1WSEA

Co-crystal structure of e.coli rnase hi active site mutant (e48a*) with mn2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMALMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Identification of Single Mn(2+) Binding Sites Required for Activation of the Mutant Proteins of E.coli RNase HI at Glu48 and/or Asp134 by X-ray Crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 44
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wseA00
3SQ1A 4H4OA 4CGHA 4BACA 1R0AA 1ZBHA 1B92A 3S3OA 3TAEA 2HNDA 4AHTA 2ATQA 1FXXA 3IRXA 1RTIA 4DS4A 3E01A 1JLEA 1RBVA 1W9HA 3AO1A 3I0SA 4NCBA 3OYLA 4E0DA 2XHBA 5SZTA 4F2SA 2ETJA 4F4KA 3AVGA 2RN2A 3AV9A 4CJWA 1TKZA 3LPUA 4CIGA 3K5OA 1NJYA 3O3HA 3L8BA 1D9FA 1NJZA 3ZT4A 2OPQA 3HL8A 4KREA 1FKPA 4MFBA 4FJ9A 3VQ6A 4CK1A 4E7KA 3BDPA 2HHTA 1I3AA 2I5JA 3HT3A 4PUOA 4CHNA 3SJJA 3SUQA 4N41A 2BGGA 1BIUA 1QTMA 4W5NA 2FBVA 4N76A 4CGIA 4NCAA 3VQ7A 3NDKA 3TAPA 1BL3A 1REVA 4FW2A 4ZHRA 4BWJA 3VQEA 4CJQA 4DTRA 2G8WA 4AHUA 1LWFA 4F8RA 1RDDA 4KTQA 1J54A 5CYQA 4Z0UA 4DQRA 2XO7A 1QSLA 1T03A 1HQUA 2OZSA 3V1OA 1L3VA 1RT5A 2FBYA 3SI6A 5DK5A 3ULDA 4EZ6A 3RMCA 3KK3A 4DF4A 2GUIA 2IGIA 1S9EA 3KLHA 3P83D 3V9UA 2XY5A 4O55A 1G15A 1YT3A 4M3ZA 4RW6A 3V81A 4J2AA 4KPYA 4Z4GA 1DTTA 3OYHA 1TGOA 1RDAA 2HHXA 1SL0A 5KI6A 1LW2A 1B9FA 2YKNA 2ITGA 4GVMA 1X9WA 3C94A 4J2EA 3DM2A 3V9ZA 1U4BA 3HP6A 4DQIA 3CM5A 3TAQA 3KLIA 3MECA 1GOBA 4CFAA 2XY8A 4CCHA 4C8MA 2FC0A 1MU2A 5SWMA 3OJSA 4KHQA 4Q0BA 3O4NA 4W5OA 1HJRA 1EP4A 1Q8IA 4FJ7A 3LPTA 1ZBUA 1RT3A 4LSNA 3WNHA 4CJKA 4E7LA 3PO5A 2YNIA 4DLEA 1N5YA 1I39A 2EX3A 3JSMA 3AA3A 1VRTA 4FM1A 1Q9XA 4DU4A 3SPYA 1Q9YA 3ZSXA 4B9SA 2PZSA 4DFJA 3NGYA 1C1AA 4ID1A 2YHBA 3ZT2A 1N6QA 1RTJA 4CF0A 5KRSA 3HPOA 3LDSA 3L3VA 4M3YA 5FRNA 1ASVA 4CFDA 1T8EA 4QOZB 3RMAA 3OYEA 3DOLA 3DLKA 2R7YA 4DQSA 3TABA 1RDBA 3ZT1A 4N5SA 2IDOA 4KHSA 3KD5E 3AVLA 3OYAA 1RBTA 5HRSA 2B4JA 3DLBA 2A1SA 1NK8A 1HYSA 4B3OA 4LSLA 4CHPA 1HPZA 1KCFA 1RDCA 4FZYA 2IC3A 1VSLA 1TL3A 5JS2A 2F8TA 4AILC 1S1WA 1S1TA 4OKJA 4O0IA 3IAYA 1WSFA 3QEPA 3CFPA 2LSNA 5DMRA 3K59A 4Q5VA 1SKWA 3S9HA 5J1EA 4W5RA 4IBNA 4DFMA 3QNOA 4FJIA 4J2BA 1EETA 3C6TA 1VSFA 4ID5A 4DU3A 1NKBA 4R5PA 2B6AA 2JGUA 4K8ZA 4C8LA 4CEBA 3SUNA 4NCGA 1NJWA 1TL1A 3AVIA 3PUFA 4OGCA 4FJXA 3A2FA 4DF8A 3D45A 3OYDA 3CFRA 3TI0A 4N56A 1IO2A 4EP5A 3K58A 2VWJA 4H8KA 3DLGA 3SQ0A 4M3WA 4FZZA 2FBXA 1U45A 3VQQA 2OPPA 3RRGA 1Z26A 4RW7A 4Y1CA 4E19A 3VQ8A 1RBUA 3QO9A 3NF7A 4AHVA 1S6PA 1S9GA 3LALA 3MEDA 4CJTA 5KRTA 3ZSRA 3KK2A 1L3SA 4OLBA 4DSLA 3NAEA 3PX4A 3L2WA 1F21A 3LP3A 3QINA 3AA5X 4B08A 3S3MA 1JKHA 2YV0X 1TKXA 2Z1HA 3DMJA 3ZSZA 4B9UA 4IKFA 2ZE2A 4E1MA 3DLHA 4C8NA 1UA0A 5I3UA 1U04A 2HVHA 3T19A 3OYIA 3EY1A 2ZQBA 3F9KA 3THVA 4M41A 3TR8A 4F3TA 2RF2A 5HROA 1KTQA 3LP0A 3SYZA 1HNVA 4CHZA 3SQ4A 4DQPA 3SV3A 4RW4A 4FZXC 2E6LA 3ASMA 1NK0A 2X74A 4CF1A 1TV6A 4FJKA 3SCXA 4FJLA 1ITGA 3V1QA 1L5UA 1GOAA 3JYTA 1ZBLA 2X6NA 4PY5A 4Z4HA 4K8XA 3WNGA 2VWKA 1RILA 2E6MA 2QK9A 1U47A 2O4GA 3VQCA 4EP4A 1VK0A 1VSHA 1RBRA 2HHWA 1LW0A 2F96A 3KLGA 1FKOA 3AVAA 1UOCA 1HYVA 3DLEA 3O4QA 1D5AA 4PWDA 2OYQA 4LD0A 1XHXA 4CK2A 3G10A 1WLJA 1UAXA 1EXQA 5CYMA 4PQUA 4E7JA 3HVRA 2G8FA 3TAFA 4CHOA 3SUOA 4QAGA 3LZIA 4FM2A 2G8IA 4QCLA 1VSJA 1BCMA 5HLFA 2DFEA 3VQDA 3B6OA 1WSGA 4HHTA 2P1JA 4ICLA 3TAMA 4E1NA 4FK4A 3QESA 1S1VA 4JS4A 1KRPA 4KB1A 3QIPA 3NBPA 1ASUA 4Y1DA 4FM0A 4CF8A 4Z4FA 1JXBA 3AVFA 2BANA 5KTQA 1JLBA 3M8RA 1XI1A 3AVHA 4DTNA 1NKEA 1LAWA 1LAVA 3NH1A 5J2QA 3V6DA 4CJUA 1BQMA 4JS5A 3MEGA 1JL2A 3LAMA 1TK5A 4FJGA 3L2UA 2HVIA 1RT1A 3KIOA 3LANA 2O4IA 1DLOA 1RT4A 4CJLA 4KAZA 1IG9A 5J2NA 1C0TA 2X78A 4CEAA 4AHSA 1RTDA 4L8RB 4Z4EA 4CEEA 4FJJA 3I0RA 2B5JA 3VN5A 1T05A 1VRUA 1NOYA 4ELUA 4FK0A 4CJ3A 2YHAA 2KTQA 3OYBA 2HNYA 4O0JA 4CEDA 2PYLA 1JL1A 1S6QA 3OYMA 3RTVA 4DTSA 3TWHA 3L2QA 4H4MA 3AA2A 3WNFA 1VSMA 3V1RA 3ZT0A 1FK9A 3OYNA 4FJNA 2QXFA 3P5JA 3QERA 4CF9A 4NYFA 4AHRA 4DTPA 1VSEA 2P51A 4KHNA 1A5XA 1TKTA 3CYMA 1KLMA 1WAJA 3EYZA 5J2PA 4JLHA 4DWIA 1BHLA 2QKKA 2D0BA 5D3GA 1TKDA 1NK9A 1QHTA 3TANA 4DTUA 3LWMA 5EU7A 3C6UA 3PX6A 4TSXA 4W5TA 3SV4A 3V9WA 4ZTFA 1D9DA 4B9VA 4KHUA 4KV8A 4CGGA 3O3FA 1TK8A 2KFZA 1IKWA 3QETA 4AH9A 2DY4A 4DG1A 2WOMA 3QEWA 2Z1JA 3MXIA 4DSFA 1UWBA 1X9MA 3MEEA 1C1BA 4I9LA 4LY7A 5E41A 3SUPA 1UA1A 3LP1A 1U49A 4B9LA 3HK2A 1KVAA 1KLNA 4N47A 3F73A 4JRPA 1ASWA 2HHVA 4C8KA 3NGIA 1BIZA 1C0UA 1NJXA 2OPSA 5CZ1A 1IKVA 3QEXA 4DFKA 5HP1A 2YKMA 3NF8A 3KJVA 4FLTA 3QEIA 3HO1A 5FROA 1L3TA 4B9NA 2YNGA 4E7IA 1YTAA 1GOCA 1J5OA 1TAUA 1W0HA 1RT7A 3DYAA 4FLUA 1J9AA 1C6VA 1SKRA 1LV5A 4CGJA 2FBTA 2P5GA 4WE1A 1YVUA 1WNSA 3AO3A 3L2VA 1A5WA 4LH5A 3AVKA 3ISNC 4KFBA 4FLZA 3IS9A 4I2QA 5T7BA 3VQ4A 3OS2A 3HM9A 1O1WA 1XWLA 1QSSA 5CY4A 1CLQA 2ZD1A 1QQCA 4DSKA 1RT2A 3KKRA 3OYFA 2YNFA 4FVMA 3U6FA 4C8OA 4OLAA 3CM6A 3M8QA 2IS3A 3L2RA 1KVCA 3AVBA 3M8SA 2WONA 1C0MA 1LWCA 2Z1IA 3RRHA 2GBZA 3PY8A 4PA1A 1RTHA 1EKEA 4IDKA 1WAFA 4FCYA 3RMBA 3NF9A 4BDYA 3KKSA 4GW6A 3HSTB 4DSEA 2OA8A 3OJUA 3M8PA 4CESA 1NK6A 1KSPA 2DTUA 2RPIA 2Q3SA 3U3YA 4ELTA 4HUFA 3V9SA 1XHZA 3HXMA 4CERA 3EZ5A 1ZYQA 4FLXA 4IG3A 5K14A 3SNNA 3AVJA 4CEQA 3NHGA 4FLYA 3IG1A 4BE1A 2HHQA 3TAGA 5C42A 3L3UA 2D0AA 3AVMA 4CJVA 3NGZA 1NK5A 2DFHA 3VQ5A 3NE6A 3BGRA 4FLWA 4IFYA 2HMIA 1CZBA 1J53A 1HRHA 1BQNA 2YNHA 1BISA 1B9DA 3MXJA 4CJFA 4CHYA 4HTUA 4DTOA 2AJQA 4CGDA 3U3GA 4IG0A 3OYJA 1YTUA 1CZ9A 4CJ4A 4KHYA 3CG7A 3ZCMA 4I9QA 4JRQA 3DRPA 4E3SA 4M3XA 1BGXT 3VQ9A 1NK4A 4O5BA 4KO0A 3C95A 4E89A 4CIFA 2Y1IA 2P5OA 4O44A 3SQ2A 3WNEA 5FRMA 4CJPA 4HVJA 1U48A 2G8KA 2HNZA 4KI6A 3RMDA 3H08A 1KFDA 4BE2A 1C1CA 5HRNA 1IKXA 5HRRA 2Z1GA 3OY9A 1VSIA 3QLHA 4RG8A 4CEZA 3HYFA 2QKBA 4Z4IA 2DFFA 3ZSVA 4OPKA 4DTMA 1NOZA 4CECA 1KVBA 5J2MA 1NK7A 1TK0A 1HNIA 1ZBFA 4KB0A 3DRSA 1S1UA 1TVRA 2HW3A 2BDPA 1CXQA 4CJ5A 1T7PA 3DLRA 5FDLA 4CJRA 4ZTJA 4FYDA 1WSEA 2RKIA 3MXMA 1TAQA 3ALYA 2JLEA 4DS5A 3K57A 1WSIA 1HQEA 3AVNA 1Z25A 1DTQA 1RBSA 3CFOA 3P1GA 3RWUA 3B6PA 1HMVA 3OS0A 3VA3A 5KGWA 1S5JA 1A5VA 1Y97A 4I2PA 3OS1A 3LWLA 3K5NA 4OPJA 1RT6A 1QS4A 1SUQA 2KW4A 1XC9A 4CJSA 1KFSA 4YNQA 4FJMA 3SPZA 3HVTA 1BI4B 4DMNA 2OPRA 3ZSQA 5KGXA 3NCIA 4DTJA 1SKSA 3LAKA 1CXUA 3NF6A 1RCHA 3KD1E 3NH2A 4CJEA 1WSHA 2VG5A 4MQ3A 5C24A 4CIEA 2HB5A 1BI4A 1SL1A 1EX4A 5HRPA 1RNHA 2VG7A 4RW9A 1WN7A 3I8DA 3KLFA 4CEFA 3VQPA 5C25A 4F3OA 1ZBIA 3TARA 4BWMA 3K2PA 3O3GA 1X1PA 4XIUA 3PX0A 3ZT3A 3KTQA 2G8HA 1K6YA 3K5MA 3QEVA 2X6SA 4AHCA 2XY6A 4M3TA 2NUBA 2KZZA 2E4LA 4DSIA 4CE9A 3UIQA 4B8CA 2VG6A 3FFIA 1BCOA 2GV9A 4KKOA 3VQBA 2G8UA 2D0CA 4CEOA 3V9XA 3PO4A 4M42A 4CF2A 3RR8A 3OYGA 3DOKA 4FW1A 4O4GA 4CFCA 3LZJA 4B8AB 2F8SA 1SL2A 2OZMA 4CFBA 4HCBA 4FJHA 4KTZA 3PV8A 3K5LA 4OKEA 1QE1A 4DQQA 3KK1A 4DFPA 3S3NA 3NFAA 3OYCA 1IH7A 4BDZA 1WSJA 2EHGA 1L3UA 3AVCA 2BE2A 2XY7A 4NYNA 4Z4CA 1D8YA 4B9MA 4KHWA 3LP2A 4EZ9A 4OGEA 1JLCA 2XRIA 3HPHA 2D5RA 3G0ZA 4M3RA 3VQAA 3CQ8A 2A1RA 1JLAA 3NH0A 5JS1A 4OJRA 2KFNA 2PY5A 4B9TA 3ITHA 3T3FA 3HJFA 3QNNA 1HYZA 4CK3A 2IOCA 3ZSWA 4FJ8A 4G1QA 3AO5A 2Y1JA 4FK2A 4DU1A 4BDPA 5CZ2A 5HBMA 4FXDA 1NKCA 3OYKA 1VSDA 4UQGA 4LH4A 4YFUA 4GMJB 3KLEA 1JLQA 3SZ2A 1X9SA 4KRFA 3T1AA 3AA4A 4HUEA 1JXEA 1VSKA 3HP9A 2W42A 4W5QA 4OKKA 1SV5A 2G8VA 3HPGA 3ZSOA 4M3UA 3AO4A 4CHQA 1IKYA 4BE0A 4J2DA 4KTWA 4I7FA 3VA0A 4IFVA 4RW8A 1JLGA 4DTXA 1JLFA 1S1XA 4HCCA 4HUGA 5I42A 4E7HA 2PYJA 3QIOA 4CGFA 1QSYA 3AO2A 2HHSA 4FJ5A 3DI6A 3OVNA 4DSJA 2KZMA 2KQ2A 4M45A 3ZSYA 3RR7A 4OVLA 1LWEA 2IAJA 3MAQA 4FLVA 3V4IA 4ELVA 4KI4A 4DLGA 2HHUA 3D0PA 4F2RA 3DRRA
chains in the Genus database with same CATH superfamily
2CGJA 3FZKA 4BACA 1B92A 1K73O 3TAEA 4AHTA 1RTIA 4YORA 1W9HA 2BH1A 3AO1A 2XHBA 2YHWA 3CCLN 1NJYA 1TKZA 3LPUA 3K5OA 4IJAA 5CR4A 3VEWA 2A6AA 1NJZA 2A5XA 3VF6A 1JCEA 4E7KA 3BDPA 2WTUA 4YOYA 5TKWA 2FLOA 3HT3A 3JAMO 2OTLN 4N41A 2QEXN 3CJCA 3ZEUA 4FW2A 5AQXA 3VQEA 4AHUA 5C10A 5CYQA 4Z0UA 4DQRA 2XO7A 1T03A 2OZSA 3L4IA 1RT5A 3CC4N 2FBYA 1NBWA 3GDQA 4A59A 3BF1A 3RMCA 5GAHP 1S9EA 2QA4N 2XY5A 4O55A 1G15A 3BF3A 2ZJRL 3MX2A 3C7NA 1TGOA 1LW2A 1YJ9N 5DM6L 2YKNA 2ITGA 1X9WA 3C94A 1Q81O 3HP6A 3TAQA 4BRPA 2P9NA 3KLIA 4CFAA 3O9QA 2A41A 1MU2A 2JWKA 5SWMA 3TTFA 4KHQA 4Q0BA 1HJRA 1EP4A 4LSNA 4E7LA 4LFAK 4BC4A 1I39A 3A5OC 4FM1A 4UY8O 1Q9YA 1W97L 3NGYA 4ID1A 1N6QA 5KRSA 3HPOA 2Q36A 3CIPA 4ISFA 4WQ4C 2W40A 3GG4A 3O80A 3KD5E 3H1QA 1QQMA 5HRSA 3DLBA 1HYSA 4B3OA 1RDCA 3IAYA 1ESVA 1MA9B 2LSNA 4W5RA 4IBNA 4QS8A 4WQ4A 3SUNA 3UKRB 3T1YK 2KHOA 4DF8A 3E66A 3CFRA 1IO2A 4EP5A 2VWJA 1N8RO 3CCMN 4JI6K 3VQQA 2OPPA 3PIPL 3VTHA 2ASPA 1RBUA 3THXB 4AHVA 1VHXA 4CJTA 3KK2A 3ZX3A 3PX4A 1F21A 3LP3A 3QINA 4KBOA 3AA5X 5AZIA 1TKXA 3DMJA 1GLEG 4B9UA 2ZE2A 3DLHA 4O5FA 4C8NA 3MN9A 3A0IX 4JI3K 5I3UA 5F1XA 1U04A 2HVHA 3T19A 2O8BB 3LP0A 4CHZA 3T1HK 4RW4A 2E6LA 2X74A 3VTIA 4CF1A 1NWKA 2P9SA 2YHXA 4FJLA 1ITGA 3V1QA 1L5UA 2CGLA 2X6NA 2VWKA 3CHWA 4LF4K 1GLAG 2E6MA 1NGCA 2O4GA 1VK0A 1VSHA 1RBRA 4WFNL 3AVAA 1UOCA 3CMEN 1D5AA 3CJBA 3SJHA 4CK2A 3G10A 4NO7A 1UAXA 1EXQA 5FPNA 3DJCA 3G25A 4E7JA 3HVRA 2G8FA 4FL9A 4QCLA 5GAGP 4FOEA 1BCMA 3VGKA 4IOCL 3C65A 2O8DA 1BUPA 2P1JA 4EHUA 4H0TB 5ADXH 4Y1DA 2FF6A 4A5BA 1JXBA 3AVFA 3FZLA 4DR2K 1LAWA 1LAVA 1BQMA 3L2UA 2HVIA 3LANA 3THWA 2BTFA 4BRHA 4M63C 1IG9A 4IOXA 2J4RA 4CEAA 2E2PA 2UYTA 4ELUA 4FK0A 1ZXOA 4H0OA 4O0JA 3OYMA 3RTVA 4DTSA 3L2QA 3WNFA 1C0FA 1RDWX 3MN7A 5FPMA 2UUCK 2P9KB 1VSEA 3O6WA 4NXNK 2UXDK 1E4FT 3RSEB 1NK9A 4JKEA 4K0KK 4W5TA 4KHUA 5ADXA 4OO1J 1JCFA 1TK8A 1IKWA 4BR9A 2HSTA 4DG1A 4DSFA 3MEEA 4B9LA 4I9LA 3SUPA 1BU6O 3E9OA 4C8KA 3SAHA 2YKMA 4FLTA 3CC2N 5KQ8A 1L3TA 4K25A 4E7IA 1YTAA 2ASMA 3H45C 1J5OA 1W0HA 3DYAA 1LV5A 4GKJK 4CGJA 2P5GA 4WE1A 3MWPA 1NU0A 4LH5A 3ISNC 4KFBA 3MWTA 4I2QA 3VQ4A 1O1WA 1XWLA 3C6HA 4FPBA 5BN9A 1QQCA 1RT2A 3OYFA 4JNEA 1Q82O 2IS3A 5HOOA 1OH5A 1HKGA 3AVBA 2WONA 4H5RA 4NLBA 2Z1IA 3RRHA 1OH6A 3D2FA 1N36K 5AFUH 1RTHA 3RMBA 3DXMB 4GW6A 3D2EB 2IVPA 3HXMA 4CERA 2Q1NA 3MCPA 1ZC6A 3CXCM 3CCUN 4FLXA 4PKIA 5K14A 4BRKA 2HMPA 3SNNA 1HJOA 3FGUA 1YJWN 2HHQA 3TAGA 5KPRA 3TSQA 2D0AA 4CJVA 2DFHA 3WXLA 3NE6A 3BGRA 2VQEK 1HRHA 1BQNA 4DTOA 3U3GA 4IG0A 1V4SA 1MWKA 5LMUK 3U8XA 3ULEA 3CJ7A 4KHYA 2Q97A 3DRPA 4E3SA 1BGXT 1NK4A 3C95A 4E89A 2P5OA 2Y1IA 3PSFA 4WFAL 4HVJA 5AFUA 3RMDA 3FZFA 1BDGA 4RG8A 4CEZA 3ZSVA 2P9IA 4V19S 4CECA 1KVBA 1ZBFA 1S1UA 3SBTA 5AZJB 2BDPA 4FWSA 1SAZA 4CJ5A 1NLVA 4ZTJA 2E88A 1WSEA 3MXMA 1TAQA 4DS5A 1YITN 1K8KB 3RWUA 3CFOA 3OS0A 4I2PA 3LWLA 2UXCK 2KW4A 1HUXA 1KFSA 1NM1A 1QQOA 1BI4B 2OPRA 5H1SQ 3KD1E 1WSHA 2HB5A 2GWJA 4B1XB 1OVYA 2VG7A 1WN7A 3A5LC 3LDPA 5C25A 2ASOA 3O3GA 3K2PA 1CZAN 3ZT3A 3KTQA 1K6YA 2X6SA 2XY6A 2NUBA 1ZBSA 5EOYA 4NLCA 3UIQA 2QWOA 4YDUC 3DXKB 2GV9A 4CEOA 2NLXA 5F2RA 3EO3A 4O4GA 1D4XA 1SL2A 5I9EB 3O1BA 4KTZA 3K5LA 1VQ9N 3WEEB 5BPLA 4JHDB 1IH7A 4H0PA 4KH4A 4YHHK 1VQ8N 4A5AA 4YDUA 4AM7A 2ZM6K 1D8YA 4B9MA 4EZ9A 4DV1K 4KHWA 3HPHA 2G8VA 1V4TA 1JLAA 1NGGA 3F2KA 4OJRA 4DV7K 5JS1A 3G71N 4B9TA 1HYZA 3Q7BA 3ZSWA 1HR0K 4G9ZA 4FK2A 2VGNA 2ITMA 3EZWA 1VQKN 1VSDA 4GMJB 1DT9A 1JLQA 3T1AA 3HP9A 3O08A 3CQYA 3HPGA 3ZSOA 3AO4A 3CJAA 4WCEL 4BE0A 4I7FA 2WUSA 1S1XA 4HCCA 4HUGA 4DB3A 2PYJA 1MDUB 3QIOA 4X62K 3T7ZA 4FWKA 3DI6A 4IJNA 4OVLA 4ELVA 5CE3A 2HHUA 4DV6K 4BRLA 5GIOA 4BGBA 3D0PA 3I33A 4F2RA 4BRMA 1YIJN 1KAZA 4CGHA 2P9PA 3S3OA 1K8AO 4JD2A 2HBJA 2HNDA 2ATQA 1FXXA 2QWPA 3VETA 3E01A 1JLEA 3R6MA 4NCBA 3OYLA 4E0DA 3QMLA 5SZTA 4F2SA 2Q2RA 3F5TA 4B3TK 2RN2A 5LJWA 3L8BA 2Q0UA 1HKBA 3HL8A 4IZ9A 5BPNA 1EWRA 1FKPA 4MFBA 3VQ6A 2O8FA 4CHNA 3SUQA 1BIUA 1U2VA 3VQ7A 2YHYA 1BL3A 1DKGD 4CJQA 3VERA 1QSLA 4U67L 3LDNA 1T44A 4DR5K 3GL1A 5DK5A 3ULDA 4EZ6A 3CETA 4DF4A 2IGIA 3O9TA 4RW6A 4J2AA 4KPYA 3CF5L 3SLCA 1LOTB 4J2EA 1U4BA 4E1JA 2E2QA 3MECA 2V7ZA 2XY8A 4BVOA 3VGLA 1Q8IA 5AQVA 4FJ7A 1RT3A 4LF8K 3WXIA 4IWVA 5AQRA 1N5YA 2AA4A 3AA3A 1VRTA 3SPYA 3MDQA 4B9SA 2PZSA 5GINA 2F9TA 3ZETB 4CFDA 4JKAA 2RE2A 3DLKA 3TABA 3ZT1A 2IDOA 3GBTA 4KHSA 3AVLA 1EWQA 3ENOA 2B4JA 1NK8A 3B8AX 1HPZA 1XMQK 2QM1A 1S1TA 4DHYA 5DMRA 3H46O 3K59A 3E9PA 1SKWA 5J1EA 4FJIA 3C6TA 3N4QA 4R5PA 4K8ZA 4NCGA 1TL1A 2V51B 4OGCA 5AQHA 3TI0A 4M3WA 3WQTA 3K58A 4H8KA 5AQFA 2O8EB 4FZZA 2E20A 3MMVA 2FF3B 4RW7A 4E19A 4PHTX 4BQZA 3QO9A 3NF7A 5AQSA 1S6PA 1S9GA 1L3SA 5KRTA 3ZSRA 1TUUA 2OANA 3NAEA 1JKHA 3EKUA 1BA0A 1XUPO 1VQPN 1UA0A 1VQLN 2ZQBA 3F9KA 1BA1A 5HROA 1VAZA 4F9OA 1S22A 3SYZA 4IO8A 3SV3A 1S72N 2QWNA 1NK0A 3TSUA 3IUCA 2NRZA 4FJKA 1GOAA 3LM9A 1ZBLA 4PY5A 2I7PA 2A3ZA 3BUZB 3OBYA 1N33K 1LW0A 3KLGA 1FKOA 1HYVA 3P4IA 2P9LB 2OYQA 3SAGA 3HZ6A 3JS6A 5JMVA 1XHXA 4PQUA 3OW2M 2E8AA 5BR8K 4CHOA 2QXLA 4QAGA 2G8IA 3EN9A 4DR3K 4IDHA 2DFEA 1WSGA 1H1VA 2CH6A 4JS4A 2E5LK 1GLFO 1J5EK 1VQMN 5AQPA 4FM0A 4CF8A 3O1WA 3M8RA 3AVHA 3NH1A 5J2QA 2HF4A 4CJUA 4JK8A 4MO5A 3MEGA 1ILYA 4C1NK 5BRHA 1C0TA 4LF9K 4CZLA 1RTDA 3LDLA 3FR0A 4CEEA 1VRUA 1NOYA 3VOVA 3OYBA 2D0PA 4IXCA 3TWHA 3AA2A 1ATNA 1VSMA 4CF9A 4BRGA 4AHRA 1M1KO 4KHNA 1OH7A 2GELA 4BR7A 3CYMA 4GVEA 1WAJA 5J2PA 4JLHA 4DWIA 2QKKA 5D3GA 1QHTA 4DTUA 3LWMA 5EU7A 5LY3A 3WXMB 4TSXA 3SV4A 1D9DA 4B9VA 4EHTA 4DV2K 2KKZA 1IBKK 2DY4A 2Z1JA 4DV0K 1X9MA 1C1BA 2JWLA 2YJEA 3AARA 2CH5A 3J7ZO 4JRPA 4Y0WA 2OPSA 1IKVA 2WC9A 3ATUA 3TTCA 1YHQN 3QEIA 3HO1A 2YNGA 4ILJA 4FOIA 1GOCA 4CZHA 4DUZK 1TAUA 4FLUA 3CMAN 1BG3A 1YVUA 1WNSA 3L2VA 3AVKA 3HM9A 1TYQB 4B1WB 5CY4A 3FZHA 1T6DA 3CM6A 3CCSN 3L2RA 1KVCA 4BY9C 1FW6A 3BP8A 3PY8A 3AAPA 1N32K 2V52B 1WAFA 4FCYA 3QBXA 4CI6A 3HSTB 4X65K 4GY2B 3HOSA 3P39A 4BR2A 4JI2K 1G99A 4CESA 1NK6A 3V9SA 1XHZA 1WBDA 5TKYA 3W3DA 4IG3A 1KC8O 4LF7K 4JKHA 5AR0A 3L3UA 4GKKK 2KLAA 1NK5A 3VQ5A 2HMIA 4IFYA 2YNHA 3CPEA 1CZ9A 3A8YA 1NJIO 4GNIA 3A5MC 4M3XA 3VQ9A 4O5BA 5LMNK 4KO0A 4YOWA 4CJPA 2G8KA 4KI6A 2E2OA 1KFDA 2V7YA 4BE2A 4DV4K 5HRNA 5HRRA 3I56N 2Z1GA 4I6MA 2DFFA 1NK7A 5J2MA 2P9UA 4KB0A 2NRXA 3UKUA 4FWQA 3EE8A 3DLRA 3DLLL 4CZIA 2RKIA 2JLEA 3MN6A 1HQEA 3AVNA 1DTQA 3FE1A 4HTLA 3K5NA 4OPJA 1QS4A 1NMDA 1XC9A 4CJSA 4JKGA 1YJNN 3HVTA 3ZSQA 3NCIA 1NGFA 4FPAA 1RCHA 3HBTA 3NH2A 4CJEA 1NGEA 5HRPA 4RW9A 4M7XA 3I8DA 3KLFA 1Q7YO 1GLLO 1ZBIA 1X1PA 4EAHD 4B1VA 4OPHA 4XIUA 4H03B 3PX0A 4YOVA 4AHCA 3VF4A 4KH6A 4NXMK 2VG6A 3FFIA 1BCOA 1DGKN 2G8UA 3V9XA 4C1NI 4M42A 3ID8A 3RR8A 1BO5O 4JI7K 1P8ZA 2OZMA 4BREA 3PV8A 1QE1A 5A2QO 1YVNA 4DQQA 3W0LA 4GV6A 3LP2A 4M3RA 3VQAA 1XNRK 2O8CA 4A2BA 3CC7N 4CZJA 5AQMA 4G1QA 5M1NA 3THYA 4DU1A 2Y1JA 5DM7L 4FXDA 3SZ2A 1JXEA 1T3VA 1KD1O 4OKKA 5M1QA 1SV5A 5AQLA 4M3UA 3QFUA 1NGAA 3QB0A 4DTXA 4IFVA 4RW8A 4BVPA 3AO2A 3FFKB 2NRHA 2HHSA 2HBKA 2KQ2A 5JVHL 1RDUA 3ZSYA 3SMSA 3KHYA 3RR7A 3V4IA 4KI4A 3DRRA 3N4PA 4H4OA 1ZBHA 1R0AA 3KK7A 3OBWA 4DS4A 1RBVA 3HRGA 3J80O 5AQGA 3WQUA 1YAGA 3AV9A 4CJWA 3O3HA 1D9FA 3ZT4A 4KREA 4CK1A 3E9LA 1I3AA 3U4LA 2I5JA 3GOIA 4JI4K 4NB4A 3SJJA 3ZEUB 2BGGA 3M1FA 2FBVA 4N76A 2BUPA 4CGIA 4NCAA 1REVA 4ZHRA 4BWJA 3U9ZA 1LWFA 4F8RA 1RDDA 4KTQA 4H0VB 3VF2A 1HQUA 3P38A 5M1FA 5ELZA 3C7NB 1NGJA 2E2NA 5EXWA 4B1UB 1YT3A 4M3ZA 4CD3A 4Z4GA 1DTTA 1RDAA 4A61A 2P9NB 3SBGA 1SL0A 5KI6A 1OH8A 3IKMA 1B9FA 4GVMA 3K9KA 3V9ZA 4DKWA 1IJJA 1GOBA 2FC0A 3O4NA 4W5OA 2Q0RA 3WNHA 3PO5A 2YNIA 4DLEA 1QVFM 2EX3A 4DU4A 4QS9A 5AQOA 5BRFA 3ZT2A 2FSNA 5C2FA 1RFQA 1NGIA 3L3VA 3AY9A 4M7YA 4BRAA 4LFCK 1T8EA 5FPEA 3H1VX 2R7YA 4DQSA 4A2AA 1RDBA 3LDQA 3VENA 4DR7K 2A1SA 3L6QA 4FZYA 2IC3A 1VSLA 2IVOA 1YXQA 2F8TA 2HHVA 1S1WA 4OKJA 1WSFA 3QEPA 3CFPA 4Q5VA 4PKGA 3S9HA 4DFMA 3LDOA 3Q7CA 5EX5A 3QNOA 4ID5A 4FWMA 2JGUA 1J6ZA 5C12A 4C8LA 3IFRA 3ZX2A 4BR0A 1NJWA 4FJXA 3OYDA 4N56A 3UKRA 3DLGA 3L0QA 2HBLA 4BRFA 1U45A 4JV5K 3RVCA 3ZYYX 5IT9O 3RRGA 1Z26A 4Y1CA 4BRNA 3CJ9A 2GUPA 5M1KA 1EO1A 3LALA 2ZWHA 1YUWA 5AZIB 4OLBA 2FSKA 3R8EA 4DSLA 1DEJA 3THXA 4B08A 2RHKA 2YV0X 4IKFA 4E1MA 1U6ZA 4JAXA 3OYIA 4WF9L 3CCEN 4FWOA 1OVQA 1Z6RA 1KTQA 2P9SB 4FJMA 3SQ4A 1WUAA 3QBWA 4DQPA 2QWLA 3ASMA 3CI5A 1TV6A 3EKSA 3SCXA 2IVNA 3JYTA 4Z4HA 2VGMA 4K8XA 3WNGA 3VEOA 1RILA 1U47A 3VQCA 5AQYA 2F96A 5JLFA 4AM6A 4JK7A 4IEIA 2GX9A 3DAWA 3O4QA 1VQNN 4PWDA 1GLDG 4LD0A 5JLHA 4FO0A 2YCHA 5CYMA 3CCJN 3CERA 3TAFA 2O8DB 3LZIA 1Y64A 3R1XA 4FM2A 3KVGA 4R79A 1TUYA 4OPAA 3VQDA 3B6OA 4HHTA 4BR5A 3VEVA 4E1NA 4K42A 1KRPA 3QIPA 3NBPA 4Z4FA 4AQYK 3IMXA 3K9JA 4DTNA 1NKEA 2ZJQL 3THWB 5AQKA 4X66K 4JS5A 3LAMA 3VEXA 1C0GA 1RT4A 4KAZA 4RCHA 1RGIA 3ATVA 2OCEA 1X3MA 1Z05A 1SQKA 3I0RA 1T05A 2KTQA 4CJ3A 2YHAA 4WFBL 2HNYA 4CEDA 4IEEA 1JL1A 1S6QA 4DFKA 4B3RK 2PAVA 4H4MA 3OYNA 3CCRN 3SMPA 4DTPA 1A5XA 1R59O 4MDAA 2E1YA 3EYZA 2P9KA 1BHLA 4AF1A 2D0BA 1GLJO 4K41A 1TKDA 2W41A 4ISEA 4O8UA 3C6UA 3PX6A 4JYAK 3RSEA 4C23A 2E1ZA 3O3FA 4H5TA 3QEWA 3D7EO 3O9UA 1UWBA 5E41A 4LY7A 1U49A 2QWMA 1KVAA 1KLNA 3BEXA 4GV3A 1BIZA 1C0UA 1NJXA 3TPQA 3QEXA 5HP1A 1HLUA 3NF8A 3KJVA 3OA9A 4FWRA 3M3ZA 2WFBA 4BRIA 1RT7A 1C6VA 3AO3A 1A5WA 1Q86O 4LC9B 2IIRA 4DV3K 1VQ4N 3KKRA 4H5VA 3D2FB 4OLAA 3U6FA 3M8QA 2GTDA 3CQXA 4PA1A 4DR4K 3HOTA 1EKEA 4BG9A 3C6AA 3MK6A 4DSEA 2OA8A 2Q31A 3WT0A 3M8PA 3DXMA 2OTJN 1KSPA 2DTUA 5LJVA 5BR9A 3D2EA 3EZ5A 1ZYQA 4B1ZA 3ENHA 3NHGA 1GLCG 3IG1A 4XH4A 3G4SN 2PFUA 3NGZA 1VQ7N 1XMOK 2VYPA 1J53A 2KFZA 4CHYA 1BISA 4HTUA 4CJFA 1HNWK 3ULEB 2AJQA 1BOTO 3OYJA 4B3SK 1YTUA 3VGMA 4RTFD 4CJ4A 3ZCMA 4QS7A 4JRQA 1QVGM 1HKCA 2VWBA 3BZKA 4X64K 4O44A 3SQ2A 2HBMA 3WNEA 5FRMA 4DR1K 3G6EN 1U48A 2HNZA 4BG8A 4JN4A 3H08A 1WB9A 2P9IB 3OY9A 4XH1A 5KPZA 3HYFA 4KHPK 3UB5A 4Z4IA 3HM8A 1TK0A 4Z94A 5GADP 3DRSA 1TVRA 2HW3A 2UXBK 2F9WA 3NMUA 3O5BA 1T7PA 2QI2A 3PSIA 5FDLA 4CJRA 1KAYA 1HNZK 5AZJA 2F7TA 4CW7B 3K57A 4BC2A 1RBSA 3B6PA 3C0BA 1E3MA 1A5VA 1Y97A 1K8KA 3OS1A 2ZGYA 1SZ2A 3TTDA 1SUQA 4YNQA 4DMNA 5KGXA 1SKSA 1CXUA 3NF6A 2VG5A 5C24A 1BI4A 1SL1A 1EX4A 1HNXK 3TARA 2D1KA 4KH5A 2G8HA 3KZBA 2ZGZA 3K5MA 4CJ7A 4M3TA 2E4LA 4CE9A 3MCAB 4KKOA 3VQBA 4MO4A 4ILHA 1EQYA 4CF2A 3T69A 3O9RA 4FW1A 3DXKA 2F8SA 3J7AP 4ISGA 4HCBA 4FJHA 4CVNE 3KK1A 3H3OB 4EIAA 3NFAA 1WSJA 4CZKA 3AVCA 3PLAA 3I8BA 2UUBK 4NYNA 3EEQA 4OGEA 3WEEA 3NVMA 1JLCA 5AQNA 4JHDA 3G0ZA 2A1RA 3NH0A 3FLCO 2PY5A 3WXKA 3HJFA 4FJ8A 3OHRA 1X9JA 2YX6A 3AO5A 2WBNA 5HL7L 4BDPA 2FXUA 4BROA 4KRFA 3IDHA 3KLEA 4ILGB 5CHIA 4HUEA 3AA4A 2W42A 4W5QA 4JKFA 4EFHA 4JI1K 4FVUA 3AGRA 5F0XA 1IKYA 1IG8A 4J2DA 3BZCA 3WXJA 1JLFA 3HSCA 1JCGA 3VMFB 4E7HA 2QW9A 1QSYA 3R3LA 4H5NA 4FJ5A 4BGAA 1LWEA 2IAJA 2P9PB 4JD2B 3SQ1A 3LM2A 3IRXA 3I0SA 4YY3K 2ETJA 4F4KA 3AVGA 4CIGA 2O8FB 1IV0A 2QTDA 2OPQA 4JI0K 4FJ9A 2HHTA 1U2VB 3R9PA 4PUOA 1QTMA 4W5NA 3NDKA 5EY4A 3TAPA 4DTRA 4A57A 2G8WA 5LL6Z 2FSJA 1J54A 1XQSC 2NZTA 3V1OA 1L3VA 1OKJA 3SI6A 4CBUA 4JKBA 5GAEP 3M5RA 3KK3A 2GUIA 3KLHA 3P83D 3V9UA 3V81A 2W6KA 1YI2N 3OYHA 2HHXA 3DM2A 4DQIA 3CM5A 4CCHA 4C8MA 3CCVN 1NGDA 3OJSA 2HHHK 3CJ1A 3LPTA 1ZBUA 5E84A 4CJKA 1KXPA 4CBXA 3JSMA 2F4VK 1Q9XA 3ZSXA 4DFJA 1C1AA 2YHBA 1RTJA 4CF0A 4FWNA 3LDSA 4XEIA 4M3YA 5FRNA 1ASVA 1N34K 4QOZB 3RMAA 3OYEA 3DOLA 4N5SA 3ZETA 1LCUA 3OYAA 1RBTA 3CD6N 1WOQA 4LSLA 4CHPA 1KCFA 2EWSA 3OTOK 5JS2A 1TL3A 4O0IA 4DSKA 2HF3A 3U9DA 4J2BA 1EETA 4DU3A 1VSFA 3ZLJA 1NKBA 3TU5A 5JICA 2B6AA 1W2BM 4CEBA 1Q18A 3A5NC 3AVIA 1I94K 3PUFA 4JK9A 3A2FA 1M90O 3D45A 2QWRA 1FJGK 3SQ0A 2FBXA 2O8EA 5E26A 2W6LA 3VQ8A 3MEDA 4RWTA 5M1OA 1QQNA 4MLEA 3L2WA 3S3MA 1O13A 4U7BA 4BRDA 2Z1HA 3ZSZA 2VCPA 2YJFA 4B1YB 1KQSM 3WUHA 3O4WA 3I55N 3EY1A 3THVA 1GLBG 4M41A 3TR8A 1XC3A 4F3TA 2RF2A 5AQTA 1HNVA 4FZXC 5FPDA 2HOEA 2VQFK 1KAXA 4MLHA 2QK9A 4EP4A 2HHWA 3DLEA 1HPMA 5FLXO 4DQ8A 4DCHA 4BR4A 4FWPA 1WLJA 3D6RA 2UUAK 3P31A 2NRTA 2P9LA 3EE9A 3J8AA 4CZFA 2QWQA 4JKDA 3SUOA 1QZ5A 1VSJA 4IO9L 5HLFA 4WYBA 4ICLA 3TAMA 4FK4A 3QESA 1S1VA 3ZX0A 4KB1A 1HX1A 1ASUA 2BANA 5KTQA 1JLBA 5JVGL 1XI1A 2GEMA 4PKHA 3V6DA 5AJ3K 1VQ5N 1T6CA 5EVZA 1TK5A 1JL2A 4FJGA 4H5WA 2GWKA 1RT1A 3KIOA 2O4IA 4YOTA 3CPWM 1DLOA 4CJLA 1VQON 3F9MA 5J2NA 2X78A 4AHSA 4L8RB 4Z4EA 4FJJA 2A42A 2B5JA 4L3QA 3VN5A 3O8MA 2PYLA 4A62A 4AILC 4FJNA 3H3NO 3V1RA 3ZT0A 1FK9A 3JXUA 2QXFA 3P5JA 3QERA 2ZF5O 3ENBA 4NYFA 2P51A 1TKTA 2CGKA 1KLMA 1NGBA 2D4WA 4HWIA 3TANA 3AAQA 3MN5A 3V9WA 4ZTFA 1BWFO 4KV8A 4CGGA 5AQJA 4H0XB 3QETA 4AH9A 3NVKA 4BQLA 2WOMA 3AGKA 3FZMA 4LF6K 3MXIA 1NG9A 3HTVA 1UA1A 3HK2A 4J8FA 3LP1A 4N47A 3F73A 1ASWA 5IWAK 3NGIA 5CZ1A 2NNWA 1S3XA 3H6EA 4LF5K 3GE1A 5FROA 5AQUA 4B9NA 5AQWA 3QICA 5BPMA 5C0YA 1P90A 4BC5A 1SKRA 1J9AA 1NMNA 2FBTA 3DWLA 4FLZA 4IFEA 3IS9A 5T7BA 3OS2A 1NNEA 4CBWA 1QSSA 1NGHA 2ZD1A 2UU9K 1CLQA 2YNFA 4FVMA 4C8OA 4JKCA 1SS6A 1TYQA 3M8SA 1C0MA 1LWCA 2GBZA 4WQ5C 1VQ6N 4IDKA 4K43A 3NF9A 5B8HA 2I7NA 1W7AA 4BDYA 3KKSA 2O8BA 5BRDA 3KWIA 3OJUA 2RPIA 1YF5L 1ATSA 2Q3SA 3U3YA 4ELTA 4HUFA 4DUYK 2NRRA 3AVJA 4CEQA 4WQ5A 4FLYA 4BE1A 3O9SA 5C42A 3EL2A 3AVMA 3E1YA 4B9QA 4FLWA 1CZBA 3MXJA 5M1PA 1B9DA 3MX5A 4CGDA 1WBBA 3J7YP 3CG7A 3K0SA 3LL3A 4I9QA 4CIFA 3ID6A 4FWLA 4O8KA 3S41A 4GV9A 1QZ6A 2D0OA 4I6MB 1C1CA 1IKXA 1VSIA 3QLHA 2P9UB 4YOXA 2QKBA 3UKUB 4OPKA 4DTMA 1NOZA 1HNIA 4BC3A 1CXQA 3VESA 5AQIA 3QFPA 4JI8K 1K9MO 4FYDA 1IBLK 5AQQA 3ALYA 5BN8A 1XNQK 3PIOL 3M6GA 1WSIA 2AP1A 1Z25A 3BY5A 3P1GA 4JKGB 1HMVA 3VA3A 5KGWA 1S5JA 4PL8A 1RT6A 1E4GT 1X3NA 3HI0A 3SPZA 3QDKA 4DTJA 3LAKA 4MQ3A 4CIEA 4OX9K 4CZEA 1RNHA 3KWGA 4CZMA 4CEFA 3VQPA 5KPTA 4F3OA 2PBDA 4BWMA 3VEZA 2A40A 3SK3A 5C15A 4BRCA 3QEVA 4JI5K 2KZZA 3TSPA 1MWMA 4DSIA 4B8CA 2DPNA 2NRVA 1IBMK 3PO4A 5AQZA 2D0CA 1JJ2M 4IOAL 3OYGA 3DOKA 2ZJPL 5GIPA 3LZJA 4CFCA 4B8AB 2YI1A 4CFBA 4YOUA 4OKEA 1QHAA 3CCQN 4DFPA 3S3NA 4BDZA 3OYCA 1L3UA 2EHGA 2BE2A 3SAFA 2XY7A 4Z4CA 2O8CB 3VEYA 2XRIA 4DR6K 2D5RA 3CQ8A 2KFNA 1ATRA 3THYB 5C2DA 3ITHA 3T3FA 3QNNA 3UE5A 4CK3A 2IOCA 4BRQA 4H0YB 5BREA 5MLCQ 2H3GX 4MDBA 4PL7A 5CZ2A 5HBMA 3J81O 3OYKA 1NKCA 4UQGA 4LH4A 4YFUA 4XH5A 1X9SA 3L4QA 1VSKA 3VPZA 5KQDA 4CHQA 4DV5K 4LFBK 2NRWA 4KTWA 3VA0A 1JLGA 5I42A 4CGFA 3OVNA 4DSJA 2KZMA 4JEPA 4M45A 4B3MK 4FSVA 3MAQA 4FLVA 4DLGA 4CD1A 4CZGA
chains in the Genus database with same CATH topology
3SQ1A 4H4OA 4CGHA 4BACA 1R0AA 1ZBHA 1B92A 3S3OA 3TAEA 2HNDA 4AHTA 2ATQA 1FXXA 3IRXA 1RTIA 4DS4A 3E01A 1JLEA 1RBVA 1W9HA 3AO1A 3I0SA 4NCBA 3OYLA 4E0DA 2XHBA 5SZTA 4F2SA 2ETJA 4F4KA 3AVGA 2RN2A 3AV9A 4CJWA 1TKZA 3LPUA 4CIGA 3K5OA 1NJYA 3O3HA 3L8BA 1D9FA 1NJZA 3ZT4A 2OPQA 3HL8A 4KREA 1FKPA 4MFBA 4FJ9A 3VQ6A 4CK1A 4E7KA 3BDPA 2HHTA 1I3AA 2I5JA 3HT3A 4PUOA 4CHNA 3SJJA 3SUQA 4N41A 2BGGA 1BIUA 1QTMA 4W5NA 2FBVA 4N76A 4CGIA 4NCAA 3VQ7A 3NDKA 3TAPA 1BL3A 1REVA 4FW2A 4ZHRA 4BWJA 3VQEA 4CJQA 4DTRA 2G8WA 4AHUA 1LWFA 4F8RA 1RDDA 4KTQA 1J54A 5CYQA 4Z0UA 4DQRA 2XO7A 1QSLA 1T03A 1HQUA 2OZSA 3V1OA 1L3VA 1RT5A 2FBYA 3SI6A 5DK5A 3ULDA 4EZ6A 3RMCA 3KK3A 4DF4A 2GUIA 2IGIA 1S9EA 3KLHA 3P83D 3V9UA 2XY5A 4O55A 1G15A 1YT3A 4M3ZA 4RW6A 3V81A 4J2AA 4KPYA 4Z4GA 1DTTA 3OYHA 1TGOA 1RDAA 2HHXA 1SL0A 5KI6A 1LW2A 1B9FA 2YKNA 2ITGA 4GVMA 1X9WA 3C94A 4J2EA 3DM2A 3V9ZA 1U4BA 3HP6A 4DQIA 3CM5A 3TAQA 3KLIA 3MECA 1GOBA 4CFAA 2XY8A 4CCHA 4C8MA 2FC0A 1MU2A 5SWMA 3OJSA 4KHQA 4Q0BA 3O4NA 4W5OA 1HJRA 1EP4A 1Q8IA 4FJ7A 3LPTA 1ZBUA 1RT3A 4LSNA 3WNHA 4CJKA 4E7LA 3PO5A 2YNIA 4DLEA 1N5YA 1I39A 2EX3A 3JSMA 3AA3A 1VRTA 4FM1A 1Q9XA 4DU4A 3SPYA 1Q9YA 3ZSXA 4B9SA 2PZSA 4DFJA 3NGYA 1C1AA 4ID1A 2YHBA 3ZT2A 1N6QA 1RTJA 4CF0A 5KRSA 3HPOA 3LDSA 3L3VA 4M3YA 5FRNA 1ASVA 4CFDA 1T8EA 4QOZB 3RMAA 3OYEA 3DOLA 3DLKA 2R7YA 4DQSA 3TABA 1RDBA 3ZT1A 4N5SA 2IDOA 4KHSA 3KD5E 3AVLA 3OYAA 1RBTA 5HRSA 2B4JA 3DLBA 2A1SA 1NK8A 1HYSA 4B3OA 4LSLA 4CHPA 1HPZA 1KCFA 1RDCA 4FZYA 2IC3A 1VSLA 1TL3A 5JS2A 2F8TA 4AILC 1S1WA 1S1TA 4OKJA 4O0IA 3IAYA 1WSFA 3QEPA 3CFPA 2LSNA 5DMRA 3K59A 4Q5VA 1SKWA 3S9HA 5J1EA 4W5RA 4IBNA 4DFMA 3QNOA 4FJIA 4J2BA 1EETA 3C6TA 1VSFA 4ID5A 4DU3A 1NKBA 4R5PA 2B6AA 2JGUA 4K8ZA 4C8LA 4CEBA 3SUNA 4NCGA 1NJWA 1TL1A 3AVIA 3PUFA 4OGCA 4FJXA 3A2FA 4DF8A 3D45A 3OYDA 3CFRA 3TI0A 4N56A 1IO2A 4EP5A 3K58A 2VWJA 4H8KA 3DLGA 3SQ0A 4M3WA 4FZZA 2FBXA 1U45A 3VQQA 2OPPA 3RRGA 1Z26A 4RW7A 4Y1CA 4E19A 3VQ8A 1RBUA 3QO9A 3NF7A 4AHVA 1S6PA 1S9GA 3LALA 3MEDA 4CJTA 5KRTA 3ZSRA 3KK2A 1L3SA 4OLBA 4DSLA 3NAEA 3PX4A 3L2WA 1F21A 3LP3A 3QINA 3AA5X 4B08A 3S3MA 1JKHA 2YV0X 1TKXA 2Z1HA 3DMJA 3ZSZA 4B9UA 4IKFA 2ZE2A 4E1MA 3DLHA 4C8NA 1UA0A 5I3UA 1U04A 2HVHA 3T19A 3OYIA 3EY1A 2ZQBA 3F9KA 3THVA 4M41A 3TR8A 4F3TA 2RF2A 5HROA 1KTQA 3LP0A 3SYZA 1HNVA 4CHZA 3SQ4A 4DQPA 3SV3A 4RW4A 4FZXC 2E6LA 3ASMA 1NK0A 2X74A 4CF1A 1TV6A 4FJKA 3SCXA 4FJLA 1ITGA 3V1QA 1L5UA 1GOAA 3JYTA 1ZBLA 2X6NA 4PY5A 4Z4HA 4K8XA 3WNGA 2VWKA 1RILA 2E6MA 2QK9A 1U47A 2O4GA 3VQCA 4EP4A 1VK0A 1VSHA 1RBRA 2HHWA 1LW0A 2F96A 3KLGA 1FKOA 3AVAA 1UOCA 1HYVA 3DLEA 3O4QA 1D5AA 4PWDA 2OYQA 4LD0A 1XHXA 4CK2A 3G10A 1WLJA 1UAXA 1EXQA 5CYMA 4PQUA 4E7JA 3HVRA 2G8FA 3TAFA 4CHOA 3SUOA 4QAGA 3LZIA 4FM2A 2G8IA 4QCLA 1VSJA 1BCMA 5HLFA 2DFEA 3VQDA 3B6OA 1WSGA 4HHTA 2P1JA 4ICLA 3TAMA 4E1NA 4FK4A 3QESA 1S1VA 4JS4A 1KRPA 4KB1A 3QIPA 3NBPA 1ASUA 4Y1DA 4FM0A 4CF8A 4Z4FA 1JXBA 3AVFA 2BANA 5KTQA 1JLBA 3M8RA 1XI1A 3AVHA 4DTNA 1NKEA 1LAWA 1LAVA 3NH1A 5J2QA 3V6DA 4CJUA 1BQMA 4JS5A 3MEGA 1JL2A 3LAMA 1TK5A 4FJGA 3L2UA 2HVIA 1RT1A 3KIOA 3LANA 2O4IA 1DLOA 1RT4A 4CJLA 4KAZA 1IG9A 5J2NA 1C0TA 2X78A 4CEAA 4AHSA 1RTDA 4L8RB 4Z4EA 4CEEA 4FJJA 3I0RA 2B5JA 3VN5A 1T05A 1VRUA 1NOYA 4ELUA 4FK0A 4CJ3A 2YHAA 2KTQA 3OYBA 2HNYA 4O0JA 4CEDA 2PYLA 1JL1A 1S6QA 3OYMA 3RTVA 4DTSA 3TWHA 3L2QA 4H4MA 3AA2A 3WNFA 1VSMA 3V1RA 3ZT0A 1FK9A 3OYNA 4FJNA 2QXFA 3P5JA 3QERA 4CF9A 4NYFA 4AHRA 4DTPA 1VSEA 2P51A 4KHNA 1A5XA 1TKTA 3CYMA 1KLMA 1WAJA 3EYZA 5J2PA 4JLHA 4DWIA 1BHLA 2QKKA 2D0BA 5D3GA 1TKDA 1NK9A 1QHTA 3TANA 4DTUA 3LWMA 5EU7A 3C6UA 3PX6A 4TSXA 4W5TA 3SV4A 3V9WA 4ZTFA 1D9DA 4B9VA 4KHUA 4KV8A 4CGGA 3O3FA 1TK8A 2KFZA 1IKWA 3QETA 4AH9A 2DY4A 4DG1A 2WOMA 3QEWA 2Z1JA 3MXIA 4DSFA 1UWBA 1X9MA 3MEEA 1C1BA 4I9LA 4LY7A 5E41A 3SUPA 1UA1A 3LP1A 1U49A 4B9LA 3HK2A 1KVAA 1KLNA 4N47A 3F73A 4JRPA 1ASWA 2HHVA 4C8KA 3NGIA 1BIZA 1C0UA 1NJXA 2OPSA 5CZ1A 1IKVA 3QEXA 4DFKA 5HP1A 2YKMA 3NF8A 3KJVA 4FLTA 3QEIA 3HO1A 5FROA 1L3TA 4B9NA 2YNGA 4E7IA 1YTAA 1GOCA 1J5OA 1TAUA 1W0HA 1RT7A 3DYAA 4FLUA 1J9AA 1C6VA 1SKRA 1LV5A 4CGJA 2FBTA 2P5GA 4WE1A 1YVUA 1WNSA 3AO3A 3L2VA 1A5WA 4LH5A 3AVKA 3ISNC 4KFBA 4FLZA 3IS9A 4I2QA 5T7BA 3VQ4A 3OS2A 3HM9A 1O1WA 1XWLA 1QSSA 5CY4A 1CLQA 2ZD1A 1QQCA 4DSKA 1RT2A 3KKRA 3OYFA 2YNFA 4FVMA 3U6FA 4C8OA 4OLAA 3CM6A 3M8QA 2IS3A 3L2RA 1KVCA 3AVBA 3M8SA 2WONA 1C0MA 1LWCA 2Z1IA 3RRHA 2GBZA 3PY8A 4PA1A 1RTHA 1EKEA 4IDKA 1WAFA 4FCYA 3RMBA 3NF9A 4BDYA 3KKSA 4GW6A 3HSTB 4DSEA 2OA8A 3OJUA 3M8PA 4CESA 1NK6A 1KSPA 2DTUA 2RPIA 2Q3SA 3U3YA 4ELTA 4HUFA 3V9SA 1XHZA 3HXMA 4CERA 3EZ5A 1ZYQA 4FLXA 4IG3A 5K14A 3SNNA 3AVJA 4CEQA 3NHGA 4FLYA 3IG1A 4BE1A 2HHQA 3TAGA 5C42A 3L3UA 2D0AA 3AVMA 4CJVA 3NGZA 1NK5A 2DFHA 3VQ5A 3NE6A 3BGRA 4FLWA 4IFYA 2HMIA 1CZBA 1J53A 1HRHA 1BQNA 2YNHA 1BISA 1B9DA 3MXJA 4CJFA 4CHYA 4HTUA 4DTOA 2AJQA 4CGDA 3U3GA 4IG0A 3OYJA 1YTUA 1CZ9A 4CJ4A 4KHYA 3CG7A 3ZCMA 4I9QA 4JRQA 3DRPA 4E3SA 4M3XA 1BGXT 3VQ9A 1NK4A 4O5BA 4KO0A 3C95A 4E89A 4CIFA 2Y1IA 2P5OA 4O44A 3SQ2A 3WNEA 5FRMA 4CJPA 4HVJA 1U48A 2G8KA 2HNZA 4KI6A 3RMDA 3H08A 1KFDA 4BE2A 1C1CA 5HRNA 1IKXA 5HRRA 2Z1GA 3OY9A 1VSIA 3QLHA 4RG8A 4CEZA 3HYFA 2QKBA 4Z4IA 2DFFA 3ZSVA 4OPKA 4DTMA 1NOZA 4CECA 1KVBA 5J2MA 1NK7A 1TK0A 1HNIA 1ZBFA 4KB0A 3DRSA 1S1UA 1TVRA 2HW3A 2BDPA 1CXQA 4CJ5A 1T7PA 3DLRA 5FDLA 4CJRA 4ZTJA 4FYDA 1WSEA 2RKIA 3MXMA 1TAQA 3ALYA 2JLEA 4DS5A 3K57A 1WSIA 1HQEA 3AVNA 1Z25A 1DTQA 1RBSA 3CFOA 3P1GA 3RWUA 3B6PA 1HMVA 3OS0A 3VA3A 5KGWA 1S5JA 1A5VA 1Y97A 4I2PA 3OS1A 3LWLA 3K5NA 4OPJA 1RT6A 1QS4A 1SUQA 2KW4A 1XC9A 4CJSA 1KFSA 4YNQA 4FJMA 3SPZA 3HVTA 1BI4B 4DMNA 2OPRA 3ZSQA 5KGXA 3NCIA 4DTJA 1SKSA 3LAKA 1CXUA 3NF6A 1RCHA 3KD1E 3NH2A 4CJEA 1WSHA 2VG5A 4MQ3A 5C24A 4CIEA 2HB5A 1BI4A 1SL1A 1EX4A 5HRPA 1RNHA 2VG7A 4RW9A 1WN7A 3I8DA 3KLFA 4CEFA 3VQPA 5C25A 4F3OA 1ZBIA 3TARA 4BWMA 3K2PA 3O3GA 1X1PA 4XIUA 3PX0A 3ZT3A 3KTQA 2G8HA 1K6YA 3K5MA 3QEVA 2X6SA 4AHCA 2XY6A 4M3TA 2NUBA 2KZZA 2E4LA 4DSIA 4CE9A 3UIQA 4B8CA 2VG6A 3FFIA 1BCOA 2GV9A 4KKOA 3VQBA 2G8UA 2D0CA 4CEOA 3V9XA 3PO4A 4M42A 4CF2A 3RR8A 3OYGA 3DOKA 4FW1A 4O4GA 4CFCA 3LZJA 4B8AB 2F8SA 1SL2A 2OZMA 4CFBA 4HCBA 4FJHA 4KTZA 3PV8A 3K5LA 4OKEA 1QE1A 4DQQA 3KK1A 4DFPA 3S3NA 3NFAA 3OYCA 1IH7A 4BDZA 1WSJA 2EHGA 1L3UA 3AVCA 2BE2A 2XY7A 4NYNA 4Z4CA 1D8YA 4B9MA 4KHWA 3LP2A 4EZ9A 4OGEA 1JLCA 2XRIA 3HPHA 2D5RA 3G0ZA 4M3RA 3VQAA 3CQ8A 2A1RA 1JLAA 3NH0A 5JS1A 4OJRA 2KFNA 2PY5A 4B9TA 3ITHA 3T3FA 3HJFA 3QNNA 1HYZA 4CK3A 2IOCA 3ZSWA 4FJ8A 4G1QA 3AO5A 2Y1JA 4FK2A 4DU1A 4BDPA 5CZ2A 5HBMA 4FXDA 1NKCA 3OYKA 1VSDA 4UQGA 4LH4A 4YFUA 4GMJB 3KLEA 1JLQA 3SZ2A 1X9SA 4KRFA 3T1AA 3AA4A 4HUEA 1JXEA 1VSKA 3HP9A 2W42A 4W5QA 4OKKA 1SV5A 2G8VA 3HPGA 3ZSOA 4M3UA 3AO4A 4CHQA 1IKYA 4BE0A 4J2DA 4KTWA 4I7FA 3VA0A 4IFVA 4RW8A 1JLGA 4DTXA 1JLFA 1S1XA 4HCCA 4HUGA 5I42A 4E7HA 2PYJA 3QIOA 4CGFA 1QSYA 3AO2A 2HHSA 4FJ5A 3DI6A 3OVNA 4DSJA 2KZMA 2KQ2A 4M45A 3ZSYA 3RR7A 4OVLA 1LWEA 2IAJA 3MAQA 4FLVA 3V4IA 4ELVA 4KI4A 4DLGA 2HHUA 3D0PA 4F2RA 3DRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQ1 A;  4H4O A;  4CGH A;  4BAC A;  1R0A A;  1ZBH A;  1B92 A;  3S3O A;  3TAE A;  2HND A;  4AHT A;  2ATQ A;  1FXX A;  3IRX A;  1RTI A;  4DS4 A;  3E01 A;  1JLE A;  1RBV A;  1W9H A;  3AO1 A;  3I0S A;  4NCB A;  3OYL A;  4E0D A;  2XHB A;  5SZT A;  4F2S A;  2ETJ A;  4F4K A;  3AVG A;  2RN2 A;  3AV9 A;  4CJW A;  1TKZ A;  3LPU A;  4CIG A;  3K5O A;  1NJY A;  3O3H A;  3L8B A;  1D9F A;  1NJZ A;  3ZT4 A;  2OPQ A;  3HL8 A;  4KRE A;  1FKP A;  4MFB A;  4FJ9 A;  3VQ6 A;  4CK1 A;  4E7K A;  3BDP A;  2HHT A;  1I3A A;  2I5J A;  3HT3 A;  4PUO A;  4CHN A;  3SJJ A;  3SUQ A;  4N41 A;  2BGG A;  1BIU A;  1QTM A;  4W5N A;  2FBV A;  4N76 A;  4CGI A;  4NCA A;  3VQ7 A;  3NDK A;  3TAP A;  1BL3 A;  1REV A;  4FW2 A;  4ZHR A;  4BWJ A;  3VQE A;  4CJQ A;  4DTR A;  2G8W A;  4AHU A;  1LWF A;  4F8R A;  1RDD A;  4KTQ A;  1J54 A;  5CYQ A;  4Z0U A;  4DQR A;  2XO7 A;  1QSL A;  1T03 A;  1HQU A;  2OZS A;  3V1O A;  1L3V A;  1RT5 A;  2FBY A;  3SI6 A;  5DK5 A;  3ULD A;  4EZ6 A;  3RMC A;  3KK3 A;  4DF4 A;  2GUI A;  2IGI A;  1S9E A;  3KLH A;  3P83 D;  3V9U A;  2XY5 A;  4O55 A;  1G15 A;  1YT3 A;  4M3Z A;  4RW6 A;  3V81 A;  4J2A A;  4KPY A;  4Z4G A;  1DTT A;  3OYH A;  1TGO A;  1RDA A;  2HHX A;  1SL0 A;  5KI6 A;  1LW2 A;  1B9F A;  2YKN A;  2ITG A;  4GVM A;  1X9W A;  3C94 A;  4J2E A;  3DM2 A;  3V9Z A;  1U4B A;  3HP6 A;  4DQI A;  3CM5 A;  3TAQ A;  3KLI A;  3MEC A;  1GOB A;  4CFA A;  2XY8 A;  4CCH A;  4C8M A;  2FC0 A;  1MU2 A;  5SWM A;  3OJS A;  4KHQ A;  4Q0B A;  3O4N A;  4W5O A;  1HJR A;  1EP4 A;  1Q8I A;  4FJ7 A;  3LPT A;  1ZBU A;  1RT3 A;  4LSN A;  3WNH A;  4CJK A;  4E7L A;  3PO5 A;  2YNI A;  4DLE A;  1N5Y A;  1I39 A;  2EX3 A;  3JSM A;  3AA3 A;  1VRT A;  4FM1 A;  1Q9X A;  4DU4 A;  3SPY A;  1Q9Y A;  3ZSX A;  4B9S A;  2PZS A;  4DFJ A;  3NGY A;  1C1A A;  4ID1 A;  2YHB A;  3ZT2 A;  1N6Q A;  1RTJ A;  4CF0 A;  5KRS A;  3HPO A;  3LDS A;  3L3V A;  4M3Y A;  5FRN A;  1ASV A;  4CFD A;  1T8E A;  4QOZ B;  3RMA A;  3OYE A;  3DOL A;  3DLK A;  2R7Y A;  4DQS A;  3TAB A;  1RDB A;  3ZT1 A;  4N5S A;  2IDO A;  4KHS A;  3KD5 E;  3AVL A;  3OYA A;  1RBT A;  5HRS A;  2B4J A;  3DLB A;  2A1S A;  1NK8 A;  1HYS A;  4B3O A;  4LSL A;  4CHP A;  1HPZ A;  1KCF A;  1RDC A;  4FZY A;  2IC3 A;  1VSL A;  1TL3 A;  5JS2 A;  2F8T A;  4AIL C;  1S1W A;  1S1T A;  4OKJ A;  4O0I A;  3IAY A;  1WSF A;  3QEP A;  3CFP A;  2LSN A;  5DMR A;  3K59 A;  4Q5V A;  1SKW A;  3S9H A;  5J1E A;  4W5R A;  4IBN A;  4DFM A;  3QNO A;  4FJI A;  4J2B A;  1EET A;  3C6T A;  1VSF A;  4ID5 A;  4DU3 A;  1NKB A;  4R5P A;  2B6A A;  2JGU A;  4K8Z A;  4C8L A;  4CEB A;  3SUN A;  4NCG A;  1NJW A;  1TL1 A;  3AVI A;  3PUF A;  4OGC A;  4FJX A;  3A2F A;  4DF8 A;  3D45 A;  3OYD A;  3CFR A;  3TI0 A;  4N56 A;  1IO2 A;  4EP5 A;  3K58 A;  2VWJ A;  4H8K A;  3DLG A;  3SQ0 A;  4M3W A;  4FZZ A;  2FBX A;  1U45 A;  3VQQ A;  2OPP A;  3RRG A;  1Z26 A;  4RW7 A;  4Y1C A;  4E19 A;  3VQ8 A;  1RBU A;  3QO9 A;  3NF7 A;  4AHV A;  1S6P A;  1S9G A;  3LAL A;  3MED A;  4CJT A;  5KRT A;  3ZSR A;  3KK2 A;  1L3S A;  4OLB A;  4DSL A;  3NAE A;  3PX4 A;  3L2W A;  1F21 A;  3LP3 A;  3QIN A;  3AA5 X;  4B08 A;  3S3M A;  1JKH A;  2YV0 X;  1TKX A;  2Z1H A;  3DMJ A;  3ZSZ A;  4B9U A;  4IKF A;  2ZE2 A;  4E1M A;  3DLH A;  4C8N A;  1UA0 A;  5I3U A;  1U04 A;  2HVH A;  3T19 A;  3OYI A;  3EY1 A;  2ZQB A;  3F9K A;  3THV A;  4M41 A;  3TR8 A;  4F3T A;  2RF2 A;  5HRO A;  1KTQ A;  3LP0 A;  3SYZ A;  1HNV A;  4CHZ A;  3SQ4 A;  4DQP A;  3SV3 A;  4RW4 A;  4FZX C;  2E6L A;  3ASM A;  1NK0 A;  2X74 A;  4CF1 A;  1TV6 A;  4FJK A;  3SCX A;  4FJL A;  1ITG A;  3V1Q A;  1L5U A;  1GOA A;  3JYT A;  1ZBL A;  2X6N A;  4PY5 A;  4Z4H A;  4K8X A;  3WNG A;  2VWK A;  1RIL A;  2E6M A;  2QK9 A;  1U47 A;  2O4G A;  3VQC A;  4EP4 A;  1VK0 A;  1VSH A;  1RBR A;  2HHW A;  1LW0 A;  2F96 A;  3KLG A;  1FKO A;  3AVA A;  1UOC A;  1HYV A;  3DLE A;  3O4Q A;  1D5A A;  4PWD A;  2OYQ A;  4LD0 A;  1XHX A;  4CK2 A;  3G10 A;  1WLJ A;  1UAX A;  1EXQ A;  5CYM A;  4PQU A;  4E7J A;  3HVR A;  2G8F A;  3TAF A;  4CHO A;  3SUO A;  4QAG A;  3LZI A;  4FM2 A;  2G8I A;  4QCL A;  1VSJ A;  1BCM A;  5HLF A;  2DFE A;  3VQD A;  3B6O A;  1WSG A;  4HHT A;  2P1J A;  4ICL A;  3TAM A;  4E1N A;  4FK4 A;  3QES A;  1S1V A;  4JS4 A;  1KRP A;  4KB1 A;  3QIP A;  3NBP A;  1ASU A;  4Y1D A;  4FM0 A;  4CF8 A;  4Z4F A;  1JXB A;  3AVF A;  2BAN A;  5KTQ A;  1JLB A;  3M8R A;  1XI1 A;  3AVH A;  4DTN A;  1NKE A;  1LAW A;  1LAV A;  3NH1 A;  5J2Q A;  3V6D A;  4CJU A;  1BQM A;  4JS5 A;  3MEG A;  1JL2 A;  3LAM A;  1TK5 A;  4FJG A;  3L2U A;  2HVI A;  1RT1 A;  3KIO A;  3LAN A;  2O4I A;  1DLO A;  1RT4 A;  4CJL A;  4KAZ A;  1IG9 A;  5J2N A;  1C0T A;  2X78 A;  4CEA A;  4AHS A;  1RTD A;  4L8R B;  4Z4E A;  4CEE A;  4FJJ A;  3I0R A;  2B5J A;  3VN5 A;  1T05 A;  1VRU A;  1NOY A;  4ELU A;  4FK0 A;  4CJ3 A;  2YHA A;  2KTQ A;  3OYB A;  2HNY A;  4O0J A;  4CED A;  2PYL A;  1JL1 A;  1S6Q A;  3OYM A;  3RTV A;  4DTS A;  3TWH A;  3L2Q A;  4H4M A;  3AA2 A;  3WNF A;  1VSM A;  3V1R A;  3ZT0 A;  1FK9 A;  3OYN A;  4FJN A;  2QXF A;  3P5J A;  3QER A;  4CF9 A;  4NYF A;  4AHR A;  4DTP A;  1VSE A;  2P51 A;  4KHN A;  1A5X A;  1TKT A;  3CYM A;  1KLM A;  1WAJ A;  3EYZ A;  5J2P A;  4JLH A;  4DWI A;  1BHL A;  2QKK A;  2D0B A;  5D3G A;  1TKD A;  1NK9 A;  1QHT A;  3TAN A;  4DTU A;  3LWM A;  5EU7 A;  3C6U A;  3PX6 A;  4TSX A;  4W5T A;  3SV4 A;  3V9W A;  4ZTF A;  1D9D A;  4B9V A;  4KHU A;  4KV8 A;  4CGG A;  3O3F A;  1TK8 A;  2KFZ A;  1IKW A;  3QET A;  4AH9 A;  2DY4 A;  4DG1 A;  2WOM A;  3QEW A;  2Z1J A;  3MXI A;  4DSF A;  1UWB A;  1X9M A;  3MEE A;  1C1B A;  4I9L A;  4LY7 A;  5E41 A;  3SUP A;  1UA1 A;  3LP1 A;  1U49 A;  4B9L A;  3HK2 A;  1KVA A;  1KLN A;  4N47 A;  3F73 A;  4JRP A;  1ASW A;  2HHV A;  4C8K A;  3NGI A;  1BIZ A;  1C0U A;  1NJX A;  2OPS A;  5CZ1 A;  1IKV A;  3QEX A;  4DFK A;  5HP1 A;  2YKM A;  3NF8 A;  3KJV A;  4FLT A;  3QEI A;  3HO1 A;  5FRO A;  1L3T A;  4B9N A;  2YNG A;  4E7I A;  1YTA A;  1GOC A;  1J5O A;  1TAU A;  1W0H A;  1RT7 A;  3DYA A;  4FLU A;  1J9A A;  1C6V A;  1SKR A;  1LV5 A;  4CGJ A;  2FBT A;  2P5G A;  4WE1 A;  1YVU A;  1WNS A;  3AO3 A;  3L2V A;  1A5W A;  4LH5 A;  3AVK A;  3ISN C;  4KFB A;  4FLZ A;  3IS9 A;  4I2Q A;  5T7B A;  3VQ4 A;  3OS2 A;  3HM9 A;  1O1W A;  1XWL A;  1QSS A;  5CY4 A;  1CLQ A;  2ZD1 A;  1QQC A;  4DSK A;  1RT2 A;  3KKR A;  3OYF A;  2YNF A;  4FVM A;  3U6F A;  4C8O A;  4OLA A;  3CM6 A;  3M8Q A;  2IS3 A;  3L2R A;  1KVC A;  3AVB A;  3M8S A;  2WON A;  1C0M A;  1LWC A;  2Z1I A;  3RRH A;  2GBZ A;  3PY8 A;  4PA1 A;  1RTH A;  1EKE A;  4IDK A;  1WAF A;  4FCY A;  3RMB A;  3NF9 A;  4BDY A;  3KKS A;  4GW6 A;  3HST B;  4DSE A;  2OA8 A;  3OJU A;  3M8P A;  4CES A;  1NK6 A;  1KSP A;  2DTU A;  2RPI A;  2Q3S A;  3U3Y A;  4ELT A;  4HUF A;  3V9S A;  1XHZ A;  3HXM A;  4CER A;  3EZ5 A;  1ZYQ A;  4FLX A;  4IG3 A;  5K14 A;  3SNN A;  3AVJ A;  4CEQ A;  3NHG A;  4FLY A;  3IG1 A;  4BE1 A;  2HHQ A;  3TAG A;  5C42 A;  3L3U A;  2D0A A;  3AVM A;  4CJV A;  3NGZ A;  1NK5 A;  2DFH A;  3VQ5 A;  3NE6 A;  3BGR A;  4FLW A;  4IFY A;  2HMI A;  1CZB A;  1J53 A;  1HRH A;  1BQN A;  2YNH A;  1BIS A;  1B9D A;  3MXJ A;  4CJF A;  4CHY A;  4HTU A;  4DTO A;  2AJQ A;  4CGD A;  3U3G A;  4IG0 A;  3OYJ A;  1YTU A;  1CZ9 A;  4CJ4 A;  4KHY A;  3CG7 A;  3ZCM A;  4I9Q A;  4JRQ A;  3DRP A;  4E3S A;  4M3X A;  1BGX T;  3VQ9 A;  1NK4 A;  4O5B A;  4KO0 A;  3C95 A;  4E89 A;  4CIF A;  2Y1I A;  2P5O A;  4O44 A;  3SQ2 A;  3WNE A;  5FRM A;  4CJP A;  4HVJ A;  1U48 A;  2G8K A;  2HNZ A;  4KI6 A;  3RMD A;  3H08 A;  1KFD A;  4BE2 A;  1C1C A;  5HRN A;  1IKX A;  5HRR A;  2Z1G A;  3OY9 A;  1VSI A;  3QLH A;  4RG8 A;  4CEZ A;  3HYF A;  2QKB A;  4Z4I A;  2DFF A;  3ZSV A;  4OPK A;  4DTM A;  1NOZ A;  4CEC A;  1KVB A;  5J2M A;  1NK7 A;  1TK0 A;  1HNI A;  1ZBF A;  4KB0 A;  3DRS A;  1S1U A;  1TVR A;  2HW3 A;  2BDP A;  1CXQ A;  4CJ5 A;  1T7P A;  3DLR A;  5FDL A;  4CJR A;  4ZTJ A;  4FYD A;  1WSE A;  2RKI A;  3MXM A;  1TAQ A;  3ALY A;  2JLE A;  4DS5 A;  3K57 A;  1WSI A;  1HQE A;  3AVN A;  1Z25 A;  1DTQ A;  1RBS A;  3CFO A;  3P1G A;  3RWU A;  3B6P A;  1HMV A;  3OS0 A;  3VA3 A;  5KGW A;  1S5J A;  1A5V A;  1Y97 A;  4I2P A;  3OS1 A;  3LWL A;  3K5N A;  4OPJ A;  1RT6 A;  1QS4 A;  1SUQ A;  2KW4 A;  1XC9 A;  4CJS A;  1KFS A;  4YNQ A;  4FJM A;  3SPZ A;  3HVT A;  1BI4 B;  4DMN A;  2OPR A;  3ZSQ A;  5KGX A;  3NCI A;  4DTJ A;  1SKS A;  3LAK A;  1CXU A;  3NF6 A;  1RCH A;  3KD1 E;  3NH2 A;  4CJE A;  1WSH A;  2VG5 A;  4MQ3 A;  5C24 A;  4CIE A;  2HB5 A;  1BI4 A;  1SL1 A;  1EX4 A;  5HRP A;  1RNH A;  2VG7 A;  4RW9 A;  1WN7 A;  3I8D A;  3KLF A;  4CEF A;  3VQP A;  5C25 A;  4F3O A;  1ZBI A;  3TAR A;  4BWM A;  3K2P A;  3O3G A;  1X1P A;  4XIU A;  3PX0 A;  3ZT3 A;  3KTQ A;  2G8H A;  1K6Y A;  3K5M A;  3QEV A;  2X6S A;  4AHC A;  2XY6 A;  4M3T A;  2NUB A;  2KZZ A;  2E4L A;  4DSI A;  4CE9 A;  3UIQ A;  4B8C A;  2VG6 A;  3FFI A;  1BCO A;  2GV9 A;  4KKO A;  3VQB A;  2G8U A;  2D0C A;  4CEO A;  3V9X A;  3PO4 A;  4M42 A;  4CF2 A;  3RR8 A;  3OYG A;  3DOK A;  4FW1 A;  4O4G A;  4CFC A;  3LZJ A;  4B8A B;  2F8S A;  1SL2 A;  2OZM A;  4CFB A;  4HCB A;  4FJH A;  4KTZ A;  3PV8 A;  3K5L A;  4OKE A;  1QE1 A;  4DQQ A;  3KK1 A;  4DFP A;  3S3N A;  3NFA A;  3OYC A;  1IH7 A;  4BDZ A;  1WSJ A;  2EHG A;  1L3U A;  3AVC A;  2BE2 A;  2XY7 A;  4NYN A;  4Z4C A;  1D8Y A;  4B9M A;  4KHW A;  3LP2 A;  4EZ9 A;  4OGE A;  1JLC A;  2XRI A;  3HPH A;  2D5R A;  3G0Z A;  4M3R A;  3VQA A;  3CQ8 A;  2A1R A;  1JLA A;  3NH0 A;  5JS1 A;  4OJR A;  2KFN A;  2PY5 A;  4B9T A;  3ITH A;  3T3F A;  3HJF A;  3QNN A;  1HYZ A;  4CK3 A;  2IOC A;  3ZSW A;  4FJ8 A;  4G1Q A;  3AO5 A;  2Y1J A;  4FK2 A;  4DU1 A;  4BDP A;  5CZ2 A;  5HBM A;  4FXD A;  1NKC A;  3OYK A;  1VSD A;  4UQG A;  4LH4 A;  4YFU A;  4GMJ B;  3KLE A;  1JLQ A;  3SZ2 A;  1X9S A;  4KRF A;  3T1A A;  3AA4 A;  4HUE A;  1JXE A;  1VSK A;  3HP9 A;  2W42 A;  4W5Q A;  4OKK A;  1SV5 A;  2G8V A;  3HPG A;  3ZSO A;  4M3U A;  3AO4 A;  4CHQ A;  1IKY A;  4BE0 A;  4J2D A;  4KTW A;  4I7F A;  3VA0 A;  4IFV A;  4RW8 A;  1JLG A;  4DTX A;  1JLF A;  1S1X A;  4HCC A;  4HUG A;  5I42 A;  4E7H A;  2PYJ A;  3QIO A;  4CGF A;  1QSY A;  3AO2 A;  2HHS A;  4FJ5 A;  3DI6 A;  3OVN A;  4DSJ A;  2KZM A;  2KQ2 A;  4M45 A;  3ZSY A;  3RR7 A;  4OVL A;  1LWE A;  2IAJ A;  3MAQ A;  4FLV A;  3V4I A;  4ELV A;  4KI4 A;  4DLG A;  2HHU A;  3D0P A;  4F2R A;  3DRR A; 
#chains in the Genus database with same CATH topology
 2CGJ A;  3FZK A;  4BAC A;  1B92 A;  1K73 O;  3TAE A;  4AHT A;  1RTI A;  4YOR A;  1W9H A;  2BH1 A;  3AO1 A;  2XHB A;  2YHW A;  3CCL N;  1NJY A;  1TKZ A;  3LPU A;  3K5O A;  4IJA A;  5CR4 A;  3VEW A;  2A6A A;  1NJZ A;  2A5X A;  3VF6 A;  1JCE A;  4E7K A;  3BDP A;  2WTU A;  4YOY A;  5TKW A;  2FLO A;  3HT3 A;  3JAM O;  2OTL N;  4N41 A;  2QEX N;  3CJC A;  3ZEU A;  4FW2 A;  5AQX A;  3VQE A;  4AHU A;  5C10 A;  5CYQ A;  4Z0U A;  4DQR A;  2XO7 A;  1T03 A;  2OZS A;  3L4I A;  1RT5 A;  3CC4 N;  2FBY A;  1NBW A;  3GDQ A;  4A59 A;  3BF1 A;  3RMC A;  5GAH P;  1S9E A;  2QA4 N;  2XY5 A;  4O55 A;  1G15 A;  3BF3 A;  2ZJR L;  3MX2 A;  3C7N A;  1TGO A;  1LW2 A;  1YJ9 N;  5DM6 L;  2YKN A;  2ITG A;  1X9W A;  3C94 A;  1Q81 O;  3HP6 A;  3TAQ A;  4BRP A;  2P9N A;  3KLI A;  4CFA A;  3O9Q A;  2A41 A;  1MU2 A;  2JWK A;  5SWM A;  3TTF A;  4KHQ A;  4Q0B A;  1HJR A;  1EP4 A;  4LSN A;  4E7L A;  4LFA K;  4BC4 A;  1I39 A;  3A5O C;  4FM1 A;  4UY8 O;  1Q9Y A;  1W97 L;  3NGY A;  4ID1 A;  1N6Q A;  5KRS A;  3HPO A;  2Q36 A;  3CIP A;  4ISF A;  4WQ4 C;  2W40 A;  3GG4 A;  3O80 A;  3KD5 E;  3H1Q A;  1QQM A;  5HRS A;  3DLB A;  1HYS A;  4B3O A;  1RDC A;  3IAY A;  1ESV A;  1MA9 B;  2LSN A;  4W5R A;  4IBN A;  4QS8 A;  4WQ4 A;  3SUN A;  3UKR B;  3T1Y K;  2KHO A;  4DF8 A;  3E66 A;  3CFR A;  1IO2 A;  4EP5 A;  2VWJ A;  1N8R O;  3CCM N;  4JI6 K;  3VQQ A;  2OPP A;  3PIP L;  3VTH A;  2ASP A;  1RBU A;  3THX B;  4AHV A;  1VHX A;  4CJT A;  3KK2 A;  3ZX3 A;  3PX4 A;  1F21 A;  3LP3 A;  3QIN A;  4KBO A;  3AA5 X;  5AZI A;  1TKX A;  3DMJ A;  1GLE G;  4B9U A;  2ZE2 A;  3DLH A;  4O5F A;  4C8N A;  3MN9 A;  3A0I X;  4JI3 K;  5I3U A;  5F1X A;  1U04 A;  2HVH A;  3T19 A;  2O8B B;  3LP0 A;  4CHZ A;  3T1H K;  4RW4 A;  2E6L A;  2X74 A;  3VTI A;  4CF1 A;  1NWK A;  2P9S A;  2YHX A;  4FJL A;  1ITG A;  3V1Q A;  1L5U A;  2CGL A;  2X6N A;  2VWK A;  3CHW A;  4LF4 K;  1GLA G;  2E6M A;  1NGC A;  2O4G A;  1VK0 A;  1VSH A;  1RBR A;  4WFN L;  3AVA A;  1UOC A;  3CME N;  1D5A A;  3CJB A;  3SJH A;  4CK2 A;  3G10 A;  4NO7 A;  1UAX A;  1EXQ A;  5FPN A;  3DJC A;  3G25 A;  4E7J A;  3HVR A;  2G8F A;  4FL9 A;  4QCL A;  5GAG P;  4FOE A;  1BCM A;  3VGK A;  4IOC L;  3C65 A;  2O8D A;  1BUP A;  2P1J A;  4EHU A;  4H0T B;  5ADX H;  4Y1D A;  2FF6 A;  4A5B A;  1JXB A;  3AVF A;  3FZL A;  4DR2 K;  1LAW A;  1LAV A;  1BQM A;  3L2U A;  2HVI A;  3LAN A;  3THW A;  2BTF A;  4BRH A;  4M63 C;  1IG9 A;  4IOX A;  2J4R A;  4CEA A;  2E2P A;  2UYT A;  4ELU A;  4FK0 A;  1ZXO A;  4H0O A;  4O0J A;  3OYM A;  3RTV A;  4DTS A;  3L2Q A;  3WNF A;  1C0F A;  1RDW X;  3MN7 A;  5FPM A;  2UUC K;  2P9K B;  1VSE A;  3O6W A;  4NXN K;  2UXD K;  1E4F T;  3RSE B;  1NK9 A;  4JKE A;  4K0K K;  4W5T A;  4KHU A;  5ADX A;  4OO1 J;  1JCF A;  1TK8 A;  1IKW A;  4BR9 A;  2HST A;  4DG1 A;  4DSF A;  3MEE A;  4B9L A;  4I9L A;  3SUP A;  1BU6 O;  3E9O A;  4C8K A;  3SAH A;  2YKM A;  4FLT A;  3CC2 N;  5KQ8 A;  1L3T A;  4K25 A;  4E7I A;  1YTA A;  2ASM A;  3H45 C;  1J5O A;  1W0H A;  3DYA A;  1LV5 A;  4GKJ K;  4CGJ A;  2P5G A;  4WE1 A;  3MWP A;  1NU0 A;  4LH5 A;  3ISN C;  4KFB A;  3MWT A;  4I2Q A;  3VQ4 A;  1O1W A;  1XWL A;  3C6H A;  4FPB A;  5BN9 A;  1QQC A;  1RT2 A;  3OYF A;  4JNE A;  1Q82 O;  2IS3 A;  5HOO A;  1OH5 A;  1HKG A;  3AVB A;  2WON A;  4H5R A;  4NLB A;  2Z1I A;  3RRH A;  1OH6 A;  3D2F A;  1N36 K;  5AFU H;  1RTH A;  3RMB A;  3DXM B;  4GW6 A;  3D2E B;  2IVP A;  3HXM A;  4CER A;  2Q1N A;  3MCP A;  1ZC6 A;  3CXC M;  3CCU N;  4FLX A;  4PKI A;  5K14 A;  4BRK A;  2HMP A;  3SNN A;  1HJO A;  3FGU A;  1YJW N;  2HHQ A;  3TAG A;  5KPR A;  3TSQ A;  2D0A A;  4CJV A;  2DFH A;  3WXL A;  3NE6 A;  3BGR A;  2VQE K;  1HRH A;  1BQN A;  4DTO A;  3U3G A;  4IG0 A;  1V4S A;  1MWK A;  5LMU K;  3U8X A;  3ULE A;  3CJ7 A;  4KHY A;  2Q97 A;  3DRP A;  4E3S A;  1BGX T;  1NK4 A;  3C95 A;  4E89 A;  2P5O A;  2Y1I A;  3PSF A;  4WFA L;  4HVJ A;  5AFU A;  3RMD A;  3FZF A;  1BDG A;  4RG8 A;  4CEZ A;  3ZSV A;  2P9I A;  4V19 S;  4CEC A;  1KVB A;  1ZBF A;  1S1U A;  3SBT A;  5AZJ B;  2BDP A;  4FWS A;  1SAZ A;  4CJ5 A;  1NLV A;  4ZTJ A;  2E88 A;  1WSE A;  3MXM A;  1TAQ A;  4DS5 A;  1YIT N;  1K8K B;  3RWU A;  3CFO A;  3OS0 A;  4I2P A;  3LWL A;  2UXC K;  2KW4 A;  1HUX A;  1KFS A;  1NM1 A;  1QQO A;  1BI4 B;  2OPR A;  5H1S Q;  3KD1 E;  1WSH A;  2HB5 A;  2GWJ A;  4B1X B;  1OVY A;  2VG7 A;  1WN7 A;  3A5L C;  3LDP A;  5C25 A;  2ASO A;  3O3G A;  3K2P A;  1CZA N;  3ZT3 A;  3KTQ A;  1K6Y A;  2X6S A;  2XY6 A;  2NUB A;  1ZBS A;  5EOY A;  4NLC A;  3UIQ A;  2QWO A;  4YDU C;  3DXK B;  2GV9 A;  4CEO A;  2NLX A;  5F2R A;  3EO3 A;  4O4G A;  1D4X A;  1SL2 A;  5I9E B;  3O1B A;  4KTZ A;  3K5L A;  1VQ9 N;  3WEE B;  5BPL A;  4JHD B;  1IH7 A;  4H0P A;  4KH4 A;  4YHH K;  1VQ8 N;  4A5A A;  4YDU A;  4AM7 A;  2ZM6 K;  1D8Y A;  4B9M A;  4EZ9 A;  4DV1 K;  4KHW A;  3HPH A;  2G8V A;  1V4T A;  1JLA A;  1NGG A;  3F2K A;  4OJR A;  4DV7 K;  5JS1 A;  3G71 N;  4B9T A;  1HYZ A;  3Q7B A;  3ZSW A;  1HR0 K;  4G9Z A;  4FK2 A;  2VGN A;  2ITM A;  3EZW A;  1VQK N;  1VSD A;  4GMJ B;  1DT9 A;  1JLQ A;  3T1A A;  3HP9 A;  3O08 A;  3CQY A;  3HPG A;  3ZSO A;  3AO4 A;  3CJA A;  4WCE L;  4BE0 A;  4I7F A;  2WUS A;  1S1X A;  4HCC A;  4HUG A;  4DB3 A;  2PYJ A;  1MDU B;  3QIO A;  4X62 K;  3T7Z A;  4FWK A;  3DI6 A;  4IJN A;  4OVL A;  4ELV A;  5CE3 A;  2HHU A;  4DV6 K;  4BRL A;  5GIO A;  4BGB A;  3D0P A;  3I33 A;  4F2R A;  4BRM A;  1YIJ N;  1KAZ A;  4CGH A;  2P9P A;  3S3O A;  1K8A O;  4JD2 A;  2HBJ A;  2HND A;  2ATQ A;  1FXX A;  2QWP A;  3VET A;  3E01 A;  1JLE A;  3R6M A;  4NCB A;  3OYL A;  4E0D A;  3QML A;  5SZT A;  4F2S A;  2Q2R A;  3F5T A;  4B3T K;  2RN2 A;  5LJW A;  3L8B A;  2Q0U A;  1HKB A;  3HL8 A;  4IZ9 A;  5BPN A;  1EWR A;  1FKP A;  4MFB A;  3VQ6 A;  2O8F A;  4CHN A;  3SUQ A;  1BIU A;  1U2V A;  3VQ7 A;  2YHY A;  1BL3 A;  1DKG D;  4CJQ A;  3VER A;  1QSL A;  4U67 L;  3LDN A;  1T44 A;  4DR5 K;  3GL1 A;  5DK5 A;  3ULD A;  4EZ6 A;  3CET A;  4DF4 A;  2IGI A;  3O9T A;  4RW6 A;  4J2A A;  4KPY A;  3CF5 L;  3SLC A;  1LOT B;  4J2E A;  1U4B A;  4E1J A;  2E2Q A;  3MEC A;  2V7Z A;  2XY8 A;  4BVO A;  3VGL A;  1Q8I A;  5AQV A;  4FJ7 A;  1RT3 A;  4LF8 K;  3WXI A;  4IWV A;  5AQR A;  1N5Y A;  2AA4 A;  3AA3 A;  1VRT A;  3SPY A;  3MDQ A;  4B9S A;  2PZS A;  5GIN A;  2F9T A;  3ZET B;  4CFD A;  4JKA A;  2RE2 A;  3DLK A;  3TAB A;  3ZT1 A;  2IDO A;  3GBT A;  4KHS A;  3AVL A;  1EWQ A;  3ENO A;  2B4J A;  1NK8 A;  3B8A X;  1HPZ A;  1XMQ K;  2QM1 A;  1S1T A;  4DHY A;  5DMR A;  3H46 O;  3K59 A;  3E9P A;  1SKW A;  5J1E A;  4FJI A;  3C6T A;  3N4Q A;  4R5P A;  4K8Z A;  4NCG A;  1TL1 A;  2V51 B;  4OGC A;  5AQH A;  3TI0 A;  4M3W A;  3WQT A;  3K58 A;  4H8K A;  5AQF A;  2O8E B;  4FZZ A;  2E20 A;  3MMV A;  2FF3 B;  4RW7 A;  4E19 A;  4PHT X;  4BQZ A;  3QO9 A;  3NF7 A;  5AQS A;  1S6P A;  1S9G A;  1L3S A;  5KRT A;  3ZSR A;  1TUU A;  2OAN A;  3NAE A;  1JKH A;  3EKU A;  1BA0 A;  1XUP O;  1VQP N;  1UA0 A;  1VQL N;  2ZQB A;  3F9K A;  1BA1 A;  5HRO A;  1VAZ A;  4F9O A;  1S22 A;  3SYZ A;  4IO8 A;  3SV3 A;  1S72 N;  2QWN A;  1NK0 A;  3TSU A;  3IUC A;  2NRZ A;  4FJK A;  1GOA A;  3LM9 A;  1ZBL A;  4PY5 A;  2I7P A;  2A3Z A;  3BUZ B;  3OBY A;  1N33 K;  1LW0 A;  3KLG A;  1FKO A;  1HYV A;  3P4I A;  2P9L B;  2OYQ A;  3SAG A;  3HZ6 A;  3JS6 A;  5JMV A;  1XHX A;  4PQU A;  3OW2 M;  2E8A A;  5BR8 K;  4CHO A;  2QXL A;  4QAG A;  2G8I A;  3EN9 A;  4DR3 K;  4IDH A;  2DFE A;  1WSG A;  1H1V A;  2CH6 A;  4JS4 A;  2E5L K;  1GLF O;  1J5E K;  1VQM N;  5AQP A;  4FM0 A;  4CF8 A;  3O1W A;  3M8R A;  3AVH A;  3NH1 A;  5J2Q A;  2HF4 A;  4CJU A;  4JK8 A;  4MO5 A;  3MEG A;  1ILY A;  4C1N K;  5BRH A;  1C0T A;  4LF9 K;  4CZL A;  1RTD A;  3LDL A;  3FR0 A;  4CEE A;  1VRU A;  1NOY A;  3VOV A;  3OYB A;  2D0P A;  4IXC A;  3TWH A;  3AA2 A;  1ATN A;  1VSM A;  4CF9 A;  4BRG A;  4AHR A;  1M1K O;  4KHN A;  1OH7 A;  2GEL A;  4BR7 A;  3CYM A;  4GVE A;  1WAJ A;  5J2P A;  4JLH A;  4DWI A;  2QKK A;  5D3G A;  1QHT A;  4DTU A;  3LWM A;  5EU7 A;  5LY3 A;  3WXM B;  4TSX A;  3SV4 A;  1D9D A;  4B9V A;  4EHT A;  4DV2 K;  2KKZ A;  1IBK K;  2DY4 A;  2Z1J A;  4DV0 K;  1X9M A;  1C1B A;  2JWL A;  2YJE A;  3AAR A;  2CH5 A;  3J7Z O;  4JRP A;  4Y0W A;  2OPS A;  1IKV A;  2WC9 A;  3ATU A;  3TTC A;  1YHQ N;  3QEI A;  3HO1 A;  2YNG A;  4ILJ A;  4FOI A;  1GOC A;  4CZH A;  4DUZ K;  1TAU A;  4FLU A;  3CMA N;  1BG3 A;  1YVU A;  1WNS A;  3L2V A;  3AVK A;  3HM9 A;  1TYQ B;  4B1W B;  5CY4 A;  3FZH A;  1T6D A;  3CM6 A;  3CCS N;  3L2R A;  1KVC A;  4BY9 C;  1FW6 A;  3BP8 A;  3PY8 A;  3AAP A;  1N32 K;  2V52 B;  1WAF A;  4FCY A;  3QBX A;  4CI6 A;  3HST B;  4X65 K;  4GY2 B;  3HOS A;  3P39 A;  4BR2 A;  4JI2 K;  1G99 A;  4CES A;  1NK6 A;  3V9S A;  1XHZ A;  1WBD A;  5TKY A;  3W3D A;  4IG3 A;  1KC8 O;  4LF7 K;  4JKH A;  5AR0 A;  3L3U A;  4GKK K;  2KLA A;  1NK5 A;  3VQ5 A;  2HMI A;  4IFY A;  2YNH A;  3CPE A;  1CZ9 A;  3A8Y A;  1NJI O;  4GNI A;  3A5M C;  4M3X A;  3VQ9 A;  4O5B A;  5LMN K;  4KO0 A;  4YOW A;  4CJP A;  2G8K A;  4KI6 A;  2E2O A;  1KFD A;  2V7Y A;  4BE2 A;  4DV4 K;  5HRN A;  5HRR A;  3I56 N;  2Z1G A;  4I6M A;  2DFF A;  1NK7 A;  5J2M A;  2P9U A;  4KB0 A;  2NRX A;  3UKU A;  4FWQ A;  3EE8 A;  3DLR A;  3DLL L;  4CZI A;  2RKI A;  2JLE A;  3MN6 A;  1HQE A;  3AVN A;  1DTQ A;  3FE1 A;  4HTL A;  3K5N A;  4OPJ A;  1QS4 A;  1NMD A;  1XC9 A;  4CJS A;  4JKG A;  1YJN N;  3HVT A;  3ZSQ A;  3NCI A;  1NGF A;  4FPA A;  1RCH A;  3HBT A;  3NH2 A;  4CJE A;  1NGE A;  5HRP A;  4RW9 A;  4M7X A;  3I8D A;  3KLF A;  1Q7Y O;  1GLL O;  1ZBI A;  1X1P A;  4EAH D;  4B1V A;  4OPH A;  4XIU A;  4H03 B;  3PX0 A;  4YOV A;  4AHC A;  3VF4 A;  4KH6 A;  4NXM K;  2VG6 A;  3FFI A;  1BCO A;  1DGK N;  2G8U A;  3V9X A;  4C1N I;  4M42 A;  3ID8 A;  3RR8 A;  1BO5 O;  4JI7 K;  1P8Z A;  2OZM A;  4BRE A;  3PV8 A;  1QE1 A;  5A2Q O;  1YVN A;  4DQQ A;  3W0L A;  4GV6 A;  3LP2 A;  4M3R A;  3VQA A;  1XNR K;  2O8C A;  4A2B A;  3CC7 N;  4CZJ A;  5AQM A;  4G1Q A;  5M1N A;  3THY A;  4DU1 A;  2Y1J A;  5DM7 L;  4FXD A;  3SZ2 A;  1JXE A;  1T3V A;  1KD1 O;  4OKK A;  5M1Q A;  1SV5 A;  5AQL A;  4M3U A;  3QFU A;  1NGA A;  3QB0 A;  4DTX A;  4IFV A;  4RW8 A;  4BVP A;  3AO2 A;  3FFK B;  2NRH A;  2HHS A;  2HBK A;  2KQ2 A;  5JVH L;  1RDU A;  3ZSY A;  3SMS A;  3KHY A;  3RR7 A;  3V4I A;  4KI4 A;  3DRR A;  3N4P A;  4H4O A;  1ZBH A;  1R0A A;  3KK7 A;  3OBW A;  4DS4 A;  1RBV A;  3HRG A;  3J80 O;  5AQG A;  3WQU A;  1YAG A;  3AV9 A;  4CJW A;  3O3H A;  1D9F A;  3ZT4 A;  4KRE A;  4CK1 A;  3E9L A;  1I3A A;  3U4L A;  2I5J A;  3GOI A;  4JI4 K;  4NB4 A;  3SJJ A;  3ZEU B;  2BGG A;  3M1F A;  2FBV A;  4N76 A;  2BUP A;  4CGI A;  4NCA A;  1REV A;  4ZHR A;  4BWJ A;  3U9Z A;  1LWF A;  4F8R A;  1RDD A;  4KTQ A;  4H0V B;  3VF2 A;  1HQU A;  3P38 A;  5M1F A;  5ELZ A;  3C7N B;  1NGJ A;  2E2N A;  5EXW A;  4B1U B;  1YT3 A;  4M3Z A;  4CD3 A;  4Z4G A;  1DTT A;  1RDA A;  4A61 A;  2P9N B;  3SBG A;  1SL0 A;  5KI6 A;  1OH8 A;  3IKM A;  1B9F A;  4GVM A;  3K9K A;  3V9Z A;  4DKW A;  1IJJ A;  1GOB A;  2FC0 A;  3O4N A;  4W5O A;  2Q0R A;  3WNH A;  3PO5 A;  2YNI A;  4DLE A;  1QVF M;  2EX3 A;  4DU4 A;  4QS9 A;  5AQO A;  5BRF A;  3ZT2 A;  2FSN A;  5C2F A;  1RFQ A;  1NGI A;  3L3V A;  3AY9 A;  4M7Y A;  4BRA A;  4LFC K;  1T8E A;  5FPE A;  3H1V X;  2R7Y A;  4DQS A;  4A2A A;  1RDB A;  3LDQ A;  3VEN A;  4DR7 K;  2A1S A;  3L6Q A;  4FZY A;  2IC3 A;  1VSL A;  2IVO A;  1YXQ A;  2F8T A;  2HHV A;  1S1W A;  4OKJ A;  1WSF A;  3QEP A;  3CFP A;  4Q5V A;  4PKG A;  3S9H A;  4DFM A;  3LDO A;  3Q7C A;  5EX5 A;  3QNO A;  4ID5 A;  4FWM A;  2JGU A;  1J6Z A;  5C12 A;  4C8L A;  3IFR A;  3ZX2 A;  4BR0 A;  1NJW A;  4FJX A;  3OYD A;  4N56 A;  3UKR A;  3DLG A;  3L0Q A;  2HBL A;  4BRF A;  1U45 A;  4JV5 K;  3RVC A;  3ZYY X;  5IT9 O;  3RRG A;  1Z26 A;  4Y1C A;  4BRN A;  3CJ9 A;  2GUP A;  5M1K A;  1EO1 A;  3LAL A;  2ZWH A;  1YUW A;  5AZI B;  4OLB A;  2FSK A;  3R8E A;  4DSL A;  1DEJ A;  3THX A;  4B08 A;  2RHK A;  2YV0 X;  4IKF A;  4E1M A;  1U6Z A;  4JAX A;  3OYI A;  4WF9 L;  3CCE N;  4FWO A;  1OVQ A;  1Z6R A;  1KTQ A;  2P9S B;  4FJM A;  3SQ4 A;  1WUA A;  3QBW A;  4DQP A;  2QWL A;  3ASM A;  3CI5 A;  1TV6 A;  3EKS A;  3SCX A;  2IVN A;  3JYT A;  4Z4H A;  2VGM A;  4K8X A;  3WNG A;  3VEO A;  1RIL A;  1U47 A;  3VQC A;  5AQY A;  2F96 A;  5JLF A;  4AM6 A;  4JK7 A;  4IEI A;  2GX9 A;  3DAW A;  3O4Q A;  1VQN N;  4PWD A;  1GLD G;  4LD0 A;  5JLH A;  4FO0 A;  2YCH A;  5CYM A;  3CCJ N;  3CER A;  3TAF A;  2O8D B;  3LZI A;  1Y64 A;  3R1X A;  4FM2 A;  3KVG A;  4R79 A;  1TUY A;  4OPA A;  3VQD A;  3B6O A;  4HHT A;  4BR5 A;  3VEV A;  4E1N A;  4K42 A;  1KRP A;  3QIP A;  3NBP A;  4Z4F A;  4AQY K;  3IMX A;  3K9J A;  4DTN A;  1NKE A;  2ZJQ L;  3THW B;  5AQK A;  4X66 K;  4JS5 A;  3LAM A;  3VEX A;  1C0G A;  1RT4 A;  4KAZ A;  4RCH A;  1RGI A;  3ATV A;  2OCE A;  1X3M A;  1Z05 A;  1SQK A;  3I0R A;  1T05 A;  2KTQ A;  4CJ3 A;  2YHA A;  4WFB L;  2HNY A;  4CED A;  4IEE A;  1JL1 A;  1S6Q A;  4DFK A;  4B3R K;  2PAV A;  4H4M A;  3OYN A;  3CCR N;  3SMP A;  4DTP A;  1A5X A;  1R59 O;  4MDA A;  2E1Y A;  3EYZ A;  2P9K A;  1BHL A;  4AF1 A;  2D0B A;  1GLJ O;  4K41 A;  1TKD A;  2W41 A;  4ISE A;  4O8U A;  3C6U A;  3PX6 A;  4JYA K;  3RSE A;  4C23 A;  2E1Z A;  3O3F A;  4H5T A;  3QEW A;  3D7E O;  3O9U A;  1UWB A;  5E41 A;  4LY7 A;  1U49 A;  2QWM A;  1KVA A;  1KLN A;  3BEX A;  4GV3 A;  1BIZ A;  1C0U A;  1NJX A;  3TPQ A;  3QEX A;  5HP1 A;  1HLU A;  3NF8 A;  3KJV A;  3OA9 A;  4FWR A;  3M3Z A;  2WFB A;  4BRI A;  1RT7 A;  1C6V A;  3AO3 A;  1A5W A;  1Q86 O;  4LC9 B;  2IIR A;  4DV3 K;  1VQ4 N;  3KKR A;  4H5V A;  3D2F B;  4OLA A;  3U6F A;  3M8Q A;  2GTD A;  3CQX A;  4PA1 A;  4DR4 K;  3HOT A;  1EKE A;  4BG9 A;  3C6A A;  3MK6 A;  4DSE A;  2OA8 A;  2Q31 A;  3WT0 A;  3M8P A;  3DXM A;  2OTJ N;  1KSP A;  2DTU A;  5LJV A;  5BR9 A;  3D2E A;  3EZ5 A;  1ZYQ A;  4B1Z A;  3ENH A;  3NHG A;  1GLC G;  3IG1 A;  4XH4 A;  3G4S N;  2PFU A;  3NGZ A;  1VQ7 N;  1XMO K;  2VYP A;  1J53 A;  2KFZ A;  4CHY A;  1BIS A;  4HTU A;  4CJF A;  1HNW K;  3ULE B;  2AJQ A;  1BOT O;  3OYJ A;  4B3S K;  1YTU A;  3VGM A;  4RTF D;  4CJ4 A;  3ZCM A;  4QS7 A;  4JRQ A;  1QVG M;  1HKC A;  2VWB A;  3BZK A;  4X64 K;  4O44 A;  3SQ2 A;  2HBM A;  3WNE A;  5FRM A;  4DR1 K;  3G6E N;  1U48 A;  2HNZ A;  4BG8 A;  4JN4 A;  3H08 A;  1WB9 A;  2P9I B;  3OY9 A;  4XH1 A;  5KPZ A;  3HYF A;  4KHP K;  3UB5 A;  4Z4I A;  3HM8 A;  1TK0 A;  4Z94 A;  5GAD P;  3DRS A;  1TVR A;  2HW3 A;  2UXB K;  2F9W A;  3NMU A;  3O5B A;  1T7P A;  2QI2 A;  3PSI A;  5FDL A;  4CJR A;  1KAY A;  1HNZ K;  5AZJ A;  2F7T A;  4CW7 B;  3K57 A;  4BC2 A;  1RBS A;  3B6P A;  3C0B A;  1E3M A;  1A5V A;  1Y97 A;  1K8K A;  3OS1 A;  2ZGY A;  1SZ2 A;  3TTD A;  1SUQ A;  4YNQ A;  4DMN A;  5KGX A;  1SKS A;  1CXU A;  3NF6 A;  2VG5 A;  5C24 A;  1BI4 A;  1SL1 A;  1EX4 A;  1HNX K;  3TAR A;  2D1K A;  4KH5 A;  2G8H A;  3KZB A;  2ZGZ A;  3K5M A;  4CJ7 A;  4M3T A;  2E4L A;  4CE9 A;  3MCA B;  4KKO A;  3VQB A;  4MO4 A;  4ILH A;  1EQY A;  4CF2 A;  3T69 A;  3O9R A;  4FW1 A;  3DXK A;  2F8S A;  3J7A P;  4ISG A;  4HCB A;  4FJH A;  4CVN E;  3KK1 A;  3H3O B;  4EIA A;  3NFA A;  1WSJ A;  4CZK A;  3AVC A;  3PLA A;  3I8B A;  2UUB K;  4NYN A;  3EEQ A;  4OGE A;  3WEE A;  3NVM A;  1JLC A;  5AQN A;  4JHD A;  3G0Z A;  2A1R A;  3NH0 A;  3FLC O;  2PY5 A;  3WXK A;  3HJF A;  4FJ8 A;  3OHR A;  1X9J A;  2YX6 A;  3AO5 A;  2WBN A;  5HL7 L;  4BDP A;  2FXU A;  4BRO A;  4KRF A;  3IDH A;  3KLE A;  4ILG B;  5CHI A;  4HUE A;  3AA4 A;  2W42 A;  4W5Q A;  4JKF A;  4EFH A;  4JI1 K;  4FVU A;  3AGR A;  5F0X A;  1IKY A;  1IG8 A;  4J2D A;  3BZC A;  3WXJ A;  1JLF A;  3HSC A;  1JCG A;  3VMF B;  4E7H A;  2QW9 A;  1QSY A;  3R3L A;  4H5N A;  4FJ5 A;  4BGA A;  1LWE A;  2IAJ A;  2P9P B;  4JD2 B;  3SQ1 A;  3LM2 A;  3IRX A;  3I0S A;  4YY3 K;  2ETJ A;  4F4K A;  3AVG A;  4CIG A;  2O8F B;  1IV0 A;  2QTD A;  2OPQ A;  4JI0 K;  4FJ9 A;  2HHT A;  1U2V B;  3R9P A;  4PUO A;  1QTM A;  4W5N A;  3NDK A;  5EY4 A;  3TAP A;  4DTR A;  4A57 A;  2G8W A;  5LL6 Z;  2FSJ A;  1J54 A;  1XQS C;  2NZT A;  3V1O A;  1L3V A;  1OKJ A;  3SI6 A;  4CBU A;  4JKB A;  5GAE P;  3M5R A;  3KK3 A;  2GUI A;  3KLH A;  3P83 D;  3V9U A;  3V81 A;  2W6K A;  1YI2 N;  3OYH A;  2HHX A;  3DM2 A;  4DQI A;  3CM5 A;  4CCH A;  4C8M A;  3CCV N;  1NGD A;  3OJS A;  2HHH K;  3CJ1 A;  3LPT A;  1ZBU A;  5E84 A;  4CJK A;  1KXP A;  4CBX A;  3JSM A;  2F4V K;  1Q9X A;  3ZSX A;  4DFJ A;  1C1A A;  2YHB A;  1RTJ A;  4CF0 A;  4FWN A;  3LDS A;  4XEI A;  4M3Y A;  5FRN A;  1ASV A;  1N34 K;  4QOZ B;  3RMA A;  3OYE A;  3DOL A;  4N5S A;  3ZET A;  1LCU A;  3OYA A;  1RBT A;  3CD6 N;  1WOQ A;  4LSL A;  4CHP A;  1KCF A;  2EWS A;  3OTO K;  5JS2 A;  1TL3 A;  4O0I A;  4DSK A;  2HF3 A;  3U9D A;  4J2B A;  1EET A;  4DU3 A;  1VSF A;  3ZLJ A;  1NKB A;  3TU5 A;  5JIC A;  2B6A A;  1W2B M;  4CEB A;  1Q18 A;  3A5N C;  3AVI A;  1I94 K;  3PUF A;  4JK9 A;  3A2F A;  1M90 O;  3D45 A;  2QWR A;  1FJG K;  3SQ0 A;  2FBX A;  2O8E A;  5E26 A;  2W6L A;  3VQ8 A;  3MED A;  4RWT A;  5M1O A;  1QQN A;  4MLE A;  3L2W A;  3S3M A;  1O13 A;  4U7B A;  4BRD A;  2Z1H A;  3ZSZ A;  2VCP A;  2YJF A;  4B1Y B;  1KQS M;  3WUH A;  3O4W A;  3I55 N;  3EY1 A;  3THV A;  1GLB G;  4M41 A;  3TR8 A;  1XC3 A;  4F3T A;  2RF2 A;  5AQT A;  1HNV A;  4FZX C;  5FPD A;  2HOE A;  2VQF K;  1KAX A;  4MLH A;  2QK9 A;  4EP4 A;  2HHW A;  3DLE A;  1HPM A;  5FLX O;  4DQ8 A;  4DCH A;  4BR4 A;  4FWP A;  1WLJ A;  3D6R A;  2UUA K;  3P31 A;  2NRT A;  2P9L A;  3EE9 A;  3J8A A;  4CZF A;  2QWQ A;  4JKD A;  3SUO A;  1QZ5 A;  1VSJ A;  4IO9 L;  5HLF A;  4WYB A;  4ICL A;  3TAM A;  4FK4 A;  3QES A;  1S1V A;  3ZX0 A;  4KB1 A;  1HX1 A;  1ASU A;  2BAN A;  5KTQ A;  1JLB A;  5JVG L;  1XI1 A;  2GEM A;  4PKH A;  3V6D A;  5AJ3 K;  1VQ5 N;  1T6C A;  5EVZ A;  1TK5 A;  1JL2 A;  4FJG A;  4H5W A;  2GWK A;  1RT1 A;  3KIO A;  2O4I A;  4YOT A;  3CPW M;  1DLO A;  4CJL A;  1VQO N;  3F9M A;  5J2N A;  2X78 A;  4AHS A;  4L8R B;  4Z4E A;  4FJJ A;  2A42 A;  2B5J A;  4L3Q A;  3VN5 A;  3O8M A;  2PYL A;  4A62 A;  4AIL C;  4FJN A;  3H3N O;  3V1R A;  3ZT0 A;  1FK9 A;  3JXU A;  2QXF A;  3P5J A;  3QER A;  2ZF5 O;  3ENB A;  4NYF A;  2P51 A;  1TKT A;  2CGK A;  1KLM A;  1NGB A;  2D4W A;  4HWI A;  3TAN A;  3AAQ A;  3MN5 A;  3V9W A;  4ZTF A;  1BWF O;  4KV8 A;  4CGG A;  5AQJ A;  4H0X B;  3QET A;  4AH9 A;  3NVK A;  4BQL A;  2WOM A;  3AGK A;  3FZM A;  4LF6 K;  3MXI A;  1NG9 A;  3HTV A;  1UA1 A;  3HK2 A;  4J8F A;  3LP1 A;  4N47 A;  3F73 A;  1ASW A;  5IWA K;  3NGI A;  5CZ1 A;  2NNW A;  1S3X A;  3H6E A;  4LF5 K;  3GE1 A;  5FRO A;  5AQU A;  4B9N A;  5AQW A;  3QIC A;  5BPM A;  5C0Y A;  1P90 A;  4BC5 A;  1SKR A;  1J9A A;  1NMN A;  2FBT A;  3DWL A;  4FLZ A;  4IFE A;  3IS9 A;  5T7B A;  3OS2 A;  1NNE A;  4CBW A;  1QSS A;  1NGH A;  2ZD1 A;  2UU9 K;  1CLQ A;  2YNF A;  4FVM A;  4C8O A;  4JKC A;  1SS6 A;  1TYQ A;  3M8S A;  1C0M A;  1LWC A;  2GBZ A;  4WQ5 C;  1VQ6 N;  4IDK A;  4K43 A;  3NF9 A;  5B8H A;  2I7N A;  1W7A A;  4BDY A;  3KKS A;  2O8B A;  5BRD A;  3KWI A;  3OJU A;  2RPI A;  1YF5 L;  1ATS A;  2Q3S A;  3U3Y A;  4ELT A;  4HUF A;  4DUY K;  2NRR A;  3AVJ A;  4CEQ A;  4WQ5 A;  4FLY A;  4BE1 A;  3O9S A;  5C42 A;  3EL2 A;  3AVM A;  3E1Y A;  4B9Q A;  4FLW A;  1CZB A;  3MXJ A;  5M1P A;  1B9D A;  3MX5 A;  4CGD A;  1WBB A;  3J7Y P;  3CG7 A;  3K0S A;  3LL3 A;  4I9Q A;  4CIF A;  3ID6 A;  4FWL A;  4O8K A;  3S41 A;  4GV9 A;  1QZ6 A;  2D0O A;  4I6M B;  1C1C A;  1IKX A;  1VSI A;  3QLH A;  2P9U B;  4YOX A;  2QKB A;  3UKU B;  4OPK A;  4DTM A;  1NOZ A;  1HNI A;  4BC3 A;  1CXQ A;  3VES A;  5AQI A;  3QFP A;  4JI8 K;  1K9M O;  4FYD A;  1IBL K;  5AQQ A;  3ALY A;  5BN8 A;  1XNQ K;  3PIO L;  3M6G A;  1WSI A;  2AP1 A;  1Z25 A;  3BY5 A;  3P1G A;  4JKG B;  1HMV A;  3VA3 A;  5KGW A;  1S5J A;  4PL8 A;  1RT6 A;  1E4G T;  1X3N A;  3HI0 A;  3SPZ A;  3QDK A;  4DTJ A;  3LAK A;  4MQ3 A;  4CIE A;  4OX9 K;  4CZE A;  1RNH A;  3KWG A;  4CZM A;  4CEF A;  3VQP A;  5KPT A;  4F3O A;  2PBD A;  4BWM A;  3VEZ A;  2A40 A;  3SK3 A;  5C15 A;  4BRC A;  3QEV A;  4JI5 K;  2KZZ A;  3TSP A;  1MWM A;  4DSI A;  4B8C A;  2DPN A;  2NRV A;  1IBM K;  3PO4 A;  5AQZ A;  2D0C A;  1JJ2 M;  4IOA L;  3OYG A;  3DOK A;  2ZJP L;  5GIP A;  3LZJ A;  4CFC A;  4B8A B;  2YI1 A;  4CFB A;  4YOU A;  4OKE A;  1QHA A;  3CCQ N;  4DFP A;  3S3N A;  4BDZ A;  3OYC A;  1L3U A;  2EHG A;  2BE2 A;  3SAF A;  2XY7 A;  4Z4C A;  2O8C B;  3VEY A;  2XRI A;  4DR6 K;  2D5R A;  3CQ8 A;  2KFN A;  1ATR A;  3THY B;  5C2D A;  3ITH A;  3T3F A;  3QNN A;  3UE5 A;  4CK3 A;  2IOC A;  4BRQ A;  4H0Y B;  5BRE A;  5MLC Q;  2H3G X;  4MDB A;  4PL7 A;  5CZ2 A;  5HBM A;  3J81 O;  3OYK A;  1NKC A;  4UQG A;  4LH4 A;  4YFU A;  4XH5 A;  1X9S A;  3L4Q A;  1VSK A;  3VPZ A;  5KQD A;  4CHQ A;  4DV5 K;  4LFB K;  2NRW A;  4KTW A;  3VA0 A;  1JLG A;  5I42 A;  4CGF A;  3OVN A;  4DSJ A;  2KZM A;  4JEP A;  4M45 A;  4B3M K;  4FSV A;  3MAQ A;  4FLV A;  4DLG A;  4CD1 A;  4CZG A; 
#chains in the Genus database with same CATH homology
 3SQ1 A;  4H4O A;  4CGH A;  4BAC A;  1R0A A;  1ZBH A;  1B92 A;  3S3O A;  3TAE A;  2HND A;  4AHT A;  2ATQ A;  1FXX A;  3IRX A;  1RTI A;  4DS4 A;  3E01 A;  1JLE A;  1RBV A;  1W9H A;  3AO1 A;  3I0S A;  4NCB A;  3OYL A;  4E0D A;  2XHB A;  5SZT A;  4F2S A;  2ETJ A;  4F4K A;  3AVG A;  2RN2 A;  3AV9 A;  4CJW A;  1TKZ A;  3LPU A;  4CIG A;  3K5O A;  1NJY A;  3O3H A;  3L8B A;  1D9F A;  1NJZ A;  3ZT4 A;  2OPQ A;  3HL8 A;  4KRE A;  1FKP A;  4MFB A;  4FJ9 A;  3VQ6 A;  4CK1 A;  4E7K A;  3BDP A;  2HHT A;  1I3A A;  2I5J A;  3HT3 A;  4PUO A;  4CHN A;  3SJJ A;  3SUQ A;  4N41 A;  2BGG A;  1BIU A;  1QTM A;  4W5N A;  2FBV A;  4N76 A;  4CGI A;  4NCA A;  3VQ7 A;  3NDK A;  3TAP A;  1BL3 A;  1REV A;  4FW2 A;  4ZHR A;  4BWJ A;  3VQE A;  4CJQ A;  4DTR A;  2G8W A;  4AHU A;  1LWF A;  4F8R A;  1RDD A;  4KTQ A;  1J54 A;  5CYQ A;  4Z0U A;  4DQR A;  2XO7 A;  1QSL A;  1T03 A;  1HQU A;  2OZS A;  3V1O A;  1L3V A;  1RT5 A;  2FBY A;  3SI6 A;  5DK5 A;  3ULD A;  4EZ6 A;  3RMC A;  3KK3 A;  4DF4 A;  2GUI A;  2IGI A;  1S9E A;  3KLH A;  3P83 D;  3V9U A;  2XY5 A;  4O55 A;  1G15 A;  1YT3 A;  4M3Z A;  4RW6 A;  3V81 A;  4J2A A;  4KPY A;  4Z4G A;  1DTT A;  3OYH A;  1TGO A;  1RDA A;  2HHX A;  1SL0 A;  5KI6 A;  1LW2 A;  1B9F A;  2YKN A;  2ITG A;  4GVM A;  1X9W A;  3C94 A;  4J2E A;  3DM2 A;  3V9Z A;  1U4B A;  3HP6 A;  4DQI A;  3CM5 A;  3TAQ A;  3KLI A;  3MEC A;  1GOB A;  4CFA A;  2XY8 A;  4CCH A;  4C8M A;  2FC0 A;  1MU2 A;  5SWM A;  3OJS A;  4KHQ A;  4Q0B A;  3O4N A;  4W5O A;  1HJR A;  1EP4 A;  1Q8I A;  4FJ7 A;  3LPT A;  1ZBU A;  1RT3 A;  4LSN A;  3WNH A;  4CJK A;  4E7L A;  3PO5 A;  2YNI A;  4DLE A;  1N5Y A;  1I39 A;  2EX3 A;  3JSM A;  3AA3 A;  1VRT A;  4FM1 A;  1Q9X A;  4DU4 A;  3SPY A;  1Q9Y A;  3ZSX A;  4B9S A;  2PZS A;  4DFJ A;  3NGY A;  1C1A A;  4ID1 A;  2YHB A;  3ZT2 A;  1N6Q A;  1RTJ A;  4CF0 A;  5KRS A;  3HPO A;  3LDS A;  3L3V A;  4M3Y A;  5FRN A;  1ASV A;  4CFD A;  1T8E A;  4QOZ B;  3RMA A;  3OYE A;  3DOL A;  3DLK A;  2R7Y A;  4DQS A;  3TAB A;  1RDB A;  3ZT1 A;  4N5S A;  2IDO A;  4KHS A;  3KD5 E;  3AVL A;  3OYA A;  1RBT A;  5HRS A;  2B4J A;  3DLB A;  2A1S A;  1NK8 A;  1HYS A;  4B3O A;  4LSL A;  4CHP A;  1HPZ A;  1KCF A;  1RDC A;  4FZY A;  2IC3 A;  1VSL A;  1TL3 A;  5JS2 A;  2F8T A;  4AIL C;  1S1W A;  1S1T A;  4OKJ A;  4O0I A;  3IAY A;  1WSF A;  3QEP A;  3CFP A;  2LSN A;  5DMR A;  3K59 A;  4Q5V A;  1SKW A;  3S9H A;  5J1E A;  4W5R A;  4IBN A;  4DFM A;  3QNO A;  4FJI A;  4J2B A;  1EET A;  3C6T A;  1VSF A;  4ID5 A;  4DU3 A;  1NKB A;  4R5P A;  2B6A A;  2JGU A;  4K8Z A;  4C8L A;  4CEB A;  3SUN A;  4NCG A;  1NJW A;  1TL1 A;  3AVI A;  3PUF A;  4OGC A;  4FJX A;  3A2F A;  4DF8 A;  3D45 A;  3OYD A;  3CFR A;  3TI0 A;  4N56 A;  1IO2 A;  4EP5 A;  3K58 A;  2VWJ A;  4H8K A;  3DLG A;  3SQ0 A;  4M3W A;  4FZZ A;  2FBX A;  1U45 A;  3VQQ A;  2OPP A;  3RRG A;  1Z26 A;  4RW7 A;  4Y1C A;  4E19 A;  3VQ8 A;  1RBU A;  3QO9 A;  3NF7 A;  4AHV A;  1S6P A;  1S9G A;  3LAL A;  3MED A;  4CJT A;  5KRT A;  3ZSR A;  3KK2 A;  1L3S A;  4OLB A;  4DSL A;  3NAE A;  3PX4 A;  3L2W A;  1F21 A;  3LP3 A;  3QIN A;  3AA5 X;  4B08 A;  3S3M A;  1JKH A;  2YV0 X;  1TKX A;  2Z1H A;  3DMJ A;  3ZSZ A;  4B9U A;  4IKF A;  2ZE2 A;  4E1M A;  3DLH A;  4C8N A;  1UA0 A;  5I3U A;  1U04 A;  2HVH A;  3T19 A;  3OYI A;  3EY1 A;  2ZQB A;  3F9K A;  3THV A;  4M41 A;  3TR8 A;  4F3T A;  2RF2 A;  5HRO A;  1KTQ A;  3LP0 A;  3SYZ A;  1HNV A;  4CHZ A;  3SQ4 A;  4DQP A;  3SV3 A;  4RW4 A;  4FZX C;  2E6L A;  3ASM A;  1NK0 A;  2X74 A;  4CF1 A;  1TV6 A;  4FJK A;  3SCX A;  4FJL A;  1ITG A;  3V1Q A;  1L5U A;  1GOA A;  3JYT A;  1ZBL A;  2X6N A;  4PY5 A;  4Z4H A;  4K8X A;  3WNG A;  2VWK A;  1RIL A;  2E6M A;  2QK9 A;  1U47 A;  2O4G A;  3VQC A;  4EP4 A;  1VK0 A;  1VSH A;  1RBR A;  2HHW A;  1LW0 A;  2F96 A;  3KLG A;  1FKO A;  3AVA A;  1UOC A;  1HYV A;  3DLE A;  3O4Q A;  1D5A A;  4PWD A;  2OYQ A;  4LD0 A;  1XHX A;  4CK2 A;  3G10 A;  1WLJ A;  1UAX A;  1EXQ A;  5CYM A;  4PQU A;  4E7J A;  3HVR A;  2G8F A;  3TAF A;  4CHO A;  3SUO A;  4QAG A;  3LZI A;  4FM2 A;  2G8I A;  4QCL A;  1VSJ A;  1BCM A;  5HLF A;  2DFE A;  3VQD A;  3B6O A;  1WSG A;  4HHT A;  2P1J A;  4ICL A;  3TAM A;  4E1N A;  4FK4 A;  3QES A;  1S1V A;  4JS4 A;  1KRP A;  4KB1 A;  3QIP A;  3NBP A;  1ASU A;  4Y1D A;  4FM0 A;  4CF8 A;  4Z4F A;  1JXB A;  3AVF A;  2BAN A;  5KTQ A;  1JLB A;  3M8R A;  1XI1 A;  3AVH A;  4DTN A;  1NKE A;  1LAW A;  1LAV A;  3NH1 A;  5J2Q A;  3V6D A;  4CJU A;  1BQM A;  4JS5 A;  3MEG A;  1JL2 A;  3LAM A;  1TK5 A;  4FJG A;  3L2U A;  2HVI A;  1RT1 A;  3KIO A;  3LAN A;  2O4I A;  1DLO A;  1RT4 A;  4CJL A;  4KAZ A;  1IG9 A;  5J2N A;  1C0T A;  2X78 A;  4CEA A;  4AHS A;  1RTD A;  4L8R B;  4Z4E A;  4CEE A;  4FJJ A;  3I0R A;  2B5J A;  3VN5 A;  1T05 A;  1VRU A;  1NOY A;  4ELU A;  4FK0 A;  4CJ3 A;  2YHA A;  2KTQ A;  3OYB A;  2HNY A;  4O0J A;  4CED A;  2PYL A;  1JL1 A;  1S6Q A;  3OYM A;  3RTV A;  4DTS A;  3TWH A;  3L2Q A;  4H4M A;  3AA2 A;  3WNF A;  1VSM A;  3V1R A;  3ZT0 A;  1FK9 A;  3OYN A;  4FJN A;  2QXF A;  3P5J A;  3QER A;  4CF9 A;  4NYF A;  4AHR A;  4DTP A;  1VSE A;  2P51 A;  4KHN A;  1A5X A;  1TKT A;  3CYM A;  1KLM A;  1WAJ A;  3EYZ A;  5J2P A;  4JLH A;  4DWI A;  1BHL A;  2QKK A;  2D0B A;  5D3G A;  1TKD A;  1NK9 A;  1QHT A;  3TAN A;  4DTU A;  3LWM A;  5EU7 A;  3C6U A;  3PX6 A;  4TSX A;  4W5T A;  3SV4 A;  3V9W A;  4ZTF A;  1D9D A;  4B9V A;  4KHU A;  4KV8 A;  4CGG A;  3O3F A;  1TK8 A;  2KFZ A;  1IKW A;  3QET A;  4AH9 A;  2DY4 A;  4DG1 A;  2WOM A;  3QEW A;  2Z1J A;  3MXI A;  4DSF A;  1UWB A;  1X9M A;  3MEE A;  1C1B A;  4I9L A;  4LY7 A;  5E41 A;  3SUP A;  1UA1 A;  3LP1 A;  1U49 A;  4B9L A;  3HK2 A;  1KVA A;  1KLN A;  4N47 A;  3F73 A;  4JRP A;  1ASW A;  2HHV A;  4C8K A;  3NGI A;  1BIZ A;  1C0U A;  1NJX A;  2OPS A;  5CZ1 A;  1IKV A;  3QEX A;  4DFK A;  5HP1 A;  2YKM A;  3NF8 A;  3KJV A;  4FLT A;  3QEI A;  3HO1 A;  5FRO A;  1L3T A;  4B9N A;  2YNG A;  4E7I A;  1YTA A;  1GOC A;  1J5O A;  1TAU A;  1W0H A;  1RT7 A;  3DYA A;  4FLU A;  1J9A A;  1C6V A;  1SKR A;  1LV5 A;  4CGJ A;  2FBT A;  2P5G A;  4WE1 A;  1YVU A;  1WNS A;  3AO3 A;  3L2V A;  1A5W A;  4LH5 A;  3AVK A;  3ISN C;  4KFB A;  4FLZ A;  3IS9 A;  4I2Q A;  5T7B A;  3VQ4 A;  3OS2 A;  3HM9 A;  1O1W A;  1XWL A;  1QSS A;  5CY4 A;  1CLQ A;  2ZD1 A;  1QQC A;  4DSK A;  1RT2 A;  3KKR A;  3OYF A;  2YNF A;  4FVM A;  3U6F A;  4C8O A;  4OLA A;  3CM6 A;  3M8Q A;  2IS3 A;  3L2R A;  1KVC A;  3AVB A;  3M8S A;  2WON A;  1C0M A;  1LWC A;  2Z1I A;  3RRH A;  2GBZ A;  3PY8 A;  4PA1 A;  1RTH A;  1EKE A;  4IDK A;  1WAF A;  4FCY A;  3RMB A;  3NF9 A;  4BDY A;  3KKS A;  4GW6 A;  3HST B;  4DSE A;  2OA8 A;  3OJU A;  3M8P A;  4CES A;  1NK6 A;  1KSP A;  2DTU A;  2RPI A;  2Q3S A;  3U3Y A;  4ELT A;  4HUF A;  3V9S A;  1XHZ A;  3HXM A;  4CER A;  3EZ5 A;  1ZYQ A;  4FLX A;  4IG3 A;  5K14 A;  3SNN A;  3AVJ A;  4CEQ A;  3NHG A;  4FLY A;  3IG1 A;  4BE1 A;  2HHQ A;  3TAG A;  5C42 A;  3L3U A;  2D0A A;  3AVM A;  4CJV A;  3NGZ A;  1NK5 A;  2DFH A;  3VQ5 A;  3NE6 A;  3BGR A;  4FLW A;  4IFY A;  2HMI A;  1CZB A;  1J53 A;  1HRH A;  1BQN A;  2YNH A;  1BIS A;  1B9D A;  3MXJ A;  4CJF A;  4CHY A;  4HTU A;  4DTO A;  2AJQ A;  4CGD A;  3U3G A;  4IG0 A;  3OYJ A;  1YTU A;  1CZ9 A;  4CJ4 A;  4KHY A;  3CG7 A;  3ZCM A;  4I9Q A;  4JRQ A;  3DRP A;  4E3S A;  4M3X A;  1BGX T;  3VQ9 A;  1NK4 A;  4O5B A;  4KO0 A;  3C95 A;  4E89 A;  4CIF A;  2Y1I A;  2P5O A;  4O44 A;  3SQ2 A;  3WNE A;  5FRM A;  4CJP A;  4HVJ A;  1U48 A;  2G8K A;  2HNZ A;  4KI6 A;  3RMD A;  3H08 A;  1KFD A;  4BE2 A;  1C1C A;  5HRN A;  1IKX A;  5HRR A;  2Z1G A;  3OY9 A;  1VSI A;  3QLH A;  4RG8 A;  4CEZ A;  3HYF A;  2QKB A;  4Z4I A;  2DFF A;  3ZSV A;  4OPK A;  4DTM A;  1NOZ A;  4CEC A;  1KVB A;  5J2M A;  1NK7 A;  1TK0 A;  1HNI A;  1ZBF A;  4KB0 A;  3DRS A;  1S1U A;  1TVR A;  2HW3 A;  2BDP A;  1CXQ A;  4CJ5 A;  1T7P A;  3DLR A;  5FDL A;  4CJR A;  4ZTJ A;  4FYD A;  1WSE A;  2RKI A;  3MXM A;  1TAQ A;  3ALY A;  2JLE A;  4DS5 A;  3K57 A;  1WSI A;  1HQE A;  3AVN A;  1Z25 A;  1DTQ A;  1RBS A;  3CFO A;  3P1G A;  3RWU A;  3B6P A;  1HMV A;  3OS0 A;  3VA3 A;  5KGW A;  1S5J A;  1A5V A;  1Y97 A;  4I2P A;  3OS1 A;  3LWL A;  3K5N A;  4OPJ A;  1RT6 A;  1QS4 A;  1SUQ A;  2KW4 A;  1XC9 A;  4CJS A;  1KFS A;  4YNQ A;  4FJM A;  3SPZ A;  3HVT A;  1BI4 B;  4DMN A;  2OPR A;  3ZSQ A;  5KGX A;  3NCI A;  4DTJ A;  1SKS A;  3LAK A;  1CXU A;  3NF6 A;  1RCH A;  3KD1 E;  3NH2 A;  4CJE A;  1WSH A;  2VG5 A;  4MQ3 A;  5C24 A;  4CIE A;  2HB5 A;  1BI4 A;  1SL1 A;  1EX4 A;  5HRP A;  1RNH A;  2VG7 A;  4RW9 A;  1WN7 A;  3I8D A;  3KLF A;  4CEF A;  3VQP A;  5C25 A;  4F3O A;  1ZBI A;  3TAR A;  4BWM A;  3K2P A;  3O3G A;  1X1P A;  4XIU A;  3PX0 A;  3ZT3 A;  3KTQ A;  2G8H A;  1K6Y A;  3K5M A;  3QEV A;  2X6S A;  4AHC A;  2XY6 A;  4M3T A;  2NUB A;  2KZZ A;  2E4L A;  4DSI A;  4CE9 A;  3UIQ A;  4B8C A;  2VG6 A;  3FFI A;  1BCO A;  2GV9 A;  4KKO A;  3VQB A;  2G8U A;  2D0C A;  4CEO A;  3V9X A;  3PO4 A;  4M42 A;  4CF2 A;  3RR8 A;  3OYG A;  3DOK A;  4FW1 A;  4O4G A;  4CFC A;  3LZJ A;  4B8A B;  2F8S A;  1SL2 A;  2OZM A;  4CFB A;  4HCB A;  4FJH A;  4KTZ A;  3PV8 A;  3K5L A;  4OKE A;  1QE1 A;  4DQQ A;  3KK1 A;  4DFP A;  3S3N A;  3NFA A;  3OYC A;  1IH7 A;  4BDZ A;  1WSJ A;  2EHG A;  1L3U A;  3AVC A;  2BE2 A;  2XY7 A;  4NYN A;  4Z4C A;  1D8Y A;  4B9M A;  4KHW A;  3LP2 A;  4EZ9 A;  4OGE A;  1JLC A;  2XRI A;  3HPH A;  2D5R A;  3G0Z A;  4M3R A;  3VQA A;  3CQ8 A;  2A1R A;  1JLA A;  3NH0 A;  5JS1 A;  4OJR A;  2KFN A;  2PY5 A;  4B9T A;  3ITH A;  3T3F A;  3HJF A;  3QNN A;  1HYZ A;  4CK3 A;  2IOC A;  3ZSW A;  4FJ8 A;  4G1Q A;  3AO5 A;  2Y1J A;  4FK2 A;  4DU1 A;  4BDP A;  5CZ2 A;  5HBM A;  4FXD A;  1NKC A;  3OYK A;  1VSD A;  4UQG A;  4LH4 A;  4YFU A;  4GMJ B;  3KLE A;  1JLQ A;  3SZ2 A;  1X9S A;  4KRF A;  3T1A A;  3AA4 A;  4HUE A;  1JXE A;  1VSK A;  3HP9 A;  2W42 A;  4W5Q A;  4OKK A;  1SV5 A;  2G8V A;  3HPG A;  3ZSO A;  4M3U A;  3AO4 A;  4CHQ A;  1IKY A;  4BE0 A;  4J2D A;  4KTW A;  4I7F A;  3VA0 A;  4IFV A;  4RW8 A;  1JLG A;  4DTX A;  1JLF A;  1S1X A;  4HCC A;  4HUG A;  5I42 A;  4E7H A;  2PYJ A;  3QIO A;  4CGF A;  1QSY A;  3AO2 A;  2HHS A;  4FJ5 A;  3DI6 A;  3OVN A;  4DSJ A;  2KZM A;  2KQ2 A;  4M45 A;  3ZSY A;  3RR7 A;  4OVL A;  1LWE A;  2IAJ A;  3MAQ A;  4FLV A;  3V4I A;  4ELV A;  4KI4 A;  4DLG A;  2HHU A;  3D0P A;  4F2R A;  3DRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...