1WSEA

Co-crystal structure of e.coli rnase hi active site mutant (e48a*) with mn2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMALMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKARGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
publication title Identification of Single Mn(2+) Binding Sites Required for Activation of the Mutant Proteins of E.coli RNase HI at Glu48 and/or Asp134 by X-ray Crystallography
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1wseA00
3O3HA 4AHVA 1GOBA 1J9AA 3L3VA 1FKOA 1S6QA 4BACA 4XIUA 3SYZA 3E01A 4M3RA 4KI6A 3S3OA 2LSNA 5HBMA 4E7JA 4DTPA 1ZBLA 1HPZA 4CF8A 1KVBA 3C94A 3LAKA 4B3OA 3AA3A 3HPGA 4CHNA 4HUFA 4DFKA 3AVAA 1RT3A 3QLHA 5HROA 5T7BA 4B9NA 3L2QA 4CFCA 4OPKA 2FBVA 4JRPA 3QEXA 1RTHA 2VG6A 3HP9A 3LP1A 3EY1A 4BE1A 1CZBA 4FJHA 2I5JA 3CFOA 3LPTA 3OVNA 3VQ7A 3AVFA 1RT7A 3MECA 1Q9YA 4BDYA 3KLHA 2XHBA 1FKPA 1TKXA 3PX6A 2O4IA 5FROA 3TAMA 5HRPA 1SL1A 3O4QA 4RW8A 3P1GA 1BL3A 3MEEA 2EX3A 3AO2A 3HSTB 3LP2A 4FVMA 4CFDA 3D0PA 4UQGA 2Z1IA 4B8CA 4DQSA 3SV3A 1ASVA 3NF8A 2ZE2A 1HMVA 1RT6A 1U04A 3MXJA 3VQCA 1IKXA 3ZSWA 3OYLA 3K5MA 5J2MA 5J2NA 2P5OA 2KZZA 3OS0A 5FRMA 2HW3A 3WNGA 1C1AA 4E7KA 1ZBUA 2HHWA 4H4MA 4M3UA 3VA0A 4KTWA 1WAJA 3QNOA 1QS4A 4DSIA 1RT1A 2YNFA 4DTRA 2YNIA 1UAXA 3SJJA 4AHCA 3NH0A 4DTOA 3DM2A 3CFRA 4CEOA 4BDPA 1J5OA 2OYQA 1WNSA 2OPQA 1S1TA 2XRIA 1DTTA 1RDAA 3V9UA 4DQRA 4QAGA 1ASUA 1TGOA 4JS4A 1QSLA 2OZSA 4CGHA 3L3UA 4HCBA 1S1XA 3QESA 4FLYA 2YNGA 4CHZA 5I3UA 3T19A 2WONA 1T7PA 4CECA 5CZ1A 1CXQA 1C0TA 4DQIA 3HPHA 2E6MA 4IG0A 1D9FA 2B6AA 3O4NA 2B5JA 3LZJA 3QO9A 1UA0A 4AHUA 1TKTA 3OYFA 1XHZA 3LAMA 3PY8A 4W5TA 4CIEA 1Y97A 2O4GA 4CERA 1VSDA 1JLEA 2BE2A 3HO1A 1NKBA 2FBYA 5CZ2A 4FM1A 2Y1JA 4KHNA 4CJVA 2DFEA 4B9LA 1QHTA 4CEZA 3RTVA 1Q8IA 1VSJA 4HTUA 1S1VA 1FXXA 1IKYA 4EZ9A 3KK3A 2D0CA 4O0JA 1YT3A 3VQEA 4RW7A 1RBUA 4CJ5A 5EU7A 4CJEA 4CJRA 3RR7A 1QQCA 1NK4A 1WSEA 3OYHA 1WSIA 3SUOA 3T3FA 1X1PA 4B9VA 4FXDA 3ZSYA 3F73A 2HHVA 1KVCA 1WSJA 3HXMA 4E19A 4BE2A 4FJ5A 2D5RA 3V81A 1QE1A 1WN7A 5HRSA 2Z1JA 3HPOA 1DTQA 2RN2A 3OS2A 3ZT1A 4ZTFA 4J2EA 4CEAA 2HHSA 3OYNA 1KTQA 4FYDA 4Y1DA 1UA1A 4K8ZA 4Z4IA 2XY8A 5DMRA 2XY6A 4DQQA 4OLAA 4M3XA 3BGRA 3ZSZA 4HVJA 3AVHA 1NKEA 1LV5A 1C1BA 1ASWA 3VQAA 4F4KA 1VRTA 4J2DA 1J53A 4CJFA 2IC3A 1K6YA 2RF2A 4GVMA 5KGWA 1T8EA 4LH4A 3MEGA 4CEQA 4JS5A 2G8VA 4DTXA 3K58A 5I42A 3TWHA 1HNVA 3HYFA 3ZT4A 3DLEA 1NK6A 3OYMA 3K5LA 3SUPA 3LWMA 3V9SA 4DSKA 2WOMA 1D5AA 1NOZA 1L5UA 2G8IA 3QEIA 4CEBA 4ID1A 1BQNA 1TK5A 1VSMA 3MEDA 1VSIA 1L3UA 4KHWA 1XC9A 1RBTA 2E4LA 4C8LA 3V9ZA 3V1QA 4CF1A 2ITGA 4JRQA 4FZYA 4CHPA 1TL1A 3S3MA 1SKRA 4E89A 1TK0A 4DLGA 4L8RB 1KLMA 1JL1A 4CJWA 3SV4A 1VSKA 4OKKA 4N41A 3L2WA 3AVJA 1CXUA 4M41A 3PX0A 2X78A 3WNHA 1LWFA 3KKSA 1QTMA 4OGEA 1HNIA 3ZT3A 4CHOA 3KLFA 1L3VA 3DYAA 3SNNA 3QINA 1RBSA 1JXEA 3SZ2A 4J2BA 4ELTA 4ELUA 4HHTA 3OYJA 3DLHA 1U4BA 2R7YA 1N6QA 1TKDA 3DLBA 1SL2A 1L3TA 1NK5A 1VSHA 3ZT2A 4DS5A 4DU4A 3QEPA 1U45A 3DLGA 1B92A 3DRPA 4DTMA 4LH5A 4NYNA 1RDBA 1S1WA 3ULDA 5J2PA 1RDDA 4N76A 2JGUA 1NJWA 1LAVA 2GV9A 1JLAA 3SQ4A 3TABA 3AVCA 4EZ6A 2Y1IA 4FJ7A 3AO5A 2XY7A 1LW2A 4JLHA 4I7FA 1S5JA 4AHSA 1JLBA 4Z0UA 1S1UA 2OPRA 3A2FA 2QXFA 4M42A 1ZBHA 1JLFA 1CLQA 4AHRA 4WE1A 3LPUA 5C24A 4DMNA 3ALYA 1BQMA 4CGFA 4FJJA 4CF0A 3QIOA 1A5XA 4I9QA 1JLGA 3TAFA 4ID5A 3NE6A 4BE0A 3CG7A 3OYAA 1EX4A 4IDKA 4KV8A 1RDCA 2HB5A 4NYFA 4OPJA 2YHAA 3K59A 3S9HA 1SKWA 4PA1A 1YTUA 1XWLA 4ICLA 2EHGA 4ZTJA 1BGXT 3ISNC 3EZ5A 4DSFA 1U47A 3C95A 2IGIA 5E41A 1WAFA 3AVGA 4I2PA 5J1EA 4DTUA 2AJQA 1NK7A 3AO4A 2D0BA 2KTQA 4Q0BA 4CJQA 4AILC 3DLRA 4LSNA 4DFJA 3G0ZA 3LZIA 4F8RA 3V4IA 1KCFA 2PYJA 4KKOA 1YVUA 2P1JA 2YNHA 4DS4A 3K57A 4AHTA 2OPSA 4KFBA 3S3NA 2VWJA 2FBTA 1KRPA 4LY7A 1WSHA 1NOYA 5KRSA 1RILA 4KB1A 3DRSA 4FJNA 2OA8A 3AVLA 3C6TA 4NCBA 3SCXA 1IKWA 1TL3A 1T05A 1SL0A 1BHLA 2HHQA 1RNHA 3IS9A 5FRNA 1W9HA 2KW4A 4H8KA 4YNQA 4KRFA 2DY4A 3NBPA 1JKHA 1RT2A 3LP0A 4EP4A 4OKJA 1T03A 1TAQA 4OJRA 2G8WA 3NF7A 2G8FA 1VK0A 1REVA 3HJFA 3B6PA 3RMCA 4DQPA 2NUBA 3SQ2A 3P5JA 1NJYA 2HVHA 3U3GA 3D45A 3VA3A 4CJTA 3FFIA 3EYZA 3NCIA 1U48A 2JLEA 4FJXA 4I2QA 1ITGA 1LWEA 1EKEA 4OGCA 1ZBIA 1J54A 2P51A 1I39A 4PQUA 3SPYA 3DOKA 3ZSXA 1U49A 3K5NA 5KI6A 2VG5A 1Q9XA 2PZSA 1B9FA 1S9EA 4OKEA 2IS3A 3M8PA 3KLEA 1JL2A 3VQ9A 1EP4A 3AA5X 1RCHA 4CJ4A 3KKRA 3NAEA 3THVA 3DMJA 5SZTA 2FBXA 3KD5E 2F8SA 4RW9A 4N47A 3VQPA 1C0UA 5JS1A 4M3WA 3NF6A 4J2AA 4B08A 2F8TA 4FZZA 4F3OA 4Z4EA 4F3TA 1I3AA 2QK9A 4C8OA 2ZQBA 2Q3SA 3SQ1A 3WNFA 3AO1A 1MU2A 1NKCA 4HUEA 2HVIA 5SWMA 3TANA 3OYEA 4QCLA 2ETJA 4KHUA 1F21A 5CY4A 1YTAA 2VWKA 3V1RA 1HQEA 3OYGA 2G8HA 3DLKA 2GUIA 2KQ2A 1IKVA 1EXQA 3PX4A 2VG7A 3KK2A 3VQBA 4R5PA 4O55A 4CJSA 1HJRA 3OYKA 3NGYA 3KLIA 4IBNA 4TSXA 3LANA 5K14A 4CGJA 1SKSA 4DWIA 1Z26A 4CK3A 3HT3A 2IAJA 2DFFA 4HUGA 5D3GA 2X74A 2ZD1A 3HK2A 4FM2A 3RMDA 4B9SA 4CHQA 4CF2A 1O1WA 4E0DA 3VQ6A 3NDKA 1NJZA 4KPYA 4M45A 4I9LA 2Z1GA 1IG9A 1QSSA 4KREA 4FK4A 4CIFA 4CEDA 3HVRA 4C8KA 1Z25A 2Z1HA 3L2RA 4M3YA 1KFDA 3OYCA 3QEWA 3P83D 4DF4A 4FJGA 4FLTA 4PUOA 3M8QA 4ZHRA 2PY5A 2G8UA 4O4GA 1RTJA 1BISA 3KK1A 1UWBA 4DTJA 3TAPA 4MFBA 3UIQA 2OZMA 1N5YA 1KVAA 2X6SA 1C1CA 2E6LA 2IDOA 3AA2A 4CFAA 3QNNA 3U6FA 1NK0A 4KHSA 4Z4FA 3TAQA 3NH1A 1X9MA 2F96A 4KB0A 3KJVA 1L3SA 4HCCA 4CEEA 3KTQA 3AA4A 5KGXA 3CM6A 3JYTA 1WLJA 3BDPA 1KLNA 1BCMA 2YHBA 3AV9A 4E7LA 4CJUA 2ATQA 4FW1A 5HRRA 3TAEA 3PV8A 1BIUA 3TI0A 1KFSA 4B9MA 4IKFA 4RG8A 3I0SA 3LP3A 1JLQA 4FLZA 3U3YA 4MQ3A 3TR8A 4FZXC 4GMJB 3HP6A 1A5VA 4FJMA 3L2UA 3V9XA 1IH7A 4N56A 1VSEA 4O5BA 4DSLA 4FJ8A 2HHUA 2HHXA 1TK8A 4W5OA 1A5WA 3B6OA 3V9WA 1GOCA 3CM5A 2OPPA 1XHXA 3AVBA 3PUFA 1RTDA 4CK2A 1HYZA 3ZT0A 4DF8A 4IG3A 4OVLA 3ZSRA 4CJ3A 3HL8A 3M8RA 1LWCA 3CFPA 4FLWA 3NGIA 3MXIA 2A1RA 3VQ8A 3SI6A 3RRHA 3OYIA 3QIPA 1VSLA 3RMBA 1BIZA 4M3TA 2HNYA 4PY5A 2YV0X 4W5NA 1RBVA 1HQUA 4Z4GA 2BANA 3AO3A 3TARA 3CQ8A 1RT4A 4LSLA 4Y1CA 1NJXA 1D8YA 3V1OA 4F2SA 2BGGA 5J2QA 1JXBA 1RT5A 2QKKA 4CFBA 2YKMA 4E1NA 3V6DA 1NK9A 4KHQA 1BCOA 4RW6A 1HYVA 4C8MA 1RTIA 1S6PA 4CHYA 4OLBA 1C0MA 3WNEA 4CJKA 2QKBA 3DOLA 3CYMA 1KSPA 5KRTA 1X9WA 3PO5A 3F9KA 3LWLA 1TVRA 4CESA 4DTSA 4B8AB 4KTQA 3DRRA 4CEFA 2HMIA 4PWDA 3NHGA 1BI4B 3K2PA 4BDZA 3OYDA 3SQ0A 3RR8A 3ZSOA 2KZMA 3VQ5A 2W42A 4CF9A 4O44A 3VN5A 4KTZA 4CGDA 3HM9A 3OY9A 2RKIA 3NFAA 3I0RA 4FLUA 4FK0A 3QEVA 4DU1A 3O3FA 4KI4A 1RBRA 5DK5A 3C6UA 3H08A 1WSGA 1DLOA 4DFMA 3K5OA 1NK8A 4DFPA 4E7IA 4BWJA 4EP5A 4N5SA 4FJLA 3QERA 5JS2A 3T1AA 3I8DA 3O3GA 5KTQA 1EETA 2PYLA 3IAYA 4FJIA 2HHTA 3LALA 1G15A 4GW6A 4Z4CA 5C42A 4O0IA 4FCYA 3MAQA 3IG1A 2YKNA 3ASMA 4FJKA 1W0HA 4QOZB 3VQDA 2XY5A 1TV6A 2B4JA 2KFZA 3AVIA 4CGGA 5HRNA 3HVTA 3SUNA 2P5GA 1HYSA 3LDSA 3SUQA 3RWUA 4E7HA 1BI4A 1FK9A 3AVKA 3DI6A 4H4OA 4IFVA 3ZSQA 4CJPA 2GBZA 1IO2A 5C25A 4F2RA 2D0AA 3OYBA 1VRUA 1R0AA 3ZSVA 4B9TA 4K8XA 1ZBFA 1SV5A 3NF9A 4E1MA 4M3ZA 1QSYA 1VSFA 4DG1A 3ITHA 1B9DA 1X9SA 4CCHA 4C8NA 3RMAA 5CYMA 4YFUA 3JSMA 4E3SA 3QETA 5HP1A 4CIGA 4FLVA 1D9DA 1S9GA 2HNDA 4DSEA 4FW2A 2BDPA 5CYQA 3AVNA 1HRHA 4BWMA 5HLFA 4FJ9A 4CK1A 3RRGA 4KAZA 4AH9A 4NCGA 4CE9A 3L2VA 3TAGA 1XI1A 4FM0A 2KFNA 3VQQA 4W5QA 1UOCA 4DU3A 3KIOA 3OS1A 2G8KA 4KHYA 1JLCA 1LW0A 4DTNA 4ELVA 3NGZA 3SPZA 4LD0A 1LAWA 5FDLA 1ZYQA 4Z4HA 4FLXA 2DFHA 3L8BA 2FC0A 3M8SA 4KO0A 3MXMA 1TKZA 1SUQA 1C6VA 4B9UA 3PO4A 1TAUA 2DTUA 1GOAA 4NCAA 4Q5VA 3AVMA 3OJSA 4FK2A 3KLGA 2XO7A 4DSJA 3ZCMA 1CZ9A 4DLEA 3IRXA 4CJLA 3KD1E 1WSFA 2A1SA 2X6NA 3G10A 4CGIA 2IOCA 3OJUA 4IFYA 4W5RA 2HNZA 4RW4A 3VQ4A 3NH2A 2RPIA 4G1QA
chains in the Genus database with same CATH superfamily
3O3HA 3L4IA 3L3VA 2A42A 3SYZA 4BC3A 2LSNA 3C94A 4B3OA 4E1JA 1FW6A 3AA3A 3QLHA 1RT3A 1KAYA 2V52B 4OPKA 3QEXA 2VG6A 4FJHA 2I5JA 3CFOA 3LPTA 3VQ7A 1ILYA 3QICA 4BDYA 2XHBA 1FKPA 1TKXA 3MX2A 3PX6A 1H1VA 5FROA 4DCHA 5HRPA 5JVHL 5AQPA 3LDQA 2CGLA 3P1GA 2EX3A 2KLAA 2Z1IA 4F9OA 1LOTB 4DQSA 3SV3A 2ZE2A 5M1KA 3AAQA 1U04A 2O8DB 2P5OA 1K8KB 2HW3A 3WNGA 4DV3K 1ZBUA 4KTWA 4EHUA 4IO9L 1YITN 4H5TA 3CFRA 4O8KA 3O08A 1J5OA 4YDUA 1ASUA 4JS4A 2OZSA 1WOQA 2WONA 4FO0A 1CXQA 1C0TA 4WQ4C 1HNZK 2AP1A 4JEPA 5M1QA 1VQ4N 3LZJA 4CIEA 2YCHA 2O8DA 5ADXA 3KHYA 4CERA 2ZM6K 1NKBA 1K8KA 5CZ2A 2P9KB 4KHNA 4FPBA 3ENHA 2QXLA 4IFEA 3VEWA 4EZ9A 2D0CA 4O0JA 4CJEA 1RBUA 1QQCA 3P39A 3QFPA 4FWOA 3ZSYA 4M7XA 2HHVA 1WSJA 1GLBG 4BE2A 1HKCA 1QE1A 1DTQA 4CEAA 3SBGA 4H03B 3J7AP 1NM1A 3VGKA 4Y1DA 3HTVA 3O1BA 3CCEN 4DQQA 4OLAA 3BGRA 4X65K 4ISEA 1LV5A 4F4KA 3MCAB 3MN6A 3WQUA 2IC3A 1K6YA 1DKGD 2P9KA 3LL3A 5BPLA 1G99A 3WT0A 4LH4A 3NMUA 3ZT4A 1NGJA 1C0GA 3OYMA 3K5LA 3SUPA 3LWMA 1VQPN 1D5AA 3QBXA 1L5UA 2EWSA 4KHWA 1L3UA 1XC9A 4C8LA 4CF1A 4JRQA 3S3MA 1VQNN 1VSKA 3AVJA 3SBTA 1LWFA 1HNIA 4CHOA 3DYAA 3SNNA 1RBSA 3SZ2A 4J2BA 4ELUA 3T1YK 1U4BA 4DR1K 1NK5A 1VSHA 3ZT2A 2NRTA 3DLGA 1NNEA 3DRPA 4DTMA 4X66K 1S1WA 3ULDA 4BRPA 2JGUA 1NJWA 1LAVA 1JLAA 4FSVA 3TABA 5AQZA 2Y1IA 4FJ7A 1S5JA 4CZIA 2OPRA 3NVMA 4BG8A 1BO5O 4DMNA 1BQMA 4DR2K 4FJJA 3QIOA 1JLGA 5BN9A 3FLCO 3RSEB 1X3NA 5BN8A 2FXUA 4A5AA 4FWRA 4X64K 1RDCA 1SKWA 2YHAA 3CHWA 3ID6A 4GNIA 2ZJRL 2IGIA 3AVGA 4I2PA 1V4SA 4EFHA 2GWJA 1KCFA 2PYJA 1YVUA 2YNHA 1K8AO 3CJBA 4KHPK 4DV5K 4OPAA 1NOYA 1KRPA 4KB1A 3O9TA 2OA8A 4NCBA 2ASMA 1TL3A 1SL0A 2NLXA 1RNHA 3RSEA 2KW4A 1D4XA 4H8KA 4YNQA 3NBPA 1RT2A 3J7YP 1T03A 1TAQA 3GL1A 4OJRA 2G8WA 4B1ZA 2QWQA 2NUBA 1NJYA 4JI8K 3U3GA 2D0OA 5C2FA 1NWKA 2IIRA 4OGCA 2UXCK 1J54A 3VEXA 3SPYA 2HOEA 3K5NA 1Q9XA 4OKEA 2IS3A 3M8PA 4CJ4A 3BF1A 3KD5E 4N47A 5JS1A 1DT9A 1N36K 2F8TA 3C6HA 4F3TA 2ZQBA 3SQ1A 4JK9A 2CGKA 1KQSM 2HVIA 4CBWA 2HHHK 5SWMA 1F21A 3QB0A 5CY4A 3V1RA 4BRDA 2G8HA 3VGMA 1ZBSA 1EXQA 1VQ8N 4R5PA 4JI4K 1Q82O 3VF6A 4DHYA 1ZC6A 3NGYA 3CCMN 4TSXA 1SKSA 2DPNA 1GLJO 2IAJA 4HUGA 3PSIA 4FM2A 4CHQA 4CF2A 3NDKA 1NJZA 1ATRA 2Z1GA 4L3QA 4QS8A 4FL9A 4CEDA 4C8KA 1Z25A 1C0FA 3P83D 4DF4A 4FJGA 5JLFA 4JN4A 4A5BA 3M8QA 4BR9A 4ZHRA 2P9NB 4O4GA 1RTJA 3GG4A 1VQON 1N5YA 1KVAA 1C1CA 2E6LA 4CFAA 3QNNA 2A41A 1BG3A 4FPAA 4PL8A 2F96A 4JKBA 1L3SA 4HCCA 4CEEA 3KTQA 3KVGA 3CC7N 2FSJA 3CPEA 4E7LA 3I56N 5HRRA 3PV8A 5AQWA 3G71N 5C2DA 4FZXC 5AQQA 3T69A 4IWVA 4GKKK 4CD3A 2P9NA 4AM7A 3PUFA 5AQFA 3EO3A 1HYZA 4FLWA 3SI6A 2BUPA 3QIPA 4LF9K 1BIZA 2YV0X 1GLCG 3WUHA 4BGBA 4A62A 2BH1A 3F9MA 1RT5A 4KHQA 1RTIA 2ZWHA 3WNEA 3DOLA 3CYMA 1K73O 5KRTA 4DTSA 4B8AB 4JHDB 3DRRA 1XUPO 3ZSOA 2KZMA 2H3GX 3VN5A 4BR4A 4CGDA 3OY9A 2RE2A 5GAHP 4FK0A 4DU1A 2P9PB 4NLBA 3ZX3A 1NK8A 2JWLA 4EP5A 2Q0RA 3BEXA 4YHHK 5KTQA 3HZ6A 5BR8K 3WEEB 3VOVA 2YKNA 4X62K 1EO1A 4JHDA 4CGGA 3CCVN 3SUNA 1HYSA 1IJJA 1VHXA 4H4OA 4E7HA 4DSKA 4CJPA 5C25A 2D0AA 3ZSVA 1B9DA 1RDUA 4C8NA 3DAWA 5AQHA 2P9PA 3AVNA 1HRHA 5HLFA 4QCLA 4KAZA 3RRGA 4NB4A 4CE9A 5AFUH 5AZIB 3TAGA 4FM0A 4CZGA 3VQQA 3TSQA 1OKJA 1T3VA 2G8KA 4KH5A 4ELVA 3SPZA 4BG9A 5E84A 3O1WA 3WEEA 2FC0A 3M8SA 1TUYA 1SUQA 3B8AX 3PO4A 2DTUA 3OJSA 5BR9A 4FK2A 3KLGA 5AQMA 4AQYK 5BRDA 2NRVA 2HNZA 3VTIA 3NH2A 3S41A 2RPIA 4G1QA 4B1VA 2GWKA 1GOBA 4RWTA 4XIUA 5EVZA 2ZJQL 4NXNK 4CZMA 4LF5K 5I9EB 4JI5K 1ZBLA 3LAKA 4MLEA 4R79A 3PSFA 3VF4A 1HUXA 2RHKA 4HUFA 5AZIA 4DV0K 3L0QA 3EY1A 4B9QA 4BRNA 1Q9YA 5AQXA 3KLHA 4FWNA 2O4IA 4XH5A 5DM6L 3HSTB 4RTFD 4NXMK 3VQCA 1IKXA 3QMLA 5J2MA 5J2NA 3FGUA 2YJEA 5FRMA 5C15A 1JCGA 3VA0A 1K9MO 4CJ7A 1T44A 4DSIA 2YNFA 3THWB 1UAXA 1SAZA 4DTOA 4CEOA 1WBBA 1S1TA 1DTTA 3V9UA 4DQRA 3QBWA 2HBMA 2BTFA 3A8YA 2I7NA 2VYPA 2HF4A 4CECA 5CZ1A 4FWSA 4H0VB 1YXQA 3O4NA 2B5JA 3TTCA 1UA0A 3OYFA 3LAMA 3PY8A 4W5TA 4BRLA 4GV3A 3HI0A 2FBYA 3ENOA 3O80A 3H6EA 3VTHA 2DFEA 3G6EN 3RTVA 1VSJA 1FXXA 1IKYA 3PIOL 1DGKN 4CJ5A 4CJRA 3T7ZA 1U2VB 3THWA 2IVOA 3I33A 1DEJA 4E19A 4FJ5A 4IEEA 3OS2A 2HHSA 5AQSA 3OYNA 1KTQA 4BRQA 3O9UA 4H0TB 1NU0A 5A2QO 2XY6A 3ZSZA 4BVOA 1ASWA 5GINA 1JCFA 2GUPA 4GVMA 4DV2K 1IBLK 1IV0A 3MEGA 4DTXA 3K58A 5I42A 3TWHA 1HNVA 5GIPA 3CCQN 4IJAA 4FWKA 4WQ4A 5LJVA 1NK6A 1U2VA 3V9SA 2WOMA 2V7YA 2G8IA 3QEIA 4CEBA 4OO1J 1BQNA 5IT9O 2A5XA 4CW7B 2HMPA 1RBTA 3A5NC 4BR7A 2ZF5O 3R8EA 4FZYA 1SKRA 1Q18A 4DLGA 4L8RB 3ULEB 3SV4A 4N41A 3L2WA 5ADXH 4OGEA 3KLFA 1NGBA 3QINA 4IZ9A 2ZGYA 3WQTA 3OYJA 3OA9A 5LMUK 1N6QA 2HBLA 1TKDA 3DLBA 1SL2A 4OX9K 3MDQA 4DS5A 1U45A 4CD1A 3CERA 1NGGA 2KKZA 3FR0A 2O8FB 1QZ5A 1YJ9N 3SQ4A 4JI0K 4DKWA 4EZ6A 4I7FA 3PLAA 5KPRA 4Z0UA 1JLFA 4AHRA 4WE1A 3LPUA 3ULEA 4IO8A 4I9QA 3TAFA 3K9JA 3CG7A 4NYFA 1KAZA 3HBTA 1VAZA 4ICLA 5BRFA 4DSFA 3C95A 4DTUA 5DM7L 3AO4A 1HJOA 2KTQA 4CI6A 3AY9A 2D4WA 2O8FA 1HLUA 4XEIA 4F8RA 2AA4A 2YJFA 2OPSA 4KFBA 5M1PA 1WSHA 3ZETB 1RILA 1FJGK 3DRSA 2WTUA 1T05A 5GAGP 4LF6K 3IS9A 3IUCA 1W9HA 4KRFA 1JKHA 3CCSN 3LP0A 4LF7K 4FWPA 4EP4A 3NF7A 3B6PA 4BQZA 3HOSA 5C0YA 4DQPA 2E1YA 2E2QA 3P5JA 4JV5K 4IDHA 3D45A 4BVPA 5ELZA 1TUUA 3FFIA 3EYZA 3NCIA 3VA3A 3EN9A 1U48A 4I2QA 1ITGA 3SAGA 3KWIA 4LFCK 4PQUA 3DOKA 1U49A 2GELA 3KLEA 3AA5X 1VQKN 3NAEA 3WXKA 3DMJA 5JMVA 5SZTA 2F8SA 3T1HK 3ZETA 2YI1A 2O8EB 4M3WA 3NF6A 4J2AA 4B08A 1I3AA 3M6GA 2QK9A 1XMOK 2Q3SA 1MU2A 4QS9A 4HUEA 2ETJA 3OYGA 1YTAA 2VWKA 3DXMB 3W0LA 2GUIA 2KQ2A 3PX4A 4WQ5C 1MDUB 3OBYA 4GVEA 4IBNA 4CGJA 1Z26A 5D3GA 2OTLN 4JI1K 2X74A 1QQMA 2D1KA 1O1WA 3P38A 4NLCA 5AR0A 4I9LA 1IG9A 4WF9L 2E1ZA 2VGNA 1O13A 2Z1HA 4M3YA 4ILJA 4FLTA 2O8EA 5JVGL 2PY5A 1BISA 1UWBA 5TKYA 2NRWA 2F9WA 4MFBA 2OZMA 2X6SA 2GTDA 2IDOA 3U6FA 1OVQA 3NH1A 1X9MA 3DXMA 4H0PA 4YOYA 1GLFO 3BDPA 5BPMA 1TAUA 2ATQA 5GIOA 4IKFA 3TTFA 1BIUA 1KFSA 3MN7A 3PIPL 3LDLA 3U3YA 1A5VA 5GADP 4FJMA 1IH7A 3LM2A 3U8XA 4N56A 3J80O 4IOCL 1VSEA 2UXBK 2HHUA 3CPWM 1TK8A 4W5OA 4LC9B 1A5WA 3V9WA 3CM5A 2OPPA 3TTDA 4CZFA 3UE5A 1Z05A 4DF8A 4IG3A 4AF1A 5M1FA 3NGIA 2A1RA 1VSLA 4M3TA 3CMAN 4PY5A 3DJCA 5B8HA 3A5OC 3TARA 3CQ8A 4FVUA 5F1XA 1RT4A 4LSLA 4Y1CA 5EX5A 3VPZA 3EE8A 1I94K 4DV4K 2A6AA 2YKMA 3UB5A 4C8MA 3TSUA 4OLBA 4CHYA 1C0MA 3H1QA 4CJKA 4BRHA 1KSPA 4IOAL 4CESA 2W40A 2ASOA 3ID8A 4KTQA 4IXCA 5AQGA 4PWDA 5AQRA 3R3LA 3NHGA 3K2PA 4DV6K 1VQ7N 4M7YA 5KPTA 5BRHA 3VQ5A 2W42A 3D2FB 2QW9A 4Z94A 4CF9A 3G4SN 2QWPA 4GV6A 5KQDA 5DK5A 1NGIA 3H08A 1WSGA 1DLOA 3VEOA 4E7IA 4BWJA 3QERA 5LL6Z 4A2AA 2ITMA 1EETA 1NGEA 3H46O 4FCYA 4O0IA 4GW6A 3ASMA 4FJKA 2GEMA 3HVTA 2P9UB 3AVKA 3DI6A 5F2RA 2GBZA 1IO2A 5LMNK 2WBNA 4K8XA 4B9TA 3D2FA 3NF9A 1QSYA 3CJ7A 4YFUA 3WXJA 3CJCA 1KC8O 5HP1A 1D9DA 3JAMO 1NMNA 2HNDA 4BC2A 1IBKK 4FJ9A 1XNQK 4CK1A 4BRAA 2F9TA 1UOCA 1NGCA 4DU3A 3OS1A 3U9DA 1LAWA 3CIPA 5FDLA 4Z4HA 4FLXA 1RGIA 4KO0A 1TKZA 1C6VA 3WXMB 4B9UA 2E2OA 1GOAA 4NCAA 2P9UA 2QWOA 4DLEA 1RFQA 3M1FA 1WSFA 2A1SA 1J9AA 1FKOA 4BC4A 4BACA 5F0XA 3GBTA 4O5FA 3S3OA 3N4PA 4CF8A 1KVBA 4C1NK 3SJHA 3D7EO 5HROA 3VMFB 5T7BA 2OTJN 3L2QA 4CFCA 2NZTA 2FBVA 1RTHA 3JXUA 3LP1A 1CZBA 2V51B 1YF5L 3OVNA 3ATUA 5AQNA 5AQTA 1RT7A 1ZXOA 3WXIA 1SL1A 3MEEA 4MO5A 4CFDA 4YOTA 4UQGA 4WFAL 2VGMA 2D0PA 3BUZB 3SK3A 3NF8A 1SQKA 1HMVA 3GDQA 3A5MC 2VQFK 2YHWA 3OS0A 3ZYYX 5M1OA 4E7KA 1QQNA 4H4MA 4M3UA 2UXDK 1WAJA 1HR0K 1XMQK 1QS4A 1NGAA 2YNIA 3MN9A 5FPEA 2NRZA 2OPQA 1E4GT 1QSLA 4CGHA 3L3UA 4HCBA 1S1XA 3QESA 4FLYA 3MCPA 4CHZA 1QVGM 4ILHA 2E6MA 1D9FA 3QO9A 4DQ8A 4JKGB 4A57A 3MWPA 3CQXA 1Y97A 3AGKA 2O4GA 1VSDA 4FM1A 2Y1JA 4B9LA 3VETA 1TYQB 3MWTA 1U6ZA 3VQEA 5EU7A 1BA1A 1NK4A 1WSEA 3T3FA 1X1PA 4B9VA 4K42A 4NO7A 3F73A 3HXMA 1WBDA 3CC2N 2UUAK 5HRSA 2RN2A 3ZT1A 4J2EA 2IVPA 4K8ZA 2XY8A 3D2EB 3C0BA 4HVJA 3VERA 1X9JA 3AVHA 4JKGA 5AQOA 1NKEA 1VRTA 3E9OA 4BRIA 1GLEG 1T6DA 4CJFA 1T8EA 1IG8A 4JS5A 3O5BA 4H0OA 1TYQA 1YVNA 2FF6A 3CI5A 4AM6A 5H1SQ 4GY2B 4IOXA 3UKRB 1VSIA 4J8FA 1ATSA 2E4LA 3V9ZA 3V1QA 4H0XB 4WYBA 1NJIO 1TL1A 1TK0A 3OHRA 2CH6A 4K25A 1Y64A 1YAGA 3PX0A 3WNHA 3CJAA 3KKSA 4DR5K 3ZT3A 1L3VA 3D2EA 1JXEA 4ELTA 4HHTA 3DLHA 5IWAK 2W6KA 4BC5A 1YUWA 3A5LC 3QEPA 1QZ6A 1P8ZA 4LH5A 4NYNA 3R1XA 2GV9A 3AVCA 3N4QA 3H45C 4AHSA 1YI2N 1JLBA 4HWIA 4YORA 1S1UA 2JWKA 3A2FA 1ZBHA 1CLQA 1JCEA 1ATNA 1P90A 4CGFA 2ASPA 4CF0A 4EAHD 3NE6A 4BE0A 4B1WB 3M5RA 1EX4A 2HB5A 4OPJA 2QTDA 1HPMA 4ZTJA 2Q0UA 4BRKA 1BGXT 3ISNC 1WB9A 4H5RA 5C12A 1U47A 1WAFA 5J1EA 5AQIA 5FLXO 1QQOA 4V19S 1V4TA 1N8RO 4Q0BA 3QDKA 2F4VK 3O6WA 4LSNA 2P9LB 2VWBA 4B1UB 3HRGA 3LZIA 3A0IX 4KKOA 2P1JA 4DS4A 3O9QA 4C1NI 3CMEN 3S3NA 2VWJA 2HBJA 4KH6A 4LY7A 1W7AA 2UUCK 4FJNA 5AFUA 3AVLA 3SCXA 5FRNA 4CZJA 3TSPA 1W2BM 1N33K 3VEYA 4OKJA 4BRGA 4B1XB 3SQ2A 3R9PA 1BDGA 2HVHA 4DUYK 4FJXA 5AQKA 1EKEA 2OCEA 2P9LA 4PKGA 1I39A 3AGRA 3E9LA 3F2KA 5KI6A 2VG5A 1B9FA 1S9EA 2E8AA 3VQ9A 1EP4A 3KKRA 2FBXA 3VQPA 1C0UA 1HNWK 5AQYA 4I6MB 1RDWX 3CQYA 4FZZA 4F3OA 4Z4EA 5MLCQ 3FZFA 4C8OA 3J8AA 3WNFA 2VCPA 4FWMA 1SS6A 4ISGA 3OYEA 4KHUA 3DLKA 3QFUA 4JKDA 2VG7A 4O55A 4C23A 4CJSA 1HJRA 3LDOA 3KLIA 4DWIA 3LANA 5K14A 4CK3A 3HT3A 4JI7K 2ZD1A 5KPZA 5JICA 4KPYA 1QSSA 4YOWA 4KREA 4BRFA 3HVRA 1KFDA 3OYCA 5LJWA 4PUOA 4B3MK 4I6MA 2G8UA 2KHOA 2Q31A 3FZMA 4DTJA 1XC3A 4EIAA 3AA2A 4Z4FA 4KB0A 4K41A 3AA4A 5KGXA 3JYTA 3VEZA 1WLJA 1M1KO 1KLNA 1BCMA 2QWMA 2YHBA 4PL7A 3TAEA 4B9MA 4RG8A 4PKIA 4DUZK 4MQ3A 5JLHA 4GMJB 3HP6A 3W3DA 3V9XA 1CZAN 1VQ6N 4DSLA 1HKBA 2HHXA 4JI3K 4B3SK 3B6OA 3IDHA 4MO4A 3M3ZA 1GOCA 2IVNA 4WQ5A 1XHXA 3AVBA 1RTDA 4CK2A 1S72N 5BREA 3HL8A 2O8BB 1LWCA 1T6CA 4MLHA 3RRHA 3OYIA 4W5NA 4YOUA 4Y0WA 3THXB 4Z4GA 3AO3A 1YJNN 1KD1O 4O8UA 4JI6K 1NJXA 3V1OA 4FWLA 3OBWA 1JXBA 5EY4A 1E3MA 4CFBA 1NK9A 3V6DA 2W6LA 1HYVA 5TKWA 2QKBA 4WFNL 3U9ZA 5HOOA 1VQMN 3PO5A 2P9IB 3H3OB 1TVRA 3LWLA 3MX5A 4LFAK 4CEFA 4CVNE 1BI4B 4B3TK 4BDZA 3SQ0A 3GOIA 2O8BA 4U7BA 4BR2A 4KTZA 5BPNA 2A40A 3HM9A 2RKIA 1EQYA 3I0RA 4FLUA 3L4QA 4H5WA 3O3FA 3THXA 1RBRA 4KI4A 4HTLA 5GAEP 3K5OA 4DFMA 4DFPA 2I7PA 3MMVA 4WCEL 2CGJA 4A61A 3O3GA 3IAYA 3VF2A 1MWKA 3IG1A 5EXWA 1W0HA 3ZX2A 4QOZB 1QHAA 2P9IA 4CBUA 1TV6A 1XNRK 3AVIA 5HRNA 4K0KK 2P5GA 3OTOK 3SUQA 1BI4A 3HPOA 4F2RA 4IFVA 3THYB 1R0AA 2PAVA 1W97L 1ZBFA 3ITHA 5CYMA 3FZLA 3CCLN 3JSMA 4E3SA 4JNEA 3QETA 4BRCA 4UY8O 1S9GA 4DSEA 5CYQA 1JJ2M 4BWMA 4YOXA 2YX6A 3L2VA 1OH7A 1J6ZA 3O9RA 2NRRA 2KFNA 4DR3K 1N32K 2NRXA 2YHXA 4LD0A 1VQ5N 1ZYQA 3L8BA 2HSTA 4U67L 3GE1A 4GKJK 4Q5VA 3AVMA 2XO7A 3H3NO 4DSJA 1CZ9A 4CJLA 3KD1E 2X6NA 3G10A 3THYA 4YDUC 2IOCA 3OJUA 4IFYA 4W5RA 2NRHA 3CETA 3VQ4A 4AHVA 1S6QA 3E01A 4M3RA 4KI6A 5HBMA 4E7JA 4BR0A 4DTPA 1HPZA 4DFKA 3HPGA 4CHNA 3AVAA 4MDBA 3EKUA 4WFBL 4B9NA 4JRPA 4IJNA 4H5NA 3HP9A 4RCHA 4BGAA 4BE1A 1SZ2A 3AVFA 3MECA 2Q2RA 4FOEA 1OH6A 3TAMA 4BRMA 3P4IA 2FF3B 3O4QA 4RW8A 1BL3A 3J7ZO 4OPHA 1Q7YO 3LP2A 3AO2A 4FVMA 2HBKA 3D0PA 4B8CA 2WC9A 3FZKA 3J81O 1ASVA 1XQSC 3MXJA 1RT6A 3C6AA 3ZSWA 3OYLA 3K5MA 2KZZA 4M63C 1C1AA 2HHWA 1KAXA 3QNOA 2Q36A 1RT1A 4DTRA 3SJJA 4AHCA 3NH0A 4BDPA 3DM2A 2OYQA 1WNSA 2XRIA 1RDAA 4QS7A 4H5VA 4QAGA 3R6MA 1TGOA 3E9PA 4DR6K 1OH8A 2YNGA 3JS6A 3TPQA 5I3UA 3T19A 1T7PA 1R59O 3CCJN 4DQIA 3HPHA 4IG0A 2B6AA 5AZJB 3RVCA 4AHUA 1TKTA 1XHZA 3KWGA 2ZGZA 1JLEA 2BE2A 3HO1A 5AQLA 4CJVA 2E88A 1QHTA 4CEZA 3CCUN 2UUBK 1Q8IA 1YJWN 4HTUA 1S1VA 2PFUA 1NMDA 3KK3A 1YT3A 3RR7A 4RW7A 4LF8K 5AQJA 3OYHA 1WSIA 3SUOA 4FXDA 1KVCA 3SAFA 5C10A 4KH4A 2D5RA 3BZKA 3V81A 1WN7A 2Z1JA 4ZTFA 5M1NA 4FYDA 2J4RA 1UA1A 4Z4IA 5DMRA 1LCUA 5AZJA 4M3XA 4JI2K 1C1BA 3VQAA 3HM8A 3KZBA 4J2DA 1J53A 3DWLA 2RF2A 5KGWA 4JYAK 3KK7A 4G9ZA 4CEQA 2G8VA 3K0SA 3HYFA 3DLEA 3FFKB 4PHTX 1NOZA 4H0YB 4ID1A 1TK5A 1VSMA 3MEDA 4BROA 1NG9A 4ISFA 2ITGA 4DV7K 3G25A 4CHPA 4E89A 4CZLA 3IFRA 1KLMA 1JL1A 4CJWA 4OKKA 1CXUA 4M41A 2X78A 1QTMA 3FE1A 3MN5A 5AQVA 2R7YA 1L3TA 1X3MA 4DU4A 4JK7A 3ZX0A 1B92A 1GLLO 1RDBA 5J2PA 1RDDA 4JKHA 4N76A 5FPNA 3AO5A 2XY7A 1LW2A 4JLHA 4CZHA 2QXFA 4M42A 5C24A 5CHIA 4FWQA 3ALYA 4JKCA 2UU9K 3L6QA 1N34K 1EWQA 4XH4A 3I8BA 1A5XA 4ID5A 3OYAA 4IDKA 4KV8A 3S9HA 3K59A 4JAXA 4PA1A 1YTUA 1XWLA 2EHGA 3EZ5A 5E41A 3DXKB 3ZEUB 2AJQA 1NK7A 3O9SA 1VQ9N 2D0BA 3CJ1A 4CJQA 1IBMK 4JD2B 4AILC 4DV1K 1NLVA 3DLRA 4DFJA 3NVKA 4DB3A 3G0ZA 1VQLN 4K43A 3V4IA 1M90O 5FPDA 3HOTA 1E4FT 2HF3A 3K57A 4AHTA 1NBWA 3Q7CA 2FBTA 3AARA 3CC4N 5KRSA 5LY3A 2YHYA 3C6TA 1IKWA 3DLLL 1BHLA 3EKSA 4MDAA 2HHQA 3U4LA 1MWMA 2DY4A 4BR5A 5E26A 2G8FA 1VK0A 1NGHA 1REVA 3HJFA 3RMCA 2WFBA 3DXKA 3C65A 3ZEUA 4A2BA 2F7TA 4JKAA 5FPMA 4CJTA 2JLEA 4DR7K 3ATVA 1LWEA 4JD2A 4BREA 1ZBIA 1HX1A 2P51A 3ZSXA 2PZSA 2WUSA 1JL2A 1RCHA 3THVA 5AJ3K 2QWRA 3ENBA 4RW9A 4ILGB 3CF5L 3CD6N 3WXLA 2O8CB 4EHTA 3AO1A 1NKCA 2ZJPL 2FLOA 3TANA 1Z6RA 1HQEA 1IKVA 3IMXA 3KK2A 4BQLA 1ESVA 3VQBA 2QM1A 5KQ8A 3OYKA 3D6RA 2DFFA 5HL7L 3HK2A 3RMDA 1HNXK 3HSCA 4B9SA 4E0DA 3VQ6A 2QWNA 3EEQA 3MK6A 4M45A 4FK4A 4CIFA 3L2RA 2E20A 3QEWA 4BY9C 3EZWA 1Q86O 3KK1A 3O8MA 3TAPA 3UIQA 2O8CA 1NK0A 1EWRA 3VGLA 2FSNA 4KHSA 3TAQA 4A59A 2OANA 1OVYA 3KJVA 3TU5A 2FSKA 3CCRN 3CM6A 3AV9A 4CJUA 2PBDA 4FW1A 3UKRA 3TI0A 3I0SA 3LP3A 3ZLJA 1JLQA 4FLZA 3TR8A 3H1VX 1GLAG 4JKEA 3L2UA 1Q81O 2CH5A 3K9KA 4O5BA 3UKUB 4FJ8A 3BF3A 1HKGA 4PKHA 4B3RK 3BZCA 3CXCM 2QWLA 5CR4A 3ZT0A 3ZSRA 4OVLA 4CJ3A 2GX9A 3M8RA 3CFPA 3MXIA 4GV9A 3VQ8A 2W41A 1BUPA 3RMBA 3FZHA 2HNYA 1YHQN 1RBVA 1HQUA 2BANA 2BGGA 1D8YA 4F2SA 2VQEK 1NGDA 5J2QA 3EL2A 2QKKA 4E1NA 3VENA 2NNWA 1BCOA 4RW6A 2P9SB 1S6PA 2UYTA 3UKUA 1X9WA 3F9KA 4YY3K 4CBXA 2Q97A 2HMIA 2Q1NA 3P31A 3RR8A 3OYDA 2V7ZA 1WUAA 4YOVA 4O44A 4JKFA 3IKMA 3SLCA 3NFAA 5AQUA 3QEVA 2E2PA 3C6UA 3LDPA 3SMPA 3SMSA 4DR4K 4N5SA 4FJLA 1OH5A 3Q7BA 4XH1A 5JS2A 2QI2A 3T1AA 5EOYA 3I8DA 3OW2M 2HHTA 2PYLA 4CZEA 4FJIA 3AAPA 3LALA 1G15A 4Z4CA 3C7NB 5C42A 3CJ9A 2P9SA 3MAQA 4LFBK 4B1YB 4IEIA 3VQDA 2XY5A 1NGFA 2B4JA 1QVFM 2KFZA 1MA9B 2QA4N 3LDSA 3RWUA 1FK9A 3ZSQA 1YIJN 3OYBA 4FOIA 1VRUA 1SV5A 4M3ZA 4E1MA 1VSFA 4DG1A 1X9SA 4CCHA 3EE9A 3RMAA 2E5LK 3E66A 4CIGA 1BU6O 4FLVA 3LM9A 4FW2A 5CE3A 2BDPA 4AH9A 4NCGA 1J5EK 1XI1A 4CZKA 3I55N 4W5QA 4LF4K 3KIOA 4KHYA 1JLCA 1LW0A 4DTNA 3NGZA 1BA0A 3BY5A 3C7NA 3LDNA 2DFHA 3E1YA 1S3XA 4JK8A 3MXMA 3O4WA 2E2NA 3F5TA 1KXPA 1GLDG 3BP8A 3VEVA 1BWFO 4KBOA 3ZCMA 3VESA 3SAHA 3IRXA 2QEXN 4CGIA 1BOTO 1S22A 4RW4A 2A3ZA
chains in the Genus database with same CATH topology
3O3HA 4AHVA 1GOBA 1J9AA 3L3VA 1FKOA 1S6QA 4BACA 4XIUA 3SYZA 3E01A 4M3RA 4KI6A 3S3OA 2LSNA 5HBMA 4E7JA 4DTPA 1ZBLA 1HPZA 4CF8A 1KVBA 3C94A 3LAKA 4B3OA 3AA3A 3HPGA 4CHNA 4HUFA 4DFKA 3AVAA 1RT3A 3QLHA 5HROA 5T7BA 4B9NA 3L2QA 4CFCA 4OPKA 2FBVA 4JRPA 3QEXA 1RTHA 2VG6A 3HP9A 3LP1A 3EY1A 4BE1A 1CZBA 4FJHA 2I5JA 3CFOA 3LPTA 3OVNA 3VQ7A 3AVFA 1RT7A 3MECA 1Q9YA 4BDYA 3KLHA 2XHBA 1FKPA 1TKXA 3PX6A 2O4IA 5FROA 3TAMA 5HRPA 1SL1A 3O4QA 4RW8A 3P1GA 1BL3A 3MEEA 2EX3A 3AO2A 3HSTB 3LP2A 4FVMA 4CFDA 3D0PA 4UQGA 2Z1IA 4B8CA 4DQSA 3SV3A 1ASVA 3NF8A 2ZE2A 1HMVA 1RT6A 1U04A 3MXJA 3VQCA 1IKXA 3ZSWA 3OYLA 3K5MA 5J2MA 5J2NA 2P5OA 2KZZA 3OS0A 5FRMA 2HW3A 3WNGA 1C1AA 4E7KA 1ZBUA 2HHWA 4H4MA 4M3UA 3VA0A 4KTWA 1WAJA 3QNOA 1QS4A 4DSIA 1RT1A 2YNFA 4DTRA 2YNIA 1UAXA 3SJJA 4AHCA 3NH0A 4DTOA 3DM2A 3CFRA 4CEOA 4BDPA 1J5OA 2OYQA 1WNSA 2OPQA 1S1TA 2XRIA 1DTTA 1RDAA 3V9UA 4DQRA 4QAGA 1ASUA 1TGOA 4JS4A 1QSLA 2OZSA 4CGHA 3L3UA 4HCBA 1S1XA 3QESA 4FLYA 2YNGA 4CHZA 5I3UA 3T19A 2WONA 1T7PA 4CECA 5CZ1A 1CXQA 1C0TA 4DQIA 3HPHA 2E6MA 4IG0A 1D9FA 2B6AA 3O4NA 2B5JA 3LZJA 3QO9A 1UA0A 4AHUA 1TKTA 3OYFA 1XHZA 3LAMA 3PY8A 4W5TA 4CIEA 1Y97A 2O4GA 4CERA 1VSDA 1JLEA 2BE2A 3HO1A 1NKBA 2FBYA 5CZ2A 4FM1A 2Y1JA 4KHNA 4CJVA 2DFEA 4B9LA 1QHTA 4CEZA 3RTVA 1Q8IA 1VSJA 4HTUA 1S1VA 1FXXA 1IKYA 4EZ9A 3KK3A 2D0CA 4O0JA 1YT3A 3VQEA 4RW7A 1RBUA 4CJ5A 5EU7A 4CJEA 4CJRA 3RR7A 1QQCA 1NK4A 1WSEA 3OYHA 1WSIA 3SUOA 3T3FA 1X1PA 4B9VA 4FXDA 3ZSYA 3F73A 2HHVA 1KVCA 1WSJA 3HXMA 4E19A 4BE2A 4FJ5A 2D5RA 3V81A 1QE1A 1WN7A 5HRSA 2Z1JA 3HPOA 1DTQA 2RN2A 3OS2A 3ZT1A 4ZTFA 4J2EA 4CEAA 2HHSA 3OYNA 1KTQA 4FYDA 4Y1DA 1UA1A 4K8ZA 4Z4IA 2XY8A 5DMRA 2XY6A 4DQQA 4OLAA 4M3XA 3BGRA 3ZSZA 4HVJA 3AVHA 1NKEA 1LV5A 1C1BA 1ASWA 3VQAA 4F4KA 1VRTA 4J2DA 1J53A 4CJFA 2IC3A 1K6YA 2RF2A 4GVMA 5KGWA 1T8EA 4LH4A 3MEGA 4CEQA 4JS5A 2G8VA 4DTXA 3K58A 5I42A 3TWHA 1HNVA 3HYFA 3ZT4A 3DLEA 1NK6A 3OYMA 3K5LA 3SUPA 3LWMA 3V9SA 4DSKA 2WOMA 1D5AA 1NOZA 1L5UA 2G8IA 3QEIA 4CEBA 4ID1A 1BQNA 1TK5A 1VSMA 3MEDA 1VSIA 1L3UA 4KHWA 1XC9A 1RBTA 2E4LA 4C8LA 3V9ZA 3V1QA 4CF1A 2ITGA 4JRQA 4FZYA 4CHPA 1TL1A 3S3MA 1SKRA 4E89A 1TK0A 4DLGA 4L8RB 1KLMA 1JL1A 4CJWA 3SV4A 1VSKA 4OKKA 4N41A 3L2WA 3AVJA 1CXUA 4M41A 3PX0A 2X78A 3WNHA 1LWFA 3KKSA 1QTMA 4OGEA 1HNIA 3ZT3A 4CHOA 3KLFA 1L3VA 3DYAA 3SNNA 3QINA 1RBSA 1JXEA 3SZ2A 4J2BA 4ELTA 4ELUA 4HHTA 3OYJA 3DLHA 1U4BA 2R7YA 1N6QA 1TKDA 3DLBA 1SL2A 1L3TA 1NK5A 1VSHA 3ZT2A 4DS5A 4DU4A 3QEPA 1U45A 3DLGA 1B92A 3DRPA 4DTMA 4LH5A 4NYNA 1RDBA 1S1WA 3ULDA 5J2PA 1RDDA 4N76A 2JGUA 1NJWA 1LAVA 2GV9A 1JLAA 3SQ4A 3TABA 3AVCA 4EZ6A 2Y1IA 4FJ7A 3AO5A 2XY7A 1LW2A 4JLHA 4I7FA 1S5JA 4AHSA 1JLBA 4Z0UA 1S1UA 2OPRA 3A2FA 2QXFA 4M42A 1ZBHA 1JLFA 1CLQA 4AHRA 4WE1A 3LPUA 5C24A 4DMNA 3ALYA 1BQMA 4CGFA 4FJJA 4CF0A 3QIOA 1A5XA 4I9QA 1JLGA 3TAFA 4ID5A 3NE6A 4BE0A 3CG7A 3OYAA 1EX4A 4IDKA 4KV8A 1RDCA 2HB5A 4NYFA 4OPJA 2YHAA 3K59A 3S9HA 1SKWA 4PA1A 1YTUA 1XWLA 4ICLA 2EHGA 4ZTJA 1BGXT 3ISNC 3EZ5A 4DSFA 1U47A 3C95A 2IGIA 5E41A 1WAFA 3AVGA 4I2PA 5J1EA 4DTUA 2AJQA 1NK7A 3AO4A 2D0BA 2KTQA 4Q0BA 4CJQA 4AILC 3DLRA 4LSNA 4DFJA 3G0ZA 3LZIA 4F8RA 3V4IA 1KCFA 2PYJA 4KKOA 1YVUA 2P1JA 2YNHA 4DS4A 3K57A 4AHTA 2OPSA 4KFBA 3S3NA 2VWJA 2FBTA 1KRPA 4LY7A 1WSHA 1NOYA 5KRSA 1RILA 4KB1A 3DRSA 4FJNA 2OA8A 3AVLA 3C6TA 4NCBA 3SCXA 1IKWA 1TL3A 1T05A 1SL0A 1BHLA 2HHQA 1RNHA 3IS9A 5FRNA 1W9HA 2KW4A 4H8KA 4YNQA 4KRFA 2DY4A 3NBPA 1JKHA 1RT2A 3LP0A 4EP4A 4OKJA 1T03A 1TAQA 4OJRA 2G8WA 3NF7A 2G8FA 1VK0A 1REVA 3HJFA 3B6PA 3RMCA 4DQPA 2NUBA 3SQ2A 3P5JA 1NJYA 2HVHA 3U3GA 3D45A 3VA3A 4CJTA 3FFIA 3EYZA 3NCIA 1U48A 2JLEA 4FJXA 4I2QA 1ITGA 1LWEA 1EKEA 4OGCA 1ZBIA 1J54A 2P51A 1I39A 4PQUA 3SPYA 3DOKA 3ZSXA 1U49A 3K5NA 5KI6A 2VG5A 1Q9XA 2PZSA 1B9FA 1S9EA 4OKEA 2IS3A 3M8PA 3KLEA 1JL2A 3VQ9A 1EP4A 3AA5X 1RCHA 4CJ4A 3KKRA 3NAEA 3THVA 3DMJA 5SZTA 2FBXA 3KD5E 2F8SA 4RW9A 4N47A 3VQPA 1C0UA 5JS1A 4M3WA 3NF6A 4J2AA 4B08A 2F8TA 4FZZA 4F3OA 4Z4EA 4F3TA 1I3AA 2QK9A 4C8OA 2ZQBA 2Q3SA 3SQ1A 3WNFA 3AO1A 1MU2A 1NKCA 4HUEA 2HVIA 5SWMA 3TANA 3OYEA 4QCLA 2ETJA 4KHUA 1F21A 5CY4A 1YTAA 2VWKA 3V1RA 1HQEA 3OYGA 2G8HA 3DLKA 2GUIA 2KQ2A 1IKVA 1EXQA 3PX4A 2VG7A 3KK2A 3VQBA 4R5PA 4O55A 4CJSA 1HJRA 3OYKA 3NGYA 3KLIA 4IBNA 4TSXA 3LANA 5K14A 4CGJA 1SKSA 4DWIA 1Z26A 4CK3A 3HT3A 2IAJA 2DFFA 4HUGA 5D3GA 2X74A 2ZD1A 3HK2A 4FM2A 3RMDA 4B9SA 4CHQA 4CF2A 1O1WA 4E0DA 3VQ6A 3NDKA 1NJZA 4KPYA 4M45A 4I9LA 2Z1GA 1IG9A 1QSSA 4KREA 4FK4A 4CIFA 4CEDA 3HVRA 4C8KA 1Z25A 2Z1HA 3L2RA 4M3YA 1KFDA 3OYCA 3QEWA 3P83D 4DF4A 4FJGA 4FLTA 4PUOA 3M8QA 4ZHRA 2PY5A 2G8UA 4O4GA 1RTJA 1BISA 3KK1A 1UWBA 4DTJA 3TAPA 4MFBA 3UIQA 2OZMA 1N5YA 1KVAA 2X6SA 1C1CA 2E6LA 2IDOA 3AA2A 4CFAA 3QNNA 3U6FA 1NK0A 4KHSA 4Z4FA 3TAQA 3NH1A 1X9MA 2F96A 4KB0A 3KJVA 1L3SA 4HCCA 4CEEA 3KTQA 3AA4A 5KGXA 3CM6A 3JYTA 1WLJA 3BDPA 1KLNA 1BCMA 2YHBA 3AV9A 4E7LA 4CJUA 2ATQA 4FW1A 5HRRA 3TAEA 3PV8A 1BIUA 3TI0A 1KFSA 4B9MA 4IKFA 4RG8A 3I0SA 3LP3A 1JLQA 4FLZA 3U3YA 4MQ3A 3TR8A 4FZXC 4GMJB 3HP6A 1A5VA 4FJMA 3L2UA 3V9XA 1IH7A 4N56A 1VSEA 4O5BA 4DSLA 4FJ8A 2HHUA 2HHXA 1TK8A 4W5OA 1A5WA 3B6OA 3V9WA 1GOCA 3CM5A 2OPPA 1XHXA 3AVBA 3PUFA 1RTDA 4CK2A 1HYZA 3ZT0A 4DF8A 4IG3A 4OVLA 3ZSRA 4CJ3A 3HL8A 3M8RA 1LWCA 3CFPA 4FLWA 3NGIA 3MXIA 2A1RA 3VQ8A 3SI6A 3RRHA 3OYIA 3QIPA 1VSLA 3RMBA 1BIZA 4M3TA 2HNYA 4PY5A 2YV0X 4W5NA 1RBVA 1HQUA 4Z4GA 2BANA 3AO3A 3TARA 3CQ8A 1RT4A 4LSLA 4Y1CA 1NJXA 1D8YA 3V1OA 4F2SA 2BGGA 5J2QA 1JXBA 1RT5A 2QKKA 4CFBA 2YKMA 4E1NA 3V6DA 1NK9A 4KHQA 1BCOA 4RW6A 1HYVA 4C8MA 1RTIA 1S6PA 4CHYA 4OLBA 1C0MA 3WNEA 4CJKA 2QKBA 3DOLA 3CYMA 1KSPA 5KRTA 1X9WA 3PO5A 3F9KA 3LWLA 1TVRA 4CESA 4DTSA 4B8AB 4KTQA 3DRRA 4CEFA 2HMIA 4PWDA 3NHGA 1BI4B 3K2PA 4BDZA 3OYDA 3SQ0A 3RR8A 3ZSOA 2KZMA 3VQ5A 2W42A 4CF9A 4O44A 3VN5A 4KTZA 4CGDA 3HM9A 3OY9A 2RKIA 3NFAA 3I0RA 4FLUA 4FK0A 3QEVA 4DU1A 3O3FA 4KI4A 1RBRA 5DK5A 3C6UA 3H08A 1WSGA 1DLOA 4DFMA 3K5OA 1NK8A 4DFPA 4E7IA 4BWJA 4EP5A 4N5SA 4FJLA 3QERA 5JS2A 3T1AA 3I8DA 3O3GA 5KTQA 1EETA 2PYLA 3IAYA 4FJIA 2HHTA 3LALA 1G15A 4GW6A 4Z4CA 5C42A 4O0IA 4FCYA 3MAQA 3IG1A 2YKNA 3ASMA 4FJKA 1W0HA 4QOZB 3VQDA 2XY5A 1TV6A 2B4JA 2KFZA 3AVIA 4CGGA 5HRNA 3HVTA 3SUNA 2P5GA 1HYSA 3LDSA 3SUQA 3RWUA 4E7HA 1BI4A 1FK9A 3AVKA 3DI6A 4H4OA 4IFVA 3ZSQA 4CJPA 2GBZA 1IO2A 5C25A 4F2RA 2D0AA 3OYBA 1VRUA 1R0AA 3ZSVA 4B9TA 4K8XA 1ZBFA 1SV5A 3NF9A 4E1MA 4M3ZA 1QSYA 1VSFA 4DG1A 3ITHA 1B9DA 1X9SA 4CCHA 4C8NA 3RMAA 5CYMA 4YFUA 3JSMA 4E3SA 3QETA 5HP1A 4CIGA 4FLVA 1D9DA 1S9GA 2HNDA 4DSEA 4FW2A 2BDPA 5CYQA 3AVNA 1HRHA 4BWMA 5HLFA 4FJ9A 4CK1A 3RRGA 4KAZA 4AH9A 4NCGA 4CE9A 3L2VA 3TAGA 1XI1A 4FM0A 2KFNA 3VQQA 4W5QA 1UOCA 4DU3A 3KIOA 3OS1A 2G8KA 4KHYA 1JLCA 1LW0A 4DTNA 4ELVA 3NGZA 3SPZA 4LD0A 1LAWA 5FDLA 1ZYQA 4Z4HA 4FLXA 2DFHA 3L8BA 2FC0A 3M8SA 4KO0A 3MXMA 1TKZA 1SUQA 1C6VA 4B9UA 3PO4A 1TAUA 2DTUA 1GOAA 4NCAA 4Q5VA 3AVMA 3OJSA 4FK2A 3KLGA 2XO7A 4DSJA 3ZCMA 1CZ9A 4DLEA 3IRXA 4CJLA 3KD1E 1WSFA 2A1SA 2X6NA 3G10A 4CGIA 2IOCA 3OJUA 4IFYA 4W5RA 2HNZA 4RW4A 3VQ4A 3NH2A 2RPIA 4G1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O3H A;  4AHV A;  1GOB A;  1J9A A;  3L3V A;  1FKO A;  1S6Q A;  4BAC A;  4XIU A;  3SYZ A;  3E01 A;  4M3R A;  4KI6 A;  3S3O A;  2LSN A;  5HBM A;  4E7J A;  4DTP A;  1ZBL A;  1HPZ A;  4CF8 A;  1KVB A;  3C94 A;  3LAK A;  4B3O A;  3AA3 A;  3HPG A;  4CHN A;  4HUF A;  4DFK A;  3AVA A;  1RT3 A;  3QLH A;  5HRO A;  5T7B A;  4B9N A;  3L2Q A;  4CFC A;  4OPK A;  2FBV A;  4JRP A;  3QEX A;  1RTH A;  2VG6 A;  3HP9 A;  3LP1 A;  3EY1 A;  4BE1 A;  1CZB A;  4FJH A;  2I5J A;  3CFO A;  3LPT A;  3OVN A;  3VQ7 A;  3AVF A;  1RT7 A;  3MEC A;  1Q9Y A;  4BDY A;  3KLH A;  2XHB A;  1FKP A;  1TKX A;  3PX6 A;  2O4I A;  5FRO A;  3TAM A;  5HRP A;  1SL1 A;  3O4Q A;  4RW8 A;  3P1G A;  1BL3 A;  3MEE A;  2EX3 A;  3AO2 A;  3HST B;  3LP2 A;  4FVM A;  4CFD A;  3D0P A;  4UQG A;  2Z1I A;  4B8C A;  4DQS A;  3SV3 A;  1ASV A;  3NF8 A;  2ZE2 A;  1HMV A;  1RT6 A;  1U04 A;  3MXJ A;  3VQC A;  1IKX A;  3ZSW A;  3OYL A;  3K5M A;  5J2M A;  5J2N A;  2P5O A;  2KZZ A;  3OS0 A;  5FRM A;  2HW3 A;  3WNG A;  1C1A A;  4E7K A;  1ZBU A;  2HHW A;  4H4M A;  4M3U A;  3VA0 A;  4KTW A;  1WAJ A;  3QNO A;  1QS4 A;  4DSI A;  1RT1 A;  2YNF A;  4DTR A;  2YNI A;  1UAX A;  3SJJ A;  4AHC A;  3NH0 A;  4DTO A;  3DM2 A;  3CFR A;  4CEO A;  4BDP A;  1J5O A;  2OYQ A;  1WNS A;  2OPQ A;  1S1T A;  2XRI A;  1DTT A;  1RDA A;  3V9U A;  4DQR A;  4QAG A;  1ASU A;  1TGO A;  4JS4 A;  1QSL A;  2OZS A;  4CGH A;  3L3U A;  4HCB A;  1S1X A;  3QES A;  4FLY A;  2YNG A;  4CHZ A;  5I3U A;  3T19 A;  2WON A;  1T7P A;  4CEC A;  5CZ1 A;  1CXQ A;  1C0T A;  4DQI A;  3HPH A;  2E6M A;  4IG0 A;  1D9F A;  2B6A A;  3O4N A;  2B5J A;  3LZJ A;  3QO9 A;  1UA0 A;  4AHU A;  1TKT A;  3OYF A;  1XHZ A;  3LAM A;  3PY8 A;  4W5T A;  4CIE A;  1Y97 A;  2O4G A;  4CER A;  1VSD A;  1JLE A;  2BE2 A;  3HO1 A;  1NKB A;  2FBY A;  5CZ2 A;  4FM1 A;  2Y1J A;  4KHN A;  4CJV A;  2DFE A;  4B9L A;  1QHT A;  4CEZ A;  3RTV A;  1Q8I A;  1VSJ A;  4HTU A;  1S1V A;  1FXX A;  1IKY A;  4EZ9 A;  3KK3 A;  2D0C A;  4O0J A;  1YT3 A;  3VQE A;  4RW7 A;  1RBU A;  4CJ5 A;  5EU7 A;  4CJE A;  4CJR A;  3RR7 A;  1QQC A;  1NK4 A;  1WSE A;  3OYH A;  1WSI A;  3SUO A;  3T3F A;  1X1P A;  4B9V A;  4FXD A;  3ZSY A;  3F73 A;  2HHV A;  1KVC A;  1WSJ A;  3HXM A;  4E19 A;  4BE2 A;  4FJ5 A;  2D5R A;  3V81 A;  1QE1 A;  1WN7 A;  5HRS A;  2Z1J A;  3HPO A;  1DTQ A;  2RN2 A;  3OS2 A;  3ZT1 A;  4ZTF A;  4J2E A;  4CEA A;  2HHS A;  3OYN A;  1KTQ A;  4FYD A;  4Y1D A;  1UA1 A;  4K8Z A;  4Z4I A;  2XY8 A;  5DMR A;  2XY6 A;  4DQQ A;  4OLA A;  4M3X A;  3BGR A;  3ZSZ A;  4HVJ A;  3AVH A;  1NKE A;  1LV5 A;  1C1B A;  1ASW A;  3VQA A;  4F4K A;  1VRT A;  4J2D A;  1J53 A;  4CJF A;  2IC3 A;  1K6Y A;  2RF2 A;  4GVM A;  5KGW A;  1T8E A;  4LH4 A;  3MEG A;  4CEQ A;  4JS5 A;  2G8V A;  4DTX A;  3K58 A;  5I42 A;  3TWH A;  1HNV A;  3HYF A;  3ZT4 A;  3DLE A;  1NK6 A;  3OYM A;  3K5L A;  3SUP A;  3LWM A;  3V9S A;  4DSK A;  2WOM A;  1D5A A;  1NOZ A;  1L5U A;  2G8I A;  3QEI A;  4CEB A;  4ID1 A;  1BQN A;  1TK5 A;  1VSM A;  3MED A;  1VSI A;  1L3U A;  4KHW A;  1XC9 A;  1RBT A;  2E4L A;  4C8L A;  3V9Z A;  3V1Q A;  4CF1 A;  2ITG A;  4JRQ A;  4FZY A;  4CHP A;  1TL1 A;  3S3M A;  1SKR A;  4E89 A;  1TK0 A;  4DLG A;  4L8R B;  1KLM A;  1JL1 A;  4CJW A;  3SV4 A;  1VSK A;  4OKK A;  4N41 A;  3L2W A;  3AVJ A;  1CXU A;  4M41 A;  3PX0 A;  2X78 A;  3WNH A;  1LWF A;  3KKS A;  1QTM A;  4OGE A;  1HNI A;  3ZT3 A;  4CHO A;  3KLF A;  1L3V A;  3DYA A;  3SNN A;  3QIN A;  1RBS A;  1JXE A;  3SZ2 A;  4J2B A;  4ELT A;  4ELU A;  4HHT A;  3OYJ A;  3DLH A;  1U4B A;  2R7Y A;  1N6Q A;  1TKD A;  3DLB A;  1SL2 A;  1L3T A;  1NK5 A;  1VSH A;  3ZT2 A;  4DS5 A;  4DU4 A;  3QEP A;  1U45 A;  3DLG A;  1B92 A;  3DRP A;  4DTM A;  4LH5 A;  4NYN A;  1RDB A;  1S1W A;  3ULD A;  5J2P A;  1RDD A;  4N76 A;  2JGU A;  1NJW A;  1LAV A;  2GV9 A;  1JLA A;  3SQ4 A;  3TAB A;  3AVC A;  4EZ6 A;  2Y1I A;  4FJ7 A;  3AO5 A;  2XY7 A;  1LW2 A;  4JLH A;  4I7F A;  1S5J A;  4AHS A;  1JLB A;  4Z0U A;  1S1U A;  2OPR A;  3A2F A;  2QXF A;  4M42 A;  1ZBH A;  1JLF A;  1CLQ A;  4AHR A;  4WE1 A;  3LPU A;  5C24 A;  4DMN A;  3ALY A;  1BQM A;  4CGF A;  4FJJ A;  4CF0 A;  3QIO A;  1A5X A;  4I9Q A;  1JLG A;  3TAF A;  4ID5 A;  3NE6 A;  4BE0 A;  3CG7 A;  3OYA A;  1EX4 A;  4IDK A;  4KV8 A;  1RDC A;  2HB5 A;  4NYF A;  4OPJ A;  2YHA A;  3K59 A;  3S9H A;  1SKW A;  4PA1 A;  1YTU A;  1XWL A;  4ICL A;  2EHG A;  4ZTJ A;  1BGX T;  3ISN C;  3EZ5 A;  4DSF A;  1U47 A;  3C95 A;  2IGI A;  5E41 A;  1WAF A;  3AVG A;  4I2P A;  5J1E A;  4DTU A;  2AJQ A;  1NK7 A;  3AO4 A;  2D0B A;  2KTQ A;  4Q0B A;  4CJQ A;  4AIL C;  3DLR A;  4LSN A;  4DFJ A;  3G0Z A;  3LZI A;  4F8R A;  3V4I A;  1KCF A;  2PYJ A;  4KKO A;  1YVU A;  2P1J A;  2YNH A;  4DS4 A;  3K57 A;  4AHT A;  2OPS A;  4KFB A;  3S3N A;  2VWJ A;  2FBT A;  1KRP A;  4LY7 A;  1WSH A;  1NOY A;  5KRS A;  1RIL A;  4KB1 A;  3DRS A;  4FJN A;  2OA8 A;  3AVL A;  3C6T A;  4NCB A;  3SCX A;  1IKW A;  1TL3 A;  1T05 A;  1SL0 A;  1BHL A;  2HHQ A;  1RNH A;  3IS9 A;  5FRN A;  1W9H A;  2KW4 A;  4H8K A;  4YNQ A;  4KRF A;  2DY4 A;  3NBP A;  1JKH A;  1RT2 A;  3LP0 A;  4EP4 A;  4OKJ A;  1T03 A;  1TAQ A;  4OJR A;  2G8W A;  3NF7 A;  2G8F A;  1VK0 A;  1REV A;  3HJF A;  3B6P A;  3RMC A;  4DQP A;  2NUB A;  3SQ2 A;  3P5J A;  1NJY A;  2HVH A;  3U3G A;  3D45 A;  3VA3 A;  4CJT A;  3FFI A;  3EYZ A;  3NCI A;  1U48 A;  2JLE A;  4FJX A;  4I2Q A;  1ITG A;  1LWE A;  1EKE A;  4OGC A;  1ZBI A;  1J54 A;  2P51 A;  1I39 A;  4PQU A;  3SPY A;  3DOK A;  3ZSX A;  1U49 A;  3K5N A;  5KI6 A;  2VG5 A;  1Q9X A;  2PZS A;  1B9F A;  1S9E A;  4OKE A;  2IS3 A;  3M8P A;  3KLE A;  1JL2 A;  3VQ9 A;  1EP4 A;  3AA5 X;  1RCH A;  4CJ4 A;  3KKR A;  3NAE A;  3THV A;  3DMJ A;  5SZT A;  2FBX A;  3KD5 E;  2F8S A;  4RW9 A;  4N47 A;  3VQP A;  1C0U A;  5JS1 A;  4M3W A;  3NF6 A;  4J2A A;  4B08 A;  2F8T A;  4FZZ A;  4F3O A;  4Z4E A;  4F3T A;  1I3A A;  2QK9 A;  4C8O A;  2ZQB A;  2Q3S A;  3SQ1 A;  3WNF A;  3AO1 A;  1MU2 A;  1NKC A;  4HUE A;  2HVI A;  5SWM A;  3TAN A;  3OYE A;  4QCL A;  2ETJ A;  4KHU A;  1F21 A;  5CY4 A;  1YTA A;  2VWK A;  3V1R A;  1HQE A;  3OYG A;  2G8H A;  3DLK A;  2GUI A;  2KQ2 A;  1IKV A;  1EXQ A;  3PX4 A;  2VG7 A;  3KK2 A;  3VQB A;  4R5P A;  4O55 A;  4CJS A;  1HJR A;  3OYK A;  3NGY A;  3KLI A;  4IBN A;  4TSX A;  3LAN A;  5K14 A;  4CGJ A;  1SKS A;  4DWI A;  1Z26 A;  4CK3 A;  3HT3 A;  2IAJ A;  2DFF A;  4HUG A;  5D3G A;  2X74 A;  2ZD1 A;  3HK2 A;  4FM2 A;  3RMD A;  4B9S A;  4CHQ A;  4CF2 A;  1O1W A;  4E0D A;  3VQ6 A;  3NDK A;  1NJZ A;  4KPY A;  4M45 A;  4I9L A;  2Z1G A;  1IG9 A;  1QSS A;  4KRE A;  4FK4 A;  4CIF A;  4CED A;  3HVR A;  4C8K A;  1Z25 A;  2Z1H A;  3L2R A;  4M3Y A;  1KFD A;  3OYC A;  3QEW A;  3P83 D;  4DF4 A;  4FJG A;  4FLT A;  4PUO A;  3M8Q A;  4ZHR A;  2PY5 A;  2G8U A;  4O4G A;  1RTJ A;  1BIS A;  3KK1 A;  1UWB A;  4DTJ A;  3TAP A;  4MFB A;  3UIQ A;  2OZM A;  1N5Y A;  1KVA A;  2X6S A;  1C1C A;  2E6L A;  2IDO A;  3AA2 A;  4CFA A;  3QNN A;  3U6F A;  1NK0 A;  4KHS A;  4Z4F A;  3TAQ A;  3NH1 A;  1X9M A;  2F96 A;  4KB0 A;  3KJV A;  1L3S A;  4HCC A;  4CEE A;  3KTQ A;  3AA4 A;  5KGX A;  3CM6 A;  3JYT A;  1WLJ A;  3BDP A;  1KLN A;  1BCM A;  2YHB A;  3AV9 A;  4E7L A;  4CJU A;  2ATQ A;  4FW1 A;  5HRR A;  3TAE A;  3PV8 A;  1BIU A;  3TI0 A;  1KFS A;  4B9M A;  4IKF A;  4RG8 A;  3I0S A;  3LP3 A;  1JLQ A;  4FLZ A;  3U3Y A;  4MQ3 A;  3TR8 A;  4FZX C;  4GMJ B;  3HP6 A;  1A5V A;  4FJM A;  3L2U A;  3V9X A;  1IH7 A;  4N56 A;  1VSE A;  4O5B A;  4DSL A;  4FJ8 A;  2HHU A;  2HHX A;  1TK8 A;  4W5O A;  1A5W A;  3B6O A;  3V9W A;  1GOC A;  3CM5 A;  2OPP A;  1XHX A;  3AVB A;  3PUF A;  1RTD A;  4CK2 A;  1HYZ A;  3ZT0 A;  4DF8 A;  4IG3 A;  4OVL A;  3ZSR A;  4CJ3 A;  3HL8 A;  3M8R A;  1LWC A;  3CFP A;  4FLW A;  3NGI A;  3MXI A;  2A1R A;  3VQ8 A;  3SI6 A;  3RRH A;  3OYI A;  3QIP A;  1VSL A;  3RMB A;  1BIZ A;  4M3T A;  2HNY A;  4PY5 A;  2YV0 X;  4W5N A;  1RBV A;  1HQU A;  4Z4G A;  2BAN A;  3AO3 A;  3TAR A;  3CQ8 A;  1RT4 A;  4LSL A;  4Y1C A;  1NJX A;  1D8Y A;  3V1O A;  4F2S A;  2BGG A;  5J2Q A;  1JXB A;  1RT5 A;  2QKK A;  4CFB A;  2YKM A;  4E1N A;  3V6D A;  1NK9 A;  4KHQ A;  1BCO A;  4RW6 A;  1HYV A;  4C8M A;  1RTI A;  1S6P A;  4CHY A;  4OLB A;  1C0M A;  3WNE A;  4CJK A;  2QKB A;  3DOL A;  3CYM A;  1KSP A;  5KRT A;  1X9W A;  3PO5 A;  3F9K A;  3LWL A;  1TVR A;  4CES A;  4DTS A;  4B8A B;  4KTQ A;  3DRR A;  4CEF A;  2HMI A;  4PWD A;  3NHG A;  1BI4 B;  3K2P A;  4BDZ A;  3OYD A;  3SQ0 A;  3RR8 A;  3ZSO A;  2KZM A;  3VQ5 A;  2W42 A;  4CF9 A;  4O44 A;  3VN5 A;  4KTZ A;  4CGD A;  3HM9 A;  3OY9 A;  2RKI A;  3NFA A;  3I0R A;  4FLU A;  4FK0 A;  3QEV A;  4DU1 A;  3O3F A;  4KI4 A;  1RBR A;  5DK5 A;  3C6U A;  3H08 A;  1WSG A;  1DLO A;  4DFM A;  3K5O A;  1NK8 A;  4DFP A;  4E7I A;  4BWJ A;  4EP5 A;  4N5S A;  4FJL A;  3QER A;  5JS2 A;  3T1A A;  3I8D A;  3O3G A;  5KTQ A;  1EET A;  2PYL A;  3IAY A;  4FJI A;  2HHT A;  3LAL A;  1G15 A;  4GW6 A;  4Z4C A;  5C42 A;  4O0I A;  4FCY A;  3MAQ A;  3IG1 A;  2YKN A;  3ASM A;  4FJK A;  1W0H A;  4QOZ B;  3VQD A;  2XY5 A;  1TV6 A;  2B4J A;  2KFZ A;  3AVI A;  4CGG A;  5HRN A;  3HVT A;  3SUN A;  2P5G A;  1HYS A;  3LDS A;  3SUQ A;  3RWU A;  4E7H A;  1BI4 A;  1FK9 A;  3AVK A;  3DI6 A;  4H4O A;  4IFV A;  3ZSQ A;  4CJP A;  2GBZ A;  1IO2 A;  5C25 A;  4F2R A;  2D0A A;  3OYB A;  1VRU A;  1R0A A;  3ZSV A;  4B9T A;  4K8X A;  1ZBF A;  1SV5 A;  3NF9 A;  4E1M A;  4M3Z A;  1QSY A;  1VSF A;  4DG1 A;  3ITH A;  1B9D A;  1X9S A;  4CCH A;  4C8N A;  3RMA A;  5CYM A;  4YFU A;  3JSM A;  4E3S A;  3QET A;  5HP1 A;  4CIG A;  4FLV A;  1D9D A;  1S9G A;  2HND A;  4DSE A;  4FW2 A;  2BDP A;  5CYQ A;  3AVN A;  1HRH A;  4BWM A;  5HLF A;  4FJ9 A;  4CK1 A;  3RRG A;  4KAZ A;  4AH9 A;  4NCG A;  4CE9 A;  3L2V A;  3TAG A;  1XI1 A;  4FM0 A;  2KFN A;  3VQQ A;  4W5Q A;  1UOC A;  4DU3 A;  3KIO A;  3OS1 A;  2G8K A;  4KHY A;  1JLC A;  1LW0 A;  4DTN A;  4ELV A;  3NGZ A;  3SPZ A;  4LD0 A;  1LAW A;  5FDL A;  1ZYQ A;  4Z4H A;  4FLX A;  2DFH A;  3L8B A;  2FC0 A;  3M8S A;  4KO0 A;  3MXM A;  1TKZ A;  1SUQ A;  1C6V A;  4B9U A;  3PO4 A;  1TAU A;  2DTU A;  1GOA A;  4NCA A;  4Q5V A;  3AVM A;  3OJS A;  4FK2 A;  3KLG A;  2XO7 A;  4DSJ A;  3ZCM A;  1CZ9 A;  4DLE A;  3IRX A;  4CJL A;  3KD1 E;  1WSF A;  2A1S A;  2X6N A;  3G10 A;  4CGI A;  2IOC A;  3OJU A;  4IFY A;  4W5R A;  2HNZ A;  4RW4 A;  3VQ4 A;  3NH2 A;  2RPI A;  4G1Q A; 
#chains in the Genus database with same CATH topology
 3O3H A;  3L4I A;  3L3V A;  2A42 A;  3SYZ A;  4BC3 A;  2LSN A;  3C94 A;  4B3O A;  4E1J A;  1FW6 A;  3AA3 A;  3QLH A;  1RT3 A;  1KAY A;  2V52 B;  4OPK A;  3QEX A;  2VG6 A;  4FJH A;  2I5J A;  3CFO A;  3LPT A;  3VQ7 A;  1ILY A;  3QIC A;  4BDY A;  2XHB A;  1FKP A;  1TKX A;  3MX2 A;  3PX6 A;  1H1V A;  5FRO A;  4DCH A;  5HRP A;  5JVH L;  5AQP A;  3LDQ A;  2CGL A;  3P1G A;  2EX3 A;  2KLA A;  2Z1I A;  4F9O A;  1LOT B;  4DQS A;  3SV3 A;  2ZE2 A;  5M1K A;  3AAQ A;  1U04 A;  2O8D B;  2P5O A;  1K8K B;  2HW3 A;  3WNG A;  4DV3 K;  1ZBU A;  4KTW A;  4EHU A;  4IO9 L;  1YIT N;  4H5T A;  3CFR A;  4O8K A;  3O08 A;  1J5O A;  4YDU A;  1ASU A;  4JS4 A;  2OZS A;  1WOQ A;  2WON A;  4FO0 A;  1CXQ A;  1C0T A;  4WQ4 C;  1HNZ K;  2AP1 A;  4JEP A;  5M1Q A;  1VQ4 N;  3LZJ A;  4CIE A;  2YCH A;  2O8D A;  5ADX A;  3KHY A;  4CER A;  2ZM6 K;  1NKB A;  1K8K A;  5CZ2 A;  2P9K B;  4KHN A;  4FPB A;  3ENH A;  2QXL A;  4IFE A;  3VEW A;  4EZ9 A;  2D0C A;  4O0J A;  4CJE A;  1RBU A;  1QQC A;  3P39 A;  3QFP A;  4FWO A;  3ZSY A;  4M7X A;  2HHV A;  1WSJ A;  1GLB G;  4BE2 A;  1HKC A;  1QE1 A;  1DTQ A;  4CEA A;  3SBG A;  4H03 B;  3J7A P;  1NM1 A;  3VGK A;  4Y1D A;  3HTV A;  3O1B A;  3CCE N;  4DQQ A;  4OLA A;  3BGR A;  4X65 K;  4ISE A;  1LV5 A;  4F4K A;  3MCA B;  3MN6 A;  3WQU A;  2IC3 A;  1K6Y A;  1DKG D;  2P9K A;  3LL3 A;  5BPL A;  1G99 A;  3WT0 A;  4LH4 A;  3NMU A;  3ZT4 A;  1NGJ A;  1C0G A;  3OYM A;  3K5L A;  3SUP A;  3LWM A;  1VQP N;  1D5A A;  3QBX A;  1L5U A;  2EWS A;  4KHW A;  1L3U A;  1XC9 A;  4C8L A;  4CF1 A;  4JRQ A;  3S3M A;  1VQN N;  1VSK A;  3AVJ A;  3SBT A;  1LWF A;  1HNI A;  4CHO A;  3DYA A;  3SNN A;  1RBS A;  3SZ2 A;  4J2B A;  4ELU A;  3T1Y K;  1U4B A;  4DR1 K;  1NK5 A;  1VSH A;  3ZT2 A;  2NRT A;  3DLG A;  1NNE A;  3DRP A;  4DTM A;  4X66 K;  1S1W A;  3ULD A;  4BRP A;  2JGU A;  1NJW A;  1LAV A;  1JLA A;  4FSV A;  3TAB A;  5AQZ A;  2Y1I A;  4FJ7 A;  1S5J A;  4CZI A;  2OPR A;  3NVM A;  4BG8 A;  1BO5 O;  4DMN A;  1BQM A;  4DR2 K;  4FJJ A;  3QIO A;  1JLG A;  5BN9 A;  3FLC O;  3RSE B;  1X3N A;  5BN8 A;  2FXU A;  4A5A A;  4FWR A;  4X64 K;  1RDC A;  1SKW A;  2YHA A;  3CHW A;  3ID6 A;  4GNI A;  2ZJR L;  2IGI A;  3AVG A;  4I2P A;  1V4S A;  4EFH A;  2GWJ A;  1KCF A;  2PYJ A;  1YVU A;  2YNH A;  1K8A O;  3CJB A;  4KHP K;  4DV5 K;  4OPA A;  1NOY A;  1KRP A;  4KB1 A;  3O9T A;  2OA8 A;  4NCB A;  2ASM A;  1TL3 A;  1SL0 A;  2NLX A;  1RNH A;  3RSE A;  2KW4 A;  1D4X A;  4H8K A;  4YNQ A;  3NBP A;  1RT2 A;  3J7Y P;  1T03 A;  1TAQ A;  3GL1 A;  4OJR A;  2G8W A;  4B1Z A;  2QWQ A;  2NUB A;  1NJY A;  4JI8 K;  3U3G A;  2D0O A;  5C2F A;  1NWK A;  2IIR A;  4OGC A;  2UXC K;  1J54 A;  3VEX A;  3SPY A;  2HOE A;  3K5N A;  1Q9X A;  4OKE A;  2IS3 A;  3M8P A;  4CJ4 A;  3BF1 A;  3KD5 E;  4N47 A;  5JS1 A;  1DT9 A;  1N36 K;  2F8T A;  3C6H A;  4F3T A;  2ZQB A;  3SQ1 A;  4JK9 A;  2CGK A;  1KQS M;  2HVI A;  4CBW A;  2HHH K;  5SWM A;  1F21 A;  3QB0 A;  5CY4 A;  3V1R A;  4BRD A;  2G8H A;  3VGM A;  1ZBS A;  1EXQ A;  1VQ8 N;  4R5P A;  4JI4 K;  1Q82 O;  3VF6 A;  4DHY A;  1ZC6 A;  3NGY A;  3CCM N;  4TSX A;  1SKS A;  2DPN A;  1GLJ O;  2IAJ A;  4HUG A;  3PSI A;  4FM2 A;  4CHQ A;  4CF2 A;  3NDK A;  1NJZ A;  1ATR A;  2Z1G A;  4L3Q A;  4QS8 A;  4FL9 A;  4CED A;  4C8K A;  1Z25 A;  1C0F A;  3P83 D;  4DF4 A;  4FJG A;  5JLF A;  4JN4 A;  4A5B A;  3M8Q A;  4BR9 A;  4ZHR A;  2P9N B;  4O4G A;  1RTJ A;  3GG4 A;  1VQO N;  1N5Y A;  1KVA A;  1C1C A;  2E6L A;  4CFA A;  3QNN A;  2A41 A;  1BG3 A;  4FPA A;  4PL8 A;  2F96 A;  4JKB A;  1L3S A;  4HCC A;  4CEE A;  3KTQ A;  3KVG A;  3CC7 N;  2FSJ A;  3CPE A;  4E7L A;  3I56 N;  5HRR A;  3PV8 A;  5AQW A;  3G71 N;  5C2D A;  4FZX C;  5AQQ A;  3T69 A;  4IWV A;  4GKK K;  4CD3 A;  2P9N A;  4AM7 A;  3PUF A;  5AQF A;  3EO3 A;  1HYZ A;  4FLW A;  3SI6 A;  2BUP A;  3QIP A;  4LF9 K;  1BIZ A;  2YV0 X;  1GLC G;  3WUH A;  4BGB A;  4A62 A;  2BH1 A;  3F9M A;  1RT5 A;  4KHQ A;  1RTI A;  2ZWH A;  3WNE A;  3DOL A;  3CYM A;  1K73 O;  5KRT A;  4DTS A;  4B8A B;  4JHD B;  3DRR A;  1XUP O;  3ZSO A;  2KZM A;  2H3G X;  3VN5 A;  4BR4 A;  4CGD A;  3OY9 A;  2RE2 A;  5GAH P;  4FK0 A;  4DU1 A;  2P9P B;  4NLB A;  3ZX3 A;  1NK8 A;  2JWL A;  4EP5 A;  2Q0R A;  3BEX A;  4YHH K;  5KTQ A;  3HZ6 A;  5BR8 K;  3WEE B;  3VOV A;  2YKN A;  4X62 K;  1EO1 A;  4JHD A;  4CGG A;  3CCV N;  3SUN A;  1HYS A;  1IJJ A;  1VHX A;  4H4O A;  4E7H A;  4DSK A;  4CJP A;  5C25 A;  2D0A A;  3ZSV A;  1B9D A;  1RDU A;  4C8N A;  3DAW A;  5AQH A;  2P9P A;  3AVN A;  1HRH A;  5HLF A;  4QCL A;  4KAZ A;  3RRG A;  4NB4 A;  4CE9 A;  5AFU H;  5AZI B;  3TAG A;  4FM0 A;  4CZG A;  3VQQ A;  3TSQ A;  1OKJ A;  1T3V A;  2G8K A;  4KH5 A;  4ELV A;  3SPZ A;  4BG9 A;  5E84 A;  3O1W A;  3WEE A;  2FC0 A;  3M8S A;  1TUY A;  1SUQ A;  3B8A X;  3PO4 A;  2DTU A;  3OJS A;  5BR9 A;  4FK2 A;  3KLG A;  5AQM A;  4AQY K;  5BRD A;  2NRV A;  2HNZ A;  3VTI A;  3NH2 A;  3S41 A;  2RPI A;  4G1Q A;  4B1V A;  2GWK A;  1GOB A;  4RWT A;  4XIU A;  5EVZ A;  2ZJQ L;  4NXN K;  4CZM A;  4LF5 K;  5I9E B;  4JI5 K;  1ZBL A;  3LAK A;  4MLE A;  4R79 A;  3PSF A;  3VF4 A;  1HUX A;  2RHK A;  4HUF A;  5AZI A;  4DV0 K;  3L0Q A;  3EY1 A;  4B9Q A;  4BRN A;  1Q9Y A;  5AQX A;  3KLH A;  4FWN A;  2O4I A;  4XH5 A;  5DM6 L;  3HST B;  4RTF D;  4NXM K;  3VQC A;  1IKX A;  3QML A;  5J2M A;  5J2N A;  3FGU A;  2YJE A;  5FRM A;  5C15 A;  1JCG A;  3VA0 A;  1K9M O;  4CJ7 A;  1T44 A;  4DSI A;  2YNF A;  3THW B;  1UAX A;  1SAZ A;  4DTO A;  4CEO A;  1WBB A;  1S1T A;  1DTT A;  3V9U A;  4DQR A;  3QBW A;  2HBM A;  2BTF A;  3A8Y A;  2I7N A;  2VYP A;  2HF4 A;  4CEC A;  5CZ1 A;  4FWS A;  4H0V B;  1YXQ A;  3O4N A;  2B5J A;  3TTC A;  1UA0 A;  3OYF A;  3LAM A;  3PY8 A;  4W5T A;  4BRL A;  4GV3 A;  3HI0 A;  2FBY A;  3ENO A;  3O80 A;  3H6E A;  3VTH A;  2DFE A;  3G6E N;  3RTV A;  1VSJ A;  1FXX A;  1IKY A;  3PIO L;  1DGK N;  4CJ5 A;  4CJR A;  3T7Z A;  1U2V B;  3THW A;  2IVO A;  3I33 A;  1DEJ A;  4E19 A;  4FJ5 A;  4IEE A;  3OS2 A;  2HHS A;  5AQS A;  3OYN A;  1KTQ A;  4BRQ A;  3O9U A;  4H0T B;  1NU0 A;  5A2Q O;  2XY6 A;  3ZSZ A;  4BVO A;  1ASW A;  5GIN A;  1JCF A;  2GUP A;  4GVM A;  4DV2 K;  1IBL K;  1IV0 A;  3MEG A;  4DTX A;  3K58 A;  5I42 A;  3TWH A;  1HNV A;  5GIP A;  3CCQ N;  4IJA A;  4FWK A;  4WQ4 A;  5LJV A;  1NK6 A;  1U2V A;  3V9S A;  2WOM A;  2V7Y A;  2G8I A;  3QEI A;  4CEB A;  4OO1 J;  1BQN A;  5IT9 O;  2A5X A;  4CW7 B;  2HMP A;  1RBT A;  3A5N C;  4BR7 A;  2ZF5 O;  3R8E A;  4FZY A;  1SKR A;  1Q18 A;  4DLG A;  4L8R B;  3ULE B;  3SV4 A;  4N41 A;  3L2W A;  5ADX H;  4OGE A;  3KLF A;  1NGB A;  3QIN A;  4IZ9 A;  2ZGY A;  3WQT A;  3OYJ A;  3OA9 A;  5LMU K;  1N6Q A;  2HBL A;  1TKD A;  3DLB A;  1SL2 A;  4OX9 K;  3MDQ A;  4DS5 A;  1U45 A;  4CD1 A;  3CER A;  1NGG A;  2KKZ A;  3FR0 A;  2O8F B;  1QZ5 A;  1YJ9 N;  3SQ4 A;  4JI0 K;  4DKW A;  4EZ6 A;  4I7F A;  3PLA A;  5KPR A;  4Z0U A;  1JLF A;  4AHR A;  4WE1 A;  3LPU A;  3ULE A;  4IO8 A;  4I9Q A;  3TAF A;  3K9J A;  3CG7 A;  4NYF A;  1KAZ A;  3HBT A;  1VAZ A;  4ICL A;  5BRF A;  4DSF A;  3C95 A;  4DTU A;  5DM7 L;  3AO4 A;  1HJO A;  2KTQ A;  4CI6 A;  3AY9 A;  2D4W A;  2O8F A;  1HLU A;  4XEI A;  4F8R A;  2AA4 A;  2YJF A;  2OPS A;  4KFB A;  5M1P A;  1WSH A;  3ZET B;  1RIL A;  1FJG K;  3DRS A;  2WTU A;  1T05 A;  5GAG P;  4LF6 K;  3IS9 A;  3IUC A;  1W9H A;  4KRF A;  1JKH A;  3CCS N;  3LP0 A;  4LF7 K;  4FWP A;  4EP4 A;  3NF7 A;  3B6P A;  4BQZ A;  3HOS A;  5C0Y A;  4DQP A;  2E1Y A;  2E2Q A;  3P5J A;  4JV5 K;  4IDH A;  3D45 A;  4BVP A;  5ELZ A;  1TUU A;  3FFI A;  3EYZ A;  3NCI A;  3VA3 A;  3EN9 A;  1U48 A;  4I2Q A;  1ITG A;  3SAG A;  3KWI A;  4LFC K;  4PQU A;  3DOK A;  1U49 A;  2GEL A;  3KLE A;  3AA5 X;  1VQK N;  3NAE A;  3WXK A;  3DMJ A;  5JMV A;  5SZT A;  2F8S A;  3T1H K;  3ZET A;  2YI1 A;  2O8E B;  4M3W A;  3NF6 A;  4J2A A;  4B08 A;  1I3A A;  3M6G A;  2QK9 A;  1XMO K;  2Q3S A;  1MU2 A;  4QS9 A;  4HUE A;  2ETJ A;  3OYG A;  1YTA A;  2VWK A;  3DXM B;  3W0L A;  2GUI A;  2KQ2 A;  3PX4 A;  4WQ5 C;  1MDU B;  3OBY A;  4GVE A;  4IBN A;  4CGJ A;  1Z26 A;  5D3G A;  2OTL N;  4JI1 K;  2X74 A;  1QQM A;  2D1K A;  1O1W A;  3P38 A;  4NLC A;  5AR0 A;  4I9L A;  1IG9 A;  4WF9 L;  2E1Z A;  2VGN A;  1O13 A;  2Z1H A;  4M3Y A;  4ILJ A;  4FLT A;  2O8E A;  5JVG L;  2PY5 A;  1BIS A;  1UWB A;  5TKY A;  2NRW A;  2F9W A;  4MFB A;  2OZM A;  2X6S A;  2GTD A;  2IDO A;  3U6F A;  1OVQ A;  3NH1 A;  1X9M A;  3DXM A;  4H0P A;  4YOY A;  1GLF O;  3BDP A;  5BPM A;  1TAU A;  2ATQ A;  5GIO A;  4IKF A;  3TTF A;  1BIU A;  1KFS A;  3MN7 A;  3PIP L;  3LDL A;  3U3Y A;  1A5V A;  5GAD P;  4FJM A;  1IH7 A;  3LM2 A;  3U8X A;  4N56 A;  3J80 O;  4IOC L;  1VSE A;  2UXB K;  2HHU A;  3CPW M;  1TK8 A;  4W5O A;  4LC9 B;  1A5W A;  3V9W A;  3CM5 A;  2OPP A;  3TTD A;  4CZF A;  3UE5 A;  1Z05 A;  4DF8 A;  4IG3 A;  4AF1 A;  5M1F A;  3NGI A;  2A1R A;  1VSL A;  4M3T A;  3CMA N;  4PY5 A;  3DJC A;  5B8H A;  3A5O C;  3TAR A;  3CQ8 A;  4FVU A;  5F1X A;  1RT4 A;  4LSL A;  4Y1C A;  5EX5 A;  3VPZ A;  3EE8 A;  1I94 K;  4DV4 K;  2A6A A;  2YKM A;  3UB5 A;  4C8M A;  3TSU A;  4OLB A;  4CHY A;  1C0M A;  3H1Q A;  4CJK A;  4BRH A;  1KSP A;  4IOA L;  4CES A;  2W40 A;  2ASO A;  3ID8 A;  4KTQ A;  4IXC A;  5AQG A;  4PWD A;  5AQR A;  3R3L A;  3NHG A;  3K2P A;  4DV6 K;  1VQ7 N;  4M7Y A;  5KPT A;  5BRH A;  3VQ5 A;  2W42 A;  3D2F B;  2QW9 A;  4Z94 A;  4CF9 A;  3G4S N;  2QWP A;  4GV6 A;  5KQD A;  5DK5 A;  1NGI A;  3H08 A;  1WSG A;  1DLO A;  3VEO A;  4E7I A;  4BWJ A;  3QER A;  5LL6 Z;  4A2A A;  2ITM A;  1EET A;  1NGE A;  3H46 O;  4FCY A;  4O0I A;  4GW6 A;  3ASM A;  4FJK A;  2GEM A;  3HVT A;  2P9U B;  3AVK A;  3DI6 A;  5F2R A;  2GBZ A;  1IO2 A;  5LMN K;  2WBN A;  4K8X A;  4B9T A;  3D2F A;  3NF9 A;  1QSY A;  3CJ7 A;  4YFU A;  3WXJ A;  3CJC A;  1KC8 O;  5HP1 A;  1D9D A;  3JAM O;  1NMN A;  2HND A;  4BC2 A;  1IBK K;  4FJ9 A;  1XNQ K;  4CK1 A;  4BRA A;  2F9T A;  1UOC A;  1NGC A;  4DU3 A;  3OS1 A;  3U9D A;  1LAW A;  3CIP A;  5FDL A;  4Z4H A;  4FLX A;  1RGI A;  4KO0 A;  1TKZ A;  1C6V A;  3WXM B;  4B9U A;  2E2O A;  1GOA A;  4NCA A;  2P9U A;  2QWO A;  4DLE A;  1RFQ A;  3M1F A;  1WSF A;  2A1S A;  1J9A A;  1FKO A;  4BC4 A;  4BAC A;  5F0X A;  3GBT A;  4O5F A;  3S3O A;  3N4P A;  4CF8 A;  1KVB A;  4C1N K;  3SJH A;  3D7E O;  5HRO A;  3VMF B;  5T7B A;  2OTJ N;  3L2Q A;  4CFC A;  2NZT A;  2FBV A;  1RTH A;  3JXU A;  3LP1 A;  1CZB A;  2V51 B;  1YF5 L;  3OVN A;  3ATU A;  5AQN A;  5AQT A;  1RT7 A;  1ZXO A;  3WXI A;  1SL1 A;  3MEE A;  4MO5 A;  4CFD A;  4YOT A;  4UQG A;  4WFA L;  2VGM A;  2D0P A;  3BUZ B;  3SK3 A;  3NF8 A;  1SQK A;  1HMV A;  3GDQ A;  3A5M C;  2VQF K;  2YHW A;  3OS0 A;  3ZYY X;  5M1O A;  4E7K A;  1QQN A;  4H4M A;  4M3U A;  2UXD K;  1WAJ A;  1HR0 K;  1XMQ K;  1QS4 A;  1NGA A;  2YNI A;  3MN9 A;  5FPE A;  2NRZ A;  2OPQ A;  1E4G T;  1QSL A;  4CGH A;  3L3U A;  4HCB A;  1S1X A;  3QES A;  4FLY A;  3MCP A;  4CHZ A;  1QVG M;  4ILH A;  2E6M A;  1D9F A;  3QO9 A;  4DQ8 A;  4JKG B;  4A57 A;  3MWP A;  3CQX A;  1Y97 A;  3AGK A;  2O4G A;  1VSD A;  4FM1 A;  2Y1J A;  4B9L A;  3VET A;  1TYQ B;  3MWT A;  1U6Z A;  3VQE A;  5EU7 A;  1BA1 A;  1NK4 A;  1WSE A;  3T3F A;  1X1P A;  4B9V A;  4K42 A;  4NO7 A;  3F73 A;  3HXM A;  1WBD A;  3CC2 N;  2UUA K;  5HRS A;  2RN2 A;  3ZT1 A;  4J2E A;  2IVP A;  4K8Z A;  2XY8 A;  3D2E B;  3C0B A;  4HVJ A;  3VER A;  1X9J A;  3AVH A;  4JKG A;  5AQO A;  1NKE A;  1VRT A;  3E9O A;  4BRI A;  1GLE G;  1T6D A;  4CJF A;  1T8E A;  1IG8 A;  4JS5 A;  3O5B A;  4H0O A;  1TYQ A;  1YVN A;  2FF6 A;  3CI5 A;  4AM6 A;  5H1S Q;  4GY2 B;  4IOX A;  3UKR B;  1VSI A;  4J8F A;  1ATS A;  2E4L A;  3V9Z A;  3V1Q A;  4H0X B;  4WYB A;  1NJI O;  1TL1 A;  1TK0 A;  3OHR A;  2CH6 A;  4K25 A;  1Y64 A;  1YAG A;  3PX0 A;  3WNH A;  3CJA A;  3KKS A;  4DR5 K;  3ZT3 A;  1L3V A;  3D2E A;  1JXE A;  4ELT A;  4HHT A;  3DLH A;  5IWA K;  2W6K A;  4BC5 A;  1YUW A;  3A5L C;  3QEP A;  1QZ6 A;  1P8Z A;  4LH5 A;  4NYN A;  3R1X A;  2GV9 A;  3AVC A;  3N4Q A;  3H45 C;  4AHS A;  1YI2 N;  1JLB A;  4HWI A;  4YOR A;  1S1U A;  2JWK A;  3A2F A;  1ZBH A;  1CLQ A;  1JCE A;  1ATN A;  1P90 A;  4CGF A;  2ASP A;  4CF0 A;  4EAH D;  3NE6 A;  4BE0 A;  4B1W B;  3M5R A;  1EX4 A;  2HB5 A;  4OPJ A;  2QTD A;  1HPM A;  4ZTJ A;  2Q0U A;  4BRK A;  1BGX T;  3ISN C;  1WB9 A;  4H5R A;  5C12 A;  1U47 A;  1WAF A;  5J1E A;  5AQI A;  5FLX O;  1QQO A;  4V19 S;  1V4T A;  1N8R O;  4Q0B A;  3QDK A;  2F4V K;  3O6W A;  4LSN A;  2P9L B;  2VWB A;  4B1U B;  3HRG A;  3LZI A;  3A0I X;  4KKO A;  2P1J A;  4DS4 A;  3O9Q A;  4C1N I;  3CME N;  3S3N A;  2VWJ A;  2HBJ A;  4KH6 A;  4LY7 A;  1W7A A;  2UUC K;  4FJN A;  5AFU A;  3AVL A;  3SCX A;  5FRN A;  4CZJ A;  3TSP A;  1W2B M;  1N33 K;  3VEY A;  4OKJ A;  4BRG A;  4B1X B;  3SQ2 A;  3R9P A;  1BDG A;  2HVH A;  4DUY K;  4FJX A;  5AQK A;  1EKE A;  2OCE A;  2P9L A;  4PKG A;  1I39 A;  3AGR A;  3E9L A;  3F2K A;  5KI6 A;  2VG5 A;  1B9F A;  1S9E A;  2E8A A;  3VQ9 A;  1EP4 A;  3KKR A;  2FBX A;  3VQP A;  1C0U A;  1HNW K;  5AQY A;  4I6M B;  1RDW X;  3CQY A;  4FZZ A;  4F3O A;  4Z4E A;  5MLC Q;  3FZF A;  4C8O A;  3J8A A;  3WNF A;  2VCP A;  4FWM A;  1SS6 A;  4ISG A;  3OYE A;  4KHU A;  3DLK A;  3QFU A;  4JKD A;  2VG7 A;  4O55 A;  4C23 A;  4CJS A;  1HJR A;  3LDO A;  3KLI A;  4DWI A;  3LAN A;  5K14 A;  4CK3 A;  3HT3 A;  4JI7 K;  2ZD1 A;  5KPZ A;  5JIC A;  4KPY A;  1QSS A;  4YOW A;  4KRE A;  4BRF A;  3HVR A;  1KFD A;  3OYC A;  5LJW A;  4PUO A;  4B3M K;  4I6M A;  2G8U A;  2KHO A;  2Q31 A;  3FZM A;  4DTJ A;  1XC3 A;  4EIA A;  3AA2 A;  4Z4F A;  4KB0 A;  4K41 A;  3AA4 A;  5KGX A;  3JYT A;  3VEZ A;  1WLJ A;  1M1K O;  1KLN A;  1BCM A;  2QWM A;  2YHB A;  4PL7 A;  3TAE A;  4B9M A;  4RG8 A;  4PKI A;  4DUZ K;  4MQ3 A;  5JLH A;  4GMJ B;  3HP6 A;  3W3D A;  3V9X A;  1CZA N;  1VQ6 N;  4DSL A;  1HKB A;  2HHX A;  4JI3 K;  4B3S K;  3B6O A;  3IDH A;  4MO4 A;  3M3Z A;  1GOC A;  2IVN A;  4WQ5 A;  1XHX A;  3AVB A;  1RTD A;  4CK2 A;  1S72 N;  5BRE A;  3HL8 A;  2O8B B;  1LWC A;  1T6C A;  4MLH A;  3RRH A;  3OYI A;  4W5N A;  4YOU A;  4Y0W A;  3THX B;  4Z4G A;  3AO3 A;  1YJN N;  1KD1 O;  4O8U A;  4JI6 K;  1NJX A;  3V1O A;  4FWL A;  3OBW A;  1JXB A;  5EY4 A;  1E3M A;  4CFB A;  1NK9 A;  3V6D A;  2W6L A;  1HYV A;  5TKW A;  2QKB A;  4WFN L;  3U9Z A;  5HOO A;  1VQM N;  3PO5 A;  2P9I B;  3H3O B;  1TVR A;  3LWL A;  3MX5 A;  4LFA K;  4CEF A;  4CVN E;  1BI4 B;  4B3T K;  4BDZ A;  3SQ0 A;  3GOI A;  2O8B A;  4U7B A;  4BR2 A;  4KTZ A;  5BPN A;  2A40 A;  3HM9 A;  2RKI A;  1EQY A;  3I0R A;  4FLU A;  3L4Q A;  4H5W A;  3O3F A;  3THX A;  1RBR A;  4KI4 A;  4HTL A;  5GAE P;  3K5O A;  4DFM A;  4DFP A;  2I7P A;  3MMV A;  4WCE L;  2CGJ A;  4A61 A;  3O3G A;  3IAY A;  3VF2 A;  1MWK A;  3IG1 A;  5EXW A;  1W0H A;  3ZX2 A;  4QOZ B;  1QHA A;  2P9I A;  4CBU A;  1TV6 A;  1XNR K;  3AVI A;  5HRN A;  4K0K K;  2P5G A;  3OTO K;  3SUQ A;  1BI4 A;  3HPO A;  4F2R A;  4IFV A;  3THY B;  1R0A A;  2PAV A;  1W97 L;  1ZBF A;  3ITH A;  5CYM A;  3FZL A;  3CCL N;  3JSM A;  4E3S A;  4JNE A;  3QET A;  4BRC A;  4UY8 O;  1S9G A;  4DSE A;  5CYQ A;  1JJ2 M;  4BWM A;  4YOX A;  2YX6 A;  3L2V A;  1OH7 A;  1J6Z A;  3O9R A;  2NRR A;  2KFN A;  4DR3 K;  1N32 K;  2NRX A;  2YHX A;  4LD0 A;  1VQ5 N;  1ZYQ A;  3L8B A;  2HST A;  4U67 L;  3GE1 A;  4GKJ K;  4Q5V A;  3AVM A;  2XO7 A;  3H3N O;  4DSJ A;  1CZ9 A;  4CJL A;  3KD1 E;  2X6N A;  3G10 A;  3THY A;  4YDU C;  2IOC A;  3OJU A;  4IFY A;  4W5R A;  2NRH A;  3CET A;  3VQ4 A;  4AHV A;  1S6Q A;  3E01 A;  4M3R A;  4KI6 A;  5HBM A;  4E7J A;  4BR0 A;  4DTP A;  1HPZ A;  4DFK A;  3HPG A;  4CHN A;  3AVA A;  4MDB A;  3EKU A;  4WFB L;  4B9N A;  4JRP A;  4IJN A;  4H5N A;  3HP9 A;  4RCH A;  4BGA A;  4BE1 A;  1SZ2 A;  3AVF A;  3MEC A;  2Q2R A;  4FOE A;  1OH6 A;  3TAM A;  4BRM A;  3P4I A;  2FF3 B;  3O4Q A;  4RW8 A;  1BL3 A;  3J7Z O;  4OPH A;  1Q7Y O;  3LP2 A;  3AO2 A;  4FVM A;  2HBK A;  3D0P A;  4B8C A;  2WC9 A;  3FZK A;  3J81 O;  1ASV A;  1XQS C;  3MXJ A;  1RT6 A;  3C6A A;  3ZSW A;  3OYL A;  3K5M A;  2KZZ A;  4M63 C;  1C1A A;  2HHW A;  1KAX A;  3QNO A;  2Q36 A;  1RT1 A;  4DTR A;  3SJJ A;  4AHC A;  3NH0 A;  4BDP A;  3DM2 A;  2OYQ A;  1WNS A;  2XRI A;  1RDA A;  4QS7 A;  4H5V A;  4QAG A;  3R6M A;  1TGO A;  3E9P A;  4DR6 K;  1OH8 A;  2YNG A;  3JS6 A;  3TPQ A;  5I3U A;  3T19 A;  1T7P A;  1R59 O;  3CCJ N;  4DQI A;  3HPH A;  4IG0 A;  2B6A A;  5AZJ B;  3RVC A;  4AHU A;  1TKT A;  1XHZ A;  3KWG A;  2ZGZ A;  1JLE A;  2BE2 A;  3HO1 A;  5AQL A;  4CJV A;  2E88 A;  1QHT A;  4CEZ A;  3CCU N;  2UUB K;  1Q8I A;  1YJW N;  4HTU A;  1S1V A;  2PFU A;  1NMD A;  3KK3 A;  1YT3 A;  3RR7 A;  4RW7 A;  4LF8 K;  5AQJ A;  3OYH A;  1WSI A;  3SUO A;  4FXD A;  1KVC A;  3SAF A;  5C10 A;  4KH4 A;  2D5R A;  3BZK A;  3V81 A;  1WN7 A;  2Z1J A;  4ZTF A;  5M1N A;  4FYD A;  2J4R A;  1UA1 A;  4Z4I A;  5DMR A;  1LCU A;  5AZJ A;  4M3X A;  4JI2 K;  1C1B A;  3VQA A;  3HM8 A;  3KZB A;  4J2D A;  1J53 A;  3DWL A;  2RF2 A;  5KGW A;  4JYA K;  3KK7 A;  4G9Z A;  4CEQ A;  2G8V A;  3K0S A;  3HYF A;  3DLE A;  3FFK B;  4PHT X;  1NOZ A;  4H0Y B;  4ID1 A;  1TK5 A;  1VSM A;  3MED A;  4BRO A;  1NG9 A;  4ISF A;  2ITG A;  4DV7 K;  3G25 A;  4CHP A;  4E89 A;  4CZL A;  3IFR A;  1KLM A;  1JL1 A;  4CJW A;  4OKK A;  1CXU A;  4M41 A;  2X78 A;  1QTM A;  3FE1 A;  3MN5 A;  5AQV A;  2R7Y A;  1L3T A;  1X3M A;  4DU4 A;  4JK7 A;  3ZX0 A;  1B92 A;  1GLL O;  1RDB A;  5J2P A;  1RDD A;  4JKH A;  4N76 A;  5FPN A;  3AO5 A;  2XY7 A;  1LW2 A;  4JLH A;  4CZH A;  2QXF A;  4M42 A;  5C24 A;  5CHI A;  4FWQ A;  3ALY A;  4JKC A;  2UU9 K;  3L6Q A;  1N34 K;  1EWQ A;  4XH4 A;  3I8B A;  1A5X A;  4ID5 A;  3OYA A;  4IDK A;  4KV8 A;  3S9H A;  3K59 A;  4JAX A;  4PA1 A;  1YTU A;  1XWL A;  2EHG A;  3EZ5 A;  5E41 A;  3DXK B;  3ZEU B;  2AJQ A;  1NK7 A;  3O9S A;  1VQ9 N;  2D0B A;  3CJ1 A;  4CJQ A;  1IBM K;  4JD2 B;  4AIL C;  4DV1 K;  1NLV A;  3DLR A;  4DFJ A;  3NVK A;  4DB3 A;  3G0Z A;  1VQL N;  4K43 A;  3V4I A;  1M90 O;  5FPD A;  3HOT A;  1E4F T;  2HF3 A;  3K57 A;  4AHT A;  1NBW A;  3Q7C A;  2FBT A;  3AAR A;  3CC4 N;  5KRS A;  5LY3 A;  2YHY A;  3C6T A;  1IKW A;  3DLL L;  1BHL A;  3EKS A;  4MDA A;  2HHQ A;  3U4L A;  1MWM A;  2DY4 A;  4BR5 A;  5E26 A;  2G8F A;  1VK0 A;  1NGH A;  1REV A;  3HJF A;  3RMC A;  2WFB A;  3DXK A;  3C65 A;  3ZEU A;  4A2B A;  2F7T A;  4JKA A;  5FPM A;  4CJT A;  2JLE A;  4DR7 K;  3ATV A;  1LWE A;  4JD2 A;  4BRE A;  1ZBI A;  1HX1 A;  2P51 A;  3ZSX A;  2PZS A;  2WUS A;  1JL2 A;  1RCH A;  3THV A;  5AJ3 K;  2QWR A;  3ENB A;  4RW9 A;  4ILG B;  3CF5 L;  3CD6 N;  3WXL A;  2O8C B;  4EHT A;  3AO1 A;  1NKC A;  2ZJP L;  2FLO A;  3TAN A;  1Z6R A;  1HQE A;  1IKV A;  3IMX A;  3KK2 A;  4BQL A;  1ESV A;  3VQB A;  2QM1 A;  5KQ8 A;  3OYK A;  3D6R A;  2DFF A;  5HL7 L;  3HK2 A;  3RMD A;  1HNX K;  3HSC A;  4B9S A;  4E0D A;  3VQ6 A;  2QWN A;  3EEQ A;  3MK6 A;  4M45 A;  4FK4 A;  4CIF A;  3L2R A;  2E20 A;  3QEW A;  4BY9 C;  3EZW A;  1Q86 O;  3KK1 A;  3O8M A;  3TAP A;  3UIQ A;  2O8C A;  1NK0 A;  1EWR A;  3VGL A;  2FSN A;  4KHS A;  3TAQ A;  4A59 A;  2OAN A;  1OVY A;  3KJV A;  3TU5 A;  2FSK A;  3CCR N;  3CM6 A;  3AV9 A;  4CJU A;  2PBD A;  4FW1 A;  3UKR A;  3TI0 A;  3I0S A;  3LP3 A;  3ZLJ A;  1JLQ A;  4FLZ A;  3TR8 A;  3H1V X;  1GLA G;  4JKE A;  3L2U A;  1Q81 O;  2CH5 A;  3K9K A;  4O5B A;  3UKU B;  4FJ8 A;  3BF3 A;  1HKG A;  4PKH A;  4B3R K;  3BZC A;  3CXC M;  2QWL A;  5CR4 A;  3ZT0 A;  3ZSR A;  4OVL A;  4CJ3 A;  2GX9 A;  3M8R A;  3CFP A;  3MXI A;  4GV9 A;  3VQ8 A;  2W41 A;  1BUP A;  3RMB A;  3FZH A;  2HNY A;  1YHQ N;  1RBV A;  1HQU A;  2BAN A;  2BGG A;  1D8Y A;  4F2S A;  2VQE K;  1NGD A;  5J2Q A;  3EL2 A;  2QKK A;  4E1N A;  3VEN A;  2NNW A;  1BCO A;  4RW6 A;  2P9S B;  1S6P A;  2UYT A;  3UKU A;  1X9W A;  3F9K A;  4YY3 K;  4CBX A;  2Q97 A;  2HMI A;  2Q1N A;  3P31 A;  3RR8 A;  3OYD A;  2V7Z A;  1WUA A;  4YOV A;  4O44 A;  4JKF A;  3IKM A;  3SLC A;  3NFA A;  5AQU A;  3QEV A;  2E2P A;  3C6U A;  3LDP A;  3SMP A;  3SMS A;  4DR4 K;  4N5S A;  4FJL A;  1OH5 A;  3Q7B A;  4XH1 A;  5JS2 A;  2QI2 A;  3T1A A;  5EOY A;  3I8D A;  3OW2 M;  2HHT A;  2PYL A;  4CZE A;  4FJI A;  3AAP A;  3LAL A;  1G15 A;  4Z4C A;  3C7N B;  5C42 A;  3CJ9 A;  2P9S A;  3MAQ A;  4LFB K;  4B1Y B;  4IEI A;  3VQD A;  2XY5 A;  1NGF A;  2B4J A;  1QVF M;  2KFZ A;  1MA9 B;  2QA4 N;  3LDS A;  3RWU A;  1FK9 A;  3ZSQ A;  1YIJ N;  3OYB A;  4FOI A;  1VRU A;  1SV5 A;  4M3Z A;  4E1M A;  1VSF A;  4DG1 A;  1X9S A;  4CCH A;  3EE9 A;  3RMA A;  2E5L K;  3E66 A;  4CIG A;  1BU6 O;  4FLV A;  3LM9 A;  4FW2 A;  5CE3 A;  2BDP A;  4AH9 A;  4NCG A;  1J5E K;  1XI1 A;  4CZK A;  3I55 N;  4W5Q A;  4LF4 K;  3KIO A;  4KHY A;  1JLC A;  1LW0 A;  4DTN A;  3NGZ A;  1BA0 A;  3BY5 A;  3C7N A;  3LDN A;  2DFH A;  3E1Y A;  1S3X A;  4JK8 A;  3MXM A;  3O4W A;  2E2N A;  3F5T A;  1KXP A;  1GLD G;  3BP8 A;  3VEV A;  1BWF O;  4KBO A;  3ZCM A;  3VES A;  3SAH A;  3IRX A;  2QEX N;  4CGI A;  1BOT O;  1S22 A;  4RW4 A;  2A3Z A; 
#chains in the Genus database with same CATH homology
 3O3H A;  4AHV A;  1GOB A;  1J9A A;  3L3V A;  1FKO A;  1S6Q A;  4BAC A;  4XIU A;  3SYZ A;  3E01 A;  4M3R A;  4KI6 A;  3S3O A;  2LSN A;  5HBM A;  4E7J A;  4DTP A;  1ZBL A;  1HPZ A;  4CF8 A;  1KVB A;  3C94 A;  3LAK A;  4B3O A;  3AA3 A;  3HPG A;  4CHN A;  4HUF A;  4DFK A;  3AVA A;  1RT3 A;  3QLH A;  5HRO A;  5T7B A;  4B9N A;  3L2Q A;  4CFC A;  4OPK A;  2FBV A;  4JRP A;  3QEX A;  1RTH A;  2VG6 A;  3HP9 A;  3LP1 A;  3EY1 A;  4BE1 A;  1CZB A;  4FJH A;  2I5J A;  3CFO A;  3LPT A;  3OVN A;  3VQ7 A;  3AVF A;  1RT7 A;  3MEC A;  1Q9Y A;  4BDY A;  3KLH A;  2XHB A;  1FKP A;  1TKX A;  3PX6 A;  2O4I A;  5FRO A;  3TAM A;  5HRP A;  1SL1 A;  3O4Q A;  4RW8 A;  3P1G A;  1BL3 A;  3MEE A;  2EX3 A;  3AO2 A;  3HST B;  3LP2 A;  4FVM A;  4CFD A;  3D0P A;  4UQG A;  2Z1I A;  4B8C A;  4DQS A;  3SV3 A;  1ASV A;  3NF8 A;  2ZE2 A;  1HMV A;  1RT6 A;  1U04 A;  3MXJ A;  3VQC A;  1IKX A;  3ZSW A;  3OYL A;  3K5M A;  5J2M A;  5J2N A;  2P5O A;  2KZZ A;  3OS0 A;  5FRM A;  2HW3 A;  3WNG A;  1C1A A;  4E7K A;  1ZBU A;  2HHW A;  4H4M A;  4M3U A;  3VA0 A;  4KTW A;  1WAJ A;  3QNO A;  1QS4 A;  4DSI A;  1RT1 A;  2YNF A;  4DTR A;  2YNI A;  1UAX A;  3SJJ A;  4AHC A;  3NH0 A;  4DTO A;  3DM2 A;  3CFR A;  4CEO A;  4BDP A;  1J5O A;  2OYQ A;  1WNS A;  2OPQ A;  1S1T A;  2XRI A;  1DTT A;  1RDA A;  3V9U A;  4DQR A;  4QAG A;  1ASU A;  1TGO A;  4JS4 A;  1QSL A;  2OZS A;  4CGH A;  3L3U A;  4HCB A;  1S1X A;  3QES A;  4FLY A;  2YNG A;  4CHZ A;  5I3U A;  3T19 A;  2WON A;  1T7P A;  4CEC A;  5CZ1 A;  1CXQ A;  1C0T A;  4DQI A;  3HPH A;  2E6M A;  4IG0 A;  1D9F A;  2B6A A;  3O4N A;  2B5J A;  3LZJ A;  3QO9 A;  1UA0 A;  4AHU A;  1TKT A;  3OYF A;  1XHZ A;  3LAM A;  3PY8 A;  4W5T A;  4CIE A;  1Y97 A;  2O4G A;  4CER A;  1VSD A;  1JLE A;  2BE2 A;  3HO1 A;  1NKB A;  2FBY A;  5CZ2 A;  4FM1 A;  2Y1J A;  4KHN A;  4CJV A;  2DFE A;  4B9L A;  1QHT A;  4CEZ A;  3RTV A;  1Q8I A;  1VSJ A;  4HTU A;  1S1V A;  1FXX A;  1IKY A;  4EZ9 A;  3KK3 A;  2D0C A;  4O0J A;  1YT3 A;  3VQE A;  4RW7 A;  1RBU A;  4CJ5 A;  5EU7 A;  4CJE A;  4CJR A;  3RR7 A;  1QQC A;  1NK4 A;  1WSE A;  3OYH A;  1WSI A;  3SUO A;  3T3F A;  1X1P A;  4B9V A;  4FXD A;  3ZSY A;  3F73 A;  2HHV A;  1KVC A;  1WSJ A;  3HXM A;  4E19 A;  4BE2 A;  4FJ5 A;  2D5R A;  3V81 A;  1QE1 A;  1WN7 A;  5HRS A;  2Z1J A;  3HPO A;  1DTQ A;  2RN2 A;  3OS2 A;  3ZT1 A;  4ZTF A;  4J2E A;  4CEA A;  2HHS A;  3OYN A;  1KTQ A;  4FYD A;  4Y1D A;  1UA1 A;  4K8Z A;  4Z4I A;  2XY8 A;  5DMR A;  2XY6 A;  4DQQ A;  4OLA A;  4M3X A;  3BGR A;  3ZSZ A;  4HVJ A;  3AVH A;  1NKE A;  1LV5 A;  1C1B A;  1ASW A;  3VQA A;  4F4K A;  1VRT A;  4J2D A;  1J53 A;  4CJF A;  2IC3 A;  1K6Y A;  2RF2 A;  4GVM A;  5KGW A;  1T8E A;  4LH4 A;  3MEG A;  4CEQ A;  4JS5 A;  2G8V A;  4DTX A;  3K58 A;  5I42 A;  3TWH A;  1HNV A;  3HYF A;  3ZT4 A;  3DLE A;  1NK6 A;  3OYM A;  3K5L A;  3SUP A;  3LWM A;  3V9S A;  4DSK A;  2WOM A;  1D5A A;  1NOZ A;  1L5U A;  2G8I A;  3QEI A;  4CEB A;  4ID1 A;  1BQN A;  1TK5 A;  1VSM A;  3MED A;  1VSI A;  1L3U A;  4KHW A;  1XC9 A;  1RBT A;  2E4L A;  4C8L A;  3V9Z A;  3V1Q A;  4CF1 A;  2ITG A;  4JRQ A;  4FZY A;  4CHP A;  1TL1 A;  3S3M A;  1SKR A;  4E89 A;  1TK0 A;  4DLG A;  4L8R B;  1KLM A;  1JL1 A;  4CJW A;  3SV4 A;  1VSK A;  4OKK A;  4N41 A;  3L2W A;  3AVJ A;  1CXU A;  4M41 A;  3PX0 A;  2X78 A;  3WNH A;  1LWF A;  3KKS A;  1QTM A;  4OGE A;  1HNI A;  3ZT3 A;  4CHO A;  3KLF A;  1L3V A;  3DYA A;  3SNN A;  3QIN A;  1RBS A;  1JXE A;  3SZ2 A;  4J2B A;  4ELT A;  4ELU A;  4HHT A;  3OYJ A;  3DLH A;  1U4B A;  2R7Y A;  1N6Q A;  1TKD A;  3DLB A;  1SL2 A;  1L3T A;  1NK5 A;  1VSH A;  3ZT2 A;  4DS5 A;  4DU4 A;  3QEP A;  1U45 A;  3DLG A;  1B92 A;  3DRP A;  4DTM A;  4LH5 A;  4NYN A;  1RDB A;  1S1W A;  3ULD A;  5J2P A;  1RDD A;  4N76 A;  2JGU A;  1NJW A;  1LAV A;  2GV9 A;  1JLA A;  3SQ4 A;  3TAB A;  3AVC A;  4EZ6 A;  2Y1I A;  4FJ7 A;  3AO5 A;  2XY7 A;  1LW2 A;  4JLH A;  4I7F A;  1S5J A;  4AHS A;  1JLB A;  4Z0U A;  1S1U A;  2OPR A;  3A2F A;  2QXF A;  4M42 A;  1ZBH A;  1JLF A;  1CLQ A;  4AHR A;  4WE1 A;  3LPU A;  5C24 A;  4DMN A;  3ALY A;  1BQM A;  4CGF A;  4FJJ A;  4CF0 A;  3QIO A;  1A5X A;  4I9Q A;  1JLG A;  3TAF A;  4ID5 A;  3NE6 A;  4BE0 A;  3CG7 A;  3OYA A;  1EX4 A;  4IDK A;  4KV8 A;  1RDC A;  2HB5 A;  4NYF A;  4OPJ A;  2YHA A;  3K59 A;  3S9H A;  1SKW A;  4PA1 A;  1YTU A;  1XWL A;  4ICL A;  2EHG A;  4ZTJ A;  1BGX T;  3ISN C;  3EZ5 A;  4DSF A;  1U47 A;  3C95 A;  2IGI A;  5E41 A;  1WAF A;  3AVG A;  4I2P A;  5J1E A;  4DTU A;  2AJQ A;  1NK7 A;  3AO4 A;  2D0B A;  2KTQ A;  4Q0B A;  4CJQ A;  4AIL C;  3DLR A;  4LSN A;  4DFJ A;  3G0Z A;  3LZI A;  4F8R A;  3V4I A;  1KCF A;  2PYJ A;  4KKO A;  1YVU A;  2P1J A;  2YNH A;  4DS4 A;  3K57 A;  4AHT A;  2OPS A;  4KFB A;  3S3N A;  2VWJ A;  2FBT A;  1KRP A;  4LY7 A;  1WSH A;  1NOY A;  5KRS A;  1RIL A;  4KB1 A;  3DRS A;  4FJN A;  2OA8 A;  3AVL A;  3C6T A;  4NCB A;  3SCX A;  1IKW A;  1TL3 A;  1T05 A;  1SL0 A;  1BHL A;  2HHQ A;  1RNH A;  3IS9 A;  5FRN A;  1W9H A;  2KW4 A;  4H8K A;  4YNQ A;  4KRF A;  2DY4 A;  3NBP A;  1JKH A;  1RT2 A;  3LP0 A;  4EP4 A;  4OKJ A;  1T03 A;  1TAQ A;  4OJR A;  2G8W A;  3NF7 A;  2G8F A;  1VK0 A;  1REV A;  3HJF A;  3B6P A;  3RMC A;  4DQP A;  2NUB A;  3SQ2 A;  3P5J A;  1NJY A;  2HVH A;  3U3G A;  3D45 A;  3VA3 A;  4CJT A;  3FFI A;  3EYZ A;  3NCI A;  1U48 A;  2JLE A;  4FJX A;  4I2Q A;  1ITG A;  1LWE A;  1EKE A;  4OGC A;  1ZBI A;  1J54 A;  2P51 A;  1I39 A;  4PQU A;  3SPY A;  3DOK A;  3ZSX A;  1U49 A;  3K5N A;  5KI6 A;  2VG5 A;  1Q9X A;  2PZS A;  1B9F A;  1S9E A;  4OKE A;  2IS3 A;  3M8P A;  3KLE A;  1JL2 A;  3VQ9 A;  1EP4 A;  3AA5 X;  1RCH A;  4CJ4 A;  3KKR A;  3NAE A;  3THV A;  3DMJ A;  5SZT A;  2FBX A;  3KD5 E;  2F8S A;  4RW9 A;  4N47 A;  3VQP A;  1C0U A;  5JS1 A;  4M3W A;  3NF6 A;  4J2A A;  4B08 A;  2F8T A;  4FZZ A;  4F3O A;  4Z4E A;  4F3T A;  1I3A A;  2QK9 A;  4C8O A;  2ZQB A;  2Q3S A;  3SQ1 A;  3WNF A;  3AO1 A;  1MU2 A;  1NKC A;  4HUE A;  2HVI A;  5SWM A;  3TAN A;  3OYE A;  4QCL A;  2ETJ A;  4KHU A;  1F21 A;  5CY4 A;  1YTA A;  2VWK A;  3V1R A;  1HQE A;  3OYG A;  2G8H A;  3DLK A;  2GUI A;  2KQ2 A;  1IKV A;  1EXQ A;  3PX4 A;  2VG7 A;  3KK2 A;  3VQB A;  4R5P A;  4O55 A;  4CJS A;  1HJR A;  3OYK A;  3NGY A;  3KLI A;  4IBN A;  4TSX A;  3LAN A;  5K14 A;  4CGJ A;  1SKS A;  4DWI A;  1Z26 A;  4CK3 A;  3HT3 A;  2IAJ A;  2DFF A;  4HUG A;  5D3G A;  2X74 A;  2ZD1 A;  3HK2 A;  4FM2 A;  3RMD A;  4B9S A;  4CHQ A;  4CF2 A;  1O1W A;  4E0D A;  3VQ6 A;  3NDK A;  1NJZ A;  4KPY A;  4M45 A;  4I9L A;  2Z1G A;  1IG9 A;  1QSS A;  4KRE A;  4FK4 A;  4CIF A;  4CED A;  3HVR A;  4C8K A;  1Z25 A;  2Z1H A;  3L2R A;  4M3Y A;  1KFD A;  3OYC A;  3QEW A;  3P83 D;  4DF4 A;  4FJG A;  4FLT A;  4PUO A;  3M8Q A;  4ZHR A;  2PY5 A;  2G8U A;  4O4G A;  1RTJ A;  1BIS A;  3KK1 A;  1UWB A;  4DTJ A;  3TAP A;  4MFB A;  3UIQ A;  2OZM A;  1N5Y A;  1KVA A;  2X6S A;  1C1C A;  2E6L A;  2IDO A;  3AA2 A;  4CFA A;  3QNN A;  3U6F A;  1NK0 A;  4KHS A;  4Z4F A;  3TAQ A;  3NH1 A;  1X9M A;  2F96 A;  4KB0 A;  3KJV A;  1L3S A;  4HCC A;  4CEE A;  3KTQ A;  3AA4 A;  5KGX A;  3CM6 A;  3JYT A;  1WLJ A;  3BDP A;  1KLN A;  1BCM A;  2YHB A;  3AV9 A;  4E7L A;  4CJU A;  2ATQ A;  4FW1 A;  5HRR A;  3TAE A;  3PV8 A;  1BIU A;  3TI0 A;  1KFS A;  4B9M A;  4IKF A;  4RG8 A;  3I0S A;  3LP3 A;  1JLQ A;  4FLZ A;  3U3Y A;  4MQ3 A;  3TR8 A;  4FZX C;  4GMJ B;  3HP6 A;  1A5V A;  4FJM A;  3L2U A;  3V9X A;  1IH7 A;  4N56 A;  1VSE A;  4O5B A;  4DSL A;  4FJ8 A;  2HHU A;  2HHX A;  1TK8 A;  4W5O A;  1A5W A;  3B6O A;  3V9W A;  1GOC A;  3CM5 A;  2OPP A;  1XHX A;  3AVB A;  3PUF A;  1RTD A;  4CK2 A;  1HYZ A;  3ZT0 A;  4DF8 A;  4IG3 A;  4OVL A;  3ZSR A;  4CJ3 A;  3HL8 A;  3M8R A;  1LWC A;  3CFP A;  4FLW A;  3NGI A;  3MXI A;  2A1R A;  3VQ8 A;  3SI6 A;  3RRH A;  3OYI A;  3QIP A;  1VSL A;  3RMB A;  1BIZ A;  4M3T A;  2HNY A;  4PY5 A;  2YV0 X;  4W5N A;  1RBV A;  1HQU A;  4Z4G A;  2BAN A;  3AO3 A;  3TAR A;  3CQ8 A;  1RT4 A;  4LSL A;  4Y1C A;  1NJX A;  1D8Y A;  3V1O A;  4F2S A;  2BGG A;  5J2Q A;  1JXB A;  1RT5 A;  2QKK A;  4CFB A;  2YKM A;  4E1N A;  3V6D A;  1NK9 A;  4KHQ A;  1BCO A;  4RW6 A;  1HYV A;  4C8M A;  1RTI A;  1S6P A;  4CHY A;  4OLB A;  1C0M A;  3WNE A;  4CJK A;  2QKB A;  3DOL A;  3CYM A;  1KSP A;  5KRT A;  1X9W A;  3PO5 A;  3F9K A;  3LWL A;  1TVR A;  4CES A;  4DTS A;  4B8A B;  4KTQ A;  3DRR A;  4CEF A;  2HMI A;  4PWD A;  3NHG A;  1BI4 B;  3K2P A;  4BDZ A;  3OYD A;  3SQ0 A;  3RR8 A;  3ZSO A;  2KZM A;  3VQ5 A;  2W42 A;  4CF9 A;  4O44 A;  3VN5 A;  4KTZ A;  4CGD A;  3HM9 A;  3OY9 A;  2RKI A;  3NFA A;  3I0R A;  4FLU A;  4FK0 A;  3QEV A;  4DU1 A;  3O3F A;  4KI4 A;  1RBR A;  5DK5 A;  3C6U A;  3H08 A;  1WSG A;  1DLO A;  4DFM A;  3K5O A;  1NK8 A;  4DFP A;  4E7I A;  4BWJ A;  4EP5 A;  4N5S A;  4FJL A;  3QER A;  5JS2 A;  3T1A A;  3I8D A;  3O3G A;  5KTQ A;  1EET A;  2PYL A;  3IAY A;  4FJI A;  2HHT A;  3LAL A;  1G15 A;  4GW6 A;  4Z4C A;  5C42 A;  4O0I A;  4FCY A;  3MAQ A;  3IG1 A;  2YKN A;  3ASM A;  4FJK A;  1W0H A;  4QOZ B;  3VQD A;  2XY5 A;  1TV6 A;  2B4J A;  2KFZ A;  3AVI A;  4CGG A;  5HRN A;  3HVT A;  3SUN A;  2P5G A;  1HYS A;  3LDS A;  3SUQ A;  3RWU A;  4E7H A;  1BI4 A;  1FK9 A;  3AVK A;  3DI6 A;  4H4O A;  4IFV A;  3ZSQ A;  4CJP A;  2GBZ A;  1IO2 A;  5C25 A;  4F2R A;  2D0A A;  3OYB A;  1VRU A;  1R0A A;  3ZSV A;  4B9T A;  4K8X A;  1ZBF A;  1SV5 A;  3NF9 A;  4E1M A;  4M3Z A;  1QSY A;  1VSF A;  4DG1 A;  3ITH A;  1B9D A;  1X9S A;  4CCH A;  4C8N A;  3RMA A;  5CYM A;  4YFU A;  3JSM A;  4E3S A;  3QET A;  5HP1 A;  4CIG A;  4FLV A;  1D9D A;  1S9G A;  2HND A;  4DSE A;  4FW2 A;  2BDP A;  5CYQ A;  3AVN A;  1HRH A;  4BWM A;  5HLF A;  4FJ9 A;  4CK1 A;  3RRG A;  4KAZ A;  4AH9 A;  4NCG A;  4CE9 A;  3L2V A;  3TAG A;  1XI1 A;  4FM0 A;  2KFN A;  3VQQ A;  4W5Q A;  1UOC A;  4DU3 A;  3KIO A;  3OS1 A;  2G8K A;  4KHY A;  1JLC A;  1LW0 A;  4DTN A;  4ELV A;  3NGZ A;  3SPZ A;  4LD0 A;  1LAW A;  5FDL A;  1ZYQ A;  4Z4H A;  4FLX A;  2DFH A;  3L8B A;  2FC0 A;  3M8S A;  4KO0 A;  3MXM A;  1TKZ A;  1SUQ A;  1C6V A;  4B9U A;  3PO4 A;  1TAU A;  2DTU A;  1GOA A;  4NCA A;  4Q5V A;  3AVM A;  3OJS A;  4FK2 A;  3KLG A;  2XO7 A;  4DSJ A;  3ZCM A;  1CZ9 A;  4DLE A;  3IRX A;  4CJL A;  3KD1 E;  1WSF A;  2A1S A;  2X6N A;  3G10 A;  4CGI A;  2IOC A;  3OJU A;  4IFY A;  4W5R A;  2HNZ A;  4RW4 A;  3VQ4 A;  3NH2 A;  2RPI A;  4G1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...