3AVMA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avmA00
4EP4A 3QNNA 1S1VA 2YHAA 3AVLA 4CEQA 3O3GA 4I9LA 5CZ1A 1HYVA 4CIFA 3H08A 5KI6A 4CGGA 3RMCA 1JXEA 1MU2A 1FKPA 2HNDA 1ASWA 2IS3A 3OVNA 3ULDA 3OYIA 3HPHA 3SUNA 3SPYA 2WOMA 3MAQA 3F73A 1BQMA 1YTUA 1J9AA 2YNFA 4CHNA 2Z1IA 4DU3A 4CF1A 1J5OA 4RW8A 1YTAA 1NK8A 4B08A 2KFZA 4WE1A 4FM1A 3DYAA 4AHTA 4NYNA 4M41A 2DY4A 1UAXA 3KKSA 4ELVA 4OVLA 3O4NA 2IOCA 4FLWA 4DTRA 1B9FA 1HMVA 1QQCA 2OPQA 4CGDA 3AA4A 3CFPA 1RT5A 4GW6A 3QEXA 2HB5A 4E0DA 4OLBA 2Z1GA 2IC3A 4UQGA 3RRGA 2W42A 3C6UA 4W5OA 4DQIA 3LPTA 1JKHA 3MEDA 4CJKA 3KK1A 3AO4A 1VSMA 4J2AA 3KLHA 1C1CA 4FVMA 1RDDA 5E41A 3WNEA 4ZTJA 2P1JA 2NUBA 3CM6A 4I2PA 3DRRA 4ELTA 1VSDA 4FJ8A 4W5NA 1C1BA 1HQEA 3DOKA 4H4MA 4CJPA 3CQ8A 4DS4A 4LSLA 5HRSA 1KRPA 4DSJA 4CJ4A 4DSKA 1N5YA 3KK3A 4G1QA 4CIGA 1DTTA 4CJSA 4CJWA 3DRSA 3O3HA 1JLGA 3OYAA 1IKYA 4JRPA 3RMDA 1TKDA 1TVRA 3PUFA 3AVGA 4CK3A 3NH0A 2PY5A 2F96A 3WNHA 2E6LA 1U48A 3NBPA 3NH1A 4W5TA 1S9GA 1NK9A 3CYMA 3K5OA 1WSFA 4B9LA 1CXUA 2O4GA 1SKSA 3BDPA 4FJXA 4CCHA 3SQ4A 3I8DA 3ALYA 4FJIA 3AVAA 4Z4FA 4HHTA 3ZT2A 4LH5A 3QIPA 4KPYA 4KREA 3L3UA 4OLAA 4ID1A 3NF7A 4PQUA 1KTQA 3ZSXA 1REVA 5C42A 1SKWA 2KZMA 3MEGA 2IGIA 1NJYA 5KGXA 3OS2A 1W9HA 3OS0A 1B9DA 3A2FA 3ZT1A 3VA3A 1VK0A 2FC0A 2XRIA 3AVCA 3T3FA 2DFHA 5KRSA 4DTPA 4QOZB 1U04A 2YKMA 3SJJA 4OKEA 5KTQA 2BDPA 1RTIA 4YNQA 4GMJB 2PYLA 2GBZA 4BDYA 3SYZA 4CHQA 4CERA 3VA0A 4Z0UA 3OJSA 4DF8A 1L3UA 4IFVA 3K5LA 1GOBA 3TR8A 1KFDA 4LSNA 3KKRA 1TKZA 3L2QA 4DTOA 2HMIA 3I0SA 3LALA 3M8RA 4O55A 2D0AA 3B6PA 3SV3A 2Q3SA 5DMRA 4HTUA 2HVHA 1C0TA 3WNGA 5KRTA 1JLAA 2G8HA 1A5WA 4KHNA 3K57A 1S9EA 3VQ4A 4B3OA 3D0PA 1TAQA 1NK5A 4FK2A 4Z4EA 1JLQA 1D9DA 1TL1A 3L3VA 1W0HA 3DLRA 2KQ2A 3S9HA 4NYFA 3VQQA 3HSTB 3CG7A 4O4GA 3TAMA 4NCAA 2EHGA 3ASMA 1TK8A 4DF4A 1SV5A 1WSEA 5CYQA 2BGGA 1CLQA 1EX4A 1IKXA 2RF2A 2FBVA 4FJ5A 3DMJA 1SUQA 4NCGA 4GVMA 2YKNA 3OS1A 3OY9A 1QS4A 3RMBA 5KGWA 4CFAA 4CHZA 3TARA 4MFBA 4RW4A 1RTDA 4HCCA 1LWFA 3DLBA 4FJ7A 2PZSA 4ICLA 3ZSOA 3OJUA 4OKKA 3NF9A 2XHBA 4CEFA 4E7IA 3DM2A 3ZT4A 1A5VA 1ITGA 3TWHA 4E89A 2VG6A 1ZYQA 4F3TA 1QE1A 1QHTA 3VQ9A 2ZQBA 1RBTA 3DLEA 4Y1DA 3HP9A 4B9SA 4FJKA 4FYDA 4DFMA 1JLBA 4FW1A 4M3YA 3K5NA 1ASUA 1A5XA 1Q9XA 4CECA 1L3VA 1Y97A 1WSHA 3KLFA 4F4KA 4OPJA 4C8NA 3SQ2A 3FFIA 4E7LA 3P1GA 1L3SA 1WLJA 3DLKA 4M3RA 1BIZA 1NOZA 3C95A 2OYQA 4AHRA 4N76A 4CEEA 1SL1A 2VG5A 3PX6A 4J2BA 2HHUA 2VG7A 4O44A 3NGIA 1TKXA 2YNHA 3MXIA 3AO5A 4KB1A 4ID5A 1S6PA 3TANA 3MXMA 1RBVA 3V81A 2BE2A 2FBYA 3V1RA 2VWKA 5CYMA 3F9KA 3LP3A 1BGXT 1DLOA 3AO1A 4H8KA 3K59A 4E7KA 2BANA 3KIOA 2G8WA 3U3YA 4KKOA 4IG0A 4IDKA 2XY5A 1LW0A 3AV9A 4DU1A 4O0IA 1S1UA 1LV5A 4EZ6A 2QK9A 4FJ9A 3D45A 1RT3A 2FBXA 3AO2A 3SUPA 3SQ1A 2KW4A 2GUIA 3AO3A 3SCXA 3DLGA 2HNZA 1O1WA 4CJ5A 4CJRA 1ZBLA 3KD1E 4FJHA 1G15A 1EETA 5J1EA 2I5JA 3AVNA 4Y1CA 1Z25A 4ZHRA 3NH2A 3LDSA 4CHPA 4DLGA 1TGOA 1VSHA 4DWIA 3HYFA 3OYLA 1TK5A 2ZE2A 4OGEA 4BWMA 4E1MA 1ZBIA 2G8KA 3RTVA 2ZD1A 3AVMA 4CHYA 4JS4A 4E19A 4AHVA 4QCLA 1GOCA 1CXQA 3S3NA 4CFBA 1L5UA 2ATQA 4FJGA 1VSIA 4I9QA 1YVUA 2XY8A 4CEAA 1T03A 1Q9YA 1B92A 1RTHA 4BE1A 3QEIA 1BISA 5FRMA 1X9SA 1JL2A 4PA1A 4CEBA 1XHZA 2G8FA 5HROA 3RR7A 4CJTA 1ZBFA 3KLIA 3OYNA 1L3TA 1T05A 4C8OA 4OJRA 2YHBA 2Z1JA 1SKRA 4B9NA 4RG8A 3NAEA 1S6QA 4N56A 1YT3A 3V9UA 1NK7A 3OYDA 4Z4CA 4FLZA 1C1AA 1NKCA 3K2PA 2YV0X 3ZSRA 4BACA 3KLEA 3TAEA 4KHWA 3T19A 2A1SA 3SQ0A 3QEWA 4CF9A 4CF2A 2HHQA 1RBUA 4HUGA 4PWDA 3HL8A 3JYTA 1D5AA 3VQEA 3CFRA 2R7YA 4DU4A 1KFSA 4CK2A 1IG9A 4DQRA 4FJJA 1RT1A 2OPSA 4N5SA 1LWEA 2Z1HA 3LAKA 4Z4HA 1HRHA 3V1OA 1VSLA 2GV9A 1WSGA 3QETA 4C8LA 3VQ6A 3V9SA 3EYZA 1T7PA 4CJLA 3NE6A 4DS5A 3OYKA 2HNYA 1S1TA 1HQUA 3AVHA 4CGIA 4DTUA 3SUQA 1XI1A 2G8UA 5HBMA 4FZXC 5HRRA 4M42A 1SL2A 5K14A 1WAJA 4OPKA 2HHWA 3I0RA 5SWMA 1U45A 2KZZA 2E4LA 3DRPA 3G0ZA 2G8VA 4KHSA 4IG3A 2XO7A 4MQ3A 3NGYA 2JLEA 3M8SA 4CEDA 4DTXA 4FJNA 2HVIA 4BE0A 1JLEA 5FROA 3OYHA 4CFCA 3JSMA 3SV4A 1NJZA 3P5JA 1K6YA 3VQ7A 2HHTA 4N41A 4QAGA 1UOCA 3OYGA 3HPOA 1BIUA 4B9TA 1UA0A 3MECA 4M3WA 4KTQA 1WNSA 5JS1A 1RNHA 4M45A 4Q0BA 4K8ZA 3ISNC 4LY7A 4KI6A 5CZ2A 4KO0A 1R0AA 1BHLA 2E6MA 3LAMA 2ETJA 4TSXA 5HLFA 1BL3A 3AVBA 3LZIA 3SNNA 1N6QA 4F2SA 3L2RA 1BQNA 4KHYA 1LWCA 3HVTA 4FXDA 1CZ9A 4FLVA 3RR8A 3PO4A 2X6SA 3NF8A 1DTQA 3CFOA 1IKWA 1BCMA 5J2NA 3TAGA 3SPZA 4HUFA 4LH4A 2B4JA 1JLCA 3L2UA 2Y1JA 3V9XA 1LAWA 3LWMA 4KTZA 1TKTA 3LP2A 3ZSQA 4RW9A 3QEPA 2HHSA 4B9UA 1F21A 3OYJA 2QKBA 2QKKA 4DQSA 5FRNA 1KVCA 3CM5A 4DFJA 5I3UA 3U3GA 4CESA 3TAQA 1S1WA 4CJ3A 4OGCA 4FLYA 1UA1A 3T1AA 4CHOA 2XY7A 1BI4B 4DSLA 4CGJA 4CGFA 1RT6A 3VQDA 4FLTA 4I7FA 4DTMA 1VSEA 4DSEA 3M8PA 4N47A 4FLXA 1VRUA 3ZCMA 1T8EA 3OYFA 2VWJA 4FM2A 2EX3A 1I3AA 3WNFA 4M3UA 1VRTA 4CEOA 4IKFA 1RT4A 2IAJA 1NK6A 3B6OA 3IRXA 2RKIA 4JLHA 1KSPA 2DFEA 4JRQA 2HW3A 1KVBA 4IFYA 4FZZA 4DTJA 5J2QA 3ZSZA 2B6AA 1NJWA 2PYJA 3DLHA 2KTQA 1WAFA 2AJQA 4J2DA 1FK9A 1VSJA 5FDLA 3TAPA 1NJXA 5I42A 3NFAA 2D0CA 1HJRA 3AA5X 1RBRA 4CE9A 3V4IA 1C0MA 3HP6A 3SZ2A 4E7JA 4CGHA 1QSYA 4F2RA 4JS5A 2D0BA 4DLEA 4DSFA 3K5MA 4XIUA 4AILC 1U4BA 3K58A 1QSLA 1LAVA 4BDZA 3ZSYA 3HPGA 1VSKA 3EY1A 4KHUA 3AVJA 1HNVA 4FCYA 1SL0A 1RT7A 1HYZA 1FKOA 2D5RA 3AA2A 5T7BA 4DTNA 4RW6A 4Z4GA 4CFDA 4FZYA 3L8BA 1WSJA 1Q8IA 4F3OA 2RN2A 5J2PA 3VQ8A 2OPRA 3S3OA 1I39A 2OPPA 1Z26A 3ZT3A 1HPZA 1WN7A 2DTUA 3IS9A 4C8MA 1U49A 3G10A 5C25A 4CIEA 4KTWA 2P5OA 4W5RA 1U47A 3V6DA 1GOAA 1ASVA 3PX4A 4ELUA 4R5PA 3NGZA 3TI0A 1EXQA 1NK0A 2B5JA 4CJFA 4AHCA 4KHQA 4ZTFA 1EKEA 1TV6A 4FK4A 3OYBA 3QINA 3DI6A 5SZTA 4KI4A 1LW2A 3LPUA 3MXJA 3SUOA 3HO1A 3SI6A 1FXXA 3VQAA 4O5BA 4NCBA 4BE2A 4B8CA 4AH9A 2O4IA 5D3GA 1XWLA 5HP1A 2QXFA 3OYCA 4DG1A 4E1NA 3BGRA 3PX0A 2IDOA 4RW7A 3VN5A 3VQCA 5CY4A 2P5GA 3HJFA 5EU7A 2HHXA 4KB0A 3QIOA 3LZJA 1JLFA 1S5JA 1J53A 4DFPA 3MEEA 5DK5A 4CF0A 3PV8A 1NKBA 4CK1A 3UIQA 4Z4IA 1UWBA 1S1XA 2X6NA 4FLUA 1IKVA 1RTJA 3V1QA 4CF8A 4K8XA 4LD0A 3L2WA 4HCBA 1RBSA 2DFFA 1KCFA 1TK0A 1EP4A 4HUEA 1CZBA 1RDAA 3C94A 3M8QA 3ITHA 1NKEA 4B9MA 3OYMA 4E3SA 3V9WA 3KK2A 4M3TA 1RDCA 1X1PA 4EP5A 1WSIA 3KJVA 3PY8A 2G8IA 5HRNA 2WONA 3O3FA 3NDKA 3LWLA 3VQPA 1NOYA 4FM0A 1HYSA 3THVA 1RILA 3QEVA 1JXBA 3KD5E 4KFBA 1TL3A 4FJMA 1C6VA 3P83D 4F8RA 2X78A 4CJQA 2X74A 1C0UA 2YNGA 3HT3A 3VQBA 2RPIA 4CJEA 3HM9A 4OKJA 4O0JA 3U6FA 1KVAA 3KLGA 1ZBHA 3AVKA 3VQ5A 3QNOA 3ZSVA 3NCIA 4M3ZA 2Y1IA 2A1RA 1X9WA 1QSSA 1KLNA 3AA3A 4DFKA 1RDBA 1BI4A 4IBNA 3S3MA 4AHSA 3AVFA 2ITGA 3E01A 3ZT0A 3RRHA 3QERA 5JS2A 4PY5A 3RMAA 1XHXA 3O4QA 1XC9A 3QO9A 4H4OA 1KLMA 4FW2A 4J2EA 2LSNA 3QLHA 4BDPA 4L8RB 2F8TA 4CEZA 5HRPA 3KTQA 4DQPA 3LANA 4AHUA 1X9MA 5C24A 4B9VA 2XY6A 3HK2A 2HHVA 1ZBUA 1RCHA 4C8KA 3OYEA 3V9ZA 3L2VA 4DSIA 1BCOA 4CJVA 4KAZA 1QTMA 4BWJA 4I2QA 3HXMA 4DTSA 1RT2A 3C6TA 2F8SA 2YNIA 3IAYA 4FK0A 3RWUA 4CJUA 4KV8A 3QESA 1HNIA 4KRFA 1IO2A 4M3XA 4YFUA 3AVIA 2OZMA 2OZSA 3ZSWA 5J2MA 3TABA 4DQQA 1JL1A 3NHGA 3PO5A 4Q5VA 4B8AB 1NK4A 2FBTA 1J54A 1VSFA 4PUOA 4W5QA 2OA8A 1D8YA 2KFNA 1IH7A 3DOLA 3LP1A 4DMNA 3IG1A 4HVJA 3EZ5A 4E7HA 3TAFA 4FJLA 4EZ9A 1TAUA 3NF6A 3LP0A 2JGUA 1D9FA 2P51A 3HVRA
chains in the Genus database with same CATH superfamily
4EHTA 3M3ZA 1S1VA 4CEQA 3O3GA 5M1KA 5CZ1A 2E88A 3OVNA 3C6AA 4M63C 3OYIA 3HPHA 3J7ZO 3MAQA 3F73A 2YNFA 2Z1IA 1YTAA 4C1NK 3DYAA 4AHTA 5AQQA 4JKHA 4DTRA 4CGDA 3QEXA 2IC3A 2JWKA 3RRGA 3C65A 2W42A 1ZBSA 4DQIA 4BQLA 1QQMA 3MEDA 3AO4A 4EIAA 2BTFA 1P8ZA 3KLHA 5EX5A 1RDDA 4AM7A 3WNEA 5E41A 4FJ8A 3DRRA 1C1BA 1DT9A 3EL2A 4H4MA 4CJPA 3BY5A 4H5VA 3CQ8A 4LSLA 1KRPA 3THYB 4CJ4A 4DSKA 3GL1A 2P9IA 4FWOA 1K8AO 3K9KA 3VEOA 4CJWA 3O3HA 3OYAA 4DHYA 1TVRA 3VESA 2ZJQL 2E6LA 4CBWA 1U48A 4W5TA 3CYMA 1WSFA 2V52B 2QI2A 3U8XA 3VGLA 1KAXA 3DWLA 5C42A 3CETA 1SKWA 2O8FB 3MEGA 4CBXA 3UKRA 1NJYA 5KGXA 1B9DA 3A2FA 2FC0A 2XRIA 3IMXA 4BRAA 2DFHA 4QOZB 2FXUA 3U9DA 4DV1K 3CCVN 3SJJA 5KTQA 2PYLA 4JI4K 3P38A 3CCEN 1L3UA 2Q97A 4IFVA 1NGEA 3K5LA 1GOBA 3G71N 1TKZA 3CCLN 4BRHA 1Q7YO 3SV3A 5DMRA 1GLJO 1JLAA 3THXA 1NGJA 2G8HA 3DXMB 3K57A 4DKWA 3D0PA 4H0YB 1VHXA 2FLOA 1TL1A 5AQVA 1NU0A 3S9HA 4LFBK 3HSTB 3CG7A 3TAMA 3ASMA 4DR7K 3LDQA 3DMJA 3OY9A 2E8AA 2O8EA 2OCEA 4E7IA 3QDKA 1A5VA 1ITGA 3ZT4A 4F3TA 3DLEA 4FJKA 4DFMA 5AQNA 2Q1NA 3G6EN 1NGIA 1M90O 4E7LA 1WLJA 4M3RA 1BIZA 1NOZA 3C95A 5BRHA 4CEEA 1Z6RA 2YNHA 3AO5A 4KB1A 3BZKA 4L3QA 3W3DA 3LP3A 4H8KA 3K59A 3H1QA 4IG0A 4IDKA 2XY5A 4BRGA 1LW0A 4O0IA 5H1SQ 1S1UA 2QK9A 4JKGA 3D45A 4FWRA 3SQ1A 4B1UB 3FE1A 2NRWA 1ZBLA 4FJHA 3EZWA 3E9OA 4AF1A 3NH2A 3LDSA 4A2AA 1VSHA 1K8KA 3HYFA 4JAXA 2GX9A 5BR9A 4AHVA 4FJGA 3S3NA 4CFBA 1T03A 1B92A 1EWRA 1RTHA 1IBMK 2G8FA 5HROA 1ZBFA 3OYNA 1T05A 2YHBA 1SKRA 3NMUA 2P9SB 1W2BM 2YHWA 3RVCA 3ZSRA 1YJNN 3KLEA 3QEWA 3UE5A 3PSFA 4CF9A 2E2NA 3MMVA 1OKJA 1S3XA 3VQEA 1IG9A 4FJJA 3TSPA 3C0BA 1NG9A 1LWEA 1DKGD 2IIRA 3LAKA 2YHYA 2D1KA 1HRHA 3V1OA 2NZTA 3VQ6A 3V9SA 2HBLA 1T7PA 3NE6A 1YXQA 5KPRA 1HQUA 3AVHA 1XI1A 2A40A 3E1YA 4M42A 1HKCA 3O9UA 4CZIA 4OPKA 1U45A 3DRPA 3H3NO 4H0OA 4MQ3A 4YOVA 2Q36A 4DTXA 4BRQA 3OHRA 4RCHA 4WFNL 4CFCA 3TTFA 5M1QA 2HHTA 3EO3A 3HBTA 3HPOA 2E5LK 2ZJRL 4WFBL 5FPMA 4YDUA 4YOYA 5CZ2A 1R0AA 1N6QA 3P31A 4BY9C 4HTLA 4FLVA 3RR8A 3WXLA 2B4JA 1JLCA 3L2UA 3V9XA 2QWLA 4B1YB 3LP2A 1VQMN 3SK3A 2CGJA 5FRNA 4CESA 4FLYA 3IDHA 3ENOA 2XY7A 1BI4B 4IZ9A 2EWSA 4MLHA 2P9NB 2P9KB 2RHKA 1VSEA 3M8PA 4FLXA 1BA1A 3ZCMA 1T8EA 4BR0A 1RT4A 2IAJA 3IRXA 3SAGA 3CCMN 4DR5K 3IUCA 1YF5L 1KVBA 2KTQA 4J2DA 5FDLA 3VGMA 5I42A 3NFAA 4JKDA 3QFPA 5AQHA 3VF6A 4CE9A 4DLEA 4DSFA 4XIUA 1U4BA 4IO8A 1SL0A 1RT7A 1HYZA 4DTNA 2YCHA 5T7BA 4RW6A 4CFDA 3WEEB 1BDGA 3L8BA 4F3OA 1Q8IA 2O8DB 4E1JA 2O8BA 5J2PA 5GIPA 3S3OA 1WN7A 3EKUA 2A41A 1GOAA 3SAFA 3HI0A 3OBYA 5LMUK 1VQNN 3TI0A 1EXQA 2B5JA 3CJCA 4CJFA 1YVNA 4H5WA 3O9RA 3QINA 3SMSA 5SZTA 1S72N 3HO1A 2GWJA 4PL8A 4C1NI 5D3GA 1XWLA 3L4QA 3VEXA 4B3MK 3VN5A 1HUXA 3WXIA 3HJFA 5BPNA 2HHXA 4KB0A 3OTOK 4JKBA 4FO0A 3E9PA 1W7AA 1UWBA 5GIOA 4X62K 3VETA 4GVEA 3JXUA 4WCEL 3HSCA 1TUYA 1Q18A 1GLFO 1KCFA 1P90A 4FWLA 1TK0A 2JWLA 3I33A 4JK7A 4HUEA 1RDAA 1NKEA 4B9MA 4LF5K 4M3TA 2VYPA 5AZIB 1WSIA 3KJVA 3PY8A 5HRNA 1Q81O 3NDKA 3VQPA 1NOYA 4FM0A 4FVUA 5E84A 3THVA 3KD5E 2E1ZA 4FJMA 3P83D 4F8RA 4Z94A 4CJQA 3FZMA 3VQBA 2RPIA 5AQJA 1MDUB 3HM9A 3KLGA 3AVKA 3QNOA 3L6QA 3T7ZA 2Y1IA 5AQSA 2YX6A 3AVFA 4I6MB 3E01A 4LFAK 3QERA 5JS2A 4PY5A 5CHIA 2LSNA 5AJ3K 5HRPA 3KTQA 4DQPA 3LANA 1X9MA 4B9VA 5C24A 3HK2A 2HHVA 2O8CB 4K42A 4JI3K 1ZBUA 4C8KA 3OYEA 4GNIA 3V9ZA 4BRMA 1BCOA 4WF9L 4I2QA 4AQYK 4MDAA 4DTSA 2YNIA 2KLAA 4FK0A 4JI7K 3QESA 4FL9A 3GG4A 4PKIA 2D4WA 3TABA 4DQQA 1JL1A 1BA0A 2FBTA 1VSFA 4W5QA 4FSVA 2VGNA 4R79A 3DOLA 3LP1A 4FJLA 3ZETB 2P51A 4EP4A 5JVGL 3H08A 5KI6A 1MU2A 2HNDA 3SPYA 2IS3A 2PY5A 5AFUH 1J9AA 3E66A 1NK8A 4B08A 4LF4K 5JICA 4WE1A 4B1VA 4NYNA 4M41A 4H5NA 4ILHA 3HZ6A 4OVLA 1D4XA 2IOCA 3G4SN 4FLWA 1B9FA 1RTDA 3CFPA 4OLBA 4BROA 2Z1GA 3D2FA 4UQGA 2UXDK 1MWKA 4W5OA 4KBOA 1BO5O 1VSMA 1C1CA 4FVMA 3CCRN 4ZTJA 4LF9K 2ASOA 2NUBA 1VSDA 4CZMA 1HQEA 4K41A 3DOKA 5DM6L 5C0YA 1N5YA 2IVPA 5HL7L 4CJSA 3DRSA 4A57A 4DQ8A 1IKYA 2FSJA 4CK3A 2H3GX 3NBPA 1NK9A 3K5OA 1CXUA 3BDPA 4KH4A 4ISGA 3SQ4A 1IJJA 1J5EK 4OLAA 3ZSXA 3CF5L 3ZT1A 1VK0A 3KWGA 3UKUA 5JLFA 2D0PA 5ADXH 3GOIA 4WQ5C 1RTIA 4YNQA 4GMJB 3CCJN 4BDYA 4CERA 3R3LA 4DF8A 2Q0UA 3Q7BA 5CE3A 3KKRA 2HMPA 3I55N 3M8RA 2Q3SA 3O4WA 3MWPA 1X3MA 4KHNA 3VQ4A 1TAQA 1W0HA 4NO7A 4NYFA 4O4GA 2P9LA 4NCAA 1N32K 3M6GA 3ENHA 1WSEA 2I7PA 1EX4A 1VQ9N 3ATUA 1GLLO 2RF2A 2ZGZA 4NCGA 2YKNA 3OS1A 2IVNA 2NNWA 4CHZA 4MFBA 4CZLA 3ULEB 4JYAK 3ZSOA 3OJUA 5AZJA 4E89A 2ZQBA 1RBTA 2FF6A 2VGMA 2ZM6K 1E3MA 4B9SA 4FYDA 3K5NA 1E4FT 1Q9XA 4BG8A 4CECA 1WSHA 4OPJA 3QBXA 1YAGA 1BUPA 4JHDB 2F7TA 1ZC6A 4AHRA 4BR7A 2RE2A 2VG7A 4JI5K 1MA9B 1RBVA 1VQ4N 3V1RA 2FBYA 2VWKA 4M7YA 3F9KA 3AO1A 4E7KA 4IJNA 1SZ2A 4KKOA 5AQGA 1BWFO 4DU1A 1LV5A 1NNEA 2FBXA 4PL7A 3AO2A 5MLCQ 1NGAA 2KW4A 3AO3A 3SCXA 3THYA 2HNZA 1O1WA 4CJ5A 4CJRA 3KD1E 2QTDA 1G15A 3AVNA 1Z25A 1TGOA 4BRFA 3OYLA 1TK5A 3J7YP 2ZE2A 3FLCO 1NGFA 4CHYA 3RSEB 1CXQA 3QEIA 1BISA 1HNXK 1XHZA 2O8FA 4CJTA 1L3TA 4FWMA 4OJRA 2Z1JA 3DJCA 4B9NA 2ASMA 1S6QA 1U2VB 2NRXA 1C1AA 4CBUA 3N4QA 4BACA 4KHWA 3SQ0A 4PKGA 4HUGA 3JYTA 3CFRA 1KFSA 4V19S 4DQRA 1VSLA 4EHUA 3QETA 3EYZA 3CMAN 4CJLA 4H0TB 2HF4A 3DXMA 2HNYA 1S1TA 3FZHA 1VQLN 2G8UA 3SUQA 2W40A 1HNWK 1WAJA 2HHWA 3I0RA 2W6LA 4KHSA 1YI2N 1XMQK 4EAHD 5FROA 5AR0A 3SV4A 3AARA 3C6HA 3P5JA 1UOCA 4LFCK 4O8UA 1UA0A 3QMLA 4M45A 3ISNC 4KO0A 4FOIA 3LAMA 1BL3A 2GELA 3AVBA 5GINA 4DV5K 3SNNA 3HVTA 3PO4A 3TAGA 3CFOA 2HMIA 3VF4A 4H0VB 1TKTA 3O08A 4RW9A 3QEPA 1V4TA 1WBBA 1RDUA 3OYJA 5F0XA 3CCSN 4DQSA 4LF8K 2VWBA 1KVCA 4CD3A 1S1WA 3NVKA 3DLLL 4OGCA 5BREA 1UA1A 4A5AA 1GLBG 3MN6A 3VQDA 2P9UB 4FLTA 2Q0RA 3MWTA 3J81O 4DSEA 4N47A 3OYFA 4GKJK 5BN8A 5LL6Z 2QW9A 4H5TA 1TUUA 4YOWA 2EX3A 2VWJA 4FM2A 1CZAN 3U9ZA 4CEOA 1QVGM 4XEIA 2WBNA 4IKFA 4WFAL 2RKIA 4JV5K 2DFEA 4JRQA 2HW3A 4FZZA 4DTJA 3ZSZA 2B6AA 1NJWA 2PYJA 3DLHA 2AJQA 1WAFA 5FPEA 2BH1A 3THWB 2A3ZA 2D0CA 2QWOA 1KD1O 4G9ZA 4CGHA 4BR5A 4K43A 4DR4K 3I8BA 4BC3A 3K58A 1LAVA 1QZ6A 3ZSYA 1GLCG 3O80A 1VSKA 3ATVA 1HNVA 3LDPA 5AQOA 1FKOA 5EY4A 2E2PA 3C7NB 1OH8A 2RN2A 3VEWA 1RGIA 3BF3A 2OPRA 1I39A 3TTDA 4X66K 2P9SA 4W5RA 3V6DA 1OH5A 5AQMA 1J6ZA 4DV2K 3PX4A 1NJIO 2UU9K 2WUSA 3WT0A 1ESVA 1TV6A 2HF3A 1LW2A 2V7YA 1NGDA 4BE2A 3ZEUB 2ZJPL 3OYCA 3PX0A 4A59A 2IDOA 3VQCA 5EU7A 3SLCA 3QIOA 5GAEP 1J53A 4DFPA 3MEEA 4CF0A 1GLDG 2E2OA 5GADP 4Z4IA 3H3OB 4FLUA 2X6NA 1IKVA 3V1QA 4CF8A 4FWSA 4K8XA 4LD0A 2NRZA 3E9LA 2DFFA 4X64K 1XC3A 3C94A 3ITHA 3QICA 2YI1A 3FFKB 3KK2A 3HM8A 1RDCA 4OPAA 5C15A 4EP5A 3KVGA 3F9MA 5KQDA 2QWRA 5EXWA 3QEVA 4X65K 5KPTA 1TL3A 3A0IX 3IKMA 2X78A 2X74A 3HT3A 4MLEA 4CJEA 3U6FA 4O0JA 5F1XA 1ZBHA 3VQ5A 3ZSVA 2DPNA 4M3ZA 4DFKA 1RDBA 1BI4A 4AHSA 1JCFA 2P9NA 5C2FA 2P9KA 1QQOA 3J8AA 1G99A 3CXCM 4H4OA 4YY3K 1KLMA 4FW2A 3KHYA 2NRHA 3QLHA 3ZX2A 1HX1A 2XY6A 1RCHA 3VF2A 4NLCA 4IJAA 2OTLN 3PIOL 3AAQA 3C6TA 3RWUA 4KV8A 3WQTA 2QA4N 3SBTA 1LCUA 4ISFA 3J7AP 3PO5A 2GEMA 1IV0A 3SAHA 4K0KK 2KFNA 1IH7A 3TAFA 3VEVA 4DMNA 1TYQA 3NF6A 3LP0A 3BP8A 1OH6A 1NLVA 3L4IA 4BRDA 3WEEA 5BPMA 3HVRA 2O8DA 5LJVA 4DV4K 3AVLA 5EVZA 1O13A 1JCGA 1IBLK 4IO9L 4BRNA 2HBKA 4I9LA 3CPEA 1HLUA 1HYVA 4CIFA 3RMCA 1ASWA 2WOMA 1TYQB 4DU3A 1KAZA 4RW8A 4ILGB 2DY4A 1NGCA 3KKSA 4ELVA 3O4NA 3A8YA 1QQCA 4E0DA 3AA4A 4BRPA 4GW6A 4FWPA 2HB5A 4BG9A 4JI0K 3O9QA 3R1XA 3C6UA 1EWQA 3LPTA 1JKHA 4WQ4C 3KK1A 1N8RO 4J2AA 5GAGP 3MN7A 4I2PA 5AFUA 1H1VA 3CJ1A 5CR4A 4DS4A 4DSJA 3P39A 5HRSA 4AM6A 2J4RA 4CIGA 1DTTA 2NRRA 4JRPA 3RMDA 1IBKK 2W6KA 3PUFA 5BPLA 3AVGA 3NH0A 1EQYA 1S9GA 1FW6A 4GV6A 5AQTA 1SKSA 3DXKB 4PKHA 1C0GA 3ALYA 4Z4FA 4HHTA 5AZIA 1MWMA 5JVHL 4KPYA 3L3UA 3IFRA 1KTQA 4XH4A 3OS0A 3VA3A 3AVCA 5AQLA 4YOXA 3T3FA 5KRSA 3QB0A 2YKMA 5IWAK 4FWKA 4DCHA 2GBZA 3OJSA 1T6DA 4I6MA 4H0PA 3KWIA 5M1NA 3TR8A 1KFDA 4DR2K 5FLXO 4RTFD 3I0SA 2QEXN 4O55A 2D0AA 3FR0A 3B6PA 2O8CA 2CGKA 4B1XB 3FZLA 3JS6A 4FOEA 2HVHA 5KRTA 4JN4A 2QWMA 4JI8K 5B8HA 4FK2A 1JLQA 1D9DA 5ADXA 2PBDA 2EHGA 1TK8A 4DF4A 1SV5A 5CYQA 2BGGA 1CLQA 4FJ5A 1QS4A 5KGWA 4CFAA 3TARA 4A2BA 4RW4A 1HR0K 4HCCA 3A5NC 1LWFA 4FJ7A 2PZSA 4OKKA 3NF9A 2XHBA 3TWHA 3ZETA 4CZEA 2A42A 1ZYQA 2W41A 3VQ9A 4Y1DA 3HP9A 1JLBA 5AQXA 3S41A 3WXMB 4FW1A 4M3YA 1A5XA 5M1OA 4YOUA 3SBGA 3CC4N 1L3VA 3KLFA 4F4KA 3PIPL 1ATRA 4C8NA 3SQ2A 3FFIA 3P1GA 4GV9A 3DLKA 4GV3A 4N76A 2HHUA 2VG5A 4J2BA 1TKXA 1XNQK 1S6PA 3O8MA 3TANA 3R6MA 3V81A 2I7NA 3D2EB 1NJXA 1BGXT 1HJOA 2BANA 3KIOA 2V7ZA 5M1PA 1BOTO 3AV9A 1RT3A 1VQON 3OA9A 2GUIA 4GKKK 1N33K 3DLGA 4WQ5A 3CJ7A 1SS6A 5J1EA 3O5BA 1NMNA 3T1YK 4ZHRA 1K73O 4DWIA 2P9PA 4CHPA 4OGEA 4E1MA 2G8KA 2ZD1A 4JS4A 4E19A 3GBTA 4QCLA 1GOCA 2ATQA 1ILYA 2XY8A 2V51B 1Q9YA 3O1WA 2P9PB 1JL2A 1NMDA 4PA1A 1LOTB 4CEBA 3RR7A 3KLIA 4C8OA 2F9WA 1KAYA 5KPZA 1VQ8N 1VQKN 3VPZA 4FLZA 5EOYA 1RFQA 2YV0X 3VTIA 3WXJA 4BRLA 3TAEA 4CF2A 2HHQA 4PWDA 1OH7A 2R7YA 1D5AA 4DU4A 4U67L 3UB5A 1S22A 2OPSA 4N5SA 3K0SA 4Z4HA 2GV9A 1WSGA 4C8LA 4DTUA 1KC8O 4FZXC 5HRRA 1SL2A 2YJEA 4M7XA 1ZXOA 2KZZA 4O5FA 4BVPA 5AQKA 2G8VA 3NGYA 2JLEA 3EEQA 4B1ZA 4FJNA 4BE0A 5TKWA 3OYHA 4DR3K 1NJZA 3VMFB 4N41A 4QAGA 3SJHA 3R8EA 1BG3A 4RWTA 1BIUA 4DUZK 4BC2A 4A5BA 3ULEA 4M3WA 3B8AX 1WNSA 1I94K 4KTQA 2D0OA 5JS1A 4KI6A 4LY7A 4TSXA 2UUBK 2A5XA 2CH5A 4JNEA 3BUZB 1CZ9A 2UUCK 4CZGA 2X6SA 1DTQA 1IKWA 1BCMA 2AP1A 4Y0WA 5J2NA 4LH4A 2Y1JA 4JI2K 5AQPA 1LAWA 3LWMA 4JHDA 1EO1A 2HHSA 1F21A 4MO5A 2AA4A 3M1FA 4DFJA 3TAQA 4CJ3A 2OANA 4CHOA 4DSLA 4CGFA 2HHHK 3CJAA 1RT6A 3CJBA 4JD2B 5FPNA 4O8KA 1E4GT 4DTMA 1VRUA 2F9TA 3BF1A 1I3AA 3O1BA 4M3UA 1VRTA 1NK6A 1KSPA 4J8FA 3WXKA 3MCAB 4B9QA 2YJFA 2QWQA 4IFYA 1GLEG 2WTUA 1FK9A 5LMNK 2QWPA 2ITMA 3VERA 4A62A 4U7BA 3HP6A 4IFEA 4JK9A 4E7JA 3RSEA 4AILC 1QSLA 4BDZA 3EY1A 5JMVA 2D5RA 3AA2A 4Z4GA 1HKGA 2IVOA 1KQSM 3DAWA 3QBWA 5AQIA 3VQ8A 1U2VA 4C8MA 5C25A 4KTWA 1WOQA 2P5OA 2GTDA 2NLXA 4NXNK 1WBDA 1U47A 5C12A 5FPDA 1ASVA 4ELUA 4R5PA 4FPAA 3AGKA 4OO1J 4AHCA 3ZLJA 4ZTFA 4FK4A 5LJWA 3SUOA 3SI6A 1FXXA 4O5BA 4A61A 4NCBA 4B8CA 2CGLA 3D6RA 3ENBA 2QXFA 4BR4A 4DG1A 3BGRA 4E1NA 4RW7A 1SQKA 2P5GA 3A5LC 3HRGA 1ATNA 1JLFA 1S5JA 2P9IB 1NKBA 3UIQA 4CK1A 5BRFA 1S1XA 1OVQA 3G25A 1XNRK 2VQFK 4EFHA 1NGGA 3L2WA 4HCBA 5BRDA 3OW2M 1CZBA 3M8QA 3OYMA 4BGAA 1X1PA 3I56N 1YHQN 2G8IA 1YJWN 3ID8A 2WONA 3O3FA 2QWNA 1JXBA 3CCQN 3UKRB 3H45C 2FSKA 4QS7A 3CJ9A 2E20A 1KVAA 4LF7K 1QSSA 5F2RA 3AA3A 4IBNA 3S3MA 2ITGA 1QVFM 2P9UA 3RRHA 1XHXA 3O4QA 1XC9A 1M1KO 4L8RB 5KQ8A 4AHUA 4DUYK 4B3RK 1VQ7N 3THXB 3L2VA 2ZWHA 1N34K 4DSIA 4GY2B 2QXLA 1QTMA 4BWJA 3CC7N 2HSTA 4IOXA 4OPHA 3R9PA 3THWA 1HNIA 3LM2A 2UUAK 4KRFA 4YFUA 3AVIA 5AQZA 2OZMA 4IWVA 3ZSWA 5J2MA 2OZSA 3EKSA 3HOTA 4Q5VA 4MDBA 1HKBA 4PUOA 4H5RA 2O8EB 3IG1A 4E7HA 4EZ9A 1TAUA 5BR8K 2NRTA 4DV6K 2JGUA 1D9FA 4HWIA 2E2QA 3QFUA 3C7NA 3QNNA 2YHAA 1Q82O 3VEYA 4CGGA 1JXEA 1FKPA 4LC9B 3SUNA 3ULDA 1YTUA 3TU5A 1BQMA 4CHNA 4CF1A 1J5OA 2KFZA 4FM1A 3ZX3A 3FZFA 1UAXA 2ASPA 1HMVA 2OPQA 1RT5A 4K25A 3ZEUA 1JJ2M 1QZ5A 1R59O 4CJKA 1W97L 4DV0K 2HBJA 4IEIA 2P1JA 3CM6A 4JKGB 4ELTA 4W5NA 4IDHA 4CI6A 3LDNA 3KK3A 4G1QA 2ZGYA 3MX2A 1JLGA 4DR1K 1XMOK 1TKDA 1K8KB 2F96A 3WNHA 3F5TA 3NH1A 4DR6K 4B9LA 2O4GA 5C10A 4FJXA 4CCHA 3A5MC 3I8DA 4FJIA 3AVAA 4CZJA 2OTJN 3LM9A 3ZT2A 4LH5A 3QIPA 3OBWA 4ID1A 3NF7A 4PQUA 5E26A 1REVA 1HNZK 2KZMA 2IGIA 3MN5A 3OS2A 1W9HA 3PLAA 4KREA 3AGRA 3O9SA 1QHAA 4DTPA 4XH1A 1U04A 4OKEA 2BDPA 3SYZA 3Q7CA 4CHQA 3VA0A 4Z0UA 4LSNA 2VQEK 4XH5A 3L2QA 4DTOA 3LALA 3AAPA 4HTUA 3MCPA 1C0TA 3WNGA 3WQUA 1A5WA 1S9EA 4B3OA 1NK5A 4Z4EA 3L3VA 2CH6A 3DLRA 2KQ2A 3WUHA 3VQQA 3CC2N 3CD6N 2FSNA 3H6EA 4BR9A 3TSUA 1IKXA 4BREA 2FBVA 2E1YA 1SUQA 1YUWA 4GVMA 3RMBA 3DLBA 4FWNA 4ICLA 2F4VK 1OVYA 4WQ4A 4CEFA 3DM2A 3U4LA 2VG6A 1QE1A 4CW7B 1QHTA 4YORA 3FGUA 1BU6O 3KZBA 1WUAA 1ASUA 1Q86O 5AQFA 1Y97A 1NGHA 3FZKA 3T69A 2NRVA 1QQNA 1L3SA 1VQ6N 4CZHA 3A5OC 2OYQA 3K9JA 1SL1A 3PX6A 3NGIA 4O44A 5I9EB 3MXIA 3CI5A 4JI6K 4FPBA 4ID5A 4UY8O 3GE1A 4BGBA 3MXMA 2BE2A 5CYMA 1DLOA 2G8WA 4JKFA 4YDUC 3U3YA 1X9JA 1KXPA 3O9TA 3O6WA 3MX5A 4ILJA 3CIPA 4EZ6A 4FJ9A 3CQXA 3SUPA 1NBWA 2GUPA 2UXBK 1EETA 2I5JA 4Y1CA 4DLGA 4BWMA 5M1FA 4BRIA 1ZBIA 3TTCA 3HOSA 3RTVA 3AVMA 4ISEA 3DXKA 1L5UA 1VSIA 4I9QA 1YVUA 4CEAA 2BUPA 4BE1A 5FRMA 1X9SA 4C23A 1Y64A 2O8BB 3NVMA 4NLBA 4RG8A 4JKAA 3NAEA 4OX9K 1YITN 4KH5A 4BC4A 3SMPA 1YT3A 4N56A 3V9UA 3MDQA 1NK7A 3OYDA 4Z4CA 1NKCA 3TPQA 3K2PA 3T19A 2A1SA 1XQSC 4KHPK 1XUPO 4NXMK 4CJ7A 1RBUA 1NWKA 3HL8A 1U6ZA 5HOOA 2VCPA 4CK2A 1RT1A 4DV7K 1DEJA 2Z1HA 3ZX0A 1IG8A 1NM1A 5A2QO 3VTHA 1GLAG 3VGKA 1FJGK 4DS5A 4B3SK 3OYKA 4CGIA 3W0LA 5HBMA 4DB3A 4CZFA 5K14A 2WC9A 2HBMA 3ID6A 5SWMA 3M5RA 5AQUA 2HOEA 2E4LA 3G0ZA 4IG3A 2XO7A 3M8SA 2HVIA 4CEDA 1JLEA 3JSMA 1NGBA 1C0FA 1K6YA 3VQ7A 1YIJN 5TKYA 3CCUN 3OYGA 4F9OA 4B9TA 3MECA 5C2DA 1RNHA 4Q0BA 4K8ZA 1DGKN 3MK6A 1BHLA 2E6MA 4F2SA 2ETJA 5HLFA 3LZIA 4FXDA 4KHYA 3L2RA 1BQNA 1LWCA 2A6AA 1VQ5N 3NF8A 3SPZA 4HUFA 1VAZA 4JI1K 5DM7L 3EE8A 4YHHK 5AQWA 4KTZA 3ZSQA 3BEXA 4LF6K 4B9UA 1SAZA 2QKBA 2QKKA 3VENA 3CM5A 3AY9A 5I3UA 3U3GA 1YJ9N 4H0XB 3T1AA 4H03B 1K9MO 4CGJA 2PAVA 3ZYYX 3D2EA 4I7FA 4IOCL 4KH6A 5ELZA 3WNFA 3L0QA 4NB4A 3B6OA 4JLHA 4JKCA 4PHTX 3LL3A 5J2QA 4BR2A 1T44A 1VSJA 3LDLA 3TAPA 3TSQA 1HJRA 3AA5X 1RBRA 3V4IA 1C0MA 4BRCA 3SZ2A 3VEZA 1QSYA 5IT9O 4F2RA 4MO4A 2D0BA 4JS5A 3K5MA 1WB9A 3KK7A 2UYTA 3HPGA 4KHUA 3AVJA 4FCYA 4CVNE 5AQYA 4FZYA 1WSJA 5LY3A 2Q2RA 3ZT3A 2OPPA 1Z26A 1HPZA 2DTUA 3IS9A 1U49A 3G10A 2PFUA 4CIEA 2ZF5O 4FWQA 4CD1A 3GDQA 3T1HK 3NGZA 4IXCA 2GWKA 1NK0A 2QM1A 2UXCK 4KHQA 1EKEA 3OYBA 2YHXA 3DI6A 4KI4A 3D2FB 3LPUA 3BZCA 3MXJA 3VQAA 4AH9A 1V4SA 2O4IA 5HP1A 1T3VA 5AQRA 5CY4A 4QS8A 3LDOA 3LZJA 5DK5A 4DV3K 4CZKA 3PV8A 2KHOA 3D7EO 1RTJA 1N36K 5GAHP 1RBSA 1X3NA 3EN9A 3F2KA 3CHWA 1EP4A 4YOTA 5JLHA 4E3SA 3V9WA 4BC5A 3CERA 1HPMA 1Z05A 3N4PA 1T6CA 2WFBA 3LWLA 1HYSA 3JAMO 1RILA 3HTVA 4KFBA 2KKZA 1C6VA 3EE9A 1C0UA 2YNGA 4JK8A 3UKUB 4OKJA 4IOAL 3NCIA 2A1RA 1X9WA 3J80O 1KLNA 4JD2A 3ZT0A 3H1VX 2FF3B 3RMAA 3QO9A 3CQYA 4B1WB 4IEEA 4BDPA 4J2EA 2F8TA 4CEZA 5BN9A 4JKEA 2Q31A 4BRKA 3PSIA 4CJVA 3CMEN 4KAZA 3HXMA 3H46O 1RT2A 2F8SA 3IAYA 4CJUA 4WYBA 2P9LB 1VQPN 3CPWM 1IO2A 4BQZA 4M3XA 4JEPA 1ATSA 3P4IA 1JCEA 3NHGA 3MN9A 4B8AB 1NK4A 3VOVA 1J54A 2OA8A 4BVOA 4QS9A 1D8YA 3EZ5A 4HVJA 5AZJB 4B3TK 1RDWX
chains in the Genus database with same CATH topology
4EP4A 3QNNA 1S1VA 2YHAA 3AVLA 4CEQA 3O3GA 4I9LA 5CZ1A 1HYVA 4CIFA 3H08A 5KI6A 4CGGA 3RMCA 1JXEA 1MU2A 1FKPA 2HNDA 1ASWA 2IS3A 3OVNA 3ULDA 3OYIA 3HPHA 3SUNA 3SPYA 2WOMA 3MAQA 3F73A 1BQMA 1YTUA 1J9AA 2YNFA 4CHNA 2Z1IA 4DU3A 4CF1A 1J5OA 4RW8A 1YTAA 1NK8A 4B08A 2KFZA 4WE1A 4FM1A 3DYAA 4AHTA 4NYNA 4M41A 2DY4A 1UAXA 3KKSA 4ELVA 4OVLA 3O4NA 2IOCA 4FLWA 4DTRA 1B9FA 1HMVA 1QQCA 2OPQA 4CGDA 3AA4A 3CFPA 1RT5A 4GW6A 3QEXA 2HB5A 4E0DA 4OLBA 2Z1GA 2IC3A 4UQGA 3RRGA 2W42A 3C6UA 4W5OA 4DQIA 3LPTA 1JKHA 3MEDA 4CJKA 3KK1A 3AO4A 1VSMA 4J2AA 3KLHA 1C1CA 4FVMA 1RDDA 5E41A 3WNEA 4ZTJA 2P1JA 2NUBA 3CM6A 4I2PA 3DRRA 4ELTA 1VSDA 4FJ8A 4W5NA 1C1BA 1HQEA 3DOKA 4H4MA 4CJPA 3CQ8A 4DS4A 4LSLA 5HRSA 1KRPA 4DSJA 4CJ4A 4DSKA 1N5YA 3KK3A 4G1QA 4CIGA 1DTTA 4CJSA 4CJWA 3DRSA 3O3HA 1JLGA 3OYAA 1IKYA 4JRPA 3RMDA 1TKDA 1TVRA 3PUFA 3AVGA 4CK3A 3NH0A 2PY5A 2F96A 3WNHA 2E6LA 1U48A 3NBPA 3NH1A 4W5TA 1S9GA 1NK9A 3CYMA 3K5OA 1WSFA 4B9LA 1CXUA 2O4GA 1SKSA 3BDPA 4FJXA 4CCHA 3SQ4A 3I8DA 3ALYA 4FJIA 3AVAA 4Z4FA 4HHTA 3ZT2A 4LH5A 3QIPA 4KPYA 4KREA 3L3UA 4OLAA 4ID1A 3NF7A 4PQUA 1KTQA 3ZSXA 1REVA 5C42A 1SKWA 2KZMA 3MEGA 2IGIA 1NJYA 5KGXA 3OS2A 1W9HA 3OS0A 1B9DA 3A2FA 3ZT1A 3VA3A 1VK0A 2FC0A 2XRIA 3AVCA 3T3FA 2DFHA 5KRSA 4DTPA 4QOZB 1U04A 2YKMA 3SJJA 4OKEA 5KTQA 2BDPA 1RTIA 4YNQA 4GMJB 2PYLA 2GBZA 4BDYA 3SYZA 4CHQA 4CERA 3VA0A 4Z0UA 3OJSA 4DF8A 1L3UA 4IFVA 3K5LA 1GOBA 3TR8A 1KFDA 4LSNA 3KKRA 1TKZA 3L2QA 4DTOA 2HMIA 3I0SA 3LALA 3M8RA 4O55A 2D0AA 3B6PA 3SV3A 2Q3SA 5DMRA 4HTUA 2HVHA 1C0TA 3WNGA 5KRTA 1JLAA 2G8HA 1A5WA 4KHNA 3K57A 1S9EA 3VQ4A 4B3OA 3D0PA 1TAQA 1NK5A 4FK2A 4Z4EA 1JLQA 1D9DA 1TL1A 3L3VA 1W0HA 3DLRA 2KQ2A 3S9HA 4NYFA 3VQQA 3HSTB 3CG7A 4O4GA 3TAMA 4NCAA 2EHGA 3ASMA 1TK8A 4DF4A 1SV5A 1WSEA 5CYQA 2BGGA 1CLQA 1EX4A 1IKXA 2RF2A 2FBVA 4FJ5A 3DMJA 1SUQA 4NCGA 4GVMA 2YKNA 3OS1A 3OY9A 1QS4A 3RMBA 5KGWA 4CFAA 4CHZA 3TARA 4MFBA 4RW4A 1RTDA 4HCCA 1LWFA 3DLBA 4FJ7A 2PZSA 4ICLA 3ZSOA 3OJUA 4OKKA 3NF9A 2XHBA 4CEFA 4E7IA 3DM2A 3ZT4A 1A5VA 1ITGA 3TWHA 4E89A 2VG6A 1ZYQA 4F3TA 1QE1A 1QHTA 3VQ9A 2ZQBA 1RBTA 3DLEA 4Y1DA 3HP9A 4B9SA 4FJKA 4FYDA 4DFMA 1JLBA 4FW1A 4M3YA 3K5NA 1ASUA 1A5XA 1Q9XA 4CECA 1L3VA 1Y97A 1WSHA 3KLFA 4F4KA 4OPJA 4C8NA 3SQ2A 3FFIA 4E7LA 3P1GA 1L3SA 1WLJA 3DLKA 4M3RA 1BIZA 1NOZA 3C95A 2OYQA 4AHRA 4N76A 4CEEA 1SL1A 2VG5A 3PX6A 4J2BA 2HHUA 2VG7A 4O44A 3NGIA 1TKXA 2YNHA 3MXIA 3AO5A 4KB1A 4ID5A 1S6PA 3TANA 3MXMA 1RBVA 3V81A 2BE2A 2FBYA 3V1RA 2VWKA 5CYMA 3F9KA 3LP3A 1BGXT 1DLOA 3AO1A 4H8KA 3K59A 4E7KA 2BANA 3KIOA 2G8WA 3U3YA 4KKOA 4IG0A 4IDKA 2XY5A 1LW0A 3AV9A 4DU1A 4O0IA 1S1UA 1LV5A 4EZ6A 2QK9A 4FJ9A 3D45A 1RT3A 2FBXA 3AO2A 3SUPA 3SQ1A 2KW4A 2GUIA 3AO3A 3SCXA 3DLGA 2HNZA 1O1WA 4CJ5A 4CJRA 1ZBLA 3KD1E 4FJHA 1G15A 1EETA 5J1EA 2I5JA 3AVNA 4Y1CA 1Z25A 4ZHRA 3NH2A 3LDSA 4CHPA 4DLGA 1TGOA 1VSHA 4DWIA 3HYFA 3OYLA 1TK5A 2ZE2A 4OGEA 4BWMA 4E1MA 1ZBIA 2G8KA 3RTVA 2ZD1A 3AVMA 4CHYA 4JS4A 4E19A 4AHVA 4QCLA 1GOCA 1CXQA 3S3NA 4CFBA 1L5UA 2ATQA 4FJGA 1VSIA 4I9QA 1YVUA 2XY8A 4CEAA 1T03A 1Q9YA 1B92A 1RTHA 4BE1A 3QEIA 1BISA 5FRMA 1X9SA 1JL2A 4PA1A 4CEBA 1XHZA 2G8FA 5HROA 3RR7A 4CJTA 1ZBFA 3KLIA 3OYNA 1L3TA 1T05A 4C8OA 4OJRA 2YHBA 2Z1JA 1SKRA 4B9NA 4RG8A 3NAEA 1S6QA 4N56A 1YT3A 3V9UA 1NK7A 3OYDA 4Z4CA 4FLZA 1C1AA 1NKCA 3K2PA 2YV0X 3ZSRA 4BACA 3KLEA 3TAEA 4KHWA 3T19A 2A1SA 3SQ0A 3QEWA 4CF9A 4CF2A 2HHQA 1RBUA 4HUGA 4PWDA 3HL8A 3JYTA 1D5AA 3VQEA 3CFRA 2R7YA 4DU4A 1KFSA 4CK2A 1IG9A 4DQRA 4FJJA 1RT1A 2OPSA 4N5SA 1LWEA 2Z1HA 3LAKA 4Z4HA 1HRHA 3V1OA 1VSLA 2GV9A 1WSGA 3QETA 4C8LA 3VQ6A 3V9SA 3EYZA 1T7PA 4CJLA 3NE6A 4DS5A 3OYKA 2HNYA 1S1TA 1HQUA 3AVHA 4CGIA 4DTUA 3SUQA 1XI1A 2G8UA 5HBMA 4FZXC 5HRRA 4M42A 1SL2A 5K14A 1WAJA 4OPKA 2HHWA 3I0RA 5SWMA 1U45A 2KZZA 2E4LA 3DRPA 3G0ZA 2G8VA 4KHSA 4IG3A 2XO7A 4MQ3A 3NGYA 2JLEA 3M8SA 4CEDA 4DTXA 4FJNA 2HVIA 4BE0A 1JLEA 5FROA 3OYHA 4CFCA 3JSMA 3SV4A 1NJZA 3P5JA 1K6YA 3VQ7A 2HHTA 4N41A 4QAGA 1UOCA 3OYGA 3HPOA 1BIUA 4B9TA 1UA0A 3MECA 4M3WA 4KTQA 1WNSA 5JS1A 1RNHA 4M45A 4Q0BA 4K8ZA 3ISNC 4LY7A 4KI6A 5CZ2A 4KO0A 1R0AA 1BHLA 2E6MA 3LAMA 2ETJA 4TSXA 5HLFA 1BL3A 3AVBA 3LZIA 3SNNA 1N6QA 4F2SA 3L2RA 1BQNA 4KHYA 1LWCA 3HVTA 4FXDA 1CZ9A 4FLVA 3RR8A 3PO4A 2X6SA 3NF8A 1DTQA 3CFOA 1IKWA 1BCMA 5J2NA 3TAGA 3SPZA 4HUFA 4LH4A 2B4JA 1JLCA 3L2UA 2Y1JA 3V9XA 1LAWA 3LWMA 4KTZA 1TKTA 3LP2A 3ZSQA 4RW9A 3QEPA 2HHSA 4B9UA 1F21A 3OYJA 2QKBA 2QKKA 4DQSA 5FRNA 1KVCA 3CM5A 4DFJA 5I3UA 3U3GA 4CESA 3TAQA 1S1WA 4CJ3A 4OGCA 4FLYA 1UA1A 3T1AA 4CHOA 2XY7A 1BI4B 4DSLA 4CGJA 4CGFA 1RT6A 3VQDA 4FLTA 4I7FA 4DTMA 1VSEA 4DSEA 3M8PA 4N47A 4FLXA 1VRUA 3ZCMA 1T8EA 3OYFA 2VWJA 4FM2A 2EX3A 1I3AA 3WNFA 4M3UA 1VRTA 4CEOA 4IKFA 1RT4A 2IAJA 1NK6A 3B6OA 3IRXA 2RKIA 4JLHA 1KSPA 2DFEA 4JRQA 2HW3A 1KVBA 4IFYA 4FZZA 4DTJA 5J2QA 3ZSZA 2B6AA 1NJWA 2PYJA 3DLHA 2KTQA 1WAFA 2AJQA 4J2DA 1FK9A 1VSJA 5FDLA 3TAPA 1NJXA 5I42A 3NFAA 2D0CA 1HJRA 3AA5X 1RBRA 4CE9A 3V4IA 1C0MA 3HP6A 3SZ2A 4E7JA 4CGHA 1QSYA 4F2RA 4JS5A 2D0BA 4DLEA 4DSFA 3K5MA 4XIUA 4AILC 1U4BA 3K58A 1QSLA 1LAVA 4BDZA 3ZSYA 3HPGA 1VSKA 3EY1A 4KHUA 3AVJA 1HNVA 4FCYA 1SL0A 1RT7A 1HYZA 1FKOA 2D5RA 3AA2A 5T7BA 4DTNA 4RW6A 4Z4GA 4CFDA 4FZYA 3L8BA 1WSJA 1Q8IA 4F3OA 2RN2A 5J2PA 3VQ8A 2OPRA 3S3OA 1I39A 2OPPA 1Z26A 3ZT3A 1HPZA 1WN7A 2DTUA 3IS9A 4C8MA 1U49A 3G10A 5C25A 4CIEA 4KTWA 2P5OA 4W5RA 1U47A 3V6DA 1GOAA 1ASVA 3PX4A 4ELUA 4R5PA 3NGZA 3TI0A 1EXQA 1NK0A 2B5JA 4CJFA 4AHCA 4KHQA 4ZTFA 1EKEA 1TV6A 4FK4A 3OYBA 3QINA 3DI6A 5SZTA 4KI4A 1LW2A 3LPUA 3MXJA 3SUOA 3HO1A 3SI6A 1FXXA 3VQAA 4O5BA 4NCBA 4BE2A 4B8CA 4AH9A 2O4IA 5D3GA 1XWLA 5HP1A 2QXFA 3OYCA 4DG1A 4E1NA 3BGRA 3PX0A 2IDOA 4RW7A 3VN5A 3VQCA 5CY4A 2P5GA 3HJFA 5EU7A 2HHXA 4KB0A 3QIOA 3LZJA 1JLFA 1S5JA 1J53A 4DFPA 3MEEA 5DK5A 4CF0A 3PV8A 1NKBA 4CK1A 3UIQA 4Z4IA 1UWBA 1S1XA 2X6NA 4FLUA 1IKVA 1RTJA 3V1QA 4CF8A 4K8XA 4LD0A 3L2WA 4HCBA 1RBSA 2DFFA 1KCFA 1TK0A 1EP4A 4HUEA 1CZBA 1RDAA 3C94A 3M8QA 3ITHA 1NKEA 4B9MA 3OYMA 4E3SA 3V9WA 3KK2A 4M3TA 1RDCA 1X1PA 4EP5A 1WSIA 3KJVA 3PY8A 2G8IA 5HRNA 2WONA 3O3FA 3NDKA 3LWLA 3VQPA 1NOYA 4FM0A 1HYSA 3THVA 1RILA 3QEVA 1JXBA 3KD5E 4KFBA 1TL3A 4FJMA 1C6VA 3P83D 4F8RA 2X78A 4CJQA 2X74A 1C0UA 2YNGA 3HT3A 3VQBA 2RPIA 4CJEA 3HM9A 4OKJA 4O0JA 3U6FA 1KVAA 3KLGA 1ZBHA 3AVKA 3VQ5A 3QNOA 3ZSVA 3NCIA 4M3ZA 2Y1IA 2A1RA 1X9WA 1QSSA 1KLNA 3AA3A 4DFKA 1RDBA 1BI4A 4IBNA 3S3MA 4AHSA 3AVFA 2ITGA 3E01A 3ZT0A 3RRHA 3QERA 5JS2A 4PY5A 3RMAA 1XHXA 3O4QA 1XC9A 3QO9A 4H4OA 1KLMA 4FW2A 4J2EA 2LSNA 3QLHA 4BDPA 4L8RB 2F8TA 4CEZA 5HRPA 3KTQA 4DQPA 3LANA 4AHUA 1X9MA 5C24A 4B9VA 2XY6A 3HK2A 2HHVA 1ZBUA 1RCHA 4C8KA 3OYEA 3V9ZA 3L2VA 4DSIA 1BCOA 4CJVA 4KAZA 1QTMA 4BWJA 4I2QA 3HXMA 4DTSA 1RT2A 3C6TA 2F8SA 2YNIA 3IAYA 4FK0A 3RWUA 4CJUA 4KV8A 3QESA 1HNIA 4KRFA 1IO2A 4M3XA 4YFUA 3AVIA 2OZMA 2OZSA 3ZSWA 5J2MA 3TABA 4DQQA 1JL1A 3NHGA 3PO5A 4Q5VA 4B8AB 1NK4A 2FBTA 1J54A 1VSFA 4PUOA 4W5QA 2OA8A 1D8YA 2KFNA 1IH7A 3DOLA 3LP1A 4DMNA 3IG1A 4HVJA 3EZ5A 4E7HA 3TAFA 4FJLA 4EZ9A 1TAUA 3NF6A 3LP0A 2JGUA 1D9FA 2P51A 3HVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EP4 A;  3QNN A;  1S1V A;  2YHA A;  3AVL A;  4CEQ A;  3O3G A;  4I9L A;  5CZ1 A;  1HYV A;  4CIF A;  3H08 A;  5KI6 A;  4CGG A;  3RMC A;  1JXE A;  1MU2 A;  1FKP A;  2HND A;  1ASW A;  2IS3 A;  3OVN A;  3ULD A;  3OYI A;  3HPH A;  3SUN A;  3SPY A;  2WOM A;  3MAQ A;  3F73 A;  1BQM A;  1YTU A;  1J9A A;  2YNF A;  4CHN A;  2Z1I A;  4DU3 A;  4CF1 A;  1J5O A;  4RW8 A;  1YTA A;  1NK8 A;  4B08 A;  2KFZ A;  4WE1 A;  4FM1 A;  3DYA A;  4AHT A;  4NYN A;  4M41 A;  2DY4 A;  1UAX A;  3KKS A;  4ELV A;  4OVL A;  3O4N A;  2IOC A;  4FLW A;  4DTR A;  1B9F A;  1HMV A;  1QQC A;  2OPQ A;  4CGD A;  3AA4 A;  3CFP A;  1RT5 A;  4GW6 A;  3QEX A;  2HB5 A;  4E0D A;  4OLB A;  2Z1G A;  2IC3 A;  4UQG A;  3RRG A;  2W42 A;  3C6U A;  4W5O A;  4DQI A;  3LPT A;  1JKH A;  3MED A;  4CJK A;  3KK1 A;  3AO4 A;  1VSM A;  4J2A A;  3KLH A;  1C1C A;  4FVM A;  1RDD A;  5E41 A;  3WNE A;  4ZTJ A;  2P1J A;  2NUB A;  3CM6 A;  4I2P A;  3DRR A;  4ELT A;  1VSD A;  4FJ8 A;  4W5N A;  1C1B A;  1HQE A;  3DOK A;  4H4M A;  4CJP A;  3CQ8 A;  4DS4 A;  4LSL A;  5HRS A;  1KRP A;  4DSJ A;  4CJ4 A;  4DSK A;  1N5Y A;  3KK3 A;  4G1Q A;  4CIG A;  1DTT A;  4CJS A;  4CJW A;  3DRS A;  3O3H A;  1JLG A;  3OYA A;  1IKY A;  4JRP A;  3RMD A;  1TKD A;  1TVR A;  3PUF A;  3AVG A;  4CK3 A;  3NH0 A;  2PY5 A;  2F96 A;  3WNH A;  2E6L A;  1U48 A;  3NBP A;  3NH1 A;  4W5T A;  1S9G A;  1NK9 A;  3CYM A;  3K5O A;  1WSF A;  4B9L A;  1CXU A;  2O4G A;  1SKS A;  3BDP A;  4FJX A;  4CCH A;  3SQ4 A;  3I8D A;  3ALY A;  4FJI A;  3AVA A;  4Z4F A;  4HHT A;  3ZT2 A;  4LH5 A;  3QIP A;  4KPY A;  4KRE A;  3L3U A;  4OLA A;  4ID1 A;  3NF7 A;  4PQU A;  1KTQ A;  3ZSX A;  1REV A;  5C42 A;  1SKW A;  2KZM A;  3MEG A;  2IGI A;  1NJY A;  5KGX A;  3OS2 A;  1W9H A;  3OS0 A;  1B9D A;  3A2F A;  3ZT1 A;  3VA3 A;  1VK0 A;  2FC0 A;  2XRI A;  3AVC A;  3T3F A;  2DFH A;  5KRS A;  4DTP A;  4QOZ B;  1U04 A;  2YKM A;  3SJJ A;  4OKE A;  5KTQ A;  2BDP A;  1RTI A;  4YNQ A;  4GMJ B;  2PYL A;  2GBZ A;  4BDY A;  3SYZ A;  4CHQ A;  4CER A;  3VA0 A;  4Z0U A;  3OJS A;  4DF8 A;  1L3U A;  4IFV A;  3K5L A;  1GOB A;  3TR8 A;  1KFD A;  4LSN A;  3KKR A;  1TKZ A;  3L2Q A;  4DTO A;  2HMI A;  3I0S A;  3LAL A;  3M8R A;  4O55 A;  2D0A A;  3B6P A;  3SV3 A;  2Q3S A;  5DMR A;  4HTU A;  2HVH A;  1C0T A;  3WNG A;  5KRT A;  1JLA A;  2G8H A;  1A5W A;  4KHN A;  3K57 A;  1S9E A;  3VQ4 A;  4B3O A;  3D0P A;  1TAQ A;  1NK5 A;  4FK2 A;  4Z4E A;  1JLQ A;  1D9D A;  1TL1 A;  3L3V A;  1W0H A;  3DLR A;  2KQ2 A;  3S9H A;  4NYF A;  3VQQ A;  3HST B;  3CG7 A;  4O4G A;  3TAM A;  4NCA A;  2EHG A;  3ASM A;  1TK8 A;  4DF4 A;  1SV5 A;  1WSE A;  5CYQ A;  2BGG A;  1CLQ A;  1EX4 A;  1IKX A;  2RF2 A;  2FBV A;  4FJ5 A;  3DMJ A;  1SUQ A;  4NCG A;  4GVM A;  2YKN A;  3OS1 A;  3OY9 A;  1QS4 A;  3RMB A;  5KGW A;  4CFA A;  4CHZ A;  3TAR A;  4MFB A;  4RW4 A;  1RTD A;  4HCC A;  1LWF A;  3DLB A;  4FJ7 A;  2PZS A;  4ICL A;  3ZSO A;  3OJU A;  4OKK A;  3NF9 A;  2XHB A;  4CEF A;  4E7I A;  3DM2 A;  3ZT4 A;  1A5V A;  1ITG A;  3TWH A;  4E89 A;  2VG6 A;  1ZYQ A;  4F3T A;  1QE1 A;  1QHT A;  3VQ9 A;  2ZQB A;  1RBT A;  3DLE A;  4Y1D A;  3HP9 A;  4B9S A;  4FJK A;  4FYD A;  4DFM A;  1JLB A;  4FW1 A;  4M3Y A;  3K5N A;  1ASU A;  1A5X A;  1Q9X A;  4CEC A;  1L3V A;  1Y97 A;  1WSH A;  3KLF A;  4F4K A;  4OPJ A;  4C8N A;  3SQ2 A;  3FFI A;  4E7L A;  3P1G A;  1L3S A;  1WLJ A;  3DLK A;  4M3R A;  1BIZ A;  1NOZ A;  3C95 A;  2OYQ A;  4AHR A;  4N76 A;  4CEE A;  1SL1 A;  2VG5 A;  3PX6 A;  4J2B A;  2HHU A;  2VG7 A;  4O44 A;  3NGI A;  1TKX A;  2YNH A;  3MXI A;  3AO5 A;  4KB1 A;  4ID5 A;  1S6P A;  3TAN A;  3MXM A;  1RBV A;  3V81 A;  2BE2 A;  2FBY A;  3V1R A;  2VWK A;  5CYM A;  3F9K A;  3LP3 A;  1BGX T;  1DLO A;  3AO1 A;  4H8K A;  3K59 A;  4E7K A;  2BAN A;  3KIO A;  2G8W A;  3U3Y A;  4KKO A;  4IG0 A;  4IDK A;  2XY5 A;  1LW0 A;  3AV9 A;  4DU1 A;  4O0I A;  1S1U A;  1LV5 A;  4EZ6 A;  2QK9 A;  4FJ9 A;  3D45 A;  1RT3 A;  2FBX A;  3AO2 A;  3SUP A;  3SQ1 A;  2KW4 A;  2GUI A;  3AO3 A;  3SCX A;  3DLG A;  2HNZ A;  1O1W A;  4CJ5 A;  4CJR A;  1ZBL A;  3KD1 E;  4FJH A;  1G15 A;  1EET A;  5J1E A;  2I5J A;  3AVN A;  4Y1C A;  1Z25 A;  4ZHR A;  3NH2 A;  3LDS A;  4CHP A;  4DLG A;  1TGO A;  1VSH A;  4DWI A;  3HYF A;  3OYL A;  1TK5 A;  2ZE2 A;  4OGE A;  4BWM A;  4E1M A;  1ZBI A;  2G8K A;  3RTV A;  2ZD1 A;  3AVM A;  4CHY A;  4JS4 A;  4E19 A;  4AHV A;  4QCL A;  1GOC A;  1CXQ A;  3S3N A;  4CFB A;  1L5U A;  2ATQ A;  4FJG A;  1VSI A;  4I9Q A;  1YVU A;  2XY8 A;  4CEA A;  1T03 A;  1Q9Y A;  1B92 A;  1RTH A;  4BE1 A;  3QEI A;  1BIS A;  5FRM A;  1X9S A;  1JL2 A;  4PA1 A;  4CEB A;  1XHZ A;  2G8F A;  5HRO A;  3RR7 A;  4CJT A;  1ZBF A;  3KLI A;  3OYN A;  1L3T A;  1T05 A;  4C8O A;  4OJR A;  2YHB A;  2Z1J A;  1SKR A;  4B9N A;  4RG8 A;  3NAE A;  1S6Q A;  4N56 A;  1YT3 A;  3V9U A;  1NK7 A;  3OYD A;  4Z4C A;  4FLZ A;  1C1A A;  1NKC A;  3K2P A;  2YV0 X;  3ZSR A;  4BAC A;  3KLE A;  3TAE A;  4KHW A;  3T19 A;  2A1S A;  3SQ0 A;  3QEW A;  4CF9 A;  4CF2 A;  2HHQ A;  1RBU A;  4HUG A;  4PWD A;  3HL8 A;  3JYT A;  1D5A A;  3VQE A;  3CFR A;  2R7Y A;  4DU4 A;  1KFS A;  4CK2 A;  1IG9 A;  4DQR A;  4FJJ A;  1RT1 A;  2OPS A;  4N5S A;  1LWE A;  2Z1H A;  3LAK A;  4Z4H A;  1HRH A;  3V1O A;  1VSL A;  2GV9 A;  1WSG A;  3QET A;  4C8L A;  3VQ6 A;  3V9S A;  3EYZ A;  1T7P A;  4CJL A;  3NE6 A;  4DS5 A;  3OYK A;  2HNY A;  1S1T A;  1HQU A;  3AVH A;  4CGI A;  4DTU A;  3SUQ A;  1XI1 A;  2G8U A;  5HBM A;  4FZX C;  5HRR A;  4M42 A;  1SL2 A;  5K14 A;  1WAJ A;  4OPK A;  2HHW A;  3I0R A;  5SWM A;  1U45 A;  2KZZ A;  2E4L A;  3DRP A;  3G0Z A;  2G8V A;  4KHS A;  4IG3 A;  2XO7 A;  4MQ3 A;  3NGY A;  2JLE A;  3M8S A;  4CED A;  4DTX A;  4FJN A;  2HVI A;  4BE0 A;  1JLE A;  5FRO A;  3OYH A;  4CFC A;  3JSM A;  3SV4 A;  1NJZ A;  3P5J A;  1K6Y A;  3VQ7 A;  2HHT A;  4N41 A;  4QAG A;  1UOC A;  3OYG A;  3HPO A;  1BIU A;  4B9T A;  1UA0 A;  3MEC A;  4M3W A;  4KTQ A;  1WNS A;  5JS1 A;  1RNH A;  4M45 A;  4Q0B A;  4K8Z A;  3ISN C;  4LY7 A;  4KI6 A;  5CZ2 A;  4KO0 A;  1R0A A;  1BHL A;  2E6M A;  3LAM A;  2ETJ A;  4TSX A;  5HLF A;  1BL3 A;  3AVB A;  3LZI A;  3SNN A;  1N6Q A;  4F2S A;  3L2R A;  1BQN A;  4KHY A;  1LWC A;  3HVT A;  4FXD A;  1CZ9 A;  4FLV A;  3RR8 A;  3PO4 A;  2X6S A;  3NF8 A;  1DTQ A;  3CFO A;  1IKW A;  1BCM A;  5J2N A;  3TAG A;  3SPZ A;  4HUF A;  4LH4 A;  2B4J A;  1JLC A;  3L2U A;  2Y1J A;  3V9X A;  1LAW A;  3LWM A;  4KTZ A;  1TKT A;  3LP2 A;  3ZSQ A;  4RW9 A;  3QEP A;  2HHS A;  4B9U A;  1F21 A;  3OYJ A;  2QKB A;  2QKK A;  4DQS A;  5FRN A;  1KVC A;  3CM5 A;  4DFJ A;  5I3U A;  3U3G A;  4CES A;  3TAQ A;  1S1W A;  4CJ3 A;  4OGC A;  4FLY A;  1UA1 A;  3T1A A;  4CHO A;  2XY7 A;  1BI4 B;  4DSL A;  4CGJ A;  4CGF A;  1RT6 A;  3VQD A;  4FLT A;  4I7F A;  4DTM A;  1VSE A;  4DSE A;  3M8P A;  4N47 A;  4FLX A;  1VRU A;  3ZCM A;  1T8E A;  3OYF A;  2VWJ A;  4FM2 A;  2EX3 A;  1I3A A;  3WNF A;  4M3U A;  1VRT A;  4CEO A;  4IKF A;  1RT4 A;  2IAJ A;  1NK6 A;  3B6O A;  3IRX A;  2RKI A;  4JLH A;  1KSP A;  2DFE A;  4JRQ A;  2HW3 A;  1KVB A;  4IFY A;  4FZZ A;  4DTJ A;  5J2Q A;  3ZSZ A;  2B6A A;  1NJW A;  2PYJ A;  3DLH A;  2KTQ A;  1WAF A;  2AJQ A;  4J2D A;  1FK9 A;  1VSJ A;  5FDL A;  3TAP A;  1NJX A;  5I42 A;  3NFA A;  2D0C A;  1HJR A;  3AA5 X;  1RBR A;  4CE9 A;  3V4I A;  1C0M A;  3HP6 A;  3SZ2 A;  4E7J A;  4CGH A;  1QSY A;  4F2R A;  4JS5 A;  2D0B A;  4DLE A;  4DSF A;  3K5M A;  4XIU A;  4AIL C;  1U4B A;  3K58 A;  1QSL A;  1LAV A;  4BDZ A;  3ZSY A;  3HPG A;  1VSK A;  3EY1 A;  4KHU A;  3AVJ A;  1HNV A;  4FCY A;  1SL0 A;  1RT7 A;  1HYZ A;  1FKO A;  2D5R A;  3AA2 A;  5T7B A;  4DTN A;  4RW6 A;  4Z4G A;  4CFD A;  4FZY A;  3L8B A;  1WSJ A;  1Q8I A;  4F3O A;  2RN2 A;  5J2P A;  3VQ8 A;  2OPR A;  3S3O A;  1I39 A;  2OPP A;  1Z26 A;  3ZT3 A;  1HPZ A;  1WN7 A;  2DTU A;  3IS9 A;  4C8M A;  1U49 A;  3G10 A;  5C25 A;  4CIE A;  4KTW A;  2P5O A;  4W5R A;  1U47 A;  3V6D A;  1GOA A;  1ASV A;  3PX4 A;  4ELU A;  4R5P A;  3NGZ A;  3TI0 A;  1EXQ A;  1NK0 A;  2B5J A;  4CJF A;  4AHC A;  4KHQ A;  4ZTF A;  1EKE A;  1TV6 A;  4FK4 A;  3OYB A;  3QIN A;  3DI6 A;  5SZT A;  4KI4 A;  1LW2 A;  3LPU A;  3MXJ A;  3SUO A;  3HO1 A;  3SI6 A;  1FXX A;  3VQA A;  4O5B A;  4NCB A;  4BE2 A;  4B8C A;  4AH9 A;  2O4I A;  5D3G A;  1XWL A;  5HP1 A;  2QXF A;  3OYC A;  4DG1 A;  4E1N A;  3BGR A;  3PX0 A;  2IDO A;  4RW7 A;  3VN5 A;  3VQC A;  5CY4 A;  2P5G A;  3HJF A;  5EU7 A;  2HHX A;  4KB0 A;  3QIO A;  3LZJ A;  1JLF A;  1S5J A;  1J53 A;  4DFP A;  3MEE A;  5DK5 A;  4CF0 A;  3PV8 A;  1NKB A;  4CK1 A;  3UIQ A;  4Z4I A;  1UWB A;  1S1X A;  2X6N A;  4FLU A;  1IKV A;  1RTJ A;  3V1Q A;  4CF8 A;  4K8X A;  4LD0 A;  3L2W A;  4HCB A;  1RBS A;  2DFF A;  1KCF A;  1TK0 A;  1EP4 A;  4HUE A;  1CZB A;  1RDA A;  3C94 A;  3M8Q A;  3ITH A;  1NKE A;  4B9M A;  3OYM A;  4E3S A;  3V9W A;  3KK2 A;  4M3T A;  1RDC A;  1X1P A;  4EP5 A;  1WSI A;  3KJV A;  3PY8 A;  2G8I A;  5HRN A;  2WON A;  3O3F A;  3NDK A;  3LWL A;  3VQP A;  1NOY A;  4FM0 A;  1HYS A;  3THV A;  1RIL A;  3QEV A;  1JXB A;  3KD5 E;  4KFB A;  1TL3 A;  4FJM A;  1C6V A;  3P83 D;  4F8R A;  2X78 A;  4CJQ A;  2X74 A;  1C0U A;  2YNG A;  3HT3 A;  3VQB A;  2RPI A;  4CJE A;  3HM9 A;  4OKJ A;  4O0J A;  3U6F A;  1KVA A;  3KLG A;  1ZBH A;  3AVK A;  3VQ5 A;  3QNO A;  3ZSV A;  3NCI A;  4M3Z A;  2Y1I A;  2A1R A;  1X9W A;  1QSS A;  1KLN A;  3AA3 A;  4DFK A;  1RDB A;  1BI4 A;  4IBN A;  3S3M A;  4AHS A;  3AVF A;  2ITG A;  3E01 A;  3ZT0 A;  3RRH A;  3QER A;  5JS2 A;  4PY5 A;  3RMA A;  1XHX A;  3O4Q A;  1XC9 A;  3QO9 A;  4H4O A;  1KLM A;  4FW2 A;  4J2E A;  2LSN A;  3QLH A;  4BDP A;  4L8R B;  2F8T A;  4CEZ A;  5HRP A;  3KTQ A;  4DQP A;  3LAN A;  4AHU A;  1X9M A;  5C24 A;  4B9V A;  2XY6 A;  3HK2 A;  2HHV A;  1ZBU A;  1RCH A;  4C8K A;  3OYE A;  3V9Z A;  3L2V A;  4DSI A;  1BCO A;  4CJV A;  4KAZ A;  1QTM A;  4BWJ A;  4I2Q A;  3HXM A;  4DTS A;  1RT2 A;  3C6T A;  2F8S A;  2YNI A;  3IAY A;  4FK0 A;  3RWU A;  4CJU A;  4KV8 A;  3QES A;  1HNI A;  4KRF A;  1IO2 A;  4M3X A;  4YFU A;  3AVI A;  2OZM A;  2OZS A;  3ZSW A;  5J2M A;  3TAB A;  4DQQ A;  1JL1 A;  3NHG A;  3PO5 A;  4Q5V A;  4B8A B;  1NK4 A;  2FBT A;  1J54 A;  1VSF A;  4PUO A;  4W5Q A;  2OA8 A;  1D8Y A;  2KFN A;  1IH7 A;  3DOL A;  3LP1 A;  4DMN A;  3IG1 A;  4HVJ A;  3EZ5 A;  4E7H A;  3TAF A;  4FJL A;  4EZ9 A;  1TAU A;  3NF6 A;  3LP0 A;  2JGU A;  1D9F A;  2P51 A;  3HVR A; 
#chains in the Genus database with same CATH topology
 4EHT A;  3M3Z A;  1S1V A;  4CEQ A;  3O3G A;  5M1K A;  5CZ1 A;  2E88 A;  3OVN A;  3C6A A;  4M63 C;  3OYI A;  3HPH A;  3J7Z O;  3MAQ A;  3F73 A;  2YNF A;  2Z1I A;  1YTA A;  4C1N K;  3DYA A;  4AHT A;  5AQQ A;  4JKH A;  4DTR A;  4CGD A;  3QEX A;  2IC3 A;  2JWK A;  3RRG A;  3C65 A;  2W42 A;  1ZBS A;  4DQI A;  4BQL A;  1QQM A;  3MED A;  3AO4 A;  4EIA A;  2BTF A;  1P8Z A;  3KLH A;  5EX5 A;  1RDD A;  4AM7 A;  3WNE A;  5E41 A;  4FJ8 A;  3DRR A;  1C1B A;  1DT9 A;  3EL2 A;  4H4M A;  4CJP A;  3BY5 A;  4H5V A;  3CQ8 A;  4LSL A;  1KRP A;  3THY B;  4CJ4 A;  4DSK A;  3GL1 A;  2P9I A;  4FWO A;  1K8A O;  3K9K A;  3VEO A;  4CJW A;  3O3H A;  3OYA A;  4DHY A;  1TVR A;  3VES A;  2ZJQ L;  2E6L A;  4CBW A;  1U48 A;  4W5T A;  3CYM A;  1WSF A;  2V52 B;  2QI2 A;  3U8X A;  3VGL A;  1KAX A;  3DWL A;  5C42 A;  3CET A;  1SKW A;  2O8F B;  3MEG A;  4CBX A;  3UKR A;  1NJY A;  5KGX A;  1B9D A;  3A2F A;  2FC0 A;  2XRI A;  3IMX A;  4BRA A;  2DFH A;  4QOZ B;  2FXU A;  3U9D A;  4DV1 K;  3CCV N;  3SJJ A;  5KTQ A;  2PYL A;  4JI4 K;  3P38 A;  3CCE N;  1L3U A;  2Q97 A;  4IFV A;  1NGE A;  3K5L A;  1GOB A;  3G71 N;  1TKZ A;  3CCL N;  4BRH A;  1Q7Y O;  3SV3 A;  5DMR A;  1GLJ O;  1JLA A;  3THX A;  1NGJ A;  2G8H A;  3DXM B;  3K57 A;  4DKW A;  3D0P A;  4H0Y B;  1VHX A;  2FLO A;  1TL1 A;  5AQV A;  1NU0 A;  3S9H A;  4LFB K;  3HST B;  3CG7 A;  3TAM A;  3ASM A;  4DR7 K;  3LDQ A;  3DMJ A;  3OY9 A;  2E8A A;  2O8E A;  2OCE A;  4E7I A;  3QDK A;  1A5V A;  1ITG A;  3ZT4 A;  4F3T A;  3DLE A;  4FJK A;  4DFM A;  5AQN A;  2Q1N A;  3G6E N;  1NGI A;  1M90 O;  4E7L A;  1WLJ A;  4M3R A;  1BIZ A;  1NOZ A;  3C95 A;  5BRH A;  4CEE A;  1Z6R A;  2YNH A;  3AO5 A;  4KB1 A;  3BZK A;  4L3Q A;  3W3D A;  3LP3 A;  4H8K A;  3K59 A;  3H1Q A;  4IG0 A;  4IDK A;  2XY5 A;  4BRG A;  1LW0 A;  4O0I A;  5H1S Q;  1S1U A;  2QK9 A;  4JKG A;  3D45 A;  4FWR A;  3SQ1 A;  4B1U B;  3FE1 A;  2NRW A;  1ZBL A;  4FJH A;  3EZW A;  3E9O A;  4AF1 A;  3NH2 A;  3LDS A;  4A2A A;  1VSH A;  1K8K A;  3HYF A;  4JAX A;  2GX9 A;  5BR9 A;  4AHV A;  4FJG A;  3S3N A;  4CFB A;  1T03 A;  1B92 A;  1EWR A;  1RTH A;  1IBM K;  2G8F A;  5HRO A;  1ZBF A;  3OYN A;  1T05 A;  2YHB A;  1SKR A;  3NMU A;  2P9S B;  1W2B M;  2YHW A;  3RVC A;  3ZSR A;  1YJN N;  3KLE A;  3QEW A;  3UE5 A;  3PSF A;  4CF9 A;  2E2N A;  3MMV A;  1OKJ A;  1S3X A;  3VQE A;  1IG9 A;  4FJJ A;  3TSP A;  3C0B A;  1NG9 A;  1LWE A;  1DKG D;  2IIR A;  3LAK A;  2YHY A;  2D1K A;  1HRH A;  3V1O A;  2NZT A;  3VQ6 A;  3V9S A;  2HBL A;  1T7P A;  3NE6 A;  1YXQ A;  5KPR A;  1HQU A;  3AVH A;  1XI1 A;  2A40 A;  3E1Y A;  4M42 A;  1HKC A;  3O9U A;  4CZI A;  4OPK A;  1U45 A;  3DRP A;  3H3N O;  4H0O A;  4MQ3 A;  4YOV A;  2Q36 A;  4DTX A;  4BRQ A;  3OHR A;  4RCH A;  4WFN L;  4CFC A;  3TTF A;  5M1Q A;  2HHT A;  3EO3 A;  3HBT A;  3HPO A;  2E5L K;  2ZJR L;  4WFB L;  5FPM A;  4YDU A;  4YOY A;  5CZ2 A;  1R0A A;  1N6Q A;  3P31 A;  4BY9 C;  4HTL A;  4FLV A;  3RR8 A;  3WXL A;  2B4J A;  1JLC A;  3L2U A;  3V9X A;  2QWL A;  4B1Y B;  3LP2 A;  1VQM N;  3SK3 A;  2CGJ A;  5FRN A;  4CES A;  4FLY A;  3IDH A;  3ENO A;  2XY7 A;  1BI4 B;  4IZ9 A;  2EWS A;  4MLH A;  2P9N B;  2P9K B;  2RHK A;  1VSE A;  3M8P A;  4FLX A;  1BA1 A;  3ZCM A;  1T8E A;  4BR0 A;  1RT4 A;  2IAJ A;  3IRX A;  3SAG A;  3CCM N;  4DR5 K;  3IUC A;  1YF5 L;  1KVB A;  2KTQ A;  4J2D A;  5FDL A;  3VGM A;  5I42 A;  3NFA A;  4JKD A;  3QFP A;  5AQH A;  3VF6 A;  4CE9 A;  4DLE A;  4DSF A;  4XIU A;  1U4B A;  4IO8 A;  1SL0 A;  1RT7 A;  1HYZ A;  4DTN A;  2YCH A;  5T7B A;  4RW6 A;  4CFD A;  3WEE B;  1BDG A;  3L8B A;  4F3O A;  1Q8I A;  2O8D B;  4E1J A;  2O8B A;  5J2P A;  5GIP A;  3S3O A;  1WN7 A;  3EKU A;  2A41 A;  1GOA A;  3SAF A;  3HI0 A;  3OBY A;  5LMU K;  1VQN N;  3TI0 A;  1EXQ A;  2B5J A;  3CJC A;  4CJF A;  1YVN A;  4H5W A;  3O9R A;  3QIN A;  3SMS A;  5SZT A;  1S72 N;  3HO1 A;  2GWJ A;  4PL8 A;  4C1N I;  5D3G A;  1XWL A;  3L4Q A;  3VEX A;  4B3M K;  3VN5 A;  1HUX A;  3WXI A;  3HJF A;  5BPN A;  2HHX A;  4KB0 A;  3OTO K;  4JKB A;  4FO0 A;  3E9P A;  1W7A A;  1UWB A;  5GIO A;  4X62 K;  3VET A;  4GVE A;  3JXU A;  4WCE L;  3HSC A;  1TUY A;  1Q18 A;  1GLF O;  1KCF A;  1P90 A;  4FWL A;  1TK0 A;  2JWL A;  3I33 A;  4JK7 A;  4HUE A;  1RDA A;  1NKE A;  4B9M A;  4LF5 K;  4M3T A;  2VYP A;  5AZI B;  1WSI A;  3KJV A;  3PY8 A;  5HRN A;  1Q81 O;  3NDK A;  3VQP A;  1NOY A;  4FM0 A;  4FVU A;  5E84 A;  3THV A;  3KD5 E;  2E1Z A;  4FJM A;  3P83 D;  4F8R A;  4Z94 A;  4CJQ A;  3FZM A;  3VQB A;  2RPI A;  5AQJ A;  1MDU B;  3HM9 A;  3KLG A;  3AVK A;  3QNO A;  3L6Q A;  3T7Z A;  2Y1I A;  5AQS A;  2YX6 A;  3AVF A;  4I6M B;  3E01 A;  4LFA K;  3QER A;  5JS2 A;  4PY5 A;  5CHI A;  2LSN A;  5AJ3 K;  5HRP A;  3KTQ A;  4DQP A;  3LAN A;  1X9M A;  4B9V A;  5C24 A;  3HK2 A;  2HHV A;  2O8C B;  4K42 A;  4JI3 K;  1ZBU A;  4C8K A;  3OYE A;  4GNI A;  3V9Z A;  4BRM A;  1BCO A;  4WF9 L;  4I2Q A;  4AQY K;  4MDA A;  4DTS A;  2YNI A;  2KLA A;  4FK0 A;  4JI7 K;  3QES A;  4FL9 A;  3GG4 A;  4PKI A;  2D4W A;  3TAB A;  4DQQ A;  1JL1 A;  1BA0 A;  2FBT A;  1VSF A;  4W5Q A;  4FSV A;  2VGN A;  4R79 A;  3DOL A;  3LP1 A;  4FJL A;  3ZET B;  2P51 A;  4EP4 A;  5JVG L;  3H08 A;  5KI6 A;  1MU2 A;  2HND A;  3SPY A;  2IS3 A;  2PY5 A;  5AFU H;  1J9A A;  3E66 A;  1NK8 A;  4B08 A;  4LF4 K;  5JIC A;  4WE1 A;  4B1V A;  4NYN A;  4M41 A;  4H5N A;  4ILH A;  3HZ6 A;  4OVL A;  1D4X A;  2IOC A;  3G4S N;  4FLW A;  1B9F A;  1RTD A;  3CFP A;  4OLB A;  4BRO A;  2Z1G A;  3D2F A;  4UQG A;  2UXD K;  1MWK A;  4W5O A;  4KBO A;  1BO5 O;  1VSM A;  1C1C A;  4FVM A;  3CCR N;  4ZTJ A;  4LF9 K;  2ASO A;  2NUB A;  1VSD A;  4CZM A;  1HQE A;  4K41 A;  3DOK A;  5DM6 L;  5C0Y A;  1N5Y A;  2IVP A;  5HL7 L;  4CJS A;  3DRS A;  4A57 A;  4DQ8 A;  1IKY A;  2FSJ A;  4CK3 A;  2H3G X;  3NBP A;  1NK9 A;  3K5O A;  1CXU A;  3BDP A;  4KH4 A;  4ISG A;  3SQ4 A;  1IJJ A;  1J5E K;  4OLA A;  3ZSX A;  3CF5 L;  3ZT1 A;  1VK0 A;  3KWG A;  3UKU A;  5JLF A;  2D0P A;  5ADX H;  3GOI A;  4WQ5 C;  1RTI A;  4YNQ A;  4GMJ B;  3CCJ N;  4BDY A;  4CER A;  3R3L A;  4DF8 A;  2Q0U A;  3Q7B A;  5CE3 A;  3KKR A;  2HMP A;  3I55 N;  3M8R A;  2Q3S A;  3O4W A;  3MWP A;  1X3M A;  4KHN A;  3VQ4 A;  1TAQ A;  1W0H A;  4NO7 A;  4NYF A;  4O4G A;  2P9L A;  4NCA A;  1N32 K;  3M6G A;  3ENH A;  1WSE A;  2I7P A;  1EX4 A;  1VQ9 N;  3ATU A;  1GLL O;  2RF2 A;  2ZGZ A;  4NCG A;  2YKN A;  3OS1 A;  2IVN A;  2NNW A;  4CHZ A;  4MFB A;  4CZL A;  3ULE B;  4JYA K;  3ZSO A;  3OJU A;  5AZJ A;  4E89 A;  2ZQB A;  1RBT A;  2FF6 A;  2VGM A;  2ZM6 K;  1E3M A;  4B9S A;  4FYD A;  3K5N A;  1E4F T;  1Q9X A;  4BG8 A;  4CEC A;  1WSH A;  4OPJ A;  3QBX A;  1YAG A;  1BUP A;  4JHD B;  2F7T A;  1ZC6 A;  4AHR A;  4BR7 A;  2RE2 A;  2VG7 A;  4JI5 K;  1MA9 B;  1RBV A;  1VQ4 N;  3V1R A;  2FBY A;  2VWK A;  4M7Y A;  3F9K A;  3AO1 A;  4E7K A;  4IJN A;  1SZ2 A;  4KKO A;  5AQG A;  1BWF O;  4DU1 A;  1LV5 A;  1NNE A;  2FBX A;  4PL7 A;  3AO2 A;  5MLC Q;  1NGA A;  2KW4 A;  3AO3 A;  3SCX A;  3THY A;  2HNZ A;  1O1W A;  4CJ5 A;  4CJR A;  3KD1 E;  2QTD A;  1G15 A;  3AVN A;  1Z25 A;  1TGO A;  4BRF A;  3OYL A;  1TK5 A;  3J7Y P;  2ZE2 A;  3FLC O;  1NGF A;  4CHY A;  3RSE B;  1CXQ A;  3QEI A;  1BIS A;  1HNX K;  1XHZ A;  2O8F A;  4CJT A;  1L3T A;  4FWM A;  4OJR A;  2Z1J A;  3DJC A;  4B9N A;  2ASM A;  1S6Q A;  1U2V B;  2NRX A;  1C1A A;  4CBU A;  3N4Q A;  4BAC A;  4KHW A;  3SQ0 A;  4PKG A;  4HUG A;  3JYT A;  3CFR A;  1KFS A;  4V19 S;  4DQR A;  1VSL A;  4EHU A;  3QET A;  3EYZ A;  3CMA N;  4CJL A;  4H0T B;  2HF4 A;  3DXM A;  2HNY A;  1S1T A;  3FZH A;  1VQL N;  2G8U A;  3SUQ A;  2W40 A;  1HNW K;  1WAJ A;  2HHW A;  3I0R A;  2W6L A;  4KHS A;  1YI2 N;  1XMQ K;  4EAH D;  5FRO A;  5AR0 A;  3SV4 A;  3AAR A;  3C6H A;  3P5J A;  1UOC A;  4LFC K;  4O8U A;  1UA0 A;  3QML A;  4M45 A;  3ISN C;  4KO0 A;  4FOI A;  3LAM A;  1BL3 A;  2GEL A;  3AVB A;  5GIN A;  4DV5 K;  3SNN A;  3HVT A;  3PO4 A;  3TAG A;  3CFO A;  2HMI A;  3VF4 A;  4H0V B;  1TKT A;  3O08 A;  4RW9 A;  3QEP A;  1V4T A;  1WBB A;  1RDU A;  3OYJ A;  5F0X A;  3CCS N;  4DQS A;  4LF8 K;  2VWB A;  1KVC A;  4CD3 A;  1S1W A;  3NVK A;  3DLL L;  4OGC A;  5BRE A;  1UA1 A;  4A5A A;  1GLB G;  3MN6 A;  3VQD A;  2P9U B;  4FLT A;  2Q0R A;  3MWT A;  3J81 O;  4DSE A;  4N47 A;  3OYF A;  4GKJ K;  5BN8 A;  5LL6 Z;  2QW9 A;  4H5T A;  1TUU A;  4YOW A;  2EX3 A;  2VWJ A;  4FM2 A;  1CZA N;  3U9Z A;  4CEO A;  1QVG M;  4XEI A;  2WBN A;  4IKF A;  4WFA L;  2RKI A;  4JV5 K;  2DFE A;  4JRQ A;  2HW3 A;  4FZZ A;  4DTJ A;  3ZSZ A;  2B6A A;  1NJW A;  2PYJ A;  3DLH A;  2AJQ A;  1WAF A;  5FPE A;  2BH1 A;  3THW B;  2A3Z A;  2D0C A;  2QWO A;  1KD1 O;  4G9Z A;  4CGH A;  4BR5 A;  4K43 A;  4DR4 K;  3I8B A;  4BC3 A;  3K58 A;  1LAV A;  1QZ6 A;  3ZSY A;  1GLC G;  3O80 A;  1VSK A;  3ATV A;  1HNV A;  3LDP A;  5AQO A;  1FKO A;  5EY4 A;  2E2P A;  3C7N B;  1OH8 A;  2RN2 A;  3VEW A;  1RGI A;  3BF3 A;  2OPR A;  1I39 A;  3TTD A;  4X66 K;  2P9S A;  4W5R A;  3V6D A;  1OH5 A;  5AQM A;  1J6Z A;  4DV2 K;  3PX4 A;  1NJI O;  2UU9 K;  2WUS A;  3WT0 A;  1ESV A;  1TV6 A;  2HF3 A;  1LW2 A;  2V7Y A;  1NGD A;  4BE2 A;  3ZEU B;  2ZJP L;  3OYC A;  3PX0 A;  4A59 A;  2IDO A;  3VQC A;  5EU7 A;  3SLC A;  3QIO A;  5GAE P;  1J53 A;  4DFP A;  3MEE A;  4CF0 A;  1GLD G;  2E2O A;  5GAD P;  4Z4I A;  3H3O B;  4FLU A;  2X6N A;  1IKV A;  3V1Q A;  4CF8 A;  4FWS A;  4K8X A;  4LD0 A;  2NRZ A;  3E9L A;  2DFF A;  4X64 K;  1XC3 A;  3C94 A;  3ITH A;  3QIC A;  2YI1 A;  3FFK B;  3KK2 A;  3HM8 A;  1RDC A;  4OPA A;  5C15 A;  4EP5 A;  3KVG A;  3F9M A;  5KQD A;  2QWR A;  5EXW A;  3QEV A;  4X65 K;  5KPT A;  1TL3 A;  3A0I X;  3IKM A;  2X78 A;  2X74 A;  3HT3 A;  4MLE A;  4CJE A;  3U6F A;  4O0J A;  5F1X A;  1ZBH A;  3VQ5 A;  3ZSV A;  2DPN A;  4M3Z A;  4DFK A;  1RDB A;  1BI4 A;  4AHS A;  1JCF A;  2P9N A;  5C2F A;  2P9K A;  1QQO A;  3J8A A;  1G99 A;  3CXC M;  4H4O A;  4YY3 K;  1KLM A;  4FW2 A;  3KHY A;  2NRH A;  3QLH A;  3ZX2 A;  1HX1 A;  2XY6 A;  1RCH A;  3VF2 A;  4NLC A;  4IJA A;  2OTL N;  3PIO L;  3AAQ A;  3C6T A;  3RWU A;  4KV8 A;  3WQT A;  2QA4 N;  3SBT A;  1LCU A;  4ISF A;  3J7A P;  3PO5 A;  2GEM A;  1IV0 A;  3SAH A;  4K0K K;  2KFN A;  1IH7 A;  3TAF A;  3VEV A;  4DMN A;  1TYQ A;  3NF6 A;  3LP0 A;  3BP8 A;  1OH6 A;  1NLV A;  3L4I A;  4BRD A;  3WEE A;  5BPM A;  3HVR A;  2O8D A;  5LJV A;  4DV4 K;  3AVL A;  5EVZ A;  1O13 A;  1JCG A;  1IBL K;  4IO9 L;  4BRN A;  2HBK A;  4I9L A;  3CPE A;  1HLU A;  1HYV A;  4CIF A;  3RMC A;  1ASW A;  2WOM A;  1TYQ B;  4DU3 A;  1KAZ A;  4RW8 A;  4ILG B;  2DY4 A;  1NGC A;  3KKS A;  4ELV A;  3O4N A;  3A8Y A;  1QQC A;  4E0D A;  3AA4 A;  4BRP A;  4GW6 A;  4FWP A;  2HB5 A;  4BG9 A;  4JI0 K;  3O9Q A;  3R1X A;  3C6U A;  1EWQ A;  3LPT A;  1JKH A;  4WQ4 C;  3KK1 A;  1N8R O;  4J2A A;  5GAG P;  3MN7 A;  4I2P A;  5AFU A;  1H1V A;  3CJ1 A;  5CR4 A;  4DS4 A;  4DSJ A;  3P39 A;  5HRS A;  4AM6 A;  2J4R A;  4CIG A;  1DTT A;  2NRR A;  4JRP A;  3RMD A;  1IBK K;  2W6K A;  3PUF A;  5BPL A;  3AVG A;  3NH0 A;  1EQY A;  1S9G A;  1FW6 A;  4GV6 A;  5AQT A;  1SKS A;  3DXK B;  4PKH A;  1C0G A;  3ALY A;  4Z4F A;  4HHT A;  5AZI A;  1MWM A;  5JVH L;  4KPY A;  3L3U A;  3IFR A;  1KTQ A;  4XH4 A;  3OS0 A;  3VA3 A;  3AVC A;  5AQL A;  4YOX A;  3T3F A;  5KRS A;  3QB0 A;  2YKM A;  5IWA K;  4FWK A;  4DCH A;  2GBZ A;  3OJS A;  1T6D A;  4I6M A;  4H0P A;  3KWI A;  5M1N A;  3TR8 A;  1KFD A;  4DR2 K;  5FLX O;  4RTF D;  3I0S A;  2QEX N;  4O55 A;  2D0A A;  3FR0 A;  3B6P A;  2O8C A;  2CGK A;  4B1X B;  3FZL A;  3JS6 A;  4FOE A;  2HVH A;  5KRT A;  4JN4 A;  2QWM A;  4JI8 K;  5B8H A;  4FK2 A;  1JLQ A;  1D9D A;  5ADX A;  2PBD A;  2EHG A;  1TK8 A;  4DF4 A;  1SV5 A;  5CYQ A;  2BGG A;  1CLQ A;  4FJ5 A;  1QS4 A;  5KGW A;  4CFA A;  3TAR A;  4A2B A;  4RW4 A;  1HR0 K;  4HCC A;  3A5N C;  1LWF A;  4FJ7 A;  2PZS A;  4OKK A;  3NF9 A;  2XHB A;  3TWH A;  3ZET A;  4CZE A;  2A42 A;  1ZYQ A;  2W41 A;  3VQ9 A;  4Y1D A;  3HP9 A;  1JLB A;  5AQX A;  3S41 A;  3WXM B;  4FW1 A;  4M3Y A;  1A5X A;  5M1O A;  4YOU A;  3SBG A;  3CC4 N;  1L3V A;  3KLF A;  4F4K A;  3PIP L;  1ATR A;  4C8N A;  3SQ2 A;  3FFI A;  3P1G A;  4GV9 A;  3DLK A;  4GV3 A;  4N76 A;  2HHU A;  2VG5 A;  4J2B A;  1TKX A;  1XNQ K;  1S6P A;  3O8M A;  3TAN A;  3R6M A;  3V81 A;  2I7N A;  3D2E B;  1NJX A;  1BGX T;  1HJO A;  2BAN A;  3KIO A;  2V7Z A;  5M1P A;  1BOT O;  3AV9 A;  1RT3 A;  1VQO N;  3OA9 A;  2GUI A;  4GKK K;  1N33 K;  3DLG A;  4WQ5 A;  3CJ7 A;  1SS6 A;  5J1E A;  3O5B A;  1NMN A;  3T1Y K;  4ZHR A;  1K73 O;  4DWI A;  2P9P A;  4CHP A;  4OGE A;  4E1M A;  2G8K A;  2ZD1 A;  4JS4 A;  4E19 A;  3GBT A;  4QCL A;  1GOC A;  2ATQ A;  1ILY A;  2XY8 A;  2V51 B;  1Q9Y A;  3O1W A;  2P9P B;  1JL2 A;  1NMD A;  4PA1 A;  1LOT B;  4CEB A;  3RR7 A;  3KLI A;  4C8O A;  2F9W A;  1KAY A;  5KPZ A;  1VQ8 N;  1VQK N;  3VPZ A;  4FLZ A;  5EOY A;  1RFQ A;  2YV0 X;  3VTI A;  3WXJ A;  4BRL A;  3TAE A;  4CF2 A;  2HHQ A;  4PWD A;  1OH7 A;  2R7Y A;  1D5A A;  4DU4 A;  4U67 L;  3UB5 A;  1S22 A;  2OPS A;  4N5S A;  3K0S A;  4Z4H A;  2GV9 A;  1WSG A;  4C8L A;  4DTU A;  1KC8 O;  4FZX C;  5HRR A;  1SL2 A;  2YJE A;  4M7X A;  1ZXO A;  2KZZ A;  4O5F A;  4BVP A;  5AQK A;  2G8V A;  3NGY A;  2JLE A;  3EEQ A;  4B1Z A;  4FJN A;  4BE0 A;  5TKW A;  3OYH A;  4DR3 K;  1NJZ A;  3VMF B;  4N41 A;  4QAG A;  3SJH A;  3R8E A;  1BG3 A;  4RWT A;  1BIU A;  4DUZ K;  4BC2 A;  4A5B A;  3ULE A;  4M3W A;  3B8A X;  1WNS A;  1I94 K;  4KTQ A;  2D0O A;  5JS1 A;  4KI6 A;  4LY7 A;  4TSX A;  2UUB K;  2A5X A;  2CH5 A;  4JNE A;  3BUZ B;  1CZ9 A;  2UUC K;  4CZG A;  2X6S A;  1DTQ A;  1IKW A;  1BCM A;  2AP1 A;  4Y0W A;  5J2N A;  4LH4 A;  2Y1J A;  4JI2 K;  5AQP A;  1LAW A;  3LWM A;  4JHD A;  1EO1 A;  2HHS A;  1F21 A;  4MO5 A;  2AA4 A;  3M1F A;  4DFJ A;  3TAQ A;  4CJ3 A;  2OAN A;  4CHO A;  4DSL A;  4CGF A;  2HHH K;  3CJA A;  1RT6 A;  3CJB A;  4JD2 B;  5FPN A;  4O8K A;  1E4G T;  4DTM A;  1VRU A;  2F9T A;  3BF1 A;  1I3A A;  3O1B A;  4M3U A;  1VRT A;  1NK6 A;  1KSP A;  4J8F A;  3WXK A;  3MCA B;  4B9Q A;  2YJF A;  2QWQ A;  4IFY A;  1GLE G;  2WTU A;  1FK9 A;  5LMN K;  2QWP A;  2ITM A;  3VER A;  4A62 A;  4U7B A;  3HP6 A;  4IFE A;  4JK9 A;  4E7J A;  3RSE A;  4AIL C;  1QSL A;  4BDZ A;  3EY1 A;  5JMV A;  2D5R A;  3AA2 A;  4Z4G A;  1HKG A;  2IVO A;  1KQS M;  3DAW A;  3QBW A;  5AQI A;  3VQ8 A;  1U2V A;  4C8M A;  5C25 A;  4KTW A;  1WOQ A;  2P5O A;  2GTD A;  2NLX A;  4NXN K;  1WBD A;  1U47 A;  5C12 A;  5FPD A;  1ASV A;  4ELU A;  4R5P A;  4FPA A;  3AGK A;  4OO1 J;  4AHC A;  3ZLJ A;  4ZTF A;  4FK4 A;  5LJW A;  3SUO A;  3SI6 A;  1FXX A;  4O5B A;  4A61 A;  4NCB A;  4B8C A;  2CGL A;  3D6R A;  3ENB A;  2QXF A;  4BR4 A;  4DG1 A;  3BGR A;  4E1N A;  4RW7 A;  1SQK A;  2P5G A;  3A5L C;  3HRG A;  1ATN A;  1JLF A;  1S5J A;  2P9I B;  1NKB A;  3UIQ A;  4CK1 A;  5BRF A;  1S1X A;  1OVQ A;  3G25 A;  1XNR K;  2VQF K;  4EFH A;  1NGG A;  3L2W A;  4HCB A;  5BRD A;  3OW2 M;  1CZB A;  3M8Q A;  3OYM A;  4BGA A;  1X1P A;  3I56 N;  1YHQ N;  2G8I A;  1YJW N;  3ID8 A;  2WON A;  3O3F A;  2QWN A;  1JXB A;  3CCQ N;  3UKR B;  3H45 C;  2FSK A;  4QS7 A;  3CJ9 A;  2E20 A;  1KVA A;  4LF7 K;  1QSS A;  5F2R A;  3AA3 A;  4IBN A;  3S3M A;  2ITG A;  1QVF M;  2P9U A;  3RRH A;  1XHX A;  3O4Q A;  1XC9 A;  1M1K O;  4L8R B;  5KQ8 A;  4AHU A;  4DUY K;  4B3R K;  1VQ7 N;  3THX B;  3L2V A;  2ZWH A;  1N34 K;  4DSI A;  4GY2 B;  2QXL A;  1QTM A;  4BWJ A;  3CC7 N;  2HST A;  4IOX A;  4OPH A;  3R9P A;  3THW A;  1HNI A;  3LM2 A;  2UUA K;  4KRF A;  4YFU A;  3AVI A;  5AQZ A;  2OZM A;  4IWV A;  3ZSW A;  5J2M A;  2OZS A;  3EKS A;  3HOT A;  4Q5V A;  4MDB A;  1HKB A;  4PUO A;  4H5R A;  2O8E B;  3IG1 A;  4E7H A;  4EZ9 A;  1TAU A;  5BR8 K;  2NRT A;  4DV6 K;  2JGU A;  1D9F A;  4HWI A;  2E2Q A;  3QFU A;  3C7N A;  3QNN A;  2YHA A;  1Q82 O;  3VEY A;  4CGG A;  1JXE A;  1FKP A;  4LC9 B;  3SUN A;  3ULD A;  1YTU A;  3TU5 A;  1BQM A;  4CHN A;  4CF1 A;  1J5O A;  2KFZ A;  4FM1 A;  3ZX3 A;  3FZF A;  1UAX A;  2ASP A;  1HMV A;  2OPQ A;  1RT5 A;  4K25 A;  3ZEU A;  1JJ2 M;  1QZ5 A;  1R59 O;  4CJK A;  1W97 L;  4DV0 K;  2HBJ A;  4IEI A;  2P1J A;  3CM6 A;  4JKG B;  4ELT A;  4W5N A;  4IDH A;  4CI6 A;  3LDN A;  3KK3 A;  4G1Q A;  2ZGY A;  3MX2 A;  1JLG A;  4DR1 K;  1XMO K;  1TKD A;  1K8K B;  2F96 A;  3WNH A;  3F5T A;  3NH1 A;  4DR6 K;  4B9L A;  2O4G A;  5C10 A;  4FJX A;  4CCH A;  3A5M C;  3I8D A;  4FJI A;  3AVA A;  4CZJ A;  2OTJ N;  3LM9 A;  3ZT2 A;  4LH5 A;  3QIP A;  3OBW A;  4ID1 A;  3NF7 A;  4PQU A;  5E26 A;  1REV A;  1HNZ K;  2KZM A;  2IGI A;  3MN5 A;  3OS2 A;  1W9H A;  3PLA A;  4KRE A;  3AGR A;  3O9S A;  1QHA A;  4DTP A;  4XH1 A;  1U04 A;  4OKE A;  2BDP A;  3SYZ A;  3Q7C A;  4CHQ A;  3VA0 A;  4Z0U A;  4LSN A;  2VQE K;  4XH5 A;  3L2Q A;  4DTO A;  3LAL A;  3AAP A;  4HTU A;  3MCP A;  1C0T A;  3WNG A;  3WQU A;  1A5W A;  1S9E A;  4B3O A;  1NK5 A;  4Z4E A;  3L3V A;  2CH6 A;  3DLR A;  2KQ2 A;  3WUH A;  3VQQ A;  3CC2 N;  3CD6 N;  2FSN A;  3H6E A;  4BR9 A;  3TSU A;  1IKX A;  4BRE A;  2FBV A;  2E1Y A;  1SUQ A;  1YUW A;  4GVM A;  3RMB A;  3DLB A;  4FWN A;  4ICL A;  2F4V K;  1OVY A;  4WQ4 A;  4CEF A;  3DM2 A;  3U4L A;  2VG6 A;  1QE1 A;  4CW7 B;  1QHT A;  4YOR A;  3FGU A;  1BU6 O;  3KZB A;  1WUA A;  1ASU A;  1Q86 O;  5AQF A;  1Y97 A;  1NGH A;  3FZK A;  3T69 A;  2NRV A;  1QQN A;  1L3S A;  1VQ6 N;  4CZH A;  3A5O C;  2OYQ A;  3K9J A;  1SL1 A;  3PX6 A;  3NGI A;  4O44 A;  5I9E B;  3MXI A;  3CI5 A;  4JI6 K;  4FPB A;  4ID5 A;  4UY8 O;  3GE1 A;  4BGB A;  3MXM A;  2BE2 A;  5CYM A;  1DLO A;  2G8W A;  4JKF A;  4YDU C;  3U3Y A;  1X9J A;  1KXP A;  3O9T A;  3O6W A;  3MX5 A;  4ILJ A;  3CIP A;  4EZ6 A;  4FJ9 A;  3CQX A;  3SUP A;  1NBW A;  2GUP A;  2UXB K;  1EET A;  2I5J A;  4Y1C A;  4DLG A;  4BWM A;  5M1F A;  4BRI A;  1ZBI A;  3TTC A;  3HOS A;  3RTV A;  3AVM A;  4ISE A;  3DXK A;  1L5U A;  1VSI A;  4I9Q A;  1YVU A;  4CEA A;  2BUP A;  4BE1 A;  5FRM A;  1X9S A;  4C23 A;  1Y64 A;  2O8B B;  3NVM A;  4NLB A;  4RG8 A;  4JKA A;  3NAE A;  4OX9 K;  1YIT N;  4KH5 A;  4BC4 A;  3SMP A;  1YT3 A;  4N56 A;  3V9U A;  3MDQ A;  1NK7 A;  3OYD A;  4Z4C A;  1NKC A;  3TPQ A;  3K2P A;  3T19 A;  2A1S A;  1XQS C;  4KHP K;  1XUP O;  4NXM K;  4CJ7 A;  1RBU A;  1NWK A;  3HL8 A;  1U6Z A;  5HOO A;  2VCP A;  4CK2 A;  1RT1 A;  4DV7 K;  1DEJ A;  2Z1H A;  3ZX0 A;  1IG8 A;  1NM1 A;  5A2Q O;  3VTH A;  1GLA G;  3VGK A;  1FJG K;  4DS5 A;  4B3S K;  3OYK A;  4CGI A;  3W0L A;  5HBM A;  4DB3 A;  4CZF A;  5K14 A;  2WC9 A;  2HBM A;  3ID6 A;  5SWM A;  3M5R A;  5AQU A;  2HOE A;  2E4L A;  3G0Z A;  4IG3 A;  2XO7 A;  3M8S A;  2HVI A;  4CED A;  1JLE A;  3JSM A;  1NGB A;  1C0F A;  1K6Y A;  3VQ7 A;  1YIJ N;  5TKY A;  3CCU N;  3OYG A;  4F9O A;  4B9T A;  3MEC A;  5C2D A;  1RNH A;  4Q0B A;  4K8Z A;  1DGK N;  3MK6 A;  1BHL A;  2E6M A;  4F2S A;  2ETJ A;  5HLF A;  3LZI A;  4FXD A;  4KHY A;  3L2R A;  1BQN A;  1LWC A;  2A6A A;  1VQ5 N;  3NF8 A;  3SPZ A;  4HUF A;  1VAZ A;  4JI1 K;  5DM7 L;  3EE8 A;  4YHH K;  5AQW A;  4KTZ A;  3ZSQ A;  3BEX A;  4LF6 K;  4B9U A;  1SAZ A;  2QKB A;  2QKK A;  3VEN A;  3CM5 A;  3AY9 A;  5I3U A;  3U3G A;  1YJ9 N;  4H0X B;  3T1A A;  4H03 B;  1K9M O;  4CGJ A;  2PAV A;  3ZYY X;  3D2E A;  4I7F A;  4IOC L;  4KH6 A;  5ELZ A;  3WNF A;  3L0Q A;  4NB4 A;  3B6O A;  4JLH A;  4JKC A;  4PHT X;  3LL3 A;  5J2Q A;  4BR2 A;  1T44 A;  1VSJ A;  3LDL A;  3TAP A;  3TSQ A;  1HJR A;  3AA5 X;  1RBR A;  3V4I A;  1C0M A;  4BRC A;  3SZ2 A;  3VEZ A;  1QSY A;  5IT9 O;  4F2R A;  4MO4 A;  2D0B A;  4JS5 A;  3K5M A;  1WB9 A;  3KK7 A;  2UYT A;  3HPG A;  4KHU A;  3AVJ A;  4FCY A;  4CVN E;  5AQY A;  4FZY A;  1WSJ A;  5LY3 A;  2Q2R A;  3ZT3 A;  2OPP A;  1Z26 A;  1HPZ A;  2DTU A;  3IS9 A;  1U49 A;  3G10 A;  2PFU A;  4CIE A;  2ZF5 O;  4FWQ A;  4CD1 A;  3GDQ A;  3T1H K;  3NGZ A;  4IXC A;  2GWK A;  1NK0 A;  2QM1 A;  2UXC K;  4KHQ A;  1EKE A;  3OYB A;  2YHX A;  3DI6 A;  4KI4 A;  3D2F B;  3LPU A;  3BZC A;  3MXJ A;  3VQA A;  4AH9 A;  1V4S A;  2O4I A;  5HP1 A;  1T3V A;  5AQR A;  5CY4 A;  4QS8 A;  3LDO A;  3LZJ A;  5DK5 A;  4DV3 K;  4CZK A;  3PV8 A;  2KHO A;  3D7E O;  1RTJ A;  1N36 K;  5GAH P;  1RBS A;  1X3N A;  3EN9 A;  3F2K A;  3CHW A;  1EP4 A;  4YOT A;  5JLH A;  4E3S A;  3V9W A;  4BC5 A;  3CER A;  1HPM A;  1Z05 A;  3N4P A;  1T6C A;  2WFB A;  3LWL A;  1HYS A;  3JAM O;  1RIL A;  3HTV A;  4KFB A;  2KKZ A;  1C6V A;  3EE9 A;  1C0U A;  2YNG A;  4JK8 A;  3UKU B;  4OKJ A;  4IOA L;  3NCI A;  2A1R A;  1X9W A;  3J80 O;  1KLN A;  4JD2 A;  3ZT0 A;  3H1V X;  2FF3 B;  3RMA A;  3QO9 A;  3CQY A;  4B1W B;  4IEE A;  4BDP A;  4J2E A;  2F8T A;  4CEZ A;  5BN9 A;  4JKE A;  2Q31 A;  4BRK A;  3PSI A;  4CJV A;  3CME N;  4KAZ A;  3HXM A;  3H46 O;  1RT2 A;  2F8S A;  3IAY A;  4CJU A;  4WYB A;  2P9L B;  1VQP N;  3CPW M;  1IO2 A;  4BQZ A;  4M3X A;  4JEP A;  1ATS A;  3P4I A;  1JCE A;  3NHG A;  3MN9 A;  4B8A B;  1NK4 A;  3VOV A;  1J54 A;  2OA8 A;  4BVO A;  4QS9 A;  1D8Y A;  3EZ5 A;  4HVJ A;  5AZJ B;  4B3T K;  1RDW X; 
#chains in the Genus database with same CATH homology
 4EP4 A;  3QNN A;  1S1V A;  2YHA A;  3AVL A;  4CEQ A;  3O3G A;  4I9L A;  5CZ1 A;  1HYV A;  4CIF A;  3H08 A;  5KI6 A;  4CGG A;  3RMC A;  1JXE A;  1MU2 A;  1FKP A;  2HND A;  1ASW A;  2IS3 A;  3OVN A;  3ULD A;  3OYI A;  3HPH A;  3SUN A;  3SPY A;  2WOM A;  3MAQ A;  3F73 A;  1BQM A;  1YTU A;  1J9A A;  2YNF A;  4CHN A;  2Z1I A;  4DU3 A;  4CF1 A;  1J5O A;  4RW8 A;  1YTA A;  1NK8 A;  4B08 A;  2KFZ A;  4WE1 A;  4FM1 A;  3DYA A;  4AHT A;  4NYN A;  4M41 A;  2DY4 A;  1UAX A;  3KKS A;  4ELV A;  4OVL A;  3O4N A;  2IOC A;  4FLW A;  4DTR A;  1B9F A;  1HMV A;  1QQC A;  2OPQ A;  4CGD A;  3AA4 A;  3CFP A;  1RT5 A;  4GW6 A;  3QEX A;  2HB5 A;  4E0D A;  4OLB A;  2Z1G A;  2IC3 A;  4UQG A;  3RRG A;  2W42 A;  3C6U A;  4W5O A;  4DQI A;  3LPT A;  1JKH A;  3MED A;  4CJK A;  3KK1 A;  3AO4 A;  1VSM A;  4J2A A;  3KLH A;  1C1C A;  4FVM A;  1RDD A;  5E41 A;  3WNE A;  4ZTJ A;  2P1J A;  2NUB A;  3CM6 A;  4I2P A;  3DRR A;  4ELT A;  1VSD A;  4FJ8 A;  4W5N A;  1C1B A;  1HQE A;  3DOK A;  4H4M A;  4CJP A;  3CQ8 A;  4DS4 A;  4LSL A;  5HRS A;  1KRP A;  4DSJ A;  4CJ4 A;  4DSK A;  1N5Y A;  3KK3 A;  4G1Q A;  4CIG A;  1DTT A;  4CJS A;  4CJW A;  3DRS A;  3O3H A;  1JLG A;  3OYA A;  1IKY A;  4JRP A;  3RMD A;  1TKD A;  1TVR A;  3PUF A;  3AVG A;  4CK3 A;  3NH0 A;  2PY5 A;  2F96 A;  3WNH A;  2E6L A;  1U48 A;  3NBP A;  3NH1 A;  4W5T A;  1S9G A;  1NK9 A;  3CYM A;  3K5O A;  1WSF A;  4B9L A;  1CXU A;  2O4G A;  1SKS A;  3BDP A;  4FJX A;  4CCH A;  3SQ4 A;  3I8D A;  3ALY A;  4FJI A;  3AVA A;  4Z4F A;  4HHT A;  3ZT2 A;  4LH5 A;  3QIP A;  4KPY A;  4KRE A;  3L3U A;  4OLA A;  4ID1 A;  3NF7 A;  4PQU A;  1KTQ A;  3ZSX A;  1REV A;  5C42 A;  1SKW A;  2KZM A;  3MEG A;  2IGI A;  1NJY A;  5KGX A;  3OS2 A;  1W9H A;  3OS0 A;  1B9D A;  3A2F A;  3ZT1 A;  3VA3 A;  1VK0 A;  2FC0 A;  2XRI A;  3AVC A;  3T3F A;  2DFH A;  5KRS A;  4DTP A;  4QOZ B;  1U04 A;  2YKM A;  3SJJ A;  4OKE A;  5KTQ A;  2BDP A;  1RTI A;  4YNQ A;  4GMJ B;  2PYL A;  2GBZ A;  4BDY A;  3SYZ A;  4CHQ A;  4CER A;  3VA0 A;  4Z0U A;  3OJS A;  4DF8 A;  1L3U A;  4IFV A;  3K5L A;  1GOB A;  3TR8 A;  1KFD A;  4LSN A;  3KKR A;  1TKZ A;  3L2Q A;  4DTO A;  2HMI A;  3I0S A;  3LAL A;  3M8R A;  4O55 A;  2D0A A;  3B6P A;  3SV3 A;  2Q3S A;  5DMR A;  4HTU A;  2HVH A;  1C0T A;  3WNG A;  5KRT A;  1JLA A;  2G8H A;  1A5W A;  4KHN A;  3K57 A;  1S9E A;  3VQ4 A;  4B3O A;  3D0P A;  1TAQ A;  1NK5 A;  4FK2 A;  4Z4E A;  1JLQ A;  1D9D A;  1TL1 A;  3L3V A;  1W0H A;  3DLR A;  2KQ2 A;  3S9H A;  4NYF A;  3VQQ A;  3HST B;  3CG7 A;  4O4G A;  3TAM A;  4NCA A;  2EHG A;  3ASM A;  1TK8 A;  4DF4 A;  1SV5 A;  1WSE A;  5CYQ A;  2BGG A;  1CLQ A;  1EX4 A;  1IKX A;  2RF2 A;  2FBV A;  4FJ5 A;  3DMJ A;  1SUQ A;  4NCG A;  4GVM A;  2YKN A;  3OS1 A;  3OY9 A;  1QS4 A;  3RMB A;  5KGW A;  4CFA A;  4CHZ A;  3TAR A;  4MFB A;  4RW4 A;  1RTD A;  4HCC A;  1LWF A;  3DLB A;  4FJ7 A;  2PZS A;  4ICL A;  3ZSO A;  3OJU A;  4OKK A;  3NF9 A;  2XHB A;  4CEF A;  4E7I A;  3DM2 A;  3ZT4 A;  1A5V A;  1ITG A;  3TWH A;  4E89 A;  2VG6 A;  1ZYQ A;  4F3T A;  1QE1 A;  1QHT A;  3VQ9 A;  2ZQB A;  1RBT A;  3DLE A;  4Y1D A;  3HP9 A;  4B9S A;  4FJK A;  4FYD A;  4DFM A;  1JLB A;  4FW1 A;  4M3Y A;  3K5N A;  1ASU A;  1A5X A;  1Q9X A;  4CEC A;  1L3V A;  1Y97 A;  1WSH A;  3KLF A;  4F4K A;  4OPJ A;  4C8N A;  3SQ2 A;  3FFI A;  4E7L A;  3P1G A;  1L3S A;  1WLJ A;  3DLK A;  4M3R A;  1BIZ A;  1NOZ A;  3C95 A;  2OYQ A;  4AHR A;  4N76 A;  4CEE A;  1SL1 A;  2VG5 A;  3PX6 A;  4J2B A;  2HHU A;  2VG7 A;  4O44 A;  3NGI A;  1TKX A;  2YNH A;  3MXI A;  3AO5 A;  4KB1 A;  4ID5 A;  1S6P A;  3TAN A;  3MXM A;  1RBV A;  3V81 A;  2BE2 A;  2FBY A;  3V1R A;  2VWK A;  5CYM A;  3F9K A;  3LP3 A;  1BGX T;  1DLO A;  3AO1 A;  4H8K A;  3K59 A;  4E7K A;  2BAN A;  3KIO A;  2G8W A;  3U3Y A;  4KKO A;  4IG0 A;  4IDK A;  2XY5 A;  1LW0 A;  3AV9 A;  4DU1 A;  4O0I A;  1S1U A;  1LV5 A;  4EZ6 A;  2QK9 A;  4FJ9 A;  3D45 A;  1RT3 A;  2FBX A;  3AO2 A;  3SUP A;  3SQ1 A;  2KW4 A;  2GUI A;  3AO3 A;  3SCX A;  3DLG A;  2HNZ A;  1O1W A;  4CJ5 A;  4CJR A;  1ZBL A;  3KD1 E;  4FJH A;  1G15 A;  1EET A;  5J1E A;  2I5J A;  3AVN A;  4Y1C A;  1Z25 A;  4ZHR A;  3NH2 A;  3LDS A;  4CHP A;  4DLG A;  1TGO A;  1VSH A;  4DWI A;  3HYF A;  3OYL A;  1TK5 A;  2ZE2 A;  4OGE A;  4BWM A;  4E1M A;  1ZBI A;  2G8K A;  3RTV A;  2ZD1 A;  3AVM A;  4CHY A;  4JS4 A;  4E19 A;  4AHV A;  4QCL A;  1GOC A;  1CXQ A;  3S3N A;  4CFB A;  1L5U A;  2ATQ A;  4FJG A;  1VSI A;  4I9Q A;  1YVU A;  2XY8 A;  4CEA A;  1T03 A;  1Q9Y A;  1B92 A;  1RTH A;  4BE1 A;  3QEI A;  1BIS A;  5FRM A;  1X9S A;  1JL2 A;  4PA1 A;  4CEB A;  1XHZ A;  2G8F A;  5HRO A;  3RR7 A;  4CJT A;  1ZBF A;  3KLI A;  3OYN A;  1L3T A;  1T05 A;  4C8O A;  4OJR A;  2YHB A;  2Z1J A;  1SKR A;  4B9N A;  4RG8 A;  3NAE A;  1S6Q A;  4N56 A;  1YT3 A;  3V9U A;  1NK7 A;  3OYD A;  4Z4C A;  4FLZ A;  1C1A A;  1NKC A;  3K2P A;  2YV0 X;  3ZSR A;  4BAC A;  3KLE A;  3TAE A;  4KHW A;  3T19 A;  2A1S A;  3SQ0 A;  3QEW A;  4CF9 A;  4CF2 A;  2HHQ A;  1RBU A;  4HUG A;  4PWD A;  3HL8 A;  3JYT A;  1D5A A;  3VQE A;  3CFR A;  2R7Y A;  4DU4 A;  1KFS A;  4CK2 A;  1IG9 A;  4DQR A;  4FJJ A;  1RT1 A;  2OPS A;  4N5S A;  1LWE A;  2Z1H A;  3LAK A;  4Z4H A;  1HRH A;  3V1O A;  1VSL A;  2GV9 A;  1WSG A;  3QET A;  4C8L A;  3VQ6 A;  3V9S A;  3EYZ A;  1T7P A;  4CJL A;  3NE6 A;  4DS5 A;  3OYK A;  2HNY A;  1S1T A;  1HQU A;  3AVH A;  4CGI A;  4DTU A;  3SUQ A;  1XI1 A;  2G8U A;  5HBM A;  4FZX C;  5HRR A;  4M42 A;  1SL2 A;  5K14 A;  1WAJ A;  4OPK A;  2HHW A;  3I0R A;  5SWM A;  1U45 A;  2KZZ A;  2E4L A;  3DRP A;  3G0Z A;  2G8V A;  4KHS A;  4IG3 A;  2XO7 A;  4MQ3 A;  3NGY A;  2JLE A;  3M8S A;  4CED A;  4DTX A;  4FJN A;  2HVI A;  4BE0 A;  1JLE A;  5FRO A;  3OYH A;  4CFC A;  3JSM A;  3SV4 A;  1NJZ A;  3P5J A;  1K6Y A;  3VQ7 A;  2HHT A;  4N41 A;  4QAG A;  1UOC A;  3OYG A;  3HPO A;  1BIU A;  4B9T A;  1UA0 A;  3MEC A;  4M3W A;  4KTQ A;  1WNS A;  5JS1 A;  1RNH A;  4M45 A;  4Q0B A;  4K8Z A;  3ISN C;  4LY7 A;  4KI6 A;  5CZ2 A;  4KO0 A;  1R0A A;  1BHL A;  2E6M A;  3LAM A;  2ETJ A;  4TSX A;  5HLF A;  1BL3 A;  3AVB A;  3LZI A;  3SNN A;  1N6Q A;  4F2S A;  3L2R A;  1BQN A;  4KHY A;  1LWC A;  3HVT A;  4FXD A;  1CZ9 A;  4FLV A;  3RR8 A;  3PO4 A;  2X6S A;  3NF8 A;  1DTQ A;  3CFO A;  1IKW A;  1BCM A;  5J2N A;  3TAG A;  3SPZ A;  4HUF A;  4LH4 A;  2B4J A;  1JLC A;  3L2U A;  2Y1J A;  3V9X A;  1LAW A;  3LWM A;  4KTZ A;  1TKT A;  3LP2 A;  3ZSQ A;  4RW9 A;  3QEP A;  2HHS A;  4B9U A;  1F21 A;  3OYJ A;  2QKB A;  2QKK A;  4DQS A;  5FRN A;  1KVC A;  3CM5 A;  4DFJ A;  5I3U A;  3U3G A;  4CES A;  3TAQ A;  1S1W A;  4CJ3 A;  4OGC A;  4FLY A;  1UA1 A;  3T1A A;  4CHO A;  2XY7 A;  1BI4 B;  4DSL A;  4CGJ A;  4CGF A;  1RT6 A;  3VQD A;  4FLT A;  4I7F A;  4DTM A;  1VSE A;  4DSE A;  3M8P A;  4N47 A;  4FLX A;  1VRU A;  3ZCM A;  1T8E A;  3OYF A;  2VWJ A;  4FM2 A;  2EX3 A;  1I3A A;  3WNF A;  4M3U A;  1VRT A;  4CEO A;  4IKF A;  1RT4 A;  2IAJ A;  1NK6 A;  3B6O A;  3IRX A;  2RKI A;  4JLH A;  1KSP A;  2DFE A;  4JRQ A;  2HW3 A;  1KVB A;  4IFY A;  4FZZ A;  4DTJ A;  5J2Q A;  3ZSZ A;  2B6A A;  1NJW A;  2PYJ A;  3DLH A;  2KTQ A;  1WAF A;  2AJQ A;  4J2D A;  1FK9 A;  1VSJ A;  5FDL A;  3TAP A;  1NJX A;  5I42 A;  3NFA A;  2D0C A;  1HJR A;  3AA5 X;  1RBR A;  4CE9 A;  3V4I A;  1C0M A;  3HP6 A;  3SZ2 A;  4E7J A;  4CGH A;  1QSY A;  4F2R A;  4JS5 A;  2D0B A;  4DLE A;  4DSF A;  3K5M A;  4XIU A;  4AIL C;  1U4B A;  3K58 A;  1QSL A;  1LAV A;  4BDZ A;  3ZSY A;  3HPG A;  1VSK A;  3EY1 A;  4KHU A;  3AVJ A;  1HNV A;  4FCY A;  1SL0 A;  1RT7 A;  1HYZ A;  1FKO A;  2D5R A;  3AA2 A;  5T7B A;  4DTN A;  4RW6 A;  4Z4G A;  4CFD A;  4FZY A;  3L8B A;  1WSJ A;  1Q8I A;  4F3O A;  2RN2 A;  5J2P A;  3VQ8 A;  2OPR A;  3S3O A;  1I39 A;  2OPP A;  1Z26 A;  3ZT3 A;  1HPZ A;  1WN7 A;  2DTU A;  3IS9 A;  4C8M A;  1U49 A;  3G10 A;  5C25 A;  4CIE A;  4KTW A;  2P5O A;  4W5R A;  1U47 A;  3V6D A;  1GOA A;  1ASV A;  3PX4 A;  4ELU A;  4R5P A;  3NGZ A;  3TI0 A;  1EXQ A;  1NK0 A;  2B5J A;  4CJF A;  4AHC A;  4KHQ A;  4ZTF A;  1EKE A;  1TV6 A;  4FK4 A;  3OYB A;  3QIN A;  3DI6 A;  5SZT A;  4KI4 A;  1LW2 A;  3LPU A;  3MXJ A;  3SUO A;  3HO1 A;  3SI6 A;  1FXX A;  3VQA A;  4O5B A;  4NCB A;  4BE2 A;  4B8C A;  4AH9 A;  2O4I A;  5D3G A;  1XWL A;  5HP1 A;  2QXF A;  3OYC A;  4DG1 A;  4E1N A;  3BGR A;  3PX0 A;  2IDO A;  4RW7 A;  3VN5 A;  3VQC A;  5CY4 A;  2P5G A;  3HJF A;  5EU7 A;  2HHX A;  4KB0 A;  3QIO A;  3LZJ A;  1JLF A;  1S5J A;  1J53 A;  4DFP A;  3MEE A;  5DK5 A;  4CF0 A;  3PV8 A;  1NKB A;  4CK1 A;  3UIQ A;  4Z4I A;  1UWB A;  1S1X A;  2X6N A;  4FLU A;  1IKV A;  1RTJ A;  3V1Q A;  4CF8 A;  4K8X A;  4LD0 A;  3L2W A;  4HCB A;  1RBS A;  2DFF A;  1KCF A;  1TK0 A;  1EP4 A;  4HUE A;  1CZB A;  1RDA A;  3C94 A;  3M8Q A;  3ITH A;  1NKE A;  4B9M A;  3OYM A;  4E3S A;  3V9W A;  3KK2 A;  4M3T A;  1RDC A;  1X1P A;  4EP5 A;  1WSI A;  3KJV A;  3PY8 A;  2G8I A;  5HRN A;  2WON A;  3O3F A;  3NDK A;  3LWL A;  3VQP A;  1NOY A;  4FM0 A;  1HYS A;  3THV A;  1RIL A;  3QEV A;  1JXB A;  3KD5 E;  4KFB A;  1TL3 A;  4FJM A;  1C6V A;  3P83 D;  4F8R A;  2X78 A;  4CJQ A;  2X74 A;  1C0U A;  2YNG A;  3HT3 A;  3VQB A;  2RPI A;  4CJE A;  3HM9 A;  4OKJ A;  4O0J A;  3U6F A;  1KVA A;  3KLG A;  1ZBH A;  3AVK A;  3VQ5 A;  3QNO A;  3ZSV A;  3NCI A;  4M3Z A;  2Y1I A;  2A1R A;  1X9W A;  1QSS A;  1KLN A;  3AA3 A;  4DFK A;  1RDB A;  1BI4 A;  4IBN A;  3S3M A;  4AHS A;  3AVF A;  2ITG A;  3E01 A;  3ZT0 A;  3RRH A;  3QER A;  5JS2 A;  4PY5 A;  3RMA A;  1XHX A;  3O4Q A;  1XC9 A;  3QO9 A;  4H4O A;  1KLM A;  4FW2 A;  4J2E A;  2LSN A;  3QLH A;  4BDP A;  4L8R B;  2F8T A;  4CEZ A;  5HRP A;  3KTQ A;  4DQP A;  3LAN A;  4AHU A;  1X9M A;  5C24 A;  4B9V A;  2XY6 A;  3HK2 A;  2HHV A;  1ZBU A;  1RCH A;  4C8K A;  3OYE A;  3V9Z A;  3L2V A;  4DSI A;  1BCO A;  4CJV A;  4KAZ A;  1QTM A;  4BWJ A;  4I2Q A;  3HXM A;  4DTS A;  1RT2 A;  3C6T A;  2F8S A;  2YNI A;  3IAY A;  4FK0 A;  3RWU A;  4CJU A;  4KV8 A;  3QES A;  1HNI A;  4KRF A;  1IO2 A;  4M3X A;  4YFU A;  3AVI A;  2OZM A;  2OZS A;  3ZSW A;  5J2M A;  3TAB A;  4DQQ A;  1JL1 A;  3NHG A;  3PO5 A;  4Q5V A;  4B8A B;  1NK4 A;  2FBT A;  1J54 A;  1VSF A;  4PUO A;  4W5Q A;  2OA8 A;  1D8Y A;  2KFN A;  1IH7 A;  3DOL A;  3LP1 A;  4DMN A;  3IG1 A;  4HVJ A;  3EZ5 A;  4E7H A;  3TAF A;  4FJL A;  4EZ9 A;  1TAU A;  3NF6 A;  3LP0 A;  2JGU A;  1D9F A;  2P51 A;  3HVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...