HVT A;  4DQQ A;  3C6T A;  4O44 A;  1VSE A;  1EXQ A;  1TAQ A;  4CK2 A;  3NGZ A;  1REV A;  2RPI A;  4CJ4 A;  1S5J A;  1U49 A;  4IG0 A;  4NYF A;  1JLB A;  3VQC A;  3EZ5 A;  4BDP A;  1LW2 A;  2XHB A;  4LSL A;  3ZT1 A;  3SYZ A;  4FLT A;  4CJF A;  4DFP A;  4E0D A;  4ELU A;  1HJR A;  1VSK A;  4DQS A;  4Z4H A;  1W0H A;  4KI4 A;  1RBT A;  4DSF A;  4M3T A;  4IFV A;  4CIG A;  1IH7 A;  3AVH A;  4GMJ B;  1JXE A;  1WSJ A;  3G0Z A;  3DLG A;  2EHG A;  1CZ9 A;  3WNH A;  3KK3 A;  3CG7 A;  1KLN A;  4Z4I A;  1NK4 A;  3OYN A;  4B8C A;  1NK8 A;  2YNH A;  4BE2 A;  3PX4 A;  1HNV A;  1EX4 A;  1HYZ A;  4LH4 A;  4E7H A;  4CGJ A;  2P5O A;  3LP1 A;  3VQ5 A;  1VSJ A;  4CF2 A;  4DTN A;  1HYV A;  2HVH A;  1VSH A;  4O55 A;  3LP3 A;  3MEG A;  3OS0 A;  1B92 A;  3U3G A;  1SKS A;  4OLA A;  2PZS A;  2IOC A;  2YKN A;  1HQU A;  1NOY A;  2WOM A;  4FXD A;  1IG9 A;  4FJJ A;  4JLH A;  1XI1 A;  3SCX A;  3VQ8 A;  1YTU A;  1U48 A;  1KFS A;  2ITG A;  1RT1 A;  4CEC A;  4B9V A;  3DOL A;  1HQE A;  4LD0 A;  4DSI A;  2HHU A;  1JLG A;  1Z25 A;  2YNF A;  4E1M A;  3VQ7 A;  4JRQ A;  3HT3 A;  1NK5 A;  4DSK A;  4AHC A;  4OPK A;  4ZTJ A;  4CHQ A;  3O3F A;  1BHL A;  2X74 A;  4FZX C;  3HPG A;  1X1P A;  4Z4E A;  4CJW A;  2RKI A;  4CGG A;  4KRF A;  3P1G A;  3AA5 X;  4RG8 A;  4DTU A;  4KV8 A;  2O4G A;  2OPQ A;  3AO5 A;  1LWE A;  3JSM A;  4IBN A;  4C8O A;  4IFY A;  4M3W A;  3AVF A;  1C1C A;  2HVI A;  1BQM A;  1HNI A;  1I39 A;  2P1J A;  3QIN A;  3L2V A;  4BWJ A;  3V1O A;  3HJF A;  4FLX A;  4N47 A;  4AHU A;  3AA3 A;  5HRR A;  3O3G A;  1SUQ A;  3RRG A;  4DWI A;  1UA1 A;  4EP5 A;  3TAR A;  1ASW A;  1MU2 A;  4H8K A;  4OVL A;  5KRS A;  3OVN A;  4O0J A;  5SWM A;  2HHW A;  3ZSW A;  3LAM A;  4CJL A;  4I2Q A;  2HHS A;  4KAZ A;  1IKY A;  5J1E A;  2IC3 A;  1W9H A;  5CY4 A;  4CJV A;  5C42 A;  4FLU A;  3NGI A;  3HPH A;  4N5S A;  3DLH A;  3KD1 E;  4CEE A;  3L2W A;  5JS1 A;  3VQP A;  1Q8I A;  4W5T A;  1KCF A;  4M41 A;  1RT4 A;  1RTD A;  3SPZ A;  3P83 D;  1T8E A;  3VA0 A;  4CHO A;  3SUP A;  2Z1G A;  3IG1 A;  2PYJ A;  3SZ2 A;  1L3S A;  2YV0 X;  3P5J A;  1NK9 A;  3QNO A;  4G1Q A;  3T19 A;  5J2P A;  4DU1 A;  4FJH A;  4Z4G A;  4CHY A;  1BIU A;  3NE6 A;  2EX3 A;  2W42 A;  4KFB A;  3CFR A;  1QSS A;  3UIQ A;  1TK0 A;  1A5W A;  1BQN A;  1N6Q A;  4C8L A;  1O1W A;  2DY4 A;  1JL2 A;  1RTI A;  3PO5 A;  5HRO A;  1NK0 A;  3QER A;  1KRP A;  4Z0U A;  1NOZ A;  2A1R A;  5C25 A;  2D0B A;  3KLE A;  1X9W A;  2YNG A;  4UQG A;  4H4M A;  3SUN A;  3DLB A;  2QKB A;  3V4I A;  2HHX A;  4E1N A;  1J54 A;  1ZBF A;  2P51 A;  3M8P A;  2B5J A;  1FK9 A;  2NUB A;  4AHV A;  4ZTF A;  4BE1 A;  4RW4 A;  1G15 A;  3ZT4 A;  1ASV A;  3HVR A;  3C95 A;  3CFO A;  3DRS A;  4CEB A;  1IO2 A;  3SUO A;  4FLZ A;  1ZBH A;  1BCM A;  3ALY A;  1QE1 A;  2FBY A;  4FVM A;  5DMR A;  4CF9 A;  2G8V A;  3WNG A;  3C94 A;  3DMJ A;  3O4Q A;  4FM1 A;  4TSX A;  4HVJ A;  1DLO A;  2G8I A;  3VQE A;  3V81 A;  3QET A;  2IS3 A;  3AO3 A;  4OJR A;  3V1Q A;  4E7K A;  3SNN A;  1T05 A;  4I9L A;  4PY5 A;  3CM5 A;  4HTU A;  4MFB A;  1S6Q A;  3QEW A;  2KQ2 A;  2X6S A;  1HPZ A;  1UOC A;  4KHU A;  4Y1C A;  4BE0 A;  4R5P A;  4M3X A;  1BIZ A;  1GOA A;  1C0T A;  4CJS A;  3K5M A;  1KTQ A;  1IKX A;  4OKJ A;  3ZT2 A;  4RW9 A;  4QOZ B;  1YT3 A;  3TAG A;  2ZD1 A;  2IAJ A;  3OYJ A;  1BIS A;  3L3V A;  3ZSZ A;  1JL1 A;  1RT6 A;  1J5O A;  4FJX A;  1WAJ A;  4CK3 A;  3PV8 A;  1NKC A;  3TWH A;  3HL8 A;  4N76 A;  3AVI A;  4DF8 A;  4OLB A;  2F8T A;  4FJL A;  1S1W A;  4AIL C;  3RR8 A;  3LWL A;  1S1U A;  4O5B A;  4FJ9 A;  2Z1H A;  4I2P A;  4KKO A;  4E7I A;  2HMI A;  3QEP A;  4C8M A;  1X9M A;  4M3U A;  5DK5 A;  3KTQ A;  4DQP A;  3VQD A;  5HP1 A;  2Q3S A;  4LSN A;  2DFF A;  4DQR A;  4B9N A;  1C0U A;  3HPO A;  2ZE2 A;  4CGD A;  4N41 A;  2B4J A;  5CYQ A;  3SQ0 A;  3LWM A;  1NKE A;  3PX6 A;  1GOC A;  1RDC A;  4LY7 A;  4C8K A;  2WON A;  4M3Y A;  3OJS A;  2QKK A;  4DTX A;  2BDP A;  2KZZ A;  4DTJ A;  2GUI A;  4QCL A;  3QO9 A;  3TI0 A;  3O3H A;  3IRX A;  3VQ4 A;  3RMD A;  1TV6 A;  4W5O A;  3AVM A;  3AO4 A;  2GV9 A;  4CFC A;  1ZBU A;  5HRN A;  2XY5 A;  4DLG A;  3E01 A;  3HP9 A;  3VN5 A;  2B6A A;  3ZCM A;  3SJJ A;  3KLF A;  1U47 A;  4FJ5 A;  3HXM A;  4HUF A;  2P5G A;  1TK8 A;  1L3T A;  3V9W A;  1C1A A;  4AHT A;  1JKH A;  1JLF A;  4CJ5 A;  3OYA A;  1WSF A;  1RIL A;  3VA3 A;  1EKE A;  3ASM A;  4CJP A;  4CHZ A;  4B9M A;  2G8H A;  2F8S A;  4F4K A;  2OA8 A;  3QIO A;  4MQ3 A;  4E19 A;  3NCI A;  2DTU A;  1KLM A;  1ASU A;  2RN2 A;  2G8F A;  2FBT A;  1LWF A;  3S3O A;  1WSI A;  3TAE A;  4BWM A;  2HHV A;  3NH2 A;  4FK4 A;  3QEI A;  3AVB A;  2ZQB A;  5KGW A;  1N5Y A;  2FBX A;  3QEX A;  1WAF A;  5SZT A;  2XY7 A;  4FJK A;  3HST B;  4CIE A;  4BAC A;  3NH0 A;  3TAF A;  3HK2 A;  4CJQ A;  4HCC A;  1WN7 A;  4LH5 A;  5FDL A;  1T03 A;  3OYD A;  1RTH A;  1KVC A;  1RT2 A;  2FC0 A;  3NHG A;  4OKK A;  4CEF A;  4J2A A;  1UWB A;  4DS5 A;  4ID5 A;  3KJV A;  3MXJ A;  4FJM A;  4M3R A;  3V9U A;  5E41 A;  4DTR A;  4M42 A;  2XY8 A;  2HHQ A;  3AA2 A;  3HP6 A;  3TAQ A;  1JXB A;  4DU4 A;  4H4O A;  4ID1 A;  4DU3 A;  4Z4F A;  3EYZ A;  4FM2 A;  3G10 A;  1RDD A;  1QS4 A;  3ISN C;  3KKR A;  4CF8 A;  3L2R A;  4DLE A;  1VK0 A;  3M8R A;  4FM0 A;  3PY8 A;  4KB0 A;  3LPT A;  2D0C A;  5J2N A;  1VSI A;  1B9D A;  5HRS A;  2A1S A;  3M8Q A;  5EU7 A;  3V9X A;  3K58 A;  3MED A;  4M45 A;  4FW1 A;  4EP4 A;  1TK5 A;  3TAN A;  1SV5 A;  3WNE A;  4CJU A;  1U45 A;  1D9D A;  3AVC A;  4DQI A;  4PUO A;  2BAN A;  3I0R A;  3L8B A;  1CZB A;  4DTP A;  4F8R A;  4GVM A;  4RW7 A;  3AA4 A;  3ZSX A;  3MEE A;  3NGY A;  3QNN A;  3SI6 A;  3VQ9 A;  3NBP A;  1A5V A;  4NCA A;  3IAY A;  2LSN A;  1EET A;  3OYE A;  1D5A A;  2PYL A;  3RMA A;  3I8D A;  4B3O A;  2HB5 A;  5HBM A;  3CM6 A;  2KTQ A;  4CJR A;  1ZBL A;  4ICL A;  3KKS A;  1WSE A;  4HCB A;  1SKW A;  2G8U A;  4QAG A;  1XHZ A;  1BL3 A;  4KB1 A;  4KO0 A;  1XC9 A;  1F21 A;  3DLR A;  3KIO A;  4CIF A;  3VQQ A;  1IKW A;  3WNF A;  2GBZ A;  3RTV A;  3OYF A;  3L2U A;  3TAP A;  3K57 A;  4J2D A;  3OY9 A;  4B9U A;  3ZT3 A;  4KHN A;  1BI4 A;  1YVU A;  2JGU A;  3V6D A;  4DMN A;  5D3G A;  5KTQ A;  2PY5 A;  1TVR A;  1FKP A;  1RDA A;  4FZZ A;  3AVJ A;  4CJK A;  1RT3 A;  4I7F A;  3K5N A;  4FW2 A;  3DYA A;  4KHW A;  3LZJ A;  1CLQ A;  3NF9 A;  4CE9 A;  3RMB A;  4KPY A;  3DI6 A;  1RT5 A;  4FYD A;  4W5R A;  4IKF A;  2BGG A;  3NFA A;  1RBS A;  5K14 A;  3OYB A;  4RW6 A;  4PQU A;  3MAQ A;  3B6O A;  3CQ8 A;  1D9F A;  2OZM A;  4J2E A;  1HYS A;  2D5R A;  3B6P A;  3EY1 A;  1WSG A;  3OJU A;  3SQ1 A;  3LP0 A;  4OPJ A;  5KI6 A;  4FK0 A;  3S9H A;  4FJ8 A;  4KI6 A;  1XHX A;  2OPP A;  1HRH A;  3LAL A;  1FKO A;  1S9E A;  4CHP A;  4CFD A;  3KD5 E;  1QHT A;  4KTW A;  4NYN A;  2YHB A;  1D8Y A;  2XRI A;  1TAU A;  5JS2 A;  1VSF A;  3ZSY A;  3SQ4 A;  3AVG A;  1L3V A;  3AVL A;  3I0S A;  3TR8 A;  4BDZ A;  4CGH A;  1VSM A;  3F9K A;  5KGX A;  2DFH A;  4CEQ A;  1NKB A;  3RWU A;  4KHQ A;  4F3T A;  5KRT A;  1C0M A;  3ZSO A;  4IDK A;  3U3Y A;  1TGO A;  4O0I A;  4HHT A;  2QXF A;  1RBR A;  4CEO A;  3VQA A;  3K5L A;  4K8Z A;  4CHN A;  3OYI A;  4F3O A;  3NF6 A;  2KFZ A;  4FZY A;  4CJ3 A;  3NH1 A;  4FLY A;  1IKV A;  2E6L A;  4CFA A;  4HUE A;  5HLF A;  3F73 A;  4FK2 A;  3BGR A;  1QSL A;  4PWD A;  5CZ2 A;  1WLJ A;  4O4G A;  1TKX A;  2ATQ A;  4JRP A;  5I42 A;  1I3A A;  1RNH A;  1L5U A;  4B9L A;  3T1A A;  3HO1 A;  4XIU A;  4CED A;  1RCH A;  2VG6 A;  3S3N A;  3D45 A;  5HRP A;  4OGC A;  2RF2 A;  3NDK A;  2OZS A;  2DFE A;  5T7B A;  4DS4 A;  4F2R A;  3OS2 A;  1NK7 A;  4J2B A;  1FXX A;  2G8K A;  2G8W A;  1LAV A;  4Q5V A;  5J2Q A;  1KVA A;  1U04 A;  3K59 A;  2E6M A;  4Z4C A;  3LAK A;  1VRT A;  4NCG A;  3TAM A;  1SL1 A;  4YNQ A;  3KLH A;  3DRP A;  5FRN A;  3SV3 A;  4KHY A;  3NF7 A;  4Q0B A;  1LWC A;  4ELV A;  4M3Z A;  3LP2 A;  2OPS A;  3AVA A;  1S6P A;  3DLE A;  4FJG A;  3ZSR A;  1GOB A;  1LW0 A;  4W5Q A;  4B9T A;  3K5O A;  4CEZ A;  5I3U A;  3VQB A;  1NJX A;  4CGF A;  4E3S A;  2HNY A;  1ZBI A;  3AO1 A;  2O4I A;  4DG1 A;  2HNZ A;  3AO2 A;  2KFN A;  3QIP A;  4JS5 A;  3V9Z A;  2XY6 A;  2VWJ A;  4L8R B;  3OS1 A;  1R0A A;  1ITG A;  5C24 A;  2R7Y A;  3V1R A;  3PUF A;  4N56 A;  1CXU A;  3NAE A;  2ETJ A;  1SKR A;  1J9A A;  3O4N A;  2X6N A;  3S3M A;  5FRM A;  3LPU A;  5FRO A;  4BDY A;  4FLV A;  4PA1 A;  1Q9X A;  5CZ1 A;  3SPY A;  3L2Q A;  1SL0 A;  1TL1 A;  1S1V A;  4CEA A;  4DSL A;  4DSJ A;  2QK9 A;  3MXM A;  3FFI A;  2HHT A; 
#chains in the Genus database with same CATH topology
 2NZT A;  3CCS N;  2YKM A;  2YNI A;  2YHX A;  2FBV A;  3CFP A;  4LC9 B;  1SAZ A;  2IGI A;  3ZT0 A;  3A8Y A;  4KTQ A;  5AQW A;  3KK2 A;  3HBT A;  4XH4 A;  2GWK A;  3WXJ A;  4DFK A;  4ELT A;  3A2F A;  4DUZ K;  5FPM A;  3JS6 A;  4GV6 A;  3BF1 A;  3KVG A;  1VSL A;  3ITH A;  3QDK A;  3JAM O;  1RT7 A;  3KWI A;  1JLA A;  2E4L A;  3E9P A;  4FJ7 A;  4JKE A;  1XQS C;  1C1B A;  4MLH A;  3HM8 A;  1HMV A;  1A5X A;  1RDW X;  4EFH A;  1C6V A;  3HYF A;  3RSE B;  1Q7Y O;  2UXB K;  4JHD B;  3THY A;  2QI2 A;  4CZI A;  5BPL A;  4BRN A;  3M1F A;  3SV4 A;  4DTM A;  1TKZ A;  2HW3 A;  4DCH A;  3PSF A;  1CXQ A;  3SQ2 A;  1RTJ A;  4FWN A;  2E20 A;  4KH4 A;  1BWF O;  4I9Q A;  3KLG A;  3MMV A;  2NRH A;  3OBW A;  4IOC L;  1TKD A;  2ITM A;  1JLQ A;  3MX5 A;  4GY2 B;  3TSP A;  3C6U A;  4OGE A;  2OTL N;  1EQY A;  5J2M A;  3C0B A;  1XNR K;  2YHY A;  1DTQ A;  3U8X A;  4HUG A;  1SL2 A;  2XO7 A;  3M8S A;  3ZX2 A;  4E89 A;  4DFM A;  2Y1J A;  4E7L A;  1J53 A;  1KVB A;  4OX9 K;  2HND A;  4WQ5 A;  3OYL A;  1WNS A;  1L3U A;  4KTZ A;  5KQ8 A;  2P9P B;  4CK2 A;  1S5J A;  4NYF A;  3VQC A;  1JLB A;  3ZYY X;  3EZ5 A;  1LW2 A;  4DFP A;  4LSL A;  4FLT A;  4CJF A;  2JWK A;  4CVN E;  1NGB A;  1TYQ B;  4ELU A;  4FWO A;  1RBT A;  4DSF A;  4IFV A;  1IH7 A;  3AVH A;  3G0Z A;  5F1X A;  3DLG A;  1CZ9 A;  3WNH A;  5LY3 A;  4Z4I A;  1NK8 A;  4BRQ A;  4LH4 A;  1HYZ A;  4CGJ A;  5BRH A;  3LP1 A;  1VSJ A;  4CF2 A;  1HYV A;  3LP3 A;  3TTD A;  1B92 A;  4BRM A;  5BRE A;  5EVZ A;  3VEN A;  4DHY A;  2WOM A;  4FXD A;  5AQL A;  2OAN A;  2P9L B;  1WBD A;  1IG9 A;  5AQH A;  3HRG A;  3GBT A;  3VGK A;  2ITG A;  3CET A;  3DOL A;  5KPT A;  4E1M A;  3VQ7 A;  3D2F A;  1NK5 A;  3HT3 A;  3LDN A;  3HSC A;  4FZX C;  3O9T A;  4RG8 A;  3BUZ B;  4KV8 A;  3H3O B;  1VQ6 N;  5BPM A;  3O4W A;  3AVF A;  1XMQ K;  1C1C A;  2HVI A;  1BQM A;  1DT9 A;  3HJF A;  1DGK N;  1RDU A;  1NBW A;  1SUQ A;  3N4P A;  4JI1 K;  2HHW A;  4H0V B;  5AQQ A;  4CJL A;  4CZK A;  3AAQ A;  2IC3 A;  5CY4 A;  4B1X B;  5C42 A;  5AQG A;  4FLU A;  4CZF A;  4JKB A;  3NGI A;  5JIC A;  1Q8I A;  3UKR B;  5JLF A;  4YY3 K;  2I7N A;  2E1Z A;  2VYP A;  2PYJ A;  1NK9 A;  4G1Q A;  4FJH A;  4JI2 K;  3F5T A;  4CHY A;  3AAP A;  3NE6 A;  4KFB A;  4CBU A;  3CFR A;  1GLE G;  1NM1 A;  2UU9 K;  3CQY A;  3WEE A;  4M63 C;  1YJN N;  4BRP A;  3VEX A;  4Z0U A;  1X3N A;  5C25 A;  2D0B A;  1BU6 O;  2KKZ A;  1JCE A;  4H4M A;  4PL7 A;  3J8A A;  2HHX A;  2ASO A;  1YJW N;  1S72 N;  3LDP A;  3EZW A;  4BE1 A;  4RW4 A;  3ZT4 A;  5AQY A;  3DRS A;  1YIJ N;  4X66 K;  2Q97 A;  4FLZ A;  4CF9 A;  1W2B M;  4FM1 A;  4HVJ A;  2G8I A;  4XEI A;  1K8A O;  2IS3 A;  3V1Q A;  3SNN A;  4I9L A;  3M6G A;  4MFB A;  2KQ2 A;  3IFR A;  5AZI A;  4M3X A;  4CJS A;  3CXC M;  1IKX A;  1GLA G;  3FR0 A;  1QVF M;  4QOZ B;  3CER A;  4AM6 A;  3L3V A;  3ZSZ A;  2UYT A;  1JL1 A;  4JKG A;  2PAV A;  3THW A;  1NKC A;  4JI4 K;  4BG8 A;  3WQT A;  4QS7 A;  4QS8 A;  3QB0 A;  5GAE P;  1S1U A;  2AA4 A;  2O8D B;  4KKO A;  3QEP A;  4C8M A;  1HNX K;  1NGH A;  4NLB A;  4LF6 K;  4DQR A;  5AQF A;  4LF7 K;  2B4J A;  4AF1 A;  1IJJ A;  1RDC A;  4LY7 A;  1OH6 A;  2WON A;  3VGL A;  1GLJ O;  4DTJ A;  2GUI A;  4JKH A;  3O3H A;  2D0O A;  4LF4 K;  3VQ4 A;  4W5O A;  2ZJP L;  3E01 A;  3HP9 A;  3ZEU A;  2B6A A;  4DLG A;  1U47 A;  5AFU H;  3UKU B;  4JV5 K;  1VQ7 N;  4EHU A;  1JKH A;  1MDU B;  4CJ5 A;  3VA3 A;  2G8H A;  3FZL A;  1KAZ A;  4E19 A;  3CC2 N;  1ASU A;  1KLM A;  2RN2 A;  1LWF A;  1QZ6 A;  2P9S B;  3AVB A;  2XY7 A;  4CIE A;  4BAC A;  4DV6 K;  3MN5 A;  3HK2 A;  3SAG A;  4HCC A;  2CGJ A;  1NGD A;  3D2E B;  1KVC A;  1T6C A;  5CR4 A;  3KJV A;  1DEJ A;  1HNW K;  3TAQ A;  3DWL A;  4H5R A;  4DU3 A;  3EYZ A;  2NRT A;  3MN9 A;  4CF8 A;  3NVK A;  1T6D A;  1ATN A;  2D0C A;  5HRS A;  2A1S A;  3DJC A;  3M8Q A;  1WUA A;  3AVC A;  3I0R A;  1CZB A;  3FZM A;  4DTP A;  4YHH K;  4RW7 A;  2YJE A;  3AA4 A;  4DB3 A;  3IAY A;  3BP8 A;  3RMA A;  3I8D A;  2PYL A;  3MX2 A;  3CM6 A;  3O9U A;  2KTQ A;  4BRF A;  2HF4 A;  1ATR A;  1ZBL A;  4HCB A;  4FOI A;  4KB1 A;  3BEX A;  4JKF A;  3WNF A;  1IKW A;  2GBZ A;  3K57 A;  3R8E A;  3ZT3 A;  4PKI A;  3GOI A;  1YVU A;  2P9U B;  2PY5 A;  4CJK A;  2FF3 B;  3DI6 A;  4BG9 A;  4IKF A;  3E66 A;  1RBS A;  2GEL A;  3QML A;  2HST A;  4IOA L;  2HBM A;  4FJ8 A;  1KC8 O;  3LAL A;  1NG9 A;  4CFD A;  4KTW A;  4NYN A;  2P9I A;  2VCP A;  4YDU C;  3F9K A;  4ILG B;  5KGX A;  2DFH A;  3UE5 A;  4F3T A;  4GNI A;  4QS9 A;  1C0M A;  2O8C B;  1MWK A;  4IDK A;  5GAG P;  4CEO A;  3R3L A;  3K5L A;  3OYI A;  3NF6 A;  4FLY A;  3O9S A;  3BGR A;  3SAF A;  3VEY A;  1TKX A;  2IVO A;  3EE8 A;  1L5U A;  3T1A A;  1M1K O;  4CED A;  1RCH A;  2VG6 A;  4BQZ A;  5DM6 L;  2F9T A;  1TYQ A;  2OZS A;  2RF2 A;  5CHI A;  2DFE A;  4DS4 A;  5M1K A;  3OS2 A;  1NK7 A;  2G8W A;  1N33 K;  3SLC A;  5C15 A;  3ID8 A;  1KVA A;  3K59 A;  5LJW A;  4A62 A;  5LL6 Z;  4NCG A;  5M1N A;  4BRA A;  3KLH A;  5FRN A;  2VQE K;  4Q0B A;  4M3Z A;  2OPS A;  3DLE A;  5GIO A;  2WBN A;  3K5O A;  4CEZ A;  5KPZ A;  4JKD A;  1QHA A;  3CCQ N;  3CJB A;  4CBW A;  3AO1 A;  3N4Q A;  3AO2 A;  4ISF A;  4L3Q A;  1BG3 A;  3OS1 A;  1R0A A;  2HMP A;  4FWM A;  3THX B;  3VEO A;  3PUF A;  4X64 K;  4N56 A;  1CXU A;  2ETJ A;  1SKR A;  5FRM A;  1N8R O;  3CC4 N;  5CZ1 A;  3L2Q A;  2PBD A;  3IDH A;  4DSL A;  4DSJ A;  1IBM K;  1IBL K;  2YCH A;  4O5B A;  1U2V A;  4BC2 A;  1UA0 A;  3ZSV A;  4DF4 A;  4DR5 K;  4E7J A;  4JS4 A;  4CER A;  1ESV A;  1RBV A;  3VQ6 A;  3PIO L;  4CES A;  3NF8 A;  1J6Z A;  4FJI A;  3K2P A;  1OKJ A;  1TKT A;  4IEE A;  1RDB A;  1BGX T;  1ZYQ A;  3AVK A;  1VSD A;  3OYM A;  3DM2 A;  4JD2 B;  4CF1 A;  3ENO A;  3K9J A;  4C8N A;  3H08 A;  3ULD A;  1Y97 A;  4FWL A;  4CJ7 A;  2E88 A;  5GAD P;  1YTA A;  3LAN A;  3QLH A;  1KD1 O;  3PX0 A;  1NJY A;  3BDP A;  4DFJ A;  4NCB A;  2VG5 A;  3A5O C;  1Z26 A;  4AHR A;  1RGI A;  4AH9 A;  2QM1 A;  2OPR A;  3CYM A;  4YDU A;  1VQM N;  1NJZ A;  3L3U A;  3HM9 A;  5A2Q O;  2NRX A;  3VF6 A;  3DLK A;  3CCR N;  1KSP A;  4DV3 K;  1B9F A;  1E4G T;  4W5N A;  3QEV A;  1NGE A;  3CCJ N;  1JLE A;  4DTO A;  2JLE A;  1EP4 A;  1KAY A;  3LDQ A;  4KHS A;  4CF0 A;  1T44 A;  5EXW A;  2KZM A;  2VWK A;  4FVU A;  4WE1 A;  4CK1 A;  3IS9 A;  1RBU A;  1X3M A;  1XWL A;  3M3Z A;  2BH1 A;  1S1X A;  4I6M B;  2W6L A;  3QES A;  4K0K K;  3P4I A;  2D1K A;  1YJ9 N;  1U6Z A;  3C6T A;  1VAZ A;  3NGZ A;  3WXI A;  4CJ4 A;  2XHB A;  3SYZ A;  2V51 B;  3P31 A;  4DQS A;  4GMJ B;  1GLB G;  2EHG A;  3VTH A;  1KLN A;  2D4W A;  1NK4 A;  3OYN A;  4B1Y B;  3CCL N;  1Q18 A;  4C23 A;  1VQ9 N;  3QBW A;  1HNV A;  4E7H A;  4ISG A;  3VQ5 A;  3MEG A;  1SKS A;  4RTF D;  2IOC A;  2YKN A;  1HQU A;  4WF9 L;  1HLU A;  2P9N A;  4LF8 K;  2ZJQ L;  4FJJ A;  3SCX A;  3VQ8 A;  1RT1 A;  2BTF A;  1VQ5 N;  1HQE A;  1TUY A;  1W97 L;  4DSK A;  4OPK A;  3HPG A;  2UUB K;  3AA5 X;  5BRF A;  4DTU A;  2OPQ A;  3MCP A;  1LWE A;  4A61 A;  4C8O A;  3MK6 A;  4JI6 K;  3CPE A;  1HNI A;  1I39 A;  5AFU A;  4LFA K;  4BWJ A;  4IOX A;  1DKG D;  4MDB A;  4EP5 A;  1ASW A;  2VQF K;  4H8K A;  4OVL A;  1YXQ A;  3ZSW A;  2NNW A;  4I2Q A;  3VEV A;  4CZJ A;  4Y0W A;  2ASM A;  4CJV A;  5AQS A;  2KHO A;  4A2A A;  3KD1 E;  1KCF A;  1RT4 A;  3MN6 A;  3IG1 A;  1L3S A;  5J2P A;  2BUP A;  4Z4G A;  2V7Y A;  5HL7 L;  2EX3 A;  1TUU A;  3LM9 A;  1WB9 A;  1QSS A;  1HUX A;  3W0L A;  3ULE B;  1BOT O;  4C8L A;  5BN9 A;  1O1W A;  2DY4 A;  3DXM B;  1NK0 A;  2CH5 A;  3W3D A;  2A1R A;  3O1W A;  2YNG A;  3DLB A;  1J54 A;  1VQO N;  3M8P A;  4AHV A;  1K8K A;  2QXL A;  1G15 A;  3I55 N;  4CEB A;  3R6M A;  3ALY A;  2FBY A;  3WNG A;  5LMU K;  4TSX A;  1DLO A;  3QET A;  1T05 A;  1Y64 A;  3TPQ A;  4HTU A;  4DV7 K;  1P8Z A;  2Q36 A;  2P9U A;  1HPZ A;  1UOC A;  4KHU A;  4Y1C A;  4R5P A;  1BIZ A;  5ELZ A;  1KTQ A;  2QWR A;  2QW9 A;  4RW9 A;  2AP1 A;  4IO8 A;  3U9Z A;  2E2O A;  2QWO A;  3PIP L;  4YOT A;  4BRK A;  4CK3 A;  3TWH A;  1K73 O;  4N76 A;  4CBX A;  1S1W A;  1BO5 O;  2A3Z A;  4AIL C;  4R79 A;  4FJ9 A;  4BR0 A;  2Z1H A;  4I2P A;  4E7I A;  5HP1 A;  2RHK A;  3HPO A;  2ZE2 A;  4CGD A;  4M7Y A;  3SQ0 A;  1XUP O;  1YF5 L;  1BDG A;  3L4I A;  2UUA K;  2QKK A;  4DTX A;  4A59 A;  2BDP A;  4QCL A;  3QO9 A;  3SAH A;  2H3G X;  3RMD A;  1TV6 A;  3MWT A;  4GV3 A;  4CFC A;  5HRN A;  4ZTJ A;  3SJJ A;  4KHW A;  3CJ7 A;  3ZCM A;  3KLF A;  4MLE A;  3Q7B A;  4FJ5 A;  4HUF A;  4C1N I;  4WQ4 C;  1JCF A;  4BR5 A;  1C1A A;  4AHT A;  4K42 A;  3TU5 A;  4CHZ A;  4DR1 K;  2Q31 A;  3H3N O;  1JJ2 M;  2YI1 A;  3CQX A;  3UB5 A;  1NGF A;  3S3O A;  3TAE A;  4BWM A;  3NH2 A;  4FK4 A;  4ILH A;  1WAF A;  3EO3 A;  3HZ6 A;  1WBB A;  5FDL A;  1T03 A;  2A40 A;  1RT2 A;  3U9D A;  1UWB A;  4DS5 A;  3V9U A;  1V4T A;  2HHQ A;  4H4O A;  4FM2 A;  4NB4 A;  4DLE A;  3LPT A;  3V9X A;  5EU7 A;  5GIN A;  3K58 A;  4YOV A;  1TK5 A;  3E9O A;  1U45 A;  1Q86 O;  2BAN A;  3L8B A;  1OVY A;  5AQO A;  5JVH L;  4DV4 K;  3CCV N;  4GVM A;  3ZSX A;  3VF2 A;  3SI6 A;  3NBP A;  4ICL A;  2G8U A;  4QAG A;  4JD2 A;  4DV5 K;  4IJN A;  1F21 A;  3CME N;  3DLR A;  3KIO A;  3G71 N;  4BRE A;  3OYF A;  3A0I X;  1NWK A;  2JGU A;  3FLC O;  4DMN A;  5D3G A;  5KTQ A;  1RDA A;  4FZZ A;  4I7F A;  3K5N A;  3DYA A;  3NF9 A;  3ZX0 A;  4CE9 A;  1RT5 A;  1JCG A;  4DR7 K;  3ZET B;  3NFA A;  4YOX A;  3MAQ A;  3EKS A;  3CQ8 A;  2P9K B;  4J2E A;  1WSG A;  3LP0 A;  2CGK A;  4OPJ A;  4FK0 A;  5BRD A;  4KI6 A;  1HRH A;  4BR2 A;  4WQ4 A;  3CJ9 A;  3KD5 E;  2YHB A;  1TAU A;  1VSF A;  3ZSY A;  4WCE L;  3MCA B;  3G6E N;  4CGH A;  4KHQ A;  1C0F A;  3ZSO A;  3F2K A;  4JI8 K;  1TGO A;  4AM7 A;  2QXF A;  3P38 A;  4K43 A;  4DV1 K;  4FZY A;  3NH1 A;  4CFA A;  5HLF A;  3VET A;  2E2Q A;  3ENB A;  4O4G A;  5I42 A;  2YJF A;  5JS1 A;  2NRZ A;  3D45 A;  5HRP A;  4JI5 K;  5T7B A;  1VQN N;  4BRH A;  1KXP A;  2G8K A;  3EL2 A;  3H1V X;  4Q5V A;  2E6M A;  4DR2 K;  2A41 A;  3TAM A;  3DRP A;  3SV3 A;  4IJA A;  1LWC A;  4ELV A;  2UXC K;  3LP2 A;  3AVA A;  4B3M K;  3ZSR A;  1LW0 A;  3T1H K;  5I3U A;  4E3S A;  2HNY A;  1ZBI A;  4DG1 A;  4E1J A;  2KFN A;  5AQP A;  1VQK N;  3CJA A;  3O5B A;  2XY6 A;  1XNQ K;  1NU0 A;  4BRD A;  3EN9 A;  5KPR A;  3O4N A;  3L0Q A;  3LPU A;  4IZ9 A;  2ZM6 K;  2VWB A;  3NMU A;  1S1T A;  4CI6 A;  4ZHR A;  2HOE A;  4CGI A;  2ASP A;  2BE2 A;  3DOK A;  3JYT A;  1NK6 A;  3PLA A;  3FZF A;  4FLW A;  3A5M C;  4EIA A;  4GW6 A;  4AQY K;  3U6F A;  3OYH A;  4OKE A;  3MXI A;  3DXK B;  4AHS A;  1QTM A;  4BRC A;  3KK1 A;  1QQC A;  3LDS A;  3J7Z O;  4LFC K;  1X9J A;  1VRU A;  3B8A X;  2Z1J A;  3LZI A;  4F2S A;  4H0O A;  3THY B;  1DTT A;  1S9G A;  4XH1 A;  4GKJ K;  3AVN A;  4O8K A;  1VQP N;  3BZC A;  2FSK A;  3CPW M;  5AQX A;  1XMO K;  4CJT A;  3RRH A;  3RSE A;  3DXM A;  2Z1I A;  2F96 A;  3T3F A;  2J4R A;  4JHD A;  2PFU A;  3THV A;  2Q2R A;  4LF9 K;  1ZC6 A;  1TL3 A;  3OYC A;  3TAB A;  2Y1I A;  2ZJR L;  1CZA N;  4CCH A;  2AJQ A;  4DSE A;  3SUQ A;  4K8X A;  5LJV A;  4RW8 A;  4JKC A;  3OYG A;  4H03 B;  4CFB A;  3RR7 A;  4B8A B;  1G99 A;  1BCO A;  3FFK B;  1WSH A;  1Q9Y A;  1U4B A;  1LAW A;  4Y1D A;  2D0A A;  4DTS A;  4O44 A;  1VSE A;  1EXQ A;  1TAQ A;  5I9E B;  1REV A;  2QWP A;  1C0G A;  2O8F B;  2P9P A;  4LF5 K;  4E0D A;  2V52 B;  5M1F A;  4Z4H A;  3OHR A;  1YUW A;  4KI4 A;  4CIG A;  4JKA A;  1HX1 A;  1WSJ A;  3CG7 A;  2YX6 A;  2YNH A;  4OPA A;  4BE2 A;  2W41 A;  2E8A A;  3PX4 A;  3D6R A;  1EX4 A;  3O9R A;  2QWL A;  5E84 A;  4DTN A;  4O55 A;  4CZL A;  3U3G A;  4OLA A;  1GLC G;  3TSU A;  1ATS A;  4JLH A;  1XI1 A;  1YTU A;  3H6E A;  4A5A A;  2FF6 A;  4CEC A;  4B9V A;  3BZK A;  1Z25 A;  4BRO A;  3A5N C;  4JRQ A;  2P9L A;  4AHC A;  3WUH A;  4CHQ A;  1BHL A;  3O3F A;  2NRW A;  1X1P A;  4IEI A;  4KRF A;  4V19 S;  1R59 O;  3P1G A;  2NLX A;  2I7P A;  3SMS A;  2O4G A;  4BR9 A;  4JI0 K;  4BVP A;  3JSM A;  4IBN A;  3D7E O;  5AQI A;  1HKC A;  3V1O A;  5TKW A;  4FLX A;  5IT9 O;  5HRR A;  1FW6 A;  3RRG A;  4DWI A;  3TAR A;  4B1V A;  3OVN A;  5SWM A;  2WUS A;  5TKY A;  3LAM A;  4KAZ A;  1NGI A;  1W9H A;  1ILY A;  3HPH A;  4N5S A;  3VMF B;  1HJO A;  3DLH A;  1RTD A;  4W5T A;  4M41 A;  3P83 D;  4PKG A;  3VA0 A;  4BR7 A;  4CHO A;  2Z1G A;  1ZBS A;  3T19 A;  2HF3 A;  3WEE B;  3QNO A;  3UKR A;  1BIU A;  2ZWH A;  2W42 A;  5BPN A;  4BC5 A;  3UIQ A;  1TK0 A;  1NLV A;  3CHW A;  1EO1 A;  1RTI A;  3QER A;  4X62 K;  2ZF5 O;  4FSV A;  4CZM A;  1NOZ A;  1BA0 A;  4B3S K;  1QVG M;  1X9W A;  1YIT N;  3SUN A;  3HTV A;  3V4I A;  2GWJ A;  2DPN A;  1ZBF A;  1FK9 A;  4ZTF A;  4EHT A;  4OO1 J;  2VGM A;  4H5N A;  1ZBH A;  3C95 A;  3K9K A;  1IO2 A;  5FPE A;  1QE1 A;  5DMR A;  1GLL O;  4EAH D;  3C94 A;  3K0S A;  3VOV A;  3V81 A;  5AQU A;  2QWQ A;  3VF4 A;  3EKU A;  4PY5 A;  3CM5 A;  3R9P A;  1S6Q A;  3QEW A;  1NGC A;  5CE3 A;  4BE0 A;  1C0T A;  3K5M A;  3THW B;  4OKJ A;  4C1N K;  4B3R K;  3ZT2 A;  4UY8 O;  4FPB A;  1YT3 A;  3TAG A;  2IAJ A;  2ZD1 A;  2CGL A;  1M90 O;  1RT6 A;  2O8B B;  2P9K A;  5AQJ A;  5MLC Q;  3J7Y P;  3AVI A;  2F8T A;  4CD3 A;  4FJL A;  5C2D A;  5DM7 L;  4U67 L;  1E3M A;  5DK5 A;  3OTO K;  1HKB A;  1NGA A;  4H0P A;  5C10 A;  3VQD A;  3KTQ A;  4DQP A;  2DFF A;  4B9N A;  1C0U A;  4DR6 K;  4N41 A;  2O8D A;  3PX6 A;  4JK7 A;  4M7X A;  4JNE A;  3HOS A;  4NLC A;  3SBT A;  1IBK K;  3IRX A;  3AVM A;  3AO4 A;  2GV9 A;  1ZBU A;  4B9T A;  1RFQ A;  4A57 A;  3MN7 A;  4IDH A;  3HXM A;  2P5G A;  1QQO A;  1NGJ A;  1L3T A;  4B3T K;  1RIL A;  2GEM A;  5AQT A;  3UKU A;  4CJP A;  4NXN K;  2F8S A;  4F4K A;  2OA8 A;  3ATU A;  3QIO A;  5M1O A;  1ZXO A;  4BGB A;  4DR3 K;  3KHY A;  2G8F A;  4IWV A;  3EE9 A;  3QEI A;  4BRI A;  2ZQB A;  5KGW A;  1N5Y A;  2FBX A;  3VEZ A;  5SZT A;  4FJK A;  3NH0 A;  3TAF A;  3GG4 A;  1NNE A;  4CJQ A;  1WN7 A;  2P9S A;  4BC4 A;  1RTH A;  3OYD A;  1NJI O;  5AQR A;  4CEF A;  4J2A A;  4DR4 K;  3CJ1 A;  3HI0 A;  1HKG A;  4M3R A;  4JAX A;  5GAH P;  4DTR A;  3D2E A;  3AA2 A;  3HP6 A;  1JXB A;  4DU4 A;  4Z4F A;  3FZK A;  3G10 A;  3KKR A;  3ISN C;  4KB0 A;  3M8R A;  4FM0 A;  1P90 A;  1VSI A;  2FXU A;  4M45 A;  4FW1 A;  3CD6 N;  5AZJ B;  1SV5 A;  3WNE A;  3TAN A;  4DQI A;  4PUO A;  4JYA K;  1GLF O;  4H0T B;  3I8B A;  3H46 O;  4F8R A;  4H0X B;  1BA1 A;  2HBJ A;  4NCA A;  1NMD A;  1D5A A;  1W7A A;  4GVE A;  2HB5 A;  5HBM A;  3DXK A;  1MA9 B;  4J8F A;  1WSE A;  4KH5 A;  1SKW A;  3SMP A;  1BL3 A;  4KO0 A;  1XC9 A;  3MWP A;  1HR0 K;  4LFB K;  3TAP A;  3VQQ A;  5JMV A;  3L2U A;  1KAX A;  3OY9 A;  4KHN A;  3LL3 A;  1FKP A;  3AVJ A;  5AQM A;  5KQD A;  1RT3 A;  3LZJ A;  2RE2 A;  3ZLJ A;  4YOY A;  4FYD A;  4W5R A;  2UUC K;  2D0P A;  3OYB A;  4RW6 A;  4PQU A;  3B6O A;  4PHT X;  2OZM A;  4FWK A;  3EY1 A;  4PKH A;  3OJU A;  3SQ1 A;  3E9L A;  2CH6 A;  1SZ2 A;  2P9I B;  4O5F A;  1FKO A;  4CHP A;  1QHT A;  3J7A P;  3M5R A;  1D8Y A;  3AVG A;  3Q7C A;  3AVL A;  2IIR A;  3I0S A;  3TR8 A;  1NKB A;  3RWU A;  4YOU A;  3I56 N;  5FPD A;  3CI5 A;  3WXM B;  3R1X A;  4O0I A;  1RBR A;  3VQA A;  4H5V A;  4K8Z A;  4F3O A;  4CJ3 A;  1QQN A;  2O8C A;  1IKV A;  2E6L A;  4HUE A;  3L4Q A;  3F73 A;  3VEW A;  1T7P A;  1I3A A;  1LOT B;  3TTF A;  4B9L A;  2O8F A;  1Z05 A;  4OGC A;  5ADX H;  3NDK A;  2Q1N A;  3T1Y K;  1FXX A;  3GL1 A;  1LAV A;  1U04 A;  3L6Q A;  3SJH A;  1VRT A;  1SL1 A;  5C12 A;  1K9M O;  4KHY A;  3NF7 A;  4JI3 K;  1S6P A;  4FJG A;  3ENH A;  4W5Q A;  5AQZ A;  3VQB A;  1H1V A;  2HNZ A;  4PL8 A;  5EY4 A;  4BQL A;  3J80 O;  4DV2 K;  4B1Z A;  2VWJ A;  4L8R B;  3H1Q A;  1ITG A;  5C24 A;  2R7Y A;  5C2F A;  2A42 A;  3V1R A;  2F4V K;  4OPH A;  3C7N B;  3NAE A;  4A5B A;  1J9A A;  2X6N A;  1HNZ K;  1U2V B;  3DAW A;  3TTC A;  5FRO A;  4BDY A;  4FLV A;  5IWA K;  3SPY A;  5E26 A;  1TL1 A;  3OBY A;  3THX A;  1SL0 A;  3CC7 N;  1S1V A;  4CEA A;  3MXM A;  3FFI A;  5EOY A;  3CCM N;  1K6Y A;  3KWG A;  5M1Q A;  2HHH K;  4EZ6 A;  1EWQ A;  3V9S A;  2W6K A;  1X9S A;  5HOO A;  2WTU A;  3OYK A;  2E1Y A;  5EX5 A;  4O8U A;  2KW4 A;  1QSY A;  3ATV A;  4MDA A;  4IG3 A;  1OH7 A;  4CD1 A;  3DRR A;  3ZSQ A;  4FCY A;  2YHA A;  4FL9 A;  5AQN A;  1BI4 B;  1YVN A;  2IVN A;  3AAR A;  5CYM A;  3SK3 A;  1KFD A;  4K41 A;  4CJE A;  5LMN K;  3QFP A;  4HWI A;  1IV0 A;  3PO4 A;  3O80 A;  4EZ9 A;  3RMC A;  4FWQ A;  3KLI A;  4B9Q A;  3FE1 A;  4B9S A;  1Z6R A;  3BY5 A;  2IDO A;  3VER A;  3C6A A;  1JLC A;  3AV9 A;  2X78 A;  2F7T A;  4FJN A;  3MEC A;  4KRE A;  3WQU A;  4B1U B;  1E4F T;  3VPZ A;  4FPA A;  3D0P A;  4RCH A;  1UAX A;  4WFB L;  3E1Y A;  5F2R A;  3GE1 A;  2OCE A;  4B08 A;  1NJW A;  2O8E B;  3O9Q A;  4YFU A;  1LV5 A;  5F0X A;  2VG7 A;  2OYQ A;  1I94 K;  1N32 K;  2I5J A;  3A5L C;  3HVT A;  4FWP A;  4DQQ A;  4I6M A;  3WXK A;  1SS6 A;  2RPI A;  1HPM A;  4IFE A;  4IG0 A;  1U49 A;  1OH5 A;  4KBO A;  4BDP A;  2HBL A;  3ZT1 A;  3SBG A;  3QIC A;  1HJR A;  1VSK A;  4M3T A;  1W0H A;  1JXE A;  3OW2 M;  2O8B A;  4KH6 A;  3KK3 A;  3IMX A;  2NRR A;  4B8C A;  2UXD K;  3PSI A;  2P9N B;  2P5O A;  2HVH A;  1VSH A;  2PZS A;  4F9O A;  1NOY A;  1SQK A;  3IKM A;  1MWM A;  1U48 A;  1KFS A;  3DLL L;  4LD0 A;  2HHU A;  4DSI A;  1V4S A;  1JLG A;  2YNF A;  2W40 A;  2X74 A;  3NVM A;  4Z4E A;  4CJW A;  2RKI A;  4CGG A;  5B8H A;  4U7B A;  3C65 A;  3AO5 A;  4RWT A;  4IFY A;  4M3W A;  2P1J A;  3QIN A;  3L2V A;  4N47 A;  4AHU A;  3AA3 A;  3O3G A;  1VQ8 N;  2E2P A;  1UA1 A;  1MU2 A;  2ZGY A;  5KRS A;  4NXM K;  4O0J A;  2HHS A;  1IKY A;  5J1E A;  5AQK A;  4KHP K;  4CEE A;  3L2W A;  3VQP A;  1IG8 A;  3SPZ A;  4FWS A;  1T8E A;  3SUP A;  3SZ2 A;  2YV0 X;  3P5J A;  5BR9 A;  4DV0 K;  5BN8 A;  4DU1 A;  2FSJ A;  3H45 C;  2YHW A;  1OH8 A;  1A5W A;  1BQN A;  1N6Q A;  4WYB A;  1J5E K;  4HTL A;  5C0Y A;  4JK9 A;  1JL2 A;  1VHX A;  3PO5 A;  3RVC A;  5HRO A;  1N34 K;  1KRP A;  3GDQ A;  4YOW A;  3ULE A;  1K8K B;  3KLE A;  4UQG A;  5AZJ A;  2QKB A;  4E1N A;  3WT0 A;  2P51 A;  2B5J A;  2NUB A;  2WFB A;  4BRL A;  1ASV A;  3HVR A;  3CFO A;  3SUO A;  1BCM A;  4FVM A;  4H5T A;  2G8V A;  4BVO A;  3ID6 A;  4BY9 C;  2GUP A;  3DMJ A;  3O4Q A;  2V7Z A;  1GLD G;  5JVG L;  1EWR A;  3VQE A;  3AO3 A;  4OJR A;  4E7K A;  2WC9 A;  1VQ4 N;  5AQV A;  5BR8 K;  4YOR A;  3FGU A;  2X6S A;  5JLH A;  1LCU A;  1GOA A;  3CF5 L;  1S22 A;  4FO0 A;  3P39 A;  3QBX A;  3IUC A;  3OYJ A;  1BIS A;  3FZH A;  1J5O A;  4FJX A;  3TSQ A;  1WAJ A;  3PV8 A;  1VQL N;  2QWM A;  2VGN A;  3HL8 A;  4JI7 K;  4OLB A;  4DF8 A;  2QTD A;  4FOE A;  3RR8 A;  3LWL A;  1Q81 O;  2HMI A;  1X9M A;  4M3U A;  2Q3S A;  4LSN A;  5AR0 A;  5CYQ A;  3LWM A;  3LM2 A;  1NKE A;  1GOC A;  3CCE N;  4C8K A;  4BC3 A;  4M3Y A;  3OJS A;  1YHQ N;  3ZX3 A;  2KZZ A;  3TI0 A;  1D4X A;  3D2F B;  2QWN A;  2XY5 A;  3VN5 A;  4DKW A;  4CZE A;  3F9M A;  3LDO A;  1Q82 O;  1TK8 A;  3CIP A;  3V9W A;  4G9Z A;  1JLF A;  3OYA A;  4IO9 L;  1WSF A;  1NMN A;  1EKE A;  3T69 A;  3ASM A;  3J81 O;  1KQS M;  4B9M A;  5AJ3 K;  2ZGZ A;  1N36 K;  4MQ3 A;  3NCI A;  2DTU A;  3CJC A;  4JEP A;  4DQ8 A;  5ADX A;  2FBT A;  1WSI A;  2HHV A;  3QEX A;  3G4S N;  2GX9 A;  3HST B;  3O8M A;  4JN4 A;  2QA4 N;  4LH5 A;  1FJG K;  2FC0 A;  3NHG A;  2KLA A;  4OKK A;  3WXL A;  4ID5 A;  3MXJ A;  5FPN A;  4CW7 B;  4FJM A;  1S3X A;  4Z94 A;  5E41 A;  4M42 A;  2XY8 A;  3C7N A;  3G25 A;  4ID1 A;  1RDD A;  1QS4 A;  1BUP A;  3L2R A;  1VK0 A;  3PY8 A;  3AGK A;  4A2B A;  5J2N A;  4MO5 A;  1B9D A;  3KK7 A;  3MED A;  2FLO A;  4CZG A;  2IVP A;  1OVQ A;  4EP4 A;  3VES A;  3VTI A;  4CJU A;  1D9D A;  3AY9 A;  4H0Y B;  2A5X A;  3MEE A;  3NGY A;  3QNN A;  3VQ9 A;  1A5V A;  2FSN A;  2LSN A;  2E5L K;  1EET A;  3OYE A;  4B3O A;  4WFN L;  4JK8 A;  4CJR A;  3KKS A;  2Q0U A;  2JWL A;  2A6A A;  1XHZ A;  3O6W A;  3U4L A;  4BR4 A;  4CIF A;  2HBK A;  3RTV A;  4J2D A;  5H1S Q;  4B9U A;  1BI4 A;  3T7Z A;  3V6D A;  1TVR A;  3QFU A;  4ILJ A;  5AZI B;  5FLX O;  4DUY K;  4BRG A;  4FW2 A;  2NRV A;  1CLQ A;  3RMB A;  4KPY A;  2BGG A;  1O13 A;  5K14 A;  4CZH A;  4JKG B;  1YI2 N;  1D9F A;  3BF3 A;  2D5R A;  3B6P A;  2Q0R A;  3ZET A;  1HYS A;  4ISE A;  3S41 A;  5KI6 A;  3C6H A;  3S9H A;  3OA9 A;  4FWR A;  1XHX A;  2OPP A;  1S9E A;  4NO7 A;  4IXC A;  1NGG A;  2XRI A;  5JS2 A;  3SQ4 A;  4X65 K;  1L3V A;  1WOQ A;  4BDZ A;  1VSM A;  4CEQ A;  2OTJ N;  5KRT A;  2O8E A;  1XC3 A;  4XH5 A;  3U3Y A;  4HHT A;  4GKK K;  4CHN A;  3ZEU B;  2E2N A;  2KFZ A;  4FK2 A;  1QSL A;  4PWD A;  5CZ2 A;  1WLJ A;  4JRP A;  2ATQ A;  1RNH A;  3HO1 A;  4XIU A;  3S3N A;  2F9W A;  2EWS A;  3AGR A;  4GV9 A;  4F2R A;  3CMA N;  2GTD A;  4J2B A;  3JXU A;  1YAG A;  3I33 A;  5J2Q A;  4MO4 A;  4Z4C A;  3LAK A;  4WQ5 C;  4YNQ A;  4BGA A;  1T3V A;  4H5W A;  1GOB A;  3LDL A;  1NJX A;  5M1P A;  4CGF A;  2QEX N;  1QQM A;  2O4I A;  3EEQ A;  3QIP A;  3MDQ A;  3KZB A;  4JS5 A;  3V9Z A;  4K25 A;  3O08 A;  3O1B A;  4B1W B;  3CCU N;  3VGM A;  4WFA L;  5GIP A;  3S3M A;  3HOT A;  1QZ5 A;  4PA1 A;  1Q9X A;  2QK9 A;  3OS0 A;  2HHT A; 
#chains in the Genus database with same CATH homology
 1UA0 A;  1K6Y A;  1S1T A;  2YKM A;  3ZSV A;  4ZHR A;  2YNI A;  4DF4 A;  4EZ6 A;  2FBV A;  3CFP A;  4E7J A;  3V9S A;  4JS4 A;  4CER A;  1RBV A;  4CGI A;  2BE2 A;  3VQ6 A;  1X9S A;  2IGI A;  3DOK A;  3ZT0 A;  4CES A;  3NF8 A;  3JYT A;  1NK6 A;  4KTQ A;  4FJI A;  3K2P A;  3OYK A;  1TKT A;  4FLW A;  3KK2 A;  4GW6 A;  1RDB A;  1BGX T;  3OYH A;  4OKE A;  3U6F A;  2KW4 A;  3MXI A;  1ZYQ A;  4AHS A;  1QSY A;  3AVK A;  4DFK A;  1QTM A;  3KK1 A;  3A2F A;  4ELT A;  1VSD A;  3OYM A;  1QQC A;  3DM2 A;  4IG3 A;  3LDS A;  1VSL A;  3ITH A;  4CF1 A;  1RT7 A;  4C8N A;  3ULD A;  3H08 A;  1VRU A;  1JLA A;  2E4L A;  1Y97 A;  3DRR A;  4FJ7 A;  2Z1J A;  3LZI A;  3ZSQ A;  4FCY A;  2YHA A;  1C1B A;  4F2S A;  1BI4 B;  1YTA A;  3LAN A;  1DTT A;  3QLH A;  1HMV A;  1A5X A;  1S9G A;  3AVN A;  5CYM A;  3PX0 A;  1NJY A;  3BDP A;  4DFJ A;  1KFD A;  1C6V A;  2VG5 A;  3HYF A;  4CJE A;  4NCB A;  1Z26 A;  3PO4 A;  4AHR A;  4EZ9 A;  4AH9 A;  2OPR A;  3CYM A;  3RMC A;  1NJZ A;  3KLI A;  3L3U A;  4CJT A;  3HM9 A;  3RRH A;  3SV4 A;  4DTM A;  4B9S A;  3DLK A;  2IDO A;  2Z1I A;  2F96 A;  1TKZ A;  2HW3 A;  1KSP A;  1JLC A;  1CXQ A;  1B9F A;  3T3F A;  3SQ2 A;  1RTJ A;  3QEV A;  4W5N A;  3AV9 A;  2X78 A;  3THV A;  4I9Q A;  4FJN A;  3KLG A;  3MEC A;  3OYC A;  1TL3 A;  3TAB A;  1TKD A;  1JLE A;  4KRE A;  1JLQ A;  2Y1I A;  4DTO A;  3C6U A;  4OGE A;  2JLE A;  1EP4 A;  1T7P A;  5J2M A;  4KHS A;  3D0P A;  4CCH A;  2AJQ A;  4CF0 A;  4DSE A;  3SUQ A;  4K8X A;  1DTQ A;  1UAX A;  2VWK A;  4HUG A;  1SL2 A;  4WE1 A;  2KZM A;  4CK1 A;  3IS9 A;  4RW8 A;  2XO7 A;  3OYG A;  4CFB A;  1RBU A;  4B08 A;  4E89 A;  3M8S A;  1XWL A;  4E7L A;  4DFM A;  2Y1J A;  1NJW A;  3RR7 A;  4B8A B;  1J53 A;  4YFU A;  1S1X A;  1KVB A;  1BCO A;  1LV5 A;  3QES A;  1WSH A;  2HND A;  1Q9Y A;  2VG7 A;  2OYQ A;  3OYL A;  1WNS A;  1U4B A;  1LAW A;  4Y1D A;  4KTZ A;  2I5J A;  2D0A A;  1L3U A;  4DTS A;  3HVT A;  4DQQ A;  3C6T A;  4O44 A;  1VSE A;  1EXQ A;  1TAQ A;  4CK2 A;  3NGZ A;  1REV A;  2RPI A;  4CJ4 A;  1S5J A;  1U49 A;  4IG0 A;  4NYF A;  1JLB A;  3VQC A;  3EZ5 A;  4BDP A;  1LW2 A;  2XHB A;  4LSL A;  3ZT1 A;  3SYZ A;  4FLT A;  4CJF A;  4DFP A;  4E0D A;  4ELU A;  1HJR A;  1VSK A;  4DQS A;  4Z4H A;  1W0H A;  4KI4 A;  1RBT A;  4DSF A;  4M3T A;  4IFV A;  4CIG A;  1IH7 A;  3AVH A;  4GMJ B;  1JXE A;  1WSJ A;  3G0Z A;  3DLG A;  2EHG A;  1CZ9 A;  3WNH A;  3KK3 A;  3CG7 A;  1KLN A;  4Z4I A;  1NK4 A;  3OYN A;  4B8C A;  1NK8 A;  2YNH A;  4BE2 A;  3PX4 A;  1HNV A;  1EX4 A;  1HYZ A;  4LH4 A;  4E7H A;  4CGJ A;  2P5O A;  3LP1 A;  3VQ5 A;  1VSJ A;  4CF2 A;  4DTN A;  1HYV A;  2HVH A;  1VSH A;  4O55 A;  3LP3 A;  3MEG A;  3OS0 A;  1B92 A;  3U3G A;  1SKS A;  4OLA A;  2PZS A;  2IOC A;  2YKN A;  1HQU A;  1NOY A;  2WOM A;  4FXD A;  1IG9 A;  4FJJ A;  4JLH A;  1XI1 A;  3SCX A;  3VQ8 A;  1YTU A;  1U48 A;  1KFS A;  2ITG A;  1RT1 A;  4CEC A;  4B9V A;  3DOL A;  1HQE A;  4LD0 A;  4DSI A;  2HHU A;  1JLG A;  1Z25 A;  2YNF A;  4E1M A;  3VQ7 A;  4JRQ A;  3HT3 A;  1NK5 A;  4DSK A;  4AHC A;  4OPK A;  4ZTJ A;  4CHQ A;  3O3F A;  1BHL A;  2X74 A;  4FZX C;  3HPG A;  1X1P A;  4Z4E A;  4CJW A;  2RKI A;  4CGG A;  4KRF A;  3P1G A;  3AA5 X;  4RG8 A;  4DTU A;  4KV8 A;  2O4G A;  2OPQ A;  3AO5 A;  1LWE A;  3JSM A;  4IBN A;  4C8O A;  4IFY A;  4M3W A;  3AVF A;  1C1C A;  2HVI A;  1BQM A;  1HNI A;  1I39 A;  2P1J A;  3QIN A;  3L2V A;  4BWJ A;  3V1O A;  3HJF A;  4FLX A;  4N47 A;  4AHU A;  3AA3 A;  5HRR A;  3O3G A;  1SUQ A;  3RRG A;  4DWI A;  1UA1 A;  4EP5 A;  3TAR A;  1ASW A;  1MU2 A;  4H8K A;  4OVL A;  5KRS A;  3OVN A;  4O0J A;  5SWM A;  2HHW A;  3ZSW A;  3LAM A;  4CJL A;  4I2Q A;  2HHS A;  4KAZ A;  1IKY A;  5J1E A;  2IC3 A;  1W9H A;  5CY4 A;  4CJV A;  5C42 A;  4FLU A;  3NGI A;  3HPH A;  4N5S A;  3DLH A;  3KD1 E;  4CEE A;  3L2W A;  5JS1 A;  3VQP A;  1Q8I A;  4W5T A;  1KCF A;  4M41 A;  1RT4 A;  1RTD A;  3SPZ A;  3P83 D;  1T8E A;  3VA0 A;  4CHO A;  3SUP A;  2Z1G A;  3IG1 A;  2PYJ A;  3SZ2 A;  1L3S A;  2YV0 X;  3P5J A;  1NK9 A;  3QNO A;  4G1Q A;  3T19 A;  5J2P A;  4DU1 A;  4FJH A;  4Z4G A;  4CHY A;  1BIU A;  3NE6 A;  2EX3 A;  2W42 A;  4KFB A;  3CFR A;  1QSS A;  3UIQ A;  1TK0 A;  1A5W A;  1BQN A;  1N6Q A;  4C8L A;  1O1W A;  2DY4 A;  1JL2 A;  1RTI A;  3PO5 A;  5HRO A;  1NK0 A;  3QER A;  1KRP A;  4Z0U A;  1NOZ A;  2A1R A;  5C25 A;  2D0B A;  3KLE A;  1X9W A;  2YNG A;  4UQG A;  4H4M A;  3SUN A;  3DLB A;  2QKB A;  3V4I A;  2HHX A;  4E1N A;  1J54 A;  1ZBF A;  2P51 A;  3M8P A;  2B5J A;  1FK9 A;  2NUB A;  4AHV A;  4ZTF A;  4BE1 A;  4RW4 A;  1G15 A;  3ZT4 A;  1ASV A;  3HVR A;  3C95 A;  3CFO A;  3DRS A;  4CEB A;  1IO2 A;  3SUO A;  4FLZ A;  1ZBH A;  1BCM A;  3ALY A;  1QE1 A;  2FBY A;  4FVM A;  5DMR A;  4CF9 A;  2G8V A;  3WNG A;  3C94 A;  3DMJ A;  3O4Q A;  4FM1 A;  4TSX A;  4HVJ A;  1DLO A;  2G8I A;  3VQE A;  3V81 A;  3QET A;  2IS3 A;  3AO3 A;  4OJR A;  3V1Q A;  4E7K A;  3SNN A;  1T05 A;  4I9L A;  4PY5 A;  3CM5 A;  4HTU A;  4MFB A;  1S6Q A;  3QEW A;  2KQ2 A;  2X6S A;  1HPZ A;  1UOC A;  4KHU A;  4Y1C A;  4BE0 A;  4R5P A;  4M3X A;  1BIZ A;  1GOA A;  1C0T A;  4CJS A;  3K5M A;  1KTQ A;  1IKX A;  4OKJ A;  3ZT2 A;  4RW9 A;  4QOZ B;  1YT3 A;  3TAG A;  2ZD1 A;  2IAJ A;  3OYJ A;  1BIS A;  3L3V A;  3ZSZ A;  1JL1 A;  1RT6 A;  1J5O A;  4FJX A;  1WAJ A;  4CK3 A;  3PV8 A;  1NKC A;  3TWH A;  3HL8 A;  4N76 A;  3AVI A;  4DF8 A;  4OLB A;  2F8T A;  4FJL A;  1S1W A;  4AIL C;  3RR8 A;  3LWL A;  1S1U A;  4O5B A;  4FJ9 A;  2Z1H A;  4I2P A;  4KKO A;  4E7I A;  2HMI A;  3QEP A;  4C8M A;  1X9M A;  4M3U A;  5DK5 A;  3KTQ A;  4DQP A;  3VQD A;  5HP1 A;  2Q3S A;  4LSN A;  2DFF A;  4DQR A;  4B9N A;  1C0U A;  3HPO A;  2ZE2 A;  4CGD A;  4N41 A;  2B4J A;  5CYQ A;  3SQ0 A;  3LWM A;  1NKE A;  3PX6 A;  1GOC A;  1RDC A;  4LY7 A;  4C8K A;  2WON A;  4M3Y A;  3OJS A;  2QKK A;  4DTX A;  2BDP A;  2KZZ A;  4DTJ A;  2GUI A;  4QCL A;  3QO9 A;  3TI0 A;  3O3H A;  3IRX A;  3VQ4 A;  3RMD A;  1TV6 A;  4W5O A;  3AVM A;  3AO4 A;  2GV9 A;  4CFC A;  1ZBU A;  5HRN A;  2XY5 A;  4DLG A;  3E01 A;  3HP9 A;  3VN5 A;  2B6A A;  3ZCM A;  3SJJ A;  3KLF A;  1U47 A;  4FJ5 A;  3HXM A;  4HUF A;  2P5G A;  1TK8 A;  1L3T A;  3V9W A;  1C1A A;  4AHT A;  1JKH A;  1JLF A;  4CJ5 A;  3OYA A;  1WSF A;  1RIL A;  3VA3 A;  1EKE A;  3ASM A;  4CJP A;  4CHZ A;  4B9M A;  2G8H A;  2F8S A;  4F4K A;  2OA8 A;  3QIO A;  4MQ3 A;  4E19 A;  3NCI A;  2DTU A;  1KLM A;  1ASU A;  2RN2 A;  2G8F A;  2FBT A;  1LWF A;  3S3O A;  1WSI A;  3TAE A;  4BWM A;  2HHV A;  3NH2 A;  4FK4 A;  3QEI A;  3AVB A;  2ZQB A;  5KGW A;  1N5Y A;  2FBX A;  3QEX A;  1WAF A;  5SZT A;  2XY7 A;  4FJK A;  3HST B;  4CIE A;  4BAC A;  3NH0 A;  3TAF A;  3HK2 A;  4CJQ A;  4HCC A;  1WN7 A;  4LH5 A;  5FDL A;  1T03 A;  3OYD A;  1RTH A;  1KVC A;  1RT2 A;  2FC0 A;  3NHG A;  4OKK A;  4CEF A;  4J2A A;  1UWB A;  4DS5 A;  4ID5 A;  3KJV A;  3MXJ A;  4FJM A;  4M3R A;  3V9U A;  5E41 A;  4DTR A;  4M42 A;  2XY8 A;  2HHQ A;  3AA2 A;  3HP6 A;  3TAQ A;  1JXB A;  4DU4 A;  4H4O A;  4ID1 A;  4DU3 A;  4Z4F A;  3EYZ A;  4FM2 A;  3G10 A;  1RDD A;  1QS4 A;  3ISN C;  3KKR A;  4CF8 A;  3L2R A;  4DLE A;  1VK0 A;  3M8R A;  4FM0 A;  3PY8 A;  4KB0 A;  3LPT A;  2D0C A;  5J2N A;  1VSI A;  1B9D A;  5HRS A;  2A1S A;  3M8Q A;  5EU7 A;  3V9X A;  3K58 A;  3MED A;  4M45 A;  4FW1 A;  4EP4 A;  1TK5 A;  3TAN A;  1SV5 A;  3WNE A;  4CJU A;  1U45 A;  1D9D A;  3AVC A;  4DQI A;  4PUO A;  2BAN A;  3I0R A;  3L8B A;  1CZB A;  4DTP A;  4F8R A;  4GVM A;  4RW7 A;  3AA4 A;  3ZSX A;  3MEE A;  3NGY A;  3QNN A;  3SI6 A;  3VQ9 A;  3NBP A;  1A5V A;  4NCA A;  3IAY A;  2LSN A;  1EET A;  3OYE A;  1D5A A;  2PYL A;  3RMA A;  3I8D A;  4B3O A;  2HB5 A;  5HBM A;  3CM6 A;  2KTQ A;  4CJR A;  1ZBL A;  4ICL A;  3KKS A;  1WSE A;  4HCB A;  1SKW A;  2G8U A;  4QAG A;  1XHZ A;  1BL3 A;  4KB1 A;  4KO0 A;  1XC9 A;  1F21 A;  3DLR A;  3KIO A;  4CIF A;  3VQQ A;  1IKW A;  3WNF A;  2GBZ A;  3RTV A;  3OYF A;  3L2U A;  3TAP A;  3K57 A;  4J2D A;  3OY9 A;  4B9U A;  3ZT3 A;  4KHN A;  1BI4 A;  1YVU A;  2JGU A;  3V6D A;  4DMN A;  5D3G A;  5KTQ A;  2PY5 A;  1TVR A;  1FKP A;  1RDA A;  4FZZ A;  3AVJ A;  4CJK A;  1RT3 A;  4I7F A;  3K5N A;  4FW2 A;  3DYA A;  4KHW A;  3LZJ A;  1CLQ A;  3NF9 A;  4CE9 A;  3RMB A;  4KPY A;  3DI6 A;  1RT5 A;  4FYD A;  4W5R A;  4IKF A;  2BGG A;  3NFA A;  1RBS A;  5K14 A;  3OYB A;  4RW6 A;  4PQU A;  3MAQ A;  3B6O A;  3CQ8 A;  1D9F A;  2OZM A;  4J2E A;  1HYS A;  2D5R A;  3B6P A;  3EY1 A;  1WSG A;  3OJU A;  3SQ1 A;  3LP0 A;  4OPJ A;  5KI6 A;  4FK0 A;  3S9H A;  4FJ8 A;  4KI6 A;  1XHX A;  2OPP A;  1HRH A;  3LAL A;  1FKO A;  1S9E A;  4CHP A;  4CFD A;  3KD5 E;  1QHT A;  4KTW A;  4NYN A;  2YHB A;  1D8Y A;  2XRI A;  1TAU A;  5JS2 A;  1VSF A;  3ZSY A;  3SQ4 A;  3AVG A;  1L3V A;  3AVL A;  3I0S A;  3TR8 A;  4BDZ A;  4CGH A;  1VSM A;  3F9K A;  5KGX A;  2DFH A;  4CEQ A;  1NKB A;  3RWU A;  4KHQ A;  4F3T A;  5KRT A;  1C0M A;  3ZSO A;  4IDK A;  3U3Y A;  1TGO A;  4O0I A;  4HHT A;  2QXF A;  1RBR A;  4CEO A;  3VQA A;  3K5L A;  4K8Z A;  4CHN A;  3OYI A;  4F3O A;  3NF6 A;  2KFZ A;  4FZY A;  4CJ3 A;  3NH1 A;  4FLY A;  1IKV A;  2E6L A;  4CFA A;  4HUE A;  5HLF A;  3F73 A;  4FK2 A;  3BGR A;  1QSL A;  4PWD A;  5CZ2 A;  1WLJ A;  4O4G A;  1TKX A;  2ATQ A;  4JRP A;  5I42 A;  1I3A A;  1RNH A;  1L5U A;  4B9L A;  3T1A A;  3HO1 A;  4XIU A;  4CED A;  1RCH A;  2VG6 A;  3S3N A;  3D45 A;  5HRP A;  4OGC A;  2RF2 A;  3NDK A;  2OZS A;  2DFE A;  5T7B A;  4DS4 A;  4F2R A;  3OS2 A;  1NK7 A;  4J2B A;  1FXX A;  2G8K A;  2G8W A;  1LAV A;  4Q5V A;  5J2Q A;  1KVA A;  1U04 A;  3K59 A;  2E6M A;  4Z4C A;  3LAK A;  1VRT A;  4NCG A;  3TAM A;  1SL1 A;  4YNQ A;  3KLH A;  3DRP A;  5FRN A;  3SV3 A;  4KHY A;  3NF7 A;  4Q0B A;  1LWC A;  4ELV A;  4M3Z A;  3LP2 A;  2OPS A;  3AVA A;  1S6P A;  3DLE A;  4FJG A;  3ZSR A;  1GOB A;  1LW0 A;  4W5Q A;  4B9T A;  3K5O A;  4CEZ A;  5I3U A;  3VQB A;  1NJX A;  4CGF A;  4E3S A;  2HNY A;  1ZBI A;  3AO1 A;  2O4I A;  4DG1 A;  2HNZ A;  3AO2 A;  2KFN A;  3QIP A;  4JS5 A;  3V9Z A;  2XY6 A;  2VWJ A;  4L8R B;  3OS1 A;  1R0A A;  1ITG A;  5C24 A;  2R7Y A;  3V1R A;  3PUF A;  4N56 A;  1CXU A;  3NAE A;  2ETJ A;  1SKR A;  1J9A A;  3O4N A;  2X6N A;  3S3M A;  5FRM A;  3LPU A;  5FRO A;  4BDY A;  4FLV A;  4PA1 A;  1Q9X A;  5CZ1 A;  3SPY A;  3L2Q A;  1SL0 A;  1TL1 A;  1S1V A;  4CEA A;  4DSL A;  4DSJ A;  2QK9 A;  3MXM A;  3FFI A;  2HHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...