1WSEA

Co-crystal structure of e.coli rnase hi active site mutant (e48a*) with mn2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMALMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Identification of Single Mn(2+) Binding Sites Required for Activation of the Mutant Proteins of E.coli RNase HI at Glu48 and/or Asp134 by X-ray Crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 44
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wseA00
3DLRA 3HVTA 3VQ7A 3KD1E 4FLUA 1U4BA 1JL1A 4N41A 1KVAA 1SL1A 3DLEA 3P1GA 3OS0A 3DMJA 4CEFA 1JXBA 3SYZA 4Q0BA 2A1RA 1J53A 1X9MA 1BISA 3LAKA 3WNHA 4ID5A 3K5MA 2AJQA 1QSYA 4E7LA 4CF9A 4M41A 1VK0A 3SJJA 3KK1A 4HTUA 1HPZA 2Z1GA 4B9MA 4NYFA 1DLOA 3ZSYA 3K5NA 5EU7A 5E41A 3B6PA 3OYFA 1CXUA 3HVRA 3PY8A 1BQMA 1NJXA 4M3ZA 4IBNA 1WAFA 1RBVA 2IS3A 5FROA 4JRQA 1O1WA 1KFSA 3NF7A 3NH0A 3V4IA 4LH4A 1GOBA 1L5UA 4E3SA 3U3YA 3OYKA 3RMAA 5DK5A 3DLHA 1RBTA 3DLGA 5K14A 3VQAA 3QNOA 1B9FA 4C8NA 1W9HA 4DTSA 3RMCA 2HHVA 4HVJA 1C0MA 3D45A 2HVIA 3CYMA 1RILA 1ASWA 4CCHA 3LAMA 3AA4A 3OJUA 3SI6A 3U6FA 1WAJA 4CEAA 4CFAA 4I9LA 3V9WA 4J2DA 3LZIA 2P5OA 3ZT2A 1RT5A 4M45A 1TK8A 2JLEA 3NAEA 1NK8A 3HK2A 2D5RA 3KD5E 1IKWA 3LP2A 3NGIA 1X9WA 4DQSA 3IG1A 2RN2A 2O4GA 3M8QA 4RG8A 4FM2A 3SUOA 1KCFA 1VSLA 1RT7A 2O4IA 4CGJA 3WNEA 5HROA 3U3GA 4DTMA 2FBYA 4H4OA 1IG9A 4FM1A 4FJMA 4DTUA 1BIZA 3BGRA 3LP1A 4LSLA 1VSHA 4B9SA 2YV0X 3ZT4A 4CHPA 4BE2A 2ZD1A 1QS4A 5HRRA 3KLHA 3MEDA 3V9SA 4GW6A 2Z1HA 1XI1A 4E7IA 3ISNC 3DLBA 4RW6A 3NFAA 5KI6A 2G8KA 2Y1IA 1JLQA 2JGUA 4KO0A 3OYBA 4AHVA 3HPGA 1UA1A 1TL1A 4DSJA 4KI4A 3SQ2A 4DS5A 3PV8A 3V9XA 1L3UA 3QLHA 3OYCA 2FC0A 4OKJA 4ELVA 4M42A 1QHTA 4DTRA 2P1JA 2DFHA 4FW2A 3ZSQA 4DQQA 4O0JA 1BHLA 5CYQA 3OYDA 4O5BA 3SCXA 4FYDA 1QSLA 4DS4A 4IG0A 4CJRA 4DQIA 3ULDA 1SKWA 1BCOA 4BACA 2HMIA 4CEEA 1WN7A 2OA8A 5FRMA 3K58A 4FLYA 2EHGA 3L2RA 3O4QA 4HUEA 2E4LA 5CYMA 4N76A 4FZXC 2KZZA 2IGIA 3NH1A 4O0IA 3TAFA 2D0BA 3AVFA 3RTVA 1FK9A 1WSGA 4AHRA 3K5LA 4FLXA 4FJ5A 1IKXA 4AILC 4E0DA 4LY7A 4E19A 1ZBIA 3OY9A 2KZMA 3AVBA 4CK2A 4N56A 4BDYA 4PA1A 3ZSZA 3LDSA 1HQEA 3TR8A 4I7FA 4OPKA 4CHZA 3LWMA 3S3NA 1TK0A 2Y1JA 4CJTA 4HUGA 1SKSA 4OKEA 1LV5A 1VSDA 1LWEA 4CEOA 4N5SA 4RW9A 3ZSOA 1U04A 1TKTA 4WE1A 2OZMA 4DLGA 4CFCA 4GVMA 4I2PA 1U49A 1RNHA 2OPSA 1EKEA 3LP0A 1FKOA 1D9FA 4KV8A 1NJYA 3DRSA 2IDOA 4CJLA 5HRPA 3KKSA 3S9HA 3KKRA 4OLBA 2VWKA 1WSHA 4FW1A 3AVGA 1SL0A 2BE2A 3C6UA 4CIGA 3V1RA 4B08A 3JSMA 3NF6A 4E7KA 2HHUA 1A5VA 3CQ8A 3VQDA 1KTQA 4NYNA 1WSIA 1ITGA 5J2NA 1U45A 4FJHA 3CG7A 1WSJA 2WONA 1T8EA 1EP4A 1S1TA 4YNQA 4DU4A 1NKCA 1RT4A 4CF2A 3P5JA 3I0SA 2IOCA 3CM5A 4CIFA 4KHNA 3ZT3A 1KRPA 3PX6A 1YTUA 3VQ5A 1UOCA 3AVMA 3V81A 1Q9XA 2RKIA 3OYEA 3AO3A 1HQUA 2X78A 2VG5A 1T03A 1JLAA 3NBPA 4H8KA 3ZT0A 3RR8A 5I42A 2B4JA 3G10A 1BI4B 5JS2A 1CZBA 3ZSVA 4FJ7A 1GOCA 4FK0A 3DRPA 4RW7A 5C25A 1UWBA 3ALYA 4DFPA 1IO2A 3AV9A 1T05A 3CFPA 4DSKA 3PO5A 2ATQA 4DF8A 3OS2A 3L8BA 3ZT1A 3AO4A 3RMDA 3QIPA 3MXMA 4DSLA 3RRGA 4BE1A 2OZSA 3T1AA 1JLFA 1HYSA 4Z4HA 3QETA 1IKYA 5CZ1A 5FDLA 1NK4A 4HHTA 1NK6A 3OYHA 2GBZA 1EETA 2QK9A 1RDAA 4FJ9A 1GOAA 3G0ZA 1ZYQA 1I39A 3AA2A 4KKOA 5C24A 1REVA 4CJSA 1LAWA 1RTJA 5HP1A 4FJGA 4PWDA 1JXEA 2EX3A 3ASMA 3OS1A 4DLEA 1XWLA 3IRXA 4DSIA 3C6TA 1TV6A 4CFDA 1SKRA 3PX4A 3VQBA 4DTXA 3V9ZA 3MXJA 5DMRA 4G1QA 1Z26A 4Z4GA 4QOZB 3TAQA 3KTQA 2X6NA 1UA0A 3SV3A 1QQCA 4AHUA 3M8PA 4CJQA 4BDZA 3PX0A 4DG1A 1KLNA 4HCBA 2NUBA 1VSIA 3P83D 1RT3A 3DOKA 4EP4A 3HP6A 2XY7A 2YHAA 4KPYA 1N5YA 4HCCA 2YNGA 4FJXA 4QCLA 4NCGA 4CHOA 4DU1A 2QKBA 2R7YA 4DMNA 1VSKA 3AO2A 3OYGA 3VQEA 1S6PA 4KHSA 4CGFA 3HXMA 1XHXA 1YTAA 2DFEA 3O3FA 3QNNA 1KSPA 4FK4A 2HHSA 3S3MA 2E6MA 4OJRA 1TKXA 1RBRA 3SZ2A 4DFKA 4BDPA 4AH9A 2YNFA 3LANA 4Z4CA 4CHYA 3O3HA 4FLTA 4O55A 2BDPA 4PY5A 3VA3A 3CFRA 2XY6A 1BGXT 4IG3A 4QAGA 3OYLA 3NE6A 2HNDA 1ASVA 1JKHA 2HNZA 3DLKA 4EZ9A 3VQPA 4J2EA 1VSJA 1EX4A 1L3SA 4IDKA 4IKFA 4M3XA 4NCBA 4E1NA 1QTMA 4CGDA 5J2QA 1Z25A 1ASUA 3F9KA 4E7JA 5JS1A 1RBUA 4OKKA 4FCYA 4FLWA 4K8XA 4Z4IA 1KVBA 4M3RA 5HLFA 3WNGA 4W5OA 1DTTA 1NKBA 3VA0A 1LWCA 3TAEA 4C8LA 1RTDA 2HB5A 3HP9A 4IFVA 4Y1CA 4ZTJA 1T7PA 3KLIA 1NK0A 5J1EA 2FBTA 3KJVA 4CK3A 1XHZA 2DTUA 4OLAA 3HYFA 3SQ1A 2G8IA 1B9DA 1HRHA 4FK2A 4F2RA 4CJPA 5KGWA 3OVNA 4B8CA 2Z1IA 1S1XA 3L2QA 4JS5A 4B9UA 4YFUA 4FJNA 2PYLA 3FFIA 2D0AA 4E1MA 3ZSWA 4B9NA 3HL8A 1WSFA 5HRNA 5HRSA 5CZ2A 3LWLA 4CJ5A 4KRFA 1I3AA 3K2PA 4O4GA 4Y1DA 2G8FA 1LWFA 2HHXA 1JLGA 1XC9A 1KLMA 4IFYA 4MQ3A 3QEXA 1DTQA 3O4NA 4F4KA 3KLGA 3DRRA 3ZSRA 2F8TA 2KFZA 4CGGA 3IAYA 4FXDA 3NCIA 2LSNA 1VRUA 2GUIA 3VN5A 4DFMA 4FJLA 4CJFA 3QEWA 5T7BA 1RT1A 3LPUA 3HPOA 3SQ4A 4DQRA 1NK5A 2PYJA 1QSSA 2B5JA 3I8DA 4JRPA 1A5WA 3VQQA 4N47A 4C8MA 5KTQA 4ID1A 4DSEA 4CGIA 4ELTA 4W5NA 3IS9A 3AVHA 3NHGA 4FJKA 1TAQA 1C6VA 2OPRA 5KRSA 2E6LA 1RDDA 4AHTA 2VG6A 3D0PA 2RPIA 1LAVA 4MFBA 4FM0A 1NJWA 1VRTA 4LSNA 1IH7A 1X9SA 3OYAA 5J2PA 4DQPA 1NK7A 5FRNA 1RT2A 4HUFA 1J9AA 2OPPA 1J54A 2KQ2A 2PY5A 4PUOA 1RTHA 4JLHA 3SUQA 5D3GA 2P51A 2YKNA 2ETJA 3L2WA 3K59A 3AVJA 4JS4A 4Z0UA 3VQ9A 3VQ4A 1S5JA 3NGZA 3AA3A 4GMJB 2A1SA 4CHNA 2W42A 3K57A 4CJWA 3RMBA 4ZHRA 4F3TA 4Z4EA 1D5AA 1Y97A 3L3UA 4CE9A 3KK3A 4L8RB 3AA5X 4E89A 2IC3A 2X74A 2QKKA 1QE1A 4Z4FA 4F3OA 4F8RA 2Q3SA 1BQNA 1J5OA 4B9VA 1NOZA 5SZTA 3AVKA 1KFDA 4DU3A 1F21A 3EYZA 3QERA 1NJZA 1N6QA 3VQ6A 1HYVA 3HO1A 2ITGA 3QEPA 1L3VA 2HW3A 3SUNA 1BL3A 1A5XA 4CEBA 1G15A 3HSTB 1Q9YA 2HHTA 3V9UA 1ZBLA 1JLEA 2XHBA 4M3YA 4CJVA 3HT3A 3T19A 1BCMA 3BDPA 2D0CA 1CZ9A 4KTZA 5C42A 3TWHA 4KHUA 1RT6A 4OGCA 2OPQA 3LALA 4CJEA 3V6DA 1TKZA 4Q5VA 3OYJA 3MEEA 2DY4A 4KAZA 4DTOA 1R0AA 3L2VA 4W5RA 1IKVA 3OYIA 1L3TA 5KGXA 3QINA 3QEVA 3SPYA 4OPJA 3LZJA 3KIOA 1X1PA 2P5GA 4KREA 1B92A 1ZBHA 3C95A 3NDKA 3VQ8A 3T3FA 2VG7A 3B6OA 3HPHA 4FVMA 4CHQA 1TK5A 4K8ZA 3HJFA 4M3UA 3QESA 1Q8IA 2GV9A 4KB0A 1C1BA 4FJ8A 3I0RA 3SPZA 3TAPA 3MEGA 3KLEA 1VSFA 3ZSXA 3TARA 3ITHA 4FJJA 4R5PA 4DTJA 3TANA 1HNVA 2KW4A 2YKMA 1VSMA 2G8UA 4BE0A 1NK9A 3NGYA 3TAGA 1NKEA 3DM2A 1S1VA 3LP3A 1K6YA 4KTQA 2X6SA 4M3WA 2KFNA 3NF8A 4TSXA 3TAMA 1JLBA 3VQCA 4CJUA 3MECA 3QIOA 3KK2A 3K5OA 4KTWA 1WLJA 4CESA 3SUPA 1YVUA 3ZCMA 2YNIA 1MU2A 3AVIA 3M8SA 2KTQA 1LW0A 4O44A 3DYAA 4RW8A 1BIUA 4CF1A 2Z1JA 4CERA 2OYQA 4PQUA 2HHQA 3M8RA 4FLZA 4E7HA 5I3UA 1SL2A 2HVHA 4KHQA 4ICLA 4B3OA 4DWIA 4NCAA 4CJ3A 3CFOA 2F8SA 1HNIA 4OGEA 3WNFA 3V1QA 4CF8A 4DTPA 4F2SA 3OYNA 4UQGA 4CJKA 3QEIA 5HBMA 4DFJA 2HHWA 5KRTA 5CY4A 1RBSA 2ZQBA 1S1UA 3AO5A 4KFBA 4CK1A 4KB1A 4J2BA 1HJRA 1S9EA 4I2QA 3SNNA 4KI6A 1U47A 1HMVA 1SUQA 3TI0A 4CF0A 4CEDA 1C1CA 3MXIA 3RRHA 3E01A 1D8YA 2FBXA 3RR7A 4CEQA 3RWUA 1EXQA 3HM9A 4ELUA 3H08A 3MAQA 3S3OA 1FXXA 1JL2A 1RCHA 1D9DA 2XO7A 2XY8A 1S6QA 3LPTA 1WSEA 3PO4A 2FBVA 1SV5A 3O3GA 2I5JA 3EZ5A 1S1WA 4OVLA 1ZBFA 2IAJA 4BWMA 3AVCA 4CJ4A 3AVNA 3OYMA 4FJIA 4BWJA 3TABA 4EP5A 3DI6A 1TGOA 3NF9A 1CLQA 1C1AA 2HNYA 1JLCA 4LH5A 4CGHA 4H4MA 2BANA 1C0TA 2WOMA 4KHYA 1U48A 2RF2A 4ZTFA 2YNHA 1TL3A 3CM6A 4KHWA 1HYZA 3KLFA 1WNSA 3C94A 3AO1A 1VSEA 2YHBA 2XY5A 2QXFA 3THVA 4C8OA 3SV4A 1NOYA 1BI4A 5J2MA 4FZYA 4CEZA 4FZZA 1TAUA 1LW2A 4DF4A 2G8HA 3QO9A 3V1OA 3JYTA 4C8KA 1KVCA 1TVRA 4I9QA 4W5QA 4DTNA 2F96A 4B8AB 2PZSA 2DFFA 3NH2A 3F73A 1W0HA 3PUFA 1RTIA 3EY1A 3DOLA 3L3VA 4EZ6A 4AHCA 4CIEA 1TKDA 1RDBA 1YT3A 1ZBUA 4LD0A 1C0UA 4W5TA 2G8WA 3L2UA 1CXQA 3UIQA 2B6AA 4DSFA 4B9LA 3SQ0A 4AHSA 2VWJA 1S9GA 5SWMA 4M3TA 2G8VA 4RW4A 2XRIA 4CECA 1UAXA 1RDCA 2ZE2A 3OJSA 4B9TA 4FLVA 4CFBA 3AVAA 4XIUA 4J2AA 2BGGA 3A2FA 1FKPA 3AVLA
chains in the Genus database with same CATH superfamily
3BP8A 3U9DA 3KD1E 4LFCK 4JYAK 3C6HA 1JXBA 4DV6K 2A1RA 3CIPA 5LL6Z 3SJHA 2P9KB 4BRCA 1DLOA 3ZSYA 3K5NA 3E1YA 4BC3A 3B6PA 3PY8A 1CXUA 5AFUH 1NJXA 1DKGD 2IS3A 1I94K 1O1WA 4FWMA 1NU0A 3U3YA 2P9SA 2F9TA 3DLGA 3VQAA 3H45C 1B9FA 4DTSA 1ZC6A 3D45A 4WQ5A 3CYMA 3CCEN 3TSPA 3AA4A 1V4SA 1WAJA 3V9WA 5C2FA 3LZIA 3ZT2A 1VQLN 3E9LA 4YOXA 2D5RA 4DQSA 1YF5L 3ZX2A 4RG8A 3FR0A 1VSLA 1BO5O 3CCVN 5HROA 4FOIA 4FM1A 3BGRA 3LP1A 4JKHA 3ENHA 3EE9A 1VSHA 4B9SA 2HBKA 3VGMA 1S3XA 3KLHA 1QS4A 3V9SA 3I33A 4GW6A 3DLBA 5KI6A 1WB9A 1JLQA 3M3ZA 4AHVA 1TL1A 2W40A 4KI4A 3VEOA 5TKWA 4A61A 4IWVA 4X65K 3QLHA 2P1JA 1BHLA 3OYDA 4O5BA 4FYDA 4DS4A 4CJRA 1BCOA 2Q2RA 1K73O 4O8UA 1X9JA 5FRMA 1IJJA 2EHGA 4RTFD 5CYMA 4DR4K 3N4PA 4JKBA 1NGHA 4A57A 3CJ1A 3FFKB 3O1WA 4O0IA 5TKYA 3RTVA 1ESVA 4FLXA 1ZBIA 4AILC 4E0DA 3AVBA 1GLFO 3F9MA 1HQEA 4CHZA 3SAGA 4HUGA 1LV5A 3P4IA 1VQMN 1U04A 1TKTA 5AQSA 4WCEL 4I2PA 2O8EA 2OPSA 1EKEA 3CJ7A 4CJLA 3KKSA 2VWKA 4FW1A 3V1RA 2HHUA 4C23A 3SAFA 3CQ8A 4FJHA 1U45A 1ITGA 2WONA 4DU4A 1NKCA 4CF2A 3P5JA 3I0SA 4KHNA 1YTUA 4WFBL 4H0XB 4YORA 4H8KA 2E2OA 5I42A 5JS2A 4FK0A 1GOCA 4RW7A 3VOVA 4DF8A 3OS2A 3L8BA 1GLBG 3QIPA 3RRGA 3QMLA 4BREA 1JLFA 4Z4HA 1IKYA 5CZ1A 5GINA 4HHTA 3AY9A 1EETA 4FJ9A 4FWPA 4UY8O 1I39A 2D1KA 1LAWA 4YDUA 5BR8K 2GWJA 3D2EB 3G71N 4DSIA 5C2DA 1TUUA 2A40A 3V9ZA 1KQSM 1Z26A 2NRXA 3SV3A 3PSIA 3PX0A 4CJ7A 4LF8K 1VSIA 4EP4A 3W3DA 4FWKA 2IVNA 4DU1A 2QKBA 3AO2A 3M5RA 3VQEA 1S6PA 4CGFA 1XHXA 1YTAA 4DFKA 2BH1A 4BDPA 4AH9A 2YNFA 3O3HA 3I55N 3J80O 4PY5A 3OBYA 3CFRA 1BGXT 4IG3A 4QAGA 2HNZA 1ASVA 3DLKA 5AQVA 5M1KA 1T3VA 3THXA 3H3NO 3SMSA 1Z6RA 1RBUA 3CHWA 4K8XA 1KVBA 4M3RA 5HLFA 3WNGA 1NGFA 4OPAA 5AQGA 3JAMO 3J81O 3TAEA 1M1KO 1T7PA 1NK0A 2QWNA 3KJVA 4CK3A 1XHZA 3SBTA 1W97L 3SQ1A 4RWTA 3CC7N 1S1XA 2A5XA 2QWMA 3ZETB 4YFUA 4U67L 1YJWN 4BR5A 4FWQA 5HRSA 1E4FT 4WQ4C 4KRFA 1I3AA 3O8MA 4LFBK 4KHPK 1XC9A 3QEXA 5AQKA 1DTQA 3HSCA 3VEZA 1VRUA 2GUIA 2GEMA 1LOTB 1SQKA 3CETA 3CXCM 1RT1A 3LPUA 5MLCQ 5BRDA 2B5JA 4C8MA 4CGIA 3DXMB 1TAQA 4DKWA 5KRSA 4X62K 2E6LA 3ULEA 2VWBA 3D0PA 5AJ3K 2RPIA 3ID8A 4MFBA 1NJWA 1VRTA 3OYAA 4DQPA 1NK7A 4HUFA 5HL7L 1J9AA 1J54A 2NRTA 4K25A 2ETJA 2YJFA 3K9KA 4Z0UA 3VQ4A 5AQWA 3K57A 4F3TA 4E89A 3CCJN 2X74A 3MN5A 3D2FB 4F3OA 4JKDA 4F8RA 2O8EB 1KFDA 3EYZA 2O8BA 4B3MK 3VQ6A 3QEPA 4CZIA 4CEBA 4CZKA 3HSTB 1Q9YA 1QQMA 2HHTA 3BDPA 4DV2K 4KTZA 5C12A 3R3LA 3MWTA 4KHUA 2OPQA 1VQ9N 4JK7A 1KAXA 4KAZA 1R0AA 3L2VA 3OYIA 2QTDA 5KGXA 4J8FA 4OPJA 1X1PA 4BROA 2YCHA 2VG7A 4KH5A 4CHQA 1YVNA 4JI2K 4KB0A 3TAPA 3CC2N 4CBUA 2Q0UA 1E4GT 2A41A 4R5PA 2KW4A 2QXLA 1VSMA 2YKMA 1S1VA 2QWLA 5AQPA 3VTIA 1K6YA 4M3WA 2KLAA 3EKSA 1GLEG 2ASPA 5KPZA 2KFNA 3TAMA 2QW9A 4LF4K 5AQRA 3M8SA 1BG3A 3FE1A 4O44A 4YOUA 5CE3A 3O80A 2Q31A 3THWA 4CF1A 2Z1JA 4CERA 5BREA 3BZKA 3M8RA 2HVHA 4A5BA 5GADP 1M90O 4KHQA 4DR5K 4A5AA 5BN8A 3CFOA 2F8SA 4DV3K 3WNFA 3V1QA 4CF8A 4F2SA 3OYNA 4UQGA 4CJKA 1RBSA 1S1UA 4KB1A 3S41A 4BRKA 1R59O 2NNWA 1SUQA 4JEPA 3M1FA 4YY3K 3TI0A 3MXIA 3E01A 4NXNK 2V7YA 3HM9A 4ELUA 3MAQA 3WXJA 1JL2A 1RCHA 2XY8A 3PO4A 2WTUA 2FBVA 1RDWX 3NVKA 3O3GA 1KXPA 3QB0A 2P9NA 4H5VA 1ZBFA 3OYMA 1BOTO 3TABA 4EP5A 3R1XA 4IO9L 3NF9A 2O8DA 5EXWA 4CGHA 1LCUA 1U2VA 4KH4A 1U48A 4ZTFA 2YNHA 4BRGA 4KHWA 3KLFA 3UKUA 5AFUA 2QEXN 4FZYA 3THVA 1NMDA 3CJBA 1TAUA 1LW2A 3C65A 3QO9A 5FPMA 4C8KA 1KVCA 3T1HK 3J7AP 4I9QA 4W5QA 3A5OC 3NH2A 2OANA 3DXKB 3F73A 3L3VA 3AARA 3PSFA 1TKDA 4H5TA 3TU5A 3UIQA 4AHSA 1S9GA 3MN6A 1NNEA 1OVQA 3KD5E 1UAXA 2BGGA 4B9TA 4J2AA 3OW2M 1FKPA 1ILYA 1NGJA 2E8AA 2HBMA 3ZLJA 3IFRA 3P1GA 2ZJPL 3DMJA 4CI6A 3CC4N 3SYZA 1J53A 1BISA 4ID5A 3MK6A 3WXIA 3MWPA 4M41A 2ZGZA 3SJJA 2O8FB 3KK1A 4HTUA 2Z1GA 4B9MA 4NYFA 1RDUA 4QS9A 4PKGA 5E41A 3OYFA 3HVRA 2O8BB 1HR0K 4IBNA 1RBVA 5ADXA 4B1WB 4JRQA 1KFSA 1WUAA 3NH0A 2IVPA 3V4IA 4LH4A 3OYKA 5DM7L 5AQOA 5K14A 3RMCA 3ZX3A 3THYB 1W9HA 4GKKK 2HHVA 4HVJA 1C0MA 3R8EA 4H03B 4A62A 3ATUA 1ASWA 4CCHA 4JI7K 3LAMA 3OBWA 5DM6L 3U6FA 4NXMK 4CFAA 4WFAL 2P5OA 4M45A 3NGIA 3LP2A 3CD6N 4FM2A 1FW6A 2O4IA 4ISGA 4CGJA 3L4QA 3U3GA 4DTMA 2FLOA 1IG9A 4DTUA 1ZXOA 3ZT4A 4BE2A 3FGUA 3ENOA 4A59A 4MDAA 3NFAA 2Y1IA 2Q36A 1G99A 4KO0A 3OYBA 1UA1A 5KQDA 4DSJA 3SQ2A 3VEVA 4DS5A 3UB5A 3T69A 3PIOL 1L3UA 4ELVA 2FC0A 4V19S 2V7ZA 1QHTA 3THWB 2E88A 4FW2A 2NZTA 4O0JA 3SCXA 4IG0A 4DQIA 3ULDA 3IUCA 4BACA 4B1XB 1WN7A 1QQNA 4MLHA 3CMEN 3O9UA 4AQYK 2D0BA 2FSKA 3AVFA 3K5LA 3CPEA 4BDYA 4MO5A 1NM1A 4DV4K 3LDSA 3S3NA 4JI4K 1GLAG 1EWRA 4OKEA 2WFBA 1MDUB 4CEOA 4PL8A 4N5SA 3HZ6A 4RW9A 4XH5A 3ZSOA 4DLGA 4GVMA 1U49A 1JJ2M 3LP0A 1D9FA 2JWLA 5HRPA 3KKRA 4DV7K 4B08A 3JSMA 3NF6A 4E7KA 3O5BA 2OTJN 4NYNA 2E2QA 3CG7A 1WSJA 1T8EA 4IOCL 1RT4A 2KKZA 1U2VB 1KRPA 3FZMA 3PX6A 3VQ5A 3HOTA 5FLXO 3KHYA 3OYEA 2FXUA 3AO3A 2CH6A 3RR8A 2B4JA 4YDUC 2ZJQL 4BQZA 4B9QA 3DRPA 4BC5A 3RMDA 1RGIA 5KQ8A 4DSLA 2OZSA 3MDQA 3QETA 3E9OA 5FDLA 1NK6A 3OYHA 2GBZA 3DAWA 1GOAA 2P9PA 3G0ZA 1ZYQA 5C24A 1REVA 4CJSA 5HP1A 4FJGA 3ASMA 3OS1A 4DLEA 3IRXA 3C6TA 5B8HA 4CZEA 2WUSA 3PX4A 4GV9A 3SBGA 3QICA 4Z4GA 3TAQA 3WXKA 3TTDA 4AHUA 2Q1NA 3KWGA 3P83D 3LDQA 2FF3B 2YHAA 4KPYA 1YIJN 4JHDA 1Q7YO 1KAZA 5H1SQ 4KHSA 1VQ5N 1K8KB 3QNNA 2HHSA 3S3MA 4OJRA 3CCSN 1RBRA 1BWFO 4JK8A 3EL2A 5AQLA 3WEEB 3O9RA 3OYLA 3NE6A 2VQFK 3VQPA 1VSJA 1L3SA 1HKCA 4IDKA 4IKFA 4E1NA 5J2QA 4FCYA 1BA0A 4FLWA 4Z4IA 4W5OA 2DPNA 1YJNN 1NKBA 3VA0A 5ADXH 4C8LA 2HB5A 4IFVA 2D0OA 4FOEA 2G8IA 1HRHA 3H1QA 4WFNL 3KWIA 5KGWA 4B8CA 3L6QA 5AQXA 1U6ZA 3K0SA 2FF6A 4E1MA 3ZSWA 2PAVA 3A5MC 3EEQA 1EO1A 2IIRA 4LF7K 3CQXA 4CJ5A 4DR6K 4GV6A 3ZEUB 4EHTA 2G8FA 4BRLA 1KLMA 5LMNK 4F4KA 3O1BA 3DRRA 2F9WA 3CERA 2YHYA 4ILHA 4FXDA 3NCIA 2LSNA 3VN5A 3QEWA 4DQ8A 4FPAA 3WXLA 3HPOA 4DQRA 3SQ4A 2P9IB 4JRPA 4CZLA 4N47A 5AZIA 3NHGA 2ZJRL 1HJOA 4CD3A 2V51B 5AZJB 1NMNA 1KC8O 1RDDA 3SAHA 4IOAL 1YAGA 1LAVA 4FM0A 4OO1J 1X9SA 2P9LB 5EY4A 1YXQA 1RT2A 3ZX0A 1RTHA 2P51A 3ENBA 3K59A 3CCLN 1S5JA 3AA3A 1YJ9N 4CJWA 4Z4EA 1D5AA 3KK3A 1MA9B 2W6LA 2IC3A 4MO4A 5E84A 4X64K 1T6CA 3JS6A 4B9VA 5SZTA 4IZ9A 1TYQA 3N4QA 4DU3A 2E2PA 3QERA 1NJZA 4GV3A 2W6KA 2HW3A 1SAZA 4BRIA 2HBLA 2O8CB 3V9UA 1ZBLA 1JLEA 2XHBA 3VGKA 2D0CA 2CGLA 3LALA 5AR0A 4CJEA 1WBDA 3V6DA 1TKZA 2QWPA 4PHTX 4BQLA 4W5RA 1L3TA 4ILGB 3ATVA 4KREA 3KIOA 5M1QA 1B92A 3NDKA 5BRFA 3LDLA 3VQ8A 4FVMA 3NMUA 4M3UA 4EFHA 3C7NA 4GNIA 3TARA 3ZSXA 1HNVA 1OH7A 2G8UA 1NK9A 3NGYA 2WC9A 2IVOA 2X6SA 1YITN 1W7AA 4JKEA 2YX6A 4TSXA 1JLBA 3VQCA 4CJUA 2P9SB 4JI1K 4BG8A 4IFEA 4CESA 3SUPA 1YVUA 3ZCMA 2YNIA 1MU2A 4K0KK 2KTQA 4ILJA 3CJCA 4PQUA 4JHDB 1T6DA 5I3UA 2E1YA 4E7HA 2ZM6K 4BRQA 4B3OA 1GLLO 4DWIA 3TSQA 4OGEA 4YOWA 4DTPA 3BF3A 3I56N 4A2BA 1QZ6A 4NLBA 3QEIA 5HBMA 2HHWA 3AO5A 4KI6A 1U47A 1NGDA 4CEDA 4CEQA 3NVMA 2XO7A 1WSEA 1IBKK 1HUXA 4H0TB 2I5JA 3EZ5A 4H0YB 3LL3A 3QBWA 3AVCA 3PLAA 1FJGK 5A2QO 2HNYA 1JLCA 1OH5A 1C0TA 2WOMA 4XH4A 5BR9A 3DWLA 3KK7A 2HF4A 1HYZA 1IG8A 1NGEA 2QXFA 4C8OA 4IOXA 2EWSA 1NLVA 4JD2A 4DF4A 3D7EO 3V1OA 2HBJA 4JI5K 1IV0A 4B8AB 2PZSA 4PL7A 4BRAA 5GAHP 1WBBA 3U8XA 3PUFA 3EY1A 4BR0A 3DOLA 1ZBUA 1C0UA 2G8WA 3GL1A 3AAQA 4B9LA 3SQ0A 2VWJA 5SWMA 3CCRN 3VTHA 4DV0K 3AVLA 3DLRA 3HVTA 4FLUA 1KVAA 4JKGA 4JK9A 2E1ZA 3DLEA 3OS0A 4CEFA 4Q0BA 1X9MA 3WNHA 3LAKA 2AJQA 3CPWM 1Q18A 1QSYA 4E7LA 1XC3A 4JI0K 5EU7A 4M3ZA 1TYQB 1W2BM 1BQMA 3JXUA 5FROA 3BF1A 1JCGA 3TTCA 1GOBA 1L5UA 5AQQA 4JI8K 3CMAN 4JKFA 3RMAA 5DK5A 3R9PA 2E5LK 5CR4A 3OJUA 3FZLA 3VEYA 4I9LA 4BRMA 1RT5A 2JLEA 1NK8A 3QBXA 3LDPA 1MWKA 3IG1A 2O4GA 4M7YA 1KCFA 5FPEA 5FPDA 2FBYA 4FJMA 1BIZA 4LSLA 2BTFA 4BR9A 2YV0X 4CHPA 4EHUA 4LF9K 3MEDA 4IXCA 3VENA 3F2KA 3ISNC 1O13A 3CJ9A 5M1FA 3THXB 1VQ7N 1HNZK 3UE5A 4FL9A 5EX5A 5JVHL 3V9XA 3RSEA 4BR4A 4RCHA 3WQTA 5BPLA 4DTRA 5LMUK 4DQQA 2DFHA 3HRGA 4U7BA 4NLCA 1SKWA 1NGGA 4BVOA 2HMIA 4CEEA 4EAHD 2OA8A 2OTLN 3K58A 4FLYA 3VF2A 4HUEA 2E4LA 4B3RK 3ID6A 4DV1K 4N76A 4FZXC 4L3QA 2IGIA 1XQSC 3TAFA 3IKMA 5JLFA 4CZFA 1XMOK 1FK9A 4M63C 5M1OA 4AHRA 4LY7A 3OY9A 4N56A 2ZF5O 3ZSZA 5E26A 3TR8A 3LWMA 1TK0A 4C1NI 1BU6O 4WQ4A 4CJTA 2Y1JA 1VSDA 1XUPO 3QFUA 4WE1A 2OZMA 4CFCA 2HSTA 3EO3A 2F7TA 1VHXA 1FKOA 4KV8A 3DRSA 2IDOA 2QWQA 3S9HA 1WSHA 3AVGA 5J2NA 1KTQA 2UU9K 5AQHA 4GKJK 3ULEB 1S1TA 4LC9B 4XH1A 4CIFA 2IOCA 1E3MA 3ZT3A 1UOCA 4JNEA 3TTFA 2HMPA 2RKIA 3H3OB 1HQUA 1J6ZA 4FSVA 5KPRA 1JLAA 3NBPA 3ZT0A 2KHOA 4Y0WA 5AQFA 4FJ7A 5C25A 1UWBA 3SMPA 2ITMA 1IO2A 3AV9A 1T05A 2P9KA 3PO5A 4BVPA 3ZT1A 3AO4A 3MXMA 1T44A 2GX9A 1IBLK 3T1AA 3SLCA 1HYSA 3BZCA 1WOQA 2QK9A 1RDAA 4WQ5C 1RTJA 4PWDA 4BC2A 2EX3A 5LY3A 1N32K 4CFDA 2YI1A 1NGBA 3HBTA 4DTXA 2HF3A 2RE2A 3MXJA 4HTLA 4G1QA 1YHQN 3E9PA 3WUHA 2X6NA 1UA0A 1QQCA 3M8PA 4BDZA 1KLNA 1QZ5A 4DG1A 4HCBA 4JKGB 1RT3A 1IBMK 3HP6A 4BC4A 1N5YA 4FJXA 4QCLA 2ASOA 5LJVA 1JCFA 4K41A 3P38A 2R7YA 3OYGA 4CZGA 3VESA 1GLCG 3HXMA 4FK4A 5BN9A 3O3FA 2E6MA 3SZ2A 4R79A 3GG4A 4FLTA 3T7ZA 3MCPA 3VA3A 2XY6A 4FWLA 2HNDA 1JKHA 4H0PA 1EX4A 2YHXA 1ASUA 4E7JA 5JS1A 1C0GA 1DTTA 3EN9A 1RTDA 3H1VX 5BPMA 3KLIA 4LF6K 1YUWA 3HYFA 1B9DA 2UYTA 4CJPA 1S72N 2Z1IA 4DR7K 4KH6A 4FJNA 2PYLA 3FFIA 4B9NA 3HL8A 1WSFA 4KBOA 1RFQA 4CBXA 4O4GA 4BRNA 2NRWA 1Y64A 1LWFA 3MCAB 1VAZA 4IJAA 3O4NA 4YOYA 2YJEA 5AQNA 3KVGA 3IAYA 2KFZA 4FJLA 4CJFA 1D4XA 1HNWK 4H5RA 5BPNA 3VF6A 3RSEB 3I8DA 4X66K 1A5WA 3GBTA 5KTQA 4ID1A 4DSEA 4G9ZA 4ELTA 4BGAA 4FJKA 4JV5K 1C6VA 2OPRA 4BGBA 2P9NB 4YOTA 2NRVA 5J2PA 4IJNA 5FRNA 1N33K 2OPPA 1N8RO 4JLHA 3SUQA 3CF5L 2O8DB 1H1VA 3LDNA 5AQJA 3AVJA 5CHIA 5FPNA 5M1PA 4CHNA 3MX2A 2A1SA 3RMBA 4CZMA 3UKUB 4ZHRA 1Y97A 4CE9A 3AA5X 5M1NA 4C1NK 2AP1A 4GVEA 5GAGP 2NLXA 1BQNA 1NG9A 1P90A 4JAXA 3O08A 4JI6K 3HO1A 1OKJA 2A3ZA 3SUNA 3OA9A 1YI2N 4CJVA 3HT3A 1KD1O 1BCMA 4MLEA 5C42A 3TWHA 1RT6A 1ZBSA 4OGCA 2V52B 3Q7CA 2UUBK 3MEEA 2DY4A 4LFAK 4DTOA 3QINA 3SPYA 2P5GA 4BRPA 1OH8A 2ZGYA 3HOSA 4DUYK 3C95A 1ZBHA 2D4WA 3B6OA 1BUPA 2PBDA 4K8ZA 3HJFA 3QESA 3I0RA 3SPZA 3TSUA 3MEGA 4DR1K 4B3TK 1VSFA 1XNRK 1P8ZA 3ITHA 1NKEA 3TAGA 3DM2A 3LP3A 4KTQA 2Q0RA 4OX9K 3LM9A 3NF8A 3KK2A 3K5OA 3AVIA 1LW0A 4RW8A 1BIUA 3KZBA 4CZHA 2OYQA 2HHQA 3ZETA 3CJAA 4EIAA 3O9SA 4CJ3A 3CCQN 1HNIA 1QHAA 5KRTA 1BDGA 3GE1A 4CK1A 4J2BA 5AQMA 3QDKA 1HMVA 4O8KA 4CF0A 2UXDK 1C1CA 3LM2A 3RRHA 3RWUA 2FBXA 5C0YA 1EXQA 1VQKN 1HKGA 3H08A 1D9DA 1HLUA 3S3OA 1KSPA 4FVUA 1S6QA 3LPTA 3DXMA 4Z94A 4DR2K 1K8AO 1V4TA 1EWQA 1S1WA 2AA4A 4BWMA 4CJ4A 3AVNA 4ISFA 4BR7A 4FJIA 2HOEA 4BWJA 3J7ZO 3VERA 1NBWA 1TGOA 3DI6A 1BA1A 2VCPA 4H0OA 1OH6A 4LH5A 2BANA 4KHYA 1DT9A 5JMVA 2RF2A 3EE8A 4CVNE 3CM6A 3U9ZA 3MN7A 3C94A 5AQZA 3AO1A 5C15A 3UKRA 2XY5A 1K9MO 3SV4A 3D2FA 1BI4A 1NOYA 4NB4A 4CEZA 4PKHA 4DB3A 4FZZA 3OHRA 2H3GX 3VPZA 4BRHA 1TVRA 4I6MA 2F96A 1J5EK 1VQ8N 1NGCA 1NGIA 1RTIA 3C6AA 4AHCA 2PFUA 4W5TA 2B6AA 4DHYA 2FSNA 2ASMA 2G8VA 2NRZA 3OJSA 4B1ZA 4FLVA 1QVFM 1QTMA 4AM6A 3VQ7A 2NRRA 1U4BA 1JL1A 3BEXA 5GAEP 1ATRA 4N41A 3L0QA 1SL1A 2YHWA 1VQNN 4BRFA 1GLDG 3FZHA 3K5MA 1C0FA 5LJWA 4CF9A 3DLLL 1VK0A 4JKCA 1HPZA 4CD1A 4MDBA 5HOOA 1WAFA 3NF7A 4JKAA 2P9PB 2P9UA 4E3SA 1X3MA 3DLHA 2QWOA 1RBTA 3QNOA 4C8NA 3A0IX 1QQOA 1RILA 3SI6A 2VGMA 3WQUA 4CEAA 3VMFB 4J2DA 3H6EA 3NAEA 2J4RA 1OVYA 3HK2A 1IKWA 1X9WA 2RN2A 3M8QA 3B8AX 3ZYYX 5BRHA 3SUOA 1RT7A 1HX1A 3FZFA 3WNEA 2GTDA 4FWNA 4H4OA 1DGKN 4BR2A 3TPQA 2ZD1A 5HRRA 2Z1HA 1XI1A 4E7IA 3MMVA 1Z05A 4RW6A 2G8KA 3RVCA 2JGUA 3HPGA 3CI5A 4FPBA 3PV8A 2ZWHA 2UXCK 3OYCA 4M42A 4OKJA 4BRDA 2QWRA 3C0BA 3ZSQA 5CYQA 3GOIA 1QSLA 4IEIA 1HPMA 2OCEA 1N36K 5IWAK 2QM1A 3L2RA 3O4QA 2KZZA 4OPHA 3NH1A 4CBWA 2E20A 4FJ5A 1WSGA 1HKBA 3E66A 4F9OA 2HVIA 1IKXA 4E19A 2KZMA 4CK2A 4PA1A 3G4SN 4I7FA 4OPKA 3J8AA 1SKSA 5IT9O 1LWEA 1SZ2A 5AQUA 1MWMA 4E1JA 3DXKA 1RNHA 2QA4N 1NJYA 4OLBA 4FWSA 1SL0A 2BE2A 3C6UA 5AZIB 4CIGA 1A5VA 3VQDA 1WSIA 3VETA 1JCEA 1EP4A 4YNQA 3SK3A 4B1VA 3HM8A 3CM5A 2D0PA 2I7PA 3VEXA 3AVMA 3V81A 1Q9XA 2X78A 2VG5A 1T03A 4B1UB 3UKRB 3G10A 1BI4B 1CZBA 3ZSVA 3ALYA 3P39A 4DFPA 4DSKA 2O8FA 3CFPA 2ATQA 4I6MB 3AGRA 4BE1A 1Q86O 4CZJA 1NK4A 3F5TA 1TUYA 4DCHA 3AA2A 4KKOA 1JXEA 1XWLA 3THYA 1VQ6N 1TV6A 1SKRA 3VQBA 3MN9A 1XNQK 5DMRA 4ISEA 4QOZB 4WYBA 5JVGL 3KTQA 4CJQA 2NUBA 3A8YA 3DOKA 3J7YP 3O9TA 2XY7A 4LF5K 1VQON 4HCCA 2YNGA 2WBNA 4IO8A 4NCGA 3HTVA 4CHOA 4DMNA 1VSKA 3D6RA 1ATSA 3EKUA 4YHHK 2DFEA 2A6AA 1SS6A 1VQPN 1TKXA 3I8BA 4Z4CA 2CGJA 3LANA 4CHYA 4O55A 3C7NB 2BDPA 3AAPA 4EZ9A 2P9UB 4J2EA 3DJCA 3Q7BA 4M3XA 4NCBA 4JN4A 1CZAN 4CGDA 2GELA 1Z25A 4HWIA 3F9KA 4OKKA 4B3SK 1LWCA 2I7NA 4Y1CA 3HP9A 4ZTJA 5F0XA 3OTOK 2DTUA 5J1EA 2FBTA 5JLHA 5C10A 4OLAA 2Q97A 5EVZA 4K42A 4FK2A 4F2RA 3OVNA 4PKIA 4JS5A 3L2QA 4B9UA 2D0AA 3T1YK 5HRNA 5CZ2A 3LWLA 3K2PA 3O9QA 4Y1DA 1Q81O 2UUAK 2HHXA 1JLGA 4IFYA 4MQ3A 3AGKA 2A42A 3HI0A 3KLGA 3ZSRA 4GY2B 3IDHA 2F8TA 4CGGA 2UUCK 2VQEK 4B1YB 4DFMA 5T7BA 5ELZA 1NK5A 2PYJA 1QSSA 4H5WA 2W41A 4NO7A 3VQQA 4W5NA 3IS9A 3AVHA 4FWOA 1S22A 1DEJA 4AHTA 2NRHA 2VG6A 4O5FA 2JWKA 4LSNA 3W0LA 1IH7A 3O6WA 3GDQA 2PY5A 4PUOA 1NGAA 2KQ2A 4IDHA 3VEWA 5D3GA 2YKNA 3L2WA 5GIOA 3FLCO 4JS4A 3VQ9A 4FO0A 3NGZA 2W42A 4GMJB 1TK8A 2F4VK 2GUPA 3L3UA 3FZKA 4L8RB 2QKKA 1QE1A 3K9JA 3PIPL 3CCUN 4Z4FA 1KAYA 4JD2B 3BY5A 2Q3SA 1J5OA 1NOZA 3AVKA 1F21A 1N6QA 2UXBK 1HYVA 2ITGA 5I9EB 1L3VA 1BL3A 1A5XA 4AF1A 1G15A 4M3YA 3A5NC 3VF4A 3T19A 1CZ9A 2HHHK 4Q5VA 2BUPA 4XEIA 3OYJA 4WF9L 1IKVA 3QEVA 3LZJA 5AQYA 3U4LA 4IEEA 1ATNA 1K8KA 3T3FA 3HPHA 1TK5A 4H5NA 1Q8IA 2GV9A 1C1BA 2CH5A 4FJ8A 3KLEA 1HNXK 3WEEA 4FJJA 4DTJA 4M7XA 3TANA 4BE0A 4DV5K 4H0VB 3MECA 5EOYA 3QIOA 4KTWA 1WLJA 3WXMB 3WT0A 5F2RA 3DYAA 3LDOA 1SL2A 4FLZA 3BUZB 1NWKA 4ICLA 2GWKA 3VGLA 4DUZK 4NCAA 3ZEUA 2RHKA 4BG9A 4DFJA 5CY4A 2ZQBA 1X3NA 4KFBA 4DR3K 1HJRA 3CCMN 1S9EA 1QVGM 4I2QA 3SNNA 5F1XA 1D8YA 3RR7A 3QFPA 3EZWA 2VYPA 2P9IA 5GIPA 1EQYA 1FXXA 2E2NA 5AQTA 3G6EN 3IMXA 5AZJA 5JICA 1SV5A 2FSJA 3G25A 4K43A 2VGNA 4OVLA 4A2AA 2QI2A 2IAJA 3A5LC 3CQYA 2P9LA 4CW7B 1VQ4N 1CLQA 1C1AA 4H4MA 1TL3A 4QS8A 1WNSA 1VSEA 2YHBA 5J2MA 3M6GA 2G8HA 4FWRA 1NJIO 4BY9C 4JI3K 3JYTA 4AM7A 4DTNA 3H46O 2DFFA 1XMQK 1W0HA 2O8CA 3R6MA 3L4IA 3O4WA 3P31A 4EZ6A 5KPTA 4QS7A 4CIEA 1RDBA 1YT3A 4LD0A 3MX5A 1CXQA 3D2EA 3L2UA 4DSFA 1Q82O 4M3TA 4YOVA 1N34K 4RW4A 1GLJO 2XRIA 4CECA 1RDCA 2ZE2A 4CFBA 3AVAA 4XIUA 5AQIA 3A2FA 2CGKA
chains in the Genus database with same CATH topology
3DLRA 3HVTA 3VQ7A 3KD1E 4FLUA 1U4BA 1JL1A 4N41A 1KVAA 1SL1A 3DLEA 3P1GA 3OS0A 3DMJA 4CEFA 1JXBA 3SYZA 4Q0BA 2A1RA 1J53A 1X9MA 1BISA 3LAKA 3WNHA 4ID5A 3K5MA 2AJQA 1QSYA 4E7LA 4CF9A 4M41A 1VK0A 3SJJA 3KK1A 4HTUA 1HPZA 2Z1GA 4B9MA 4NYFA 1DLOA 3ZSYA 3K5NA 5EU7A 5E41A 3B6PA 3OYFA 1CXUA 3HVRA 3PY8A 1BQMA 1NJXA 4M3ZA 4IBNA 1WAFA 1RBVA 2IS3A 5FROA 4JRQA 1O1WA 1KFSA 3NF7A 3NH0A 3V4IA 4LH4A 1GOBA 1L5UA 4E3SA 3U3YA 3OYKA 3RMAA 5DK5A 3DLHA 1RBTA 3DLGA 5K14A 3VQAA 3QNOA 1B9FA 4C8NA 1W9HA 4DTSA 3RMCA 2HHVA 4HVJA 1C0MA 3D45A 2HVIA 3CYMA 1RILA 1ASWA 4CCHA 3LAMA 3AA4A 3OJUA 3SI6A 3U6FA 1WAJA 4CEAA 4CFAA 4I9LA 3V9WA 4J2DA 3LZIA 2P5OA 3ZT2A 1RT5A 4M45A 1TK8A 2JLEA 3NAEA 1NK8A 3HK2A 2D5RA 3KD5E 1IKWA 3LP2A 3NGIA 1X9WA 4DQSA 3IG1A 2RN2A 2O4GA 3M8QA 4RG8A 4FM2A 3SUOA 1KCFA 1VSLA 1RT7A 2O4IA 4CGJA 3WNEA 5HROA 3U3GA 4DTMA 2FBYA 4H4OA 1IG9A 4FM1A 4FJMA 4DTUA 1BIZA 3BGRA 3LP1A 4LSLA 1VSHA 4B9SA 2YV0X 3ZT4A 4CHPA 4BE2A 2ZD1A 1QS4A 5HRRA 3KLHA 3MEDA 3V9SA 4GW6A 2Z1HA 1XI1A 4E7IA 3ISNC 3DLBA 4RW6A 3NFAA 5KI6A 2G8KA 2Y1IA 1JLQA 2JGUA 4KO0A 3OYBA 4AHVA 3HPGA 1UA1A 1TL1A 4DSJA 4KI4A 3SQ2A 4DS5A 3PV8A 3V9XA 1L3UA 3QLHA 3OYCA 2FC0A 4OKJA 4ELVA 4M42A 1QHTA 4DTRA 2P1JA 2DFHA 4FW2A 3ZSQA 4DQQA 4O0JA 1BHLA 5CYQA 3OYDA 4O5BA 3SCXA 4FYDA 1QSLA 4DS4A 4IG0A 4CJRA 4DQIA 3ULDA 1SKWA 1BCOA 4BACA 2HMIA 4CEEA 1WN7A 2OA8A 5FRMA 3K58A 4FLYA 2EHGA 3L2RA 3O4QA 4HUEA 2E4LA 5CYMA 4N76A 4FZXC 2KZZA 2IGIA 3NH1A 4O0IA 3TAFA 2D0BA 3AVFA 3RTVA 1FK9A 1WSGA 4AHRA 3K5LA 4FLXA 4FJ5A 1IKXA 4AILC 4E0DA 4LY7A 4E19A 1ZBIA 3OY9A 2KZMA 3AVBA 4CK2A 4N56A 4BDYA 4PA1A 3ZSZA 3LDSA 1HQEA 3TR8A 4I7FA 4OPKA 4CHZA 3LWMA 3S3NA 1TK0A 2Y1JA 4CJTA 4HUGA 1SKSA 4OKEA 1LV5A 1VSDA 1LWEA 4CEOA 4N5SA 4RW9A 3ZSOA 1U04A 1TKTA 4WE1A 2OZMA 4DLGA 4CFCA 4GVMA 4I2PA 1U49A 1RNHA 2OPSA 1EKEA 3LP0A 1FKOA 1D9FA 4KV8A 1NJYA 3DRSA 2IDOA 4CJLA 5HRPA 3KKSA 3S9HA 3KKRA 4OLBA 2VWKA 1WSHA 4FW1A 3AVGA 1SL0A 2BE2A 3C6UA 4CIGA 3V1RA 4B08A 3JSMA 3NF6A 4E7KA 2HHUA 1A5VA 3CQ8A 3VQDA 1KTQA 4NYNA 1WSIA 1ITGA 5J2NA 1U45A 4FJHA 3CG7A 1WSJA 2WONA 1T8EA 1EP4A 1S1TA 4YNQA 4DU4A 1NKCA 1RT4A 4CF2A 3P5JA 3I0SA 2IOCA 3CM5A 4CIFA 4KHNA 3ZT3A 1KRPA 3PX6A 1YTUA 3VQ5A 1UOCA 3AVMA 3V81A 1Q9XA 2RKIA 3OYEA 3AO3A 1HQUA 2X78A 2VG5A 1T03A 1JLAA 3NBPA 4H8KA 3ZT0A 3RR8A 5I42A 2B4JA 3G10A 1BI4B 5JS2A 1CZBA 3ZSVA 4FJ7A 1GOCA 4FK0A 3DRPA 4RW7A 5C25A 1UWBA 3ALYA 4DFPA 1IO2A 3AV9A 1T05A 3CFPA 4DSKA 3PO5A 2ATQA 4DF8A 3OS2A 3L8BA 3ZT1A 3AO4A 3RMDA 3QIPA 3MXMA 4DSLA 3RRGA 4BE1A 2OZSA 3T1AA 1JLFA 1HYSA 4Z4HA 3QETA 1IKYA 5CZ1A 5FDLA 1NK4A 4HHTA 1NK6A 3OYHA 2GBZA 1EETA 2QK9A 1RDAA 4FJ9A 1GOAA 3G0ZA 1ZYQA 1I39A 3AA2A 4KKOA 5C24A 1REVA 4CJSA 1LAWA 1RTJA 5HP1A 4FJGA 4PWDA 1JXEA 2EX3A 3ASMA 3OS1A 4DLEA 1XWLA 3IRXA 4DSIA 3C6TA 1TV6A 4CFDA 1SKRA 3PX4A 3VQBA 4DTXA 3V9ZA 3MXJA 5DMRA 4G1QA 1Z26A 4Z4GA 4QOZB 3TAQA 3KTQA 2X6NA 1UA0A 3SV3A 1QQCA 4AHUA 3M8PA 4CJQA 4BDZA 3PX0A 4DG1A 1KLNA 4HCBA 2NUBA 1VSIA 3P83D 1RT3A 3DOKA 4EP4A 3HP6A 2XY7A 2YHAA 4KPYA 1N5YA 4HCCA 2YNGA 4FJXA 4QCLA 4NCGA 4CHOA 4DU1A 2QKBA 2R7YA 4DMNA 1VSKA 3AO2A 3OYGA 3VQEA 1S6PA 4KHSA 4CGFA 3HXMA 1XHXA 1YTAA 2DFEA 3O3FA 3QNNA 1KSPA 4FK4A 2HHSA 3S3MA 2E6MA 4OJRA 1TKXA 1RBRA 3SZ2A 4DFKA 4BDPA 4AH9A 2YNFA 3LANA 4Z4CA 4CHYA 3O3HA 4FLTA 4O55A 2BDPA 4PY5A 3VA3A 3CFRA 2XY6A 1BGXT 4IG3A 4QAGA 3OYLA 3NE6A 2HNDA 1ASVA 1JKHA 2HNZA 3DLKA 4EZ9A 3VQPA 4J2EA 1VSJA 1EX4A 1L3SA 4IDKA 4IKFA 4M3XA 4NCBA 4E1NA 1QTMA 4CGDA 5J2QA 1Z25A 1ASUA 3F9KA 4E7JA 5JS1A 1RBUA 4OKKA 4FCYA 4FLWA 4K8XA 4Z4IA 1KVBA 4M3RA 5HLFA 3WNGA 4W5OA 1DTTA 1NKBA 3VA0A 1LWCA 3TAEA 4C8LA 1RTDA 2HB5A 3HP9A 4IFVA 4Y1CA 4ZTJA 1T7PA 3KLIA 1NK0A 5J1EA 2FBTA 3KJVA 4CK3A 1XHZA 2DTUA 4OLAA 3HYFA 3SQ1A 2G8IA 1B9DA 1HRHA 4FK2A 4F2RA 4CJPA 5KGWA 3OVNA 4B8CA 2Z1IA 1S1XA 3L2QA 4JS5A 4B9UA 4YFUA 4FJNA 2PYLA 3FFIA 2D0AA 4E1MA 3ZSWA 4B9NA 3HL8A 1WSFA 5HRNA 5HRSA 5CZ2A 3LWLA 4CJ5A 4KRFA 1I3AA 3K2PA 4O4GA 4Y1DA 2G8FA 1LWFA 2HHXA 1JLGA 1XC9A 1KLMA 4IFYA 4MQ3A 3QEXA 1DTQA 3O4NA 4F4KA 3KLGA 3DRRA 3ZSRA 2F8TA 2KFZA 4CGGA 3IAYA 4FXDA 3NCIA 2LSNA 1VRUA 2GUIA 3VN5A 4DFMA 4FJLA 4CJFA 3QEWA 5T7BA 1RT1A 3LPUA 3HPOA 3SQ4A 4DQRA 1NK5A 2PYJA 1QSSA 2B5JA 3I8DA 4JRPA 1A5WA 3VQQA 4N47A 4C8MA 5KTQA 4ID1A 4DSEA 4CGIA 4ELTA 4W5NA 3IS9A 3AVHA 3NHGA 4FJKA 1TAQA 1C6VA 2OPRA 5KRSA 2E6LA 1RDDA 4AHTA 2VG6A 3D0PA 2RPIA 1LAVA 4MFBA 4FM0A 1NJWA 1VRTA 4LSNA 1IH7A 1X9SA 3OYAA 5J2PA 4DQPA 1NK7A 5FRNA 1RT2A 4HUFA 1J9AA 2OPPA 1J54A 2KQ2A 2PY5A 4PUOA 1RTHA 4JLHA 3SUQA 5D3GA 2P51A 2YKNA 2ETJA 3L2WA 3K59A 3AVJA 4JS4A 4Z0UA 3VQ9A 3VQ4A 1S5JA 3NGZA 3AA3A 4GMJB 2A1SA 4CHNA 2W42A 3K57A 4CJWA 3RMBA 4ZHRA 4F3TA 4Z4EA 1D5AA 1Y97A 3L3UA 4CE9A 3KK3A 4L8RB 3AA5X 4E89A 2IC3A 2X74A 2QKKA 1QE1A 4Z4FA 4F3OA 4F8RA 2Q3SA 1BQNA 1J5OA 4B9VA 1NOZA 5SZTA 3AVKA 1KFDA 4DU3A 1F21A 3EYZA 3QERA 1NJZA 1N6QA 3VQ6A 1HYVA 3HO1A 2ITGA 3QEPA 1L3VA 2HW3A 3SUNA 1BL3A 1A5XA 4CEBA 1G15A 3HSTB 1Q9YA 2HHTA 3V9UA 1ZBLA 1JLEA 2XHBA 4M3YA 4CJVA 3HT3A 3T19A 1BCMA 3BDPA 2D0CA 1CZ9A 4KTZA 5C42A 3TWHA 4KHUA 1RT6A 4OGCA 2OPQA 3LALA 4CJEA 3V6DA 1TKZA 4Q5VA 3OYJA 3MEEA 2DY4A 4KAZA 4DTOA 1R0AA 3L2VA 4W5RA 1IKVA 3OYIA 1L3TA 5KGXA 3QINA 3QEVA 3SPYA 4OPJA 3LZJA 3KIOA 1X1PA 2P5GA 4KREA 1B92A 1ZBHA 3C95A 3NDKA 3VQ8A 3T3FA 2VG7A 3B6OA 3HPHA 4FVMA 4CHQA 1TK5A 4K8ZA 3HJFA 4M3UA 3QESA 1Q8IA 2GV9A 4KB0A 1C1BA 4FJ8A 3I0RA 3SPZA 3TAPA 3MEGA 3KLEA 1VSFA 3ZSXA 3TARA 3ITHA 4FJJA 4R5PA 4DTJA 3TANA 1HNVA 2KW4A 2YKMA 1VSMA 2G8UA 4BE0A 1NK9A 3NGYA 3TAGA 1NKEA 3DM2A 1S1VA 3LP3A 1K6YA 4KTQA 2X6SA 4M3WA 2KFNA 3NF8A 4TSXA 3TAMA 1JLBA 3VQCA 4CJUA 3MECA 3QIOA 3KK2A 3K5OA 4KTWA 1WLJA 4CESA 3SUPA 1YVUA 3ZCMA 2YNIA 1MU2A 3AVIA 3M8SA 2KTQA 1LW0A 4O44A 3DYAA 4RW8A 1BIUA 4CF1A 2Z1JA 4CERA 2OYQA 4PQUA 2HHQA 3M8RA 4FLZA 4E7HA 5I3UA 1SL2A 2HVHA 4KHQA 4ICLA 4B3OA 4DWIA 4NCAA 4CJ3A 3CFOA 2F8SA 1HNIA 4OGEA 3WNFA 3V1QA 4CF8A 4DTPA 4F2SA 3OYNA 4UQGA 4CJKA 3QEIA 5HBMA 4DFJA 2HHWA 5KRTA 5CY4A 1RBSA 2ZQBA 1S1UA 3AO5A 4KFBA 4CK1A 4KB1A 4J2BA 1HJRA 1S9EA 4I2QA 3SNNA 4KI6A 1U47A 1HMVA 1SUQA 3TI0A 4CF0A 4CEDA 1C1CA 3MXIA 3RRHA 3E01A 1D8YA 2FBXA 3RR7A 4CEQA 3RWUA 1EXQA 3HM9A 4ELUA 3H08A 3MAQA 3S3OA 1FXXA 1JL2A 1RCHA 1D9DA 2XO7A 2XY8A 1S6QA 3LPTA 1WSEA 3PO4A 2FBVA 1SV5A 3O3GA 2I5JA 3EZ5A 1S1WA 4OVLA 1ZBFA 2IAJA 4BWMA 3AVCA 4CJ4A 3AVNA 3OYMA 4FJIA 4BWJA 3TABA 4EP5A 3DI6A 1TGOA 3NF9A 1CLQA 1C1AA 2HNYA 1JLCA 4LH5A 4CGHA 4H4MA 2BANA 1C0TA 2WOMA 4KHYA 1U48A 2RF2A 4ZTFA 2YNHA 1TL3A 3CM6A 4KHWA 1HYZA 3KLFA 1WNSA 3C94A 3AO1A 1VSEA 2YHBA 2XY5A 2QXFA 3THVA 4C8OA 3SV4A 1NOYA 1BI4A 5J2MA 4FZYA 4CEZA 4FZZA 1TAUA 1LW2A 4DF4A 2G8HA 3QO9A 3V1OA 3JYTA 4C8KA 1KVCA 1TVRA 4I9QA 4W5QA 4DTNA 2F96A 4B8AB 2PZSA 2DFFA 3NH2A 3F73A 1W0HA 3PUFA 1RTIA 3EY1A 3DOLA 3L3VA 4EZ6A 4AHCA 4CIEA 1TKDA 1RDBA 1YT3A 1ZBUA 4LD0A 1C0UA 4W5TA 2G8WA 3L2UA 1CXQA 3UIQA 2B6AA 4DSFA 4B9LA 3SQ0A 4AHSA 2VWJA 1S9GA 5SWMA 4M3TA 2G8VA 4RW4A 2XRIA 4CECA 1UAXA 1RDCA 2ZE2A 3OJSA 4B9TA 4FLVA 4CFBA 3AVAA 4XIUA 4J2AA 2BGGA 3A2FA 1FKPA 3AVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLR A;  3HVT A;  3VQ7 A;  3KD1 E;  4FLU A;  1U4B A;  1JL1 A;  4N41 A;  1KVA A;  1SL1 A;  3DLE A;  3P1G A;  3OS0 A;  3DMJ A;  4CEF A;  1JXB A;  3SYZ A;  4Q0B A;  2A1R A;  1J53 A;  1X9M A;  1BIS A;  3LAK A;  3WNH A;  4ID5 A;  3K5M A;  2AJQ A;  1QSY A;  4E7L A;  4CF9 A;  4M41 A;  1VK0 A;  3SJJ A;  3KK1 A;  4HTU A;  1HPZ A;  2Z1G A;  4B9M A;  4NYF A;  1DLO A;  3ZSY A;  3K5N A;  5EU7 A;  5E41 A;  3B6P A;  3OYF A;  1CXU A;  3HVR A;  3PY8 A;  1BQM A;  1NJX A;  4M3Z A;  4IBN A;  1WAF A;  1RBV A;  2IS3 A;  5FRO A;  4JRQ A;  1O1W A;  1KFS A;  3NF7 A;  3NH0 A;  3V4I A;  4LH4 A;  1GOB A;  1L5U A;  4E3S A;  3U3Y A;  3OYK A;  3RMA A;  5DK5 A;  3DLH A;  1RBT A;  3DLG A;  5K14 A;  3VQA A;  3QNO A;  1B9F A;  4C8N A;  1W9H A;  4DTS A;  3RMC A;  2HHV A;  4HVJ A;  1C0M A;  3D45 A;  2HVI A;  3CYM A;  1RIL A;  1ASW A;  4CCH A;  3LAM A;  3AA4 A;  3OJU A;  3SI6 A;  3U6F A;  1WAJ A;  4CEA A;  4CFA A;  4I9L A;  3V9W A;  4J2D A;  3LZI A;  2P5O A;  3ZT2 A;  1RT5 A;  4M45 A;  1TK8 A;  2JLE A;  3NAE A;  1NK8 A;  3HK2 A;  2D5R A;  3KD5 E;  1IKW A;  3LP2 A;  3NGI A;  1X9W A;  4DQS A;  3IG1 A;  2RN2 A;  2O4G A;  3M8Q A;  4RG8 A;  4FM2 A;  3SUO A;  1KCF A;  1VSL A;  1RT7 A;  2O4I A;  4CGJ A;  3WNE A;  5HRO A;  3U3G A;  4DTM A;  2FBY A;  4H4O A;  1IG9 A;  4FM1 A;  4FJM A;  4DTU A;  1BIZ A;  3BGR A;  3LP1 A;  4LSL A;  1VSH A;  4B9S A;  2YV0 X;  3ZT4 A;  4CHP A;  4BE2 A;  2ZD1 A;  1QS4 A;  5HRR A;  3KLH A;  3MED A;  3V9S A;  4GW6 A;  2Z1H A;  1XI1 A;  4E7I A;  3ISN C;  3DLB A;  4RW6 A;  3NFA A;  5KI6 A;  2G8K A;  2Y1I A;  1JLQ A;  2JGU A;  4KO0 A;  3OYB A;  4AHV A;  3HPG A;  1UA1 A;  1TL1 A;  4DSJ A;  4KI4 A;  3SQ2 A;  4DS5 A;  3PV8 A;  3V9X A;  1L3U A;  3QLH A;  3OYC A;  2FC0 A;  4OKJ A;  4ELV A;  4M42 A;  1QHT A;  4DTR A;  2P1J A;  2DFH A;  4FW2 A;  3ZSQ A;  4DQQ A;  4O0J A;  1BHL A;  5CYQ A;  3OYD A;  4O5B A;  3SCX A;  4FYD A;  1QSL A;  4DS4 A;  4IG0 A;  4CJR A;  4DQI A;  3ULD A;  1SKW A;  1BCO A;  4BAC A;  2HMI A;  4CEE A;  1WN7 A;  2OA8 A;  5FRM A;  3K58 A;  4FLY A;  2EHG A;  3L2R A;  3O4Q A;  4HUE A;  2E4L A;  5CYM A;  4N76 A;  4FZX C;  2KZZ A;  2IGI A;  3NH1 A;  4O0I A;  3TAF A;  2D0B A;  3AVF A;  3RTV A;  1FK9 A;  1WSG A;  4AHR A;  3K5L A;  4FLX A;  4FJ5 A;  1IKX A;  4AIL C;  4E0D A;  4LY7 A;  4E19 A;  1ZBI A;  3OY9 A;  2KZM A;  3AVB A;  4CK2 A;  4N56 A;  4BDY A;  4PA1 A;  3ZSZ A;  3LDS A;  1HQE A;  3TR8 A;  4I7F A;  4OPK A;  4CHZ A;  3LWM A;  3S3N A;  1TK0 A;  2Y1J A;  4CJT A;  4HUG A;  1SKS A;  4OKE A;  1LV5 A;  1VSD A;  1LWE A;  4CEO A;  4N5S A;  4RW9 A;  3ZSO A;  1U04 A;  1TKT A;  4WE1 A;  2OZM A;  4DLG A;  4CFC A;  4GVM A;  4I2P A;  1U49 A;  1RNH A;  2OPS A;  1EKE A;  3LP0 A;  1FKO A;  1D9F A;  4KV8 A;  1NJY A;  3DRS A;  2IDO A;  4CJL A;  5HRP A;  3KKS A;  3S9H A;  3KKR A;  4OLB A;  2VWK A;  1WSH A;  4FW1 A;  3AVG A;  1SL0 A;  2BE2 A;  3C6U A;  4CIG A;  3V1R A;  4B08 A;  3JSM A;  3NF6 A;  4E7K A;  2HHU A;  1A5V A;  3CQ8 A;  3VQD A;  1KTQ A;  4NYN A;  1WSI A;  1ITG A;  5J2N A;  1U45 A;  4FJH A;  3CG7 A;  1WSJ A;  2WON A;  1T8E A;  1EP4 A;  1S1T A;  4YNQ A;  4DU4 A;  1NKC A;  1RT4 A;  4CF2 A;  3P5J A;  3I0S A;  2IOC A;  3CM5 A;  4CIF A;  4KHN A;  3ZT3 A;  1KRP A;  3PX6 A;  1YTU A;  3VQ5 A;  1UOC A;  3AVM A;  3V81 A;  1Q9X A;  2RKI A;  3OYE A;  3AO3 A;  1HQU A;  2X78 A;  2VG5 A;  1T03 A;  1JLA A;  3NBP A;  4H8K A;  3ZT0 A;  3RR8 A;  5I42 A;  2B4J A;  3G10 A;  1BI4 B;  5JS2 A;  1CZB A;  3ZSV A;  4FJ7 A;  1GOC A;  4FK0 A;  3DRP A;  4RW7 A;  5C25 A;  1UWB A;  3ALY A;  4DFP A;  1IO2 A;  3AV9 A;  1T05 A;  3CFP A;  4DSK A;  3PO5 A;  2ATQ A;  4DF8 A;  3OS2 A;  3L8B A;  3ZT1 A;  3AO4 A;  3RMD A;  3QIP A;  3MXM A;  4DSL A;  3RRG A;  4BE1 A;  2OZS A;  3T1A A;  1JLF A;  1HYS A;  4Z4H A;  3QET A;  1IKY A;  5CZ1 A;  5FDL A;  1NK4 A;  4HHT A;  1NK6 A;  3OYH A;  2GBZ A;  1EET A;  2QK9 A;  1RDA A;  4FJ9 A;  1GOA A;  3G0Z A;  1ZYQ A;  1I39 A;  3AA2 A;  4KKO A;  5C24 A;  1REV A;  4CJS A;  1LAW A;  1RTJ A;  5HP1 A;  4FJG A;  4PWD A;  1JXE A;  2EX3 A;  3ASM A;  3OS1 A;  4DLE A;  1XWL A;  3IRX A;  4DSI A;  3C6T A;  1TV6 A;  4CFD A;  1SKR A;  3PX4 A;  3VQB A;  4DTX A;  3V9Z A;  3MXJ A;  5DMR A;  4G1Q A;  1Z26 A;  4Z4G A;  4QOZ B;  3TAQ A;  3KTQ A;  2X6N A;  1UA0 A;  3SV3 A;  1QQC A;  4AHU A;  3M8P A;  4CJQ A;  4BDZ A;  3PX0 A;  4DG1 A;  1KLN A;  4HCB A;  2NUB A;  1VSI A;  3P83 D;  1RT3 A;  3DOK A;  4EP4 A;  3HP6 A;  2XY7 A;  2YHA A;  4KPY A;  1N5Y A;  4HCC A;  2YNG A;  4FJX A;  4QCL A;  4NCG A;  4CHO A;  4DU1 A;  2QKB A;  2R7Y A;  4DMN A;  1VSK A;  3AO2 A;  3OYG A;  3VQE A;  1S6P A;  4KHS A;  4CGF A;  3HXM A;  1XHX A;  1YTA A;  2DFE A;  3O3F A;  3QNN A;  1KSP A;  4FK4 A;  2HHS A;  3S3M A;  2E6M A;  4OJR A;  1TKX A;  1RBR A;  3SZ2 A;  4DFK A;  4BDP A;  4AH9 A;  2YNF A;  3LAN A;  4Z4C A;  4CHY A;  3O3H A;  4FLT A;  4O55 A;  2BDP A;  4PY5 A;  3VA3 A;  3CFR A;  2XY6 A;  1BGX T;  4IG3 A;  4QAG A;  3OYL A;  3NE6 A;  2HND A;  1ASV A;  1JKH A;  2HNZ A;  3DLK A;  4EZ9 A;  3VQP A;  4J2E A;  1VSJ A;  1EX4 A;  1L3S A;  4IDK A;  4IKF A;  4M3X A;  4NCB A;  4E1N A;  1QTM A;  4CGD A;  5J2Q A;  1Z25 A;  1ASU A;  3F9K A;  4E7J A;  5JS1 A;  1RBU A;  4OKK A;  4FCY A;  4FLW A;  4K8X A;  4Z4I A;  1KVB A;  4M3R A;  5HLF A;  3WNG A;  4W5O A;  1DTT A;  1NKB A;  3VA0 A;  1LWC A;  3TAE A;  4C8L A;  1RTD A;  2HB5 A;  3HP9 A;  4IFV A;  4Y1C A;  4ZTJ A;  1T7P A;  3KLI A;  1NK0 A;  5J1E A;  2FBT A;  3KJV A;  4CK3 A;  1XHZ A;  2DTU A;  4OLA A;  3HYF A;  3SQ1 A;  2G8I A;  1B9D A;  1HRH A;  4FK2 A;  4F2R A;  4CJP A;  5KGW A;  3OVN A;  4B8C A;  2Z1I A;  1S1X A;  3L2Q A;  4JS5 A;  4B9U A;  4YFU A;  4FJN A;  2PYL A;  3FFI A;  2D0A A;  4E1M A;  3ZSW A;  4B9N A;  3HL8 A;  1WSF A;  5HRN A;  5HRS A;  5CZ2 A;  3LWL A;  4CJ5 A;  4KRF A;  1I3A A;  3K2P A;  4O4G A;  4Y1D A;  2G8F A;  1LWF A;  2HHX A;  1JLG A;  1XC9 A;  1KLM A;  4IFY A;  4MQ3 A;  3QEX A;  1DTQ A;  3O4N A;  4F4K A;  3KLG A;  3DRR A;  3ZSR A;  2F8T A;  2KFZ A;  4CGG A;  3IAY A;  4FXD A;  3NCI A;  2LSN A;  1VRU A;  2GUI A;  3VN5 A;  4DFM A;  4FJL A;  4CJF A;  3QEW A;  5T7B A;  1RT1 A;  3LPU A;  3HPO A;  3SQ4 A;  4DQR A;  1NK5 A;  2PYJ A;  1QSS A;  2B5J A;  3I8D A;  4JRP A;  1A5W A;  3VQQ A;  4N47 A;  4C8M A;  5KTQ A;  4ID1 A;  4DSE A;  4CGI A;  4ELT A;  4W5N A;  3IS9 A;  3AVH A;  3NHG A;  4FJK A;  1TAQ A;  1C6V A;  2OPR A;  5KRS A;  2E6L A;  1RDD A;  4AHT A;  2VG6 A;  3D0P A;  2RPI A;  1LAV A;  4MFB A;  4FM0 A;  1NJW A;  1VRT A;  4LSN A;  1IH7 A;  1X9S A;  3OYA A;  5J2P A;  4DQP A;  1NK7 A;  5FRN A;  1RT2 A;  4HUF A;  1J9A A;  2OPP A;  1J54 A;  2KQ2 A;  2PY5 A;  4PUO A;  1RTH A;  4JLH A;  3SUQ A;  5D3G A;  2P51 A;  2YKN A;  2ETJ A;  3L2W A;  3K59 A;  3AVJ A;  4JS4 A;  4Z0U A;  3VQ9 A;  3VQ4 A;  1S5J A;  3NGZ A;  3AA3 A;  4GMJ B;  2A1S A;  4CHN A;  2W42 A;  3K57 A;  4CJW A;  3RMB A;  4ZHR A;  4F3T A;  4Z4E A;  1D5A A;  1Y97 A;  3L3U A;  4CE9 A;  3KK3 A;  4L8R B;  3AA5 X;  4E89 A;  2IC3 A;  2X74 A;  2QKK A;  1QE1 A;  4Z4F A;  4F3O A;  4F8R A;  2Q3S A;  1BQN A;  1J5O A;  4B9V A;  1NOZ A;  5SZT A;  3AVK A;  1KFD A;  4DU3 A;  1F21 A;  3EYZ A;  3QER A;  1NJZ A;  1N6Q A;  3VQ6 A;  1HYV A;  3HO1 A;  2ITG A;  3QEP A;  1L3V A;  2HW3 A;  3SUN A;  1BL3 A;  1A5X A;  4CEB A;  1G15 A;  3HST B;  1Q9Y A;  2HHT A;  3V9U A;  1ZBL A;  1JLE A;  2XHB A;  4M3Y A;  4CJV A;  3HT3 A;  3T19 A;  1BCM A;  3BDP A;  2D0C A;  1CZ9 A;  4KTZ A;  5C42 A;  3TWH A;  4KHU A;  1RT6 A;  4OGC A;  2OPQ A;  3LAL A;  4CJE A;  3V6D A;  1TKZ A;  4Q5V A;  3OYJ A;  3MEE A;  2DY4 A;  4KAZ A;  4DTO A;  1R0A A;  3L2V A;  4W5R A;  1IKV A;  3OYI A;  1L3T A;  5KGX A;  3QIN A;  3QEV A;  3SPY A;  4OPJ A;  3LZJ A;  3KIO A;  1X1P A;  2P5G A;  4KRE A;  1B92 A;  1ZBH A;  3C95 A;  3NDK A;  3VQ8 A;  3T3F A;  2VG7 A;  3B6O A;  3HPH A;  4FVM A;  4CHQ A;  1TK5 A;  4K8Z A;  3HJF A;  4M3U A;  3QES A;  1Q8I A;  2GV9 A;  4KB0 A;  1C1B A;  4FJ8 A;  3I0R A;  3SPZ A;  3TAP A;  3MEG A;  3KLE A;  1VSF A;  3ZSX A;  3TAR A;  3ITH A;  4FJJ A;  4R5P A;  4DTJ A;  3TAN A;  1HNV A;  2KW4 A;  2YKM A;  1VSM A;  2G8U A;  4BE0 A;  1NK9 A;  3NGY A;  3TAG A;  1NKE A;  3DM2 A;  1S1V A;  3LP3 A;  1K6Y A;  4KTQ A;  2X6S A;  4M3W A;  2KFN A;  3NF8 A;  4TSX A;  3TAM A;  1JLB A;  3VQC A;  4CJU A;  3MEC A;  3QIO A;  3KK2 A;  3K5O A;  4KTW A;  1WLJ A;  4CES A;  3SUP A;  1YVU A;  3ZCM A;  2YNI A;  1MU2 A;  3AVI A;  3M8S A;  2KTQ A;  1LW0 A;  4O44 A;  3DYA A;  4RW8 A;  1BIU A;  4CF1 A;  2Z1J A;  4CER A;  2OYQ A;  4PQU A;  2HHQ A;  3M8R A;  4FLZ A;  4E7H A;  5I3U A;  1SL2 A;  2HVH A;  4KHQ A;  4ICL A;  4B3O A;  4DWI A;  4NCA A;  4CJ3 A;  3CFO A;  2F8S A;  1HNI A;  4OGE A;  3WNF A;  3V1Q A;  4CF8 A;  4DTP A;  4F2S A;  3OYN A;  4UQG A;  4CJK A;  3QEI A;  5HBM A;  4DFJ A;  2HHW A;  5KRT A;  5CY4 A;  1RBS A;  2ZQB A;  1S1U A;  3AO5 A;  4KFB A;  4CK1 A;  4KB1 A;  4J2B A;  1HJR A;  1S9E A;  4I2Q A;  3SNN A;  4KI6 A;  1U47 A;  1HMV A;  1SUQ A;  3TI0 A;  4CF0 A;  4CED A;  1C1C A;  3MXI A;  3RRH A;  3E01 A;  1D8Y A;  2FBX A;  3RR7 A;  4CEQ A;  3RWU A;  1EXQ A;  3HM9 A;  4ELU A;  3H08 A;  3MAQ A;  3S3O A;  1FXX A;  1JL2 A;  1RCH A;  1D9D A;  2XO7 A;  2XY8 A;  1S6Q A;  3LPT A;  1WSE A;  3PO4 A;  2FBV A;  1SV5 A;  3O3G A;  2I5J A;  3EZ5 A;  1S1W A;  4OVL A;  1ZBF A;  2IAJ A;  4BWM A;  3AVC A;  4CJ4 A;  3AVN A;  3OYM A;  4FJI A;  4BWJ A;  3TAB A;  4EP5 A;  3DI6 A;  1TGO A;  3NF9 A;  1CLQ A;  1C1A A;  2HNY A;  1JLC A;  4LH5 A;  4CGH A;  4H4M A;  2BAN A;  1C0T A;  2WOM A;  4KHY A;  1U48 A;  2RF2 A;  4ZTF A;  2YNH A;  1TL3 A;  3CM6 A;  4KHW A;  1HYZ A;  3KLF A;  1WNS A;  3C94 A;  3AO1 A;  1VSE A;  2YHB A;  2XY5 A;  2QXF A;  3THV A;  4C8O A;  3SV4 A;  1NOY A;  1BI4 A;  5J2M A;  4FZY A;  4CEZ A;  4FZZ A;  1TAU A;  1LW2 A;  4DF4 A;  2G8H A;  3QO9 A;  3V1O A;  3JYT A;  4C8K A;  1KVC A;  1TVR A;  4I9Q A;  4W5Q A;  4DTN A;  2F96 A;  4B8A B;  2PZS A;  2DFF A;  3NH2 A;  3F73 A;  1W0H A;  3PUF A;  1RTI A;  3EY1 A;  3DOL A;  3L3V A;  4EZ6 A;  4AHC A;  4CIE A;  1TKD A;  1RDB A;  1YT3 A;  1ZBU A;  4LD0 A;  1C0U A;  4W5T A;  2G8W A;  3L2U A;  1CXQ A;  3UIQ A;  2B6A A;  4DSF A;  4B9L A;  3SQ0 A;  4AHS A;  2VWJ A;  1S9G A;  5SWM A;  4M3T A;  2G8V A;  4RW4 A;  2XRI A;  4CEC A;  1UAX A;  1RDC A;  2ZE2 A;  3OJS A;  4B9T A;  4FLV A;  4CFB A;  3AVA A;  4XIU A;  4J2A A;  2BGG A;  3A2F A;  1FKP A;  3AVL A; 
#chains in the Genus database with same CATH topology
 3BP8 A;  3U9D A;  3KD1 E;  4LFC K;  4JYA K;  3C6H A;  1JXB A;  4DV6 K;  2A1R A;  3CIP A;  5LL6 Z;  3SJH A;  2P9K B;  4BRC A;  1DLO A;  3ZSY A;  3K5N A;  3E1Y A;  4BC3 A;  3B6P A;  3PY8 A;  1CXU A;  5AFU H;  1NJX A;  1DKG D;  2IS3 A;  1I94 K;  1O1W A;  4FWM A;  1NU0 A;  3U3Y A;  2P9S A;  2F9T A;  3DLG A;  3VQA A;  3H45 C;  1B9F A;  4DTS A;  1ZC6 A;  3D45 A;  4WQ5 A;  3CYM A;  3CCE N;  3TSP A;  3AA4 A;  1V4S A;  1WAJ A;  3V9W A;  5C2F A;  3LZI A;  3ZT2 A;  1VQL N;  3E9L A;  4YOX A;  2D5R A;  4DQS A;  1YF5 L;  3ZX2 A;  4RG8 A;  3FR0 A;  1VSL A;  1BO5 O;  3CCV N;  5HRO A;  4FOI A;  4FM1 A;  3BGR A;  3LP1 A;  4JKH A;  3ENH A;  3EE9 A;  1VSH A;  4B9S A;  2HBK A;  3VGM A;  1S3X A;  3KLH A;  1QS4 A;  3V9S A;  3I33 A;  4GW6 A;  3DLB A;  5KI6 A;  1WB9 A;  1JLQ A;  3M3Z A;  4AHV A;  1TL1 A;  2W40 A;  4KI4 A;  3VEO A;  5TKW A;  4A61 A;  4IWV A;  4X65 K;  3QLH A;  2P1J A;  1BHL A;  3OYD A;  4O5B A;  4FYD A;  4DS4 A;  4CJR A;  1BCO A;  2Q2R A;  1K73 O;  4O8U A;  1X9J A;  5FRM A;  1IJJ A;  2EHG A;  4RTF D;  5CYM A;  4DR4 K;  3N4P A;  4JKB A;  1NGH A;  4A57 A;  3CJ1 A;  3FFK B;  3O1W A;  4O0I A;  5TKY A;  3RTV A;  1ESV A;  4FLX A;  1ZBI A;  4AIL C;  4E0D A;  3AVB A;  1GLF O;  3F9M A;  1HQE A;  4CHZ A;  3SAG A;  4HUG A;  1LV5 A;  3P4I A;  1VQM N;  1U04 A;  1TKT A;  5AQS A;  4WCE L;  4I2P A;  2O8E A;  2OPS A;  1EKE A;  3CJ7 A;  4CJL A;  3KKS A;  2VWK A;  4FW1 A;  3V1R A;  2HHU A;  4C23 A;  3SAF A;  3CQ8 A;  4FJH A;  1U45 A;  1ITG A;  2WON A;  4DU4 A;  1NKC A;  4CF2 A;  3P5J A;  3I0S A;  4KHN A;  1YTU A;  4WFB L;  4H0X B;  4YOR A;  4H8K A;  2E2O A;  5I42 A;  5JS2 A;  4FK0 A;  1GOC A;  4RW7 A;  3VOV A;  4DF8 A;  3OS2 A;  3L8B A;  1GLB G;  3QIP A;  3RRG A;  3QML A;  4BRE A;  1JLF A;  4Z4H A;  1IKY A;  5CZ1 A;  5GIN A;  4HHT A;  3AY9 A;  1EET A;  4FJ9 A;  4FWP A;  4UY8 O;  1I39 A;  2D1K A;  1LAW A;  4YDU A;  5BR8 K;  2GWJ A;  3D2E B;  3G71 N;  4DSI A;  5C2D A;  1TUU A;  2A40 A;  3V9Z A;  1KQS M;  1Z26 A;  2NRX A;  3SV3 A;  3PSI A;  3PX0 A;  4CJ7 A;  4LF8 K;  1VSI A;  4EP4 A;  3W3D A;  4FWK A;  2IVN A;  4DU1 A;  2QKB A;  3AO2 A;  3M5R A;  3VQE A;  1S6P A;  4CGF A;  1XHX A;  1YTA A;  4DFK A;  2BH1 A;  4BDP A;  4AH9 A;  2YNF A;  3O3H A;  3I55 N;  3J80 O;  4PY5 A;  3OBY A;  3CFR A;  1BGX T;  4IG3 A;  4QAG A;  2HNZ A;  1ASV A;  3DLK A;  5AQV A;  5M1K A;  1T3V A;  3THX A;  3H3N O;  3SMS A;  1Z6R A;  1RBU A;  3CHW A;  4K8X A;  1KVB A;  4M3R A;  5HLF A;  3WNG A;  1NGF A;  4OPA A;  5AQG A;  3JAM O;  3J81 O;  3TAE A;  1M1K O;  1T7P A;  1NK0 A;  2QWN A;  3KJV A;  4CK3 A;  1XHZ A;  3SBT A;  1W97 L;  3SQ1 A;  4RWT A;  3CC7 N;  1S1X A;  2A5X A;  2QWM A;  3ZET B;  4YFU A;  4U67 L;  1YJW N;  4BR5 A;  4FWQ A;  5HRS A;  1E4F T;  4WQ4 C;  4KRF A;  1I3A A;  3O8M A;  4LFB K;  4KHP K;  1XC9 A;  3QEX A;  5AQK A;  1DTQ A;  3HSC A;  3VEZ A;  1VRU A;  2GUI A;  2GEM A;  1LOT B;  1SQK A;  3CET A;  3CXC M;  1RT1 A;  3LPU A;  5MLC Q;  5BRD A;  2B5J A;  4C8M A;  4CGI A;  3DXM B;  1TAQ A;  4DKW A;  5KRS A;  4X62 K;  2E6L A;  3ULE A;  2VWB A;  3D0P A;  5AJ3 K;  2RPI A;  3ID8 A;  4MFB A;  1NJW A;  1VRT A;  3OYA A;  4DQP A;  1NK7 A;  4HUF A;  5HL7 L;  1J9A A;  1J54 A;  2NRT A;  4K25 A;  2ETJ A;  2YJF A;  3K9K A;  4Z0U A;  3VQ4 A;  5AQW A;  3K57 A;  4F3T A;  4E89 A;  3CCJ N;  2X74 A;  3MN5 A;  3D2F B;  4F3O A;  4JKD A;  4F8R A;  2O8E B;  1KFD A;  3EYZ A;  2O8B A;  4B3M K;  3VQ6 A;  3QEP A;  4CZI A;  4CEB A;  4CZK A;  3HST B;  1Q9Y A;  1QQM A;  2HHT A;  3BDP A;  4DV2 K;  4KTZ A;  5C12 A;  3R3L A;  3MWT A;  4KHU A;  2OPQ A;  1VQ9 N;  4JK7 A;  1KAX A;  4KAZ A;  1R0A A;  3L2V A;  3OYI A;  2QTD A;  5KGX A;  4J8F A;  4OPJ A;  1X1P A;  4BRO A;  2YCH A;  2VG7 A;  4KH5 A;  4CHQ A;  1YVN A;  4JI2 K;  4KB0 A;  3TAP A;  3CC2 N;  4CBU A;  2Q0U A;  1E4G T;  2A41 A;  4R5P A;  2KW4 A;  2QXL A;  1VSM A;  2YKM A;  1S1V A;  2QWL A;  5AQP A;  3VTI A;  1K6Y A;  4M3W A;  2KLA A;  3EKS A;  1GLE G;  2ASP A;  5KPZ A;  2KFN A;  3TAM A;  2QW9 A;  4LF4 K;  5AQR A;  3M8S A;  1BG3 A;  3FE1 A;  4O44 A;  4YOU A;  5CE3 A;  3O80 A;  2Q31 A;  3THW A;  4CF1 A;  2Z1J A;  4CER A;  5BRE A;  3BZK A;  3M8R A;  2HVH A;  4A5B A;  5GAD P;  1M90 O;  4KHQ A;  4DR5 K;  4A5A A;  5BN8 A;  3CFO A;  2F8S A;  4DV3 K;  3WNF A;  3V1Q A;  4CF8 A;  4F2S A;  3OYN A;  4UQG A;  4CJK A;  1RBS A;  1S1U A;  4KB1 A;  3S41 A;  4BRK A;  1R59 O;  2NNW A;  1SUQ A;  4JEP A;  3M1F A;  4YY3 K;  3TI0 A;  3MXI A;  3E01 A;  4NXN K;  2V7Y A;  3HM9 A;  4ELU A;  3MAQ A;  3WXJ A;  1JL2 A;  1RCH A;  2XY8 A;  3PO4 A;  2WTU A;  2FBV A;  1RDW X;  3NVK A;  3O3G A;  1KXP A;  3QB0 A;  2P9N A;  4H5V A;  1ZBF A;  3OYM A;  1BOT O;  3TAB A;  4EP5 A;  3R1X A;  4IO9 L;  3NF9 A;  2O8D A;  5EXW A;  4CGH A;  1LCU A;  1U2V A;  4KH4 A;  1U48 A;  4ZTF A;  2YNH A;  4BRG A;  4KHW A;  3KLF A;  3UKU A;  5AFU A;  2QEX N;  4FZY A;  3THV A;  1NMD A;  3CJB A;  1TAU A;  1LW2 A;  3C65 A;  3QO9 A;  5FPM A;  4C8K A;  1KVC A;  3T1H K;  3J7A P;  4I9Q A;  4W5Q A;  3A5O C;  3NH2 A;  2OAN A;  3DXK B;  3F73 A;  3L3V A;  3AAR A;  3PSF A;  1TKD A;  4H5T A;  3TU5 A;  3UIQ A;  4AHS A;  1S9G A;  3MN6 A;  1NNE A;  1OVQ A;  3KD5 E;  1UAX A;  2BGG A;  4B9T A;  4J2A A;  3OW2 M;  1FKP A;  1ILY A;  1NGJ A;  2E8A A;  2HBM A;  3ZLJ A;  3IFR A;  3P1G A;  2ZJP L;  3DMJ A;  4CI6 A;  3CC4 N;  3SYZ A;  1J53 A;  1BIS A;  4ID5 A;  3MK6 A;  3WXI A;  3MWP A;  4M41 A;  2ZGZ A;  3SJJ A;  2O8F B;  3KK1 A;  4HTU A;  2Z1G A;  4B9M A;  4NYF A;  1RDU A;  4QS9 A;  4PKG A;  5E41 A;  3OYF A;  3HVR A;  2O8B B;  1HR0 K;  4IBN A;  1RBV A;  5ADX A;  4B1W B;  4JRQ A;  1KFS A;  1WUA A;  3NH0 A;  2IVP A;  3V4I A;  4LH4 A;  3OYK A;  5DM7 L;  5AQO A;  5K14 A;  3RMC A;  3ZX3 A;  3THY B;  1W9H A;  4GKK K;  2HHV A;  4HVJ A;  1C0M A;  3R8E A;  4H03 B;  4A62 A;  3ATU A;  1ASW A;  4CCH A;  4JI7 K;  3LAM A;  3OBW A;  5DM6 L;  3U6F A;  4NXM K;  4CFA A;  4WFA L;  2P5O A;  4M45 A;  3NGI A;  3LP2 A;  3CD6 N;  4FM2 A;  1FW6 A;  2O4I A;  4ISG A;  4CGJ A;  3L4Q A;  3U3G A;  4DTM A;  2FLO A;  1IG9 A;  4DTU A;  1ZXO A;  3ZT4 A;  4BE2 A;  3FGU A;  3ENO A;  4A59 A;  4MDA A;  3NFA A;  2Y1I A;  2Q36 A;  1G99 A;  4KO0 A;  3OYB A;  1UA1 A;  5KQD A;  4DSJ A;  3SQ2 A;  3VEV A;  4DS5 A;  3UB5 A;  3T69 A;  3PIO L;  1L3U A;  4ELV A;  2FC0 A;  4V19 S;  2V7Z A;  1QHT A;  3THW B;  2E88 A;  4FW2 A;  2NZT A;  4O0J A;  3SCX A;  4IG0 A;  4DQI A;  3ULD A;  3IUC A;  4BAC A;  4B1X B;  1WN7 A;  1QQN A;  4MLH A;  3CME N;  3O9U A;  4AQY K;  2D0B A;  2FSK A;  3AVF A;  3K5L A;  3CPE A;  4BDY A;  4MO5 A;  1NM1 A;  4DV4 K;  3LDS A;  3S3N A;  4JI4 K;  1GLA G;  1EWR A;  4OKE A;  2WFB A;  1MDU B;  4CEO A;  4PL8 A;  4N5S A;  3HZ6 A;  4RW9 A;  4XH5 A;  3ZSO A;  4DLG A;  4GVM A;  1U49 A;  1JJ2 M;  3LP0 A;  1D9F A;  2JWL A;  5HRP A;  3KKR A;  4DV7 K;  4B08 A;  3JSM A;  3NF6 A;  4E7K A;  3O5B A;  2OTJ N;  4NYN A;  2E2Q A;  3CG7 A;  1WSJ A;  1T8E A;  4IOC L;  1RT4 A;  2KKZ A;  1U2V B;  1KRP A;  3FZM A;  3PX6 A;  3VQ5 A;  3HOT A;  5FLX O;  3KHY A;  3OYE A;  2FXU A;  3AO3 A;  2CH6 A;  3RR8 A;  2B4J A;  4YDU C;  2ZJQ L;  4BQZ A;  4B9Q A;  3DRP A;  4BC5 A;  3RMD A;  1RGI A;  5KQ8 A;  4DSL A;  2OZS A;  3MDQ A;  3QET A;  3E9O A;  5FDL A;  1NK6 A;  3OYH A;  2GBZ A;  3DAW A;  1GOA A;  2P9P A;  3G0Z A;  1ZYQ A;  5C24 A;  1REV A;  4CJS A;  5HP1 A;  4FJG A;  3ASM A;  3OS1 A;  4DLE A;  3IRX A;  3C6T A;  5B8H A;  4CZE A;  2WUS A;  3PX4 A;  4GV9 A;  3SBG A;  3QIC A;  4Z4G A;  3TAQ A;  3WXK A;  3TTD A;  4AHU A;  2Q1N A;  3KWG A;  3P83 D;  3LDQ A;  2FF3 B;  2YHA A;  4KPY A;  1YIJ N;  4JHD A;  1Q7Y O;  1KAZ A;  5H1S Q;  4KHS A;  1VQ5 N;  1K8K B;  3QNN A;  2HHS A;  3S3M A;  4OJR A;  3CCS N;  1RBR A;  1BWF O;  4JK8 A;  3EL2 A;  5AQL A;  3WEE B;  3O9R A;  3OYL A;  3NE6 A;  2VQF K;  3VQP A;  1VSJ A;  1L3S A;  1HKC A;  4IDK A;  4IKF A;  4E1N A;  5J2Q A;  4FCY A;  1BA0 A;  4FLW A;  4Z4I A;  4W5O A;  2DPN A;  1YJN N;  1NKB A;  3VA0 A;  5ADX H;  4C8L A;  2HB5 A;  4IFV A;  2D0O A;  4FOE A;  2G8I A;  1HRH A;  3H1Q A;  4WFN L;  3KWI A;  5KGW A;  4B8C A;  3L6Q A;  5AQX A;  1U6Z A;  3K0S A;  2FF6 A;  4E1M A;  3ZSW A;  2PAV A;  3A5M C;  3EEQ A;  1EO1 A;  2IIR A;  4LF7 K;  3CQX A;  4CJ5 A;  4DR6 K;  4GV6 A;  3ZEU B;  4EHT A;  2G8F A;  4BRL A;  1KLM A;  5LMN K;  4F4K A;  3O1B A;  3DRR A;  2F9W A;  3CER A;  2YHY A;  4ILH A;  4FXD A;  3NCI A;  2LSN A;  3VN5 A;  3QEW A;  4DQ8 A;  4FPA A;  3WXL A;  3HPO A;  4DQR A;  3SQ4 A;  2P9I B;  4JRP A;  4CZL A;  4N47 A;  5AZI A;  3NHG A;  2ZJR L;  1HJO A;  4CD3 A;  2V51 B;  5AZJ B;  1NMN A;  1KC8 O;  1RDD A;  3SAH A;  4IOA L;  1YAG A;  1LAV A;  4FM0 A;  4OO1 J;  1X9S A;  2P9L B;  5EY4 A;  1YXQ A;  1RT2 A;  3ZX0 A;  1RTH A;  2P51 A;  3ENB A;  3K59 A;  3CCL N;  1S5J A;  3AA3 A;  1YJ9 N;  4CJW A;  4Z4E A;  1D5A A;  3KK3 A;  1MA9 B;  2W6L A;  2IC3 A;  4MO4 A;  5E84 A;  4X64 K;  1T6C A;  3JS6 A;  4B9V A;  5SZT A;  4IZ9 A;  1TYQ A;  3N4Q A;  4DU3 A;  2E2P A;  3QER A;  1NJZ A;  4GV3 A;  2W6K A;  2HW3 A;  1SAZ A;  4BRI A;  2HBL A;  2O8C B;  3V9U A;  1ZBL A;  1JLE A;  2XHB A;  3VGK A;  2D0C A;  2CGL A;  3LAL A;  5AR0 A;  4CJE A;  1WBD A;  3V6D A;  1TKZ A;  2QWP A;  4PHT X;  4BQL A;  4W5R A;  1L3T A;  4ILG B;  3ATV A;  4KRE A;  3KIO A;  5M1Q A;  1B92 A;  3NDK A;  5BRF A;  3LDL A;  3VQ8 A;  4FVM A;  3NMU A;  4M3U A;  4EFH A;  3C7N A;  4GNI A;  3TAR A;  3ZSX A;  1HNV A;  1OH7 A;  2G8U A;  1NK9 A;  3NGY A;  2WC9 A;  2IVO A;  2X6S A;  1YIT N;  1W7A A;  4JKE A;  2YX6 A;  4TSX A;  1JLB A;  3VQC A;  4CJU A;  2P9S B;  4JI1 K;  4BG8 A;  4IFE A;  4CES A;  3SUP A;  1YVU A;  3ZCM A;  2YNI A;  1MU2 A;  4K0K K;  2KTQ A;  4ILJ A;  3CJC A;  4PQU A;  4JHD B;  1T6D A;  5I3U A;  2E1Y A;  4E7H A;  2ZM6 K;  4BRQ A;  4B3O A;  1GLL O;  4DWI A;  3TSQ A;  4OGE A;  4YOW A;  4DTP A;  3BF3 A;  3I56 N;  4A2B A;  1QZ6 A;  4NLB A;  3QEI A;  5HBM A;  2HHW A;  3AO5 A;  4KI6 A;  1U47 A;  1NGD A;  4CED A;  4CEQ A;  3NVM A;  2XO7 A;  1WSE A;  1IBK K;  1HUX A;  4H0T B;  2I5J A;  3EZ5 A;  4H0Y B;  3LL3 A;  3QBW A;  3AVC A;  3PLA A;  1FJG K;  5A2Q O;  2HNY A;  1JLC A;  1OH5 A;  1C0T A;  2WOM A;  4XH4 A;  5BR9 A;  3DWL A;  3KK7 A;  2HF4 A;  1HYZ A;  1IG8 A;  1NGE A;  2QXF A;  4C8O A;  4IOX A;  2EWS A;  1NLV A;  4JD2 A;  4DF4 A;  3D7E O;  3V1O A;  2HBJ A;  4JI5 K;  1IV0 A;  4B8A B;  2PZS A;  4PL7 A;  4BRA A;  5GAH P;  1WBB A;  3U8X A;  3PUF A;  3EY1 A;  4BR0 A;  3DOL A;  1ZBU A;  1C0U A;  2G8W A;  3GL1 A;  3AAQ A;  4B9L A;  3SQ0 A;  2VWJ A;  5SWM A;  3CCR N;  3VTH A;  4DV0 K;  3AVL A;  3DLR A;  3HVT A;  4FLU A;  1KVA A;  4JKG A;  4JK9 A;  2E1Z A;  3DLE A;  3OS0 A;  4CEF A;  4Q0B A;  1X9M A;  3WNH A;  3LAK A;  2AJQ A;  3CPW M;  1Q18 A;  1QSY A;  4E7L A;  1XC3 A;  4JI0 K;  5EU7 A;  4M3Z A;  1TYQ B;  1W2B M;  1BQM A;  3JXU A;  5FRO A;  3BF1 A;  1JCG A;  3TTC A;  1GOB A;  1L5U A;  5AQQ A;  4JI8 K;  3CMA N;  4JKF A;  3RMA A;  5DK5 A;  3R9P A;  2E5L K;  5CR4 A;  3OJU A;  3FZL A;  3VEY A;  4I9L A;  4BRM A;  1RT5 A;  2JLE A;  1NK8 A;  3QBX A;  3LDP A;  1MWK A;  3IG1 A;  2O4G A;  4M7Y A;  1KCF A;  5FPE A;  5FPD A;  2FBY A;  4FJM A;  1BIZ A;  4LSL A;  2BTF A;  4BR9 A;  2YV0 X;  4CHP A;  4EHU A;  4LF9 K;  3MED A;  4IXC A;  3VEN A;  3F2K A;  3ISN C;  1O13 A;  3CJ9 A;  5M1F A;  3THX B;  1VQ7 N;  1HNZ K;  3UE5 A;  4FL9 A;  5EX5 A;  5JVH L;  3V9X A;  3RSE A;  4BR4 A;  4RCH A;  3WQT A;  5BPL A;  4DTR A;  5LMU K;  4DQQ A;  2DFH A;  3HRG A;  4U7B A;  4NLC A;  1SKW A;  1NGG A;  4BVO A;  2HMI A;  4CEE A;  4EAH D;  2OA8 A;  2OTL N;  3K58 A;  4FLY A;  3VF2 A;  4HUE A;  2E4L A;  4B3R K;  3ID6 A;  4DV1 K;  4N76 A;  4FZX C;  4L3Q A;  2IGI A;  1XQS C;  3TAF A;  3IKM A;  5JLF A;  4CZF A;  1XMO K;  1FK9 A;  4M63 C;  5M1O A;  4AHR A;  4LY7 A;  3OY9 A;  4N56 A;  2ZF5 O;  3ZSZ A;  5E26 A;  3TR8 A;  3LWM A;  1TK0 A;  4C1N I;  1BU6 O;  4WQ4 A;  4CJT A;  2Y1J A;  1VSD A;  1XUP O;  3QFU A;  4WE1 A;  2OZM A;  4CFC A;  2HST A;  3EO3 A;  2F7T A;  1VHX A;  1FKO A;  4KV8 A;  3DRS A;  2IDO A;  2QWQ A;  3S9H A;  1WSH A;  3AVG A;  5J2N A;  1KTQ A;  2UU9 K;  5AQH A;  4GKJ K;  3ULE B;  1S1T A;  4LC9 B;  4XH1 A;  4CIF A;  2IOC A;  1E3M A;  3ZT3 A;  1UOC A;  4JNE A;  3TTF A;  2HMP A;  2RKI A;  3H3O B;  1HQU A;  1J6Z A;  4FSV A;  5KPR A;  1JLA A;  3NBP A;  3ZT0 A;  2KHO A;  4Y0W A;  5AQF A;  4FJ7 A;  5C25 A;  1UWB A;  3SMP A;  2ITM A;  1IO2 A;  3AV9 A;  1T05 A;  2P9K A;  3PO5 A;  4BVP A;  3ZT1 A;  3AO4 A;  3MXM A;  1T44 A;  2GX9 A;  1IBL K;  3T1A A;  3SLC A;  1HYS A;  3BZC A;  1WOQ A;  2QK9 A;  1RDA A;  4WQ5 C;  1RTJ A;  4PWD A;  4BC2 A;  2EX3 A;  5LY3 A;  1N32 K;  4CFD A;  2YI1 A;  1NGB A;  3HBT A;  4DTX A;  2HF3 A;  2RE2 A;  3MXJ A;  4HTL A;  4G1Q A;  1YHQ N;  3E9P A;  3WUH A;  2X6N A;  1UA0 A;  1QQC A;  3M8P A;  4BDZ A;  1KLN A;  1QZ5 A;  4DG1 A;  4HCB A;  4JKG B;  1RT3 A;  1IBM K;  3HP6 A;  4BC4 A;  1N5Y A;  4FJX A;  4QCL A;  2ASO A;  5LJV A;  1JCF A;  4K41 A;  3P38 A;  2R7Y A;  3OYG A;  4CZG A;  3VES A;  1GLC G;  3HXM A;  4FK4 A;  5BN9 A;  3O3F A;  2E6M A;  3SZ2 A;  4R79 A;  3GG4 A;  4FLT A;  3T7Z A;  3MCP A;  3VA3 A;  2XY6 A;  4FWL A;  2HND A;  1JKH A;  4H0P A;  1EX4 A;  2YHX A;  1ASU A;  4E7J A;  5JS1 A;  1C0G A;  1DTT A;  3EN9 A;  1RTD A;  3H1V X;  5BPM A;  3KLI A;  4LF6 K;  1YUW A;  3HYF A;  1B9D A;  2UYT A;  4CJP A;  1S72 N;  2Z1I A;  4DR7 K;  4KH6 A;  4FJN A;  2PYL A;  3FFI A;  4B9N A;  3HL8 A;  1WSF A;  4KBO A;  1RFQ A;  4CBX A;  4O4G A;  4BRN A;  2NRW A;  1Y64 A;  1LWF A;  3MCA B;  1VAZ A;  4IJA A;  3O4N A;  4YOY A;  2YJE A;  5AQN A;  3KVG A;  3IAY A;  2KFZ A;  4FJL A;  4CJF A;  1D4X A;  1HNW K;  4H5R A;  5BPN A;  3VF6 A;  3RSE B;  3I8D A;  4X66 K;  1A5W A;  3GBT A;  5KTQ A;  4ID1 A;  4DSE A;  4G9Z A;  4ELT A;  4BGA A;  4FJK A;  4JV5 K;  1C6V A;  2OPR A;  4BGB A;  2P9N B;  4YOT A;  2NRV A;  5J2P A;  4IJN A;  5FRN A;  1N33 K;  2OPP A;  1N8R O;  4JLH A;  3SUQ A;  3CF5 L;  2O8D B;  1H1V A;  3LDN A;  5AQJ A;  3AVJ A;  5CHI A;  5FPN A;  5M1P A;  4CHN A;  3MX2 A;  2A1S A;  3RMB A;  4CZM A;  3UKU B;  4ZHR A;  1Y97 A;  4CE9 A;  3AA5 X;  5M1N A;  4C1N K;  2AP1 A;  4GVE A;  5GAG P;  2NLX A;  1BQN A;  1NG9 A;  1P90 A;  4JAX A;  3O08 A;  4JI6 K;  3HO1 A;  1OKJ A;  2A3Z A;  3SUN A;  3OA9 A;  1YI2 N;  4CJV A;  3HT3 A;  1KD1 O;  1BCM A;  4MLE A;  5C42 A;  3TWH A;  1RT6 A;  1ZBS A;  4OGC A;  2V52 B;  3Q7C A;  2UUB K;  3MEE A;  2DY4 A;  4LFA K;  4DTO A;  3QIN A;  3SPY A;  2P5G A;  4BRP A;  1OH8 A;  2ZGY A;  3HOS A;  4DUY K;  3C95 A;  1ZBH A;  2D4W A;  3B6O A;  1BUP A;  2PBD A;  4K8Z A;  3HJF A;  3QES A;  3I0R A;  3SPZ A;  3TSU A;  3MEG A;  4DR1 K;  4B3T K;  1VSF A;  1XNR K;  1P8Z A;  3ITH A;  1NKE A;  3TAG A;  3DM2 A;  3LP3 A;  4KTQ A;  2Q0R A;  4OX9 K;  3LM9 A;  3NF8 A;  3KK2 A;  3K5O A;  3AVI A;  1LW0 A;  4RW8 A;  1BIU A;  3KZB A;  4CZH A;  2OYQ A;  2HHQ A;  3ZET A;  3CJA A;  4EIA A;  3O9S A;  4CJ3 A;  3CCQ N;  1HNI A;  1QHA A;  5KRT A;  1BDG A;  3GE1 A;  4CK1 A;  4J2B A;  5AQM A;  3QDK A;  1HMV A;  4O8K A;  4CF0 A;  2UXD K;  1C1C A;  3LM2 A;  3RRH A;  3RWU A;  2FBX A;  5C0Y A;  1EXQ A;  1VQK N;  1HKG A;  3H08 A;  1D9D A;  1HLU A;  3S3O A;  1KSP A;  4FVU A;  1S6Q A;  3LPT A;  3DXM A;  4Z94 A;  4DR2 K;  1K8A O;  1V4T A;  1EWQ A;  1S1W A;  2AA4 A;  4BWM A;  4CJ4 A;  3AVN A;  4ISF A;  4BR7 A;  4FJI A;  2HOE A;  4BWJ A;  3J7Z O;  3VER A;  1NBW A;  1TGO A;  3DI6 A;  1BA1 A;  2VCP A;  4H0O A;  1OH6 A;  4LH5 A;  2BAN A;  4KHY A;  1DT9 A;  5JMV A;  2RF2 A;  3EE8 A;  4CVN E;  3CM6 A;  3U9Z A;  3MN7 A;  3C94 A;  5AQZ A;  3AO1 A;  5C15 A;  3UKR A;  2XY5 A;  1K9M O;  3SV4 A;  3D2F A;  1BI4 A;  1NOY A;  4NB4 A;  4CEZ A;  4PKH A;  4DB3 A;  4FZZ A;  3OHR A;  2H3G X;  3VPZ A;  4BRH A;  1TVR A;  4I6M A;  2F96 A;  1J5E K;  1VQ8 N;  1NGC A;  1NGI A;  1RTI A;  3C6A A;  4AHC A;  2PFU A;  4W5T A;  2B6A A;  4DHY A;  2FSN A;  2ASM A;  2G8V A;  2NRZ A;  3OJS A;  4B1Z A;  4FLV A;  1QVF M;  1QTM A;  4AM6 A;  3VQ7 A;  2NRR A;  1U4B A;  1JL1 A;  3BEX A;  5GAE P;  1ATR A;  4N41 A;  3L0Q A;  1SL1 A;  2YHW A;  1VQN N;  4BRF A;  1GLD G;  3FZH A;  3K5M A;  1C0F A;  5LJW A;  4CF9 A;  3DLL L;  1VK0 A;  4JKC A;  1HPZ A;  4CD1 A;  4MDB A;  5HOO A;  1WAF A;  3NF7 A;  4JKA A;  2P9P B;  2P9U A;  4E3S A;  1X3M A;  3DLH A;  2QWO A;  1RBT A;  3QNO A;  4C8N A;  3A0I X;  1QQO A;  1RIL A;  3SI6 A;  2VGM A;  3WQU A;  4CEA A;  3VMF B;  4J2D A;  3H6E A;  3NAE A;  2J4R A;  1OVY A;  3HK2 A;  1IKW A;  1X9W A;  2RN2 A;  3M8Q A;  3B8A X;  3ZYY X;  5BRH A;  3SUO A;  1RT7 A;  1HX1 A;  3FZF A;  3WNE A;  2GTD A;  4FWN A;  4H4O A;  1DGK N;  4BR2 A;  3TPQ A;  2ZD1 A;  5HRR A;  2Z1H A;  1XI1 A;  4E7I A;  3MMV A;  1Z05 A;  4RW6 A;  2G8K A;  3RVC A;  2JGU A;  3HPG A;  3CI5 A;  4FPB A;  3PV8 A;  2ZWH A;  2UXC K;  3OYC A;  4M42 A;  4OKJ A;  4BRD A;  2QWR A;  3C0B A;  3ZSQ A;  5CYQ A;  3GOI A;  1QSL A;  4IEI A;  1HPM A;  2OCE A;  1N36 K;  5IWA K;  2QM1 A;  3L2R A;  3O4Q A;  2KZZ A;  4OPH A;  3NH1 A;  4CBW A;  2E20 A;  4FJ5 A;  1WSG A;  1HKB A;  3E66 A;  4F9O A;  2HVI A;  1IKX A;  4E19 A;  2KZM A;  4CK2 A;  4PA1 A;  3G4S N;  4I7F A;  4OPK A;  3J8A A;  1SKS A;  5IT9 O;  1LWE A;  1SZ2 A;  5AQU A;  1MWM A;  4E1J A;  3DXK A;  1RNH A;  2QA4 N;  1NJY A;  4OLB A;  4FWS A;  1SL0 A;  2BE2 A;  3C6U A;  5AZI B;  4CIG A;  1A5V A;  3VQD A;  1WSI A;  3VET A;  1JCE A;  1EP4 A;  4YNQ A;  3SK3 A;  4B1V A;  3HM8 A;  3CM5 A;  2D0P A;  2I7P A;  3VEX A;  3AVM A;  3V81 A;  1Q9X A;  2X78 A;  2VG5 A;  1T03 A;  4B1U B;  3UKR B;  3G10 A;  1BI4 B;  1CZB A;  3ZSV A;  3ALY A;  3P39 A;  4DFP A;  4DSK A;  2O8F A;  3CFP A;  2ATQ A;  4I6M B;  3AGR A;  4BE1 A;  1Q86 O;  4CZJ A;  1NK4 A;  3F5T A;  1TUY A;  4DCH A;  3AA2 A;  4KKO A;  1JXE A;  1XWL A;  3THY A;  1VQ6 N;  1TV6 A;  1SKR A;  3VQB A;  3MN9 A;  1XNQ K;  5DMR A;  4ISE A;  4QOZ B;  4WYB A;  5JVG L;  3KTQ A;  4CJQ A;  2NUB A;  3A8Y A;  3DOK A;  3J7Y P;  3O9T A;  2XY7 A;  4LF5 K;  1VQO N;  4HCC A;  2YNG A;  2WBN A;  4IO8 A;  4NCG A;  3HTV A;  4CHO A;  4DMN A;  1VSK A;  3D6R A;  1ATS A;  3EKU A;  4YHH K;  2DFE A;  2A6A A;  1SS6 A;  1VQP N;  1TKX A;  3I8B A;  4Z4C A;  2CGJ A;  3LAN A;  4CHY A;  4O55 A;  3C7N B;  2BDP A;  3AAP A;  4EZ9 A;  2P9U B;  4J2E A;  3DJC A;  3Q7B A;  4M3X A;  4NCB A;  4JN4 A;  1CZA N;  4CGD A;  2GEL A;  1Z25 A;  4HWI A;  3F9K A;  4OKK A;  4B3S K;  1LWC A;  2I7N A;  4Y1C A;  3HP9 A;  4ZTJ A;  5F0X A;  3OTO K;  2DTU A;  5J1E A;  2FBT A;  5JLH A;  5C10 A;  4OLA A;  2Q97 A;  5EVZ A;  4K42 A;  4FK2 A;  4F2R A;  3OVN A;  4PKI A;  4JS5 A;  3L2Q A;  4B9U A;  2D0A A;  3T1Y K;  5HRN A;  5CZ2 A;  3LWL A;  3K2P A;  3O9Q A;  4Y1D A;  1Q81 O;  2UUA K;  2HHX A;  1JLG A;  4IFY A;  4MQ3 A;  3AGK A;  2A42 A;  3HI0 A;  3KLG A;  3ZSR A;  4GY2 B;  3IDH A;  2F8T A;  4CGG A;  2UUC K;  2VQE K;  4B1Y B;  4DFM A;  5T7B A;  5ELZ A;  1NK5 A;  2PYJ A;  1QSS A;  4H5W A;  2W41 A;  4NO7 A;  3VQQ A;  4W5N A;  3IS9 A;  3AVH A;  4FWO A;  1S22 A;  1DEJ A;  4AHT A;  2NRH A;  2VG6 A;  4O5F A;  2JWK A;  4LSN A;  3W0L A;  1IH7 A;  3O6W A;  3GDQ A;  2PY5 A;  4PUO A;  1NGA A;  2KQ2 A;  4IDH A;  3VEW A;  5D3G A;  2YKN A;  3L2W A;  5GIO A;  3FLC O;  4JS4 A;  3VQ9 A;  4FO0 A;  3NGZ A;  2W42 A;  4GMJ B;  1TK8 A;  2F4V K;  2GUP A;  3L3U A;  3FZK A;  4L8R B;  2QKK A;  1QE1 A;  3K9J A;  3PIP L;  3CCU N;  4Z4F A;  1KAY A;  4JD2 B;  3BY5 A;  2Q3S A;  1J5O A;  1NOZ A;  3AVK A;  1F21 A;  1N6Q A;  2UXB K;  1HYV A;  2ITG A;  5I9E B;  1L3V A;  1BL3 A;  1A5X A;  4AF1 A;  1G15 A;  4M3Y A;  3A5N C;  3VF4 A;  3T19 A;  1CZ9 A;  2HHH K;  4Q5V A;  2BUP A;  4XEI A;  3OYJ A;  4WF9 L;  1IKV A;  3QEV A;  3LZJ A;  5AQY A;  3U4L A;  4IEE A;  1ATN A;  1K8K A;  3T3F A;  3HPH A;  1TK5 A;  4H5N A;  1Q8I A;  2GV9 A;  1C1B A;  2CH5 A;  4FJ8 A;  3KLE A;  1HNX K;  3WEE A;  4FJJ A;  4DTJ A;  4M7X A;  3TAN A;  4BE0 A;  4DV5 K;  4H0V B;  3MEC A;  5EOY A;  3QIO A;  4KTW A;  1WLJ A;  3WXM B;  3WT0 A;  5F2R A;  3DYA A;  3LDO A;  1SL2 A;  4FLZ A;  3BUZ B;  1NWK A;  4ICL A;  2GWK A;  3VGL A;  4DUZ K;  4NCA A;  3ZEU A;  2RHK A;  4BG9 A;  4DFJ A;  5CY4 A;  2ZQB A;  1X3N A;  4KFB A;  4DR3 K;  1HJR A;  3CCM N;  1S9E A;  1QVG M;  4I2Q A;  3SNN A;  5F1X A;  1D8Y A;  3RR7 A;  3QFP A;  3EZW A;  2VYP A;  2P9I A;  5GIP A;  1EQY A;  1FXX A;  2E2N A;  5AQT A;  3G6E N;  3IMX A;  5AZJ A;  5JIC A;  1SV5 A;  2FSJ A;  3G25 A;  4K43 A;  2VGN A;  4OVL A;  4A2A A;  2QI2 A;  2IAJ A;  3A5L C;  3CQY A;  2P9L A;  4CW7 B;  1VQ4 N;  1CLQ A;  1C1A A;  4H4M A;  1TL3 A;  4QS8 A;  1WNS A;  1VSE A;  2YHB A;  5J2M A;  3M6G A;  2G8H A;  4FWR A;  1NJI O;  4BY9 C;  4JI3 K;  3JYT A;  4AM7 A;  4DTN A;  3H46 O;  2DFF A;  1XMQ K;  1W0H A;  2O8C A;  3R6M A;  3L4I A;  3O4W A;  3P31 A;  4EZ6 A;  5KPT A;  4QS7 A;  4CIE A;  1RDB A;  1YT3 A;  4LD0 A;  3MX5 A;  1CXQ A;  3D2E A;  3L2U A;  4DSF A;  1Q82 O;  4M3T A;  4YOV A;  1N34 K;  4RW4 A;  1GLJ O;  2XRI A;  4CEC A;  1RDC A;  2ZE2 A;  4CFB A;  3AVA A;  4XIU A;  5AQI A;  3A2F A;  2CGK A; 
#chains in the Genus database with same CATH homology
 3DLR A;  3HVT A;  3VQ7 A;  3KD1 E;  4FLU A;  1U4B A;  1JL1 A;  4N41 A;  1KVA A;  1SL1 A;  3DLE A;  3P1G A;  3OS0 A;  3DMJ A;  4CEF A;  1JXB A;  3SYZ A;  4Q0B A;  2A1R A;  1J53 A;  1X9M A;  1BIS A;  3LAK A;  3WNH A;  4ID5 A;  3K5M A;  2AJQ A;  1QSY A;  4E7L A;  4CF9 A;  4M41 A;  1VK0 A;  3SJJ A;  3KK1 A;  4HTU A;  1HPZ A;  2Z1G A;  4B9M A;  4NYF A;  1DLO A;  3ZSY A;  3K5N A;  5EU7 A;  5E41 A;  3B6P A;  3OYF A;  1CXU A;  3HVR A;  3PY8 A;  1BQM A;  1NJX A;  4M3Z A;  4IBN A;  1WAF A;  1RBV A;  2IS3 A;  5FRO A;  4JRQ A;  1O1W A;  1KFS A;  3NF7 A;  3NH0 A;  3V4I A;  4LH4 A;  1GOB A;  1L5U A;  4E3S A;  3U3Y A;  3OYK A;  3RMA A;  5DK5 A;  3DLH A;  1RBT A;  3DLG A;  5K14 A;  3VQA A;  3QNO A;  1B9F A;  4C8N A;  1W9H A;  4DTS A;  3RMC A;  2HHV A;  4HVJ A;  1C0M A;  3D45 A;  2HVI A;  3CYM A;  1RIL A;  1ASW A;  4CCH A;  3LAM A;  3AA4 A;  3OJU A;  3SI6 A;  3U6F A;  1WAJ A;  4CEA A;  4CFA A;  4I9L A;  3V9W A;  4J2D A;  3LZI A;  2P5O A;  3ZT2 A;  1RT5 A;  4M45 A;  1TK8 A;  2JLE A;  3NAE A;  1NK8 A;  3HK2 A;  2D5R A;  3KD5 E;  1IKW A;  3LP2 A;  3NGI A;  1X9W A;  4DQS A;  3IG1 A;  2RN2 A;  2O4G A;  3M8Q A;  4RG8 A;  4FM2 A;  3SUO A;  1KCF A;  1VSL A;  1RT7 A;  2O4I A;  4CGJ A;  3WNE A;  5HRO A;  3U3G A;  4DTM A;  2FBY A;  4H4O A;  1IG9 A;  4FM1 A;  4FJM A;  4DTU A;  1BIZ A;  3BGR A;  3LP1 A;  4LSL A;  1VSH A;  4B9S A;  2YV0 X;  3ZT4 A;  4CHP A;  4BE2 A;  2ZD1 A;  1QS4 A;  5HRR A;  3KLH A;  3MED A;  3V9S A;  4GW6 A;  2Z1H A;  1XI1 A;  4E7I A;  3ISN C;  3DLB A;  4RW6 A;  3NFA A;  5KI6 A;  2G8K A;  2Y1I A;  1JLQ A;  2JGU A;  4KO0 A;  3OYB A;  4AHV A;  3HPG A;  1UA1 A;  1TL1 A;  4DSJ A;  4KI4 A;  3SQ2 A;  4DS5 A;  3PV8 A;  3V9X A;  1L3U A;  3QLH A;  3OYC A;  2FC0 A;  4OKJ A;  4ELV A;  4M42 A;  1QHT A;  4DTR A;  2P1J A;  2DFH A;  4FW2 A;  3ZSQ A;  4DQQ A;  4O0J A;  1BHL A;  5CYQ A;  3OYD A;  4O5B A;  3SCX A;  4FYD A;  1QSL A;  4DS4 A;  4IG0 A;  4CJR A;  4DQI A;  3ULD A;  1SKW A;  1BCO A;  4BAC A;  2HMI A;  4CEE A;  1WN7 A;  2OA8 A;  5FRM A;  3K58 A;  4FLY A;  2EHG A;  3L2R A;  3O4Q A;  4HUE A;  2E4L A;  5CYM A;  4N76 A;  4FZX C;  2KZZ A;  2IGI A;  3NH1 A;  4O0I A;  3TAF A;  2D0B A;  3AVF A;  3RTV A;  1FK9 A;  1WSG A;  4AHR A;  3K5L A;  4FLX A;  4FJ5 A;  1IKX A;  4AIL C;  4E0D A;  4LY7 A;  4E19 A;  1ZBI A;  3OY9 A;  2KZM A;  3AVB A;  4CK2 A;  4N56 A;  4BDY A;  4PA1 A;  3ZSZ A;  3LDS A;  1HQE A;  3TR8 A;  4I7F A;  4OPK A;  4CHZ A;  3LWM A;  3S3N A;  1TK0 A;  2Y1J A;  4CJT A;  4HUG A;  1SKS A;  4OKE A;  1LV5 A;  1VSD A;  1LWE A;  4CEO A;  4N5S A;  4RW9 A;  3ZSO A;  1U04 A;  1TKT A;  4WE1 A;  2OZM A;  4DLG A;  4CFC A;  4GVM A;  4I2P A;  1U49 A;  1RNH A;  2OPS A;  1EKE A;  3LP0 A;  1FKO A;  1D9F A;  4KV8 A;  1NJY A;  3DRS A;  2IDO A;  4CJL A;  5HRP A;  3KKS A;  3S9H A;  3KKR A;  4OLB A;  2VWK A;  1WSH A;  4FW1 A;  3AVG A;  1SL0 A;  2BE2 A;  3C6U A;  4CIG A;  3V1R A;  4B08 A;  3JSM A;  3NF6 A;  4E7K A;  2HHU A;  1A5V A;  3CQ8 A;  3VQD A;  1KTQ A;  4NYN A;  1WSI A;  1ITG A;  5J2N A;  1U45 A;  4FJH A;  3CG7 A;  1WSJ A;  2WON A;  1T8E A;  1EP4 A;  1S1T A;  4YNQ A;  4DU4 A;  1NKC A;  1RT4 A;  4CF2 A;  3P5J A;  3I0S A;  2IOC A;  3CM5 A;  4CIF A;  4KHN A;  3ZT3 A;  1KRP A;  3PX6 A;  1YTU A;  3VQ5 A;  1UOC A;  3AVM A;  3V81 A;  1Q9X A;  2RKI A;  3OYE A;  3AO3 A;  1HQU A;  2X78 A;  2VG5 A;  1T03 A;  1JLA A;  3NBP A;  4H8K A;  3ZT0 A;  3RR8 A;  5I42 A;  2B4J A;  3G10 A;  1BI4 B;  5JS2 A;  1CZB A;  3ZSV A;  4FJ7 A;  1GOC A;  4FK0 A;  3DRP A;  4RW7 A;  5C25 A;  1UWB A;  3ALY A;  4DFP A;  1IO2 A;  3AV9 A;  1T05 A;  3CFP A;  4DSK A;  3PO5 A;  2ATQ A;  4DF8 A;  3OS2 A;  3L8B A;  3ZT1 A;  3AO4 A;  3RMD A;  3QIP A;  3MXM A;  4DSL A;  3RRG A;  4BE1 A;  2OZS A;  3T1A A;  1JLF A;  1HYS A;  4Z4H A;  3QET A;  1IKY A;  5CZ1 A;  5FDL A;  1NK4 A;  4HHT A;  1NK6 A;  3OYH A;  2GBZ A;  1EET A;  2QK9 A;  1RDA A;  4FJ9 A;  1GOA A;  3G0Z A;  1ZYQ A;  1I39 A;  3AA2 A;  4KKO A;  5C24 A;  1REV A;  4CJS A;  1LAW A;  1RTJ A;  5HP1 A;  4FJG A;  4PWD A;  1JXE A;  2EX3 A;  3ASM A;  3OS1 A;  4DLE A;  1XWL A;  3IRX A;  4DSI A;  3C6T A;  1TV6 A;  4CFD A;  1SKR A;  3PX4 A;  3VQB A;  4DTX A;  3V9Z A;  3MXJ A;  5DMR A;  4G1Q A;  1Z26 A;  4Z4G A;  4QOZ B;  3TAQ A;  3KTQ A;  2X6N A;  1UA0 A;  3SV3 A;  1QQC A;  4AHU A;  3M8P A;  4CJQ A;  4BDZ A;  3PX0 A;  4DG1 A;  1KLN A;  4HCB A;  2NUB A;  1VSI A;  3P83 D;  1RT3 A;  3DOK A;  4EP4 A;  3HP6 A;  2XY7 A;  2YHA A;  4KPY A;  1N5Y A;  4HCC A;  2YNG A;  4FJX A;  4QCL A;  4NCG A;  4CHO A;  4DU1 A;  2QKB A;  2R7Y A;  4DMN A;  1VSK A;  3AO2 A;  3OYG A;  3VQE A;  1S6P A;  4KHS A;  4CGF A;  3HXM A;  1XHX A;  1YTA A;  2DFE A;  3O3F A;  3QNN A;  1KSP A;  4FK4 A;  2HHS A;  3S3M A;  2E6M A;  4OJR A;  1TKX A;  1RBR A;  3SZ2 A;  4DFK A;  4BDP A;  4AH9 A;  2YNF A;  3LAN A;  4Z4C A;  4CHY A;  3O3H A;  4FLT A;  4O55 A;  2BDP A;  4PY5 A;  3VA3 A;  3CFR A;  2XY6 A;  1BGX T;  4IG3 A;  4QAG A;  3OYL A;  3NE6 A;  2HND A;  1ASV A;  1JKH A;  2HNZ A;  3DLK A;  4EZ9 A;  3VQP A;  4J2E A;  1VSJ A;  1EX4 A;  1L3S A;  4IDK A;  4IKF A;  4M3X A;  4NCB A;  4E1N A;  1QTM A;  4CGD A;  5J2Q A;  1Z25 A;  1ASU A;  3F9K A;  4E7J A;  5JS1 A;  1RBU A;  4OKK A;  4FCY A;  4FLW A;  4K8X A;  4Z4I A;  1KVB A;  4M3R A;  5HLF A;  3WNG A;  4W5O A;  1DTT A;  1NKB A;  3VA0 A;  1LWC A;  3TAE A;  4C8L A;  1RTD A;  2HB5 A;  3HP9 A;  4IFV A;  4Y1C A;  4ZTJ A;  1T7P A;  3KLI A;  1NK0 A;  5J1E A;  2FBT A;  3KJV A;  4CK3 A;  1XHZ A;  2DTU A;  4OLA A;  3HYF A;  3SQ1 A;  2G8I A;  1B9D A;  1HRH A;  4FK2 A;  4F2R A;  4CJP A;  5KGW A;  3OVN A;  4B8C A;  2Z1I A;  1S1X A;  3L2Q A;  4JS5 A;  4B9U A;  4YFU A;  4FJN A;  2PYL A;  3FFI A;  2D0A A;  4E1M A;  3ZSW A;  4B9N A;  3HL8 A;  1WSF A;  5HRN A;  5HRS A;  5CZ2 A;  3LWL A;  4CJ5 A;  4KRF A;  1I3A A;  3K2P A;  4O4G A;  4Y1D A;  2G8F A;  1LWF A;  2HHX A;  1JLG A;  1XC9 A;  1KLM A;  4IFY A;  4MQ3 A;  3QEX A;  1DTQ A;  3O4N A;  4F4K A;  3KLG A;  3DRR A;  3ZSR A;  2F8T A;  2KFZ A;  4CGG A;  3IAY A;  4FXD A;  3NCI A;  2LSN A;  1VRU A;  2GUI A;  3VN5 A;  4DFM A;  4FJL A;  4CJF A;  3QEW A;  5T7B A;  1RT1 A;  3LPU A;  3HPO A;  3SQ4 A;  4DQR A;  1NK5 A;  2PYJ A;  1QSS A;  2B5J A;  3I8D A;  4JRP A;  1A5W A;  3VQQ A;  4N47 A;  4C8M A;  5KTQ A;  4ID1 A;  4DSE A;  4CGI A;  4ELT A;  4W5N A;  3IS9 A;  3AVH A;  3NHG A;  4FJK A;  1TAQ A;  1C6V A;  2OPR A;  5KRS A;  2E6L A;  1RDD A;  4AHT A;  2VG6 A;  3D0P A;  2RPI A;  1LAV A;  4MFB A;  4FM0 A;  1NJW A;  1VRT A;  4LSN A;  1IH7 A;  1X9S A;  3OYA A;  5J2P A;  4DQP A;  1NK7 A;  5FRN A;  1RT2 A;  4HUF A;  1J9A A;  2OPP A;  1J54 A;  2KQ2 A;  2PY5 A;  4PUO A;  1RTH A;  4JLH A;  3SUQ A;  5D3G A;  2P51 A;  2YKN A;  2ETJ A;  3L2W A;  3K59 A;  3AVJ A;  4JS4 A;  4Z0U A;  3VQ9 A;  3VQ4 A;  1S5J A;  3NGZ A;  3AA3 A;  4GMJ B;  2A1S A;  4CHN A;  2W42 A;  3K57 A;  4CJW A;  3RMB A;  4ZHR A;  4F3T A;  4Z4E A;  1D5A A;  1Y97 A;  3L3U A;  4CE9 A;  3KK3 A;  4L8R B;  3AA5 X;  4E89 A;  2IC3 A;  2X74 A;  2QKK A;  1QE1 A;  4Z4F A;  4F3O A;  4F8R A;  2Q3S A;  1BQN A;  1J5O A;  4B9V A;  1NOZ A;  5SZT A;  3AVK A;  1KFD A;  4DU3 A;  1F21 A;  3EYZ A;  3QER A;  1NJZ A;  1N6Q A;  3VQ6 A;  1HYV A;  3HO1 A;  2ITG A;  3QEP A;  1L3V A;  2HW3 A;  3SUN A;  1BL3 A;  1A5X A;  4CEB A;  1G15 A;  3HST B;  1Q9Y A;  2HHT A;  3V9U A;  1ZBL A;  1JLE A;  2XHB A;  4M3Y A;  4CJV A;  3HT3 A;  3T19 A;  1BCM A;  3BDP A;  2D0C A;  1CZ9 A;  4KTZ A;  5C42 A;  3TWH A;  4KHU A;  1RT6 A;  4OGC A;  2OPQ A;  3LAL A;  4CJE A;  3V6D A;  1TKZ A;  4Q5V A;  3OYJ A;  3MEE A;  2DY4 A;  4KAZ A;  4DTO A;  1R0A A;  3L2V A;  4W5R A;  1IKV A;  3OYI A;  1L3T A;  5KGX A;  3QIN A;  3QEV A;  3SPY A;  4OPJ A;  3LZJ A;  3KIO A;  1X1P A;  2P5G A;  4KRE A;  1B92 A;  1ZBH A;  3C95 A;  3NDK A;  3VQ8 A;  3T3F A;  2VG7 A;  3B6O A;  3HPH A;  4FVM A;  4CHQ A;  1TK5 A;  4K8Z A;  3HJF A;  4M3U A;  3QES A;  1Q8I A;  2GV9 A;  4KB0 A;  1C1B A;  4FJ8 A;  3I0R A;  3SPZ A;  3TAP A;  3MEG A;  3KLE A;  1VSF A;  3ZSX A;  3TAR A;  3ITH A;  4FJJ A;  4R5P A;  4DTJ A;  3TAN A;  1HNV A;  2KW4 A;  2YKM A;  1VSM A;  2G8U A;  4BE0 A;  1NK9 A;  3NGY A;  3TAG A;  1NKE A;  3DM2 A;  1S1V A;  3LP3 A;  1K6Y A;  4KTQ A;  2X6S A;  4M3W A;  2KFN A;  3NF8 A;  4TSX A;  3TAM A;  1JLB A;  3VQC A;  4CJU A;  3MEC A;  3QIO A;  3KK2 A;  3K5O A;  4KTW A;  1WLJ A;  4CES A;  3SUP A;  1YVU A;  3ZCM A;  2YNI A;  1MU2 A;  3AVI A;  3M8S A;  2KTQ A;  1LW0 A;  4O44 A;  3DYA A;  4RW8 A;  1BIU A;  4CF1 A;  2Z1J A;  4CER A;  2OYQ A;  4PQU A;  2HHQ A;  3M8R A;  4FLZ A;  4E7H A;  5I3U A;  1SL2 A;  2HVH A;  4KHQ A;  4ICL A;  4B3O A;  4DWI A;  4NCA A;  4CJ3 A;  3CFO A;  2F8S A;  1HNI A;  4OGE A;  3WNF A;  3V1Q A;  4CF8 A;  4DTP A;  4F2S A;  3OYN A;  4UQG A;  4CJK A;  3QEI A;  5HBM A;  4DFJ A;  2HHW A;  5KRT A;  5CY4 A;  1RBS A;  2ZQB A;  1S1U A;  3AO5 A;  4KFB A;  4CK1 A;  4KB1 A;  4J2B A;  1HJR A;  1S9E A;  4I2Q A;  3SNN A;  4KI6 A;  1U47 A;  1HMV A;  1SUQ A;  3TI0 A;  4CF0 A;  4CED A;  1C1C A;  3MXI A;  3RRH A;  3E01 A;  1D8Y A;  2FBX A;  3RR7 A;  4CEQ A;  3RWU A;  1EXQ A;  3HM9 A;  4ELU A;  3H08 A;  3MAQ A;  3S3O A;  1FXX A;  1JL2 A;  1RCH A;  1D9D A;  2XO7 A;  2XY8 A;  1S6Q A;  3LPT A;  1WSE A;  3PO4 A;  2FBV A;  1SV5 A;  3O3G A;  2I5J A;  3EZ5 A;  1S1W A;  4OVL A;  1ZBF A;  2IAJ A;  4BWM A;  3AVC A;  4CJ4 A;  3AVN A;  3OYM A;  4FJI A;  4BWJ A;  3TAB A;  4EP5 A;  3DI6 A;  1TGO A;  3NF9 A;  1CLQ A;  1C1A A;  2HNY A;  1JLC A;  4LH5 A;  4CGH A;  4H4M A;  2BAN A;  1C0T A;  2WOM A;  4KHY A;  1U48 A;  2RF2 A;  4ZTF A;  2YNH A;  1TL3 A;  3CM6 A;  4KHW A;  1HYZ A;  3KLF A;  1WNS A;  3C94 A;  3AO1 A;  1VSE A;  2YHB A;  2XY5 A;  2QXF A;  3THV A;  4C8O A;  3SV4 A;  1NOY A;  1BI4 A;  5J2M A;  4FZY A;  4CEZ A;  4FZZ A;  1TAU A;  1LW2 A;  4DF4 A;  2G8H A;  3QO9 A;  3V1O A;  3JYT A;  4C8K A;  1KVC A;  1TVR A;  4I9Q A;  4W5Q A;  4DTN A;  2F96 A;  4B8A B;  2PZS A;  2DFF A;  3NH2 A;  3F73 A;  1W0H A;  3PUF A;  1RTI A;  3EY1 A;  3DOL A;  3L3V A;  4EZ6 A;  4AHC A;  4CIE A;  1TKD A;  1RDB A;  1YT3 A;  1ZBU A;  4LD0 A;  1C0U A;  4W5T A;  2G8W A;  3L2U A;  1CXQ A;  3UIQ A;  2B6A A;  4DSF A;  4B9L A;  3SQ0 A;  4AHS A;  2VWJ A;  1S9G A;  5SWM A;  4M3T A;  2G8V A;  4RW4 A;  2XRI A;  4CEC A;  1UAX A;  1RDC A;  2ZE2 A;  3OJS A;  4B9T A;  4FLV A;  4CFB A;  3AVA A;  4XIU A;  4J2A A;  2BGG A;  3A2F A;  1FKP A;  3AVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...