5HRSA

Hiv integrase catalytic domain containing f185k + a124n + t125a mutations complexed with gsk0002
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
139
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSNAVKAACWWAGIKQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural Basis for Inhibitor-Induced Aggregation of HIV Integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhibitor
total genus 51
structure length 139
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hrsA00
3DMJA 1RT7A 2VWJA 4Y1CA 5CYMA 4CJTA 4HUEA 3NF7A 1RTIA 1VSKA 2YV0X 4JS5A 3B6OA 2XO7A 3VQ7A 4Z4IA 3AVLA 3VQDA 1S1WA 5C25A 2F8SA 1U4BA 3ALYA 2HHQA 1RTJA 3P1GA 4RW6A 4Z4CA 2XRIA 1TKZA 2YKNA 2YNIA 5KI6A 4DQSA 3PX4A 1SL2A 2KFZA 2Q3SA 4OLAA 4EZ9A 4ELVA 3DLKA 2G8KA 3OYBA 3LP2A 3QIPA 3ZSVA 4FLTA 4IDKA 3KJVA 1VSDA 4IFVA 3ZSZA 3VQQA 2G8UA 1TKXA 4O0JA 4CHQA 1RTHA 1VSHA 1O1WA 2HNZA 4HUGA 2XY8A 3RMBA 3TR8A 3L2QA 3TABA 1QHTA 1UA1A 4PQUA 1TK5A 4CJEA 4H4MA 5KTQA 3K59A 2RKIA 4MFBA 1RTDA 5HRNA 4KB1A 5SZTA 1RILA 3JSMA 3ZT2A 1RNHA 3O3FA 3S3OA 4IKFA 2G8VA 3AA4A 1HNVA 4NCAA 5EU7A 4DQRA 4C8LA 1WSFA 3O4QA 3CM6A 4JLHA 4IBNA 4FLYA 3SPZA 4CIGA 1IH7A 4IFYA 5HP1A 3NAEA 4QCLA 3M8PA 3AO4A 3DOKA 4FJMA 1C6VA 3PX0A 4YFUA 1S1UA 3VQ6A 4N56A 3SQ2A 1TAUA 2P5OA 3SI6A 3DLBA 1NJYA 2BDPA 1NK9A 2P5GA 3QO9A 4O4GA 2QKKA 3LWMA 4CJFA 5HRSA 4ELUA 4M3YA 4QOZB 2B5JA 3TAFA 4CEZA 3HP6A 1D8YA 4BE1A 4K8XA 1JLAA 2YNFA 1KCFA 4OPKA 4W5OA 4FJIA 3QERA 4E3SA 3QNOA 4C8OA 4M3WA 3V4IA 3V81A 3TAPA 1IO2A 1BGXT 3NF8A 3VQPA 4CF8A 3OYDA 5HROA 3ZT1A 3ZSQA 3AVJA 1NOYA 4CHOA 1NK0A 4FJLA 4PY5A 4CHPA 1SUQA 3C6UA 1UA0A 4GMJB 2FBVA 2ITGA 4M41A 3PY8A 4CJVA 1HYVA 1LW2A 4F2SA 3C6TA 4CGDA 3K57A 1EETA 1WAFA 4PUOA 2F8TA 3F73A 4Q5VA 2VWKA 4CEQA 3NGZA 3ZSYA 3SJJA 3IG1A 3D0PA 4CJWA 3MEEA 4LD0A 4E7LA 2PYLA 3SQ1A 5J1EA 3V9ZA 4AHVA 3QETA 3QIOA 4FJ7A 3DYAA 4LSLA 4TSXA 3VQAA 4E19A 3CYMA 4Z0UA 4CJSA 2XY5A 1D9FA 1K6YA 3H08A 4GVMA 2E6LA 3KKSA 4CFBA 1LWFA 1RT6A 2DFFA 4I2PA 4JRQA 1TK0A 2OZSA 1SKWA 4N76A 1SL1A 1C1CA 1NOZA 2X6SA 3AVGA 4ZTFA 1T8EA 4FZZA 4CF9A 2BGGA 2G8IA 1KSPA 2NUBA 1S1XA 4CJPA 2YHAA 3EY1A 1NJXA 4J2DA 4E7HA 4FJ5A 2WONA 3DLGA 4DG1A 3MAQA 2BE2A 1ASWA 1RT4A 4OGEA 4DF8A 2HHWA 4DU4A 4CEBA 3WNGA 4CJ3A 1WSHA 4BDYA 2O4IA 2Z1HA 3AO3A 3LANA 4DTSA 1LW0A 3K5MA 3V1RA 3KLFA 3QEVA 2HNDA 4BDZA 3AVHA 3NH1A 3RMDA 4FK2A 3QESA 3KTQA 3MXMA 3IS9A 1B9FA 4HTUA 3I8DA 4CJRA 3LPUA 1YTAA 1A5VA 2D0BA 4B8AB 1B9DA 1HJRA 1JLFA 1XI1A 1RBVA 4OJRA 4CE9A 3QEWA 1HRHA 3P5JA 2HVHA 2XY7A 3HPGA 1BI4A 3HPHA 1GOAA 4M45A 4B8CA 3NGIA 2Y1JA 4J2BA 4AHRA 4CF1A 3HVTA 4CIFA 3T1AA 3HJFA 3DRPA 1RT3A 1WAJA 1VSIA 4M3RA 3KIOA 1A5WA 1QQCA 4IG3A 1ZBHA 4R5PA 1T05A 1J5OA 1S5JA 3AVBA 1ASVA 1I39A 1FKOA 2DFHA 3WNHA 4ELTA 3V1OA 2HVIA 2WOMA 4LH4A 2FBTA 3O3GA 3BGRA 1NJZA 3OS2A 3VQBA 4GW6A 4F3OA 4FZYA 4CJKA 3EZ5A 4FM2A 3DLEA 1QSYA 3C95A 2GUIA 1HQUA 4B9MA 2E6MA 3LALA 3WNFA 5FRNA 3MEDA 4FM1A 4FJXA 5J2NA 2IAJA 1FK9A 4I9LA 3U3GA 3M8RA 3PX6A 4W5NA 2EX3A 4KKOA 1IKXA 3G10A 1T03A 2HHSA 1FKPA 3AA2A 4F2RA 4DF4A 3OYJA 3HVRA 2D0AA 3AO5A 5FRMA 3NE6A 1JLCA 1CXUA 3T3FA 3SUPA 2FBXA 4KTQA 3OYIA 3T19A 4KB0A 1DTTA 4EP5A 4ZHRA 5D3GA 5DMRA 4BWMA 4CJQA 1VRTA 2OPRA 1R0AA 2D0CA 4DQQA 1SL0A 3K2PA 4G1QA 4N5SA 2FBYA 4LH5A 1L3VA 4E1MA 1IKYA 1B92A 1VSFA 1BHLA 3M8SA 1Q8IA 5CZ2A 2KZMA 2DY4A 3AVCA 1JL1A 1Q9YA 1WN7A 1SKSA 4FJGA 4M3UA 4K8ZA 3ZSXA 4RG8A 1HYZA 1WLJA 4ID5A 4M42A 3HK2A 1LWCA 4CK2A 1QS4A 4HVJA 1RBSA 4FW2A 3KLIA 4AHSA 4UQGA 4AHCA 3VQ5A 4CERA 4CF0A 3CM5A 1S9EA 1TK8A 1JL2A 3NH0A 2PZSA 4KFBA 1QSLA 1UWBA 2DTUA 1KTQA 3SUQA 1Z25A 3MEGA 1U49A 3M8QA 3AVIA 4Z4GA 4CK1A 3AO1A 4FW1A 3K58A 4L8RB 2HHVA 1YVUA 4DTPA 2RF2A 3KKRA 4I9QA 3VQEA 1XHXA 2HHUA 4O44A 2EHGA 3TANA 5HBMA 4DS5A 2IOCA 4CESA 4DSIA 4AILC 1GOCA 3O3HA 4CGIA 5JS2A 3V6DA 1VSMA 3HL8A 1BI4B 1T7PA 3PO5A 3QINA 4NCBA 2KFNA 4DTOA 4FYDA 4FXDA 3I0SA 3AA3A 2XY6A 1WSEA 4AHTA 2G8WA 3HPOA 4KTWA 4DS4A 3ZSRA 1VRUA 5C24A 3AA5X 2E4LA 4OVLA 4FLXA 1XHZA 1NKBA 4CJ5A 1RT2A 1KVAA 2Z1GA 4B9LA 3KK1A 4FLUA 4C8KA 4KHYA 1REVA 4DSFA 3QEIA 3DLRA 1EP4A 4LSNA 3VQ4A 3HM9A 4KPYA 4BE2A 1NK7A 4FLVA 1X9WA 3AVFA 3ZT3A 1U48A 4BDPA 1QSSA 4F8RA 1S1VA 3CFPA 2B4JA 1GOBA 3PUFA 2ATQA 1HQEA 4H8KA 3L8BA 4E0DA 3SQ0A 4B08A 5JS1A 1QE1A 3SNNA 3LDSA 1BL3A 3LAKA 3TI0A 2ZE2A 4DWIA 3OJUA 1BQMA 1JLQA 1TKDA 4RW8A 1ITGA 3O4NA 2HB5A 3UIQA 4DFJA 2PY5A 4J2EA 1CZ9A 2ZD1A 3SV3A 3SYZA 4FJHA 2OZMA 1RDDA 4AHUA 3OYAA 2X74A 3L3VA 3DM2A 3LWLA 2A1RA 3LPTA 4HCCA 3NF6A 3V9WA 3KK2A 4M3ZA 3F9KA 3RMAA 4XIUA 1ZBIA 4DFMA 1KVCA 5I42A 4RW7A 1NJWA 3OS0A 4E7IA 4F4KA 3HYFA 4ID1A 4CEOA 3OYFA 3S3MA 3DLHA 4DFPA 2KZZA 4OKKA 4DU3A 2FC0A 1KRPA 3U6FA 4FJJA 1EX4A 4CGHA 4KHQA 3VQ9A 3AVAA 3KK3A 1C0UA 2QXFA 1KLNA 3TAQA 1VSEA 1RDBA 1DTQA 4KV8A 4O55A 1XWLA 4Y1DA 3ZSOA 1N5YA 4DLEA 3FFIA 3ZSWA 4E7KA 4DTMA 3NBPA 5J2MA 4KHNA 3SPYA 4JS4A 3CG7A 1N6QA 1D9DA 1C0MA 1C1AA 2O4GA 1CLQA 3LP3A 3CQ8A 4FM0A 3NFAA 1MU2A 4CJLA 4W5RA 4NYNA 3K5LA 1NK4A 1C1BA 3PV8A 3L2WA 4J2AA 2KQ2A 3DRRA 4DLGA 2PYJA 4PWDA 4DU1A 3ZT0A 1X9SA 3ZT4A 4B3OA 3CFRA 3HO1A 4F3TA 4KREA 3NCIA 3HSTB 3MECA 2P1JA 1IKWA 1RBTA 1TL3A 1FXXA 4IG0A 2YNHA 4MQ3A 4NYFA 3VA0A 2B6AA 4KAZA 1UAXA 3OS1A 3QEPA 3LZJA 3OYNA 2D5RA 3ISNC 3CFOA 2QK9A 1W0HA 2KTQA 5KGWA 1JKHA 4O5BA 1CXQA 4BACA 3E01A 3V9XA 4DSJA 4YNQA 2JGUA 4RW9A 3OYGA 3JYTA 2HW3A 1VK0A 2JLEA 3NF9A 1S6QA 4OKJA 4KHSA 3LP1A 2IS3A 3IAYA 4DTNA 1TL1A 2HHTA 1KFDA 1ASUA 1SV5A 1HPZA 4DFKA 3QNNA 4DTRA 1Q9XA 1A5XA 3LZIA 5HRRA 4FLZA 3ITHA 3DOLA 4CEEA 3AO2A 1ZBFA 1L3SA 1EKEA 1X1PA 2IC3A 2RPIA 5FROA 3RMCA 1YTUA 5SWMA 3ULDA 3LAMA 4DTJA 3QEXA 4O0IA 3SUNA 3KLEA 3HT3A 4CGJA 1J54A 2X78A 2GV9A 5J2PA 4HCBA 4H4OA 4KTZA 4BE0A 4DSEA 2XHBA 4N47A 5KRSA 1G15A 3S3NA 2X6NA 5CZ1A 1S6PA 3TAMA 4I2QA 1HNIA 4JRPA 3ZCMA 4E7JA 3TARA 4KI6A 5DK5A 3V1QA 4CEDA 4CHNA 4FLWA 3OY9A 1BCMA 1L3TA 3SZ2A 4CIEA 3RWUA 2LSNA 1L3UA 5KGXA 2GBZA 2W42A 3G0ZA 1ZBLA 1NKEA 3IRXA 1NKCA 2G8HA 4NCGA 1RBUA 1Z26A 4FZXC 1S9GA 1YT3A 4Q0BA 3OVNA 3TAGA 4CHZA 2KW4A 4OKEA 4AH9A 3TWHA 3TAEA 3C94A 1Y97A 3EYZA 4B9NA 3MXJA 3OYHA 1WSIA 4E1NA 4Z4HA 1WSGA 3KD5E 3RR7A 2DFEA 4CEAA 4CJ4A 3V9UA 2Z1JA 3SQ4A 1NK5A 4I7FA 3P83D 4CGGA 3D45A 4HUFA 3ASMA 4DTUA 2HHXA 4FJNA 1RBRA 4EZ6A 2OPPA 1RT5A 4CGFA 3KD1E 1LWEA 2VG6A 5C42A 1TGOA 2ETJA 3AVKA 4OGCA 3NHGA 4FK4A 1JLBA 1BQNA 3QLHA 3WNEA 3OYKA 1L5UA 1JXEA 4CECA 3BDPA 4B9UA 4M3TA 1JLEA 1LAVA 3SCXA 4KHUA 1BCOA 3LP0A 1U04A 4CFDA 1TV6A 3B6PA 3AV9A 3OYMA 3MXIA 3PO4A 4N41A 4Z4EA 3RRGA 4CK3A 1JLGA 4FVMA 4KRFA 5E41A 3SUOA 3HXMA 1RT1A 2VG5A 2YHBA 3AVNA 1S1TA 3K5NA 4KO0A 1JXBA 4M3XA 2HMIA 1ZBUA 2VG7A 4C8MA 3L2UA 5J2QA 4OLBA 3A2FA 3RTVA 4DMNA 5I3UA 1LAWA 4ICLA 2Y1IA 4WE1A 3VA3A 4B9TA 3KLHA 3L2RA 4FJ8A 5T7BA 4W5QA 4CF2A 1HYSA 1NK8A 3DI6A 3VQ8A 3U3YA 1IG9A 4FJKA 2HNYA 4FK0A 4KHWA 1KLMA 1VSJA 1IKVA 3THVA 2ZQBA 3NGYA 1QTMA 5KRTA 2Z1IA 4C8NA 1XC9A 4CFAA 3OYLA 1I3AA 1W9HA 2R7YA 5HLFA 2A1SA 4HHTA 4DTXA 4DSKA 2YKMA 3OYEA 3OJSA 4CCHA 1DLOA 5CY4A 3HP9A 3RRHA 3VQCA 1KVBA 1CZBA 1RCHA 4PA1A 4CFCA 3L3UA 3VN5A 4CHYA 2F96A 1TVRA 1VSLA 4FCYA 1NK6A 1EXQA 2IGIA 3K5OA 5HRPA 3SV4A 4DQIA 1U45A 4BWJA 2OA8A 1HMVA 1J53A 4RW4A 4ZTJA 2YNGA 2P51A 2RN2A 1BIUA 5FDLA 4KI4A 2AJQA 2OYQA 1TKTA 4DSLA 4LY7A 3S9HA 4OPJA 3KLGA 1UOCA 2OPQA 3NH2A 5CYQA 3V9SA 1U47A 3NDKA 2G8FA 1RDAA 2BANA 4E89A 4W5TA 1F21A 4EP4A 1LV5A 4CEFA 3RR8A 4Z4FA 1WSJA 1C0TA 1ZYQA 2QKBA 1RDCA 3I0RA 1WNSA 3OYCA 3DRSA 4DQPA 1J9AA 5K14A 3L2VA 1D5AA 1X9MA 4FJ9A 3AVMA 4CJUA 4B9SA 2I5JA 2OPSA 1SKRA 1KFSA 1TAQA 4B9VA 2IDOA 1BISA 4QAGA 1BIZA
chains in the Genus database with same CATH superfamily
1MWKA 4CJTA 4HUEA 1RTIA 1VSKA 2YV0X 5E26A 4Z4IA 3NVMA 1RTJA 4RW6A 3PX4A 1SL2A 2KFZA 4B1WB 2VYPA 2QW9A 2UU9K 4OLAA 4MO4A 3IDHA 3OYBA 2WUSA 2NRRA 5KQDA 4B3MK 4KBOA 1TKXA 5LJWA 1O1WA 4EAHD 3RMBA 5AQMA 2Q0UA 3TABA 2UUBK 4FPAA 3BZCA 4MFBA 5HRNA 2ZM6K 1RILA 1RNHA 4NCAA 3AA4A 1HNVA 5EU7A 2WTUA 3CM6A 4IBNA 1HR0K 3VPZA 2FSKA 1C6VA 2NRTA 1TAUA 3DLBA 5AQJA 2QKKA 4QOZB 4LFAK 2B5JA 4K8XA 2YNFA 1KAXA 4QS7A 3EKUA 4FJIA 2GWJA 1J5EK 3CF5L 3TAPA 3NF8A 3P4IA 3VQPA 3ZT1A 3D6RA 3EKSA 4C1NI 4V19S 4PY5A 1Z05A 1SUQA 3PY8A 1HYVA 4C1NK 4GNIA 4PUOA 3LDOA 3F73A 2F8TA 3KVGA 3UKUA 4DV1K 3C7NA 4CJWA 3H3OB 5JMVA 4LD0A 3V9ZA 3BP8A 4AHVA 4FJ7A 3QIOA 3DYAA 4BRLA 3VQAA 4E19A 2XY5A 3CYMA 1K6YA 4CFBA 3KKSA 5FPDA 3O9QA 4WQ4A 4RWTA 2G8IA 3C6AA 2NUBA 3L4IA 3EY1A 4J2DA 4LF8K 4E7HA 3SAFA 3MAQA 4DF8A 5AQFA 4CEBA 4CJ3A 1WSHA 3LANA 3V1RA 3KLFA 1OH7A 4FK2A 4U7BA 3QESA 4KH5A 1B9FA 3OW2M 2KLAA 1C0FA 4ISEA 1A5VA 2D0BA 3LDQA 1JLFA 2QWNA 3O9SA 1RBVA 2HVHA 3HPGA 3HPHA 3NGIA 5LY3A 4J2BA 2QA4N 3HVTA 4JKHA 3CCSN 1M90O 2O8DA 1WAJA 3ZX0A 1NU0A 3E66A 3KIOA 1A5WA 4M63C 2OCEA 1ZBHA 2ZF5O 1ASVA 4ELTA 2DFHA 2HVIA 5LL6Z 1FJGK 2WOMA 5BRDA 2ASPA 4BG9A 1HUXA 4GV3A 3VQBA 4GW6A 4JYAK 5FPEA 3EZ5A 2I7NA 1HQUA 4JI2K 4B9MA 3SMSA 2E6MA 3QBWA 4FOIA 1S3XA 2P9UB 4A59A 2A40A 2IAJA 2DPNA 4BRCA 4KKOA 4MDBA 3G10A 4CZFA 4RTFD 1FKPA 4PL8A 1OKJA 2D0AA 1CXUA 4KTQA 2FBXA 4JKCA 3KHYA 5DM7L 2FSJA 4BWMA 1RFQA 2E2PA 2D0CA 3K2PA 1L3VA 3M8SA 1BOTO 1Q8IA 3VF4A 2HF3A 1JL1A 5M1OA 1WLJA 4YDUA 4BC2A 4CK2A 1SZ2A 3KLIA 3VEYA 3VQ5A 4JI1K 2BTFA 1S9EA 2PZSA 1QSLA 4X66K 3AVIA 1N34K 4WFBL 4X62K 4AM6A 4BRFA 4I9QA 2J4RA 5BRFA 5HBMA 5BN9A 4AILC 3V6DA 1VSMA 1X9JA 3PO5A 3QINA 1C0GA 4DTOA 3THYA 3LDLA 2O8DB 3HPOA 4DS4A 1VRUA 4FLXA 3AA5X 1YF5L 4OVLA 2Q97A 4CJ5A 1YJWN 1KVAA 3FZMA 4FO0A 1DKGD 4B9LA 4A62A 3KK1A 4KHYA 4WQ5C 4BVPA 1REVA 1E4FT 4G9ZA 2IVPA 3HBTA 4DR5K 1ZC6A 4KPYA 2F4VK 4BE2A 1X9WA 3CCUN 3AVFA 2P9NA 2FXUA 5AQQA 3CJCA 2B4JA 4HTLA 5C0YA 4YHHK 3CC7N 4BRKA 1BL3A 3TI0A 5ELZA 3OJUA 4RW8A 3MMVA 2CGLA 3UIQA 2PY5A 1CZ9A 3G4SN 2ZD1A 3SV3A 2OZMA 3BF1A 2Q0RA 3OYAA 1M1KO 3L3VA 3LPTA 2QEXN 3V9WA 4M3ZA 3RMAA 1HNWK 1KVCA 5I42A 3DWLA 4RW7A 3OS0A 4E7IA 4ID1A 3S3MA 3VGKA 4DFPA 3MWTA 3AGRA 4CD3A 1EX4A 4CGHA 3GL1A 3VQ9A 3AVAA 2QWQA 2RHKA 1XWLA 5AQNA 3FFIA 4KHNA 2QWMA 3EO3A 4JS4A 1C1AA 3CHWA 5F0XA 1MU2A 4CJLA 1NK4A 3L2WA 3J7AP 2P9IA 1X9SA 3ZT4A 3CFRA 3J8AA 3MCAB 3NVKA 4EHTA 2P1JA 3ZX3A 4KAZA 2YNHA 3VA0A 4FWKA 2B6AA 4WYBA 3QEPA 2KTQA 2D5RA 1BDGA 2E1ZA 1IBKK 4BGBA 4IZ9A 5KPZA 3V9XA 4DSJA 3CCMN 3THYB 3OYGA 3JYTA 4KHSA 2HHTA 2W41A 3ZX2A 3P31A 3JS6A 1H1VA 3QNNA 3BUZB 5BREA 4DR2K 1ZBFA 1EKEA 1X1PA 5FROA 1YTUA 2P9NB 4U67L 2W40A 4O0IA 3WQTA 3HT3A 4CGJA 1J54A 1EO1A 2GWKA 4DV7K 2CH6A 3K9KA 1HKCA 2W6KA 3S3NA 2X6NA 1S6PA 4E7JA 3TARA 1ATSA 3V1QA 4WF9L 1L3TA 2LSNA 1U2VA 4CW7B 1HKBA 2HBJA 1V4TA 1ZBLA 1NKEA 2KKZA 4FZXC 1S9GA 4CHZA 4OKEA 4AH9A 3TAEA 4IJAA 1YITN 3EYZA 1YI2N 4E1NA 5M1PA 4CJ4A 4I7FA 5ADXA 4JKBA 3P83D 4CGGA 4HUFA 2QM1A 4DTUA 3OA9A 4FJNA 4FWMA 1E3MA 4EZ6A 3KD1E 1LWEA 3L0QA 3NHGA 1HNZK 4CZLA 2EWSA 1K8AO 3QLHA 3BDPA 1JLEA 1LAVA 1CZAN 1NJIO 3LP0A 1U04A 3VOVA 3B6PA 3MXIA 2P9IB 3U9DA 4XH5A 1JLGA 5AQIA 5AQTA 3HXMA 1OH5A 4KO0A 1JXBA 3CQYA 2VG7A 5J2QA 5I3UA 4WE1A 1HJOA 4NLBA 5T7BA 3CIPA 3DI6A 3U3YA 4FJKA 3ULEA 4LF4K 2V7YA 2WBNA 4IJNA 4CFAA 1I3AA 2R7YA 4HHTA 4DTXA 4B3SK 2YKMA 5KQ8A 1KVBA 1CZBA 3J7YP 4DUYK 4DQIA 3K5OA 2NZTA 3BZKA 3SV4A 4IOAL 3QDKA 4GVEA 5TKYA 3IMXA 4DSLA 3P39A 4YORA 4OPJA 3KLGA 4AQYK 3O5BA 2G8FA 2BANA 4E89A 1LV5A 4A5BA 1ZYQA 1U2VB 1RDCA 1J9AA 1X9MA 4B1VA 4BQLA 4FJ9A 4CJUA 1SKRA 1TAQA 4B9VA 4CHOA 4W5QA 3DMJA 4Y1CA 1Y64A 3NF7A 5AFUA 5BN8A 4WQ5A 3VQDA 1VQ5N 1S1WA 2F8SA 3ALYA 2YX6A 3P1GA 2NRZA 2Q3SA 1TUUA 3CCQN 1NGFA 2AP1A 4ELVA 2FLOA 3MN6A 3QIPA 3FZLA 3CMEN 3TTFA 4BQZA 2P9SB 3ZSZA 5JICA 2G8UA 2VQEK 1RTHA 4F9OA 2XY8A 4JKGA 1KAZA 1UA1A 4H4MA 3K59A 1RTDA 2RKIA 3J7ZO 3HM8A 1JCFA 5SZTA 3O3FA 3I56N 3S3OA 2ASMA 4C8LA 1ESVA 3OHRA 5HP1A 2ZJQL 3AO4A 4B1YB 4X64K 2CH5A 5AJ3K 3VQ6A 2E2NA 1ATRA 2P5GA 4O4GA 3THXA 3LWMA 5HRSA 3AY9A 1E4GT 4ELUA 4M3YA 5AZJA 4CEZA 2A5XA 2IVNA 2P9LB 2E2OA 4BRDA 3VMFB 4E3SA 4C8OA 1BGXT 5HROA 3ZSQA 2NRWA 5LJVA 1NOYA 1NGEA 4FJLA 2FBVA 2O8BA 3C6TA 1WAFA 5EOYA 3R6MA 3ZSYA 3IG1A 4E7LA 3ATUA 2V51B 5BR9A 4Z0UA 5I9EB 3H08A 3I8BA 2E6LA 1TK0A 2QK9A 1LWFA 1RT6A 2DFFA 2OZSA 4N76A 1SL1A 1T6CA 4FZZA 4ZTFA 2BGGA 3GBTA 5HL7L 2YHAA 4DG1A 2QI2A 1VQON 3WXJA 1YJ9N 3WNGA 4WFAL 4DTSA 1LW0A 3K5MA 5AQVA 2HNDA 4KH4A 4BDZA 3KTQA 3MXMA 5M1QA 3RVCA 1ZBSA 3PLAA 3LPUA 2E8AA 4X65K 4O8KA 5A2QO 1HJRA 4JKGB 3HRGA 3D2EB 4OJRA 1HRHA 3UE5A 1BI4A 1BG3A 4JK8A 1VQ6N 4B8CA 1IBMK 4FWLA 4AHRA 4CF1A 3ENOA 3HJFA 1VSIA 3OTOK 1OH8A 3ZETA 4R5PA 1J5OA 3CPEA 2FBTA 3HI0A 3O3GA 3O08A 4FZYA 3THXB 1XMOK 3LM2A 5FRNA 3W0LA 5J2NA 4KH6A 3J80O 3M8RA 2D4WA 4ISFA 3PX6A 1HNXK 4JI5K 5BR8K 3Q7BA 1QQNA 4DF4A 3O4WA 5C10A 4IXCA 2O8BB 4A61A 4KB0A 3I55N 1XC3A 4ZHRA 5D3GA 2OANA 4MLHA 1R0AA 4CVNE 4G1QA 2FBYA 2G8WA 1IKYA 1BHLA 3C0BA 2KZMA 2DY4A 3AVCA 4AM7A 1QZ6A 4K8ZA 3ZSXA 3HK2A 1HYZA 5H1SQ 3FLCO 4JKDA 4AHCA 2HOEA 3CM5A 4A57A 4GY2B 1JL2A 4CZIA 1BUPA 1UWBA 3DXMA 2VQFK 1KTQA 3DAWA 4JKFA 3O8MA 1U49A 3M8QA 3NMUA 4CK1A 3VF6A 3AO1A 2NRVA 2HHVA 4L8RB 1YVUA 3KKRA 1N33K 2EHGA 4DSIA 3D2FA 1GOCA 3HL8A 1BI4B 1T7PA 4NCBA 1QQMA 4FYDA 2XY6A 5AQHA 3ZETB 1RT2A 4C8KA 3KWGA 3WXIA 1KXPA 3T69A 3CJ9A 3VQ4A 3HM9A 2P9PA 1U48A 1QSSA 4F8RA 1S1VA 3T1HK 2ATQA 1O13A 3SQ0A 5JS1A 3VEWA 4JNEA 1EQYA 3BEXA 3LAKA 4DWIA 1TKDA 5CR4A 3FFKB 1ITGA 5C15A 3UB5A 5AQKA 3LWLA 3DM2A 2YHYA 2A1RA 3TSQA 3NF6A 2O8FA 3KK2A 3F9KA 4QS8A 4XIUA 3ZYYX 1ZBIA 2YJEA 5AQLA 1GLBG 4GKKK 3BY5A 3CCEN 3OYFA 4FWNA 3DLHA 3F2KA 4FJJA 3U6FA 4YOXA 1NGHA 3KK3A 1C0UA 2QXFA 1KLNA 3TAQA 3ZSOA 1RDBA 4JAXA 2ZJRL 4DLEA 5GAGP 3P38A 3J81O 4DTMA 5J2MA 5FPNA 3VEXA 1D9DA 1C0MA 3CQ8A 4W5RA 1C1BA 4DLGA 2PYJA 4PWDA 4CZEA 3HO1A 3WEEA 4IOCL 1G99A 4M7XA 3HSTB 3NCIA 1TL3A 1UAXA 3FZFA 3U9ZA 3SAGA 3OYNA 5EXWA 3LZJA 4BACA 4O5BA 1CXQA 3E01A 3QFPA 4Y0WA 2HW3A 1VK0A 4YY3K 4OKJA 3UKUB 2HBKA 3C7NB 4DTRA 4BY9C 2VWBA 3LZIA 5HRRA 1IJJA 3DOLA 3AO2A 2RPIA 4BGAA 2P9PB 3ULDA 3LAMA 4DTJA 2W6LA 4H0OA 5IT9O 1OVQA 3KLEA 3RSEA 2GX9A 4MDAA 2GV9A 4KTZA 1ILYA 4IEIA 2UUCK 3TAMA 1HNIA 4JRPA 1X3MA 4DR7K 5DK5A 1BCMA 3VEZA 3SZ2A 1JJ2M 2O8FB 3C65A 1NKCA 1N8RO 3CCLN 4NCGA 5MLCQ 4K25A 3OVNA 3TWHA 3CCRN 1Y97A 3L4QA 4B9NA 1WSIA 4Z4HA 4IDHA 2Z1JA 3D45A 2E20A 3CC4N 5AQRA 2VG6A 2ETJA 4DQ8A 4FK4A 1BQNA 3WNEA 3SLCA 1JXEA 3KZBA 1NM1A 1HX1A 4CFDA 1ATNA 1TV6A 3AV9A 3OYMA 4Z4EA 3VENA 4IO8A 3O9TA 3WEEB 1JCEA 3CQXA 4FVMA 4KRFA 3SUOA 2HBMA 5BRHA 1RT1A 4K43A 1N32K 3ENHA 2VG5A 1NNEA 3L6QA 1ZBUA 4QS9A 2KHOA 4A5AA 4OLBA 1LAWA 2E5LK 4B9TA 3FR0A 4R79A 2A3ZA 1IG9A 4FK0A 4KHPK 1IKVA 2ZQBA 1XNQK 3MDQA 1XQSC 1XC9A 1WOQA 2A1SA 3OYEA 4CCHA 3O1BA 3RRHA 3SBTA 4PA1A 3VN5A 3EE9A 4FCYA 2IGIA 5HRPA 3MN7A 1X3NA 5JVHL 4KI4A 1TKTA 3LDNA 3M1FA 3S9HA 1UOCA 2OPQA 3R1XA 1U47A 5E84A 3E9LA 1GLFO 3NDKA 4JI0K 1GLLO 1RDAA 3QBXA 3RR8A 1F21A 2QKBA 3DRSA 2OPSA 2IDOA 4QAGA 5CYMA 1W2BM 3B6OA 2XO7A 4FWOA 4H03B 3AVLA 3B8AX 3SMPA 5BPNA 4CBUA 2NRHA 2HHQA 4DQSA 4Z4CA 2XRIA 1TKZA 2YKNA 2YNIA 3G25A 2YJFA 5KI6A 3ZEUA 4JI4K 5JVGL 1NGDA 4C23A 4EZ9A 1DGKN 3IFRA 4I6MA 3ZSVA 4IDKA 1Q7YO 4IFVA 3VQQA 4B3RK 4O0JA 4XEIA 3TR8A 4BROA 3L2QA 1LOTB 1TK5A 4KB1A 5KTQA 1QVGM 3JSMA 3ZT2A 4IKFA 3D7EO 3DXKA 4CBWA 4DQRA 4JLHA 1NMDA 3U4LA 1IH7A 4NO7A 3VERA 3NAEA 4QCLA 3M8PA 3DOKA 5AQXA 3AAPA 3PX0A 2QXLA 2H3GX 3SQ2A 3VEVA 2P5OA 5AQGA 1YAGA 1NJYA 5CHIA 2GUPA 1NK9A 4BR2A 3WUHA 1JLAA 4OPKA 3QNOA 4M3WA 3V81A 4CF8A 3OYDA 4BC3A 3DJCA 3OBYA 4EFHA 4BG8A 2I7PA 4CHPA 1UA0A 3C6UA 4GMJB 1LCUA 4CJVA 1LW2A 4F2SA 4OX9K 1SAZA 2VWKA 1GLEG 1JCGA 3D0PA 4JK7A 3MEEA 1NWKA 2QWRA 3QETA 4TSXA 2PBDA 4CJSA 2ITMA 4GVMA 4LFCK 1C1CA 2X6SA 3AVGA 5AQYA 1TYQA 1S1XA 4DV6K 4CJPA 3N4QA 1QVFM 4B3TK 3DLGA 3ZEUB 1ASWA 3TTDA 2HHWA 3FZHA 2O4IA 4BDYA 2Z1HA 1NGAA 3AO3A 3K0SA 3QEVA 4I6MB 2ASOA 5AQPA 1RDWX 3AVHA 3NH1A 4DV2K 3RMDA 4HTUA 3I8DA 1GLAG 1IBLK 5AQOA 1B9DA 4FOEA 5BPMA 3QEWA 3P5JA 1ZXOA 1GOAA 3N4PA 4H5TA 4M45A 2Y1JA 4H5VA 4LFBK 3T1AA 4FVUA 5DM6L 1RT3A 4IG3A 3CCVN 3G6EN 4YOVA 1T05A 1S5JA 3AVBA 4OO1J 1FKOA 3WNHA 4LH4A 3JXUA 4ILHA 4F3OA 1VHXA 4CJKA 3C95A 2GUIA 4FL9A 3TTCA 5AQUA 3LALA 3MEDA 4FM1A 3TSUA 4BRHA 1IKXA 4DR6K 3OYJA 3AO5A 3I33A 3NE6A 3T3FA 3SUPA 2D0OA 3OYIA 2O8EA 5AQSA 1DTTA 4EP5A 2JWLA 3WXMB 4YOUA 2OPRA 2UXCK 1SL0A 3CXCM 4N5SA 4LH5A 4E1MA 1VSFA 3CMAN 3A8YA 4M42A 1K8KA 4BC5A 1QZ5A 1MDUB 3ENBA 4HVJA 4EHUA 1RBSA 4IO9L 5AR0A 4DCHA 4BR4A 4CERA 4DUZK 4JI6K 4YOTA 3NH0A 3U8XA 3ULEB 3ID6A 4KFBA 2HBLA 4LF7K 3SUQA 3MEGA 5GIPA 5IWAK 3LL3A 3MN9A 4DTPA 2RF2A 3VQEA 4O44A 3MN5A 3QB0A 5B8HA 3TANA 3E9OA 5F2RA 4DS5A 4CESA 5JS2A 4JI3K 2Q31A 4XH1A 2KFNA 4DR3K 2IIRA 1SS6A 4DV3K 4AHTA 2CGJA 4KTWA 3DLLL 1NGJA 3ZSRA 5C24A 1VQ7N 4M3UA 3TU5A 2P9KA 4LF6K 4FLUA 4DSFA 4ILJA 1WBDA 4WFNL 3DLRA 4LSNA 4FPBA 1NK7A 4FLVA 4BDPA 3CFPA 3PUFA 2ZWHA 3BF3A 1HQEA 5JLFA 3L8BA 4O5FA 4E0DA 2YI1A 1QE1A 1JLQA 1YJNN 4LF9K 3O4NA 4OPAA 4DFJA 3SYZA 4FJHA 4AHUA 4BRAA 3H1VX 4HCCA 1VQLN 2E1YA 3GG4A 3VGLA 4DFMA 4E1JA 2V7ZA 3A5NC 5TKWA 3HYFA 3K9JA 4CEOA 1FW6A 2KZZA 4OKKA 1KRPA 2FC0A 3M5RA 3F9MA 1VSEA 4Y1DA 1DTQA 4H5WA 4O55A 1N5YA 1NG9A 4CZGA 3KK7A 4DHYA 1NLVA 2O4GA 2E2QA 4JKAA 5AZJB 4FM0A 3NFAA 4J2AA 4NYNA 3PV8A 2KQ2A 3CJAA 3DRRA 3AAQA 4B3OA 4F3TA 4KREA 1IKWA 1RBTA 3VTHA 3PIPL 4NB4A 3SAHA 2WC9A 3R8EA 2QWOA 1W0HA 3VESA 3H3NO 5KGWA 4BR9A 4BREA 1NBWA 4YNQA 4YOYA 4Z94A 4RW9A 3IKMA 1NMNA 3MK6A 3LP1A 2IS3A 3IAYA 1TL1A 5BPLA 2P9KB 4BRQA 1SV5A 2A42A 1HPZA 4FSVA 3MWPA 1I94K 1Q9XA 1EWQA 3CJ7A 4BRGA 3ITHA 3FGUA 2IC3A 3RMCA 5SWMA 1S72N 3SUNA 5KPTA 3VETA 3KWIA 4HCBA 5J2PA 4H4OA 4BE0A 2VCPA 4N47A 5KRSA 1VQ8N 1K73O 4I2QA 1HLUA 3S41A 4KI6A 1YIJN 2F9TA 4FLWA 4BRPA 2GBZA 2W42A 1VQMN 2G8HA 3IRXA 3TSPA 4DV5K 1RBUA 1Z26A 1YT3A 4H5NA 1IV0A 3ID8A 3TAGA 2QWLA 3C94A 3CI5A 3MXJA 4PHTX 4DV4K 3KD5E 3RR7A 4CEAA 3V9UA 2P9UA 3H46O 3ATVA 3ASMA 2HHXA 4EIAA 1RBRA 1RT5A 3GOIA 4CGFA 1TGOA 2V52B 3QMLA 4OGCA 4DR4K 1L5UA 4M3TA 3AGKA 3GDQA 4A2BA 3PO4A 4N41A 4CK3A 4J8FA 1T3VA 5ADXH 5E41A 3AARA 1MWMA 1S1TA 3VEOA 3OBWA 3L2UA 4DV0K 4ICLA 3MCPA 3KLHA 3L2RA 4NXMK 1XNRK 1MA9B 3VQ8A 1NK8A 3THVA 1QTMA 3NGYA 5KRTA 2Z1IA 3OYLA 1W9HA 5HLFA 3OJSA 1DLOA 5CY4A 1VQKN 3VQCA 4CFCA 3L3UA 1NK6A 1VSLA 2NNWA 2Q36A 1EXQA 3FE1A 3T1YK 4BRNA 4HWIA 4BWJA 2OA8A 1HMVA 1J53A 4RW4A 2YNGA 2P51A 2RN2A 1GLCG 5KPRA 3DXMB 5FDLA 1SQKA 1KAYA 1XMQK 2OYQA 4GV9A 5LMUK 3V9SA 3NH2A 3SBGA 1T6DA 5EVZA 1Q81O 4EP4A 4CEFA 2GEMA 4Z4FA 1WSJA 3HTVA 3I0RA 1W7AA 4CD1A 5K14A 5EX5A 3L2VA 1D5AA 3D2FB 4B9SA 1BISA 1BIZA 1RT7A 2VWJA 4JS5A 3VQ7A 1N36K 3H6EA 2PFUA 1P90A 1Q18A 1W97L 5C25A 1DT9A 1U4BA 2HSTA 2AA4A 4JHDA 4JI7K 3SJHA 3DLKA 2G8KA 3LP2A 4FLTA 1Z6RA 2JWKA 3CERA 3KJVA 1VSDA 1KD1O 4CHQA 5AFUH 1VSHA 3PIOL 2HNZA 4HUGA 2D0PA 1QHTA 4PQUA 4CJEA 3CD6N 4MO5A 2G8VA 2ZGYA 4BC4A 1WSFA 3O4QA 4FLYA 3SPZA 4CIGA 4IFYA 4K0KK 3MX5A 1NGBA 3EN9A 3WXKA 4BR0A 4FJMA 4YFUA 1S1UA 4O8UA 4N56A 1YXQA 3H45C 1YVNA 4BR7A 3SI6A 2BDPA 3O9UA 3QO9A 4IFEA 4CJFA 3M6GA 3TAFA 3HP6A 2QTDA 3O9RA 4BE1A 5FPMA 3QFUA 1KCFA 2HMPA 4W5OA 3QERA 3C6HA 3V4IA 1IO2A 4FWRA 4H0YB 1BA0A 3AVJA 2VGMA 1NK0A 2ITGA 4M41A 4CGDA 1IG8A 3K57A 1EETA 1BWFO 2RE2A 4PKGA 4Q5VA 4CEQA 3NGZA 3SJJA 1WUAA 3EE8A 4FWPA 5AZIA 2PYLA 3SQ1A 5J1EA 3QICA 4CBXA 4LSLA 1D9FA 1VAZA 4I2PA 4CZHA 4JRQA 5GIOA 1SKWA 2ZJPL 1NOZA 4L3QA 4M7YA 1T8EA 4CF9A 3UKRA 1KSPA 2NLXA 1WB9A 1NJXA 3SK3A 1RGIA 4FJ5A 2WONA 1TUYA 4JHDB 2F7TA 4OPHA 2BE2A 1RT4A 4OGEA 4CI6A 4DU4A 4WCEL 3GE1A 4LC9B 4JI8K 2GTDA 3IS9A 3RSEB 3CC2N 4CJRA 1YTAA 4B8AB 1XI1A 4CE9A 4H5RA 2XY7A 1Q82O 3O80A 4CIFA 3CJ1A 3PSFA 3DRPA 4M3RA 3R9PA 1QQCA 4DKWA 4B1ZA 1I39A 5GADP 2UUAK 3WT0A 3V1OA 5C2DA 3CETA 4JEPA 4BRMA 3BGRA 2HHHK 1NJZA 3OS2A 2E88A 1K9MO 3HSCA 4FM2A 3DLEA 1QSYA 2OTJN 4H0XB 2UXBK 3WNFA 1DEJA 4FJXA 1P8ZA 1KQSM 1FK9A 4I9LA 4K41A 3U3GA 4A2AA 4W5NA 2UYTA 2EX3A 5EY4A 3T7ZA 1T03A 2HHSA 3AA2A 1GLDG 4F2RA 3HVRA 5FRMA 2UXDK 1JLCA 3T19A 1S22A 5DMRA 3THWA 4CJQA 1VRTA 4DQQA 3EZWA 4AF1A 1V4SA 5AZIB 1B92A 5CZ2A 1Q9YA 3R3LA 1WN7A 1SKSA 4FJGA 1NGIA 4GV6A 4RG8A 2IVOA 4ID5A 2O8CA 1LWCA 3WXLA 4YOWA 3MX2A 1QS4A 5M1KA 4FW2A 4ILGB 3UKRB 4AHSA 4UQGA 1GLJO 2D1KA 4CF0A 1TK8A 4LF5K 5HOOA 4JN4A 4RCHA 2DTUA 1Z25A 4Z4GA 1QHAA 1EWRA 3Q7CA 4FW1A 3K58A 2WFBA 1XHXA 1HKGA 2HHUA 2IOCA 3HOTA 3VF2A 3O3HA 4CGIA 1T44A 4NLCA 4FXDA 1OVYA 3AA3A 3I0SA 4K42A 1WSEA 4DB3A 2E4LA 2ZGZA 1XHZA 1NKBA 5M1NA 1VQ4N 2Z1GA 1D4XA 4H0PA 3QEIA 5GAHP 1EP4A 3ZT3A 5CE3A 4BRIA 2P9SA 1GOBA 4H8KA 4B08A 3LDPA 3SNNA 4FWQA 3LDSA 5C12A 4GKJK 2ZE2A 1BQMA 1XUPO 2HB5A 4J2EA 1RDDA 2X74A 1KC8O 4IOXA 2NRXA 3THWB 4JD2A 3TPQA 1NJWA 2YHXA 2YHWA 3FZKA 4F4KA 1NGCA 2Q2RA 3DXKB 4DU3A 4KHQA 4DR1K 1OH6A 3VTIA 1BO5O 2GELA 4KV8A 2O8CB 2P9LA 3ZSWA 4E7KA 3NBPA 2FF6A 4FWSA 4H0VB 3SPYA 1HPMA 3IUCA 2QWPA 3CG7A 2A41A 1N6QA 1CLQA 3LP3A 5FLXO 4IEEA 3K5LA 3A0IX 5AQWA 4DU1A 3ZT0A 3EEQA 1VQNN 3MECA 5AQZA 1FXXA 4IG0A 4MQ3A 4NYFA 3OS1A 3ISNC 3CFOA 1J6ZA 1JKHA 1BU6O 2JGUA 2JLEA 3NF9A 1S6QA 2BUPA 4DTNA 1KFDA 1ASUA 4WQ4C 1YUWA 4DFKA 1A5XA 4FLZA 4CEEA 4H0TB 1L3SA 3H1QA 3QEXA 1TYQB 2PAVA 3F5TA 5C2FA 2X78A 1QQOA 2FSNA 3JAMO 4DSEA 2XHBA 3D2EA 1G15A 5CZ1A 4CJ7A 1R59O 2HF4A 3ZCMA 4NXNK 1Q86O 4JK9A 4CEDA 4CHNA 3OY9A 3RWUA 4CIEA 2Q1NA 1L3UA 5KGXA 3G0ZA 1U6ZA 5LMNK 4JD2B 4Q0BA 4PL7A 4MLEA 2KW4A 2YCHA 4JKEA 3G71N 4XH4A 1WBBA 1NGGA 3M3ZA 3OYHA 1VQ9N 3E9PA 1WSGA 2DFEA 3SQ4A 1NK5A 2BH1A 3O6WA 1BA1A 4JV5K 3CPWM 2OPPA 4BVOA 3W3DA 5C42A 3AVKA 3CJBA 1JLBA 3OYKA 5GAEP 4CECA 4BR5A 2VGNA 4B9UA 4B1UB 3E1YA 3PSIA 3SCXA 4KHUA 1BCOA 5M1FA 3CCJN 5GINA 2OTLN 3RRGA 3A5OC 4CZKA 2FF3B 2YHBA 3AVNA 3K5NA 4CZMA 4ISGA 4B1XB 4M3XA 2HMIA 3ZLJA 4C8MA 2O8EB 4PKHA 3A2FA 3RTVA 4DMNA 2Y1IA 3VA3A 3HOSA 4PKIA 4FJ8A 4YDUC 1HYSA 4CF2A 4UY8O 5F1XA 4KHWA 2CGKA 2HNYA 1KLMA 1VSJA 3VGMA 4CZJA 1VQPN 4C8NA 4DSKA 1K8KB 3A5MC 2A6AA 3HP9A 4CHYA 1RCHA 1YHQN 4IWVA 3O1WA 2F96A 1TVRA 3WQUA 1U45A 4ZTJA 1BIUA 2AJQA 3EL2A 5JLHA 4LY7A 5CYQA 3A5LC 2F9WA 3HZ6A 4W5TA 4B9QA 1C0TA 3LM9A 1WNSA 3OYCA 4DQPA 3AVMA 1RDUA 2I5JA 1KFSA 1D8YA
chains in the Genus database with same CATH topology
3DMJA 1RT7A 2VWJA 4Y1CA 5CYMA 4CJTA 4HUEA 3NF7A 1RTIA 1VSKA 2YV0X 4JS5A 3B6OA 2XO7A 3VQ7A 4Z4IA 3AVLA 3VQDA 1S1WA 5C25A 2F8SA 1U4BA 3ALYA 2HHQA 1RTJA 3P1GA 4RW6A 4Z4CA 2XRIA 1TKZA 2YKNA 2YNIA 5KI6A 4DQSA 3PX4A 1SL2A 2KFZA 2Q3SA 4OLAA 4EZ9A 4ELVA 3DLKA 2G8KA 3OYBA 3LP2A 3QIPA 3ZSVA 4FLTA 4IDKA 3KJVA 1VSDA 4IFVA 3ZSZA 3VQQA 2G8UA 1TKXA 4O0JA 4CHQA 1RTHA 1VSHA 1O1WA 2HNZA 4HUGA 2XY8A 3RMBA 3TR8A 3L2QA 3TABA 1QHTA 1UA1A 4PQUA 1TK5A 4CJEA 4H4MA 5KTQA 3K59A 2RKIA 4MFBA 1RTDA 5HRNA 4KB1A 5SZTA 1RILA 3JSMA 3ZT2A 1RNHA 3O3FA 3S3OA 4IKFA 2G8VA 3AA4A 1HNVA 4NCAA 5EU7A 4DQRA 4C8LA 1WSFA 3O4QA 3CM6A 4JLHA 4IBNA 4FLYA 3SPZA 4CIGA 1IH7A 4IFYA 5HP1A 3NAEA 4QCLA 3M8PA 3AO4A 3DOKA 4FJMA 1C6VA 3PX0A 4YFUA 1S1UA 3VQ6A 4N56A 3SQ2A 1TAUA 2P5OA 3SI6A 3DLBA 1NJYA 2BDPA 1NK9A 2P5GA 3QO9A 4O4GA 2QKKA 3LWMA 4CJFA 5HRSA 4ELUA 4M3YA 4QOZB 2B5JA 3TAFA 4CEZA 3HP6A 1D8YA 4BE1A 4K8XA 1JLAA 2YNFA 1KCFA 4OPKA 4W5OA 4FJIA 3QERA 4E3SA 3QNOA 4C8OA 4M3WA 3V4IA 3V81A 3TAPA 1IO2A 1BGXT 3NF8A 3VQPA 4CF8A 3OYDA 5HROA 3ZT1A 3ZSQA 3AVJA 1NOYA 4CHOA 1NK0A 4FJLA 4PY5A 4CHPA 1SUQA 3C6UA 1UA0A 4GMJB 2FBVA 2ITGA 4M41A 3PY8A 4CJVA 1HYVA 1LW2A 4F2SA 3C6TA 4CGDA 3K57A 1EETA 1WAFA 4PUOA 2F8TA 3F73A 4Q5VA 2VWKA 4CEQA 3NGZA 3ZSYA 3SJJA 3IG1A 3D0PA 4CJWA 3MEEA 4LD0A 4E7LA 2PYLA 3SQ1A 5J1EA 3V9ZA 4AHVA 3QETA 3QIOA 4FJ7A 3DYAA 4LSLA 4TSXA 3VQAA 4E19A 3CYMA 4Z0UA 4CJSA 2XY5A 1D9FA 1K6YA 3H08A 4GVMA 2E6LA 3KKSA 4CFBA 1LWFA 1RT6A 2DFFA 4I2PA 4JRQA 1TK0A 2OZSA 1SKWA 4N76A 1SL1A 1C1CA 1NOZA 2X6SA 3AVGA 4ZTFA 1T8EA 4FZZA 4CF9A 2BGGA 2G8IA 1KSPA 2NUBA 1S1XA 4CJPA 2YHAA 3EY1A 1NJXA 4J2DA 4E7HA 4FJ5A 2WONA 3DLGA 4DG1A 3MAQA 2BE2A 1ASWA 1RT4A 4OGEA 4DF8A 2HHWA 4DU4A 4CEBA 3WNGA 4CJ3A 1WSHA 4BDYA 2O4IA 2Z1HA 3AO3A 3LANA 4DTSA 1LW0A 3K5MA 3V1RA 3KLFA 3QEVA 2HNDA 4BDZA 3AVHA 3NH1A 3RMDA 4FK2A 3QESA 3KTQA 3MXMA 3IS9A 1B9FA 4HTUA 3I8DA 4CJRA 3LPUA 1YTAA 1A5VA 2D0BA 4B8AB 1B9DA 1HJRA 1JLFA 1XI1A 1RBVA 4OJRA 4CE9A 3QEWA 1HRHA 3P5JA 2HVHA 2XY7A 3HPGA 1BI4A 3HPHA 1GOAA 4M45A 4B8CA 3NGIA 2Y1JA 4J2BA 4AHRA 4CF1A 3HVTA 4CIFA 3T1AA 3HJFA 3DRPA 1RT3A 1WAJA 1VSIA 4M3RA 3KIOA 1A5WA 1QQCA 4IG3A 1ZBHA 4R5PA 1T05A 1J5OA 1S5JA 3AVBA 1ASVA 1I39A 1FKOA 2DFHA 3WNHA 4ELTA 3V1OA 2HVIA 2WOMA 4LH4A 2FBTA 3O3GA 3BGRA 1NJZA 3OS2A 3VQBA 4GW6A 4F3OA 4FZYA 4CJKA 3EZ5A 4FM2A 3DLEA 1QSYA 3C95A 2GUIA 1HQUA 4B9MA 2E6MA 3LALA 3WNFA 5FRNA 3MEDA 4FM1A 4FJXA 5J2NA 2IAJA 1FK9A 4I9LA 3U3GA 3M8RA 3PX6A 4W5NA 2EX3A 4KKOA 1IKXA 3G10A 1T03A 2HHSA 1FKPA 3AA2A 4F2RA 4DF4A 3OYJA 3HVRA 2D0AA 3AO5A 5FRMA 3NE6A 1JLCA 1CXUA 3T3FA 3SUPA 2FBXA 4KTQA 3OYIA 3T19A 4KB0A 1DTTA 4EP5A 4ZHRA 5D3GA 5DMRA 4BWMA 4CJQA 1VRTA 2OPRA 1R0AA 2D0CA 4DQQA 1SL0A 3K2PA 4G1QA 4N5SA 2FBYA 4LH5A 1L3VA 4E1MA 1IKYA 1B92A 1VSFA 1BHLA 3M8SA 1Q8IA 5CZ2A 2KZMA 2DY4A 3AVCA 1JL1A 1Q9YA 1WN7A 1SKSA 4FJGA 4M3UA 4K8ZA 3ZSXA 4RG8A 1HYZA 1WLJA 4ID5A 4M42A 3HK2A 1LWCA 4CK2A 1QS4A 4HVJA 1RBSA 4FW2A 3KLIA 4AHSA 4UQGA 4AHCA 3VQ5A 4CERA 4CF0A 3CM5A 1S9EA 1TK8A 1JL2A 3NH0A 2PZSA 4KFBA 1QSLA 1UWBA 2DTUA 1KTQA 3SUQA 1Z25A 3MEGA 1U49A 3M8QA 3AVIA 4Z4GA 4CK1A 3AO1A 4FW1A 3K58A 4L8RB 2HHVA 1YVUA 4DTPA 2RF2A 3KKRA 4I9QA 3VQEA 1XHXA 2HHUA 4O44A 2EHGA 3TANA 5HBMA 4DS5A 2IOCA 4CESA 4DSIA 4AILC 1GOCA 3O3HA 4CGIA 5JS2A 3V6DA 1VSMA 3HL8A 1BI4B 1T7PA 3PO5A 3QINA 4NCBA 2KFNA 4DTOA 4FYDA 4FXDA 3I0SA 3AA3A 2XY6A 1WSEA 4AHTA 2G8WA 3HPOA 4KTWA 4DS4A 3ZSRA 1VRUA 5C24A 3AA5X 2E4LA 4OVLA 4FLXA 1XHZA 1NKBA 4CJ5A 1RT2A 1KVAA 2Z1GA 4B9LA 3KK1A 4FLUA 4C8KA 4KHYA 1REVA 4DSFA 3QEIA 3DLRA 1EP4A 4LSNA 3VQ4A 3HM9A 4KPYA 4BE2A 1NK7A 4FLVA 1X9WA 3AVFA 3ZT3A 1U48A 4BDPA 1QSSA 4F8RA 1S1VA 3CFPA 2B4JA 1GOBA 3PUFA 2ATQA 1HQEA 4H8KA 3L8BA 4E0DA 3SQ0A 4B08A 5JS1A 1QE1A 3SNNA 3LDSA 1BL3A 3LAKA 3TI0A 2ZE2A 4DWIA 3OJUA 1BQMA 1JLQA 1TKDA 4RW8A 1ITGA 3O4NA 2HB5A 3UIQA 4DFJA 2PY5A 4J2EA 1CZ9A 2ZD1A 3SV3A 3SYZA 4FJHA 2OZMA 1RDDA 4AHUA 3OYAA 2X74A 3L3VA 3DM2A 3LWLA 2A1RA 3LPTA 4HCCA 3NF6A 3V9WA 3KK2A 4M3ZA 3F9KA 3RMAA 4XIUA 1ZBIA 4DFMA 1KVCA 5I42A 4RW7A 1NJWA 3OS0A 4E7IA 4F4KA 3HYFA 4ID1A 4CEOA 3OYFA 3S3MA 3DLHA 4DFPA 2KZZA 4OKKA 4DU3A 2FC0A 1KRPA 3U6FA 4FJJA 1EX4A 4CGHA 4KHQA 3VQ9A 3AVAA 3KK3A 1C0UA 2QXFA 1KLNA 3TAQA 1VSEA 1RDBA 1DTQA 4KV8A 4O55A 1XWLA 4Y1DA 3ZSOA 1N5YA 4DLEA 3FFIA 3ZSWA 4E7KA 4DTMA 3NBPA 5J2MA 4KHNA 3SPYA 4JS4A 3CG7A 1N6QA 1D9DA 1C0MA 1C1AA 2O4GA 1CLQA 3LP3A 3CQ8A 4FM0A 3NFAA 1MU2A 4CJLA 4W5RA 4NYNA 3K5LA 1NK4A 1C1BA 3PV8A 3L2WA 4J2AA 2KQ2A 3DRRA 4DLGA 2PYJA 4PWDA 4DU1A 3ZT0A 1X9SA 3ZT4A 4B3OA 3CFRA 3HO1A 4F3TA 4KREA 3NCIA 3HSTB 3MECA 2P1JA 1IKWA 1RBTA 1TL3A 1FXXA 4IG0A 2YNHA 4MQ3A 4NYFA 3VA0A 2B6AA 4KAZA 1UAXA 3OS1A 3QEPA 3LZJA 3OYNA 2D5RA 3ISNC 3CFOA 2QK9A 1W0HA 2KTQA 5KGWA 1JKHA 4O5BA 1CXQA 4BACA 3E01A 3V9XA 4DSJA 4YNQA 2JGUA 4RW9A 3OYGA 3JYTA 2HW3A 1VK0A 2JLEA 3NF9A 1S6QA 4OKJA 4KHSA 3LP1A 2IS3A 3IAYA 4DTNA 1TL1A 2HHTA 1KFDA 1ASUA 1SV5A 1HPZA 4DFKA 3QNNA 4DTRA 1Q9XA 1A5XA 3LZIA 5HRRA 4FLZA 3ITHA 3DOLA 4CEEA 3AO2A 1ZBFA 1L3SA 1EKEA 1X1PA 2IC3A 2RPIA 5FROA 3RMCA 1YTUA 5SWMA 3ULDA 3LAMA 4DTJA 3QEXA 4O0IA 3SUNA 3KLEA 3HT3A 4CGJA 1J54A 2X78A 2GV9A 5J2PA 4HCBA 4H4OA 4KTZA 4BE0A 4DSEA 2XHBA 4N47A 5KRSA 1G15A 3S3NA 2X6NA 5CZ1A 1S6PA 3TAMA 4I2QA 1HNIA 4JRPA 3ZCMA 4E7JA 3TARA 4KI6A 5DK5A 3V1QA 4CEDA 4CHNA 4FLWA 3OY9A 1BCMA 1L3TA 3SZ2A 4CIEA 3RWUA 2LSNA 1L3UA 5KGXA 2GBZA 2W42A 3G0ZA 1ZBLA 1NKEA 3IRXA 1NKCA 2G8HA 4NCGA 1RBUA 1Z26A 4FZXC 1S9GA 1YT3A 4Q0BA 3OVNA 3TAGA 4CHZA 2KW4A 4OKEA 4AH9A 3TWHA 3TAEA 3C94A 1Y97A 3EYZA 4B9NA 3MXJA 3OYHA 1WSIA 4E1NA 4Z4HA 1WSGA 3KD5E 3RR7A 2DFEA 4CEAA 4CJ4A 3V9UA 2Z1JA 3SQ4A 1NK5A 4I7FA 3P83D 4CGGA 3D45A 4HUFA 3ASMA 4DTUA 2HHXA 4FJNA 1RBRA 4EZ6A 2OPPA 1RT5A 4CGFA 3KD1E 1LWEA 2VG6A 5C42A 1TGOA 2ETJA 3AVKA 4OGCA 3NHGA 4FK4A 1JLBA 1BQNA 3QLHA 3WNEA 3OYKA 1L5UA 1JXEA 4CECA 3BDPA 4B9UA 4M3TA 1JLEA 1LAVA 3SCXA 4KHUA 1BCOA 3LP0A 1U04A 4CFDA 1TV6A 3B6PA 3AV9A 3OYMA 3MXIA 3PO4A 4N41A 4Z4EA 3RRGA 4CK3A 1JLGA 4FVMA 4KRFA 5E41A 3SUOA 3HXMA 1RT1A 2VG5A 2YHBA 3AVNA 1S1TA 3K5NA 4KO0A 1JXBA 4M3XA 2HMIA 1ZBUA 2VG7A 4C8MA 3L2UA 5J2QA 4OLBA 3A2FA 3RTVA 4DMNA 5I3UA 1LAWA 4ICLA 2Y1IA 4WE1A 3VA3A 4B9TA 3KLHA 3L2RA 4FJ8A 5T7BA 4W5QA 4CF2A 1HYSA 1NK8A 3DI6A 3VQ8A 3U3YA 1IG9A 4FJKA 2HNYA 4FK0A 4KHWA 1KLMA 1VSJA 1IKVA 3THVA 2ZQBA 3NGYA 1QTMA 5KRTA 2Z1IA 4C8NA 1XC9A 4CFAA 3OYLA 1I3AA 1W9HA 2R7YA 5HLFA 2A1SA 4HHTA 4DTXA 4DSKA 2YKMA 3OYEA 3OJSA 4CCHA 1DLOA 5CY4A 3HP9A 3RRHA 3VQCA 1KVBA 1CZBA 1RCHA 4PA1A 4CFCA 3L3UA 3VN5A 4CHYA 2F96A 1TVRA 1VSLA 4FCYA 1NK6A 1EXQA 2IGIA 3K5OA 5HRPA 3SV4A 4DQIA 1U45A 4BWJA 2OA8A 1HMVA 1J53A 4RW4A 4ZTJA 2YNGA 2P51A 2RN2A 1BIUA 5FDLA 4KI4A 2AJQA 2OYQA 1TKTA 4DSLA 4LY7A 3S9HA 4OPJA 3KLGA 1UOCA 2OPQA 3NH2A 5CYQA 3V9SA 1U47A 3NDKA 2G8FA 1RDAA 2BANA 4E89A 4W5TA 1F21A 4EP4A 1LV5A 4CEFA 3RR8A 4Z4FA 1WSJA 1C0TA 1ZYQA 2QKBA 1RDCA 3I0RA 1WNSA 3OYCA 3DRSA 4DQPA 1J9AA 5K14A 3L2VA 1D5AA 1X9MA 4FJ9A 3AVMA 4CJUA 4B9SA 2I5JA 2OPSA 1SKRA 1KFSA 1TAQA 4B9VA 2IDOA 1BISA 4QAGA 1BIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMJ A;  1RT7 A;  2VWJ A;  4Y1C A;  5CYM A;  4CJT A;  4HUE A;  3NF7 A;  1RTI A;  1VSK A;  2YV0 X;  4JS5 A;  3B6O A;  2XO7 A;  3VQ7 A;  4Z4I A;  3AVL A;  3VQD A;  1S1W A;  5C25 A;  2F8S A;  1U4B A;  3ALY A;  2HHQ A;  1RTJ A;  3P1G A;  4RW6 A;  4Z4C A;  2XRI A;  1TKZ A;  2YKN A;  2YNI A;  5KI6 A;  4DQS A;  3PX4 A;  1SL2 A;  2KFZ A;  2Q3S A;  4OLA A;  4EZ9 A;  4ELV A;  3DLK A;  2G8K A;  3OYB A;  3LP2 A;  3QIP A;  3ZSV A;  4FLT A;  4IDK A;  3KJV A;  1VSD A;  4IFV A;  3ZSZ A;  3VQQ A;  2G8U A;  1TKX A;  4O0J A;  4CHQ A;  1RTH A;  1VSH A;  1O1W A;  2HNZ A;  4HUG A;  2XY8 A;  3RMB A;  3TR8 A;  3L2Q A;  3TAB A;  1QHT A;  1UA1 A;  4PQU A;  1TK5 A;  4CJE A;  4H4M A;  5KTQ A;  3K59 A;  2RKI A;  4MFB A;  1RTD A;  5HRN A;  4KB1 A;  5SZT A;  1RIL A;  3JSM A;  3ZT2 A;  1RNH A;  3O3F A;  3S3O A;  4IKF A;  2G8V A;  3AA4 A;  1HNV A;  4NCA A;  5EU7 A;  4DQR A;  4C8L A;  1WSF A;  3O4Q A;  3CM6 A;  4JLH A;  4IBN A;  4FLY A;  3SPZ A;  4CIG A;  1IH7 A;  4IFY A;  5HP1 A;  3NAE A;  4QCL A;  3M8P A;  3AO4 A;  3DOK A;  4FJM A;  1C6V A;  3PX0 A;  4YFU A;  1S1U A;  3VQ6 A;  4N56 A;  3SQ2 A;  1TAU A;  2P5O A;  3SI6 A;  3DLB A;  1NJY A;  2BDP A;  1NK9 A;  2P5G A;  3QO9 A;  4O4G A;  2QKK A;  3LWM A;  4CJF A;  5HRS A;  4ELU A;  4M3Y A;  4QOZ B;  2B5J A;  3TAF A;  4CEZ A;  3HP6 A;  1D8Y A;  4BE1 A;  4K8X A;  1JLA A;  2YNF A;  1KCF A;  4OPK A;  4W5O A;  4FJI A;  3QER A;  4E3S A;  3QNO A;  4C8O A;  4M3W A;  3V4I A;  3V81 A;  3TAP A;  1IO2 A;  1BGX T;  3NF8 A;  3VQP A;  4CF8 A;  3OYD A;  5HRO A;  3ZT1 A;  3ZSQ A;  3AVJ A;  1NOY A;  4CHO A;  1NK0 A;  4FJL A;  4PY5 A;  4CHP A;  1SUQ A;  3C6U A;  1UA0 A;  4GMJ B;  2FBV A;  2ITG A;  4M41 A;  3PY8 A;  4CJV A;  1HYV A;  1LW2 A;  4F2S A;  3C6T A;  4CGD A;  3K57 A;  1EET A;  1WAF A;  4PUO A;  2F8T A;  3F73 A;  4Q5V A;  2VWK A;  4CEQ A;  3NGZ A;  3ZSY A;  3SJJ A;  3IG1 A;  3D0P A;  4CJW A;  3MEE A;  4LD0 A;  4E7L A;  2PYL A;  3SQ1 A;  5J1E A;  3V9Z A;  4AHV A;  3QET A;  3QIO A;  4FJ7 A;  3DYA A;  4LSL A;  4TSX A;  3VQA A;  4E19 A;  3CYM A;  4Z0U A;  4CJS A;  2XY5 A;  1D9F A;  1K6Y A;  3H08 A;  4GVM A;  2E6L A;  3KKS A;  4CFB A;  1LWF A;  1RT6 A;  2DFF A;  4I2P A;  4JRQ A;  1TK0 A;  2OZS A;  1SKW A;  4N76 A;  1SL1 A;  1C1C A;  1NOZ A;  2X6S A;  3AVG A;  4ZTF A;  1T8E A;  4FZZ A;  4CF9 A;  2BGG A;  2G8I A;  1KSP A;  2NUB A;  1S1X A;  4CJP A;  2YHA A;  3EY1 A;  1NJX A;  4J2D A;  4E7H A;  4FJ5 A;  2WON A;  3DLG A;  4DG1 A;  3MAQ A;  2BE2 A;  1ASW A;  1RT4 A;  4OGE A;  4DF8 A;  2HHW A;  4DU4 A;  4CEB A;  3WNG A;  4CJ3 A;  1WSH A;  4BDY A;  2O4I A;  2Z1H A;  3AO3 A;  3LAN A;  4DTS A;  1LW0 A;  3K5M A;  3V1R A;  3KLF A;  3QEV A;  2HND A;  4BDZ A;  3AVH A;  3NH1 A;  3RMD A;  4FK2 A;  3QES A;  3KTQ A;  3MXM A;  3IS9 A;  1B9F A;  4HTU A;  3I8D A;  4CJR A;  3LPU A;  1YTA A;  1A5V A;  2D0B A;  4B8A B;  1B9D A;  1HJR A;  1JLF A;  1XI1 A;  1RBV A;  4OJR A;  4CE9 A;  3QEW A;  1HRH A;  3P5J A;  2HVH A;  2XY7 A;  3HPG A;  1BI4 A;  3HPH A;  1GOA A;  4M45 A;  4B8C A;  3NGI A;  2Y1J A;  4J2B A;  4AHR A;  4CF1 A;  3HVT A;  4CIF A;  3T1A A;  3HJF A;  3DRP A;  1RT3 A;  1WAJ A;  1VSI A;  4M3R A;  3KIO A;  1A5W A;  1QQC A;  4IG3 A;  1ZBH A;  4R5P A;  1T05 A;  1J5O A;  1S5J A;  3AVB A;  1ASV A;  1I39 A;  1FKO A;  2DFH A;  3WNH A;  4ELT A;  3V1O A;  2HVI A;  2WOM A;  4LH4 A;  2FBT A;  3O3G A;  3BGR A;  1NJZ A;  3OS2 A;  3VQB A;  4GW6 A;  4F3O A;  4FZY A;  4CJK A;  3EZ5 A;  4FM2 A;  3DLE A;  1QSY A;  3C95 A;  2GUI A;  1HQU A;  4B9M A;  2E6M A;  3LAL A;  3WNF A;  5FRN A;  3MED A;  4FM1 A;  4FJX A;  5J2N A;  2IAJ A;  1FK9 A;  4I9L A;  3U3G A;  3M8R A;  3PX6 A;  4W5N A;  2EX3 A;  4KKO A;  1IKX A;  3G10 A;  1T03 A;  2HHS A;  1FKP A;  3AA2 A;  4F2R A;  4DF4 A;  3OYJ A;  3HVR A;  2D0A A;  3AO5 A;  5FRM A;  3NE6 A;  1JLC A;  1CXU A;  3T3F A;  3SUP A;  2FBX A;  4KTQ A;  3OYI A;  3T19 A;  4KB0 A;  1DTT A;  4EP5 A;  4ZHR A;  5D3G A;  5DMR A;  4BWM A;  4CJQ A;  1VRT A;  2OPR A;  1R0A A;  2D0C A;  4DQQ A;  1SL0 A;  3K2P A;  4G1Q A;  4N5S A;  2FBY A;  4LH5 A;  1L3V A;  4E1M A;  1IKY A;  1B92 A;  1VSF A;  1BHL A;  3M8S A;  1Q8I A;  5CZ2 A;  2KZM A;  2DY4 A;  3AVC A;  1JL1 A;  1Q9Y A;  1WN7 A;  1SKS A;  4FJG A;  4M3U A;  4K8Z A;  3ZSX A;  4RG8 A;  1HYZ A;  1WLJ A;  4ID5 A;  4M42 A;  3HK2 A;  1LWC A;  4CK2 A;  1QS4 A;  4HVJ A;  1RBS A;  4FW2 A;  3KLI A;  4AHS A;  4UQG A;  4AHC A;  3VQ5 A;  4CER A;  4CF0 A;  3CM5 A;  1S9E A;  1TK8 A;  1JL2 A;  3NH0 A;  2PZS A;  4KFB A;  1QSL A;  1UWB A;  2DTU A;  1KTQ A;  3SUQ A;  1Z25 A;  3MEG A;  1U49 A;  3M8Q A;  3AVI A;  4Z4G A;  4CK1 A;  3AO1 A;  4FW1 A;  3K58 A;  4L8R B;  2HHV A;  1YVU A;  4DTP A;  2RF2 A;  3KKR A;  4I9Q A;  3VQE A;  1XHX A;  2HHU A;  4O44 A;  2EHG A;  3TAN A;  5HBM A;  4DS5 A;  2IOC A;  4CES A;  4DSI A;  4AIL C;  1GOC A;  3O3H A;  4CGI A;  5JS2 A;  3V6D A;  1VSM A;  3HL8 A;  1BI4 B;  1T7P A;  3PO5 A;  3QIN A;  4NCB A;  2KFN A;  4DTO A;  4FYD A;  4FXD A;  3I0S A;  3AA3 A;  2XY6 A;  1WSE A;  4AHT A;  2G8W A;  3HPO A;  4KTW A;  4DS4 A;  3ZSR A;  1VRU A;  5C24 A;  3AA5 X;  2E4L A;  4OVL A;  4FLX A;  1XHZ A;  1NKB A;  4CJ5 A;  1RT2 A;  1KVA A;  2Z1G A;  4B9L A;  3KK1 A;  4FLU A;  4C8K A;  4KHY A;  1REV A;  4DSF A;  3QEI A;  3DLR A;  1EP4 A;  4LSN A;  3VQ4 A;  3HM9 A;  4KPY A;  4BE2 A;  1NK7 A;  4FLV A;  1X9W A;  3AVF A;  3ZT3 A;  1U48 A;  4BDP A;  1QSS A;  4F8R A;  1S1V A;  3CFP A;  2B4J A;  1GOB A;  3PUF A;  2ATQ A;  1HQE A;  4H8K A;  3L8B A;  4E0D A;  3SQ0 A;  4B08 A;  5JS1 A;  1QE1 A;  3SNN A;  3LDS A;  1BL3 A;  3LAK A;  3TI0 A;  2ZE2 A;  4DWI A;  3OJU A;  1BQM A;  1JLQ A;  1TKD A;  4RW8 A;  1ITG A;  3O4N A;  2HB5 A;  3UIQ A;  4DFJ A;  2PY5 A;  4J2E A;  1CZ9 A;  2ZD1 A;  3SV3 A;  3SYZ A;  4FJH A;  2OZM A;  1RDD A;  4AHU A;  3OYA A;  2X74 A;  3L3V A;  3DM2 A;  3LWL A;  2A1R A;  3LPT A;  4HCC A;  3NF6 A;  3V9W A;  3KK2 A;  4M3Z A;  3F9K A;  3RMA A;  4XIU A;  1ZBI A;  4DFM A;  1KVC A;  5I42 A;  4RW7 A;  1NJW A;  3OS0 A;  4E7I A;  4F4K A;  3HYF A;  4ID1 A;  4CEO A;  3OYF A;  3S3M A;  3DLH A;  4DFP A;  2KZZ A;  4OKK A;  4DU3 A;  2FC0 A;  1KRP A;  3U6F A;  4FJJ A;  1EX4 A;  4CGH A;  4KHQ A;  3VQ9 A;  3AVA A;  3KK3 A;  1C0U A;  2QXF A;  1KLN A;  3TAQ A;  1VSE A;  1RDB A;  1DTQ A;  4KV8 A;  4O55 A;  1XWL A;  4Y1D A;  3ZSO A;  1N5Y A;  4DLE A;  3FFI A;  3ZSW A;  4E7K A;  4DTM A;  3NBP A;  5J2M A;  4KHN A;  3SPY A;  4JS4 A;  3CG7 A;  1N6Q A;  1D9D A;  1C0M A;  1C1A A;  2O4G A;  1CLQ A;  3LP3 A;  3CQ8 A;  4FM0 A;  3NFA A;  1MU2 A;  4CJL A;  4W5R A;  4NYN A;  3K5L A;  1NK4 A;  1C1B A;  3PV8 A;  3L2W A;  4J2A A;  2KQ2 A;  3DRR A;  4DLG A;  2PYJ A;  4PWD A;  4DU1 A;  3ZT0 A;  1X9S A;  3ZT4 A;  4B3O A;  3CFR A;  3HO1 A;  4F3T A;  4KRE A;  3NCI A;  3HST B;  3MEC A;  2P1J A;  1IKW A;  1RBT A;  1TL3 A;  1FXX A;  4IG0 A;  2YNH A;  4MQ3 A;  4NYF A;  3VA0 A;  2B6A A;  4KAZ A;  1UAX A;  3OS1 A;  3QEP A;  3LZJ A;  3OYN A;  2D5R A;  3ISN C;  3CFO A;  2QK9 A;  1W0H A;  2KTQ A;  5KGW A;  1JKH A;  4O5B A;  1CXQ A;  4BAC A;  3E01 A;  3V9X A;  4DSJ A;  4YNQ A;  2JGU A;  4RW9 A;  3OYG A;  3JYT A;  2HW3 A;  1VK0 A;  2JLE A;  3NF9 A;  1S6Q A;  4OKJ A;  4KHS A;  3LP1 A;  2IS3 A;  3IAY A;  4DTN A;  1TL1 A;  2HHT A;  1KFD A;  1ASU A;  1SV5 A;  1HPZ A;  4DFK A;  3QNN A;  4DTR A;  1Q9X A;  1A5X A;  3LZI A;  5HRR A;  4FLZ A;  3ITH A;  3DOL A;  4CEE A;  3AO2 A;  1ZBF A;  1L3S A;  1EKE A;  1X1P A;  2IC3 A;  2RPI A;  5FRO A;  3RMC A;  1YTU A;  5SWM A;  3ULD A;  3LAM A;  4DTJ A;  3QEX A;  4O0I A;  3SUN A;  3KLE A;  3HT3 A;  4CGJ A;  1J54 A;  2X78 A;  2GV9 A;  5J2P A;  4HCB A;  4H4O A;  4KTZ A;  4BE0 A;  4DSE A;  2XHB A;  4N47 A;  5KRS A;  1G15 A;  3S3N A;  2X6N A;  5CZ1 A;  1S6P A;  3TAM A;  4I2Q A;  1HNI A;  4JRP A;  3ZCM A;  4E7J A;  3TAR A;  4KI6 A;  5DK5 A;  3V1Q A;  4CED A;  4CHN A;  4FLW A;  3OY9 A;  1BCM A;  1L3T A;  3SZ2 A;  4CIE A;  3RWU A;  2LSN A;  1L3U A;  5KGX A;  2GBZ A;  2W42 A;  3G0Z A;  1ZBL A;  1NKE A;  3IRX A;  1NKC A;  2G8H A;  4NCG A;  1RBU A;  1Z26 A;  4FZX C;  1S9G A;  1YT3 A;  4Q0B A;  3OVN A;  3TAG A;  4CHZ A;  2KW4 A;  4OKE A;  4AH9 A;  3TWH A;  3TAE A;  3C94 A;  1Y97 A;  3EYZ A;  4B9N A;  3MXJ A;  3OYH A;  1WSI A;  4E1N A;  4Z4H A;  1WSG A;  3KD5 E;  3RR7 A;  2DFE A;  4CEA A;  4CJ4 A;  3V9U A;  2Z1J A;  3SQ4 A;  1NK5 A;  4I7F A;  3P83 D;  4CGG A;  3D45 A;  4HUF A;  3ASM A;  4DTU A;  2HHX A;  4FJN A;  1RBR A;  4EZ6 A;  2OPP A;  1RT5 A;  4CGF A;  3KD1 E;  1LWE A;  2VG6 A;  5C42 A;  1TGO A;  2ETJ A;  3AVK A;  4OGC A;  3NHG A;  4FK4 A;  1JLB A;  1BQN A;  3QLH A;  3WNE A;  3OYK A;  1L5U A;  1JXE A;  4CEC A;  3BDP A;  4B9U A;  4M3T A;  1JLE A;  1LAV A;  3SCX A;  4KHU A;  1BCO A;  3LP0 A;  1U04 A;  4CFD A;  1TV6 A;  3B6P A;  3AV9 A;  3OYM A;  3MXI A;  3PO4 A;  4N41 A;  4Z4E A;  3RRG A;  4CK3 A;  1JLG A;  4FVM A;  4KRF A;  5E41 A;  3SUO A;  3HXM A;  1RT1 A;  2VG5 A;  2YHB A;  3AVN A;  1S1T A;  3K5N A;  4KO0 A;  1JXB A;  4M3X A;  2HMI A;  1ZBU A;  2VG7 A;  4C8M A;  3L2U A;  5J2Q A;  4OLB A;  3A2F A;  3RTV A;  4DMN A;  5I3U A;  1LAW A;  4ICL A;  2Y1I A;  4WE1 A;  3VA3 A;  4B9T A;  3KLH A;  3L2R A;  4FJ8 A;  5T7B A;  4W5Q A;  4CF2 A;  1HYS A;  1NK8 A;  3DI6 A;  3VQ8 A;  3U3Y A;  1IG9 A;  4FJK A;  2HNY A;  4FK0 A;  4KHW A;  1KLM A;  1VSJ A;  1IKV A;  3THV A;  2ZQB A;  3NGY A;  1QTM A;  5KRT A;  2Z1I A;  4C8N A;  1XC9 A;  4CFA A;  3OYL A;  1I3A A;  1W9H A;  2R7Y A;  5HLF A;  2A1S A;  4HHT A;  4DTX A;  4DSK A;  2YKM A;  3OYE A;  3OJS A;  4CCH A;  1DLO A;  5CY4 A;  3HP9 A;  3RRH A;  3VQC A;  1KVB A;  1CZB A;  1RCH A;  4PA1 A;  4CFC A;  3L3U A;  3VN5 A;  4CHY A;  2F96 A;  1TVR A;  1VSL A;  4FCY A;  1NK6 A;  1EXQ A;  2IGI A;  3K5O A;  5HRP A;  3SV4 A;  4DQI A;  1U45 A;  4BWJ A;  2OA8 A;  1HMV A;  1J53 A;  4RW4 A;  4ZTJ A;  2YNG A;  2P51 A;  2RN2 A;  1BIU A;  5FDL A;  4KI4 A;  2AJQ A;  2OYQ A;  1TKT A;  4DSL A;  4LY7 A;  3S9H A;  4OPJ A;  3KLG A;  1UOC A;  2OPQ A;  3NH2 A;  5CYQ A;  3V9S A;  1U47 A;  3NDK A;  2G8F A;  1RDA A;  2BAN A;  4E89 A;  4W5T A;  1F21 A;  4EP4 A;  1LV5 A;  4CEF A;  3RR8 A;  4Z4F A;  1WSJ A;  1C0T A;  1ZYQ A;  2QKB A;  1RDC A;  3I0R A;  1WNS A;  3OYC A;  3DRS A;  4DQP A;  1J9A A;  5K14 A;  3L2V A;  1D5A A;  1X9M A;  4FJ9 A;  3AVM A;  4CJU A;  4B9S A;  2I5J A;  2OPS A;  1SKR A;  1KFS A;  1TAQ A;  4B9V A;  2IDO A;  1BIS A;  4QAG A;  1BIZ A; 
#chains in the Genus database with same CATH topology
 1MWK A;  4CJT A;  4HUE A;  1RTI A;  1VSK A;  2YV0 X;  5E26 A;  4Z4I A;  3NVM A;  1RTJ A;  4RW6 A;  3PX4 A;  1SL2 A;  2KFZ A;  4B1W B;  2VYP A;  2QW9 A;  2UU9 K;  4OLA A;  4MO4 A;  3IDH A;  3OYB A;  2WUS A;  2NRR A;  5KQD A;  4B3M K;  4KBO A;  1TKX A;  5LJW A;  1O1W A;  4EAH D;  3RMB A;  5AQM A;  2Q0U A;  3TAB A;  2UUB K;  4FPA A;  3BZC A;  4MFB A;  5HRN A;  2ZM6 K;  1RIL A;  1RNH A;  4NCA A;  3AA4 A;  1HNV A;  5EU7 A;  2WTU A;  3CM6 A;  4IBN A;  1HR0 K;  3VPZ A;  2FSK A;  1C6V A;  2NRT A;  1TAU A;  3DLB A;  5AQJ A;  2QKK A;  4QOZ B;  4LFA K;  2B5J A;  4K8X A;  2YNF A;  1KAX A;  4QS7 A;  3EKU A;  4FJI A;  2GWJ A;  1J5E K;  3CF5 L;  3TAP A;  3NF8 A;  3P4I A;  3VQP A;  3ZT1 A;  3D6R A;  3EKS A;  4C1N I;  4V19 S;  4PY5 A;  1Z05 A;  1SUQ A;  3PY8 A;  1HYV A;  4C1N K;  4GNI A;  4PUO A;  3LDO A;  3F73 A;  2F8T A;  3KVG A;  3UKU A;  4DV1 K;  3C7N A;  4CJW A;  3H3O B;  5JMV A;  4LD0 A;  3V9Z A;  3BP8 A;  4AHV A;  4FJ7 A;  3QIO A;  3DYA A;  4BRL A;  3VQA A;  4E19 A;  2XY5 A;  3CYM A;  1K6Y A;  4CFB A;  3KKS A;  5FPD A;  3O9Q A;  4WQ4 A;  4RWT A;  2G8I A;  3C6A A;  2NUB A;  3L4I A;  3EY1 A;  4J2D A;  4LF8 K;  4E7H A;  3SAF A;  3MAQ A;  4DF8 A;  5AQF A;  4CEB A;  4CJ3 A;  1WSH A;  3LAN A;  3V1R A;  3KLF A;  1OH7 A;  4FK2 A;  4U7B A;  3QES A;  4KH5 A;  1B9F A;  3OW2 M;  2KLA A;  1C0F A;  4ISE A;  1A5V A;  2D0B A;  3LDQ A;  1JLF A;  2QWN A;  3O9S A;  1RBV A;  2HVH A;  3HPG A;  3HPH A;  3NGI A;  5LY3 A;  4J2B A;  2QA4 N;  3HVT A;  4JKH A;  3CCS N;  1M90 O;  2O8D A;  1WAJ A;  3ZX0 A;  1NU0 A;  3E66 A;  3KIO A;  1A5W A;  4M63 C;  2OCE A;  1ZBH A;  2ZF5 O;  1ASV A;  4ELT A;  2DFH A;  2HVI A;  5LL6 Z;  1FJG K;  2WOM A;  5BRD A;  2ASP A;  4BG9 A;  1HUX A;  4GV3 A;  3VQB A;  4GW6 A;  4JYA K;  5FPE A;  3EZ5 A;  2I7N A;  1HQU A;  4JI2 K;  4B9M A;  3SMS A;  2E6M A;  3QBW A;  4FOI A;  1S3X A;  2P9U B;  4A59 A;  2A40 A;  2IAJ A;  2DPN A;  4BRC A;  4KKO A;  4MDB A;  3G10 A;  4CZF A;  4RTF D;  1FKP A;  4PL8 A;  1OKJ A;  2D0A A;  1CXU A;  4KTQ A;  2FBX A;  4JKC A;  3KHY A;  5DM7 L;  2FSJ A;  4BWM A;  1RFQ A;  2E2P A;  2D0C A;  3K2P A;  1L3V A;  3M8S A;  1BOT O;  1Q8I A;  3VF4 A;  2HF3 A;  1JL1 A;  5M1O A;  1WLJ A;  4YDU A;  4BC2 A;  4CK2 A;  1SZ2 A;  3KLI A;  3VEY A;  3VQ5 A;  4JI1 K;  2BTF A;  1S9E A;  2PZS A;  1QSL A;  4X66 K;  3AVI A;  1N34 K;  4WFB L;  4X62 K;  4AM6 A;  4BRF A;  4I9Q A;  2J4R A;  5BRF A;  5HBM A;  5BN9 A;  4AIL C;  3V6D A;  1VSM A;  1X9J A;  3PO5 A;  3QIN A;  1C0G A;  4DTO A;  3THY A;  3LDL A;  2O8D B;  3HPO A;  4DS4 A;  1VRU A;  4FLX A;  3AA5 X;  1YF5 L;  4OVL A;  2Q97 A;  4CJ5 A;  1YJW N;  1KVA A;  3FZM A;  4FO0 A;  1DKG D;  4B9L A;  4A62 A;  3KK1 A;  4KHY A;  4WQ5 C;  4BVP A;  1REV A;  1E4F T;  4G9Z A;  2IVP A;  3HBT A;  4DR5 K;  1ZC6 A;  4KPY A;  2F4V K;  4BE2 A;  1X9W A;  3CCU N;  3AVF A;  2P9N A;  2FXU A;  5AQQ A;  3CJC A;  2B4J A;  4HTL A;  5C0Y A;  4YHH K;  3CC7 N;  4BRK A;  1BL3 A;  3TI0 A;  5ELZ A;  3OJU A;  4RW8 A;  3MMV A;  2CGL A;  3UIQ A;  2PY5 A;  1CZ9 A;  3G4S N;  2ZD1 A;  3SV3 A;  2OZM A;  3BF1 A;  2Q0R A;  3OYA A;  1M1K O;  3L3V A;  3LPT A;  2QEX N;  3V9W A;  4M3Z A;  3RMA A;  1HNW K;  1KVC A;  5I42 A;  3DWL A;  4RW7 A;  3OS0 A;  4E7I A;  4ID1 A;  3S3M A;  3VGK A;  4DFP A;  3MWT A;  3AGR A;  4CD3 A;  1EX4 A;  4CGH A;  3GL1 A;  3VQ9 A;  3AVA A;  2QWQ A;  2RHK A;  1XWL A;  5AQN A;  3FFI A;  4KHN A;  2QWM A;  3EO3 A;  4JS4 A;  1C1A A;  3CHW A;  5F0X A;  1MU2 A;  4CJL A;  1NK4 A;  3L2W A;  3J7A P;  2P9I A;  1X9S A;  3ZT4 A;  3CFR A;  3J8A A;  3MCA B;  3NVK A;  4EHT A;  2P1J A;  3ZX3 A;  4KAZ A;  2YNH A;  3VA0 A;  4FWK A;  2B6A A;  4WYB A;  3QEP A;  2KTQ A;  2D5R A;  1BDG A;  2E1Z A;  1IBK K;  4BGB A;  4IZ9 A;  5KPZ A;  3V9X A;  4DSJ A;  3CCM N;  3THY B;  3OYG A;  3JYT A;  4KHS A;  2HHT A;  2W41 A;  3ZX2 A;  3P31 A;  3JS6 A;  1H1V A;  3QNN A;  3BUZ B;  5BRE A;  4DR2 K;  1ZBF A;  1EKE A;  1X1P A;  5FRO A;  1YTU A;  2P9N B;  4U67 L;  2W40 A;  4O0I A;  3WQT A;  3HT3 A;  4CGJ A;  1J54 A;  1EO1 A;  2GWK A;  4DV7 K;  2CH6 A;  3K9K A;  1HKC A;  2W6K A;  3S3N A;  2X6N A;  1S6P A;  4E7J A;  3TAR A;  1ATS A;  3V1Q A;  4WF9 L;  1L3T A;  2LSN A;  1U2V A;  4CW7 B;  1HKB A;  2HBJ A;  1V4T A;  1ZBL A;  1NKE A;  2KKZ A;  4FZX C;  1S9G A;  4CHZ A;  4OKE A;  4AH9 A;  3TAE A;  4IJA A;  1YIT N;  3EYZ A;  1YI2 N;  4E1N A;  5M1P A;  4CJ4 A;  4I7F A;  5ADX A;  4JKB A;  3P83 D;  4CGG A;  4HUF A;  2QM1 A;  4DTU A;  3OA9 A;  4FJN A;  4FWM A;  1E3M A;  4EZ6 A;  3KD1 E;  1LWE A;  3L0Q A;  3NHG A;  1HNZ K;  4CZL A;  2EWS A;  1K8A O;  3QLH A;  3BDP A;  1JLE A;  1LAV A;  1CZA N;  1NJI O;  3LP0 A;  1U04 A;  3VOV A;  3B6P A;  3MXI A;  2P9I B;  3U9D A;  4XH5 A;  1JLG A;  5AQI A;  5AQT A;  3HXM A;  1OH5 A;  4KO0 A;  1JXB A;  3CQY A;  2VG7 A;  5J2Q A;  5I3U A;  4WE1 A;  1HJO A;  4NLB A;  5T7B A;  3CIP A;  3DI6 A;  3U3Y A;  4FJK A;  3ULE A;  4LF4 K;  2V7Y A;  2WBN A;  4IJN A;  4CFA A;  1I3A A;  2R7Y A;  4HHT A;  4DTX A;  4B3S K;  2YKM A;  5KQ8 A;  1KVB A;  1CZB A;  3J7Y P;  4DUY K;  4DQI A;  3K5O A;  2NZT A;  3BZK A;  3SV4 A;  4IOA L;  3QDK A;  4GVE A;  5TKY A;  3IMX A;  4DSL A;  3P39 A;  4YOR A;  4OPJ A;  3KLG A;  4AQY K;  3O5B A;  2G8F A;  2BAN A;  4E89 A;  1LV5 A;  4A5B A;  1ZYQ A;  1U2V B;  1RDC A;  1J9A A;  1X9M A;  4B1V A;  4BQL A;  4FJ9 A;  4CJU A;  1SKR A;  1TAQ A;  4B9V A;  4CHO A;  4W5Q A;  3DMJ A;  4Y1C A;  1Y64 A;  3NF7 A;  5AFU A;  5BN8 A;  4WQ5 A;  3VQD A;  1VQ5 N;  1S1W A;  2F8S A;  3ALY A;  2YX6 A;  3P1G A;  2NRZ A;  2Q3S A;  1TUU A;  3CCQ N;  1NGF A;  2AP1 A;  4ELV A;  2FLO A;  3MN6 A;  3QIP A;  3FZL A;  3CME N;  3TTF A;  4BQZ A;  2P9S B;  3ZSZ A;  5JIC A;  2G8U A;  2VQE K;  1RTH A;  4F9O A;  2XY8 A;  4JKG A;  1KAZ A;  1UA1 A;  4H4M A;  3K59 A;  1RTD A;  2RKI A;  3J7Z O;  3HM8 A;  1JCF A;  5SZT A;  3O3F A;  3I56 N;  3S3O A;  2ASM A;  4C8L A;  1ESV A;  3OHR A;  5HP1 A;  2ZJQ L;  3AO4 A;  4B1Y B;  4X64 K;  2CH5 A;  5AJ3 K;  3VQ6 A;  2E2N A;  1ATR A;  2P5G A;  4O4G A;  3THX A;  3LWM A;  5HRS A;  3AY9 A;  1E4G T;  4ELU A;  4M3Y A;  5AZJ A;  4CEZ A;  2A5X A;  2IVN A;  2P9L B;  2E2O A;  4BRD A;  3VMF B;  4E3S A;  4C8O A;  1BGX T;  5HRO A;  3ZSQ A;  2NRW A;  5LJV A;  1NOY A;  1NGE A;  4FJL A;  2FBV A;  2O8B A;  3C6T A;  1WAF A;  5EOY A;  3R6M A;  3ZSY A;  3IG1 A;  4E7L A;  3ATU A;  2V51 B;  5BR9 A;  4Z0U A;  5I9E B;  3H08 A;  3I8B A;  2E6L A;  1TK0 A;  2QK9 A;  1LWF A;  1RT6 A;  2DFF A;  2OZS A;  4N76 A;  1SL1 A;  1T6C A;  4FZZ A;  4ZTF A;  2BGG A;  3GBT A;  5HL7 L;  2YHA A;  4DG1 A;  2QI2 A;  1VQO N;  3WXJ A;  1YJ9 N;  3WNG A;  4WFA L;  4DTS A;  1LW0 A;  3K5M A;  5AQV A;  2HND A;  4KH4 A;  4BDZ A;  3KTQ A;  3MXM A;  5M1Q A;  3RVC A;  1ZBS A;  3PLA A;  3LPU A;  2E8A A;  4X65 K;  4O8K A;  5A2Q O;  1HJR A;  4JKG B;  3HRG A;  3D2E B;  4OJR A;  1HRH A;  3UE5 A;  1BI4 A;  1BG3 A;  4JK8 A;  1VQ6 N;  4B8C A;  1IBM K;  4FWL A;  4AHR A;  4CF1 A;  3ENO A;  3HJF A;  1VSI A;  3OTO K;  1OH8 A;  3ZET A;  4R5P A;  1J5O A;  3CPE A;  2FBT A;  3HI0 A;  3O3G A;  3O08 A;  4FZY A;  3THX B;  1XMO K;  3LM2 A;  5FRN A;  3W0L A;  5J2N A;  4KH6 A;  3J80 O;  3M8R A;  2D4W A;  4ISF A;  3PX6 A;  1HNX K;  4JI5 K;  5BR8 K;  3Q7B A;  1QQN A;  4DF4 A;  3O4W A;  5C10 A;  4IXC A;  2O8B B;  4A61 A;  4KB0 A;  3I55 N;  1XC3 A;  4ZHR A;  5D3G A;  2OAN A;  4MLH A;  1R0A A;  4CVN E;  4G1Q A;  2FBY A;  2G8W A;  1IKY A;  1BHL A;  3C0B A;  2KZM A;  2DY4 A;  3AVC A;  4AM7 A;  1QZ6 A;  4K8Z A;  3ZSX A;  3HK2 A;  1HYZ A;  5H1S Q;  3FLC O;  4JKD A;  4AHC A;  2HOE A;  3CM5 A;  4A57 A;  4GY2 B;  1JL2 A;  4CZI A;  1BUP A;  1UWB A;  3DXM A;  2VQF K;  1KTQ A;  3DAW A;  4JKF A;  3O8M A;  1U49 A;  3M8Q A;  3NMU A;  4CK1 A;  3VF6 A;  3AO1 A;  2NRV A;  2HHV A;  4L8R B;  1YVU A;  3KKR A;  1N33 K;  2EHG A;  4DSI A;  3D2F A;  1GOC A;  3HL8 A;  1BI4 B;  1T7P A;  4NCB A;  1QQM A;  4FYD A;  2XY6 A;  5AQH A;  3ZET B;  1RT2 A;  4C8K A;  3KWG A;  3WXI A;  1KXP A;  3T69 A;  3CJ9 A;  3VQ4 A;  3HM9 A;  2P9P A;  1U48 A;  1QSS A;  4F8R A;  1S1V A;  3T1H K;  2ATQ A;  1O13 A;  3SQ0 A;  5JS1 A;  3VEW A;  4JNE A;  1EQY A;  3BEX A;  3LAK A;  4DWI A;  1TKD A;  5CR4 A;  3FFK B;  1ITG A;  5C15 A;  3UB5 A;  5AQK A;  3LWL A;  3DM2 A;  2YHY A;  2A1R A;  3TSQ A;  3NF6 A;  2O8F A;  3KK2 A;  3F9K A;  4QS8 A;  4XIU A;  3ZYY X;  1ZBI A;  2YJE A;  5AQL A;  1GLB G;  4GKK K;  3BY5 A;  3CCE N;  3OYF A;  4FWN A;  3DLH A;  3F2K A;  4FJJ A;  3U6F A;  4YOX A;  1NGH A;  3KK3 A;  1C0U A;  2QXF A;  1KLN A;  3TAQ A;  3ZSO A;  1RDB A;  4JAX A;  2ZJR L;  4DLE A;  5GAG P;  3P38 A;  3J81 O;  4DTM A;  5J2M A;  5FPN A;  3VEX A;  1D9D A;  1C0M A;  3CQ8 A;  4W5R A;  1C1B A;  4DLG A;  2PYJ A;  4PWD A;  4CZE A;  3HO1 A;  3WEE A;  4IOC L;  1G99 A;  4M7X A;  3HST B;  3NCI A;  1TL3 A;  1UAX A;  3FZF A;  3U9Z A;  3SAG A;  3OYN A;  5EXW A;  3LZJ A;  4BAC A;  4O5B A;  1CXQ A;  3E01 A;  3QFP A;  4Y0W A;  2HW3 A;  1VK0 A;  4YY3 K;  4OKJ A;  3UKU B;  2HBK A;  3C7N B;  4DTR A;  4BY9 C;  2VWB A;  3LZI A;  5HRR A;  1IJJ A;  3DOL A;  3AO2 A;  2RPI A;  4BGA A;  2P9P B;  3ULD A;  3LAM A;  4DTJ A;  2W6L A;  4H0O A;  5IT9 O;  1OVQ A;  3KLE A;  3RSE A;  2GX9 A;  4MDA A;  2GV9 A;  4KTZ A;  1ILY A;  4IEI A;  2UUC K;  3TAM A;  1HNI A;  4JRP A;  1X3M A;  4DR7 K;  5DK5 A;  1BCM A;  3VEZ A;  3SZ2 A;  1JJ2 M;  2O8F B;  3C65 A;  1NKC A;  1N8R O;  3CCL N;  4NCG A;  5MLC Q;  4K25 A;  3OVN A;  3TWH A;  3CCR N;  1Y97 A;  3L4Q A;  4B9N A;  1WSI A;  4Z4H A;  4IDH A;  2Z1J A;  3D45 A;  2E20 A;  3CC4 N;  5AQR A;  2VG6 A;  2ETJ A;  4DQ8 A;  4FK4 A;  1BQN A;  3WNE A;  3SLC A;  1JXE A;  3KZB A;  1NM1 A;  1HX1 A;  4CFD A;  1ATN A;  1TV6 A;  3AV9 A;  3OYM A;  4Z4E A;  3VEN A;  4IO8 A;  3O9T A;  3WEE B;  1JCE A;  3CQX A;  4FVM A;  4KRF A;  3SUO A;  2HBM A;  5BRH A;  1RT1 A;  4K43 A;  1N32 K;  3ENH A;  2VG5 A;  1NNE A;  3L6Q A;  1ZBU A;  4QS9 A;  2KHO A;  4A5A A;  4OLB A;  1LAW A;  2E5L K;  4B9T A;  3FR0 A;  4R79 A;  2A3Z A;  1IG9 A;  4FK0 A;  4KHP K;  1IKV A;  2ZQB A;  1XNQ K;  3MDQ A;  1XQS C;  1XC9 A;  1WOQ A;  2A1S A;  3OYE A;  4CCH A;  3O1B A;  3RRH A;  3SBT A;  4PA1 A;  3VN5 A;  3EE9 A;  4FCY A;  2IGI A;  5HRP A;  3MN7 A;  1X3N A;  5JVH L;  4KI4 A;  1TKT A;  3LDN A;  3M1F A;  3S9H A;  1UOC A;  2OPQ A;  3R1X A;  1U47 A;  5E84 A;  3E9L A;  1GLF O;  3NDK A;  4JI0 K;  1GLL O;  1RDA A;  3QBX A;  3RR8 A;  1F21 A;  2QKB A;  3DRS A;  2OPS A;  2IDO A;  4QAG A;  5CYM A;  1W2B M;  3B6O A;  2XO7 A;  4FWO A;  4H03 B;  3AVL A;  3B8A X;  3SMP A;  5BPN A;  4CBU A;  2NRH A;  2HHQ A;  4DQS A;  4Z4C A;  2XRI A;  1TKZ A;  2YKN A;  2YNI A;  3G25 A;  2YJF A;  5KI6 A;  3ZEU A;  4JI4 K;  5JVG L;  1NGD A;  4C23 A;  4EZ9 A;  1DGK N;  3IFR A;  4I6M A;  3ZSV A;  4IDK A;  1Q7Y O;  4IFV A;  3VQQ A;  4B3R K;  4O0J A;  4XEI A;  3TR8 A;  4BRO A;  3L2Q A;  1LOT B;  1TK5 A;  4KB1 A;  5KTQ A;  1QVG M;  3JSM A;  3ZT2 A;  4IKF A;  3D7E O;  3DXK A;  4CBW A;  4DQR A;  4JLH A;  1NMD A;  3U4L A;  1IH7 A;  4NO7 A;  3VER A;  3NAE A;  4QCL A;  3M8P A;  3DOK A;  5AQX A;  3AAP A;  3PX0 A;  2QXL A;  2H3G X;  3SQ2 A;  3VEV A;  2P5O A;  5AQG A;  1YAG A;  1NJY A;  5CHI A;  2GUP A;  1NK9 A;  4BR2 A;  3WUH A;  1JLA A;  4OPK A;  3QNO A;  4M3W A;  3V81 A;  4CF8 A;  3OYD A;  4BC3 A;  3DJC A;  3OBY A;  4EFH A;  4BG8 A;  2I7P A;  4CHP A;  1UA0 A;  3C6U A;  4GMJ B;  1LCU A;  4CJV A;  1LW2 A;  4F2S A;  4OX9 K;  1SAZ A;  2VWK A;  1GLE G;  1JCG A;  3D0P A;  4JK7 A;  3MEE A;  1NWK A;  2QWR A;  3QET A;  4TSX A;  2PBD A;  4CJS A;  2ITM A;  4GVM A;  4LFC K;  1C1C A;  2X6S A;  3AVG A;  5AQY A;  1TYQ A;  1S1X A;  4DV6 K;  4CJP A;  3N4Q A;  1QVF M;  4B3T K;  3DLG A;  3ZEU B;  1ASW A;  3TTD A;  2HHW A;  3FZH A;  2O4I A;  4BDY A;  2Z1H A;  1NGA A;  3AO3 A;  3K0S A;  3QEV A;  4I6M B;  2ASO A;  5AQP A;  1RDW X;  3AVH A;  3NH1 A;  4DV2 K;  3RMD A;  4HTU A;  3I8D A;  1GLA G;  1IBL K;  5AQO A;  1B9D A;  4FOE A;  5BPM A;  3QEW A;  3P5J A;  1ZXO A;  1GOA A;  3N4P A;  4H5T A;  4M45 A;  2Y1J A;  4H5V A;  4LFB K;  3T1A A;  4FVU A;  5DM6 L;  1RT3 A;  4IG3 A;  3CCV N;  3G6E N;  4YOV A;  1T05 A;  1S5J A;  3AVB A;  4OO1 J;  1FKO A;  3WNH A;  4LH4 A;  3JXU A;  4ILH A;  4F3O A;  1VHX A;  4CJK A;  3C95 A;  2GUI A;  4FL9 A;  3TTC A;  5AQU A;  3LAL A;  3MED A;  4FM1 A;  3TSU A;  4BRH A;  1IKX A;  4DR6 K;  3OYJ A;  3AO5 A;  3I33 A;  3NE6 A;  3T3F A;  3SUP A;  2D0O A;  3OYI A;  2O8E A;  5AQS A;  1DTT A;  4EP5 A;  2JWL A;  3WXM B;  4YOU A;  2OPR A;  2UXC K;  1SL0 A;  3CXC M;  4N5S A;  4LH5 A;  4E1M A;  1VSF A;  3CMA N;  3A8Y A;  4M42 A;  1K8K A;  4BC5 A;  1QZ5 A;  1MDU B;  3ENB A;  4HVJ A;  4EHU A;  1RBS A;  4IO9 L;  5AR0 A;  4DCH A;  4BR4 A;  4CER A;  4DUZ K;  4JI6 K;  4YOT A;  3NH0 A;  3U8X A;  3ULE B;  3ID6 A;  4KFB A;  2HBL A;  4LF7 K;  3SUQ A;  3MEG A;  5GIP A;  5IWA K;  3LL3 A;  3MN9 A;  4DTP A;  2RF2 A;  3VQE A;  4O44 A;  3MN5 A;  3QB0 A;  5B8H A;  3TAN A;  3E9O A;  5F2R A;  4DS5 A;  4CES A;  5JS2 A;  4JI3 K;  2Q31 A;  4XH1 A;  2KFN A;  4DR3 K;  2IIR A;  1SS6 A;  4DV3 K;  4AHT A;  2CGJ A;  4KTW A;  3DLL L;  1NGJ A;  3ZSR A;  5C24 A;  1VQ7 N;  4M3U A;  3TU5 A;  2P9K A;  4LF6 K;  4FLU A;  4DSF A;  4ILJ A;  1WBD A;  4WFN L;  3DLR A;  4LSN A;  4FPB A;  1NK7 A;  4FLV A;  4BDP A;  3CFP A;  3PUF A;  2ZWH A;  3BF3 A;  1HQE A;  5JLF A;  3L8B A;  4O5F A;  4E0D A;  2YI1 A;  1QE1 A;  1JLQ A;  1YJN N;  4LF9 K;  3O4N A;  4OPA A;  4DFJ A;  3SYZ A;  4FJH A;  4AHU A;  4BRA A;  3H1V X;  4HCC A;  1VQL N;  2E1Y A;  3GG4 A;  3VGL A;  4DFM A;  4E1J A;  2V7Z A;  3A5N C;  5TKW A;  3HYF A;  3K9J A;  4CEO A;  1FW6 A;  2KZZ A;  4OKK A;  1KRP A;  2FC0 A;  3M5R A;  3F9M A;  1VSE A;  4Y1D A;  1DTQ A;  4H5W A;  4O55 A;  1N5Y A;  1NG9 A;  4CZG A;  3KK7 A;  4DHY A;  1NLV A;  2O4G A;  2E2Q A;  4JKA A;  5AZJ B;  4FM0 A;  3NFA A;  4J2A A;  4NYN A;  3PV8 A;  2KQ2 A;  3CJA A;  3DRR A;  3AAQ A;  4B3O A;  4F3T A;  4KRE A;  1IKW A;  1RBT A;  3VTH A;  3PIP L;  4NB4 A;  3SAH A;  2WC9 A;  3R8E A;  2QWO A;  1W0H A;  3VES A;  3H3N O;  5KGW A;  4BR9 A;  4BRE A;  1NBW A;  4YNQ A;  4YOY A;  4Z94 A;  4RW9 A;  3IKM A;  1NMN A;  3MK6 A;  3LP1 A;  2IS3 A;  3IAY A;  1TL1 A;  5BPL A;  2P9K B;  4BRQ A;  1SV5 A;  2A42 A;  1HPZ A;  4FSV A;  3MWP A;  1I94 K;  1Q9X A;  1EWQ A;  3CJ7 A;  4BRG A;  3ITH A;  3FGU A;  2IC3 A;  3RMC A;  5SWM A;  1S72 N;  3SUN A;  5KPT A;  3VET A;  3KWI A;  4HCB A;  5J2P A;  4H4O A;  4BE0 A;  2VCP A;  4N47 A;  5KRS A;  1VQ8 N;  1K73 O;  4I2Q A;  1HLU A;  3S41 A;  4KI6 A;  1YIJ N;  2F9T A;  4FLW A;  4BRP A;  2GBZ A;  2W42 A;  1VQM N;  2G8H A;  3IRX A;  3TSP A;  4DV5 K;  1RBU A;  1Z26 A;  1YT3 A;  4H5N A;  1IV0 A;  3ID8 A;  3TAG A;  2QWL A;  3C94 A;  3CI5 A;  3MXJ A;  4PHT X;  4DV4 K;  3KD5 E;  3RR7 A;  4CEA A;  3V9U A;  2P9U A;  3H46 O;  3ATV A;  3ASM A;  2HHX A;  4EIA A;  1RBR A;  1RT5 A;  3GOI A;  4CGF A;  1TGO A;  2V52 B;  3QML A;  4OGC A;  4DR4 K;  1L5U A;  4M3T A;  3AGK A;  3GDQ A;  4A2B A;  3PO4 A;  4N41 A;  4CK3 A;  4J8F A;  1T3V A;  5ADX H;  5E41 A;  3AAR A;  1MWM A;  1S1T A;  3VEO A;  3OBW A;  3L2U A;  4DV0 K;  4ICL A;  3MCP A;  3KLH A;  3L2R A;  4NXM K;  1XNR K;  1MA9 B;  3VQ8 A;  1NK8 A;  3THV A;  1QTM A;  3NGY A;  5KRT A;  2Z1I A;  3OYL A;  1W9H A;  5HLF A;  3OJS A;  1DLO A;  5CY4 A;  1VQK N;  3VQC A;  4CFC A;  3L3U A;  1NK6 A;  1VSL A;  2NNW A;  2Q36 A;  1EXQ A;  3FE1 A;  3T1Y K;  4BRN A;  4HWI A;  4BWJ A;  2OA8 A;  1HMV A;  1J53 A;  4RW4 A;  2YNG A;  2P51 A;  2RN2 A;  1GLC G;  5KPR A;  3DXM B;  5FDL A;  1SQK A;  1KAY A;  1XMQ K;  2OYQ A;  4GV9 A;  5LMU K;  3V9S A;  3NH2 A;  3SBG A;  1T6D A;  5EVZ A;  1Q81 O;  4EP4 A;  4CEF A;  2GEM A;  4Z4F A;  1WSJ A;  3HTV A;  3I0R A;  1W7A A;  4CD1 A;  5K14 A;  5EX5 A;  3L2V A;  1D5A A;  3D2F B;  4B9S A;  1BIS A;  1BIZ A;  1RT7 A;  2VWJ A;  4JS5 A;  3VQ7 A;  1N36 K;  3H6E A;  2PFU A;  1P90 A;  1Q18 A;  1W97 L;  5C25 A;  1DT9 A;  1U4B A;  2HST A;  2AA4 A;  4JHD A;  4JI7 K;  3SJH A;  3DLK A;  2G8K A;  3LP2 A;  4FLT A;  1Z6R A;  2JWK A;  3CER A;  3KJV A;  1VSD A;  1KD1 O;  4CHQ A;  5AFU H;  1VSH A;  3PIO L;  2HNZ A;  4HUG A;  2D0P A;  1QHT A;  4PQU A;  4CJE A;  3CD6 N;  4MO5 A;  2G8V A;  2ZGY A;  4BC4 A;  1WSF A;  3O4Q A;  4FLY A;  3SPZ A;  4CIG A;  4IFY A;  4K0K K;  3MX5 A;  1NGB A;  3EN9 A;  3WXK A;  4BR0 A;  4FJM A;  4YFU A;  1S1U A;  4O8U A;  4N56 A;  1YXQ A;  3H45 C;  1YVN A;  4BR7 A;  3SI6 A;  2BDP A;  3O9U A;  3QO9 A;  4IFE A;  4CJF A;  3M6G A;  3TAF A;  3HP6 A;  2QTD A;  3O9R A;  4BE1 A;  5FPM A;  3QFU A;  1KCF A;  2HMP A;  4W5O A;  3QER A;  3C6H A;  3V4I A;  1IO2 A;  4FWR A;  4H0Y B;  1BA0 A;  3AVJ A;  2VGM A;  1NK0 A;  2ITG A;  4M41 A;  4CGD A;  1IG8 A;  3K57 A;  1EET A;  1BWF O;  2RE2 A;  4PKG A;  4Q5V A;  4CEQ A;  3NGZ A;  3SJJ A;  1WUA A;  3EE8 A;  4FWP A;  5AZI A;  2PYL A;  3SQ1 A;  5J1E A;  3QIC A;  4CBX A;  4LSL A;  1D9F A;  1VAZ A;  4I2P A;  4CZH A;  4JRQ A;  5GIO A;  1SKW A;  2ZJP L;  1NOZ A;  4L3Q A;  4M7Y A;  1T8E A;  4CF9 A;  3UKR A;  1KSP A;  2NLX A;  1WB9 A;  1NJX A;  3SK3 A;  1RGI A;  4FJ5 A;  2WON A;  1TUY A;  4JHD B;  2F7T A;  4OPH A;  2BE2 A;  1RT4 A;  4OGE A;  4CI6 A;  4DU4 A;  4WCE L;  3GE1 A;  4LC9 B;  4JI8 K;  2GTD A;  3IS9 A;  3RSE B;  3CC2 N;  4CJR A;  1YTA A;  4B8A B;  1XI1 A;  4CE9 A;  4H5R A;  2XY7 A;  1Q82 O;  3O80 A;  4CIF A;  3CJ1 A;  3PSF A;  3DRP A;  4M3R A;  3R9P A;  1QQC A;  4DKW A;  4B1Z A;  1I39 A;  5GAD P;  2UUA K;  3WT0 A;  3V1O A;  5C2D A;  3CET A;  4JEP A;  4BRM A;  3BGR A;  2HHH K;  1NJZ A;  3OS2 A;  2E88 A;  1K9M O;  3HSC A;  4FM2 A;  3DLE A;  1QSY A;  2OTJ N;  4H0X B;  2UXB K;  3WNF A;  1DEJ A;  4FJX A;  1P8Z A;  1KQS M;  1FK9 A;  4I9L A;  4K41 A;  3U3G A;  4A2A A;  4W5N A;  2UYT A;  2EX3 A;  5EY4 A;  3T7Z A;  1T03 A;  2HHS A;  3AA2 A;  1GLD G;  4F2R A;  3HVR A;  5FRM A;  2UXD K;  1JLC A;  3T19 A;  1S22 A;  5DMR A;  3THW A;  4CJQ A;  1VRT A;  4DQQ A;  3EZW A;  4AF1 A;  1V4S A;  5AZI B;  1B92 A;  5CZ2 A;  1Q9Y A;  3R3L A;  1WN7 A;  1SKS A;  4FJG A;  1NGI A;  4GV6 A;  4RG8 A;  2IVO A;  4ID5 A;  2O8C A;  1LWC A;  3WXL A;  4YOW A;  3MX2 A;  1QS4 A;  5M1K A;  4FW2 A;  4ILG B;  3UKR B;  4AHS A;  4UQG A;  1GLJ O;  2D1K A;  4CF0 A;  1TK8 A;  4LF5 K;  5HOO A;  4JN4 A;  4RCH A;  2DTU A;  1Z25 A;  4Z4G A;  1QHA A;  1EWR A;  3Q7C A;  4FW1 A;  3K58 A;  2WFB A;  1XHX A;  1HKG A;  2HHU A;  2IOC A;  3HOT A;  3VF2 A;  3O3H A;  4CGI A;  1T44 A;  4NLC A;  4FXD A;  1OVY A;  3AA3 A;  3I0S A;  4K42 A;  1WSE A;  4DB3 A;  2E4L A;  2ZGZ A;  1XHZ A;  1NKB A;  5M1N A;  1VQ4 N;  2Z1G A;  1D4X A;  4H0P A;  3QEI A;  5GAH P;  1EP4 A;  3ZT3 A;  5CE3 A;  4BRI A;  2P9S A;  1GOB A;  4H8K A;  4B08 A;  3LDP A;  3SNN A;  4FWQ A;  3LDS A;  5C12 A;  4GKJ K;  2ZE2 A;  1BQM A;  1XUP O;  2HB5 A;  4J2E A;  1RDD A;  2X74 A;  1KC8 O;  4IOX A;  2NRX A;  3THW B;  4JD2 A;  3TPQ A;  1NJW A;  2YHX A;  2YHW A;  3FZK A;  4F4K A;  1NGC A;  2Q2R A;  3DXK B;  4DU3 A;  4KHQ A;  4DR1 K;  1OH6 A;  3VTI A;  1BO5 O;  2GEL A;  4KV8 A;  2O8C B;  2P9L A;  3ZSW A;  4E7K A;  3NBP A;  2FF6 A;  4FWS A;  4H0V B;  3SPY A;  1HPM A;  3IUC A;  2QWP A;  3CG7 A;  2A41 A;  1N6Q A;  1CLQ A;  3LP3 A;  5FLX O;  4IEE A;  3K5L A;  3A0I X;  5AQW A;  4DU1 A;  3ZT0 A;  3EEQ A;  1VQN N;  3MEC A;  5AQZ A;  1FXX A;  4IG0 A;  4MQ3 A;  4NYF A;  3OS1 A;  3ISN C;  3CFO A;  1J6Z A;  1JKH A;  1BU6 O;  2JGU A;  2JLE A;  3NF9 A;  1S6Q A;  2BUP A;  4DTN A;  1KFD A;  1ASU A;  4WQ4 C;  1YUW A;  4DFK A;  1A5X A;  4FLZ A;  4CEE A;  4H0T B;  1L3S A;  3H1Q A;  3QEX A;  1TYQ B;  2PAV A;  3F5T A;  5C2F A;  2X78 A;  1QQO A;  2FSN A;  3JAM O;  4DSE A;  2XHB A;  3D2E A;  1G15 A;  5CZ1 A;  4CJ7 A;  1R59 O;  2HF4 A;  3ZCM A;  4NXN K;  1Q86 O;  4JK9 A;  4CED A;  4CHN A;  3OY9 A;  3RWU A;  4CIE A;  2Q1N A;  1L3U A;  5KGX A;  3G0Z A;  1U6Z A;  5LMN K;  4JD2 B;  4Q0B A;  4PL7 A;  4MLE A;  2KW4 A;  2YCH A;  4JKE A;  3G71 N;  4XH4 A;  1WBB A;  1NGG A;  3M3Z A;  3OYH A;  1VQ9 N;  3E9P A;  1WSG A;  2DFE A;  3SQ4 A;  1NK5 A;  2BH1 A;  3O6W A;  1BA1 A;  4JV5 K;  3CPW M;  2OPP A;  4BVO A;  3W3D A;  5C42 A;  3AVK A;  3CJB A;  1JLB A;  3OYK A;  5GAE P;  4CEC A;  4BR5 A;  2VGN A;  4B9U A;  4B1U B;  3E1Y A;  3PSI A;  3SCX A;  4KHU A;  1BCO A;  5M1F A;  3CCJ N;  5GIN A;  2OTL N;  3RRG A;  3A5O C;  4CZK A;  2FF3 B;  2YHB A;  3AVN A;  3K5N A;  4CZM A;  4ISG A;  4B1X B;  4M3X A;  2HMI A;  3ZLJ A;  4C8M A;  2O8E B;  4PKH A;  3A2F A;  3RTV A;  4DMN A;  2Y1I A;  3VA3 A;  3HOS A;  4PKI A;  4FJ8 A;  4YDU C;  1HYS A;  4CF2 A;  4UY8 O;  5F1X A;  4KHW A;  2CGK A;  2HNY A;  1KLM A;  1VSJ A;  3VGM A;  4CZJ A;  1VQP N;  4C8N A;  4DSK A;  1K8K B;  3A5M C;  2A6A A;  3HP9 A;  4CHY A;  1RCH A;  1YHQ N;  4IWV A;  3O1W A;  2F96 A;  1TVR A;  3WQU A;  1U45 A;  4ZTJ A;  1BIU A;  2AJQ A;  3EL2 A;  5JLH A;  4LY7 A;  5CYQ A;  3A5L C;  2F9W A;  3HZ6 A;  4W5T A;  4B9Q A;  1C0T A;  3LM9 A;  1WNS A;  3OYC A;  4DQP A;  3AVM A;  1RDU A;  2I5J A;  1KFS A;  1D8Y A; 
#chains in the Genus database with same CATH homology
 3DMJ A;  1RT7 A;  2VWJ A;  4Y1C A;  5CYM A;  4CJT A;  4HUE A;  3NF7 A;  1RTI A;  1VSK A;  2YV0 X;  4JS5 A;  3B6O A;  2XO7 A;  3VQ7 A;  4Z4I A;  3AVL A;  3VQD A;  1S1W A;  5C25 A;  2F8S A;  1U4B A;  3ALY A;  2HHQ A;  1RTJ A;  3P1G A;  4RW6 A;  4Z4C A;  2XRI A;  1TKZ A;  2YKN A;  2YNI A;  5KI6 A;  4DQS A;  3PX4 A;  1SL2 A;  2KFZ A;  2Q3S A;  4OLA A;  4EZ9 A;  4ELV A;  3DLK A;  2G8K A;  3OYB A;  3LP2 A;  3QIP A;  3ZSV A;  4FLT A;  4IDK A;  3KJV A;  1VSD A;  4IFV A;  3ZSZ A;  3VQQ A;  2G8U A;  1TKX A;  4O0J A;  4CHQ A;  1RTH A;  1VSH A;  1O1W A;  2HNZ A;  4HUG A;  2XY8 A;  3RMB A;  3TR8 A;  3L2Q A;  3TAB A;  1QHT A;  1UA1 A;  4PQU A;  1TK5 A;  4CJE A;  4H4M A;  5KTQ A;  3K59 A;  2RKI A;  4MFB A;  1RTD A;  5HRN A;  4KB1 A;  5SZT A;  1RIL A;  3JSM A;  3ZT2 A;  1RNH A;  3O3F A;  3S3O A;  4IKF A;  2G8V A;  3AA4 A;  1HNV A;  4NCA A;  5EU7 A;  4DQR A;  4C8L A;  1WSF A;  3O4Q A;  3CM6 A;  4JLH A;  4IBN A;  4FLY A;  3SPZ A;  4CIG A;  1IH7 A;  4IFY A;  5HP1 A;  3NAE A;  4QCL A;  3M8P A;  3AO4 A;  3DOK A;  4FJM A;  1C6V A;  3PX0 A;  4YFU A;  1S1U A;  3VQ6 A;  4N56 A;  3SQ2 A;  1TAU A;  2P5O A;  3SI6 A;  3DLB A;  1NJY A;  2BDP A;  1NK9 A;  2P5G A;  3QO9 A;  4O4G A;  2QKK A;  3LWM A;  4CJF A;  5HRS A;  4ELU A;  4M3Y A;  4QOZ B;  2B5J A;  3TAF A;  4CEZ A;  3HP6 A;  1D8Y A;  4BE1 A;  4K8X A;  1JLA A;  2YNF A;  1KCF A;  4OPK A;  4W5O A;  4FJI A;  3QER A;  4E3S A;  3QNO A;  4C8O A;  4M3W A;  3V4I A;  3V81 A;  3TAP A;  1IO2 A;  1BGX T;  3NF8 A;  3VQP A;  4CF8 A;  3OYD A;  5HRO A;  3ZT1 A;  3ZSQ A;  3AVJ A;  1NOY A;  4CHO A;  1NK0 A;  4FJL A;  4PY5 A;  4CHP A;  1SUQ A;  3C6U A;  1UA0 A;  4GMJ B;  2FBV A;  2ITG A;  4M41 A;  3PY8 A;  4CJV A;  1HYV A;  1LW2 A;  4F2S A;  3C6T A;  4CGD A;  3K57 A;  1EET A;  1WAF A;  4PUO A;  2F8T A;  3F73 A;  4Q5V A;  2VWK A;  4CEQ A;  3NGZ A;  3ZSY A;  3SJJ A;  3IG1 A;  3D0P A;  4CJW A;  3MEE A;  4LD0 A;  4E7L A;  2PYL A;  3SQ1 A;  5J1E A;  3V9Z A;  4AHV A;  3QET A;  3QIO A;  4FJ7 A;  3DYA A;  4LSL A;  4TSX A;  3VQA A;  4E19 A;  3CYM A;  4Z0U A;  4CJS A;  2XY5 A;  1D9F A;  1K6Y A;  3H08 A;  4GVM A;  2E6L A;  3KKS A;  4CFB A;  1LWF A;  1RT6 A;  2DFF A;  4I2P A;  4JRQ A;  1TK0 A;  2OZS A;  1SKW A;  4N76 A;  1SL1 A;  1C1C A;  1NOZ A;  2X6S A;  3AVG A;  4ZTF A;  1T8E A;  4FZZ A;  4CF9 A;  2BGG A;  2G8I A;  1KSP A;  2NUB A;  1S1X A;  4CJP A;  2YHA A;  3EY1 A;  1NJX A;  4J2D A;  4E7H A;  4FJ5 A;  2WON A;  3DLG A;  4DG1 A;  3MAQ A;  2BE2 A;  1ASW A;  1RT4 A;  4OGE A;  4DF8 A;  2HHW A;  4DU4 A;  4CEB A;  3WNG A;  4CJ3 A;  1WSH A;  4BDY A;  2O4I A;  2Z1H A;  3AO3 A;  3LAN A;  4DTS A;  1LW0 A;  3K5M A;  3V1R A;  3KLF A;  3QEV A;  2HND A;  4BDZ A;  3AVH A;  3NH1 A;  3RMD A;  4FK2 A;  3QES A;  3KTQ A;  3MXM A;  3IS9 A;  1B9F A;  4HTU A;  3I8D A;  4CJR A;  3LPU A;  1YTA A;  1A5V A;  2D0B A;  4B8A B;  1B9D A;  1HJR A;  1JLF A;  1XI1 A;  1RBV A;  4OJR A;  4CE9 A;  3QEW A;  1HRH A;  3P5J A;  2HVH A;  2XY7 A;  3HPG A;  1BI4 A;  3HPH A;  1GOA A;  4M45 A;  4B8C A;  3NGI A;  2Y1J A;  4J2B A;  4AHR A;  4CF1 A;  3HVT A;  4CIF A;  3T1A A;  3HJF A;  3DRP A;  1RT3 A;  1WAJ A;  1VSI A;  4M3R A;  3KIO A;  1A5W A;  1QQC A;  4IG3 A;  1ZBH A;  4R5P A;  1T05 A;  1J5O A;  1S5J A;  3AVB A;  1ASV A;  1I39 A;  1FKO A;  2DFH A;  3WNH A;  4ELT A;  3V1O A;  2HVI A;  2WOM A;  4LH4 A;  2FBT A;  3O3G A;  3BGR A;  1NJZ A;  3OS2 A;  3VQB A;  4GW6 A;  4F3O A;  4FZY A;  4CJK A;  3EZ5 A;  4FM2 A;  3DLE A;  1QSY A;  3C95 A;  2GUI A;  1HQU A;  4B9M A;  2E6M A;  3LAL A;  3WNF A;  5FRN A;  3MED A;  4FM1 A;  4FJX A;  5J2N A;  2IAJ A;  1FK9 A;  4I9L A;  3U3G A;  3M8R A;  3PX6 A;  4W5N A;  2EX3 A;  4KKO A;  1IKX A;  3G10 A;  1T03 A;  2HHS A;  1FKP A;  3AA2 A;  4F2R A;  4DF4 A;  3OYJ A;  3HVR A;  2D0A A;  3AO5 A;  5FRM A;  3NE6 A;  1JLC A;  1CXU A;  3T3F A;  3SUP A;  2FBX A;  4KTQ A;  3OYI A;  3T19 A;  4KB0 A;  1DTT A;  4EP5 A;  4ZHR A;  5D3G A;  5DMR A;  4BWM A;  4CJQ A;  1VRT A;  2OPR A;  1R0A A;  2D0C A;  4DQQ A;  1SL0 A;  3K2P A;  4G1Q A;  4N5S A;  2FBY A;  4LH5 A;  1L3V A;  4E1M A;  1IKY A;  1B92 A;  1VSF A;  1BHL A;  3M8S A;  1Q8I A;  5CZ2 A;  2KZM A;  2DY4 A;  3AVC A;  1JL1 A;  1Q9Y A;  1WN7 A;  1SKS A;  4FJG A;  4M3U A;  4K8Z A;  3ZSX A;  4RG8 A;  1HYZ A;  1WLJ A;  4ID5 A;  4M42 A;  3HK2 A;  1LWC A;  4CK2 A;  1QS4 A;  4HVJ A;  1RBS A;  4FW2 A;  3KLI A;  4AHS A;  4UQG A;  4AHC A;  3VQ5 A;  4CER A;  4CF0 A;  3CM5 A;  1S9E A;  1TK8 A;  1JL2 A;  3NH0 A;  2PZS A;  4KFB A;  1QSL A;  1UWB A;  2DTU A;  1KTQ A;  3SUQ A;  1Z25 A;  3MEG A;  1U49 A;  3M8Q A;  3AVI A;  4Z4G A;  4CK1 A;  3AO1 A;  4FW1 A;  3K58 A;  4L8R B;  2HHV A;  1YVU A;  4DTP A;  2RF2 A;  3KKR A;  4I9Q A;  3VQE A;  1XHX A;  2HHU A;  4O44 A;  2EHG A;  3TAN A;  5HBM A;  4DS5 A;  2IOC A;  4CES A;  4DSI A;  4AIL C;  1GOC A;  3O3H A;  4CGI A;  5JS2 A;  3V6D A;  1VSM A;  3HL8 A;  1BI4 B;  1T7P A;  3PO5 A;  3QIN A;  4NCB A;  2KFN A;  4DTO A;  4FYD A;  4FXD A;  3I0S A;  3AA3 A;  2XY6 A;  1WSE A;  4AHT A;  2G8W A;  3HPO A;  4KTW A;  4DS4 A;  3ZSR A;  1VRU A;  5C24 A;  3AA5 X;  2E4L A;  4OVL A;  4FLX A;  1XHZ A;  1NKB A;  4CJ5 A;  1RT2 A;  1KVA A;  2Z1G A;  4B9L A;  3KK1 A;  4FLU A;  4C8K A;  4KHY A;  1REV A;  4DSF A;  3QEI A;  3DLR A;  1EP4 A;  4LSN A;  3VQ4 A;  3HM9 A;  4KPY A;  4BE2 A;  1NK7 A;  4FLV A;  1X9W A;  3AVF A;  3ZT3 A;  1U48 A;  4BDP A;  1QSS A;  4F8R A;  1S1V A;  3CFP A;  2B4J A;  1GOB A;  3PUF A;  2ATQ A;  1HQE A;  4H8K A;  3L8B A;  4E0D A;  3SQ0 A;  4B08 A;  5JS1 A;  1QE1 A;  3SNN A;  3LDS A;  1BL3 A;  3LAK A;  3TI0 A;  2ZE2 A;  4DWI A;  3OJU A;  1BQM A;  1JLQ A;  1TKD A;  4RW8 A;  1ITG A;  3O4N A;  2HB5 A;  3UIQ A;  4DFJ A;  2PY5 A;  4J2E A;  1CZ9 A;  2ZD1 A;  3SV3 A;  3SYZ A;  4FJH A;  2OZM A;  1RDD A;  4AHU A;  3OYA A;  2X74 A;  3L3V A;  3DM2 A;  3LWL A;  2A1R A;  3LPT A;  4HCC A;  3NF6 A;  3V9W A;  3KK2 A;  4M3Z A;  3F9K A;  3RMA A;  4XIU A;  1ZBI A;  4DFM A;  1KVC A;  5I42 A;  4RW7 A;  1NJW A;  3OS0 A;  4E7I A;  4F4K A;  3HYF A;  4ID1 A;  4CEO A;  3OYF A;  3S3M A;  3DLH A;  4DFP A;  2KZZ A;  4OKK A;  4DU3 A;  2FC0 A;  1KRP A;  3U6F A;  4FJJ A;  1EX4 A;  4CGH A;  4KHQ A;  3VQ9 A;  3AVA A;  3KK3 A;  1C0U A;  2QXF A;  1KLN A;  3TAQ A;  1VSE A;  1RDB A;  1DTQ A;  4KV8 A;  4O55 A;  1XWL A;  4Y1D A;  3ZSO A;  1N5Y A;  4DLE A;  3FFI A;  3ZSW A;  4E7K A;  4DTM A;  3NBP A;  5J2M A;  4KHN A;  3SPY A;  4JS4 A;  3CG7 A;  1N6Q A;  1D9D A;  1C0M A;  1C1A A;  2O4G A;  1CLQ A;  3LP3 A;  3CQ8 A;  4FM0 A;  3NFA A;  1MU2 A;  4CJL A;  4W5R A;  4NYN A;  3K5L A;  1NK4 A;  1C1B A;  3PV8 A;  3L2W A;  4J2A A;  2KQ2 A;  3DRR A;  4DLG A;  2PYJ A;  4PWD A;  4DU1 A;  3ZT0 A;  1X9S A;  3ZT4 A;  4B3O A;  3CFR A;  3HO1 A;  4F3T A;  4KRE A;  3NCI A;  3HST B;  3MEC A;  2P1J A;  1IKW A;  1RBT A;  1TL3 A;  1FXX A;  4IG0 A;  2YNH A;  4MQ3 A;  4NYF A;  3VA0 A;  2B6A A;  4KAZ A;  1UAX A;  3OS1 A;  3QEP A;  3LZJ A;  3OYN A;  2D5R A;  3ISN C;  3CFO A;  2QK9 A;  1W0H A;  2KTQ A;  5KGW A;  1JKH A;  4O5B A;  1CXQ A;  4BAC A;  3E01 A;  3V9X A;  4DSJ A;  4YNQ A;  2JGU A;  4RW9 A;  3OYG A;  3JYT A;  2HW3 A;  1VK0 A;  2JLE A;  3NF9 A;  1S6Q A;  4OKJ A;  4KHS A;  3LP1 A;  2IS3 A;  3IAY A;  4DTN A;  1TL1 A;  2HHT A;  1KFD A;  1ASU A;  1SV5 A;  1HPZ A;  4DFK A;  3QNN A;  4DTR A;  1Q9X A;  1A5X A;  3LZI A;  5HRR A;  4FLZ A;  3ITH A;  3DOL A;  4CEE A;  3AO2 A;  1ZBF A;  1L3S A;  1EKE A;  1X1P A;  2IC3 A;  2RPI A;  5FRO A;  3RMC A;  1YTU A;  5SWM A;  3ULD A;  3LAM A;  4DTJ A;  3QEX A;  4O0I A;  3SUN A;  3KLE A;  3HT3 A;  4CGJ A;  1J54 A;  2X78 A;  2GV9 A;  5J2P A;  4HCB A;  4H4O A;  4KTZ A;  4BE0 A;  4DSE A;  2XHB A;  4N47 A;  5KRS A;  1G15 A;  3S3N A;  2X6N A;  5CZ1 A;  1S6P A;  3TAM A;  4I2Q A;  1HNI A;  4JRP A;  3ZCM A;  4E7J A;  3TAR A;  4KI6 A;  5DK5 A;  3V1Q A;  4CED A;  4CHN A;  4FLW A;  3OY9 A;  1BCM A;  1L3T A;  3SZ2 A;  4CIE A;  3RWU A;  2LSN A;  1L3U A;  5KGX A;  2GBZ A;  2W42 A;  3G0Z A;  1ZBL A;  1NKE A;  3IRX A;  1NKC A;  2G8H A;  4NCG A;  1RBU A;  1Z26 A;  4FZX C;  1S9G A;  1YT3 A;  4Q0B A;  3OVN A;  3TAG A;  4CHZ A;  2KW4 A;  4OKE A;  4AH9 A;  3TWH A;  3TAE A;  3C94 A;  1Y97 A;  3EYZ A;  4B9N A;  3MXJ A;  3OYH A;  1WSI A;  4E1N A;  4Z4H A;  1WSG A;  3KD5 E;  3RR7 A;  2DFE A;  4CEA A;  4CJ4 A;  3V9U A;  2Z1J A;  3SQ4 A;  1NK5 A;  4I7F A;  3P83 D;  4CGG A;  3D45 A;  4HUF A;  3ASM A;  4DTU A;  2HHX A;  4FJN A;  1RBR A;  4EZ6 A;  2OPP A;  1RT5 A;  4CGF A;  3KD1 E;  1LWE A;  2VG6 A;  5C42 A;  1TGO A;  2ETJ A;  3AVK A;  4OGC A;  3NHG A;  4FK4 A;  1JLB A;  1BQN A;  3QLH A;  3WNE A;  3OYK A;  1L5U A;  1JXE A;  4CEC A;  3BDP A;  4B9U A;  4M3T A;  1JLE A;  1LAV A;  3SCX A;  4KHU A;  1BCO A;  3LP0 A;  1U04 A;  4CFD A;  1TV6 A;  3B6P A;  3AV9 A;  3OYM A;  3MXI A;  3PO4 A;  4N41 A;  4Z4E A;  3RRG A;  4CK3 A;  1JLG A;  4FVM A;  4KRF A;  5E41 A;  3SUO A;  3HXM A;  1RT1 A;  2VG5 A;  2YHB A;  3AVN A;  1S1T A;  3K5N A;  4KO0 A;  1JXB A;  4M3X A;  2HMI A;  1ZBU A;  2VG7 A;  4C8M A;  3L2U A;  5J2Q A;  4OLB A;  3A2F A;  3RTV A;  4DMN A;  5I3U A;  1LAW A;  4ICL A;  2Y1I A;  4WE1 A;  3VA3 A;  4B9T A;  3KLH A;  3L2R A;  4FJ8 A;  5T7B A;  4W5Q A;  4CF2 A;  1HYS A;  1NK8 A;  3DI6 A;  3VQ8 A;  3U3Y A;  1IG9 A;  4FJK A;  2HNY A;  4FK0 A;  4KHW A;  1KLM A;  1VSJ A;  1IKV A;  3THV A;  2ZQB A;  3NGY A;  1QTM A;  5KRT A;  2Z1I A;  4C8N A;  1XC9 A;  4CFA A;  3OYL A;  1I3A A;  1W9H A;  2R7Y A;  5HLF A;  2A1S A;  4HHT A;  4DTX A;  4DSK A;  2YKM A;  3OYE A;  3OJS A;  4CCH A;  1DLO A;  5CY4 A;  3HP9 A;  3RRH A;  3VQC A;  1KVB A;  1CZB A;  1RCH A;  4PA1 A;  4CFC A;  3L3U A;  3VN5 A;  4CHY A;  2F96 A;  1TVR A;  1VSL A;  4FCY A;  1NK6 A;  1EXQ A;  2IGI A;  3K5O A;  5HRP A;  3SV4 A;  4DQI A;  1U45 A;  4BWJ A;  2OA8 A;  1HMV A;  1J53 A;  4RW4 A;  4ZTJ A;  2YNG A;  2P51 A;  2RN2 A;  1BIU A;  5FDL A;  4KI4 A;  2AJQ A;  2OYQ A;  1TKT A;  4DSL A;  4LY7 A;  3S9H A;  4OPJ A;  3KLG A;  1UOC A;  2OPQ A;  3NH2 A;  5CYQ A;  3V9S A;  1U47 A;  3NDK A;  2G8F A;  1RDA A;  2BAN A;  4E89 A;  4W5T A;  1F21 A;  4EP4 A;  1LV5 A;  4CEF A;  3RR8 A;  4Z4F A;  1WSJ A;  1C0T A;  1ZYQ A;  2QKB A;  1RDC A;  3I0R A;  1WNS A;  3OYC A;  3DRS A;  4DQP A;  1J9A A;  5K14 A;  3L2V A;  1D5A A;  1X9M A;  4FJ9 A;  3AVM A;  4CJU A;  4B9S A;  2I5J A;  2OPS A;  1SKR A;  1KFS A;  1TAQ A;  4B9V A;  2IDO A;  1BIS A;  4QAG A;  1BIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...