2I5JA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with dhbnh, an rnase h inhibitor
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 reverse transcriptase structure with RNase H inhibitor dihydroxy benzoyl naphthyl hydrazone bound at a novel site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H P66 subunit
total genus 117
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2i5jA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2i5jA05
3L2VA 1FK9A 3LP2A 4CFDA 3DRSB 4AHTA 3OJUA 1RT4B 5F8LA 5KRSA 1HPZB 5DGAA 1QUVA 2WRMA 3VQ8A 2D7SA 1QQCA 1N6QB 4CK1A 1RT4A 3DMJB 3AO5A 3BSCA 1N56A 2XY8A 3AVJA 4BE2A 2ZD1B 1DTQA 1WNSA 3V6DA 1IM4A 4J9SA 4CJQA 3U6FA 3TQ1A 2I1RA 2A1RA 4FJXA 3D45A 3K59A 1C1BA 2C2DA 3DLEA 1W9HA 2IOCA 4Z4HA 4TY9A 3SZ2A 4LQ9A 2E6LA 4NYZA 3VN5A 4M3UA 4M94A 4FLUA 1YTAA 2HNZA 3HPGA 5JXSA 1T7PA 4NLUA 3RMBA 4Q43A 4FJGA 4PQUB 1RYSA 2P51A 1S0NA 3DRPA 5F8HA 4YQWA 2EHGA 2BQ3A 3NCIA 2F8TA 4DTSA 2FLNA 4B9UA 2RF2B 3SI6A 3DM2A 4QWCA 4KFBA 4E7IA 4ELVA 3HXMA 1JLAB 4I2QA 1T03B 4JUZA 2XRIA 4FK2A 3VQSA 2OPRB 3O3FA 5SZTA 4DFJA 4E19A 3ZSXA 2UVVA 3V6DB 3NBPA 3OL9A 2FBYA 4I9LA 1RAJA 4N47A 3OHBA 2ASLA 1S0MA 2XGQA 3DLBA 3MEGB 3DLGB 3TARA 2UUWA 3LAKA 4B9TA 4G3IA 1VSDA 4ID5A 3NBPB 4ZVHA 1NJYA 2RPIA 1D5AA 2OPRA 3CM5A 4C8NA 3KJVA 2GV9A 4TY8A 2RKIA 3QNNA 4M95A 5HRSA 4KO0B 4I2QB 1RTHB 4ECUA 1NK9A 5KFMA 1Q9XA 1FXXA 3DM2B 4CGGA 3AVLA 1B9FA 4KHMA 1U04A 4NLXA 5DG9A 5KT4A 4NCBA 5KFUA 3TI0A 4M45A 3P83D 5JS2A 1C1AA 4Y1DA 4CEAA 4DWIA 2OPPB 4CJ5A 5HRNA 3CJ2A 5CY4A 1NOYA 4C8OA 3TAQA 3DRRA 4DSKA 4M3ZA 4TQSA 5KGXA 1HJRA 3G6YA 3LP3A 3VQ7A 4IRDA 2KFNA 2IM2A 2PY5A 1Z25A 3T5JA 4WFXA 4ECQA 3LZIA 3PW7A 1FKOA 2IBKA 1L3TA 5KFYA 1N5YB 4RUCA 5KFBA 5L9XA 4CIFA 1IKXB 1QSSA 4MKBA 1EKEA 4CJSA 4LSNA 1SH2A 4FJJA 2UUTA 3I5BA 4TYAA 1HQEB 3BGRA 4ZP6A 4I9QA 3LP2B 4IFYB 1TVRB 4K8XA 2D3UA 4IDKB 3OYJA 4XO0A 4KB7A 3RB6A 4WZMA 4DTPA 5KFOA 3E51A 5L1IA 1SV5B 3QZ8A 3UR0A 5D3GB 4R8UA 4DSJA 3AV9A 3KHLA 3GIJA 3KLEA 1LWCA 2FLPA 3RMCA 4KTQA 4IH7A 2XY7A 3ICLA 4RW7A 1REVA 3TAPA 3C6TA 3KHHA 4O4GB 5KGWA 4NCGB 5DG8A 2YHAA 4KB1A 3SFGA 5KFIA 2EC0A 2HW3A 5E41A 3ITHA 1RT5B 2VG6B 3GV8B 4KAZA 1IKWA 3FSIA 3OS0A 3CFOA 4W5OA 2O4IA 2ATQA 5L1LA 3H5XA 5KG6A 3RBEA 3PHEA 4C8KA 3K5NA 2RKIB 5L1KA 3CJ3A 4DTNA 4NLWA 4XIUA 4L8RB 2XO7A 1NHUA 2BRKA 1TKTA 1YVFA 5C42A 3H59A 4RUAA 3HVAA 4LSLA 4RNMA 1JLEA 1NKEA 3RRGA 3DDKA 1IKVA 1TKZA 4RW8A 4MK8A 3NGYA 3PO4A 4DFPA 4J2EA 4NYNA 3O3GA 2YKNB 4FM2A 3TAGA 1WLJA 1NJZA 2DPJA 1RDCA 2HNYB 3AO4A 1NK5A 1VSMA 3V4IB 3L2UA 4Z4GA 2IMWP 4K50A 1U4BA 4NCAA 1BIZA 1RT5A 3IRXB 3A2FA 1KLNA 1RT1B 1T03A 2JEIA 2IJNA 4CESA 4HVJA 3KTQA 3PZPA 2IAJB 4CJTA 4NLRA 3V1QA 2JLEA 3VQAA 3HO1A 4EZ6A 1JLFB 4XPEA 1K6YA 1BIUA 3C6TB 3DRPB 1KFDA 4M3XA 4CHYA 1EETA 4KI4A 4DL4A 3T5HA 4OLAA 1EX4A 2PZSA 2KZZA 2KFZA 4CEEA 3IG1B 4DS5A 2XHBA 4Q45A 4RW9B 1BCMA 5CZ2A 2J6TA 1S0OA 3KJVB 4AHUA 4J9MA 4Q0BB 1S9EB 3SUOA 3V9XA 3N6NA 1B92A 1DTQB 4FK0A 1QAIA 3IN5A 4WXOA 4IKAA 5I3UB 1NK7A 3DLGA 3NDKA 2QKKA 2KTQA 3M9OB 3AVBA 2V4RA 3KKRA 1RTIA 2JEFA 3SI8A 1TL3B 1JL1A 3ALYA 4K4XA 1C0TA 4KKOA 1FK9B 4J2AA 3V6HA 3PV8A 4EYHB 1TL1B 3GQCA 1NJXA 1SUQA 3KIOA 5HBMA 3CIZA 2VWKA 2YKMA 1BISA 5K14A 2VA2A 3M8SA 5C25B 4QWDA 3ZT0A 4IKFA 4JRQA 2FBVA 3Q8PB 1RT3B 3VQ4A 4QWEA 2E4LA 4FM1A 3I0RA 1RDBA 4CF1A 3QZ7A 2D0AA 4E7JA 3DI6B 4CJVA 4O3PA 3L2WA 4CGDA 4Z4CA 4DG1B 3I5AA 1VSJA 4DLEA 3M8QB 4CEOA 2B5JB 3KK2A 4Z4IA 2HVIA 3SUQA 4QWAA 4URQU 3AVMA 4ID5B 4K4WA 4KHUA 1YTUA 4DTXA 2QKBA 1RT3A 1TK0A 4HCCA 4Y2AA 4HCBA 2Q3SA 2YV0X 1RTDA 3MEEB 3JYTA 4IBNA 3RMAA 2O5DA 3KHRA 5J2NA 4HKQA 3ZSQA 4E3SA 3TAMA 5JUMA 4MH8A 4ELTA 1NNDA 1UWBB 3I0SA 3DRSA 3CWJA 1QSYA 4NRUA 1S5JA 4B9VA 2AJQA 5HBMB 4OVLA 2ALZA 2WONB 3HP9A 4YNQA 1L3SA 3JSMA 3V1OA 2D5RA 4XPCA 1KRPA 2X78A 4LQ3A 5KT5A 2F8EX 4RZRA 2HWHA 3UDLA 1LAWA 3AVAA 3IG1A 4B3OB 1C0UB 1U09A 1LAVA 4E89A 4IRKA 4NLGA 1JXLA 2X6SA 4ECWA 1JLCB 3S3MA 1DLOA 5DGBA 2OPQA 3NH2A 3DOLB 4OPJA 3BDPA 3SQ0A 1UAXA 3M9NB 5C42B 3AA3A 2JEGA 3PW4A 3ZT1A 4NYFA 3CM6A 4QOZB 3MXJA 3KK1A 1S1VB 4F4WA 2ZQBA 1RT1A 2A1SA 3P5JA 3VQ9A 1S1XA 2GUIA 3BQ1A 2WOMB 5FRMA 3KLFA 3KLFB 3M9MB 3QEPA 3DLKA 4F3OA 2E9RX 3MXMA 3LAMA 2WHOA 1S97A 2KW4A 1RT6A 1RDDA 2D0CA 4J2BA 3KK1B 1S48A 2ILYA 5J2MA 2AX1A 2QE5A 4Q44A 4RW8B 4CGFA 4DL2A 2FVRA 1RA7A 2BE2A 3N6LA 4WYWA 1SL0A 4KHWA 5HRPA 3RR8A 1C1CA 4ZMMA 1T3NA 3D5MA 3CQ8A 4Q5VA 4KHNA 1X9SA 3KLHB 1X9WA 2HMIA 1LW0A 3GIKA 3V6JA 1RBVA 2BR0A 4CFBA 3PX4A 2OPSB 3LWLA 3AVKA 3LANA 1TV6A 2GIRA 5KFTA 4ZTJA 2W9CB 2FBTA 1HMVB 3IAYA 4G1QA 2XCAA 4IH5A 3OS1A 4IQXA 4CFAA 4TN2A 5CYMB 4FS1A 1FKOB 3MR6A 2RDJA 4Y34A 5KFSA 2WTFA 4O5BA 3M8QA 1HYVA 2R7YA 1NK6A 5EUHA 2B43A 2JEJA 1S10A 4NLDA 3DYAA 3PJXA 1HARA 2B6AA 4WFZA 1IH7A 1HQUA 1ITGA 3OYAA 2R8IA 5KFQA 4N41A 4NLYA 3PJWA 3NFAA 4E7LA 5I42A 3NGDA 2G8WA 4O3NA 2W7OA 2IDOA 2IM1A 4N5SA 1VSEA 3NF8A 4RW6B 4B3OA 4R8UB 4RNHA 4O0JA 3QERA 2NUBA 1W0HA 3PUFA 3TAEA 2W9BA 4ZPAA 1JKHA 4FXDA 1C0TB 4CEBA 3KLGB 3PW5A 5KRTA 1JL2A 2G8UA 4RG8A 3SCXA 3MEEA 3JYTB 1BQNA 1RTDB 4BE1A 5I3UA 5HLFA 4W5QA 1RT6B 1IKXA 5FDLB 4RNOA 4CF0A 2ZKUA 5FROA 2IGIA 2ITGA 2BGGA 3HPOA 1RILA 3OY9A 3H5UA 2CJQA 4RU9A 2DFFA 3SPYA 4ECVA 3RBDA 4FYDA 3MR2A 4IR1A 1TK5A 1R0AA 5KFHA 4F4ZA 3CDWA 1RTHA 4CHZA 4DG1A 4MIBA 5T14A 3OYEA 3T3FA 4KFBB 4HUEA 4KV8A 3ZSYA 3DI6A 4MKAA 3H98A 1DTTB 2Z1IA 3IS9B 2R2TA 2VG5A 1SL1A 3IGVA 3L8BA 3EPIA 3HL8A 3RAXA 4J2DA 4Y1CA 5SWMA 1UOCA 3HVWA 1T94A 3KLIA 1HYSB 4FS2A 1Z4UA 3B6PA 3NE6A 3SPZA 1T8EA 3NGZA 3CJ0A 1IKYB 1S1UB 4NZ0A 3MECB 2HMIB 2R2RA 4WYLA 3L2QA 2UVWA 3DLEB 3OYKA 2FLLA 1C6VA 3PVXA 2WONA 3HYFA 4DTMA 2HHWA 4OKJA 4BDZA 3PW0A 1BL3A 3KK3B 4U7CA 4DL7A 3AA5X 2ZE2A 4IG3B 3G6XA 3NF6A 3MECA 3H5SA 1GOBA 3VQPA 1TP7A 2YKNA 2AGPA 2E9ZA 1I3AA 4HUGA 3PY8A 1HYSA 3ZT4A 2GC8A 1RTIB 4E1MA 5J1EA 3RB4A 5C5JA 4FLYA 1VRTA 4UQGA 4PQUA 3ZT3A 3QESA 2P5GA 4IG0A 4JV0A 4Q0BA 1DTTA 1Y97A 4CFCA 3KK2B 3L2RA 2XY6A 4F2SA 2CKWA 3KHGA 4GW6A 2YNIB 4NLOA 4MIAA 4TXSA 1KCFA 2PYLA 4CIGA 1HNIA 2F96A 4FLXA 3EPGA 2OA8A 4PA1A 4NLVA 1IKWB 5F9NA 3OYFA 4IH6A 3QEWA 4PY5A 2IM3A 1EP4A 1XHZA 4IG0B 3ITHB 2XC9A 1J54A 3RAQA 3T1AA 4DF8A 5FDLA 5F8JA 3ZSVA 1VRTB 3TABA 1NK0A 1N6QA 4ZPBA 1BQNB 2YNFA 1JLFA 3NAEA 5KFVA 1S6PB 3RB3A 4DU4A 5CZ1A 3EZ5A 2FJXA 3V9WA 3CJ5A 4B08A 3KLEB 1TKXA 3HSTB 4TYBA 2W9BB 1RDAA 3FRZA 5D3GA 2RDIA 1N48A 3I0SB 1TAUA 2AWZA 3T5KA 4ZHRB 4M3WA 1ASVA 1RYRA 1HPZA 1S49A 5I42B 4DMNA 4K8ZA 3PX0A 2P1JA 4LH5A 2R8KA 3TAFA 1RDRA 5HP1B 2Z1JA 4ECYA 2W7PA 2XWYA 4FLZA 3KD5E 3K57A 2P5OA 1HQUB 3NHGA 2FJWA 4DQPA 2DFHA 3RTVA 4R0EA 1S9EA 4PUOA 3UIQA 1VSKA 3BSNA 4QAGA 3NGIA 3HK2A 3KLVA 4ZP9A 2IA6A 4BWMA 4EBDA 1S9GB 1WNEA 5T7BA 1YVUA 2BDPA 3L3UA 1R0AB 1L5UA 4MK7A 3Q8RB 2YNHB 4QCLA 1RT7B 4ELUA 3L3VA 2HAIA 1S1TB 4CECA 2QK9A 3BSOA 1YT3A 3OYIA 4FJKA 4MFBB 1X9MA 3HKWA 3H2LA 4K4TA 3PW2A 3LPUA 4CJ4A 4I7FA 4PWDA 4MFBA 4E1NA 1LWFB 1CXQA 1BQMB 4RW4A 4CIEA 1S1TA 3FFIA 4FJ7A 1CXUA 4CJFA 4DTOA 4B8AB 1CLQA 3E01B 3OL6A 2AGOA 2HNYA 4WZQA 4CEFA 1T05A 4IFVB 1SH3A 3SFUA 4AHRA 1TKZB 4O3RA 1TVRA 4M3YA 3RMDA 4OKEA 1TQLA 1QSLA 2BE2B 2OPSA 3O4NA 1UA1A 3MEDA 1IG9A 2E6MA 5C24A 3OYMA 4CEZA 1HNVA 1JIHA 1U45A 4CK2A 2OYQA 3BQ0A 2FC0A 3TANA 4ICLA 1MU2A 2AGQA 1I6JA 4F8RA 2VG6A 3QETA 3C95A 1S1XB 3QGHA 4CCHA 1HRHA 4ZPCA 1JLGA 5KFCA 1LWFA 2DPIA 5KG1A 2RF2A 3F9KA 4O55A 4O44A 3NKYA 2HVHA 2XI2A 3VQQA 5J2MB 4AHSA 1S6QA 1VRUB 4ED1A 4KAIA 3CYMA 4R5PB 1TV6B 1WSHA 2VWJA 2YHBA 1RBUA 4LD0A 3V1RA 4OKKA 3AVHA 4FZZA 1LW2A 1JLCA 1ASWA 4ZP8A 1NKCA 3ASMA 2XI3A 4H54A 5JS1A 1C0UA 3V4IA 4KO0A 4CF8A 1SV5A 3VQEA 1Z26A 1NOZA 4TLRA 4FJIA 1KLMA 3ZSWA 3NH1A 3MEDB 1IKVB 2V4QA 4IRCA 5F8IA 4DTRA 3OLAA 3V9ZA 2HWIA 1HQEA 3BGRB 2OZMA 4YR2A 1D8YA 5DQIA 4KI6A 3SNNA 2HHXA 3OSNA 5J2NB 3SUNA 4LSNB 2HHUA 3NF7A 4ZHRA 4IFVA 3OYBA 2XGPA 4KHYA 4CJWA 4E7HA 1K1SA 1RTJB 3HVTB 3VQ6A 3Q8SB 3H4DA 4JLHA 3HPHA 3MFIA 4EBCA 3DLKB 4YP3A 3DLHA 4ID1A 3F73A 2ATLA 4QW8A 4BWJA 3HVRA 3CFPA 1SKWA 3FFIB 4B9LA 4ECZA 3QIPA 1BQMA 4FK4A 4KB0A 4OL8A 1UWBA 2BRLA 4NLSA 3TAMB 4TSXA 3DRRB 1S4FA 3IGNA 3LP0A 4HTUA 4O3OA 4FZXC 2YNFB 1UA0A 3RR7A 4FVMA 4EP4A 5DLFA 4YR3A 4CF9A 3OYDA 4DSLA 2GIQA 4K4SA 3ZSZA 4I2PA 4RNNA 3OJSA 1GX6A 4ECRA 4MQ3A 3IS9A 2R2SA 2B4JA 3P1GA 1EP4B 3BSAA 4ECXA 3GYNA 5C25A 4X2BA 2YNHA 2HNDB 4JRPA 1JLBA 2FBXA 2R8JA 1HNIB 3QIPB 5KFKA 3ULDA 3DOKA 4FJLA 4FBTA 5L1JA 4ED6A 3AVIA 3PR5B 4H4OA 3NMAA 2G8KA 3OS2A 2UVUA 2VA3A 1TK8A 2ZD1A 4Q8EA 4KKOB 3CG7A 1RCHA 4K4ZA 5KFAA 1ZETA 2HHSA 3AA4A 2G8FA 1SH0A 2GBZA 4GVMA 4ED2A 1ZBUA 2YKMB 1WSFA 1N5YA 1J9AA 3SJJA 3G6VA 3AO1A 1J5OA 2C28A 2IS3A 3G0ZA 2AU0A 2Y1JA 4ZP7A 3M8RA 4EZ9A 4J9OA 4AILC 4FZYA 4CGIA 4FJ9A 4DU1A 2HNDA 3KLIB 4CGHA 2IJFA 1CZBA 3HJFA 3C6UA 1EETB 3KKSA 2FVQA 4I2PB 1SL2A 2HB5A 5CYQA 1Q8IA 1S6QB 3BREA 3VA3A 2RN2A 3SV4A 3QGGA 3AVFA 4AHVA 4ZVEA 3M8PA 2ETJA 2B6AB 1XR6A 4O44B 3LP0B 1S9FA 5KFZA 3RWUA 3OYGA 4FCYA 3SQ2A 5DG7A 1U49A 1C0MA 4GMJB 4KTZA 2YNIA 4CE9A 1C1BB 4YR0A 1A5VA 4HYKA 1GOAA 1J5OB 4ED7A 5KG2A 2E9TA 2BQRA 2HHQA 5KFPA 4CGJA 5KFJA 1XWLA 3KMQA 4WXWA 5EWEA 1KSPA 2IC3B 2R2UA 4ZPDA 1HMVA 3WNFA 3TVKA 3KLGA 4J9RA 4AHCA 4LSLB 2ZE2B 4IG3A 1JKHB 3EZUA 4ZVFA 4M3TA 1TGOA 1KLMB 1N4LA 1VSLA 1T05B 2QV6A 2C2EA 3DOKB 4LH4A 5F8MA 5F8GA 3NL0A 4N56A 3QINA 1XC9A 2X74A 4E0DA 2BQUA 1W25A 4FLVA 4FJNA 1MMLA 1JLEB 3MTKA 1VRUA 4EYIB 2YNGA 3MF5A 3BQ2A 1LWEB 2VG5B 4ECTA 1FKPB 2F8SA 3HP6A 3U3GA 3V6KA 4O4GA 4DL5A 3ISNC 4LY7A 5KG7A 4J9NA 4CEQA 1NK4A 1ASUA 2PYJA 4B9SA 1KVBA 2G8HA 3THVA 1A5WA 4ICLB 4WE1A 4FLWA 3FDSA 4JS5A 4DL6A 5KG0A 1L3UA 5HLFB 3GILA 1LV5A 5C24B 4YMEA 1O1WA 4DFKA 1NJWA 3AO2A 5EWGA 4KREA 4H4MB 4DL3A 5KFDA 4ECSA 4BDYA 4NLPA 1D1UA 4N76A 1VSIA 2OZSA 4NRTA 1DLOB 1EXQA 4M42A 4OPKA 3CJ4A 4KRFA 2UVRA 3NAIA 4DTJA 3NF9A 4BACA 3LP1B 4CJRA 2FVSA 2W9AA 1CZ9A 3G86A 4J9QA 1TKXB 3QLHB 4QWBA 1QE1A 4CJEA 1JXBA 1C1CB 4CHQA 4IFYA 4C8MA 3G10A 3D0PA 4ED8A 3ZCMA 4Z0UA 5KTQA 1RBRA 4E7KA 5KG4A 4EEYA 4OJRA 3V81B 4CJPA 4NCGA 4NLQA 3VQBA 1KHVA 1VSFA 4CJLA 2W8KA 1ZBHA 1REVB 1JX4A 3PX6A 3MR5A 2DFEA 4WFYA 3WNEA 5J2QB 3H5YA 1KFSA 2B5JA 4F4YA 3AVGA 2VG7B 2I5JA 4FLTA 1WSGA 5KFNA 3OYCA 2XCPA 1BI4B 5EU7A 3QNOA 4IDKA 4OGCA 4IR9A 2YNGB 4URGA 4CJUA 1J53A 1XR5A 3MEGA 3QGIA 4JV2A 3ZSOA 3VQ5A 1QAJA 4U6PA 1XR7A 1C2PA 4FJ5A 1LW0B 3UPFA 2Z1HA 3KK3A 3QEVA 2AX0A 3E01A 3ZT2A 1SUQB 3OYLA 4DSFA 1TL1A 4CJKA 4M3RA 4F3TA 3EY1A 3EYZA 2G8IA 4RW4B 2EX3A 3HT3A 4DQSA 4DFMA 3V9UA 3QYYA 3RRHA 4PWDB 4FW1A 1TL3A 4DSIA 3OSPA 2V0NA 4KBIA 2OPPA 4KSEB 3M8PB 3S3NA 2IC3A 1A5XA 2HHTA 3K5LA 2AQ4A 3WNHA 4M41A 4EP5A 5J2PA 5KFGA 4F50A 2Z1GA 1BI4A 3U3YA 3PO5A 2FJVA 1QHTA 1ZYQA 3V9SA 5HRRA 3LALA 1JLQA 1OS5A 2W8LA 1BGXT 3LZJA 2VG7A 1S1VA 4TY8B 5KFFA 4J9PA 4KE5A 3KD1E 3N6MA 2ASJA 4FW2A 3DLRA 1BCOA 5KG5A 2D0BA 4FM0A 4JV1A 3FQLA 1F21A 3GIMA 3SQ1A 4KPYA 3SUPA 4ED3A 2BANB 3DOLA 5J1EB 2OPQB 1KVCA 3C6UB 3ISND 5KT2A 5EWFA 2R8HA 3QIOA 2QXFA 3SYZA 4CF2A 1ZBFA 5KFRA 3OHAA 3T19A 3AO3A 2ASDA 1ZTTA 4J9KA 1WSEA 4KHSA 3S9HA 1WSJA 2O4GA 4DQRA 4OLBA 3O4QA 2FVCA 3MR3A 2J6UA 1XI1A 4AH9A 1B9DA 1RBSA 3GIIA 4F2RA 2DY4A 1S6PA 4O3QA 1ZTWA 4W5TA 2J6SA 1WAFA 3MAQA 5KFLA 3CFRA 1XHXA 1D9DA 4B9NA 2BANA 5DQHA 4EO8A 4KTWA 3AVCA 1ZBIA 3CVKA 4DQIA 4TQRA 4H4OB 4J9LA 1NHVA 5KT7A 3KNAA 1JXEA 3K58A 3RB0A 3AA2A 4W5NA 3NH0A 1RNHA 4B8CA 1JLQB 1Q9YA 2IM0A 2I5JB 4GC7A 3K2PA 4DS4A 5KFWA 5DK5A 1TAQA 2D3ZA 4DSEA 2OH2A 5CYMA 5J2QA 3DMJA 1D9FA 3QEIA 4NLTA 3VQDA 5HROA 3GV7B 4CERA 3I8DA 4MK9A 4BE0A 1WN7A 1VK0A 2W9CA 1G15A 2JGUA 1LWEA 3BJYA 4HUFA 5K14B 1VSHA 3LWMA 3D28A 3LPTA 4JS4A 3SV3A 4FJHA 5KT3A 1QE1B 1LWCB 3OYHA 3GV5B 3TR8A 4CJ3A 2LSNA 3QO9A 1K1QA 1I39A 1RTJA 3HVTA 3OYNA 3WNGA 4H8KA 4BDPA 1IKYA 1S1UA 2WCXA 3OL8A 4QPXA 3ZSRA 1KHWA 2KQ2A 3QIDA 4Q8FA 2JC1A 1SKRA 1RA6A 3MFHA 4R5PA 1KTQA 1D0EA 3VQCA 3OVNA 3OL7A 2WB4A 4KV8B 1RT2B 3C94A 3DYAB 4RW9A 3O3HA 4CHPA 2R8GA 5KI6A 2X6NA 4F4KA 3K5MA 4ZTFA 4WE1B 4QW9A 1MU2B 2DTUA 4EO6A 4ED0A 1NK8A 2WOMA 5FRNA 1LW2B 4KHQA 4O4RA 5J2PB 3HHKA 3NAHA 4O0IA 3MXIA 3H40A 3CDEA 2XY5A 3I5CA 1S1WA 5F8NA 4G1QB 1U47A 2D41A 1SKSA 3TWHA 1CSJA 3V81A 5EDWA 1FKPA 2IAJA 4DQQA 4B9MA 3H4BA 4RW7B 4Y3CA 1JLGB 2KZMA 3IRXA 1BHLA 1X1PA 3QEXA 1QTMA 3S3OA 3KOAA 4GC6A 4IOBA 3LP1A 3FQKA 3OLBA 2ILZA 3KLHA 1HNVB 4RW6A 2WK4A 5KFEA 1RT2A 4CK3A 4CEDA 4PUOB 4DEZA 4CHNA 2JC0A 5DMRA 1ZBLA 5KFXA 4EBEA 3CDUA 1WAJA 1TKTB 4Z4FA 4RNFA 4H4MA 4DLGA 4KHRA 4O3SA 4CHOA 5HROB 1S1WB 4Y2CA 3LDSA 2Y1IA 2HHVA 1HYZA 4URSA 3AVNA 3BR9A 4DU3A 1WSIA 5DQGA 5KT6A 1RT7A 1QS4A 4FJMA 3H08A 3HM9A 4K4UA 3KMSA 2C2RA 1TKDA 1S9GA 1L3VA 1JLAA 4K4YA 1JLBB 4F4XA 4HHTA 4I7FB 4OGEA 4FJ8A 2C22A 3T5LA 4FBUA 1GX5A 1RBTA 4DF4A 2FVPA 2G8VA 3I0RB 1IO2A 2V9WA 5CYQB 5HP1A 3SQ4A 3CO9A 4ZVGA 4W5RA 1KVAA 2HNZB 4Z4EA 4YFUA 3QLHA 3B6OA 3UQSA 1U48A 5KG3A 1GOCA 1NKBA 5DLGA 5F9LA 3Q8QB 3K5OA 4DTUA 3QO9B 4K4VA 3PR4A 3JSMB 3VA0A 2W42A 4C8LA
chains in the Genus database with same CATH superfamily
4DUZF 2M70A 1RFQA 4YDUC 1U0HB 3L2VA 3OUYA 1FK9A 4CFDA 1W26A 2XSFA 4AHTA 3OJUA 1N5TA 1HHTP 2IBOA 4IZ9A 5DGAA 1R8CA 4JOUA 3VQ8A 3GJQB 5AQJA 3DMJB 2DCLA 1N56A 1NM1A 2E5LK 2VODA 4BE2A 4A46A 3HHLA 1IM4A 1F3VA 3A5MC 4J9SA 4CJQA 3FMBA 4F4AA 2DO0A 4OIXA 3D45A 4BR2A 3B4DA 1NSKL 3DLEA 1S12A 2I6WA 4WCEQ 4LQ9A 2UU9F 1ZA2B 4QPTA 2IA0A 5IT0A 1WDDA 3MOZA 4HACA 1HKCA 1YTAA 2HNZA 2K7KA 1YJNN 3HPGA 3LPEA 1YQHA 4FJGA 5A2QO 4JKAA 3DRPA 3SDEA 2BJ7A 2O3DA 4YQWA 2EHGA 4JBCA 2BQ3A 2F8TA 4E2FB 2UUCK 5D0HA 4KFBA 3CCWA 4E7IA 3DGVA 3HXMA 3MM9B 1CJTB 2XRIA 3ETOA 5SZTA 1HNZK 4AFFA 4ZJQA 1RAJA 2QA4G 3OVAA 2AMCB 1FT8A 2OEMA 3GCWP 2GHPA 1XMOK 3MEGB 3HT0A 1K9MT 5JVHL 3BS9A 1QVFM 2UUWA 4G3IA 1WI6A 2UXCJ 5JLFA 4HI1A 1Q16B 1WG1A 4AYBD 2HURA 2MTLA 3KJVA 3HHEA 4TY8A 1WOOA 1G2EA 1TL5A 2A10A 2DY9A 3NGKA 2VQFF 4XH5A 3DM2B 2FHKA 4EWTA 1U04A 4NLXA 1VQ4S 4DPWA 5IM0A 2MY7A 2ASMA 5KFUA 2VFUA 4DR4K 1ZPWX 3EDRB 2XLIA 4CH1A 3G4SN 1VQSA 3QNWB 4CTAA 5LSOA 2OPPB 3O4WA 4C8OA 5L46A 3IBWA 3G6YA 3LL3A 2CH6A 5FLXU 4H5WA 4WFAQ 3N4PA 3LZIA 2CPYA 2IBKA 2QT7A 2XSJA 1L3TA 1IKXB 4B3RK 2I38A 5K8NA 1NG9A 2FY1A 3CMES 1NHKL 3AQOA 4NZ7A 1V6HA 1S76D 4FJJA 4AUKA 2C3MA 3I5BA 1E3MA 3BGRA 5E3CA 2LU1A 1IBKF 3FZFA 5D4LA 3LP2B 3W3DA 4IFYB 4TNOA 3MPYA 1HKBA 1JCGA 2EKNA 2CGLA 3RB6A 3IAM9 1RWNB 3E51A 2PFDA 2V63A 3QZ8A 3MMCA 5EN1A 5T7LB 1FCAA 1Y4ZB 2MQLA 4K43A 2F9JA 3AV9A 2Z57B 2CPHA 2VL1A 4CLUA 4JI3J 3RMCA 3AY9A 1AYEA 3MCOA 4KTQA 5IWAF 2NQPA 3CC7N 5IC4B 4RW7A 2FHOB 3C6TA 1YUWA 2PFFB 2YHAA 2DH9A 4KB1A 3JB9k 2IMOA 1P27B 4JKBA 2E1CA 3SFGA 5KFIA 3Q22A 2QMWA 3BPSP 5HQ8A 5IOLA 5E41A 3MCNA 2ZWOA 2MGZB 1GLFO 3FZKA 3CFOA 2N3LA 3H5XA 1YBUA 3PHEA 1HWIA 2YX7A 1WHVA 4C8KA 2DXFA 4DTNA 2AEJA 4NLWA 1YVFA 5C42A 5CYJA 1VQ5N 1S99A 2ZH4A 2R7VA 4JI8F 1JLEA 1NKEA 3DDKA 3VGUA 4BRDA 2YH1A 1TKZA 4ZCLA 4NASA 2B7CB 4NYNA 4J2EA 2YKNB 1JNZB 4FM2A 2HQGA 4B3RF 3NOCA 3FZMA 1U8WA 1NDPA 2HNYB 1HWKA 1K8KB 2IMWP 4LBHA 4O8UA 2ZBCA 1BIZA 2XNRA 3IRXB 4K0KF 3ET6A 1VC0A 1T03A 4S0MA 4CO3A 1PC5A 3MX5A 3KHYA 3KTQA 7FD1A 3VQAA 3MM5B 4EZ6A 3IWNC 1BIUA 4QYZJ 2BKPA 1KFDA 4M3XA 1VBXA 4NWBA 3GONA 1QQNA 4H0VB 4OLAA 4FXVA 2EFQA 2V2ZA 3E2EA 1BCMA 3E3XA 2J0WA 2J6TA 4DV2F 4MDAA 1H2TZ 2NXEA 1QVGM 1QAIA 2HFOA 5I3UB 3DLGA 2KTQA 4DPYA 4QYZK 3EN9A 1WUUA 4DPUA 3AVBA 2P2CB 1SIZA 2MZRA 2GMLA 5BN9A 4DV6K 1JL1A 3I55S 3EGWB 5FLXY 1C0TA 2NZ4A 4KKOA 4CZJA 5LJ3Y 1FK9B 2XTJP 1O0PA 3B78A 2O67A 1Q86T 1P8GA 5T7LA 1WORA 4LF9F 4LF6K 1S7IA 4DR2F 1RAIB 5HBMA 1RB0A 2PSZA 4L3QA 2YKMA 2DTJA 3KZBA 5K14A 1FXDA 1YF5L 1WG5A 3LDOA 4C8YA 4L3KA 4RR5A 1FVQA 4JRQA 2FBVA 3VQ4A 1W7AA 4OI2A 1HWJA 2E4LA 1KR4A 4LFAF 1BG3A 4P74A 2IYIA 4YB6A 3ZTPA 3DI6B 4Z4CA 2HGMA 3W65A 1XMBA 3M8QB 2Y1RI 3LGHA 1GXLA 2B5JB 3KK2A 2HVIA 4Z4IA 2AT1B 1U1LA 4QWAA 1FJCA 3AVMA 4ID5B 4K4WA 1KWMA 2QZ8A 2BOAA 1DQAA 2F9TA 4HCBA 2YHXA 3MEEB 2O5DA 1Q8LA 4BROA 4CLYA 3ZSQA 2FD2A 2FZGB 1NNDA 3CCSS 3I0SA 2MQQA 1HNWJ 3MXHP 4B9QA 1QSYA 4O5FA 4NRUA 4YHHF 2CFXA 2VCPA 4YNQA 4C98A 3A5LC 3J81j 3LOUA 3JSMA 3V1OA 4XPCA 3CJ9A 1VGYA 4CP5A 2FGOA 2AP1A 1U09A 4FWQA 4IRKA 2L9WA 2X6SA 2YH0A 1DLOA 1JCEA 1Y9OA 3DOLB 2F8MA 2W2OP 3NLCA 1UAXA 3PW4A 4NYFA 3CM6A 1YLXA 3MXJA 1X31C 3CCJN 4GVEA 3P5JA 2B3TB 4IOAQ 3EGVA 4NEZA 2WOMB 4YB1P 3DHXA 2ROPA 4IO9Q 2UZAA 1YBTA 2EG1A 3M9MB 4HT5A 3SQOP 1B70B 3P39A 5T41A 4F3OA 4MAKA 2PBDA 3HJVA 3LAMA 2B8QA 3MXMA 2WHOA 1KC8O 1RT6A 5M1OA 4A8YA 2GJFA 3CTRA 1S48A 2ILYA 4QZVB 1X60A 2LMIA 4CI0B 4CGFA 4DPXA 5J1NA 2KDOA 1X4AA 2FVRA 3THYB 2BE2A 4PL8A 3N6LA 5A8WA 2HZVA 5KPZA 2J8AA 5GADP 1SL0A 2GMHA 5HRPA 3RR8A 4KHWA 4LF7F 3SQGB 4OI0A 1VQNN 3UCUP 4WQ4C 1UL3A 4JYAK 4ANCA 2QL9B 3KLHB 1XUPO 2DR7A 4HHUA 3ZZRA 2AP6A 5H9EJ 1NB7A 3VF0B 2BR0A 3TUZC 3NG8A 3LDQA 1TV6A 5KFTA 2DHXA 3M6WA 5E3AA 4ZTJA 2Y3YA 2W9CB 2FBTA 3MCSA 4X64K 3IAYA 5HANA 1BUPA 3ZX3A 4DR1J 5CYMB 3K5PA 4Y34A 1HNZJ 3DWLA 1N34K 1HYVA 2R7YA 5EUHA 1OO0B 3CCVS 2B43A 1CULB 2JEJA 4NLDA 3DYAA 3ILOA 2DYAA 1HARA 2B6AA 3NGRA 1IH7A 1TL7A 3E9LA 2CPFA 4P71A 2E2NA 3RRKA 3NFAA 1RBLA 4E7LA 5I42A 2X3DA 2G8WA 2W7OA 4OX9J 2IDOA 1YRUA 3KJFB 2PN6A 1Q82O 1GLCG 2RU3A 4LRAA 2YWHA 3CCRS 3NVMA 3M3ZA 4ZPAA 5AQSA 2RHKA 1VMBA 4K25A 5AQNA 4PL7A 1X4BA 4BG8A 2QN6B 1JKHA 1ZBSA 2ZHAA 1J5EF 3VEYA 2MKHA 3F41A 1JL2A 1K47A 3L7UA 3MEEA 2OI2A 4AL5A 4BE1A 4M5IA 2QM1A 3D7SB 3OW2R 3BY5A 5FROA 2AA4A 1VQ9S 2ITGA 1YDLA 3HPOA 3CCRN 2OANA 4IR1A 1KQSR 2ASOA 4K2JA 2JWLA 4MIBA 3ZZUA 3IS9B 4PCQA 4BRLA 2VG5A 5BRFA 1Y5NB 1IBLF 3MK6A 4DN9A 3VGTA 3P49B 4PQAA 1UOCA 1LCUA 4LR7A 3NE6A 4D3HA 1VQPS 2PDAA 5TKYA 4F3QA 2KFYA 2Q0RA 3A5OC 1EZZB 5DS7A 2UVWA 3DLEB 1KKHA 3OYKA 3LO3A 5M2PA 2IVPA 2WVDA 1K8KA 3VAHA 2I7PA 4M63A 3AA5X 3NF6A 2RVJA 3MECA 3VQPA 3J80Y 4IO8A 1HYSA 2DNGA 3U7JA 4N77A 3R5CA 5C5JA 4FLYA 4CDIA 4PG6A 2CG4A 4LR9A 2UV8G 5A0YB 1J27A 4GV3A 4Q0BA 1DTTA 2G0CA 4CFCA 4OMFG 2NRTA 2YNIB 1KCFA 3BKUA 2F96A 3NVKA 5HMZA 4FLXA 1YJWN 1SJQA 2OA8A 5D77A 4A8KA 3UN3A 3OYFA 4IH6A 5THWA 2AW0A 3R9PA 4IG0B 3ITHB 1ZM9A 5JJBA 5F8JA 2GFFA 1M90O 2KYXA 2FUG9 4BR4A 3T41A 5IXUA 2PI5A 2Y8WA 1P9YA 3CC4S 2LEPA 2QSFA 4NXMJ 1XNQJ 5CZ1A 4P2XA 2YKAA 3TUIC 3NCRA 1OJ4A 2HZAA 3CJ5A 3IR7B 1TKXA 2FHJD 3HSTB 3WQUA 2W01A 5L39A 2W9BB 3FRZA 2RDIA 1N48A 1VQ6S 3I0SB 4U9RA 4JV5F 4UUXA 1H3DA 1S49A 3C8YA 3SLCA 3PX0A 3CCMN 5DETA 2R8KA 4OZJA 1RDRA 5HP1B 1Y5LB 3H20A 4ECYA 1WKLA 2GGPB 3K57A 3ILIA 3LF0A 3NHGA 2CQ0A 1S9EA 4PUOA 1J6ZA 3OTEA 3BSNA 3NGIA 3KLVA 1I94K 4ZP9A 4EBDA 3L3UA 1R0AB 3Q8RB 3VEXA 4L75A 4IEIA 1NBEB 4CECA 1BDGA 4XDDA 4MFBB 3FVYA 2Z58B 4B1XB 4XDCA 4I7FA 3TZXA 3EL2A 1BA0A 1LEOA 1BQMB 3CXCM 4H5RA 2VBXA 2CQIA 1F2GA 5DO2A 4ALZA 2VJVA 4FJ7A 3LM2A 1CXUA 2EPIA 3A8YA 4B8AB 5ETPA 3NP5A 1UW4A 4WZQA 4CEFA 3NY0A 1SH3A 2BACA 2KT2A 3PSFA 4DR7K 1TKZB 3RMDA 4OKEA 2X3GA 3PTWA 2BE2B 4U96A 1HBUB 5IQ6A 2RRAA 2A2DA 2XZDB 4OZLA 1G3OA 2VFSA 1JIHA 1WI8A 2AJ2A 2FXUA 3MM7B 3CCUS 1RAHB 2CZ9A 1RP5A 3OPKA 1QJHA 2FC8A 4OYPA 1I6JA 4X4PA 1VQKN 4P2SA 3QETA 3C95A 1S1XB 4CCHA 5KFCA 3EVWA 2PEBA 1UTAA 3RUBL 1YVNA 3M32A 3QQCD 4O44A 4DV6J 3CJQA 4DPOA 4PABA 5B0GA 1GAOA 1IBMF 4BC2A 4ED1A 2HS4A 2ROEA 2CNLB 2R42A 4UZBA 3O1LA 1RBUA 4OKKA 3H1QA 4FZZA 1JLCA 2BE9B 5AQGA 2XI3A 5JS1A 2MEWA 2JDJA 2MJUA 2PIIA 2JFKA 5BR8F 4KO0A 3M2RB 1SV5A 1YBAA 2K7JA 2UUAF 3VAJA 4DTRA 1VHIA 1F5CA 2HWIA 1HQEA 1GLBG 2ZHOA 2VZ9A 2HHXA 5J2NB 4DR7J 1XMOF 4LSNB 3SUNA 4UQTA 1ATSA 4ZHRA 4IFVA 3OYBA 5IV4A 5GAGI 3BV8A 2DH8A 1RTJB 3HVTB 3VQ6A 3Q8SB 4JLHA 2YHYA 1Q5VA 2D3OR 5LOQA 3PG9A 4QW8A 3QSYB 3CFPA 4QR0A 1DZ5A 2A6OA 3Q8VA 2BRLA 4TSXA 5D0EA 2ZNZA 4CI6A 3LP0A 3I31A 4X4NA 4FZXC 4J90A 1SAZA 2YNFB 3DRYA 9ATCB 4JKGB 5M2UA 1RKJA 3L7OA 4CF9A 2GIQA 4NEYA 4K4SA 3HF5A 3VMFB 4H5TA 1UEKA 4LREA 3OJSA 2N7YA 3IBCB 2R2SA 1EP4B 5A8KB 3BSAA 4ECXA 3CGIA 1AZSA 4JI1F 4M5DA 3AAPA 2Q36A 2VOPA 1HNIB 5KFKA 3ULDA 4XEIA 3OFFA 3PRDA 4FBTA 5L1JA 4ES3A 1NAQA 2V8GA 1TK8A 2ZD1A 3NEKA 2FY8A 4KKOB 3IA0A 4P7TA 5J1PA 3QAEA 3JXOA 2WC9A 4X64J 1NGFA 2D9OA 2RQMA 2CUYA 4OZ2A 2HQCA 4ED2A 2YKMB 4BRKA 3GBTA 4MKYA 3C15A 3W1YC 1J5OA 2C28A 1TL4A 2AU0A 3BBFA 4J9OA 4USWA 3JAMU 4PHTX 2MKCA 4JI4F 4Z37A 5GAGU 5I9EB 2VONA 1N36F 4DR3K 3CC7S 3T6BA 1EETB 3KKSA 2FVQA 5CYQA 4YN3B 4DR4F 3WC2A 2RN2A 2I7NA 3QGGA 4ZCKA 1BU6O 4U7UK 3UDCA 3RWUA 1EJ7L 2YWFA 3SQ2A 5DG7A 2ZM6J 1FI4A 1T9TA 1MWZA 4KTZA 5BR9A 2YNIA 1C1BB 3J7ZT 2EWHA 4GNIA 4ED7A 2DO4A 2E9TA 5KFPA 2VUGA 4C11A 2ZNYA 4I0WA 5EWEA 1PAEX 4ZPDA 2VDIA 1HMVA 3G82B 3KLGA 8RUCA 2B51A 1YGYA 4JI8K 2ZE2B 4IG3A 4DV1F 3CF5Q 4ZVFA 5C12A 1YJUA 3FRYA 1VSLA 3NCQA 1T05B 2KO1A 2J0SD 3D2EA 1HPMA 3RAMA 2QI2A 3NL0A 1V9OA 4N56A 2A6AA 2X74A 3BBCA 4E0DA 3I56N 2MZ1A 4EGLA 3IWXA 2UXCK 3MTKA 3S6EA 4CNZA 4EYIB 3FEYB 2B4OA 3TW0A 4RWXA 2F8SA 4ES2A 3HP6A 4YY3J 2E2QA 3U3GA 2ZH8A 5KG7A 1F5AA 3ET6B 1ASUA 1SC1B 3DRXA 2HF3A 2MXYA 3M1VA 1S57A 3FEXB 4WE1A 3O6QA 5E2QA 3NMRA 3O1WA 3FDSA 3WQPA 2P9NA 3D6HB 5KG0A 1YG0A 2V2VA 3TSQA 2H48B 1LV5A 5C24B 3EJMA 2DH7A 1NJWA 3ZZ0A 1FRLA 3SBMA 2HQFA 4NLPA 3MMBB 1D1UA 1VSIA 2J0QD 3VENA 1EXQA 4OPKA 3CJ4A 4ILMA 1BO5O 1HHSA 4DR6J 2APOA 4KRFA 4KH6A 4MDBA 2NYHA 3NAIA 3NF9A 4BACA 1JWWA 2W9AA 3G86A 4PKIA 3DXMA 4DUZJ 4CJEA 1RE1B 3J8AA 3G10A 1FESA 1UEVA 3ZCMA 2ABYA 2B4VA 5KG4A 4NCGA 2GCFA 3QT8A 4MKVA 1VSFA 2E5JA 2C2MB 3C2PA 3GP9A 1ZBHA 3PX6A 4O23A 5J2QB 3FLCO 2M7SA 3H5YA 1NDLA 2H4WB 1KFSA 4F4YA 3AVGA 1GLDG 1Y00A 2CYYA 2UU9J 3H2UB 1RHRB 5ADZA 1WSGA 2XCPA 2P9SA 2DGSA 5EU7A 1YIJS 5AJ3J 1WF2A 5D0GA 1N5SA 4DV4F 1Q81T 5DDPC 1Q7YT 2GX9A 2KB2A 4WJBA 3NWRA 3RYLA 2CNOB 1XR5A 2DK2A 4DUYJ 3QGIA 2LFVA 2J7WA 1QAJA 3MGJA 2VD3A 4FJ5A 5LSRA 1RWKB 3OA9A 3PXGa 1ICEB 1QLNA 2GWJA 3QRPA 4PR6A 1HNXK 1GXTA 2ZWHA 3MPUB 2A3JA 1AW0A 3JTPA 1TL1A 4JAXA 4M3RA 4F36A 3EYZA 2G8IA 3HHDA 4DX5A 5LJVA 4C1NI 2RUSA 2WBNA 2V0NA 1BD6A 4KBIA 4KSEB 3M8PB 1KONA 2HHTA 3K5LA 3WNHA 3J7YP 1NU4A 1TFWA 3QRQA 4EP5A 5J2PA 3D1QA 4F50A 2Z1GA 1FNXH 4ISFA 4G1PA 3PO5A 1VQ5S 3IR5B 5DZ6A 5HRRA 4CO2A 3LALA 2GVDB 4Z94A 2W8LA 3LZJA 2KLAA 1S1VA 1NJIO 5C2DA 3CJ1A 2ASJA 4BRQA 3D9BA 1S72S 2LECA 3HHLB 1BCOA 3K8VA 1F21A 2AKWB 2BANB 2BH1A 2OPQB 3C6UB 1RK8A 2XMAA 3E9PA 4QYRA 5CZXA 3VR1A 2PFUA 3WXLA 4B1YB 1ZBFA 1SC6A 4KC5A 3CULA 1U2FA 3W5ZA 4FPIA 2UUBF 4J9KA 2O4GA 2JL9A 3HCXA 2CIMA 2KHCA 1XI1A 4A48A 3ADAC 4O3QA 1ZTWA 5F41A 3IM9A 5A8KA 4NZ6A 3WX4A 1VK8A 3D6TB 3OXLA 5L9NA 1XHXA 4B9NA 2QA4S 1IBKJ 4EO8A 1Q53A 3M7VA 4DV4K 4H4OB 1YWXA 2VYPA 1KD1O 3PYEA 2Y0BB 3KNAA 1JXEA 5E33A 3DFEA 3AA2A 1RNHA 2UU9K 4EFAC 1IM6A 1NBWA 1FJGK 3QT7A 2D3ZA 3H0PA 5CYMA 3UE5A 3BGFA 4RWWA 3OR1B 3DMJA 2DNYA 1D9FA 3CCTA 3VQDA 3HHLC 1FFSB 4DKWA 4H4KA 4LF8F 1LWEA 1U1MA 1MLAA 5K14B 1X7VA 4CWBA 3T1YK 3D28A 3SV3A 4JS4A 3P4UB 4LF5F 3W2WB 1IQTA 5KT3A 1QE1B 5C2FA 3OYHA 2M88A 3O9QA 1X3NA 4CJ3A 4O0NA 2EFNA 3IDHA 1XJWB 3POTA 1S1UA 1VQON 2J0XA 4JI0F 5TKWA 3ZSRA 1KHWA 1VQMS 4BR7A 1RA6A 3MFHA 3ILJA 4QR1A 3IFEA 3EWGA 3OL7A 4H5NA 5H9EK 5KPTA 1Y5IB 3A4TA 2ZHBA 1D9AA 4GKJF 3AD7C 3M2RA 3O3HA 3SCIE 2R8GA 2VH7A 3JTOA 5AXKA 4WE1B 1QD1A 3IUCA 4L6V3 1MU2B 2DTUA 2HFNA 3AAQA 3MCAB 3GL1A 3HHKA 3NAHA 1CJUB 2O8FB 1BWVA 1D8ZA 2BOPA 4OLOA 2D41A 2WW8A 4X4UA 5IV3A 4RTFD 4FWMA 4RW7B 4N8OA 3SAFA 3CF5L 2NPIA 2KZMA 1K73T 1V4SA 4KJIA 3LDPA 1BHLA 4LRDA 3QEXA 4WBFA 4BGBA 3S3OA 3ENOA 4B3SK 3VZHA 3M6UA 3WC0A 2AZ3A 1PJ5A 3W9IA 1S79A 1HNVB 4RW6A 2DGVA 1B7YB 2N3OA 4CK3A 1M5OC 1XMQK 4FF1A 3CCLS 2YTCA 4M7XA 1ZBLA 5KFXA 5A2QU 1XN9A 4ZCMA 1WAJA 4G1IA 4DLGA 4DV3K 5AQKA 4CBUA 5LY3A 2VKRA 4CHOA 3HFKA 1M1KO 1WF0A 3MHYA 4MIWA 1HYZA 1NMEB 3LUYA 1HW9A 3HSDA 1OPZA 2HWTA 3I55N 2DGXA 3UKUA 1RT7A 3H08A 4DR2J 3QICA 3M05A 2I8EA 1L3VA 4FPRA 1JLBB 1TFYA 4WPAA 4FJ8A 2GMJA 3T5LA 1OVYA 3NS6A 2G8VA 3I0RB 4UF4A 3D0IE 4WU3A 1XQSC 2QMUB 2F5GA 2BUPA 3HTVA 3AT1B 4YFUA 3HX9A 3B6OA 2KKZA 1PJ6A 2B9XA 5KG3A 3L95X 5F9LA 4DTUA 1QAXA 3PR4A 2XS2A 1Z6RA 4JYAF 1SI9A 5F0XA 4CZKA 3CCZA 3DRSB 1RT4B 5F8LA 1MSWD 3KFWX 1TYQA 2DRBA 5KRSA 1HPZB 1I51B 3AGKA 4CK1A 4NL5A 1NB2A 1HI1A 3AO5A 4MLEA 3AVJA 3FCWA 2ZD1B 2YJFA 2F4FA 4YHHJ 3QJLA 3U6FA 3TQ1A 4DR5K 2GX8A 4Z4HA 3SZ2A 3TTFA 4NOHA 3MM9A 4NYZA 4M3UA 3FBEA 3N79A 4FLUA 2L9NA 4CYUB 5JXSA 2HHPA 4NLUA 5HMWA 4Q43A 4EHTA 4PQUB 2H5JB 4JI5J 3C6AA 3OV7A 4DTSA 2QYGA 2FF3B 4QWCA 1SQKA 2XZTB 3NWGA 4A62A 2GVDA 4UZCA 4I2QA 1G4CA 4JNEA 2E5HA 3D6FB 4FK2A 5CH7B 3O3FA 2PA3A 1HA1A 2UVVA 3V6DB 3MN9A 3OL9A 1RAEB 3W62A 3TP2A 1LKZA 4XTTA 3G82A 1S0MA 3EE9A 1CPZA 3GB0A 4AL6A 4HH0A 1VCTA 4FWLA 1AUSL 4RO0A 3QFPA 3LAKA 4B9TA 4ILLA 4ID5A 3IP0A 4LF7J 2L9DA 4ZVHA 2ACMA 2DB1A 2KN4A 1NJYA 3O08A 1CQNA 2B0GA 1DJ0A 1GMWA 1D5AA 3CM5A 4C8NA 2GV9A 2IJRA 3QNNA 2CG8A 1OSCA 1FXXA 3R1HA 3CIPA 4G9ZA 4KHMA 2KVIA 3TI0A 4JK7A 2QIFA 3S8SA 4AM7A 1WWHA 3P83D 5JS2A 1C1AA 4Y1DA 4CEAA 4DWIA 3D67A 1UAWA 4ZLNA 3H46O 3VEOA 5HRNA 3CJ2A 1KAXA 5CY4A 2IVNA 1J5EK 3AQPA 4DSKA 4WP3A 4M3ZA 4TQSA 2BJ1A 2KFNA 4OZ3A 1Z25A 3T5JA 4WFXA 3ULHA 4FF3A 4YUDA 5KFYA 1N5YB 4RUCA 5KFBA 2DNRA 3BN4A 4CIFA 3F44A 3ZNJ1 3S41A 1S3XA 1FHTA 5G4DA 4CJSA 1KOOA 1VQNS 4CVNE 4PKDB 2UUTA 2FSJA 1U0SA 2BM1A 2Q97A 4I9QA 4HHHA 3GJTB 1TVRB 4K8XA 4NPOA 3D2WA 2WVFA 3OYJA 4OX9F 4XO0A 4KB7A 3TEHB 2F63A 3I82A 4DTPA 1SV5B 2E7WA 1Q0NA 3QPIA 5AE1A 4DSJA 3H6EA 4Q7AA 4A59A 3CPWM 3GIJA 1LWCA 1BE4A 3PIOL 3ICLA 1REVA 5KGWA 4NCGB 5DG8A 5LL6Z 4DV3J 3MM5A 3QBWA 3MX2A 2EC0A 3EMTA 4LVNP 4OLPA 4DV0J 4H4KC 4LF4J 4X62F 3ITHA 1RT5B 1DQ8A 1NPRA 2IRYA 2CQHA 4KAZA 1IKWA 3FSIA 3CDBA 3OS0A 2XHCA 3GR1A 1NDCA 2O4IA 5M1NA 5L1LA 3K9JA 3RBEA 2N82B 3K5NA 3ZC4A 2RKIB 4IEEA 4QS8A 3IM8A 4XIUA 2EK1A 2K8GA 1NHUA 4K7QA 4JI2J 2YHWA 4J37A 2XS5A 4LSLA 3RRGA 1RBAA 1YHQS 3W0LA 2HVEA 3BB5A 4LFCK 2C3UA 3NGYA 1VQ7N 3PO4A 3L4QA 2DRAA 2Q66A 1WLJA 5CHIA 3PLAA 3W2VB 1RDCA 1Z05A 4PXBA 3AO4A 1NK5A 1X5PA 3L2UA 4Z4GA 1ATRA 4JK9A 4A61A 3I8BA 2OTJS 1A0OB 2DD8S 2IJNA 1FXRA 4CESA 3THYA 5BXIA 4ZVRB 4NLRA 3HO1A 3V1QA 1U24A 2KM8B 1EB0A 4OJHA 3DRPB 1FRMA 3SK3A 4CHYA 3VZIA 2ZH6A 2DCUB 1VI7A 4KI4A 1AROP 4A47A 2O8BB 2F65A 4Y2KA 3H90A 2KFZA 1HL6A 3IG1B 2HQIA 4DS5A 1IBCB 3UNYA 1UP1A 1FERA 4DV7F 5CZ2A 1S0OA 4CZLA 5K20B 3KJVB 2PEHA 1S9EB 4X4QA 3V9XA 3TPQA 4KH1B 4DOZA 4A4JA 3IN5A 5AFUH 4JHDA 3HHLD 2NR0A 1OMSA 3HDSA 1NK7A 1NZ8A 2P9IB 2QKKA 3M9OB 2V4RA 3KKRA 2JEFA 3SI8A 1TL3B 4OYZA 2HBQB 3ALYA 4NXMF 1XNQF 2YWWA 1EWQA 2P9CA 4KGKA 1VAZA 1NJXA 2E44A 1SUQA 2P5VA 3A8KA 4AXIA 4OZNA 2MQOA 2VA2A 3M8SA 5C25B 1XTZA 5SUHA 3ZT0A 3W60A 4IKFA 4PEOA 3P38A 1FD8A 1RT3B 3K0JA 4FM1A 3I0RA 1RDBA 4CF1A 2KM8C 5IM0B 1HQ2A 2D0AA 2NRHA 4USKA 4CJVA 4O3PA 3L2WA 2RNEA 4CGDA 1CJKB 2P9LA 3I5AA 3C16A 2BVZA 4YB5A 2BYCA 1GT8A 2LDYA 3TYTA 2QLWA 4CEOA 1KDNA 3OT9A 3TX0A 2YWGA 4EI2A 1FFGB 2ZJPQ 2HQDA 4URQU 4LFAK 3QMQA 2CNNB 1YTUA 4DTXA 4ZLPA 1T3OA 1RT3A 2P8IA 1XC3A 4CZIA 5DM7L 5HI7A 1URNA 2LVWA 2KYZA 4HKQA 4ELTA 5JUMA 4MH8A 2VV5A 2C3OA 2HVDA 1S5JA 4PWWA 1CG2A 4WIQA 1MN9A 1N54B 2WONB 4NI2B 2RH3A 1L3SA 3RSEA 5GAEU 4K8RA 4RU2A 2D5RA 2X78A 4LQ3A 5KT5A 4RZRA 2HWHA 1LAWA 2DJWA 3IG1A 1NEEA 1UVJA 2P6TA 5LXRA 4NLGA 2RMLA 4CLLA 3S3MA 5DGBA 2OPQA 3NH2A 1IBLK 3BDPA 3MMBA 3B8AX 3E9OA 2K3IA 5C42B 3AA3A 2WAQD 3TX8A 2LQBA 1NU0A 4DQ8A 5B0AA 2MZTA 2JVRA 3QWPA 3G8QA 4A8QA 3FE1A 2QFJA 3PCOB 5AXLA 4ID8A 5DJBA 1RT1A 2GQCA 3CMAN 1AFJA 1PC4A 2XULA 4KGXB 1LNQA 1RWPB 3KLFA 1ZM4A 3FZHA 3UR3C 2E9RX 2KW4A 2V7ZA 2PI4A 2D3O1 3KK1B 4Q44A 1VHFA 4RW8B 1IBMJ 1WTBA 4DL2A 1TMMA 1T02A 2E1MC 1ZA1B 3KJNB 1VQ7S 2HPUA 3W63A 5HL7Q 1N88A 3MWBA 4V19S 4OI4A 3CQ8A 1X9SA 4KYZA 5D4OA 5E0OA 1IWGA 3FGUA 2HMIA 4M7YA 3TSUA 3S7RA 1RBVA 4OX9K 2UUAJ 1MWYA 1WEZA 3ENQA 3TZZA 3LWLA 3AVKA 2GIRA 3T1YJ 2FLOA 5F0WA 1HJOA 4JKCA 2ZWPA 1ULRA 1VC6A 2XCAA 3EKUA 2IYGA 4CFAA 2X7IA 2MKKA 1BLUA 4TN2A 2OMOA 3U4LA 4FS1A 3MAAA 3MR6A 1R43A 3J81U 3CNQP 1NGIA 3UWTA 2WTFA 4A2BA 1RAAB 3M8QA 3G6EN 3HI9A 1NK6A 2R7TA 2UXBK 3ZZYA 4I6AA 1WC0A 2K3KA 1W2BR 5B0DA 1SIWB 3TA2A 1HQUA 2B56A 2H1YA 3OYAA 2HBJA 4NLYA 3ZYYX 1LOTB 3NGDA 2OTLS 3T9NA 2Y8YA 2XHWA 1MWQA 1VSEA 4HVZA 3GSIA 4RW6B 4B3OA 4O0JA 3QERA 2XMTA 4M5NA 3PUFA 4K41A 4Q2LA 1Z2ZA 3AXKA 1AT1B 3AJ1A 1CC7A 2KKHA 2RDDA 4OX7A 3CW2C 1IJEB 5H9FJ 5KRTA 1I1GA 3TSPA 3CC2N 1APSA 4RG8A 9RUBA 2RRNA 5JVHQ 2DHSA 4CF0A 4ZLLA 4LF6J 3AD8C 1RILA 3OY9A 2CJQA 3SPYA 2DFFA 4MO4A 2RILA 3JSYA 3MR2A 1E4FT 1Q86O 1TK5A 3MAAB 3O80A 3D6RA 5KFHA 4F4ZA 1CJTA 3CDWA 4IFEA 1RTHA 4GVLA 5T14A 1OIAA 3K2YA 1SJRA 4MKAA 3H98A 4I1TA 5BYRA 4I68A 3DHWC 2R9LA 2LDIA 2R2TA 4BY9C 4Y0FA 1X4GA 3OTCA 1NSQA 4J2DA 2VFRA 1V5IB 4P75A 1HYSB 2CQGA 1Z4UA 4DX8H 3NGZA 3THPA 1S1UB 3RZAA 1Q79A 3PRBA 2EFVA 3L2QA 1CZAN 2F40A 4EUVA 3TZYA 2FLLA 5JICA 1SCJB 4DV5J 2V8HA 3MUTP 3HYFA 4DTMA 2HHWA 4BDZA 3RJMB 4DL7A 2B4UA 2ZE2A 4IG3B 2R3VA 1RCOB 1GOBA 3PY8A 3AARA 5ADXA 4LFCJ 2GC8A 1QM9A 3H8YA 4I64A 5J1EA 2M52A 3HOSA 2GJ2A 3BGLA 3QESA 2P5GA 3OHRA 4DHYA 4B3TF 4JV0A 2DNQA 3W66A 4F2SA 7FDRA 2KL8A 2NPFA 4GW6A 3QT6A 4MIAA 2PYLA 4CIGA 3QFHA 1HNIA 4DR6K 3W9HA 2A40A 3OTOK 3FZ2A 4PY5A 4NA2A 1N33F 1EP4A 4MMOA 5A0YA 2XMJA 2KT3A 3PIOQ 2H5IB 2ZOFA 3D54A 1AUDA 2ZBRA 4BRFA 2YNFA 4JKGA 3NAEA 5KFVA 4PXEA 1S6PB 2WW4A 2PMZD 4JP8A 3VEZA 2MQPA 2FDNA 2CVIA 3BYRA 3IXQA 1RDAA 4DR1K 2MZSA 5D3GA 5LMUJ 1N32J 5CXTA 1XQIA 3T5KA 1E6VA 3DOMA 2P9KB 1ASVA 2OTLN 5ETRA 4H0OA 1RYRA 2J9EA 4MTPA 1WJ9A 4K8ZA 2AEFA 3O3LA 2P1JA 3ZZPA 2BJ8A 1S5ZA 2W7PA 2NLWA 2EBGA 2PO4A 7AT1B 2CH5A 2UV8A 3G2XA 3F0NA 4R0EA 3OXFA 1VR6A 1ZZFA 2C2KB 4BWMA 2IA6A 1WNEA 1RADB 5T7BA 4CBWA 2ZVIA 3VGMA 1SQEA 1L5UA 1W7WA 2D69A 4GVBB 2ZOMA 5BN8A 2BTFA 3PYGA 3OYIA 1BUXA 1QHAA 4FJKA 1HWUA 4QQBA 3CJAA 2CQCA 1TL7B 1PO6A 3PW2A 1K44A 3LPUA 1TUUA 3P96A 1P9QC 4MFBA 1RTZA 1S1TA 1ZAVA 3MD3A 3CE8A 4ZPVR 4A8FA 1N34F 4CJFA 3AAWB 4DTOA 3DXSX 5M2RA 2GVZB 2H65B 1LK7A 2QYCA 3N0VA 1T05A 4W4MA 4WFBQ 4AHRA 3DKDA 4O3RA 1TVRA 4DV4J 2ZDOA 3EZWA 4X66F 1TQLA 1MA9B 4DUYF 1UA1A 1WC3A 2WBRA 3TO8A 2UXDF 4HDHA 1YKWA 2XM3A 4ZS6A 5C24A 4CEZA 1HNVA 3PDNA 2JX2A 2GVZA 4Y2MA 2VFVA 3U8XA 4KY3A 4CK2A 3SJHA 5BRDA 2OYQA 2XBPA 3BQ0A 3NGTA 1GTHA 3TANA 4WYBA 4F25A 2ZM6K 1Q81O 1LWFA 5GADI 3SAHA 2OP5A 4V1Ak 3NKYA 2XI2A 1F9HA 2W24A 3VQQA 3KNGA 3M32B 2O8FA 4KAIA 1ZM3A 1WSHA 2P9PB 3MEKA 1EQ0A 4ZP8A 4WF9L 1UVNA 3ASMA 3MZIA 2XQCA 2XEXA 4BRGA 3QBXA 4CF8A 5IT4A 3OVSA 4BQLA 3MN6A 5ETLA 1NOZA 5E26A 4FJIA 1KLMA 3NH1A 3MEDB 2HQ3A 1YAGA 2ZJPL 4LJMA 2YI1A 5ETOA 3D1HA 5D78A 3VALA 2CPIA 3BGRB 4QR2A 4YR2A 5B8HA 1D8YA 3WEEB 1A6LA 4LF8K 3OSNA 3NF7A 3AXMA 2DIUA 4YOWA 4CJWA 1Q95G 1K1SA 2CQBA 2ZBIA 3H4DA 4EBCA 5A6PA 1KEKA 4CD3A 4YP3A 3B8HA 3F73A 4BWJA 1M5PC 2CAJA 2F1FA 3NGUA 1SKWA 3FFIB 4B9LA 1GFWB 4C3LA 3P31A 2CJYB 3QIPA 4FK4A 2NRWA 1I94J 1UWBA 4NLSA 1ELOA 4O3OA 1FO1A 2DXEA 4H0PA 2HSTA 4DSLA 2V52B 1XBWA 4HTJA 4OYAA 4EIAA 2AF6A 4ECRA 2QSWA 2B4JA 3P1GA 4RBTA 5C25A 4PXDA 2HNDB 4JRPA 3JS6A 2FBXA 3QIPB 2GS8A 3TNVA 4BQZA 5DM7Q 3DOKA 3IMQJ 2ZZMA 2PT0A 2QLFB 3NMAA 3M8WA 2VA3A 1OY8A 4DV1K 1HLWA 5CCMA 2PA8D 4DV0K 5KFAA 4PG5A 3MMVA 2QLXA 1RBOB 4CH0S 5JMVA 4FSVA 1N5YA 1J9AA 2RQKA 4LF5J 4KH4A 3SJJA 2IS3A 4ZIWA 4CLPA 1HR0F 4DXLA 1UVMA 3WQTA 4CGIA 4FJ9A 4DU1A 4JI0J 1TZ0A 2IJFA 2G0JA 2HB5A 1QDUB 1Q8IA 1Y3KA 4IOAL 3VA3A 3SV4A 3J7ZO 4ZVEA 3M8PA 1XR6A 1S9FA 2NSCA 3OYGA 3FZBA 1ROFA 4BHQA 2QL7B 1C0MA 1A9NB 2DVIA 1KAZA 4GMJB 1V4TA 5AQYA 3LQVA 4YR0A 2RHSB 3FKBA 5LMNF 4DHVA 1GOAA 1J5OB 2XNQA 1RISA 3ID8A 2M2BA 2BQRA 2HHQA 5KFJA 1XWLA 5H1SV 2KXNB 2V5HG 4WXWA 2UUCJ 2IC3B 2CPXA 3J7YU 3WXIA 4J9RA 4AHCA 1OH6A 3OBYA 3EZUA 5AJ3K 4FDFA 1TGOA 1EKSA 5ELZA 5AQWA 2OUGA 1N4LA 2BEFA 2MJNA 1UPMB 1JB0C 2K1RB 3DOKB 3F9MA 4LH4A 1VS3A 5F8GA 2YPYA 1BWFO 3T1HF 4LUBA 4ZDNA 2AD9A 2BQUA 3HRGA 1W25A 4CLKA 3FBFA 2J9CA 2YNGA 2E1PA 2VG5B 1FKPB 5HVGA 3ATUA 3CERA 1O8BA 2R7QA 2HRYA 1Q78A 1KP6A 3ISNC 4BRCA 1IWAA 2FYXA 8ATCB 4LMZA 2PYJA 4B9SA 2QA2A 1SB6A 2G8HA 4GVBA 4H0YB 1FNMA 3VTIA 2UYTA 4FLWA 2LKZA 2FZKB 5HLFB 3GILA 1Q5YA 4L74A 4YMEA 3AO2A 5EWGA 1ZBTA 4JI5K 2GAGC 3WZ0A 4ECSA 4M1KA 4DUTA 2OZSA 3BR8A 5F1XA 3VERA 3VGSA 3R8EA 5BR8K 4DTJA 1LFWA 3NNAA 3SBTA 3LP1B 4CJRA 4LF1A 2FVSA 1U6FA 4AQYK 3M1VB 1TKXB 3QLHB 2PGCA 3SAGA 4J5OA 4QWBA 1QE1A 3A3OB 4YHHK 4U67Q 3WUHA 4IFYA 4C8MA 3J7Z5 3D0PA 3ZLJA 4ED8A 2JVOA 1XNRJ 5KTQA 3V81B 4P72A 3L9ZA 3IR6B 2M8HA 4CJLA 2W8KA 1REVB 1EQYA 1CJVA 4WFYA 2XS7A 5A76A 2WBMA 4CRJA 3EKSA 3MR7A 4FLTA 5KFNA 5AT1B 1NUEA 4OGCA 4IR9A 2YNGB 3O9TA 4CJUA 1SS6A 4KR0B 4ISGA 2BJDA 3GTYX 4I69A 1LW0B 2EG2A 2VBYA 4CH7A 3UPFA 2Z1HA 2K1RA 3ZT2A 2XMKA 1NPKA 4M5JA 4DSFA 2FZCB 4CJKA 4KQZA 3CC2S 4ZKAA 3EY1A 3W3SA 4LF7K 2NXJA 4RW4B 2EX3A 5K8MA 1TL3A 4DSIA 3OSPA 3MM6B 4FWRA 4P2MA 3ZTSA 3M2VB 1HD1A 4YB7A 4IUFA 2KXHA 3HD1A 2FF6A 2W4DA 3Q24A 4M41A 2QEXN 3ZZZA 2A2CA 1BI4A 3OR2A 3U3YA 1QHTA 4DN0A 1RAOA 3TQEA 1ZYQA 4BRPA 2BW2A 3UVJA 1OS5A 4LT6A 1JJHA 3D3CJ 4M5DB 1T9UA 4W90B 3N6MA 5FPEA 2D0BA 3FQLA 3GIMA 4KPYA 2P9UA 5J1EB 4UY85 2ZDPA 3ISND 5KT2A 2BKNA 2QXFA 1K8AT 2RQCA 4C2MA 4OYBA 4Y65A 2ADCA 1YI2N 2O8EB 3T19A 3PYDA 2UUBK 1ZTTA 2QO3A 1B0TA 1WSEA 4OYMA 5HVHA 4WIIA 1UETA 1RABB 3KDNA 5B08A 1FA0A 3MR3A 1T0TV 2J6UA 1RBSA 3GIIA 3R5GA 1S6PA 3BKTA 5ADXH 2J6SA 3CCEN 4WFBL 3CFRA 2WSEC 4C0OC 2BANA 3M30A 3C7NA 1ZBIA 4KGMA 3CVKA 1M5VC 1FE4A 3KYLA 2G2YA 3HOTA 3K58A 4W5NA 2V8DA 4B8CA 1KN6A 5M1FA 2CQ4A 3M5RA 5K9FA 1WBBA 2ZZNA 4GC7A 2W1BA 2J4RA 1WOPA 2HAFA 2HBYB 1K73O 2CRLA 3BP8A 4ZJOA 2OH2A 1M90T 3BKFA 5IWAJ 2MKYA 1WEYA 4WK1A 3KWIA 2ZZTA 2P9GA 4NLTA 3ID6A 4MT1A 3I8DA 1OY6A 4BE0A 1WN7A 3MM6A 4A8XA 1G15A 4L3NA 4MJKA 3CD6N 2CZVC 1VSHA 4QU6A 3ETMA 3OUYB 4LF4F 4X62J 4FJHA 3DJCA 5AQZA 4BRNA 2BMBA 1EWRA 3M2UB 2V69A 3A13A 4K5SA 4H8KA 4BDPA 2ZJQQ 1QAYA 4B3SJ 4BR5A 4RWTA 1SKRA 1KQGB 3BO4A 1YJ9S 4JI2F 5A8WB 1KVIA 1OH7A 3RVCA 5GAHI 5LM7E 2J7UA 2LEBA 2G4BA 2UUAK 2WB4A 2MHNA 4B3RJ 3DYAB 4RW9A 5A6WA 4FWSA 5KI6A 3JSRA 2X6NA 1I5OB 1URRA 2KHOA 1VQOS 1LW2B 4KHQA 4O0IA 2E8AA 3MXIA 3H40A 2CQ2A 3HSGA 1HNWK 2QEXS 1U47A 2JRSA 3TWHA 1CSJA 4ZCIA 1FWKA 1FKPA 2IAJA 2CNKB 3WIUA 3H4BA 2ITMA 1WG4A 4Y3CA 3EGNA 1JLGB 4RCHA 3IRXA 1X1PA 4CLWA 1ZH5A 1WSVA 4OV6A 1IXKA 2KU7A 5BREA 4RUHA 3Q2SC 3LP1A 2CADA 3D6MB 3FQKA 3OLBA 2CQ1A 3GDQA 4DV7J 3M2UA 4DV2J 5KFEA 1RT2A 1YHQN 3WBZA 3RSEB 4CEDA 4DEZA 1N0VC 1LK5A 2QWNA 5AE2A 2C42A 1H7XA 2Z4PA 5AFUA 2NSBA 2OGUA 2W7AA 4RNFA 4Z4FA 4C4WA 3PIPQ 2L48A 1RXOB 4JV5K 3LDSA 4K5RA 3EM1A 1CULA 3CIMA 1MWKA 1OVQA 1PYOB 2XLJA 5DQGA 3LTOA 2W2MP 4LC9B 5KOWA 2CWXA 1DY3A 3KMSA 1TKDA 4CM2A 4K4YA 2E5LJ 4I7FB 2YKOA 2C22A 1PBAA 4DF4A 2FVPA 4IYQA 2E1YA 1D3WA 5BRHA 4OJGA 5CYQB 1PG5B 2AJFE 2C2NA 3SQ4A 3UCGA 3R7BB 4LFAJ 1WF1A 4QS9A 3C19A 2HNZB 3QLHA 3UQSA 1FJGF 1U48A 3MTJA 3Q8QB 1FXLA 2B9WA 4K4VA 4UOFA 1VJWA 3ZXWA 2D9PA 1VQ6N 4PG8A 3LP2A 4YDDB 3UI3A 3M6XA 3K7RA 3O8MA 2QJ3A 3BO3A 1XNQK 1JXVA 1FX2A 5F0UA 2J8SA 1Y7PA 1QUVA 1PBUA 2IVMA 2WRMA 1U02A 1U25A 2D7SA 1H7WA 4WTYA 1N6QB 1QQCA 4O8KA 1RT4A 2HBKA 1ESVA 3Q8YA 2CPJA 1IUJA 2XY8A 4WU2A 3PACA 4FZVA 2JNJA 2I1RA 2A1RA 3K59A 1C1BA 2C2DA 4IJAA 1W9HA 2IOCA 4WWSA 2ZFHA 1Q8KA 1VLYA 3M8YA 3DU5A 2GWKA 1Z2LA 2E6LA 4J9VA 3VN5A 3I32A 1NGGA 2A0FB 3EE3A 4P9SA 1T7PA 5EVZA 3RMBA 3ZO7A 1KC8T 2CJAA 4V19J 1LXNA 4LRBA 2P51A 1S0NA 3MPDA 2F8HA 5F8HA 1HBMB 5IZHA 1NMDA 4OZ1A 3NCIA 3KUGA 3PRVA 4B9UA 2RF2B 3SI6A 3DM2A 4C97A 2QLBB 4LFBJ 4ELVA 1JLAB 4JUZA 4FWKA 5FPNA 2GZOA 2Q6CA 3D2EB 2AHOB 3T6JA 3VQSA 1ZAXA 2OPRB 2HLUA 4DFJA 2O01C 4M5MA 4E19A 3ZNUA 1OH8A 2FBYA 1H1VA 2QWPA 2FSNA 4B3MF 1QY7A 3R5JB 4W92B 2XGQA 1T95A 2DR6A 3TARA 1RKIA 2HBLA 4ZVTB 5JVGQ 3NBPB 4ZITA 3WDOA 2RPIA 1P1TA 2OPRA 1K8AO 1XMQF 4KO0B 4I2QB 4ECUA 3C16B 2E29A 4IDHA 4CGGA 3UDVA 1B9FA 2NZTA 3R5AA 5KT4A 3O9RA 2K2PA 2HHHK 4QIEA 2DXDA 2J9DA 1S22A 1KS2A 5E84A 2A6MA 3TVYA 4ZIVA 2V94A 4DR3F 1N36K 3DRRA 2MMYA 4JI4K 3SIPB 5MAOA 2F9DA 1NWKA 2QWOA 2Y9HA 2ZOGA 2PY5A 4NO7A 4DR5J 1OH5A 3B54A 3R2CJ 2Q43A 3PW7A 1FKOA 2YCHA 2IPOB 4CO0A 4FP9A 4MKBA 1WC6A 4TVAB 4FN5A 1YITN 4OI1A 2VWBA 2QC3A 3CMQA 3HM8A 1NGCA 2D3UA 1FVSA 3VCDA 3W8PA 2CJXB 1YXQA 4IDKB 3L0QA 5M1QA 2EVZA 4U67L 4WQ4A 1FTRA 4TU9A 5L1IA 3UR0A 4R8UA 3KHLA 3KLEA 4KIAA 2VASA 4IH7A 2XY7A 2WZ1A 1GK8A 3KHHA 1NXIA 2LXUA 5IT9Y 2N4DA 1UVKA 3ENHA 3CQYA 3PFOA 2COLA 3GV8B 3VOVA 5HJXA 3TJ8A 2Q2RA 1T9WA 2IY5B 3BZKA 4FOEA 3C14B 2ATQA 3EEQA 4F67A 1S72N 1R0CB 2YWKA 2MZJA 2HS3A 1BY9A 3CXCR 5GIOA 4L8RB 1ITPA 4K42A 1GMWD 3MPWA 3H59A 4RUAA 3SMSA 1IBLJ 1RWVB 1IKVA 4BGAA 4RW8A 2XYHB 2LU2A 3A0IX 4DFPA 3O3GA 3H25A 3TAGA 1NJZA 2DPJA 4ES1A 1O51A 4PAAA 3P5TL 1VSMA 3V4IB 2JWNA 2DR8A 3N28A 4NCAA 1RT5A 3A2FA 1YJRA 3BH7B 1RT1B 1NJIT 3GJRB 2IAJB 3PFEA 1JLFB 4XPEA 1WHWA 1VK3A 1K6YA 1X5SA 3C6TB 1Y3JA 4FNIA 4P52A 2I2YA 1VQLS 4DL4A 5IS2A 4LRFA 4RUBA 4ETXA 2KZZA 4MYUA 3FZLA 3CJBA 2XHBA 4Q45A 1IQZA 2QRRA 2AYGA 4F0MA 3F5TA 2IIRA 4Q0BB 3SUOA 3G71N 1B92A 4USVA 1DTQB 8AT1B 4FK0A 3VAIA 4QOTA 3AB4B 1HBUA 2E1ZA 5FLXO 5LSLA 1WB9A 1RWUA 3FBBA 1YRXA 4NX9A 4IOCQ 3PEJA 4ER8A 2QTDA 3W7BA 4UT4A 4J2AA 2L41A 3PV8A 2LQ8A 2KRBA 4EYHB 1TL1B 3QATA 1UMJA 2GEMA 4KGVB 4BC9A 3CIZA 1VQMN 5GIPA 4JV5J 2FGCA 3R5BA 4BC3A 4QWDA 4QS7A 1U8SA 4YY3K 2A3ZA 3D7EO 3ISZA 5H9FK 5DDRC 4QWEA 1SC3B 3C3LA 5K8PA 1KQKA 3A3NB 4U7UD 1B7FA 3PJ9A 2GTDA 5CHCB 3GLJA 1W97L 1MROA 4OYOA 4DG1B 5CE3A 3GFHA 1T6CA 1VSJA 3TUJC 3H3OB 4DLEA 4A8OA 3ULEB 3SUQA 4RKUC 4G65A 3SCJE 3SXLA 3V5RA 4KHUA 4OFZA 1VJQA 2GGPA 2QKBA 4R25A 4R0JA 5CR4A 3ILLA 2YV0X 1RTDA 1LFPA 4IBNA 1RHUB 3RMAA 4PZVA 3KHRA 4IOXA 2QWRA 4IO1A 4M8LA 1UWBB 2AJQA 3IBFB 2ZJQL 1WKJA 2YJEA 1S7HA 4OVLA 1ZPVA 3HP9A 2MQ8A 1Q1KA 3RW7A 5AQOA 5AQUA 1KRPA 3CDAA 1HLUA 1H73A 2F8EX 4ZJLA 1C0UB 3JQJA 1LAVA 4E89A 1JXLA 1JLCB 4CT8A 4FPAA 3PEHA 5E3PA 2C2ZB 4X66J 1UVLA 3SQ0A 1ILYA 3M9NB 3IRWP 1E6YB 2JJ4D 3ZT1A 2HBMA 4D3GA 3W5YA 3KK1A 3KG1A 1S1VB 2ZQBA 1ATNA 4G6VB 3VESA 1OWXA 1UJ6A 2DGTA 4BG9A 2A1SA 3VQ9A 4J7CA 1S1XA 1NH7A 2F3JA 2R7SA 2GUIA 3BQ1A 5FRMA 1R89A 2R7WA 4USIA 3KLFB 3DU6A 3DLKA 3VPZA 1LQ9A 1BMQB 4DB3A 1RDDA 4J2BA 1R0BG 3GIRA 5J2MA 1IBMK 2R7OA 1N5VA 3C0BA 1SPBP 2V8VA 3JXUA 2Y0SD 5F3ZA 4WYWA 5JVGL 2UXCF 4AE5A 4ZMMA 2DNPA 3FEZA 1T3NA 1S4EA 4CQ1A 1XIQA 4KHNA 4Q5VA 1V3RA 1X9WA 3IC1A 3GSDA 3BEXA 4X65J 2Q6BA 1LW0A 2NRXA 3V6JA 3U9ZA 2GAHC 5FD1A 2WVBA 3PX4A 2OPSB 4DUYK 1KNZA 3LANA 4C23A 4GV6A 1SJFA 2E7XA 4C7QA 2DKOB 1V3ZA 4I6MA 4DR7F 1XMOJ 4G1QA 5GAGP 3OS1A 1KVKA 3QWUA 4IQXA 1RHKB 3J7A1 1RWWB 3A5NC 2V67A 3CPWR 1FKOB 4CO1A 1FF2A 4PG4A 1IG8A 3ULEA 4O5BA 1FDNA 1YIJN 5GMEA 2OIHA 4CLTA 1B64A 1BQXA 3Q0AA 2OD6A 3WX8A 4WFZA 2O8CB 1EQMA 3R3LA 4N41A 2KJWA 3D3BJ 4O3NA 4HEA9 5B0FA 3U1LA 2IM1A 4MO5A 2P9KA 3CD0A 4N5SA 2Z8QA 3NF8A 5AQIA 2NUBA 2J5AA 3HSCA 4J91A 3TAEA 2VPXB 1HR0K 2DNLA 4H0XB 1TU0B 3GG4A 1JMTA 5HO4A 2O8EA 3JAMY 4DI6A 4OHZA 3GE9A 4EMDA 1IBKK 1Y64A 4FXDA 1VQ4N 3DGPB 5EY4A 4CEBA 1X4EA 2G8UA 1NGBA 3SCXA 2DBBA 2P9IA 5I3UA 4KHPF 5HLFA 4C9DA 4W5QA 2MZQA 1RT6B 3IAS9 5BPLA 2ZKUA 3THWA 1YJWS 4K2XA 3H5UA 5LMNK 3TJ9A 1VIOA 4ECVA 4FYDA 3RU0A 1HR0J 4DZDA 1YZ6A 2BABA 2HZCA 4CHZA 1CJKA 2SXLA 4KFBB 1LWXA 3SMPA 3ZSYA 3M8ZA 4LIRA 4P73A 2X1AA 1HW8A 2LXIA 6FD1A 1DTTB 1NCLA 3CO0P 4B3TK 3I6PA 3M30B 1SL1A 3AHPA 3CUNA 3EPIA 4OZ5A 3RAXA 2HOEA 1S0VA 4Y1CA 2GHWA 1T94A 3KLIA 4FS2A 1IR1A 3SPZA 3CJ0A 2XYGB 2G2OA 4BC7A 2O8DB 1NSPA 2QGFB 5HAOA 2HKEA 1C6VA 3ENAA 2WONA 3ENVA 4NI2A 1AXQA 3MPVA 4OKJA 3GJSB 4K0KJ 3PW0A 1BL3A 3CMAS 2J7KA 1VQ9N 2ERRA 2D74B 2E9ZA 3U9DA 1RHQB 2UUCF 2ZH2A 3I4PA 4KRWA 1NO8A 3AA9A 2D4WA 3QDKA 3HZ6A 3RB4A 5CCLA 4Y2IA 3G25A 2HG4A 2N7CA 2V4JA 4UQGA 2PC6A 3ZT3A 1HI8A 1RWMB 3FC9A 1UFWA 1Y97A 2E66A 3MN5A 2CKWA 3Q89A 3OBWA 4TXSA 3SMZA 3VVUA 3KUEA 3EPGA 4L76A 4PA1A 5EX3A 1T11A 1IKWB 5F9NA 2OKQA 3QEWA 2IM3A 5MLCV 1HI0P 3QGPA 3T1AA 4DX6A 2U1AA 4DF8A 3ZSVA 4CO4A 1NK0A 1U26A 3EUNA 4ZPBA 3AY0A 5C15A 4YY3F 2FQQB 3RB3A 4J9UE 4FWOA 1WSRA 2HIYA 3CEDA 4NXNJ 3V9WA 3GE1A 4B08A 3KLEB 1GTEA 1GMVA 5AQQA 4TYBA 1WC1A 2KH9A 2EI5A 1TAUA 2AWZA 4HTIA 1YTYA 2YY3A 4ZHRB 4F7VA 4M3WA 1HPZA 3GYXB 2ZH9A 1N52B 2V51B 5B0CA 2Z1JA 1DURA 3EXCX 4FLZA 3KD5E 2P5OA 1ZC6A 1HQUB 2FJWA 1GQEA 2BZ2A 2DFHA 2OMLA 1NGJA 3LPYA 4CO5A 4QAGA 3HK2A 2P9EA 1V3SA 3UCZP 3TA1A 5IC6B 2UXBF 1YVUA 3CPEA 3CC4N 5ETKA 4QCLA 4ELUA 2JLFA 2DGQA 2HAIA 1S1TB 3CSKA 3DLLQ 1ZM2A 2QK9A 1YT3A 1WHXA 1GMUA 1XNRF 1X9MA 2VDHA 4WKYA 1CC8A 2JLGA 4A2AA 4PKGA 1T9XA 3AD9C 1OQ3A 4CJ4A 2RSQA 5EHHA 4PWDA 1GLLO 2X1FA 4E1NA 1CXQA 1VYAA 3L7PA 1V5VA 1Z1ZA 1RDWX 3CJRA 5C0YA 2EFPA 4QJVA 2DNZA 2HNYA 4FF2A 1ACMB 3CJCA 4HH1A 1F9EB 2HFZA 1HUXA 1TUYA 1TUGB 5AJ3F 4KGZB 3KK7A 3ELHA 4E98A 2H9ZA 3O4NA 3MEDA 3D2FB 1UFKA 1VQ8N 2E6MA 3DOMB 2NRZA 1C4AA 3FFKB 3W8GA 3OQ2A 3C14A 1MNEA 1VRQC 5AQFA 1MU2A 2AGQA 4DU8A 2VG6A 3Q7BA 3QGHA 5HMXA 2P9PA 3NNCA 1GH8A 2RHQB 4ZPCA 3VEVA 4JI7K 3THXB 2DPIA 3A8EA 5D4PA 2CJ9A 2RF2A 3C65A 2HRTA 1VIXA 3SSRA 3JQMA 1E6YA 1UEUA 5J2MB 4AHSA 2Q1NA 4HR2A 3D0GE 2PE8A 3CYMA 4R5PB 1TV6B 2YHBA 3V1RA 1ASWA 3U1NA 4HHJA 5AQRA 4GKKK 1RWXB 4H54A 3OTOF 5HK4A 4Z2XA 3UE2A 4HTLA 3V4IA 4IXCA 2MYFA 1ZZNA 5KQ8A 4XAKA 1S77D 2DITA 1Z26A 4I4BA 2VPZB 2DNNA 4C3MA 4RBVA 3ZSWA 1IKVB 2V4QA 4IRCA 5F8IA 3OLAA 3V9ZA 1U2CA 1Q7LB 1SJ4P 4H0TB 2OZMA 5DQIA 4FXWA 4KI6A