4Y1DA

Cyclic hexapeptide cyc[ndpoppkid] in complex with hiv-1 integrase core domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
141
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase binding protein
molecule keywords Integrase
publication title HEXAPEPTIDE MIMETICS OF LEDGF IN COMPLEX WITH HIV-1 INTEGRASE
rcsb
source organism Human immunodeficiency virus 1
total genus 49
structure length 141
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4y1dA00
1YT3A 3D45A 3OYBA 5DK5A 4N47A 4CK2A 4ID5A 1HNIA 4DLEA 1XI1A 1U47A 4F3OA 4DS5A 3VA3A 3VQDA 2IOCA 4DTRA 2VG6A 3V9SA 1FXXA 1SKWA 4KPYA 1VSKA 1RT6A 4HVJA 4YFUA 4KB1A 3V1OA 3MXIA 2KQ2A 3PO4A 1WN7A 5EU7A 1EP4A 1S1WA 1KRPA 1L3TA 4CJ3A 3OYJA 1EXQA 1CZ9A 3LZJA 3AO3A 2B5JA 3SV3A 3OYCA 1N6QA 4GVMA 4FJ8A 2QKBA 2RN2A 5J1EA 4W5OA 1ZYQA 3O4QA 3SUQA 1KVBA 4C8MA 3SPYA 1VSDA 2KW4A 4DTXA 4PUOA 1UA1A 2DFHA 1FKPA 4LH4A 4CECA 4DFPA 2ETJA 2Y1IA 3KTQA 4KHUA 3SV4A 4IDKA 4FLUA 3K5OA 1WSIA 4H4OA 2G8IA 1FK9A 1LW0A 2YNHA 2GUIA 3AA3A 5T7BA 2VWJA 5D3GA 4CHYA 3DLEA 2R7YA 2LSNA 1TK8A 3NH0A 4DSLA 1U48A 2ATQA 2OYQA 1KSPA 3EZ5A 4W5NA 3HM9A 4FLYA 1SKSA 1HPZA 1SUQA 4M41A 4QOZB 4EP4A 4E7KA 1UOCA 1ASWA 1TVRA 5CYQA 4CJVA 3OYKA 3SUNA 4ELVA 4HCBA 4E7JA 4CERA 1RBUA 4CGDA 1RDBA 3G0ZA 4LSNA 1Q9YA 3PX6A 1VSIA 4B8CA 5KGXA 4OKJA 2BE2A 3RRHA 1C0TA 3M8QA 1S1TA 3V1QA 4PY5A 1QTMA 1RT4A 1W9HA 1IKYA 3K5MA 3VQEA 3UIQA 4CHNA 4JLHA 3OJSA 4DSFA 1CXQA 2GV9A 3VQCA 1XHZA 4ID1A 4CEFA 4E7LA 2P5OA 3MECA 1TKTA 5CZ1A 4HTUA 3NF7A 4E19A 3F73A 3OY9A 1DLOA 4E89A 3AO5A 2HW3A 3M8PA 3ZSQA 2G8WA 3AVHA 3L3VA 3AA4A 1C1AA 2QXFA 3U3YA 4ZTJA 3OYHA 1LV5A 3OYFA 3L2QA 3CYMA 1KVCA 4CF0A 4CJQA 3LDSA 1NOYA 4LD0A 2KFZA 3T3FA 4CJLA 4N56A 4FLVA 1LAWA 1SL2A 1I39A 2D0CA 4FK2A 4MFBA 2WONA 4IKFA 4CHPA 1KCFA 3DLKA 3RWUA 3V1RA 5C25A 4M3UA 2YKMA 3C94A 3LPTA 3RR7A 2HHXA 4H4MA 3RMCA 3PY8A 2DFEA 3BDPA 4KREA 4CEZA 1F21A 2YHBA 4QAGA 2YNIA 4DSJA 2GBZA 3VQ4A 1QHTA 4IG0A 4RG8A 4CEAA 1TKZA 1WNSA 4CJSA 1RTDA 4BDZA 3KLFA 2KZMA 1IKVA 2OPQA 2Z1GA 3A2FA 1L5UA 4OLBA 1T03A 2HNYA 1HJRA 3V9WA 4DQQA 4DQPA 4CIEA 1RDAA 4R5PA 1JLEA 2JGUA 3SJJA 3IG1A 3TAQA 1WAFA 1LW2A 3RMDA 4E1MA 4O0JA 3LANA 3WNHA 4DU3A 2BGGA 1VRUA 2HHWA 3V9ZA 3RTVA 3NGYA 3ZSWA 1A5XA 3OVNA 1JLCA 1RNHA 3VQPA 3AVBA 4AHCA 4CFCA 4CJPA 3MEDA 3L2UA 3NGIA 2P5GA 3HJFA 3AO2A 3AVAA 4AHUA 3SI6A 4KI4A 2KZZA 4K8ZA 1IG9A 1MU2A 3RR8A 3MAQA 4CEDA 4C8NA 3OYEA 1Q8IA 2JLEA 3NGZA 5KRTA 2FBXA 3G10A 4DU4A 4PQUA 3QLHA 1QQCA 1VSFA 3PX4A 1U45A 4I2QA 1LWFA 4RW6A 4CFDA 1S6PA 2Y1JA 4FK4A 2NUBA 4DTJA 5HRSA 4J2AA 4ELTA 1X1PA 2A1RA 1NJZA 4N76A 1QSSA 4F2RA 1JLAA 3VQ5A 4B9VA 4O5BA 4RW4A 1LWCA 2RPIA 3SUOA 2Z1IA 3B6OA 1JL2A 1KFDA 3AVLA 4W5QA 3QO9A 3S3MA 1KFSA 4DSIA 3NF9A 4B9NA 1D9FA 3IS9A 4FJ5A 3CM5A 3OYIA 1RTIA 2YKNA 4CJFA 4JS5A 4F4KA 2XY5A 2PYLA 4M3WA 4CHQA 4KRFA 3WNEA 4AHVA 3L2VA 3F9KA 2RKIA 3AVFA 3NE6A 1BGXT 1J54A 3CFOA 3PUFA 2F8SA 3TAPA 3VN5A 5CYMA 2XY8A 4CCHA 2Z1HA 4BE1A 4I9QA 3QNNA 3QIOA 4DTNA 3ZSVA 1BHLA 1X9WA 4IBNA 1S6QA 1TK0A 4I7FA 1U49A 2ITGA 3AVCA 3NBPA 1IKXA 4KB0A 2E4LA 3LPUA 1SL1A 1NK7A 1B92A 2IC3A 4FM1A 1A5WA 1NKCA 1Z25A 3DLGA 4B08A 3NFAA 3KKSA 4DFKA 1NKEA 3QERA 5J2PA 1Y97A 1WLJA 2FC0A 3KLGA 4L8RB 1S1VA 2RF2A 2O4IA 2A1SA 3ZSOA 3AVNA 1RT2A 4NYFA 1RBVA 1VSHA 4YNQA 1A5VA 4OPKA 4FW2A 1JLQA 4CF9A 3RMBA 1T05A 3SQ2A 4C8LA 4DQIA 4CJRA 3P1GA 1TV6A 2QK9A 2IGIA 1WSEA 1BIZA 2YV0X 4CGFA 1J5OA 4KI6A 3AVGA 4Q5VA 3QEXA 4FJ9A 4N5SA 3OYDA 4ELUA 4AHSA 3L2WA 4OLAA 2HNZA 2FBYA 2D0AA 2HNDA 3K58A 1C1CA 3V9UA 3S3OA 1L3UA 4CE9A 1HYVA 4OKEA 3TI0A 1CZBA 3MXJA 3K5LA 1BQMA 4FJLA 3DMJA 2VG7A 4DTPA 4M3YA 4MQ3A 3DI6A 1XHXA 2YNFA 4GW6A 3HL8A 4ZHRA 4FJIA 3U6FA 1SKRA 4LY7A 3KIOA 4O0IA 2OA8A 1C6VA 1HYSA 1RBRA 3MEGA 4CHZA 4F8RA 4M3RA 2I5JA 4G1QA 4FJGA 1WAJA 1S1UA 3ZT3A 3VQ8A 2OZSA 1Q9XA 5SZTA 3K5NA 3SUPA 2VWKA 1RBSA 1RT3A 1C0MA 3S3NA 4B9LA 1UAXA 4DQSA 4M45A 3HPHA 4HCCA 1RT1A 3ZSYA 3M8SA 3HP6A 4DTUA 3SQ1A 4GMJB 2G8UA 1EKEA 2D5RA 1ZBFA 3TAFA 3AA2A 1DTQA 3LP0A 1U4BA 2B4JA 3ITHA 4Z4EA 1WSHA 1JXEA 3T1AA 3B6PA 2HMIA 4O4GA 3TAGA 2PZSA 5HBMA 3VQ6A 5JS2A 3K57A 3QNOA 4KKOA 1S9GA 4HUEA 5HLFA 3HPOA 1QSYA 4FJJA 5JS1A 3LAMA 1NOZA 1C1BA 4Q0BA 3V9XA 3CFPA 3V81A 4O44A 5I42A 4C8OA 4TSXA 3NDKA 3HPGA 1B9FA 2DFFA 3DRRA 4IFVA 2OPSA 4BWMA 3ZT4A 4DFJA 3S9HA 1GOBA 4CJTA 2HHQA 3QEWA 3C6UA 1SV5A 4FJKA 4CF1A 4CGJA 1TAUA 4CK3A 3IRXA 3OYGA 4E7HA 3DRPA 1BIUA 4DF8A 3SNNA 2OPRA 3WNFA 3SZ2A 3EYZA 1BCOA 5J2QA 4N41A 4OGCA 3VA0A 4H8KA 3T19A 3LAKA 2Z1JA 1RILA 1RTHA 2X78A 3NF8A 4OGEA 3ZT2A 2HHVA 3I0SA 1XWLA 1CXUA 3NH1A 3O3FA 5J2MA 1YTAA 4AH9A 3QETA 2B6AA 3L3UA 1BL3A 3KLHA 1QE1A 5SWMA 4Z4GA 1TKDA 3OS2A 1VSEA 4KO0A 1WSGA 2O4GA 2WOMA 5E41A 4DS4A 1IKWA 1GOAA 4OJRA 3VQQA 5HRNA 2P1JA 1VK0A 3KD1E 1BCMA 4FJNA 3NHGA 3L2RA 3NCIA 3AVJA 1IO2A 1JLFA 4RW7A 4RW8A 1Z26A 4PA1A 2P51A 4K8XA 1NK4A 1RT7A 1O1WA 4IFYA 3O4NA 3JSMA 1RBTA 3LALA 4JRQA 2HVIA 4EP5A 3ULDA 2EHGA 3EY1A 1NK6A 3SYZA 4CJKA 2ZQBA 4W5TA 4KTQA 4FM0A 2X6SA 5K14A 4CEQA 4BE2A 3AV9A 1X9MA 4FW1A 3RRGA 4FJMA 4J2DA 2Q3SA 3NH2A 1BI4A 1NK9A 4I2PA 2DTUA 1L3VA 4FZZA 3DRSA 4FK0A 4CFAA 4B9TA 1QSLA 1D9DA 4LH5A 3KK1A 4DQRA 3SPZA 1ZBIA 5J2NA 3QEIA 3HK2A 4CJEA 4KAZA 2OZMA 3KLIA 3PX0A 3ZT0A 3KK2A 4CJ5A 2X6NA 3V6DA 4KHYA 1NK8A 3M8RA 3NF6A 1TL1A 4RW9A 1JKHA 1EX4A 2VG5A 1BISA 3AVKA 3OYLA 3QINA 3CFRA 4FXDA 2D0BA 3I8DA 3MEEA 3O3HA 5KI6A 4Z4HA 4Z0UA 1I3AA 4CIGA 3TWHA 1TGOA 3RMAA 4B3OA 4M3TA 4WE1A 2XHBA 2F96A 4BDYA 3LP2A 4HHTA 1IH7A 3HSTB 2F8TA 3KLEA 1DTTA 4FJXA 5CZ2A 1W0HA 4KHSA 3ASMA 4CK1A 5C24A 4UQGA 2G8KA 2E6LA 3DLHA 2HHUA 2IS3A 1JXBA 4HUFA 4C8KA 3VQ7A 4FLXA 4E1NA 1JLBA 5CY4A 3OYMA 4NCAA 5FRMA 2E6MA 4CF2A 4QCLA 2OPPA 3DYAA 5HRRA 1VSLA 4BWJA 1K6YA 1B9DA 1RDCA 1TL3A 4KHQA 3WNGA 2XY7A 3BGRA 4FZXC 3ZSRA 1NJXA 4KTZA 3HVRA 4FCYA 4Z4IA 1BQNA 1WSFA 3C6TA 3OYNA 3DLBA 4J2EA 1S1XA 3DLRA 4ICLA 4M3ZA 4AILC 1UWBA 3HYFA 2HHTA 3ISNC 4IG3A 1HMVA 3CQ8A 1NK5A 5HP1A 2XRIA 5HRPA 4CF8A 1ITGA 2G8FA 3V4IA 4PWDA 1TAQA 3MXMA 4KFBA 3LWMA 4M3XA 4FLWA 4NCGA 4OPJA 4F2SA 3H08A 4KTWA 3KK3A 4FLTA 3CM6A 3TR8A 4ZTFA 3ZSXA 4EZ9A 1BI4B 3AO1A 2YNGA 1D5AA 1KLNA 2HB5A 1J53A 2PYJA 3QIPA 1HRHA 4DSKA 3K59A 4Y1DA 1L3SA 3HT3A 1TKXA 3ZSZA 4DMNA 4DTSA 3OJUA 3QEVA 3PV8A 3ZCMA 1QS4A 3LP1A 4O55A 4JS4A 4HUGA 4BE0A 4FM2A 4AHRA 4E3SA 3PO5A 4I9LA 1X9SA 1HNVA 4E7IA 1XC9A 1KVAA 1NJYA 3E01A 1S5JA 3CG7A 1NKBA 1T7PA 4CGGA 1GOCA 1ZBUA 3I0RA 4W5RA 3HVTA 3TAMA 5I3UA 2YHAA 1REVA 4DLGA 1TK5A 3K2PA 1LWEA 2IDOA 2G8HA 4FJHA 3AVIA 3QESA 2KTQA 4DTMA 1RCHA 4FLZA 3SQ0A 1HQUA 4B8AB 4BDPA 4FZYA 4CEBA 3DOLA 4B9SA 3ALYA 4CGHA 2BANA 1SL0A 5FDLA 1HQEA 4XIUA 2G8VA 1HYZA 1VRTA 4CEOA 4CJUA 3DM2A 4DG1A 4CIFA 3HP9A 4DF4A 5C42A 3P83D 3TAEA 1EETA 4OKKA 3LP3A 3U3GA 1VSMA 3OS0A 5DMRA 4DU1A 1KTQA 1YVUA 4DTOA 2KFNA 1WSJA 3NAEA 2ZE2A 4NYNA 1UA0A 3ZT1A 2IAJA 3THVA 1U04A 3VQAA 2PY5A 4OVLA 2FBVA 3HO1A 5KRSA 2FBTA 4CFBA 2ZD1A 1ZBLA 3TANA 3KJVA 4M42A 2HVHA 1KLMA 1RT5A 1S9EA 3KKRA 5FRNA 3OYAA 4CJWA 4CHOA 1VSJA 4EZ6A 1NK0A 3LZIA 3AA5X 3SCXA 1R0AA 2DY4A 3JYTA 4F3TA 4FJ7A 2EX3A 3L8BA 4CEEA 3O3GA 1LAVA 5KGWA 4Z4CA 1CLQA 4KHWA 4FYDA 3FFIA 4FVMA 1JL1A 3AO4A 4AHTA 5FROA 3LWLA 1JLGA 1NJWA 3VQBA 1D8YA 1ASVA 2XY6A 4B9MA 4Y1CA 4Z4FA 1FKOA 1T8EA 3VQ9A 4KV8A 4KHNA 1C0UA 2X74A 3HXMA 4DFMA 4BACA 3SQ4A 1YTUA 1G15A 2W42A 1RTJA 5KTQA 2QKKA 4CESA 3AVMA 1J9AA 4JRPA 3KD5E 3P5JA 5HROA 3DOKA 4LSLA 3C95A 1N5YA 1ZBHA 4J2BA 4B9UA 3OS1A 1RDDA 4DWIA 4CJ4A 4DSEA 2BDPA 3IAYA 2AJQA 4NCBA 3TABA 4E0DA 1ASUA 4CGIA 3QEPA 3TARA 2HHSA 3D0PA 2XO7A
chains in the Genus database with same CATH superfamily
4CK2A 1XC3A 1U47A 4DTRA 3V9SA 3FFKB 3MXIA 2A3ZA 3ZX0A 1EP4A 1HKBA 5KPTA 3AO3A 3QBWA 2B5JA 1BU6O 5J1EA 1ZYQA 1KVBA 2O8CA 3VEXA 1VSDA 4MDBA 1KAYA 4PUOA 1UA1A 4LFAK 4B1XB 1FKPA 4JI8K 3DXMB 2BTFA 2HOEA 3K5OA 1WSIA 4H4OA 4B9QA 3VGMA 5D3GA 3NH0A 4DSLA 4FWSA 1U48A 3QMLA 2ATQA 3AAPA 1KSPA 3EZ5A 2P9UB 4M41A 3B8AX 4EP4A 1UOCA 5CYQA 5AFUA 1RBUA 4IDHA 4M7YA 2E2OA 1VSIA 1QQOA 1S1TA 5AQHA 1IKYA 3UKRA 3VQEA 3RVCA 4E7LA 4E19A 3OY9A 1DLOA 1CZAN 3AO5A 3TTCA 3L3VA 4ZTJA 3VEVA 4CJQA 3EN9A 1GLEG 4LD0A 2D0CA 2KLAA 2GEMA 1KCFA 5C25A 4ISEA 3C94A 3RR7A 4H4MA 4WQ5A 4CEZA 2HBMA 2YHBA 4DSJA 2GBZA 1QHTA 4CJSA 2WBNA 4BDZA 3I55N 1T03A 2HNYA 3VGKA 3R3LA 3J7ZO 4ILGB 1JLEA 3R8EA 1WAFA 3WNHA 1HJOA 3G4SN 3NGIA 4CFCA 4AHCA 2YCHA 3AO2A 4EHTA 2D1KA 4BROA 2KZZA 3VPZA 3RR8A 1MDUB 3OYEA 4DU4A 5KRTA 2FBXA 4MO5A 1QQCA 3K0SA 1VSFA 1U45A 1S6PA 4DTJA 3AGKA 1X1PA 2A6AA 1VQPN 1QSSA 4RW4A 1JL2A 3AVLA 3L4QA 4JI1K 3S3MA 2P9IB 4BRLA 1D9FA 2QEXN 4B9NA 3IS9A 5TKYA 2W41A 2QM1A 1RTIA 4CJFA 4BREA 3A0IX 2F9WA 3CCQN 1I94K 3VENA 3NE6A 3HRGA 3TAPA 3MDQA 5CYMA 2XY8A 2HF3A 4I9QA 2UYTA 4JKDA 2UU9K 4CZFA 1U49A 3AVCA 2O8DA 1IKXA 1HNWK 2IC3A 5JLHA 4IOAL 5GINA 4DFKA 3ZSOA 3AVNA 3A5MC 5LMNK 1RBVA 3RMBA 4CF9A 1T05A 5AQOA 3SQ2A 3P1GA 1QQNA 2NRVA 1TV6A 2IGIA 2YV0X 1J5OA 1VQ6N 1YJNN 4FJ9A 3OYDA 1S22A 4AHSA 3K58A 3S3OA 1N34K 1L3UA 1FJGK 4JKFA 4DKWA 3K5LA 4CZKA 3DMJA 2VG7A 4MQ3A 1XHXA 4ZHRA 2OA8A 1QZ5A 1T6CA 1RBRA 2WFBA 4CHZA 4M3RA 3O1WA 4FJGA 4FO0A 4YOWA 4DV3K 2I7NA 3ZT3A 3N4QA 4BRIA 1Q9XA 2VWKA 1RT3A 1C0MA 3S3NA 3AY9A 1UAXA 2VGNA 1J5EK 4FWPA 4X64K 3FLCO 4B3RK 3TAFA 1SAZA 1J6ZA 3LP0A 4BR0A 2B4JA 3CERA 1WSHA 3B6PA 3VTHA 2VYPA 4KKOA 4KH5A 4Q0BA 3CFPA 3V81A 1NNEA 3NDKA 3CC2N 3NMUA 4Y0WA 3O08A 2OPSA 4DFJA 1GLLO 2UUBK 4LF9K 3OHRA 4JEPA 4MLHA 2QXLA 3QEWA 1N33K 1ATNA 4CF1A 3THWA 3THYA 4E7HA 5CHIA 1BIUA 2OPRA 3SZ2A 5E84A 3O9UA 3CJCA 3LDQA 5I9EB 2YHYA 4B3SK 1RILA 2X78A 2HHVA 3WEEB 1XWLA 1CXUA 3NH1A 1V4TA 4H0PA 2VWBA 1LOTB 1QE1A 5SWMA 4BR9A 3OS2A 4DQ8A 5E41A 4DS4A 3DXMA 1GOAA 1VK0A 3NHGA 5H1SQ 3NCIA 1IO2A 2Q0UA 4F9OA 1TUYA 4RW8A 1VHXA 2YHWA 3O4NA 1RBTA 1NMNA 3O6WA 2HVIA 3ULDA 3EY1A 4KTQA 3QICA 2X6SA 4YHHK 5K14A 4BRHA 2FSJA 2IIRA 1X9MA 4FJMA 4H0OA 3J8AA 2DTUA 3DRSA 4FK0A 1HR0K 4CFAA 1QSLA 1D9DA 3UB5A 1KQSM 3SPZA 2ASOA 3ATVA 4CJEA 4KAZA 4KH6A 3ID8A 3NF6A 3P4IA 1JKHA 3JXUA 1EX4A 4JI7K 1BISA 4FXDA 3CFRA 5KI6A 4Z0UA 1OH8A 2NLXA 3SK3A 5AJ3K 3RMAA 3R1XA 4WE1A 5A2QO 3LP2A 4J8FA 5AQFA 3EE8A 1DTTA 3WT0A 4IEIA 1W0HA 3ASMA 3DLHA 3SLCA 2HHUA 4C8KA 4OPAA 3ZYYX 5HRRA 3WNGA 3ZSRA 4JI4K 1WSFA 1S1XA 5GAEP 1UWBA 4AILC 4EHUA 3ISNC 4H5VA 3D7EO 3CQ8A 4CF8A 2G8FA 3U8XA 3V4IA 3G6EN 4M3XA 4BC4A 3TU5A 3FZFA 2ZWHA 3WXMB 3ULEA 4LF7K 3VF4A 5AQSA 3J7AP 3TR8A 1MWKA 3ZSXA 4M63C 1BI4B 2YNGA 1J53A 1NGBA 3VEOA 3QEVA 4AF1A 5TKWA 1QS4A 3LP1A 4O55A 4HUGA 4AHRA 3C0BA 2HHHK 1HNVA 4C23A 3U9DA 1XC9A 1NJYA 1BA1A 1YF5L 4BRCA 2P9IA 3CG7A 1T7PA 4DR6K 3I0RA 3HVTA 3TAMA 2G8HA 4QOZB 5IT9O 3K2PA 1LWEA 3AVIA 1EWQA 2ZJRL 1HQUA 5BR8K 4CEBA 1NGEA 3DOLA 3ALYA 3M3ZA 4CGHA 5FDLA 4XIUA 2G8VA 2IVNA 1VRTA 4CJUA 4CIFA 4DF4A 3TAEA 3MN7A 3OS0A 3T7ZA 5DMRA 4MO4A 1YVUA 1UA0A 3ZT1A 1U04A 4JI6K 4OVLA 3CMAN 5JVGL 1KLMA 1SQKA 5AZJB 3CQXA 3L0QA 1VSJA 3LZIA 5E26A 4F3TA 3I8BA 3O3GA 5KGWA 4KHWA 3VMFB 2QWRA 3KWGA 1K8KA 4O5FA 3ZEUB 2XY6A 3HXMA 1TYQB 1RTJA 4CI6A 3IKMA 3P5JA 4FVUA 3C95A 3ZETB 1ZBHA 3F5TA 4YY3K 3OS1A 1RDDA 2D0OA 3HM8A 3FR0A 1XMOK 3M1FA 1HNZK 1QVFM 3D45A 4N47A 3G25A 4ID5A 1HNIA 3D2EA 1XI1A 3F9MA 2HBJA 2IOCA 2VG6A 4BRMA 4CBWA 1VSKA 4YFUA 3J80O 3V1OA 1S1WA 4C1NI 1CZ9A 3OYCA 2KW4A 5AQJA 4DTXA 5JICA 4LH4A 2ETJA 4V19S 3OBWA 5EX5A 3SV4A 2FF3B 3O9RA 2G8IA 3O4WA 1FK9A 1LW0A 2YNHA 2GUIA 4BR7A 3QBXA 2VWJA 1KD1O 2R7YA 2LSNA 4W5NA 3A8YA 4FLYA 1ASWA 4CJVA 1G99A 5KQ8A 2O8BA 1RDUA 4CERA 4CGDA 3H45C 3PX6A 3CCUN 5KGXA 4OKJA 3M8QA 1TUUA 3QDKA 3UIQA 2BH1A 4JLHA 4JAXA 4DSFA 3CI5A 4JK8A 1XHZA 3SAGA 3MECA 1TKTA 3N4PA 3NF7A 4E89A 3ZSQA 5AQQA 3AVHA 2V52B 4DCHA 3CYMA 4CF0A 1NOYA 2KFZA 3T3FA 4CJLA 1I39A 3WQUA 4IKFA 3RWUA 3LPTA 3MN9A 1WB9A 2DFEA 3BDPA 5EVZA 3WXIA 1F21A 4KHPK 3ZX3A 4ILJA 2HBLA 3ZLJA 4CEAA 1TKZA 1WNSA 2F4VK 3A5LC 3KLFA 4OLBA 2A40A 3OA9A 1OH6A 3SJJA 4B3TK 3TAQA 3RMDA 2BGGA 3LANA 1K8AO 4E1JA 1JLCA 3VQPA 4CJPA 3HJFA 4AHUA 4K8ZA 3SAFA 3MAQA 2JLEA 3QLHA 5EOYA 3PX4A 4RWTA 3DLLL 4MLEA 2Y1JA 2NUBA 4B1ZA 2JWKA 4ELTA 2A1RA 4F2RA 1VAZA 3VQ5A 3BZCA 1RFQA 4BVOA 3QO9A 4HWIA 4I6MA 5FPDA 3CJ1A 4BG9A 2GELA 3K9JA 4F4KA 4JS5A 1ZXOA 3L6QA 3L2VA 4DV4K 2CGKA 3PUFA 4CCHA 1SZ2A 4BE1A 3QNNA 3QIOA 1YXQA 5AQPA 1X9WA 1NU0A 4KB0A 2E5LK 1SL1A 2E8AA 1NK7A 4FM1A 1ATRA 1A5WA 3DLGA 4B08A 2AA4A 1NKEA 1Q82O 4BRQA 2FC0A 3RSEA 3KLGA 2RF2A 1IV0A 2QWLA 4NYFA 3VOVA 1A5VA 4YNQA 1N36K 1X3NA 4CJRA 4BC5A 4AM6A 3IUCA 2HSTA 1VQ5N 4ELUA 3L2WA 4OLAA 2HNZA 3GE1A 3MMVA 1C1CA 3TTFA 3V9UA 3C7NA 4CE9A 1HYVA 1CZBA 3MXJA 4FJLA 1BQMA 4IO8A 2ITMA 4B1UB 2YNFA 4CD1A 4FJIA 1SKRA 1NBWA 3H46O 5C15A 2E2QA 3O8MA 2I5JA 5M1FA 3ATUA 3VTIA 4PKHA 5SZTA 3K5NA 5AZIA 1RBSA 2P9KB 4IJAA 2O8FB 2QWNA 4DQSA 1NM1A 1YIJN 5KPZA 2E88A 4GMJB 1EKEA 3SQ1A 1ZBFA 3M5RA 4H5RA 1DTQA 3MCAB 3OW2M 1EWRA 1JXEA 4BRFA 2HMIA 4H03B 4O4GA 2QWOA 3IFRA 4HUEA 5HLFA 4R79A 3E66A 3R6MA 4O44A 5EY4A 3HPGA 2DFFA 3MWPA 3CCVN 3C6UA 5AQKA 5EXWA 4OO1J 1TAUA 5JLFA 3SNNA 3WNFA 5J2QA 4B1VA 3VA0A 4H8KA 3T19A 1E4FT 1RTHA 4FWMA 3UKUB 3ZT2A 4YDUA 3SBGA 3O3FA 1YTAA 3L3UA 4CZEA 4Z4GA 1U6ZA 1IKWA 5HRNA 2P1JA 3KD1E 1BCMA 4JD2B 3DXKA 2ASMA 4DV1K 1NK4A 1VQKN 4IFYA 3H6EA 4JRQA 5BRDA 2ZQBA 2VQFK 3VEZA 4FW1A 2RHKA 4J2DA 5GAHP 3CCJN 2Q3SA 4KH4A 3D2FA 2P9PA 1RDWX 5BR9A 4B9TA 4LH5A 1ZBIA 3HK2A 1QZ6A 3O80A 2OZMA 3KK2A 2X6NA 1NK8A 4O8KA 4RW9A 3KHYA 2VG5A 3MEEA 3O3HA 5BPLA 5HL7L 3TWHA 2O8EB 2F96A 4BDYA 2YI1A 1IH7A 4JI0K 1Y64A 4FJXA 4M7XA 1NGDA 4CK1A 2G8KA 2E6LA 1MA9B 4DR3K 2IS3A 4HUFA 3AAQA 2CH6A 4E1NA 4QCLA 4NCAA 4H0YB 5FRMA 3DYAA 4JKCA 3P31A 4BWJA 1TL3A 4FWOA 1NJXA 3QFPA 4KTZA 4FCYA 1NJIO 5AR0A 3OYNA 3HOSA 3DLRA 4ICLA 2HHTA 3HYFA 2PAVA 5HP1A 2XRIA 2VCPA 5ADXH 1ITGA 4Z94A 5HRPA 1KC8O 4KFBA 3LWMA 4FLWA 4GV3A 4OPJA 3BF1A 3CJ9A 3H08A 4KTWA 4FLTA 1C0GA 3CQYA 1JCEA 1IG8A 1D5AA 1KLNA 1HRHA 4WYBA 4CZGA 4DSKA 1XQSC 3HT3A 1TKXA 4DTSA 4DMNA 3DWLA 3OJUA 4BE0A 4E3SA 2PBDA 2YHXA 2QWQA 4E7IA 1OVYA 2P9NB 1NKBA 4DLGA 5F0XA 2IDOA 3QESA 1RCHA 1HX1A 4FLZA 1DEJA 3A5NC 4B8AB 3F2KA 1GLAG 1SL0A 1HYZA 4CEOA 1EETA 3LP3A 1VSMA 4BRGA 4DTOA 3NAEA 5JVHL 3THVA 3E9LA 2HMPA 4BR5A 1XMQK 5AQVA 5KRSA 4CW7B 4CFBA 4KBOA 3TANA 4M42A 2HVHA 1EO1A 4FOEA 1RT5A 1S9EA 5FRNA 3FZLA 3OYAA 4CJWA 3CCSN 4CHOA 3K9KA 4EZ6A 1U2VB 1K73O 2DY4A 3JYTA 4A57A 2P9UA 5JMVA 2EX3A 2QTDA 3L8BA 4Z4CA 4JKEA 2V7YA 4FVMA 3AARA 3LWLA 1EQYA 2HHQA 4DR2K 4Z4FA 3SMPA 2P9LB 4KV8A 2X74A 4FWKA 1G15A 5KTQA 4FWRA 5M1OA 4DUYK 3AVMA 1J9AA 3IMXA 4JKGB 4HTLA 1KAXA 4LF6K 5M1PA 4DWIA 4CJ4A 2BDPA 2FSKA 2HHSA 1YT3A 2ASPA 3OYBA 2GTDA 5DK5A 2W6LA 3MN5A 4DLEA 5LJVA 4DS5A 3VETA 1SKWA 4KPYA 3M6GA 4HVJA 4KB1A 2W40A 2KQ2A 4GKJK 3PO4A 1WN7A 5EU7A 1L3TA 2HBKA 4CJ3A 3OYJA 3LZJA 3SV3A 1N6QA 4GVMA 4K42A 4FJ8A 2QKBA 2RN2A 4W5OA 3O4QA 3SPYA 4QS8A 5LJWA 1BDGA 3VF6A 2UUCK 2DFHA 3KTQA 3CJAA 3W3DA 4KHUA 1Q18A 4IDKA 4FLUA 4DV2K 4CJ7A 4PHTX 4CHYA 3DLEA 4BRAA 3O9SA 2Q1NA 4JKHA 1C0FA 1SKSA 1HPZA 4E7KA 4FL9A 3NVMA 2FXUA 1TVRA 3OYKA 4ELVA 4BRNA 2I7PA 4BR2A 1RDBA 4LSNA 1Q9YA 4B8CA 2P9SB 1C0TA 3MX2A 4K41A 3C6HA 4PY5A 3K5MA 3SAHA 4JI2K 3VQCA 3TPQA 5CZ1A 1BUPA 4FWQA 4YOYA 4DV7K 2HW3A 3U3YA 3AA4A 2QXFA 4YOTA 2YX6A 3OYHA 1LV5A 5BN9A 3LDSA 4A2AA 4N56A 4FK2A 4BRPA 4MFBA 3LL3A 2DPNA 5C0YA 3V1RA 2HHXA 3RMCA 1WBBA 4DR7K 1ZC6A 3CIPA 1M1KO 2YNIA 3VQ4A 4IG0A 5CR4A 4RG8A 5ADXA 3IDHA 2O8CB 3E1YA 1IKVA 3A2FA 1L5UA 2QW9A 1HJRA 3V9WA 4DQQA 4CIEA 5KPRA 1RDAA 4R5PA 3ZX2A 3T1HK 4FPAA 1E3MA 1LW2A 2O8EA 4E1MA 4O0JA 4DU3A 2HHWA 3RTVA 5AQXA 3T69A 3ZSWA 3OVNA 1RNHA 3J7YP 3AVAA 3SI6A 3CXCM 4DV6K 1IG9A 1MU2A 3EZWA 3PSFA 4K25A 3NGZA 4PQUA 5BRFA 2NNWA 3LDPA 1LWFA 4PKGA 4RW6A 1YJWN 4CFDA 4BGBA 2KKZA 3JS6A 5MLCQ 4J2AA 3UKRB 1H1VA 4B9VA 2RPIA 3SUOA 2Z1IA 3B6OA 1KFDA 1VQLN 5DM6L 4DSIA 3A5OC 1GLDG 3NF9A 4AM7A 3OYIA 2YKNA 1NMDA 2ZJPL 1Q7YO 4AHVA 3F9KA 3AVFA 3WUHA 4L3QA 2F8SA 3VN5A 2KHOA 1HKGA 2VQEK 4PL8A 4DTNA 3ZSVA 1BHLA 4IBNA 1S6QA 3NBPA 1NGGA 5C2FA 3LPUA 4YOVA 4AQYK 1NKCA 1Z25A 2OTJN 4WQ5C 2P9NA 1VQ7N 5J2PA 1Y97A 1WLJA 4L8RB 2GX9A 1HLUA 4JKAA 4IEEA 4A61A 3J81O 2Q31A 3R9PA 4DQIA 4IZ9A 3HSCA 1BIZA 1NGIA 4KI6A 4WQ4C 4Q5VA 3QEXA 3WEEA 2W6KA 3FGUA 2D0AA 4IFEA 3GDQA 1BO5O 3TI0A 4DTPA 4GW6A 4LC9B 2E2NA 3L4IA 3KIOA 4XEIA 3W0LA 5GIPA 2UXCK 4BQLA 4EFHA 1HYSA 3MEGA 1U2VA 4OX9K 1WAJA 1S1UA 4U7BA 3TTDA 5DM7L 3C65A 3SUPA 4B9LA 4DUZK 3HPHA 4HCCA 1RT1A 3M8SA 3HP6A 5AQWA 1VQ9N 2IVPA 3AA2A 3EKSA 1U4BA 3ITHA 4A5BA 4Z4EA 1T3VA 4GY2B 2PZSA 3TAGA 3VQ6A 4IXCA 1YUWA 2E2PA 3QNOA 1S9GA 2O8DB 1X3MA 5JS1A 3HPOA 3LAMA 4O8UA 5C10A 5HOOA 3OTOK 3V9XA 2EWSA 3KK7A 1JCFA 3DRRA 4IFVA 4BWMA 3ZT4A 1GOBA 4U67L 4CJTA 3O9TA 1SV5A 4FJKA 4B1WB 4CGJA 1YVNA 5IWAK 3DRPA 4DF8A 1MWMA 3EYZA 4N41A 3CHWA 3CC7N 5M1KA 4X62K 5AQZA 2A41A 3LAKA 3NF8A 5AQTA 3LDOA 3QETA 1D4XA 3KLHA 5AQGA 1QQMA 3H3NO 1VSEA 4KO0A 4FWNA 2WOMA 2ZGZA 3HTVA 4A62A 1Z05A 4OJRA 2E20A 1W2BM 3AVJA 5F2RA 1JLFA 4X66K 1W97L 1Z26A 1FW6A 3LDLA 4A2BA 1O1WA 3JSMA 2YJEA 3LALA 1NK6A 3EL2A 3SYZA 3O1BA 4FM0A 2FF6A 4CEQA 3RRGA 4BGAA 4CZIA 1HPMA 3E9OA 1BI4A 1YITN 1L3VA 2F9TA 1ILYA 1NGFA 3O5BA 3VEYA 1Q86O 2GWJA 5J2NA 3QEIA 2A42A 4DR4K 2NRZA 4BR4A 3KLIA 4CZJA 4CJ5A 4DB3A 3V6DA 3M8RA 3CPEA 3OYLA 4PKIA 3QINA 3DAWA 4H0TB 2V51B 3GL1A 1I3AA 4CIGA 4B3OA 1TGOA 1NG9A 3THWB 3THYB 2XHBA 1XUPO 3HSTB 1WOQA 4KHSA 2YJFA 5C24A 4UQGA 4NO7A 3VESA 1X9JA 2E1YA 3VQ7A 1JLBA 5CY4A 5BPMA 1VSLA 4JN4A 1B9DA 4KHQA 1IBLK 4FZXC 3PLAA 4CZMA 4Z4IA 3EKUA 3C6TA 4J2EA 4M3ZA 5AQYA 5AZJA 2ZM6K 3BZKA 1IJJA 4PWDA 5C12A 1Q81O 1N32K 1IBMK 4F2SA 3KK3A 3ZEUA 4WFAL 4ZTFA 3AO1A 4DR5K 2PYJA 3QIPA 3I56N 1W7AA 1TYQA 1HUXA 4JKBA 4H5TA 3ZSZA 2OTLN 3ZCMA 4FM2A 4YORA 1BA0A 3PO5A 3ZETA 4B3MK 4NLBA 4WCEL 1KVAA 3E01A 4CGGA 1GOCA 5I3UA 5BPNA 1REVA 2KTQA 2RE2A 4CZHA 3MWTA 4FJHA 4DTMA 3SQ0A 4BDPA 1QVGM 4FZYA 3BP8A 5AQUA 5GADP 1OH7A 4B9SA 3H1VX 5C2DA 4DG1A 3DM2A 3VGLA 3HP9A 5C42A 3P83D 3TSQA 1KTQA 2Q2RA 4K43A 1WSJA 4NYNA 1ZBSA 2FBVA 1VQ8N 2ZD1A 3KVGA 2Q97A 5AQNA 1DT9A 4BY9C 4WQ4A 3KKRA 3OBYA 1ESVA 1NK0A 1R0AA 4CZLA 3KZBA 4FJ7A 4CVNE 4CEEA 3Q7CA 1CLQA 3MK6A 3C6AA 4H0XB 3ULEB 2ZF5O 3FZKA 4OPHA 3VQBA 4IJNA 1ASVA 1NJWA 1FKOA 3VQ9A 4KHNA 1C0UA 1YTUA 4DFMA 2QI2A 1BOTO 4CESA 2UUAK 1VQNN 4JRPA 2J4RA 3VF2A 3THXB 3KD5E 3DOKA 3WXLA 3FZHA 4J2BA 3IAYA 2AJQA 1ASUA 1QHAA 5LY3A 3D0PA 2XO7A 4JYAK 4F3OA 3VA3A 3VQDA 5FLXO 1FXXA 1RT6A 4BQZA 1KRPA 4BVPA 1EXQA 3AGRA 3MCPA 1OKJA 1T44A 3SUQA 4C8MA 1BG3A 1S3XA 3CCMN 3PIOL 4CECA 4DFPA 2Y1IA 1YAGA 5T7BA 3AA3A 2VGMA 1TK8A 5BREA 5BRHA 5B8HA 2OYQA 2IVOA 1GLJO 5AQRA 3HM9A 3TSPA 1GLBG 1SUQA 5GIOA 1KAZA 5AQMA 3SUNA 3U9ZA 4HCBA 4YOXA 4E7JA 3E9PA 2JWLA 1IBKK 1K8KB 3G0ZA 4GNIA 2E1ZA 1NGCA 2BE2A 3RRHA 3V1QA 1QTMA 1RT4A 1W9HA 3Q7BA 4CHNA 3OJSA 2WTUA 1R59O 1CXQA 2GV9A 4X65K 1SS6A 4ID1A 4CEFA 4CD3A 2P5OA 4HTUA 4C1NK 3F73A 5ELZA 3M8PA 2G8WA 5M1QA 1C1AA 4JNEA 4K0KK 3OYFA 3L2QA 4BC2A 1KVCA 3JAMO 4LF8K 3LDNA 2NRHA 4FLVA 1LAWA 2Q36A 1SL2A 3D2EB 2WONA 4CHPA 3DLKA 3H1QA 4M3UA 2BUPA 2YKMA 3PY8A 4KREA 4QAGA 1KXPA 4IO9L 1RTDA 3T1YK 2KZMA 2OPQA 2Z1GA 2H3GX 4DQPA 2JGUA 3QFUA 3GOIA 3IG1A 3BF3A 4DV0K 1VRUA 4GV6A 3V9ZA 3NGYA 1A5XA 1ATSA 3L2UA 3AVBA 3MEDA 2P5GA 1VQMN 4JHDB 3UE5A 4KI4A 2NRWA 3CETA 5CE3A 4XH1A 2O8BB 4CEDA 4C8NA 1Q8IA 3G10A 4JV5K 5AQIA 3BEXA 4CBXA 2NRXA 4I2QA 3WXJA 1M90O 4GVEA 4FK4A 3VEWA 5HRSA 3EO3A 4LF5K 3BY5A 1NJZA 4N76A 1JLAA 5AQLA 2QA4N 3CJ7A 4O5BA 1LWCA 4W5QA 1BWFO 1KFSA 4FWLA 1YHQN 3MX5A 2NZTA 2P9KA 1JJ2M 4FJ5A 3CM5A 2O8FA 4M3WA 2XY5A 2PYLA 4KRFA 4CHQA 3WNEA 2RKIA 1BGXT 1J54A 3CFOA 2Z1HA 3CF5L 1TK0A 4I7FA 3HOTA 2ITGA 2E4LA 1OH5A 4RTFD 1B92A 1OVQA 1P90A 3ENHA 4XH5A 3NFAA 3KKSA 1V4SA 3QERA 1S72N 1S1VA 4B1YB 4JI5K 1XNRK 2O4IA 2A1SA 1RT2A 3G71N 1VSHA 4DHYA 4OPKA 4FW2A 1JLQA 4C8LA 2QK9A 1WSEA 3CCRN 4CGFA 4JK9A 3AVGA 2NRTA 4N5SA 3UKUA 1NGHA 2FBYA 2HNDA 4LF4K 4H0VB 4OKEA 1NWKA 4PL7A 3GBTA 4M3YA 4WF9L 3DI6A 2UXDK 3HL8A 2WC9A 3U6FA 4JD2A 4LY7A 4O0IA 1C6VA 3NVKA 4F8RA 3ID6A 3SBTA 4G1QA 2WUSA 3TSUA 3VQ8A 2OZSA 4I6MB 3P38A 3CJBA 4RCHA 4M45A 3ZSYA 4DTUA 3U4LA 2G8UA 2D5RA 3GG4A 4JK7A 3VERA 3CMEN 1HKCA 2GUPA 3T1AA 5HBMA 3K57A 5JS2A 3THXA 1QSYA 4FJJA 1NOZA 1WUAA 1C1BA 4IWVA 3SMSA 4EAHD 3CCEN 5I42A 4C8OA 4TSXA 4ISGA 3P39A 1B9FA 3RSEB 4DV5K 3S9HA 4FOIA 4CK3A 3IRXA 3OYGA 1YJ9N 3CPWM 2ZJQL 3FE1A 1BCOA 5GAGP 4OGCA 2Z1JA 4OGEA 3I0SA 2A5XA 5J2MA 4AH9A 2B6AA 4G9ZA 2OANA 1BL3A 3EE9A 3C7NB 1TKDA 3LM2A 2QWPA 1WSGA 2CGLA 2O4GA 4ISFA 3VQQA 4FJNA 1GLFO 3CCLN 3L2RA 3PIPL 4RW7A 2AP1A 3HBTA 4PA1A 4K8XA 2P51A 1RT7A 5M1NA 4EP5A 2EHGA 2FSNA 4CJKA 5AZIB 4W5TA 4CBUA 3EEQA 4NXMK 4BE2A 3AV9A 3D6RA 3NH2A 1DKGD 3O9QA 1NK9A 4LFBK 4I2PA 4BRKA 4FZZA 1JCGA 3KK1A 4DQRA 3PSIA 2V7ZA 1VQON 5AFUH 3LM9A 4UY8O 1NLVA 3PX0A 3ZT0A 4KHYA 2QWMA 4NXNK 3DJCA 1TL1A 4GV9A 4IOXA 2OCEA 3AVKA 4ILHA 2D0BA 3I8DA 4Z4HA 4EIAA 3CD6N 4M3TA 2F7TA 4MDAA 3ENOA 4HHTA 4NLCA 2F8TA 3KLEA 2ZGYA 4WFNL 4IOCL 1P8ZA 5CZ2A 4FSVA 1JXBA 3WQTA 5LL6Z 4FLXA 3OYMA 3FZMA 2E6MA 4CF2A 1Z6RA 2OPPA 3HZ6A 4YDUC 1K6YA 1RDCA 4LFCK 3CC4N 2XY7A 3BGRA 1VQ4N 3HVRA 1BQNA 3DLBA 5BN8A 5KQDA 1HNXK 3DXKB 4IG3A 1HMVA 1NK5A 2HF4A 2CH5A 3KWIA 1TAQA 4JHDA 3MXMA 4NCGA 1T6DA 3CM6A 3D2FB 2P9PB 4BRDA 4EZ9A 5FPNA 2P9LA 1LCUA 2HB5A 3QB0A 3SJHA 4BG8A 3K59A 4Y1DA 1L3SA 2Q0RA 1DGKN 4NB4A 4DR1K 3PV8A 4JS4A 4QS9A 1RGIA 4JKGA 4I9LA 4A5AA 1X9SA 4QS7A 2NRRA 1S5JA 3WXKA 4WFBL 1ZBUA 4W5RA 5FPEA 5LMUK 2YHAA 4H5NA 1TK5A 2CGJA 4XH4A 3ENBA 2BANA 1HQEA 4OKKA 3U3GA 5F1XA 4DU1A 2KFNA 2ZE2A 2IAJA 2PY5A 3VQAA 3HO1A 2FBTA 1NGAA 4H5WA 1ZBLA 3KJVA 3I33A 1XNQK 5FPMA 2FLOA 1K9MO 3SCXA 3AA5X 4BC3A 1YI2N 1LAVA 4GKKK 4FYDA 3FFIA 4AHTA 1JL1A 3AO4A 5FROA 1WBDA 1JLGA 1D8YA 4B9MA 1NGJA 4Y1CA 1T8EA 1O13A 2P9SA 2D0PA 3S41A 2PFUA 1E4GT 4YOUA 4BACA 3SQ4A 2W42A 2QKKA 3HI0A 4JI3K 2UXBK 4A59A 4FPBA 5HROA 4LSLA 2GWKA 1N5YA 4B9UA 4DSEA 1GLCG 3H3OB 3TABA 4NCBA 4E0DA 3TARA 4CGIA 3BUZB 2D4WA 3QEPA 1N8RO 3MN6A
chains in the Genus database with same CATH topology
1YT3A 3D45A 3OYBA 5DK5A 4N47A 4CK2A 4ID5A 1HNIA 4DLEA 1XI1A 1U47A 4F3OA 4DS5A 3VA3A 3VQDA 2IOCA 4DTRA 2VG6A 3V9SA 1FXXA 1SKWA 4KPYA 1VSKA 1RT6A 4HVJA 4YFUA 4KB1A 3V1OA 3MXIA 2KQ2A 3PO4A 1WN7A 5EU7A 1EP4A 1S1WA 1KRPA 1L3TA 4CJ3A 3OYJA 1EXQA 1CZ9A 3LZJA 3AO3A 2B5JA 3SV3A 3OYCA 1N6QA 4GVMA 4FJ8A 2QKBA 2RN2A 5J1EA 4W5OA 1ZYQA 3O4QA 3SUQA 1KVBA 4C8MA 3SPYA 1VSDA 2KW4A 4DTXA 4PUOA 1UA1A 2DFHA 1FKPA 4LH4A 4CECA 4DFPA 2ETJA 2Y1IA 3KTQA 4KHUA 3SV4A 4IDKA 4FLUA 3K5OA 1WSIA 4H4OA 2G8IA 1FK9A 1LW0A 2YNHA 2GUIA 3AA3A 5T7BA 2VWJA 5D3GA 4CHYA 3DLEA 2R7YA 2LSNA 1TK8A 3NH0A 4DSLA 1U48A 2ATQA 2OYQA 1KSPA 3EZ5A 4W5NA 3HM9A 4FLYA 1SKSA 1HPZA 1SUQA 4M41A 4QOZB 4EP4A 4E7KA 1UOCA 1ASWA 1TVRA 5CYQA 4CJVA 3OYKA 3SUNA 4ELVA 4HCBA 4E7JA 4CERA 1RBUA 4CGDA 1RDBA 3G0ZA 4LSNA 1Q9YA 3PX6A 1VSIA 4B8CA 5KGXA 4OKJA 2BE2A 3RRHA 1C0TA 3M8QA 1S1TA 3V1QA 4PY5A 1QTMA 1RT4A 1W9HA 1IKYA 3K5MA 3VQEA 3UIQA 4CHNA 4JLHA 3OJSA 4DSFA 1CXQA 2GV9A 3VQCA 1XHZA 4ID1A 4CEFA 4E7LA 2P5OA 3MECA 1TKTA 5CZ1A 4HTUA 3NF7A 4E19A 3F73A 3OY9A 1DLOA 4E89A 3AO5A 2HW3A 3M8PA 3ZSQA 2G8WA 3AVHA 3L3VA 3AA4A 1C1AA 2QXFA 3U3YA 4ZTJA 3OYHA 1LV5A 3OYFA 3L2QA 3CYMA 1KVCA 4CF0A 4CJQA 3LDSA 1NOYA 4LD0A 2KFZA 3T3FA 4CJLA 4N56A 4FLVA 1LAWA 1SL2A 1I39A 2D0CA 4FK2A 4MFBA 2WONA 4IKFA 4CHPA 1KCFA 3DLKA 3RWUA 3V1RA 5C25A 4M3UA 2YKMA 3C94A 3LPTA 3RR7A 2HHXA 4H4MA 3RMCA 3PY8A 2DFEA 3BDPA 4KREA 4CEZA 1F21A 2YHBA 4QAGA 2YNIA 4DSJA 2GBZA 3VQ4A 1QHTA 4IG0A 4RG8A 4CEAA 1TKZA 1WNSA 4CJSA 1RTDA 4BDZA 3KLFA 2KZMA 1IKVA 2OPQA 2Z1GA 3A2FA 1L5UA 4OLBA 1T03A 2HNYA 1HJRA 3V9WA 4DQQA 4DQPA 4CIEA 1RDAA 4R5PA 1JLEA 2JGUA 3SJJA 3IG1A 3TAQA 1WAFA 1LW2A 3RMDA 4E1MA 4O0JA 3LANA 3WNHA 4DU3A 2BGGA 1VRUA 2HHWA 3V9ZA 3RTVA 3NGYA 3ZSWA 1A5XA 3OVNA 1JLCA 1RNHA 3VQPA 3AVBA 4AHCA 4CFCA 4CJPA 3MEDA 3L2UA 3NGIA 2P5GA 3HJFA 3AO2A 3AVAA 4AHUA 3SI6A 4KI4A 2KZZA 4K8ZA 1IG9A 1MU2A 3RR8A 3MAQA 4CEDA 4C8NA 3OYEA 1Q8IA 2JLEA 3NGZA 5KRTA 2FBXA 3G10A 4DU4A 4PQUA 3QLHA 1QQCA 1VSFA 3PX4A 1U45A 4I2QA 1LWFA 4RW6A 4CFDA 1S6PA 2Y1JA 4FK4A 2NUBA 4DTJA 5HRSA 4J2AA 4ELTA 1X1PA 2A1RA 1NJZA 4N76A 1QSSA 4F2RA 1JLAA 3VQ5A 4B9VA 4O5BA 4RW4A 1LWCA 2RPIA 3SUOA 2Z1IA 3B6OA 1JL2A 1KFDA 3AVLA 4W5QA 3QO9A 3S3MA 1KFSA 4DSIA 3NF9A 4B9NA 1D9FA 3IS9A 4FJ5A 3CM5A 3OYIA 1RTIA 2YKNA 4CJFA 4JS5A 4F4KA 2XY5A 2PYLA 4M3WA 4CHQA 4KRFA 3WNEA 4AHVA 3L2VA 3F9KA 2RKIA 3AVFA 3NE6A 1BGXT 1J54A 3CFOA 3PUFA 2F8SA 3TAPA 3VN5A 5CYMA 2XY8A 4CCHA 2Z1HA 4BE1A 4I9QA 3QNNA 3QIOA 4DTNA 3ZSVA 1BHLA 1X9WA 4IBNA 1S6QA 1TK0A 4I7FA 1U49A 2ITGA 3AVCA 3NBPA 1IKXA 4KB0A 2E4LA 3LPUA 1SL1A 1NK7A 1B92A 2IC3A 4FM1A 1A5WA 1NKCA 1Z25A 3DLGA 4B08A 3NFAA 3KKSA 4DFKA 1NKEA 3QERA 5J2PA 1Y97A 1WLJA 2FC0A 3KLGA 4L8RB 1S1VA 2RF2A 2O4IA 2A1SA 3ZSOA 3AVNA 1RT2A 4NYFA 1RBVA 1VSHA 4YNQA 1A5VA 4OPKA 4FW2A 1JLQA 4CF9A 3RMBA 1T05A 3SQ2A 4C8LA 4DQIA 4CJRA 3P1GA 1TV6A 2QK9A 2IGIA 1WSEA 1BIZA 2YV0X 4CGFA 1J5OA 4KI6A 3AVGA 4Q5VA 3QEXA 4FJ9A 4N5SA 3OYDA 4ELUA 4AHSA 3L2WA 4OLAA 2HNZA 2FBYA 2D0AA 2HNDA 3K58A 1C1CA 3V9UA 3S3OA 1L3UA 4CE9A 1HYVA 4OKEA 3TI0A 1CZBA 3MXJA 3K5LA 1BQMA 4FJLA 3DMJA 2VG7A 4DTPA 4M3YA 4MQ3A 3DI6A 1XHXA 2YNFA 4GW6A 3HL8A 4ZHRA 4FJIA 3U6FA 1SKRA 4LY7A 3KIOA 4O0IA 2OA8A 1C6VA 1HYSA 1RBRA 3MEGA 4CHZA 4F8RA 4M3RA 2I5JA 4G1QA 4FJGA 1WAJA 1S1UA 3ZT3A 3VQ8A 2OZSA 1Q9XA 5SZTA 3K5NA 3SUPA 2VWKA 1RBSA 1RT3A 1C0MA 3S3NA 4B9LA 1UAXA 4DQSA 4M45A 3HPHA 4HCCA 1RT1A 3ZSYA 3M8SA 3HP6A 4DTUA 3SQ1A 4GMJB 2G8UA 1EKEA 2D5RA 1ZBFA 3TAFA 3AA2A 1DTQA 3LP0A 1U4BA 2B4JA 3ITHA 4Z4EA 1WSHA 1JXEA 3T1AA 3B6PA 2HMIA 4O4GA 3TAGA 2PZSA 5HBMA 3VQ6A 5JS2A 3K57A 3QNOA 4KKOA 1S9GA 4HUEA 5HLFA 3HPOA 1QSYA 4FJJA 5JS1A 3LAMA 1NOZA 1C1BA 4Q0BA 3V9XA 3CFPA 3V81A 4O44A 5I42A 4C8OA 4TSXA 3NDKA 3HPGA 1B9FA 2DFFA 3DRRA 4IFVA 2OPSA 4BWMA 3ZT4A 4DFJA 3S9HA 1GOBA 4CJTA 2HHQA 3QEWA 3C6UA 1SV5A 4FJKA 4CF1A 4CGJA 1TAUA 4CK3A 3IRXA 3OYGA 4E7HA 3DRPA 1BIUA 4DF8A 3SNNA 2OPRA 3WNFA 3SZ2A 3EYZA 1BCOA 5J2QA 4N41A 4OGCA 3VA0A 4H8KA 3T19A 3LAKA 2Z1JA 1RILA 1RTHA 2X78A 3NF8A 4OGEA 3ZT2A 2HHVA 3I0SA 1XWLA 1CXUA 3NH1A 3O3FA 5J2MA 1YTAA 4AH9A 3QETA 2B6AA 3L3UA 1BL3A 3KLHA 1QE1A 5SWMA 4Z4GA 1TKDA 3OS2A 1VSEA 4KO0A 1WSGA 2O4GA 2WOMA 5E41A 4DS4A 1IKWA 1GOAA 4OJRA 3VQQA 5HRNA 2P1JA 1VK0A 3KD1E 1BCMA 4FJNA 3NHGA 3L2RA 3NCIA 3AVJA 1IO2A 1JLFA 4RW7A 4RW8A 1Z26A 4PA1A 2P51A 4K8XA 1NK4A 1RT7A 1O1WA 4IFYA 3O4NA 3JSMA 1RBTA 3LALA 4JRQA 2HVIA 4EP5A 3ULDA 2EHGA 3EY1A 1NK6A 3SYZA 4CJKA 2ZQBA 4W5TA 4KTQA 4FM0A 2X6SA 5K14A 4CEQA 4BE2A 3AV9A 1X9MA 4FW1A 3RRGA 4FJMA 4J2DA 2Q3SA 3NH2A 1BI4A 1NK9A 4I2PA 2DTUA 1L3VA 4FZZA 3DRSA 4FK0A 4CFAA 4B9TA 1QSLA 1D9DA 4LH5A 3KK1A 4DQRA 3SPZA 1ZBIA 5J2NA 3QEIA 3HK2A 4CJEA 4KAZA 2OZMA 3KLIA 3PX0A 3ZT0A 3KK2A 4CJ5A 2X6NA 3V6DA 4KHYA 1NK8A 3M8RA 3NF6A 1TL1A 4RW9A 1JKHA 1EX4A 2VG5A 1BISA 3AVKA 3OYLA 3QINA 3CFRA 4FXDA 2D0BA 3I8DA 3MEEA 3O3HA 5KI6A 4Z4HA 4Z0UA 1I3AA 4CIGA 3TWHA 1TGOA 3RMAA 4B3OA 4M3TA 4WE1A 2XHBA 2F96A 4BDYA 3LP2A 4HHTA 1IH7A 3HSTB 2F8TA 3KLEA 1DTTA 4FJXA 5CZ2A 1W0HA 4KHSA 3ASMA 4CK1A 5C24A 4UQGA 2G8KA 2E6LA 3DLHA 2HHUA 2IS3A 1JXBA 4HUFA 4C8KA 3VQ7A 4FLXA 4E1NA 1JLBA 5CY4A 3OYMA 4NCAA 5FRMA 2E6MA 4CF2A 4QCLA 2OPPA 3DYAA 5HRRA 1VSLA 4BWJA 1K6YA 1B9DA 1RDCA 1TL3A 4KHQA 3WNGA 2XY7A 3BGRA 4FZXC 3ZSRA 1NJXA 4KTZA 3HVRA 4FCYA 4Z4IA 1BQNA 1WSFA 3C6TA 3OYNA 3DLBA 4J2EA 1S1XA 3DLRA 4ICLA 4M3ZA 4AILC 1UWBA 3HYFA 2HHTA 3ISNC 4IG3A 1HMVA 3CQ8A 1NK5A 5HP1A 2XRIA 5HRPA 4CF8A 1ITGA 2G8FA 3V4IA 4PWDA 1TAQA 3MXMA 4KFBA 3LWMA 4M3XA 4FLWA 4NCGA 4OPJA 4F2SA 3H08A 4KTWA 3KK3A 4FLTA 3CM6A 3TR8A 4ZTFA 3ZSXA 4EZ9A 1BI4B 3AO1A 2YNGA 1D5AA 1KLNA 2HB5A 1J53A 2PYJA 3QIPA 1HRHA 4DSKA 3K59A 4Y1DA 1L3SA 3HT3A 1TKXA 3ZSZA 4DMNA 4DTSA 3OJUA 3QEVA 3PV8A 3ZCMA 1QS4A 3LP1A 4O55A 4JS4A 4HUGA 4BE0A 4FM2A 4AHRA 4E3SA 3PO5A 4I9LA 1X9SA 1HNVA 4E7IA 1XC9A 1KVAA 1NJYA 3E01A 1S5JA 3CG7A 1NKBA 1T7PA 4CGGA 1GOCA 1ZBUA 3I0RA 4W5RA 3HVTA 3TAMA 5I3UA 2YHAA 1REVA 4DLGA 1TK5A 3K2PA 1LWEA 2IDOA 2G8HA 4FJHA 3AVIA 3QESA 2KTQA 4DTMA 1RCHA 4FLZA 3SQ0A 1HQUA 4B8AB 4BDPA 4FZYA 4CEBA 3DOLA 4B9SA 3ALYA 4CGHA 2BANA 1SL0A 5FDLA 1HQEA 4XIUA 2G8VA 1HYZA 1VRTA 4CEOA 4CJUA 3DM2A 4DG1A 4CIFA 3HP9A 4DF4A 5C42A 3P83D 3TAEA 1EETA 4OKKA 3LP3A 3U3GA 1VSMA 3OS0A 5DMRA 4DU1A 1KTQA 1YVUA 4DTOA 2KFNA 1WSJA 3NAEA 2ZE2A 4NYNA 1UA0A 3ZT1A 2IAJA 3THVA 1U04A 3VQAA 2PY5A 4OVLA 2FBVA 3HO1A 5KRSA 2FBTA 4CFBA 2ZD1A 1ZBLA 3TANA 3KJVA 4M42A 2HVHA 1KLMA 1RT5A 1S9EA 3KKRA 5FRNA 3OYAA 4CJWA 4CHOA 1VSJA 4EZ6A 1NK0A 3LZIA 3AA5X 3SCXA 1R0AA 2DY4A 3JYTA 4F3TA 4FJ7A 2EX3A 3L8BA 4CEEA 3O3GA 1LAVA 5KGWA 4Z4CA 1CLQA 4KHWA 4FYDA 3FFIA 4FVMA 1JL1A 3AO4A 4AHTA 5FROA 3LWLA 1JLGA 1NJWA 3VQBA 1D8YA 1ASVA 2XY6A 4B9MA 4Y1CA 4Z4FA 1FKOA 1T8EA 3VQ9A 4KV8A 4KHNA 1C0UA 2X74A 3HXMA 4DFMA 4BACA 3SQ4A 1YTUA 1G15A 2W42A 1RTJA 5KTQA 2QKKA 4CESA 3AVMA 1J9AA 4JRPA 3KD5E 3P5JA 5HROA 3DOKA 4LSLA 3C95A 1N5YA 1ZBHA 4J2BA 4B9UA 3OS1A 1RDDA 4DWIA 4CJ4A 4DSEA 2BDPA 3IAYA 2AJQA 4NCBA 3TABA 4E0DA 1ASUA 4CGIA 3QEPA 3TARA 2HHSA 3D0PA 2XO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YT3 A;  3D45 A;  3OYB A;  5DK5 A;  4N47 A;  4CK2 A;  4ID5 A;  1HNI A;  4DLE A;  1XI1 A;  1U47 A;  4F3O A;  4DS5 A;  3VA3 A;  3VQD A;  2IOC A;  4DTR A;  2VG6 A;  3V9S A;  1FXX A;  1SKW A;  4KPY A;  1VSK A;  1RT6 A;  4HVJ A;  4YFU A;  4KB1 A;  3V1O A;  3MXI A;  2KQ2 A;  3PO4 A;  1WN7 A;  5EU7 A;  1EP4 A;  1S1W A;  1KRP A;  1L3T A;  4CJ3 A;  3OYJ A;  1EXQ A;  1CZ9 A;  3LZJ A;  3AO3 A;  2B5J A;  3SV3 A;  3OYC A;  1N6Q A;  4GVM A;  4FJ8 A;  2QKB A;  2RN2 A;  5J1E A;  4W5O A;  1ZYQ A;  3O4Q A;  3SUQ A;  1KVB A;  4C8M A;  3SPY A;  1VSD A;  2KW4 A;  4DTX A;  4PUO A;  1UA1 A;  2DFH A;  1FKP A;  4LH4 A;  4CEC A;  4DFP A;  2ETJ A;  2Y1I A;  3KTQ A;  4KHU A;  3SV4 A;  4IDK A;  4FLU A;  3K5O A;  1WSI A;  4H4O A;  2G8I A;  1FK9 A;  1LW0 A;  2YNH A;  2GUI A;  3AA3 A;  5T7B A;  2VWJ A;  5D3G A;  4CHY A;  3DLE A;  2R7Y A;  2LSN A;  1TK8 A;  3NH0 A;  4DSL A;  1U48 A;  2ATQ A;  2OYQ A;  1KSP A;  3EZ5 A;  4W5N A;  3HM9 A;  4FLY A;  1SKS A;  1HPZ A;  1SUQ A;  4M41 A;  4QOZ B;  4EP4 A;  4E7K A;  1UOC A;  1ASW A;  1TVR A;  5CYQ A;  4CJV A;  3OYK A;  3SUN A;  4ELV A;  4HCB A;  4E7J A;  4CER A;  1RBU A;  4CGD A;  1RDB A;  3G0Z A;  4LSN A;  1Q9Y A;  3PX6 A;  1VSI A;  4B8C A;  5KGX A;  4OKJ A;  2BE2 A;  3RRH A;  1C0T A;  3M8Q A;  1S1T A;  3V1Q A;  4PY5 A;  1QTM A;  1RT4 A;  1W9H A;  1IKY A;  3K5M A;  3VQE A;  3UIQ A;  4CHN A;  4JLH A;  3OJS A;  4DSF A;  1CXQ A;  2GV9 A;  3VQC A;  1XHZ A;  4ID1 A;  4CEF A;  4E7L A;  2P5O A;  3MEC A;  1TKT A;  5CZ1 A;  4HTU A;  3NF7 A;  4E19 A;  3F73 A;  3OY9 A;  1DLO A;  4E89 A;  3AO5 A;  2HW3 A;  3M8P A;  3ZSQ A;  2G8W A;  3AVH A;  3L3V A;  3AA4 A;  1C1A A;  2QXF A;  3U3Y A;  4ZTJ A;  3OYH A;  1LV5 A;  3OYF A;  3L2Q A;  3CYM A;  1KVC A;  4CF0 A;  4CJQ A;  3LDS A;  1NOY A;  4LD0 A;  2KFZ A;  3T3F A;  4CJL A;  4N56 A;  4FLV A;  1LAW A;  1SL2 A;  1I39 A;  2D0C A;  4FK2 A;  4MFB A;  2WON A;  4IKF A;  4CHP A;  1KCF A;  3DLK A;  3RWU A;  3V1R A;  5C25 A;  4M3U A;  2YKM A;  3C94 A;  3LPT A;  3RR7 A;  2HHX A;  4H4M A;  3RMC A;  3PY8 A;  2DFE A;  3BDP A;  4KRE A;  4CEZ A;  1F21 A;  2YHB A;  4QAG A;  2YNI A;  4DSJ A;  2GBZ A;  3VQ4 A;  1QHT A;  4IG0 A;  4RG8 A;  4CEA A;  1TKZ A;  1WNS A;  4CJS A;  1RTD A;  4BDZ A;  3KLF A;  2KZM A;  1IKV A;  2OPQ A;  2Z1G A;  3A2F A;  1L5U A;  4OLB A;  1T03 A;  2HNY A;  1HJR A;  3V9W A;  4DQQ A;  4DQP A;  4CIE A;  1RDA A;  4R5P A;  1JLE A;  2JGU A;  3SJJ A;  3IG1 A;  3TAQ A;  1WAF A;  1LW2 A;  3RMD A;  4E1M A;  4O0J A;  3LAN A;  3WNH A;  4DU3 A;  2BGG A;  1VRU A;  2HHW A;  3V9Z A;  3RTV A;  3NGY A;  3ZSW A;  1A5X A;  3OVN A;  1JLC A;  1RNH A;  3VQP A;  3AVB A;  4AHC A;  4CFC A;  4CJP A;  3MED A;  3L2U A;  3NGI A;  2P5G A;  3HJF A;  3AO2 A;  3AVA A;  4AHU A;  3SI6 A;  4KI4 A;  2KZZ A;  4K8Z A;  1IG9 A;  1MU2 A;  3RR8 A;  3MAQ A;  4CED A;  4C8N A;  3OYE A;  1Q8I A;  2JLE A;  3NGZ A;  5KRT A;  2FBX A;  3G10 A;  4DU4 A;  4PQU A;  3QLH A;  1QQC A;  1VSF A;  3PX4 A;  1U45 A;  4I2Q A;  1LWF A;  4RW6 A;  4CFD A;  1S6P A;  2Y1J A;  4FK4 A;  2NUB A;  4DTJ A;  5HRS A;  4J2A A;  4ELT A;  1X1P A;  2A1R A;  1NJZ A;  4N76 A;  1QSS A;  4F2R A;  1JLA A;  3VQ5 A;  4B9V A;  4O5B A;  4RW4 A;  1LWC A;  2RPI A;  3SUO A;  2Z1I A;  3B6O A;  1JL2 A;  1KFD A;  3AVL A;  4W5Q A;  3QO9 A;  3S3M A;  1KFS A;  4DSI A;  3NF9 A;  4B9N A;  1D9F A;  3IS9 A;  4FJ5 A;  3CM5 A;  3OYI A;  1RTI A;  2YKN A;  4CJF A;  4JS5 A;  4F4K A;  2XY5 A;  2PYL A;  4M3W A;  4CHQ A;  4KRF A;  3WNE A;  4AHV A;  3L2V A;  3F9K A;  2RKI A;  3AVF A;  3NE6 A;  1BGX T;  1J54 A;  3CFO A;  3PUF A;  2F8S A;  3TAP A;  3VN5 A;  5CYM A;  2XY8 A;  4CCH A;  2Z1H A;  4BE1 A;  4I9Q A;  3QNN A;  3QIO A;  4DTN A;  3ZSV A;  1BHL A;  1X9W A;  4IBN A;  1S6Q A;  1TK0 A;  4I7F A;  1U49 A;  2ITG A;  3AVC A;  3NBP A;  1IKX A;  4KB0 A;  2E4L A;  3LPU A;  1SL1 A;  1NK7 A;  1B92 A;  2IC3 A;  4FM1 A;  1A5W A;  1NKC A;  1Z25 A;  3DLG A;  4B08 A;  3NFA A;  3KKS A;  4DFK A;  1NKE A;  3QER A;  5J2P A;  1Y97 A;  1WLJ A;  2FC0 A;  3KLG A;  4L8R B;  1S1V A;  2RF2 A;  2O4I A;  2A1S A;  3ZSO A;  3AVN A;  1RT2 A;  4NYF A;  1RBV A;  1VSH A;  4YNQ A;  1A5V A;  4OPK A;  4FW2 A;  1JLQ A;  4CF9 A;  3RMB A;  1T05 A;  3SQ2 A;  4C8L A;  4DQI A;  4CJR A;  3P1G A;  1TV6 A;  2QK9 A;  2IGI A;  1WSE A;  1BIZ A;  2YV0 X;  4CGF A;  1J5O A;  4KI6 A;  3AVG A;  4Q5V A;  3QEX A;  4FJ9 A;  4N5S A;  3OYD A;  4ELU A;  4AHS A;  3L2W A;  4OLA A;  2HNZ A;  2FBY A;  2D0A A;  2HND A;  3K58 A;  1C1C A;  3V9U A;  3S3O A;  1L3U A;  4CE9 A;  1HYV A;  4OKE A;  3TI0 A;  1CZB A;  3MXJ A;  3K5L A;  1BQM A;  4FJL A;  3DMJ A;  2VG7 A;  4DTP A;  4M3Y A;  4MQ3 A;  3DI6 A;  1XHX A;  2YNF A;  4GW6 A;  3HL8 A;  4ZHR A;  4FJI A;  3U6F A;  1SKR A;  4LY7 A;  3KIO A;  4O0I A;  2OA8 A;  1C6V A;  1HYS A;  1RBR A;  3MEG A;  4CHZ A;  4F8R A;  4M3R A;  2I5J A;  4G1Q A;  4FJG A;  1WAJ A;  1S1U A;  3ZT3 A;  3VQ8 A;  2OZS A;  1Q9X A;  5SZT A;  3K5N A;  3SUP A;  2VWK A;  1RBS A;  1RT3 A;  1C0M A;  3S3N A;  4B9L A;  1UAX A;  4DQS A;  4M45 A;  3HPH A;  4HCC A;  1RT1 A;  3ZSY A;  3M8S A;  3HP6 A;  4DTU A;  3SQ1 A;  4GMJ B;  2G8U A;  1EKE A;  2D5R A;  1ZBF A;  3TAF A;  3AA2 A;  1DTQ A;  3LP0 A;  1U4B A;  2B4J A;  3ITH A;  4Z4E A;  1WSH A;  1JXE A;  3T1A A;  3B6P A;  2HMI A;  4O4G A;  3TAG A;  2PZS A;  5HBM A;  3VQ6 A;  5JS2 A;  3K57 A;  3QNO A;  4KKO A;  1S9G A;  4HUE A;  5HLF A;  3HPO A;  1QSY A;  4FJJ A;  5JS1 A;  3LAM A;  1NOZ A;  1C1B A;  4Q0B A;  3V9X A;  3CFP A;  3V81 A;  4O44 A;  5I42 A;  4C8O A;  4TSX A;  3NDK A;  3HPG A;  1B9F A;  2DFF A;  3DRR A;  4IFV A;  2OPS A;  4BWM A;  3ZT4 A;  4DFJ A;  3S9H A;  1GOB A;  4CJT A;  2HHQ A;  3QEW A;  3C6U A;  1SV5 A;  4FJK A;  4CF1 A;  4CGJ A;  1TAU A;  4CK3 A;  3IRX A;  3OYG A;  4E7H A;  3DRP A;  1BIU A;  4DF8 A;  3SNN A;  2OPR A;  3WNF A;  3SZ2 A;  3EYZ A;  1BCO A;  5J2Q A;  4N41 A;  4OGC A;  3VA0 A;  4H8K A;  3T19 A;  3LAK A;  2Z1J A;  1RIL A;  1RTH A;  2X78 A;  3NF8 A;  4OGE A;  3ZT2 A;  2HHV A;  3I0S A;  1XWL A;  1CXU A;  3NH1 A;  3O3F A;  5J2M A;  1YTA A;  4AH9 A;  3QET A;  2B6A A;  3L3U A;  1BL3 A;  3KLH A;  1QE1 A;  5SWM A;  4Z4G A;  1TKD A;  3OS2 A;  1VSE A;  4KO0 A;  1WSG A;  2O4G A;  2WOM A;  5E41 A;  4DS4 A;  1IKW A;  1GOA A;  4OJR A;  3VQQ A;  5HRN A;  2P1J A;  1VK0 A;  3KD1 E;  1BCM A;  4FJN A;  3NHG A;  3L2R A;  3NCI A;  3AVJ A;  1IO2 A;  1JLF A;  4RW7 A;  4RW8 A;  1Z26 A;  4PA1 A;  2P51 A;  4K8X A;  1NK4 A;  1RT7 A;  1O1W A;  4IFY A;  3O4N A;  3JSM A;  1RBT A;  3LAL A;  4JRQ A;  2HVI A;  4EP5 A;  3ULD A;  2EHG A;  3EY1 A;  1NK6 A;  3SYZ A;  4CJK A;  2ZQB A;  4W5T A;  4KTQ A;  4FM0 A;  2X6S A;  5K14 A;  4CEQ A;  4BE2 A;  3AV9 A;  1X9M A;  4FW1 A;  3RRG A;  4FJM A;  4J2D A;  2Q3S A;  3NH2 A;  1BI4 A;  1NK9 A;  4I2P A;  2DTU A;  1L3V A;  4FZZ A;  3DRS A;  4FK0 A;  4CFA A;  4B9T A;  1QSL A;  1D9D A;  4LH5 A;  3KK1 A;  4DQR A;  3SPZ A;  1ZBI A;  5J2N A;  3QEI A;  3HK2 A;  4CJE A;  4KAZ A;  2OZM A;  3KLI A;  3PX0 A;  3ZT0 A;  3KK2 A;  4CJ5 A;  2X6N A;  3V6D A;  4KHY A;  1NK8 A;  3M8R A;  3NF6 A;  1TL1 A;  4RW9 A;  1JKH A;  1EX4 A;  2VG5 A;  1BIS A;  3AVK A;  3OYL A;  3QIN A;  3CFR A;  4FXD A;  2D0B A;  3I8D A;  3MEE A;  3O3H A;  5KI6 A;  4Z4H A;  4Z0U A;  1I3A A;  4CIG A;  3TWH A;  1TGO A;  3RMA A;  4B3O A;  4M3T A;  4WE1 A;  2XHB A;  2F96 A;  4BDY A;  3LP2 A;  4HHT A;  1IH7 A;  3HST B;  2F8T A;  3KLE A;  1DTT A;  4FJX A;  5CZ2 A;  1W0H A;  4KHS A;  3ASM A;  4CK1 A;  5C24 A;  4UQG A;  2G8K A;  2E6L A;  3DLH A;  2HHU A;  2IS3 A;  1JXB A;  4HUF A;  4C8K A;  3VQ7 A;  4FLX A;  4E1N A;  1JLB A;  5CY4 A;  3OYM A;  4NCA A;  5FRM A;  2E6M A;  4CF2 A;  4QCL A;  2OPP A;  3DYA A;  5HRR A;  1VSL A;  4BWJ A;  1K6Y A;  1B9D A;  1RDC A;  1TL3 A;  4KHQ A;  3WNG A;  2XY7 A;  3BGR A;  4FZX C;  3ZSR A;  1NJX A;  4KTZ A;  3HVR A;  4FCY A;  4Z4I A;  1BQN A;  1WSF A;  3C6T A;  3OYN A;  3DLB A;  4J2E A;  1S1X A;  3DLR A;  4ICL A;  4M3Z A;  4AIL C;  1UWB A;  3HYF A;  2HHT A;  3ISN C;  4IG3 A;  1HMV A;  3CQ8 A;  1NK5 A;  5HP1 A;  2XRI A;  5HRP A;  4CF8 A;  1ITG A;  2G8F A;  3V4I A;  4PWD A;  1TAQ A;  3MXM A;  4KFB A;  3LWM A;  4M3X A;  4FLW A;  4NCG A;  4OPJ A;  4F2S A;  3H08 A;  4KTW A;  3KK3 A;  4FLT A;  3CM6 A;  3TR8 A;  4ZTF A;  3ZSX A;  4EZ9 A;  1BI4 B;  3AO1 A;  2YNG A;  1D5A A;  1KLN A;  2HB5 A;  1J53 A;  2PYJ A;  3QIP A;  1HRH A;  4DSK A;  3K59 A;  4Y1D A;  1L3S A;  3HT3 A;  1TKX A;  3ZSZ A;  4DMN A;  4DTS A;  3OJU A;  3QEV A;  3PV8 A;  3ZCM A;  1QS4 A;  3LP1 A;  4O55 A;  4JS4 A;  4HUG A;  4BE0 A;  4FM2 A;  4AHR A;  4E3S A;  3PO5 A;  4I9L A;  1X9S A;  1HNV A;  4E7I A;  1XC9 A;  1KVA A;  1NJY A;  3E01 A;  1S5J A;  3CG7 A;  1NKB A;  1T7P A;  4CGG A;  1GOC A;  1ZBU A;  3I0R A;  4W5R A;  3HVT A;  3TAM A;  5I3U A;  2YHA A;  1REV A;  4DLG A;  1TK5 A;  3K2P A;  1LWE A;  2IDO A;  2G8H A;  4FJH A;  3AVI A;  3QES A;  2KTQ A;  4DTM A;  1RCH A;  4FLZ A;  3SQ0 A;  1HQU A;  4B8A B;  4BDP A;  4FZY A;  4CEB A;  3DOL A;  4B9S A;  3ALY A;  4CGH A;  2BAN A;  1SL0 A;  5FDL A;  1HQE A;  4XIU A;  2G8V A;  1HYZ A;  1VRT A;  4CEO A;  4CJU A;  3DM2 A;  4DG1 A;  4CIF A;  3HP9 A;  4DF4 A;  5C42 A;  3P83 D;  3TAE A;  1EET A;  4OKK A;  3LP3 A;  3U3G A;  1VSM A;  3OS0 A;  5DMR A;  4DU1 A;  1KTQ A;  1YVU A;  4DTO A;  2KFN A;  1WSJ A;  3NAE A;  2ZE2 A;  4NYN A;  1UA0 A;  3ZT1 A;  2IAJ A;  3THV A;  1U04 A;  3VQA A;  2PY5 A;  4OVL A;  2FBV A;  3HO1 A;  5KRS A;  2FBT A;  4CFB A;  2ZD1 A;  1ZBL A;  3TAN A;  3KJV A;  4M42 A;  2HVH A;  1KLM A;  1RT5 A;  1S9E A;  3KKR A;  5FRN A;  3OYA A;  4CJW A;  4CHO A;  1VSJ A;  4EZ6 A;  1NK0 A;  3LZI A;  3AA5 X;  3SCX A;  1R0A A;  2DY4 A;  3JYT A;  4F3T A;  4FJ7 A;  2EX3 A;  3L8B A;  4CEE A;  3O3G A;  1LAV A;  5KGW A;  4Z4C A;  1CLQ A;  4KHW A;  4FYD A;  3FFI A;  4FVM A;  1JL1 A;  3AO4 A;  4AHT A;  5FRO A;  3LWL A;  1JLG A;  1NJW A;  3VQB A;  1D8Y A;  1ASV A;  2XY6 A;  4B9M A;  4Y1C A;  4Z4F A;  1FKO A;  1T8E A;  3VQ9 A;  4KV8 A;  4KHN A;  1C0U A;  2X74 A;  3HXM A;  4DFM A;  4BAC A;  3SQ4 A;  1YTU A;  1G15 A;  2W42 A;  1RTJ A;  5KTQ A;  2QKK A;  4CES A;  3AVM A;  1J9A A;  4JRP A;  3KD5 E;  3P5J A;  5HRO A;  3DOK A;  4LSL A;  3C95 A;  1N5Y A;  1ZBH A;  4J2B A;  4B9U A;  3OS1 A;  1RDD A;  4DWI A;  4CJ4 A;  4DSE A;  2BDP A;  3IAY A;  2AJQ A;  4NCB A;  3TAB A;  4E0D A;  1ASU A;  4CGI A;  3QEP A;  3TAR A;  2HHS A;  3D0P A;  2XO7 A; 
#chains in the Genus database with same CATH topology
 4CK2 A;  1XC3 A;  1U47 A;  4DTR A;  3V9S A;  3FFK B;  3MXI A;  2A3Z A;  3ZX0 A;  1EP4 A;  1HKB A;  5KPT A;  3AO3 A;  3QBW A;  2B5J A;  1BU6 O;  5J1E A;  1ZYQ A;  1KVB A;  2O8C A;  3VEX A;  1VSD A;  4MDB A;  1KAY A;  4PUO A;  1UA1 A;  4LFA K;  4B1X B;  1FKP A;  4JI8 K;  3DXM B;  2BTF A;  2HOE A;  3K5O A;  1WSI A;  4H4O A;  4B9Q A;  3VGM A;  5D3G A;  3NH0 A;  4DSL A;  4FWS A;  1U48 A;  3QML A;  2ATQ A;  3AAP A;  1KSP A;  3EZ5 A;  2P9U B;  4M41 A;  3B8A X;  4EP4 A;  1UOC A;  5CYQ A;  5AFU A;  1RBU A;  4IDH A;  4M7Y A;  2E2O A;  1VSI A;  1QQO A;  1S1T A;  5AQH A;  1IKY A;  3UKR A;  3VQE A;  3RVC A;  4E7L A;  4E19 A;  3OY9 A;  1DLO A;  1CZA N;  3AO5 A;  3TTC A;  3L3V A;  4ZTJ A;  3VEV A;  4CJQ A;  3EN9 A;  1GLE G;  4LD0 A;  2D0C A;  2KLA A;  2GEM A;  1KCF A;  5C25 A;  4ISE A;  3C94 A;  3RR7 A;  4H4M A;  4WQ5 A;  4CEZ A;  2HBM A;  2YHB A;  4DSJ A;  2GBZ A;  1QHT A;  4CJS A;  2WBN A;  4BDZ A;  3I55 N;  1T03 A;  2HNY A;  3VGK A;  3R3L A;  3J7Z O;  4ILG B;  1JLE A;  3R8E A;  1WAF A;  3WNH A;  1HJO A;  3G4S N;  3NGI A;  4CFC A;  4AHC A;  2YCH A;  3AO2 A;  4EHT A;  2D1K A;  4BRO A;  2KZZ A;  3VPZ A;  3RR8 A;  1MDU B;  3OYE A;  4DU4 A;  5KRT A;  2FBX A;  4MO5 A;  1QQC A;  3K0S A;  1VSF A;  1U45 A;  1S6P A;  4DTJ A;  3AGK A;  1X1P A;  2A6A A;  1VQP N;  1QSS A;  4RW4 A;  1JL2 A;  3AVL A;  3L4Q A;  4JI1 K;  3S3M A;  2P9I B;  4BRL A;  1D9F A;  2QEX N;  4B9N A;  3IS9 A;  5TKY A;  2W41 A;  2QM1 A;  1RTI A;  4CJF A;  4BRE A;  3A0I X;  2F9W A;  3CCQ N;  1I94 K;  3VEN A;  3NE6 A;  3HRG A;  3TAP A;  3MDQ A;  5CYM A;  2XY8 A;  2HF3 A;  4I9Q A;  2UYT A;  4JKD A;  2UU9 K;  4CZF A;  1U49 A;  3AVC A;  2O8D A;  1IKX A;  1HNW K;  2IC3 A;  5JLH A;  4IOA L;  5GIN A;  4DFK A;  3ZSO A;  3AVN A;  3A5M C;  5LMN K;  1RBV A;  3RMB A;  4CF9 A;  1T05 A;  5AQO A;  3SQ2 A;  3P1G A;  1QQN A;  2NRV A;  1TV6 A;  2IGI A;  2YV0 X;  1J5O A;  1VQ6 N;  1YJN N;  4FJ9 A;  3OYD A;  1S22 A;  4AHS A;  3K58 A;  3S3O A;  1N34 K;  1L3U A;  1FJG K;  4JKF A;  4DKW A;  3K5L A;  4CZK A;  3DMJ A;  2VG7 A;  4MQ3 A;  1XHX A;  4ZHR A;  2OA8 A;  1QZ5 A;  1T6C A;  1RBR A;  2WFB A;  4CHZ A;  4M3R A;  3O1W A;  4FJG A;  4FO0 A;  4YOW A;  4DV3 K;  2I7N A;  3ZT3 A;  3N4Q A;  4BRI A;  1Q9X A;  2VWK A;  1RT3 A;  1C0M A;  3S3N A;  3AY9 A;  1UAX A;  2VGN A;  1J5E K;  4FWP A;  4X64 K;  3FLC O;  4B3R K;  3TAF A;  1SAZ A;  1J6Z A;  3LP0 A;  4BR0 A;  2B4J A;  3CER A;  1WSH A;  3B6P A;  3VTH A;  2VYP A;  4KKO A;  4KH5 A;  4Q0B A;  3CFP A;  3V81 A;  1NNE A;  3NDK A;  3CC2 N;  3NMU A;  4Y0W A;  3O08 A;  2OPS A;  4DFJ A;  1GLL O;  2UUB K;  4LF9 K;  3OHR A;  4JEP A;  4MLH A;  2QXL A;  3QEW A;  1N33 K;  1ATN A;  4CF1 A;  3THW A;  3THY A;  4E7H A;  5CHI A;  1BIU A;  2OPR A;  3SZ2 A;  5E84 A;  3O9U A;  3CJC A;  3LDQ A;  5I9E B;  2YHY A;  4B3S K;  1RIL A;  2X78 A;  2HHV A;  3WEE B;  1XWL A;  1CXU A;  3NH1 A;  1V4T A;  4H0P A;  2VWB A;  1LOT B;  1QE1 A;  5SWM A;  4BR9 A;  3OS2 A;  4DQ8 A;  5E41 A;  4DS4 A;  3DXM A;  1GOA A;  1VK0 A;  3NHG A;  5H1S Q;  3NCI A;  1IO2 A;  2Q0U A;  4F9O A;  1TUY A;  4RW8 A;  1VHX A;  2YHW A;  3O4N A;  1RBT A;  1NMN A;  3O6W A;  2HVI A;  3ULD A;  3EY1 A;  4KTQ A;  3QIC A;  2X6S A;  4YHH K;  5K14 A;  4BRH A;  2FSJ A;  2IIR A;  1X9M A;  4FJM A;  4H0O A;  3J8A A;  2DTU A;  3DRS A;  4FK0 A;  1HR0 K;  4CFA A;  1QSL A;  1D9D A;  3UB5 A;  1KQS M;  3SPZ A;  2ASO A;  3ATV A;  4CJE A;  4KAZ A;  4KH6 A;  3ID8 A;  3NF6 A;  3P4I A;  1JKH A;  3JXU A;  1EX4 A;  4JI7 K;  1BIS A;  4FXD A;  3CFR A;  5KI6 A;  4Z0U A;  1OH8 A;  2NLX A;  3SK3 A;  5AJ3 K;  3RMA A;  3R1X A;  4WE1 A;  5A2Q O;  3LP2 A;  4J8F A;  5AQF A;  3EE8 A;  1DTT A;  3WT0 A;  4IEI A;  1W0H A;  3ASM A;  3DLH A;  3SLC A;  2HHU A;  4C8K A;  4OPA A;  3ZYY X;  5HRR A;  3WNG A;  3ZSR A;  4JI4 K;  1WSF A;  1S1X A;  5GAE P;  1UWB A;  4AIL C;  4EHU A;  3ISN C;  4H5V A;  3D7E O;  3CQ8 A;  4CF8 A;  2G8F A;  3U8X A;  3V4I A;  3G6E N;  4M3X A;  4BC4 A;  3TU5 A;  3FZF A;  2ZWH A;  3WXM B;  3ULE A;  4LF7 K;  3VF4 A;  5AQS A;  3J7A P;  3TR8 A;  1MWK A;  3ZSX A;  4M63 C;  1BI4 B;  2YNG A;  1J53 A;  1NGB A;  3VEO A;  3QEV A;  4AF1 A;  5TKW A;  1QS4 A;  3LP1 A;  4O55 A;  4HUG A;  4AHR A;  3C0B A;  2HHH K;  1HNV A;  4C23 A;  3U9D A;  1XC9 A;  1NJY A;  1BA1 A;  1YF5 L;  4BRC A;  2P9I A;  3CG7 A;  1T7P A;  4DR6 K;  3I0R A;  3HVT A;  3TAM A;  2G8H A;  4QOZ B;  5IT9 O;  3K2P A;  1LWE A;  3AVI A;  1EWQ A;  2ZJR L;  1HQU A;  5BR8 K;  4CEB A;  1NGE A;  3DOL A;  3ALY A;  3M3Z A;  4CGH A;  5FDL A;  4XIU A;  2G8V A;  2IVN A;  1VRT A;  4CJU A;  4CIF A;  4DF4 A;  3TAE A;  3MN7 A;  3OS0 A;  3T7Z A;  5DMR A;  4MO4 A;  1YVU A;  1UA0 A;  3ZT1 A;  1U04 A;  4JI6 K;  4OVL A;  3CMA N;  5JVG L;  1KLM A;  1SQK A;  5AZJ B;  3CQX A;  3L0Q A;  1VSJ A;  3LZI A;  5E26 A;  4F3T A;  3I8B A;  3O3G A;  5KGW A;  4KHW A;  3VMF B;  2QWR A;  3KWG A;  1K8K A;  4O5F A;  3ZEU B;  2XY6 A;  3HXM A;  1TYQ B;  1RTJ A;  4CI6 A;  3IKM A;  3P5J A;  4FVU A;  3C95 A;  3ZET B;  1ZBH A;  3F5T A;  4YY3 K;  3OS1 A;  1RDD A;  2D0O A;  3HM8 A;  3FR0 A;  1XMO K;  3M1F A;  1HNZ K;  1QVF M;  3D45 A;  4N47 A;  3G25 A;  4ID5 A;  1HNI A;  3D2E A;  1XI1 A;  3F9M A;  2HBJ A;  2IOC A;  2VG6 A;  4BRM A;  4CBW A;  1VSK A;  4YFU A;  3J80 O;  3V1O A;  1S1W A;  4C1N I;  1CZ9 A;  3OYC A;  2KW4 A;  5AQJ A;  4DTX A;  5JIC A;  4LH4 A;  2ETJ A;  4V19 S;  3OBW A;  5EX5 A;  3SV4 A;  2FF3 B;  3O9R A;  2G8I A;  3O4W A;  1FK9 A;  1LW0 A;  2YNH A;  2GUI A;  4BR7 A;  3QBX A;  2VWJ A;  1KD1 O;  2R7Y A;  2LSN A;  4W5N A;  3A8Y A;  4FLY A;  1ASW A;  4CJV A;  1G99 A;  5KQ8 A;  2O8B A;  1RDU A;  4CER A;  4CGD A;  3H45 C;  3PX6 A;  3CCU N;  5KGX A;  4OKJ A;  3M8Q A;  1TUU A;  3QDK A;  3UIQ A;  2BH1 A;  4JLH A;  4JAX A;  4DSF A;  3CI5 A;  4JK8 A;  1XHZ A;  3SAG A;  3MEC A;  1TKT A;  3N4P A;  3NF7 A;  4E89 A;  3ZSQ A;  5AQQ A;  3AVH A;  2V52 B;  4DCH A;  3CYM A;  4CF0 A;  1NOY A;  2KFZ A;  3T3F A;  4CJL A;  1I39 A;  3WQU A;  4IKF A;  3RWU A;  3LPT A;  3MN9 A;  1WB9 A;  2DFE A;  3BDP A;  5EVZ A;  3WXI A;  1F21 A;  4KHP K;  3ZX3 A;  4ILJ A;  2HBL A;  3ZLJ A;  4CEA A;  1TKZ A;  1WNS A;  2F4V K;  3A5L C;  3KLF A;  4OLB A;  2A40 A;  3OA9 A;  1OH6 A;  3SJJ A;  4B3T K;  3TAQ A;  3RMD A;  2BGG A;  3LAN A;  1K8A O;  4E1J A;  1JLC A;  3VQP A;  4CJP A;  3HJF A;  4AHU A;  4K8Z A;  3SAF A;  3MAQ A;  2JLE A;  3QLH A;  5EOY A;  3PX4 A;  4RWT A;  3DLL L;  4MLE A;  2Y1J A;  2NUB A;  4B1Z A;  2JWK A;  4ELT A;  2A1R A;  4F2R A;  1VAZ A;  3VQ5 A;  3BZC A;  1RFQ A;  4BVO A;  3QO9 A;  4HWI A;  4I6M A;  5FPD A;  3CJ1 A;  4BG9 A;  2GEL A;  3K9J A;  4F4K A;  4JS5 A;  1ZXO A;  3L6Q A;  3L2V A;  4DV4 K;  2CGK A;  3PUF A;  4CCH A;  1SZ2 A;  4BE1 A;  3QNN A;  3QIO A;  1YXQ A;  5AQP A;  1X9W A;  1NU0 A;  4KB0 A;  2E5L K;  1SL1 A;  2E8A A;  1NK7 A;  4FM1 A;  1ATR A;  1A5W A;  3DLG A;  4B08 A;  2AA4 A;  1NKE A;  1Q82 O;  4BRQ A;  2FC0 A;  3RSE A;  3KLG A;  2RF2 A;  1IV0 A;  2QWL A;  4NYF A;  3VOV A;  1A5V A;  4YNQ A;  1N36 K;  1X3N A;  4CJR A;  4BC5 A;  4AM6 A;  3IUC A;  2HST A;  1VQ5 N;  4ELU A;  3L2W A;  4OLA A;  2HNZ A;  3GE1 A;  3MMV A;  1C1C A;  3TTF A;  3V9U A;  3C7N A;  4CE9 A;  1HYV A;  1CZB A;  3MXJ A;  4FJL A;  1BQM A;  4IO8 A;  2ITM A;  4B1U B;  2YNF A;  4CD1 A;  4FJI A;  1SKR A;  1NBW A;  3H46 O;  5C15 A;  2E2Q A;  3O8M A;  2I5J A;  5M1F A;  3ATU A;  3VTI A;  4PKH A;  5SZT A;  3K5N A;  5AZI A;  1RBS A;  2P9K B;  4IJA A;  2O8F B;  2QWN A;  4DQS A;  1NM1 A;  1YIJ N;  5KPZ A;  2E88 A;  4GMJ B;  1EKE A;  3SQ1 A;  1ZBF A;  3M5R A;  4H5R A;  1DTQ A;  3MCA B;  3OW2 M;  1EWR A;  1JXE A;  4BRF A;  2HMI A;  4H03 B;  4O4G A;  2QWO A;  3IFR A;  4HUE A;  5HLF A;  4R79 A;  3E66 A;  3R6M A;  4O44 A;  5EY4 A;  3HPG A;  2DFF A;  3MWP A;  3CCV N;  3C6U A;  5AQK A;  5EXW A;  4OO1 J;  1TAU A;  5JLF A;  3SNN A;  3WNF A;  5J2Q A;  4B1V A;  3VA0 A;  4H8K A;  3T19 A;  1E4F T;  1RTH A;  4FWM A;  3UKU B;  3ZT2 A;  4YDU A;  3SBG A;  3O3F A;  1YTA A;  3L3U A;  4CZE A;  4Z4G A;  1U6Z A;  1IKW A;  5HRN A;  2P1J A;  3KD1 E;  1BCM A;  4JD2 B;  3DXK A;  2ASM A;  4DV1 K;  1NK4 A;  1VQK N;  4IFY A;  3H6E A;  4JRQ A;  5BRD A;  2ZQB A;  2VQF K;  3VEZ A;  4FW1 A;  2RHK A;  4J2D A;  5GAH P;  3CCJ N;  2Q3S A;  4KH4 A;  3D2F A;  2P9P A;  1RDW X;  5BR9 A;  4B9T A;  4LH5 A;  1ZBI A;  3HK2 A;  1QZ6 A;  3O80 A;  2OZM A;  3KK2 A;  2X6N A;  1NK8 A;  4O8K A;  4RW9 A;  3KHY A;  2VG5 A;  3MEE A;  3O3H A;  5BPL A;  5HL7 L;  3TWH A;  2O8E B;  2F96 A;  4BDY A;  2YI1 A;  1IH7 A;  4JI0 K;  1Y64 A;  4FJX A;  4M7X A;  1NGD A;  4CK1 A;  2G8K A;  2E6L A;  1MA9 B;  4DR3 K;  2IS3 A;  4HUF A;  3AAQ A;  2CH6 A;  4E1N A;  4QCL A;  4NCA A;  4H0Y B;  5FRM A;  3DYA A;  4JKC A;  3P31 A;  4BWJ A;  1TL3 A;  4FWO A;  1NJX A;  3QFP A;  4KTZ A;  4FCY A;  1NJI O;  5AR0 A;  3OYN A;  3HOS A;  3DLR A;  4ICL A;  2HHT A;  3HYF A;  2PAV A;  5HP1 A;  2XRI A;  2VCP A;  5ADX H;  1ITG A;  4Z94 A;  5HRP A;  1KC8 O;  4KFB A;  3LWM A;  4FLW A;  4GV3 A;  4OPJ A;  3BF1 A;  3CJ9 A;  3H08 A;  4KTW A;  4FLT A;  1C0G A;  3CQY A;  1JCE A;  1IG8 A;  1D5A A;  1KLN A;  1HRH A;  4WYB A;  4CZG A;  4DSK A;  1XQS C;  3HT3 A;  1TKX A;  4DTS A;  4DMN A;  3DWL A;  3OJU A;  4BE0 A;  4E3S A;  2PBD A;  2YHX A;  2QWQ A;  4E7I A;  1OVY A;  2P9N B;  1NKB A;  4DLG A;  5F0X A;  2IDO A;  3QES A;  1RCH A;  1HX1 A;  4FLZ A;  1DEJ A;  3A5N C;  4B8A B;  3F2K A;  1GLA G;  1SL0 A;  1HYZ A;  4CEO A;  1EET A;  3LP3 A;  1VSM A;  4BRG A;  4DTO A;  3NAE A;  5JVH L;  3THV A;  3E9L A;  2HMP A;  4BR5 A;  1XMQ K;  5AQV A;  5KRS A;  4CW7 B;  4CFB A;  4KBO A;  3TAN A;  4M42 A;  2HVH A;  1EO1 A;  4FOE A;  1RT5 A;  1S9E A;  5FRN A;  3FZL A;  3OYA A;  4CJW A;  3CCS N;  4CHO A;  3K9K A;  4EZ6 A;  1U2V B;  1K73 O;  2DY4 A;  3JYT A;  4A57 A;  2P9U A;  5JMV A;  2EX3 A;  2QTD A;  3L8B A;  4Z4C A;  4JKE A;  2V7Y A;  4FVM A;  3AAR A;  3LWL A;  1EQY A;  2HHQ A;  4DR2 K;  4Z4F A;  3SMP A;  2P9L B;  4KV8 A;  2X74 A;  4FWK A;  1G15 A;  5KTQ A;  4FWR A;  5M1O A;  4DUY K;  3AVM A;  1J9A A;  3IMX A;  4JKG B;  4HTL A;  1KAX A;  4LF6 K;  5M1P A;  4DWI A;  4CJ4 A;  2BDP A;  2FSK A;  2HHS A;  1YT3 A;  2ASP A;  3OYB A;  2GTD A;  5DK5 A;  2W6L A;  3MN5 A;  4DLE A;  5LJV A;  4DS5 A;  3VET A;  1SKW A;  4KPY A;  3M6G A;  4HVJ A;  4KB1 A;  2W40 A;  2KQ2 A;  4GKJ K;  3PO4 A;  1WN7 A;  5EU7 A;  1L3T A;  2HBK A;  4CJ3 A;  3OYJ A;  3LZJ A;  3SV3 A;  1N6Q A;  4GVM A;  4K42 A;  4FJ8 A;  2QKB A;  2RN2 A;  4W5O A;  3O4Q A;  3SPY A;  4QS8 A;  5LJW A;  1BDG A;  3VF6 A;  2UUC K;  2DFH A;  3KTQ A;  3CJA A;  3W3D A;  4KHU A;  1Q18 A;  4IDK A;  4FLU A;  4DV2 K;  4CJ7 A;  4PHT X;  4CHY A;  3DLE A;  4BRA A;  3O9S A;  2Q1N A;  4JKH A;  1C0F A;  1SKS A;  1HPZ A;  4E7K A;  4FL9 A;  3NVM A;  2FXU A;  1TVR A;  3OYK A;  4ELV A;  4BRN A;  2I7P A;  4BR2 A;  1RDB A;  4LSN A;  1Q9Y A;  4B8C A;  2P9S B;  1C0T A;  3MX2 A;  4K41 A;  3C6H A;  4PY5 A;  3K5M A;  3SAH A;  4JI2 K;  3VQC A;  3TPQ A;  5CZ1 A;  1BUP A;  4FWQ A;  4YOY A;  4DV7 K;  2HW3 A;  3U3Y A;  3AA4 A;  2QXF A;  4YOT A;  2YX6 A;  3OYH A;  1LV5 A;  5BN9 A;  3LDS A;  4A2A A;  4N56 A;  4FK2 A;  4BRP A;  4MFB A;  3LL3 A;  2DPN A;  5C0Y A;  3V1R A;  2HHX A;  3RMC A;  1WBB A;  4DR7 K;  1ZC6 A;  3CIP A;  1M1K O;  2YNI A;  3VQ4 A;  4IG0 A;  5CR4 A;  4RG8 A;  5ADX A;  3IDH A;  2O8C B;  3E1Y A;  1IKV A;  3A2F A;  1L5U A;  2QW9 A;  1HJR A;  3V9W A;  4DQQ A;  4CIE A;  5KPR A;  1RDA A;  4R5P A;  3ZX2 A;  3T1H K;  4FPA A;  1E3M A;  1LW2 A;  2O8E A;  4E1M A;  4O0J A;  4DU3 A;  2HHW A;  3RTV A;  5AQX A;  3T69 A;  3ZSW A;  3OVN A;  1RNH A;  3J7Y P;  3AVA A;  3SI6 A;  3CXC M;  4DV6 K;  1IG9 A;  1MU2 A;  3EZW A;  3PSF A;  4K25 A;  3NGZ A;  4PQU A;  5BRF A;  2NNW A;  3LDP A;  1LWF A;  4PKG A;  4RW6 A;  1YJW N;  4CFD A;  4BGB A;  2KKZ A;  3JS6 A;  5MLC Q;  4J2A A;  3UKR B;  1H1V A;  4B9V A;  2RPI A;  3SUO A;  2Z1I A;  3B6O A;  1KFD A;  1VQL N;  5DM6 L;  4DSI A;  3A5O C;  1GLD G;  3NF9 A;  4AM7 A;  3OYI A;  2YKN A;  1NMD A;  2ZJP L;  1Q7Y O;  4AHV A;  3F9K A;  3AVF A;  3WUH A;  4L3Q A;  2F8S A;  3VN5 A;  2KHO A;  1HKG A;  2VQE K;  4PL8 A;  4DTN A;  3ZSV A;  1BHL A;  4IBN A;  1S6Q A;  3NBP A;  1NGG A;  5C2F A;  3LPU A;  4YOV A;  4AQY K;  1NKC A;  1Z25 A;  2OTJ N;  4WQ5 C;  2P9N A;  1VQ7 N;  5J2P A;  1Y97 A;  1WLJ A;  4L8R B;  2GX9 A;  1HLU A;  4JKA A;  4IEE A;  4A61 A;  3J81 O;  2Q31 A;  3R9P A;  4DQI A;  4IZ9 A;  3HSC A;  1BIZ A;  1NGI A;  4KI6 A;  4WQ4 C;  4Q5V A;  3QEX A;  3WEE A;  2W6K A;  3FGU A;  2D0A A;  4IFE A;  3GDQ A;  1BO5 O;  3TI0 A;  4DTP A;  4GW6 A;  4LC9 B;  2E2N A;  3L4I A;  3KIO A;  4XEI A;  3W0L A;  5GIP A;  2UXC K;  4BQL A;  4EFH A;  1HYS A;  3MEG A;  1U2V A;  4OX9 K;  1WAJ A;  1S1U A;  4U7B A;  3TTD A;  5DM7 L;  3C65 A;  3SUP A;  4B9L A;  4DUZ K;  3HPH A;  4HCC A;  1RT1 A;  3M8S A;  3HP6 A;  5AQW A;  1VQ9 N;  2IVP A;  3AA2 A;  3EKS A;  1U4B A;  3ITH A;  4A5B A;  4Z4E A;  1T3V A;  4GY2 B;  2PZS A;  3TAG A;  3VQ6 A;  4IXC A;  1YUW A;  2E2P A;  3QNO A;  1S9G A;  2O8D B;  1X3M A;  5JS1 A;  3HPO A;  3LAM A;  4O8U A;  5C10 A;  5HOO A;  3OTO K;  3V9X A;  2EWS A;  3KK7 A;  1JCF A;  3DRR A;  4IFV A;  4BWM A;  3ZT4 A;  1GOB A;  4U67 L;  4CJT A;  3O9T A;  1SV5 A;  4FJK A;  4B1W B;  4CGJ A;  1YVN A;  5IWA K;  3DRP A;  4DF8 A;  1MWM A;  3EYZ A;  4N41 A;  3CHW A;  3CC7 N;  5M1K A;  4X62 K;  5AQZ A;  2A41 A;  3LAK A;  3NF8 A;  5AQT A;  3LDO A;  3QET A;  1D4X A;  3KLH A;  5AQG A;  1QQM A;  3H3N O;  1VSE A;  4KO0 A;  4FWN A;  2WOM A;  2ZGZ A;  3HTV A;  4A62 A;  1Z05 A;  4OJR A;  2E20 A;  1W2B M;  3AVJ A;  5F2R A;  1JLF A;  4X66 K;  1W97 L;  1Z26 A;  1FW6 A;  3LDL A;  4A2B A;  1O1W A;  3JSM A;  2YJE A;  3LAL A;  1NK6 A;  3EL2 A;  3SYZ A;  3O1B A;  4FM0 A;  2FF6 A;  4CEQ A;  3RRG A;  4BGA A;  4CZI A;  1HPM A;  3E9O A;  1BI4 A;  1YIT N;  1L3V A;  2F9T A;  1ILY A;  1NGF A;  3O5B A;  3VEY A;  1Q86 O;  2GWJ A;  5J2N A;  3QEI A;  2A42 A;  4DR4 K;  2NRZ A;  4BR4 A;  3KLI A;  4CZJ A;  4CJ5 A;  4DB3 A;  3V6D A;  3M8R A;  3CPE A;  3OYL A;  4PKI A;  3QIN A;  3DAW A;  4H0T B;  2V51 B;  3GL1 A;  1I3A A;  4CIG A;  4B3O A;  1TGO A;  1NG9 A;  3THW B;  3THY B;  2XHB A;  1XUP O;  3HST B;  1WOQ A;  4KHS A;  2YJF A;  5C24 A;  4UQG A;  4NO7 A;  3VES A;  1X9J A;  2E1Y A;  3VQ7 A;  1JLB A;  5CY4 A;  5BPM A;  1VSL A;  4JN4 A;  1B9D A;  4KHQ A;  1IBL K;  4FZX C;  3PLA A;  4CZM A;  4Z4I A;  3EKU A;  3C6T A;  4J2E A;  4M3Z A;  5AQY A;  5AZJ A;  2ZM6 K;  3BZK A;  1IJJ A;  4PWD A;  5C12 A;  1Q81 O;  1N32 K;  1IBM K;  4F2S A;  3KK3 A;  3ZEU A;  4WFA L;  4ZTF A;  3AO1 A;  4DR5 K;  2PYJ A;  3QIP A;  3I56 N;  1W7A A;  1TYQ A;  1HUX A;  4JKB A;  4H5T A;  3ZSZ A;  2OTL N;  3ZCM A;  4FM2 A;  4YOR A;  1BA0 A;  3PO5 A;  3ZET A;  4B3M K;  4NLB A;  4WCE L;  1KVA A;  3E01 A;  4CGG A;  1GOC A;  5I3U A;  5BPN A;  1REV A;  2KTQ A;  2RE2 A;  4CZH A;  3MWT A;  4FJH A;  4DTM A;  3SQ0 A;  4BDP A;  1QVG M;  4FZY A;  3BP8 A;  5AQU A;  5GAD P;  1OH7 A;  4B9S A;  3H1V X;  5C2D A;  4DG1 A;  3DM2 A;  3VGL A;  3HP9 A;  5C42 A;  3P83 D;  3TSQ A;  1KTQ A;  2Q2R A;  4K43 A;  1WSJ A;  4NYN A;  1ZBS A;  2FBV A;  1VQ8 N;  2ZD1 A;  3KVG A;  2Q97 A;  5AQN A;  1DT9 A;  4BY9 C;  4WQ4 A;  3KKR A;  3OBY A;  1ESV A;  1NK0 A;  1R0A A;  4CZL A;  3KZB A;  4FJ7 A;  4CVN E;  4CEE A;  3Q7C A;  1CLQ A;  3MK6 A;  3C6A A;  4H0X B;  3ULE B;  2ZF5 O;  3FZK A;  4OPH A;  3VQB A;  4IJN A;  1ASV A;  1NJW A;  1FKO A;  3VQ9 A;  4KHN A;  1C0U A;  1YTU A;  4DFM A;  2QI2 A;  1BOT O;  4CES A;  2UUA K;  1VQN N;  4JRP A;  2J4R A;  3VF2 A;  3THX B;  3KD5 E;  3DOK A;  3WXL A;  3FZH A;  4J2B A;  3IAY A;  2AJQ A;  1ASU A;  1QHA A;  5LY3 A;  3D0P A;  2XO7 A;  4JYA K;  4F3O A;  3VA3 A;  3VQD A;  5FLX O;  1FXX A;  1RT6 A;  4BQZ A;  1KRP A;  4BVP A;  1EXQ A;  3AGR A;  3MCP A;  1OKJ A;  1T44 A;  3SUQ A;  4C8M A;  1BG3 A;  1S3X A;  3CCM N;  3PIO L;  4CEC A;  4DFP A;  2Y1I A;  1YAG A;  5T7B A;  3AA3 A;  2VGM A;  1TK8 A;  5BRE A;  5BRH A;  5B8H A;  2OYQ A;  2IVO A;  1GLJ O;  5AQR A;  3HM9 A;  3TSP A;  1GLB G;  1SUQ A;  5GIO A;  1KAZ A;  5AQM A;  3SUN A;  3U9Z A;  4HCB A;  4YOX A;  4E7J A;  3E9P A;  2JWL A;  1IBK K;  1K8K B;  3G0Z A;  4GNI A;  2E1Z A;  1NGC A;  2BE2 A;  3RRH A;  3V1Q A;  1QTM A;  1RT4 A;  1W9H A;  3Q7B A;  4CHN A;  3OJS A;  2WTU A;  1R59 O;  1CXQ A;  2GV9 A;  4X65 K;  1SS6 A;  4ID1 A;  4CEF A;  4CD3 A;  2P5O A;  4HTU A;  4C1N K;  3F73 A;  5ELZ A;  3M8P A;  2G8W A;  5M1Q A;  1C1A A;  4JNE A;  4K0K K;  3OYF A;  3L2Q A;  4BC2 A;  1KVC A;  3JAM O;  4LF8 K;  3LDN A;  2NRH A;  4FLV A;  1LAW A;  2Q36 A;  1SL2 A;  3D2E B;  2WON A;  4CHP A;  3DLK A;  3H1Q A;  4M3U A;  2BUP A;  2YKM A;  3PY8 A;  4KRE A;  4QAG A;  1KXP A;  4IO9 L;  1RTD A;  3T1Y K;  2KZM A;  2OPQ A;  2Z1G A;  2H3G X;  4DQP A;  2JGU A;  3QFU A;  3GOI A;  3IG1 A;  3BF3 A;  4DV0 K;  1VRU A;  4GV6 A;  3V9Z A;  3NGY A;  1A5X A;  1ATS A;  3L2U A;  3AVB A;  3MED A;  2P5G A;  1VQM N;  4JHD B;  3UE5 A;  4KI4 A;  2NRW A;  3CET A;  5CE3 A;  4XH1 A;  2O8B B;  4CED A;  4C8N A;  1Q8I A;  3G10 A;  4JV5 K;  5AQI A;  3BEX A;  4CBX A;  2NRX A;  4I2Q A;  3WXJ A;  1M90 O;  4GVE A;  4FK4 A;  3VEW A;  5HRS A;  3EO3 A;  4LF5 K;  3BY5 A;  1NJZ A;  4N76 A;  1JLA A;  5AQL A;  2QA4 N;  3CJ7 A;  4O5B A;  1LWC A;  4W5Q A;  1BWF O;  1KFS A;  4FWL A;  1YHQ N;  3MX5 A;  2NZT A;  2P9K A;  1JJ2 M;  4FJ5 A;  3CM5 A;  2O8F A;  4M3W A;  2XY5 A;  2PYL A;  4KRF A;  4CHQ A;  3WNE A;  2RKI A;  1BGX T;  1J54 A;  3CFO A;  2Z1H A;  3CF5 L;  1TK0 A;  4I7F A;  3HOT A;  2ITG A;  2E4L A;  1OH5 A;  4RTF D;  1B92 A;  1OVQ A;  1P90 A;  3ENH A;  4XH5 A;  3NFA A;  3KKS A;  1V4S A;  3QER A;  1S72 N;  1S1V A;  4B1Y B;  4JI5 K;  1XNR K;  2O4I A;  2A1S A;  1RT2 A;  3G71 N;  1VSH A;  4DHY A;  4OPK A;  4FW2 A;  1JLQ A;  4C8L A;  2QK9 A;  1WSE A;  3CCR N;  4CGF A;  4JK9 A;  3AVG A;  2NRT A;  4N5S A;  3UKU A;  1NGH A;  2FBY A;  2HND A;  4LF4 K;  4H0V B;  4OKE A;  1NWK A;  4PL7 A;  3GBT A;  4M3Y A;  4WF9 L;  3DI6 A;  2UXD K;  3HL8 A;  2WC9 A;  3U6F A;  4JD2 A;  4LY7 A;  4O0I A;  1C6V A;  3NVK A;  4F8R A;  3ID6 A;  3SBT A;  4G1Q A;  2WUS A;  3TSU A;  3VQ8 A;  2OZS A;  4I6M B;  3P38 A;  3CJB A;  4RCH A;  4M45 A;  3ZSY A;  4DTU A;  3U4L A;  2G8U A;  2D5R A;  3GG4 A;  4JK7 A;  3VER A;  3CME N;  1HKC A;  2GUP A;  3T1A A;  5HBM A;  3K57 A;  5JS2 A;  3THX A;  1QSY A;  4FJJ A;  1NOZ A;  1WUA A;  1C1B A;  4IWV A;  3SMS A;  4EAH D;  3CCE N;  5I42 A;  4C8O A;  4TSX A;  4ISG A;  3P39 A;  1B9F A;  3RSE B;  4DV5 K;  3S9H A;  4FOI A;  4CK3 A;  3IRX A;  3OYG A;  1YJ9 N;  3CPW M;  2ZJQ L;  3FE1 A;  1BCO A;  5GAG P;  4OGC A;  2Z1J A;  4OGE A;  3I0S A;  2A5X A;  5J2M A;  4AH9 A;  2B6A A;  4G9Z A;  2OAN A;  1BL3 A;  3EE9 A;  3C7N B;  1TKD A;  3LM2 A;  2QWP A;  1WSG A;  2CGL A;  2O4G A;  4ISF A;  3VQQ A;  4FJN A;  1GLF O;  3CCL N;  3L2R A;  3PIP L;  4RW7 A;  2AP1 A;  3HBT A;  4PA1 A;  4K8X A;  2P51 A;  1RT7 A;  5M1N A;  4EP5 A;  2EHG A;  2FSN A;  4CJK A;  5AZI B;  4W5T A;  4CBU A;  3EEQ A;  4NXM K;  4BE2 A;  3AV9 A;  3D6R A;  3NH2 A;  1DKG D;  3O9Q A;  1NK9 A;  4LFB K;  4I2P A;  4BRK A;  4FZZ A;  1JCG A;  3KK1 A;  4DQR A;  3PSI A;  2V7Z A;  1VQO N;  5AFU H;  3LM9 A;  4UY8 O;  1NLV A;  3PX0 A;  3ZT0 A;  4KHY A;  2QWM A;  4NXN K;  3DJC A;  1TL1 A;  4GV9 A;  4IOX A;  2OCE A;  3AVK A;  4ILH A;  2D0B A;  3I8D A;  4Z4H A;  4EIA A;  3CD6 N;  4M3T A;  2F7T A;  4MDA A;  3ENO A;  4HHT A;  4NLC A;  2F8T A;  3KLE A;  2ZGY A;  4WFN L;  4IOC L;  1P8Z A;  5CZ2 A;  4FSV A;  1JXB A;  3WQT A;  5LL6 Z;  4FLX A;  3OYM A;  3FZM A;  2E6M A;  4CF2 A;  1Z6R A;  2OPP A;  3HZ6 A;  4YDU C;  1K6Y A;  1RDC A;  4LFC K;  3CC4 N;  2XY7 A;  3BGR A;  1VQ4 N;  3HVR A;  1BQN A;  3DLB A;  5BN8 A;  5KQD A;  1HNX K;  3DXK B;  4IG3 A;  1HMV A;  1NK5 A;  2HF4 A;  2CH5 A;  3KWI A;  1TAQ A;  4JHD A;  3MXM A;  4NCG A;  1T6D A;  3CM6 A;  3D2F B;  2P9P B;  4BRD A;  4EZ9 A;  5FPN A;  2P9L A;  1LCU A;  2HB5 A;  3QB0 A;  3SJH A;  4BG8 A;  3K59 A;  4Y1D A;  1L3S A;  2Q0R A;  1DGK N;  4NB4 A;  4DR1 K;  3PV8 A;  4JS4 A;  4QS9 A;  1RGI A;  4JKG A;  4I9L A;  4A5A A;  1X9S A;  4QS7 A;  2NRR A;  1S5J A;  3WXK A;  4WFB L;  1ZBU A;  4W5R A;  5FPE A;  5LMU K;  2YHA A;  4H5N A;  1TK5 A;  2CGJ A;  4XH4 A;  3ENB A;  2BAN A;  1HQE A;  4OKK A;  3U3G A;  5F1X A;  4DU1 A;  2KFN A;  2ZE2 A;  2IAJ A;  2PY5 A;  3VQA A;  3HO1 A;  2FBT A;  1NGA A;  4H5W A;  1ZBL A;  3KJV A;  3I33 A;  1XNQ K;  5FPM A;  2FLO A;  1K9M O;  3SCX A;  3AA5 X;  4BC3 A;  1YI2 N;  1LAV A;  4GKK K;  4FYD A;  3FFI A;  4AHT A;  1JL1 A;  3AO4 A;  5FRO A;  1WBD A;  1JLG A;  1D8Y A;  4B9M A;  1NGJ A;  4Y1C A;  1T8E A;  1O13 A;  2P9S A;  2D0P A;  3S41 A;  2PFU A;  1E4G T;  4YOU A;  4BAC A;  3SQ4 A;  2W42 A;  2QKK A;  3HI0 A;  4JI3 K;  2UXB K;  4A59 A;  4FPB A;  5HRO A;  4LSL A;  2GWK A;  1N5Y A;  4B9U A;  4DSE A;  1GLC G;  3H3O B;  3TAB A;  4NCB A;  4E0D A;  3TAR A;  4CGI A;  3BUZ B;  2D4W A;  3QEP A;  1N8R O;  3MN6 A; 
#chains in the Genus database with same CATH homology
 1YT3 A;  3D45 A;  3OYB A;  5DK5 A;  4N47 A;  4CK2 A;  4ID5 A;  1HNI A;  4DLE A;  1XI1 A;  1U47 A;  4F3O A;  4DS5 A;  3VA3 A;  3VQD A;  2IOC A;  4DTR A;  2VG6 A;  3V9S A;  1FXX A;  1SKW A;  4KPY A;  1VSK A;  1RT6 A;  4HVJ A;  4YFU A;  4KB1 A;  3V1O A;  3MXI A;  2KQ2 A;  3PO4 A;  1WN7 A;  5EU7 A;  1EP4 A;  1S1W A;  1KRP A;  1L3T A;  4CJ3 A;  3OYJ A;  1EXQ A;  1CZ9 A;  3LZJ A;  3AO3 A;  2B5J A;  3SV3 A;  3OYC A;  1N6Q A;  4GVM A;  4FJ8 A;  2QKB A;  2RN2 A;  5J1E A;  4W5O A;  1ZYQ A;  3O4Q A;  3SUQ A;  1KVB A;  4C8M A;  3SPY A;  1VSD A;  2KW4 A;  4DTX A;  4PUO A;  1UA1 A;  2DFH A;  1FKP A;  4LH4 A;  4CEC A;  4DFP A;  2ETJ A;  2Y1I A;  3KTQ A;  4KHU A;  3SV4 A;  4IDK A;  4FLU A;  3K5O A;  1WSI A;  4H4O A;  2G8I A;  1FK9 A;  1LW0 A;  2YNH A;  2GUI A;  3AA3 A;  5T7B A;  2VWJ A;  5D3G A;  4CHY A;  3DLE A;  2R7Y A;  2LSN A;  1TK8 A;  3NH0 A;  4DSL A;  1U48 A;  2ATQ A;  2OYQ A;  1KSP A;  3EZ5 A;  4W5N A;  3HM9 A;  4FLY A;  1SKS A;  1HPZ A;  1SUQ A;  4M41 A;  4QOZ B;  4EP4 A;  4E7K A;  1UOC A;  1ASW A;  1TVR A;  5CYQ A;  4CJV A;  3OYK A;  3SUN A;  4ELV A;  4HCB A;  4E7J A;  4CER A;  1RBU A;  4CGD A;  1RDB A;  3G0Z A;  4LSN A;  1Q9Y A;  3PX6 A;  1VSI A;  4B8C A;  5KGX A;  4OKJ A;  2BE2 A;  3RRH A;  1C0T A;  3M8Q A;  1S1T A;  3V1Q A;  4PY5 A;  1QTM A;  1RT4 A;  1W9H A;  1IKY A;  3K5M A;  3VQE A;  3UIQ A;  4CHN A;  4JLH A;  3OJS A;  4DSF A;  1CXQ A;  2GV9 A;  3VQC A;  1XHZ A;  4ID1 A;  4CEF A;  4E7L A;  2P5O A;  3MEC A;  1TKT A;  5CZ1 A;  4HTU A;  3NF7 A;  4E19 A;  3F73 A;  3OY9 A;  1DLO A;  4E89 A;  3AO5 A;  2HW3 A;  3M8P A;  3ZSQ A;  2G8W A;  3AVH A;  3L3V A;  3AA4 A;  1C1A A;  2QXF A;  3U3Y A;  4ZTJ A;  3OYH A;  1LV5 A;  3OYF A;  3L2Q A;  3CYM A;  1KVC A;  4CF0 A;  4CJQ A;  3LDS A;  1NOY A;  4LD0 A;  2KFZ A;  3T3F A;  4CJL A;  4N56 A;  4FLV A;  1LAW A;  1SL2 A;  1I39 A;  2D0C A;  4FK2 A;  4MFB A;  2WON A;  4IKF A;  4CHP A;  1KCF A;  3DLK A;  3RWU A;  3V1R A;  5C25 A;  4M3U A;  2YKM A;  3C94 A;  3LPT A;  3RR7 A;  2HHX A;  4H4M A;  3RMC A;  3PY8 A;  2DFE A;  3BDP A;  4KRE A;  4CEZ A;  1F21 A;  2YHB A;  4QAG A;  2YNI A;  4DSJ A;  2GBZ A;  3VQ4 A;  1QHT A;  4IG0 A;  4RG8 A;  4CEA A;  1TKZ A;  1WNS A;  4CJS A;  1RTD A;  4BDZ A;  3KLF A;  2KZM A;  1IKV A;  2OPQ A;  2Z1G A;  3A2F A;  1L5U A;  4OLB A;  1T03 A;  2HNY A;  1HJR A;  3V9W A;  4DQQ A;  4DQP A;  4CIE A;  1RDA A;  4R5P A;  1JLE A;  2JGU A;  3SJJ A;  3IG1 A;  3TAQ A;  1WAF A;  1LW2 A;  3RMD A;  4E1M A;  4O0J A;  3LAN A;  3WNH A;  4DU3 A;  2BGG A;  1VRU A;  2HHW A;  3V9Z A;  3RTV A;  3NGY A;  3ZSW A;  1A5X A;  3OVN A;  1JLC A;  1RNH A;  3VQP A;  3AVB A;  4AHC A;  4CFC A;  4CJP A;  3MED A;  3L2U A;  3NGI A;  2P5G A;  3HJF A;  3AO2 A;  3AVA A;  4AHU A;  3SI6 A;  4KI4 A;  2KZZ A;  4K8Z A;  1IG9 A;  1MU2 A;  3RR8 A;  3MAQ A;  4CED A;  4C8N A;  3OYE A;  1Q8I A;  2JLE A;  3NGZ A;  5KRT A;  2FBX A;  3G10 A;  4DU4 A;  4PQU A;  3QLH A;  1QQC A;  1VSF A;  3PX4 A;  1U45 A;  4I2Q A;  1LWF A;  4RW6 A;  4CFD A;  1S6P A;  2Y1J A;  4FK4 A;  2NUB A;  4DTJ A;  5HRS A;  4J2A A;  4ELT A;  1X1P A;  2A1R A;  1NJZ A;  4N76 A;  1QSS A;  4F2R A;  1JLA A;  3VQ5 A;  4B9V A;  4O5B A;  4RW4 A;  1LWC A;  2RPI A;  3SUO A;  2Z1I A;  3B6O A;  1JL2 A;  1KFD A;  3AVL A;  4W5Q A;  3QO9 A;  3S3M A;  1KFS A;  4DSI A;  3NF9 A;  4B9N A;  1D9F A;  3IS9 A;  4FJ5 A;  3CM5 A;  3OYI A;  1RTI A;  2YKN A;  4CJF A;  4JS5 A;  4F4K A;  2XY5 A;  2PYL A;  4M3W A;  4CHQ A;  4KRF A;  3WNE A;  4AHV A;  3L2V A;  3F9K A;  2RKI A;  3AVF A;  3NE6 A;  1BGX T;  1J54 A;  3CFO A;  3PUF A;  2F8S A;  3TAP A;  3VN5 A;  5CYM A;  2XY8 A;  4CCH A;  2Z1H A;  4BE1 A;  4I9Q A;  3QNN A;  3QIO A;  4DTN A;  3ZSV A;  1BHL A;  1X9W A;  4IBN A;  1S6Q A;  1TK0 A;  4I7F A;  1U49 A;  2ITG A;  3AVC A;  3NBP A;  1IKX A;  4KB0 A;  2E4L A;  3LPU A;  1SL1 A;  1NK7 A;  1B92 A;  2IC3 A;  4FM1 A;  1A5W A;  1NKC A;  1Z25 A;  3DLG A;  4B08 A;  3NFA A;  3KKS A;  4DFK A;  1NKE A;  3QER A;  5J2P A;  1Y97 A;  1WLJ A;  2FC0 A;  3KLG A;  4L8R B;  1S1V A;  2RF2 A;  2O4I A;  2A1S A;  3ZSO A;  3AVN A;  1RT2 A;  4NYF A;  1RBV A;  1VSH A;  4YNQ A;  1A5V A;  4OPK A;  4FW2 A;  1JLQ A;  4CF9 A;  3RMB A;  1T05 A;  3SQ2 A;  4C8L A;  4DQI A;  4CJR A;  3P1G A;  1TV6 A;  2QK9 A;  2IGI A;  1WSE A;  1BIZ A;  2YV0 X;  4CGF A;  1J5O A;  4KI6 A;  3AVG A;  4Q5V A;  3QEX A;  4FJ9 A;  4N5S A;  3OYD A;  4ELU A;  4AHS A;  3L2W A;  4OLA A;  2HNZ A;  2FBY A;  2D0A A;  2HND A;  3K58 A;  1C1C A;  3V9U A;  3S3O A;  1L3U A;  4CE9 A;  1HYV A;  4OKE A;  3TI0 A;  1CZB A;  3MXJ A;  3K5L A;  1BQM A;  4FJL A;  3DMJ A;  2VG7 A;  4DTP A;  4M3Y A;  4MQ3 A;  3DI6 A;  1XHX A;  2YNF A;  4GW6 A;  3HL8 A;  4ZHR A;  4FJI A;  3U6F A;  1SKR A;  4LY7 A;  3KIO A;  4O0I A;  2OA8 A;  1C6V A;  1HYS A;  1RBR A;  3MEG A;  4CHZ A;  4F8R A;  4M3R A;  2I5J A;  4G1Q A;  4FJG A;  1WAJ A;  1S1U A;  3ZT3 A;  3VQ8 A;  2OZS A;  1Q9X A;  5SZT A;  3K5N A;  3SUP A;  2VWK A;  1RBS A;  1RT3 A;  1C0M A;  3S3N A;  4B9L A;  1UAX A;  4DQS A;  4M45 A;  3HPH A;  4HCC A;  1RT1 A;  3ZSY A;  3M8S A;  3HP6 A;  4DTU A;  3SQ1 A;  4GMJ B;  2G8U A;  1EKE A;  2D5R A;  1ZBF A;  3TAF A;  3AA2 A;  1DTQ A;  3LP0 A;  1U4B A;  2B4J A;  3ITH A;  4Z4E A;  1WSH A;  1JXE A;  3T1A A;  3B6P A;  2HMI A;  4O4G A;  3TAG A;  2PZS A;  5HBM A;  3VQ6 A;  5JS2 A;  3K57 A;  3QNO A;  4KKO A;  1S9G A;  4HUE A;  5HLF A;  3HPO A;  1QSY A;  4FJJ A;  5JS1 A;  3LAM A;  1NOZ A;  1C1B A;  4Q0B A;  3V9X A;  3CFP A;  3V81 A;  4O44 A;  5I42 A;  4C8O A;  4TSX A;  3NDK A;  3HPG A;  1B9F A;  2DFF A;  3DRR A;  4IFV A;  2OPS A;  4BWM A;  3ZT4 A;  4DFJ A;  3S9H A;  1GOB A;  4CJT A;  2HHQ A;  3QEW A;  3C6U A;  1SV5 A;  4FJK A;  4CF1 A;  4CGJ A;  1TAU A;  4CK3 A;  3IRX A;  3OYG A;  4E7H A;  3DRP A;  1BIU A;  4DF8 A;  3SNN A;  2OPR A;  3WNF A;  3SZ2 A;  3EYZ A;  1BCO A;  5J2Q A;  4N41 A;  4OGC A;  3VA0 A;  4H8K A;  3T19 A;  3LAK A;  2Z1J A;  1RIL A;  1RTH A;  2X78 A;  3NF8 A;  4OGE A;  3ZT2 A;  2HHV A;  3I0S A;  1XWL A;  1CXU A;  3NH1 A;  3O3F A;  5J2M A;  1YTA A;  4AH9 A;  3QET A;  2B6A A;  3L3U A;  1BL3 A;  3KLH A;  1QE1 A;  5SWM A;  4Z4G A;  1TKD A;  3OS2 A;  1VSE A;  4KO0 A;  1WSG A;  2O4G A;  2WOM A;  5E41 A;  4DS4 A;  1IKW A;  1GOA A;  4OJR A;  3VQQ A;  5HRN A;  2P1J A;  1VK0 A;  3KD1 E;  1BCM A;  4FJN A;  3NHG A;  3L2R A;  3NCI A;  3AVJ A;  1IO2 A;  1JLF A;  4RW7 A;  4RW8 A;  1Z26 A;  4PA1 A;  2P51 A;  4K8X A;  1NK4 A;  1RT7 A;  1O1W A;  4IFY A;  3O4N A;  3JSM A;  1RBT A;  3LAL A;  4JRQ A;  2HVI A;  4EP5 A;  3ULD A;  2EHG A;  3EY1 A;  1NK6 A;  3SYZ A;  4CJK A;  2ZQB A;  4W5T A;  4KTQ A;  4FM0 A;  2X6S A;  5K14 A;  4CEQ A;  4BE2 A;  3AV9 A;  1X9M A;  4FW1 A;  3RRG A;  4FJM A;  4J2D A;  2Q3S A;  3NH2 A;  1BI4 A;  1NK9 A;  4I2P A;  2DTU A;  1L3V A;  4FZZ A;  3DRS A;  4FK0 A;  4CFA A;  4B9T A;  1QSL A;  1D9D A;  4LH5 A;  3KK1 A;  4DQR A;  3SPZ A;  1ZBI A;  5J2N A;  3QEI A;  3HK2 A;  4CJE A;  4KAZ A;  2OZM A;  3KLI A;  3PX0 A;  3ZT0 A;  3KK2 A;  4CJ5 A;  2X6N A;  3V6D A;  4KHY A;  1NK8 A;  3M8R A;  3NF6 A;  1TL1 A;  4RW9 A;  1JKH A;  1EX4 A;  2VG5 A;  1BIS A;  3AVK A;  3OYL A;  3QIN A;  3CFR A;  4FXD A;  2D0B A;  3I8D A;  3MEE A;  3O3H A;  5KI6 A;  4Z4H A;  4Z0U A;  1I3A A;  4CIG A;  3TWH A;  1TGO A;  3RMA A;  4B3O A;  4M3T A;  4WE1 A;  2XHB A;  2F96 A;  4BDY A;  3LP2 A;  4HHT A;  1IH7 A;  3HST B;  2F8T A;  3KLE A;  1DTT A;  4FJX A;  5CZ2 A;  1W0H A;  4KHS A;  3ASM A;  4CK1 A;  5C24 A;  4UQG A;  2G8K A;  2E6L A;  3DLH A;  2HHU A;  2IS3 A;  1JXB A;  4HUF A;  4C8K A;  3VQ7 A;  4FLX A;  4E1N A;  1JLB A;  5CY4 A;  3OYM A;  4NCA A;  5FRM A;  2E6M A;  4CF2 A;  4QCL A;  2OPP A;  3DYA A;  5HRR A;  1VSL A;  4BWJ A;  1K6Y A;  1B9D A;  1RDC A;  1TL3 A;  4KHQ A;  3WNG A;  2XY7 A;  3BGR A;  4FZX C;  3ZSR A;  1NJX A;  4KTZ A;  3HVR A;  4FCY A;  4Z4I A;  1BQN A;  1WSF A;  3C6T A;  3OYN A;  3DLB A;  4J2E A;  1S1X A;  3DLR A;  4ICL A;  4M3Z A;  4AIL C;  1UWB A;  3HYF A;  2HHT A;  3ISN C;  4IG3 A;  1HMV A;  3CQ8 A;  1NK5 A;  5HP1 A;  2XRI A;  5HRP A;  4CF8 A;  1ITG A;  2G8F A;  3V4I A;  4PWD A;  1TAQ A;  3MXM A;  4KFB A;  3LWM A;  4M3X A;  4FLW A;  4NCG A;  4OPJ A;  4F2S A;  3H08 A;  4KTW A;  3KK3 A;  4FLT A;  3CM6 A;  3TR8 A;  4ZTF A;  3ZSX A;  4EZ9 A;  1BI4 B;  3AO1 A;  2YNG A;  1D5A A;  1KLN A;  2HB5 A;  1J53 A;  2PYJ A;  3QIP A;  1HRH A;  4DSK A;  3K59 A;  4Y1D A;  1L3S A;  3HT3 A;  1TKX A;  3ZSZ A;  4DMN A;  4DTS A;  3OJU A;  3QEV A;  3PV8 A;  3ZCM A;  1QS4 A;  3LP1 A;  4O55 A;  4JS4 A;  4HUG A;  4BE0 A;  4FM2 A;  4AHR A;  4E3S A;  3PO5 A;  4I9L A;  1X9S A;  1HNV A;  4E7I A;  1XC9 A;  1KVA A;  1NJY A;  3E01 A;  1S5J A;  3CG7 A;  1NKB A;  1T7P A;  4CGG A;  1GOC A;  1ZBU A;  3I0R A;  4W5R A;  3HVT A;  3TAM A;  5I3U A;  2YHA A;  1REV A;  4DLG A;  1TK5 A;  3K2P A;  1LWE A;  2IDO A;  2G8H A;  4FJH A;  3AVI A;  3QES A;  2KTQ A;  4DTM A;  1RCH A;  4FLZ A;  3SQ0 A;  1HQU A;  4B8A B;  4BDP A;  4FZY A;  4CEB A;  3DOL A;  4B9S A;  3ALY A;  4CGH A;  2BAN A;  1SL0 A;  5FDL A;  1HQE A;  4XIU A;  2G8V A;  1HYZ A;  1VRT A;  4CEO A;  4CJU A;  3DM2 A;  4DG1 A;  4CIF A;  3HP9 A;  4DF4 A;  5C42 A;  3P83 D;  3TAE A;  1EET A;  4OKK A;  3LP3 A;  3U3G A;  1VSM A;  3OS0 A;  5DMR A;  4DU1 A;  1KTQ A;  1YVU A;  4DTO A;  2KFN A;  1WSJ A;  3NAE A;  2ZE2 A;  4NYN A;  1UA0 A;  3ZT1 A;  2IAJ A;  3THV A;  1U04 A;  3VQA A;  2PY5 A;  4OVL A;  2FBV A;  3HO1 A;  5KRS A;  2FBT A;  4CFB A;  2ZD1 A;  1ZBL A;  3TAN A;  3KJV A;  4M42 A;  2HVH A;  1KLM A;  1RT5 A;  1S9E A;  3KKR A;  5FRN A;  3OYA A;  4CJW A;  4CHO A;  1VSJ A;  4EZ6 A;  1NK0 A;  3LZI A;  3AA5 X;  3SCX A;  1R0A A;  2DY4 A;  3JYT A;  4F3T A;  4FJ7 A;  2EX3 A;  3L8B A;  4CEE A;  3O3G A;  1LAV A;  5KGW A;  4Z4C A;  1CLQ A;  4KHW A;  4FYD A;  3FFI A;  4FVM A;  1JL1 A;  3AO4 A;  4AHT A;  5FRO A;  3LWL A;  1JLG A;  1NJW A;  3VQB A;  1D8Y A;  1ASV A;  2XY6 A;  4B9M A;  4Y1C A;  4Z4F A;  1FKO A;  1T8E A;  3VQ9 A;  4KV8 A;  4KHN A;  1C0U A;  2X74 A;  3HXM A;  4DFM A;  4BAC A;  3SQ4 A;  1YTU A;  1G15 A;  2W42 A;  1RTJ A;  5KTQ A;  2QKK A;  4CES A;  3AVM A;  1J9A A;  4JRP A;  3KD5 E;  3P5J A;  5HRO A;  3DOK A;  4LSL A;  3C95 A;  1N5Y A;  1ZBH A;  4J2B A;  4B9U A;  3OS1 A;  1RDD A;  4DWI A;  4CJ4 A;  4DSE A;  2BDP A;  3IAY A;  2AJQ A;  4NCB A;  3TAB A;  4E0D A;  1ASU A;  4CGI A;  3QEP A;  3TAR A;  2HHS A;  3D0P A;  2XO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...