4DV6K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv6K00
4CW7B 1XNQK 2E5LK 5A2QO 4K0KK 5LMNK 1J5EK 4DV6K 4JI6K 4JI7K 4DR1K 4NXNK 4B3RK 4NXMK 1IBKK 1IBLK 3J7AP 3J80O 4JI4K 4X62K 4X65K 4YY3K 4DV5K 2ZM6K 4LF6K 2UU9K 4DR3K 1N34K 3J7YP 4X64K 4LFAK 4LF7K 2F4VK 1I94K 1HR0K 4B3TK 4GKJK 1XMQK 1XMOK 2UUBK 4JV5K 5AJ3K 4OX9K 2UUAK 4AQYK 4DR6K 4DR2K 1IBMK 4KHPK 4X66K 3JAMO 4JI3K 4LFBK 3J81O 4DUYK 4LFCK 2VQFK 3T1YK 4GKKK 4JYAK 4LF9K 4DV3K 4LF8K 2UXDK 1N36K 5IT9O 4DUZK 4LF4K 4DV0K 5LL6Z 4DR5K 2VQEK 1N33K 4JI8K 5IWAK 1HNZK 2UXCK 4B3SK 4DR7K 5FLXO 1N32K 1XNRK 1HNXK 4DV4K 1HNWK 3T1HK 5BR8K 4JI0K 2UXBK 4YHHK 5LMUK 4V19S 4JI1K 4JI5K 1FJGK 2UUCK 2HHHK 4JI2K 4DV1K 3OTOK 4LF5K 4CVNE 4DV2K 4DV7K 4DR4K 4B3MK
chains in the Genus database with same CATH superfamily
3PSFA 5KRTA 1WSIA 3F9MA 3O3HA 1RFQA 3VQQA 3R8EA 2YJFA 2ZJQL 4OGEA 3QEXA 4BDYA 1WSJA 3OBYA 1ATRA 3VGKA 1T6DA 1VSEA 1K9MO 4ICLA 4DTPA 2YHAA 1L5UA 3EE8A 1L3TA 1U49A 3EO3A 3D2EB 4CHZA 1BDGA 2JWLA 3AVCA 3M5RA 1U47A 2GWKA 1DTTA 3KK3A 3CJ9A 5AFUA 2Q31A 4MDBA 1U48A 1C6VA 3U3GA 1NJXA 2Z1JA 1BA1A 2I7NA 2QTDA 1FKPA 5CR4A 3AARA 3J81O 4W5NA 2Z1HA 3OYKA 1M90O 3O9RA 4N41A 1SKRA 2A6AA 1X1PA 4JKBA 3P1GA 4GY2B 5KTQA 1RILA 4DR5K 2QWPA 4ILGB 3J7ZO 4BWJA 1Q8IA 2OCEA 1EETA 2EWSA 3DXKA 4CJPA 5LY3A 1YVNA 1RBVA 4BGAA 4CJLA 1JLBA 3K2PA 4CZLA 3SUQA 3IS9A 5AQXA 4YHHK 2P9SA 4M7XA 4CEBA 3OYFA 4FJMA 1UOCA 4ZTJA 3EL2A 3AO2A 3CQ8A 4JI5K 1NLVA 3VQ8A 1Z6RA 3R6MA 1VQ7N 5ADXA 4KAZA 3AVHA 1LWCA 3A5OC 4C1NK 5EOYA 3CFOA 3ITHA 3VEYA 5DK5A 1UA0A 3HPHA 4DV7K 4GVMA 2BTFA 4KPYA 2OZMA 4H0PA 4Z4IA 4FW2A 4AHSA 4M7YA 4CJKA 1G15A 4E1MA 3MN6A 4CZIA 2P9NB 3HOSA 1YXQA 3DMJA 3O8MA 3G4SN 4E1JA 2E88A 4M3YA 3WNFA 3HBTA 1NK0A 4B9VA 4NLBA 4KTZA 4M41A 3UKRA 3ENHA 2E20A 1QE1A 4X64K 2QWOA 1OH7A 3OS1A 4B9UA 5T7BA 2Q3SA 2E1YA 2H3GX 3FFIA 1HR0K 5J1EA 3SI6A 2GUIA 3WXJA 3VQEA 2P1JA 4FZZA 1BHLA 3VEXA 4FWOA 3SQ2A 4CF2A 3CQXA 3K58A 3I8BA 4DQIA 2HHWA 3L8BA 2F8TA 3KJVA 3M6GA 3ZT0A 5BRFA 3MN5A 1RGIA 1L3UA 3K9JA 4FSVA 3H1VX 5GIPA 4OPAA 2HBMA 1GOAA 5M1NA 5BN8A 3DI6A 1HRHA 3WT0A 3RR7A 3VF6A 4LF4K 3SPZA 3OYGA 5JVHL 3EYZA 1ZBHA 3A0IX 1BL3A 2JGUA 4LD0A 5IWAK 2UXCK 1A5XA 3LP3A 2JLEA 3QBXA 1N32K 3O9QA 1NK7A 4JS4A 3PO4A 4DF8A 4CJ7A 1YI2N 3CCMN 3PX0A 4HTUA 3T69A 4A5BA 4CJ5A 3CETA 4ELUA 4OKEA 1HUXA 1T05A 3V4IA 2JWKA 3TABA 1YJWN 1VSKA 4CK2A 3ASMA 2P51A 2HOEA 3SQ0A 1YIJN 4OO1J 1LCUA 5SWMA 1R0AA 3MEDA 3O1BA 4Q5VA 3V1RA 3N4QA 1KC8O 3O08A 3ENBA 1NOYA 3ZX3A 2BH1A 4CHPA 1XWLA 4B1ZA 3WEEA 1OH6A 4X62K 2XHBA 3AGKA 3NVKA 5HOOA 4DB3A 4IXCA 2X78A 2G8IA 3J7YP 4NCAA 3DRRA 3O9UA 3VQPA 5BREA 3LDNA 1OVQA 1EWRA 1VSDA 5AQWA 3M8PA 4OJRA 2DFHA 5BPMA 3ZT4A 4FOIA 1OKJA 3U4LA 4KKOA 1LAWA 2AA4A 3G10A 4C8MA 2D0OA 1HYZA 4IEIA 4K42A 3L2RA 4M63C 1XUPO 2F9WA 4JAXA 2CH6A 3FZFA 4LFBK 4KHQA 1MWMA 5AQSA 5HBMA 2QW9A 2VQFK 5JLHA 4GKKK 2YNHA 3T19A 4DV3K 4N47A 2RE2A 4BRDA 3C6HA 4CJSA 3TTCA 2HSTA 4YDUC 2X74A 2GTDA 3HVRA 3JXUA 2XY8A 4JN4A 3CM5A 4QAGA 4FK4A 1X9SA 4DHYA 4DFJA 1OVYA 5E84A 4NCBA 3QO9A 3BF1A 1YF5L 2O8CB 2E1ZA 5KRSA 2ZF5O 1C0TA 3ZSQA 1JL2A 4HCBA 3O4WA 2VWJA 4CZMA 3KHYA 1P90A 2P9SB 3RVCA 5LMUK 3K5NA 3SNNA 1ZBLA 5HRSA 4NYFA 4BG9A 2ZJPL 3V9XA 3T3FA 1EO1A 4KREA 1O13A 1RTJA 5AQJA 4RW8A 4BE2A 2P9LA 3VEOA 5F0XA 2YNIA 3U6FA 1S3XA 1U04A 1RBUA 2ETJA 3LDOA 1GLFO 3QDKA 3E9PA 4PL7A 4G9ZA 1SV5A 3D6RA 3DXMA 4FWKA 4B1XB 1NG9A 3SCXA 1Q7YO 2E2OA 1J5EK 3BUZB 5D3GA 3FZMA 3TI0A 4JI4K 5C12A 2O8FA 2XO7A 4J2BA 4X65K 4DV5K 4AH9A 1VSIA 1N8RO 3P39A 3OYLA 5CYQA 2P9KA 3DLRA 3TAEA 3LDLA 4K43A 3PY8A 1A5WA 3ULDA 2QXFA 2F4VK 4WF9L 1WN7A 3NH2A 2E6LA 2VYPA 1XI1A 4DU4A 3IUCA 4LH4A 3MXMA 3J8AA 3QICA 2OA8A 1CZBA 2XY5A 4KTWA 4JK9A 4EHUA 3T1AA 1RCHA 4PKHA 2W6LA 1ASVA 4OVLA 1C0FA 4H0YB 3AVNA 3KK1A 3K57A 3SUNA 4JKEA 1S5JA 2HHTA 4DTMA 2E4LA 3T1YK 5EX5A 2KW4A 3A2FA 1P8ZA 1HPZA 4M3UA 4CJ3A 4EZ9A 3IKMA 4H4OA 3AVBA 2E8AA 2PYJA 3AVMA 4EAHD 1JCFA 3S3NA 2IC3A 3C6AA 1T44A 3OY9A 4LSLA 2V52B 4CGJA 1XNRK 4M3ZA 4BE0A 3CCQN 2HF3A 1D4XA 3O3GA 1S1VA 3EN9A 4CEOA 4V19S 4CF9A 5AQLA 2LSNA 3I0RA 1CZ9A 3G6EN 3NF9A 4IOAL 4BGBA 5AZIA 3RTVA 3G0ZA 1VRTA 3WQUA 3GOIA 3TAQA 3B6OA 3OYJA 1HNVA 3SPYA 4F2RA 4R79A 4JS5A 4WFBL 3JS6A 1WBBA 2YHWA 3VA3A 3CHWA 1BCOA 4IDHA 4DV6K 4PY5A 4JI7K 3LALA 4OLAA 3AVFA 2CGJA 3AA4A 1VSFA 4ELTA 4CEAA 1GLCG 1XC3A 1LW2A 1BUPA 1ZBUA 5AZJA 3QLHA 1M1KO 1VQKN 4M3WA 1VHXA 4LH5A 4OKKA 1ASWA 1KCFA 2PY5A 1KVBA 1SAZA 1EQYA 3PX4A 3UKUB 2O4IA 1KVAA 2P9PB 1JLGA 1JKHA 2NLXA 3DLBA 5AQUA 3SZ2A 1GLAG 4MLHA 3LL3A 1XMQK 4LC9B 2FXUA 2PYLA 4CGIA 4JD2A 3R9PA 3E01A 2OPQA 1Q9XA 3RWUA 3QEPA 1HJRA 1ILYA 3HP9A 2IVNA 3FFKB 2WUSA 4NB4A 3KK2A 4RW9A 5GAEP 3JAMO 4GVEA 3ZT1A 4DUYK 2RPIA 3EE9A 3VGLA 2YV0X 2I7PA 4AM6A 1YTAA 4K41A 3LPTA 3NE6A 4CF8A 4M3RA 4UY8O 2VG6A 5JS2A 2J4RA 3C6UA 2D0CA 2VQEK 2D0AA 3Q7CA 4R5PA 4B3SK 3DM2A 2EX3A 2VGNA 2IVPA 1HQEA 3KZBA 4Z4GA 4FVMA 3AA2A 5GINA 2G8VA 1Z05A 1BISA 3MWTA 2Q0RA 2YX6A 2GWJA 2WONA 3PSIA 4EIAA 2KQ2A 1NK6A 4RW7A 4DCHA 1RDDA 3SV4A 1KRPA 3OYHA 4FVUA 5KGXA 4FLXA 2P9LB 1WSEA 4Z94A 3THXB 4CJEA 1DEJA 3NGIA 3CFRA 4I6MA 4FLVA 1T7PA 1VSHA 3DXMB 1J53A 4BRMA 1REVA 3K5OA 5BRDA 3RMBA 4DF4A 3LP1A 1IO2A 3B6PA 4E0DA 3PLAA 2G8HA 4B9LA 3WNEA 4KFBA 4DG1A 3TAMA 3LDQA 2OTJN 1BGXT 2O8FB 3B8AX 1NJZA 2V51B 5C42A 4MQ3A 2ZM6K 4FJNA 4DR3K 2P9KB 4Y0WA 4IOCL 4CF1A 2HBKA 1VSMA 4PQUA 4DTRA 3BEXA 1K6YA 3H3OB 1BI4A 1RBTA 3HPGA 4OPHA 5JMVA 1DKGD 3OYCA 3BP8A 2D0BA 2WC9A 4KH4A 1V4TA 3K59A 3WXLA 5AQNA 2FSJA 3AAQA 2UUAK 2NNWA 1QSLA 2KZMA 1T8EA 4CCHA 3QB0A 4CJVA 3TAGA 3MN7A 1GLDG 4A2AA 4GW6A 4BDZA 1ESVA 5AQFA 3ULEB 3V1QA 3QETA 4GV9A 2R7YA 3QFPA 3PUFA 4WYBA 4IBNA 4PKGA 2YKMA 2HVIA 4PA1A 1E3MA 3VQAA 3KK7A 3CCSN 3IMXA 4RW6A 5FRMA 5J2NA 4FO0A 4BACA 3CERA 4BRIA 5AQMA 2QI2A 3OYNA 1YVUA 4WFNL 2FSNA 4E7JA 4DFKA 3ZEUA 3E9LA 4PUOA 3A5NC 5LJVA 4XIUA 4Z4FA 3DRPA 5CZ1A 4H8KA 3F9KA 5F2RA 4HUFA 3KTQA 2OTLN 3AVIA 4JK8A 3FE1A 1DT9A 1SZ2A 4O0JA 4YOYA 3SMPA 2YHXA 1X3MA 4H5NA 2Z1IA 3OJUA 2Y1IA 2W42A 4DTUA 3V9WA 3HO1A 3OYMA 3AA5X 3KLGA 5LMNK 4CFCA 3AGRA 4KHUA 1NK9A 4FWRA 1NKEA 2QEXN 2OANA 5C24A 1LWEA 3MECA 2UU9K 3SUOA 5JVGL 4CEFA 4BR9A 3Q7BA 1NWKA 2W41A 2O8DB 4B08A 3TARA 3F73A 4CGFA 4JEPA 5SZTA 3OA9A 4DQ8A 4B1WB 4B3TK 3O9SA 2Q2RA 1NK8A 2XRIA 4CIFA 3NH0A 1XMOK 4JD2B 3SAFA 2YJEA 4YFUA 4DR6K 3WXIA 3ZETB 4RWTA 2E2QA 1X9MA 1QVGM 1IBMK 5CZ2A 1KQSM 3RR8A 1VQON 4HVJA 4KB1A 2DFEA 2DTUA 3HL8A 1K8AO 1FKOA 5GADP 3QBWA 3IRXA 4FM2A 1GLEG 3RSEA 4ISEA 5IT9O 3OYAA 1NMNA 1IKXA 4CZFA 1JLCA 1BO5O 1ZXOA 1ZYQA 4FJKA 1IG8A 4BR2A 4PWDA 1UAXA 1OH5A 3GBTA 3QEWA 2UYTA 5I9EB 2HBJA 2OYQA 1XQSC 2QWNA 3MXIA 1J5OA 4IEEA 2UXBK 4I2PA 3OBWA 3L3VA 4CJWA 5GAGP 1JLAA 4IKFA 1ZBIA 2QWQA 3LM2A 1SS6A 3L6QA 2Q1NA 3E1YA 2XY6A 1JCGA 3KWIA 2A3ZA 1WSHA 3ZSYA 1HPMA 1S1XA 4IDKA 2DY4A 4C8LA 1QHAA 4FK2A 5MLCQ 4KO0A 2CH5A 3LDPA 4CEQA 3MN9A 1W7AA 2NRTA 2A40A 4FWNA 2E5LK 1D9DA 3SMSA 4DSKA 2OPPA 3CJ7A 2VG5A 2Y1JA 1VQ9N 1QSYA 4NXNK 2P9IB 4O4GA 1TYQA 2VGMA 3J80O 4C8OA 4HCCA 3SQ1A 4DQPA 3KLEA 2ZJRL 3U9DA 3F2KA 1XHZA 1N34K 2HNDA 2ITGA 3BY5A 2QK9A 4RW4A 2HMPA 3HZ6A 1Y64A 1S1WA 1QZ6A 1S72N 3FZHA 1GLLO 1BQNA 4FLWA 5LJWA 4FJ5A 1WSGA 1OH8A 1TAQA 1YUWA 1LW0A 3OYBA 3CMEN 3NF7A 4BQZA 1HKCA 3VF2A 1ATNA 4JI3K 3HYFA 1YTUA 4FWMA 3O3FA 1NK4A 3TANA 1IJJA 4CJTA 2ITMA 1SQKA 3QEIA 1YT3A 1WNSA 4BREA 4OGCA 4E7LA 3P31A 1QQMA 4F2SA 2HBLA 2XY7A 4O0IA 3IDHA 1N6QA 4H0OA 5AQIA 1VK0A 4EFHA 2YCHA 1N33K 4BC2A 1CLQA 2HHXA 3CC7N 1TKZA 5AQZA 4FJ9A 3CCVN 1J9AA 1KD1O 1ZBFA 4KHYA 2O8EA 3T1HK 5AFUH 3K5LA 1RT3A 3E9OA 3M8QA 1BOTO 4Z4CA 4FWPA 5AQRA 4DMNA 2NRRA 5JICA 2UUCK 4IFYA 3CJCA 3ZCMA 2G8WA 5JS1A 4KHSA 3HPOA 2Q0UA 4DTJA 3CQYA 3ISNC 3DXKB 1IKWA 3NH1A 3EEQA 4CJ4A 5HRPA 3VA0A 4BQLA 3T7ZA 4EHTA 1QHTA 3CCJN 4CECA 5BRHA 2PFUA 1WB9A 1S22A 2NRXA 5DM6L 1RDBA 5HL7L 4BRCA 4CHOA 3PX6A 1IBLK 4CIGA 5C2FA 3C6TA 3MWPA 1QQNA 4DU1A 1IKVA 3V6DA 4CHNA 1NGGA 1RDUA 5FRNA 3ZX0A 1TKTA 2NRWA 4DTSA 3L3UA 5J2QA 3IFRA 2GEMA 3NGYA 5DM7L 1GOBA 5ADXH 4QS8A 1W9HA 2QA4N 1KAXA 4YOUA 4GKJK 3TSUA 3DWLA 1BG3A 1HYVA 2UUBK 5FROA 4KRFA 1DGKN 2PAVA 4YOTA 3VQ9A 5E41A 4N56A 3UKRB 4DR2K 4ID1A 2HB5A 4WQ4A 3LZIA 4LSNA 4LFCK 2FF3B 1KFDA 3TU5A 4CJQA 4L8RB 3KKRA 4BC4A 3UIQA 1RT2A 4LF9K 3SJHA 3NDKA 1T03A 4F4KA 1HYSA 2BE2A 3SJJA 3CCEN 4DTNA 1I3AA 4MFBA 5C25A 3TAPA 3VOVA 4CZKA 4YOXA 2A1SA 4FZXC 3K5MA 4B1YB 4I9QA 4A5AA 5FLXO 3C0BA 3MK6A 3D2FA 3VQCA 4YORA 3AVGA 3LZJA 3HOTA 3AVKA 5BR8K 4JI0K 4MLEA 4J2AA 2X6NA 2KLAA 3NMUA 1IH7A 4GV3A 4U67L 3H45C 5C10A 3P83D 5I42A 2HHHK 4DFPA 4KV8A 4DTXA 1ZBSA 5BN9A 2HW3A 3H46O 1D9FA 3MCPA 4FWLA 1TGOA 3RMDA 3DLLL 4GMJB 3WUHA 3RMCA 4B3MK 1LOTB 4H5TA 3WXMB 2ZE2A 3D2EA 1TUYA 3QESA 1VQMN 1KVCA 1TK8A 4FWSA 4JHDA 3O1WA 4O5FA 4KH5A 4NXMK 3HTVA 4QS9A 3SK3A 1TYQB 4CD3A 3VQ7A 4FLUA 1A5VA 2FC0A 3N4PA 3NVMA 3HK2A 3NF6A 1BCMA 3RRHA 3DYAA 2G8UA 1XHXA 4E89A 3DJCA 4E3SA 3A8YA 1WOQA 5BPLA 4F9OA 3L4QA 4OKJA 4LF7K 3KWGA 2B5JA 5KQDA 4JKAA 4NLCA 1L3SA 1BA0A 1S6QA 3OHRA 3PO5A 3NGZA 4FW1A 4WE1A 1J54A 1TUUA 3WEEB 5AJ3K 2IGIA 3BF3A 2QKBA 1YJ9N 3KD5E 2G8KA 4A2BA 4WQ5A 3CCRN 1Q86O 3P4IA 4KHPK 1S9GA 4CHYA 2IVOA 4CHQA 3ENOA 1VQ5N 3ZSXA 3CYMA 4W5OA 3LM9A 3MX5A 4JYAK 4IO8A 3CCUN 5EU7A 3G25A 3ZT2A 3NCIA 1C0MA 5KPZA 1X3NA 3DRSA 2GX9A 3R1XA 5HP1A 5AQTA 3V9UA 4H03B 4BRPA 4KH6A 3DLEA 1TK0A 4W5RA 4CBWA 3UB5A 4FJGA 4FJIA 4IFVA 5HROA 1N5YA 4ELVA 5BPNA 2G8FA 5AQYA 5HRRA 1RT1A 1NBWA 3HM9A 4CGDA 3EZ5A 4BR4A 3KLFA 3O6WA 3DLGA 2NUBA 3BZKA 5CY4A 3A5MC 3V1OA 2IS3A 1Q9YA 1WAJA 3KLHA 1NNEA 1F21A 1B9FA 1RTDA 5CE3A 4J2EA 3JYTA 4DTOA 4BVPA 1XNQK 5A2QO 4AHRA 1GOCA 2E6MA 1NMDA 4OPJA 1EP4A 3J7AP 3S3MA 4O44A 4FL9A 1Z26A 4WFAL 2HF4A 4FWQA 3I8DA 1E4FT 3FLCO 3WNGA 2FBTA 4LFAK 1S1UA 3S41A 3G71N 2YNFA 4CBUA 2FBXA 4BRHA 3DLKA 4DWIA 3QNOA 2HHUA 1NJWA 2FBYA 1W2BM 3LAKA 3VGMA 5M1QA 4ZHRA 3PIPL 4GV6A 1EWQA 4DQSA 3HRGA 1NGDA 3GE1A 2F9TA 1KAYA 2HMIA 2HNZA 2ASOA 3R3LA 1VQ4N 4JK7A 4CBXA 3CMAN 1HJOA 2BANA 2I5JA 4DU3A 5DMRA 3VQBA 4X66K 1U2VA 4FPAA 3H1QA 2P9UA 3ZYYX 4CZHA 2KTQA 4IZ9A 3LP0A 4Q0BA 3CF5L 1YJNN 3ZSRA 3AO1A 4C1NI 2UXDK 5BR9A 3QERA 4O8UA 4BR5A 1TL1A 3NBPA 5F1XA 4AHTA 2KFNA 1NGBA 2E2PA 1BQMA 3TTFA 4OPKA 4DR7K 3MEEA 5AQHA 4IO9L 1LWFA 1U6ZA 4U7BA 1NGFA 3OJSA 2P5GA 1YITN 4BRLA 4FLYA 5AQGA 3O9TA 3VQ5A 2F96A 2CGKA 1XC9A 3SUPA 4FJ8A 1LV5A 2KKZA 4DV1K 1RT5A 2W6KA 4CEEA 4WCEL 2V7YA 3W3DA 5K14A 4PKIA 2FF6A 3MCAB 1FXXA 1Y97A 3KVGA 3CPWM 1MU2A 3GDQA 4J2DA 4B9NA 4K0KK 4IG3A 1KXPA 4MO5A 4PHTX 3I0SA 1WBDA 4JHDB 2BDPA 1VQ6N 3HT3A 4IFEA 1CXQA 3ZSOA 5AQQA 1RDWX 2HVHA 3SBGA 1DLOA 5AZIB 4QCLA 4CI6A 1NKBA 2ZD1A 1JXEA 1BU6O 3V9SA 4A59A 2O8BA 2NZTA 4F8RA 4B9QA 1NOZA 4E7KA 5EY4A 4CIEA 3THYA 2D5RA 1SKSA 5C2DA 1C1AA 4ID5A 5CYMA 3BDPA 1RDCA 3OW2M 1ASUA 3AO4A 3KKSA 2FLOA 2F8SA 4HTLA 5AZJB 2O8CA 4XEIA 4I7FA 3WXKA 2NRZA 4HHTA 2FSKA 5FPMA 3CCLN 3ID8A 1TKDA 2D0PA 2IIRA 4H0XB 4YNQA 4FJJA 4ILHA 4YOVA 1TL3A 3OYEA 5KPTA 1N36K 3HI0A 4XH5A 3TWHA 2DPNA 4K8ZA 5B8HA 2HNYA 2ZWHA 4DV0K 4IJAA 2RN2A 4DS4A 1UA1A 4JNEA 5ELZA 4CFAA 2VWBA 3U9ZA 5J2PA 3VETA 5M1OA 1BWFO 4CK1A 4FOEA 2QWMA 4AHCA 3L4IA 4BRKA 2A41A 1VQNN 1QZ5A 3V81A 4JLHA 4C8KA 3VQ6A 1NKCA 1D8YA 4EZ6A 3LWMA 3MAQA 1BIUA 1MWKA 3OYDA 3SV3A 4BRQA 3C7NA 2CGLA 3QMLA 3THWA 3CI5A 4E7HA 5AQVA 5AQOA 3P5JA 1NU0A 2YHYA 4W5QA 4AHVA 1EX4A 4N5SA 5KGWA 1W0HA 4JRQA 4KHNA 4FZYA 3FGUA 2VCPA 3H08A 3O80A 1R59O 1Q18A 4KBOA 4F3TA 4FJXA 2QM1A 4CW7B 3M1FA 5HRNA 1FK9A 1GLBG 4B3OA 4ZTFA 3SQ4A 4CZEA 1SUQA 2W40A 3UE5A 4BRNA 5C15A 1Q82O 4BR7A 4YY3K 3LP2A 3SYZA 2O4GA 1RNHA 2WFBA 3GL1A 4CJFA 3VF4A 4BRFA 4DKWA 4Y1DA 2IDOA 3NHGA 4I6MB 4IOXA 1G99A 3I55N 3AY9A 3VESA 1DTQA 4DSJA 4NO7A 4JKGA 3ZT3A 4N76A 4FYDA 2KHOA 3HVTA 1RTHA 4NCGA 3ZLJA 4KI4A 3ZSVA 1KLMA 1HMVA 2RKIA 1Z25A 4RTFD 2QKKA 4JKHA 1KTQA 4NYNA 1T6CA 4FJLA 1S9EA 4H0VB 3TSPA 1U2VB 4BVOA 2P9UB 4CESA 2FBVA 3VEWA 4DQRA 3AVAA 4FK0A 4CK3A 1BI4B 3CPEA 5TKWA 4C8NA 4Z4HA 1NJYA 1K73O 4A57A 4TSXA 1L3VA 1S1TA 2BUPA 3W0LA 1HKBA 4MO4A 5AR0A 3O5BA 5LL6Z 2OPSA 4ILJA 4CEZA 3PV8A 4IG0A 1EXQA 2VWKA 3BZCA 1RT7A 2F7TA 2ZGZA 1HX1A 3TAFA 4FPBA 4KHWA 4C23A 3HP6A 1C0GA 3AVLA 2NRVA 4PL8A 1VQ8N 3MMVA 1VRUA 3IG1A 2OZSA 3GG4A 4FM0A 4BY9C 4HWIA 4A61A 3C95A 3DLHA 4H4MA 4JRPA 1X9JA 4I2QA 4CFDA 4E7IA 1NGHA 3VTIA 3OVNA 1T3VA 3VN5A 3HSTB 4DSIA 2YKNA 4WQ4C 4BC5A 4CVNE 4JKFA 3RMAA 3O4QA 4DR4K 1NGIA 3THVA 3UKUA 5FPEA 2P9PA 5FPDA 3CJ1A 3K9KA 1S6PA 3QIPA 3LAMA 3DOKA 3SLCA 5M1PA 1X9WA 2YNGA 4BE1A 3ALYA 4DR1K 4DSEA 3ZEUB 2PBDA 1QSSA 1HKGA 1YAGA 1LAVA 3TPQA 4CF0A 4LF6K 1JL1A 4ISFA 2ZQBA 3M8SA 2AJQA 3KLIA 1KAZA 3WQTA 1WAFA 3L2WA 1ITGA 4M42A 5EVZA 2O8BB 2HHVA 4GNIA 2B6AA 4FJ7A 4Z0UA 1C1BA 4BR0A 4EP5A 3NF8A 1BIZA 1JLEA 3THYB 5FDLA 3M8RA 2Q36A 3SBTA 3NFAA 4DFMA 1IKYA 1RTIA 3I33A 4BDPA 3ATVA 4H5VA 4H5WA 1NGJA 3IAYA 1NJIO 1QQCA 3EKSA 4HUEA 3WNHA 4FJHA 1C1CA 2PZSA 3H3NO 4CZGA 3NAEA 4F3OA 3S9HA 1VQPN 4B9SA 1NGEA 4BG8A 4DSLA 4LF8K 5GIOA 3V9ZA 2ATQA 3ZX2A 4M3XA 3SAHA 3DOLA 1JJ2M 3CD6N 4H0TB 2ASPA 3LWLA 1RT6A 1YHQN 3THXA 1HNZK 3CFPA 1RBSA 1SL0A 3CC4N 1KFSA 2WOMA 1V4SA 1QVFM 5AQKA 4B8CA 1HNWK 3L0QA 4DLEA 1K8KA 3LANA 4KB0A 3CJBA 4CFBA 1MDUB 1WUAA 4G1QA 4DS5A 3EZWA 3VEZA 3RSEB 3CJAA 4A62A 4FLZA 1HLUA 3C7NB 2D4WA 2HHSA 1WSFA 4WQ5C 4AF1A 3THWB 3HJFA 4AHUA 1JXBA 1QS4A 3MDQA 4B1VA 5H1SQ 1VAZA 1KSPA 4DSFA 2OPRA 3CM6A 4LY7A 4CEDA 3VENA 3TR8A 2KFZA 1TK5A 3ATUA 4MDAA 1SL1A 3RRGA 2Z1GA 3AA3A 3F5TA 1D5AA 5TKYA 3AVJA 4YDUA 1JLQA 4FXDA 3C65A 4IJNA 1SL2A 3D0PA 3FR0A 4M3TA 4QS7A 1VSJA 2KZZA 1E4GT 4BRAA 4OLBA 2A1RA 2GV9A 3ULEA 3L2VA 3ZSZA 3ID6A 2GUPA 1I94K 3DAWA 3JSMA 2WTUA 3AV9A 1B9DA 4JKGB 4O5BA 5KI6A 2E2NA 1HNIA 2NRHA 3E66A 1MA9B 2QXLA 2V7ZA 4AM7A 2IAJA 1NK5A 1VQLN 3KD1E 1HQUA 5KPRA 4FLTA 4Z4EA 4OX9K 3LPUA 1TKXA 2QWRA 2RF2A 2YHBA 1IV0A 2VG7A 1QTMA 1JLFA 4B1UB 3C94A 1TV6A 2P5OA 3VERA 1Q81O 4CGGA 4BC3A 4IWVA 4BWMA 4XH1A 1NM1A 4E19A 3D45A 4J8FA 4K8XA 4CGHA 5M1KA 1U4BA 4DLGA 5HLFA 4CE9A 1TAUA 4RG8A 4ISGA 3L2UA 3VTHA 2X6SA 4H5RA 3H6EA 1EKEA 5M1FA 1TVRA 3CXCM 1KLNA 5C0YA 4CERA 4DV4K 5GAHP 2B4JA 3FZKA 3QFUA 3MXJA 3QINA 1RDAA 3EKUA 4FM1A 2BGGA 5I3UA 4I9LA 4O8KA 1H1VA 3U3YA 4JI2K 3HXMA 3PIOL 4LF5K 3L2QA 3MEGA 2D1KA 2O8DA 4Y1CA 4K25A 3CIPA 3M3ZA 2O8EB 1RT4A 2A42A 3FZLA 3QNNA 1JCEA 3U8XA 2P9NA 4KI6A 1J6ZA 4JI6K 4BROA 3SAGA 4EP4A 4B3RK 1IBKK 2IOCA 4B9MA 1W97L 4B8AB 3VMFB 3HM8A 3ZETA 3OYIA 3VPZA 1C0UA 3LDSA 4XH4A 4JKDA 4M45A 5CHIA 1CZAN 3EY1A 3I56N 2A5XA 4W5TA 4CZJA 3D7EO 5EXWA 3TSQA 3VQDA 2ASMA 5FPNA 1ATSA 2GELA 1B92A 1FW6A 4QOZB 1RBRA 4JV5K 4E1NA 1IG9A 1I39A 3VQ4A 4CJUA 4AQYK 1NGAA 2RHKA 2AP1A 3QEVA 3S3OA 3BGRA 3VEVA 4BRGA 1GLJO 2WBNA 1CXUA 4DQQA 4YOWA 1ZC6A 3AO3A 3MX2A 4CD1A 1SKWA 4DUZK 2DFFA 4JI8K 5JLFA 1UWBA 4KTQA 3AAPA 4UQGA 2Q97A 1WLJA 1U45A 4HUGA 3CG7A 5E26A 1HNXK 3A5LC 4CJRA 3AO5A 2ZGYA 3KIOA 4JKCA 3OS0A 2QWLA 1K8KB 4O55A 1VSLA 2P9IA 4JI1K 1O1WA 4AILC 1FJGK 4FCYA 3ZSWA 5KQ8A 3CC2N 1NGCA 3K0SA 3OTOK 5J2MA 4L3QA 4B9TA 2YI1A 3HSCA 3O4NA 4DV2K 3OS2A 4RCHA 2HHQA 2EHGA 1QQOA 3TTDA 2GBZA 3D2FB 3P38A 3QIOA 5AQPA
chains in the Genus database with same CATH topology
4CW7B 1XNQK 2E5LK 5A2QO 4K0KK 5LMNK 1J5EK 4DV6K 4JI6K 4JI7K 4DR1K 4NXNK 4B3RK 4NXMK 1IBKK 1IBLK 3J7AP 3J80O 4JI4K 4X62K 4X65K 4YY3K 4DV5K 2ZM6K 4LF6K 2UU9K 4DR3K 1N34K 3J7YP 4X64K 4LFAK 4LF7K 2F4VK 1I94K 1HR0K 4B3TK 4GKJK 1XMQK 1XMOK 2UUBK 4JV5K 5AJ3K 4OX9K 2UUAK 4AQYK 4DR6K 4DR2K 1IBMK 4KHPK 4X66K 3JAMO 4JI3K 4LFBK 3J81O 4DUYK 4LFCK 2VQFK 3T1YK 4GKKK 4JYAK 4LF9K 4DV3K 4LF8K 2UXDK 1N36K 5IT9O 4DUZK 4LF4K 4DV0K 5LL6Z 4DR5K 2VQEK 1N33K 4JI8K 5IWAK 1HNZK 2UXCK 4B3SK 4DR7K 5FLXO 1N32K 1XNRK 1HNXK 4DV4K 1HNWK 3T1HK 5BR8K 4JI0K 2UXBK 4YHHK 5LMUK 4V19S 4JI1K 4JI5K 1FJGK 2UUCK 2HHHK 4JI2K 4DV1K 3OTOK 4LF5K 4CVNE 4DV2K 4DV7K 4DR4K 4B3MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CW7 B;  1XNQ K;  2E5L K;  5A2Q O;  4K0K K;  5LMN K;  1J5E K;  4DV6 K;  4JI6 K;  4JI7 K;  4DR1 K;  4NXN K;  4B3R K;  4NXM K;  1IBK K;  1IBL K;  3J7A P;  3J80 O;  4JI4 K;  4X62 K;  4X65 K;  4YY3 K;  4DV5 K;  2ZM6 K;  4LF6 K;  2UU9 K;  4DR3 K;  1N34 K;  3J7Y P;  4X64 K;  4LFA K;  4LF7 K;  2F4V K;  1I94 K;  1HR0 K;  4B3T K;  4GKJ K;  1XMQ K;  1XMO K;  2UUB K;  4JV5 K;  5AJ3 K;  4OX9 K;  2UUA K;  4AQY K;  4DR6 K;  4DR2 K;  1IBM K;  4KHP K;  4X66 K;  3JAM O;  4JI3 K;  4LFB K;  3J81 O;  4DUY K;  4LFC K;  2VQF K;  3T1Y K;  4GKK K;  4JYA K;  4LF9 K;  4DV3 K;  4LF8 K;  2UXD K;  1N36 K;  5IT9 O;  4DUZ K;  4LF4 K;  4DV0 K;  5LL6 Z;  4DR5 K;  2VQE K;  1N33 K;  4JI8 K;  5IWA K;  1HNZ K;  2UXC K;  4B3S K;  4DR7 K;  5FLX O;  1N32 K;  1XNR K;  1HNX K;  4DV4 K;  1HNW K;  3T1H K;  5BR8 K;  4JI0 K;  2UXB K;  4YHH K;  5LMU K;  4V19 S;  4JI1 K;  4JI5 K;  1FJG K;  2UUC K;  2HHH K;  4JI2 K;  4DV1 K;  3OTO K;  4LF5 K;  4CVN E;  4DV2 K;  4DV7 K;  4DR4 K;  4B3M K; 
#chains in the Genus database with same CATH topology
 3PSF A;  5KRT A;  1WSI A;  3F9M A;  3O3H A;  1RFQ A;  3VQQ A;  3R8E A;  2YJF A;  2ZJQ L;  4OGE A;  3QEX A;  4BDY A;  1WSJ A;  3OBY A;  1ATR A;  3VGK A;  1T6D A;  1VSE A;  1K9M O;  4ICL A;  4DTP A;  2YHA A;  1L5U A;  3EE8 A;  1L3T A;  1U49 A;  3EO3 A;  3D2E B;  4CHZ A;  1BDG A;  2JWL A;  3AVC A;  3M5R A;  1U47 A;  2GWK A;  1DTT A;  3KK3 A;  3CJ9 A;  5AFU A;  2Q31 A;  4MDB A;  1U48 A;  1C6V A;  3U3G A;  1NJX A;  2Z1J A;  1BA1 A;  2I7N A;  2QTD A;  1FKP A;  5CR4 A;  3AAR A;  3J81 O;  4W5N A;  2Z1H A;  3OYK A;  1M90 O;  3O9R A;  4N41 A;  1SKR A;  2A6A A;  1X1P A;  4JKB A;  3P1G A;  4GY2 B;  5KTQ A;  1RIL A;  4DR5 K;  2QWP A;  4ILG B;  3J7Z O;  4BWJ A;  1Q8I A;  2OCE A;  1EET A;  2EWS A;  3DXK A;  4CJP A;  5LY3 A;  1YVN A;  1RBV A;  4BGA A;  4CJL A;  1JLB A;  3K2P A;  4CZL A;  3SUQ A;  3IS9 A;  5AQX A;  4YHH K;  2P9S A;  4M7X A;  4CEB A;  3OYF A;  4FJM A;  1UOC A;  4ZTJ A;  3EL2 A;  3AO2 A;  3CQ8 A;  4JI5 K;  1NLV A;  3VQ8 A;  1Z6R A;  3R6M A;  1VQ7 N;  5ADX A;  4KAZ A;  3AVH A;  1LWC A;  3A5O C;  4C1N K;  5EOY A;  3CFO A;  3ITH A;  3VEY A;  5DK5 A;  1UA0 A;  3HPH A;  4DV7 K;  4GVM A;  2BTF A;  4KPY A;  2OZM A;  4H0P A;  4Z4I A;  4FW2 A;  4AHS A;  4M7Y A;  4CJK A;  1G15 A;  4E1M A;  3MN6 A;  4CZI A;  2P9N B;  3HOS A;  1YXQ A;  3DMJ A;  3O8M A;  3G4S N;  4E1J A;  2E88 A;  4M3Y A;  3WNF A;  3HBT A;  1NK0 A;  4B9V A;  4NLB A;  4KTZ A;  4M41 A;  3UKR A;  3ENH A;  2E20 A;  1QE1 A;  4X64 K;  2QWO A;  1OH7 A;  3OS1 A;  4B9U A;  5T7B A;  2Q3S A;  2E1Y A;  2H3G X;  3FFI A;  1HR0 K;  5J1E A;  3SI6 A;  2GUI A;  3WXJ A;  3VQE A;  2P1J A;  4FZZ A;  1BHL A;  3VEX A;  4FWO A;  3SQ2 A;  4CF2 A;  3CQX A;  3K58 A;  3I8B A;  4DQI A;  2HHW A;  3L8B A;  2F8T A;  3KJV A;  3M6G A;  3ZT0 A;  5BRF A;  3MN5 A;  1RGI A;  1L3U A;  3K9J A;  4FSV A;  3H1V X;  5GIP A;  4OPA A;  2HBM A;  1GOA A;  5M1N A;  5BN8 A;  3DI6 A;  1HRH A;  3WT0 A;  3RR7 A;  3VF6 A;  4LF4 K;  3SPZ A;  3OYG A;  5JVH L;  3EYZ A;  1ZBH A;  3A0I X;  1BL3 A;  2JGU A;  4LD0 A;  5IWA K;  2UXC K;  1A5X A;  3LP3 A;  2JLE A;  3QBX A;  1N32 K;  3O9Q A;  1NK7 A;  4JS4 A;  3PO4 A;  4DF8 A;  4CJ7 A;  1YI2 N;  3CCM N;  3PX0 A;  4HTU A;  3T69 A;  4A5B A;  4CJ5 A;  3CET A;  4ELU A;  4OKE A;  1HUX A;  1T05 A;  3V4I A;  2JWK A;  3TAB A;  1YJW N;  1VSK A;  4CK2 A;  3ASM A;  2P51 A;  2HOE A;  3SQ0 A;  1YIJ N;  4OO1 J;  1LCU A;  5SWM A;  1R0A A;  3MED A;  3O1B A;  4Q5V A;  3V1R A;  3N4Q A;  1KC8 O;  3O08 A;  3ENB A;  1NOY A;  3ZX3 A;  2BH1 A;  4CHP A;  1XWL A;  4B1Z A;  3WEE A;  1OH6 A;  4X62 K;  2XHB A;  3AGK A;  3NVK A;  5HOO A;  4DB3 A;  4IXC A;  2X78 A;  2G8I A;  3J7Y P;  4NCA A;  3DRR A;  3O9U A;  3VQP A;  5BRE A;  3LDN A;  1OVQ A;  1EWR A;  1VSD A;  5AQW A;  3M8P A;  4OJR A;  2DFH A;  5BPM A;  3ZT4 A;  4FOI A;  1OKJ A;  3U4L A;  4KKO A;  1LAW A;  2AA4 A;  3G10 A;  4C8M A;  2D0O A;  1HYZ A;  4IEI A;  4K42 A;  3L2R A;  4M63 C;  1XUP O;  2F9W A;  4JAX A;  2CH6 A;  3FZF A;  4LFB K;  4KHQ A;  1MWM A;  5AQS A;  5HBM A;  2QW9 A;  2VQF K;  5JLH A;  4GKK K;  2YNH A;  3T19 A;  4DV3 K;  4N47 A;  2RE2 A;  4BRD A;  3C6H A;  4CJS A;  3TTC A;  2HST A;  4YDU C;  2X74 A;  2GTD A;  3HVR A;  3JXU A;  2XY8 A;  4JN4 A;  3CM5 A;  4QAG A;  4FK4 A;  1X9S A;  4DHY A;  4DFJ A;  1OVY A;  5E84 A;  4NCB A;  3QO9 A;  3BF1 A;  1YF5 L;  2O8C B;  2E1Z A;  5KRS A;  2ZF5 O;  1C0T A;  3ZSQ A;  1JL2 A;  4HCB A;  3O4W A;  2VWJ A;  4CZM A;  3KHY A;  1P90 A;  2P9S B;  3RVC A;  5LMU K;  3K5N A;  3SNN A;  1ZBL A;  5HRS A;  4NYF A;  4BG9 A;  2ZJP L;  3V9X A;  3T3F A;  1EO1 A;  4KRE A;  1O13 A;  1RTJ A;  5AQJ A;  4RW8 A;  4BE2 A;  2P9L A;  3VEO A;  5F0X A;  2YNI A;  3U6F A;  1S3X A;  1U04 A;  1RBU A;  2ETJ A;  3LDO A;  1GLF O;  3QDK A;  3E9P A;  4PL7 A;  4G9Z A;  1SV5 A;  3D6R A;  3DXM A;  4FWK A;  4B1X B;  1NG9 A;  3SCX A;  1Q7Y O;  2E2O A;  1J5E K;  3BUZ B;  5D3G A;  3FZM A;  3TI0 A;  4JI4 K;  5C12 A;  2O8F A;  2XO7 A;  4J2B A;  4X65 K;  4DV5 K;  4AH9 A;  1VSI A;  1N8R O;  3P39 A;  3OYL A;  5CYQ A;  2P9K A;  3DLR A;  3TAE A;  3LDL A;  4K43 A;  3PY8 A;  1A5W A;  3ULD A;  2QXF A;  2F4V K;  4WF9 L;  1WN7 A;  3NH2 A;  2E6L A;  2VYP A;  1XI1 A;  4DU4 A;  3IUC A;  4LH4 A;  3MXM A;  3J8A A;  3QIC A;  2OA8 A;  1CZB A;  2XY5 A;  4KTW A;  4JK9 A;  4EHU A;  3T1A A;  1RCH A;  4PKH A;  2W6L A;  1ASV A;  4OVL A;  1C0F A;  4H0Y B;  3AVN A;  3KK1 A;  3K57 A;  3SUN A;  4JKE A;  1S5J A;  2HHT A;  4DTM A;  2E4L A;  3T1Y K;  5EX5 A;  2KW4 A;  3A2F A;  1P8Z A;  1HPZ A;  4M3U A;  4CJ3 A;  4EZ9 A;  3IKM A;  4H4O A;  3AVB A;  2E8A A;  2PYJ A;  3AVM A;  4EAH D;  1JCF A;  3S3N A;  2IC3 A;  3C6A A;  1T44 A;  3OY9 A;  4LSL A;  2V52 B;  4CGJ A;  1XNR K;  4M3Z A;  4BE0 A;  3CCQ N;  2HF3 A;  1D4X A;  3O3G A;  1S1V A;  3EN9 A;  4CEO A;  4V19 S;  4CF9 A;  5AQL A;  2LSN A;  3I0R A;  1CZ9 A;  3G6E N;  3NF9 A;  4IOA L;  4BGB A;  5AZI A;  3RTV A;  3G0Z A;  1VRT A;  3WQU A;  3GOI A;  3TAQ A;  3B6O A;  3OYJ A;  1HNV A;  3SPY A;  4F2R A;  4R79 A;  4JS5 A;  4WFB L;  3JS6 A;  1WBB A;  2YHW A;  3VA3 A;  3CHW A;  1BCO A;  4IDH A;  4DV6 K;  4PY5 A;  4JI7 K;  3LAL A;  4OLA A;  3AVF A;  2CGJ A;  3AA4 A;  1VSF A;  4ELT A;  4CEA A;  1GLC G;  1XC3 A;  1LW2 A;  1BUP A;  1ZBU A;  5AZJ A;  3QLH A;  1M1K O;  1VQK N;  4M3W A;  1VHX A;  4LH5 A;  4OKK A;  1ASW A;  1KCF A;  2PY5 A;  1KVB A;  1SAZ A;  1EQY A;  3PX4 A;  3UKU B;  2O4I A;  1KVA A;  2P9P B;  1JLG A;  1JKH A;  2NLX A;  3DLB A;  5AQU A;  3SZ2 A;  1GLA G;  4MLH A;  3LL3 A;  1XMQ K;  4LC9 B;  2FXU A;  2PYL A;  4CGI A;  4JD2 A;  3R9P A;  3E01 A;  2OPQ A;  1Q9X A;  3RWU A;  3QEP A;  1HJR A;  1ILY A;  3HP9 A;  2IVN A;  3FFK B;  2WUS A;  4NB4 A;  3KK2 A;  4RW9 A;  5GAE P;  3JAM O;  4GVE A;  3ZT1 A;  4DUY K;  2RPI A;  3EE9 A;  3VGL A;  2YV0 X;  2I7P A;  4AM6 A;  1YTA A;  4K41 A;  3LPT A;  3NE6 A;  4CF8 A;  4M3R A;  4UY8 O;  2VG6 A;  5JS2 A;  2J4R A;  3C6U A;  2D0C A;  2VQE K;  2D0A A;  3Q7C A;  4R5P A;  4B3S K;  3DM2 A;  2EX3 A;  2VGN A;  2IVP A;  1HQE A;  3KZB A;  4Z4G A;  4FVM A;  3AA2 A;  5GIN A;  2G8V A;  1Z05 A;  1BIS A;  3MWT A;  2Q0R A;  2YX6 A;  2GWJ A;  2WON A;  3PSI A;  4EIA A;  2KQ2 A;  1NK6 A;  4RW7 A;  4DCH A;  1RDD A;  3SV4 A;  1KRP A;  3OYH A;  4FVU A;  5KGX A;  4FLX A;  2P9L B;  1WSE A;  4Z94 A;  3THX B;  4CJE A;  1DEJ A;  3NGI A;  3CFR A;  4I6M A;  4FLV A;  1T7P A;  1VSH A;  3DXM B;  1J53 A;  4BRM A;  1REV A;  3K5O A;  5BRD A;  3RMB A;  4DF4 A;  3LP1 A;  1IO2 A;  3B6P A;  4E0D A;  3PLA A;  2G8H A;  4B9L A;  3WNE A;  4KFB A;  4DG1 A;  3TAM A;  3LDQ A;  2OTJ N;  1BGX T;  2O8F B;  3B8A X;  1NJZ A;  2V51 B;  5C42 A;  4MQ3 A;  2ZM6 K;  4FJN A;  4DR3 K;  2P9K B;  4Y0W A;  4IOC L;  4CF1 A;  2HBK A;  1VSM A;  4PQU A;  4DTR A;  3BEX A;  1K6Y A;  3H3O B;  1BI4 A;  1RBT A;  3HPG A;  4OPH A;  5JMV A;  1DKG D;  3OYC A;  3BP8 A;  2D0B A;  2WC9 A;  4KH4 A;  1V4T A;  3K59 A;  3WXL A;  5AQN A;  2FSJ A;  3AAQ A;  2UUA K;  2NNW A;  1QSL A;  2KZM A;  1T8E A;  4CCH A;  3QB0 A;  4CJV A;  3TAG A;  3MN7 A;  1GLD G;  4A2A A;  4GW6 A;  4BDZ A;  1ESV A;  5AQF A;  3ULE B;  3V1Q A;  3QET A;  4GV9 A;  2R7Y A;  3QFP A;  3PUF A;  4WYB A;  4IBN A;  4PKG A;  2YKM A;  2HVI A;  4PA1 A;  1E3M A;  3VQA A;  3KK7 A;  3CCS N;  3IMX A;  4RW6 A;  5FRM A;  5J2N A;  4FO0 A;  4BAC A;  3CER A;  4BRI A;  5AQM A;  2QI2 A;  3OYN A;  1YVU A;  4WFN L;  2FSN A;  4E7J A;  4DFK A;  3ZEU A;  3E9L A;  4PUO A;  3A5N C;  5LJV A;  4XIU A;  4Z4F A;  3DRP A;  5CZ1 A;  4H8K A;  3F9K A;  5F2R A;  4HUF A;  3KTQ A;  2OTL N;  3AVI A;  4JK8 A;  3FE1 A;  1DT9 A;  1SZ2 A;  4O0J A;  4YOY A;  3SMP A;  2YHX A;  1X3M A;  4H5N A;  2Z1I A;  3OJU A;  2Y1I A;  2W42 A;  4DTU A;  3V9W A;  3HO1 A;  3OYM A;  3AA5 X;  3KLG A;  5LMN K;  4CFC A;  3AGR A;  4KHU A;  1NK9 A;  4FWR A;  1NKE A;  2QEX N;  2OAN A;  5C24 A;  1LWE A;  3MEC A;  2UU9 K;  3SUO A;  5JVG L;  4CEF A;  4BR9 A;  3Q7B A;  1NWK A;  2W41 A;  2O8D B;  4B08 A;  3TAR A;  3F73 A;  4CGF A;  4JEP A;  5SZT A;  3OA9 A;  4DQ8 A;  4B1W B;  4B3T K;  3O9S A;  2Q2R A;  1NK8 A;  2XRI A;  4CIF A;  3NH0 A;  1XMO K;  4JD2 B;  3SAF A;  2YJE A;  4YFU A;  4DR6 K;  3WXI A;  3ZET B;  4RWT A;  2E2Q A;  1X9M A;  1QVG M;  1IBM K;  5CZ2 A;  1KQS M;  3RR8 A;  1VQO N;  4HVJ A;  4KB1 A;  2DFE A;  2DTU A;  3HL8 A;  1K8A O;  1FKO A;  5GAD P;  3QBW A;  3IRX A;  4FM2 A;  1GLE G;  3RSE A;  4ISE A;  5IT9 O;  3OYA A;  1NMN A;  1IKX A;  4CZF A;  1JLC A;  1BO5 O;  1ZXO A;  1ZYQ A;  4FJK A;  1IG8 A;  4BR2 A;  4PWD A;  1UAX A;  1OH5 A;  3GBT A;  3QEW A;  2UYT A;  5I9E B;  2HBJ A;  2OYQ A;  1XQS C;  2QWN A;  3MXI A;  1J5O A;  4IEE A;  2UXB K;  4I2P A;  3OBW A;  3L3V A;  4CJW A;  5GAG P;  1JLA A;  4IKF A;  1ZBI A;  2QWQ A;  3LM2 A;  1SS6 A;  3L6Q A;  2Q1N A;  3E1Y A;  2XY6 A;  1JCG A;  3KWI A;  2A3Z A;  1WSH A;  3ZSY A;  1HPM A;  1S1X A;  4IDK A;  2DY4 A;  4C8L A;  1QHA A;  4FK2 A;  5MLC Q;  4KO0 A;  2CH5 A;  3LDP A;  4CEQ A;  3MN9 A;  1W7A A;  2NRT A;  2A40 A;  4FWN A;  2E5L K;  1D9D A;  3SMS A;  4DSK A;  2OPP A;  3CJ7 A;  2VG5 A;  2Y1J A;  1VQ9 N;  1QSY A;  4NXN K;  2P9I B;  4O4G A;  1TYQ A;  2VGM A;  3J80 O;  4C8O A;  4HCC A;  3SQ1 A;  4DQP A;  3KLE A;  2ZJR L;  3U9D A;  3F2K A;  1XHZ A;  1N34 K;  2HND A;  2ITG A;  3BY5 A;  2QK9 A;  4RW4 A;  2HMP A;  3HZ6 A;  1Y64 A;  1S1W A;  1QZ6 A;  1S72 N;  3FZH A;  1GLL O;  1BQN A;  4FLW A;  5LJW A;  4FJ5 A;  1WSG A;  1OH8 A;  1TAQ A;  1YUW A;  1LW0 A;  3OYB A;  3CME N;  3NF7 A;  4BQZ A;  1HKC A;  3VF2 A;  1ATN A;  4JI3 K;  3HYF A;  1YTU A;  4FWM A;  3O3F A;  1NK4 A;  3TAN A;  1IJJ A;  4CJT A;  2ITM A;  1SQK A;  3QEI A;  1YT3 A;  1WNS A;  4BRE A;  4OGC A;  4E7L A;  3P31 A;  1QQM A;  4F2S A;  2HBL A;  2XY7 A;  4O0I A;  3IDH A;  1N6Q A;  4H0O A;  5AQI A;  1VK0 A;  4EFH A;  2YCH A;  1N33 K;  4BC2 A;  1CLQ A;  2HHX A;  3CC7 N;  1TKZ A;  5AQZ A;  4FJ9 A;  3CCV N;  1J9A A;  1KD1 O;  1ZBF A;  4KHY A;  2O8E A;  3T1H K;  5AFU H;  3K5L A;  1RT3 A;  3E9O A;  3M8Q A;  1BOT O;  4Z4C A;  4FWP A;  5AQR A;  4DMN A;  2NRR A;  5JIC A;  2UUC K;  4IFY A;  3CJC A;  3ZCM A;  2G8W A;  5JS1 A;  4KHS A;  3HPO A;  2Q0U A;  4DTJ A;  3CQY A;  3ISN C;  3DXK B;  1IKW A;  3NH1 A;  3EEQ A;  4CJ4 A;  5HRP A;  3VA0 A;  4BQL A;  3T7Z A;  4EHT A;  1QHT A;  3CCJ N;  4CEC A;  5BRH A;  2PFU A;  1WB9 A;  1S22 A;  2NRX A;  5DM6 L;  1RDB A;  5HL7 L;  4BRC A;  4CHO A;  3PX6 A;  1IBL K;  4CIG A;  5C2F A;  3C6T A;  3MWP A;  1QQN A;  4DU1 A;  1IKV A;  3V6D A;  4CHN A;  1NGG A;  1RDU A;  5FRN A;  3ZX0 A;  1TKT A;  2NRW A;  4DTS A;  3L3U A;  5J2Q A;  3IFR A;  2GEM A;  3NGY A;  5DM7 L;  1GOB A;  5ADX H;  4QS8 A;  1W9H A;  2QA4 N;  1KAX A;  4YOU A;  4GKJ K;  3TSU A;  3DWL A;  1BG3 A;  1HYV A;  2UUB K;  5FRO A;  4KRF A;  1DGK N;  2PAV A;  4YOT A;  3VQ9 A;  5E41 A;  4N56 A;  3UKR B;  4DR2 K;  4ID1 A;  2HB5 A;  4WQ4 A;  3LZI A;  4LSN A;  4LFC K;  2FF3 B;  1KFD A;  3TU5 A;  4CJQ A;  4L8R B;  3KKR A;  4BC4 A;  3UIQ A;  1RT2 A;  4LF9 K;  3SJH A;  3NDK A;  1T03 A;  4F4K A;  1HYS A;  2BE2 A;  3SJJ A;  3CCE N;  4DTN A;  1I3A A;  4MFB A;  5C25 A;  3TAP A;  3VOV A;  4CZK A;  4YOX A;  2A1S A;  4FZX C;  3K5M A;  4B1Y B;  4I9Q A;  4A5A A;  5FLX O;  3C0B A;  3MK6 A;  3D2F A;  3VQC A;  4YOR A;  3AVG A;  3LZJ A;  3HOT A;  3AVK A;  5BR8 K;  4JI0 K;  4MLE A;  4J2A A;  2X6N A;  2KLA A;  3NMU A;  1IH7 A;  4GV3 A;  4U67 L;  3H45 C;  5C10 A;  3P83 D;  5I42 A;  2HHH K;  4DFP A;  4KV8 A;  4DTX A;  1ZBS A;  5BN9 A;  2HW3 A;  3H46 O;  1D9F A;  3MCP A;  4FWL A;  1TGO A;  3RMD A;  3DLL L;  4GMJ B;  3WUH A;  3RMC A;  4B3M K;  1LOT B;  4H5T A;  3WXM B;  2ZE2 A;  3D2E A;  1TUY A;  3QES A;  1VQM N;  1KVC A;  1TK8 A;  4FWS A;  4JHD A;  3O1W A;  4O5F A;  4KH5 A;  4NXM K;  3HTV A;  4QS9 A;  3SK3 A;  1TYQ B;  4CD3 A;  3VQ7 A;  4FLU A;  1A5V A;  2FC0 A;  3N4P A;  3NVM A;  3HK2 A;  3NF6 A;  1BCM A;  3RRH A;  3DYA A;  2G8U A;  1XHX A;  4E89 A;  3DJC A;  4E3S A;  3A8Y A;  1WOQ A;  5BPL A;  4F9O A;  3L4Q A;  4OKJ A;  4LF7 K;  3KWG A;  2B5J A;  5KQD A;  4JKA A;  4NLC A;  1L3S A;  1BA0 A;  1S6Q A;  3OHR A;  3PO5 A;  3NGZ A;  4FW1 A;  4WE1 A;  1J54 A;  1TUU A;  3WEE B;  5AJ3 K;  2IGI A;  3BF3 A;  2QKB A;  1YJ9 N;  3KD5 E;  2G8K A;  4A2B A;  4WQ5 A;  3CCR N;  1Q86 O;  3P4I A;  4KHP K;  1S9G A;  4CHY A;  2IVO A;  4CHQ A;  3ENO A;  1VQ5 N;  3ZSX A;  3CYM A;  4W5O A;  3LM9 A;  3MX5 A;  4JYA K;  4IO8 A;  3CCU N;  5EU7 A;  3G25 A;  3ZT2 A;  3NCI A;  1C0M A;  5KPZ A;  1X3N A;  3DRS A;  2GX9 A;  3R1X A;  5HP1 A;  5AQT A;  3V9U A;  4H03 B;  4BRP A;  4KH6 A;  3DLE A;  1TK0 A;  4W5R A;  4CBW A;  3UB5 A;  4FJG A;  4FJI A;  4IFV A;  5HRO A;  1N5Y A;  4ELV A;  5BPN A;  2G8F A;  5AQY A;  5HRR A;  1RT1 A;  1NBW A;  3HM9 A;  4CGD A;  3EZ5 A;  4BR4 A;  3KLF A;  3O6W A;  3DLG A;  2NUB A;  3BZK A;  5CY4 A;  3A5M C;  3V1O A;  2IS3 A;  1Q9Y A;  1WAJ A;  3KLH A;  1NNE A;  1F21 A;  1B9F A;  1RTD A;  5CE3 A;  4J2E A;  3JYT A;  4DTO A;  4BVP A;  1XNQ K;  5A2Q O;  4AHR A;  1GOC A;  2E6M A;  1NMD A;  4OPJ A;  1EP4 A;  3J7A P;  3S3M A;  4O44 A;  4FL9 A;  1Z26 A;  4WFA L;  2HF4 A;  4FWQ A;  3I8D A;  1E4F T;  3FLC O;  3WNG A;  2FBT A;  4LFA K;  1S1U A;  3S41 A;  3G71 N;  2YNF A;  4CBU A;  2FBX A;  4BRH A;  3DLK A;  4DWI A;  3QNO A;  2HHU A;  1NJW A;  2FBY A;  1W2B M;  3LAK A;  3VGM A;  5M1Q A;  4ZHR A;  3PIP L;  4GV6 A;  1EWQ A;  4DQS A;  3HRG A;  1NGD A;  3GE1 A;  2F9T A;  1KAY A;  2HMI A;  2HNZ A;  2ASO A;  3R3L A;  1VQ4 N;  4JK7 A;  4CBX A;  3CMA N;  1HJO A;  2BAN A;  2I5J A;  4DU3 A;  5DMR A;  3VQB A;  4X66 K;  1U2V A;  4FPA A;  3H1Q A;  2P9U A;  3ZYY X;  4CZH A;  2KTQ A;  4IZ9 A;  3LP0 A;  4Q0B A;  3CF5 L;  1YJN N;  3ZSR A;  3AO1 A;  4C1N I;  2UXD K;  5BR9 A;  3QER A;  4O8U A;  4BR5 A;  1TL1 A;  3NBP A;  5F1X A;  4AHT A;  2KFN A;  1NGB A;  2E2P A;  1BQM A;  3TTF A;  4OPK A;  4DR7 K;  3MEE A;  5AQH A;  4IO9 L;  1LWF A;  1U6Z A;  4U7B A;  1NGF A;  3OJS A;  2P5G A;  1YIT N;  4BRL A;  4FLY A;  5AQG A;  3O9T A;  3VQ5 A;  2F96 A;  2CGK A;  1XC9 A;  3SUP A;  4FJ8 A;  1LV5 A;  2KKZ A;  4DV1 K;  1RT5 A;  2W6K A;  4CEE A;  4WCE L;  2V7Y A;  3W3D A;  5K14 A;  4PKI A;  2FF6 A;  3MCA B;  1FXX A;  1Y97 A;  3KVG A;  3CPW M;  1MU2 A;  3GDQ A;  4J2D A;  4B9N A;  4K0K K;  4IG3 A;  1KXP A;  4MO5 A;  4PHT X;  3I0S A;  1WBD A;  4JHD B;  2BDP A;  1VQ6 N;  3HT3 A;  4IFE A;  1CXQ A;  3ZSO A;  5AQQ A;  1RDW X;  2HVH A;  3SBG A;  1DLO A;  5AZI B;  4QCL A;  4CI6 A;  1NKB A;  2ZD1 A;  1JXE A;  1BU6 O;  3V9S A;  4A59 A;  2O8B A;  2NZT A;  4F8R A;  4B9Q A;  1NOZ A;  4E7K A;  5EY4 A;  4CIE A;  3THY A;  2D5R A;  1SKS A;  5C2D A;  1C1A A;  4ID5 A;  5CYM A;  3BDP A;  1RDC A;  3OW2 M;  1ASU A;  3AO4 A;  3KKS A;  2FLO A;  2F8S A;  4HTL A;  5AZJ B;  2O8C A;  4XEI A;  4I7F A;  3WXK A;  2NRZ A;  4HHT A;  2FSK A;  5FPM A;  3CCL N;  3ID8 A;  1TKD A;  2D0P A;  2IIR A;  4H0X B;  4YNQ A;  4FJJ A;  4ILH A;  4YOV A;  1TL3 A;  3OYE A;  5KPT A;  1N36 K;  3HI0 A;  4XH5 A;  3TWH A;  2DPN A;  4K8Z A;  5B8H A;  2HNY A;  2ZWH A;  4DV0 K;  4IJA A;  2RN2 A;  4DS4 A;  1UA1 A;  4JNE A;  5ELZ A;  4CFA A;  2VWB A;  3U9Z A;  5J2P A;  3VET A;  5M1O A;  1BWF O;  4CK1 A;  4FOE A;  2QWM A;  4AHC A;  3L4I A;  4BRK A;  2A41 A;  1VQN N;  1QZ5 A;  3V81 A;  4JLH A;  4C8K A;  3VQ6 A;  1NKC A;  1D8Y A;  4EZ6 A;  3LWM A;  3MAQ A;  1BIU A;  1MWK A;  3OYD A;  3SV3 A;  4BRQ A;  3C7N A;  2CGL A;  3QML A;  3THW A;  3CI5 A;  4E7H A;  5AQV A;  5AQO A;  3P5J A;  1NU0 A;  2YHY A;  4W5Q A;  4AHV A;  1EX4 A;  4N5S A;  5KGW A;  1W0H A;  4JRQ A;  4KHN A;  4FZY A;  3FGU A;  2VCP A;  3H08 A;  3O80 A;  1R59 O;  1Q18 A;  4KBO A;  4F3T A;  4FJX A;  2QM1 A;  4CW7 B;  3M1F A;  5HRN A;  1FK9 A;  1GLB G;  4B3O A;  4ZTF A;  3SQ4 A;  4CZE A;  1SUQ A;  2W40 A;  3UE5 A;  4BRN A;  5C15 A;  1Q82 O;  4BR7 A;  4YY3 K;  3LP2 A;  3SYZ A;  2O4G A;  1RNH A;  2WFB A;  3GL1 A;  4CJF A;  3VF4 A;  4BRF A;  4DKW A;  4Y1D A;  2IDO A;  3NHG A;  4I6M B;  4IOX A;  1G99 A;  3I55 N;  3AY9 A;  3VES A;  1DTQ A;  4DSJ A;  4NO7 A;  4JKG A;  3ZT3 A;  4N76 A;  4FYD A;  2KHO A;  3HVT A;  1RTH A;  4NCG A;  3ZLJ A;  4KI4 A;  3ZSV A;  1KLM A;  1HMV A;  2RKI A;  1Z25 A;  4RTF D;  2QKK A;  4JKH A;  1KTQ A;  4NYN A;  1T6C A;  4FJL A;  1S9E A;  4H0V B;  3TSP A;  1U2V B;  4BVO A;  2P9U B;  4CES A;  2FBV A;  3VEW A;  4DQR A;  3AVA A;  4FK0 A;  4CK3 A;  1BI4 B;  3CPE A;  5TKW A;  4C8N A;  4Z4H A;  1NJY A;  1K73 O;  4A57 A;  4TSX A;  1L3V A;  1S1T A;  2BUP A;  3W0L A;  1HKB A;  4MO4 A;  5AR0 A;  3O5B A;  5LL6 Z;  2OPS A;  4ILJ A;  4CEZ A;  3PV8 A;  4IG0 A;  1EXQ A;  2VWK A;  3BZC A;  1RT7 A;  2F7T A;  2ZGZ A;  1HX1 A;  3TAF A;  4FPB A;  4KHW A;  4C23 A;  3HP6 A;  1C0G A;  3AVL A;  2NRV A;  4PL8 A;  1VQ8 N;  3MMV A;  1VRU A;  3IG1 A;  2OZS A;  3GG4 A;  4FM0 A;  4BY9 C;  4HWI A;  4A61 A;  3C95 A;  3DLH A;  4H4M A;  4JRP A;  1X9J A;  4I2Q A;  4CFD A;  4E7I A;  1NGH A;  3VTI A;  3OVN A;  1T3V A;  3VN5 A;  3HST B;  4DSI A;  2YKN A;  4WQ4 C;  4BC5 A;  4CVN E;  4JKF A;  3RMA A;  3O4Q A;  4DR4 K;  1NGI A;  3THV A;  3UKU A;  5FPE A;  2P9P A;  5FPD A;  3CJ1 A;  3K9K A;  1S6P A;  3QIP A;  3LAM A;  3DOK A;  3SLC A;  5M1P A;  1X9W A;  2YNG A;  4BE1 A;  3ALY A;  4DR1 K;  4DSE A;  3ZEU B;  2PBD A;  1QSS A;  1HKG A;  1YAG A;  1LAV A;  3TPQ A;  4CF0 A;  4LF6 K;  1JL1 A;  4ISF A;  2ZQB A;  3M8S A;  2AJQ A;  3KLI A;  1KAZ A;  3WQT A;  1WAF A;  3L2W A;  1ITG A;  4M42 A;  5EVZ A;  2O8B B;  2HHV A;  4GNI A;  2B6A A;  4FJ7 A;  4Z0U A;  1C1B A;  4BR0 A;  4EP5 A;  3NF8 A;  1BIZ A;  1JLE A;  3THY B;  5FDL A;  3M8R A;  2Q36 A;  3SBT A;  3NFA A;  4DFM A;  1IKY A;  1RTI A;  3I33 A;  4BDP A;  3ATV A;  4H5V A;  4H5W A;  1NGJ A;  3IAY A;  1NJI O;  1QQC A;  3EKS A;  4HUE A;  3WNH A;  4FJH A;  1C1C A;  2PZS A;  3H3N O;  4CZG A;  3NAE A;  4F3O A;  3S9H A;  1VQP N;  4B9S A;  1NGE A;  4BG8 A;  4DSL A;  4LF8 K;  5GIO A;  3V9Z A;  2ATQ A;  3ZX2 A;  4M3X A;  3SAH A;  3DOL A;  1JJ2 M;  3CD6 N;  4H0T B;  2ASP A;  3LWL A;  1RT6 A;  1YHQ N;  3THX A;  1HNZ K;  3CFP A;  1RBS A;  1SL0 A;  3CC4 N;  1KFS A;  2WOM A;  1V4S A;  1QVF M;  5AQK A;  4B8C A;  1HNW K;  3L0Q A;  4DLE A;  1K8K A;  3LAN A;  4KB0 A;  3CJB A;  4CFB A;  1MDU B;  1WUA A;  4G1Q A;  4DS5 A;  3EZW A;  3VEZ A;  3RSE B;  3CJA A;  4A62 A;  4FLZ A;  1HLU A;  3C7N B;  2D4W A;  2HHS A;  1WSF A;  4WQ5 C;  4AF1 A;  3THW B;  3HJF A;  4AHU A;  1JXB A;  1QS4 A;  3MDQ A;  4B1V A;  5H1S Q;  1VAZ A;  1KSP A;  4DSF A;  2OPR A;  3CM6 A;  4LY7 A;  4CED A;  3VEN A;  3TR8 A;  2KFZ A;  1TK5 A;  3ATU A;  4MDA A;  1SL1 A;  3RRG A;  2Z1G A;  3AA3 A;  3F5T A;  1D5A A;  5TKY A;  3AVJ A;  4YDU A;  1JLQ A;  4FXD A;  3C65 A;  4IJN A;  1SL2 A;  3D0P A;  3FR0 A;  4M3T A;  4QS7 A;  1VSJ A;  2KZZ A;  1E4G T;  4BRA A;  4OLB A;  2A1R A;  2GV9 A;  3ULE A;  3L2V A;  3ZSZ A;  3ID6 A;  2GUP A;  1I94 K;  3DAW A;  3JSM A;  2WTU A;  3AV9 A;  1B9D A;  4JKG B;  4O5B A;  5KI6 A;  2E2N A;  1HNI A;  2NRH A;  3E66 A;  1MA9 B;  2QXL A;  2V7Z A;  4AM7 A;  2IAJ A;  1NK5 A;  1VQL N;  3KD1 E;  1HQU A;  5KPR A;  4FLT A;  4Z4E A;  4OX9 K;  3LPU A;  1TKX A;  2QWR A;  2RF2 A;  2YHB A;  1IV0 A;  2VG7 A;  1QTM A;  1JLF A;  4B1U B;  3C94 A;  1TV6 A;  2P5O A;  3VER A;  1Q81 O;  4CGG A;  4BC3 A;  4IWV A;  4BWM A;  4XH1 A;  1NM1 A;  4E19 A;  3D45 A;  4J8F A;  4K8X A;  4CGH A;  5M1K A;  1U4B A;  4DLG A;  5HLF A;  4CE9 A;  1TAU A;  4RG8 A;  4ISG A;  3L2U A;  3VTH A;  2X6S A;  4H5R A;  3H6E A;  1EKE A;  5M1F A;  1TVR A;  3CXC M;  1KLN A;  5C0Y A;  4CER A;  4DV4 K;  5GAH P;  2B4J A;  3FZK A;  3QFU A;  3MXJ A;  3QIN A;  1RDA A;  3EKU A;  4FM1 A;  2BGG A;  5I3U A;  4I9L A;  4O8K A;  1H1V A;  3U3Y A;  4JI2 K;  3HXM A;  3PIO L;  4LF5 K;  3L2Q A;  3MEG A;  2D1K A;  2O8D A;  4Y1C A;  4K25 A;  3CIP A;  3M3Z A;  2O8E B;  1RT4 A;  2A42 A;  3FZL A;  3QNN A;  1JCE A;  3U8X A;  2P9N A;  4KI6 A;  1J6Z A;  4JI6 K;  4BRO A;  3SAG A;  4EP4 A;  4B3R K;  1IBK K;  2IOC A;  4B9M A;  1W97 L;  4B8A B;  3VMF B;  3HM8 A;  3ZET A;  3OYI A;  3VPZ A;  1C0U A;  3LDS A;  4XH4 A;  4JKD A;  4M45 A;  5CHI A;  1CZA N;  3EY1 A;  3I56 N;  2A5X A;  4W5T A;  4CZJ A;  3D7E O;  5EXW A;  3TSQ A;  3VQD A;  2ASM A;  5FPN A;  1ATS A;  2GEL A;  1B92 A;  1FW6 A;  4QOZ B;  1RBR A;  4JV5 K;  4E1N A;  1IG9 A;  1I39 A;  3VQ4 A;  4CJU A;  4AQY K;  1NGA A;  2RHK A;  2AP1 A;  3QEV A;  3S3O A;  3BGR A;  3VEV A;  4BRG A;  1GLJ O;  2WBN A;  1CXU A;  4DQQ A;  4YOW A;  1ZC6 A;  3AO3 A;  3MX2 A;  4CD1 A;  1SKW A;  4DUZ K;  2DFF A;  4JI8 K;  5JLF A;  1UWB A;  4KTQ A;  3AAP A;  4UQG A;  2Q97 A;  1WLJ A;  1U45 A;  4HUG A;  3CG7 A;  5E26 A;  1HNX K;  3A5L C;  4CJR A;  3AO5 A;  2ZGY A;  3KIO A;  4JKC A;  3OS0 A;  2QWL A;  1K8K B;  4O55 A;  1VSL A;  2P9I A;  4JI1 K;  1O1W A;  4AIL C;  1FJG K;  4FCY A;  3ZSW A;  5KQ8 A;  3CC2 N;  1NGC A;  3K0S A;  3OTO K;  5J2M A;  4L3Q A;  4B9T A;  2YI1 A;  3HSC A;  3O4N A;  4DV2 K;  3OS2 A;  4RCH A;  2HHQ A;  2EHG A;  1QQO A;  3TTD A;  2GBZ A;  3D2F B;  3P38 A;  3QIO A;  5AQP A; 
#chains in the Genus database with same CATH homology
 4CW7 B;  1XNQ K;  2E5L K;  5A2Q O;  4K0K K;  5LMN K;  1J5E K;  4DV6 K;  4JI6 K;  4JI7 K;  4DR1 K;  4NXN K;  4B3R K;  4NXM K;  1IBK K;  1IBL K;  3J7A P;  3J80 O;  4JI4 K;  4X62 K;  4X65 K;  4YY3 K;  4DV5 K;  2ZM6 K;  4LF6 K;  2UU9 K;  4DR3 K;  1N34 K;  3J7Y P;  4X64 K;  4LFA K;  4LF7 K;  2F4V K;  1I94 K;  1HR0 K;  4B3T K;  4GKJ K;  1XMQ K;  1XMO K;  2UUB K;  4JV5 K;  5AJ3 K;  4OX9 K;  2UUA K;  4AQY K;  4DR6 K;  4DR2 K;  1IBM K;  4KHP K;  4X66 K;  3JAM O;  4JI3 K;  4LFB K;  3J81 O;  4DUY K;  4LFC K;  2VQF K;  3T1Y K;  4GKK K;  4JYA K;  4LF9 K;  4DV3 K;  4LF8 K;  2UXD K;  1N36 K;  5IT9 O;  4DUZ K;  4LF4 K;  4DV0 K;  5LL6 Z;  4DR5 K;  2VQE K;  1N33 K;  4JI8 K;  5IWA K;  1HNZ K;  2UXC K;  4B3S K;  4DR7 K;  5FLX O;  1N32 K;  1XNR K;  1HNX K;  4DV4 K;  1HNW K;  3T1H K;  5BR8 K;  4JI0 K;  2UXB K;  4YHH K;  5LMU K;  4V19 S;  4JI1 K;  4JI5 K;  1FJG K;  2UUC K;  2HHH K;  4JI2 K;  4DV1 K;  3OTO K;  4LF5 K;  4CVN E;  4DV2 K;  4DV7 K;  4DR4 K;  4B3M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...