2I5JA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with dhbnh, an rnase h inhibitor
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H P66 subunit
publication title HIV-1 reverse transcriptase structure with RNase H inhibitor dihydroxy benzoyl naphthyl hydrazone bound at a novel site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 117
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2i5jA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2i5jA05
1RT4A 4IFVA 1SL2A 5DQGA 3GIKA 4U6PA 1TL3A 2G8UA 4OKKA 3C95A 4KE5A 3AVFA 3O4NA 2HHQA 4FJXA 1HRHA 3D28A 1S49A 3S3MA 5KG7A 3PW5A 3BSNA 5HROA 1IG9A 3AA3A 2EX3A 3OJSA 2FVPA 1VSHA 4TXSA 3AO2A 4CF9A 1WLJA 2HW3A 5KFYA 1IKXB 4CJPA 3ICLA 2UVVA 3MR2A 4Y2AA 4NCGB 1XHZA 1SH2A 1UWBA 3OYHA 3K57A 4PUOB 3SFUA 4EBDA 1RT6B 1RDAA 1NJWA 1NK0A 3N6LA 4H8KA 1YT3A 3KHHA 2DFFA 5HRPA 4KHRA 1JLQB 3ISNC 3AVLA 1EXQA 4RW8A 2IA6A 3QZ8A 4M3TA 1TKTA 4KKOB 3B6OA 4DSIA 3KK2A 3HK2A 4CGGA 2I5JB 1ITGA 2E4LA 4Z4EA 4OLAA 3OHAA 5CYQB 3CFPA 2OPRA 3DLRA 4CJFA 1D0EA 3FFIA 1ASUA 4KAIA 1S1VB 1HPZA 4YP3A 4YFUA 1HYSA 1TKZB 2WCXA 4OJRA 2NUBA 3IN5A 3OYKA 1K1QA 3TR8A 1SH0A 4DF8A 3MXJA 2HWHA 2IM3A 2KW4A 3IG1B 5F8NA 5J1EA 3FDSA 4CJEA 4IKFA 2C2EA 1J5OA 1KVBA 3H5UA 1JLEB 3KKRA 3BDPA 3KD1E 2XCAA 1TVRA 4EO6A 2BRKA 4NYNA 4FK2A 2IAJA 5EWFA 2R2TA 1QE1A 1RT3A 4CESA 3PW0A 1IKWA 4KSEB 2RKIB 3H59A 4NCBA 4N76A 4FBUA 4DTXA 5F8JA 3HP9A 2YNFB 3VQBA 5HROB 4KFBB 4J9NA 4E7KA 2DPIA 4YR0A 4FJNA 1A5VA 3RR7A 1CXUA 4F3OA 5KFGA 3TVKA 3HVWA 1TAUA 5KFZA 3C94A 4DLGA 5J2QB 1RTJA 4GC7A 2YHAA 2O4GA 3BSCA 4KB1A 1UWBB 2RDJA 4DU3A 4ECVA 2D0AA 4KHYA 1KVAA 4H4MB 4CJ4A 3V6DA 3I0SA 3QLHA 4I2QA 4LQ3A 1KFDA 3O3FA 4FM0A 1ASWA 3IS9A 3TAMB 1S6QA 5I42A 4RG8A 4BWMA 4RW8B 3M8RA 4ZPDA 1TKTB 4ZHRA 4IRDA 2XCPA 4NLDA 4DQIA 5C42A 5DQIA 4CE9A 4EBEA 4KBIA 2IOCA 1Q9YA 4KI6A 3BQ0A 1BQNA 1JLGB 4TY9A 3AO1A 1X9SA 2UVRA 1RDBA 2OPQA 3HPOA 1IO2A 1QS4A 4KAZA 3GYNA 4Y2CA 2DFEA 5L1LA 2RF2A 1C0UB 1T3NA 3HPGA 4ZPBA 3CDEA 3O3HA 3V9WA 2I1RA 3UDLA 3OYNA 4KHMA 3DM2A 3CJ0A 1D5AA 3CYMA 5D3GA 1L3UA 2ZE2A 3M8PA 4B3OA 1TVRB 4ECRA 3DRSB 1DTQA 2E9TA 5DGAA 3L8BA 1RT3B 4IBNA 4CECA 3NH2A 2D3UA 3RTVA 4N5SA 3LP3A 3NL0A 3V1OA 2XRIA 1NOYA 3UR0A 2D0CA 1C1CA 4C8NA 3I8DA 3V81A 1BIUA 4OGCA 4DTNA 1LWCA 4FM1A 4CF1A 4AHUA 1U09A 4CEAA 1TKXA 3OYFA 1RTJB 1C1AA 4XPCA 5I3UA 1LWFA 3CO9A 1TV6B 4DLEA 3LDSA 1WAFA 2X6SA 4E7JA 3BGRA 4DL2A 4KO0A 5HP1A 4JV1A 3M8QA 4O3NA 1LW2B 3V1RA 2FBYA 3HPHA 2YNGB 4FLWA 1S9GB 3IS9B 1FKOA 4NLYA 3K59A 3PO4A 3KOAA 2JLEA 4O4GA 3NH0A 1WNEA 4ZHRB 1B92A 4AH9A 4EBCA 5JS1A 4CEEA 2QKKA 4Y3CA 4FJ8A 4ECXA 3H5XA 2WRMA 4B9NA 2W9BA 3P5JA 1R0AA 4CHNA 2IDOA 1NHUA 3NE6A 4F2SA 4K4YA 1BQNB 4J9RA 2ZD1A 3KLEB 3OSNA 5F8MA 3DMJA 2OPQB 2IJFA 4JV0A 3OJUA 2HHUA 2W8KA 2XGQA 3GIIA 5DG7A 2ITGA 3H08A 1JKHB 4M3RA 1RDDA 5HRRA 3TANA 2HWIA 1UOCA 4DG1A 2UVUA 4BWJA 2F8EX 4KRFA 1VSKA 3M8PB 4B3OB 2W9CA 4O3QA 2ILZA 3H2LA 4F4ZA 2F96A 3EPIA 1T8EA 3KK1B 1RYRA 4NLXA 1CZBA 2IM0A 3E51A 1YVUA 3PW2A 5KG3A 1S1TB 4J9OA 1X9MA 4TYAA 1D9FA 2R8HA 2IC3A 2P1JA 5KG4A 4LQ9A 4CHZA 3QEVA 4O4RA 1S9FA 4CGJA 4Q0BA 2VG5A 4R0EA 2QXFA 1TK8A 2VA2A 2ILYA 4EEYA 3H5YA 3SCXA 3QNNA 3BGRB 2Z1JA 2RN2A 4TY8B 5JS2A 4TQSA 3M8QB 5KG1A 1T03B 5J2MA 5HLFA 5KFMA 2HHWA 3ITHB 1NK4A 2R2UA 3QEIA 4TQRA 3HVTA 5L1JA 1O1WA 5EWGA 3QETA 1D9DA 3JSMB 4KB0A 4Z0UA 1YTUA 1VRTB 4HKQA 2R7YA 1JLBA 3MR6A 2YNHB 4HTUA 3EPGA 3L2RA 4IH5A 4JS4A 3EZUA 4DTSA 5FROA 1RT2B 3FQLA 2ZD1B 3THVA 4Z4CA 4F2RA 4BDYA 1MMLA 3PJXA 2AQ4A 3K58A 1L5UA 2FVCA 3T19A 4ECZA 1TK0A 1HMVA 5KG2A 1HNVA 2OPSB 4CJUA 2XY7A 4E7LA 1UAXA 1QSLA 5DLGA 1NK9A 4R8UA 1KCFA 4C8KA 3QINA 5KFQA 1KHVA 3MAQA 1SKWA 5J2NB 2C2RA 3U3GA 3PZPA 3DYAB 2E9ZA 4CEFA 4FS2A 3QEPA 3C6UA 2BGGA 1RA6A 3ULDA 3CIZA 4FW1A 4ELTA 4DF4A 2FC0A 1NJZA 1NJXA 3L2VA 3RWUA 4QOZB 2FVSA 3TWHA 2IC3B 5FDLB 3RAQA 4HHTA 3DLEA 4F4XA 4M3XA 4Q0BB 2VG5B 3G6YA 3PUFA 3DLHA 4RW6B 3DOLA 1U47A 2G8WA 1HJRA 1NK6A 2WOMA 4URQU 4DSFA 1ZTTA 2UUTA 3TAFA 2HNDA 5HLFB 3RMCA 3OL9A 4DWIA 1RDCA 3NAIA 5JXSA 1IKYA 4O44A 2FBVA 3QGHA 4ID5B 3LP1B 3HVTB 4B9VA 3KHRA 4NLQA 4O5BA 2ETJA 4J9QA 3MXIA 3HYFA 3KLGB 5HBMB 1T05A 3KHLA 4DTRA 4E1NA 3V4IB 4RW4A 4LSNA 3QIOA 4FZXC 4K4XA 3KTQA 4AHTA 1S0MA 1RTHB 4E7IA 1NKCA 4QWCA 4MFBB 2AGPA 3BQ2A 1EETA 1C0TA 2HNZA 4TN2A 4O0JA 3IGVA 1D8YA 4FK4A 5CYMA 3QYYA 4IRKA 4BDZA 1HMVB 2B5JA 2IMWP 2RPIA 5DMRA 3VQ4A 1BCOA 3P83D 2GUIA 1KSPA 1JXLA 4EP4A 3H4DA 4NLOA 3K5LA 2YKNB 3PJWA 5KFRA 5KFNA 4MH8A 1S1UA 4R5PA 2WONA 1RAJA 3BREA 1S0OA 3DLKB 2JC1A 2AU0A 3H98A 3C6UB 1BGXT 4KHQA 3EY1A 2VG6B 4MK8A 1MU2A 2BRLA 1XR6A 4KHNA 3V1QA 1ZBHA 1OS5A 3SPYA 4DSEA 4H4OA 3CDUA 2BE2A 1ZBFA 2GIQA 3QIPA 3Q8SB 2JC0A 5EWEA 4ZTFA 2UUWA 3NH1A 4O3SA 4BACA 1BISA 3A2FA 4F8RA 1T7PA 4I2PA 4GVMA 1REVB 2WOMB 1RILA 1TKDA 3EZ5A 3OS0A 2HNDB 1D1UA 4CGHA 5KFSA 1C1BA 4NLTA 2FVQA 3E01B 5EU7A 4CEBA 3PX0A 3VQ7A 4IQXA 3DOKB 4QW8A 4QWBA 3V6JA 3HVRA 2YHBA 4Z4IA 3DRPB 2A1SA 3KLIA 3KKSA 3SUPA 2AGOA 1DLOB 4WE1A 1XC9A 4RW4B 3KHGA 4KREA 1B9FA 2HNYA 4DFMA 1B9DA 4DL3A 4QCLA 4OVLA 4CEDA 1SV5B 2HNZB 4J9SA 3DRRA 2VA3A 3MEGA 5DK5A 1T94A 2Z1HA 5CYMB 4DL7A 5C25B 2B5JB 4Z4GA 3HP6A 4BE2A 3ZT3A 1LAWA 1EKEA 4W5NA 3OS2A 4FJ9A 4OKJA 1RT4B 4FS1A 4CCHA 1S1XA 4IFVB 4ZTJA 3CJ2A 5KTQA 1TL3B 3PR4A 4R5PB 2WONB 1SUQA 2W7PA 3OL8A 3T1AA 4M3WA 5KFUA 4FLZA 4MKBA 4CGIA 1HQUA 4E19A 3L2UA 1I39A 4LH5A 4KPYA 2BE2B 5KFCA 2Y1IA 3BSOA 2YKMA 4EYIB 3QESA 1CXQA 2KFNA 3VN5A 4N56A 5DLFA 1HQEA 3V6HA 2HAIA 1N48A 2G8VA 4C8OA 3MXMA 1SKSA 4I2PB 2KFZA 4FJIA 4NZ0A 4CK1A 4RNNA 4OPKA 3KK3A 2XHBA 1ASVA 3QO9A 3AVGA 3V9SA 1WSJA 1Z4UA 4ZPAA 3RB6A 3M9OB 4ICLA 4Y1CA 4QWDA 2C2DA 3MTKA 2ZKUA 5F8HA 4CJSA 3KK2B 5KFBA 3IRXA 3SYZA 1QAJA 3KLIB 3NGIA 3RR8A 1KTQA 2FLPA 1I3AA 4K4WA 5FRNA 2DFHA 4WE1B 1WSEA 4JRPA 3PO5A 2OPRB 4CF2A 1TQLA 3FFIB 2HNYB 1U49A 1N56A 1HPZB 3TAGA 1S6PA 1HYSB 3FRZA 4YMEA 2ASLA 1QSSA 3IGNA 4K4SA 2EHGA 1C2PA 3SPZA 2QKBA 4O0IA 3SNNA 5KFEA 2OPPA 2FBXA 1ZBUA 2R8GA 4NRTA 5J1EB 4DEZA 4Z4HA 4CIGA 4DU1A 1J5OB 1BI4A 4KV8A 3AO4A 1S1XB 2B6AA 1J53A 2IAJB 4QW9A 1TGOA 1QE1B 5SWMA 1SUQB 1IKWB 4WXWA 4ED0A 4LSLA 3G6XA 3ZT1A 3V9UA 5K14A 2JEGA 1GX5A 2AJQA 2Q3SA 5KT3A 4OKEA 2P51A 2YKMB 1ZETA 3M8SA 3G86A 1GX6A 4I7FA 3CG7A 4ZVHA 4G3IA 4KI4A 3MEEA 4EZ6A 1WN7A 4KHUA 4NLVA 3MR5A 1LWEA 3B6PA 1LW0A 1VK0A 3CFOA 2XY5A 4WFXA 3V6DB 3I0SB 3QLHB 4I2QB 4K4VA 3K5OA 4LY7A 1NJYA 3ZT0A 3SQ4A 3OYDA 3QGIA 1IH7A 2FVRA 4ICLB 3RMBA 1S6QB 4CK2A 4DL4A 1X1PA 5I42B 3CJ5A 4FJKA 4FXDA 3N6NA 2VG7A 2XY6A 3AVNA 3M9NB 3RBEA 5HRSA 2R8KA 3OYBA 1L3TA 1W0HA 3CFRA 2V4QA 3OYAA 5C42B 4DTJA 3ZSRA 4CHQA 4NLGA 3JYTA 4QPXA 1JLFA 3CM5A 2IM1A 1U04A 2R2SA 4F50A 5KG5A 4K4TA 3ZSVA 1NK7A 4ECYA 2JGUA 3OSPA 4RNHA 5L1IA 2RF2B 4CFCA 2YNIA 2GBZA 3NF7A 4EP5A 1RBTA 3DM2B 1SL1A 2OPPB 5F9LA 5D3GB 4M45A 2HHXA 4KB7A 1C6VA 1RBRA 4XPEA 2ZE2B 4FZZA 4AHCA 3AA5X 1DTQB 3NBPA 5T14A 3FQKA 4J2EA 3ASMA 4FJJA 3AA4A 3VQEA 4ELUA 4PQUA 3MF5A 3F9KA 4LSLB 3KLFA 3KLHA 3U6FA 4URSA 4WYWA 1BL3A 3T5HA 3GIJA 4FW2A 1C0MA 1RT5A 4PY5A 1C1CB 4Y34A 3V81B 3GIMA 1LWCB 4CJKA 1WSIA 4CJ5A 1TKXB 4DQRA 3MEEB 5I3UB 4BE1A 1LWFB 4NYZA 4J9LA 4QWEA 2J6TA 1BHLA 4KO0B 5HP1B 1LWEB 3DLGA 1LW0B 3VQSA 4M42A 2HVHA 4NLWA 4Q5VA 2KZZA 2WHOA 3CM6A 4CK3A 2ASDA 4B8AB 3RB3A 4K50A 4GC6A 3DLBA 1DTTA 3U3YA 3D5MA 3LWLA 1FKOB 3D45A 3RRGA 4B8CA 1IKVA 4O4GB 2VG7B 3IAYA 1NHVA 2P5GA 4TSXA 4CEZA 2KZMA 5T7BA 4ZVFA 4E89A 1RT7A 4ECQA 1JX4A 2W9BB 4C8MA 4MK9A 3CJ3A 1R0AB 3HHKA 3JYTB 1QAIA 1XHXA 4NYFA 1XI1A 3BSAA 4RW9A 3PHEA 5L9XA 1EX4A 1L3VA 2B43A 2G8IA 1XWLA 4ED8A 4IOBA 2B4JA 2ZQBA 3DMJB 4B9SA 3NF9A 2PZSA 4OLBA 3LPUA 1IM4A 2X6NA 2PYLA 5F8GA 1KRPA 3SQ2A 4O3PA 1NNDA 4DMNA 3LZIA 3LANA 4CJTA 4IG0A 4DG1B 5DG9A 3CDWA 1NKEA 1JL2A 4BDPA 3KD5E 1U48A 4ED6A 3AV9A 5KG6A 1BQMA 2W9CB 1N6QA 1NOZA 4IDKA 4EYHB 3VQDA 3L3VA 5JUMA 4MIBA 4OPJA 3WNFA 5KFDA 3TQ1A 4RNOA 3WNHA 3FSIA 3OLBA 3SUQA 4IH6A 4TYBA 3KMQA 1BIZA 5CZ1A 2HHVA 1UA1A 2VWJA 3VQAA 3OYLA 2Z1GA 4BE0A 5KT2A 3RRHA 3VQ8A 2JEFA 4IR1A 3SI8A 3OYIA 4DS5A 1VSIA 3G10A 4FJHA 1S97A 3V9ZA 5J2MB 2C28A 1ZBIA 2QE5A 2D0BA 4LD0A 2OZMA 4CJLA 4FVMA 4MQ3A 2OA8A 4FLYA 2R2RA 4PUOA 1IKVB 4DTPA 4CFBA 3RB0A 2J6UA 3VQPA 4HCCA 3PVXA 2AX0A 3ZT4A 4WFZA 1JLBB 3NGZA 3I5BA 4DSJA 4ZPCA 3S3OA 4OL8A 4RW9B 3AVIA 5KGWA 1Z26A 4CFDA 3SUNA 4E3SA 2GC8A 3KJVA 2I5JA 3RMDA 3ZT2A 5CYQA 3T3FA 1BCMA 4FK0A 2BQUA 4N41A 1HNVB 5E41A 5F8IA 3UIQA 3CVKA 1J54A 3CWJA 2BQRA 2PYJA 2C22A 4R8UB 4ELVA 3K5NA 3HT3A 1TL1A 4M95A 3EYZA 4FJMA 1N6QB 2E6LA 4DFKA 4C8LA 3HL8A 3AO5A 4DQQA 1J9AA 4Y1DA 3GV5B 4KTZA 1HNIA 5KFWA 1JLEA 3NMAA 4JS5A 4CHPA 3Q8RB 4PA1A 3MECA 2RKIA 2W9AA 4W5RA 1LV5A 3DLEB 2Y1JA 4CFAA 4HUGA 3HSTB 3DOLB 1GOCA 3ISND 4HVJA 4ZP6A 4F4KA 2D5RA 2WK4A 3HKWA 2V9WA 2YNFA 3DI6A 4CERA 4IKAA 4KFBA 1WSHA 1KLNA 3G0ZA 3S3NA 3PX4A 3LAMA 4J2BA 1K6YA 5J2QA 3M9MB 4ED2A 1S1WA 4XO0A 3NCIA 1IKYB 4O44B 2JEJA 3F73A 4DFJA 1RT1A 3AA2A 5F8LA 4Q43A 3QZ7A 5KT5A 2OZSA 2FJXA 4H4MA 2IS3A 4DQPA 4NLUA 5CZ2A 5KG0A 1T05B 1QTMA 4CHYA 5CY4A 1NKBA 4ZVGA 1TAQA 4LSNB 4NRUA 4CJRA 4E7HA 1U4BA 3TAMA 1JL1A 2XGPA 2BQ3A 2G8KA 4DSKA 4DTUA 5EDWA 1EETB 1C0TB 2E9RX 3KJVB 2W8LA 4K8XA 1VSFA 3C6TA 1Q9XA 2R8JA 2ATQA 3VA0A 3TAPA 2ATLA 1FKPA 1JLGA 1GOAA 4AHVA 4W5OA 4Q8EA 1CLQA 1YTAA 4FCYA 3LWMA 3V6KA 3OYEA 1TL1B 1W9HA 1C0UA 3K5MA 4HUEA 1S1UB 4O55A 2G8FA 4NCAA 4FJ5A 1KFSA 1JXEA 3QNOA 4F4YA 5KGXA 1ZTWA 1MU2B 1HYVA 4E0DA 3UQSA 3GV8B 1HNIB 3HO1A 4O3OA 3RMAA 1RDRA 4H4OB 1NK5A 3DRSA 4LH4A 2HHSA 2WB4A 1RBVA 3D0PA 3BJYA 1QQCA 3MECB 3QIPB 4IH7A 5KT4A 2QK9A 5KFLA 4DSLA 4M94A 3SQ0A 4JV2A 4JUZA 4RW7A 4FJ7A 1QUVA 4ZP7A 3TAEA 3DI6B 2O4IA 3DDKA 4ECSA 1RCHA 2E6MA 2F8TA 1L3SA 2R8IA 4DFPA 1LAVA 1HARA 2XC9A 3ALYA 2RDIA 4IFYA 1S1WB 1C1BB 4K4UA 2O5DA 1TV6A 1RT1B 4Q45A 1VSEA 1NK8A 4CJVA 1RYSA 2XI3A 4ZP8A 3OYJA 1S10A 1LW2A 4YR3A 5HRNA 3KLVA 2YV0X 3H40A 1X9WA 3G6VA 2YNGA 1S9GA 4ZVEA 3KMSA 4F3TA 2FJWA 3GILA 3T5KA 1QSYA 4FBTA 2QV6A 1FK9A 1RTDA 4RU9A 1A5WA 4QAGA 3DRRB 3MEGB 3AO3A 1CZ9A 3I0RA 4PWDA 3SFGA 3NDKA 3VA3A 3C6TB 5KRTA 4WFYA 4DQSA 5KI6A 4W5QA 2X74A 4B9UA 4MKAA 1FKPB 3OL7A 3VQ9A 3AVAA 3VQQA 3KLEA 3SV3A 4YR2A 4N47A 4Q8FA 4CEOA 4YNQA 2BDPA 4B9MA 2P5OA 4IG3A 4WYLA 1JKHA 1N5YA 2KQ2A 3Q8QB 3OL6A 4RNFA 5KT7A 3PW4A 1KLMA 4CIEA 2OYQA 3HM9A 1HQUB 4FLTA 1A5XA 2VWKA 3OYCA 3HJFA 4JRQA 1K1SA 1WSFA 3ZSYA 4Z4FA 4YQWA 4Q44A 3SV4A 5KFPA 5EUHA 3TI0A 3KK1A 4B9LA 4ZMMA 2WTFA 3NFAA 2XWYA 1HQEB 4IR9A 3QEWA 2HMIA 4FLVA 1S1TA 3PW7A 4JLHA 4RW7B 2IJNA 5KFOA 3I5AA 4CIFA 3O3GA 4TLRA 4F4WA 3KK3B 4H54A 2XY8A 4W5TA 3QO9B 4AHRA 4IFYB 4ECWA 5KT6A 3RAXA 1KVCA 3ZSWA 3NAHA 4K4ZA 3BR9A 3ZSXA 2FLLA 3PR5B 3QGGA 1CSJA 4TY8A 3H5SA 3OYGA 3IRXB 4CF8A 1T03A 4NLPA 3TAQA 2BANA 3N6MA 1JLAA 3SJJA 1G15A 3ITHA 3ZSOA 1S9EA 1HYZA 3WNEA 4WZQA 3NGYA 3KNAA 2HB5A 4G1QA 4AILC 1EP4A 3VQCA 5KFHA 3LAKA 1S6PB 3PX6A 1FK9B 1RTDB 1S48A 5KFIA 4J9MA 4EZ9A 1RNHA 3JSMA 3OHBA 4CEQA 4FLXA 4KHSA 1ZBLA 1JLCA 1VRTA 3T5JA 3I0RB 4CJQA 4PWDB 4UQGA 4K8ZA 2YNHA 4ECTA 4DL5A 3Q8PB 2KTQA 1VSLA 2V0NA 3GQCA 2D41A 1RT2A 3OVNA 4HUFA 3PV8A 3ZSZA 2D3ZA 4HCBA 4ED7A 4DL6A 1BI4B 4L8RB 4KV8B 3H4BA 2B6AB 3TABA 3SQ1A 3I5CA 4IG3B 3ZCMA 1N5YB 2J6SA 3OYMA 2OPSA 3VQ6A 1KLMB 2X78A 3MR3A 2V4RA 3AVMA 1SH3A 5K14B 4KTWA 4EO8A 1RBUA 1VSMA 3AVKA 3NF8A 2CJQA 4OGEA 4ZP9A 2AWZA 3CJ4A 3LPTA 5J2NA 1Y97A 3HXMA 4J9KA 5L1KA 3QIDA 1VRUA 1XR5A 4FJLA 3DYAA 4I7FB 4B08A 1U45A 3NGDA 3NKYA 2HMIB 4ECUA 1W25A 4J2DA 2JEIA 5KFVA 4XIUA 1RA7A 3ZSQA 2UVWA 3LZJA 3SZ2A 5FDLA 1WSGA 3MFIA 4ID1A 3RBDA 1F21A 4CJ3A 5DQHA 2CKWA 5J2PA 4RW6A 5KFJA 3NHGA 3WNGA 4RZRA 3QEXA 4WZMA 5KFFA 4J9PA 2BANB 1SKRA 2PY5A 1JLAB 4HYKA 4FZYA 2XO7A 3K2PA 2FBTA 1S9EB 2HHTA 2IM2A 4RNMA 3LP0A 4G1QB 1JLFB 4ID5A 3NF6A 3UPFA 1VSDA 1EP4B 3LP1A 1XR7A 5C24A 4DU4A 4FLUA 4KTQA 3V9XA 5FRMA 3LALA 5DGBA 1GOBA 1WNSA 3LP2A 3KLGA 5HBMA 2GV9A 3AVJA 1JXBA 1JLCB 3V4IA 4KHWA 3MEDA 2FJVA 2BR0A 2YNIB 4CF0A 1RTHA 4NLRA 1RTIA 4MFBA 1Q8IA 4M3ZA 4AHSA 4DTOA 3QERA 4I9LA 3AVCA 3T5LA 3NBPB 1TP7A 2IGIA 4FM2A 3S9HA 3O4QA 2W42A 4PQUB 5C5JA 3VQ5A 4X2BA 3SI6A 3KIOA 4CJWA 3KLFB 3KLHB 2DPJA 3L3UA 3NAEA 4O3RA 2YKNA 2Z1IA 3BQ1A 2OH2A 1RT5B 5DG8A 3L2WA 3DLKA 2D7SA 1VRUB 4NLSA 4QWAA 4FJGA 3RB4A 2VG6A 5SZTA 2IBKA 4M3YA 5KFXA 4ED3A 2FLNA 1S5JA 1KHWA 3DLGB 1JIHA 3CQ8A 3SUOA 5F9NA 4RUCA 1S4FA 2HVIA 1RBSA 3HVAA 5KFKA 1IKXA 3GV7B 3P1GA 4CHOA 4NCGA 2W7OA 1DTTB 5J2PB 2LSNA 4U7CA 4URGA 2GIRA 3OY9A 4MK7A 4GW6A 1TK5A 1RT6A 3OLAA 4I9QA 1REVA 4GMJB 2ASJA 4MIAA 1N4LA 4B9TA 1Z25A 1SL0A 2EC0A 4CGFA 5KRSA 2F8SA 1RT7B 1FXXA 4M3UA 2AGQA 1QHTA 1VSJA 2DY4A 1JLQA 4FYDA 3LP0B 1WAJA 3E01A 2ALZA 4KKOA 5C24B 3DOKA 3AVHA 3DRPA 4M41A 4CGDA 3LP2B 3PY8A 3MFHA 1DLOA 2A1RA 4ED1A 4J2AA 3MEDB 5KFTA 3OS1A 3L2QA 4WXOA 4E1MA 4IG0B 1S1VA 1ZYQA 1RTIB 4DTMA 1SV5A 1I6JA 1TKZA 1UA0A 1BQMB 4IRCA 2G8HA 2AX1A 1S0NA 2XI2A 4IDKB 5C25A 1YVFA 3AVBA 2DTUA 4DS4A 3IG1A 4RUAA 3TARA 5KFAA
chains in the Genus database with same CATH superfamily
3VF0B 3PRVA 1RT4A 4FF4A 3MX5A 1TL3A 1Q7YT 5ETPA 2G8UA 3AQOA 4OKKA 4KHPJ 5IQQA 3MCOA 1FNXH 3LM9A 5BPNA 4WQ4A 3D28A 4ZIVA 1BUXA 2XMWA 1OJ4A 4DR5K 3X3UA 3KNGA 3PW5A 5HROA 5IWAF 2O8CB 2EX3A 4UT4A 1X9JA 3O8MA 1YI2S 2Z2YB 2WVDA 3QWPA 2GHVC 3DU6A 4JI5J 3SCJE 4E8UA 3AD9C 3ICLA 3F5TA 4Y2AA 2DISA 1XHZA 5ETRA 1UWBA 3RAMA 3FBFA 3K57A 2KL8A 4FPIA 5F2RA 2O8FB 3BBBA 1RDAA 1NJWA 1R8AA 3SJHA 2A5XA 2P9KA 4OZ1A 3VAHA 3WXKA 4L75A 2O8EB 3OVAA 4KHRA 2HOEA 4QYZJ 3GYGA 2ZM6K 2ZGYA 2HBRB 1EXQA 2IA6A 4M3TA 4BRHA 1TKTA 3NS6A 4KKOB 4CIOA 4DSIA 1TL4A 4H4KC 1NDPA 2DNPA 5CYQB 4BRKA 1YLXA 3D2FA 1OYEA 5LXRA 3AGRA 3NWGA 3DLRA 1S1VB 2KO1A 1NU0A 1H2TZ 2XLJA 2VFUA 2XEXA 2WCXA 2KFYA 3AAQA 1SJ4P 1BOTO 4DN9A 4JI7K 1WB9A 1FF2A 3DHWC 2NQPA 1M5KC 4J5OA 2MHNA 3FDSA 2C2EA 1RKJA 3BDPA 2WW4A 1TVRA 3A13A 4FK2A 1QE1A 1RT3A 3UB5A 2BYCA 3PW0A 4F36A 2RKIB 4CI0B 2HZVA 3CF5Q 2QW9A 3H59A 4NCBA 2GIFA 3UWTA 3HLUA 4WF9L 3GFYA 5HROB 4KFBB 4J9NA 1BHNA 4ZPTR 1A5VA 3SLCA 2CQ2A 2CPHA 4FXWA 2Z4PA 2H3EB 2B8PA 3MWPA 1AUSL 4FYWB 4GC7A 2WTUA 4CNYA 3C3LA 1VQ6S 3CJSA 3PNIA 4FYXB 4FWOA 3BSCA 4KB1A 1UWBB 2DD8S 4A62A 4I6YA 4JKGB 2V2QA 4DX7A 1NDLA 4LQ3A 3H45C 4OYIA 2LQBA 4ZCKA 3THXA 4M63A 1NB2A 5AJ3K 3IS9A 3OFEA 1DY3A 1DJ0A 5I42A 4BWMA 4RBVA 2AIRB 1TKTB 1QVGR 5CABA 4IRDA 3KZBA 4NLDA 5C42A 1YBUA 5DQIA 4P2XA 2GTDA 1ZA2B 3D2FB 2BX6A 1AB8A 3BQ0A 4TY9A 4NA2A 4OHVA 2PI4A 1X9SA 2OPQA 1IO2A 3R2CJ 2ASPA 1QS4A 1B0PA 4LR8A 5L1LA 3WXLA 3HPGA 2R7QA 2M88A 4ZPBA 1O51A 1VK8A 3U27A 1YITN 3CCSS 1D5AA 5JMVA 2CQ3A 1NGEA 3ZFVA 1X4FA 5AQRA 3HSJA 1TVRB 3CJTA 3J7AP 1SJQA 2E9TA 4EUVA 1XMOK 1RT3B 4XTTA 1B0TA 5A8KB 2FY1A 2OIHA 3WUHA 4BQZA 3EVOA 4CECA 2CPZA 3W64A 2D3UA 3RTVA 4N5SA 2WSEC 2GX9A 3NL0A 4NO7A 3HHNB 2VYPA 1GNKA 3M2RA 1NOYA 4JI3K 2YWWA 1RHMB 2D0CA 1X5TA 4MDBA 3MEKA 2KHCA 4FM1A 3NCPA 2O8BA 5I3UA 1GMWA 4P71A 1TV6B 1QVFM 1WAFA 4A5AA 1LXJA 4E7JA 1RU1A 4DL2A 1U1PA 4CLZA 3RRKA 3LPEA 3M8QA 2JLGA 1QAYA 5HK4A 3T41A 1CVJA 3V1RA 1TL7A 5H9EJ 4DU8A 3THXB 3A12A 3TZYA 4FLWA 3IS9B 5IXUA 3A5OC 3PO4A 3B54A 3NEKA 5BPMA 2BKOA 2ZZNA 1B92A 3LDOA 3P49B 5JS1A 2EK1A 4Y3CA 5LL6Z 1DQAA 4U9RA 2WSCC 4YOEA 1R0AA 1NHUA 2A6MA 4JV5K 3DMJA 2OPQB 1SJ1A 2DITA 2C3UA 2HHUA 2XGQA 3BYRA 3H08A 3KDNA 4M3RA 3J80O 5HRRA 2HWIA 4JKFA 3R7SB 2OTJS 2LA4A 1VC5A 2F8EX 1A6LA 1N34J 2ILZA 3H2LA 2ZDPA 2PMZD 4C1NK 2CJAA 2XZDB 4ETXA 2IM0A 3WIVA 4J9OA 5B0EA 2DNLA 2PBDA 2R8HA 3GFZA 3M2RB 1OY6A 4JI7F 3CPEA 3RUBL 3SAHA 4C7QA 4O4RA 2G9OA 1IBLJ 4Q0BA 1IJFB 3SDEA 3M3ZA 3N4QA 2F9TA 2ILYA 5CZVA 4CZCA 1ZPVA 4TQSA 3M8QB 3B8HA 4DUZK 1P9YA 4ZVRB 2CQBA 4A8FA 2R2UA 3QEIA 3NNAA 3WQTA 2A2DA 4DR4J 4TQRA 2ZBRA 2YXLA 3A5MC 3BO2A 3JAMU 4UF4A 1X60A 3MR6A 1B70B 4HTUA 3L2RA 4GKKK 3HSGA 3J81O 5FROA 4EFHA 2ZJQL 1BE4A 1AA1B 1T95A 3UN3A 2HFVA 4CZIA 2QZ8A 3B4MA 3N5FA 1T9TA 4C3KA 4ZVUB 4GRSA 3PJXA 4FWKA 3K58A 1HR0K 2FVCA 5ELZA 1S7HA 4AQYF 1HMVA 3G25A 5AQLA 3ZZUA 4H4KA 4HACA 2GWKA 2YHXA 1QSLA 2NCKL 3BB5A 3DGVA 1KCFA 1FRKA 4PKHA 3CJ1A 3GJRB 3N28A 5KFQA 5GADU 4BRQA 4OYAA 2N7CA 3PZPA 2J7UA 1Q82T 3T1YK 2E9ZA 3C6UA 1U2VA 3I82A 3CD0A 3ULDA 5DRKA 3M2UA 1YJTA 4ELTA 3RWUA 1NJXA 3L2VA 3R5DA 4NXNK 4QOZB 2FVSA 4ZLJA 4AL7A 5LL6d 4HHTA 4YS2A 2E1CA 3DLEA 2VKRA 4M3XA 4Q0BB 3SDEB 3G6YA 4PG5A 3NLCA 3A1YG 2CQGA 2CVIA 2EFVA 2VF3A 1H2UX 1IJEB 3GDQA 2RVJA 3M7VA 1U2FA 4FKXA 4C23A 3RMCA 1DRZA 1RDCA 2ZUAA 1FKAF 2NNWA 3S6EA 4ZJOA 4ID5B 1GTHA 3LP1B 1SI9A 2P9GA 2RIJA 4B9VA 3ZZYA 4J9QA 1T44A 3MXIA 5HQMA 4E1NA 1ZA1B 4NB4A 4AHTA 1S0MA 2GZOA 3ZNJ1 4AUKA 4MFBB 2QIFA 1C0TA 4KYZA 2QT7A 1REGX 2UU9K 3IGVA 4GV6A 4DR7F 1HMVB 4HACB 5CZXA 3TJAA 3R9PA 4PKGA 1Q8KA 1KSPA 2M52A 4X64F 4EP4A 4NLOA 3I56S 3K5LA 4LFAF 1VQLN 5KFNA 5KFRA 2HS4A 3EE8A 3T69A 1FFWB 1RAJA 2OD6A 8ATCB 1PYSB 3H98A 4EFAC 3C6UB 1PCAA 1P8ZA 1U2VB 4JI6J 2ZH6A 4M5LA 2QC3A 4KHNA 1HIYA 3LPYA 1Y4ZB 3CDUA 2ZC3A 2OFGX 2GIQA 3QIPA 2HHHJ 3BGUA 2YKQA 3ZTOA 5EWEA 3QSIA 5BXIA 5JJBA 4CBXA 1D8ZA 4OYOA 4I2PA 4GVMA 1RILA 2E2PA 2JWNA 2B7CB 3CF5L 2B4VA 4ZVSB 1VQ8N 1C1BA 4NLTA 4QS8A 1S12A 3GU0A 3PX0A 4CEBA 4QWBA 1JJCB 3GB0A 2A1SA 3KKSA 2AGOA 4DU7A 4WE1A 1XC9A 3CEDA 4KREA 2XTJP 4LFBJ 1YITS 3D3CJ 1FE0A 4J9SA 4BR0A 3DRRA 5E0OA 3MEGA 4ZKAA 4LRAA 1X4HA 3OPKA 2Z1HA 2P9NA 3CCUS 1FW6A 5C25B 1FXDA 1ZBTA 4HI2A 4Z4GA 4X4RA 2GEMA 3TYTA 4BE2A 3ONQA 3E2EA 5KQ8A 3RJMB 1HBOA 3M32B 3EXYA 4OKJA 2J8AA 3GJQB 1S1XA 3QT7A 2Q1NA 3EL2A 4I6MA 1SUQA 2W7PA 3NXZA 2PMWA 1HNZJ 4KY3A 1NSPA 3W3SA 1HQUA 1H73A 2MEWA 2XWXA 1K73O 1I39A 3S8SA 3NMUA 1JB0C 1M1KO 2VONA 2ALYB 1CJTA 4N56A 5DLFA 4JI1J 3V6HA 3MN6A 3OFGA 1F9FA 1EQYA 5AQJA 2G8VA 4DV0K 4I2PB 2KFZA 4FJIA 3SXLA 2GWJA 4OPKA 3KK3A 2XLIA 4JI8F 1ASVA 1Z4UA 3RB6A 4ICLA 1IN0A 4Y1CA 1NJIT 4QWDA 2C2DA 1KAYA 2FZGB 2L3MA 3NGUA 3N5BA 3KK2B 3W7BA 3VGMA 3Q89A 3VEYA 5FRNA 4WE1B 3JTPA 1WSEA 1YG0A 2L41A 1SC3B 4JRPA 1UWAA 2ASYA 2W1BA 1N56A 1NLVA 3OT9A 4X62K 2NZ4A 1NRKA 2ASLA 2RQKA 4K4SA 4RUBA 3R1XA 3SPZA 1G4CA 4F3MA 4IO8A 2QKBA 2W2PP 4NRTA 5J1EB 5KAKA 4DU1A 1J5OB 1BI4A 1NWKA 5LOQA 3LL3A 1S1XB 2IAJB 1N36K 4I6MB 1SUQB 1WUUA 1V3ZA 4ZLLA 3EE9A 2NUHA 3BBFA 4WTYA 2N3OA 4O5FA 4DUTA 2UU9F 1N0UA 3T9NA 3ZT1A 3KXDA 4OZ2A 2Q3SA 1KXPA 4OO1J 4EIAA 4OKEA 1RTZA 1H0HB 3S41A 3M8SA 1NXIA 4I7FA 2ZVIA 1HHQA 4KI4A 3O4WA 4DHYA 2H48B 1FTCA 1LW0A 2GVDB 2DNYA 2P9UA 4YOUA 2XY5A 3I0SB 4I2QB 2B8QA 2CJBA 4LY7A 4ZA1A 3SQ4A 3QGIA 3OBWA 1SB6A 4ICLB 1WC3A 3RMBA 1MDUB 5IM0A 1S6QB 5IT9O 1X1PA 4ZDNA 4BR2A 2XY6A 2MJUA 3CCEN 4U67Q 1L3TA 3CFRA 5L39A 2V4QA 3SMSA 3VALA 4CHQA 2QTDA 3L7UA 3JYTA 4EGLA 1JLFA 2B0GA 4F50A 3ZSVA 1URNA 4ECYA 4Y65A 1NPPA 3OSPA 2DCLA 1NGGA 1VDHA 4DV7F 4CFCA 5J1PA 3NF7A 4EP5A 4PPZA 3DM2B 1SL1A 1LK7A 3M8YA 4M45A 2OANA 2R7VA 1H72C 5SUHA 4XPEA 2ZE2B 3H1VX 2C2MB 3OVBA 2MYFA 4FJJA 3AA4A 1SBRA 3SIPB 2HK2A 3MF5A 3M1FA 5LMNF 1CJUB 3KLHA 3U6FA 2FSJA 1BL3A 1RT5A 4B3RK 3KUGA 4Y34A 1R59O 3A3NB 5LM7E 4CT9A 1LWCB 3GCWP 4FPAA 4CJ5A 1JWWA 1LWFB 4NYZA 4QWEA 3ILJA 2J6TA 4KO0B 1LW0B 1KC8T 2ZM6J 2YHWA 3CCVN 5BYRA 1VQMN 2WHOA 2VU5A 3GZ7A 4B8AB 4K50A 3DLBA 4A8XA 3P39A 4QJVA 2HPUA 3D5MA 3FGVA 1U0HA 1NB7A 4P74A 3O9UA 3MUMP 1NBWA 4CEZA 5GIOA 2W4CA 3MUTP 2LQ8A 4ECQA 3L3CA 1TUVA 4MK9A 3JYTB 1QAIA 2GJ2A 4TU7A 1XHXA 3C65A 2VUGA 3VV2B 2H5EA 1L3VA 4JI7J 1XWLA 2IMOA 4DR6K 4IOBA 2B4JA 2WC9A 4WK3A 3S1TA 3NF9A 2PZSA 1VQLS 3BH6B 2PYLA 5F8GA 3CPWR 4A8QA 4C0HA 4MMOA 3SQ2A 2OSRA 4PKDB 3BEGB 3LANA 4DG1B 5DG9A 3KJQB 1WG4A 2XS2A 1JL2A 4ILJA 2VPZB 2W9CB 1N6QA 1NOZA 2D9PA 2JFKA 1SCJB 3AA8A 4KPCA 3VQDA 3PLAA 2XS7A 3L3VA 3HFVA 1JJ2M 1SIZA 1NM1A 4FVUA 5IC6B 3BF3A 4L3QA 1Q0NA 4RNOA 3HSCA 3VAKA 2UXCK 3FSIA 3BN7A 4LRFA 3FZ2A 3MM9A 3SUQA 2EFQA 3KMQA 4C48A 5CZ1A 1UA1A 2DRDA 3AT1B 3GL1A 4BE0A 1VBXA 1H2VZ 3OYIA 2AA4A 4C11A 1UFKA 2MZQA 5AJ3J 4LF7K 1UL3A 3V9ZA 1VQON 1N36F 2NZCA 5IOLA 2RDDA 4WQ5C 4NEYA 3THPA 3PEJA 5M1FA 5BR8K 4FVMA 4CLKA 3RGIA 1QVFR 4KGZB 2DHSA 4ATNA 4HCCA 1VR6A 1RI7A 2DGQA 3PVXA 2AX0A 4WFZA 2C2ZB 1XTZA 1JLBB 4DPTA 3NGZA 4ZPCA 5D4LA 4CLPA 3QICA 5JICA 1UCNA 2VCPA 2VQEK 3VF6A 2HK3A 4E3SA 2GC8A 4RX6A 1X4EA 3ZT2A 3T3FA 5IT0A 2UZAA 2CWKA 4NPOA 3W8PA 2FGOA 1HNVB 4GV3A 1Q81O 3AOAA 2VJVA 3CWJA 2BQRA 2PYJA 2C22A 3LUYA 4R8UB 5AQWA 1U2RA 1N6QB 2YWHA 4KGKA 3MM6A 3JXOA 2J7KA 3BR8A 4C8LA 4JI3J 2MMYA 3RW7A 1J9AA 2ZF5O 5ETTA 2Y1RI 4M7YA 3NMAA 3JAMY 3MM9B 4CHPA 3Q8RB 4M5KA 3QAUA 2ZVSA 2FJAB 2KXHA 2RUSA 4ZP6A 1QQMA 1YF5L 2YNFA 4C11B 2PMHA 3S3NA 3LAMA 5J2QA 3M9MB 5T7LA 3F73A 4O44B 2Y1LB 2A3JA 1RT1A 2E2OA 5F8LA 5FIIA 4CLTA 5KT5A 4H4MA 4B3RF 1P27B 2FC8A 1U26A 3TX8A 5CCLA 1T05B 1AROP 1T6CA 2FIUA 4NMXA 4JV5J 4ZVGA 3PEHA 1JL1A 4CJ7A 2BQ3A 3CCZA 1HHTP 2OMOA 5I9EB 5EDWA 5F41A 3OXGA 4K8XA 5AZJA 4ZVTB 2VQFK 1FRLA 1WSRA 3BDEA 2F1FA 1VSFA 3THYA 1Q9XA 1RISA 3VA0A 2GMHA 3TAPA 4WP9A 2ATLA 1U6BA 3TVZA 3RBXA 1OPZA 4X4UA 4HH1A 1CLQA 2FHJD 3PKYA 1IWGA 3FEZA 4BROA 1W9HA 3BS9A 4OI1A 3R6MA 1S1UB 4E1JA 1XC3A 3ETOA 2LDIA 1VBYA 4FJ5A 5KGXA 1VQ5N 1MU2B 1HYVA 3GTYX 4E0DA 2X3GA 2ZHOA 3GV8B 3HO1A 3DRSA 5I4MA 2HHSA 4MKYA 1QQCA 5KT4A 3HD1A 2QK9A 3SCIE 4M94A 3SQ0A 4UY8T 3TUPA 4DUZJ 3JTNA 2ZH4A 1SJFA 2VKZG 3WC0A 2O4IA 3CCES 2P9SA 3O1LA 2OP5A 4ECSA 1L3SA 2ZOGA 4DFPA 3TOQA 3ALYA 2WBMA 3UE2A 2RDIA 3DN9A 4W92B 1RT1B 5TKWA 1NK8A 1RWXB 2NYIA 2GX8A 4GKKJ 2XI3A 4ZP8A 3OYJA 3B8AX 5CHIA 5E3RA 5HRNA 1Y64A 1TFWA 2NXUA 4PABA 2Q6CA 5B08A 4MO4A 3J81j 4AE5A 1HR0J 3BKUA 1K47A 1WC1A 2ZOMA 2QV6A 4JK7A 3ZC4A 4GVBA 1ZAXA 2QGFB 1CZ9A 3I0RA 4PWDA 3THYB 4P52A 2OI2A 3RBZA 5FLXO 3EEQA 1K8AT 4MKAA 3OL7A 3VQ9A 4U67L 1Q7YO 3TWZA 4N47A 3T1YJ 3Q2TC 3B6BA 2DPNA 3R8EA 1VYAA 3CD5A 1AFJA 2M5YA 3PHTA 4WYLA 3CC4N 2PI5A 3Q8QB 4DBQA 5E33A 3PW4A 3G8QA 1KAZA 5D0EA 3CO0P 3CD7A 3HI9A 3RG6A 4JRQA 1K1SA 1HD1A 2HYIB 3MGJA 4PHTX 4Q44A 3SV4A 4CM0A 3QB0A 4BRNA 3QFPA 4ZMMA 2XWYA 2XYHB 2LFVA 4IR9A 2WVCA 1S1TA 3PW7A 4JLHA 4IO1A 2HS3A 2DXDA 3I5AA 4CIFA 2P9SB 2FZKB 1RCXB 3QFWA 4W5TA 3QO9B 3DWLA 3HHLC 2YCHA 4WKRA 4AHRA 4ECWA 3RAXA 3NGRA 2Q6BA 3NAHA 3KKFA 3CJ8A 4K4ZA 4FWSA 1CSJA 4TY8A 2XNQA 3L4BC 4GKJF 3MMBA 4NLPA 3N6MA 3AXMA 4K59A 1JLAA 5U47A 1TUYA 2FZCB 3G8SA 3SJJA 3ITHA 3O9TA 5AXNA 4MO5A 3ZSOA 4L73A 1ZM9A 2UU9J 2X7IA 4NEZA 5F0UA 3ZETA 3LAKA 2BH1A 2JHEA 2Z2ZA 3PX6A 3O1BA 4GVBB 5HMWA 2NYHA 1AUDA 3VGKA 3T5JA 3I0RB 4CJQA 4PWDB 2LCWA 4K8ZA 4DL5A 3Q2SC 1VSLA 3OFHA 3H3OB 3OVNA 8AT1B 2POKA 1X31C 2D3ZA 4ED7A 4OYZA 4L8RB 2AT1B 4KV8B 1XUPO 2HAFA 3TABA 1YTYA 2UUAF 2EW9A 2J6SA 3OYMA 1Q86T 4QIWD 3VQ6A 1AYEA 4C2MA 1X0FA 2VQFF 3NNHA 1NSKL 2E5JA 5IT9U 3AVKA 4FF3A 4OGEA 1G2EA 1APSA 3CJ4A 2MXYA 5L1KA 3QIDA 4I1TA 4LF4K 4B08A 1CULA 2B4OA 3UVJB 2CZVC 1FDAA 3MMAA 1FJCA 1FJEB 2F4VK 4C8ZA 1YIJN 2VFTA 4XIUA 1GH8A 2HGNA 3ZSQA 3KUHA 3SZ2A 5FDLA 5DQHA 2CKWA 2HF4A 2MQOA 4RW6A 1T3OA 3D1QA 4OV6A 4WZMA 3MMBB 5KFFA 4J9PA 1IVZA 2PY5A 5B0DA 1JLAB 2FBTA 3CXCM 4RNMA 3LP0A 3D3BJ 2OEJA 5CQGA 2EBEA 2AYEA 3UPFA 1XR7A 5C24A 1MWYA 3H8YA 3Q24A 4QIFA 2BE7D 1GOBA 1WNSA 1XMQF 2HFOA 3P3DA 1ZC6A 2WVFA 5D0RA 3IWLA 2EI5A 1W2BM 3G96A 3C16B 2UP1A 2O8DA 3UCGA 4AHSA 3QERA 4X84A 1N54B 2KT3A 3T5LA 4OYPA 3NBPB 3VCDA 2DRAA 3UI3A 1O13A 4WJBA 2CNKB 1TP7A 4FM2A 3EKUA 3FZMA 3P6YC 5AT1B 4PQUB 4I6WA 4PR6A 2G1DA 3KLFB 2AEJA 2VBZA 2BTFA 3MCAB 1GXLA 5CHCB 4DHVA 2ZWOA 1NDKA 5ITHA 4MLEA 2FPHX 3L2WA 5GAEP 2D7SA 4FJGA 2ZOFA 1IG8A 3MMAB 4M3YA 4DR1F 4UOHA 4ED3A 1S5JA 3HDSA 3U8XA 3CQ8A 4ILHA 3SUOA 5DO2A 1SQEA 3GBTA 4BR4A 2MZRA 3HVAA 3H42A 5GADP 2GHPA 3GLJA 4CHOA 4NCGA 1YRXA 5ETVA 2DCUB 4U7CA 2CPJA 1TK5A 3O9SA 4OI3A 4O8UA 2DRBA 1REVA 4MIAA 1VHXA 2EEYA 1Z25A 2V51B 1LXNA 1PG5B 4X62J 1RT7B 1FXXA 4PWUA 3OXFA 1VSJA 2DT9A 3LP0B 1WAJA 3E01A 2BE9B 5C24B 4DPOA 3PRBA 4M41A 4IJAA 3P31A 1DLOA 4OYXA 4ED1A 4JI0K 1OQ3A 2RQCA 3IFEA 2Q1LA 4WXOA 3AGKA 1OH5A 3LTOA 4OZNA 1ZYQA 1N36J 3EM1A 3C7NB 4Y2MA 1CC8A 2IBOA 3EVMA 1B3TA 1VQ5S 4DTMA 2PFUA 2O8DB 2FTRA 4I64A 1BQMB 1CC7A 4IRCA 4BRAA 2AX1A 1LK5A 4AT1B 5FJ4A 4TNOA 4DS4A 1VQ9S 5KFAA 3EGZA 4D3HA 1T02A 4KQZA 4U6PA 4KE5A 3FMWA 4ZIWA 5D8HB 1S4EA 2Z0GA 3GSIA 1HRHA 1XNQF 1S49A 5KG7A 3BSNA 2FF6A 3AA3A 3OJSA 1ZXOA 1VSHA 2BW7A 5G0RA 1F5CA 3R1HA 2HW3A 2ROPA 3OA9A 4NCGB 1WWHA 2W2OP 4PUOB 5EXWA 5H1SV 2P9PB 2KG0A 2GJIA 4XAKA 4LF4F 1NK0A 3OTBA 4UOFA 4QQBA 1YT3A 1RCOB 1OY8A 3LQVA 5LY3A 2ZJPQ 3Q8UA 5MLCQ 3HHLA 2RS2A 4Z4EA 4OLAA 1FXRA 1VQSA 4ZCIA 3I33A 3L6QA 2ZWPA 3CC4S 1FERA 3PYDA 2G0CA 4PYDA 3GWCA 3FFIA 3F44A 1ASUA 4KAIA 4RO0A 1HPZA 2LP4A 4UOGA 1HYSA 1Q82O 4OJRA 3AAPA 3I4HX 4XH4A 2CJKA 4K2XA 1HWLA 5JMNA 1EWRA 2Q97A 4B3RJ 4OX9F 1I1GA 1KVBA 1UPPA 1JLEB 3KD1E 4H0OA 2K1RB 2V68A 5FPNA 1JJ2R 4KSEB 2V8GA 4OJGA 4DZ6A 1RAOA 3LM2A 2DGSA 4FBUA 4ISFA 3ZTPA 2LU2A 3HP9A 1TR0A 3VQBA 2DPIA 4YR0A 4FJNA 5D77A 4A8OA 1CXUA 3HVWA 5G0RB 3GJTB 4BRLA 1HBUA 3HOSA 3NWRA 2UXDF 2YHAA 4ES2A 1E6YA 1TMJA 2E7VA 4XDCA 2XHWA 1CG2A 2D4WA 2XNRA 3V6DA 4DR2K 2HFSA 1VQNN 4DR6J 4G9ZA 3U1NA 2CA9A 3EGVA 1WHXA 3MM5A 4KBIA 4OZJA 1Q9YA 4KI6A 1BQNA 1JLGB 3KWGA 6AT1B 1GXTA 4JI4K 3GP9A 2UVRA 5I3PA 3UN2A 1N5QA 5AR0A 1T3NA 1C0UB 3KG1A 2V4JA 2CPYA 2VGNA 5EX0A 3V9WA 3ZLJA 3CUNA 3OYNA 3CJ0A 2JX2A 3CYMA 5D3GA 2Y8WA 3HI0A 4DN0A 1EJ7L 2G13A 4ZVQB 1BY9A 1YIJS 4ECRA 2WB1D 1DTQA 5DGAA 4DUYF 1JCEA 4IBNA 2D1KA 3W2WB 4KC5A 4LF7J 2KM8B 1JMTA 3M5RA 2M70A 4MYUA 4H0VB 4FWRA 5BR8J 1FESA 3UR0A 1C1CA 3WBZA 2QO3A 3MCMA 3MN7A 2GNKA 4CF1A 4AHUA 2NREA 1V4TA 4BRIA 1TKXA 1FRIA 1C1AA 4XPCA 1X7VA 2Z2LA 4MDAA 2ZH3A 2X6SA 5C2FA 1IBKF 2B9XA 5HP1A 5FLXU 1YJUA 4JV1A 2VQEJ 4DZDA 1R0BG 4Y2IA 4JHDA 1FA0A 2V2VA 4HDHA 3JSRA 5HMYA 2FBYA 4C9DA 3KWIA 3HZGA 4PG7A 1S9GB 4NLYA 5M1PA 3K59A 1PGZA 1IR2A 7FD1A 1EQMA 3NH0A 1IBMF 4FJ8A 1UVMA 1HNXF 2ZKTA 4MJKA 4B9NA 3QAEA 4CHNA 1K9MT 1Z1ZA 4WWSA 2ZNZA 4F2SA 2NRTA 3P38A 1BQNB 2ZD1A 2HVZA 2IY5B 1LFPA 2GVZB 1CEZA 2IJFA 1CPZA 2Q0RA 3ZX3A 4JV0A 2QLJB 3PSFA 4DV3K 3OJUA 5DG7A 2F63A 2JWLA 4MYTA 3TANA 4HT5A 2DH9A 4GKJJ 1VQ4N 4WP3A 4KRFA 1WKKA 5AQMA 4F25A 2XG8A 2M4MA 4O3QA 2N4DA 2XO6A 2VASA 3AD7C 4KGXB 1MWZA 1GLAG 2PSZA 2L9NA 1X9MA 4TYAA 1K8KA 1S57A 1T9YA 2IC3A 2P1JA 1M1HA 3QEVA 5F3TA 3A8IA 1LOTB 3L7PA 5M1QA 3VEZA 2VG5A 2QXFA 1TK8A 2HQ3A 1VBZA 2UUAJ 1C4AA 2Z1JA 4A8SA 1VGYA 2R7SA 3NOGA 1ZPWX 2Y0BB 2P6TA 5KFMA 1WEXA 1Y0HA 4LVNP 3R97A 4FNIA 2VQFJ 1JNZB 4EI2A 3U9DA 2BM0A 1D9DA 4M1KA 4KB0A 4HKQA 3O6QA 4LF5K 3IR6B 3EPGA 2RE1A 3R5BA 2H65B 1RT2B 3FQLA 2ZD1B 4LFCK 5AQTA 4DV2K 4KT0C 4DR2F 4F2RA 4BDYA 5JLFA 3SMZA 4FNHA 4K8RA 2AQ4A 2PFDA 3T19A 1GMWD 2W7AA 2OPSB 2DK2A 3HJVA 2LVWA 4C97A 2L9DA 1S7IA 5DLGA 2R9LA 1NK9A 4A8KA 3MK6A 3VESA 2DGUA 1GXUA 5EHHA 4A5BA 4BC3A 3MAQA 1IR1A 4QU6A 2C2RA 2UXBK 4JYAK 3DYAB 2BGGA 3BZKA 2DEIA 1A9NB 3MAAB 2PEBA 1KD1T 2L48A 4FW1A 2FC0A 1NJZA 3V5RA 4WFNQ 2DY9A 3MTJA 3UFCX 2IC3B 3RAQA 5AQOA 1IQZA 1KVKA 3QATA 1P1TA 2VG5B 3PUFA 3DLHA 5A8RA 3DOLA 3G82B 1HX1A 4YHHK 4U95A 2MQMA 4URQU 2UUTA 4LF6K 4OV1A 1T3VA 3TUZC 3HF5A 1R8HA 3A8EA 3Q8YA 3NAIA 5JXSA 2MKKA 3W2VA 1IKYA 4B3TF 5L38A 4C6AA 3W62A 2YWGA 2FBVA 5M2RA 3KHRA 4NLQA 1KVJA 1TZ0A 5IT9Y 5HBMB 2YTCA 2RU9A 2ZITA 3TQEA 4YDUC 1Y5IB 5EVZA 4LSNA 1FT8A 3QFHA 4DR1J 3QIOA 3KTQA 2QX0A 5IC4B 1RTHB 4CTAA 3EWGA 1NKCA 4QWCA 3BGLA 2AGPA 1KS2A 3BQ2A 2HNZA 4TN2A 2CH5A 2AV5A 4FK4A 4JK9A 1NUEA 3QYYA 2V8VA 3IRWP 4BDZA 1HI1A 1P8GA 1S0VA 1QTNB 2ZJPL 5DMRA 2M0GB 1WSVA 1X5PA 2AHOB 1U1QA 2JWKA 3BN4A 4YB5A 3PJWA 5AQNA 4OZ5A 3A8JA 2VC1A 3BREA 1S0OA 2B56A 2JC1A 1KC8O 3DNCA 4MK8A 2BRLA 3THTA 3V1QA 3SPYA 1KOHA 4H4OA 3D0GE 3WZ0A 4USMA 3D67A 1OVQA 5C2GA 1VQNS 1KQSM 4ZTFA 3NH1A 2K3KA 1ULRA 2IFXA 3WHIA 3DOMB 4F8RA 3TX0A 1I94F 2B9YA 1JNRB 1PBUA 1U2CA 3BBCA 4CGHA 5M1NA 5KFSA 1KKHA 2DNNA 4CBWA 4IQXA 2AYGA 3HVRA 4Z4IA 2YHBA 3DRPB 2DNZA 2V2ZA 4MT1A 4WFBQ 3CXCR 4F04B 2NLWA 1HD0A 3ILIA 1XNQJ 3KHGA 1UP1A 2BABA 4EHUA 2RHKA 1KTVA 2KJVA 2XULA 2DO4A 2Q43A 2A40A 4CEDA 2V6AA 1SV5B 2DHAA 1P1LA 2J76E 3AY0A 2HNZB 1DAXA 5DK5A 2VA3A 3HHEA 1R8CA 2CRLA 3ENOA 4OX6A 1W2BR 5A76A 5LT5A 1RWVB 1ZAWA 2DHXA 3ZT3A 3EVWA 2ZDOA 4LF4J 2J7WA 3OS2A 3Q8VA 4L72B 1SQGA 3VQTA 4FS1A 4CCHA 4WP8A 4IFVB 2V7YA 2MQ8A 3K9JA 2F4VJ 3NP5A 5FPEA 3ID6A 2EFNA 4LFCF 2O3DA 4YOWA 1WKLA 2P6SA 4E19A 5L8RC 2J0XA 2B9EA 2X1GA 3P5TL 1T9XA 2RB7A 1O5JA 4EYIB 5IS2A 2GHWA 2DGXA 2QWLA 1HQEA 2HQGA 2LEPA 4C8OA 1ZS6A 4P7VA 3C0BA 1N5TA 3V4MA 4CK1A 4RNNA 4JYAF 3V9SA 4LRBA 3DAWA 5GAEI 4ZPAA 2MKIA 1Z05A 4LBIA 4QPTA 1WOPA 4CJSA 5KFBA 1YI2N 3NGIA 3UKUA 4USIA 5A0YA 2DFHA 2XHCA 4C3MA 4UY85 2FGCA 1HLWA 4BC5A 2OPRB 4DPYA 1RP5A 1TQLA 4YHHF 1F9HA 2VHGA 2A6AA 1RWOB 1S6PA 3HKZD 3LDLA 1VQ4S 4LF6F 3N9UC 4YMEA 3KVGA 3IGNA 2EHGA 1C2PA 3ZZPA 5J1NA 1DBDA 4O0IA 1WI8A 3D68A 3PRDA 2QLBB 1ZBUA 4DEZA 3CETA 4Z4HA 4LF1A 2RMLA 3A5NC 4DPUA 2LQ5A 3QDKA 3OR2B 4BBYA 3DLLQ 2B6AA 1J53A 2P9EA 2VBYA 5SWMA 1IKWB 1SC4B 4KGMA 2C2NA 4IJNA 2MB0B 5FPDA 1GTEA 2CADA 2A18A 5LMUK 1PC5A 2WSFC 3ET6A 4JKCA 2XMMA 6FDRA 3V9UA 2X51A 2G2YA 4YY3K 4A47A 1Q5VA 2XSJA 4NLBA 3ENAA 1MWQA 1ZETA 3FFKB 1GX6A 5HJXA 4ZVHA 4DL0C 3MEEA 4KHUA 4FWMA 3VF4A 5H9FK 1LWEA 3CFOA 3E8OA 3HT0A 2H54B 3QLHB 3K5OA 1H7XA 1FRJA 3ZT0A 4ITSA 1KWMA 1HWKA 1C0FA 4DL4A 3N6NA 2VG7A 3M9NB 1U7LA 3RBEA 5HRSA 3RVCA 2R8KA 3K0SA 3M2VA 4DUYJ 3O9QA 2D9OA 4DTJA 1BA0A 4M5DB 3UO0A 2DGTA 4QPXA 2NR0A 3CM5A 3VAFA 1RDUA 4HH0A 2R2SA 3I8BA 5KG5A 1MROA 1NK7A 4W98A 4RNHA 5L1IA 2RF2B 1H3DA 1AW0A 2YNIA 5M2UA 2HQIA 4ED5A 1IBKJ 1OSCA 5B0GA 4YDUA 2HHXA 2MKJA 4CYUB 4UY8O 2GQ2A 2CGLA 3AA5X 3MXHP 1XN9A 2YVSA 5T14A 2KKZA 3VGSA 3VETA 1IBMJ 5D78A 2QI2A 4WYWA 1HNXJ 3MPYA 4DR4F 4BVPA 4FW2A 5CA5A 5BR9A 4PY5A 1X8DA 2XSJB 3V81B 1ICEB 4V1Ak 1LKZA 2YBVA 2VDHA 3AB4B 4DQRA 3ILLA 3MEEB 2CWXA 2OUGA 4J9LA 2NRVA 4V19J 2BJ1A 1BHLA 4M63C 1LWEB 4CH0S 3G87A 3VQSA 4NLWA 5AQFA 3D66A 2XB2D 4TU9A 2KZZA 3SSSA 3O6WA 3OTOK 3RB3A 3AAWB 2L9WA 3LWLA 1FKOB 4WFNL 3RRGA 4B8CA 1IKVA 4O4GB 2VG7B 3IAYA 1K8AO 2P5GA 1E6VB 3L95X 2KZMA 1FJGK 5T7BA 3C66A 4E89A 3SCLE 3IWNC 2MLYA 1JX4A 2W9BB 4NYFA 2HURA 2CFXA 1PYTA 5L9XA 4IOCQ 1EX4A 2B43A 2G8IA 4KH6A 1MROB 2VD3A 4OLBA 1NO8A 1VQYA 2UUBK 2X6NA 3DXSX 3QRRA 4DV6K 4O3PA 1CJKA 1WOQA 1NNDA 4NLCA 2MKYA 4NZ7A 4CJTA 4IG0A 4N8NA 3CDWA 3M1VB 5FLXY 3AV9A 5M2PA 3D0HE 4JBCA 2EPIA 4KH4A 3DFEA 2V9KA 4PXCA 1M0SA 2YX6A 2AF6A 1RGIA 4IDKA 2E1PA 4EYHB 5B09A 3WXIA 4MIBA 4OPJA 3ZTQA 3WNFA 4DR3K 5KFDA 3WNHA 1KBRA 1X0PA 3GFHA 1YJ9N 1F0XA 2J8SA 1WTBA 4DR2J 3OYLA 2Z1GA 3G4SN 3ETMA 4J90A 1HJOA 3CQXA 3VGUA 3VEOA 2FJBB 5J2MB 2C28A 1ZZNA 3BY5A 2QE5A 1R8BA 3TRGA 1XNRK 3L0QA 1YVNA 2OA8A 2V5HG 1FCAA 4LC9B 1IKVB 1KAXA 1NU4A 3G71N 4DOZA 4ILRA 4CFBA 1SJ3P 3ZT4A 3FBBA 1YK9A 4JI4J 1KNZA 2QWRA 2ITMA 2O8EA 2RS8A 2N3LA 2YKAA 1UW9A 2CNLB 1ZZFA 1V5VA 4Q7AA 4E98A 3SUNA 2ZH9A 5HVFA 2VC0A 3K2YA 1WHWA 3HZ6A 4JKBA 4NXMK 3KJVA 3LO3A 1B64A 4JI6F 5CYQA 1T11A 1YJ7A 1ITPA 3DDNA 3O8WA 1CJKB 5E41A 1U0SA 2CPIA 2QYGA 4K5RA 1J54A 1NMNA 2HHHF 2YHYA 3EDRB 4WFBL 2J5AA 4ELVA 3UD5A 2Y9HA 3K5NA 4AXJA 1TL1A 4M95A 3EYZA 1FWKA 4FJMA 4B3MK 4DFKA 2VB6A 3HL8A 5AFUA 4DQQA 3AO5A 3MOJB 2F8HA 4U8VA 1HNIA 3H0PA 1GLBG 1HNWK 4KH1B 4JS5A 2XMKA 1YHQS 3MECA 2RKIA 1LCUA 1LV5A 5AXMA 3VENA 4YB1P 3VAGA 2ASMA 5A8WA 1GOCA 3ISND 3RSEA 2D5RA 2WK4A 3HKWA 4IKAA 4KFBA 4LFBF 3ILOA 5AZIA 4GV9A 4YOTA 4BRGA 2YH0A 2DNMA 5D0GA 2BMBA 1RFQA 3UD4P 3PX4A 3EJMA 1K6YA 4ED2A 1WG5A 2F5GA 1HFEL 4XO0A 3NCIA 3AA2A 2QLXA 3VHQA 5BN8A 4JKGA 1CQMA 3EDQB 5CZ2A 5KG0A 2JOQA 1T9VA 3GPAA 3KWMA 4PZVA 1QTMA 4NWBA 3TO8A 2X1BA 5CY4A 1UJ4A 1U4BA 4E7HA 2XGPA 1XQSC 2G8KA 1RB0A 3W8GA 2CJXB 1HNZF 1EETB 2E9RX 3KJVB 2W8LA 3GG1A 2OHDA 3U9ZA 4OZ0A 1VFJA 1N8RO 2CDRB 4RU2A 3JXUA 1I94J 1GOAA 4YORA 1YTAA 4BR7A 3VAIA 4JI1F 4X65K 3LWMA 3V6KA 3OYEA 1TL1B 3TZZA 3K5MA 1I3OB 3CC2S 3HSDA 2QRRA 5BREA 2P9IA 2A10A 2VL1A 1KFSA 5HO4A 3FE1A 1IQTA 3EZWA 3IMQJ 2PE8A 1HNIB 2GFFA 1NMEB 4O3OA 4GVEA 3DGPB 3MECB 3MD1A 4IH7A 2V7ZA 5A8KA 5C10A 3WX4A 2QMWA 3DLLL 5A8WB 2ZH5A 4JI2K 4FJ7A 1BXNA 3RSEB 4X66F 2CQ4A 3R5JB 3I56N 2KU7A 4QZVB 2B51A 5AZIB 3DXMB 2BEFA 4CD3A 3SK3A 4DR3F 2NLXA 4K4UA 1FX2A 1TV6A 4Q45A 1VSEA 3AB2B 3IA0A 4NI2B 2EG2A 1RYSA 2I6WA 1S10A 3GG4A 5GAHI 2Q3PA 1HWJA 2WVBA 4LFCJ 1FJ7A 3O80A 4DI6A 1GEHA 3VGLA 3Q23A 3HFKA 4J37A 2FJWA 1QSYA 4FBTA 4S0MA 4RU9A 3AO3A 4XDDA 3BPDA 1DGKN 3SFGA 3NDKA 2XMAA 4CNZA 3VA3A 1VCTA 1NHKL 4DQSA 3IAS9 1HWIA 3OBIA 3AVAA 3VQQA 4YR2A 4Q8FA 2UXBJ 4JYAJ 5F3ZA 4GVLA 1OPIA 4P10A 1YWXA 2OTLN 4B9MA 3WX8A 2P5OA 2P9IB 1ZBSA 1UJ5A 3K0JA 3HM9A 2BOPA 1A5XA 2E1AA 3HJFA 3D1HA 2CZ4A 1RSCA 4W90B 4Z4FA 4YQWA 1ELOA 3IDHA 5KFPA 3CCUN 4DV4K 4YHHJ 2HS0A 5EUHA 3O44A 4DV1K 3DCAA 3NFAA 4LF6J 3Q7BA 2IJNA 5KFOA 1Y7PA 4BCAA 4KHPK 4F4WA 3A0IX 1KQSR 3WEEA 1YJWN 2XY8A 1NNEA 2OO4A 3PIOQ 3GONA 3FCHA 1KVCA 2W6LA 1FFSB 1CBKA 1HKGA 3ZSXA 4JI5K 3PR5B 2JSXA 4EMDA 5F0XA 3C2PA 3IRXB 3DC2A 3TAQA 4LR9A 1ILYA 1A0OB 2YX7A 2M3DA 3IAM9 3NGYA 3KNAA 2Y8YA 5GINA 4M5IA 4DR5F 1R0CB 3MMVA 3TP2A 4HDGA 2RILA 1S48A 5KFIA 4A4JA 4J9MA 4EZ9A 4CEQA 4KHSA 1JLCA 2IRYA 3PDNA 2Q0UA 1DT9A 3L09A 2BA9A 4BG8A 2IVPA 3IUCA 2D41A 4OJ3A 4CH7A 2YPYA 1KN6A 1OY9A 3ZSZA 2I7PA 2PT0A 3JS9A 4YOYA 3PFOA 4HCBA 2CPDA 4YN3B 1NGIA 5E3CA 3H4BA 4V19S 1RWWB 1YJ9S 2UV8G 2ZM6F 4JKAA 4IOCL 4OZLA 2L08A 5HL7Q 4RJVA 1KQFB 3G4SS 2HBKA 1RUSA 1SH3A 2F7TA 5K14B 4EO8A 1RBUA 1VSMA 3NF8A 3LPTA 4WCEQ 1SC6A 3HXMA 4J9KA 1VRUA 4FJLA 2HBJA 2DYAA 3E9PA 3EXCX 3NKYA 3AH6A 3J7YP 3HBTA 2R7UA 1W25A 4J2DA 2JEIA 3G71S 2UVWA 3CCTA 4DDFA 1UPMB 3WEEB 3VWSA 3GR1A 3E3XA 3FBEA 3RBDA 1YZ7A 4QS7A 2Q2RA 4JKDA 3WNGA 1VIXA 4CLSA 2VJUA 4RZRA 5ETNA 4B1WB 3JTOA 3DHXA 3W66A 3K2PA 3P4UB 2EWHA 3D7EO 5BYSA 1Z2LA 1KOOA 2FLOA 4ID5A 3NF6A 1R6YA 1VSDA 3LP1A 4LF8K 1F2GA 4KTQA 4DU4A 3V9XA 3D6MB 1T0TV 1R27B 5DGBA 5C12A 1JLCB 2JJ4D 3MEDA 2KN4A 3T7ZA 5C0YA 1FO1A 2WW8A 2EG1A 2O67A 2GGPB 4MFBA 1TL5A 3I87A 4DV5K 3QT5A 3PTWA 4J9UE 4I9LA 5A6PA 5GAEU 3A5LC 5AJ3F 2MQQA 5JVHQ 2IGIA 2CXEA 1UFLA 2W42A 4QS9A 1PC4A 4QR2A 5C5JA 1C0GA 3GG0A 3SI6A 1PAEX 2N7YA 1VC0A 3UW1A 2DNKA 3M6UA 2FSKA 2ZH7A 3I9V9 3MMCB 5DG8A 2DO0A 3TEGA 2HFNA 1VRUB 4NLSA 3CCMN 4QWAA 2Y0SD 3F41A 5EY4A 2IBKA 3D6HB 1XIQA 3MCSA 3DLGB 1X4CA 5F9NA 4RUCA 1S4FA 1S72S 2MQNA 1RWPB 2HVIA 1WOSA 5KFKA 1IKXA 2NRHA 1N33K 1K73T 1MN9A 2W7OA 1DTTB 3D0IE 1M1KT 4GW6A 2YX1A 4OYBA 1HKCA 3MWBA 1RT6A 3OLAA 4I9QA 1K9MO 3SBTA 1XMOF 2KYZA 1QVGM 2XSFA 4P75A 3FBCA 2EC0A 4DX6A 5B0FA 1JLQA 2ALZA 4TU8A 4JI3F 4JN4A 4K5SA 5H9EK 1Q95G 1V6HA 5K20B 3PY8A 3LGHA 4Y2KA 3MEDB 5KFTA 5BYQA 2E2QA 3L2QA 3ENVA 5K5MA 2QWPA 1NDCA 1U6ZA 1I6JA 3MUVP 3MM8B 1FD8A 3E9LA 1BO5O 5C25A 2K3IA 1MLAA 3OV7A 3C6AA 3IG1A 1P6TA 3TTDA 2R4FA 3M32A 3B78A 4ZS6A 3BEXA 4Z2XA 4HHHA 5DQGA 3GIKA 3C95A 3AVFA 5GAGI 3O4NA 1LFWA 4JV5F 1N34K 4JAXA 3E9OA 2OLWA 3Q0AA 4FWPA 5CYJA 3CW2C 1GFWB 2FVPA 2ADBA 4OMFG 1VQKS 5EOYA 5KFYA 2OCEA 1IKXB 2V52B 2UVVA 3MR2A 1PJ6A 1SH2A 3FZFA 2ZEJA 4D3GA 3H6EA 3BUZB 4EBDA 1RT6B 2MQLA 2MZSA 4CO4A 4C0OC 2LEBA 5AQKA 2MZJA 3KHHA 1VRQC 3CCQN 1J27A 1JLQB 3ISNC 4MKVA 4YB7A 4OJ1A 2GELA 3ULEA 6FD1A 4CO1A 3B6OA 3KK2A 4ANCA 3A3PB 4CGGA 2I5JB 2E4LA 2LXIA 1BC6A 2OTLS 2GW8A 1U24A 3K5PA 1HBMA 1D0EA 3C19A 3CCJN 2IPOB 4YP3A 1X4BA 1WC5A 2E5IA 3IN5A 4DUZF 3OYKA 5RUBA 2CG4A 4G1PA 2Z8QA 1SH0A 1ROFA 5E7OB 5K8MA 2JZ5A 1XMBA 2AJ1A 2KW4A 4TKTA 3IG1B 5J1EA 3PIPQ 1Y5NB 1J5OA 2I9SA 3KKRA 2BRKA 2IAJA 4DCHA 3QNWB 4GKKF 4CESA 3D7SB 4CZFA 2W41A 3I55N 1YJWS 1HWUA 4IYQA 3W60A 4ZCLA 1BUPA 4DTXA 4OQJA 2KXFA 1DHMA 5F8JA 2P8IA 1HR0F 3SQGB 4E7KA 2GS8A 3R9LA 3CMEN 1D4XA 5KFGA 5KFZA 2VOPA 4M5JA 3T1HK 2HLTA 4DLGA 2XM3A 1RTJA 1NH7A 2V8PA 3ZZOA 3LDPA 4DU3A 4XH1A 4QIGA 2DR5A 2GVDA 4LF9K 4KHYA 4Z37A 2XMJA 4CJ4A 3CD6N 3I0SA 3IMXA 4I2QA 3T1YF 1KFDA 4FM0A 2LEAA 1Q53A 4YDDB 4OX8A 2AP6A 1JCGA 2UUBJ 3TAMB 3LDNA 1S6QA 3NCRA 4DV6J 3DXKA 4RG8A 3M8RA 4NXNF 2BBEA 3ULEB 4ZPDA 1EB0A 2RAQA 3P45B 3VVUA 3KYLA 1RXOB 1VC6A 3PIOL 1FD2A 2ROEA 5CH7B 3FSYA 3QSYB 2DKOB 1NGAA 1HBMB 5GMDA 4X66J 2YJFA 3AO1A 1CS4A 1JXVA 2CPXA 1W26A 5G4DA 4KAZA 3GYNA 4Y2CA 4DR3J 2DFEA 2KRRA 2YKOA 3VPZA 3CDEA 4KH0B 3PXGa 3O3HA 2RUGA 4CZGA 2I1RA 3DM2A 1R7IA 3H3NO 3I31A 1L3UA 4Z7YA 5AE3A 1F9EB 2ZE2A 3M8PA 4B3OA 2BJ8A 2MKCA 1HA1A 3PFEA 2MGZB 3L8BA 3FCVA 4RWXA 2J0SD 3HHLD 2HG4A 3NH2A 1CJUA 1EAYC 3C46A 3CJBA 5ETSA 2ZFHA 1XNRJ 3NVMA 2HRUA 5KQDA 2K8GA 3I8DA 5HL7L 3M6VA 2HZCA 1LWCA 4CEAA 2QN6B 1RTJB 4KR0B 4WU2A 4U7UK 1YJNN 4HVZA 2LLZA 1LWFA 1W97L 3CO9A 3LDSA 3BGRA 4KO0A 4I4BA 1YKWA 4WCEL 1U1OA 4O3NA 1LW2B 1VMBA 1NPKA 1S5ZA 1U25A 4OI0A 4NXMJ 3HPHA 3W5ZA 5THWA 2YNGB 1DURA 4HHJA 1J5EK 3LH2S 1NBEB 3DXKB 5DDRC 3KOAA 3W0LA 3TU5A 4AH9A 2QKKA 5IFMA 4ECXA 2BJ9A 3P5JA 3PYFA 2NUUG 3NE6A 1NGDA 3CHWA 2CPEA 4B3MJ 3KLEB 3OSNA 2LA6A 2BW2A 1CS4B 4GMKA 1H6KX 2F40A 5F8MA 3HTVA 2W8KA 4CZHA 2QL5B 2FY8A 4F26A 5IWAK 2ITGA 4IOAQ 1JKHB 4G65A 4DXLA 2A41A 1RDDA 1QQOA 2LKZA 4BC4A 3CCMS 1UOCA 4DG1A 1R6VA 3VZIA 4TLQA 3N01A 3UD3P 4BWJA 4IEEA 1VSKA 3M8PB 4B3OB 2W9CA 3AJ1A 1Q81T 1V3SA 2F96A 3RZAA 4DR5J 5GVQA 2OKQA 5B0AA 1T8EA 3KK1B 1RYRA 4CZKA 1SXLA 1CZBA 2FHOB 3I6PA 1H74A 1RAIB 4CLWA 3PW2A 5KG3A 1D9FA 2BXJA 3NVKA 3MCPA 3ATUA 2DXEA 1NEEA 4CHZA 3N4WA 1S9FA 4CGJA 4R0EA 3UCZP 2NSCA 3H90A 2LQ9A 3SCXA 1R89A 3BGRB 1JK9B 1LWXA 5KG1A 1T03B 5HLFA 1YJVA 1WF2A 1NK4A 5IV4A 1R31A 5KOXA 3HVTA 5L1JA 3ZEUA 1O1WA 3QETA 3J80U 4I0WA 3AJ2A 4ZPVR 3JSMB 2ZBIA 4Z0UA 1YTUA 1BWFO 2JVRA 2G0IA 1VRTB 2R7YA 1JLBA 2YNHB 4PXBA 3H25A 1G1XA 4JS4A 4IH5A 1FRHA 1QD1A 4FWQA 2BVZA 4DV0F 3THVA 2PAVA 2LMIA 4HWIA 3VTIA 2I38A 2KI2A 4ECZA 1TK0A 1HNVA 1XEZA 3M30B 2XY7A 4E7LA 2V8DA 3HCXA 3CMAN 1Q8LA 4R8UA 1WACA 5GAHU 3QINA 3HULA 1KHVA 4JI2J 1SKWA 2E7WA 5J2NB 1MN7A 3U3GA 2Q36A 4CEFA 4FS2A 3QEPA 4BHQA 2JNJA 4X62F 2A0FB 4USHA 1U1MA 1CJVB 3CIZA 1K0TA 4C98A 4ZLPA 4P6QA 2DBBA 3QJPA 1SC1B 4FL9A 2V50A 3BKFA 2ZGZA 4ENOA 4LIWA 3CCQS 1G7CB 4L76A 4M5GA 2G8WA 2EKNA 1YSJA 3S01A 3J81U 2WOMA 3CIMA 4DSFA 3TAFA 1TMMA 2HNDA 5HLFB 1BU6O 3OL9A 4CLYA 4O44A 1FRMA 4I56A 3HVTB 3ZEUB 3CCJS 3R6GB 2ETJA 2GMLA 2ZNYA 3GIRA 3HYFA 3KLGB 4EK2A 1T05A 2NXNA 3V4IB 4BQLA 4G6VB 1HLUA 1D3WA 1V4SA 2A3ZA 4K4XA 3SQOP 3UDEA 4E7IA 1HW9A 4H0XB 1F5AA 1RU2A 1UEVA 2WBRA 4K7QA 4NE9C 2C3MA 1VAZA 2XBPA 4UW2A 4F9OA 1M5PC 4ZCMA 2ZBPA 1RAEB 3I55S 4KH5A 2RPIA 1BCOA 2FF3B 1XMOJ 3P83D 4DV4J 3U02A 2GUIA 4ALZA 2ZWHA 4IUFA 4DV1J 3O5BA 3LF0A 2U2FA 3FZHA 3H4DA 3VVTA 2XMTA 1VQ7N 2YKNB 2RRNA 2EC2A 2APOA 1S1UA 2O1PA 4R5PA 1U02A 3CMES 4JEPA 4M5HA 3DLKB 2AU0A 2IVOA 4R79A 3A8KA 4ISEA 1BGXT 2KT2A 3A4TA 4RLEA 3EY1A 2VG6B 1MU2A 1DQ8A 4ER8A 1ZBHA 4DSEA 3LW5C 1WD6A 2BE2A 4GNIA 1VLYA 1ZBFA 3CD6S 2K7KA 3Q8SB 2JC0A 2ERRA 4L3KA 3J7Z5 3PIPL 5KPZA 4PL7A 1NGHA 4O3SA 4CVNE 3A2FA 3B4DA 4X4PA 2X1AA 1T7PA 2WOMB 2HF3A 2E5GA 3OS0A 2HNDB 1D1UA 5KOWA 2D1CA 3CQYA 2FVQA 2ZJRQ 3P4IA 1UVLA 5EU7A 3CSKA 3DOKB 3J7YI 3V6JA 1CQNA 4QIEA 4F0MA 3GFXA 5ETQA 3SUPA 2EFPA 4PG8A 3SEOA 4AL6A 2PC6A 1OIAA 5CE3A 4CO0A 3NNCA 3OXLA 4F0HA 2OELA 3QT8A 3POTA 1B9FA 2HNYA 2VICA 4DL3A 4QCLA 2HQFA 4OVLA 2Q66A 2G0JA 3R5AA 2A6OA 5C7PA 3OQ2A 2LXUA 4ZPWR 1H38A 3HP6A 2ZH8A 4IQMA 3US5A 1UTAA 5D6GA 3J7AN 4FF2A 4OI2A 2ZBCA 2XMUA 4MAKA 4FJ9A 2PO4A 1RT4B 2MSTA 3QQCD 4ZTJA 3CJ2A 1TL3B 4R5PB 2A1BA 3OL8A 4M3WA 3VTHA 1KEKA 1NM2A 1YJNS 4DR6F 1ZH5A 2PEHA 2NPIA 1BLUA 3JS6A 4BC9A 2BE2B 3IXQA 2Q31A 1EKRA 3BSOA 2YKMA 1FVQA 5E3AA 3QESA 2QMXA 3DXBA 1CXQA 3VN5A 2HAIA 1VQ9N 1B7FA 1GT8A 4I6AA 2LQJA 4DCJB 1PYOB 4Y0WA 4X4QA 3NS5A 4LF8J 2XHBA 2RQ4A 3QO9A 2P9KB 1WSJA 1T6DA 2IA0A 3M9OB 4AQYK 3Q83A 1EWQA 2UXCF 5F8HA 2BJEA 3SYZA 1QAJA 3J7ZO 2FLPA 4DV5J 1RWKB 2CIMA 2GO9A 4C8YA 1QM9A 3CPWM 3PO5A 2BUNA 4CF2A 3DDIA 3POTB 1UW4A 2HNYB 3OHRA 4LF7F 3TAGA 1C4CA 3W3DA 3FRZA 2COLA 4BC2A 5BR8F 1VK3A 2E1ZA 3R5CA 1PSDA 2NSBA 2NPFA 5LJVA 5JVGQ 2J4RA 5KFEA 1WKJA 2FBXA 4CLFA 3ENHA 3FNNA 2IVYA 4YDXA 2QXLA 4CIGA 4KV8A 2E5LK 3AO4A 3H46O 2AKWB 3D4JA 4QW9A 4OI4A 1QE1B 1XJWB 1FE4A 1HI0P 1UVKA 4NXNJ 3IM8A 2VQEF 1EZZB 2KHDA 1UETA 2HVEA 4WXWA 4ED0A 4NX9A 3G6XA 1QQNA 1N33J 3UNGC 2JEGA 4IOAL 1GX5A 2AJQA 5KT3A 1SKUB 4KJIA 2PA3A 3CJAA 2YKMB 1EKSA 3IFRA 3G86A 4HL9A 2RU3A 1VLOA 3VGVA 4EZ6A 3TTFA 1TELA 3CCWA 2P5VA 3UVJA 1QUPA 1Y10A 3MR5A 3B6PA 3MN5A 1VK0A 3FSXA 4ERDA 3QRPA 1Q1KA 3TA1A 1NJYA 3ZTSA 4DR7K 2AEMA 5DDPC 5I42B 4FJKA 1M5HA 1UZHA 4FXDA 2AYMA 2HRTA 3AVNA 4QOTA 4X64K 3OYAA 5C42B 4LMZA 4LFAK 5GAGU 1E4FT 2QA4N 2IM1A 3TUIC 3CMAS 4HTIA 4PYAA 3LOUA 2JGUA 1AZSA 1VHIA 4CH1A 2EBGA 3OR1A 3I9ZA 2GBZA 2C42A 2AEFA 3JB9k 5F9LA 3C16A 2QFJA 2PD1A 2I0XA 1NCLA 4KB7A 2VDIA 2KM8C 3VZHA 3TR5A 4FZZA 4AHCA 3ZZ0A 3NBPA 5MAOA 3FQKA 3FZBA 4J2EA 2DHHA 3ASMA 4BG9A 5HANA 4FOEA 3VQEA 4ELUA 4PQUA 4PXDA 3BO4A 1OWXA 1XQIA 1H7WA 3F9KA 3CE8A 3KLFA 2JH3A 1QDUB 5AQVA 3DJCA 1C0MA 3EN9A 4UOCA 5E3PA 3D6RA 4Y6IA 3GIMA 3T6JA 1M5OC 1Q78A 3HRGA 1UFWA 2O8BB 3R7BB 5I3UB 4BE1A 5AQPA 1RAAB 1JJHA 4A46A 3AOBA 4FO0A 3OUYA 4M42A 1YXQA 2VODA 4Q5VA 1N5SA 4WFAQ 3CM6A 4CK3A 1TL7B 2UYTA 3N0VA 2ASDA 4PPDA 1RWNB 1K0VA 4GC6A 1OYDA 5C2CA 1ESVA 2OD4A 2V67A 3DRXA 2HHPA 3BYPA 1Y9OA 5HJYA 4ZVFA 1RT7A 4C8MA 3M6GA 1R0AB 3NGSA 1XI1A 3K7RA 5D4PA 4EHTA 2DB1A 4WBFA 3QFUA 4A61A 3DMJB 2OSQA 3LPUA 1IM4A 4R0JA 4I67A 4AFFA 1VQ7S 3SBMA 4H5WA 2NRXA 1AZSB