4Y1DA

Cyclic hexapeptide cyc[ndpoppkid] in complex with hiv-1 integrase core domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
141
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HEXAPEPTIDE MIMETICS OF LEDGF IN COMPLEX WITH HIV-1 INTEGRASE
rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase binding protein
molecule keywords Integrase
total genus 49
structure length 141
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4y1dA00
2W42A 3TAPA 1RT2A 4HCBA 1IH7A 4ICLA 2IS3A 4CFCA 4DSEA 4CF2A 1VSMA 4EP4A 4HTUA 4B3OA 3K2PA 4CJLA 3P5JA 1XHZA 3T3FA 3T1AA 3PX4A 3CFOA 1Z25A 4H8KA 2PZSA 4BACA 1T7PA 4DWIA 1ZBIA 1RDDA 1TL3A 4O4GA 4B9TA 1NJXA 3VQBA 2YNHA 2DFFA 3NF7A 3IRXA 4IKFA 2HHWA 4AHUA 5HROA 1B9DA 3HM9A 5C25A 4KI4A 2JLEA 3VQPA 3WNHA 2ATQA 4O5BA 2RN2A 3V6DA 4KHQA 1N6QA 3VA0A 3BGRA 5SZTA 1XC9A 2Y1JA 3V1QA 4N47A 3P83D 4EZ9A 3AVCA 1HYZA 3K5MA 1J5OA 2QXFA 1BL3A 5CZ2A 4QAGA 2P5GA 1GOBA 2XY6A 4J2AA 1YTUA 5EU7A 1RBTA 3CYMA 2XO7A 3RMCA 2G8FA 3SUNA 3NF8A 4DTPA 4NCBA 1RT7A 1U4BA 3PUFA 3U3YA 4N76A 4CF9A 3RMAA 5DK5A 3OYNA 1SUQA 3LWLA 4HUGA 4G1QA 3TAFA 3AO1A 3B6OA 4HUEA 2A1RA 2YNFA 4YNQA 3OYGA 1L5UA 3OY9A 4B8AB 3TI0A 4ZTJA 4KHUA 1WSFA 3MXMA 4BE2A 2WONA 3IAYA 4M3XA 4CIGA 2YNGA 4ID1A 4O44A 1LWEA 3V1OA 3QEIA 4I9QA 1XHXA 1SL1A 3SUQA 3PO4A 2KQ2A 3L2UA 3LZJA 3MECA 1CXQA 2Y1IA 1RNHA 3K58A 4E7KA 4RW9A 3MEGA 1NK7A 3EY1A 5HRNA 4DMNA 4KB0A 3ZT3A 3KD1E 4CEQA 3OYFA 2YKMA 3TAGA 3AVFA 1F21A 1GOCA 1YT3A 3ZT1A 4DQPA 4FJKA 1R0AA 1EETA 3NHGA 3OYCA 1U49A 3PO5A 4Z4IA 4PWDA 2NUBA 4Z0UA 4C8MA 3QNNA 4NCAA 4CGIA 4HHTA 1WNSA 1HQUA 4DFPA 2OPRA 3QETA 3LANA 3TANA 5FROA 4CHZA 4W5NA 4F2SA 1QS4A 3TAQA 2G8KA 1EXQA 2HHXA 4B9VA 3A2FA 1UA1A 4M3WA 4DS4A 4DF8A 1W9HA 1Q9XA 5CZ1A 4CGDA 1W0HA 2HHQA 4C8NA 4E1NA 4PUOA 2GUIA 4CHQA 3V9UA 5JS2A 2HNYA 1J54A 3ZT2A 2R7YA 4JRQA 3PV8A 4AHRA 3KIOA 5KGXA 2EX3A 5J1EA 3QEPA 3AVNA 2FBTA 1CZ9A 4DQSA 1D8YA 2BDPA 4Z4EA 3M8SA 3C95A 3OYEA 1LW2A 1NKCA 4FJNA 3DRSA 1RBRA 3ALYA 3I0SA 4FJJA 5J2MA 4AHCA 2HHUA 1KCFA 4JRPA 4DU4A 2G8HA 1ZBHA 3ZSZA 4CK1A 1NKEA 1FKOA 1VSKA 4I2PA 3S3MA 4LH4A 1QQCA 4FW2A 2YNIA 2HB5A 1U48A 1X9SA 4FK0A 4E7JA 3LP3A 2X78A 3BDPA 2X6NA 4E7LA 5KRSA 4L8RB 2VWJA 3HPHA 4FZZA 1C6VA 2A1SA 2IGIA 3M8RA 1SL0A 4C8LA 4OGCA 4KTQA 3WNFA 4N41A 3G0ZA 1TKZA 3AO2A 1JLCA 4CEZA 3KLFA 3CQ8A 4JS4A 4TSXA 4QCLA 1TKTA 3AVGA 2ZD1A 2P1JA 4KHSA 4RW7A 3D45A 4RW8A 3RR8A 1BI4B 4BDPA 3NDKA 1RDCA 1RBVA 3DLEA 1KTQA 1S1TA 3NCIA 4DU3A 2F8SA 1TK5A 1IG9A 3LAKA 1JLGA 3MXJA 4FVMA 1IKXA 4CJ4A 3O3HA 4CJ3A 3SI6A 3OS0A 1N5YA 3RR7A 3O4NA 3U6FA 3SQ2A 4FJXA 4M3TA 4QOZB 1S1UA 1ZBUA 4C8OA 3KK3A 4W5TA 3TWHA 1BGXT 1SL2A 3AVAA 3AVBA 3OYAA 3VQQA 3O3FA 3LP1A 4DSJA 1TVRA 1TV6A 4LD0A 1Q9YA 3ZSWA 3DMJA 4N5SA 2D5RA 3V9SA 2HW3A 2HHSA 2DTUA 4FLWA 3MEDA 1JL2A 4BWJA 4CE9A 4CGJA 3VQAA 4HCCA 3M8QA 2EHGA 4ELVA 5D3GA 4KO0A 3KLHA 3VQEA 1NK6A 3MEEA 3HK2A 2DY4A 3KLEA 1LWCA 3O3GA 1C1BA 3V9XA 2RKIA 4DLEA 3QO9A 4MFBA 4UQGA 3TARA 2O4IA 1X1PA 4H4OA 3VN5A 4F4KA 1KLMA 2DFHA 3V9ZA 2G8IA 3AVJA 5J2NA 1JLBA 2PY5A 1HNVA 2FBYA 2FBVA 4CEFA 4CGFA 3DRPA 1RDBA 4JS5A 4OLBA 4FLXA 2B5JA 4B9SA 3SV4A 4GW6A 1L3UA 4DF4A 1RBSA 3I0RA 3AA2A 1TK8A 1WSIA 4DFMA 1BIZA 2XRIA 3QNOA 4IG0A 2VG7A 1BCMA 1S1VA 1VSHA 4CJSA 2G8VA 4CEAA 1ASVA 2Z1GA 3ZT0A 3QEVA 2BGGA 1DTTA 4B08A 4YFUA 4DQQA 4LSLA 3NF9A 3MXIA 4I2QA 5HRRA 3DLKA 1JKHA 4DSLA 4OPJA 3WNEA 3L2RA 4WE1A 1U04A 3U3GA 4FM2A 1RT3A 4F2RA 3QINA 4H4MA 3HXMA 1TAQA 4AHTA 2KZZA 1IO2A 4FJ9A 3F9KA 4W5OA 3DLHA 1MU2A 1FKPA 4JLHA 3VQDA 4CGHA 3SCXA 2HVIA 3OYLA 1DLOA 3D0PA 3SUPA 1RTDA 3L3VA 1FK9A 4CJQA 3L2QA 3MAQA 1BQNA 1C0MA 3LAMA 3S3OA 4CF0A 2VG6A 1JXEA 1QE1A 1UWBA 2P51A 1REVA 2Z1JA 4I7FA 4XIUA 3JSMA 4FYDA 4O0JA 1BQMA 4KHWA 4DTRA 3KKSA 4CJWA 4J2BA 4DLGA 3KK1A 5C42A 4CF1A 1Y97A 2D0CA 1NJZA 3LPTA 1WSEA 3L2VA 4CECA 3ZSVA 3OYDA 4NYFA 1VSIA 4FLZA 1ASWA 4C8KA 3V9WA 4E3SA 1S1XA 3DLGA 4FLUA 4AILC 1C1AA 4CEBA 2PYJA 4E1MA 2OZSA 2KTQA 5HRPA 1RTHA 3OYMA 1X9WA 3VQ7A 2HHTA 4LH5A 3I8DA 1VRUA 2RPIA 1TL1A 5CYQA 5HBMA 3HVRA 3QIOA 2IDOA 3KK2A 1WN7A 4FLYA 3QERA 4CF8A 3B6PA 1G15A 1S9EA 4CEEA 3LDSA 4AH9A 1T8EA 3RWUA 4CEOA 5I42A 1RT6A 4IFVA 3IG1A 2XHBA 1NK0A 4Z4GA 1LW0A 4RW4A 4BDZA 3QLHA 4E7HA 4CJFA 1BIUA 1I3AA 1L3VA 3K5NA 1UAXA 3VQ9A 4M45A 3JYTA 1XI1A 2GV9A 4KHNA 1VSJA 4M42A 4KPYA 3OJUA 1KFSA 3PY8A 3C94A 4BE1A 4CJPA 3AA5X 4PA1A 4Z4FA 4KI6A 2IAJA 4FJIA 1EP4A 3ZSQA 4B9LA 1JLEA 1C0UA 1HRHA 1VSEA 4E7IA 4CGGA 1B92A 2G8WA 1NK4A 4DQRA 3SPYA 1NK5A 4B9NA 3EYZA 1TKDA 3AVMA 4LSNA 1NJYA 4Y1CA 2Q3SA 3CM6A 4KB1A 1C0TA 4FM1A 2VWKA 4ELUA 3VA3A 1U47A 4FJHA 4W5QA 1ASUA 3AV9A 1RTJA 4DSFA 1BISA 4CJEA 2HNDA 3NGIA 1QHTA 2Z1HA 1S1WA 2PYLA 2GBZA 3VQ5A 1JXBA 3C6UA 3ITHA 4KV8A 1HJRA 3SQ0A 3SUOA 1SKSA 2AJQA 4FJMA 5E41A 3OJSA 2F96A 4PQUA 4B8CA 3AO3A 3OS1A 4M41A 3HVTA 1BCOA 3QIPA 4CJUA 4AHVA 4KTWA 1O1WA 1DTQA 3CG7A 3AO5A 3IS9A 4FLVA 1RT1A 3TR8A 4DS5A 1RCHA 1HPZA 4Y1DA 5HLFA 2F8TA 1JLAA 4FCYA 1TAUA 5JS1A 2BE2A 4M3RA 4PY5A 3AVKA 5K14A 3RMDA 4DSKA 1KVAA 2G8UA 4CFAA 3DI6A 4B9MA 4CERA 4ZHRA 4FZYA 4EZ6A 4DFJA 4FXDA 4GVMA 3M8PA 1QSSA 1CXUA 3L8BA 1L3TA 1RBUA 3ISNC 3LP0A 3NH2A 2YKNA 3SYZA 4FJLA 4CEDA 3C6TA 4Z4HA 3RTVA 3PX0A 2E6MA 1LAVA 4HUFA 1HMVA 3ULDA 3ZSYA 3QEWA 3RMBA 3T19A 2X74A 4CJKA 1ZYQA 4ELTA 3DLRA 3VQ8A 3VQCA 5FRMA 1A5XA 3DOLA 3TAMA 3QESA 3QEXA 2OPQA 3PX6A 1T03A 4B9UA 4FM0A 4FJ7A 2HNZA 4CESA 4BE0A 1LAWA 1J53A 3V1RA 1WSJA 4I9LA 2OPSA 3K5OA 3SV3A 4GMJB 4KTZA 3HJFA 5KGWA 4CIEA 2XY5A 4FJGA 3HL8A 1X9MA 2OA8A 2E4LA 4J2EA 1NK9A 1VSLA 3OYJA 3VQ6A 3KLGA 2Z1IA 1KFDA 4IDKA 1IKYA 1VSFA 1BHLA 3OVNA 4OKKA 1SKRA 4IG3A 4OLAA 3K57A 3S3NA 3LPUA 4DTJA 1A5VA 3SNNA 3DLBA 2QKKA 1HYSA 1WAJA 4ID5A 4OGEA 3V81A 5C24A 4KKOA 2IOCA 4DTSA 1Z26A 4O55A 1HNIA 1RDAA 2VG5A 5FRNA 3NE6A 4KFBA 3AO4A 1ZBFA 3NGYA 4OKEA 3L3UA 1KVCA 4CJVA 3VQ4A 1KSPA 4FJ5A 2KFNA 3HT3A 4CJTA 2IC3A 1YVUA 4Q0BA 4CIFA 3LALA 1IKWA 1CZBA 1A5WA 1WLJA 1RT5A 1KVBA 2RF2A 2YV0X 4F3OA 2ZQBA 3E01A 3CFPA 3KKRA 1QSLA 3SQ1A 5DMRA 3ZCMA 2X6SA 2QK9A 1XWLA 5KI6A 3F73A 3AVHA 1KRPA 1JLFA 3SQ4A 2HHVA 3FFIA 1RILA 1SKWA 2JGUA 4N56A 4CHNA 4DTOA 4OJRA 4MQ3A 3NF6A 4DTUA 1QSYA 1T05A 3L2WA 3HPGA 2ZE2A 3OYIA 3NBPA 1SV5A 4LY7A 4E0DA 4NYNA 4K8ZA 4DTXA 2ITGA 2OPPA 4E89A 4AHSA 3LWMA 4DG1A 1I39A 4CHYA 4ZTFA 3UIQA 4DSIA 1FXXA 3HP9A 1RT4A 4OPKA 1Q8IA 3NGZA 4CK3A 1EX4A 1GOAA 3OYKA 2HMIA 2E6LA 2OZMA 4NCGA 3ZSXA 1NKBA 5I3UA 4CHOA 2OYQA 1U45A 3AVIA 5CY4A 1LV5A 5FDLA 4CFBA 2ETJA 3WNGA 3ZT4A 2KZMA 3K59A 2XY7A 2FC0A 4DFKA 1S6PA 1WAFA 4OVLA 3NFAA 1D9FA 1S5JA 3OS2A 3DYAA 4KRFA 4KAZA 3LZIA 4DTNA 4CJ5A 1UOCA 5T7BA 3NH1A 3KJVA 5J2PA 4FK4A 3SPZA 1JLQA 4J2DA 3LP2A 3OYBA 2O4GA 2XY8A 2QKBA 2FBXA 2P5OA 3AA3A 2HVHA 3OYHA 3KD5E 1WSHA 4RW6A 3V4IA 1HQEA 1B9FA 3CFRA 1HYVA 1NOZA 2I5JA 4M3YA 1TGOA 3DOKA 2B6AA 1D5AA 1TK0A 3DRRA 3EZ5A 5KTQA 1TKXA 2YHAA 4IFYA 1YTAA 4O0IA 1C1CA 4BDYA 4EP5A 3ASMA 3CM5A 3DM2A 4RG8A 3P1GA 1VRTA 4R5PA 3HP6A 5SWMA 3SJJA 3THVA 1NK8A 1QTMA 1L3SA 2LSNA 4FLTA 1S6QA 1D9DA 3G10A 4Z4CA 1JL1A 1BI4A 3NH0A 2KW4A 1LWFA 3AVLA 4CCHA 4KHYA 3HPOA 4CJRA 4K8XA 1EKEA 1IKVA 3S9HA 4M3ZA 2WOMA 4IBNA 4CK2A 4HVJA 5HRSA 3RRHA 5HP1A 4DQIA 2KFZA 3KTQA 3K5LA 1NOYA 3TAEA 3RRGA 1UA0A 4KREA 2B4JA 4W5RA 3NAEA 4BWMA 5J2QA 4FJ8A 3HO1A 4E19A 2DFEA 4DTMA 5CYMA 1S9GA 4FW1A 4FK2A 1RTIA 1K6YA 1VSDA 3AA4A 4F3TA 3HSTB 3H08A 3O4QA 1VK0A 4CHPA 4OKJA 4CFDA 1ZBLA 4FZXC 4DU1A 3ZSOA 2D0BA 3SZ2A 2BANA 4M3UA 1CLQA 4Q5VA 1KLNA 1WSGA 5KRTA 2D0AA 3ZSRA 1J9AA 3TABA 4F8RA 1NJWA 3HYFA 3KLIA 2YHBA 1ITGA
chains in the Genus database with same CATH superfamily
3OW2M 3VTHA 2IS3A 4CFCA 2PZSA 4JAXA 4DWIA 1ZBIA 4KBOA 1SQKA 2E2OA 1NJXA 3VQBA 2YNHA 2DFFA 1B9DA 4BR7A 3EE9A 4M63C 3O4WA 1TUUA 3VQPA 1GLEG 3V6DA 4KHQA 1KAZA 4BRGA 2E88A 5SZTA 4WF9L 2P9KB 3VA0A 2Y1JA 2O8FA 1H1VA 4U67L 3AVCA 4DR6K 4IXCA 2QXFA 1K8KA 4J2AA 3M6GA 3CYMA 3RMCA 3CF5L 3SUNA 3NF8A 1RT7A 4JI7K 2KHOA 3RMAA 4K43A 4G1QA 3B6OA 2A1RA 4FWSA 2YNFA 4YNQA 3OYGA 1L5UA 4ZTJA 3ULEB 4B8AB 3JXUA 3G6EN 4M3XA 4CIGA 4ID1A 4O44A 3AGRA 4FWKA 3SUQA 4WQ4A 3L2UA 3MECA 1CXQA 3K58A 3IUCA 4RW9A 3SJHA 3EY1A 5LL6Z 4DMNA 3OYFA 3I56N 4CW7B 3TAGA 1U49A 3PO5A 5AQNA 3VERA 3QNNA 2OPRA 3LANA 5FROA 3TAQA 1J6ZA 5BRHA 2G8KA 1Q86O 4M3WA 1YAGA 4DF8A 3FZLA 1Q9XA 1W0HA 3V9UA 3CERA 1X3MA 1LCUA 3KIOA 5AZIB 1YHQN 5J1EA 3BUZB 1HJOA 1QVGM 2FBTA 4A57A 1CZ9A 3O9UA 4DQSA 1V4TA 1NG9A 3GL1A 1LW2A 1RBRA 3ALYA 3I0SA 4H0XB 1KCFA 3THXB 2G8HA 3ZSZA 3FR0A 4JI8K 4FK0A 2YNIA 2HB5A 3O8MA 3NVMA 1YUWA 2VWJA 3AAPA 1C6VA 2W6LA 4OGCA 3CHWA 1TKZA 3AO2A 4CZMA 4B1WB 3FZKA 3VEVA 3CC7N 3AVGA 1MWMA 4RW8A 1HKGA 4DU3A 1OH5A 1IG9A 3LAKA 2O8EA 3MXJA 4CZLA 4FVMA 1GLCG 1BUPA 3THWA 3CD6N 3SQ2A 4QOZB 5C0YA 4JKCA 1ZBUA 4MLEA 2ZWHA 4JI1K 1CZAN 2BH1A 4W5TA 2P9LA 3VGLA 4J8FA 1TV6A 1Q9YA 3DMJA 4JYAK 2HW3A 2HHSA 2DTUA 2A42A 3MEDA 4FLWA 1NWKA 5M1OA 3ULEA 4KO0A 3KLHA 3HK2A 3D2FA 2DY4A 1LWCA 3V9XA 1C1BA 2RKIA 5H1SQ 2O4IA 2NZTA 2DFHA 3CJCA 2G8IA 1W2BM 3TSUA 2ASPA 1BWFO 2FBVA 3QFUA 1DGKN 3QB0A 3GBTA 4OLBA 4FLXA 2B5JA 3CI5A 3SV4A 4BRCA 4EAHD 5F1XA 3FGUA 2IIRA 2VG7A 1S1VA 4RCHA 4CEAA 2O8DB 3ZT0A 3JAMO 3QEVA 4DQQA 4I2QA 3DLKA 3ENOA 3A0IX 4WE1A 1NGHA 3QINA 3HXMA 4B9QA 1KXPA 4AHTA 1YITN 1IO2A 3F9KA 2HBLA 3DLHA 3CMAN 3SCXA 1HR0K 2QXLA 2QEXN 4XH1A 3PSFA 2ASMA 3R8EA 3S3OA 4CF0A 2VG6A 3JSMA 1QE1A 4XIUA 4GVEA 4O0JA 5M1QA 5GIPA 5C42A 2GWKA 4IZ9A 3UKRA 3HTVA 4E3SA 3VEOA 4FLUA 4AILC 1C1AA 2KTQA 3THWB 2HHTA 3VQ7A 3I8DA 5FLXO 2RPIA 2IDOA 5LMNK 3A5NC 3B6PA 2D0OA 3SAFA 3LDSA 1E3MA 1KQSM 5EOYA 4HWIA 4JHDB 1LW0A 1FJGK 4BDZA 1K9MO 3K5NA 1UAXA 3JYTA 2GV9A 3OJUA 3CCRN 4FJIA 1HRHA 1R59O 2F9WA 1B92A 2E2NA 4B9NA 3EYZA 1TKDA 3O9RA 3J7AP 2VWKA 3ZETB 4ELUA 5TKYA 1ILYA 4W5QA 4JI2K 1RTJA 4H0VB 4CJEA 4CBUA 1WB9A 1S1WA 1GLFO 5E41A 3OJSA 1JCGA 1MWKA 4Y0WA 4B8CA 2A6AA 3OS1A 4M41A 2YHYA 3O1WA 3ID6A 3AO5A 4DS5A 1RT1A 4O8UA 1HPZA 2F8TA 3KVGA 1JLAA 5AQZA 3RMDA 4DSKA 1QQOA 3B8AX 4DFJA 3SLCA 1L3TA 3ZX2A 2A41A 4GNIA 3NH2A 4Z4HA 4BRIA 4HUFA 1HMVA 1ZYQA 1K73O 2X74A 3DLRA 3VQ8A 3BEXA 3VQCA 1DT9A 4B1ZA 3DOLA 1T03A 4H0OA 4CESA 3QDKA 1LAWA 1WSJA 4I9LA 2QI2A 2QWQA 4GMJB 5IWAK 4LF5K 3CC2N 2XY5A 4J2EA 1NK9A 4JI5K 1KFDA 1IKYA 1VSFA 2QWRA 4OKKA 3HSCA 5FPDA 1A5VA 1TYQA 2ZJQL 4OGEA 3DLLL 3HI0A 4FWMA 1Z26A 2YHXA 1HNIA 1NU0A 2NRRA 3AO4A 1ZBFA 1S22A 3CCSN 3VQ4A 3MWTA 3UE5A 2D0PA 2VGNA 2WUSA 3E01A 3CC4N 3EO3A 4X62K 3MWPA 1JLFA 3SQ4A 2HHVA 1RILA 3I8BA 3CQYA 3OBYA 4JD2A 4DTOA 3NF6A 1T05A 3HPGA 5F2RA 4K8ZA 4LY7A 3O9QA 4DTXA 4AHSA 1I39A 4FO0A 2IVPA 1RT4A 4BRMA 1NGFA 4CK3A 4BRPA 2E1ZA 1EX4A 4BQZA 2HMIA 1ATNA 1T6DA 5I3UA 2OYQA 2VCPA 5FDLA 3ZT4A 2JWKA 2P9SA 3WXIA 2FC0A 4OVLA 2ZF5O 4KAZA 3LZIA 1VQNN 3RSEB 4H5NA 4LF6K 4NO7A 4J2DA 3SBTA 2QKBA 3CCLN 1SZ2A 2P5OA 4V19S 1VQ5N 4H5RA 2E2QA 5AJ3K 4ISGA 2Q0RA 4RW6A 3WT0A 4K41A 4DQ8A 4DV5K 3CJAA 2B6AA 1VAZA 2P9UB 4AM7A 1TKXA 4O0IA 1YTAA 4BDYA 3AY9A 3TPQA 4EP5A 4C23A 3CM5A 3HP6A 5SWMA 3THVA 5M1FA 3CPWM 3NH0A 4BRKA 4KHYA 3HPOA 3F5TA 3EE8A 2V7ZA 3LDOA 3LDNA 1GLDG 4JKDA 4HVJA 3RRHA 5HP1A 2P9IB 1NOYA 1KAXA 2YJEA 4KREA 3O6WA 4E19A 1OKJA 1S9GA 4CZJA 2W40A 1RTIA 1K6YA 4YDUA 4CHPA 4FZXC 1VK0A 3O5BA 5FPEA 1ZBLA 4FPBA 4IOXA 1XNQK 1BA1A 3WEEA 3CJ9A 3TABA 4F8RA 4BRAA 3KLIA 2YHBA 2W42A 1IH7A 3D2EA 1VSMA 3K2PA 4CJLA 3P5JA 1XHZA 2WTUA 4DR7K 3CFOA 4H8KA 4BACA 3MN6A 1Q82O 3MDQA 4B9TA 3C0BA 1WUAA 4AHUA 4NLBA 3MX2A 1OVYA 3NVKA 3CJ1A 2JLEA 1YI2N 3LM9A 2ATQA 5B8HA 3QMLA 1N6QA 3BGRA 1N33K 3E9LA 3P83D 1J5OA 5CZ2A 4QAGA 1T6CA 4C1NK 5EU7A 3J80O 1VQON 4M7YA 4DTPA 1M1KO 4XH4A 3FFKB 4N76A 1YJNN 4CF9A 5DK5A 1C0GA 4HUGA 3TAFA 4HUEA 2ITMA 3THYB 2UU9K 1VQMN 2A3ZA 4BRNA 3TI0A 3CCEN 3VEYA 3VF2A 1WSFA 3MXMA 4K0KK 3IAYA 4XH5A 2YNGA 2F4VK 2I7NA 2P9KA 4ILGB 1SL1A 4H0YB 3PSIA 3PO4A 2Y1IA 3EEQA 4E7KA 3QICA 3LDLA 4KB0A 3KD1E 4GKJK 2YKMA 3AVFA 1YT3A 1R0AA 1EETA 3NHGA 4JKAA 3G25A 2NUBA 1OH7A 3BY5A 4Z0UA 4C8MA 3QETA 4W5NA 3T1HK 2GTDA 3ATUA 4F2SA 4JKFA 1EXQA 4CZKA 4B9VA 1VQ4N 4DS4A 3VESA 4NLCA 5AQYA 4CGDA 4B3TK 3C7NB 2PFUA 5JS2A 1J54A 3ZT2A 2R7YA 4JRQA 1N32K 4AHRA 4BRQA 5KGXA 3QEPA 1YXQA 3P38A 3M8SA 4JI3K 3C95A 1NKCA 4FJNA 4CZEA 3OBWA 2UYTA 1QQNA 1HUXA 1HNXK 2CH6A 2A5XA 1ZBHA 4CK1A 4I2PA 3S3MA 4LH4A 2X78A 5JLHA 4B3SK 4FZZA 3M8RA 1SL0A 4KTQA 3WNFA 4CZFA 4CEZA 4JS4A 3KLFA 2ZD1A 4LFCK 3RR8A 1BI4B 1S1TA 3NCIA 2GX9A 2ZGYA 2F8SA 4DHYA 4CJ3A 3O4NA 4JKHA 4C8OA 4F9OA 3UKUA 4YDUC 5ADXH 3Q7CA 3OYAA 3VQQA 3O3FA 3LP1A 4DSJA 3VENA 3ZSWA 2ZGZA 5EXWA 4BWJA 4CGJA 4QS8A 2ASOA 1BDGA 5D3GA 3ENHA 2OTLN 4FWLA 4B1XB 2WBNA 3ZETA 3SBGA 1NGCA 3QO9A 4UQGA 1X1PA 4F4KA 3VN5A 1IBMK 3V9ZA 1TUYA 4BVOA 3AVJA 5J2NA 2E1YA 1NGDA 2PY5A 3SMSA 3I33A 4KH4A 3DRPA 4JS5A 3M5RA 3GDQA 4B9SA 3EN9A 3I0RA 3AA2A 2DPNA 3QNOA 2G8VA 1BCMA 4JEPA 2Z1GA 3DXMB 3HBTA 2BGGA 5LJWA 3MXIA 3NF9A 1P90A 4OPJA 3WNEA 1U04A 1RT3A 1S3XA 2KZZA 4FJ9A 3VQDA 5TKWA 4JLHA 1YIJN 3OYLA 1DLOA 3D0PA 3SUPA 2Q97A 1RTDA 4PL7A 1BQNA 1C0MA 3LAMA 4I7FA 2IVOA 2P51A 4BREA 1BQMA 3CCUN 4DTRA 2AP1A 1OH6A 4MDBA 1XMQK 1ESVA 1WSEA 3ZSVA 4JKBA 4NYFA 2QM1A 3HM8A 4FLZA 5C12A 3DXKB 1S1XA 3J81O 2NLXA 3DLGA 3H6EA 1N8RO 4CEBA 2PYJA 1RTHA 1GLBG 1VRUA 3U3YA 5M1NA 1GLJO 3H45C 1IV0A 1K8KB 3VF4A 1QQMA 5A2QO 4CEEA 4RWTA 4IO9L 4AH9A 3RWUA 5LY3A 1RT6A 3D6RA 3LDPA 1NK0A 4Z4GA 4FWNA 4FOIA 4CJFA 1BIUA 1DKGD 1L3VA 1NNEA 4H03B 3VQ9A 1XI1A 4WFNL 4KPYA 3PY8A 3AA5X 3KWIA 2IAJA 1EP4A 1SAZA 3ZSQA 3UB5A 1VSEA 5ADXA 4CGGA 2HMPA 3OA9A 2G8WA 4DQRA 4B1UB 4BR9A 1WBDA 2NRTA 3AVMA 4Y1CA 2Q3SA 3CM6A 5LJVA 4KB1A 1X9JA 4BGBA 1U47A 4LF4K 1ASUA 3AV9A 1GLAG 3PIPL 4DSFA 1X3NA 2PYLA 1HKBA 5M1PA 1JXBA 4KV8A 3VQ5A 2AJQA 4DV3K 3SUOA 4I6MA 4FJMA 1GLLO 4PQUA 1Q81O 2FXUA 3CG7A 5HLFA 1BO5O 3TR8A 4Y1DA 5JS1A 3AVKA 1KVAA 4CFAA 4EZ6A 4JHDA 1N34K 3CJBA 3L8BA 3ISNC 3SYZA 4FWPA 2E6MA 4OPAA 4QS7A 3RMBA 1VQ8N 4DUZK 5FRMA 3QESA 3PLAA 3L4IA 4FM0A 2D4WA 4FJ7A 4JK7A 3V1RA 2NRZA 3CCJN 4GV3A 2OPSA 1N36K 4JNEA 4CIEA 4DR5K 2OA8A 2E4LA 2OANA 3TSQA 4A61A 1KD1O 5AQQA 3VQ6A 2Z1IA 4IDKA 1S72N 5KPZA 2O8FB 4DV0K 4E1JA 4OLAA 3EKSA 4IG3A 1SKRA 3K57A 1V4SA 3LPUA 2PAVA 4DTJA 3BZKA 3SNNA 1WAJA 4ID5A 2IOCA 2QWOA 4FWOA 4EIAA 4DTSA 2UUBK 5FRNA 2UUCK 4DKWA 3NE6A 3L3UA 4FJ5A 2KFNA 1YVUA 3KHYA 3LALA 3A5MC 1IKWA 1A5WA 1RT5A 1KVBA 2RF2A 2YV0X 1NLVA 2HHHK 3KKRA 3VGMA 5KQDA 5DMRA 1XWLA 3VEXA 3IDHA 4PHTX 4X64K 3A5LC 3NBPA 3OYIA 1BOTO 1HNWK 5C2FA 4ZTFA 4BGAA 4OPKA 1Q8IA 2OZMA 3OYKA 2E6LA 3TTDA 3J7ZO 3HRGA 2WFBA 3AVIA 4CFBA 2ETJA 3WNGA 4IOCL 3K59A 3EL2A 1S6PA 4ILHA 1ATRA 3DYAA 4DTNA 4CJ5A 4FVUA 1ZC6A 5AFUA 4GKKK 3LP2A 1G99A 3W0LA 2XY8A 3LDQA 2FBXA 3AA3A 4C1NI 3KD5E 1WSHA 3FZHA 3CFRA 1NOZA 2I5JA 4LF7K 2Q36A 3EZ5A 5KTQA 2YHAA 5GADP 1C1CA 4JI0K 3DM2A 3K9KA 1Z6RA 4R5PA 1XUPO 4FLTA 5IT9O 4Z4CA 2FSKA 2KW4A 1HNZK 4K8XA 1VQKN 4GV6A 1VQLN 2GWJA 5HRSA 1ZBSA 1U6ZA 2KFZA 3QBWA 3KTQA 1NM1A 3GE1A 3T7ZA 4WQ4C 3TAEA 1UA0A 3NAEA 5LMUK 4FK2A 4BRLA 4OKJA 1O13A 4A59A 5GAHP 1D4XA 3SZ2A 4M3UA 1KLNA 2D0AA 5GIOA 3CCVN 3VTIA 1ITGA 2QWPA 3LL3A 5MLCQ 4PKGA 5BRFA 4DSEA 4MLHA 3SMPA 3NMUA 4B1YB 4EP4A 4HTUA 4B3OA 3R3LA 4WCEL 3T3FA 3T1AA 2P9NB 3PX4A 1Z25A 1RDDA 2RHKA 2VWBA 3MN7A 4O4GA 3K0SA 2YHWA 3IRXA 1HX1A 1IG8A 4IKFA 3C6AA 1U2VA 3HM9A 5C25A 4KI4A 2CGJA 1NGBA 2RN2A 4BRDA 4N47A 1QVFM 4EZ9A 1BL3A 3R6MA 4KH6A 2W41A 1RBTA 4YOUA 4IFEA 2XO7A 2G8FA 3G71N 4LF9K 4NCBA 1OVQA 3F2KA 3U8XA 1U4BA 3PUFA 5EVZA 3WXJA 4JK8A 3AO1A 3N4QA 3OY9A 4KHUA 2OTJN 5AQVA 4BE2A 4JI6K 1LWEA 3QEIA 4I9QA 2KQ2A 2UXCK 3MEGA 1NK7A 2I7PA 3ZT3A 4CEQA 3ZT1A 1I94K 3OYCA 4Z4IA 4PWDA 3R9PA 4NCAA 5AR0A 4DFPA 1WNSA 3IMXA 1TYQB 4CHZA 3THYA 3GG4A 3CPEA 2HHXA 1W9HA 5CZ1A 2HHQA 4OX9K 5AQFA 4E1NA 2GUIA 4CHQA 2HNYA 1E4GT 3PV8A 5E26A 3AVNA 2FF6A 2P9PA 2BDPA 1D8YA 4HTLA 4Z4EA 4BG8A 4EHUA 3OYEA 3DRSA 3E9OA 4YOVA 1VQ6N 5J2MA 4AHCA 2HHUA 4JRPA 3T1YK 4YOYA 4CBWA 3HOTA 1NKEA 1FKOA 4JD2B 1U48A 1QQCA 4FW2A 3VOVA 1X9SA 4E7JA 2X6NA 5AQMA 4DB3A 4E7LA 5KRSA 2HBJA 3HPHA 4A62A 4C8LA 5AZJA 4N41A 3G0ZA 2E20A 4TSXA 5AQHA 2A40A 2P1JA 4KHSA 4RW7A 3VPZA 3MK6A 4BDPA 3DLEA 4KH5A 4O8KA 3L0QA 1JLGA 4IWVA 4G9ZA 2HBKA 3KK7A 3QFPA 3SI6A 4FJXA 3HOSA 1KAYA 3AVAA 3L4QA 3MCPA 4B3MK 4ISEA 1TVRA 4N5SA 2D5RA 3V9SA 4GY2B 1BG3A 3VF6A 1JL2A 4CE9A 4HCCA 2D1KA 4IEEA 3MCAB 2EHGA 3VQEA 1NK6A 2ZJPL 3KLEA 5AQKA 1VQ9N 4DLEA 3L6QA 1KLMA 3VETA 4DUYK 5AQTA 2FBYA 4CEFA 1RDBA 4WFBL 1P8ZA 4GW6A 3TTCA 1L3UA 1RBSA 1TK8A 2WC9A 5BPNA 2XRIA 4DV2K 1ASVA 1K8AO 4H5VA 3O80A 1DTTA 4YFUA 4LSLA 1JKHA 4DSLA 5DM6L 2VQEK 4K42A 3ZEUA 5JMVA 1YF5L 4MO5A 4O5FA 1TAQA 2AA4A 4W5OA 2QWMA 4CGHA 3H46O 4BRHA 2E5LK 5BR8K 3IKMA 1UWBA 1REVA 5JVHL 3DXMA 4KHWA 4J2BA 4BR2A 4NB4A 4CF1A 1Y97A 3CETA 2D0CA 1NJZA 3LPTA 1T44A 4CECA 1NJIO 5JLFA 3OYDA 3SAGA 1ASWA 4C8KA 5BN9A 4E1MA 3OYMA 1X9WA 4LH5A 4FLYA 1TL1A 3KK2A 1WN7A 3QERA 4CF8A 1G15A 4IO8A 2UXBK 4CEOA 5I42A 2XHBA 4YHHK 1I3AA 1RDUA 3WUHA 2QA4N 4KHNA 3DXKA 4BC2A 4BE1A 4CJPA 4PA1A 4A5AA 4DV7K 4Z4FA 4KI6A 2W6KA 1C0UA 5EX5A 3IFRA 4E7IA 4A2AA 2QW9A 5M1KA 3SPYA 4PL8A 3CXCM 1NJYA 1HKCA 1NGGA 4FM1A 3VA3A 2P9IA 3QBXA 4H0TB 1YJWN 3FZFA 3WQTA 4UY8O 4DV1K 3NGIA 2NNWA 2Z1HA 1BU6O 3C6UA 3ITHA 2CGLA 1HJRA 2HOEA 2F96A 3HVTA 3QIPA 4AHVA 3MN5A 4AM6A 3ZEUB 1O1WA 3JS6A 1DTQA 3IS9A 1JCFA 1RCHA 2O8BB 4BR5A 3WQUA 3DI6A 3M1FA 4ZHRA 4OO1J 3M8PA 1QSSA 1CXUA 1RBUA 2GELA 3GOIA 1LAVA 3U9ZA 3QEWA 3T19A 5FPNA 4ELTA 1A5XA 3TAMA 4B9UA 1NGAA 2HNZA 2NRHA 4H5TA 4BE0A 1J53A 3EKUA 1XC3A 3SV3A 5KGWA 4FJGA 3PIOL 1VSLA 2YJFA 5HL7L 3CIPA 3VGKA 1J5EK 3DLBA 2QKKA 4CZGA 3R1XA 1QZ6A 3V81A 3D7EO 4ISFA 4KKOA 4I6MB 4O55A 5C24A 4KFBA 3NGYA 1KVCA 4R79A 3HT3A 4CJTA 1XMOK 3EZWA 4DV4K 5BREA 4F3OA 3CFPA 5HOOA 3ID8A 1EO1A 4JV5K 2X6SA 4IJAA 5KI6A 3F73A 3FFIA 1SKWA 2JGUA 4OJRA 4DTUA 1QSYA 4CI6A 3KWGA 3L2WA 4E0DA 2OPPA 3UIQA 4DG1A 4DSIA 1FXXA 4MDAA 2F9TA 2UXDK 4RTFD 4NCGA 3ZSXA 1NKBA 2V51B 4ILJA 4CHOA 4BC4A 2KZMA 2XY7A 5AQLA 1D9FA 1WAFA 3U9DA 3NFAA 5FPMA 1S5JA 3OS2A 1NBWA 5GINA 4KRFA 2CGKA 4FOEA 5J2PA 3LM2A 3SPZA 4BY9C 1JLQA 2ZM6K 2HVHA 3I55N 2QWNA 4LF8K 2BTFA 1B9FA 3DJCA 1HYVA 1Y64A 1TK0A 3H3OB 4IFYA 2BUPA 5GAEP 2V7YA 4EHTA 4RG8A 3P1GA 1QTMA 1L3SA 2LSNA 1S6QA 3H1QA 3G10A 1D9DA 1BI4A 1Z05A 1LWFA 3AVLA 4CCHA 3M3ZA 4BQLA 1IBKK 4CJRA 1IKVA 3S9HA 4IBNA 1NGJA 2YI1A 5BR9A 3K5LA 3T69A 2O8DA 2B4JA 4B1VA 4WYBA 4BWMA 1HLUA 3HO1A 4FW1A 2FSNA 1VSDA 3AA4A 3HSTB 3O4QA 2E8AA 1XQSC 1WOQA 1W7AA 4FWQA 2BANA 3KZBA 4Q5VA 1WSGA 2EWSA 5KRTA 2JWLA 1J9AA 2HF3A 1NJWA 4AQYK 4HCBA 3TAPA 1RT2A 4ICLA 3MN9A 4CF2A 5BRDA 4FSVA 4LFBK 1IBLK 3K9JA 1T7PA 3E1YA 1TL3A 4X65K 1JJ2M 4A2BA 3NF7A 3OHRA 5AQGA 2HHWA 1RDWX 5HROA 4WQ5A 3ZX3A 3WNHA 4O5BA 1HPMA 1XC9A 3ZYYX 3V1QA 5GAGP 1Q18A 2O8CB 1HYZA 3K5MA 1YVNA 2VQFK 2P5GA 1GOBA 2XY6A 4FPAA 1YTUA 5KPRA 1QZ5A 4DR1K 4IEIA 4EFHA 3A8YA 3OYNA 1SUQA 3LWLA 2Q0UA 1KC8O 4YOWA 3P39A 2WONA 2Q2RA 3V1OA 2KLAA 3BF3A 1XHXA 5AQSA 3LZJA 1RNHA 3ZX0A 5HRNA 2FSJA 4JI4K 4U7BA 5JVGL 1F21A 1GOCA 4PKIA 1M90O 4DQPA 4FJKA 1U2VB 2PBDA 3THXA 4CGIA 4HHTA 1HQUA 4DCHA 5AQOA 3TANA 1FW6A 2F7TA 1LOTB 1QS4A 3A2FA 1UA1A 2P9SB 4NXNK 3AARA 3E9PA 4C8NA 4PUOA 4JKEA 1EQYA 2EX3A 5AQWA 2O8EB 3FE1A 4FJJA 4DU4A 1VSKA 2P9LB 5KQ8A 3FZMA 3LP3A 1SS6A 3BDPA 2P9UA 4L8RB 2A1SA 2IGIA 4DR3K 3F9MA 2J4RA 5BPLA 3CQ8A 1JLCA 3C65A 1T3VA 4QCLA 1TKTA 1ATSA 1DEJA 2Q31A 3D2FB 3D45A 4CZHA 3NDKA 3H3NO 1RDCA 1RBVA 2HBMA 1KTQA 1NGEA 3O9TA 2P9PB 3MX5A 3P31A 1E4FT 4K25A 4YORA 1TK5A 2O8CA 1IKXA 4CJ4A 3O3HA 3OS0A 1N5YA 3RR7A 4IOAL 1MDUB 3U6FA 5AQJA 3E66A 4M3TA 1S1UA 4DR2K 3KK3A 3TWHA 2HF4A 1BGXT 1SL2A 2OCEA 3AVBA 4WFAL 3G4SN 5JICA 3CCMN 4LD0A 1Q7YO 3WEEB 3VQAA 3M8QA 1IJJA 4ELVA 3UKUB 3MEEA 3O3GA 4H5WA 3TARA 4MFBA 3BF1A 4H4OA 4LC9B 3D2EB 3AAQA 3ZLJA 1JLBA 2GUPA 1HNVA 1VHXA 5KPTA 4CGFA 3O9SA 1RFQA 4DF4A 3RVCA 1WSIA 4BR4A 4DFMA 1BIZA 5DM7L 4IG0A 4CJSA 1VSHA 1OH8A 2QTDA 3O1BA 4IJNA 4B08A 3ENBA 5HRRA 3A5OC 4BRFA 4Z94A 3L2RA 3BZCA 3DAWA 3U3GA 4FM2A 2H3GX 3UKRB 4F2RA 4B3RK 4H4MA 2UUAK 3J7YP 4BROA 1MU2A 1FKPA 3C6HA 2HVIA 4AF1A 4FL9A 3L3VA 1FK9A 3VMFB 4CJQA 3L2QA 3MAQA 1JXEA 5AFUH 2Z1JA 4FYDA 4PKHA 4NXMK 3KKSA 4CJWA 4DLGA 3KK1A 1NMDA 3N4PA 3L2VA 1VSIA 3DWLA 4CD1A 2YCHA 4BVPA 3V9WA 3TSPA 4JKGA 2OZSA 5EY4A 5HRPA 1MA9B 5CYQA 5HBMA 3HVRA 3QIOA 2V52B 5AQRA 1VQ7N 3BP8A 3CCQN 1S9EA 3ATVA 1T8EA 3AGKA 4A5BA 4IFVA 3IG1A 3TTFA 4CJ7A 4CVNE 3O08A 4RW4A 2NRXA 3QLHA 4E7HA 2CH5A 5CE3A 4M45A 2NRVA 4M42A 1VSJA 2YX6A 5BPMA 1KFSA 3C94A 4YY3K 3H1VX 4B9LA 4XEIA 1JLEA 1NK4A 5AQUA 1NK5A 4DV6K 4LSNA 4FWRA 1C0TA 5C2DA 5E84A 4FJHA 1NGIA 1C0FA 3OTOK 4L3QA 1BISA 2HNDA 1QHTA 3CJ7A 2GBZA 1BA0A 3SQ0A 1SKSA 2ZJRL 3AO3A 4CJUA 1BCOA 2VGMA 4BR0A 4KTWA 4M7XA 4BG9A 4FLVA 4MO4A 4FCYA 1TAUA 4CZIA 2BE2A 4WQ5C 4M3RA 4PY5A 5K14A 3HZ6A 2G8UA 5AQXA 4B9MA 4FZYA 4CERA 4FXDA 4GVMA 4FJLA 4JKGB 3LP0A 2YKNA 4JK9A 4JN4A 4CEDA 3C6TA 3RTVA 3PX0A 3J8AA 3ULDA 3ZSYA 3WXLA 4CJKA 2P9NA 1EWQA 3QEXA 2OPQA 3PX6A 4DR4K 4QS9A 5AZJB 2QWLA 3K5OA 3HJFA 4KTZA 3TU5A 2O8BA 3HL8A 1X9MA 3OYJA 3KLGA 1BHLA 3OVNA 3S3NA 1HYSA 3U4LA 5C15A 5I9EB 1RDAA 2VG5A 3RSEA 2KKZA 4OKEA 1YJ9N 4CJVA 1KSPA 3C7NA 2IC3A 4Q0BA 4CIFA 1CZBA 1WLJA 2VYPA 2ZQBA 3MMVA 1QSLA 3SQ1A 3ZCMA 1XNRK 2QK9A 1KRPA 3AVHA 3FLCO 4N56A 1RGIA 4CHNA 4MQ3A 5C10A 2ZE2A 5ELZA 1SV5A 4H0PA 2HSTA 4NYNA 1ZXOA 2ITGA 4E89A 2GEMA 3LWMA 4CHYA 3HP9A 4YOTA 3NGZA 4BC3A 1GOAA 2FLOA 5CHIA 2Q1NA 1U45A 5CY4A 1LV5A 2NRWA 4LFAK 4KHPK 4DFKA 3Q7BA 3VEZA 1QHAA 2IVNA 1NMNA 1UOCA 5T7BA 3NH1A 3KJVA 4FK4A 2E2PA 4X66K 3P4IA 4YOXA 2O4GA 3OYBA 3OYHA 3WXKA 5AQPA 4GV9A 3V4IA 1HQEA 4M3YA 1TGOA 3DOKA 1D5AA 3SAHA 4BC5A 1JCEA 2FF3B 3DRRA 3ASMA 1VRTA 3SJJA 1NK8A 2RE2A 3VEWA 1JL1A 5AQIA 1EKEA 4M3ZA 2WOMA 4CK2A 4OPHA 3W3DA 1VQPN 4DQIA 5F0XA 3WXMB 4IDHA 1W97L 3CMEN 1WBBA 1EWRA 3RRGA 5BN8A 5CR4A 4W5RA 5J2QA 4CBXA 4FJ8A 2DFEA 3S41A 5CYMA 4DTMA 4F3TA 3H08A 4CFDA 4DU1A 3ZSOA 2D0BA 4CD3A 3CQXA 1CLQA 3SK3A 3ZSRA 5AZIA 3HYFA
chains in the Genus database with same CATH topology
2W42A 3TAPA 1RT2A 4HCBA 1IH7A 4ICLA 2IS3A 4CFCA 4DSEA 4CF2A 1VSMA 4EP4A 4HTUA 4B3OA 3K2PA 4CJLA 3P5JA 1XHZA 3T3FA 3T1AA 3PX4A 3CFOA 1Z25A 4H8KA 2PZSA 4BACA 1T7PA 4DWIA 1ZBIA 1RDDA 1TL3A 4O4GA 4B9TA 1NJXA 3VQBA 2YNHA 2DFFA 3NF7A 3IRXA 4IKFA 2HHWA 4AHUA 5HROA 1B9DA 3HM9A 5C25A 4KI4A 2JLEA 3VQPA 3WNHA 2ATQA 4O5BA 2RN2A 3V6DA 4KHQA 1N6QA 3VA0A 3BGRA 5SZTA 1XC9A 2Y1JA 3V1QA 4N47A 3P83D 4EZ9A 3AVCA 1HYZA 3K5MA 1J5OA 2QXFA 1BL3A 5CZ2A 4QAGA 2P5GA 1GOBA 2XY6A 4J2AA 1YTUA 5EU7A 1RBTA 3CYMA 2XO7A 3RMCA 2G8FA 3SUNA 3NF8A 4DTPA 4NCBA 1RT7A 1U4BA 3PUFA 3U3YA 4N76A 4CF9A 3RMAA 5DK5A 3OYNA 1SUQA 3LWLA 4HUGA 4G1QA 3TAFA 3AO1A 3B6OA 4HUEA 2A1RA 2YNFA 4YNQA 3OYGA 1L5UA 3OY9A 4B8AB 3TI0A 4ZTJA 4KHUA 1WSFA 3MXMA 4BE2A 2WONA 3IAYA 4M3XA 4CIGA 2YNGA 4ID1A 4O44A 1LWEA 3V1OA 3QEIA 4I9QA 1XHXA 1SL1A 3SUQA 3PO4A 2KQ2A 3L2UA 3LZJA 3MECA 1CXQA 2Y1IA 1RNHA 3K58A 4E7KA 4RW9A 3MEGA 1NK7A 3EY1A 5HRNA 4DMNA 4KB0A 3ZT3A 3KD1E 4CEQA 3OYFA 2YKMA 3TAGA 3AVFA 1F21A 1GOCA 1YT3A 3ZT1A 4DQPA 4FJKA 1R0AA 1EETA 3NHGA 3OYCA 1U49A 3PO5A 4Z4IA 4PWDA 2NUBA 4Z0UA 4C8MA 3QNNA 4NCAA 4CGIA 4HHTA 1WNSA 1HQUA 4DFPA 2OPRA 3QETA 3LANA 3TANA 5FROA 4CHZA 4W5NA 4F2SA 1QS4A 3TAQA 2G8KA 1EXQA 2HHXA 4B9VA 3A2FA 1UA1A 4M3WA 4DS4A 4DF8A 1W9HA 1Q9XA 5CZ1A 4CGDA 1W0HA 2HHQA 4C8NA 4E1NA 4PUOA 2GUIA 4CHQA 3V9UA 5JS2A 2HNYA 1J54A 3ZT2A 2R7YA 4JRQA 3PV8A 4AHRA 3KIOA 5KGXA 2EX3A 5J1EA 3QEPA 3AVNA 2FBTA 1CZ9A 4DQSA 1D8YA 2BDPA 4Z4EA 3M8SA 3C95A 3OYEA 1LW2A 1NKCA 4FJNA 3DRSA 1RBRA 3ALYA 3I0SA 4FJJA 5J2MA 4AHCA 2HHUA 1KCFA 4JRPA 4DU4A 2G8HA 1ZBHA 3ZSZA 4CK1A 1NKEA 1FKOA 1VSKA 4I2PA 3S3MA 4LH4A 1QQCA 4FW2A 2YNIA 2HB5A 1U48A 1X9SA 4FK0A 4E7JA 3LP3A 2X78A 3BDPA 2X6NA 4E7LA 5KRSA 4L8RB 2VWJA 3HPHA 4FZZA 1C6VA 2A1SA 2IGIA 3M8RA 1SL0A 4C8LA 4OGCA 4KTQA 3WNFA 4N41A 3G0ZA 1TKZA 3AO2A 1JLCA 4CEZA 3KLFA 3CQ8A 4JS4A 4TSXA 4QCLA 1TKTA 3AVGA 2ZD1A 2P1JA 4KHSA 4RW7A 3D45A 4RW8A 3RR8A 1BI4B 4BDPA 3NDKA 1RDCA 1RBVA 3DLEA 1KTQA 1S1TA 3NCIA 4DU3A 2F8SA 1TK5A 1IG9A 3LAKA 1JLGA 3MXJA 4FVMA 1IKXA 4CJ4A 3O3HA 4CJ3A 3SI6A 3OS0A 1N5YA 3RR7A 3O4NA 3U6FA 3SQ2A 4FJXA 4M3TA 4QOZB 1S1UA 1ZBUA 4C8OA 3KK3A 4W5TA 3TWHA 1BGXT 1SL2A 3AVAA 3AVBA 3OYAA 3VQQA 3O3FA 3LP1A 4DSJA 1TVRA 1TV6A 4LD0A 1Q9YA 3ZSWA 3DMJA 4N5SA 2D5RA 3V9SA 2HW3A 2HHSA 2DTUA 4FLWA 3MEDA 1JL2A 4BWJA 4CE9A 4CGJA 3VQAA 4HCCA 3M8QA 2EHGA 4ELVA 5D3GA 4KO0A 3KLHA 3VQEA 1NK6A 3MEEA 3HK2A 2DY4A 3KLEA 1LWCA 3O3GA 1C1BA 3V9XA 2RKIA 4DLEA 3QO9A 4MFBA 4UQGA 3TARA 2O4IA 1X1PA 4H4OA 3VN5A 4F4KA 1KLMA 2DFHA 3V9ZA 2G8IA 3AVJA 5J2NA 1JLBA 2PY5A 1HNVA 2FBYA 2FBVA 4CEFA 4CGFA 3DRPA 1RDBA 4JS5A 4OLBA 4FLXA 2B5JA 4B9SA 3SV4A 4GW6A 1L3UA 4DF4A 1RBSA 3I0RA 3AA2A 1TK8A 1WSIA 4DFMA 1BIZA 2XRIA 3QNOA 4IG0A 2VG7A 1BCMA 1S1VA 1VSHA 4CJSA 2G8VA 4CEAA 1ASVA 2Z1GA 3ZT0A 3QEVA 2BGGA 1DTTA 4B08A 4YFUA 4DQQA 4LSLA 3NF9A 3MXIA 4I2QA 5HRRA 3DLKA 1JKHA 4DSLA 4OPJA 3WNEA 3L2RA 4WE1A 1U04A 3U3GA 4FM2A 1RT3A 4F2RA 3QINA 4H4MA 3HXMA 1TAQA 4AHTA 2KZZA 1IO2A 4FJ9A 3F9KA 4W5OA 3DLHA 1MU2A 1FKPA 4JLHA 3VQDA 4CGHA 3SCXA 2HVIA 3OYLA 1DLOA 3D0PA 3SUPA 1RTDA 3L3VA 1FK9A 4CJQA 3L2QA 3MAQA 1BQNA 1C0MA 3LAMA 3S3OA 4CF0A 2VG6A 1JXEA 1QE1A 1UWBA 2P51A 1REVA 2Z1JA 4I7FA 4XIUA 3JSMA 4FYDA 4O0JA 1BQMA 4KHWA 4DTRA 3KKSA 4CJWA 4J2BA 4DLGA 3KK1A 5C42A 4CF1A 1Y97A 2D0CA 1NJZA 3LPTA 1WSEA 3L2VA 4CECA 3ZSVA 3OYDA 4NYFA 1VSIA 4FLZA 1ASWA 4C8KA 3V9WA 4E3SA 1S1XA 3DLGA 4FLUA 4AILC 1C1AA 4CEBA 2PYJA 4E1MA 2OZSA 2KTQA 5HRPA 1RTHA 3OYMA 1X9WA 3VQ7A 2HHTA 4LH5A 3I8DA 1VRUA 2RPIA 1TL1A 5CYQA 5HBMA 3HVRA 3QIOA 2IDOA 3KK2A 1WN7A 4FLYA 3QERA 4CF8A 3B6PA 1G15A 1S9EA 4CEEA 3LDSA 4AH9A 1T8EA 3RWUA 4CEOA 5I42A 1RT6A 4IFVA 3IG1A 2XHBA 1NK0A 4Z4GA 1LW0A 4RW4A 4BDZA 3QLHA 4E7HA 4CJFA 1BIUA 1I3AA 1L3VA 3K5NA 1UAXA 3VQ9A 4M45A 3JYTA 1XI1A 2GV9A 4KHNA 1VSJA 4M42A 4KPYA 3OJUA 1KFSA 3PY8A 3C94A 4BE1A 4CJPA 3AA5X 4PA1A 4Z4FA 4KI6A 2IAJA 4FJIA 1EP4A 3ZSQA 4B9LA 1JLEA 1C0UA 1HRHA 1VSEA 4E7IA 4CGGA 1B92A 2G8WA 1NK4A 4DQRA 3SPYA 1NK5A 4B9NA 3EYZA 1TKDA 3AVMA 4LSNA 1NJYA 4Y1CA 2Q3SA 3CM6A 4KB1A 1C0TA 4FM1A 2VWKA 4ELUA 3VA3A 1U47A 4FJHA 4W5QA 1ASUA 3AV9A 1RTJA 4DSFA 1BISA 4CJEA 2HNDA 3NGIA 1QHTA 2Z1HA 1S1WA 2PYLA 2GBZA 3VQ5A 1JXBA 3C6UA 3ITHA 4KV8A 1HJRA 3SQ0A 3SUOA 1SKSA 2AJQA 4FJMA 5E41A 3OJSA 2F96A 4PQUA 4B8CA 3AO3A 3OS1A 4M41A 3HVTA 1BCOA 3QIPA 4CJUA 4AHVA 4KTWA 1O1WA 1DTQA 3CG7A 3AO5A 3IS9A 4FLVA 1RT1A 3TR8A 4DS5A 1RCHA 1HPZA 4Y1DA 5HLFA 2F8TA 1JLAA 4FCYA 1TAUA 5JS1A 2BE2A 4M3RA 4PY5A 3AVKA 5K14A 3RMDA 4DSKA 1KVAA 2G8UA 4CFAA 3DI6A 4B9MA 4CERA 4ZHRA 4FZYA 4EZ6A 4DFJA 4FXDA 4GVMA 3M8PA 1QSSA 1CXUA 3L8BA 1L3TA 1RBUA 3ISNC 3LP0A 3NH2A 2YKNA 3SYZA 4FJLA 4CEDA 3C6TA 4Z4HA 3RTVA 3PX0A 2E6MA 1LAVA 4HUFA 1HMVA 3ULDA 3ZSYA 3QEWA 3RMBA 3T19A 2X74A 4CJKA 1ZYQA 4ELTA 3DLRA 3VQ8A 3VQCA 5FRMA 1A5XA 3DOLA 3TAMA 3QESA 3QEXA 2OPQA 3PX6A 1T03A 4B9UA 4FM0A 4FJ7A 2HNZA 4CESA 4BE0A 1LAWA 1J53A 3V1RA 1WSJA 4I9LA 2OPSA 3K5OA 3SV3A 4GMJB 4KTZA 3HJFA 5KGWA 4CIEA 2XY5A 4FJGA 3HL8A 1X9MA 2OA8A 2E4LA 4J2EA 1NK9A 1VSLA 3OYJA 3VQ6A 3KLGA 2Z1IA 1KFDA 4IDKA 1IKYA 1VSFA 1BHLA 3OVNA 4OKKA 1SKRA 4IG3A 4OLAA 3K57A 3S3NA 3LPUA 4DTJA 1A5VA 3SNNA 3DLBA 2QKKA 1HYSA 1WAJA 4ID5A 4OGEA 3V81A 5C24A 4KKOA 2IOCA 4DTSA 1Z26A 4O55A 1HNIA 1RDAA 2VG5A 5FRNA 3NE6A 4KFBA 3AO4A 1ZBFA 3NGYA 4OKEA 3L3UA 1KVCA 4CJVA 3VQ4A 1KSPA 4FJ5A 2KFNA 3HT3A 4CJTA 2IC3A 1YVUA 4Q0BA 4CIFA 3LALA 1IKWA 1CZBA 1A5WA 1WLJA 1RT5A 1KVBA 2RF2A 2YV0X 4F3OA 2ZQBA 3E01A 3CFPA 3KKRA 1QSLA 3SQ1A 5DMRA 3ZCMA 2X6SA 2QK9A 1XWLA 5KI6A 3F73A 3AVHA 1KRPA 1JLFA 3SQ4A 2HHVA 3FFIA 1RILA 1SKWA 2JGUA 4N56A 4CHNA 4DTOA 4OJRA 4MQ3A 3NF6A 4DTUA 1QSYA 1T05A 3L2WA 3HPGA 2ZE2A 3OYIA 3NBPA 1SV5A 4LY7A 4E0DA 4NYNA 4K8ZA 4DTXA 2ITGA 2OPPA 4E89A 4AHSA 3LWMA 4DG1A 1I39A 4CHYA 4ZTFA 3UIQA 4DSIA 1FXXA 3HP9A 1RT4A 4OPKA 1Q8IA 3NGZA 4CK3A 1EX4A 1GOAA 3OYKA 2HMIA 2E6LA 2OZMA 4NCGA 3ZSXA 1NKBA 5I3UA 4CHOA 2OYQA 1U45A 3AVIA 5CY4A 1LV5A 5FDLA 4CFBA 2ETJA 3WNGA 3ZT4A 2KZMA 3K59A 2XY7A 2FC0A 4DFKA 1S6PA 1WAFA 4OVLA 3NFAA 1D9FA 1S5JA 3OS2A 3DYAA 4KRFA 4KAZA 3LZIA 4DTNA 4CJ5A 1UOCA 5T7BA 3NH1A 3KJVA 5J2PA 4FK4A 3SPZA 1JLQA 4J2DA 3LP2A 3OYBA 2O4GA 2XY8A 2QKBA 2FBXA 2P5OA 3AA3A 2HVHA 3OYHA 3KD5E 1WSHA 4RW6A 3V4IA 1HQEA 1B9FA 3CFRA 1HYVA 1NOZA 2I5JA 4M3YA 1TGOA 3DOKA 2B6AA 1D5AA 1TK0A 3DRRA 3EZ5A 5KTQA 1TKXA 2YHAA 4IFYA 1YTAA 4O0IA 1C1CA 4BDYA 4EP5A 3ASMA 3CM5A 3DM2A 4RG8A 3P1GA 1VRTA 4R5PA 3HP6A 5SWMA 3SJJA 3THVA 1NK8A 1QTMA 1L3SA 2LSNA 4FLTA 1S6QA 1D9DA 3G10A 4Z4CA 1JL1A 1BI4A 3NH0A 2KW4A 1LWFA 3AVLA 4CCHA 4KHYA 3HPOA 4CJRA 4K8XA 1EKEA 1IKVA 3S9HA 4M3ZA 2WOMA 4IBNA 4CK2A 4HVJA 5HRSA 3RRHA 5HP1A 4DQIA 2KFZA 3KTQA 3K5LA 1NOYA 3TAEA 3RRGA 1UA0A 4KREA 2B4JA 4W5RA 3NAEA 4BWMA 5J2QA 4FJ8A 3HO1A 4E19A 2DFEA 4DTMA 5CYMA 1S9GA 4FW1A 4FK2A 1RTIA 1K6YA 1VSDA 3AA4A 4F3TA 3HSTB 3H08A 3O4QA 1VK0A 4CHPA 4OKJA 4CFDA 1ZBLA 4FZXC 4DU1A 3ZSOA 2D0BA 3SZ2A 2BANA 4M3UA 1CLQA 4Q5VA 1KLNA 1WSGA 5KRTA 2D0AA 3ZSRA 1J9AA 3TABA 4F8RA 1NJWA 3HYFA 3KLIA 2YHBA 1ITGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W42 A;  3TAP A;  1RT2 A;  4HCB A;  1IH7 A;  4ICL A;  2IS3 A;  4CFC A;  4DSE A;  4CF2 A;  1VSM A;  4EP4 A;  4HTU A;  4B3O A;  3K2P A;  4CJL A;  3P5J A;  1XHZ A;  3T3F A;  3T1A A;  3PX4 A;  3CFO A;  1Z25 A;  4H8K A;  2PZS A;  4BAC A;  1T7P A;  4DWI A;  1ZBI A;  1RDD A;  1TL3 A;  4O4G A;  4B9T A;  1NJX A;  3VQB A;  2YNH A;  2DFF A;  3NF7 A;  3IRX A;  4IKF A;  2HHW A;  4AHU A;  5HRO A;  1B9D A;  3HM9 A;  5C25 A;  4KI4 A;  2JLE A;  3VQP A;  3WNH A;  2ATQ A;  4O5B A;  2RN2 A;  3V6D A;  4KHQ A;  1N6Q A;  3VA0 A;  3BGR A;  5SZT A;  1XC9 A;  2Y1J A;  3V1Q A;  4N47 A;  3P83 D;  4EZ9 A;  3AVC A;  1HYZ A;  3K5M A;  1J5O A;  2QXF A;  1BL3 A;  5CZ2 A;  4QAG A;  2P5G A;  1GOB A;  2XY6 A;  4J2A A;  1YTU A;  5EU7 A;  1RBT A;  3CYM A;  2XO7 A;  3RMC A;  2G8F A;  3SUN A;  3NF8 A;  4DTP A;  4NCB A;  1RT7 A;  1U4B A;  3PUF A;  3U3Y A;  4N76 A;  4CF9 A;  3RMA A;  5DK5 A;  3OYN A;  1SUQ A;  3LWL A;  4HUG A;  4G1Q A;  3TAF A;  3AO1 A;  3B6O A;  4HUE A;  2A1R A;  2YNF A;  4YNQ A;  3OYG A;  1L5U A;  3OY9 A;  4B8A B;  3TI0 A;  4ZTJ A;  4KHU A;  1WSF A;  3MXM A;  4BE2 A;  2WON A;  3IAY A;  4M3X A;  4CIG A;  2YNG A;  4ID1 A;  4O44 A;  1LWE A;  3V1O A;  3QEI A;  4I9Q A;  1XHX A;  1SL1 A;  3SUQ A;  3PO4 A;  2KQ2 A;  3L2U A;  3LZJ A;  3MEC A;  1CXQ A;  2Y1I A;  1RNH A;  3K58 A;  4E7K A;  4RW9 A;  3MEG A;  1NK7 A;  3EY1 A;  5HRN A;  4DMN A;  4KB0 A;  3ZT3 A;  3KD1 E;  4CEQ A;  3OYF A;  2YKM A;  3TAG A;  3AVF A;  1F21 A;  1GOC A;  1YT3 A;  3ZT1 A;  4DQP A;  4FJK A;  1R0A A;  1EET A;  3NHG A;  3OYC A;  1U49 A;  3PO5 A;  4Z4I A;  4PWD A;  2NUB A;  4Z0U A;  4C8M A;  3QNN A;  4NCA A;  4CGI A;  4HHT A;  1WNS A;  1HQU A;  4DFP A;  2OPR A;  3QET A;  3LAN A;  3TAN A;  5FRO A;  4CHZ A;  4W5N A;  4F2S A;  1QS4 A;  3TAQ A;  2G8K A;  1EXQ A;  2HHX A;  4B9V A;  3A2F A;  1UA1 A;  4M3W A;  4DS4 A;  4DF8 A;  1W9H A;  1Q9X A;  5CZ1 A;  4CGD A;  1W0H A;  2HHQ A;  4C8N A;  4E1N A;  4PUO A;  2GUI A;  4CHQ A;  3V9U A;  5JS2 A;  2HNY A;  1J54 A;  3ZT2 A;  2R7Y A;  4JRQ A;  3PV8 A;  4AHR A;  3KIO A;  5KGX A;  2EX3 A;  5J1E A;  3QEP A;  3AVN A;  2FBT A;  1CZ9 A;  4DQS A;  1D8Y A;  2BDP A;  4Z4E A;  3M8S A;  3C95 A;  3OYE A;  1LW2 A;  1NKC A;  4FJN A;  3DRS A;  1RBR A;  3ALY A;  3I0S A;  4FJJ A;  5J2M A;  4AHC A;  2HHU A;  1KCF A;  4JRP A;  4DU4 A;  2G8H A;  1ZBH A;  3ZSZ A;  4CK1 A;  1NKE A;  1FKO A;  1VSK A;  4I2P A;  3S3M A;  4LH4 A;  1QQC A;  4FW2 A;  2YNI A;  2HB5 A;  1U48 A;  1X9S A;  4FK0 A;  4E7J A;  3LP3 A;  2X78 A;  3BDP A;  2X6N A;  4E7L A;  5KRS A;  4L8R B;  2VWJ A;  3HPH A;  4FZZ A;  1C6V A;  2A1S A;  2IGI A;  3M8R A;  1SL0 A;  4C8L A;  4OGC A;  4KTQ A;  3WNF A;  4N41 A;  3G0Z A;  1TKZ A;  3AO2 A;  1JLC A;  4CEZ A;  3KLF A;  3CQ8 A;  4JS4 A;  4TSX A;  4QCL A;  1TKT A;  3AVG A;  2ZD1 A;  2P1J A;  4KHS A;  4RW7 A;  3D45 A;  4RW8 A;  3RR8 A;  1BI4 B;  4BDP A;  3NDK A;  1RDC A;  1RBV A;  3DLE A;  1KTQ A;  1S1T A;  3NCI A;  4DU3 A;  2F8S A;  1TK5 A;  1IG9 A;  3LAK A;  1JLG A;  3MXJ A;  4FVM A;  1IKX A;  4CJ4 A;  3O3H A;  4CJ3 A;  3SI6 A;  3OS0 A;  1N5Y A;  3RR7 A;  3O4N A;  3U6F A;  3SQ2 A;  4FJX A;  4M3T A;  4QOZ B;  1S1U A;  1ZBU A;  4C8O A;  3KK3 A;  4W5T A;  3TWH A;  1BGX T;  1SL2 A;  3AVA A;  3AVB A;  3OYA A;  3VQQ A;  3O3F A;  3LP1 A;  4DSJ A;  1TVR A;  1TV6 A;  4LD0 A;  1Q9Y A;  3ZSW A;  3DMJ A;  4N5S A;  2D5R A;  3V9S A;  2HW3 A;  2HHS A;  2DTU A;  4FLW A;  3MED A;  1JL2 A;  4BWJ A;  4CE9 A;  4CGJ A;  3VQA A;  4HCC A;  3M8Q A;  2EHG A;  4ELV A;  5D3G A;  4KO0 A;  3KLH A;  3VQE A;  1NK6 A;  3MEE A;  3HK2 A;  2DY4 A;  3KLE A;  1LWC A;  3O3G A;  1C1B A;  3V9X A;  2RKI A;  4DLE A;  3QO9 A;  4MFB A;  4UQG A;  3TAR A;  2O4I A;  1X1P A;  4H4O A;  3VN5 A;  4F4K A;  1KLM A;  2DFH A;  3V9Z A;  2G8I A;  3AVJ A;  5J2N A;  1JLB A;  2PY5 A;  1HNV A;  2FBY A;  2FBV A;  4CEF A;  4CGF A;  3DRP A;  1RDB A;  4JS5 A;  4OLB A;  4FLX A;  2B5J A;  4B9S A;  3SV4 A;  4GW6 A;  1L3U A;  4DF4 A;  1RBS A;  3I0R A;  3AA2 A;  1TK8 A;  1WSI A;  4DFM A;  1BIZ A;  2XRI A;  3QNO A;  4IG0 A;  2VG7 A;  1BCM A;  1S1V A;  1VSH A;  4CJS A;  2G8V A;  4CEA A;  1ASV A;  2Z1G A;  3ZT0 A;  3QEV A;  2BGG A;  1DTT A;  4B08 A;  4YFU A;  4DQQ A;  4LSL A;  3NF9 A;  3MXI A;  4I2Q A;  5HRR A;  3DLK A;  1JKH A;  4DSL A;  4OPJ A;  3WNE A;  3L2R A;  4WE1 A;  1U04 A;  3U3G A;  4FM2 A;  1RT3 A;  4F2R A;  3QIN A;  4H4M A;  3HXM A;  1TAQ A;  4AHT A;  2KZZ A;  1IO2 A;  4FJ9 A;  3F9K A;  4W5O A;  3DLH A;  1MU2 A;  1FKP A;  4JLH A;  3VQD A;  4CGH A;  3SCX A;  2HVI A;  3OYL A;  1DLO A;  3D0P A;  3SUP A;  1RTD A;  3L3V A;  1FK9 A;  4CJQ A;  3L2Q A;  3MAQ A;  1BQN A;  1C0M A;  3LAM A;  3S3O A;  4CF0 A;  2VG6 A;  1JXE A;  1QE1 A;  1UWB A;  2P51 A;  1REV A;  2Z1J A;  4I7F A;  4XIU A;  3JSM A;  4FYD A;  4O0J A;  1BQM A;  4KHW A;  4DTR A;  3KKS A;  4CJW A;  4J2B A;  4DLG A;  3KK1 A;  5C42 A;  4CF1 A;  1Y97 A;  2D0C A;  1NJZ A;  3LPT A;  1WSE A;  3L2V A;  4CEC A;  3ZSV A;  3OYD A;  4NYF A;  1VSI A;  4FLZ A;  1ASW A;  4C8K A;  3V9W A;  4E3S A;  1S1X A;  3DLG A;  4FLU A;  4AIL C;  1C1A A;  4CEB A;  2PYJ A;  4E1M A;  2OZS A;  2KTQ A;  5HRP A;  1RTH A;  3OYM A;  1X9W A;  3VQ7 A;  2HHT A;  4LH5 A;  3I8D A;  1VRU A;  2RPI A;  1TL1 A;  5CYQ A;  5HBM A;  3HVR A;  3QIO A;  2IDO A;  3KK2 A;  1WN7 A;  4FLY A;  3QER A;  4CF8 A;  3B6P A;  1G15 A;  1S9E A;  4CEE A;  3LDS A;  4AH9 A;  1T8E A;  3RWU A;  4CEO A;  5I42 A;  1RT6 A;  4IFV A;  3IG1 A;  2XHB A;  1NK0 A;  4Z4G A;  1LW0 A;  4RW4 A;  4BDZ A;  3QLH A;  4E7H A;  4CJF A;  1BIU A;  1I3A A;  1L3V A;  3K5N A;  1UAX A;  3VQ9 A;  4M45 A;  3JYT A;  1XI1 A;  2GV9 A;  4KHN A;  1VSJ A;  4M42 A;  4KPY A;  3OJU A;  1KFS A;  3PY8 A;  3C94 A;  4BE1 A;  4CJP A;  3AA5 X;  4PA1 A;  4Z4F A;  4KI6 A;  2IAJ A;  4FJI A;  1EP4 A;  3ZSQ A;  4B9L A;  1JLE A;  1C0U A;  1HRH A;  1VSE A;  4E7I A;  4CGG A;  1B92 A;  2G8W A;  1NK4 A;  4DQR A;  3SPY A;  1NK5 A;  4B9N A;  3EYZ A;  1TKD A;  3AVM A;  4LSN A;  1NJY A;  4Y1C A;  2Q3S A;  3CM6 A;  4KB1 A;  1C0T A;  4FM1 A;  2VWK A;  4ELU A;  3VA3 A;  1U47 A;  4FJH A;  4W5Q A;  1ASU A;  3AV9 A;  1RTJ A;  4DSF A;  1BIS A;  4CJE A;  2HND A;  3NGI A;  1QHT A;  2Z1H A;  1S1W A;  2PYL A;  2GBZ A;  3VQ5 A;  1JXB A;  3C6U A;  3ITH A;  4KV8 A;  1HJR A;  3SQ0 A;  3SUO A;  1SKS A;  2AJQ A;  4FJM A;  5E41 A;  3OJS A;  2F96 A;  4PQU A;  4B8C A;  3AO3 A;  3OS1 A;  4M41 A;  3HVT A;  1BCO A;  3QIP A;  4CJU A;  4AHV A;  4KTW A;  1O1W A;  1DTQ A;  3CG7 A;  3AO5 A;  3IS9 A;  4FLV A;  1RT1 A;  3TR8 A;  4DS5 A;  1RCH A;  1HPZ A;  4Y1D A;  5HLF A;  2F8T A;  1JLA A;  4FCY A;  1TAU A;  5JS1 A;  2BE2 A;  4M3R A;  4PY5 A;  3AVK A;  5K14 A;  3RMD A;  4DSK A;  1KVA A;  2G8U A;  4CFA A;  3DI6 A;  4B9M A;  4CER A;  4ZHR A;  4FZY A;  4EZ6 A;  4DFJ A;  4FXD A;  4GVM A;  3M8P A;  1QSS A;  1CXU A;  3L8B A;  1L3T A;  1RBU A;  3ISN C;  3LP0 A;  3NH2 A;  2YKN A;  3SYZ A;  4FJL A;  4CED A;  3C6T A;  4Z4H A;  3RTV A;  3PX0 A;  2E6M A;  1LAV A;  4HUF A;  1HMV A;  3ULD A;  3ZSY A;  3QEW A;  3RMB A;  3T19 A;  2X74 A;  4CJK A;  1ZYQ A;  4ELT A;  3DLR A;  3VQ8 A;  3VQC A;  5FRM A;  1A5X A;  3DOL A;  3TAM A;  3QES A;  3QEX A;  2OPQ A;  3PX6 A;  1T03 A;  4B9U A;  4FM0 A;  4FJ7 A;  2HNZ A;  4CES A;  4BE0 A;  1LAW A;  1J53 A;  3V1R A;  1WSJ A;  4I9L A;  2OPS A;  3K5O A;  3SV3 A;  4GMJ B;  4KTZ A;  3HJF A;  5KGW A;  4CIE A;  2XY5 A;  4FJG A;  3HL8 A;  1X9M A;  2OA8 A;  2E4L A;  4J2E A;  1NK9 A;  1VSL A;  3OYJ A;  3VQ6 A;  3KLG A;  2Z1I A;  1KFD A;  4IDK A;  1IKY A;  1VSF A;  1BHL A;  3OVN A;  4OKK A;  1SKR A;  4IG3 A;  4OLA A;  3K57 A;  3S3N A;  3LPU A;  4DTJ A;  1A5V A;  3SNN A;  3DLB A;  2QKK A;  1HYS A;  1WAJ A;  4ID5 A;  4OGE A;  3V81 A;  5C24 A;  4KKO A;  2IOC A;  4DTS A;  1Z26 A;  4O55 A;  1HNI A;  1RDA A;  2VG5 A;  5FRN A;  3NE6 A;  4KFB A;  3AO4 A;  1ZBF A;  3NGY A;  4OKE A;  3L3U A;  1KVC A;  4CJV A;  3VQ4 A;  1KSP A;  4FJ5 A;  2KFN A;  3HT3 A;  4CJT A;  2IC3 A;  1YVU A;  4Q0B A;  4CIF A;  3LAL A;  1IKW A;  1CZB A;  1A5W A;  1WLJ A;  1RT5 A;  1KVB A;  2RF2 A;  2YV0 X;  4F3O A;  2ZQB A;  3E01 A;  3CFP A;  3KKR A;  1QSL A;  3SQ1 A;  5DMR A;  3ZCM A;  2X6S A;  2QK9 A;  1XWL A;  5KI6 A;  3F73 A;  3AVH A;  1KRP A;  1JLF A;  3SQ4 A;  2HHV A;  3FFI A;  1RIL A;  1SKW A;  2JGU A;  4N56 A;  4CHN A;  4DTO A;  4OJR A;  4MQ3 A;  3NF6 A;  4DTU A;  1QSY A;  1T05 A;  3L2W A;  3HPG A;  2ZE2 A;  3OYI A;  3NBP A;  1SV5 A;  4LY7 A;  4E0D A;  4NYN A;  4K8Z A;  4DTX A;  2ITG A;  2OPP A;  4E89 A;  4AHS A;  3LWM A;  4DG1 A;  1I39 A;  4CHY A;  4ZTF A;  3UIQ A;  4DSI A;  1FXX A;  3HP9 A;  1RT4 A;  4OPK A;  1Q8I A;  3NGZ A;  4CK3 A;  1EX4 A;  1GOA A;  3OYK A;  2HMI A;  2E6L A;  2OZM A;  4NCG A;  3ZSX A;  1NKB A;  5I3U A;  4CHO A;  2OYQ A;  1U45 A;  3AVI A;  5CY4 A;  1LV5 A;  5FDL A;  4CFB A;  2ETJ A;  3WNG A;  3ZT4 A;  2KZM A;  3K59 A;  2XY7 A;  2FC0 A;  4DFK A;  1S6P A;  1WAF A;  4OVL A;  3NFA A;  1D9F A;  1S5J A;  3OS2 A;  3DYA A;  4KRF A;  4KAZ A;  3LZI A;  4DTN A;  4CJ5 A;  1UOC A;  5T7B A;  3NH1 A;  3KJV A;  5J2P A;  4FK4 A;  3SPZ A;  1JLQ A;  4J2D A;  3LP2 A;  3OYB A;  2O4G A;  2XY8 A;  2QKB A;  2FBX A;  2P5O A;  3AA3 A;  2HVH A;  3OYH A;  3KD5 E;  1WSH A;  4RW6 A;  3V4I A;  1HQE A;  1B9F A;  3CFR A;  1HYV A;  1NOZ A;  2I5J A;  4M3Y A;  1TGO A;  3DOK A;  2B6A A;  1D5A A;  1TK0 A;  3DRR A;  3EZ5 A;  5KTQ A;  1TKX A;  2YHA A;  4IFY A;  1YTA A;  4O0I A;  1C1C A;  4BDY A;  4EP5 A;  3ASM A;  3CM5 A;  3DM2 A;  4RG8 A;  3P1G A;  1VRT A;  4R5P A;  3HP6 A;  5SWM A;  3SJJ A;  3THV A;  1NK8 A;  1QTM A;  1L3S A;  2LSN A;  4FLT A;  1S6Q A;  1D9D A;  3G10 A;  4Z4C A;  1JL1 A;  1BI4 A;  3NH0 A;  2KW4 A;  1LWF A;  3AVL A;  4CCH A;  4KHY A;  3HPO A;  4CJR A;  4K8X A;  1EKE A;  1IKV A;  3S9H A;  4M3Z A;  2WOM A;  4IBN A;  4CK2 A;  4HVJ A;  5HRS A;  3RRH A;  5HP1 A;  4DQI A;  2KFZ A;  3KTQ A;  3K5L A;  1NOY A;  3TAE A;  3RRG A;  1UA0 A;  4KRE A;  2B4J A;  4W5R A;  3NAE A;  4BWM A;  5J2Q A;  4FJ8 A;  3HO1 A;  4E19 A;  2DFE A;  4DTM A;  5CYM A;  1S9G A;  4FW1 A;  4FK2 A;  1RTI A;  1K6Y A;  1VSD A;  3AA4 A;  4F3T A;  3HST B;  3H08 A;  3O4Q A;  1VK0 A;  4CHP A;  4OKJ A;  4CFD A;  1ZBL A;  4FZX C;  4DU1 A;  3ZSO A;  2D0B A;  3SZ2 A;  2BAN A;  4M3U A;  1CLQ A;  4Q5V A;  1KLN A;  1WSG A;  5KRT A;  2D0A A;  3ZSR A;  1J9A A;  3TAB A;  4F8R A;  1NJW A;  3HYF A;  3KLI A;  2YHB A;  1ITG A; 
#chains in the Genus database with same CATH topology
 3OW2 M;  3VTH A;  2IS3 A;  4CFC A;  2PZS A;  4JAX A;  4DWI A;  1ZBI A;  4KBO A;  1SQK A;  2E2O A;  1NJX A;  3VQB A;  2YNH A;  2DFF A;  1B9D A;  4BR7 A;  3EE9 A;  4M63 C;  3O4W A;  1TUU A;  3VQP A;  1GLE G;  3V6D A;  4KHQ A;  1KAZ A;  4BRG A;  2E88 A;  5SZT A;  4WF9 L;  2P9K B;  3VA0 A;  2Y1J A;  2O8F A;  1H1V A;  4U67 L;  3AVC A;  4DR6 K;  4IXC A;  2QXF A;  1K8K A;  4J2A A;  3M6G A;  3CYM A;  3RMC A;  3CF5 L;  3SUN A;  3NF8 A;  1RT7 A;  4JI7 K;  2KHO A;  3RMA A;  4K43 A;  4G1Q A;  3B6O A;  2A1R A;  4FWS A;  2YNF A;  4YNQ A;  3OYG A;  1L5U A;  4ZTJ A;  3ULE B;  4B8A B;  3JXU A;  3G6E N;  4M3X A;  4CIG A;  4ID1 A;  4O44 A;  3AGR A;  4FWK A;  3SUQ A;  4WQ4 A;  3L2U A;  3MEC A;  1CXQ A;  3K58 A;  3IUC A;  4RW9 A;  3SJH A;  3EY1 A;  5LL6 Z;  4DMN A;  3OYF A;  3I56 N;  4CW7 B;  3TAG A;  1U49 A;  3PO5 A;  5AQN A;  3VER A;  3QNN A;  2OPR A;  3LAN A;  5FRO A;  3TAQ A;  1J6Z A;  5BRH A;  2G8K A;  1Q86 O;  4M3W A;  1YAG A;  4DF8 A;  3FZL A;  1Q9X A;  1W0H A;  3V9U A;  3CER A;  1X3M A;  1LCU A;  3KIO A;  5AZI B;  1YHQ N;  5J1E A;  3BUZ B;  1HJO A;  1QVG M;  2FBT A;  4A57 A;  1CZ9 A;  3O9U A;  4DQS A;  1V4T A;  1NG9 A;  3GL1 A;  1LW2 A;  1RBR A;  3ALY A;  3I0S A;  4H0X B;  1KCF A;  3THX B;  2G8H A;  3ZSZ A;  3FR0 A;  4JI8 K;  4FK0 A;  2YNI A;  2HB5 A;  3O8M A;  3NVM A;  1YUW A;  2VWJ A;  3AAP A;  1C6V A;  2W6L A;  4OGC A;  3CHW A;  1TKZ A;  3AO2 A;  4CZM A;  4B1W B;  3FZK A;  3VEV A;  3CC7 N;  3AVG A;  1MWM A;  4RW8 A;  1HKG A;  4DU3 A;  1OH5 A;  1IG9 A;  3LAK A;  2O8E A;  3MXJ A;  4CZL A;  4FVM A;  1GLC G;  1BUP A;  3THW A;  3CD6 N;  3SQ2 A;  4QOZ B;  5C0Y A;  4JKC A;  1ZBU A;  4MLE A;  2ZWH A;  4JI1 K;  1CZA N;  2BH1 A;  4W5T A;  2P9L A;  3VGL A;  4J8F A;  1TV6 A;  1Q9Y A;  3DMJ A;  4JYA K;  2HW3 A;  2HHS A;  2DTU A;  2A42 A;  3MED A;  4FLW A;  1NWK A;  5M1O A;  3ULE A;  4KO0 A;  3KLH A;  3HK2 A;  3D2F A;  2DY4 A;  1LWC A;  3V9X A;  1C1B A;  2RKI A;  5H1S Q;  2O4I A;  2NZT A;  2DFH A;  3CJC A;  2G8I A;  1W2B M;  3TSU A;  2ASP A;  1BWF O;  2FBV A;  3QFU A;  1DGK N;  3QB0 A;  3GBT A;  4OLB A;  4FLX A;  2B5J A;  3CI5 A;  3SV4 A;  4BRC A;  4EAH D;  5F1X A;  3FGU A;  2IIR A;  2VG7 A;  1S1V A;  4RCH A;  4CEA A;  2O8D B;  3ZT0 A;  3JAM O;  3QEV A;  4DQQ A;  4I2Q A;  3DLK A;  3ENO A;  3A0I X;  4WE1 A;  1NGH A;  3QIN A;  3HXM A;  4B9Q A;  1KXP A;  4AHT A;  1YIT N;  1IO2 A;  3F9K A;  2HBL A;  3DLH A;  3CMA N;  3SCX A;  1HR0 K;  2QXL A;  2QEX N;  4XH1 A;  3PSF A;  2ASM A;  3R8E A;  3S3O A;  4CF0 A;  2VG6 A;  3JSM A;  1QE1 A;  4XIU A;  4GVE A;  4O0J A;  5M1Q A;  5GIP A;  5C42 A;  2GWK A;  4IZ9 A;  3UKR A;  3HTV A;  4E3S A;  3VEO A;  4FLU A;  4AIL C;  1C1A A;  2KTQ A;  3THW B;  2HHT A;  3VQ7 A;  3I8D A;  5FLX O;  2RPI A;  2IDO A;  5LMN K;  3A5N C;  3B6P A;  2D0O A;  3SAF A;  3LDS A;  1E3M A;  1KQS M;  5EOY A;  4HWI A;  4JHD B;  1LW0 A;  1FJG K;  4BDZ A;  1K9M O;  3K5N A;  1UAX A;  3JYT A;  2GV9 A;  3OJU A;  3CCR N;  4FJI A;  1HRH A;  1R59 O;  2F9W A;  1B92 A;  2E2N A;  4B9N A;  3EYZ A;  1TKD A;  3O9R A;  3J7A P;  2VWK A;  3ZET B;  4ELU A;  5TKY A;  1ILY A;  4W5Q A;  4JI2 K;  1RTJ A;  4H0V B;  4CJE A;  4CBU A;  1WB9 A;  1S1W A;  1GLF O;  5E41 A;  3OJS A;  1JCG A;  1MWK A;  4Y0W A;  4B8C A;  2A6A A;  3OS1 A;  4M41 A;  2YHY A;  3O1W A;  3ID6 A;  3AO5 A;  4DS5 A;  1RT1 A;  4O8U A;  1HPZ A;  2F8T A;  3KVG A;  1JLA A;  5AQZ A;  3RMD A;  4DSK A;  1QQO A;  3B8A X;  4DFJ A;  3SLC A;  1L3T A;  3ZX2 A;  2A41 A;  4GNI A;  3NH2 A;  4Z4H A;  4BRI A;  4HUF A;  1HMV A;  1ZYQ A;  1K73 O;  2X74 A;  3DLR A;  3VQ8 A;  3BEX A;  3VQC A;  1DT9 A;  4B1Z A;  3DOL A;  1T03 A;  4H0O A;  4CES A;  3QDK A;  1LAW A;  1WSJ A;  4I9L A;  2QI2 A;  2QWQ A;  4GMJ B;  5IWA K;  4LF5 K;  3CC2 N;  2XY5 A;  4J2E A;  1NK9 A;  4JI5 K;  1KFD A;  1IKY A;  1VSF A;  2QWR A;  4OKK A;  3HSC A;  5FPD A;  1A5V A;  1TYQ A;  2ZJQ L;  4OGE A;  3DLL L;  3HI0 A;  4FWM A;  1Z26 A;  2YHX A;  1HNI A;  1NU0 A;  2NRR A;  3AO4 A;  1ZBF A;  1S22 A;  3CCS N;  3VQ4 A;  3MWT A;  3UE5 A;  2D0P A;  2VGN A;  2WUS A;  3E01 A;  3CC4 N;  3EO3 A;  4X62 K;  3MWP A;  1JLF A;  3SQ4 A;  2HHV A;  1RIL A;  3I8B A;  3CQY A;  3OBY A;  4JD2 A;  4DTO A;  3NF6 A;  1T05 A;  3HPG A;  5F2R A;  4K8Z A;  4LY7 A;  3O9Q A;  4DTX A;  4AHS A;  1I39 A;  4FO0 A;  2IVP A;  1RT4 A;  4BRM A;  1NGF A;  4CK3 A;  4BRP A;  2E1Z A;  1EX4 A;  4BQZ A;  2HMI A;  1ATN A;  1T6D A;  5I3U A;  2OYQ A;  2VCP A;  5FDL A;  3ZT4 A;  2JWK A;  2P9S A;  3WXI A;  2FC0 A;  4OVL A;  2ZF5 O;  4KAZ A;  3LZI A;  1VQN N;  3RSE B;  4H5N A;  4LF6 K;  4NO7 A;  4J2D A;  3SBT A;  2QKB A;  3CCL N;  1SZ2 A;  2P5O A;  4V19 S;  1VQ5 N;  4H5R A;  2E2Q A;  5AJ3 K;  4ISG A;  2Q0R A;  4RW6 A;  3WT0 A;  4K41 A;  4DQ8 A;  4DV5 K;  3CJA A;  2B6A A;  1VAZ A;  2P9U B;  4AM7 A;  1TKX A;  4O0I A;  1YTA A;  4BDY A;  3AY9 A;  3TPQ A;  4EP5 A;  4C23 A;  3CM5 A;  3HP6 A;  5SWM A;  3THV A;  5M1F A;  3CPW M;  3NH0 A;  4BRK A;  4KHY A;  3HPO A;  3F5T A;  3EE8 A;  2V7Z A;  3LDO A;  3LDN A;  1GLD G;  4JKD A;  4HVJ A;  3RRH A;  5HP1 A;  2P9I B;  1NOY A;  1KAX A;  2YJE A;  4KRE A;  3O6W A;  4E19 A;  1OKJ A;  1S9G A;  4CZJ A;  2W40 A;  1RTI A;  1K6Y A;  4YDU A;  4CHP A;  4FZX C;  1VK0 A;  3O5B A;  5FPE A;  1ZBL A;  4FPB A;  4IOX A;  1XNQ K;  1BA1 A;  3WEE A;  3CJ9 A;  3TAB A;  4F8R A;  4BRA A;  3KLI A;  2YHB A;  2W42 A;  1IH7 A;  3D2E A;  1VSM A;  3K2P A;  4CJL A;  3P5J A;  1XHZ A;  2WTU A;  4DR7 K;  3CFO A;  4H8K A;  4BAC A;  3MN6 A;  1Q82 O;  3MDQ A;  4B9T A;  3C0B A;  1WUA A;  4AHU A;  4NLB A;  3MX2 A;  1OVY A;  3NVK A;  3CJ1 A;  2JLE A;  1YI2 N;  3LM9 A;  2ATQ A;  5B8H A;  3QML A;  1N6Q A;  3BGR A;  1N33 K;  3E9L A;  3P83 D;  1J5O A;  5CZ2 A;  4QAG A;  1T6C A;  4C1N K;  5EU7 A;  3J80 O;  1VQO N;  4M7Y A;  4DTP A;  1M1K O;  4XH4 A;  3FFK B;  4N76 A;  1YJN N;  4CF9 A;  5DK5 A;  1C0G A;  4HUG A;  3TAF A;  4HUE A;  2ITM A;  3THY B;  2UU9 K;  1VQM N;  2A3Z A;  4BRN A;  3TI0 A;  3CCE N;  3VEY A;  3VF2 A;  1WSF A;  3MXM A;  4K0K K;  3IAY A;  4XH5 A;  2YNG A;  2F4V K;  2I7N A;  2P9K A;  4ILG B;  1SL1 A;  4H0Y B;  3PSI A;  3PO4 A;  2Y1I A;  3EEQ A;  4E7K A;  3QIC A;  3LDL A;  4KB0 A;  3KD1 E;  4GKJ K;  2YKM A;  3AVF A;  1YT3 A;  1R0A A;  1EET A;  3NHG A;  4JKA A;  3G25 A;  2NUB A;  1OH7 A;  3BY5 A;  4Z0U A;  4C8M A;  3QET A;  4W5N A;  3T1H K;  2GTD A;  3ATU A;  4F2S A;  4JKF A;  1EXQ A;  4CZK A;  4B9V A;  1VQ4 N;  4DS4 A;  3VES A;  4NLC A;  5AQY A;  4CGD A;  4B3T K;  3C7N B;  2PFU A;  5JS2 A;  1J54 A;  3ZT2 A;  2R7Y A;  4JRQ A;  1N32 K;  4AHR A;  4BRQ A;  5KGX A;  3QEP A;  1YXQ A;  3P38 A;  3M8S A;  4JI3 K;  3C95 A;  1NKC A;  4FJN A;  4CZE A;  3OBW A;  2UYT A;  1QQN A;  1HUX A;  1HNX K;  2CH6 A;  2A5X A;  1ZBH A;  4CK1 A;  4I2P A;  3S3M A;  4LH4 A;  2X78 A;  5JLH A;  4B3S K;  4FZZ A;  3M8R A;  1SL0 A;  4KTQ A;  3WNF A;  4CZF A;  4CEZ A;  4JS4 A;  3KLF A;  2ZD1 A;  4LFC K;  3RR8 A;  1BI4 B;  1S1T A;  3NCI A;  2GX9 A;  2ZGY A;  2F8S A;  4DHY A;  4CJ3 A;  3O4N A;  4JKH A;  4C8O A;  4F9O A;  3UKU A;  4YDU C;  5ADX H;  3Q7C A;  3OYA A;  3VQQ A;  3O3F A;  3LP1 A;  4DSJ A;  3VEN A;  3ZSW A;  2ZGZ A;  5EXW A;  4BWJ A;  4CGJ A;  4QS8 A;  2ASO A;  1BDG A;  5D3G A;  3ENH A;  2OTL N;  4FWL A;  4B1X B;  2WBN A;  3ZET A;  3SBG A;  1NGC A;  3QO9 A;  4UQG A;  1X1P A;  4F4K A;  3VN5 A;  1IBM K;  3V9Z A;  1TUY A;  4BVO A;  3AVJ A;  5J2N A;  2E1Y A;  1NGD A;  2PY5 A;  3SMS A;  3I33 A;  4KH4 A;  3DRP A;  4JS5 A;  3M5R A;  3GDQ A;  4B9S A;  3EN9 A;  3I0R A;  3AA2 A;  2DPN A;  3QNO A;  2G8V A;  1BCM A;  4JEP A;  2Z1G A;  3DXM B;  3HBT A;  2BGG A;  5LJW A;  3MXI A;  3NF9 A;  1P90 A;  4OPJ A;  3WNE A;  1U04 A;  1RT3 A;  1S3X A;  2KZZ A;  4FJ9 A;  3VQD A;  5TKW A;  4JLH A;  1YIJ N;  3OYL A;  1DLO A;  3D0P A;  3SUP A;  2Q97 A;  1RTD A;  4PL7 A;  1BQN A;  1C0M A;  3LAM A;  4I7F A;  2IVO A;  2P51 A;  4BRE A;  1BQM A;  3CCU N;  4DTR A;  2AP1 A;  1OH6 A;  4MDB A;  1XMQ K;  1ESV A;  1WSE A;  3ZSV A;  4JKB A;  4NYF A;  2QM1 A;  3HM8 A;  4FLZ A;  5C12 A;  3DXK B;  1S1X A;  3J81 O;  2NLX A;  3DLG A;  3H6E A;  1N8R O;  4CEB A;  2PYJ A;  1RTH A;  1GLB G;  1VRU A;  3U3Y A;  5M1N A;  1GLJ O;  3H45 C;  1IV0 A;  1K8K B;  3VF4 A;  1QQM A;  5A2Q O;  4CEE A;  4RWT A;  4IO9 L;  4AH9 A;  3RWU A;  5LY3 A;  1RT6 A;  3D6R A;  3LDP A;  1NK0 A;  4Z4G A;  4FWN A;  4FOI A;  4CJF A;  1BIU A;  1DKG D;  1L3V A;  1NNE A;  4H03 B;  3VQ9 A;  1XI1 A;  4WFN L;  4KPY A;  3PY8 A;  3AA5 X;  3KWI A;  2IAJ A;  1EP4 A;  1SAZ A;  3ZSQ A;  3UB5 A;  1VSE A;  5ADX A;  4CGG A;  2HMP A;  3OA9 A;  2G8W A;  4DQR A;  4B1U B;  4BR9 A;  1WBD A;  2NRT A;  3AVM A;  4Y1C A;  2Q3S A;  3CM6 A;  5LJV A;  4KB1 A;  1X9J A;  4BGB A;  1U47 A;  4LF4 K;  1ASU A;  3AV9 A;  1GLA G;  3PIP L;  4DSF A;  1X3N A;  2PYL A;  1HKB A;  5M1P A;  1JXB A;  4KV8 A;  3VQ5 A;  2AJQ A;  4DV3 K;  3SUO A;  4I6M A;  4FJM A;  1GLL O;  4PQU A;  1Q81 O;  2FXU A;  3CG7 A;  5HLF A;  1BO5 O;  3TR8 A;  4Y1D A;  5JS1 A;  3AVK A;  1KVA A;  4CFA A;  4EZ6 A;  4JHD A;  1N34 K;  3CJB A;  3L8B A;  3ISN C;  3SYZ A;  4FWP A;  2E6M A;  4OPA A;  4QS7 A;  3RMB A;  1VQ8 N;  4DUZ K;  5FRM A;  3QES A;  3PLA A;  3L4I A;  4FM0 A;  2D4W A;  4FJ7 A;  4JK7 A;  3V1R A;  2NRZ A;  3CCJ N;  4GV3 A;  2OPS A;  1N36 K;  4JNE A;  4CIE A;  4DR5 K;  2OA8 A;  2E4L A;  2OAN A;  3TSQ A;  4A61 A;  1KD1 O;  5AQQ A;  3VQ6 A;  2Z1I A;  4IDK A;  1S72 N;  5KPZ A;  2O8F B;  4DV0 K;  4E1J A;  4OLA A;  3EKS A;  4IG3 A;  1SKR A;  3K57 A;  1V4S A;  3LPU A;  2PAV A;  4DTJ A;  3BZK A;  3SNN A;  1WAJ A;  4ID5 A;  2IOC A;  2QWO A;  4FWO A;  4EIA A;  4DTS A;  2UUB K;  5FRN A;  2UUC K;  4DKW A;  3NE6 A;  3L3U A;  4FJ5 A;  2KFN A;  1YVU A;  3KHY A;  3LAL A;  3A5M C;  1IKW A;  1A5W A;  1RT5 A;  1KVB A;  2RF2 A;  2YV0 X;  1NLV A;  2HHH K;  3KKR A;  3VGM A;  5KQD A;  5DMR A;  1XWL A;  3VEX A;  3IDH A;  4PHT X;  4X64 K;  3A5L C;  3NBP A;  3OYI A;  1BOT O;  1HNW K;  5C2F A;  4ZTF A;  4BGA A;  4OPK A;  1Q8I A;  2OZM A;  3OYK A;  2E6L A;  3TTD A;  3J7Z O;  3HRG A;  2WFB A;  3AVI A;  4CFB A;  2ETJ A;  3WNG A;  4IOC L;  3K59 A;  3EL2 A;  1S6P A;  4ILH A;  1ATR A;  3DYA A;  4DTN A;  4CJ5 A;  4FVU A;  1ZC6 A;  5AFU A;  4GKK K;  3LP2 A;  1G99 A;  3W0L A;  2XY8 A;  3LDQ A;  2FBX A;  3AA3 A;  4C1N I;  3KD5 E;  1WSH A;  3FZH A;  3CFR A;  1NOZ A;  2I5J A;  4LF7 K;  2Q36 A;  3EZ5 A;  5KTQ A;  2YHA A;  5GAD P;  1C1C A;  4JI0 K;  3DM2 A;  3K9K A;  1Z6R A;  4R5P A;  1XUP O;  4FLT A;  5IT9 O;  4Z4C A;  2FSK A;  2KW4 A;  1HNZ K;  4K8X A;  1VQK N;  4GV6 A;  1VQL N;  2GWJ A;  5HRS A;  1ZBS A;  1U6Z A;  2KFZ A;  3QBW A;  3KTQ A;  1NM1 A;  3GE1 A;  3T7Z A;  4WQ4 C;  3TAE A;  1UA0 A;  3NAE A;  5LMU K;  4FK2 A;  4BRL A;  4OKJ A;  1O13 A;  4A59 A;  5GAH P;  1D4X A;  3SZ2 A;  4M3U A;  1KLN A;  2D0A A;  5GIO A;  3CCV N;  3VTI A;  1ITG A;  2QWP A;  3LL3 A;  5MLC Q;  4PKG A;  5BRF A;  4DSE A;  4MLH A;  3SMP A;  3NMU A;  4B1Y B;  4EP4 A;  4HTU A;  4B3O A;  3R3L A;  4WCE L;  3T3F A;  3T1A A;  2P9N B;  3PX4 A;  1Z25 A;  1RDD A;  2RHK A;  2VWB A;  3MN7 A;  4O4G A;  3K0S A;  2YHW A;  3IRX A;  1HX1 A;  1IG8 A;  4IKF A;  3C6A A;  1U2V A;  3HM9 A;  5C25 A;  4KI4 A;  2CGJ A;  1NGB A;  2RN2 A;  4BRD A;  4N47 A;  1QVF M;  4EZ9 A;  1BL3 A;  3R6M A;  4KH6 A;  2W41 A;  1RBT A;  4YOU A;  4IFE A;  2XO7 A;  2G8F A;  3G71 N;  4LF9 K;  4NCB A;  1OVQ A;  3F2K A;  3U8X A;  1U4B A;  3PUF A;  5EVZ A;  3WXJ A;  4JK8 A;  3AO1 A;  3N4Q A;  3OY9 A;  4KHU A;  2OTJ N;  5AQV A;  4BE2 A;  4JI6 K;  1LWE A;  3QEI A;  4I9Q A;  2KQ2 A;  2UXC K;  3MEG A;  1NK7 A;  2I7P A;  3ZT3 A;  4CEQ A;  3ZT1 A;  1I94 K;  3OYC A;  4Z4I A;  4PWD A;  3R9P A;  4NCA A;  5AR0 A;  4DFP A;  1WNS A;  3IMX A;  1TYQ B;  4CHZ A;  3THY A;  3GG4 A;  3CPE A;  2HHX A;  1W9H A;  5CZ1 A;  2HHQ A;  4OX9 K;  5AQF A;  4E1N A;  2GUI A;  4CHQ A;  2HNY A;  1E4G T;  3PV8 A;  5E26 A;  3AVN A;  2FF6 A;  2P9P A;  2BDP A;  1D8Y A;  4HTL A;  4Z4E A;  4BG8 A;  4EHU A;  3OYE A;  3DRS A;  3E9O A;  4YOV A;  1VQ6 N;  5J2M A;  4AHC A;  2HHU A;  4JRP A;  3T1Y K;  4YOY A;  4CBW A;  3HOT A;  1NKE A;  1FKO A;  4JD2 B;  1U48 A;  1QQC A;  4FW2 A;  3VOV A;  1X9S A;  4E7J A;  2X6N A;  5AQM A;  4DB3 A;  4E7L A;  5KRS A;  2HBJ A;  3HPH A;  4A62 A;  4C8L A;  5AZJ A;  4N41 A;  3G0Z A;  2E20 A;  4TSX A;  5AQH A;  2A40 A;  2P1J A;  4KHS A;  4RW7 A;  3VPZ A;  3MK6 A;  4BDP A;  3DLE A;  4KH5 A;  4O8K A;  3L0Q A;  1JLG A;  4IWV A;  4G9Z A;  2HBK A;  3KK7 A;  3QFP A;  3SI6 A;  4FJX A;  3HOS A;  1KAY A;  3AVA A;  3L4Q A;  3MCP A;  4B3M K;  4ISE A;  1TVR A;  4N5S A;  2D5R A;  3V9S A;  4GY2 B;  1BG3 A;  3VF6 A;  1JL2 A;  4CE9 A;  4HCC A;  2D1K A;  4IEE A;  3MCA B;  2EHG A;  3VQE A;  1NK6 A;  2ZJP L;  3KLE A;  5AQK A;  1VQ9 N;  4DLE A;  3L6Q A;  1KLM A;  3VET A;  4DUY K;  5AQT A;  2FBY A;  4CEF A;  1RDB A;  4WFB L;  1P8Z A;  4GW6 A;  3TTC A;  1L3U A;  1RBS A;  1TK8 A;  2WC9 A;  5BPN A;  2XRI A;  4DV2 K;  1ASV A;  1K8A O;  4H5V A;  3O80 A;  1DTT A;  4YFU A;  4LSL A;  1JKH A;  4DSL A;  5DM6 L;  2VQE K;  4K42 A;  3ZEU A;  5JMV A;  1YF5 L;  4MO5 A;  4O5F A;  1TAQ A;  2AA4 A;  4W5O A;  2QWM A;  4CGH A;  3H46 O;  4BRH A;  2E5L K;  5BR8 K;  3IKM A;  1UWB A;  1REV A;  5JVH L;  3DXM A;  4KHW A;  4J2B A;  4BR2 A;  4NB4 A;  4CF1 A;  1Y97 A;  3CET A;  2D0C A;  1NJZ A;  3LPT A;  1T44 A;  4CEC A;  1NJI O;  5JLF A;  3OYD A;  3SAG A;  1ASW A;  4C8K A;  5BN9 A;  4E1M A;  3OYM A;  1X9W A;  4LH5 A;  4FLY A;  1TL1 A;  3KK2 A;  1WN7 A;  3QER A;  4CF8 A;  1G15 A;  4IO8 A;  2UXB K;  4CEO A;  5I42 A;  2XHB A;  4YHH K;  1I3A A;  1RDU A;  3WUH A;  2QA4 N;  4KHN A;  3DXK A;  4BC2 A;  4BE1 A;  4CJP A;  4PA1 A;  4A5A A;  4DV7 K;  4Z4F A;  4KI6 A;  2W6K A;  1C0U A;  5EX5 A;  3IFR A;  4E7I A;  4A2A A;  2QW9 A;  5M1K A;  3SPY A;  4PL8 A;  3CXC M;  1NJY A;  1HKC A;  1NGG A;  4FM1 A;  3VA3 A;  2P9I A;  3QBX A;  4H0T B;  1YJW N;  3FZF A;  3WQT A;  4UY8 O;  4DV1 K;  3NGI A;  2NNW A;  2Z1H A;  1BU6 O;  3C6U A;  3ITH A;  2CGL A;  1HJR A;  2HOE A;  2F96 A;  3HVT A;  3QIP A;  4AHV A;  3MN5 A;  4AM6 A;  3ZEU B;  1O1W A;  3JS6 A;  1DTQ A;  3IS9 A;  1JCF A;  1RCH A;  2O8B B;  4BR5 A;  3WQU A;  3DI6 A;  3M1F A;  4ZHR A;  4OO1 J;  3M8P A;  1QSS A;  1CXU A;  1RBU A;  2GEL A;  3GOI A;  1LAV A;  3U9Z A;  3QEW A;  3T19 A;  5FPN A;  4ELT A;  1A5X A;  3TAM A;  4B9U A;  1NGA A;  2HNZ A;  2NRH A;  4H5T A;  4BE0 A;  1J53 A;  3EKU A;  1XC3 A;  3SV3 A;  5KGW A;  4FJG A;  3PIO L;  1VSL A;  2YJF A;  5HL7 L;  3CIP A;  3VGK A;  1J5E K;  3DLB A;  2QKK A;  4CZG A;  3R1X A;  1QZ6 A;  3V81 A;  3D7E O;  4ISF A;  4KKO A;  4I6M B;  4O55 A;  5C24 A;  4KFB A;  3NGY A;  1KVC A;  4R79 A;  3HT3 A;  4CJT A;  1XMO K;  3EZW A;  4DV4 K;  5BRE A;  4F3O A;  3CFP A;  5HOO A;  3ID8 A;  1EO1 A;  4JV5 K;  2X6S A;  4IJA A;  5KI6 A;  3F73 A;  3FFI A;  1SKW A;  2JGU A;  4OJR A;  4DTU A;  1QSY A;  4CI6 A;  3KWG A;  3L2W A;  4E0D A;  2OPP A;  3UIQ A;  4DG1 A;  4DSI A;  1FXX A;  4MDA A;  2F9T A;  2UXD K;  4RTF D;  4NCG A;  3ZSX A;  1NKB A;  2V51 B;  4ILJ A;  4CHO A;  4BC4 A;  2KZM A;  2XY7 A;  5AQL A;  1D9F A;  1WAF A;  3U9D A;  3NFA A;  5FPM A;  1S5J A;  3OS2 A;  1NBW A;  5GIN A;  4KRF A;  2CGK A;  4FOE A;  5J2P A;  3LM2 A;  3SPZ A;  4BY9 C;  1JLQ A;  2ZM6 K;  2HVH A;  3I55 N;  2QWN A;  4LF8 K;  2BTF A;  1B9F A;  3DJC A;  1HYV A;  1Y64 A;  1TK0 A;  3H3O B;  4IFY A;  2BUP A;  5GAE P;  2V7Y A;  4EHT A;  4RG8 A;  3P1G A;  1QTM A;  1L3S A;  2LSN A;  1S6Q A;  3H1Q A;  3G10 A;  1D9D A;  1BI4 A;  1Z05 A;  1LWF A;  3AVL A;  4CCH A;  3M3Z A;  4BQL A;  1IBK K;  4CJR A;  1IKV A;  3S9H A;  4IBN A;  1NGJ A;  2YI1 A;  5BR9 A;  3K5L A;  3T69 A;  2O8D A;  2B4J A;  4B1V A;  4WYB A;  4BWM A;  1HLU A;  3HO1 A;  4FW1 A;  2FSN A;  1VSD A;  3AA4 A;  3HST B;  3O4Q A;  2E8A A;  1XQS C;  1WOQ A;  1W7A A;  4FWQ A;  2BAN A;  3KZB A;  4Q5V A;  1WSG A;  2EWS A;  5KRT A;  2JWL A;  1J9A A;  2HF3 A;  1NJW A;  4AQY K;  4HCB A;  3TAP A;  1RT2 A;  4ICL A;  3MN9 A;  4CF2 A;  5BRD A;  4FSV A;  4LFB K;  1IBL K;  3K9J A;  1T7P A;  3E1Y A;  1TL3 A;  4X65 K;  1JJ2 M;  4A2B A;  3NF7 A;  3OHR A;  5AQG A;  2HHW A;  1RDW X;  5HRO A;  4WQ5 A;  3ZX3 A;  3WNH A;  4O5B A;  1HPM A;  1XC9 A;  3ZYY X;  3V1Q A;  5GAG P;  1Q18 A;  2O8C B;  1HYZ A;  3K5M A;  1YVN A;  2VQF K;  2P5G A;  1GOB A;  2XY6 A;  4FPA A;  1YTU A;  5KPR A;  1QZ5 A;  4DR1 K;  4IEI A;  4EFH A;  3A8Y A;  3OYN A;  1SUQ A;  3LWL A;  2Q0U A;  1KC8 O;  4YOW A;  3P39 A;  2WON A;  2Q2R A;  3V1O A;  2KLA A;  3BF3 A;  1XHX A;  5AQS A;  3LZJ A;  1RNH A;  3ZX0 A;  5HRN A;  2FSJ A;  4JI4 K;  4U7B A;  5JVG L;  1F21 A;  1GOC A;  4PKI A;  1M90 O;  4DQP A;  4FJK A;  1U2V B;  2PBD A;  3THX A;  4CGI A;  4HHT A;  1HQU A;  4DCH A;  5AQO A;  3TAN A;  1FW6 A;  2F7T A;  1LOT B;  1QS4 A;  3A2F A;  1UA1 A;  2P9S B;  4NXN K;  3AAR A;  3E9P A;  4C8N A;  4PUO A;  4JKE A;  1EQY A;  2EX3 A;  5AQW A;  2O8E B;  3FE1 A;  4FJJ A;  4DU4 A;  1VSK A;  2P9L B;  5KQ8 A;  3FZM A;  3LP3 A;  1SS6 A;  3BDP A;  2P9U A;  4L8R B;  2A1S A;  2IGI A;  4DR3 K;  3F9M A;  2J4R A;  5BPL A;  3CQ8 A;  1JLC A;  3C65 A;  1T3V A;  4QCL A;  1TKT A;  1ATS A;  1DEJ A;  2Q31 A;  3D2F B;  3D45 A;  4CZH A;  3NDK A;  3H3N O;  1RDC A;  1RBV A;  2HBM A;  1KTQ A;  1NGE A;  3O9T A;  2P9P B;  3MX5 A;  3P31 A;  1E4F T;  4K25 A;  4YOR A;  1TK5 A;  2O8C A;  1IKX A;  4CJ4 A;  3O3H A;  3OS0 A;  1N5Y A;  3RR7 A;  4IOA L;  1MDU B;  3U6F A;  5AQJ A;  3E66 A;  4M3T A;  1S1U A;  4DR2 K;  3KK3 A;  3TWH A;  2HF4 A;  1BGX T;  1SL2 A;  2OCE A;  3AVB A;  4WFA L;  3G4S N;  5JIC A;  3CCM N;  4LD0 A;  1Q7Y O;  3WEE B;  3VQA A;  3M8Q A;  1IJJ A;  4ELV A;  3UKU B;  3MEE A;  3O3G A;  4H5W A;  3TAR A;  4MFB A;  3BF1 A;  4H4O A;  4LC9 B;  3D2E B;  3AAQ A;  3ZLJ A;  1JLB A;  2GUP A;  1HNV A;  1VHX A;  5KPT A;  4CGF A;  3O9S A;  1RFQ A;  4DF4 A;  3RVC A;  1WSI A;  4BR4 A;  4DFM A;  1BIZ A;  5DM7 L;  4IG0 A;  4CJS A;  1VSH A;  1OH8 A;  2QTD A;  3O1B A;  4IJN A;  4B08 A;  3ENB A;  5HRR A;  3A5O C;  4BRF A;  4Z94 A;  3L2R A;  3BZC A;  3DAW A;  3U3G A;  4FM2 A;  2H3G X;  3UKR B;  4F2R A;  4B3R K;  4H4M A;  2UUA K;  3J7Y P;  4BRO A;  1MU2 A;  1FKP A;  3C6H A;  2HVI A;  4AF1 A;  4FL9 A;  3L3V A;  1FK9 A;  3VMF B;  4CJQ A;  3L2Q A;  3MAQ A;  1JXE A;  5AFU H;  2Z1J A;  4FYD A;  4PKH A;  4NXM K;  3KKS A;  4CJW A;  4DLG A;  3KK1 A;  1NMD A;  3N4P A;  3L2V A;  1VSI A;  3DWL A;  4CD1 A;  2YCH A;  4BVP A;  3V9W A;  3TSP A;  4JKG A;  2OZS A;  5EY4 A;  5HRP A;  1MA9 B;  5CYQ A;  5HBM A;  3HVR A;  3QIO A;  2V52 B;  5AQR A;  1VQ7 N;  3BP8 A;  3CCQ N;  1S9E A;  3ATV A;  1T8E A;  3AGK A;  4A5B A;  4IFV A;  3IG1 A;  3TTF A;  4CJ7 A;  4CVN E;  3O08 A;  4RW4 A;  2NRX A;  3QLH A;  4E7H A;  2CH5 A;  5CE3 A;  4M45 A;  2NRV A;  4M42 A;  1VSJ A;  2YX6 A;  5BPM A;  1KFS A;  3C94 A;  4YY3 K;  3H1V X;  4B9L A;  4XEI A;  1JLE A;  1NK4 A;  5AQU A;  1NK5 A;  4DV6 K;  4LSN A;  4FWR A;  1C0T A;  5C2D A;  5E84 A;  4FJH A;  1NGI A;  1C0F A;  3OTO K;  4L3Q A;  1BIS A;  2HND A;  1QHT A;  3CJ7 A;  2GBZ A;  1BA0 A;  3SQ0 A;  1SKS A;  2ZJR L;  3AO3 A;  4CJU A;  1BCO A;  2VGM A;  4BR0 A;  4KTW A;  4M7X A;  4BG9 A;  4FLV A;  4MO4 A;  4FCY A;  1TAU A;  4CZI A;  2BE2 A;  4WQ5 C;  4M3R A;  4PY5 A;  5K14 A;  3HZ6 A;  2G8U A;  5AQX A;  4B9M A;  4FZY A;  4CER A;  4FXD A;  4GVM A;  4FJL A;  4JKG B;  3LP0 A;  2YKN A;  4JK9 A;  4JN4 A;  4CED A;  3C6T A;  3RTV A;  3PX0 A;  3J8A A;  3ULD A;  3ZSY A;  3WXL A;  4CJK A;  2P9N A;  1EWQ A;  3QEX A;  2OPQ A;  3PX6 A;  4DR4 K;  4QS9 A;  5AZJ B;  2QWL A;  3K5O A;  3HJF A;  4KTZ A;  3TU5 A;  2O8B A;  3HL8 A;  1X9M A;  3OYJ A;  3KLG A;  1BHL A;  3OVN A;  3S3N A;  1HYS A;  3U4L A;  5C15 A;  5I9E B;  1RDA A;  2VG5 A;  3RSE A;  2KKZ A;  4OKE A;  1YJ9 N;  4CJV A;  1KSP A;  3C7N A;  2IC3 A;  4Q0B A;  4CIF A;  1CZB A;  1WLJ A;  2VYP A;  2ZQB A;  3MMV A;  1QSL A;  3SQ1 A;  3ZCM A;  1XNR K;  2QK9 A;  1KRP A;  3AVH A;  3FLC O;  4N56 A;  1RGI A;  4CHN A;  4MQ3 A;  5C10 A;  2ZE2 A;  5ELZ A;  1SV5 A;  4H0P A;  2HST A;  4NYN A;  1ZXO A;  2ITG A;  4E89 A;  2GEM A;  3LWM A;  4CHY A;  3HP9 A;  4YOT A;  3NGZ A;  4BC3 A;  1GOA A;  2FLO A;  5CHI A;  2Q1N A;  1U45 A;  5CY4 A;  1LV5 A;  2NRW A;  4LFA K;  4KHP K;  4DFK A;  3Q7B A;  3VEZ A;  1QHA A;  2IVN A;  1NMN A;  1UOC A;  5T7B A;  3NH1 A;  3KJV A;  4FK4 A;  2E2P A;  4X66 K;  3P4I A;  4YOX A;  2O4G A;  3OYB A;  3OYH A;  3WXK A;  5AQP A;  4GV9 A;  3V4I A;  1HQE A;  4M3Y A;  1TGO A;  3DOK A;  1D5A A;  3SAH A;  4BC5 A;  1JCE A;  2FF3 B;  3DRR A;  3ASM A;  1VRT A;  3SJJ A;  1NK8 A;  2RE2 A;  3VEW A;  1JL1 A;  5AQI A;  1EKE A;  4M3Z A;  2WOM A;  4CK2 A;  4OPH A;  3W3D A;  1VQP N;  4DQI A;  5F0X A;  3WXM B;  4IDH A;  1W97 L;  3CME N;  1WBB A;  1EWR A;  3RRG A;  5BN8 A;  5CR4 A;  4W5R A;  5J2Q A;  4CBX A;  4FJ8 A;  2DFE A;  3S41 A;  5CYM A;  4DTM A;  4F3T A;  3H08 A;  4CFD A;  4DU1 A;  3ZSO A;  2D0B A;  4CD3 A;  3CQX A;  1CLQ A;  3SK3 A;  3ZSR A;  5AZI A;  3HYF A; 
#chains in the Genus database with same CATH homology
 2W42 A;  3TAP A;  1RT2 A;  4HCB A;  1IH7 A;  4ICL A;  2IS3 A;  4CFC A;  4DSE A;  4CF2 A;  1VSM A;  4EP4 A;  4HTU A;  4B3O A;  3K2P A;  4CJL A;  3P5J A;  1XHZ A;  3T3F A;  3T1A A;  3PX4 A;  3CFO A;  1Z25 A;  4H8K A;  2PZS A;  4BAC A;  1T7P A;  4DWI A;  1ZBI A;  1RDD A;  1TL3 A;  4O4G A;  4B9T A;  1NJX A;  3VQB A;  2YNH A;  2DFF A;  3NF7 A;  3IRX A;  4IKF A;  2HHW A;  4AHU A;  5HRO A;  1B9D A;  3HM9 A;  5C25 A;  4KI4 A;  2JLE A;  3VQP A;  3WNH A;  2ATQ A;  4O5B A;  2RN2 A;  3V6D A;  4KHQ A;  1N6Q A;  3VA0 A;  3BGR A;  5SZT A;  1XC9 A;  2Y1J A;  3V1Q A;  4N47 A;  3P83 D;  4EZ9 A;  3AVC A;  1HYZ A;  3K5M A;  1J5O A;  2QXF A;  1BL3 A;  5CZ2 A;  4QAG A;  2P5G A;  1GOB A;  2XY6 A;  4J2A A;  1YTU A;  5EU7 A;  1RBT A;  3CYM A;  2XO7 A;  3RMC A;  2G8F A;  3SUN A;  3NF8 A;  4DTP A;  4NCB A;  1RT7 A;  1U4B A;  3PUF A;  3U3Y A;  4N76 A;  4CF9 A;  3RMA A;  5DK5 A;  3OYN A;  1SUQ A;  3LWL A;  4HUG A;  4G1Q A;  3TAF A;  3AO1 A;  3B6O A;  4HUE A;  2A1R A;  2YNF A;  4YNQ A;  3OYG A;  1L5U A;  3OY9 A;  4B8A B;  3TI0 A;  4ZTJ A;  4KHU A;  1WSF A;  3MXM A;  4BE2 A;  2WON A;  3IAY A;  4M3X A;  4CIG A;  2YNG A;  4ID1 A;  4O44 A;  1LWE A;  3V1O A;  3QEI A;  4I9Q A;  1XHX A;  1SL1 A;  3SUQ A;  3PO4 A;  2KQ2 A;  3L2U A;  3LZJ A;  3MEC A;  1CXQ A;  2Y1I A;  1RNH A;  3K58 A;  4E7K A;  4RW9 A;  3MEG A;  1NK7 A;  3EY1 A;  5HRN A;  4DMN A;  4KB0 A;  3ZT3 A;  3KD1 E;  4CEQ A;  3OYF A;  2YKM A;  3TAG A;  3AVF A;  1F21 A;  1GOC A;  1YT3 A;  3ZT1 A;  4DQP A;  4FJK A;  1R0A A;  1EET A;  3NHG A;  3OYC A;  1U49 A;  3PO5 A;  4Z4I A;  4PWD A;  2NUB A;  4Z0U A;  4C8M A;  3QNN A;  4NCA A;  4CGI A;  4HHT A;  1WNS A;  1HQU A;  4DFP A;  2OPR A;  3QET A;  3LAN A;  3TAN A;  5FRO A;  4CHZ A;  4W5N A;  4F2S A;  1QS4 A;  3TAQ A;  2G8K A;  1EXQ A;  2HHX A;  4B9V A;  3A2F A;  1UA1 A;  4M3W A;  4DS4 A;  4DF8 A;  1W9H A;  1Q9X A;  5CZ1 A;  4CGD A;  1W0H A;  2HHQ A;  4C8N A;  4E1N A;  4PUO A;  2GUI A;  4CHQ A;  3V9U A;  5JS2 A;  2HNY A;  1J54 A;  3ZT2 A;  2R7Y A;  4JRQ A;  3PV8 A;  4AHR A;  3KIO A;  5KGX A;  2EX3 A;  5J1E A;  3QEP A;  3AVN A;  2FBT A;  1CZ9 A;  4DQS A;  1D8Y A;  2BDP A;  4Z4E A;  3M8S A;  3C95 A;  3OYE A;  1LW2 A;  1NKC A;  4FJN A;  3DRS A;  1RBR A;  3ALY A;  3I0S A;  4FJJ A;  5J2M A;  4AHC A;  2HHU A;  1KCF A;  4JRP A;  4DU4 A;  2G8H A;  1ZBH A;  3ZSZ A;  4CK1 A;  1NKE A;  1FKO A;  1VSK A;  4I2P A;  3S3M A;  4LH4 A;  1QQC A;  4FW2 A;  2YNI A;  2HB5 A;  1U48 A;  1X9S A;  4FK0 A;  4E7J A;  3LP3 A;  2X78 A;  3BDP A;  2X6N A;  4E7L A;  5KRS A;  4L8R B;  2VWJ A;  3HPH A;  4FZZ A;  1C6V A;  2A1S A;  2IGI A;  3M8R A;  1SL0 A;  4C8L A;  4OGC A;  4KTQ A;  3WNF A;  4N41 A;  3G0Z A;  1TKZ A;  3AO2 A;  1JLC A;  4CEZ A;  3KLF A;  3CQ8 A;  4JS4 A;  4TSX A;  4QCL A;  1TKT A;  3AVG A;  2ZD1 A;  2P1J A;  4KHS A;  4RW7 A;  3D45 A;  4RW8 A;  3RR8 A;  1BI4 B;  4BDP A;  3NDK A;  1RDC A;  1RBV A;  3DLE A;  1KTQ A;  1S1T A;  3NCI A;  4DU3 A;  2F8S A;  1TK5 A;  1IG9 A;  3LAK A;  1JLG A;  3MXJ A;  4FVM A;  1IKX A;  4CJ4 A;  3O3H A;  4CJ3 A;  3SI6 A;  3OS0 A;  1N5Y A;  3RR7 A;  3O4N A;  3U6F A;  3SQ2 A;  4FJX A;  4M3T A;  4QOZ B;  1S1U A;  1ZBU A;  4C8O A;  3KK3 A;  4W5T A;  3TWH A;  1BGX T;  1SL2 A;  3AVA A;  3AVB A;  3OYA A;  3VQQ A;  3O3F A;  3LP1 A;  4DSJ A;  1TVR A;  1TV6 A;  4LD0 A;  1Q9Y A;  3ZSW A;  3DMJ A;  4N5S A;  2D5R A;  3V9S A;  2HW3 A;  2HHS A;  2DTU A;  4FLW A;  3MED A;  1JL2 A;  4BWJ A;  4CE9 A;  4CGJ A;  3VQA A;  4HCC A;  3M8Q A;  2EHG A;  4ELV A;  5D3G A;  4KO0 A;  3KLH A;  3VQE A;  1NK6 A;  3MEE A;  3HK2 A;  2DY4 A;  3KLE A;  1LWC A;  3O3G A;  1C1B A;  3V9X A;  2RKI A;  4DLE A;  3QO9 A;  4MFB A;  4UQG A;  3TAR A;  2O4I A;  1X1P A;  4H4O A;  3VN5 A;  4F4K A;  1KLM A;  2DFH A;  3V9Z A;  2G8I A;  3AVJ A;  5J2N A;  1JLB A;  2PY5 A;  1HNV A;  2FBY A;  2FBV A;  4CEF A;  4CGF A;  3DRP A;  1RDB A;  4JS5 A;  4OLB A;  4FLX A;  2B5J A;  4B9S A;  3SV4 A;  4GW6 A;  1L3U A;  4DF4 A;  1RBS A;  3I0R A;  3AA2 A;  1TK8 A;  1WSI A;  4DFM A;  1BIZ A;  2XRI A;  3QNO A;  4IG0 A;  2VG7 A;  1BCM A;  1S1V A;  1VSH A;  4CJS A;  2G8V A;  4CEA A;  1ASV A;  2Z1G A;  3ZT0 A;  3QEV A;  2BGG A;  1DTT A;  4B08 A;  4YFU A;  4DQQ A;  4LSL A;  3NF9 A;  3MXI A;  4I2Q A;  5HRR A;  3DLK A;  1JKH A;  4DSL A;  4OPJ A;  3WNE A;  3L2R A;  4WE1 A;  1U04 A;  3U3G A;  4FM2 A;  1RT3 A;  4F2R A;  3QIN A;  4H4M A;  3HXM A;  1TAQ A;  4AHT A;  2KZZ A;  1IO2 A;  4FJ9 A;  3F9K A;  4W5O A;  3DLH A;  1MU2 A;  1FKP A;  4JLH A;  3VQD A;  4CGH A;  3SCX A;  2HVI A;  3OYL A;  1DLO A;  3D0P A;  3SUP A;  1RTD A;  3L3V A;  1FK9 A;  4CJQ A;  3L2Q A;  3MAQ A;  1BQN A;  1C0M A;  3LAM A;  3S3O A;  4CF0 A;  2VG6 A;  1JXE A;  1QE1 A;  1UWB A;  2P51 A;  1REV A;  2Z1J A;  4I7F A;  4XIU A;  3JSM A;  4FYD A;  4O0J A;  1BQM A;  4KHW A;  4DTR A;  3KKS A;  4CJW A;  4J2B A;  4DLG A;  3KK1 A;  5C42 A;  4CF1 A;  1Y97 A;  2D0C A;  1NJZ A;  3LPT A;  1WSE A;  3L2V A;  4CEC A;  3ZSV A;  3OYD A;  4NYF A;  1VSI A;  4FLZ A;  1ASW A;  4C8K A;  3V9W A;  4E3S A;  1S1X A;  3DLG A;  4FLU A;  4AIL C;  1C1A A;  4CEB A;  2PYJ A;  4E1M A;  2OZS A;  2KTQ A;  5HRP A;  1RTH A;  3OYM A;  1X9W A;  3VQ7 A;  2HHT A;  4LH5 A;  3I8D A;  1VRU A;  2RPI A;  1TL1 A;  5CYQ A;  5HBM A;  3HVR A;  3QIO A;  2IDO A;  3KK2 A;  1WN7 A;  4FLY A;  3QER A;  4CF8 A;  3B6P A;  1G15 A;  1S9E A;  4CEE A;  3LDS A;  4AH9 A;  1T8E A;  3RWU A;  4CEO A;  5I42 A;  1RT6 A;  4IFV A;  3IG1 A;  2XHB A;  1NK0 A;  4Z4G A;  1LW0 A;  4RW4 A;  4BDZ A;  3QLH A;  4E7H A;  4CJF A;  1BIU A;  1I3A A;  1L3V A;  3K5N A;  1UAX A;  3VQ9 A;  4M45 A;  3JYT A;  1XI1 A;  2GV9 A;  4KHN A;  1VSJ A;  4M42 A;  4KPY A;  3OJU A;  1KFS A;  3PY8 A;  3C94 A;  4BE1 A;  4CJP A;  3AA5 X;  4PA1 A;  4Z4F A;  4KI6 A;  2IAJ A;  4FJI A;  1EP4 A;  3ZSQ A;  4B9L A;  1JLE A;  1C0U A;  1HRH A;  1VSE A;  4E7I A;  4CGG A;  1B92 A;  2G8W A;  1NK4 A;  4DQR A;  3SPY A;  1NK5 A;  4B9N A;  3EYZ A;  1TKD A;  3AVM A;  4LSN A;  1NJY A;  4Y1C A;  2Q3S A;  3CM6 A;  4KB1 A;  1C0T A;  4FM1 A;  2VWK A;  4ELU A;  3VA3 A;  1U47 A;  4FJH A;  4W5Q A;  1ASU A;  3AV9 A;  1RTJ A;  4DSF A;  1BIS A;  4CJE A;  2HND A;  3NGI A;  1QHT A;  2Z1H A;  1S1W A;  2PYL A;  2GBZ A;  3VQ5 A;  1JXB A;  3C6U A;  3ITH A;  4KV8 A;  1HJR A;  3SQ0 A;  3SUO A;  1SKS A;  2AJQ A;  4FJM A;  5E41 A;  3OJS A;  2F96 A;  4PQU A;  4B8C A;  3AO3 A;  3OS1 A;  4M41 A;  3HVT A;  1BCO A;  3QIP A;  4CJU A;  4AHV A;  4KTW A;  1O1W A;  1DTQ A;  3CG7 A;  3AO5 A;  3IS9 A;  4FLV A;  1RT1 A;  3TR8 A;  4DS5 A;  1RCH A;  1HPZ A;  4Y1D A;  5HLF A;  2F8T A;  1JLA A;  4FCY A;  1TAU A;  5JS1 A;  2BE2 A;  4M3R A;  4PY5 A;  3AVK A;  5K14 A;  3RMD A;  4DSK A;  1KVA A;  2G8U A;  4CFA A;  3DI6 A;  4B9M A;  4CER A;  4ZHR A;  4FZY A;  4EZ6 A;  4DFJ A;  4FXD A;  4GVM A;  3M8P A;  1QSS A;  1CXU A;  3L8B A;  1L3T A;  1RBU A;  3ISN C;  3LP0 A;  3NH2 A;  2YKN A;  3SYZ A;  4FJL A;  4CED A;  3C6T A;  4Z4H A;  3RTV A;  3PX0 A;  2E6M A;  1LAV A;  4HUF A;  1HMV A;  3ULD A;  3ZSY A;  3QEW A;  3RMB A;  3T19 A;  2X74 A;  4CJK A;  1ZYQ A;  4ELT A;  3DLR A;  3VQ8 A;  3VQC A;  5FRM A;  1A5X A;  3DOL A;  3TAM A;  3QES A;  3QEX A;  2OPQ A;  3PX6 A;  1T03 A;  4B9U A;  4FM0 A;  4FJ7 A;  2HNZ A;  4CES A;  4BE0 A;  1LAW A;  1J53 A;  3V1R A;  1WSJ A;  4I9L A;  2OPS A;  3K5O A;  3SV3 A;  4GMJ B;  4KTZ A;  3HJF A;  5KGW A;  4CIE A;  2XY5 A;  4FJG A;  3HL8 A;  1X9M A;  2OA8 A;  2E4L A;  4J2E A;  1NK9 A;  1VSL A;  3OYJ A;  3VQ6 A;  3KLG A;  2Z1I A;  1KFD A;  4IDK A;  1IKY A;  1VSF A;  1BHL A;  3OVN A;  4OKK A;  1SKR A;  4IG3 A;  4OLA A;  3K57 A;  3S3N A;  3LPU A;  4DTJ A;  1A5V A;  3SNN A;  3DLB A;  2QKK A;  1HYS A;  1WAJ A;  4ID5 A;  4OGE A;  3V81 A;  5C24 A;  4KKO A;  2IOC A;  4DTS A;  1Z26 A;  4O55 A;  1HNI A;  1RDA A;  2VG5 A;  5FRN A;  3NE6 A;  4KFB A;  3AO4 A;  1ZBF A;  3NGY A;  4OKE A;  3L3U A;  1KVC A;  4CJV A;  3VQ4 A;  1KSP A;  4FJ5 A;  2KFN A;  3HT3 A;  4CJT A;  2IC3 A;  1YVU A;  4Q0B A;  4CIF A;  3LAL A;  1IKW A;  1CZB A;  1A5W A;  1WLJ A;  1RT5 A;  1KVB A;  2RF2 A;  2YV0 X;  4F3O A;  2ZQB A;  3E01 A;  3CFP A;  3KKR A;  1QSL A;  3SQ1 A;  5DMR A;  3ZCM A;  2X6S A;  2QK9 A;  1XWL A;  5KI6 A;  3F73 A;  3AVH A;  1KRP A;  1JLF A;  3SQ4 A;  2HHV A;  3FFI A;  1RIL A;  1SKW A;  2JGU A;  4N56 A;  4CHN A;  4DTO A;  4OJR A;  4MQ3 A;  3NF6 A;  4DTU A;  1QSY A;  1T05 A;  3L2W A;  3HPG A;  2ZE2 A;  3OYI A;  3NBP A;  1SV5 A;  4LY7 A;  4E0D A;  4NYN A;  4K8Z A;  4DTX A;  2ITG A;  2OPP A;  4E89 A;  4AHS A;  3LWM A;  4DG1 A;  1I39 A;  4CHY A;  4ZTF A;  3UIQ A;  4DSI A;  1FXX A;  3HP9 A;  1RT4 A;  4OPK A;  1Q8I A;  3NGZ A;  4CK3 A;  1EX4 A;  1GOA A;  3OYK A;  2HMI A;  2E6L A;  2OZM A;  4NCG A;  3ZSX A;  1NKB A;  5I3U A;  4CHO A;  2OYQ A;  1U45 A;  3AVI A;  5CY4 A;  1LV5 A;  5FDL A;  4CFB A;  2ETJ A;  3WNG A;  3ZT4 A;  2KZM A;  3K59 A;  2XY7 A;  2FC0 A;  4DFK A;  1S6P A;  1WAF A;  4OVL A;  3NFA A;  1D9F A;  1S5J A;  3OS2 A;  3DYA A;  4KRF A;  4KAZ A;  3LZI A;  4DTN A;  4CJ5 A;  1UOC A;  5T7B A;  3NH1 A;  3KJV A;  5J2P A;  4FK4 A;  3SPZ A;  1JLQ A;  4J2D A;  3LP2 A;  3OYB A;  2O4G A;  2XY8 A;  2QKB A;  2FBX A;  2P5O A;  3AA3 A;  2HVH A;  3OYH A;  3KD5 E;  1WSH A;  4RW6 A;  3V4I A;  1HQE A;  1B9F A;  3CFR A;  1HYV A;  1NOZ A;  2I5J A;  4M3Y A;  1TGO A;  3DOK A;  2B6A A;  1D5A A;  1TK0 A;  3DRR A;  3EZ5 A;  5KTQ A;  1TKX A;  2YHA A;  4IFY A;  1YTA A;  4O0I A;  1C1C A;  4BDY A;  4EP5 A;  3ASM A;  3CM5 A;  3DM2 A;  4RG8 A;  3P1G A;  1VRT A;  4R5P A;  3HP6 A;  5SWM A;  3SJJ A;  3THV A;  1NK8 A;  1QTM A;  1L3S A;  2LSN A;  4FLT A;  1S6Q A;  1D9D A;  3G10 A;  4Z4C A;  1JL1 A;  1BI4 A;  3NH0 A;  2KW4 A;  1LWF A;  3AVL A;  4CCH A;  4KHY A;  3HPO A;  4CJR A;  4K8X A;  1EKE A;  1IKV A;  3S9H A;  4M3Z A;  2WOM A;  4IBN A;  4CK2 A;  4HVJ A;  5HRS A;  3RRH A;  5HP1 A;  4DQI A;  2KFZ A;  3KTQ A;  3K5L A;  1NOY A;  3TAE A;  3RRG A;  1UA0 A;  4KRE A;  2B4J A;  4W5R A;  3NAE A;  4BWM A;  5J2Q A;  4FJ8 A;  3HO1 A;  4E19 A;  2DFE A;  4DTM A;  5CYM A;  1S9G A;  4FW1 A;  4FK2 A;  1RTI A;  1K6Y A;  1VSD A;  3AA4 A;  4F3T A;  3HST B;  3H08 A;  3O4Q A;  1VK0 A;  4CHP A;  4OKJ A;  4CFD A;  1ZBL A;  4FZX C;  4DU1 A;  3ZSO A;  2D0B A;  3SZ2 A;  2BAN A;  4M3U A;  1CLQ A;  4Q5V A;  1KLN A;  1WSG A;  5KRT A;  2D0A A;  3ZSR A;  1J9A A;  3TAB A;  4F8R A;  1NJW A;  3HYF A;  3KLI A;  2YHB A;  1ITG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...