5HRSA

Hiv integrase catalytic domain containing f185k + a124n + t125a mutations complexed with gsk0002
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSNAVKAACWWAGIKQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhibitor
total genus 51
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrsA00
1BI4B 1TVRA 1XWLA 3CFOA 3KKRA 4Z4GA 1L3VA 4CHNA 2ZD1A 1TAQA 4DG1A 3KK3A 3KLHA 3KLEA 3AO2A 4FXDA 3NCIA 1SL1A 4Q0BA 4FVMA 5KTQA 1IO2A 1KVAA 4K8XA 1RDDA 4E7HA 4DSEA 5JS1A 3QEIA 2DFEA 4TSXA 1EETA 2OPPA 1VSMA 4BE2A 3VQ9A 4BACA 1FK9A 4FJIA 1UOCA 3AVIA 2KQ2A 1S1XA 3ZSOA 3QEPA 2PY5A 1RT1A 1J54A 4CF2A 4FZYA 2HHTA 2YV0X 3DMJA 2LSNA 4JLHA 3TAQA 3NHGA 5JS2A 5C24A 2FBTA 4LD0A 4RW7A 4FW1A 4CE9A 3NGZA 4RW4A 5DK5A 1C1CA 4DTRA 3A2FA 4AHCA 3VQEA 3VA3A 3SUPA 1KSPA 4DSKA 1BIUA 4ELTA 2ITGA 3LP1A 5FROA 1RTJA 1HYZA 1VRUA 1JL2A 2VG5A 4DTPA 4GW6A 3SJJA 4C8OA 2HVHA 1NJZA 3SQ0A 3K59A 2Q3SA 3QIPA 3C6UA 1RBSA 1QSYA 3AVKA 1LWEA 2NUBA 2QK9A 2YKMA 1GOAA 3ITHA 1VSHA 1XHXA 3IS9A 4DTNA 3AVLA 4NCGA 4B3OA 2DY4A 4FW2A 4CF8A 3NE6A 4ZHRA 2YKNA 1TV6A 3CFRA 4I7FA 1WSIA 4W5OA 1BISA 3SV4A 4DTXA 3LZJA 3NDKA 3SCXA 3ZT0A 2RN2A 3MXJA 3VQAA 2VG6A 1Y97A 1O1WA 3L2UA 3CYMA 3TABA 5I3UA 1T03A 1NJWA 4L8RB 1VSDA 3QNNA 1NK6A 4DQIA 1CXQA 3AA2A 5EU7A 1JLCA 1HJRA 1RTHA 1WAFA 4DTMA 2PZSA 2Z1HA 1K6YA 4IFVA 4W5QA 3HP6A 3VA0A 2G8IA 3HVRA 4CF9A 1NK4A 1ZBHA 2IOCA 1C1BA 3LDSA 2OA8A 1S6PA 2FC0A 1S9GA 4H8KA 4C8MA 3HP9A 3ZT4A 4YFUA 3K57A 3PV8A 5HP1A 4OJRA 3L3VA 4DQSA 4KRFA 4DU1A 3SQ1A 4CHOA 3S3NA 3NF9A 3DLRA 3SYZA 4DSJA 1QSSA 4M3RA 2X6SA 2G8HA 1TKZA 3RMAA 3DLKA 2XY5A 1TKDA 2B5JA 3HL8A 2G8VA 4PA1A 1SV5A 4CJEA 5CZ2A 2X78A 4CHYA 4CEBA 4BWMA 4KTZA 3CQ8A 3TAMA 2PYJA 1JKHA 2GV9A 4DQRA 2P51A 1EKEA 4AHUA 3KD1E 1GOCA 4ID1A 2HHWA 4J2DA 3ZSVA 4PWDA 3V1RA 4G1QA 4M42A 4C8LA 5DMRA 2B6AA 3AVGA 4HHTA 4IFYA 1TKTA 4N76A 1IKXA 1BQMA 1U04A 4FJHA 3AVJA 2A1RA 3OS2A 3U3GA 3G10A 3KK1A 3S3OA 2KTQA 1LWFA 3DLGA 1NK7A 1HYVA 3QINA 4CEFA 3KLFA 4LSLA 1IKYA 1HNIA 3G0ZA 4E7IA 3P83D 4HCCA 3AVNA 3ZT2A 1KTQA 3TR8A 1RDAA 1ASUA 1JLQA 4B8CA 3TWHA 3LWMA 3RMDA 3PX6A 3THVA 3WNFA 1Q8IA 2VG7A 2WONA 1S1VA 3ASMA 4E1NA 1D9FA 1TL1A 1IG9A 2HNDA 4QOZB 3C95A 4I9LA 4LH5A 3LWLA 3D45A 4Z4FA 1QSLA 3L2RA 4FLYA 4CIFA 4BDZA 2B4JA 3NGYA 1JXBA 5J2MA 4N47A 3OS1A 4M3ZA 2A1SA 4M3TA 2X74A 4CJVA 4KHSA 1NOZA 2YNFA 2KZMA 1HQUA 1HMVA 2YNGA 4H4OA 3NH2A 3OYLA 1VSLA 1NKBA 5K14A 1XI1A 3HJFA 1KFDA 5CZ1A 4N5SA 2WOMA 1T8EA 1RT5A 1CXUA 4M45A 3SI6A 5CYQA 3V9WA 4W5RA 3ZT3A 3ZSZA 4M3YA 3LP2A 3LALA 3OYMA 5I42A 3MEDA 4QCLA 2KFNA 4KHQA 1EX4A 4RG8A 1RT3A 3CG7A 4KB1A 2Y1IA 5HLFA 1SL0A 4E1MA 1KFSA 4CF0A 1BQNA 3VQBA 3CM6A 1QHTA 4C8NA 2IC3A 4CJ4A 3DRSA 4CFBA 5HROA 1W9HA 4Y1DA 1S1UA 4DS5A 2O4IA 1IKVA 4IG3A 2G8FA 2PYLA 4KI6A 1RCHA 3QEVA 3VQ7A 4HCBA 4NCBA 3RMCA 4CK3A 1B92A 3ZSRA 1S1WA 4CFAA 1UA0A 1RT4A 3T19A 3ZCMA 3O3FA 3RRHA 4DFPA 4DF4A 1N5YA 1QS4A 3OJUA 1REVA 3WNHA 3AA4A 4J2EA 5HBMA 3M8SA 3K5OA 2XY8A 1VSIA 1NOYA 4W5NA 4NCAA 4DSIA 2HHVA 4CF1A 4O55A 4CJUA 3AVFA 3K5MA 1BCOA 4B9SA 4PUOA 1ZYQA 3LZIA 3S9HA 3I0SA 1WSHA 2YNHA 5KGWA 2D0CA 3NBPA 4CIEA 4CESA 2D5RA 1B9FA 3L3UA 1WSGA 2Z1JA 3WNGA 3JYTA 3U3YA 1MU2A 4CGDA 4IDKA 1NK5A 1A5WA 1WSFA 1A5XA 3OYNA 4M3UA 1D8YA 2F8SA 1BL3A 3VQ5A 5KRSA 4FM0A 4FJ8A 5T7BA 3TI0A 3QETA 3UIQA 3OJSA 1WLJA 3V9ZA 1U4BA 3O4NA 3MXIA 3ZSWA 1J9AA 4DS4A 2XY7A 4Z0UA 4CJFA 2YNIA 1ASVA 3VQPA 3DM2A 3AO4A 3NH1A 4E19A 3HM9A 3RR8A 3WNEA 1JL1A 4LY7A 1TK8A 4ZTFA 4B9MA 2OPQA 4AHTA 4CJWA 4OPKA 1TAUA 1TGOA 2DFHA 3RMBA 3DRRA 1TK0A 1S6QA 1D5AA 3PX4A 4E7KA 1U48A 3NGIA 3EY1A 1YTAA 2RKIA 2O4GA 1ITGA 1LAVA 2BE2A 2HNYA 3V1QA 3OYGA 3L8BA 4LSNA 1SL2A 3TAPA 1SKSA 3DLBA 1RDBA 1RTIA 4DSLA 4I9QA 3L2VA 5FDLA 4CGHA 5HRSA 3DLHA 1RBUA 3KJVA 4O0JA 4CJKA 4DF8A 1RT6A 3OYFA 3NAEA 4JRPA 4Z4HA 1S5JA 3EZ5A 4XIUA 4FYDA 4F8RA 4CEQA 4E3SA 1YTUA 4CFDA 2KZZA 4KPYA 2XY6A 4FK0A 2HB5A 3LAKA 2RPIA 2AJQA 1HRHA 1L3TA 1BHLA 3HSTB 3HVTA 5J2NA 2GBZA 2G8WA 3OYJA 4UQGA 1RBRA 1KRPA 3PY8A 3OYCA 3HO1A 3OYIA 4OLAA 2DFFA 4FCYA 4CERA 4N56A 2EHGA 4F3TA 3T1AA 4BE1A 1QQCA 4ID5A 3QO9A 1Z25A 3QNOA 3SQ2A 1TK5A 1C1AA 2ATQA 3MXMA 4OGEA 1KLMA 1RBVA 3AVAA 4BWJA 3OY9A 1X9SA 4FJXA 3KTQA 1U47A 3M8QA 4JS4A 4AH9A 4DSFA 3OYAA 4KAZA 3K5NA 1TL3A 4M41A 3QEXA 4B9UA 3HXMA 4AHRA 4AHSA 1NJXA 3RR7A 1JLGA 5D3GA 1RNHA 3IRXA 3LP3A 1DTQA 3MEEA 4W5TA 4K8ZA 3VQ8A 3TAFA 1HQEA 3HPHA 5CYMA 1S1TA 5SZTA 3QERA 4E0DA 1BI4A 4OLBA 3ISNC 4E7JA 4JRQA 3VN5A 1L3UA 4CEOA 3DRPA 2VWJA 1F21A 1UA1A 2XHBA 4EZ6A 1EXQA 3VQCA 4B9TA 3RTVA 4F4KA 3PO5A 1JLAA 2E4LA 4FJ9A 1JXEA 4F3OA 4CEEA 5CY4A 1CLQA 4B9LA 4LH4A 1L3SA 4O4GA 2JLEA 4DMNA 2JGUA 4FK4A 4WE1A 3AO3A 4FLZA 1DTTA 1X9WA 1NKEA 1CZ9A 3IG1A 4DLGA 3V4IA 3RWUA 4FJMA 3OS0A 1CZBA 1X1PA 4DLEA 3M8RA 3TARA 3OYEA 1U45A 3PUFA 2W42A 5C25A 1XC9A 4OKEA 1VRTA 3I8DA 2OZMA 4KHNA 3NFAA 2D0BA 4C8KA 3H08A 3DOKA 3ZT1A 3B6OA 2Z1GA 1KVBA 3KIOA 4CK2A 3F73A 3L2QA 2DTUA 4KTWA 1NKCA 3LP0A 1D9DA 2FBYA 3FFIA 3AA3A 3KD5E 4CJ3A 1ZBUA 3HK2A 2FBXA 4FJNA 3MAQA 1NK8A 5FRNA 1B9DA 2YHBA 1VSFA 3M8PA 4PQUA 2BANA 2ZQBA 4CJSA 4CHZA 4ICLA 1JLBA 1G15A 3QEWA 4FJ5A 2FBVA 1LWCA 3SUQA 1SKRA 4M3XA 3T3FA 1WSEA 4RW8A 4FM1A 3DYAA 4FJLA 2BGGA 1JLFA 3KLIA 4RW9A 3VQ4A 1KCFA 3DOLA 4CJQA 1ZBLA 3K5LA 3DLEA 4CCHA 4DQPA 1IKWA 1TKXA 4KV8A 1FXXA 3RRGA 2I5JA 4CGJA 1EP4A 3SPZA 3EYZA 3L2WA 1IH7A 3SUNA 4OVLA 4J2BA 2F8TA 4PY5A 4CEDA 4CFCA 4CHQA 3C6TA 4BE0A 1J5OA 1JLEA 3V9SA 1RT7A 4NYNA 4B8AB 4HTUA 2D0AA 2F96A 2IS3A 3AVMA 4B9NA 3HYFA 3DI6A 2HNZA 1BIZA 1I3AA 3P5JA 1VK0A 4CJPA 3PO4A 4HUGA 4J2AA 2ZE2A 4CJRA 4KHYA 4IBNA 5E41A 4KO0A 1LAWA 4KKOA 1YVUA 5J2QA 2BDPA 2E6LA 4FJJA 4IG0A 1FKOA 2KW4A 1RT2A 4M3WA 4CEZA 2XO7A 3V9UA 4KI4A 4RW6A 3LANA 4H4MA 2GUIA 4OKJA 4CHPA 3F9KA 1WNSA 1R0AA 4FLWA 3BDPA 4KTQA 2HHUA 3V6DA 4Z4CA 4HUEA 1ZBIA 3NH0A 1QTMA 4DTUA 1BGXT 1N6QA 4AHVA 1WSJA 2P1JA 3MEGA 3D0PA 4IKFA 5HRRA 2G8KA 4CECA 4FLUA 2HHQA 1ASWA 3OYDA 1RDCA 2ETJA 4HVJA 4FZXC 5HRPA 4KHUA 1J53A 1S9EA 3CFPA 1LV5A 3V81A 1QE1A 1WN7A 4DFMA 3B6PA 3LPTA 1DLOA 3NF6A 3ZSXA 2XRIA 3OYBA 4GMJB 3OYHA 3QESA 3OYKA 2OPSA 3LAMA 3VQQA 4ELUA 4F2RA 4CJ5A 4CIGA 4Q5VA 3P1GA 4EZ9A 3AV9A 1SUQA 4CGGA 4CGFA 3KKSA 3SQ4A 2YHAA 4DFJA 4O0IA 1LW2A 3AA5X 3OVNA 3KLGA 3PX0A 4DFKA 4FJ7A 4QAGA 1HNVA 5KGXA 3SNNA 4MQ3A 2G8UA 4MFBA 3ZSQA 2HMIA 4B9VA 1C0UA 3O3GA 1GOBA 1HPZA 3QIOA 4DU4A 2HHSA 4N41A 4JS5A 2EX3A 2Z1IA 1X9MA 2HVIA 4O5BA 2QXFA 4I2PA 4CJTA 1RILA 3VQ6A 3TANA 1KVCA 2VWKA 3QLHA 3BGRA 4CEAA 5J1EA 2P5GA 2QKKA 2OZSA 3AVBA 4I2QA 2R7YA 3HPGA 1Z26A 4KFBA 1HYSA 2RF2A 3HPOA 1VSJA 1FKPA 3TAGA 4ZTJA 1UAXA 2IAJA 3V1OA 4O44A 2KFZA 3JSMA 1NK0A 3V9XA 3K2PA 1ZBFA 2X6NA 3VQDA 1UWBA 4YNQA 1A5VA 4DTJA 4BDPA 4Z4IA 1Q9YA 2Y1JA 4FLTA 4CK1A 1KLNA 3HT3A 5FRMA 3O4QA 4B08A 4FJGA 4R5PA 1W0HA 3AVCA 3LPUA 4FJKA 3SUOA 4EP5A 4KHWA 2OPRA 5C42A 3KK2A 1T05A 4BDYA 1SKWA 2HHXA 4E7LA 3SPYA 3CM5A 1RTDA 4FK2A 4CJLA 4E89A 5KRTA 1C6VA 1NK9A 2HW3A 4FLVA 1NJYA 4DQQA 1RBTA 5SWMA 4F2SA 4EP4A 1T7PA 1C0MA 3ALYA 3O3HA 4DU3A 1C0TA 2IDOA 1U49A 4DTSA 5KI6A 4HUFA 3ULDA 3U6FA 1YT3A 3AO5A 4OKKA 1I39A 4NYFA 1VSEA 5J2PA 1XHZA 1BCMA 2E6MA 3AVHA 3C94A 3NF8A 3SV3A 4FZZA 4GVMA 4AILC 4FM2A 1Q9XA 4FLXA 3IAYA 4CGIA 4OPJA 2IGIA 3I0RA 4Z4EA 3SZ2A 3AO1A 3TAEA 4OGCA 3E01A 3MECA 1LW0A 2OYQA 4KREA 2QKBA 2P5OA 3K58A 4Y1CA 3ZSYA 4DWIA 5HRNA 1WAJA 4KB0A 1VSKA 1L5UA 3NF7A 3S3MA 4DTOA 4ELVA
chains in the Genus database with same CATH superfamily
3CFOA 2IIRA 3KKRA 3E1YA 4Z4GA 5GINA 4CHNA 1L3VA 3VOVA 3AGKA 4CZKA 4DG1A 3KLEA 3KK3A 3AO2A 5BPLA 4FXDA 5GIPA 4FVMA 4DSEA 4DR1K 3GBTA 5E26A 3HTVA 3ZSOA 4XH5A 4FWKA 3G6EN 4WQ5C 4I6MA 2LSNA 4JLHA 3TAQA 3DXMA 2FBTA 4CE9A 3NGZA 3AAPA 1ATSA 3SUPA 3G4SN 3VA3A 3VQEA 5FROA 4PKIA 2FXUA 1HYZA 3U4LA 1JL2A 1NGAA 4IDHA 4GW6A 5GAHP 4QS8A 3VGMA 4DTPA 3SJJA 4RWTA 2Q3SA 1TYQA 4IEEA 1K73O 2NUBA 3ZETB 3L6QA 2YKMA 1GOAA 3ITHA 4DTNA 4BC2A 2DY4A 1NMNA 5GAGP 1NGFA 1BISA 4DTXA 3SCXA 3LZJA 3ZT0A 4YDUC 2YHYA 1T03A 1NGCA 4DQIA 4DR5K 1RTHA 4DTMA 4JN4A 4W5QA 3HP6A 3VA0A 1HKGA 2G8IA 2QM1A 3AAQA 1C1BA 2FC0A 1S9GA 2GUPA 5HP1A 4YFUA 1E3MA 3OBYA 3SQ1A 4A2AA 4LC9B 4M3RA 2X6SA 2HMPA 3SBTA 3WXLA 3HL8A 4A61A 2I7NA 4CEBA 4DV6K 2O8BA 4JI6K 3IMXA 2PYJA 1JKHA 4DQRA 1GLAG 4FSVA 3WEEA 3JAMO 3KD1E 1GOCA 2E8AA 5AQYA 4JYAK 3AVGA 5GADP 5M1KA 1IKXA 1BG3A 1YJNN 3EN9A 2A1RA 3OS2A 3S3OA 1Q18A 3SBGA 3KLFA 1V4SA 3ENBA 1IKYA 1HNIA 3VENA 5JMVA 3P83D 4E7IA 4HCCA 1RDAA 1JLQA 3PX6A 2YI1A 2WONA 3ZYYX 2HBMA 3P39A 1D9FA 2ZJPL 4QOZB 2O8EA 3LWLA 3O9SA 4CIFA 2W6KA 4LF5K 4M3ZA 4M3TA 4K41A 1NOZA 2YNFA 1HQUA 2YNGA 3WT0A 2NRHA 1K8KB 1CXUA 4HTLA 4QS7A 5CYQA 4W5RA 3V9WA 3ZSZA 3LP2A 4A5BA 3LM2A 3CG7A 4KB1A 4CF0A 1BQNA 3VQBA 3CM6A 1QHTA 3UKUB 5HROA 4YOXA 3DRSA 1W9HA 1S1UA 2WTUA 3WQUA 2PYLA 4KI6A 4NO7A 2WUSA 5LMNK 1B92A 1YXQA 4CFAA 1UA0A 4CBUA 3RSEA 1QS4A 3OJUA 2QEXN 5HBMA 2E1YA 2GX9A 1NOYA 4O55A 4CJUA 3AVFA 3K5MA 4BROA 4B9SA 2UYTA 3S9HA 3A5NC 5AQFA 2D0CA 3NBPA 4FL9A 5IWAK 1B9FA 3L3UA 1WSGA 3LDQA 1N32K 3JYTA 4M7XA 3CJAA 1WSFA 1D8YA 1BL3A 4FM0A 4FJ8A 3A5LC 5GIOA 4KHPK 3V9ZA 1FW6A 1VQ7N 4H5VA 4Z0UA 4CJFA 2UXDK 1XNRK 3CERA 2YNIA 4FWPA 4FPBA 4JAXA 3AO4A 3CJ7A 3RR8A 4OPKA 2DFHA 4DR6K 3PX4A 4E7KA 1YTAA 2BE2A 3L8BA 4LSNA 3DLBA 3TAPA 1SKSA 4I9QA 3CJCA 3FLCO 3ULEA 5AQIA 2FF3B 1LOTB 1C0GA 3NAEA 5JLFA 4JI2K 4XIUA 4FYDA 4EAHD 1CZAN 3F5TA 4CFDA 5BPMA 2CH5A 4FK0A 1X3MA 3LAKA 2RPIA 1HRHA 5LL6Z 5CHIA 2GBZA 3PY8A 1RBRA 3OYCA 4JKHA 2D1KA 3TPQA 5AQQA 3T1AA 3H1VX 3QO9A 3C7NA 1C1AA 1RBVA 1U47A 5C15A 3QEXA 4WYBA 5ADXA 3IRXA 4W5TA 3H1QA 1DTQA 3MEEA 3HOTA 4CJ7A 3VQ8A 4MO4A 1HQEA 4B3TK 1S1TA 1BI4A 2OANA 1VQNN 1L3UA 4CEOA 1YAGA 2VWJA 2A5XA 5CE3A 2XHBA 4EZ6A 3O1BA 1GLEG 3MWPA 2P9IB 2JLEA 2JGUA 4H03B 3M3ZA 4FLZA 1DTTA 1X9WA 3CD6N 1BU6O 1U45A 3OYEA 3PUFA 4OKEA 3TTCA 1IV0A 3F73A 5GAEP 1VQPN 3L2QA 3VF4A 3LP0A 1D9DA 3E9PA 3FFIA 3AA3A 4ILJA 3H6EA 1S72N 5FRNA 4PQUA 2WBNA 1JCGA 2BANA 2ZQBA 4BRCA 4CJSA 1JLBA 1G15A 3CCMN 3ZEUB 2FBVA 4AF1A 1SKRA 5KPRA 3FR0A 4X64K 3T3FA 1WSEA 4RW8A 3CJ1A 3KVGA 4RW9A 3U9DA 4DQPA 1J6ZA 3OTOK 3RRGA 2P9NA 1EP4A 3MX2A 3THYB 1NJIO 4OVLA 4J2BA 2F8TA 4CD1A 1J5OA 3VGLA 1RT7A 4K43A 2IS3A 3HYFA 3DI6A 2HNZA 3ZX0A 5AZIB 4KKOA 4JKCA 3FZKA 4AM7A 4JI1K 4CEZA 2XO7A 3THXB 1YJWN 3R3LA 4RW6A 4JKFA 1WNSA 4C23A 3EO3A 4HUEA 1ZBIA 3NH0A 3LL3A 4DTUA 2UXCK 1GLCG 1N6QA 1DT9A 4RCHA 2P1JA 3MEGA 3TSQA 3D0PA 4CECA 1VAZA 1J53A 5FPMA 1QE1A 2VWBA 5KQDA 3EE8A 4DFMA 3LPTA 4CD3A 3OYHA 3LAMA 1NNEA 3SJHA 4CJ5A 1YITN 3HBTA 1YVNA 3D2EB 4CGGA 4CGFA 4O0IA 3AA5X 3PSFA 4DFKA 4KH4A 4MQ3A 2UUCK 2G8UA 2A41A 4DV2K 4B9QA 1HPZA 4JD2B 4JS5A 1LCUA 1X9MA 2HVIA 1T3VA 4O5BA 3WQTA 4CJTA 4OX9K 3TANA 2VWKA 4NXMK 1WBBA 4B3RK 4KFBA 2ASPA 1HKCA 1VSJA 5AQZA 3MDQA 4GNIA 3V9XA 4C1NK 4GV9A 2P9UA 1UWBA 2Y1JA 4HWIA 3EZWA 2V51B 3O4QA 2ZF5O 3MN9A 3SAFA 1W0HA 4YOWA 1NMDA 3AVCA 4FJKA 2OPRA 3FZFA 1T44A 4CBWA 4BDYA 1SKWA 2HHXA 4YOUA 3SPYA 3J80O 1NK9A 5F2RA 4DQQA 1T7PA 2ZJQL 4H0OA 1NLVA 3A8YA 1C0TA 2IDOA 4K25A 5KI6A 3C65A 1YT3A 5J2PA 3AVHA 3SV3A 2V7YA 2V7ZA 4BY9C 1Q9XA 3IAYA 2IGIA 4E1JA 5KPTA 2GWJA 3SZ2A 3AO1A 2VQFK 2IVPA 2OYQA 1LW0A 4JK8A 2P5OA 3CCUN 3R9PA 5AFUH 1ESVA 4B1WB 3A5MC 4BR4A 1TAQA 5F1XA 5E84A 4Q0BA 4FWRA 3K9KA 1KVAA 5BPNA 1RDDA 4E7HA 5JS1A 1EETA 2O8CA 4IFEA 3VQ9A 1FK9A 4BACA 4H5WA 5M1PA 4BR5A 4FZYA 1J54A 2HHTA 2YV0X 1RDUA 3KWIA 3SAGA 3NHGA 2FLOA 5JS2A 5AR0A 4GV6A 5C24A 4LD0A 1D4XA 4FW1A 1QVGM 3JS6A 5DK5A 3CCSN 3A2FA 4BRLA 3GL1A 2ITGA 3LP1A 1RTJA 2VG5A 4C8OA 2HVHA 4NLBA 1NJZA 3QIPA 1RBSA 2D4WA 5AQXA 4WCEL 2QK9A 2FSNA 3SK3A 5FPNA 1XHXA 3IS9A 1IBLK 1XMOK 2Q1NA 1OKJA 4B3OA 4FW2A 4CF8A 4BRNA 4ZHRA 1TV6A 4JKBA 4I7FA 2FSJA 4JHDB 1S3XA 3MXJA 4ILGB 3VQAA 3L2UA 3TABA 1NJWA 3CQYA 4L8RB 4UY8O 3AA2A 1JLCA 1HJRA 4IOCL 5AQPA 1HJOA 4CF9A 1ZBHA 3O8MA 1U48A 3C6AA 2HSTA 1M1KO 4DKWA 3SYZA 1TKZA 2G8VA 4PA1A 5CZ2A 4CW7B 4LF8K 3Q7CA 4BWMA 4KTZA 4PKGA 3QDKA 3HI0A 3L0QA 3T1YK 5AQSA 4ID1A 2P9KA 4J2DA 2P9PB 4C8LA 5DMRA 4HHTA 4N76A 1GLDG 1BQMA 3I33A 3KK1A 1GLFO 1DEJA 3DLGA 3CCEN 1NK7A 3N4QA 4CEFA 3G0ZA 4PHTX 3AVNA 3ZT2A 2A3ZA 1ASUA 4B8CA 3TWHA 3LWMA 3THVA 1TL1A 1XQSC 2HNDA 3D45A 2Q2RA 1QSLA 4Z4FA 3CJ9A 2A40A 1S22A 1JXBA 4EHUA 2A1SA 4CJVA 1OH6A 2KZMA 4H4OA 1HMVA 1Q86O 1VSLA 3QBXA 1NKBA 5BRHA 4BC3A 4A2BA 4CBXA 1RT5A 3R1XA 1Q82O 1YUWA 4O8UA 4A59A 4M3YA 5I42A 3MEDA 1EX4A 1RT3A 2QWOA 2VQEK 1EO1A 4E1MA 2W40A 3FZLA 3O6WA 3AARA 4C8NA 4CJ4A 2IC3A 1R59O 4DS5A 4IG3A 2E5LK 3NVKA 4JKGB 3K9JA 1EWQA 1N5YA 3T19A 3O3FA 3RRHA 3GE1A 4BRDA 1REVA 2O8FB 3AA4A 3M8SA 3I8BA 3K5OA 1VSIA 4W5NA 2BTFA 4JK9A 4CF1A 4PUOA 4YHHK 1BCOA 2F9WA 5MLCQ 1ZYQA 3VERA 3WXMB 5AQOA 3E9OA 1HKBA 4CIEA 2D5RA 1HNWK 4JI8K 4CGDA 4IDKA 5KPZA 3M1FA 1EQYA 1IJJA 1M90O 1QQMA 3J81O 5KRSA 2F8SA 5T7BA 3QETA 3H46O 3ATUA 2VGNA 3D2FB 3ZSWA 3THWB 3HM9A 1JL1A 4H5RA 4LY7A 3ZX3A 5C12A 4CJWA 3MWTA 5M1NA 4IO8A 3RMBA 1D5AA 1N33K 2O4GA 2HNYA 1LAVA 3OYGA 5HOOA 5FDLA 4CGHA 3DLHA 1RT6A 4BQLA 3SLCA 1YTUA 4KPYA 5C2FA 1J5EK 5BRFA 1Y64A 1BHLA 3CC7N 3HO1A 3DXMB 4UQGA 2GEMA 4CI6A 4OLAA 3O9QA 4FCYA 1ZC6A 1WBDA 3LDOA 2IVOA 2OCEA 3ID6A 4F3TA 3R6MA 3UB5A 1Z25A 2ATQA 3MXMA 1KLMA 1O13A 1OVQA 3AVAA 4DCHA 4BR7A 1HLUA 3EE9A 4KAZA 3OYAA 5AZJA 3K5NA 1TL3A 3A5OC 2I7PA 4B9UA 4AHSA 4BRPA 2ZWHA 5D3GA 3CQXA 3LP3A 1ILYA 3HPHA 4E0DA 3E66A 3KK7A 3ISNC 4E7JA 4JI5K 3UKUA 4JRQA 3VN5A 1F21A 4DUZK 3FFKB 3VEYA 5AQUA 4B9TA 2PFUA 3RTVA 4YDUA 3QMLA 2E4LA 4F3OA 4CEEA 1VHXA 4LH4A 4O4GA 4FK4A 1JJ2M 4WE1A 3AO3A 4FOIA 3V4IA 3RWUA 3OS0A 4DLEA 3TARA 1KXPA 2NRRA 3I8DA 4BRIA 3NFAA 3ZLJA 2Z1GA 1KVBA 2O8BB 4KTWA 3BEXA 1NGBA 1EWRA 3CIPA 3HK2A 4FJNA 3UE5A 3MAQA 4JI4K 3M8PA 1HNXK 4CVNE 3QEWA 1NGJA 1BOTO 2QWNA 1YI2N 3CMAN 4MDAA 1VQ6N 3VQ4A 1ZBLA 1KCFA 3K5LA 1IKWA 1FXXA 1G99A 2I5JA 3A0IX 4DV0K 4PY5A 4CEDA 2O8EB 4BE0A 3RVCA 1JLEA 3V9SA 2F4VK 4LFBK 4B8AB 2D0AA 1SS6A 2F96A 3AVMA 4JNEA 1W2BM 5A2QO 4KHYA 3HSCA 4HUGA 4J2AA 5E41A 1VQ5N 4PL7A 1LAWA 3S41A 2E6LA 4FJJA 1FKOA 2D0PA 2E1ZA 3KWGA 4CHPA 1HX1A 1HNZK 2RHKA 3VEXA 2QWQA 1QTMA 1BGXT 4AHVA 4IEIA 4IKFA 2HHQA 2G8KA 1HUXA 3OYDA 2NRVA 4HVJA 4FZXC 4KHUA 1S9EA 1LV5A 1P90A 2JWKA 3B6PA 4DHYA 2Q0RA 1DLOA 2YJFA 3RSEB 1HR0K 3OYBA 1NM1A 4B1UB 3OYKA 3VQQA 1VQ8N 3EKSA 4ELUA 4OO1J 3AV9A 3SQ4A 1LW2A 3OVNA 1GLJO 4QAGA 3CETA 4B3MK 3BF1A 4MFBA 5BN9A 3ZSQA 3KZBA 2HMIA 4B9VA 1C0UA 3MX5A 1GOBA 4N41A 3VF6A 2EX3A 2Z1IA 2QXFA 4I2PA 1NGHA 1KVCA 1KAYA 3BGRA 5J1EA 2HF4A 4LF6K 2QKKA 3HPGA 1HYSA 2IAJA 3CXCM 3K2PA 2NZTA 1ZBFA 2X6NA 5AQJA 4XEIA 3VEOA 4BRQA 4BDPA 1Q9YA 4CK1A 1KLNA 3DLLL 3ULEB 2UUBK 3LPUA 3SUOA 4EP5A 3NMUA 3MMVA 3KK2A 1T05A 3VTHA 2AP1A 4BG8A 2Q97A 1YJ9N 1C6VA 1NJYA 2E20A 1C0MA 3O3HA 4DU3A 4DR2K 5EXWA 3W0LA 1U49A 4HUFA 3ULDA 3QFUA 2QI2A 5EVZA 1NU0A 2E6MA 3C94A 3NF8A 4EHTA 4GVMA 4FM2A 4FLXA 4CGIA 4OPJA 4FWMA 3HOSA 3THXA 4KREA 3TTDA 3K58A 4DWIA 3ZSYA 3VEZA 1WAJA 1VSKA 4CJLA 3S3MA 4GKJK 1BI4B 1TVRA 4FWLA 4L3QA 4YOTA 3KLHA 3SMSA 3NCIA 1SL1A 4WFNL 2UU9K 3QEIA 1MWKA 2DFEA 2OPPA 4K42A 1E4GT 1UOCA 1KC8O 3QEPA 1S1XA 1Q7YO 4B3SK 4BR0A 3DMJA 3D2EA 4RW7A 4DR3K 4RW4A 1C1CA 2BH1A 4DTRA 4ELTA 3CPWM 3SQ0A 4BVOA 3K59A 5M1OA 3C6UA 1QSYA 1MWMA 1LWEA 4JKDA 3VETA 3R8EA 3AVLA 4NCGA 3NE6A 3DXKA 1VQON 3SV4A 1WSIA 4W5OA 2P9NB 1NGGA 2P9LB 2RN2A 1TUYA 2VG6A 3CYMA 5I3UA 1VSDA 3QNNA 3J8AA 1WAFA 2Z1HA 1K6YA 2W6LA 4IFVA 3F9MA 3QFPA 1NK4A 2IOCA 2ZM6K 3IDHA 5DM6L 3LDSA 3ZT4A 4C8MA 4KRFA 4OJRA 4CHOA 3VGKA 4EIAA 3DLRA 1QSSA 2G8HA 2B5JA 4CJEA 5HL7L 2X78A 2UUAK 4CHYA 2H3GX 3L4QA 3T69A 2WC9A 4BG9A 4AHUA 4YY3K 5AQTA 4G1QA 4GVEA 1ZBSA 1U04A 3AVJA 2KHOA 3U3GA 2KTQA 1LWFA 2D0OA 3VESA 3OW2M 1HYVA 3QINA 4LSLA 3TSUA 3VPZA 1X9JA 1Q8IA 1U2VA 4E1NA 3L2RA 4FLYA 3NGYA 4N47A 2YX6A 4X62K 2NRWA 1RFQA 4IOXA 3NH2A 4JKAA 4WQ4C 3HJFA 5CZ1A 1T8EA 4LF7K 4OPHA 3SI6A 2QW9A 2O8DA 3LALA 3OYMA 5ADXH 2KFNA 4KHQA 4RG8A 4DV7K 2Y1IA 2GWKA 5HLFA 3CPEA 3G25A 4A57A 4Y1DA 2O4IA 5EY4A 4FO0A 2PBDA 4HCBA 3VQ7A 4NCBA 3RMCA 5AQKA 3ZSRA 1S1WA 1RT4A 4DFPA 4X65K 2ASMA 3VTIA 5H1SQ 4AM6A 4B1YB 4J2EA 2ASOA 4ISGA 4KH5A 4NCAA 4JK7A 2HHVA 3VF2A 1WSHA 4PKHA 2P9SA 3WNGA 2Z1JA 3QBWA 1U6ZA 1GLBG 3VQ5A 2HBJA 3UIQA 3OJSA 1WLJA 3O4NA 3MXIA 5KQ8A 1BA0A 1J9AA 3N4PA 1DKGD 2ITMA 3VQPA 3WNEA 2VCPA 5BR8K 1TK8A 4ZTFA 4B9MA 1TAUA 5C0YA 3DRRA 1S6QA 3NGIA 1XNQK 1ITGA 3V1QA 4DSLA 1RDBA 1RTIA 5AQMA 2CH6A 5HRSA 4O0JA 4CJKA 3OYFA 2CGKA 5BR9A 4Z4HA 1S5JA 4BGAA 3EZ5A 1VQ9N 2F7TA 1IBKK 2E2OA 2O8CB 3I56N 1QZ6A 4F8RA 4CEQA 4E3SA 2KZZA 1SQKA 2IVNA 2XY6A 2HB5A 3BF3A 1L3TA 3OYJA 1KRPA 3OYIA 4CZGA 2DFFA 2PAVA 4N56A 2EHGA 5M1QA 5EX5A 3CMEN 1BWFO 1QQCA 3BZCA 5LJVA 4DV3K 3WXIA 5B8HA 5DM7L 3OY9A 4FJXA 5JVHL 1QQNA 4J8FA 3KTQA 4XH4A 3VEWA 4M41A 3MCAB 3RR7A 1JLGA 1P8ZA 3BP8A 5SZTA 3E9LA 1RGIA 3P4IA 4OLBA 4DQ8A 1ZXOA 4JEPA 4O8KA 4IOAL 4DR4K 2Q31A 1EXQA 5EOYA 3PO5A 1JLAA 4FJ9A 1JXEA 1CLQA 3H45C 1L3SA 5JLHA 1NKEA 3O5BA 4FJMA 1X1PA 3CCQN 1JCEA 1DGKN 2FSKA 2HOEA 1XC9A 1VRTA 2OZMA 2D0BA 1Z05A 3ZT1A 3KIOA 1ATNA 1NKCA 3FE1A 2NRZA 3KD5E 2YHBA 4BRHA 4ICLA 4FJ5A 1LWCA 4G9ZA 3SUQA 3ZETA 3O9RA 2BGGA 1JLFA 4CJQA 3DOLA 4CCHA 3DLEA 3OHRA 3O80A 3SPZA 4YOVA 3EYZA 3SUNA 4MLEA 5IT9O 4CFCA 4K0KK 4IWVA 4CHQA 3C6TA 1NWKA 4B1ZA 4B1XB 2YHXA 4ISFA 1I3AA 4CJPA 3PO4A 2ZE2A 4CJRA 4H0TB 4IBNA 3UKRB 4MLHA 4GV3A 1YVUA 5J2QA 1BA1A 4IG0A 2KW4A 4Y0WA 1RT2A 4M3WA 4BR9A 4KI4A 1KAXA 3LANA 4H4MA 2GUIA 4OKJA 3BDPA 4KTQA 4FLWA 2HHUA 4NB4A 4LFCK 3J7AP 1N34K 4FLUA 1BDGA 3VEVA 5HRPA 3PSIA 3HZ6A 3CFPA 1WN7A 4DV4K 3CCLN 1W97L 1VQMN 3ZSXA 2QWPA 4GMJB 3QESA 1W7AA 2KLAA 1MDUB 5LY3A 4LFAK 4CIGA 4EZ9A 3P1GA 1K8AO 4I6MB 5F0XA 4GY2B 2YHAA 5LJWA 3KLGA 3PX0A 4FJ7A 4GKKK 2NRTA 3ENHA 3SNNA 3BY5A 4WQ5A 3EEQA 4BREA 3IFRA 3QIOA 4DU4A 1HPMA 2EWSA 2HHSA 3U8XA 1T6CA 1TYQB 2CGLA 1K8KA 4KH6A 3QLHA 4CEAA 2P5GA 5AQNA 3AVBA 4I2QA 5JVGL 4JV5K 3HPOA 2QWRA 3JSMA 3D6RA 4DV5K 3ATVA 3VQDA 4DTJA 4BRKA 4FLTA 5FRMA 3Q7BA 4FJGA 3QICA 4R5PA 4IXCA 4B1VA 4E7LA 2QTDA 1RTDA 2YJEA 1NG9A 1RBTA 5SWMA 4F2SA 4EP4A 1GLLO 3T1HK 3ALYA 4DTSA 2QA4N 3U6FA 1VSEA 3WEEB 2UXBK 4MO5A 4AILC 4CZJA 4DV1K 3I0RA 3WXKA 4V19S 5AZJB 1JCFA 2A6AA 3E01A 4OGCA 1WB9A 5HRNA 3SAHA 1IBMK 2F9TA 1L5UA 3NF7A 3ID8A 4F4KA 1QHAA 1XWLA 4PL8A 2ZD1A 4ISEA 2NNWA 3TSPA 5C10A 4F9OA 5KTQA 1IO2A 4K8XA 3PIOL 1WUAA 4TSXA 1VSMA 4BE2A 1BUPA 4FJIA 3AVIA 2J4RA 2KQ2A 3T7ZA 2PY5A 1RT1A 4CF2A 2HBLA 4FWOA 1KAZA 1N8RO 1X3NA 4DSKA 4AHCA 1KSPA 1BIUA 1VRUA 1C0FA 1NBWA 1BO5O 4C1NI 4DUYK 3GDQA 3AVKA 2HBKA 3CJBA 2E2QA 1VSHA 4IJNA 3AY9A 3IKMA 2KKZA 2YKNA 3FGUA 3CFRA 3VMFB 3NDKA 1Y97A 1O1WA 2ZGYA 5CR4A 3QB0A 1NK6A 3WXJA 1CXQA 5EU7A 2PZSA 1YHQN 4BR2A 3HVRA 2OA8A 1S6PA 4H8KA 2P9IA 3HP9A 3PV8A 3K57A 4DQSA 2GTDA 3L3VA 4CZEA 4DU1A 3S3NA 3NF9A 4DSJA 3MK6A 3RMAA 3DLKA 2Q0UA 3O9TA 2XY5A 1TKDA 1SV5A 4FWNA 3LM9A 4O5FA 3CQ8A 3TAMA 2OTJN 2GV9A 4BRGA 1TUUA 2P51A 2V52B 1EKEA 1Q81O 2HHWA 3ZSVA 4PWDA 3V1RA 4M42A 3P31A 2B6AA 4NLCA 4JI0K 4IFYA 3ZEUA 1TKTA 4KBOA 4FJHA 3G10A 5TKYA 4LF4K 3J7ZO 1V4TA 3BZKA 4IJAA 1QQOA 1KTQA 3TR8A 3U9ZA 4IO9L 5AQGA 1XC3A 1VQ4N 5AFUA 1OH7A 3RMDA 3M6GA 3WNFA 2VG7A 1S1VA 3THYA 3ASMA 3CC4N 1IG9A 4YOYA 3C95A 4I9LA 4LH5A 1FJGK 4BDZA 2B4JA 5J2MA 3OS1A 5AZIA 2X74A 3C7NB 4KHSA 4Z94A 3OYLA 4U7BA 3JXUA 5K14A 1XI1A 1KFDA 2E2NA 4N5SA 2WOMA 3CCVN 2W41A 2QWMA 4M45A 2DPNA 5C2DA 5AQRA 3ZT3A 4QCLA 5I9EB 1KD1O 1SL0A 1XMQK 1KFSA 4CFBA 4DB3A 3ZX2A 5AQVA 1IKVA 2G8FA 1RCHA 3QEVA 4WFBL 4CK3A 1SAZA 3ZCMA 4DF4A 5BN8A 2OTLN 2WFBA 1Z6RA 3WNHA 1I94K 1H1VA 3DAWA 4QS9A 4H0YB 2XY8A 5BRDA 4DSIA 2P9LA 1ATRA 4H0PA 3H3NO 3LZIA 3I0SA 4MDBA 3C6HA 2YNHA 4BGBA 5KGWA 4CESA 4WF9L 3CHWA 3U3YA 3FZMA 1MU2A 1NK5A 1A5WA 3AGRA 4JD2A 1A5XA 3OYNA 4M3UA 3LDPA 4R79A 3TI0A 1U4BA 4X66K 4LF9K 4DS4A 3EKUA 2XY7A 4XH1A 1ASVA 3DM2A 4BC5A 3NH1A 4E19A 4CZMA 4BC4A 1WOQA 2OPQA 4AHTA 1TGOA 3O4WA 1TK0A 2FF6A 3EY1A 1VQLN 2RKIA 5JICA 4Z4EA 1SL2A 3LDNA 2GELA 3L2VA 3K0SA 3IUCA 4BVPA 1RBUA 3KJVA 1SZ2A 4DF8A 4FWQA 1QZ5A 4JRPA 3M5RA 5AQWA 3GOIA 2AJQA 1OVYA 3HSTB 3HVTA 5J2NA 5TKWA 2G8WA 3O1WA 4AQYK 4CERA 4EFHA 1OH8A 4BE1A 2AA4A 4OPAA 4ID5A 3SQ2A 3QNOA 1TK5A 1YF5L 4OGEA 3BUZB 4IZ9A 4BWJA 1X9SA 4FPAA 3M8QA 4JS4A 4AH9A 4DSFA 1NGDA 3ENOA 3NVMA 4AHRA 3HXMA 1NJXA 3LDLA 3SMPA 1RNHA 4WFAL 4K8ZA 2HF3A 3CCRN 1K9MO 3TAFA 5CYMA 3QERA 3DXKB 4JI7K 1N36K 1QVFM 3MN6A 4FWSA 4U67L 3DRPA 4BRFA 4NXNK 1UA1A 3VQCA 3C0BA 3W3DA 3EL2A 3MN7A 5CY4A 4A62A 1T6DA 4B9LA 3CF5L 4DMNA 2VGMA 3FZHA 1CZ9A 3IG1A 4DLGA 1CZBA 3M8RA 2W42A 2NLXA 3P38A 5C25A 4KHNA 4C8KA 3H08A 3DOKA 3B6OA 4CK2A 2DTUA 3OBWA 3J7YP 2FBYA 4CJ3A 1ZBUA 2A42A 2FBXA 2P9UB 1NK8A 1KQSM 1B9DA 3CC2N 1VSFA 3G71N 4CHZA 3B8AX 3GG4A 4M3XA 4FM1A 3DYAA 4M7YA 4FJLA 3KLIA 4H5TA 3CI5A 4CZFA 1TKXA 2JWLA 4KV8A 4CGJA 4JHDA 3L2WA 1IH7A 1U2VB 5FPDA 2RE2A 4CZHA 3MCPA 4NYNA 4B9NA 4HTUA 2VYPA 3CCJN 1BIZA 3P5JA 3F2KA 1VK0A 4RTFD 1E4FT 4KO0A 2BDPA 2QXLA 4M63C 3V9UA 2O8DB 1IG8A 4WQ4A 1R0AA 3F9KA 3V6DA 4Z4CA 2NRXA 2CGJA 5FPEA 3KHYA 1XUPO 1WSJA 3D7EO 1YIJN 5HRRA 2BUPA 1RDWX 2P9PA 1ASWA 1RDCA 2ETJA 3L4IA 3PIPL 3O9UA 3V81A 5M1FA 1OH5A 3NF6A 2XRIA 4CZIA 1NGEA 4FOEA 3TU5A 2OPSA 3DJCA 4FVUA 4F2RA 1VQKN 4Q5VA 3PLAA 3MN5A 1SUQA 3KKSA 2E88A 2YCHA 4DFJA 4JI3K 3O08A 1HNVA 4H0XB 5KGXA 2P9SB 1NGIA 3O3GA 4ILHA 5AJ3K 5AQLA 2HHHK 1RILA 3H3OB 3VQ6A 3WUHA 2OZSA 2R7YA 1Z26A 2RF2A 1FKPA 3TAGA 4ZTJA 1UAXA 3V1OA 4H0VB 4O44A 2KFZA 4BRAA 5BREA 1NK0A 2YHWA 5ELZA 4YNQA 1A5VA 4Z4IA 1MA9B 4JKGA 3HT3A 4CZLA 4B08A 5LMUK 4KHWA 5C42A 2O8FA 3CM5A 4FK2A 4E89A 5KRTA 2HW3A 4FLVA 4BQZA 4A5AA 2E2PA 3OA9A 3I55N 4DR7K 3AO5A 4OKKA 1I39A 4NYFA 2ZJRL 3HRGA 1BCMA 1XHZA 4BRMA 2P9KB 2ZGZA 3HM8A 4FZZA 4YORA 3UKRA 2Q36A 3DWLA 3D2FA 3THWA 4H5NA 2QWLA 3TAEA 5FLXO 5AQHA 3MECA 2QKBA 4Y1CA 4KB0A 4JKEA 4DTOA 4ELVA 3TTFA
chains in the Genus database with same CATH topology
1BI4B 1TVRA 1XWLA 3CFOA 3KKRA 4Z4GA 1L3VA 4CHNA 2ZD1A 1TAQA 4DG1A 3KK3A 3KLHA 3KLEA 3AO2A 4FXDA 3NCIA 1SL1A 4Q0BA 4FVMA 5KTQA 1IO2A 1KVAA 4K8XA 1RDDA 4E7HA 4DSEA 5JS1A 3QEIA 2DFEA 4TSXA 1EETA 2OPPA 1VSMA 4BE2A 3VQ9A 4BACA 1FK9A 4FJIA 1UOCA 3AVIA 2KQ2A 1S1XA 3ZSOA 3QEPA 2PY5A 1RT1A 1J54A 4CF2A 4FZYA 2HHTA 2YV0X 3DMJA 2LSNA 4JLHA 3TAQA 3NHGA 5JS2A 5C24A 2FBTA 4LD0A 4RW7A 4FW1A 4CE9A 3NGZA 4RW4A 5DK5A 1C1CA 4DTRA 3A2FA 4AHCA 3VQEA 3VA3A 3SUPA 1KSPA 4DSKA 1BIUA 4ELTA 2ITGA 3LP1A 5FROA 1RTJA 1HYZA 1VRUA 1JL2A 2VG5A 4DTPA 4GW6A 3SJJA 4C8OA 2HVHA 1NJZA 3SQ0A 3K59A 2Q3SA 3QIPA 3C6UA 1RBSA 1QSYA 3AVKA 1LWEA 2NUBA 2QK9A 2YKMA 1GOAA 3ITHA 1VSHA 1XHXA 3IS9A 4DTNA 3AVLA 4NCGA 4B3OA 2DY4A 4FW2A 4CF8A 3NE6A 4ZHRA 2YKNA 1TV6A 3CFRA 4I7FA 1WSIA 4W5OA 1BISA 3SV4A 4DTXA 3LZJA 3NDKA 3SCXA 3ZT0A 2RN2A 3MXJA 3VQAA 2VG6A 1Y97A 1O1WA 3L2UA 3CYMA 3TABA 5I3UA 1T03A 1NJWA 4L8RB 1VSDA 3QNNA 1NK6A 4DQIA 1CXQA 3AA2A 5EU7A 1JLCA 1HJRA 1RTHA 1WAFA 4DTMA 2PZSA 2Z1HA 1K6YA 4IFVA 4W5QA 3HP6A 3VA0A 2G8IA 3HVRA 4CF9A 1NK4A 1ZBHA 2IOCA 1C1BA 3LDSA 2OA8A 1S6PA 2FC0A 1S9GA 4H8KA 4C8MA 3HP9A 3ZT4A 4YFUA 3K57A 3PV8A 5HP1A 4OJRA 3L3VA 4DQSA 4KRFA 4DU1A 3SQ1A 4CHOA 3S3NA 3NF9A 3DLRA 3SYZA 4DSJA 1QSSA 4M3RA 2X6SA 2G8HA 1TKZA 3RMAA 3DLKA 2XY5A 1TKDA 2B5JA 3HL8A 2G8VA 4PA1A 1SV5A 4CJEA 5CZ2A 2X78A 4CHYA 4CEBA 4BWMA 4KTZA 3CQ8A 3TAMA 2PYJA 1JKHA 2GV9A 4DQRA 2P51A 1EKEA 4AHUA 3KD1E 1GOCA 4ID1A 2HHWA 4J2DA 3ZSVA 4PWDA 3V1RA 4G1QA 4M42A 4C8LA 5DMRA 2B6AA 3AVGA 4HHTA 4IFYA 1TKTA 4N76A 1IKXA 1BQMA 1U04A 4FJHA 3AVJA 2A1RA 3OS2A 3U3GA 3G10A 3KK1A 3S3OA 2KTQA 1LWFA 3DLGA 1NK7A 1HYVA 3QINA 4CEFA 3KLFA 4LSLA 1IKYA 1HNIA 3G0ZA 4E7IA 3P83D 4HCCA 3AVNA 3ZT2A 1KTQA 3TR8A 1RDAA 1ASUA 1JLQA 4B8CA 3TWHA 3LWMA 3RMDA 3PX6A 3THVA 3WNFA 1Q8IA 2VG7A 2WONA 1S1VA 3ASMA 4E1NA 1D9FA 1TL1A 1IG9A 2HNDA 4QOZB 3C95A 4I9LA 4LH5A 3LWLA 3D45A 4Z4FA 1QSLA 3L2RA 4FLYA 4CIFA 4BDZA 2B4JA 3NGYA 1JXBA 5J2MA 4N47A 3OS1A 4M3ZA 2A1SA 4M3TA 2X74A 4CJVA 4KHSA 1NOZA 2YNFA 2KZMA 1HQUA 1HMVA 2YNGA 4H4OA 3NH2A 3OYLA 1VSLA 1NKBA 5K14A 1XI1A 3HJFA 1KFDA 5CZ1A 4N5SA 2WOMA 1T8EA 1RT5A 1CXUA 4M45A 3SI6A 5CYQA 3V9WA 4W5RA 3ZT3A 3ZSZA 4M3YA 3LP2A 3LALA 3OYMA 5I42A 3MEDA 4QCLA 2KFNA 4KHQA 1EX4A 4RG8A 1RT3A 3CG7A 4KB1A 2Y1IA 5HLFA 1SL0A 4E1MA 1KFSA 4CF0A 1BQNA 3VQBA 3CM6A 1QHTA 4C8NA 2IC3A 4CJ4A 3DRSA 4CFBA 5HROA 1W9HA 4Y1DA 1S1UA 4DS5A 2O4IA 1IKVA 4IG3A 2G8FA 2PYLA 4KI6A 1RCHA 3QEVA 3VQ7A 4HCBA 4NCBA 3RMCA 4CK3A 1B92A 3ZSRA 1S1WA 4CFAA 1UA0A 1RT4A 3T19A 3ZCMA 3O3FA 3RRHA 4DFPA 4DF4A 1N5YA 1QS4A 3OJUA 1REVA 3WNHA 3AA4A 4J2EA 5HBMA 3M8SA 3K5OA 2XY8A 1VSIA 1NOYA 4W5NA 4NCAA 4DSIA 2HHVA 4CF1A 4O55A 4CJUA 3AVFA 3K5MA 1BCOA 4B9SA 4PUOA 1ZYQA 3LZIA 3S9HA 3I0SA 1WSHA 2YNHA 5KGWA 2D0CA 3NBPA 4CIEA 4CESA 2D5RA 1B9FA 3L3UA 1WSGA 2Z1JA 3WNGA 3JYTA 3U3YA 1MU2A 4CGDA 4IDKA 1NK5A 1A5WA 1WSFA 1A5XA 3OYNA 4M3UA 1D8YA 2F8SA 1BL3A 3VQ5A 5KRSA 4FM0A 4FJ8A 5T7BA 3TI0A 3QETA 3UIQA 3OJSA 1WLJA 3V9ZA 1U4BA 3O4NA 3MXIA 3ZSWA 1J9AA 4DS4A 2XY7A 4Z0UA 4CJFA 2YNIA 1ASVA 3VQPA 3DM2A 3AO4A 3NH1A 4E19A 3HM9A 3RR8A 3WNEA 1JL1A 4LY7A 1TK8A 4ZTFA 4B9MA 2OPQA 4AHTA 4CJWA 4OPKA 1TAUA 1TGOA 2DFHA 3RMBA 3DRRA 1TK0A 1S6QA 1D5AA 3PX4A 4E7KA 1U48A 3NGIA 3EY1A 1YTAA 2RKIA 2O4GA 1ITGA 1LAVA 2BE2A 2HNYA 3V1QA 3OYGA 3L8BA 4LSNA 1SL2A 3TAPA 1SKSA 3DLBA 1RDBA 1RTIA 4DSLA 4I9QA 3L2VA 5FDLA 4CGHA 5HRSA 3DLHA 1RBUA 3KJVA 4O0JA 4CJKA 4DF8A 1RT6A 3OYFA 3NAEA 4JRPA 4Z4HA 1S5JA 3EZ5A 4XIUA 4FYDA 4F8RA 4CEQA 4E3SA 1YTUA 4CFDA 2KZZA 4KPYA 2XY6A 4FK0A 2HB5A 3LAKA 2RPIA 2AJQA 1HRHA 1L3TA 1BHLA 3HSTB 3HVTA 5J2NA 2GBZA 2G8WA 3OYJA 4UQGA 1RBRA 1KRPA 3PY8A 3OYCA 3HO1A 3OYIA 4OLAA 2DFFA 4FCYA 4CERA 4N56A 2EHGA 4F3TA 3T1AA 4BE1A 1QQCA 4ID5A 3QO9A 1Z25A 3QNOA 3SQ2A 1TK5A 1C1AA 2ATQA 3MXMA 4OGEA 1KLMA 1RBVA 3AVAA 4BWJA 3OY9A 1X9SA 4FJXA 3KTQA 1U47A 3M8QA 4JS4A 4AH9A 4DSFA 3OYAA 4KAZA 3K5NA 1TL3A 4M41A 3QEXA 4B9UA 3HXMA 4AHRA 4AHSA 1NJXA 3RR7A 1JLGA 5D3GA 1RNHA 3IRXA 3LP3A 1DTQA 3MEEA 4W5TA 4K8ZA 3VQ8A 3TAFA 1HQEA 3HPHA 5CYMA 1S1TA 5SZTA 3QERA 4E0DA 1BI4A 4OLBA 3ISNC 4E7JA 4JRQA 3VN5A 1L3UA 4CEOA 3DRPA 2VWJA 1F21A 1UA1A 2XHBA 4EZ6A 1EXQA 3VQCA 4B9TA 3RTVA 4F4KA 3PO5A 1JLAA 2E4LA 4FJ9A 1JXEA 4F3OA 4CEEA 5CY4A 1CLQA 4B9LA 4LH4A 1L3SA 4O4GA 2JLEA 4DMNA 2JGUA 4FK4A 4WE1A 3AO3A 4FLZA 1DTTA 1X9WA 1NKEA 1CZ9A 3IG1A 4DLGA 3V4IA 3RWUA 4FJMA 3OS0A 1CZBA 1X1PA 4DLEA 3M8RA 3TARA 3OYEA 1U45A 3PUFA 2W42A 5C25A 1XC9A 4OKEA 1VRTA 3I8DA 2OZMA 4KHNA 3NFAA 2D0BA 4C8KA 3H08A 3DOKA 3ZT1A 3B6OA 2Z1GA 1KVBA 3KIOA 4CK2A 3F73A 3L2QA 2DTUA 4KTWA 1NKCA 3LP0A 1D9DA 2FBYA 3FFIA 3AA3A 3KD5E 4CJ3A 1ZBUA 3HK2A 2FBXA 4FJNA 3MAQA 1NK8A 5FRNA 1B9DA 2YHBA 1VSFA 3M8PA 4PQUA 2BANA 2ZQBA 4CJSA 4CHZA 4ICLA 1JLBA 1G15A 3QEWA 4FJ5A 2FBVA 1LWCA 3SUQA 1SKRA 4M3XA 3T3FA 1WSEA 4RW8A 4FM1A 3DYAA 4FJLA 2BGGA 1JLFA 3KLIA 4RW9A 3VQ4A 1KCFA 3DOLA 4CJQA 1ZBLA 3K5LA 3DLEA 4CCHA 4DQPA 1IKWA 1TKXA 4KV8A 1FXXA 3RRGA 2I5JA 4CGJA 1EP4A 3SPZA 3EYZA 3L2WA 1IH7A 3SUNA 4OVLA 4J2BA 2F8TA 4PY5A 4CEDA 4CFCA 4CHQA 3C6TA 4BE0A 1J5OA 1JLEA 3V9SA 1RT7A 4NYNA 4B8AB 4HTUA 2D0AA 2F96A 2IS3A 3AVMA 4B9NA 3HYFA 3DI6A 2HNZA 1BIZA 1I3AA 3P5JA 1VK0A 4CJPA 3PO4A 4HUGA 4J2AA 2ZE2A 4CJRA 4KHYA 4IBNA 5E41A 4KO0A 1LAWA 4KKOA 1YVUA 5J2QA 2BDPA 2E6LA 4FJJA 4IG0A 1FKOA 2KW4A 1RT2A 4M3WA 4CEZA 2XO7A 3V9UA 4KI4A 4RW6A 3LANA 4H4MA 2GUIA 4OKJA 4CHPA 3F9KA 1WNSA 1R0AA 4FLWA 3BDPA 4KTQA 2HHUA 3V6DA 4Z4CA 4HUEA 1ZBIA 3NH0A 1QTMA 4DTUA 1BGXT 1N6QA 4AHVA 1WSJA 2P1JA 3MEGA 3D0PA 4IKFA 5HRRA 2G8KA 4CECA 4FLUA 2HHQA 1ASWA 3OYDA 1RDCA 2ETJA 4HVJA 4FZXC 5HRPA 4KHUA 1J53A 1S9EA 3CFPA 1LV5A 3V81A 1QE1A 1WN7A 4DFMA 3B6PA 3LPTA 1DLOA 3NF6A 3ZSXA 2XRIA 3OYBA 4GMJB 3OYHA 3QESA 3OYKA 2OPSA 3LAMA 3VQQA 4ELUA 4F2RA 4CJ5A 4CIGA 4Q5VA 3P1GA 4EZ9A 3AV9A 1SUQA 4CGGA 4CGFA 3KKSA 3SQ4A 2YHAA 4DFJA 4O0IA 1LW2A 3AA5X 3OVNA 3KLGA 3PX0A 4DFKA 4FJ7A 4QAGA 1HNVA 5KGXA 3SNNA 4MQ3A 2G8UA 4MFBA 3ZSQA 2HMIA 4B9VA 1C0UA 3O3GA 1GOBA 1HPZA 3QIOA 4DU4A 2HHSA 4N41A 4JS5A 2EX3A 2Z1IA 1X9MA 2HVIA 4O5BA 2QXFA 4I2PA 4CJTA 1RILA 3VQ6A 3TANA 1KVCA 2VWKA 3QLHA 3BGRA 4CEAA 5J1EA 2P5GA 2QKKA 2OZSA 3AVBA 4I2QA 2R7YA 3HPGA 1Z26A 4KFBA 1HYSA 2RF2A 3HPOA 1VSJA 1FKPA 3TAGA 4ZTJA 1UAXA 2IAJA 3V1OA 4O44A 2KFZA 3JSMA 1NK0A 3V9XA 3K2PA 1ZBFA 2X6NA 3VQDA 1UWBA 4YNQA 1A5VA 4DTJA 4BDPA 4Z4IA 1Q9YA 2Y1JA 4FLTA 4CK1A 1KLNA 3HT3A 5FRMA 3O4QA 4B08A 4FJGA 4R5PA 1W0HA 3AVCA 3LPUA 4FJKA 3SUOA 4EP5A 4KHWA 2OPRA 5C42A 3KK2A 1T05A 4BDYA 1SKWA 2HHXA 4E7LA 3SPYA 3CM5A 1RTDA 4FK2A 4CJLA 4E89A 5KRTA 1C6VA 1NK9A 2HW3A 4FLVA 1NJYA 4DQQA 1RBTA 5SWMA 4F2SA 4EP4A 1T7PA 1C0MA 3ALYA 3O3HA 4DU3A 1C0TA 2IDOA 1U49A 4DTSA 5KI6A 4HUFA 3ULDA 3U6FA 1YT3A 3AO5A 4OKKA 1I39A 4NYFA 1VSEA 5J2PA 1XHZA 1BCMA 2E6MA 3AVHA 3C94A 3NF8A 3SV3A 4FZZA 4GVMA 4AILC 4FM2A 1Q9XA 4FLXA 3IAYA 4CGIA 4OPJA 2IGIA 3I0RA 4Z4EA 3SZ2A 3AO1A 3TAEA 4OGCA 3E01A 3MECA 1LW0A 2OYQA 4KREA 2QKBA 2P5OA 3K58A 4Y1CA 3ZSYA 4DWIA 5HRNA 1WAJA 4KB0A 1VSKA 1L5UA 3NF7A 3S3MA 4DTOA 4ELVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI4 B;  1TVR A;  1XWL A;  3CFO A;  3KKR A;  4Z4G A;  1L3V A;  4CHN A;  2ZD1 A;  1TAQ A;  4DG1 A;  3KK3 A;  3KLH A;  3KLE A;  3AO2 A;  4FXD A;  3NCI A;  1SL1 A;  4Q0B A;  4FVM A;  5KTQ A;  1IO2 A;  1KVA A;  4K8X A;  1RDD A;  4E7H A;  4DSE A;  5JS1 A;  3QEI A;  2DFE A;  4TSX A;  1EET A;  2OPP A;  1VSM A;  4BE2 A;  3VQ9 A;  4BAC A;  1FK9 A;  4FJI A;  1UOC A;  3AVI A;  2KQ2 A;  1S1X A;  3ZSO A;  3QEP A;  2PY5 A;  1RT1 A;  1J54 A;  4CF2 A;  4FZY A;  2HHT A;  2YV0 X;  3DMJ A;  2LSN A;  4JLH A;  3TAQ A;  3NHG A;  5JS2 A;  5C24 A;  2FBT A;  4LD0 A;  4RW7 A;  4FW1 A;  4CE9 A;  3NGZ A;  4RW4 A;  5DK5 A;  1C1C A;  4DTR A;  3A2F A;  4AHC A;  3VQE A;  3VA3 A;  3SUP A;  1KSP A;  4DSK A;  1BIU A;  4ELT A;  2ITG A;  3LP1 A;  5FRO A;  1RTJ A;  1HYZ A;  1VRU A;  1JL2 A;  2VG5 A;  4DTP A;  4GW6 A;  3SJJ A;  4C8O A;  2HVH A;  1NJZ A;  3SQ0 A;  3K59 A;  2Q3S A;  3QIP A;  3C6U A;  1RBS A;  1QSY A;  3AVK A;  1LWE A;  2NUB A;  2QK9 A;  2YKM A;  1GOA A;  3ITH A;  1VSH A;  1XHX A;  3IS9 A;  4DTN A;  3AVL A;  4NCG A;  4B3O A;  2DY4 A;  4FW2 A;  4CF8 A;  3NE6 A;  4ZHR A;  2YKN A;  1TV6 A;  3CFR A;  4I7F A;  1WSI A;  4W5O A;  1BIS A;  3SV4 A;  4DTX A;  3LZJ A;  3NDK A;  3SCX A;  3ZT0 A;  2RN2 A;  3MXJ A;  3VQA A;  2VG6 A;  1Y97 A;  1O1W A;  3L2U A;  3CYM A;  3TAB A;  5I3U A;  1T03 A;  1NJW A;  4L8R B;  1VSD A;  3QNN A;  1NK6 A;  4DQI A;  1CXQ A;  3AA2 A;  5EU7 A;  1JLC A;  1HJR A;  1RTH A;  1WAF A;  4DTM A;  2PZS A;  2Z1H A;  1K6Y A;  4IFV A;  4W5Q A;  3HP6 A;  3VA0 A;  2G8I A;  3HVR A;  4CF9 A;  1NK4 A;  1ZBH A;  2IOC A;  1C1B A;  3LDS A;  2OA8 A;  1S6P A;  2FC0 A;  1S9G A;  4H8K A;  4C8M A;  3HP9 A;  3ZT4 A;  4YFU A;  3K57 A;  3PV8 A;  5HP1 A;  4OJR A;  3L3V A;  4DQS A;  4KRF A;  4DU1 A;  3SQ1 A;  4CHO A;  3S3N A;  3NF9 A;  3DLR A;  3SYZ A;  4DSJ A;  1QSS A;  4M3R A;  2X6S A;  2G8H A;  1TKZ A;  3RMA A;  3DLK A;  2XY5 A;  1TKD A;  2B5J A;  3HL8 A;  2G8V A;  4PA1 A;  1SV5 A;  4CJE A;  5CZ2 A;  2X78 A;  4CHY A;  4CEB A;  4BWM A;  4KTZ A;  3CQ8 A;  3TAM A;  2PYJ A;  1JKH A;  2GV9 A;  4DQR A;  2P51 A;  1EKE A;  4AHU A;  3KD1 E;  1GOC A;  4ID1 A;  2HHW A;  4J2D A;  3ZSV A;  4PWD A;  3V1R A;  4G1Q A;  4M42 A;  4C8L A;  5DMR A;  2B6A A;  3AVG A;  4HHT A;  4IFY A;  1TKT A;  4N76 A;  1IKX A;  1BQM A;  1U04 A;  4FJH A;  3AVJ A;  2A1R A;  3OS2 A;  3U3G A;  3G10 A;  3KK1 A;  3S3O A;  2KTQ A;  1LWF A;  3DLG A;  1NK7 A;  1HYV A;  3QIN A;  4CEF A;  3KLF A;  4LSL A;  1IKY A;  1HNI A;  3G0Z A;  4E7I A;  3P83 D;  4HCC A;  3AVN A;  3ZT2 A;  1KTQ A;  3TR8 A;  1RDA A;  1ASU A;  1JLQ A;  4B8C A;  3TWH A;  3LWM A;  3RMD A;  3PX6 A;  3THV A;  3WNF A;  1Q8I A;  2VG7 A;  2WON A;  1S1V A;  3ASM A;  4E1N A;  1D9F A;  1TL1 A;  1IG9 A;  2HND A;  4QOZ B;  3C95 A;  4I9L A;  4LH5 A;  3LWL A;  3D45 A;  4Z4F A;  1QSL A;  3L2R A;  4FLY A;  4CIF A;  4BDZ A;  2B4J A;  3NGY A;  1JXB A;  5J2M A;  4N47 A;  3OS1 A;  4M3Z A;  2A1S A;  4M3T A;  2X74 A;  4CJV A;  4KHS A;  1NOZ A;  2YNF A;  2KZM A;  1HQU A;  1HMV A;  2YNG A;  4H4O A;  3NH2 A;  3OYL A;  1VSL A;  1NKB A;  5K14 A;  1XI1 A;  3HJF A;  1KFD A;  5CZ1 A;  4N5S A;  2WOM A;  1T8E A;  1RT5 A;  1CXU A;  4M45 A;  3SI6 A;  5CYQ A;  3V9W A;  4W5R A;  3ZT3 A;  3ZSZ A;  4M3Y A;  3LP2 A;  3LAL A;  3OYM A;  5I42 A;  3MED A;  4QCL A;  2KFN A;  4KHQ A;  1EX4 A;  4RG8 A;  1RT3 A;  3CG7 A;  4KB1 A;  2Y1I A;  5HLF A;  1SL0 A;  4E1M A;  1KFS A;  4CF0 A;  1BQN A;  3VQB A;  3CM6 A;  1QHT A;  4C8N A;  2IC3 A;  4CJ4 A;  3DRS A;  4CFB A;  5HRO A;  1W9H A;  4Y1D A;  1S1U A;  4DS5 A;  2O4I A;  1IKV A;  4IG3 A;  2G8F A;  2PYL A;  4KI6 A;  1RCH A;  3QEV A;  3VQ7 A;  4HCB A;  4NCB A;  3RMC A;  4CK3 A;  1B92 A;  3ZSR A;  1S1W A;  4CFA A;  1UA0 A;  1RT4 A;  3T19 A;  3ZCM A;  3O3F A;  3RRH A;  4DFP A;  4DF4 A;  1N5Y A;  1QS4 A;  3OJU A;  1REV A;  3WNH A;  3AA4 A;  4J2E A;  5HBM A;  3M8S A;  3K5O A;  2XY8 A;  1VSI A;  1NOY A;  4W5N A;  4NCA A;  4DSI A;  2HHV A;  4CF1 A;  4O55 A;  4CJU A;  3AVF A;  3K5M A;  1BCO A;  4B9S A;  4PUO A;  1ZYQ A;  3LZI A;  3S9H A;  3I0S A;  1WSH A;  2YNH A;  5KGW A;  2D0C A;  3NBP A;  4CIE A;  4CES A;  2D5R A;  1B9F A;  3L3U A;  1WSG A;  2Z1J A;  3WNG A;  3JYT A;  3U3Y A;  1MU2 A;  4CGD A;  4IDK A;  1NK5 A;  1A5W A;  1WSF A;  1A5X A;  3OYN A;  4M3U A;  1D8Y A;  2F8S A;  1BL3 A;  3VQ5 A;  5KRS A;  4FM0 A;  4FJ8 A;  5T7B A;  3TI0 A;  3QET A;  3UIQ A;  3OJS A;  1WLJ A;  3V9Z A;  1U4B A;  3O4N A;  3MXI A;  3ZSW A;  1J9A A;  4DS4 A;  2XY7 A;  4Z0U A;  4CJF A;  2YNI A;  1ASV A;  3VQP A;  3DM2 A;  3AO4 A;  3NH1 A;  4E19 A;  3HM9 A;  3RR8 A;  3WNE A;  1JL1 A;  4LY7 A;  1TK8 A;  4ZTF A;  4B9M A;  2OPQ A;  4AHT A;  4CJW A;  4OPK A;  1TAU A;  1TGO A;  2DFH A;  3RMB A;  3DRR A;  1TK0 A;  1S6Q A;  1D5A A;  3PX4 A;  4E7K A;  1U48 A;  3NGI A;  3EY1 A;  1YTA A;  2RKI A;  2O4G A;  1ITG A;  1LAV A;  2BE2 A;  2HNY A;  3V1Q A;  3OYG A;  3L8B A;  4LSN A;  1SL2 A;  3TAP A;  1SKS A;  3DLB A;  1RDB A;  1RTI A;  4DSL A;  4I9Q A;  3L2V A;  5FDL A;  4CGH A;  5HRS A;  3DLH A;  1RBU A;  3KJV A;  4O0J A;  4CJK A;  4DF8 A;  1RT6 A;  3OYF A;  3NAE A;  4JRP A;  4Z4H A;  1S5J A;  3EZ5 A;  4XIU A;  4FYD A;  4F8R A;  4CEQ A;  4E3S A;  1YTU A;  4CFD A;  2KZZ A;  4KPY A;  2XY6 A;  4FK0 A;  2HB5 A;  3LAK A;  2RPI A;  2AJQ A;  1HRH A;  1L3T A;  1BHL A;  3HST B;  3HVT A;  5J2N A;  2GBZ A;  2G8W A;  3OYJ A;  4UQG A;  1RBR A;  1KRP A;  3PY8 A;  3OYC A;  3HO1 A;  3OYI A;  4OLA A;  2DFF A;  4FCY A;  4CER A;  4N56 A;  2EHG A;  4F3T A;  3T1A A;  4BE1 A;  1QQC A;  4ID5 A;  3QO9 A;  1Z25 A;  3QNO A;  3SQ2 A;  1TK5 A;  1C1A A;  2ATQ A;  3MXM A;  4OGE A;  1KLM A;  1RBV A;  3AVA A;  4BWJ A;  3OY9 A;  1X9S A;  4FJX A;  3KTQ A;  1U47 A;  3M8Q A;  4JS4 A;  4AH9 A;  4DSF A;  3OYA A;  4KAZ A;  3K5N A;  1TL3 A;  4M41 A;  3QEX A;  4B9U A;  3HXM A;  4AHR A;  4AHS A;  1NJX A;  3RR7 A;  1JLG A;  5D3G A;  1RNH A;  3IRX A;  3LP3 A;  1DTQ A;  3MEE A;  4W5T A;  4K8Z A;  3VQ8 A;  3TAF A;  1HQE A;  3HPH A;  5CYM A;  1S1T A;  5SZT A;  3QER A;  4E0D A;  1BI4 A;  4OLB A;  3ISN C;  4E7J A;  4JRQ A;  3VN5 A;  1L3U A;  4CEO A;  3DRP A;  2VWJ A;  1F21 A;  1UA1 A;  2XHB A;  4EZ6 A;  1EXQ A;  3VQC A;  4B9T A;  3RTV A;  4F4K A;  3PO5 A;  1JLA A;  2E4L A;  4FJ9 A;  1JXE A;  4F3O A;  4CEE A;  5CY4 A;  1CLQ A;  4B9L A;  4LH4 A;  1L3S A;  4O4G A;  2JLE A;  4DMN A;  2JGU A;  4FK4 A;  4WE1 A;  3AO3 A;  4FLZ A;  1DTT A;  1X9W A;  1NKE A;  1CZ9 A;  3IG1 A;  4DLG A;  3V4I A;  3RWU A;  4FJM A;  3OS0 A;  1CZB A;  1X1P A;  4DLE A;  3M8R A;  3TAR A;  3OYE A;  1U45 A;  3PUF A;  2W42 A;  5C25 A;  1XC9 A;  4OKE A;  1VRT A;  3I8D A;  2OZM A;  4KHN A;  3NFA A;  2D0B A;  4C8K A;  3H08 A;  3DOK A;  3ZT1 A;  3B6O A;  2Z1G A;  1KVB A;  3KIO A;  4CK2 A;  3F73 A;  3L2Q A;  2DTU A;  4KTW A;  1NKC A;  3LP0 A;  1D9D A;  2FBY A;  3FFI A;  3AA3 A;  3KD5 E;  4CJ3 A;  1ZBU A;  3HK2 A;  2FBX A;  4FJN A;  3MAQ A;  1NK8 A;  5FRN A;  1B9D A;  2YHB A;  1VSF A;  3M8P A;  4PQU A;  2BAN A;  2ZQB A;  4CJS A;  4CHZ A;  4ICL A;  1JLB A;  1G15 A;  3QEW A;  4FJ5 A;  2FBV A;  1LWC A;  3SUQ A;  1SKR A;  4M3X A;  3T3F A;  1WSE A;  4RW8 A;  4FM1 A;  3DYA A;  4FJL A;  2BGG A;  1JLF A;  3KLI A;  4RW9 A;  3VQ4 A;  1KCF A;  3DOL A;  4CJQ A;  1ZBL A;  3K5L A;  3DLE A;  4CCH A;  4DQP A;  1IKW A;  1TKX A;  4KV8 A;  1FXX A;  3RRG A;  2I5J A;  4CGJ A;  1EP4 A;  3SPZ A;  3EYZ A;  3L2W A;  1IH7 A;  3SUN A;  4OVL A;  4J2B A;  2F8T A;  4PY5 A;  4CED A;  4CFC A;  4CHQ A;  3C6T A;  4BE0 A;  1J5O A;  1JLE A;  3V9S A;  1RT7 A;  4NYN A;  4B8A B;  4HTU A;  2D0A A;  2F96 A;  2IS3 A;  3AVM A;  4B9N A;  3HYF A;  3DI6 A;  2HNZ A;  1BIZ A;  1I3A A;  3P5J A;  1VK0 A;  4CJP A;  3PO4 A;  4HUG A;  4J2A A;  2ZE2 A;  4CJR A;  4KHY A;  4IBN A;  5E41 A;  4KO0 A;  1LAW A;  4KKO A;  1YVU A;  5J2Q A;  2BDP A;  2E6L A;  4FJJ A;  4IG0 A;  1FKO A;  2KW4 A;  1RT2 A;  4M3W A;  4CEZ A;  2XO7 A;  3V9U A;  4KI4 A;  4RW6 A;  3LAN A;  4H4M A;  2GUI A;  4OKJ A;  4CHP A;  3F9K A;  1WNS A;  1R0A A;  4FLW A;  3BDP A;  4KTQ A;  2HHU A;  3V6D A;  4Z4C A;  4HUE A;  1ZBI A;  3NH0 A;  1QTM A;  4DTU A;  1BGX T;  1N6Q A;  4AHV A;  1WSJ A;  2P1J A;  3MEG A;  3D0P A;  4IKF A;  5HRR A;  2G8K A;  4CEC A;  4FLU A;  2HHQ A;  1ASW A;  3OYD A;  1RDC A;  2ETJ A;  4HVJ A;  4FZX C;  5HRP A;  4KHU A;  1J53 A;  1S9E A;  3CFP A;  1LV5 A;  3V81 A;  1QE1 A;  1WN7 A;  4DFM A;  3B6P A;  3LPT A;  1DLO A;  3NF6 A;  3ZSX A;  2XRI A;  3OYB A;  4GMJ B;  3OYH A;  3QES A;  3OYK A;  2OPS A;  3LAM A;  3VQQ A;  4ELU A;  4F2R A;  4CJ5 A;  4CIG A;  4Q5V A;  3P1G A;  4EZ9 A;  3AV9 A;  1SUQ A;  4CGG A;  4CGF A;  3KKS A;  3SQ4 A;  2YHA A;  4DFJ A;  4O0I A;  1LW2 A;  3AA5 X;  3OVN A;  3KLG A;  3PX0 A;  4DFK A;  4FJ7 A;  4QAG A;  1HNV A;  5KGX A;  3SNN A;  4MQ3 A;  2G8U A;  4MFB A;  3ZSQ A;  2HMI A;  4B9V A;  1C0U A;  3O3G A;  1GOB A;  1HPZ A;  3QIO A;  4DU4 A;  2HHS A;  4N41 A;  4JS5 A;  2EX3 A;  2Z1I A;  1X9M A;  2HVI A;  4O5B A;  2QXF A;  4I2P A;  4CJT A;  1RIL A;  3VQ6 A;  3TAN A;  1KVC A;  2VWK A;  3QLH A;  3BGR A;  4CEA A;  5J1E A;  2P5G A;  2QKK A;  2OZS A;  3AVB A;  4I2Q A;  2R7Y A;  3HPG A;  1Z26 A;  4KFB A;  1HYS A;  2RF2 A;  3HPO A;  1VSJ A;  1FKP A;  3TAG A;  4ZTJ A;  1UAX A;  2IAJ A;  3V1O A;  4O44 A;  2KFZ A;  3JSM A;  1NK0 A;  3V9X A;  3K2P A;  1ZBF A;  2X6N A;  3VQD A;  1UWB A;  4YNQ A;  1A5V A;  4DTJ A;  4BDP A;  4Z4I A;  1Q9Y A;  2Y1J A;  4FLT A;  4CK1 A;  1KLN A;  3HT3 A;  5FRM A;  3O4Q A;  4B08 A;  4FJG A;  4R5P A;  1W0H A;  3AVC A;  3LPU A;  4FJK A;  3SUO A;  4EP5 A;  4KHW A;  2OPR A;  5C42 A;  3KK2 A;  1T05 A;  4BDY A;  1SKW A;  2HHX A;  4E7L A;  3SPY A;  3CM5 A;  1RTD A;  4FK2 A;  4CJL A;  4E89 A;  5KRT A;  1C6V A;  1NK9 A;  2HW3 A;  4FLV A;  1NJY A;  4DQQ A;  1RBT A;  5SWM A;  4F2S A;  4EP4 A;  1T7P A;  1C0M A;  3ALY A;  3O3H A;  4DU3 A;  1C0T A;  2IDO A;  1U49 A;  4DTS A;  5KI6 A;  4HUF A;  3ULD A;  3U6F A;  1YT3 A;  3AO5 A;  4OKK A;  1I39 A;  4NYF A;  1VSE A;  5J2P A;  1XHZ A;  1BCM A;  2E6M A;  3AVH A;  3C94 A;  3NF8 A;  3SV3 A;  4FZZ A;  4GVM A;  4AIL C;  4FM2 A;  1Q9X A;  4FLX A;  3IAY A;  4CGI A;  4OPJ A;  2IGI A;  3I0R A;  4Z4E A;  3SZ2 A;  3AO1 A;  3TAE A;  4OGC A;  3E01 A;  3MEC A;  1LW0 A;  2OYQ A;  4KRE A;  2QKB A;  2P5O A;  3K58 A;  4Y1C A;  3ZSY A;  4DWI A;  5HRN A;  1WAJ A;  4KB0 A;  1VSK A;  1L5U A;  3NF7 A;  3S3M A;  4DTO A;  4ELV A; 
#chains in the Genus database with same CATH topology
 3CFO A;  2IIR A;  3KKR A;  3E1Y A;  4Z4G A;  5GIN A;  4CHN A;  1L3V A;  3VOV A;  3AGK A;  4CZK A;  4DG1 A;  3KLE A;  3KK3 A;  3AO2 A;  5BPL A;  4FXD A;  5GIP A;  4FVM A;  4DSE A;  4DR1 K;  3GBT A;  5E26 A;  3HTV A;  3ZSO A;  4XH5 A;  4FWK A;  3G6E N;  4WQ5 C;  4I6M A;  2LSN A;  4JLH A;  3TAQ A;  3DXM A;  2FBT A;  4CE9 A;  3NGZ A;  3AAP A;  1ATS A;  3SUP A;  3G4S N;  3VA3 A;  3VQE A;  5FRO A;  4PKI A;  2FXU A;  1HYZ A;  3U4L A;  1JL2 A;  1NGA A;  4IDH A;  4GW6 A;  5GAH P;  4QS8 A;  3VGM A;  4DTP A;  3SJJ A;  4RWT A;  2Q3S A;  1TYQ A;  4IEE A;  1K73 O;  2NUB A;  3ZET B;  3L6Q A;  2YKM A;  1GOA A;  3ITH A;  4DTN A;  4BC2 A;  2DY4 A;  1NMN A;  5GAG P;  1NGF A;  1BIS A;  4DTX A;  3SCX A;  3LZJ A;  3ZT0 A;  4YDU C;  2YHY A;  1T03 A;  1NGC A;  4DQI A;  4DR5 K;  1RTH A;  4DTM A;  4JN4 A;  4W5Q A;  3HP6 A;  3VA0 A;  1HKG A;  2G8I A;  2QM1 A;  3AAQ A;  1C1B A;  2FC0 A;  1S9G A;  2GUP A;  5HP1 A;  4YFU A;  1E3M A;  3OBY A;  3SQ1 A;  4A2A A;  4LC9 B;  4M3R A;  2X6S A;  2HMP A;  3SBT A;  3WXL A;  3HL8 A;  4A61 A;  2I7N A;  4CEB A;  4DV6 K;  2O8B A;  4JI6 K;  3IMX A;  2PYJ A;  1JKH A;  4DQR A;  1GLA G;  4FSV A;  3WEE A;  3JAM O;  3KD1 E;  1GOC A;  2E8A A;  5AQY A;  4JYA K;  3AVG A;  5GAD P;  5M1K A;  1IKX A;  1BG3 A;  1YJN N;  3EN9 A;  2A1R A;  3OS2 A;  3S3O A;  1Q18 A;  3SBG A;  3KLF A;  1V4S A;  3ENB A;  1IKY A;  1HNI A;  3VEN A;  5JMV A;  3P83 D;  4E7I A;  4HCC A;  1RDA A;  1JLQ A;  3PX6 A;  2YI1 A;  2WON A;  3ZYY X;  2HBM A;  3P39 A;  1D9F A;  2ZJP L;  4QOZ B;  2O8E A;  3LWL A;  3O9S A;  4CIF A;  2W6K A;  4LF5 K;  4M3Z A;  4M3T A;  4K41 A;  1NOZ A;  2YNF A;  1HQU A;  2YNG A;  3WT0 A;  2NRH A;  1K8K B;  1CXU A;  4HTL A;  4QS7 A;  5CYQ A;  4W5R A;  3V9W A;  3ZSZ A;  3LP2 A;  4A5B A;  3LM2 A;  3CG7 A;  4KB1 A;  4CF0 A;  1BQN A;  3VQB A;  3CM6 A;  1QHT A;  3UKU B;  5HRO A;  4YOX A;  3DRS A;  1W9H A;  1S1U A;  2WTU A;  3WQU A;  2PYL A;  4KI6 A;  4NO7 A;  2WUS A;  5LMN K;  1B92 A;  1YXQ A;  4CFA A;  1UA0 A;  4CBU A;  3RSE A;  1QS4 A;  3OJU A;  2QEX N;  5HBM A;  2E1Y A;  2GX9 A;  1NOY A;  4O55 A;  4CJU A;  3AVF A;  3K5M A;  4BRO A;  4B9S A;  2UYT A;  3S9H A;  3A5N C;  5AQF A;  2D0C A;  3NBP A;  4FL9 A;  5IWA K;  1B9F A;  3L3U A;  1WSG A;  3LDQ A;  1N32 K;  3JYT A;  4M7X A;  3CJA A;  1WSF A;  1D8Y A;  1BL3 A;  4FM0 A;  4FJ8 A;  3A5L C;  5GIO A;  4KHP K;  3V9Z A;  1FW6 A;  1VQ7 N;  4H5V A;  4Z0U A;  4CJF A;  2UXD K;  1XNR K;  3CER A;  2YNI A;  4FWP A;  4FPB A;  4JAX A;  3AO4 A;  3CJ7 A;  3RR8 A;  4OPK A;  2DFH A;  4DR6 K;  3PX4 A;  4E7K A;  1YTA A;  2BE2 A;  3L8B A;  4LSN A;  3DLB A;  3TAP A;  1SKS A;  4I9Q A;  3CJC A;  3FLC O;  3ULE A;  5AQI A;  2FF3 B;  1LOT B;  1C0G A;  3NAE A;  5JLF A;  4JI2 K;  4XIU A;  4FYD A;  4EAH D;  1CZA N;  3F5T A;  4CFD A;  5BPM A;  2CH5 A;  4FK0 A;  1X3M A;  3LAK A;  2RPI A;  1HRH A;  5LL6 Z;  5CHI A;  2GBZ A;  3PY8 A;  1RBR A;  3OYC A;  4JKH A;  2D1K A;  3TPQ A;  5AQQ A;  3T1A A;  3H1V X;  3QO9 A;  3C7N A;  1C1A A;  1RBV A;  1U47 A;  5C15 A;  3QEX A;  4WYB A;  5ADX A;  3IRX A;  4W5T A;  3H1Q A;  1DTQ A;  3MEE A;  3HOT A;  4CJ7 A;  3VQ8 A;  4MO4 A;  1HQE A;  4B3T K;  1S1T A;  1BI4 A;  2OAN A;  1VQN N;  1L3U A;  4CEO A;  1YAG A;  2VWJ A;  2A5X A;  5CE3 A;  2XHB A;  4EZ6 A;  3O1B A;  1GLE G;  3MWP A;  2P9I B;  2JLE A;  2JGU A;  4H03 B;  3M3Z A;  4FLZ A;  1DTT A;  1X9W A;  3CD6 N;  1BU6 O;  1U45 A;  3OYE A;  3PUF A;  4OKE A;  3TTC A;  1IV0 A;  3F73 A;  5GAE P;  1VQP N;  3L2Q A;  3VF4 A;  3LP0 A;  1D9D A;  3E9P A;  3FFI A;  3AA3 A;  4ILJ A;  3H6E A;  1S72 N;  5FRN A;  4PQU A;  2WBN A;  1JCG A;  2BAN A;  2ZQB A;  4BRC A;  4CJS A;  1JLB A;  1G15 A;  3CCM N;  3ZEU B;  2FBV A;  4AF1 A;  1SKR A;  5KPR A;  3FR0 A;  4X64 K;  3T3F A;  1WSE A;  4RW8 A;  3CJ1 A;  3KVG A;  4RW9 A;  3U9D A;  4DQP A;  1J6Z A;  3OTO K;  3RRG A;  2P9N A;  1EP4 A;  3MX2 A;  3THY B;  1NJI O;  4OVL A;  4J2B A;  2F8T A;  4CD1 A;  1J5O A;  3VGL A;  1RT7 A;  4K43 A;  2IS3 A;  3HYF A;  3DI6 A;  2HNZ A;  3ZX0 A;  5AZI B;  4KKO A;  4JKC A;  3FZK A;  4AM7 A;  4JI1 K;  4CEZ A;  2XO7 A;  3THX B;  1YJW N;  3R3L A;  4RW6 A;  4JKF A;  1WNS A;  4C23 A;  3EO3 A;  4HUE A;  1ZBI A;  3NH0 A;  3LL3 A;  4DTU A;  2UXC K;  1GLC G;  1N6Q A;  1DT9 A;  4RCH A;  2P1J A;  3MEG A;  3TSQ A;  3D0P A;  4CEC A;  1VAZ A;  1J53 A;  5FPM A;  1QE1 A;  2VWB A;  5KQD A;  3EE8 A;  4DFM A;  3LPT A;  4CD3 A;  3OYH A;  3LAM A;  1NNE A;  3SJH A;  4CJ5 A;  1YIT N;  3HBT A;  1YVN A;  3D2E B;  4CGG A;  4CGF A;  4O0I A;  3AA5 X;  3PSF A;  4DFK A;  4KH4 A;  4MQ3 A;  2UUC K;  2G8U A;  2A41 A;  4DV2 K;  4B9Q A;  1HPZ A;  4JD2 B;  4JS5 A;  1LCU A;  1X9M A;  2HVI A;  1T3V A;  4O5B A;  3WQT A;  4CJT A;  4OX9 K;  3TAN A;  2VWK A;  4NXM K;  1WBB A;  4B3R K;  4KFB A;  2ASP A;  1HKC A;  1VSJ A;  5AQZ A;  3MDQ A;  4GNI A;  3V9X A;  4C1N K;  4GV9 A;  2P9U A;  1UWB A;  2Y1J A;  4HWI A;  3EZW A;  2V51 B;  3O4Q A;  2ZF5 O;  3MN9 A;  3SAF A;  1W0H A;  4YOW A;  1NMD A;  3AVC A;  4FJK A;  2OPR A;  3FZF A;  1T44 A;  4CBW A;  4BDY A;  1SKW A;  2HHX A;  4YOU A;  3SPY A;  3J80 O;  1NK9 A;  5F2R A;  4DQQ A;  1T7P A;  2ZJQ L;  4H0O A;  1NLV A;  3A8Y A;  1C0T A;  2IDO A;  4K25 A;  5KI6 A;  3C65 A;  1YT3 A;  5J2P A;  3AVH A;  3SV3 A;  2V7Y A;  2V7Z A;  4BY9 C;  1Q9X A;  3IAY A;  2IGI A;  4E1J A;  5KPT A;  2GWJ A;  3SZ2 A;  3AO1 A;  2VQF K;  2IVP A;  2OYQ A;  1LW0 A;  4JK8 A;  2P5O A;  3CCU N;  3R9P A;  5AFU H;  1ESV A;  4B1W B;  3A5M C;  4BR4 A;  1TAQ A;  5F1X A;  5E84 A;  4Q0B A;  4FWR A;  3K9K A;  1KVA A;  5BPN A;  1RDD A;  4E7H A;  5JS1 A;  1EET A;  2O8C A;  4IFE A;  3VQ9 A;  1FK9 A;  4BAC A;  4H5W A;  5M1P A;  4BR5 A;  4FZY A;  1J54 A;  2HHT A;  2YV0 X;  1RDU A;  3KWI A;  3SAG A;  3NHG A;  2FLO A;  5JS2 A;  5AR0 A;  4GV6 A;  5C24 A;  4LD0 A;  1D4X A;  4FW1 A;  1QVG M;  3JS6 A;  5DK5 A;  3CCS N;  3A2F A;  4BRL A;  3GL1 A;  2ITG A;  3LP1 A;  1RTJ A;  2VG5 A;  4C8O A;  2HVH A;  4NLB A;  1NJZ A;  3QIP A;  1RBS A;  2D4W A;  5AQX A;  4WCE L;  2QK9 A;  2FSN A;  3SK3 A;  5FPN A;  1XHX A;  3IS9 A;  1IBL K;  1XMO K;  2Q1N A;  1OKJ A;  4B3O A;  4FW2 A;  4CF8 A;  4BRN A;  4ZHR A;  1TV6 A;  4JKB A;  4I7F A;  2FSJ A;  4JHD B;  1S3X A;  3MXJ A;  4ILG B;  3VQA A;  3L2U A;  3TAB A;  1NJW A;  3CQY A;  4L8R B;  4UY8 O;  3AA2 A;  1JLC A;  1HJR A;  4IOC L;  5AQP A;  1HJO A;  4CF9 A;  1ZBH A;  3O8M A;  1U48 A;  3C6A A;  2HST A;  1M1K O;  4DKW A;  3SYZ A;  1TKZ A;  2G8V A;  4PA1 A;  5CZ2 A;  4CW7 B;  4LF8 K;  3Q7C A;  4BWM A;  4KTZ A;  4PKG A;  3QDK A;  3HI0 A;  3L0Q A;  3T1Y K;  5AQS A;  4ID1 A;  2P9K A;  4J2D A;  2P9P B;  4C8L A;  5DMR A;  4HHT A;  4N76 A;  1GLD G;  1BQM A;  3I33 A;  3KK1 A;  1GLF O;  1DEJ A;  3DLG A;  3CCE N;  1NK7 A;  3N4Q A;  4CEF A;  3G0Z A;  4PHT X;  3AVN A;  3ZT2 A;  2A3Z A;  1ASU A;  4B8C A;  3TWH A;  3LWM A;  3THV A;  1TL1 A;  1XQS C;  2HND A;  3D45 A;  2Q2R A;  1QSL A;  4Z4F A;  3CJ9 A;  2A40 A;  1S22 A;  1JXB A;  4EHU A;  2A1S A;  4CJV A;  1OH6 A;  2KZM A;  4H4O A;  1HMV A;  1Q86 O;  1VSL A;  3QBX A;  1NKB A;  5BRH A;  4BC3 A;  4A2B A;  4CBX A;  1RT5 A;  3R1X A;  1Q82 O;  1YUW A;  4O8U A;  4A59 A;  4M3Y A;  5I42 A;  3MED A;  1EX4 A;  1RT3 A;  2QWO A;  2VQE K;  1EO1 A;  4E1M A;  2W40 A;  3FZL A;  3O6W A;  3AAR A;  4C8N A;  4CJ4 A;  2IC3 A;  1R59 O;  4DS5 A;  4IG3 A;  2E5L K;  3NVK A;  4JKG B;  3K9J A;  1EWQ A;  1N5Y A;  3T19 A;  3O3F A;  3RRH A;  3GE1 A;  4BRD A;  1REV A;  2O8F B;  3AA4 A;  3M8S A;  3I8B A;  3K5O A;  1VSI A;  4W5N A;  2BTF A;  4JK9 A;  4CF1 A;  4PUO A;  4YHH K;  1BCO A;  2F9W A;  5MLC Q;  1ZYQ A;  3VER A;  3WXM B;  5AQO A;  3E9O A;  1HKB A;  4CIE A;  2D5R A;  1HNW K;  4JI8 K;  4CGD A;  4IDK A;  5KPZ A;  3M1F A;  1EQY A;  1IJJ A;  1M90 O;  1QQM A;  3J81 O;  5KRS A;  2F8S A;  5T7B A;  3QET A;  3H46 O;  3ATU A;  2VGN A;  3D2F B;  3ZSW A;  3THW B;  3HM9 A;  1JL1 A;  4H5R A;  4LY7 A;  3ZX3 A;  5C12 A;  4CJW A;  3MWT A;  5M1N A;  4IO8 A;  3RMB A;  1D5A A;  1N33 K;  2O4G A;  2HNY A;  1LAV A;  3OYG A;  5HOO A;  5FDL A;  4CGH A;  3DLH A;  1RT6 A;  4BQL A;  3SLC A;  1YTU A;  4KPY A;  5C2F A;  1J5E K;  5BRF A;  1Y64 A;  1BHL A;  3CC7 N;  3HO1 A;  3DXM B;  4UQG A;  2GEM A;  4CI6 A;  4OLA A;  3O9Q A;  4FCY A;  1ZC6 A;  1WBD A;  3LDO A;  2IVO A;  2OCE A;  3ID6 A;  4F3T A;  3R6M A;  3UB5 A;  1Z25 A;  2ATQ A;  3MXM A;  1KLM A;  1O13 A;  1OVQ A;  3AVA A;  4DCH A;  4BR7 A;  1HLU A;  3EE9 A;  4KAZ A;  3OYA A;  5AZJ A;  3K5N A;  1TL3 A;  3A5O C;  2I7P A;  4B9U A;  4AHS A;  4BRP A;  2ZWH A;  5D3G A;  3CQX A;  3LP3 A;  1ILY A;  3HPH A;  4E0D A;  3E66 A;  3KK7 A;  3ISN C;  4E7J A;  4JI5 K;  3UKU A;  4JRQ A;  3VN5 A;  1F21 A;  4DUZ K;  3FFK B;  3VEY A;  5AQU A;  4B9T A;  2PFU A;  3RTV A;  4YDU A;  3QML A;  2E4L A;  4F3O A;  4CEE A;  1VHX A;  4LH4 A;  4O4G A;  4FK4 A;  1JJ2 M;  4WE1 A;  3AO3 A;  4FOI A;  3V4I A;  3RWU A;  3OS0 A;  4DLE A;  3TAR A;  1KXP A;  2NRR A;  3I8D A;  4BRI A;  3NFA A;  3ZLJ A;  2Z1G A;  1KVB A;  2O8B B;  4KTW A;  3BEX A;  1NGB A;  1EWR A;  3CIP A;  3HK2 A;  4FJN A;  3UE5 A;  3MAQ A;  4JI4 K;  3M8P A;  1HNX K;  4CVN E;  3QEW A;  1NGJ A;  1BOT O;  2QWN A;  1YI2 N;  3CMA N;  4MDA A;  1VQ6 N;  3VQ4 A;  1ZBL A;  1KCF A;  3K5L A;  1IKW A;  1FXX A;  1G99 A;  2I5J A;  3A0I X;  4DV0 K;  4PY5 A;  4CED A;  2O8E B;  4BE0 A;  3RVC A;  1JLE A;  3V9S A;  2F4V K;  4LFB K;  4B8A B;  2D0A A;  1SS6 A;  2F96 A;  3AVM A;  4JNE A;  1W2B M;  5A2Q O;  4KHY A;  3HSC A;  4HUG A;  4J2A A;  5E41 A;  1VQ5 N;  4PL7 A;  1LAW A;  3S41 A;  2E6L A;  4FJJ A;  1FKO A;  2D0P A;  2E1Z A;  3KWG A;  4CHP A;  1HX1 A;  1HNZ K;  2RHK A;  3VEX A;  2QWQ A;  1QTM A;  1BGX T;  4AHV A;  4IEI A;  4IKF A;  2HHQ A;  2G8K A;  1HUX A;  3OYD A;  2NRV A;  4HVJ A;  4FZX C;  4KHU A;  1S9E A;  1LV5 A;  1P90 A;  2JWK A;  3B6P A;  4DHY A;  2Q0R A;  1DLO A;  2YJF A;  3RSE B;  1HR0 K;  3OYB A;  1NM1 A;  4B1U B;  3OYK A;  3VQQ A;  1VQ8 N;  3EKS A;  4ELU A;  4OO1 J;  3AV9 A;  3SQ4 A;  1LW2 A;  3OVN A;  1GLJ O;  4QAG A;  3CET A;  4B3M K;  3BF1 A;  4MFB A;  5BN9 A;  3ZSQ A;  3KZB A;  2HMI A;  4B9V A;  1C0U A;  3MX5 A;  1GOB A;  4N41 A;  3VF6 A;  2EX3 A;  2Z1I A;  2QXF A;  4I2P A;  1NGH A;  1KVC A;  1KAY A;  3BGR A;  5J1E A;  2HF4 A;  4LF6 K;  2QKK A;  3HPG A;  1HYS A;  2IAJ A;  3CXC M;  3K2P A;  2NZT A;  1ZBF A;  2X6N A;  5AQJ A;  4XEI A;  3VEO A;  4BRQ A;  4BDP A;  1Q9Y A;  4CK1 A;  1KLN A;  3DLL L;  3ULE B;  2UUB K;  3LPU A;  3SUO A;  4EP5 A;  3NMU A;  3MMV A;  3KK2 A;  1T05 A;  3VTH A;  2AP1 A;  4BG8 A;  2Q97 A;  1YJ9 N;  1C6V A;  1NJY A;  2E20 A;  1C0M A;  3O3H A;  4DU3 A;  4DR2 K;  5EXW A;  3W0L A;  1U49 A;  4HUF A;  3ULD A;  3QFU A;  2QI2 A;  5EVZ A;  1NU0 A;  2E6M A;  3C94 A;  3NF8 A;  4EHT A;  4GVM A;  4FM2 A;  4FLX A;  4CGI A;  4OPJ A;  4FWM A;  3HOS A;  3THX A;  4KRE A;  3TTD A;  3K58 A;  4DWI A;  3ZSY A;  3VEZ A;  1WAJ A;  1VSK A;  4CJL A;  3S3M A;  4GKJ K;  1BI4 B;  1TVR A;  4FWL A;  4L3Q A;  4YOT A;  3KLH A;  3SMS A;  3NCI A;  1SL1 A;  4WFN L;  2UU9 K;  3QEI A;  1MWK A;  2DFE A;  2OPP A;  4K42 A;  1E4G T;  1UOC A;  1KC8 O;  3QEP A;  1S1X A;  1Q7Y O;  4B3S K;  4BR0 A;  3DMJ A;  3D2E A;  4RW7 A;  4DR3 K;  4RW4 A;  1C1C A;  2BH1 A;  4DTR A;  4ELT A;  3CPW M;  3SQ0 A;  4BVO A;  3K59 A;  5M1O A;  3C6U A;  1QSY A;  1MWM A;  1LWE A;  4JKD A;  3VET A;  3R8E A;  3AVL A;  4NCG A;  3NE6 A;  3DXK A;  1VQO N;  3SV4 A;  1WSI A;  4W5O A;  2P9N B;  1NGG A;  2P9L B;  2RN2 A;  1TUY A;  2VG6 A;  3CYM A;  5I3U A;  1VSD A;  3QNN A;  3J8A A;  1WAF A;  2Z1H A;  1K6Y A;  2W6L A;  4IFV A;  3F9M A;  3QFP A;  1NK4 A;  2IOC A;  2ZM6 K;  3IDH A;  5DM6 L;  3LDS A;  3ZT4 A;  4C8M A;  4KRF A;  4OJR A;  4CHO A;  3VGK A;  4EIA A;  3DLR A;  1QSS A;  2G8H A;  2B5J A;  4CJE A;  5HL7 L;  2X78 A;  2UUA K;  4CHY A;  2H3G X;  3L4Q A;  3T69 A;  2WC9 A;  4BG9 A;  4AHU A;  4YY3 K;  5AQT A;  4G1Q A;  4GVE A;  1ZBS A;  1U04 A;  3AVJ A;  2KHO A;  3U3G A;  2KTQ A;  1LWF A;  2D0O A;  3VES A;  3OW2 M;  1HYV A;  3QIN A;  4LSL A;  3TSU A;  3VPZ A;  1X9J A;  1Q8I A;  1U2V A;  4E1N A;  3L2R A;  4FLY A;  3NGY A;  4N47 A;  2YX6 A;  4X62 K;  2NRW A;  1RFQ A;  4IOX A;  3NH2 A;  4JKA A;  4WQ4 C;  3HJF A;  5CZ1 A;  1T8E A;  4LF7 K;  4OPH A;  3SI6 A;  2QW9 A;  2O8D A;  3LAL A;  3OYM A;  5ADX H;  2KFN A;  4KHQ A;  4RG8 A;  4DV7 K;  2Y1I A;  2GWK A;  5HLF A;  3CPE A;  3G25 A;  4A57 A;  4Y1D A;  2O4I A;  5EY4 A;  4FO0 A;  2PBD A;  4HCB A;  3VQ7 A;  4NCB A;  3RMC A;  5AQK A;  3ZSR A;  1S1W A;  1RT4 A;  4DFP A;  4X65 K;  2ASM A;  3VTI A;  5H1S Q;  4AM6 A;  4B1Y B;  4J2E A;  2ASO A;  4ISG A;  4KH5 A;  4NCA A;  4JK7 A;  2HHV A;  3VF2 A;  1WSH A;  4PKH A;  2P9S A;  3WNG A;  2Z1J A;  3QBW A;  1U6Z A;  1GLB G;  3VQ5 A;  2HBJ A;  3UIQ A;  3OJS A;  1WLJ A;  3O4N A;  3MXI A;  5KQ8 A;  1BA0 A;  1J9A A;  3N4P A;  1DKG D;  2ITM A;  3VQP A;  3WNE A;  2VCP A;  5BR8 K;  1TK8 A;  4ZTF A;  4B9M A;  1TAU A;  5C0Y A;  3DRR A;  1S6Q A;  3NGI A;  1XNQ K;  1ITG A;  3V1Q A;  4DSL A;  1RDB A;  1RTI A;  5AQM A;  2CH6 A;  5HRS A;  4O0J A;  4CJK A;  3OYF A;  2CGK A;  5BR9 A;  4Z4H A;  1S5J A;  4BGA A;  3EZ5 A;  1VQ9 N;  2F7T A;  1IBK K;  2E2O A;  2O8C B;  3I56 N;  1QZ6 A;  4F8R A;  4CEQ A;  4E3S A;  2KZZ A;  1SQK A;  2IVN A;  2XY6 A;  2HB5 A;  3BF3 A;  1L3T A;  3OYJ A;  1KRP A;  3OYI A;  4CZG A;  2DFF A;  2PAV A;  4N56 A;  2EHG A;  5M1Q A;  5EX5 A;  3CME N;  1BWF O;  1QQC A;  3BZC A;  5LJV A;  4DV3 K;  3WXI A;  5B8H A;  5DM7 L;  3OY9 A;  4FJX A;  5JVH L;  1QQN A;  4J8F A;  3KTQ A;  4XH4 A;  3VEW A;  4M41 A;  3MCA B;  3RR7 A;  1JLG A;  1P8Z A;  3BP8 A;  5SZT A;  3E9L A;  1RGI A;  3P4I A;  4OLB A;  4DQ8 A;  1ZXO A;  4JEP A;  4O8K A;  4IOA L;  4DR4 K;  2Q31 A;  1EXQ A;  5EOY A;  3PO5 A;  1JLA A;  4FJ9 A;  1JXE A;  1CLQ A;  3H45 C;  1L3S A;  5JLH A;  1NKE A;  3O5B A;  4FJM A;  1X1P A;  3CCQ N;  1JCE A;  1DGK N;  2FSK A;  2HOE A;  1XC9 A;  1VRT A;  2OZM A;  2D0B A;  1Z05 A;  3ZT1 A;  3KIO A;  1ATN A;  1NKC A;  3FE1 A;  2NRZ A;  3KD5 E;  2YHB A;  4BRH A;  4ICL A;  4FJ5 A;  1LWC A;  4G9Z A;  3SUQ A;  3ZET A;  3O9R A;  2BGG A;  1JLF A;  4CJQ A;  3DOL A;  4CCH A;  3DLE A;  3OHR A;  3O80 A;  3SPZ A;  4YOV A;  3EYZ A;  3SUN A;  4MLE A;  5IT9 O;  4CFC A;  4K0K K;  4IWV A;  4CHQ A;  3C6T A;  1NWK A;  4B1Z A;  4B1X B;  2YHX A;  4ISF A;  1I3A A;  4CJP A;  3PO4 A;  2ZE2 A;  4CJR A;  4H0T B;  4IBN A;  3UKR B;  4MLH A;  4GV3 A;  1YVU A;  5J2Q A;  1BA1 A;  4IG0 A;  2KW4 A;  4Y0W A;  1RT2 A;  4M3W A;  4BR9 A;  4KI4 A;  1KAX A;  3LAN A;  4H4M A;  2GUI A;  4OKJ A;  3BDP A;  4KTQ A;  4FLW A;  2HHU A;  4NB4 A;  4LFC K;  3J7A P;  1N34 K;  4FLU A;  1BDG A;  3VEV A;  5HRP A;  3PSI A;  3HZ6 A;  3CFP A;  1WN7 A;  4DV4 K;  3CCL N;  1W97 L;  1VQM N;  3ZSX A;  2QWP A;  4GMJ B;  3QES A;  1W7A A;  2KLA A;  1MDU B;  5LY3 A;  4LFA K;  4CIG A;  4EZ9 A;  3P1G A;  1K8A O;  4I6M B;  5F0X A;  4GY2 B;  2YHA A;  5LJW A;  3KLG A;  3PX0 A;  4FJ7 A;  4GKK K;  2NRT A;  3ENH A;  3SNN A;  3BY5 A;  4WQ5 A;  3EEQ A;  4BRE A;  3IFR A;  3QIO A;  4DU4 A;  1HPM A;  2EWS A;  2HHS A;  3U8X A;  1T6C A;  1TYQ B;  2CGL A;  1K8K A;  4KH6 A;  3QLH A;  4CEA A;  2P5G A;  5AQN A;  3AVB A;  4I2Q A;  5JVG L;  4JV5 K;  3HPO A;  2QWR A;  3JSM A;  3D6R A;  4DV5 K;  3ATV A;  3VQD A;  4DTJ A;  4BRK A;  4FLT A;  5FRM A;  3Q7B A;  4FJG A;  3QIC A;  4R5P A;  4IXC A;  4B1V A;  4E7L A;  2QTD A;  1RTD A;  2YJE A;  1NG9 A;  1RBT A;  5SWM A;  4F2S A;  4EP4 A;  1GLL O;  3T1H K;  3ALY A;  4DTS A;  2QA4 N;  3U6F A;  1VSE A;  3WEE B;  2UXB K;  4MO5 A;  4AIL C;  4CZJ A;  4DV1 K;  3I0R A;  3WXK A;  4V19 S;  5AZJ B;  1JCF A;  2A6A A;  3E01 A;  4OGC A;  1WB9 A;  5HRN A;  3SAH A;  1IBM K;  2F9T A;  1L5U A;  3NF7 A;  3ID8 A;  4F4K A;  1QHA A;  1XWL A;  4PL8 A;  2ZD1 A;  4ISE A;  2NNW A;  3TSP A;  5C10 A;  4F9O A;  5KTQ A;  1IO2 A;  4K8X A;  3PIO L;  1WUA A;  4TSX A;  1VSM A;  4BE2 A;  1BUP A;  4FJI A;  3AVI A;  2J4R A;  2KQ2 A;  3T7Z A;  2PY5 A;  1RT1 A;  4CF2 A;  2HBL A;  4FWO A;  1KAZ A;  1N8R O;  1X3N A;  4DSK A;  4AHC A;  1KSP A;  1BIU A;  1VRU A;  1C0F A;  1NBW A;  1BO5 O;  4C1N I;  4DUY K;  3GDQ A;  3AVK A;  2HBK A;  3CJB A;  2E2Q A;  1VSH A;  4IJN A;  3AY9 A;  3IKM A;  2KKZ A;  2YKN A;  3FGU A;  3CFR A;  3VMF B;  3NDK A;  1Y97 A;  1O1W A;  2ZGY A;  5CR4 A;  3QB0 A;  1NK6 A;  3WXJ A;  1CXQ A;  5EU7 A;  2PZS A;  1YHQ N;  4BR2 A;  3HVR A;  2OA8 A;  1S6P A;  4H8K A;  2P9I A;  3HP9 A;  3PV8 A;  3K57 A;  4DQS A;  2GTD A;  3L3V A;  4CZE A;  4DU1 A;  3S3N A;  3NF9 A;  4DSJ A;  3MK6 A;  3RMA A;  3DLK A;  2Q0U A;  3O9T A;  2XY5 A;  1TKD A;  1SV5 A;  4FWN A;  3LM9 A;  4O5F A;  3CQ8 A;  3TAM A;  2OTJ N;  2GV9 A;  4BRG A;  1TUU A;  2P51 A;  2V52 B;  1EKE A;  1Q81 O;  2HHW A;  3ZSV A;  4PWD A;  3V1R A;  4M42 A;  3P31 A;  2B6A A;  4NLC A;  4JI0 K;  4IFY A;  3ZEU A;  1TKT A;  4KBO A;  4FJH A;  3G10 A;  5TKY A;  4LF4 K;  3J7Z O;  1V4T A;  3BZK A;  4IJA A;  1QQO A;  1KTQ A;  3TR8 A;  3U9Z A;  4IO9 L;  5AQG A;  1XC3 A;  1VQ4 N;  5AFU A;  1OH7 A;  3RMD A;  3M6G A;  3WNF A;  2VG7 A;  1S1V A;  3THY A;  3ASM A;  3CC4 N;  1IG9 A;  4YOY A;  3C95 A;  4I9L A;  4LH5 A;  1FJG K;  4BDZ A;  2B4J A;  5J2M A;  3OS1 A;  5AZI A;  2X74 A;  3C7N B;  4KHS A;  4Z94 A;  3OYL A;  4U7B A;  3JXU A;  5K14 A;  1XI1 A;  1KFD A;  2E2N A;  4N5S A;  2WOM A;  3CCV N;  2W41 A;  2QWM A;  4M45 A;  2DPN A;  5C2D A;  5AQR A;  3ZT3 A;  4QCL A;  5I9E B;  1KD1 O;  1SL0 A;  1XMQ K;  1KFS A;  4CFB A;  4DB3 A;  3ZX2 A;  5AQV A;  1IKV A;  2G8F A;  1RCH A;  3QEV A;  4WFB L;  4CK3 A;  1SAZ A;  3ZCM A;  4DF4 A;  5BN8 A;  2OTL N;  2WFB A;  1Z6R A;  3WNH A;  1I94 K;  1H1V A;  3DAW A;  4QS9 A;  4H0Y B;  2XY8 A;  5BRD A;  4DSI A;  2P9L A;  1ATR A;  4H0P A;  3H3N O;  3LZI A;  3I0S A;  4MDB A;  3C6H A;  2YNH A;  4BGB A;  5KGW A;  4CES A;  4WF9 L;  3CHW A;  3U3Y A;  3FZM A;  1MU2 A;  1NK5 A;  1A5W A;  3AGR A;  4JD2 A;  1A5X A;  3OYN A;  4M3U A;  3LDP A;  4R79 A;  3TI0 A;  1U4B A;  4X66 K;  4LF9 K;  4DS4 A;  3EKU A;  2XY7 A;  4XH1 A;  1ASV A;  3DM2 A;  4BC5 A;  3NH1 A;  4E19 A;  4CZM A;  4BC4 A;  1WOQ A;  2OPQ A;  4AHT A;  1TGO A;  3O4W A;  1TK0 A;  2FF6 A;  3EY1 A;  1VQL N;  2RKI A;  5JIC A;  4Z4E A;  1SL2 A;  3LDN A;  2GEL A;  3L2V A;  3K0S A;  3IUC A;  4BVP A;  1RBU A;  3KJV A;  1SZ2 A;  4DF8 A;  4FWQ A;  1QZ5 A;  4JRP A;  3M5R A;  5AQW A;  3GOI A;  2AJQ A;  1OVY A;  3HST B;  3HVT A;  5J2N A;  5TKW A;  2G8W A;  3O1W A;  4AQY K;  4CER A;  4EFH A;  1OH8 A;  4BE1 A;  2AA4 A;  4OPA A;  4ID5 A;  3SQ2 A;  3QNO A;  1TK5 A;  1YF5 L;  4OGE A;  3BUZ B;  4IZ9 A;  4BWJ A;  1X9S A;  4FPA A;  3M8Q A;  4JS4 A;  4AH9 A;  4DSF A;  1NGD A;  3ENO A;  3NVM A;  4AHR A;  3HXM A;  1NJX A;  3LDL A;  3SMP A;  1RNH A;  4WFA L;  4K8Z A;  2HF3 A;  3CCR N;  1K9M O;  3TAF A;  5CYM A;  3QER A;  3DXK B;  4JI7 K;  1N36 K;  1QVF M;  3MN6 A;  4FWS A;  4U67 L;  3DRP A;  4BRF A;  4NXN K;  1UA1 A;  3VQC A;  3C0B A;  3W3D A;  3EL2 A;  3MN7 A;  5CY4 A;  4A62 A;  1T6D A;  4B9L A;  3CF5 L;  4DMN A;  2VGM A;  3FZH A;  1CZ9 A;  3IG1 A;  4DLG A;  1CZB A;  3M8R A;  2W42 A;  2NLX A;  3P38 A;  5C25 A;  4KHN A;  4C8K A;  3H08 A;  3DOK A;  3B6O A;  4CK2 A;  2DTU A;  3OBW A;  3J7Y P;  2FBY A;  4CJ3 A;  1ZBU A;  2A42 A;  2FBX A;  2P9U B;  1NK8 A;  1KQS M;  1B9D A;  3CC2 N;  1VSF A;  3G71 N;  4CHZ A;  3B8A X;  3GG4 A;  4M3X A;  4FM1 A;  3DYA A;  4M7Y A;  4FJL A;  3KLI A;  4H5T A;  3CI5 A;  4CZF A;  1TKX A;  2JWL A;  4KV8 A;  4CGJ A;  4JHD A;  3L2W A;  1IH7 A;  1U2V B;  5FPD A;  2RE2 A;  4CZH A;  3MCP A;  4NYN A;  4B9N A;  4HTU A;  2VYP A;  3CCJ N;  1BIZ A;  3P5J A;  3F2K A;  1VK0 A;  4RTF D;  1E4F T;  4KO0 A;  2BDP A;  2QXL A;  4M63 C;  3V9U A;  2O8D B;  1IG8 A;  4WQ4 A;  1R0A A;  3F9K A;  3V6D A;  4Z4C A;  2NRX A;  2CGJ A;  5FPE A;  3KHY A;  1XUP O;  1WSJ A;  3D7E O;  1YIJ N;  5HRR A;  2BUP A;  1RDW X;  2P9P A;  1ASW A;  1RDC A;  2ETJ A;  3L4I A;  3PIP L;  3O9U A;  3V81 A;  5M1F A;  1OH5 A;  3NF6 A;  2XRI A;  4CZI A;  1NGE A;  4FOE A;  3TU5 A;  2OPS A;  3DJC A;  4FVU A;  4F2R A;  1VQK N;  4Q5V A;  3PLA A;  3MN5 A;  1SUQ A;  3KKS A;  2E88 A;  2YCH A;  4DFJ A;  4JI3 K;  3O08 A;  1HNV A;  4H0X B;  5KGX A;  2P9S B;  1NGI A;  3O3G A;  4ILH A;  5AJ3 K;  5AQL A;  2HHH K;  1RIL A;  3H3O B;  3VQ6 A;  3WUH A;  2OZS A;  2R7Y A;  1Z26 A;  2RF2 A;  1FKP A;  3TAG A;  4ZTJ A;  1UAX A;  3V1O A;  4H0V B;  4O44 A;  2KFZ A;  4BRA A;  5BRE A;  1NK0 A;  2YHW A;  5ELZ A;  4YNQ A;  1A5V A;  4Z4I A;  1MA9 B;  4JKG A;  3HT3 A;  4CZL A;  4B08 A;  5LMU K;  4KHW A;  5C42 A;  2O8F A;  3CM5 A;  4FK2 A;  4E89 A;  5KRT A;  2HW3 A;  4FLV A;  4BQZ A;  4A5A A;  2E2P A;  3OA9 A;  3I55 N;  4DR7 K;  3AO5 A;  4OKK A;  1I39 A;  4NYF A;  2ZJR L;  3HRG A;  1BCM A;  1XHZ A;  4BRM A;  2P9K B;  2ZGZ A;  3HM8 A;  4FZZ A;  4YOR A;  3UKR A;  2Q36 A;  3DWL A;  3D2F A;  3THW A;  4H5N A;  2QWL A;  3TAE A;  5FLX O;  5AQH A;  3MEC A;  2QKB A;  4Y1C A;  4KB0 A;  4JKE A;  4DTO A;  4ELV A;  3TTF A; 
#chains in the Genus database with same CATH homology
 1BI4 B;  1TVR A;  1XWL A;  3CFO A;  3KKR A;  4Z4G A;  1L3V A;  4CHN A;  2ZD1 A;  1TAQ A;  4DG1 A;  3KK3 A;  3KLH A;  3KLE A;  3AO2 A;  4FXD A;  3NCI A;  1SL1 A;  4Q0B A;  4FVM A;  5KTQ A;  1IO2 A;  1KVA A;  4K8X A;  1RDD A;  4E7H A;  4DSE A;  5JS1 A;  3QEI A;  2DFE A;  4TSX A;  1EET A;  2OPP A;  1VSM A;  4BE2 A;  3VQ9 A;  4BAC A;  1FK9 A;  4FJI A;  1UOC A;  3AVI A;  2KQ2 A;  1S1X A;  3ZSO A;  3QEP A;  2PY5 A;  1RT1 A;  1J54 A;  4CF2 A;  4FZY A;  2HHT A;  2YV0 X;  3DMJ A;  2LSN A;  4JLH A;  3TAQ A;  3NHG A;  5JS2 A;  5C24 A;  2FBT A;  4LD0 A;  4RW7 A;  4FW1 A;  4CE9 A;  3NGZ A;  4RW4 A;  5DK5 A;  1C1C A;  4DTR A;  3A2F A;  4AHC A;  3VQE A;  3VA3 A;  3SUP A;  1KSP A;  4DSK A;  1BIU A;  4ELT A;  2ITG A;  3LP1 A;  5FRO A;  1RTJ A;  1HYZ A;  1VRU A;  1JL2 A;  2VG5 A;  4DTP A;  4GW6 A;  3SJJ A;  4C8O A;  2HVH A;  1NJZ A;  3SQ0 A;  3K59 A;  2Q3S A;  3QIP A;  3C6U A;  1RBS A;  1QSY A;  3AVK A;  1LWE A;  2NUB A;  2QK9 A;  2YKM A;  1GOA A;  3ITH A;  1VSH A;  1XHX A;  3IS9 A;  4DTN A;  3AVL A;  4NCG A;  4B3O A;  2DY4 A;  4FW2 A;  4CF8 A;  3NE6 A;  4ZHR A;  2YKN A;  1TV6 A;  3CFR A;  4I7F A;  1WSI A;  4W5O A;  1BIS A;  3SV4 A;  4DTX A;  3LZJ A;  3NDK A;  3SCX A;  3ZT0 A;  2RN2 A;  3MXJ A;  3VQA A;  2VG6 A;  1Y97 A;  1O1W A;  3L2U A;  3CYM A;  3TAB A;  5I3U A;  1T03 A;  1NJW A;  4L8R B;  1VSD A;  3QNN A;  1NK6 A;  4DQI A;  1CXQ A;  3AA2 A;  5EU7 A;  1JLC A;  1HJR A;  1RTH A;  1WAF A;  4DTM A;  2PZS A;  2Z1H A;  1K6Y A;  4IFV A;  4W5Q A;  3HP6 A;  3VA0 A;  2G8I A;  3HVR A;  4CF9 A;  1NK4 A;  1ZBH A;  2IOC A;  1C1B A;  3LDS A;  2OA8 A;  1S6P A;  2FC0 A;  1S9G A;  4H8K A;  4C8M A;  3HP9 A;  3ZT4 A;  4YFU A;  3K57 A;  3PV8 A;  5HP1 A;  4OJR A;  3L3V A;  4DQS A;  4KRF A;  4DU1 A;  3SQ1 A;  4CHO A;  3S3N A;  3NF9 A;  3DLR A;  3SYZ A;  4DSJ A;  1QSS A;  4M3R A;  2X6S A;  2G8H A;  1TKZ A;  3RMA A;  3DLK A;  2XY5 A;  1TKD A;  2B5J A;  3HL8 A;  2G8V A;  4PA1 A;  1SV5 A;  4CJE A;  5CZ2 A;  2X78 A;  4CHY A;  4CEB A;  4BWM A;  4KTZ A;  3CQ8 A;  3TAM A;  2PYJ A;  1JKH A;  2GV9 A;  4DQR A;  2P51 A;  1EKE A;  4AHU A;  3KD1 E;  1GOC A;  4ID1 A;  2HHW A;  4J2D A;  3ZSV A;  4PWD A;  3V1R A;  4G1Q A;  4M42 A;  4C8L A;  5DMR A;  2B6A A;  3AVG A;  4HHT A;  4IFY A;  1TKT A;  4N76 A;  1IKX A;  1BQM A;  1U04 A;  4FJH A;  3AVJ A;  2A1R A;  3OS2 A;  3U3G A;  3G10 A;  3KK1 A;  3S3O A;  2KTQ A;  1LWF A;  3DLG A;  1NK7 A;  1HYV A;  3QIN A;  4CEF A;  3KLF A;  4LSL A;  1IKY A;  1HNI A;  3G0Z A;  4E7I A;  3P83 D;  4HCC A;  3AVN A;  3ZT2 A;  1KTQ A;  3TR8 A;  1RDA A;  1ASU A;  1JLQ A;  4B8C A;  3TWH A;  3LWM A;  3RMD A;  3PX6 A;  3THV A;  3WNF A;  1Q8I A;  2VG7 A;  2WON A;  1S1V A;  3ASM A;  4E1N A;  1D9F A;  1TL1 A;  1IG9 A;  2HND A;  4QOZ B;  3C95 A;  4I9L A;  4LH5 A;  3LWL A;  3D45 A;  4Z4F A;  1QSL A;  3L2R A;  4FLY A;  4CIF A;  4BDZ A;  2B4J A;  3NGY A;  1JXB A;  5J2M A;  4N47 A;  3OS1 A;  4M3Z A;  2A1S A;  4M3T A;  2X74 A;  4CJV A;  4KHS A;  1NOZ A;  2YNF A;  2KZM A;  1HQU A;  1HMV A;  2YNG A;  4H4O A;  3NH2 A;  3OYL A;  1VSL A;  1NKB A;  5K14 A;  1XI1 A;  3HJF A;  1KFD A;  5CZ1 A;  4N5S A;  2WOM A;  1T8E A;  1RT5 A;  1CXU A;  4M45 A;  3SI6 A;  5CYQ A;  3V9W A;  4W5R A;  3ZT3 A;  3ZSZ A;  4M3Y A;  3LP2 A;  3LAL A;  3OYM A;  5I42 A;  3MED A;  4QCL A;  2KFN A;  4KHQ A;  1EX4 A;  4RG8 A;  1RT3 A;  3CG7 A;  4KB1 A;  2Y1I A;  5HLF A;  1SL0 A;  4E1M A;  1KFS A;  4CF0 A;  1BQN A;  3VQB A;  3CM6 A;  1QHT A;  4C8N A;  2IC3 A;  4CJ4 A;  3DRS A;  4CFB A;  5HRO A;  1W9H A;  4Y1D A;  1S1U A;  4DS5 A;  2O4I A;  1IKV A;  4IG3 A;  2G8F A;  2PYL A;  4KI6 A;  1RCH A;  3QEV A;  3VQ7 A;  4HCB A;  4NCB A;  3RMC A;  4CK3 A;  1B92 A;  3ZSR A;  1S1W A;  4CFA A;  1UA0 A;  1RT4 A;  3T19 A;  3ZCM A;  3O3F A;  3RRH A;  4DFP A;  4DF4 A;  1N5Y A;  1QS4 A;  3OJU A;  1REV A;  3WNH A;  3AA4 A;  4J2E A;  5HBM A;  3M8S A;  3K5O A;  2XY8 A;  1VSI A;  1NOY A;  4W5N A;  4NCA A;  4DSI A;  2HHV A;  4CF1 A;  4O55 A;  4CJU A;  3AVF A;  3K5M A;  1BCO A;  4B9S A;  4PUO A;  1ZYQ A;  3LZI A;  3S9H A;  3I0S A;  1WSH A;  2YNH A;  5KGW A;  2D0C A;  3NBP A;  4CIE A;  4CES A;  2D5R A;  1B9F A;  3L3U A;  1WSG A;  2Z1J A;  3WNG A;  3JYT A;  3U3Y A;  1MU2 A;  4CGD A;  4IDK A;  1NK5 A;  1A5W A;  1WSF A;  1A5X A;  3OYN A;  4M3U A;  1D8Y A;  2F8S A;  1BL3 A;  3VQ5 A;  5KRS A;  4FM0 A;  4FJ8 A;  5T7B A;  3TI0 A;  3QET A;  3UIQ A;  3OJS A;  1WLJ A;  3V9Z A;  1U4B A;  3O4N A;  3MXI A;  3ZSW A;  1J9A A;  4DS4 A;  2XY7 A;  4Z0U A;  4CJF A;  2YNI A;  1ASV A;  3VQP A;  3DM2 A;  3AO4 A;  3NH1 A;  4E19 A;  3HM9 A;  3RR8 A;  3WNE A;  1JL1 A;  4LY7 A;  1TK8 A;  4ZTF A;  4B9M A;  2OPQ A;  4AHT A;  4CJW A;  4OPK A;  1TAU A;  1TGO A;  2DFH A;  3RMB A;  3DRR A;  1TK0 A;  1S6Q A;  1D5A A;  3PX4 A;  4E7K A;  1U48 A;  3NGI A;  3EY1 A;  1YTA A;  2RKI A;  2O4G A;  1ITG A;  1LAV A;  2BE2 A;  2HNY A;  3V1Q A;  3OYG A;  3L8B A;  4LSN A;  1SL2 A;  3TAP A;  1SKS A;  3DLB A;  1RDB A;  1RTI A;  4DSL A;  4I9Q A;  3L2V A;  5FDL A;  4CGH A;  5HRS A;  3DLH A;  1RBU A;  3KJV A;  4O0J A;  4CJK A;  4DF8 A;  1RT6 A;  3OYF A;  3NAE A;  4JRP A;  4Z4H A;  1S5J A;  3EZ5 A;  4XIU A;  4FYD A;  4F8R A;  4CEQ A;  4E3S A;  1YTU A;  4CFD A;  2KZZ A;  4KPY A;  2XY6 A;  4FK0 A;  2HB5 A;  3LAK A;  2RPI A;  2AJQ A;  1HRH A;  1L3T A;  1BHL A;  3HST B;  3HVT A;  5J2N A;  2GBZ A;  2G8W A;  3OYJ A;  4UQG A;  1RBR A;  1KRP A;  3PY8 A;  3OYC A;  3HO1 A;  3OYI A;  4OLA A;  2DFF A;  4FCY A;  4CER A;  4N56 A;  2EHG A;  4F3T A;  3T1A A;  4BE1 A;  1QQC A;  4ID5 A;  3QO9 A;  1Z25 A;  3QNO A;  3SQ2 A;  1TK5 A;  1C1A A;  2ATQ A;  3MXM A;  4OGE A;  1KLM A;  1RBV A;  3AVA A;  4BWJ A;  3OY9 A;  1X9S A;  4FJX A;  3KTQ A;  1U47 A;  3M8Q A;  4JS4 A;  4AH9 A;  4DSF A;  3OYA A;  4KAZ A;  3K5N A;  1TL3 A;  4M41 A;  3QEX A;  4B9U A;  3HXM A;  4AHR A;  4AHS A;  1NJX A;  3RR7 A;  1JLG A;  5D3G A;  1RNH A;  3IRX A;  3LP3 A;  1DTQ A;  3MEE A;  4W5T A;  4K8Z A;  3VQ8 A;  3TAF A;  1HQE A;  3HPH A;  5CYM A;  1S1T A;  5SZT A;  3QER A;  4E0D A;  1BI4 A;  4OLB A;  3ISN C;  4E7J A;  4JRQ A;  3VN5 A;  1L3U A;  4CEO A;  3DRP A;  2VWJ A;  1F21 A;  1UA1 A;  2XHB A;  4EZ6 A;  1EXQ A;  3VQC A;  4B9T A;  3RTV A;  4F4K A;  3PO5 A;  1JLA A;  2E4L A;  4FJ9 A;  1JXE A;  4F3O A;  4CEE A;  5CY4 A;  1CLQ A;  4B9L A;  4LH4 A;  1L3S A;  4O4G A;  2JLE A;  4DMN A;  2JGU A;  4FK4 A;  4WE1 A;  3AO3 A;  4FLZ A;  1DTT A;  1X9W A;  1NKE A;  1CZ9 A;  3IG1 A;  4DLG A;  3V4I A;  3RWU A;  4FJM A;  3OS0 A;  1CZB A;  1X1P A;  4DLE A;  3M8R A;  3TAR A;  3OYE A;  1U45 A;  3PUF A;  2W42 A;  5C25 A;  1XC9 A;  4OKE A;  1VRT A;  3I8D A;  2OZM A;  4KHN A;  3NFA A;  2D0B A;  4C8K A;  3H08 A;  3DOK A;  3ZT1 A;  3B6O A;  2Z1G A;  1KVB A;  3KIO A;  4CK2 A;  3F73 A;  3L2Q A;  2DTU A;  4KTW A;  1NKC A;  3LP0 A;  1D9D A;  2FBY A;  3FFI A;  3AA3 A;  3KD5 E;  4CJ3 A;  1ZBU A;  3HK2 A;  2FBX A;  4FJN A;  3MAQ A;  1NK8 A;  5FRN A;  1B9D A;  2YHB A;  1VSF A;  3M8P A;  4PQU A;  2BAN A;  2ZQB A;  4CJS A;  4CHZ A;  4ICL A;  1JLB A;  1G15 A;  3QEW A;  4FJ5 A;  2FBV A;  1LWC A;  3SUQ A;  1SKR A;  4M3X A;  3T3F A;  1WSE A;  4RW8 A;  4FM1 A;  3DYA A;  4FJL A;  2BGG A;  1JLF A;  3KLI A;  4RW9 A;  3VQ4 A;  1KCF A;  3DOL A;  4CJQ A;  1ZBL A;  3K5L A;  3DLE A;  4CCH A;  4DQP A;  1IKW A;  1TKX A;  4KV8 A;  1FXX A;  3RRG A;  2I5J A;  4CGJ A;  1EP4 A;  3SPZ A;  3EYZ A;  3L2W A;  1IH7 A;  3SUN A;  4OVL A;  4J2B A;  2F8T A;  4PY5 A;  4CED A;  4CFC A;  4CHQ A;  3C6T A;  4BE0 A;  1J5O A;  1JLE A;  3V9S A;  1RT7 A;  4NYN A;  4B8A B;  4HTU A;  2D0A A;  2F96 A;  2IS3 A;  3AVM A;  4B9N A;  3HYF A;  3DI6 A;  2HNZ A;  1BIZ A;  1I3A A;  3P5J A;  1VK0 A;  4CJP A;  3PO4 A;  4HUG A;  4J2A A;  2ZE2 A;  4CJR A;  4KHY A;  4IBN A;  5E41 A;  4KO0 A;  1LAW A;  4KKO A;  1YVU A;  5J2Q A;  2BDP A;  2E6L A;  4FJJ A;  4IG0 A;  1FKO A;  2KW4 A;  1RT2 A;  4M3W A;  4CEZ A;  2XO7 A;  3V9U A;  4KI4 A;  4RW6 A;  3LAN A;  4H4M A;  2GUI A;  4OKJ A;  4CHP A;  3F9K A;  1WNS A;  1R0A A;  4FLW A;  3BDP A;  4KTQ A;  2HHU A;  3V6D A;  4Z4C A;  4HUE A;  1ZBI A;  3NH0 A;  1QTM A;  4DTU A;  1BGX T;  1N6Q A;  4AHV A;  1WSJ A;  2P1J A;  3MEG A;  3D0P A;  4IKF A;  5HRR A;  2G8K A;  4CEC A;  4FLU A;  2HHQ A;  1ASW A;  3OYD A;  1RDC A;  2ETJ A;  4HVJ A;  4FZX C;  5HRP A;  4KHU A;  1J53 A;  1S9E A;  3CFP A;  1LV5 A;  3V81 A;  1QE1 A;  1WN7 A;  4DFM A;  3B6P A;  3LPT A;  1DLO A;  3NF6 A;  3ZSX A;  2XRI A;  3OYB A;  4GMJ B;  3OYH A;  3QES A;  3OYK A;  2OPS A;  3LAM A;  3VQQ A;  4ELU A;  4F2R A;  4CJ5 A;  4CIG A;  4Q5V A;  3P1G A;  4EZ9 A;  3AV9 A;  1SUQ A;  4CGG A;  4CGF A;  3KKS A;  3SQ4 A;  2YHA A;  4DFJ A;  4O0I A;  1LW2 A;  3AA5 X;  3OVN A;  3KLG A;  3PX0 A;  4DFK A;  4FJ7 A;  4QAG A;  1HNV A;  5KGX A;  3SNN A;  4MQ3 A;  2G8U A;  4MFB A;  3ZSQ A;  2HMI A;  4B9V A;  1C0U A;  3O3G A;  1GOB A;  1HPZ A;  3QIO A;  4DU4 A;  2HHS A;  4N41 A;  4JS5 A;  2EX3 A;  2Z1I A;  1X9M A;  2HVI A;  4O5B A;  2QXF A;  4I2P A;  4CJT A;  1RIL A;  3VQ6 A;  3TAN A;  1KVC A;  2VWK A;  3QLH A;  3BGR A;  4CEA A;  5J1E A;  2P5G A;  2QKK A;  2OZS A;  3AVB A;  4I2Q A;  2R7Y A;  3HPG A;  1Z26 A;  4KFB A;  1HYS A;  2RF2 A;  3HPO A;  1VSJ A;  1FKP A;  3TAG A;  4ZTJ A;  1UAX A;  2IAJ A;  3V1O A;  4O44 A;  2KFZ A;  3JSM A;  1NK0 A;  3V9X A;  3K2P A;  1ZBF A;  2X6N A;  3VQD A;  1UWB A;  4YNQ A;  1A5V A;  4DTJ A;  4BDP A;  4Z4I A;  1Q9Y A;  2Y1J A;  4FLT A;  4CK1 A;  1KLN A;  3HT3 A;  5FRM A;  3O4Q A;  4B08 A;  4FJG A;  4R5P A;  1W0H A;  3AVC A;  3LPU A;  4FJK A;  3SUO A;  4EP5 A;  4KHW A;  2OPR A;  5C42 A;  3KK2 A;  1T05 A;  4BDY A;  1SKW A;  2HHX A;  4E7L A;  3SPY A;  3CM5 A;  1RTD A;  4FK2 A;  4CJL A;  4E89 A;  5KRT A;  1C6V A;  1NK9 A;  2HW3 A;  4FLV A;  1NJY A;  4DQQ A;  1RBT A;  5SWM A;  4F2S A;  4EP4 A;  1T7P A;  1C0M A;  3ALY A;  3O3H A;  4DU3 A;  1C0T A;  2IDO A;  1U49 A;  4DTS A;  5KI6 A;  4HUF A;  3ULD A;  3U6F A;  1YT3 A;  3AO5 A;  4OKK A;  1I39 A;  4NYF A;  1VSE A;  5J2P A;  1XHZ A;  1BCM A;  2E6M A;  3AVH A;  3C94 A;  3NF8 A;  3SV3 A;  4FZZ A;  4GVM A;  4AIL C;  4FM2 A;  1Q9X A;  4FLX A;  3IAY A;  4CGI A;  4OPJ A;  2IGI A;  3I0R A;  4Z4E A;  3SZ2 A;  3AO1 A;  3TAE A;  4OGC A;  3E01 A;  3MEC A;  1LW0 A;  2OYQ A;  4KRE A;  2QKB A;  2P5O A;  3K58 A;  4Y1C A;  3ZSY A;  4DWI A;  5HRN A;  1WAJ A;  4KB0 A;  1VSK A;  1L5U A;  3NF7 A;  3S3M A;  4DTO A;  4ELV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...