5HRSA

Hiv integrase catalytic domain containing f185k + a124n + t125a mutations complexed with gsk0002
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
139
Chain Sequence
b'CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSNAVKAACWWAGIKQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhibitor
total genus 51
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrsA00
1UWBA 1KVBA 1RNHA 4OVLA 4JS4A 4O44A 3CQ8A 4CHYA 3ULDA 4DLGA 2YNGA 3SZ2A 2FBVA 5FRNA 1IKYA 1N5YA 2RN2A 4OLAA 1RCHA 3NHGA 4DTNA 4TSXA 1EXQA 4E1NA 4DTOA 3MXIA 3M8QA 4F2SA 1BHLA 4M3ZA 5J2MA 5FDLA 2G8FA 3WNEA 3PX6A 4F3OA 4F3TA 5J2PA 1C0UA 4YFUA 3O4NA 1XI1A 3TAQA 3AVAA 4I2PA 3V4IA 2HHVA 3OYMA 4YNQA 1U48A 1G15A 3M8RA 2HHUA 3CM5A 1BL3A 1BQMA 4HUFA 4CJUA 3QESA 1LW2A 1S1VA 1R0AA 1NK7A 1RDBA 4HUGA 2B6AA 4BWMA 4KB0A 3S3MA 1GOCA 4ID1A 5SWMA 3ZT3A 3DYAA 4NCAA 1VSDA 1NK8A 1N6QA 1NKBA 1WSGA 2I5JA 3SUNA 4CFBA 4CGIA 4CERA 4FK4A 3I0SA 4G1QA 1TL3A 3ZT2A 1CXUA 4DU3A 2XY7A 2OZSA 4FJ8A 3DI6A 4FM2A 4DU1A 1ZBHA 1RTIA 4IG0A 4CK2A 1NK4A 4AHRA 5CZ1A 2Y1IA 3V9ZA 1JLCA 5HBMA 4CEOA 4ELTA 4WE1A 4CF2A 1NOZA 4KI4A 5EU7A 3OYNA 3I8DA 1WSJA 3DLKA 3T19A 1Z26A 4GVMA 3KIOA 4CJ4A 1LWCA 4B9NA 3QEWA 1VSLA 3CFRA 4CEDA 4E7IA 4KKOA 3ZSRA 1RTDA 3HT3A 1YT3A 4CIGA 1S1WA 1KVCA 4LSNA 5KGWA 3DRPA 3LDSA 3AA4A 4J2DA 4KHWA 4RW6A 2IGIA 4Q5VA 2FBTA 4DQRA 1EETA 4BDYA 1RTJA 5T7BA 1DTTA 1RBTA 1WAJA 3DLRA 3K5OA 3KLGA 2G8KA 4DSKA 4KPYA 2DFHA 4BE2A 4FK2A 1XWLA 1ASWA 4CHPA 3NF6A 3KK2A 4Z4EA 4CGHA 4DTRA 2HVIA 1ZYQA 3HM9A 4DTJA 1CXQA 1RBSA 4IDKA 1IKWA 2F8TA 1HNVA 4W5RA 4FW1A 2YKNA 3QEPA 2F8SA 4CF0A 3HK2A 2DTUA 3IRXA 2IOCA 3VQDA 4OKKA 3VN5A 4Z4IA 3TAMA 3SI6A 4B9VA 1TKZA 1SKRA 4HCBA 5CZ2A 2O4IA 4LD0A 1IG9A 5FRMA 3D0PA 3TAFA 4FK0A 1J53A 2BE2A 1L3TA 1NOYA 3HJFA 3AA3A 4CJRA 1L3UA 1NK5A 3RMCA 4DQIA 4KHQA 2KFZA 4CIEA 3NBPA 1C0MA 1KTQA 3AVLA 5SZTA 1YVUA 3OYAA 2KFNA 1K6YA 2OZMA 1FKPA 3OYGA 1T7PA 3OS2A 4BDZA 4PQUA 2KQ2A 3L8BA 2ZD1A 1SL0A 4PWDA 4B9TA 2FC0A 3L2WA 4Q0BA 4K8XA 4CEEA 4KTQA 3HXMA 3VQ9A 4HVJA 2P5GA 4JRPA 2OPRA 3S3NA 1NK6A 3IAYA 4KTZA 4OJRA 2OPPA 4FJ5A 1S6PA 1VRUA 2EX3A 4DTXA 3MEEA 2XY8A 2KZMA 4C8LA 5HRNA 4M41A 4CJSA 2HNZA 3LP3A 2XHBA 2HMIA 2XRIA 3AVCA 3K2PA 4R5PA 1EKEA 2B5JA 1D9DA 1KSPA 3DLBA 4FJHA 3AVHA 4KHYA 2B4JA 4W5NA 3TAEA 4CEQA 1NK9A 2R7YA 4CESA 4DSLA 3K5LA 4C8KA 1TK8A 4OLBA 1D9FA 3K57A 3HSTB 2D0BA 4CJ3A 4FCYA 3KD1E 2A1RA 1RT7A 3KK3A 3T1AA 1HYZA 1Q9YA 3UIQA 1RDDA 3SPYA 3A2FA 1RBRA 1TAQA 3C95A 4B08A 3JSMA 3AVFA 4Y1DA 1YTUA 1NJYA 1L3VA 4KB1A 3AA5X 1CZBA 3QERA 4AHVA 3LP2A 3NGZA 3SV3A 1C1BA 3K59A 3VA0A 1QTMA 4CJEA 3K5NA 1QE1A 2HW3A 3WNHA 4RW8A 4DSIA 4FJXA 3QIPA 3AV9A 3DLGA 1VSKA 4DTUA 2FBYA 1UA0A 3LPUA 1B9DA 4F2RA 3TARA 3LAKA 3OVNA 4N47A 1ASUA 3HPHA 3OYKA 4QOZB 1NKEA 1HYSA 2Q3SA 4PY5A 1FK9A 3THVA 3WNGA 1UA1A 2PYLA 3AVJA 4KFBA 3SUOA 4IFYA 3ZSWA 4DQPA 3KJVA 2IC3A 5DMRA 2G8HA 1RBUA 4FZZA 5HROA 3KD5E 3KTQA 4CJWA 4E7JA 2F96A 3C6TA 2WOMA 2P51A 1Q9XA 4M42A 3L3VA 3SYZA 4IG3A 1JKHA 3AO4A 5HRRA 5KTQA 4DG1A 3NFAA 4B8CA 3MXMA 1IH7A 1L3SA 3V1RA 3ZSZA 4AHSA 1SUQA 4CF9A 2RPIA 3AVNA 4ELUA 1BIUA 4CGDA 4Z0UA 1RDAA 4CJTA 4CJVA 1NK0A 1ZBLA 4FYDA 3HP9A 4M45A 4E7HA 3OS0A 3QEVA 4QCLA 4CEBA 4FZYA 1TKXA 1GOAA 3F73A 3HYFA 1LAWA 3SQ4A 1ZBUA 1JLQA 2JLEA 4KHUA 2YHBA 3KKSA 4E0DA 2HHSA 1QS4A 2NUBA 4OKJA 1NJZA 1KLNA 1MU2A 4ICLA 1S6QA 4DTPA 1SV5A 3FFIA 4J2EA 3IG1A 3NF7A 3VQQA 2YNFA 3LAMA 3HVRA 3PX4A 1X9SA 3AO5A 2E6MA 3DLEA 2EHGA 4KI6A 2DFFA 4FM0A 4B9SA 1NJWA 3OYLA 2OPQA 1S1XA 3QETA 1QQCA 5JS1A 1TGOA 3MAQA 4M3UA 5JS2A 4EP5A 3V9UA 2AJQA 3ZSVA 3PV8A 5J2NA 1C0TA 3QEXA 3AVIA 3SV4A 1BI4A 1WNSA 1YTAA 5KI6A 3ZT4A 1VSFA 3LWMA 3AVGA 4E19A 1TK5A 3P1GA 2IS3A 1KRPA 5CYQA 3VQ7A 3D45A 4LH4A 3RMAA 4FJNA 2YNIA 4RW4A 2Z1GA 4CF8A 4FJ7A 2Z1HA 5E41A 3OJSA 1ZBIA 3RRHA 2WONA 3VQ4A 4DF4A 1JXBA 3IS9A 5FROA 5CY4A 3QINA 1CLQA 1KLMA 2QK9A 3AVBA 4FZXC 1X9WA 4HHTA 4EZ6A 4KREA 3DRSA 1S1UA 4DSEA 4DS5A 3S3OA 4IBNA 3ZT1A 2Z1JA 4CEFA 3HPOA 3RTVA 4FJ9A 4CEZA 3SUPA 1U49A 3L2QA 2GBZA 4FLTA 2PYJA 1X9MA 4FJJA 1WSHA 3ASMA 3V9SA 4FJLA 4DSFA 3AA2A 3AO3A 1TKDA 3O3GA 4Z4FA 4RW9A 1S9GA 4HUEA 1S9EA 4CIFA 1JLFA 3CFOA 1REVA 4CJLA 5J1EA 1WN7A 1NKCA 2VG5A 4OPJA 1B9FA 4I7FA 4BACA 2BDPA 1X1PA 2BANA 2JGUA 4CJPA 3OYBA 2GV9A 2XY5A 4B9UA 3TANA 3TR8A 4JLHA 2P5OA 4M3YA 2O4GA 2Y1JA 3QO9A 1HNIA 4O55A 3SCXA 3LP0A 4DQQA 3F9KA 4FW2A 5C42A 4ZHRA 1RT5A 4NCGA 3RMDA 4B8AB 1HQEA 1WAFA 4CHNA 1QSYA 1I39A 4N5SA 4BE0A 4PUOA 3V9XA 4CFAA 1WSIA 4I2QA 4B3OA 4FXDA 1U4BA 2G8IA 2BGGA 5CYMA 2HNYA 4CCHA 2E4LA 4B9LA 3NGYA 4M3WA 3LALA 2DY4A 1KFSA 1W0HA 3OYIA 1EP4A 4DMNA 3TI0A 4HCCA 1RTHA 4FM1A 2HHQA 3LP1A 3MXJA 4KV8A 5HP1A 2YV0X 3HP6A 1U04A 2E6LA 3ZSYA 4AH9A 4FLYA 2VG6A 4KO0A 4UQGA 3VQAA 3KLEA 2OPSA 4BE1A 1C1AA 1JL1A 1RT4A 2G8VA 4DSJA 2ZQBA 2HB5A 1LV5A 1TAUA 3V1QA 4CJKA 4OPKA 2G8UA 3NE6A 4CHOA 4FLWA 3NDKA 2HHTA 3HPGA 4M3RA 3ZSOA 3PX0A 3CM6A 3SQ0A 1WLJA 4Z4GA 1JLAA 5D3GA 1RDCA 3U3YA 3B6OA 1QSSA 3OYJA 5I42A 3O3HA 2PY5A 4M3XA 2KW4A 3C94A 3VQCA 4KHNA 3P83D 3PUFA 3NH2A 3KLFA 1IKXA 4GW6A 4E7LA 3DM2A 5I3UA 1U47A 4OGEA 4Z4CA 4W5QA 4KRFA 2VWJA 4CFCA 4CHZA 4QAGA 4N76A 2GUIA 4W5OA 4E3SA 3AO1A 4IFVA 3PO5A 3RR7A 3EY1A 4CF1A 4DFJA 4DFPA 2ETJA 3NH1A 4LH5A 3DOLA 1RT3A 4CGFA 3VA3A 4FVMA 5HRPA 4KTWA 4O0JA 2VG7A 3V6DA 3O3FA 3H08A 4H4MA 2OA8A 3M8PA 1O1WA 3NH0A 1SL2A 3RWUA 1A5WA 1J5OA 1JLBA 4JS5A 4J2AA 4BDPA 3QLHA 2KTQA 1XC9A 4MFBA 4HTUA 4NYNA 5K14A 3MEDA 3BDPA 2YHAA 3AVMA 3SPZA 1J9AA 4ID5A 1JLEA 4I9LA 1WSEA 1D5AA 5KGXA 3LWLA 1SL1A 3SNNA 1J54A 4ZTFA 4F8RA 3B6PA 4O4GA 4IKFA 3WNFA 4RG8A 1GOBA 1VSMA 1JL2A 1CZ9A 2D0CA 2QXFA 2D0AA 3ITHA 4CE9A 4DQSA 4GMJB 3RMBA 2X74A 4E7KA 1QSLA 4EZ9A 4KAZA 2X6NA 1HPZA 5J2QA 3HVTA 3AVKA 1T05A 1HJRA 1UOCA 3TAGA 1HRHA 4LY7A 3VQBA 1T03A 2A1SA 4K8ZA 4M3TA 2KZZA 2VWKA 1TK0A 4L8RB 5DK5A 1BCMA 1BIZA 4CJQA 4KHSA 1A5XA 2DFEA 3M8SA 3ISNC 4C8MA 1NJXA 3VQ5A 5KRTA 3L2VA 1SKSA 4FLXA 4CK3A 1L5UA 4CJFA 3KK1A 3O4QA 5C25A 3G10A 1Q8IA 1JLGA 1A5VA 2QKKA 5C24A 1TKTA 3CYMA 1Z25A 3VQ6A 3G0ZA 1RBVA 2Z1IA 3U6FA 4DF8A 2X6SA 3SJJA 4NYFA 3KLHA 2D5RA 3ALYA 1UAXA 3TAPA 4RW7A 1IO2A 5HLFA 4CK1A 4DWIA 4EP4A 4FLZA 1JXEA 4ZTJA 2RF2A 4FJIA 1DTQA 1BCOA 3V1OA 3NGIA 1FXXA 4CGJA 2XO7A 3NAEA 4AILC 1U45A 3LANA 1ITGA 1BQNA 3DLHA 4W5TA 3NCIA 2ZE2A 1XHZA 4NCBA 3AO2A 3V81A 2X78A 1VSHA 4BWJA 2XY6A 4E89A 1F21A 1WSFA 3NF9A 4OKEA 1VSJA 3JYTA 4DU4A 3V9WA 3RRGA 3ZCMA 4CEAA 3L2UA 4OGCA 3PO4A 3CG7A 4F4KA 4H8KA 3OY9A 1LAVA 1TVRA 4AHUA 4CECA 1BISA 1KCFA 2FBXA 1ZBFA 1RT6A 3MECA 3LZJA 1TV6A 1VSEA 3QEIA 3C6UA 2ATQA 3OYCA 1W9HA 3OYFA 2QKBA 4N56A 1C1CA 4FJMA 3K58A 3DRRA 1VK0A 4C8NA 3KLIA 1RILA 1C6VA 2HNDA 4LSLA 1HQUA 4DFKA 3PY8A 2OYQA 3DMJA 1KFDA 4J2BA 2P1JA 2HVHA 3DOKA 4DS4A 1B92A 4N41A 4AHTA 1LW0A 4MQ3A 4PA1A 4AHCA 4CJ5A 1XHXA 4DLEA 4DFMA 1S5JA 3RR8A 2ITGA 4C8OA 3VQEA 1EX4A 1Y97A 3VQ8A 3SQ1A 1TL1A 3TABA 1RT1A 3OYDA 5KRSA 3OS1A 3OYEA 1RT2A 1VSIA 2RKIA 2IDOA 3HL8A 2YNHA 2HHWA 1KVAA 2PZSA 4Z4HA 5HRSA 3KKRA 3TWHA 3OJUA 1HMVA 1D8YA 1LWFA 3S9HA 4DTSA 3U3GA 4O5BA 3T3FA 3NF8A 4JRQA 1QHTA 1S1TA 3P5JA 3SUQA 1BI4B 2YKMA 4H4OA 1VRTA 4CGGA 3L2RA 4Y1CA 3BGRA 3K5MA 3CFPA 3VQPA 1BGXT 4CFDA 4O0IA 3QNNA 3MEGA 3ZSXA 4I9QA 4DTMA 4CHQA 2W42A 4E1MA 4FLVA 3ZSQA 3LPTA 3HO1A 3EYZA 1LWEA 3ZT0A 4B9MA 2G8WA 3SQ2A 1ASVA 1IKVA 2HHXA 1DLOA 4FJKA 3EZ5A 4FJGA 3QNOA 3QIOA 3E01A 2LSNA 1HYVA 1SKWA 4ELVA 2IAJA 3I0RA 1FKOA 3OYHA 3LZIA 3L3UA 1I3AA 4XIUA 4FLUA 1T8EA
chains in the Genus database with same CATH superfamily
1KVBA 4JS4A 3ULDA 4LF9K 5AZJB 3ZETA 1N5YA 1RCHA 3CD6N 1EXQA 4DTOA 2OTJN 5FDLA 5E84A 3PX6A 4LF5K 3V4IA 1HLUA 3MN6A 3TSQA 2HHVA 4YNQA 3M8RA 3CM5A 2A41A 2O8EB 3CERA 1RDBA 1HJOA 3VERA 4WFBL 2B6AA 4DR2K 2O8CB 3RSEA 4ID1A 5GIPA 3DYAA 5AQYA 1VSDA 2NRVA 1WSGA 1Q82O 3VETA 3HOSA 4CERA 3I0SA 3ZT2A 1CXUA 4DU3A 1T6CA 3M5RA 2XY7A 4FJ8A 5C15A 4DU1A 4CK2A 2VYPA 2Y1IA 3V9ZA 3THYB 1JLCA 2P9IA 5HBMA 4KI4A 5EU7A 4B1UB 4K25A 3DLKA 3KIOA 3O8MA 1LWCA 3EZWA 2HBLA 3QEWA 5JLFA 1VSLA 3ZSRA 1RTDA 3DAWA 3HT3A 5A2QO 1CZAN 1S1WA 1YJWN 4J2DA 4ISEA 4Q5VA 2FBTA 1Q86O 4ISFA 4BVPA 1DTTA 1RBTA 1WAJA 3K5OA 3CCRN 2DFHA 1XWLA 1ZC6A 3CHWA 4CGHA 2CH6A 1ZYQA 3HM9A 2ZJRL 1RBSA 3DXMB 4IDKA 1VQ8N 2F8TA 1HNVA 4FW1A 2YKNA 3QMLA 4CD1A 2F8SA 3HK2A 5IWAK 4X65K 2IOCA 4XH4A 2VGNA 4OKKA 1W97L 4Z4IA 3SI6A 4B9VA 1SKRA 5CZ2A 2VWBA 2BE2A 1L3UA 2HHHK 3EL2A 4IO8A 3CF5L 5SZTA 2OZMA 2W6KA 1FKPA 4PQUA 5JLHA 1X9JA 3L8BA 2ZD1A 4Q0BA 4CEEA 1NK6A 3CJ1A 4OJRA 3EE9A 5AQQA 3EKSA 3K2PA 2QWMA 2XRIA 4JAXA 2B5JA 4A5AA 5GAHP 3JS6A 4R5PA 1MA9B 3AVHA 1KSPA 3DLBA 3TAEA 4C1NK 3VTHA 3R8EA 3J7ZO 1TK8A 4Y0WA 1RT7A 3KK3A 1WBBA 1RDDA 1YJNN 4JK9A 4B08A 4KH6A 3JSMA 3AVFA 4Y1DA 1E4FT 4CBUA 3J7YP 3QERA 5AQZA 1X3NA 3EKUA 4QS9A 2QWPA 3K5NA 1QE1A 4FJXA 1C0GA 1VSKA 4BRMA 4KHPK 2O8FB 3LPUA 4H0VB 4PHTX 1W2BM 1IG8A 2HOEA 3P31A 1UA1A 3AVJA 3ZSWA 3KJVA 4DQ8A 3KD5E 1R59O 2WOMA 1Q9XA 4M42A 3BZKA 2VQFK 4DUYK 4IG3A 1EO1A 3BP8A 4JKAA 1C0FA 5F0XA 3GE1A 4B8CA 2HF3A 3CQYA 3MCPA 1L3SA 3AVNA 3LDOA 4A2BA 1ZXOA 4IZ9A 2A6AA 4Z0UA 2ZM6K 1NK0A 1ZBLA 2E88A 3HP9A 4E7HA 1GLDG 1XMOK 1HNWK 1RDUA 4CW7B 2V51B 1ZBUA 4KHUA 2YHBA 2OCEA 4CVNE 1KLNA 4BRKA 4ICLA 1SV5A 4NB4A 2YNFA 2F9WA 3PX4A 3UKRA 2E6MA 4JI3K 1DT9A 3D6RA 4M3UA 3IUCA 4EP5A 3F9MA 3V9UA 2AJQA 2O8BB 3ZSVA 2DPNA 3PV8A 5J2NA 3QEXA 3SV4A 4JN4A 5KI6A 1WNSA 1YTAA 4CZGA 2Q2RA 3LWMA 4E19A 3P1GA 2IS3A 3C6AA 3D45A 1DGKN 4LH4A 4RW4A 5M1FA 1HKBA 1M90O 3RRHA 1JXBA 3LDPA 3GG4A 3AVBA 3MK6A 3KHYA 4DS5A 4JKDA 3HPOA 3RTVA 4FJ9A 4RTFD 3SUPA 5BRFA 3AAPA 4FLTA 2PYJA 4FJLA 3QBXA 1TKDA 1S9GA 1WB9A 4LF6K 4B3RK 3Q7CA 2VG5A 4FWRA 4BACA 1VQ4N 4JKGB 3OYBA 1E4GT 1N34K 2FSKA 4JK8A 2P5OA 3QO9A 4O55A 3LP0A 2AP1A 1IJJA 5C42A 2ZF5O 4ZHRA 4NCGA 4JKCA 4B8AB 2WTUA 1V4SA 4BE0A 3IFRA 4DR6K 4A2AA 4CCHA 2E4LA 1HKCA 1KFSA 3LM2A 1N33K 3OYIA 3WXJA 4DMNA 3TI0A 4FM1A 4KV8A 3P38A 2P9LB 1GLEG 4IWVA 4AH9A 3CPWM 2VG6A 4FLYA 3KLEA 2OPSA 2HMPA 1K8KA 2FSNA 3WT0A 1Q18A 1NBWA 3ZSOA 4A61A 1XC3A 1WLJA 4Z4GA 1JLAA 3D2EA 1RDCA 3B6OA 2KW4A 3KLFA 4NCAA 4E7LA 3DM2A 4W5QA 4CFCA 1HNXK 4N76A 3THWA 4W5OA 2O8DB 2CGKA 3AGKA 3AO1A 3RR7A 2UUBK 3DOLA 5FPNA 2YJFA 3VA3A 5LJWA 5EX5A 2VG7A 3O3FA 4WFNL 4R79A 1BDGA 1V4TA 3RWUA 1A5WA 1JLBA 3ZEUB 1XC9A 4MFBA 1OH7A 3J80O 3BDPA 3O1WA 3B8AX 3R1XA 3DWLA 1SL1A 4F8RA 2BH1A 4H5TA 3CIPA 5C12A 1QSLA 1QQNA 3THXB 5KQDA 4LY7A 1T03A 1NG9A 2KZZA 1TK0A 4L8RB 2UUCK 3CMAN 4L3QA 5BR9A 4FPBA 2UYTA 3K0SA 4CK3A 3O4QA 4CZEA 2NZTA 4QS7A 3MDQA 1U6ZA 3FZKA 1U2VA 5AQTA 4NYFA 3ALYA 2E2OA 5BRDA 3DXKB 4EP4A 1NGHA 4DKWA 4FJIA 4H0YB 4B1ZA 2XO7A 1ITGA 1BQNA 2E2NA 1IBLK 2P9PB 3AO2A 4FWNA 4JHDA 2XY6A 1E3MA 3HSCA 5BPNA 3BF3A 3NF9A 4OKEA 3JYTA 4F4KA 2F9TA 3UB5A 4FWOA 3O1BA 3ATUA 1BISA 3LZJA 2YHXA 1TV6A 4CZHA 4CZFA 4JK7A 1C1CA 3K58A 1NNEA 4WQ5A 1RILA 4LSLA 3PY8A 4DFKA 3CC7N 2OYQA 5FPMA 1Y64A 2P1JA 5EVZA 4DS4A 4AHTA 4DFMA 3ATVA 3VQEA 5AZIB 3VEVA 3SQ1A 5CR4A 1EWQA 3VGLA 3HL8A 1RDWX 2P9SA 2PZSA 3OJUA 1HMVA 1D8YA 2NRXA 5AQMA 4CGGA 4Y1CA 3ID8A 4O0IA 1BGXT 4JKBA 1QQOA 2A3ZA 4DR4K 4XH1A 5M1OA 4CHQA 1LWEA 4A62A 2G8WA 1ASVA 2CH5A 4FSVA 4BR5A 4GV3A 3E01A 1SAZA 3TU5A 4ELVA 2W41A 2ZGYA 3A5NC 3HZ6A 1I3AA 4XIUA 4LF7K 1T8EA 1RNHA 4OVLA 4CHYA 4X64K 3C7NA 2RN2A 4XEIA 4OO1J 4TSXA 4M3ZA 1BHLA 1JCFA 5J2MA 4F3OA 3WNEA 2QA4N 4F3TA 5J2PA 3G25A 1C0UA 4YFUA 4BREA 1OH5A 3L4QA 1WBDA 2HHUA 4JEPA 5GADP 5AQUA 4HUFA 4XH5A 2ZWHA 3JAMO 3RVCA 3ZT3A 1NK8A 4CZMA 2CGLA 3WUHA 3TTDA 4G1QA 1TL3A 4KBOA 1ZBHA 1RTIA 3O6WA 2EWSA 2I7PA 4AHRA 5CZ1A 4KH5A 2H3GX 4MO5A 4ELTA 4CF2A 4BRFA 3OYNA 2PAVA 3LDQA 4GVMA 1OH8A 3CFRA 4FWQA 1YT3A 3LDSA 3CQXA 4KHWA 3DRPA 3U9DA 1NLVA 2IGIA 3HBTA 4IJAA 3U8XA 1RTJA 2GWKA 4DSKA 1VQPN 4BE2A 4CHPA 3NF6A 4Z4EA 4M7XA 2HVIA 4ILGB 4DTJA 3GDQA 1Q81O 3D2FB 2FF3B 3KWGA 4AF1A 3IRXA 4LD0A 3ZETB 2VQEK 1IG9A 5FRMA 3HJFA 1J53A 1NOYA 2HBKA 5FPDA 4B3SK 1XQSC 1C0MA 3AVLA 2KFNA 3MN7A 4EZ9A 1I94K 4K8XA 4BG8A 3G4SN 3VQ9A 1KQSM 4HVJA 3H3NO 5LL6Z 3IAYA 1GLLO 4FJ5A 3RSEB 5JMVA 5AQIA 3CETA 4CJSA 2HNZA 2XHBA 2QM1A 4FJHA 4KHYA 3WXIA 3FR0A 4C8KA 1D9FA 3H46O 3HSTB 3KD1E 1MDUB 1YHQN 3UIQA 1HYZA 3SPYA 3O9QA 1RBRA 1TAQA 3C95A 2E2QA 5IT9O 1L3VA 2QWRA 4JNEA 3SV3A 3TPQA 3O80A 2HW3A 4JD2A 3DLGA 2FBYA 4H03B 2UUAK 1B9DA 4DR1K 4F2RA 3MN5A 1ZBSA 3QICA 5AQXA 3HPHA 3OYKA 2Q3SA 2V52B 3THVA 3WNGA 2IC3A 5DMRA 2G8HA 5HROA 4DV6K 3KTQA 3L3VA 3T1YK 1JKHA 3AO4A 5KTQA 5BN8A 1SUQA 4GKJK 3VMFB 2RPIA 2OANA 4CF9A 4ELUA 1BIUA 4CGDA 1RDAA 4CJVA 2Q36A 3QEVA 1GOAA 1LAWA 3OBYA 3SQ4A 2JLEA 4DCHA 1HX1A 2RHKA 4JI2K 3ULEB 2WBNA 1S6QA 4DTPA 3FFIA 3IG1A 4WCEL 3HVRA 1XMQK 2HBJA 2JWLA 3R6MA 1O13A 2OPQA 4EIAA 3TTCA 3CJCA 3QETA 5JS2A 4ISGA 4MO4A 4IJNA 5C0YA 3AVIA 2NLXA 4JKHA 3ZT4A 4YOUA 1VSFA 4DV3K 1KRPA 3VQ7A 4FJNA 3S41A 3SAFA 4FO0A 2Z1HA 5AJ3K 3LDLA 3I33A 3OJSA 2WONA 4DF4A 3NVMA 1BA0A 4H0OA 5CY4A 1CLQA 1KLMA 4K41A 4EZ6A 3DRSA 1S1UA 3S3OA 4IBNA 3ZT1A 2Z1JA 4CEFA 1SS6A 2P9LA 3SLCA 4AM6A 1U49A 5DM7L 2GBZA 3L2QA 4BC2A 3CXCM 4M63C 5AZJA 1M1KO 1X9MA 5AQVA 3V9SA 4DSFA 5F2RA 4Z4FA 1N36K 1JLFA 4CD3A 1NKCA 3VEOA 2BANA 4FWSA 4CJPA 3E66A 2XY5A 3TANA 4JLHA 4CZLA 5C2FA 4DQQA 5EY4A 2O8EA 3MX5A 1RT5A 5AQFA 3HRGA 3CCQN 4EAHD 1I39A 2O8CA 3V9XA 4CFAA 2G8IA 2FXUA 2HNYA 3NGYA 1FJGK 2DY4A 1W0HA 1TUYA 3CPEA 4YOTA 2ZJPL 3LP1A 3MXJA 1T3VA 4BR2A 4K0KK 1RT4A 2G8VA 1G99A 2ZQBA 4FOEA 1TAUA 2GUPA 3V1QA 4CJKA 1TYQA 4CHOA 4FLWA 2HHTA 3HPGA 4K43A 3KZBA 5BR8K 4DV4K 3AY9A 4FOIA 5D3GA 3OYJA 3O3HA 3SBTA 1U47A 1VQ7N 3DXMA 4DV1K 2GUIA 4H0PA 2IVNA 4E3SA 3PO5A 5AQKA 3EY1A 4DFJA 3FLCO 4KTWA 2OA8A 4U7BA 2HBMA 4JI7K 5I9EB 3A0IX 1SL2A 1J5OA 5ELZA 3U4LA 3SAGA 4YY3K 4NYNA 4B1XB 4WQ4A 3SPZA 1J9AA 4ID5A 4H5NA 4I9LA 1WSEA 1D5AA 2Q0UA 1J54A 3T1HK 3B6PA 4RG8A 4GMJB 4KAZA 4PKHA 3HOTA 4YDUC 3CCVN 1HPZA 1T05A 3AVKA 2D0OA 2A1SA 4K8ZA 5BREA 4DR3K 3UKUB 1LOTB 5LY3A 3M8SA 3ISNC 3WQTA 3VQ5A 5KRTA 3L2VA 4AM7A 1SKSA 2F4VK 5HL7L 3KK1A 5C25A 2QKKA 1Q8IA 3H3OB 4QCLA 3U6FA 4DF8A 2X6SA 4H5RA 5EXWA 1UAXA 3TAPA 4RW7A 1XUPO 4DWIA 4CK1A 4BG9A 3R9PA 4ZTJA 2RF2A 2O8FA 3V1OA 3KVGA 3D2EB 3NCIA 3V81A 1F21A 1X3MA 4ILJA 4GY2B 4DU4A 3RRGA 3ZCMA 4CEAA 3PO4A 4H8KA 4BGAA 3OY9A 1K9MO 4CECA 3MMVA 3MECA 5H1SQ 4LF4K 3OYFA 4N56A 3DRRA 3KLIA 2HNDA 1N32K 1HQUA 3DMJA 4X66K 5GIOA 1HPMA 4IEIA 5F1XA 1K73O 3ZYYX 2ITGA 3CCMN 5MLCQ 2Q31A 3H6EA 5KRSA 2RKIA 3QBWA 4B3MK 2IDOA 3T69A 2YNHA 4G9ZA 1KVAA 4BQZA 3KKRA 3TWHA 3AARA 4B1WB 4DTSA 4FPAA 4O5BA 3T3FA 4JRQA 3O08A 1BI4B 3A5OC 4F9OA 3K5MA 3FGUA 3MEGA 3ZSXA 3CCSN 4DTMA 1QZ5A 3EYZA 3SQ2A 4BC3A 4FJKA 1NGEA 4ILHA 4FJGA 3QNOA 3QIOA 1U2VB 4UY8O 4O5FA 1SKWA 2IAJA 1IBMK 3LZIA 5AQHA 4H0XB 1UWBA 1EQYA 4DLGA 3SZ2A 2YNGA 1GLFO 2FBVA 3OTOK 1J5EK 3NHGA 4DR7K 4DV0K 4CBXA 4E1NA 3MXIA 3M8QA 1BA1A 3O4NA 4JKEA 3TAQA 2ASPA 3CCEN 3AVAA 4I2PA 4JKGA 1XNQK 2ASMA 1G15A 1VHXA 4BR4A 1BL3A 3FZMA 4CJUA 3QESA 1NK7A 3SMSA 1GOCA 2KKZA 5SWMA 3O4WA 2P9KB 4CGIA 3C6HA 4FK4A 2OZSA 1YITN 4IG0A 3VTIA 4AQYK 5TKYA 2ASOA 4WE1A 1NOZA 3O9RA 1WSJA 3T19A 1Z26A 2QW9A 4JI5K 4CEDA 4KKOA 1KVCA 5KGWA 1EWRA 4RW6A 4BDYA 3AGRA 5T7BA 4IEEA 2IVPA 2G8KA 3DLRA 3KLGA 3CMEN 1WOQA 1ASWA 4YORA 4IFEA 3KWIA 3Q7BA 4DTRA 4B9QA 2WC9A 3CJ9A 3QEPA 2DTUA 5GAGP 3J81O 4IO9L 5C10A 2O8DA 3VQDA 2VGMA 3TAMA 2O4IA 1TKZA 2ZJQL 1QHAA 4HCBA 1YVNA 4YHHK 3FFKB 3D0PA 3K9JA 4CJRA 4KHQA 3NBPA 1YVUA 3OYAA 3ZEUA 3MN9A 3OYGA 2E8AA 2I7NA 2KQ2A 2A40A 1SL0A 3L2WA 2E1YA 3HXMA 2P5GA 2FF6A 1HUXA 4JRPA 3S3NA 3CCUN 3QFPA 1S6PA 1VRUA 2EX3A 4DTXA 3MEEA 4LFBK 2XY8A 2KZMA 4C8LA 5HRNA 2NRWA 3LP3A 3THXA 5KPTA 3QDKA 4M7YA 1NGBA 1NK9A 3HTVA 3A8YA 4GVEA 2AA4A 2R7YA 2WUSA 4OLBA 1P90A 3HI0A 3K57A 2D0BA 4CJ3A 4DV5K 4FCYA 3N4PA 5AR0A 3T1AA 1Q9YA 1ATNA 2QWNA 4KB1A 3AA5X 4NXMK 3L4IA 1NWKA 4DSIA 1MWKA 3E1YA 4RW8A 3QIPA 3DXKA 3SBGA 5M1QA 3TARA 3LAKA 4CBWA 3OVNA 2P9NB 1ASUA 4N47A 5M1NA 4QOZB 1NKEA 1HYSA 4PY5A 1H1VA 1FK9A 4CZIA 3PLAA 5KPRA 2PYLA 4WQ5C 2NRTA 3SUOA 4Z94A 4IFYA 4DQPA 1RBUA 4CJWA 4E7JA 2F96A 2YCHA 3C6TA 1QVFM 1VQ5N 3SYZA 3BY5A 3CJ7A 5LJVA 3NFAA 4BRGA 3MXMA 1VQMN 1IH7A 5JVGL 1ATRA 3OA9A 4FYDA 4M45A 3ZLJA 4J8FA 4CEBA 4BQLA 1JLQA 4E0DA 2HHSA 2E2PA 3OHRA 2NUBA 1MU2A 2JWKA 5M1PA 3NF7A 2RE2A 5AZIA 3VQQA 1X9SA 4BRAA 4I6MB 3DLEA 2EHGA 4KI6A 2DFFA 3LL3A 1S1XA 1QQCA 4BR9A 5JS1A 1GLCG 4BRHA 5ADXA 4DHYA 4BC4A 3AVGA 4YOYA 1TK5A 5CYQA 4MDAA 3RMAA 2YNIA 2Z1GA 4FJ7A 1JCGA 3VQ4A 2P9UB 3IS9A 4C1NI 4LC9B 4FZXC 1X9WA 4HHTA 3MX2A 4CEZA 1JJ2M 4BVOA 5AFUA 4FJJA 3AO3A 3F5TA 3O3GA 4RW9A 1S9EA 3IDHA 4CIFA 3CFOA 1REVA 1KAXA 2BDPA 1X1PA 2GV9A 4M3YA 3QB0A 2YHWA 2Y1JA 1HNIA 3SCXA 4B1YB 3F9KA 4FW2A 4DB3A 3ID6A 5LMUK 4O8UA 1HQEA 1WAFA 2GX9A 4CHNA 1YJ9N 4N5SA 4FXDA 3LM9A 1KD1O 1S3XA 2QTDA 4K42A 5AQSA 3G71N 5AQJA 2UXDK 1T6DA 2HHQA 2P9IB 2YV0X 5B8HA 4BE1A 2CGJA 5BPMA 3TSUA 1NJIO 3NE6A 2YI1A 4M3RA 3CM6A 2F7TA 1T44A 4JI1K 4A59A 3I55N 2PY5A 3C94A 4KHNA 3P83D 3PUFA 3NH2A 4GW6A 4NLBA 4KRFA 4OGEA 4Z4CA 5HOOA 3E9OA 3VF2A 1SZ2A 4CHZA 3D2FA 4QAGA 4A5BA 3LDNA 3NH1A 4LH5A 4CGFA 1RT3A 4O0JA 3V6DA 3H08A 1BOTO 1NU0A 3M8PA 1O1WA 4O8KA 1OVQA 2KTQA 4HTUA 4GKKK 5K14A 3MEDA 2YHAA 1JLEA 4PKIA 1GLAG 3VEYA 3ZX3A 4O4GA 4IKFA 3WNFA 3K9KA 2QXFA 2D0CA 3GBTA 3IMXA 4DQSA 4HTLA 5AQOA 5J2QA 3F2KA 4BC5A 3VQBA 4M3TA 2VWKA 5DK5A 1BIZA 4CJQA 1A5XA 2NRHA 4C8MA 3WEEA 3L6QA 5AQGA 2PFUA 3VENA 5CHIA 1L5UA 4CJFA 3G10A 1A5VA 5C2DA 5C24A 3CYMA 3VQ6A 3DLLL 2Z1IA 4IDHA 3SJJA 4WYBA 1TYQB 2D5RA 1NMDA 3QFUA 1JXEA 1QZ6A 1TUUA 3NGIA 1FXXA 3VPZA 4CGJA 4GNIA 4AILC 3LANA 3DLHA 2ZE2A 1XHZA 5AQRA 4NCBA 4GV9A 3HM8A 3U9ZA 1DEJA 3L2UA 1HR0K 1LAVA 4DV2K 1KCFA 2FBXA 1ZBFA 1NM1A 3QEIA 2QWQA 2BUPA 2ATQA 1W9HA 2QKBA 2HF4A 4C8NA 4EFHA 4BRDA 4J2BA 3VEXA 2D0PA 1KFDA 3W3DA 3DOKA 4N41A 1B92A 1LW0A 4MQ3A 4AHCA 4DLEA 3H1VX 1Y97A 3ULEA 1BWFO 3UKRB 3TABA 1RT1A 3OYDA 1YI2N 3VGKA 1IV0A 3THYA 1VSIA 3CC2N 5BN9A 4Z4HA 5HRSA 4JYAK 1S22A 1LWFA 3U3GA 1QHTA 1S1TA 3P5JA 3SUQA 2YKMA 1VRTA 3L2RA 4JI6K 3CFPA 1VQLN 3VQPA 3QNNA 4FWKA 1N8RO 4GV6A 3ZSQA 3FZLA 3LPTA 3HO1A 3CCJN 3ZT0A 4B9MA 1IKVA 4BRPA 4YDUA 3SJHA 3EZ5A 2IIRA 5EOYA 3ENBA 4X62K 3OYHA 4H5VA 1FW6A 4B9TA 2E20A 4O44A 3WXMB 3CQ8A 5FRNA 1IKYA 1ATSA 4OLAA 4DTNA 4CI6A 5DM6L 3E9LA 5ADXH 4F2SA 2G8FA 2NRRA 3ZX2A 1XI1A 1J6ZA 3A5LC 4BRIA 4JI0K 3TSPA 1IBKK 5BPLA 3OYMA 1U48A 3ZX0A 5LMNK 3AAQA 1BQMA 4BROA 1YXQA 4BRCA 1LW2A 1S1VA 4B1VA 5KPZA 1R0AA 4HUGA 2Q97A 3T7ZA 4FWLA 4BWMA 4FL9A 4DR5K 3S3MA 4KB0A 3J7AP 3SAHA 5GAEP 1DKGD 1N6QA 1NKBA 5JICA 2I5JA 5AFUH 3C65A 3WXLA 4CFBA 5JVHL 3SUNA 1VQON 2IVOA 4YOVA 3BUZB 4YOWA 3ENHA 3DI6A 4FM2A 4KH4A 1NK4A 2GEMA 2NRZA 4CEOA 3I8DA 3EN9A 1K8KB 4CJ4A 4JKFA 3MWTA 4B9NA 4E7IA 4YOXA 4CZJA 4CIGA 4LSNA 2E5LK 3AA4A 3MCAB 4DQRA 1BUPA 1EETA 5KQ8A 5FLXO 3PIPL 3BF1A 4JV5K 2QEXN 4KPYA 3D7EO 4FK2A 4RWTA 4PKGA 4NLCA 3KK2A 5M1KA 5AQWA 5TKWA 1CXQA 2UU9K 1IKWA 4BRNA 4W5RA 3THWB 2ITMA 4CF0A 1NGDA 3J8AA 4E1JA 4WQ4C 4EHUA 3VN5A 3L0QA 4FVUA 4OPHA 1RFQA 2J4RA 4NO7A 3TAFA 4FK0A 1L3TA 1D4XA 2GTDA 3AA3A 3PSFA 1NK5A 3RMCA 4DQIA 2KFZA 3CJBA 4CIEA 1KTQA 3G6EN 1K6YA 1T7PA 3OS2A 4JI8K 4BDZA 1OVYA 4PWDA 2FC0A 3FZHA 3OBWA 4KTQA 1QVGM 1BG3A 2OPRA 4KTZA 2OPPA 3M6GA 4WF9L 4NXNK 4M41A 5E26A 2HMIA 1Z05A 3AVCA 1D9DA 2O8BA 1EKEA 2QXLA 2B4JA 3CC4N 4W5NA 4CEQA 4A57A 1NGFA 4HWIA 1JCEA 4CESA 4DSLA 3K5LA 3GOIA 3UKUA 1K8AO 4FWMA 2A1RA 4OX9K 3CI5A 3A2FA 1GLBG 1YTUA 1KAYA 1NJYA 1CZBA 3P4IA 4AHVA 3LP2A 3NGZA 1BO5O 1C1BA 3K59A 3VA0A 1QTMA 4CJEA 3WNHA 2UXCK 4DTUA 3AV9A 1UA0A 1VQ9N 2V7YA 3O5BA 1S72N 3VF6A 4JHDB 4KFBA 2Q0RA 4FZZA 3GL1A 3OW2M 4DV7K 2P51A 2GWJA 5HRRA 3SMPA 4DG1A 3NMUA 4H0TB 3V1RA 3ZSZA 4AHSA 3PIOL 1ILYA 3NVKA 4CJTA 4H5WA 3OS0A 4FZYA 1TKXA 3F73A 3HYFA 3N4QA 3KKSA 3TTFA 1QS4A 1OH6A 4OKJA 5AQLA 1NJZA 2A42A 1RGIA 4J2EA 4BRLA 3LAMA 3AO5A 4U67L 2QWOA 1VQNN 4FM0A 4B9SA 1NJWA 1HKGA 3OYLA 2P9SB 1GLJO 1TGOA 3MAQA 1NGCA 2A5XA 1C0TA 3A5MC 4QS8A 4LFCK 1BI4A 4CJ7A 4FWPA 4C23A 3H1QA 4MLHA 5CE3A 4BY9C 4CF8A 5E41A 1ZBIA 4IOXA 1YIJN 2PBDA 1KXPA 5FROA 3QINA 2QK9A 1NGJA 4KREA 4DSEA 2QI2A 2YJEA 3C7NB 3O9UA 1WSHA 3ASMA 3AA2A 2KHOA 3FZFA 4HUEA 3UE5A 4CJLA 4OPAA 5J1EA 1WN7A 4OPJA 1B9FA 4I7FA 2JGUA 4B9UA 3TR8A 2O4GA 1YUWA 5FPEA 3RMDA 1QSYA 1Z6RA 2VCPA 3M1FA 4PUOA 1WSIA 4I2QA 4B3OA 1U4BA 2BGGA 5CYMA 3O9SA 5AQNA 2P9KA 4B9LA 4M3WA 3LALA 4DUZK 1EP4A 1NGAA 4HCCA 1KC8O 1RTHA 1ESVA 5HP1A 1SQKA 1NMNA 3HP6A 1U04A 2E6LA 3ZSYA 4KO0A 4UQGA 3VQAA 1C1AA 1JL1A 3JXUA 3MWPA 3WXKA 4DSJA 2HB5A 1LV5A 4OPKA 2G8UA 2D1KA 3KK7A 3NDKA 3VOVA 3W0LA 4LFAK 3PSIA 3PX0A 3EEQA 3SQ0A 1KAZA 3U3YA 4M3XA 1QSSA 5I42A 1VQ6N 3VQCA 2P9PA 5I3UA 1IKXA 3E9PA 2HSTA 4RCHA 2VWJA 4BR0A 4PL8A 3IKMA 4IFVA 2KLAA 4CF1A 4DFPA 2ETJA 2FLOA 4FVMA 5HRPA 5BRHA 2V7ZA 3O9TA 4H4MA 3NH0A 3WQUA 4CZKA 4JS5A 3SK3A 4J2AA 4BDPA 3QLHA 3EE8A 3ENOA 3AVMA 2YX6A 2BTFA 5KGXA 3M3ZA 3LWLA 2WFBA 3SNNA 4ZTFA 4JI4K 1GOBA 2Q1NA 2YHYA 1VSMA 1JL2A 1CZ9A 3I56N 1QQMA 2D0AA 3ITHA 2GELA 2QWLA 2FSJA 2X74A 4BGBA 4CE9A 4PL7A 4E7KA 2X6NA 5AQPA 3FE1A 3HVTA 3I8BA 1HJRA 1UOCA 3TAGA 1HRHA 4WFAL 4LF8K 2NNWA 1BCMA 4KHSA 2DFEA 2UXBK 1MWMA 1YAGA 1NJXA 3EO3A 4EHTA 4FLXA 4MLEA 1JLGA 1VQKN 1TKTA 1Z25A 3CJAA 5GINA 3G0ZA 1RBVA 3VGMA 3KLHA 2D4WA 4JD2B 1YF5L 1IO2A 5HLFA 4IOCL 4FLZA 3VEZA 1LCUA 1DTQA 1BCOA 4BRQA 1U45A 3NAEA 2P9NA 1HNZK 4IXCA 4W5TA 4V19S 1OKJA 2X78A 1VSHA 4BWJA 3RMBA 3R3LA 4E89A 1WSFA 1VSJA 3V9WA 1XNRK 4OGCA 3CG7A 1BU6O 1TVRA 4AHUA 2OTLN 1RT6A 1VSEA 3C6UA 3OYCA 2W40A 4FJMA 1VK0A 1C6VA 2HVHA 4PA1A 4CJ5A 3RR8A 1XHXA 4C8OA 4IOAL 1S5JA 1EX4A 3VQ8A 4BR7A 1P8ZA 1TL1A 3H45C 3CCLN 3OS1A 3OYEA 1RT2A 4I6MA 4MDBA 1NGIA 3BZCA 2HHWA 1VAZA 4B3TK 1W7AA 3VESA 3S9HA 3DJCA 3VF4A 2ZGZA 3NF8A 4H4OA 3BGRA 1WUAA 3WEEB 4CFDA 3P39A 2E1ZA 4I9QA 2W42A 3VEWA 4E1MA 3BEXA 4FLVA 1Q7YO 1NGGA 2HHXA 1DLOA 2W6LA 2P9UA 2LSNA 1HYVA 3I0RA 1FKOA 3C0BA 4FLUA 3L3UA
chains in the Genus database with same CATH topology
1UWBA 1KVBA 1RNHA 4OVLA 4JS4A 4O44A 3CQ8A 4CHYA 3ULDA 4DLGA 2YNGA 3SZ2A 2FBVA 5FRNA 1IKYA 1N5YA 2RN2A 4OLAA 1RCHA 3NHGA 4DTNA 4TSXA 1EXQA 4E1NA 4DTOA 3MXIA 3M8QA 4F2SA 1BHLA 4M3ZA 5J2MA 5FDLA 2G8FA 3WNEA 3PX6A 4F3OA 4F3TA 5J2PA 1C0UA 4YFUA 3O4NA 1XI1A 3TAQA 3AVAA 4I2PA 3V4IA 2HHVA 3OYMA 4YNQA 1U48A 1G15A 3M8RA 2HHUA 3CM5A 1BL3A 1BQMA 4HUFA 4CJUA 3QESA 1LW2A 1S1VA 1R0AA 1NK7A 1RDBA 4HUGA 2B6AA 4BWMA 4KB0A 3S3MA 1GOCA 4ID1A 5SWMA 3ZT3A 3DYAA 4NCAA 1VSDA 1NK8A 1N6QA 1NKBA 1WSGA 2I5JA 3SUNA 4CFBA 4CGIA 4CERA 4FK4A 3I0SA 4G1QA 1TL3A 3ZT2A 1CXUA 4DU3A 2XY7A 2OZSA 4FJ8A 3DI6A 4FM2A 4DU1A 1ZBHA 1RTIA 4IG0A 4CK2A 1NK4A 4AHRA 5CZ1A 2Y1IA 3V9ZA 1JLCA 5HBMA 4CEOA 4ELTA 4WE1A 4CF2A 1NOZA 4KI4A 5EU7A 3OYNA 3I8DA 1WSJA 3DLKA 3T19A 1Z26A 4GVMA 3KIOA 4CJ4A 1LWCA 4B9NA 3QEWA 1VSLA 3CFRA 4CEDA 4E7IA 4KKOA 3ZSRA 1RTDA 3HT3A 1YT3A 4CIGA 1S1WA 1KVCA 4LSNA 5KGWA 3DRPA 3LDSA 3AA4A 4J2DA 4KHWA 4RW6A 2IGIA 4Q5VA 2FBTA 4DQRA 1EETA 4BDYA 1RTJA 5T7BA 1DTTA 1RBTA 1WAJA 3DLRA 3K5OA 3KLGA 2G8KA 4DSKA 4KPYA 2DFHA 4BE2A 4FK2A 1XWLA 1ASWA 4CHPA 3NF6A 3KK2A 4Z4EA 4CGHA 4DTRA 2HVIA 1ZYQA 3HM9A 4DTJA 1CXQA 1RBSA 4IDKA 1IKWA 2F8TA 1HNVA 4W5RA 4FW1A 2YKNA 3QEPA 2F8SA 4CF0A 3HK2A 2DTUA 3IRXA 2IOCA 3VQDA 4OKKA 3VN5A 4Z4IA 3TAMA 3SI6A 4B9VA 1TKZA 1SKRA 4HCBA 5CZ2A 2O4IA 4LD0A 1IG9A 5FRMA 3D0PA 3TAFA 4FK0A 1J53A 2BE2A 1L3TA 1NOYA 3HJFA 3AA3A 4CJRA 1L3UA 1NK5A 3RMCA 4DQIA 4KHQA 2KFZA 4CIEA 3NBPA 1C0MA 1KTQA 3AVLA 5SZTA 1YVUA 3OYAA 2KFNA 1K6YA 2OZMA 1FKPA 3OYGA 1T7PA 3OS2A 4BDZA 4PQUA 2KQ2A 3L8BA 2ZD1A 1SL0A 4PWDA 4B9TA 2FC0A 3L2WA 4Q0BA 4K8XA 4CEEA 4KTQA 3HXMA 3VQ9A 4HVJA 2P5GA 4JRPA 2OPRA 3S3NA 1NK6A 3IAYA 4KTZA 4OJRA 2OPPA 4FJ5A 1S6PA 1VRUA 2EX3A 4DTXA 3MEEA 2XY8A 2KZMA 4C8LA 5HRNA 4M41A 4CJSA 2HNZA 3LP3A 2XHBA 2HMIA 2XRIA 3AVCA 3K2PA 4R5PA 1EKEA 2B5JA 1D9DA 1KSPA 3DLBA 4FJHA 3AVHA 4KHYA 2B4JA 4W5NA 3TAEA 4CEQA 1NK9A 2R7YA 4CESA 4DSLA 3K5LA 4C8KA 1TK8A 4OLBA 1D9FA 3K57A 3HSTB 2D0BA 4CJ3A 4FCYA 3KD1E 2A1RA 1RT7A 3KK3A 3T1AA 1HYZA 1Q9YA 3UIQA 1RDDA 3SPYA 3A2FA 1RBRA 1TAQA 3C95A 4B08A 3JSMA 3AVFA 4Y1DA 1YTUA 1NJYA 1L3VA 4KB1A 3AA5X 1CZBA 3QERA 4AHVA 3LP2A 3NGZA 3SV3A 1C1BA 3K59A 3VA0A 1QTMA 4CJEA 3K5NA 1QE1A 2HW3A 3WNHA 4RW8A 4DSIA 4FJXA 3QIPA 3AV9A 3DLGA 1VSKA 4DTUA 2FBYA 1UA0A 3LPUA 1B9DA 4F2RA 3TARA 3LAKA 3OVNA 4N47A 1ASUA 3HPHA 3OYKA 4QOZB 1NKEA 1HYSA 2Q3SA 4PY5A 1FK9A 3THVA 3WNGA 1UA1A 2PYLA 3AVJA 4KFBA 3SUOA 4IFYA 3ZSWA 4DQPA 3KJVA 2IC3A 5DMRA 2G8HA 1RBUA 4FZZA 5HROA 3KD5E 3KTQA 4CJWA 4E7JA 2F96A 3C6TA 2WOMA 2P51A 1Q9XA 4M42A 3L3VA 3SYZA 4IG3A 1JKHA 3AO4A 5HRRA 5KTQA 4DG1A 3NFAA 4B8CA 3MXMA 1IH7A 1L3SA 3V1RA 3ZSZA 4AHSA 1SUQA 4CF9A 2RPIA 3AVNA 4ELUA 1BIUA 4CGDA 4Z0UA 1RDAA 4CJTA 4CJVA 1NK0A 1ZBLA 4FYDA 3HP9A 4M45A 4E7HA 3OS0A 3QEVA 4QCLA 4CEBA 4FZYA 1TKXA 1GOAA 3F73A 3HYFA 1LAWA 3SQ4A 1ZBUA 1JLQA 2JLEA 4KHUA 2YHBA 3KKSA 4E0DA 2HHSA 1QS4A 2NUBA 4OKJA 1NJZA 1KLNA 1MU2A 4ICLA 1S6QA 4DTPA 1SV5A 3FFIA 4J2EA 3IG1A 3NF7A 3VQQA 2YNFA 3LAMA 3HVRA 3PX4A 1X9SA 3AO5A 2E6MA 3DLEA 2EHGA 4KI6A 2DFFA 4FM0A 4B9SA 1NJWA 3OYLA 2OPQA 1S1XA 3QETA 1QQCA 5JS1A 1TGOA 3MAQA 4M3UA 5JS2A 4EP5A 3V9UA 2AJQA 3ZSVA 3PV8A 5J2NA 1C0TA 3QEXA 3AVIA 3SV4A 1BI4A 1WNSA 1YTAA 5KI6A 3ZT4A 1VSFA 3LWMA 3AVGA 4E19A 1TK5A 3P1GA 2IS3A 1KRPA 5CYQA 3VQ7A 3D45A 4LH4A 3RMAA 4FJNA 2YNIA 4RW4A 2Z1GA 4CF8A 4FJ7A 2Z1HA 5E41A 3OJSA 1ZBIA 3RRHA 2WONA 3VQ4A 4DF4A 1JXBA 3IS9A 5FROA 5CY4A 3QINA 1CLQA 1KLMA 2QK9A 3AVBA 4FZXC 1X9WA 4HHTA 4EZ6A 4KREA 3DRSA 1S1UA 4DSEA 4DS5A 3S3OA 4IBNA 3ZT1A 2Z1JA 4CEFA 3HPOA 3RTVA 4FJ9A 4CEZA 3SUPA 1U49A 3L2QA 2GBZA 4FLTA 2PYJA 1X9MA 4FJJA 1WSHA 3ASMA 3V9SA 4FJLA 4DSFA 3AA2A 3AO3A 1TKDA 3O3GA 4Z4FA 4RW9A 1S9GA 4HUEA 1S9EA 4CIFA 1JLFA 3CFOA 1REVA 4CJLA 5J1EA 1WN7A 1NKCA 2VG5A 4OPJA 1B9FA 4I7FA 4BACA 2BDPA 1X1PA 2BANA 2JGUA 4CJPA 3OYBA 2GV9A 2XY5A 4B9UA 3TANA 3TR8A 4JLHA 2P5OA 4M3YA 2O4GA 2Y1JA 3QO9A 1HNIA 4O55A 3SCXA 3LP0A 4DQQA 3F9KA 4FW2A 5C42A 4ZHRA 1RT5A 4NCGA 3RMDA 4B8AB 1HQEA 1WAFA 4CHNA 1QSYA 1I39A 4N5SA 4BE0A 4PUOA 3V9XA 4CFAA 1WSIA 4I2QA 4B3OA 4FXDA 1U4BA 2G8IA 2BGGA 5CYMA 2HNYA 4CCHA 2E4LA 4B9LA 3NGYA 4M3WA 3LALA 2DY4A 1KFSA 1W0HA 3OYIA 1EP4A 4DMNA 3TI0A 4HCCA 1RTHA 4FM1A 2HHQA 3LP1A 3MXJA 4KV8A 5HP1A 2YV0X 3HP6A 1U04A 2E6LA 3ZSYA 4AH9A 4FLYA 2VG6A 4KO0A 4UQGA 3VQAA 3KLEA 2OPSA 4BE1A 1C1AA 1JL1A 1RT4A 2G8VA 4DSJA 2ZQBA 2HB5A 1LV5A 1TAUA 3V1QA 4CJKA 4OPKA 2G8UA 3NE6A 4CHOA 4FLWA 3NDKA 2HHTA 3HPGA 4M3RA 3ZSOA 3PX0A 3CM6A 3SQ0A 1WLJA 4Z4GA 1JLAA 5D3GA 1RDCA 3U3YA 3B6OA 1QSSA 3OYJA 5I42A 3O3HA 2PY5A 4M3XA 2KW4A 3C94A 3VQCA 4KHNA 3P83D 3PUFA 3NH2A 3KLFA 1IKXA 4GW6A 4E7LA 3DM2A 5I3UA 1U47A 4OGEA 4Z4CA 4W5QA 4KRFA 2VWJA 4CFCA 4CHZA 4QAGA 4N76A 2GUIA 4W5OA 4E3SA 3AO1A 4IFVA 3PO5A 3RR7A 3EY1A 4CF1A 4DFJA 4DFPA 2ETJA 3NH1A 4LH5A 3DOLA 1RT3A 4CGFA 3VA3A 4FVMA 5HRPA 4KTWA 4O0JA 2VG7A 3V6DA 3O3FA 3H08A 4H4MA 2OA8A 3M8PA 1O1WA 3NH0A 1SL2A 3RWUA 1A5WA 1J5OA 1JLBA 4JS5A 4J2AA 4BDPA 3QLHA 2KTQA 1XC9A 4MFBA 4HTUA 4NYNA 5K14A 3MEDA 3BDPA 2YHAA 3AVMA 3SPZA 1J9AA 4ID5A 1JLEA 4I9LA 1WSEA 1D5AA 5KGXA 3LWLA 1SL1A 3SNNA 1J54A 4ZTFA 4F8RA 3B6PA 4O4GA 4IKFA 3WNFA 4RG8A 1GOBA 1VSMA 1JL2A 1CZ9A 2D0CA 2QXFA 2D0AA 3ITHA 4CE9A 4DQSA 4GMJB 3RMBA 2X74A 4E7KA 1QSLA 4EZ9A 4KAZA 2X6NA 1HPZA 5J2QA 3HVTA 3AVKA 1T05A 1HJRA 1UOCA 3TAGA 1HRHA 4LY7A 3VQBA 1T03A 2A1SA 4K8ZA 4M3TA 2KZZA 2VWKA 1TK0A 4L8RB 5DK5A 1BCMA 1BIZA 4CJQA 4KHSA 1A5XA 2DFEA 3M8SA 3ISNC 4C8MA 1NJXA 3VQ5A 5KRTA 3L2VA 1SKSA 4FLXA 4CK3A 1L5UA 4CJFA 3KK1A 3O4QA 5C25A 3G10A 1Q8IA 1JLGA 1A5VA 2QKKA 5C24A 1TKTA 3CYMA 1Z25A 3VQ6A 3G0ZA 1RBVA 2Z1IA 3U6FA 4DF8A 2X6SA 3SJJA 4NYFA 3KLHA 2D5RA 3ALYA 1UAXA 3TAPA 4RW7A 1IO2A 5HLFA 4CK1A 4DWIA 4EP4A 4FLZA 1JXEA 4ZTJA 2RF2A 4FJIA 1DTQA 1BCOA 3V1OA 3NGIA 1FXXA 4CGJA 2XO7A 3NAEA 4AILC 1U45A 3LANA 1ITGA 1BQNA 3DLHA 4W5TA 3NCIA 2ZE2A 1XHZA 4NCBA 3AO2A 3V81A 2X78A 1VSHA 4BWJA 2XY6A 4E89A 1F21A 1WSFA 3NF9A 4OKEA 1VSJA 3JYTA 4DU4A 3V9WA 3RRGA 3ZCMA 4CEAA 3L2UA 4OGCA 3PO4A 3CG7A 4F4KA 4H8KA 3OY9A 1LAVA 1TVRA 4AHUA 4CECA 1BISA 1KCFA 2FBXA 1ZBFA 1RT6A 3MECA 3LZJA 1TV6A 1VSEA 3QEIA 3C6UA 2ATQA 3OYCA 1W9HA 3OYFA 2QKBA 4N56A 1C1CA 4FJMA 3K58A 3DRRA 1VK0A 4C8NA 3KLIA 1RILA 1C6VA 2HNDA 4LSLA 1HQUA 4DFKA 3PY8A 2OYQA 3DMJA 1KFDA 4J2BA 2P1JA 2HVHA 3DOKA 4DS4A 1B92A 4N41A 4AHTA 1LW0A 4MQ3A 4PA1A 4AHCA 4CJ5A 1XHXA 4DLEA 4DFMA 1S5JA 3RR8A 2ITGA 4C8OA 3VQEA 1EX4A 1Y97A 3VQ8A 3SQ1A 1TL1A 3TABA 1RT1A 3OYDA 5KRSA 3OS1A 3OYEA 1RT2A 1VSIA 2RKIA 2IDOA 3HL8A 2YNHA 2HHWA 1KVAA 2PZSA 4Z4HA 5HRSA 3KKRA 3TWHA 3OJUA 1HMVA 1D8YA 1LWFA 3S9HA 4DTSA 3U3GA 4O5BA 3T3FA 3NF8A 4JRQA 1QHTA 1S1TA 3P5JA 3SUQA 1BI4B 2YKMA 4H4OA 1VRTA 4CGGA 3L2RA 4Y1CA 3BGRA 3K5MA 3CFPA 3VQPA 1BGXT 4CFDA 4O0IA 3QNNA 3MEGA 3ZSXA 4I9QA 4DTMA 4CHQA 2W42A 4E1MA 4FLVA 3ZSQA 3LPTA 3HO1A 3EYZA 1LWEA 3ZT0A 4B9MA 2G8WA 3SQ2A 1ASVA 1IKVA 2HHXA 1DLOA 4FJKA 3EZ5A 4FJGA 3QNOA 3QIOA 3E01A 2LSNA 1HYVA 1SKWA 4ELVA 2IAJA 3I0RA 1FKOA 3OYHA 3LZIA 3L3UA 1I3AA 4XIUA 4FLUA 1T8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWB A;  1KVB A;  1RNH A;  4OVL A;  4JS4 A;  4O44 A;  3CQ8 A;  4CHY A;  3ULD A;  4DLG A;  2YNG A;  3SZ2 A;  2FBV A;  5FRN A;  1IKY A;  1N5Y A;  2RN2 A;  4OLA A;  1RCH A;  3NHG A;  4DTN A;  4TSX A;  1EXQ A;  4E1N A;  4DTO A;  3MXI A;  3M8Q A;  4F2S A;  1BHL A;  4M3Z A;  5J2M A;  5FDL A;  2G8F A;  3WNE A;  3PX6 A;  4F3O A;  4F3T A;  5J2P A;  1C0U A;  4YFU A;  3O4N A;  1XI1 A;  3TAQ A;  3AVA A;  4I2P A;  3V4I A;  2HHV A;  3OYM A;  4YNQ A;  1U48 A;  1G15 A;  3M8R A;  2HHU A;  3CM5 A;  1BL3 A;  1BQM A;  4HUF A;  4CJU A;  3QES A;  1LW2 A;  1S1V A;  1R0A A;  1NK7 A;  1RDB A;  4HUG A;  2B6A A;  4BWM A;  4KB0 A;  3S3M A;  1GOC A;  4ID1 A;  5SWM A;  3ZT3 A;  3DYA A;  4NCA A;  1VSD A;  1NK8 A;  1N6Q A;  1NKB A;  1WSG A;  2I5J A;  3SUN A;  4CFB A;  4CGI A;  4CER A;  4FK4 A;  3I0S A;  4G1Q A;  1TL3 A;  3ZT2 A;  1CXU A;  4DU3 A;  2XY7 A;  2OZS A;  4FJ8 A;  3DI6 A;  4FM2 A;  4DU1 A;  1ZBH A;  1RTI A;  4IG0 A;  4CK2 A;  1NK4 A;  4AHR A;  5CZ1 A;  2Y1I A;  3V9Z A;  1JLC A;  5HBM A;  4CEO A;  4ELT A;  4WE1 A;  4CF2 A;  1NOZ A;  4KI4 A;  5EU7 A;  3OYN A;  3I8D A;  1WSJ A;  3DLK A;  3T19 A;  1Z26 A;  4GVM A;  3KIO A;  4CJ4 A;  1LWC A;  4B9N A;  3QEW A;  1VSL A;  3CFR A;  4CED A;  4E7I A;  4KKO A;  3ZSR A;  1RTD A;  3HT3 A;  1YT3 A;  4CIG A;  1S1W A;  1KVC A;  4LSN A;  5KGW A;  3DRP A;  3LDS A;  3AA4 A;  4J2D A;  4KHW A;  4RW6 A;  2IGI A;  4Q5V A;  2FBT A;  4DQR A;  1EET A;  4BDY A;  1RTJ A;  5T7B A;  1DTT A;  1RBT A;  1WAJ A;  3DLR A;  3K5O A;  3KLG A;  2G8K A;  4DSK A;  4KPY A;  2DFH A;  4BE2 A;  4FK2 A;  1XWL A;  1ASW A;  4CHP A;  3NF6 A;  3KK2 A;  4Z4E A;  4CGH A;  4DTR A;  2HVI A;  1ZYQ A;  3HM9 A;  4DTJ A;  1CXQ A;  1RBS A;  4IDK A;  1IKW A;  2F8T A;  1HNV A;  4W5R A;  4FW1 A;  2YKN A;  3QEP A;  2F8S A;  4CF0 A;  3HK2 A;  2DTU A;  3IRX A;  2IOC A;  3VQD A;  4OKK A;  3VN5 A;  4Z4I A;  3TAM A;  3SI6 A;  4B9V A;  1TKZ A;  1SKR A;  4HCB A;  5CZ2 A;  2O4I A;  4LD0 A;  1IG9 A;  5FRM A;  3D0P A;  3TAF A;  4FK0 A;  1J53 A;  2BE2 A;  1L3T A;  1NOY A;  3HJF A;  3AA3 A;  4CJR A;  1L3U A;  1NK5 A;  3RMC A;  4DQI A;  4KHQ A;  2KFZ A;  4CIE A;  3NBP A;  1C0M A;  1KTQ A;  3AVL A;  5SZT A;  1YVU A;  3OYA A;  2KFN A;  1K6Y A;  2OZM A;  1FKP A;  3OYG A;  1T7P A;  3OS2 A;  4BDZ A;  4PQU A;  2KQ2 A;  3L8B A;  2ZD1 A;  1SL0 A;  4PWD A;  4B9T A;  2FC0 A;  3L2W A;  4Q0B A;  4K8X A;  4CEE A;  4KTQ A;  3HXM A;  3VQ9 A;  4HVJ A;  2P5G A;  4JRP A;  2OPR A;  3S3N A;  1NK6 A;  3IAY A;  4KTZ A;  4OJR A;  2OPP A;  4FJ5 A;  1S6P A;  1VRU A;  2EX3 A;  4DTX A;  3MEE A;  2XY8 A;  2KZM A;  4C8L A;  5HRN A;  4M41 A;  4CJS A;  2HNZ A;  3LP3 A;  2XHB A;  2HMI A;  2XRI A;  3AVC A;  3K2P A;  4R5P A;  1EKE A;  2B5J A;  1D9D A;  1KSP A;  3DLB A;  4FJH A;  3AVH A;  4KHY A;  2B4J A;  4W5N A;  3TAE A;  4CEQ A;  1NK9 A;  2R7Y A;  4CES A;  4DSL A;  3K5L A;  4C8K A;  1TK8 A;  4OLB A;  1D9F A;  3K57 A;  3HST B;  2D0B A;  4CJ3 A;  4FCY A;  3KD1 E;  2A1R A;  1RT7 A;  3KK3 A;  3T1A A;  1HYZ A;  1Q9Y A;  3UIQ A;  1RDD A;  3SPY A;  3A2F A;  1RBR A;  1TAQ A;  3C95 A;  4B08 A;  3JSM A;  3AVF A;  4Y1D A;  1YTU A;  1NJY A;  1L3V A;  4KB1 A;  3AA5 X;  1CZB A;  3QER A;  4AHV A;  3LP2 A;  3NGZ A;  3SV3 A;  1C1B A;  3K59 A;  3VA0 A;  1QTM A;  4CJE A;  3K5N A;  1QE1 A;  2HW3 A;  3WNH A;  4RW8 A;  4DSI A;  4FJX A;  3QIP A;  3AV9 A;  3DLG A;  1VSK A;  4DTU A;  2FBY A;  1UA0 A;  3LPU A;  1B9D A;  4F2R A;  3TAR A;  3LAK A;  3OVN A;  4N47 A;  1ASU A;  3HPH A;  3OYK A;  4QOZ B;  1NKE A;  1HYS A;  2Q3S A;  4PY5 A;  1FK9 A;  3THV A;  3WNG A;  1UA1 A;  2PYL A;  3AVJ A;  4KFB A;  3SUO A;  4IFY A;  3ZSW A;  4DQP A;  3KJV A;  2IC3 A;  5DMR A;  2G8H A;  1RBU A;  4FZZ A;  5HRO A;  3KD5 E;  3KTQ A;  4CJW A;  4E7J A;  2F96 A;  3C6T A;  2WOM A;  2P51 A;  1Q9X A;  4M42 A;  3L3V A;  3SYZ A;  4IG3 A;  1JKH A;  3AO4 A;  5HRR A;  5KTQ A;  4DG1 A;  3NFA A;  4B8C A;  3MXM A;  1IH7 A;  1L3S A;  3V1R A;  3ZSZ A;  4AHS A;  1SUQ A;  4CF9 A;  2RPI A;  3AVN A;  4ELU A;  1BIU A;  4CGD A;  4Z0U A;  1RDA A;  4CJT A;  4CJV A;  1NK0 A;  1ZBL A;  4FYD A;  3HP9 A;  4M45 A;  4E7H A;  3OS0 A;  3QEV A;  4QCL A;  4CEB A;  4FZY A;  1TKX A;  1GOA A;  3F73 A;  3HYF A;  1LAW A;  3SQ4 A;  1ZBU A;  1JLQ A;  2JLE A;  4KHU A;  2YHB A;  3KKS A;  4E0D A;  2HHS A;  1QS4 A;  2NUB A;  4OKJ A;  1NJZ A;  1KLN A;  1MU2 A;  4ICL A;  1S6Q A;  4DTP A;  1SV5 A;  3FFI A;  4J2E A;  3IG1 A;  3NF7 A;  3VQQ A;  2YNF A;  3LAM A;  3HVR A;  3PX4 A;  1X9S A;  3AO5 A;  2E6M A;  3DLE A;  2EHG A;  4KI6 A;  2DFF A;  4FM0 A;  4B9S A;  1NJW A;  3OYL A;  2OPQ A;  1S1X A;  3QET A;  1QQC A;  5JS1 A;  1TGO A;  3MAQ A;  4M3U A;  5JS2 A;  4EP5 A;  3V9U A;  2AJQ A;  3ZSV A;  3PV8 A;  5J2N A;  1C0T A;  3QEX A;  3AVI A;  3SV4 A;  1BI4 A;  1WNS A;  1YTA A;  5KI6 A;  3ZT4 A;  1VSF A;  3LWM A;  3AVG A;  4E19 A;  1TK5 A;  3P1G A;  2IS3 A;  1KRP A;  5CYQ A;  3VQ7 A;  3D45 A;  4LH4 A;  3RMA A;  4FJN A;  2YNI A;  4RW4 A;  2Z1G A;  4CF8 A;  4FJ7 A;  2Z1H A;  5E41 A;  3OJS A;  1ZBI A;  3RRH A;  2WON A;  3VQ4 A;  4DF4 A;  1JXB A;  3IS9 A;  5FRO A;  5CY4 A;  3QIN A;  1CLQ A;  1KLM A;  2QK9 A;  3AVB A;  4FZX C;  1X9W A;  4HHT A;  4EZ6 A;  4KRE A;  3DRS A;  1S1U A;  4DSE A;  4DS5 A;  3S3O A;  4IBN A;  3ZT1 A;  2Z1J A;  4CEF A;  3HPO A;  3RTV A;  4FJ9 A;  4CEZ A;  3SUP A;  1U49 A;  3L2Q A;  2GBZ A;  4FLT A;  2PYJ A;  1X9M A;  4FJJ A;  1WSH A;  3ASM A;  3V9S A;  4FJL A;  4DSF A;  3AA2 A;  3AO3 A;  1TKD A;  3O3G A;  4Z4F A;  4RW9 A;  1S9G A;  4HUE A;  1S9E A;  4CIF A;  1JLF A;  3CFO A;  1REV A;  4CJL A;  5J1E A;  1WN7 A;  1NKC A;  2VG5 A;  4OPJ A;  1B9F A;  4I7F A;  4BAC A;  2BDP A;  1X1P A;  2BAN A;  2JGU A;  4CJP A;  3OYB A;  2GV9 A;  2XY5 A;  4B9U A;  3TAN A;  3TR8 A;  4JLH A;  2P5O A;  4M3Y A;  2O4G A;  2Y1J A;  3QO9 A;  1HNI A;  4O55 A;  3SCX A;  3LP0 A;  4DQQ A;  3F9K A;  4FW2 A;  5C42 A;  4ZHR A;  1RT5 A;  4NCG A;  3RMD A;  4B8A B;  1HQE A;  1WAF A;  4CHN A;  1QSY A;  1I39 A;  4N5S A;  4BE0 A;  4PUO A;  3V9X A;  4CFA A;  1WSI A;  4I2Q A;  4B3O A;  4FXD A;  1U4B A;  2G8I A;  2BGG A;  5CYM A;  2HNY A;  4CCH A;  2E4L A;  4B9L A;  3NGY A;  4M3W A;  3LAL A;  2DY4 A;  1KFS A;  1W0H A;  3OYI A;  1EP4 A;  4DMN A;  3TI0 A;  4HCC A;  1RTH A;  4FM1 A;  2HHQ A;  3LP1 A;  3MXJ A;  4KV8 A;  5HP1 A;  2YV0 X;  3HP6 A;  1U04 A;  2E6L A;  3ZSY A;  4AH9 A;  4FLY A;  2VG6 A;  4KO0 A;  4UQG A;  3VQA A;  3KLE A;  2OPS A;  4BE1 A;  1C1A A;  1JL1 A;  1RT4 A;  2G8V A;  4DSJ A;  2ZQB A;  2HB5 A;  1LV5 A;  1TAU A;  3V1Q A;  4CJK A;  4OPK A;  2G8U A;  3NE6 A;  4CHO A;  4FLW A;  3NDK A;  2HHT A;  3HPG A;  4M3R A;  3ZSO A;  3PX0 A;  3CM6 A;  3SQ0 A;  1WLJ A;  4Z4G A;  1JLA A;  5D3G A;  1RDC A;  3U3Y A;  3B6O A;  1QSS A;  3OYJ A;  5I42 A;  3O3H A;  2PY5 A;  4M3X A;  2KW4 A;  3C94 A;  3VQC A;  4KHN A;  3P83 D;  3PUF A;  3NH2 A;  3KLF A;  1IKX A;  4GW6 A;  4E7L A;  3DM2 A;  5I3U A;  1U47 A;  4OGE A;  4Z4C A;  4W5Q A;  4KRF A;  2VWJ A;  4CFC A;  4CHZ A;  4QAG A;  4N76 A;  2GUI A;  4W5O A;  4E3S A;  3AO1 A;  4IFV A;  3PO5 A;  3RR7 A;  3EY1 A;  4CF1 A;  4DFJ A;  4DFP A;  2ETJ A;  3NH1 A;  4LH5 A;  3DOL A;  1RT3 A;  4CGF A;  3VA3 A;  4FVM A;  5HRP A;  4KTW A;  4O0J A;  2VG7 A;  3V6D A;  3O3F A;  3H08 A;  4H4M A;  2OA8 A;  3M8P A;  1O1W A;  3NH0 A;  1SL2 A;  3RWU A;  1A5W A;  1J5O A;  1JLB A;  4JS5 A;  4J2A A;  4BDP A;  3QLH A;  2KTQ A;  1XC9 A;  4MFB A;  4HTU A;  4NYN A;  5K14 A;  3MED A;  3BDP A;  2YHA A;  3AVM A;  3SPZ A;  1J9A A;  4ID5 A;  1JLE A;  4I9L A;  1WSE A;  1D5A A;  5KGX A;  3LWL A;  1SL1 A;  3SNN A;  1J54 A;  4ZTF A;  4F8R A;  3B6P A;  4O4G A;  4IKF A;  3WNF A;  4RG8 A;  1GOB A;  1VSM A;  1JL2 A;  1CZ9 A;  2D0C A;  2QXF A;  2D0A A;  3ITH A;  4CE9 A;  4DQS A;  4GMJ B;  3RMB A;  2X74 A;  4E7K A;  1QSL A;  4EZ9 A;  4KAZ A;  2X6N A;  1HPZ A;  5J2Q A;  3HVT A;  3AVK A;  1T05 A;  1HJR A;  1UOC A;  3TAG A;  1HRH A;  4LY7 A;  3VQB A;  1T03 A;  2A1S A;  4K8Z A;  4M3T A;  2KZZ A;  2VWK A;  1TK0 A;  4L8R B;  5DK5 A;  1BCM A;  1BIZ A;  4CJQ A;  4KHS A;  1A5X A;  2DFE A;  3M8S A;  3ISN C;  4C8M A;  1NJX A;  3VQ5 A;  5KRT A;  3L2V A;  1SKS A;  4FLX A;  4CK3 A;  1L5U A;  4CJF A;  3KK1 A;  3O4Q A;  5C25 A;  3G10 A;  1Q8I A;  1JLG A;  1A5V A;  2QKK A;  5C24 A;  1TKT A;  3CYM A;  1Z25 A;  3VQ6 A;  3G0Z A;  1RBV A;  2Z1I A;  3U6F A;  4DF8 A;  2X6S A;  3SJJ A;  4NYF A;  3KLH A;  2D5R A;  3ALY A;  1UAX A;  3TAP A;  4RW7 A;  1IO2 A;  5HLF A;  4CK1 A;  4DWI A;  4EP4 A;  4FLZ A;  1JXE A;  4ZTJ A;  2RF2 A;  4FJI A;  1DTQ A;  1BCO A;  3V1O A;  3NGI A;  1FXX A;  4CGJ A;  2XO7 A;  3NAE A;  4AIL C;  1U45 A;  3LAN A;  1ITG A;  1BQN A;  3DLH A;  4W5T A;  3NCI A;  2ZE2 A;  1XHZ A;  4NCB A;  3AO2 A;  3V81 A;  2X78 A;  1VSH A;  4BWJ A;  2XY6 A;  4E89 A;  1F21 A;  1WSF A;  3NF9 A;  4OKE A;  1VSJ A;  3JYT A;  4DU4 A;  3V9W A;  3RRG A;  3ZCM A;  4CEA A;  3L2U A;  4OGC A;  3PO4 A;  3CG7 A;  4F4K A;  4H8K A;  3OY9 A;  1LAV A;  1TVR A;  4AHU A;  4CEC A;  1BIS A;  1KCF A;  2FBX A;  1ZBF A;  1RT6 A;  3MEC A;  3LZJ A;  1TV6 A;  1VSE A;  3QEI A;  3C6U A;  2ATQ A;  3OYC A;  1W9H A;  3OYF A;  2QKB A;  4N56 A;  1C1C A;  4FJM A;  3K58 A;  3DRR A;  1VK0 A;  4C8N A;  3KLI A;  1RIL A;  1C6V A;  2HND A;  4LSL A;  1HQU A;  4DFK A;  3PY8 A;  2OYQ A;  3DMJ A;  1KFD A;  4J2B A;  2P1J A;  2HVH A;  3DOK A;  4DS4 A;  1B92 A;  4N41 A;  4AHT A;  1LW0 A;  4MQ3 A;  4PA1 A;  4AHC A;  4CJ5 A;  1XHX A;  4DLE A;  4DFM A;  1S5J A;  3RR8 A;  2ITG A;  4C8O A;  3VQE A;  1EX4 A;  1Y97 A;  3VQ8 A;  3SQ1 A;  1TL1 A;  3TAB A;  1RT1 A;  3OYD A;  5KRS A;  3OS1 A;  3OYE A;  1RT2 A;  1VSI A;  2RKI A;  2IDO A;  3HL8 A;  2YNH A;  2HHW A;  1KVA A;  2PZS A;  4Z4H A;  5HRS A;  3KKR A;  3TWH A;  3OJU A;  1HMV A;  1D8Y A;  1LWF A;  3S9H A;  4DTS A;  3U3G A;  4O5B A;  3T3F A;  3NF8 A;  4JRQ A;  1QHT A;  1S1T A;  3P5J A;  3SUQ A;  1BI4 B;  2YKM A;  4H4O A;  1VRT A;  4CGG A;  3L2R A;  4Y1C A;  3BGR A;  3K5M A;  3CFP A;  3VQP A;  1BGX T;  4CFD A;  4O0I A;  3QNN A;  3MEG A;  3ZSX A;  4I9Q A;  4DTM A;  4CHQ A;  2W42 A;  4E1M A;  4FLV A;  3ZSQ A;  3LPT A;  3HO1 A;  3EYZ A;  1LWE A;  3ZT0 A;  4B9M A;  2G8W A;  3SQ2 A;  1ASV A;  1IKV A;  2HHX A;  1DLO A;  4FJK A;  3EZ5 A;  4FJG A;  3QNO A;  3QIO A;  3E01 A;  2LSN A;  1HYV A;  1SKW A;  4ELV A;  2IAJ A;  3I0R A;  1FKO A;  3OYH A;  3LZI A;  3L3U A;  1I3A A;  4XIU A;  4FLU A;  1T8E A; 
#chains in the Genus database with same CATH topology
 1KVB A;  4JS4 A;  3ULD A;  4LF9 K;  5AZJ B;  3ZET A;  1N5Y A;  1RCH A;  3CD6 N;  1EXQ A;  4DTO A;  2OTJ N;  5FDL A;  5E84 A;  3PX6 A;  4LF5 K;  3V4I A;  1HLU A;  3MN6 A;  3TSQ A;  2HHV A;  4YNQ A;  3M8R A;  3CM5 A;  2A41 A;  2O8E B;  3CER A;  1RDB A;  1HJO A;  3VER A;  4WFB L;  2B6A A;  4DR2 K;  2O8C B;  3RSE A;  4ID1 A;  5GIP A;  3DYA A;  5AQY A;  1VSD A;  2NRV A;  1WSG A;  1Q82 O;  3VET A;  3HOS A;  4CER A;  3I0S A;  3ZT2 A;  1CXU A;  4DU3 A;  1T6C A;  3M5R A;  2XY7 A;  4FJ8 A;  5C15 A;  4DU1 A;  4CK2 A;  2VYP A;  2Y1I A;  3V9Z A;  3THY B;  1JLC A;  2P9I A;  5HBM A;  4KI4 A;  5EU7 A;  4B1U B;  4K25 A;  3DLK A;  3KIO A;  3O8M A;  1LWC A;  3EZW A;  2HBL A;  3QEW A;  5JLF A;  1VSL A;  3ZSR A;  1RTD A;  3DAW A;  3HT3 A;  5A2Q O;  1CZA N;  1S1W A;  1YJW N;  4J2D A;  4ISE A;  4Q5V A;  2FBT A;  1Q86 O;  4ISF A;  4BVP A;  1DTT A;  1RBT A;  1WAJ A;  3K5O A;  3CCR N;  2DFH A;  1XWL A;  1ZC6 A;  3CHW A;  4CGH A;  2CH6 A;  1ZYQ A;  3HM9 A;  2ZJR L;  1RBS A;  3DXM B;  4IDK A;  1VQ8 N;  2F8T A;  1HNV A;  4FW1 A;  2YKN A;  3QML A;  4CD1 A;  2F8S A;  3HK2 A;  5IWA K;  4X65 K;  2IOC A;  4XH4 A;  2VGN A;  4OKK A;  1W97 L;  4Z4I A;  3SI6 A;  4B9V A;  1SKR A;  5CZ2 A;  2VWB A;  2BE2 A;  1L3U A;  2HHH K;  3EL2 A;  4IO8 A;  3CF5 L;  5SZT A;  2OZM A;  2W6K A;  1FKP A;  4PQU A;  5JLH A;  1X9J A;  3L8B A;  2ZD1 A;  4Q0B A;  4CEE A;  1NK6 A;  3CJ1 A;  4OJR A;  3EE9 A;  5AQQ A;  3EKS A;  3K2P A;  2QWM A;  2XRI A;  4JAX A;  2B5J A;  4A5A A;  5GAH P;  3JS6 A;  4R5P A;  1MA9 B;  3AVH A;  1KSP A;  3DLB A;  3TAE A;  4C1N K;  3VTH A;  3R8E A;  3J7Z O;  1TK8 A;  4Y0W A;  1RT7 A;  3KK3 A;  1WBB A;  1RDD A;  1YJN N;  4JK9 A;  4B08 A;  4KH6 A;  3JSM A;  3AVF A;  4Y1D A;  1E4F T;  4CBU A;  3J7Y P;  3QER A;  5AQZ A;  1X3N A;  3EKU A;  4QS9 A;  2QWP A;  3K5N A;  1QE1 A;  4FJX A;  1C0G A;  1VSK A;  4BRM A;  4KHP K;  2O8F B;  3LPU A;  4H0V B;  4PHT X;  1W2B M;  1IG8 A;  2HOE A;  3P31 A;  1UA1 A;  3AVJ A;  3ZSW A;  3KJV A;  4DQ8 A;  3KD5 E;  1R59 O;  2WOM A;  1Q9X A;  4M42 A;  3BZK A;  2VQF K;  4DUY K;  4IG3 A;  1EO1 A;  3BP8 A;  4JKA A;  1C0F A;  5F0X A;  3GE1 A;  4B8C A;  2HF3 A;  3CQY A;  3MCP A;  1L3S A;  3AVN A;  3LDO A;  4A2B A;  1ZXO A;  4IZ9 A;  2A6A A;  4Z0U A;  2ZM6 K;  1NK0 A;  1ZBL A;  2E88 A;  3HP9 A;  4E7H A;  1GLD G;  1XMO K;  1HNW K;  1RDU A;  4CW7 B;  2V51 B;  1ZBU A;  4KHU A;  2YHB A;  2OCE A;  4CVN E;  1KLN A;  4BRK A;  4ICL A;  1SV5 A;  4NB4 A;  2YNF A;  2F9W A;  3PX4 A;  3UKR A;  2E6M A;  4JI3 K;  1DT9 A;  3D6R A;  4M3U A;  3IUC A;  4EP5 A;  3F9M A;  3V9U A;  2AJQ A;  2O8B B;  3ZSV A;  2DPN A;  3PV8 A;  5J2N A;  3QEX A;  3SV4 A;  4JN4 A;  5KI6 A;  1WNS A;  1YTA A;  4CZG A;  2Q2R A;  3LWM A;  4E19 A;  3P1G A;  2IS3 A;  3C6A A;  3D45 A;  1DGK N;  4LH4 A;  4RW4 A;  5M1F A;  1HKB A;  1M90 O;  3RRH A;  1JXB A;  3LDP A;  3GG4 A;  3AVB A;  3MK6 A;  3KHY A;  4DS5 A;  4JKD A;  3HPO A;  3RTV A;  4FJ9 A;  4RTF D;  3SUP A;  5BRF A;  3AAP A;  4FLT A;  2PYJ A;  4FJL A;  3QBX A;  1TKD A;  1S9G A;  1WB9 A;  4LF6 K;  4B3R K;  3Q7C A;  2VG5 A;  4FWR A;  4BAC A;  1VQ4 N;  4JKG B;  3OYB A;  1E4G T;  1N34 K;  2FSK A;  4JK8 A;  2P5O A;  3QO9 A;  4O55 A;  3LP0 A;  2AP1 A;  1IJJ A;  5C42 A;  2ZF5 O;  4ZHR A;  4NCG A;  4JKC A;  4B8A B;  2WTU A;  1V4S A;  4BE0 A;  3IFR A;  4DR6 K;  4A2A A;  4CCH A;  2E4L A;  1HKC A;  1KFS A;  3LM2 A;  1N33 K;  3OYI A;  3WXJ A;  4DMN A;  3TI0 A;  4FM1 A;  4KV8 A;  3P38 A;  2P9L B;  1GLE G;  4IWV A;  4AH9 A;  3CPW M;  2VG6 A;  4FLY A;  3KLE A;  2OPS A;  2HMP A;  1K8K A;  2FSN A;  3WT0 A;  1Q18 A;  1NBW A;  3ZSO A;  4A61 A;  1XC3 A;  1WLJ A;  4Z4G A;  1JLA A;  3D2E A;  1RDC A;  3B6O A;  2KW4 A;  3KLF A;  4NCA A;  4E7L A;  3DM2 A;  4W5Q A;  4CFC A;  1HNX K;  4N76 A;  3THW A;  4W5O A;  2O8D B;  2CGK A;  3AGK A;  3AO1 A;  3RR7 A;  2UUB K;  3DOL A;  5FPN A;  2YJF A;  3VA3 A;  5LJW A;  5EX5 A;  2VG7 A;  3O3F A;  4WFN L;  4R79 A;  1BDG A;  1V4T A;  3RWU A;  1A5W A;  1JLB A;  3ZEU B;  1XC9 A;  4MFB A;  1OH7 A;  3J80 O;  3BDP A;  3O1W A;  3B8A X;  3R1X A;  3DWL A;  1SL1 A;  4F8R A;  2BH1 A;  4H5T A;  3CIP A;  5C12 A;  1QSL A;  1QQN A;  3THX B;  5KQD A;  4LY7 A;  1T03 A;  1NG9 A;  2KZZ A;  1TK0 A;  4L8R B;  2UUC K;  3CMA N;  4L3Q A;  5BR9 A;  4FPB A;  2UYT A;  3K0S A;  4CK3 A;  3O4Q A;  4CZE A;  2NZT A;  4QS7 A;  3MDQ A;  1U6Z A;  3FZK A;  1U2V A;  5AQT A;  4NYF A;  3ALY A;  2E2O A;  5BRD A;  3DXK B;  4EP4 A;  1NGH A;  4DKW A;  4FJI A;  4H0Y B;  4B1Z A;  2XO7 A;  1ITG A;  1BQN A;  2E2N A;  1IBL K;  2P9P B;  3AO2 A;  4FWN A;  4JHD A;  2XY6 A;  1E3M A;  3HSC A;  5BPN A;  3BF3 A;  3NF9 A;  4OKE A;  3JYT A;  4F4K A;  2F9T A;  3UB5 A;  4FWO A;  3O1B A;  3ATU A;  1BIS A;  3LZJ A;  2YHX A;  1TV6 A;  4CZH A;  4CZF A;  4JK7 A;  1C1C A;  3K58 A;  1NNE A;  4WQ5 A;  1RIL A;  4LSL A;  3PY8 A;  4DFK A;  3CC7 N;  2OYQ A;  5FPM A;  1Y64 A;  2P1J A;  5EVZ A;  4DS4 A;  4AHT A;  4DFM A;  3ATV A;  3VQE A;  5AZI B;  3VEV A;  3SQ1 A;  5CR4 A;  1EWQ A;  3VGL A;  3HL8 A;  1RDW X;  2P9S A;  2PZS A;  3OJU A;  1HMV A;  1D8Y A;  2NRX A;  5AQM A;  4CGG A;  4Y1C A;  3ID8 A;  4O0I A;  1BGX T;  4JKB A;  1QQO A;  2A3Z A;  4DR4 K;  4XH1 A;  5M1O A;  4CHQ A;  1LWE A;  4A62 A;  2G8W A;  1ASV A;  2CH5 A;  4FSV A;  4BR5 A;  4GV3 A;  3E01 A;  1SAZ A;  3TU5 A;  4ELV A;  2W41 A;  2ZGY A;  3A5N C;  3HZ6 A;  1I3A A;  4XIU A;  4LF7 K;  1T8E A;  1RNH A;  4OVL A;  4CHY A;  4X64 K;  3C7N A;  2RN2 A;  4XEI A;  4OO1 J;  4TSX A;  4M3Z A;  1BHL A;  1JCF A;  5J2M A;  4F3O A;  3WNE A;  2QA4 N;  4F3T A;  5J2P A;  3G25 A;  1C0U A;  4YFU A;  4BRE A;  1OH5 A;  3L4Q A;  1WBD A;  2HHU A;  4JEP A;  5GAD P;  5AQU A;  4HUF A;  4XH5 A;  2ZWH A;  3JAM O;  3RVC A;  3ZT3 A;  1NK8 A;  4CZM A;  2CGL A;  3WUH A;  3TTD A;  4G1Q A;  1TL3 A;  4KBO A;  1ZBH A;  1RTI A;  3O6W A;  2EWS A;  2I7P A;  4AHR A;  5CZ1 A;  4KH5 A;  2H3G X;  4MO5 A;  4ELT A;  4CF2 A;  4BRF A;  3OYN A;  2PAV A;  3LDQ A;  4GVM A;  1OH8 A;  3CFR A;  4FWQ A;  1YT3 A;  3LDS A;  3CQX A;  4KHW A;  3DRP A;  3U9D A;  1NLV A;  2IGI A;  3HBT A;  4IJA A;  3U8X A;  1RTJ A;  2GWK A;  4DSK A;  1VQP N;  4BE2 A;  4CHP A;  3NF6 A;  4Z4E A;  4M7X A;  2HVI A;  4ILG B;  4DTJ A;  3GDQ A;  1Q81 O;  3D2F B;  2FF3 B;  3KWG A;  4AF1 A;  3IRX A;  4LD0 A;  3ZET B;  2VQE K;  1IG9 A;  5FRM A;  3HJF A;  1J53 A;  1NOY A;  2HBK A;  5FPD A;  4B3S K;  1XQS C;  1C0M A;  3AVL A;  2KFN A;  3MN7 A;  4EZ9 A;  1I94 K;  4K8X A;  4BG8 A;  3G4S N;  3VQ9 A;  1KQS M;  4HVJ A;  3H3N O;  5LL6 Z;  3IAY A;  1GLL O;  4FJ5 A;  3RSE B;  5JMV A;  5AQI A;  3CET A;  4CJS A;  2HNZ A;  2XHB A;  2QM1 A;  4FJH A;  4KHY A;  3WXI A;  3FR0 A;  4C8K A;  1D9F A;  3H46 O;  3HST B;  3KD1 E;  1MDU B;  1YHQ N;  3UIQ A;  1HYZ A;  3SPY A;  3O9Q A;  1RBR A;  1TAQ A;  3C95 A;  2E2Q A;  5IT9 O;  1L3V A;  2QWR A;  4JNE A;  3SV3 A;  3TPQ A;  3O80 A;  2HW3 A;  4JD2 A;  3DLG A;  2FBY A;  4H03 B;  2UUA K;  1B9D A;  4DR1 K;  4F2R A;  3MN5 A;  1ZBS A;  3QIC A;  5AQX A;  3HPH A;  3OYK A;  2Q3S A;  2V52 B;  3THV A;  3WNG A;  2IC3 A;  5DMR A;  2G8H A;  5HRO A;  4DV6 K;  3KTQ A;  3L3V A;  3T1Y K;  1JKH A;  3AO4 A;  5KTQ A;  5BN8 A;  1SUQ A;  4GKJ K;  3VMF B;  2RPI A;  2OAN A;  4CF9 A;  4ELU A;  1BIU A;  4CGD A;  1RDA A;  4CJV A;  2Q36 A;  3QEV A;  1GOA A;  1LAW A;  3OBY A;  3SQ4 A;  2JLE A;  4DCH A;  1HX1 A;  2RHK A;  4JI2 K;  3ULE B;  2WBN A;  1S6Q A;  4DTP A;  3FFI A;  3IG1 A;  4WCE L;  3HVR A;  1XMQ K;  2HBJ A;  2JWL A;  3R6M A;  1O13 A;  2OPQ A;  4EIA A;  3TTC A;  3CJC A;  3QET A;  5JS2 A;  4ISG A;  4MO4 A;  4IJN A;  5C0Y A;  3AVI A;  2NLX A;  4JKH A;  3ZT4 A;  4YOU A;  1VSF A;  4DV3 K;  1KRP A;  3VQ7 A;  4FJN A;  3S41 A;  3SAF A;  4FO0 A;  2Z1H A;  5AJ3 K;  3LDL A;  3I33 A;  3OJS A;  2WON A;  4DF4 A;  3NVM A;  1BA0 A;  4H0O A;  5CY4 A;  1CLQ A;  1KLM A;  4K41 A;  4EZ6 A;  3DRS A;  1S1U A;  3S3O A;  4IBN A;  3ZT1 A;  2Z1J A;  4CEF A;  1SS6 A;  2P9L A;  3SLC A;  4AM6 A;  1U49 A;  5DM7 L;  2GBZ A;  3L2Q A;  4BC2 A;  3CXC M;  4M63 C;  5AZJ A;  1M1K O;  1X9M A;  5AQV A;  3V9S A;  4DSF A;  5F2R A;  4Z4F A;  1N36 K;  1JLF A;  4CD3 A;  1NKC A;  3VEO A;  2BAN A;  4FWS A;  4CJP A;  3E66 A;  2XY5 A;  3TAN A;  4JLH A;  4CZL A;  5C2F A;  4DQQ A;  5EY4 A;  2O8E A;  3MX5 A;  1RT5 A;  5AQF A;  3HRG A;  3CCQ N;  4EAH D;  1I39 A;  2O8C A;  3V9X A;  4CFA A;  2G8I A;  2FXU A;  2HNY A;  3NGY A;  1FJG K;  2DY4 A;  1W0H A;  1TUY A;  3CPE A;  4YOT A;  2ZJP L;  3LP1 A;  3MXJ A;  1T3V A;  4BR2 A;  4K0K K;  1RT4 A;  2G8V A;  1G99 A;  2ZQB A;  4FOE A;  1TAU A;  2GUP A;  3V1Q A;  4CJK A;  1TYQ A;  4CHO A;  4FLW A;  2HHT A;  3HPG A;  4K43 A;  3KZB A;  5BR8 K;  4DV4 K;  3AY9 A;  4FOI A;  5D3G A;  3OYJ A;  3O3H A;  3SBT A;  1U47 A;  1VQ7 N;  3DXM A;  4DV1 K;  2GUI A;  4H0P A;  2IVN A;  4E3S A;  3PO5 A;  5AQK A;  3EY1 A;  4DFJ A;  3FLC O;  4KTW A;  2OA8 A;  4U7B A;  2HBM A;  4JI7 K;  5I9E B;  3A0I X;  1SL2 A;  1J5O A;  5ELZ A;  3U4L A;  3SAG A;  4YY3 K;  4NYN A;  4B1X B;  4WQ4 A;  3SPZ A;  1J9A A;  4ID5 A;  4H5N A;  4I9L A;  1WSE A;  1D5A A;  2Q0U A;  1J54 A;  3T1H K;  3B6P A;  4RG8 A;  4GMJ B;  4KAZ A;  4PKH A;  3HOT A;  4YDU C;  3CCV N;  1HPZ A;  1T05 A;  3AVK A;  2D0O A;  2A1S A;  4K8Z A;  5BRE A;  4DR3 K;  3UKU B;  1LOT B;  5LY3 A;  3M8S A;  3ISN C;  3WQT A;  3VQ5 A;  5KRT A;  3L2V A;  4AM7 A;  1SKS A;  2F4V K;  5HL7 L;  3KK1 A;  5C25 A;  2QKK A;  1Q8I A;  3H3O B;  4QCL A;  3U6F A;  4DF8 A;  2X6S A;  4H5R A;  5EXW A;  1UAX A;  3TAP A;  4RW7 A;  1XUP O;  4DWI A;  4CK1 A;  4BG9 A;  3R9P A;  4ZTJ A;  2RF2 A;  2O8F A;  3V1O A;  3KVG A;  3D2E B;  3NCI A;  3V81 A;  1F21 A;  1X3M A;  4ILJ A;  4GY2 B;  4DU4 A;  3RRG A;  3ZCM A;  4CEA A;  3PO4 A;  4H8K A;  4BGA A;  3OY9 A;  1K9M O;  4CEC A;  3MMV A;  3MEC A;  5H1S Q;  4LF4 K;  3OYF A;  4N56 A;  3DRR A;  3KLI A;  2HND A;  1N32 K;  1HQU A;  3DMJ A;  4X66 K;  5GIO A;  1HPM A;  4IEI A;  5F1X A;  1K73 O;  3ZYY X;  2ITG A;  3CCM N;  5MLC Q;  2Q31 A;  3H6E A;  5KRS A;  2RKI A;  3QBW A;  4B3M K;  2IDO A;  3T69 A;  2YNH A;  4G9Z A;  1KVA A;  4BQZ A;  3KKR A;  3TWH A;  3AAR A;  4B1W B;  4DTS A;  4FPA A;  4O5B A;  3T3F A;  4JRQ A;  3O08 A;  1BI4 B;  3A5O C;  4F9O A;  3K5M A;  3FGU A;  3MEG A;  3ZSX A;  3CCS N;  4DTM A;  1QZ5 A;  3EYZ A;  3SQ2 A;  4BC3 A;  4FJK A;  1NGE A;  4ILH A;  4FJG A;  3QNO A;  3QIO A;  1U2V B;  4UY8 O;  4O5F A;  1SKW A;  2IAJ A;  1IBM K;  3LZI A;  5AQH A;  4H0X B;  1UWB A;  1EQY A;  4DLG A;  3SZ2 A;  2YNG A;  1GLF O;  2FBV A;  3OTO K;  1J5E K;  3NHG A;  4DR7 K;  4DV0 K;  4CBX A;  4E1N A;  3MXI A;  3M8Q A;  1BA1 A;  3O4N A;  4JKE A;  3TAQ A;  2ASP A;  3CCE N;  3AVA A;  4I2P A;  4JKG A;  1XNQ K;  2ASM A;  1G15 A;  1VHX A;  4BR4 A;  1BL3 A;  3FZM A;  4CJU A;  3QES A;  1NK7 A;  3SMS A;  1GOC A;  2KKZ A;  5SWM A;  3O4W A;  2P9K B;  4CGI A;  3C6H A;  4FK4 A;  2OZS A;  1YIT N;  4IG0 A;  3VTI A;  4AQY K;  5TKY A;  2ASO A;  4WE1 A;  1NOZ A;  3O9R A;  1WSJ A;  3T19 A;  1Z26 A;  2QW9 A;  4JI5 K;  4CED A;  4KKO A;  1KVC A;  5KGW A;  1EWR A;  4RW6 A;  4BDY A;  3AGR A;  5T7B A;  4IEE A;  2IVP A;  2G8K A;  3DLR A;  3KLG A;  3CME N;  1WOQ A;  1ASW A;  4YOR A;  4IFE A;  3KWI A;  3Q7B A;  4DTR A;  4B9Q A;  2WC9 A;  3CJ9 A;  3QEP A;  2DTU A;  5GAG P;  3J81 O;  4IO9 L;  5C10 A;  2O8D A;  3VQD A;  2VGM A;  3TAM A;  2O4I A;  1TKZ A;  2ZJQ L;  1QHA A;  4HCB A;  1YVN A;  4YHH K;  3FFK B;  3D0P A;  3K9J A;  4CJR A;  4KHQ A;  3NBP A;  1YVU A;  3OYA A;  3ZEU A;  3MN9 A;  3OYG A;  2E8A A;  2I7N A;  2KQ2 A;  2A40 A;  1SL0 A;  3L2W A;  2E1Y A;  3HXM A;  2P5G A;  2FF6 A;  1HUX A;  4JRP A;  3S3N A;  3CCU N;  3QFP A;  1S6P A;  1VRU A;  2EX3 A;  4DTX A;  3MEE A;  4LFB K;  2XY8 A;  2KZM A;  4C8L A;  5HRN A;  2NRW A;  3LP3 A;  3THX A;  5KPT A;  3QDK A;  4M7Y A;  1NGB A;  1NK9 A;  3HTV A;  3A8Y A;  4GVE A;  2AA4 A;  2R7Y A;  2WUS A;  4OLB A;  1P90 A;  3HI0 A;  3K57 A;  2D0B A;  4CJ3 A;  4DV5 K;  4FCY A;  3N4P A;  5AR0 A;  3T1A A;  1Q9Y A;  1ATN A;  2QWN A;  4KB1 A;  3AA5 X;  4NXM K;  3L4I A;  1NWK A;  4DSI A;  1MWK A;  3E1Y A;  4RW8 A;  3QIP A;  3DXK A;  3SBG A;  5M1Q A;  3TAR A;  3LAK A;  4CBW A;  3OVN A;  2P9N B;  1ASU A;  4N47 A;  5M1N A;  4QOZ B;  1NKE A;  1HYS A;  4PY5 A;  1H1V A;  1FK9 A;  4CZI A;  3PLA A;  5KPR A;  2PYL A;  4WQ5 C;  2NRT A;  3SUO A;  4Z94 A;  4IFY A;  4DQP A;  1RBU A;  4CJW A;  4E7J A;  2F96 A;  2YCH A;  3C6T A;  1QVF M;  1VQ5 N;  3SYZ A;  3BY5 A;  3CJ7 A;  5LJV A;  3NFA A;  4BRG A;  3MXM A;  1VQM N;  1IH7 A;  5JVG L;  1ATR A;  3OA9 A;  4FYD A;  4M45 A;  3ZLJ A;  4J8F A;  4CEB A;  4BQL A;  1JLQ A;  4E0D A;  2HHS A;  2E2P A;  3OHR A;  2NUB A;  1MU2 A;  2JWK A;  5M1P A;  3NF7 A;  2RE2 A;  5AZI A;  3VQQ A;  1X9S A;  4BRA A;  4I6M B;  3DLE A;  2EHG A;  4KI6 A;  2DFF A;  3LL3 A;  1S1X A;  1QQC A;  4BR9 A;  5JS1 A;  1GLC G;  4BRH A;  5ADX A;  4DHY A;  4BC4 A;  3AVG A;  4YOY A;  1TK5 A;  5CYQ A;  4MDA A;  3RMA A;  2YNI A;  2Z1G A;  4FJ7 A;  1JCG A;  3VQ4 A;  2P9U B;  3IS9 A;  4C1N I;  4LC9 B;  4FZX C;  1X9W A;  4HHT A;  3MX2 A;  4CEZ A;  1JJ2 M;  4BVO A;  5AFU A;  4FJJ A;  3AO3 A;  3F5T A;  3O3G A;  4RW9 A;  1S9E A;  3IDH A;  4CIF A;  3CFO A;  1REV A;  1KAX A;  2BDP A;  1X1P A;  2GV9 A;  4M3Y A;  3QB0 A;  2YHW A;  2Y1J A;  1HNI A;  3SCX A;  4B1Y B;  3F9K A;  4FW2 A;  4DB3 A;  3ID6 A;  5LMU K;  4O8U A;  1HQE A;  1WAF A;  2GX9 A;  4CHN A;  1YJ9 N;  4N5S A;  4FXD A;  3LM9 A;  1KD1 O;  1S3X A;  2QTD A;  4K42 A;  5AQS A;  3G71 N;  5AQJ A;  2UXD K;  1T6D A;  2HHQ A;  2P9I B;  2YV0 X;  5B8H A;  4BE1 A;  2CGJ A;  5BPM A;  3TSU A;  1NJI O;  3NE6 A;  2YI1 A;  4M3R A;  3CM6 A;  2F7T A;  1T44 A;  4JI1 K;  4A59 A;  3I55 N;  2PY5 A;  3C94 A;  4KHN A;  3P83 D;  3PUF A;  3NH2 A;  4GW6 A;  4NLB A;  4KRF A;  4OGE A;  4Z4C A;  5HOO A;  3E9O A;  3VF2 A;  1SZ2 A;  4CHZ A;  3D2F A;  4QAG A;  4A5B A;  3LDN A;  3NH1 A;  4LH5 A;  4CGF A;  1RT3 A;  4O0J A;  3V6D A;  3H08 A;  1BOT O;  1NU0 A;  3M8P A;  1O1W A;  4O8K A;  1OVQ A;  2KTQ A;  4HTU A;  4GKK K;  5K14 A;  3MED A;  2YHA A;  1JLE A;  4PKI A;  1GLA G;  3VEY A;  3ZX3 A;  4O4G A;  4IKF A;  3WNF A;  3K9K A;  2QXF A;  2D0C A;  3GBT A;  3IMX A;  4DQS A;  4HTL A;  5AQO A;  5J2Q A;  3F2K A;  4BC5 A;  3VQB A;  4M3T A;  2VWK A;  5DK5 A;  1BIZ A;  4CJQ A;  1A5X A;  2NRH A;  4C8M A;  3WEE A;  3L6Q A;  5AQG A;  2PFU A;  3VEN A;  5CHI A;  1L5U A;  4CJF A;  3G10 A;  1A5V A;  5C2D A;  5C24 A;  3CYM A;  3VQ6 A;  3DLL L;  2Z1I A;  4IDH A;  3SJJ A;  4WYB A;  1TYQ B;  2D5R A;  1NMD A;  3QFU A;  1JXE A;  1QZ6 A;  1TUU A;  3NGI A;  1FXX A;  3VPZ A;  4CGJ A;  4GNI A;  4AIL C;  3LAN A;  3DLH A;  2ZE2 A;  1XHZ A;  5AQR A;  4NCB A;  4GV9 A;  3HM8 A;  3U9Z A;  1DEJ A;  3L2U A;  1HR0 K;  1LAV A;  4DV2 K;  1KCF A;  2FBX A;  1ZBF A;  1NM1 A;  3QEI A;  2QWQ A;  2BUP A;  2ATQ A;  1W9H A;  2QKB A;  2HF4 A;  4C8N A;  4EFH A;  4BRD A;  4J2B A;  3VEX A;  2D0P A;  1KFD A;  3W3D A;  3DOK A;  4N41 A;  1B92 A;  1LW0 A;  4MQ3 A;  4AHC A;  4DLE A;  3H1V X;  1Y97 A;  3ULE A;  1BWF O;  3UKR B;  3TAB A;  1RT1 A;  3OYD A;  1YI2 N;  3VGK A;  1IV0 A;  3THY A;  1VSI A;  3CC2 N;  5BN9 A;  4Z4H A;  5HRS A;  4JYA K;  1S22 A;  1LWF A;  3U3G A;  1QHT A;  1S1T A;  3P5J A;  3SUQ A;  2YKM A;  1VRT A;  3L2R A;  4JI6 K;  3CFP A;  1VQL N;  3VQP A;  3QNN A;  4FWK A;  1N8R O;  4GV6 A;  3ZSQ A;  3FZL A;  3LPT A;  3HO1 A;  3CCJ N;  3ZT0 A;  4B9M A;  1IKV A;  4BRP A;  4YDU A;  3SJH A;  3EZ5 A;  2IIR A;  5EOY A;  3ENB A;  4X62 K;  3OYH A;  4H5V A;  1FW6 A;  4B9T A;  2E20 A;  4O44 A;  3WXM B;  3CQ8 A;  5FRN A;  1IKY A;  1ATS A;  4OLA A;  4DTN A;  4CI6 A;  5DM6 L;  3E9L A;  5ADX H;  4F2S A;  2G8F A;  2NRR A;  3ZX2 A;  1XI1 A;  1J6Z A;  3A5L C;  4BRI A;  4JI0 K;  3TSP A;  1IBK K;  5BPL A;  3OYM A;  1U48 A;  3ZX0 A;  5LMN K;  3AAQ A;  1BQM A;  4BRO A;  1YXQ A;  4BRC A;  1LW2 A;  1S1V A;  4B1V A;  5KPZ A;  1R0A A;  4HUG A;  2Q97 A;  3T7Z A;  4FWL A;  4BWM A;  4FL9 A;  4DR5 K;  3S3M A;  4KB0 A;  3J7A P;  3SAH A;  5GAE P;  1DKG D;  1N6Q A;  1NKB A;  5JIC A;  2I5J A;  5AFU H;  3C65 A;  3WXL A;  4CFB A;  5JVH L;  3SUN A;  1VQO N;  2IVO A;  4YOV A;  3BUZ B;  4YOW A;  3ENH A;  3DI6 A;  4FM2 A;  4KH4 A;  1NK4 A;  2GEM A;  2NRZ A;  4CEO A;  3I8D A;  3EN9 A;  1K8K B;  4CJ4 A;  4JKF A;  3MWT A;  4B9N A;  4E7I A;  4YOX A;  4CZJ A;  4CIG A;  4LSN A;  2E5L K;  3AA4 A;  3MCA B;  4DQR A;  1BUP A;  1EET A;  5KQ8 A;  5FLX O;  3PIP L;  3BF1 A;  4JV5 K;  2QEX N;  4KPY A;  3D7E O;  4FK2 A;  4RWT A;  4PKG A;  4NLC A;  3KK2 A;  5M1K A;  5AQW A;  5TKW A;  1CXQ A;  2UU9 K;  1IKW A;  4BRN A;  4W5R A;  3THW B;  2ITM A;  4CF0 A;  1NGD A;  3J8A A;  4E1J A;  4WQ4 C;  4EHU A;  3VN5 A;  3L0Q A;  4FVU A;  4OPH A;  1RFQ A;  2J4R A;  4NO7 A;  3TAF A;  4FK0 A;  1L3T A;  1D4X A;  2GTD A;  3AA3 A;  3PSF A;  1NK5 A;  3RMC A;  4DQI A;  2KFZ A;  3CJB A;  4CIE A;  1KTQ A;  3G6E N;  1K6Y A;  1T7P A;  3OS2 A;  4JI8 K;  4BDZ A;  1OVY A;  4PWD A;  2FC0 A;  3FZH A;  3OBW A;  4KTQ A;  1QVG M;  1BG3 A;  2OPR A;  4KTZ A;  2OPP A;  3M6G A;  4WF9 L;  4NXN K;  4M41 A;  5E26 A;  2HMI A;  1Z05 A;  3AVC A;  1D9D A;  2O8B A;  1EKE A;  2QXL A;  2B4J A;  3CC4 N;  4W5N A;  4CEQ A;  4A57 A;  1NGF A;  4HWI A;  1JCE A;  4CES A;  4DSL A;  3K5L A;  3GOI A;  3UKU A;  1K8A O;  4FWM A;  2A1R A;  4OX9 K;  3CI5 A;  3A2F A;  1GLB G;  1YTU A;  1KAY A;  1NJY A;  1CZB A;  3P4I A;  4AHV A;  3LP2 A;  3NGZ A;  1BO5 O;  1C1B A;  3K59 A;  3VA0 A;  1QTM A;  4CJE A;  3WNH A;  2UXC K;  4DTU A;  3AV9 A;  1UA0 A;  1VQ9 N;  2V7Y A;  3O5B A;  1S72 N;  3VF6 A;  4JHD B;  4KFB A;  2Q0R A;  4FZZ A;  3GL1 A;  3OW2 M;  4DV7 K;  2P51 A;  2GWJ A;  5HRR A;  3SMP A;  4DG1 A;  3NMU A;  4H0T B;  3V1R A;  3ZSZ A;  4AHS A;  3PIO L;  1ILY A;  3NVK A;  4CJT A;  4H5W A;  3OS0 A;  4FZY A;  1TKX A;  3F73 A;  3HYF A;  3N4Q A;  3KKS A;  3TTF A;  1QS4 A;  1OH6 A;  4OKJ A;  5AQL A;  1NJZ A;  2A42 A;  1RGI A;  4J2E A;  4BRL A;  3LAM A;  3AO5 A;  4U67 L;  2QWO A;  1VQN N;  4FM0 A;  4B9S A;  1NJW A;  1HKG A;  3OYL A;  2P9S B;  1GLJ O;  1TGO A;  3MAQ A;  1NGC A;  2A5X A;  1C0T A;  3A5M C;  4QS8 A;  4LFC K;  1BI4 A;  4CJ7 A;  4FWP A;  4C23 A;  3H1Q A;  4MLH A;  5CE3 A;  4BY9 C;  4CF8 A;  5E41 A;  1ZBI A;  4IOX A;  1YIJ N;  2PBD A;  1KXP A;  5FRO A;  3QIN A;  2QK9 A;  1NGJ A;  4KRE A;  4DSE A;  2QI2 A;  2YJE A;  3C7N B;  3O9U A;  1WSH A;  3ASM A;  3AA2 A;  2KHO A;  3FZF A;  4HUE A;  3UE5 A;  4CJL A;  4OPA A;  5J1E A;  1WN7 A;  4OPJ A;  1B9F A;  4I7F A;  2JGU A;  4B9U A;  3TR8 A;  2O4G A;  1YUW A;  5FPE A;  3RMD A;  1QSY A;  1Z6R A;  2VCP A;  3M1F A;  4PUO A;  1WSI A;  4I2Q A;  4B3O A;  1U4B A;  2BGG A;  5CYM A;  3O9S A;  5AQN A;  2P9K A;  4B9L A;  4M3W A;  3LAL A;  4DUZ K;  1EP4 A;  1NGA A;  4HCC A;  1KC8 O;  1RTH A;  1ESV A;  5HP1 A;  1SQK A;  1NMN A;  3HP6 A;  1U04 A;  2E6L A;  3ZSY A;  4KO0 A;  4UQG A;  3VQA A;  1C1A A;  1JL1 A;  3JXU A;  3MWP A;  3WXK A;  4DSJ A;  2HB5 A;  1LV5 A;  4OPK A;  2G8U A;  2D1K A;  3KK7 A;  3NDK A;  3VOV A;  3W0L A;  4LFA K;  3PSI A;  3PX0 A;  3EEQ A;  3SQ0 A;  1KAZ A;  3U3Y A;  4M3X A;  1QSS A;  5I42 A;  1VQ6 N;  3VQC A;  2P9P A;  5I3U A;  1IKX A;  3E9P A;  2HST A;  4RCH A;  2VWJ A;  4BR0 A;  4PL8 A;  3IKM A;  4IFV A;  2KLA A;  4CF1 A;  4DFP A;  2ETJ A;  2FLO A;  4FVM A;  5HRP A;  5BRH A;  2V7Z A;  3O9T A;  4H4M A;  3NH0 A;  3WQU A;  4CZK A;  4JS5 A;  3SK3 A;  4J2A A;  4BDP A;  3QLH A;  3EE8 A;  3ENO A;  3AVM A;  2YX6 A;  2BTF A;  5KGX A;  3M3Z A;  3LWL A;  2WFB A;  3SNN A;  4ZTF A;  4JI4 K;  1GOB A;  2Q1N A;  2YHY A;  1VSM A;  1JL2 A;  1CZ9 A;  3I56 N;  1QQM A;  2D0A A;  3ITH A;  2GEL A;  2QWL A;  2FSJ A;  2X74 A;  4BGB A;  4CE9 A;  4PL7 A;  4E7K A;  2X6N A;  5AQP A;  3FE1 A;  3HVT A;  3I8B A;  1HJR A;  1UOC A;  3TAG A;  1HRH A;  4WFA L;  4LF8 K;  2NNW A;  1BCM A;  4KHS A;  2DFE A;  2UXB K;  1MWM A;  1YAG A;  1NJX A;  3EO3 A;  4EHT A;  4FLX A;  4MLE A;  1JLG A;  1VQK N;  1TKT A;  1Z25 A;  3CJA A;  5GIN A;  3G0Z A;  1RBV A;  3VGM A;  3KLH A;  2D4W A;  4JD2 B;  1YF5 L;  1IO2 A;  5HLF A;  4IOC L;  4FLZ A;  3VEZ A;  1LCU A;  1DTQ A;  1BCO A;  4BRQ A;  1U45 A;  3NAE A;  2P9N A;  1HNZ K;  4IXC A;  4W5T A;  4V19 S;  1OKJ A;  2X78 A;  1VSH A;  4BWJ A;  3RMB A;  3R3L A;  4E89 A;  1WSF A;  1VSJ A;  3V9W A;  1XNR K;  4OGC A;  3CG7 A;  1BU6 O;  1TVR A;  4AHU A;  2OTL N;  1RT6 A;  1VSE A;  3C6U A;  3OYC A;  2W40 A;  4FJM A;  1VK0 A;  1C6V A;  2HVH A;  4PA1 A;  4CJ5 A;  3RR8 A;  1XHX A;  4C8O A;  4IOA L;  1S5J A;  1EX4 A;  3VQ8 A;  4BR7 A;  1P8Z A;  1TL1 A;  3H45 C;  3CCL N;  3OS1 A;  3OYE A;  1RT2 A;  4I6M A;  4MDB A;  1NGI A;  3BZC A;  2HHW A;  1VAZ A;  4B3T K;  1W7A A;  3VES A;  3S9H A;  3DJC A;  3VF4 A;  2ZGZ A;  3NF8 A;  4H4O A;  3BGR A;  1WUA A;  3WEE B;  4CFD A;  3P39 A;  2E1Z A;  4I9Q A;  2W42 A;  3VEW A;  4E1M A;  3BEX A;  4FLV A;  1Q7Y O;  1NGG A;  2HHX A;  1DLO A;  2W6L A;  2P9U A;  2LSN A;  1HYV A;  3I0R A;  1FKO A;  3C0B A;  4FLU A;  3L3U A; 
#chains in the Genus database with same CATH homology
 1UWB A;  1KVB A;  1RNH A;  4OVL A;  4JS4 A;  4O44 A;  3CQ8 A;  4CHY A;  3ULD A;  4DLG A;  2YNG A;  3SZ2 A;  2FBV A;  5FRN A;  1IKY A;  1N5Y A;  2RN2 A;  4OLA A;  1RCH A;  3NHG A;  4DTN A;  4TSX A;  1EXQ A;  4E1N A;  4DTO A;  3MXI A;  3M8Q A;  4F2S A;  1BHL A;  4M3Z A;  5J2M A;  5FDL A;  2G8F A;  3WNE A;  3PX6 A;  4F3O A;  4F3T A;  5J2P A;  1C0U A;  4YFU A;  3O4N A;  1XI1 A;  3TAQ A;  3AVA A;  4I2P A;  3V4I A;  2HHV A;  3OYM A;  4YNQ A;  1U48 A;  1G15 A;  3M8R A;  2HHU A;  3CM5 A;  1BL3 A;  1BQM A;  4HUF A;  4CJU A;  3QES A;  1LW2 A;  1S1V A;  1R0A A;  1NK7 A;  1RDB A;  4HUG A;  2B6A A;  4BWM A;  4KB0 A;  3S3M A;  1GOC A;  4ID1 A;  5SWM A;  3ZT3 A;  3DYA A;  4NCA A;  1VSD A;  1NK8 A;  1N6Q A;  1NKB A;  1WSG A;  2I5J A;  3SUN A;  4CFB A;  4CGI A;  4CER A;  4FK4 A;  3I0S A;  4G1Q A;  1TL3 A;  3ZT2 A;  1CXU A;  4DU3 A;  2XY7 A;  2OZS A;  4FJ8 A;  3DI6 A;  4FM2 A;  4DU1 A;  1ZBH A;  1RTI A;  4IG0 A;  4CK2 A;  1NK4 A;  4AHR A;  5CZ1 A;  2Y1I A;  3V9Z A;  1JLC A;  5HBM A;  4CEO A;  4ELT A;  4WE1 A;  4CF2 A;  1NOZ A;  4KI4 A;  5EU7 A;  3OYN A;  3I8D A;  1WSJ A;  3DLK A;  3T19 A;  1Z26 A;  4GVM A;  3KIO A;  4CJ4 A;  1LWC A;  4B9N A;  3QEW A;  1VSL A;  3CFR A;  4CED A;  4E7I A;  4KKO A;  3ZSR A;  1RTD A;  3HT3 A;  1YT3 A;  4CIG A;  1S1W A;  1KVC A;  4LSN A;  5KGW A;  3DRP A;  3LDS A;  3AA4 A;  4J2D A;  4KHW A;  4RW6 A;  2IGI A;  4Q5V A;  2FBT A;  4DQR A;  1EET A;  4BDY A;  1RTJ A;  5T7B A;  1DTT A;  1RBT A;  1WAJ A;  3DLR A;  3K5O A;  3KLG A;  2G8K A;  4DSK A;  4KPY A;  2DFH A;  4BE2 A;  4FK2 A;  1XWL A;  1ASW A;  4CHP A;  3NF6 A;  3KK2 A;  4Z4E A;  4CGH A;  4DTR A;  2HVI A;  1ZYQ A;  3HM9 A;  4DTJ A;  1CXQ A;  1RBS A;  4IDK A;  1IKW A;  2F8T A;  1HNV A;  4W5R A;  4FW1 A;  2YKN A;  3QEP A;  2F8S A;  4CF0 A;  3HK2 A;  2DTU A;  3IRX A;  2IOC A;  3VQD A;  4OKK A;  3VN5 A;  4Z4I A;  3TAM A;  3SI6 A;  4B9V A;  1TKZ A;  1SKR A;  4HCB A;  5CZ2 A;  2O4I A;  4LD0 A;  1IG9 A;  5FRM A;  3D0P A;  3TAF A;  4FK0 A;  1J53 A;  2BE2 A;  1L3T A;  1NOY A;  3HJF A;  3AA3 A;  4CJR A;  1L3U A;  1NK5 A;  3RMC A;  4DQI A;  4KHQ A;  2KFZ A;  4CIE A;  3NBP A;  1C0M A;  1KTQ A;  3AVL A;  5SZT A;  1YVU A;  3OYA A;  2KFN A;  1K6Y A;  2OZM A;  1FKP A;  3OYG A;  1T7P A;  3OS2 A;  4BDZ A;  4PQU A;  2KQ2 A;  3L8B A;  2ZD1 A;  1SL0 A;  4PWD A;  4B9T A;  2FC0 A;  3L2W A;  4Q0B A;  4K8X A;  4CEE A;  4KTQ A;  3HXM A;  3VQ9 A;  4HVJ A;  2P5G A;  4JRP A;  2OPR A;  3S3N A;  1NK6 A;  3IAY A;  4KTZ A;  4OJR A;  2OPP A;  4FJ5 A;  1S6P A;  1VRU A;  2EX3 A;  4DTX A;  3MEE A;  2XY8 A;  2KZM A;  4C8L A;  5HRN A;  4M41 A;  4CJS A;  2HNZ A;  3LP3 A;  2XHB A;  2HMI A;  2XRI A;  3AVC A;  3K2P A;  4R5P A;  1EKE A;  2B5J A;  1D9D A;  1KSP A;  3DLB A;  4FJH A;  3AVH A;  4KHY A;  2B4J A;  4W5N A;  3TAE A;  4CEQ A;  1NK9 A;  2R7Y A;  4CES A;  4DSL A;  3K5L A;  4C8K A;  1TK8 A;  4OLB A;  1D9F A;  3K57 A;  3HST B;  2D0B A;  4CJ3 A;  4FCY A;  3KD1 E;  2A1R A;  1RT7 A;  3KK3 A;  3T1A A;  1HYZ A;  1Q9Y A;  3UIQ A;  1RDD A;  3SPY A;  3A2F A;  1RBR A;  1TAQ A;  3C95 A;  4B08 A;  3JSM A;  3AVF A;  4Y1D A;  1YTU A;  1NJY A;  1L3V A;  4KB1 A;  3AA5 X;  1CZB A;  3QER A;  4AHV A;  3LP2 A;  3NGZ A;  3SV3 A;  1C1B A;  3K59 A;  3VA0 A;  1QTM A;  4CJE A;  3K5N A;  1QE1 A;  2HW3 A;  3WNH A;  4RW8 A;  4DSI A;  4FJX A;  3QIP A;  3AV9 A;  3DLG A;  1VSK A;  4DTU A;  2FBY A;  1UA0 A;  3LPU A;  1B9D A;  4F2R A;  3TAR A;  3LAK A;  3OVN A;  4N47 A;  1ASU A;  3HPH A;  3OYK A;  4QOZ B;  1NKE A;  1HYS A;  2Q3S A;  4PY5 A;  1FK9 A;  3THV A;  3WNG A;  1UA1 A;  2PYL A;  3AVJ A;  4KFB A;  3SUO A;  4IFY A;  3ZSW A;  4DQP A;  3KJV A;  2IC3 A;  5DMR A;  2G8H A;  1RBU A;  4FZZ A;  5HRO A;  3KD5 E;  3KTQ A;  4CJW A;  4E7J A;  2F96 A;  3C6T A;  2WOM A;  2P51 A;  1Q9X A;  4M42 A;  3L3V A;  3SYZ A;  4IG3 A;  1JKH A;  3AO4 A;  5HRR A;  5KTQ A;  4DG1 A;  3NFA A;  4B8C A;  3MXM A;  1IH7 A;  1L3S A;  3V1R A;  3ZSZ A;  4AHS A;  1SUQ A;  4CF9 A;  2RPI A;  3AVN A;  4ELU A;  1BIU A;  4CGD A;  4Z0U A;  1RDA A;  4CJT A;  4CJV A;  1NK0 A;  1ZBL A;  4FYD A;  3HP9 A;  4M45 A;  4E7H A;  3OS0 A;  3QEV A;  4QCL A;  4CEB A;  4FZY A;  1TKX A;  1GOA A;  3F73 A;  3HYF A;  1LAW A;  3SQ4 A;  1ZBU A;  1JLQ A;  2JLE A;  4KHU A;  2YHB A;  3KKS A;  4E0D A;  2HHS A;  1QS4 A;  2NUB A;  4OKJ A;  1NJZ A;  1KLN A;  1MU2 A;  4ICL A;  1S6Q A;  4DTP A;  1SV5 A;  3FFI A;  4J2E A;  3IG1 A;  3NF7 A;  3VQQ A;  2YNF A;  3LAM A;  3HVR A;  3PX4 A;  1X9S A;  3AO5 A;  2E6M A;  3DLE A;  2EHG A;  4KI6 A;  2DFF A;  4FM0 A;  4B9S A;  1NJW A;  3OYL A;  2OPQ A;  1S1X A;  3QET A;  1QQC A;  5JS1 A;  1TGO A;  3MAQ A;  4M3U A;  5JS2 A;  4EP5 A;  3V9U A;  2AJQ A;  3ZSV A;  3PV8 A;  5J2N A;  1C0T A;  3QEX A;  3AVI A;  3SV4 A;  1BI4 A;  1WNS A;  1YTA A;  5KI6 A;  3ZT4 A;  1VSF A;  3LWM A;  3AVG A;  4E19 A;  1TK5 A;  3P1G A;  2IS3 A;  1KRP A;  5CYQ A;  3VQ7 A;  3D45 A;  4LH4 A;  3RMA A;  4FJN A;  2YNI A;  4RW4 A;  2Z1G A;  4CF8 A;  4FJ7 A;  2Z1H A;  5E41 A;  3OJS A;  1ZBI A;  3RRH A;  2WON A;  3VQ4 A;  4DF4 A;  1JXB A;  3IS9 A;  5FRO A;  5CY4 A;  3QIN A;  1CLQ A;  1KLM A;  2QK9 A;  3AVB A;  4FZX C;  1X9W A;  4HHT A;  4EZ6 A;  4KRE A;  3DRS A;  1S1U A;  4DSE A;  4DS5 A;  3S3O A;  4IBN A;  3ZT1 A;  2Z1J A;  4CEF A;  3HPO A;  3RTV A;  4FJ9 A;  4CEZ A;  3SUP A;  1U49 A;  3L2Q A;  2GBZ A;  4FLT A;  2PYJ A;  1X9M A;  4FJJ A;  1WSH A;  3ASM A;  3V9S A;  4FJL A;  4DSF A;  3AA2 A;  3AO3 A;  1TKD A;  3O3G A;  4Z4F A;  4RW9 A;  1S9G A;  4HUE A;  1S9E A;  4CIF A;  1JLF A;  3CFO A;  1REV A;  4CJL A;  5J1E A;  1WN7 A;  1NKC A;  2VG5 A;  4OPJ A;  1B9F A;  4I7F A;  4BAC A;  2BDP A;  1X1P A;  2BAN A;  2JGU A;  4CJP A;  3OYB A;  2GV9 A;  2XY5 A;  4B9U A;  3TAN A;  3TR8 A;  4JLH A;  2P5O A;  4M3Y A;  2O4G A;  2Y1J A;  3QO9 A;  1HNI A;  4O55 A;  3SCX A;  3LP0 A;  4DQQ A;  3F9K A;  4FW2 A;  5C42 A;  4ZHR A;  1RT5 A;  4NCG A;  3RMD A;  4B8A B;  1HQE A;  1WAF A;  4CHN A;  1QSY A;  1I39 A;  4N5S A;  4BE0 A;  4PUO A;  3V9X A;  4CFA A;  1WSI A;  4I2Q A;  4B3O A;  4FXD A;  1U4B A;  2G8I A;  2BGG A;  5CYM A;  2HNY A;  4CCH A;  2E4L A;  4B9L A;  3NGY A;  4M3W A;  3LAL A;  2DY4 A;  1KFS A;  1W0H A;  3OYI A;  1EP4 A;  4DMN A;  3TI0 A;  4HCC A;  1RTH A;  4FM1 A;  2HHQ A;  3LP1 A;  3MXJ A;  4KV8 A;  5HP1 A;  2YV0 X;  3HP6 A;  1U04 A;  2E6L A;  3ZSY A;  4AH9 A;  4FLY A;  2VG6 A;  4KO0 A;  4UQG A;  3VQA A;  3KLE A;  2OPS A;  4BE1 A;  1C1A A;  1JL1 A;  1RT4 A;  2G8V A;  4DSJ A;  2ZQB A;  2HB5 A;  1LV5 A;  1TAU A;  3V1Q A;  4CJK A;  4OPK A;  2G8U A;  3NE6 A;  4CHO A;  4FLW A;  3NDK A;  2HHT A;  3HPG A;  4M3R A;  3ZSO A;  3PX0 A;  3CM6 A;  3SQ0 A;  1WLJ A;  4Z4G A;  1JLA A;  5D3G A;  1RDC A;  3U3Y A;  3B6O A;  1QSS A;  3OYJ A;  5I42 A;  3O3H A;  2PY5 A;  4M3X A;  2KW4 A;  3C94 A;  3VQC A;  4KHN A;  3P83 D;  3PUF A;  3NH2 A;  3KLF A;  1IKX A;  4GW6 A;  4E7L A;  3DM2 A;  5I3U A;  1U47 A;  4OGE A;  4Z4C A;  4W5Q A;  4KRF A;  2VWJ A;  4CFC A;  4CHZ A;  4QAG A;  4N76 A;  2GUI A;  4W5O A;  4E3S A;  3AO1 A;  4IFV A;  3PO5 A;  3RR7 A;  3EY1 A;  4CF1 A;  4DFJ A;  4DFP A;  2ETJ A;  3NH1 A;  4LH5 A;  3DOL A;  1RT3 A;  4CGF A;  3VA3 A;  4FVM A;  5HRP A;  4KTW A;  4O0J A;  2VG7 A;  3V6D A;  3O3F A;  3H08 A;  4H4M A;  2OA8 A;  3M8P A;  1O1W A;  3NH0 A;  1SL2 A;  3RWU A;  1A5W A;  1J5O A;  1JLB A;  4JS5 A;  4J2A A;  4BDP A;  3QLH A;  2KTQ A;  1XC9 A;  4MFB A;  4HTU A;  4NYN A;  5K14 A;  3MED A;  3BDP A;  2YHA A;  3AVM A;  3SPZ A;  1J9A A;  4ID5 A;  1JLE A;  4I9L A;  1WSE A;  1D5A A;  5KGX A;  3LWL A;  1SL1 A;  3SNN A;  1J54 A;  4ZTF A;  4F8R A;  3B6P A;  4O4G A;  4IKF A;  3WNF A;  4RG8 A;  1GOB A;  1VSM A;  1JL2 A;  1CZ9 A;  2D0C A;  2QXF A;  2D0A A;  3ITH A;  4CE9 A;  4DQS A;  4GMJ B;  3RMB A;  2X74 A;  4E7K A;  1QSL A;  4EZ9 A;  4KAZ A;  2X6N A;  1HPZ A;  5J2Q A;  3HVT A;  3AVK A;  1T05 A;  1HJR A;  1UOC A;  3TAG A;  1HRH A;  4LY7 A;  3VQB A;  1T03 A;  2A1S A;  4K8Z A;  4M3T A;  2KZZ A;  2VWK A;  1TK0 A;  4L8R B;  5DK5 A;  1BCM A;  1BIZ A;  4CJQ A;  4KHS A;  1A5X A;  2DFE A;  3M8S A;  3ISN C;  4C8M A;  1NJX A;  3VQ5 A;  5KRT A;  3L2V A;  1SKS A;  4FLX A;  4CK3 A;  1L5U A;  4CJF A;  3KK1 A;  3O4Q A;  5C25 A;  3G10 A;  1Q8I A;  1JLG A;  1A5V A;  2QKK A;  5C24 A;  1TKT A;  3CYM A;  1Z25 A;  3VQ6 A;  3G0Z A;  1RBV A;  2Z1I A;  3U6F A;  4DF8 A;  2X6S A;  3SJJ A;  4NYF A;  3KLH A;  2D5R A;  3ALY A;  1UAX A;  3TAP A;  4RW7 A;  1IO2 A;  5HLF A;  4CK1 A;  4DWI A;  4EP4 A;  4FLZ A;  1JXE A;  4ZTJ A;  2RF2 A;  4FJI A;  1DTQ A;  1BCO A;  3V1O A;  3NGI A;  1FXX A;  4CGJ A;  2XO7 A;  3NAE A;  4AIL C;  1U45 A;  3LAN A;  1ITG A;  1BQN A;  3DLH A;  4W5T A;  3NCI A;  2ZE2 A;  1XHZ A;  4NCB A;  3AO2 A;  3V81 A;  2X78 A;  1VSH A;  4BWJ A;  2XY6 A;  4E89 A;  1F21 A;  1WSF A;  3NF9 A;  4OKE A;  1VSJ A;  3JYT A;  4DU4 A;  3V9W A;  3RRG A;  3ZCM A;  4CEA A;  3L2U A;  4OGC A;  3PO4 A;  3CG7 A;  4F4K A;  4H8K A;  3OY9 A;  1LAV A;  1TVR A;  4AHU A;  4CEC A;  1BIS A;  1KCF A;  2FBX A;  1ZBF A;  1RT6 A;  3MEC A;  3LZJ A;  1TV6 A;  1VSE A;  3QEI A;  3C6U A;  2ATQ A;  3OYC A;  1W9H A;  3OYF A;  2QKB A;  4N56 A;  1C1C A;  4FJM A;  3K58 A;  3DRR A;  1VK0 A;  4C8N A;  3KLI A;  1RIL A;  1C6V A;  2HND A;  4LSL A;  1HQU A;  4DFK A;  3PY8 A;  2OYQ A;  3DMJ A;  1KFD A;  4J2B A;  2P1J A;  2HVH A;  3DOK A;  4DS4 A;  1B92 A;  4N41 A;  4AHT A;  1LW0 A;  4MQ3 A;  4PA1 A;  4AHC A;  4CJ5 A;  1XHX A;  4DLE A;  4DFM A;  1S5J A;  3RR8 A;  2ITG A;  4C8O A;  3VQE A;  1EX4 A;  1Y97 A;  3VQ8 A;  3SQ1 A;  1TL1 A;  3TAB A;  1RT1 A;  3OYD A;  5KRS A;  3OS1 A;  3OYE A;  1RT2 A;  1VSI A;  2RKI A;  2IDO A;  3HL8 A;  2YNH A;  2HHW A;  1KVA A;  2PZS A;  4Z4H A;  5HRS A;  3KKR A;  3TWH A;  3OJU A;  1HMV A;  1D8Y A;  1LWF A;  3S9H A;  4DTS A;  3U3G A;  4O5B A;  3T3F A;  3NF8 A;  4JRQ A;  1QHT A;  1S1T A;  3P5J A;  3SUQ A;  1BI4 B;  2YKM A;  4H4O A;  1VRT A;  4CGG A;  3L2R A;  4Y1C A;  3BGR A;  3K5M A;  3CFP A;  3VQP A;  1BGX T;  4CFD A;  4O0I A;  3QNN A;  3MEG A;  3ZSX A;  4I9Q A;  4DTM A;  4CHQ A;  2W42 A;  4E1M A;  4FLV A;  3ZSQ A;  3LPT A;  3HO1 A;  3EYZ A;  1LWE A;  3ZT0 A;  4B9M A;  2G8W A;  3SQ2 A;  1ASV A;  1IKV A;  2HHX A;  1DLO A;  4FJK A;  3EZ5 A;  4FJG A;  3QNO A;  3QIO A;  3E01 A;  2LSN A;  1HYV A;  1SKW A;  4ELV A;  2IAJ A;  3I0R A;  1FKO A;  3OYH A;  3LZI A;  3L3U A;  1I3A A;  4XIU A;  4FLU A;  1T8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...