1ITGA

Crystal structure of the catalytic domain of hiv-1 integrase: similarity to other polynucleotidyl transferases
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
142
Chain Sequence
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna integration
molecule keywords HIV-1 INTEGRASE
publication title Crystal structure of the catalytic domain of HIV-1 integrase: similarity to other polynucleotidyl transferases.
pubmed rcsb
source organism Human immunodeficiency virus 1
total genus 44
structure length 142
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1994-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1itgA00
2HW3A 4FJ7A 4CJPA 1BL3A 4FJ8A 3P5JA 4OJRA 3EY1A 1ASUA 4DQIA 4RW4A 5HRSA 1ZBHA 2KZZA 4QCLA 4MFBA 3AVNA 1UWBA 4CJKA 3SQ4A 2KTQA 4CE9A 3K59A 3KD1E 4F3OA 4E7KA 3OYEA 1LAWA 2OZSA 3LANA 3OJUA 2P51A 4CGFA 1Q9YA 1XC9A 4RW8A 4FLZA 3OS2A 4DLEA 4ZTJA 2EHGA 5FROA 1D5AA 4CJ5A 3L2QA 3F73A 2PZSA 3IAYA 1KVBA 4CJ3A 2HHQA 3QESA 2WONA 1C1AA 1RTJA 4H4OA 1LW0A 4ICLA 4AHRA 3SUQA 1Q9XA 1QSLA 2OA8A 2DTUA 3NDKA 2XY8A 4OVLA 4KB0A 3LAKA 4CJVA 3TAGA 4FLVA 3VQDA 1JLCA 4E7LA 3SNNA 4YNQA 1NK8A 5SZTA 4CESA 3QEVA 1J54A 3AO3A 3MXMA 2FBVA 3V9WA 4CJLA 4RW9A 1YT3A 3AO1A 3ZT1A 3LWLA 1IKYA 1B9DA 4GVMA 3U3GA 4FLUA 1SL2A 1HQEA 2O4IA 4NYFA 3HM9A 4DTRA 1SL0A 2PYJA 1WSEA 1IG9A 3QEXA 4H4MA 4I9LA 4B9UA 5FRNA 4F2RA 2P1JA 3QINA 4AHSA 1A5XA 3K2PA 2YNFA 4Z4EA 3AA4A 1Q8IA 1REVA 4ID1A 4IDKA 3O3FA 2Z1IA 3HP9A 2DFFA 5JS1A 2I5JA 2QKBA 3F9KA 4AH9A 1TGOA 2ZE2A 3QETA 4DFMA 1NKEA 1O1WA 2OPQA 4PY5A 3OS1A 5KTQA 1BISA 2LSNA 2Y1JA 1NKBA 3B6PA 4KPYA 2HVIA 4DTPA 4CJFA 4AHTA 3LPTA 1S9EA 4FZXC 4N76A 4W5NA 3NH0A 3U3YA 3U6FA 3LP1A 4TSXA 5I42A 4DSLA 3AVFA 5D3GA 3ZCMA 1IKVA 2VWKA 1VRTA 1HYSA 2Z1HA 1U4BA 3KJVA 1LV5A 4N47A 3L2WA 5HROA 3VQPA 4BE0A 3PX4A 1QTMA 2BDPA 4FJNA 3OYCA 1T03A 1QSSA 4Z4IA 4Z4GA 2RN2A 2IOCA 4M3WA 4CFDA 1NK6A 1DTTA 1JLAA 2X6NA 3ZT4A 4DU4A 3P1GA 2OPRA 3HYFA 3VQBA 3VN5A 3ZSXA 5E41A 4OPKA 1RBTA 1S6PA 4B08A 1C6VA 4O0IA 3K5LA 3K57A 4FZZA 3KLFA 1HNVA 2JGUA 3RR7A 2VWJA 4PQUA 4EZ9A 4W5RA 2O4GA 2QK9A 1SL1A 3OYDA 3NF7A 1U47A 1D9DA 4DTOA 1KCFA 4CHOA 3OYAA 4CIFA 4M45A 3I0RA 4CHNA 2F8SA 3O3HA 3C94A 4KFBA 4FJJA 2G8VA 3RWUA 4LD0A 3SUNA 3ZSOA 4CJEA 4DF4A 4I2QA 1JLGA 1JKHA 3VQ4A 2G8WA 4DTSA 4DFPA 3NF9A 3TAEA 5CY4A 4B9TA 3EYZA 3PO4A 2Q3SA 3NH1A 1HYVA 2P5GA 4CGJA 1L5UA 1D8YA 1D9FA 3PO5A 4DSIA 3PV8A 1S6QA 4KKOA 4BWMA 5I3UA 4ELUA 2YNGA 1S1XA 4FVMA 4JS5A 4HUGA 3THVA 1W9HA 3VQEA 2HHUA 1ZBFA 1RBVA 3SQ0A 3SI6A 1ZBIA 3M8PA 3EZ5A 4DSEA 1HPZA 5T7BA 2KFZA 4AHCA 1IO2A 1NKCA 1NJXA 2G8IA 4ID5A 1N6QA 4BDPA 3WNGA 1K6YA 4C8MA 4FLYA 4CK2A 1EETA 4DG1A 1RDDA 4PWDA 4BDZA 4DU3A 1RTDA 1XHXA 3OYJA 3VQQA 3HJFA 1ZYQA 1S5JA 4E19A 4KI4A 2WOMA 2ATQA 3DOKA 3VQ5A 4AILC 3TAFA 2QXFA 1WAFA 4HCBA 3HPOA 4J2BA 5FRMA 1TKXA 1T7PA 1DTQA 3NHGA 4E0DA 1RT6A 4R5PA 3NAEA 4CHPA 4IBNA 4CGIA 4FK0A 4B9MA 3MEDA 4NCAA 3C6TA 3CQ8A 3VQCA 3AVBA 4I2PA 5HRRA 3ZT3A 3MXJA 4DFKA 1VK0A 4O5BA 3I0SA 3SQ1A 3RR8A 3QIOA 1ASWA 4OKEA 1CZBA 4CEOA 2DFEA 3OY9A 4HUFA 3VQ6A 1FKPA 1NK4A 2IAJA 3V9XA 3SYZA 3B6OA 1JLFA 2HVHA 1KTQA 4C8LA 3LAMA 4CFAA 2VG5A 1SKWA 3AV9A 4HUEA 4E7IA 3QNNA 3AVAA 4DS4A 3DLHA 3BDPA 4CGGA 1WSJA 5C42A 1S1WA 3PUFA 4FM0A 3S3NA 2G8KA 3JYTA 4DQQA 4CEZA 4DLGA 1JL2A 3AO4A 3L8BA 4DSFA 1BI4B 3OYIA 3NFAA 1UAXA 1CLQA 4CECA 1TK8A 2P5OA 2YHAA 3KKSA 4DFJA 4KTWA 4UQGA 1EP4A 1NJZA 4CCHA 2D5RA 1LW2A 3PX6A 5K14A 3K58A 1RBRA 2E6LA 3CG7A 4LSLA 4FLTA 4I9QA 5HBMA 4M3XA 4KHWA 1TK5A 1DLOA 4Y1CA 1JL1A 2YKNA 3RMAA 2HNYA 3VQAA 2Z1GA 4DS5A 2D0AA 4K8ZA 1IKXA 1RBUA 3V1QA 4JLHA 1WSFA 3A2FA 1UA0A 3ZSYA 1L3UA 1SUQA 2B6AA 1L3VA 1YTUA 2YV0X 4J2AA 1Z26A 5KGWA 4KTQA 1Y97A 3E01A 4FLXA 1J5OA 3OYFA 1XHZA 3TR8A 1XWLA 3L2RA 4CF0A 3AO2A 3KLIA 5KRSA 3OYKA 1RDAA 2IC3A 1VSDA 3MECA 4CF1A 4DTXA 4B8CA 3QNOA 4DF8A 4FJGA 3I8DA 2IGIA 4HCCA 1VSKA 3DRRA 1YTAA 1XI1A 3TWHA 4BE1A 4J2DA 1C1BA 2D0BA 4CHQA 2OPSA 1KLNA 2OZMA 4FJLA 2XRIA 4FJIA 3SV3A 4O4GA 1WN7A 5EU7A 3OYHA 3V9ZA 1MU2A 1S1TA 4KO0A 4E7JA 3VQ7A 3SQ2A 1LWEA 4KREA 3WNEA 1NOYA 5KI6A 3SUPA 4Z4FA 4CJ4A 4O44A 5HRPA 2YHBA 4DU1A 4CEDA 4RG8A 4E1NA 2W42A 4BE2A 4FW2A 4M3ZA 1X1PA 1ZBUA 4CIGA 3KLHA 1QS4A 3QIPA 1ITGA 1JLEA 3L3VA 3VQ9A 3V9UA 1C0MA 1GOAA 3DYAA 5KGXA 2EX3A 2KQ2A 3DRSA 1J53A 1B9FA 3LPUA 4CJQA 3M8RA 3OYGA 1N5YA 4L8RB 4BACA 1S1VA 4LH5A 4CFBA 4HHTA 4FCYA 3SCXA 5J2QA 3FFIA 3IRXA 5DK5A 4Q5VA 2RPIA 1VSJA 3LZJA 4FXDA 5KRTA 3DLGA 2A1SA 3O4NA 3IG1A 4DMNA 2FBXA 4B9LA 1BCMA 5J2NA 4FJHA 4LSNA 2DY4A 1VRUA 2GBZA 1U45A 4KHQA 3NGIA 4LH4A 1BCOA 1S1UA 3HO1A 4Z4CA 1RTHA 3NH2A 1WSIA 4DQSA 2BE2A 1W0HA 1EKEA 5J2MA 3TABA 1KFDA 3DLBA 4KI6A 4CJRA 2XHBA 1QE1A 4JS4A 2Z1JA 1T05A 4FJ9A 4O0JA 3LDSA 4CHZA 3JSMA 2AJQA 1WAJA 1CZ9A 4GMJB 3NGZA 1KLMA 4IKFA 4CJSA 4OKJA 3VA0A 3H08A 4B3OA 4M3TA 3AVCA 4J2EA 2E6MA 3S9HA 1WSHA 3T1AA 4KHUA 3TANA 4M42A 5HRNA 3DLEA 2HHVA 5C24A 1FKOA 2R7YA 3O3GA 1TKZA 1JXEA 2BANA 1VSIA 5J1EA 4FLWA 3QEWA 3SPZA 2ZD1A 3KLGA 1A5WA 4B9VA 4RW6A 3OVNA 3V1RA 2A1RA 4WE1A 4AHVA 4IG3A 3NF8A 1JXBA 5SWMA 3LP0A 4CERA 4B9SA 1TAUA 4FK2A 4M3UA 3ZT2A 4E89A 3NGYA 3SPYA 3ZSVA 5JS2A 3MEGA 4CGHA 3S3MA 3CFPA 3QEPA 3L3UA 1X9WA 3ITHA 4CEQA 3LP3A 3KK2A 4OGCA 3SV4A 4DWIA 1HYZA 3MXIA 4CK1A 1HNIA 1HJRA 4MQ3A 3G10A 4DTMA 4JRQA 3SZ2A 3RRHA 1JLBA 3V81A 3OYBA 3DI6A 4E3SA 2XY6A 1SKRA 4EP4A 1BGXT 2HHTA 1ASVA 3KKRA 5CZ2A 4Z0UA 4B8AB 1G15A 5DMRA 3LWMA 4N56A 2D0CA 1KFSA 4I7FA 1A5VA 3K5NA 2HNDA 3AVLA 4NYNA 3D0PA 3V9SA 3PY8A 3HVTA 2G8HA 3TAMA 3AA3A 4M41A 3S3OA 1RT7A 3V4IA 1BIZA 1C1CA 2B4JA 1BI4A 1CXQA 4N5SA 3HPGA 1L3SA 3RMDA 2PYLA 3LP2A 4HVJA 3RMBA 1TK0A 4KB1A 3AA2A 4CK3A 2ITGA 4LY7A 3OYMA 1BIUA 3HT3A 4QAGA 5J2PA 4CEAA 3TARA 2OYQA 3NF6A 3SUOA 1L3TA 2PY5A 3QERA 2HHSA 2F96A 3OS0A 3LALA 3QEIA 3CYMA 4OGEA 3C95A 3DLRA 1EX4A 3L2VA 1NJWA 4IFYA 4XIUA 4CEEA 1LWFA 3HP6A 1I39A 2OPPA 4OPJA 4KRFA 3DMJA 4M3RA 1NK7A 1TL1A 3VA3A 3AA5X 3TAQA 2X6SA 4CEBA 1VSFA 2RKIA 2X74A 5FDLA 1RDBA 1IH7A 4K8XA 4DTNA 1KVCA 3O4QA 5C25A 1LWCA 1U48A 1X9MA 4C8KA 3IS9A 2FBTA 4CF8A 3QO9A 3KK1A 4ZHRA 4DQRA 4PUOA 3ZSWA 3MAQA 1JLQA 3AVMA 1X9SA 2GUIA 2QKKA 1HMVA 3ZSZA 3DOLA 3K5OA 4G1QA 3ALYA 2YKMA 3G0ZA 4RW7A 3HVRA 5HP1A 1VSEA 1IKWA 4CF9A 4OLBA 1U04A 2JLEA 4M3YA 1RT1A 2HHXA 1GOBA 1BQNA 1T8EA 4C8OA 4DQPA 3TAPA 1HQUA 2ZQBA 4FJ5A 1C0TA 4FK4A 3NBPA 3AVKA 4CJUA 4YFUA 1FXXA 1RT5A 3CM6A 3HSTB 3ISNC 3M8SA 3TI0A 1TKDA 4BWJA 4ZTFA 1KRPA 2KZMA 3VQ8A 4AHUA 3WNHA 1J9AA 2KW4A 4FM2A 2Y1IA 1NOZA 3HPHA 4FM1A 1F21A 1TAQA 1VSMA 3HXMA 1WNSA 1HRHA 4DTUA 4F2SA 1QQCA 3WNFA 1KSPA 2RF2A 4B9NA 4F8RA 3NCIA 4KTZA 2X78A 3M8QA 3MEEA 2B5JA 3P83D 4E7HA 1NK0A 2HHWA 4IG0A 5CYQA 4CIEA 4W5OA 1QHTA 1VSHA 1RCHA 3QLHA 4W5TA 1RT2A 2YNHA 3OYLA 3AVIA 3ZSQA 4IFVA 1LAVA 2HNZA 4CJTA 3NE6A 3D45A 1U49A 4EP5A 1BQMA 3V1OA 1RNHA 4CGDA 4CJWA 2VG7A 1GOCA 1FK9A 4O55A 4JRPA 5CZ1A 2YNIA 3DLKA 1UA1A 1B92A 4PA1A 1NJYA 4Q0BA 2DFHA 4BDYA 1VSLA 4FJMA 3L2UA 5CYMA 3KD5E 4OLAA 4EZ6A 1RTIA 4Y1DA 1ZBLA 4QOZB 2XY5A 2IDOA 2GV9A 3KTQA 4N41A 4FJKA 1TVRA 2XO7A 1BHLA 4Z4HA 3ULDA 3RMCA 1YVUA 1CXUA 2XY7A 2FBYA 2F8TA 3RTVA 2IS3A 1TKTA 3AO5A 3BGRA 4CFCA 3V6DA 3SJJA 1RILA 4C8NA 4GW6A 2BGGA 3ASMA 3PX0A 3LZIA 4DSJA 3CM5A 4DSKA 4F4KA 3RRGA 4FJXA 1S9GA 3K5MA 4E1MA 3CFRA 1TV6A 4DTJA 1SKSA 3T19A 4W5QA 3OYNA 1R0AA 1NK5A 1RDCA 3AVGA 3HL8A 4KHSA 4F3TA 1I3AA 3KIOA 3OJSA 4FZYA 3ZSRA 1Z25A 3AVHA 2NUBA 3C6UA 1RT4A 3ZT0A 1WSGA 2G8UA 2ETJA 1SV5A 3KK3A 3CFOA 4KV8A 3DM2A 4ELTA 3UIQA 4NCBA 5HLFA 2VG6A 4CHYA 4KHNA 1EXQA 1WLJA 4FW1A 1QSYA 1KVAA 1TL3A 4H8KA 3DRPA 2HMIA 1UOCA 4FYDA 3AVJA 2HB5A 4CF2A 2E4LA 1NK9A 2KFNA 4ELVA 4CEFA 4HTUA 4KAZA 3KLEA 1C0UA 3HK2A 2G8FA 1RBSA 4KHYA 2FC0A 3T3FA 4NCGA 1RT3A 4OKKA
chains in the Genus database with same CATH superfamily
2HW3A 4FJ8A 4XH1A 1ZBHA 4MDBA 2KZZA 1UWBA 3SQ4A 4CE9A 3KD1E 1LAWA 1NGAA 2Q2RA 3CF5L 3OJUA 3CJAA 3EE9A 4RW8A 3L2QA 1D5AA 4CZGA 4CJ3A 2OA8A 3F5TA 2H3GX 4H03B 4WQ5A 5HOOA 4B3RK 3CMEN 3TAGA 4NLCA 4BRFA 3D2EA 3FLCO 2O8BA 1EWRA 4FWMA 3A5NC 5TKYA 5LL6Z 3AO1A 3ZT1A 5AR0A 4BR9A 3HM9A 5AQXA 1SL0A 2PYJA 2ITMA 4H4MA 5FRNA 2E20A 3R1XA 3DXKB 2YNFA 3I8BA 3AARA 3O3FA 2UU9K 2I5JA 2I7NA 4OPHA 4WFBL 3J8AA 1FW6A 4DFMA 2Q0RA 1NKEA 1O1WA 2OPQA 3ZETA 1QVFM 1BISA 1NKBA 1ATRA 2HVIA 3U6FA 2AA4A 4TSXA 5AQUA 5D3GA 1EO1A 3ZCMA 1VRTA 4GNIA 2Z1HA 2O8FA 5F2RA 3F9MA 3KJVA 2O8CA 5FPNA 4KH5A 4DV5K 3CQYA 1LV5A 3L2WA 2ZJQL 4Z4GA 1EQYA 3TU5A 3QEPA 4DU4A 2X6NA 3P1GA 5E41A 4OPKA 4FZZA 1HPMA 1KQSM 3BP8A 1NGCA 4EZ9A 1SL1A 3OYDA 1KCFA 2NRRA 5I9EB 3I0RA 4KFBA 4DF4A 4CZLA 5CY4A 1HYVA 2GX9A 1S6QA 4ELUA 4HUGA 4JS5A 1ZBFA 3O1BA 1RGIA 1N32K 1KAZA 2HF4A 2KFZA 3LDPA 4DSEA 5C2FA 4CZHA 1RDDA 3FZLA 4BDZA 3CD6N 1P8ZA 4DU3A 4CD3A 4JKFA 1S5JA 4E19A 2WOMA 4DHYA 3VQ5A 5BRHA 3TAFA 4J2BA 3ENOA 1BG3A 4E0DA 4R5PA 4IBNA 1OH6A 4B9MA 1C0GA 3ZT3A 4BC5A 4O5BA 3L0QA 3EN9A 4YDUC 2HBMA 4CEOA 2DFEA 2IAJA 3V9XA 3SYZA 4BVPA 2HVHA 1KTQA 4A5BA 4B1XB 1D4XA 1RFQA 4HUEA 4E7IA 4FM0A 3S3NA 2AP1A 4MLHA 1VQ7N 4DQQA 3AO4A 3L8BA 4DSFA 2P9LB 1TK8A 2P5OA 4BG9A 1EP4A 1LW2A 3VEVA 4FLTA 4M3XA 5HBMA 1DLOA 3FFKB 2YKNA 5AQLA 3FE1A 4DS5A 4JLHA 1WSFA 3ZSYA 3HOTA 2B6AA 3FR0A 4JKHA 4KBOA 5KGWA 5AQRA 1J5OA 2E2NA 3OYFA 1XWLA 3AO2A 5KRSA 3QNOA 1IBLK 4CF1A 4YOYA 4B8CA 2UUAK 3I8DA 1VSKA 1YTAA 2D0OA 3EKSA 4IOAL 5C0YA 2IVNA 4Z94A 4FJIA 4YDUA 4O4GA 3C65A 5EU7A 1OVYA 3KWIA 3V9ZA 1MU2A 1S1TA 1Q86O 4KREA 1LWEA 4LF8K 3WNEA 4CJ4A 3M5RA 3O08A 4O44A 4JKDA 5HRPA 2YHBA 2YHYA 3CERA 4X64K 1X1PA 3VEYA 3KLHA 1QS4A 3QIPA 1ITGA 3MX2A 1GOAA 3D2FB 3DYAA 2KQ2A 4BREA 1J53A 5BN8A 4CJQA 3M8RA 3OYGA 4L8RB 1NGDA 1S1VA 4FCYA 3A8YA 5DK5A 5J2QA 4FVUA 2RPIA 1VSJA 2F9TA 5KRTA 2A1SA 3O4NA 4DMNA 5F1XA 1HNXK 4B9LA 2P9SA 4UY8O 4G9ZA 5J2NA 5EX5A 4GV9A 1BCOA 5AFUA 5LJVA 1NGJA 4CJRA 4PL8A 1QE1A 3T7ZA 1BDGA 2I7PA 1WBBA 1GLFO 3K0SA 5H1SQ 4GMJB 5AQNA 1KLMA 5KPTA 3VERA 4FLWA 3SPZA 1R59O 3KLGA 1X9JA 4B9SA 1JXBA 3SPYA 1NG9A 4IOXA 3WXKA 1X9WA 5M1QA 1K8AO 3KK2A 5AQOA 1HNIA 4DTMA 2V51B 3SZ2A 3OYBA 5AZJA 1E4GT 3UB5A 5IWAK 4O8KA 4B8AB 3I33A 1KFSA 3VESA 1A5VA 3D0PA 2HNDA 4NYNA 3HVTA 4EAHD 1RT7A 3GG4A 1BIZA 4N5SA 4FWPA 4HVJA 3RMBA 2ITGA 4QAGA 4H0TB 5J2PA 2NZTA 3Q7CA 2HSTA 1L3TA 2PY5A 1SQKA 2HHSA 3LALA 4CZIA 3QEIA 3DXKA 4OGEA 3DLRA 1EX4A 1NJWA 4IFYA 5EOYA 1JCFA 2OPPA 4BVOA 5AJ3K 3DMJA 3WQUA 3EO3A 1IH7A 4C8KA 4CF8A 3QO9A 3ZSWA 1JLQA 3H45C 1X9SA 2GUIA 1HMVA 3ZSZA 1XNQK 4G1QA 3HVRA 1VSEA 1U04A 1QQOA 2JLEA 1NGGA 1GOBA 1BQNA 4DV7K 3P38A 4DV6K 4DQPA 3TAPA 4FJ5A 4FK4A 1C0TA 5AQMA 3M8SA 3MCAB 3MN5A 5AQJA 3PIPL 2RE2A 3J80O 1J9AA 1VQON 4BY9C 4DTUA 3SJHA 1KSPA 1NMDA 2RF2A 2O8FB 3MN7A 1M1KO 3NCIA 2X78A 3MEEA 4B1VA 3THYA 4E7HA 3IMXA 4IO8A 1MA9B 4IG0A 2NRHA 3LDNA 3DXMA 1VSHA 2Q1NA 2YNHA 1LAVA 1SZ2A 3HTVA 3D45A 4H5RA 4BG8A 3V1OA 4CGDA 4CJWA 2VG7A 5CZ1A 4JI2K 1NJYA 4BDYA 1T6DA 2ASMA 2IDOA 2GV9A 3QFPA 1XQSC 1TVRA 4Z4HA 3RMCA 3SBGA 3O8MA 1CXUA 2XY7A 3RTVA 3ASMA 4FJXA 3CFRA 4DTJA 3VTHA 3C6HA 4QS7A 3T19A 3CMAN 3AVGA 1I3AA 3KIOA 2A41A 3AVHA 3MCPA 3ZT0A 4AQYK 2ETJA 3DM2A 4NCBA 3LDQA 4KHNA 3H3OB 1IG8A 1QSYA 1KC8O 1KVAA 3VENA 2HMIA 4FYDA 4LF6K 4GKJK 2E4LA 2KFNA 4DUYK 3MN9A 4ELVA 3O9SA 3VGMA 1IV0A 3MWPA 1RBSA 4NCGA 4HTLA 2CGKA 4FJ7A 2OTJN 4RW4A 4A61A 4CJKA 2KTQA 2CGJA 2FSJA 3K59A 4C1NK 3OYEA 4CGFA 2PZSA 3QESA 1RTJA 4ICLA 3KVGA 2QW9A 2XY8A 5AQFA 4IJAA 2IVPA 3LAKA 3U4LA 4A59A 5FPDA 3CCJN 1JLCA 4YNQA 1NK8A 5SZTA 3QEVA 3CCSN 3U9DA 1IKYA 4FO0A 3U3GA 4DTRA 1WSEA 4I9LA 2WBNA 2P1JA 5GAHP 5C10A 4ID1A 4M7XA 4IDKA 2Z1IA 2GELA 2DFFA 3HP9A 4U7BA 3THWB 2ZF5O 1TGOA 3QETA 5AQSA 3TTCA 3R9PA 4YY3K 2WUSA 1HNZK 5KTQA 1ZXOA 2Y1JA 1K8KA 4DTPA 4AHTA 1GLJO 4FZXC 3D2FA 4BC4A 3T69A 3U3YA 3LP1A 5I42A 4DSLA 3AVFA 1IKVA 3HZ6A 3J7AP 2GTDA 4IJNA 3VQPA 2BDPA 1QTMA 4FJNA 3OYCA 1T03A 1QSSA 4M3WA 2E5LK 1JLAA 3ZT4A 4KB0A 3HYFA 3ZSXA 1S6PA 4O0IA 3K5LA 5GAGP 3K57A 3EL2A 1HNVA 3OBYA 4PQUA 2QK9A 4NXNK 3MMVA 3OHRA 3NF7A 4DTOA 4A5AA 4KHPK 2W41A 3RWUA 4CI6A 3ZSOA 4CJEA 2HBLA 4I2QA 1JLGA 3U8XA 3NF9A 4DFPA 1NNEA 3PLAA 4BROA 3PIOL 2P5GA 1D9FA 2P9IA 3PV8A 4FVMA 1S1XA 4IZ9A 3THVA 4DKWA 3ENHA 1XC3A 4KH4A 3H1VX 1RBVA 4BC3A 3SI6A 1ZBIA 3M8PA 3EZ5A 1HPZA 5T7BA 1IO2A 2G8IA 4ID5A 1N6QA 4A2AA 1K6YA 1EETA 4NB4A 1XHXA 3OYJA 3HJFA 2QA4N 2FLOA 4AILC 4GV3A 1WAFA 1T7PA 3NAEA 3VF2A 2VCPA 4JI4K 3C6TA 3CQ8A 3AVBA 2VQFK 3MXJA 4DFKA 1VK0A 3I0SA 1VQKN 5AZJB 1NM1A 1CZBA 1QZ5A 4HUFA 1NK4A 3VQ6A 1LCUA 5LMUK 4DV1K 1QQMA 4C8LA 4FWOA 1BOTO 1VQ6N 4CGGA 5C42A 1S1WA 3PUFA 4PKGA 1OVQA 2NNWA 1ESVA 1S3XA 1UAXA 5JMVA 4DFJA 4KTWA 4UQGA 3PX6A 3CG7A 1W7AA 4JYAK 1JL1A 4H0YB 2HNYA 3VQAA 4BR5A 5LMNK 1U2VA 2D0AA 1IKXA 1UA0A 1X3MA 2Q31A 4EFHA 2YV0X 2E1YA 4J2AA 1TUYA 3QICA 3TR8A 1ATNA 4CF0A 3SAGA 4BR7A 4HCCA 3DRRA 1I94K 1XI1A 4J2DA 4J8FA 2D0BA 2OPSA 1XMOK 1MWKA 2E2QA 3TTFA 3VQ7A 3Q7BA 4Z4FA 5JLFA 2W42A 3EKUA 4L3QA 2CH5A 4IFEA 5E84A 3P31A 1VQMN 4NO7A 2QWNA 4YHHK 5AQHA 3QBXA 1B9FA 3LPUA 1N33K 4FXDA 1WUAA 4WQ4C 4H5TA 1HKBA 3DLGA 3IG1A 3THYB 2FBXA 4JI6K 4QS8A 1BCMA 3O4WA 4B3TK 3DXMB 2GBZA 1S1UA 4DQSA 2BE2A 1W0HA 1YI2N 5J2MA 3TABA 4AM7A 4DV2K 4WYBA 4OPAA 2F9WA 1T05A 4FJ9A 1N36K 3LDSA 2CH6A 4JN4A 1SAZA 2F4VK 3SAFA 4OKJA 3VA0A 3H08A 4B3OA 4M3TA 3AVCA 4J2EA 2BH1A 2YJFA 3T1AA 2ZJRL 3O3GA 2BANA 3QEWA 5J1EA 1A5WA 4RW6A 2D0PA 2P9KA 2A1RA 4WE1A 2E2PA 5SWMA 2OTLN 4CERA 4BR0A 4FK2A 1TAUA 3ZT2A 4JI3K 3LL3A 1DT9A 3S3MA 3MEGA 3CFPA 2HHHK 4JI8K 4OGCA 3HBTA 5AQTA 4MQ3A 4JKBA 3V81A 3VF4A 3N4PA 3E9OA 1SKRA 1O13A 3ID8A 4A62A 4EP4A 2A5XA 2XY6A 4H0OA 5AQZA 1ASVA 1VAZA 5CZ2A 1YJNN 5DMRA 3K5NA 4FWKA 4BRGA 3GBTA 2G8HA 3TAMA 3AA3A 1HKCA 3V4IA 1BI4A 3LP2A 1VQ5N 4BRCA 3AA2A 4JKGA 4CK3A 4LY7A 3HT3A 1Q82O 1GLAG 2KLAA 2UYTA 3TARA 1OH5A 1QVGM 4B1WB 2ASOA 3CYMA 1VQLN 1LWFA 4KRFA 4M63C 2GWKA 3QBWA 3THWA 5M1KA 1TL1A 1YF5L 1GLCG 4CEBA 2QWPA 1RDBA 3WT0A 4DTNA 4DR3K 1U48A 3O1WA 1X9MA 3CC7N 3IS9A 4DQRA 3MAQA 4IWVA 3AVMA 1YITN 4JI5K 3CC4N 4X66K 4RW7A 5HP1A 4CF9A 3JS6A 3VMFB 1T8EA 4B1YB 1HQUA 2ZQBA 3GOIA 3HSTB 3TI0A 3ISNC 2JWLA 4O8UA 1U6ZA 1KRPA 2KZMA 1K8KB 3VQ8A 4AHUA 5M1FA 4CZEA 5BPMA 4FM2A 2Y1IA 1NOZA 4F9OA 4C1NI 3CQXA 1F21A 4FM1A 1TAQA 1VSMA 3O80A 1WNSA 3ZEUA 1HRHA 2GUPA 3VEWA 4IO9L 4DR7K 1QQCA 3WNFA 5ADXH 3P4IA 4KTZA 1HJOA 2B5JA 3P83D 4BGAA 3ATUA 1J5EK 5F0XA 4BRPA 4CIEA 1QHTA 3QLHA 5DM6L 2RHKA 1RDWX 3ZSQA 3H6EA 3AGRA 3FZMA 2HNZA 3L4QA 4CJTA 1BUPA 1BQMA 2NRZA 3CPEA 5AQKA 1GOCA 4BC2A 2HBJA 4Q0BA 2DFHA 4FJMA 5CYMA 4OLAA 1RTIA 2XY5A 3J7YP 4N41A 4LFCK 4FJKA 4DR4K 3ULDA 2FBYA 2F8TA 3AO5A 3B8AX 3V6DA 2BGGA 2O8EA 4C8NA 3PX0A 3LZIA 4DSJA 4F4KA 3RRGA 1S9GA 4E1MA 2P9IB 5HL7L 4RWTA 4ISFA 3WQTA 1Q18A 3MX5A 2G8UA 1WSGA 3KK3A 1SV5A 4JAXA 1JCEA 5HLFA 1EXQA 3UE5A 1S22A 1N34K 2WC9A 1FJGK 4V19S 3VTIA 3QFUA 3KLEA 1GLBG 3CCMN 3HK2A 3CJ7A 2G8FA 2QTDA 3WXJA 4KHYA 4GVEA 3T3FA 4OKKA 3OTOK 1BL3A 3P5JA 1ASUA 4PKIA 4DQIA 5HRSA 4QCLA 2P9PB 4MO5A 5BRFA 4LC9B 3IUCA 4DLEA 4ZTJA 2HHQA 3G25A 3F73A 1KVBA 3BUZB 3J7ZO 1YAGA 1C1AA 2WONA 4H4OA 1LW0A 3SUQA 2NRWA 4WFNL 4LF9K 5GAEP 4JD2A 2NRTA 2DTUA 3NDKA 5M1PA 4OVLA 3O9TA 4E7LA 2UXCK 3A5LC 4CESA 2KHOA 2HOEA 4BRDA 3MXMA 1GLEG 3V9WA 2ZJPL 1YT3A 2QWRA 3MWTA 4GVMA 3LWLA 1HQEA 2O4IA 2P9NA 4QS9A 4BGBA 3DJCA 3LDLA 5BREA 1U2VB 4F2RA 3TSQA 1A5XA 1GLLO 4Z4EA 3AA4A 1REVA 4B9QA 3FZFA 2QWOA 4CJ7A 2QKBA 2FSNA 3F9KA 4DCHA 2ZE2A 4H0PA 4IDHA 4AF1A 2V52B 4PY5A 2LSNA 3B6PA 5JVGL 4KPYA 3FGUA 3DAWA 3LPTA 3FZKA 1QHAA 4JKAA 3TSUA 4JI7K 4DV4K 1HYSA 3UKUA 1U4BA 3L6QA 3L4IA 3I56N 4N47A 5HROA 3ATVA 5CR4A 4BE0A 4Z4IA 2RN2A 1NK6A 1DTTA 1VQNN 3VN5A 1ILYA 4B08A 1C6VA 4BR2A 5GIOA 2JGUA 3JXUA 3RR7A 2VWJA 5LY3A 1IJJA 4W5RA 3KK7A 1NGEA 1U47A 5M1NA 5C12A 3MN6A 4K0KK 1IBMK 3VEXA 1DGKN 2F8SA 3C94A 3ZX0A 5CE3A 4H0VB 5AQGA 3LM9A 4H5VA 1JKHA 3VQ4A 4DTSA 5C15A 4FPBA 3EYZA 2Q3SA 3PO4A 1YHQN 5AQYA 3CJ9A 3CCLN 4KKOA 4BWMA 4DR2K 3QB0A 1W9HA 3VQEA 3SLCA 3S41A 2QXLA 3SQ0A 5GINA 4AHCA 1NKCA 1NGHA 4BR4A 4BDPA 3WNGA 4C8MA 4FLYA 4PWDA 4NXMK 2FF6A 2YX6A 3ZYYX 1ZYQA 2P9KB 4CW7B 4KI4A 1X3NA 2ATQA 3DOKA 1K9MO 3HI0A 5B8HA 2D1KA 4CZKA 3VF6A 3W3DA 3HPOA 5FRMA 1TKXA 1DTQA 3NHGA 2NRVA 4CGIA 4FK0A 4K43A 4YOXA 4NCAA 3VQCA 4I2PA 5HRRA 1V4SA 4WCEL 3QIOA 3AAQA 2A3ZA 1ASWA 2V7ZA 3OBWA 3OY9A 1FKPA 3B6OA 3GDQA 3THXA 3LAMA 2VG5A 3AVAA 3DLHA 2G8KA 3T1HK 4CD1A 4DLGA 2UXBK 1NU0A 1BI4B 1CLQA 4CECA 2YHAA 4MDAA 1NJZA 3BF1A 2D5RA 4JKGB 5K14A 1RBRA 2E6LA 2BTFA 4LSLA 4CBUA 2F7TA 4B1UB 3VGLA 3QMLA 4IXCA 3RMAA 5KPZA 2Z1GA 5BR8K 4K8ZA 1RBUA 3V1QA 3A2FA 1SUQA 1YTUA 5AZIA 4LF5K 4KTQA 4YORA 3E01A 3ENBA 4RCHA 4FLXA 1XHZA 3KLIA 4FJGA 4DF8A 3MECA 4DTXA 5C2DA 2IGIA 1XMQK 3TWHA 4BE1A 4CHQA 2XRIA 1V4TA 3SV3A 4JKCA 4KO0A 3SQ2A 3IKMA 3SUPA 1OH7A 3C0BA 3E9PA 3FZHA 4RG8A 3BF3A 3T1YK 4FW2A 1ZBUA 4BQLA 4CBXA 3L3VA 1BU6O 1C0MA 5KGXA 2EX3A 4FOIA 3CI5A 3ZEUB 4BACA 3SCXA 3FFIA 2D4WA 3VETA 1NGFA 3AAPA 3O9QA 1YJWN 4BRKA 3IDHA 2A6AA 1W2BM 1WBDA 4FJHA 3R3LA 1VRUA 5BPLA 4KHQA 4LH4A 3HO1A 4Z4CA 1RTHA 3M3ZA 3NH2A 1J6ZA 5AQPA 1EKEA 3WXMB 1KFDA 3DLBA 5ADXA 3E1YA 1T6CA 2YCHA 1VQPN 2Z1JA 3CCVN 3TSPA 4B3SK 5AQVA 4IKFA 5A2QO 4JHDA 5GIPA 3EEQA 5FPEA 3S9HA 3N4QA 5HRNA 2O8EB 2HHVA 1GLDG 5C24A 1FKOA 4IEEA 1TKZA 1JXEA 3ULEB 1HNWK 4H0XB 1NLVA 4I6MA 4B9VA 2GWJA 3OVNA 3A5OC 4H5NA 3NF8A 2P9UA 3WXLA 4E89A 3NGYA 3ZSVA 3BZKA 5JS2A 4CGHA 3L3UA 3ITHA 4CEQA 1T3VA 1E4FT 4DWIA 3MXIA 4CK1A 2P9PA 3G10A 1Q81O 3MDQA 3RRHA 3DI6A 4XEIA 3VEOA 2HHTA 2OANA 3KKRA 4IEIA 3O6WA 3G4SN 2KKZA 2YI1A 4N56A 2D0CA 2JWKA 3V9SA 3PY8A 3C7NA 4M41A 3S3OA 1E3MA 2EWSA 1C1CA 2B4JA 1CXQA 3HPGA 4B3MK 4ISEA 3RMDA 2PYLA 3O9UA 3HRGA 1BIUA 3G71N 3M1FA 1BA0A 2OYQA 3SUOA 2QWMA 3QERA 1VHXA 4JD2B 2F96A 4LFBK 4ILHA 3C95A 3CJCA 3QDKA 3E9LA 1YXQA 4XIUA 4CEEA 3HP6A 3O9RA 4M3RA 1NK7A 3TAQA 3WEEA 2X6SA 2RKIA 5FDLA 4K8XA 1KVCA 3O4QA 3R6MA 4DV3K 4JI1K 4ILGB 2FBTA 3LM2A 3KK1A 4PUOA 2P9NB 2ZWHA 3PSIA 2YHWA 3DOLA 1HKGA 4B1ZA 3ALYA 2YKMA 3G0ZA 1IKWA 4OLBA 2IIRA 1RT1A 4C8OA 3CCEN 4PL7A 3AY9A 3NBPA 4CJUA 1RT5A 3CM6A 2FXUA 4A57A 2PAVA 2O8DA 1TYQB 3SK3A 4ZTFA 2GEMA 4BRLA 1S72N 4GV6A 4FL9A 1QQNA 3HPHA 4BQZA 2V7YA 3UKUB 1KXPA 3M8QA 3NMUA 3JAMO 1NK0A 2HHWA 5CYQA 4W5TA 3OYLA 4DV0K 3VPZA 3P39A 4K25A 4O55A 3A0IX 4K42A 2YNIA 3DLKA 1UA1A 1B92A 1VSLA 2WTUA 4EZ6A 4Y1DA 4DR6K 4QOZB 1KAXA 4PKHA 4GKKK 3W0LA 1BHLA 3PSFA 3RVCA 3D7EO 3BGRA 4EHUA 4GW6A 3K5MA 1R0AA 1NJIO 5TKWA 3BEXA 3RSEA 3CCQN 3ZSRA 1Z25A 3C6UA 1RT4A 4WQ4A 3UIQA 1WLJA 4FW1A 4O5FA 3DRPA 1UOCA 4CF2A 2HB5A 4FWQA 2PBDA 4YOTA 4CEFA 4HTUA 1NWKA 4KAZA 1C0UA 4XH4A 2ASPA 1WB9A 3TTDA 4M7YA 4OO1J 4CJPA 3EY1A 4OJRA 4E1JA 5M1OA 4MFBA 2Q97A 3AVNA 4PHTX 1YJ9N 1YIJN 4F3OA 2J4RA 3K9KA 4E7KA 2OZSA 3LANA 2P51A 1Q9YA 1XC9A 4FLZA 3OS2A 4DR1K 2EHGA 5FROA 4CJ5A 3IAYA 3I55N 3SAHA 3AGKA 4AHRA 3THXB 1Q9XA 1QSLA 1M90O 4YOVA 1JCGA 3EE8A 4CJVA 4FLVA 3VQDA 3SNNA 5JVHL 4EHTA 1ZC6A 1J54A 2CGLA 3AO3A 3E66A 2FBVA 4CJLA 4RW9A 2VQEK 1B9DA 4FLUA 1SL2A 1OH8A 2E2OA 4NYFA 1IG9A 3QEXA 4B9UA 3QINA 4AHSA 3K2PA 1NGIA 4FWNA 4FSVA 1Q8IA 5JS1A 5AZIB 3DLLL 4AH9A 1HR0K 1OKJA 5EY4A 5MLCQ 3OS1A 2E88A 5E26A 4N76A 4CJFA 1S9EA 4W5NA 3O5BA 3NH0A 2FSKA 1C0FA 2VGMA 5ELZA 2QI2A 2VWKA 4FWLA 3VEZA 3UKRA 3PX4A 3ZX2A 4JK9A 3SMSA 2IOCA 4CFDA 2OPRA 3VQBA 4X62K 2UUBK 1ZBSA 1RBTA 3KLFA 5BRDA 2O4GA 5CHIA 3R8EA 4BRAA 1D9DA 4HWIA 4CHOA 4CIFA 3OYAA 4M45A 4CHNA 3O3HA 4FJJA 2G8VA 4LD0A 3SUNA 2VYPA 2G8WA 3NVMA 3TAEA 4B9TA 1G99A 4MLEA 3ULEA 3NH1A 3K9JA 4CGJA 1L5UA 1D8YA 5JLHA 3PO5A 4DSIA 4YOWA 5I3UA 2HHUA 2YNGA 4CZMA 2ZGZA 4RTFD 4JHDB 1NJXA 1KD1O 2HMPA 4BRMA 4CK2A 2DPNA 4DG1A 5AQWA 2A42A 1T44A 4CZJA 4I6MB 1RTDA 4JV5K 3VQQA 1RDUA 2P9UB 2OCEA 2QXFA 4IOCL 4HCBA 1RT6A 4CHPA 3ID6A 3MEDA 2Q0UA 3HSCA 2UUCK 3A5MC 2E8AA 4DQ8A 3HOSA 3SQ1A 4A2BA 3RR8A 4CZFA 4U67L 4OKEA 3KWGA 5JICA 1VQ9N 4CVNE 1JLFA 4CFAA 1SKWA 3AV9A 4H5WA 3QNNA 1VQ8N 4DS4A 3BDPA 1WSJA 3C7NB 4JI0K 3JYTA 4CEZA 1MWMA 1JL2A 4Y0WA 3NFAA 3OYIA 4C23A 2HHXA 3KKSA 4CCHA 1MDUB 3M6GA 3K58A 4I9QA 3ZX3A 3SBTA 4KHWA 1TK5A 2W6LA 2YJEA 4Y1CA 3J81O 2QEXN 1YVNA 1L3UA 4LFAK 1L3VA 1JJ2M 3D2EB 2O8BB 1Z26A 4DB3A 3OA9A 1Y97A 3WEEB 4CBWA 3L2RA 3OYKA 2PFUA 2YHXA 1RDAA 2IC3A 1VSDA 1TYQA 4FOEA 3VOVA 1C1BA 1BWFO 1KLNA 2OZMA 4FJLA 1WN7A 3OYHA 4E7JA 2BUPA 3KHYA 1NOYA 5KI6A 5AQQA 4DU1A 4OX9K 4CEDA 4E1NA 4BRNA 2O8DB 4M3ZA 3ZETB 1BA1A 2ZM6K 4CIGA 4KH6A 1JLEA 1ATSA 3VQ9A 1NMNA 3V9UA 1TUUA 1KAYA 4FWSA 3DRSA 3CXCM 3CCRN 5BN9A 1N5YA 2E1ZA 4LH5A 4CFBA 4HHTA 1NK5A 3IRXA 4Q5VA 3LZJA 2O8CB 1LOTB 4BRQA 3ZLJA 2WFBA 1YUWA 4LSNA 4WF9L 1U45A 2DY4A 2QM1A 3NGIA 3WXIA 2FF3B 1WSIA 3GL1A 4KI6A 1NBWA 2XHBA 5KQ8A 4JS4A 4MO4A 4BRHA 1CZAN 4O0JA 4CHZA 3JSMA 2AJQA 1WAJA 4JK8A 1HUXA 1CZ9A 1IBKK 5BR9A 3DWLA 3NGZA 4CJSA 4WFAL 2E6MA 1WSHA 4KHUA 3TANA 4M42A 3KZBA 3DLEA 2R7YA 1Q7YO 1VSIA 3H1QA 4K41A 2ZD1A 3GE1A 3TPQA 4LF7K 3V1RA 4AHVA 4IG3A 3LP0A 4M3UA 3RSEB 2UXDK 4YOUA 2VGNA 1H1VA 3SMPA 3LP3A 3SV4A 3CHWA 1P90A 1HYZA 1HJRA 2NLXA 4JRQA 1JLBA 1VQ4N 4XH5A 4E3SA 1BGXT 4Z0UA 3OW2M 1G15A 3LWMA 2NRXA 5KPRA 4X65K 4I7FA 1K73O 3CPWM 3CJ1A 3AVLA 2HBKA 4LF4K 2P9LA 1L3SA 1TK0A 4KB1A 3OYMA 4CEAA 1Z05A 2IVOA 3NF6A 1WOQA 3BZCA 3OS0A 3U9ZA 5FPMA 3L2VA 4FWRA 1EWQA 4JKEA 5BPNA 2VWBA 1I39A 4OPJA 1Y64A 3VA3A 3AA5X 1SS6A 3CETA 4ISGA 1VSFA 1HLUA 2X74A 3CJBA 5C25A 1LWCA 3G6EN 4ZHRA 3NVKA 1DEJA 4R79A 2QKKA 3IFRA 3K5OA 4ILJA 1HX1A 4M3YA 2A40A 5EVZA 3AVKA 4YFUA 1FXXA 5AQIA 4EIAA 1TKDA 4BWJA 3WNHA 2KW4A 3HM8A 3HXMA 4F2SA 4B9NA 4JK7A 4F8RA 5AFUH 1XUPO 3EZWA 3UKRB 4FPAA 3D6RA 3CC2N 2W6KA 4W5OA 1RCHA 3LDOA 1RT2A 3AVIA 4IFVA 1NGBA 3NE6A 3CCUN 1U49A 4EP5A 2QWQA 2ZGYA 1RNHA 2W40A 3BY5A 1FK9A 4JRPA 4PA1A 3CIPA 3L2UA 3KD5E 4DUZK 3WUHA 1ZBLA 5DM7L 3KTQA 2P9SB 2XO7A 4NLBA 1YVUA 3H46O 2HF3A 3H3NO 4JEPA 5GADP 5IT9O 3VGKA 2IS3A 1TKTA 4CFCA 4BRIA 3SJJA 1RILA 3CM5A 4DSKA 4WQ5C 1N8RO 4DR5K 1TV6A 1DKGD 1SKSA 5KQDA 4W5QA 3OYNA 1RDCA 3HL8A 4KHSA 1Z6RA 3F2KA 4F3TA 4JNEA 4GY2B 3OJSA 4FZYA 2NUBA 2Q36A 3CFOA 4KV8A 4ELTA 5EXWA 1XNRK 2VG6A 3MK6A 4CHYA 1TL3A 4H8KA 5FLXO 5LJWA 3AVJA 1NK9A 1W97L 1QZ6A 2QWLA 4AM6A 1BO5O 2FC0A 4BE2A 3C6AA 1RT3A
chains in the Genus database with same CATH topology
2HW3A 4FJ7A 4CJPA 1BL3A 4FJ8A 3P5JA 4OJRA 3EY1A 1ASUA 4DQIA 4RW4A 5HRSA 1ZBHA 2KZZA 4QCLA 4MFBA 3AVNA 1UWBA 4CJKA 3SQ4A 2KTQA 4CE9A 3K59A 3KD1E 4F3OA 4E7KA 3OYEA 1LAWA 2OZSA 3LANA 3OJUA 2P51A 4CGFA 1Q9YA 1XC9A 4RW8A 4FLZA 3OS2A 4DLEA 4ZTJA 2EHGA 5FROA 1D5AA 4CJ5A 3L2QA 3F73A 2PZSA 3IAYA 1KVBA 4CJ3A 2HHQA 3QESA 2WONA 1C1AA 1RTJA 4H4OA 1LW0A 4ICLA 4AHRA 3SUQA 1Q9XA 1QSLA 2OA8A 2DTUA 3NDKA 2XY8A 4OVLA 4KB0A 3LAKA 4CJVA 3TAGA 4FLVA 3VQDA 1JLCA 4E7LA 3SNNA 4YNQA 1NK8A 5SZTA 4CESA 3QEVA 1J54A 3AO3A 3MXMA 2FBVA 3V9WA 4CJLA 4RW9A 1YT3A 3AO1A 3ZT1A 3LWLA 1IKYA 1B9DA 4GVMA 3U3GA 4FLUA 1SL2A 1HQEA 2O4IA 4NYFA 3HM9A 4DTRA 1SL0A 2PYJA 1WSEA 1IG9A 3QEXA 4H4MA 4I9LA 4B9UA 5FRNA 4F2RA 2P1JA 3QINA 4AHSA 1A5XA 3K2PA 2YNFA 4Z4EA 3AA4A 1Q8IA 1REVA 4ID1A 4IDKA 3O3FA 2Z1IA 3HP9A 2DFFA 5JS1A 2I5JA 2QKBA 3F9KA 4AH9A 1TGOA 2ZE2A 3QETA 4DFMA 1NKEA 1O1WA 2OPQA 4PY5A 3OS1A 5KTQA 1BISA 2LSNA 2Y1JA 1NKBA 3B6PA 4KPYA 2HVIA 4DTPA 4CJFA 4AHTA 3LPTA 1S9EA 4FZXC 4N76A 4W5NA 3NH0A 3U3YA 3U6FA 3LP1A 4TSXA 5I42A 4DSLA 3AVFA 5D3GA 3ZCMA 1IKVA 2VWKA 1VRTA 1HYSA 2Z1HA 1U4BA 3KJVA 1LV5A 4N47A 3L2WA 5HROA 3VQPA 4BE0A 3PX4A 1QTMA 2BDPA 4FJNA 3OYCA 1T03A 1QSSA 4Z4IA 4Z4GA 2RN2A 2IOCA 4M3WA 4CFDA 1NK6A 1DTTA 1JLAA 2X6NA 3ZT4A 4DU4A 3P1GA 2OPRA 3HYFA 3VQBA 3VN5A 3ZSXA 5E41A 4OPKA 1RBTA 1S6PA 4B08A 1C6VA 4O0IA 3K5LA 3K57A 4FZZA 3KLFA 1HNVA 2JGUA 3RR7A 2VWJA 4PQUA 4EZ9A 4W5RA 2O4GA 2QK9A 1SL1A 3OYDA 3NF7A 1U47A 1D9DA 4DTOA 1KCFA 4CHOA 3OYAA 4CIFA 4M45A 3I0RA 4CHNA 2F8SA 3O3HA 3C94A 4KFBA 4FJJA 2G8VA 3RWUA 4LD0A 3SUNA 3ZSOA 4CJEA 4DF4A 4I2QA 1JLGA 1JKHA 3VQ4A 2G8WA 4DTSA 4DFPA 3NF9A 3TAEA 5CY4A 4B9TA 3EYZA 3PO4A 2Q3SA 3NH1A 1HYVA 2P5GA 4CGJA 1L5UA 1D8YA 1D9FA 3PO5A 4DSIA 3PV8A 1S6QA 4KKOA 4BWMA 5I3UA 4ELUA 2YNGA 1S1XA 4FVMA 4JS5A 4HUGA 3THVA 1W9HA 3VQEA 2HHUA 1ZBFA 1RBVA 3SQ0A 3SI6A 1ZBIA 3M8PA 3EZ5A 4DSEA 1HPZA 5T7BA 2KFZA 4AHCA 1IO2A 1NKCA 1NJXA 2G8IA 4ID5A 1N6QA 4BDPA 3WNGA 1K6YA 4C8MA 4FLYA 4CK2A 1EETA 4DG1A 1RDDA 4PWDA 4BDZA 4DU3A 1RTDA 1XHXA 3OYJA 3VQQA 3HJFA 1ZYQA 1S5JA 4E19A 4KI4A 2WOMA 2ATQA 3DOKA 3VQ5A 4AILC 3TAFA 2QXFA 1WAFA 4HCBA 3HPOA 4J2BA 5FRMA 1TKXA 1T7PA 1DTQA 3NHGA 4E0DA 1RT6A 4R5PA 3NAEA 4CHPA 4IBNA 4CGIA 4FK0A 4B9MA 3MEDA 4NCAA 3C6TA 3CQ8A 3VQCA 3AVBA 4I2PA 5HRRA 3ZT3A 3MXJA 4DFKA 1VK0A 4O5BA 3I0SA 3SQ1A 3RR8A 3QIOA 1ASWA 4OKEA 1CZBA 4CEOA 2DFEA 3OY9A 4HUFA 3VQ6A 1FKPA 1NK4A 2IAJA 3V9XA 3SYZA 3B6OA 1JLFA 2HVHA 1KTQA 4C8LA 3LAMA 4CFAA 2VG5A 1SKWA 3AV9A 4HUEA 4E7IA 3QNNA 3AVAA 4DS4A 3DLHA 3BDPA 4CGGA 1WSJA 5C42A 1S1WA 3PUFA 4FM0A 3S3NA 2G8KA 3JYTA 4DQQA 4CEZA 4DLGA 1JL2A 3AO4A 3L8BA 4DSFA 1BI4B 3OYIA 3NFAA 1UAXA 1CLQA 4CECA 1TK8A 2P5OA 2YHAA 3KKSA 4DFJA 4KTWA 4UQGA 1EP4A 1NJZA 4CCHA 2D5RA 1LW2A 3PX6A 5K14A 3K58A 1RBRA 2E6LA 3CG7A 4LSLA 4FLTA 4I9QA 5HBMA 4M3XA 4KHWA 1TK5A 1DLOA 4Y1CA 1JL1A 2YKNA 3RMAA 2HNYA 3VQAA 2Z1GA 4DS5A 2D0AA 4K8ZA 1IKXA 1RBUA 3V1QA 4JLHA 1WSFA 3A2FA 1UA0A 3ZSYA 1L3UA 1SUQA 2B6AA 1L3VA 1YTUA 2YV0X 4J2AA 1Z26A 5KGWA 4KTQA 1Y97A 3E01A 4FLXA 1J5OA 3OYFA 1XHZA 3TR8A 1XWLA 3L2RA 4CF0A 3AO2A 3KLIA 5KRSA 3OYKA 1RDAA 2IC3A 1VSDA 3MECA 4CF1A 4DTXA 4B8CA 3QNOA 4DF8A 4FJGA 3I8DA 2IGIA 4HCCA 1VSKA 3DRRA 1YTAA 1XI1A 3TWHA 4BE1A 4J2DA 1C1BA 2D0BA 4CHQA 2OPSA 1KLNA 2OZMA 4FJLA 2XRIA 4FJIA 3SV3A 4O4GA 1WN7A 5EU7A 3OYHA 3V9ZA 1MU2A 1S1TA 4KO0A 4E7JA 3VQ7A 3SQ2A 1LWEA 4KREA 3WNEA 1NOYA 5KI6A 3SUPA 4Z4FA 4CJ4A 4O44A 5HRPA 2YHBA 4DU1A 4CEDA 4RG8A 4E1NA 2W42A 4BE2A 4FW2A 4M3ZA 1X1PA 1ZBUA 4CIGA 3KLHA 1QS4A 3QIPA 1ITGA 1JLEA 3L3VA 3VQ9A 3V9UA 1C0MA 1GOAA 3DYAA 5KGXA 2EX3A 2KQ2A 3DRSA 1J53A 1B9FA 3LPUA 4CJQA 3M8RA 3OYGA 1N5YA 4L8RB 4BACA 1S1VA 4LH5A 4CFBA 4HHTA 4FCYA 3SCXA 5J2QA 3FFIA 3IRXA 5DK5A 4Q5VA 2RPIA 1VSJA 3LZJA 4FXDA 5KRTA 3DLGA 2A1SA 3O4NA 3IG1A 4DMNA 2FBXA 4B9LA 1BCMA 5J2NA 4FJHA 4LSNA 2DY4A 1VRUA 2GBZA 1U45A 4KHQA 3NGIA 4LH4A 1BCOA 1S1UA 3HO1A 4Z4CA 1RTHA 3NH2A 1WSIA 4DQSA 2BE2A 1W0HA 1EKEA 5J2MA 3TABA 1KFDA 3DLBA 4KI6A 4CJRA 2XHBA 1QE1A 4JS4A 2Z1JA 1T05A 4FJ9A 4O0JA 3LDSA 4CHZA 3JSMA 2AJQA 1WAJA 1CZ9A 4GMJB 3NGZA 1KLMA 4IKFA 4CJSA 4OKJA 3VA0A 3H08A 4B3OA 4M3TA 3AVCA 4J2EA 2E6MA 3S9HA 1WSHA 3T1AA 4KHUA 3TANA 4M42A 5HRNA 3DLEA 2HHVA 5C24A 1FKOA 2R7YA 3O3GA 1TKZA 1JXEA 2BANA 1VSIA 5J1EA 4FLWA 3QEWA 3SPZA 2ZD1A 3KLGA 1A5WA 4B9VA 4RW6A 3OVNA 3V1RA 2A1RA 4WE1A 4AHVA 4IG3A 3NF8A 1JXBA 5SWMA 3LP0A 4CERA 4B9SA 1TAUA 4FK2A 4M3UA 3ZT2A 4E89A 3NGYA 3SPYA 3ZSVA 5JS2A 3MEGA 4CGHA 3S3MA 3CFPA 3QEPA 3L3UA 1X9WA 3ITHA 4CEQA 3LP3A 3KK2A 4OGCA 3SV4A 4DWIA 1HYZA 3MXIA 4CK1A 1HNIA 1HJRA 4MQ3A 3G10A 4DTMA 4JRQA 3SZ2A 3RRHA 1JLBA 3V81A 3OYBA 3DI6A 4E3SA 2XY6A 1SKRA 4EP4A 1BGXT 2HHTA 1ASVA 3KKRA 5CZ2A 4Z0UA 4B8AB 1G15A 5DMRA 3LWMA 4N56A 2D0CA 1KFSA 4I7FA 1A5VA 3K5NA 2HNDA 3AVLA 4NYNA 3D0PA 3V9SA 3PY8A 3HVTA 2G8HA 3TAMA 3AA3A 4M41A 3S3OA 1RT7A 3V4IA 1BIZA 1C1CA 2B4JA 1BI4A 1CXQA 4N5SA 3HPGA 1L3SA 3RMDA 2PYLA 3LP2A 4HVJA 3RMBA 1TK0A 4KB1A 3AA2A 4CK3A 2ITGA 4LY7A 3OYMA 1BIUA 3HT3A 4QAGA 5J2PA 4CEAA 3TARA 2OYQA 3NF6A 3SUOA 1L3TA 2PY5A 3QERA 2HHSA 2F96A 3OS0A 3LALA 3QEIA 3CYMA 4OGEA 3C95A 3DLRA 1EX4A 3L2VA 1NJWA 4IFYA 4XIUA 4CEEA 1LWFA 3HP6A 1I39A 2OPPA 4OPJA 4KRFA 3DMJA 4M3RA 1NK7A 1TL1A 3VA3A 3AA5X 3TAQA 2X6SA 4CEBA 1VSFA 2RKIA 2X74A 5FDLA 1RDBA 1IH7A 4K8XA 4DTNA 1KVCA 3O4QA 5C25A 1LWCA 1U48A 1X9MA 4C8KA 3IS9A 2FBTA 4CF8A 3QO9A 3KK1A 4ZHRA 4DQRA 4PUOA 3ZSWA 3MAQA 1JLQA 3AVMA 1X9SA 2GUIA 2QKKA 1HMVA 3ZSZA 3DOLA 3K5OA 4G1QA 3ALYA 2YKMA 3G0ZA 4RW7A 3HVRA 5HP1A 1VSEA 1IKWA 4CF9A 4OLBA 1U04A 2JLEA 4M3YA 1RT1A 2HHXA 1GOBA 1BQNA 1T8EA 4C8OA 4DQPA 3TAPA 1HQUA 2ZQBA 4FJ5A 1C0TA 4FK4A 3NBPA 3AVKA 4CJUA 4YFUA 1FXXA 1RT5A 3CM6A 3HSTB 3ISNC 3M8SA 3TI0A 1TKDA 4BWJA 4ZTFA 1KRPA 2KZMA 3VQ8A 4AHUA 3WNHA 1J9AA 2KW4A 4FM2A 2Y1IA 1NOZA 3HPHA 4FM1A 1F21A 1TAQA 1VSMA 3HXMA 1WNSA 1HRHA 4DTUA 4F2SA 1QQCA 3WNFA 1KSPA 2RF2A 4B9NA 4F8RA 3NCIA 4KTZA 2X78A 3M8QA 3MEEA 2B5JA 3P83D 4E7HA 1NK0A 2HHWA 4IG0A 5CYQA 4CIEA 4W5OA 1QHTA 1VSHA 1RCHA 3QLHA 4W5TA 1RT2A 2YNHA 3OYLA 3AVIA 3ZSQA 4IFVA 1LAVA 2HNZA 4CJTA 3NE6A 3D45A 1U49A 4EP5A 1BQMA 3V1OA 1RNHA 4CGDA 4CJWA 2VG7A 1GOCA 1FK9A 4O55A 4JRPA 5CZ1A 2YNIA 3DLKA 1UA1A 1B92A 4PA1A 1NJYA 4Q0BA 2DFHA 4BDYA 1VSLA 4FJMA 3L2UA 5CYMA 3KD5E 4OLAA 4EZ6A 1RTIA 4Y1DA 1ZBLA 4QOZB 2XY5A 2IDOA 2GV9A 3KTQA 4N41A 4FJKA 1TVRA 2XO7A 1BHLA 4Z4HA 3ULDA 3RMCA 1YVUA 1CXUA 2XY7A 2FBYA 2F8TA 3RTVA 2IS3A 1TKTA 3AO5A 3BGRA 4CFCA 3V6DA 3SJJA 1RILA 4C8NA 4GW6A 2BGGA 3ASMA 3PX0A 3LZIA 4DSJA 3CM5A 4DSKA 4F4KA 3RRGA 4FJXA 1S9GA 3K5MA 4E1MA 3CFRA 1TV6A 4DTJA 1SKSA 3T19A 4W5QA 3OYNA 1R0AA 1NK5A 1RDCA 3AVGA 3HL8A 4KHSA 4F3TA 1I3AA 3KIOA 3OJSA 4FZYA 3ZSRA 1Z25A 3AVHA 2NUBA 3C6UA 1RT4A 3ZT0A 1WSGA 2G8UA 2ETJA 1SV5A 3KK3A 3CFOA 4KV8A 3DM2A 4ELTA 3UIQA 4NCBA 5HLFA 2VG6A 4CHYA 4KHNA 1EXQA 1WLJA 4FW1A 1QSYA 1KVAA 1TL3A 4H8KA 3DRPA 2HMIA 1UOCA 4FYDA 3AVJA 2HB5A 4CF2A 2E4LA 1NK9A 2KFNA 4ELVA 4CEFA 4HTUA 4KAZA 3KLEA 1C0UA 3HK2A 2G8FA 1RBSA 4KHYA 2FC0A 3T3FA 4NCGA 1RT3A 4OKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HW3 A;  4FJ7 A;  4CJP A;  1BL3 A;  4FJ8 A;  3P5J A;  4OJR A;  3EY1 A;  1ASU A;  4DQI A;  4RW4 A;  5HRS A;  1ZBH A;  2KZZ A;  4QCL A;  4MFB A;  3AVN A;  1UWB A;  4CJK A;  3SQ4 A;  2KTQ A;  4CE9 A;  3K59 A;  3KD1 E;  4F3O A;  4E7K A;  3OYE A;  1LAW A;  2OZS A;  3LAN A;  3OJU A;  2P51 A;  4CGF A;  1Q9Y A;  1XC9 A;  4RW8 A;  4FLZ A;  3OS2 A;  4DLE A;  4ZTJ A;  2EHG A;  5FRO A;  1D5A A;  4CJ5 A;  3L2Q A;  3F73 A;  2PZS A;  3IAY A;  1KVB A;  4CJ3 A;  2HHQ A;  3QES A;  2WON A;  1C1A A;  1RTJ A;  4H4O A;  1LW0 A;  4ICL A;  4AHR A;  3SUQ A;  1Q9X A;  1QSL A;  2OA8 A;  2DTU A;  3NDK A;  2XY8 A;  4OVL A;  4KB0 A;  3LAK A;  4CJV A;  3TAG A;  4FLV A;  3VQD A;  1JLC A;  4E7L A;  3SNN A;  4YNQ A;  1NK8 A;  5SZT A;  4CES A;  3QEV A;  1J54 A;  3AO3 A;  3MXM A;  2FBV A;  3V9W A;  4CJL A;  4RW9 A;  1YT3 A;  3AO1 A;  3ZT1 A;  3LWL A;  1IKY A;  1B9D A;  4GVM A;  3U3G A;  4FLU A;  1SL2 A;  1HQE A;  2O4I A;  4NYF A;  3HM9 A;  4DTR A;  1SL0 A;  2PYJ A;  1WSE A;  1IG9 A;  3QEX A;  4H4M A;  4I9L A;  4B9U A;  5FRN A;  4F2R A;  2P1J A;  3QIN A;  4AHS A;  1A5X A;  3K2P A;  2YNF A;  4Z4E A;  3AA4 A;  1Q8I A;  1REV A;  4ID1 A;  4IDK A;  3O3F A;  2Z1I A;  3HP9 A;  2DFF A;  5JS1 A;  2I5J A;  2QKB A;  3F9K A;  4AH9 A;  1TGO A;  2ZE2 A;  3QET A;  4DFM A;  1NKE A;  1O1W A;  2OPQ A;  4PY5 A;  3OS1 A;  5KTQ A;  1BIS A;  2LSN A;  2Y1J A;  1NKB A;  3B6P A;  4KPY A;  2HVI A;  4DTP A;  4CJF A;  4AHT A;  3LPT A;  1S9E A;  4FZX C;  4N76 A;  4W5N A;  3NH0 A;  3U3Y A;  3U6F A;  3LP1 A;  4TSX A;  5I42 A;  4DSL A;  3AVF A;  5D3G A;  3ZCM A;  1IKV A;  2VWK A;  1VRT A;  1HYS A;  2Z1H A;  1U4B A;  3KJV A;  1LV5 A;  4N47 A;  3L2W A;  5HRO A;  3VQP A;  4BE0 A;  3PX4 A;  1QTM A;  2BDP A;  4FJN A;  3OYC A;  1T03 A;  1QSS A;  4Z4I A;  4Z4G A;  2RN2 A;  2IOC A;  4M3W A;  4CFD A;  1NK6 A;  1DTT A;  1JLA A;  2X6N A;  3ZT4 A;  4DU4 A;  3P1G A;  2OPR A;  3HYF A;  3VQB A;  3VN5 A;  3ZSX A;  5E41 A;  4OPK A;  1RBT A;  1S6P A;  4B08 A;  1C6V A;  4O0I A;  3K5L A;  3K57 A;  4FZZ A;  3KLF A;  1HNV A;  2JGU A;  3RR7 A;  2VWJ A;  4PQU A;  4EZ9 A;  4W5R A;  2O4G A;  2QK9 A;  1SL1 A;  3OYD A;  3NF7 A;  1U47 A;  1D9D A;  4DTO A;  1KCF A;  4CHO A;  3OYA A;  4CIF A;  4M45 A;  3I0R A;  4CHN A;  2F8S A;  3O3H A;  3C94 A;  4KFB A;  4FJJ A;  2G8V A;  3RWU A;  4LD0 A;  3SUN A;  3ZSO A;  4CJE A;  4DF4 A;  4I2Q A;  1JLG A;  1JKH A;  3VQ4 A;  2G8W A;  4DTS A;  4DFP A;  3NF9 A;  3TAE A;  5CY4 A;  4B9T A;  3EYZ A;  3PO4 A;  2Q3S A;  3NH1 A;  1HYV A;  2P5G A;  4CGJ A;  1L5U A;  1D8Y A;  1D9F A;  3PO5 A;  4DSI A;  3PV8 A;  1S6Q A;  4KKO A;  4BWM A;  5I3U A;  4ELU A;  2YNG A;  1S1X A;  4FVM A;  4JS5 A;  4HUG A;  3THV A;  1W9H A;  3VQE A;  2HHU A;  1ZBF A;  1RBV A;  3SQ0 A;  3SI6 A;  1ZBI A;  3M8P A;  3EZ5 A;  4DSE A;  1HPZ A;  5T7B A;  2KFZ A;  4AHC A;  1IO2 A;  1NKC A;  1NJX A;  2G8I A;  4ID5 A;  1N6Q A;  4BDP A;  3WNG A;  1K6Y A;  4C8M A;  4FLY A;  4CK2 A;  1EET A;  4DG1 A;  1RDD A;  4PWD A;  4BDZ A;  4DU3 A;  1RTD A;  1XHX A;  3OYJ A;  3VQQ A;  3HJF A;  1ZYQ A;  1S5J A;  4E19 A;  4KI4 A;  2WOM A;  2ATQ A;  3DOK A;  3VQ5 A;  4AIL C;  3TAF A;  2QXF A;  1WAF A;  4HCB A;  3HPO A;  4J2B A;  5FRM A;  1TKX A;  1T7P A;  1DTQ A;  3NHG A;  4E0D A;  1RT6 A;  4R5P A;  3NAE A;  4CHP A;  4IBN A;  4CGI A;  4FK0 A;  4B9M A;  3MED A;  4NCA A;  3C6T A;  3CQ8 A;  3VQC A;  3AVB A;  4I2P A;  5HRR A;  3ZT3 A;  3MXJ A;  4DFK A;  1VK0 A;  4O5B A;  3I0S A;  3SQ1 A;  3RR8 A;  3QIO A;  1ASW A;  4OKE A;  1CZB A;  4CEO A;  2DFE A;  3OY9 A;  4HUF A;  3VQ6 A;  1FKP A;  1NK4 A;  2IAJ A;  3V9X A;  3SYZ A;  3B6O A;  1JLF A;  2HVH A;  1KTQ A;  4C8L A;  3LAM A;  4CFA A;  2VG5 A;  1SKW A;  3AV9 A;  4HUE A;  4E7I A;  3QNN A;  3AVA A;  4DS4 A;  3DLH A;  3BDP A;  4CGG A;  1WSJ A;  5C42 A;  1S1W A;  3PUF A;  4FM0 A;  3S3N A;  2G8K A;  3JYT A;  4DQQ A;  4CEZ A;  4DLG A;  1JL2 A;  3AO4 A;  3L8B A;  4DSF A;  1BI4 B;  3OYI A;  3NFA A;  1UAX A;  1CLQ A;  4CEC A;  1TK8 A;  2P5O A;  2YHA A;  3KKS A;  4DFJ A;  4KTW A;  4UQG A;  1EP4 A;  1NJZ A;  4CCH A;  2D5R A;  1LW2 A;  3PX6 A;  5K14 A;  3K58 A;  1RBR A;  2E6L A;  3CG7 A;  4LSL A;  4FLT A;  4I9Q A;  5HBM A;  4M3X A;  4KHW A;  1TK5 A;  1DLO A;  4Y1C A;  1JL1 A;  2YKN A;  3RMA A;  2HNY A;  3VQA A;  2Z1G A;  4DS5 A;  2D0A A;  4K8Z A;  1IKX A;  1RBU A;  3V1Q A;  4JLH A;  1WSF A;  3A2F A;  1UA0 A;  3ZSY A;  1L3U A;  1SUQ A;  2B6A A;  1L3V A;  1YTU A;  2YV0 X;  4J2A A;  1Z26 A;  5KGW A;  4KTQ A;  1Y97 A;  3E01 A;  4FLX A;  1J5O A;  3OYF A;  1XHZ A;  3TR8 A;  1XWL A;  3L2R A;  4CF0 A;  3AO2 A;  3KLI A;  5KRS A;  3OYK A;  1RDA A;  2IC3 A;  1VSD A;  3MEC A;  4CF1 A;  4DTX A;  4B8C A;  3QNO A;  4DF8 A;  4FJG A;  3I8D A;  2IGI A;  4HCC A;  1VSK A;  3DRR A;  1YTA A;  1XI1 A;  3TWH A;  4BE1 A;  4J2D A;  1C1B A;  2D0B A;  4CHQ A;  2OPS A;  1KLN A;  2OZM A;  4FJL A;  2XRI A;  4FJI A;  3SV3 A;  4O4G A;  1WN7 A;  5EU7 A;  3OYH A;  3V9Z A;  1MU2 A;  1S1T A;  4KO0 A;  4E7J A;  3VQ7 A;  3SQ2 A;  1LWE A;  4KRE A;  3WNE A;  1NOY A;  5KI6 A;  3SUP A;  4Z4F A;  4CJ4 A;  4O44 A;  5HRP A;  2YHB A;  4DU1 A;  4CED A;  4RG8 A;  4E1N A;  2W42 A;  4BE2 A;  4FW2 A;  4M3Z A;  1X1P A;  1ZBU A;  4CIG A;  3KLH A;  1QS4 A;  3QIP A;  1ITG A;  1JLE A;  3L3V A;  3VQ9 A;  3V9U A;  1C0M A;  1GOA A;  3DYA A;  5KGX A;  2EX3 A;  2KQ2 A;  3DRS A;  1J53 A;  1B9F A;  3LPU A;  4CJQ A;  3M8R A;  3OYG A;  1N5Y A;  4L8R B;  4BAC A;  1S1V A;  4LH5 A;  4CFB A;  4HHT A;  4FCY A;  3SCX A;  5J2Q A;  3FFI A;  3IRX A;  5DK5 A;  4Q5V A;  2RPI A;  1VSJ A;  3LZJ A;  4FXD A;  5KRT A;  3DLG A;  2A1S A;  3O4N A;  3IG1 A;  4DMN A;  2FBX A;  4B9L A;  1BCM A;  5J2N A;  4FJH A;  4LSN A;  2DY4 A;  1VRU A;  2GBZ A;  1U45 A;  4KHQ A;  3NGI A;  4LH4 A;  1BCO A;  1S1U A;  3HO1 A;  4Z4C A;  1RTH A;  3NH2 A;  1WSI A;  4DQS A;  2BE2 A;  1W0H A;  1EKE A;  5J2M A;  3TAB A;  1KFD A;  3DLB A;  4KI6 A;  4CJR A;  2XHB A;  1QE1 A;  4JS4 A;  2Z1J A;  1T05 A;  4FJ9 A;  4O0J A;  3LDS A;  4CHZ A;  3JSM A;  2AJQ A;  1WAJ A;  1CZ9 A;  4GMJ B;  3NGZ A;  1KLM A;  4IKF A;  4CJS A;  4OKJ A;  3VA0 A;  3H08 A;  4B3O A;  4M3T A;  3AVC A;  4J2E A;  2E6M A;  3S9H A;  1WSH A;  3T1A A;  4KHU A;  3TAN A;  4M42 A;  5HRN A;  3DLE A;  2HHV A;  5C24 A;  1FKO A;  2R7Y A;  3O3G A;  1TKZ A;  1JXE A;  2BAN A;  1VSI A;  5J1E A;  4FLW A;  3QEW A;  3SPZ A;  2ZD1 A;  3KLG A;  1A5W A;  4B9V A;  4RW6 A;  3OVN A;  3V1R A;  2A1R A;  4WE1 A;  4AHV A;  4IG3 A;  3NF8 A;  1JXB A;  5SWM A;  3LP0 A;  4CER A;  4B9S A;  1TAU A;  4FK2 A;  4M3U A;  3ZT2 A;  4E89 A;  3NGY A;  3SPY A;  3ZSV A;  5JS2 A;  3MEG A;  4CGH A;  3S3M A;  3CFP A;  3QEP A;  3L3U A;  1X9W A;  3ITH A;  4CEQ A;  3LP3 A;  3KK2 A;  4OGC A;  3SV4 A;  4DWI A;  1HYZ A;  3MXI A;  4CK1 A;  1HNI A;  1HJR A;  4MQ3 A;  3G10 A;  4DTM A;  4JRQ A;  3SZ2 A;  3RRH A;  1JLB A;  3V81 A;  3OYB A;  3DI6 A;  4E3S A;  2XY6 A;  1SKR A;  4EP4 A;  1BGX T;  2HHT A;  1ASV A;  3KKR A;  5CZ2 A;  4Z0U A;  4B8A B;  1G15 A;  5DMR A;  3LWM A;  4N56 A;  2D0C A;  1KFS A;  4I7F A;  1A5V A;  3K5N A;  2HND A;  3AVL A;  4NYN A;  3D0P A;  3V9S A;  3PY8 A;  3HVT A;  2G8H A;  3TAM A;  3AA3 A;  4M41 A;  3S3O A;  1RT7 A;  3V4I A;  1BIZ A;  1C1C A;  2B4J A;  1BI4 A;  1CXQ A;  4N5S A;  3HPG A;  1L3S A;  3RMD A;  2PYL A;  3LP2 A;  4HVJ A;  3RMB A;  1TK0 A;  4KB1 A;  3AA2 A;  4CK3 A;  2ITG A;  4LY7 A;  3OYM A;  1BIU A;  3HT3 A;  4QAG A;  5J2P A;  4CEA A;  3TAR A;  2OYQ A;  3NF6 A;  3SUO A;  1L3T A;  2PY5 A;  3QER A;  2HHS A;  2F96 A;  3OS0 A;  3LAL A;  3QEI A;  3CYM A;  4OGE A;  3C95 A;  3DLR A;  1EX4 A;  3L2V A;  1NJW A;  4IFY A;  4XIU A;  4CEE A;  1LWF A;  3HP6 A;  1I39 A;  2OPP A;  4OPJ A;  4KRF A;  3DMJ A;  4M3R A;  1NK7 A;  1TL1 A;  3VA3 A;  3AA5 X;  3TAQ A;  2X6S A;  4CEB A;  1VSF A;  2RKI A;  2X74 A;  5FDL A;  1RDB A;  1IH7 A;  4K8X A;  4DTN A;  1KVC A;  3O4Q A;  5C25 A;  1LWC A;  1U48 A;  1X9M A;  4C8K A;  3IS9 A;  2FBT A;  4CF8 A;  3QO9 A;  3KK1 A;  4ZHR A;  4DQR A;  4PUO A;  3ZSW A;  3MAQ A;  1JLQ A;  3AVM A;  1X9S A;  2GUI A;  2QKK A;  1HMV A;  3ZSZ A;  3DOL A;  3K5O A;  4G1Q A;  3ALY A;  2YKM A;  3G0Z A;  4RW7 A;  3HVR A;  5HP1 A;  1VSE A;  1IKW A;  4CF9 A;  4OLB A;  1U04 A;  2JLE A;  4M3Y A;  1RT1 A;  2HHX A;  1GOB A;  1BQN A;  1T8E A;  4C8O A;  4DQP A;  3TAP A;  1HQU A;  2ZQB A;  4FJ5 A;  1C0T A;  4FK4 A;  3NBP A;  3AVK A;  4CJU A;  4YFU A;  1FXX A;  1RT5 A;  3CM6 A;  3HST B;  3ISN C;  3M8S A;  3TI0 A;  1TKD A;  4BWJ A;  4ZTF A;  1KRP A;  2KZM A;  3VQ8 A;  4AHU A;  3WNH A;  1J9A A;  2KW4 A;  4FM2 A;  2Y1I A;  1NOZ A;  3HPH A;  4FM1 A;  1F21 A;  1TAQ A;  1VSM A;  3HXM A;  1WNS A;  1HRH A;  4DTU A;  4F2S A;  1QQC A;  3WNF A;  1KSP A;  2RF2 A;  4B9N A;  4F8R A;  3NCI A;  4KTZ A;  2X78 A;  3M8Q A;  3MEE A;  2B5J A;  3P83 D;  4E7H A;  1NK0 A;  2HHW A;  4IG0 A;  5CYQ A;  4CIE A;  4W5O A;  1QHT A;  1VSH A;  1RCH A;  3QLH A;  4W5T A;  1RT2 A;  2YNH A;  3OYL A;  3AVI A;  3ZSQ A;  4IFV A;  1LAV A;  2HNZ A;  4CJT A;  3NE6 A;  3D45 A;  1U49 A;  4EP5 A;  1BQM A;  3V1O A;  1RNH A;  4CGD A;  4CJW A;  2VG7 A;  1GOC A;  1FK9 A;  4O55 A;  4JRP A;  5CZ1 A;  2YNI A;  3DLK A;  1UA1 A;  1B92 A;  4PA1 A;  1NJY A;  4Q0B A;  2DFH A;  4BDY A;  1VSL A;  4FJM A;  3L2U A;  5CYM A;  3KD5 E;  4OLA A;  4EZ6 A;  1RTI A;  4Y1D A;  1ZBL A;  4QOZ B;  2XY5 A;  2IDO A;  2GV9 A;  3KTQ A;  4N41 A;  4FJK A;  1TVR A;  2XO7 A;  1BHL A;  4Z4H A;  3ULD A;  3RMC A;  1YVU A;  1CXU A;  2XY7 A;  2FBY A;  2F8T A;  3RTV A;  2IS3 A;  1TKT A;  3AO5 A;  3BGR A;  4CFC A;  3V6D A;  3SJJ A;  1RIL A;  4C8N A;  4GW6 A;  2BGG A;  3ASM A;  3PX0 A;  3LZI A;  4DSJ A;  3CM5 A;  4DSK A;  4F4K A;  3RRG A;  4FJX A;  1S9G A;  3K5M A;  4E1M A;  3CFR A;  1TV6 A;  4DTJ A;  1SKS A;  3T19 A;  4W5Q A;  3OYN A;  1R0A A;  1NK5 A;  1RDC A;  3AVG A;  3HL8 A;  4KHS A;  4F3T A;  1I3A A;  3KIO A;  3OJS A;  4FZY A;  3ZSR A;  1Z25 A;  3AVH A;  2NUB A;  3C6U A;  1RT4 A;  3ZT0 A;  1WSG A;  2G8U A;  2ETJ A;  1SV5 A;  3KK3 A;  3CFO A;  4KV8 A;  3DM2 A;  4ELT A;  3UIQ A;  4NCB A;  5HLF A;  2VG6 A;  4CHY A;  4KHN A;  1EXQ A;  1WLJ A;  4FW1 A;  1QSY A;  1KVA A;  1TL3 A;  4H8K A;  3DRP A;  2HMI A;  1UOC A;  4FYD A;  3AVJ A;  2HB5 A;  4CF2 A;  2E4L A;  1NK9 A;  2KFN A;  4ELV A;  4CEF A;  4HTU A;  4KAZ A;  3KLE A;  1C0U A;  3HK2 A;  2G8F A;  1RBS A;  4KHY A;  2FC0 A;  3T3F A;  4NCG A;  1RT3 A;  4OKK A; 
#chains in the Genus database with same CATH topology
 2HW3 A;  4FJ8 A;  4XH1 A;  1ZBH A;  4MDB A;  2KZZ A;  1UWB A;  3SQ4 A;  4CE9 A;  3KD1 E;  1LAW A;  1NGA A;  2Q2R A;  3CF5 L;  3OJU A;  3CJA A;  3EE9 A;  4RW8 A;  3L2Q A;  1D5A A;  4CZG A;  4CJ3 A;  2OA8 A;  3F5T A;  2H3G X;  4H03 B;  4WQ5 A;  5HOO A;  4B3R K;  3CME N;  3TAG A;  4NLC A;  4BRF A;  3D2E A;  3FLC O;  2O8B A;  1EWR A;  4FWM A;  3A5N C;  5TKY A;  5LL6 Z;  3AO1 A;  3ZT1 A;  5AR0 A;  4BR9 A;  3HM9 A;  5AQX A;  1SL0 A;  2PYJ A;  2ITM A;  4H4M A;  5FRN A;  2E20 A;  3R1X A;  3DXK B;  2YNF A;  3I8B A;  3AAR A;  3O3F A;  2UU9 K;  2I5J A;  2I7N A;  4OPH A;  4WFB L;  3J8A A;  1FW6 A;  4DFM A;  2Q0R A;  1NKE A;  1O1W A;  2OPQ A;  3ZET A;  1QVF M;  1BIS A;  1NKB A;  1ATR A;  2HVI A;  3U6F A;  2AA4 A;  4TSX A;  5AQU A;  5D3G A;  1EO1 A;  3ZCM A;  1VRT A;  4GNI A;  2Z1H A;  2O8F A;  5F2R A;  3F9M A;  3KJV A;  2O8C A;  5FPN A;  4KH5 A;  4DV5 K;  3CQY A;  1LV5 A;  3L2W A;  2ZJQ L;  4Z4G A;  1EQY A;  3TU5 A;  3QEP A;  4DU4 A;  2X6N A;  3P1G A;  5E41 A;  4OPK A;  4FZZ A;  1HPM A;  1KQS M;  3BP8 A;  1NGC A;  4EZ9 A;  1SL1 A;  3OYD A;  1KCF A;  2NRR A;  5I9E B;  3I0R A;  4KFB A;  4DF4 A;  4CZL A;  5CY4 A;  1HYV A;  2GX9 A;  1S6Q A;  4ELU A;  4HUG A;  4JS5 A;  1ZBF A;  3O1B A;  1RGI A;  1N32 K;  1KAZ A;  2HF4 A;  2KFZ A;  3LDP A;  4DSE A;  5C2F A;  4CZH A;  1RDD A;  3FZL A;  4BDZ A;  3CD6 N;  1P8Z A;  4DU3 A;  4CD3 A;  4JKF A;  1S5J A;  4E19 A;  2WOM A;  4DHY A;  3VQ5 A;  5BRH A;  3TAF A;  4J2B A;  3ENO A;  1BG3 A;  4E0D A;  4R5P A;  4IBN A;  1OH6 A;  4B9M A;  1C0G A;  3ZT3 A;  4BC5 A;  4O5B A;  3L0Q A;  3EN9 A;  4YDU C;  2HBM A;  4CEO A;  2DFE A;  2IAJ A;  3V9X A;  3SYZ A;  4BVP A;  2HVH A;  1KTQ A;  4A5B A;  4B1X B;  1D4X A;  1RFQ A;  4HUE A;  4E7I A;  4FM0 A;  3S3N A;  2AP1 A;  4MLH A;  1VQ7 N;  4DQQ A;  3AO4 A;  3L8B A;  4DSF A;  2P9L B;  1TK8 A;  2P5O A;  4BG9 A;  1EP4 A;  1LW2 A;  3VEV A;  4FLT A;  4M3X A;  5HBM A;  1DLO A;  3FFK B;  2YKN A;  5AQL A;  3FE1 A;  4DS5 A;  4JLH A;  1WSF A;  3ZSY A;  3HOT A;  2B6A A;  3FR0 A;  4JKH A;  4KBO A;  5KGW A;  5AQR A;  1J5O A;  2E2N A;  3OYF A;  1XWL A;  3AO2 A;  5KRS A;  3QNO A;  1IBL K;  4CF1 A;  4YOY A;  4B8C A;  2UUA K;  3I8D A;  1VSK A;  1YTA A;  2D0O A;  3EKS A;  4IOA L;  5C0Y A;  2IVN A;  4Z94 A;  4FJI A;  4YDU A;  4O4G A;  3C65 A;  5EU7 A;  1OVY A;  3KWI A;  3V9Z A;  1MU2 A;  1S1T A;  1Q86 O;  4KRE A;  1LWE A;  4LF8 K;  3WNE A;  4CJ4 A;  3M5R A;  3O08 A;  4O44 A;  4JKD A;  5HRP A;  2YHB A;  2YHY A;  3CER A;  4X64 K;  1X1P A;  3VEY A;  3KLH A;  1QS4 A;  3QIP A;  1ITG A;  3MX2 A;  1GOA A;  3D2F B;  3DYA A;  2KQ2 A;  4BRE A;  1J53 A;  5BN8 A;  4CJQ A;  3M8R A;  3OYG A;  4L8R B;  1NGD A;  1S1V A;  4FCY A;  3A8Y A;  5DK5 A;  5J2Q A;  4FVU A;  2RPI A;  1VSJ A;  2F9T A;  5KRT A;  2A1S A;  3O4N A;  4DMN A;  5F1X A;  1HNX K;  4B9L A;  2P9S A;  4UY8 O;  4G9Z A;  5J2N A;  5EX5 A;  4GV9 A;  1BCO A;  5AFU A;  5LJV A;  1NGJ A;  4CJR A;  4PL8 A;  1QE1 A;  3T7Z A;  1BDG A;  2I7P A;  1WBB A;  1GLF O;  3K0S A;  5H1S Q;  4GMJ B;  5AQN A;  1KLM A;  5KPT A;  3VER A;  4FLW A;  3SPZ A;  1R59 O;  3KLG A;  1X9J A;  4B9S A;  1JXB A;  3SPY A;  1NG9 A;  4IOX A;  3WXK A;  1X9W A;  5M1Q A;  1K8A O;  3KK2 A;  5AQO A;  1HNI A;  4DTM A;  2V51 B;  3SZ2 A;  3OYB A;  5AZJ A;  1E4G T;  3UB5 A;  5IWA K;  4O8K A;  4B8A B;  3I33 A;  1KFS A;  3VES A;  1A5V A;  3D0P A;  2HND A;  4NYN A;  3HVT A;  4EAH D;  1RT7 A;  3GG4 A;  1BIZ A;  4N5S A;  4FWP A;  4HVJ A;  3RMB A;  2ITG A;  4QAG A;  4H0T B;  5J2P A;  2NZT A;  3Q7C A;  2HST A;  1L3T A;  2PY5 A;  1SQK A;  2HHS A;  3LAL A;  4CZI A;  3QEI A;  3DXK A;  4OGE A;  3DLR A;  1EX4 A;  1NJW A;  4IFY A;  5EOY A;  1JCF A;  2OPP A;  4BVO A;  5AJ3 K;  3DMJ A;  3WQU A;  3EO3 A;  1IH7 A;  4C8K A;  4CF8 A;  3QO9 A;  3ZSW A;  1JLQ A;  3H45 C;  1X9S A;  2GUI A;  1HMV A;  3ZSZ A;  1XNQ K;  4G1Q A;  3HVR A;  1VSE A;  1U04 A;  1QQO A;  2JLE A;  1NGG A;  1GOB A;  1BQN A;  4DV7 K;  3P38 A;  4DV6 K;  4DQP A;  3TAP A;  4FJ5 A;  4FK4 A;  1C0T A;  5AQM A;  3M8S A;  3MCA B;  3MN5 A;  5AQJ A;  3PIP L;  2RE2 A;  3J80 O;  1J9A A;  1VQO N;  4BY9 C;  4DTU A;  3SJH A;  1KSP A;  1NMD A;  2RF2 A;  2O8F B;  3MN7 A;  1M1K O;  3NCI A;  2X78 A;  3MEE A;  4B1V A;  3THY A;  4E7H A;  3IMX A;  4IO8 A;  1MA9 B;  4IG0 A;  2NRH A;  3LDN A;  3DXM A;  1VSH A;  2Q1N A;  2YNH A;  1LAV A;  1SZ2 A;  3HTV A;  3D45 A;  4H5R A;  4BG8 A;  3V1O A;  4CGD A;  4CJW A;  2VG7 A;  5CZ1 A;  4JI2 K;  1NJY A;  4BDY A;  1T6D A;  2ASM A;  2IDO A;  2GV9 A;  3QFP A;  1XQS C;  1TVR A;  4Z4H A;  3RMC A;  3SBG A;  3O8M A;  1CXU A;  2XY7 A;  3RTV A;  3ASM A;  4FJX A;  3CFR A;  4DTJ A;  3VTH A;  3C6H A;  4QS7 A;  3T19 A;  3CMA N;  3AVG A;  1I3A A;  3KIO A;  2A41 A;  3AVH A;  3MCP A;  3ZT0 A;  4AQY K;  2ETJ A;  3DM2 A;  4NCB A;  3LDQ A;  4KHN A;  3H3O B;  1IG8 A;  1QSY A;  1KC8 O;  1KVA A;  3VEN A;  2HMI A;  4FYD A;  4LF6 K;  4GKJ K;  2E4L A;  2KFN A;  4DUY K;  3MN9 A;  4ELV A;  3O9S A;  3VGM A;  1IV0 A;  3MWP A;  1RBS A;  4NCG A;  4HTL A;  2CGK A;  4FJ7 A;  2OTJ N;  4RW4 A;  4A61 A;  4CJK A;  2KTQ A;  2CGJ A;  2FSJ A;  3K59 A;  4C1N K;  3OYE A;  4CGF A;  2PZS A;  3QES A;  1RTJ A;  4ICL A;  3KVG A;  2QW9 A;  2XY8 A;  5AQF A;  4IJA A;  2IVP A;  3LAK A;  3U4L A;  4A59 A;  5FPD A;  3CCJ N;  1JLC A;  4YNQ A;  1NK8 A;  5SZT A;  3QEV A;  3CCS N;  3U9D A;  1IKY A;  4FO0 A;  3U3G A;  4DTR A;  1WSE A;  4I9L A;  2WBN A;  2P1J A;  5GAH P;  5C10 A;  4ID1 A;  4M7X A;  4IDK A;  2Z1I A;  2GEL A;  2DFF A;  3HP9 A;  4U7B A;  3THW B;  2ZF5 O;  1TGO A;  3QET A;  5AQS A;  3TTC A;  3R9P A;  4YY3 K;  2WUS A;  1HNZ K;  5KTQ A;  1ZXO A;  2Y1J A;  1K8K A;  4DTP A;  4AHT A;  1GLJ O;  4FZX C;  3D2F A;  4BC4 A;  3T69 A;  3U3Y A;  3LP1 A;  5I42 A;  4DSL A;  3AVF A;  1IKV A;  3HZ6 A;  3J7A P;  2GTD A;  4IJN A;  3VQP A;  2BDP A;  1QTM A;  4FJN A;  3OYC A;  1T03 A;  1QSS A;  4M3W A;  2E5L K;  1JLA A;  3ZT4 A;  4KB0 A;  3HYF A;  3ZSX A;  1S6P A;  4O0I A;  3K5L A;  5GAG P;  3K57 A;  3EL2 A;  1HNV A;  3OBY A;  4PQU A;  2QK9 A;  4NXN K;  3MMV A;  3OHR A;  3NF7 A;  4DTO A;  4A5A A;  4KHP K;  2W41 A;  3RWU A;  4CI6 A;  3ZSO A;  4CJE A;  2HBL A;  4I2Q A;  1JLG A;  3U8X A;  3NF9 A;  4DFP A;  1NNE A;  3PLA A;  4BRO A;  3PIO L;  2P5G A;  1D9F A;  2P9I A;  3PV8 A;  4FVM A;  1S1X A;  4IZ9 A;  3THV A;  4DKW A;  3ENH A;  1XC3 A;  4KH4 A;  3H1V X;  1RBV A;  4BC3 A;  3SI6 A;  1ZBI A;  3M8P A;  3EZ5 A;  1HPZ A;  5T7B A;  1IO2 A;  2G8I A;  4ID5 A;  1N6Q A;  4A2A A;  1K6Y A;  1EET A;  4NB4 A;  1XHX A;  3OYJ A;  3HJF A;  2QA4 N;  2FLO A;  4AIL C;  4GV3 A;  1WAF A;  1T7P A;  3NAE A;  3VF2 A;  2VCP A;  4JI4 K;  3C6T A;  3CQ8 A;  3AVB A;  2VQF K;  3MXJ A;  4DFK A;  1VK0 A;  3I0S A;  1VQK N;  5AZJ B;  1NM1 A;  1CZB A;  1QZ5 A;  4HUF A;  1NK4 A;  3VQ6 A;  1LCU A;  5LMU K;  4DV1 K;  1QQM A;  4C8L A;  4FWO A;  1BOT O;  1VQ6 N;  4CGG A;  5C42 A;  1S1W A;  3PUF A;  4PKG A;  1OVQ A;  2NNW A;  1ESV A;  1S3X A;  1UAX A;  5JMV A;  4DFJ A;  4KTW A;  4UQG A;  3PX6 A;  3CG7 A;  1W7A A;  4JYA K;  1JL1 A;  4H0Y B;  2HNY A;  3VQA A;  4BR5 A;  5LMN K;  1U2V A;  2D0A A;  1IKX A;  1UA0 A;  1X3M A;  2Q31 A;  4EFH A;  2YV0 X;  2E1Y A;  4J2A A;  1TUY A;  3QIC A;  3TR8 A;  1ATN A;  4CF0 A;  3SAG A;  4BR7 A;  4HCC A;  3DRR A;  1I94 K;  1XI1 A;  4J2D A;  4J8F A;  2D0B A;  2OPS A;  1XMO K;  1MWK A;  2E2Q A;  3TTF A;  3VQ7 A;  3Q7B A;  4Z4F A;  5JLF A;  2W42 A;  3EKU A;  4L3Q A;  2CH5 A;  4IFE A;  5E84 A;  3P31 A;  1VQM N;  4NO7 A;  2QWN A;  4YHH K;  5AQH A;  3QBX A;  1B9F A;  3LPU A;  1N33 K;  4FXD A;  1WUA A;  4WQ4 C;  4H5T A;  1HKB A;  3DLG A;  3IG1 A;  3THY B;  2FBX A;  4JI6 K;  4QS8 A;  1BCM A;  3O4W A;  4B3T K;  3DXM B;  2GBZ A;  1S1U A;  4DQS A;  2BE2 A;  1W0H A;  1YI2 N;  5J2M A;  3TAB A;  4AM7 A;  4DV2 K;  4WYB A;  4OPA A;  2F9W A;  1T05 A;  4FJ9 A;  1N36 K;  3LDS A;  2CH6 A;  4JN4 A;  1SAZ A;  2F4V K;  3SAF A;  4OKJ A;  3VA0 A;  3H08 A;  4B3O A;  4M3T A;  3AVC A;  4J2E A;  2BH1 A;  2YJF A;  3T1A A;  2ZJR L;  3O3G A;  2BAN A;  3QEW A;  5J1E A;  1A5W A;  4RW6 A;  2D0P A;  2P9K A;  2A1R A;  4WE1 A;  2E2P A;  5SWM A;  2OTL N;  4CER A;  4BR0 A;  4FK2 A;  1TAU A;  3ZT2 A;  4JI3 K;  3LL3 A;  1DT9 A;  3S3M A;  3MEG A;  3CFP A;  2HHH K;  4JI8 K;  4OGC A;  3HBT A;  5AQT A;  4MQ3 A;  4JKB A;  3V81 A;  3VF4 A;  3N4P A;  3E9O A;  1SKR A;  1O13 A;  3ID8 A;  4A62 A;  4EP4 A;  2A5X A;  2XY6 A;  4H0O A;  5AQZ A;  1ASV A;  1VAZ A;  5CZ2 A;  1YJN N;  5DMR A;  3K5N A;  4FWK A;  4BRG A;  3GBT A;  2G8H A;  3TAM A;  3AA3 A;  1HKC A;  3V4I A;  1BI4 A;  3LP2 A;  1VQ5 N;  4BRC A;  3AA2 A;  4JKG A;  4CK3 A;  4LY7 A;  3HT3 A;  1Q82 O;  1GLA G;  2KLA A;  2UYT A;  3TAR A;  1OH5 A;  1QVG M;  4B1W B;  2ASO A;  3CYM A;  1VQL N;  1LWF A;  4KRF A;  4M63 C;  2GWK A;  3QBW A;  3THW A;  5M1K A;  1TL1 A;  1YF5 L;  1GLC G;  4CEB A;  2QWP A;  1RDB A;  3WT0 A;  4DTN A;  4DR3 K;  1U48 A;  3O1W A;  1X9M A;  3CC7 N;  3IS9 A;  4DQR A;  3MAQ A;  4IWV A;  3AVM A;  1YIT N;  4JI5 K;  3CC4 N;  4X66 K;  4RW7 A;  5HP1 A;  4CF9 A;  3JS6 A;  3VMF B;  1T8E A;  4B1Y B;  1HQU A;  2ZQB A;  3GOI A;  3HST B;  3TI0 A;  3ISN C;  2JWL A;  4O8U A;  1U6Z A;  1KRP A;  2KZM A;  1K8K B;  3VQ8 A;  4AHU A;  5M1F A;  4CZE A;  5BPM A;  4FM2 A;  2Y1I A;  1NOZ A;  4F9O A;  4C1N I;  3CQX A;  1F21 A;  4FM1 A;  1TAQ A;  1VSM A;  3O80 A;  1WNS A;  3ZEU A;  1HRH A;  2GUP A;  3VEW A;  4IO9 L;  4DR7 K;  1QQC A;  3WNF A;  5ADX H;  3P4I A;  4KTZ A;  1HJO A;  2B5J A;  3P83 D;  4BGA A;  3ATU A;  1J5E K;  5F0X A;  4BRP A;  4CIE A;  1QHT A;  3QLH A;  5DM6 L;  2RHK A;  1RDW X;  3ZSQ A;  3H6E A;  3AGR A;  3FZM A;  2HNZ A;  3L4Q A;  4CJT A;  1BUP A;  1BQM A;  2NRZ A;  3CPE A;  5AQK A;  1GOC A;  4BC2 A;  2HBJ A;  4Q0B A;  2DFH A;  4FJM A;  5CYM A;  4OLA A;  1RTI A;  2XY5 A;  3J7Y P;  4N41 A;  4LFC K;  4FJK A;  4DR4 K;  3ULD A;  2FBY A;  2F8T A;  3AO5 A;  3B8A X;  3V6D A;  2BGG A;  2O8E A;  4C8N A;  3PX0 A;  3LZI A;  4DSJ A;  4F4K A;  3RRG A;  1S9G A;  4E1M A;  2P9I B;  5HL7 L;  4RWT A;  4ISF A;  3WQT A;  1Q18 A;  3MX5 A;  2G8U A;  1WSG A;  3KK3 A;  1SV5 A;  4JAX A;  1JCE A;  5HLF A;  1EXQ A;  3UE5 A;  1S22 A;  1N34 K;  2WC9 A;  1FJG K;  4V19 S;  3VTI A;  3QFU A;  3KLE A;  1GLB G;  3CCM N;  3HK2 A;  3CJ7 A;  2G8F A;  2QTD A;  3WXJ A;  4KHY A;  4GVE A;  3T3F A;  4OKK A;  3OTO K;  1BL3 A;  3P5J A;  1ASU A;  4PKI A;  4DQI A;  5HRS A;  4QCL A;  2P9P B;  4MO5 A;  5BRF A;  4LC9 B;  3IUC A;  4DLE A;  4ZTJ A;  2HHQ A;  3G25 A;  3F73 A;  1KVB A;  3BUZ B;  3J7Z O;  1YAG A;  1C1A A;  2WON A;  4H4O A;  1LW0 A;  3SUQ A;  2NRW A;  4WFN L;  4LF9 K;  5GAE P;  4JD2 A;  2NRT A;  2DTU A;  3NDK A;  5M1P A;  4OVL A;  3O9T A;  4E7L A;  2UXC K;  3A5L C;  4CES A;  2KHO A;  2HOE A;  4BRD A;  3MXM A;  1GLE G;  3V9W A;  2ZJP L;  1YT3 A;  2QWR A;  3MWT A;  4GVM A;  3LWL A;  1HQE A;  2O4I A;  2P9N A;  4QS9 A;  4BGB A;  3DJC A;  3LDL A;  5BRE A;  1U2V B;  4F2R A;  3TSQ A;  1A5X A;  1GLL O;  4Z4E A;  3AA4 A;  1REV A;  4B9Q A;  3FZF A;  2QWO A;  4CJ7 A;  2QKB A;  2FSN A;  3F9K A;  4DCH A;  2ZE2 A;  4H0P A;  4IDH A;  4AF1 A;  2V52 B;  4PY5 A;  2LSN A;  3B6P A;  5JVG L;  4KPY A;  3FGU A;  3DAW A;  3LPT A;  3FZK A;  1QHA A;  4JKA A;  3TSU A;  4JI7 K;  4DV4 K;  1HYS A;  3UKU A;  1U4B A;  3L6Q A;  3L4I A;  3I56 N;  4N47 A;  5HRO A;  3ATV A;  5CR4 A;  4BE0 A;  4Z4I A;  2RN2 A;  1NK6 A;  1DTT A;  1VQN N;  3VN5 A;  1ILY A;  4B08 A;  1C6V A;  4BR2 A;  5GIO A;  2JGU A;  3JXU A;  3RR7 A;  2VWJ A;  5LY3 A;  1IJJ A;  4W5R A;  3KK7 A;  1NGE A;  1U47 A;  5M1N A;  5C12 A;  3MN6 A;  4K0K K;  1IBM K;  3VEX A;  1DGK N;  2F8S A;  3C94 A;  3ZX0 A;  5CE3 A;  4H0V B;  5AQG A;  3LM9 A;  4H5V A;  1JKH A;  3VQ4 A;  4DTS A;  5C15 A;  4FPB A;  3EYZ A;  2Q3S A;  3PO4 A;  1YHQ N;  5AQY A;  3CJ9 A;  3CCL N;  4KKO A;  4BWM A;  4DR2 K;  3QB0 A;  1W9H A;  3VQE A;  3SLC A;  3S41 A;  2QXL A;  3SQ0 A;  5GIN A;  4AHC A;  1NKC A;  1NGH A;  4BR4 A;  4BDP A;  3WNG A;  4C8M A;  4FLY A;  4PWD A;  4NXM K;  2FF6 A;  2YX6 A;  3ZYY X;  1ZYQ A;  2P9K B;  4CW7 B;  4KI4 A;  1X3N A;  2ATQ A;  3DOK A;  1K9M O;  3HI0 A;  5B8H A;  2D1K A;  4CZK A;  3VF6 A;  3W3D A;  3HPO A;  5FRM A;  1TKX A;  1DTQ A;  3NHG A;  2NRV A;  4CGI A;  4FK0 A;  4K43 A;  4YOX A;  4NCA A;  3VQC A;  4I2P A;  5HRR A;  1V4S A;  4WCE L;  3QIO A;  3AAQ A;  2A3Z A;  1ASW A;  2V7Z A;  3OBW A;  3OY9 A;  1FKP A;  3B6O A;  3GDQ A;  3THX A;  3LAM A;  2VG5 A;  3AVA A;  3DLH A;  2G8K A;  3T1H K;  4CD1 A;  4DLG A;  2UXB K;  1NU0 A;  1BI4 B;  1CLQ A;  4CEC A;  2YHA A;  4MDA A;  1NJZ A;  3BF1 A;  2D5R A;  4JKG B;  5K14 A;  1RBR A;  2E6L A;  2BTF A;  4LSL A;  4CBU A;  2F7T A;  4B1U B;  3VGL A;  3QML A;  4IXC A;  3RMA A;  5KPZ A;  2Z1G A;  5BR8 K;  4K8Z A;  1RBU A;  3V1Q A;  3A2F A;  1SUQ A;  1YTU A;  5AZI A;  4LF5 K;  4KTQ A;  4YOR A;  3E01 A;  3ENB A;  4RCH A;  4FLX A;  1XHZ A;  3KLI A;  4FJG A;  4DF8 A;  3MEC A;  4DTX A;  5C2D A;  2IGI A;  1XMQ K;  3TWH A;  4BE1 A;  4CHQ A;  2XRI A;  1V4T A;  3SV3 A;  4JKC A;  4KO0 A;  3SQ2 A;  3IKM A;  3SUP A;  1OH7 A;  3C0B A;  3E9P A;  3FZH A;  4RG8 A;  3BF3 A;  3T1Y K;  4FW2 A;  1ZBU A;  4BQL A;  4CBX A;  3L3V A;  1BU6 O;  1C0M A;  5KGX A;  2EX3 A;  4FOI A;  3CI5 A;  3ZEU B;  4BAC A;  3SCX A;  3FFI A;  2D4W A;  3VET A;  1NGF A;  3AAP A;  3O9Q A;  1YJW N;  4BRK A;  3IDH A;  2A6A A;  1W2B M;  1WBD A;  4FJH A;  3R3L A;  1VRU A;  5BPL A;  4KHQ A;  4LH4 A;  3HO1 A;  4Z4C A;  1RTH A;  3M3Z A;  3NH2 A;  1J6Z A;  5AQP A;  1EKE A;  3WXM B;  1KFD A;  3DLB A;  5ADX A;  3E1Y A;  1T6C A;  2YCH A;  1VQP N;  2Z1J A;  3CCV N;  3TSP A;  4B3S K;  5AQV A;  4IKF A;  5A2Q O;  4JHD A;  5GIP A;  3EEQ A;  5FPE A;  3S9H A;  3N4Q A;  5HRN A;  2O8E B;  2HHV A;  1GLD G;  5C24 A;  1FKO A;  4IEE A;  1TKZ A;  1JXE A;  3ULE B;  1HNW K;  4H0X B;  1NLV A;  4I6M A;  4B9V A;  2GWJ A;  3OVN A;  3A5O C;  4H5N A;  3NF8 A;  2P9U A;  3WXL A;  4E89 A;  3NGY A;  3ZSV A;  3BZK A;  5JS2 A;  4CGH A;  3L3U A;  3ITH A;  4CEQ A;  1T3V A;  1E4F T;  4DWI A;  3MXI A;  4CK1 A;  2P9P A;  3G10 A;  1Q81 O;  3MDQ A;  3RRH A;  3DI6 A;  4XEI A;  3VEO A;  2HHT A;  2OAN A;  3KKR A;  4IEI A;  3O6W A;  3G4S N;  2KKZ A;  2YI1 A;  4N56 A;  2D0C A;  2JWK A;  3V9S A;  3PY8 A;  3C7N A;  4M41 A;  3S3O A;  1E3M A;  2EWS A;  1C1C A;  2B4J A;  1CXQ A;  3HPG A;  4B3M K;  4ISE A;  3RMD A;  2PYL A;  3O9U A;  3HRG A;  1BIU A;  3G71 N;  3M1F A;  1BA0 A;  2OYQ A;  3SUO A;  2QWM A;  3QER A;  1VHX A;  4JD2 B;  2F96 A;  4LFB K;  4ILH A;  3C95 A;  3CJC A;  3QDK A;  3E9L A;  1YXQ A;  4XIU A;  4CEE A;  3HP6 A;  3O9R A;  4M3R A;  1NK7 A;  3TAQ A;  3WEE A;  2X6S A;  2RKI A;  5FDL A;  4K8X A;  1KVC A;  3O4Q A;  3R6M A;  4DV3 K;  4JI1 K;  4ILG B;  2FBT A;  3LM2 A;  3KK1 A;  4PUO A;  2P9N B;  2ZWH A;  3PSI A;  2YHW A;  3DOL A;  1HKG A;  4B1Z A;  3ALY A;  2YKM A;  3G0Z A;  1IKW A;  4OLB A;  2IIR A;  1RT1 A;  4C8O A;  3CCE N;  4PL7 A;  3AY9 A;  3NBP A;  4CJU A;  1RT5 A;  3CM6 A;  2FXU A;  4A57 A;  2PAV A;  2O8D A;  1TYQ B;  3SK3 A;  4ZTF A;  2GEM A;  4BRL A;  1S72 N;  4GV6 A;  4FL9 A;  1QQN A;  3HPH A;  4BQZ A;  2V7Y A;  3UKU B;  1KXP A;  3M8Q A;  3NMU A;  3JAM O;  1NK0 A;  2HHW A;  5CYQ A;  4W5T A;  3OYL A;  4DV0 K;  3VPZ A;  3P39 A;  4K25 A;  4O55 A;  3A0I X;  4K42 A;  2YNI A;  3DLK A;  1UA1 A;  1B92 A;  1VSL A;  2WTU A;  4EZ6 A;  4Y1D A;  4DR6 K;  4QOZ B;  1KAX A;  4PKH A;  4GKK K;  3W0L A;  1BHL A;  3PSF A;  3RVC A;  3D7E O;  3BGR A;  4EHU A;  4GW6 A;  3K5M A;  1R0A A;  1NJI O;  5TKW A;  3BEX A;  3RSE A;  3CCQ N;  3ZSR A;  1Z25 A;  3C6U A;  1RT4 A;  4WQ4 A;  3UIQ A;  1WLJ A;  4FW1 A;  4O5F A;  3DRP A;  1UOC A;  4CF2 A;  2HB5 A;  4FWQ A;  2PBD A;  4YOT A;  4CEF A;  4HTU A;  1NWK A;  4KAZ A;  1C0U A;  4XH4 A;  2ASP A;  1WB9 A;  3TTD A;  4M7Y A;  4OO1 J;  4CJP A;  3EY1 A;  4OJR A;  4E1J A;  5M1O A;  4MFB A;  2Q97 A;  3AVN A;  4PHT X;  1YJ9 N;  1YIJ N;  4F3O A;  2J4R A;  3K9K A;  4E7K A;  2OZS A;  3LAN A;  2P51 A;  1Q9Y A;  1XC9 A;  4FLZ A;  3OS2 A;  4DR1 K;  2EHG A;  5FRO A;  4CJ5 A;  3IAY A;  3I55 N;  3SAH A;  3AGK A;  4AHR A;  3THX B;  1Q9X A;  1QSL A;  1M90 O;  4YOV A;  1JCG A;  3EE8 A;  4CJV A;  4FLV A;  3VQD A;  3SNN A;  5JVH L;  4EHT A;  1ZC6 A;  1J54 A;  2CGL A;  3AO3 A;  3E66 A;  2FBV A;  4CJL A;  4RW9 A;  2VQE K;  1B9D A;  4FLU A;  1SL2 A;  1OH8 A;  2E2O A;  4NYF A;  1IG9 A;  3QEX A;  4B9U A;  3QIN A;  4AHS A;  3K2P A;  1NGI A;  4FWN A;  4FSV A;  1Q8I A;  5JS1 A;  5AZI B;  3DLL L;  4AH9 A;  1HR0 K;  1OKJ A;  5EY4 A;  5MLC Q;  3OS1 A;  2E88 A;  5E26 A;  4N76 A;  4CJF A;  1S9E A;  4W5N A;  3O5B A;  3NH0 A;  2FSK A;  1C0F A;  2VGM A;  5ELZ A;  2QI2 A;  2VWK A;  4FWL A;  3VEZ A;  3UKR A;  3PX4 A;  3ZX2 A;  4JK9 A;  3SMS A;  2IOC A;  4CFD A;  2OPR A;  3VQB A;  4X62 K;  2UUB K;  1ZBS A;  1RBT A;  3KLF A;  5BRD A;  2O4G A;  5CHI A;  3R8E A;  4BRA A;  1D9D A;  4HWI A;  4CHO A;  4CIF A;  3OYA A;  4M45 A;  4CHN A;  3O3H A;  4FJJ A;  2G8V A;  4LD0 A;  3SUN A;  2VYP A;  2G8W A;  3NVM A;  3TAE A;  4B9T A;  1G99 A;  4MLE A;  3ULE A;  3NH1 A;  3K9J A;  4CGJ A;  1L5U A;  1D8Y A;  5JLH A;  3PO5 A;  4DSI A;  4YOW A;  5I3U A;  2HHU A;  2YNG A;  4CZM A;  2ZGZ A;  4RTF D;  4JHD B;  1NJX A;  1KD1 O;  2HMP A;  4BRM A;  4CK2 A;  2DPN A;  4DG1 A;  5AQW A;  2A42 A;  1T44 A;  4CZJ A;  4I6M B;  1RTD A;  4JV5 K;  3VQQ A;  1RDU A;  2P9U B;  2OCE A;  2QXF A;  4IOC L;  4HCB A;  1RT6 A;  4CHP A;  3ID6 A;  3MED A;  2Q0U A;  3HSC A;  2UUC K;  3A5M C;  2E8A A;  4DQ8 A;  3HOS A;  3SQ1 A;  4A2B A;  3RR8 A;  4CZF A;  4U67 L;  4OKE A;  3KWG A;  5JIC A;  1VQ9 N;  4CVN E;  1JLF A;  4CFA A;  1SKW A;  3AV9 A;  4H5W A;  3QNN A;  1VQ8 N;  4DS4 A;  3BDP A;  1WSJ A;  3C7N B;  4JI0 K;  3JYT A;  4CEZ A;  1MWM A;  1JL2 A;  4Y0W A;  3NFA A;  3OYI A;  4C23 A;  2HHX A;  3KKS A;  4CCH A;  1MDU B;  3M6G A;  3K58 A;  4I9Q A;  3ZX3 A;  3SBT A;  4KHW A;  1TK5 A;  2W6L A;  2YJE A;  4Y1C A;  3J81 O;  2QEX N;  1YVN A;  1L3U A;  4LFA K;  1L3V A;  1JJ2 M;  3D2E B;  2O8B B;  1Z26 A;  4DB3 A;  3OA9 A;  1Y97 A;  3WEE B;  4CBW A;  3L2R A;  3OYK A;  2PFU A;  2YHX A;  1RDA A;  2IC3 A;  1VSD A;  1TYQ A;  4FOE A;  3VOV A;  1C1B A;  1BWF O;  1KLN A;  2OZM A;  4FJL A;  1WN7 A;  3OYH A;  4E7J A;  2BUP A;  3KHY A;  1NOY A;  5KI6 A;  5AQQ A;  4DU1 A;  4OX9 K;  4CED A;  4E1N A;  4BRN A;  2O8D B;  4M3Z A;  3ZET B;  1BA1 A;  2ZM6 K;  4CIG A;  4KH6 A;  1JLE A;  1ATS A;  3VQ9 A;  1NMN A;  3V9U A;  1TUU A;  1KAY A;  4FWS A;  3DRS A;  3CXC M;  3CCR N;  5BN9 A;  1N5Y A;  2E1Z A;  4LH5 A;  4CFB A;  4HHT A;  1NK5 A;  3IRX A;  4Q5V A;  3LZJ A;  2O8C B;  1LOT B;  4BRQ A;  3ZLJ A;  2WFB A;  1YUW A;  4LSN A;  4WF9 L;  1U45 A;  2DY4 A;  2QM1 A;  3NGI A;  3WXI A;  2FF3 B;  1WSI A;  3GL1 A;  4KI6 A;  1NBW A;  2XHB A;  5KQ8 A;  4JS4 A;  4MO4 A;  4BRH A;  1CZA N;  4O0J A;  4CHZ A;  3JSM A;  2AJQ A;  1WAJ A;  4JK8 A;  1HUX A;  1CZ9 A;  1IBK K;  5BR9 A;  3DWL A;  3NGZ A;  4CJS A;  4WFA L;  2E6M A;  1WSH A;  4KHU A;  3TAN A;  4M42 A;  3KZB A;  3DLE A;  2R7Y A;  1Q7Y O;  1VSI A;  3H1Q A;  4K41 A;  2ZD1 A;  3GE1 A;  3TPQ A;  4LF7 K;  3V1R A;  4AHV A;  4IG3 A;  3LP0 A;  4M3U A;  3RSE B;  2UXD K;  4YOU A;  2VGN A;  1H1V A;  3SMP A;  3LP3 A;  3SV4 A;  3CHW A;  1P90 A;  1HYZ A;  1HJR A;  2NLX A;  4JRQ A;  1JLB A;  1VQ4 N;  4XH5 A;  4E3S A;  1BGX T;  4Z0U A;  3OW2 M;  1G15 A;  3LWM A;  2NRX A;  5KPR A;  4X65 K;  4I7F A;  1K73 O;  3CPW M;  3CJ1 A;  3AVL A;  2HBK A;  4LF4 K;  2P9L A;  1L3S A;  1TK0 A;  4KB1 A;  3OYM A;  4CEA A;  1Z05 A;  2IVO A;  3NF6 A;  1WOQ A;  3BZC A;  3OS0 A;  3U9Z A;  5FPM A;  3L2V A;  4FWR A;  1EWQ A;  4JKE A;  5BPN A;  2VWB A;  1I39 A;  4OPJ A;  1Y64 A;  3VA3 A;  3AA5 X;  1SS6 A;  3CET A;  4ISG A;  1VSF A;  1HLU A;  2X74 A;  3CJB A;  5C25 A;  1LWC A;  3G6E N;  4ZHR A;  3NVK A;  1DEJ A;  4R79 A;  2QKK A;  3IFR A;  3K5O A;  4ILJ A;  1HX1 A;  4M3Y A;  2A40 A;  5EVZ A;  3AVK A;  4YFU A;  1FXX A;  5AQI A;  4EIA A;  1TKD A;  4BWJ A;  3WNH A;  2KW4 A;  3HM8 A;  3HXM A;  4F2S A;  4B9N A;  4JK7 A;  4F8R A;  5AFU H;  1XUP O;  3EZW A;  3UKR B;  4FPA A;  3D6R A;  3CC2 N;  2W6K A;  4W5O A;  1RCH A;  3LDO A;  1RT2 A;  3AVI A;  4IFV A;  1NGB A;  3NE6 A;  3CCU N;  1U49 A;  4EP5 A;  2QWQ A;  2ZGY A;  1RNH A;  2W40 A;  3BY5 A;  1FK9 A;  4JRP A;  4PA1 A;  3CIP A;  3L2U A;  3KD5 E;  4DUZ K;  3WUH A;  1ZBL A;  5DM7 L;  3KTQ A;  2P9S B;  2XO7 A;  4NLB A;  1YVU A;  3H46 O;  2HF3 A;  3H3N O;  4JEP A;  5GAD P;  5IT9 O;  3VGK A;  2IS3 A;  1TKT A;  4CFC A;  4BRI A;  3SJJ A;  1RIL A;  3CM5 A;  4DSK A;  4WQ5 C;  1N8R O;  4DR5 K;  1TV6 A;  1DKG D;  1SKS A;  5KQD A;  4W5Q A;  3OYN A;  1RDC A;  3HL8 A;  4KHS A;  1Z6R A;  3F2K A;  4F3T A;  4JNE A;  4GY2 B;  3OJS A;  4FZY A;  2NUB A;  2Q36 A;  3CFO A;  4KV8 A;  4ELT A;  5EXW A;  1XNR K;  2VG6 A;  3MK6 A;  4CHY A;  1TL3 A;  4H8K A;  5FLX O;  5LJW A;  3AVJ A;  1NK9 A;  1W97 L;  1QZ6 A;  2QWL A;  4AM6 A;  1BO5 O;  2FC0 A;  4BE2 A;  3C6A A;  1RT3 A; 
#chains in the Genus database with same CATH homology
 2HW3 A;  4FJ7 A;  4CJP A;  1BL3 A;  4FJ8 A;  3P5J A;  4OJR A;  3EY1 A;  1ASU A;  4DQI A;  4RW4 A;  5HRS A;  1ZBH A;  2KZZ A;  4QCL A;  4MFB A;  3AVN A;  1UWB A;  4CJK A;  3SQ4 A;  2KTQ A;  4CE9 A;  3K59 A;  3KD1 E;  4F3O A;  4E7K A;  3OYE A;  1LAW A;  2OZS A;  3LAN A;  3OJU A;  2P51 A;  4CGF A;  1Q9Y A;  1XC9 A;  4RW8 A;  4FLZ A;  3OS2 A;  4DLE A;  4ZTJ A;  2EHG A;  5FRO A;  1D5A A;  4CJ5 A;  3L2Q A;  3F73 A;  2PZS A;  3IAY A;  1KVB A;  4CJ3 A;  2HHQ A;  3QES A;  2WON A;  1C1A A;  1RTJ A;  4H4O A;  1LW0 A;  4ICL A;  4AHR A;  3SUQ A;  1Q9X A;  1QSL A;  2OA8 A;  2DTU A;  3NDK A;  2XY8 A;  4OVL A;  4KB0 A;  3LAK A;  4CJV A;  3TAG A;  4FLV A;  3VQD A;  1JLC A;  4E7L A;  3SNN A;  4YNQ A;  1NK8 A;  5SZT A;  4CES A;  3QEV A;  1J54 A;  3AO3 A;  3MXM A;  2FBV A;  3V9W A;  4CJL A;  4RW9 A;  1YT3 A;  3AO1 A;  3ZT1 A;  3LWL A;  1IKY A;  1B9D A;  4GVM A;  3U3G A;  4FLU A;  1SL2 A;  1HQE A;  2O4I A;  4NYF A;  3HM9 A;  4DTR A;  1SL0 A;  2PYJ A;  1WSE A;  1IG9 A;  3QEX A;  4H4M A;  4I9L A;  4B9U A;  5FRN A;  4F2R A;  2P1J A;  3QIN A;  4AHS A;  1A5X A;  3K2P A;  2YNF A;  4Z4E A;  3AA4 A;  1Q8I A;  1REV A;  4ID1 A;  4IDK A;  3O3F A;  2Z1I A;  3HP9 A;  2DFF A;  5JS1 A;  2I5J A;  2QKB A;  3F9K A;  4AH9 A;  1TGO A;  2ZE2 A;  3QET A;  4DFM A;  1NKE A;  1O1W A;  2OPQ A;  4PY5 A;  3OS1 A;  5KTQ A;  1BIS A;  2LSN A;  2Y1J A;  1NKB A;  3B6P A;  4KPY A;  2HVI A;  4DTP A;  4CJF A;  4AHT A;  3LPT A;  1S9E A;  4FZX C;  4N76 A;  4W5N A;  3NH0 A;  3U3Y A;  3U6F A;  3LP1 A;  4TSX A;  5I42 A;  4DSL A;  3AVF A;  5D3G A;  3ZCM A;  1IKV A;  2VWK A;  1VRT A;  1HYS A;  2Z1H A;  1U4B A;  3KJV A;  1LV5 A;  4N47 A;  3L2W A;  5HRO A;  3VQP A;  4BE0 A;  3PX4 A;  1QTM A;  2BDP A;  4FJN A;  3OYC A;  1T03 A;  1QSS A;  4Z4I A;  4Z4G A;  2RN2 A;  2IOC A;  4M3W A;  4CFD A;  1NK6 A;  1DTT A;  1JLA A;  2X6N A;  3ZT4 A;  4DU4 A;  3P1G A;  2OPR A;  3HYF A;  3VQB A;  3VN5 A;  3ZSX A;  5E41 A;  4OPK A;  1RBT A;  1S6P A;  4B08 A;  1C6V A;  4O0I A;  3K5L A;  3K57 A;  4FZZ A;  3KLF A;  1HNV A;  2JGU A;  3RR7 A;  2VWJ A;  4PQU A;  4EZ9 A;  4W5R A;  2O4G A;  2QK9 A;  1SL1 A;  3OYD A;  3NF7 A;  1U47 A;  1D9D A;  4DTO A;  1KCF A;  4CHO A;  3OYA A;  4CIF A;  4M45 A;  3I0R A;  4CHN A;  2F8S A;  3O3H A;  3C94 A;  4KFB A;  4FJJ A;  2G8V A;  3RWU A;  4LD0 A;  3SUN A;  3ZSO A;  4CJE A;  4DF4 A;  4I2Q A;  1JLG A;  1JKH A;  3VQ4 A;  2G8W A;  4DTS A;  4DFP A;  3NF9 A;  3TAE A;  5CY4 A;  4B9T A;  3EYZ A;  3PO4 A;  2Q3S A;  3NH1 A;  1HYV A;  2P5G A;  4CGJ A;  1L5U A;  1D8Y A;  1D9F A;  3PO5 A;  4DSI A;  3PV8 A;  1S6Q A;  4KKO A;  4BWM A;  5I3U A;  4ELU A;  2YNG A;  1S1X A;  4FVM A;  4JS5 A;  4HUG A;  3THV A;  1W9H A;  3VQE A;  2HHU A;  1ZBF A;  1RBV A;  3SQ0 A;  3SI6 A;  1ZBI A;  3M8P A;  3EZ5 A;  4DSE A;  1HPZ A;  5T7B A;  2KFZ A;  4AHC A;  1IO2 A;  1NKC A;  1NJX A;  2G8I A;  4ID5 A;  1N6Q A;  4BDP A;  3WNG A;  1K6Y A;  4C8M A;  4FLY A;  4CK2 A;  1EET A;  4DG1 A;  1RDD A;  4PWD A;  4BDZ A;  4DU3 A;  1RTD A;  1XHX A;  3OYJ A;  3VQQ A;  3HJF A;  1ZYQ A;  1S5J A;  4E19 A;  4KI4 A;  2WOM A;  2ATQ A;  3DOK A;  3VQ5 A;  4AIL C;  3TAF A;  2QXF A;  1WAF A;  4HCB A;  3HPO A;  4J2B A;  5FRM A;  1TKX A;  1T7P A;  1DTQ A;  3NHG A;  4E0D A;  1RT6 A;  4R5P A;  3NAE A;  4CHP A;  4IBN A;  4CGI A;  4FK0 A;  4B9M A;  3MED A;  4NCA A;  3C6T A;  3CQ8 A;  3VQC A;  3AVB A;  4I2P A;  5HRR A;  3ZT3 A;  3MXJ A;  4DFK A;  1VK0 A;  4O5B A;  3I0S A;  3SQ1 A;  3RR8 A;  3QIO A;  1ASW A;  4OKE A;  1CZB A;  4CEO A;  2DFE A;  3OY9 A;  4HUF A;  3VQ6 A;  1FKP A;  1NK4 A;  2IAJ A;  3V9X A;  3SYZ A;  3B6O A;  1JLF A;  2HVH A;  1KTQ A;  4C8L A;  3LAM A;  4CFA A;  2VG5 A;  1SKW A;  3AV9 A;  4HUE A;  4E7I A;  3QNN A;  3AVA A;  4DS4 A;  3DLH A;  3BDP A;  4CGG A;  1WSJ A;  5C42 A;  1S1W A;  3PUF A;  4FM0 A;  3S3N A;  2G8K A;  3JYT A;  4DQQ A;  4CEZ A;  4DLG A;  1JL2 A;  3AO4 A;  3L8B A;  4DSF A;  1BI4 B;  3OYI A;  3NFA A;  1UAX A;  1CLQ A;  4CEC A;  1TK8 A;  2P5O A;  2YHA A;  3KKS A;  4DFJ A;  4KTW A;  4UQG A;  1EP4 A;  1NJZ A;  4CCH A;  2D5R A;  1LW2 A;  3PX6 A;  5K14 A;  3K58 A;  1RBR A;  2E6L A;  3CG7 A;  4LSL A;  4FLT A;  4I9Q A;  5HBM A;  4M3X A;  4KHW A;  1TK5 A;  1DLO A;  4Y1C A;  1JL1 A;  2YKN A;  3RMA A;  2HNY A;  3VQA A;  2Z1G A;  4DS5 A;  2D0A A;  4K8Z A;  1IKX A;  1RBU A;  3V1Q A;  4JLH A;  1WSF A;  3A2F A;  1UA0 A;  3ZSY A;  1L3U A;  1SUQ A;  2B6A A;  1L3V A;  1YTU A;  2YV0 X;  4J2A A;  1Z26 A;  5KGW A;  4KTQ A;  1Y97 A;  3E01 A;  4FLX A;  1J5O A;  3OYF A;  1XHZ A;  3TR8 A;  1XWL A;  3L2R A;  4CF0 A;  3AO2 A;  3KLI A;  5KRS A;  3OYK A;  1RDA A;  2IC3 A;  1VSD A;  3MEC A;  4CF1 A;  4DTX A;  4B8C A;  3QNO A;  4DF8 A;  4FJG A;  3I8D A;  2IGI A;  4HCC A;  1VSK A;  3DRR A;  1YTA A;  1XI1 A;  3TWH A;  4BE1 A;  4J2D A;  1C1B A;  2D0B A;  4CHQ A;  2OPS A;  1KLN A;  2OZM A;  4FJL A;  2XRI A;  4FJI A;  3SV3 A;  4O4G A;  1WN7 A;  5EU7 A;  3OYH A;  3V9Z A;  1MU2 A;  1S1T A;  4KO0 A;  4E7J A;  3VQ7 A;  3SQ2 A;  1LWE A;  4KRE A;  3WNE A;  1NOY A;  5KI6 A;  3SUP A;  4Z4F A;  4CJ4 A;  4O44 A;  5HRP A;  2YHB A;  4DU1 A;  4CED A;  4RG8 A;  4E1N A;  2W42 A;  4BE2 A;  4FW2 A;  4M3Z A;  1X1P A;  1ZBU A;  4CIG A;  3KLH A;  1QS4 A;  3QIP A;  1ITG A;  1JLE A;  3L3V A;  3VQ9 A;  3V9U A;  1C0M A;  1GOA A;  3DYA A;  5KGX A;  2EX3 A;  2KQ2 A;  3DRS A;  1J53 A;  1B9F A;  3LPU A;  4CJQ A;  3M8R A;  3OYG A;  1N5Y A;  4L8R B;  4BAC A;  1S1V A;  4LH5 A;  4CFB A;  4HHT A;  4FCY A;  3SCX A;  5J2Q A;  3FFI A;  3IRX A;  5DK5 A;  4Q5V A;  2RPI A;  1VSJ A;  3LZJ A;  4FXD A;  5KRT A;  3DLG A;  2A1S A;  3O4N A;  3IG1 A;  4DMN A;  2FBX A;  4B9L A;  1BCM A;  5J2N A;  4FJH A;  4LSN A;  2DY4 A;  1VRU A;  2GBZ A;  1U45 A;  4KHQ A;  3NGI A;  4LH4 A;  1BCO A;  1S1U A;  3HO1 A;  4Z4C A;  1RTH A;  3NH2 A;  1WSI A;  4DQS A;  2BE2 A;  1W0H A;  1EKE A;  5J2M A;  3TAB A;  1KFD A;  3DLB A;  4KI6 A;  4CJR A;  2XHB A;  1QE1 A;  4JS4 A;  2Z1J A;  1T05 A;  4FJ9 A;  4O0J A;  3LDS A;  4CHZ A;  3JSM A;  2AJQ A;  1WAJ A;  1CZ9 A;  4GMJ B;  3NGZ A;  1KLM A;  4IKF A;  4CJS A;  4OKJ A;  3VA0 A;  3H08 A;  4B3O A;  4M3T A;  3AVC A;  4J2E A;  2E6M A;  3S9H A;  1WSH A;  3T1A A;  4KHU A;  3TAN A;  4M42 A;  5HRN A;  3DLE A;  2HHV A;  5C24 A;  1FKO A;  2R7Y A;  3O3G A;  1TKZ A;  1JXE A;  2BAN A;  1VSI A;  5J1E A;  4FLW A;  3QEW A;  3SPZ A;  2ZD1 A;  3KLG A;  1A5W A;  4B9V A;  4RW6 A;  3OVN A;  3V1R A;  2A1R A;  4WE1 A;  4AHV A;  4IG3 A;  3NF8 A;  1JXB A;  5SWM A;  3LP0 A;  4CER A;  4B9S A;  1TAU A;  4FK2 A;  4M3U A;  3ZT2 A;  4E89 A;  3NGY A;  3SPY A;  3ZSV A;  5JS2 A;  3MEG A;  4CGH A;  3S3M A;  3CFP A;  3QEP A;  3L3U A;  1X9W A;  3ITH A;  4CEQ A;  3LP3 A;  3KK2 A;  4OGC A;  3SV4 A;  4DWI A;  1HYZ A;  3MXI A;  4CK1 A;  1HNI A;  1HJR A;  4MQ3 A;  3G10 A;  4DTM A;  4JRQ A;  3SZ2 A;  3RRH A;  1JLB A;  3V81 A;  3OYB A;  3DI6 A;  4E3S A;  2XY6 A;  1SKR A;  4EP4 A;  1BGX T;  2HHT A;  1ASV A;  3KKR A;  5CZ2 A;  4Z0U A;  4B8A B;  1G15 A;  5DMR A;  3LWM A;  4N56 A;  2D0C A;  1KFS A;  4I7F A;  1A5V A;  3K5N A;  2HND A;  3AVL A;  4NYN A;  3D0P A;  3V9S A;  3PY8 A;  3HVT A;  2G8H A;  3TAM A;  3AA3 A;  4M41 A;  3S3O A;  1RT7 A;  3V4I A;  1BIZ A;  1C1C A;  2B4J A;  1BI4 A;  1CXQ A;  4N5S A;  3HPG A;  1L3S A;  3RMD A;  2PYL A;  3LP2 A;  4HVJ A;  3RMB A;  1TK0 A;  4KB1 A;  3AA2 A;  4CK3 A;  2ITG A;  4LY7 A;  3OYM A;  1BIU A;  3HT3 A;  4QAG A;  5J2P A;  4CEA A;  3TAR A;  2OYQ A;  3NF6 A;  3SUO A;  1L3T A;  2PY5 A;  3QER A;  2HHS A;  2F96 A;  3OS0 A;  3LAL A;  3QEI A;  3CYM A;  4OGE A;  3C95 A;  3DLR A;  1EX4 A;  3L2V A;  1NJW A;  4IFY A;  4XIU A;  4CEE A;  1LWF A;  3HP6 A;  1I39 A;  2OPP A;  4OPJ A;  4KRF A;  3DMJ A;  4M3R A;  1NK7 A;  1TL1 A;  3VA3 A;  3AA5 X;  3TAQ A;  2X6S A;  4CEB A;  1VSF A;  2RKI A;  2X74 A;  5FDL A;  1RDB A;  1IH7 A;  4K8X A;  4DTN A;  1KVC A;  3O4Q A;  5C25 A;  1LWC A;  1U48 A;  1X9M A;  4C8K A;  3IS9 A;  2FBT A;  4CF8 A;  3QO9 A;  3KK1 A;  4ZHR A;  4DQR A;  4PUO A;  3ZSW A;  3MAQ A;  1JLQ A;  3AVM A;  1X9S A;  2GUI A;  2QKK A;  1HMV A;  3ZSZ A;  3DOL A;  3K5O A;  4G1Q A;  3ALY A;  2YKM A;  3G0Z A;  4RW7 A;  3HVR A;  5HP1 A;  1VSE A;  1IKW A;  4CF9 A;  4OLB A;  1U04 A;  2JLE A;  4M3Y A;  1RT1 A;  2HHX A;  1GOB A;  1BQN A;  1T8E A;  4C8O A;  4DQP A;  3TAP A;  1HQU A;  2ZQB A;  4FJ5 A;  1C0T A;  4FK4 A;  3NBP A;  3AVK A;  4CJU A;  4YFU A;  1FXX A;  1RT5 A;  3CM6 A;  3HST B;  3ISN C;  3M8S A;  3TI0 A;  1TKD A;  4BWJ A;  4ZTF A;  1KRP A;  2KZM A;  3VQ8 A;  4AHU A;  3WNH A;  1J9A A;  2KW4 A;  4FM2 A;  2Y1I A;  1NOZ A;  3HPH A;  4FM1 A;  1F21 A;  1TAQ A;  1VSM A;  3HXM A;  1WNS A;  1HRH A;  4DTU A;  4F2S A;  1QQC A;  3WNF A;  1KSP A;  2RF2 A;  4B9N A;  4F8R A;  3NCI A;  4KTZ A;  2X78 A;  3M8Q A;  3MEE A;  2B5J A;  3P83 D;  4E7H A;  1NK0 A;  2HHW A;  4IG0 A;  5CYQ A;  4CIE A;  4W5O A;  1QHT A;  1VSH A;  1RCH A;  3QLH A;  4W5T A;  1RT2 A;  2YNH A;  3OYL A;  3AVI A;  3ZSQ A;  4IFV A;  1LAV A;  2HNZ A;  4CJT A;  3NE6 A;  3D45 A;  1U49 A;  4EP5 A;  1BQM A;  3V1O A;  1RNH A;  4CGD A;  4CJW A;  2VG7 A;  1GOC A;  1FK9 A;  4O55 A;  4JRP A;  5CZ1 A;  2YNI A;  3DLK A;  1UA1 A;  1B92 A;  4PA1 A;  1NJY A;  4Q0B A;  2DFH A;  4BDY A;  1VSL A;  4FJM A;  3L2U A;  5CYM A;  3KD5 E;  4OLA A;  4EZ6 A;  1RTI A;  4Y1D A;  1ZBL A;  4QOZ B;  2XY5 A;  2IDO A;  2GV9 A;  3KTQ A;  4N41 A;  4FJK A;  1TVR A;  2XO7 A;  1BHL A;  4Z4H A;  3ULD A;  3RMC A;  1YVU A;  1CXU A;  2XY7 A;  2FBY A;  2F8T A;  3RTV A;  2IS3 A;  1TKT A;  3AO5 A;  3BGR A;  4CFC A;  3V6D A;  3SJJ A;  1RIL A;  4C8N A;  4GW6 A;  2BGG A;  3ASM A;  3PX0 A;  3LZI A;  4DSJ A;  3CM5 A;  4DSK A;  4F4K A;  3RRG A;  4FJX A;  1S9G A;  3K5M A;  4E1M A;  3CFR A;  1TV6 A;  4DTJ A;  1SKS A;  3T19 A;  4W5Q A;  3OYN A;  1R0A A;  1NK5 A;  1RDC A;  3AVG A;  3HL8 A;  4KHS A;  4F3T A;  1I3A A;  3KIO A;  3OJS A;  4FZY A;  3ZSR A;  1Z25 A;  3AVH A;  2NUB A;  3C6U A;  1RT4 A;  3ZT0 A;  1WSG A;  2G8U A;  2ETJ A;  1SV5 A;  3KK3 A;  3CFO A;  4KV8 A;  3DM2 A;  4ELT A;  3UIQ A;  4NCB A;  5HLF A;  2VG6 A;  4CHY A;  4KHN A;  1EXQ A;  1WLJ A;  4FW1 A;  1QSY A;  1KVA A;  1TL3 A;  4H8K A;  3DRP A;  2HMI A;  1UOC A;  4FYD A;  3AVJ A;  2HB5 A;  4CF2 A;  2E4L A;  1NK9 A;  2KFN A;  4ELV A;  4CEF A;  4HTU A;  4KAZ A;  3KLE A;  1C0U A;  3HK2 A;  2G8F A;  1RBS A;  4KHY A;  2FC0 A;  3T3F A;  4NCG A;  1RT3 A;  4OKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...