4DV6K

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 30
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4dv6K00
4CVNE 4LF9K 2UXBK 5IWAK 4GKKK 1XNQK 4DV5K 1XMQK 2UUBK 4LF6K 4K0KK 2HHHK 4JI8K 4DR6K 4YHHK 4JI1K 1IBKK 4DR5K 4DV4K 2ZM6K 4DV0K 4B3SK 4JI4K 4JI7K 4LF8K 1HNXK 5FLXO 5LL6Z 3J80O 2UXDK 4JI5K 3OTOK 4LFAK 4LFCK 2F4VK 1J5EK 4B3MK 1IBLK 1IBMK 4KHPK 5BR8K 4DV1K 5IT9O 4YY3K 1HNWK 3J7AP 4LF7K 4X65K 4V19S 1I94K 4JI6K 2UUCK 2VQFK 4DV7K 4DUYK 4DR7K 4DR3K 4CW7B 1HR0K 4LF5K 4DV3K 1XMOK 1XNRK 1HNZK 3JAMO 4OX9K 4JV5K 4GKJK 4JI2K 4NXMK 2VQEK 4DV6K 2UUAK 4JYAK 3J81O 4B3RK 4DV2K 4NXNK 2UXCK 4DR4K 1N32K 4LFBK 4JI3K 5LMUK 4X66K 1N34K 4X62K 2UU9K 1FJGK 4LF4K 5LMNK 2E5LK 5A2QO 4DUZK 4DR2K 1N36K 4X64K 4AQYK 3J7YP 3T1HK 4DR1K 3T1YK 5AJ3K 4B3TK 4JI0K 1N33K
chains in the Genus database with same CATH superfamily
1NJIO 4BACA 3HVRA 2I5JA 2ZWHA 1HNVA 2QWPA 4WQ4C 4KAZA 4HUFA 1ZBIA 3HPGA 1NWKA 3NF6A 4RW4A 3DLEA 1S6QA 2A6AA 1VQ6N 5K14A 4WQ4A 1X1PA 3QERA 1BOTO 2GUIA 1KAYA 4KO0A 3OW2M 1OKJA 3EO3A 1F21A 3OBYA 4NYNA 4Q0BA 2IC3A 2NRZA 2FBXA 1HNXK 3AAQA 3DXKA 5AZJA 3BDPA 3KD5E 2GELA 3E01A 4N41A 1L5UA 4FJ9A 3LM2A 1VQ9N 3OYKA 3KLIA 4DSKA 3LPTA 1BIZA 2ZJPL 1BA0A 3VTIA 3O9TA 2Q0RA 3O1BA 4QS7A 3VQ8A 4CIFA 3NF8A 1XUPO 4RW9A 4ILJA 3H1VX 4BE2A 2UYTA 1MU2A 3AVIA 5F1XA 4DQPA 3R3LA 1CLQA 2LSNA 2NZTA 2ZGYA 5CZ2A 2FF6A 3CQ8A 2CGLA 2E1YA 4H8KA 3O4WA 4E7HA 4U7BA 3O9UA 2CH6A 4FZYA 4B1WB 3TSPA 2WTUA 1XMOK 2GTDA 2P9UA 5DM7L 1Q18A 3A5MC 3THWA 2F7TA 4LY7A 3VQPA 4DU4A 4OKKA 4OX9K 1U49A 3ZETA 4H5WA 4BR2A 3DLRA 1HJOA 5GAGP 3PLAA 1QSYA 1K9MO 1SL0A 3N4PA 1VSJA 2XY5A 4F3TA 4DTSA 1YUWA 2VG6A 1GLCG 1NKCA 4JK9A 3MCPA 2GUPA 2D0PA 3VETA 5BRHA 3VQBA 2UU9K 1RFQA 4XEIA 3D2EA 4KTQA 3LP2A 5AR0A 4OO1J 4FM2A 5JS2A 3PX0A 1RGIA 3WXMB 4H0PA 1YTAA 3NH2A 3A8YA 1LCUA 4DR1K 4FJLA 3RRHA 4JRPA 2PAVA 4JI0K 3ID8A 1ZBFA 3C6HA 4BY9C 4CVNE 1HMVA 4BC3A 4EZ9A 1XNQK 4CEDA 3SJJA 5GIPA 3OYAA 1Q82O 4B1YB 3VEYA 5AQUA 4WFBL 3P31A 3ZEUB 3SJHA 2X6SA 4IO8A 3TARA 4EZ6A 2O8CB 3CJ9A 1KVAA 1U2VA 3HO1A 2GV9A 1EO1A 3RMDA 5J2MA 4OPKA 4PKGA 2FBTA 2VG7A 3CETA 2O8FB 3QMLA 4PQUA 4HUEA 3K5OA 5AQXA 3QBWA 3QEWA 2OCEA 3TANA 1VK0A 1IG8A 3J7AP 1C0UA 3IAYA 2OA8A 4RW7A 3KK3A 1KVCA 4DUYK 4DR3K 1FXXA 4OPJA 5BRDA 3CHWA 1NK5A 1VQKN 3AVMA 2QKBA 4H0TB 4RW6A 2OPPA 1BWFO 4FJ7A 3EL2A 1ASVA 3WQTA 1EKEA 1VRTA 4H5TA 5JMVA 3KWGA 4ZTJA 3NFAA 3FZLA 2YKNA 3SAGA 3OYBA 4KBOA 1EWRA 4BDPA 5AZIB 1SV5A 2KKZA 4FWPA 4AILC 5AQOA 3QEIA 4ID5A 3R8EA 4X62K 3BEXA 1NKBA 5LY3A 2FXUA 4DQIA 1BI4A 2P9SA 2YV0X 1GLJO 4E3SA 4BWMA 4AHSA 5C0YA 2Q2RA 3UIQA 3T1YK 1D4XA 4PKIA 1X9WA 4JS4A 4E7JA 4W5NA 1NKEA 1X9MA 3M6GA 1YVNA 3D45A 2ITGA 3O9RA 3WXIA 1QQNA 4YOUA 4CK1A 3OYFA 4DS5A 3HI0A 2J4RA 4LF6K 3LDPA 4KREA 2Q31A 2YNGA 2DPNA 1WSEA 4JI1K 4Z94A 5EX5A 4I6MA 1KAXA 4JKAA 3M8SA 4DR5K 4FXDA 1D5AA 4CZMA 4L8RB 1OH7A 1LW0A 2WOMA 3JYTA 2AA4A 3AA2A 4R5PA 3MN9A 1LAWA 2A5XA 3JS6A 3KIOA 3HM9A 1HPMA 3LZIA 3L2QA 4CIEA 4J2EA 3E9PA 3MXIA 3V4IA 4RW8A 3J80O 4CJ4A 3OVNA 1NM1A 4BDYA 3AVHA 1DT9A 2P9NB 4MO4A 1REVA 2B4JA 3NH0A 2O4GA 1DTTA 1IKWA 5EXWA 1HJRA 1BGXT 2OPSA 1IBMK 2VGNA 3IMXA 4JKDA 4OGCA 2ASMA 4DV1K 5IT9O 4YY3K 4NYFA 3AARA 3AVAA 3P83D 1ASWA 4KHQA 5AQHA 1D9DA 3QFPA 3G71N 1WUAA 3FFKB 5AQSA 3ULEA 3H3OB 3THXA 2EWSA 1TUYA 3AY9A 4KH6A 2HF3A 1RNHA 4O8UA 2G8VA 4FWLA 5TKYA 4J8FA 4KI6A 3SAHA 3P1GA 4JN4A 3ZSXA 4UY8O 3G25A 3ISNC 1V4TA 3VQDA 1S9EA 3ZSQA 3EKSA 2KFNA 1HRHA 2ZJQL 4DR4K 4CZHA 5AQJA 4IEIA 1NGFA 4CF9A 3DM2A 5LMUK 3V1RA 1YT3A 2Z1GA 1VQON 3HP9A 3ATUA 3I0RA 3K9KA 4KHSA 2XRIA 5F0XA 3VA0A 1W97L 2GBZA 2XY7A 3CXCM 1S72N 3AVNA 3THYA 4DCHA 4B9LA 3HOSA 1Q9XA 1ZBSA 4AQYK 1EP4A 3SV4A 3PX4A 4JKFA 4FK0A 5C24A 4DQSA 3LL3A 5AQNA 2Z1HA 3CJ7A 3C6TA 1K8KB 1NG9A 5AQKA 4BR7A 4U67L 1KD1O 3CMEN 4CJ3A 4DR6K 4FCYA 4E7IA 1HKBA 4CGHA 4CJRA 4B3SK 3QIPA 4XH1A 1RBTA 4CFBA 4MDAA 4ILGB 5HRNA 2YNFA 4HWIA 1JL1A 4BQLA 1UA1A 3G6EN 5AQMA 1SL1A 4B9QA 4YOXA 4L3QA 1NGCA 4IEEA 2A42A 4M3TA 4CJPA 1C0GA 4DTUA 5LJWA 4OKEA 2YHYA 3FLCO 3WNHA 2NNWA 3VQEA 1C1CA 3OJSA 4CJ5A 4BRLA 4BR4A 4OGEA 3AGRA 3MMVA 3O3FA 3FFIA 4BVPA 3QNOA 1JCGA 4CJEA 2P9IB 3DXMB 5M1FA 1ASUA 1VSLA 1U4BA 2O8EA 3C0BA 3AA5X 2DFHA 3SNNA 2X6NA 4F8RA 1YF5L 3M8PA 2X74A 5M1PA 1KLMA 3CC2N 5KRSA 3CPEA 4KI4A 2VG5A 3GOIA 4CZFA 4ISEA 5GADP 4B3RK 3KWIA 1DTQA 1HLUA 1L3TA 4KHUA 2V52B 2E88A 4A2AA 1FKOA 3CJBA 4DFJA 4E1JA 4NCGA 1YTUA 3TI0A 2Z1IA 4K43A 3ZT3A 3Q7CA 4I2PA 4DUZK 3TABA 2G8WA 3ZSWA 1UAXA 2B6AA 3MCAB 4FJMA 3LWMA 4DKWA 4RG8A 2QI2A 2RF2A 4IO9L 1TGOA 4AM7A 1N33K 3SUNA 2E6MA 4QS8A 5GINA 5BN9A 5CZ1A 5J1EA 3NAEA 3K5MA 4LF9K 3QBXA 1KQSM 5C42A 3EZ5A 1Q8IA 4DV5K 3THVA 3B6OA 3S3MA 4W5OA 3OY9A 3SUPA 3MN6A 3MXJA 4IG0A 2ZD1A 1VQ4N 4LF8K 3ALYA 4WE1A 4DSIA 1TYQB 2HOEA 5J2QA 4O5BA 1FKPA 3KZBA 4KHWA 4WF9L 1GLLO 4JAXA 3WEEA 3V9UA 3RSEB 4JS5A 2QWRA 2HW3A 2IVOA 3LDLA 1XHXA 4K41A 3ZX3A 4LFCK 1N5YA 1WLJA 4B3MK 4EHUA 4ELTA 2ZE2A 1TV6A 2W40A 1NK7A 1S9GA 4K25A 3UKUB 3P39A 3CMAN 1NGHA 4X65K 5AQVA 3HT3A 4FK4A 4M7XA 4JI6K 1QHAA 4YFUA 4PL7A 4M45A 2A1SA 2Q3SA 4H0OA 1T03A 4CK2A 4CZKA 2BANA 4W5RA 3I56N 4FWRA 4FPAA 1VSEA 2VWKA 3CCUN 4Z4CA 4CJSA 2NLXA 4Z4GA 2E1ZA 4AF1A 3RTVA 4FLTA 3MWPA 3ITHA 5AQPA 3NH1A 3S9HA 1RILA 4DTJA 2WBNA 3T19A 3VQ7A 1HKGA 1LW2A 4JK7A 3CCEN 3FZMA 1V4SA 5AFUA 4B9TA 5J2PA 5A2QO 2QXFA 3AVGA 4AHUA 1D9FA 3NMUA 3TTDA 4YOYA 3QESA 2D0AA 3U9ZA 4OPAA 2QEXN 5FPDA 1N36K 3C7NB 5AQYA 3TAQA 3J7YP 2PBDA 3ENHA 2JLEA 1H1VA 1BO5O 4XH4A 4IFEA 4FJIA 4AHCA 2WC9A 3L6QA 4IZ9A 4C8MA 3ZSOA 3WXJA 1ZBUA 4WFNL 3UKRB 4C8OA 3G0ZA 1XQSC 4KRFA 4JI8K 4NO7A 3BGRA 2RE2A 1HQEA 4DV4K 2EHGA 1M90O 4JI4K 1LWCA 3O4NA 5KQ8A 4LSLA 4NLCA 4H5NA 3E9OA 2NRRA 2QWQA 4BE0A 3CJCA 3MXMA 4FJNA 2FSJA 3ZSVA 1SKWA 1EETA 3H6EA 2P9LA 2B5JA 3SAFA 3ZLJA 4HVJA 3OTOK 3DMJA 2E20A 3MWTA 2IIRA 5BPNA 2RN2A 5BR8K 4CBXA 4GW6A 4CHZA 1MWMA 1NGEA 4JRQA 3M3ZA 1TUUA 4GNIA 1RDCA 4FPBA 1I94K 2OTJN 1SS6A 3CCMN 3RMCA 3KLEA 4O8KA 3K57A 3PUFA 2VGMA 4BRNA 3DLBA 4DU1A 3PY8A 1JLQA 5EVZA 3HSTB 3AO5A 2GWKA 3OYIA 4E89A 3S3NA 3SI6A 3U8XA 3AVKA 3HVTA 4Z4IA 4BROA 3O9QA 5BREA 4IOCL 3R9PA 4B3OA 1TVRA 4KB1A 1BQMA 3A5LC 3T1AA 1FJGK 3EN9A 4PUOA 4CESA 1Q9YA 5KPRA 3M1FA 5KRTA 4F4KA 2AJQA 5JLHA 1S3XA 2G8KA 1IKYA 3ZYYX 4FJ8A 4AHVA 1ILYA 4JHDA 1WAJA 4A59A 4K42A 1CZ9A 5AQTA 1NU0A 4DF4A 3LANA 5ADXA 3BUZB 2IGIA 4DTXA 1J9AA 4LH4A 3O5BA 3V9XA 2QM1A 4NCBA 2HNZA 1C0TA 1LWFA 3OA9A 4BREA 2HNYA 1HKCA 3TAPA 3TTFA 2IVPA 4CZJA 3L2UA 3AVFA 4JKGA 3QEXA 3EZWA 1QVFM 3FR0A 4CBWA 2P5GA 3L0QA 5AQGA 2X78A 4JD2A 3QEVA 2D0CA 1KAZA 4EAHD 1YAGA 4G1QA 5FLXO 4LD0A 1WN7A 4HCBA 3ZT1A 3QEPA 2OYQA 4LFAK 1RT7A 3ZT4A 2WUSA 4RWTA 1K6YA 1VSDA 2R7YA 2RHKA 1L3UA 1JKHA 1VQMN 2O8DB 1JL2A 1TKZA 2E2NA 3DAWA 3W0LA 1KSPA 3QB0A 4WYBA 3BZCA 5BPLA 2HMPA 3HP6A 1ZBLA 1D8YA 4FJJA 1RT1A 4CEQA 3VQ9A 5D3GA 4FM1A 4IDKA 3SQ4A 3FE1A 3CCLN 1GOAA 3LM9A 1HNZK 2Y1JA 2P9KB 3HSCA 1GOCA 3VOVA 3VESA 4A62A 4O4GA 3TR8A 3ZX2A 3I0SA 1C1AA 1TL3A 2JWLA 1J5OA 3VEWA 1N32K 2HHVA 3LAMA 4JLHA 2KLAA 3F5TA 4Y1CA 3KK2A 1S1XA 1OH8A 4H4OA 3ZT2A 4CK3A 3AA3A 2OPQA 1LOTB 1HUXA 2HSTA 1CXQA 1ZXOA 3NF9A 3CI5A 2AP1A 3HPOA 3AO3A 4KH5A 4RCHA 1A5VA 3E66A 5SWMA 2KQ2A 3T3FA 4CERA 4N76A 3HZ6A 5KPTA 2VYPA 4ID1A 1KXPA 4PKHA 3JXUA 3M8QA 3LP1A 1HQUA 5CY4A 2P9PA 2HMIA 5DMRA 1NK0A 4HHTA 4B9VA 2HVIA 4CD1A 3O3HA 4RTFD 4CGIA 3P4IA 2BTFA 3BZKA 1VSKA 3C6UA 4DV0K 4F9OA 3O6WA 3I8DA 2QWNA 5AZJB 3DXKB 3O4QA 1MWKA 2IDOA 1GLAG 3DLHA 3C6AA 4DSLA 3AVJA 4XH5A 2PY5A 1YXQA 1X9JA 3EKUA 1IKVA 1KFDA 2P9IA 3GL1A 3MAQA 1QSLA 2CGKA 2Q97A 4DG1A 4R79A 1SKSA 2FLOA 1RTDA 1RBVA 3DRRA 4JNEA 1U6ZA 4B8AB 1CZBA 4BR0A 3WUHA 3GE1A 4CJKA 4LH5A 3WQUA 4CD3A 1RBRA 4IFVA 2ITMA 3AVCA 3TSQA 5E41A 1YITN 1Q7YO 2YJEA 2O4IA 1SZ2A 3CCVN 4JEPA 3CPWM 3NF7A 1VQ5N 4O0IA 2P9UB 3THWB 3RMAA 3CERA 4BWJA 3D7EO 1NJZA 4I9QA 3ZETB 3DI6A 4QS9A 3D2FA 5HRSA 1RBSA 3HL8A 4BRFA 3CQYA 3AO4A 4DQ8A 1NLVA 3L2WA 2E2PA 4FLXA 3WXKA 1QQCA 1Z26A 2NRVA 2A1RA 3VQ6A 3D2EB 2QWLA 2A40A 3Q7BA 5HROA 1UOCA 3R6MA 1W9HA 4N47A 3NDKA 1KVBA 3LP3A 4AHRA 3PIPL 1J54A 3S3OA 1Z25A 4CGGA 5AFUH 4FOIA 1LV5A 3T1HK 5AQQA 4M7YA 1IJJA 2G8UA 4CHOA 2YHBA 4BC4A 2KFZA 1U48A 2V7ZA 1VSFA 4B1ZA 1JLBA 4DHYA 3O3GA 1C1BA 4C1NK 2HNDA 3KLHA 3LP0A 3F9MA 4ISFA 5KPZA 4KB0A 1LWEA 1W2BM 1HPZA 2HBKA 2WONA 3C94A 1IBKK 4DTNA 4CEOA 2F8TA 2G8HA 3CM6A 3LALA 4FJKA 1ATNA 1U2VB 4M63C 1BCOA 3QLHA 3K0SA 4UQGA 4EIAA 2PFUA 3V1QA 1ATRA 3VF6A 4M3RA 1R0AA 2ASPA 4JKCA 4CJ7A 1HYSA 1BU6O 4IKFA 3SK3A 3MEGA 4DS4A 5BRFA 4C23A 4QOZB 1IBLK 2D5RA 4BRKA 4CE9A 4A2BA 1C6VA 3PO5A 2KZZA 3O1WA 3GG4A 1BISA 3KKSA 2O8BA 1Y64A 1EWQA 1OH6A 4CJWA 1JLFA 2UUCK 4MDBA 4OKJA 4CZLA 3DWLA 4E1MA 4CW7B 4H5RA 3VTHA 4B8CA 4CHQA 1Q86O 1NOYA 1UWBA 2ASOA 4J2AA 3JAMO 2D4WA 1ITGA 4CFCA 4GVMA 1NJXA 4DV2K 1KFSA 4JKBA 4FO0A 4BRHA 3DLLL 4DFMA 2FSKA 3QIOA 1N34K 4JK8A 2P9SB 1YJ9N 1TKXA 3DYAA 5LMNK 3SQ0A 2P5OA 4BGBA 2JWKA 5KGWA 2Z1JA 1S1WA 3SMPA 3FGUA 1P8ZA 1VQNN 1QSSA 1E3MA 4FWSA 2QW9A 3OJUA 4AM6A 3IKMA 3OYLA 1ESVA 3V9ZA 2DFFA 4BC2A 4KH4A 1NJWA 2ETJA 2V51B 3F9KA 4GKKK 3CD6N 1T05A 3SPYA 3QO9A 5ADXH 3VMFB 1BL3A 5AQLA 4CHYA 1N6QA 4I6MB 3VENA 4CJQA 4FYDA 4KFBA 2NRWA 4I2QA 4CEFA 5MLCQ 4Z4FA 4A5BA 4FW1A 3ENBA 1B92A 3NVMA 3R1XA 3OYMA 1RTJA 4CI6A 4YOTA 2CH5A 3SPZA 5I42A 3CCQN 1JCFA 4O44A 3NE6A 3AAPA 3MX2A 4C1NI 3PIOL 1WSGA 2YNIA 5GAEP 3VEXA 4E7LA 2HHSA 4EHTA 4H4MA 2Q36A 4BDZA 3L3VA 1J6ZA 1CZAN 1U45A 2PYLA 3VGKA 2W42A 3TAFA 4IJAA 3KD1E 4DV7K 2OZSA 4DR7K 2Y1IA 3ULEB 3THXB 1O13A 2QK9A 1NGDA 1TK5A 1OVYA 4C8LA 3KLFA 5AQWA 1BCMA 1VQ8N 3B8AX 3SUOA 3PV8A 2IOCA 2G8FA 1NGAA 2IS3A 1QZ5A 1JLAA 2IVNA 2GEMA 3RR8A 3CC4N 3NVKA 3VF2A 1VQLN 3IDHA 3VA3A 3IUCA 4HTUA 3MEDA 2YJFA 1GLEG 4AHTA 2PYJA 4Z0UA 4Y1DA 4F2RA 3PSIA 1R59O 1BIUA 5CYMA 4QAGA 2W6LA 2DY4A 2VCPA 5FRMA 2A41A 3MEEA 3T69A 4FLYA 3LPUA 3NGYA 2DTUA 4NCAA 4YOWA 3KTQA 4LSNA 5JVHL 4CEAA 1RTHA 2W6KA 4IWVA 3RRGA 4DQRA 5CR4A 3M8RA 4BRCA 4HTLA 2OZMA 1WB9A 1KRPA 1XMQK 3KKRA 1NGGA 1G99A 4CJVA 4PHTX 3E9LA 1KC8O 2HHUA 3ZEUA 3PSFA 1HYZA 2QA4N 2O8CA 1W0HA 4OLAA 3EE9A 5M1OA 3U3YA 2RKIA 3O8MA 4FOEA 5DM6L 3HRGA 3NBPA 3DJCA 1EX4A 4FWMA 3VEOA 2XHBA 4GV9A 2UXDK 4PL8A 1I3AA 3MN5A 1GLFO 4BG8A 2E4LA 5BN8A 1FW6A 4ILHA 4E1NA 2O8FA 4BQZA 3CFPA 5FRNA 3K2PA 4NB4A 3QNNA 1TKDA 2HVHA 1HX1A 4DU3A 1A5WA 1Y97A 2E6LA 4BC5A 1I39A 3K5LA 5AQIA 4MLEA 2V7YA 4GMJB 4FLUA 5HBMA 4CJLA 4DV3K 5EY4A 3HJFA 4WFAL 2YHAA 3L2VA 4M3ZA 2P1JA 3TAGA 4FLWA 4BRAA 4JI2K 3CF5L 5C12A 3J81O 4WCEL 5AZIA 4CBUA 4GV6A 4CFAA 5HP1A 3SYZA 5FDLA 1RDDA 4DMNA 4DR2K 4DSJA 5HRRA 1BUPA 1XHZA 2HF4A 1YJWN 1OH5A 4YNQA 2KZMA 5KGXA 1S5JA 3IRXA 3HPHA 3OBWA 4IOXA 5HRPA 3EE8A 4CF1A 4DB3A 1WSFA 2NRXA 1MDUB 1SQKA 4CEEA 3BP8A 5I9EB 1XWLA 2QTDA 2OANA 4MQ3A 3H46O 4CGDA 3KHYA 3CFOA 3VPZA 3VEZA 3D6RA 2XO7A 3HK2A 3ENOA 3ATVA 3HTVA 5M1NA 2FF3B 3KLGA 4CIGA 3WEEB 3OYEA 1RTIA 1DLOA 5J2NA 4CF2A 4JI5K 4YOVA 3JSMA 3UB5A 1J5EK 4DQQA 3ZSYA 2P9NA 2D0BA 5HLFA 3L2RA 4FJXA 5EOYA 4ELVA 3EEQA 3CC7N 3U9DA 1Q81O 3IFRA 5HOOA 3G10A 2NRTA 1QVGM 5KTQA 1M1KO 4OLBA 1QE1A 4CECA 4IBNA 4BR9A 5GIOA 1J53A 4IOAL 3MX5A 1ZBHA 2Q0UA 4O55A 3NHGA 3VQ5A 4NLBA 2ZQBA 1T6CA 3I33A 3ZSRA 3K9JA 3LAKA 4H5VA 1E4FT 4BE1A 1T3VA 2H3GX 5T7BA 3H3NO 1JXEA 2WFBA 4M3UA 5SZTA 4PWDA 4B9NA 4C8KA 1ZYQA 1QTMA 3VQQA 1DKGD 4DWIA 3TWHA 1NGIA 1IKXA 3TAEA 2BE2A 3ASMA 5E84A 3WNGA 3G4SN 3QETA 3K58A 4LC9B 4FVMA 4FZZA 2DFEA 1S6PA 3EYZA 4HCCA 1YI2N 2HBMA 1NMDA 5E26A 1K8KA 4B9UA 3V9WA 4ZHRA 4EP4A 3K5NA 1TK0A 4BG9A 3ID6A 2ZM6K 3AVBA 4FK2A 5HL7L 4GVEA 4B1VA 4OVLA 1VSHA 4KHYA 1GLBG 1RBUA 2GX9A 1VSIA 2P9LB 3N4QA 1SUQA 2ZF5O 3AA4A 3SCXA 1RT5A 4BRGA 5ELZA 1T8EA 4CCHA 3OHRA 5FROA 3HXMA 3OYNA 2KHOA 4E19A 4KHPK 4M3YA 3HBTA 3OYGA 3L3UA 1K73O 1HNWK 3TPQA 4J2DA 2YHWA 4IG3A 3FZKA 3T7ZA 3SQ1A 1NK6A 3O08A 4CHNA 4FWQA 1S1VA 1Z6RA 5CYQA 3UE5A 4KTWA 3LZJA 1CXUA 1X3MA 1TL1A 3CCRN 3DXMA 1XNRK 1OVQA 4FL9A 4CF8A 2OTLN 1S1TA 2HHXA 4JV5K 2YX6A 3QICA 4GKJK 4NXMK 4DV6K 5M1QA 4JYAK 2BH1A 1BG3A 4NXNK 1YJNN 1A5XA 1IH7A 4MFBA 4FSVA 1B9FA 4M3XA 2BGGA 4B08A 4JI3K 1WAFA 4X66K 3AO1A 4BRIA 1G15A 3BY5A 3ULDA 3RWUA 4IFYA 2GWJA 1BDGA 2E5LK 3PO4A 4FWOA 2QKKA 4JHDB 3O9SA 4KV8A 2QWOA 4C8NA 3C95A 1RCHA 1RT3A 4CEZA 3J7ZO 2YCHA 4CGJA 1RDAA 1GLDG 5C25A 4YDUC 5IWAK 3CIPA 1KLNA 4FW2A 1RT6A 1RT2A 4PA1A 1BA1A 3M5RA 4FLZA 2UUBK 4K0KK 2F9WA 3HM8A 2I7NA 1QS4A 5LJVA 1QZ6A 4JKGB 4YDUA 1EQYA 3VGMA 2VWBA 1E4GT 3NGZA 3AGKA 5EU7A 3L4IA 2E2OA 1NNEA 4PY5A 3CM5A 1DGKN 1VSMA 4JD2B 2RPIA 5CHIA 4DLEA 1TYQA 3VQAA 3SBTA 2XY6A 3OYDA 3RSEA 3H45C 2F4VK 4BVOA 3A5NC 3SQ2A 1RT4A 2HB5A 5JICA 3UKUA 1QHTA 5JVGL 3VQ4A 4WQ5C 2ATQA 4B1UB 4LF7K 1GOBA 4Y0WA 3FZHA 2G8IA 4O0JA 3NGIA 3F73A 2VQFK 2HBJA 4B9SA 5F2RA 1HNIA 3P5JA 1T6DA 4LF5K 3LDOA 4WQ5A 4DLGA 2PZSA 2D1KA 3L8BA 1B9DA 3MK6A 4W5TA 1N8RO 1DEJA 2XY8A 2F8SA 2BUPA 3CG7A 5AQRA 4M42A 2KW4A 3ZT0A 3TSUA 4CF0A 3VGLA 2YKMA 1IG9A 3LDNA 3IG1A 3KVGA 1NOZA 4GY2B 1XC9A 2IAJA 2F9TA 3SZ2A 3LDSA 1C0MA 3RR7A 4ELUA 3AO2A 2FSNA 5JLFA 1QQOA 3OYHA 3U6FA 1SL2A 1KTQA 2P51A 4X64K 3OS1A 3C7NA 3CJ1A 3DOLA 4KPYA 5AJ3K 4FJHA 3SV3A 4B3TK 4H03B 1WSHA 2P9PB 3A2FA 1SAZA 5AQZA 3NCIA 3UKRA 4DSEA 1BI4B 2HHHK 1YVUA 1BHLA 5C15A 1MA9B 1RDWX 2YNHA 1WNSA 2I7PA 2A3ZA 4E7KA 3OS0A 4A61A 4MO5A 3K59A 3W3DA 1W7AA 3VN5A 4M41A 4JI7K 2ZGZA 5AQFA 1O1WA 1X9SA 2E8AA 4ZTFA 2BDPA 1VHXA 3WXLA 1XI1A 4KKOA 4CJTA 4KTZA 1NMNA 3CJAA 1NK8A 1TKTA 1NGJA 4B1XB 4BRPA 3SMSA 3V1OA 3U4LA 1Z05A 4YORA 1JXBA 4DFKA 3DLKA 1WBBA 1T7PA 1LAVA 5B8HA 1JLCA 3SLCA 3KK7A 2EX3A 4IJNA 3EY1A 4DFPA 3I8BA 2HHWA 4M3WA 4K8ZA 1IO2A 1WSJA 1X3NA 3HYFA 3J8AA 1RDBA 2FC0A 4Q5VA 4BRMA 3D0PA 3LDQA 3I55N 3QINA 3D2FB 4BRDA 1JCEA 3TU5A 5BR9A 1EXQA 2VQEK 2UUAK 3OYCA 4CJUA 2UXCK 3DLGA 1VAZA 2QWMA 3OS2A 3QDKA 3E1YA 1NK9A 3CCSN 2VWJA 4DSFA 4LF4K 4Z4HA 3QFUA 4H0XB 4CFDA 1TAQA 3MDQA 1NBWA 4F3OA 4FVUA 2CGJA 3OYJA 4CZGA 3LWLA 5M1KA 1L3SA 2YHXA 2W41A 4OPHA 1HYVA 4CJFA 4CZIA 4EFHA 3CFRA 4FLVA 4F2SA 3WNFA 1VRUA 4ICLA 2D0OA 3V81A 4I9LA 1FK9A 4ISGA 2QXLA 3KK1A 3MN7A 4IXCA 4FJ5A 2UXBK 3VF4A 4CEBA 3U3GA 3SUQA 1YHQN 2KTQA 3CQXA 4EP5A 1VQPN 5H1SQ 1TK8A 4H0YB 1L3VA 4YHHK 3L4QA 3MECA 1C0FA 3SBGA 1S1UA 2HHQA 1KCFA 5GAHP 3THYB 4FWKA 4JKEA 3P38A 3FZFA 3IS9A 3AVLA 3GDQA 1JLEA 4MLHA 1ZC6A 4H0VB 3BF3A 3AV9A 3GBTA 2OPRA 1JJ2M 2NUBA 5LL6Z 4A5AA 2JGUA 3CYMA 4FZXC 4DTMA 4J2BA 5BPMA 3PX6A 3WT0A 3V9SA 4W5QA 4B9MA 4N56A 4K8XA 5C2DA 5FPMA 4DTRA 5C2FA 2E2QA 3ZX0A 3S41A 4O5FA 1P90A 4CGFA 2O8BB 1BQNA 4DTOA 4Z4EA 1WSIA 1XC3A 4QCLA 3KJVA 2O8DA 1ATSA 1VQ7N 4V19S 3ZCMA 5FPEA 5TKWA 1NJYA 5JS1A 1HR0K 3RMBA 4A57A 5C10A 4CZEA 3CCJN 1YIJN 2HBLA 1WOQA 3H1QA 3V6DA 1U04A 1NGBA 3BF1A 4IDHA 3A0IX 2F96A 1TAUA 3ZSZA 3DRPA 3DRSA 4FM0A 3H08A 2ZJRL 4JKHA 1RDUA 2Q1NA 3F2KA 2P9KA 4XIUA 2HHTA 1WBDA 2YI1A 5KQDA 3TAMA 5CE3A 4BRQA 1QQMA 4BGAA 4GV3A 5FPNA 4DF8A 4LFBK 1K8AO 4I7FA 1SKRA 3C65A 1S22A 4DTPA 3O80A 4FJGA 3RVCA 1U47A 4BR5A 4FWNA 5DK5A 4HUGA 3DOKA 4N5SA 2O8EB 3TTCA 4KHNA 3VQCA 2FBVA 3WNEA 4G9ZA 4CHPA 1UA0A 4TSXA 3VEVA 2FBYA 1T44A 3VERA 1JLGA 1NK4A 2NRHA 3A5OC 1IV0A 5I3UA 3B6PA 4AH9A 4OJRA 5KI6A 3HOTA 4E0DA
chains in the Genus database with same CATH topology
4CVNE 4LF9K 2UXBK 5IWAK 4GKKK 1XNQK 4DV5K 1XMQK 2UUBK 4LF6K 4K0KK 2HHHK 4JI8K 4DR6K 4YHHK 4JI1K 1IBKK 4DR5K 4DV4K 2ZM6K 4DV0K 4B3SK 4JI4K 4JI7K 4LF8K 1HNXK 5FLXO 5LL6Z 3J80O 2UXDK 4JI5K 3OTOK 4LFAK 4LFCK 2F4VK 1J5EK 4B3MK 1IBLK 1IBMK 4KHPK 5BR8K 4DV1K 5IT9O 4YY3K 1HNWK 3J7AP 4LF7K 4X65K 4V19S 1I94K 4JI6K 2UUCK 2VQFK 4DV7K 4DUYK 4DR7K 4DR3K 4CW7B 1HR0K 4LF5K 4DV3K 1XMOK 1XNRK 1HNZK 3JAMO 4OX9K 4JV5K 4GKJK 4JI2K 4NXMK 2VQEK 4DV6K 2UUAK 4JYAK 3J81O 4B3RK 4DV2K 4NXNK 2UXCK 4DR4K 1N32K 4LFBK 4JI3K 5LMUK 4X66K 1N34K 4X62K 2UU9K 1FJGK 4LF4K 5LMNK 2E5LK 5A2QO 4DUZK 4DR2K 1N36K 4X64K 4AQYK 3J7YP 3T1HK 4DR1K 3T1YK 5AJ3K 4B3TK 4JI0K 1N33K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CVN E;  4LF9 K;  2UXB K;  5IWA K;  4GKK K;  1XNQ K;  4DV5 K;  1XMQ K;  2UUB K;  4LF6 K;  4K0K K;  2HHH K;  4JI8 K;  4DR6 K;  4YHH K;  4JI1 K;  1IBK K;  4DR5 K;  4DV4 K;  2ZM6 K;  4DV0 K;  4B3S K;  4JI4 K;  4JI7 K;  4LF8 K;  1HNX K;  5FLX O;  5LL6 Z;  3J80 O;  2UXD K;  4JI5 K;  3OTO K;  4LFA K;  4LFC K;  2F4V K;  1J5E K;  4B3M K;  1IBL K;  1IBM K;  4KHP K;  5BR8 K;  4DV1 K;  5IT9 O;  4YY3 K;  1HNW K;  3J7A P;  4LF7 K;  4X65 K;  4V19 S;  1I94 K;  4JI6 K;  2UUC K;  2VQF K;  4DV7 K;  4DUY K;  4DR7 K;  4DR3 K;  4CW7 B;  1HR0 K;  4LF5 K;  4DV3 K;  1XMO K;  1XNR K;  1HNZ K;  3JAM O;  4OX9 K;  4JV5 K;  4GKJ K;  4JI2 K;  4NXM K;  2VQE K;  4DV6 K;  2UUA K;  4JYA K;  3J81 O;  4B3R K;  4DV2 K;  4NXN K;  2UXC K;  4DR4 K;  1N32 K;  4LFB K;  4JI3 K;  5LMU K;  4X66 K;  1N34 K;  4X62 K;  2UU9 K;  1FJG K;  4LF4 K;  5LMN K;  2E5L K;  5A2Q O;  4DUZ K;  4DR2 K;  1N36 K;  4X64 K;  4AQY K;  3J7Y P;  3T1H K;  4DR1 K;  3T1Y K;  5AJ3 K;  4B3T K;  4JI0 K;  1N33 K; 
#chains in the Genus database with same CATH topology
 1NJI O;  4BAC A;  3HVR A;  2I5J A;  2ZWH A;  1HNV A;  2QWP A;  4WQ4 C;  4KAZ A;  4HUF A;  1ZBI A;  3HPG A;  1NWK A;  3NF6 A;  4RW4 A;  3DLE A;  1S6Q A;  2A6A A;  1VQ6 N;  5K14 A;  4WQ4 A;  1X1P A;  3QER A;  1BOT O;  2GUI A;  1KAY A;  4KO0 A;  3OW2 M;  1OKJ A;  3EO3 A;  1F21 A;  3OBY A;  4NYN A;  4Q0B A;  2IC3 A;  2NRZ A;  2FBX A;  1HNX K;  3AAQ A;  3DXK A;  5AZJ A;  3BDP A;  3KD5 E;  2GEL A;  3E01 A;  4N41 A;  1L5U A;  4FJ9 A;  3LM2 A;  1VQ9 N;  3OYK A;  3KLI A;  4DSK A;  3LPT A;  1BIZ A;  2ZJP L;  1BA0 A;  3VTI A;  3O9T A;  2Q0R A;  3O1B A;  4QS7 A;  3VQ8 A;  4CIF A;  3NF8 A;  1XUP O;  4RW9 A;  4ILJ A;  3H1V X;  4BE2 A;  2UYT A;  1MU2 A;  3AVI A;  5F1X A;  4DQP A;  3R3L A;  1CLQ A;  2LSN A;  2NZT A;  2ZGY A;  5CZ2 A;  2FF6 A;  3CQ8 A;  2CGL A;  2E1Y A;  4H8K A;  3O4W A;  4E7H A;  4U7B A;  3O9U A;  2CH6 A;  4FZY A;  4B1W B;  3TSP A;  2WTU A;  1XMO K;  2GTD A;  2P9U A;  5DM7 L;  1Q18 A;  3A5M C;  3THW A;  2F7T A;  4LY7 A;  3VQP A;  4DU4 A;  4OKK A;  4OX9 K;  1U49 A;  3ZET A;  4H5W A;  4BR2 A;  3DLR A;  1HJO A;  5GAG P;  3PLA A;  1QSY A;  1K9M O;  1SL0 A;  3N4P A;  1VSJ A;  2XY5 A;  4F3T A;  4DTS A;  1YUW A;  2VG6 A;  1GLC G;  1NKC A;  4JK9 A;  3MCP A;  2GUP A;  2D0P A;  3VET A;  5BRH A;  3VQB A;  2UU9 K;  1RFQ A;  4XEI A;  3D2E A;  4KTQ A;  3LP2 A;  5AR0 A;  4OO1 J;  4FM2 A;  5JS2 A;  3PX0 A;  1RGI A;  3WXM B;  4H0P A;  1YTA A;  3NH2 A;  3A8Y A;  1LCU A;  4DR1 K;  4FJL A;  3RRH A;  4JRP A;  2PAV A;  4JI0 K;  3ID8 A;  1ZBF A;  3C6H A;  4BY9 C;  4CVN E;  1HMV A;  4BC3 A;  4EZ9 A;  1XNQ K;  4CED A;  3SJJ A;  5GIP A;  3OYA A;  1Q82 O;  4B1Y B;  3VEY A;  5AQU A;  4WFB L;  3P31 A;  3ZEU B;  3SJH A;  2X6S A;  4IO8 A;  3TAR A;  4EZ6 A;  2O8C B;  3CJ9 A;  1KVA A;  1U2V A;  3HO1 A;  2GV9 A;  1EO1 A;  3RMD A;  5J2M A;  4OPK A;  4PKG A;  2FBT A;  2VG7 A;  3CET A;  2O8F B;  3QML A;  4PQU A;  4HUE A;  3K5O A;  5AQX A;  3QBW A;  3QEW A;  2OCE A;  3TAN A;  1VK0 A;  1IG8 A;  3J7A P;  1C0U A;  3IAY A;  2OA8 A;  4RW7 A;  3KK3 A;  1KVC A;  4DUY K;  4DR3 K;  1FXX A;  4OPJ A;  5BRD A;  3CHW A;  1NK5 A;  1VQK N;  3AVM A;  2QKB A;  4H0T B;  4RW6 A;  2OPP A;  1BWF O;  4FJ7 A;  3EL2 A;  1ASV A;  3WQT A;  1EKE A;  1VRT A;  4H5T A;  5JMV A;  3KWG A;  4ZTJ A;  3NFA A;  3FZL A;  2YKN A;  3SAG A;  3OYB A;  4KBO A;  1EWR A;  4BDP A;  5AZI B;  1SV5 A;  2KKZ A;  4FWP A;  4AIL C;  5AQO A;  3QEI A;  4ID5 A;  3R8E A;  4X62 K;  3BEX A;  1NKB A;  5LY3 A;  2FXU A;  4DQI A;  1BI4 A;  2P9S A;  2YV0 X;  1GLJ O;  4E3S A;  4BWM A;  4AHS A;  5C0Y A;  2Q2R A;  3UIQ A;  3T1Y K;  1D4X A;  4PKI A;  1X9W A;  4JS4 A;  4E7J A;  4W5N A;  1NKE A;  1X9M A;  3M6G A;  1YVN A;  3D45 A;  2ITG A;  3O9R A;  3WXI A;  1QQN A;  4YOU A;  4CK1 A;  3OYF A;  4DS5 A;  3HI0 A;  2J4R A;  4LF6 K;  3LDP A;  4KRE A;  2Q31 A;  2YNG A;  2DPN A;  1WSE A;  4JI1 K;  4Z94 A;  5EX5 A;  4I6M A;  1KAX A;  4JKA A;  3M8S A;  4DR5 K;  4FXD A;  1D5A A;  4CZM A;  4L8R B;  1OH7 A;  1LW0 A;  2WOM A;  3JYT A;  2AA4 A;  3AA2 A;  4R5P A;  3MN9 A;  1LAW A;  2A5X A;  3JS6 A;  3KIO A;  3HM9 A;  1HPM A;  3LZI A;  3L2Q A;  4CIE A;  4J2E A;  3E9P A;  3MXI A;  3V4I A;  4RW8 A;  3J80 O;  4CJ4 A;  3OVN A;  1NM1 A;  4BDY A;  3AVH A;  1DT9 A;  2P9N B;  4MO4 A;  1REV A;  2B4J A;  3NH0 A;  2O4G A;  1DTT A;  1IKW A;  5EXW A;  1HJR A;  1BGX T;  2OPS A;  1IBM K;  2VGN A;  3IMX A;  4JKD A;  4OGC A;  2ASM A;  4DV1 K;  5IT9 O;  4YY3 K;  4NYF A;  3AAR A;  3AVA A;  3P83 D;  1ASW A;  4KHQ A;  5AQH A;  1D9D A;  3QFP A;  3G71 N;  1WUA A;  3FFK B;  5AQS A;  3ULE A;  3H3O B;  3THX A;  2EWS A;  1TUY A;  3AY9 A;  4KH6 A;  2HF3 A;  1RNH A;  4O8U A;  2G8V A;  4FWL A;  5TKY A;  4J8F A;  4KI6 A;  3SAH A;  3P1G A;  4JN4 A;  3ZSX A;  4UY8 O;  3G25 A;  3ISN C;  1V4T A;  3VQD A;  1S9E A;  3ZSQ A;  3EKS A;  2KFN A;  1HRH A;  2ZJQ L;  4DR4 K;  4CZH A;  5AQJ A;  4IEI A;  1NGF A;  4CF9 A;  3DM2 A;  5LMU K;  3V1R A;  1YT3 A;  2Z1G A;  1VQO N;  3HP9 A;  3ATU A;  3I0R A;  3K9K A;  4KHS A;  2XRI A;  5F0X A;  3VA0 A;  1W97 L;  2GBZ A;  2XY7 A;  3CXC M;  1S72 N;  3AVN A;  3THY A;  4DCH A;  4B9L A;  3HOS A;  1Q9X A;  1ZBS A;  4AQY K;  1EP4 A;  3SV4 A;  3PX4 A;  4JKF A;  4FK0 A;  5C24 A;  4DQS A;  3LL3 A;  5AQN A;  2Z1H A;  3CJ7 A;  3C6T A;  1K8K B;  1NG9 A;  5AQK A;  4BR7 A;  4U67 L;  1KD1 O;  3CME N;  4CJ3 A;  4DR6 K;  4FCY A;  4E7I A;  1HKB A;  4CGH A;  4CJR A;  4B3S K;  3QIP A;  4XH1 A;  1RBT A;  4CFB A;  4MDA A;  4ILG B;  5HRN A;  2YNF A;  4HWI A;  1JL1 A;  4BQL A;  1UA1 A;  3G6E N;  5AQM A;  1SL1 A;  4B9Q A;  4YOX A;  4L3Q A;  1NGC A;  4IEE A;  2A42 A;  4M3T A;  4CJP A;  1C0G A;  4DTU A;  5LJW A;  4OKE A;  2YHY A;  3FLC O;  3WNH A;  2NNW A;  3VQE A;  1C1C A;  3OJS A;  4CJ5 A;  4BRL A;  4BR4 A;  4OGE A;  3AGR A;  3MMV A;  3O3F A;  3FFI A;  4BVP A;  3QNO A;  1JCG A;  4CJE A;  2P9I B;  3DXM B;  5M1F A;  1ASU A;  1VSL A;  1U4B A;  2O8E A;  3C0B A;  3AA5 X;  2DFH A;  3SNN A;  2X6N A;  4F8R A;  1YF5 L;  3M8P A;  2X74 A;  5M1P A;  1KLM A;  3CC2 N;  5KRS A;  3CPE A;  4KI4 A;  2VG5 A;  3GOI A;  4CZF A;  4ISE A;  5GAD P;  4B3R K;  3KWI A;  1DTQ A;  1HLU A;  1L3T A;  4KHU A;  2V52 B;  2E88 A;  4A2A A;  1FKO A;  3CJB A;  4DFJ A;  4E1J A;  4NCG A;  1YTU A;  3TI0 A;  2Z1I A;  4K43 A;  3ZT3 A;  3Q7C A;  4I2P A;  4DUZ K;  3TAB A;  2G8W A;  3ZSW A;  1UAX A;  2B6A A;  3MCA B;  4FJM A;  3LWM A;  4DKW A;  4RG8 A;  2QI2 A;  2RF2 A;  4IO9 L;  1TGO A;  4AM7 A;  1N33 K;  3SUN A;  2E6M A;  4QS8 A;  5GIN A;  5BN9 A;  5CZ1 A;  5J1E A;  3NAE A;  3K5M A;  4LF9 K;  3QBX A;  1KQS M;  5C42 A;  3EZ5 A;  1Q8I A;  4DV5 K;  3THV A;  3B6O A;  3S3M A;  4W5O A;  3OY9 A;  3SUP A;  3MN6 A;  3MXJ A;  4IG0 A;  2ZD1 A;  1VQ4 N;  4LF8 K;  3ALY A;  4WE1 A;  4DSI A;  1TYQ B;  2HOE A;  5J2Q A;  4O5B A;  1FKP A;  3KZB A;  4KHW A;  4WF9 L;  1GLL O;  4JAX A;  3WEE A;  3V9U A;  3RSE B;  4JS5 A;  2QWR A;  2HW3 A;  2IVO A;  3LDL A;  1XHX A;  4K41 A;  3ZX3 A;  4LFC K;  1N5Y A;  1WLJ A;  4B3M K;  4EHU A;  4ELT A;  2ZE2 A;  1TV6 A;  2W40 A;  1NK7 A;  1S9G A;  4K25 A;  3UKU B;  3P39 A;  3CMA N;  1NGH A;  4X65 K;  5AQV A;  3HT3 A;  4FK4 A;  4M7X A;  4JI6 K;  1QHA A;  4YFU A;  4PL7 A;  4M45 A;  2A1S A;  2Q3S A;  4H0O A;  1T03 A;  4CK2 A;  4CZK A;  2BAN A;  4W5R A;  3I56 N;  4FWR A;  4FPA A;  1VSE A;  2VWK A;  3CCU N;  4Z4C A;  4CJS A;  2NLX A;  4Z4G A;  2E1Z A;  4AF1 A;  3RTV A;  4FLT A;  3MWP A;  3ITH A;  5AQP A;  3NH1 A;  3S9H A;  1RIL A;  4DTJ A;  2WBN A;  3T19 A;  3VQ7 A;  1HKG A;  1LW2 A;  4JK7 A;  3CCE N;  3FZM A;  1V4S A;  5AFU A;  4B9T A;  5J2P A;  5A2Q O;  2QXF A;  3AVG A;  4AHU A;  1D9F A;  3NMU A;  3TTD A;  4YOY A;  3QES A;  2D0A A;  3U9Z A;  4OPA A;  2QEX N;  5FPD A;  1N36 K;  3C7N B;  5AQY A;  3TAQ A;  3J7Y P;  2PBD A;  3ENH A;  2JLE A;  1H1V A;  1BO5 O;  4XH4 A;  4IFE A;  4FJI A;  4AHC A;  2WC9 A;  3L6Q A;  4IZ9 A;  4C8M A;  3ZSO A;  3WXJ A;  1ZBU A;  4WFN L;  3UKR B;  4C8O A;  3G0Z A;  1XQS C;  4KRF A;  4JI8 K;  4NO7 A;  3BGR A;  2RE2 A;  1HQE A;  4DV4 K;  2EHG A;  1M90 O;  4JI4 K;  1LWC A;  3O4N A;  5KQ8 A;  4LSL A;  4NLC A;  4H5N A;  3E9O A;  2NRR A;  2QWQ A;  4BE0 A;  3CJC A;  3MXM A;  4FJN A;  2FSJ A;  3ZSV A;  1SKW A;  1EET A;  3H6E A;  2P9L A;  2B5J A;  3SAF A;  3ZLJ A;  4HVJ A;  3OTO K;  3DMJ A;  2E20 A;  3MWT A;  2IIR A;  5BPN A;  2RN2 A;  5BR8 K;  4CBX A;  4GW6 A;  4CHZ A;  1MWM A;  1NGE A;  4JRQ A;  3M3Z A;  1TUU A;  4GNI A;  1RDC A;  4FPB A;  1I94 K;  2OTJ N;  1SS6 A;  3CCM N;  3RMC A;  3KLE A;  4O8K A;  3K57 A;  3PUF A;  2VGM A;  4BRN A;  3DLB A;  4DU1 A;  3PY8 A;  1JLQ A;  5EVZ A;  3HST B;  3AO5 A;  2GWK A;  3OYI A;  4E89 A;  3S3N A;  3SI6 A;  3U8X A;  3AVK A;  3HVT A;  4Z4I A;  4BRO A;  3O9Q A;  5BRE A;  4IOC L;  3R9P A;  4B3O A;  1TVR A;  4KB1 A;  1BQM A;  3A5L C;  3T1A A;  1FJG K;  3EN9 A;  4PUO A;  4CES A;  1Q9Y A;  5KPR A;  3M1F A;  5KRT A;  4F4K A;  2AJQ A;  5JLH A;  1S3X A;  2G8K A;  1IKY A;  3ZYY X;  4FJ8 A;  4AHV A;  1ILY A;  4JHD A;  1WAJ A;  4A59 A;  4K42 A;  1CZ9 A;  5AQT A;  1NU0 A;  4DF4 A;  3LAN A;  5ADX A;  3BUZ B;  2IGI A;  4DTX A;  1J9A A;  4LH4 A;  3O5B A;  3V9X A;  2QM1 A;  4NCB A;  2HNZ A;  1C0T A;  1LWF A;  3OA9 A;  4BRE A;  2HNY A;  1HKC A;  3TAP A;  3TTF A;  2IVP A;  4CZJ A;  3L2U A;  3AVF A;  4JKG A;  3QEX A;  3EZW A;  1QVF M;  3FR0 A;  4CBW A;  2P5G A;  3L0Q A;  5AQG A;  2X78 A;  4JD2 A;  3QEV A;  2D0C A;  1KAZ A;  4EAH D;  1YAG A;  4G1Q A;  5FLX O;  4LD0 A;  1WN7 A;  4HCB A;  3ZT1 A;  3QEP A;  2OYQ A;  4LFA K;  1RT7 A;  3ZT4 A;  2WUS A;  4RWT A;  1K6Y A;  1VSD A;  2R7Y A;  2RHK A;  1L3U A;  1JKH A;  1VQM N;  2O8D B;  1JL2 A;  1TKZ A;  2E2N A;  3DAW A;  3W0L A;  1KSP A;  3QB0 A;  4WYB A;  3BZC A;  5BPL A;  2HMP A;  3HP6 A;  1ZBL A;  1D8Y A;  4FJJ A;  1RT1 A;  4CEQ A;  3VQ9 A;  5D3G A;  4FM1 A;  4IDK A;  3SQ4 A;  3FE1 A;  3CCL N;  1GOA A;  3LM9 A;  1HNZ K;  2Y1J A;  2P9K B;  3HSC A;  1GOC A;  3VOV A;  3VES A;  4A62 A;  4O4G A;  3TR8 A;  3ZX2 A;  3I0S A;  1C1A A;  1TL3 A;  2JWL A;  1J5O A;  3VEW A;  1N32 K;  2HHV A;  3LAM A;  4JLH A;  2KLA A;  3F5T A;  4Y1C A;  3KK2 A;  1S1X A;  1OH8 A;  4H4O A;  3ZT2 A;  4CK3 A;  3AA3 A;  2OPQ A;  1LOT B;  1HUX A;  2HST A;  1CXQ A;  1ZXO A;  3NF9 A;  3CI5 A;  2AP1 A;  3HPO A;  3AO3 A;  4KH5 A;  4RCH A;  1A5V A;  3E66 A;  5SWM A;  2KQ2 A;  3T3F A;  4CER A;  4N76 A;  3HZ6 A;  5KPT A;  2VYP A;  4ID1 A;  1KXP A;  4PKH A;  3JXU A;  3M8Q A;  3LP1 A;  1HQU A;  5CY4 A;  2P9P A;  2HMI A;  5DMR A;  1NK0 A;  4HHT A;  4B9V A;  2HVI A;  4CD1 A;  3O3H A;  4RTF D;  4CGI A;  3P4I A;  2BTF A;  3BZK A;  1VSK A;  3C6U A;  4DV0 K;  4F9O A;  3O6W A;  3I8D A;  2QWN A;  5AZJ B;  3DXK B;  3O4Q A;  1MWK A;  2IDO A;  1GLA G;  3DLH A;  3C6A A;  4DSL A;  3AVJ A;  4XH5 A;  2PY5 A;  1YXQ A;  1X9J A;  3EKU A;  1IKV A;  1KFD A;  2P9I A;  3GL1 A;  3MAQ A;  1QSL A;  2CGK A;  2Q97 A;  4DG1 A;  4R79 A;  1SKS A;  2FLO A;  1RTD A;  1RBV A;  3DRR A;  4JNE A;  1U6Z A;  4B8A B;  1CZB A;  4BR0 A;  3WUH A;  3GE1 A;  4CJK A;  4LH5 A;  3WQU A;  4CD3 A;  1RBR A;  4IFV A;  2ITM A;  3AVC A;  3TSQ A;  5E41 A;  1YIT N;  1Q7Y O;  2YJE A;  2O4I A;  1SZ2 A;  3CCV N;  4JEP A;  3CPW M;  3NF7 A;  1VQ5 N;  4O0I A;  2P9U B;  3THW B;  3RMA A;  3CER A;  4BWJ A;  3D7E O;  1NJZ A;  4I9Q A;  3ZET B;  3DI6 A;  4QS9 A;  3D2F A;  5HRS A;  1RBS A;  3HL8 A;  4BRF A;  3CQY A;  3AO4 A;  4DQ8 A;  1NLV A;  3L2W A;  2E2P A;  4FLX A;  3WXK A;  1QQC A;  1Z26 A;  2NRV A;  2A1R A;  3VQ6 A;  3D2E B;  2QWL A;  2A40 A;  3Q7B A;  5HRO A;  1UOC A;  3R6M A;  1W9H A;  4N47 A;  3NDK A;  1KVB A;  3LP3 A;  4AHR A;  3PIP L;  1J54 A;  3S3O A;  1Z25 A;  4CGG A;  5AFU H;  4FOI A;  1LV5 A;  3T1H K;  5AQQ A;  4M7Y A;  1IJJ A;  2G8U A;  4CHO A;  2YHB A;  4BC4 A;  2KFZ A;  1U48 A;  2V7Z A;  1VSF A;  4B1Z A;  1JLB A;  4DHY A;  3O3G A;  1C1B A;  4C1N K;  2HND A;  3KLH A;  3LP0 A;  3F9M A;  4ISF A;  5KPZ A;  4KB0 A;  1LWE A;  1W2B M;  1HPZ A;  2HBK A;  2WON A;  3C94 A;  1IBK K;  4DTN A;  4CEO A;  2F8T A;  2G8H A;  3CM6 A;  3LAL A;  4FJK A;  1ATN A;  1U2V B;  4M63 C;  1BCO A;  3QLH A;  3K0S A;  4UQG A;  4EIA A;  2PFU A;  3V1Q A;  1ATR A;  3VF6 A;  4M3R A;  1R0A A;  2ASP A;  4JKC A;  4CJ7 A;  1HYS A;  1BU6 O;  4IKF A;  3SK3 A;  3MEG A;  4DS4 A;  5BRF A;  4C23 A;  4QOZ B;  1IBL K;  2D5R A;  4BRK A;  4CE9 A;  4A2B A;  1C6V A;  3PO5 A;  2KZZ A;  3O1W A;  3GG4 A;  1BIS A;  3KKS A;  2O8B A;  1Y64 A;  1EWQ A;  1OH6 A;  4CJW A;  1JLF A;  2UUC K;  4MDB A;  4OKJ A;  4CZL A;  3DWL A;  4E1M A;  4CW7 B;  4H5R A;  3VTH A;  4B8C A;  4CHQ A;  1Q86 O;  1NOY A;  1UWB A;  2ASO A;  4J2A A;  3JAM O;  2D4W A;  1ITG A;  4CFC A;  4GVM A;  1NJX A;  4DV2 K;  1KFS A;  4JKB A;  4FO0 A;  4BRH A;  3DLL L;  4DFM A;  2FSK A;  3QIO A;  1N34 K;  4JK8 A;  2P9S B;  1YJ9 N;  1TKX A;  3DYA A;  5LMN K;  3SQ0 A;  2P5O A;  4BGB A;  2JWK A;  5KGW A;  2Z1J A;  1S1W A;  3SMP A;  3FGU A;  1P8Z A;  1VQN N;  1QSS A;  1E3M A;  4FWS A;  2QW9 A;  3OJU A;  4AM6 A;  3IKM A;  3OYL A;  1ESV A;  3V9Z A;  2DFF A;  4BC2 A;  4KH4 A;  1NJW A;  2ETJ A;  2V51 B;  3F9K A;  4GKK K;  3CD6 N;  1T05 A;  3SPY A;  3QO9 A;  5ADX H;  3VMF B;  1BL3 A;  5AQL A;  4CHY A;  1N6Q A;  4I6M B;  3VEN A;  4CJQ A;  4FYD A;  4KFB A;  2NRW A;  4I2Q A;  4CEF A;  5MLC Q;  4Z4F A;  4A5B A;  4FW1 A;  3ENB A;  1B92 A;  3NVM A;  3R1X A;  3OYM A;  1RTJ A;  4CI6 A;  4YOT A;  2CH5 A;  3SPZ A;  5I42 A;  3CCQ N;  1JCF A;  4O44 A;  3NE6 A;  3AAP A;  3MX2 A;  4C1N I;  3PIO L;  1WSG A;  2YNI A;  5GAE P;  3VEX A;  4E7L A;  2HHS A;  4EHT A;  4H4M A;  2Q36 A;  4BDZ A;  3L3V A;  1J6Z A;  1CZA N;  1U45 A;  2PYL A;  3VGK A;  2W42 A;  3TAF A;  4IJA A;  3KD1 E;  4DV7 K;  2OZS A;  4DR7 K;  2Y1I A;  3ULE B;  3THX B;  1O13 A;  2QK9 A;  1NGD A;  1TK5 A;  1OVY A;  4C8L A;  3KLF A;  5AQW A;  1BCM A;  1VQ8 N;  3B8A X;  3SUO A;  3PV8 A;  2IOC A;  2G8F A;  1NGA A;  2IS3 A;  1QZ5 A;  1JLA A;  2IVN A;  2GEM A;  3RR8 A;  3CC4 N;  3NVK A;  3VF2 A;  1VQL N;  3IDH A;  3VA3 A;  3IUC A;  4HTU A;  3MED A;  2YJF A;  1GLE G;  4AHT A;  2PYJ A;  4Z0U A;  4Y1D A;  4F2R A;  3PSI A;  1R59 O;  1BIU A;  5CYM A;  4QAG A;  2W6L A;  2DY4 A;  2VCP A;  5FRM A;  2A41 A;  3MEE A;  3T69 A;  4FLY A;  3LPU A;  3NGY A;  2DTU A;  4NCA A;  4YOW A;  3KTQ A;  4LSN A;  5JVH L;  4CEA A;  1RTH A;  2W6K A;  4IWV A;  3RRG A;  4DQR A;  5CR4 A;  3M8R A;  4BRC A;  4HTL A;  2OZM A;  1WB9 A;  1KRP A;  1XMQ K;  3KKR A;  1NGG A;  1G99 A;  4CJV A;  4PHT X;  3E9L A;  1KC8 O;  2HHU A;  3ZEU A;  3PSF A;  1HYZ A;  2QA4 N;  2O8C A;  1W0H A;  4OLA A;  3EE9 A;  5M1O A;  3U3Y A;  2RKI A;  3O8M A;  4FOE A;  5DM6 L;  3HRG A;  3NBP A;  3DJC A;  1EX4 A;  4FWM A;  3VEO A;  2XHB A;  4GV9 A;  2UXD K;  4PL8 A;  1I3A A;  3MN5 A;  1GLF O;  4BG8 A;  2E4L A;  5BN8 A;  1FW6 A;  4ILH A;  4E1N A;  2O8F A;  4BQZ A;  3CFP A;  5FRN A;  3K2P A;  4NB4 A;  3QNN A;  1TKD A;  2HVH A;  1HX1 A;  4DU3 A;  1A5W A;  1Y97 A;  2E6L A;  4BC5 A;  1I39 A;  3K5L A;  5AQI A;  4MLE A;  2V7Y A;  4GMJ B;  4FLU A;  5HBM A;  4CJL A;  4DV3 K;  5EY4 A;  3HJF A;  4WFA L;  2YHA A;  3L2V A;  4M3Z A;  2P1J A;  3TAG A;  4FLW A;  4BRA A;  4JI2 K;  3CF5 L;  5C12 A;  3J81 O;  4WCE L;  5AZI A;  4CBU A;  4GV6 A;  4CFA A;  5HP1 A;  3SYZ A;  5FDL A;  1RDD A;  4DMN A;  4DR2 K;  4DSJ A;  5HRR A;  1BUP A;  1XHZ A;  2HF4 A;  1YJW N;  1OH5 A;  4YNQ A;  2KZM A;  5KGX A;  1S5J A;  3IRX A;  3HPH A;  3OBW A;  4IOX A;  5HRP A;  3EE8 A;  4CF1 A;  4DB3 A;  1WSF A;  2NRX A;  1MDU B;  1SQK A;  4CEE A;  3BP8 A;  5I9E B;  1XWL A;  2QTD A;  2OAN A;  4MQ3 A;  3H46 O;  4CGD A;  3KHY A;  3CFO A;  3VPZ A;  3VEZ A;  3D6R A;  2XO7 A;  3HK2 A;  3ENO A;  3ATV A;  3HTV A;  5M1N A;  2FF3 B;  3KLG A;  4CIG A;  3WEE B;  3OYE A;  1RTI A;  1DLO A;  5J2N A;  4CF2 A;  4JI5 K;  4YOV A;  3JSM A;  3UB5 A;  1J5E K;  4DQQ A;  3ZSY A;  2P9N A;  2D0B A;  5HLF A;  3L2R A;  4FJX A;  5EOY A;  4ELV A;  3EEQ A;  3CC7 N;  3U9D A;  1Q81 O;  3IFR A;  5HOO A;  3G10 A;  2NRT A;  1QVG M;  5KTQ A;  1M1K O;  4OLB A;  1QE1 A;  4CEC A;  4IBN A;  4BR9 A;  5GIO A;  1J53 A;  4IOA L;  3MX5 A;  1ZBH A;  2Q0U A;  4O55 A;  3NHG A;  3VQ5 A;  4NLB A;  2ZQB A;  1T6C A;  3I33 A;  3ZSR A;  3K9J A;  3LAK A;  4H5V A;  1E4F T;  4BE1 A;  1T3V A;  2H3G X;  5T7B A;  3H3N O;  1JXE A;  2WFB A;  4M3U A;  5SZT A;  4PWD A;  4B9N A;  4C8K A;  1ZYQ A;  1QTM A;  3VQQ A;  1DKG D;  4DWI A;  3TWH A;  1NGI A;  1IKX A;  3TAE A;  2BE2 A;  3ASM A;  5E84 A;  3WNG A;  3G4S N;  3QET A;  3K58 A;  4LC9 B;  4FVM A;  4FZZ A;  2DFE A;  1S6P A;  3EYZ A;  4HCC A;  1YI2 N;  2HBM A;  1NMD A;  5E26 A;  1K8K A;  4B9U A;  3V9W A;  4ZHR A;  4EP4 A;  3K5N A;  1TK0 A;  4BG9 A;  3ID6 A;  2ZM6 K;  3AVB A;  4FK2 A;  5HL7 L;  4GVE A;  4B1V A;  4OVL A;  1VSH A;  4KHY A;  1GLB G;  1RBU A;  2GX9 A;  1VSI A;  2P9L B;  3N4Q A;  1SUQ A;  2ZF5 O;  3AA4 A;  3SCX A;  1RT5 A;  4BRG A;  5ELZ A;  1T8E A;  4CCH A;  3OHR A;  5FRO A;  3HXM A;  3OYN A;  2KHO A;  4E19 A;  4KHP K;  4M3Y A;  3HBT A;  3OYG A;  3L3U A;  1K73 O;  1HNW K;  3TPQ A;  4J2D A;  2YHW A;  4IG3 A;  3FZK A;  3T7Z A;  3SQ1 A;  1NK6 A;  3O08 A;  4CHN A;  4FWQ A;  1S1V A;  1Z6R A;  5CYQ A;  3UE5 A;  4KTW A;  3LZJ A;  1CXU A;  1X3M A;  1TL1 A;  3CCR N;  3DXM A;  1XNR K;  1OVQ A;  4FL9 A;  4CF8 A;  2OTL N;  1S1T A;  2HHX A;  4JV5 K;  2YX6 A;  3QIC A;  4GKJ K;  4NXM K;  4DV6 K;  5M1Q A;  4JYA K;  2BH1 A;  1BG3 A;  4NXN K;  1YJN N;  1A5X A;  1IH7 A;  4MFB A;  4FSV A;  1B9F A;  4M3X A;  2BGG A;  4B08 A;  4JI3 K;  1WAF A;  4X66 K;  3AO1 A;  4BRI A;  1G15 A;  3BY5 A;  3ULD A;  3RWU A;  4IFY A;  2GWJ A;  1BDG A;  2E5L K;  3PO4 A;  4FWO A;  2QKK A;  4JHD B;  3O9S A;  4KV8 A;  2QWO A;  4C8N A;  3C95 A;  1RCH A;  1RT3 A;  4CEZ A;  3J7Z O;  2YCH A;  4CGJ A;  1RDA A;  1GLD G;  5C25 A;  4YDU C;  5IWA K;  3CIP A;  1KLN A;  4FW2 A;  1RT6 A;  1RT2 A;  4PA1 A;  1BA1 A;  3M5R A;  4FLZ A;  2UUB K;  4K0K K;  2F9W A;  3HM8 A;  2I7N A;  1QS4 A;  5LJV A;  1QZ6 A;  4JKG B;  4YDU A;  1EQY A;  3VGM A;  2VWB A;  1E4G T;  3NGZ A;  3AGK A;  5EU7 A;  3L4I A;  2E2O A;  1NNE A;  4PY5 A;  3CM5 A;  1DGK N;  1VSM A;  4JD2 B;  2RPI A;  5CHI A;  4DLE A;  1TYQ A;  3VQA A;  3SBT A;  2XY6 A;  3OYD A;  3RSE A;  3H45 C;  2F4V K;  4BVO A;  3A5N C;  3SQ2 A;  1RT4 A;  2HB5 A;  5JIC A;  3UKU A;  1QHT A;  5JVG L;  3VQ4 A;  4WQ5 C;  2ATQ A;  4B1U B;  4LF7 K;  1GOB A;  4Y0W A;  3FZH A;  2G8I A;  4O0J A;  3NGI A;  3F73 A;  2VQF K;  2HBJ A;  4B9S A;  5F2R A;  1HNI A;  3P5J A;  1T6D A;  4LF5 K;  3LDO A;  4WQ5 A;  4DLG A;  2PZS A;  2D1K A;  3L8B A;  1B9D A;  3MK6 A;  4W5T A;  1N8R O;  1DEJ A;  2XY8 A;  2F8S A;  2BUP A;  3CG7 A;  5AQR A;  4M42 A;  2KW4 A;  3ZT0 A;  3TSU A;  4CF0 A;  3VGL A;  2YKM A;  1IG9 A;  3LDN A;  3IG1 A;  3KVG A;  1NOZ A;  4GY2 B;  1XC9 A;  2IAJ A;  2F9T A;  3SZ2 A;  3LDS A;  1C0M A;  3RR7 A;  4ELU A;  3AO2 A;  2FSN A;  5JLF A;  1QQO A;  3OYH A;  3U6F A;  1SL2 A;  1KTQ A;  2P51 A;  4X64 K;  3OS1 A;  3C7N A;  3CJ1 A;  3DOL A;  4KPY A;  5AJ3 K;  4FJH A;  3SV3 A;  4B3T K;  4H03 B;  1WSH A;  2P9P B;  3A2F A;  1SAZ A;  5AQZ A;  3NCI A;  3UKR A;  4DSE A;  1BI4 B;  2HHH K;  1YVU A;  1BHL A;  5C15 A;  1MA9 B;  1RDW X;  2YNH A;  1WNS A;  2I7P A;  2A3Z A;  4E7K A;  3OS0 A;  4A61 A;  4MO5 A;  3K59 A;  3W3D A;  1W7A A;  3VN5 A;  4M41 A;  4JI7 K;  2ZGZ A;  5AQF A;  1O1W A;  1X9S A;  2E8A A;  4ZTF A;  2BDP A;  1VHX A;  3WXL A;  1XI1 A;  4KKO A;  4CJT A;  4KTZ A;  1NMN A;  3CJA A;  1NK8 A;  1TKT A;  1NGJ A;  4B1X B;  4BRP A;  3SMS A;  3V1O A;  3U4L A;  1Z05 A;  4YOR A;  1JXB A;  4DFK A;  3DLK A;  1WBB A;  1T7P A;  1LAV A;  5B8H A;  1JLC A;  3SLC A;  3KK7 A;  2EX3 A;  4IJN A;  3EY1 A;  4DFP A;  3I8B A;  2HHW A;  4M3W A;  4K8Z A;  1IO2 A;  1WSJ A;  1X3N A;  3HYF A;  3J8A A;  1RDB A;  2FC0 A;  4Q5V A;  4BRM A;  3D0P A;  3LDQ A;  3I55 N;  3QIN A;  3D2F B;  4BRD A;  1JCE A;  3TU5 A;  5BR9 A;  1EXQ A;  2VQE K;  2UUA K;  3OYC A;  4CJU A;  2UXC K;  3DLG A;  1VAZ A;  2QWM A;  3OS2 A;  3QDK A;  3E1Y A;  1NK9 A;  3CCS N;  2VWJ A;  4DSF A;  4LF4 K;  4Z4H A;  3QFU A;  4H0X B;  4CFD A;  1TAQ A;  3MDQ A;  1NBW A;  4F3O A;  4FVU A;  2CGJ A;  3OYJ A;  4CZG A;  3LWL A;  5M1K A;  1L3S A;  2YHX A;  2W41 A;  4OPH A;  1HYV A;  4CJF A;  4CZI A;  4EFH A;  3CFR A;  4FLV A;  4F2S A;  3WNF A;  1VRU A;  4ICL A;  2D0O A;  3V81 A;  4I9L A;  1FK9 A;  4ISG A;  2QXL A;  3KK1 A;  3MN7 A;  4IXC A;  4FJ5 A;  2UXB K;  3VF4 A;  4CEB A;  3U3G A;  3SUQ A;  1YHQ N;  2KTQ A;  3CQX A;  4EP5 A;  1VQP N;  5H1S Q;  1TK8 A;  4H0Y B;  1L3V A;  4YHH K;  3L4Q A;  3MEC A;  1C0F A;  3SBG A;  1S1U A;  2HHQ A;  1KCF A;  5GAH P;  3THY B;  4FWK A;  4JKE A;  3P38 A;  3FZF A;  3IS9 A;  3AVL A;  3GDQ A;  1JLE A;  4MLH A;  1ZC6 A;  4H0V B;  3BF3 A;  3AV9 A;  3GBT A;  2OPR A;  1JJ2 M;  2NUB A;  5LL6 Z;  4A5A A;  2JGU A;  3CYM A;  4FZX C;  4DTM A;  4J2B A;  5BPM A;  3PX6 A;  3WT0 A;  3V9S A;  4W5Q A;  4B9M A;  4N56 A;  4K8X A;  5C2D A;  5FPM A;  4DTR A;  5C2F A;  2E2Q A;  3ZX0 A;  3S41 A;  4O5F A;  1P90 A;  4CGF A;  2O8B B;  1BQN A;  4DTO A;  4Z4E A;  1WSI A;  1XC3 A;  4QCL A;  3KJV A;  2O8D A;  1ATS A;  1VQ7 N;  4V19 S;  3ZCM A;  5FPE A;  5TKW A;  1NJY A;  5JS1 A;  1HR0 K;  3RMB A;  4A57 A;  5C10 A;  4CZE A;  3CCJ N;  1YIJ N;  2HBL A;  1WOQ A;  3H1Q A;  3V6D A;  1U04 A;  1NGB A;  3BF1 A;  4IDH A;  3A0I X;  2F96 A;  1TAU A;  3ZSZ A;  3DRP A;  3DRS A;  4FM0 A;  3H08 A;  2ZJR L;  4JKH A;  1RDU A;  2Q1N A;  3F2K A;  2P9K A;  4XIU A;  2HHT A;  1WBD A;  2YI1 A;  5KQD A;  3TAM A;  5CE3 A;  4BRQ A;  1QQM A;  4BGA A;  4GV3 A;  5FPN A;  4DF8 A;  4LFB K;  1K8A O;  4I7F A;  1SKR A;  3C65 A;  1S22 A;  4DTP A;  3O80 A;  4FJG A;  3RVC A;  1U47 A;  4BR5 A;  4FWN A;  5DK5 A;  4HUG A;  3DOK A;  4N5S A;  2O8E B;  3TTC A;  4KHN A;  3VQC A;  2FBV A;  3WNE A;  4G9Z A;  4CHP A;  1UA0 A;  4TSX A;  3VEV A;  2FBY A;  1T44 A;  3VER A;  1JLG A;  1NK4 A;  2NRH A;  3A5O C;  1IV0 A;  5I3U A;  3B6P A;  4AH9 A;  4OJR A;  5KI6 A;  3HOT A;  4E0D A; 
#chains in the Genus database with same CATH homology
 4CVN E;  4LF9 K;  2UXB K;  5IWA K;  4GKK K;  1XNQ K;  4DV5 K;  1XMQ K;  2UUB K;  4LF6 K;  4K0K K;  2HHH K;  4JI8 K;  4DR6 K;  4YHH K;  4JI1 K;  1IBK K;  4DR5 K;  4DV4 K;  2ZM6 K;  4DV0 K;  4B3S K;  4JI4 K;  4JI7 K;  4LF8 K;  1HNX K;  5FLX O;  5LL6 Z;  3J80 O;  2UXD K;  4JI5 K;  3OTO K;  4LFA K;  4LFC K;  2F4V K;  1J5E K;  4B3M K;  1IBL K;  1IBM K;  4KHP K;  5BR8 K;  4DV1 K;  5IT9 O;  4YY3 K;  1HNW K;  3J7A P;  4LF7 K;  4X65 K;  4V19 S;  1I94 K;  4JI6 K;  2UUC K;  2VQF K;  4DV7 K;  4DUY K;  4DR7 K;  4DR3 K;  4CW7 B;  1HR0 K;  4LF5 K;  4DV3 K;  1XMO K;  1XNR K;  1HNZ K;  3JAM O;  4OX9 K;  4JV5 K;  4GKJ K;  4JI2 K;  4NXM K;  2VQE K;  4DV6 K;  2UUA K;  4JYA K;  3J81 O;  4B3R K;  4DV2 K;  4NXN K;  2UXC K;  4DR4 K;  1N32 K;  4LFB K;  4JI3 K;  5LMU K;  4X66 K;  1N34 K;  4X62 K;  2UU9 K;  1FJG K;  4LF4 K;  5LMN K;  2E5L K;  5A2Q O;  4DUZ K;  4DR2 K;  1N36 K;  4X64 K;  4AQY K;  3J7Y P;  3T1H K;  4DR1 K;  3T1Y K;  5AJ3 K;  4B3T K;  4JI0 K;  1N33 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...