2ZQBA

Crystal structure of a psychrotrophic rnasehi variant with sextuple thermostabilizing mutations
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
152
structure length
149
Chain Sequence
ELKLIHIFTDGSCLGNPGPGGYGIVMKYKGHTKEMSGGFSLTTNNRMELLAPIVALEALKEPCKIILTSDSQYVRQGIMTWIHGWKKNGWMTSNGTPVKNVDLWKRLDKAAQLHQIDWRWVKGHAENERCHQLARAAAEANPTQIDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Destabilization of psychrotrophic RNase HI in a localized fashion as revealed by mutational and X-ray crystallographic analyses
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 44
structure length 149
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2zqbA00
2VWJA 4OJRA 3AVFA 4MFBA 4W5RA 1ZYQA 4KB0A 3LWMA 2G8UA 5I42A 1KLNA 1A5WA 1BGXT 1RT7A 2BANA 1BISA 1JLBA 1VSJA 2ATQA 4RG8A 4CIGA 3CFPA 4OPJA 1TKZA 4BWJA 4CJEA 1Q9XA 3OS2A 3I0SA 4LH5A 3QO9A 1L3SA 3NDKA 3P5JA 1NJZA 2BDPA 2PYLA 3KK2A 3LZJA 1BHLA 4ZHRA 1LV5A 5HRRA 4DU1A 1J54A 1C1AA 3LP0A 5KI6A 4AHRA 3NE6A 5C42A 3KLFA 3OY9A 4HUFA 4GW6A 2OYQA 4ZTJA 3DMJA 3HSTB 3NF8A 4RW9A 5JS2A 4M41A 5HRNA 3HM9A 2G8VA 2EHGA 4DQIA 4FJ7A 4FK0A 2YHBA 3NCIA 4E7IA 4LSNA 1HRHA 3VQ6A 3NH2A 3MXJA 3KD1E 2DFFA 5KGWA 2KZMA 3CG7A 1BIUA 3OYGA 3OS1A 3EYZA 1Z25A 4DTUA 4CF0A 2RKIA 4KFBA 3ULDA 4DS4A 1FKOA 1IKXA 3OYKA 4CHZA 1WSIA 3SPZA 1EKEA 3DRRA 1D5AA 3AVHA 2G8KA 3O3GA 1HPZA 3EZ5A 5C24A 3SNNA 3WNHA 3OJSA 2HVIA 1RNHA 2NUBA 4DTMA 2ZQBA 3RTVA 4BE0A 1QTMA 4PUOA 2FBXA 4B9TA 3M8QA 4CJTA 1VSHA 1C1BA 1S5JA 1Q8IA 1U4BA 3AVIA 4Z4HA 4FM0A 1IKYA 2RPIA 1S6PA 3QETA 4FLWA 2QK9A 3L8BA 4EZ6A 4DQSA 3C6UA 2Z1IA 3QLHA 1JLGA 3S9HA 4FJMA 3B6OA 2VWKA 2OPQA 1B92A 3DLHA 4CK1A 3O3HA 4JRPA 3I8DA 3SJJA 1NK6A 1RTDA 1JXEA 2YNGA 3OYFA 4KO0A 4CERA 2OA8A 4F4KA 3KKSA 3NFAA 3HPHA 4J2BA 2KZZA 4E0DA 4QOZB 2PY5A 1R0AA 4DF4A 2F8TA 1QQCA 1S9GA 1ASWA 3O4QA 3AVBA 1NK4A 2HHTA 3OS0A 4IG0A 1EX4A 1NKBA 3DYAA 1TV6A 1IKVA 2G8WA 5FROA 1QHTA 2HHQA 4FZYA 4H4MA 4OGCA 4CFCA 2KW4A 4CJ5A 1SKRA 1CXQA 1FXXA 1BQMA 1O1WA 4KHUA 4E7KA 3CM6A 1ASUA 1QSSA 1BQNA 4ID5A 5CY4A 4BDZA 4DLGA 4G1QA 2E4LA 1QSYA 4B9NA 2BGGA 4OLAA 4LH4A 3HVTA 4E7LA 3HO1A 3TAMA 1S1XA 1VSLA 1RTIA 3VQBA 5SZTA 3U3GA 4DTPA 4FW1A 2XY5A 1X9SA 4ID1A 2PZSA 4RW6A 1C6VA 1CXUA 4CHPA 3OYIA 4FJHA 1HYSA 1VK0A 4O44A 2OPSA 3RRGA 1VSFA 1LAWA 3LPTA 3F73A 4FLZA 4FJLA 3LZIA 3I0RA 4F8RA 4Z4EA 4HUGA 1UWBA 4F2RA 4O0JA 1QS4A 4EP5A 1CLQA 1RT4A 3KK3A 3NHGA 4BACA 3ZSWA 4AH9A 1SKSA 2OPPA 5DMRA 3RRHA 4E1MA 3HPGA 3AO5A 3K5LA 4YNQA 2WOMA 3SI6A 4FJIA 5CZ1A 3VQ8A 1JL2A 3BGRA 1SL0A 3ALYA 2XY8A 3KD5E 3L2UA 3IAYA 4ELTA 1VRUA 4DSKA 4BE1A 2HB5A 3C94A 2E6MA 4FLYA 1RTJA 3TAFA 1GOAA 3QERA 2ZD1A 2XY6A 4CEDA 3AVGA 1VSMA 1SUQA 4CF1A 3LDSA 4C8NA 1RBSA 4BE2A 2KFNA 4CGHA 4CGGA 3V9XA 4M3WA 1RDCA 2IOCA 4OKJA 5J1EA 3L2QA 5FRNA 4DWIA 4DTOA 2JGUA 1L5UA 4B8AB 3VN5A 4H8KA 4WE1A 1BCOA 1QSLA 1WN7A 4C8MA 1SL2A 3B6PA 2P5OA 4FXDA 3TAGA 1RT3A 3VQ4A 1S1TA 3LWLA 4UQGA 3DLGA 4FZXC 3VQ9A 2P51A 1REVA 3KTQA 2FBTA 4HHTA 1T8EA 4FJKA 4KI6A 3V4IA 1IG9A 1K6YA 3ZT0A 4KHNA 2RF2A 3G10A 3LALA 3QEPA 4CEOA 2FBYA 4I2QA 3S3NA 3V1OA 2O4IA 4FK2A 4IG3A 2GBZA 4O55A 3QEWA 3TWHA 4CF8A 4YFUA 3M8RA 4E3SA 3NH1A 1I39A 2YKNA 4FJNA 2ZE2A 3NF9A 4FM2A 2BE2A 3RR8A 4KHSA 3AA2A 3ZSRA 4PWDA 3C95A 4M45A 3K5NA 2IC3A 1HYVA 4N76A 1LWFA 3DLKA 1D8YA 4GMJB 4I2PA 4DTRA 2DTUA 1KSPA 3KLIA 3ITHA 3K58A 2R7YA 4DSLA 1RBTA 3K57A 4CJ4A 3OJUA 3PX0A 2P5GA 4FVMA 3IG1A 3O4NA 2Z1JA 4B8CA 4KI4A 3ZSXA 4Y1CA 4M3XA 1VSEA 4DFKA 1U48A 3P83D 3ZT3A 3BDPA 2F96A 5D3GA 1J53A 1KFDA 2IDOA 2WONA 2XHBA 2Q3SA 5C25A 3K2PA 4O5BA 1J9AA 3AA4A 1RDAA 1RTHA 3HVRA 1IO2A 2HNDA 3DI6A 3QIPA 2Y1JA 2Y1IA 4DG1A 4KRFA 2HHVA 1RT6A 3TR8A 1JLAA 3K5MA 2D0AA 2AJQA 1A5VA 3U3YA 4FJGA 4CF2A 4M3UA 3SCXA 3DOKA 2HMIA 4XIUA 2O4GA 5SWMA 1N5YA 4M3ZA 4W5NA 4DS5A 3K5OA 1IH7A 5HLFA 1RT1A 1NK5A 4BDPA 3OYCA 3QNNA 4OLBA 3TI0A 4C8LA 3P1GA 3G0ZA 4E89A 2HW3A 2YKMA 4CK3A 3SQ0A 3HP9A 3A2FA 5KRSA 2GUIA 1LAVA 4AHUA 4CGFA 3CFRA 3AV9A 4DFJA 1KFSA 2QKKA 1JKHA 3NAEA 3HK2A 2YNHA 2W42A 3AA5X 4CE9A 2KTQA 4KHQA 3DLEA 3OYJA 2D0CA 4R5PA 4IDKA 3VQEA 3K59A 1NK7A 4JLHA 4DSFA 1F21A 3ZSQA 4TSXA 1I3AA 2I5JA 4ICLA 2XO7A 2HHWA 4GVMA 4W5TA 1TVRA 3WNGA 1DTTA 1S1UA 1SKWA 1ITGA 1CZ9A 1BI4A 1W9HA 1Y97A 4DSEA 3V9UA 1L3UA 1X9WA 3RWUA 4F3TA 1KCFA 3AO4A 1VSDA 1JLCA 1EXQA 2B4JA 3LP2A 3PY8A 2OZSA 4CJWA 3LAMA 4CHOA 4DFMA 3QINA 1NJYA 2HNZA 3AVLA 1LWEA 4OGEA 5EU7A 3OYLA 4DU3A 5J2PA 1KVBA 3RMCA 1RT5A 1NOYA 4F3OA 4QCLA 3MXIA 4NCBA 1NOZA 4M3YA 3PX6A 1ZBLA 3VA0A 1KLMA 4Z4FA 2XRIA 4CEFA 3OYNA 1NJWA 3T1AA 4CJVA 3PUFA 4B9LA 4J2DA 2X6SA 4CFAA 5KGXA 2B6AA 3H08A 3AVMA 3MECA 3KLEA 2B5JA 1TKDA 2JLEA 4FJJA 4CHNA 2VG5A 4CIEA 1T7PA 3ZT1A 3PV8A 3AVCA 4M3TA 3FFIA 3AVJA 3KKRA 4N56A 2HNYA 2G8HA 4B3OA 2HHXA 3MXMA 4FLTA 3QEXA 2VG7A 1MU2A 3TAPA 3QESA 2X74A 3MAQA 3SPYA 2A1RA 3D45A 3V9ZA 3LANA 4Q0BA 4CEBA 2HHSA 2FC0A 3ISNC 3E01A 1WSFA 3RR7A 1NKEA 3THVA 1W0HA 4DQPA 1S1VA 3NBPA 3V1QA 4DTSA 4J2EA 1HNVA 4BWMA 4ELUA 1NK9A 4PA1A 3QNOA 3F9KA 3SQ4A 3S3MA 1WNSA 3V81A 4CIFA 5JS1A 4QAGA 1B9DA 3S3OA 4N41A 1RDDA 1QE1A 5FRMA 3OYEA 4CEAA 5CZ2A 3PX4A 5KRTA 2D0BA 1VRTA 3AVAA 3VQ7A 4FJ8A 4C8OA 4E7JA 3MEGA 4CHYA 4JS5A 1KRPA 4L8RB 1IKWA 2DFHA 1TL1A 1Z26A 1NJXA 3SUOA 1YVUA 3OYMA 2G8FA 3CM5A 4NCAA 3VQ5A 3IS9A 4Z4CA 1TAUA 1DLOA 4DU4A 4I7FA 4I9LA 4CEZA 1NK8A 3LAKA 3TANA 1LW0A 4KTWA 4DMNA 4CGDA 4RW8A 4CJFA 2LSNA 3V6DA 4MQ3A 4Y1DA 4FZZA 1TK5A 2ITGA 4N47A 3HP6A 4FK4A 4NYNA 4O4GA 4CFBA 3LP1A 3KLHA 4AILC 3OYAA 5E41A 4O0IA 4DTNA 1TKXA 4B9VA 3DLBA 4KKOA 3CQ8A 3HT3A 3NGIA 3WNFA 3ZSZA 1XC9A 1SL1A 4IKFA 1BCMA 1S1WA 5K14A 3V1RA 4FJXA 2YNFA 4IFYA 4CCHA 4FJ9A 4NYFA 4CJPA 1LW2A 3DRSA 3PO5A 4AHVA 4E19A 3C6TA 3VQCA 3ZSYA 4LY7A 4BDYA 3TAQA 2G8IA 1TGOA 1U49A 1WSGA 5FDLA 3QIOA 4HUEA 1YTAA 4DFPA 3NF6A 1GOBA 4FLVA 4CFDA 1JLEA 1HJRA 4B08A 4CJSA 4Q5VA 3KK1A 3IRXA 4DF8A 5CYMA 4M3RA 2Z1GA 4H4OA 4OPKA 5I3UA 1C0TA 4CJRA 4IBNA 1NK0A 3HPOA 2A1SA 3AVNA 1JXBA 2KQ2A 3SUNA 4DQRA 3VQDA 4K8ZA 3VQPA 3T19A 4FCYA 3V9WA 1RDBA 5KTQA 4ZTFA 1S6QA 2YNIA 3JSMA 3CFOA 4NCGA 1TK0A 3ZCMA 4KV8A 1S9EA 2QXFA 4FW2A 3SZ2A 4FM1A 3RMDA 3T3FA 4DLEA 4CJLA 3SUPA 1RT2A 1B9FA 1XHXA 1WLJA 3L2RA 1L3VA 3VA3A 1D9DA 1JLFA 5CYQA 4LD0A 4OVLA 4AHSA 4HVJA 3L2VA 5J2MA 3L2WA 1RCHA 1RILA 1BIZA 4KPYA 1ZBUA 4Z4GA 1YT3A 1HYZA 4JS4A 1T05A 1WSEA 1WAJA 3WNEA 4DTXA 3RMBA 1TAQA 1YTUA 3NGZA 4HCCA 4CGJA 2E6LA 3TAEA 2FBVA 3MEEA 1EETA 1HQUA 1FK9A 5DK5A 3SV4A 3NGYA 3M8SA 3HXMA 3TABA 1KVCA 2Z1HA 3SYZA 4M42A 2YHAA 1ZBIA 3LP3A 1JLQA 4CEEA 3D0PA 4DSJA 3AVKA 3AO3A 4CJKA 1Q9YA 4N5SA 2P1JA 4HCBA 3AO2A 1RBRA 3VQAA 4LSLA 4KREA 3DRPA 5J2NA 3EY1A 1EP4A 1RBVA 2IS3A 1RBUA 4Z0UA 3DLRA 3HYFA 3TARA 4HTUA 2YV0X 1T03A 1U45A 5HRPA 1XWLA 3DM2A 3U6FA 4I9QA 3L3VA 4CK2A 3PO4A 4K8XA 2DFEA 4CJ3A 5T7BA 1VSKA 2IGIA 3M8PA 1U47A 4CHQA 4Z4IA 1CZBA 3OYBA 4DTJA 1J5OA 2X78A 1G15A 5HBMA 4AHCA 4ELVA 4KAZA 1KVAA 1A5XA 1HNIA 4B9MA 1BI4B 4CGIA 4E1NA 4FLXA 4KTQA 3HJFA 3UIQA 3QEIA 2GV9A 1BL3A 4PY5A 4CJQA 4CJUA 4OKKA 2OZMA 1X9MA 1LWCA 1TK8A 4FLUA 3ASMA 3NF7A 4PQUA 4JRQA 4J2AA 1GOCA 1ZBHA 1WAFA 3ZT4A 5J2QA 3OYHA 3QEVA 3AA3A 2X6NA 4CESA 3SUQA 2PYJA 3LPUA 3ZSOA 1XHZA 4DSIA 1UOCA 2XY7A 4E7HA 4W5QA 1ZBFA 3O3FA 1U04A 2D5RA 1VSIA 4KB1A 1KTQA 1WSHA 3V9SA 2KFZA 3VQQA 4KHWA 2DY4A 2VG6A 3ZSVA 1DTQA 4CF9A 3HL8A 1TKTA 3KIOA 3MEDA 1JL1A 1ASVA 4FJ5A 1C1CA 2QKBA 2IAJA 1HQEA 3OVNA 4CEQA 4FYDA 1FKPA 1X1PA 5HRSA 1C0UA 4RW7A 2ETJA 4EP4A 4W5OA 3NH0A 3ZT2A 3L3UA 4C8KA 2HVHA 1HMVA 3JYTA 3RMAA 4B9SA 4KTZA 3DOLA 2HHUA 3OYDA 4AHTA 4F2SA 1XI1A 1NKCA 2OPRA 3SQ2A 5HROA 5HP1A 4CECA 4DQQA 1WSJA 3SV3A 1TL3A 1UA0A 1UA1A 1C0MA 2RN2A 4IFVA 4OKEA 1SV5A 4RW4A 3KLGA 2EX3A 1L3TA 1UAXA 4B9UA 4KHYA 3KJVA 3AO1A 4EZ9A 3SQ1A 1N6QA 1D9FA 3CYMA 2F8SA
chains in the Genus database with same CATH superfamily
4OJRA 1ZYQA 4W5RA 4KB0A 1N36K 5I42A 4WQ5C 5DM7L 2D4WA 4WQ5A 2ATQA 4BWJA 4IOAL 3MWPA 4CJEA 1L3SA 1NJZA 3KK2A 1LV5A 3BF3A 1E3MA 3CCEN 4GW6A 4BG8A 3HSTB 2QXLA 3H6EA 3NCIA 4E7IA 3OBYA 3C0BA 4CZJA 2KZMA 4DR5K 3EYZA 1Z25A 3J81O 4KFBA 3T1HK 4CHZA 3NVKA 1D5AA 3AVHA 3O3GA 3WNHA 3CF5L 1LCUA 2HOEA 5JVHL 2P9UA 1QTMA 4PUOA 3PIOL 3M8QA 4CBUA 4CJTA 2QW9A 4B9TA 1C1BA 1S5JA 1Q8IA 2NLXA 3AVIA 5M1OA 4FM0A 3CCLN 2O8EA 1XC3A 5A2QO 1S6PA 3QETA 4NCBA 4DQSA 3S9HA 3QLHA 3B6OA 3J80O 3H3OB 2P9KA 3DLHA 1HLUA 4JRPA 3SJJA 1NLVA 1ATNA 1JXEA 2V7ZA 4KO0A 2OA8A 4E0DA 3TTFA 3LM9A 2PY5A 4L3QA 3AVBA 1DKGD 2HHTA 4IG0A 3ULEB 2CGJA 1NKBA 5FROA 3ATVA 4H4MA 3QMLA 3DWLA 5AQZA 4CJ5A 3IFRA 3CC4N 5BR9A 1FXXA 1BQMA 1YJ9N 1QSSA 4ID5A 4BDZA 4DLGA 2BGGA 4K43A 1S1XA 2ZJRL 5AQNA 3CJCA 3OA9A 5SZTA 1HNZK 2XY5A 1X9SA 4ID1A 4CHPA 1CXUA 4FJHA 4PKHA 2Q0UA 1VK0A 4O44A 1VHXA 4O5FA 3F73A 4WF9L 3CD6N 3LZIA 4F8RA 4H0TB 1UWBA 4O0JA 1CLQA 1RT4A 3VF6A 3NHGA 4JKDA 3ZSWA 1SKSA 5BPMA 3RRHA 5AQFA 4E1MA 1R59O 3HPGA 2GWKA 3AO5A 1SZ2A 3LDPA 4YNQA 1JL2A 2P9LA 3BGRA 1SL0A 3ALYA 4FWMA 4ELTA 1VRUA 2E6MA 3SAFA 3TAFA 3RVCA 2V52B 4CGGA 1OH6A 5FRNA 1WBDA 3VPZA 4FVUA 3GE1A 1BCOA 4BR4A 4C8MA 3J7AP 3DXMB 4FZXC 1REVA 1T8EA 1U2VB 4KH4A 5LMNK 1IG9A 4CD3A 1VQ4N 2RF2A 2FBYA 3EZWA 1I39A 4YOUA 1QVGM 2ZGYA 4CZGA 4WFBL 4H5TA 1RFQA 2YJFA 3HTVA 3AA2A 3RR8A 4PWDA 4M45A 3K5NA 2IC3A 4N76A 1LWFA 3DLKA 2OTJN 4I2PA 1P90A 2KKZA 4JYAK 1KSPA 2R7YA 2YX6A 3OJUA 2P5GA 3IG1A 1Q86O 1HUXA 3C6HA 3P83D 4DR3K 3BDPA 5D3GA 2Q3SA 4O5BA 1J9AA 3AA4A 3AARA 1IO2A 4ISEA 3K5MA 1HKGA 5JICA 3O9UA 3VGMA 1H1VA 4BGAA 4DS5A 5F0XA 3OYCA 2ASMA 1OKJA 4CZLA 1NGAA 3P1GA 3G0ZA 4E89A 2VYPA 4YDUA 3SQ0A 3A2FA 4AHUA 1K8AO 3AV9A 4JKCA 3E66A 2YNHA 3AA5X 4CE9A 4KHQA 4IZ9A 2ITMA 3H1QA 3FR0A 4JLHA 4DSFA 2H3GX 4JK8A 4JI4K 2HHWA 1T6DA 1TVRA 1DTTA 3H46O 2QTDA 1BI4A 1L3UA 5LY3A 3AO4A 1VSDA 3LP2A 4O8UA 2OZSA 1S72N 4CJWA 3LAMA 4DR6K 4DU3A 1LWEA 3UKRB 5J2PA 3OYLA 3RMCA 4QCLA 3D2FA 1HPMA 4BQZA 3CETA 4DV3K 3LDQA 4B9LA 3PUFA 2X6SA 5FPEA 4DHYA 4FJJA 4GV9A 3UE5A 2QA4N 3AVCA 4FWNA 3AVJA 3KKRA 1VQ6N 4JV5K 4B3OA 5I9EB 3TAPA 3QESA 3MAQA 2A1RA 3D45A 2W6LA 4CEBA 2FC0A 3ISNC 4DQPA 1GLBG 3NBPA 4DTSA 3T1YK 4J2EA 1HNVA 4BWMA 4JI5K 3VEZA 1EQYA 4BR5A 1EWRA 1WNSA 2F9WA 5KRTA 4BRAA 4JK7A 3TTDA 1Q18A 4JS5A 3Q7CA 4UY8O 2DFHA 1TL1A 1Z26A 1YVUA 4NCAA 1KQSM 3IS9A 4CBWA 4Y0WA 4I7FA 3LAKA 2Q36A 2IVPA 4RW8A 4DMNA 2LSNA 4YOVA 2P9NB 4YORA 2ITGA 3HP6A 4FK4A 4AQYK 4JI6K 4CFBA 1GLEG 3LP1A 3CMAN 5M1KA 3DLBA 4JI8K 3NGIA 3WNFA 1XC9A 2YI1A 3WXMB 1BCMA 3ZETB 5K14A 4NLCA 4H0YB 1IV0A 4NXMK 1LW2A 3PO5A 4BDYA 4LY7A 3O80A 1TGOA 2ZJPL 1U6ZA 1U49A 1KXPA 4LF4K 1GOBA 4FLVA 1JLEA 4Q5VA 4H0VB 5CYMA 2RHKA 3VEXA 2GELA 5I3UA 1NGDA 3SUNA 4K8ZA 3VQPA 3T19A 4K42A 1RDBA 2NRRA 5KTQA 3S41A 1T6CA 4LFAK 3TSPA 3SZ2A 3E9OA 4CJLA 3SUPA 1ESVA 3L2RA 3VA3A 3AY9A 4HVJA 4OVLA 3G25A 5AFUH 1W2BM 4Z4GA 1HYZA 2HBMA 3RMBA 2YHXA 3CCVN 5F2RA 4CGJA 3TAEA 1Q81O 3MEEA 1EETA 1HQUA 1FK9A 4JD2B 3M8SA 3D2EA 4BRPA 1KVCA 2Z1HA 4QS9A 1ZBIA 5AQWA 3AO3A 2PAVA 2P1JA 4OPHA 3RSEB 1QQNA 3WQUA 3J8AA 5AQTA 1EP4A 4YHHK 1EWQA 3HYFA 3P39A 5HRPA 1XWLA 1IBLK 3CCQN 3U6FA 1P8ZA 1VSKA 4JKGB 4CHQA 4Z4IA 1JCGA 1G15A 3ID8A 4B9MA 4CGIA 4FLXA 4B1VA 4PY5A 4YOYA 4PQUA 4J2AA 1GOCA 3HZ6A 3ZT4A 3AA3A 2X6NA 1ZBFA 4KB1A 2DY4A 2VG6A 4DV4K 4CF9A 3HL8A 3MEDA 4FJ5A 2VGNA 1HQEA 4FYDA 4EFHA 4W5OA 4B9QA 4RW7A 3WUHA 4EP4A 4C8KA 3LM2A 5LMUK 4BRIA 2HHUA 5AQLA 3OYDA 3N4QA 5M1NA 1CZAN 1X3MA 4OX9K 3SQ2A 5HROA 4CECA 2RN2A 4IFVA 1SV5A 1UAXA 4B3TK 3KJVA 3KD5E 4BROA 1XUPO 1KLNA 1A5WA 3CFPA 4RG8A 3A5MC 4BY9C 5AZJA 3LZJA 1BHLA 3GL1A 2E8AA 3CCJN 1J54A 1C1AA 4IOXA 3PSFA 5KI6A 3EO3A 1WB9A 4BC3A 3KLFA 2F8TA 2OYQA 1N33K 5AJ3K 5HRNA 3HM9A 2EHGA 1HRHA 3NH2A 3MXJA 3KD1E 1KAYA 3CG7A 3JAMO 3OYGA 3OS1A 3G6EN 1I94K 4FOIA 4A2BA 4DTUA 2FF3B 2O8FB 1KC8O 3ULDA 5LJWA 4PKIA 3WXJA 1HPZA 3EZ5A 4BC5A 2VGMA 5KPZA 3OJSA 2HVIA 3B8AX 3MWTA 1RNHA 3DLLL 4DTMA 4BE0A 3THXB 2FBXA 3EKSA 4B3MK 3KWIA 1VSHA 1OVYA 4MLHA 1IKYA 4GV6A 3EN9A 2E1ZA 2QK9A 5DM6L 4DV0K 4FJMA 2VWKA 1B92A 3O3HA 3UKUB 3OYFA 1V4SA 4CD1A 3NFAA 4C1NI 2KZZA 1R0AA 4DF4A 1S9GA 1ASWA 3TSUA 1NK4A 4DUZK 3TTCA 3OHRA 3OS0A 1EX4A 3WXIA 4WQ4A 2G8WA 3QDKA 1BA0A 4FZYA 4FWSA 1HNWK 4LFCK 2KW4A 4K25A 1SKRA 5AQOA 1O1WA 1BQNA 5CY4A 4F9OA 4G1QA 1GLJO 4IEEA 4JI0K 1VSLA 4GKJK 3ZX3A 1RTIA 3U3GA 4FW1A 1C6VA 3OYIA 4FLZA 1LAWA 3LPTA 3I0RA 3AGRA 4Z4EA 4BRHA 4HUGA 1QS4A 4AH9A 4X62K 3K5LA 4FJIA 5C0YA 1O13A 3O8MA 1ZC6A 4BE1A 4FLYA 1RTJA 1GOAA 4FWKA 1ZXOA 3H1VX 2XY6A 4CEDA 3AVGA 1VSMA 1SUQA 4CF1A 4R79A 4JKHA 2ZF5O 4BE2A 3MK6A 4XEIA 4CGHA 3V9XA 1RDCA 3L2QA 1QSLA 1VQ8N 3EL2A 2NRZA 1S1TA 3LWLA 4UQGA 4U7BA 3VOVA 2FBTA 3IKMA 2NNWA 3ZT0A 3LALA 2QWLA 4I2QA 2O8CB 3VF2A 4CJ7A 4O55A 3QEWA 4CF8A 4E3SA 4BRNA 4KHSA 2BE2A 3ZSRA 1HYVA 1YF5L 3U4LA 1D8YA 4GMJB 3KLIA 4FWOA 4B1WB 4CZHA 3PX0A 4FVMA 1DGKN 3O4NA 2Z1JA 3ZSXA 4M3XA 1SAZA 5E84A 2F96A 1J53A 5E26A 2IDOA 2JWLA 5C25A 3K2PA 4BR9A 3HVRA 1IJJA 2HNDA 2HHVA 2Y1IA 3A8YA 1VQON 2PBDA 3BP8A 2AJQA 1QZ6A 4FJGA 3DOKA 2HMIA 2CGLA 4M3ZA 3PSIA 1KAXA 3K5OA 1IH7A 5HLFA 1RT1A 1M1KO 4BR7A 4OLBA 1NM1A 4A57A 2HW3A 1YUWA 1WOQA 1QHAA 3TU5A 4CK3A 3HSCA 5KRSA 4CGFA 3CFRA 2QKKA 1JKHA 2V7YA 2ZGZA 2KTQA 5AZIB 4JI3K 1HKBA 2UU9K 1NK7A 4JKEA 3I56N 4DV1K 2I7PA 2XO7A 2Q2RA 4GVMA 3WNGA 3H3NO 1SKWA 4FSVA 5F1XA 5AQQA 2QWRA 3DXKB 4F3TA 2B4JA 2W6KA 3OTOK 2D0PA 1NOZA 4M3YA 3CJAA 1J5EK 5ADXH 4DR7K 3VA0A 1KLMA 4Z4FA 3OYNA 4BC2A 3T1AA 4CJVA 3C6AA 4CFAA 3MECA 3CCSN 3KLEA 4CHNA 4FL9A 3IDHA 3VGKA 2VG5A 4CIEA 3PV8A 3K9JA 4CZIA 2HHXA 1NGGA 3QEXA 1YITN 5CHIA 3VEWA 4Q0BA 2HF4A 3DXMA 3E01A 3RR7A 4DB3A 1NKEA 3GOIA 1W0HA 4JKBA 3F9KA 3NMUA 5GIPA 5C15A 4N41A 1QE1A 5FRMA 3OYEA 1T3VA 4H03B 2IIRA 1VRTA 3P38A 4C8OA 1KRPA 2GUPA 4CHYA 4L8RB 4EHUA 1NJXA 1YIJN 3CM5A 1M90O 4Z4CA 3L4IA 4C1NK 1TAUA 3QICA 1NMNA 4I9LA 1Q82O 4KTWA 4CGDA 3V6DA 3CJ7A 4IO9L 4N47A 4JAXA 4NYNA 4AILC 3KLHA 1TKXA 2F7TA 3ENBA 1SL1A 4HWIA 3V1RA 4FJ9A 4FPBA 5GAGP 4CJPA 5AQUA 4DR4K 4H0OA 3C6TA 2UUAK 2A41A 5FPDA 2QWNA 3K9KA 1VQ5N 1YTAA 3M5RA 4CFDA 3HRGA 3KK1A 1C0TA 4CJRA 1YJWN 3IUCA 4PL8A 3AVNA 4DQRA 1HNXK 4IWVA 4GY2B 1S6QA 2YNIA 3JSMA 3ZCMA 2J4RA 1N32K 2IVNA 3O9SA 2QXFA 5BPNA 3MN7A 1RT2A 1L3VA 1WLJA 2WFBA 3L0QA 3W0LA 1JLFA 5CYQA 3AAQA 3R3LA 4WYBA 3BUZB 4JHDB 4KPYA 1D4XA 1YT3A 1T05A 3I8BA 1WAJA 3WNEA 4DTXA 1TAQA 4HCCA 2E6LA 4CW7B 2FBVA 1C0GA 3R9PA 3BF1A 3HXMA 3TABA 2YHAA 3LP3A 3I55N 4KBOA 3AGKA 4HCBA 4M63C 1RBRA 4QS8A 4LSLA 4BG9A 4KREA 3DRPA 5J2NA 3IMXA 3G71N 2IS3A 4Z0UA 3DLRA 4HTUA 3R8EA 1U45A 3ID6A 4I9QA 3CERA 3M8PA 3E9PA 1J5OA 1HNIA 1BI4B 3QEIA 1BL3A 4CJQA 1NGIA 4OKKA 1LWCA 3ASMA 4JRQA 1ZBHA 1GLFO 1MA9B 5J2QA 4AF1A 3OYHA 4CESA 3LPUA 3ZSOA 1XHZA 1N34K 1UOCA 3SMPA 1BOTO 4W5QA 3BZKA 3ZSVA 1DTQA 1K73O 3BY5A 1JCEA 4EIAA 2IAJA 1FKPA 1BO5O 3ZT2A 3RMAA 5JMVA 3CQYA 5KPTA 2ZJQL 4FO0A 2P9NA 3VTIA 1XI1A 2OPRA 1K8KB 2FLOA 1X3NA 5HP1A 1BA1A 1WSJA 3VMFB 1C0MA 1NG9A 4RW4A 3KLGA 4KHYA 4PHTX 4EZ9A 3ZETA 3EE8A 3CYMA 3AVFA 4MFBA 2G8UA 5ADXA 2A40A 2E2OA 1BISA 1JLBA 4CIGA 4OPJA 1NU0A 3OS2A 3I0SA 4LH5A 2BDPA 3CCUN 2AA4A 5HRRA 2O8BB 3LP0A 3CJBA 4AHRA 2Q1NA 3NE6A 5C42A 3OY9A 3E1YA 3DMJA 4ZTJA 2G8VA 5JS2A 3CMEN 4FK0A 5BRDA 2YHBA 3VQ6A 3SJHA 5C2FA 4M7YA 2F9TA 2CH5A 4WFAL 2FSJA 4H5RA 3C7NB 3CXCM 5AQGA 2HHHK 4DS4A 1IKXA 2W40A 4DV5K 1EKEA 3DRRA 2G8KA 3QBWA 4JI1K 5C24A 3SNNA 1W7AA 3M6GA 2NUBA 2HBLA 1MWMA 1U4BA 2P9IB 3A5OC 4JD2A 4MO5A 2RPIA 5AQYA 4K0KK 3L8BA 4EZ6A 4DKWA 4DUYK 2OPQA 3RSEA 4CK1A 3I8DA 4JKFA 5FLXO 1NK6A 4WFNL 4AM6A 4CERA 3HPHA 4J2BA 5GAEP 2NRVA 2ZWHA 1QQCA 3FZLA 3O4QA 2UUCK 1QQOA 1TV6A 1IKVA 4A2AA 1QHTA 3U8XA 4OGCA 2WBNA 5JLHA 4KHUA 4E7KA 3CM6A 4OPAA 5KQ8A 3FZKA 4B9NA 2E4LA 1S22A 5C2DA 4LH4A 4E7LA 3HO1A 2F4VK 4OO1J 3SBGA 2AP1A 4RW6A 1HYSA 1VQLN 4I6MB 1VQ9N 1VSFA 4FJLA 4F2RA 4EP5A 5IWAK 4BACA 4IOCL 2OPPA 1OH7A 1JCFA 3U9DA 2WOMA 3SI6A 4FWLA 5CZ1A 3VQ8A 3THWB 2VQFK 1FW6A 2XY8A 3I33A 5AQPA 3L2UA 5IT9O 3O9TA 2HB5A 3C94A 4GVEA 1YI2N 3JXUA 4C23A 4IEIA 1LOTB 2WC9A 5KQDA 4JI2K 5AQIA 4OKJA 5J1EA 4B8AB 3CCMN 1XMQK 4WE1A 4KHPK 1SL2A 2P5OA 3B6PA 3CIPA 3T69A 5LJVA 4HHTA 3FFKB 3BEXA 1QZ5A 3GG4A 4CEOA 1VQPN 4FK2A 4IG3A 2GBZA 3ENHA 4MLEA 4YFUA 1NBWA 3CCRN 4FWQA 2O8DA 2ZE2A 5CR4A 1XNQK 1TYQB 4DTRA 2O8FA 3MCAB 3ITHA 2P9SA 4DSLA 1G99A 4CJ4A 3F2KA 3A0IX 3CPWM 2V51B 4B8CA 4KI4A 4Y1CA 3THYB 1U48A 1MDUB 5EX5A 2JWKA 4LF8K 3THXA 3HM8A 4BRGA 4ISFA 3QIPA 3DI6A 2Y1JA 1RT6A 2E2PA 4RWTA 2D0AA 5M1FA 5BR8K 1A5VA 4CF2A 1WBBA 5C12A 4M3UA 3SCXA 2BH1A 4XIUA 2O4GA 3UKUA 3HI0A 4BDPA 3QNNA 4C8LA 3FZMA 2YKMA 4ILGB 4ILHA 4DFJA 3NAEA 3WXLA 4JNEA 3DLEA 2D0CA 4R5PA 4IDKA 4DV2K 3VESA 1F21A 3ZSQA 3NVMA 2I5JA 3SMSA 1YXQA 1S1UA 4ISGA 2VQEK 1CZ9A 1W9HA 1Y97A 4DSEA 1X9WA 3RWUA 2OANA 4NB4A 1JLCA 1EXQA 1X9JA 4CHOA 4DFMA 1NJYA 2HNZA 1ATSA 3D7EO 4F3OA 1RT5A 3O4WA 3PX6A 1ZBLA 5JVGL 4CEFA 4X64K 2KLAA 2E20A 5KGXA 4J2DA 2B6AA 3H08A 1VQNN 1TKDA 2B5JA 2JLEA 3J7YP 4YOTA 5H1SQ 3WEEB 4BRLA 3ZT1A 4BRDA 1WUAA 3FFIA 3CC2N 3ZLJA 4N56A 2G8HA 2CH6A 3MXMA 4LF5K 4BC4A 4FLTA 2VG7A 1MU2A 3FLCO 1E4GT 2X74A 3V9ZA 3LANA 2Q97A 3ZEUB 1KAZA 3EEQA 3J7ZO 5C10A 5AFUA 3THVA 1J6ZA 3MN9A 4JEPA 3V1QA 4ELUA 3BZCA 4HTLA 3QNOA 3SQ4A 3S3MA 1YVNA 3V81A 4CIFA 2O8CA 5JS1A 4M7XA 1RDDA 3PX4A 4CEAA 3L6QA 5CZ2A 3GDQA 3DAWA 4H0PA 3VQ7A 4FPAA 1E4FT 3WT0A 2P9PB 3MEGA 3HOSA 4FOEA 3SUOA 3OYMA 2G8FA 3VQ5A 2UXBK 4DU4A 1NK8A 3TANA 4CJFA 4Y1DA 4A5AA 4BR2A 2GTDA 4DV6K 4O4GA 4BRFA 3OYAA 5E41A 1NGBA 2WUSA 3CI5A 3CQ8A 4IKFA 4Z94A 2YNFA 4IFYA 2FSNA 3O08A 4EHTA 3DRSA 4CZMA 3VQCA 3ZSYA 5BN8A 2G8IA 4HUEA 1GLAG 3FGUA 4B3RK 2QI2A 2GWJA 1HJRA 4YOWA 3IRXA 4DF8A 2Z1GA 3ATUA 4ILJA 4H4OA 4K41A 5AZIA 4IBNA 1NK0A 2KQ2A 3ULEA 3V9WA 4ZTFA 1YJNN 3CFOA 2NRTA 4A61A 1NGJA 4XH4A 1EO1A 4IJNA 4A59A 1S9EA 5JLFA 3HOTA 3RMDA 4DCHA 3DXKA 4DLEA 2KHOA 1D9DA 4LD0A 4AHSA 5J2MA 3T7ZA 3L2VA 1ZBUA 2P9UB 3NGZA 3MDQA 2E88A 1RDWX 4EAHD 4AM7A 2O8EB 3SYZA 4M42A 1GLLO 4XH5A 1JLQA 3AVKA 2P9KB 5CE3A 2EWSA 2NZTA 5AQHA 1RBUA 2YV0X 1HX1A 4CK2A 4K8XA 2DFEA 3FZFA 2IGIA 3MN6A 4BVPA 3OYBA 4DTJA 2X78A 2BTFA 5HBMA 4KAZA 1KVAA 1A5XA 4H0XB 3UIQA 2GV9A 4BREA 3R1XA 2OZMA 2HSTA 1X9MA 5AQJA 3NF7A 3LDNA 2VCPA 3SUQA 5BN9A 4IDHA 1U2VA 5TKWA 3O3FA 1U04A 1VSIA 3VENA 1KTQA 1MWKA 4BRMA 3V9SA 3VQQA 3VTHA 1VQ7N 3KIOA 4E1JA 2QKBA 1C1CA 4CEQA 3OVNA 1T44A 4CBXA 5HRSA 1C0UA 2ETJA 3CPEA 3SAGA 1HMVA 3DOLA 5M1QA 2P9LB 3O1WA 3VERA 1NKCA 4DQQA 1UA0A 1UA1A 3SK3A 1W97L 4DR2K 4ELVA 2EX3A 3WXKA 4B9UA 2UXCK 5EY4A 3SQ1A 1D9FA 4H5VA 1NGCA 2VWJA 3LWMA 1BGXT 1RT7A 2BANA 3O6WA 1VSJA 1HJOA 1TKZA 1Q9XA 1QQMA 4LF7K 4A5BA 3QO9A 2PYLA 3NDKA 3P5JA 1XQSC 2OTLN 3U9ZA 3P31A 4ZHRA 1HR0K 4DU1A 3O9RA 3VETA 3QBXA 4BVOA 4HUFA 2YCHA 2QEXN 2HHSA 3NF8A 4RW9A 5AQRA 4FJ7A 5ELZA 4M41A 4DQIA 4LSNA 1BUPA 3VEYA 1TUYA 1NMDA 2QWQA 4NXNK 2DFFA 5KGWA 1BIUA 3OW2M 5AQMA 1YAGA 4CF0A 1S3XA 2RKIA 1FKOA 3OYKA 1IBMK 2YHWA 3CJ1A 3ZYYX 1WSIA 3SPZA 4LFBK 4PKGA 3TPQA 3ZX0A 4JHDA 2OCEA 1GLCG 2ZQBA 3RTVA 1RGIA 4Z4HA 5FPNA 3UKRA 4FLWA 3VF4A 2WTUA 3C6UA 2Z1IA 1JLGA 4YDUC 2BUPA 1RTDA 3QFPA 3SAHA 2YNGA 4F4KA 1BU6O 3KKSA 4QOZB 3LL3A 5GAHP 3QB0A 2FF6A 3DYAA 2HHQA 4BGBA 4CFCA 1CXQA 3P4IA 4V19S 1ASUA 1QSYA 4OLAA 4IFEA 3HVTA 3EKUA 3TAMA 1OVQA 3VQBA 4DTPA 2UUBK 2PZSA 1GLDG 5HL7L 2OPSA 3E9LA 4H5NA 3RRGA 2D1KA 2HMPA 3F5TA 4B1UB 3KK3A 3D2FB 3R6MA 5EOYA 3O9QA 4QS7A 4BRKA 5DMRA 4CI6A 3W3DA 4MDAA 1Q7YO 3C65A 3KK7A 3IAYA 5BRFA 2A5XA 1K8KA 4DSKA 2QWPA 3O1BA 2QWMA 3TSQA 3QERA 2ZD1A 2E2QA 3LDSA 4C8NA 1RBSA 2KFNA 5EXWA 4M3WA 2IOCA 4DWIA 1Z6RA 4DTOA 2JGUA 5B8HA 3VN5A 3O5BA 4H8KA 4FXDA 1WN7A 3TAGA 1RT3A 3VQ4A 3DLGA 3VQ9A 2P51A 4KI6A 3KTQA 4FJKA 3V4IA 4IO8A 2O8BA 1K6YA 1DEJA 4KHNA 3G10A 3QEPA 1SS6A 4BRCA 3S3NA 3KWGA 3MCPA 3V1OA 2O4IA 1YHQN 3UB5A 3TWHA 3M8RA 3NH1A 2YKNA 1K9MO 4FJNA 2HBKA 3NF9A 4FM2A 3JS6A 3C95A 1VQKN 3D6RA 2FXUA 3C7NA 2DTUA 4JKAA 2I7NA 4J8FA 3K58A 1RBTA 3K57A 1HKCA 5AQKA 3QFUA 1VSEA 4DFKA 3ZT3A 1KFDA 2A6AA 2WONA 2XHBA 3VEOA 3OBWA 1RTHA 1RDAA 4PL7A 2YJEA 4KRFA 4DG1A 2P9IA 3TR8A 2ASOA 1XNRK 1JLAA 3F9MA 3CQXA 3Q7BA 3U3YA 5MLCQ 3GBTA 2DPNA 5GADP 5SWMA 4LC9B 1N5YA 1NGHA 1QVFM 1NK5A 5M1PA 5LL6Z 2A42A 3H45C 3TI0A 3HP9A 4IJAA 4MDBA 2GUIA 1LAVA 1KFSA 3HK2A 2IVOA 2W42A 4XH1A 3OYJA 2E2NA 3K59A 5FPMA 3VQEA 3LDOA 4JKGA 2D0OA 4TSXA 2NRHA 4ICLA 2ASPA 1I3AA 2NRWA 4W5TA 1ITGA 3G4SN 4B1ZA 4BR0A 4X65K 1VAZA 2A3ZA 4CVNE 3V9UA 2GX9A 4I6MA 1KCFA 4NLBA 3PY8A 3VGLA 3FE1A 1ATRA 3QINA 3AVLA 4OGEA 5EU7A 2ZM6K 1KVBA 1NOYA 3MXIA 1ZBSA 2XRIA 1XMOK 4FWRA 1NJWA 5BREA 3THWA 3CC7N 3D2EB 3ENOA 5AR0A 4U67L 1NNEA 3AVMA 3MN5A 4NO7A 1T7PA 5GIOA 1Z05A 4M3TA 3LDLA 2HNYA 4DQ8A 5AQSA 4JI7K 4GNIA 3SBTA 1FJGK 3SPYA 4FWPA 1WSFA 1S1VA 1NK9A 4JN4A 4PA1A 4DV7K 4QAGA 1B9DA 3S3OA 4O8KA 3MMVA 3CJ9A 2D0BA 3DJCA 3KHYA 2E1YA 3AVAA 4FJ8A 2PFUA 5AQVA 2YHYA 4E7JA 1TYQA 1IKWA 4CZKA 4LF6K 4DR1K 1DLOA 3L4QA 1Y64A 5BRHA 4CEZA 4B1YB 1LW0A 4CZFA 3AAPA 3M1FA 4X66K 3THYA 4YOXA 4MQ3A 4FZZA 1BDGA 1TK5A 4YY3K 2W41A 5BPLA 4LF9K 4BQLA 2GEMA 1NGEA 4O0IA 4DTNA 1IBKK 4B9VA 4KKOA 4G9ZA 2QM1A 3EE9A 3HT3A 3ZSZA 1S1WA 4FJXA 1ILYA 4CCHA 3KVGA 4NYFA 4AHVA 4E19A 3TAQA 4A62A 3HBTA 1WSGA 5FDLA 3QIOA 4DFPA 3NF6A 5AZJB 4CJSA 4B08A 2O8DB 1SQKA 2Q0RA 4JK9A 4M3RA 1NJIO 1OH8A 4OPKA 3HPOA 2A1SA 1JXBA 2P9SB 3VQDA 4IXCA 3MX5A 1IG8A 4FCYA 4NCGA 1TK0A 3WQTA 4KH6A 4KV8A 4FW2A 2QWOA 3K0SA 4FM1A 3T3FA 3ZX2A 1B9FA 1XHXA 4RTFD 4B3SK 3L2WA 1RCHA 1RILA 1BIZA 4JS4A 1WSEA 2VWBA 1YTUA 5TKYA 5DK5A 4GKKK 3SV4A 3NGYA 4BRQA 4GV3A 1NGFA 3D0PA 4DSJA 4CEEA 4CJKA 1Q9YA 4H5WA 4N5SA 3AO2A 3N4PA 3VQAA 3WEEA 4WQ4C 2Q31A 4RCHA 3FZHA 1RBVA 3EY1A 3A5LC 1KD1O 2UYTA 1DT9A 3TARA 2NRXA 1T03A 5EVZA 3DM2A 3PLAA 3L3VA 3PO4A 4CJ3A 5T7BA 3A5NC 1BWFO 1U47A 3SLCA 1CZBA 3ZEUA 3PIPL 2HF3A 5KPRA 4AHCA 2UXDK 3CHWA 3HJFA 4E1NA 3VEVA 4KTQA 2FSKA 3M3ZA 5GINA 4CZEA 4CJUA 4WCEL 1TK8A 4FLUA 1C0FA 3KZBA 1WAFA 3QEVA 2PYJA 4KH5A 1VQMN 2E5LK 4DSIA 1NWKA 4E7HA 2XY7A 2KFZA 2D5RA 1WSHA 1TUUA 4KHWA 2P9PA 4MO4A 1TKTA 1JL1A 1ASVA 5HOOA 1X1PA 3NH0A 3L3UA 4B1XB 2HVHA 2RE2A 1JJ2M 3JYTA 4B9SA 4KTZA 3MX2A 5AQXA 1V4TA 4AHTA 4F2SA 2HBJA 3SV3A 1TL3A 1L5UA 1RDUA 1BG3A 4W5NA 4OKEA 1OH5A 1L3TA 2CGKA 3AO1A 1N6QA 2F8SA 1N8RO
chains in the Genus database with same CATH topology
2VWJA 4OJRA 3AVFA 4MFBA 4W5RA 1ZYQA 4KB0A 3LWMA 2G8UA 5I42A 1KLNA 1A5WA 1BGXT 1RT7A 2BANA 1BISA 1JLBA 1VSJA 2ATQA 4RG8A 4CIGA 3CFPA 4OPJA 1TKZA 4BWJA 4CJEA 1Q9XA 3OS2A 3I0SA 4LH5A 3QO9A 1L3SA 3NDKA 3P5JA 1NJZA 2BDPA 2PYLA 3KK2A 3LZJA 1BHLA 4ZHRA 1LV5A 5HRRA 4DU1A 1J54A 1C1AA 3LP0A 5KI6A 4AHRA 3NE6A 5C42A 3KLFA 3OY9A 4HUFA 4GW6A 2OYQA 4ZTJA 3DMJA 3HSTB 3NF8A 4RW9A 5JS2A 4M41A 5HRNA 3HM9A 2G8VA 2EHGA 4DQIA 4FJ7A 4FK0A 2YHBA 3NCIA 4E7IA 4LSNA 1HRHA 3VQ6A 3NH2A 3MXJA 3KD1E 2DFFA 5KGWA 2KZMA 3CG7A 1BIUA 3OYGA 3OS1A 3EYZA 1Z25A 4DTUA 4CF0A 2RKIA 4KFBA 3ULDA 4DS4A 1FKOA 1IKXA 3OYKA 4CHZA 1WSIA 3SPZA 1EKEA 3DRRA 1D5AA 3AVHA 2G8KA 3O3GA 1HPZA 3EZ5A 5C24A 3SNNA 3WNHA 3OJSA 2HVIA 1RNHA 2NUBA 4DTMA 2ZQBA 3RTVA 4BE0A 1QTMA 4PUOA 2FBXA 4B9TA 3M8QA 4CJTA 1VSHA 1C1BA 1S5JA 1Q8IA 1U4BA 3AVIA 4Z4HA 4FM0A 1IKYA 2RPIA 1S6PA 3QETA 4FLWA 2QK9A 3L8BA 4EZ6A 4DQSA 3C6UA 2Z1IA 3QLHA 1JLGA 3S9HA 4FJMA 3B6OA 2VWKA 2OPQA 1B92A 3DLHA 4CK1A 3O3HA 4JRPA 3I8DA 3SJJA 1NK6A 1RTDA 1JXEA 2YNGA 3OYFA 4KO0A 4CERA 2OA8A 4F4KA 3KKSA 3NFAA 3HPHA 4J2BA 2KZZA 4E0DA 4QOZB 2PY5A 1R0AA 4DF4A 2F8TA 1QQCA 1S9GA 1ASWA 3O4QA 3AVBA 1NK4A 2HHTA 3OS0A 4IG0A 1EX4A 1NKBA 3DYAA 1TV6A 1IKVA 2G8WA 5FROA 1QHTA 2HHQA 4FZYA 4H4MA 4OGCA 4CFCA 2KW4A 4CJ5A 1SKRA 1CXQA 1FXXA 1BQMA 1O1WA 4KHUA 4E7KA 3CM6A 1ASUA 1QSSA 1BQNA 4ID5A 5CY4A 4BDZA 4DLGA 4G1QA 2E4LA 1QSYA 4B9NA 2BGGA 4OLAA 4LH4A 3HVTA 4E7LA 3HO1A 3TAMA 1S1XA 1VSLA 1RTIA 3VQBA 5SZTA 3U3GA 4DTPA 4FW1A 2XY5A 1X9SA 4ID1A 2PZSA 4RW6A 1C6VA 1CXUA 4CHPA 3OYIA 4FJHA 1HYSA 1VK0A 4O44A 2OPSA 3RRGA 1VSFA 1LAWA 3LPTA 3F73A 4FLZA 4FJLA 3LZIA 3I0RA 4F8RA 4Z4EA 4HUGA 1UWBA 4F2RA 4O0JA 1QS4A 4EP5A 1CLQA 1RT4A 3KK3A 3NHGA 4BACA 3ZSWA 4AH9A 1SKSA 2OPPA 5DMRA 3RRHA 4E1MA 3HPGA 3AO5A 3K5LA 4YNQA 2WOMA 3SI6A 4FJIA 5CZ1A 3VQ8A 1JL2A 3BGRA 1SL0A 3ALYA 2XY8A 3KD5E 3L2UA 3IAYA 4ELTA 1VRUA 4DSKA 4BE1A 2HB5A 3C94A 2E6MA 4FLYA 1RTJA 3TAFA 1GOAA 3QERA 2ZD1A 2XY6A 4CEDA 3AVGA 1VSMA 1SUQA 4CF1A 3LDSA 4C8NA 1RBSA 4BE2A 2KFNA 4CGHA 4CGGA 3V9XA 4M3WA 1RDCA 2IOCA 4OKJA 5J1EA 3L2QA 5FRNA 4DWIA 4DTOA 2JGUA 1L5UA 4B8AB 3VN5A 4H8KA 4WE1A 1BCOA 1QSLA 1WN7A 4C8MA 1SL2A 3B6PA 2P5OA 4FXDA 3TAGA 1RT3A 3VQ4A 1S1TA 3LWLA 4UQGA 3DLGA 4FZXC 3VQ9A 2P51A 1REVA 3KTQA 2FBTA 4HHTA 1T8EA 4FJKA 4KI6A 3V4IA 1IG9A 1K6YA 3ZT0A 4KHNA 2RF2A 3G10A 3LALA 3QEPA 4CEOA 2FBYA 4I2QA 3S3NA 3V1OA 2O4IA 4FK2A 4IG3A 2GBZA 4O55A 3QEWA 3TWHA 4CF8A 4YFUA 3M8RA 4E3SA 3NH1A 1I39A 2YKNA 4FJNA 2ZE2A 3NF9A 4FM2A 2BE2A 3RR8A 4KHSA 3AA2A 3ZSRA 4PWDA 3C95A 4M45A 3K5NA 2IC3A 1HYVA 4N76A 1LWFA 3DLKA 1D8YA 4GMJB 4I2PA 4DTRA 2DTUA 1KSPA 3KLIA 3ITHA 3K58A 2R7YA 4DSLA 1RBTA 3K57A 4CJ4A 3OJUA 3PX0A 2P5GA 4FVMA 3IG1A 3O4NA 2Z1JA 4B8CA 4KI4A 3ZSXA 4Y1CA 4M3XA 1VSEA 4DFKA 1U48A 3P83D 3ZT3A 3BDPA 2F96A 5D3GA 1J53A 1KFDA 2IDOA 2WONA 2XHBA 2Q3SA 5C25A 3K2PA 4O5BA 1J9AA 3AA4A 1RDAA 1RTHA 3HVRA 1IO2A 2HNDA 3DI6A 3QIPA 2Y1JA 2Y1IA 4DG1A 4KRFA 2HHVA 1RT6A 3TR8A 1JLAA 3K5MA 2D0AA 2AJQA 1A5VA 3U3YA 4FJGA 4CF2A 4M3UA 3SCXA 3DOKA 2HMIA 4XIUA 2O4GA 5SWMA 1N5YA 4M3ZA 4W5NA 4DS5A 3K5OA 1IH7A 5HLFA 1RT1A 1NK5A 4BDPA 3OYCA 3QNNA 4OLBA 3TI0A 4C8LA 3P1GA 3G0ZA 4E89A 2HW3A 2YKMA 4CK3A 3SQ0A 3HP9A 3A2FA 5KRSA 2GUIA 1LAVA 4AHUA 4CGFA 3CFRA 3AV9A 4DFJA 1KFSA 2QKKA 1JKHA 3NAEA 3HK2A 2YNHA 2W42A 3AA5X 4CE9A 2KTQA 4KHQA 3DLEA 3OYJA 2D0CA 4R5PA 4IDKA 3VQEA 3K59A 1NK7A 4JLHA 4DSFA 1F21A 3ZSQA 4TSXA 1I3AA 2I5JA 4ICLA 2XO7A 2HHWA 4GVMA 4W5TA 1TVRA 3WNGA 1DTTA 1S1UA 1SKWA 1ITGA 1CZ9A 1BI4A 1W9HA 1Y97A 4DSEA 3V9UA 1L3UA 1X9WA 3RWUA 4F3TA 1KCFA 3AO4A 1VSDA 1JLCA 1EXQA 2B4JA 3LP2A 3PY8A 2OZSA 4CJWA 3LAMA 4CHOA 4DFMA 3QINA 1NJYA 2HNZA 3AVLA 1LWEA 4OGEA 5EU7A 3OYLA 4DU3A 5J2PA 1KVBA 3RMCA 1RT5A 1NOYA 4F3OA 4QCLA 3MXIA 4NCBA 1NOZA 4M3YA 3PX6A 1ZBLA 3VA0A 1KLMA 4Z4FA 2XRIA 4CEFA 3OYNA 1NJWA 3T1AA 4CJVA 3PUFA 4B9LA 4J2DA 2X6SA 4CFAA 5KGXA 2B6AA 3H08A 3AVMA 3MECA 3KLEA 2B5JA 1TKDA 2JLEA 4FJJA 4CHNA 2VG5A 4CIEA 1T7PA 3ZT1A 3PV8A 3AVCA 4M3TA 3FFIA 3AVJA 3KKRA 4N56A 2HNYA 2G8HA 4B3OA 2HHXA 3MXMA 4FLTA 3QEXA 2VG7A 1MU2A 3TAPA 3QESA 2X74A 3MAQA 3SPYA 2A1RA 3D45A 3V9ZA 3LANA 4Q0BA 4CEBA 2HHSA 2FC0A 3ISNC 3E01A 1WSFA 3RR7A 1NKEA 3THVA 1W0HA 4DQPA 1S1VA 3NBPA 3V1QA 4DTSA 4J2EA 1HNVA 4BWMA 4ELUA 1NK9A 4PA1A 3QNOA 3F9KA 3SQ4A 3S3MA 1WNSA 3V81A 4CIFA 5JS1A 4QAGA 1B9DA 3S3OA 4N41A 1RDDA 1QE1A 5FRMA 3OYEA 4CEAA 5CZ2A 3PX4A 5KRTA 2D0BA 1VRTA 3AVAA 3VQ7A 4FJ8A 4C8OA 4E7JA 3MEGA 4CHYA 4JS5A 1KRPA 4L8RB 1IKWA 2DFHA 1TL1A 1Z26A 1NJXA 3SUOA 1YVUA 3OYMA 2G8FA 3CM5A 4NCAA 3VQ5A 3IS9A 4Z4CA 1TAUA 1DLOA 4DU4A 4I7FA 4I9LA 4CEZA 1NK8A 3LAKA 3TANA 1LW0A 4KTWA 4DMNA 4CGDA 4RW8A 4CJFA 2LSNA 3V6DA 4MQ3A 4Y1DA 4FZZA 1TK5A 2ITGA 4N47A 3HP6A 4FK4A 4NYNA 4O4GA 4CFBA 3LP1A 3KLHA 4AILC 3OYAA 5E41A 4O0IA 4DTNA 1TKXA 4B9VA 3DLBA 4KKOA 3CQ8A 3HT3A 3NGIA 3WNFA 3ZSZA 1XC9A 1SL1A 4IKFA 1BCMA 1S1WA 5K14A 3V1RA 4FJXA 2YNFA 4IFYA 4CCHA 4FJ9A 4NYFA 4CJPA 1LW2A 3DRSA 3PO5A 4AHVA 4E19A 3C6TA 3VQCA 3ZSYA 4LY7A 4BDYA 3TAQA 2G8IA 1TGOA 1U49A 1WSGA 5FDLA 3QIOA 4HUEA 1YTAA 4DFPA 3NF6A 1GOBA 4FLVA 4CFDA 1JLEA 1HJRA 4B08A 4CJSA 4Q5VA 3KK1A 3IRXA 4DF8A 5CYMA 4M3RA 2Z1GA 4H4OA 4OPKA 5I3UA 1C0TA 4CJRA 4IBNA 1NK0A 3HPOA 2A1SA 3AVNA 1JXBA 2KQ2A 3SUNA 4DQRA 3VQDA 4K8ZA 3VQPA 3T19A 4FCYA 3V9WA 1RDBA 5KTQA 4ZTFA 1S6QA 2YNIA 3JSMA 3CFOA 4NCGA 1TK0A 3ZCMA 4KV8A 1S9EA 2QXFA 4FW2A 3SZ2A 4FM1A 3RMDA 3T3FA 4DLEA 4CJLA 3SUPA 1RT2A 1B9FA 1XHXA 1WLJA 3L2RA 1L3VA 3VA3A 1D9DA 1JLFA 5CYQA 4LD0A 4OVLA 4AHSA 4HVJA 3L2VA 5J2MA 3L2WA 1RCHA 1RILA 1BIZA 4KPYA 1ZBUA 4Z4GA 1YT3A 1HYZA 4JS4A 1T05A 1WSEA 1WAJA 3WNEA 4DTXA 3RMBA 1TAQA 1YTUA 3NGZA 4HCCA 4CGJA 2E6LA 3TAEA 2FBVA 3MEEA 1EETA 1HQUA 1FK9A 5DK5A 3SV4A 3NGYA 3M8SA 3HXMA 3TABA 1KVCA 2Z1HA 3SYZA 4M42A 2YHAA 1ZBIA 3LP3A 1JLQA 4CEEA 3D0PA 4DSJA 3AVKA 3AO3A 4CJKA 1Q9YA 4N5SA 2P1JA 4HCBA 3AO2A 1RBRA 3VQAA 4LSLA 4KREA 3DRPA 5J2NA 3EY1A 1EP4A 1RBVA 2IS3A 1RBUA 4Z0UA 3DLRA 3HYFA 3TARA 4HTUA 2YV0X 1T03A 1U45A 5HRPA 1XWLA 3DM2A 3U6FA 4I9QA 3L3VA 4CK2A 3PO4A 4K8XA 2DFEA 4CJ3A 5T7BA 1VSKA 2IGIA 3M8PA 1U47A 4CHQA 4Z4IA 1CZBA 3OYBA 4DTJA 1J5OA 2X78A 1G15A 5HBMA 4AHCA 4ELVA 4KAZA 1KVAA 1A5XA 1HNIA 4B9MA 1BI4B 4CGIA 4E1NA 4FLXA 4KTQA 3HJFA 3UIQA 3QEIA 2GV9A 1BL3A 4PY5A 4CJQA 4CJUA 4OKKA 2OZMA 1X9MA 1LWCA 1TK8A 4FLUA 3ASMA 3NF7A 4PQUA 4JRQA 4J2AA 1GOCA 1ZBHA 1WAFA 3ZT4A 5J2QA 3OYHA 3QEVA 3AA3A 2X6NA 4CESA 3SUQA 2PYJA 3LPUA 3ZSOA 1XHZA 4DSIA 1UOCA 2XY7A 4E7HA 4W5QA 1ZBFA 3O3FA 1U04A 2D5RA 1VSIA 4KB1A 1KTQA 1WSHA 3V9SA 2KFZA 3VQQA 4KHWA 2DY4A 2VG6A 3ZSVA 1DTQA 4CF9A 3HL8A 1TKTA 3KIOA 3MEDA 1JL1A 1ASVA 4FJ5A 1C1CA 2QKBA 2IAJA 1HQEA 3OVNA 4CEQA 4FYDA 1FKPA 1X1PA 5HRSA 1C0UA 4RW7A 2ETJA 4EP4A 4W5OA 3NH0A 3ZT2A 3L3UA 4C8KA 2HVHA 1HMVA 3JYTA 3RMAA 4B9SA 4KTZA 3DOLA 2HHUA 3OYDA 4AHTA 4F2SA 1XI1A 1NKCA 2OPRA 3SQ2A 5HROA 5HP1A 4CECA 4DQQA 1WSJA 3SV3A 1TL3A 1UA0A 1UA1A 1C0MA 2RN2A 4IFVA 4OKEA 1SV5A 4RW4A 3KLGA 2EX3A 1L3TA 1UAXA 4B9UA 4KHYA 3KJVA 3AO1A 4EZ9A 3SQ1A 1N6QA 1D9FA 3CYMA 2F8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWJ A;  4OJR A;  3AVF A;  4MFB A;  4W5R A;  1ZYQ A;  4KB0 A;  3LWM A;  2G8U A;  5I42 A;  1KLN A;  1A5W A;  1BGX T;  1RT7 A;  2BAN A;  1BIS A;  1JLB A;  1VSJ A;  2ATQ A;  4RG8 A;  4CIG A;  3CFP A;  4OPJ A;  1TKZ A;  4BWJ A;  4CJE A;  1Q9X A;  3OS2 A;  3I0S A;  4LH5 A;  3QO9 A;  1L3S A;  3NDK A;  3P5J A;  1NJZ A;  2BDP A;  2PYL A;  3KK2 A;  3LZJ A;  1BHL A;  4ZHR A;  1LV5 A;  5HRR A;  4DU1 A;  1J54 A;  1C1A A;  3LP0 A;  5KI6 A;  4AHR A;  3NE6 A;  5C42 A;  3KLF A;  3OY9 A;  4HUF A;  4GW6 A;  2OYQ A;  4ZTJ A;  3DMJ A;  3HST B;  3NF8 A;  4RW9 A;  5JS2 A;  4M41 A;  5HRN A;  3HM9 A;  2G8V A;  2EHG A;  4DQI A;  4FJ7 A;  4FK0 A;  2YHB A;  3NCI A;  4E7I A;  4LSN A;  1HRH A;  3VQ6 A;  3NH2 A;  3MXJ A;  3KD1 E;  2DFF A;  5KGW A;  2KZM A;  3CG7 A;  1BIU A;  3OYG A;  3OS1 A;  3EYZ A;  1Z25 A;  4DTU A;  4CF0 A;  2RKI A;  4KFB A;  3ULD A;  4DS4 A;  1FKO A;  1IKX A;  3OYK A;  4CHZ A;  1WSI A;  3SPZ A;  1EKE A;  3DRR A;  1D5A A;  3AVH A;  2G8K A;  3O3G A;  1HPZ A;  3EZ5 A;  5C24 A;  3SNN A;  3WNH A;  3OJS A;  2HVI A;  1RNH A;  2NUB A;  4DTM A;  2ZQB A;  3RTV A;  4BE0 A;  1QTM A;  4PUO A;  2FBX A;  4B9T A;  3M8Q A;  4CJT A;  1VSH A;  1C1B A;  1S5J A;  1Q8I A;  1U4B A;  3AVI A;  4Z4H A;  4FM0 A;  1IKY A;  2RPI A;  1S6P A;  3QET A;  4FLW A;  2QK9 A;  3L8B A;  4EZ6 A;  4DQS A;  3C6U A;  2Z1I A;  3QLH A;  1JLG A;  3S9H A;  4FJM A;  3B6O A;  2VWK A;  2OPQ A;  1B92 A;  3DLH A;  4CK1 A;  3O3H A;  4JRP A;  3I8D A;  3SJJ A;  1NK6 A;  1RTD A;  1JXE A;  2YNG A;  3OYF A;  4KO0 A;  4CER A;  2OA8 A;  4F4K A;  3KKS A;  3NFA A;  3HPH A;  4J2B A;  2KZZ A;  4E0D A;  4QOZ B;  2PY5 A;  1R0A A;  4DF4 A;  2F8T A;  1QQC A;  1S9G A;  1ASW A;  3O4Q A;  3AVB A;  1NK4 A;  2HHT A;  3OS0 A;  4IG0 A;  1EX4 A;  1NKB A;  3DYA A;  1TV6 A;  1IKV A;  2G8W A;  5FRO A;  1QHT A;  2HHQ A;  4FZY A;  4H4M A;  4OGC A;  4CFC A;  2KW4 A;  4CJ5 A;  1SKR A;  1CXQ A;  1FXX A;  1BQM A;  1O1W A;  4KHU A;  4E7K A;  3CM6 A;  1ASU A;  1QSS A;  1BQN A;  4ID5 A;  5CY4 A;  4BDZ A;  4DLG A;  4G1Q A;  2E4L A;  1QSY A;  4B9N A;  2BGG A;  4OLA A;  4LH4 A;  3HVT A;  4E7L A;  3HO1 A;  3TAM A;  1S1X A;  1VSL A;  1RTI A;  3VQB A;  5SZT A;  3U3G A;  4DTP A;  4FW1 A;  2XY5 A;  1X9S A;  4ID1 A;  2PZS A;  4RW6 A;  1C6V A;  1CXU A;  4CHP A;  3OYI A;  4FJH A;  1HYS A;  1VK0 A;  4O44 A;  2OPS A;  3RRG A;  1VSF A;  1LAW A;  3LPT A;  3F73 A;  4FLZ A;  4FJL A;  3LZI A;  3I0R A;  4F8R A;  4Z4E A;  4HUG A;  1UWB A;  4F2R A;  4O0J A;  1QS4 A;  4EP5 A;  1CLQ A;  1RT4 A;  3KK3 A;  3NHG A;  4BAC A;  3ZSW A;  4AH9 A;  1SKS A;  2OPP A;  5DMR A;  3RRH A;  4E1M A;  3HPG A;  3AO5 A;  3K5L A;  4YNQ A;  2WOM A;  3SI6 A;  4FJI A;  5CZ1 A;  3VQ8 A;  1JL2 A;  3BGR A;  1SL0 A;  3ALY A;  2XY8 A;  3KD5 E;  3L2U A;  3IAY A;  4ELT A;  1VRU A;  4DSK A;  4BE1 A;  2HB5 A;  3C94 A;  2E6M A;  4FLY A;  1RTJ A;  3TAF A;  1GOA A;  3QER A;  2ZD1 A;  2XY6 A;  4CED A;  3AVG A;  1VSM A;  1SUQ A;  4CF1 A;  3LDS A;  4C8N A;  1RBS A;  4BE2 A;  2KFN A;  4CGH A;  4CGG A;  3V9X A;  4M3W A;  1RDC A;  2IOC A;  4OKJ A;  5J1E A;  3L2Q A;  5FRN A;  4DWI A;  4DTO A;  2JGU A;  1L5U A;  4B8A B;  3VN5 A;  4H8K A;  4WE1 A;  1BCO A;  1QSL A;  1WN7 A;  4C8M A;  1SL2 A;  3B6P A;  2P5O A;  4FXD A;  3TAG A;  1RT3 A;  3VQ4 A;  1S1T A;  3LWL A;  4UQG A;  3DLG A;  4FZX C;  3VQ9 A;  2P51 A;  1REV A;  3KTQ A;  2FBT A;  4HHT A;  1T8E A;  4FJK A;  4KI6 A;  3V4I A;  1IG9 A;  1K6Y A;  3ZT0 A;  4KHN A;  2RF2 A;  3G10 A;  3LAL A;  3QEP A;  4CEO A;  2FBY A;  4I2Q A;  3S3N A;  3V1O A;  2O4I A;  4FK2 A;  4IG3 A;  2GBZ A;  4O55 A;  3QEW A;  3TWH A;  4CF8 A;  4YFU A;  3M8R A;  4E3S A;  3NH1 A;  1I39 A;  2YKN A;  4FJN A;  2ZE2 A;  3NF9 A;  4FM2 A;  2BE2 A;  3RR8 A;  4KHS A;  3AA2 A;  3ZSR A;  4PWD A;  3C95 A;  4M45 A;  3K5N A;  2IC3 A;  1HYV A;  4N76 A;  1LWF A;  3DLK A;  1D8Y A;  4GMJ B;  4I2P A;  4DTR A;  2DTU A;  1KSP A;  3KLI A;  3ITH A;  3K58 A;  2R7Y A;  4DSL A;  1RBT A;  3K57 A;  4CJ4 A;  3OJU A;  3PX0 A;  2P5G A;  4FVM A;  3IG1 A;  3O4N A;  2Z1J A;  4B8C A;  4KI4 A;  3ZSX A;  4Y1C A;  4M3X A;  1VSE A;  4DFK A;  1U48 A;  3P83 D;  3ZT3 A;  3BDP A;  2F96 A;  5D3G A;  1J53 A;  1KFD A;  2IDO A;  2WON A;  2XHB A;  2Q3S A;  5C25 A;  3K2P A;  4O5B A;  1J9A A;  3AA4 A;  1RDA A;  1RTH A;  3HVR A;  1IO2 A;  2HND A;  3DI6 A;  3QIP A;  2Y1J A;  2Y1I A;  4DG1 A;  4KRF A;  2HHV A;  1RT6 A;  3TR8 A;  1JLA A;  3K5M A;  2D0A A;  2AJQ A;  1A5V A;  3U3Y A;  4FJG A;  4CF2 A;  4M3U A;  3SCX A;  3DOK A;  2HMI A;  4XIU A;  2O4G A;  5SWM A;  1N5Y A;  4M3Z A;  4W5N A;  4DS5 A;  3K5O A;  1IH7 A;  5HLF A;  1RT1 A;  1NK5 A;  4BDP A;  3OYC A;  3QNN A;  4OLB A;  3TI0 A;  4C8L A;  3P1G A;  3G0Z A;  4E89 A;  2HW3 A;  2YKM A;  4CK3 A;  3SQ0 A;  3HP9 A;  3A2F A;  5KRS A;  2GUI A;  1LAV A;  4AHU A;  4CGF A;  3CFR A;  3AV9 A;  4DFJ A;  1KFS A;  2QKK A;  1JKH A;  3NAE A;  3HK2 A;  2YNH A;  2W42 A;  3AA5 X;  4CE9 A;  2KTQ A;  4KHQ A;  3DLE A;  3OYJ A;  2D0C A;  4R5P A;  4IDK A;  3VQE A;  3K59 A;  1NK7 A;  4JLH A;  4DSF A;  1F21 A;  3ZSQ A;  4TSX A;  1I3A A;  2I5J A;  4ICL A;  2XO7 A;  2HHW A;  4GVM A;  4W5T A;  1TVR A;  3WNG A;  1DTT A;  1S1U A;  1SKW A;  1ITG A;  1CZ9 A;  1BI4 A;  1W9H A;  1Y97 A;  4DSE A;  3V9U A;  1L3U A;  1X9W A;  3RWU A;  4F3T A;  1KCF A;  3AO4 A;  1VSD A;  1JLC A;  1EXQ A;  2B4J A;  3LP2 A;  3PY8 A;  2OZS A;  4CJW A;  3LAM A;  4CHO A;  4DFM A;  3QIN A;  1NJY A;  2HNZ A;  3AVL A;  1LWE A;  4OGE A;  5EU7 A;  3OYL A;  4DU3 A;  5J2P A;  1KVB A;  3RMC A;  1RT5 A;  1NOY A;  4F3O A;  4QCL A;  3MXI A;  4NCB A;  1NOZ A;  4M3Y A;  3PX6 A;  1ZBL A;  3VA0 A;  1KLM A;  4Z4F A;  2XRI A;  4CEF A;  3OYN A;  1NJW A;  3T1A A;  4CJV A;  3PUF A;  4B9L A;  4J2D A;  2X6S A;  4CFA A;  5KGX A;  2B6A A;  3H08 A;  3AVM A;  3MEC A;  3KLE A;  2B5J A;  1TKD A;  2JLE A;  4FJJ A;  4CHN A;  2VG5 A;  4CIE A;  1T7P A;  3ZT1 A;  3PV8 A;  3AVC A;  4M3T A;  3FFI A;  3AVJ A;  3KKR A;  4N56 A;  2HNY A;  2G8H A;  4B3O A;  2HHX A;  3MXM A;  4FLT A;  3QEX A;  2VG7 A;  1MU2 A;  3TAP A;  3QES A;  2X74 A;  3MAQ A;  3SPY A;  2A1R A;  3D45 A;  3V9Z A;  3LAN A;  4Q0B A;  4CEB A;  2HHS A;  2FC0 A;  3ISN C;  3E01 A;  1WSF A;  3RR7 A;  1NKE A;  3THV A;  1W0H A;  4DQP A;  1S1V A;  3NBP A;  3V1Q A;  4DTS A;  4J2E A;  1HNV A;  4BWM A;  4ELU A;  1NK9 A;  4PA1 A;  3QNO A;  3F9K A;  3SQ4 A;  3S3M A;  1WNS A;  3V81 A;  4CIF A;  5JS1 A;  4QAG A;  1B9D A;  3S3O A;  4N41 A;  1RDD A;  1QE1 A;  5FRM A;  3OYE A;  4CEA A;  5CZ2 A;  3PX4 A;  5KRT A;  2D0B A;  1VRT A;  3AVA A;  3VQ7 A;  4FJ8 A;  4C8O A;  4E7J A;  3MEG A;  4CHY A;  4JS5 A;  1KRP A;  4L8R B;  1IKW A;  2DFH A;  1TL1 A;  1Z26 A;  1NJX A;  3SUO A;  1YVU A;  3OYM A;  2G8F A;  3CM5 A;  4NCA A;  3VQ5 A;  3IS9 A;  4Z4C A;  1TAU A;  1DLO A;  4DU4 A;  4I7F A;  4I9L A;  4CEZ A;  1NK8 A;  3LAK A;  3TAN A;  1LW0 A;  4KTW A;  4DMN A;  4CGD A;  4RW8 A;  4CJF A;  2LSN A;  3V6D A;  4MQ3 A;  4Y1D A;  4FZZ A;  1TK5 A;  2ITG A;  4N47 A;  3HP6 A;  4FK4 A;  4NYN A;  4O4G A;  4CFB A;  3LP1 A;  3KLH A;  4AIL C;  3OYA A;  5E41 A;  4O0I A;  4DTN A;  1TKX A;  4B9V A;  3DLB A;  4KKO A;  3CQ8 A;  3HT3 A;  3NGI A;  3WNF A;  3ZSZ A;  1XC9 A;  1SL1 A;  4IKF A;  1BCM A;  1S1W A;  5K14 A;  3V1R A;  4FJX A;  2YNF A;  4IFY A;  4CCH A;  4FJ9 A;  4NYF A;  4CJP A;  1LW2 A;  3DRS A;  3PO5 A;  4AHV A;  4E19 A;  3C6T A;  3VQC A;  3ZSY A;  4LY7 A;  4BDY A;  3TAQ A;  2G8I A;  1TGO A;  1U49 A;  1WSG A;  5FDL A;  3QIO A;  4HUE A;  1YTA A;  4DFP A;  3NF6 A;  1GOB A;  4FLV A;  4CFD A;  1JLE A;  1HJR A;  4B08 A;  4CJS A;  4Q5V A;  3KK1 A;  3IRX A;  4DF8 A;  5CYM A;  4M3R A;  2Z1G A;  4H4O A;  4OPK A;  5I3U A;  1C0T A;  4CJR A;  4IBN A;  1NK0 A;  3HPO A;  2A1S A;  3AVN A;  1JXB A;  2KQ2 A;  3SUN A;  4DQR A;  3VQD A;  4K8Z A;  3VQP A;  3T19 A;  4FCY A;  3V9W A;  1RDB A;  5KTQ A;  4ZTF A;  1S6Q A;  2YNI A;  3JSM A;  3CFO A;  4NCG A;  1TK0 A;  3ZCM A;  4KV8 A;  1S9E A;  2QXF A;  4FW2 A;  3SZ2 A;  4FM1 A;  3RMD A;  3T3F A;  4DLE A;  4CJL A;  3SUP A;  1RT2 A;  1B9F A;  1XHX A;  1WLJ A;  3L2R A;  1L3V A;  3VA3 A;  1D9D A;  1JLF A;  5CYQ A;  4LD0 A;  4OVL A;  4AHS A;  4HVJ A;  3L2V A;  5J2M A;  3L2W A;  1RCH A;  1RIL A;  1BIZ A;  4KPY A;  1ZBU A;  4Z4G A;  1YT3 A;  1HYZ A;  4JS4 A;  1T05 A;  1WSE A;  1WAJ A;  3WNE A;  4DTX A;  3RMB A;  1TAQ A;  1YTU A;  3NGZ A;  4HCC A;  4CGJ A;  2E6L A;  3TAE A;  2FBV A;  3MEE A;  1EET A;  1HQU A;  1FK9 A;  5DK5 A;  3SV4 A;  3NGY A;  3M8S A;  3HXM A;  3TAB A;  1KVC A;  2Z1H A;  3SYZ A;  4M42 A;  2YHA A;  1ZBI A;  3LP3 A;  1JLQ A;  4CEE A;  3D0P A;  4DSJ A;  3AVK A;  3AO3 A;  4CJK A;  1Q9Y A;  4N5S A;  2P1J A;  4HCB A;  3AO2 A;  1RBR A;  3VQA A;  4LSL A;  4KRE A;  3DRP A;  5J2N A;  3EY1 A;  1EP4 A;  1RBV A;  2IS3 A;  1RBU A;  4Z0U A;  3DLR A;  3HYF A;  3TAR A;  4HTU A;  2YV0 X;  1T03 A;  1U45 A;  5HRP A;  1XWL A;  3DM2 A;  3U6F A;  4I9Q A;  3L3V A;  4CK2 A;  3PO4 A;  4K8X A;  2DFE A;  4CJ3 A;  5T7B A;  1VSK A;  2IGI A;  3M8P A;  1U47 A;  4CHQ A;  4Z4I A;  1CZB A;  3OYB A;  4DTJ A;  1J5O A;  2X78 A;  1G15 A;  5HBM A;  4AHC A;  4ELV A;  4KAZ A;  1KVA A;  1A5X A;  1HNI A;  4B9M A;  1BI4 B;  4CGI A;  4E1N A;  4FLX A;  4KTQ A;  3HJF A;  3UIQ A;  3QEI A;  2GV9 A;  1BL3 A;  4PY5 A;  4CJQ A;  4CJU A;  4OKK A;  2OZM A;  1X9M A;  1LWC A;  1TK8 A;  4FLU A;  3ASM A;  3NF7 A;  4PQU A;  4JRQ A;  4J2A A;  1GOC A;  1ZBH A;  1WAF A;  3ZT4 A;  5J2Q A;  3OYH A;  3QEV A;  3AA3 A;  2X6N A;  4CES A;  3SUQ A;  2PYJ A;  3LPU A;  3ZSO A;  1XHZ A;  4DSI A;  1UOC A;  2XY7 A;  4E7H A;  4W5Q A;  1ZBF A;  3O3F A;  1U04 A;  2D5R A;  1VSI A;  4KB1 A;  1KTQ A;  1WSH A;  3V9S A;  2KFZ A;  3VQQ A;  4KHW A;  2DY4 A;  2VG6 A;  3ZSV A;  1DTQ A;  4CF9 A;  3HL8 A;  1TKT A;  3KIO A;  3MED A;  1JL1 A;  1ASV A;  4FJ5 A;  1C1C A;  2QKB A;  2IAJ A;  1HQE A;  3OVN A;  4CEQ A;  4FYD A;  1FKP A;  1X1P A;  5HRS A;  1C0U A;  4RW7 A;  2ETJ A;  4EP4 A;  4W5O A;  3NH0 A;  3ZT2 A;  3L3U A;  4C8K A;  2HVH A;  1HMV A;  3JYT A;  3RMA A;  4B9S A;  4KTZ A;  3DOL A;  2HHU A;  3OYD A;  4AHT A;  4F2S A;  1XI1 A;  1NKC A;  2OPR A;  3SQ2 A;  5HRO A;  5HP1 A;  4CEC A;  4DQQ A;  1WSJ A;  3SV3 A;  1TL3 A;  1UA0 A;  1UA1 A;  1C0M A;  2RN2 A;  4IFV A;  4OKE A;  1SV5 A;  4RW4 A;  3KLG A;  2EX3 A;  1L3T A;  1UAX A;  4B9U A;  4KHY A;  3KJV A;  3AO1 A;  4EZ9 A;  3SQ1 A;  1N6Q A;  1D9F A;  3CYM A;  2F8S A; 
#chains in the Genus database with same CATH topology
 4OJR A;  1ZYQ A;  4W5R A;  4KB0 A;  1N36 K;  5I42 A;  4WQ5 C;  5DM7 L;  2D4W A;  4WQ5 A;  2ATQ A;  4BWJ A;  4IOA L;  3MWP A;  4CJE A;  1L3S A;  1NJZ A;  3KK2 A;  1LV5 A;  3BF3 A;  1E3M A;  3CCE N;  4GW6 A;  4BG8 A;  3HST B;  2QXL A;  3H6E A;  3NCI A;  4E7I A;  3OBY A;  3C0B A;  4CZJ A;  2KZM A;  4DR5 K;  3EYZ A;  1Z25 A;  3J81 O;  4KFB A;  3T1H K;  4CHZ A;  3NVK A;  1D5A A;  3AVH A;  3O3G A;  3WNH A;  3CF5 L;  1LCU A;  2HOE A;  5JVH L;  2P9U A;  1QTM A;  4PUO A;  3PIO L;  3M8Q A;  4CBU A;  4CJT A;  2QW9 A;  4B9T A;  1C1B A;  1S5J A;  1Q8I A;  2NLX A;  3AVI A;  5M1O A;  4FM0 A;  3CCL N;  2O8E A;  1XC3 A;  5A2Q O;  1S6P A;  3QET A;  4NCB A;  4DQS A;  3S9H A;  3QLH A;  3B6O A;  3J80 O;  3H3O B;  2P9K A;  3DLH A;  1HLU A;  4JRP A;  3SJJ A;  1NLV A;  1ATN A;  1JXE A;  2V7Z A;  4KO0 A;  2OA8 A;  4E0D A;  3TTF A;  3LM9 A;  2PY5 A;  4L3Q A;  3AVB A;  1DKG D;  2HHT A;  4IG0 A;  3ULE B;  2CGJ A;  1NKB A;  5FRO A;  3ATV A;  4H4M A;  3QML A;  3DWL A;  5AQZ A;  4CJ5 A;  3IFR A;  3CC4 N;  5BR9 A;  1FXX A;  1BQM A;  1YJ9 N;  1QSS A;  4ID5 A;  4BDZ A;  4DLG A;  2BGG A;  4K43 A;  1S1X A;  2ZJR L;  5AQN A;  3CJC A;  3OA9 A;  5SZT A;  1HNZ K;  2XY5 A;  1X9S A;  4ID1 A;  4CHP A;  1CXU A;  4FJH A;  4PKH A;  2Q0U A;  1VK0 A;  4O44 A;  1VHX A;  4O5F A;  3F73 A;  4WF9 L;  3CD6 N;  3LZI A;  4F8R A;  4H0T B;  1UWB A;  4O0J A;  1CLQ A;  1RT4 A;  3VF6 A;  3NHG A;  4JKD A;  3ZSW A;  1SKS A;  5BPM A;  3RRH A;  5AQF A;  4E1M A;  1R59 O;  3HPG A;  2GWK A;  3AO5 A;  1SZ2 A;  3LDP A;  4YNQ A;  1JL2 A;  2P9L A;  3BGR A;  1SL0 A;  3ALY A;  4FWM A;  4ELT A;  1VRU A;  2E6M A;  3SAF A;  3TAF A;  3RVC A;  2V52 B;  4CGG A;  1OH6 A;  5FRN A;  1WBD A;  3VPZ A;  4FVU A;  3GE1 A;  1BCO A;  4BR4 A;  4C8M A;  3J7A P;  3DXM B;  4FZX C;  1REV A;  1T8E A;  1U2V B;  4KH4 A;  5LMN K;  1IG9 A;  4CD3 A;  1VQ4 N;  2RF2 A;  2FBY A;  3EZW A;  1I39 A;  4YOU A;  1QVG M;  2ZGY A;  4CZG A;  4WFB L;  4H5T A;  1RFQ A;  2YJF A;  3HTV A;  3AA2 A;  3RR8 A;  4PWD A;  4M45 A;  3K5N A;  2IC3 A;  4N76 A;  1LWF A;  3DLK A;  2OTJ N;  4I2P A;  1P90 A;  2KKZ A;  4JYA K;  1KSP A;  2R7Y A;  2YX6 A;  3OJU A;  2P5G A;  3IG1 A;  1Q86 O;  1HUX A;  3C6H A;  3P83 D;  4DR3 K;  3BDP A;  5D3G A;  2Q3S A;  4O5B A;  1J9A A;  3AA4 A;  3AAR A;  1IO2 A;  4ISE A;  3K5M A;  1HKG A;  5JIC A;  3O9U A;  3VGM A;  1H1V A;  4BGA A;  4DS5 A;  5F0X A;  3OYC A;  2ASM A;  1OKJ A;  4CZL A;  1NGA A;  3P1G A;  3G0Z A;  4E89 A;  2VYP A;  4YDU A;  3SQ0 A;  3A2F A;  4AHU A;  1K8A O;  3AV9 A;  4JKC A;  3E66 A;  2YNH A;  3AA5 X;  4CE9 A;  4KHQ A;  4IZ9 A;  2ITM A;  3H1Q A;  3FR0 A;  4JLH A;  4DSF A;  2H3G X;  4JK8 A;  4JI4 K;  2HHW A;  1T6D A;  1TVR A;  1DTT A;  3H46 O;  2QTD A;  1BI4 A;  1L3U A;  5LY3 A;  3AO4 A;  1VSD A;  3LP2 A;  4O8U A;  2OZS A;  1S72 N;  4CJW A;  3LAM A;  4DR6 K;  4DU3 A;  1LWE A;  3UKR B;  5J2P A;  3OYL A;  3RMC A;  4QCL A;  3D2F A;  1HPM A;  4BQZ A;  3CET A;  4DV3 K;  3LDQ A;  4B9L A;  3PUF A;  2X6S A;  5FPE A;  4DHY A;  4FJJ A;  4GV9 A;  3UE5 A;  2QA4 N;  3AVC A;  4FWN A;  3AVJ A;  3KKR A;  1VQ6 N;  4JV5 K;  4B3O A;  5I9E B;  3TAP A;  3QES A;  3MAQ A;  2A1R A;  3D45 A;  2W6L A;  4CEB A;  2FC0 A;  3ISN C;  4DQP A;  1GLB G;  3NBP A;  4DTS A;  3T1Y K;  4J2E A;  1HNV A;  4BWM A;  4JI5 K;  3VEZ A;  1EQY A;  4BR5 A;  1EWR A;  1WNS A;  2F9W A;  5KRT A;  4BRA A;  4JK7 A;  3TTD A;  1Q18 A;  4JS5 A;  3Q7C A;  4UY8 O;  2DFH A;  1TL1 A;  1Z26 A;  1YVU A;  4NCA A;  1KQS M;  3IS9 A;  4CBW A;  4Y0W A;  4I7F A;  3LAK A;  2Q36 A;  2IVP A;  4RW8 A;  4DMN A;  2LSN A;  4YOV A;  2P9N B;  4YOR A;  2ITG A;  3HP6 A;  4FK4 A;  4AQY K;  4JI6 K;  4CFB A;  1GLE G;  3LP1 A;  3CMA N;  5M1K A;  3DLB A;  4JI8 K;  3NGI A;  3WNF A;  1XC9 A;  2YI1 A;  3WXM B;  1BCM A;  3ZET B;  5K14 A;  4NLC A;  4H0Y B;  1IV0 A;  4NXM K;  1LW2 A;  3PO5 A;  4BDY A;  4LY7 A;  3O80 A;  1TGO A;  2ZJP L;  1U6Z A;  1U49 A;  1KXP A;  4LF4 K;  1GOB A;  4FLV A;  1JLE A;  4Q5V A;  4H0V B;  5CYM A;  2RHK A;  3VEX A;  2GEL A;  5I3U A;  1NGD A;  3SUN A;  4K8Z A;  3VQP A;  3T19 A;  4K42 A;  1RDB A;  2NRR A;  5KTQ A;  3S41 A;  1T6C A;  4LFA K;  3TSP A;  3SZ2 A;  3E9O A;  4CJL A;  3SUP A;  1ESV A;  3L2R A;  3VA3 A;  3AY9 A;  4HVJ A;  4OVL A;  3G25 A;  5AFU H;  1W2B M;  4Z4G A;  1HYZ A;  2HBM A;  3RMB A;  2YHX A;  3CCV N;  5F2R A;  4CGJ A;  3TAE A;  1Q81 O;  3MEE A;  1EET A;  1HQU A;  1FK9 A;  4JD2 B;  3M8S A;  3D2E A;  4BRP A;  1KVC A;  2Z1H A;  4QS9 A;  1ZBI A;  5AQW A;  3AO3 A;  2PAV A;  2P1J A;  4OPH A;  3RSE B;  1QQN A;  3WQU A;  3J8A A;  5AQT A;  1EP4 A;  4YHH K;  1EWQ A;  3HYF A;  3P39 A;  5HRP A;  1XWL A;  1IBL K;  3CCQ N;  3U6F A;  1P8Z A;  1VSK A;  4JKG B;  4CHQ A;  4Z4I A;  1JCG A;  1G15 A;  3ID8 A;  4B9M A;  4CGI A;  4FLX A;  4B1V A;  4PY5 A;  4YOY A;  4PQU A;  4J2A A;  1GOC A;  3HZ6 A;  3ZT4 A;  3AA3 A;  2X6N A;  1ZBF A;  4KB1 A;  2DY4 A;  2VG6 A;  4DV4 K;  4CF9 A;  3HL8 A;  3MED A;  4FJ5 A;  2VGN A;  1HQE A;  4FYD A;  4EFH A;  4W5O A;  4B9Q A;  4RW7 A;  3WUH A;  4EP4 A;  4C8K A;  3LM2 A;  5LMU K;  4BRI A;  2HHU A;  5AQL A;  3OYD A;  3N4Q A;  5M1N A;  1CZA N;  1X3M A;  4OX9 K;  3SQ2 A;  5HRO A;  4CEC A;  2RN2 A;  4IFV A;  1SV5 A;  1UAX A;  4B3T K;  3KJV A;  3KD5 E;  4BRO A;  1XUP O;  1KLN A;  1A5W A;  3CFP A;  4RG8 A;  3A5M C;  4BY9 C;  5AZJ A;  3LZJ A;  1BHL A;  3GL1 A;  2E8A A;  3CCJ N;  1J54 A;  1C1A A;  4IOX A;  3PSF A;  5KI6 A;  3EO3 A;  1WB9 A;  4BC3 A;  3KLF A;  2F8T A;  2OYQ A;  1N33 K;  5AJ3 K;  5HRN A;  3HM9 A;  2EHG A;  1HRH A;  3NH2 A;  3MXJ A;  3KD1 E;  1KAY A;  3CG7 A;  3JAM O;  3OYG A;  3OS1 A;  3G6E N;  1I94 K;  4FOI A;  4A2B A;  4DTU A;  2FF3 B;  2O8F B;  1KC8 O;  3ULD A;  5LJW A;  4PKI A;  3WXJ A;  1HPZ A;  3EZ5 A;  4BC5 A;  2VGM A;  5KPZ A;  3OJS A;  2HVI A;  3B8A X;  3MWT A;  1RNH A;  3DLL L;  4DTM A;  4BE0 A;  3THX B;  2FBX A;  3EKS A;  4B3M K;  3KWI A;  1VSH A;  1OVY A;  4MLH A;  1IKY A;  4GV6 A;  3EN9 A;  2E1Z A;  2QK9 A;  5DM6 L;  4DV0 K;  4FJM A;  2VWK A;  1B92 A;  3O3H A;  3UKU B;  3OYF A;  1V4S A;  4CD1 A;  3NFA A;  4C1N I;  2KZZ A;  1R0A A;  4DF4 A;  1S9G A;  1ASW A;  3TSU A;  1NK4 A;  4DUZ K;  3TTC A;  3OHR A;  3OS0 A;  1EX4 A;  3WXI A;  4WQ4 A;  2G8W A;  3QDK A;  1BA0 A;  4FZY A;  4FWS A;  1HNW K;  4LFC K;  2KW4 A;  4K25 A;  1SKR A;  5AQO A;  1O1W A;  1BQN A;  5CY4 A;  4F9O A;  4G1Q A;  1GLJ O;  4IEE A;  4JI0 K;  1VSL A;  4GKJ K;  3ZX3 A;  1RTI A;  3U3G A;  4FW1 A;  1C6V A;  3OYI A;  4FLZ A;  1LAW A;  3LPT A;  3I0R A;  3AGR A;  4Z4E A;  4BRH A;  4HUG A;  1QS4 A;  4AH9 A;  4X62 K;  3K5L A;  4FJI A;  5C0Y A;  1O13 A;  3O8M A;  1ZC6 A;  4BE1 A;  4FLY A;  1RTJ A;  1GOA A;  4FWK A;  1ZXO A;  3H1V X;  2XY6 A;  4CED A;  3AVG A;  1VSM A;  1SUQ A;  4CF1 A;  4R79 A;  4JKH A;  2ZF5 O;  4BE2 A;  3MK6 A;  4XEI A;  4CGH A;  3V9X A;  1RDC A;  3L2Q A;  1QSL A;  1VQ8 N;  3EL2 A;  2NRZ A;  1S1T A;  3LWL A;  4UQG A;  4U7B A;  3VOV A;  2FBT A;  3IKM A;  2NNW A;  3ZT0 A;  3LAL A;  2QWL A;  4I2Q A;  2O8C B;  3VF2 A;  4CJ7 A;  4O55 A;  3QEW A;  4CF8 A;  4E3S A;  4BRN A;  4KHS A;  2BE2 A;  3ZSR A;  1HYV A;  1YF5 L;  3U4L A;  1D8Y A;  4GMJ B;  3KLI A;  4FWO A;  4B1W B;  4CZH A;  3PX0 A;  4FVM A;  1DGK N;  3O4N A;  2Z1J A;  3ZSX A;  4M3X A;  1SAZ A;  5E84 A;  2F96 A;  1J53 A;  5E26 A;  2IDO A;  2JWL A;  5C25 A;  3K2P A;  4BR9 A;  3HVR A;  1IJJ A;  2HND A;  2HHV A;  2Y1I A;  3A8Y A;  1VQO N;  2PBD A;  3BP8 A;  2AJQ A;  1QZ6 A;  4FJG A;  3DOK A;  2HMI A;  2CGL A;  4M3Z A;  3PSI A;  1KAX A;  3K5O A;  1IH7 A;  5HLF A;  1RT1 A;  1M1K O;  4BR7 A;  4OLB A;  1NM1 A;  4A57 A;  2HW3 A;  1YUW A;  1WOQ A;  1QHA A;  3TU5 A;  4CK3 A;  3HSC A;  5KRS A;  4CGF A;  3CFR A;  2QKK A;  1JKH A;  2V7Y A;  2ZGZ A;  2KTQ A;  5AZI B;  4JI3 K;  1HKB A;  2UU9 K;  1NK7 A;  4JKE A;  3I56 N;  4DV1 K;  2I7P A;  2XO7 A;  2Q2R A;  4GVM A;  3WNG A;  3H3N O;  1SKW A;  4FSV A;  5F1X A;  5AQQ A;  2QWR A;  3DXK B;  4F3T A;  2B4J A;  2W6K A;  3OTO K;  2D0P A;  1NOZ A;  4M3Y A;  3CJA A;  1J5E K;  5ADX H;  4DR7 K;  3VA0 A;  1KLM A;  4Z4F A;  3OYN A;  4BC2 A;  3T1A A;  4CJV A;  3C6A A;  4CFA A;  3MEC A;  3CCS N;  3KLE A;  4CHN A;  4FL9 A;  3IDH A;  3VGK A;  2VG5 A;  4CIE A;  3PV8 A;  3K9J A;  4CZI A;  2HHX A;  1NGG A;  3QEX A;  1YIT N;  5CHI A;  3VEW A;  4Q0B A;  2HF4 A;  3DXM A;  3E01 A;  3RR7 A;  4DB3 A;  1NKE A;  3GOI A;  1W0H A;  4JKB A;  3F9K A;  3NMU A;  5GIP A;  5C15 A;  4N41 A;  1QE1 A;  5FRM A;  3OYE A;  1T3V A;  4H03 B;  2IIR A;  1VRT A;  3P38 A;  4C8O A;  1KRP A;  2GUP A;  4CHY A;  4L8R B;  4EHU A;  1NJX A;  1YIJ N;  3CM5 A;  1M90 O;  4Z4C A;  3L4I A;  4C1N K;  1TAU A;  3QIC A;  1NMN A;  4I9L A;  1Q82 O;  4KTW A;  4CGD A;  3V6D A;  3CJ7 A;  4IO9 L;  4N47 A;  4JAX A;  4NYN A;  4AIL C;  3KLH A;  1TKX A;  2F7T A;  3ENB A;  1SL1 A;  4HWI A;  3V1R A;  4FJ9 A;  4FPB A;  5GAG P;  4CJP A;  5AQU A;  4DR4 K;  4H0O A;  3C6T A;  2UUA K;  2A41 A;  5FPD A;  2QWN A;  3K9K A;  1VQ5 N;  1YTA A;  3M5R A;  4CFD A;  3HRG A;  3KK1 A;  1C0T A;  4CJR A;  1YJW N;  3IUC A;  4PL8 A;  3AVN A;  4DQR A;  1HNX K;  4IWV A;  4GY2 B;  1S6Q A;  2YNI A;  3JSM A;  3ZCM A;  2J4R A;  1N32 K;  2IVN A;  3O9S A;  2QXF A;  5BPN A;  3MN7 A;  1RT2 A;  1L3V A;  1WLJ A;  2WFB A;  3L0Q A;  3W0L A;  1JLF A;  5CYQ A;  3AAQ A;  3R3L A;  4WYB A;  3BUZ B;  4JHD B;  4KPY A;  1D4X A;  1YT3 A;  1T05 A;  3I8B A;  1WAJ A;  3WNE A;  4DTX A;  1TAQ A;  4HCC A;  2E6L A;  4CW7 B;  2FBV A;  1C0G A;  3R9P A;  3BF1 A;  3HXM A;  3TAB A;  2YHA A;  3LP3 A;  3I55 N;  4KBO A;  3AGK A;  4HCB A;  4M63 C;  1RBR A;  4QS8 A;  4LSL A;  4BG9 A;  4KRE A;  3DRP A;  5J2N A;  3IMX A;  3G71 N;  2IS3 A;  4Z0U A;  3DLR A;  4HTU A;  3R8E A;  1U45 A;  3ID6 A;  4I9Q A;  3CER A;  3M8P A;  3E9P A;  1J5O A;  1HNI A;  1BI4 B;  3QEI A;  1BL3 A;  4CJQ A;  1NGI A;  4OKK A;  1LWC A;  3ASM A;  4JRQ A;  1ZBH A;  1GLF O;  1MA9 B;  5J2Q A;  4AF1 A;  3OYH A;  4CES A;  3LPU A;  3ZSO A;  1XHZ A;  1N34 K;  1UOC A;  3SMP A;  1BOT O;  4W5Q A;  3BZK A;  3ZSV A;  1DTQ A;  1K73 O;  3BY5 A;  1JCE A;  4EIA A;  2IAJ A;  1FKP A;  1BO5 O;  3ZT2 A;  3RMA A;  5JMV A;  3CQY A;  5KPT A;  2ZJQ L;  4FO0 A;  2P9N A;  3VTI A;  1XI1 A;  2OPR A;  1K8K B;  2FLO A;  1X3N A;  5HP1 A;  1BA1 A;  1WSJ A;  3VMF B;  1C0M A;  1NG9 A;  4RW4 A;  3KLG A;  4KHY A;  4PHT X;  4EZ9 A;  3ZET A;  3EE8 A;  3CYM A;  3AVF A;  4MFB A;  2G8U A;  5ADX A;  2A40 A;  2E2O A;  1BIS A;  1JLB A;  4CIG A;  4OPJ A;  1NU0 A;  3OS2 A;  3I0S A;  4LH5 A;  2BDP A;  3CCU N;  2AA4 A;  5HRR A;  2O8B B;  3LP0 A;  3CJB A;  4AHR A;  2Q1N A;  3NE6 A;  5C42 A;  3OY9 A;  3E1Y A;  3DMJ A;  4ZTJ A;  2G8V A;  5JS2 A;  3CME N;  4FK0 A;  5BRD A;  2YHB A;  3VQ6 A;  3SJH A;  5C2F A;  4M7Y A;  2F9T A;  2CH5 A;  4WFA L;  2FSJ A;  4H5R A;  3C7N B;  3CXC M;  5AQG A;  2HHH K;  4DS4 A;  1IKX A;  2W40 A;  4DV5 K;  1EKE A;  3DRR A;  2G8K A;  3QBW A;  4JI1 K;  5C24 A;  3SNN A;  1W7A A;  3M6G A;  2NUB A;  2HBL A;  1MWM A;  1U4B A;  2P9I B;  3A5O C;  4JD2 A;  4MO5 A;  2RPI A;  5AQY A;  4K0K K;  3L8B A;  4EZ6 A;  4DKW A;  4DUY K;  2OPQ A;  3RSE A;  4CK1 A;  3I8D A;  4JKF A;  5FLX O;  1NK6 A;  4WFN L;  4AM6 A;  4CER A;  3HPH A;  4J2B A;  5GAE P;  2NRV A;  2ZWH A;  1QQC A;  3FZL A;  3O4Q A;  2UUC K;  1QQO A;  1TV6 A;  1IKV A;  4A2A A;  1QHT A;  3U8X A;  4OGC A;  2WBN A;  5JLH A;  4KHU A;  4E7K A;  3CM6 A;  4OPA A;  5KQ8 A;  3FZK A;  4B9N A;  2E4L A;  1S22 A;  5C2D A;  4LH4 A;  4E7L A;  3HO1 A;  2F4V K;  4OO1 J;  3SBG A;  2AP1 A;  4RW6 A;  1HYS A;  1VQL N;  4I6M B;  1VQ9 N;  1VSF A;  4FJL A;  4F2R A;  4EP5 A;  5IWA K;  4BAC A;  4IOC L;  2OPP A;  1OH7 A;  1JCF A;  3U9D A;  2WOM A;  3SI6 A;  4FWL A;  5CZ1 A;  3VQ8 A;  3THW B;  2VQF K;  1FW6 A;  2XY8 A;  3I33 A;  5AQP A;  3L2U A;  5IT9 O;  3O9T A;  2HB5 A;  3C94 A;  4GVE A;  1YI2 N;  3JXU A;  4C23 A;  4IEI A;  1LOT B;  2WC9 A;  5KQD A;  4JI2 K;  5AQI A;  4OKJ A;  5J1E A;  4B8A B;  3CCM N;  1XMQ K;  4WE1 A;  4KHP K;  1SL2 A;  2P5O A;  3B6P A;  3CIP A;  3T69 A;  5LJV A;  4HHT A;  3FFK B;  3BEX A;  1QZ5 A;  3GG4 A;  4CEO A;  1VQP N;  4FK2 A;  4IG3 A;  2GBZ A;  3ENH A;  4MLE A;  4YFU A;  1NBW A;  3CCR N;  4FWQ A;  2O8D A;  2ZE2 A;  5CR4 A;  1XNQ K;  1TYQ B;  4DTR A;  2O8F A;  3MCA B;  3ITH A;  2P9S A;  4DSL A;  1G99 A;  4CJ4 A;  3F2K A;  3A0I X;  3CPW M;  2V51 B;  4B8C A;  4KI4 A;  4Y1C A;  3THY B;  1U48 A;  1MDU B;  5EX5 A;  2JWK A;  4LF8 K;  3THX A;  3HM8 A;  4BRG A;  4ISF A;  3QIP A;  3DI6 A;  2Y1J A;  1RT6 A;  2E2P A;  4RWT A;  2D0A A;  5M1F A;  5BR8 K;  1A5V A;  4CF2 A;  1WBB A;  5C12 A;  4M3U A;  3SCX A;  2BH1 A;  4XIU A;  2O4G A;  3UKU A;  3HI0 A;  4BDP A;  3QNN A;  4C8L A;  3FZM A;  2YKM A;  4ILG B;  4ILH A;  4DFJ A;  3NAE A;  3WXL A;  4JNE A;  3DLE A;  2D0C A;  4R5P A;  4IDK A;  4DV2 K;  3VES A;  1F21 A;  3ZSQ A;  3NVM A;  2I5J A;  3SMS A;  1YXQ A;  1S1U A;  4ISG A;  2VQE K;  1CZ9 A;  1W9H A;  1Y97 A;  4DSE A;  1X9W A;  3RWU A;  2OAN A;  4NB4 A;  1JLC A;  1EXQ A;  1X9J A;  4CHO A;  4DFM A;  1NJY A;  2HNZ A;  1ATS A;  3D7E O;  4F3O A;  1RT5 A;  3O4W A;  3PX6 A;  1ZBL A;  5JVG L;  4CEF A;  4X64 K;  2KLA A;  2E20 A;  5KGX A;  4J2D A;  2B6A A;  3H08 A;  1VQN N;  1TKD A;  2B5J A;  2JLE A;  3J7Y P;  4YOT A;  5H1S Q;  3WEE B;  4BRL A;  3ZT1 A;  4BRD A;  1WUA A;  3FFI A;  3CC2 N;  3ZLJ A;  4N56 A;  2G8H A;  2CH6 A;  3MXM A;  4LF5 K;  4BC4 A;  4FLT A;  2VG7 A;  1MU2 A;  3FLC O;  1E4G T;  2X74 A;  3V9Z A;  3LAN A;  2Q97 A;  3ZEU B;  1KAZ A;  3EEQ A;  3J7Z O;  5C10 A;  5AFU A;  3THV A;  1J6Z A;  3MN9 A;  4JEP A;  3V1Q A;  4ELU A;  3BZC A;  4HTL A;  3QNO A;  3SQ4 A;  3S3M A;  1YVN A;  3V81 A;  4CIF A;  2O8C A;  5JS1 A;  4M7X A;  1RDD A;  3PX4 A;  4CEA A;  3L6Q A;  5CZ2 A;  3GDQ A;  3DAW A;  4H0P A;  3VQ7 A;  4FPA A;  1E4F T;  3WT0 A;  2P9P B;  3MEG A;  3HOS A;  4FOE A;  3SUO A;  3OYM A;  2G8F A;  3VQ5 A;  2UXB K;  4DU4 A;  1NK8 A;  3TAN A;  4CJF A;  4Y1D A;  4A5A A;  4BR2 A;  2GTD A;  4DV6 K;  4O4G A;  4BRF A;  3OYA A;  5E41 A;  1NGB A;  2WUS A;  3CI5 A;  3CQ8 A;  4IKF A;  4Z94 A;  2YNF A;  4IFY A;  2FSN A;  3O08 A;  4EHT A;  3DRS A;  4CZM A;  3VQC A;  3ZSY A;  5BN8 A;  2G8I A;  4HUE A;  1GLA G;  3FGU A;  4B3R K;  2QI2 A;  2GWJ A;  1HJR A;  4YOW A;  3IRX A;  4DF8 A;  2Z1G A;  3ATU A;  4ILJ A;  4H4O A;  4K41 A;  5AZI A;  4IBN A;  1NK0 A;  2KQ2 A;  3ULE A;  3V9W A;  4ZTF A;  1YJN N;  3CFO A;  2NRT A;  4A61 A;  1NGJ A;  4XH4 A;  1EO1 A;  4IJN A;  4A59 A;  1S9E A;  5JLF A;  3HOT A;  3RMD A;  4DCH A;  3DXK A;  4DLE A;  2KHO A;  1D9D A;  4LD0 A;  4AHS A;  5J2M A;  3T7Z A;  3L2V A;  1ZBU A;  2P9U B;  3NGZ A;  3MDQ A;  2E88 A;  1RDW X;  4EAH D;  4AM7 A;  2O8E B;  3SYZ A;  4M42 A;  1GLL O;  4XH5 A;  1JLQ A;  3AVK A;  2P9K B;  5CE3 A;  2EWS A;  2NZT A;  5AQH A;  1RBU A;  2YV0 X;  1HX1 A;  4CK2 A;  4K8X A;  2DFE A;  3FZF A;  2IGI A;  3MN6 A;  4BVP A;  3OYB A;  4DTJ A;  2X78 A;  2BTF A;  5HBM A;  4KAZ A;  1KVA A;  1A5X A;  4H0X B;  3UIQ A;  2GV9 A;  4BRE A;  3R1X A;  2OZM A;  2HST A;  1X9M A;  5AQJ A;  3NF7 A;  3LDN A;  2VCP A;  3SUQ A;  5BN9 A;  4IDH A;  1U2V A;  5TKW A;  3O3F A;  1U04 A;  1VSI A;  3VEN A;  1KTQ A;  1MWK A;  4BRM A;  3V9S A;  3VQQ A;  3VTH A;  1VQ7 N;  3KIO A;  4E1J A;  2QKB A;  1C1C A;  4CEQ A;  3OVN A;  1T44 A;  4CBX A;  5HRS A;  1C0U A;  2ETJ A;  3CPE A;  3SAG A;  1HMV A;  3DOL A;  5M1Q A;  2P9L B;  3O1W A;  3VER A;  1NKC A;  4DQQ A;  1UA0 A;  1UA1 A;  3SK3 A;  1W97 L;  4DR2 K;  4ELV A;  2EX3 A;  3WXK A;  4B9U A;  2UXC K;  5EY4 A;  3SQ1 A;  1D9F A;  4H5V A;  1NGC A;  2VWJ A;  3LWM A;  1BGX T;  1RT7 A;  2BAN A;  3O6W A;  1VSJ A;  1HJO A;  1TKZ A;  1Q9X A;  1QQM A;  4LF7 K;  4A5B A;  3QO9 A;  2PYL A;  3NDK A;  3P5J A;  1XQS C;  2OTL N;  3U9Z A;  3P31 A;  4ZHR A;  1HR0 K;  4DU1 A;  3O9R A;  3VET A;  3QBX A;  4BVO A;  4HUF A;  2YCH A;  2QEX N;  2HHS A;  3NF8 A;  4RW9 A;  5AQR A;  4FJ7 A;  5ELZ A;  4M41 A;  4DQI A;  4LSN A;  1BUP A;  3VEY A;  1TUY A;  1NMD A;  2QWQ A;  4NXN K;  2DFF A;  5KGW A;  1BIU A;  3OW2 M;  5AQM A;  1YAG A;  4CF0 A;  1S3X A;  2RKI A;  1FKO A;  3OYK A;  1IBM K;  2YHW A;  3CJ1 A;  3ZYY X;  1WSI A;  3SPZ A;  4LFB K;  4PKG A;  3TPQ A;  3ZX0 A;  4JHD A;  2OCE A;  1GLC G;  2ZQB A;  3RTV A;  1RGI A;  4Z4H A;  5FPN A;  3UKR A;  4FLW A;  3VF4 A;  2WTU A;  3C6U A;  2Z1I A;  1JLG A;  4YDU C;  2BUP A;  1RTD A;  3QFP A;  3SAH A;  2YNG A;  4F4K A;  1BU6 O;  3KKS A;  4QOZ B;  3LL3 A;  5GAH P;  3QB0 A;  2FF6 A;  3DYA A;  2HHQ A;  4BGB A;  4CFC A;  1CXQ A;  3P4I A;  4V19 S;  1ASU A;  1QSY A;  4OLA A;  4IFE A;  3HVT A;  3EKU A;  3TAM A;  1OVQ A;  3VQB A;  4DTP A;  2UUB K;  2PZS A;  1GLD G;  5HL7 L;  2OPS A;  3E9L A;  4H5N A;  3RRG A;  2D1K A;  2HMP A;  3F5T A;  4B1U B;  3KK3 A;  3D2F B;  3R6M A;  5EOY A;  3O9Q A;  4QS7 A;  4BRK A;  5DMR A;  4CI6 A;  3W3D A;  4MDA A;  1Q7Y O;  3C65 A;  3KK7 A;  3IAY A;  5BRF A;  2A5X A;  1K8K A;  4DSK A;  2QWP A;  3O1B A;  2QWM A;  3TSQ A;  3QER A;  2ZD1 A;  2E2Q A;  3LDS A;  4C8N A;  1RBS A;  2KFN A;  5EXW A;  4M3W A;  2IOC A;  4DWI A;  1Z6R A;  4DTO A;  2JGU A;  5B8H A;  3VN5 A;  3O5B A;  4H8K A;  4FXD A;  1WN7 A;  3TAG A;  1RT3 A;  3VQ4 A;  3DLG A;  3VQ9 A;  2P51 A;  4KI6 A;  3KTQ A;  4FJK A;  3V4I A;  4IO8 A;  2O8B A;  1K6Y A;  1DEJ A;  4KHN A;  3G10 A;  3QEP A;  1SS6 A;  4BRC A;  3S3N A;  3KWG A;  3MCP A;  3V1O A;  2O4I A;  1YHQ N;  3UB5 A;  3TWH A;  3M8R A;  3NH1 A;  2YKN A;  1K9M O;  4FJN A;  2HBK A;  3NF9 A;  4FM2 A;  3JS6 A;  3C95 A;  1VQK N;  3D6R A;  2FXU A;  3C7N A;  2DTU A;  4JKA A;  2I7N A;  4J8F A;  3K58 A;  1RBT A;  3K57 A;  1HKC A;  5AQK A;  3QFU A;  1VSE A;  4DFK A;  3ZT3 A;  1KFD A;  2A6A A;  2WON A;  2XHB A;  3VEO A;  3OBW A;  1RTH A;  1RDA A;  4PL7 A;  2YJE A;  4KRF A;  4DG1 A;  2P9I A;  3TR8 A;  2ASO A;  1XNR K;  1JLA A;  3F9M A;  3CQX A;  3Q7B A;  3U3Y A;  5MLC Q;  3GBT A;  2DPN A;  5GAD P;  5SWM A;  4LC9 B;  1N5Y A;  1NGH A;  1QVF M;  1NK5 A;  5M1P A;  5LL6 Z;  2A42 A;  3H45 C;  3TI0 A;  3HP9 A;  4IJA A;  4MDB A;  2GUI A;  1LAV A;  1KFS A;  3HK2 A;  2IVO A;  2W42 A;  4XH1 A;  3OYJ A;  2E2N A;  3K59 A;  5FPM A;  3VQE A;  3LDO A;  4JKG A;  2D0O A;  4TSX A;  2NRH A;  4ICL A;  2ASP A;  1I3A A;  2NRW A;  4W5T A;  1ITG A;  3G4S N;  4B1Z A;  4BR0 A;  4X65 K;  1VAZ A;  2A3Z A;  4CVN E;  3V9U A;  2GX9 A;  4I6M A;  1KCF A;  4NLB A;  3PY8 A;  3VGL A;  3FE1 A;  1ATR A;  3QIN A;  3AVL A;  4OGE A;  5EU7 A;  2ZM6 K;  1KVB A;  1NOY A;  3MXI A;  1ZBS A;  2XRI A;  1XMO K;  4FWR A;  1NJW A;  5BRE A;  3THW A;  3CC7 N;  3D2E B;  3ENO A;  5AR0 A;  4U67 L;  1NNE A;  3AVM A;  3MN5 A;  4NO7 A;  1T7P A;  5GIO A;  1Z05 A;  4M3T A;  3LDL A;  2HNY A;  4DQ8 A;  5AQS A;  4JI7 K;  4GNI A;  3SBT A;  1FJG K;  3SPY A;  4FWP A;  1WSF A;  1S1V A;  1NK9 A;  4JN4 A;  4PA1 A;  4DV7 K;  4QAG A;  1B9D A;  3S3O A;  4O8K A;  3MMV A;  3CJ9 A;  2D0B A;  3DJC A;  3KHY A;  2E1Y A;  3AVA A;  4FJ8 A;  2PFU A;  5AQV A;  2YHY A;  4E7J A;  1TYQ A;  1IKW A;  4CZK A;  4LF6 K;  4DR1 K;  1DLO A;  3L4Q A;  1Y64 A;  5BRH A;  4CEZ A;  4B1Y B;  1LW0 A;  4CZF A;  3AAP A;  3M1F A;  4X66 K;  3THY A;  4YOX A;  4MQ3 A;  4FZZ A;  1BDG A;  1TK5 A;  4YY3 K;  2W41 A;  5BPL A;  4LF9 K;  4BQL A;  2GEM A;  1NGE A;  4O0I A;  4DTN A;  1IBK K;  4B9V A;  4KKO A;  4G9Z A;  2QM1 A;  3EE9 A;  3HT3 A;  3ZSZ A;  1S1W A;  4FJX A;  1ILY A;  4CCH A;  3KVG A;  4NYF A;  4AHV A;  4E19 A;  3TAQ A;  4A62 A;  3HBT A;  1WSG A;  5FDL A;  3QIO A;  4DFP A;  3NF6 A;  5AZJ B;  4CJS A;  4B08 A;  2O8D B;  1SQK A;  2Q0R A;  4JK9 A;  4M3R A;  1NJI O;  1OH8 A;  4OPK A;  3HPO A;  2A1S A;  1JXB A;  2P9S B;  3VQD A;  4IXC A;  3MX5 A;  1IG8 A;  4FCY A;  4NCG A;  1TK0 A;  3WQT A;  4KH6 A;  4KV8 A;  4FW2 A;  2QWO A;  3K0S A;  4FM1 A;  3T3F A;  3ZX2 A;  1B9F A;  1XHX A;  4RTF D;  4B3S K;  3L2W A;  1RCH A;  1RIL A;  1BIZ A;  4JS4 A;  1WSE A;  2VWB A;  1YTU A;  5TKY A;  5DK5 A;  4GKK K;  3SV4 A;  3NGY A;  4BRQ A;  4GV3 A;  1NGF A;  3D0P A;  4DSJ A;  4CEE A;  4CJK A;  1Q9Y A;  4H5W A;  4N5S A;  3AO2 A;  3N4P A;  3VQA A;  3WEE A;  4WQ4 C;  2Q31 A;  4RCH A;  3FZH A;  1RBV A;  3EY1 A;  3A5L C;  1KD1 O;  2UYT A;  1DT9 A;  3TAR A;  2NRX A;  1T03 A;  5EVZ A;  3DM2 A;  3PLA A;  3L3V A;  3PO4 A;  4CJ3 A;  5T7B A;  3A5N C;  1BWF O;  1U47 A;  3SLC A;  1CZB A;  3ZEU A;  3PIP L;  2HF3 A;  5KPR A;  4AHC A;  2UXD K;  3CHW A;  3HJF A;  4E1N A;  3VEV A;  4KTQ A;  2FSK A;  3M3Z A;  5GIN A;  4CZE A;  4CJU A;  4WCE L;  1TK8 A;  4FLU A;  1C0F A;  3KZB A;  1WAF A;  3QEV A;  2PYJ A;  4KH5 A;  1VQM N;  2E5L K;  4DSI A;  1NWK A;  4E7H A;  2XY7 A;  2KFZ A;  2D5R A;  1WSH A;  1TUU A;  4KHW A;  2P9P A;  4MO4 A;  1TKT A;  1JL1 A;  1ASV A;  5HOO A;  1X1P A;  3NH0 A;  3L3U A;  4B1X B;  2HVH A;  2RE2 A;  1JJ2 M;  3JYT A;  4B9S A;  4KTZ A;  3MX2 A;  5AQX A;  1V4T A;  4AHT A;  4F2S A;  2HBJ A;  3SV3 A;  1TL3 A;  1L5U A;  1RDU A;  1BG3 A;  4W5N A;  4OKE A;  1OH5 A;  1L3T A;  2CGK A;  3AO1 A;  1N6Q A;  2F8S A;  1N8R O; 
#chains in the Genus database with same CATH homology
 2VWJ A;  4OJR A;  3AVF A;  4MFB A;  4W5R A;  1ZYQ A;  4KB0 A;  3LWM A;  2G8U A;  5I42 A;  1KLN A;  1A5W A;  1BGX T;  1RT7 A;  2BAN A;  1BIS A;  1JLB A;  1VSJ A;  2ATQ A;  4RG8 A;  4CIG A;  3CFP A;  4OPJ A;  1TKZ A;  4BWJ A;  4CJE A;  1Q9X A;  3OS2 A;  3I0S A;  4LH5 A;  3QO9 A;  1L3S A;  3NDK A;  3P5J A;  1NJZ A;  2BDP A;  2PYL A;  3KK2 A;  3LZJ A;  1BHL A;  4ZHR A;  1LV5 A;  5HRR A;  4DU1 A;  1J54 A;  1C1A A;  3LP0 A;  5KI6 A;  4AHR A;  3NE6 A;  5C42 A;  3KLF A;  3OY9 A;  4HUF A;  4GW6 A;  2OYQ A;  4ZTJ A;  3DMJ A;  3HST B;  3NF8 A;  4RW9 A;  5JS2 A;  4M41 A;  5HRN A;  3HM9 A;  2G8V A;  2EHG A;  4DQI A;  4FJ7 A;  4FK0 A;  2YHB A;  3NCI A;  4E7I A;  4LSN A;  1HRH A;  3VQ6 A;  3NH2 A;  3MXJ A;  3KD1 E;  2DFF A;  5KGW A;  2KZM A;  3CG7 A;  1BIU A;  3OYG A;  3OS1 A;  3EYZ A;  1Z25 A;  4DTU A;  4CF0 A;  2RKI A;  4KFB A;  3ULD A;  4DS4 A;  1FKO A;  1IKX A;  3OYK A;  4CHZ A;  1WSI A;  3SPZ A;  1EKE A;  3DRR A;  1D5A A;  3AVH A;  2G8K A;  3O3G A;  1HPZ A;  3EZ5 A;  5C24 A;  3SNN A;  3WNH A;  3OJS A;  2HVI A;  1RNH A;  2NUB A;  4DTM A;  2ZQB A;  3RTV A;  4BE0 A;  1QTM A;  4PUO A;  2FBX A;  4B9T A;  3M8Q A;  4CJT A;  1VSH A;  1C1B A;  1S5J A;  1Q8I A;  1U4B A;  3AVI A;  4Z4H A;  4FM0 A;  1IKY A;  2RPI A;  1S6P A;  3QET A;  4FLW A;  2QK9 A;  3L8B A;  4EZ6 A;  4DQS A;  3C6U A;  2Z1I A;  3QLH A;  1JLG A;  3S9H A;  4FJM A;  3B6O A;  2VWK A;  2OPQ A;  1B92 A;  3DLH A;  4CK1 A;  3O3H A;  4JRP A;  3I8D A;  3SJJ A;  1NK6 A;  1RTD A;  1JXE A;  2YNG A;  3OYF A;  4KO0 A;  4CER A;  2OA8 A;  4F4K A;  3KKS A;  3NFA A;  3HPH A;  4J2B A;  2KZZ A;  4E0D A;  4QOZ B;  2PY5 A;  1R0A A;  4DF4 A;  2F8T A;  1QQC A;  1S9G A;  1ASW A;  3O4Q A;  3AVB A;  1NK4 A;  2HHT A;  3OS0 A;  4IG0 A;  1EX4 A;  1NKB A;  3DYA A;  1TV6 A;  1IKV A;  2G8W A;  5FRO A;  1QHT A;  2HHQ A;  4FZY A;  4H4M A;  4OGC A;  4CFC A;  2KW4 A;  4CJ5 A;  1SKR A;  1CXQ A;  1FXX A;  1BQM A;  1O1W A;  4KHU A;  4E7K A;  3CM6 A;  1ASU A;  1QSS A;  1BQN A;  4ID5 A;  5CY4 A;  4BDZ A;  4DLG A;  4G1Q A;  2E4L A;  1QSY A;  4B9N A;  2BGG A;  4OLA A;  4LH4 A;  3HVT A;  4E7L A;  3HO1 A;  3TAM A;  1S1X A;  1VSL A;  1RTI A;  3VQB A;  5SZT A;  3U3G A;  4DTP A;  4FW1 A;  2XY5 A;  1X9S A;  4ID1 A;  2PZS A;  4RW6 A;  1C6V A;  1CXU A;  4CHP A;  3OYI A;  4FJH A;  1HYS A;  1VK0 A;  4O44 A;  2OPS A;  3RRG A;  1VSF A;  1LAW A;  3LPT A;  3F73 A;  4FLZ A;  4FJL A;  3LZI A;  3I0R A;  4F8R A;  4Z4E A;  4HUG A;  1UWB A;  4F2R A;  4O0J A;  1QS4 A;  4EP5 A;  1CLQ A;  1RT4 A;  3KK3 A;  3NHG A;  4BAC A;  3ZSW A;  4AH9 A;  1SKS A;  2OPP A;  5DMR A;  3RRH A;  4E1M A;  3HPG A;  3AO5 A;  3K5L A;  4YNQ A;  2WOM A;  3SI6 A;  4FJI A;  5CZ1 A;  3VQ8 A;  1JL2 A;  3BGR A;  1SL0 A;  3ALY A;  2XY8 A;  3KD5 E;  3L2U A;  3IAY A;  4ELT A;  1VRU A;  4DSK A;  4BE1 A;  2HB5 A;  3C94 A;  2E6M A;  4FLY A;  1RTJ A;  3TAF A;  1GOA A;  3QER A;  2ZD1 A;  2XY6 A;  4CED A;  3AVG A;  1VSM A;  1SUQ A;  4CF1 A;  3LDS A;  4C8N A;  1RBS A;  4BE2 A;  2KFN A;  4CGH A;  4CGG A;  3V9X A;  4M3W A;  1RDC A;  2IOC A;  4OKJ A;  5J1E A;  3L2Q A;  5FRN A;  4DWI A;  4DTO A;  2JGU A;  1L5U A;  4B8A B;  3VN5 A;  4H8K A;  4WE1 A;  1BCO A;  1QSL A;  1WN7 A;  4C8M A;  1SL2 A;  3B6P A;  2P5O A;  4FXD A;  3TAG A;  1RT3 A;  3VQ4 A;  1S1T A;  3LWL A;  4UQG A;  3DLG A;  4FZX C;  3VQ9 A;  2P51 A;  1REV A;  3KTQ A;  2FBT A;  4HHT A;  1T8E A;  4FJK A;  4KI6 A;  3V4I A;  1IG9 A;  1K6Y A;  3ZT0 A;  4KHN A;  2RF2 A;  3G10 A;  3LAL A;  3QEP A;  4CEO A;  2FBY A;  4I2Q A;  3S3N A;  3V1O A;  2O4I A;  4FK2 A;  4IG3 A;  2GBZ A;  4O55 A;  3QEW A;  3TWH A;  4CF8 A;  4YFU A;  3M8R A;  4E3S A;  3NH1 A;  1I39 A;  2YKN A;  4FJN A;  2ZE2 A;  3NF9 A;  4FM2 A;  2BE2 A;  3RR8 A;  4KHS A;  3AA2 A;  3ZSR A;  4PWD A;  3C95 A;  4M45 A;  3K5N A;  2IC3 A;  1HYV A;  4N76 A;  1LWF A;  3DLK A;  1D8Y A;  4GMJ B;  4I2P A;  4DTR A;  2DTU A;  1KSP A;  3KLI A;  3ITH A;  3K58 A;  2R7Y A;  4DSL A;  1RBT A;  3K57 A;  4CJ4 A;  3OJU A;  3PX0 A;  2P5G A;  4FVM A;  3IG1 A;  3O4N A;  2Z1J A;  4B8C A;  4KI4 A;  3ZSX A;  4Y1C A;  4M3X A;  1VSE A;  4DFK A;  1U48 A;  3P83 D;  3ZT3 A;  3BDP A;  2F96 A;  5D3G A;  1J53 A;  1KFD A;  2IDO A;  2WON A;  2XHB A;  2Q3S A;  5C25 A;  3K2P A;  4O5B A;  1J9A A;  3AA4 A;  1RDA A;  1RTH A;  3HVR A;  1IO2 A;  2HND A;  3DI6 A;  3QIP A;  2Y1J A;  2Y1I A;  4DG1 A;  4KRF A;  2HHV A;  1RT6 A;  3TR8 A;  1JLA A;  3K5M A;  2D0A A;  2AJQ A;  1A5V A;  3U3Y A;  4FJG A;  4CF2 A;  4M3U A;  3SCX A;  3DOK A;  2HMI A;  4XIU A;  2O4G A;  5SWM A;  1N5Y A;  4M3Z A;  4W5N A;  4DS5 A;  3K5O A;  1IH7 A;  5HLF A;  1RT1 A;  1NK5 A;  4BDP A;  3OYC A;  3QNN A;  4OLB A;  3TI0 A;  4C8L A;  3P1G A;  3G0Z A;  4E89 A;  2HW3 A;  2YKM A;  4CK3 A;  3SQ0 A;  3HP9 A;  3A2F A;  5KRS A;  2GUI A;  1LAV A;  4AHU A;  4CGF A;  3CFR A;  3AV9 A;  4DFJ A;  1KFS A;  2QKK A;  1JKH A;  3NAE A;  3HK2 A;  2YNH A;  2W42 A;  3AA5 X;  4CE9 A;  2KTQ A;  4KHQ A;  3DLE A;  3OYJ A;  2D0C A;  4R5P A;  4IDK A;  3VQE A;  3K59 A;  1NK7 A;  4JLH A;  4DSF A;  1F21 A;  3ZSQ A;  4TSX A;  1I3A A;  2I5J A;  4ICL A;  2XO7 A;  2HHW A;  4GVM A;  4W5T A;  1TVR A;  3WNG A;  1DTT A;  1S1U A;  1SKW A;  1ITG A;  1CZ9 A;  1BI4 A;  1W9H A;  1Y97 A;  4DSE A;  3V9U A;  1L3U A;  1X9W A;  3RWU A;  4F3T A;  1KCF A;  3AO4 A;  1VSD A;  1JLC A;  1EXQ A;  2B4J A;  3LP2 A;  3PY8 A;  2OZS A;  4CJW A;  3LAM A;  4CHO A;  4DFM A;  3QIN A;  1NJY A;  2HNZ A;  3AVL A;  1LWE A;  4OGE A;  5EU7 A;  3OYL A;  4DU3 A;  5J2P A;  1KVB A;  3RMC A;  1RT5 A;  1NOY A;  4F3O A;  4QCL A;  3MXI A;  4NCB A;  1NOZ A;  4M3Y A;  3PX6 A;  1ZBL A;  3VA0 A;  1KLM A;  4Z4F A;  2XRI A;  4CEF A;  3OYN A;  1NJW A;  3T1A A;  4CJV A;  3PUF A;  4B9L A;  4J2D A;  2X6S A;  4CFA A;  5KGX A;  2B6A A;  3H08 A;  3AVM A;  3MEC A;  3KLE A;  2B5J A;  1TKD A;  2JLE A;  4FJJ A;  4CHN A;  2VG5 A;  4CIE A;  1T7P A;  3ZT1 A;  3PV8 A;  3AVC A;  4M3T A;  3FFI A;  3AVJ A;  3KKR A;  4N56 A;  2HNY A;  2G8H A;  4B3O A;  2HHX A;  3MXM A;  4FLT A;  3QEX A;  2VG7 A;  1MU2 A;  3TAP A;  3QES A;  2X74 A;  3MAQ A;  3SPY A;  2A1R A;  3D45 A;  3V9Z A;  3LAN A;  4Q0B A;  4CEB A;  2HHS A;  2FC0 A;  3ISN C;  3E01 A;  1WSF A;  3RR7 A;  1NKE A;  3THV A;  1W0H A;  4DQP A;  1S1V A;  3NBP A;  3V1Q A;  4DTS A;  4J2E A;  1HNV A;  4BWM A;  4ELU A;  1NK9 A;  4PA1 A;  3QNO A;  3F9K A;  3SQ4 A;  3S3M A;  1WNS A;  3V81 A;  4CIF A;  5JS1 A;  4QAG A;  1B9D A;  3S3O A;  4N41 A;  1RDD A;  1QE1 A;  5FRM A;  3OYE A;  4CEA A;  5CZ2 A;  3PX4 A;  5KRT A;  2D0B A;  1VRT A;  3AVA A;  3VQ7 A;  4FJ8 A;  4C8O A;  4E7J A;  3MEG A;  4CHY A;  4JS5 A;  1KRP A;  4L8R B;  1IKW A;  2DFH A;  1TL1 A;  1Z26 A;  1NJX A;  3SUO A;  1YVU A;  3OYM A;  2G8F A;  3CM5 A;  4NCA A;  3VQ5 A;  3IS9 A;  4Z4C A;  1TAU A;  1DLO A;  4DU4 A;  4I7F A;  4I9L A;  4CEZ A;  1NK8 A;  3LAK A;  3TAN A;  1LW0 A;  4KTW A;  4DMN A;  4CGD A;  4RW8 A;  4CJF A;  2LSN A;  3V6D A;  4MQ3 A;  4Y1D A;  4FZZ A;  1TK5 A;  2ITG A;  4N47 A;  3HP6 A;  4FK4 A;  4NYN A;  4O4G A;  4CFB A;  3LP1 A;  3KLH A;  4AIL C;  3OYA A;  5E41 A;  4O0I A;  4DTN A;  1TKX A;  4B9V A;  3DLB A;  4KKO A;  3CQ8 A;  3HT3 A;  3NGI A;  3WNF A;  3ZSZ A;  1XC9 A;  1SL1 A;  4IKF A;  1BCM A;  1S1W A;  5K14 A;  3V1R A;  4FJX A;  2YNF A;  4IFY A;  4CCH A;  4FJ9 A;  4NYF A;  4CJP A;  1LW2 A;  3DRS A;  3PO5 A;  4AHV A;  4E19 A;  3C6T A;  3VQC A;  3ZSY A;  4LY7 A;  4BDY A;  3TAQ A;  2G8I A;  1TGO A;  1U49 A;  1WSG A;  5FDL A;  3QIO A;  4HUE A;  1YTA A;  4DFP A;  3NF6 A;  1GOB A;  4FLV A;  4CFD A;  1JLE A;  1HJR A;  4B08 A;  4CJS A;  4Q5V A;  3KK1 A;  3IRX A;  4DF8 A;  5CYM A;  4M3R A;  2Z1G A;  4H4O A;  4OPK A;  5I3U A;  1C0T A;  4CJR A;  4IBN A;  1NK0 A;  3HPO A;  2A1S A;  3AVN A;  1JXB A;  2KQ2 A;  3SUN A;  4DQR A;  3VQD A;  4K8Z A;  3VQP A;  3T19 A;  4FCY A;  3V9W A;  1RDB A;  5KTQ A;  4ZTF A;  1S6Q A;  2YNI A;  3JSM A;  3CFO A;  4NCG A;  1TK0 A;  3ZCM A;  4KV8 A;  1S9E A;  2QXF A;  4FW2 A;  3SZ2 A;  4FM1 A;  3RMD A;  3T3F A;  4DLE A;  4CJL A;  3SUP A;  1RT2 A;  1B9F A;  1XHX A;  1WLJ A;  3L2R A;  1L3V A;  3VA3 A;  1D9D A;  1JLF A;  5CYQ A;  4LD0 A;  4OVL A;  4AHS A;  4HVJ A;  3L2V A;  5J2M A;  3L2W A;  1RCH A;  1RIL A;  1BIZ A;  4KPY A;  1ZBU A;  4Z4G A;  1YT3 A;  1HYZ A;  4JS4 A;  1T05 A;  1WSE A;  1WAJ A;  3WNE A;  4DTX A;  3RMB A;  1TAQ A;  1YTU A;  3NGZ A;  4HCC A;  4CGJ A;  2E6L A;  3TAE A;  2FBV A;  3MEE A;  1EET A;  1HQU A;  1FK9 A;  5DK5 A;  3SV4 A;  3NGY A;  3M8S A;  3HXM A;  3TAB A;  1KVC A;  2Z1H A;  3SYZ A;  4M42 A;  2YHA A;  1ZBI A;  3LP3 A;  1JLQ A;  4CEE A;  3D0P A;  4DSJ A;  3AVK A;  3AO3 A;  4CJK A;  1Q9Y A;  4N5S A;  2P1J A;  4HCB A;  3AO2 A;  1RBR A;  3VQA A;  4LSL A;  4KRE A;  3DRP A;  5J2N A;  3EY1 A;  1EP4 A;  1RBV A;  2IS3 A;  1RBU A;  4Z0U A;  3DLR A;  3HYF A;  3TAR A;  4HTU A;  2YV0 X;  1T03 A;  1U45 A;  5HRP A;  1XWL A;  3DM2 A;  3U6F A;  4I9Q A;  3L3V A;  4CK2 A;  3PO4 A;  4K8X A;  2DFE A;  4CJ3 A;  5T7B A;  1VSK A;  2IGI A;  3M8P A;  1U47 A;  4CHQ A;  4Z4I A;  1CZB A;  3OYB A;  4DTJ A;  1J5O A;  2X78 A;  1G15 A;  5HBM A;  4AHC A;  4ELV A;  4KAZ A;  1KVA A;  1A5X A;  1HNI A;  4B9M A;  1BI4 B;  4CGI A;  4E1N A;  4FLX A;  4KTQ A;  3HJF A;  3UIQ A;  3QEI A;  2GV9 A;  1BL3 A;  4PY5 A;  4CJQ A;  4CJU A;  4OKK A;  2OZM A;  1X9M A;  1LWC A;  1TK8 A;  4FLU A;  3ASM A;  3NF7 A;  4PQU A;  4JRQ A;  4J2A A;  1GOC A;  1ZBH A;  1WAF A;  3ZT4 A;  5J2Q A;  3OYH A;  3QEV A;  3AA3 A;  2X6N A;  4CES A;  3SUQ A;  2PYJ A;  3LPU A;  3ZSO A;  1XHZ A;  4DSI A;  1UOC A;  2XY7 A;  4E7H A;  4W5Q A;  1ZBF A;  3O3F A;  1U04 A;  2D5R A;  1VSI A;  4KB1 A;  1KTQ A;  1WSH A;  3V9S A;  2KFZ A;  3VQQ A;  4KHW A;  2DY4 A;  2VG6 A;  3ZSV A;  1DTQ A;  4CF9 A;  3HL8 A;  1TKT A;  3KIO A;  3MED A;  1JL1 A;  1ASV A;  4FJ5 A;  1C1C A;  2QKB A;  2IAJ A;  1HQE A;  3OVN A;  4CEQ A;  4FYD A;  1FKP A;  1X1P A;  5HRS A;  1C0U A;  4RW7 A;  2ETJ A;  4EP4 A;  4W5O A;  3NH0 A;  3ZT2 A;  3L3U A;  4C8K A;  2HVH A;  1HMV A;  3JYT A;  3RMA A;  4B9S A;  4KTZ A;  3DOL A;  2HHU A;  3OYD A;  4AHT A;  4F2S A;  1XI1 A;  1NKC A;  2OPR A;  3SQ2 A;  5HRO A;  5HP1 A;  4CEC A;  4DQQ A;  1WSJ A;  3SV3 A;  1TL3 A;  1UA0 A;  1UA1 A;  1C0M A;  2RN2 A;  4IFV A;  4OKE A;  1SV5 A;  4RW4 A;  3KLG A;  2EX3 A;  1L3T A;  1UAX A;  4B9U A;  4KHY A;  3KJV A;  3AO1 A;  4EZ9 A;  3SQ1 A;  1N6Q A;  1D9F A;  3CYM A;  2F8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...