4Y1DA

Cyclic hexapeptide cyc[ndpoppkid] in complex with hiv-1 integrase core domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
141
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title HEXAPEPTIDE MIMETICS OF LEDGF IN COMPLEX WITH HIV-1 INTEGRASE
rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase binding protein
total genus 49
structure length 141
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4y1dA00
3NF9A 4CJKA 3SI6A 1CXUA 1BISA 2FBYA 2D5RA 3SQ2A 1JXBA 4AHVA 3ALYA 1DLOA 4FK2A 1RTDA 1LW2A 3WNEA 1KRPA 1BCMA 1QE1A 3ZT2A 4J2EA 3SUPA 3IG1A 2W42A 4KKOA 1TKTA 4IBNA 3SQ1A 1BHLA 3DOKA 3RTVA 1JLGA 4IFYA 2O4IA 1RBRA 3DYAA 5DK5A 2G8HA 4ZTFA 2HHUA 4Z4GA 3DRRA 4LY7A 1J53A 1ZBHA 4GW6A 2G8WA 3PX4A 3VA3A 3O3GA 4BWMA 4Q5VA 3DM2A 3VQ7A 1SKWA 1CLQA 2P1JA 1NJYA 3V1OA 3DRSA 4CJVA 4PQUA 1ASWA 3PUFA 3VQCA 3TARA 4DQPA 1N6QA 4CJ3A 3EZ5A 1UAXA 3LPUA 2HVIA 5J2QA 1J54A 4WE1A 1RT7A 5CZ1A 3SJJA 3K57A 4JS4A 1EX4A 1BQNA 4G1QA 1SKSA 3OYFA 2R7YA 4FLYA 4B9SA 3AO5A 3KK1A 2IOCA 1WAJA 2HNYA 4LH4A 4YNQA 3OYEA 3K59A 2KFNA 3DMJA 4OPKA 4BDPA 1I39A 4FJHA 4CGFA 2YNHA 1RT4A 1QTMA 2FBVA 3TAGA 1VSIA 4CEQA 2EX3A 1S9EA 3AVLA 5HRRA 1I3AA 1DTQA 3G10A 3KK2A 4DSJA 3K5OA 1VSHA 1RT3A 2PYJA 4M3YA 3NF6A 2RPIA 5CY4A 3ZSQA 4FJXA 1TK0A 1RT6A 3ITHA 3KLIA 3QEPA 4DLEA 1JLBA 2X78A 4CCHA 3T19A 3AA3A 1SUQA 5DMRA 3OYNA 4HUFA 3LP1A 3HT3A 3HK2A 4GVMA 2WONA 4CE9A 3O3FA 1ZBUA 3NH1A 1JL1A 3L3UA 4B9LA 5E41A 3HP6A 2Z1GA 4BDYA 2E6MA 4CHZA 3U3YA 3NGZA 1SL1A 3DLHA 4M3RA 1VSKA 4LSLA 3C95A 1X9SA 4ELUA 1HYZA 4HUEA 4I9QA 2XO7A 3OYIA 5C42A 1TKDA 2G8UA 1RBTA 4IDKA 1T03A 4J2DA 3KTQA 4CJTA 4CECA 3SPYA 5HROA 1ZBIA 3OYKA 3AVFA 4F8RA 5FRMA 1JKHA 4FW2A 4CEZA 2ITGA 4RW6A 2PZSA 4M45A 4BWJA 4M3WA 3OYMA 4MFBA 3LAKA 1SL0A 4FJ7A 1HNVA 1TV6A 2IAJA 3TWHA 4RW8A 2G8FA 3L2QA 4K8ZA 4DTRA 3AVIA 3QINA 4XIUA 1RDBA 4QAGA 2Z1JA 4J2AA 1BCOA 4FJ8A 3NF8A 1NKCA 1Q9YA 3B6OA 4KI4A 1TKXA 4OKKA 4FJIA 2Y1JA 3TAEA 4UQGA 4I2PA 3NCIA 4H4OA 5KRTA 4DF8A 4E1NA 3OY9A 3LWMA 4IG0A 4CGIA 4CGHA 2FBTA 3SV4A 3K58A 3L2WA 2P5OA 4DMNA 3VQDA 4KTWA 3WNGA 4CEOA 5KGXA 3NAEA 4HCCA 1T8EA 2VG7A 4RW9A 4DTMA 3MXJA 4CGGA 1L3TA 1BQMA 1W9HA 1HNIA 3QO9A 1L3VA 3DLBA 1KVCA 3HJFA 2G8KA 4E89A 3LP0A 4KTZA 4CJRA 3LZIA 4KFBA 4PUOA 4LSNA 1RTIA 5T7BA 2YHAA 1RCHA 4KB1A 3MXMA 3SUOA 1LAVA 1VRTA 1UOCA 1FXXA 4CHNA 3PO5A 2FC0A 3DI6A 2ZD1A 3M8SA 3WNHA 3OYDA 4F2SA 4CFAA 3S3OA 4AHCA 1EP4A 3ZT1A 3QEIA 5HLFA 4W5TA 1C1AA 3B6PA 5K14A 2GV9A 4DSLA 1WSEA 3SUQA 4KPYA 3VA0A 3I0RA 3OJUA 4KHWA 4KHYA 1TL1A 1Z26A 2G8IA 3KIOA 1WN7A 2HHXA 4CF9A 4N56A 4DTXA 4DSFA 2YV0X 3AVKA 3TANA 4OLAA 1VSJA 2F8TA 2OPPA 5HP1A 4DF4A 5CYMA 1GOBA 3ZSXA 2HMIA 1TK8A 1KTQA 2JLEA 3KLHA 4AILC 1C0UA 3SQ0A 3AVMA 1CXQA 2QXFA 3H08A 4C8NA 3ZSRA 4CESA 4DU3A 3RMDA 3TI0A 4DWIA 5D3GA 1JXEA 5HRSA 1KSPA 4KRFA 3C6UA 1VSDA 2XHBA 4CHQA 1GOCA 1QHTA 2OA8A 3F9KA 1HPZA 3LPTA 2XY6A 1S5JA 3VQEA 2E4LA 4E7HA 4OGEA 3PX6A 4KHNA 4DQIA 4CHYA 4DU4A 4JRPA 3PV8A 4H8KA 1B92A 4J2BA 1WAFA 1HMVA 2O4GA 2JGUA 4I9LA 4E7JA 4LH5A 4CIEA 1IKXA 3ULDA 3A2FA 2VWJA 3C6TA 3LALA 3QEVA 3IS9A 2HHTA 1T05A 4FM2A 3DLRA 3KD1E 1EXQA 4B8CA 3DRPA 5HRPA 4DS4A 3V4IA 4C8LA 4HVJA 1LWEA 4OJRA 2XY7A 1J9AA 1KFSA 2G8VA 2QK9A 1DTTA 4YFUA 1RBVA 4E19A 1A5XA 4JRQA 3MEDA 3HXMA 4ELVA 1VSEA 1WSJA 3E01A 4KREA 1HYSA 3QEXA 3TAPA 2I5JA 4KB0A 4NCAA 3AVAA 1XHZA 4JS5A 1NKEA 2YKNA 1LW0A 2BANA 3FFIA 3PY8A 3UIQA 1LWCA 4DFKA 4ID5A 2F96A 4AHRA 3KD5E 4EZ9A 3ZSWA 1NKBA 1XWLA 1C6VA 1C0TA 5KGWA 3VQ6A 4FVMA 4CJ5A 4DTJA 1Q8IA 4LD0A 2ZQBA 4Z4FA 3OYBA 3TAMA 3SUNA 3LP3A 3VQ9A 4CJ4A 4NYFA 1JLQA 4BE2A 4OLBA 1QQCA 2D0AA 3VQPA 4E7LA 1D9FA 1U47A 3AVBA 1L3SA 1LV5A 3HVRA 3AA2A 1JL2A 4HHTA 3G0ZA 3K2PA 3K5MA 4CGJA 3KLEA 1EETA 3TAFA 1W0HA 3RR8A 4DU1A 3V6DA 1NK8A 3AA5X 1VRUA 3SQ4A 5C24A 3CFPA 4FJLA 1BIZA 1CZ9A 3NF7A 2QKBA 2DFFA 1KLNA 3KKRA 4KO0A 1IG9A 2HNDA 4FK4A 4PY5A 3HPHA 2E6LA 2IC3A 1ASUA 3SNNA 1HYVA 3QEWA 4DFPA 3K5NA 4B8AB 3MXIA 1NK6A 1A5WA 4NCGA 3ZSVA 2D0CA 4Z0UA 3S9HA 3P5JA 3S3MA 3DOLA 4KAZA 4M3TA 1RT1A 1L3UA 4CERA 1YTAA 3KJVA 4DTOA 1XI1A 4C8MA 4AH9A 3SV3A 3PO4A 1S9GA 1SL2A 1YVUA 4C8KA 2VG6A 3M8QA 3PX0A 3NGYA 5CYQA 2DTUA 1IKVA 4EZ6A 3M8PA 3VQ8A 2XY5A 4H4MA 4FJ5A 5J2MA 3NGIA 1X9MA 1J5OA 2VG5A 2KFZA 3HO1A 3EYZA 2KW4A 3D45A 1KLMA 3JSMA 3TABA 3QERA 2YNFA 3U3GA 2A1RA 1NK0A 1KVBA 4BDZA 4E7IA 4GMJB 1T7PA 3ZT3A 3CQ8A 4M3ZA 1D8YA 2HVHA 1WSGA 5FRNA 1KFDA 1ITGA 2KQ2A 4B9VA 1EKEA 3KK3A 4PWDA 2DY4A 1UA0A 2QKKA 1NJWA 1NK9A 1JLCA 1RNHA 2GBZA 4CHPA 4F3OA 3CYMA 4FJJA 4FCYA 1QSSA 1WNSA 1YT3A 3RMCA 4W5NA 3NHGA 4DSEA 3ZCMA 3V81A 4C8OA 2RF2A 2DFHA 3V9WA 1BGXT 3BDPA 1MU2A 1JLEA 1IH7A 4DTNA 4IG3A 1U45A 3KLGA 3OS1A 1FK9A 2RKIA 3AO3A 3CFRA 4E3SA 4DFJA 3AVCA 1KCFA 2B6AA 2YHBA 3VQ4A 2OZMA 2NUBA 3AA4A 1QSLA 4K8XA 4FK0A 3KLFA 1F21A 3QIOA 4IFVA 3VQBA 3RRHA 4KHUA 4M42A 4AHUA 3L3VA 2HNZA 4FW1A 1B9FA 1C1BA 1QS4A 1TAQA 3K5LA 1S1TA 1N5YA 1WLJA 2B4JA 3NBPA 4N41A 4FXDA 4NYNA 1D9DA 4FJ9A 1UWBA 1WSHA 4CK1A 1RBSA 4B9TA 1IKWA 2YNGA 4O0JA 1HQEA 3LAMA 2ETJA 4Y1CA 4W5OA 3OYAA 3RR7A 4B3OA 1TAUA 2KZMA 4N47A 3CM5A 3U6FA 2BDPA 2BE2A 4FZZA 1S1WA 2KZZA 4DSIA 3VN5A 5C25A 1NOYA 1LAWA 4CF2A 3EY1A 3AVHA 1RTJA 3HSTB 3ZT0A 2HHWA 4FLWA 3HYFA 1TL3A 1RT5A 2IGIA 3P83D 4L8RB 3OYCA 1RBUA 3AO4A 1S1UA 2Z1IA 4OKEA 3VQ5A 4B9MA 4N76A 1C0MA 4Y1DA 1YTUA 4F3TA 4OPJA 3LP2A 3WNFA 5HRNA 4FM1A 4CIGA 3RRGA 3RMBA 4KHSA 4FJKA 4FYDA 1B9DA 4FM0A 2FBXA 2OPSA 2RN2A 3MEGA 2KTQA 4M41A 5SWMA 1BI4A 1KVAA 3DLEA 3V1RA 2EHGA 3HVTA 5KTQA 1NK4A 1RTHA 3AO1A 3AV9A 4I2QA 4MQ3A 1VSMA 3V9XA 3I0SA 4FLTA 4CEFA 1JLFA 3SYZA 3HL8A 4EP4A 3SPZA 3HP9A 1TK5A 3QIPA 4R5PA 1UA1A 4QCLA 2OZSA 4CEBA 3NFAA 3AVJA 4CF0A 2P5GA 1L5UA 1S1VA 5J2NA 3V9SA 2ATQA 5HBMA 4W5RA 1D5AA 3T1AA 4Z4HA 4BE1A 4E7KA 1U49A 4FZYA 1IKYA 3HPGA 4HCBA 2OPRA 5KI6A 4HTUA 3ZSOA 1BL3A 2DFEA 3MECA 3NH2A 1RDDA 3OYGA 4EP5A 4DFMA 4IKFA 4DLGA 1X1PA 1NK7A 4B08A 5I3UA 4FJGA 2AJQA 3ASMA 4F4KA 3L2VA 2HW3A 2BGGA 1HJRA 2HB5A 3D0PA 3V1QA 2IS3A 1HRHA 4O5BA 2OPQA 5EU7A 3OS0A 2ZE2A 2Z1HA 3MEEA 2LSNA 3QLHA 4CFBA 4DS5A 4CEDA 4DTSA 1Q9XA 1WSFA 3CG7A 3SCXA 4O44A 1ASVA 1RDAA 4B9UA 2D0BA 1NOZA 1K6YA 3O3HA 1U4BA 4RG8A 4W5QA 2Y1IA 5JS1A 4AHSA 3ZT4A 1REVA 4CJSA 4QOZB 4O4GA 1VSLA 3C94A 4HUGA 4CFCA 4ZHRA 1GOAA 1S6QA 4CK2A 5J2PA 1NJXA 1TKZA 3OYHA 2B5JA 4CJEA 4FJNA 4N5SA 3AO2A 1BI4B 1RDCA 3O4QA 5FROA 1WSIA 3ZSZA 4CGDA 4DG1A 5J1EA 4FLVA 3RWUA 4KHQA 3OS2A 3AVGA 3OJSA 3KKSA 4CJPA 3LWLA 1Z25A 3OYLA 4F2RA 4NCBA 4TSXA 2YNIA 3HPOA 4FZXC 2HHVA 2XRIA 3DLKA 3ISNC 1BIUA 3AVNA 3LANA 3L2UA 1HQUA 2PYLA 4B9NA 3NE6A 1G15A 4E0DA 4CFDA 4CEEA 3I8DA 2OYQA 3V9ZA 3ZSYA 4BACA 1R0AA 4Z4IA 3BGRA 4FLXA 3NH0A 2X74A 4BE0A 4DSKA 2HHSA 2YKMA 4FLUA 4E1MA 4RW7A 4OGCA 1U04A 4DTPA 2PY5A 4OKJA 3CFOA 1ZBFA 1VK0A 4PA1A 3LDSA 5CZ2A 4CIFA 4KV8A 1IO2A 1XHXA 3DLGA 3MAQA 1NJZA 4I7FA 4DTUA 4ZTJA 2XY8A 3TR8A 5I42A 3VQAA 3TAQA 1TGOA 2VWKA 1QSYA 4KI6A 4CF1A 5JS2A 3F73A 2GUIA 1TVRA 4ICLA 4CJLA 3OVNA 3SZ2A 4Z4EA 5SZTA 4CJFA 4O55A 3HM9A 1CZBA 4O0IA 1JLAA 4M3UA 4OVLA 3S3NA 4CHOA 1NK5A 1XC9A 4FLZA 1S6PA 3QESA 2P51A 3VQQA 2X6SA 4FJMA 3L2RA 1SV5A 1S1XA 4M3XA 1A5VA 4DQQA 4ELTA 4DQRA 4RW4A 4CJUA 4DQSA 2Q3SA 1ZBLA 4ID1A 3T3FA 1LWFA 3QETA 2F8SA 1Y97A 3OYJA 4Q0BA 3P1GA 1FKPA 2IDOA 3CM6A 3IRXA 3QNOA 3THVA 2WOMA 4CK3A 1ZYQA 3M8RA 5FDLA 4Z4CA 2A1SA 4CEAA 4CJQA 4CF8A 3JYTA 2X6NA 1X9WA 4KTQA 1SKRA 4CJWA 3V9UA 2HHQA 1RILA 1O1WA 3LZJA 1VSFA 1FKOA 3RMAA 3L8BA 3IAYA 3O4NA 1RT2A 4JLHA 5KRSA 4AHTA 3QNNA 1U48A 1C1CA 3NDKA
chains in the Genus database with same CATH superfamily
1VQPN 1N8RO 3HZ6A 2GWKA 1BISA 3LDNA 3SQ2A 4FK2A 4DHYA 3WNEA 1BCMA 4JI5K 4J2EA 3T69A 1RGIA 2W42A 3SQ1A 1JLGA 4IFYA 3VTIA 4ZTFA 4LY7A 4A5BA 3J81O 3HM8A 3WQTA 3VA3A 3O3GA 4Q5VA 4BRIA 5M1KA 1CLQA 3V1OA 4CJVA 3J7YP 3TARA 4O8UA 1GLDG 1NGCA 2GX9A 3J8AA 4CZIA 5J2QA 2HVIA 3OYFA 4B9SA 2IOCA 4FWRA 1WAJA 4FWQA 2HNYA 1Q7YO 3IDHA 3ZX0A 4B3SK 4A5AA 3DMJA 5KPZA 4KH6A 3WEEB 2YNHA 1QTMA 3GL1A 1VSIA 5HRRA 3KK2A 4CZLA 3TPQA 2PYJA 1K8KA 3W3DA 3NF6A 1TK0A 1RT6A 3KLIA 4JI8K 1JLBA 1YJ9N 4LF4K 3PSIA 3LP1A 3HK2A 4GVMA 3EKSA 2WONA 1NM1A 4BDYA 3U3YA 1JJ2M 4M3RA 3C95A 1HYZA 2XO7A 4B1UB 2G8UA 4IDKA 5BRDA 4DV7K 4IOXA 2CGJA 3FGUA 5ELZA 5AQXA 3VENA 4F8RA 4DV5K 4A61A 2QWLA 2ITGA 3QICA 3E9OA 4WFAL 3LAKA 4FJ7A 1TV6A 3TWHA 5LMNK 1Z05A 2Z1JA 3R8EA 1BCOA 2AP1A 3B6OA 1VAZA 4O5FA 2RE2A 3E9PA 3M6GA 3NCIA 4H4OA 5KRTA 3LWMA 4CGIA 3AARA 3L2WA 2ITMA 3VQDA 4KTWA 3WNGA 4DCHA 2UU9K 4KH4A 3HBTA 3KK7A 4IJAA 3HJFA 3VGMA 2QWMA 2G8KA 4E89A 3LP0A 5JLFA 3THYB 4LSNA 3G71N 2JWLA 1X9JA 1Q18A 4CHNA 5AZIB 3H46O 2HBKA 4F2SA 4CFAA 3S3OA 2P9PA 1C1AA 4DSLA 4AF1A 1WN7A 1NMDA 5M1FA 1NU0A 1MWMA 3AVKA 4H0VB 4CZJA 5HP1A 1IBLK 4DF4A 1H1VA 4BRFA 1TK8A 4BC3A 3KLHA 4ILJA 1C0UA 1CXQA 2QXFA 3ZSRA 4FWPA 2D4WA 3TI0A 4LF6K 1JXEA 1LCUA 5HRSA 1KSPA 3ID8A 4KRFA 3WXLA 1VSDA 3F9KA 1KC8O 3PX6A 5M1PA 4DQIA 4OX9K 4GV9A 4H8KA 1ZC6A 2JGUA 4LF5K 4LH5A 3N4PA 3A2FA 1C0GA 1EXQA 1J9AA 1KFSA 3THWB 4YFUA 1DKGD 1RBVA 5MLCQ 3SJHA 4CZFA 3HXMA 1VSEA 1WSJA 3E01A 2E2NA 3L0QA 3O80A 3AVAA 3D2FA 3E1YA 3J7AP 1GLCG 2F96A 1NKBA 3ZETB 4CJ5A 4DTJA 1D4XA 2ZQBA 3TAMA 3LP3A 4CJ4A 3NMUA 4BE2A 5FPMA 2D0AA 3P39A 3HVRA 3MWTA 2HHHK 3KLEA 1EETA 1W0HA 1NK8A 4RTFD 1CZ9A 1KLNA 4FK4A 4WQ4C 3ULEA 1YJNN 3SNNA 3QEWA 1HUXA 4NCGA 3ZSVA 4XH4A 3KJVA 4WQ5C 4GKKK 1XI1A 3SBGA 2P9SA 1SL2A 2F7TA 3VGKA 1ATSA 3O6WA 3VF4A 4A2BA 5GAEP 1NG9A 3EYZA 3D45A 3QERA 4BG8A 1LOTB 4M3ZA 1D8YA 4PKHA 1ITGA 4EFHA 2KQ2A 4BREA 1XMOK 1EKEA 1UA0A 1JLCA 2P9UB 3LM2A 1NMNA 1WNSA 1QSSA 4W5NA 3NHGA 3BDPA 3V9WA 3KLGA 1FK9A 1EO1A 4K0KK 4E3SA 2OZMA 2B6AA 4FWNA 2ZF5O 3AA4A 3QIOA 4IFVA 3BZKA 3L3VA 2HNZA 3MX2A 3UKUB 1QS4A 2GELA 4NYNA 5AQPA 2YHXA 1GLAG 3OYAA 1HQEA 3TSQA 4B3OA 4W5OA 3BP8A 4OPAA 4JD2A 5GADP 3HOSA 3VN5A 3HSTB 3ZT0A 4GY2B 2F4VK 1RBUA 2Z1IA 4B9MA 4N76A 4B9QA 1C0MA 4Y1DA 5FPNA 1YTUA 4F3TA 4C1NI 2FLOA 4MO4A 4H5VA 3RRGA 1GLFO 1WB9A 5AZJB 3FLCO 3H1QA 3O9TA 3GBTA 4MQ3A 1SZ2A 1ATRA 3I0SA 2UUCK 5AQIA 3C7NA 1TK5A 4IZ9A 4DR7K 3LDPA 2OZSA 3NFAA 1L5UA 1S1VA 3FFKB 5J2NA 2EWSA 2ATQA 2NRWA 5EVZA 3F2KA 4BE1A 1U49A 4FZYA 1TUUA 1IKYA 4HCBA 1W97L 4NO7A 5KI6A 3ZSOA 1BL3A 2DFEA 3MECA 3NH2A 5B8HA 1VQ7N 4FJGA 1S72N 2AJQA 2KHOA 2NRHA 3ASMA 1K73O 2BGGA 2IS3A 3CERA 5AQVA 1T44A 1YHQN 3ATVA 3MEEA 4IWVA 2E20A 3SCXA 3PSFA 4B9UA 3O3HA 1U4BA 1K6YA 2Y1IA 5DM7L 5AQZA 1NGHA 4O4GA 1DEJA 3C94A 4CFCA 3MMVA 1GOAA 5J2PA 3CCRN 5GINA 5AQOA 4CJEA 3CQXA 5E84A 1BI4B 3ENBA 4FLVA 4CGDA 3QDKA 3AVGA 3OYLA 2HHVA 2XRIA 3ISNC 3O08A 1G15A 5JMVA 4E0DA 4FOIA 4FLXA 3MWPA 3NH0A 2W40A 4BE0A 4DSKA 4FLUA 3Q7BA 2PY5A 3CFOA 1ZBFA 5CZ2A 4JI4K 1KAXA 3MAQA 4ZTJA 3TAQA 2VWKA 1QSYA 3RSEA 4Z4EA 2GUIA 1TVRA 4ISGA 2P9IA 3HM9A 1Q81O 4O55A 1G99A 4M3UA 3S3NA 4FLZA 3SK3A 3QESA 2P51A 3QFPA 4FPAA 4NLBA 3ZX3A 4AM6A 4ELTA 1SAZA 3DXKA 5GAHP 4JK8A 4B1VA 3T3FA 1LWFA 4LFCK 2F8SA 1Y97A 3P1GA 1BUPA 2IDOA 3OW2M 4CK3A 1ZYQA 5FDLA 4CEAA 4CJQA 3JYTA 3V9UA 1O1WA 1VSFA 2QTDA 3JS6A 3L8BA 4JI3K 1BDGA 4BRDA 1RT2A 3QNNA 1C1CA 3NDKA 1TYQA 3NF9A 3O9UA 5AR0A 1CXUA 2FBYA 3D2EB 4AHVA 1LW2A 3VGLA 1KRPA 4BROA 1QE1A 3ZEUB 3ZT2A 4AQYK 3SUPA 1FW6A 5BR8K 4KKOA 1TKTA 3EZWA 4IBNA 5AQLA 4DR5K 3RTVA 5DK5A 2GUPA 2HHUA 4Z4GA 1J53A 4JHDA 2G8WA 3DAWA 1OH6A 2P9LB 3M3ZA 1SKWA 3UE5A 4PQUA 2FSJA 1VQLN 3IKMA 4MO5A 4CJ3A 1EX4A 2R7YA 3KK1A 3CC2N 4LC9B 3OYEA 3K59A 2KFNA 2O8EB 4BDPA 1I39A 4FJHA 2CGLA 2WFBA 3A5MC 4CEQA 1S9EA 1I3AA 5JVGL 3G10A 4DSJA 1NJIO 1VSHA 1RT3A 4DR2K 3JXUA 3CQYA 4FJXA 3LDQA 3ITHA 3QEPA 4DLEA 2NRRA 3SMPA 4CCHA 2P9NA 4WYBA 3NH1A 3O3FA 4B9LA 3L3UA 5E41A 3HP6A 2E6MA 1BG3A 3CHWA 4BQZA 1HNWK 1X9SA 4HUEA 3VMFB 1TKDA 4FWKA 1T03A 1QHAA 3LL3A 3KTQA 3CJBA 5BRFA 3W0LA 5HROA 4HTLA 2I7PA 3CCMN 3OYKA 3AVFA 4FW2A 4JI6K 4RW6A 3FZHA 3SAHA 4BR7A 4M3WA 2YCHA 4MFBA 4KHPK 1SL0A 4B1WB 4K8ZA 5HOOA 4GV6A 3LM9A 1OKJA 3QINA 4EHTA 1T6CA 4QAGA 4J2AA 1NKCA 1OVQA 4KI4A 1TKXA 4OKKA 1RFQA 2HSTA 3H3OB 4IG0A 1ZBSA 3SAFA 3SV4A 2P5OA 4DMNA 1ATNA 5KGXA 3NAEA 3BZCA 1L3TA 4CGGA 1L3VA 1W9HA 3UKRA 1HNIA 1K8KB 3QO9A 1KVCA 5JLHA 4CJRA 4KTZA 4KFBA 2V7YA 4JKGA 4KB1A 1VRTA 1UOCA 4QS8A 2FC0A 3DI6A 4NLCA 3M8SA 3WNHA 1XNQK 5HLFA 4W5TA 1WSEA 1BA1A 4KPYA 3OJUA 4KHWA 4B1XB 4N56A 4DTXA 1N36K 2D0PA 3D7EO 1VSJA 2IIRA 2ZGZA 2QXLA 3SQ0A 4B1ZA 3H08A 5CHIA 5GAGP 3RMDA 4PL7A 4JNEA 3C6UA 3IUCA 3EKUA 2XHBA 4CHQA 1GOCA 1QHTA 2OA8A 2XY6A 1S5JA 3VQEA 4E7HA 3A5LC 5AQRA 4CHYA 4ILHA 2O8FB 3CCVN 4JRPA 3L4IA 1WAFA 2O4GA 3G4SN 4CIEA 1IKXA 1J5EK 4BR9A 3TTCA 3ULDA 4K41A 3C6TA 3IS9A 1T05A 2O8BA 3DLRA 4BRNA 4LFAK 3V4IA 4C8LA 1E4GT 5BN8A 4BR4A 3NVKA 1HPMA 3MEDA 3MN6A 3O1WA 4YORA 3QEXA 2YX6A 3VF6A 4NCAA 3MCAB 3M1FA 2YKNA 3FFIA 3L4QA 4ID5A 2ASMA 2P9PB 3AAQA 3KD5E 2J4RA 5KGWA 4Z4FA 4FVMA 1NNEA 5AQHA 4ISFA 3AY9A 3F9MA 1JLQA 4OLBA 3VQPA 1U47A 3AVBA 1L3SA 3CJ1A 1DT9A 4BG9A 3K5MA 3TAFA 2OTJN 1JCEA 4YDUC 3V6DA 1VRUA 3SQ4A 4A62A 4X62K 4FJLA 1BIZA 3KKRA 2PFUA 4PY5A 3HPHA 3CXCM 3KVGA 1HYVA 1NK6A 1XNRK 1A5WA 3P5JA 3S3MA 1RT1A 4CERA 1YTAA 3N4QA 4DTOA 1YVUA 2DTUA 3NGYA 2IVOA 4EZ6A 4H4MA 5C0YA 5J2MA 3NGIA 1J5OA 4CD1A 4FSVA 5AQSA 5BRHA 1KLMA 3JSMA 3TABA 3U3GA 3CETA 4E7IA 2HVHA 1WSGA 3D2FB 5FRNA 5C2DA 3KK3A 4PWDA 2DY4A 3U9DA 2GBZA 4CHPA 4EIAA 4F3OA 3CYMA 4FJJA 1XQSC 2Q97A 1YT3A 4DSEA 2RF2A 2DFHA 1BGXT 1JLEA 1NWKA 3I55N 4IG3A 3OS1A 2RKIA 3FZFA 3CFRA 2YHBA 3VQ4A 2Q2RA 1MWKA 1F21A 4DR3K 5M1QA 4JI1K 1ZXOA 1TAQA 3ULEB 3K5LA 1N5YA 1WLJA 4N41A 3NBPA 4FXDA 4FL9A 1E4FT 1DGKN 1RBSA 3CJCA 1IKWA 2YNGA 4O0JA 4B9TA 3VESA 4Y1CA 4XEIA 2BDPA 4FZZA 3P38A 4CVNE 1HNXK 2P9SB 2QWQA 4DSIA 2KZZA 5C25A 2VGMA 1LAWA 4CF2A 1RTJA 2HHWA 3FE1A 1RT5A 3P83D 3AO4A 2UXBK 4OPJA 3LDOA 3J7ZO 4BRGA 4FM1A 4KHSA 2VCPA 4FJKA 3EE9A 4OPHA 4LFBK 2Q0RA 4WFNL 4M41A 1YI2N 4FPBA 4RCHA 3V1RA 3KHYA 2EHGA 3O1BA 1NK4A 1RTHA 3AV9A 4I2QA 4E1JA 4IXCA 2NLXA 3SYZA 1IV0A 3HL8A 3HP9A 4R5PA 1V4SA 1UA1A 3KZBA 4CEBA 5AQJA 3V9SA 4FVUA 3T1AA 2Q0UA 4E7KA 5BR9A 4HTUA 1RDDA 4DFMA 4IKFA 3ZX2A 4B08A 5I3UA 1QVGM 2QM1A 3BUZB 1HJRA 2HB5A 3WQUA 4O5BA 5BREA 5EU7A 1W2BM 2ZE2A 1OH7A 2LSNA 3MN5A 4BRLA 4DS5A 2UYTA 3GDQA 3CG7A 3THYA 4MDBA 1ASVA 5AQKA 2D0BA 3I56N 3ZT4A 1VSLA 4FO0A 4WQ4A 4HUGA 4ZHRA 1TKZA 3OYHA 4RWTA 4N5SA 3E66A 3G6EN 1WSIA 2I7NA 2P9KB 4WQ5A 4KHQA 3OJSA 3F5TA 4NCBA 3HPOA 4FZXC 2ASOA 5AQUA 3C7NB 1HQUA 2PYLA 3CJ7A 3TTDA 3I8DA 1VQ9N 4K42A 3EL2A 2X74A 4FWLA 4DV4K 4OGCA 4DTPA 5C15A 3VF2A 3MN9A 1VK0A 4PA1A 4KV8A 1IO2A 1XHXA 4I7FA 3EO3A 4WF9L 3PIOL 3MX5A 1X3MA 5JS2A 2QK9A 4WFBL 4CJFA 1CZBA 1JLAA 3K9KA 2F9WA 4KH5A 4BR2A 5E26A 5TKWA 5KPRA 3VQQA 3THWA 2X6SA 4YHHK 4X64K 3L2RA 1SV5A 1S1XA 3QBWA 4M3XA 3ATUA 3WXKA 4BVPA 4DQQA 3ID6A 4ISEA 4ID1A 1OH5A 3CM6A 3IRXA 2WUSA 3THVA 2WOMA 2W6LA 3M8RA 5A2QO 4DV3K 1X9WA 3KWIA 2HHQA 1RILA 1R59O 5LJVA 2CH5A 1KXPA 4V19S 1U48A 4JKBA 1KD1O 3BF3A 1YIJN 3SI6A 2NNWA 2D1KA 2D5RA 3VERA 1DLOA 1RTDA 4PKGA 4FYDA 1BHLA 2O4IA 2Q36A 2E8AA 1RBRA 5FPDA 1NGAA 3DYAA 4FWSA 1VQ8N 4GW6A 3PX4A 3C65A 5KQDA 4BWMA 3M5RA 3DM2A 3VTHA 3RSEB 3PUFA 2BTFA 2P9IB 3DWLA 1N6QA 3LPUA 4CBUA 4WE1A 2E88A 5CZ1A 1SQKA 4JS4A 3C0BA 1YVNA 1FJGK 5EXWA 2V51B 3A5OC 4H03B 4JKDA 2W41A 3DXKB 3EN9A 5EX5A 4GVEA 2FBVA 1KAYA 2EX3A 3AVLA 2WC9A 3ZLJA 3K5OA 3ZSQA 2X78A 4JI2K 3T19A 3AA3A 1SUQA 3HT3A 4CE9A 1TYQB 3OA9A 3CC7N 4CHZA 4JN4A 5AQMA 4ELUA 4CZHA 3OYIA 1J6ZA 5C42A 5JVHL 2QWOA 3U8XA 2NRXA 3UKUA 4CJTA 3SPYA 1YXQA 1JKHA 4JHDB 4CEZA 4M45A 3C6AA 2O8CA 4C23A 3E9LA 3SMSA 4RW8A 2G8FA 3L2QA 1T6DA 4LF9K 3QB0A 3NF8A 2HBMA 1Q9YA 4OO1J 4JKFA 4FJIA 2CGKA 3CCLN 2UXDK 5AQYA 3TAEA 3H45C 4DF8A 4E1NA 3OY9A 3K58A 2ASPA 3L6QA 4CEOA 4HCCA 3U9ZA 4BGAA 1T8EA 4RW9A 4DTMA 4I6MA 1BQMA 3OBWA 3CF5L 3THXA 4PUOA 1RTIA 3FZKA 1RCHA 3MXMA 2P9NB 3SUOA 3VEOA 1FXXA 1BU6O 3CI5A 2ZD1A 5LMUK 4A59A 3WUHA 4HWIA 2QI2A 3ZT1A 3SLCA 3B6PA 3H1VX 4U67L 3AAPA 3SUQA 4B3MK 3VA0A 3I0RA 2G8IA 1TL1A 3O9RA 1IJJA 3VEVA 4DSFA 1HR0K 2YV0X 5EOYA 3TANA 4OLAA 2E1YA 2QWNA 2OPPA 5AFUA 5CYMA 3ZSXA 4DV2K 4C8NA 4CESA 4DU3A 1NGIA 2V52B 2A6AA 1N33K 1HPZA 4OGEA 4KHNA 2O8DB 4DU4A 4J2BA 4I9LA 1HMVA 4E7JA 3I8BA 1M1KO 2A5XA 2VWJA 5C10A 2HHTA 5AQQA 1OH8A 2UXCK 4FM2A 4DS4A 4CZEA 3T1YK 4F9OA 4A57A 2G8VA 1DTTA 3CMEN 4E19A 3UKRB 2HF4A 4JRQA 4KREA 4ELVA 2KKZA 4JKGB 2I5JA 4H5RA 1XHZA 1NKEA 4A2AA 3EE8A 2BANA 1RDWX 3PY8A 4DFKA 1VQ5N 1XWLA 3FZLA 1Q8IA 4LD0A 1SS6A 4YOUA 3OYBA 3SUNA 3VQ9A 4NYFA 1W7AA 1BOTO 1QQCA 2HBLA 5C12A 4E7LA 3KWGA 4DKWA 2YHYA 3AA2A 1JL2A 4HHTA 3G0ZA 3RR8A 4DU1A 3CCEN 4QS9A 5C24A 1QQOA 3BF1A 3CFPA 4CD3A 1O13A 2QKBA 2DFFA 4KO0A 3A0IX 4UY8O 1NGEA 1HKCA 1ASUA 3TSPA 4B8AB 3K0SA 2UUAK 4PKIA 4Z0UA 3S9HA 4KAZA 4M3TA 1VQNN 3DOLA 1L3UA 2ZM6K 4EHUA 3SV3A 5TKYA 3PO4A 1S9GA 2VG6A 3M8QA 4B3RK 4JKEA 2O8BB 3B8AX 3PX0A 5CYQA 2ZGYA 1MA9B 1IKVA 2XY5A 3VQ8A 1HJOA 4FJ5A 1X9MA 1S22A 4YOYA 2KFZA 3HO1A 3R1XA 2KW4A 4JEPA 2A1RA 1KVBA 4BDZA 4GMJB 1KFDA 3QBXA 4B9VA 3AGKA 1NJWA 1NK9A 4U7BA 4FCYA 3RMCA 4C8OA 1IH7A 4DTNA 1U45A 3AO3A 4DFJA 3AVCA 1KCFA 2NUBA 1QSLA 4K8XA 4KHUA 3VQBA 4XH5A 4BR0A 3RRHA 4AHUA 1B9FA 1S1TA 1D9DA 4FJ9A 2AA4A 1WSHA 3HI0A 4MDAA 3EEQA 3RR7A 3GOIA 1GLJO 4N47A 2BE2A 1S1WA 2HF3A 2NRZA 4H5WA 1NOYA 4R79A 2BUPA 2QWPA 3AVHA 3WXJA 3T7ZA 3HYFA 4LF7K 3AGRA 2IGIA 4JKAA 1WOQA 2FSKA 3S41A 3WNFA 5HRNA 1ESVA 3DXMA 3OHRA 4CIGA 4YOVA 3RMBA 2HOEA 4KBOA 2OPSA 3OTOK 3MEGA 3P31A 1S3XA 2A41A 3WT0A 5SWMA 2OANA 3DLEA 1NGFA 3HVTA 3BY5A 5KTQA 1VSMA 3TTFA 4CEFA 1JLFA 1U2VA 1NGJA 4EP4A 2QA4N 3CCUN 4QCLA 3H3NO 3J80O 4DR1K 2P5GA 5HL7L 4BRAA 4LF8K 2VYPA 1GLLO 5HBMA 4W5RA 1U6ZA 4Z4HA 1P8ZA 3HPGA 2NZTA 2OPRA 4M7XA 5F2RA 4DV0K 4EP5A 4DR6K 1X1PA 1NK7A 4NB4A 1YUWA 1XC3A 3L2VA 3CIPA 3IFRA 3MK6A 2OPQA 5AQNA 1GLEG 4CFBA 4XH1A 5M1NA 3O9SA 4CZMA 4O44A 1RDAA 2WTUA 1NOZA 2YJFA 4RG8A 4YDUA 2Q31A 3R9PA 3TSUA 4Z94A 1HNZK 4X65K 3CPWM 4CJSA 5IWAK 3T1HK 1Q86O 1NJXA 4CK2A 3O8MA 2B5JA 4PL8A 3DLLL 3OBYA 4YY3K 1RDCA 3O4QA 5FROA 3U4LA 3ZSZA 4DG1A 3RWUA 3WXIA 4CJPA 1Z25A 4TSXA 2YNIA 2E5LK 1BIUA 3AVNA 3LANA 4B9NA 3NE6A 2OYQA 4CEEA 1XUPO 5BPNA 3V9ZA 3FZMA 3BGRA 2ZJPL 4Z4IA 4JK7A 2YHWA 4IDHA 4K43A 2HHSA 4RW7A 1U04A 4EAHD 4BRKA 4OKJA 2IVPA 2O8FA 3DLGA 2YI1A 3CCSN 3QFUA 3IMXA 5I42A 2PAVA 3TR8A 1TGOA 4ICLA 3RVCA 4O0IA 4OVLA 4CHOA 1NK5A 1XC9A 2OCEA 1A5VA 4DQRA 4CJUA 1QQMA 3WEEA 1ZBLA 5F1XA 3OYJA 1OVYA 1CZAN 1FKPA 3QNOA 2FF6A 3WXMB 4Z4CA 2A1SA 3MN7A 4KTQA 1SKRA 4CJWA 4BC5A 5LL6Z 3LZJA 1FKOA 3MCPA 1EQYA 3O4NA 4AHTA 3HOTA 4CJKA 3CCQN 1JXBA 3ALYA 1VQ6N 4IOAL 3VOVA 5GIOA 2YJEA 3IG1A 3DOKA 1I94K 1HKBA 4H0PA 2G8HA 1YITN 3DRRA 4H5TA 1ZBHA 5AFUH 3VQ7A 2P1JA 1NJYA 1QVFM 3DRSA 4BRHA 1ASWA 3VQCA 3CPEA 3H6EA 4DQPA 3EZ5A 1UAXA 5KPTA 1J54A 1RT7A 3SJJA 3K57A 1BQNA 4G1QA 2E2PA 1SKSA 4FLYA 1K9MO 3AO5A 4M63C 4LH4A 4YNQA 4NXNK 4OPKA 4DUYK 3CCJN 4CGFA 2A40A 3R3LA 1RT4A 4JD2B 3TAGA 1Y64A 1DTQA 3VEXA 3VETA 4M3YA 2RPIA 5CY4A 4JYAK 2H3GX 3DJCA 1YAGA 3OYNA 5DMRA 4HUFA 1WBDA 1ZBUA 5AZIA 1JL1A 2Z1GA 3NGZA 5LY3A 1SL1A 3DLHA 1VSKA 4LSLA 4MLHA 4I9QA 3A8YA 1V4TA 4BC2A 4IJNA 1RBTA 4J2DA 3G25A 4CECA 4CJ7A 1ZBIA 5FRMA 1E3MA 4BRCA 4BY9C 3UB5A 2PZSA 3FR0A 4BWJA 3OYMA 1HNVA 1BO5O 1KAZA 2IAJA 5AQFA 4DTRA 3AVIA 4FWMA 4L3QA 1RDBA 4XIUA 5ADXA 4FJ8A 4GNIA 2ZWHA 2DPNA 1HLUA 3ENHA 2Y1JA 4DB3A 4UQGA 4I2PA 4BRQA 3CJ9A 1TUYA 4CW7B 1K8AO 4CGHA 2FBTA 3VEYA 2VG7A 3MXJA 3DLBA 3D6RA 3Q7CA 5CE3A 2NRTA 4ILGB 3LZIA 5T7BA 2A42A 2YHAA 3GE1A 1LAVA 1XMQK 3PO5A 2HMPA 4DR4K 1HX1A 3OYDA 4H0XB 4AHCA 4IO9L 1JCGA 1EP4A 4BC4A 3QEIA 5KQ8A 5K14A 2GV9A 1JCFA 4G9ZA 3ZETA 3NVMA 5BPMA 4KHYA 1Z26A 3KIOA 2HHXA 4CF9A 3O4WA 1KQSM 4B3TK 2F8TA 2QWRA 5AQWA 1GOBA 4DV6K 2GTDA 2HMIA 2O8CB 1KTQA 2JLEA 4AILC 4AM7A 3AVMA 1QZ6A 4DWIA 1Q82O 5D3GA 3BEXA 4DQ8A 3VPZA 4CZGA 4JKCA 2BH1A 2Q1NA 2E2QA 3LPTA 4CI6A 2E4LA 4JAXA 2A3ZA 4DV1K 1EWQA 3PV8A 5FLXO 1B92A 5C2FA 3I33A 1IBMK 4JI7K 3LALA 3QEVA 4BVOA 3KD1E 3P4IA 4B8CA 3DRPA 5HRPA 4HVJA 1LWEA 4OJRA 2XY7A 4I6MB 2P9KA 1A5XA 1P90A 3THXB 3HSCA 1HYSA 3TAPA 5AQTA 1QQNA 4KB0A 3K9JA 4O8KA 1YF5L 4JS5A 5I9EB 1LW0A 3UIQA 1LWCA 2FF3B 2P9UA 4AHRA 4EZ9A 2HBJA 1NBWA 3ZSWA 1X3NA 2E2OA 1C6VA 1C0TA 2V7ZA 3VQ6A 4BGBA 3QMLA 1GLBG 2FSNA 1D9FA 1LV5A 1NGGA 3K2PA 4CGJA 5BN9A 3AA5X 1RDUA 3NF7A 1N34K 1IG9A 2HNDA 4Y0WA 2E6LA 2IC3A 4JK9A 4H0OA 3K5NA 4DFPA 3MDQA 4WCEL 3MXIA 2D0CA 1VQON 4BQLA 4C8MA 4AH9A 4CBXA 2UUBK 4C8KA 3M8PA 2QEXN 2CH6A 2VG5A 3A5NC 2YNFA 1VQ4N 1NK0A 1HKGA 2QW9A 1T7PA 3ZT3A 3CQ8A 2VGNA 5AZJA 5CR4A 4MLEA 2NRVA 3R6MA 2QKKA 1RNHA 4IEEA 3ZCMA 3V81A 1MU2A 5AQGA 3HRGA 3TU5A 4IOCL 4JKHA 1WUAA 4BRMA 4FK0A 3KLFA 4H0YB 2VQEK 4M42A 1VHXA 4FW1A 1C1BA 2B4JA 4H0TB 1UWBA 1EWRA 4CK1A 4IFEA 4IO8A 3LAMA 2ETJA 4QS7A 1TAUA 5BPLA 2KZMA 1BWFO 3CM5A 3U6FA 5FPEA 4YOXA 2PBDA 2GEMA 5EY4A 4FOEA 2VQFK 3C6HA 1VQMN 1ILYA 3EY1A 3VEWA 1YJWN 1Z6RA 2WBNA 5LJWA 4FLWA 1TL3A 4J8FA 4L8RB 3OYCA 1S1UA 3VQ5A 4OKEA 4GV3A 3LP2A 4X66K 2KLAA 1B9DA 5AJ3K 4FM0A 2FBXA 2RN2A 1NGBA 2KTQA 3O5BA 4BRPA 1BI4A 1BA0A 1KVAA 4CBWA 3PLAA 1VQKN 2FXUA 3AO1A 3V9XA 4FLTA 1WBBA 5M1OA 3SPZA 3QIPA 3ZYYX 3AVJA 4CF0A 2F9TA 4M7YA 1D5AA 2E1ZA 4IEIA 3OYGA 4DLGA 3LDLA 1M90O 4JV5K 2ZJQL 2RHKA 1MDUB 3VEZA 4F4KA 2HW3A 3D0PA 3V1QA 1HRHA 2OTLN 5GIPA 3O9QA 3OS0A 4PHTX 2Z1HA 5F0XA 2W6KA 3QLHA 4YOTA 2IVNA 4CEDA 4DTSA 1Q9XA 1WSFA 2GWJA 4W5QA 4H5NA 2D0OA 5JS1A 4AHSA 1REVA 3DXMB 4QOZB 5IT9O 2JWKA 1S6QA 4JI0K 4C1NK 4FJNA 3AO2A 5J1EA 3OS2A 3KKSA 4CZKA 3CD6N 1C0FA 3LWLA 3CMAN 5DM6L 4F2RA 2ZJRL 1U2VB 3DLKA 5H1SQ 3L2UA 3JAMO 3D2EA 4CFDA 5JICA 3ZSYA 4BACA 3GG4A 3ZEUA 1R0AA 3SBTA 1NGDA 2YKMA 4E1MA 4DUZK 3LDSA 2O8DA 4CIFA 2P9LA 1NJZA 1IG8A 4DTUA 4GKJK 2XY8A 3VQAA 4KI6A 4CF1A 3F73A 3SZ2A 4CJLA 3OVNA 5SZTA 4YOWA 2VWBA 3ENOA 1S6PA 4FJMA 5ADXH 1T3VA 3PIPL 3CJAA 4RW4A 2O8EA 4DQSA 4B1YB 2Q3SA 1N32K 3QETA 4NXMK 1IBKK 4Q0BA 3HTVA 4CF8A 3SAGA 2X6NA 3CC4N 3RMAA 4K25A 3IAYA 4FWOA 4JLHA 4BR5A 1NLVA 5KRSA 1QZ5A
chains in the Genus database with same CATH topology
3NF9A 4CJKA 3SI6A 1CXUA 1BISA 2FBYA 2D5RA 3SQ2A 1JXBA 4AHVA 3ALYA 1DLOA 4FK2A 1RTDA 1LW2A 3WNEA 1KRPA 1BCMA 1QE1A 3ZT2A 4J2EA 3SUPA 3IG1A 2W42A 4KKOA 1TKTA 4IBNA 3SQ1A 1BHLA 3DOKA 3RTVA 1JLGA 4IFYA 2O4IA 1RBRA 3DYAA 5DK5A 2G8HA 4ZTFA 2HHUA 4Z4GA 3DRRA 4LY7A 1J53A 1ZBHA 4GW6A 2G8WA 3PX4A 3VA3A 3O3GA 4BWMA 4Q5VA 3DM2A 3VQ7A 1SKWA 1CLQA 2P1JA 1NJYA 3V1OA 3DRSA 4CJVA 4PQUA 1ASWA 3PUFA 3VQCA 3TARA 4DQPA 1N6QA 4CJ3A 3EZ5A 1UAXA 3LPUA 2HVIA 5J2QA 1J54A 4WE1A 1RT7A 5CZ1A 3SJJA 3K57A 4JS4A 1EX4A 1BQNA 4G1QA 1SKSA 3OYFA 2R7YA 4FLYA 4B9SA 3AO5A 3KK1A 2IOCA 1WAJA 2HNYA 4LH4A 4YNQA 3OYEA 3K59A 2KFNA 3DMJA 4OPKA 4BDPA 1I39A 4FJHA 4CGFA 2YNHA 1RT4A 1QTMA 2FBVA 3TAGA 1VSIA 4CEQA 2EX3A 1S9EA 3AVLA 5HRRA 1I3AA 1DTQA 3G10A 3KK2A 4DSJA 3K5OA 1VSHA 1RT3A 2PYJA 4M3YA 3NF6A 2RPIA 5CY4A 3ZSQA 4FJXA 1TK0A 1RT6A 3ITHA 3KLIA 3QEPA 4DLEA 1JLBA 2X78A 4CCHA 3T19A 3AA3A 1SUQA 5DMRA 3OYNA 4HUFA 3LP1A 3HT3A 3HK2A 4GVMA 2WONA 4CE9A 3O3FA 1ZBUA 3NH1A 1JL1A 3L3UA 4B9LA 5E41A 3HP6A 2Z1GA 4BDYA 2E6MA 4CHZA 3U3YA 3NGZA 1SL1A 3DLHA 4M3RA 1VSKA 4LSLA 3C95A 1X9SA 4ELUA 1HYZA 4HUEA 4I9QA 2XO7A 3OYIA 5C42A 1TKDA 2G8UA 1RBTA 4IDKA 1T03A 4J2DA 3KTQA 4CJTA 4CECA 3SPYA 5HROA 1ZBIA 3OYKA 3AVFA 4F8RA 5FRMA 1JKHA 4FW2A 4CEZA 2ITGA 4RW6A 2PZSA 4M45A 4BWJA 4M3WA 3OYMA 4MFBA 3LAKA 1SL0A 4FJ7A 1HNVA 1TV6A 2IAJA 3TWHA 4RW8A 2G8FA 3L2QA 4K8ZA 4DTRA 3AVIA 3QINA 4XIUA 1RDBA 4QAGA 2Z1JA 4J2AA 1BCOA 4FJ8A 3NF8A 1NKCA 1Q9YA 3B6OA 4KI4A 1TKXA 4OKKA 4FJIA 2Y1JA 3TAEA 4UQGA 4I2PA 3NCIA 4H4OA 5KRTA 4DF8A 4E1NA 3OY9A 3LWMA 4IG0A 4CGIA 4CGHA 2FBTA 3SV4A 3K58A 3L2WA 2P5OA 4DMNA 3VQDA 4KTWA 3WNGA 4CEOA 5KGXA 3NAEA 4HCCA 1T8EA 2VG7A 4RW9A 4DTMA 3MXJA 4CGGA 1L3TA 1BQMA 1W9HA 1HNIA 3QO9A 1L3VA 3DLBA 1KVCA 3HJFA 2G8KA 4E89A 3LP0A 4KTZA 4CJRA 3LZIA 4KFBA 4PUOA 4LSNA 1RTIA 5T7BA 2YHAA 1RCHA 4KB1A 3MXMA 3SUOA 1LAVA 1VRTA 1UOCA 1FXXA 4CHNA 3PO5A 2FC0A 3DI6A 2ZD1A 3M8SA 3WNHA 3OYDA 4F2SA 4CFAA 3S3OA 4AHCA 1EP4A 3ZT1A 3QEIA 5HLFA 4W5TA 1C1AA 3B6PA 5K14A 2GV9A 4DSLA 1WSEA 3SUQA 4KPYA 3VA0A 3I0RA 3OJUA 4KHWA 4KHYA 1TL1A 1Z26A 2G8IA 3KIOA 1WN7A 2HHXA 4CF9A 4N56A 4DTXA 4DSFA 2YV0X 3AVKA 3TANA 4OLAA 1VSJA 2F8TA 2OPPA 5HP1A 4DF4A 5CYMA 1GOBA 3ZSXA 2HMIA 1TK8A 1KTQA 2JLEA 3KLHA 4AILC 1C0UA 3SQ0A 3AVMA 1CXQA 2QXFA 3H08A 4C8NA 3ZSRA 4CESA 4DU3A 3RMDA 3TI0A 4DWIA 5D3GA 1JXEA 5HRSA 1KSPA 4KRFA 3C6UA 1VSDA 2XHBA 4CHQA 1GOCA 1QHTA 2OA8A 3F9KA 1HPZA 3LPTA 2XY6A 1S5JA 3VQEA 2E4LA 4E7HA 4OGEA 3PX6A 4KHNA 4DQIA 4CHYA 4DU4A 4JRPA 3PV8A 4H8KA 1B92A 4J2BA 1WAFA 1HMVA 2O4GA 2JGUA 4I9LA 4E7JA 4LH5A 4CIEA 1IKXA 3ULDA 3A2FA 2VWJA 3C6TA 3LALA 3QEVA 3IS9A 2HHTA 1T05A 4FM2A 3DLRA 3KD1E 1EXQA 4B8CA 3DRPA 5HRPA 4DS4A 3V4IA 4C8LA 4HVJA 1LWEA 4OJRA 2XY7A 1J9AA 1KFSA 2G8VA 2QK9A 1DTTA 4YFUA 1RBVA 4E19A 1A5XA 4JRQA 3MEDA 3HXMA 4ELVA 1VSEA 1WSJA 3E01A 4KREA 1HYSA 3QEXA 3TAPA 2I5JA 4KB0A 4NCAA 3AVAA 1XHZA 4JS5A 1NKEA 2YKNA 1LW0A 2BANA 3FFIA 3PY8A 3UIQA 1LWCA 4DFKA 4ID5A 2F96A 4AHRA 3KD5E 4EZ9A 3ZSWA 1NKBA 1XWLA 1C6VA 1C0TA 5KGWA 3VQ6A 4FVMA 4CJ5A 4DTJA 1Q8IA 4LD0A 2ZQBA 4Z4FA 3OYBA 3TAMA 3SUNA 3LP3A 3VQ9A 4CJ4A 4NYFA 1JLQA 4BE2A 4OLBA 1QQCA 2D0AA 3VQPA 4E7LA 1D9FA 1U47A 3AVBA 1L3SA 1LV5A 3HVRA 3AA2A 1JL2A 4HHTA 3G0ZA 3K2PA 3K5MA 4CGJA 3KLEA 1EETA 3TAFA 1W0HA 3RR8A 4DU1A 3V6DA 1NK8A 3AA5X 1VRUA 3SQ4A 5C24A 3CFPA 4FJLA 1BIZA 1CZ9A 3NF7A 2QKBA 2DFFA 1KLNA 3KKRA 4KO0A 1IG9A 2HNDA 4FK4A 4PY5A 3HPHA 2E6LA 2IC3A 1ASUA 3SNNA 1HYVA 3QEWA 4DFPA 3K5NA 4B8AB 3MXIA 1NK6A 1A5WA 4NCGA 3ZSVA 2D0CA 4Z0UA 3S9HA 3P5JA 3S3MA 3DOLA 4KAZA 4M3TA 1RT1A 1L3UA 4CERA 1YTAA 3KJVA 4DTOA 1XI1A 4C8MA 4AH9A 3SV3A 3PO4A 1S9GA 1SL2A 1YVUA 4C8KA 2VG6A 3M8QA 3PX0A 3NGYA 5CYQA 2DTUA 1IKVA 4EZ6A 3M8PA 3VQ8A 2XY5A 4H4MA 4FJ5A 5J2MA 3NGIA 1X9MA 1J5OA 2VG5A 2KFZA 3HO1A 3EYZA 2KW4A 3D45A 1KLMA 3JSMA 3TABA 3QERA 2YNFA 3U3GA 2A1RA 1NK0A 1KVBA 4BDZA 4E7IA 4GMJB 1T7PA 3ZT3A 3CQ8A 4M3ZA 1D8YA 2HVHA 1WSGA 5FRNA 1KFDA 1ITGA 2KQ2A 4B9VA 1EKEA 3KK3A 4PWDA 2DY4A 1UA0A 2QKKA 1NJWA 1NK9A 1JLCA 1RNHA 2GBZA 4CHPA 4F3OA 3CYMA 4FJJA 4FCYA 1QSSA 1WNSA 1YT3A 3RMCA 4W5NA 3NHGA 4DSEA 3ZCMA 3V81A 4C8OA 2RF2A 2DFHA 3V9WA 1BGXT 3BDPA 1MU2A 1JLEA 1IH7A 4DTNA 4IG3A 1U45A 3KLGA 3OS1A 1FK9A 2RKIA 3AO3A 3CFRA 4E3SA 4DFJA 3AVCA 1KCFA 2B6AA 2YHBA 3VQ4A 2OZMA 2NUBA 3AA4A 1QSLA 4K8XA 4FK0A 3KLFA 1F21A 3QIOA 4IFVA 3VQBA 3RRHA 4KHUA 4M42A 4AHUA 3L3VA 2HNZA 4FW1A 1B9FA 1C1BA 1QS4A 1TAQA 3K5LA 1S1TA 1N5YA 1WLJA 2B4JA 3NBPA 4N41A 4FXDA 4NYNA 1D9DA 4FJ9A 1UWBA 1WSHA 4CK1A 1RBSA 4B9TA 1IKWA 2YNGA 4O0JA 1HQEA 3LAMA 2ETJA 4Y1CA 4W5OA 3OYAA 3RR7A 4B3OA 1TAUA 2KZMA 4N47A 3CM5A 3U6FA 2BDPA 2BE2A 4FZZA 1S1WA 2KZZA 4DSIA 3VN5A 5C25A 1NOYA 1LAWA 4CF2A 3EY1A 3AVHA 1RTJA 3HSTB 3ZT0A 2HHWA 4FLWA 3HYFA 1TL3A 1RT5A 2IGIA 3P83D 4L8RB 3OYCA 1RBUA 3AO4A 1S1UA 2Z1IA 4OKEA 3VQ5A 4B9MA 4N76A 1C0MA 4Y1DA 1YTUA 4F3TA 4OPJA 3LP2A 3WNFA 5HRNA 4FM1A 4CIGA 3RRGA 3RMBA 4KHSA 4FJKA 4FYDA 1B9DA 4FM0A 2FBXA 2OPSA 2RN2A 3MEGA 2KTQA 4M41A 5SWMA 1BI4A 1KVAA 3DLEA 3V1RA 2EHGA 3HVTA 5KTQA 1NK4A 1RTHA 3AO1A 3AV9A 4I2QA 4MQ3A 1VSMA 3V9XA 3I0SA 4FLTA 4CEFA 1JLFA 3SYZA 3HL8A 4EP4A 3SPZA 3HP9A 1TK5A 3QIPA 4R5PA 1UA1A 4QCLA 2OZSA 4CEBA 3NFAA 3AVJA 4CF0A 2P5GA 1L5UA 1S1VA 5J2NA 3V9SA 2ATQA 5HBMA 4W5RA 1D5AA 3T1AA 4Z4HA 4BE1A 4E7KA 1U49A 4FZYA 1IKYA 3HPGA 4HCBA 2OPRA 5KI6A 4HTUA 3ZSOA 1BL3A 2DFEA 3MECA 3NH2A 1RDDA 3OYGA 4EP5A 4DFMA 4IKFA 4DLGA 1X1PA 1NK7A 4B08A 5I3UA 4FJGA 2AJQA 3ASMA 4F4KA 3L2VA 2HW3A 2BGGA 1HJRA 2HB5A 3D0PA 3V1QA 2IS3A 1HRHA 4O5BA 2OPQA 5EU7A 3OS0A 2ZE2A 2Z1HA 3MEEA 2LSNA 3QLHA 4CFBA 4DS5A 4CEDA 4DTSA 1Q9XA 1WSFA 3CG7A 3SCXA 4O44A 1ASVA 1RDAA 4B9UA 2D0BA 1NOZA 1K6YA 3O3HA 1U4BA 4RG8A 4W5QA 2Y1IA 5JS1A 4AHSA 3ZT4A 1REVA 4CJSA 4QOZB 4O4GA 1VSLA 3C94A 4HUGA 4CFCA 4ZHRA 1GOAA 1S6QA 4CK2A 5J2PA 1NJXA 1TKZA 3OYHA 2B5JA 4CJEA 4FJNA 4N5SA 3AO2A 1BI4B 1RDCA 3O4QA 5FROA 1WSIA 3ZSZA 4CGDA 4DG1A 5J1EA 4FLVA 3RWUA 4KHQA 3OS2A 3AVGA 3OJSA 3KKSA 4CJPA 3LWLA 1Z25A 3OYLA 4F2RA 4NCBA 4TSXA 2YNIA 3HPOA 4FZXC 2HHVA 2XRIA 3DLKA 3ISNC 1BIUA 3AVNA 3LANA 3L2UA 1HQUA 2PYLA 4B9NA 3NE6A 1G15A 4E0DA 4CFDA 4CEEA 3I8DA 2OYQA 3V9ZA 3ZSYA 4BACA 1R0AA 4Z4IA 3BGRA 4FLXA 3NH0A 2X74A 4BE0A 4DSKA 2HHSA 2YKMA 4FLUA 4E1MA 4RW7A 4OGCA 1U04A 4DTPA 2PY5A 4OKJA 3CFOA 1ZBFA 1VK0A 4PA1A 3LDSA 5CZ2A 4CIFA 4KV8A 1IO2A 1XHXA 3DLGA 3MAQA 1NJZA 4I7FA 4DTUA 4ZTJA 2XY8A 3TR8A 5I42A 3VQAA 3TAQA 1TGOA 2VWKA 1QSYA 4KI6A 4CF1A 5JS2A 3F73A 2GUIA 1TVRA 4ICLA 4CJLA 3OVNA 3SZ2A 4Z4EA 5SZTA 4CJFA 4O55A 3HM9A 1CZBA 4O0IA 1JLAA 4M3UA 4OVLA 3S3NA 4CHOA 1NK5A 1XC9A 4FLZA 1S6PA 3QESA 2P51A 3VQQA 2X6SA 4FJMA 3L2RA 1SV5A 1S1XA 4M3XA 1A5VA 4DQQA 4ELTA 4DQRA 4RW4A 4CJUA 4DQSA 2Q3SA 1ZBLA 4ID1A 3T3FA 1LWFA 3QETA 2F8SA 1Y97A 3OYJA 4Q0BA 3P1GA 1FKPA 2IDOA 3CM6A 3IRXA 3QNOA 3THVA 2WOMA 4CK3A 1ZYQA 3M8RA 5FDLA 4Z4CA 2A1SA 4CEAA 4CJQA 4CF8A 3JYTA 2X6NA 1X9WA 4KTQA 1SKRA 4CJWA 3V9UA 2HHQA 1RILA 1O1WA 3LZJA 1VSFA 1FKOA 3RMAA 3L8BA 3IAYA 3O4NA 1RT2A 4JLHA 5KRSA 4AHTA 3QNNA 1U48A 1C1CA 3NDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NF9 A;  4CJK A;  3SI6 A;  1CXU A;  1BIS A;  2FBY A;  2D5R A;  3SQ2 A;  1JXB A;  4AHV A;  3ALY A;  1DLO A;  4FK2 A;  1RTD A;  1LW2 A;  3WNE A;  1KRP A;  1BCM A;  1QE1 A;  3ZT2 A;  4J2E A;  3SUP A;  3IG1 A;  2W42 A;  4KKO A;  1TKT A;  4IBN A;  3SQ1 A;  1BHL A;  3DOK A;  3RTV A;  1JLG A;  4IFY A;  2O4I A;  1RBR A;  3DYA A;  5DK5 A;  2G8H A;  4ZTF A;  2HHU A;  4Z4G A;  3DRR A;  4LY7 A;  1J53 A;  1ZBH A;  4GW6 A;  2G8W A;  3PX4 A;  3VA3 A;  3O3G A;  4BWM A;  4Q5V A;  3DM2 A;  3VQ7 A;  1SKW A;  1CLQ A;  2P1J A;  1NJY A;  3V1O A;  3DRS A;  4CJV A;  4PQU A;  1ASW A;  3PUF A;  3VQC A;  3TAR A;  4DQP A;  1N6Q A;  4CJ3 A;  3EZ5 A;  1UAX A;  3LPU A;  2HVI A;  5J2Q A;  1J54 A;  4WE1 A;  1RT7 A;  5CZ1 A;  3SJJ A;  3K57 A;  4JS4 A;  1EX4 A;  1BQN A;  4G1Q A;  1SKS A;  3OYF A;  2R7Y A;  4FLY A;  4B9S A;  3AO5 A;  3KK1 A;  2IOC A;  1WAJ A;  2HNY A;  4LH4 A;  4YNQ A;  3OYE A;  3K59 A;  2KFN A;  3DMJ A;  4OPK A;  4BDP A;  1I39 A;  4FJH A;  4CGF A;  2YNH A;  1RT4 A;  1QTM A;  2FBV A;  3TAG A;  1VSI A;  4CEQ A;  2EX3 A;  1S9E A;  3AVL A;  5HRR A;  1I3A A;  1DTQ A;  3G10 A;  3KK2 A;  4DSJ A;  3K5O A;  1VSH A;  1RT3 A;  2PYJ A;  4M3Y A;  3NF6 A;  2RPI A;  5CY4 A;  3ZSQ A;  4FJX A;  1TK0 A;  1RT6 A;  3ITH A;  3KLI A;  3QEP A;  4DLE A;  1JLB A;  2X78 A;  4CCH A;  3T19 A;  3AA3 A;  1SUQ A;  5DMR A;  3OYN A;  4HUF A;  3LP1 A;  3HT3 A;  3HK2 A;  4GVM A;  2WON A;  4CE9 A;  3O3F A;  1ZBU A;  3NH1 A;  1JL1 A;  3L3U A;  4B9L A;  5E41 A;  3HP6 A;  2Z1G A;  4BDY A;  2E6M A;  4CHZ A;  3U3Y A;  3NGZ A;  1SL1 A;  3DLH A;  4M3R A;  1VSK A;  4LSL A;  3C95 A;  1X9S A;  4ELU A;  1HYZ A;  4HUE A;  4I9Q A;  2XO7 A;  3OYI A;  5C42 A;  1TKD A;  2G8U A;  1RBT A;  4IDK A;  1T03 A;  4J2D A;  3KTQ A;  4CJT A;  4CEC A;  3SPY A;  5HRO A;  1ZBI A;  3OYK A;  3AVF A;  4F8R A;  5FRM A;  1JKH A;  4FW2 A;  4CEZ A;  2ITG A;  4RW6 A;  2PZS A;  4M45 A;  4BWJ A;  4M3W A;  3OYM A;  4MFB A;  3LAK A;  1SL0 A;  4FJ7 A;  1HNV A;  1TV6 A;  2IAJ A;  3TWH A;  4RW8 A;  2G8F A;  3L2Q A;  4K8Z A;  4DTR A;  3AVI A;  3QIN A;  4XIU A;  1RDB A;  4QAG A;  2Z1J A;  4J2A A;  1BCO A;  4FJ8 A;  3NF8 A;  1NKC A;  1Q9Y A;  3B6O A;  4KI4 A;  1TKX A;  4OKK A;  4FJI A;  2Y1J A;  3TAE A;  4UQG A;  4I2P A;  3NCI A;  4H4O A;  5KRT A;  4DF8 A;  4E1N A;  3OY9 A;  3LWM A;  4IG0 A;  4CGI A;  4CGH A;  2FBT A;  3SV4 A;  3K58 A;  3L2W A;  2P5O A;  4DMN A;  3VQD A;  4KTW A;  3WNG A;  4CEO A;  5KGX A;  3NAE A;  4HCC A;  1T8E A;  2VG7 A;  4RW9 A;  4DTM A;  3MXJ A;  4CGG A;  1L3T A;  1BQM A;  1W9H A;  1HNI A;  3QO9 A;  1L3V A;  3DLB A;  1KVC A;  3HJF A;  2G8K A;  4E89 A;  3LP0 A;  4KTZ A;  4CJR A;  3LZI A;  4KFB A;  4PUO A;  4LSN A;  1RTI A;  5T7B A;  2YHA A;  1RCH A;  4KB1 A;  3MXM A;  3SUO A;  1LAV A;  1VRT A;  1UOC A;  1FXX A;  4CHN A;  3PO5 A;  2FC0 A;  3DI6 A;  2ZD1 A;  3M8S A;  3WNH A;  3OYD A;  4F2S A;  4CFA A;  3S3O A;  4AHC A;  1EP4 A;  3ZT1 A;  3QEI A;  5HLF A;  4W5T A;  1C1A A;  3B6P A;  5K14 A;  2GV9 A;  4DSL A;  1WSE A;  3SUQ A;  4KPY A;  3VA0 A;  3I0R A;  3OJU A;  4KHW A;  4KHY A;  1TL1 A;  1Z26 A;  2G8I A;  3KIO A;  1WN7 A;  2HHX A;  4CF9 A;  4N56 A;  4DTX A;  4DSF A;  2YV0 X;  3AVK A;  3TAN A;  4OLA A;  1VSJ A;  2F8T A;  2OPP A;  5HP1 A;  4DF4 A;  5CYM A;  1GOB A;  3ZSX A;  2HMI A;  1TK8 A;  1KTQ A;  2JLE A;  3KLH A;  4AIL C;  1C0U A;  3SQ0 A;  3AVM A;  1CXQ A;  2QXF A;  3H08 A;  4C8N A;  3ZSR A;  4CES A;  4DU3 A;  3RMD A;  3TI0 A;  4DWI A;  5D3G A;  1JXE A;  5HRS A;  1KSP A;  4KRF A;  3C6U A;  1VSD A;  2XHB A;  4CHQ A;  1GOC A;  1QHT A;  2OA8 A;  3F9K A;  1HPZ A;  3LPT A;  2XY6 A;  1S5J A;  3VQE A;  2E4L A;  4E7H A;  4OGE A;  3PX6 A;  4KHN A;  4DQI A;  4CHY A;  4DU4 A;  4JRP A;  3PV8 A;  4H8K A;  1B92 A;  4J2B A;  1WAF A;  1HMV A;  2O4G A;  2JGU A;  4I9L A;  4E7J A;  4LH5 A;  4CIE A;  1IKX A;  3ULD A;  3A2F A;  2VWJ A;  3C6T A;  3LAL A;  3QEV A;  3IS9 A;  2HHT A;  1T05 A;  4FM2 A;  3DLR A;  3KD1 E;  1EXQ A;  4B8C A;  3DRP A;  5HRP A;  4DS4 A;  3V4I A;  4C8L A;  4HVJ A;  1LWE A;  4OJR A;  2XY7 A;  1J9A A;  1KFS A;  2G8V A;  2QK9 A;  1DTT A;  4YFU A;  1RBV A;  4E19 A;  1A5X A;  4JRQ A;  3MED A;  3HXM A;  4ELV A;  1VSE A;  1WSJ A;  3E01 A;  4KRE A;  1HYS A;  3QEX A;  3TAP A;  2I5J A;  4KB0 A;  4NCA A;  3AVA A;  1XHZ A;  4JS5 A;  1NKE A;  2YKN A;  1LW0 A;  2BAN A;  3FFI A;  3PY8 A;  3UIQ A;  1LWC A;  4DFK A;  4ID5 A;  2F96 A;  4AHR A;  3KD5 E;  4EZ9 A;  3ZSW A;  1NKB A;  1XWL A;  1C6V A;  1C0T A;  5KGW A;  3VQ6 A;  4FVM A;  4CJ5 A;  4DTJ A;  1Q8I A;  4LD0 A;  2ZQB A;  4Z4F A;  3OYB A;  3TAM A;  3SUN A;  3LP3 A;  3VQ9 A;  4CJ4 A;  4NYF A;  1JLQ A;  4BE2 A;  4OLB A;  1QQC A;  2D0A A;  3VQP A;  4E7L A;  1D9F A;  1U47 A;  3AVB A;  1L3S A;  1LV5 A;  3HVR A;  3AA2 A;  1JL2 A;  4HHT A;  3G0Z A;  3K2P A;  3K5M A;  4CGJ A;  3KLE A;  1EET A;  3TAF A;  1W0H A;  3RR8 A;  4DU1 A;  3V6D A;  1NK8 A;  3AA5 X;  1VRU A;  3SQ4 A;  5C24 A;  3CFP A;  4FJL A;  1BIZ A;  1CZ9 A;  3NF7 A;  2QKB A;  2DFF A;  1KLN A;  3KKR A;  4KO0 A;  1IG9 A;  2HND A;  4FK4 A;  4PY5 A;  3HPH A;  2E6L A;  2IC3 A;  1ASU A;  3SNN A;  1HYV A;  3QEW A;  4DFP A;  3K5N A;  4B8A B;  3MXI A;  1NK6 A;  1A5W A;  4NCG A;  3ZSV A;  2D0C A;  4Z0U A;  3S9H A;  3P5J A;  3S3M A;  3DOL A;  4KAZ A;  4M3T A;  1RT1 A;  1L3U A;  4CER A;  1YTA A;  3KJV A;  4DTO A;  1XI1 A;  4C8M A;  4AH9 A;  3SV3 A;  3PO4 A;  1S9G A;  1SL2 A;  1YVU A;  4C8K A;  2VG6 A;  3M8Q A;  3PX0 A;  3NGY A;  5CYQ A;  2DTU A;  1IKV A;  4EZ6 A;  3M8P A;  3VQ8 A;  2XY5 A;  4H4M A;  4FJ5 A;  5J2M A;  3NGI A;  1X9M A;  1J5O A;  2VG5 A;  2KFZ A;  3HO1 A;  3EYZ A;  2KW4 A;  3D45 A;  1KLM A;  3JSM A;  3TAB A;  3QER A;  2YNF A;  3U3G A;  2A1R A;  1NK0 A;  1KVB A;  4BDZ A;  4E7I A;  4GMJ B;  1T7P A;  3ZT3 A;  3CQ8 A;  4M3Z A;  1D8Y A;  2HVH A;  1WSG A;  5FRN A;  1KFD A;  1ITG A;  2KQ2 A;  4B9V A;  1EKE A;  3KK3 A;  4PWD A;  2DY4 A;  1UA0 A;  2QKK A;  1NJW A;  1NK9 A;  1JLC A;  1RNH A;  2GBZ A;  4CHP A;  4F3O A;  3CYM A;  4FJJ A;  4FCY A;  1QSS A;  1WNS A;  1YT3 A;  3RMC A;  4W5N A;  3NHG A;  4DSE A;  3ZCM A;  3V81 A;  4C8O A;  2RF2 A;  2DFH A;  3V9W A;  1BGX T;  3BDP A;  1MU2 A;  1JLE A;  1IH7 A;  4DTN A;  4IG3 A;  1U45 A;  3KLG A;  3OS1 A;  1FK9 A;  2RKI A;  3AO3 A;  3CFR A;  4E3S A;  4DFJ A;  3AVC A;  1KCF A;  2B6A A;  2YHB A;  3VQ4 A;  2OZM A;  2NUB A;  3AA4 A;  1QSL A;  4K8X A;  4FK0 A;  3KLF A;  1F21 A;  3QIO A;  4IFV A;  3VQB A;  3RRH A;  4KHU A;  4M42 A;  4AHU A;  3L3V A;  2HNZ A;  4FW1 A;  1B9F A;  1C1B A;  1QS4 A;  1TAQ A;  3K5L A;  1S1T A;  1N5Y A;  1WLJ A;  2B4J A;  3NBP A;  4N41 A;  4FXD A;  4NYN A;  1D9D A;  4FJ9 A;  1UWB A;  1WSH A;  4CK1 A;  1RBS A;  4B9T A;  1IKW A;  2YNG A;  4O0J A;  1HQE A;  3LAM A;  2ETJ A;  4Y1C A;  4W5O A;  3OYA A;  3RR7 A;  4B3O A;  1TAU A;  2KZM A;  4N47 A;  3CM5 A;  3U6F A;  2BDP A;  2BE2 A;  4FZZ A;  1S1W A;  2KZZ A;  4DSI A;  3VN5 A;  5C25 A;  1NOY A;  1LAW A;  4CF2 A;  3EY1 A;  3AVH A;  1RTJ A;  3HST B;  3ZT0 A;  2HHW A;  4FLW A;  3HYF A;  1TL3 A;  1RT5 A;  2IGI A;  3P83 D;  4L8R B;  3OYC A;  1RBU A;  3AO4 A;  1S1U A;  2Z1I A;  4OKE A;  3VQ5 A;  4B9M A;  4N76 A;  1C0M A;  4Y1D A;  1YTU A;  4F3T A;  4OPJ A;  3LP2 A;  3WNF A;  5HRN A;  4FM1 A;  4CIG A;  3RRG A;  3RMB A;  4KHS A;  4FJK A;  4FYD A;  1B9D A;  4FM0 A;  2FBX A;  2OPS A;  2RN2 A;  3MEG A;  2KTQ A;  4M41 A;  5SWM A;  1BI4 A;  1KVA A;  3DLE A;  3V1R A;  2EHG A;  3HVT A;  5KTQ A;  1NK4 A;  1RTH A;  3AO1 A;  3AV9 A;  4I2Q A;  4MQ3 A;  1VSM A;  3V9X A;  3I0S A;  4FLT A;  4CEF A;  1JLF A;  3SYZ A;  3HL8 A;  4EP4 A;  3SPZ A;  3HP9 A;  1TK5 A;  3QIP A;  4R5P A;  1UA1 A;  4QCL A;  2OZS A;  4CEB A;  3NFA A;  3AVJ A;  4CF0 A;  2P5G A;  1L5U A;  1S1V A;  5J2N A;  3V9S A;  2ATQ A;  5HBM A;  4W5R A;  1D5A A;  3T1A A;  4Z4H A;  4BE1 A;  4E7K A;  1U49 A;  4FZY A;  1IKY A;  3HPG A;  4HCB A;  2OPR A;  5KI6 A;  4HTU A;  3ZSO A;  1BL3 A;  2DFE A;  3MEC A;  3NH2 A;  1RDD A;  3OYG A;  4EP5 A;  4DFM A;  4IKF A;  4DLG A;  1X1P A;  1NK7 A;  4B08 A;  5I3U A;  4FJG A;  2AJQ A;  3ASM A;  4F4K A;  3L2V A;  2HW3 A;  2BGG A;  1HJR A;  2HB5 A;  3D0P A;  3V1Q A;  2IS3 A;  1HRH A;  4O5B A;  2OPQ A;  5EU7 A;  3OS0 A;  2ZE2 A;  2Z1H A;  3MEE A;  2LSN A;  3QLH A;  4CFB A;  4DS5 A;  4CED A;  4DTS A;  1Q9X A;  1WSF A;  3CG7 A;  3SCX A;  4O44 A;  1ASV A;  1RDA A;  4B9U A;  2D0B A;  1NOZ A;  1K6Y A;  3O3H A;  1U4B A;  4RG8 A;  4W5Q A;  2Y1I A;  5JS1 A;  4AHS A;  3ZT4 A;  1REV A;  4CJS A;  4QOZ B;  4O4G A;  1VSL A;  3C94 A;  4HUG A;  4CFC A;  4ZHR A;  1GOA A;  1S6Q A;  4CK2 A;  5J2P A;  1NJX A;  1TKZ A;  3OYH A;  2B5J A;  4CJE A;  4FJN A;  4N5S A;  3AO2 A;  1BI4 B;  1RDC A;  3O4Q A;  5FRO A;  1WSI A;  3ZSZ A;  4CGD A;  4DG1 A;  5J1E A;  4FLV A;  3RWU A;  4KHQ A;  3OS2 A;  3AVG A;  3OJS A;  3KKS A;  4CJP A;  3LWL A;  1Z25 A;  3OYL A;  4F2R A;  4NCB A;  4TSX A;  2YNI A;  3HPO A;  4FZX C;  2HHV A;  2XRI A;  3DLK A;  3ISN C;  1BIU A;  3AVN A;  3LAN A;  3L2U A;  1HQU A;  2PYL A;  4B9N A;  3NE6 A;  1G15 A;  4E0D A;  4CFD A;  4CEE A;  3I8D A;  2OYQ A;  3V9Z A;  3ZSY A;  4BAC A;  1R0A A;  4Z4I A;  3BGR A;  4FLX A;  3NH0 A;  2X74 A;  4BE0 A;  4DSK A;  2HHS A;  2YKM A;  4FLU A;  4E1M A;  4RW7 A;  4OGC A;  1U04 A;  4DTP A;  2PY5 A;  4OKJ A;  3CFO A;  1ZBF A;  1VK0 A;  4PA1 A;  3LDS A;  5CZ2 A;  4CIF A;  4KV8 A;  1IO2 A;  1XHX A;  3DLG A;  3MAQ A;  1NJZ A;  4I7F A;  4DTU A;  4ZTJ A;  2XY8 A;  3TR8 A;  5I42 A;  3VQA A;  3TAQ A;  1TGO A;  2VWK A;  1QSY A;  4KI6 A;  4CF1 A;  5JS2 A;  3F73 A;  2GUI A;  1TVR A;  4ICL A;  4CJL A;  3OVN A;  3SZ2 A;  4Z4E A;  5SZT A;  4CJF A;  4O55 A;  3HM9 A;  1CZB A;  4O0I A;  1JLA A;  4M3U A;  4OVL A;  3S3N A;  4CHO A;  1NK5 A;  1XC9 A;  4FLZ A;  1S6P A;  3QES A;  2P51 A;  3VQQ A;  2X6S A;  4FJM A;  3L2R A;  1SV5 A;  1S1X A;  4M3X A;  1A5V A;  4DQQ A;  4ELT A;  4DQR A;  4RW4 A;  4CJU A;  4DQS A;  2Q3S A;  1ZBL A;  4ID1 A;  3T3F A;  1LWF A;  3QET A;  2F8S A;  1Y97 A;  3OYJ A;  4Q0B A;  3P1G A;  1FKP A;  2IDO A;  3CM6 A;  3IRX A;  3QNO A;  3THV A;  2WOM A;  4CK3 A;  1ZYQ A;  3M8R A;  5FDL A;  4Z4C A;  2A1S A;  4CEA A;  4CJQ A;  4CF8 A;  3JYT A;  2X6N A;  1X9W A;  4KTQ A;  1SKR A;  4CJW A;  3V9U A;  2HHQ A;  1RIL A;  1O1W A;  3LZJ A;  1VSF A;  1FKO A;  3RMA A;  3L8B A;  3IAY A;  3O4N A;  1RT2 A;  4JLH A;  5KRS A;  4AHT A;  3QNN A;  1U48 A;  1C1C A;  3NDK A; 
#chains in the Genus database with same CATH topology
 1VQP N;  1N8R O;  3HZ6 A;  2GWK A;  1BIS A;  3LDN A;  3SQ2 A;  4FK2 A;  4DHY A;  3WNE A;  1BCM A;  4JI5 K;  4J2E A;  3T69 A;  1RGI A;  2W42 A;  3SQ1 A;  1JLG A;  4IFY A;  3VTI A;  4ZTF A;  4LY7 A;  4A5B A;  3J81 O;  3HM8 A;  3WQT A;  3VA3 A;  3O3G A;  4Q5V A;  4BRI A;  5M1K A;  1CLQ A;  3V1O A;  4CJV A;  3J7Y P;  3TAR A;  4O8U A;  1GLD G;  1NGC A;  2GX9 A;  3J8A A;  4CZI A;  5J2Q A;  2HVI A;  3OYF A;  4B9S A;  2IOC A;  4FWR A;  1WAJ A;  4FWQ A;  2HNY A;  1Q7Y O;  3IDH A;  3ZX0 A;  4B3S K;  4A5A A;  3DMJ A;  5KPZ A;  4KH6 A;  3WEE B;  2YNH A;  1QTM A;  3GL1 A;  1VSI A;  5HRR A;  3KK2 A;  4CZL A;  3TPQ A;  2PYJ A;  1K8K A;  3W3D A;  3NF6 A;  1TK0 A;  1RT6 A;  3KLI A;  4JI8 K;  1JLB A;  1YJ9 N;  4LF4 K;  3PSI A;  3LP1 A;  3HK2 A;  4GVM A;  3EKS A;  2WON A;  1NM1 A;  4BDY A;  3U3Y A;  1JJ2 M;  4M3R A;  3C95 A;  1HYZ A;  2XO7 A;  4B1U B;  2G8U A;  4IDK A;  5BRD A;  4DV7 K;  4IOX A;  2CGJ A;  3FGU A;  5ELZ A;  5AQX A;  3VEN A;  4F8R A;  4DV5 K;  4A61 A;  2QWL A;  2ITG A;  3QIC A;  3E9O A;  4WFA L;  3LAK A;  4FJ7 A;  1TV6 A;  3TWH A;  5LMN K;  1Z05 A;  2Z1J A;  3R8E A;  1BCO A;  2AP1 A;  3B6O A;  1VAZ A;  4O5F A;  2RE2 A;  3E9P A;  3M6G A;  3NCI A;  4H4O A;  5KRT A;  3LWM A;  4CGI A;  3AAR A;  3L2W A;  2ITM A;  3VQD A;  4KTW A;  3WNG A;  4DCH A;  2UU9 K;  4KH4 A;  3HBT A;  3KK7 A;  4IJA A;  3HJF A;  3VGM A;  2QWM A;  2G8K A;  4E89 A;  3LP0 A;  5JLF A;  3THY B;  4LSN A;  3G71 N;  2JWL A;  1X9J A;  1Q18 A;  4CHN A;  5AZI B;  3H46 O;  2HBK A;  4F2S A;  4CFA A;  3S3O A;  2P9P A;  1C1A A;  4DSL A;  4AF1 A;  1WN7 A;  1NMD A;  5M1F A;  1NU0 A;  1MWM A;  3AVK A;  4H0V B;  4CZJ A;  5HP1 A;  1IBL K;  4DF4 A;  1H1V A;  4BRF A;  1TK8 A;  4BC3 A;  3KLH A;  4ILJ A;  1C0U A;  1CXQ A;  2QXF A;  3ZSR A;  4FWP A;  2D4W A;  3TI0 A;  4LF6 K;  1JXE A;  1LCU A;  5HRS A;  1KSP A;  3ID8 A;  4KRF A;  3WXL A;  1VSD A;  3F9K A;  1KC8 O;  3PX6 A;  5M1P A;  4DQI A;  4OX9 K;  4GV9 A;  4H8K A;  1ZC6 A;  2JGU A;  4LF5 K;  4LH5 A;  3N4P A;  3A2F A;  1C0G A;  1EXQ A;  1J9A A;  1KFS A;  3THW B;  4YFU A;  1DKG D;  1RBV A;  5MLC Q;  3SJH A;  4CZF A;  3HXM A;  1VSE A;  1WSJ A;  3E01 A;  2E2N A;  3L0Q A;  3O80 A;  3AVA A;  3D2F A;  3E1Y A;  3J7A P;  1GLC G;  2F96 A;  1NKB A;  3ZET B;  4CJ5 A;  4DTJ A;  1D4X A;  2ZQB A;  3TAM A;  3LP3 A;  4CJ4 A;  3NMU A;  4BE2 A;  5FPM A;  2D0A A;  3P39 A;  3HVR A;  3MWT A;  2HHH K;  3KLE A;  1EET A;  1W0H A;  1NK8 A;  4RTF D;  1CZ9 A;  1KLN A;  4FK4 A;  4WQ4 C;  3ULE A;  1YJN N;  3SNN A;  3QEW A;  1HUX A;  4NCG A;  3ZSV A;  4XH4 A;  3KJV A;  4WQ5 C;  4GKK K;  1XI1 A;  3SBG A;  2P9S A;  1SL2 A;  2F7T A;  3VGK A;  1ATS A;  3O6W A;  3VF4 A;  4A2B A;  5GAE P;  1NG9 A;  3EYZ A;  3D45 A;  3QER A;  4BG8 A;  1LOT B;  4M3Z A;  1D8Y A;  4PKH A;  1ITG A;  4EFH A;  2KQ2 A;  4BRE A;  1XMO K;  1EKE A;  1UA0 A;  1JLC A;  2P9U B;  3LM2 A;  1NMN A;  1WNS A;  1QSS A;  4W5N A;  3NHG A;  3BDP A;  3V9W A;  3KLG A;  1FK9 A;  1EO1 A;  4K0K K;  4E3S A;  2OZM A;  2B6A A;  4FWN A;  2ZF5 O;  3AA4 A;  3QIO A;  4IFV A;  3BZK A;  3L3V A;  2HNZ A;  3MX2 A;  3UKU B;  1QS4 A;  2GEL A;  4NYN A;  5AQP A;  2YHX A;  1GLA G;  3OYA A;  1HQE A;  3TSQ A;  4B3O A;  4W5O A;  3BP8 A;  4OPA A;  4JD2 A;  5GAD P;  3HOS A;  3VN5 A;  3HST B;  3ZT0 A;  4GY2 B;  2F4V K;  1RBU A;  2Z1I A;  4B9M A;  4N76 A;  4B9Q A;  1C0M A;  4Y1D A;  5FPN A;  1YTU A;  4F3T A;  4C1N I;  2FLO A;  4MO4 A;  4H5V A;  3RRG A;  1GLF O;  1WB9 A;  5AZJ B;  3FLC O;  3H1Q A;  3O9T A;  3GBT A;  4MQ3 A;  1SZ2 A;  1ATR A;  3I0S A;  2UUC K;  5AQI A;  3C7N A;  1TK5 A;  4IZ9 A;  4DR7 K;  3LDP A;  2OZS A;  3NFA A;  1L5U A;  1S1V A;  3FFK B;  5J2N A;  2EWS A;  2ATQ A;  2NRW A;  5EVZ A;  3F2K A;  4BE1 A;  1U49 A;  4FZY A;  1TUU A;  1IKY A;  4HCB A;  1W97 L;  4NO7 A;  5KI6 A;  3ZSO A;  1BL3 A;  2DFE A;  3MEC A;  3NH2 A;  5B8H A;  1VQ7 N;  4FJG A;  1S72 N;  2AJQ A;  2KHO A;  2NRH A;  3ASM A;  1K73 O;  2BGG A;  2IS3 A;  3CER A;  5AQV A;  1T44 A;  1YHQ N;  3ATV A;  3MEE A;  4IWV A;  2E20 A;  3SCX A;  3PSF A;  4B9U A;  3O3H A;  1U4B A;  1K6Y A;  2Y1I A;  5DM7 L;  5AQZ A;  1NGH A;  4O4G A;  1DEJ A;  3C94 A;  4CFC A;  3MMV A;  1GOA A;  5J2P A;  3CCR N;  5GIN A;  5AQO A;  4CJE A;  3CQX A;  5E84 A;  1BI4 B;  3ENB A;  4FLV A;  4CGD A;  3QDK A;  3AVG A;  3OYL A;  2HHV A;  2XRI A;  3ISN C;  3O08 A;  1G15 A;  5JMV A;  4E0D A;  4FOI A;  4FLX A;  3MWP A;  3NH0 A;  2W40 A;  4BE0 A;  4DSK A;  4FLU A;  3Q7B A;  2PY5 A;  3CFO A;  1ZBF A;  5CZ2 A;  4JI4 K;  1KAX A;  3MAQ A;  4ZTJ A;  3TAQ A;  2VWK A;  1QSY A;  3RSE A;  4Z4E A;  2GUI A;  1TVR A;  4ISG A;  2P9I A;  3HM9 A;  1Q81 O;  4O55 A;  1G99 A;  4M3U A;  3S3N A;  4FLZ A;  3SK3 A;  3QES A;  2P51 A;  3QFP A;  4FPA A;  4NLB A;  3ZX3 A;  4AM6 A;  4ELT A;  1SAZ A;  3DXK A;  5GAH P;  4JK8 A;  4B1V A;  3T3F A;  1LWF A;  4LFC K;  2F8S A;  1Y97 A;  3P1G A;  1BUP A;  2IDO A;  3OW2 M;  4CK3 A;  1ZYQ A;  5FDL A;  4CEA A;  4CJQ A;  3JYT A;  3V9U A;  1O1W A;  1VSF A;  2QTD A;  3JS6 A;  3L8B A;  4JI3 K;  1BDG A;  4BRD A;  1RT2 A;  3QNN A;  1C1C A;  3NDK A;  1TYQ A;  3NF9 A;  3O9U A;  5AR0 A;  1CXU A;  2FBY A;  3D2E B;  4AHV A;  1LW2 A;  3VGL A;  1KRP A;  4BRO A;  1QE1 A;  3ZEU B;  3ZT2 A;  4AQY K;  3SUP A;  1FW6 A;  5BR8 K;  4KKO A;  1TKT A;  3EZW A;  4IBN A;  5AQL A;  4DR5 K;  3RTV A;  5DK5 A;  2GUP A;  2HHU A;  4Z4G A;  1J53 A;  4JHD A;  2G8W A;  3DAW A;  1OH6 A;  2P9L B;  3M3Z A;  1SKW A;  3UE5 A;  4PQU A;  2FSJ A;  1VQL N;  3IKM A;  4MO5 A;  4CJ3 A;  1EX4 A;  2R7Y A;  3KK1 A;  3CC2 N;  4LC9 B;  3OYE A;  3K59 A;  2KFN A;  2O8E B;  4BDP A;  1I39 A;  4FJH A;  2CGL A;  2WFB A;  3A5M C;  4CEQ A;  1S9E A;  1I3A A;  5JVG L;  3G10 A;  4DSJ A;  1NJI O;  1VSH A;  1RT3 A;  4DR2 K;  3JXU A;  3CQY A;  4FJX A;  3LDQ A;  3ITH A;  3QEP A;  4DLE A;  2NRR A;  3SMP A;  4CCH A;  2P9N A;  4WYB A;  3NH1 A;  3O3F A;  4B9L A;  3L3U A;  5E41 A;  3HP6 A;  2E6M A;  1BG3 A;  3CHW A;  4BQZ A;  1HNW K;  1X9S A;  4HUE A;  3VMF B;  1TKD A;  4FWK A;  1T03 A;  1QHA A;  3LL3 A;  3KTQ A;  3CJB A;  5BRF A;  3W0L A;  5HRO A;  4HTL A;  2I7P A;  3CCM N;  3OYK A;  3AVF A;  4FW2 A;  4JI6 K;  4RW6 A;  3FZH A;  3SAH A;  4BR7 A;  4M3W A;  2YCH A;  4MFB A;  4KHP K;  1SL0 A;  4B1W B;  4K8Z A;  5HOO A;  4GV6 A;  3LM9 A;  1OKJ A;  3QIN A;  4EHT A;  1T6C A;  4QAG A;  4J2A A;  1NKC A;  1OVQ A;  4KI4 A;  1TKX A;  4OKK A;  1RFQ A;  2HST A;  3H3O B;  4IG0 A;  1ZBS A;  3SAF A;  3SV4 A;  2P5O A;  4DMN A;  1ATN A;  5KGX A;  3NAE A;  3BZC A;  1L3T A;  4CGG A;  1L3V A;  1W9H A;  3UKR A;  1HNI A;  1K8K B;  3QO9 A;  1KVC A;  5JLH A;  4CJR A;  4KTZ A;  4KFB A;  2V7Y A;  4JKG A;  4KB1 A;  1VRT A;  1UOC A;  4QS8 A;  2FC0 A;  3DI6 A;  4NLC A;  3M8S A;  3WNH A;  1XNQ K;  5HLF A;  4W5T A;  1WSE A;  1BA1 A;  4KPY A;  3OJU A;  4KHW A;  4B1X B;  4N56 A;  4DTX A;  1N36 K;  2D0P A;  3D7E O;  1VSJ A;  2IIR A;  2ZGZ A;  2QXL A;  3SQ0 A;  4B1Z A;  3H08 A;  5CHI A;  5GAG P;  3RMD A;  4PL7 A;  4JNE A;  3C6U A;  3IUC A;  3EKU A;  2XHB A;  4CHQ A;  1GOC A;  1QHT A;  2OA8 A;  2XY6 A;  1S5J A;  3VQE A;  4E7H A;  3A5L C;  5AQR A;  4CHY A;  4ILH A;  2O8F B;  3CCV N;  4JRP A;  3L4I A;  1WAF A;  2O4G A;  3G4S N;  4CIE A;  1IKX A;  1J5E K;  4BR9 A;  3TTC A;  3ULD A;  4K41 A;  3C6T A;  3IS9 A;  1T05 A;  2O8B A;  3DLR A;  4BRN A;  4LFA K;  3V4I A;  4C8L A;  1E4G T;  5BN8 A;  4BR4 A;  3NVK A;  1HPM A;  3MED A;  3MN6 A;  3O1W A;  4YOR A;  3QEX A;  2YX6 A;  3VF6 A;  4NCA A;  3MCA B;  3M1F A;  2YKN A;  3FFI A;  3L4Q A;  4ID5 A;  2ASM A;  2P9P B;  3AAQ A;  3KD5 E;  2J4R A;  5KGW A;  4Z4F A;  4FVM A;  1NNE A;  5AQH A;  4ISF A;  3AY9 A;  3F9M A;  1JLQ A;  4OLB A;  3VQP A;  1U47 A;  3AVB A;  1L3S A;  3CJ1 A;  1DT9 A;  4BG9 A;  3K5M A;  3TAF A;  2OTJ N;  1JCE A;  4YDU C;  3V6D A;  1VRU A;  3SQ4 A;  4A62 A;  4X62 K;  4FJL A;  1BIZ A;  3KKR A;  2PFU A;  4PY5 A;  3HPH A;  3CXC M;  3KVG A;  1HYV A;  1NK6 A;  1XNR K;  1A5W A;  3P5J A;  3S3M A;  1RT1 A;  4CER A;  1YTA A;  3N4Q A;  4DTO A;  1YVU A;  2DTU A;  3NGY A;  2IVO A;  4EZ6 A;  4H4M A;  5C0Y A;  5J2M A;  3NGI A;  1J5O A;  4CD1 A;  4FSV A;  5AQS A;  5BRH A;  1KLM A;  3JSM A;  3TAB A;  3U3G A;  3CET A;  4E7I A;  2HVH A;  1WSG A;  3D2F B;  5FRN A;  5C2D A;  3KK3 A;  4PWD A;  2DY4 A;  3U9D A;  2GBZ A;  4CHP A;  4EIA A;  4F3O A;  3CYM A;  4FJJ A;  1XQS C;  2Q97 A;  1YT3 A;  4DSE A;  2RF2 A;  2DFH A;  1BGX T;  1JLE A;  1NWK A;  3I55 N;  4IG3 A;  3OS1 A;  2RKI A;  3FZF A;  3CFR A;  2YHB A;  3VQ4 A;  2Q2R A;  1MWK A;  1F21 A;  4DR3 K;  5M1Q A;  4JI1 K;  1ZXO A;  1TAQ A;  3ULE B;  3K5L A;  1N5Y A;  1WLJ A;  4N41 A;  3NBP A;  4FXD A;  4FL9 A;  1E4F T;  1DGK N;  1RBS A;  3CJC A;  1IKW A;  2YNG A;  4O0J A;  4B9T A;  3VES A;  4Y1C A;  4XEI A;  2BDP A;  4FZZ A;  3P38 A;  4CVN E;  1HNX K;  2P9S B;  2QWQ A;  4DSI A;  2KZZ A;  5C25 A;  2VGM A;  1LAW A;  4CF2 A;  1RTJ A;  2HHW A;  3FE1 A;  1RT5 A;  3P83 D;  3AO4 A;  2UXB K;  4OPJ A;  3LDO A;  3J7Z O;  4BRG A;  4FM1 A;  4KHS A;  2VCP A;  4FJK A;  3EE9 A;  4OPH A;  4LFB K;  2Q0R A;  4WFN L;  4M41 A;  1YI2 N;  4FPB A;  4RCH A;  3V1R A;  3KHY A;  2EHG A;  3O1B A;  1NK4 A;  1RTH A;  3AV9 A;  4I2Q A;  4E1J A;  4IXC A;  2NLX A;  3SYZ A;  1IV0 A;  3HL8 A;  3HP9 A;  4R5P A;  1V4S A;  1UA1 A;  3KZB A;  4CEB A;  5AQJ A;  3V9S A;  4FVU A;  3T1A A;  2Q0U A;  4E7K A;  5BR9 A;  4HTU A;  1RDD A;  4DFM A;  4IKF A;  3ZX2 A;  4B08 A;  5I3U A;  1QVG M;  2QM1 A;  3BUZ B;  1HJR A;  2HB5 A;  3WQU A;  4O5B A;  5BRE A;  5EU7 A;  1W2B M;  2ZE2 A;  1OH7 A;  2LSN A;  3MN5 A;  4BRL A;  4DS5 A;  2UYT A;  3GDQ A;  3CG7 A;  3THY A;  4MDB A;  1ASV A;  5AQK A;  2D0B A;  3I56 N;  3ZT4 A;  1VSL A;  4FO0 A;  4WQ4 A;  4HUG A;  4ZHR A;  1TKZ A;  3OYH A;  4RWT A;  4N5S A;  3E66 A;  3G6E N;  1WSI A;  2I7N A;  2P9K B;  4WQ5 A;  4KHQ A;  3OJS A;  3F5T A;  4NCB A;  3HPO A;  4FZX C;  2ASO A;  5AQU A;  3C7N B;  1HQU A;  2PYL A;  3CJ7 A;  3TTD A;  3I8D A;  1VQ9 N;  4K42 A;  3EL2 A;  2X74 A;  4FWL A;  4DV4 K;  4OGC A;  4DTP A;  5C15 A;  3VF2 A;  3MN9 A;  1VK0 A;  4PA1 A;  4KV8 A;  1IO2 A;  1XHX A;  4I7F A;  3EO3 A;  4WF9 L;  3PIO L;  3MX5 A;  1X3M A;  5JS2 A;  2QK9 A;  4WFB L;  4CJF A;  1CZB A;  1JLA A;  3K9K A;  2F9W A;  4KH5 A;  4BR2 A;  5E26 A;  5TKW A;  5KPR A;  3VQQ A;  3THW A;  2X6S A;  4YHH K;  4X64 K;  3L2R A;  1SV5 A;  1S1X A;  3QBW A;  4M3X A;  3ATU A;  3WXK A;  4BVP A;  4DQQ A;  3ID6 A;  4ISE A;  4ID1 A;  1OH5 A;  3CM6 A;  3IRX A;  2WUS A;  3THV A;  2WOM A;  2W6L A;  3M8R A;  5A2Q O;  4DV3 K;  1X9W A;  3KWI A;  2HHQ A;  1RIL A;  1R59 O;  5LJV A;  2CH5 A;  1KXP A;  4V19 S;  1U48 A;  4JKB A;  1KD1 O;  3BF3 A;  1YIJ N;  3SI6 A;  2NNW A;  2D1K A;  2D5R A;  3VER A;  1DLO A;  1RTD A;  4PKG A;  4FYD A;  1BHL A;  2O4I A;  2Q36 A;  2E8A A;  1RBR A;  5FPD A;  1NGA A;  3DYA A;  4FWS A;  1VQ8 N;  4GW6 A;  3PX4 A;  3C65 A;  5KQD A;  4BWM A;  3M5R A;  3DM2 A;  3VTH A;  3RSE B;  3PUF A;  2BTF A;  2P9I B;  3DWL A;  1N6Q A;  3LPU A;  4CBU A;  4WE1 A;  2E88 A;  5CZ1 A;  1SQK A;  4JS4 A;  3C0B A;  1YVN A;  1FJG K;  5EXW A;  2V51 B;  3A5O C;  4H03 B;  4JKD A;  2W41 A;  3DXK B;  3EN9 A;  5EX5 A;  4GVE A;  2FBV A;  1KAY A;  2EX3 A;  3AVL A;  2WC9 A;  3ZLJ A;  3K5O A;  3ZSQ A;  2X78 A;  4JI2 K;  3T19 A;  3AA3 A;  1SUQ A;  3HT3 A;  4CE9 A;  1TYQ B;  3OA9 A;  3CC7 N;  4CHZ A;  4JN4 A;  5AQM A;  4ELU A;  4CZH A;  3OYI A;  1J6Z A;  5C42 A;  5JVH L;  2QWO A;  3U8X A;  2NRX A;  3UKU A;  4CJT A;  3SPY A;  1YXQ A;  1JKH A;  4JHD B;  4CEZ A;  4M45 A;  3C6A A;  2O8C A;  4C23 A;  3E9L A;  3SMS A;  4RW8 A;  2G8F A;  3L2Q A;  1T6D A;  4LF9 K;  3QB0 A;  3NF8 A;  2HBM A;  1Q9Y A;  4OO1 J;  4JKF A;  4FJI A;  2CGK A;  3CCL N;  2UXD K;  5AQY A;  3TAE A;  3H45 C;  4DF8 A;  4E1N A;  3OY9 A;  3K58 A;  2ASP A;  3L6Q A;  4CEO A;  4HCC A;  3U9Z A;  4BGA A;  1T8E A;  4RW9 A;  4DTM A;  4I6M A;  1BQM A;  3OBW A;  3CF5 L;  3THX A;  4PUO A;  1RTI A;  3FZK A;  1RCH A;  3MXM A;  2P9N B;  3SUO A;  3VEO A;  1FXX A;  1BU6 O;  3CI5 A;  2ZD1 A;  5LMU K;  4A59 A;  3WUH A;  4HWI A;  2QI2 A;  3ZT1 A;  3SLC A;  3B6P A;  3H1V X;  4U67 L;  3AAP A;  3SUQ A;  4B3M K;  3VA0 A;  3I0R A;  2G8I A;  1TL1 A;  3O9R A;  1IJJ A;  3VEV A;  4DSF A;  1HR0 K;  2YV0 X;  5EOY A;  3TAN A;  4OLA A;  2E1Y A;  2QWN A;  2OPP A;  5AFU A;  5CYM A;  3ZSX A;  4DV2 K;  4C8N A;  4CES A;  4DU3 A;  1NGI A;  2V52 B;  2A6A A;  1N33 K;  1HPZ A;  4OGE A;  4KHN A;  2O8D B;  4DU4 A;  4J2B A;  4I9L A;  1HMV A;  4E7J A;  3I8B A;  1M1K O;  2A5X A;  2VWJ A;  5C10 A;  2HHT A;  5AQQ A;  1OH8 A;  2UXC K;  4FM2 A;  4DS4 A;  4CZE A;  3T1Y K;  4F9O A;  4A57 A;  2G8V A;  1DTT A;  3CME N;  4E19 A;  3UKR B;  2HF4 A;  4JRQ A;  4KRE A;  4ELV A;  2KKZ A;  4JKG B;  2I5J A;  4H5R A;  1XHZ A;  1NKE A;  4A2A A;  3EE8 A;  2BAN A;  1RDW X;  3PY8 A;  4DFK A;  1VQ5 N;  1XWL A;  3FZL A;  1Q8I A;  4LD0 A;  1SS6 A;  4YOU A;  3OYB A;  3SUN A;  3VQ9 A;  4NYF A;  1W7A A;  1BOT O;  1QQC A;  2HBL A;  5C12 A;  4E7L A;  3KWG A;  4DKW A;  2YHY A;  3AA2 A;  1JL2 A;  4HHT A;  3G0Z A;  3RR8 A;  4DU1 A;  3CCE N;  4QS9 A;  5C24 A;  1QQO A;  3BF1 A;  3CFP A;  4CD3 A;  1O13 A;  2QKB A;  2DFF A;  4KO0 A;  3A0I X;  4UY8 O;  1NGE A;  1HKC A;  1ASU A;  3TSP A;  4B8A B;  3K0S A;  2UUA K;  4PKI A;  4Z0U A;  3S9H A;  4KAZ A;  4M3T A;  1VQN N;  3DOL A;  1L3U A;  2ZM6 K;  4EHU A;  3SV3 A;  5TKY A;  3PO4 A;  1S9G A;  2VG6 A;  3M8Q A;  4B3R K;  4JKE A;  2O8B B;  3B8A X;  3PX0 A;  5CYQ A;  2ZGY A;  1MA9 B;  1IKV A;  2XY5 A;  3VQ8 A;  1HJO A;  4FJ5 A;  1X9M A;  1S22 A;  4YOY A;  2KFZ A;  3HO1 A;  3R1X A;  2KW4 A;  4JEP A;  2A1R A;  1KVB A;  4BDZ A;  4GMJ B;  1KFD A;  3QBX A;  4B9V A;  3AGK A;  1NJW A;  1NK9 A;  4U7B A;  4FCY A;  3RMC A;  4C8O A;  1IH7 A;  4DTN A;  1U45 A;  3AO3 A;  4DFJ A;  3AVC A;  1KCF A;  2NUB A;  1QSL A;  4K8X A;  4KHU A;  3VQB A;  4XH5 A;  4BR0 A;  3RRH A;  4AHU A;  1B9F A;  1S1T A;  1D9D A;  4FJ9 A;  2AA4 A;  1WSH A;  3HI0 A;  4MDA A;  3EEQ A;  3RR7 A;  3GOI A;  1GLJ O;  4N47 A;  2BE2 A;  1S1W A;  2HF3 A;  2NRZ A;  4H5W A;  1NOY A;  4R79 A;  2BUP A;  2QWP A;  3AVH A;  3WXJ A;  3T7Z A;  3HYF A;  4LF7 K;  3AGR A;  2IGI A;  4JKA A;  1WOQ A;  2FSK A;  3S41 A;  3WNF A;  5HRN A;  1ESV A;  3DXM A;  3OHR A;  4CIG A;  4YOV A;  3RMB A;  2HOE A;  4KBO A;  2OPS A;  3OTO K;  3MEG A;  3P31 A;  1S3X A;  2A41 A;  3WT0 A;  5SWM A;  2OAN A;  3DLE A;  1NGF A;  3HVT A;  3BY5 A;  5KTQ A;  1VSM A;  3TTF A;  4CEF A;  1JLF A;  1U2V A;  1NGJ A;  4EP4 A;  2QA4 N;  3CCU N;  4QCL A;  3H3N O;  3J80 O;  4DR1 K;  2P5G A;  5HL7 L;  4BRA A;  4LF8 K;  2VYP A;  1GLL O;  5HBM A;  4W5R A;  1U6Z A;  4Z4H A;  1P8Z A;  3HPG A;  2NZT A;  2OPR A;  4M7X A;  5F2R A;  4DV0 K;  4EP5 A;  4DR6 K;  1X1P A;  1NK7 A;  4NB4 A;  1YUW A;  1XC3 A;  3L2V A;  3CIP A;  3IFR A;  3MK6 A;  2OPQ A;  5AQN A;  1GLE G;  4CFB A;  4XH1 A;  5M1N A;  3O9S A;  4CZM A;  4O44 A;  1RDA A;  2WTU A;  1NOZ A;  2YJF A;  4RG8 A;  4YDU A;  2Q31 A;  3R9P A;  3TSU A;  4Z94 A;  1HNZ K;  4X65 K;  3CPW M;  4CJS A;  5IWA K;  3T1H K;  1Q86 O;  1NJX A;  4CK2 A;  3O8M A;  2B5J A;  4PL8 A;  3DLL L;  3OBY A;  4YY3 K;  1RDC A;  3O4Q A;  5FRO A;  3U4L A;  3ZSZ A;  4DG1 A;  3RWU A;  3WXI A;  4CJP A;  1Z25 A;  4TSX A;  2YNI A;  2E5L K;  1BIU A;  3AVN A;  3LAN A;  4B9N A;  3NE6 A;  2OYQ A;  4CEE A;  1XUP O;  5BPN A;  3V9Z A;  3FZM A;  3BGR A;  2ZJP L;  4Z4I A;  4JK7 A;  2YHW A;  4IDH A;  4K43 A;  2HHS A;  4RW7 A;  1U04 A;  4EAH D;  4BRK A;  4OKJ A;  2IVP A;  2O8F A;  3DLG A;  2YI1 A;  3CCS N;  3QFU A;  3IMX A;  5I42 A;  2PAV A;  3TR8 A;  1TGO A;  4ICL A;  3RVC A;  4O0I A;  4OVL A;  4CHO A;  1NK5 A;  1XC9 A;  2OCE A;  1A5V A;  4DQR A;  4CJU A;  1QQM A;  3WEE A;  1ZBL A;  5F1X A;  3OYJ A;  1OVY A;  1CZA N;  1FKP A;  3QNO A;  2FF6 A;  3WXM B;  4Z4C A;  2A1S A;  3MN7 A;  4KTQ A;  1SKR A;  4CJW A;  4BC5 A;  5LL6 Z;  3LZJ A;  1FKO A;  3MCP A;  1EQY A;  3O4N A;  4AHT A;  3HOT A;  4CJK A;  3CCQ N;  1JXB A;  3ALY A;  1VQ6 N;  4IOA L;  3VOV A;  5GIO A;  2YJE A;  3IG1 A;  3DOK A;  1I94 K;  1HKB A;  4H0P A;  2G8H A;  1YIT N;  3DRR A;  4H5T A;  1ZBH A;  5AFU H;  3VQ7 A;  2P1J A;  1NJY A;  1QVF M;  3DRS A;  4BRH A;  1ASW A;  3VQC A;  3CPE A;  3H6E A;  4DQP A;  3EZ5 A;  1UAX A;  5KPT A;  1J54 A;  1RT7 A;  3SJJ A;  3K57 A;  1BQN A;  4G1Q A;  2E2P A;  1SKS A;  4FLY A;  1K9M O;  3AO5 A;  4M63 C;  4LH4 A;  4YNQ A;  4NXN K;  4OPK A;  4DUY K;  3CCJ N;  4CGF A;  2A40 A;  3R3L A;  1RT4 A;  4JD2 B;  3TAG A;  1Y64 A;  1DTQ A;  3VEX A;  3VET A;  4M3Y A;  2RPI A;  5CY4 A;  4JYA K;  2H3G X;  3DJC A;  1YAG A;  3OYN A;  5DMR A;  4HUF A;  1WBD A;  1ZBU A;  5AZI A;  1JL1 A;  2Z1G A;  3NGZ A;  5LY3 A;  1SL1 A;  3DLH A;  1VSK A;  4LSL A;  4MLH A;  4I9Q A;  3A8Y A;  1V4T A;  4BC2 A;  4IJN A;  1RBT A;  4J2D A;  3G25 A;  4CEC A;  4CJ7 A;  1ZBI A;  5FRM A;  1E3M A;  4BRC A;  4BY9 C;  3UB5 A;  2PZS A;  3FR0 A;  4BWJ A;  3OYM A;  1HNV A;  1BO5 O;  1KAZ A;  2IAJ A;  5AQF A;  4DTR A;  3AVI A;  4FWM A;  4L3Q A;  1RDB A;  4XIU A;  5ADX A;  4FJ8 A;  4GNI A;  2ZWH A;  2DPN A;  1HLU A;  3ENH A;  2Y1J A;  4DB3 A;  4UQG A;  4I2P A;  4BRQ A;  3CJ9 A;  1TUY A;  4CW7 B;  1K8A O;  4CGH A;  2FBT A;  3VEY A;  2VG7 A;  3MXJ A;  3DLB A;  3D6R A;  3Q7C A;  5CE3 A;  2NRT A;  4ILG B;  3LZI A;  5T7B A;  2A42 A;  2YHA A;  3GE1 A;  1LAV A;  1XMQ K;  3PO5 A;  2HMP A;  4DR4 K;  1HX1 A;  3OYD A;  4H0X B;  4AHC A;  4IO9 L;  1JCG A;  1EP4 A;  4BC4 A;  3QEI A;  5KQ8 A;  5K14 A;  2GV9 A;  1JCF A;  4G9Z A;  3ZET A;  3NVM A;  5BPM A;  4KHY A;  1Z26 A;  3KIO A;  2HHX A;  4CF9 A;  3O4W A;  1KQS M;  4B3T K;  2F8T A;  2QWR A;  5AQW A;  1GOB A;  4DV6 K;  2GTD A;  2HMI A;  2O8C B;  1KTQ A;  2JLE A;  4AIL C;  4AM7 A;  3AVM A;  1QZ6 A;  4DWI A;  1Q82 O;  5D3G A;  3BEX A;  4DQ8 A;  3VPZ A;  4CZG A;  4JKC A;  2BH1 A;  2Q1N A;  2E2Q A;  3LPT A;  4CI6 A;  2E4L A;  4JAX A;  2A3Z A;  4DV1 K;  1EWQ A;  3PV8 A;  5FLX O;  1B92 A;  5C2F A;  3I33 A;  1IBM K;  4JI7 K;  3LAL A;  3QEV A;  4BVO A;  3KD1 E;  3P4I A;  4B8C A;  3DRP A;  5HRP A;  4HVJ A;  1LWE A;  4OJR A;  2XY7 A;  4I6M B;  2P9K A;  1A5X A;  1P90 A;  3THX B;  3HSC A;  1HYS A;  3TAP A;  5AQT A;  1QQN A;  4KB0 A;  3K9J A;  4O8K A;  1YF5 L;  4JS5 A;  5I9E B;  1LW0 A;  3UIQ A;  1LWC A;  2FF3 B;  2P9U A;  4AHR A;  4EZ9 A;  2HBJ A;  1NBW A;  3ZSW A;  1X3N A;  2E2O A;  1C6V A;  1C0T A;  2V7Z A;  3VQ6 A;  4BGB A;  3QML A;  1GLB G;  2FSN A;  1D9F A;  1LV5 A;  1NGG A;  3K2P A;  4CGJ A;  5BN9 A;  3AA5 X;  1RDU A;  3NF7 A;  1N34 K;  1IG9 A;  2HND A;  4Y0W A;  2E6L A;  2IC3 A;  4JK9 A;  4H0O A;  3K5N A;  4DFP A;  3MDQ A;  4WCE L;  3MXI A;  2D0C A;  1VQO N;  4BQL A;  4C8M A;  4AH9 A;  4CBX A;  2UUB K;  4C8K A;  3M8P A;  2QEX N;  2CH6 A;  2VG5 A;  3A5N C;  2YNF A;  1VQ4 N;  1NK0 A;  1HKG A;  2QW9 A;  1T7P A;  3ZT3 A;  3CQ8 A;  2VGN A;  5AZJ A;  5CR4 A;  4MLE A;  2NRV A;  3R6M A;  2QKK A;  1RNH A;  4IEE A;  3ZCM A;  3V81 A;  1MU2 A;  5AQG A;  3HRG A;  3TU5 A;  4IOC L;  4JKH A;  1WUA A;  4BRM A;  4FK0 A;  3KLF A;  4H0Y B;  2VQE K;  4M42 A;  1VHX A;  4FW1 A;  1C1B A;  2B4J A;  4H0T B;  1UWB A;  1EWR A;  4CK1 A;  4IFE A;  4IO8 A;  3LAM A;  2ETJ A;  4QS7 A;  1TAU A;  5BPL A;  2KZM A;  1BWF O;  3CM5 A;  3U6F A;  5FPE A;  4YOX A;  2PBD A;  2GEM A;  5EY4 A;  4FOE A;  2VQF K;  3C6H A;  1VQM N;  1ILY A;  3EY1 A;  3VEW A;  1YJW N;  1Z6R A;  2WBN A;  5LJW A;  4FLW A;  1TL3 A;  4J8F A;  4L8R B;  3OYC A;  1S1U A;  3VQ5 A;  4OKE A;  4GV3 A;  3LP2 A;  4X66 K;  2KLA A;  1B9D A;  5AJ3 K;  4FM0 A;  2FBX A;  2RN2 A;  1NGB A;  2KTQ A;  3O5B A;  4BRP A;  1BI4 A;  1BA0 A;  1KVA A;  4CBW A;  3PLA A;  1VQK N;  2FXU A;  3AO1 A;  3V9X A;  4FLT A;  1WBB A;  5M1O A;  3SPZ A;  3QIP A;  3ZYY X;  3AVJ A;  4CF0 A;  2F9T A;  4M7Y A;  1D5A A;  2E1Z A;  4IEI A;  3OYG A;  4DLG A;  3LDL A;  1M90 O;  4JV5 K;  2ZJQ L;  2RHK A;  1MDU B;  3VEZ A;  4F4K A;  2HW3 A;  3D0P A;  3V1Q A;  1HRH A;  2OTL N;  5GIP A;  3O9Q A;  3OS0 A;  4PHT X;  2Z1H A;  5F0X A;  2W6K A;  3QLH A;  4YOT A;  2IVN A;  4CED A;  4DTS A;  1Q9X A;  1WSF A;  2GWJ A;  4W5Q A;  4H5N A;  2D0O A;  5JS1 A;  4AHS A;  1REV A;  3DXM B;  4QOZ B;  5IT9 O;  2JWK A;  1S6Q A;  4JI0 K;  4C1N K;  4FJN A;  3AO2 A;  5J1E A;  3OS2 A;  3KKS A;  4CZK A;  3CD6 N;  1C0F A;  3LWL A;  3CMA N;  5DM6 L;  4F2R A;  2ZJR L;  1U2V B;  3DLK A;  5H1S Q;  3L2U A;  3JAM O;  3D2E A;  4CFD A;  5JIC A;  3ZSY A;  4BAC A;  3GG4 A;  3ZEU A;  1R0A A;  3SBT A;  1NGD A;  2YKM A;  4E1M A;  4DUZ K;  3LDS A;  2O8D A;  4CIF A;  2P9L A;  1NJZ A;  1IG8 A;  4DTU A;  4GKJ K;  2XY8 A;  3VQA A;  4KI6 A;  4CF1 A;  3F73 A;  3SZ2 A;  4CJL A;  3OVN A;  5SZT A;  4YOW A;  2VWB A;  3ENO A;  1S6P A;  4FJM A;  5ADX H;  1T3V A;  3PIP L;  3CJA A;  4RW4 A;  2O8E A;  4DQS A;  4B1Y B;  2Q3S A;  1N32 K;  3QET A;  4NXM K;  1IBK K;  4Q0B A;  3HTV A;  4CF8 A;  3SAG A;  2X6N A;  3CC4 N;  3RMA A;  4K25 A;  3IAY A;  4FWO A;  4JLH A;  4BR5 A;  1NLV A;  5KRS A;  1QZ5 A; 
#chains in the Genus database with same CATH homology
 3NF9 A;  4CJK A;  3SI6 A;  1CXU A;  1BIS A;  2FBY A;  2D5R A;  3SQ2 A;  1JXB A;  4AHV A;  3ALY A;  1DLO A;  4FK2 A;  1RTD A;  1LW2 A;  3WNE A;  1KRP A;  1BCM A;  1QE1 A;  3ZT2 A;  4J2E A;  3SUP A;  3IG1 A;  2W42 A;  4KKO A;  1TKT A;  4IBN A;  3SQ1 A;  1BHL A;  3DOK A;  3RTV A;  1JLG A;  4IFY A;  2O4I A;  1RBR A;  3DYA A;  5DK5 A;  2G8H A;  4ZTF A;  2HHU A;  4Z4G A;  3DRR A;  4LY7 A;  1J53 A;  1ZBH A;  4GW6 A;  2G8W A;  3PX4 A;  3VA3 A;  3O3G A;  4BWM A;  4Q5V A;  3DM2 A;  3VQ7 A;  1SKW A;  1CLQ A;  2P1J A;  1NJY A;  3V1O A;  3DRS A;  4CJV A;  4PQU A;  1ASW A;  3PUF A;  3VQC A;  3TAR A;  4DQP A;  1N6Q A;  4CJ3 A;  3EZ5 A;  1UAX A;  3LPU A;  2HVI A;  5J2Q A;  1J54 A;  4WE1 A;  1RT7 A;  5CZ1 A;  3SJJ A;  3K57 A;  4JS4 A;  1EX4 A;  1BQN A;  4G1Q A;  1SKS A;  3OYF A;  2R7Y A;  4FLY A;  4B9S A;  3AO5 A;  3KK1 A;  2IOC A;  1WAJ A;  2HNY A;  4LH4 A;  4YNQ A;  3OYE A;  3K59 A;  2KFN A;  3DMJ A;  4OPK A;  4BDP A;  1I39 A;  4FJH A;  4CGF A;  2YNH A;  1RT4 A;  1QTM A;  2FBV A;  3TAG A;  1VSI A;  4CEQ A;  2EX3 A;  1S9E A;  3AVL A;  5HRR A;  1I3A A;  1DTQ A;  3G10 A;  3KK2 A;  4DSJ A;  3K5O A;  1VSH A;  1RT3 A;  2PYJ A;  4M3Y A;  3NF6 A;  2RPI A;  5CY4 A;  3ZSQ A;  4FJX A;  1TK0 A;  1RT6 A;  3ITH A;  3KLI A;  3QEP A;  4DLE A;  1JLB A;  2X78 A;  4CCH A;  3T19 A;  3AA3 A;  1SUQ A;  5DMR A;  3OYN A;  4HUF A;  3LP1 A;  3HT3 A;  3HK2 A;  4GVM A;  2WON A;  4CE9 A;  3O3F A;  1ZBU A;  3NH1 A;  1JL1 A;  3L3U A;  4B9L A;  5E41 A;  3HP6 A;  2Z1G A;  4BDY A;  2E6M A;  4CHZ A;  3U3Y A;  3NGZ A;  1SL1 A;  3DLH A;  4M3R A;  1VSK A;  4LSL A;  3C95 A;  1X9S A;  4ELU A;  1HYZ A;  4HUE A;  4I9Q A;  2XO7 A;  3OYI A;  5C42 A;  1TKD A;  2G8U A;  1RBT A;  4IDK A;  1T03 A;  4J2D A;  3KTQ A;  4CJT A;  4CEC A;  3SPY A;  5HRO A;  1ZBI A;  3OYK A;  3AVF A;  4F8R A;  5FRM A;  1JKH A;  4FW2 A;  4CEZ A;  2ITG A;  4RW6 A;  2PZS A;  4M45 A;  4BWJ A;  4M3W A;  3OYM A;  4MFB A;  3LAK A;  1SL0 A;  4FJ7 A;  1HNV A;  1TV6 A;  2IAJ A;  3TWH A;  4RW8 A;  2G8F A;  3L2Q A;  4K8Z A;  4DTR A;  3AVI A;  3QIN A;  4XIU A;  1RDB A;  4QAG A;  2Z1J A;  4J2A A;  1BCO A;  4FJ8 A;  3NF8 A;  1NKC A;  1Q9Y A;  3B6O A;  4KI4 A;  1TKX A;  4OKK A;  4FJI A;  2Y1J A;  3TAE A;  4UQG A;  4I2P A;  3NCI A;  4H4O A;  5KRT A;  4DF8 A;  4E1N A;  3OY9 A;  3LWM A;  4IG0 A;  4CGI A;  4CGH A;  2FBT A;  3SV4 A;  3K58 A;  3L2W A;  2P5O A;  4DMN A;  3VQD A;  4KTW A;  3WNG A;  4CEO A;  5KGX A;  3NAE A;  4HCC A;  1T8E A;  2VG7 A;  4RW9 A;  4DTM A;  3MXJ A;  4CGG A;  1L3T A;  1BQM A;  1W9H A;  1HNI A;  3QO9 A;  1L3V A;  3DLB A;  1KVC A;  3HJF A;  2G8K A;  4E89 A;  3LP0 A;  4KTZ A;  4CJR A;  3LZI A;  4KFB A;  4PUO A;  4LSN A;  1RTI A;  5T7B A;  2YHA A;  1RCH A;  4KB1 A;  3MXM A;  3SUO A;  1LAV A;  1VRT A;  1UOC A;  1FXX A;  4CHN A;  3PO5 A;  2FC0 A;  3DI6 A;  2ZD1 A;  3M8S A;  3WNH A;  3OYD A;  4F2S A;  4CFA A;  3S3O A;  4AHC A;  1EP4 A;  3ZT1 A;  3QEI A;  5HLF A;  4W5T A;  1C1A A;  3B6P A;  5K14 A;  2GV9 A;  4DSL A;  1WSE A;  3SUQ A;  4KPY A;  3VA0 A;  3I0R A;  3OJU A;  4KHW A;  4KHY A;  1TL1 A;  1Z26 A;  2G8I A;  3KIO A;  1WN7 A;  2HHX A;  4CF9 A;  4N56 A;  4DTX A;  4DSF A;  2YV0 X;  3AVK A;  3TAN A;  4OLA A;  1VSJ A;  2F8T A;  2OPP A;  5HP1 A;  4DF4 A;  5CYM A;  1GOB A;  3ZSX A;  2HMI A;  1TK8 A;  1KTQ A;  2JLE A;  3KLH A;  4AIL C;  1C0U A;  3SQ0 A;  3AVM A;  1CXQ A;  2QXF A;  3H08 A;  4C8N A;  3ZSR A;  4CES A;  4DU3 A;  3RMD A;  3TI0 A;  4DWI A;  5D3G A;  1JXE A;  5HRS A;  1KSP A;  4KRF A;  3C6U A;  1VSD A;  2XHB A;  4CHQ A;  1GOC A;  1QHT A;  2OA8 A;  3F9K A;  1HPZ A;  3LPT A;  2XY6 A;  1S5J A;  3VQE A;  2E4L A;  4E7H A;  4OGE A;  3PX6 A;  4KHN A;  4DQI A;  4CHY A;  4DU4 A;  4JRP A;  3PV8 A;  4H8K A;  1B92 A;  4J2B A;  1WAF A;  1HMV A;  2O4G A;  2JGU A;  4I9L A;  4E7J A;  4LH5 A;  4CIE A;  1IKX A;  3ULD A;  3A2F A;  2VWJ A;  3C6T A;  3LAL A;  3QEV A;  3IS9 A;  2HHT A;  1T05 A;  4FM2 A;  3DLR A;  3KD1 E;  1EXQ A;  4B8C A;  3DRP A;  5HRP A;  4DS4 A;  3V4I A;  4C8L A;  4HVJ A;  1LWE A;  4OJR A;  2XY7 A;  1J9A A;  1KFS A;  2G8V A;  2QK9 A;  1DTT A;  4YFU A;  1RBV A;  4E19 A;  1A5X A;  4JRQ A;  3MED A;  3HXM A;  4ELV A;  1VSE A;  1WSJ A;  3E01 A;  4KRE A;  1HYS A;  3QEX A;  3TAP A;  2I5J A;  4KB0 A;  4NCA A;  3AVA A;  1XHZ A;  4JS5 A;  1NKE A;  2YKN A;  1LW0 A;  2BAN A;  3FFI A;  3PY8 A;  3UIQ A;  1LWC A;  4DFK A;  4ID5 A;  2F96 A;  4AHR A;  3KD5 E;  4EZ9 A;  3ZSW A;  1NKB A;  1XWL A;  1C6V A;  1C0T A;  5KGW A;  3VQ6 A;  4FVM A;  4CJ5 A;  4DTJ A;  1Q8I A;  4LD0 A;  2ZQB A;  4Z4F A;  3OYB A;  3TAM A;  3SUN A;  3LP3 A;  3VQ9 A;  4CJ4 A;  4NYF A;  1JLQ A;  4BE2 A;  4OLB A;  1QQC A;  2D0A A;  3VQP A;  4E7L A;  1D9F A;  1U47 A;  3AVB A;  1L3S A;  1LV5 A;  3HVR A;  3AA2 A;  1JL2 A;  4HHT A;  3G0Z A;  3K2P A;  3K5M A;  4CGJ A;  3KLE A;  1EET A;  3TAF A;  1W0H A;  3RR8 A;  4DU1 A;  3V6D A;  1NK8 A;  3AA5 X;  1VRU A;  3SQ4 A;  5C24 A;  3CFP A;  4FJL A;  1BIZ A;  1CZ9 A;  3NF7 A;  2QKB A;  2DFF A;  1KLN A;  3KKR A;  4KO0 A;  1IG9 A;  2HND A;  4FK4 A;  4PY5 A;  3HPH A;  2E6L A;  2IC3 A;  1ASU A;  3SNN A;  1HYV A;  3QEW A;  4DFP A;  3K5N A;  4B8A B;  3MXI A;  1NK6 A;  1A5W A;  4NCG A;  3ZSV A;  2D0C A;  4Z0U A;  3S9H A;  3P5J A;  3S3M A;  3DOL A;  4KAZ A;  4M3T A;  1RT1 A;  1L3U A;  4CER A;  1YTA A;  3KJV A;  4DTO A;  1XI1 A;  4C8M A;  4AH9 A;  3SV3 A;  3PO4 A;  1S9G A;  1SL2 A;  1YVU A;  4C8K A;  2VG6 A;  3M8Q A;  3PX0 A;  3NGY A;  5CYQ A;  2DTU A;  1IKV A;  4EZ6 A;  3M8P A;  3VQ8 A;  2XY5 A;  4H4M A;  4FJ5 A;  5J2M A;  3NGI A;  1X9M A;  1J5O A;  2VG5 A;  2KFZ A;  3HO1 A;  3EYZ A;  2KW4 A;  3D45 A;  1KLM A;  3JSM A;  3TAB A;  3QER A;  2YNF A;  3U3G A;  2A1R A;  1NK0 A;  1KVB A;  4BDZ A;  4E7I A;  4GMJ B;  1T7P A;  3ZT3 A;  3CQ8 A;  4M3Z A;  1D8Y A;  2HVH A;  1WSG A;  5FRN A;  1KFD A;  1ITG A;  2KQ2 A;  4B9V A;  1EKE A;  3KK3 A;  4PWD A;  2DY4 A;  1UA0 A;  2QKK A;  1NJW A;  1NK9 A;  1JLC A;  1RNH A;  2GBZ A;  4CHP A;  4F3O A;  3CYM A;  4FJJ A;  4FCY A;  1QSS A;  1WNS A;  1YT3 A;  3RMC A;  4W5N A;  3NHG A;  4DSE A;  3ZCM A;  3V81 A;  4C8O A;  2RF2 A;  2DFH A;  3V9W A;  1BGX T;  3BDP A;  1MU2 A;  1JLE A;  1IH7 A;  4DTN A;  4IG3 A;  1U45 A;  3KLG A;  3OS1 A;  1FK9 A;  2RKI A;  3AO3 A;  3CFR A;  4E3S A;  4DFJ A;  3AVC A;  1KCF A;  2B6A A;  2YHB A;  3VQ4 A;  2OZM A;  2NUB A;  3AA4 A;  1QSL A;  4K8X A;  4FK0 A;  3KLF A;  1F21 A;  3QIO A;  4IFV A;  3VQB A;  3RRH A;  4KHU A;  4M42 A;  4AHU A;  3L3V A;  2HNZ A;  4FW1 A;  1B9F A;  1C1B A;  1QS4 A;  1TAQ A;  3K5L A;  1S1T A;  1N5Y A;  1WLJ A;  2B4J A;  3NBP A;  4N41 A;  4FXD A;  4NYN A;  1D9D A;  4FJ9 A;  1UWB A;  1WSH A;  4CK1 A;  1RBS A;  4B9T A;  1IKW A;  2YNG A;  4O0J A;  1HQE A;  3LAM A;  2ETJ A;  4Y1C A;  4W5O A;  3OYA A;  3RR7 A;  4B3O A;  1TAU A;  2KZM A;  4N47 A;  3CM5 A;  3U6F A;  2BDP A;  2BE2 A;  4FZZ A;  1S1W A;  2KZZ A;  4DSI A;  3VN5 A;  5C25 A;  1NOY A;  1LAW A;  4CF2 A;  3EY1 A;  3AVH A;  1RTJ A;  3HST B;  3ZT0 A;  2HHW A;  4FLW A;  3HYF A;  1TL3 A;  1RT5 A;  2IGI A;  3P83 D;  4L8R B;  3OYC A;  1RBU A;  3AO4 A;  1S1U A;  2Z1I A;  4OKE A;  3VQ5 A;  4B9M A;  4N76 A;  1C0M A;  4Y1D A;  1YTU A;  4F3T A;  4OPJ A;  3LP2 A;  3WNF A;  5HRN A;  4FM1 A;  4CIG A;  3RRG A;  3RMB A;  4KHS A;  4FJK A;  4FYD A;  1B9D A;  4FM0 A;  2FBX A;  2OPS A;  2RN2 A;  3MEG A;  2KTQ A;  4M41 A;  5SWM A;  1BI4 A;  1KVA A;  3DLE A;  3V1R A;  2EHG A;  3HVT A;  5KTQ A;  1NK4 A;  1RTH A;  3AO1 A;  3AV9 A;  4I2Q A;  4MQ3 A;  1VSM A;  3V9X A;  3I0S A;  4FLT A;  4CEF A;  1JLF A;  3SYZ A;  3HL8 A;  4EP4 A;  3SPZ A;  3HP9 A;  1TK5 A;  3QIP A;  4R5P A;  1UA1 A;  4QCL A;  2OZS A;  4CEB A;  3NFA A;  3AVJ A;  4CF0 A;  2P5G A;  1L5U A;  1S1V A;  5J2N A;  3V9S A;  2ATQ A;  5HBM A;  4W5R A;  1D5A A;  3T1A A;  4Z4H A;  4BE1 A;  4E7K A;  1U49 A;  4FZY A;  1IKY A;  3HPG A;  4HCB A;  2OPR A;  5KI6 A;  4HTU A;  3ZSO A;  1BL3 A;  2DFE A;  3MEC A;  3NH2 A;  1RDD A;  3OYG A;  4EP5 A;  4DFM A;  4IKF A;  4DLG A;  1X1P A;  1NK7 A;  4B08 A;  5I3U A;  4FJG A;  2AJQ A;  3ASM A;  4F4K A;  3L2V A;  2HW3 A;  2BGG A;  1HJR A;  2HB5 A;  3D0P A;  3V1Q A;  2IS3 A;  1HRH A;  4O5B A;  2OPQ A;  5EU7 A;  3OS0 A;  2ZE2 A;  2Z1H A;  3MEE A;  2LSN A;  3QLH A;  4CFB A;  4DS5 A;  4CED A;  4DTS A;  1Q9X A;  1WSF A;  3CG7 A;  3SCX A;  4O44 A;  1ASV A;  1RDA A;  4B9U A;  2D0B A;  1NOZ A;  1K6Y A;  3O3H A;  1U4B A;  4RG8 A;  4W5Q A;  2Y1I A;  5JS1 A;  4AHS A;  3ZT4 A;  1REV A;  4CJS A;  4QOZ B;  4O4G A;  1VSL A;  3C94 A;  4HUG A;  4CFC A;  4ZHR A;  1GOA A;  1S6Q A;  4CK2 A;  5J2P A;  1NJX A;  1TKZ A;  3OYH A;  2B5J A;  4CJE A;  4FJN A;  4N5S A;  3AO2 A;  1BI4 B;  1RDC A;  3O4Q A;  5FRO A;  1WSI A;  3ZSZ A;  4CGD A;  4DG1 A;  5J1E A;  4FLV A;  3RWU A;  4KHQ A;  3OS2 A;  3AVG A;  3OJS A;  3KKS A;  4CJP A;  3LWL A;  1Z25 A;  3OYL A;  4F2R A;  4NCB A;  4TSX A;  2YNI A;  3HPO A;  4FZX C;  2HHV A;  2XRI A;  3DLK A;  3ISN C;  1BIU A;  3AVN A;  3LAN A;  3L2U A;  1HQU A;  2PYL A;  4B9N A;  3NE6 A;  1G15 A;  4E0D A;  4CFD A;  4CEE A;  3I8D A;  2OYQ A;  3V9Z A;  3ZSY A;  4BAC A;  1R0A A;  4Z4I A;  3BGR A;  4FLX A;  3NH0 A;  2X74 A;  4BE0 A;  4DSK A;  2HHS A;  2YKM A;  4FLU A;  4E1M A;  4RW7 A;  4OGC A;  1U04 A;  4DTP A;  2PY5 A;  4OKJ A;  3CFO A;  1ZBF A;  1VK0 A;  4PA1 A;  3LDS A;  5CZ2 A;  4CIF A;  4KV8 A;  1IO2 A;  1XHX A;  3DLG A;  3MAQ A;  1NJZ A;  4I7F A;  4DTU A;  4ZTJ A;  2XY8 A;  3TR8 A;  5I42 A;  3VQA A;  3TAQ A;  1TGO A;  2VWK A;  1QSY A;  4KI6 A;  4CF1 A;  5JS2 A;  3F73 A;  2GUI A;  1TVR A;  4ICL A;  4CJL A;  3OVN A;  3SZ2 A;  4Z4E A;  5SZT A;  4CJF A;  4O55 A;  3HM9 A;  1CZB A;  4O0I A;  1JLA A;  4M3U A;  4OVL A;  3S3N A;  4CHO A;  1NK5 A;  1XC9 A;  4FLZ A;  1S6P A;  3QES A;  2P51 A;  3VQQ A;  2X6S A;  4FJM A;  3L2R A;  1SV5 A;  1S1X A;  4M3X A;  1A5V A;  4DQQ A;  4ELT A;  4DQR A;  4RW4 A;  4CJU A;  4DQS A;  2Q3S A;  1ZBL A;  4ID1 A;  3T3F A;  1LWF A;  3QET A;  2F8S A;  1Y97 A;  3OYJ A;  4Q0B A;  3P1G A;  1FKP A;  2IDO A;  3CM6 A;  3IRX A;  3QNO A;  3THV A;  2WOM A;  4CK3 A;  1ZYQ A;  3M8R A;  5FDL A;  4Z4C A;  2A1S A;  4CEA A;  4CJQ A;  4CF8 A;  3JYT A;  2X6N A;  1X9W A;  4KTQ A;  1SKR A;  4CJW A;  3V9U A;  2HHQ A;  1RIL A;  1O1W A;  3LZJ A;  1VSF A;  1FKO A;  3RMA A;  3L8B A;  3IAY A;  3O4N A;  1RT2 A;  4JLH A;  5KRS A;  4AHT A;  3QNN A;  1U48 A;  1C1C A;  3NDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...