3AVMA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avmA00
1TL1A 3QO9A 3C95A 3PX0A 3ASMA 3OYNA 1L3VA 3BDPA 3L2QA 1BHLA 3DLHA 4KTWA 5C25A 3NH0A 4MQ3A 5CZ2A 3OYJA 1BIUA 1HMVA 1HYZA 3AVBA 1ASVA 3TANA 2D0CA 4DQSA 1U48A 2O4IA 5T7BA 4PY5A 1HRHA 5HRNA 5KGXA 4M3RA 3MECA 4LY7A 4FK0A 4O44A 1KLMA 1U45A 4HVJA 4QCLA 1NKBA 1QHTA 1TKTA 2ITGA 1C1CA 2QKBA 1UA1A 3M8QA 1ASUA 3AVFA 2F8TA 4M42A 3SQ4A 4CJPA 1TKXA 4F3TA 4FVMA 4B08A 3ZSVA 2HW3A 4CGDA 1JLQA 1BISA 1X9WA 4E89A 4KAZA 1MU2A 2QXFA 4CHYA 3OYGA 4J2DA 1S1TA 2DY4A 2GV9A 3VQDA 1TKZA 3NHGA 3AA4A 2BE2A 4CCHA 3DLGA 4BE0A 1Z26A 1GOAA 3T3FA 1IH7A 2FBVA 3LAMA 1T03A 4FJXA 1HQUA 1R0AA 3K5OA 4CJWA 2D0BA 3K2PA 3MXJA 3V1RA 1RDDA 1KCFA 3HP6A 4DQQA 3U6FA 5I42A 1RBTA 4Z4HA 3OYMA 4M3TA 4KHSA 4DSFA 2RN2A 3QINA 1S1UA 5HLFA 4PA1A 3NDKA 3LWMA 4IFVA 3RR7A 2DFFA 4Y1DA 3HYFA 1JLFA 2P1JA 3ZSXA 1B92A 1RBRA 3WNGA 1NKCA 1NJWA 3AO3A 3NFAA 3CFOA 3TAGA 1BI4A 4CF1A 1JXEA 1JLBA 4CJEA 4CHOA 3S3MA 3NF7A 2HMIA 1VSDA 2A1RA 1HNVA 4DTSA 3OS0A 1ZBFA 4CFAA 1EETA 2OPQA 4CIFA 4OPJA 3G10A 3KD5E 4AHTA 4FJ5A 2W42A 2HB5A 3CQ8A 3HPGA 4CHZA 3KLGA 3KIOA 3HT3A 4BWMA 3RRGA 3OYHA 3DOLA 3TARA 3F9KA 1NK6A 4FJ7A 1WSGA 3TR8A 1CXUA 4CJQA 5KRTA 4DQPA 4OLBA 4DF8A 4MFBA 4CJLA 4Z0UA 4F2SA 4FJGA 2E4LA 2X6SA 3TAFA 3ZT3A 1S1XA 2DFEA 3HJFA 1CZ9A 4OKJA 4CGFA 4KTQA 3V9WA 4B9SA 1SL0A 5HRRA 2G8HA 3AVHA 4CEZA 1FKPA 3H08A 5KI6A 2Z1IA 1IO2A 1ZBUA 4KFBA 3QIOA 3RMBA 3PY8A 3QNNA 4IG3A 1TKDA 3T19A 3AA3A 2KTQA 2PYLA 3AA5X 2IGIA 4FXDA 5HRPA 3EYZA 3KKSA 3KK2A 3ZT0A 3I8DA 4FLWA 4B3OA 3SYZA 3BGRA 4DS4A 4NYNA 4GW6A 4DFJA 4AHRA 4B9VA 4M3ZA 3AO2A 1JLCA 3TABA 5J2NA 4KHUA 4KKOA 3VQAA 2ZD1A 4CIGA 1C0UA 4IKFA 4DMNA 1VSHA 1TVRA 3ZSRA 4JLHA 4CHNA 2PYJA 2BGGA 3DLRA 2EHGA 4RW8A 1QSSA 4CEOA 4M45A 4OGEA 1WNSA 1HYSA 3SPZA 3HXMA 4LH5A 4KB1A 1XC9A 3V4IA 3NH1A 1N6QA 4Q0BA 4HUFA 1D9DA 3HK2A 3SV3A 4UQGA 1NK0A 1ZBLA 1JXBA 4ELVA 1VRTA 3LANA 4RG8A 1RTIA 2RPIA 4FW2A 3K57A 3RRHA 1YVUA 3RR8A 2P5GA 1C1AA 2KW4A 3DI6A 3HM9A 3NGIA 2HVHA 1VRUA 3EY1A 3AVMA 3F73A 3CM5A 4I7FA 1RDAA 3I0SA 1C0MA 4DTJA 3KLIA 4DS5A 3AV9A 5JS2A 1ZYQA 4M3YA 2Q3SA 4W5TA 3SQ1A 3LP2A 3L2RA 3O3HA 4E7HA 4CK1A 4DFMA 4O0IA 3NGZA 1RTDA 4DQIA 5SWMA 4KO0A 3ISNC 2B6AA 4CEFA 2IDOA 2OPPA 4L8RB 1I3AA 4DTXA 2XY5A 3HVTA 2FBTA 1TK5A 4DF4A 4CJTA 1NK9A 1NKEA 1T05A 3SCXA 3KLEA 3HO1A 3IG1A 3VN5A 3VQ8A 4BDPA 1FKOA 3QESA 1RTHA 3V9SA 4CK3A 4ID5A 2HHTA 1S1VA 5J1EA 4CJFA 3K59A 1CXQA 1JKHA 1HNIA 4AHCA 5FRNA 4OLAA 3T1AA 4DFPA 4FJNA 1IKYA 3MEDA 1RCHA 5KGWA 4TSXA 4DTOA 2X6NA 4BWJA 4CJ5A 1LWCA 1YT3A 4AHUA 4I2QA 1EXQA 4CGGA 1VSIA 3D0PA 1NK4A 2HVIA 4CIEA 4FLVA 5HBMA 3PX4A 1X1PA 2Z1GA 4IFYA 2GUIA 3B6PA 3OYFA 4ID1A 1RT7A 3RMAA 3V6DA 1TK8A 1U4BA 5DMRA 1NJZA 1WN7A 1IKXA 1EP4A 4CJ4A 4E7IA 2KFZA 4E7JA 4B9UA 2IAJA 4CGJA 1RILA 4FZZA 3M8SA 2HNDA 1B9DA 1ASWA 4CJSA 1F21A 1D8YA 3LAKA 5KTQA 3OYDA 1HPZA 4BACA 2YKNA 4CEDA 1S5JA 4O4GA 4BDZA 4IG0A 4KB0A 3RMDA 1ZBIA 2XO7A 3DRSA 3AVIA 1LAVA 3PUFA 2IS3A 3QERA 4C8OA 2VG7A 4DU1A 4E3SA 3S3NA 1CZBA 3AVNA 2HNZA 4LSNA 3O3FA 4HHTA 4KHWA 2HHWA 1RT1A 4F3OA 3UIQA 4AHVA 1FXXA 4FYDA 5FROA 1KVCA 3V1QA 3IS9A 1Z25A 4J2EA 5C24A 2HHSA 3AVKA 3ZT2A 4NYFA 1SKWA 5JS1A 1BGXT 4DWIA 1WLJA 2YHBA 4DSIA 3NAEA 4RW9A 3P1GA 3DLBA 2AJQA 3AVLA 4HCCA 4M3XA 2OA8A 4DFKA 3VA3A 4FK4A 2LSNA 3HVRA 4F8RA 2ETJA 4CEAA 3DRPA 2G8IA 1WAFA 3O3GA 1JL2A 1BI4B 1QSLA 2G8VA 1TAQA 3VQ5A 3B6OA 2OZSA 3CFPA 4FLYA 4J2AA 1S6QA 4J2BA 4DTRA 1LWEA 2HHVA 3THVA 2XY6A 1WSFA 3L8BA 3SUNA 1FK9A 4PQUA 2D5RA 1NJXA 2F96A 3VQ9A 4FLZA 1BQMA 1EX4A 3SV4A 3S9HA 4FJIA 2O4GA 1RDCA 3NE6A 3C6UA 4I9LA 5CYMA 1VSKA 4OPKA 4FZYA 1YTAA 3L2VA 1DTQA 2E6MA 4JRPA 4CFCA 3DOKA 1KVBA 3QEVA 2G8FA 2IOCA 4AH9A 4FW1A 5FRMA 1UAXA 1XI1A 3FFIA 2BDPA 1VK0A 4ZTFA 3AO4A 2VG5A 3PO5A 3S3OA 2KQ2A 3JSMA 4B9NA 4Y1CA 3EZ5A 1BQNA 3SPYA 5HP1A 1NOYA 1HYVA 4CJRA 3JYTA 3RTVA 1EKEA 3LP3A 4KV8A 2I5JA 4FM2A 5J2MA 4FLTA 3M8PA 3L3VA 3AVAA 2Z1HA 3DM2A 3VQ7A 3MAQA 3OYEA 4CESA 4DLEA 1L3SA 1BCOA 3P5JA 4JS4A 1LWFA 1RT5A 4FJ8A 4KRFA 3OS1A 3LZJA 1X9SA 3V9UA 5D3GA 1UA0A 5HRSA 1SL1A 1TAUA 3HSTB 1RBUA 4BE1A 2FC0A 2RKIA 3KK1A 4DSEA 4C8KA 2B4JA 1RBVA 4KHYA 1RT4A 4CHQA 1LAWA 4N41A 2F8SA 5SZTA 4E19A 3PO4A 1L3TA 1RDBA 4H4MA 1TL3A 4FJHA 1GOBA 1QQCA 2P51A 1J9AA 1WSEA 1Q8IA 3AO1A 3OJUA 3OYLA 1IG9A 4BDYA 3LPTA 1S9GA 3V9XA 1G15A 3C94A 3ZSQA 4DTPA 3KLHA 1DLOA 3CYMA 3L2UA 4W5OA 3QEXA 4E7LA 2HHQA 1ITGA 3AVGA 4CFDA 3U3GA 3ZSYA 3K5LA 3K58A 3TAEA 4W5NA 3HL8A 4FM0A 4OGCA 1U04A 3QEIA 1BL3A 3AVJA 5EU7A 2Y1JA 3MEGA 2RF2A 4CF9A 2YNGA 4AILC 4QOZB 4E7KA 5HROA 3SQ0A 3TAMA 1KFSA 3CG7A 4G1QA 1X9MA 1KFDA 4JRQA 5E41A 1QTMA 4W5RA 4NCGA 3E01A 4EZ9A 1TGOA 2XY7A 3RMCA 4FK2A 4QAGA 4B9TA 5CZ1A 1SKSA 4ZHRA 1J5OA 1BIZA 3NCIA 4JS5A 1Q9YA 4Z4FA 3SNNA 4FLXA 4KPYA 3L2WA 1T7PA 1W0HA 4F2RA 3HP9A 3AA2A 2IC3A 1NK8A 4ZTJA 4ICLA 2G8UA 4DLGA 4NCAA 3C6TA 3QIPA 1C1BA 1WAJA 4DU4A 4OKKA 1QSYA 2E6LA 1DTTA 3NH2A 2GBZA 4HCBA 3VQEA 4YNQA 3O4QA 3VQPA 4RW4A 3ZT4A 3WNEA 1U47A 3D45A 1NJYA 1S1WA 1WSHA 2PY5A 5KRSA 3LZIA 3DLKA 2HHXA 2YKMA 2YV0X 2ZE2A 3VQ4A 1VSJA 3KJVA 2Y1IA 4FJ9A 3HPHA 1IKVA 3OJSA 2G8WA 4FJKA 4PWDA 4IDKA 4DSJA 1WSIA 3CM6A 1YTUA 1A5VA 3SUOA 3TAQA 2PZSA 1IKWA 1J53A 1J54A 1JLAA 4C8MA 4CK2A 4CERA 3U3YA 3I0RA 3OY9A 4K8ZA 3OYAA 3LWLA 4KHNA 4KREA 2OPRA 4W5QA 3SZ2A 1GOCA 1SL2A 1RTJA 1XHXA 2R7YA 2OZMA 2A1SA 3ZSOA 3TAPA 2KFNA 4CJVA 3SUPA 1L3UA 4N76A 4Z4IA 1JL1A 2EX3A 3OYCA 3NGYA 4DQRA 3PV8A 4RW6A 3KLFA 1LV5A 2Z1JA 1KRPA 1QE1A 3DRRA 3K5MA 1VSMA 4CF2A 4FLUA 5J2QA 3V81A 3SJJA 3CFRA 4EZ6A 4M3WA 1SUQA 1Y97A 3K5NA 5FDLA 3MEEA 3MXMA 4B9MA 1NOZA 4CFBA 2P5OA 2VWKA 2XRIA 4DSKA 1RT2A 2QKKA 3LALA 4LD0A 4ELTA 4FJJA 1VSEA 4LSLA 1KLNA 2JGUA 2X74A 2YHAA 4CEQA 2VG6A 4AHSA 4I9QA 4M41A 4CF8A 3TWHA 1VSLA 4GVMA 4C8LA 1K6YA 4WE1A 2X78A 3OYBA 3V9ZA 2JLEA 2FBYA 3LP1A 2BANA 4ELUA 3ZCMA 2FBXA 4B8AB 1N5YA 1REVA 1TV6A 3QEWA 3P83D 4C8NA 4Z4CA 3QNOA 4KTZA 4R5PA 4H4OA 5J2PA 1KSPA 4KI4A 3ULDA 2OYQA 4BE2A 1CLQA 1SV5A 3PX6A 3WNFA 3DLEA 3NF8A 3QLHA 3OS2A 1XWLA 1JLEA 5C42A 4OJRA 1UWBA 1LW0A 2D0AA 3VQCA 4CJUA 3NBPA 1U49A 4NCBA 4FZXC 1A5WA 1NK5A 3LDSA 3ITHA 2DTUA 4O5BA 1C0TA 4DTMA 1Q9XA 4LH4A 2YNHA 4K8XA 1UOCA 3A2FA 3VQ6A 4CHPA 4FCYA 3KTQA 2QK9A 1NK7A 2XY8A 3RWUA 2ATQA 3ALYA 3L3UA 4XIUA 4CGHA 1JLGA 1A5XA 1RBSA 3LP0A 3NF6A 4RW7A 2XHBA 4HUGA 4DTUA 1RNHA 5I3UA 2HHUA 2KZMA 2DFHA 3VA0A 4DTNA 5K14A 4Q5VA 4N47A 4CF0A 3QEPA 4FJMA 1QS4A 3SQ2A 1S9EA 4N5SA 2OPSA 4HUEA 4H8KA 4O0JA 3ZSZA 4B8CA 4Z4GA 3SUQA 1HQEA 1D9FA 1TK0A 1XHZA 4FM1A 1BCMA 4PUOA 4KI6A 3G0ZA 4B9LA 1S6PA 1WSJA 4DG1A 5CYQA 3M8RA 3O4NA 3QETA 4CE9A 1C6VA 1HJRA 4KHQA 3AO5A 1KVAA 5CY4A 4EP5A 4E0DA 4FJLA 3V1OA 4OKEA 3VQBA 1SKRA 3IRXA 3ZSWA 1W9HA 4F4KA 1D5AA 3DYAA 3IAYA 4I2PA 4CGIA 2WONA 4CEEA 3OVNA 4CECA 4CJKA 1L5UA 2YNIA 2NUBA 4EP4A 4N56A 4OVLA 1ZBHA 2WOMA 3NF9A 4Z4EA 1B9FA 1RT3A 2YNFA 1T8EA 4DSLA 3KD1E 3VQQA 4E1NA 3HPOA 4DU3A 3OYKA 3LPUA 2B5JA 3SI6A 1RT6A 3KKRA 4O55A 4E1MA 3DMJA 3OYIA 3ZT1A 2HNYA 3TI0A 3MXIA 2VWJA 4M3UA 2KZZA 4IBNA 1LW2A 4GMJB 4CJ3A 4YFUA 3KK3A 1VSFA 1O1WA 5DK5A 3WNHA 3AVCA 2G8KA 4CEBA 4HTUA 1I39A 1KTQA 2ZQBA
chains in the Genus database with same CATH superfamily
4FWNA 3PX0A 1L3VA 3OYJA 1HMVA 1ASVA 3TANA 1YITN 1ZC6A 3CIPA 3D2FB 5AQYA 3OA9A 5AQJA 3MECA 4FK0A 4O44A 1QHTA 2ITGA 3M8QA 1ASUA 3AVFA 4K41A 4M42A 1TKXA 4DV3K 5GAEP 4E89A 3THXA 5KQ8A 1HKGA 3VQDA 2W41A 3NHGA 2BE2A 1GLBG 4ISGA 3OW2M 3O80A 2D4WA 3T3FA 4CZMA 2VGMA 1T03A 4ISFA 5C12A 3K5OA 4CJWA 4BR7A 4I6MB 4DQQA 1RBTA 4M3TA 2E1ZA 4DSFA 4DV7K 1OVYA 4ILGB 2BH1A 4PA1A 3HYFA 1JLFA 4JK9A 3VENA 1NU0A 4CJEA 4CHOA 2A1RA 4CFAA 1EETA 1KAXA 3EKSA 4FJ5A 2OANA 2ASPA 1VHXA 3KLGA 3HT3A 1NGAA 1NWKA 2F9WA 3TR8A 4CJQA 4FJ7A 3WEEB 3L0QA 2E4LA 3ZT3A 3MK6A 4KTQA 4LC9B 3MCPA 3JS6A 5HRRA 5MLCQ 4XH4A 1YJNN 3PY8A 1DEJA 2KTQA 3MN7A 3KK2A 4FLWA 5H1SQ 3BGRA 4NYNA 3AO2A 2JWLA 3TABA 4M7YA 2E2NA 2OCEA 1Q7YO 4KHUA 2WC9A 2ZF5O 3ZSRA 3DLRA 4WFNL 1U2VA 1QSSA 4M45A 4OGEA 1HYSA 4LF9K 3HXMA 4YORA 4LH5A 3G6EN 3NH1A 1D9DA 5M1FA 3SV3A 3THWB 1ZBLA 4ELVA 1VRTA 1K8KB 2RPIA 3RR8A 3AAPA 3DI6A 2HVHA 1VRUA 3EY1A 3CM5A 1BG3A 4I7FA 1HJOA 5LJWA 3KLIA 4DS5A 4JKAA 5JS2A 4M3YA 1VQ5N 3LP2A 5FLXO 3O3HA 3NGZA 1RTDA 4B1ZA 4DQIA 4CEFA 2IDOA 2OPPA 2XY5A 1NKEA 3IG1A 4BDPA 3VQ8A 4ID5A 2HHTA 2A5XA 4AHCA 4FWPA 5C2FA 4BWJA 4CJ5A 1YT3A 4AHUA 2NZTA 4FSVA 1NK4A 4CIEA 4FLVA 2VGNA 1U4BA 5DMRA 3P38A 2D1KA 1IKXA 2HSTA 4CJ4A 4E7IA 2KFZA 2IAJA 3WXMB 3M8SA 2HNDA 1B9DA 2VWBA 5AZJA 4JI2K 4CW7B 1HPZA 1JCGA 3THXB 4IG0A 1HUXA 5F2RA 3D7EO 3EE8A 3QERA 3P31A 4E3SA 4HHTA 3HSCA 4LSNA 3O3FA 2ZJQL 2HHWA 4JKEA 4JKBA 4JKGA 3UIQA 4AHVA 2D0OA 2EWSA 3M5RA 4FYDA 2NRXA 5FROA 3C6AA 3V1QA 1YAGA 4DV5K 1Z25A 3AVKA 3CJBA 5JS1A 4GV3A 2YHBA 3IUCA 3CCQN 1YXQA 3E9OA 4KH4A 4K43A 2IVNA 1QQNA 3DRPA 3CC4N 1WAFA 1OVQA 3CQYA 2G8VA 2QWMA 3MMVA 4FLYA 1S6QA 3C0BA 3L8BA 1FK9A 2D5RA 3VESA 1YHQN 3C6UA 4H0XB 1YTAA 1DTQA 4JRPA 1OKJA 4CFCA 2YHWA 1UAXA 4FWSA 3O5BA 3PO5A 3EZ5A 4OO1J 4IO8A 3LM9A 3O9QA 4JI4K 5AQOA 4BC3A 3CCMN 5HP1A 3R8EA 4ISEA 3HBTA 1EKEA 3LP3A 2VQFK 4FM2A 4DR4K 4JEPA 2IVPA 1QHAA 3VQ7A 1L3SA 3CJAA 3GG4A 4DR3K 4JAXA 3LZJA 3MX2A 5D3GA 1UA0A 5BR9A 5HRSA 1TAUA 5AQWA 3HSTB 2RKIA 4CZFA 1U2VB 4C8KA 1VQ8N 5BN9A 4KHYA 4N41A 4BRCA 1RDBA 1TL3A 4E1JA 4J8FA 5BRHA 1GOBA 5I9EB 4YOWA 4YHHK 1K9MO 4XH5A 4BDYA 1TUYA 3C94A 1V4SA 4IEIA 3ID6A 5EVZA 4B3SK 2HHQA 3OBYA 3U3GA 4FM0A 4AILC 2YNGA 5DM7L 3SQ0A 4JI8K 3CCLN 3AGRA 1KFDA 5AQUA 4NCGA 3E01A 4MO5A 4B9TA 5CZ1A 1BDGA 5ELZA 1BIZA 4Z4FA 4JS5A 3ATVA 1Q9YA 4FLXA 3L2WA 4F2RA 2GUPA 3AA2A 4ICLA 4DLGA 4NCAA 1G99A 4WYBA 1MA9B 4DU4A 2E6LA 1DTTA 2GBZA 3O4QA 3VQPA 3ZT4A 3M3ZA 2HBLA 3SK3A 5AZJB 2PY5A 5LY3A 3LZIA 3DLKA 2YKMA 2ZE2A 4M7XA 1IBMK 1RDUA 1WSIA 1J53A 1J54A 1TYQB 4CERA 3CJ7A 4KHNA 4U7BA 1SL2A 2R7YA 2OZMA 3TAPA 4JKGB 1L3UA 1ZXOA 5KPTA 1JL1A 2EX3A 3OYCA 3TSPA 5KPRA 5AZIA 1KRPA 1X3MA 3Q7CA 4NLCA 5B8HA 1DGKN 5FDLA 3MXMA 1NOZA 2ASMA 1NG9A 1YF5L 3UKUB 4FJJA 4DCHA 1KLNA 4CZLA 3SAHA 4IXCA 3J7YP 4DR2K 5AQXA 4I9QA 3TWHA 1VSLA 1K6YA 4WCEL 2X78A 1Q18A 2E2OA 3LP1A 4BRDA 2BANA 4A61A 1REVA 3LL3A 1TV6A 4GV9A 1E3MA 4BG9A 3DXMA 3AGKA 2PFUA 1KSPA 4B1XB 3PX6A 3OS2A 4BC2A 1JLEA 2FSNA 4OJRA 4DR1K 3KZBA 1U49A 3NBPA 1A5WA 3GOIA 3ITHA 2DTUA 1Q9XA 4LH4A 1UOCA 4WQ5A 3IDHA 5DM6L 2Q0RA 3CHWA 2XY8A 4XIUA 3L3UA 4YOTA 3FE1A 3QICA 4RW7A 4HUGA 1HKCA 4DV4K 2DFHA 3ULEA 2YX6A 4WQ5C 3VEOA 3SQ2A 4N5SA 2OPSA 3E9PA 3WXLA 4O0JA 4B8CA 3SUQA 1TK0A 4X65K 4FM1A 4DV6K 3MN5A 1WSJA 4DG1A 1E4FT 2IVOA 2AA4A 2QWQA 3O4NA 1NGEA 4CE9A 1C6VA 3AY9A 3AO5A 4FJLA 4E0DA 3V1OA 3VQBA 2P9LB 1NGIA 3H6EA 4I2PA 2Q2RA 2WONA 4CEEA 2NUBA 5AFUA 3ENHA 2UUBK 3NF9A 1OH7A 1B9FA 1RT3A 4CZGA 4DSLA 3KD1E 1QQOA 3OYKA 4FPAA 4O55A 1LOTB 3ZT1A 1YIJN 2VWJA 3M6GA 1VSFA 3WNHA 3AVCA 2G8KA 1I39A 4CHZA 2ZQBA 1NGBA 4O8KA 3RSEA 1LCUA 4KTWA 4NO7A 2QWLA 1GLDG 1HYZA 4JI3K 2D0CA 4YOVA 3TPQA 5HRNA 5KGXA 5M1QA 2YI1A 1U45A 2OTJN 4HVJA 4QCLA 4DV2K 2Q97A 5AQHA 2QKBA 2F8TA 3KHYA 1BO5O 4H0PA 4BR0A 1X9WA 1MU2A 3VF4A 4U67L 4CHYA 3OYGA 3HOSA 2W6LA 2DY4A 3AA4A 4H5WA 1ATRA 3DLGA 1Z26A 1IH7A 2O8DA 2O8EA 3LAMA 4FWMA 1HQUA 3J8AA 3MXJA 4DB3A 1FW6A 3V1RA 1RDDA 2E1YA 1KCFA 1P8ZA 3HP6A 3U6FA 5EOYA 3S41A 3DXKA 3OYMA 2QM1A 1SS6A 4MLEA 3QINA 1S1UA 4LFBK 3LWMA 4BY9C 4G9ZA 2RE2A 4IWVA 4Y1DA 3D2EA 1ATSA 2P1JA 1NLVA 4BRMA 1KXPA 2A41A 1NJWA 3AO3A 2HF3A 3NFAA 5AJ3K 3S3MA 4CZHA 1HNVA 1ZBFA 4OPJA 4AHTA 2W42A 3HPGA 3RRGA 3KIOA 5LJVA 3FLCO 3TARA 1NK6A 2UYTA 2HHHK 3DXMB 3CCRN 4F2SA 3ID8A 2P9KA 4CGFA 2QTDA 5BREA 1SL0A 2QWOA 1YJWN 3AVHA 4CEZA 2G8HA 1ZBUA 2P9NA 3QIOA 3QNNA 1TKDA 3T19A 4FXDA 3SYZA 4DS4A 2A40A 4A57A 4A2AA 5J2NA 2ZD1A 3ULEB 4DMNA 1VSHA 2PYJA 3Q7BA 4JLHA 2YCHA 4CEOA 3ZLJA 1WNSA 3SPZA 5M1NA 4KB1A 4BR5A 3V4IA 1CZAN 1N6QA 3WXKA 4HUFA 3HK2A 2QWRA 3LANA 4RG8A 1RTIA 4JI1K 4FW2A 3K57A 3THYA 1YVUA 3NGIA 1NMDA 2V51B 4JKFA 4UY8O 5JICA 1NGHA 2D0PA 3EN9A 1RDAA 1NBWA 4DTJA 3FZLA 2Q3SA 4W5TA 1U6ZA 4BVOA 3ISNC 3MCAB 2B6AA 2FXUA 2P9PA 3HVTA 2FBTA 4CJTA 2O8BA 3TU5A 1T05A 3SCXA 3VN5A 3CXCM 4CBWA 1ILYA 4CJFA 3K59A 1CXQA 1JKHA 1HNIA 4OLAA 1N32K 4DFPA 4FJNA 1RCHA 5KGWA 1LWCA 3RSEB 4I2QA 1EXQA 4CGGA 1VSIA 4A5BA 1X1PA 4IFYA 2Q36A 1W2BM 5GAHP 5F1XA 4BRHA 3RMAA 3G4SN 3VF2A 3I56N 4B9UA 2W6KA 3QDKA 5BPNA 3J81O 4JK8A 1ASWA 4BRIA 4CJSA 3SAGA 5AQGA 5GIPA 3T1HK 5KTQA 1N33K 2NRZA 3LDNA 2YKNA 4HTLA 3EEQA 3WXJA 3KWIA 1ZBIA 2XO7A 3PUFA 2P9IA 4C8OA 4DU1A 2GWJA 1CZBA 2O8DB 4X66K 3H3OB 3AVNA 2O8EB 1XQSC 5FPDA 3VF6A 3SMSA 1KVCA 4J2EA 3ZT2A 4NYFA 4BRPA 1SKWA 1WLJA 4AM7A 3P1GA 4HCCA 2YHXA 3VA3A 3D2EB 2LSNA 3RVCA 4CEAA 3C65A 3ZETB 2G8IA 1QSLA 1TAQA 3VQ5A 3CFPA 4JHDA 3CJ9A 4DTRA 1LWEA 3PSIA 1QVFM 3THVA 1WSFA 3SUNA 4PQUA 3N4QA 4FJIA 1EX4A 4I9LA 1VSKA 3L2VA 2E6MA 3A0IX 3DOKA 1KVBA 4AH9A 4QS9A 3VPZA 4B9NA 2P9KB 3NMUA 3IMXA 4B1WB 1BQNA 1NOYA 1V4TA 2P9NB 3GDQA 4CJRA 3JYTA 3RTVA 4BVPA 4R79A 2UXDK 4YOUA 1XMOK 3L3VA 3RWUA 3OYEA 4DLEA 1RT5A 4FJ8A 3L4QA 1DKGD 3V9UA 4BE1A 2FC0A 3KK1A 4DSEA 1RT4A 5BRFA 3EZWA 3ZYYX 1YI2N 1FJGK 4FJHA 1QQCA 5JLFA 3THYB 3JXUA 2CGJA 3UE5A 3ZSQA 4W5OA 4RCHA 4V19S 1VQ4N 4JD2A 4CFDA 3K58A 4LF8K 4W5NA 4BGAA 3KK7A 2GWKA 1U04A 4K25A 3QEIA 2DPNA 3KVGA 4CF9A 3CG7A 2O8BB 1K8AO 4KBOA 3CC7N 1QVGM 3I33A 4QAGA 5ADXA 4GNIA 1W0HA 1W97L 2IC3A 4Z94A 1C1BA 3NH2A 4BRKA 3VQEA 4YNQA 4RW4A 2O8CA 5AQFA 2FSJA 1U47A 4FWOA 3VTIA 1NJYA 2HHXA 2YV0X 3KJVA 4FJ9A 3OJSA 3LDLA 3HI0A 1IKWA 4CK2A 2P9IB 3I0RA 3OY9A 3OYAA 1GLCG 4ILHA 2OPRA 3ZSOA 4CD3A 4O5FA 4DQRA 4RW6A 2HF4A 5JMVA 1BA1A 1VSMA 4WFAL 4YOYA 3N4PA 3V81A 4EZ6A 5C10A 1Y97A 4B9MA 3MEEA 4BRLA 4CI6A 2VWKA 5JLHA 4IFEA 4LSLA 1KAZA 2O8FA 2QW9A 2X74A 2YHAA 1VQ7N 2VG6A 3BUZB 4AHSA 2NRVA 5FPEA 3J7AP 5E26A 2KHOA 3VGMA 3OYBA 2V7YA 5BPLA 1YJ9N 4LF4K 3VGKA 3HZ6A 5TKWA 4C8NA 3QNOA 4BRNA 4KTZA 4YY3K 4R5PA 2UUAK 4H4OA 3CCEN 4K0KK 2OYQA 3DLEA 3NF8A 1VQ9N 1LW0A 5C2DA 1VQPN 4NCBA 4FZXC 3U8XA 4JKDA 3LDSA 4DTMA 3KWGA 3K9KA 3VQ6A 1WB9A 3CCSN 2ATQA 3ALYA 4CGHA 1WUAA 3LP0A 4DTUA 4DTNA 3CPWM 1J5EK 4Q5VA 4N47A 2A42A 1KC8O 4FJMA 1QS4A 1S9EA 4BGBA 4K42A 4H8KA 2W40A 4Z4GA 1HQEA 1BCMA 4PUOA 4KI6A 3QETA 5CY4A 1KVAA 4EP5A 3PIPL 4DV1K 2HOEA 3R6MA 3IRXA 3SAFA 1W9HA 4F4KA 3I55N 4CGIA 4CECA 1L5UA 2YNIA 4QS8A 4Y0WA 1ZBHA 2WOMA 4MO4A 1XC3A 3A5MC 1X3NA 3MWTA 1VQLN 4E1NA 4BQLA 3HPOA 4DU3A 4JNEA 1WOQA 1RT6A 2QWNA 4E1MA 3DMJA 3OYIA 3TI0A 4JI6K 1P90A 1VAZA 4FWRA 1T3VA 5IWAK 4CJ3A 3KK3A 1MWMA 5KQDA 3QO9A 3R3LA 3F5TA 1BHLA 2YJFA 5C25A 4MQ3A 3DJCA 2E20A 3A5LC 3AVBA 3H3NO 2O4IA 5T7BA 3O9TA 4EHTA 1HRHA 2O8CB 4M3RA 1YVNA 5KPZA 1KLMA 3VERA 1NKBA 1C1CA 3SQ4A 1IV0A 2KKZA 4F3TA 1O13A 4B08A 1RGIA 5AQRA 1YUWA 3SBGA 4KAZA 2QXFA 1S1TA 2GV9A 4CCHA 1TKZA 3UKRA 4BE0A 4OX9K 2WBNA 2FBVA 2Q1NA 2D0BA 3NVKA 4KH6A 1Z05A 2UXCK 4Z4HA 1N36K 2RN2A 3SBTA 3GBTA 4AQYK 5HLFA 2E8AA 3RR7A 1T6CA 3BY5A 4H0VB 4DR5K 3BF3A 3P4IA 4BREA 1B92A 3B8AX 4C1NK 2O8FB 3T1YK 1EO1A 2CGLA 1VSDA 5GAGP 4DTSA 2OPQA 3KD5E 3G10A 3CQ8A 4BWMA 3OYHA 3DOLA 2QXLA 3F9KA 3QB0A 1NJIO 1WSGA 1CXUA 5KRTA 1BWFO 1ZBSA 4CJLA 4FJGA 2X6SA 4FWQA 2BUPA 5GINA 2DFEA 4L3QA 2WFBA 4CVNE 4OKJA 1Z6RA 4BR9A 1SZ2A 1FKPA 3H08A 2Z1IA 4NB4A 4KFBA 3RMBA 4B3RK 4JI5K 5LL6Z 2PYLA 5HRPA 3EYZA 1KAYA 3KKSA 3ZT0A 3I8DA 4AHRA 4B9VA 4M3ZA 1JLCA 3VQAA 1C0UA 4IKFA 2BGGA 1TVRA 4O8UA 1NGCA 5CR4A 2EHGA 4RW8A 2NRRA 4M63C 4UQGA 1NK0A 1JXBA 5EX5A 3TTDA 2ZGZA 1HNWK 5CHIA 3RRHA 1C1AA 2ZJPL 3F73A 3K0SA 3VEZA 3WQUA 3AV9A 2VQEK 3H1QA 4NXMK 4BRGA 4KO0A 3C7NA 5SWMA 4L8RB 1SQKA 1I3AA 3O1BA 1Y64A 2F9TA 3LDOA 4DF4A 1NK9A 3KLEA 4LFCK 3VEVA 3V9SA 3ENBA 3MEDA 1NGDA 4TSXA 4DTOA 2X6NA 3D0PA 4GKKK 3PX4A 1QZ6A 2Z1GA 4CZIA 3BEXA 3OYFA 1RT7A 3F2KA 1TK8A 3VEXA 4OPHA 4X62K 3VETA 1EP4A 4CGJA 1RILA 4B3TK 4FZZA 3D2FA 3OYDA 4BACA 3IKMA 4O4GA 4A5AA 3EO3A 4YOXA 3CMEN 4KB0A 3RMDA 3DRSA 3AVIA 1LAVA 3UKRB 2IS3A 5M1PA 2VG7A 3E9LA 4KHWA 5AZIB 1RT1A 2CH5A 3MN9A 4F3OA 3IS9A 2FSKA 1BUPA 5M1OA 3NAEA 4FL9A 3DLBA 3CCUN 2OA8A 4DFKA 1J6ZA 3QMLA 3TTCA 3O3GA 2OZSA 2XY6A 2E5LK 1NJXA 2F96A 3VEYA 1BQMA 4FLZA 2O4GA 4CBUA 1RDCA 3NE6A 4IOAL 2G8FA 2ZGYA 4WFBL 2IOCA 4FW1A 3NVMA 2Q0UA 4IZ9A 1XI1A 2BDPA 1VK0A 2VG5A 2NRTA 3S3OA 3JSMA 1T44A 4FO0A 3H45C 2ITMA 3SPYA 5BN8A 4EHUA 3O9RA 1GLEG 3TTFA 3UB5A 4CZEA 4KV8A 1QQMA 4QS7A 2I5JA 1OH8A 5J2MA 3M8PA 3AVAA 5M1KA 2Z1HA 3DM2A 1IBKK 3MAQA 1HNXK 4CESA 1BCOA 4JS4A 4KRFA 1D4XA 5AR0A 1SL1A 1RBUA 3TSUA 3M1FA 1W7AA 4CHQA 1LAWA 2QWPA 4CBXA 4E19A 4EIAA 1IG8A 1J9AA 2VYPA 3OJUA 3ZX3A 1G15A 2F7TA 3THWA 1DLOA 4EFHA 3CYMA 1Q81O 4OGCA 3C7NB 1JJ2M 3PLAA 1BL3A 3AVJA 3MEGA 4QOZB 4AF1A 3CI5A 5HROA 1KFSA 4G1QA 5AQTA 1SAZA 1X9MA 3HOTA 3GL1A 2AP1A 5E41A 4H5RA 2XY7A 3RMCA 4JI0K 4FK2A 1BU6O 1J5OA 3NCIA 2YHYA 3SNNA 2NRWA 3HP9A 4OPAA 1NK8A 4ZTJA 2G8UA 3WUHA 3QIPA 1BOTO 1WAJA 4OKKA 1QSYA 2P9UA 4H0YB 3QBXA 4H5TA 1NM1A 5CE3A 1S1WA 1HNZK 3MN6A 2G8WA 4FJKA 4PWDA 1GLLO 4IDKA 4DSJA 1A5VA 2PZSA 3TAQA 1E4GT 4KREA 2CH6A 4W5QA 3SZ2A 1JCEA 1XHXA 2KFNA 3DXKB 4FVUA 4CJVA 3SUPA 5AQKA 4LF6K 3NGYA 5C15A 3KLFA 1LV5A 2Z1JA 1ESVA 1QE1A 3ENOA 3DRRA 4IOCL 2UUCK 3ATUA 3K5MA 4FLUA 5J2QA 3CFRA 4JKCA 5AQVA 1NNEA 4BRQA 2UXBK 4DSKA 1RT2A 3SLCA 1VSEA 3I8BA 3HTVA 2JGUA 1MWKA 4CEQA 3QFUA 4JKHA 3O9UA 3G25A 4M41A 1WBBA 3CQXA 2QI2A 4CZJA 3WQTA 4WE1A 3V9ZA 3ZCMA 2FBXA 3ZEUA 4B8AB 1N5YA 5HOOA 3LM2A 4Z4CA 4CZKA 5J2PA 4GY2B 4BE2A 3QLHA 1XWLA 2A3ZA 4DV0K 3VQCA 4CJUA 4BQZA 4H0OA 3AARA 2YNHA 1JCFA 2NLXA 4K8XA 2QK9A 2XHBA 1A5XA 3NF6A 4H5NA 2HHUA 1RNHA 3VA0A 4CF0A 3QEPA 4LF5K 1WBDA 1EWQA 5F0XA 3G0ZA 4B9LA 1S6PA 1XUPO 3EKUA 1HJRA 3H1VX 3ZSWA 2P9PB 3CERA 3OVNA 4CJKA 4EP4A 4N56A 1ATNA 4Z4EA 1T8EA 2YNFA 2B5JA 4NXNK 3OHRA 4MLHA 2V7ZA 2FF3B 3CJ1A 2HNYA 3MXIA 3HM8A 4JYAK 2KZZA 4DR7K 4IBNA 1LW2A 2YJEA 5DK5A 4HTUA 1KTQA 1TL1A 3C95A 2GTDA 3BDPA 3ASMA 3OYNA 3L2QA 3DLHA 2P9UB 3NH0A 5CZ2A 1BIUA 4DQSA 1U48A 3DAWA 3OBWA 1OH5A 4PY5A 4LY7A 2ZM6K 1TKTA 5HL7L 1UA1A 1VQMN 2CGKA 4CJPA 4FVMA 4ILJA 3ZSVA 3FR0A 4CGDA 1JLQA 2GELA 2HW3A 1BISA 1T6DA 1VQ6N 4J2DA 3DWLA 4PL7A 4YDUA 1GOAA 4DUYK 4FJXA 1TYQA 1R0AA 4A62A 3K2PA 4YDUC 5FPNA 2VCPA 5I42A 4BC4A 3VGLA 4KHSA 3W0LA 1X9JA 3NDKA 4IFVA 4JHDB 5AQQA 4RWTA 2DFFA 1NGFA 1NGGA 3CMAN 4FWKA 3ZSXA 1RBRA 5AQSA 3WNGA 1NKCA 3TAGA 3CFOA 3O6WA 1BI4A 4CF1A 1JXEA 1JLBA 3NF7A 2HMIA 2E2QA 3UKUA 2GEMA 5AFUH 3OS0A 2ZJRL 4CIFA 4A59A 3ZEUB 2HB5A 4BRFA 3K9JA 4DQPA 4OLBA 4DF8A 4MFBA 4Z0UA 2E2PA 3TAFA 1S1XA 3HJFA 3SJHA 1CZ9A 1HPMA 3V9WA 4B9SA 2HBKA 3A5OC 5KI6A 3CJCA 1IO2A 2RHKA 4IG3A 5JVHL 3AA3A 4H03B 3AA5X 3L6QA 2IGIA 1Q86O 4B3OA 2OTLN 5FPMA 3E66A 4GW6A 4DFJA 3CC2N 1KD1O 2ZWHA 3L4IA 4KKOA 4CIGA 4CHNA 3CF5L 3A5NC 4B3MK 1N8RO 1XC9A 4BROA 3U9DA 4WF9L 4JD2B 2P5GA 2KW4A 1R59O 3HM9A 1C0GA 4DUZK 3AVMA 3BZKA 3I0SA 1C0MA 4H5VA 1GLFO 1ZYQA 3SQ1A 5GIOA 3L2RA 4E7HA 4CK1A 1EQYA 4O0IA 4DFMA 4JN4A 2P9LA 4IJNA 3ZX0A 4DTXA 1TK5A 1OH6A 3HO1A 5BPMA 1FKOA 3QESA 1RTHA 4C23A 4CK3A 1S1VA 2HBMA 5J1EA 1K73O 5FRNA 4PKHA 3T1AA 1IKYA 4FWLA 3U4LA 1VQON 2Q31A 2HVIA 3DLLL 5HBMA 2GUIA 2QEXN 3B6PA 1VQNN 4ID1A 4FOIA 3WXIA 3V6DA 1NJZA 1WN7A 3GE1A 4E7JA 1HX1A 4GV6A 5GADP 1HKBA 3D6RA 1NMNA 2JWKA 3TSQA 4JV5K 3BP8A 1F21A 4BR2A 1D8YA 3LAKA 4CEDA 1S5JA 4BDZA 2NRHA 3HRGA 3MX5A 3LDQA 1RDWX 3R1XA 3S3NA 3T7ZA 2HNZA 4F9OA 1FXXA 2J4RA 5LMUK 3F9MA 2HHSA 5C24A 4IDHA 1BGXT 4DWIA 5AQNA 4DSIA 3J80O 4RW9A 2AJQA 1N34K 3AVLA 4M3XA 4FK4A 3HVRA 4F8RA 2ETJA 1M1KO 3PSFA 1JL2A 4BG8A 1BI4B 3O8MA 4BRAA 3B6OA 5AQZA 4XH1A 4J2BA 4J2AA 2HHVA 2BTFA 3EL2A 3VQ9A 3SV4A 3AAQA 3S9HA 1QZ5A 5CYMA 2HMPA 3BF1A 4OPKA 4H0TB 4FZYA 5EXWA 3C6HA 3QEVA 5FRMA 3FFIA 4NLBA 4ZTFA 2E88A 3AO4A 2KQ2A 4Y1CA 2P9SA 2KLAA 3SMPA 1HYVA 4PL8A 1C0FA 2PBDA 1S22A 3T69A 4IO9L 4FLTA 3A8YA 3U9ZA 4DKWA 3P5JA 4B9QA 3VTHA 1LWFA 3W3DA 3OS1A 1X9SA 1IJJA 3IFRA 2UU9K 5E84A 4DQ8A 1XNRK 4B1VA 2B4JA 1RBVA 2F8SA 5SZTA 3PO4A 1L3TA 4H4MA 2PAVA 4PKIA 3H46O 2P51A 1WSEA 1Q8IA 3AO1A 3OYLA 1IG9A 3LDPA 4AM6A 3OTOK 3LPTA 1S9GA 3V9XA 4DTPA 3E1YA 4C1NI 3KLHA 2GX9A 5BRDA 3L2UA 3QEXA 4LFAK 4E7LA 3MDQA 1ITGA 3AVGA 3K5LA 3TAEA 3ZSYA 2QA4N 1I94K 3CCVN 3HL8A 4CD1A 4B1UB 5EU7A 4EAHD 2Y1JA 2RF2A 2NNWA 3FZKA 4E7KA 3TAMA 4A2BA 4JRQA 1QTMA 4W5RA 4EZ9A 1TGOA 3ZX2A 5AQIA 4LF7K 4DR6K 1SKSA 4ZHRA 1NGJA 4KPYA 1T7PA 4BR4A 1KQSM 3C6TA 3O1WA 4HCBA 2HBJA 4FOEA 2I7PA 3WNEA 3D45A 3EE9A 1WSHA 4PHTX 3PIOL 5KRSA 2Y1IA 3VQ4A 1XNQK 1VSJA 3HPHA 1IKVA 1HR0K 3CM6A 1YTUA 3CCJN 3SUOA 4CJ7A 1JLAA 4C8MA 3U3YA 3O9SA 4K8ZA 3LWLA 3J7ZO 2FF6A 1GOCA 5JVGL 4JK7A 4PKGA 1Q82O 1RTJA 5EY4A 2A1SA 4X64K 4MDBA 2FLOA 4Z4IA 5IT9O 4FPBA 4KHPK 3PV8A 3P39A 4RTFD 3JAMO 4I6MA 1S72N 4CF2A 3SJJA 5C0YA 4M3WA 1SUQA 2P5OA 3K5NA 4CFBA 2IIRA 2XRIA 4ELTA 2QKKA 3LALA 4LD0A 1EWRA 4IJAA 2H3GX 3FGUA 2WTUA 4CF8A 4GVMA 4C8LA 3ZETA 2JLEA 2FBYA 4ELUA 4KH5A 5AQMA 3R9PA 4MDAA 5A2QO 3QEWA 5AQLA 3P83D 1GLAG 4IOXA 5BR8K 1TUUA 2I7NA 3WEEA 1BA0A 4KI4A 2P9SB 3ULDA 1DT9A 3QFPA 4GKJK 1CLQA 1SV5A 5ADXH 3WNFA 5LMNK 3CD6N 5C42A 1UWBA 2D0AA 1MDUB 1NK5A 3FZFA 4O5BA 1C0TA 3FZMA 5TKYA 2V52B 3A2FA 5AQPA 4CHPA 3KTQA 4FCYA 1NK7A 4JI7K 1JLGA 1RBSA 3MWPA 5I3UA 2KZMA 5K14A 2ASOA 4HUEA 1RFQA 3ZSZA 3FFKB 3O08A 1D9FA 1XHZA 3CPEA 4XEIA 1GLJO 4WQ4A 1H1VA 3CETA 4GVEA 5CYQA 1K8KA 4DHYA 3FZHA 3M8RA 1HLUA 4KHQA 3BZCA 3VMFB 4OKEA 4WQ4C 1SKRA 4B1YB 1D5AA 3DYAA 1M90O 3IAYA 2F4VK 3VEWA 1S3XA 1IBLK 4IEEA 1VQKN 4Q0BA 4OVLA 3VOVA 3O4WA 3WT0A 3VQQA 4HWIA 2WUSA 3LPUA 3SI6A 2A6AA 3KKRA 3G71N 4M3UA 1XMQK 4GMJB 4YFUA 1O1WA 4CEBA 4BC5A 3QBWA 4N76A
chains in the Genus database with same CATH topology
1TL1A 3QO9A 3C95A 3PX0A 3ASMA 3OYNA 1L3VA 3BDPA 3L2QA 1BHLA 3DLHA 4KTWA 5C25A 3NH0A 4MQ3A 5CZ2A 3OYJA 1BIUA 1HMVA 1HYZA 3AVBA 1ASVA 3TANA 2D0CA 4DQSA 1U48A 2O4IA 5T7BA 4PY5A 1HRHA 5HRNA 5KGXA 4M3RA 3MECA 4LY7A 4FK0A 4O44A 1KLMA 1U45A 4HVJA 4QCLA 1NKBA 1QHTA 1TKTA 2ITGA 1C1CA 2QKBA 1UA1A 3M8QA 1ASUA 3AVFA 2F8TA 4M42A 3SQ4A 4CJPA 1TKXA 4F3TA 4FVMA 4B08A 3ZSVA 2HW3A 4CGDA 1JLQA 1BISA 1X9WA 4E89A 4KAZA 1MU2A 2QXFA 4CHYA 3OYGA 4J2DA 1S1TA 2DY4A 2GV9A 3VQDA 1TKZA 3NHGA 3AA4A 2BE2A 4CCHA 3DLGA 4BE0A 1Z26A 1GOAA 3T3FA 1IH7A 2FBVA 3LAMA 1T03A 4FJXA 1HQUA 1R0AA 3K5OA 4CJWA 2D0BA 3K2PA 3MXJA 3V1RA 1RDDA 1KCFA 3HP6A 4DQQA 3U6FA 5I42A 1RBTA 4Z4HA 3OYMA 4M3TA 4KHSA 4DSFA 2RN2A 3QINA 1S1UA 5HLFA 4PA1A 3NDKA 3LWMA 4IFVA 3RR7A 2DFFA 4Y1DA 3HYFA 1JLFA 2P1JA 3ZSXA 1B92A 1RBRA 3WNGA 1NKCA 1NJWA 3AO3A 3NFAA 3CFOA 3TAGA 1BI4A 4CF1A 1JXEA 1JLBA 4CJEA 4CHOA 3S3MA 3NF7A 2HMIA 1VSDA 2A1RA 1HNVA 4DTSA 3OS0A 1ZBFA 4CFAA 1EETA 2OPQA 4CIFA 4OPJA 3G10A 3KD5E 4AHTA 4FJ5A 2W42A 2HB5A 3CQ8A 3HPGA 4CHZA 3KLGA 3KIOA 3HT3A 4BWMA 3RRGA 3OYHA 3DOLA 3TARA 3F9KA 1NK6A 4FJ7A 1WSGA 3TR8A 1CXUA 4CJQA 5KRTA 4DQPA 4OLBA 4DF8A 4MFBA 4CJLA 4Z0UA 4F2SA 4FJGA 2E4LA 2X6SA 3TAFA 3ZT3A 1S1XA 2DFEA 3HJFA 1CZ9A 4OKJA 4CGFA 4KTQA 3V9WA 4B9SA 1SL0A 5HRRA 2G8HA 3AVHA 4CEZA 1FKPA 3H08A 5KI6A 2Z1IA 1IO2A 1ZBUA 4KFBA 3QIOA 3RMBA 3PY8A 3QNNA 4IG3A 1TKDA 3T19A 3AA3A 2KTQA 2PYLA 3AA5X 2IGIA 4FXDA 5HRPA 3EYZA 3KKSA 3KK2A 3ZT0A 3I8DA 4FLWA 4B3OA 3SYZA 3BGRA 4DS4A 4NYNA 4GW6A 4DFJA 4AHRA 4B9VA 4M3ZA 3AO2A 1JLCA 3TABA 5J2NA 4KHUA 4KKOA 3VQAA 2ZD1A 4CIGA 1C0UA 4IKFA 4DMNA 1VSHA 1TVRA 3ZSRA 4JLHA 4CHNA 2PYJA 2BGGA 3DLRA 2EHGA 4RW8A 1QSSA 4CEOA 4M45A 4OGEA 1WNSA 1HYSA 3SPZA 3HXMA 4LH5A 4KB1A 1XC9A 3V4IA 3NH1A 1N6QA 4Q0BA 4HUFA 1D9DA 3HK2A 3SV3A 4UQGA 1NK0A 1ZBLA 1JXBA 4ELVA 1VRTA 3LANA 4RG8A 1RTIA 2RPIA 4FW2A 3K57A 3RRHA 1YVUA 3RR8A 2P5GA 1C1AA 2KW4A 3DI6A 3HM9A 3NGIA 2HVHA 1VRUA 3EY1A 3AVMA 3F73A 3CM5A 4I7FA 1RDAA 3I0SA 1C0MA 4DTJA 3KLIA 4DS5A 3AV9A 5JS2A 1ZYQA 4M3YA 2Q3SA 4W5TA 3SQ1A 3LP2A 3L2RA 3O3HA 4E7HA 4CK1A 4DFMA 4O0IA 3NGZA 1RTDA 4DQIA 5SWMA 4KO0A 3ISNC 2B6AA 4CEFA 2IDOA 2OPPA 4L8RB 1I3AA 4DTXA 2XY5A 3HVTA 2FBTA 1TK5A 4DF4A 4CJTA 1NK9A 1NKEA 1T05A 3SCXA 3KLEA 3HO1A 3IG1A 3VN5A 3VQ8A 4BDPA 1FKOA 3QESA 1RTHA 3V9SA 4CK3A 4ID5A 2HHTA 1S1VA 5J1EA 4CJFA 3K59A 1CXQA 1JKHA 1HNIA 4AHCA 5FRNA 4OLAA 3T1AA 4DFPA 4FJNA 1IKYA 3MEDA 1RCHA 5KGWA 4TSXA 4DTOA 2X6NA 4BWJA 4CJ5A 1LWCA 1YT3A 4AHUA 4I2QA 1EXQA 4CGGA 1VSIA 3D0PA 1NK4A 2HVIA 4CIEA 4FLVA 5HBMA 3PX4A 1X1PA 2Z1GA 4IFYA 2GUIA 3B6PA 3OYFA 4ID1A 1RT7A 3RMAA 3V6DA 1TK8A 1U4BA 5DMRA 1NJZA 1WN7A 1IKXA 1EP4A 4CJ4A 4E7IA 2KFZA 4E7JA 4B9UA 2IAJA 4CGJA 1RILA 4FZZA 3M8SA 2HNDA 1B9DA 1ASWA 4CJSA 1F21A 1D8YA 3LAKA 5KTQA 3OYDA 1HPZA 4BACA 2YKNA 4CEDA 1S5JA 4O4GA 4BDZA 4IG0A 4KB0A 3RMDA 1ZBIA 2XO7A 3DRSA 3AVIA 1LAVA 3PUFA 2IS3A 3QERA 4C8OA 2VG7A 4DU1A 4E3SA 3S3NA 1CZBA 3AVNA 2HNZA 4LSNA 3O3FA 4HHTA 4KHWA 2HHWA 1RT1A 4F3OA 3UIQA 4AHVA 1FXXA 4FYDA 5FROA 1KVCA 3V1QA 3IS9A 1Z25A 4J2EA 5C24A 2HHSA 3AVKA 3ZT2A 4NYFA 1SKWA 5JS1A 1BGXT 4DWIA 1WLJA 2YHBA 4DSIA 3NAEA 4RW9A 3P1GA 3DLBA 2AJQA 3AVLA 4HCCA 4M3XA 2OA8A 4DFKA 3VA3A 4FK4A 2LSNA 3HVRA 4F8RA 2ETJA 4CEAA 3DRPA 2G8IA 1WAFA 3O3GA 1JL2A 1BI4B 1QSLA 2G8VA 1TAQA 3VQ5A 3B6OA 2OZSA 3CFPA 4FLYA 4J2AA 1S6QA 4J2BA 4DTRA 1LWEA 2HHVA 3THVA 2XY6A 1WSFA 3L8BA 3SUNA 1FK9A 4PQUA 2D5RA 1NJXA 2F96A 3VQ9A 4FLZA 1BQMA 1EX4A 3SV4A 3S9HA 4FJIA 2O4GA 1RDCA 3NE6A 3C6UA 4I9LA 5CYMA 1VSKA 4OPKA 4FZYA 1YTAA 3L2VA 1DTQA 2E6MA 4JRPA 4CFCA 3DOKA 1KVBA 3QEVA 2G8FA 2IOCA 4AH9A 4FW1A 5FRMA 1UAXA 1XI1A 3FFIA 2BDPA 1VK0A 4ZTFA 3AO4A 2VG5A 3PO5A 3S3OA 2KQ2A 3JSMA 4B9NA 4Y1CA 3EZ5A 1BQNA 3SPYA 5HP1A 1NOYA 1HYVA 4CJRA 3JYTA 3RTVA 1EKEA 3LP3A 4KV8A 2I5JA 4FM2A 5J2MA 4FLTA 3M8PA 3L3VA 3AVAA 2Z1HA 3DM2A 3VQ7A 3MAQA 3OYEA 4CESA 4DLEA 1L3SA 1BCOA 3P5JA 4JS4A 1LWFA 1RT5A 4FJ8A 4KRFA 3OS1A 3LZJA 1X9SA 3V9UA 5D3GA 1UA0A 5HRSA 1SL1A 1TAUA 3HSTB 1RBUA 4BE1A 2FC0A 2RKIA 3KK1A 4DSEA 4C8KA 2B4JA 1RBVA 4KHYA 1RT4A 4CHQA 1LAWA 4N41A 2F8SA 5SZTA 4E19A 3PO4A 1L3TA 1RDBA 4H4MA 1TL3A 4FJHA 1GOBA 1QQCA 2P51A 1J9AA 1WSEA 1Q8IA 3AO1A 3OJUA 3OYLA 1IG9A 4BDYA 3LPTA 1S9GA 3V9XA 1G15A 3C94A 3ZSQA 4DTPA 3KLHA 1DLOA 3CYMA 3L2UA 4W5OA 3QEXA 4E7LA 2HHQA 1ITGA 3AVGA 4CFDA 3U3GA 3ZSYA 3K5LA 3K58A 3TAEA 4W5NA 3HL8A 4FM0A 4OGCA 1U04A 3QEIA 1BL3A 3AVJA 5EU7A 2Y1JA 3MEGA 2RF2A 4CF9A 2YNGA 4AILC 4QOZB 4E7KA 5HROA 3SQ0A 3TAMA 1KFSA 3CG7A 4G1QA 1X9MA 1KFDA 4JRQA 5E41A 1QTMA 4W5RA 4NCGA 3E01A 4EZ9A 1TGOA 2XY7A 3RMCA 4FK2A 4QAGA 4B9TA 5CZ1A 1SKSA 4ZHRA 1J5OA 1BIZA 3NCIA 4JS5A 1Q9YA 4Z4FA 3SNNA 4FLXA 4KPYA 3L2WA 1T7PA 1W0HA 4F2RA 3HP9A 3AA2A 2IC3A 1NK8A 4ZTJA 4ICLA 2G8UA 4DLGA 4NCAA 3C6TA 3QIPA 1C1BA 1WAJA 4DU4A 4OKKA 1QSYA 2E6LA 1DTTA 3NH2A 2GBZA 4HCBA 3VQEA 4YNQA 3O4QA 3VQPA 4RW4A 3ZT4A 3WNEA 1U47A 3D45A 1NJYA 1S1WA 1WSHA 2PY5A 5KRSA 3LZIA 3DLKA 2HHXA 2YKMA 2YV0X 2ZE2A 3VQ4A 1VSJA 3KJVA 2Y1IA 4FJ9A 3HPHA 1IKVA 3OJSA 2G8WA 4FJKA 4PWDA 4IDKA 4DSJA 1WSIA 3CM6A 1YTUA 1A5VA 3SUOA 3TAQA 2PZSA 1IKWA 1J53A 1J54A 1JLAA 4C8MA 4CK2A 4CERA 3U3YA 3I0RA 3OY9A 4K8ZA 3OYAA 3LWLA 4KHNA 4KREA 2OPRA 4W5QA 3SZ2A 1GOCA 1SL2A 1RTJA 1XHXA 2R7YA 2OZMA 2A1SA 3ZSOA 3TAPA 2KFNA 4CJVA 3SUPA 1L3UA 4N76A 4Z4IA 1JL1A 2EX3A 3OYCA 3NGYA 4DQRA 3PV8A 4RW6A 3KLFA 1LV5A 2Z1JA 1KRPA 1QE1A 3DRRA 3K5MA 1VSMA 4CF2A 4FLUA 5J2QA 3V81A 3SJJA 3CFRA 4EZ6A 4M3WA 1SUQA 1Y97A 3K5NA 5FDLA 3MEEA 3MXMA 4B9MA 1NOZA 4CFBA 2P5OA 2VWKA 2XRIA 4DSKA 1RT2A 2QKKA 3LALA 4LD0A 4ELTA 4FJJA 1VSEA 4LSLA 1KLNA 2JGUA 2X74A 2YHAA 4CEQA 2VG6A 4AHSA 4I9QA 4M41A 4CF8A 3TWHA 1VSLA 4GVMA 4C8LA 1K6YA 4WE1A 2X78A 3OYBA 3V9ZA 2JLEA 2FBYA 3LP1A 2BANA 4ELUA 3ZCMA 2FBXA 4B8AB 1N5YA 1REVA 1TV6A 3QEWA 3P83D 4C8NA 4Z4CA 3QNOA 4KTZA 4R5PA 4H4OA 5J2PA 1KSPA 4KI4A 3ULDA 2OYQA 4BE2A 1CLQA 1SV5A 3PX6A 3WNFA 3DLEA 3NF8A 3QLHA 3OS2A 1XWLA 1JLEA 5C42A 4OJRA 1UWBA 1LW0A 2D0AA 3VQCA 4CJUA 3NBPA 1U49A 4NCBA 4FZXC 1A5WA 1NK5A 3LDSA 3ITHA 2DTUA 4O5BA 1C0TA 4DTMA 1Q9XA 4LH4A 2YNHA 4K8XA 1UOCA 3A2FA 3VQ6A 4CHPA 4FCYA 3KTQA 2QK9A 1NK7A 2XY8A 3RWUA 2ATQA 3ALYA 3L3UA 4XIUA 4CGHA 1JLGA 1A5XA 1RBSA 3LP0A 3NF6A 4RW7A 2XHBA 4HUGA 4DTUA 1RNHA 5I3UA 2HHUA 2KZMA 2DFHA 3VA0A 4DTNA 5K14A 4Q5VA 4N47A 4CF0A 3QEPA 4FJMA 1QS4A 3SQ2A 1S9EA 4N5SA 2OPSA 4HUEA 4H8KA 4O0JA 3ZSZA 4B8CA 4Z4GA 3SUQA 1HQEA 1D9FA 1TK0A 1XHZA 4FM1A 1BCMA 4PUOA 4KI6A 3G0ZA 4B9LA 1S6PA 1WSJA 4DG1A 5CYQA 3M8RA 3O4NA 3QETA 4CE9A 1C6VA 1HJRA 4KHQA 3AO5A 1KVAA 5CY4A 4EP5A 4E0DA 4FJLA 3V1OA 4OKEA 3VQBA 1SKRA 3IRXA 3ZSWA 1W9HA 4F4KA 1D5AA 3DYAA 3IAYA 4I2PA 4CGIA 2WONA 4CEEA 3OVNA 4CECA 4CJKA 1L5UA 2YNIA 2NUBA 4EP4A 4N56A 4OVLA 1ZBHA 2WOMA 3NF9A 4Z4EA 1B9FA 1RT3A 2YNFA 1T8EA 4DSLA 3KD1E 3VQQA 4E1NA 3HPOA 4DU3A 3OYKA 3LPUA 2B5JA 3SI6A 1RT6A 3KKRA 4O55A 4E1MA 3DMJA 3OYIA 3ZT1A 2HNYA 3TI0A 3MXIA 2VWJA 4M3UA 2KZZA 4IBNA 1LW2A 4GMJB 4CJ3A 4YFUA 3KK3A 1VSFA 1O1WA 5DK5A 3WNHA 3AVCA 2G8KA 4CEBA 4HTUA 1I39A 1KTQA 2ZQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TL1 A;  3QO9 A;  3C95 A;  3PX0 A;  3ASM A;  3OYN A;  1L3V A;  3BDP A;  3L2Q A;  1BHL A;  3DLH A;  4KTW A;  5C25 A;  3NH0 A;  4MQ3 A;  5CZ2 A;  3OYJ A;  1BIU A;  1HMV A;  1HYZ A;  3AVB A;  1ASV A;  3TAN A;  2D0C A;  4DQS A;  1U48 A;  2O4I A;  5T7B A;  4PY5 A;  1HRH A;  5HRN A;  5KGX A;  4M3R A;  3MEC A;  4LY7 A;  4FK0 A;  4O44 A;  1KLM A;  1U45 A;  4HVJ A;  4QCL A;  1NKB A;  1QHT A;  1TKT A;  2ITG A;  1C1C A;  2QKB A;  1UA1 A;  3M8Q A;  1ASU A;  3AVF A;  2F8T A;  4M42 A;  3SQ4 A;  4CJP A;  1TKX A;  4F3T A;  4FVM A;  4B08 A;  3ZSV A;  2HW3 A;  4CGD A;  1JLQ A;  1BIS A;  1X9W A;  4E89 A;  4KAZ A;  1MU2 A;  2QXF A;  4CHY A;  3OYG A;  4J2D A;  1S1T A;  2DY4 A;  2GV9 A;  3VQD A;  1TKZ A;  3NHG A;  3AA4 A;  2BE2 A;  4CCH A;  3DLG A;  4BE0 A;  1Z26 A;  1GOA A;  3T3F A;  1IH7 A;  2FBV A;  3LAM A;  1T03 A;  4FJX A;  1HQU A;  1R0A A;  3K5O A;  4CJW A;  2D0B A;  3K2P A;  3MXJ A;  3V1R A;  1RDD A;  1KCF A;  3HP6 A;  4DQQ A;  3U6F A;  5I42 A;  1RBT A;  4Z4H A;  3OYM A;  4M3T A;  4KHS A;  4DSF A;  2RN2 A;  3QIN A;  1S1U A;  5HLF A;  4PA1 A;  3NDK A;  3LWM A;  4IFV A;  3RR7 A;  2DFF A;  4Y1D A;  3HYF A;  1JLF A;  2P1J A;  3ZSX A;  1B92 A;  1RBR A;  3WNG A;  1NKC A;  1NJW A;  3AO3 A;  3NFA A;  3CFO A;  3TAG A;  1BI4 A;  4CF1 A;  1JXE A;  1JLB A;  4CJE A;  4CHO A;  3S3M A;  3NF7 A;  2HMI A;  1VSD A;  2A1R A;  1HNV A;  4DTS A;  3OS0 A;  1ZBF A;  4CFA A;  1EET A;  2OPQ A;  4CIF A;  4OPJ A;  3G10 A;  3KD5 E;  4AHT A;  4FJ5 A;  2W42 A;  2HB5 A;  3CQ8 A;  3HPG A;  4CHZ A;  3KLG A;  3KIO A;  3HT3 A;  4BWM A;  3RRG A;  3OYH A;  3DOL A;  3TAR A;  3F9K A;  1NK6 A;  4FJ7 A;  1WSG A;  3TR8 A;  1CXU A;  4CJQ A;  5KRT A;  4DQP A;  4OLB A;  4DF8 A;  4MFB A;  4CJL A;  4Z0U A;  4F2S A;  4FJG A;  2E4L A;  2X6S A;  3TAF A;  3ZT3 A;  1S1X A;  2DFE A;  3HJF A;  1CZ9 A;  4OKJ A;  4CGF A;  4KTQ A;  3V9W A;  4B9S A;  1SL0 A;  5HRR A;  2G8H A;  3AVH A;  4CEZ A;  1FKP A;  3H08 A;  5KI6 A;  2Z1I A;  1IO2 A;  1ZBU A;  4KFB A;  3QIO A;  3RMB A;  3PY8 A;  3QNN A;  4IG3 A;  1TKD A;  3T19 A;  3AA3 A;  2KTQ A;  2PYL A;  3AA5 X;  2IGI A;  4FXD A;  5HRP A;  3EYZ A;  3KKS A;  3KK2 A;  3ZT0 A;  3I8D A;  4FLW A;  4B3O A;  3SYZ A;  3BGR A;  4DS4 A;  4NYN A;  4GW6 A;  4DFJ A;  4AHR A;  4B9V A;  4M3Z A;  3AO2 A;  1JLC A;  3TAB A;  5J2N A;  4KHU A;  4KKO A;  3VQA A;  2ZD1 A;  4CIG A;  1C0U A;  4IKF A;  4DMN A;  1VSH A;  1TVR A;  3ZSR A;  4JLH A;  4CHN A;  2PYJ A;  2BGG A;  3DLR A;  2EHG A;  4RW8 A;  1QSS A;  4CEO A;  4M45 A;  4OGE A;  1WNS A;  1HYS A;  3SPZ A;  3HXM A;  4LH5 A;  4KB1 A;  1XC9 A;  3V4I A;  3NH1 A;  1N6Q A;  4Q0B A;  4HUF A;  1D9D A;  3HK2 A;  3SV3 A;  4UQG A;  1NK0 A;  1ZBL A;  1JXB A;  4ELV A;  1VRT A;  3LAN A;  4RG8 A;  1RTI A;  2RPI A;  4FW2 A;  3K57 A;  3RRH A;  1YVU A;  3RR8 A;  2P5G A;  1C1A A;  2KW4 A;  3DI6 A;  3HM9 A;  3NGI A;  2HVH A;  1VRU A;  3EY1 A;  3AVM A;  3F73 A;  3CM5 A;  4I7F A;  1RDA A;  3I0S A;  1C0M A;  4DTJ A;  3KLI A;  4DS5 A;  3AV9 A;  5JS2 A;  1ZYQ A;  4M3Y A;  2Q3S A;  4W5T A;  3SQ1 A;  3LP2 A;  3L2R A;  3O3H A;  4E7H A;  4CK1 A;  4DFM A;  4O0I A;  3NGZ A;  1RTD A;  4DQI A;  5SWM A;  4KO0 A;  3ISN C;  2B6A A;  4CEF A;  2IDO A;  2OPP A;  4L8R B;  1I3A A;  4DTX A;  2XY5 A;  3HVT A;  2FBT A;  1TK5 A;  4DF4 A;  4CJT A;  1NK9 A;  1NKE A;  1T05 A;  3SCX A;  3KLE A;  3HO1 A;  3IG1 A;  3VN5 A;  3VQ8 A;  4BDP A;  1FKO A;  3QES A;  1RTH A;  3V9S A;  4CK3 A;  4ID5 A;  2HHT A;  1S1V A;  5J1E A;  4CJF A;  3K59 A;  1CXQ A;  1JKH A;  1HNI A;  4AHC A;  5FRN A;  4OLA A;  3T1A A;  4DFP A;  4FJN A;  1IKY A;  3MED A;  1RCH A;  5KGW A;  4TSX A;  4DTO A;  2X6N A;  4BWJ A;  4CJ5 A;  1LWC A;  1YT3 A;  4AHU A;  4I2Q A;  1EXQ A;  4CGG A;  1VSI A;  3D0P A;  1NK4 A;  2HVI A;  4CIE A;  4FLV A;  5HBM A;  3PX4 A;  1X1P A;  2Z1G A;  4IFY A;  2GUI A;  3B6P A;  3OYF A;  4ID1 A;  1RT7 A;  3RMA A;  3V6D A;  1TK8 A;  1U4B A;  5DMR A;  1NJZ A;  1WN7 A;  1IKX A;  1EP4 A;  4CJ4 A;  4E7I A;  2KFZ A;  4E7J A;  4B9U A;  2IAJ A;  4CGJ A;  1RIL A;  4FZZ A;  3M8S A;  2HND A;  1B9D A;  1ASW A;  4CJS A;  1F21 A;  1D8Y A;  3LAK A;  5KTQ A;  3OYD A;  1HPZ A;  4BAC A;  2YKN A;  4CED A;  1S5J A;  4O4G A;  4BDZ A;  4IG0 A;  4KB0 A;  3RMD A;  1ZBI A;  2XO7 A;  3DRS A;  3AVI A;  1LAV A;  3PUF A;  2IS3 A;  3QER A;  4C8O A;  2VG7 A;  4DU1 A;  4E3S A;  3S3N A;  1CZB A;  3AVN A;  2HNZ A;  4LSN A;  3O3F A;  4HHT A;  4KHW A;  2HHW A;  1RT1 A;  4F3O A;  3UIQ A;  4AHV A;  1FXX A;  4FYD A;  5FRO A;  1KVC A;  3V1Q A;  3IS9 A;  1Z25 A;  4J2E A;  5C24 A;  2HHS A;  3AVK A;  3ZT2 A;  4NYF A;  1SKW A;  5JS1 A;  1BGX T;  4DWI A;  1WLJ A;  2YHB A;  4DSI A;  3NAE A;  4RW9 A;  3P1G A;  3DLB A;  2AJQ A;  3AVL A;  4HCC A;  4M3X A;  2OA8 A;  4DFK A;  3VA3 A;  4FK4 A;  2LSN A;  3HVR A;  4F8R A;  2ETJ A;  4CEA A;  3DRP A;  2G8I A;  1WAF A;  3O3G A;  1JL2 A;  1BI4 B;  1QSL A;  2G8V A;  1TAQ A;  3VQ5 A;  3B6O A;  2OZS A;  3CFP A;  4FLY A;  4J2A A;  1S6Q A;  4J2B A;  4DTR A;  1LWE A;  2HHV A;  3THV A;  2XY6 A;  1WSF A;  3L8B A;  3SUN A;  1FK9 A;  4PQU A;  2D5R A;  1NJX A;  2F96 A;  3VQ9 A;  4FLZ A;  1BQM A;  1EX4 A;  3SV4 A;  3S9H A;  4FJI A;  2O4G A;  1RDC A;  3NE6 A;  3C6U A;  4I9L A;  5CYM A;  1VSK A;  4OPK A;  4FZY A;  1YTA A;  3L2V A;  1DTQ A;  2E6M A;  4JRP A;  4CFC A;  3DOK A;  1KVB A;  3QEV A;  2G8F A;  2IOC A;  4AH9 A;  4FW1 A;  5FRM A;  1UAX A;  1XI1 A;  3FFI A;  2BDP A;  1VK0 A;  4ZTF A;  3AO4 A;  2VG5 A;  3PO5 A;  3S3O A;  2KQ2 A;  3JSM A;  4B9N A;  4Y1C A;  3EZ5 A;  1BQN A;  3SPY A;  5HP1 A;  1NOY A;  1HYV A;  4CJR A;  3JYT A;  3RTV A;  1EKE A;  3LP3 A;  4KV8 A;  2I5J A;  4FM2 A;  5J2M A;  4FLT A;  3M8P A;  3L3V A;  3AVA A;  2Z1H A;  3DM2 A;  3VQ7 A;  3MAQ A;  3OYE A;  4CES A;  4DLE A;  1L3S A;  1BCO A;  3P5J A;  4JS4 A;  1LWF A;  1RT5 A;  4FJ8 A;  4KRF A;  3OS1 A;  3LZJ A;  1X9S A;  3V9U A;  5D3G A;  1UA0 A;  5HRS A;  1SL1 A;  1TAU A;  3HST B;  1RBU A;  4BE1 A;  2FC0 A;  2RKI A;  3KK1 A;  4DSE A;  4C8K A;  2B4J A;  1RBV A;  4KHY A;  1RT4 A;  4CHQ A;  1LAW A;  4N41 A;  2F8S A;  5SZT A;  4E19 A;  3PO4 A;  1L3T A;  1RDB A;  4H4M A;  1TL3 A;  4FJH A;  1GOB A;  1QQC A;  2P51 A;  1J9A A;  1WSE A;  1Q8I A;  3AO1 A;  3OJU A;  3OYL A;  1IG9 A;  4BDY A;  3LPT A;  1S9G A;  3V9X A;  1G15 A;  3C94 A;  3ZSQ A;  4DTP A;  3KLH A;  1DLO A;  3CYM A;  3L2U A;  4W5O A;  3QEX A;  4E7L A;  2HHQ A;  1ITG A;  3AVG A;  4CFD A;  3U3G A;  3ZSY A;  3K5L A;  3K58 A;  3TAE A;  4W5N A;  3HL8 A;  4FM0 A;  4OGC A;  1U04 A;  3QEI A;  1BL3 A;  3AVJ A;  5EU7 A;  2Y1J A;  3MEG A;  2RF2 A;  4CF9 A;  2YNG A;  4AIL C;  4QOZ B;  4E7K A;  5HRO A;  3SQ0 A;  3TAM A;  1KFS A;  3CG7 A;  4G1Q A;  1X9M A;  1KFD A;  4JRQ A;  5E41 A;  1QTM A;  4W5R A;  4NCG A;  3E01 A;  4EZ9 A;  1TGO A;  2XY7 A;  3RMC A;  4FK2 A;  4QAG A;  4B9T A;  5CZ1 A;  1SKS A;  4ZHR A;  1J5O A;  1BIZ A;  3NCI A;  4JS5 A;  1Q9Y A;  4Z4F A;  3SNN A;  4FLX A;  4KPY A;  3L2W A;  1T7P A;  1W0H A;  4F2R A;  3HP9 A;  3AA2 A;  2IC3 A;  1NK8 A;  4ZTJ A;  4ICL A;  2G8U A;  4DLG A;  4NCA A;  3C6T A;  3QIP A;  1C1B A;  1WAJ A;  4DU4 A;  4OKK A;  1QSY A;  2E6L A;  1DTT A;  3NH2 A;  2GBZ A;  4HCB A;  3VQE A;  4YNQ A;  3O4Q A;  3VQP A;  4RW4 A;  3ZT4 A;  3WNE A;  1U47 A;  3D45 A;  1NJY A;  1S1W A;  1WSH A;  2PY5 A;  5KRS A;  3LZI A;  3DLK A;  2HHX A;  2YKM A;  2YV0 X;  2ZE2 A;  3VQ4 A;  1VSJ A;  3KJV A;  2Y1I A;  4FJ9 A;  3HPH A;  1IKV A;  3OJS A;  2G8W A;  4FJK A;  4PWD A;  4IDK A;  4DSJ A;  1WSI A;  3CM6 A;  1YTU A;  1A5V A;  3SUO A;  3TAQ A;  2PZS A;  1IKW A;  1J53 A;  1J54 A;  1JLA A;  4C8M A;  4CK2 A;  4CER A;  3U3Y A;  3I0R A;  3OY9 A;  4K8Z A;  3OYA A;  3LWL A;  4KHN A;  4KRE A;  2OPR A;  4W5Q A;  3SZ2 A;  1GOC A;  1SL2 A;  1RTJ A;  1XHX A;  2R7Y A;  2OZM A;  2A1S A;  3ZSO A;  3TAP A;  2KFN A;  4CJV A;  3SUP A;  1L3U A;  4N76 A;  4Z4I A;  1JL1 A;  2EX3 A;  3OYC A;  3NGY A;  4DQR A;  3PV8 A;  4RW6 A;  3KLF A;  1LV5 A;  2Z1J A;  1KRP A;  1QE1 A;  3DRR A;  3K5M A;  1VSM A;  4CF2 A;  4FLU A;  5J2Q A;  3V81 A;  3SJJ A;  3CFR A;  4EZ6 A;  4M3W A;  1SUQ A;  1Y97 A;  3K5N A;  5FDL A;  3MEE A;  3MXM A;  4B9M A;  1NOZ A;  4CFB A;  2P5O A;  2VWK A;  2XRI A;  4DSK A;  1RT2 A;  2QKK A;  3LAL A;  4LD0 A;  4ELT A;  4FJJ A;  1VSE A;  4LSL A;  1KLN A;  2JGU A;  2X74 A;  2YHA A;  4CEQ A;  2VG6 A;  4AHS A;  4I9Q A;  4M41 A;  4CF8 A;  3TWH A;  1VSL A;  4GVM A;  4C8L A;  1K6Y A;  4WE1 A;  2X78 A;  3OYB A;  3V9Z A;  2JLE A;  2FBY A;  3LP1 A;  2BAN A;  4ELU A;  3ZCM A;  2FBX A;  4B8A B;  1N5Y A;  1REV A;  1TV6 A;  3QEW A;  3P83 D;  4C8N A;  4Z4C A;  3QNO A;  4KTZ A;  4R5P A;  4H4O A;  5J2P A;  1KSP A;  4KI4 A;  3ULD A;  2OYQ A;  4BE2 A;  1CLQ A;  1SV5 A;  3PX6 A;  3WNF A;  3DLE A;  3NF8 A;  3QLH A;  3OS2 A;  1XWL A;  1JLE A;  5C42 A;  4OJR A;  1UWB A;  1LW0 A;  2D0A A;  3VQC A;  4CJU A;  3NBP A;  1U49 A;  4NCB A;  4FZX C;  1A5W A;  1NK5 A;  3LDS A;  3ITH A;  2DTU A;  4O5B A;  1C0T A;  4DTM A;  1Q9X A;  4LH4 A;  2YNH A;  4K8X A;  1UOC A;  3A2F A;  3VQ6 A;  4CHP A;  4FCY A;  3KTQ A;  2QK9 A;  1NK7 A;  2XY8 A;  3RWU A;  2ATQ A;  3ALY A;  3L3U A;  4XIU A;  4CGH A;  1JLG A;  1A5X A;  1RBS A;  3LP0 A;  3NF6 A;  4RW7 A;  2XHB A;  4HUG A;  4DTU A;  1RNH A;  5I3U A;  2HHU A;  2KZM A;  2DFH A;  3VA0 A;  4DTN A;  5K14 A;  4Q5V A;  4N47 A;  4CF0 A;  3QEP A;  4FJM A;  1QS4 A;  3SQ2 A;  1S9E A;  4N5S A;  2OPS A;  4HUE A;  4H8K A;  4O0J A;  3ZSZ A;  4B8C A;  4Z4G A;  3SUQ A;  1HQE A;  1D9F A;  1TK0 A;  1XHZ A;  4FM1 A;  1BCM A;  4PUO A;  4KI6 A;  3G0Z A;  4B9L A;  1S6P A;  1WSJ A;  4DG1 A;  5CYQ A;  3M8R A;  3O4N A;  3QET A;  4CE9 A;  1C6V A;  1HJR A;  4KHQ A;  3AO5 A;  1KVA A;  5CY4 A;  4EP5 A;  4E0D A;  4FJL A;  3V1O A;  4OKE A;  3VQB A;  1SKR A;  3IRX A;  3ZSW A;  1W9H A;  4F4K A;  1D5A A;  3DYA A;  3IAY A;  4I2P A;  4CGI A;  2WON A;  4CEE A;  3OVN A;  4CEC A;  4CJK A;  1L5U A;  2YNI A;  2NUB A;  4EP4 A;  4N56 A;  4OVL A;  1ZBH A;  2WOM A;  3NF9 A;  4Z4E A;  1B9F A;  1RT3 A;  2YNF A;  1T8E A;  4DSL A;  3KD1 E;  3VQQ A;  4E1N A;  3HPO A;  4DU3 A;  3OYK A;  3LPU A;  2B5J A;  3SI6 A;  1RT6 A;  3KKR A;  4O55 A;  4E1M A;  3DMJ A;  3OYI A;  3ZT1 A;  2HNY A;  3TI0 A;  3MXI A;  2VWJ A;  4M3U A;  2KZZ A;  4IBN A;  1LW2 A;  4GMJ B;  4CJ3 A;  4YFU A;  3KK3 A;  1VSF A;  1O1W A;  5DK5 A;  3WNH A;  3AVC A;  2G8K A;  4CEB A;  4HTU A;  1I39 A;  1KTQ A;  2ZQB A; 
#chains in the Genus database with same CATH topology
 4FWN A;  3PX0 A;  1L3V A;  3OYJ A;  1HMV A;  1ASV A;  3TAN A;  1YIT N;  1ZC6 A;  3CIP A;  3D2F B;  5AQY A;  3OA9 A;  5AQJ A;  3MEC A;  4FK0 A;  4O44 A;  1QHT A;  2ITG A;  3M8Q A;  1ASU A;  3AVF A;  4K41 A;  4M42 A;  1TKX A;  4DV3 K;  5GAE P;  4E89 A;  3THX A;  5KQ8 A;  1HKG A;  3VQD A;  2W41 A;  3NHG A;  2BE2 A;  1GLB G;  4ISG A;  3OW2 M;  3O80 A;  2D4W A;  3T3F A;  4CZM A;  2VGM A;  1T03 A;  4ISF A;  5C12 A;  3K5O A;  4CJW A;  4BR7 A;  4I6M B;  4DQQ A;  1RBT A;  4M3T A;  2E1Z A;  4DSF A;  4DV7 K;  1OVY A;  4ILG B;  2BH1 A;  4PA1 A;  3HYF A;  1JLF A;  4JK9 A;  3VEN A;  1NU0 A;  4CJE A;  4CHO A;  2A1R A;  4CFA A;  1EET A;  1KAX A;  3EKS A;  4FJ5 A;  2OAN A;  2ASP A;  1VHX A;  3KLG A;  3HT3 A;  1NGA A;  1NWK A;  2F9W A;  3TR8 A;  4CJQ A;  4FJ7 A;  3WEE B;  3L0Q A;  2E4L A;  3ZT3 A;  3MK6 A;  4KTQ A;  4LC9 B;  3MCP A;  3JS6 A;  5HRR A;  5MLC Q;  4XH4 A;  1YJN N;  3PY8 A;  1DEJ A;  2KTQ A;  3MN7 A;  3KK2 A;  4FLW A;  5H1S Q;  3BGR A;  4NYN A;  3AO2 A;  2JWL A;  3TAB A;  4M7Y A;  2E2N A;  2OCE A;  1Q7Y O;  4KHU A;  2WC9 A;  2ZF5 O;  3ZSR A;  3DLR A;  4WFN L;  1U2V A;  1QSS A;  4M45 A;  4OGE A;  1HYS A;  4LF9 K;  3HXM A;  4YOR A;  4LH5 A;  3G6E N;  3NH1 A;  1D9D A;  5M1F A;  3SV3 A;  3THW B;  1ZBL A;  4ELV A;  1VRT A;  1K8K B;  2RPI A;  3RR8 A;  3AAP A;  3DI6 A;  2HVH A;  1VRU A;  3EY1 A;  3CM5 A;  1BG3 A;  4I7F A;  1HJO A;  5LJW A;  3KLI A;  4DS5 A;  4JKA A;  5JS2 A;  4M3Y A;  1VQ5 N;  3LP2 A;  5FLX O;  3O3H A;  3NGZ A;  1RTD A;  4B1Z A;  4DQI A;  4CEF A;  2IDO A;  2OPP A;  2XY5 A;  1NKE A;  3IG1 A;  4BDP A;  3VQ8 A;  4ID5 A;  2HHT A;  2A5X A;  4AHC A;  4FWP A;  5C2F A;  4BWJ A;  4CJ5 A;  1YT3 A;  4AHU A;  2NZT A;  4FSV A;  1NK4 A;  4CIE A;  4FLV A;  2VGN A;  1U4B A;  5DMR A;  3P38 A;  2D1K A;  1IKX A;  2HST A;  4CJ4 A;  4E7I A;  2KFZ A;  2IAJ A;  3WXM B;  3M8S A;  2HND A;  1B9D A;  2VWB A;  5AZJ A;  4JI2 K;  4CW7 B;  1HPZ A;  1JCG A;  3THX B;  4IG0 A;  1HUX A;  5F2R A;  3D7E O;  3EE8 A;  3QER A;  3P31 A;  4E3S A;  4HHT A;  3HSC A;  4LSN A;  3O3F A;  2ZJQ L;  2HHW A;  4JKE A;  4JKB A;  4JKG A;  3UIQ A;  4AHV A;  2D0O A;  2EWS A;  3M5R A;  4FYD A;  2NRX A;  5FRO A;  3C6A A;  3V1Q A;  1YAG A;  4DV5 K;  1Z25 A;  3AVK A;  3CJB A;  5JS1 A;  4GV3 A;  2YHB A;  3IUC A;  3CCQ N;  1YXQ A;  3E9O A;  4KH4 A;  4K43 A;  2IVN A;  1QQN A;  3DRP A;  3CC4 N;  1WAF A;  1OVQ A;  3CQY A;  2G8V A;  2QWM A;  3MMV A;  4FLY A;  1S6Q A;  3C0B A;  3L8B A;  1FK9 A;  2D5R A;  3VES A;  1YHQ N;  3C6U A;  4H0X B;  1YTA A;  1DTQ A;  4JRP A;  1OKJ A;  4CFC A;  2YHW A;  1UAX A;  4FWS A;  3O5B A;  3PO5 A;  3EZ5 A;  4OO1 J;  4IO8 A;  3LM9 A;  3O9Q A;  4JI4 K;  5AQO A;  4BC3 A;  3CCM N;  5HP1 A;  3R8E A;  4ISE A;  3HBT A;  1EKE A;  3LP3 A;  2VQF K;  4FM2 A;  4DR4 K;  4JEP A;  2IVP A;  1QHA A;  3VQ7 A;  1L3S A;  3CJA A;  3GG4 A;  4DR3 K;  4JAX A;  3LZJ A;  3MX2 A;  5D3G A;  1UA0 A;  5BR9 A;  5HRS A;  1TAU A;  5AQW A;  3HST B;  2RKI A;  4CZF A;  1U2V B;  4C8K A;  1VQ8 N;  5BN9 A;  4KHY A;  4N41 A;  4BRC A;  1RDB A;  1TL3 A;  4E1J A;  4J8F A;  5BRH A;  1GOB A;  5I9E B;  4YOW A;  4YHH K;  1K9M O;  4XH5 A;  4BDY A;  1TUY A;  3C94 A;  1V4S A;  4IEI A;  3ID6 A;  5EVZ A;  4B3S K;  2HHQ A;  3OBY A;  3U3G A;  4FM0 A;  4AIL C;  2YNG A;  5DM7 L;  3SQ0 A;  4JI8 K;  3CCL N;  3AGR A;  1KFD A;  5AQU A;  4NCG A;  3E01 A;  4MO5 A;  4B9T A;  5CZ1 A;  1BDG A;  5ELZ A;  1BIZ A;  4Z4F A;  4JS5 A;  3ATV A;  1Q9Y A;  4FLX A;  3L2W A;  4F2R A;  2GUP A;  3AA2 A;  4ICL A;  4DLG A;  4NCA A;  1G99 A;  4WYB A;  1MA9 B;  4DU4 A;  2E6L A;  1DTT A;  2GBZ A;  3O4Q A;  3VQP A;  3ZT4 A;  3M3Z A;  2HBL A;  3SK3 A;  5AZJ B;  2PY5 A;  5LY3 A;  3LZI A;  3DLK A;  2YKM A;  2ZE2 A;  4M7X A;  1IBM K;  1RDU A;  1WSI A;  1J53 A;  1J54 A;  1TYQ B;  4CER A;  3CJ7 A;  4KHN A;  4U7B A;  1SL2 A;  2R7Y A;  2OZM A;  3TAP A;  4JKG B;  1L3U A;  1ZXO A;  5KPT A;  1JL1 A;  2EX3 A;  3OYC A;  3TSP A;  5KPR A;  5AZI A;  1KRP A;  1X3M A;  3Q7C A;  4NLC A;  5B8H A;  1DGK N;  5FDL A;  3MXM A;  1NOZ A;  2ASM A;  1NG9 A;  1YF5 L;  3UKU B;  4FJJ A;  4DCH A;  1KLN A;  4CZL A;  3SAH A;  4IXC A;  3J7Y P;  4DR2 K;  5AQX A;  4I9Q A;  3TWH A;  1VSL A;  1K6Y A;  4WCE L;  2X78 A;  1Q18 A;  2E2O A;  3LP1 A;  4BRD A;  2BAN A;  4A61 A;  1REV A;  3LL3 A;  1TV6 A;  4GV9 A;  1E3M A;  4BG9 A;  3DXM A;  3AGK A;  2PFU A;  1KSP A;  4B1X B;  3PX6 A;  3OS2 A;  4BC2 A;  1JLE A;  2FSN A;  4OJR A;  4DR1 K;  3KZB A;  1U49 A;  3NBP A;  1A5W A;  3GOI A;  3ITH A;  2DTU A;  1Q9X A;  4LH4 A;  1UOC A;  4WQ5 A;  3IDH A;  5DM6 L;  2Q0R A;  3CHW A;  2XY8 A;  4XIU A;  3L3U A;  4YOT A;  3FE1 A;  3QIC A;  4RW7 A;  4HUG A;  1HKC A;  4DV4 K;  2DFH A;  3ULE A;  2YX6 A;  4WQ5 C;  3VEO A;  3SQ2 A;  4N5S A;  2OPS A;  3E9P A;  3WXL A;  4O0J A;  4B8C A;  3SUQ A;  1TK0 A;  4X65 K;  4FM1 A;  4DV6 K;  3MN5 A;  1WSJ A;  4DG1 A;  1E4F T;  2IVO A;  2AA4 A;  2QWQ A;  3O4N A;  1NGE A;  4CE9 A;  1C6V A;  3AY9 A;  3AO5 A;  4FJL A;  4E0D A;  3V1O A;  3VQB A;  2P9L B;  1NGI A;  3H6E A;  4I2P A;  2Q2R A;  2WON A;  4CEE A;  2NUB A;  5AFU A;  3ENH A;  2UUB K;  3NF9 A;  1OH7 A;  1B9F A;  1RT3 A;  4CZG A;  4DSL A;  3KD1 E;  1QQO A;  3OYK A;  4FPA A;  4O55 A;  1LOT B;  3ZT1 A;  1YIJ N;  2VWJ A;  3M6G A;  1VSF A;  3WNH A;  3AVC A;  2G8K A;  1I39 A;  4CHZ A;  2ZQB A;  1NGB A;  4O8K A;  3RSE A;  1LCU A;  4KTW A;  4NO7 A;  2QWL A;  1GLD G;  1HYZ A;  4JI3 K;  2D0C A;  4YOV A;  3TPQ A;  5HRN A;  5KGX A;  5M1Q A;  2YI1 A;  1U45 A;  2OTJ N;  4HVJ A;  4QCL A;  4DV2 K;  2Q97 A;  5AQH A;  2QKB A;  2F8T A;  3KHY A;  1BO5 O;  4H0P A;  4BR0 A;  1X9W A;  1MU2 A;  3VF4 A;  4U67 L;  4CHY A;  3OYG A;  3HOS A;  2W6L A;  2DY4 A;  3AA4 A;  4H5W A;  1ATR A;  3DLG A;  1Z26 A;  1IH7 A;  2O8D A;  2O8E A;  3LAM A;  4FWM A;  1HQU A;  3J8A A;  3MXJ A;  4DB3 A;  1FW6 A;  3V1R A;  1RDD A;  2E1Y A;  1KCF A;  1P8Z A;  3HP6 A;  3U6F A;  5EOY A;  3S41 A;  3DXK A;  3OYM A;  2QM1 A;  1SS6 A;  4MLE A;  3QIN A;  1S1U A;  4LFB K;  3LWM A;  4BY9 C;  4G9Z A;  2RE2 A;  4IWV A;  4Y1D A;  3D2E A;  1ATS A;  2P1J A;  1NLV A;  4BRM A;  1KXP A;  2A41 A;  1NJW A;  3AO3 A;  2HF3 A;  3NFA A;  5AJ3 K;  3S3M A;  4CZH A;  1HNV A;  1ZBF A;  4OPJ A;  4AHT A;  2W42 A;  3HPG A;  3RRG A;  3KIO A;  5LJV A;  3FLC O;  3TAR A;  1NK6 A;  2UYT A;  2HHH K;  3DXM B;  3CCR N;  4F2S A;  3ID8 A;  2P9K A;  4CGF A;  2QTD A;  5BRE A;  1SL0 A;  2QWO A;  1YJW N;  3AVH A;  4CEZ A;  2G8H A;  1ZBU A;  2P9N A;  3QIO A;  3QNN A;  1TKD A;  3T19 A;  4FXD A;  3SYZ A;  4DS4 A;  2A40 A;  4A57 A;  4A2A A;  5J2N A;  2ZD1 A;  3ULE B;  4DMN A;  1VSH A;  2PYJ A;  3Q7B A;  4JLH A;  2YCH A;  4CEO A;  3ZLJ A;  1WNS A;  3SPZ A;  5M1N A;  4KB1 A;  4BR5 A;  3V4I A;  1CZA N;  1N6Q A;  3WXK A;  4HUF A;  3HK2 A;  2QWR A;  3LAN A;  4RG8 A;  1RTI A;  4JI1 K;  4FW2 A;  3K57 A;  3THY A;  1YVU A;  3NGI A;  1NMD A;  2V51 B;  4JKF A;  4UY8 O;  5JIC A;  1NGH A;  2D0P A;  3EN9 A;  1RDA A;  1NBW A;  4DTJ A;  3FZL A;  2Q3S A;  4W5T A;  1U6Z A;  4BVO A;  3ISN C;  3MCA B;  2B6A A;  2FXU A;  2P9P A;  3HVT A;  2FBT A;  4CJT A;  2O8B A;  3TU5 A;  1T05 A;  3SCX A;  3VN5 A;  3CXC M;  4CBW A;  1ILY A;  4CJF A;  3K59 A;  1CXQ A;  1JKH A;  1HNI A;  4OLA A;  1N32 K;  4DFP A;  4FJN A;  1RCH A;  5KGW A;  1LWC A;  3RSE B;  4I2Q A;  1EXQ A;  4CGG A;  1VSI A;  4A5B A;  1X1P A;  4IFY A;  2Q36 A;  1W2B M;  5GAH P;  5F1X A;  4BRH A;  3RMA A;  3G4S N;  3VF2 A;  3I56 N;  4B9U A;  2W6K A;  3QDK A;  5BPN A;  3J81 O;  4JK8 A;  1ASW A;  4BRI A;  4CJS A;  3SAG A;  5AQG A;  5GIP A;  3T1H K;  5KTQ A;  1N33 K;  2NRZ A;  3LDN A;  2YKN A;  4HTL A;  3EEQ A;  3WXJ A;  3KWI A;  1ZBI A;  2XO7 A;  3PUF A;  2P9I A;  4C8O A;  4DU1 A;  2GWJ A;  1CZB A;  2O8D B;  4X66 K;  3H3O B;  3AVN A;  2O8E B;  1XQS C;  5FPD A;  3VF6 A;  3SMS A;  1KVC A;  4J2E A;  3ZT2 A;  4NYF A;  4BRP A;  1SKW A;  1WLJ A;  4AM7 A;  3P1G A;  4HCC A;  2YHX A;  3VA3 A;  3D2E B;  2LSN A;  3RVC A;  4CEA A;  3C65 A;  3ZET B;  2G8I A;  1QSL A;  1TAQ A;  3VQ5 A;  3CFP A;  4JHD A;  3CJ9 A;  4DTR A;  1LWE A;  3PSI A;  1QVF M;  3THV A;  1WSF A;  3SUN A;  4PQU A;  3N4Q A;  4FJI A;  1EX4 A;  4I9L A;  1VSK A;  3L2V A;  2E6M A;  3A0I X;  3DOK A;  1KVB A;  4AH9 A;  4QS9 A;  3VPZ A;  4B9N A;  2P9K B;  3NMU A;  3IMX A;  4B1W B;  1BQN A;  1NOY A;  1V4T A;  2P9N B;  3GDQ A;  4CJR A;  3JYT A;  3RTV A;  4BVP A;  4R79 A;  2UXD K;  4YOU A;  1XMO K;  3L3V A;  3RWU A;  3OYE A;  4DLE A;  1RT5 A;  4FJ8 A;  3L4Q A;  1DKG D;  3V9U A;  4BE1 A;  2FC0 A;  3KK1 A;  4DSE A;  1RT4 A;  5BRF A;  3EZW A;  3ZYY X;  1YI2 N;  1FJG K;  4FJH A;  1QQC A;  5JLF A;  3THY B;  3JXU A;  2CGJ A;  3UE5 A;  3ZSQ A;  4W5O A;  4RCH A;  4V19 S;  1VQ4 N;  4JD2 A;  4CFD A;  3K58 A;  4LF8 K;  4W5N A;  4BGA A;  3KK7 A;  2GWK A;  1U04 A;  4K25 A;  3QEI A;  2DPN A;  3KVG A;  4CF9 A;  3CG7 A;  2O8B B;  1K8A O;  4KBO A;  3CC7 N;  1QVG M;  3I33 A;  4QAG A;  5ADX A;  4GNI A;  1W0H A;  1W97 L;  2IC3 A;  4Z94 A;  1C1B A;  3NH2 A;  4BRK A;  3VQE A;  4YNQ A;  4RW4 A;  2O8C A;  5AQF A;  2FSJ A;  1U47 A;  4FWO A;  3VTI A;  1NJY A;  2HHX A;  2YV0 X;  3KJV A;  4FJ9 A;  3OJS A;  3LDL A;  3HI0 A;  1IKW A;  4CK2 A;  2P9I B;  3I0R A;  3OY9 A;  3OYA A;  1GLC G;  4ILH A;  2OPR A;  3ZSO A;  4CD3 A;  4O5F A;  4DQR A;  4RW6 A;  2HF4 A;  5JMV A;  1BA1 A;  1VSM A;  4WFA L;  4YOY A;  3N4P A;  3V81 A;  4EZ6 A;  5C10 A;  1Y97 A;  4B9M A;  3MEE A;  4BRL A;  4CI6 A;  2VWK A;  5JLH A;  4IFE A;  4LSL A;  1KAZ A;  2O8F A;  2QW9 A;  2X74 A;  2YHA A;  1VQ7 N;  2VG6 A;  3BUZ B;  4AHS A;  2NRV A;  5FPE A;  3J7A P;  5E26 A;  2KHO A;  3VGM A;  3OYB A;  2V7Y A;  5BPL A;  1YJ9 N;  4LF4 K;  3VGK A;  3HZ6 A;  5TKW A;  4C8N A;  3QNO A;  4BRN A;  4KTZ A;  4YY3 K;  4R5P A;  2UUA K;  4H4O A;  3CCE N;  4K0K K;  2OYQ A;  3DLE A;  3NF8 A;  1VQ9 N;  1LW0 A;  5C2D A;  1VQP N;  4NCB A;  4FZX C;  3U8X A;  4JKD A;  3LDS A;  4DTM A;  3KWG A;  3K9K A;  3VQ6 A;  1WB9 A;  3CCS N;  2ATQ A;  3ALY A;  4CGH A;  1WUA A;  3LP0 A;  4DTU A;  4DTN A;  3CPW M;  1J5E K;  4Q5V A;  4N47 A;  2A42 A;  1KC8 O;  4FJM A;  1QS4 A;  1S9E A;  4BGB A;  4K42 A;  4H8K A;  2W40 A;  4Z4G A;  1HQE A;  1BCM A;  4PUO A;  4KI6 A;  3QET A;  5CY4 A;  1KVA A;  4EP5 A;  3PIP L;  4DV1 K;  2HOE A;  3R6M A;  3IRX A;  3SAF A;  1W9H A;  4F4K A;  3I55 N;  4CGI A;  4CEC A;  1L5U A;  2YNI A;  4QS8 A;  4Y0W A;  1ZBH A;  2WOM A;  4MO4 A;  1XC3 A;  3A5M C;  1X3N A;  3MWT A;  1VQL N;  4E1N A;  4BQL A;  3HPO A;  4DU3 A;  4JNE A;  1WOQ A;  1RT6 A;  2QWN A;  4E1M A;  3DMJ A;  3OYI A;  3TI0 A;  4JI6 K;  1P90 A;  1VAZ A;  4FWR A;  1T3V A;  5IWA K;  4CJ3 A;  3KK3 A;  1MWM A;  5KQD A;  3QO9 A;  3R3L A;  3F5T A;  1BHL A;  2YJF A;  5C25 A;  4MQ3 A;  3DJC A;  2E20 A;  3A5L C;  3AVB A;  3H3N O;  2O4I A;  5T7B A;  3O9T A;  4EHT A;  1HRH A;  2O8C B;  4M3R A;  1YVN A;  5KPZ A;  1KLM A;  3VER A;  1NKB A;  1C1C A;  3SQ4 A;  1IV0 A;  2KKZ A;  4F3T A;  1O13 A;  4B08 A;  1RGI A;  5AQR A;  1YUW A;  3SBG A;  4KAZ A;  2QXF A;  1S1T A;  2GV9 A;  4CCH A;  1TKZ A;  3UKR A;  4BE0 A;  4OX9 K;  2WBN A;  2FBV A;  2Q1N A;  2D0B A;  3NVK A;  4KH6 A;  1Z05 A;  2UXC K;  4Z4H A;  1N36 K;  2RN2 A;  3SBT A;  3GBT A;  4AQY K;  5HLF A;  2E8A A;  3RR7 A;  1T6C A;  3BY5 A;  4H0V B;  4DR5 K;  3BF3 A;  3P4I A;  4BRE A;  1B92 A;  3B8A X;  4C1N K;  2O8F B;  3T1Y K;  1EO1 A;  2CGL A;  1VSD A;  5GAG P;  4DTS A;  2OPQ A;  3KD5 E;  3G10 A;  3CQ8 A;  4BWM A;  3OYH A;  3DOL A;  2QXL A;  3F9K A;  3QB0 A;  1NJI O;  1WSG A;  1CXU A;  5KRT A;  1BWF O;  1ZBS A;  4CJL A;  4FJG A;  2X6S A;  4FWQ A;  2BUP A;  5GIN A;  2DFE A;  4L3Q A;  2WFB A;  4CVN E;  4OKJ A;  1Z6R A;  4BR9 A;  1SZ2 A;  1FKP A;  3H08 A;  2Z1I A;  4NB4 A;  4KFB A;  3RMB A;  4B3R K;  4JI5 K;  5LL6 Z;  2PYL A;  5HRP A;  3EYZ A;  1KAY A;  3KKS A;  3ZT0 A;  3I8D A;  4AHR A;  4B9V A;  4M3Z A;  1JLC A;  3VQA A;  1C0U A;  4IKF A;  2BGG A;  1TVR A;  4O8U A;  1NGC A;  5CR4 A;  2EHG A;  4RW8 A;  2NRR A;  4M63 C;  4UQG A;  1NK0 A;  1JXB A;  5EX5 A;  3TTD A;  2ZGZ A;  1HNW K;  5CHI A;  3RRH A;  1C1A A;  2ZJP L;  3F73 A;  3K0S A;  3VEZ A;  3WQU A;  3AV9 A;  2VQE K;  3H1Q A;  4NXM K;  4BRG A;  4KO0 A;  3C7N A;  5SWM A;  4L8R B;  1SQK A;  1I3A A;  3O1B A;  1Y64 A;  2F9T A;  3LDO A;  4DF4 A;  1NK9 A;  3KLE A;  4LFC K;  3VEV A;  3V9S A;  3ENB A;  3MED A;  1NGD A;  4TSX A;  4DTO A;  2X6N A;  3D0P A;  4GKK K;  3PX4 A;  1QZ6 A;  2Z1G A;  4CZI A;  3BEX A;  3OYF A;  1RT7 A;  3F2K A;  1TK8 A;  3VEX A;  4OPH A;  4X62 K;  3VET A;  1EP4 A;  4CGJ A;  1RIL A;  4B3T K;  4FZZ A;  3D2F A;  3OYD A;  4BAC A;  3IKM A;  4O4G A;  4A5A A;  3EO3 A;  4YOX A;  3CME N;  4KB0 A;  3RMD A;  3DRS A;  3AVI A;  1LAV A;  3UKR B;  2IS3 A;  5M1P A;  2VG7 A;  3E9L A;  4KHW A;  5AZI B;  1RT1 A;  2CH5 A;  3MN9 A;  4F3O A;  3IS9 A;  2FSK A;  1BUP A;  5M1O A;  3NAE A;  4FL9 A;  3DLB A;  3CCU N;  2OA8 A;  4DFK A;  1J6Z A;  3QML A;  3TTC A;  3O3G A;  2OZS A;  2XY6 A;  2E5L K;  1NJX A;  2F96 A;  3VEY A;  1BQM A;  4FLZ A;  2O4G A;  4CBU A;  1RDC A;  3NE6 A;  4IOA L;  2G8F A;  2ZGY A;  4WFB L;  2IOC A;  4FW1 A;  3NVM A;  2Q0U A;  4IZ9 A;  1XI1 A;  2BDP A;  1VK0 A;  2VG5 A;  2NRT A;  3S3O A;  3JSM A;  1T44 A;  4FO0 A;  3H45 C;  2ITM A;  3SPY A;  5BN8 A;  4EHU A;  3O9R A;  1GLE G;  3TTF A;  3UB5 A;  4CZE A;  4KV8 A;  1QQM A;  4QS7 A;  2I5J A;  1OH8 A;  5J2M A;  3M8P A;  3AVA A;  5M1K A;  2Z1H A;  3DM2 A;  1IBK K;  3MAQ A;  1HNX K;  4CES A;  1BCO A;  4JS4 A;  4KRF A;  1D4X A;  5AR0 A;  1SL1 A;  1RBU A;  3TSU A;  3M1F A;  1W7A A;  4CHQ A;  1LAW A;  2QWP A;  4CBX A;  4E19 A;  4EIA A;  1IG8 A;  1J9A A;  2VYP A;  3OJU A;  3ZX3 A;  1G15 A;  2F7T A;  3THW A;  1DLO A;  4EFH A;  3CYM A;  1Q81 O;  4OGC A;  3C7N B;  1JJ2 M;  3PLA A;  1BL3 A;  3AVJ A;  3MEG A;  4QOZ B;  4AF1 A;  3CI5 A;  5HRO A;  1KFS A;  4G1Q A;  5AQT A;  1SAZ A;  1X9M A;  3HOT A;  3GL1 A;  2AP1 A;  5E41 A;  4H5R A;  2XY7 A;  3RMC A;  4JI0 K;  4FK2 A;  1BU6 O;  1J5O A;  3NCI A;  2YHY A;  3SNN A;  2NRW A;  3HP9 A;  4OPA A;  1NK8 A;  4ZTJ A;  2G8U A;  3WUH A;  3QIP A;  1BOT O;  1WAJ A;  4OKK A;  1QSY A;  2P9U A;  4H0Y B;  3QBX A;  4H5T A;  1NM1 A;  5CE3 A;  1S1W A;  1HNZ K;  3MN6 A;  2G8W A;  4FJK A;  4PWD A;  1GLL O;  4IDK A;  4DSJ A;  1A5V A;  2PZS A;  3TAQ A;  1E4G T;  4KRE A;  2CH6 A;  4W5Q A;  3SZ2 A;  1JCE A;  1XHX A;  2KFN A;  3DXK B;  4FVU A;  4CJV A;  3SUP A;  5AQK A;  4LF6 K;  3NGY A;  5C15 A;  3KLF A;  1LV5 A;  2Z1J A;  1ESV A;  1QE1 A;  3ENO A;  3DRR A;  4IOC L;  2UUC K;  3ATU A;  3K5M A;  4FLU A;  5J2Q A;  3CFR A;  4JKC A;  5AQV A;  1NNE A;  4BRQ A;  2UXB K;  4DSK A;  1RT2 A;  3SLC A;  1VSE A;  3I8B A;  3HTV A;  2JGU A;  1MWK A;  4CEQ A;  3QFU A;  4JKH A;  3O9U A;  3G25 A;  4M41 A;  1WBB A;  3CQX A;  2QI2 A;  4CZJ A;  3WQT A;  4WE1 A;  3V9Z A;  3ZCM A;  2FBX A;  3ZEU A;  4B8A B;  1N5Y A;  5HOO A;  3LM2 A;  4Z4C A;  4CZK A;  5J2P A;  4GY2 B;  4BE2 A;  3QLH A;  1XWL A;  2A3Z A;  4DV0 K;  3VQC A;  4CJU A;  4BQZ A;  4H0O A;  3AAR A;  2YNH A;  1JCF A;  2NLX A;  4K8X A;  2QK9 A;  2XHB A;  1A5X A;  3NF6 A;  4H5N A;  2HHU A;  1RNH A;  3VA0 A;  4CF0 A;  3QEP A;  4LF5 K;  1WBD A;  1EWQ A;  5F0X A;  3G0Z A;  4B9L A;  1S6P A;  1XUP O;  3EKU A;  1HJR A;  3H1V X;  3ZSW A;  2P9P B;  3CER A;  3OVN A;  4CJK A;  4EP4 A;  4N56 A;  1ATN A;  4Z4E A;  1T8E A;  2YNF A;  2B5J A;  4NXN K;  3OHR A;  4MLH A;  2V7Z A;  2FF3 B;  3CJ1 A;  2HNY A;  3MXI A;  3HM8 A;  4JYA K;  2KZZ A;  4DR7 K;  4IBN A;  1LW2 A;  2YJE A;  5DK5 A;  4HTU A;  1KTQ A;  1TL1 A;  3C95 A;  2GTD A;  3BDP A;  3ASM A;  3OYN A;  3L2Q A;  3DLH A;  2P9U B;  3NH0 A;  5CZ2 A;  1BIU A;  4DQS A;  1U48 A;  3DAW A;  3OBW A;  1OH5 A;  4PY5 A;  4LY7 A;  2ZM6 K;  1TKT A;  5HL7 L;  1UA1 A;  1VQM N;  2CGK A;  4CJP A;  4FVM A;  4ILJ A;  3ZSV A;  3FR0 A;  4CGD A;  1JLQ A;  2GEL A;  2HW3 A;  1BIS A;  1T6D A;  1VQ6 N;  4J2D A;  3DWL A;  4PL7 A;  4YDU A;  1GOA A;  4DUY K;  4FJX A;  1TYQ A;  1R0A A;  4A62 A;  3K2P A;  4YDU C;  5FPN A;  2VCP A;  5I42 A;  4BC4 A;  3VGL A;  4KHS A;  3W0L A;  1X9J A;  3NDK A;  4IFV A;  4JHD B;  5AQQ A;  4RWT A;  2DFF A;  1NGF A;  1NGG A;  3CMA N;  4FWK A;  3ZSX A;  1RBR A;  5AQS A;  3WNG A;  1NKC A;  3TAG A;  3CFO A;  3O6W A;  1BI4 A;  4CF1 A;  1JXE A;  1JLB A;  3NF7 A;  2HMI A;  2E2Q A;  3UKU A;  2GEM A;  5AFU H;  3OS0 A;  2ZJR L;  4CIF A;  4A59 A;  3ZEU B;  2HB5 A;  4BRF A;  3K9J A;  4DQP A;  4OLB A;  4DF8 A;  4MFB A;  4Z0U A;  2E2P A;  3TAF A;  1S1X A;  3HJF A;  3SJH A;  1CZ9 A;  1HPM A;  3V9W A;  4B9S A;  2HBK A;  3A5O C;  5KI6 A;  3CJC A;  1IO2 A;  2RHK A;  4IG3 A;  5JVH L;  3AA3 A;  4H03 B;  3AA5 X;  3L6Q A;  2IGI A;  1Q86 O;  4B3O A;  2OTL N;  5FPM A;  3E66 A;  4GW6 A;  4DFJ A;  3CC2 N;  1KD1 O;  2ZWH A;  3L4I A;  4KKO A;  4CIG A;  4CHN A;  3CF5 L;  3A5N C;  4B3M K;  1N8R O;  1XC9 A;  4BRO A;  3U9D A;  4WF9 L;  4JD2 B;  2P5G A;  2KW4 A;  1R59 O;  3HM9 A;  1C0G A;  4DUZ K;  3AVM A;  3BZK A;  3I0S A;  1C0M A;  4H5V A;  1GLF O;  1ZYQ A;  3SQ1 A;  5GIO A;  3L2R A;  4E7H A;  4CK1 A;  1EQY A;  4O0I A;  4DFM A;  4JN4 A;  2P9L A;  4IJN A;  3ZX0 A;  4DTX A;  1TK5 A;  1OH6 A;  3HO1 A;  5BPM A;  1FKO A;  3QES A;  1RTH A;  4C23 A;  4CK3 A;  1S1V A;  2HBM A;  5J1E A;  1K73 O;  5FRN A;  4PKH A;  3T1A A;  1IKY A;  4FWL A;  3U4L A;  1VQO N;  2Q31 A;  2HVI A;  3DLL L;  5HBM A;  2GUI A;  2QEX N;  3B6P A;  1VQN N;  4ID1 A;  4FOI A;  3WXI A;  3V6D A;  1NJZ A;  1WN7 A;  3GE1 A;  4E7J A;  1HX1 A;  4GV6 A;  5GAD P;  1HKB A;  3D6R A;  1NMN A;  2JWK A;  3TSQ A;  4JV5 K;  3BP8 A;  1F21 A;  4BR2 A;  1D8Y A;  3LAK A;  4CED A;  1S5J A;  4BDZ A;  2NRH A;  3HRG A;  3MX5 A;  3LDQ A;  1RDW X;  3R1X A;  3S3N A;  3T7Z A;  2HNZ A;  4F9O A;  1FXX A;  2J4R A;  5LMU K;  3F9M A;  2HHS A;  5C24 A;  4IDH A;  1BGX T;  4DWI A;  5AQN A;  4DSI A;  3J80 O;  4RW9 A;  2AJQ A;  1N34 K;  3AVL A;  4M3X A;  4FK4 A;  3HVR A;  4F8R A;  2ETJ A;  1M1K O;  3PSF A;  1JL2 A;  4BG8 A;  1BI4 B;  3O8M A;  4BRA A;  3B6O A;  5AQZ A;  4XH1 A;  4J2B A;  4J2A A;  2HHV A;  2BTF A;  3EL2 A;  3VQ9 A;  3SV4 A;  3AAQ A;  3S9H A;  1QZ5 A;  5CYM A;  2HMP A;  3BF1 A;  4OPK A;  4H0T B;  4FZY A;  5EXW A;  3C6H A;  3QEV A;  5FRM A;  3FFI A;  4NLB A;  4ZTF A;  2E88 A;  3AO4 A;  2KQ2 A;  4Y1C A;  2P9S A;  2KLA A;  3SMP A;  1HYV A;  4PL8 A;  1C0F A;  2PBD A;  1S22 A;  3T69 A;  4IO9 L;  4FLT A;  3A8Y A;  3U9Z A;  4DKW A;  3P5J A;  4B9Q A;  3VTH A;  1LWF A;  3W3D A;  3OS1 A;  1X9S A;  1IJJ A;  3IFR A;  2UU9 K;  5E84 A;  4DQ8 A;  1XNR K;  4B1V A;  2B4J A;  1RBV A;  2F8S A;  5SZT A;  3PO4 A;  1L3T A;  4H4M A;  2PAV A;  4PKI A;  3H46 O;  2P51 A;  1WSE A;  1Q8I A;  3AO1 A;  3OYL A;  1IG9 A;  3LDP A;  4AM6 A;  3OTO K;  3LPT A;  1S9G A;  3V9X A;  4DTP A;  3E1Y A;  4C1N I;  3KLH A;  2GX9 A;  5BRD A;  3L2U A;  3QEX A;  4LFA K;  4E7L A;  3MDQ A;  1ITG A;  3AVG A;  3K5L A;  3TAE A;  3ZSY A;  2QA4 N;  1I94 K;  3CCV N;  3HL8 A;  4CD1 A;  4B1U B;  5EU7 A;  4EAH D;  2Y1J A;  2RF2 A;  2NNW A;  3FZK A;  4E7K A;  3TAM A;  4A2B A;  4JRQ A;  1QTM A;  4W5R A;  4EZ9 A;  1TGO A;  3ZX2 A;  5AQI A;  4LF7 K;  4DR6 K;  1SKS A;  4ZHR A;  1NGJ A;  4KPY A;  1T7P A;  4BR4 A;  1KQS M;  3C6T A;  3O1W A;  4HCB A;  2HBJ A;  4FOE A;  2I7P A;  3WNE A;  3D45 A;  3EE9 A;  1WSH A;  4PHT X;  3PIO L;  5KRS A;  2Y1I A;  3VQ4 A;  1XNQ K;  1VSJ A;  3HPH A;  1IKV A;  1HR0 K;  3CM6 A;  1YTU A;  3CCJ N;  3SUO A;  4CJ7 A;  1JLA A;  4C8M A;  3U3Y A;  3O9S A;  4K8Z A;  3LWL A;  3J7Z O;  2FF6 A;  1GOC A;  5JVG L;  4JK7 A;  4PKG A;  1Q82 O;  1RTJ A;  5EY4 A;  2A1S A;  4X64 K;  4MDB A;  2FLO A;  4Z4I A;  5IT9 O;  4FPB A;  4KHP K;  3PV8 A;  3P39 A;  4RTF D;  3JAM O;  4I6M A;  1S72 N;  4CF2 A;  3SJJ A;  5C0Y A;  4M3W A;  1SUQ A;  2P5O A;  3K5N A;  4CFB A;  2IIR A;  2XRI A;  4ELT A;  2QKK A;  3LAL A;  4LD0 A;  1EWR A;  4IJA A;  2H3G X;  3FGU A;  2WTU A;  4CF8 A;  4GVM A;  4C8L A;  3ZET A;  2JLE A;  2FBY A;  4ELU A;  4KH5 A;  5AQM A;  3R9P A;  4MDA A;  5A2Q O;  3QEW A;  5AQL A;  3P83 D;  1GLA G;  4IOX A;  5BR8 K;  1TUU A;  2I7N A;  3WEE A;  1BA0 A;  4KI4 A;  2P9S B;  3ULD A;  1DT9 A;  3QFP A;  4GKJ K;  1CLQ A;  1SV5 A;  5ADX H;  3WNF A;  5LMN K;  3CD6 N;  5C42 A;  1UWB A;  2D0A A;  1MDU B;  1NK5 A;  3FZF A;  4O5B A;  1C0T A;  3FZM A;  5TKY A;  2V52 B;  3A2F A;  5AQP A;  4CHP A;  3KTQ A;  4FCY A;  1NK7 A;  4JI7 K;  1JLG A;  1RBS A;  3MWP A;  5I3U A;  2KZM A;  5K14 A;  2ASO A;  4HUE A;  1RFQ A;  3ZSZ A;  3FFK B;  3O08 A;  1D9F A;  1XHZ A;  3CPE A;  4XEI A;  1GLJ O;  4WQ4 A;  1H1V A;  3CET A;  4GVE A;  5CYQ A;  1K8K A;  4DHY A;  3FZH A;  3M8R A;  1HLU A;  4KHQ A;  3BZC A;  3VMF B;  4OKE A;  4WQ4 C;  1SKR A;  4B1Y B;  1D5A A;  3DYA A;  1M90 O;  3IAY A;  2F4V K;  3VEW A;  1S3X A;  1IBL K;  4IEE A;  1VQK N;  4Q0B A;  4OVL A;  3VOV A;  3O4W A;  3WT0 A;  3VQQ A;  4HWI A;  2WUS A;  3LPU A;  3SI6 A;  2A6A A;  3KKR A;  3G71 N;  4M3U A;  1XMQ K;  4GMJ B;  4YFU A;  1O1W A;  4CEB A;  4BC5 A;  3QBW A;  4N76 A; 
#chains in the Genus database with same CATH homology
 1TL1 A;  3QO9 A;  3C95 A;  3PX0 A;  3ASM A;  3OYN A;  1L3V A;  3BDP A;  3L2Q A;  1BHL A;  3DLH A;  4KTW A;  5C25 A;  3NH0 A;  4MQ3 A;  5CZ2 A;  3OYJ A;  1BIU A;  1HMV A;  1HYZ A;  3AVB A;  1ASV A;  3TAN A;  2D0C A;  4DQS A;  1U48 A;  2O4I A;  5T7B A;  4PY5 A;  1HRH A;  5HRN A;  5KGX A;  4M3R A;  3MEC A;  4LY7 A;  4FK0 A;  4O44 A;  1KLM A;  1U45 A;  4HVJ A;  4QCL A;  1NKB A;  1QHT A;  1TKT A;  2ITG A;  1C1C A;  2QKB A;  1UA1 A;  3M8Q A;  1ASU A;  3AVF A;  2F8T A;  4M42 A;  3SQ4 A;  4CJP A;  1TKX A;  4F3T A;  4FVM A;  4B08 A;  3ZSV A;  2HW3 A;  4CGD A;  1JLQ A;  1BIS A;  1X9W A;  4E89 A;  4KAZ A;  1MU2 A;  2QXF A;  4CHY A;  3OYG A;  4J2D A;  1S1T A;  2DY4 A;  2GV9 A;  3VQD A;  1TKZ A;  3NHG A;  3AA4 A;  2BE2 A;  4CCH A;  3DLG A;  4BE0 A;  1Z26 A;  1GOA A;  3T3F A;  1IH7 A;  2FBV A;  3LAM A;  1T03 A;  4FJX A;  1HQU A;  1R0A A;  3K5O A;  4CJW A;  2D0B A;  3K2P A;  3MXJ A;  3V1R A;  1RDD A;  1KCF A;  3HP6 A;  4DQQ A;  3U6F A;  5I42 A;  1RBT A;  4Z4H A;  3OYM A;  4M3T A;  4KHS A;  4DSF A;  2RN2 A;  3QIN A;  1S1U A;  5HLF A;  4PA1 A;  3NDK A;  3LWM A;  4IFV A;  3RR7 A;  2DFF A;  4Y1D A;  3HYF A;  1JLF A;  2P1J A;  3ZSX A;  1B92 A;  1RBR A;  3WNG A;  1NKC A;  1NJW A;  3AO3 A;  3NFA A;  3CFO A;  3TAG A;  1BI4 A;  4CF1 A;  1JXE A;  1JLB A;  4CJE A;  4CHO A;  3S3M A;  3NF7 A;  2HMI A;  1VSD A;  2A1R A;  1HNV A;  4DTS A;  3OS0 A;  1ZBF A;  4CFA A;  1EET A;  2OPQ A;  4CIF A;  4OPJ A;  3G10 A;  3KD5 E;  4AHT A;  4FJ5 A;  2W42 A;  2HB5 A;  3CQ8 A;  3HPG A;  4CHZ A;  3KLG A;  3KIO A;  3HT3 A;  4BWM A;  3RRG A;  3OYH A;  3DOL A;  3TAR A;  3F9K A;  1NK6 A;  4FJ7 A;  1WSG A;  3TR8 A;  1CXU A;  4CJQ A;  5KRT A;  4DQP A;  4OLB A;  4DF8 A;  4MFB A;  4CJL A;  4Z0U A;  4F2S A;  4FJG A;  2E4L A;  2X6S A;  3TAF A;  3ZT3 A;  1S1X A;  2DFE A;  3HJF A;  1CZ9 A;  4OKJ A;  4CGF A;  4KTQ A;  3V9W A;  4B9S A;  1SL0 A;  5HRR A;  2G8H A;  3AVH A;  4CEZ A;  1FKP A;  3H08 A;  5KI6 A;  2Z1I A;  1IO2 A;  1ZBU A;  4KFB A;  3QIO A;  3RMB A;  3PY8 A;  3QNN A;  4IG3 A;  1TKD A;  3T19 A;  3AA3 A;  2KTQ A;  2PYL A;  3AA5 X;  2IGI A;  4FXD A;  5HRP A;  3EYZ A;  3KKS A;  3KK2 A;  3ZT0 A;  3I8D A;  4FLW A;  4B3O A;  3SYZ A;  3BGR A;  4DS4 A;  4NYN A;  4GW6 A;  4DFJ A;  4AHR A;  4B9V A;  4M3Z A;  3AO2 A;  1JLC A;  3TAB A;  5J2N A;  4KHU A;  4KKO A;  3VQA A;  2ZD1 A;  4CIG A;  1C0U A;  4IKF A;  4DMN A;  1VSH A;  1TVR A;  3ZSR A;  4JLH A;  4CHN A;  2PYJ A;  2BGG A;  3DLR A;  2EHG A;  4RW8 A;  1QSS A;  4CEO A;  4M45 A;  4OGE A;  1WNS A;  1HYS A;  3SPZ A;  3HXM A;  4LH5 A;  4KB1 A;  1XC9 A;  3V4I A;  3NH1 A;  1N6Q A;  4Q0B A;  4HUF A;  1D9D A;  3HK2 A;  3SV3 A;  4UQG A;  1NK0 A;  1ZBL A;  1JXB A;  4ELV A;  1VRT A;  3LAN A;  4RG8 A;  1RTI A;  2RPI A;  4FW2 A;  3K57 A;  3RRH A;  1YVU A;  3RR8 A;  2P5G A;  1C1A A;  2KW4 A;  3DI6 A;  3HM9 A;  3NGI A;  2HVH A;  1VRU A;  3EY1 A;  3AVM A;  3F73 A;  3CM5 A;  4I7F A;  1RDA A;  3I0S A;  1C0M A;  4DTJ A;  3KLI A;  4DS5 A;  3AV9 A;  5JS2 A;  1ZYQ A;  4M3Y A;  2Q3S A;  4W5T A;  3SQ1 A;  3LP2 A;  3L2R A;  3O3H A;  4E7H A;  4CK1 A;  4DFM A;  4O0I A;  3NGZ A;  1RTD A;  4DQI A;  5SWM A;  4KO0 A;  3ISN C;  2B6A A;  4CEF A;  2IDO A;  2OPP A;  4L8R B;  1I3A A;  4DTX A;  2XY5 A;  3HVT A;  2FBT A;  1TK5 A;  4DF4 A;  4CJT A;  1NK9 A;  1NKE A;  1T05 A;  3SCX A;  3KLE A;  3HO1 A;  3IG1 A;  3VN5 A;  3VQ8 A;  4BDP A;  1FKO A;  3QES A;  1RTH A;  3V9S A;  4CK3 A;  4ID5 A;  2HHT A;  1S1V A;  5J1E A;  4CJF A;  3K59 A;  1CXQ A;  1JKH A;  1HNI A;  4AHC A;  5FRN A;  4OLA A;  3T1A A;  4DFP A;  4FJN A;  1IKY A;  3MED A;  1RCH A;  5KGW A;  4TSX A;  4DTO A;  2X6N A;  4BWJ A;  4CJ5 A;  1LWC A;  1YT3 A;  4AHU A;  4I2Q A;  1EXQ A;  4CGG A;  1VSI A;  3D0P A;  1NK4 A;  2HVI A;  4CIE A;  4FLV A;  5HBM A;  3PX4 A;  1X1P A;  2Z1G A;  4IFY A;  2GUI A;  3B6P A;  3OYF A;  4ID1 A;  1RT7 A;  3RMA A;  3V6D A;  1TK8 A;  1U4B A;  5DMR A;  1NJZ A;  1WN7 A;  1IKX A;  1EP4 A;  4CJ4 A;  4E7I A;  2KFZ A;  4E7J A;  4B9U A;  2IAJ A;  4CGJ A;  1RIL A;  4FZZ A;  3M8S A;  2HND A;  1B9D A;  1ASW A;  4CJS A;  1F21 A;  1D8Y A;  3LAK A;  5KTQ A;  3OYD A;  1HPZ A;  4BAC A;  2YKN A;  4CED A;  1S5J A;  4O4G A;  4BDZ A;  4IG0 A;  4KB0 A;  3RMD A;  1ZBI A;  2XO7 A;  3DRS A;  3AVI A;  1LAV A;  3PUF A;  2IS3 A;  3QER A;  4C8O A;  2VG7 A;  4DU1 A;  4E3S A;  3S3N A;  1CZB A;  3AVN A;  2HNZ A;  4LSN A;  3O3F A;  4HHT A;  4KHW A;  2HHW A;  1RT1 A;  4F3O A;  3UIQ A;  4AHV A;  1FXX A;  4FYD A;  5FRO A;  1KVC A;  3V1Q A;  3IS9 A;  1Z25 A;  4J2E A;  5C24 A;  2HHS A;  3AVK A;  3ZT2 A;  4NYF A;  1SKW A;  5JS1 A;  1BGX T;  4DWI A;  1WLJ A;  2YHB A;  4DSI A;  3NAE A;  4RW9 A;  3P1G A;  3DLB A;  2AJQ A;  3AVL A;  4HCC A;  4M3X A;  2OA8 A;  4DFK A;  3VA3 A;  4FK4 A;  2LSN A;  3HVR A;  4F8R A;  2ETJ A;  4CEA A;  3DRP A;  2G8I A;  1WAF A;  3O3G A;  1JL2 A;  1BI4 B;  1QSL A;  2G8V A;  1TAQ A;  3VQ5 A;  3B6O A;  2OZS A;  3CFP A;  4FLY A;  4J2A A;  1S6Q A;  4J2B A;  4DTR A;  1LWE A;  2HHV A;  3THV A;  2XY6 A;  1WSF A;  3L8B A;  3SUN A;  1FK9 A;  4PQU A;  2D5R A;  1NJX A;  2F96 A;  3VQ9 A;  4FLZ A;  1BQM A;  1EX4 A;  3SV4 A;  3S9H A;  4FJI A;  2O4G A;  1RDC A;  3NE6 A;  3C6U A;  4I9L A;  5CYM A;  1VSK A;  4OPK A;  4FZY A;  1YTA A;  3L2V A;  1DTQ A;  2E6M A;  4JRP A;  4CFC A;  3DOK A;  1KVB A;  3QEV A;  2G8F A;  2IOC A;  4AH9 A;  4FW1 A;  5FRM A;  1UAX A;  1XI1 A;  3FFI A;  2BDP A;  1VK0 A;  4ZTF A;  3AO4 A;  2VG5 A;  3PO5 A;  3S3O A;  2KQ2 A;  3JSM A;  4B9N A;  4Y1C A;  3EZ5 A;  1BQN A;  3SPY A;  5HP1 A;  1NOY A;  1HYV A;  4CJR A;  3JYT A;  3RTV A;  1EKE A;  3LP3 A;  4KV8 A;  2I5J A;  4FM2 A;  5J2M A;  4FLT A;  3M8P A;  3L3V A;  3AVA A;  2Z1H A;  3DM2 A;  3VQ7 A;  3MAQ A;  3OYE A;  4CES A;  4DLE A;  1L3S A;  1BCO A;  3P5J A;  4JS4 A;  1LWF A;  1RT5 A;  4FJ8 A;  4KRF A;  3OS1 A;  3LZJ A;  1X9S A;  3V9U A;  5D3G A;  1UA0 A;  5HRS A;  1SL1 A;  1TAU A;  3HST B;  1RBU A;  4BE1 A;  2FC0 A;  2RKI A;  3KK1 A;  4DSE A;  4C8K A;  2B4J A;  1RBV A;  4KHY A;  1RT4 A;  4CHQ A;  1LAW A;  4N41 A;  2F8S A;  5SZT A;  4E19 A;  3PO4 A;  1L3T A;  1RDB A;  4H4M A;  1TL3 A;  4FJH A;  1GOB A;  1QQC A;  2P51 A;  1J9A A;  1WSE A;  1Q8I A;  3AO1 A;  3OJU A;  3OYL A;  1IG9 A;  4BDY A;  3LPT A;  1S9G A;  3V9X A;  1G15 A;  3C94 A;  3ZSQ A;  4DTP A;  3KLH A;  1DLO A;  3CYM A;  3L2U A;  4W5O A;  3QEX A;  4E7L A;  2HHQ A;  1ITG A;  3AVG A;  4CFD A;  3U3G A;  3ZSY A;  3K5L A;  3K58 A;  3TAE A;  4W5N A;  3HL8 A;  4FM0 A;  4OGC A;  1U04 A;  3QEI A;  1BL3 A;  3AVJ A;  5EU7 A;  2Y1J A;  3MEG A;  2RF2 A;  4CF9 A;  2YNG A;  4AIL C;  4QOZ B;  4E7K A;  5HRO A;  3SQ0 A;  3TAM A;  1KFS A;  3CG7 A;  4G1Q A;  1X9M A;  1KFD A;  4JRQ A;  5E41 A;  1QTM A;  4W5R A;  4NCG A;  3E01 A;  4EZ9 A;  1TGO A;  2XY7 A;  3RMC A;  4FK2 A;  4QAG A;  4B9T A;  5CZ1 A;  1SKS A;  4ZHR A;  1J5O A;  1BIZ A;  3NCI A;  4JS5 A;  1Q9Y A;  4Z4F A;  3SNN A;  4FLX A;  4KPY A;  3L2W A;  1T7P A;  1W0H A;  4F2R A;  3HP9 A;  3AA2 A;  2IC3 A;  1NK8 A;  4ZTJ A;  4ICL A;  2G8U A;  4DLG A;  4NCA A;  3C6T A;  3QIP A;  1C1B A;  1WAJ A;  4DU4 A;  4OKK A;  1QSY A;  2E6L A;  1DTT A;  3NH2 A;  2GBZ A;  4HCB A;  3VQE A;  4YNQ A;  3O4Q A;  3VQP A;  4RW4 A;  3ZT4 A;  3WNE A;  1U47 A;  3D45 A;  1NJY A;  1S1W A;  1WSH A;  2PY5 A;  5KRS A;  3LZI A;  3DLK A;  2HHX A;  2YKM A;  2YV0 X;  2ZE2 A;  3VQ4 A;  1VSJ A;  3KJV A;  2Y1I A;  4FJ9 A;  3HPH A;  1IKV A;  3OJS A;  2G8W A;  4FJK A;  4PWD A;  4IDK A;  4DSJ A;  1WSI A;  3CM6 A;  1YTU A;  1A5V A;  3SUO A;  3TAQ A;  2PZS A;  1IKW A;  1J53 A;  1J54 A;  1JLA A;  4C8M A;  4CK2 A;  4CER A;  3U3Y A;  3I0R A;  3OY9 A;  4K8Z A;  3OYA A;  3LWL A;  4KHN A;  4KRE A;  2OPR A;  4W5Q A;  3SZ2 A;  1GOC A;  1SL2 A;  1RTJ A;  1XHX A;  2R7Y A;  2OZM A;  2A1S A;  3ZSO A;  3TAP A;  2KFN A;  4CJV A;  3SUP A;  1L3U A;  4N76 A;  4Z4I A;  1JL1 A;  2EX3 A;  3OYC A;  3NGY A;  4DQR A;  3PV8 A;  4RW6 A;  3KLF A;  1LV5 A;  2Z1J A;  1KRP A;  1QE1 A;  3DRR A;  3K5M A;  1VSM A;  4CF2 A;  4FLU A;  5J2Q A;  3V81 A;  3SJJ A;  3CFR A;  4EZ6 A;  4M3W A;  1SUQ A;  1Y97 A;  3K5N A;  5FDL A;  3MEE A;  3MXM A;  4B9M A;  1NOZ A;  4CFB A;  2P5O A;  2VWK A;  2XRI A;  4DSK A;  1RT2 A;  2QKK A;  3LAL A;  4LD0 A;  4ELT A;  4FJJ A;  1VSE A;  4LSL A;  1KLN A;  2JGU A;  2X74 A;  2YHA A;  4CEQ A;  2VG6 A;  4AHS A;  4I9Q A;  4M41 A;  4CF8 A;  3TWH A;  1VSL A;  4GVM A;  4C8L A;  1K6Y A;  4WE1 A;  2X78 A;  3OYB A;  3V9Z A;  2JLE A;  2FBY A;  3LP1 A;  2BAN A;  4ELU A;  3ZCM A;  2FBX A;  4B8A B;  1N5Y A;  1REV A;  1TV6 A;  3QEW A;  3P83 D;  4C8N A;  4Z4C A;  3QNO A;  4KTZ A;  4R5P A;  4H4O A;  5J2P A;  1KSP A;  4KI4 A;  3ULD A;  2OYQ A;  4BE2 A;  1CLQ A;  1SV5 A;  3PX6 A;  3WNF A;  3DLE A;  3NF8 A;  3QLH A;  3OS2 A;  1XWL A;  1JLE A;  5C42 A;  4OJR A;  1UWB A;  1LW0 A;  2D0A A;  3VQC A;  4CJU A;  3NBP A;  1U49 A;  4NCB A;  4FZX C;  1A5W A;  1NK5 A;  3LDS A;  3ITH A;  2DTU A;  4O5B A;  1C0T A;  4DTM A;  1Q9X A;  4LH4 A;  2YNH A;  4K8X A;  1UOC A;  3A2F A;  3VQ6 A;  4CHP A;  4FCY A;  3KTQ A;  2QK9 A;  1NK7 A;  2XY8 A;  3RWU A;  2ATQ A;  3ALY A;  3L3U A;  4XIU A;  4CGH A;  1JLG A;  1A5X A;  1RBS A;  3LP0 A;  3NF6 A;  4RW7 A;  2XHB A;  4HUG A;  4DTU A;  1RNH A;  5I3U A;  2HHU A;  2KZM A;  2DFH A;  3VA0 A;  4DTN A;  5K14 A;  4Q5V A;  4N47 A;  4CF0 A;  3QEP A;  4FJM A;  1QS4 A;  3SQ2 A;  1S9E A;  4N5S A;  2OPS A;  4HUE A;  4H8K A;  4O0J A;  3ZSZ A;  4B8C A;  4Z4G A;  3SUQ A;  1HQE A;  1D9F A;  1TK0 A;  1XHZ A;  4FM1 A;  1BCM A;  4PUO A;  4KI6 A;  3G0Z A;  4B9L A;  1S6P A;  1WSJ A;  4DG1 A;  5CYQ A;  3M8R A;  3O4N A;  3QET A;  4CE9 A;  1C6V A;  1HJR A;  4KHQ A;  3AO5 A;  1KVA A;  5CY4 A;  4EP5 A;  4E0D A;  4FJL A;  3V1O A;  4OKE A;  3VQB A;  1SKR A;  3IRX A;  3ZSW A;  1W9H A;  4F4K A;  1D5A A;  3DYA A;  3IAY A;  4I2P A;  4CGI A;  2WON A;  4CEE A;  3OVN A;  4CEC A;  4CJK A;  1L5U A;  2YNI A;  2NUB A;  4EP4 A;  4N56 A;  4OVL A;  1ZBH A;  2WOM A;  3NF9 A;  4Z4E A;  1B9F A;  1RT3 A;  2YNF A;  1T8E A;  4DSL A;  3KD1 E;  3VQQ A;  4E1N A;  3HPO A;  4DU3 A;  3OYK A;  3LPU A;  2B5J A;  3SI6 A;  1RT6 A;  3KKR A;  4O55 A;  4E1M A;  3DMJ A;  3OYI A;  3ZT1 A;  2HNY A;  3TI0 A;  3MXI A;  2VWJ A;  4M3U A;  2KZZ A;  4IBN A;  1LW2 A;  4GMJ B;  4CJ3 A;  4YFU A;  3KK3 A;  1VSF A;  1O1W A;  5DK5 A;  3WNH A;  3AVC A;  2G8K A;  4CEB A;  4HTU A;  1I39 A;  1KTQ A;  2ZQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...