2I5JA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with dhbnh, an rnase h inhibitor
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H P66 subunit
publication title HIV-1 reverse transcriptase structure with RNase H inhibitor dihydroxy benzoyl naphthyl hydrazone bound at a novel site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 117
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2i5jA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2i5jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2i5jA05
3PX0A 4IH7A 2IMWP 3UDLA 4RZRA 4E89A 2ZD1B 1IKYA 2IC3A 4R8UA 3MEDB 3DI6B 3M8SA 1C0UA 3AVJA 4IG0B 4Z4GA 2JEGA 4RW6B 3VQBA 3V9UA 2PY5A 3LP1A 3KLHA 3C6TB 1TAQA 3QO9B 4NLTA 3G86A 3PJWA 3IRXB 3PR4A 4CJTA 3QIOA 4WFZA 1XR6A 4ED0A 3DRSB 4RW8A 4KHRA 1D9FA 2P51A 3NH2A 3CDWA 3MFIA 3QLHB 5EDWA 2XWYA 3V6DB 1RDRA 2GV9A 4Q8EA 3Q8RB 4W5RA 3QNNA 3ALYA 1CXQA 4XO0A 4O3QA 4PA1A 2LSNA 4AH9A 4PUOA 1IKYB 4DSKA 2IC3B 4R8UB 5HRNA 5DGBA 4EYIB 1C0UB 5KFLA 3P5JA 2RN2A 4CIFA 1WLJA 3HXMA 1NKEA 3RR8A 3OYEA 3C95A 3U3YA 3LP1B 3KLHB 1RDDA 4JV1A 4YFUA 4BE2A 5HRRA 4DL2A 3HK2A 2C2DA 4BDPA 1YT3A 4O44A 4RW8B 3V1RA 4RW9A 2D5RA 2R8GA 3KD1E 5KFIA 1L3TA 3RB6A 1QSLA 1EP4A 4BDYA 4OVLA 2FBXA 3KTQA 3OLBA 3LALA 1FK9A 4EO8A 3CFPA 3KD5E 3KK3A 3MXIA 4F2RA 4PUOB 1XR5A 1TKTA 2OZMA 2FLLA 4J2BA 4IRCA 2R2SA 4B8CA 4DSEA 2D3ZA 3SI8A 4O5BA 3UIQA 3TAPA 4NLYA 4ELVA 3BR9A 4IDKA 1SV5A 4CEQA 2X78A 2YNHA 3VQ4A 1VRUA 2JEJA 2ITGA 3G6VA 4NCBA 4O44B 4ZVHA 4BE0A 4NYNA 2GUIA 4RW9B 3V6JA 3ZSVA 5J2QA 2DFEA 1XHZA 4LY7A 3KMQA 3KMSA 1EP4B 3VQQA 1HPZA 3T19A 2OPSA 4QWCA 1JLFA 5L1KA 3SZ2A 3AVAA 2Y1IA 4FZYA 1REVA 5KFPA 1UAXA 4KREA 5L1LA 4CIGA 5KFRA 1FK9B 4FLWA 4KB7A 3RB0A 3AO4A 3KK3B 3VA0A 1TKTB 1RTIA 2EX3A 4EYHB 3OYDA 4KHYA 4AHCA 3M8RA 4CECA 1KVCA 2YHBA 3RB4A 2E9RX 3LPUA 1X9SA 2AGQA 3OYLA 3OL9A 4NCGA 2RDJA 1Z25A 4KHQA 1NK8A 4C8LA 4LQ9A 4MIAA 5DG8A 3C94A 4IDKB 1SV5B 3DLEA 1SUQA 2YNHB 1RNHA 3B6OA 4CFCA 1VRUB 1VSJA 5CZ2A 4FW1A 4EBDA 2W8LA 1SKRA 4DU3A 3RAXA 4F4KA 1L3UA 4DQIA 4RG8A 3UPFA 5J2QB 3TAGA 1SH2A 4CGHA 3T3FA 3QGIA 3IG1A 3CWJA 1HPZB 3VQPA 4ZPCA 3NF8A 2OPSB 4B9LA 1WSHA 4IR9A 1JLFB 3FFIA 1REVB 4OKJA 4FXDA 4IKAA 5KFWA 3H5SA 3S3OA 1S1WA 4H4MA 1GOBA 4CJSA 2YNIA 3MR6A 3WNEA 4CF2A 1DLOA 1RTIB 2X6SA 1S6QA 4E7HA 1S5JA 4XPEA 4FLTA 3PX4A 3DDKA 3T5KA 5C5JA 2HB5A 2R8IA 4NCGB 1CXUA 3KIOA 4B9TA 4FLVA 3DYAA 4HUEA 3DLEB 3NGYA 1SUQB 4HHTA 3LP0A 1MMLA 1HYSA 2RKIA 4O4GA 4F4ZA 3V1OA 3TAQA 4KSEB 2HNZA 3GIJA 4OPJA 3KK2A 4HUFA 4FLXA 2B43A 1IKVA 3HPGA 3IG1B 1T94A 2WONA 4J9QA 2X6NA 3BSOA 2J6SA 4FBUA 3KLFA 3AO1A 3HKWA 2V0NA 1IH7A 1S97A 4IRDA 1RTDA 1TK5A 1SKWA 3FFIB 4OKEA 1QSSA 4B9UA 2FVRA 2UUTA 2IM2A 1JKHA 1S1WB 4CJKA 4H4MB 2YNIB 1X9MA 5KG7A 3AVHA 3K57A 4DSLA 4KRFA 1DLOB 3O3HA 4J9OA 1S6QB 4Q0BA 4DTRA 3S3NA 4W5NA 3CQ8A 4YNQA 2J6UA 2P5OA 3BJYA 1R0AA 4TY9A 3G6YA 3DYAB 3OYGA 4DTMA 4J2DA 2GBZA 1CZBA 3LP0B 2KTQA 1T7PA 1HYSB 2RKIB 4O4GB 2PYJA 2E4LA 3L3VA 1ASUA 2HNZB 3I8DA 4RNOA 3ZSRA 4W5TA 1HQUA 3KK2B 1IKVB 4R5PA 2WONB 4J9PA 1N56A 3AV9A 4DMNA 1QS4A 1K1QA 3L2WA 3KLFB 4M3YA 1RTDB 4K4UA 4CHQA 4RNHA 1SKSA 5DMRA 1JKHB 1KVBA 4C8OA 1JLCA 3HPHA 2PZSA 3I5AA 3ITHA 4Q0BB 5KFMA 1JL1A 5KFSA 1GX6A 4ZP8A 4FJ7A 1R0AB 3KNAA 4NYZA 3QIDA 4XPCA 3PW4A 3L2RA 4ZP6A 4K8XA 2V9WA 3KK1A 5JXSA 3BGRA 4WXOA 1RT3A 4DTNA 2HMIA 4W5OA 2OYQA 1ASWA 3ZT1A 2VG5A 1HQUB 2Z1HA 3H59A 4LH5A 4KHNA 2BANA 2G8HA 2HHVA 3ZSYA 4R5PB 1BCOA 3SUPA 5F8MA 3ICLA 4E0DA 1B92A 3QETA 2XY7A 3V9XA 3K5OA 4FJXA 3QINA 4QOZB 4NLWA 4O3SA 1RTHA 3K58A 1JLCB 5E41A 4GC6A 3SCXA 4IH5A 3ITHB 4WYWA 4I9LA 4CERA 3MR3A 5FROA 3NMAA 4DS4A 4IOBA 3SPYA 3VQEA 1SL2A 3KK1B 2QXFA 4ICLA 4TLRA 3DLKA 3KHRA 5T7BA 3BGRB 3PW7A 1RT3B 5CY4A 2HMIB 1NNDA 1QE1A 2W7PA 1QAJA 4ECQA 3PW5A 1KVAA 5KG4A 1U4BA 3I0SA 4Y2AA 4FK0A 1TK0A 2VG5B 3HJFA 4NLRA 5KFQA 3F9KA 3BSCA 2IA6A 2BANB 4NRTA 5I3UA 4FJKA 4M42A 2JGUA 1LWFA 4Y1DA 1RBTA 4KI4A 3AO2A 4X2BA 4DSFA 1RTJA 4O3NA 3SUNA 3IGVA 1S1VA 1RT7A 5EUHA 4CCHA 4NLPA 1NOYA 3OYHA 2XY5A 4RU9A 4DFMA 2R2TA 4N76A 1VSMA 4ECUA 4HVJA 1ASVA 5KT4A 3NF6A 1MU2A 4U7CA 1W25A 3LP2A 4ICLB 4CHYA 3TVKA 3DLKB 4MFBA 1JLBA 3JYTA 5KFNA 3S9HA 4CJRA 1QE1B 2KFNA 3I0SB 4DF8A 1JLAA 1NKBA 4ECTA 4FK2A 5I3UB 4B9MA 4M95A 3VQ6A 1LWFB 1QHTA 4H8KA 2OZSA 5DG9A 3P1GA 4QWEA 1TL3A 3RRGA 4FJJA 2FJVA 3OYKA 1RTJB 1XHXA 4PY5A 3DM2A 5KT7A 1S1VB 1RT7B 1IKXA 5KFCA 5HLFA 4FM0A 4AHVA 2F8TA 5KTQA 3CM5A 3KHGA 4CJ4A 3MXJA 4ZTJA 3PHEA 3GYNA 1HQEA 1BQNA 3OJUA 1MU2B 2BR0A 1IKWA 3LP2B 2G8KA 2GC8A 1JLQA 2BRLA 2C2RA 4K4TA 4MFBB 1JLBB 3JYTB 3JSMA 3KJVA 3AA4A 5DLGA 4HYKA 5C42A 4ZVFA 1JLAB 2C28A 2FJXA 4I9QA 2G8IA 3SQ1A 4O4RA 4G3IA 2R8JA 1NK0A 4Z4IA 1TL3B 4TY8A 3AVKA 3PV8A 4DL6A 3DM2B 1IKXB 5HLFB 1S10A 5KFZA 4WZQA 4ZP7A 3RMDA 1NK6A 1VSKA 4JS4A 3HPOA 3BQ0A 1HQEB 1BQNB 3I5BA 2ZQBA 1IKWB 4F8RA 4KI6A 5FRNA 2YKMA 1JLQB 3SI6A 5HROA 4WFXA 2R2RA 3OYJA 3JSMB 3KJVB 5KFFA 1RAJA 5KFTA 5C42B 4KHUA 4F4XA 4KHSA 2YHAA 3LZIA 3LWLA 1C1BA 5KFXA 1U45A 2KFZA 4BWMA 4R0EA 3OL7A 4DFKA 3KLGA 4TY8B 4OGCA 4NLQA 1KRPA 2OPRA 4JS5A 1N5YA 1RT2A 3H40A 4HUGA 4DFPA 5F8IA 1JLGA 3Q8PB 3FQLA 3RMAA 4Q8FA 3HHKA 4Z4HA 2W7OA 3LP3A 4KFBA 4GVMA 1S48A 3VQAA 4EO6A 4RUCA 4B3OA 3V81A 1SL0A 2YKMB 4CHNA 5HROB 2DY4A 2FLPA 4Z4CA 3FSIA 2QKKA 3VQSA 3NH0A 1I6JA 4PWDA 4M3XA 4MH8A 1BCMA 2RF2A 4FLYA 1EKEA 5FDLA 1C1BB 2HNYA 1UWBA 3NKYA 3KLGB 4KBIA 5KFAA 2OPRB 4FLUA 2O4GA 1N5YB 1RT2B 1RBSA 4MK7A 3ASMA 4ZPDA 3OHBA 1JLGB 4NLXA 2DPJA 3ZSXA 3BQ2A 5DK5A 1X9WA 4KFBB 4YR2A 1NOZA 3H4DA 4J9LA 4B9VA 2W8KA 4FJMA 4FBTA 4DWIA 4ZVGA 4KKOA 4IBNA 5F8NA 2I1RA 4B3OB 3OJSA 3V81B 4LSLA 4QW9A 3MXMA 4KE5A 4M41A 2X74A 3BSAA 3KOAA 2VA2A 4Y2CA 5KFHA 2AU0A 1LWCA 2B4JA 4DTPA 4PWDB 1QAIA 3L2QA 1IG9A 4FK4A 2O4IA 4JV0A 3QERA 2RF2B 4KAZA 3K2PA 4H4OA 2UVVA 3F73A 4K4YA 3N6NA 5FDLB 4FLZA 4NLSA 3SUOA 5KG5A 1UWBB 4NRUA 2FVSA 1RA7A 3L8BA 1XC9A 1S0MA 3MR5A 2F8SA 4F2SA 1LW2A 1DTQA 1TKZA 2FJWA 3M8PA 3SYZA 4O0IA 4Y3CA 4KKOB 4K4XA 4OGEA 4CJEA 3LZJA 3QEPA 3FRZA 1CLQA 4LSLB 1B9FA 3NF9A 1S1XA 4DG1A 3MEGA 1LWCB 1XI1A 4RNFA 1RYRA 2HNDA 3E01A 3M9NB 4IR1A 2RPIA 1S6PA 3DOLA 3OL8A 5KFYA 4ED1A 4Q5VA 4DF4A 1X1PA 4H4OB 4NLVA 1W9HA 4IFVA 3ZT0A 2IBKA 5J2NA 2A1SA 2I5JA 3DOKA 1SH0A 3NE6A 3H2LA 3LANA 3CG7A 2R7YA 3O4QA 4NLDA 3IN5A 1LW2B 4EZ6A 3QESA 3AVNA 3CJ4A 1DTQB 4ECWA 3OYCA 5F9LA 2FBVA 2IM3A 3NDKA 1TKZB 3M8PB 5JUMA 4YR3A 3TAMA 3RMBA 2OH2A 3EZUA 4Z4EA 5JS1A 2JC0A 4DTOA 1NK7A 1S1XB 4DL7A 4DG1B 5FRMA 3MEGB 4Y1CA 2XCAA 3PVXA 4EP5A 2HNDB 3E01B 1S6PB 3DOLB 3K59A 2R8KA 3VQ7A 5KRTA 4E7LA 2AJQA 1YTAA 3EZ5A 1D5AA 4IFVB 5L1JA 4B08A 3IGNA 3M8QA 3OS1A 5J2NB 4CF8A 2HHUA 3O3FA 2I5JB 4N5SA 2XCPA 3DOKB 3BSNA 5KT2A 3V4IA 2PYLA 2R8HA 2GIQA 1RT1A 2DTUA 3LPTA 3NFAA 4N47A 4YMEA 3HP6A 2UVRA 4M94A 2IOCA 3MTKA 4B9NA 4ED6A 4J9KA 2HHWA 3VQCA 3OS0A 2WHOA 1TV6A 5KRSA 3TAMB 4JUZA 3Q8SB 3B6PA 4WE1A 2HWHA 3GIIA 1HARA 3RBDA 2E6LA 3N6MA 1Z26A 1WN7A 2WB4A 1N48A 2DFHA 3AVMA 1KLMA 3SJJA 3RB3A 4ZVEA 1U47A 3PO5A 5F8HA 4CFDA 5HBMA 1J9AA 2FBYA 5EU7A 2W9BA 3M8QB 3SFGA 1C1AA 3V9SA 2AWZA 1D1UA 2RDIA 4CIEA 1CSJA 1WSJA 3V4IB 3K5MA 3SQ4A 3T5HA 4Z4FA 4CHPA 3Q8QB 4RUAA 3GV5B 5DLFA 1RT1B 3TABA 1WAFA 2EHGA 4K8ZA 1TK8A 1WAJA 4ZPAA 4CGIA 1RT6A 4DTJA 1N6QA 4J9RA 3G6XA 4Q43A 2OPQA 1TV6B 3V6HA 3SV3A 1A5VA 3AO3A 1WSEA 4WE1B 4ELUA 1B9DA 4FYDA 3OYBA 4FJGA 5EWEA 1NJWA 3HL8A 1KLMB 3KLIA 4ECRA 4K4VA 4CHOA 1EETA 3DRRA 3QIPA 4ZP9A 2XRIA 4E7IA 2IS3A 2BRKA 5HBMB 2Z1IA 3FDSA 3PY8A 4CGGA 5KFOA 2W9BB 4BE1A 3H5UA 4ZTFA 4LH4A 2UVWA 4ECSA 1J54A 1XR7A 4IRKA 1OS5A 3LAKA 2ZKUA 3GV8B 2Z1JA 1RT6B 1U49A 1YVUA 1N6QB 3CDEA 4C8KA 2OPQB 3CO9A 1EX4A 3AVGA 1D8YA 3ZCMA 3U3GA 2FVQA 3E51A 5CYMA 3I0RA 4EBCA 3HP9A 1ZBUA 3GILA 4FJ8A 3K5LA 3HO1A 4CFAA 4Z0UA 3SUQA 4DTXA 3OYFA 4CK2A 3O4NA 3KLIB 1EETB 1QUVA 2XHBA 3QIPB 3T5JA 1F21A 2Y1JA 1S1TA 4KTZA 4FCYA 1KFSA 4DQPA 1RTHB 4KHWA 5CYQA 1LWEA 3DLGA 4EEYA 5DGAA 3RRHA 4O3RA 2JEIA 1TGOA 3O3GA 3QEVA 1A5WA 1KHWA 4KV8A 4U6PA 1TAUA 4URQU 2D3UA 3IS9A 4KAIA 1HMVA 4QPXA 3V9ZA 3RMCA 4E7JA 1RDAA 3QEWA 3AVLA 2B5JA 1QQCA 1IO2A 1SH3A 2A1RA 5CYMB 1BI4A 3I0RB 3CVKA 4KPYA 1GOCA 2ATLA 3H98A 3AA5X 3QNOA 1XWLA 3TQ1A 2ASLA 5KI6A 3TAEA 3AVBA 3ISND 4MQ3A 4FZXC 1S1TB 4O0JA 2XI2A 4J9NA 1K6YA 4FJNA 3L3UA 4QWDA 5CYQB 1ZTTA 1LWEB 4ED8A 3DLGB 3WNFA 4ZHRA 2UUWA 1S49A 3ZSZA 4F4WA 4J2AA 2XC9A 2HHSA 4E7KA 3HYFA 5I42A 1W0HA 4KV8B 3NGDA 4DL5A 4DS5A 5J1EA 3RR7A 3TR8A 2HW3A 4QCLA 5KGXA 1U48A 3IS9B 3THVA 3PW0A 1HMVB 5K14A 3ZT4A 1QSYA 2B5JB 1NHVA 1T03A 3CFOA 5DG7A 1BI4B 2IAJA 1RBVA 1UA1A 4DEZA 4EP4A 4Q45A 1UOCA 1NJZA 4K4ZA 2D41A 1Q8IA 1N4LA 4FVMA 4CF1A 1ZETA 4TXSA 1FXXA 4CJQA 3HVWA 4TQSA 4OL8A 5HRSA 3D0PA 3ZSOA 1J5OA 4AHSA 4URSA 4KTQA 4CJ3A 1BQMA 3MAQA 2G8WA 3DLBA 4CJWA 4FJIA 2HVIA 3MF5A 2ILZA 2HHQA 3AA3A 1ITGA 3V1QA 2G8VA 4QAGA 2ZE2A 3CFRA 4ZHRB 1HJRA 4IQXA 4CEOA 3UQSA 5KFDA 1D9DA 4DLGA 4GW6A 1S9FA 2AGPA 4K4WA 1ZYQA 4F3TA 3NL0A 5I42B 4FJLA 5C25A 5J1EB 4M3WA 4DU4A 5D3GA 1S1UA 1TL1A 4PQUA 1WSIA 1CZ9A 4WXWA 4WFYA 5K14B 4I7FA 4OPKA 1T03B 3KLVA 2XO7A 2IAJB 4CJ5A 1TP7A 1UA0A 4RNNA 1VK0A 3P83D 1C2PA 4FM2A 4CEBA 3C6UA 5KFEA 4WZMA 1J5OB 4B8AB 4LSNA 1BQMB 1J53A 2XGPA 5KG1A 3QEIA 2ZE2B 3PJXA 4QWAA 3PW2A 5KG3A 4ECZA 1ZBIA 2FC0A 2YV0X 1LV5A 5C25B 2W42A 3VA3A 4URGA 2Z1GA 1IM4A 3DMJA 5D3GB 1S1UB 1TL1B 4XIUA 5KFBA 4DSIA 4PQUB 3OHAA 4WYLA 3OY9A 4KTWA 3NGIA 3PR5B 4I7FB 4MKAA 1A5XA 1Y97A 3QGGA 3LDSA 1RBUA 1RA6A 2BE2A 3T5LA 4Y34A 3OVNA 1I3AA 3K5NA 4YP3A 3C6UB 3GQCA 2ETJA 2WOMA 4W5QA 4IFYA 4TQRA 4CFBA 4ED2A 4ED3A 4LSNB 4ZPBA 1ZBLA 1VSIA 2WTFA 4YR0A 2WCXA 1C1CA 2VG7A 3MEEA 2ASDA 4CJLA 1L5UA 3RBEA 1S4FA 4OKKA 4GMJB 3ZT2A 3CDUA 4ECYA 4F3OA 4RW7A 3CM6A 4CGDA 4CF9A 2XGQA 4O55A 4TYBA 2FVPA 3DMJB 2G8UA 5F8LA 3EPGA 4E3SA 4ZMMA 2HVHA 3TARA 2D0BA 4FJ9A 3LAMA 2HHXA 2IM0A 2BE2B 3KHLA 4CGJA 3OSNA 3RAQA 1RYSA 2BGGA 2WOMB 2XY6A 2HNYB 4IFYB 2IJFA 5KG2A 4BWJA 3OLAA 4K4SA 2C22A 4L8RB 1O1WA 3QZ8A 1C1CB 2VG7B 3MEEB 5J2PA 2ILYA 4CJPA 2JC1A 3KLEA 4CEFA 4TN2A 4FS1A 2QK9A 3CIZA 4K50A 4RW7B 4N56A 4AHTA 2FLNA 3OYMA 1WNSA 4CEZA 1HRHA 3TWHA 4CF0A 1VSLA 1RDBA 3SQ2A 2AQ4A 4H54A 4CEAA 2D0AA 5HRPA 1NKCA 4DLEA 1G15A 4FJ5A 3BQ1A 1C0MA 1NK9A 1GX5A 4JLHA 1VSHA 4MK8A 2VG6A 3BDPA 4CEEA 1T05A 3NCIA 3WNGA 3ULDA 1S0NA 5C24A 3ZSQA 4E1MA 4HKQA 5KFKA 1RILA 1NK5A 4E1NA 1SL1A 3D45A 1VSDA 4HTUA 3HM9A 1KHVA 4J9MA 3GV7B 5J2PB 4JRPA 1JX4A 2YKNA 3KLEB 3OS2A 3HT3A 2F96A 4ED7A 1D0EA 5KT3A 1RBRA 3KHHA 4N41A 3AVFA 2QKBA 4DQQA 4M3RA 4NZ0A 5F8JA 1RCHA 4KB0A 1DTTA 3MECA 2W9CA 5KT5A 3NAHA 2FBTA 4BACA 4IH6A 3NBPA 3NAIA 2E9ZA 3SFUA 3OSPA 3CJ3A 3A2FA 4JRQA 4DTSA 5KFUA 3DLRA 1NK4A 1KFDA 1KLNA 2VG6B 3NF7A 4AHUA 4ELTA 1T05B 1ZBFA 5L1IA 1TKDA 4OLBA 3M9MB 1HYVA 5C24B 3MFHA 4M3ZA 1VSEA 1KTQA 3TANA 3NGZA 1S0OA 4ID1A 1NJYA 5DQGA 3N6LA 2HWIA 4ID5A 2YKNB 4RNMA 4HCCA 5KG6A 4E19A 4CK1A 5EWGA 2QE5A 4C8MA 3CJ2A 1EXQA 3KKSA 3UR0A 2HHTA 1DTTB 3MECB 2KQ2A 3SQ0A 3D5MA 3L2UA 2W9CB 2BQ3A 1BGXT 4J9SA 3EY1A 3ISNC 3VQ5A 2AX1A 3OL6A 3NBPB 4NLOA 1FKOA 4UQGA 1L3VA 4DU1A 3G10A 1YTUA 2VWKA 3NAEA 4HCBA 2O5DA 2VA3A 3EPIA 4QWBA 3CYMA 3OYNA 1QTMA 1JL2A 3L2VA 4GC7A 1Q9YA 2ALZA 1S9EA 1RT4A 4Q44A 3VQ8A 3AO5A 3S3MA 1WSGA 2BDPA 2BQRA 4KHMA 2YNGA 2FVCA 2V4RA 4O3PA 5EWFA 2BQUA 3DRPA 4ID5B 5KG0A 2DPIA 3D28A 4CESA 1TKXA 5F8GA 2AGOA 2OA8A 2IM1A 3HSTB 4DFJA 3VQ9A 4MKBA 3OYAA 4M45A 1BL3A 4IG3A 2JLEA 3AA2A 4NLGA 3KKRA 3HVTA 1KCFA 3PO4A 2D7SA 3H08A 3VN5A 3NHGA 1T3NA 5J2MA 4NLUA 1FKOB 2P1JA 4MK9A 1JXEA 3MR2A 4F4YA 5DQIA 1HYZA 1RDCA 4G1QA 1K1SA 3U6FA 4ECXA 2ATQA 4DTUA 3QGHA 2KW4A 2KZZA 4CE9A 1S9EB 1RT4B 1S9GA 3HVRA 2XY8A 1BISA 4B9SA 2QV6A 2B6AA 2YNGB 3AVIA 3SV4A 4AILC 2E6MA 3DRPB 1U04A 1LAWA 2DFFA 4M3UA 4OJRA 1TKXB 1Q9XA 5KFJA 1HNIA 1TQLA 1VSFA 3EYZA 1FKPA 3RWUA 4C8NA 4DSJA 4DL4A 1WSFA 4IG3B 2UVUA 3M9OB 2VWJA 3HVTB 3DLHA 1WNEA 4DQRA 5J2MB 2CKWA 5HP1A 4FM1A 3TI0A 2ASJA 3WNHA 3I5CA 2IDOA 3LWMA 5JS2A 3FQKA 4J2EA 1HNVA 5KGWA 1C0TA 1JIHA 4IKFA 4LQ3A 4G1QB 3DRRB 3T1AA 3IAYA 2OPPA 1RT5A 4TYAA 1S9GB 3GIMA 5KFVA 2XI3A 4JV2A 5CZ1A 2B6AB 2W9AA 3ZT3A 3NH1A 2P5GA 3GIKA 4FJHA 4CEDA 4KO0A 2V4QA 1ZTWA 4NYFA 4FW2A 1U09A 5F9NA 1HNIB 1FKPB 4QW8A 4CGFA 3VQDA 5L9XA 1TVRA 4BDZA 3RTVA 2WK4A 4O3OA 1Z4UA 5KFGA 1VRTA 4KB1A 3HVAA 5HP1B 4CJUA 5KT6A 4CK3A 4I2PA 1NHUA 4YQWA 3AVCA 1HNVB 3H5XA 1C0TB 2F8EX 3CJ5A 1JLEA 4OLAA 3SPZA 1LW0A 2AX0A 2C2EA 3PZPA 2OPPB 1JXBA 1YVFA 1RT5B 2IJNA 4RW4A 2YNFA 2Q3SA 1BIUA 3V9WA 2WRMA 3BREA 1C6VA 4I2QA 4LD0A 4KO0B 1ZBHA 4FZZA 1LAVA 3QYYA 2E9TA 2EC0A 2R2UA 2D0CA 2HAIA 5DQHA 1KSPA 4F50A 2IGIA 2ZD1A 3H4BA 3MEDA 4ECVA 4CJFA 3DI6A 4CHZA 3V6KA 3PUFA 1TVRB 1JXLA 3SNNA 4IG0A 4EZ9A 1NJXA 4AHRA 4RW6A 3PX6A 4DQSA 1L3SA 1VRTB 2G8FA 4NCAA 3C6TA 3TAFA 3QO9A 2CJQA 1BIZA 2NUBA 4FS2A 4I2PB 3H5YA 2GIRA 3QEXA 3IRXA 4M3TA 1GOAA 1JLEB 4DL3A 2KZMA 2J6TA 1LW0B 3DRSA 2JEFA 4MIBA 3CJ0A 3QZ7A 5SWMA 3OYIA 4EBEA 5SZTA 4RW4B 2YNFB 3ZSWA 3G0ZA 4CJVA 1T8EA 3QLHA 1BHLA 5T14A 3V6DA 1I39A 4I2QB 4TSXA
chains in the Genus database with same CATH superfamily
1BE4A 3L4IA 3JSBA 3UDLA 4A5AA 4D3GA 1YHQS 2IC3A 3MEDB 4YN3B 3M7VA 3DKDA 3VTHA 1Y0HA 2O8BB 2JEGA 2VGMA 4RW6B 3V9UA 3LP1A 2QA1A 2YPZA 1TAQA 1RWOB 2CQBA 2JFKA 2PSZA 1LCUA 3IRXB 2G1HA 3EZWA 1EO1A 4IOCQ 3TW0A 2BYCA 4RW8A 2VB6A 2CPXA 2D0PA 3D2EB 3E2EA 2P51A 5L39A 1ZOTA 5BJRA 3NH2A 3CDWA 4EUVA 5EDWA 1QQNA 1O51A 4Q8EA 3VV2B 3Q8RB 3P45B 4ZVQB 2R3VA 2RU3A 4JKGB 1CXQA 1GXTA 2BOPA 4PA1A 2NLWA 2LSNA 3J7YU 3AAPA 1IKYB 4DSKA 5HRNA 3JXOA 4M5MA 3IA0A 2RN2A 4CIFA 1WLJA 3EEQA 5A8WB 3OYEA 2V34A 3U3YA 4DR5F 5HMXA 4WKYA 4OYBA 3M1FA 1YRTA 5H9FJ 2ZF5O 5ETOA 2R8GA 4ISEA 1QSLA 3EVMA 1EP4A 1XMOK 4KQZA 4BDYA 1CC8A 3GMGA 3DFEA 2MKCA 2P9SA 3LALA 1VHFA 3FBCA 4EO8A 2Z0GA 3BBBA 3OR1A 4X62K 1XR5A 3MMBB 3RRKA 3M32B 2GMHA 3KUHA 2N4CA 4P10A 1VQON 4FN5A 4IRCA 2WSCC 3N4WA 1NGHA 3UIQA 4DR2F 1XIQA 4ELVA 2XB2D 3OQ2A 1SV5A 2QN6B 4YS2A 4FWOA 1HNZJ 3MAAA 1NSQA 5BYRA 4BGBA 4ZVHA 4DU8A 3IAS9 4YEAA 4FWPA 3V6JA 3M4XA 2DNMA 4A5BA 5J2QA 2EXUA 4LY7A 1UW4A 2CDRB 1HD1A 1LKZA 5F0WA 3VF0B 3IO1A 4FF4A 3T19A 4GVBB 1O8BA 3SZ2A 2Y1IA 2MZ1A 5T7LA 2ZJQQ 4CIGA 5KFRA 1S22A 3BH6B 4KB7A 3RB0A 3VA0A 3KK3B 1CJUA 4PKIA 2IVYA 3VEZA 1TKTB 4ILHA 2V69A 1RTIA 4EYHB 3OYDA 1JXVA 3RB4A 2OAUA 1NGEA 3JTOA 4NCGA 1HW9A 4KHQA 4CDIA 1NK8A 2PA3A 2ACYA 5DG8A 4IDKB 1RNHA 3EUNA 1PYOB 3C0BA 1VRUB 5CZ2A 3WXKA 1MLAA 2W8LA 3CC7S 1YAGA 3A8EA 2ZWOA 4UOCA 3DAWA 2DR5A 3IG1A 3CWJA 1CULA 1HPZB 3VQPA 4P72A 2NLXA 3TSQA 2OPSB 3M2VA 2O8CB 1JLFB 1ICEB 1TL5A 1REVB 3BN7A 4FXDA 1RWWB 1FJCA 2E1ZA 4EAHD 1H38A 1GOBA 4CJSA 3WNEA 2L41A 4CF2A 3OXFA 3IDHA 4E7HA 2QG9B 3F56A 3DDKA 3SLCA 1WUUA 2R8IA 2RRNA 5AQXA 4FLVA 4GKJF 1ZM3A 3DLEB 3I9ZA 2MB0B 5B0EA 1EB0A 2MHNA 1SKUB 3GIJA 2O67A 1VQOS 1DEJA 4B3SF 2DR7A 4FLXA 2JL9A 1N8RO 1T94A 2WONA 5IQQA 1KQSR 3U1MA 4PXBA 4Y6IA 4PYDA 3LA0A 5D0GA 1IH7A 3MPUB 3FFIB 3Q8VA 4OKEA 3CCSN 1VQYA 4JI5F 2QWRA 2FVRA 3MXHP 1FD2A 2D3O1 2YNIB 1X9MA 2C3UA 3K57A 2HBJA 4DSLA 5I3QA 1XMOF 1N33K 3CCEN 4YOTA 4USHA 2OEJA 4DV0K 3S3NA 1N5VA 4DV5J 4YNQA 2J6UA 3FZHA 3G6EN 1HI8A 1R0AA 3UFCX 4HDHA 4JP8A 5CXTA 4CO5A 1HWIA 4S0MA 3DYAB 4DTMA 2QL7B 5K8OA 3IAM9 3LP0B 2WZ1A 1T7PA 1HYSB 4TKTA 2PYJA 1MMDA 2HNZB 1KBRA 3JSRA 1HQUA 4R5PA 1N56A 1RBOB 2AKWB 2DEIA 3BO2A 1P9QC 5E3PA 4J8FA 1Y5LB 4WYBA 4BQZA 1MN9A 3E9PA 4CD3A 1SJRA 3MZIA 4C8OA 1KVBA 2PZSA 7FDRA 3ITHA 5AQHA 4BRAA 4O5FA 4RWWA 3UDCA 1GX6A 3EGZA 4DKWA 1HPMA 1TFYA 3L2RA 4K8XA 3ZZOA 2V2VA 4I68A 3I82A 2DHSA 4DTNA 1Q95G 3EO3A 4UZBA 4H0YB 1PBUA 3QRRA 2YWFA 1NXIA 1P8GA 3CJ8A 4ID8A 5EY4A 1QTNB 3ZSYA 5EXWA 1WC5A 1WC3A 1N5TA 4FWLA 4E0DA 1B92A 2XY7A 2GMJA 5ADXH 1YBUA 5BYSA 4QOZB 2FSJA 3QWPA 2RU9A 5EOYA 1JLCB 5E41A 4GC6A 2XMWA 4AL7A 3SCXA 4B1VA 3MOZA 1QQMA 4I9LA 3OPKA 4CERA 4ANDA 4DS4A 3SPYA 1YJNS 3CCSS 1ULRA 5T7BA 3BGRB 5HQMA 1FJGJ 2CGJA 3JTPA 4BVPA 1U4BA 2RQKA 4JHDA 4FK0A 1RUSA 1TK0A 4JV5K 3CCES 3GCXP 3IMXA 4CLYA 2BJ8A 4MJKA 2BANB 5I3UA 2A5XA 4M42A 2JGUA 2HPUA 2F4FA 3H8YA 4PKHA 1V3SA 1RTJA 3GYGA 3IGVA 1Q8BA 1RT7A 1X3MA 2XNQA 5EUHA 1X0PA 2AJ4A 1WACA 3PRBA 3W2VB 3CJ9A 2B3TB 4RU9A 5LT5A 2ITMA 1VSMA 1PKUA 4ECUA 4HVJA 1MU2A 4U7CA 1PILA 4MIWA 4CHYA 1AUSL 1U02A 1JLBA 3S9HA 1RU2A 1LXNA 4DV0F 3LO3A 6FD1A 3VGUA 4FKYA 2CWKA 4JI7J 3MX2A 1NKBA 1R8CA 4FK2A 5CAAA 3VQ6A 1LWFB 3BF4A 3P1GA 4FWSA 1ZA2B 4QWEA 5E7OB 1ZM2A 1QLNA 5KT7A 1S1VB 5KFCA 1IKXA 1N36K 3VEWA 2F8TA 2Q0UA 2DNNA 3CUNA 3FK4A 5GAGI 4JI3F 1X9JA 4WKRA 4LF4J 3CD6N 1J6ZA 3GE1A 5A2QO 3BBCA 2CQ4A 4WFBQ 3OJUA 4NPOA 1N5QA 4U95A 2UU9K 3GBTA 1CS4B 2GC8A 4MFBB 5IOLA 1U1PA 1K0TA 4M5NA 1X5TA 3I31A 3D6TB 3AA4A 2CRLA 4HYKA 5C42A 3KG1A 1XUPO 1JLAB 2C28A 2E44A 1WJ9A 3CCTA 4I9QA 2G8IA 2C3PA 3SQ1A 1WC0A 4O4RA 1TL3B 2FHOB 1BHNA 4DL6A 5IWAJ 3RU0A 5HLFB 3QWUA 2LA6A 3O3LA 2Q2RA 3RMDA 1BC6A 1UFKA 2V63A 3MN5A 2CJ9A 3GJQB 2DH9A 3PSIA 4JS4A 3BQ0A 1HQEB 1BQNB 3I5BA 3H25A 1EWQA 2HHPA 1IKWB 5FRNA 1JLQB 5HROA 5KFTA 4KHSA 3S01A 3G82A 1UEKA 4ANCA 3FZKA 2YVSA 1C1BA 3LWLA 4OHZA 3J81U 2IHR1 1N34J 4OGCA 1KRPA 4OFZA 4QR0A 4HUGA 2P9UA 1IUJA 3JB9k 1JLGA 1R8HA 3Q8PB 2NRTA 2F4VJ 4Q8FA 1BUXA 3D3BJ 2PN6A 4LF9J 3MCAB 4JI4J 5DS7A 1P9YA 3SMZA 1RTZA 4BG9A 4B3OA 2HK2A 3QB0A 4NOHA 2DY4A 2FLPA 5ETPA 2VPZB 3QFUA 3VQSA 1VQ7S 1RWVB 4DV7K 2RF2A 3T9NA 3OTBA 4DX8H 5HL7Q 4FF1A 1VQMN 2J0SD 5FDLA 1IBCB 3BH7B 4DX7A 4DR6J 4ZN3A 4OYOA 2DHGA 4FLUA 4KGMA 2K7JA 4YDDB 2K8GA 3D1QA 5LMUJ 4ZPTR 3O8MA 4WWSA 5LXYA 2GCFA 2OO4A 2ROGA 4YR2A 3CDBA 1SXLA 1VOMA 4B9VA 3J80U 3SAHA 4CM2A 4Z94A 5HK4A 3OJSA 2DEJA 3V81B 2AV5A 2L9NA 3L7UA 2X7IA 4PYAA 5KFHA 4BQLA 4QOTA 2AU0A 1R27B 3I87A 2B4JA 1MWKA 3BZCA 1RISA 5B08A 4PWDB 4FK4A 1IG9A 5CCMA 2KI2A 3BF3A 4Q2MA 3F73A 3U4LA 4FLZA 4NLSA 1T9WA 5KG5A 4H4KA 1U1QA 1WBBA 5JVGQ 1RA7A 2B56A 2CZ9A 4F67A 3M1VB 1VQ6N 1AUDA 5GADU 3W7BA 3MR5A 5BN8A 3THYB 4F2SA 2KDOA 1OQ3A 2NCKL 4HDGA 1DTQA 1P8ZA 2Q66A 3ILIA 3WXMB 2FHJD 5E3CA 3SYZA 4JI1K 4O0IA 4Y3CA 3H6EA 3ENAA 1OY8A 4JYAJ 1OPZA 4USIA 4CJEA 1CLQA 1B9FA 3NF9A 3ZX0A 2DO0A 2WFBA 4DR4F 2AEMA 4EK2A 1RYRA 2HNDA 5D8HB 2DGSA 1NJIT 2MZRA 4ED1A 4DF4A 1YJWN 5ITHA 1E6VA 2APOA 4M8LA 4IFVA 3JTNA 1IBKF 1P6TA 1GTEA 2WVBA 2A1SA 1XBWA 3HOTA 3GIRA 4X4UA 1JJHA 3NE6A 4RLEA 1IBMJ 3LANA 2HLTA 4USMA 2NRZA 1RAHB 4USKA 1N0UA 4RPFA 3RBXA 1GMWA 1VQMS 2FBVA 1I94F 2HS0A 2E5LK 5K8PA 1VIXA 3TJ8A 3C8YA 4A61A 3J7Z5 3CDAA 2HRTA 3TAMA 3RMBA 3CTRA 1FW6A 3EZUA 3WXJA 1LK7A 5FLXU 2RE1A 4NEZA 4DL7A 3A8YA 4Y1CA 3MWTA 1FRXA 2V8GA 5HATA 3E01B 1IWAA 3K59A 2R8KA 2AJQA 1YTAA 1QD1A 4L75A 1FDDA 1RWUA 5JJBA 2EKNA 4FPBA 2B9YA 5F2RA 2J4RA 3ET6B 2XCPA 3DOKB 3TWZA 2CQ3A 2N7CA 3LPTA 2E5GA 3HP6A 2H1YA 4C1NI 2HHWA 3VQCA 1BXNA 2HBQB 5KRSA 3U27A 4X65F 3QMLA 5TKWA 2DD8S 4WP8A 1H74A 1OH8A 4AQYF 3RBDA 1HNWK 1PYSB 1VQ6S 7FD1A 3AVMA 5L38A 3OBYA 4C0HA 2ROPA 1J9AA 2E1PA 1D09B 1Q53A 1N5SA 5C2GA 1VK3A 1NNEA 4L6V3 2J76E 4DPYA 1WSJA 4C7QA 3BN4A 3SMPA 4Z4FA 4CHPA 3GV5B 1NDPA 2EHGA 2CNKB 2V5HG 1WAJA 2JFDA 4ER8A 1RT6A 1YJWS 3HSDA 4DN0A 1ZXOA 4C48A 3QDKA 4ITSA 2PO4A 3BKFA 3RUBL 4HWIA 1XNQF 5LL6Z 3EVOA 4FYDA 3O1BA 2CFXA 2POKA 2R7TA 5EWEA 1NJWA 2V68A 3O9SA 3O6QA 5LJ3Y 1KLMB 3KLIA 4K4VA 4CHOA 1DURA 3DRRA 3R1XA 4P7VA 2OJ3A 3MHYA 4K0KJ 2IS3A 2V94A 2Z1IA 2W9BB 3NGUA 4BE1A 1X31C 3FCWA 2KXFA 1KAXA 2BM1A 3G96A 4ECSA 3BY5A 1J54A 1OS5A 2ZKUA 7AT1B 2Z1JA 5F41A 1YVUA 2P9LB 4I56A 2VICA 2ZBQA 3OUYB 4NXNJ 5LOQA 2Q36A 3HI0A 2LEBA 4WFNL 4W98A 4FJ8A 5KQDA 3T6JA 3R3TA 1RWPB 3Q86A 4OZ5A 3SUQA 3D1OA 5FIIA 1A0OB 3T5JA 2ZZNA 3TEGA 1S1TA 1F3VA 4RUBA 1KFSA 2V6AA 2V8PA 2A3ZA 3MWPA 4KHWA 4NASA 5JMVA 2LECA 2H5EA 4IO9Q 2JEIA 2BH1A 1BO5O 3O3GA 3TJ9A 1HHTP 1KHWA 4KV8A 2AIRB 4RX6A 1NSKL 2ZKTA 2DGOA 4RJVA 3VAFA 3SBMA 4QIVA 4CBXA 4JI0J 3V9ZA 1HMVA 4QPXA 3RMCA 4E7JA 3W8PA 4J5OA 1BI4A 1IJFB 2KYXA 3CVKA 2EW9A 5FPMA 2RHQB 4NI2B 1BQXA 2FZKB 4YOWA 4KHPK 2ASLA 5KI6A 3TAEA 1RWNB 1B3TA 2DTJA 1NH7A 4O0JA 1MNEA 1K6YA 4FJNA 3VEYA 2FPHX 3B54A 5CYQB 1ZTTA 1OKJA 3WNFA 3ZSZA 4F4WA 3R3LA 3ZETA 3J7ZT 4DPXA 1GK8A 4I6MA 2HHSA 1TTHB 3W64A 3CCVS 2CWXA 2N3OA 5J1EA 4H5WA 3RR7A 4H03B 2HW3A 5JMNA 2E66A 4FSVA 5KGXA 1QSYA 1HBUB 3QBCA 3NGTA 3J81j 1RBVA 3MK6A 4GO7X 4EP4A 1H73A 4K4ZA 2DNHA 1Q8IA 5AJ3F 4F7VA 1URRA 1SC4B 1M5KC 5B0FA 1IBLF 4DV3K 1R8PA 1CJVA 4ZS6A 2J9DE 5C2CA 3ONQA 2G8WA 4R0JA 3Q8UA 2HVIA 1U1KA 1U7LA 2UUCK 2HHQA 3CJQA 3BO4A 1ITGA 1VHIA 3HSCA 3LGMA 3GWCA 3I6PA 4QYZJ 5KFDA 9ATCB 1UJ5A 2IIHA 3Q8YA 5B0DA 3TEHB 4F3TA 3NL0A 5I42B 4M3WA 3G8QA 1S1UA 1Q8KA 2VQFJ 2CUYA 4DR7J 3SDEB 1GMVA 1WSIA 1CZ9A 1HWKA 3D0HE 5K14B 1HWUA 1UCNA 4PXCA 4N7TA 1JJ2R 2IAJB 1UMJA 1REGX 1UAWA 4LF2A 4OX9F 4RNNA 4DL0C 3M05A 4OZ0A 1WEXA 4CEBA 4OLPA 3C6UA 2H3GX 4CQ1A 1ZH5A 5E5NA 2A2DA 1RJJA 2XHWA 2C2KB 2W2OP 1Z6RA 1ZC6A 4QWAA 3WHIA 2ERRA 2J0WA 3PCOB 5HMYA 1ZBIA 2BX6A 3CCZA 1EHWA 3TU5A 1H2UX 3VA3A 4LIRA 4FYVB 3W9HA 2B8PA 4O23A 4AT1B 1TL1B 4XIUA 4DSIA 4EFHA 4GRSA 3PR5B 4I7FB 4MKAA 3ENVA 3NLCA 4CNZA 4K25A 3VF4A 1A5XA 2F8MA 5IV3A 4IWVA 2DNRA 1CLFA 1OIAA 3T5LA 3HHLD 5F3TA 4Y34A 2PIIA 1I3AA 3TX8A 5THWA 2F7TA 5GAGP 1HBMA 2HQGA 2NYHA 4PG7A 5E84A 2LMIA 4ED3A 3POTA 2GZOA 1LQ9A 4ZPBA 1CJKA 5D0RA 1XQIA 4YR0A 2WCXA 3BUZB 2BZ2A 1X60A 3K5PA 4LT6A 2KM8B 1L5UA 5BRFA 3VWSA 2QTDA 3W60A 2BTFA 3QRQA 4ECYA 3MUVP 4RW7A 1WF1A 1V3RA 2HURA 4O55A 1KS2A 1HNXJ 1YSJA 4TYBA 2J9DA 2FVPA 2A6OA 3BP8A 3HRGA 4X64F 3FGUA 2G2ZA 3GFXA 3MMAB 4B3RF 4E3SA 3JSYA 1WI8A 3DGPB 3UNGC 2IM0A 3RJMB 2BE2B 2YX6A 4ISFA 3KUGA 3OSNA 2BGGA 2LEPA 2VD3A 3BEXA 2XY6A 3AQOA 4BWJA 3VR1A 4HI2A 1X4HA 2DNZA 4HEA9 3QZ8A 2E8AA 1C1CB 3MEEB 3AAWB 4OYMA 2CVEA 4QJVA 1EIYB 1HNZK 2GVDA 2BMBA 2QK9A 3CIZA 1W2BR 4FPAA 2ZNYA 3VAIA 3TQEA 4C0OC 3P96A 3H1QA 1U0SA 2Y8YA 2R7XA 3TZZA 3D2FA 2RHKA 4CF0A 2ZJPL 2RUSA 3ULEA 3I55N 3ZTPA 2MZTA 3W62A 5HRPA 4JOUA 3C46A 3D6FB 1GX5A 3IR6B 1VSHA 1NM2A 2VYPA 4DR1F 3Q89A 4RO0A 3E8OA 3T1HF 4ZVPB 1KAYA 5IM0B 5LXRA 3SIPB 3C3LA 1NMNA 2AJFE 3D45A 3BGLA 3GR1A 4L73A 3A13A 1FNXH 1X8DA 3FZFA 3CMAS 1RDWX 5KT3A 4N41A 4G6VB 3AVFA 3EKSA 2M88A 2ZJRL 2QWQA 1S6OA 1DTTA 3P3DA 4EGLA 2RJZA 3SFUA 3KG0A 1JCGA 1VAZA 4JRQA 5E2QA 3OT9A 1R8BA 4Z37A 2BKPA 3N4PA 4WFAL 3EGWB 1DKGD 4ELTA 1T05B 2UXCK 3OTOJ 1S72N 3VGVA 5ETTA 4YB5A 5HI7A 1VSEA 2OLWA 1XN9A 2ACMA 3TANA 4C8ZA 1VBZA 1S0OA 1KQSM 1NJYA 1A9NB 4F3QA 4RNMA 2MLXA 1GEHA 4NXMK 4JBCA 5KG6A 2PBDA 1D8ZA 1WTBA 1B0VA 3EL2A 1FE0A 1WEYA 1CQMA 3CCQN 2HHTA 1NEEA 1V3ZA 2N4DA 2KQ2A 3MECB 1SBRA 5C0YA 4J9SA 1K0VA 3SMSA 3VQ5A 2RRAA 3NBPB 1X0FA 1YDLA 4O0NA 4UQGA 1L3VA 4DU1A 5AXLA 1YTUA 2ZUAA 1KNZA 2O5DA 3UI3A 3EPIA 3W5YA 2VASA 3CYMA 2QLXA 2UYTA 1JL2A 4IUFA 2ALZA 1RT4A 2MQLA 1AFJA 1OSCA 4KHMA 5EWFA 1SJ1A 3NVKA 4B3MK 5CYJA 2DPIA 2XZTB 4CESA 1BU6O 3BPSP 4LR7A 4LBHA 3OYAA 8RUCA 5BN9A 4IG3A 4B17A 3CC2N 2CPFA 2OKQA 3PO4A 4OHWA 2D7SA 3NHGA 2YHXA 2W7AA 3DOMB 1NLKL 5IT9U 3M3ZA 4MK9A 1JXEA 1J5EK 3MR2A 4G1QA 1ZAWA 3U9ZA 3U6FA 1RAOA 2CJKA 3DJCA 2E1CA 3HVRA 4XDCA 5HMWA 1TUYA 2QV6A 3W3SA 2B6AA 4PAAA 1X5SA 4WTOB 3OFGA 2YY3A 2HHHJ 5I3PA 2HSEB 4OJRA 1X4BA 1TKXB 1Q9XA 1HNIA 3VENA 4DV2K 2XQCA 1TQLA 4MKYA 5M1KA 1HBNB 4C8NA 2QL5B 3O9QA 4LF6J 4ILRA 3LM2A 3S6EA 1Q79A 2HZAA 3TJAA 3M9OB 5ELZA 1HR0J 2AT1B 3KDNA 3I5CA 2ASJA 2IDOA 2R7UA 4F26A 3QJLA 5KGWA 1C0TA 1JIHA 2E20A 2W2MP 4NEYA 3QBXA 3CCQS 4ILLA 2OEMA 4L3KA 1VS3A 4BRIA 3KWGA 3THPA 3ILOA 3MD1A 2P5GA 2W9AA 3OVSA 4FJHA 1RHKB 4KO0A 2K2PA 4NYFA 4FW2A 3R97A 1FJGK 2MXYA 4RBUA 2KVIA 1NG9A 4LFCJ 3CD7A 4CGFA 1TVRA 2IJRA 4PEOA 4QPTA 4OHYA 1Z4UA 1DBDA 2HWTA 4JK7A 3LDNA 2AYMA 3CB4A 5HP1B 5KT6A 4CK3A 3MMCB 2XLIA 3H5XA 3OR2A 5A2QY 3SPZA 4BGAA 3ZX2A 2AX0A 2JLGA 1ATRA 2UXBK 1RT5B 3CC2S 1TYQB 2Q3SA 1BIUA 3M6GA 2WRMA 4B9QA 4HT7A 1VR6A 1X4CA 3BREA 3A5OC 2ROEA 2MY8A 3TYTA 4OX6A 3QYYA 2E9TA 5DQHA 2IGIA 4DV5F 3MEDA 1RAIB 2CADA 4GVLA 3SNNA 2O8BA 1LOUA 2ZH4A 3LDLA 1FRIA 4RW6A 1ILYA 5AQJA 1L3SA 1VRTB 4NE9C 2CJQA 1IXKA 3ISZA 3IRXA 4DR3K 1JLEB 2NXUA 5FPEA 3CJ0A 3OYIA 2C2OB 3SCJE 3CJBA 3D2EA 1DY3A 4RW4B 3CIMA 3MUTP 2HQ3A 3MM9B 1T8EA 1BHLA 2X1AA 3HOSA 4BS2A 1RK8A 4CZJA 3QSIA 5DDRC 1OSDA 2ZNZA 5AQQA 2IMWP 4JKGA 1T9VA 1AT1B 4A8QA 2ZD1B 1IKYA 1ZPWX 1XTZA 2CPEA 3OTCA 3AVJA 3PIOQ 2Y9HA 1SI9A 4IFEA 5A8WA 1H2VZ 5AQVA 3VQBA 2PY5A 4FNHA 5M1QA 4N77A 3W2WB 4NLTA 2HF4A 2RH3A 4H5TA 4DX6A 1NJIO 2RQ4A 1IG8A 3EZOA 4KH5A 3DRSB 4KHRA 1SC1B 4KY3A 4DUZJ 4M5KA 3AXMA 3MFIA 3FCVA 2FHMA 3PKYA 2ZVSA 3GFHA 3GOIA 2XMMA 3HTVA 3I9V9 3OD2A 4W5RA 3RGIA 3ALYA 4OI1A 4CW7B 5CHIA 3T1YF 5HN0A 4O3QA 4AH9A 4CI0B 3PRDA 2UXDJ 4R8UB 2Z58B 3MMBA 3M32A 8ATCB 3N01A 4LRFA 5KFLA 4K5SA 2DITA 2AMCB 3HXMA 3RR8A 2V7ZA 1N34K 4BRLA 1FJGF 3OVAA 3L7PA 4JV1A 5HRRA 3HK2A 2HS3A 4L74A 4GY2B 1T9TA 4BDPA 1XNRK 4QYRA 5DM7L 1YT3A 3VZHA 3OFHA 4BRMA 2D5RA 2XMUA 3AOCA 5KFIA 4WK1A 3RB6A 4HLBA 1RU1A 1VLYA 1SJ3P 4JI4K 1H6KX 2NPIA 3FBEA 4GVBA 4IOXA 3CE8A 4C11B 3A5MC 3CFPA 3KK3A 3MXIA 4PUOB 1TKTA 2DNYA 3DXKB 2OZMA 1KR4A 3ZXWA 2DKOB 3MN7A 1S79A 2OGUA 3WIVA 1GLCG 3SI8A 3RW6A 2CH6A 2GHPA 3TAPA 2D1CA 5LSRA 3BR9A 4IDKA 4CEQA 5FD1A 2GNKA 2ZOGA 1VRUA 2ITGA 3G6VA 4JI7F 2DISA 1KVKA 4BE0A 2ZHOA 2CG8A 2V67A 2DFEA 1XEZA 4P2XA 3KFWX 1HPZA 2E2PA 3AH6A 4F02A 5AE1A 5EX5A 2OPSA 2O8CA 1JLFA 3AVAA 4FZYA 1REVA 4X4SA 2SXLA 1BWVA 1FK9B 2HQCA 3QICA 4LF4F 1VMBA 2EX3A 2QJ3A 3D6RA 5J1NA 2DCUB 1X9SA 3LPUA 1MWQA 5LJVA 3IXQA 3OL9A 3GPAA 2RDJA 3WXIA 4MIAA 3DLEA 2CNNB 2YNHB 3B6OA 1RKJA 4K41A 1T9UA 4EBDA 4DV6K 2W1BA 4F4KA 2X1BA 3PKMA 3CCMN 5EVZA 4DQIA 3HX9A 1T9XA 1Y10A 4CVNE 2LVWA 3L4BC 3Q2SC 1VQKS 2EG1A 5IWAF 4B9LA 4JYAK 2ZHBA 3CCLN 3FFIA 4ZCKA 5KFWA 3H5SA 2MQNA 3MMJA 3AHPA 2YNIA 4IOCL 3MR6A 4U7UK 2JHEA 2GWKA 3J7YI 4FLTA 4H0TB 4AFFA 3SCLE 3T5KA 2VQEJ 2HB5A 1Q1KA 3PHTA 5HANA 1CXUA 1X7VA 2DNGA 3DYAA 3VCDA 3QT5A 1SUQB 2NRWA 3LP0A 1IBMK 1IWGA 2XSJB 1QY7A 3PEHA 1HYSA 3THWB 1OH5A 3TAQA 4ZPWR 2HNZA 4OPJA 1F2GA 3I8BA 2ASYA 2UZAA 4L76A 3FMBA 4X66J 2B43A 1HLUA 5M1OA 3NP5A 3HPGA 4J9QA 3BSOA 1VQPS 3HKWA 2V0NA 4IRDA 2F4VF 5LY3A 2IM2A 1S1WB 4YUDA 4H4MB 1QZ5A 4MAKA 2CPHA 4LF9F 1DLOB 1DGKN 2J5AA 3O3HA 5H9EJ 3LW5C 4J9OA 1S6QB 4DTRA 4BR4A 3CQ8A 3T9ZA 2P5OA 3BJYA 3MPWA 1U2VB 4LRAA 3T7ZA 3QPIA 4TY9A 2AJ1A 3OYGA 4J2DA 2GBZA 2DT9A 4Y2MA 2DGQA 3R7SB 4UY8T 1Q86T 2RKIB 1GLDG 4WQ4C 1ASUA 2MSTA 4LFAK 5AFUH 2HGLA 3TZWA 3KK2B 1IKVB 4DR6F 1SB6A 4FKXA 3PIPQ 4H4KC 4J9PA 3P8BB 1NUEA 4IXCA 2P5VA 4DMNA 1K1QA 3A0IX 3L2WA 3KLFB 3F2KA 1RTDB 4XK8C 3AD7C 1RACB 3J7ZO 4LJMA 5LMUF 2FYXA 5H1SQ 5DMRA 3TZYA 1JKHB 1N32K 2QXLA 3GSIA 5AQMA 1JLCA 3CCMS 2DY9A 4NMLA 3HPHA 3FGVA 5ETMA 5J1PA 3I5AA 2RD5C 5KFMA 5H1SV 3TVZA 3A8JA 3TTDA 4J37A 4ZP8A 2MYFA 1Y4ZB 1VHXA 4ZP6A 3W66A 5AQIA 2FY8A 3BGRA 2ZJQL 2VONA 1RAAB 4KR0B 4WXOA 2OYQA 1FCAA 1ZPVA 4AXIA 2Z1HA 2XYGB 3KXDA 3H59A 3EGNA 2BANA 2G8HA 2HHVA 2IDEA 3FC9A 1BCOA 1FX4A 3SUPA 3D1HA 3PNIA 3NOGA 4LF5J 1M5SA 4CYUB 1HD0A 1B99A 4G1IA 3K5OA 5ADZA 4FJXA 3QINA 5D4PA 3UCUP 4RR5A 4ES3A 2C2NA 4O3SA 1RTHA 2E7XA 3W2VA 4B1WB 5RUBA 2AYBA 2DHAA 2AA4A 2BUPA 1VI7A 5FROA 2X51A 3X1LB 3KHRA 1QVFR 1NGFA 2Q6CA 1RT3B 2HMIB 4YHHF 4ECQA 2RE2A 4Y2AA 3ZNJ1 4LFBJ 3HJFA 4NLRA 5A0YB 1M5OC 5KFQA 3BSCA 2IA6A 3EE3A 4NRTA 4FJKA 2WVFA 4ZA1A 3HMJG 1LWFA 3N9UC 1IBMF 3AO2A 1JJCB 4DSFA 2CZ4A 4HTJA 4O3NA 3SUNA 2ZM6J 2HVZA 5G0RB 1S1VA 2CPDA 4QU6A 5BR8J 2VJUA 2NRXA 2JWLA 4CLKA 2BJ1A 2XY5A 3VGMA 2Q79A 4DFMA 2Z56B 4FVUA 5B7WA 1ASVA 3TA0A 2ZH7A 1S3XA 2A40A 1CS4A 1FJ7A 4X4TA 2W24A 3OV7A 4FXVA 4MFBA 1QVGR 4BR0A 2D1KA 2CG4A 4CO3A 1QE1B 4TVAB 2KFNA 4DF8A 2DGUA 3UW1A 2G4BA 1JLAA 2Z2YB 1KXPA 8AT1B 4KJIA 3R8YA 1QHTA 3V2UC 3C6HA 5DG9A 2PT0A 1TL3A 4DPTA 1H2TZ 3OYKA 1XHXA 2A42A 1R59O 5HLFA 1W26A 5KTQA 2OANA 3CM5A 5IS2A 5CR4A 2RDDA 4CZIA 2N7YA 3KHGA 4CJ4A 1ITPA 2F63A 4ZTJA 4WJBA 3E66A 3PSFA 1HQEA 2OMOA 1BQNA 4NZ7A 3NCRA 4LUBA 1IKWA 3B82A 2BE7D 3CD5A 1JLQA 4J90A 2C2RA 4K2JA 5AXNA 3JYTB 4JI8J 1HHQA 4C3KA 2QI2A 2FJXA 3ZO7A 2RSQA 3AA8A 4IO1A 3KJQB 2QMUB 2CPZA 2VFUA 3CMES 3AVKA 1S10A 2ATCB 5KFZA 3WX8A 3AJDA 4ZP7A 4RCHA 3ZZTA 2F8HA 1NAQA 1VSKA 3ZFVA 1S77D 1WDDA 3K8WA 2ZQBA 3HZEA 3DU5A 3HM8A 4RBVA 4QYZK 4A62A 4K0KF 1NU4A 5A76A 4BRQA 5AR0A 4F4XA 2NREA 1K73T 3LZIA 2UUBF 2AZ1A 1FD8A 5KFXA 4USWA 3PYDA 2J7KA 3TO8A 3SBTA 3GTYX 4DFKA 2DH8A 3A8KA 4M5GA 2P9NB 4JS5A 2YTCA 1T6DA 3K17A 2XMTA 3FQLA 4NXNF 4YORA 2NZCA 5BPLA 3VQAA 1KVJA 1JNZB 2YWEA 4RUCA 1CPZA 3V81A 2YKMB 2HAFA 1N0VC 2IYIA 3NS6A 3FSIA 2QKKA 5E0OA 4PWDA 4M3XA 1Q4RA 4MH8A 4NYPA 4FLYA 1QJHA 2HRYA 2VC1A 1UTAA 3QBWA 4JKFA 3HFKA 3GYXB 5KFAA 1F60B 2OPRB 3C2PA 4LF8J 3M1VA 2CXEA 3AA9A 3D6HB 4JKAA 4L3NA 4A4JA 3ASMA 4F0KA 3THYA 2DPJA 3ZSXA 4JI0F 5CA5A 3B4DA 4KFBB 1FXLA 4YOUA 1NOZA 4J9LA 4FJMA 1HWLA 4DWIA 2ZEJA 2KRRA 4IBNA 1SC6A 2I1RA 1SVDA 3SAFA 3DLLL 4KE5A 4M41A 2X74A 4DTPA 4BR2A 3CNQP 3QERA 2VPWB 3K2PA 4K4YA 2FVSA 3NG8A 3IR7B 4WFBL 4P6QA 4J7CA 1VQ5N 4FPIA 1XC9A 1RABB 1W2BM 4B02A 6AT1B 1H98A 1RDUA 3HLUA 4QU7A 1B7FA 3P4UB 1RB0A 2FJWA 2Q31A 4OGEA 2R4FA 1YITS 3LZJA 3QEPA 2LFVA 3FRZA 1YK9A 4IOAL 1C0GA 4BRHA 1LWCB 1XI1A 1XJWB 3E01A 1U24A 2BJEA 4IR1A 5BPMA 5KFYA 1MWMA 2GGPB 4FOEA 4Q5VA 3IBCB 4NLVA 4CZHA 4CH0S 1W9HA 1SIWB 3BR8A 1FEHA 1LEOA 3G2XA 2Y0SD 2QWOA 2B9WA 3DOKA 2P2CB 3EE9A 1WOOA 3IWXA 4JKDA 3N79A 3O4QA 2VQFF 4DR7F 1LW2B 3MTJA 3G71N 3H3NO 4I0WA 4P2MA 4ECWA 2QA4G 4PG8A 3R8EA 1TKZB 1FKAF 3M8PB 4ISGA 4U8YA 2IRXA 4ED4A 4GMKA 4MDAA 4JI6J 1SZ2A 2F65A 4Z4EA 5JS1A 4DTOA 3BBFA 1IM6A 1S1XB 1K44A 3X3UA 1K47A 3P6YC 2XCAA 1HKCA 2W4PA 4P9SA 4M5HA 3F44A 4E7LA 3ENBA 3SSQA 2XMJA 3R1HA 3IGNA 2HQFA 4CF8A 1PIEA 1WG5A 1G7CB 2R8HA 1BOTO 3IRWP 2UVRA 2IOCA 4B9NA 4V1Ak 5U47A 3CJ1A 4OI6A 4ZLNA 4XEIA 4ILGB 2C2MB 3SAGA 2OUGA 2VC0A 3GIIA 3WC2A 3ILLA 4FYXB 4DHVA 2F9JA 2P9KB 1OO0B 1UEVA 3HD1A 3N28A 3R2DJ 1KLMA 4XH1A 1MDUB 3RB3A 4ZVEA 3PO5A 2CVIA 2D9OA 5F8HA 4TU8A 2LKZA 1U1NA 4WQ5C 1NPPA 2FBYA 2PE8A 4HT5A 4ZLLA 5EU7A 2W9BA 3SFGA 1C1AA 3V9SA 2K3KA 1D1UA 2E2OA 5HJYA 3SQ4A 2A0FB 1HNXF 3QFPA 3TABA 1Q78A 1S4EA 4A8KA 3U1NA 1WAFA 3N5BA 3Q2TC 1TK8A 4RTFD 4ZPAA 3DRXA 2FSKA 5GADI 3O44A 2P9LA 3JQKA 3OUYA 4Q43A 1Q16B 4ZJLA 1NGCA 2DIUA 4K5RA 3IBWA 3SV3A 3AO3A 2H5IB 2EBGA 1WSEA 2J9CA 4GV6A 3LQVA 4FJGA 2HFVA 3W9JA 3G71S 4ECRA 1WBDA 2BACA 4ZP9A 3J7YP 2BRKA 2EPIA 3PY8A 4LF7J 1F2HA 2CA9A 2RVJA 4ED5A 3H5UA 4LH4A 3WC0A 2GA7A 1K8KB 3LAKA 4FWRA 3GV8B 3G4SS 4DUYJ 1WOPA 2FJAB 1U49A 3WEEB 2XULA 1VQLN 2QIFA 3E3XA 4FWQA 3AB2B 4C8KA 2OPQB 2B0GA 3U3GA 4LSZB 1Y3KA 3K5LA 4DB3A 4DTXA 4CK2A 4CZGA 3CSKA 1SJFA 2ZH5A 1X4AA 1NO8A 2XHBA 1F21A 2MQQA 1YHQN 2Y1JA 3I56S 4KTZA 2NRRA 3O9TA 5FJ4A 4UOGA 2E2QA 2GUPA 5CYQA 1X4DA 4M5LA 4DV4J 4EEYA 3I96A 4LC9B 4CLZA 3WZ0A 4URQU 2D3UA 5IT9O 2PFDA 2WAQD 2QRRA 5CE3A 3NCQA 3BM7A 2G0IA 1HBUA 3AVLA 5GAHU 1QQCA 1IO2A 5DM6L 1E6YB 1SH3A 4I6YA 2FZGB 5AXKA 5CYMB 3I0RB 3OTOF 3VPZA 2RQMA 1WC1A 5IC6B 4A48A 3H98A 1XWLA 2I0XA 2VZ9A 5D77A 5FPDA 4LR8A 1F1BB 2ZITA 2NUUG 4J9NA 2E29A 1LWEB 4ED8A 4YY3J 2RIJA 1S49A 4J2AA 4OO1J 5E3AA 2KH9A 4DR2K 3HYFA 5I42A 5LMNJ 4NLBA 1OWXA 5T41A 2BW7A 2K7KA 5IT4A 3AD9C 4PQAA 3SDEA 4QS9A 1UJ6A 3IS9B 4ZVTB 4ATNA 3AOBA 5K14A 3ZT4A 2B5JB 1NHVA 5AQUA 2QC3A 4H5NA 2IDLA 2IAJA 1C4AA 2EK6A 4OPHA 4Q45A 1Q82T 2D41A 1NZ8A 2AJ2A 2PAVA 1FXXA 4CJQA 3HVWA 4FNIA 4OL8A 5HRSA 3D0PA 4OZNA 1VQLS 4M5JA 1OVQA 1X3NA 4OYAA 4KTQA 1O13A 3NRBA 3MAQA 3DLBA 3AOAA 2ILZA 2E5JA 3AA3A 2G8VA 2VPXB 4BBYA 3L7OA 3EVWA 1ZM9A 4ZHRB 5IT0A 4CEOA 3UQSA 1D9DA 3VF2A 4GW6A 3KJNB 1EQYA 1N52B 4DZ6A 2UUAF 2P9CA 5BR9A 4FJLA 5KQ8A 2UV8A 4I6WA 1XERA 4DU4A 1TL1A 2IMOA 3J8AA 1JB0C 4I7FA 3FJ2A 2VFSA 1T03B 3H3OB 2PMWA 3LTOA 4FVCA 2VHGA 4CJ5A 1UA0A 3J7AN 1VK0A 2QSFA 3P83D 1VBYA 4U67L 5KFEA 2HHHF 1NGGA 1J5OB 1F3FA 4V19S 4DQ8A 3CGIA 2GAGC 3KWMA 3FNNA 4NA2A 3B78A 3QEIA 2ZE2B 3PJXA 2VBYA 3PW2A 1KQGB 4LF6F 1YI2N 5KG3A 4ECZA 1S0VA 3Q22A 4CZKA 3GG0A 3PTWA 3P38A 3W61A 5M2PA 4BHQA 4GKJK 2IVFB 2YV0X 1LV5A 5C25B 3MEKA 1HR0F 2BE9B 4URGA 1WF0A 2KHOA 3CC7N 5D3GB 1YTYA 3CERA 4UUXA 3MMAA 3UWTA 2U1AA 3T41A 4KTWA 1RQ0A 3WQTA 3NGIA 4B3SK 4X62J 3L0QA 2HOEA 3DGPA 3QGGA 3CPEA 3G87A 1Z1ZA 1SJ4P 2BE2A 4IO9L 2VIHA 2QMXA 1MW7A 2XSFA 4JI5K 1U8WA 1YRUA 2D3OR 1U6FA 3LF0A 5CABA 1VSIA 2N82B 1C1CA 3MEEA 4WF9L 3SQGB 2RUGA 3LM9A 1A6LA 2H48B 4LFCF 3LPEA 4GMJB 2G0CA 1FX2A 3CDUA 4F3OA 1OYEA 3GR0A 1NGJA 2MJUA 3UKRB 4CGDA 4DCHA 2YBVA 3DMJB 1FFWB 1KQKA 2G8UA 4WIIA 1Q86O 1BLUA 3TARA 1RADB 4GNIA 1E4GT 4C97A 2HBLA 5GIPA 3KHLA 1T6CA 4CGJA 2M2BA 3RAQA 1F9FA 5IM0A 3RG6A 3Q0AA 4IFYB 2BKOA 2HZVA 1UEUA 5A6PA 1VQNN 2C22A 4CIOA 4L8RB 1O1WA 2B4VA 2ILYA 4FWMA 1U1RA 1NMEB 3GFZA 4CEFA 2QL9B 3VVUA 4TN2A 1U6ZA 4FS1A 4MYTA 3R9PA 2IVNA 4AYBD 5AQPA 2ZVIA 5L46A 3DHWC 3OYMA 3H7HB 2P6TA 3HF5A 4YB1P 5HQ8A 4YDUC 1U8SA 2YQ3A 1RDBA 1RBLA 1SAZA 2D0AA 4LR9A 3GFYA 4DLEA 4FJ5A 1NK9A 4JLHA 1YI2S 4ZVSB 1T05A 4BC2A 2Z2MA 4HKQA 4WFNQ 1NK5A 2ZBIA 2DYAA 4HTUA 2ZHAA 3HM9A 1R6YA 5BRHA 1MN7A 3JQJA 3QNWB 1JX4A 3KLEB 3HT3A 2BABA 2F96A 1WG4A 4ED7A 1D0EA 1WOSA 3C19A 3BB5A 3BGOP 4NZ0A 2GHWA 3MECA 4ES2A 1FHTA 4PPDA 3CJKB 1T3VA 4BACA 3NBPA 3CJ3A 3PLAA 4ILJA 3QT7A 3M6VA 1NK4A 4JK8A 4ERDA 1N33J 4DUZF 2VG6B 3NF7A 5LL6d 3MCSA 3H42A 4OLBA 1S57A 1WUAA 1KTQA 1BG3A 1NWKA 2O66A 4Y2IA 5HVGA 1FT8A 1M90T 3VGKA 3N6LA 2HBKA 2UXDF 2OIHA 2MZQA 3DGVA 1TU0B 3LL3A 1YJNN 2QE5A 4C8MA 4ZCLA 1EXQA 1XQSC 2LDYA 3UR0A 3MM8B 4BR9A 4WPAA 3SQ0A 3R5CA 3S7RA 1VQNS 1BGXT 4UF4A 3OL6A 3AJ1A 1VISA 3DOMA 2B51A 1RLDA 1N88A 4LF1A 5AE3A 3F5TA 4ZPVR 3NAEA 4DCOB 2JZ5A 4QWBA 4PHTX 2DGXA 3C7NB 3AY0A 3PDNA 2YI1A 1VBXA 3AO5A 1YGYA 2MQMA 2V4RA 3VGLA 3VMFB 4ID5B 4JI3K 2M3DA 2QLWA 3D28A 4BRKA 2MGZB 1TKXA 3VQ9A 3FSXA 5DDOC 1WELA 2W4DA 2E5HA 5DDQC 1HBNA 3C14B 1BL3A 1H7XA 3UB5A 3HHLB 3K7RA 4NLGA 1XMBA 3H08A 5F0XA 3VN5A 5BPNA 1NDLA 1T3NA 1C0FA 1AYEA 4JKCA 2HFOA 1FKOB 4NLUA 3QFWA 2BA9A 3UDEA 5EX0A 4USTA 1HYZA 2K1RB 1GLJO 4ECXA 4DTUA 2I9SA 2KZZA 1S9EB 4PWUA 1BISA 3AVIA 1OY9A 2ASPA 3SV4A 2V50A 3HKZD 4AILC 2AYGA 2E6MA 3DRPB 2LLZA 5AZJB 2KLAA 1Y11A 2Z30B 4JV5J 4FWKA 4OJ3A 3EYZA 4TLQA 1Y9OA 2UVUA 5A2QU 3R1LA 2DR9A 2YKOA 3HVTB 4ZCMA 3T1YJ 3A3NB 5J2MB 4BC9A 2CKWA 5HP1A 3TI0A 3MMCA 2I7NA 3I32A 3FQKA 4J2EA 4IKFA 1T0TV 5KAKA 3MUMP 3DRRB 1QVFM 3TTCA 2CYYA 5GINA 1K73O 1RT5A 1TYQA 4U9RA 5KFVA 3RSEB 1DARA 4JV2A 2H54B 4A8XA 4IZ9A 3NH1A 1JCFA 4CEDA 4FOIA 4WK3A 2V4QA 2E7VA 3H20A 5F9NA 2QEXN 3M5RA 2F9TA 3HHLC 3DU6A 1WORA 2VQEF 3NY0A 1Y5IB 5L9XA 4DN9A 2VKZG 4CI6A 3KVGA 4I4BA 4QIGA 2O8FB 4PR6A 2EBEA 1RSCA 1VRTA 1AFIA 5D4LA 3HVAA 5GAEU 1N36J 1NHUA 4CLSA 3CT9A 3SK3A 4B1UB 3UD4P 5BR8K 1JLEA 1FWKA 4OLAA 5AE2A 3FUYA 1X5PA 3M2UB 4X66F 4LVOP 1G99A 1QVGM 2JH3A 3K89A 2C2EA 2OPPB 4RW4A 2YJFA 2PA8D 3MM9A 3A12A 3V9WA 2UU9J 3L9ZA 2BJDA 1DFDA 1ZBHA 2ZH1A 1UW9A 4FZZA 4NZ6A 2R7VA 2K3IA 2NYIA 5A8KB 2HAIA 1KSPA 2ZD1A 4CJFA 4CHZA 2MKKA 3D7EO 2HGMA 3MM6B 4AHRA 1VQ7N 4O8UA 2G8FA 4NA3A 4YOVA 3W2WA 1P1TA 4W92B 4FS2A 2GVZB 3H5YA 4DCPB 3QEXA 2XO6A 2KZMA 3VGSA 2J6TA 2IA0A 3DRSA 2ZJPQ 5F1XA 3QZ7A 5SWMA 2UP1A 5EHHA 4OJHA 3KZBA 2YNFB 3ZSWA 4CJVA 2VFRA 2NNWA 5K8NA 1I39A 4TSXA 3I4HX 2EG2A 1MROB 2I2YA 2EFNA 4RZRA 3M30B 4LRCA 4R8UA 3HHEA 3B4MA 3DI6B 3IWNC 3M8SA 4ZCIA 3EWGA 1T44A 4IG0B 4Z4GA 4DR4K 2NS1B 4JD2B 3C6TB 4FYYB 3QO9B 3BS9A 2ZJRQ 3G86A 4RU2A 4UZCA 2QEXS 2XG8A 5B0CA 3PR4A 3HSJA 2XHCA 3QIOA 4WFZA 2CQIA 1HLWA 1HKBA 3DXMB 1IBKK 5HVFA 1D9FA 1H7WA 4LF5F 1OH6A 3QLHB 3ID8A 2XWYA 3BKUA 3V6DB 4USUA 3H2UB 4WFAQ 3QNNA 4HHJA 5C2DA 4C11A 1I94K 2LA4A 4DV7J 4PUOA 4LRBA 3DXKA 2EKYA 1C0UB 3SJHA 2AP1A 2YHYA 2GQ2A 3RBZA 5DJBA 3KLHB 4A47A 2ZZTA 2QTWA 2C3OA 5GMDA 4OV6A 4LFBF 2C2DA 2KFYA 2WSFC 2CQCA 3NVMA 2OTLN 2FF3B 2VOOA 4KH0B 3ZZYA 3IR5B 5MLCQ 3KD1E 1U2FA 1Q81O 4OYXA 2YKAA 3ATVA 2QWNA 4QS8A 1SJQA 2ZM6F 4KGKA 4OVLA 5MLCV 4NB4A 2V4JB 2FBXA 5BR8F 5IXUA 4P7TA 4HI1A 2ZGYA 3NMRA 1UVKA 1FJEB 1FK9A 4LRDA 3US5A 4BRDA 1HA1A 4X65K 3FRYA 4M7YA 5KPRA 2FLLA 1UZDA 2R2SA 1B64A 4AQYK 1GLFO 4O5BA 5AQWA 3SSSA 4NLYA 4C98A 2YNHA 3VQ4A 5D4NA 2JNJA 4O44B 2VFVA 4NYNA 2GUIA 4RW9B 1VCTA 3ZSVA 1BMQB 1V4TA 4JI1J 2PFUA 3KMQA 3TUJC 2ZWPA 4DUTA 2XYPB 4PRFA 4WQ4A 1NPRA 1Q8LA 3O80A 4QWCA 2J0QD 2PMHA 1S76D 2WUSA 1CQNA 5KFPA 4KREA 2F9WA 5L1LA 3MX5A 1X4EA 3SBGA 1TL4A 1GLEG 1XNQK 3M2RB 3UE2A 3M8RA 4BC5A 2YHBA 4FP9A 2H51B 1Z25A 2JJ4D 4C8LA 1IR2A 1AB8A 3C94A 2AW0A 4JI8F 1SUQA 4CFCA 1UP1A 4CJ7A 2A2CA 2LQ5A 4FW1A 2XSJA 3THWA 1Q7LB 1L3UA 1BWEA 4RG8A 3UPFA 3O8WA 2E5LJ 2PD1A 3TAGA 3T3FA 3PIOL 4CLTA 4N8NA 1GXUA 3DNCA 1VC0A 2VPYB 2FJBB 4JI2F 4YHHJ 2RNEA 2WVCA 4IKAA 1S1WA 2OTLS 3CCRN 4H4MA 3MDQA 1DLOA 4ZOSA 1PC5A 2X6SA 1S6QA 2Y8WA 4XPEA 4MTPA 2OD4A 5C5JA 5DO2A 1U2VA 4U8VA 2V2ZA 2B4PA 2HFUA 3KIOA 4HUEA 2YH1A 3TUPA 3NGYA 4HHTA 4LVNP 1MMLA 2RKIA 4F4ZA 4BRCA 2N3LA 4YB6A 3KK2A 3HFVA 3W63A 1IKVA 2LCWA 1I3OB 4A8OA 1KOHA 2KJVA 4Y2KA 3KLFA 3AO1A 4F0HA 1S97A 1HNWJ 1RTDA 1TK5A 1SKWA 4C3MA 1JKHA 4CJKA 2YX4A 4KRFA 2P9EA 3W5ZA 1UVLA 3NWRA 2EFGA 2B7BB 4W5NA 1ZAVA 4WP9A 1U0HB 4A2AA 1UPMB 3HCXA 1VQSA 4QIWD 3G6YA 2OFGX 1VFJA 4BRNA 1CZBA 4GO5X 3MCPA 4H0XB 2KTQA 1KC8T 4O4GB 2VL1A 2E4LA 3L3VA 3O5TB 3UO0A 4M1KA 5K9FA 4RNOA 2HMPA 3ZSRA 4W5TA 3N0VA 2CH5A 5M2RA 1RBAA 5AQLA 5KPZA 3O9RA 3AV9A 4LF8F 4UW2A 1M5HA 4CTAB 4CYUA 4M3YA 2B9XA 4RNHA 1SKSA 1DAXA 1TMMA 3QJPA 1WEZA 2W2PP 3HI9A 3QQCD 5CD4H 4H0OA 5E26A 5BREA 2LYVA 2ZFHA 1KN6A 3I4PA 4Q0BB 2MJNA 1JL1A 3CJAA 5AJ3K 2QX0A 3HZ6A 1IBLK 6FDRA 1Q82O 3PM9A 2IRUA 3CCRS 1RXOB 1VJWA 4OZJA 1RT3A 2HMIA 3WDOA 1KWMA 4BRGA 4W5OA 3ZT1A 5A0YA 4D3HA 4LH5A 2NXEA 4K7QA 1Y64A 2MHEA 3CCVN 3ICLA 2VCPA 2U2FA 3QETA 3ENOA 3V9XA 2WVDA 5G0RA 1LOTB 1QAXA 1TUWA 1WWHA 2UUBJ 4PPZA 1WHVA 4OX9K 2LP4A 2JOQA 3DHXA 3FKBA 3VQEA 2CGLA 3KK1B 2BJ9A 2QXFA 2FD2A 1RWXB 1FTRA 3QRPA 2QW9A 3PW7A 1NB2A 5IT9Y 4WCEL 2W7PA 1NNDA 1QE1A 3PW5A 1QAJA 1UVJA 1KVAA 2VFTA 5KG4A 4C8YA 3DLJA 2DHHA 2VG5B 3WQPA 2W2NP 3T69A 3ATUA 4Y0WA 3MGJA 2GHVC 4XDDA 4NO7A 1RGIA 5C10A 2R7SA 2VDHA 1VK8A 1KDNA 3M8ZA 3QMQA 4QZVB 4IJNA 5AQTA 1Z2ZA 3RVCA 4Z2XA 4NWBA 1NOYA 2XWXA 2GWJA 2VU5A 4F04B 2JRSA 2GFFA 2H3EB 1FVSA 2R2TA 1LFWA 4JI6F 4N76A 5KT4A 3NF6A 2KU7A 1A7GE 1KQFB 4ICLB 3TVKA 3DLKB 3JYTA 3I0SB 1BUPA 4K2XA 4B9MA 2MKJA 2JWNA 4NL5A 4B3TF 2M8DB 4M95A 4LBIA 3NWGA 4LREA 3C16B 4H8KA 3QFHA 3RRGA 4FJJA 3IM9A 4KC5A 3UNYA 1URNA 2KHDA 5CZVA 1B0TA 4DV3J 2E1MC 4AHVA 4X64K 2MTLA 1WOQA 4B3RK 4FPRA 2WB1D 3GJRB 3MXJA 3PHEA 2UUCJ 3PIPL 3R6GB 1M0SA 1RLCL 4OYZA 4NX9A 3LP2B 3KKFA 2BRLA 3E9OA 4K4TA 3O5BA 3BZKA 5M2UA 2XM3A 2OFHX 4XH5A 5DLGA 3WXLA 1R8AA 1H0HB 1CG2A 4FF3A 4QR2A 3B8HA 4G3IA 2R8JA 1NK0A 1PJ5A 4XAKA 3W3DA 2P9NA 2VOPA 3DM2B 2BKNA 4WZQA 4I64A 3CJRA 1D9AA 2GELA 1S7IA 2FTRA 1NK6A 2Z2LA 2DIVA 1HWJA 4DR1K 3CF5Q 4DXLA 3UD3P 3T1HK 2QLJB 4YOYA 1RAEB 3H46O 4F8RA 5E3QA 4KI6A 2YKMA 2Z4PA 2DNKA 1ZAXA 2AD9A 2HBYB 1JNRB 5GMEA 4J9UE 2BOAA 1GMWD 3ZC4A 3JSMB 3HD2A 3KJVB 5KFFA 4KHUA 4LF7F 2FIUA 5JICA 4A46A 1PAEX 1FWPA 2BJ3A 3ZTQA 1PJ7A 4BWMA 3OL7A 2GJFA 4TY8B 2OPRA 1Q18A 3MM7B 4DUYF 3CW2C 3BEGB 1R0CB 3C66A 4HTIA 1Y5NB 3MN6A 2EFPA 4Z4HA 2DGVA 4KFBA 4GVMA 3Q24A 3MOJB 1FDBA 2DK2A 2KT3A 2ZOFA 4CHNA 2GIFA 1W97L 1WSVA 3LUYA 3WT0A 3CMAN 3M8YA 1I6JA 4U7BA 2RS8A 1M90O 1EKEA 4MYUA 2HNYA 4DV4F 1YF5L 4TU7A 3KLGB 4KBIA 1N5YB 1RT2B 1KONA 5H9FK 1WHXA 4NLXA 2XBPA 3BQ2A 3CCUN 4JKBA 4GV9A 5DK5A 1XMQJ 1X9WA 2H4YB 3WQUA 4F9OA 1HQ2A 1UVMA 1IV0A 3N4QA 4RKUC 4E2FB 4A57A 1RWMB 4B1XB 4CNYA 3OVBA 5G4DA 1UJ4A 4Y2CA 5IZHA 1LWCA 3THXB 3EXYA 4Y28C 3VAMA 4JV0A 1M5VC 2AP6A 2GGPA 4CO4A 3N6NA 4QR1A 3OXGA 3SUOA 4CBUA 1UWBB 3D4JA 4YY3F 4ZLPA 4PKDB 5IFMA 2FGCA 4WQ5A 5AQNA 5LMNF 4Z7YA 2F8SA 3PFEA 2Q6BA 1LW2A 1TUGB 2FJEB 1NGAA 3NOCA 1TKZA 3M8PA 2IPOB 4BC7A 4KKOB 3MDFA 3UKUB 4QBUA 4K4XA 4WTYA 4X4NA 1OVYA 4LSLB 3DDNA 1S1XA 5KPTA 4QIFA 2O8EB 3FE1A 1EQ0A 3M9NB 1YJRA 1R89A 1VBKA 2HSTA 1X1PA 4H4OB 4PWWA 1R3NA 2KM8C 1V5IB 3ZT0A 1TUVA 1JK9B 4EWTA 3FR0A 1SH0A 2W41A 5JLFA 3J7A1 2UXCJ 4CM0A 2NZTA 1QM9A 1E4FT 3PYGA 3PACA 3AVNA 3CJ4A 3OYCA 2VDIA 5ETVA 5JUMA 4DPWA 2WVEA 1S12A 4NXMJ 4ZK7M 2JC0A 2O8DB 4E8UA 1NK7A 2IBOA 3VAGA 4DG1B 5C2FA 5FRMA 1YQHA 3MEGB 2JDJA 2P9KA 4EP5A 3O9UA 1S6PB 3DOLB 3CCUS 2W4CA 3AODA 2KN4A 4IQMA 3VQ7A 2XS7A 1NRKA 1D5AA 4A8FA 4B08A 5J2NB 4WU3A 2HHUA 2IVOA 3O3FA 2OD6A 2I5JB 4UOHA 4N5SA 4ZIVA 3BSNA 5KT2A 2PYLA 2GIQA 4K42A 2F9DA 3W9IA 2MKYA 2KHCA 5JVHL 2DTUA 4YMEA 2LQ9A 1F9HA 3MTKA 3W0LA 4ED6A 4B3MJ 1CBKA 3PRVA 2X1FA 4X62F 3AGKA 5M1FA 1YJVA 1VC6A 1K9MT 2Q43A 4OI4A 1X4FA 3Q8SB 2HWHA 2HQDA 3DN9A 3N6MA 1Z26A 2WB4A 2VJVA 1N48A 2IRYA 1YJ7A 2CQGA 2YXLA 4R79A 4B1YB 5ETSA 1RCOB 4CFDA 4X84A 1YZ7A 4CBWA 2B9EA 1M1KT 4V19J 1J5EJ 4DV5K 3JAMU 3M8QB 4JB8B 1EAYC 2AWZA 2HRUA 1CJTB 2RDIA 4CIEA 2YPYA 3TUIC 3BGUA 4U7UD 3W1YC 3V4IB 3T5HA 3Q8QB 4RUAA 5DLFA 1K8KA 1RT1B 4OX7A 4YOXA 3U1LA 1SCJB 1MA9B 3WEEA 4J9RA 3G6XA 2VBWA 3MM5B 2OPQA 1TV6B 1O6XA 3V6HA 1A5VA 2J7UA 3BF1A 4DV2J 4WE1B 2UUAJ 3GONA 3SCKE 4ELUA 1B9DA 3LPYA 2E2NA 3OYBA 3PYFA 1X4GA 4EHUA 2W6KA 2CJXB 2VKRA 4AXJA 2XRIA 4E7IA 2YX1A 5HBMB 2RRBA 4H0PA 2YX7A 1HUXA 3CJCA 3VZIA 2FHJA 3VVTA 2K06A 3CO0P 3NGKA 2UVWA 2NRHA 5CHCB 4IRKA 3GE9A 1G6BA 2J8SA 1CEZA 2X1GA 2XZWA 2P9PB 1N6QB 2QLBB 4C4WA 3CDEA 1OPIA 3CO9A 1EX4A 3AVGA 3ZCMA 1E6YA 5LM7E 5CYMA