2I5JA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with dhbnh, an rnase h inhibitor
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H P66 subunit
publication title HIV-1 reverse transcriptase structure with RNase H inhibitor dihydroxy benzoyl naphthyl hydrazone bound at a novel site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 117
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2i5jA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2i5jA05
4FK4A 1RTHA 4FJNA 5KFTA 4IG3A 1VSMA 1RBTA 4RW7A 2WRMA 2E6MA 1T05B 1VSFA 4FM2A 4LSLB 3RR7A 3CG7A 4CGHA 2AGPA 4NLGA 3T1AA 4IKFA 2VG7A 4ZP9A 1RDBA 3KHRA 1ZBHA 3M9OB 3HP6A 4KSEB 2YKNA 4KBIA 3V6DB 3KLEA 2X6NA 1SV5A 3M9MB 1C0UB 4O3OA 2GBZA 2IM3A 5KFDA 5DLFA 2ATLA 2UVUA 3DLEB 3SQ4A 2J6TA 3HK2A 3O4QA 1RT4B 1BCOA 3TAGA 1C2PA 2D0CA 5CYQB 3KK1B 1D8YA 2JLEA 4FLYA 2HNDB 4N56A 1WAFA 1X9SA 3DMJB 4CEFA 1WNEA 2V9WA 1KVCA 3CVKA 5KFYA 3OLAA 3PO5A 1LW2A 3RR8A 4CHNA 1JXEA 3RAXA 1HRHA 4O4GA 2G8KA 1ZTTA 4MH8A 1RDRA 1IH7A 3QGHA 1RTJA 3OSNA 2XY7A 3C6TB 3VQ9A 4XPCA 3KLHA 3SCXA 4DLEA 3SUNA 4CIFA 1NK9A 1FK9A 3LP0A 2C22A 1QSSA 4PQUB 3S3OA 1KVAA 1QQCA 1QUVA 2RDJA 4ID1A 4FBTA 3JSMA 1JLFB 4NRUA 3RBEA 5FRNA 3VQ8A 4GW6A 3CFOA 1S6PA 4EBCA 2X78A 4I2QB 2IDOA 1CXUA 4R5PA 3SQ1A 2F96A 1NK5A 2DPIA 4F3OA 1G15A 5J2NB 2UUWA 1ASUA 4YR3A 5F8MA 1REVB 1Q9XA 4HHTA 2F8EX 3CWJA 5I3UB 4BDPA 3K5NA 3SQ2A 3NF7A 4LSNA 3O4NA 4LH4A 2XO7A 3VQCA 4DTJA 3BQ2A 3Q8QB 4DQIA 3N6NA 4KI6A 1S48A 4CJ5A 1VRTB 4IKAA 4FW1A 1S0MA 2VA3A 1XHXA 1RDAA 3K58A 3V9SA 2G8HA 3VQEA 1ITGA 1TKDA 5FRMA 3MFIA 2OPPA 4KHYA 4Q45A 4GMJB 1OS5A 3CDEA 3KHLA 2C2DA 3DRRA 1X9MA 2PYJA 1I3AA 1SL1A 5KI6A 1TKXB 2G8UA 3KLIB 2AX1A 1JLEB 3F73A 4B3OB 3OYLA 4DLGA 1RNHA 3AO3A 3ZT0A 5HP1B 4Q0BB 3IRXB 3DM2A 4C8NA 4KHUA 4H54A 1NHVA 1B9FA 2FVPA 1HYVA 1T94A 3K5MA 5JS2A 4FJ8A 1RT1A 4FZZA 4EZ6A 3KMSA 4R8UB 3ITHB 4J9QA 1KSPA 3U3GA 5KGWA 3VQAA 1TL1B 4Z4HA 3TVKA 4ED3A 3AV9A 2IJNA 1EP4A 1WSHA 3OJUA 3I0SA 3D5MA 4NCGA 4ECWA 2O4GA 4OGEA 1VSEA 3KK2B 2OPSB 3AO4A 3DYAB 4ELVA 3QIDA 4FCYA 3NGDA 2WB4A 2EHGA 1C1CB 4O3PA 1J9AA 4OLAA 2R2UA 2XCPA 1BI4A 4L8RB 2ZD1B 4PWDB 2OZMA 4QPXA 3QO9A 3DI6A 2PYLA 1JLBA 2PY5A 5FDLA 2B6AB 3CJ2A 5KG7A 1IKYB 3B6PA 3D45A 5C25A 4EO8A 4DL5A 3L8BA 4RW9B 1RCHA 3RRHA 3UDLA 3VA0A 3OJSA 4B9UA 3RB0A 3E51A 4CESA 5HROB 4OL8A 4UQGA 2BRKA 4ECRA 3SV3A 1RDDA 4AHVA 3CO9A 4OKJA 1NKBA 3TABA 4J9MA 3ISND 2XRIA 2HHSA 2BANB 3C6UA 3K59A 1TKZA 3SZ2A 5C24B 2P5OA 4FJXA 4HUGA 2XWYA 2RF2B 3MR5A 2XI3A 2HMIB 3V6KA 4Z0UA 3QEWA 3PVXA 1TV6B 3NH1A 4EEYA 3SI6A 1LAWA 1KRPA 2XY6A 4DFJA 5KFNA 1Q9YA 2Z1HA 4EZ9A 1NK6A 1N6QB 3RBDA 4Y3CA 2W9BA 3QINA 1DLOA 4KHMA 3PZPA 4CK1A 3KNAA 4O4RA 4Q44A 5C42B 1YTAA 5KFKA 4H4OB 4J2DA 4FS2A 3L2UA 4ED1A 4CF9A 1QAIA 2JEFA 3TAEA 5F9LA 1R0AB 1HPZA 4DTOA 5KRSA 4ZHRB 3LP1A 1S9EA 2FVQA 4J9OA 2IM2A 5JXSA 1YVUA 1EETB 4YR2A 4HVJA 4ZP7A 5KFFA 3V9UA 1IKXA 3NL0A 4M3YA 4CGGA 4ED7A 3OSPA 3T5JA 4EBDA 4QWEA 5DQIA 3OLBA 2A1SA 5J2QA 2X6SA 1DTQA 3BSOA 1UA1A 5KT2A 1ZETA 3CFPA 4AHUA 4M3UA 1S0NA 4NLYA 5EDWA 3PJXA 3OY9A 1ZBLA 1U48A 1YVFA 3WNEA 4PUOA 4O3QA 4DSFA 4KKOB 4ED8A 5KFQA 1BGXT 4KHNA 2D3UA 4K4ZA 4DFMA 4URSA 1SUQA 3NBPA 4O3RA 3HO1A 4OLBA 3G10A 1UWBA 1RTIB 2XGPA 4KI4A 1S9GA 4N76A 1JLAB 3SPZA 1RT6B 4ID5A 3I0RB 3V6HA 1S4FA 2JEGA 4MIAA 4OVLA 4DSIA 2HHQA 4E7JA 1C1BB 4TY8A 1WSIA 3OYGA 4JS4A 4F3TA 4TQRA 4DF4A 4H4MB 3GV7B 4M95A 1B9DA 4RNMA 1JLCA 4Q43A 3AVHA 4CJPA 4QW9A 4FJLA 2W42A 3KJVA 4J2EA 5J1EB 4RU9A 3Q8PB 5KFZA 4KO0B 1RT5B 3ICLA 2FJWA 4DG1A 3KKSA 3NAEA 3P1GA 2BQ3A 4K8ZA 5HRRA 2B5JA 3GILA 1HYZA 4CJFA 4M41A 3MXMA 3U6FA 4CJWA 1D9FA 4LQ9A 4HCCA 1RBRA 4YNQA 3ZSZA 3LP2A 1WLJA 3THVA 1HNVA 1N4LA 3NMAA 3HSTB 3UR0A 1GOCA 4JUZA 1S1WA 4HUEA 4ZVFA 5CYMA 4O0IA 2O4IA 2BQRA 3DLKB 3LANA 2R8KA 1ZBFA 5DG7A 1TAQA 1J54A 4IBNA 3DOLB 2JEJA 4LY7A 3BR9A 3DOKB 4CJRA 3KLGB 4CERA 3SJJA 1UA0A 2VA2A 1S1UB 4EYIB 1T05A 4LSLA 2HHTA 5KG4A 4WZQA 5C5JA 4DSKA 3EZUA 4ELUA 4BE1A 2HWHA 1QS4A 2C2RA 4WXOA 2HB5A 2GUIA 3P5JA 2P1JA 5KT4A 4O3NA 3V6DA 4FJ5A 3NF9A 1SH2A 1U09A 1SKWA 1C0UA 3OYHA 3MF5A 3M8SA 4GVMA 1L3TA 3G86A 4NYFA 2KZZA 3HKWA 1RT4A 2GC8A 2C28A 2R8IA 3KK1A 3AA4A 3AVAA 3CJ4A 3MAQA 4AHSA 2ATQA 4KB1A 4IFVB 1FXXA 1TP7A 4KV8B 3DMJA 3FFIB 3H5YA 2FVSA 1MU2B 3HHKA 3NF6A 4ZTJA 4IRKA 2FVCA 4X2BA 2GIQA 4EP4A 5F9NA 2DFEA 2WHOA 5KFPA 1Z25A 2ILZA 2KW4A 1EXQA 4URGA 3RRGA 4RW8B 3C6TA 4W5TA 4KHQA 2YNGB 3AVKA 2BGGA 3G6XA 2AGOA 3AVGA 3EZ5A 4PQUA 4M94A 3NE6A 3H40A 2F8SA 1HNIB 3HT3A 2RDIA 2I1RA 3HPGA 1KFSA 2UVRA 2IM0A 4YFUA 2KFNA 3SFUA 2R8GA 1JLFA 4FLUA 3G0ZA 5J2MB 2R2TA 4IFYA 3RB4A 5F8HA 3HYFA 5HBMB 4I2QA 3H98A 4CFBA 4FK0A 1HARA 2J6UA 4JLHA 3LAKA 3NF8A 4MFBB 3OHBA 3NAHA 2R7YA 5J2NA 3VQQA 1WSFA 1BQNB 3TAFA 2JC1A 1REVA 4NCBA 3ZSXA 2HHXA 4QWDA 1VSHA 3U3YA 4KREA 2R2RA 4B9LA 5I3UA 4ED6A 4JV2A 3H5UA 2CJQA 1S6QA 4J9RA 3QEPA 3VQ6A 4Q5VA 4QW8A 4CEDA 2QK9A 3OYCA 3ULDA 2W8LA 1VRTA 4E1NA 1LWEA 3PW0A 3UIQA 4OKKA 5F8GA 2WK4A 1KHWA 1JL2A 4WFXA 3VQPA 3LAMA 3IGVA 5HLFB 4CHZA 4KTWA 1VSIA 3I5AA 3MTKA 3HVWA 3GV8B 2FJXA 3KLIA 3Q8SB 2XCAA 1JLEA 4FYDA 4B3OA 4CEBA 4G3IA 4PY5A 1FKPB 3V1RA 1IKWB 5HP1A 3RB3A 4Z4IA 4Q0BA 4YQWA 3MECB 3IRXA 1WSEA 3ZT4A 3SUOA 4Z4EA 5KG1A 1HMVA 4TQSA 1BHLA 1CZ9A 4DS4A 4CJSA 4R8UA 4BWMA 3KIOA 3ITHA 3K5LA 3SV4A 3I8DA 3CM6A 1TL1A 2ITGA 2D41A 4NYZA 3MXIA 5KFGA 3SI8A 3OYMA 3HXMA 3HPHA 2FBTA 3KK2A 2FBYA 4ECXA 1JL1A 2OPSA 1X9WA 3DYAA 5SZTA 4W5NA 2FBVA 2BE2B 1C1CA 4ECYA 3SUPA 3ZT1A 2AJQA 3DLBA 3DRPB 3L2QA 3HJFA 4ED0A 3TR8A 4YMEA 4M3ZA 3V1OA 2ZD1A 5DQGA 3M8PB 4CJKA 4PWDA 5KFSA 4JRQA 2W7OA 3BSNA 3L3UA 4CF8A 4NLPA 4FLZA 4WE1B 1L3SA 1NK0A 2Z1IA 2B6AA 4C8KA 1N48A 3IGNA 1NOZA 3H4DA 1IKYA 1RA7A 4FJ7A 5DMRA 4URQU 4RW4B 4DL7A 4CK2A 4F4ZA 1TVRB 4CHPA 4RW9A 1VSJA 2AWZA 4FJ9A 1W25A 3V4IB 4E7IA 1NKCA 3QEIA 4ECQA 3IN5A 4F2RA 4O3SA 5HROA 1RBUA 1CSJA 4FBUA 3S3NA 2XC9A 3OL7A 4DL2A 1LV5A 2BDPA 1S1VB 1KHVA 3NGZA 5I42B 5L1JA 2BANA 4FM1A 1LWCB 4E19A 1RT3B 3AVJA 4IR9A 2OPRB 3NAIA 3GIJA 4CJLA 5C24A 3SYZA 2WCXA 5HRPA 1NK7A 2RF2A 3OYIA 2IAJA 1TL3B 2HMIA 4O55A 4FJGA 1TV6A 4KHRA 4CIEA 1EKEA 1IM4A 1B92A 4FK2A 4FM0A 3QIOA 5D3GB 1FKOB 3T5LA 3KLFB 3JSMB 3H5XA 1EX4A 4J9NA 1N6QA 4N47A 4WYLA 1TKTB 4CFDA 3QLHB 4OGCA 1DTTB 3PW4A 4MK7A 4C8OA 4CGDA 1KFDA 2W8KA 4ZMMA 2OA8A 1VSLA 5C42A 3I5CA 2B43A 2ASJA 1IG9A 1RT7B 2G8FA 4H4OA 4CCHA 2IJFA 4K50A 3QIPB 2FJVA 1CZBA 1JX4A 4B8AB 5KFVA 1RT2B 1R0AA 3FRZA 4RNHA 3M8RA 1Q8IA 3NDKA 5KG0A 4DU4A 4R0EA 1KLNA 2VG6B 4TSXA 4ZHRA 3MEGB 3SFGA 3DRSB 4DSLA 2ILYA 3EY1A 3V6JA 3KK3A 4KTZA 1EETA 3LP3A 2WOMB 4IRCA 3PJWA 3MXJA 2D5RA 5CZ2A 1TAUA 4CJ3A 3V81A 2B4JA 1RTDB 3FQKA 2V4QA 3OYNA 1TK0A 3PW2A 4F2SA 3HL8A 4IG0B 3PR5B 4ELTA 4HCBA 4KAIA 2XGQA 5JUMA 4CGFA 4IDKB 3Q8RB 4TN2A 1HQEB 4JS5A 2XY8A 1I39A 4GC7A 4KKOA 4HUFA 2O5DA 1ASVA 3GIMA 4DTXA 3BREA 3E01B 5FROA 4CEAA 5KFEA 2YV0X 3ZT3A 1BQMB 2V4RA 1BISA 4I2PB 4IH6A 3KTQA 1SKRA 2ASLA 2W9CB 1JLAA 1RT6A 3I0RA 1LW0B 3MR3A 2IOCA 3NCIA 4DFKA 3OYDA 1SL0A 1C1BA 4CF0A 4TLRA 1A5XA 2VWJA 4H4MA 4ZPBA 3FQLA 5KFWA 3MEEB 3V1QA 2VG5B 4FVMA 4NLSA 4EBEA 3DLRA 3H4BA 4F4XA 3VQBA 2Z1GA 1GX6A 4DF8A 3O3GA 1NJWA 2IC3B 3AVFA 4NLUA 5J1EA 4BWJA 4KO0A 1RT5A 4ZPAA 4M3XA 4I7FB 4ZTFA 4HKQA 5KFRA 5T7BA 4RUAA 3KD1E 4EP5A 4E7LA 1S1XB 3FSIA 3M8QB 3AO2A 3TAQA 3VQ5A 4O5BA 4M3TA 1XR7A 3RWUA 1QAJA 3OYKA 4E7KA 4QWAA 3AVBA 3LZIA 3DLKA 3T5KA 3L3VA 1C0TB 3C6UB 1D9DA 2YNIB 4AHTA 3TANA 4IOBA 4FJMA 3DOLA 3DOKA 3MEDB 1JKHB 3KLGA 2HWIA 4WZMA 1RBVA 3LALA 5K14B 3AVLA 2OZSA 1S1UA 3BGRB 3PW7A 5EUHA 3VQ7A 2ZE2B 4TYAA 2Q3SA 1JIHA 1RYSA 4O0JA 3CJ5A 2W7PA 5KFLA 4ZVGA 3RMDA 4K4WA 3IG1B 3LWMA 1RYRA 2DPJA 4B9TA 2XHBA 3I5BA 5HRSA 3EYZA 5DGAA 3PY8A 3TARA 5F8NA 4J2AA 3HP9A 2D7SA 1KLMB 1T8EA 4BDZA 4I9QA 2DFHA 2HNZB 2G8VA 3MR2A 5KT3A 2XI2A 4JV0A 2YKMB 3T5HA 2ZKUA 4IFVA 4RG8A 4RW6A 3VQDA 3ZSOA 4KV8A 3MFHA 1T3NA 4ECVA 3AO5A 3FFIA 1MU2A 1NKEA 2HNYB 4ICLB 1HQUB 4J9PA 2YNFB 3IS9B 5F8LA 1VSKA 3PHEA 1S9FA 4PA1A 3G6VA 3OHAA 5SWMA 5KT7A 2RN2A 3UQSA 1S10A 3B6OA 1QE1B 1S0OA 4Z4CA 4RW8A 2RPIA 2YNGA 3LZJA 3NH0A 4Q8EA 1IKVB 3TQ1A 1HNIA 4FS1A 3PX4A 5DK5A 3ZSQA 2CKWA 4KHSA 4E3SA 4Y34A 1TK5A 5KFCA 1W9HA 4B9SA 2ZQBA 3DLGB 5J2MA 2WONB 5KG6A 4F8RA 5HBMA 4QWBA 2R8JA 3JYTB 4NLRA 3OYAA 2HHWA 3BSCA 3BQ0A 1C1AA 4MFBA 4DTPA 1N5YB 3KMQA 3M9NB 5EU7A 1BQNA 2F8TA 4C8MA 1L3UA 3TAPA 3DLEA 4CF1A 2I5JB 4NLOA 3GV5B 4IH5A 4W5OA 1KVBA 1LWFB 5CYQA 3LWLA 2HNDA 4G1QB 4IR1A 2FC0A 4NCAA 5DQHA 5KFOA 4FLTA 2W9AA 2QKBA 4TY9A 3OYFA 3WNFA 1N56A 1J5OB 2OPQB 4Z4GA 3PR4A 5L1LA 5HLFA 4ZP6A 3L2WA 3BDPA 3L2RA 2AX0A 3BSAA 4XIUA 4NLWA 3A2FA 4HYKA 4ZVEA 3P83D 4GC6A 2YHAA 1RDCA 1BCMA 1FKPA 1IKWA 1VRUB 3N6LA 4AHRA 3MECA 3EPIA 4M3WA 4N5SA 4CGIA 4NYNA 3QESA 1XR6A 4FXDA 5KTQA 3OYEA 1WSGA 1L3VA 4ZVHA 3S3MA 1T7PA 1BIUA 2XY5A 2AU0A 5J2PB 1CXQA 4O44B 4EYHB 2IBKA 2G8IA 1JLQB 2VWKA 2IGIA 1J53A 4CEEA 1QTMA 2YNHB 1S49A 2BE2A 1T03B 4KB0A 4LD0A 3DRPA 3V9WA 5KFAA 3M8PA 3PW5A 1WSJA 4B9NA 4M42A 2Y1JA 3RMAA 4K8XA 4WE1A 4CFCA 2AGQA 4FJIA 3O3FA 2RKIB 2FLPA 4RW4A 4CJTA 3OS1A 1TVRA 4OKEA 2IS3A 4FJKA 1MMLA 1JLGB 3V4IA 4J9LA 1TKXA 1NK4A 4E7HA 1HYSB 2KZMA 3KHGA 1S1VA 3D28A 1SL2A 5I42A 3HVRA 4NLDA 1YT3A 3AVCA 1QSLA 1LWCA 1RT3A 3CQ8A 4KFBB 4DTUA 3C95A 4Q8FA 3ZCMA 1S1TB 2OPRA 4ED2A 1UAXA 2P51A 3TAMB 2UVWA 4FZXC 4DQQA 3HVTB 1CLQA 3KKRA 1TL3A 4DMNA 3OS2A 4F4WA 4DS5A 3WNGA 1XC9A 3QZ7A 4Y1DA 4RNFA 4F50A 1Y97A 1RTHB 4Y1CA 2HHVA 4DSEA 5D3GA 1FKOA 4IG3B 5DG9A 3KLFA 2BRLA 1D5AA 4RW7B 4DU1A 2V0NA 4Y2CA 4CIGA 4IFYB 1TKTA 4Z4FA 1F21A 1WNSA 3QLHA 1DTTA 4J9SA 2D0BA 3KD5E 2VG7B 3T19A 4K4VA 3PO4A 3V9ZA 4CK3A 3SNNA 3AA3A 3CIZA 2YKNB 1D0EA 3HVAA 2IMWP 3KLEB 5KFMA 4DU3A 1SV5B 3EPGA 3ISNC 4ECSA 2BQUA 1RT7A 1S5JA 3PV8A 4KPYA 5KFUA 1NJXA 3QIPA 4DSJA 5DGBA 4MK9A 3H59A 4DL4A 1RT2A 4NZ0A 4DQSA 3NHGA 1S6QB 3QEXA 3KHHA 4KAZA 2VG6A 3MEGA 3VN5A 2Y1IA 3DRSA 4NRTA 2P5GA 1LW2B 2WOMA 1LWEB 4MIBA 3H08A 5KRTA 1BIZA 1ZYQA 3D0PA 1RTDA 4FLWA 5L1IA 1QSYA 4O4GB 3CFRA 5KT6A 1XI1A 3QNNA 3QGIA 4IG0A 2E9TA 4WYWA 1RTJB 1Z26A 1WAJA 3C94A 5KGXA 3GQCA 4DTNA 4IDKA 2R2SA 3KLHB 1JXLA 2JC0A 3K5OA 1FK9B 3LP0B 1HQEA 1SH0A 2QXFA 1GOAA 3HM9A 1HMVB 3CJ3A 1U45A 3QGGA 3N6MA 2GV9A 4QWCA 3UPFA 4KE5A 3E01A 1U4BA 1K1SA 3GIKA 2JEIA 4XO0A 4K4XA 1BQMA 4I2PA 4DFPA 2HVHA 1S6PB 5CZ1A 2W9CA 4RUCA 4XPEA 4R5PB 2OH2A 1LW0A 4K4TA 2E9ZA 3KLVA 3F9KA 2UUTA 4W5RA 4QOZB 1W0HA 3MEEA 4OPJA 4DQRA 2VG5A 4B9MA 4B9VA 5L9XA 2IM1A 2GIRA 3OL6A 4LSNB 5CY4A 2IC3A 1C6VA 1RBSA 2D0AA 5F8IA 4I7FA 1NOYA 3RAQA 3SUQA 2OPPB 3TWHA 4BE0A 3CJ0A 1LAVA 3CM5A 1YTUA 1I6JA 2FBXA 2E4LA 4QAGA 4K4UA 1BL3A 1ZBUA 1GOBA 2FLLA 1S1XA 3DRRB 4BACA 4U6PA 3M8QA 5DLGA 1VK0A 1VSDA 4M3RA 3ZSVA 3G6YA 2R8HA 4MKAA 3ASMA 3GYNA 4BDYA 3L2VA 3QEVA 3GIIA 3QNOA 4AILC 3DM2B 4FJHA 3NFAA 3OL8A 4NLVA 2YHBA 4BE2A 4B8CA 1C0TA 1RT1B 4J2BA 4EO6A 2YNIA 4OJRA 3ZSWA 5KFXA 3MEDA 1JKHA 1SKSA 1RTIA 2IAJB 5EWFA 5K14A 2HVIA 1EP4B 3BGRA 4YP3A 4DQPA 3I0SB 2ZE2A 4NCGB 3SQ0A 1TQLA 2Z1JA 3TI0A 4LQ3A 4N41A 1IO2A 3IG1A 3VQSA 1XHZA 1JXBA 4QCLA 2D3ZA 1BI4B 1ASWA 1KTQA 3T3FA 1KLMA 5T14A 1TGOA 1U04A 1O1WA 3PX6A 2KFZA 3QO9B 2OYQA 2HNZA 4K4SA 3DI6B 2PZSA 3AVNA 1JLBB 5FDLB 4FLVA 2YKMA 4AH9A 3NH2A 4JRPA 3DDKA 1U47A 5C25B 2HNYA 4ICLA 4TYBA 1HQUA 4K4YA 4E0DA 2YNFA 3IS9A 2IA6A 3KK3B 4MKBA 1WN7A 1S97A 4NLXA 4RZRA 4CEZA 3V81B 3AA5X 4F4YA 5E41A 3AO1A 1QE1A 1K1QA 4ZP8A 2G8WA 5JS1A 1NHUA 1TK8A 4J9KA 4CEOA 2HHUA 1TKZB 3IAYA 5EWGA 5KG5A 2QV6A 1RA6A 1IKVA 4CHYA 3QETA 1NNDA 4Y2AA 5KG3A 4OPKA 4NLTA 4LH5A 3DLGA 2UVVA 4WXWA 2WONA 4IH7A 3RMCA 1NK8A 5KT5A 4ECZA 3JYTA 2DFFA 4KRFA 4DTSA 4JV1A 5KFIA 1N5YA 2W9BB 2A1RA 1Z4UA 4ZPCA 3OL9A 4CJUA 3K2PA 1DLOB 3QYYA 1C0MA 4WFYA 1K6YA 4RNOA 2I5JA 4U7CA 2X74A 3ZSRA 1QHTA 4CF2A 4CFAA 1LWFA 2FLNA 4E1MA 4G1QA 1RAJA 4I9LA 3RTVA 1HPZB 3AVMA 2AQ4A 3BQ1A 4TXSA 3LP1B 1J5OA 4ECTA 3LDSA 1S9EB 2OPQA 2QKKA 4H8KA 3ZSYA 1A5WA 3PUFA 1IKXB 3AA2A 2J6SA 4DTMA 2HW3A 4B08A 5HRNA 1XWLA 4DL3A 4AHCA 3QERA 4KB7A 4FZYA 1VRUA 1HJRA 3LPUA 4CGJA 2KQ2A 5J2QB 3KOAA 1DTQB 4ECUA 4CE9A 2E9RX 4CJEA 3S9HA 1NJYA 3CDWA 3MR6A 4FLXA 2C2EA 1RILA 4MK8A 3CDUA 3WNHA 2ASDA 4PUOB 5KFHA 3OYBA 3NGIA 5KFBA 2BR0A 3LPTA 4DWIA 5KG2A 2E6LA 3OYJA 1SUQB 3NBPB 3OS0A 4CECA 5KFJA 4DTRA 2WTFA 5J2PA 3HPOA 1UWBB 4CJVA 1S9GB 4O44A 1JLQA 4WFZA 4ID5B 1SH3A 2YNHA 1U49A 1ZTWA 1KCFA 4FW2A 2KTQA 1T03A 2EX3A 3K57A 3V9XA 4TY8B 4FJJA 3SPYA 2LSNA 3RMBA 4DEZA 4E89A 4YR0A 3CYMA 1JLCB 3OVNA 4CHQA 2FVRA 5EWEA 4CJQA 2QE5A 4W5QA 1L5UA 3NKYA 4MQ3A 2ALZA 3KJVB 2RKIA 4CEQA 2JGUA 2NUBA 3H2LA 3ZT2A 2DY4A 4IRDA 1NJZA 4DG1B 3BJYA 1JLGA 4KTQA 4RW6B 5F8JA 1D1UA 2B5JB 3H5SA 1A5VA 4CHOA 4KHWA 5DG8A 4IQXA 3RB6A 4F4KA 1XR5A 1HYSA 3FDSA 3DLHA 1UOCA 3LP2B 3PX0A 2EC0A 4DL6A 1HNVB 3NGYA 1S1WB 2ETJA 5CYMB 4KFBA 4ZPDA 3QZ8A 1S1TA 1GX5A 3TAMA 1X1PA 3AVIA 3VA3A 2HAIA 3VQ4A 4HTUA 3ALYA 3HVTA 4M45A 1ZBIA 4CJ4A 4NLQA 4RNNA 2DTUA 5L1KA 4C8LA 3O3HA
chains in the Genus database with same CATH superfamily
1Q79A 4IG3A 2MQPA 4RW7A 4E8UA 2Z2LA 3P5TL 3T1AA 4PEOA 1NPRA 1ZBHA 4KSEB 4KBIA 3V6DB 5AQVA 1SI9A 2X51A 4QIVA 1NU0A 3M05A 4YY3J 2UVUA 3TTDA 2COLA 2J6TA 3O4QA 1RT4B 3TR5A 3BBCA 3O3LA 4CIOA 1D8YA 1P9QC 3TWZA 1WAFA 1X9SA 1UFLA 4CEFA 1SQGA 2RHQB 1Z1ZA 1OQ3A 3CF5Q 5MAOA 1JXEA 3FCHA 3RAXA 4A57A 4R0JA 1HA1A 4NXNF 2V68A 4DMZA 2G8KA 4B3RK 1PJ5A 5L46A 1RDRA 2QWLA 2HHHK 1NLVA 3BZQA 2MKYA 3I55N 1TR0A 3T9NA 1WB9A 2XO6A 1H0HB 2RDJA 1Q8KA 2FXUA 4NRUA 3J7A1 1ZM4A 4BRHA 8ATCB 2I7PA 3ETOA 3GG0A 1R89A 2DYAA 3SQ1A 3VGLA 5ETKA 4F25A 1QZ5A 4AQYK 1FWPA 1ASUA 2DTJA 2F8EX 5LXYA 3BR8A 5I3UB 1CC7A 2AJ0A 2YKPA 3BKUA 1IV0A 1GAOA 3AXKA 5AXKA 3WQPA 2ZH4A 4X66J 4GKKK 2I6WA 1NZAA 4BRQA 2GA7A 3OTOF 4KI6A 3G82B 4CJ5A 4IKAA 5AZIA 4FW1A 1RAHB 1F9HA 3V9SA 3W62A 1SJ1A 4MMOA 2NPFA 1RABB 2HS3A 3GCXP 4WTOB 4LFAJ 1TL4A 3HHLA 3KHLA 2KDOA 2PYJA 3ZX2A 2IIHA 2B7CB 1RB0A 2AX1A 1JLEB 3F73A 3OYLA 3AH6A 1G3OA 4Q0BB 3IRXB 3DM2A 4KHUA 4H54A 2V2KA 1VBZA 4ES1A 5JS2A 2MY8A 1ATNA 3MUVP 4EZ6A 2VASA 3ULEB 3NNHA 2UUAK 3Q23A 5KGWA 2P9LB 3LPYA 1RAOA 1RAGB 2XLJA 3KK2B 2OPSB 3R2CJ 4FCYA 4BRNA 2EHGA 4O3PA 2MZQA 1LOUA 4OLAA 1VC6A 1BI4A 3I55S 2ZD1B 5BN9A 2OZMA 1HNXK 3WXJA 2KHDA 2XS5A 2FF6A 2CDQA 1HBMA 4GV3A 5A8WA 2G4BA 4ILJA 1JLBA 2PY5A 1UFKA 5KG7A 3MM9A 2E5LJ 1IKYB 5AQWA 2DY9A 2GV1A 5C25A 4EO8A 2ATCB 3L8BA 4RW9B 2QL9B 4YEAA 4FOIA 3UD4P 1WEZA 3F5TA 3O5BA 2BRKA 3IWNC 3VEYA 3Q2TC 3DU6A 1BG3A 2ZUGA 4J9MA 2XRIA 1NH8A 1E6YB 2GUPA 1TKZA 3V2UC 2F3JA 3SZ2A 3UDVA 1TUGB 5AQHA 5C24B 3W9HA 4G1IA 3MR5A 2XI3A 2F9TA 2DRDA 2PT0A 3H3OB 2LKZA 3PVXA 3QEWA 2P9IA 2CVIA 2Z1HA 2VU5A 4EZ9A 4Y3CA 1VBXA 2CWKA 2Q1LA 1BUPA 3I9ZA 4B1XB 1JNRB 1DLOA 1EWQA 3HULA 4C0HA 1U1OA 4RCHA 3UKRB 2XSJB 4Q44A 3VAFA 2EK6A 5C42B 1YTAA 1TL7B 2GFFA 1NSPA 5KFKA 1S76D 3OVAA 2CA9A 1G1XA 3CJ7A 1NGFA 3L2UA 5C2DA 4ED1A 1WWHA 2UP1A 3RBXA 1UFWA 3NS5A 2DBBA 3FBFA 1HPZA 2V7YA 1YJRA 2DGOA 4RKUC 1MWMA 1BDGA 2QYCA 3GSDA 1YVUA 1HI8A 2GO9A 4KGZB 2FY8A 1ZXOA 4M3YA 4CGGA 1NAQA 3NMUA 2CH5A 2AZ3A 3T5JA 3TNVA 3U7JA 2LEPA 3TEGA 4OHZA 3CD7A 5GAGP 4FXVA 5J2QA 3OY9A 3PJXA 3MD1A 1U48A 3NXZA 1YVFA 4Y0WA 3OV7A 4P7VA 3MPDA 1UW9A 2FC9A 4GKJJ 2D3UA 4MIWA 4URSA 2B4PA 4O3RA 2D0OA 3NY0A 3HO1A 2CQ0A 2DNPA 1S79A 2CIMA 3J81Y 3NP5A 4PHTX 1RAFB 4NYPA 4KI4A 4BR7A 1JLAB 1RT6B 4ID5A 1X0FA 1S4FA 2CPJA 3IFEA 4OVLA 2HHQA 5AQNA 1NSKL 3N4QA 4E7JA 4CT8A 4TY8A 5F3ZA 4F3TA 3PSFA 4CDIA 3GV7B 3CJ1A 1MWZA 1VJWA 4J91A 3N4WA 3J81U 3D6MB 1JCFA 2PMWA 2FYXA 1RACB 1M5SA 5ITHA 2W42A 4BY9C 1BXNA 1UVJA 4RU9A 5KFZA 2E66A 1Q8BA 3JSBA 1RT5B 3QRPA 4USMA 2NYIA 4X4UA 2Q36A 3MM7A 2ASYA 4A5BA 4CJ7A 2DR7A 3GILA 1G99A 4CJFA 3MXMA 4F0KA 3U6FA 4I6YA 2WTUA 4HCCA 3KKFA 3MN7A 4YNQA 3LP2A 4F3QA 3JQJA 3UD5A 3C0BA 2NRRA 4A8YA 1HNVA 3NMAA 1JNZB 4DR6F 1RSCA 2F63A 2GAHC 4JUZA 3O80A 1S1WA 3P39A 4O0IA 4FWPA 2DHSA 2CPIA 3HD1A 2H51B 3LANA 1BQXA 2BZ2A 1U2FA 1N54B 5DG7A 4NXMF 4IBNA 4WKRA 3BR9A 3ATVA 5CCLA 1NDCA 3DOKB 1N32K 2EK1A 4K0KK 4CERA 4CRJA 3R1HA 1VQNN 3NRBA 3BF1A 4S0MA 5K8PA 4LUBA 2ZDPA 3GSIA 2B4VA 3O8WA 4WZQA 4FF1A 4DSKA 1MMDA 4ELUA 2C3OA 2GTDA 4DPTA 3NWGA 2HRTA 2GUIA 2P1JA 4O3NA 1GT8A 3V6DA 2A40A 4WU3A 2X1FA 9RUBA 3O9SA 3OYHA 4GO5X 2IY5B 5E0OA 3EVWA 3NWRA 4OLOA 3HKWA 1RT4A 5C0YA 3D2EB 2GC8A 4B3RJ 4H5RA 3MAQA 4ZCLA 4KB1A 4IFVB 2HHHJ 3NOCA 4L74A 2F4VF 2P9PB 4DV4J 3EGWB 3TVYA 1WG1A 4DUYF 1T6CA 2FVSA 1MU2B 5CE3A 3HHKA 3DAWA 3KUGA 4CLZA 2GX8A 1XNQF 2DFEA 4PKGA 1VIXA 4RBVA 5CR4A 3K9KA 5AJ3F 4F0MA 1EXQA 1LCUA 3RRGA 1FT8A 1N33F 2PA3A 4KGXB 1RWKB 4GVLA 2UU9F 1U8SA 3GFZA 4M94A 5GMDA 1M5VC 2F8SA 3HT3A 2RDIA 1NGBA 2I1RA 3HPGA 1KFSA 2KHOA 3MX2A 3O5TB 5BRDA 4AQYJ 2UVRA 2LXIA 3SFUA 2R8GA 3M8ZA 4JKGB 2R2TA 4C8ZA 3NGKA 2ZWOA 5IM0B 5FPMA 5E7OB 2OEMA 5HBMB 3H98A 4GKKJ 1YITN 5CH7B 4PXEA 3HZEA 2F8HA 5FPDA 2BMBA 2JL9A 4LFBJ 3K0JA 3VQQA 1BQNB 4U67Q 3IMQJ 1RGIA 4EHTA 3ZSXA 4M7XA 2HHXA 4KREA 5I3UA 4LVNP 3WZ0A 2MZRA 1P27B 4CNZA 3KG0A 1S6QA 4J9RA 1RAAB 4O23A 1PC5A 2HGNA 3GG1A 2DNRA 2W8LA 3G82A 3UIQA 3M1VB 3PW0A 5F8GA 1Q7YT 4JI7F 1VQNS 4A8OA 4ZCKA 1ROFA 2DIUA 4CZIA 4M5DB 3GV8B 3ZZPA 3Q0AA 3M6XA 2VBWA 1KP6A 1JLEA 4G3IA 2J9DE 1FKPB 3RB3A 2OSQA 3QT7A 4Z4IA 4Q0BA 3NLCA 3MECB 3IRXA 4FF2A 2N4DA 1UAWA 1LK5A 1RWWB 1IBMJ 2AA4A 2CJ9A 5G0RB 3N28A 4BWMA 3H1QA 3KIOA 1QVGM 3ULEA 3K5LA 3I8DA 5IV4A 2P9LA 4HH0A 5DM7Q 1CBKA 4M5LA 3QFUA 1KQSM 3SI8A 1HNXJ 3RSEB 3OTOK 2IRYA 1S7IA 3HPHA 2FBTA 1NGEA 3KK2A 4ECXA 3MN6A 2OPSA 3B78A 4OI6A 5SZTA 2IYIA 1WC0A 3ZT1A 3GZ7A 3HJFA 3OFEA 3D66A 2ZD1A 1RP5A 2CGKA 1KOOA 2IVPA 2W7OA 3G96A 4X64J 1L3SA 4WE1B 1WF0A 3MPVA 3M5RA 4JI1F 4Q2LA 1NOZA 3H4DA 1IKYA 2M70A 1RA7A 1PILA 4URQU 2BJ8A 4CK2A 2QZ8A 4RW9A 2AWZA 3D6RA 4E7IA 3QEIA 4FPAA 4O3SA 1RBUA 1T3OA 4FBUA 4C3MA 2WAQD 3H25A 3S3NA 1U1LA 1YITS 1TELA 3WIVA 3TVZA 2Z8QA 1QZ6A 3NGZA 5I42B 4CM2A 3J8AA 4ZA1A 4AL7A 2QL5B 3KNGA 5L1JA 3B54A 3T6BA 2J0WA 1E6YA 3IR6B 4PL7A 2OPRB 2C2ZB 4DR1K 4JYAF 3NAIA 3GIJA 5C24A 2CG8A 3SYZA 1NK7A 4OPHA 2HBJA 2FDNA 2ZH5A 4FJGA 1TTHB 1YGYA 1B92A 4FM0A 3QIOA 1IJFB 4QBUA 2E7XA 3JSMB 2A18A 4AM6A 1V4TA 4J9NA 3QNWB 1ZOTA 4WYLA 4OGCA 3PW4A 3FEZA 2RRBA 3SCLE 4C8OA 3T69A 4EHUA 3H7HB 3UKRA 2XSJA 1VSLA 5C42A 3P31A 3I5CA 2B43A 1TL7A 2ASJA 1PCAA 3CD5A 3D3CJ 2MMYA 2HBLA 3HJVA 4K50A 1SJ3P 1YRXA 5KFVA 1RT2B 2KYZA 5KG0A 4DU4A 1GEHA 3MEGB 2ILYA 3ZZZA 4QIEA 4W4MA 3EY1A 1HKAA 4OZ3A 3V6JA 4KTZA 3LP3A 2O8BB 2JVOA 3MXJA 4QR0A 2NZCA 5RUBA 1ZA2B 3V81A 1X60A 1RTDB 2CGLA 1RHMB 4U96A 4ZN1A 5IWAF 3E2EA 1EZZB 1TK0A 1YQHA 5JUMA 3LM2A 4HL9A 1U6FA 4EMDA 4IDKB 2FZGB 3F56A 3N0VA 3L6QA 4TN2A 4C0BA 3OFHA 4JS5A 1X5PA 4HWIA 1M5KC 2LQ9A 5B7WA 1OJ4A 2ROEA 5KAKA 2MPUA 3A13A 3OTEA 4LF8F 4Z7YA 3E01B 3BREA 5FROA 5KFEA 3ZT3A 1J5EF 1WEXA 3W8PA 4OYBA 3M2RB 1BQMB 4AD6A 4Q7AA 4IH6A 1JLAA 1RT6A 4USVA 2JLFA 2QEXN 1LW0B 3MR3A 1X4EA 2DH7A 4EGLA 2CQGA 2QWMA 2VWJA 1C0FA 4BRLA 3LM9A 4ZPBA 2FC8A 4WQ5C 4FVMA 4PG7A 2CNNB 4NLSA 3H4BA 1TUYA 3VQBA 2Z1GA 2DITA 1HW8A 1VC5A 5AQTA 2OFGX 2HFSA 1RT5A 2KRRA 2WSFC 1U2VB 4ZPAA 4M3XA 4DPYA 4AT1B 2N7YA 3CCTA 1BLUA 3TAQA 3VQ5A 1J27A 4LBIA 4K5RA 1V3RA 2RE1A 1N32J 4K0KJ 3NG8A 1UMJA 4E7KA 4QWAA 3L9ZA 4CBWA 2BKPA 3L4IA 1C0TB 3C6UB 3EGNA 4DPXA 4BR4A 1HWJA 4M8LA 3JQMA 1N8RT 4IOBA 3V5RA 2HMPA 3OPKA 3DOKA 4TNOA 2HPUA 4WZMA 1BD6A 3US5A 1RBVA 4B3MF 2QJ3A 2OZSA 3PW7A 1CQMA 1NGAA 1NGCA 1GNKA 1N88A 2JRSA 2HBKA 5KFLA 2A3JA 4ZVGA 3IG1B 4YDUA 1IJJA 1RHKB 2DGVA 3N79A 3HFZB 2YI1A 4CZGA 1MW7A 4DR4F 2XTJP 2WB1D 1AROP 1WTFA 2HNZB 2FZKB 2F9JA 3D2EA 3CCLN 4ETXA 2XI2A 3HSZA 4AXJA 1CVJA 4IFVA 2FGOA 2P9PA 3VQDA 5DM6Q 3NS7B 2BW2A 1MU2A 3C65A 2C2OB 4J9PA 1Q8LA 2ZH8A 3PHEA 3ENQA 3JS9A 3OHAA 2QEXS 1I94F 3UQSA 4CH1A 2BTFA 2EBEA 4P7TA 4CBUA 1NPPA 2J9EA 4Z4CA 5M2UA 3PFOA 1Y0HA 5F2RA 4DQ8A 4Q8EA 4QYZK 2Q6BA 2VBYA 1NHKL 2YQ3A 2YHWA 3ZSQA 2CQ1A 4B9SA 3DLGB 4XAKA 4AL6A 4UZCA 4JKGA 1SQFA 3VF6A 1RAIB 4F8RA 5IM0A 2V7ZA 3LL3A 3UDCA 5HBMA 3D1HA 2F4VK 1JK9B 4K25A 3MUTP 3BSCA 4ZKAA 3AJ1A 3LH2S 4Y0FA 2HBZB 4A4JA 1BQNA 4C8MA 3DLEA 3JAMO 3L09A 1ICEB 4NLOA 2W41A 2RHKA 4IH5A 5DJBA 1NBEB 1O13A 4OHXA 5GADU 1FXRA 2DHHA 1Y7PA 3ZYYX 2VGNA 4PR6A 2Q6CA 3M1VA 4TY9A 3WNFA 1S6UA 1J5OB 4WBFA 1LEOA 4Z4GA 4AYBD 1U0HB 1CQNA 3BZCA 3CDAA 1NH7A 1BOTO 3ET6B 3P83D 4M5DA 4YOVA 1PBUA 1KN6A 3EVOA 3IFRA 1FKPA 4BC3A 2DISA 3TJAA 3CMQA 3KVGA 3MECA 3OTOJ 2NRHA 3H20A 4ZK7M 4C3KA 4LF9K 1X7VA 2VUGA 1XR6A 5G0RA 3CCLS 3I33A 1RQ0A 1L3VA 1FA0A 3S3MA 4A48A 3L95X 2QTDA 3NGSA 4ZPWR 1WSRA 4CLLA 2ZZMA 1PYOB 3RSEA 1R0BG 3PRVA 2L3MA 2G8IA 3NGTA 4JI7K 1QTMA 1S49A 2VDHA 4CP5A 3S6EA 3TP2A 2V9KA 1WSJA 1OY6A 4WE1A 1NBWA 7AT1B 2BH1A 5JJBA 4LF5F 3O3FA 2RKIB 5HVFA 1JCGA 2DXFA 2VCPA 4J9LA 2CYYA 5AQQA 1TKXA 4ETZA 2MEWA 5GIPA 1KKHA 1BY9A 3FMBA 1R6YA 3P45B 3AXMA 4OYZA 1SJ4P 3D28A 1SL2A 5I42A 1ZZNA 4ZVRB 5HJYA 3HVRA 2RU9A 1X5SA 4RPFA 2F7VA 3FSXA 1CULB 3CQ8A 4KFBB 3OVSA 1T9VA 5EHHA 2OPRA 2GX9A 3TAMB 2UVWA 2YWEA 4U67L 3HVTB 1CLQA 1FRXA 1VBKA 3Q86A 1D09B 2YH1A 3OS2A 1B3TA 1XC9A 3D7SB 3QZ7A 5M1NA 1N34F 2HHVA 4PABA 4RX6A 2V0NA 3CPWM 4Y2CA 3BBBA 3NMRA 2E5IA 1WNSA 5THWA 2KVIA 1QY7A 1SC3B 4K4VA 3T19A 2MJNA 1AUSL 3GR0A 1CJUB 3CIZA 2RUGA 2IMWP 5E2QA 1SV5B 4DV5K 2Z2YB 3EPGA 1S5JA 4HT5A 3MK6A 1U6ZA 5GADP 4MK9A 2P5VA 4WP9A 1RT2A 4DQSA 3DXMB 3NHGA 1CC8A 2HVEA 3WBZA 4A59A 1EJ7L 3MEGA 4JYAK 3DHXA 2ZBIA 4HTLA 1LW2B 2O8BA 1LWEB 4BHQA 4DV6K 4USTA 1ZYQA 1QVFM 1RTDA 4FLWA 5L1IA 3AOCA 3MN5A 2HHPA 3JTPA 1RU1A 4ZOSA 1Z26A 4U9RA 1NZ8A 1FJGF 4IDKA 3D67A 4JI3F 3QMQA 3KLHB 3K5OA 1X5TA 3Q8UA 5JVHL 2HQGA 3IUCA 3C7NB 5D15A 3HM9A 1HMVB 5CHCB 2CVEA 3UPFA 3E01A 1U4BA 1K1SA 1O6XA 3GE9A 4XO0A 3M2RA 1BQMA 2KYXA 3R5DA 4YORA 1SVDA 5DRKA 1LW0A 3MMVA 2KJWA 3O9RA 2UUTA 4M5JA 3J7YI 1WKLA 2HS0A 4DQRA 4H0VB 4PYDA 1GMUA 3VF0B 4DX7A 1DY3A 1S57A 2J76E 2IM1A 2MLYA 3UVJB 1C6VA 2AEJA 2OCEA 2CUYA 2R7OA 1RFQA 3TWHA 3CJ0A 3CM5A 1I6JA 2FBXA 2GJIA 2QG9B 2KO1A 4QAGA 1BL3A 1ZBUA 1GOBA 3R7NB 4BACA 3O6WA 5DLGA 1NO8A 1VK0A 2KLAA 4BG8A 4FWOA 3ZSVA 5L39A 2AJ4A 2R8HA 4USWA 4MKAA 1VR6A 3QNOA 2ZZTA 3FRYA 5A6WA 4UZBA 2BOPA 3OL8A 4NLVA 3RBZA 4B8CA 2ZH6A 1C0TA 2Y8WA 4MO5A 2CRLA 2JVRA 1KVJA 1OVQA 1JMTA 4IO9L 3ZSWA 3OW2M 5KFXA 5LMUF 1SKSA 5F0UA 1S0VA 3ATUA 5EWFA 1XUPO 2HVIA 2LMIA 3F44A 4DR6J 1WUUA 2XMUA 4B3TF 1Y3KA 1RADB 2N4CA 1JJ2R 3IG1A 3R2DJ 3K17A 3P3DA 3VQSA 1OH8A 4C6AA 1HLUA 4QCLA 1FX4A 2GMHA 2D3ZA 2UXCF 3K9JA 1ASWA 1VHXA 1IR2A 5T14A 2PFUA 2KFZA 3QO9B 3EE9A 2LQ5A 2HNZA 3DI6B 5AQLA 3AVNA 3CJTA 1LK7A 4U8VA 2E1YA 1RWMB 1RU2A 3L7PA 3D7EO 3P5BP 4K4YA 4KGVB 2BKOA 2VYPA 4QYZJ 3ID6A 1WN7A 1LXNA 3FVYA 4CEZA 2OEKA 4F4YA 3AO1A 3J7ZT 3LOUA 4LRFA 4HHJA 3E9OA 4LBHA 2G8WA 5JS1A 5IXUA 3FSYA 5KQDA 4CEOA 2HHUA 2F4VJ 4CZFA 1UPPA 4EWTA 2APOA 5ETRA 4OPKA 4PKIA 2GS8A 3DLGA 1XNQJ 5EX5A 2KKHA 1NGIA 2XZTB 3MD3A 2QA4G 2AYGA 4JI8K 2Z57B 5AJ3J 2LFVA 4DV1K 3SMSA 1N33J 3G25A 5LY3A 1UEVA 4C1NK 1IR1A 2W9BB 1SAZA 4GV6A 4CJUA 3K8VA 2LVWA 4KR0B 1C0MA 2K8GA 1BA1A 2F40A 1T6DA 4FNHA 4LR9A 4RWTA 1QHTA 2J7WA 3BO3A 2FLNA 2DHAA 1W7WA 3CCVN 1WTBA 3L4QA 1U0SA 4YB1P 5HN0A 2GQ2A 4KRWA 4I9LA 3RTVA 2HVZA 1XMQK 4TXSA 1QJHA 1J5OA 3LDSA 1S9EB 4W90B 1U0HA 3IP0A 4LF9J 4DX6A 4X65F 3J7AN 3ZSYA 4I64A 3ET6A 4DTMA 5B0BA 2HFNA 2VWBA 2LYVA 2GQQA 1NSAA 1PYSB 5EX0A 4DL3A 3A0IX 5GAEI 3QERA 5B0AA 1ZM3A 3QT5A 2L08A 4USKA 3LPUA 2KQ2A 2B3TB 5ETTA 4CE9A 1NGJA 2V2QA 4MK8A 2DR5A 3CT9A 1PIEA 3WNHA 4JI7J 1T0TV 1W2IA 5KFHA 2PFDA 3SQGA 3NGIA 4DR2K 4DWIA 5HVHA 2YX7A 3QFPA 1SUQB 4DTRA 3MUMP 2HFUA 3I6PA 1UWBB 2EWHA 1NM1A 2DEJA 5B0CA 3R8YA 3V9XA 4FJJA 2ZM6K 2LSNA 1HNZK 3BPDA 4DEZA 4YR0A 1JLCB 2MQOA 4CJQA 4BREA 2F7TA 2MDAA 1FNOA 3MURP 3J7ZO 3KJVB 2ZWHA 2RKIA 3AQOA 5IC4B 3H2LA 4JI0F 2DHXA 2ZJQL 4DZ6A 3E66A 4DG1B 3BJYA 4KTQA 2H54B 1ZPWX 3HSJA 3J80U 3ENOA 4TKTA 4KHWA 4OHVA 4IQXA 1X3MA 1XR5A 2W24A 4K2XA 1KBRA 3FDSA 3DLHA 4KH0B 2YHXA 1NRKA 3PX0A 2RH3A 3HHLC 4ILMA 3RGIA 3NGYA 4NLBA 1CULA 3HCXA 4KFBA 1ZBTA 3TAMA 1X1PA 4B3SF 3VQ4A 3HHDA 3MCNA 3CCVS 3HVTA 2GGPB 2MHNA 4NLQA 1H6KX 3T1HF 2G2OA 1JWWA 3WQUA 3O3HA 4FK4A 4W92B 4FJNA 1OY8A 1Q16B 2OP5A 2BXJA 4F0HA 1RBTA 2C3UA 2WRMA 3LPEA 3EO3A 2FJAB 2AGPA 2KN4A 3PFEA 5E3CA 1BC6A 4ERDA 3TJ8A 1CJUA 3HP6A 3M9OB 4JYAJ 2X6NA 4OJ1A 1SV5A 1VQPN 3FE1A 1Q86O 1GK8A 4O3OA 4DV6J 2NUUG 2DXDA 5K9FA 2HGLA 3R8EA 1FJCA 3A1YG 3TAGA 2UUBF 1SIWB 2JLEA 2XMKA 3DXMA 1HR0K 4H4KA 1HD1A 1IG8A 4N56A 2HBQB 3DMJB 2V9WA 3PO5A 1LW2A 2AW0A 1FRMA 3QSIA 1U1NA 4EI2A 4ZDNA 1V6HA 3UE5A 3AOAA 1ZTTA 1RWVB 1K8AO 4H5NA 3QGHA 3R5BA 2JWLA 4NOHA 3QJPA 4GVBB 3N4PA 4OYMA 3VQ9A 4UTGA 3KLHA 1BWFO 2A2DA 3C7NA 3S3OA 2CJAA 3CO0P 4CO2A 1W97L 1JLFB 2VPXB 3GJSB 5IWAJ 5FRNA 3VQ8A 2HQDA 4C48A 4GW6A 3CCUN 5CYJA 3CFOA 2ZWPA 1NGHA 4C1NI 4G65A 2F96A 2JZ5A 4F3OA 3RJMB 4FNIA 4Y2IA 5U47A 2UUWA 3IWLA 5F8MA 4HHTA 3W65A 2FIUA 3CWJA 1DHMA 4LF8J 2J8AA 5AZJB 3K5NA 3SQ2A 1J5EJ 4DL0C 3NF7A 2LLZA 3O4NA 4LH4A 3UVJA 4WIQA 4DTJA 3BQ2A 3W9IA 8AT1B 2W6KA 4X62F 1XHXA 3BZKA 1RDAA 3VQEA 1ITGA 3BF4A 3JB9k 5FRMA 3SCKE 5LJ5Y 3SBGA 1ILYA 2VC0A 2G8UA 3KLIB 2Q2RA 4M7YA 5HP1B 1VQPS 3SMZA 4M63A 4FWKA 1W26A 2NRXA 4C8NA 2CH6A 3DWLA 1T94A 4FJ8A 4FZZA 4MYUA 3KMSA 5CABA 2E1ZA 3ITHB 5CZXA 2MSSA 2YX4A 4YY3F 3OJUA 1WSHA 3D5MA 1FFGB 4OGEA 2BM1A 3T7ZA 1UJ6A 3QIDA 3Q83A 3NEKA 1QD1A 1KWMA 1J9AA 5GMEA 5F0XA 4PWDB 3L0QA 4QPXA 3QO9A 4ILGB 3DU5A 3DI6A 4B3MJ 5G4DA 1YRUA 1R31A 2C2MB 3NCRA 4I68A 4JV5K 2AYEA 2UXBK 1DQAA 1HBNB 2CWXA 5KPRA 3VA0A 4RTFD 3CCUS 1O8BA 3RB0A 5LMUK 3ZTSA 3ADAC 1MSWD 4DR4J 3SV3A 1FW6A 4BC9A 4AHVA 3CO9A 1QAYA 4NA2A 1KVIA 3TABA 2ZITA 2KB2A 4JI8J 2MB0B 4OJGA 3PIPQ 4CO4A 5M1QA 3B8HA 5I3PA 2PEBA 2P5OA 4FJXA 1OYDA 2RF2B 2QLBB 5IOLA 1Y00A 2HF3A 2HMIB 4JI5K 3V6KA 3DHWC 3NH1A 1ZBSA 4DFJA 4QOTA 4MJKA 1Q9YA 3TRGA 1O0PA 2VJVA 4I6WA 2VB6A 1NK6A 4X66F 3W5YA 5CD4A 2W9BA 2R7RA 5IT9U 3FZ2A 4WFBL 1H98A 1WF2A 3PZPA 2XM3A 4O4RA 1WI8A 4YOXA 2ZH1A 1PJ6A 4LFAF 4J2DA 1VRQC 4ZLNA 3S01A 4RJVA 4FO0A 3TAEA 1M1HA 3CC7N 4DTOA 5KRSA 3GJTB 3WXKA 4ZHRB 1WKKA 1S9EA 2FVQA 2DPNA 3VAHA 4OX9F 2QXLA 2P6SA 3VALA 1HFEL 1DGKN 4ZLLA 5LL6d 1WHVA 4BRMA 3OSPA 4DR2J 2DCLA 5DQIA 1HJOA 5C15A 1ZC6A 3MDFA 3TZWA 1S0NA 4AHUA 4M3UA 3KFWX 3VVUA 4X4TA 4JI4F 3FK4A 3AAQA 1XTZA 1WELA 2GNKA 4O3QA 4DSFA 2RJZA 1PAEX 2Q3PA 4UUXA 2C3YA 5KFQA 4KHNA 4FOEA 1FRKA 4DHYA 1SUQA 1Y3JA 4LR8A 2BABA 4C9DA 3W3SA 1UJ5A 4B9QA 4OPAA 1UWBA 2XGPA 3MGJA 2QA4N 2QTWA 3I0RB 3AB4B 3V6HA 1K0VA 4V1Ak 3R3TA 4DSIA 2E5LF 4X65K 1FNMA 1C1BB 3OYGA 4J9UE 4TQRA 1OIAA 4I6MB 4BG9A 1YZ6A 4LF7F 4OHYA 3SLCA 2RHSB 1JLCA 5K8MA 1O51A 2IDEA 1VDHA 3AVHA 4CJPA 3KJVA 2NRWA 4HR2A 2FJWA 1WDDA 4K59A 4DG1A 1FDDA 3W2VB 3P1GA 1HYZA 2JHEA 2F8MA 1KC8T 1D9FA 2CPXA 1EQYA 3VZIA 1RBRA 5ADXH 1TMJA 3G6EN 2CNLB 1WLJA 3THVA 4OX6A 1N4LA 1GOCA 3E9PA 2CG4A 4HUEA 2O4IA 4LF5J 2E1RA 3J80O 4M5IA 4NYOA 1ZBFA 4U7BA 4CO1A 4LF4F 2GGPA 4WTYA 2K3KA 2V8DA 4ZJOA 3CC7S 4CJRA 2O01C 2YJFA 3LDPA 2IMOA 3SJJA 2VA2A 3MI7X 2WBNA 4A8QA 3DC2A 5I9EB 3K8WA 2CNKB 3C19A 1HR0J 3OR2B 2BUPA 2C2RA 5KT4A 3PYDA 2DNLA 1U09A 1SKWA 2BEFA 5IQQA 3GTYX 3N9UC 5BYQA 2FY1A 4WF9Q 3MF5A 3M8SA 1YSJA 5IT0A 1X0PA 4DUZK 2KZZA 1WOPA 1N34J 3TZYA 1WD6A 3HHEA 1N5TA 2EFNA 2OFHX 4YHHK 1VHFA 3AVAA 2LP4A 3CJ4A 2VQEK 4B3SK 4M5KA 4KV8B 3DMJA 2CFXA 1IBLK 1RAEB 2KT3A 3JQKA 4U7UK 4IRKA 3EM1A 1WORA 2XS2A 2GIQA 2QA4S 1S3XA 4OJ3A 4GKJF 2HF4A 5LSLA 4KH4A 5AQSA 2KW4A 3JTNA 4FWNA 4URGA 4GVBA 3DRXA 1YVNA 1HWUA 1KONA 5E3PA 3AVKA 3N01A 3OVBA 1S59A 2AGOA 3AVGA 4A62A 4WYBA 3NE6A 3CULA 1HNIB 2CJBA 4BQZA 1JB0C 4A46A 2KFNA 3MMBB 1JLFA 2VFSA 3G0ZA 3TTCA 4IFYA 3RB4A 3L4BC 2QMUB 4CFBA 3KXDA 1CJVB 5EVZA 1X5OA 3LAKA 2XMAA 4DCOB 4JI3J 3OHBA 3G6ES 1B0PA 3QT6A 2W4PA 3DOMB 4NCBA 2LA6A 5AQJA 2QLWA 2A6OA 1YKWA 4QWDA 4Y65A 5LOQA 2R2RA 3MPWA 4B9LA 3QFHA 1KC8O 3ILOA 4JV2A 4FWRA 1H7XA 1FEHA 2AHOB 1VS3A 3OYCA 5EXWA 3UN2A 2FHOB 5GIOA 1NB7A 1RDWX 1EARA 4OKKA 2YKAA 1TUVA 3CMAN 2W6LA 1JL2A 5FLXY 3PTWA 1UZDA 1O5JA 3O8MA 4KTWA 5FJ4A 2QC3A 1H2TZ 2B9YA 4OYIA 3HVWA 5AQKA 2AJFE 3JSYA 1RWNB 1GFWB 3KLIA 3ETMA 3WDOA 1RCOB 4CEBA 5HP1A 3OXGA 3G8TA 4DU7A 4YQWA 3PLAA 3ZT4A 3I9V9 4Z4EA 5KG1A 4TQSA 5FLXU 2M9KA 4YOUA 2ZH7A 3QGPA 4DI6A 3ITHA 2YKQA 2HURA 3WUHA 3SV4A 3IR5B 3K0SA 3CM6A 2KM8C 1Q5YA 3CERA 3GJRB 3NNCA 2D4WA 4UOHA 3H2VE 2D0PA 2HGMA 1UPMB 4B3RF 1HNWK 3KJNB 4IJAA 4IOCL 3LDOA 3PKYA 2B56A 2HHHF 3X1LB 2FBVA 4W5NA 2HFZA 2Z30B 2FQQB 2UXBJ 4ECYA 3DLBA 3L2QA 3TR8A 3EWGA 3V1OA 2N3OA 4PWDA 5KFSA 1SCJB 5LMUJ 3TPQA 3R9PA 1B99A 3A8KA 4NLPA 1WKJA 1TZ0A 4P2XA 1N48A 1U1QA 3BYRA 3EXYA 3IGNA 4BRFA 4B3TJ 4RW4B 4DL7A 1FRLA 4F4ZA 2EI5A 1HBNA 4CHPA 3ILIA 5LM7E 2XNQA 1UEUA 2HRUA 3OL7A 2UXCJ 4UOGA 4JI5J 4DL2A 1KD1T 1LV5A 5D78A 4DV0K 1CS4B 2JLGA 3ZZTA 5ETPA 3R6MA 4FM1A 1VQ6N 1LWCB 4E19A 3AVJA 3MN9A 5I4MA 2AEFA 4GKKF 3MAHA 1AFJA 3W1YC 5AFUA 2RF2A 1GLAG 2IAJA 3P96A 5LJWA 2HMIA 4GMKA 1BWEA 5LXRA 2GZOA 3HMJG 4KHRA 3ZNJ1 1EKEA 1IM4A 4FK2A 2HZCA 4NMLA 5D3GB 3CMAS 3H5XA 1EX4A 1VBYA 4N47A 3WQTA 1TKTB 3O2IA 3W2WB 4CFDA 1DTTB 2QN6B 4ISFA 1KFDA 1Q7LB 3TSPA 2A5XA 2V6AA 3MWPA 4YDUC 2G8FA 3SSRA 3H2UB 3RYLA 3VGUA 4PG6A 1S6OA 4JK7A 3OTCA 2BJ9A 2UUAF 3M8RA 1Q8IA 5IT9O 2VG6B 4TSXA 4ZHRA 4XH4A 4DSLA 3BB5A 3BKTA 1M5HA 2FUG9 3A5MC 4ZIVA 2OMLA 1TAUA 4CJ3A 2B4JA 2WSEC 3ZETB 3FQKA 1QVGR 2WW4A 1QM9A 2DR9A 1PC4A 2E2OA 2EFOA 3HL8A 5J1PA 4HCBA 1KQSR 1P9YA 1HNXF 3A5OC 3M6UA 5GAGI 2NXEA 2ZH2A 4G1PA 1PG5B 3MOZA 1ZAWA 4GC7A 1OH6A 4X65J 4C4WA 4GVEA 4CEAA 2W4CA 2YWHA 2ZJPQ 2YV0X 3HLUA 1N52B 3BGLA 3CXCM 1GTEA 5M1OA 2V4RA 2DY1A 3QATA 5E3QA 1VLOA 1EIYB 3I0RA 2IOCA 4OX9K 4DFKA 2BM0A 1U2RA 4TLQA 2OD6A 1SL0A 1C1BA 5M2RA 5CAAA 4FYXB 1P1TA 2G0CA 5KFWA 2ZUAA 3MEEB 2L9DA 5HQLA 1VQ6S 3V1QA 2XHCA 2E8AA 3TW0A 4DBQA 1ZM9A 4DXLA 4DX8H 2RS8A 4DF8A 2Q0UA 1SS6A 4NLUA 4BWJA 3BPSP 1NU4A 3CPEA 2JDJA 3GE1A 4MTPA 3W2VA 3CMEN 4MAKA 1WC4A 4HKQA 4LVOP 4EFAC 3EKSA 2KXHA 4E1JA 4RUAA 1VC0A 1U02A 1S1XB 5ETNA 3M8QB 3W0LA 2VZ9A 4M3TA 2QSWA 2ZNZA 1QAJA 3D4JA 3ISZA 5M1KA 4KH1B 2KU7A 4JI0J 3T5KA 1WHWA 1I1GA 3BO2A 4LF7K 5ETQA 1U24A 2V8GA 1JKHB 4HI1A 3R7SB 4QQBA 1XJWB 2PBDA 5EUHA 3VQ7A 1JIHA 5LMNF 1RYSA 4YHHJ 3A8EA 2W2NP 2JH3A 3OR2A 2VQEJ 1RTZA 4OFZA 2DNOA 5EOYA 1RYRA 4B3SJ 2DPJA 4B9TA 2RQCA 1IBLJ 2EFVA 4OYPA 3T1HJ 3EDQB 5F8NA 4J2AA 3HP9A 2D7SA 1KLMB 2PC6A 4PCQA 1HWKA 4I9QA 2G8VA 4M5GA 4A8SA 2YKMB 5IQ6A 2X1GA 2ZKUA 3T5HA 2WC9A 3MMJA 4RG8A 2YHYA 4RW6A 1NEEA 3ZSOA 4KV8A 3MFHA 2QMWA 3UR3C 2HNYB 4ICLB 1HQUB 2YNFB 2PEHA 4Y28C 4LMZA 3IS9B 4ZVPB 2VOPA 1VSKA 1S9FA 3EZWA 4PA1A 4QU7A 2M8DB 2M3DA 1S10A 5B08A 4CH0S 3O1LA 2UUBJ 1SIZA 2OD4A 3E8OA 4DV7K 1WOQA 1K0TA 4BVPA 1UCNA 4R25A 3TQ1A 1HNIA 4BRKA 2R3VA 1UETA 4FS1A 3PX4A 3W3DA 1WC5A 2CKWA 4KHSA 5HMZA 1TK5A 5KFCA 2DGXA 2O67A 3MMBA 4A8KA 2WONB 4L3QA 4A61A 5SUHA 2KL8A 3CMES 3OYAA 1CJVA 2VJUA 3PACA 4KQZA 1I51B 4ZVTB 1N5YB 3KMQA 3AOBA 3M9NB 1AFIA 3DOMA 4P52A 1L3UA 3TAPA 2FSNA 2I5JB 4OZ2A 5CYQA 4PRFA 4NMXA 3LWLA 2HNDA 2ALYB 5T41A 5DQHA 1CZAN 1N32F 4K0KF 2XYHB 1NB2A 4DPWA 2M7SA 1N56A 2RIJA 2YPYA 3MPYA 4CVNE 3TTFA 5L1LA 1ZS6A 3L2WA 4B1UB 2XMVA 2AX0A 3L2RA 4XIUA 1FJEB 1W2BM 4NLWA 3VEXA 5GINA 4ZVEA 2GJ2A 4YB6A 4WU2A 1BCMA 2MQQA 4WKYA 3N6LA 1TUUA 3EL2A 1NM2A 2KH9A 3EPIA 1Y5IB 2IDLA 4DCJB 5E33A 4NYNA 5DDOC 1HNWJ 4P6QA 3ZZRA 4ZIWA 4WF9L 3ULHA 1URRA 4N8NA 2NR0A 3OYEA 5JVGQ 4ZVHA 2XY5A 3Q89A 2SXLA 1OO0B 2OELA 1P90A 4O44B 4EYHB 2FLOA 1J53A 3U27A 2YNHB 1NG9A 4NEYA 1T03B 3VF2A 1FI4A 5A8RB 4GV9A 1P1LA 2LDYA 5F3TA 4M42A 1RK8A 4K8XA 2B4UA 4CFCA 4DV3F 3CJBA 2E2NA 2WSCC 4FJIA 3U1LA 3P8BB 4DV0J 4RW4A 4WK1A 5ELZA 2W2OP 3WC2A 1KNZA 1JLGB 1CLFA 3B82A 1HYSB 3TUZC 4C7QA 2DR6A 1CS4A 2PN6A 1IM6A 2OHDA 3T41A 1QSLA 1LWCA 3C95A 3ZCMA 3EE8A 2P51A 2HLUA 3PSIA 1QQMA 3FNNA 4K2JA 1ITPA 4DS5A 3WNGA 1S12A 2RUSA 1RTHB 4Y1CA 5D3GA 2IFXA 1GLJO 2JSXA 5DG9A 2QWQA 3AT1B 1QHAA 4LRAA 1TKTA 3W2WA 1F21A 4WPAA 1SJRA 1DTTA 2VQFF 5ETOA 3VPZA 2VG7B 2MJUA 3LDLA 3VGKA 4OI2A 2YKNB 4FWSA 5EY4A 3KLEB 2IPOB 1DFDA 3ISNC 1PAUB 2VICA 2EEYA 2OSRA 5HAOA 4KPYA 1NJXA 4DSJA 5DGBA 1R3NA 2E2PA 3VQTA 3WX8A 4DL4A 3MM8B 2EFGA 1S6QB 3KHHA 2VG6A 4OZ1A 3K2YA 1X31C 2R9LA 4LF6K 2I9SA 1UEKA 1EQ0A 3E9LA 2AT1B 4BC2A 3R27A 3ZETA 2CADA 3D0PA 3G8QA 2A0FB 3VESA 1SQEA 1MN7A 2EG2A 1EQMA 4DR3K 4MDAA 4F26A 1GQEA 4DTNA 3TEHB 4CZLA 2JC0A 3U8XA 4JKCA 4K7QA 1FK9B 1MA9B 4BC5A 1DAXA 5HANA 4OX9J 3FFKB 3CJ3A 1LOTB 3GG4A 3FZLA 3F41A 2K7JA 3GIKA 4H0XB 4K4XA 3CD6N 1S6PB 2DXEA 2AV5A 3M6VA 5AQPA 2OH2A 1AXQA 1X8DA 2WVCA 2E9ZA 2VKZG 4JI4J 4CWBA 2BUNA 4W5RA 4DR1F 3MEEA 1HIYA 1PKUA 3QJLA 4OI3A 4B9MA 5CA5A 4FYYB 3IRWP 3SJHA 3ELHA 2QSFA 2OTLN 3HSCA 2L41A 2D0AA 5A2QY 5F8IA 1NOYA 1GLCG 3TA2A 4OI0A 4MDBA 2P9EA 4DOZA 3NGRA 3ENHA 1YZ7A 2E4LA 4XDCA 1OWXA 3VAKA 4KHPF 4K4UA 4LF7J 1MLAA 3GYGA 1R8PA 1S1XA 3MCPA 4U6PA 3M8QA 3QPIA 4ITSA 4M3RA 1GTHA 3ASMA 3GYNA 3QEVA 5F0WA 3GIIA 3CPWR 5H9EJ 4FJHA 2DB1A 2UUCF 3S7RA 1VQ9N 1WEYA 2V2ZA 1Q81T 4LFCK 1JKHA 2FTRA 2MKSA 4C2MA 3O08A 1RTIA 2BX6A 1EP4B 2K3IA 4DQPA 4J8FA 4B1ZA 4WP3A 4NCGB 3SQ0A 1TQLA 3CCZA 2Z1JA 4BQLA 2NREA 1FRIA 4LF4J 5AQGA 3U4LA 3KWMA 3FBCA 3W61A 1QVFR 1KLMA 1U04A 2IJRA 3PX6A 3G71N 3PRDA 4A8XA 4K4SA 3GFXA 4IWVA 4MLEA 5FDLB 5B0DA 2YKMA 1KQFB 2LXFA 1VK3A 4JRPA 3KJQB 4NLCA 1U47A 3IXQA 2HNYA 4ICLA 1ZPVA 3UB5A 1HQUA 4L73A 1HBUB 1VMBA 2YNFA 3UNGC 3IS9A 3CD6S 3ZTOA 3PIOL 3ZLJA 3W5XA 1FVSA 5AFUH 3D1OA 3V81B 3AY0A 2FJEB 1K1QA 2CQHA 5LMNK 1M1KT 1NHUA 1TK8A 3H42A 2EWSA 1YBAA 5C2GA 5EWGA 1FWKA 2UXDF 1RA6A 4QU6A 4CHYA 3QETA 4OYOA 4Y2AA 2IRUA 3SCJE 4J7CA 1NJIT 2OTLS 3ZTPA 3CCJN 1FFWB 4ZPVR 2UVVA 3EUNA 2WONA 3RMCA 4DZDA 1IR0A 2YBVA 1FO1A 5D6GA 3THXB 1KQKA 5D4PA 2V8HA 4YOWA 5H9FK 4DTSA 1OH7A 1N5YA 2R7UA 4CH7A 4A8MP 3OL9A 1HW9A 2BE9B 2DRAA 3K2PA 4FDFA 3QYYA 3LW5C 4K5SA 2G1DA 2WVFA 2JWKA 1IWAA 4WFYA 1K6YA 3CJQA 2I5JA 2RRAA 3PJ9A 2X74A 4FP9A 3A5LC 3VMFB 1VQ9S 3WX4A 5BN8A 2VHGA 3UNYA 3NGUA 3LP1B 4ECTA 3A8JA 3EEQA 4H4KC 3HFKA 2QKKA 1S99A 3DGPB 4H8KA 2RS2A 3PUFA 2HW3A 2RQ4A 2QO3A 1S7HA 1Q81O 3OW2R 1UVKA 5HMYA 4AHCA 2W40A 2RQMA 4PG4A 2EBGA 2QWRA 2Z56B 1HJRA 4JKFA 3HZ6A 3KOAA 1DTQB 4ECUA 3U1MA 1NJYA 2GQCA 4FLXA 1Y9OA 2F65A 1LQ9A 4O0NA 2C2EA 1RILA 3G71S 1DQ8A 2ASDA 3OYBA 2AEMA 3GP9A 4J90A 4NX9A 4FF4A 3TA0A 5KG2A 2GVDB 2E6LA 2MGZB 3OYJA 3NBPB 3KK7A 5KFJA 2WTFA 4OV1A 5BREA 3FZHA 4U8YA 4O44A 4LRDA 4P72A 5C12A 4WQ5A 2YNHA 1U49A 3HOTA 1KCFA 2A6AA 1T03A 5A8RA 4JKDA 3RMBA 1NMEB 4RWXA 1RKIA 1GLDG 2QI2A 4CHQA 5EWEA 3PNIA 4ZVOB 1L5UA 4I6AA 4CBXA 2JGUA 3ZT2A 1M1KO 2MZ1A 3ZX0A 3CCJS 1ATRA 3C46A 1JLGA 5F8JA 2B5JB 1RCXB 3AFGA 3C8YA 3QBWA 4F4KA 2ZKTA 1HYSA 1EHWA 3D9BA 4UY8T 4U7UD 4DL6A 4JK9A 3AARA 1OY9A 4G6VB 2WVEA 2ETJA 3KYLA 4ZPDA 3F2KA 1VQ7N 3MR7A 2NRTA 3A12A 3AVIA 3VA3A 2WUSA 4HTUA 2LQJA 2MKCA 4CJ4A 5L1KA 4QYRA 1XEZA 1UVMA 4C8LA 3HD2A 1IWGA 1RTHA 4ISGA 4DV3K 2PGCA 2KFYA 1K73T 1T05B 4LSLB 5AXMA 2I8EA 2MKHA 3KUEA 4NO7A 3RR7A 4FYWB 4CGHA 3FCWA 2IYGA 3GFYA 3VGTA 2CQCA 4IKFA 4PQAA 2VG7A 4IDHA 3KHRA 2YKNA 3KLEA 2QT7A 2VF3A 1C0UB 2CPYA 3QRQA 5DLFA 5KFDA 4LF9F 1X9JA 1DJ0A 2E1AA 3DLEB 1BCOA 1C2PA 3KK1B 3MM8A 2A41A 4FLYA 2Q31A 2GW8A 3D0IE 4DR3J 1YIJN 4LJMA 3D6FB 3CJAA 1KVCA 3HTVA 2LU1A 3RR8A 4CHNA 4XEIA 2NZTA 2XULA 2V4JB 2DT9A 4C98A 5H1SV 2FZCB 1IH7A 1SKUB 1FF2A 2UUAJ 2VQFK 3OSNA 3CEDA 3SCXA 4DLEA 1NK9A 1FK9A 7FD1A 3SAHA 1KVAA 4XTTA 1VYAA 4ID1A 5JLFA 3R9LA 4FBTA 4FL9A 2P9CA 2ABYA 3ENVA 1VQ8N 2ZVIA 1OPIA 2M8HA 1DEJA 5AQUA 3BY5A 1S6PA 2X78A 1MROB 5HL7Q 2ADBA 2DPIA 1G15A 1FRHA 4I69A 1DRZA 2BA9A 3H1VX 4YR3A 1REVB 2QFJA 2P6TA 3CF5L 3BUZB 1VQ7S 1FESA 3SBMA 4TVAB 1RWOB 2RSQA 4UY8O 1XNRK 3Q8QB 4DQIA 3N6NA 1T3VA 1S48A 1VRTB 1VI7A 3I87A 1S0MA 2VA3A 2H5JB 2G8HA 1KAYA 1TKDA 1SC1B 3VF4A 4KHYA 4Q45A 4DR5K 4LT6A 3T1YK 1OS5A 1Z05A 1X9MA 1I3AA 1SL1A 5KI6A 1TKXB 4DV5F 4LFCJ 1YK9A 1VGYA 1NMNA 4DLGA 4OZNA 3U02A 4QIFA 2MXYA 1RNHA 3AO3A 2BW7A 1K73O 4ZLJA 3MMCB 3RRKA 3HF5A 4X4NA 1I5OB 5C10A 5D4OA 5KPTA 2FVPA 3K5MA 5IV3A 4DUTA 1T95A 2QX0A 2KT5A 3AJDA 2OJ3A 4PXBA 3EGZA 1U8WA 1KSPA 5HMXA 3O6QA 3U3GA 2CJYB 3TVKA 3SDEB 4DV6F 3AV9A 2IJNA 2MZTA 1EP4A 1YIJS 1XQSC 2E5JA 5T7LB 4QS9A 4NCGA 4DDFA 3DKDA 5A0YB 3KHYA 3DJCA 3NGDA 2WB4A 4AF1A 1WC3A 5DDRC 1C1CB 4KHPK 3OHRA 2B7BB 2R2UA 3J81j 4OI1A 1Q7YO 3ENWA 3HKZD 5AQOA 3BDEA 1F1BB 1OH5A 5FDLA 3CJ2A 5LMNJ 4RBUA 2UUCK 1HD0A 1MWQA 1SC4B 3B6PA 2Z4PA 1YJNN 1R43A 1HBUA 3UDLA 3MDQA 1VQ8S 1FDBA 1FRJA 4B9UA 3MMAB 4CESA 5HROB 4OL8A 4ECRA 2M0GB 4OV6A 1AZSB 3AAWB 2OKQA 3D1QA 4LR7A 1NKBA 1NSQA 2HHSA 2BANB 2DJWA 1B64A 5H9FJ 1REGX 2RB7A 4HUGA 2XWYA 3FLCO 3A8IA 5AQRA 4CZHA 1LFPA 4CI0B 1TV6B 1V3SA 3SI6A 2VIHA 4HH1A 3BEGB 4ALZA 2XY6A 3QAUA 1GXTA 1JJ4A 5KFNA 3THXA 1U1RA 4AE5A 1S72N 2HZAA 2VC1A 4KHMA 4CK1A 3CGIA 2AMCB 3B4MA 3CIMA 4H4OB 4FS2A 1GXLA 2QLFB 1B7FA 4CF9A 2P2CB 4D3HA 1QAIA 4AM7A 3AA8A 2Y1RI 1R0AB 3PEHA 3CQYA 5AQYA 4IEIA 3LP1A 2UXDK 4K41A 1FKAF 3R5GA 3D6TB 4J9OA 2IM2A 3SK3A 5JXSA 3RU0A 1EETB 3CIPA 3DGPA 4ZP7A 4EU0A 3V9UA 1ZH5A 3NL0A 1G6BA 2YWKA 1HQ2A 2LU2A 4EBDA 3J81O 2A1SA 1HX1A 2X6SA 1DTQA 1ZETA 3CFPA 5EDWA 5FPNA 1ZBLA 4Q2MA 2FGCA 5HJXA 1CJTB 3WNEA 4ZJQA 3A4TA 1XK8A 4KKOB 4K42A 1U26A 1BGXT 2GVDA 3E1YA 2MGZA 4K4ZA 5FD1A 3NBPA 3WEEB 3D0GE 1YJNS 3OTBA 4YB5A 2R7VA 2QFIA 5AQMA 3I96A 3SPZA 4CLUA 3DLJA 3O44A 3FGUA 3K89A 4IO1A 2CNOB 1WSIA 4JS4A 4RLEA 4DF4A 1Y64A 4YN3B 4P2MA 4M95A 4RNMA 4Q43A 2GMJA 2VH7A 1IUJA 2GVZB 4Y2KA 4KT0C 4FJLA 4QW9A 2X1AA 4J2EA 4MYTA 3CCMN 2V2VA 4KO0B 2VFRA 5HQ8A 3ICLA 4P9SA 4JI8F 4MKVA 4K8ZA 4DV1F 2B5JA 1C4AA 2IRXA 5LJ3Y 3MCSA 1UVIA 4LQ9A 2DNYA 4XH5A 1PGZA 1LXJA 4KH5A 1S72S 2MY7A 3HSTB 4DV3J 2A42A 4KGMA 1HI0P 4DV2F 2BQRA 2BYCA 1F6TA 2R8KA 2V34A 3VGSA 2FB0A 2VDIA 2AF6A 2M4MA 2M2BA 1XMQF 2JEJA 3GFHA 5AR0A 2V69A 1G2EA 4JI2K 1S1UB 3W8GA 1T05A 4EYIB 4O8UA 4LSLA 5KG4A 3DRYA 3EZUA 3ZX3A 2ASPA 2HWHA 2RNEA 4ZJLA 2HB5A 3GJQB 4QS8A 2FJDB 4FJ5A 2D3O1 3NF9A 4PKHA 3TSUA 2JNJA 4KIAA 1C0UA 2HBYB 4GVMA 5A8KB 3H6EA 3G86A 2BOAA 1MWYA 3IO1A 4DR2F 2R8IA 3KK1A 3AA4A 4AHSA 2ATQA 3N5BA 1FXXA 2B8PA 1TP7A 2VQFJ 4UW2A 4JKHA 3FFIB 3H5YA 2DNMA 2UV8G 7FDRA 1A0OB 3KUHA 4C3LA 4X2BA 2V4JA 5F9NA 1VQYA 2WHOA 5KFPA 4WCEQ 4GNIA 2ZM6F 1HNZF 1N8RO 5KQ8A 4B02A 2DO4A 4IQMA 4RW8B 2QLJB 2BJ7A 4UUWA 4KHQA 2YNGB 2BGGA 1ACMB 3EZ5A 2PAVA 3RW6A 3B4DA 3H40A 2P9UB 2LEBA 1LFWA 4MT1A 5A76A 1UVLA 2EFQA 2IM0A 2AJ2A 4YFUA 3CCMS 3AJ2A 3SQGB 2ZHBA 4ANEA 2R7TA 5J2MB 2D1CA 4ANCA 1T9UA 2NQPA 1MROA 4FSVA 4L75A 1HARA 1XNRJ 3BN7A 1R6VA 3M2UB 3NF8A 3G8SA 2O8EB 2R7YA 3NAHA 3VAIA 5E26A 1WSFA 3TAFA 1REVA 5M2PA 2E1CA 4V19S 1HWLA 3U3YA 4OJHA 4DR5J 2V8PA 3T1YJ 2CJQA 2PMZD 3VQ6A 4Q5VA 2HWTA 4CEDA 3OFGA 2QK9A 3ULDA 4HDGA 1VRTA 4E1NA 3AGKA 4A2BA 4QPTA 1JXVA 2YY3A 2I0XA 2G9OA 1WC6A 1KHWA 4A2AA 3MHYA 3RG6A 3HSDA 4OZLA 3O9UA 4BGAA 3I5AA 2HSTA 3MTKA 2RDDA 4DR1J 4QR2A 2IIRA 5ADZA 4DV4K 3D6HB 1XMBA 3Q8SB 2XCAA 3AB2B 4FYDA 3O9TA 1IKWB 3MMCA 2KJVA 1T11A 3SUOA 5AE2A 2XYGB 3D0HE 1HR0F 1CZ9A 5TKYA 4A47A 1WHYA 2FHMA 2DGUA 4KHPJ 3D2FB 2DNNA 2ITGA 3SDEA 1NGDA 3I31A 3MXIA 5KFGA 3CCEN 5T7LA 5DS7A 1DQ9A 3HXMA 2MLZA 3ID8A 3I32A 3OYMA 2Z2ZA 4A5AA 2FBYA 1F2HA 3EICA 5A0YA 3VEOA 3M6GA 5JMVA 2UUCJ 3OXLA 4A8FA 5BR8K 3HHLD 1Z2ZA 2BE2B 1C1CA 3W9JA 3R3LA 1JJCB 5AQZA 2YJEA 4IFEA 4YMEA 4M3ZA 5DQGA 3M8PB 4CJKA 4JOUA 1XERA 5IS2A 1YJTA 1ZAXA 3ILLA 4CLWA 3P38A 3BSNA 3L3UA 4HHUA 4CF8A 1FX2A 3CQXA 4LFBK 1NK0A 1VISA 3CNQP 3TO8A 3TSQA 4M5MA 3Q8VA 4FJ7A 1JJHA 1TVRB 3GMGA 4Y00A 5LSOA 4IJNA 4FJ9A 4FN5A 2KI2A 3RVCA 1NKCA 4ECQA 3IN5A 1UTAA 3WT0A 3MMAA 5HROA 3EX7B 1D8ZA 1F5CA 3NNAA 2XC9A 3KG1A 5GAGU 3HZGA 3MAAB 1AZSA 1ATSA 2BDPA 4QZVB 5DM7L 5HL7L 3EGVA 1P6TA 2Y1LB 2RE2A 2BANA 4BC7A 2W7AA 1ESVA 3PRBA 4CJLA 3K5PA 5HRPA 2O66A 3VTIA 4PG8A 2OGUA 1H3DA 3AD7C 1TV6A 3TZXA 3EE3A 5CXTA 3R6LB 4KC5A 1FKOB 4BROA 3KLFB 1IBMK 1U1PA 1YXQA 3VV2B 2OANA 1KOHA 3GPAA 2VL1A 4JKBA 2G13A 3QLHB 4C0OC 1GH8A 2G0JA 2Z0GA 4MK7A 2UXDJ 2W8KA 2E7WA 4ZMMA 2OA8A 1RHUB 3CJSA 1G7CB 4NASA 4H4OA 4DX5A 4CCHA 2IJFA 1CZBA 3JTOA 2ACMA 1R0AA 3NDKA 4F67A 4R0EA 1KLNA 1MG7A 2QMXA 4CYUB 3SFGA 3DRSB 3KK3A 1EETA 2PI5A 1F0XA 3PJWA 4X64K 2D5RA 3CCES 3ZTRA 1H2VZ 1X3NA 3VGMA 3H90A 2V4QA 2K06A 1WF1A 4F2SA 3PW2A 4IYQA 4H0TB 2XGQA 2FHJD 4CGFA 3FBEA 4RUHA 3EMTA 2JWNA 3Q8RB 5BRFA 3C2PA 1OQ6A 4NA3A 1CJTA 1AT1B 1H2UX 3CC4N 3S1TA 4KKOA 4HUFA 3FMWA 4JV5F 5AT1B 2UXBF 2O5DA 1ASVA 3GIMA 4DTXA 1XBWA 4JHDB 5ADXA 3OT9A 3WEEA 1SJQA 3R97A 1BISA 2ITMA 4HEA9 3PDNA 2W9CB 2FHJA 4J37A 1BMQB 1VOMA 3QB0A 3NCIA 3C14B 3OYDA 4JI6F 5EN1A 3PCOB 3O1BA 4NPOA 3LGMA 3FQLA 1IBKK 2W4DA 2VG5B 4JAXA 3DLRA 2GVZA 4X4SA 4F4XA 1GX6A 4JI5F 2WVBA 3O3GA 2IC3B 1EKRA 5BR9A 3D3BJ 1U1KA 4KO0A 3VOVA 4I7FB 3TUIC 4ZTFA 2CZVC 1T9TA 3KD1E 1KR4A 2OLWA 4E7LA 3LGNA 1OVYA 2R4FA 3AO2A 4F36A 2N3LA 5C7PA 1DURA 1XR7A 1IBCB 2DNQA 3OYKA 4EAHD 3TYTA 4JI2J 3AVBA 3DLLQ 3LZIA 1Q0NA 1M5PC 4KPCA 2KM8B 2WW8A 5JLHA 3L3VA 2KT2A 4X4OA 2YNIB 2IVNA 1RZMA 3GIRA 4B1WB 4DN9A 2HEKA 3FC9A 3LALA 5K14B 1S1UA 3BGRB 2ZE2B 4TYAA 2Q3SA 3UE2A 3CJ5A 2W7PA 1W7AA 5JMNA 1TFYA 1V3ZA 3RMDA 2J4RA 5CZVA 4K4WA 3LWMA 3I5BA 3EYZA 3CJCA 1VQLN 4AL5A 3M3ZA 3PY8A 2E88A