2I5JA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with dhbnh, an rnase h inhibitor
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 reverse transcriptase structure with RNase H inhibitor dihydroxy benzoyl naphthyl hydrazone bound at a novel site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H P66 subunit
total genus 117
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2i5jA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2i5jA05
4DG1B 4DFKA 4YQWA 4J2AA 3WNFA 3H40A 2Y1JA 1FXXA 3QEWA 3HVTB 3AVKA 4AHCA 3CJ3A 2VG6B 1ZBLA 4E1MA 2OZMA 1SUQA 4KAZA 3GQCA 4DU4A 2GIRA 3QNNA 4KSEB 4J9PA 2XRIA 4O5BA 3AO5A 4KB7A 4CEDA 3LP1B 2JLEA 1WSJA 1CZ9A 4GVMA 2E6MA 3IGVA 4F4WA 1N48A 3VQSA 3SQ4A 3M8RA 3NCIA 1KCFA 4Z4IA 2HB5A 1S4FA 5KTQA 1TP7A 3HVAA 4PUOB 2B6AA 5DMRA 3IGNA 1J9AA 4DTSA 3OYAA 4EO6A 1WSHA 2AU0A 1XI1A 4TSXA 3L3VA 4Z4HA 2OPSA 4QWCA 2ZE2B 3QO9B 2XC9A 3DRSB 3HXMA 2RPIA 3VQ4A 3PX4A 4WFXA 4NLOA 2YKNA 4M95A 1D5AA 4JV0A 1OS5A 4IKAA 4E7JA 1X9SA 3UQSA 4YR0A 2FBXA 3G6XA 2HNZB 4J2EA 4QWEA 2J6TA 3RRHA 1T05A 1CSJA 1VRTA 3QZ8A 4OL8A 4Y2CA 3BR9A 3FRZA 1LWFB 1YTAA 4F3OA 4DFPA 2PYJA 5C42B 4FK4A 4CIGA 3DOKB 2UUWA 3OY9A 3AO4A 1RBTA 3WNGA 4JS4A 3QINA 2BRKA 3KK3A 3AA3A 3B6PA 4DTMA 2HMIA 1Q9XA 3HM9A 4IH7A 3NGYA 1T94A 3BJYA 1BQNA 1I39A 4O3RA 3MFHA 3JSMB 5KG2A 4EYHB 3O4NA 4CF0A 4CJPA 4NLPA 3H5XA 3RMDA 4AHSA 1IKWB 3G6YA 3CJ4A 1SUQB 4Q44A 4CECA 3AVAA 2IJFA 4KV8B 4CJEA 3KK3B 1K1SA 1DLOB 3LP0A 2AGPA 4IG0A 4EP4A 1S6PA 2BE2A 4CF2A 3L8BA 4KE5A 4C8KA 4FXDA 3DI6A 4XPCA 4DFMA 1TKXB 4MFBA 3TAMB 3V1OA 3L3UA 4CEBA 3Q8QB 3IN5A 3BGRB 4NLXA 4GMJB 2Z1HA 2HAIA 4J2DA 3G86A 4M41A 1NJZA 4RW7B 1C0TA 4BDYA 3BSNA 3KLIA 4CGHA 2IGIA 3DDKA 3RB0A 3M9OB 3VQ9A 3AVIA 4RW6B 2AJQA 4J9QA 2JGUA 5KG6A 4KI6A 3QZ7A 4R8UB 2HVIA 2KQ2A 4DMNA 5L1IA 1RT6A 2D41A 2I5JA 2HHQA 1JXBA 4CGGA 3MR5A 2IM1A 4EBDA 3HSTB 1HQUB 4IR1A 2OPRB 3RBEA 3CG7A 3V9UA 1YVFA 4FW1A 4QW8A 3B6OA 4CEQA 3V9SA 1WN7A 1ZETA 2R8IA 1LWCB 1RT5B 2ATLA 4PY5A 1TVRA 2R8KA 1FK9B 3H5SA 4K4ZA 1X9WA 4ZPDA 1BIUA 1WSGA 3Q8PB 4TLRA 1HNIA 3OVNA 4NCAA 1JXLA 3ZT0A 2Y1IA 4EP5A 4MFBB 3TAMA 4B9TA 5C24B 1RT1B 5DG7A 1JLBB 3KJVA 2LSNA 3VQ8A 3UPFA 2ASLA 4WZQA 3DRPB 4Q8FA 3OJSA 5KFNA 4CEFA 4J9MA 1DTTA 3TR8A 2F96A 3BSCA 1U45A 3DOLB 3ZT3A 1REVA 5F8JA 2V9WA 1CZBA 3H08A 2YKMA 2XWYA 3DLEB 1NK0A 4I2QB 3V1QA 4RW8A 2A1RA 1F21A 4F4KA 1ASVA 2DFEA 1RDAA 5HROA 1NOYA 3ZSZA 3CM5A 5KFTA 2JEIA 3SI8A 4FJXA 4ZPBA 5I42B 4B08A 3K5LA 4CJKA 1IH7A 1S0MA 3L2WA 5KGWA 3AVHA 5EWEA 2WONA 4DQQA 1RT5A 1S1TA 5HBMB 3OYFA 2W8KA 5EU7A 3MR2A 2WRMA 1MMLA 3MAQA 3MEGA 3HK2A 2EHGA 2DPIA 4HUGA 3DLKA 3V6HA 1HPZB 3DRRB 3CIZA 3NH2A 1HNIB 1QS4A 4KHUA 4N41A 3AVGA 3EPIA 4W5RA 5I3UB 4CF9A 4ECTA 1HMVB 3QNOA 2IOCA 2W42A 3DMJB 3KLEB 1S1XA 1KVCA 4CJWA 1T03A 4ECRA 5F9NA 1LAVA 5KGXA 3LPTA 3G10A 3M8PA 4DU1A 1KSPA 3QEVA 3S3OA 3GYNA 3HP6A 3I0SB 2W7PA 4EEYA 5KFHA 3AV9A 4KKOA 4IFVB 4K4XA 3KK1B 4B3OB 3ZSXA 3V4IB 1Q8IA 4Y2AA 3CJ0A 4R5PB 4R0EA 3RTVA 2OPSB 2O5DA 3DMJA 5HRSA 4CJVA 5K14A 2AGOA 3K58A 3NF6A 4E19A 3E51A 3H5UA 2VG5A 4E1NA 2FVQA 3N6LA 4CHOA 4KTWA 4B9MA 1X1PA 1JXEA 4O55A 4CFAA 4FZXC 3MR6A 4F2RA 4AHRA 4FJKA 3BSAA 4N76A 1NHUA 3PR5B 1LW0B 1WAJA 1J5OA 1WNSA 3CJ5A 3OSPA 3RR7A 3OYLA 4AH9A 4K4UA 5J1EB 3KMSA 4FJJA 3H2LA 3F9KA 1IKYB 3VQ7A 2QKKA 1GOCA 5HP1B 4FW2A 3K5MA 4B9UA 4BWJA 1L5UA 2QKBA 1S1WA 1C1CA 4PWDB 3RBDA 2AQ4A 1RBVA 1DTQA 4DQRA 1QQCA 3GV8B 3LZJA 3M8PB 4ZP9A 4URSA 2OH2A 3KLFA 3MEGB 1QAIA 4TY9A 1HARA 2HHTA 2HNZA 3NAEA 4NLTA 3KK1A 4LSNB 3C95A 1VSFA 4NLSA 5DQIA 1NK5A 3DLGB 3ICLA 4W5NA 4IDKB 1Z25A 4MQ3A 3SI6A 4KPYA 2XY7A 4Q8EA 1SH3A 3DOKA 2WOMB 4KO0A 5KFOA 2EC0A 4DFJA 3VQAA 5KI6A 4ZP7A 1DTQB 4DF4A 4ED6A 2RF2A 3KLEA 2IAJB 4O3QA 2D0CA 3NF9A 3BQ1A 4LH4A 1ASUA 4ED2A 4DG1A 4HCCA 3SYZA 3VQEA 5KG5A 1N6QA 1KHWA 4NRUA 4CERA 2KFNA 4KKOB 2OA8A 1A5XA 4M3RA 1RYSA 3PR4A 3CDWA 4ZP8A 4KHQA 2ASDA 3KMQA 2ZKUA 5J2NA 2G8IA 1JLGB 3V9ZA 2VWJA 3IG1B 3KD5E 3OLBA 2XI3A 1RILA 4M3ZA 2D3UA 1ASWA 3MEEA 4CESA 2O4IA 4LY7A 1S1WB 1A5VA 4CGFA 4M3XA 4DTOA 5KFSA 3OYBA 2W7OA 4JRQA 1S6PB 3IS9A 1CXQA 3PW0A 3TARA 2HNDB 1RT1A 3FQKA 1SL1A 4IQXA 4CJRA 4ZHRA 1JLQA 3BDPA 2OPPA 3ALYA 4MIAA 3MXMA 3KTQA 2JC1A 3CM6A 3DLHA 3HO1A 4MH8A 4RW7A 2WK4A 4NLRA 4B8AB 4B9LA 1SV5B 3HT3A 3NGZA 3OL8A 4FJGA 1Z4UA 3NKYA 4WXOA 4YP3A 3UR0A 4QWAA 1Z26A 4O3OA 1ZTTA 1BI4A 3TABA 4IKFA 4QCLA 4Q5VA 2GV9A 2BDPA 4CJTA 3U6FA 1O1WA 4EYIB 1U04A 4BDPA 5KFBA 2FC0A 3PW4A 2HVHA 1U47A 4B9SA 2KW4A 3DLBA 2B6AB 4FLTA 3L2VA 4DL5A 4WFZA 1BL3A 3RB6A 4QWDA 1EETB 1FKPA 4XPEA 3T5LA 2WOMA 4KO0B 3DM2B 1GX5A 3PW7A 4FM1A 3SQ1A 5SWMA 3IS9B 3OSNA 1QE1B 4KHYA 3I5AA 3P5JA 4OKEA 1NNDA 2B5JB 5HBMA 1NK4A 3ITHB 2IM0A 4ZVEA 1HYVA 3NGDA 1U49A 1ZYQA 3KKRA 5KT4A 4OLBA 5HLFA 4IG0B 1HQEA 3F73A 1S10A 2QXFA 3HYFA 4F4YA 1JIHA 4O0JA 1TAQA 3NAIA 1C1BB 2HHVA 3VQCA 1SL2A 1A5WA 1S5JA 1HYSB 4KBIA 4EZ6A 4LQ3A 4WE1B 2UVRA 1IKVB 5C25B 4TQSA 3NDKA 1KLNA 4ZPAA 3DI6B 2X6SA 4B9VA 1SKWA 4E7KA 4OGEA 4I9QA 4IH5A 4KTQA 5EWFA 1XR7A 1S9EA 2ILZA 4FJMA 2VG6A 4ECXA 5KFWA 3KHLA 2FBTA 2GIQA 3SFGA 4J9NA 3CQ8A 4N5SA 2X74A 3UIQA 4TYBA 1QUVA 3QESA 1RTHA 1RT7B 3V4IA 2R2RA 4FJ8A 5FDLB 3EY1A 2PZSA 5DQGA 3AVLA 3AVCA 5J1EA 4QOZB 4IFYA 4IH6A 4Y34A 2CKWA 1NK7A 1TKZA 3RRGA 4FJHA 4CEZA 1RTDA 5DK5A 4YR3A 1TV6B 1VK0A 4O44A 3AA4A 1VSMA 4CHQA 5FRMA 4PUOA 5KG4A 2PYLA 3FFIB 4K4SA 4MK7A 5C5JA 5KRTA 2ZD1A 4DSEA 3SQ0A 1XWLA 2NUBA 3T5KA 4CJQA 4CCHA 2VWKA 1BGXT 3ZT2A 1EETA 5KFZA 4I7FA 4CGDA 3KD1E 3TAEA 3H4DA 1T8EA 4M42A 1UA1A 4Z4GA 3H98A 3RB3A 4O44B 4H8KA 3OJUA 2V4QA 3OYIA 1KVAA 1YVUA 3ZSVA 2ASJA 1EP4B 5K14B 1JLAB 3O3FA 3AA5X 3OHBA 1S1VA 5DGBA 3N6MA 4RUAA 1WLJA 3DLKB 1IKXB 3SPYA 3FDSA 4E7LA 5CYMA 4HTUA 4DSFA 1TKTA 2WCXA 3SFUA 4OVLA 3GIIA 2Q3SA 1S1UB 4RW8B 2HW3A 3FSIA 5J2NB 3NF7A 1TGOA 3MF5A 4BWMA 4BE0A 4ZVFA 2KZZA 2IM2A 1EP4A 1RTDB 3HPHA 1IG9A 3TAQA 2PY5A 1RBSA 5D3GB 4CJFA 3MECA 5J2QA 3THVA 3KK2B 4MK9A 2WTFA 2WB4A 4K4YA 2CJQA 4RW4B 1JLEB 4C8LA 2D7SA 2UUTA 2AX0A 3E01B 3DOLA 4EZ9A 2V4RA 4CF1A 3I8DA 4H4MA 1Q9YA 1TL1B 4C8OA 2DFFA 2V0NA 2ITGA 1RA6A 3DLGA 4YR2A 5J2QB 3O3GA 4KHNA 4KB0A 4DWIA 3RR8A 4DTXA 3QIDA 3L2UA 1S1XB 4GC7A 2HNDA 3KLIB 3SJJA 1UAXA 3OYDA 4H4OA 1TKTB 5KFMA 2JEFA 4ZHRB 3QYYA 4DL6A 1J5OB 1ZBUA 1KHVA 2YNIA 1C0TB 4I7FB 4CHZA 4U6PA 1TK5A 1IKYA 2YNHB 1D8YA 3C6UA 1QSYA 4FJ7A 4XIUA 4ECUA 2AWZA 4E0DA 1C1CB 3NL0A 3NGIA 3ZSRA 5F8IA 4TYAA 4R8UA 2FLLA 3VQBA 2G8KA 3DLRA 4E89A 2Z1GA 4OGCA 1HYZA 3ZCMA 4ZTJA 4NCGA 4FK0A 1JLCA 4FK2A 3S9HA 3KIOA 1RBRA 1QAJA 2RDIA 4Z4FA 3QGIA 2W8LA 4RW4A 1LWEA 3AA2A 4CJ5A 2YNHA 3BQ2A 1ZBFA 4N56A 4DU3A 1XR6A 1RYRA 5KFXA 2XCPA 3RMAA 1LWCA 2UVWA 4F8RA 4JV1A 3MR3A 5L9XA 3HVTA 4ICLB 4RW9A 1SH0A 1SKSA 2KFZA 4OPJA 4PWDA 4J9LA 1N5YA 4NCGB 4AHTA 1HJRA 3LWMA 4DQSA 4DTJA 2HNYB 3KHRA 3VQPA 1QTMA 2RKIB 4QWBA 3AVNA 3O4QA 3AO3A 4I2PA 2FVCA 2E9RX 4F2SA 4CHNA 4DTNA 5J2MA 4IR9A 1JKHA 3NE6A 5HRRA 5KRSA 1I3AA 3MEDA 4HUFA 3CDEA 1TK0A 3ITHA 3S3NA 4KB1A 1LW0A 1NKBA 4FLVA 4NYFA 2OPQB 4RNHA 3SUQA 1HQEB 5DLFA 1D1UA 4NLUA 1YTUA 5CYQB 2HHWA 3DLEA 2ZE2A 1WSEA 1L3UA 3NFAA 1VSJA 2HWIA 3H59A 4KHRA 4F4ZA 2BR0A 2BANA 4M45A 3VQ5A 5KT5A 4ED3A 1JKHB 3G0ZA 1TKZB 2FLPA 3JSMA 4JS5A 5HRNA 4IG3B 4DL4A 4C8NA 5F9LA 3HP9A 5F8LA 2IJNA 4O3SA 1T05B 1TKDA 4KHSA 1HNVB 4CK1A 1LWFA 3H4BA 4FCYA 3LPUA 1W0HA 3MTKA 4I2QA 3GIKA 4W5QA 4FYDA 3SNNA 5KFFA 3TI0A 4IFYB 4CIEA 2UVVA 3JYTA 5J2MB 1XHZA 4IBNA 3AVBA 4NRTA 4IRCA 4LD0A 3PY8A 2FVPA 2RKIA 1HMVA 1TV6A 1XHXA 4OJRA 5J2PB 3CYMA 1U4BA 4FZZA 4Z4EA 5HRPA 2HHUA 4O3NA 3AO2A 1U48A 1S1TB 4ID5B 4NYNA 3DYAA 2OPPB 3BREA 3CWJA 3HJFA 5C42A 3KHGA 2ILYA 4YNQA 5CYMB 4IFVA 5EDWA 1Y97A 2BE2B 3DRRA 3CO9A 1N5YB 1D0EA 1QSLA 1BQMA 3MXJA 2XY8A 4WYWA 1JL1A 1CXUA 4RNMA 2FBYA 4PA1A 5KT2A 4KRFA 2P5OA 2OZSA 1BQNB 4LSLB 4Y3CA 1S1VB 4FJ9A 4E3SA 3EYZA 3HKWA 2VG7B 4CHPA 4IRDA 1MU2B 3VQDA 3LAKA 4W5TA 4YFUA 3AVMA 1RT2A 1B9FA 3VA0A 3OYJA 4ELTA 4QPXA 3K5NA 2D3ZA 3DM2A 3JYTB 5KFPA 2F8EX 2DTUA 1J53A 4DTPA 4DQPA 4CK3A 4FM0A 3PX0A 3NHGA 2BGGA 2A1SA 5C24A 4DSJA 3T1AA 4NYZA 4DLGA 1KFSA 2YHAA 1RA7A 4FVMA 1BIZA 4CJ3A 2P1JA 4ED1A 3OHAA 1LAWA 4H54A 5KFAA 4OKKA 4CK2A 3V1RA 1NJYA 5DLGA 4FLYA 4FJ5A 3G6VA 3RB4A 2BQRA 2R2UA 5L1KA 4CE9A 2YKNB 2D0AA 2GBZA 3CVKA 1BQMB 3NAHA 2I1RA 4URQU 5HP1A 3LP2A 4WE1A 4DL3A 4O0IA 3V81B 4AILC 1MU2A 3QEXA 1S9EB 5KG0A 1BCMA 3ZSQA 3OL9A 2J6UA 4LSLA 2UVUA 4B8CA 1KTQA 5KFGA 4MKBA 1RDDA 2XY6A 4KI4A 1TAUA 1REVB 3KK2A 3OYMA 3ISND 4WFYA 3MXIA 2KZMA 1JLGA 1DTTB 4JV2A 1U09A 1LW2A 5KFUA 4LSNA 4DL7A 4ECSA 1D9FA 2QE5A 2G8FA 5KFCA 4M3YA 4NLWA 1WAFA 2KTQA 4QAGA 2F8TA 3E01A 3C6UB 3M9NB 4TXSA 4RG8A 1T7PA 4N47A 4KAIA 4EO8A 4F50A 1JLAA 5DQHA 4Y1CA 2G8HA 5I42A 4DS4A 1VRTB 3U3YA 2B4JA 2ZD1B 3OLAA 2XY5A 4Q0BB 3UDLA 3H5YA 3QGGA 1IKWA 2E9TA 3OYKA 1KRPA 4FJNA 5KFQA 1HPZA 5F8MA 4DF8A 3KLGA 1RT3A 2E6LA 1S1UA 3SUNA 3AVJA 3KLVA 3KOAA 2DPJA 1C1AA 5JXSA 3C94A 1SKRA 1GOBA 2HMIB 4J2BA 1RTIA 4BACA 3KLHB 4CEOA 4MKAA 4E7HA 3LP3A 4KHWA 3BGRA 1T03B 3LALA 5SZTA 4CEEA 3NMAA 3IRXB 4EBCA 3PV8A 3HVWA 1ZBHA 3NBPA 3I0SA 5CZ1A 1S6QB 3HPOA 1EKEA 4YMEA 1NK8A 1S49A 4RUCA 2IC3B 4K4WA 1GOAA 1VSDA 4CF8A 3ZSWA 3V9WA 5DGAA 2FLNA 2YNFB 1BCOA 1C0MA 5KFYA 2X6NA 5FRNA 1TL3B 3S3MA 1KLMA 4PQUA 1TL1A 3D28A 2C2RA 4ECWA 3TWHA 3T3FA 2R8JA 3OL7A 3CFRA 4Q0BA 4HHTA 3V81A 3V6JA 2B5JA 4WXWA 3TAPA 1LV5A 5KFRA 1EXQA 3SV4A 3RAQA 2FBVA 1C0UB 5D3GA 2BQ3A 4IG3A 1XR5A 1ITGA 4OPKA 4DSKA 4K4VA 4IOBA 1K1QA 2FJVA 1VSKA 4RW6A 4JUZA 4ED8A 4HYKA 2GUIA 3ULDA 2YV0X 1N56A 1NJWA 4PQUB 3P1GA 2IDOA 3VQQA 3T19A 3RWUA 2XHBA 4G1QB 3QO9A 3PJWA 3V6KA 1RDRA 3HVRA 3IAYA 2HHXA 1TQLA 2OPQA 5T7BA 1SL0A 2G8UA 3TQ1A 2OPRA 1D9DA 4ZMMA 2ALZA 2X78A 2HWHA 3K5OA 3KNAA 3ZT1A 4ZVHA 4TN2A 4Q43A 4K8ZA 5KT6A 2I5JB 1W9HA 1JL2A 4H4OB 3K57A 3T5HA 5EUHA 1RT7A 2JC0A 3BQ0A 3QEPA 3SZ2A 4FS1A 2EX3A 4FBTA 4ELUA 4M3WA 2JEGA 3DRSA 2R2SA 4C8MA 4M3UA 3N6NA 2P51A 3SQ2A 3OS2A 3SUOA 4MIBA 1C0UA 3PW5A 3AO1A 1XC9A 1UOCA 3PO5A 1S48A 4Z0UA 2IS3A 4B9NA 3HL8A 4KTZA 1JLCB 1RTJA 3I0RB 2QK9A 1N4LA 5DG8A 1N6QB 3MEDB 5KFKA 1EX4A 4NCBA 3KJVB 3NF8A 3KKSA 4RZRA 2J6SA 4NLDA 2YKMB 3HPGA 4XO0A 1RAJA 4ECVA 1UWBA 5DG9A 1TL3A 5KT3A 4BE1A 2IA6A 5CYQA 4TQRA 3ZSYA 1ZTWA 3CFOA 4DTRA 1RTHB 4ICLA 3FQLA 4EBEA 2D5RA 2AX1A 3M8SA 4ECZA 3IG1A 1KVBA 1WSIA 4F3TA 1G15A 2HNYA 4CEAA 1VRUA 3C6TB 3LZIA 3OYNA 4M3TA 1S9FA 5CZ2A 3KHHA 1IKXA 2VA2A 4FJLA 2JEJA 2RN2A 4BDZA 2IM3A 2R8HA 4FZYA 1NHVA 4U7CA 4B3OA 3GIMA 2E4LA 4KV8A 4HUEA 4AHVA 3PX6A 5FROA 2XGPA 1RT2B 4HKQA 1S97A 4DS5A 1VSEA 1SH2A 3SPZA 2P5GA 2G8VA 4HCBA 3EZ5A 4CJ4A 4OKJA 3MEEB 4IRKA 1RNHA 3LDSA 1TKXA 3K2PA 3SUPA 1HNVA 1NK9A 1RBUA 4AHUA 3GV5B 3EPGA 4RU9A 4FJIA 1VSHA 3V6DB 4K50A 3LAMA 4ZTFA 5F8NA 1IO2A 3NH0A 3LP0B 1RT4A 2DY4A 3QLHA 1QSSA 5KG1A 5J2PA 1L3TA 3EZUA 3T5JA 4TY8B 5F8HA 2W9CB 1HQUA 1RT6B 5KFIA 1NKEA 1I6JA 4DEZA 3DYAB 2YHBA 3IRXA 3TVKA 5CY4A 2AGQA 3D0PA 4ID1A 3RAXA 5HLFB 1TVRB 2FJWA 1BISA 4KREA 4Q45A 1S9GB 3VA3A 3HHKA 4GW6A 2FVSA 3QLHB 1FKPB 1HYSA 3TANA 4E7IA 1RDBA 3LP1A 1LW2B 4RNFA 3KLHA 1IM4A 4J9RA 1WSFA 3PUFA 1B9DA 4FM2A 3LWLA 1T3NA 4OLAA 5KFEA 3ZT4A 2D0BA 4CFBA 2WONB 1UA0A 3PO4A 4KFBB 1W25A 2DFHA 3PVXA 4FS2A 3V6DA 2ZQBA 5KFDA 2VA3A 1DLOA 3ISNC 2ETJA 3M8QA 4JRPA 3QIOA 1LWEB 5F8GA 1VSIA 1X9MA 2YNFA 3I5BA 2RDJA 5JUMA 5L1LA 3RMCA 4FLUA 5HROB 2IMWP 2XI2A 2W9CA 4G1QA 3OS0A 2YNGA 4Y1DA 4CFCA 1J54A 2W9BB 1RT4B 4RW9B 1NK6A 1HRHA 3CDUA 4TY8A 4ZPCA 3L2RA 1IKVA 5C25A 4FLWA 3TAFA 1RTIB 1NKCA 4Z4CA 2XGQA 3GIJA 4J9SA 2QV6A 4DLEA 3GV7B 3M9MB 1JLBA 2IAJA 4FBUA 3OS1A 4LQ9A 4I2PB 3OYGA 4CJLA 1RCHA 3L2QA 1VSLA 1QHTA 1TK8A 4ZP6A 3PZPA 1S0OA 2R2TA 4JLHA 1S9GA 4R5PA 2HHSA 3O3HA 2W9BA 5FDLA 3A2FA 4BE2A 1FKOA 3ZSOA 3K59A 2BANB 3ASMA 1GX6A 1JX4A 1NOZA 4FLXA 1L3SA 4M94A 3I5CA 4KFBA 4MK8A 1R0AA 2VG5B 4J9KA 2Z1IA 3SV3A 1JLQB 3P83D 4CGIA 3WNHA 4WYLA 4DQIA 5JS2A 1RTJB 1JLFA 1B92A 1RT3B 3CFPA 4K4TA 4WZMA 1SV5A 5KFJA 1KFDA 2BRLA 3CJ2A 2Z1JA 3M8QB 3NH1A 3OL6A 2G8WA 4L8RB 3QIPB 5KFVA 3SCXA 2YNGB 3Q8SB 3Q8RB 4FLZA 3QERA 1BI4B 3QGHA 4ECYA 4ECQA 4NLQA 4HVJA 3GILA 4H4MB 4W5OA 1R0AB 2WHOA 1K6YA 5JS1A 5KG7A 4KHMA 4O4GB 4UQGA 4O4RA 2B43A 4K8XA 3LP2B 1QE1A 3VQ6A 3OYHA 3MECB 3OYEA 4NLVA 1BHLA 2R7YA 4RNNA 4NLGA 3C6TA 5KG3A 4DL2A 3I0RA 4CIFA 4CJSA 4J9OA 4NLYA 3QIPA 3BSOA 5L1JA 4QW9A 1FK9A 1WNEA 2YNIB 1JLEA 3PW2A 3KLGB 4ELVA 1UWBB 3QEIA 1KLMB 4DSLA 1C1BA 1S0NA 1C2PA 2FJXA 4LH5A 4NZ0A 3TAGA 1CLQA 2C2EA 2W9AA 1NJXA 2GC8A 2C22A 5KT7A 4DSIA 3PHEA 2F8SA 1RDCA 3NBPB 3U3GA 2C2DA 2BQUA 4CJUA 4I9LA 3QETA 4F4XA 3MFIA 3VN5A 3KLFB 3RMBA 1S6QA 2OYQA 4ZVGA 2XCAA 4ID5A 2XO7A 5I3UA 2IBKA 2VG7A 5EWGA 2C28A 4DTUA 4RNOA 2E9ZA 1C6VA 3WNEA 1FKOB 3LANA 4ED7A 5T14A 2FVRA 3PJXA 1YT3A 3D5MA 4O3PA 4GC6A 4O4GA 4URGA 4X2BA 4ED0A 3D45A 5E41A 2RF2B 2ATQA 4IDKA 4CGJA 2O4GA 3DRPA 1L3VA 4CFDA 3FFIA 4G3IA 4CHYA 3AVFA 3V9XA 5KFLA 1JLFB 3OYCA 1VRUB 2IC3A 2R8GA 1ZBIA
chains in the Genus database with same CATH superfamily
1RHKB 3WNFA 1F5BA 1IVZA 4AHCA 4LREA 2DT9A 1SUQA 2AJ2A 4KAZA 2P9UA 1AXQA 4JK9A 4KSEB 4BRHA 4TVAB 5F1XA 2JLEA 1T3OA 1WSJA 2M9KA 2E6MA 1NGIA 3IMXA 4F4WA 1OYDA 1XBWA 3NCIA 1KCFA 2HB5A 5LJVA 1PIEA 4DV0J 3HVAA 4PUOB 1VMBA 5DMRA 1TYQB 2B9WA 4DTSA 4EO6A 1WSHA 2AU0A 1XI1A 2OJ3A 3L3VA 4K5SA 1H2TZ 4H5NA 3BKTA 2ZE2B 4YB1P 2KHDA 2XC9A 4DV7F 3PX4A 1A7GE 4NLOA 4PG6A 1LFWA 1RCXB 4DMZA 4H0VB 2B4UA 1PYOB 2VFVA 4E7JA 1X9SA 3UQSA 4YR0A 4WIQA 2PDAA 5HVGA 1UPMB 4KHPK 4R0JA 1T05A 3L0QA 4GV9A 3VOVA 4MYTA 2FIUA 4OL8A 2MQNA 1LNQA 3FRZA 4BRQA 2LQ5A 4DFPA 2XYHB 1ZXOA 3D67A 4CIGA 2NXEA 3DOKB 1CJKA 5AQFA 2MY8A 1RBTA 3WXJA 1V6HA 3MD3A 2CFXA 3MM9B 5AT1B 3DRYA 3NNCA 1U1RA 2HMIA 3R5CA 1Q9XA 2XHCA 3NGYA 3BJYA 1I39A 1JCGA 1RAAB 2ZOMA 3JSMB 2BVZA 5KG2A 4MMOA 4EYHB 2RSQA 4YDUA 3H2VE 2RIJA 4CJPA 4OX9J 1CJKB 3H5XA 1R6VA 4AHSA 1IKWB 1FNXH 2E2OA 1NHKL 2RUSA 3G6YA 3CJ4A 2F9WA 2ZH1A 3LP0A 1NNEA 1ZM2A 3ZTPA 4F9OA 2XMUA 4LF7K 3D1HA 3J7YP 4QR1A 5BYSA 1XMQK 4XPCA 1WBBA 1TKXB 2XLKA 1YIJS 4MFBA 3V1OA 1X4BA 2QJ3A 4LJMA 3NOGA 2DYAA 3IN5A 2K1RA 2YKPA 5HN0A 1FA0A 3VAMA 2AW0A 5F41A 3ZXWA 4Y2IA 3VEOA 1AUSL 2ZJQL 2BMBA 1IR1A 3OVSA 4JI5J 2JGUA 4KI6A 4Y2MA 1U26A 3TO8A 4Y00A 5I3PA 4AM6A 2RE1A 2MPUA 3GJTB 3H1VX 2ZM6J 1GXLA 3TA1A 1JJ2R 1CULB 3OFHA 2CNNB 2OPRB 5I9EB 1P8GA 4M5IA 3KZBA 4NWBA 4U8YA 2E44A 3I4PA 2IRYA 4NXNK 1PAEX 1UEKA 2R8IA 2R3VA 4PG5A 2QIFA 2J0SD 2R8KA 3CCLS 1VQ7N 3H5SA 3QAEA 4A2BA 4OYZA 4ZLNA 4LMZA 3POTB 4TLRA 2M52A 4OZLA 1XQSC 1OYEA 4J8FA 4NCAA 4F3QA 5HJXA 2PIIA 2XS5A 1YITS 1R6YA 2BUNA 1RT1B 1SIZA 5DG7A 3KJVA 2UXBK 2E1ZA 4MT1A 3DRPB 1ZM3A 2OFHX 3OJSA 5KFNA 3D9BA 1UJ5A 4B1VA 1UVNA 2V8DA 3M2VA 4J9MA 1K0TA 2YKMA 4AM7A 3BY5A 1NK0A 3CCRN 3V1QA 1HWUA 4BR4A 4A8SA 3O3LA 2UU9J 1ASVA 5GIOA 4FDFA 5HROA 1X5SA 2DRAA 1NSQA 3K5LA 4IQMA 3ZTOA 4CJKA 2CDQA 3BPSP 1CJTB 2X7IA 1I1GA 3FZMA 2DNKA 4QBUA 1S0MA 3QRPA 2W8KA 1RADB 2GX9A 1HFEL 3HK2A 4OZJA 4HI1A 5BR9A 2FHKA 1CZAN 5AJ3F 1W2IA 4C8ZA 4FZVA 1QS4A 4DI6A 4N41A 5I3UB 3GJSB 3PEHA 2MKIA 3DCAA 5DDOC 5EOYA 3DMJB 1PILA 4BRFA 2IIRA 3VVUA 5ETMA 1KVCA 4CJWA 5F9NA 4IWVA 5KGXA 2VJUA 2MKCA 2Q2RA 3S3OA 1Q82T 3I0SB 2JVRA 2W7PA 3ENAA 4KKOA 1VJWA 4IFVB 4ZA1A 3KK1B 4B3OB 2PE8A 3CJ0A 5DDRC 1PJ6A 3FMBA 2DXDA 1GK8A 1S59A 2V63A 1DQAA 1FRMA 5H1SV 1OY6A 3K58A 2AGOA 1X4FA 3H5UA 2VG5A 4DN0A 1I94K 4E1NA 4HR2A 2BW2A 2MZQA 2YQ3A 2QTDA 3R1XA 4N76A 3Q83A 1WAJA 3D4JA 4LF7F 3WQPA 4BRNA 1RAIB 3CJ5A 2P2CB 3OSPA 1UW4A 1GNKA 3NNHA 2W2PP 4K4UA 5LSOA 2WTUA 3F9KA 2HOEA 3U8XA 3VQ7A 5HP1B 3OT9A 4FW2A 2H4YB 2QKBA 4B3TJ 1S1WA 4PEOA 1C1CA 2P9KB 4PWDB 5D4OA 3JXUA 2CQBA 5HMWA 1CC8A 1SI9A 3FSXA 3GV8B 3LZJA 3M8PB 1SBRA 4WK1A 2IBOA 3HT0A 2DEJA 4TY9A 3KWMA 2HNZA 4J7CA 3NAEA 1EQ0A 5KPTA 4M5LA 1IBMF 4Y6IA 5DQIA 2KHCA 4J9UE 3S7RA 3GB0A 1H7XA 4DUYJ 2Q31A 1AUDA 4W5NA 4KPYA 4Q8EA 1SH3A 2KKHA 4OX9F 4CZLA 4DFJA 5KI6A 3OTOJ 3EZOA 4ED6A 1YAGA 4CP5A 3NF9A 2OHDA 3QFWA 1FFSB 4OI0A 4JKEA 2D3O1 2KFNA 1QAXA 2OA8A 1U8WA 3PR4A 3CDWA 2EWSA 4U7UK 4KHQA 2KT2A 3GMGA 4A59A 3VEVA 1T9VA 3BEXA 4FSVA 2ZKUA 5J2NA 4DKWA 3MTJA 3HZGA 3KFWX 4GKJF 2VWJA 3IG1B 3CCUS 3NWGA 1N8RT 1RILA 2CQIA 4P2MA 4M3ZA 2D3UA 5AQWA 3VESA 1A5VA 3TYTA 2GS8A 3HHEA 2W7OA 5L38A 2HNDB 4ZHRA 1NGEA 3BDPA 1YIJN 1IWGA 1HKAA 3MXMA 2E5HA 2OTJN 3J80U 3FZFA 4MH8A 4NLRA 4B8AB 1FDAA 1RU1A 4CZHA 5ETRA 1GH8A 1HR0J 2R42A 4WXOA 2LFVA 5B08A 1SQGA 4J91A 2WVDA 5DM7L 1ZTTA 2I38A 2GV9A 1CS4A 4NB4A 5AQKA 4ZIVA 1HD1A 3PW4A 1P90A 3D0GE 3KWIA 3LQVA 1E6VB 3HBTA 4FLTA 3N0VA 5L46A 3ZTRA 3RB6A 2QL5B 3SSRA 5D77A 4WBFA 1EETB 5AQNA 3W5ZA 4XPEA 3T5LA 2WOMA 1Y4ZB 2PI4A 4ZJLA 3PW7A 3WIVA 2X1FA 3P96A 4ZOSA 5SWMA 1HHQA 3W65A 2O8BB 3HD2A 4PG4A 1CJTA 3FUYA 4GKKF 4OKEA 3CI5A 4DR1F 5AQOA 1TMMA 1NK4A 1FTCA 5E7OB 2XSJA 1KVKA 2W2MP 3CDAA 3MMCA 1S10A 2V7YA 1JIHA 4IFEA 1TAQA 3NAIA 1C1BB 4NI2A 1SL2A 2RNEA 1Q95G 4WE1B 3FZBA 1SKWA 3R6MA 4E7KA 3R8EA 3QQCD 4I9QA 4RKUC 4G1PA 4ZPWR 2K8GA 4MO4A 4JI4K 4J9NA 1QVFR 3TVZA 4TYBA 5EXWA 3QESA 2R2RA 5H9EJ 3EY1A 5DQGA 3AVLA 3VHQA 3CB4A 2K7KA 4C8YA 5J1EA 4QOZB 1U1MA 3NCRA 4L6V3 1TKZA 4FJHA 4CEZA 3L6QA 1TV6B 1VK0A 1VSMA 3AAWB 1RWOB 2ABYA 3C7NB 3AD8C 2I9SA 3CJ1A 2F4FA 2GWJA 3HD1A 1M90O 4DSEA 4X4OA 3SDEB 1GLFO 3DXMB 4YY3K 2QLFB 3KUGA 4NI2B 4CGDA 5FIIA 3MGJA 1NSPA 2ROPA 1PAUB 2QM1A 2X3DA 4H8KA 3OJUA 2W2OP 4P73A 1YVUA 3ZSVA 2ASJA 3GPAA 4F3MA 1MN9A 2V8VA 2HWTA 4AF1A 1S1VA 3T1YJ 5DGBA 2UXCJ 2YVSA 1YXQA 2YPYA 4LBIA 3EKSA 4RCHA 4OPAA 2B8QA 4HTUA 4RO0A 1TKTA 1XNRK 3H2UB 3R7BB 2Q3SA 5J2NB 2Z2YB 2ZH4A 3CMQA 3MF5A 3I55N 1FDNA 4ZVFA 3SMPA 2AJFE 3Q8VA 1R8BA 3BF4A 5IZHA 3TAQA 2GJIA 2KI2A 2E1CA 3KK2B 4FOEA 1WWHA 1DQ9A 1AZSA 5IWAF 1WSRA 3MN5A 1XUPO 4U7UD 4RTFD 4ZLLA 1YRUA 3TEGA 4J9VA 2IIHA 4WKRA 2GA7A 4OLPA 4H4MA 4MTPA 3D7EO 4C8OA 1Q9YA 3CIPA 1RA6A 2H5IB 4WFAL 2QWNA 4FKXA 2ZJRQ 1OQ6A 3HI9A 3M05A 1R8CA 3QIDA 2KN4A 2ZOFA 1S1XB 3A12A 4JI7F 2CPIA 4A8QA 2FB0A 2HNDA 2B9EA 3P39A 5A2QU 1VQNS 3MAAB 4DL6A 1RFQA 2P9SB 1RWNB 1N0UA 4PXBA 4LR9A 1UTAA 1C0TB 4CHZA 1N8RO 4B3SJ 3TTFA 4HEA9 1YJUA 2F9DA 4XIUA 3I56S 2RQCA 4DDFA 4YOUA 2O8FB 3NGIA 2I2YA 1I51B 5F8IA 4DV0K 4QR0A 4ZJOA 4R8UA 3ULHA 4LF8K 1G2EA 2F4VJ 2F8MA 2R9LA 4CLFA 4OGCA 3K89A 1HYZA 4NCGA 1NU0A 3CEDA 2D3OR 1RBRA 2EK1A 1IXKA 1CQNA 4DV3J 4F4AA 4RW4A 1LWEA 3W63A 1BG3A 1FKAF 2O8EA 1ZBFA 5E26A 2XCPA 2QLXA 4QZVB 4OI6A 1LWCA 2UVWA 2MZJA 4ICLB 3G9CA 3UVJA 1TU0B 2DXEA 2CA9A 1K0VA 1SH0A 2OP5A 2QFJA 4LF4K 4NCGB 4AHTA 4DQSA 4DTJA 1O8BA 2P9KA 4QWBA 3UW1A 3AO3A 4I2PA 4CHNA 4ALZA 1DHMA 1ZS6A 2VPZB 5HRRA 2BZ2A 1NPPA 3QFHA 3NWRA 4M5JA 2KL8A 3ZO7A 3KXDA 4KB1A 2YWKA 3BEGB 3H3NO 3BKUA 2CRLA 2OPQB 2JLGA 4K7QA 1BUXA 1D1UA 2DNGA 3A3OB 2HHWA 3DLEA 1U1QA 1BWEA 3CMES 3HSGA 4KHRA 4M63A 4B3SK 2BR0A 1VRQC 2Y0BB 4HTJA 1XQIA 5KT5A 4ILRA 5E3AA 1TKZB 3JSMA 3IWLA 1RGIA 2VC1A 3HP9A 4IO8A 5F8LA 3HSDA 3W9IA 1YX2A 4YOEA 4C3MA 4O3SA 2QLJB 1VCTA 2F7VA 2UV8A 1TUVA 1HNVB 3BS9A 1LWFA 2Z2MA 4C48A 3H4BA 5CZVA 5CA5A 3M3ZA 4FCYA 2QRRA 2FJDB 1UVKA 1W0HA 3W62A 1NBEB 5HK4A 2PFDA 2C1EB 3GIKA 4W5QA 3CCRS 2W24A 3A8JA 4RWTA 4IFYB 3AVBA 4NRTA 3U27A 2Q0RA 1TV6A 4OJRA 2ZJPL 1M1GA 4P10A 2P9IB 3AO2A 1U48A 4JI1F 1WTBA 3DYAA 2ZZMA 3T7ZA 3UCGA 2ILYA 3CC7S 3R8YA 4OJHA 3EVMA 3CE8A 1N5YB 3V5RA 4LFBK 1NGBA 3MM8A 1BUPA 4P2FA 4RNMA 4PA1A 3CPWM 4OYPA 1BQNB 2IVFB 1S1VB 4E3SA 3EYZA 4IRDA 2D1KA 1KEKA 2UV8G 1B9FA 2ROGA 3VA0A 1CJUA 3K5NA 2BH1A 3DM2A 3DN9A 2BJ8A 3JYTB 3W5XA 2VH7A 1J53A 3MUMP 2MGZA 1SQFA 3MCNA 3IM8A 3GL1A 2EG2A 2D0OA 3T1AA 5G4DA 4NOHA 4NYZA 2XS2A 3RGIA 1M5HA 2R7XA 3RSEA 4PKHA 2Z58B 2DRDA 2MLZA 4BRGA 1BIZA 3PEJA 1LAWA 2V34A 1VBKA 2EEYA 2V4JA 1FT8A 4U67Q 1NJYA 1S77D 2QA4G 3J81O 2BQRA 4CE9A 3CPWR 2KLAA 3TSPA 1VC0A 2GAGC 3NAHA 4URQU 1VK8A 4WE1A 1VQKN 2BJ9A 1HI1A 2QZ8A 1UETA 3ZSQA 2J6UA 1SZ2A 3OBYA 2AYMA 4ZCMA 4P75A 2VPXB 5K8PA 2XY6A 1RDDA 4KI4A 5BRDA 1X3MA 4L74A 1LW2A 4LSNA 1U0SA 1D9FA 2QE5A 1C0GA 2KTQA 3I9V9 1Y3KA 3JSBA 4RWWA 2F63A 3C6UB 3L3CA 5HVFA 2VBXA 4GO7X 2VOOA 1UKUA 1VQ6N 4YHHJ 4P71A 4USWA 2E8AA 4CLZA 2EBGA 3H90A 4Y1CA 5I42A 2QI2A 2AZ1A 1VHXA 2XY5A 2W4PA 3KJQB 3UDLA 2F65A 1HNXK 3BP8A 3QGGA 2CQ1A 3FMWA 2E29A 2E9TA 2ZJPQ 3OV7A 3N5BA 5KFQA 3C16A 5F8MA 3A3NB 3KLGA 4NYPA 1RDUA 2E6LA 2RT3A 3AVJA 3CC7N 2D9PA 3BO3A 2BJDA 2CGKA 2BKNA 3TUZC 1V3ZA 1VDHA 2YX7A 3I87A 4OYOA 5JXSA 4J2BA 4HACA 4CEOA 2HS0A 3A1YG 3BGRA 3R6GB 1QQMA 4CBUA 4CEEA 3HVWA 1KONA 3EM1A 1NGGA 3I0SA 4I68A 1S6QB 3HPOA 4YMEA 2IC3B 3RZAA 3DRXA 4X4SA 1AW0A 2Z56B 3V9WA 1C0MA 5KFYA 5FRNA 4ZVOB 5C2GA 3OXFA 3S3MA 3OTOK 1TL1A 2N82B 2C2RA 1N32F 3TWHA 1ROFA 3OL7A 4NXNJ 1T95A 4Q0BA 5HQ8A 1R59O 2CNOB 1A6LA 3RAQA 3HSJA 2BQ3A 2Q36A 3GFYA 4OPKA 4RW6A 2YKAA 2N3OA 2M8HA 2GUIA 4HYKA 3HRGA 4CZMA 2FZGB 2E5LJ 4PQUB 4ETXA 2IDOA 3T19A 2H54B 4DR5J 5A8WB 3TQ1A 1LK7A 4ZMMA 2ALZA 4ZVHA 4I1TA 1YJWN 2DGXA 5KT6A 2I5JB 3BDEA 1SAZA 1B70B 2HZAA 4NXMK 3G25A 5H1SQ 1AFIA 4K25A 3T5HA 4X66K 4CVNE 4FS1A 4ELUA 3ZEUB 4ZS6A 4DX6A 3DRSA 4Y0FA 2CJAA 1VQ6S 3O9UA 3U02A 4USVA 4M3UA 5J1NA 4DB3A 3A13A 2P51A 3OS2A 3SUOA 5HMXA 1XC9A 1T44A 1IV0A 3IO1A 4PYDA 1FHTA 1JLCB 1N4LA 3MEDB 1EX4A 1VFJA 3VGLA 2HFSA 4RZRA 2H5EA 4AXJA 2YKMB 5A8WA 3HPGA 4CD1A 3NGTA 4FVCA 1TL3A 3EZWA 4BE1A 4BLGA 1Q8LA 1S6UA 1ZTWA 3OUYA 1RTHB 1B0VA 2D5RA 2YXLA 4P6QA 1K8KA 4ECZA 2DO0A 1S7IA 1PG5B 4PL8A 4G9ZA 1G15A 3LZIA 4USJC 4WTOB 1HA1A 3KHHA 1IKXA 4FJLA 2CPEA 4BC4A 1K9MO 2HIQA 4U7CA 3H7HB 4B3OA 4GV6A 1B3TA 3J7YI 2KXFA 1RWXB 2G2OA 1VBYA 4AHVA 5FROA 1U02A 4KBOA 4CQ1A 5FPNA 1QZ6A 3OR1B 3EZ5A 3AHPA 4CO5A 3MM9A 4DU7A 5F3TA 2PA3A 5IC4B 4IRKA 4DV1K 4YB5A 5D8HB 4OYBA 2ZH5A 3L95X 1TKXA 5A0YA 1NO8A 3K2PA 3DAWA 1NK9A 1GQEA 4P72A 4AHUA 4RU9A 4DPXA 1T6DA 2OI2A 4BRLA 4CD3A 4KY3A 2F1FA 1LXNA 4YHHF 3I55S 2DY4A 4LRAA 5J2PA 1KD1T 3EZUA 1JXVA 2AGQA 3D0PA 5LJWA 1N33F 2BYCA 3F0NA 4ZDNA 4BRKA 4LFCK 4KH5A 2XHWA 6FD1A 1WTFA 2ZH2A 1Y5IB 5AQGA 2XBPA 4UTGA 3D3CJ 2HRTA 3HHKA 1IR0A 2DNHA 2VB6A 3M2RB 2FQQB 2HS4A 4RNFA 3CJCA 1G1XA 4JAXA 2WW4A 4J9RA 1O5JA 1S5ZA 3LWLA 3WQUA 3ZT4A 2D0BA 4CFBA 4NASA 3PO4A 3O5TB 3VAIA 2PFUA 2DFHA 2VA3A 2GTDA 3QIOA 1U2VB 1NU4A 1VSIA 2CZVC 4O0NA 2OTLS 5L1LA 2QWQA 1FNOA 2GJ2A 3RMCA 1Q16B 2YHXA 2IMWP 3CJKA 2NNWA 1DFDA 2YNGA 2W9BB 1RT4B 3IFRA 1VGYA 4A8WA 3L2RA 3MPYA 4ZLJA 2P9CA 2A40A 4DLEA 3GV7B 2ZNYA 2IFXA 3MMJA 1JLBA 3CC4S 1XNRF 3SDEA 4FBUA 3OS1A 3OYGA 2ZH3A 5A2QY 3P8BB 3CD6S 1WACA 5HSPA 1VSLA 1QHTA 3PZPA 1S0OA 2R2TA 2K7JA 3AODA 1Q1KA 4C11A 1S9GA 4X4TA 4R5PA 2LXUA 4WCEQ 3JS9A 1WG4A 2YI1A 2BW7A 4GO5X 2W9BA 4BE2A 5LXRA 3K59A 2HHHF 3W2WA 2MQ8A 1L3SA 4BC3A 4PPZA 4UQTA 4MK8A 1VQLS 1R0AA 2OEKA 2ZFHA 1NJIO 3SV3A 1JLQB 4XEIA 3WNHA 3WX4A 3MM6A 2NCKL 1GEHA 4JB8B 1U0HA 1SKUB 4DR2F 3MPUB 4WP9A 2DY9A 1B92A 2ZGYA 1RT3B 2JH3A 4HHJA 4DPYA 1SV5A 1UEVA 1V9OA 2BRLA 3CJ2A 4U9RA 2QWOA 2Z1JA 4L8RB 3LH2S 1MDUB 1PJ5A 3T1HF 3QPIA 3Q8RB 4FLZA 4M7YA 3QERA 5AQRA 1OMSA 2RRAA 4ECYA 4NLQA 3NNAA 2FD2A 1VQ9N 4BC5A 1JQGA 4O4RA 2B43A 4K8XA 3LP2B 2KYXA 1H72C 1NGJA 3OYHA 3EE9A 2GNKA 2OSRA 1T02A 2HBMA 3THYA 4O5FA 2ZVIA 5BREA 1EAYC 4A8XA 2VQEF 2P8IA 3FFKB 4DR6J 3PSIA 3QIPA 5L1JA 2BM1A 3KLGB 1FRKA 2QWPA 3QEIA 3I32A 1C1BA 3HHNB 3FZHA 2XMWA 3K5PA 3TAGA 4ZVQB 1RB0A 4EK2A 2P9PB 2W9AA 2O8BA 5D6GA 1NJXA 1XMOF 2C22A 3PHEA 4ISEA 3PJ9A 4HWIA 5GMDA 4CJUA 1HR0F 3UE2A 3F44A 1S6QA 3OQ2A 5FLXY 4ZVGA 1T0TV 4MKYA 1AFJA 5I3UA 3SCIE 4BC9A 2RD5C 4OZ1A 2E9ZA 1FKOB 1YT3A 4GC6A 3DDIA 2J5AA 4TU7A 4X2BA 3LGHA 5E41A 1UW9A 4M1KA 1RI7A 3QJPA 1OH8A 5EHHA 1UVJA 4OZ0A 2GHPA 1OO0B 2Z2ZA 2WVFA 3OYCA 4JI6J 3KUEA 1U2FA 4IOXA 4WPAA 3TW0A 1VQ5S 3DGPB 3GFHA 5HVHA 3GQCA 4LUBA 5F0WA 4DU4A 2GIRA 2ZEJA 5C2CA 1Q7YT 1VBXA 3AO5A 4X64F 4KB7A 3AJ2A 2VWBA 2LQ8A 4GVMA 3MX5A 3ENOA 3VQSA 3SQ4A 3H46O 4Z4IA 1F1BB 1P9QC 1WG1A 3R97A 3OYAA 3ZZOA 3QT5A 4TSXA 4Z4HA 3DC2A 4QWCA 4CLYA 2OD6A 3DRSB 4LFCJ 3HXMA 4L76A 3BB5A 4M5NA 2YKNA 3CIMA 5LXYA 4X4RA 2ZF5O 4M95A 1D5AA 4JV0A 1OS5A 5A8KB 4B3TF 1E3MA 3KDNA 4U95A 3JAMU 4CIOA 3RYLA 3G6XA 2HNZB 1IBLK 1XIQA 1SC3B 5KQDA 1CSJA 5AXMA 3BBCA 1ELOA 1YTAA 2EFNA 2UU9F 1PKUA 4FK4A 2UUWA 4WTYA 3HHLD 3AO4A 1N34J 2ZNZA 5AZIB 2JRSA 3QINA 5FPDA 3THWB 2BRKA 2ZC4A 3KK3A 2FJBB 1JJ2M 3SXLA 4DTMA 3HM9A 1XNRJ 4IH7A 1BQNA 5BR8F 3MFHA 3BYPA 5GADU 2AEMA 2ZBCA 1RBLA 5JJBA 3O4NA 1BQXA 2QW9A 4B3MF 1HWJA 2HLUA 4CF0A 3W2VA 4CLWA 4DUYK 3BN7A 2CVEA 1E6VA 3MWBA 4PHTX 2APOA 4CECA 2M7SA 3SSQA 2DNNA 4K43A 4BRMA 4IG0A 4EP4A 1M5KC 2ZUGA 3CD0A 2BE2A 4CF2A 4JHDB 2ZDPA 4JYAK 3DI6A 5EN1A 2W40A 3TAMB 3B6BA 3QWPA 2DCLA 3G96A 4CEBA 1WF0A 3N4QA 2CPZA 2OTLN 2HAIA 4G1IA 4OZNA 2I0XA 1HNWF 2Q1NA 5GMKa 3R5GA 4KGMA 1UWAA 3S8SA 2J9DE 3A5LC 1FJGJ 3DDKA 4BR7A 1BLUA 2B4OA 3NLCA 1BY9A 4J9QA 3VERA 3QZ7A 4R8UB 2HVIA 2KQ2A 4EHTA 2MZRA 3QRRA 1RT6A 5EVZA 2BJ3A 3M6XA 4CGGA 3NGKA 3FKBA 2N7CA 4EBDA 3AGRA 3KHYA 3CG7A 3THYB 1ZAWA 1U6BA 2RAQA 4Y2KA 4AQYJ 5E2QA 2WW8A 3HKZD 1LWCB 2DISA 1J5EK 2VBYA 4WJBA 1YBAA 1NGDA 2VDIA 4RWXA 3RRKA 5M2UA 1DBDA 4DL0C 1JXLA 3BR8A 3D66A 3C19A 3R9LA 4Y0WA 5F3ZA 5C24B 4HHHA 2LSNA 2XB2D 4K2XA 2ASLA 4WZQA 1LEOA 1MROB 5LM7E 1DTTA 3M2UA 2IDEA 2QWMA 1TELA 3C2PA 3P5BP 3EN9A 3ZT3A 1WORA 1REVA 1WF1A 4U7BA 3DLEB 4B1ZA 2MDAA 2QMXA 3A0IX 5KFTA 1G3OA 2JEIA 1CJVA 2P9EA 2VUGA 2OEMA 1M1KT 1X4AA 2DHSA 3UR3C 5EWEA 2FC8A 4DQQA 1RT5A 3UKRB 1EWRA 5A76A 1U24A 3OYFA 2WRMA 1MMLA 4YHHK 4AYBD 4LF7J 2EHGA 4HUGA 3ZX0A 4DUZK 4CZKA 1U25A 4NL5A 3OTDA 5C7PA 3JB9k 5D78A 3QAUA 3BZCA 4KHUA 3EPIA 4L73A 4YORA 4CF9A 4QPTA 2IOCA 2W42A 4CZGA 2A41A 3OTBA 4PKIA 3KLEB 2DNQA 1SJ3P 1RLCL 5GAHU 4K0KF 3X1LB 2V8PA 3R27A 4EEYA 1VLYA 4PKDB 5GAGI 3CCTA 3AV9A 4K4XA 2RU3A 2FJEB 1KBRA 3V4IB 2OAUA 3BUZB 1GMVA 3A8IA 4R5PB 4R0EA 2OPSB 3CNQP 3IWXA 2LA6A 4PKGA 2E20A 4CJVA 2N7YA 2MEWA 4E19A 1V5VA 3UNYA 2HHHJ 4JI3F 3VGTA 2PD1A 2EBEA 3TJAA 3N6LA 2WB1D 3PYGA 2P9LA 1X1PA 1JXEA 3IFEA 3CW2C 4CFAA 3L9ZA 3LDNA 5IQ6A 3MR6A 1FWLA 4AHRA 1DT9A 1NHUA 4O23A 3L4BC 1WNSA 1KN6A 3ZLJA 2DD8S 4A8FA 3LDPA 3CD6N 4FJJA 4CNZA 3V4MA 4RUBA 2LVWA 4QS7A 4JK7A 3K5MA 2PT0A 1PC4A 3RBDA 5A8RA 3IKMA 1OH5A 5DDPC 1HD0A 2N4CA 2QLWA 1HBUA 4KGZB 2OH2A 4EAHD 3KLFA 1QAIA 2JLFA 4LSNB 4FYWB 3CQXA 3C95A 4NLSA 2ATCB 4DR4F 1NK5A 5CYJA 3US5A 5LL6Z 3IBWA 1FFGB 2WZ1A 3ET6A 1F9FA 1V3SA 1F0XA 3DOKA 2WOMB 3CD5A 2EC0A 1RHUB 2KHOA 3GG1A 1DTQB 5A6WA 1U1LA 3CCJS 4DF4A 3PLAA 4DR1J 1ZPVA 3O4WA 1ASUA 4ED2A 2OFGX 4DPOA 5KG5A 3I33A 4KKOB 1A5XA 4UZBA 2IVOA 3FVYA 2ASDA 3OUYB 4DHVA 5IT9U 2CXEA 5B0CA 2U1AA 3UCUP 3D2FA 5HI7A 1H1VA 3V9ZA 5MLCQ 3OLBA 1NJIT 3M32B 2O4IA 1ASWA 4CO2A 1YJNS 1YHQN 3M1FA 4CGFA 3VETA 1IBKJ 2FUG9 5A0YB 3IS9A 1ULRA 1SL1A 2QT7A 1MG7A 4CJRA 2OPPA 3ALYA 4MIAA 2ZHOA 2KT5A 4FPBA 2JC1A 3MMBA 4CI6A 9ATCB 3BGUA 3DLHA 2Y9HA 4JI0J 1GLJO 3HT3A 3NGZA 5LJ5Y 3HDSA 1VQ9S 3J80O 3NKYA 4BRAA 3I31A 3UR0A 3BGFA 4DV7J 1VR6A 5DJBA 3NVKA 2MKJA 4IKFA 4NA1A 1IBLJ 3U4LA 2NXUA 4NLBA 4EYIB 1UFWA 3IBCB 5AQMA 2FC0A 2HGLA 3EMTA 2C2OB 2HVHA 4B9SA 2KW4A 2ROEA 4OIXA 1VQPN 2HQ3A 4CM2A 4CNYA 2B56A 4QWDA 2HBRB 3G71N 3ZTSA 1FNMA 1FKPA 3VAHA 4WQ4A 3ZETA 1B0PA 4UY8T 2MQPA 1Z05A 3DM2B 3SAGA 5M1PA 4FM1A 4UOHA 3OHRA 2IHR1 1EX8A 3BM7A 2POKA 1T3VA 1QE1B 1SC4B 2I7NA 2ZM6K 5IV3A 3P5JA 3H8YA 2IJRA 5HBMA 1G6BA 2IM0A 4ZVEA 1HYVA 4TU8A 4ZLPA 3LPYA 3KKRA 5KT4A 4OLBA 1YQHA 5HLFA 2CG4A 2BV3A 4PPDA 4WU2A 1Q7YO 2QXFA 4H0XB 1N5TA 4F4YA 1S99A 3QT6A 1J5EJ 2RQ4A 2EKNA 1A5WA 1HYSB 4KBIA 3D1OA 3T1YK 3DI6B 2J7WA 2WBMA 3AT1B 4A5AA 2LP4A 3LUYA 5D0EA 1DGKN 4B3RK 4RL1A 2CPXA 4RX6A 3D2WA 2BOPA 4FJMA 4OQJA 1KTVA 2DEIA 1U2VA 2GIQA 4R79A 3CQ8A 3K8VA 4N5SA 3P4UB 2X74A 1RT7B 3UKUA 3MM5A 2GELA 2DTJA 2K3KA 1ACMB 1RWUA 2XMTA 4Y34A 4C2MA 1NK7A 4F0HA 5DK5A 3FZKA 4JYAF 5KPZA 3F2KA 2WUSA 2C3MA 3VCDA 4PUOA 1N52B 1U0HB 3EGVA 2QL9B 2MZ1A 2YX1A 5ETSA 4K4SA 5KRTA 5C5JA 1FJCA 4I67A 3DKDA 3T6JA 2XMKA 4C4WA 4DV6F 3RAMA 1NDKA 2B7BB 3HSCA 3OR2B 3UDVA 1F9EB 1EETA 5KFZA 2O8CA 3MMCB 2KRRA 1X7VA 4CYUA 2VIHA 3FCHA 4EMDA 3TAEA 3H4DA 3FEZA 1UA1A 4DR6K 3S6EA 1HKCA 2V4QA 3OYIA 1I3OB 1HNZF 1T11A 1OH7A 1EP4B 2J76E 3AA5X 4H5VA 1T9UA 2ZKTA 5TKYA 4LFBF 2V4JB 2FZCB 1EHWA 3N6MA 4RUAA 1Z6RA 3DLKB 5IT4A 1N0VC 2LDYA 3FDSA 2CUYA 2BXJA 4NXMJ 4E7LA 4OX7A 2W1BA 2UU9K 4RBTA 2WCXA 5AQPA 4JP8A 4RW8B 2HW3A 2E5JA 2KT3A 1EO1A 2KU7A 4BWMA 3LF0A 4CLPA 4PG8A 2KZZA 2VFTA 2JWLA 1EP4A 4LFAF 2W25A 3QDKA 1Y0HA 1RTDB 3HPHA 1IG9A 5LMUK 2B4VA 2PY5A 1T9WA 3FZLA 2V94A 3MCOA 2CJQA 4DCPB 4YB6A 2D7SA 3PYDA 3WXKA 4D3GA 2V4RA 2FDNA 4KYZA 2BX6A 2KO1A 2HRUA 2CPJA 3VV2B 3OW2M 1TL1B 3EVWA 8RUCA 2DFFA 4JI6K 3DLGA 5J2QB 4KH4A 3QFPA 4KB0A 3JAMY 4DWIA 3QRQA 4WFBL 3QB0A 4EFAC 2YKQA 3L2UA 3VAFA 3FBBA 4UOFA 4GC7A 3SJJA 2HFUA 4B1WB 3OYDA 3CCMN 2JEFA 2ZZTA 3QYYA 4XH1A 3VEXA 1UP1A 2K1RB 4B17A 5JVHL 1KHVA 2LDIA 3QT7A 2Q43A 3CD7A 3EUNA 1TK5A 3HZEA 2VCPA 2QYCA 3MK6A 1D8YA 4FJ7A 3H3OB 1NB7A 2AWZA 4E0DA 3HM8A 4Z94A 3NL0A 4AT1B 4TYAA 3VQBA 2MZSA 1H2VZ 3M2RA 3D54A 3KIOA 1RAEB 4H0OA 2D74B 1QAJA 3QNWB 4BC7A 3QGIA 2W8LA 4OO1J 2LA4A 4DU3A 1RYRA 2FJAB 1VQON 3RMAA 3FBFA 3ATVA 1YJTA 4OZ5A 5BPMA 4LBHA 4PWDA 4FPIA 2NRVA 4J9LA 3UE5A 2HNYB 3E9PA 3VQPA 2Y8YA 3AVNA 5ETPA 1NBWA 4JI5F 5J2MA 4V19S 3M2VB 4IR9A 3BYRA 2PAVA 4HUFA 3CDEA 1LQ9A 4LR8A 1TK0A 3S3NA 4FVUA 1XMOJ 1YF5L 1LW0A 1NKBA 1WHXA 4P7VA 3W8GA 1HQEB 5DLFA 3IAS9 4NLUA 4OYAA 1VQ8N 1FRHA 4IEIA 2P9UB 2ZE2A 2AEJA 2F8HA 3MM5B 2HWIA 4F4ZA 1SJ4P 2J7UA 3MCSA 4P9SA 1QAYA 5AJ3K 2RE2A 4OYIA 1YKWA 3G0ZA 1FX2A 4JS5A 2FGCA 1RAHB 1UFKA 1BOTO 5AE2A 3CCJN 5F9LA 2F4VK 2JNJA 3IR6B 1T05B 5D4NA 2ZHAA 1X9JA 4JK8A 1WOSA 2VICA 3DLLQ 2VC0A 3MTKA 5IWAK 3N4WA 2LXIA 2DR9A 2DGUA 1DZ5A 1NSAA 3SNNA 3QSIA 2E7WA 2MJUA 4H03B 4CIEA 2UVVA 2OELA 5J2MB 2C42A 4IBNA 2E1YA 2RH3A 3IRWP 1H3DA 4LD0A 5FJ4A 1HMVA 1XHXA 4KHPF 3WC0A 4JV5J 5J2PB 3QSYB 3CYMA 1U4BA 3MMVA 4IOAQ 3CUNA 1S1TB 3HHLA 3G82A 4W92B 2XQCA 4UOCA 2H1YA 5AQJA 4IJNA 4YNQA 3M1VB 4CLLA 3CO9A 2DHGA 1D0EA 1Q18A 2HFNA 1BQMA 3NG8A 2P5OA 4BROA 1WHVA 3A5OC 3RBXA 4PL7A 1VISA 2B8PA 4WP8A 3G4SS 3VQDA 2GMHA 3M6VA 5K5MA 2H3GX 4Z37A 1S79A 2X1GA 5KFPA 2VGMA 4OHZA 2VKRA 4DTPA 3D6MB 3CCEN 2HZCA 1TL4A 3PX0A 4BQZA 2R7QA 2PEBA 2RHKA 2E1RA 3J7ZO 4BR2A 1R31A 4PWWA 1KFSA 2A6AA 1RA7A 1ZM4A 4CO0A 4CJ3A 2P1JA 2MLYA 4DV3F 5KFAA 5GADP 1E6YA 3V1RA 3ILIA 4IOCL 2Y1RI 4CZJA 3E3XA 3J8AA 2R2UA 5L1KA 2GBZA 1BHNA 1Q5VA 2CJKA 4B3MJ 2DNOA 4CBXA 1J5EF 3G2XA 5DZ6A 1PYTA 1W97L 4JI5K 4I6AA 3W60A 3CC2S 3OBWA 4AILC 1MU2A 1H2UX 1F3FA 1FWKA 1YVNA 3OL9A 1W7WA 4PAAA 3PCOB 4OHVA 2UVUA 3C65A 4B8CA 2DGQA 1N33J 4MKBA 4ZN1A 3PIPQ 1YJRA 2C3YA 3ISND 1KD1O 2JVOA 4WFYA 3D0HE 5JICA 1X4DA 2XMJA 1JLGA 2KZMA 3NEKA 4DL7A 3ZC4A 3TX0A 5KFCA 4NLWA 5CXTA 2F8TA 3NP5A 3HHLC 4KGVB 4TXSA 2DRBA 5GAEP 2Q97A 4ES3A 4KAIA 4GKKK 3NMRA 5DQHA 2G8HA 4DS4A 1QD1A 3KG4A 3U3YA 2ZD1B 1YBTA 3EXYA 1NRKA 3QATA 5T7LB 2KXHA 2J7KA 4FKYA 2I8EA 1LOUA 2CQCA 1RT3A 1Q8KA 2CVIA 5AZIA 3RU0A 2GHVC 4DOZA 1Q0NA 4DZDA 2DPJA 1W26A 1C1AA 4JHDA 3TZWA 1SKRA 3C94A 4BACA 1N5QA 4BRIA 4V1Ak 5D4PA 2B51A 3LALA 2AJ1A 4DV5J 4EBCA 2DGOA 1RCOB 4OHYA 5CZ1A 1EKEA 1NK8A 1S49A 4RUCA 3CMAS 1VSDA 2HVZA 2ZBIA 1HWKA 2FLNA 2X6NA 1BCOA 1TL3B 4XK8C 4DCHA 4QIGA 2QX0A 5I3QA 3WXMB 3GZ7A 4ECWA 2PSZA 3TWZA 1UZDA 3T3FA 2ZBQA 3CFRA 3R6LB 4M8LA 1UAWA 3V81A 2NSCA 4XDDA 2V2ZA 1V3RA 4M7XA 2O8DA 5LMUF 3WUHA 1XERA 1XR5A 2P9SA 1YZ7A 1WOOA 2RQKA 4WFNL 4DSKA 4IOBA 2FJVA 3JQKA 3GSIA 1WBDA 4YB7A 2V69A 3TPQA 1B7FA 3VQQA 2RS8A 2XHBA 3PJWA 3V6KA 1RDRA 3HVRA 3IAYA 3MD1A 4PCQA 2HHXA 1TQLA 1SL0A 4BQLA 3U9DA 2OMLA 5LMNF 1VK3A 2HWHA 2O8DB 3KNAA 2UXCK 2DVIA 2GFFA 5GAGP 3X3UA 3FEXB 4GVBB 2HYIB 2ITMA 1RHQB 1QM9A 2P6SA 4H4OB 3OVAA 5EUHA 2DO4A 1BMQB 3QEPA 1RWMB 3SZ2A 2DH8A 1VC5A 1FESA 4PRFA 3OBIA 2KFYA 1VQ7S 4M3WA 1FJ7A 1BA0A 3D2FB 2JEGA 2R2SA 5CHCB 2UUAF 4H0PA 2W4CA 1PJ7A 1IQZA 5AQSA 3HTVA 4P2XA 2MSSA 2V2QA 4C0OC 4A2AA 4B1YB 3AO1A 3PO5A 2MKKA 3QMQA 4JI0K 2UXDK 1RTJA 1HW8A 1N32K 4Q2MA 1GLCG 1N6QB 3TUIC 3PSFA 5KFKA 3HMJG 5HL7Q 4C0HA 3DNCA 3G8SA 5FLXU 3TEHB 4XO0A 1S76D 3THPA 5DG9A 3R9PA 4HH0A 3MMAB 1E4GT 3TOQA 1MWMA 4WWSA 2XLIA 4TQRA 5AZJB 3ZSYA 2BA9A 3FQLA 2VV5A 4EBEA 5HQLA 4NO7A 4LF2A 2W01A 3FK4A 2QO3A 2NRRA 5C15A 3QWUA 4F3TA 4CEAA 3ZZYA 3AGKA 2CQ0A 3QBCA 3OYNA 1ZBTA 1UEUA 1DKGD 1GLAG 2VA2A 3E9LA 4A46A 3T1YF 2B7CB 1U2CA 2IM3A 4M5KA 2R8HA 1NHVA 3PIOQ 3GIMA 4ILHA 2H9ZA 1ESVA 2E4LA 1JMTA 1YWXA 3CPEA 3T9NA 3BV8A 4AL7A 4OV6A 4HKQA 1S97A 2RVJA 5JVGQ 1SH2A 3BO2A 3SPZA 2BTFA 2YWWA 5EX3A 3W3SA 4N77A 1ZOTA 4OKJA 3MEEB 5IM0B 1RNHA 4QYZK 1KNZA 3NOCA 2L08A 2F7TA 4FPAA 3W8PA 1HNVA 2WVCA 1WC0A 4X64J 2XNRA 2H65B 3UCZP 3GV5B 3TP2A 4FJIA 3O08A 3RSEB 5HMZA 3WEEB 3V6DB 3GE1A 4XH4A 2QWRA 3LAMA 4ZTFA 3SQGA 2QWLA 1IO2A 3AA9A 1U1KA 3GOIA 2KXNB 3A4TA 4M5DA 3OFGA 5CAAA 1RT4A 3Q0AA 1AROP 2W9CB 2HGNA 1X4EA 3ZNUA 2YHBA 3BKFA 4L72B 2G0IA 1XNQF 4DV6J 5RUBA 1S0VA 3RAXA 5HLFB 5B7WA 1TVRB 1O0PA 2CPYA 1OKJA 5BYRA 1WKLA 1Y9OA 1HX1A 3THWA 4KREA 3TNVA 1KXPA 2PO4A 4GMKA 3ETOA 2VGNA 4E7IA 4X64K 3LP1A 4YDXA 3TX8A 5GAHP 4RBVA 3PUFA 1B9DA 5LT5A 4JI7J 1T3NA 4OLAA 5KFEA 4CM0A 1UJ4A 4C6AA 4KFBB 2H4WB 1W25A 2AV5A 3UDEA 2YWFA 3FSYA 3PVXA 3KG1A 4QIWD 3NGRA 3AQOA 1WD6A 3M8QA 2ETJA 4JRPA 2HQDA 1B0TA 1MMNA 2CGLA 3UKUB 1LWEB 4NA3A 2EFQA 1X9MA 4F67A 1PBUA 1ILYA 2RDJA 4UZCA 1P9YA 2W9CA 3OR1A 1ICEB 3IDHA 3C6AA 4Y1DA 4CFCA 2O8FA 1FD8A 1NK6A 1HRHA 2GUPA 3KUHA 4TY8A 3GYGA 5M2PA 4DR6F 2H51B 1QQNA 3K9KA 2VU5A 2DNMA 4X4QA 1RCHA 2AT1B 5B0FA 3THXA 4LF9J 3IA0A 3O3HA 3A2FA 1FKOA 2CJYB 4N7TA 1M5PC 3ASMA 1GX6A 3NGSA 4X62K 1NOZA 1FRJA 4A5BA 4KFBA 4Z7YA 1RWWB 1CBKA 4XAKA 4J9KA 2Z1IA 1LK5A 1OVYA 2GVDA 1WF2A 2MKSA 5JS2A 3TSUA 5KFJA 1BE4A 1KFDA 3A8KA 3GG0A 3NH1A 5KFVA 2DR5A 5C10A 2VF3A 1KC8O 3H6EA 4USKA 3GILA 1NH7A 4OHWA 1WEZA 3JXOA 2WHOA 3MX2A 5JS1A 5KG7A 4KHMA 4UQGA 2YPZA 4WF9Q 2GEMA 3SMSA 3VF4A 4CTAA 2CJBA 3VQ6A 1VIOA 2E2NA 2QA4N 2R7YA 4JI2J 2AD9A 4I6YA 3C6TA 1RDWX 1ZA2B 2RDDA 1GLBG 4J9OA 4NLYA 4OI2A 5IQQA 1WNEA 2JWNA 3PW2A 1CEZA 4D3HA 1NDCA 4CH1A 4DSLA 2G13A 1RE1B 1Q4RA 4NZ0A 1CLQA 5B0BA 2V8HA 4OMFG 2GC8A 1RABB 5KT7A 1DARA 2JX2A 3DXBA 1H7WA 2DNLA 2DH7A 3ULEB 3PYFA 4F4XA 4ISFA 3VN5A 2YWHA 3RMBA 4RBUA 5AQIA 2OYQA 5AQUA 3VEZA 4ID5A 2J8SA 1NLVA 2A42A 5EWGA 4Q7AA 4P52A 2CQHA 3MEKA 2KM8C 2NZTA 3CCMS 4O4GA 2PMWA 2OO4A 2DPNA 2ATQA 4CGJA 4IDKA 1QVGR 4LF8F 5IM0A 4IOAL 3DRPA 2NRWA 1L3VA 4FNIA 3A8YA 1HBNA 3FFIA 4CHYA 3V9XA 3MI7X 5KFLA 4I56A 2VQFF 3ZZTA 1VRUB 2RHQB 1S3XA 2R8GA 1D3WA 3DXSX 4DG1B 1Q8BA 4DFKA 2DR8A 4J2AA 2MLXA 1YJVA 3QEWA 3HVTB 1RWVB 3CJ3A 1ZBLA 4E1MA 1FJEB 2OZMA 2HFZA 3PHTA 4I69A 4J9PA 1RTZA 3F56A 3L7PA 4O5BA 1NM2A 3AB2B 3LP1B 2AJ0A 1WUAA 1F5AA 3AXKA 5BR8J 1CZ9A 5B0EA 3IGVA 3UD5A 5J1PA 1N48A 3M8RA 3O9SA 3T6BA 5GINA 1OJ4A 1ZC6A 3UO0A 4MDAA 3CJRA 2O8CB 3FEYB 2A2DA 3IGNA 2XWXA 1HNWJ 1O51A 1MNEA 1ZBSA 2F9JA 4F04B 2M8DB 2EC2A 2HFOA 2JZ5A 3QO9B 1OSDA 2CZ4A 2X1AA 3VQ4A 4WFXA 4CYUB 2FC9A 4JKAA 4BVOA 4JI8F 1KOOA 4E8UA 3WXLA 1HLUA 4CLTA 3W3DA 4HLBA 2FBXA 3RBZA 2FZKB 2E7VA 3RRHA 4CJ7A 3W64A 1VRTA 4HVZA 3QZ8A 1FWPA 3GFXA 4Y2CA 5G0RB 3ZX2A 5HANA 2PYJA 1OY9A 4A48A 2CJXB 1KR4A 3D3BJ 1YBUA 3P38A 3MUVP 3OY9A 5U47A 3TA0A 5I4MA 4I64A 3E9OA 3WNGA 4JS4A 2EFVA 2V68A 1NPRA 3L7OA 4B1UB 4O3RA 3SAFA 1FDBA 3LGNA 5G0RA 3UNGC 5LY3A 2UUBK 4LF6F 2A5XA 2ZOGA 2C3UA 2XM3A 3WHIA 1HBMB 1K47A 3MN7A 2CWKA 1WI6A 2IJFA 1HNZJ 4KV8B 4CJEA 5IT9Y 3KJNB 1DLOB 4CRJA 4DUYF 4YY3J 1IR2A 1S6PA 3L8BA 4C8KA 4DV5K 1P6TA 4DFMA 2UUCJ 3AXMA 3BGRB 1EKRA 2KVIA 1YSJA 4ANEA 2Z1HA 4USTA 3UKRA 4ZPVR 3KLIA 3Q22A 3IAM9 5C12A 3AVIA 4RW6B 3ZZRA 2AJQA 4BR9A 2CH6A 1A9NB 4EU0A 2IVNA 1H38A 4HDGA 3LL3A 1RAFB 5AXNA 1RP5A 5L1IA 2EI5A 2VASA 2I5JA 1N36K 4AD6A 1X5OA 5IC6B 2IM1A 3HSTB 1HQUB 4IR1A 1TMJA 2OLWA 4PYAA 2MQLA 3B6OA 1JNZB 1D09B 3V9SA 4LF8J 1WN7A 4FWLA 1ZETA 3DXMA 2ATLA 1TVRA 2QEXS 1FK9B 4NX9A 4K4ZA 4FWQA 4MKVA 4ZPDA 1YLXA 4MLEA 2RHSB 4DR1K 2W4DA 1U7LA 1Y00A 3PIPL 3OVNA 5F2RA 3WQTA 1U2RA 1HQ2A 3LW5C 3ZT0A 2Y1IA 3SCJE 3CCQN 1NCLA 4EP5A 4OJ1A 3M6WA 3TAMA 4B9TA 3VWSA 1JLBB 2AEFA 3CC4N 3UPFA 4KQZA 3OTCA 4F02A 3P49B 2Z2LA 5EY4A 3BO4A 4CEFA 1X31C 2F5GA 3TR8A 5H9EK 4FYYB 3BSCA 1CQMA 4USMA 1U45A 3L4IA 3TJ8A 4J5OA 3DOLB 5M1FA 1BU6O 2V9WA 1VQ4N 2A1RA 2CQPA 3OR2A 1VC6A 4RUHA 2LECA 2DFEA 1RISA 1NOYA 3HFZB 4BRPA 1U8SA 4OI3A 3CM5A 3SI8A 1HKBA 1EIYB 2NLWA 4FJXA 4B08A 1IH7A 3L2WA 1KQFB 3AVHA 2IYIA 1S1TA 1FW6A 3LO3A 5EU7A 3MR2A 4NEYA 3DHXA 4YDUC 1NUEA 2UYTA 5CQGA 2DPIA 4LF9F 1NSKL 3DLKA 3M5RA 3C16B 1Y10A 3LOUA 1I94J 4YOWA 4UOGA 2AP1A 1VI7A 1NPKA 5DDQC 2RB7A 4BRDA 1HNIB 5B0DA 3WXIA 2CQGA 1Y5LB 3LM9A 4ECTA 3O6WA 1HMVB 3JTOA 3MM6B 4KH1B 5L9NA 3MDFA 4AE5A 5CR4A 1S1XA 1T03A 2ZDOA 4GKJK 3G10A 3EKUA 1JWWA 3MPVA 1HNXF 3GJQB 5KFHA 5HQMA 2BJ7A 3ZSXA 1Q8IA 1MLAA 1RBOB 2VBZA 3RTVA 3IXQA 1FO1A 4CO4A 3H1QA 2CYYA 2O5DA 2JHEA 2V67A 3DMJA 4K59A 4IOCQ 5K14A 1UJ6A 2Q1LA 3NF6A 2NLXA 4HL9A 3E51A 2YWGA 2GVZA 3CDBA 1GMWA 3TA2A 5HATA 4B9MA 5ADXA 3R2DJ 2DNRA 5T41A 4O55A 4FZXC 3LDLA 1B99A 1N88A 4FWPA 1DAXA 4F2RA 4FJKA 3PDNA 1QTNB 4ETZA 3BSAA 1PGZA 2AYGA 3A5MC 4H4KA 3UVJB 4ZCLA 3RR7A 2HQCA 4AH9A 5J1EB 1IKYB 2ZBRA 4PQAA 2QKKA 2KKZA 1FEHA 3GCXP 3JAMO 4M63C 3PRDA 3R5DA 3FRYA 3GONA 2AQ4A 2ZH8A 4UY8O 1RBVA 1U1PA 4JKGA 4ZP9A 4I0WA 4URSA 2JFDA 1EQMA 2EFGA 3MEGB 1HBMA 3DFEA 4Y28C 2FPHX 1VSFA 2NUHA 3MXHP 1OY8A 1WC5A 3DLGB 3ICLA 4ILLA 1XC3A 1ZPWX 4FWSA 2RILA 2QSWA 4MQ3A 1MMDA 4KO0A 2E5LF 5KFOA 2D0PA 3VQAA 4LF5J 2RF2A 3KLEA 1SXLA 1RAGB 2IAJB 4O3QA 3TQEA 2D0CA 3BQ1A 2GQ2A 4LH4A 4H0TB 4HCCA 4I6MA 1KHWA 4CERA 4NRUA 4U96A 1ITPA 2KJVA 1GAOA 4MJKA 1SJ1A 3J7Z5 4ILJA 4IO1A 4E2FB 4IO9L 3Q2TC 3BZKA 5GAEI 2G8IA 1JLGB 2G0CA 1B7YB 2XZWA 4WQ5C 2UXCF 4X66J 2HBJA 3MEEA 3D6TB 4M3XA 3VALA 4DTOA 5KFSA 3OYBA 3CCSN 3MPDA 4JRQA 1CXQA 3D6HB 2H3EB 4FF2A 3PW0A 1FTRA 3O9QA 1RT1A 5LSLA 3FQKA 4ZVPB 1TFYA 1JLQA 4FYXB 3ZZPA 4DCJB 1FE0A 3H20A 4F26A 3KTQA 4IDHA 3CXCR 3WEEA 3CM6A 4WFNQ 4KIAA 3HO1A 2CNLB 4RW7A 2WK4A 4B9LA 1SV5B 1SIWB 1CVJA 2V7ZA 4QWAA 4LFCF 2G1HA 4O3OA 2MY7A 4C3LA 4M5MA 5D15A 1BI4A 3C15A 4QCLA 4Q5VA 2BDPA 4CJTA 3U6FA 1AA1B 1O1WA 4BDPA 3CGIA 1XEZA 3MAAA 3G87A 1G4CA 2XLJA 1VQ5N 3KKFA 3L2VA 3IMQJ 1BL3A 2CIMA 4H4KC 4LSZB 2VQEJ 3N28A 3EO3A 1LFPA 1RWPB 5BRFA 1YJWS 1GX5A 2YX4A 3S1TA 4QS8A 2QA1A 3HZ6A 1FF2A 3MM7A 1HBOB 2RMLA 4DU8A 3VR1A 3IS9B 3GE9A 3QT8A 3NY0A 1DY3A 3CETA 2B5JB 4ZK7M 4DR7F 1LOTB 3EGWB 1Q5YA 5HAOA 4PXCA 3ITHB 3JQJA 2OD4A 2BOAA 1P1LA 4X62J 4IG0B 2O1PA 3F73A 3OD2A 2AZ3A 2N3LA 4NE9C 2ZGZA 4O0JA 4OV1A 2HHVA 3VQCA 1S5JA 1TL5A 4EZ6A 4JOUA 1KLNA 4TQSA 3W9JA 1AB8A 2C3PA 4B9VA 2X6SA 2NPFA 3SLCA 5CH7B 5GAHI 2VKZG 4OGEA 4IH5A 5EWFA 1S9EA 4GVBA 3GR1A 1UZHA 2VG6A 3JTNA 5KFWA 2FBTA 3SFGA 5E84A 3W66A 2LCWA 4KGKA 2HQGA 3CMAN 3UIQA 3HI0A 4JEPA 4I6WA 3FCWA 5LL6d 2PZSA 3MN9A 3AVCA 3O9RA 2HSTA 4IFYA 2G1DA 3E2EA 2CKWA 4C3KA 3RRGA 4BG9A 3TZYA 1RTDA 3ZYYX 4YR3A 4DPWA 2ZWHA 2L9NA 3VZIA 5AQQA 4O44A 3AA4A 5IFMA 4CHQA 5FRMA 5KG4A 3B54A 4BS2A 4MK7A 5M2RA 2ZD1A 1XK8A 1WEXA 2GMJA 2HBLA 3SQ0A 4BCAA 4JI7K 5AE3A 3T5KA 4DR3F 4CCHA 2CNKB 1BGXT 4XTTA 4CZEA 1BWFO 5AE1A 3I96A 4KRWA 3KD1E 4A62A 4DX5A 1T8EA 3H98A 1WDDA 3RB3A 1KQSR 4O44B 1UPPA 2ZC3A 5B0GA 2MQOA 5E0OA 1BWVA 1M5VC 5JLFA 1M5OC 3O3FA 2WSFC 3OHBA 2DB1A 4FPRA 5AXKA 2Q6BA 4CBWA 4JI8K 1PC5A 1BXNA 3PYEA 2ZWPA 2FXUA 1K73O 5KPRA 2QLBB 1C4AA 2WSEC 5EX5A 1X5PA 4OVLA 3GIIA 3FSIA 1TGOA 4CZIA 1X4CA 4JKHA 3JS6A 4PZVA 3ISZA 3P5TL 5ETQA 1IBCB 4NZ6A 1KVJA 1RBSA 2DJWA 5D3GB 4CJFA 4FXVA 1IJFB 5E3PA 4MK9A 4EGLA 2WTFA 2WB4A 4K4YA 5ETVA 4LFBJ 4DR3K 4C8LA 1WDTA 2AX0A 5GIPA 2Q3PA 3DOLA 2L9WA 4EZ9A 3N4PA 2FHJD 1TUGB 2GHWA 4LVOP 1R3NA 4C1NK 1XTZA 2ZJRL 3O9TA 2ITGA 3BF3A 1T9TA 4YR2A 3CJ9A 3RR8A 4DTXA 3K0JA 1UAXA 3CF5L 5GADI 4RJVA 1TKTB 2MZTA 5KFMA 2FF6A 4ZHRB 2IA0A 1J5OB 1SQKA 4DR5F 3W61A 1BC6A 2NYIA 1ZBUA 1Q78A 4TU9A 4I7FB 5DZ7A 4U6PA 3DU5A 1YJ7A 4B3SF 4KGXB 2YNHB 3PRVA 3C6UA 1QSYA 4ECUA 2NREA 2VYPA 5D4LA 1M1HA 3ZSRA 2FLLA 2G8KA 4XH5A 2Z1GA 4ZTJA 1JLCA 2KDOA 4DV1F 1AZSB 8ATCB 4H5WA 4HDHA 2HLTA 2DBBA 2MB0B 5HO4A 2YNHA 3BQ2A 4N56A 1MWQA 2CGJA 4MDBA 3ZNJ1 5KFXA 3AD9C 4F8RA 5L9XA 2BKOA 4S0MA 3SIPB 1URRA 4RW9A 5AQTA 2GJFA 1SKSA 5CZXA 4OPJA 3GP9A 3EWGA 1EKSA 1HJRA 3DXKB 1IM6A 3KHRA 2OTJS 1GMWD 1QTMA 3O2IA 3O4QA 2E9RX 3U9ZA 4DV4K 2OMOA 3EL2A 3NE6A 4LF1A 2DIVA 2J0WA 3SCLE 1AT1B 3HHLB 5KRSA 1HHTP 1P8ZA 1SJRA 1I3AA 4IEEA 3ITHA 1UCNA 4FP9A 2VFUA 3M6GA 3SUQA 4NYFA 4FWNA 5LMUJ 3ILJA 1O6XA 2AHOB 2IMOA 3JTPA 3PACA 1CJVB 1SCJB 3M1VA 1YTUA 5CYQB 3NFAA 1VSJA 3H59A 2C3OA 3NS5A 3ENQA 4ZKAA 4MIWA 5LMNJ 3I82A 3ZETB 2ADBA 2YKOA 2V52B 2IRXA 2FLPA 2NR0A 4DL4A 4IUFA 4BR5A 5L8RC 4C8NA 1UMJA 3C7NA 2IJNA 5C2DA 4X62F 1TKDA 4KHSA 1B4SA 3CCES 3N5FA 3FBCA 2I6WA 3MAHA 1WKJA 3PKMA 3LPUA 2OCEA 1NGCA 3Q86A 2XNQA 4I2QA 2JFKA 4FYDA 4BGBA 3J7ZT 3TI0A 5E5NA 3JYTA 2MYFA 4DXLA 3PY8A 2FVPA 2J0XA 2RKIA 2GO8A 5GAGU 3CCVS 2W6LA 1LCUA 3Q7BA 2UZAA 5DM6Q 5HRPA 4O3NA 3QICA 3J7A1 4ID5B 1NDLA 3BREA 2DNZA 2V2VA 5C42A 3AOAA 5CE3A 3K8WA 4ZCKA 3MDQA 4IJAA 1Y97A 2PN6A 4WQ5A 2JL9A 3DRRA 3HX9A 1NH8A 3SQGB 2HBKA 2C2NA 1QSLA 2XY8A 1JL1A 1RHMB 3ADAC 1CXUA 1HBNB 2FBYA 5KT2A