5HRSA

Hiv integrase catalytic domain containing f185k + a124n + t125a mutations complexed with gsk0002
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSNAVKAACWWAGIKQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 51
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrsA00
4I2QA 1WAFA 4CHYA 3K59A 3OYNA 4ELTA 2YNIA 5HRSA 2D0BA 4I7FA 3AO4A 4EZ6A 2I5JA 4DQSA 3SPZA 4FM1A 1S1WA 3OYHA 3KLGA 1WNSA 1UA1A 1NJYA 1XI1A 4CHZA 1QSLA 2A1SA 3EYZA 4PY5A 3H08A 4DQPA 4CGIA 4C8NA 4CIFA 4KTQA 4OGEA 4ELVA 1NOYA 3ZT1A 2HHUA 3ZT4A 4BE0A 3OS0A 4NCAA 5JS2A 5C25A 5J2PA 1U4BA 4FXDA 5HP1A 3VQ7A 1FXXA 4KTZA 3TAGA 3S3NA 3DLKA 3B6OA 4B9TA 4FLTA 1G15A 3O4NA 2PZSA 1F21A 4E7HA 4DS4A 4CJSA 1TKDA 3JYTA 3VQ4A 1HYSA 4DTOA 4KHWA 1KRPA 5T7BA 1C6VA 4DSLA 4ELUA 3U3GA 1GOAA 1RT4A 4CFAA 1S9GA 4CESA 3VQDA 5KTQA 4M41A 4AHTA 2WOMA 1SL1A 1IKYA 3V9XA 1LV5A 4F8RA 1WSFA 3K57A 1RBSA 3DLRA 2XY6A 3ZSWA 4F2RA 4KB1A 3OYBA 4KHYA 2IC3A 1BIZA 4W5OA 3CFRA 4KTWA 4CHOA 3SUNA 3HJFA 1KVBA 1HPZA 1XHXA 3NF6A 4O0JA 4HCBA 2JGUA 4DU1A 1CLQA 2LSNA 1NK9A 3AA3A 3LDSA 3T3FA 4QOZB 3HPOA 2B4JA 5FDLA 3WNFA 1XHZA 4DFMA 3ZSQA 4E19A 3C6TA 1B9FA 3DOKA 4O5BA 5KGWA 3V1QA 4B9LA 2GBZA 3UIQA 1TAUA 1S1UA 3CYMA 4AHVA 3P5JA 4RG8A 4IBNA 3VQ8A 2XY7A 3AVHA 3DM2A 1RT7A 4NYNA 4M3RA 3VQ6A 3K5MA 2KZMA 4Z4EA 3AV9A 4DMNA 3THVA 3S3MA 4KI4A 4KRFA 4FJMA 3HP6A 1HJRA 1X9MA 3PX4A 1KLNA 4Y1CA 3RR7A 4DTUA 4CJUA 5C42A 3DI6A 1FKPA 3DMJA 4CIGA 3AVIA 1T7PA 1HYVA 3ZT0A 4TSXA 1QSYA 1RTIA 2ETJA 2KZZA 2VG6A 4RW4A 3SPYA 2G8KA 1YVUA 2ATQA 1KVAA 1BI4A 4C8MA 5KRSA 1BI4B 1LWFA 1QTMA 1U49A 4DF8A 3NHGA 4WE1A 4DTNA 5D3GA 4BWMA 3O3HA 1B92A 4H4OA 4CIEA 2PY5A 3AA4A 2F96A 4G1QA 2RPIA 5KRTA 3VQBA 1TKXA 4OLBA 4KAZA 2B6AA 4W5TA 1ASWA 4FM2A 4FLWA 3TARA 1N6QA 1RNHA 3VQAA 3PUFA 1BCMA 1LAWA 2AJQA 3O3FA 4FLYA 2Y1IA 1RBTA 3IG1A 2HHXA 1RDDA 3NFAA 2IDOA 3MEGA 2FBXA 1FK9A 2Q3SA 1IO2A 2KW4A 4DTRA 3SQ0A 3NF9A 1HYZA 1SUQA 1A5WA 3ASMA 3KK2A 3HYFA 1Q8IA 1IKXA 1K6YA 3VQ9A 3RMCA 1S1XA 1RBVA 4PWDA 1J53A 2QXFA 3F73A 3QERA 3SYZA 4CJLA 1W0HA 4CFBA 1WSHA 2OZSA 1C1BA 3QLHA 3VN5A 5JS1A 3LAKA 2IGIA 1VSHA 2OYQA 3VA0A 4BDYA 1KVCA 4FW1A 3LZJA 2F8TA 4DFPA 3LP2A 4CJWA 1SL0A 1UA0A 4W5RA 3OS2A 1EX4A 1SKWA 3AVCA 4L8RB 3BDPA 1BISA 3CFOA 3PV8A 1J9AA 1GOCA 4DSJA 1EETA 1WSGA 2P5GA 4ZTJA 1U45A 4DFJA 4Q0BA 2O4GA 1LW0A 2RKIA 1D8YA 4B8AB 4FZYA 3LPUA 3QEWA 3U6FA 3ZSYA 1L3UA 3O3GA 1DTTA 4E7LA 2ZQBA 1KLMA 4E7IA 4PUOA 2E6MA 1JXEA 1RDBA 4CEEA 3TAEA 3TAFA 1HNVA 2BANA 3AVMA 4JRQA 1JKHA 2OPQA 3FFIA 2IOCA 2YNGA 5C24A 4CJKA 5E41A 3SV3A 2BDPA 2E6LA 2OA8A 4AHSA 3NH0A 4B9VA 4FJ8A 4E89A 1O1WA 2ITGA 4Z0UA 4OKEA 4AH9A 1C0MA 2XY5A 1VSKA 1L3VA 2EX3A 1JL1A 2FBYA 1SV5A 1C1CA 3LP0A 3MEEA 3OJUA 4B9MA 4BDPA 4CJPA 1SL2A 4B9NA 3CM5A 4GMJB 3DLEA 3RR8A 4CF8A 4DLGA 5FRNA 2QK9A 4FLZA 3NGIA 1NK6A 1VSLA 4KHSA 4PA1A 4AHUA 3LWLA 1Q9XA 4KPYA 3WNEA 1JLBA 4CFDA 3RTVA 4QAGA 3OYDA 3K58A 3CFPA 1T05A 1NKEA 4FJJA 1ZBHA 2FBVA 4IKFA 5J2QA 5DK5A 4R5PA 2DTUA 1HRHA 2YKMA 4Z4IA 5SWMA 1YTAA 2W42A 3HXMA 2X74A 4B8CA 3AO5A 2XY8A 3ALYA 3NDKA 1S1TA 4OVLA 5K14A 3KTQA 1TKTA 1VSFA 3OYGA 1HMVA 4NYFA 1A5XA 3I0SA 3I8DA 3RMBA 4H4MA 3A2FA 4EP5A 4FM0A 3SUPA 4FJGA 3P83D 3T1AA 2D0AA 4OPJA 1I39A 4CEBA 3QESA 4IDKA 3SQ2A 3ZSVA 1VSJA 3VQEA 2P5OA 3ULDA 4JS4A 1YTUA 2YV0X 1BGXT 3OYIA 1IKWA 3OYAA 4KHQA 1N5YA 1NOZA 4JRPA 3D0PA 1IG9A 3TAPA 4ID5A 4M3UA 2HNDA 4CGHA 3V4IA 4B3OA 4B08A 2HW3A 3QIOA 4FJ7A 2PYJA 3DLHA 2KFNA 3DRSA 2HVIA 1JLCA 1LAVA 1WSIA 1TKZA 1QSSA 4DFKA 3KLEA 2G8VA 4ZHRA 3QNNA 2G8WA 3HSTB 2RN2A 1RT6A 4DSFA 4HUFA 4MQ3A 4Z4HA 5FROA 1LW2A 2D5RA 3P1GA 4FJLA 2VWKA 3PX6A 3NBPA 4FLVA 3OYEA 4CEOA 5CZ1A 4AILC 4CECA 1DTQA 4OPKA 4DTPA 3QEVA 1TAQA 1Z26A 1X1PA 1T03A 3PY8A 3O4QA 1Z25A 4CJVA 3WNHA 4C8KA 4FYDA 3RWUA 4M3XA 1ASVA 1BQNA 3NF8A 4N76A 1ZBFA 2HHTA 1QS4A 3OY9A 1VRTA 4AHCA 3ZSXA 4O0IA 3KJVA 4DQQA 3DLBA 1EXQA 1WAJA 3V9SA 3OYCA 3KKSA 3ITHA 4IFVA 1IH7A 1RCHA 3KKRA 4IG3A 4E1NA 1BL3A 3DLGA 3L3UA 4BDZA 4CJ4A 3AVKA 2G8IA 3HVRA 4LH4A 4EP4A 1VSEA 1VSDA 3KD1E 4KREA 4AHRA 4GW6A 1S6QA 3HPHA 1KSPA 4J2BA 2VG7A 3AO2A 3C6UA 3HVTA 4LD0A 3VQCA 4CEAA 4CJFA 4KHNA 1ZBIA 4HTUA 1JXBA 3HP9A 1QE1A 3OYMA 3SQ1A 1ZYQA 1TGOA 1KFDA 1C0UA 4BE2A 2HNYA 2HHSA 4CF9A 3T19A 2EHGA 4Q5VA 2IAJA 4CHQA 4CGFA 1NK5A 1TK8A 3KIOA 3BGRA 3G10A 4CJ3A 2QKKA 3RMDA 2GV9A 2Z1IA 2OPRA 1SKRA 3ZCMA 3RRHA 2IS3A 4DU3A 2Z1HA 3KLHA 3MXJA 4O55A 2YNHA 3KK3A 1WSJA 3LAMA 4DSKA 2JLEA 3ZT2A 1X9SA 3PO5A 3V1OA 4OKKA 2GUIA 3CQ8A 4CHNA 1A5VA 3PX0A 3RRGA 4FJNA 2HVHA 4DSEA 3F9KA 3S9HA 1B9DA 5J2NA 4DLEA 4NCGA 1UOCA 4J2AA 3TABA 4EZ9A 1JLEA 1VSMA 3V6DA 2G8UA 1RBUA 3ISNC 3LPTA 4DS5A 4CF0A 1L3SA 4C8OA 3QETA 1L3TA 4I9QA 3K5OA 4E3SA 2XRIA 4Z4GA 3M8PA 1XC9A 4I9LA 2HB5A 1NK4A 4DTMA 5FRMA 1I3AA 4ID1A 5HRPA 3D45A 3PO4A 4LSLA 3L2RA 4O44A 2BE2A 5EU7A 3M8SA 1C0TA 2HHQA 1NJWA 3OJSA 4M3ZA 4BACA 3G0ZA 3QINA 2KQ2A 2Z1JA 4CHPA 3NH2A 1RTJA 1JLGA 2P1JA 4E0DA 2X6SA 1BQMA 4E7KA 3TAQA 4ICLA 1TL1A 4CF2A 1L5UA 1TL3A 4K8XA 4PQUA 2E4LA 2VG5A 3CM6A 3QEXA 3S3OA 2P51A 4FZZA 3E01A 3NF7A 4CEZA 3C94A 1VRUA 1BCOA 2BGGA 4E7JA 4KHUA 4CK3A 3V9UA 5CYQA 1X9WA 4OGCA 2DFFA 4DWIA 2D0CA 4CK1A 3K2PA 4BE1A 4ZTFA 1JLAA 2X6NA 4FVMA 5J2MA 1RT5A 4FK2A 4FLUA 4OKJA 4DQRA 4RW8A 5I42A 3OYJA 4OLAA 2DY4A 4HCCA 1S9EA 3SJJA 2Z1GA 4FJ5A 3SCXA 4CEDA 1S5JA 4CGGA 3AA5X 1U48A 5SZTA 4KFBA 3VA3A 1UWBA 3VQQA 2G8FA 2OZMA 3NAEA 1Y97A 2ZD1A 4K8ZA 4HUGA 4FJHA 2YHAA 1EKEA 1QQCA 1RT2A 4OJRA 1BIUA 3HPGA 3VQ5A 4KV8A 1JL2A 4M42A 2XO7A 3LP1A 3ZSOA 4KI6A 2FBTA 3L8BA 3EY1A 1J5OA 3SUQA 3QEIA 4W5QA 4CGJA 1WN7A 4N47A 4RW7A 1DLOA 2RF2A 4I2PA 1D9DA 3L2VA 1R0AA 4J2EA 3TANA 4Z4CA 2OPSA 4C8LA 3KD5E 3HL8A 4RW6A 3IAYA 1RTDA 3B6PA 4FJ9A 5CYMA 4J2DA 4FJKA 3ZSZA 4KB0A 1YT3A 1VK0A 2Y1JA 3OYKA 4BWJA 3LWMA 3AVGA 1REVA 2WONA 2YKNA 2XHBA 4Z4FA 3MEDA 3I0RA 4CEQA 2A1RA 4B9SA 4QCLA 1CZBA 1NKCA 3DRPA 2PYLA 4M3WA 3NE6A 4DU4A 3OYFA 4CE9A 2FC0A 3KK1A 3LALA 1C1AA 3TR8A 3AVJA 3OYLA 1JLFA 3AA2A 2HHVA 1HQUA 4XIUA 2KTQA 1ITGA 1MU2A 1TVRA 4IFYA 4CJQA 4F2SA 4RW9A 3QO9A 4FK4A 4LH5A 4CJTA 3MXMA 3AO3A 5HLFA 1CXUA 1NJXA 2DFHA 4CJRA 3SUOA 1QHTA 3AVLA 3C95A 4CF1A 3KLFA 3QNOA 1KCFA 5DMRA 1VSIA 4KKOA 4M3YA 5HRNA 2YHBA 3MECA 4DSIA 5HBMA 1NK7A 1WLJA 4HVJA 3K5NA 1BHLA 3LZIA 3EZ5A 3QEPA 3LP3A 1NK0A 1JLQA 4DQIA 3V81A 4B9UA 3SV4A 5KI6A 4O4GA 3NCIA 4FJXA 4N41A 2X78A 4DTSA 4IG0A 3NGZA 3U3YA 3ZSRA 1U04A 1LWEA 2OPPA 3DRRA 1FKOA 3K5LA 5HROA 1EP4A 5I3UA 1J54A 3QIPA 3HO1A 2HNZA 3SQ4A 1D9FA 4CGDA 4MFBA 1TK5A 4DTJA 1RDCA 3V1RA 1CZ9A 3AVAA 2KFZA 1CXQA 1WSEA 3AVFA 2DFEA 2NUBA 2R7YA 4FCYA 3WNGA 1XWLA 4FLXA 4NCBA 2ZE2A 3NH1A 3TWHA 3V9WA 2F8SA 3MAQA 3OVNA 2YNFA 4YFUA 1UAXA 3KLIA 1KFSA 4W5NA 4DG1A 1TK0A 3OS1A 2B5JA 4CJEA 4KO0A 4F4KA 3AVNA 5HRRA 3CG7A 4H8KA 3L2WA 4DF4A 2HMIA 4N5SA 3HT3A 1S6PA 3AVBA 1GOBA 3RMAA 1RT3A 4F3TA 1RTHA 4E1MA 2O4IA 4CEFA 3DOLA 4CCHA 1NK8A 1Q9YA 3ZT3A 3MXIA 4GVMA 3L3VA 4M45A 4F3OA 1W9HA 5CZ2A 1ZBLA 5KGXA 4FJIA 4FK0A 1RT1A 3AO1A 1NKBA 2QKBA 3HM9A 1RILA 3LANA 3IRXA 1RDAA 1S1VA 3TAMA 3IS9A 4M3TA 4CERA 4HHTA 2VWJA 3V9ZA 4CJ5A 3M8RA 3VQPA 1IKVA 3M8QA 3L2QA 1HNIA 4CFCA 3JSMA 1T8EA 2G8HA 4FZXC 4LY7A 1NJZA 1U47A 1HQEA 4HUEA 5CY4A 1KTQA 5J1EA 4JS5A 2HHWA 4N56A 4YNQA 4JLHA 1D5AA 4DTXA 1ASUA 3SI6A 3SZ2A 3NGYA 3HK2A 4UQGA 4Y1DA 1LWCA 1RBRA 4FW2A 3DYAA 1TV6A 1ZBUA 3L2UA 3TI0A 3SNNA 4LSNA 4CK2A 1SKSA
chains in the Genus database with same CATH superfamily
3O9TA 3P31A 1GLAG 4CHYA 1OH8A 3OYNA 2YNIA 5HRSA 1J6ZA 3N4PA 3KLGA 1WNSA 1IJJA 2CH5A 1N34K 1QSLA 3E9PA 5AQQA 4CGIA 4CIFA 4FWLA 4BRGA 4DV0K 1NG9A 4BE0A 4NCAA 5JS2A 5J2PA 3BZCA 4AQYK 2QWMA 3B6OA 4FLTA 5AQXA 4DS4A 1OKJA 5HL7L 1C6VA 4DSLA 1S9GA 4CESA 3VQDA 3ZX3A 5AQMA 3MX5A 4M41A 2WOMA 1R59O 2CGKA 1LV5A 4F2RA 5HOOA 1IBMK 2IC3A 4PHTX 1W7AA 4F9OA 1HLUA 4DUYK 4KTWA 4CHOA 1NU0A 3HJFA 3VENA 4WFBL 1NK9A 3FZHA 2WTUA 3LDSA 4QOZB 4BR7A 3ZSQA 2VGNA 3V1QA 3UIQA 4FOEA 4AHVA 3VMFB 1RT7A 3J80O 4FWPA 3U9ZA 4BC4A 4DMNA 1TUYA 4KRFA 1KLNA 4CJUA 5DM6L 3CMEN 3BEXA 1HYVA 4CBUA 2KZZA 2VG6A 4RW4A 3SPYA 2ATQA 1KVAA 3QMLA 1N32K 4C8MA 3NHGA 4WE1A 4DTNA 2YJEA 4A59A 2PY5A 3AA4A 2E8AA 4G1QA 4CZEA 1IBKK 3QFUA 4FM2A 3O08A 3IUCA 3LL3A 1BCMA 1LAWA 1OH6A 5GADP 3CCLN 1RBTA 2KW4A 2ZWHA 1QQNA 2O8BB 3QICA 1YI2N 1RBVA 2QXFA 3F73A 2OZSA 1C1BA 3QLHA 4DV4K 5JS1A 4M7YA 3NVMA 4AM7A 3LZJA 4CBXA 5IWAK 1J9AA 4WF9L 2E5LK 3K0SA 1WSGA 4JYAK 4WCEL 4K0KK 1U45A 1QVGM 1C0FA 3O9SA 4Q0BA 4B8AB 3PLAA 3K9JA 4IFEA 1JXEA 2NRHA 1HNVA 4JRQA 3KVGA 2OPQA 2IOCA 4ISGA 5AQVA 4AHSA 3M1FA 1O1WA 5C2FA 4FWRA 1C0MA 2VQEK 5JVGL 2FBYA 1SV5A 3LP0A 2QM1A 2GEMA 4GV6A 3CM5A 4GMJB 3Q7CA 4H5TA 4CF8A 4JK7A 4DLGA 5FRNA 4AHUA 4KPYA 3WNEA 3RTVA 2FSJA 3CFPA 5IT9O 5J2QA 1EO1A 4Z4IA 1YHQN 3HXMA 2XY8A 2ZGYA 5GIOA 4BQLA 1VSFA 5BPNA 3OYGA 5GAGP 3I0SA 1TYQB 4H0YB 2ZM6K 1VQ8N 3ULDA 1YTUA 3KWGA 4YOYA 1IKWA 4A61A 2OCEA 1NOZA 3D0PA 3N4QA 1IG9A 4IJAA 4B08A 3PSFA 5KQDA 2G8VA 4GVEA 4ZHRA 3QNNA 2RN2A 4DSFA 3WXKA 2O8CB 3FZFA 4BRHA 4FJLA 2VWKA 4JKGA 4FLVA 4CEOA 4YORA 4AILC 3MN9A 4OPKA 4CVNE 1X1PA 2D1KA 4FSVA 1T03A 3MCAB 4JKFA 1OH7A 4C8KA 4M3XA 5CE3A 3OY9A 3ZSXA 3DLBA 5GAEP 2HBKA 2A41A 3ITHA 1GLDG 2BTFA 1RCHA 3KKRA 1VQLN 3DLGA 4CZMA 2HBLA 3JXUA 2G8IA 4LH4A 3KD1E 2GUPA 4AHRA 2WUSA 3HPHA 4H5WA 3AO2A 3C6UA 4CEAA 4LD0A 4HTUA 5EVZA 4BE2A 2HNYA 1N8RO 4CF9A 1YITN 2YHXA 4IWVA 4B9QA 2QKKA 1NMNA 1XNQK 1SKRA 2Z1HA 1SS6A 2YNHA 4O55A 3KK3A 3RSEB 3HI0A 2GUIA 3LDQA 4CHNA 4ILGB 4ISEA 4MDAA 4FJNA 2HVHA 2Q97A 5AZJB 1UOCA 4EZ9A 3V6DA 2G8UA 4FWNA 3K5OA 4E3SA 4Z4GA 3M8PA 4IXCA 3CJAA 2HB5A 4B1VA 5EOYA 4J8FA 1SZ2A 2HHQA 1NJWA 3OJSA 3QINA 3MN6A 3NH2A 2P1JA 4E0DA 1BQMA 3VEVA 3O9UA 1ATSA 3CM6A 3QEXA 3SAFA 2P51A 4FZZA 4CEZA 2YHWA 3C94A 1VRUA 3V9UA 5CYQA 4C1NI 4JKEA 2D0CA 4CK1A 1VHXA 3WEEA 4ZTFA 1JLAA 3WQUA 3I8BA 4BRCA 4RW8A 4FWQA 4OLAA 3MK6A 3WXJA 2Z1GA 2P9UB 3SCXA 4JEPA 2G8FA 1M90O 1NGHA 2ZD1A 3VGKA 4HUGA 4FJHA 1XUPO 4A2BA 1QQCA 1RT2A 3HPGA 2CGJA 1JL2A 1P90A 3ZSOA 2W41A 2FBTA 2P9LA 2VQFK 3THWA 2WC9A 1J5OA 4W5QA 4CGJA 4RW7A 4WYBA 2BH1A 5JVHL 1Q86O 3TANA 4C8LA 4M63C 1W97L 1YUWA 1YT3A 1NGDA 1C0GA 1VQKN 2KLAA 3I0RA 2A1RA 1GLEG 2V7ZA 4DV3K 4B9SA 4QCLA 1BA0A 3DRPA 1X3MA 2FSNA 3LALA 5M1FA 1D4XA 1C1AA 3M6GA 1HUXA 3LDNA 3AA2A 1MU2A 1TVRA 4IFYA 3AO3A 1EWQA 1CXUA 4CJRA 3SUOA 2NNWA 3C95A 3KLFA 3DXMA 4RCHA 1BDGA 3K5NA 3J81O 3EZ5A 2F7TA 3LP3A 2ZGZA 5KI6A 4FJXA 1ZC6A 3VEZA 1J54A 3T7ZA 4CGDA 4DTJA 3V1RA 1CXQA 1WSEA 3IDHA 3WNGA 2KKZA 3OVNA 4JI6K 1UAXA 4DG1A 3ZX2A 1TK0A 2B5JA 4MDBA 2O8BA 3UKRB 5HRRA 4DF4A 3L2WA 3UKUA 1KAZA 3VPZA 4E1MA 1YAGA 3TU5A 3DOLA 3I56N 3OW2M 1JCGA 5AQGA 2E2NA 1ZBLA 4FJIA 3J7AP 3AO1A 4DHYA 1RDAA 5AQSA 4WFNL 1VQON 5BN8A 3V9ZA 4GKJK 2QWRA 3VQPA 3JSMA 3M8QA 1HNIA 1T8EA 4FZXC 4LY7A 3OBWA 2Q36A 1U47A 3CHWA 3EE9A 2HHWA 4N56A 4WQ5C 4YOXA 3VEXA 2QEXN 1OVYA 1RBRA 1KQSM 3LDOA 3K59A 2QWNA 4I7FA 3R9PA 4EZ6A 3SPZA 1S1WA 4JHDB 1NJYA 3EYZA 4JD2A 4DQPA 4PY5A 3FLCO 1NOYA 1ESVA 2HHUA 4FL9A 3OS0A 5AQFA 3O9RA 3FGUA 5C12A 4KTZA 3TAGA 3S3NA 4DKWA 1G15A 2FLOA 1HYSA 4CJSA 3VQ4A 4BC2A 1Y64A 3R8EA 3HOSA 1GOAA 4CFAA 5BPMA 3QBXA 2JWLA 2XY6A 4KHYA 3SUNA 1XHXA 3NF6A 4HCBA 2JGUA 4CZFA 1CLQA 2LSNA 3O80A 3LM2A 3T3FA 1I94K 3WNFA 1XHZA 4DFMA 1MWMA 4E19A 1TAUA 3MX2A 5KGWA 1G99A 1HKBA 3CYMA 4IBNA 5M1NA 3CJ9A 3GDQA 3VGMA 4DR3K 2AP1A 1HX1A 4NYNA 4CZJA 4M3RA 3THVA 3S3MA 3HP6A 1HJRA 3PX4A 3I33A 2ASPA 3DI6A 1FKPA 1T7PA 3ZT0A 2ETJA 2G8KA 1BI4A 3OBYA 4H0PA 5KRSA 1T6DA 1QTMA 1U49A 1K8KA 3O3HA 4CIEA 5MLCQ 2UU9K 2HHHK 1GLCG 2RPIA 5KRTA 1YIJN 4OLBA 4KAZA 2B6AA 4H03B 3TARA 1N6QA 1ATNA 4BGAA 2Y1IA 3C65A 3A0IX 3NFAA 2Q3SA 1IO2A 4BRAA 4DTRA 3SQ0A 2P9IB 1K6YA 4IEIA 3RMCA 4BRQA 1J53A 1XNRK 4CFBA 3RSEA 3WXLA 3GBTA 4L3QA 2HMPA 2HSTA 1XC3A 1SL0A 1NGIA 4W5RA 1QQOA 4H0VB 4XEIA 4L8RB 1BISA 3PV8A 4DSJA 1EETA 2RE2A 3CI5A 2P9PA 3S41A 3ZX0A 3QEWA 4LFCK 3H45C 1L3UA 2V7YA 2UUAK 1KLMA 3D2EB 1BUPA 1RDBA 2NLXA 3TAEA 3TAFA 3AVMA 2BANA 5AQOA 3FFKB 1JKHA 3SV3A 2YNGA 5E41A 3CQYA 4Z0UA 3TTCA 2A42A 3KHYA 1VSKA 2EX3A 1JL1A 1NGJA 3OJUA 2P9NB 5GINA 2O8DB 3A8YA 4B9NA 3RR8A 3CJ1A 1RDWX 5TKYA 1Q9XA 1JLBA 4CFDA 5DM7L 4QAGA 1NKEA 3UB5A 2FXUA 2FBVA 4DCHA 4IKFA 1U2VB 2VGMA 1NJIO 2IVPA 2P9UA 2X74A 3ALYA 1HKCA 4BC3A 1TKTA 3I8DA 3RMBA 4H4MA 3SUPA 4EP5A 3P83D 1T3VA 4CEBA 4RWTA 4IOCL 4B3RK 3CQXA 4IDKA 3EEQA 2HBMA 3ZSVA 1RFQA 2CH6A 4RTFD 3VQEA 2P5OA 1GLBG 1KXPA 4B1YB 2NRVA 4YOVA 3OYAA 4ID5A 4CGHA 3V4IA 4B3OA 2HW3A 3QIOA 1ILYA 3TSQA 2PYJA 4QS9A 2KFNA 2HVIA 4DR5K 4B1ZA 2I7PA 3KLEA 3CCUN 2QTDA 3P1GA 3UE5A 2RHKA 3WXIA 3ZETB 2ASOA 4DQ8A 1O13A 4CECA 2A3ZA 4JKDA 3PY8A 3WNHA 1ASVA 4O0IA 4DQQA 1EXQA 5ADXA 3D2FA 1IH7A 4E1NA 1BL3A 4BDZA 3L3UA 2UUCK 4CJ4A 3AVKA 3HVRA 1VSDA 1S6QA 4BRPA 2VG7A 4JNEA 4KHNA 3VESA 4BVPA 5JLHA 1KFDA 1C0UA 3ZLJA 2P9SA 3T19A 4NO7A 4BVOA 4CHQA 4NLBA 3JAMO 4CJ3A 1VQNN 1LOTB 2QI2A 3SMPA 2FF3B 3SMSA 3A5MC 5EX5A 3RRHA 1YJ9N 4BREA 3MXJA 3QFPA 1WSJA 3LAMA 4FOIA 3O4WA 3CQ8A 3F9KA 3HTVA 1OH5A 5J2NA 4DLEA 2F9WA 3TABA 1JLEA 1VSMA 1Q7YO 3EKUA 1QHAA 3ISNC 3L6QA 3KZBA 2BUPA 4I9QA 4CZHA 3QETA 4LF7K 2NRXA 2GWKA 1YJNN 4I9LA 2AA4A 2P9KB 4ID1A 3CJCA 4LSLA 4CJ7A 3GL1A 3L2RA 3M8SA 1DKGD 1C0TA 4EFHA 4M7XA 4CHPA 1RTJA 4B3SK 4JI4K 2X6SA 3FZKA 4E7KA 4ICLA 1TL3A 5ELZA 2IIRA 4K8XA 4PQUA 2E4LA 3S3OA 2BGGA 4BRNA 4OGCA 4BRLA 4DWIA 5A2QO 2X6NA 4FVMA 5C10A 4FK2A 4A57A 5I42A 4Y0WA 4HCCA 3HOTA 4FJ5A 4CEDA 3AA5X 5SZTA 4KFBA 3VA3A 3VQQA 5BRDA 3VF6A 3CXCM 3CC2N 5FPEA 4YOTA 3LP1A 2YI1A 4KI6A 3THXB 4H0TB 1VQ6N 2E1YA 3D6RA 3QEIA 1WN7A 4N47A 4FO0A 5AJ3K 1IG8A 3C7NB 2RF2A 4MO4A 1D9DA 4LF6K 4J2EA 5AQUA 4Z4CA 2OPSA 3KD5E 1RTDA 3B6PA 1H1VA 5CYMA 1K8AO 4MLEA 4H0OA 2Y1JA 4BWJA 3AVGA 4ISFA 3A5OC 3EKSA 5BR9A 4Z4FA 3SLCA 2OTLN 1CZBA 4BR9A 5FPMA 1TUUA 3AAQA 3ENOA 3OYLA 1JJ2M 4YDUC 1HQUA 4K25A 4XIUA 4CJQA 3ZEUA 4FK4A 4LH5A 2W6KA 4CJTA 3MXMA 2O8EA 1Z6RA 4NXMK 5DMRA 1VSIA 3GOIA 1OVQA 2YHBA 3MECA 1NK7A 1ZXOA 1WLJA 4HVJA 3LZIA 3QEPA 5H1SQ 4B9UA 4DR4K 3SV4A 4O4GA 2X78A 4IG0A 4KH5A 3WQTA 3K5LA 1EP4A 3VETA 3E1YA 3HO1A 1ATRA 1TK5A 1HNZK 1RDCA 3VF4A 2KFZA 4U67L 2DFEA 4FCYA 4FLXA 5AQJA 1XWLA 2ZE2A 3ULEB 4WFAL 2YNFA 4YOWA 4YFUA 1KFSA 4W5NA 4JK9A 3OS1A 4KO0A 3THYB 2P9IA 3CG7A 4N5SA 3O1BA 3G6EN 4JI8K 1MDUB 1S6PA 3AVBA 1GOBA 3RMAA 1RT3A 4F3TA 4BG9A 3IMXA 1RTHA 4EIAA 4EAHD 5BRFA 2YX6A 4CBWA 1Q81O 4AF1A 2FSKA 5CZ2A 5KGXA 4FK0A 4FPAA 4DR2K 1RT1A 1N33K 3LANA 4M3TA 3U8XA 3TAMA 3IS9A 3TPQA 2E88A 4R79A 3M8RA 1JCFA 3WT0A 1S3XA 5AZIA 3L2QA 1S72N 4I6MB 1NNEA 4HTLA 3DLLL 3ID6A 1HQEA 4HWIA 5M1QA 4YNQA 4JLHA 4B3TK 4DTXA 1GLFO 2Q31A 4A5AA 1SAZA 1DGKN 1LWCA 4Y1DA 3L0QA 4U7BA 4LF4K 1TV6A 3L2UA 3A5NC 4CK2A 4I2QA 1WAFA 2D0BA 3AO4A 5ADXH 4PL8A 5CHIA 4DQSA 3H46O 3OYHA 1UA1A 2A1SA 4JI2K 3H08A 3HBTA 4C8NA 4QS7A 4KTQA 4ELVA 3EL2A 3ZT4A 3SAGA 5C25A 1YXQA 5BREA 3VQ7A 5HP1A 1FXXA 3VERA 4MO5A 3CCSN 1BOTO 3P4IA 2PZSA 1F21A 3F5TA 4E7HA 1BU6O 1BWFO 4KHWA 4H5RA 1RT4A 4DV6K 5KTQA 3PIPL 1SL1A 4AM6A 3V9XA 1WSFA 3TSUA 1RBSA 3K57A 4KB1A 1DT9A 1BIZA 4A62A 4B3MK 1KVBA 5E84A 1Q82O 3O1WA 4O0JA 2GELA 4DB3A 4DU1A 3ZYYX 1YF5L 4CW7B 3HPOA 2B4JA 5FDLA 4B9LA 3C6TA 2QXLA 3DOKA 4O5BA 2GBZA 1S1UA 1NGGA 4RG8A 3VEWA 3ZETA 3AVHA 3VQ6A 1NM1A 2KZMA 3TSPA 4JI7K 4LFAK 4FJMA 1X9MA 3QBWA 1HKGA 3T1HK 3RR7A 1WB9A 3DMJA 1KC8O 1QSYA 4TSXA 1RTIA 1YVUA 2QW9A 1V4SA 2PAVA 4CZIA 1LWFA 4DF8A 1DEJA 1E4GT 1J5EK 4H4OA 4DR7K 4B1XB 1K73O 2F4VK 4WQ5A 5BPLA 3VQBA 4BRKA 1ASWA 3LDPA 1RNHA 3VQAA 4GKKK 4FLYA 2HHXA 3MWTA 2IDOA 3MEGA 2FBXA 1FK9A 1HYZA 1SUQA 5TKWA 3KK2A 3HYFA 1Q8IA 3BF1A 3VQ9A 1S1XA 4PWDA 4DV5K 3SYZA 3SJHA 4K42A 2D0PA 3J7YP 3LAKA 1VSHA 2IGIA 2OYQA 4BDYA 1KVCA 4CJWA 4YY3K 1UA0A 3OS2A 3AVCA 3BDPA 1GOCA 2J4RA 2GWJA 2P5GA 2A5XA 4CZKA 1LW0A 1D8YA 3U6FA 3ZSYA 4BRIA 3E66A 3O3GA 4PUOA 2E6MA 3QB0A 3CPEA 3CC7N 2VWBA 5AQZA 2UXBK 3O6WA 5C24A 4CJKA 2BDPA 3BF3A 2E6LA 2OA8A 3NH0A 5AQLA 2ITGA 4E89A 4OKEA 4AH9A 2HOEA 4DV1K 2XY5A 1L3VA 5M1KA 1C1CA 4B9MA 4BDPA 3DWLA 1VQ9N 1HR0K 3DLEA 3H6EA 2QK9A 4YOUA 4PA1A 4KBOA 4BQZA 3LWLA 4PKGA 4KHSA 1T05A 3OYDA 3E9OA 1ZBHA 5FPDA 5DK5A 2YKMA 1MA9B 4JI5K 3NDKA 5K14A 4OVLA 1RGIA 4NYFA 1TYQA 4FM0A 3CETA 4FJGA 2OANA 2E2OA 4OPJA 3QESA 3SQ2A 4JS4A 3THXA 2YV0X 1BGXT 3OYIA 3A5LC 2GX9A 2YHYA 3TAPA 4M3UA 2HNDA 3DAWA 5AQHA 3CCEN 4FWOA 3CC4N 4FJ7A 1U6ZA 1NMDA 1HJOA 4KH4A 4PKHA 1JLCA 1LAVA 1QSSA 4DFKA 2G8WA 3HSTB 2O8CA 4HUFA 4MQ3A 2D5RA 5LMUK 4BRFA 3PX6A 3LM9A 5CZ1A 4JKGB 2D0OA 3TTDA 4BGBA 4DV7K 1TAQA 1Z26A 1EQYA 3O4QA 3VTIA 4FYDA 4N76A 1ZBFA 5AQYA 1QS4A 1VRTA 4AHCA 3OTOK 4XH4A 4MLHA 3KKSA 4IFVA 1VSEA 4KREA 1QZ6A 4GW6A 2Q1NA 1KSPA 4X62K 3VQCA 1ZBIA 4CJFA 3SBGA 3HP9A 3OYMA 1ZYQA 3SQ1A 5C15A 1TGOA 1K9MO 4V19S 1NGCA 2EHGA 4Q5VA 2IAJA 2H3GX 3CCMN 4H0XB 2OPRA 1N36K 2IS3A 4DU3A 3R3LA 3MDQA 4DSKA 2JLEA 3ZT2A 5KPZA 1X9SA 3PO5A 3V1OA 1A5VA 5AZJA 1XMQK 3S9HA 1B9DA 1JCEA 4NCGA 4DS5A 4CF0A 1L3SA 4C8OA 1NK4A 5FRMA 1NGBA 3D45A 4O44A 2BE2A 5EU7A 4B1UB 1VQ7N 4YHHK 4H5NA 4M3ZA 4BACA 3G0ZA 2KQ2A 3HSCA 2HF4A 1JLGA 4GNIA 3HZ6A 3TAQA 4IO8A 1TL1A 1NGAA 3OHRA 4G9ZA 3E01A 1GLLO 1QZ5A 1BG3A 4E7JA 4KHUA 3H1QA 2ZJQL 3D7EO 2DFFA 5BN9A 3K2PA 1BO5O 4WQ4C 3WEEB 3I55N 3FZMA 4OKJA 1FJGK 4DQRA 3OYJA 2W40A 1S9EA 3SJJA 2NRTA 4H5VA 4CGGA 1S5JA 1HNXK 3KK7A 2OZMA 1UWBA 3K9KA 2ITMA 1Y97A 4K8ZA 4IJNA 1BIUA 3VQ5A 5F0XA 4KV8A 1X9JA 4BR4A 2XO7A 1VQMN 3SUQA 2P9LB 1QQMA 1XQSC 3THWB 1DLOA 4I2PA 3L2VA 3J8AA 3VF2A 2ZJPL 4RW6A 4J2DA 3ZSZA 2Q0RA 1KAXA 4LF9K 1REVA 5M1OA 3R1XA 4OPHA 5KPTA 2UYTA 4IO9L 1HPMA 4M3WA 3WUHA 3NE6A 3EZWA 2WBNA 4NLCA 1VQ5N 3AVJA 1JLFA 2HHVA 3VOVA 3ATVA 5HLFA 1NJXA 3WXMB 1QHTA 3AVLA 3DJCA 4CF1A 3ENHA 1KCFA 4IDHA 4KKOA 5HRNA 2A6AA 2I7NA 5HBMA 3DXMB 1NK0A 5I9EB 2QWLA 1VAZA 3HRGA 5FPNA 5LL6Z 4N41A 4FWKA 4DTSA 3U3YA 1U04A 1LWEA 1WBBA 3DRRA 1FKOA 5HROA 3OA9A 3DXKB 2HNZA 4MFBA 1CZ9A 3M5RA 3AVFA 2NUBA 2R7YA 3T1YK 3NH1A 4A5BA 3V9WA 1KD1O 3CD6N 3KLIA 4CJEA 3UKRA 3ID8A 4H8KA 2HMIA 3HT3A 3W0LA 3UKUB 3H3OB 3IFRA 2O4IA 4CCHA 2NZTA 1IBLK 3P39A 3MXIA 4GVMA 3L3VA 4M45A 3CJBA 4FWSA 3HM9A 4LC9B 1S1VA 5JICA 3P38A 4HHTA 3G4SN 1IKVA 2G8HA 4DV2K 4JKAA 1NJZA 3B8AX 4HUEA 5CY4A 4JS5A 3NVKA 1D5AA 1ASUA 3NGYA 3HK2A 4UQGA 4DUZK 4FW2A 3DYAA 4CD3A 3SNNA 1WOQA 4LSNA 4F8RA 2CGLA 2QWQA 3O5BA 1VQ4N 4ELTA 4YDUA 2I5JA 4FM1A 4JHDA 1XI1A 4CHZA 4JKHA 4JD2B 4OGEA 5JLFA 3ZT1A 4CZGA 1ZBSA 4BR0A 4C1NK 1U4BA 5EXWA 1KAYA 4FXDA 1Q18A 3DLKA 1Z05A 2E1ZA 5M1PA 4B9TA 3O4NA 1TKDA 2ZF5O 3JYTA 3CJ7A 4DTOA 1NLVA 1KRPA 5BRHA 4LF5K 5T7BA 4ELUA 3U3GA 2W6LA 4AHTA 1IKYA 1NGFA 3DLRA 1EWRA 3ZSWA 4DR6K 3OYBA 5BR8K 1E3MA 4W5OA 3CFRA 5GAHP 2QA4N 4GV9A 1HPZA 5AFUA 2V52B 3AA3A 3G25A 1XMOK 4X66K 4BG8A 3CCQN 1B9FA 5KQ8A 2NRRA 2E20A 3P5JA 3VQ8A 1MWKA 2XY7A 1QVFM 3DM2A 3K5MA 4Z4EA 3AV9A 4XH5A 5LY3A 4KI4A 4OX9K 4Y1CA 4DTUA 5C42A 2O8FB 5LMNK 4CIGA 1RDUA 3AVIA 3C0BA 3G71N 4GV3A 1BI4B 3ENBA 5D3GA 4BWMA 2E2PA 1B92A 1K8KB 2KHOA 4Z94A 1W2BM 3EN9A 2PBDA 1LCUA 2F96A 4UY8O 1TKXA 4BRMA 4PKIA 2NRWA 4W5TA 4FLWA 1FW6A 3QDKA 3PUFA 3L4QA 2AJQA 4XH1A 3O3FA 4JN4A 3IG1A 1RDDA 2QWOA 3GE1A 3NF9A 1A5WA 3ASMA 1IKXA 1BA1A 2EWSA 4NB4A 3C6HA 3QERA 4CJLA 1W0HA 1WSHA 3MMVA 2UXDK 4O5FA 3VN5A 4FVUA 3VA0A 4FW1A 2F8TA 4A2AA 4DFPA 3LP2A 1SKWA 1EX4A 2GTDA 3CFOA 3VTHA 3VGLA 5JMVA 3PIOL 4ZTJA 3T69A 4DFJA 2O4GA 2RKIA 5AQNA 4FZYA 3LPUA 3U9DA 2P9PB 3BY5A 3HM8A 4E1JA 2HF3A 2Q2RA 3SAHA 3D2EA 1DTTA 3MCPA 2ZQBA 4E7LA 4E7IA 4CEEA 4IOXA 3FFIA 3F2KA 3FE1A 5GIPA 4FJ8A 4B9VA 4JKBA 4PL7A 4EHUA 4JI3K 4X64K 4JV5K 2P9NA 3MEEA 2O8DA 4CJPA 1SL2A 2HBJA 4FLZA 3NGIA 1NK6A 1VSLA 4FJJA 3K58A 1U2VA 3CCVN 3O8MA 4R5PA 5E26A 1HRHA 2DTUA 5SWMA 1YTAA 2W42A 3BP8A 4B8CA 3AO5A 5AQWA 1S1TA 3KTQA 1P8ZA 1HMVA 1A5XA 4EHTA 3A2FA 3T1AA 2D0AA 1I39A 1VSJA 1WUAA 4K41A 1VQPN 4KHQA 1N5YA 3EO3A 4JRPA 4LFBK 3CERA 4JAXA 3DLHA 3DRSA 4IOAL 1WSIA 1TKZA 3GG4A 1RT6A 4Z4HA 5FROA 1LW2A 4BY9C 3AGKA 4CZLA 3E9LA 2YCHA 3NBPA 4X65K 3OYEA 4IZ9A 1DTQA 2A40A 4DTPA 3QEVA 4DR1K 2ASMA 4CJVA 1Z25A 3RWUA 1BQNA 3NF8A 2IVNA 4LF8K 5B8HA 2HHTA 3BUZB 4JKCA 3KJVA 3AY9A 3O9QA 3W3DA 1WAJA 4IEEA 3D2FB 3V9SA 3OYCA 4BROA 4IG3A 2NRZA 4EP4A 4B1WB 4J2BA 5C2DA 2VCPA 1T44A 3HVTA 4JI1K 2QKBA 1JXBA 1QE1A 3PSIA 5AQIA 2HHSA 3R6MA 2FF6A 2VYPA 2P9SB 3VEYA 4CGFA 1NK5A 1TK8A 3KIOA 3BGRA 3G10A 3VEOA 3RMDA 2GV9A 2Z1IA 4KH6A 3ZCMA 3KLHA 3DXKA 4ILHA 2JWKA 4OKKA 3KWIA 3BZKA 5FLXO 3PX0A 3RRGA 4DSEA 3C6AA 4J2AA 3M3ZA 1SQKA 3IKMA 1RBUA 3LPTA 3H1VX 2E2QA 1L3TA 3FZLA 4QS8A 1NWKA 2XRIA 4FWMA 1XC9A 2P9KA 4DTMA 1CZAN 1I3AA 5HRPA 5AQTA 3PO4A 3MWPA 2Q0UA 2D4WA 2Z1JA 2DPNA 1IV0A 5AFUH 4CF2A 4CI6A 1L5UA 2VG5A 3RVCA 4OPAA 3NF7A 1BCOA 3LDLA 4CK3A 1X9WA 3J7ZO 4BE1A 5AQPA 3CPWM 5J2MA 1RT5A 4FLUA 4CD1A 2DY4A 5C0YA 3CIPA 1U48A 2PFUA 3NAEA 2UUBK 3AAPA 2YHAA 1EKEA 4OJRA 2OTJN 4M42A 3F9MA 3L4IA 4BC5A 1E4FT 3EY1A 4BR5A 1X3NA 5F2RA 3L8BA 4K43A 3C7NA 1GLJO 1R0AA 5AQKA 3CCRN 3HL8A 5KPRA 3IAYA 4FJ9A 4FJKA 4O8KA 4KB0A 1VK0A 3OYKA 2YJFA 3LWMA 2WONA 2YKNA 2XHBA 4BRDA 3CCJN 3MEDA 2V51B 4CEQA 3SBTA 1NKCA 4BR2A 2PYLA 3EE8A 4DU4A 5LJWA 3OYFA 4CE9A 2FC0A 3KK1A 1S22A 3TR8A 3AGRA 2F9TA 1V4TA 2KTQA 1ITGA 4C23A 4F2SA 4RW9A 3QO9A 3Q7BA 3ZEUB 4JK8A 2O8EB 5AQRA 2DFHA 1T6CA 1WBDA 3MN7A 3QNOA 4M3YA 4O8UA 5F1XA 4FPBA 1YJWN 4DSIA 3SK3A 3JS6A 5LJVA 1BHLA 3CF5L 2O8FA 4JI0K 1JLQA 4DQIA 3V81A 2ZJRL 3NCIA 3ZSRA 2OPPA 3H3NO 5I3UA 3QIPA 4NXNK 1D9FA 3SQ4A 3AVAA 1M1KO 4WQ4A 4NCBA 3ULEA 3FR0A 3TWHA 2F8SA 4ILJA 3MAQA 3MN5A 4F4KA 1NBWA 3THYA 3ATUA 3AVNA 3AARA 5EY4A 4KHPK 5AR0A 5CR4A 4CEFA 3U4LA 1NK8A 1Q9YA 2QWPA 3ZT3A 4F3OA 1W9HA 1NGEA 1NKBA 1HNWK 1RILA 3IRXA 4OO1J 4CERA 4GY2B 2VWJA 4CJ5A 2IVOA 4I6MA 4CFCA 5AZIB 3CMAN 2WFBA 1YVNA 5J1EA 1KTQA 3SI6A 3SZ2A 2UXCK 1ZBUA 3TI0A 3TTFA 3NGZA 1SKSA 3NMUA
chains in the Genus database with same CATH topology
4I2QA 1WAFA 4CHYA 3K59A 3OYNA 4ELTA 2YNIA 5HRSA 2D0BA 4I7FA 3AO4A 4EZ6A 2I5JA 4DQSA 3SPZA 4FM1A 1S1WA 3OYHA 3KLGA 1WNSA 1UA1A 1NJYA 1XI1A 4CHZA 1QSLA 2A1SA 3EYZA 4PY5A 3H08A 4DQPA 4CGIA 4C8NA 4CIFA 4KTQA 4OGEA 4ELVA 1NOYA 3ZT1A 2HHUA 3ZT4A 4BE0A 3OS0A 4NCAA 5JS2A 5C25A 5J2PA 1U4BA 4FXDA 5HP1A 3VQ7A 1FXXA 4KTZA 3TAGA 3S3NA 3DLKA 3B6OA 4B9TA 4FLTA 1G15A 3O4NA 2PZSA 1F21A 4E7HA 4DS4A 4CJSA 1TKDA 3JYTA 3VQ4A 1HYSA 4DTOA 4KHWA 1KRPA 5T7BA 1C6VA 4DSLA 4ELUA 3U3GA 1GOAA 1RT4A 4CFAA 1S9GA 4CESA 3VQDA 5KTQA 4M41A 4AHTA 2WOMA 1SL1A 1IKYA 3V9XA 1LV5A 4F8RA 1WSFA 3K57A 1RBSA 3DLRA 2XY6A 3ZSWA 4F2RA 4KB1A 3OYBA 4KHYA 2IC3A 1BIZA 4W5OA 3CFRA 4KTWA 4CHOA 3SUNA 3HJFA 1KVBA 1HPZA 1XHXA 3NF6A 4O0JA 4HCBA 2JGUA 4DU1A 1CLQA 2LSNA 1NK9A 3AA3A 3LDSA 3T3FA 4QOZB 3HPOA 2B4JA 5FDLA 3WNFA 1XHZA 4DFMA 3ZSQA 4E19A 3C6TA 1B9FA 3DOKA 4O5BA 5KGWA 3V1QA 4B9LA 2GBZA 3UIQA 1TAUA 1S1UA 3CYMA 4AHVA 3P5JA 4RG8A 4IBNA 3VQ8A 2XY7A 3AVHA 3DM2A 1RT7A 4NYNA 4M3RA 3VQ6A 3K5MA 2KZMA 4Z4EA 3AV9A 4DMNA 3THVA 3S3MA 4KI4A 4KRFA 4FJMA 3HP6A 1HJRA 1X9MA 3PX4A 1KLNA 4Y1CA 3RR7A 4DTUA 4CJUA 5C42A 3DI6A 1FKPA 3DMJA 4CIGA 3AVIA 1T7PA 1HYVA 3ZT0A 4TSXA 1QSYA 1RTIA 2ETJA 2KZZA 2VG6A 4RW4A 3SPYA 2G8KA 1YVUA 2ATQA 1KVAA 1BI4A 4C8MA 5KRSA 1BI4B 1LWFA 1QTMA 1U49A 4DF8A 3NHGA 4WE1A 4DTNA 5D3GA 4BWMA 3O3HA 1B92A 4H4OA 4CIEA 2PY5A 3AA4A 2F96A 4G1QA 2RPIA 5KRTA 3VQBA 1TKXA 4OLBA 4KAZA 2B6AA 4W5TA 1ASWA 4FM2A 4FLWA 3TARA 1N6QA 1RNHA 3VQAA 3PUFA 1BCMA 1LAWA 2AJQA 3O3FA 4FLYA 2Y1IA 1RBTA 3IG1A 2HHXA 1RDDA 3NFAA 2IDOA 3MEGA 2FBXA 1FK9A 2Q3SA 1IO2A 2KW4A 4DTRA 3SQ0A 3NF9A 1HYZA 1SUQA 1A5WA 3ASMA 3KK2A 3HYFA 1Q8IA 1IKXA 1K6YA 3VQ9A 3RMCA 1S1XA 1RBVA 4PWDA 1J53A 2QXFA 3F73A 3QERA 3SYZA 4CJLA 1W0HA 4CFBA 1WSHA 2OZSA 1C1BA 3QLHA 3VN5A 5JS1A 3LAKA 2IGIA 1VSHA 2OYQA 3VA0A 4BDYA 1KVCA 4FW1A 3LZJA 2F8TA 4DFPA 3LP2A 4CJWA 1SL0A 1UA0A 4W5RA 3OS2A 1EX4A 1SKWA 3AVCA 4L8RB 3BDPA 1BISA 3CFOA 3PV8A 1J9AA 1GOCA 4DSJA 1EETA 1WSGA 2P5GA 4ZTJA 1U45A 4DFJA 4Q0BA 2O4GA 1LW0A 2RKIA 1D8YA 4B8AB 4FZYA 3LPUA 3QEWA 3U6FA 3ZSYA 1L3UA 3O3GA 1DTTA 4E7LA 2ZQBA 1KLMA 4E7IA 4PUOA 2E6MA 1JXEA 1RDBA 4CEEA 3TAEA 3TAFA 1HNVA 2BANA 3AVMA 4JRQA 1JKHA 2OPQA 3FFIA 2IOCA 2YNGA 5C24A 4CJKA 5E41A 3SV3A 2BDPA 2E6LA 2OA8A 4AHSA 3NH0A 4B9VA 4FJ8A 4E89A 1O1WA 2ITGA 4Z0UA 4OKEA 4AH9A 1C0MA 2XY5A 1VSKA 1L3VA 2EX3A 1JL1A 2FBYA 1SV5A 1C1CA 3LP0A 3MEEA 3OJUA 4B9MA 4BDPA 4CJPA 1SL2A 4B9NA 3CM5A 4GMJB 3DLEA 3RR8A 4CF8A 4DLGA 5FRNA 2QK9A 4FLZA 3NGIA 1NK6A 1VSLA 4KHSA 4PA1A 4AHUA 3LWLA 1Q9XA 4KPYA 3WNEA 1JLBA 4CFDA 3RTVA 4QAGA 3OYDA 3K58A 3CFPA 1T05A 1NKEA 4FJJA 1ZBHA 2FBVA 4IKFA 5J2QA 5DK5A 4R5PA 2DTUA 1HRHA 2YKMA 4Z4IA 5SWMA 1YTAA 2W42A 3HXMA 2X74A 4B8CA 3AO5A 2XY8A 3ALYA 3NDKA 1S1TA 4OVLA 5K14A 3KTQA 1TKTA 1VSFA 3OYGA 1HMVA 4NYFA 1A5XA 3I0SA 3I8DA 3RMBA 4H4MA 3A2FA 4EP5A 4FM0A 3SUPA 4FJGA 3P83D 3T1AA 2D0AA 4OPJA 1I39A 4CEBA 3QESA 4IDKA 3SQ2A 3ZSVA 1VSJA 3VQEA 2P5OA 3ULDA 4JS4A 1YTUA 2YV0X 1BGXT 3OYIA 1IKWA 3OYAA 4KHQA 1N5YA 1NOZA 4JRPA 3D0PA 1IG9A 3TAPA 4ID5A 4M3UA 2HNDA 4CGHA 3V4IA 4B3OA 4B08A 2HW3A 3QIOA 4FJ7A 2PYJA 3DLHA 2KFNA 3DRSA 2HVIA 1JLCA 1LAVA 1WSIA 1TKZA 1QSSA 4DFKA 3KLEA 2G8VA 4ZHRA 3QNNA 2G8WA 3HSTB 2RN2A 1RT6A 4DSFA 4HUFA 4MQ3A 4Z4HA 5FROA 1LW2A 2D5RA 3P1GA 4FJLA 2VWKA 3PX6A 3NBPA 4FLVA 3OYEA 4CEOA 5CZ1A 4AILC 4CECA 1DTQA 4OPKA 4DTPA 3QEVA 1TAQA 1Z26A 1X1PA 1T03A 3PY8A 3O4QA 1Z25A 4CJVA 3WNHA 4C8KA 4FYDA 3RWUA 4M3XA 1ASVA 1BQNA 3NF8A 4N76A 1ZBFA 2HHTA 1QS4A 3OY9A 1VRTA 4AHCA 3ZSXA 4O0IA 3KJVA 4DQQA 3DLBA 1EXQA 1WAJA 3V9SA 3OYCA 3KKSA 3ITHA 4IFVA 1IH7A 1RCHA 3KKRA 4IG3A 4E1NA 1BL3A 3DLGA 3L3UA 4BDZA 4CJ4A 3AVKA 2G8IA 3HVRA 4LH4A 4EP4A 1VSEA 1VSDA 3KD1E 4KREA 4AHRA 4GW6A 1S6QA 3HPHA 1KSPA 4J2BA 2VG7A 3AO2A 3C6UA 3HVTA 4LD0A 3VQCA 4CEAA 4CJFA 4KHNA 1ZBIA 4HTUA 1JXBA 3HP9A 1QE1A 3OYMA 3SQ1A 1ZYQA 1TGOA 1KFDA 1C0UA 4BE2A 2HNYA 2HHSA 4CF9A 3T19A 2EHGA 4Q5VA 2IAJA 4CHQA 4CGFA 1NK5A 1TK8A 3KIOA 3BGRA 3G10A 4CJ3A 2QKKA 3RMDA 2GV9A 2Z1IA 2OPRA 1SKRA 3ZCMA 3RRHA 2IS3A 4DU3A 2Z1HA 3KLHA 3MXJA 4O55A 2YNHA 3KK3A 1WSJA 3LAMA 4DSKA 2JLEA 3ZT2A 1X9SA 3PO5A 3V1OA 4OKKA 2GUIA 3CQ8A 4CHNA 1A5VA 3PX0A 3RRGA 4FJNA 2HVHA 4DSEA 3F9KA 3S9HA 1B9DA 5J2NA 4DLEA 4NCGA 1UOCA 4J2AA 3TABA 4EZ9A 1JLEA 1VSMA 3V6DA 2G8UA 1RBUA 3ISNC 3LPTA 4DS5A 4CF0A 1L3SA 4C8OA 3QETA 1L3TA 4I9QA 3K5OA 4E3SA 2XRIA 4Z4GA 3M8PA 1XC9A 4I9LA 2HB5A 1NK4A 4DTMA 5FRMA 1I3AA 4ID1A 5HRPA 3D45A 3PO4A 4LSLA 3L2RA 4O44A 2BE2A 5EU7A 3M8SA 1C0TA 2HHQA 1NJWA 3OJSA 4M3ZA 4BACA 3G0ZA 3QINA 2KQ2A 2Z1JA 4CHPA 3NH2A 1RTJA 1JLGA 2P1JA 4E0DA 2X6SA 1BQMA 4E7KA 3TAQA 4ICLA 1TL1A 4CF2A 1L5UA 1TL3A 4K8XA 4PQUA 2E4LA 2VG5A 3CM6A 3QEXA 3S3OA 2P51A 4FZZA 3E01A 3NF7A 4CEZA 3C94A 1VRUA 1BCOA 2BGGA 4E7JA 4KHUA 4CK3A 3V9UA 5CYQA 1X9WA 4OGCA 2DFFA 4DWIA 2D0CA 4CK1A 3K2PA 4BE1A 4ZTFA 1JLAA 2X6NA 4FVMA 5J2MA 1RT5A 4FK2A 4FLUA 4OKJA 4DQRA 4RW8A 5I42A 3OYJA 4OLAA 2DY4A 4HCCA 1S9EA 3SJJA 2Z1GA 4FJ5A 3SCXA 4CEDA 1S5JA 4CGGA 3AA5X 1U48A 5SZTA 4KFBA 3VA3A 1UWBA 3VQQA 2G8FA 2OZMA 3NAEA 1Y97A 2ZD1A 4K8ZA 4HUGA 4FJHA 2YHAA 1EKEA 1QQCA 1RT2A 4OJRA 1BIUA 3HPGA 3VQ5A 4KV8A 1JL2A 4M42A 2XO7A 3LP1A 3ZSOA 4KI6A 2FBTA 3L8BA 3EY1A 1J5OA 3SUQA 3QEIA 4W5QA 4CGJA 1WN7A 4N47A 4RW7A 1DLOA 2RF2A 4I2PA 1D9DA 3L2VA 1R0AA 4J2EA 3TANA 4Z4CA 2OPSA 4C8LA 3KD5E 3HL8A 4RW6A 3IAYA 1RTDA 3B6PA 4FJ9A 5CYMA 4J2DA 4FJKA 3ZSZA 4KB0A 1YT3A 1VK0A 2Y1JA 3OYKA 4BWJA 3LWMA 3AVGA 1REVA 2WONA 2YKNA 2XHBA 4Z4FA 3MEDA 3I0RA 4CEQA 2A1RA 4B9SA 4QCLA 1CZBA 1NKCA 3DRPA 2PYLA 4M3WA 3NE6A 4DU4A 3OYFA 4CE9A 2FC0A 3KK1A 3LALA 1C1AA 3TR8A 3AVJA 3OYLA 1JLFA 3AA2A 2HHVA 1HQUA 4XIUA 2KTQA 1ITGA 1MU2A 1TVRA 4IFYA 4CJQA 4F2SA 4RW9A 3QO9A 4FK4A 4LH5A 4CJTA 3MXMA 3AO3A 5HLFA 1CXUA 1NJXA 2DFHA 4CJRA 3SUOA 1QHTA 3AVLA 3C95A 4CF1A 3KLFA 3QNOA 1KCFA 5DMRA 1VSIA 4KKOA 4M3YA 5HRNA 2YHBA 3MECA 4DSIA 5HBMA 1NK7A 1WLJA 4HVJA 3K5NA 1BHLA 3LZIA 3EZ5A 3QEPA 3LP3A 1NK0A 1JLQA 4DQIA 3V81A 4B9UA 3SV4A 5KI6A 4O4GA 3NCIA 4FJXA 4N41A 2X78A 4DTSA 4IG0A 3NGZA 3U3YA 3ZSRA 1U04A 1LWEA 2OPPA 3DRRA 1FKOA 3K5LA 5HROA 1EP4A 5I3UA 1J54A 3QIPA 3HO1A 2HNZA 3SQ4A 1D9FA 4CGDA 4MFBA 1TK5A 4DTJA 1RDCA 3V1RA 1CZ9A 3AVAA 2KFZA 1CXQA 1WSEA 3AVFA 2DFEA 2NUBA 2R7YA 4FCYA 3WNGA 1XWLA 4FLXA 4NCBA 2ZE2A 3NH1A 3TWHA 3V9WA 2F8SA 3MAQA 3OVNA 2YNFA 4YFUA 1UAXA 3KLIA 1KFSA 4W5NA 4DG1A 1TK0A 3OS1A 2B5JA 4CJEA 4KO0A 4F4KA 3AVNA 5HRRA 3CG7A 4H8KA 3L2WA 4DF4A 2HMIA 4N5SA 3HT3A 1S6PA 3AVBA 1GOBA 3RMAA 1RT3A 4F3TA 1RTHA 4E1MA 2O4IA 4CEFA 3DOLA 4CCHA 1NK8A 1Q9YA 3ZT3A 3MXIA 4GVMA 3L3VA 4M45A 4F3OA 1W9HA 5CZ2A 1ZBLA 5KGXA 4FJIA 4FK0A 1RT1A 3AO1A 1NKBA 2QKBA 3HM9A 1RILA 3LANA 3IRXA 1RDAA 1S1VA 3TAMA 3IS9A 4M3TA 4CERA 4HHTA 2VWJA 3V9ZA 4CJ5A 3M8RA 3VQPA 1IKVA 3M8QA 3L2QA 1HNIA 4CFCA 3JSMA 1T8EA 2G8HA 4FZXC 4LY7A 1NJZA 1U47A 1HQEA 4HUEA 5CY4A 1KTQA 5J1EA 4JS5A 2HHWA 4N56A 4YNQA 4JLHA 1D5AA 4DTXA 1ASUA 3SI6A 3SZ2A 3NGYA 3HK2A 4UQGA 4Y1DA 1LWCA 1RBRA 4FW2A 3DYAA 1TV6A 1ZBUA 3L2UA 3TI0A 3SNNA 4LSNA 4CK2A 1SKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2Q A;  1WAF A;  4CHY A;  3K59 A;  3OYN A;  4ELT A;  2YNI A;  5HRS A;  2D0B A;  4I7F A;  3AO4 A;  4EZ6 A;  2I5J A;  4DQS A;  3SPZ A;  4FM1 A;  1S1W A;  3OYH A;  3KLG A;  1WNS A;  1UA1 A;  1NJY A;  1XI1 A;  4CHZ A;  1QSL A;  2A1S A;  3EYZ A;  4PY5 A;  3H08 A;  4DQP A;  4CGI A;  4C8N A;  4CIF A;  4KTQ A;  4OGE A;  4ELV A;  1NOY A;  3ZT1 A;  2HHU A;  3ZT4 A;  4BE0 A;  3OS0 A;  4NCA A;  5JS2 A;  5C25 A;  5J2P A;  1U4B A;  4FXD A;  5HP1 A;  3VQ7 A;  1FXX A;  4KTZ A;  3TAG A;  3S3N A;  3DLK A;  3B6O A;  4B9T A;  4FLT A;  1G15 A;  3O4N A;  2PZS A;  1F21 A;  4E7H A;  4DS4 A;  4CJS A;  1TKD A;  3JYT A;  3VQ4 A;  1HYS A;  4DTO A;  4KHW A;  1KRP A;  5T7B A;  1C6V A;  4DSL A;  4ELU A;  3U3G A;  1GOA A;  1RT4 A;  4CFA A;  1S9G A;  4CES A;  3VQD A;  5KTQ A;  4M41 A;  4AHT A;  2WOM A;  1SL1 A;  1IKY A;  3V9X A;  1LV5 A;  4F8R A;  1WSF A;  3K57 A;  1RBS A;  3DLR A;  2XY6 A;  3ZSW A;  4F2R A;  4KB1 A;  3OYB A;  4KHY A;  2IC3 A;  1BIZ A;  4W5O A;  3CFR A;  4KTW A;  4CHO A;  3SUN A;  3HJF A;  1KVB A;  1HPZ A;  1XHX A;  3NF6 A;  4O0J A;  4HCB A;  2JGU A;  4DU1 A;  1CLQ A;  2LSN A;  1NK9 A;  3AA3 A;  3LDS A;  3T3F A;  4QOZ B;  3HPO A;  2B4J A;  5FDL A;  3WNF A;  1XHZ A;  4DFM A;  3ZSQ A;  4E19 A;  3C6T A;  1B9F A;  3DOK A;  4O5B A;  5KGW A;  3V1Q A;  4B9L A;  2GBZ A;  3UIQ A;  1TAU A;  1S1U A;  3CYM A;  4AHV A;  3P5J A;  4RG8 A;  4IBN A;  3VQ8 A;  2XY7 A;  3AVH A;  3DM2 A;  1RT7 A;  4NYN A;  4M3R A;  3VQ6 A;  3K5M A;  2KZM A;  4Z4E A;  3AV9 A;  4DMN A;  3THV A;  3S3M A;  4KI4 A;  4KRF A;  4FJM A;  3HP6 A;  1HJR A;  1X9M A;  3PX4 A;  1KLN A;  4Y1C A;  3RR7 A;  4DTU A;  4CJU A;  5C42 A;  3DI6 A;  1FKP A;  3DMJ A;  4CIG A;  3AVI A;  1T7P A;  1HYV A;  3ZT0 A;  4TSX A;  1QSY A;  1RTI A;  2ETJ A;  2KZZ A;  2VG6 A;  4RW4 A;  3SPY A;  2G8K A;  1YVU A;  2ATQ A;  1KVA A;  1BI4 A;  4C8M A;  5KRS A;  1BI4 B;  1LWF A;  1QTM A;  1U49 A;  4DF8 A;  3NHG A;  4WE1 A;  4DTN A;  5D3G A;  4BWM A;  3O3H A;  1B92 A;  4H4O A;  4CIE A;  2PY5 A;  3AA4 A;  2F96 A;  4G1Q A;  2RPI A;  5KRT A;  3VQB A;  1TKX A;  4OLB A;  4KAZ A;  2B6A A;  4W5T A;  1ASW A;  4FM2 A;  4FLW A;  3TAR A;  1N6Q A;  1RNH A;  3VQA A;  3PUF A;  1BCM A;  1LAW A;  2AJQ A;  3O3F A;  4FLY A;  2Y1I A;  1RBT A;  3IG1 A;  2HHX A;  1RDD A;  3NFA A;  2IDO A;  3MEG A;  2FBX A;  1FK9 A;  2Q3S A;  1IO2 A;  2KW4 A;  4DTR A;  3SQ0 A;  3NF9 A;  1HYZ A;  1SUQ A;  1A5W A;  3ASM A;  3KK2 A;  3HYF A;  1Q8I A;  1IKX A;  1K6Y A;  3VQ9 A;  3RMC A;  1S1X A;  1RBV A;  4PWD A;  1J53 A;  2QXF A;  3F73 A;  3QER A;  3SYZ A;  4CJL A;  1W0H A;  4CFB A;  1WSH A;  2OZS A;  1C1B A;  3QLH A;  3VN5 A;  5JS1 A;  3LAK A;  2IGI A;  1VSH A;  2OYQ A;  3VA0 A;  4BDY A;  1KVC A;  4FW1 A;  3LZJ A;  2F8T A;  4DFP A;  3LP2 A;  4CJW A;  1SL0 A;  1UA0 A;  4W5R A;  3OS2 A;  1EX4 A;  1SKW A;  3AVC A;  4L8R B;  3BDP A;  1BIS A;  3CFO A;  3PV8 A;  1J9A A;  1GOC A;  4DSJ A;  1EET A;  1WSG A;  2P5G A;  4ZTJ A;  1U45 A;  4DFJ A;  4Q0B A;  2O4G A;  1LW0 A;  2RKI A;  1D8Y A;  4B8A B;  4FZY A;  3LPU A;  3QEW A;  3U6F A;  3ZSY A;  1L3U A;  3O3G A;  1DTT A;  4E7L A;  2ZQB A;  1KLM A;  4E7I A;  4PUO A;  2E6M A;  1JXE A;  1RDB A;  4CEE A;  3TAE A;  3TAF A;  1HNV A;  2BAN A;  3AVM A;  4JRQ A;  1JKH A;  2OPQ A;  3FFI A;  2IOC A;  2YNG A;  5C24 A;  4CJK A;  5E41 A;  3SV3 A;  2BDP A;  2E6L A;  2OA8 A;  4AHS A;  3NH0 A;  4B9V A;  4FJ8 A;  4E89 A;  1O1W A;  2ITG A;  4Z0U A;  4OKE A;  4AH9 A;  1C0M A;  2XY5 A;  1VSK A;  1L3V A;  2EX3 A;  1JL1 A;  2FBY A;  1SV5 A;  1C1C A;  3LP0 A;  3MEE A;  3OJU A;  4B9M A;  4BDP A;  4CJP A;  1SL2 A;  4B9N A;  3CM5 A;  4GMJ B;  3DLE A;  3RR8 A;  4CF8 A;  4DLG A;  5FRN A;  2QK9 A;  4FLZ A;  3NGI A;  1NK6 A;  1VSL A;  4KHS A;  4PA1 A;  4AHU A;  3LWL A;  1Q9X A;  4KPY A;  3WNE A;  1JLB A;  4CFD A;  3RTV A;  4QAG A;  3OYD A;  3K58 A;  3CFP A;  1T05 A;  1NKE A;  4FJJ A;  1ZBH A;  2FBV A;  4IKF A;  5J2Q A;  5DK5 A;  4R5P A;  2DTU A;  1HRH A;  2YKM A;  4Z4I A;  5SWM A;  1YTA A;  2W42 A;  3HXM A;  2X74 A;  4B8C A;  3AO5 A;  2XY8 A;  3ALY A;  3NDK A;  1S1T A;  4OVL A;  5K14 A;  3KTQ A;  1TKT A;  1VSF A;  3OYG A;  1HMV A;  4NYF A;  1A5X A;  3I0S A;  3I8D A;  3RMB A;  4H4M A;  3A2F A;  4EP5 A;  4FM0 A;  3SUP A;  4FJG A;  3P83 D;  3T1A A;  2D0A A;  4OPJ A;  1I39 A;  4CEB A;  3QES A;  4IDK A;  3SQ2 A;  3ZSV A;  1VSJ A;  3VQE A;  2P5O A;  3ULD A;  4JS4 A;  1YTU A;  2YV0 X;  1BGX T;  3OYI A;  1IKW A;  3OYA A;  4KHQ A;  1N5Y A;  1NOZ A;  4JRP A;  3D0P A;  1IG9 A;  3TAP A;  4ID5 A;  4M3U A;  2HND A;  4CGH A;  3V4I A;  4B3O A;  4B08 A;  2HW3 A;  3QIO A;  4FJ7 A;  2PYJ A;  3DLH A;  2KFN A;  3DRS A;  2HVI A;  1JLC A;  1LAV A;  1WSI A;  1TKZ A;  1QSS A;  4DFK A;  3KLE A;  2G8V A;  4ZHR A;  3QNN A;  2G8W A;  3HST B;  2RN2 A;  1RT6 A;  4DSF A;  4HUF A;  4MQ3 A;  4Z4H A;  5FRO A;  1LW2 A;  2D5R A;  3P1G A;  4FJL A;  2VWK A;  3PX6 A;  3NBP A;  4FLV A;  3OYE A;  4CEO A;  5CZ1 A;  4AIL C;  4CEC A;  1DTQ A;  4OPK A;  4DTP A;  3QEV A;  1TAQ A;  1Z26 A;  1X1P A;  1T03 A;  3PY8 A;  3O4Q A;  1Z25 A;  4CJV A;  3WNH A;  4C8K A;  4FYD A;  3RWU A;  4M3X A;  1ASV A;  1BQN A;  3NF8 A;  4N76 A;  1ZBF A;  2HHT A;  1QS4 A;  3OY9 A;  1VRT A;  4AHC A;  3ZSX A;  4O0I A;  3KJV A;  4DQQ A;  3DLB A;  1EXQ A;  1WAJ A;  3V9S A;  3OYC A;  3KKS A;  3ITH A;  4IFV A;  1IH7 A;  1RCH A;  3KKR A;  4IG3 A;  4E1N A;  1BL3 A;  3DLG A;  3L3U A;  4BDZ A;  4CJ4 A;  3AVK A;  2G8I A;  3HVR A;  4LH4 A;  4EP4 A;  1VSE A;  1VSD A;  3KD1 E;  4KRE A;  4AHR A;  4GW6 A;  1S6Q A;  3HPH A;  1KSP A;  4J2B A;  2VG7 A;  3AO2 A;  3C6U A;  3HVT A;  4LD0 A;  3VQC A;  4CEA A;  4CJF A;  4KHN A;  1ZBI A;  4HTU A;  1JXB A;  3HP9 A;  1QE1 A;  3OYM A;  3SQ1 A;  1ZYQ A;  1TGO A;  1KFD A;  1C0U A;  4BE2 A;  2HNY A;  2HHS A;  4CF9 A;  3T19 A;  2EHG A;  4Q5V A;  2IAJ A;  4CHQ A;  4CGF A;  1NK5 A;  1TK8 A;  3KIO A;  3BGR A;  3G10 A;  4CJ3 A;  2QKK A;  3RMD A;  2GV9 A;  2Z1I A;  2OPR A;  1SKR A;  3ZCM A;  3RRH A;  2IS3 A;  4DU3 A;  2Z1H A;  3KLH A;  3MXJ A;  4O55 A;  2YNH A;  3KK3 A;  1WSJ A;  3LAM A;  4DSK A;  2JLE A;  3ZT2 A;  1X9S A;  3PO5 A;  3V1O A;  4OKK A;  2GUI A;  3CQ8 A;  4CHN A;  1A5V A;  3PX0 A;  3RRG A;  4FJN A;  2HVH A;  4DSE A;  3F9K A;  3S9H A;  1B9D A;  5J2N A;  4DLE A;  4NCG A;  1UOC A;  4J2A A;  3TAB A;  4EZ9 A;  1JLE A;  1VSM A;  3V6D A;  2G8U A;  1RBU A;  3ISN C;  3LPT A;  4DS5 A;  4CF0 A;  1L3S A;  4C8O A;  3QET A;  1L3T A;  4I9Q A;  3K5O A;  4E3S A;  2XRI A;  4Z4G A;  3M8P A;  1XC9 A;  4I9L A;  2HB5 A;  1NK4 A;  4DTM A;  5FRM A;  1I3A A;  4ID1 A;  5HRP A;  3D45 A;  3PO4 A;  4LSL A;  3L2R A;  4O44 A;  2BE2 A;  5EU7 A;  3M8S A;  1C0T A;  2HHQ A;  1NJW A;  3OJS A;  4M3Z A;  4BAC A;  3G0Z A;  3QIN A;  2KQ2 A;  2Z1J A;  4CHP A;  3NH2 A;  1RTJ A;  1JLG A;  2P1J A;  4E0D A;  2X6S A;  1BQM A;  4E7K A;  3TAQ A;  4ICL A;  1TL1 A;  4CF2 A;  1L5U A;  1TL3 A;  4K8X A;  4PQU A;  2E4L A;  2VG5 A;  3CM6 A;  3QEX A;  3S3O A;  2P51 A;  4FZZ A;  3E01 A;  3NF7 A;  4CEZ A;  3C94 A;  1VRU A;  1BCO A;  2BGG A;  4E7J A;  4KHU A;  4CK3 A;  3V9U A;  5CYQ A;  1X9W A;  4OGC A;  2DFF A;  4DWI A;  2D0C A;  4CK1 A;  3K2P A;  4BE1 A;  4ZTF A;  1JLA A;  2X6N A;  4FVM A;  5J2M A;  1RT5 A;  4FK2 A;  4FLU A;  4OKJ A;  4DQR A;  4RW8 A;  5I42 A;  3OYJ A;  4OLA A;  2DY4 A;  4HCC A;  1S9E A;  3SJJ A;  2Z1G A;  4FJ5 A;  3SCX A;  4CED A;  1S5J A;  4CGG A;  3AA5 X;  1U48 A;  5SZT A;  4KFB A;  3VA3 A;  1UWB A;  3VQQ A;  2G8F A;  2OZM A;  3NAE A;  1Y97 A;  2ZD1 A;  4K8Z A;  4HUG A;  4FJH A;  2YHA A;  1EKE A;  1QQC A;  1RT2 A;  4OJR A;  1BIU A;  3HPG A;  3VQ5 A;  4KV8 A;  1JL2 A;  4M42 A;  2XO7 A;  3LP1 A;  3ZSO A;  4KI6 A;  2FBT A;  3L8B A;  3EY1 A;  1J5O A;  3SUQ A;  3QEI A;  4W5Q A;  4CGJ A;  1WN7 A;  4N47 A;  4RW7 A;  1DLO A;  2RF2 A;  4I2P A;  1D9D A;  3L2V A;  1R0A A;  4J2E A;  3TAN A;  4Z4C A;  2OPS A;  4C8L A;  3KD5 E;  3HL8 A;  4RW6 A;  3IAY A;  1RTD A;  3B6P A;  4FJ9 A;  5CYM A;  4J2D A;  4FJK A;  3ZSZ A;  4KB0 A;  1YT3 A;  1VK0 A;  2Y1J A;  3OYK A;  4BWJ A;  3LWM A;  3AVG A;  1REV A;  2WON A;  2YKN A;  2XHB A;  4Z4F A;  3MED A;  3I0R A;  4CEQ A;  2A1R A;  4B9S A;  4QCL A;  1CZB A;  1NKC A;  3DRP A;  2PYL A;  4M3W A;  3NE6 A;  4DU4 A;  3OYF A;  4CE9 A;  2FC0 A;  3KK1 A;  3LAL A;  1C1A A;  3TR8 A;  3AVJ A;  3OYL A;  1JLF A;  3AA2 A;  2HHV A;  1HQU A;  4XIU A;  2KTQ A;  1ITG A;  1MU2 A;  1TVR A;  4IFY A;  4CJQ A;  4F2S A;  4RW9 A;  3QO9 A;  4FK4 A;  4LH5 A;  4CJT A;  3MXM A;  3AO3 A;  5HLF A;  1CXU A;  1NJX A;  2DFH A;  4CJR A;  3SUO A;  1QHT A;  3AVL A;  3C95 A;  4CF1 A;  3KLF A;  3QNO A;  1KCF A;  5DMR A;  1VSI A;  4KKO A;  4M3Y A;  5HRN A;  2YHB A;  3MEC A;  4DSI A;  5HBM A;  1NK7 A;  1WLJ A;  4HVJ A;  3K5N A;  1BHL A;  3LZI A;  3EZ5 A;  3QEP A;  3LP3 A;  1NK0 A;  1JLQ A;  4DQI A;  3V81 A;  4B9U A;  3SV4 A;  5KI6 A;  4O4G A;  3NCI A;  4FJX A;  4N41 A;  2X78 A;  4DTS A;  4IG0 A;  3NGZ A;  3U3Y A;  3ZSR A;  1U04 A;  1LWE A;  2OPP A;  3DRR A;  1FKO A;  3K5L A;  5HRO A;  1EP4 A;  5I3U A;  1J54 A;  3QIP A;  3HO1 A;  2HNZ A;  3SQ4 A;  1D9F A;  4CGD A;  4MFB A;  1TK5 A;  4DTJ A;  1RDC A;  3V1R A;  1CZ9 A;  3AVA A;  2KFZ A;  1CXQ A;  1WSE A;  3AVF A;  2DFE A;  2NUB A;  2R7Y A;  4FCY A;  3WNG A;  1XWL A;  4FLX A;  4NCB A;  2ZE2 A;  3NH1 A;  3TWH A;  3V9W A;  2F8S A;  3MAQ A;  3OVN A;  2YNF A;  4YFU A;  1UAX A;  3KLI A;  1KFS A;  4W5N A;  4DG1 A;  1TK0 A;  3OS1 A;  2B5J A;  4CJE A;  4KO0 A;  4F4K A;  3AVN A;  5HRR A;  3CG7 A;  4H8K A;  3L2W A;  4DF4 A;  2HMI A;  4N5S A;  3HT3 A;  1S6P A;  3AVB A;  1GOB A;  3RMA A;  1RT3 A;  4F3T A;  1RTH A;  4E1M A;  2O4I A;  4CEF A;  3DOL A;  4CCH A;  1NK8 A;  1Q9Y A;  3ZT3 A;  3MXI A;  4GVM A;  3L3V A;  4M45 A;  4F3O A;  1W9H A;  5CZ2 A;  1ZBL A;  5KGX A;  4FJI A;  4FK0 A;  1RT1 A;  3AO1 A;  1NKB A;  2QKB A;  3HM9 A;  1RIL A;  3LAN A;  3IRX A;  1RDA A;  1S1V A;  3TAM A;  3IS9 A;  4M3T A;  4CER A;  4HHT A;  2VWJ A;  3V9Z A;  4CJ5 A;  3M8R A;  3VQP A;  1IKV A;  3M8Q A;  3L2Q A;  1HNI A;  4CFC A;  3JSM A;  1T8E A;  2G8H A;  4FZX C;  4LY7 A;  1NJZ A;  1U47 A;  1HQE A;  4HUE A;  5CY4 A;  1KTQ A;  5J1E A;  4JS5 A;  2HHW A;  4N56 A;  4YNQ A;  4JLH A;  1D5A A;  4DTX A;  1ASU A;  3SI6 A;  3SZ2 A;  3NGY A;  3HK2 A;  4UQG A;  4Y1D A;  1LWC A;  1RBR A;  4FW2 A;  3DYA A;  1TV6 A;  1ZBU A;  3L2U A;  3TI0 A;  3SNN A;  4LSN A;  4CK2 A;  1SKS A; 
#chains in the Genus database with same CATH topology
 3O9T A;  3P31 A;  1GLA G;  4CHY A;  1OH8 A;  3OYN A;  2YNI A;  5HRS A;  1J6Z A;  3N4P A;  3KLG A;  1WNS A;  1IJJ A;  2CH5 A;  1N34 K;  1QSL A;  3E9P A;  5AQQ A;  4CGI A;  4CIF A;  4FWL A;  4BRG A;  4DV0 K;  1NG9 A;  4BE0 A;  4NCA A;  5JS2 A;  5J2P A;  3BZC A;  4AQY K;  2QWM A;  3B6O A;  4FLT A;  5AQX A;  4DS4 A;  1OKJ A;  5HL7 L;  1C6V A;  4DSL A;  1S9G A;  4CES A;  3VQD A;  3ZX3 A;  5AQM A;  3MX5 A;  4M41 A;  2WOM A;  1R59 O;  2CGK A;  1LV5 A;  4F2R A;  5HOO A;  1IBM K;  2IC3 A;  4PHT X;  1W7A A;  4F9O A;  1HLU A;  4DUY K;  4KTW A;  4CHO A;  1NU0 A;  3HJF A;  3VEN A;  4WFB L;  1NK9 A;  3FZH A;  2WTU A;  3LDS A;  4QOZ B;  4BR7 A;  3ZSQ A;  2VGN A;  3V1Q A;  3UIQ A;  4FOE A;  4AHV A;  3VMF B;  1RT7 A;  3J80 O;  4FWP A;  3U9Z A;  4BC4 A;  4DMN A;  1TUY A;  4KRF A;  1KLN A;  4CJU A;  5DM6 L;  3CME N;  3BEX A;  1HYV A;  4CBU A;  2KZZ A;  2VG6 A;  4RW4 A;  3SPY A;  2ATQ A;  1KVA A;  3QML A;  1N32 K;  4C8M A;  3NHG A;  4WE1 A;  4DTN A;  2YJE A;  4A59 A;  2PY5 A;  3AA4 A;  2E8A A;  4G1Q A;  4CZE A;  1IBK K;  3QFU A;  4FM2 A;  3O08 A;  3IUC A;  3LL3 A;  1BCM A;  1LAW A;  1OH6 A;  5GAD P;  3CCL N;  1RBT A;  2KW4 A;  2ZWH A;  1QQN A;  2O8B B;  3QIC A;  1YI2 N;  1RBV A;  2QXF A;  3F73 A;  2OZS A;  1C1B A;  3QLH A;  4DV4 K;  5JS1 A;  4M7Y A;  3NVM A;  4AM7 A;  3LZJ A;  4CBX A;  5IWA K;  1J9A A;  4WF9 L;  2E5L K;  3K0S A;  1WSG A;  4JYA K;  4WCE L;  4K0K K;  1U45 A;  1QVG M;  1C0F A;  3O9S A;  4Q0B A;  4B8A B;  3PLA A;  3K9J A;  4IFE A;  1JXE A;  2NRH A;  1HNV A;  4JRQ A;  3KVG A;  2OPQ A;  2IOC A;  4ISG A;  5AQV A;  4AHS A;  3M1F A;  1O1W A;  5C2F A;  4FWR A;  1C0M A;  2VQE K;  5JVG L;  2FBY A;  1SV5 A;  3LP0 A;  2QM1 A;  2GEM A;  4GV6 A;  3CM5 A;  4GMJ B;  3Q7C A;  4H5T A;  4CF8 A;  4JK7 A;  4DLG A;  5FRN A;  4AHU A;  4KPY A;  3WNE A;  3RTV A;  2FSJ A;  3CFP A;  5IT9 O;  5J2Q A;  1EO1 A;  4Z4I A;  1YHQ N;  3HXM A;  2XY8 A;  2ZGY A;  5GIO A;  4BQL A;  1VSF A;  5BPN A;  3OYG A;  5GAG P;  3I0S A;  1TYQ B;  4H0Y B;  2ZM6 K;  1VQ8 N;  3ULD A;  1YTU A;  3KWG A;  4YOY A;  1IKW A;  4A61 A;  2OCE A;  1NOZ A;  3D0P A;  3N4Q A;  1IG9 A;  4IJA A;  4B08 A;  3PSF A;  5KQD A;  2G8V A;  4GVE A;  4ZHR A;  3QNN A;  2RN2 A;  4DSF A;  3WXK A;  2O8C B;  3FZF A;  4BRH A;  4FJL A;  2VWK A;  4JKG A;  4FLV A;  4CEO A;  4YOR A;  4AIL C;  3MN9 A;  4OPK A;  4CVN E;  1X1P A;  2D1K A;  4FSV A;  1T03 A;  3MCA B;  4JKF A;  1OH7 A;  4C8K A;  4M3X A;  5CE3 A;  3OY9 A;  3ZSX A;  3DLB A;  5GAE P;  2HBK A;  2A41 A;  3ITH A;  1GLD G;  2BTF A;  1RCH A;  3KKR A;  1VQL N;  3DLG A;  4CZM A;  2HBL A;  3JXU A;  2G8I A;  4LH4 A;  3KD1 E;  2GUP A;  4AHR A;  2WUS A;  3HPH A;  4H5W A;  3AO2 A;  3C6U A;  4CEA A;  4LD0 A;  4HTU A;  5EVZ A;  4BE2 A;  2HNY A;  1N8R O;  4CF9 A;  1YIT N;  2YHX A;  4IWV A;  4B9Q A;  2QKK A;  1NMN A;  1XNQ K;  1SKR A;  2Z1H A;  1SS6 A;  2YNH A;  4O55 A;  3KK3 A;  3RSE B;  3HI0 A;  2GUI A;  3LDQ A;  4CHN A;  4ILG B;  4ISE A;  4MDA A;  4FJN A;  2HVH A;  2Q97 A;  5AZJ B;  1UOC A;  4EZ9 A;  3V6D A;  2G8U A;  4FWN A;  3K5O A;  4E3S A;  4Z4G A;  3M8P A;  4IXC A;  3CJA A;  2HB5 A;  4B1V A;  5EOY A;  4J8F A;  1SZ2 A;  2HHQ A;  1NJW A;  3OJS A;  3QIN A;  3MN6 A;  3NH2 A;  2P1J A;  4E0D A;  1BQM A;  3VEV A;  3O9U A;  1ATS A;  3CM6 A;  3QEX A;  3SAF A;  2P51 A;  4FZZ A;  4CEZ A;  2YHW A;  3C94 A;  1VRU A;  3V9U A;  5CYQ A;  4C1N I;  4JKE A;  2D0C A;  4CK1 A;  1VHX A;  3WEE A;  4ZTF A;  1JLA A;  3WQU A;  3I8B A;  4BRC A;  4RW8 A;  4FWQ A;  4OLA A;  3MK6 A;  3WXJ A;  2Z1G A;  2P9U B;  3SCX A;  4JEP A;  2G8F A;  1M90 O;  1NGH A;  2ZD1 A;  3VGK A;  4HUG A;  4FJH A;  1XUP O;  4A2B A;  1QQC A;  1RT2 A;  3HPG A;  2CGJ A;  1JL2 A;  1P90 A;  3ZSO A;  2W41 A;  2FBT A;  2P9L A;  2VQF K;  3THW A;  2WC9 A;  1J5O A;  4W5Q A;  4CGJ A;  4RW7 A;  4WYB A;  2BH1 A;  5JVH L;  1Q86 O;  3TAN A;  4C8L A;  4M63 C;  1W97 L;  1YUW A;  1YT3 A;  1NGD A;  1C0G A;  1VQK N;  2KLA A;  3I0R A;  2A1R A;  1GLE G;  2V7Z A;  4DV3 K;  4B9S A;  4QCL A;  1BA0 A;  3DRP A;  1X3M A;  2FSN A;  3LAL A;  5M1F A;  1D4X A;  1C1A A;  3M6G A;  1HUX A;  3LDN A;  3AA2 A;  1MU2 A;  1TVR A;  4IFY A;  3AO3 A;  1EWQ A;  1CXU A;  4CJR A;  3SUO A;  2NNW A;  3C95 A;  3KLF A;  3DXM A;  4RCH A;  1BDG A;  3K5N A;  3J81 O;  3EZ5 A;  2F7T A;  3LP3 A;  2ZGZ A;  5KI6 A;  4FJX A;  1ZC6 A;  3VEZ A;  1J54 A;  3T7Z A;  4CGD A;  4DTJ A;  3V1R A;  1CXQ A;  1WSE A;  3IDH A;  3WNG A;  2KKZ A;  3OVN A;  4JI6 K;  1UAX A;  4DG1 A;  3ZX2 A;  1TK0 A;  2B5J A;  4MDB A;  2O8B A;  3UKR B;  5HRR A;  4DF4 A;  3L2W A;  3UKU A;  1KAZ A;  3VPZ A;  4E1M A;  1YAG A;  3TU5 A;  3DOL A;  3I56 N;  3OW2 M;  1JCG A;  5AQG A;  2E2N A;  1ZBL A;  4FJI A;  3J7A P;  3AO1 A;  4DHY A;  1RDA A;  5AQS A;  4WFN L;  1VQO N;  5BN8 A;  3V9Z A;  4GKJ K;  2QWR A;  3VQP A;  3JSM A;  3M8Q A;  1HNI A;  1T8E A;  4FZX C;  4LY7 A;  3OBW A;  2Q36 A;  1U47 A;  3CHW A;  3EE9 A;  2HHW A;  4N56 A;  4WQ5 C;  4YOX A;  3VEX A;  2QEX N;  1OVY A;  1RBR A;  1KQS M;  3LDO A;  3K59 A;  2QWN A;  4I7F A;  3R9P A;  4EZ6 A;  3SPZ A;  1S1W A;  4JHD B;  1NJY A;  3EYZ A;  4JD2 A;  4DQP A;  4PY5 A;  3FLC O;  1NOY A;  1ESV A;  2HHU A;  4FL9 A;  3OS0 A;  5AQF A;  3O9R A;  3FGU A;  5C12 A;  4KTZ A;  3TAG A;  3S3N A;  4DKW A;  1G15 A;  2FLO A;  1HYS A;  4CJS A;  3VQ4 A;  4BC2 A;  1Y64 A;  3R8E A;  3HOS A;  1GOA A;  4CFA A;  5BPM A;  3QBX A;  2JWL A;  2XY6 A;  4KHY A;  3SUN A;  1XHX A;  3NF6 A;  4HCB A;  2JGU A;  4CZF A;  1CLQ A;  2LSN A;  3O80 A;  3LM2 A;  3T3F A;  1I94 K;  3WNF A;  1XHZ A;  4DFM A;  1MWM A;  4E19 A;  1TAU A;  3MX2 A;  5KGW A;  1G99 A;  1HKB A;  3CYM A;  4IBN A;  5M1N A;  3CJ9 A;  3GDQ A;  3VGM A;  4DR3 K;  2AP1 A;  1HX1 A;  4NYN A;  4CZJ A;  4M3R A;  3THV A;  3S3M A;  3HP6 A;  1HJR A;  3PX4 A;  3I33 A;  2ASP A;  3DI6 A;  1FKP A;  1T7P A;  3ZT0 A;  2ETJ A;  2G8K A;  1BI4 A;  3OBY A;  4H0P A;  5KRS A;  1T6D A;  1QTM A;  1U49 A;  1K8K A;  3O3H A;  4CIE A;  5MLC Q;  2UU9 K;  2HHH K;  1GLC G;  2RPI A;  5KRT A;  1YIJ N;  4OLB A;  4KAZ A;  2B6A A;  4H03 B;  3TAR A;  1N6Q A;  1ATN A;  4BGA A;  2Y1I A;  3C65 A;  3A0I X;  3NFA A;  2Q3S A;  1IO2 A;  4BRA A;  4DTR A;  3SQ0 A;  2P9I B;  1K6Y A;  4IEI A;  3RMC A;  4BRQ A;  1J53 A;  1XNR K;  4CFB A;  3RSE A;  3WXL A;  3GBT A;  4L3Q A;  2HMP A;  2HST A;  1XC3 A;  1SL0 A;  1NGI A;  4W5R A;  1QQO A;  4H0V B;  4XEI A;  4L8R B;  1BIS A;  3PV8 A;  4DSJ A;  1EET A;  2RE2 A;  3CI5 A;  2P9P A;  3S41 A;  3ZX0 A;  3QEW A;  4LFC K;  3H45 C;  1L3U A;  2V7Y A;  2UUA K;  1KLM A;  3D2E B;  1BUP A;  1RDB A;  2NLX A;  3TAE A;  3TAF A;  3AVM A;  2BAN A;  5AQO A;  3FFK B;  1JKH A;  3SV3 A;  2YNG A;  5E41 A;  3CQY A;  4Z0U A;  3TTC A;  2A42 A;  3KHY A;  1VSK A;  2EX3 A;  1JL1 A;  1NGJ A;  3OJU A;  2P9N B;  5GIN A;  2O8D B;  3A8Y A;  4B9N A;  3RR8 A;  3CJ1 A;  1RDW X;  5TKY A;  1Q9X A;  1JLB A;  4CFD A;  5DM7 L;  4QAG A;  1NKE A;  3UB5 A;  2FXU A;  2FBV A;  4DCH A;  4IKF A;  1U2V B;  2VGM A;  1NJI O;  2IVP A;  2P9U A;  2X74 A;  3ALY A;  1HKC A;  4BC3 A;  1TKT A;  3I8D A;  3RMB A;  4H4M A;  3SUP A;  4EP5 A;  3P83 D;  1T3V A;  4CEB A;  4RWT A;  4IOC L;  4B3R K;  3CQX A;  4IDK A;  3EEQ A;  2HBM A;  3ZSV A;  1RFQ A;  2CH6 A;  4RTF D;  3VQE A;  2P5O A;  1GLB G;  1KXP A;  4B1Y B;  2NRV A;  4YOV A;  3OYA A;  4ID5 A;  4CGH A;  3V4I A;  4B3O A;  2HW3 A;  3QIO A;  1ILY A;  3TSQ A;  2PYJ A;  4QS9 A;  2KFN A;  2HVI A;  4DR5 K;  4B1Z A;  2I7P A;  3KLE A;  3CCU N;  2QTD A;  3P1G A;  3UE5 A;  2RHK A;  3WXI A;  3ZET B;  2ASO A;  4DQ8 A;  1O13 A;  4CEC A;  2A3Z A;  4JKD A;  3PY8 A;  3WNH A;  1ASV A;  4O0I A;  4DQQ A;  1EXQ A;  5ADX A;  3D2F A;  1IH7 A;  4E1N A;  1BL3 A;  4BDZ A;  3L3U A;  2UUC K;  4CJ4 A;  3AVK A;  3HVR A;  1VSD A;  1S6Q A;  4BRP A;  2VG7 A;  4JNE A;  4KHN A;  3VES A;  4BVP A;  5JLH A;  1KFD A;  1C0U A;  3ZLJ A;  2P9S A;  3T19 A;  4NO7 A;  4BVO A;  4CHQ A;  4NLB A;  3JAM O;  4CJ3 A;  1VQN N;  1LOT B;  2QI2 A;  3SMP A;  2FF3 B;  3SMS A;  3A5M C;  5EX5 A;  3RRH A;  1YJ9 N;  4BRE A;  3MXJ A;  3QFP A;  1WSJ A;  3LAM A;  4FOI A;  3O4W A;  3CQ8 A;  3F9K A;  3HTV A;  1OH5 A;  5J2N A;  4DLE A;  2F9W A;  3TAB A;  1JLE A;  1VSM A;  1Q7Y O;  3EKU A;  1QHA A;  3ISN C;  3L6Q A;  3KZB A;  2BUP A;  4I9Q A;  4CZH A;  3QET A;  4LF7 K;  2NRX A;  2GWK A;  1YJN N;  4I9L A;  2AA4 A;  2P9K B;  4ID1 A;  3CJC A;  4LSL A;  4CJ7 A;  3GL1 A;  3L2R A;  3M8S A;  1DKG D;  1C0T A;  4EFH A;  4M7X A;  4CHP A;  1RTJ A;  4B3S K;  4JI4 K;  2X6S A;  3FZK A;  4E7K A;  4ICL A;  1TL3 A;  5ELZ A;  2IIR A;  4K8X A;  4PQU A;  2E4L A;  3S3O A;  2BGG A;  4BRN A;  4OGC A;  4BRL A;  4DWI A;  5A2Q O;  2X6N A;  4FVM A;  5C10 A;  4FK2 A;  4A57 A;  5I42 A;  4Y0W A;  4HCC A;  3HOT A;  4FJ5 A;  4CED A;  3AA5 X;  5SZT A;  4KFB A;  3VA3 A;  3VQQ A;  5BRD A;  3VF6 A;  3CXC M;  3CC2 N;  5FPE A;  4YOT A;  3LP1 A;  2YI1 A;  4KI6 A;  3THX B;  4H0T B;  1VQ6 N;  2E1Y A;  3D6R A;  3QEI A;  1WN7 A;  4N47 A;  4FO0 A;  5AJ3 K;  1IG8 A;  3C7N B;  2RF2 A;  4MO4 A;  1D9D A;  4LF6 K;  4J2E A;  5AQU A;  4Z4C A;  2OPS A;  3KD5 E;  1RTD A;  3B6P A;  1H1V A;  5CYM A;  1K8A O;  4MLE A;  4H0O A;  2Y1J A;  4BWJ A;  3AVG A;  4ISF A;  3A5O C;  3EKS A;  5BR9 A;  4Z4F A;  3SLC A;  2OTL N;  1CZB A;  4BR9 A;  5FPM A;  1TUU A;  3AAQ A;  3ENO A;  3OYL A;  1JJ2 M;  4YDU C;  1HQU A;  4K25 A;  4XIU A;  4CJQ A;  3ZEU A;  4FK4 A;  4LH5 A;  2W6K A;  4CJT A;  3MXM A;  2O8E A;  1Z6R A;  4NXM K;  5DMR A;  1VSI A;  3GOI A;  1OVQ A;  2YHB A;  3MEC A;  1NK7 A;  1ZXO A;  1WLJ A;  4HVJ A;  3LZI A;  3QEP A;  5H1S Q;  4B9U A;  4DR4 K;  3SV4 A;  4O4G A;  2X78 A;  4IG0 A;  4KH5 A;  3WQT A;  3K5L A;  1EP4 A;  3VET A;  3E1Y A;  3HO1 A;  1ATR A;  1TK5 A;  1HNZ K;  1RDC A;  3VF4 A;  2KFZ A;  4U67 L;  2DFE A;  4FCY A;  4FLX A;  5AQJ A;  1XWL A;  2ZE2 A;  3ULE B;  4WFA L;  2YNF A;  4YOW A;  4YFU A;  1KFS A;  4W5N A;  4JK9 A;  3OS1 A;  4KO0 A;  3THY B;  2P9I A;  3CG7 A;  4N5S A;  3O1B A;  3G6E N;  4JI8 K;  1MDU B;  1S6P A;  3AVB A;  1GOB A;  3RMA A;  1RT3 A;  4F3T A;  4BG9 A;  3IMX A;  1RTH A;  4EIA A;  4EAH D;  5BRF A;  2YX6 A;  4CBW A;  1Q81 O;  4AF1 A;  2FSK A;  5CZ2 A;  5KGX A;  4FK0 A;  4FPA A;  4DR2 K;  1RT1 A;  1N33 K;  3LAN A;  4M3T A;  3U8X A;  3TAM A;  3IS9 A;  3TPQ A;  2E88 A;  4R79 A;  3M8R A;  1JCF A;  3WT0 A;  1S3X A;  5AZI A;  3L2Q A;  1S72 N;  4I6M B;  1NNE A;  4HTL A;  3DLL L;  3ID6 A;  1HQE A;  4HWI A;  5M1Q A;  4YNQ A;  4JLH A;  4B3T K;  4DTX A;  1GLF O;  2Q31 A;  4A5A A;  1SAZ A;  1DGK N;  1LWC A;  4Y1D A;  3L0Q A;  4U7B A;  4LF4 K;  1TV6 A;  3L2U A;  3A5N C;  4CK2 A;  4I2Q A;  1WAF A;  2D0B A;  3AO4 A;  5ADX H;  4PL8 A;  5CHI A;  4DQS A;  3H46 O;  3OYH A;  1UA1 A;  2A1S A;  4JI2 K;  3H08 A;  3HBT A;  4C8N A;  4QS7 A;  4KTQ A;  4ELV A;  3EL2 A;  3ZT4 A;  3SAG A;  5C25 A;  1YXQ A;  5BRE A;  3VQ7 A;  5HP1 A;  1FXX A;  3VER A;  4MO5 A;  3CCS N;  1BOT O;  3P4I A;  2PZS A;  1F21 A;  3F5T A;  4E7H A;  1BU6 O;  1BWF O;  4KHW A;  4H5R A;  1RT4 A;  4DV6 K;  5KTQ A;  3PIP L;  1SL1 A;  4AM6 A;  3V9X A;  1WSF A;  3TSU A;  1RBS A;  3K57 A;  4KB1 A;  1DT9 A;  1BIZ A;  4A62 A;  4B3M K;  1KVB A;  5E84 A;  1Q82 O;  3O1W A;  4O0J A;  2GEL A;  4DB3 A;  4DU1 A;  3ZYY X;  1YF5 L;  4CW7 B;  3HPO A;  2B4J A;  5FDL A;  4B9L A;  3C6T A;  2QXL A;  3DOK A;  4O5B A;  2GBZ A;  1S1U A;  1NGG A;  4RG8 A;  3VEW A;  3ZET A;  3AVH A;  3VQ6 A;  1NM1 A;  2KZM A;  3TSP A;  4JI7 K;  4LFA K;  4FJM A;  1X9M A;  3QBW A;  1HKG A;  3T1H K;  3RR7 A;  1WB9 A;  3DMJ A;  1KC8 O;  1QSY A;  4TSX A;  1RTI A;  1YVU A;  2QW9 A;  1V4S A;  2PAV A;  4CZI A;  1LWF A;  4DF8 A;  1DEJ A;  1E4G T;  1J5E K;  4H4O A;  4DR7 K;  4B1X B;  1K73 O;  2F4V K;  4WQ5 A;  5BPL A;  3VQB A;  4BRK A;  1ASW A;  3LDP A;  1RNH A;  3VQA A;  4GKK K;  4FLY A;  2HHX A;  3MWT A;  2IDO A;  3MEG A;  2FBX A;  1FK9 A;  1HYZ A;  1SUQ A;  5TKW A;  3KK2 A;  3HYF A;  1Q8I A;  3BF1 A;  3VQ9 A;  1S1X A;  4PWD A;  4DV5 K;  3SYZ A;  3SJH A;  4K42 A;  2D0P A;  3J7Y P;  3LAK A;  1VSH A;  2IGI A;  2OYQ A;  4BDY A;  1KVC A;  4CJW A;  4YY3 K;  1UA0 A;  3OS2 A;  3AVC A;  3BDP A;  1GOC A;  2J4R A;  2GWJ A;  2P5G A;  2A5X A;  4CZK A;  1LW0 A;  1D8Y A;  3U6F A;  3ZSY A;  4BRI A;  3E66 A;  3O3G A;  4PUO A;  2E6M A;  3QB0 A;  3CPE A;  3CC7 N;  2VWB A;  5AQZ A;  2UXB K;  3O6W A;  5C24 A;  4CJK A;  2BDP A;  3BF3 A;  2E6L A;  2OA8 A;  3NH0 A;  5AQL A;  2ITG A;  4E89 A;  4OKE A;  4AH9 A;  2HOE A;  4DV1 K;  2XY5 A;  1L3V A;  5M1K A;  1C1C A;  4B9M A;  4BDP A;  3DWL A;  1VQ9 N;  1HR0 K;  3DLE A;  3H6E A;  2QK9 A;  4YOU A;  4PA1 A;  4KBO A;  4BQZ A;  3LWL A;  4PKG A;  4KHS A;  1T05 A;  3OYD A;  3E9O A;  1ZBH A;  5FPD A;  5DK5 A;  2YKM A;  1MA9 B;  4JI5 K;  3NDK A;  5K14 A;  4OVL A;  1RGI A;  4NYF A;  1TYQ A;  4FM0 A;  3CET A;  4FJG A;  2OAN A;  2E2O A;  4OPJ A;  3QES A;  3SQ2 A;  4JS4 A;  3THX A;  2YV0 X;  1BGX T;  3OYI A;  3A5L C;  2GX9 A;  2YHY A;  3TAP A;  4M3U A;  2HND A;  3DAW A;  5AQH A;  3CCE N;  4FWO A;  3CC4 N;  4FJ7 A;  1U6Z A;  1NMD A;  1HJO A;  4KH4 A;  4PKH A;  1JLC A;  1LAV A;  1QSS A;  4DFK A;  2G8W A;  3HST B;  2O8C A;  4HUF A;  4MQ3 A;  2D5R A;  5LMU K;  4BRF A;  3PX6 A;  3LM9 A;  5CZ1 A;  4JKG B;  2D0O A;  3TTD A;  4BGB A;  4DV7 K;  1TAQ A;  1Z26 A;  1EQY A;  3O4Q A;  3VTI A;  4FYD A;  4N76 A;  1ZBF A;  5AQY A;  1QS4 A;  1VRT A;  4AHC A;  3OTO K;  4XH4 A;  4MLH A;  3KKS A;  4IFV A;  1VSE A;  4KRE A;  1QZ6 A;  4GW6 A;  2Q1N A;  1KSP A;  4X62 K;  3VQC A;  1ZBI A;  4CJF A;  3SBG A;  3HP9 A;  3OYM A;  1ZYQ A;  3SQ1 A;  5C15 A;  1TGO A;  1K9M O;  4V19 S;  1NGC A;  2EHG A;  4Q5V A;  2IAJ A;  2H3G X;  3CCM N;  4H0X B;  2OPR A;  1N36 K;  2IS3 A;  4DU3 A;  3R3L A;  3MDQ A;  4DSK A;  2JLE A;  3ZT2 A;  5KPZ A;  1X9S A;  3PO5 A;  3V1O A;  1A5V A;  5AZJ A;  1XMQ K;  3S9H A;  1B9D A;  1JCE A;  4NCG A;  4DS5 A;  4CF0 A;  1L3S A;  4C8O A;  1NK4 A;  5FRM A;  1NGB A;  3D45 A;  4O44 A;  2BE2 A;  5EU7 A;  4B1U B;  1VQ7 N;  4YHH K;  4H5N A;  4M3Z A;  4BAC A;  3G0Z A;  2KQ2 A;  3HSC A;  2HF4 A;  1JLG A;  4GNI A;  3HZ6 A;  3TAQ A;  4IO8 A;  1TL1 A;  1NGA A;  3OHR A;  4G9Z A;  3E01 A;  1GLL O;  1QZ5 A;  1BG3 A;  4E7J A;  4KHU A;  3H1Q A;  2ZJQ L;  3D7E O;  2DFF A;  5BN9 A;  3K2P A;  1BO5 O;  4WQ4 C;  3WEE B;  3I55 N;  3FZM A;  4OKJ A;  1FJG K;  4DQR A;  3OYJ A;  2W40 A;  1S9E A;  3SJJ A;  2NRT A;  4H5V A;  4CGG A;  1S5J A;  1HNX K;  3KK7 A;  2OZM A;  1UWB A;  3K9K A;  2ITM A;  1Y97 A;  4K8Z A;  4IJN A;  1BIU A;  3VQ5 A;  5F0X A;  4KV8 A;  1X9J A;  4BR4 A;  2XO7 A;  1VQM N;  3SUQ A;  2P9L B;  1QQM A;  1XQS C;  3THW B;  1DLO A;  4I2P A;  3L2V A;  3J8A A;  3VF2 A;  2ZJP L;  4RW6 A;  4J2D A;  3ZSZ A;  2Q0R A;  1KAX A;  4LF9 K;  1REV A;  5M1O A;  3R1X A;  4OPH A;  5KPT A;  2UYT A;  4IO9 L;  1HPM A;  4M3W A;  3WUH A;  3NE6 A;  3EZW A;  2WBN A;  4NLC A;  1VQ5 N;  3AVJ A;  1JLF A;  2HHV A;  3VOV A;  3ATV A;  5HLF A;  1NJX A;  3WXM B;  1QHT A;  3AVL A;  3DJC A;  4CF1 A;  3ENH A;  1KCF A;  4IDH A;  4KKO A;  5HRN A;  2A6A A;  2I7N A;  5HBM A;  3DXM B;  1NK0 A;  5I9E B;  2QWL A;  1VAZ A;  3HRG A;  5FPN A;  5LL6 Z;  4N41 A;  4FWK A;  4DTS A;  3U3Y A;  1U04 A;  1LWE A;  1WBB A;  3DRR A;  1FKO A;  5HRO A;  3OA9 A;  3DXK B;  2HNZ A;  4MFB A;  1CZ9 A;  3M5R A;  3AVF A;  2NUB A;  2R7Y A;  3T1Y K;  3NH1 A;  4A5B A;  3V9W A;  1KD1 O;  3CD6 N;  3KLI A;  4CJE A;  3UKR A;  3ID8 A;  4H8K A;  2HMI A;  3HT3 A;  3W0L A;  3UKU B;  3H3O B;  3IFR A;  2O4I A;  4CCH A;  2NZT A;  1IBL K;  3P39 A;  3MXI A;  4GVM A;  3L3V A;  4M45 A;  3CJB A;  4FWS A;  3HM9 A;  4LC9 B;  1S1V A;  5JIC A;  3P38 A;  4HHT A;  3G4S N;  1IKV A;  2G8H A;  4DV2 K;  4JKA A;  1NJZ A;  3B8A X;  4HUE A;  5CY4 A;  4JS5 A;  3NVK A;  1D5A A;  1ASU A;  3NGY A;  3HK2 A;  4UQG A;  4DUZ K;  4FW2 A;  3DYA A;  4CD3 A;  3SNN A;  1WOQ A;  4LSN A;  4F8R A;  2CGL A;  2QWQ A;  3O5B A;  1VQ4 N;  4ELT A;  4YDU A;  2I5J A;  4FM1 A;  4JHD A;  1XI1 A;  4CHZ A;  4JKH A;  4JD2 B;  4OGE A;  5JLF A;  3ZT1 A;  4CZG A;  1ZBS A;  4BR0 A;  4C1N K;  1U4B A;  5EXW A;  1KAY A;  4FXD A;  1Q18 A;  3DLK A;  1Z05 A;  2E1Z A;  5M1P A;  4B9T A;  3O4N A;  1TKD A;  2ZF5 O;  3JYT A;  3CJ7 A;  4DTO A;  1NLV A;  1KRP A;  5BRH A;  4LF5 K;  5T7B A;  4ELU A;  3U3G A;  2W6L A;  4AHT A;  1IKY A;  1NGF A;  3DLR A;  1EWR A;  3ZSW A;  4DR6 K;  3OYB A;  5BR8 K;  1E3M A;  4W5O A;  3CFR A;  5GAH P;  2QA4 N;  4GV9 A;  1HPZ A;  5AFU A;  2V52 B;  3AA3 A;  3G25 A;  1XMO K;  4X66 K;  4BG8 A;  3CCQ N;  1B9F A;  5KQ8 A;  2NRR A;  2E20 A;  3P5J A;  3VQ8 A;  1MWK A;  2XY7 A;  1QVF M;  3DM2 A;  3K5M A;  4Z4E A;  3AV9 A;  4XH5 A;  5LY3 A;  4KI4 A;  4OX9 K;  4Y1C A;  4DTU A;  5C42 A;  2O8F B;  5LMN K;  4CIG A;  1RDU A;  3AVI A;  3C0B A;  3G71 N;  4GV3 A;  1BI4 B;  3ENB A;  5D3G A;  4BWM A;  2E2P A;  1B92 A;  1K8K B;  2KHO A;  4Z94 A;  1W2B M;  3EN9 A;  2PBD A;  1LCU A;  2F96 A;  4UY8 O;  1TKX A;  4BRM A;  4PKI A;  2NRW A;  4W5T A;  4FLW A;  1FW6 A;  3QDK A;  3PUF A;  3L4Q A;  2AJQ A;  4XH1 A;  3O3F A;  4JN4 A;  3IG1 A;  1RDD A;  2QWO A;  3GE1 A;  3NF9 A;  1A5W A;  3ASM A;  1IKX A;  1BA1 A;  2EWS A;  4NB4 A;  3C6H A;  3QER A;  4CJL A;  1W0H A;  1WSH A;  3MMV A;  2UXD K;  4O5F A;  3VN5 A;  4FVU A;  3VA0 A;  4FW1 A;  2F8T A;  4A2A A;  4DFP A;  3LP2 A;  1SKW A;  1EX4 A;  2GTD A;  3CFO A;  3VTH A;  3VGL A;  5JMV A;  3PIO L;  4ZTJ A;  3T69 A;  4DFJ A;  2O4G A;  2RKI A;  5AQN A;  4FZY A;  3LPU A;  3U9D A;  2P9P B;  3BY5 A;  3HM8 A;  4E1J A;  2HF3 A;  2Q2R A;  3SAH A;  3D2E A;  1DTT A;  3MCP A;  2ZQB A;  4E7L A;  4E7I A;  4CEE A;  4IOX A;  3FFI A;  3F2K A;  3FE1 A;  5GIP A;  4FJ8 A;  4B9V A;  4JKB A;  4PL7 A;  4EHU A;  4JI3 K;  4X64 K;  4JV5 K;  2P9N A;  3MEE A;  2O8D A;  4CJP A;  1SL2 A;  2HBJ A;  4FLZ A;  3NGI A;  1NK6 A;  1VSL A;  4FJJ A;  3K58 A;  1U2V A;  3CCV N;  3O8M A;  4R5P A;  5E26 A;  1HRH A;  2DTU A;  5SWM A;  1YTA A;  2W42 A;  3BP8 A;  4B8C A;  3AO5 A;  5AQW A;  1S1T A;  3KTQ A;  1P8Z A;  1HMV A;  1A5X A;  4EHT A;  3A2F A;  3T1A A;  2D0A A;  1I39 A;  1VSJ A;  1WUA A;  4K41 A;  1VQP N;  4KHQ A;  1N5Y A;  3EO3 A;  4JRP A;  4LFB K;  3CER A;  4JAX A;  3DLH A;  3DRS A;  4IOA L;  1WSI A;  1TKZ A;  3GG4 A;  1RT6 A;  4Z4H A;  5FRO A;  1LW2 A;  4BY9 C;  3AGK A;  4CZL A;  3E9L A;  2YCH A;  3NBP A;  4X65 K;  3OYE A;  4IZ9 A;  1DTQ A;  2A40 A;  4DTP A;  3QEV A;  4DR1 K;  2ASM A;  4CJV A;  1Z25 A;  3RWU A;  1BQN A;  3NF8 A;  2IVN A;  4LF8 K;  5B8H A;  2HHT A;  3BUZ B;  4JKC A;  3KJV A;  3AY9 A;  3O9Q A;  3W3D A;  1WAJ A;  4IEE A;  3D2F B;  3V9S A;  3OYC A;  4BRO A;  4IG3 A;  2NRZ A;  4EP4 A;  4B1W B;  4J2B A;  5C2D A;  2VCP A;  1T44 A;  3HVT A;  4JI1 K;  2QKB A;  1JXB A;  1QE1 A;  3PSI A;  5AQI A;  2HHS A;  3R6M A;  2FF6 A;  2VYP A;  2P9S B;  3VEY A;  4CGF A;  1NK5 A;  1TK8 A;  3KIO A;  3BGR A;  3G10 A;  3VEO A;  3RMD A;  2GV9 A;  2Z1I A;  4KH6 A;  3ZCM A;  3KLH A;  3DXK A;  4ILH A;  2JWK A;  4OKK A;  3KWI A;  3BZK A;  5FLX O;  3PX0 A;  3RRG A;  4DSE A;  3C6A A;  4J2A A;  3M3Z A;  1SQK A;  3IKM A;  1RBU A;  3LPT A;  3H1V X;  2E2Q A;  1L3T A;  3FZL A;  4QS8 A;  1NWK A;  2XRI A;  4FWM A;  1XC9 A;  2P9K A;  4DTM A;  1CZA N;  1I3A A;  5HRP A;  5AQT A;  3PO4 A;  3MWP A;  2Q0U A;  2D4W A;  2Z1J A;  2DPN A;  1IV0 A;  5AFU H;  4CF2 A;  4CI6 A;  1L5U A;  2VG5 A;  3RVC A;  4OPA A;  3NF7 A;  1BCO A;  3LDL A;  4CK3 A;  1X9W A;  3J7Z O;  4BE1 A;  5AQP A;  3CPW M;  5J2M A;  1RT5 A;  4FLU A;  4CD1 A;  2DY4 A;  5C0Y A;  3CIP A;  1U48 A;  2PFU A;  3NAE A;  2UUB K;  3AAP A;  2YHA A;  1EKE A;  4OJR A;  2OTJ N;  4M42 A;  3F9M A;  3L4I A;  4BC5 A;  1E4F T;  3EY1 A;  4BR5 A;  1X3N A;  5F2R A;  3L8B A;  4K43 A;  3C7N A;  1GLJ O;  1R0A A;  5AQK A;  3CCR N;  3HL8 A;  5KPR A;  3IAY A;  4FJ9 A;  4FJK A;  4O8K A;  4KB0 A;  1VK0 A;  3OYK A;  2YJF A;  3LWM A;  2WON A;  2YKN A;  2XHB A;  4BRD A;  3CCJ N;  3MED A;  2V51 B;  4CEQ A;  3SBT A;  1NKC A;  4BR2 A;  2PYL A;  3EE8 A;  4DU4 A;  5LJW A;  3OYF A;  4CE9 A;  2FC0 A;  3KK1 A;  1S22 A;  3TR8 A;  3AGR A;  2F9T A;  1V4T A;  2KTQ A;  1ITG A;  4C23 A;  4F2S A;  4RW9 A;  3QO9 A;  3Q7B A;  3ZEU B;  4JK8 A;  2O8E B;  5AQR A;  2DFH A;  1T6C A;  1WBD A;  3MN7 A;  3QNO A;  4M3Y A;  4O8U A;  5F1X A;  4FPB A;  1YJW N;  4DSI A;  3SK3 A;  3JS6 A;  5LJV A;  1BHL A;  3CF5 L;  2O8F A;  4JI0 K;  1JLQ A;  4DQI A;  3V81 A;  2ZJR L;  3NCI A;  3ZSR A;  2OPP A;  3H3N O;  5I3U A;  3QIP A;  4NXN K;  1D9F A;  3SQ4 A;  3AVA A;  1M1K O;  4WQ4 A;  4NCB A;  3ULE A;  3FR0 A;  3TWH A;  2F8S A;  4ILJ A;  3MAQ A;  3MN5 A;  4F4K A;  1NBW A;  3THY A;  3ATU A;  3AVN A;  3AAR A;  5EY4 A;  4KHP K;  5AR0 A;  5CR4 A;  4CEF A;  3U4L A;  1NK8 A;  1Q9Y A;  2QWP A;  3ZT3 A;  4F3O A;  1W9H A;  1NGE A;  1NKB A;  1HNW K;  1RIL A;  3IRX A;  4OO1 J;  4CER A;  4GY2 B;  2VWJ A;  4CJ5 A;  2IVO A;  4I6M A;  4CFC A;  5AZI B;  3CMA N;  2WFB A;  1YVN A;  5J1E A;  1KTQ A;  3SI6 A;  3SZ2 A;  2UXC K;  1ZBU A;  3TI0 A;  3TTF A;  3NGZ A;  1SKS A;  3NMU A; 
#chains in the Genus database with same CATH homology
 4I2Q A;  1WAF A;  4CHY A;  3K59 A;  3OYN A;  4ELT A;  2YNI A;  5HRS A;  2D0B A;  4I7F A;  3AO4 A;  4EZ6 A;  2I5J A;  4DQS A;  3SPZ A;  4FM1 A;  1S1W A;  3OYH A;  3KLG A;  1WNS A;  1UA1 A;  1NJY A;  1XI1 A;  4CHZ A;  1QSL A;  2A1S A;  3EYZ A;  4PY5 A;  3H08 A;  4DQP A;  4CGI A;  4C8N A;  4CIF A;  4KTQ A;  4OGE A;  4ELV A;  1NOY A;  3ZT1 A;  2HHU A;  3ZT4 A;  4BE0 A;  3OS0 A;  4NCA A;  5JS2 A;  5C25 A;  5J2P A;  1U4B A;  4FXD A;  5HP1 A;  3VQ7 A;  1FXX A;  4KTZ A;  3TAG A;  3S3N A;  3DLK A;  3B6O A;  4B9T A;  4FLT A;  1G15 A;  3O4N A;  2PZS A;  1F21 A;  4E7H A;  4DS4 A;  4CJS A;  1TKD A;  3JYT A;  3VQ4 A;  1HYS A;  4DTO A;  4KHW A;  1KRP A;  5T7B A;  1C6V A;  4DSL A;  4ELU A;  3U3G A;  1GOA A;  1RT4 A;  4CFA A;  1S9G A;  4CES A;  3VQD A;  5KTQ A;  4M41 A;  4AHT A;  2WOM A;  1SL1 A;  1IKY A;  3V9X A;  1LV5 A;  4F8R A;  1WSF A;  3K57 A;  1RBS A;  3DLR A;  2XY6 A;  3ZSW A;  4F2R A;  4KB1 A;  3OYB A;  4KHY A;  2IC3 A;  1BIZ A;  4W5O A;  3CFR A;  4KTW A;  4CHO A;  3SUN A;  3HJF A;  1KVB A;  1HPZ A;  1XHX A;  3NF6 A;  4O0J A;  4HCB A;  2JGU A;  4DU1 A;  1CLQ A;  2LSN A;  1NK9 A;  3AA3 A;  3LDS A;  3T3F A;  4QOZ B;  3HPO A;  2B4J A;  5FDL A;  3WNF A;  1XHZ A;  4DFM A;  3ZSQ A;  4E19 A;  3C6T A;  1B9F A;  3DOK A;  4O5B A;  5KGW A;  3V1Q A;  4B9L A;  2GBZ A;  3UIQ A;  1TAU A;  1S1U A;  3CYM A;  4AHV A;  3P5J A;  4RG8 A;  4IBN A;  3VQ8 A;  2XY7 A;  3AVH A;  3DM2 A;  1RT7 A;  4NYN A;  4M3R A;  3VQ6 A;  3K5M A;  2KZM A;  4Z4E A;  3AV9 A;  4DMN A;  3THV A;  3S3M A;  4KI4 A;  4KRF A;  4FJM A;  3HP6 A;  1HJR A;  1X9M A;  3PX4 A;  1KLN A;  4Y1C A;  3RR7 A;  4DTU A;  4CJU A;  5C42 A;  3DI6 A;  1FKP A;  3DMJ A;  4CIG A;  3AVI A;  1T7P A;  1HYV A;  3ZT0 A;  4TSX A;  1QSY A;  1RTI A;  2ETJ A;  2KZZ A;  2VG6 A;  4RW4 A;  3SPY A;  2G8K A;  1YVU A;  2ATQ A;  1KVA A;  1BI4 A;  4C8M A;  5KRS A;  1BI4 B;  1LWF A;  1QTM A;  1U49 A;  4DF8 A;  3NHG A;  4WE1 A;  4DTN A;  5D3G A;  4BWM A;  3O3H A;  1B92 A;  4H4O A;  4CIE A;  2PY5 A;  3AA4 A;  2F96 A;  4G1Q A;  2RPI A;  5KRT A;  3VQB A;  1TKX A;  4OLB A;  4KAZ A;  2B6A A;  4W5T A;  1ASW A;  4FM2 A;  4FLW A;  3TAR A;  1N6Q A;  1RNH A;  3VQA A;  3PUF A;  1BCM A;  1LAW A;  2AJQ A;  3O3F A;  4FLY A;  2Y1I A;  1RBT A;  3IG1 A;  2HHX A;  1RDD A;  3NFA A;  2IDO A;  3MEG A;  2FBX A;  1FK9 A;  2Q3S A;  1IO2 A;  2KW4 A;  4DTR A;  3SQ0 A;  3NF9 A;  1HYZ A;  1SUQ A;  1A5W A;  3ASM A;  3KK2 A;  3HYF A;  1Q8I A;  1IKX A;  1K6Y A;  3VQ9 A;  3RMC A;  1S1X A;  1RBV A;  4PWD A;  1J53 A;  2QXF A;  3F73 A;  3QER A;  3SYZ A;  4CJL A;  1W0H A;  4CFB A;  1WSH A;  2OZS A;  1C1B A;  3QLH A;  3VN5 A;  5JS1 A;  3LAK A;  2IGI A;  1VSH A;  2OYQ A;  3VA0 A;  4BDY A;  1KVC A;  4FW1 A;  3LZJ A;  2F8T A;  4DFP A;  3LP2 A;  4CJW A;  1SL0 A;  1UA0 A;  4W5R A;  3OS2 A;  1EX4 A;  1SKW A;  3AVC A;  4L8R B;  3BDP A;  1BIS A;  3CFO A;  3PV8 A;  1J9A A;  1GOC A;  4DSJ A;  1EET A;  1WSG A;  2P5G A;  4ZTJ A;  1U45 A;  4DFJ A;  4Q0B A;  2O4G A;  1LW0 A;  2RKI A;  1D8Y A;  4B8A B;  4FZY A;  3LPU A;  3QEW A;  3U6F A;  3ZSY A;  1L3U A;  3O3G A;  1DTT A;  4E7L A;  2ZQB A;  1KLM A;  4E7I A;  4PUO A;  2E6M A;  1JXE A;  1RDB A;  4CEE A;  3TAE A;  3TAF A;  1HNV A;  2BAN A;  3AVM A;  4JRQ A;  1JKH A;  2OPQ A;  3FFI A;  2IOC A;  2YNG A;  5C24 A;  4CJK A;  5E41 A;  3SV3 A;  2BDP A;  2E6L A;  2OA8 A;  4AHS A;  3NH0 A;  4B9V A;  4FJ8 A;  4E89 A;  1O1W A;  2ITG A;  4Z0U A;  4OKE A;  4AH9 A;  1C0M A;  2XY5 A;  1VSK A;  1L3V A;  2EX3 A;  1JL1 A;  2FBY A;  1SV5 A;  1C1C A;  3LP0 A;  3MEE A;  3OJU A;  4B9M A;  4BDP A;  4CJP A;  1SL2 A;  4B9N A;  3CM5 A;  4GMJ B;  3DLE A;  3RR8 A;  4CF8 A;  4DLG A;  5FRN A;  2QK9 A;  4FLZ A;  3NGI A;  1NK6 A;  1VSL A;  4KHS A;  4PA1 A;  4AHU A;  3LWL A;  1Q9X A;  4KPY A;  3WNE A;  1JLB A;  4CFD A;  3RTV A;  4QAG A;  3OYD A;  3K58 A;  3CFP A;  1T05 A;  1NKE A;  4FJJ A;  1ZBH A;  2FBV A;  4IKF A;  5J2Q A;  5DK5 A;  4R5P A;  2DTU A;  1HRH A;  2YKM A;  4Z4I A;  5SWM A;  1YTA A;  2W42 A;  3HXM A;  2X74 A;  4B8C A;  3AO5 A;  2XY8 A;  3ALY A;  3NDK A;  1S1T A;  4OVL A;  5K14 A;  3KTQ A;  1TKT A;  1VSF A;  3OYG A;  1HMV A;  4NYF A;  1A5X A;  3I0S A;  3I8D A;  3RMB A;  4H4M A;  3A2F A;  4EP5 A;  4FM0 A;  3SUP A;  4FJG A;  3P83 D;  3T1A A;  2D0A A;  4OPJ A;  1I39 A;  4CEB A;  3QES A;  4IDK A;  3SQ2 A;  3ZSV A;  1VSJ A;  3VQE A;  2P5O A;  3ULD A;  4JS4 A;  1YTU A;  2YV0 X;  1BGX T;  3OYI A;  1IKW A;  3OYA A;  4KHQ A;  1N5Y A;  1NOZ A;  4JRP A;  3D0P A;  1IG9 A;  3TAP A;  4ID5 A;  4M3U A;  2HND A;  4CGH A;  3V4I A;  4B3O A;  4B08 A;  2HW3 A;  3QIO A;  4FJ7 A;  2PYJ A;  3DLH A;  2KFN A;  3DRS A;  2HVI A;  1JLC A;  1LAV A;  1WSI A;  1TKZ A;  1QSS A;  4DFK A;  3KLE A;  2G8V A;  4ZHR A;  3QNN A;  2G8W A;  3HST B;  2RN2 A;  1RT6 A;  4DSF A;  4HUF A;  4MQ3 A;  4Z4H A;  5FRO A;  1LW2 A;  2D5R A;  3P1G A;  4FJL A;  2VWK A;  3PX6 A;  3NBP A;  4FLV A;  3OYE A;  4CEO A;  5CZ1 A;  4AIL C;  4CEC A;  1DTQ A;  4OPK A;  4DTP A;  3QEV A;  1TAQ A;  1Z26 A;  1X1P A;  1T03 A;  3PY8 A;  3O4Q A;  1Z25 A;  4CJV A;  3WNH A;  4C8K A;  4FYD A;  3RWU A;  4M3X A;  1ASV A;  1BQN A;  3NF8 A;  4N76 A;  1ZBF A;  2HHT A;  1QS4 A;  3OY9 A;  1VRT A;  4AHC A;  3ZSX A;  4O0I A;  3KJV A;  4DQQ A;  3DLB A;  1EXQ A;  1WAJ A;  3V9S A;  3OYC A;  3KKS A;  3ITH A;  4IFV A;  1IH7 A;  1RCH A;  3KKR A;  4IG3 A;  4E1N A;  1BL3 A;  3DLG A;  3L3U A;  4BDZ A;  4CJ4 A;  3AVK A;  2G8I A;  3HVR A;  4LH4 A;  4EP4 A;  1VSE A;  1VSD A;  3KD1 E;  4KRE A;  4AHR A;  4GW6 A;  1S6Q A;  3HPH A;  1KSP A;  4J2B A;  2VG7 A;  3AO2 A;  3C6U A;  3HVT A;  4LD0 A;  3VQC A;  4CEA A;  4CJF A;  4KHN A;  1ZBI A;  4HTU A;  1JXB A;  3HP9 A;  1QE1 A;  3OYM A;  3SQ1 A;  1ZYQ A;  1TGO A;  1KFD A;  1C0U A;  4BE2 A;  2HNY A;  2HHS A;  4CF9 A;  3T19 A;  2EHG A;  4Q5V A;  2IAJ A;  4CHQ A;  4CGF A;  1NK5 A;  1TK8 A;  3KIO A;  3BGR A;  3G10 A;  4CJ3 A;  2QKK A;  3RMD A;  2GV9 A;  2Z1I A;  2OPR A;  1SKR A;  3ZCM A;  3RRH A;  2IS3 A;  4DU3 A;  2Z1H A;  3KLH A;  3MXJ A;  4O55 A;  2YNH A;  3KK3 A;  1WSJ A;  3LAM A;  4DSK A;  2JLE A;  3ZT2 A;  1X9S A;  3PO5 A;  3V1O A;  4OKK A;  2GUI A;  3CQ8 A;  4CHN A;  1A5V A;  3PX0 A;  3RRG A;  4FJN A;  2HVH A;  4DSE A;  3F9K A;  3S9H A;  1B9D A;  5J2N A;  4DLE A;  4NCG A;  1UOC A;  4J2A A;  3TAB A;  4EZ9 A;  1JLE A;  1VSM A;  3V6D A;  2G8U A;  1RBU A;  3ISN C;  3LPT A;  4DS5 A;  4CF0 A;  1L3S A;  4C8O A;  3QET A;  1L3T A;  4I9Q A;  3K5O A;  4E3S A;  2XRI A;  4Z4G A;  3M8P A;  1XC9 A;  4I9L A;  2HB5 A;  1NK4 A;  4DTM A;  5FRM A;  1I3A A;  4ID1 A;  5HRP A;  3D45 A;  3PO4 A;  4LSL A;  3L2R A;  4O44 A;  2BE2 A;  5EU7 A;  3M8S A;  1C0T A;  2HHQ A;  1NJW A;  3OJS A;  4M3Z A;  4BAC A;  3G0Z A;  3QIN A;  2KQ2 A;  2Z1J A;  4CHP A;  3NH2 A;  1RTJ A;  1JLG A;  2P1J A;  4E0D A;  2X6S A;  1BQM A;  4E7K A;  3TAQ A;  4ICL A;  1TL1 A;  4CF2 A;  1L5U A;  1TL3 A;  4K8X A;  4PQU A;  2E4L A;  2VG5 A;  3CM6 A;  3QEX A;  3S3O A;  2P51 A;  4FZZ A;  3E01 A;  3NF7 A;  4CEZ A;  3C94 A;  1VRU A;  1BCO A;  2BGG A;  4E7J A;  4KHU A;  4CK3 A;  3V9U A;  5CYQ A;  1X9W A;  4OGC A;  2DFF A;  4DWI A;  2D0C A;  4CK1 A;  3K2P A;  4BE1 A;  4ZTF A;  1JLA A;  2X6N A;  4FVM A;  5J2M A;  1RT5 A;  4FK2 A;  4FLU A;  4OKJ A;  4DQR A;  4RW8 A;  5I42 A;  3OYJ A;  4OLA A;  2DY4 A;  4HCC A;  1S9E A;  3SJJ A;  2Z1G A;  4FJ5 A;  3SCX A;  4CED A;  1S5J A;  4CGG A;  3AA5 X;  1U48 A;  5SZT A;  4KFB A;  3VA3 A;  1UWB A;  3VQQ A;  2G8F A;  2OZM A;  3NAE A;  1Y97 A;  2ZD1 A;  4K8Z A;  4HUG A;  4FJH A;  2YHA A;  1EKE A;  1QQC A;  1RT2 A;  4OJR A;  1BIU A;  3HPG A;  3VQ5 A;  4KV8 A;  1JL2 A;  4M42 A;  2XO7 A;  3LP1 A;  3ZSO A;  4KI6 A;  2FBT A;  3L8B A;  3EY1 A;  1J5O A;  3SUQ A;  3QEI A;  4W5Q A;  4CGJ A;  1WN7 A;  4N47 A;  4RW7 A;  1DLO A;  2RF2 A;  4I2P A;  1D9D A;  3L2V A;  1R0A A;  4J2E A;  3TAN A;  4Z4C A;  2OPS A;  4C8L A;  3KD5 E;  3HL8 A;  4RW6 A;  3IAY A;  1RTD A;  3B6P A;  4FJ9 A;  5CYM A;  4J2D A;  4FJK A;  3ZSZ A;  4KB0 A;  1YT3 A;  1VK0 A;  2Y1J A;  3OYK A;  4BWJ A;  3LWM A;  3AVG A;  1REV A;  2WON A;  2YKN A;  2XHB A;  4Z4F A;  3MED A;  3I0R A;  4CEQ A;  2A1R A;  4B9S A;  4QCL A;  1CZB A;  1NKC A;  3DRP A;  2PYL A;  4M3W A;  3NE6 A;  4DU4 A;  3OYF A;  4CE9 A;  2FC0 A;  3KK1 A;  3LAL A;  1C1A A;  3TR8 A;  3AVJ A;  3OYL A;  1JLF A;  3AA2 A;  2HHV A;  1HQU A;  4XIU A;  2KTQ A;  1ITG A;  1MU2 A;  1TVR A;  4IFY A;  4CJQ A;  4F2S A;  4RW9 A;  3QO9 A;  4FK4 A;  4LH5 A;  4CJT A;  3MXM A;  3AO3 A;  5HLF A;  1CXU A;  1NJX A;  2DFH A;  4CJR A;  3SUO A;  1QHT A;  3AVL A;  3C95 A;  4CF1 A;  3KLF A;  3QNO A;  1KCF A;  5DMR A;  1VSI A;  4KKO A;  4M3Y A;  5HRN A;  2YHB A;  3MEC A;  4DSI A;  5HBM A;  1NK7 A;  1WLJ A;  4HVJ A;  3K5N A;  1BHL A;  3LZI A;  3EZ5 A;  3QEP A;  3LP3 A;  1NK0 A;  1JLQ A;  4DQI A;  3V81 A;  4B9U A;  3SV4 A;  5KI6 A;  4O4G A;  3NCI A;  4FJX A;  4N41 A;  2X78 A;  4DTS A;  4IG0 A;  3NGZ A;  3U3Y A;  3ZSR A;  1U04 A;  1LWE A;  2OPP A;  3DRR A;  1FKO A;  3K5L A;  5HRO A;  1EP4 A;  5I3U A;  1J54 A;  3QIP A;  3HO1 A;  2HNZ A;  3SQ4 A;  1D9F A;  4CGD A;  4MFB A;  1TK5 A;  4DTJ A;  1RDC A;  3V1R A;  1CZ9 A;  3AVA A;  2KFZ A;  1CXQ A;  1WSE A;  3AVF A;  2DFE A;  2NUB A;  2R7Y A;  4FCY A;  3WNG A;  1XWL A;  4FLX A;  4NCB A;  2ZE2 A;  3NH1 A;  3TWH A;  3V9W A;  2F8S A;  3MAQ A;  3OVN A;  2YNF A;  4YFU A;  1UAX A;  3KLI A;  1KFS A;  4W5N A;  4DG1 A;  1TK0 A;  3OS1 A;  2B5J A;  4CJE A;  4KO0 A;  4F4K A;  3AVN A;  5HRR A;  3CG7 A;  4H8K A;  3L2W A;  4DF4 A;  2HMI A;  4N5S A;  3HT3 A;  1S6P A;  3AVB A;  1GOB A;  3RMA A;  1RT3 A;  4F3T A;  1RTH A;  4E1M A;  2O4I A;  4CEF A;  3DOL A;  4CCH A;  1NK8 A;  1Q9Y A;  3ZT3 A;  3MXI A;  4GVM A;  3L3V A;  4M45 A;  4F3O A;  1W9H A;  5CZ2 A;  1ZBL A;  5KGX A;  4FJI A;  4FK0 A;  1RT1 A;  3AO1 A;  1NKB A;  2QKB A;  3HM9 A;  1RIL A;  3LAN A;  3IRX A;  1RDA A;  1S1V A;  3TAM A;  3IS9 A;  4M3T A;  4CER A;  4HHT A;  2VWJ A;  3V9Z A;  4CJ5 A;  3M8R A;  3VQP A;  1IKV A;  3M8Q A;  3L2Q A;  1HNI A;  4CFC A;  3JSM A;  1T8E A;  2G8H A;  4FZX C;  4LY7 A;  1NJZ A;  1U47 A;  1HQE A;  4HUE A;  5CY4 A;  1KTQ A;  5J1E A;  4JS5 A;  2HHW A;  4N56 A;  4YNQ A;  4JLH A;  1D5A A;  4DTX A;  1ASU A;  3SI6 A;  3SZ2 A;  3NGY A;  3HK2 A;  4UQG A;  4Y1D A;  1LWC A;  1RBR A;  4FW2 A;  3DYA A;  1TV6 A;  1ZBU A;  3L2U A;  3TI0 A;  3SNN A;  4LSN A;  4CK2 A;  1SKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...