3AVMA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avmA00
4OJRA 1RT4A 3V6DA 4JS4A 1VSDA 5HRPA 4DTRA 1RBRA 4JRQA 1KLNA 2BGGA 2XY8A 3NF8A 3D45A 4O5BA 5J2MA 4J2EA 4PY5A 3TAPA 3RMBA 1TKDA 4DQRA 1C1CA 3T1AA 4KREA 2OPPA 1JLGA 3AVAA 4OGEA 2G8WA 2XRIA 1QSYA 3HP6A 1TGOA 1FXXA 1ZBUA 4M41A 1N5YA 3CYMA 1X1PA 4KHWA 1YVUA 1C1BA 4CJEA 2HW3A 4BWMA 4CGFA 2OPQA 4OPJA 4PA1A 4NCAA 4FLYA 2IS3A 1EP4A 4BE1A 3CG7A 2Y1IA 4F3TA 3ZSVA 2X78A 4J2BA 1QHTA 2E6LA 3QEIA 2HVHA 3PO4A 2B6AA 4DTUA 4C8LA 5SZTA 2OZSA 4M3ZA 4H4OA 3AO1A 1WNSA 3LPTA 1TKXA 4E19A 3VQQA 4CGJA 1LV5A 4E89A 3WNEA 2G8UA 1WSGA 2P51A 3ZSYA 3I8DA 2XY7A 3SQ4A 1SL0A 4DFKA 3QEWA 1D8YA 4OGCA 3VQ8A 1VSJA 4CEDA 4IFYA 3KIOA 4AH9A 3OYBA 4OKJA 3LP0A 2HNYA 3NDKA 3DM2A 4BDZA 4CCHA 1D9DA 1XC9A 2JGUA 4CHOA 1U45A 4K8XA 1ZBLA 1BL3A 4M3XA 3TANA 4L8RB 1EX4A 4CEAA 1S6QA 4CHQA 4EZ6A 3SQ1A 3SPZA 3WNGA 2GBZA 2KZZA 5J2PA 4CHZA 3S3MA 1XHXA 4ICLA 1SL1A 3JSMA 3S3NA 1RILA 1TV6A 3IRXA 4CJUA 3DOKA 4E3SA 1J9AA 1L3TA 1XHZA 4DF4A 1JXBA 3OYAA 4KB0A 2HMIA 5HROA 4OLBA 4FZXC 3CM5A 3OYJA 3DOLA 4IFVA 3V9UA 2FBVA 3CFOA 1J53A 3NBPA 5HRRA 1TK5A 3U3YA 3NE6A 5J2QA 1D9FA 1D5AA 3LP1A 1NK8A 2DFEA 5KTQA 4KI6A 5FDLA 4B8CA 2ETJA 2O4GA 3SQ2A 3LPUA 1FKPA 1RNHA 1S1TA 1S6PA 3DYAA 4CK2A 4J2DA 4TSXA 4LSNA 3ZCMA 2F96A 4E1NA 1SUQA 3U3GA 1LWEA 4DTOA 2BDPA 3MECA 3KLEA 1LAVA 4JRPA 4FJ7A 3P5JA 2KW4A 4GW6A 4CFDA 1NKBA 3DRRA 1VSKA 3OJSA 3K2PA 3ZSQA 1JKHA 2PYJA 4FLVA 2Z1IA 3L2WA 3AVCA 4I7FA 3MXJA 3NFAA 4N47A 4DS4A 3RR7A 4KHQA 3EYZA 3RRGA 3NHGA 1A5WA 1B9DA 2DFHA 4LH5A 4RW8A 3SNNA 4DSKA 3DI6A 3SCXA 4FJ9A 2ZD1A 4FJ5A 1KVBA 2B4JA 1JLQA 4NYFA 1RCHA 3VQ4A 5KRTA 2YNGA 3AO2A 1HNVA 2D0BA 2YKMA 3OYGA 1S1UA 3F73A 3NAEA 1NOZA 1HQEA 4O55A 2OZMA 4IDKA 4CEQA 5CY4A 2ZQBA 4CJTA 1CLQA 2HVIA 4ZTFA 3OYNA 3QINA 3O3FA 4ELUA 2D5RA 2FC0A 4W5RA 4CJSA 4CEZA 4FCYA 3L3UA 3I0SA 4DSEA 4K8ZA 1A5XA 4HVJA 4QAGA 3HYFA 4DLGA 4Z4GA 4OVLA 4LH4A 3DLRA 3RRHA 3K5MA 2JLEA 4M3TA 1LAWA 1KRPA 4CGDA 1TAUA 3TAGA 1X9WA 2OYQA 3AV9A 3OVNA 4CHYA 1RT2A 5KGWA 3DRSA 3ZT1A 3L2RA 3KLFA 4B9SA 1RDDA 3VN5A 1CXQA 2OPRA 3VQ5A 5I3UA 1SV5A 2GV9A 4AHVA 4UQGA 2A1SA 4FJKA 3K5OA 1BQNA 2BANA 1NKEA 5T7BA 4O0IA 4H8KA 4DQIA 4KTQA 3KKSA 4E7IA 3THVA 1KSPA 5D3GA 4KV8A 3QNOA 3L3VA 4FXDA 3SJJA 1G15A 1UA0A 2VG5A 1JL2A 4FK0A 4CJ4A 4JS5A 3RTVA 4DQQA 4DSFA 4AHTA 4IG0A 4FJLA 2KQ2A 2B5JA 4CJPA 1QSSA 1WLJA 2HNDA 4JLHA 1X9SA 4DU1A 4DF8A 1VSFA 1T05A 4HUGA 1HYVA 4EP4A 4AHRA 1WAJA 1RDCA 2F8TA 3A2FA 1B9FA 1O1WA 4FM1A 3KK1A 3PX6A 1L3VA 1RBSA 4BE2A 2QKKA 1JLFA 4CJ3A 4KI4A 3MEDA 4R5PA 4E7LA 3QEPA 3AVMA 3CM6A 3NF6A 4DFMA 3MXMA 4BDPA 4F3OA 5KRSA 3LWMA 4PQUA 2HHXA 4I9LA 4CHPA 3QEXA 4OKEA 3PV8A 2OPSA 4ZTJA 4O4GA 4EZ9A 2ATQA 4CIEA 3OYDA 1DTTA 4KPYA 4F2RA 3LAKA 4N5SA 1K6YA 2FBXA 4FLWA 5C42A 3OYMA 4LY7A 3JYTA 2YHAA 1BI4B 3C6TA 2WOMA 3OYHA 1ASWA 2E6MA 4BACA 1NK0A 4YNQA 2AJQA 3RMCA 3OS0A 3ASMA 4CJLA 1RT7A 4KO0A 3OY9A 3HJFA 3AVJA 3V1OA 3OYCA 2QK9A 4F2SA 1Z25A 4N56A 5E41A 2X74A 5CZ2A 1KTQA 3VQEA 3O3GA 4FW1A 1NK5A 4PUOA 2A1RA 2HHUA 1L5UA 3QERA 3AA5X 4DTMA 4KHUA 4CERA 4B9LA 4W5NA 2VWKA 2YHBA 2YNIA 4FVMA 1VSMA 3NH0A 3HXMA 1WN7A 2E4LA 3DLGA 3SZ2A 4I9QA 1C0UA 4FJMA 4CK3A 4FJIA 4CJRA 4FK2A 4CK1A 2HNZA 3AVNA 4DMNA 2HHWA 4DSJA 3HK2A 1RT6A 4B9UA 1Z26A 1KFDA 4BDYA 4DS5A 1C1AA 1IKWA 4BWJA 1VRTA 3TAQA 4DG1A 3V9SA 4CE9A 1MU2A 4DTPA 3NH1A 1RBVA 3QEVA 4B9MA 2HHVA 3LANA 1NK7A 2PZSA 2Z1GA 2G8KA 3DLHA 3VQCA 1JLCA 4CEOA 4EP5A 1BIUA 3TAEA 4Z4FA 3OS1A 4RW6A 4DFPA 2R7YA 3HO1A 3IAYA 1U04A 4HCCA 5DMRA 3HT3A 4DFJA 5CYQA 4QOZB 2ZE2A 2G8IA 4FZZA 1JLEA 3VQPA 1BQMA 5C25A 4OPKA 4Z4EA 1R0AA 1YT3A 4J2AA 1RTDA 4LD0A 4E7HA 2X6SA 1BCOA 3RMAA 3AO4A 3KLIA 4YFUA 3SYZA 4KHNA 1WSJA 3AVHA 3D0PA 4ELVA 1TK0A 1IKVA 4N41A 4M45A 3M8PA 1S1XA 4W5QA 1S1VA 4M42A 3HPGA 1VK0A 4ID1A 1I39A 3M8QA 4GVMA 5HBMA 4FLZA 3NGZA 1SKWA 4BE0A 4CF9A 3P83D 4MFBA 4OLAA 5CZ1A 1VSHA 2IC3A 5FROA 3AO3A 1ASVA 3KK3A 1VRUA 3VQBA 3EY1A 3NCIA 1SKSA 1JLAA 5DK5A 1NJZA 4C8OA 4RG8A 3AA2A 4RW7A 2IOCA 1BGXT 3AO5A 1S9EA 5C24A 2IGIA 3RWUA 4C8NA 4FJHA 3LP2A 4DTSA 3RR8A 3BGRA 4CF8A 1L3UA 5KGXA 2RN2A 1L3SA 4CFCA 2XY5A 4ELTA 1SKRA 3VA0A 1DTQA 2GUIA 4AHSA 1XI1A 4FM2A 4HCBA 1GOCA 1WSEA 4CIFA 4W5OA 2Z1JA 3LZJA 2P5GA 1RBTA 2BE2A 3HPHA 3IS9A 1KLMA 1NK4A 1U48A 4LSLA 5J2NA 3LDSA 3MEGA 3HSTB 4I2PA 5HRNA 1ZYQA 3NGIA 2EX3A 1KVCA 1TKZA 3AVBA 4CHNA 4WE1A 3NF7A 4CIGA 2QXFA 3OJUA 4Z4HA 3TI0A 1VSEA 3ISNC 5HP1A 1CXUA 3QLHA 1TVRA 3WNHA 3LP3A 1JLBA 2XY6A 3G10A 3IG1A 4FLUA 3PX4A 3S9HA 1RTIA 3QESA 3T19A 1X9MA 3DLBA 2NUBA 4CECA 4HHTA 1ZBFA 4KAZA 4IKFA 5KI6A 3ZT0A 2XO7A 3O4QA 1RBUA 4CEEA 4CF1A 3L2QA 1TK8A 1QQCA 4DU4A 4DU3A 1UA1A 3HL8A 3V81A 4B08A 2EHGA 1CZBA 1BIZA 3K5LA 1EKEA 5I42A 4DWIA 4CEBA 1GOAA 5J1EA 1HPZA 4KB1A 3SUOA 2HB5A 5FRMA 1UOCA 3LAMA 4E7KA 3OYLA 3QIPA 3NH2A 1T8EA 3O3HA 4M3UA 4C8KA 2RKIA 1TKTA 1LW2A 3MAQA 3L2VA 4FM0A 2HHTA 3UIQA 2HHQA 3VQAA 3I0RA 4M3YA 5K14A 3LALA 3SV4A 1EXQA 1FKOA 2VG7A 3TWHA 3OYFA 4CJWA 1KCFA 4FK4A 1BCMA 3V9WA 4O44A 1Q8IA 4B9NA 3QIOA 1J5OA 1C6VA 4CF2A 1HMVA 1F21A 1GOBA 2IDOA 3E01A 2LSNA 2Q3SA 3ZSXA 4XIUA 1ASUA 3TARA 4DSIA 2DFFA 3KKRA 3OYKA 4F4KA 3ZT2A 1JL1A 4KHYA 3TAFA 3AA4A 1BI4A 3PX0A 4H4MA 4E0DA 4CJQA 1W9HA 5FRNA 4AILC 2FBTA 3SV3A 2QKBA 3KD5E 1HNIA 3H08A 1RT1A 4DTJA 1LW0A 1QE1A 3F9KA 3CFPA 1NK9A 2HHSA 3NF9A 3SUPA 4QCLA 4E7JA 3KTQA 3BDPA 4Z4CA 2D0CA 3VQDA 4FJ8A 2YNHA 1C0TA 3ALYA 3P1GA 3L8BA 1NOYA 3MEEA 2VWJA 4IG3A 3KJVA 4CJVA 4GMJB 3ULDA 4M3WA 1LWFA 4CF0A 1REVA 3VQ6A 4NCGA 4N76A 2DY4A 3C6UA 1ZBIA 3HP9A 1S9GA 3SUQA 4OKKA 1NJWA 1NKCA 1VSLA 1U47A 3PY8A 1JXEA 4CFAA 3M8SA 4CJ5A 2G8HA 1IO2A 4E1MA 1IKYA 1S1WA 4HUEA 2XHBA 4DTNA 3HPOA 1Q9YA 1T7PA 4AHUA 3PO5A 1Y97A 4B3OA 2KTQA 1ITGA 1TL1A 4CEFA 3KLGA 5JS2A 1FK9A 2D0AA 3C95A 5EU7A 4FW2A 4Q5VA 4DTXA 4Y1DA 4FLTA 2RF2A 3AVFA 1CZ9A 3OYIA 3T3FA 3ITHA 3TAMA 2G8VA 4HUFA 4M3RA 1QTMA 3SI6A 1T03A 4CGGA 1IKXA 2YNFA 3HM9A 2RPIA 3SPYA 1BISA 4FZYA 4FJJA 1NJXA 3B6PA 3VA3A 4PWDA 3FFIA 1EETA 4KTZA 4DSLA 1YTUA 4NCBA 2KZMA 4Z4IA 1IG9A 1HJRA 1WSFA 1WAFA 1TL3A 3AVGA 3OS2A 3O4NA 4KKOA 1RDBA 4I2QA 4KFBA 4RW9A 4Z0UA 3AVIA 4ID5A 1RDAA 4IBNA 3CQ8A 3K59A 4KTWA 2W42A 3K57A 2VG6A 3V1RA 4CFBA 2PYLA 3DLEA 1UWBA 2KFNA 3DLKA 1WSHA 3SUNA 2G8FA 4C8MA 2FBYA 3M8RA 1YTAA 1I3AA 1HYSA 4DLEA 3ZSWA 3WNFA 4ZHRA 1U4BA 1KVAA 4B9TA 3LZIA 3QNNA 3AVKA 1B92A 1IH7A 3B6OA 5JS1A 3KK2A 3V9XA 1NK6A 4CESA 4Q0BA 3V4IA 1QS4A 3G0ZA 4FLXA 1RTHA 3K58A 3AVLA 1XWLA 4G1QA 4CJKA 3QETA 3TABA 2DTUA 4FJGA 2ITGA 3HVRA 3CFRA 1RT3A 1QSLA 4NYNA 4CGHA 1KFSA 2Z1HA 2KFZA 2P1JA 3PUFA 4O0JA 3ZT4A 4FJXA 4B9VA 4B8AB 3LWLA 2P5OA 5HLFA 3V9ZA 1C0MA 3ZSZA 3L2UA 1BHLA 3EZ5A 3RMDA 3U6FA 4AHCA 1RT5A 1UAXA 2WONA 1TAQA 3TR8A 2YKNA 3ZT3A 2F8SA 3VQ7A 3MXIA 1WSIA 2OA8A 4DQPA 4F8RA 2YV0X 3NGYA 1LWCA 1A5VA 2X6NA 1Q9XA 1RTJA 3S3OA 2PY5A 3DMJA 3ZSOA 1N6QA 4KHSA 1J54A 5SWMA 1NJYA 3VQ9A 1HYZA 3C94A 4RW4A 4MQ3A 2IAJA 1SL2A 4W5TA 5CYMA 3QO9A 3K5NA 4DQSA 3KD1E 3KLHA 4Y1CA 4HTUA 1DLOA 3HVTA 3DRPA 4CJFA 1S5JA 4CGIA 2O4IA 3AA3A 4KRFA 1W0HA 3SQ0A 1HRHA 3V1QA 5HRSA 2Y1JA 3ZSRA 1HQUA 3OYEA 2I5JA 4FJNA 1ZBHA 1U49A 1VSIA 4FYDA
chains in the Genus database with same CATH superfamily
3V6DA 4PKGA 2XY8A 3NF8A 4J2EA 1Y64A 1NGDA 3LDPA 4DQRA 5LMUK 3AVAA 4YY3K 1TGOA 2QTDA 4MO4A 1NMDA 2QA4N 4DR5K 4WQ5C 4BWMA 4FLYA 3CG7A 3ID8A 2Y1IA 3ZSVA 4J2BA 3QEIA 4YDUC 3PO4A 4IOCL 4C8LA 4DTUA 5SZTA 3CPWM 3FFKB 4L3QA 1NLVA 4CGJA 1Q81O 4E89A 2G8UA 5BPNA 1VAZA 1HR0K 3QEWA 3CCJN 3NDKA 2HNYA 4H5VA 1D9DA 1XC9A 2JGUA 1U45A 4X66K 3TANA 5AZJB 4CEAA 4CHQA 4GKKK 1ATNA 3SQ1A 2P9PB 3SPZA 2NRWA 3DXKB 3S3MA 1SL1A 4ICLA 3JSMA 1RILA 3DOKA 4E3SA 1XHZA 3EO3A 3BF3A 1JXBA 2HMIA 5KPTA 4FZXC 3OYJA 5AR0A 4BRLA 3CFOA 1YJ9N 3NBPA 1TK5A 2O8EA 3U3YA 1D5AA 4MLEA 5EXWA 1BWFO 1BDGA 4JKFA 4M42A 1RNHA 3J7YP 3DYAA 3THWB 4LSNA 4E1NA 3U3GA 3BZCA 3EEQA 4JRPA 2J4RA 2W41A 1JKHA 2Z1IA 4FPBA 4I7FA 4DS4A 3D2FA 3NHGA 4RW8A 2ZD1A 3NAEA 2YNGA 3F73A 2OZMA 4CEQA 5BR8K 3OBWA 4BRDA 5C2FA 2BTFA 1NGGA 1ZBSA 1BG3A 4ZTFA 3QINA 5EVZA 2D5RA 5H1SQ 2FC0A 4A5AA 4CJSA 4FCYA 4DSEA 3VEXA 5BN8A 4HVJA 4X64K 3HYFA 1NWKA 4Z4GA 4KBOA 5JICA 4CGDA 2OYQA 1RT2A 3KLFA 4DV3K 1RDDA 5I3UA 1SV5A 3L4IA 3K5OA 2UXDK 1NKEA 1N8RO 4RWTA 4KTQA 1NGIA 4IEIA 3KKSA 2FSJA 2OCEA 5D3GA 4KV8A 5JLFA 1UA0A 1G15A 4DQQA 5A2QO 4IG0A 5LMNK 2KQ2A 4CJPA 1X9SA 4YOWA 3DXMB 4B3SK 1T05A 2F8TA 3A2FA 1L3VA 4FM1A 3PX6A 4B9VA 3FE1A 1BA0A 4R5PA 2VWBA 4MLHA 3MXMA 3CQXA 2HHXA 1HNWK 5JMVA 3LWMA 3MCAB 4DV0K 2OPSA 1VQPN 4ZTJA 3LAKA 2W40A 3WEEB 4BACA 1BI4B 3OYHA 4BR7A 5GAGP 4LFAK 5C10A 3OS0A 3SJHA 5KQ8A 4KO0A 3OY9A 3CC4N 4DQ8A 3VQEA 4FWQA 3O3GA 1DKGD 1L5UA 4CERA 1TUYA 2YHBA 5C2DA 2YNIA 4FVMA 4WYBA 1VSMA 4BREA 1WN7A 2GUPA 3HXMA 1WBBA 4FJMA 3E1YA 4C1NK 4CJRA 4FK2A 4CK1A 2HNZA 2HHWA 2IVOA 3CCQN 1Z26A 1KFDA 1KD1O 1T44A 3H45C 1VRTA 4CE9A 1RBVA 2HHVA 3VGKA 3VQCA 4CEOA 2ZJQL 3TAEA 5AZJA 2R7YA 2P9PA 5LJVA 3DXKA 1XMQK 4QOZB 4FZZA 1BQMA 1YT3A 1RTDA 1GLDG 3RMAA 3AO4A 4LF4K 4BR9A 4KHNA 3AVHA 4ELVA 4N41A 4QS8A 4IO9L 3HPGA 3M8QA 1SKWA 5MLCQ 1EWQA 3P83D 4JKCA 1C0GA 4BC2A 2IC3A 2GTDA 3EY1A 3NCIA 1SKSA 4C8OA 3SAGA 2IOCA 1BGXT 3THWA 1VQ6N 3RWUA 4H0XB 4DTSA 3WQTA 3BGRA 3QMLA 5AQYA 2BUPA 1MDUB 1ZC6A 2RN2A 1L3SA 4CFCA 2XY5A 4ELTA 1DTQA 1TYQB 1GOCA 3MX5A 3IS9A 4M63C 3O4WA 5J2NA 3MEGA 3HSTB 5AQVA 5M1FA 2NLXA 4YOTA 2QWMA 5ADXA 1Q18A 5DM6L 5AQRA 3P31A 3CCLN 2QXFA 3C65A 5BREA 3TI0A 1VSEA 1Q86O 1CXUA 2HF4A 3IG1A 4FLUA 3PX4A 1X9MA 5AZIB 3P38A 2NUBA 2QWNA 3CQYA 4ILJA 2XO7A 3O4QA 4CEEA 1TK8A 4DU3A 4BR5A 3HL8A 3A5NC 2WUSA 3J81O 2O8CB 4BRKA 1VQ4N 2EHGA 5I42A 5C0YA 1GOAA 1LOTB 4CBWA 2HB5A 1T6CA 4B1UB 1T8EA 5AQGA 4JEPA 3L2VA 3DXMA 3VQAA 2HMPA 3EKSA 1OH7A 2Q1NA 5K14A 3CCSN 1FKOA 2I7NA 3CJBA 3OYFA 4CJWA 1KCFA 2QW9A 3V9WA 4B9NA 5AQZA 4YOVA 1Z05A 3FZMA 3TTDA 2DFFA 3OYKA 4F4KA 3WEEA 1JL1A 1BI4A 4CJQA 3O9RA 4DV5K 4JK7A 4BRQA 3CFPA 1WB9A 3SUPA 3CCVN 4CZKA 1C0TA 4H0TB 1NOYA 3MEEA 2CH6A 4IG3A 3E9PA 4GV6A 1R59O 3KJVA 2F9WA 1LWFA 3VQ6A 4DV4K 1S9GA 1WBDA 3O5BA 1VSLA 3BZKA 3PY8A 4YOYA 4X65K 4KHPK 1Y97A 3JXUA 3MN6A 3CF5L 4BRHA 5JS2A 3C95A 4EFHA 4FLTA 3VEYA 3ITHA 3TAMA 4HUFA 3KK7A 3SI6A 4JI7K 4CGGA 4IXCA 4DR1K 3SPYA 2YNFA 2RPIA 1MWMA 3H6EA 1E4GT 2I7PA 4DSLA 1E3MA 4Z4IA 1HJRA 1WAFA 3LL3A 4GY2B 1RDBA 4Z0UA 1HUXA 4ID5A 1RDAA 3C0BA 3CQ8A 3K59A 1K73O 4BRFA 3K57A 1ATSA 3V1RA 1BUPA 3SUNA 4C8MA 2QWRA 1YTAA 1I3AA 4DLEA 1C0FA 3QNNA 3AVKA 4LFCK 3V9XA 1YHQN 4CESA 3V4IA 3CJ9A 3G0ZA 4QS7A 4FLXA 3QETA 4G1QA 4CJKA 1TYQA 3CCMN 4FJGA 1NGFA 2V52B 2ITGA 4CGHA 2HSTA 4O0JA 3MDQA 4B8AB 4JI0K 4MDAA 1C0MA 3RMDA 4FOIA 3KZBA 3UKRB 2DPNA 3IMXA 1WSIA 1VQ5N 4DQPA 3AY9A 1A5VA 1N34K 2X6NA 5AZIA 1N6QA 4KHSA 4H0YB 4GKJK 5SWMA 1GLCG 3C94A 4W5TA 2O8CA 4J8FA 1NGEA 4KH6A 3V1QA 2Y1JA 1S22A 3GG4A 3OYEA 2I5JA 5BRHA 1KAYA 1YF5L 1U49A 4OJRA 1RT4A 1M90O 4Z94A 4DTRA 1RBRA 4FPAA 3KVGA 1KLNA 2BGGA 5CE3A 4X62K 3THYB 5J2MA 4JK8A 3RMBA 1TKDA 2OPPA 3HOSA 1SS6A 2G8WA 2XRIA 1QSYA 2HHHK 1FXXA 1ZBUA 4CD1A 4M41A 1X1PA 2A41A 5AQJA 4CJEA 3BP8A 1RFQA 4K41A 1HX1A 4CGFA 4CZMA 5I9EB 4NCAA 4BE1A 3CC7N 5BRDA 2X78A 1QHTA 2YHWA 3G71N 2Q31A 3JS6A 3FZKA 4H4OA 3U4LA 3LPTA 1TKXA 4E19A 5JVGL 3WNEA 3GE1A 1S3XA 4CW7B 2P51A 3I8DA 5AQHA 1VSJA 3KIOA 3LP0A 4BDZA 4NXNK 3LM2A 1ZBLA 3W3DA 4B1WB 5M1QA 3HOTA 1YXQA 4EZ6A 1DT9A 3PLAA 3WNGA 4CHZA 4JI4K 1TV6A 3IRXA 3FZFA 3AGKA 4GVEA 3OYAA 2P9UB 3CM5A 4I6MB 3DOLA 4CD3A 4IFVA 2A5XA 2FBVA 2ZGZA 4BG8A 5HRRA 5FPEA 3OBYA 4AQYK 5J2QA 5GIPA 1QZ5A 4M7YA 3O1WA 4KI6A 5FDLA 2ETJA 4J2DA 5DM7L 2BDPA 2F96A 3MECA 1LAVA 4CVNE 1W97L 1NKBA 3DRRA 4B3TK 3CCRN 3L2WA 5TKWA 4DR2K 3RRGA 2ZF5O 1B9DA 2DFHA 4JKDA 4DSKA 3VQ4A 4NYFA 4JI1K 3AO2A 4CZGA 1HNVA 4F9OA 2BH1A 2E20A 5CY4A 2ZJRL 1X3MA 4CEZA 2F9TA 3MWPA 1OH6A 2ITMA 4IZ9A 4IJAA 3T7ZA 2ZGYA 4JK9A 2JLEA 1HJOA 1TAUA 4H0VB 2QWLA 3OVNA 1JCFA 2GX9A 3DRSA 3VQ5A 2OPRA 4XH4A 4UQGA 5KQDA 3UKRA 2BANA 5T7BA 4O0IA 2FF6A 4H5WA 4DQIA 4E7IA 4PKHA 3QNOA 3L3VA 4BR2A 3SLCA 4AHTA 4FJLA 3MMVA 4IOXA 3CHWA 3AARA 1VSFA 1WAJA 2QKKA 3H3OB 1JLFA 4KI4A 4E7LA 4UY8O 1XC3A 3AVMA 3NF6A 3M3ZA 4OX9K 4JI6K 1HKCA 4N5SA 3THYA 4O5FA 2FBXA 3JYTA 2YHAA 5C12A 2AJQA 5AJ3K 3ASMA 4CJLA 3HJFA 3V1OA 2QK9A 4F2SA 4N56A 2X74A 1O13A 3ENOA 2HHUA 3F2KA 2VYPA 5F0XA 5GADP 3SZ2A 2E4LA 1S72N 1C0UA 2WC9A 3AVNA 4DMNA 4A62A 4B9UA 1GLLO 4BWJA 1BOTO 3BUZB 5JLHA 3TAQA 4DG1A 4V19S 5IT9O 3QEVA 3LANA 4BVOA 1NK7A 1T3VA 3A5LC 4EP5A 4Z4FA 1QVGM 4RW6A 3VEWA 3D2EB 1U04A 4CI6A 3HT3A 3TSUA 4WQ5A 4DFJA 2ZE2A 2G8IA 4OPKA 4CZIA 1R0AA 4YDUA 4FWPA 3SYZA 3KLIA 4KH5A 2P9UA 1WSJA 4B1XB 4I6MA 1IKVA 1IJJA 3M8PA 1S1XA 1VK0A 4MFBA 4U67L 4OLAA 3THXA 2QXLA 1E4FT 3VQBA 3AAQA 3I33A 1JLAA 5DK5A 1NG9A 3AA2A 2UUBK 1S9EA 1KC8O 4C8NA 4FJHA 1YUWA 3O9SA 4CF8A 2ASPA 4XH1A 5KGXA 3VA0A 4HCBA 3MCPA 4CIFA 3RVCA 5F1XA 2F7TA 2NRVA 3LZJA 1HNXK 1RBTA 2BE2A 3HPHA 3NVKA 3LDSA 2VGMA 3IKMA 3NGIA 1ZYQA 1P90A 2EX3A 4JKGB 3NF7A 2GWJA 3WNHA 4U7BA 1JLBA 2YHYA 4B9MA 3S9HA 1N32K 3EKUA 3ATVA 3T19A 4KAZA 4CECA 4BY9C 5AQNA 3HTVA 3L2QA 4BRPA 1QQCA 3V81A 3L0QA 1BIZA 4BR0A 5ADXH 4CEBA 4FWSA 5J1EA 3SBGA 1HPZA 3LAMA 4YOUA 3NH2A 3BEXA 4FWKA 2FLOA 1SQKA 5AQFA 2OANA 4FM0A 3UIQA 3I0RA 1LCUA 2NRZA 3SV4A 1EXQA 1QHAA 2CGJA 3TWHA 3DWLA 4O44A 3TTFA 1WOQA 4Y0WA 1F21A 3DJCA 2IDOA 2Q3SA 3TARA 4KHYA 4G9ZA 3PX0A 1W9HA 4AILC 3SV3A 1Q82O 3OTOK 3KD5E 3GOIA 1HNIA 3NMUA 2NZTA 3F9KA 5AQWA 5AQQA 4DCHA 3NF9A 3HI0A 3Q7BA 4E7JA 3KTQA 3VQDA 4FJ8A 3P1GA 3L8BA 4GMJB 1IG8A 1V4TA 1REVA 5ELZA 4N76A 2E2NA 2DY4A 1ESVA 3HP9A 1NKCA 1JXEA 3M8SA 1IO2A 2GELA 4E1MA 1Q9YA 1GLBG 4AHUA 1TL1A 4CEFA 2ASOA 3D2EA 1FK9A 1SZ2A 3AVFA 5AQKA 2YCHA 5AQTA 3T3FA 4M3RA 3M6GA 1NJXA 3JAMO 4CJ7A 3FFIA 4H5RA 4KTZA 1YTUA 2KZMA 3UKUB 1TL3A 4DV6K 3O4NA 3B8AX 3CMEN 2W42A 2VG6A 4CFBA 1HNZK 1UWBA 3G6EN 2KFNA 3DLKA 1WSHA 2G8FA 4LF9K 2FBYA 4B1ZA 3M8RA 1HYSA 3WNFA 4ISEA 4B9TA 3LZIA 4Q0BA 3HVRA 3CFRA 3I8BA 4NYNA 1KFSA 2Z1HA 4JD2B 2P1JA 3SMPA 3ENBA 3BY5A 4DR3K 3LWLA 5HLFA 2AP1A 4IJNA 3L2UA 2NNWA 3U6FA 1FW6A 1RT5A 2WONA 1TAQA 3KWGA 4JKGA 3ZT3A 3AGRA 2F8SA 4WCEL 4IEEA 3QFPA 5AQXA 2YV0X 4K43A 2FSKA 1RTJA 3ENHA 3S3OA 3ZSOA 1J54A 4BC3A 3O08A 5BRFA 2IAJA 3UB5A 4DQSA 5CYMA 3QO9A 2V7ZA 4Y1CA 2KHOA 3D6RA 1JJ2M 3GBTA 1DLOA 3DRPA 4CJFA 2O4IA 4HTLA 4KRFA 3SQ0A 1HRHA 5HRSA 1HQUA 4DUYK 3C6AA 2NRXA 2NRRA 4FYDA 3LDNA 4JS4A 4JRQA 4O5BA 1YJNN 3TAPA 1MWKA 4CZJA 4KREA 1JLGA 2HW3A 4OGEA 3LDOA 4B3MK 3TTCA 4FWMA 3CYMA 1JCGA 1BO5O 4KHWA 4WFNL 1RDWX 2IS3A 1EP4A 4BVPA 1OH5A 4AF1A 3VPZA 2HVHA 2B6AA 2OZSA 4M3ZA 3AO1A 4OO1J 1WNSA 3FGUA 3VQQA 1LV5A 2RHKA 2O8BB 1WSGA 3M5RA 3ZSYA 2XY7A 1SL0A 4JI2K 1H1VA 2YHXA 4O8UA 4CCHA 3DM2A 2A3ZA 4K8XA 1BL3A 1EX4A 1S6QA 2KZZA 4DUZK 2GBZA 1XHXA 1VQNN 3QDKA 1L3TA 1IBMK 1J9AA 4DR6K 5BN9A 2V51B 4KB0A 4OLBA 2CH5A 5TKYA 4BRGA 5IWAK 3CJCA 3NE6A 1D9FA 2D4WA 1NK8A 3LPUA 1FKPA 1S1TA 4TSXA 4DTOA 3ZCMA 1LWEA 3KLEA 4GW6A 2KW4A 4CFDA 1VSKA 3OJSA 3K2PA 2HBMA 3ZSQA 4XEIA 3UKUA 5JVHL 4JKEA 2E88A 1WUAA 3AVCA 4JKHA 3MXJA 3NFAA 4N47A 3VMFB 1XNRK 3K9JA 3EYZA 2P9SB 1A5WA 5AFUH 3SNNA 3VENA 3DI6A 4FJ9A 5KRTA 1JLQA 2Q2RA 1RCHA 3HSCA 4ILGB 3OYGA 1K8AO 2YKMA 1NOZA 1HQEA 3FZHA 2YJFA 1SAZA 2HVIA 3OYNA 2UXBK 1NM1A 3EE8A 4JN4A 3FZLA 2A42A 4QAGA 4DLGA 3VEZA 4JD2A 4OVLA 3DLRA 4FOEA 3RRHA 3K5MA 1LAWA 4JAXA 3TAGA 1X9WA 4CHYA 2NRHA 4B9SA 3VN5A 3J7ZO 2GV9A 4JHDB 2A1SA 4FJKA 2E2QA 3THVA 1QZ6A 1KSPA 3SJJA 3VETA 2QEXN 4CJ4A 2W6LA 3RTVA 1N36K 4IOAL 4BRAA 1WLJA 4JLHA 1CZAN 2E1YA 4DU1A 4DF8A 4DHYA 3MN9A 4K42A 4AHRA 1RDCA 1B9FA 3KK1A 3DLLL 4BE2A 3VF4A 3MEDA 4WF9L 4BQZA 5KRSA 4I9LA 4CHPA 3QEXA 3EE9A 4OKEA 4OPHA 3PV8A 4O4GA 4EZ9A 2ATQA 1DTTA 4F2RA 2HBLA 3FR0A 3OYMA 4C1NI 3C6TA 1ASWA 2E6MA 4HWIA 4YNQA 3RMCA 1RT7A 3AVJA 3CCUN 3OYCA 5CZ2A 5FPDA 4FW1A 4BR4A 1NK5A 4PUOA 5FPNA 2A1RA 3AA5X 4DTMA 4KHUA 4B9LA 4W5NA 2VWKA 3NH0A 4I9QA 3DLGA 3MK6A 4FJIA 2FXUA 2EWSA 4DSJA 3HK2A 1NGCA 2Q0RA 2O8FB 2O8BA 4IWVA 1MU2A 3GL1A 1X3NA 2PZSA 2Z1GA 3SAFA 4ILHA 1XMOK 2D0PA 5AQIA 3IAYA 4HCCA 5DMRA 5CYQA 2FF3B 2NRTA 2H3GX 3VQPA 5AFUA 5C25A 1YITN 4Z4EA 4J2AA 4BRNA 4E7HA 3FLCO 1BCOA 1Z6RA 4FL9A 1IBLK 4DV2K 1HLUA 3VTIA 3WXJA 4M45A 3EL2A 4IDHA 1S1VA 2AA4A 4ID1A 4WQ4C 3U9ZA 1HPMA 1I39A 4GVMA 1TUUA 2HF3A 4CF9A 5CZ1A 1ASVA 4K0KK 2YX6A 1NJZA 4RG8A 3M1FA 4RW7A 3CJAA 3AO5A 3K0SA 2IGIA 3RR8A 4BGBA 3WQUA 2GUIA 4AHSA 1J6ZA 4A61A 4W5OA 2Z1JA 2P5GA 2P9SA 3J8AA 1KLMA 1U48A 3CJ7A 1OVQA 4I2PA 5HRNA 3I55N 4DR4K 4CIGA 3OJUA 5GAEP 4Z4HA 1W7AA 3ISNC 4RCHA 3CCEN 5HP1A 3QLHA 2QWOA 3O9QA 3LP3A 2XY6A 3G10A 1GLFO 3QESA 3DLBA 4HHTA 1XUPO 1MA9B 5AQUA 1RBUA 4CF1A 3MX2A 4A2BA 4DU4A 4H5TA 5M1OA 4B08A 4JHDA 3K5LA 1EKEA 3Q7CA 3J80O 4IFEA 1OVYA 3SUOA 3N4PA 5AQOA 3P4IA 2F4VK 2HOEA 1UOCA 4JYAK 5LL6Z 4C8KA 4BRMA 1TKTA 3TPQA 2E2PA 2WTUA 2HHTA 2HHQA 3N4QA 2VG7A 4GNIA 2WBNA 3TU5A 3F9MA 3O9TA 1N33K 3RSEB 2QM1A 1VQ8N 1BCMA 1Q8IA 3O9UA 4CF2A 3ZSXA 4CZFA 3E66A 3KKRA 1ZXOA 3AA4A 4LF7K 4E0DA 3CERA 5FRNA 3EN9A 3VEOA 3S41A 3AAPA 3H08A 3D7EO 1RT1A 4DTJA 1LW0A 2A40A 3LDLA 1NK9A 3T1HK 3WXIA 4QCLA 1ILYA 3G4SN 3IFRA 2D0CA 1EWRA 1FJGK 2YNHA 3C7NB 4B3RK 3VGLA 3ULDA 3QBWA 1HKGA 4YORA 3C6UA 2O8FA 3WUHA 1NJWA 4CFAA 4CJ5A 4K25A 3O1BA 1IKYA 1S1WA 3PO5A 2XHBA 2OTJN 4B3OA 2KTQA 2PBDA 1ITGA 3A5OC 3CJ1A 4IO8A 3SBTA 2D0AA 4FW2A 2PFUA 4Q5VA 4DTXA 4B1VA 3LDQA 3EZWA 5EX5A 3OYIA 2G8VA 1G99A 4ISFA 4R79A 1T03A 1IKXA 3HM9A 2JWLA 1BISA 1DEJA 3B6PA 2D0OA 4CBXA 3OS2A 3HRGA 4I2QA 4RW9A 3CIPA 4IBNA 4KTWA 1QQNA 4DB3A 4JNEA 2QWPA 2PYLA 2WFBA 3H3NO 3BF1A 1U4BA 3ZSWA 4ZHRA 4H0PA 1B92A 5BPLA 2ASMA 1NK6A 2IIRA 1XWLA 4BC4A 3VOVA 4LF6K 3E9LA 1QSLA 4AM7A 2KFZA 3PUFA 1VQON 5F2RA 1OKJA 5M1PA 3V9ZA 1KAXA 3ZSZA 3EZ5A 1BHLA 1K8KB 1J5EK 2E2OA 4AHCA 2YKNA 3ZX2A 3PIOL 2HBJA 3VQ7A 4BRCA 2OA8A 4F8RA 2PY5A 1NJYA 3VQ9A 1HYZA 4A2AA 5AQPA 3K5NA 3KLHA 4HTUA 3HVTA 1U2VB 3AA3A 1W0HA 3ZSRA 1QQOA 2KKZA 3O6WA 3ZETB 2CGKA 1EQYA 1VSIA 2E8AA 3H46O 3SMSA 1NMNA 1BA1A 1VSDA 3A8YA 5HRPA 4NLCA 3D45A 4JI3K 2P9NB 4PY5A 1D4XA 3HZ6A 1C1CA 3T1AA 5M1NA 4BQLA 2JWKA 3HP6A 2VQFK 3RSEA 1N5YA 1YVUA 1C1BA 2OPQA 4OPJA 4PA1A 4F3TA 1X9JA 2E6LA 5EOYA 1NGBA 4ISGA 3PSIA 4WFBL 3CMAN 4JV5K 4NLBA 1Q7YO 3F5TA 3CC2N 5BPMA 4M7XA 4CZEA 3SQ4A 4DFKA 1D8YA 4OGCA 3VQ8A 4CEDA 3SQ2A 4IFYA 4AH9A 3OYBA 4OKJA 3PSFA 3QBXA 4CHOA 4M3XA 4NXMK 1NU0A 5HOOA 4L8RB 4EIAA 4PHTX 3C7NA 5J2PA 3S3NA 3GDQA 3CXCM 5E84A 4CJUA 4DF4A 5HROA 4YHHK 2VGNA 3R8EA 3V9UA 2UYTA 4JKBA 1J53A 3G25A 3QFUA 3R1XA 1NGHA 3LP1A 2DFEA 5KTQA 2GEMA 4LC9B 4B8CA 2O4GA 1S6PA 4CK2A 2KLAA 5FLXO 2UUCK 4FWNA 1SUQA 4FJ7A 3P5JA 2P9LB 2P9IB 3L4QA 2PYJA 4FLVA 4O8KA 2ZM6K 3RR7A 4KHQA 1RGIA 1XNQK 3DAWA 1QVFM 4LH5A 3SK3A 3QB0A 4JI8K 3SCXA 2YJEA 4FJ5A 1KVBA 2B4JA 4PQUA 2D0BA 1S1UA 4O55A 4IDKA 3WXLA 2ZQBA 3A5MC 4CJTA 1CLQA 3ID6A 5LY3A 3O3FA 4ELUA 4DV1K 4W5RA 4K8ZA 3L3UA 3I0SA 2O8DB 1A5XA 4LH4A 4PKIA 4M3TA 1NGAA 1KRPA 3AV9A 3L2RA 5KGWA 5M1KA 3ZT1A 1K8KA 1CXQA 4LFBK 4AHVA 1BQNA 5GINA 2VQEK 4H8KA 4BRIA 4PL8A 5E26A 4FXDA 1YJWN 4FK0A 2VG5A 1JL2A 4B1YB 4JS5A 1P8ZA 4DSFA 2D1KA 2IVNA 2B5JA 1QSSA 2HNDA 3KHYA 3ZLJA 5BR9A 4HUGA 1HYVA 4EP4A 2HBKA 1U2VA 1O1WA 4H5NA 4AM6A 1RBSA 4CJ3A 3VF2A 3WXMB 3ZETA 3QEPA 3CM6A 4DFMA 4BDPA 4F3OA 2ZWHA 3TSQA 4WFAL 3WT0A 4CIEA 3OYDA 1IBKK 4KPYA 3OHRA 2CGLA 5EY4A 3VF6A 1K6YA 2P9NA 4H03B 4FLWA 5C42A 4LY7A 4NO7A 2WOMA 3LM9A 5C15A 3T1YK 4XH5A 1Z25A 5E41A 1KTQA 4QS9A 3QERA 3MWTA 1NJIO 3HBTA 1U6ZA 4CK3A 1K9MO 3ZYYX 2GWKA 3ULEB 5KPZA 1RT6A 4BDYA 4DS5A 1C1AA 4BG9A 1IKWA 3U9DA 3V9SA 4DTPA 3NH1A 3QICA 2RE2A 2G8KA 4H0OA 3DLHA 1JLCA 1BIUA 1YIJN 3OS1A 4DFPA 3HO1A 1IV0A 4A5BA 3PIPL 1VQLN 1JLEA 1NNEA 1VQ7N 4LD0A 2X6SA 4YFUA 3D0PA 1TK0A 4W5QA 5CR4A 2Q97A 5HBMA 4FLZA 3NGZA 4BE0A 2QWQA 1GLAG 2Q0UA 1VSHA 5FROA 3AO3A 3KK3A 1VRUA 3U8XA 5C24A 1VQ9N 3LP2A 3O8MA 2OTLN 2P9LA 1L3UA 3TSPA 4MO5A 2P9IA 1SKRA 4LF8K 1XI1A 4FM2A 1WSEA 2P9KB 3W0LA 1V4SA 1NK4A 1I94K 4CZLA 4LSLA 3ZEUB 1YVNA 1OH8A 5GAHP 2E5LK 3IDHA 1KVCA 1TKZA 1GLJO 2W6KA 3AVBA 3ZX3A 4CHNA 4WE1A 3SAHA 4DV7K 4E1JA 3T69A 5CHIA 1TVRA 2O8DA 1M1KO 1NK0A 3VERA 1RTIA 1XQSC 1ZBFA 2UUAK 5FPMA 4A57A 4IKFA 5KI6A 3ZT0A 4PL7A 1UA1A 2IVPA 4CZHA 1CZBA 4DWIA 2E1ZA 4A59A 4KB1A 2Q36A 1YI2N 5FRMA 4E7KA 1VHXA 4EAHD 3OYLA 3QIPA 3O3HA 4M3UA 5AQMA 2RKIA 1LW2A 4B9QA 3MAQA 3I56N 4M3YA 3LALA 1KQSM 2A6AA 2UU9K 4FK4A 1BU6O 4FWRA 3R9PA 4DR7K 3MN7A 1HKBA 3ZX0A 3QIOA 1J5OA 1C6VA 1HMVA 4DKWA 1GOBA 3E01A 2LSNA 4XIUA 3VESA 1ASUA 2QI2A 4JKAA 4DSIA 1T6DA 3ZT2A 3TAFA 4RTFD 4BROA 2PAVA 4H4MA 2FBTA 1GLEG 2QKBA 3P39A 3A0IX 2YI1A 2V7YA 3OW2M 1QE1A 3ATUA 1QQMA 2HHSA 4FVUA 3E9OA 1DGKN 4LF5K 3BDPA 4Z4CA 5LJWA 3ALYA 2UXCK 3R3LA 2VWJA 4CJVA 4M3WA 1KAZA 3ULEA 4FWLA 3KWIA 4BC5A 4CF0A 4NCGA 1ZBIA 1W2BM 1RDUA 4OKKA 4OPAA 3SUQA 5KPRA 4C23A 4EHUA 1U47A 2G8HA 4HUEA 3H1VX 1T7PA 4DTNA 4FWOA 3HPOA 2ZJPL 1ATRA 3MN5A 2O8EB 3KLGA 3CI5A 5EU7A 4Y1DA 2RF2A 4GV3A 1CZ9A 1QTMA 4FZYA 4FJJA 3H1QA 4YOXA 4PWDA 3VA3A 3THXB 3OA9A 1EETA 4NCBA 1IG9A 1WSFA 3AVGA 4GV9A 4KKOA 5B8HA 4KFBA 3AVIA 3D2FB 3DLEA 4FSVA 4CBUA 1EO1A 1KVAA 3R6MA 3B6OA 1IH7A 5JS1A 4JI5K 3HM8A 3KK2A 1QS4A 1RTHA 3K58A 3AVLA 3TABA 1NBWA 2DTUA 3UE5A 1RT3A 4WQ4A 2P9KA 3ZT4A 4FJXA 3O80A 1VQMN 3ZEUA 3CD6N 3C6HA 2P5OA 1VQKN 4MDBA 2VCPA 1KXPA 1UAXA 3VEVA 3TR8A 3VTHA 3IUCA 3MXIA 3J7AP 3NGYA 1LWCA 3K9KA 3CPEA 5HL7L 1Q9XA 1NGJA 3L6QA 3DMJA 3VGMA 4NB4A 3NVMA 1JCEA 5GIOA 4RW4A 4MQ3A 1SL2A 3KD1E 3WXKA 1YAGA 4EHTA 3CETA 1S5JA 4CGIA 4FO0A 2FSNA 5AQSA 4KH4A 4FJNA 1ZBHA 5AQLA 4BGAA
chains in the Genus database with same CATH topology
4OJRA 1RT4A 3V6DA 4JS4A 1VSDA 5HRPA 4DTRA 1RBRA 4JRQA 1KLNA 2BGGA 2XY8A 3NF8A 3D45A 4O5BA 5J2MA 4J2EA 4PY5A 3TAPA 3RMBA 1TKDA 4DQRA 1C1CA 3T1AA 4KREA 2OPPA 1JLGA 3AVAA 4OGEA 2G8WA 2XRIA 1QSYA 3HP6A 1TGOA 1FXXA 1ZBUA 4M41A 1N5YA 3CYMA 1X1PA 4KHWA 1YVUA 1C1BA 4CJEA 2HW3A 4BWMA 4CGFA 2OPQA 4OPJA 4PA1A 4NCAA 4FLYA 2IS3A 1EP4A 4BE1A 3CG7A 2Y1IA 4F3TA 3ZSVA 2X78A 4J2BA 1QHTA 2E6LA 3QEIA 2HVHA 3PO4A 2B6AA 4DTUA 4C8LA 5SZTA 2OZSA 4M3ZA 4H4OA 3AO1A 1WNSA 3LPTA 1TKXA 4E19A 3VQQA 4CGJA 1LV5A 4E89A 3WNEA 2G8UA 1WSGA 2P51A 3ZSYA 3I8DA 2XY7A 3SQ4A 1SL0A 4DFKA 3QEWA 1D8YA 4OGCA 3VQ8A 1VSJA 4CEDA 4IFYA 3KIOA 4AH9A 3OYBA 4OKJA 3LP0A 2HNYA 3NDKA 3DM2A 4BDZA 4CCHA 1D9DA 1XC9A 2JGUA 4CHOA 1U45A 4K8XA 1ZBLA 1BL3A 4M3XA 3TANA 4L8RB 1EX4A 4CEAA 1S6QA 4CHQA 4EZ6A 3SQ1A 3SPZA 3WNGA 2GBZA 2KZZA 5J2PA 4CHZA 3S3MA 1XHXA 4ICLA 1SL1A 3JSMA 3S3NA 1RILA 1TV6A 3IRXA 4CJUA 3DOKA 4E3SA 1J9AA 1L3TA 1XHZA 4DF4A 1JXBA 3OYAA 4KB0A 2HMIA 5HROA 4OLBA 4FZXC 3CM5A 3OYJA 3DOLA 4IFVA 3V9UA 2FBVA 3CFOA 1J53A 3NBPA 5HRRA 1TK5A 3U3YA 3NE6A 5J2QA 1D9FA 1D5AA 3LP1A 1NK8A 2DFEA 5KTQA 4KI6A 5FDLA 4B8CA 2ETJA 2O4GA 3SQ2A 3LPUA 1FKPA 1RNHA 1S1TA 1S6PA 3DYAA 4CK2A 4J2DA 4TSXA 4LSNA 3ZCMA 2F96A 4E1NA 1SUQA 3U3GA 1LWEA 4DTOA 2BDPA 3MECA 3KLEA 1LAVA 4JRPA 4FJ7A 3P5JA 2KW4A 4GW6A 4CFDA 1NKBA 3DRRA 1VSKA 3OJSA 3K2PA 3ZSQA 1JKHA 2PYJA 4FLVA 2Z1IA 3L2WA 3AVCA 4I7FA 3MXJA 3NFAA 4N47A 4DS4A 3RR7A 4KHQA 3EYZA 3RRGA 3NHGA 1A5WA 1B9DA 2DFHA 4LH5A 4RW8A 3SNNA 4DSKA 3DI6A 3SCXA 4FJ9A 2ZD1A 4FJ5A 1KVBA 2B4JA 1JLQA 4NYFA 1RCHA 3VQ4A 5KRTA 2YNGA 3AO2A 1HNVA 2D0BA 2YKMA 3OYGA 1S1UA 3F73A 3NAEA 1NOZA 1HQEA 4O55A 2OZMA 4IDKA 4CEQA 5CY4A 2ZQBA 4CJTA 1CLQA 2HVIA 4ZTFA 3OYNA 3QINA 3O3FA 4ELUA 2D5RA 2FC0A 4W5RA 4CJSA 4CEZA 4FCYA 3L3UA 3I0SA 4DSEA 4K8ZA 1A5XA 4HVJA 4QAGA 3HYFA 4DLGA 4Z4GA 4OVLA 4LH4A 3DLRA 3RRHA 3K5MA 2JLEA 4M3TA 1LAWA 1KRPA 4CGDA 1TAUA 3TAGA 1X9WA 2OYQA 3AV9A 3OVNA 4CHYA 1RT2A 5KGWA 3DRSA 3ZT1A 3L2RA 3KLFA 4B9SA 1RDDA 3VN5A 1CXQA 2OPRA 3VQ5A 5I3UA 1SV5A 2GV9A 4AHVA 4UQGA 2A1SA 4FJKA 3K5OA 1BQNA 2BANA 1NKEA 5T7BA 4O0IA 4H8KA 4DQIA 4KTQA 3KKSA 4E7IA 3THVA 1KSPA 5D3GA 4KV8A 3QNOA 3L3VA 4FXDA 3SJJA 1G15A 1UA0A 2VG5A 1JL2A 4FK0A 4CJ4A 4JS5A 3RTVA 4DQQA 4DSFA 4AHTA 4IG0A 4FJLA 2KQ2A 2B5JA 4CJPA 1QSSA 1WLJA 2HNDA 4JLHA 1X9SA 4DU1A 4DF8A 1VSFA 1T05A 4HUGA 1HYVA 4EP4A 4AHRA 1WAJA 1RDCA 2F8TA 3A2FA 1B9FA 1O1WA 4FM1A 3KK1A 3PX6A 1L3VA 1RBSA 4BE2A 2QKKA 1JLFA 4CJ3A 4KI4A 3MEDA 4R5PA 4E7LA 3QEPA 3AVMA 3CM6A 3NF6A 4DFMA 3MXMA 4BDPA 4F3OA 5KRSA 3LWMA 4PQUA 2HHXA 4I9LA 4CHPA 3QEXA 4OKEA 3PV8A 2OPSA 4ZTJA 4O4GA 4EZ9A 2ATQA 4CIEA 3OYDA 1DTTA 4KPYA 4F2RA 3LAKA 4N5SA 1K6YA 2FBXA 4FLWA 5C42A 3OYMA 4LY7A 3JYTA 2YHAA 1BI4B 3C6TA 2WOMA 3OYHA 1ASWA 2E6MA 4BACA 1NK0A 4YNQA 2AJQA 3RMCA 3OS0A 3ASMA 4CJLA 1RT7A 4KO0A 3OY9A 3HJFA 3AVJA 3V1OA 3OYCA 2QK9A 4F2SA 1Z25A 4N56A 5E41A 2X74A 5CZ2A 1KTQA 3VQEA 3O3GA 4FW1A 1NK5A 4PUOA 2A1RA 2HHUA 1L5UA 3QERA 3AA5X 4DTMA 4KHUA 4CERA 4B9LA 4W5NA 2VWKA 2YHBA 2YNIA 4FVMA 1VSMA 3NH0A 3HXMA 1WN7A 2E4LA 3DLGA 3SZ2A 4I9QA 1C0UA 4FJMA 4CK3A 4FJIA 4CJRA 4FK2A 4CK1A 2HNZA 3AVNA 4DMNA 2HHWA 4DSJA 3HK2A 1RT6A 4B9UA 1Z26A 1KFDA 4BDYA 4DS5A 1C1AA 1IKWA 4BWJA 1VRTA 3TAQA 4DG1A 3V9SA 4CE9A 1MU2A 4DTPA 3NH1A 1RBVA 3QEVA 4B9MA 2HHVA 3LANA 1NK7A 2PZSA 2Z1GA 2G8KA 3DLHA 3VQCA 1JLCA 4CEOA 4EP5A 1BIUA 3TAEA 4Z4FA 3OS1A 4RW6A 4DFPA 2R7YA 3HO1A 3IAYA 1U04A 4HCCA 5DMRA 3HT3A 4DFJA 5CYQA 4QOZB 2ZE2A 2G8IA 4FZZA 1JLEA 3VQPA 1BQMA 5C25A 4OPKA 4Z4EA 1R0AA 1YT3A 4J2AA 1RTDA 4LD0A 4E7HA 2X6SA 1BCOA 3RMAA 3AO4A 3KLIA 4YFUA 3SYZA 4KHNA 1WSJA 3AVHA 3D0PA 4ELVA 1TK0A 1IKVA 4N41A 4M45A 3M8PA 1S1XA 4W5QA 1S1VA 4M42A 3HPGA 1VK0A 4ID1A 1I39A 3M8QA 4GVMA 5HBMA 4FLZA 3NGZA 1SKWA 4BE0A 4CF9A 3P83D 4MFBA 4OLAA 5CZ1A 1VSHA 2IC3A 5FROA 3AO3A 1ASVA 3KK3A 1VRUA 3VQBA 3EY1A 3NCIA 1SKSA 1JLAA 5DK5A 1NJZA 4C8OA 4RG8A 3AA2A 4RW7A 2IOCA 1BGXT 3AO5A 1S9EA 5C24A 2IGIA 3RWUA 4C8NA 4FJHA 3LP2A 4DTSA 3RR8A 3BGRA 4CF8A 1L3UA 5KGXA 2RN2A 1L3SA 4CFCA 2XY5A 4ELTA 1SKRA 3VA0A 1DTQA 2GUIA 4AHSA 1XI1A 4FM2A 4HCBA 1GOCA 1WSEA 4CIFA 4W5OA 2Z1JA 3LZJA 2P5GA 1RBTA 2BE2A 3HPHA 3IS9A 1KLMA 1NK4A 1U48A 4LSLA 5J2NA 3LDSA 3MEGA 3HSTB 4I2PA 5HRNA 1ZYQA 3NGIA 2EX3A 1KVCA 1TKZA 3AVBA 4CHNA 4WE1A 3NF7A 4CIGA 2QXFA 3OJUA 4Z4HA 3TI0A 1VSEA 3ISNC 5HP1A 1CXUA 3QLHA 1TVRA 3WNHA 3LP3A 1JLBA 2XY6A 3G10A 3IG1A 4FLUA 3PX4A 3S9HA 1RTIA 3QESA 3T19A 1X9MA 3DLBA 2NUBA 4CECA 4HHTA 1ZBFA 4KAZA 4IKFA 5KI6A 3ZT0A 2XO7A 3O4QA 1RBUA 4CEEA 4CF1A 3L2QA 1TK8A 1QQCA 4DU4A 4DU3A 1UA1A 3HL8A 3V81A 4B08A 2EHGA 1CZBA 1BIZA 3K5LA 1EKEA 5I42A 4DWIA 4CEBA 1GOAA 5J1EA 1HPZA 4KB1A 3SUOA 2HB5A 5FRMA 1UOCA 3LAMA 4E7KA 3OYLA 3QIPA 3NH2A 1T8EA 3O3HA 4M3UA 4C8KA 2RKIA 1TKTA 1LW2A 3MAQA 3L2VA 4FM0A 2HHTA 3UIQA 2HHQA 3VQAA 3I0RA 4M3YA 5K14A 3LALA 3SV4A 1EXQA 1FKOA 2VG7A 3TWHA 3OYFA 4CJWA 1KCFA 4FK4A 1BCMA 3V9WA 4O44A 1Q8IA 4B9NA 3QIOA 1J5OA 1C6VA 4CF2A 1HMVA 1F21A 1GOBA 2IDOA 3E01A 2LSNA 2Q3SA 3ZSXA 4XIUA 1ASUA 3TARA 4DSIA 2DFFA 3KKRA 3OYKA 4F4KA 3ZT2A 1JL1A 4KHYA 3TAFA 3AA4A 1BI4A 3PX0A 4H4MA 4E0DA 4CJQA 1W9HA 5FRNA 4AILC 2FBTA 3SV3A 2QKBA 3KD5E 1HNIA 3H08A 1RT1A 4DTJA 1LW0A 1QE1A 3F9KA 3CFPA 1NK9A 2HHSA 3NF9A 3SUPA 4QCLA 4E7JA 3KTQA 3BDPA 4Z4CA 2D0CA 3VQDA 4FJ8A 2YNHA 1C0TA 3ALYA 3P1GA 3L8BA 1NOYA 3MEEA 2VWJA 4IG3A 3KJVA 4CJVA 4GMJB 3ULDA 4M3WA 1LWFA 4CF0A 1REVA 3VQ6A 4NCGA 4N76A 2DY4A 3C6UA 1ZBIA 3HP9A 1S9GA 3SUQA 4OKKA 1NJWA 1NKCA 1VSLA 1U47A 3PY8A 1JXEA 4CFAA 3M8SA 4CJ5A 2G8HA 1IO2A 4E1MA 1IKYA 1S1WA 4HUEA 2XHBA 4DTNA 3HPOA 1Q9YA 1T7PA 4AHUA 3PO5A 1Y97A 4B3OA 2KTQA 1ITGA 1TL1A 4CEFA 3KLGA 5JS2A 1FK9A 2D0AA 3C95A 5EU7A 4FW2A 4Q5VA 4DTXA 4Y1DA 4FLTA 2RF2A 3AVFA 1CZ9A 3OYIA 3T3FA 3ITHA 3TAMA 2G8VA 4HUFA 4M3RA 1QTMA 3SI6A 1T03A 4CGGA 1IKXA 2YNFA 3HM9A 2RPIA 3SPYA 1BISA 4FZYA 4FJJA 1NJXA 3B6PA 3VA3A 4PWDA 3FFIA 1EETA 4KTZA 4DSLA 1YTUA 4NCBA 2KZMA 4Z4IA 1IG9A 1HJRA 1WSFA 1WAFA 1TL3A 3AVGA 3OS2A 3O4NA 4KKOA 1RDBA 4I2QA 4KFBA 4RW9A 4Z0UA 3AVIA 4ID5A 1RDAA 4IBNA 3CQ8A 3K59A 4KTWA 2W42A 3K57A 2VG6A 3V1RA 4CFBA 2PYLA 3DLEA 1UWBA 2KFNA 3DLKA 1WSHA 3SUNA 2G8FA 4C8MA 2FBYA 3M8RA 1YTAA 1I3AA 1HYSA 4DLEA 3ZSWA 3WNFA 4ZHRA 1U4BA 1KVAA 4B9TA 3LZIA 3QNNA 3AVKA 1B92A 1IH7A 3B6OA 5JS1A 3KK2A 3V9XA 1NK6A 4CESA 4Q0BA 3V4IA 1QS4A 3G0ZA 4FLXA 1RTHA 3K58A 3AVLA 1XWLA 4G1QA 4CJKA 3QETA 3TABA 2DTUA 4FJGA 2ITGA 3HVRA 3CFRA 1RT3A 1QSLA 4NYNA 4CGHA 1KFSA 2Z1HA 2KFZA 2P1JA 3PUFA 4O0JA 3ZT4A 4FJXA 4B9VA 4B8AB 3LWLA 2P5OA 5HLFA 3V9ZA 1C0MA 3ZSZA 3L2UA 1BHLA 3EZ5A 3RMDA 3U6FA 4AHCA 1RT5A 1UAXA 2WONA 1TAQA 3TR8A 2YKNA 3ZT3A 2F8SA 3VQ7A 3MXIA 1WSIA 2OA8A 4DQPA 4F8RA 2YV0X 3NGYA 1LWCA 1A5VA 2X6NA 1Q9XA 1RTJA 3S3OA 2PY5A 3DMJA 3ZSOA 1N6QA 4KHSA 1J54A 5SWMA 1NJYA 3VQ9A 1HYZA 3C94A 4RW4A 4MQ3A 2IAJA 1SL2A 4W5TA 5CYMA 3QO9A 3K5NA 4DQSA 3KD1E 3KLHA 4Y1CA 4HTUA 1DLOA 3HVTA 3DRPA 4CJFA 1S5JA 4CGIA 2O4IA 3AA3A 4KRFA 1W0HA 3SQ0A 1HRHA 3V1QA 5HRSA 2Y1JA 3ZSRA 1HQUA 3OYEA 2I5JA 4FJNA 1ZBHA 1U49A 1VSIA 4FYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJR A;  1RT4 A;  3V6D A;  4JS4 A;  1VSD A;  5HRP A;  4DTR A;  1RBR A;  4JRQ A;  1KLN A;  2BGG A;  2XY8 A;  3NF8 A;  3D45 A;  4O5B A;  5J2M A;  4J2E A;  4PY5 A;  3TAP A;  3RMB A;  1TKD A;  4DQR A;  1C1C A;  3T1A A;  4KRE A;  2OPP A;  1JLG A;  3AVA A;  4OGE A;  2G8W A;  2XRI A;  1QSY A;  3HP6 A;  1TGO A;  1FXX A;  1ZBU A;  4M41 A;  1N5Y A;  3CYM A;  1X1P A;  4KHW A;  1YVU A;  1C1B A;  4CJE A;  2HW3 A;  4BWM A;  4CGF A;  2OPQ A;  4OPJ A;  4PA1 A;  4NCA A;  4FLY A;  2IS3 A;  1EP4 A;  4BE1 A;  3CG7 A;  2Y1I A;  4F3T A;  3ZSV A;  2X78 A;  4J2B A;  1QHT A;  2E6L A;  3QEI A;  2HVH A;  3PO4 A;  2B6A A;  4DTU A;  4C8L A;  5SZT A;  2OZS A;  4M3Z A;  4H4O A;  3AO1 A;  1WNS A;  3LPT A;  1TKX A;  4E19 A;  3VQQ A;  4CGJ A;  1LV5 A;  4E89 A;  3WNE A;  2G8U A;  1WSG A;  2P51 A;  3ZSY A;  3I8D A;  2XY7 A;  3SQ4 A;  1SL0 A;  4DFK A;  3QEW A;  1D8Y A;  4OGC A;  3VQ8 A;  1VSJ A;  4CED A;  4IFY A;  3KIO A;  4AH9 A;  3OYB A;  4OKJ A;  3LP0 A;  2HNY A;  3NDK A;  3DM2 A;  4BDZ A;  4CCH A;  1D9D A;  1XC9 A;  2JGU A;  4CHO A;  1U45 A;  4K8X A;  1ZBL A;  1BL3 A;  4M3X A;  3TAN A;  4L8R B;  1EX4 A;  4CEA A;  1S6Q A;  4CHQ A;  4EZ6 A;  3SQ1 A;  3SPZ A;  3WNG A;  2GBZ A;  2KZZ A;  5J2P A;  4CHZ A;  3S3M A;  1XHX A;  4ICL A;  1SL1 A;  3JSM A;  3S3N A;  1RIL A;  1TV6 A;  3IRX A;  4CJU A;  3DOK A;  4E3S A;  1J9A A;  1L3T A;  1XHZ A;  4DF4 A;  1JXB A;  3OYA A;  4KB0 A;  2HMI A;  5HRO A;  4OLB A;  4FZX C;  3CM5 A;  3OYJ A;  3DOL A;  4IFV A;  3V9U A;  2FBV A;  3CFO A;  1J53 A;  3NBP A;  5HRR A;  1TK5 A;  3U3Y A;  3NE6 A;  5J2Q A;  1D9F A;  1D5A A;  3LP1 A;  1NK8 A;  2DFE A;  5KTQ A;  4KI6 A;  5FDL A;  4B8C A;  2ETJ A;  2O4G A;  3SQ2 A;  3LPU A;  1FKP A;  1RNH A;  1S1T A;  1S6P A;  3DYA A;  4CK2 A;  4J2D A;  4TSX A;  4LSN A;  3ZCM A;  2F96 A;  4E1N A;  1SUQ A;  3U3G A;  1LWE A;  4DTO A;  2BDP A;  3MEC A;  3KLE A;  1LAV A;  4JRP A;  4FJ7 A;  3P5J A;  2KW4 A;  4GW6 A;  4CFD A;  1NKB A;  3DRR A;  1VSK A;  3OJS A;  3K2P A;  3ZSQ A;  1JKH A;  2PYJ A;  4FLV A;  2Z1I A;  3L2W A;  3AVC A;  4I7F A;  3MXJ A;  3NFA A;  4N47 A;  4DS4 A;  3RR7 A;  4KHQ A;  3EYZ A;  3RRG A;  3NHG A;  1A5W A;  1B9D A;  2DFH A;  4LH5 A;  4RW8 A;  3SNN A;  4DSK A;  3DI6 A;  3SCX A;  4FJ9 A;  2ZD1 A;  4FJ5 A;  1KVB A;  2B4J A;  1JLQ A;  4NYF A;  1RCH A;  3VQ4 A;  5KRT A;  2YNG A;  3AO2 A;  1HNV A;  2D0B A;  2YKM A;  3OYG A;  1S1U A;  3F73 A;  3NAE A;  1NOZ A;  1HQE A;  4O55 A;  2OZM A;  4IDK A;  4CEQ A;  5CY4 A;  2ZQB A;  4CJT A;  1CLQ A;  2HVI A;  4ZTF A;  3OYN A;  3QIN A;  3O3F A;  4ELU A;  2D5R A;  2FC0 A;  4W5R A;  4CJS A;  4CEZ A;  4FCY A;  3L3U A;  3I0S A;  4DSE A;  4K8Z A;  1A5X A;  4HVJ A;  4QAG A;  3HYF A;  4DLG A;  4Z4G A;  4OVL A;  4LH4 A;  3DLR A;  3RRH A;  3K5M A;  2JLE A;  4M3T A;  1LAW A;  1KRP A;  4CGD A;  1TAU A;  3TAG A;  1X9W A;  2OYQ A;  3AV9 A;  3OVN A;  4CHY A;  1RT2 A;  5KGW A;  3DRS A;  3ZT1 A;  3L2R A;  3KLF A;  4B9S A;  1RDD A;  3VN5 A;  1CXQ A;  2OPR A;  3VQ5 A;  5I3U A;  1SV5 A;  2GV9 A;  4AHV A;  4UQG A;  2A1S A;  4FJK A;  3K5O A;  1BQN A;  2BAN A;  1NKE A;  5T7B A;  4O0I A;  4H8K A;  4DQI A;  4KTQ A;  3KKS A;  4E7I A;  3THV A;  1KSP A;  5D3G A;  4KV8 A;  3QNO A;  3L3V A;  4FXD A;  3SJJ A;  1G15 A;  1UA0 A;  2VG5 A;  1JL2 A;  4FK0 A;  4CJ4 A;  4JS5 A;  3RTV A;  4DQQ A;  4DSF A;  4AHT A;  4IG0 A;  4FJL A;  2KQ2 A;  2B5J A;  4CJP A;  1QSS A;  1WLJ A;  2HND A;  4JLH A;  1X9S A;  4DU1 A;  4DF8 A;  1VSF A;  1T05 A;  4HUG A;  1HYV A;  4EP4 A;  4AHR A;  1WAJ A;  1RDC A;  2F8T A;  3A2F A;  1B9F A;  1O1W A;  4FM1 A;  3KK1 A;  3PX6 A;  1L3V A;  1RBS A;  4BE2 A;  2QKK A;  1JLF A;  4CJ3 A;  4KI4 A;  3MED A;  4R5P A;  4E7L A;  3QEP A;  3AVM A;  3CM6 A;  3NF6 A;  4DFM A;  3MXM A;  4BDP A;  4F3O A;  5KRS A;  3LWM A;  4PQU A;  2HHX A;  4I9L A;  4CHP A;  3QEX A;  4OKE A;  3PV8 A;  2OPS A;  4ZTJ A;  4O4G A;  4EZ9 A;  2ATQ A;  4CIE A;  3OYD A;  1DTT A;  4KPY A;  4F2R A;  3LAK A;  4N5S A;  1K6Y A;  2FBX A;  4FLW A;  5C42 A;  3OYM A;  4LY7 A;  3JYT A;  2YHA A;  1BI4 B;  3C6T A;  2WOM A;  3OYH A;  1ASW A;  2E6M A;  4BAC A;  1NK0 A;  4YNQ A;  2AJQ A;  3RMC A;  3OS0 A;  3ASM A;  4CJL A;  1RT7 A;  4KO0 A;  3OY9 A;  3HJF A;  3AVJ A;  3V1O A;  3OYC A;  2QK9 A;  4F2S A;  1Z25 A;  4N56 A;  5E41 A;  2X74 A;  5CZ2 A;  1KTQ A;  3VQE A;  3O3G A;  4FW1 A;  1NK5 A;  4PUO A;  2A1R A;  2HHU A;  1L5U A;  3QER A;  3AA5 X;  4DTM A;  4KHU A;  4CER A;  4B9L A;  4W5N A;  2VWK A;  2YHB A;  2YNI A;  4FVM A;  1VSM A;  3NH0 A;  3HXM A;  1WN7 A;  2E4L A;  3DLG A;  3SZ2 A;  4I9Q A;  1C0U A;  4FJM A;  4CK3 A;  4FJI A;  4CJR A;  4FK2 A;  4CK1 A;  2HNZ A;  3AVN A;  4DMN A;  2HHW A;  4DSJ A;  3HK2 A;  1RT6 A;  4B9U A;  1Z26 A;  1KFD A;  4BDY A;  4DS5 A;  1C1A A;  1IKW A;  4BWJ A;  1VRT A;  3TAQ A;  4DG1 A;  3V9S A;  4CE9 A;  1MU2 A;  4DTP A;  3NH1 A;  1RBV A;  3QEV A;  4B9M A;  2HHV A;  3LAN A;  1NK7 A;  2PZS A;  2Z1G A;  2G8K A;  3DLH A;  3VQC A;  1JLC A;  4CEO A;  4EP5 A;  1BIU A;  3TAE A;  4Z4F A;  3OS1 A;  4RW6 A;  4DFP A;  2R7Y A;  3HO1 A;  3IAY A;  1U04 A;  4HCC A;  5DMR A;  3HT3 A;  4DFJ A;  5CYQ A;  4QOZ B;  2ZE2 A;  2G8I A;  4FZZ A;  1JLE A;  3VQP A;  1BQM A;  5C25 A;  4OPK A;  4Z4E A;  1R0A A;  1YT3 A;  4J2A A;  1RTD A;  4LD0 A;  4E7H A;  2X6S A;  1BCO A;  3RMA A;  3AO4 A;  3KLI A;  4YFU A;  3SYZ A;  4KHN A;  1WSJ A;  3AVH A;  3D0P A;  4ELV A;  1TK0 A;  1IKV A;  4N41 A;  4M45 A;  3M8P A;  1S1X A;  4W5Q A;  1S1V A;  4M42 A;  3HPG A;  1VK0 A;  4ID1 A;  1I39 A;  3M8Q A;  4GVM A;  5HBM A;  4FLZ A;  3NGZ A;  1SKW A;  4BE0 A;  4CF9 A;  3P83 D;  4MFB A;  4OLA A;  5CZ1 A;  1VSH A;  2IC3 A;  5FRO A;  3AO3 A;  1ASV A;  3KK3 A;  1VRU A;  3VQB A;  3EY1 A;  3NCI A;  1SKS A;  1JLA A;  5DK5 A;  1NJZ A;  4C8O A;  4RG8 A;  3AA2 A;  4RW7 A;  2IOC A;  1BGX T;  3AO5 A;  1S9E A;  5C24 A;  2IGI A;  3RWU A;  4C8N A;  4FJH A;  3LP2 A;  4DTS A;  3RR8 A;  3BGR A;  4CF8 A;  1L3U A;  5KGX A;  2RN2 A;  1L3S A;  4CFC A;  2XY5 A;  4ELT A;  1SKR A;  3VA0 A;  1DTQ A;  2GUI A;  4AHS A;  1XI1 A;  4FM2 A;  4HCB A;  1GOC A;  1WSE A;  4CIF A;  4W5O A;  2Z1J A;  3LZJ A;  2P5G A;  1RBT A;  2BE2 A;  3HPH A;  3IS9 A;  1KLM A;  1NK4 A;  1U48 A;  4LSL A;  5J2N A;  3LDS A;  3MEG A;  3HST B;  4I2P A;  5HRN A;  1ZYQ A;  3NGI A;  2EX3 A;  1KVC A;  1TKZ A;  3AVB A;  4CHN A;  4WE1 A;  3NF7 A;  4CIG A;  2QXF A;  3OJU A;  4Z4H A;  3TI0 A;  1VSE A;  3ISN C;  5HP1 A;  1CXU A;  3QLH A;  1TVR A;  3WNH A;  3LP3 A;  1JLB A;  2XY6 A;  3G10 A;  3IG1 A;  4FLU A;  3PX4 A;  3S9H A;  1RTI A;  3QES A;  3T19 A;  1X9M A;  3DLB A;  2NUB A;  4CEC A;  4HHT A;  1ZBF A;  4KAZ A;  4IKF A;  5KI6 A;  3ZT0 A;  2XO7 A;  3O4Q A;  1RBU A;  4CEE A;  4CF1 A;  3L2Q A;  1TK8 A;  1QQC A;  4DU4 A;  4DU3 A;  1UA1 A;  3HL8 A;  3V81 A;  4B08 A;  2EHG A;  1CZB A;  1BIZ A;  3K5L A;  1EKE A;  5I42 A;  4DWI A;  4CEB A;  1GOA A;  5J1E A;  1HPZ A;  4KB1 A;  3SUO A;  2HB5 A;  5FRM A;  1UOC A;  3LAM A;  4E7K A;  3OYL A;  3QIP A;  3NH2 A;  1T8E A;  3O3H A;  4M3U A;  4C8K A;  2RKI A;  1TKT A;  1LW2 A;  3MAQ A;  3L2V A;  4FM0 A;  2HHT A;  3UIQ A;  2HHQ A;  3VQA A;  3I0R A;  4M3Y A;  5K14 A;  3LAL A;  3SV4 A;  1EXQ A;  1FKO A;  2VG7 A;  3TWH A;  3OYF A;  4CJW A;  1KCF A;  4FK4 A;  1BCM A;  3V9W A;  4O44 A;  1Q8I A;  4B9N A;  3QIO A;  1J5O A;  1C6V A;  4CF2 A;  1HMV A;  1F21 A;  1GOB A;  2IDO A;  3E01 A;  2LSN A;  2Q3S A;  3ZSX A;  4XIU A;  1ASU A;  3TAR A;  4DSI A;  2DFF A;  3KKR A;  3OYK A;  4F4K A;  3ZT2 A;  1JL1 A;  4KHY A;  3TAF A;  3AA4 A;  1BI4 A;  3PX0 A;  4H4M A;  4E0D A;  4CJQ A;  1W9H A;  5FRN A;  4AIL C;  2FBT A;  3SV3 A;  2QKB A;  3KD5 E;  1HNI A;  3H08 A;  1RT1 A;  4DTJ A;  1LW0 A;  1QE1 A;  3F9K A;  3CFP A;  1NK9 A;  2HHS A;  3NF9 A;  3SUP A;  4QCL A;  4E7J A;  3KTQ A;  3BDP A;  4Z4C A;  2D0C A;  3VQD A;  4FJ8 A;  2YNH A;  1C0T A;  3ALY A;  3P1G A;  3L8B A;  1NOY A;  3MEE A;  2VWJ A;  4IG3 A;  3KJV A;  4CJV A;  4GMJ B;  3ULD A;  4M3W A;  1LWF A;  4CF0 A;  1REV A;  3VQ6 A;  4NCG A;  4N76 A;  2DY4 A;  3C6U A;  1ZBI A;  3HP9 A;  1S9G A;  3SUQ A;  4OKK A;  1NJW A;  1NKC A;  1VSL A;  1U47 A;  3PY8 A;  1JXE A;  4CFA A;  3M8S A;  4CJ5 A;  2G8H A;  1IO2 A;  4E1M A;  1IKY A;  1S1W A;  4HUE A;  2XHB A;  4DTN A;  3HPO A;  1Q9Y A;  1T7P A;  4AHU A;  3PO5 A;  1Y97 A;  4B3O A;  2KTQ A;  1ITG A;  1TL1 A;  4CEF A;  3KLG A;  5JS2 A;  1FK9 A;  2D0A A;  3C95 A;  5EU7 A;  4FW2 A;  4Q5V A;  4DTX A;  4Y1D A;  4FLT A;  2RF2 A;  3AVF A;  1CZ9 A;  3OYI A;  3T3F A;  3ITH A;  3TAM A;  2G8V A;  4HUF A;  4M3R A;  1QTM A;  3SI6 A;  1T03 A;  4CGG A;  1IKX A;  2YNF A;  3HM9 A;  2RPI A;  3SPY A;  1BIS A;  4FZY A;  4FJJ A;  1NJX A;  3B6P A;  3VA3 A;  4PWD A;  3FFI A;  1EET A;  4KTZ A;  4DSL A;  1YTU A;  4NCB A;  2KZM A;  4Z4I A;  1IG9 A;  1HJR A;  1WSF A;  1WAF A;  1TL3 A;  3AVG A;  3OS2 A;  3O4N A;  4KKO A;  1RDB A;  4I2Q A;  4KFB A;  4RW9 A;  4Z0U A;  3AVI A;  4ID5 A;  1RDA A;  4IBN A;  3CQ8 A;  3K59 A;  4KTW A;  2W42 A;  3K57 A;  2VG6 A;  3V1R A;  4CFB A;  2PYL A;  3DLE A;  1UWB A;  2KFN A;  3DLK A;  1WSH A;  3SUN A;  2G8F A;  4C8M A;  2FBY A;  3M8R A;  1YTA A;  1I3A A;  1HYS A;  4DLE A;  3ZSW A;  3WNF A;  4ZHR A;  1U4B A;  1KVA A;  4B9T A;  3LZI A;  3QNN A;  3AVK A;  1B92 A;  1IH7 A;  3B6O A;  5JS1 A;  3KK2 A;  3V9X A;  1NK6 A;  4CES A;  4Q0B A;  3V4I A;  1QS4 A;  3G0Z A;  4FLX A;  1RTH A;  3K58 A;  3AVL A;  1XWL A;  4G1Q A;  4CJK A;  3QET A;  3TAB A;  2DTU A;  4FJG A;  2ITG A;  3HVR A;  3CFR A;  1RT3 A;  1QSL A;  4NYN A;  4CGH A;  1KFS A;  2Z1H A;  2KFZ A;  2P1J A;  3PUF A;  4O0J A;  3ZT4 A;  4FJX A;  4B9V A;  4B8A B;  3LWL A;  2P5O A;  5HLF A;  3V9Z A;  1C0M A;  3ZSZ A;  3L2U A;  1BHL A;  3EZ5 A;  3RMD A;  3U6F A;  4AHC A;  1RT5 A;  1UAX A;  2WON A;  1TAQ A;  3TR8 A;  2YKN A;  3ZT3 A;  2F8S A;  3VQ7 A;  3MXI A;  1WSI A;  2OA8 A;  4DQP A;  4F8R A;  2YV0 X;  3NGY A;  1LWC A;  1A5V A;  2X6N A;  1Q9X A;  1RTJ A;  3S3O A;  2PY5 A;  3DMJ A;  3ZSO A;  1N6Q A;  4KHS A;  1J54 A;  5SWM A;  1NJY A;  3VQ9 A;  1HYZ A;  3C94 A;  4RW4 A;  4MQ3 A;  2IAJ A;  1SL2 A;  4W5T A;  5CYM A;  3QO9 A;  3K5N A;  4DQS A;  3KD1 E;  3KLH A;  4Y1C A;  4HTU A;  1DLO A;  3HVT A;  3DRP A;  4CJF A;  1S5J A;  4CGI A;  2O4I A;  3AA3 A;  4KRF A;  1W0H A;  3SQ0 A;  1HRH A;  3V1Q A;  5HRS A;  2Y1J A;  3ZSR A;  1HQU A;  3OYE A;  2I5J A;  4FJN A;  1ZBH A;  1U49 A;  1VSI A;  4FYD A; 
#chains in the Genus database with same CATH topology
 3V6D A;  4PKG A;  2XY8 A;  3NF8 A;  4J2E A;  1Y64 A;  1NGD A;  3LDP A;  4DQR A;  5LMU K;  3AVA A;  4YY3 K;  1TGO A;  2QTD A;  4MO4 A;  1NMD A;  2QA4 N;  4DR5 K;  4WQ5 C;  4BWM A;  4FLY A;  3CG7 A;  3ID8 A;  2Y1I A;  3ZSV A;  4J2B A;  3QEI A;  4YDU C;  3PO4 A;  4IOC L;  4C8L A;  4DTU A;  5SZT A;  3CPW M;  3FFK B;  4L3Q A;  1NLV A;  4CGJ A;  1Q81 O;  4E89 A;  2G8U A;  5BPN A;  1VAZ A;  1HR0 K;  3QEW A;  3CCJ N;  3NDK A;  2HNY A;  4H5V A;  1D9D A;  1XC9 A;  2JGU A;  1U45 A;  4X66 K;  3TAN A;  5AZJ B;  4CEA A;  4CHQ A;  4GKK K;  1ATN A;  3SQ1 A;  2P9P B;  3SPZ A;  2NRW A;  3DXK B;  3S3M A;  1SL1 A;  4ICL A;  3JSM A;  1RIL A;  3DOK A;  4E3S A;  1XHZ A;  3EO3 A;  3BF3 A;  1JXB A;  2HMI A;  5KPT A;  4FZX C;  3OYJ A;  5AR0 A;  4BRL A;  3CFO A;  1YJ9 N;  3NBP A;  1TK5 A;  2O8E A;  3U3Y A;  1D5A A;  4MLE A;  5EXW A;  1BWF O;  1BDG A;  4JKF A;  4M42 A;  1RNH A;  3J7Y P;  3DYA A;  3THW B;  4LSN A;  4E1N A;  3U3G A;  3BZC A;  3EEQ A;  4JRP A;  2J4R A;  2W41 A;  1JKH A;  2Z1I A;  4FPB A;  4I7F A;  4DS4 A;  3D2F A;  3NHG A;  4RW8 A;  2ZD1 A;  3NAE A;  2YNG A;  3F73 A;  2OZM A;  4CEQ A;  5BR8 K;  3OBW A;  4BRD A;  5C2F A;  2BTF A;  1NGG A;  1ZBS A;  1BG3 A;  4ZTF A;  3QIN A;  5EVZ A;  2D5R A;  5H1S Q;  2FC0 A;  4A5A A;  4CJS A;  4FCY A;  4DSE A;  3VEX A;  5BN8 A;  4HVJ A;  4X64 K;  3HYF A;  1NWK A;  4Z4G A;  4KBO A;  5JIC A;  4CGD A;  2OYQ A;  1RT2 A;  3KLF A;  4DV3 K;  1RDD A;  5I3U A;  1SV5 A;  3L4I A;  3K5O A;  2UXD K;  1NKE A;  1N8R O;  4RWT A;  4KTQ A;  1NGI A;  4IEI A;  3KKS A;  2FSJ A;  2OCE A;  5D3G A;  4KV8 A;  5JLF A;  1UA0 A;  1G15 A;  4DQQ A;  5A2Q O;  4IG0 A;  5LMN K;  2KQ2 A;  4CJP A;  1X9S A;  4YOW A;  3DXM B;  4B3S K;  1T05 A;  2F8T A;  3A2F A;  1L3V A;  4FM1 A;  3PX6 A;  4B9V A;  3FE1 A;  1BA0 A;  4R5P A;  2VWB A;  4MLH A;  3MXM A;  3CQX A;  2HHX A;  1HNW K;  5JMV A;  3LWM A;  3MCA B;  4DV0 K;  2OPS A;  1VQP N;  4ZTJ A;  3LAK A;  2W40 A;  3WEE B;  4BAC A;  1BI4 B;  3OYH A;  4BR7 A;  5GAG P;  4LFA K;  5C10 A;  3OS0 A;  3SJH A;  5KQ8 A;  4KO0 A;  3OY9 A;  3CC4 N;  4DQ8 A;  3VQE A;  4FWQ A;  3O3G A;  1DKG D;  1L5U A;  4CER A;  1TUY A;  2YHB A;  5C2D A;  2YNI A;  4FVM A;  4WYB A;  1VSM A;  4BRE A;  1WN7 A;  2GUP A;  3HXM A;  1WBB A;  4FJM A;  3E1Y A;  4C1N K;  4CJR A;  4FK2 A;  4CK1 A;  2HNZ A;  2HHW A;  2IVO A;  3CCQ N;  1Z26 A;  1KFD A;  1KD1 O;  1T44 A;  3H45 C;  1VRT A;  4CE9 A;  1RBV A;  2HHV A;  3VGK A;  3VQC A;  4CEO A;  2ZJQ L;  3TAE A;  5AZJ A;  2R7Y A;  2P9P A;  5LJV A;  3DXK A;  1XMQ K;  4QOZ B;  4FZZ A;  1BQM A;  1YT3 A;  1RTD A;  1GLD G;  3RMA A;  3AO4 A;  4LF4 K;  4BR9 A;  4KHN A;  3AVH A;  4ELV A;  4N41 A;  4QS8 A;  4IO9 L;  3HPG A;  3M8Q A;  1SKW A;  5MLC Q;  1EWQ A;  3P83 D;  4JKC A;  1C0G A;  4BC2 A;  2IC3 A;  2GTD A;  3EY1 A;  3NCI A;  1SKS A;  4C8O A;  3SAG A;  2IOC A;  1BGX T;  3THW A;  1VQ6 N;  3RWU A;  4H0X B;  4DTS A;  3WQT A;  3BGR A;  3QML A;  5AQY A;  2BUP A;  1MDU B;  1ZC6 A;  2RN2 A;  1L3S A;  4CFC A;  2XY5 A;  4ELT A;  1DTQ A;  1TYQ B;  1GOC A;  3MX5 A;  3IS9 A;  4M63 C;  3O4W A;  5J2N A;  3MEG A;  3HST B;  5AQV A;  5M1F A;  2NLX A;  4YOT A;  2QWM A;  5ADX A;  1Q18 A;  5DM6 L;  5AQR A;  3P31 A;  3CCL N;  2QXF A;  3C65 A;  5BRE A;  3TI0 A;  1VSE A;  1Q86 O;  1CXU A;  2HF4 A;  3IG1 A;  4FLU A;  3PX4 A;  1X9M A;  5AZI B;  3P38 A;  2NUB A;  2QWN A;  3CQY A;  4ILJ A;  2XO7 A;  3O4Q A;  4CEE A;  1TK8 A;  4DU3 A;  4BR5 A;  3HL8 A;  3A5N C;  2WUS A;  3J81 O;  2O8C B;  4BRK A;  1VQ4 N;  2EHG A;  5I42 A;  5C0Y A;  1GOA A;  1LOT B;  4CBW A;  2HB5 A;  1T6C A;  4B1U B;  1T8E A;  5AQG A;  4JEP A;  3L2V A;  3DXM A;  3VQA A;  2HMP A;  3EKS A;  1OH7 A;  2Q1N A;  5K14 A;  3CCS N;  1FKO A;  2I7N A;  3CJB A;  3OYF A;  4CJW A;  1KCF A;  2QW9 A;  3V9W A;  4B9N A;  5AQZ A;  4YOV A;  1Z05 A;  3FZM A;  3TTD A;  2DFF A;  3OYK A;  4F4K A;  3WEE A;  1JL1 A;  1BI4 A;  4CJQ A;  3O9R A;  4DV5 K;  4JK7 A;  4BRQ A;  3CFP A;  1WB9 A;  3SUP A;  3CCV N;  4CZK A;  1C0T A;  4H0T B;  1NOY A;  3MEE A;  2CH6 A;  4IG3 A;  3E9P A;  4GV6 A;  1R59 O;  3KJV A;  2F9W A;  1LWF A;  3VQ6 A;  4DV4 K;  1S9G A;  1WBD A;  3O5B A;  1VSL A;  3BZK A;  3PY8 A;  4YOY A;  4X65 K;  4KHP K;  1Y97 A;  3JXU A;  3MN6 A;  3CF5 L;  4BRH A;  5JS2 A;  3C95 A;  4EFH A;  4FLT A;  3VEY A;  3ITH A;  3TAM A;  4HUF A;  3KK7 A;  3SI6 A;  4JI7 K;  4CGG A;  4IXC A;  4DR1 K;  3SPY A;  2YNF A;  2RPI A;  1MWM A;  3H6E A;  1E4G T;  2I7P A;  4DSL A;  1E3M A;  4Z4I A;  1HJR A;  1WAF A;  3LL3 A;  4GY2 B;  1RDB A;  4Z0U A;  1HUX A;  4ID5 A;  1RDA A;  3C0B A;  3CQ8 A;  3K59 A;  1K73 O;  4BRF A;  3K57 A;  1ATS A;  3V1R A;  1BUP A;  3SUN A;  4C8M A;  2QWR A;  1YTA A;  1I3A A;  4DLE A;  1C0F A;  3QNN A;  3AVK A;  4LFC K;  3V9X A;  1YHQ N;  4CES A;  3V4I A;  3CJ9 A;  3G0Z A;  4QS7 A;  4FLX A;  3QET A;  4G1Q A;  4CJK A;  1TYQ A;  3CCM N;  4FJG A;  1NGF A;  2V52 B;  2ITG A;  4CGH A;  2HST A;  4O0J A;  3MDQ A;  4B8A B;  4JI0 K;  4MDA A;  1C0M A;  3RMD A;  4FOI A;  3KZB A;  3UKR B;  2DPN A;  3IMX A;  1WSI A;  1VQ5 N;  4DQP A;  3AY9 A;  1A5V A;  1N34 K;  2X6N A;  5AZI A;  1N6Q A;  4KHS A;  4H0Y B;  4GKJ K;  5SWM A;  1GLC G;  3C94 A;  4W5T A;  2O8C A;  4J8F A;  1NGE A;  4KH6 A;  3V1Q A;  2Y1J A;  1S22 A;  3GG4 A;  3OYE A;  2I5J A;  5BRH A;  1KAY A;  1YF5 L;  1U49 A;  4OJR A;  1RT4 A;  1M90 O;  4Z94 A;  4DTR A;  1RBR A;  4FPA A;  3KVG A;  1KLN A;  2BGG A;  5CE3 A;  4X62 K;  3THY B;  5J2M A;  4JK8 A;  3RMB A;  1TKD A;  2OPP A;  3HOS A;  1SS6 A;  2G8W A;  2XRI A;  1QSY A;  2HHH K;  1FXX A;  1ZBU A;  4CD1 A;  4M41 A;  1X1P A;  2A41 A;  5AQJ A;  4CJE A;  3BP8 A;  1RFQ A;  4K41 A;  1HX1 A;  4CGF A;  4CZM A;  5I9E B;  4NCA A;  4BE1 A;  3CC7 N;  5BRD A;  2X78 A;  1QHT A;  2YHW A;  3G71 N;  2Q31 A;  3JS6 A;  3FZK A;  4H4O A;  3U4L A;  3LPT A;  1TKX A;  4E19 A;  5JVG L;  3WNE A;  3GE1 A;  1S3X A;  4CW7 B;  2P51 A;  3I8D A;  5AQH A;  1VSJ A;  3KIO A;  3LP0 A;  4BDZ A;  4NXN K;  3LM2 A;  1ZBL A;  3W3D A;  4B1W B;  5M1Q A;  3HOT A;  1YXQ A;  4EZ6 A;  1DT9 A;  3PLA A;  3WNG A;  4CHZ A;  4JI4 K;  1TV6 A;  3IRX A;  3FZF A;  3AGK A;  4GVE A;  3OYA A;  2P9U B;  3CM5 A;  4I6M B;  3DOL A;  4CD3 A;  4IFV A;  2A5X A;  2FBV A;  2ZGZ A;  4BG8 A;  5HRR A;  5FPE A;  3OBY A;  4AQY K;  5J2Q A;  5GIP A;  1QZ5 A;  4M7Y A;  3O1W A;  4KI6 A;  5FDL A;  2ETJ A;  4J2D A;  5DM7 L;  2BDP A;  2F96 A;  3MEC A;  1LAV A;  4CVN E;  1W97 L;  1NKB A;  3DRR A;  4B3T K;  3CCR N;  3L2W A;  5TKW A;  4DR2 K;  3RRG A;  2ZF5 O;  1B9D A;  2DFH A;  4JKD A;  4DSK A;  3VQ4 A;  4NYF A;  4JI1 K;  3AO2 A;  4CZG A;  1HNV A;  4F9O A;  2BH1 A;  2E20 A;  5CY4 A;  2ZJR L;  1X3M A;  4CEZ A;  2F9T A;  3MWP A;  1OH6 A;  2ITM A;  4IZ9 A;  4IJA A;  3T7Z A;  2ZGY A;  4JK9 A;  2JLE A;  1HJO A;  1TAU A;  4H0V B;  2QWL A;  3OVN A;  1JCF A;  2GX9 A;  3DRS A;  3VQ5 A;  2OPR A;  4XH4 A;  4UQG A;  5KQD A;  3UKR A;  2BAN A;  5T7B A;  4O0I A;  2FF6 A;  4H5W A;  4DQI A;  4E7I A;  4PKH A;  3QNO A;  3L3V A;  4BR2 A;  3SLC A;  4AHT A;  4FJL A;  3MMV A;  4IOX A;  3CHW A;  3AAR A;  1VSF A;  1WAJ A;  2QKK A;  3H3O B;  1JLF A;  4KI4 A;  4E7L A;  4UY8 O;  1XC3 A;  3AVM A;  3NF6 A;  3M3Z A;  4OX9 K;  4JI6 K;  1HKC A;  4N5S A;  3THY A;  4O5F A;  2FBX A;  3JYT A;  2YHA A;  5C12 A;  2AJQ A;  5AJ3 K;  3ASM A;  4CJL A;  3HJF A;  3V1O A;  2QK9 A;  4F2S A;  4N56 A;  2X74 A;  1O13 A;  3ENO A;  2HHU A;  3F2K A;  2VYP A;  5F0X A;  5GAD P;  3SZ2 A;  2E4L A;  1S72 N;  1C0U A;  2WC9 A;  3AVN A;  4DMN A;  4A62 A;  4B9U A;  1GLL O;  4BWJ A;  1BOT O;  3BUZ B;  5JLH A;  3TAQ A;  4DG1 A;  4V19 S;  5IT9 O;  3QEV A;  3LAN A;  4BVO A;  1NK7 A;  1T3V A;  3A5L C;  4EP5 A;  4Z4F A;  1QVG M;  4RW6 A;  3VEW A;  3D2E B;  1U04 A;  4CI6 A;  3HT3 A;  3TSU A;  4WQ5 A;  4DFJ A;  2ZE2 A;  2G8I A;  4OPK A;  4CZI A;  1R0A A;  4YDU A;  4FWP A;  3SYZ A;  3KLI A;  4KH5 A;  2P9U A;  1WSJ A;  4B1X B;  4I6M A;  1IKV A;  1IJJ A;  3M8P A;  1S1X A;  1VK0 A;  4MFB A;  4U67 L;  4OLA A;  3THX A;  2QXL A;  1E4F T;  3VQB A;  3AAQ A;  3I33 A;  1JLA A;  5DK5 A;  1NG9 A;  3AA2 A;  2UUB K;  1S9E A;  1KC8 O;  4C8N A;  4FJH A;  1YUW A;  3O9S A;  4CF8 A;  2ASP A;  4XH1 A;  5KGX A;  3VA0 A;  4HCB A;  3MCP A;  4CIF A;  3RVC A;  5F1X A;  2F7T A;  2NRV A;  3LZJ A;  1HNX K;  1RBT A;  2BE2 A;  3HPH A;  3NVK A;  3LDS A;  2VGM A;  3IKM A;  3NGI A;  1ZYQ A;  1P90 A;  2EX3 A;  4JKG B;  3NF7 A;  2GWJ A;  3WNH A;  4U7B A;  1JLB A;  2YHY A;  4B9M A;  3S9H A;  1N32 K;  3EKU A;  3ATV A;  3T19 A;  4KAZ A;  4CEC A;  4BY9 C;  5AQN A;  3HTV A;  3L2Q A;  4BRP A;  1QQC A;  3V81 A;  3L0Q A;  1BIZ A;  4BR0 A;  5ADX H;  4CEB A;  4FWS A;  5J1E A;  3SBG A;  1HPZ A;  3LAM A;  4YOU A;  3NH2 A;  3BEX A;  4FWK A;  2FLO A;  1SQK A;  5AQF A;  2OAN A;  4FM0 A;  3UIQ A;  3I0R A;  1LCU A;  2NRZ A;  3SV4 A;  1EXQ A;  1QHA A;  2CGJ A;  3TWH A;  3DWL A;  4O44 A;  3TTF A;  1WOQ A;  4Y0W A;  1F21 A;  3DJC A;  2IDO A;  2Q3S A;  3TAR A;  4KHY A;  4G9Z A;  3PX0 A;  1W9H A;  4AIL C;  3SV3 A;  1Q82 O;  3OTO K;  3KD5 E;  3GOI A;  1HNI A;  3NMU A;  2NZT A;  3F9K A;  5AQW A;  5AQQ A;  4DCH A;  3NF9 A;  3HI0 A;  3Q7B A;  4E7J A;  3KTQ A;  3VQD A;  4FJ8 A;  3P1G A;  3L8B A;  4GMJ B;  1IG8 A;  1V4T A;  1REV A;  5ELZ A;  4N76 A;  2E2N A;  2DY4 A;  1ESV A;  3HP9 A;  1NKC A;  1JXE A;  3M8S A;  1IO2 A;  2GEL A;  4E1M A;  1Q9Y A;  1GLB G;  4AHU A;  1TL1 A;  4CEF A;  2ASO A;  3D2E A;  1FK9 A;  1SZ2 A;  3AVF A;  5AQK A;  2YCH A;  5AQT A;  3T3F A;  4M3R A;  3M6G A;  1NJX A;  3JAM O;  4CJ7 A;  3FFI A;  4H5R A;  4KTZ A;  1YTU A;  2KZM A;  3UKU B;  1TL3 A;  4DV6 K;  3O4N A;  3B8A X;  3CME N;  2W42 A;  2VG6 A;  4CFB A;  1HNZ K;  1UWB A;  3G6E N;  2KFN A;  3DLK A;  1WSH A;  2G8F A;  4LF9 K;  2FBY A;  4B1Z A;  3M8R A;  1HYS A;  3WNF A;  4ISE A;  4B9T A;  3LZI A;  4Q0B A;  3HVR A;  3CFR A;  3I8B A;  4NYN A;  1KFS A;  2Z1H A;  4JD2 B;  2P1J A;  3SMP A;  3ENB A;  3BY5 A;  4DR3 K;  3LWL A;  5HLF A;  2AP1 A;  4IJN A;  3L2U A;  2NNW A;  3U6F A;  1FW6 A;  1RT5 A;  2WON A;  1TAQ A;  3KWG A;  4JKG A;  3ZT3 A;  3AGR A;  2F8S A;  4WCE L;  4IEE A;  3QFP A;  5AQX A;  2YV0 X;  4K43 A;  2FSK A;  1RTJ A;  3ENH A;  3S3O A;  3ZSO A;  1J54 A;  4BC3 A;  3O08 A;  5BRF A;  2IAJ A;  3UB5 A;  4DQS A;  5CYM A;  3QO9 A;  2V7Z A;  4Y1C A;  2KHO A;  3D6R A;  1JJ2 M;  3GBT A;  1DLO A;  3DRP A;  4CJF A;  2O4I A;  4HTL A;  4KRF A;  3SQ0 A;  1HRH A;  5HRS A;  1HQU A;  4DUY K;  3C6A A;  2NRX A;  2NRR A;  4FYD A;  3LDN A;  4JS4 A;  4JRQ A;  4O5B A;  1YJN N;  3TAP A;  1MWK A;  4CZJ A;  4KRE A;  1JLG A;  2HW3 A;  4OGE A;  3LDO A;  4B3M K;  3TTC A;  4FWM A;  3CYM A;  1JCG A;  1BO5 O;  4KHW A;  4WFN L;  1RDW X;  2IS3 A;  1EP4 A;  4BVP A;  1OH5 A;  4AF1 A;  3VPZ A;  2HVH A;  2B6A A;  2OZS A;  4M3Z A;  3AO1 A;  4OO1 J;  1WNS A;  3FGU A;  3VQQ A;  1LV5 A;  2RHK A;  2O8B B;  1WSG A;  3M5R A;  3ZSY A;  2XY7 A;  1SL0 A;  4JI2 K;  1H1V A;  2YHX A;  4O8U A;  4CCH A;  3DM2 A;  2A3Z A;  4K8X A;  1BL3 A;  1EX4 A;  1S6Q A;  2KZZ A;  4DUZ K;  2GBZ A;  1XHX A;  1VQN N;  3QDK A;  1L3T A;  1IBM K;  1J9A A;  4DR6 K;  5BN9 A;  2V51 B;  4KB0 A;  4OLB A;  2CH5 A;  5TKY A;  4BRG A;  5IWA K;  3CJC A;  3NE6 A;  1D9F A;  2D4W A;  1NK8 A;  3LPU A;  1FKP A;  1S1T A;  4TSX A;  4DTO A;  3ZCM A;  1LWE A;  3KLE A;  4GW6 A;  2KW4 A;  4CFD A;  1VSK A;  3OJS A;  3K2P A;  2HBM A;  3ZSQ A;  4XEI A;  3UKU A;  5JVH L;  4JKE A;  2E88 A;  1WUA A;  3AVC A;  4JKH A;  3MXJ A;  3NFA A;  4N47 A;  3VMF B;  1XNR K;  3K9J A;  3EYZ A;  2P9S B;  1A5W A;  5AFU H;  3SNN A;  3VEN A;  3DI6 A;  4FJ9 A;  5KRT A;  1JLQ A;  2Q2R A;  1RCH A;  3HSC A;  4ILG B;  3OYG A;  1K8A O;  2YKM A;  1NOZ A;  1HQE A;  3FZH A;  2YJF A;  1SAZ A;  2HVI A;  3OYN A;  2UXB K;  1NM1 A;  3EE8 A;  4JN4 A;  3FZL A;  2A42 A;  4QAG A;  4DLG A;  3VEZ A;  4JD2 A;  4OVL A;  3DLR A;  4FOE A;  3RRH A;  3K5M A;  1LAW A;  4JAX A;  3TAG A;  1X9W A;  4CHY A;  2NRH A;  4B9S A;  3VN5 A;  3J7Z O;  2GV9 A;  4JHD B;  2A1S A;  4FJK A;  2E2Q A;  3THV A;  1QZ6 A;  1KSP A;  3SJJ A;  3VET A;  2QEX N;  4CJ4 A;  2W6L A;  3RTV A;  1N36 K;  4IOA L;  4BRA A;  1WLJ A;  4JLH A;  1CZA N;  2E1Y A;  4DU1 A;  4DF8 A;  4DHY A;  3MN9 A;  4K42 A;  4AHR A;  1RDC A;  1B9F A;  3KK1 A;  3DLL L;  4BE2 A;  3VF4 A;  3MED A;  4WF9 L;  4BQZ A;  5KRS A;  4I9L A;  4CHP A;  3QEX A;  3EE9 A;  4OKE A;  4OPH A;  3PV8 A;  4O4G A;  4EZ9 A;  2ATQ A;  1DTT A;  4F2R A;  2HBL A;  3FR0 A;  3OYM A;  4C1N I;  3C6T A;  1ASW A;  2E6M A;  4HWI A;  4YNQ A;  3RMC A;  1RT7 A;  3AVJ A;  3CCU N;  3OYC A;  5CZ2 A;  5FPD A;  4FW1 A;  4BR4 A;  1NK5 A;  4PUO A;  5FPN A;  2A1R A;  3AA5 X;  4DTM A;  4KHU A;  4B9L A;  4W5N A;  2VWK A;  3NH0 A;  4I9Q A;  3DLG A;  3MK6 A;  4FJI A;  2FXU A;  2EWS A;  4DSJ A;  3HK2 A;  1NGC A;  2Q0R A;  2O8F B;  2O8B A;  4IWV A;  1MU2 A;  3GL1 A;  1X3N A;  2PZS A;  2Z1G A;  3SAF A;  4ILH A;  1XMO K;  2D0P A;  5AQI A;  3IAY A;  4HCC A;  5DMR A;  5CYQ A;  2FF3 B;  2NRT A;  2H3G X;  3VQP A;  5AFU A;  5C25 A;  1YIT N;  4Z4E A;  4J2A A;  4BRN A;  4E7H A;  3FLC O;  1BCO A;  1Z6R A;  4FL9 A;  1IBL K;  4DV2 K;  1HLU A;  3VTI A;  3WXJ A;  4M45 A;  3EL2 A;  4IDH A;  1S1V A;  2AA4 A;  4ID1 A;  4WQ4 C;  3U9Z A;  1HPM A;  1I39 A;  4GVM A;  1TUU A;  2HF3 A;  4CF9 A;  5CZ1 A;  1ASV A;  4K0K K;  2YX6 A;  1NJZ A;  4RG8 A;  3M1F A;  4RW7 A;  3CJA A;  3AO5 A;  3K0S A;  2IGI A;  3RR8 A;  4BGB A;  3WQU A;  2GUI A;  4AHS A;  1J6Z A;  4A61 A;  4W5O A;  2Z1J A;  2P5G A;  2P9S A;  3J8A A;  1KLM A;  1U48 A;  3CJ7 A;  1OVQ A;  4I2P A;  5HRN A;  3I55 N;  4DR4 K;  4CIG A;  3OJU A;  5GAE P;  4Z4H A;  1W7A A;  3ISN C;  4RCH A;  3CCE N;  5HP1 A;  3QLH A;  2QWO A;  3O9Q A;  3LP3 A;  2XY6 A;  3G10 A;  1GLF O;  3QES A;  3DLB A;  4HHT A;  1XUP O;  1MA9 B;  5AQU A;  1RBU A;  4CF1 A;  3MX2 A;  4A2B A;  4DU4 A;  4H5T A;  5M1O A;  4B08 A;  4JHD A;  3K5L A;  1EKE A;  3Q7C A;  3J80 O;  4IFE A;  1OVY A;  3SUO A;  3N4P A;  5AQO A;  3P4I A;  2F4V K;  2HOE A;  1UOC A;  4JYA K;  5LL6 Z;  4C8K A;  4BRM A;  1TKT A;  3TPQ A;  2E2P A;  2WTU A;  2HHT A;  2HHQ A;  3N4Q A;  2VG7 A;  4GNI A;  2WBN A;  3TU5 A;  3F9M A;  3O9T A;  1N33 K;  3RSE B;  2QM1 A;  1VQ8 N;  1BCM A;  1Q8I A;  3O9U A;  4CF2 A;  3ZSX A;  4CZF A;  3E66 A;  3KKR A;  1ZXO A;  3AA4 A;  4LF7 K;  4E0D A;  3CER A;  5FRN A;  3EN9 A;  3VEO A;  3S41 A;  3AAP A;  3H08 A;  3D7E O;  1RT1 A;  4DTJ A;  1LW0 A;  2A40 A;  3LDL A;  1NK9 A;  3T1H K;  3WXI A;  4QCL A;  1ILY A;  3G4S N;  3IFR A;  2D0C A;  1EWR A;  1FJG K;  2YNH A;  3C7N B;  4B3R K;  3VGL A;  3ULD A;  3QBW A;  1HKG A;  4YOR A;  3C6U A;  2O8F A;  3WUH A;  1NJW A;  4CFA A;  4CJ5 A;  4K25 A;  3O1B A;  1IKY A;  1S1W A;  3PO5 A;  2XHB A;  2OTJ N;  4B3O A;  2KTQ A;  2PBD A;  1ITG A;  3A5O C;  3CJ1 A;  4IO8 A;  3SBT A;  2D0A A;  4FW2 A;  2PFU A;  4Q5V A;  4DTX A;  4B1V A;  3LDQ A;  3EZW A;  5EX5 A;  3OYI A;  2G8V A;  1G99 A;  4ISF A;  4R79 A;  1T03 A;  1IKX A;  3HM9 A;  2JWL A;  1BIS A;  1DEJ A;  3B6P A;  2D0O A;  4CBX A;  3OS2 A;  3HRG A;  4I2Q A;  4RW9 A;  3CIP A;  4IBN A;  4KTW A;  1QQN A;  4DB3 A;  4JNE A;  2QWP A;  2PYL A;  2WFB A;  3H3N O;  3BF1 A;  1U4B A;  3ZSW A;  4ZHR A;  4H0P A;  1B92 A;  5BPL A;  2ASM A;  1NK6 A;  2IIR A;  1XWL A;  4BC4 A;  3VOV A;  4LF6 K;  3E9L A;  1QSL A;  4AM7 A;  2KFZ A;  3PUF A;  1VQO N;  5F2R A;  1OKJ A;  5M1P A;  3V9Z A;  1KAX A;  3ZSZ A;  3EZ5 A;  1BHL A;  1K8K B;  1J5E K;  2E2O A;  4AHC A;  2YKN A;  3ZX2 A;  3PIO L;  2HBJ A;  3VQ7 A;  4BRC A;  2OA8 A;  4F8R A;  2PY5 A;  1NJY A;  3VQ9 A;  1HYZ A;  4A2A A;  5AQP A;  3K5N A;  3KLH A;  4HTU A;  3HVT A;  1U2V B;  3AA3 A;  1W0H A;  3ZSR A;  1QQO A;  2KKZ A;  3O6W A;  3ZET B;  2CGK A;  1EQY A;  1VSI A;  2E8A A;  3H46 O;  3SMS A;  1NMN A;  1BA1 A;  1VSD A;  3A8Y A;  5HRP A;  4NLC A;  3D45 A;  4JI3 K;  2P9N B;  4PY5 A;  1D4X A;  3HZ6 A;  1C1C A;  3T1A A;  5M1N A;  4BQL A;  2JWK A;  3HP6 A;  2VQF K;  3RSE A;  1N5Y A;  1YVU A;  1C1B A;  2OPQ A;  4OPJ A;  4PA1 A;  4F3T A;  1X9J A;  2E6L A;  5EOY A;  1NGB A;  4ISG A;  3PSI A;  4WFB L;  3CMA N;  4JV5 K;  4NLB A;  1Q7Y O;  3F5T A;  3CC2 N;  5BPM A;  4M7X A;  4CZE A;  3SQ4 A;  4DFK A;  1D8Y A;  4OGC A;  3VQ8 A;  4CED A;  3SQ2 A;  4IFY A;  4AH9 A;  3OYB A;  4OKJ A;  3PSF A;  3QBX A;  4CHO A;  4M3X A;  4NXM K;  1NU0 A;  5HOO A;  4L8R B;  4EIA A;  4PHT X;  3C7N A;  5J2P A;  3S3N A;  3GDQ A;  3CXC M;  5E84 A;  4CJU A;  4DF4 A;  5HRO A;  4YHH K;  2VGN A;  3R8E A;  3V9U A;  2UYT A;  4JKB A;  1J53 A;  3G25 A;  3QFU A;  3R1X A;  1NGH A;  3LP1 A;  2DFE A;  5KTQ A;  2GEM A;  4LC9 B;  4B8C A;  2O4G A;  1S6P A;  4CK2 A;  2KLA A;  5FLX O;  2UUC K;  4FWN A;  1SUQ A;  4FJ7 A;  3P5J A;  2P9L B;  2P9I B;  3L4Q A;  2PYJ A;  4FLV A;  4O8K A;  2ZM6 K;  3RR7 A;  4KHQ A;  1RGI A;  1XNQ K;  3DAW A;  1QVF M;  4LH5 A;  3SK3 A;  3QB0 A;  4JI8 K;  3SCX A;  2YJE A;  4FJ5 A;  1KVB A;  2B4J A;  4PQU A;  2D0B A;  1S1U A;  4O55 A;  4IDK A;  3WXL A;  2ZQB A;  3A5M C;  4CJT A;  1CLQ A;  3ID6 A;  5LY3 A;  3O3F A;  4ELU A;  4DV1 K;  4W5R A;  4K8Z A;  3L3U A;  3I0S A;  2O8D B;  1A5X A;  4LH4 A;  4PKI A;  4M3T A;  1NGA A;  1KRP A;  3AV9 A;  3L2R A;  5KGW A;  5M1K A;  3ZT1 A;  1K8K A;  1CXQ A;  4LFB K;  4AHV A;  1BQN A;  5GIN A;  2VQE K;  4H8K A;  4BRI A;  4PL8 A;  5E26 A;  4FXD A;  1YJW N;  4FK0 A;  2VG5 A;  1JL2 A;  4B1Y B;  4JS5 A;  1P8Z A;  4DSF A;  2D1K A;  2IVN A;  2B5J A;  1QSS A;  2HND A;  3KHY A;  3ZLJ A;  5BR9 A;  4HUG A;  1HYV A;  4EP4 A;  2HBK A;  1U2V A;  1O1W A;  4H5N A;  4AM6 A;  1RBS A;  4CJ3 A;  3VF2 A;  3WXM B;  3ZET A;  3QEP A;  3CM6 A;  4DFM A;  4BDP A;  4F3O A;  2ZWH A;  3TSQ A;  4WFA L;  3WT0 A;  4CIE A;  3OYD A;  1IBK K;  4KPY A;  3OHR A;  2CGL A;  5EY4 A;  3VF6 A;  1K6Y A;  2P9N A;  4H03 B;  4FLW A;  5C42 A;  4LY7 A;  4NO7 A;  2WOM A;  3LM9 A;  5C15 A;  3T1Y K;  4XH5 A;  1Z25 A;  5E41 A;  1KTQ A;  4QS9 A;  3QER A;  3MWT A;  1NJI O;  3HBT A;  1U6Z A;  4CK3 A;  1K9M O;  3ZYY X;  2GWK A;  3ULE B;  5KPZ A;  1RT6 A;  4BDY A;  4DS5 A;  1C1A A;  4BG9 A;  1IKW A;  3U9D A;  3V9S A;  4DTP A;  3NH1 A;  3QIC A;  2RE2 A;  2G8K A;  4H0O A;  3DLH A;  1JLC A;  1BIU A;  1YIJ N;  3OS1 A;  4DFP A;  3HO1 A;  1IV0 A;  4A5B A;  3PIP L;  1VQL N;  1JLE A;  1NNE A;  1VQ7 N;  4LD0 A;  2X6S A;  4YFU A;  3D0P A;  1TK0 A;  4W5Q A;  5CR4 A;  2Q97 A;  5HBM A;  4FLZ A;  3NGZ A;  4BE0 A;  2QWQ A;  1GLA G;  2Q0U A;  1VSH A;  5FRO A;  3AO3 A;  3KK3 A;  1VRU A;  3U8X A;  5C24 A;  1VQ9 N;  3LP2 A;  3O8M A;  2OTL N;  2P9L A;  1L3U A;  3TSP A;  4MO5 A;  2P9I A;  1SKR A;  4LF8 K;  1XI1 A;  4FM2 A;  1WSE A;  2P9K B;  3W0L A;  1V4S A;  1NK4 A;  1I94 K;  4CZL A;  4LSL A;  3ZEU B;  1YVN A;  1OH8 A;  5GAH P;  2E5L K;  3IDH A;  1KVC A;  1TKZ A;  1GLJ O;  2W6K A;  3AVB A;  3ZX3 A;  4CHN A;  4WE1 A;  3SAH A;  4DV7 K;  4E1J A;  3T69 A;  5CHI A;  1TVR A;  2O8D A;  1M1K O;  1NK0 A;  3VER A;  1RTI A;  1XQS C;  1ZBF A;  2UUA K;  5FPM A;  4A57 A;  4IKF A;  5KI6 A;  3ZT0 A;  4PL7 A;  1UA1 A;  2IVP A;  4CZH A;  1CZB A;  4DWI A;  2E1Z A;  4A59 A;  4KB1 A;  2Q36 A;  1YI2 N;  5FRM A;  4E7K A;  1VHX A;  4EAH D;  3OYL A;  3QIP A;  3O3H A;  4M3U A;  5AQM A;  2RKI A;  1LW2 A;  4B9Q A;  3MAQ A;  3I56 N;  4M3Y A;  3LAL A;  1KQS M;  2A6A A;  2UU9 K;  4FK4 A;  1BU6 O;  4FWR A;  3R9P A;  4DR7 K;  3MN7 A;  1HKB A;  3ZX0 A;  3QIO A;  1J5O A;  1C6V A;  1HMV A;  4DKW A;  1GOB A;  3E01 A;  2LSN A;  4XIU A;  3VES A;  1ASU A;  2QI2 A;  4JKA A;  4DSI A;  1T6D A;  3ZT2 A;  3TAF A;  4RTF D;  4BRO A;  2PAV A;  4H4M A;  2FBT A;  1GLE G;  2QKB A;  3P39 A;  3A0I X;  2YI1 A;  2V7Y A;  3OW2 M;  1QE1 A;  3ATU A;  1QQM A;  2HHS A;  4FVU A;  3E9O A;  1DGK N;  4LF5 K;  3BDP A;  4Z4C A;  5LJW A;  3ALY A;  2UXC K;  3R3L A;  2VWJ A;  4CJV A;  4M3W A;  1KAZ A;  3ULE A;  4FWL A;  3KWI A;  4BC5 A;  4CF0 A;  4NCG A;  1ZBI A;  1W2B M;  1RDU A;  4OKK A;  4OPA A;  3SUQ A;  5KPR A;  4C23 A;  4EHU A;  1U47 A;  2G8H A;  4HUE A;  3H1V X;  1T7P A;  4DTN A;  4FWO A;  3HPO A;  2ZJP L;  1ATR A;  3MN5 A;  2O8E B;  3KLG A;  3CI5 A;  5EU7 A;  4Y1D A;  2RF2 A;  4GV3 A;  1CZ9 A;  1QTM A;  4FZY A;  4FJJ A;  3H1Q A;  4YOX A;  4PWD A;  3VA3 A;  3THX B;  3OA9 A;  1EET A;  4NCB A;  1IG9 A;  1WSF A;  3AVG A;  4GV9 A;  4KKO A;  5B8H A;  4KFB A;  3AVI A;  3D2F B;  3DLE A;  4FSV A;  4CBU A;  1EO1 A;  1KVA A;  3R6M A;  3B6O A;  1IH7 A;  5JS1 A;  4JI5 K;  3HM8 A;  3KK2 A;  1QS4 A;  1RTH A;  3K58 A;  3AVL A;  3TAB A;  1NBW A;  2DTU A;  3UE5 A;  1RT3 A;  4WQ4 A;  2P9K A;  3ZT4 A;  4FJX A;  3O80 A;  1VQM N;  3ZEU A;  3CD6 N;  3C6H A;  2P5O A;  1VQK N;  4MDB A;  2VCP A;  1KXP A;  1UAX A;  3VEV A;  3TR8 A;  3VTH A;  3IUC A;  3MXI A;  3J7A P;  3NGY A;  1LWC A;  3K9K A;  3CPE A;  5HL7 L;  1Q9X A;  1NGJ A;  3L6Q A;  3DMJ A;  3VGM A;  4NB4 A;  3NVM A;  1JCE A;  5GIO A;  4RW4 A;  4MQ3 A;  1SL2 A;  3KD1 E;  3WXK A;  1YAG A;  4EHT A;  3CET A;  1S5J A;  4CGI A;  4FO0 A;  2FSN A;  5AQS A;  4KH4 A;  4FJN A;  1ZBH A;  5AQL A;  4BGA A; 
#chains in the Genus database with same CATH homology
 4OJR A;  1RT4 A;  3V6D A;  4JS4 A;  1VSD A;  5HRP A;  4DTR A;  1RBR A;  4JRQ A;  1KLN A;  2BGG A;  2XY8 A;  3NF8 A;  3D45 A;  4O5B A;  5J2M A;  4J2E A;  4PY5 A;  3TAP A;  3RMB A;  1TKD A;  4DQR A;  1C1C A;  3T1A A;  4KRE A;  2OPP A;  1JLG A;  3AVA A;  4OGE A;  2G8W A;  2XRI A;  1QSY A;  3HP6 A;  1TGO A;  1FXX A;  1ZBU A;  4M41 A;  1N5Y A;  3CYM A;  1X1P A;  4KHW A;  1YVU A;  1C1B A;  4CJE A;  2HW3 A;  4BWM A;  4CGF A;  2OPQ A;  4OPJ A;  4PA1 A;  4NCA A;  4FLY A;  2IS3 A;  1EP4 A;  4BE1 A;  3CG7 A;  2Y1I A;  4F3T A;  3ZSV A;  2X78 A;  4J2B A;  1QHT A;  2E6L A;  3QEI A;  2HVH A;  3PO4 A;  2B6A A;  4DTU A;  4C8L A;  5SZT A;  2OZS A;  4M3Z A;  4H4O A;  3AO1 A;  1WNS A;  3LPT A;  1TKX A;  4E19 A;  3VQQ A;  4CGJ A;  1LV5 A;  4E89 A;  3WNE A;  2G8U A;  1WSG A;  2P51 A;  3ZSY A;  3I8D A;  2XY7 A;  3SQ4 A;  1SL0 A;  4DFK A;  3QEW A;  1D8Y A;  4OGC A;  3VQ8 A;  1VSJ A;  4CED A;  4IFY A;  3KIO A;  4AH9 A;  3OYB A;  4OKJ A;  3LP0 A;  2HNY A;  3NDK A;  3DM2 A;  4BDZ A;  4CCH A;  1D9D A;  1XC9 A;  2JGU A;  4CHO A;  1U45 A;  4K8X A;  1ZBL A;  1BL3 A;  4M3X A;  3TAN A;  4L8R B;  1EX4 A;  4CEA A;  1S6Q A;  4CHQ A;  4EZ6 A;  3SQ1 A;  3SPZ A;  3WNG A;  2GBZ A;  2KZZ A;  5J2P A;  4CHZ A;  3S3M A;  1XHX A;  4ICL A;  1SL1 A;  3JSM A;  3S3N A;  1RIL A;  1TV6 A;  3IRX A;  4CJU A;  3DOK A;  4E3S A;  1J9A A;  1L3T A;  1XHZ A;  4DF4 A;  1JXB A;  3OYA A;  4KB0 A;  2HMI A;  5HRO A;  4OLB A;  4FZX C;  3CM5 A;  3OYJ A;  3DOL A;  4IFV A;  3V9U A;  2FBV A;  3CFO A;  1J53 A;  3NBP A;  5HRR A;  1TK5 A;  3U3Y A;  3NE6 A;  5J2Q A;  1D9F A;  1D5A A;  3LP1 A;  1NK8 A;  2DFE A;  5KTQ A;  4KI6 A;  5FDL A;  4B8C A;  2ETJ A;  2O4G A;  3SQ2 A;  3LPU A;  1FKP A;  1RNH A;  1S1T A;  1S6P A;  3DYA A;  4CK2 A;  4J2D A;  4TSX A;  4LSN A;  3ZCM A;  2F96 A;  4E1N A;  1SUQ A;  3U3G A;  1LWE A;  4DTO A;  2BDP A;  3MEC A;  3KLE A;  1LAV A;  4JRP A;  4FJ7 A;  3P5J A;  2KW4 A;  4GW6 A;  4CFD A;  1NKB A;  3DRR A;  1VSK A;  3OJS A;  3K2P A;  3ZSQ A;  1JKH A;  2PYJ A;  4FLV A;  2Z1I A;  3L2W A;  3AVC A;  4I7F A;  3MXJ A;  3NFA A;  4N47 A;  4DS4 A;  3RR7 A;  4KHQ A;  3EYZ A;  3RRG A;  3NHG A;  1A5W A;  1B9D A;  2DFH A;  4LH5 A;  4RW8 A;  3SNN A;  4DSK A;  3DI6 A;  3SCX A;  4FJ9 A;  2ZD1 A;  4FJ5 A;  1KVB A;  2B4J A;  1JLQ A;  4NYF A;  1RCH A;  3VQ4 A;  5KRT A;  2YNG A;  3AO2 A;  1HNV A;  2D0B A;  2YKM A;  3OYG A;  1S1U A;  3F73 A;  3NAE A;  1NOZ A;  1HQE A;  4O55 A;  2OZM A;  4IDK A;  4CEQ A;  5CY4 A;  2ZQB A;  4CJT A;  1CLQ A;  2HVI A;  4ZTF A;  3OYN A;  3QIN A;  3O3F A;  4ELU A;  2D5R A;  2FC0 A;  4W5R A;  4CJS A;  4CEZ A;  4FCY A;  3L3U A;  3I0S A;  4DSE A;  4K8Z A;  1A5X A;  4HVJ A;  4QAG A;  3HYF A;  4DLG A;  4Z4G A;  4OVL A;  4LH4 A;  3DLR A;  3RRH A;  3K5M A;  2JLE A;  4M3T A;  1LAW A;  1KRP A;  4CGD A;  1TAU A;  3TAG A;  1X9W A;  2OYQ A;  3AV9 A;  3OVN A;  4CHY A;  1RT2 A;  5KGW A;  3DRS A;  3ZT1 A;  3L2R A;  3KLF A;  4B9S A;  1RDD A;  3VN5 A;  1CXQ A;  2OPR A;  3VQ5 A;  5I3U A;  1SV5 A;  2GV9 A;  4AHV A;  4UQG A;  2A1S A;  4FJK A;  3K5O A;  1BQN A;  2BAN A;  1NKE A;  5T7B A;  4O0I A;  4H8K A;  4DQI A;  4KTQ A;  3KKS A;  4E7I A;  3THV A;  1KSP A;  5D3G A;  4KV8 A;  3QNO A;  3L3V A;  4FXD A;  3SJJ A;  1G15 A;  1UA0 A;  2VG5 A;  1JL2 A;  4FK0 A;  4CJ4 A;  4JS5 A;  3RTV A;  4DQQ A;  4DSF A;  4AHT A;  4IG0 A;  4FJL A;  2KQ2 A;  2B5J A;  4CJP A;  1QSS A;  1WLJ A;  2HND A;  4JLH A;  1X9S A;  4DU1 A;  4DF8 A;  1VSF A;  1T05 A;  4HUG A;  1HYV A;  4EP4 A;  4AHR A;  1WAJ A;  1RDC A;  2F8T A;  3A2F A;  1B9F A;  1O1W A;  4FM1 A;  3KK1 A;  3PX6 A;  1L3V A;  1RBS A;  4BE2 A;  2QKK A;  1JLF A;  4CJ3 A;  4KI4 A;  3MED A;  4R5P A;  4E7L A;  3QEP A;  3AVM A;  3CM6 A;  3NF6 A;  4DFM A;  3MXM A;  4BDP A;  4F3O A;  5KRS A;  3LWM A;  4PQU A;  2HHX A;  4I9L A;  4CHP A;  3QEX A;  4OKE A;  3PV8 A;  2OPS A;  4ZTJ A;  4O4G A;  4EZ9 A;  2ATQ A;  4CIE A;  3OYD A;  1DTT A;  4KPY A;  4F2R A;  3LAK A;  4N5S A;  1K6Y A;  2FBX A;  4FLW A;  5C42 A;  3OYM A;  4LY7 A;  3JYT A;  2YHA A;  1BI4 B;  3C6T A;  2WOM A;  3OYH A;  1ASW A;  2E6M A;  4BAC A;  1NK0 A;  4YNQ A;  2AJQ A;  3RMC A;  3OS0 A;  3ASM A;  4CJL A;  1RT7 A;  4KO0 A;  3OY9 A;  3HJF A;  3AVJ A;  3V1O A;  3OYC A;  2QK9 A;  4F2S A;  1Z25 A;  4N56 A;  5E41 A;  2X74 A;  5CZ2 A;  1KTQ A;  3VQE A;  3O3G A;  4FW1 A;  1NK5 A;  4PUO A;  2A1R A;  2HHU A;  1L5U A;  3QER A;  3AA5 X;  4DTM A;  4KHU A;  4CER A;  4B9L A;  4W5N A;  2VWK A;  2YHB A;  2YNI A;  4FVM A;  1VSM A;  3NH0 A;  3HXM A;  1WN7 A;  2E4L A;  3DLG A;  3SZ2 A;  4I9Q A;  1C0U A;  4FJM A;  4CK3 A;  4FJI A;  4CJR A;  4FK2 A;  4CK1 A;  2HNZ A;  3AVN A;  4DMN A;  2HHW A;  4DSJ A;  3HK2 A;  1RT6 A;  4B9U A;  1Z26 A;  1KFD A;  4BDY A;  4DS5 A;  1C1A A;  1IKW A;  4BWJ A;  1VRT A;  3TAQ A;  4DG1 A;  3V9S A;  4CE9 A;  1MU2 A;  4DTP A;  3NH1 A;  1RBV A;  3QEV A;  4B9M A;  2HHV A;  3LAN A;  1NK7 A;  2PZS A;  2Z1G A;  2G8K A;  3DLH A;  3VQC A;  1JLC A;  4CEO A;  4EP5 A;  1BIU A;  3TAE A;  4Z4F A;  3OS1 A;  4RW6 A;  4DFP A;  2R7Y A;  3HO1 A;  3IAY A;  1U04 A;  4HCC A;  5DMR A;  3HT3 A;  4DFJ A;  5CYQ A;  4QOZ B;  2ZE2 A;  2G8I A;  4FZZ A;  1JLE A;  3VQP A;  1BQM A;  5C25 A;  4OPK A;  4Z4E A;  1R0A A;  1YT3 A;  4J2A A;  1RTD A;  4LD0 A;  4E7H A;  2X6S A;  1BCO A;  3RMA A;  3AO4 A;  3KLI A;  4YFU A;  3SYZ A;  4KHN A;  1WSJ A;  3AVH A;  3D0P A;  4ELV A;  1TK0 A;  1IKV A;  4N41 A;  4M45 A;  3M8P A;  1S1X A;  4W5Q A;  1S1V A;  4M42 A;  3HPG A;  1VK0 A;  4ID1 A;  1I39 A;  3M8Q A;  4GVM A;  5HBM A;  4FLZ A;  3NGZ A;  1SKW A;  4BE0 A;  4CF9 A;  3P83 D;  4MFB A;  4OLA A;  5CZ1 A;  1VSH A;  2IC3 A;  5FRO A;  3AO3 A;  1ASV A;  3KK3 A;  1VRU A;  3VQB A;  3EY1 A;  3NCI A;  1SKS A;  1JLA A;  5DK5 A;  1NJZ A;  4C8O A;  4RG8 A;  3AA2 A;  4RW7 A;  2IOC A;  1BGX T;  3AO5 A;  1S9E A;  5C24 A;  2IGI A;  3RWU A;  4C8N A;  4FJH A;  3LP2 A;  4DTS A;  3RR8 A;  3BGR A;  4CF8 A;  1L3U A;  5KGX A;  2RN2 A;  1L3S A;  4CFC A;  2XY5 A;  4ELT A;  1SKR A;  3VA0 A;  1DTQ A;  2GUI A;  4AHS A;  1XI1 A;  4FM2 A;  4HCB A;  1GOC A;  1WSE A;  4CIF A;  4W5O A;  2Z1J A;  3LZJ A;  2P5G A;  1RBT A;  2BE2 A;  3HPH A;  3IS9 A;  1KLM A;  1NK4 A;  1U48 A;  4LSL A;  5J2N A;  3LDS A;  3MEG A;  3HST B;  4I2P A;  5HRN A;  1ZYQ A;  3NGI A;  2EX3 A;  1KVC A;  1TKZ A;  3AVB A;  4CHN A;  4WE1 A;  3NF7 A;  4CIG A;  2QXF A;  3OJU A;  4Z4H A;  3TI0 A;  1VSE A;  3ISN C;  5HP1 A;  1CXU A;  3QLH A;  1TVR A;  3WNH A;  3LP3 A;  1JLB A;  2XY6 A;  3G10 A;  3IG1 A;  4FLU A;  3PX4 A;  3S9H A;  1RTI A;  3QES A;  3T19 A;  1X9M A;  3DLB A;  2NUB A;  4CEC A;  4HHT A;  1ZBF A;  4KAZ A;  4IKF A;  5KI6 A;  3ZT0 A;  2XO7 A;  3O4Q A;  1RBU A;  4CEE A;  4CF1 A;  3L2Q A;  1TK8 A;  1QQC A;  4DU4 A;  4DU3 A;  1UA1 A;  3HL8 A;  3V81 A;  4B08 A;  2EHG A;  1CZB A;  1BIZ A;  3K5L A;  1EKE A;  5I42 A;  4DWI A;  4CEB A;  1GOA A;  5J1E A;  1HPZ A;  4KB1 A;  3SUO A;  2HB5 A;  5FRM A;  1UOC A;  3LAM A;  4E7K A;  3OYL A;  3QIP A;  3NH2 A;  1T8E A;  3O3H A;  4M3U A;  4C8K A;  2RKI A;  1TKT A;  1LW2 A;  3MAQ A;  3L2V A;  4FM0 A;  2HHT A;  3UIQ A;  2HHQ A;  3VQA A;  3I0R A;  4M3Y A;  5K14 A;  3LAL A;  3SV4 A;  1EXQ A;  1FKO A;  2VG7 A;  3TWH A;  3OYF A;  4CJW A;  1KCF A;  4FK4 A;  1BCM A;  3V9W A;  4O44 A;  1Q8I A;  4B9N A;  3QIO A;  1J5O A;  1C6V A;  4CF2 A;  1HMV A;  1F21 A;  1GOB A;  2IDO A;  3E01 A;  2LSN A;  2Q3S A;  3ZSX A;  4XIU A;  1ASU A;  3TAR A;  4DSI A;  2DFF A;  3KKR A;  3OYK A;  4F4K A;  3ZT2 A;  1JL1 A;  4KHY A;  3TAF A;  3AA4 A;  1BI4 A;  3PX0 A;  4H4M A;  4E0D A;  4CJQ A;  1W9H A;  5FRN A;  4AIL C;  2FBT A;  3SV3 A;  2QKB A;  3KD5 E;  1HNI A;  3H08 A;  1RT1 A;  4DTJ A;  1LW0 A;  1QE1 A;  3F9K A;  3CFP A;  1NK9 A;  2HHS A;  3NF9 A;  3SUP A;  4QCL A;  4E7J A;  3KTQ A;  3BDP A;  4Z4C A;  2D0C A;  3VQD A;  4FJ8 A;  2YNH A;  1C0T A;  3ALY A;  3P1G A;  3L8B A;  1NOY A;  3MEE A;  2VWJ A;  4IG3 A;  3KJV A;  4CJV A;  4GMJ B;  3ULD A;  4M3W A;  1LWF A;  4CF0 A;  1REV A;  3VQ6 A;  4NCG A;  4N76 A;  2DY4 A;  3C6U A;  1ZBI A;  3HP9 A;  1S9G A;  3SUQ A;  4OKK A;  1NJW A;  1NKC A;  1VSL A;  1U47 A;  3PY8 A;  1JXE A;  4CFA A;  3M8S A;  4CJ5 A;  2G8H A;  1IO2 A;  4E1M A;  1IKY A;  1S1W A;  4HUE A;  2XHB A;  4DTN A;  3HPO A;  1Q9Y A;  1T7P A;  4AHU A;  3PO5 A;  1Y97 A;  4B3O A;  2KTQ A;  1ITG A;  1TL1 A;  4CEF A;  3KLG A;  5JS2 A;  1FK9 A;  2D0A A;  3C95 A;  5EU7 A;  4FW2 A;  4Q5V A;  4DTX A;  4Y1D A;  4FLT A;  2RF2 A;  3AVF A;  1CZ9 A;  3OYI A;  3T3F A;  3ITH A;  3TAM A;  2G8V A;  4HUF A;  4M3R A;  1QTM A;  3SI6 A;  1T03 A;  4CGG A;  1IKX A;  2YNF A;  3HM9 A;  2RPI A;  3SPY A;  1BIS A;  4FZY A;  4FJJ A;  1NJX A;  3B6P A;  3VA3 A;  4PWD A;  3FFI A;  1EET A;  4KTZ A;  4DSL A;  1YTU A;  4NCB A;  2KZM A;  4Z4I A;  1IG9 A;  1HJR A;  1WSF A;  1WAF A;  1TL3 A;  3AVG A;  3OS2 A;  3O4N A;  4KKO A;  1RDB A;  4I2Q A;  4KFB A;  4RW9 A;  4Z0U A;  3AVI A;  4ID5 A;  1RDA A;  4IBN A;  3CQ8 A;  3K59 A;  4KTW A;  2W42 A;  3K57 A;  2VG6 A;  3V1R A;  4CFB A;  2PYL A;  3DLE A;  1UWB A;  2KFN A;  3DLK A;  1WSH A;  3SUN A;  2G8F A;  4C8M A;  2FBY A;  3M8R A;  1YTA A;  1I3A A;  1HYS A;  4DLE A;  3ZSW A;  3WNF A;  4ZHR A;  1U4B A;  1KVA A;  4B9T A;  3LZI A;  3QNN A;  3AVK A;  1B92 A;  1IH7 A;  3B6O A;  5JS1 A;  3KK2 A;  3V9X A;  1NK6 A;  4CES A;  4Q0B A;  3V4I A;  1QS4 A;  3G0Z A;  4FLX A;  1RTH A;  3K58 A;  3AVL A;  1XWL A;  4G1Q A;  4CJK A;  3QET A;  3TAB A;  2DTU A;  4FJG A;  2ITG A;  3HVR A;  3CFR A;  1RT3 A;  1QSL A;  4NYN A;  4CGH A;  1KFS A;  2Z1H A;  2KFZ A;  2P1J A;  3PUF A;  4O0J A;  3ZT4 A;  4FJX A;  4B9V A;  4B8A B;  3LWL A;  2P5O A;  5HLF A;  3V9Z A;  1C0M A;  3ZSZ A;  3L2U A;  1BHL A;  3EZ5 A;  3RMD A;  3U6F A;  4AHC A;  1RT5 A;  1UAX A;  2WON A;  1TAQ A;  3TR8 A;  2YKN A;  3ZT3 A;  2F8S A;  3VQ7 A;  3MXI A;  1WSI A;  2OA8 A;  4DQP A;  4F8R A;  2YV0 X;  3NGY A;  1LWC A;  1A5V A;  2X6N A;  1Q9X A;  1RTJ A;  3S3O A;  2PY5 A;  3DMJ A;  3ZSO A;  1N6Q A;  4KHS A;  1J54 A;  5SWM A;  1NJY A;  3VQ9 A;  1HYZ A;  3C94 A;  4RW4 A;  4MQ3 A;  2IAJ A;  1SL2 A;  4W5T A;  5CYM A;  3QO9 A;  3K5N A;  4DQS A;  3KD1 E;  3KLH A;  4Y1C A;  4HTU A;  1DLO A;  3HVT A;  3DRP A;  4CJF A;  1S5J A;  4CGI A;  2O4I A;  3AA3 A;  4KRF A;  1W0H A;  3SQ0 A;  1HRH A;  3V1Q A;  5HRS A;  2Y1J A;  3ZSR A;  1HQU A;  3OYE A;  2I5J A;  4FJN A;  1ZBH A;  1U49 A;  1VSI A;  4FYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...