2ZQBA

Crystal structure of a psychrotrophic rnasehi variant with sextuple thermostabilizing mutations
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
152
structure length
149
Chain Sequence
ELKLIHIFTDGSCLGNPGPGGYGIVMKYKGHTKEMSGGFSLTTNNRMELLAPIVALEALKEPCKIILTSDSQYVRQGIMTWIHGWKKNGWMTSNGTPVKNVDLWKRLDKAAQLHQIDWRWVKGHAENERCHQLARAAAEANPTQIDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Destabilization of psychrotrophic RNase HI in a localized fashion as revealed by mutational and X-ray crystallographic analyses
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 44
structure length 149
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2zqbA00
5FROA 2PYLA 4ZHRA 3AVJA 4DSEA 3QNOA 3PY8A 4CF2A 2OA8A 3L2QA 1C0MA 4CFCA 1GOBA 4DQSA 1X9MA 3SQ0A 2D0AA 4F4KA 4BWJA 4BWMA 1Q9YA 4FK4A 4CEOA 3HXMA 4Z0UA 4FZXC 3DI6A 4DFMA 4H4MA 4CJ5A 1D9FA 4N41A 3AA2A 2ITGA 3L2UA 4ZTFA 3RTVA 3PO5A 4Z4EA 2VG5A 4NCGA 4B3OA 1HYZA 4M3ZA 4DQIA 1LWCA 4BE1A 3TAEA 3S3MA 3ZT0A 3NCIA 1MU2A 3AA5X 1NKBA 1CXQA 3SUOA 2PYJA 3RWUA 3DLEA 2E6LA 2HHVA 4CEZA 1SKSA 4M3YA 1BGXT 4FVMA 3TAMA 4KHYA 3OVNA 4RW8A 1EXQA 5KRSA 3AVGA 1BQNA 3NAEA 3ZSRA 4HCCA 2QKBA 1TK0A 1FXXA 1WNSA 1RT3A 4CGIA 1RTIA 4IDKA 4ELVA 1TVRA 4FYDA 1C6VA 1WSGA 4M3RA 1NOYA 1XI1A 1NJWA 4AHCA 1TK5A 2KQ2A 1A5XA 4E0DA 5FRNA 3JYTA 1W9HA 1YT3A 4HUFA 4CEDA 3L2VA 3LP3A 4IFVA 1QS4A 2PY5A 1EETA 1O1WA 2JLEA 4Y1CA 2OPPA 3HPHA 3ZT4A 3V9WA 1SKWA 2QKKA 5KGWA 1HYSA 2DY4A 1TKZA 3DLBA 4H4OA 1I39A 4C8KA 3CQ8A 1JLCA 4FJ5A 3KLIA 2B5JA 5JS1A 2Z1HA 3DLGA 3QNNA 3RMBA 3BDPA 3K5MA 3LPTA 4RG8A 4J2EA 3TABA 2ZE2A 4CJQA 1TGOA 1VSLA 3WNEA 3AVNA 3OYEA 1L3UA 2B4JA 4W5OA 3KK2A 4LH5A 1VSDA 4R5PA 1WSJA 3SUPA 1ZYQA 2IC3A 5E41A 3KK1A 1X9WA 1T05A 4F3TA 3LZIA 4GVMA 4E7LA 4OKKA 3ZT3A 3ASMA 3QIOA 1JXBA 1W0HA 4LH4A 3LWLA 1C0TA 3S3NA 4AILC 3LAMA 4CHOA 3SUQA 3G0ZA 3C95A 1EX4A 1RBTA 4HVJA 3OS1A 3OYGA 3M8RA 1UAXA 3AO3A 1JL1A 4TSXA 1JLQA 3OYMA 4FM1A 4LY7A 4CF8A 4CERA 4E7JA 3QEXA 3PX0A 2YV0X 4KFBA 4LD0A 2O4GA 4CJKA 4EZ6A 1IKVA 3CFOA 3TAPA 3RR7A 2EX3A 3NF6A 1S1TA 3NGIA 4CEQA 4Z4IA 3HO1A 2HHWA 1RBRA 4AHVA 4DSIA 4BE0A 3VQ5A 3SPZA 2Y1IA 1A5VA 4DS5A 1BI4A 1JLEA 3NHGA 1NK7A 4ICLA 3JSMA 1UA1A 1TV6A 4CESA 3OYBA 2FBXA 2YKMA 2BDPA 1ASWA 4B9LA 1TK8A 2E4LA 3DRRA 3L8BA 2R7YA 3AO5A 3I0SA 4DG1A 5C25A 1TKXA 3SI6A 4M45A 1LW0A 4O55A 3I0RA 4CJ3A 3M8SA 4E89A 3RRGA 1X1PA 1TKTA 1Q8IA 1RT4A 3A2FA 4ID1A 4O44A 4M41A 3HP6A 3PV8A 2A1RA 3NBPA 4DTXA 4PWDA 4DTRA 1NK5A 2O4IA 2HHTA 3L3VA 1ITGA 3BGRA 3DM2A 4ZTJA 1XHXA 3NFAA 4CGFA 3KLFA 1REVA 1ZBLA 2ETJA 3CG7A 4N47A 4KHUA 1KLMA 5SZTA 1KVBA 1BCOA 3AVCA 4KI6A 4M3XA 4DTSA 4DF8A 3RMAA 1S1XA 1QE1A 3QERA 3TANA 1NK9A 1KCFA 1WSHA 1RDCA 4W5TA 3QETA 4IFYA 4RW7A 2KFNA 1SV5A 1WLJA 5CYQA 4KTZA 3T1AA 4CEFA 3O3FA 2Q3SA 2P5OA 4W5QA 3TI0A 1I3AA 4DLGA 4FZYA 4M3UA 3PX4A 3CM5A 2IOCA 2DFEA 5DK5A 1J9AA 4CF9A 3UIQA 1RTJA 3MXJA 3OYFA 3T19A 4CEEA 4QCLA 1SL1A 4CJPA 4IBNA 2IAJA 1RILA 4JRPA 2YHBA 4KAZA 2ZQBA 1RTHA 1NJYA 4WE1A 4IKFA 2HNDA 1BL3A 1S1VA 3V1RA 4FCYA 1N5YA 3KD5E 3U3GA 1SL2A 2QXFA 1Y97A 2KFZA 1VRTA 4FLYA 2VG7A 3AO4A 4OLAA 1S1WA 4AHUA 2G8VA 2X78A 4FJ8A 5KI6A 5HLFA 4OGCA 3HM9A 3S3OA 3SYZA 1WSEA 5J2QA 3SQ4A 3HSTB 4OGEA 1LAVA 3NE6A 3AVKA 1BHLA 1TKDA 3O4QA 4H8KA 4F3OA 2RKIA 4FLZA 4DMNA 4FK2A 4FZZA 1U47A 5HRSA 1KRPA 3HVRA 4W5NA 4EP4A 2XO7A 1WSIA 1VSKA 1ASVA 4NYNA 2ZD1A 2XY6A 2YKNA 5FRMA 1TL3A 3SZ2A 4I2QA 2IGIA 3K57A 3PO4A 2OZMA 4E1NA 1IH7A 4MQ3A 4CK2A 1LAWA 4FLWA 1CZBA 5J2MA 1G15A 1RT6A 4FW2A 3V6DA 3SQ2A 1D5AA 1VRUA 1IO2A 4CGJA 1FK9A 3ZCMA 2F8TA 1X9SA 2QK9A 3K2PA 4KO0A 3K5NA 3KD1E 3IS9A 3HP9A 1SUQA 2HHQA 3AA3A 3WNFA 3IG1A 1JL2A 1BISA 1VSMA 4AHRA 3P1GA 1YVUA 1CXUA 3O4NA 5HBMA 2XY8A 4B9NA 4B08A 1R0AA 1KFSA 3VQ6A 3AVBA 3VN5A 4DFPA 1F21A 5CZ2A 4HUGA 1QSYA 3QIPA 1FKOA 3B6PA 4FJIA 2DFFA 3OS0A 1HNIA 3HYFA 4DU1A 3P83D 3TAFA 4DQQA 1XC9A 3CFPA 4M3WA 1S9EA 3EZ5A 4PY5A 1CLQA 2Z1GA 3V9XA 4DWIA 1K6YA 1T03A 1S6PA 1RDAA 1BIZA 4Q5VA 4QOZB 4KI4A 1RT5A 3D45A 5HRPA 1U48A 3OYLA 4NCBA 1YTAA 3OYNA 2XRIA 1BIUA 1RBSA 3E01A 3VQ4A 3VQ9A 4DLEA 4DS4A 3QEVA 4OLBA 2HB5A 2IDOA 1Z25A 3QLHA 4CIEA 2RN2A 2D0BA 1J5OA 2WOMA 2G8WA 3IRXA 3T3FA 4FLVA 5KGXA 1UA0A 1VSIA 2G8HA 2IS3A 4C8OA 1QQCA 3DMJA 1J53A 1UWBA 5K14A 1RDDA 4FJGA 1HQEA 4CJWA 2W42A 3KTQA 5HRNA 4CJRA 3OYHA 4E7IA 3NH0A 4IG3A 1KTQA 4EP5A 4CJ4A 3O3HA 4E7KA 4FJHA 3CFRA 3TAQA 2OYQA 4FXDA 1WN7A 1U4BA 4FJNA 1JLAA 2RPIA 1UOCA 4CF1A 4CJEA 2HHUA 2D0CA 1C0UA 3P5JA 3SV4A 4CGDA 2LSNA 3V9UA 3RRHA 4FW1A 1NKCA 2G8FA 4KPYA 2VWJA 4FJXA 1J54A 3V9ZA 1TL1A 5CZ1A 2XY5A 3VQBA 5KRTA 2DFHA 4BE2A 2G8IA 3AO1A 4J2DA 3ISNC 1A5WA 1U04A 4RW9A 4XIUA 4B9UA 1RT2A 2F8SA 2VWKA 4OVLA 4E19A 1JKHA 3L2WA 2HHSA 1GOCA 3HJFA 1VSEA 4C8MA 3HPGA 3OYAA 5FDLA 2P51A 1KVAA 4CJTA 2OZSA 4KHQA 4CFAA 3TARA 4Z4CA 4C8NA 3VQEA 2FBTA 1QSSA 3K5OA 3CYMA 4F8RA 4KREA 2YNHA 1SL0A 4O5BA 5CYMA 1L5UA 1WSFA 4I2PA 4HTUA 4DTOA 1RTDA 1Z26A 1TAQA 4LSLA 4AHTA 1NK4A 4FJMA 2X6NA 4CJVA 4CHQA 4CIFA 4C8LA 1ZBIA 3S9HA 1U49A 3DOLA 1C1BA 3THVA 4KB0A 2BGGA 2X6SA 2YNIA 3AVAA 5DMRA 1T7PA 1BQMA 3DLHA 1EKEA 3I8DA 4NCAA 3AVFA 3LP1A 4CHZA 3HT3A 1NK6A 4I9LA 3V4IA 4K8XA 3TWHA 3L3UA 4M3TA 4Z4HA 3MAQA 4DF4A 3PUFA 3VQAA 2OPRA 2XY7A 5HROA 2DTUA 1JLGA 4DQPA 4OKEA 4MFBA 4CHYA 4DTJA 3AVLA 1YTUA 4DSFA 3MEGA 4CHPA 1HJRA 4KV8A 4OKJA 5J2PA 4O4GA 2GBZA 4CK3A 3NH2A 1HPZA 3C94A 3V9SA 1KLNA 4CEAA 2P5GA 3SJJA 1C1AA 1Q9XA 2Y1JA 3VQQA 2HVIA 4OPJA 3QESA 3EY1A 2HVHA 1LW2A 3B6OA 3L2RA 1KFDA 1DTTA 3M8PA 3RR8A 4B9SA 3DRPA 4HHTA 1XHZA 3OYCA 1HQUA 5HP1A 5KTQA 4CE9A 3HVTA 3V1OA 3HK2A 1S9GA 1BCMA 5J2NA 4OJRA 3AVMA 4W5RA 1ZBUA 2KZZA 1S1UA 3CM6A 3F9KA 3DLRA 3ZSWA 4CFBA 3HL8A 4E1MA 5C42A 3KLEA 3SUNA 1KSPA 2JGUA 2KTQA 3LWMA 4DU3A 3QINA 3VQDA 3MXIA 1LV5A 4QAGA 1B92A 4ELUA 3NH1A 4CJLA 1HNVA 3OJUA 2WONA 3QEIA 2OPQA 4G1QA 3AO2A 3ZT2A 3O3GA 1NK0A 1RDBA 4DFKA 4J2AA 4ID5A 2FBVA 1IKXA 3SCXA 1U45A 2XHBA 3LZJA 3OYIA 3AV9A 3DYAA 1C1CA 1B9FA 1ZBHA 3F73A 4JLHA 3OY9A 4PA1A 4I7FA 4FK0A 3MEEA 4Z4GA 2BE2A 3ZSXA 3ULDA 3OS2A 2KZMA 1NKEA 4BDZA 2Z1IA 5CY4A 4K8ZA 4B8CA 2HNZA 3MEDA 3MECA 4CK1A 3LDSA 1L3TA 2Z1JA 3DLKA 3ZSQA 4CJUA 4FJKA 4KHSA 4CF0A 4GMJB 3OYKA 5SWMA 3DOKA 1NK8A 4I9QA 4Z4FA 4CJSA 3NGZA 1RBUA 3V1QA 3D0PA 3VQ7A 1ZBFA 1JLBA 4DTMA 1NJXA 4BDPA 3KIOA 4GW6A 4DTNA 3SV3A 2NUBA 3K5LA 3LALA 3MXMA 3OYJA 1DTQA 4KHNA 4PQUA 5HRRA 1RT1A 4UQGA 1D9DA 3U6FA 1VK0A 4BDYA 4CECA 1XWLA 3H08A 5C24A 2HNYA 3NGYA 4AH9A 4YNQA 3KK3A 3PX6A 3SNNA 3C6UA 4CHNA 3WNHA 3LP2A 1GOAA 1IG9A 2EHGA 1LWFA 4CEBA 3VQ8A 2OPSA 1RNHA 3VA3A 3AA4A 4E7HA 3SQ1A 4CCHA 4E3SA 2HW3A 4JS4A 5JS2A 4L8RB 3OJSA 2KW4A 3KLGA 3NDKA 1L3SA 4B9VA 4KRFA 4KKOA 4LSNA 3LANA 1TAUA 3ZSVA 3EYZA 3TR8A 1T8EA 4HCBA 2BANA 2YHAA 1RT7A 4DTUA 4M42A 2FBYA 3KLHA 1NOZA 4DFJA 3K59A 4DTPA 3ZSYA 3RMCA 4J2BA 2B6AA 2D5RA 3KJVA 4N76A 4NYFA 4FJLA 2GV9A 2F96A 1WAFA 1HYVA 1ASUA 5T7BA 1B9DA 3QO9A 4DSJA 3OYDA 1VSFA 3TAGA 1S6QA 4KTWA 4Y1DA 1EP4A 3VQPA 1QTMA 2G8KA 2FC0A 1FKPA 4F2RA 3DRSA 3ZSOA 2VG6A 3G10A 3HPOA 1RCHA 4FJ7A 3FFIA 3QEWA 1JLFA 2YNGA 3ZSZA 3V81A 1L3VA 4KTQA 4Q0BA 2HHXA 4CFDA 4FJJA 4IG0A 3M8QA 3VQCA 4YFUA 5I42A 1WAJA 4HUEA 3SPYA 3VA0A 4RW4A 3NF7A 3WNGA 3K58A 4N56A 3KKRA 2G8UA 3RMDA 1RBVA 2AJQA 2X74A 1BI4B 4DQRA 1CZ9A 1IKYA 1IKWA 2A1SA 4BACA 1QHTA 1VSJA 4KHWA 1JXEA 1VSHA 4O0JA 4CGGA 4DSLA 3LP0A 5D3GA 1HRHA 4CIGA 4FM0A 4DSKA 5I3UA 1S5JA 4AHSA 3AVHA 2E6MA 3U3YA 3NF9A 4OPKA 5EU7A 2HMIA 4N5SA 4JS5A 4B9TA 1N6QA 2RF2A 4B9MA 4FLXA 4FM2A 3AVIA 1KVCA 3ALYA 3IAYA 1HMVA 1LWEA 3C6TA 3LAKA 4O0IA 4F2SA 4KB1A 4FJ9A 5J1EA 3ITHA 4RW6A 4FLUA 4CJFA 1NJZA 1SKRA 2ATQA 2YNFA 4B8AB 3LPUA 4CGHA 4DU4A 3ZT1A 2PZSA 3NF8A 4EZ9A 1D8YA 1DLOA 2GUIA 3KKSA 1QSLA 3QEPA 4PUOA 2P1JA 4FLTA 2I5JA 4ELTA 4JRQA
chains in the Genus database with same CATH superfamily
4ZHRA 5C15A 3PY8A 3L2QA 1KC8O 4F4KA 4A57A 4AQYK 4B9QA 4BWJA 4CEOA 4RCHA 4DFMA 3JS6A 1D9FA 4ZTFA 3PO5A 4B3OA 1HYZA 3NCIA 3FLCO 4O5FA 1BG3A 2YHYA 2HHVA 4H0XB 1SKSA 4IOAL 2ZGZA 4AF1A 4KHYA 1JCGA 3D6RA 4EHTA 2QKBA 1TK0A 1NGHA 1FXXA 2UXCK 4UY8O 4HWIA 4ELVA 5LMNK 3MWTA 3AARA 1XI1A 3O80A 5FRNA 3MK6A 4H5RA 1VQ9N 1YT3A 3P39A 4CEDA 1QS4A 2BH1A 1U2VA 1SKWA 1HYSA 2QKKA 5KGWA 4AM6A 1TKZA 1WBBA 1I39A 1QZ6A 2PBDA 5JS1A 3DLGA 1VQ4N 3RMBA 4CI6A 4CJQA 3AAPA 2NRTA 4LH5A 3WUHA 1WSJA 1T05A 5BREA 4PKHA 4GVMA 1Q82O 4K42A 3O5BA 5EXWA 1JXBA 4LH4A 2OCEA 3S3NA 5AQRA 1HLUA 3DLLL 3LAMA 1ATNA 3G0ZA 1JL1A 3OYMA 3R3LA 3QEXA 3CJAA 3MX2A 3PX0A 4CJKA 2EX3A 3NF6A 3HO1A 4BRLA 3C6HA 3WEEA 4DS5A 3NHGA 2VWBA 2HMPA 1X9JA 1TV6A 2FBXA 2YKMA 2BDPA 4B9LA 2E4LA 4DG1A 5AQFA 5C25A 3EKUA 3A8YA 4BR9A 3HOTA 4E89A 1J6ZA 1RT4A 3MCPA 4M41A 3HP6A 4DTXA 1E4FT 2P9LA 3L3VA 1HKCA 3BGRA 3DM2A 4CZHA 4I6MB 3VENA 3NFAA 1ZBLA 1REVA 4CZGA 4IWVA 5BPNA 5SZTA 1BCOA 3AVCA 4KI6A 4DTSA 3QERA 3BZCA 3CJ1A 4KH6A 4W5TA 3HTVA 4H5WA 3TI0A 2F7TA 4DLGA 3IKMA 4FZYA 3CM5A 2IOCA 3EO3A 4A5BA 5DK5A 3ULEB 3MXJA 2IVPA 1SL1A 4CJPA 4IBNA 3WQUA 2A40A 3M1FA 5ELZA 1RTHA 4HTLA 4BRPA 2HNDA 1BL3A 5JVHL 3V1RA 1N5YA 3G71N 2QXFA 4WQ4C 5AZIB 1VRTA 2A3ZA 4AHUA 3HM9A 1WSEA 1LAVA 1BHLA 3CCRN 3GDQA 5HRSA 1KRPA 3ATVA 2XO7A 4FSVA 3CQXA 1SAZA 4NYNA 2ZD1A 2YKNA 3OHRA 2GELA 3K57A 4A61A 4IFEA 4MQ3A 5ADXH 1LAWA 4DV1K 3HSCA 1CZBA 3RVCA 1RT6A 3OTOK 3V6DA 2FLOA 4CW7B 1IO2A 4CGJA 3ZCMA 2F8TA 4DR3K 4KBOA 2KHOA 2O8FA 1BOTO 2HHQA 3IG1A 1BA0A 1YVUA 5HBMA 2XY8A 1R0AA 3VQ6A 3OBYA 1F21A 5CZ2A 4HUGA 1QSYA 3N4PA 3B6PA 2DFFA 1HNIA 3MMVA 3OBWA 4Y0WA 1HKGA 4M63C 1M1KO 2Z1GA 4FPAA 1RDAA 4K0KK 3BF1A 2FSKA 2XRIA 1RBSA 3E01A 4OLBA 2HB5A 3QLHA 2RN2A 3IRXA 1VQMN 1C0GA 4DHYA 2IS3A 2UUBK 3KK7A 4C8OA 1NGAA 3DMJA 2P9UB 3CCSN 3WT0A 4DUYK 1J53A 5K14A 2VQEK 4XH4A 4DKWA 4E7IA 3O3HA 4CJ4A 3VERA 4BRQA 1ESVA 3CFRA 4ISEA 3CCLN 3TTFA 4I6MA 1YXQA 4WF9L 3O9UA 5TKWA 2D0CA 5HOOA 1NKCA 3RRHA 1Q81O 3VF2A 2G8FA 2VWJA 3V9ZA 3L6QA 2F4VK 4BRHA 5LY3A 3PIOL 3ULEA 1A5WA 4XIUA 3ZYYX 3L2WA 1GOCA 3HJFA 4C8MA 1NMDA 4YOTA 4RTFD 4CFAA 4Z4CA 4CVNE 3CYMA 5AZIA 4O5BA 5CYMA 4HTUA 4DTOA 4AHTA 2O8CB 4FJMA 4CJVA 2W41A 4CIFA 4C8LA 3J7AP 2FF3B 1U49A 2PAVA 5DMRA 5AQQA 5AQZA 3DLHA 4KHPK 3I8DA 3T1YK 3AVFA 1VQ5N 4K8XA 4BVOA 4Z4HA 1GLJO 4DF4A 5GAGP 1QQMA 3H1VX 3JXUA 4NLCA 1DEJA 3J81O 3G25A 4DQPA 4OKEA 3P4IA 1YHQN 2RHKA 1YTUA 3MEGA 5KPTA 4KV8A 4OKJA 3NH2A 2W6KA 3V9SA 3GG4A 4CEAA 2Y1JA 2HVIA 4OPJA 3B6OA 3M8PA 3ZX3A 3RR8A 3DRPA 1HQUA 5KTQA 3WXLA 3HVTA 4OJRA 4JKGA 1S1UA 4CFBA 3F9KA 3DLRA 4JN4A 2V7YA 4Z94A 3LWMA 4ELUA 2P9SB 3CCQN 1BDGA 3ZT2A 3O9RA 1RDBA 2ZGYA 3LL3A 3VMFB 3ATUA 4CZMA 1U45A 3CC4N 4J2AA 1EWRA 4IJNA 2W6LA 1HKBA 3FZHA 3AV9A 1OVQA 1HNWK 4PA1A 3I56N 4BR2A 3J7YP 4Z4GA 2BE2A 3FZLA 3ZSXA 5GAHP 3OS2A 4BDZA 4BRFA 3DAWA 3ZEUB 5CY4A 4B8CA 3LDSA 3MECA 4FJKA 4CF0A 4GMJB 3JAMO 3OYKA 3K9KA 3NGZA 1RBUA 3V1QA 5BR9A 1ZBFA 1HX1A 3KIOA 4DTNA 3SV3A 1O13A 3MXMA 4XH5A 1D9DA 2Q36A 1VK0A 3I33A 4AH9A 5C24A 2HNYA 3PX6A 4OPAA 1GOAA 1QQOA 1LWFA 3VA3A 3AA4A 1XMQK 2KW4A 1MA9B 1VHXA 2BANA 4BRIA 4FWNA 4M42A 2FBYA 1D4XA 3KLHA 3ZSYA 2B6AA 1NGCA 5EVZA 4IJAA 3QO9A 5AQSA 3TAGA 1S6QA 3TSUA 3VQPA 2O8CA 1QTMA 4PL8A 1Q86O 1FKPA 4F2RA 2VG6A 3G10A 3HPOA 1RCHA 3LDLA 3QEWA 3ZSZA 3F5TA 2Q31A 4CFDA 5I42A 4BR5A 3WNGA 3SAHA 2G8UA 3RMDA 1Y64A 1IKYA 3VTIA 4BACA 3L4QA 1VSHA 5D3GA 3LP0A 1HPMA 4QS9A 5F0XA 4BROA 3GE1A 4B9TA 1R59O 4YHHK 4ILJA 1KVCA 3D2FB 3LAKA 4O0IA 1XNQK 1IBMK 5J1EA 4FLUA 1SKRA 2YNFA 5KPRA 4EZ9A 5AQYA 1DLOA 1VQKN 4BY9C 4IDHA 3NMUA 1QSLA 1LCUA 1M90O 2P1JA 3MDQA 2P9SA 2WFBA 1IG8A 2P9KB 4JRQA 3IMXA 3AVJA 1KAXA 3VEWA 2OA8A 3THWB 4GNIA 5AQJA 2NNWA 4FWOA 5KPZA 1GLLO 4FZXC 4CJ5A 1TUUA 3AA2A 5CR4A 3L2UA 3RTVA 3BZKA 3IUCA 4Z4EA 3ZEUA 1LWCA 4JKEA 3TAEA 3S3MA 3C6AA 1NKBA 3AA5X 3M3ZA 4PHTX 2PYJA 4QS8A 3DLEA 1YJNN 1BGXT 1TYQB 5BPLA 3TAMA 3OVNA 1EXQA 3AVGA 3MX5A 4H0VB 3VGLA 3NAEA 1S22A 2D4WA 3DJCA 4CGIA 1RT3A 1YI2N 1TVRA 4FYDA 5AQWA 1NOYA 1N32K 4IZ9A 4BR7A 1NJWA 1TK5A 2KQ2A 4E0DA 4FWSA 1W9HA 3L2VA 3LP3A 4IFVA 1O1WA 4Y1CA 1G99A 3EE9A 3ZT4A 5LJVA 3V9WA 3DLBA 4BRGA 4FJ5A 4B1VA 3KLIA 2B5JA 2I7NA 5AR0A 3TABA 4CZEA 1VSLA 3Q7CA 3CXCM 3AVNA 1L3UA 2E1ZA 1VSDA 3CPEA 4R5PA 4B3TK 5E41A 3KK1A 3VOVA 4E7LA 1BO5O 2A6AA 4YY3K 5M1QA 3SUQA 3OS1A 1JLQA 4H0PA 4CF8A 4OX9K 3SBTA 4CBUA 2O4GA 4BRCA 1IKVA 3CFOA 3TAPA 4EZ6A 4YORA 2PFUA 2P9NB 3MCAB 3SPZA 1A5VA 1NK7A 3R1XA 1TK8A 4KH4A 3AO5A 1TUYA 4M45A 1NNEA 3I0RA 3M8SA 2NRVA 4DV6K 3PV8A 4DTRA 1NK5A 3UE5A 2HHTA 1ITGA 4CGFA 3KLFA 4OPHA 2ETJA 3CG7A 4YOUA 4N47A 1KLMA 4M3XA 1YUWA 3RMAA 1NK9A 3TANA 1KCFA 1NGDA 1RDCA 3QETA 4IFYA 4RW7A 4LC9B 5CYQA 3O3FA 3ID6A 4M3UA 3PX4A 4CF9A 3T19A 1RGIA 3THWA 2IAJA 3KVGA 4X65K 1RILA 2ZQBA 4WE1A 1Y97A 3NVKA 4FLYA 4IEEA 2QWNA 3AO4A 1BUPA 1S1WA 2G8VA 4B3MK 3PSFA 5KI6A 2P9PB 3S3OA 4FJ8A 5J2QA 1TYQA 3HSTB 2E1YA 3CJBA 3QMLA 3O4QA 2QM1A 4F3OA 3ENHA 1OH5A 1MWMA 4FZZA 5GAEP 2VCPA 2A5XA 1ASVA 1U6ZA 1T44A 1V4TA 2VYPA 5FRMA 4I2QA 4LF7K 3PO4A 1XQSC 4FLWA 4FOIA 1IBKK 3SQ2A 1D5AA 1VRUA 3Q7BA 4FO0A 1X9SA 3K2PA 3HP9A 1SUQA 3O8MA 3P1GA 1CXUA 3O4NA 4BGAA 4B9NA 4B08A 3H46O 4GKJK 1JCEA 3VN5A 4DCHA 4DFPA 1ATRA 1N36K 3QIPA 4JD2A 3OS0A 3HYFA 3PLAA 2O8FB 4B1UB 4A59A 4NLBA 1S9EA 3EZ5A 2GX9A 4PY5A 3V9XA 4DWIA 1K6YA 2OANA 3D45A 3VTHA 1WB9A 2P9NA 1YTAA 1OVYA 3D7EO 4NCBA 1BIUA 4FWKA 3VQ4A 3VF6A 4FPBA 2IDOA 4R79A 1OKJA 2G8WA 3T3FA 5KGXA 2G8HA 3BEXA 4BC4A 4JEPA 4JI8K 3VESA 3KTQA 5BN8A 2W42A 4CJRA 4FWRA 2QWMA 2WBNA 5H1SQ 4E7KA 5FPEA 5AQOA 4V19S 3CQYA 3TAQA 1GLAG 1U4BA 4FJNA 1JLAA 4XH1A 1UOCA 3T1HK 4CJEA 2HHUA 3WQTA 1XNRK 2Q2RA 4FJXA 1Q18A 3BF3A 3K0SA 5CZ1A 2KLAA 2XY5A 4DV0K 2DFHA 4BE2A 3TU5A 5C0YA 4J2DA 1W2BM 1U04A 4RW9A 3VEZA 4B9UA 4B1XB 1RT2A 4YOWA 1BU6O 5FPMA 4E19A 1NGEA 3HPGA 5FDLA 4E1JA 4KHQA 2IVNA 3L0QA 4K25A 4C8NA 2OTLN 1SL0A 3CJ7A 1WSFA 4I2PA 1RTDA 2P9PA 1NK4A 2D0OA 3SMSA 4CHQA 1ZBIA 3S9HA 2BGGA 4A2AA 1XUPO 1EKEA 4NCAA 4CHZA 1NK6A 1WOQA 4ISGA 3CCEN 4M3TA 5DM7L 3MAQA 3VQAA 5CHIA 2DTUA 3C7NB 4FWPA 4JKFA 4CHYA 2E2NA 3AVLA 4DTJA 5GIPA 1HJRA 5J2PA 3P38A 2F9WA 1KLNA 4PKIA 1P90A 3EY1A 3G4SN 2ZJPL 4GV9A 3S41A 4LF6K 3HK2A 4YDUA 1S9GA 5J2NA 2E20A 2KZZA 3ZSWA 3HL8A 1HJOA 1YIJN 3MXIA 4JK9A 3U9DA 3NH1A 4K43A 5E26A 4CBWA 4CJLA 2WONA 4G1QA 3AO2A 4ID5A 1NU0A 5JICA 3OYIA 3DYAA 1C1CA 3E9OA 3UKRB 4EIAA 4JKGB 1NM1A 4FK0A 2O8EB 1NKEA 4CK1A 1L3TA 2Z1JA 3ZSQA 4KHSA 4WCEL 2E2QA 5SWMA 1NK8A 4Z4FA 3HOSA 4CJSA 3D0PA 4GW6A 2NUBA 3LALA 4B1WB 3VEOA 1RT1A 1NGJA 1XWLA 4X66K 4O8KA 3WNHA 3UB5A 5JMVA 1IG9A 1NG9A 4E7HA 2HF3A 4JS4A 3OJSA 3O1BA 1L3SA 4KRFA 2O8BB 3THYA 4LSNA 1TAUA 3TR8A 4BRDA 1T8EA 4F9OA 3J80O 3RMCA 3KJVA 2WC9A 2DPNA 5HL7L 2GV9A 1HYVA 1ASUA 2AP1A 1B9DA 3OYDA 2HOEA 3G6EN 4PKGA 2NRRA 3CCUN 2G8KA 5FPNA 1T3VA 3ZSOA 4H5VA 4BGBA 1JLFA 2YNGA 4KTQA 2HHXA 4GV3A 4IG0A 4YFUA 3EE8A 1KAYA 1XMOK 4BRKA 4ILGB 4IEIA 5GINA 3D2EB 3C7NA 2AJQA 4L3QA 1BI4B 1YVNA 1IKWA 2A1SA 4FWMA 1QHTA 4KHWA 4O0JA 4CGGA 2HSTA 5IT9O 4CIGA 3LM9A 4A2BA 1S5JA 1KXPA 4YOXA 4AHSA 3U3YA 2NRZA 3NF9A 4H5TA 4M7YA 2HMIA 4DR1K 1K8AO 3OW2M 4B9MA 2QWOA 4FLXA 3AVIA 3ALYA 1HMVA 1LWEA 4F2SA 4KB1A 2HBJA 2NRWA 4RW6A 1NWKA 2V7ZA 2ATQA 3W3DA 3LPUA 1NGBA 3ID8A 2GUIA 4FLTA 4ELTA 4BRNA 3R8EA 2PYLA 4DV4K 2CGLA 4DSEA 3QNOA 1VQ8N 4CF2A 1X9MA 2D0AA 3U4LA 4BWMA 2UUCK 5AZJB 3UKRA 3HXMA 4Z0UA 4FK4A 3DI6A 4N41A 2O8EA 4NCGA 5FLXO 2F9TA 2ZJRL 4M3ZA 4DQIA 4BE1A 3ZT0A 4BQZA 2E6LA 4CEZA 4M3YA 2V52B 4NB4A 3FZMA 3F2KA 5KRSA 3ZSRA 1RTIA 5JLHA 4JKAA 1BWFO 3ENBA 4WQ5C 4B1YB 4M3RA 2QXLA 1QHAA 3FE1A 4AHCA 1YAGA 3VGKA 3JYTA 2J4RA 4HUFA 3IDHA 1EETA 2JLEA 4YDUC 3HPHA 2DY4A 3GL1A 4X62K 5MLCQ 4H4OA 1GLDG 2YJFA 4PL7A 2O8BA 3J7ZO 2Z1HA 3BDPA 3LPTA 2EWSA 4RG8A 2ZE2A 3WNEA 1K9MO 2NRXA 2NZTA 3OYEA 4W5OA 3KK2A 1ZYQA 3EEQA 2A42A 3LDQA 3ASMA 3WXKA 3QIOA 3VEYA 1W0HA 3IFRA 1C0TA 5TKYA 4AILC 1YJWN 4CHOA 4JK8A 3C95A 1EX4A 4LF9K 4KFBA 3RR7A 4XEIA 4Z4IA 2HHWA 1RBRA 1N34K 4BE0A 3D2EA 4DR4K 3VQ5A 2UXDK 1BI4A 3JSMA 3LDNA 3FFKB 4DB3A 1UA1A 2FSJA 4QS7A 3CMAN 1ASWA 3DRRA 4BRMA 3L8BA 3T7ZA 1TKXA 2GWKA 3SI6A 1LW0A 4CZLA 5EOYA 3RRGA 3A2FA 4ID1A 4O44A 4JI6K 2O4IA 5KQDA 4KHUA 3M6GA 1RDWX 1KVBA 4CZJA 1S1XA 1QE1A 3L4IA 2KFNA 3I8BA 1SV5A 1WLJA 2D1KA 5M1PA 3T1AA 4CEFA 4GY2B 3O6WA 2Q3SA 2P5OA 4W5QA 3EL2A 1MWKA 5AJ3K 4JI3K 2DFEA 1RTJA 4CEEA 1K8KB 4JNEA 5AZJA 4JRPA 2YHBA 4KAZA 2NLXA 1NJYA 4LF4K 4IKFA 1S1VA 4H0OA 4FCYA 3KD5E 3VPZA 1SL2A 2NRHA 4OGCA 4U7BA 3SQ4A 3ZETB 4YOYA 4OGEA 1Q7YO 3SLCA 2UYTA 3AVKA 2E2PA 5BRFA 4FLZA 4DMNA 1U47A 3HVRA 1EO1A 4EP4A 1VSKA 1QZ5A 2IVOA 3MWPA 1TL3A 3SZ2A 2IGIA 1KD1O 1IH7A 5J2MA 1G15A 1LOTB 1XC3A 4MLHA 2V51B 4FW2A 5LJWA 3UKUB 4H03B 2QK9A 4KO0A 3K5NA 2IIRA 4GKKK 3WNFA 4EFHA 3CERA 3A5MC 5B8HA 5EX5A 5JVGL 1K73O 1GLEG 1BA1A 5BRHA 3AVBA 3THXB 1HR0K 1E4GT 5LMUK 3ZX0A 3FGUA 1OH7A 5M1KA 4DU1A 4RWTA 1XC9A 1IJJA 4JI1K 3ZLJA 4JAXA 3CFPA 4M3WA 1CLQA 1ZXOA 1BIZA 4EAHD 1RT5A 4H0YB 5HRPA 4IO8A 2W40A 3TPQA 3OYNA 5DM6L 3VQ9A 3QEVA 4DLEA 4JD2B 1VQLN 1WBDA 4JHDA 4CIEA 2WOMA 3CI5A 1QQCA 1UWBA 4FJGA 4MO4A 1HQEA 2HF4A 3GOIA 5LL6Z 4IG3A 1KTQA 4JI5K 3U9ZA 4FXDA 2OYQA 4LF5K 1JCFA 2YHWA 2UU9K 3PSIA 3P5JA 3SV4A 3V9UA 2LSNA 3MN5A 3SAGA 4KPYA 2FF6A 2CGKA 5KRTA 4CJ7A 2G8IA 2Q0RA 4DR6K 3AO1A 1KQSM 5M1NA 3LM2A 2F8SA 2VWKA 4OVLA 2GUPA 2H3GX 4JI0K 4BG9A 1JKHA 2HHSA 1K8KA 5BRDA 2P51A 1KVAA 2HBLA 1YF5L 3HI0A 1QSSA 4F8RA 1HNXK 1NGIA 3KZBA 3CC2N 1C0FA 1Z26A 3ZETA 1T6CA 3FZFA 3CF5L 1C1BA 2YNIA 1T7PA 2CH6A 1VQ7N 3HT3A 4I9LA 4MDBA 3V4IA 1GLCG 3M5RA 3L3UA 2CGJA 3VEXA 3PUFA 2XY7A 3CETA 5AQUA 4MFBA 1DKGD 2QTDA 3UKUA 4O4GA 2GBZA 3H3OB 2ASMA 2P5GA 1C1AA 5M1FA 3VQQA 4JI4K 3QESA 1KAZA 1DT9A 2HVHA 1LW2A 3L2RA 3OYCA 3F9MA 3SBGA 5HP1A 3BUZB 3THXA 3V1OA 3PIPL 4BC3A 1BCMA 3AVMA 3CM6A 2P9IA 5C42A 2ASOA 4FL9A 4E1MA 3KLEA 1KSPA 2KTQA 1B92A 2AA4A 1HNVA 2OPQA 5C2DA 4LFCK 3HRGA 3O1WA 3SCXA 1IKXA 2XHBA 1ZBSA 4C1NI 1B9FA 1ZBHA 3F73A 4JLHA 1SQKA 3H6EA 3E1YA 4I7FA 3B8AX 3MEEA 2HHHK 3HM8A 2KZMA 1VQON 4K8ZA 2JWLA 3DLKA 4CJUA 3E9PA 3AAQA 3FZKA 4I9QA 4JK7A 1NJXA 4A5AA 1JLBA 4BDPA 3K5LA 3P31A 4A62A 4KHNA 2ITMA 1N33K 4UQGA 3U6FA 4BDYA 3H08A 3RSEB 3KK3A 1N8RO 4JI7K 2HBMA 4DQ8A 2EHGA 4CEBA 2OPSA 1RNHA 4CCHA 4E3SA 2HW3A 3WXIA 5JS2A 4L8RB 4NXNK 4KKOA 3LANA 3ZSVA 3EYZA 2YX6A 2YHAA 1RT7A 3O4WA 4DTUA 1NOZA 4JKBA 4J2BA 4DTPA 2D5RA 4YOVA 4N76A 5AQVA 2E88A 4GVEA 4FJLA 3SMPA 3CJ9A 1VSFA 5AQIA 4Y1DA 1NGGA 3THYB 2ASPA 2FC0A 4B1ZA 3FFIA 4O8UA 2QI2A 4FJJA 3M8QA 1WAJA 1ZC6A 4HUEA 4RW4A 3KKRA 2X74A 2GEMA 3ENOA 1VSJA 3CCMN 4CZIA 4FM0A 3E66A 5I3UA 4DSKA 5JLFA 2E5LK 4OPKA 3EN9A 2O8DB 2Q0UA 2YJEA 3C6TA 1VQ6N 4FJ9A 3CJCA 3AGRA 4JYAK 5ADXA 4B8AB 4CGHA 2HBKA 1D8YA 3KKSA 1HUXA 4WQ5A 2I5JA 5FROA 4JV5K 1J5EK 1MDUB 3E9LA 1C0MA 4CFCA 1GOBA 4DQSA 3SQ0A 5AQLA 1VQPN 5C10A 1Q9YA 4BR0A 4H4MA 2ITGA 2VG5A 3R9PA 1MU2A 1CXQA 3SUOA 3RWUA 3BP8A 3GBTA 4FVMA 2QA4N 4X64K 3QFUA 5F1XA 4RW8A 1BQNA 4HCCA 2Q1NA 4U67L 2QWQA 4C1NK 1WNSA 5CE3A 4IDKA 4K41A 3RSEA 1C6VA 1WSGA 1A5XA 2PY5A 2OPPA 3MN6A 4BRAA 4DR5K 1FW6A 4C8KA 3CQ8A 1JLCA 5AQMA 3BY5A 5C2FA 3QNNA 3K5MA 4J2EA 2BUPA 1TGOA 3KHYA 3SAFA 1P8ZA 1WUAA 3WXMB 2B4JA 3SUPA 4F3TA 3O9SA 2IC3A 1X9WA 1OH6A 3LZIA 2ZF5O 3CCVN 2WTUA 4OKKA 3ZT3A 4IXCA 3LWLA 2BTFA 5GIOA 4HVJA 1RBTA 2UXBK 3OYGA 3M8RA 1UAXA 1T6DA 3AO3A 3WXJA 4TSXA 4FM1A 4LY7A 4E7JA 4CERA 2YV0X 4BR4A 4LD0A 4IOCL 3H45C 1S1TA 3NGIA 4CEQA 1Z05A 1CZAN 4IOXA 4AHVA 1NMNA 4DSIA 4BVPA 2Y1IA 1JLEA 4ICLA 2VGMA 4CESA 3OYBA 3CHWA 4CD1A 2R7YA 3I0SA 4O55A 4MO5A 4CJ3A 1X1PA 1TKTA 1Q8IA 2A1RA 3NBPA 3W0LA 4PWDA 2O8DA 4BC2A 4DR7K 5BPMA 1ILYA 4ZTJA 1XHXA 5AQNA 4H5NA 4DF8A 5C12A 1WSHA 4KTZA 3DXMB 1I3AA 2YI1A 3NVMA 3VETA 1J9AA 1I94K 3UIQA 4GV6A 3OYFA 4QCLA 5BN9A 2VQFK 3SJHA 3LDOA 5E84A 1Z6RA 2A41A 4DV5K 3DXKB 3MN9A 4H0TB 3U3GA 2KFZA 5A2QO 2YHXA 2VG7A 1S72N 4OLAA 2X78A 5HLFA 3SYZA 4B3SK 3NE6A 3R6MA 1TKDA 4H8KA 2RKIA 4FK2A 4WFBL 4W5NA 1VAZA 1WSIA 2XY6A 3VGMA 2YCHA 2ZWHA 5BR8K 3C0BA 2OZMA 2I7PA 4E1NA 4CK2A 2Q97A 2GWJA 1X3MA 1FK9A 1W97L 3KD1E 3IS9A 3FR0A 3O9QA 5AFUA 3AA3A 1JL2A 1BISA 1VSMA 1X3NA 3K9JA 4MDAA 4AHRA 3TSPA 3SK3A 1KFSA 5M1OA 1W7AA 1FKOA 4FJIA 3P83D 3TAFA 4DQQA 3LDPA 4WFAL 1GLBG 2P9UA 1T03A 1S6PA 3ZX2A 4Q5VA 4QOZB 3O9TA 4CD3A 4KI4A 5AQHA 3VEVA 1U48A 3T69A 3OYLA 3KWIA 2ZM6K 3I55N 4DS4A 1Z25A 4CZFA 5AQKA 2D0BA 4BC5A 5AFUH 1J5OA 4BQLA 4FLVA 4WYBA 1VSIA 1UA0A 1IV0A 2OTJN 1OH8A 3AGKA 4B3RK 1RDDA 4CJWA 1FJGK 5HRNA 3OYHA 3NH0A 4EP5A 4FJHA 5F2RA 4G9ZA 4JHDB 1WN7A 1YJ9N 4J8FA 2QWLA 3HZ6A 3O08A 2RPIA 2D0PA 4CF1A 1C0UA 1JJ2M 4CGDA 4FW1A 1J54A 3DXMA 3CPWM 1TL1A 3H1QA 4C23A 3VQBA 3QBWA 4NO7A 2QWPA 1DGKN 3ISNC 4BG8A 1QVGM 2E8AA 1VSEA 3OYAA 4CJTA 2OZSA 3DXKA 2VGNA 3TARA 4NXMK 3VQEA 2FBTA 3CCJN 3K5OA 4KREA 2YNHA 1L5UA 4DR2K 4LSLA 1TAQA 3A5OC 2X6NA 4M7XA 2FSNA 3J8AA 3DOLA 4KB0A 3THVA 2X6SA 3AVAA 1BQMA 5AQTA 3CIPA 3LP1A 2JWKA 4JKCA 5EY4A 3TWHA 1RDUA 4ISFA 3A5LC 2OPRA 1NBWA 5HROA 3CD6N 1JLGA 2UUAK 4DV3K 3QFPA 3VF4A 4DSFA 3N4QA 4CHPA 3CMEN 1VQNN 4LFBK 3TTDA 4CK3A 4EHUA 1HPZA 3C94A 4OO1J 3SJJA 1Q9XA 1E3MA 5AQGA 2KKZA 5KQ8A 1KFDA 1DTTA 3QBXA 1EWQA 4BREA 4B9SA 1XHZA 4HHTA 1NJIO 3C65A 4FOEA 3HBTA 4CE9A 4FWLA 4W5RA 3MN7A 1QQNA 1ZBUA 2CH5A 3SUNA 2JGUA 4LF8K 4DU3A 3QINA 3VQDA 1LV5A 4QAGA 4FVUA 3OJUA 3KWGA 3QEIA 3O3GA 2FXUA 1NK0A 4DUZK 4DFKA 5IWAK 2FBVA 1H1VA 2QEXN 3LZJA 4IO9L 3OY9A 2P9IB 3ULDA 1NLVA 2Z1IA 2HNZA 3MEDA 2ZJQL 1ATSA 2E2OA 3DOKA 4JI2K 4DTMA 3VQ7A 3QICA 1YITN 3OYJA 1DTQA 4PQUA 3U8XA 5HRRA 4CECA 4DV2K 3NGYA 4YNQA 3SNNA 2QWRA 3QB0A 3C6UA 4JKDA 4CHNA 3LP2A 3VQ8A 4WFNL 3SQ1A 4CBXA 3CC7N 5GADP 1U2VB 4KH5A 3KLGA 3NDKA 4B9VA 4HCBA 4DFJA 3K59A 5I9EB 4LFAK 4NYFA 2F96A 1WAFA 3OA9A 5T7BA 4DSJA 5AQPA 4KTWA 1EP4A 1RFQA 3DRSA 4FJ7A 2RE2A 3V81A 1L3VA 4Q0BA 3VQCA 4DV7K 3SPYA 3A0IX 3VA0A 4JKHA 3NF7A 3K58A 4N56A 4WQ4A 2WUSA 1RBVA 1SZ2A 3WEEB 3D2FA 3A5NC 4CZKA 4DQRA 1CZ9A 1JXEA 4DSLA 1HRHA 3TTCA 3EZWA 1IBLK 3AVHA 2E6MA 1SS6A 1HNZK 4FWQA 5EU7A 4N5SA 3AY9A 4JS5A 1S3XA 1N6QA 2GTDA 1NGFA 2RF2A 3QDKA 2P9LB 4FM2A 3IAYA 2P9KA 3EKSA 3ITHA 1NJZA 4CJFA 3DWLA 2QW9A 4DU4A 3ZT1A 5AQXA 1EQYA 3H3NO 3NF8A 4ILHA 2PZSA 1QVFM 1V4SA 1GLFO 3TSQA 3QEPA 4PUOA 4AM7A 4MLEA 5FPDA
chains in the Genus database with same CATH topology
5FROA 2PYLA 4ZHRA 3AVJA 4DSEA 3QNOA 3PY8A 4CF2A 2OA8A 3L2QA 1C0MA 4CFCA 1GOBA 4DQSA 1X9MA 3SQ0A 2D0AA 4F4KA 4BWJA 4BWMA 1Q9YA 4FK4A 4CEOA 3HXMA 4Z0UA 4FZXC 3DI6A 4DFMA 4H4MA 4CJ5A 1D9FA 4N41A 3AA2A 2ITGA 3L2UA 4ZTFA 3RTVA 3PO5A 4Z4EA 2VG5A 4NCGA 4B3OA 1HYZA 4M3ZA 4DQIA 1LWCA 4BE1A 3TAEA 3S3MA 3ZT0A 3NCIA 1MU2A 3AA5X 1NKBA 1CXQA 3SUOA 2PYJA 3RWUA 3DLEA 2E6LA 2HHVA 4CEZA 1SKSA 4M3YA 1BGXT 4FVMA 3TAMA 4KHYA 3OVNA 4RW8A 1EXQA 5KRSA 3AVGA 1BQNA 3NAEA 3ZSRA 4HCCA 2QKBA 1TK0A 1FXXA 1WNSA 1RT3A 4CGIA 1RTIA 4IDKA 4ELVA 1TVRA 4FYDA 1C6VA 1WSGA 4M3RA 1NOYA 1XI1A 1NJWA 4AHCA 1TK5A 2KQ2A 1A5XA 4E0DA 5FRNA 3JYTA 1W9HA 1YT3A 4HUFA 4CEDA 3L2VA 3LP3A 4IFVA 1QS4A 2PY5A 1EETA 1O1WA 2JLEA 4Y1CA 2OPPA 3HPHA 3ZT4A 3V9WA 1SKWA 2QKKA 5KGWA 1HYSA 2DY4A 1TKZA 3DLBA 4H4OA 1I39A 4C8KA 3CQ8A 1JLCA 4FJ5A 3KLIA 2B5JA 5JS1A 2Z1HA 3DLGA 3QNNA 3RMBA 3BDPA 3K5MA 3LPTA 4RG8A 4J2EA 3TABA 2ZE2A 4CJQA 1TGOA 1VSLA 3WNEA 3AVNA 3OYEA 1L3UA 2B4JA 4W5OA 3KK2A 4LH5A 1VSDA 4R5PA 1WSJA 3SUPA 1ZYQA 2IC3A 5E41A 3KK1A 1X9WA 1T05A 4F3TA 3LZIA 4GVMA 4E7LA 4OKKA 3ZT3A 3ASMA 3QIOA 1JXBA 1W0HA 4LH4A 3LWLA 1C0TA 3S3NA 4AILC 3LAMA 4CHOA 3SUQA 3G0ZA 3C95A 1EX4A 1RBTA 4HVJA 3OS1A 3OYGA 3M8RA 1UAXA 3AO3A 1JL1A 4TSXA 1JLQA 3OYMA 4FM1A 4LY7A 4CF8A 4CERA 4E7JA 3QEXA 3PX0A 2YV0X 4KFBA 4LD0A 2O4GA 4CJKA 4EZ6A 1IKVA 3CFOA 3TAPA 3RR7A 2EX3A 3NF6A 1S1TA 3NGIA 4CEQA 4Z4IA 3HO1A 2HHWA 1RBRA 4AHVA 4DSIA 4BE0A 3VQ5A 3SPZA 2Y1IA 1A5VA 4DS5A 1BI4A 1JLEA 3NHGA 1NK7A 4ICLA 3JSMA 1UA1A 1TV6A 4CESA 3OYBA 2FBXA 2YKMA 2BDPA 1ASWA 4B9LA 1TK8A 2E4LA 3DRRA 3L8BA 2R7YA 3AO5A 3I0SA 4DG1A 5C25A 1TKXA 3SI6A 4M45A 1LW0A 4O55A 3I0RA 4CJ3A 3M8SA 4E89A 3RRGA 1X1PA 1TKTA 1Q8IA 1RT4A 3A2FA 4ID1A 4O44A 4M41A 3HP6A 3PV8A 2A1RA 3NBPA 4DTXA 4PWDA 4DTRA 1NK5A 2O4IA 2HHTA 3L3VA 1ITGA 3BGRA 3DM2A 4ZTJA 1XHXA 3NFAA 4CGFA 3KLFA 1REVA 1ZBLA 2ETJA 3CG7A 4N47A 4KHUA 1KLMA 5SZTA 1KVBA 1BCOA 3AVCA 4KI6A 4M3XA 4DTSA 4DF8A 3RMAA 1S1XA 1QE1A 3QERA 3TANA 1NK9A 1KCFA 1WSHA 1RDCA 4W5TA 3QETA 4IFYA 4RW7A 2KFNA 1SV5A 1WLJA 5CYQA 4KTZA 3T1AA 4CEFA 3O3FA 2Q3SA 2P5OA 4W5QA 3TI0A 1I3AA 4DLGA 4FZYA 4M3UA 3PX4A 3CM5A 2IOCA 2DFEA 5DK5A 1J9AA 4CF9A 3UIQA 1RTJA 3MXJA 3OYFA 3T19A 4CEEA 4QCLA 1SL1A 4CJPA 4IBNA 2IAJA 1RILA 4JRPA 2YHBA 4KAZA 2ZQBA 1RTHA 1NJYA 4WE1A 4IKFA 2HNDA 1BL3A 1S1VA 3V1RA 4FCYA 1N5YA 3KD5E 3U3GA 1SL2A 2QXFA 1Y97A 2KFZA 1VRTA 4FLYA 2VG7A 3AO4A 4OLAA 1S1WA 4AHUA 2G8VA 2X78A 4FJ8A 5KI6A 5HLFA 4OGCA 3HM9A 3S3OA 3SYZA 1WSEA 5J2QA 3SQ4A 3HSTB 4OGEA 1LAVA 3NE6A 3AVKA 1BHLA 1TKDA 3O4QA 4H8KA 4F3OA 2RKIA 4FLZA 4DMNA 4FK2A 4FZZA 1U47A 5HRSA 1KRPA 3HVRA 4W5NA 4EP4A 2XO7A 1WSIA 1VSKA 1ASVA 4NYNA 2ZD1A 2XY6A 2YKNA 5FRMA 1TL3A 3SZ2A 4I2QA 2IGIA 3K57A 3PO4A 2OZMA 4E1NA 1IH7A 4MQ3A 4CK2A 1LAWA 4FLWA 1CZBA 5J2MA 1G15A 1RT6A 4FW2A 3V6DA 3SQ2A 1D5AA 1VRUA 1IO2A 4CGJA 1FK9A 3ZCMA 2F8TA 1X9SA 2QK9A 3K2PA 4KO0A 3K5NA 3KD1E 3IS9A 3HP9A 1SUQA 2HHQA 3AA3A 3WNFA 3IG1A 1JL2A 1BISA 1VSMA 4AHRA 3P1GA 1YVUA 1CXUA 3O4NA 5HBMA 2XY8A 4B9NA 4B08A 1R0AA 1KFSA 3VQ6A 3AVBA 3VN5A 4DFPA 1F21A 5CZ2A 4HUGA 1QSYA 3QIPA 1FKOA 3B6PA 4FJIA 2DFFA 3OS0A 1HNIA 3HYFA 4DU1A 3P83D 3TAFA 4DQQA 1XC9A 3CFPA 4M3WA 1S9EA 3EZ5A 4PY5A 1CLQA 2Z1GA 3V9XA 4DWIA 1K6YA 1T03A 1S6PA 1RDAA 1BIZA 4Q5VA 4QOZB 4KI4A 1RT5A 3D45A 5HRPA 1U48A 3OYLA 4NCBA 1YTAA 3OYNA 2XRIA 1BIUA 1RBSA 3E01A 3VQ4A 3VQ9A 4DLEA 4DS4A 3QEVA 4OLBA 2HB5A 2IDOA 1Z25A 3QLHA 4CIEA 2RN2A 2D0BA 1J5OA 2WOMA 2G8WA 3IRXA 3T3FA 4FLVA 5KGXA 1UA0A 1VSIA 2G8HA 2IS3A 4C8OA 1QQCA 3DMJA 1J53A 1UWBA 5K14A 1RDDA 4FJGA 1HQEA 4CJWA 2W42A 3KTQA 5HRNA 4CJRA 3OYHA 4E7IA 3NH0A 4IG3A 1KTQA 4EP5A 4CJ4A 3O3HA 4E7KA 4FJHA 3CFRA 3TAQA 2OYQA 4FXDA 1WN7A 1U4BA 4FJNA 1JLAA 2RPIA 1UOCA 4CF1A 4CJEA 2HHUA 2D0CA 1C0UA 3P5JA 3SV4A 4CGDA 2LSNA 3V9UA 3RRHA 4FW1A 1NKCA 2G8FA 4KPYA 2VWJA 4FJXA 1J54A 3V9ZA 1TL1A 5CZ1A 2XY5A 3VQBA 5KRTA 2DFHA 4BE2A 2G8IA 3AO1A 4J2DA 3ISNC 1A5WA 1U04A 4RW9A 4XIUA 4B9UA 1RT2A 2F8SA 2VWKA 4OVLA 4E19A 1JKHA 3L2WA 2HHSA 1GOCA 3HJFA 1VSEA 4C8MA 3HPGA 3OYAA 5FDLA 2P51A 1KVAA 4CJTA 2OZSA 4KHQA 4CFAA 3TARA 4Z4CA 4C8NA 3VQEA 2FBTA 1QSSA 3K5OA 3CYMA 4F8RA 4KREA 2YNHA 1SL0A 4O5BA 5CYMA 1L5UA 1WSFA 4I2PA 4HTUA 4DTOA 1RTDA 1Z26A 1TAQA 4LSLA 4AHTA 1NK4A 4FJMA 2X6NA 4CJVA 4CHQA 4CIFA 4C8LA 1ZBIA 3S9HA 1U49A 3DOLA 1C1BA 3THVA 4KB0A 2BGGA 2X6SA 2YNIA 3AVAA 5DMRA 1T7PA 1BQMA 3DLHA 1EKEA 3I8DA 4NCAA 3AVFA 3LP1A 4CHZA 3HT3A 1NK6A 4I9LA 3V4IA 4K8XA 3TWHA 3L3UA 4M3TA 4Z4HA 3MAQA 4DF4A 3PUFA 3VQAA 2OPRA 2XY7A 5HROA 2DTUA 1JLGA 4DQPA 4OKEA 4MFBA 4CHYA 4DTJA 3AVLA 1YTUA 4DSFA 3MEGA 4CHPA 1HJRA 4KV8A 4OKJA 5J2PA 4O4GA 2GBZA 4CK3A 3NH2A 1HPZA 3C94A 3V9SA 1KLNA 4CEAA 2P5GA 3SJJA 1C1AA 1Q9XA 2Y1JA 3VQQA 2HVIA 4OPJA 3QESA 3EY1A 2HVHA 1LW2A 3B6OA 3L2RA 1KFDA 1DTTA 3M8PA 3RR8A 4B9SA 3DRPA 4HHTA 1XHZA 3OYCA 1HQUA 5HP1A 5KTQA 4CE9A 3HVTA 3V1OA 3HK2A 1S9GA 1BCMA 5J2NA 4OJRA 3AVMA 4W5RA 1ZBUA 2KZZA 1S1UA 3CM6A 3F9KA 3DLRA 3ZSWA 4CFBA 3HL8A 4E1MA 5C42A 3KLEA 3SUNA 1KSPA 2JGUA 2KTQA 3LWMA 4DU3A 3QINA 3VQDA 3MXIA 1LV5A 4QAGA 1B92A 4ELUA 3NH1A 4CJLA 1HNVA 3OJUA 2WONA 3QEIA 2OPQA 4G1QA 3AO2A 3ZT2A 3O3GA 1NK0A 1RDBA 4DFKA 4J2AA 4ID5A 2FBVA 1IKXA 3SCXA 1U45A 2XHBA 3LZJA 3OYIA 3AV9A 3DYAA 1C1CA 1B9FA 1ZBHA 3F73A 4JLHA 3OY9A 4PA1A 4I7FA 4FK0A 3MEEA 4Z4GA 2BE2A 3ZSXA 3ULDA 3OS2A 2KZMA 1NKEA 4BDZA 2Z1IA 5CY4A 4K8ZA 4B8CA 2HNZA 3MEDA 3MECA 4CK1A 3LDSA 1L3TA 2Z1JA 3DLKA 3ZSQA 4CJUA 4FJKA 4KHSA 4CF0A 4GMJB 3OYKA 5SWMA 3DOKA 1NK8A 4I9QA 4Z4FA 4CJSA 3NGZA 1RBUA 3V1QA 3D0PA 3VQ7A 1ZBFA 1JLBA 4DTMA 1NJXA 4BDPA 3KIOA 4GW6A 4DTNA 3SV3A 2NUBA 3K5LA 3LALA 3MXMA 3OYJA 1DTQA 4KHNA 4PQUA 5HRRA 1RT1A 4UQGA 1D9DA 3U6FA 1VK0A 4BDYA 4CECA 1XWLA 3H08A 5C24A 2HNYA 3NGYA 4AH9A 4YNQA 3KK3A 3PX6A 3SNNA 3C6UA 4CHNA 3WNHA 3LP2A 1GOAA 1IG9A 2EHGA 1LWFA 4CEBA 3VQ8A 2OPSA 1RNHA 3VA3A 3AA4A 4E7HA 3SQ1A 4CCHA 4E3SA 2HW3A 4JS4A 5JS2A 4L8RB 3OJSA 2KW4A 3KLGA 3NDKA 1L3SA 4B9VA 4KRFA 4KKOA 4LSNA 3LANA 1TAUA 3ZSVA 3EYZA 3TR8A 1T8EA 4HCBA 2BANA 2YHAA 1RT7A 4DTUA 4M42A 2FBYA 3KLHA 1NOZA 4DFJA 3K59A 4DTPA 3ZSYA 3RMCA 4J2BA 2B6AA 2D5RA 3KJVA 4N76A 4NYFA 4FJLA 2GV9A 2F96A 1WAFA 1HYVA 1ASUA 5T7BA 1B9DA 3QO9A 4DSJA 3OYDA 1VSFA 3TAGA 1S6QA 4KTWA 4Y1DA 1EP4A 3VQPA 1QTMA 2G8KA 2FC0A 1FKPA 4F2RA 3DRSA 3ZSOA 2VG6A 3G10A 3HPOA 1RCHA 4FJ7A 3FFIA 3QEWA 1JLFA 2YNGA 3ZSZA 3V81A 1L3VA 4KTQA 4Q0BA 2HHXA 4CFDA 4FJJA 4IG0A 3M8QA 3VQCA 4YFUA 5I42A 1WAJA 4HUEA 3SPYA 3VA0A 4RW4A 3NF7A 3WNGA 3K58A 4N56A 3KKRA 2G8UA 3RMDA 1RBVA 2AJQA 2X74A 1BI4B 4DQRA 1CZ9A 1IKYA 1IKWA 2A1SA 4BACA 1QHTA 1VSJA 4KHWA 1JXEA 1VSHA 4O0JA 4CGGA 4DSLA 3LP0A 5D3GA 1HRHA 4CIGA 4FM0A 4DSKA 5I3UA 1S5JA 4AHSA 3AVHA 2E6MA 3U3YA 3NF9A 4OPKA 5EU7A 2HMIA 4N5SA 4JS5A 4B9TA 1N6QA 2RF2A 4B9MA 4FLXA 4FM2A 3AVIA 1KVCA 3ALYA 3IAYA 1HMVA 1LWEA 3C6TA 3LAKA 4O0IA 4F2SA 4KB1A 4FJ9A 5J1EA 3ITHA 4RW6A 4FLUA 4CJFA 1NJZA 1SKRA 2ATQA 2YNFA 4B8AB 3LPUA 4CGHA 4DU4A 3ZT1A 2PZSA 3NF8A 4EZ9A 1D8YA 1DLOA 2GUIA 3KKSA 1QSLA 3QEPA 4PUOA 2P1JA 4FLTA 2I5JA 4ELTA 4JRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FRO A;  2PYL A;  4ZHR A;  3AVJ A;  4DSE A;  3QNO A;  3PY8 A;  4CF2 A;  2OA8 A;  3L2Q A;  1C0M A;  4CFC A;  1GOB A;  4DQS A;  1X9M A;  3SQ0 A;  2D0A A;  4F4K A;  4BWJ A;  4BWM A;  1Q9Y A;  4FK4 A;  4CEO A;  3HXM A;  4Z0U A;  4FZX C;  3DI6 A;  4DFM A;  4H4M A;  4CJ5 A;  1D9F A;  4N41 A;  3AA2 A;  2ITG A;  3L2U A;  4ZTF A;  3RTV A;  3PO5 A;  4Z4E A;  2VG5 A;  4NCG A;  4B3O A;  1HYZ A;  4M3Z A;  4DQI A;  1LWC A;  4BE1 A;  3TAE A;  3S3M A;  3ZT0 A;  3NCI A;  1MU2 A;  3AA5 X;  1NKB A;  1CXQ A;  3SUO A;  2PYJ A;  3RWU A;  3DLE A;  2E6L A;  2HHV A;  4CEZ A;  1SKS A;  4M3Y A;  1BGX T;  4FVM A;  3TAM A;  4KHY A;  3OVN A;  4RW8 A;  1EXQ A;  5KRS A;  3AVG A;  1BQN A;  3NAE A;  3ZSR A;  4HCC A;  2QKB A;  1TK0 A;  1FXX A;  1WNS A;  1RT3 A;  4CGI A;  1RTI A;  4IDK A;  4ELV A;  1TVR A;  4FYD A;  1C6V A;  1WSG A;  4M3R A;  1NOY A;  1XI1 A;  1NJW A;  4AHC A;  1TK5 A;  2KQ2 A;  1A5X A;  4E0D A;  5FRN A;  3JYT A;  1W9H A;  1YT3 A;  4HUF A;  4CED A;  3L2V A;  3LP3 A;  4IFV A;  1QS4 A;  2PY5 A;  1EET A;  1O1W A;  2JLE A;  4Y1C A;  2OPP A;  3HPH A;  3ZT4 A;  3V9W A;  1SKW A;  2QKK A;  5KGW A;  1HYS A;  2DY4 A;  1TKZ A;  3DLB A;  4H4O A;  1I39 A;  4C8K A;  3CQ8 A;  1JLC A;  4FJ5 A;  3KLI A;  2B5J A;  5JS1 A;  2Z1H A;  3DLG A;  3QNN A;  3RMB A;  3BDP A;  3K5M A;  3LPT A;  4RG8 A;  4J2E A;  3TAB A;  2ZE2 A;  4CJQ A;  1TGO A;  1VSL A;  3WNE A;  3AVN A;  3OYE A;  1L3U A;  2B4J A;  4W5O A;  3KK2 A;  4LH5 A;  1VSD A;  4R5P A;  1WSJ A;  3SUP A;  1ZYQ A;  2IC3 A;  5E41 A;  3KK1 A;  1X9W A;  1T05 A;  4F3T A;  3LZI A;  4GVM A;  4E7L A;  4OKK A;  3ZT3 A;  3ASM A;  3QIO A;  1JXB A;  1W0H A;  4LH4 A;  3LWL A;  1C0T A;  3S3N A;  4AIL C;  3LAM A;  4CHO A;  3SUQ A;  3G0Z A;  3C95 A;  1EX4 A;  1RBT A;  4HVJ A;  3OS1 A;  3OYG A;  3M8R A;  1UAX A;  3AO3 A;  1JL1 A;  4TSX A;  1JLQ A;  3OYM A;  4FM1 A;  4LY7 A;  4CF8 A;  4CER A;  4E7J A;  3QEX A;  3PX0 A;  2YV0 X;  4KFB A;  4LD0 A;  2O4G A;  4CJK A;  4EZ6 A;  1IKV A;  3CFO A;  3TAP A;  3RR7 A;  2EX3 A;  3NF6 A;  1S1T A;  3NGI A;  4CEQ A;  4Z4I A;  3HO1 A;  2HHW A;  1RBR A;  4AHV A;  4DSI A;  4BE0 A;  3VQ5 A;  3SPZ A;  2Y1I A;  1A5V A;  4DS5 A;  1BI4 A;  1JLE A;  3NHG A;  1NK7 A;  4ICL A;  3JSM A;  1UA1 A;  1TV6 A;  4CES A;  3OYB A;  2FBX A;  2YKM A;  2BDP A;  1ASW A;  4B9L A;  1TK8 A;  2E4L A;  3DRR A;  3L8B A;  2R7Y A;  3AO5 A;  3I0S A;  4DG1 A;  5C25 A;  1TKX A;  3SI6 A;  4M45 A;  1LW0 A;  4O55 A;  3I0R A;  4CJ3 A;  3M8S A;  4E89 A;  3RRG A;  1X1P A;  1TKT A;  1Q8I A;  1RT4 A;  3A2F A;  4ID1 A;  4O44 A;  4M41 A;  3HP6 A;  3PV8 A;  2A1R A;  3NBP A;  4DTX A;  4PWD A;  4DTR A;  1NK5 A;  2O4I A;  2HHT A;  3L3V A;  1ITG A;  3BGR A;  3DM2 A;  4ZTJ A;  1XHX A;  3NFA A;  4CGF A;  3KLF A;  1REV A;  1ZBL A;  2ETJ A;  3CG7 A;  4N47 A;  4KHU A;  1KLM A;  5SZT A;  1KVB A;  1BCO A;  3AVC A;  4KI6 A;  4M3X A;  4DTS A;  4DF8 A;  3RMA A;  1S1X A;  1QE1 A;  3QER A;  3TAN A;  1NK9 A;  1KCF A;  1WSH A;  1RDC A;  4W5T A;  3QET A;  4IFY A;  4RW7 A;  2KFN A;  1SV5 A;  1WLJ A;  5CYQ A;  4KTZ A;  3T1A A;  4CEF A;  3O3F A;  2Q3S A;  2P5O A;  4W5Q A;  3TI0 A;  1I3A A;  4DLG A;  4FZY A;  4M3U A;  3PX4 A;  3CM5 A;  2IOC A;  2DFE A;  5DK5 A;  1J9A A;  4CF9 A;  3UIQ A;  1RTJ A;  3MXJ A;  3OYF A;  3T19 A;  4CEE A;  4QCL A;  1SL1 A;  4CJP A;  4IBN A;  2IAJ A;  1RIL A;  4JRP A;  2YHB A;  4KAZ A;  2ZQB A;  1RTH A;  1NJY A;  4WE1 A;  4IKF A;  2HND A;  1BL3 A;  1S1V A;  3V1R A;  4FCY A;  1N5Y A;  3KD5 E;  3U3G A;  1SL2 A;  2QXF A;  1Y97 A;  2KFZ A;  1VRT A;  4FLY A;  2VG7 A;  3AO4 A;  4OLA A;  1S1W A;  4AHU A;  2G8V A;  2X78 A;  4FJ8 A;  5KI6 A;  5HLF A;  4OGC A;  3HM9 A;  3S3O A;  3SYZ A;  1WSE A;  5J2Q A;  3SQ4 A;  3HST B;  4OGE A;  1LAV A;  3NE6 A;  3AVK A;  1BHL A;  1TKD A;  3O4Q A;  4H8K A;  4F3O A;  2RKI A;  4FLZ A;  4DMN A;  4FK2 A;  4FZZ A;  1U47 A;  5HRS A;  1KRP A;  3HVR A;  4W5N A;  4EP4 A;  2XO7 A;  1WSI A;  1VSK A;  1ASV A;  4NYN A;  2ZD1 A;  2XY6 A;  2YKN A;  5FRM A;  1TL3 A;  3SZ2 A;  4I2Q A;  2IGI A;  3K57 A;  3PO4 A;  2OZM A;  4E1N A;  1IH7 A;  4MQ3 A;  4CK2 A;  1LAW A;  4FLW A;  1CZB A;  5J2M A;  1G15 A;  1RT6 A;  4FW2 A;  3V6D A;  3SQ2 A;  1D5A A;  1VRU A;  1IO2 A;  4CGJ A;  1FK9 A;  3ZCM A;  2F8T A;  1X9S A;  2QK9 A;  3K2P A;  4KO0 A;  3K5N A;  3KD1 E;  3IS9 A;  3HP9 A;  1SUQ A;  2HHQ A;  3AA3 A;  3WNF A;  3IG1 A;  1JL2 A;  1BIS A;  1VSM A;  4AHR A;  3P1G A;  1YVU A;  1CXU A;  3O4N A;  5HBM A;  2XY8 A;  4B9N A;  4B08 A;  1R0A A;  1KFS A;  3VQ6 A;  3AVB A;  3VN5 A;  4DFP A;  1F21 A;  5CZ2 A;  4HUG A;  1QSY A;  3QIP A;  1FKO A;  3B6P A;  4FJI A;  2DFF A;  3OS0 A;  1HNI A;  3HYF A;  4DU1 A;  3P83 D;  3TAF A;  4DQQ A;  1XC9 A;  3CFP A;  4M3W A;  1S9E A;  3EZ5 A;  4PY5 A;  1CLQ A;  2Z1G A;  3V9X A;  4DWI A;  1K6Y A;  1T03 A;  1S6P A;  1RDA A;  1BIZ A;  4Q5V A;  4QOZ B;  4KI4 A;  1RT5 A;  3D45 A;  5HRP A;  1U48 A;  3OYL A;  4NCB A;  1YTA A;  3OYN A;  2XRI A;  1BIU A;  1RBS A;  3E01 A;  3VQ4 A;  3VQ9 A;  4DLE A;  4DS4 A;  3QEV A;  4OLB A;  2HB5 A;  2IDO A;  1Z25 A;  3QLH A;  4CIE A;  2RN2 A;  2D0B A;  1J5O A;  2WOM A;  2G8W A;  3IRX A;  3T3F A;  4FLV A;  5KGX A;  1UA0 A;  1VSI A;  2G8H A;  2IS3 A;  4C8O A;  1QQC A;  3DMJ A;  1J53 A;  1UWB A;  5K14 A;  1RDD A;  4FJG A;  1HQE A;  4CJW A;  2W42 A;  3KTQ A;  5HRN A;  4CJR A;  3OYH A;  4E7I A;  3NH0 A;  4IG3 A;  1KTQ A;  4EP5 A;  4CJ4 A;  3O3H A;  4E7K A;  4FJH A;  3CFR A;  3TAQ A;  2OYQ A;  4FXD A;  1WN7 A;  1U4B A;  4FJN A;  1JLA A;  2RPI A;  1UOC A;  4CF1 A;  4CJE A;  2HHU A;  2D0C A;  1C0U A;  3P5J A;  3SV4 A;  4CGD A;  2LSN A;  3V9U A;  3RRH A;  4FW1 A;  1NKC A;  2G8F A;  4KPY A;  2VWJ A;  4FJX A;  1J54 A;  3V9Z A;  1TL1 A;  5CZ1 A;  2XY5 A;  3VQB A;  5KRT A;  2DFH A;  4BE2 A;  2G8I A;  3AO1 A;  4J2D A;  3ISN C;  1A5W A;  1U04 A;  4RW9 A;  4XIU A;  4B9U A;  1RT2 A;  2F8S A;  2VWK A;  4OVL A;  4E19 A;  1JKH A;  3L2W A;  2HHS A;  1GOC A;  3HJF A;  1VSE A;  4C8M A;  3HPG A;  3OYA A;  5FDL A;  2P51 A;  1KVA A;  4CJT A;  2OZS A;  4KHQ A;  4CFA A;  3TAR A;  4Z4C A;  4C8N A;  3VQE A;  2FBT A;  1QSS A;  3K5O A;  3CYM A;  4F8R A;  4KRE A;  2YNH A;  1SL0 A;  4O5B A;  5CYM A;  1L5U A;  1WSF A;  4I2P A;  4HTU A;  4DTO A;  1RTD A;  1Z26 A;  1TAQ A;  4LSL A;  4AHT A;  1NK4 A;  4FJM A;  2X6N A;  4CJV A;  4CHQ A;  4CIF A;  4C8L A;  1ZBI A;  3S9H A;  1U49 A;  3DOL A;  1C1B A;  3THV A;  4KB0 A;  2BGG A;  2X6S A;  2YNI A;  3AVA A;  5DMR A;  1T7P A;  1BQM A;  3DLH A;  1EKE A;  3I8D A;  4NCA A;  3AVF A;  3LP1 A;  4CHZ A;  3HT3 A;  1NK6 A;  4I9L A;  3V4I A;  4K8X A;  3TWH A;  3L3U A;  4M3T A;  4Z4H A;  3MAQ A;  4DF4 A;  3PUF A;  3VQA A;  2OPR A;  2XY7 A;  5HRO A;  2DTU A;  1JLG A;  4DQP A;  4OKE A;  4MFB A;  4CHY A;  4DTJ A;  3AVL A;  1YTU A;  4DSF A;  3MEG A;  4CHP A;  1HJR A;  4KV8 A;  4OKJ A;  5J2P A;  4O4G A;  2GBZ A;  4CK3 A;  3NH2 A;  1HPZ A;  3C94 A;  3V9S A;  1KLN A;  4CEA A;  2P5G A;  3SJJ A;  1C1A A;  1Q9X A;  2Y1J A;  3VQQ A;  2HVI A;  4OPJ A;  3QES A;  3EY1 A;  2HVH A;  1LW2 A;  3B6O A;  3L2R A;  1KFD A;  1DTT A;  3M8P A;  3RR8 A;  4B9S A;  3DRP A;  4HHT A;  1XHZ A;  3OYC A;  1HQU A;  5HP1 A;  5KTQ A;  4CE9 A;  3HVT A;  3V1O A;  3HK2 A;  1S9G A;  1BCM A;  5J2N A;  4OJR A;  3AVM A;  4W5R A;  1ZBU A;  2KZZ A;  1S1U A;  3CM6 A;  3F9K A;  3DLR A;  3ZSW A;  4CFB A;  3HL8 A;  4E1M A;  5C42 A;  3KLE A;  3SUN A;  1KSP A;  2JGU A;  2KTQ A;  3LWM A;  4DU3 A;  3QIN A;  3VQD A;  3MXI A;  1LV5 A;  4QAG A;  1B92 A;  4ELU A;  3NH1 A;  4CJL A;  1HNV A;  3OJU A;  2WON A;  3QEI A;  2OPQ A;  4G1Q A;  3AO2 A;  3ZT2 A;  3O3G A;  1NK0 A;  1RDB A;  4DFK A;  4J2A A;  4ID5 A;  2FBV A;  1IKX A;  3SCX A;  1U45 A;  2XHB A;  3LZJ A;  3OYI A;  3AV9 A;  3DYA A;  1C1C A;  1B9F A;  1ZBH A;  3F73 A;  4JLH A;  3OY9 A;  4PA1 A;  4I7F A;  4FK0 A;  3MEE A;  4Z4G A;  2BE2 A;  3ZSX A;  3ULD A;  3OS2 A;  2KZM A;  1NKE A;  4BDZ A;  2Z1I A;  5CY4 A;  4K8Z A;  4B8C A;  2HNZ A;  3MED A;  3MEC A;  4CK1 A;  3LDS A;  1L3T A;  2Z1J A;  3DLK A;  3ZSQ A;  4CJU A;  4FJK A;  4KHS A;  4CF0 A;  4GMJ B;  3OYK A;  5SWM A;  3DOK A;  1NK8 A;  4I9Q A;  4Z4F A;  4CJS A;  3NGZ A;  1RBU A;  3V1Q A;  3D0P A;  3VQ7 A;  1ZBF A;  1JLB A;  4DTM A;  1NJX A;  4BDP A;  3KIO A;  4GW6 A;  4DTN A;  3SV3 A;  2NUB A;  3K5L A;  3LAL A;  3MXM A;  3OYJ A;  1DTQ A;  4KHN A;  4PQU A;  5HRR A;  1RT1 A;  4UQG A;  1D9D A;  3U6F A;  1VK0 A;  4BDY A;  4CEC A;  1XWL A;  3H08 A;  5C24 A;  2HNY A;  3NGY A;  4AH9 A;  4YNQ A;  3KK3 A;  3PX6 A;  3SNN A;  3C6U A;  4CHN A;  3WNH A;  3LP2 A;  1GOA A;  1IG9 A;  2EHG A;  1LWF A;  4CEB A;  3VQ8 A;  2OPS A;  1RNH A;  3VA3 A;  3AA4 A;  4E7H A;  3SQ1 A;  4CCH A;  4E3S A;  2HW3 A;  4JS4 A;  5JS2 A;  4L8R B;  3OJS A;  2KW4 A;  3KLG A;  3NDK A;  1L3S A;  4B9V A;  4KRF A;  4KKO A;  4LSN A;  3LAN A;  1TAU A;  3ZSV A;  3EYZ A;  3TR8 A;  1T8E A;  4HCB A;  2BAN A;  2YHA A;  1RT7 A;  4DTU A;  4M42 A;  2FBY A;  3KLH A;  1NOZ A;  4DFJ A;  3K59 A;  4DTP A;  3ZSY A;  3RMC A;  4J2B A;  2B6A A;  2D5R A;  3KJV A;  4N76 A;  4NYF A;  4FJL A;  2GV9 A;  2F96 A;  1WAF A;  1HYV A;  1ASU A;  5T7B A;  1B9D A;  3QO9 A;  4DSJ A;  3OYD A;  1VSF A;  3TAG A;  1S6Q A;  4KTW A;  4Y1D A;  1EP4 A;  3VQP A;  1QTM A;  2G8K A;  2FC0 A;  1FKP A;  4F2R A;  3DRS A;  3ZSO A;  2VG6 A;  3G10 A;  3HPO A;  1RCH A;  4FJ7 A;  3FFI A;  3QEW A;  1JLF A;  2YNG A;  3ZSZ A;  3V81 A;  1L3V A;  4KTQ A;  4Q0B A;  2HHX A;  4CFD A;  4FJJ A;  4IG0 A;  3M8Q A;  3VQC A;  4YFU A;  5I42 A;  1WAJ A;  4HUE A;  3SPY A;  3VA0 A;  4RW4 A;  3NF7 A;  3WNG A;  3K58 A;  4N56 A;  3KKR A;  2G8U A;  3RMD A;  1RBV A;  2AJQ A;  2X74 A;  1BI4 B;  4DQR A;  1CZ9 A;  1IKY A;  1IKW A;  2A1S A;  4BAC A;  1QHT A;  1VSJ A;  4KHW A;  1JXE A;  1VSH A;  4O0J A;  4CGG A;  4DSL A;  3LP0 A;  5D3G A;  1HRH A;  4CIG A;  4FM0 A;  4DSK A;  5I3U A;  1S5J A;  4AHS A;  3AVH A;  2E6M A;  3U3Y A;  3NF9 A;  4OPK A;  5EU7 A;  2HMI A;  4N5S A;  4JS5 A;  4B9T A;  1N6Q A;  2RF2 A;  4B9M A;  4FLX A;  4FM2 A;  3AVI A;  1KVC A;  3ALY A;  3IAY A;  1HMV A;  1LWE A;  3C6T A;  3LAK A;  4O0I A;  4F2S A;  4KB1 A;  4FJ9 A;  5J1E A;  3ITH A;  4RW6 A;  4FLU A;  4CJF A;  1NJZ A;  1SKR A;  2ATQ A;  2YNF A;  4B8A B;  3LPU A;  4CGH A;  4DU4 A;  3ZT1 A;  2PZS A;  3NF8 A;  4EZ9 A;  1D8Y A;  1DLO A;  2GUI A;  3KKS A;  1QSL A;  3QEP A;  4PUO A;  2P1J A;  4FLT A;  2I5J A;  4ELT A;  4JRQ A; 
#chains in the Genus database with same CATH topology
 4ZHR A;  5C15 A;  3PY8 A;  3L2Q A;  1KC8 O;  4F4K A;  4A57 A;  4AQY K;  4B9Q A;  4BWJ A;  4CEO A;  4RCH A;  4DFM A;  3JS6 A;  1D9F A;  4ZTF A;  3PO5 A;  4B3O A;  1HYZ A;  3NCI A;  3FLC O;  4O5F A;  1BG3 A;  2YHY A;  2HHV A;  4H0X B;  1SKS A;  4IOA L;  2ZGZ A;  4AF1 A;  4KHY A;  1JCG A;  3D6R A;  4EHT A;  2QKB A;  1TK0 A;  1NGH A;  1FXX A;  2UXC K;  4UY8 O;  4HWI A;  4ELV A;  5LMN K;  3MWT A;  3AAR A;  1XI1 A;  3O80 A;  5FRN A;  3MK6 A;  4H5R A;  1VQ9 N;  1YT3 A;  3P39 A;  4CED A;  1QS4 A;  2BH1 A;  1U2V A;  1SKW A;  1HYS A;  2QKK A;  5KGW A;  4AM6 A;  1TKZ A;  1WBB A;  1I39 A;  1QZ6 A;  2PBD A;  5JS1 A;  3DLG A;  1VQ4 N;  3RMB A;  4CI6 A;  4CJQ A;  3AAP A;  2NRT A;  4LH5 A;  3WUH A;  1WSJ A;  1T05 A;  5BRE A;  4PKH A;  4GVM A;  1Q82 O;  4K42 A;  3O5B A;  5EXW A;  1JXB A;  4LH4 A;  2OCE A;  3S3N A;  5AQR A;  1HLU A;  3DLL L;  3LAM A;  1ATN A;  3G0Z A;  1JL1 A;  3OYM A;  3R3L A;  3QEX A;  3CJA A;  3MX2 A;  3PX0 A;  4CJK A;  2EX3 A;  3NF6 A;  3HO1 A;  4BRL A;  3C6H A;  3WEE A;  4DS5 A;  3NHG A;  2VWB A;  2HMP A;  1X9J A;  1TV6 A;  2FBX A;  2YKM A;  2BDP A;  4B9L A;  2E4L A;  4DG1 A;  5AQF A;  5C25 A;  3EKU A;  3A8Y A;  4BR9 A;  3HOT A;  4E89 A;  1J6Z A;  1RT4 A;  3MCP A;  4M41 A;  3HP6 A;  4DTX A;  1E4F T;  2P9L A;  3L3V A;  1HKC A;  3BGR A;  3DM2 A;  4CZH A;  4I6M B;  3VEN A;  3NFA A;  1ZBL A;  1REV A;  4CZG A;  4IWV A;  5BPN A;  5SZT A;  1BCO A;  3AVC A;  4KI6 A;  4DTS A;  3QER A;  3BZC A;  3CJ1 A;  4KH6 A;  4W5T A;  3HTV A;  4H5W A;  3TI0 A;  2F7T A;  4DLG A;  3IKM A;  4FZY A;  3CM5 A;  2IOC A;  3EO3 A;  4A5B A;  5DK5 A;  3ULE B;  3MXJ A;  2IVP A;  1SL1 A;  4CJP A;  4IBN A;  3WQU A;  2A40 A;  3M1F A;  5ELZ A;  1RTH A;  4HTL A;  4BRP A;  2HND A;  1BL3 A;  5JVH L;  3V1R A;  1N5Y A;  3G71 N;  2QXF A;  4WQ4 C;  5AZI B;  1VRT A;  2A3Z A;  4AHU A;  3HM9 A;  1WSE A;  1LAV A;  1BHL A;  3CCR N;  3GDQ A;  5HRS A;  1KRP A;  3ATV A;  2XO7 A;  4FSV A;  3CQX A;  1SAZ A;  4NYN A;  2ZD1 A;  2YKN A;  3OHR A;  2GEL A;  3K57 A;  4A61 A;  4IFE A;  4MQ3 A;  5ADX H;  1LAW A;  4DV1 K;  3HSC A;  1CZB A;  3RVC A;  1RT6 A;  3OTO K;  3V6D A;  2FLO A;  4CW7 B;  1IO2 A;  4CGJ A;  3ZCM A;  2F8T A;  4DR3 K;  4KBO A;  2KHO A;  2O8F A;  1BOT O;  2HHQ A;  3IG1 A;  1BA0 A;  1YVU A;  5HBM A;  2XY8 A;  1R0A A;  3VQ6 A;  3OBY A;  1F21 A;  5CZ2 A;  4HUG A;  1QSY A;  3N4P A;  3B6P A;  2DFF A;  1HNI A;  3MMV A;  3OBW A;  4Y0W A;  1HKG A;  4M63 C;  1M1K O;  2Z1G A;  4FPA A;  1RDA A;  4K0K K;  3BF1 A;  2FSK A;  2XRI A;  1RBS A;  3E01 A;  4OLB A;  2HB5 A;  3QLH A;  2RN2 A;  3IRX A;  1VQM N;  1C0G A;  4DHY A;  2IS3 A;  2UUB K;  3KK7 A;  4C8O A;  1NGA A;  3DMJ A;  2P9U B;  3CCS N;  3WT0 A;  4DUY K;  1J53 A;  5K14 A;  2VQE K;  4XH4 A;  4DKW A;  4E7I A;  3O3H A;  4CJ4 A;  3VER A;  4BRQ A;  1ESV A;  3CFR A;  4ISE A;  3CCL N;  3TTF A;  4I6M A;  1YXQ A;  4WF9 L;  3O9U A;  5TKW A;  2D0C A;  5HOO A;  1NKC A;  3RRH A;  1Q81 O;  3VF2 A;  2G8F A;  2VWJ A;  3V9Z A;  3L6Q A;  2F4V K;  4BRH A;  5LY3 A;  3PIO L;  3ULE A;  1A5W A;  4XIU A;  3ZYY X;  3L2W A;  1GOC A;  3HJF A;  4C8M A;  1NMD A;  4YOT A;  4RTF D;  4CFA A;  4Z4C A;  4CVN E;  3CYM A;  5AZI A;  4O5B A;  5CYM A;  4HTU A;  4DTO A;  4AHT A;  2O8C B;  4FJM A;  4CJV A;  2W41 A;  4CIF A;  4C8L A;  3J7A P;  2FF3 B;  1U49 A;  2PAV A;  5DMR A;  5AQQ A;  5AQZ A;  3DLH A;  4KHP K;  3I8D A;  3T1Y K;  3AVF A;  1VQ5 N;  4K8X A;  4BVO A;  4Z4H A;  1GLJ O;  4DF4 A;  5GAG P;  1QQM A;  3H1V X;  3JXU A;  4NLC A;  1DEJ A;  3J81 O;  3G25 A;  4DQP A;  4OKE A;  3P4I A;  1YHQ N;  2RHK A;  1YTU A;  3MEG A;  5KPT A;  4KV8 A;  4OKJ A;  3NH2 A;  2W6K A;  3V9S A;  3GG4 A;  4CEA A;  2Y1J A;  2HVI A;  4OPJ A;  3B6O A;  3M8P A;  3ZX3 A;  3RR8 A;  3DRP A;  1HQU A;  5KTQ A;  3WXL A;  3HVT A;  4OJR A;  4JKG A;  1S1U A;  4CFB A;  3F9K A;  3DLR A;  4JN4 A;  2V7Y A;  4Z94 A;  3LWM A;  4ELU A;  2P9S B;  3CCQ N;  1BDG A;  3ZT2 A;  3O9R A;  1RDB A;  2ZGY A;  3LL3 A;  3VMF B;  3ATU A;  4CZM A;  1U45 A;  3CC4 N;  4J2A A;  1EWR A;  4IJN A;  2W6L A;  1HKB A;  3FZH A;  3AV9 A;  1OVQ A;  1HNW K;  4PA1 A;  3I56 N;  4BR2 A;  3J7Y P;  4Z4G A;  2BE2 A;  3FZL A;  3ZSX A;  5GAH P;  3OS2 A;  4BDZ A;  4BRF A;  3DAW A;  3ZEU B;  5CY4 A;  4B8C A;  3LDS A;  3MEC A;  4FJK A;  4CF0 A;  4GMJ B;  3JAM O;  3OYK A;  3K9K A;  3NGZ A;  1RBU A;  3V1Q A;  5BR9 A;  1ZBF A;  1HX1 A;  3KIO A;  4DTN A;  3SV3 A;  1O13 A;  3MXM A;  4XH5 A;  1D9D A;  2Q36 A;  1VK0 A;  3I33 A;  4AH9 A;  5C24 A;  2HNY A;  3PX6 A;  4OPA A;  1GOA A;  1QQO A;  1LWF A;  3VA3 A;  3AA4 A;  1XMQ K;  2KW4 A;  1MA9 B;  1VHX A;  2BAN A;  4BRI A;  4FWN A;  4M42 A;  2FBY A;  1D4X A;  3KLH A;  3ZSY A;  2B6A A;  1NGC A;  5EVZ A;  4IJA A;  3QO9 A;  5AQS A;  3TAG A;  1S6Q A;  3TSU A;  3VQP A;  2O8C A;  1QTM A;  4PL8 A;  1Q86 O;  1FKP A;  4F2R A;  2VG6 A;  3G10 A;  3HPO A;  1RCH A;  3LDL A;  3QEW A;  3ZSZ A;  3F5T A;  2Q31 A;  4CFD A;  5I42 A;  4BR5 A;  3WNG A;  3SAH A;  2G8U A;  3RMD A;  1Y64 A;  1IKY A;  3VTI A;  4BAC A;  3L4Q A;  1VSH A;  5D3G A;  3LP0 A;  1HPM A;  4QS9 A;  5F0X A;  4BRO A;  3GE1 A;  4B9T A;  1R59 O;  4YHH K;  4ILJ A;  1KVC A;  3D2F B;  3LAK A;  4O0I A;  1XNQ K;  1IBM K;  5J1E A;  4FLU A;  1SKR A;  2YNF A;  5KPR A;  4EZ9 A;  5AQY A;  1DLO A;  1VQK N;  4BY9 C;  4IDH A;  3NMU A;  1QSL A;  1LCU A;  1M90 O;  2P1J A;  3MDQ A;  2P9S A;  2WFB A;  1IG8 A;  2P9K B;  4JRQ A;  3IMX A;  3AVJ A;  1KAX A;  3VEW A;  2OA8 A;  3THW B;  4GNI A;  5AQJ A;  2NNW A;  4FWO A;  5KPZ A;  1GLL O;  4FZX C;  4CJ5 A;  1TUU A;  3AA2 A;  5CR4 A;  3L2U A;  3RTV A;  3BZK A;  3IUC A;  4Z4E A;  3ZEU A;  1LWC A;  4JKE A;  3TAE A;  3S3M A;  3C6A A;  1NKB A;  3AA5 X;  3M3Z A;  4PHT X;  2PYJ A;  4QS8 A;  3DLE A;  1YJN N;  1BGX T;  1TYQ B;  5BPL A;  3TAM A;  3OVN A;  1EXQ A;  3AVG A;  3MX5 A;  4H0V B;  3VGL A;  3NAE A;  1S22 A;  2D4W A;  3DJC A;  4CGI A;  1RT3 A;  1YI2 N;  1TVR A;  4FYD A;  5AQW A;  1NOY A;  1N32 K;  4IZ9 A;  4BR7 A;  1NJW A;  1TK5 A;  2KQ2 A;  4E0D A;  4FWS A;  1W9H A;  3L2V A;  3LP3 A;  4IFV A;  1O1W A;  4Y1C A;  1G99 A;  3EE9 A;  3ZT4 A;  5LJV A;  3V9W A;  3DLB A;  4BRG A;  4FJ5 A;  4B1V A;  3KLI A;  2B5J A;  2I7N A;  5AR0 A;  3TAB A;  4CZE A;  1VSL A;  3Q7C A;  3CXC M;  3AVN A;  1L3U A;  2E1Z A;  1VSD A;  3CPE A;  4R5P A;  4B3T K;  5E41 A;  3KK1 A;  3VOV A;  4E7L A;  1BO5 O;  2A6A A;  4YY3 K;  5M1Q A;  3SUQ A;  3OS1 A;  1JLQ A;  4H0P A;  4CF8 A;  4OX9 K;  3SBT A;  4CBU A;  2O4G A;  4BRC A;  1IKV A;  3CFO A;  3TAP A;  4EZ6 A;  4YOR A;  2PFU A;  2P9N B;  3MCA B;  3SPZ A;  1A5V A;  1NK7 A;  3R1X A;  1TK8 A;  4KH4 A;  3AO5 A;  1TUY A;  4M45 A;  1NNE A;  3I0R A;  3M8S A;  2NRV A;  4DV6 K;  3PV8 A;  4DTR A;  1NK5 A;  3UE5 A;  2HHT A;  1ITG A;  4CGF A;  3KLF A;  4OPH A;  2ETJ A;  3CG7 A;  4YOU A;  4N47 A;  1KLM A;  4M3X A;  1YUW A;  3RMA A;  1NK9 A;  3TAN A;  1KCF A;  1NGD A;  1RDC A;  3QET A;  4IFY A;  4RW7 A;  4LC9 B;  5CYQ A;  3O3F A;  3ID6 A;  4M3U A;  3PX4 A;  4CF9 A;  3T19 A;  1RGI A;  3THW A;  2IAJ A;  3KVG A;  4X65 K;  1RIL A;  2ZQB A;  4WE1 A;  1Y97 A;  3NVK A;  4FLY A;  4IEE A;  2QWN A;  3AO4 A;  1BUP A;  1S1W A;  2G8V A;  4B3M K;  3PSF A;  5KI6 A;  2P9P B;  3S3O A;  4FJ8 A;  5J2Q A;  1TYQ A;  3HST B;  2E1Y A;  3CJB A;  3QML A;  3O4Q A;  2QM1 A;  4F3O A;  3ENH A;  1OH5 A;  1MWM A;  4FZZ A;  5GAE P;  2VCP A;  2A5X A;  1ASV A;  1U6Z A;  1T44 A;  1V4T A;  2VYP A;  5FRM A;  4I2Q A;  4LF7 K;  3PO4 A;  1XQS C;  4FLW A;  4FOI A;  1IBK K;  3SQ2 A;  1D5A A;  1VRU A;  3Q7B A;  4FO0 A;  1X9S A;  3K2P A;  3HP9 A;  1SUQ A;  3O8M A;  3P1G A;  1CXU A;  3O4N A;  4BGA A;  4B9N A;  4B08 A;  3H46 O;  4GKJ K;  1JCE A;  3VN5 A;  4DCH A;  4DFP A;  1ATR A;  1N36 K;  3QIP A;  4JD2 A;  3OS0 A;  3HYF A;  3PLA A;  2O8F B;  4B1U B;  4A59 A;  4NLB A;  1S9E A;  3EZ5 A;  2GX9 A;  4PY5 A;  3V9X A;  4DWI A;  1K6Y A;  2OAN A;  3D45 A;  3VTH A;  1WB9 A;  2P9N A;  1YTA A;  1OVY A;  3D7E O;  4NCB A;  1BIU A;  4FWK A;  3VQ4 A;  3VF6 A;  4FPB A;  2IDO A;  4R79 A;  1OKJ A;  2G8W A;  3T3F A;  5KGX A;  2G8H A;  3BEX A;  4BC4 A;  4JEP A;  4JI8 K;  3VES A;  3KTQ A;  5BN8 A;  2W42 A;  4CJR A;  4FWR A;  2QWM A;  2WBN A;  5H1S Q;  4E7K A;  5FPE A;  5AQO A;  4V19 S;  3CQY A;  3TAQ A;  1GLA G;  1U4B A;  4FJN A;  1JLA A;  4XH1 A;  1UOC A;  3T1H K;  4CJE A;  2HHU A;  3WQT A;  1XNR K;  2Q2R A;  4FJX A;  1Q18 A;  3BF3 A;  3K0S A;  5CZ1 A;  2KLA A;  2XY5 A;  4DV0 K;  2DFH A;  4BE2 A;  3TU5 A;  5C0Y A;  4J2D A;  1W2B M;  1U04 A;  4RW9 A;  3VEZ A;  4B9U A;  4B1X B;  1RT2 A;  4YOW A;  1BU6 O;  5FPM A;  4E19 A;  1NGE A;  3HPG A;  5FDL A;  4E1J A;  4KHQ A;  2IVN A;  3L0Q A;  4K25 A;  4C8N A;  2OTL N;  1SL0 A;  3CJ7 A;  1WSF A;  4I2P A;  1RTD A;  2P9P A;  1NK4 A;  2D0O A;  3SMS A;  4CHQ A;  1ZBI A;  3S9H A;  2BGG A;  4A2A A;  1XUP O;  1EKE A;  4NCA A;  4CHZ A;  1NK6 A;  1WOQ A;  4ISG A;  3CCE N;  4M3T A;  5DM7 L;  3MAQ A;  3VQA A;  5CHI A;  2DTU A;  3C7N B;  4FWP A;  4JKF A;  4CHY A;  2E2N A;  3AVL A;  4DTJ A;  5GIP A;  1HJR A;  5J2P A;  3P38 A;  2F9W A;  1KLN A;  4PKI A;  1P90 A;  3EY1 A;  3G4S N;  2ZJP L;  4GV9 A;  3S41 A;  4LF6 K;  3HK2 A;  4YDU A;  1S9G A;  5J2N A;  2E20 A;  2KZZ A;  3ZSW A;  3HL8 A;  1HJO A;  1YIJ N;  3MXI A;  4JK9 A;  3U9D A;  3NH1 A;  4K43 A;  5E26 A;  4CBW A;  4CJL A;  2WON A;  4G1Q A;  3AO2 A;  4ID5 A;  1NU0 A;  5JIC A;  3OYI A;  3DYA A;  1C1C A;  3E9O A;  3UKR B;  4EIA A;  4JKG B;  1NM1 A;  4FK0 A;  2O8E B;  1NKE A;  4CK1 A;  1L3T A;  2Z1J A;  3ZSQ A;  4KHS A;  4WCE L;  2E2Q A;  5SWM A;  1NK8 A;  4Z4F A;  3HOS A;  4CJS A;  3D0P A;  4GW6 A;  2NUB A;  3LAL A;  4B1W B;  3VEO A;  1RT1 A;  1NGJ A;  1XWL A;  4X66 K;  4O8K A;  3WNH A;  3UB5 A;  5JMV A;  1IG9 A;  1NG9 A;  4E7H A;  2HF3 A;  4JS4 A;  3OJS A;  3O1B A;  1L3S A;  4KRF A;  2O8B B;  3THY A;  4LSN A;  1TAU A;  3TR8 A;  4BRD A;  1T8E A;  4F9O A;  3J80 O;  3RMC A;  3KJV A;  2WC9 A;  2DPN A;  5HL7 L;  2GV9 A;  1HYV A;  1ASU A;  2AP1 A;  1B9D A;  3OYD A;  2HOE A;  3G6E N;  4PKG A;  2NRR A;  3CCU N;  2G8K A;  5FPN A;  1T3V A;  3ZSO A;  4H5V A;  4BGB A;  1JLF A;  2YNG A;  4KTQ A;  2HHX A;  4GV3 A;  4IG0 A;  4YFU A;  3EE8 A;  1KAY A;  1XMO K;  4BRK A;  4ILG B;  4IEI A;  5GIN A;  3D2E B;  3C7N A;  2AJQ A;  4L3Q A;  1BI4 B;  1YVN A;  1IKW A;  2A1S A;  4FWM A;  1QHT A;  4KHW A;  4O0J A;  4CGG A;  2HST A;  5IT9 O;  4CIG A;  3LM9 A;  4A2B A;  1S5J A;  1KXP A;  4YOX A;  4AHS A;  3U3Y A;  2NRZ A;  3NF9 A;  4H5T A;  4M7Y A;  2HMI A;  4DR1 K;  1K8A O;  3OW2 M;  4B9M A;  2QWO A;  4FLX A;  3AVI A;  3ALY A;  1HMV A;  1LWE A;  4F2S A;  4KB1 A;  2HBJ A;  2NRW A;  4RW6 A;  1NWK A;  2V7Z A;  2ATQ A;  3W3D A;  3LPU A;  1NGB A;  3ID8 A;  2GUI A;  4FLT A;  4ELT A;  4BRN A;  3R8E A;  2PYL A;  4DV4 K;  2CGL A;  4DSE A;  3QNO A;  1VQ8 N;  4CF2 A;  1X9M A;  2D0A A;  3U4L A;  4BWM A;  2UUC K;  5AZJ B;  3UKR A;  3HXM A;  4Z0U A;  4FK4 A;  3DI6 A;  4N41 A;  2O8E A;  4NCG A;  5FLX O;  2F9T A;  2ZJR L;  4M3Z A;  4DQI A;  4BE1 A;  3ZT0 A;  4BQZ A;  2E6L A;  4CEZ A;  4M3Y A;  2V52 B;  4NB4 A;  3FZM A;  3F2K A;  5KRS A;  3ZSR A;  1RTI A;  5JLH A;  4JKA A;  1BWF O;  3ENB A;  4WQ5 C;  4B1Y B;  4M3R A;  2QXL A;  1QHA A;  3FE1 A;  4AHC A;  1YAG A;  3VGK A;  3JYT A;  2J4R A;  4HUF A;  3IDH A;  1EET A;  2JLE A;  4YDU C;  3HPH A;  2DY4 A;  3GL1 A;  4X62 K;  5MLC Q;  4H4O A;  1GLD G;  2YJF A;  4PL7 A;  2O8B A;  3J7Z O;  2Z1H A;  3BDP A;  3LPT A;  2EWS A;  4RG8 A;  2ZE2 A;  3WNE A;  1K9M O;  2NRX A;  2NZT A;  3OYE A;  4W5O A;  3KK2 A;  1ZYQ A;  3EEQ A;  2A42 A;  3LDQ A;  3ASM A;  3WXK A;  3QIO A;  3VEY A;  1W0H A;  3IFR A;  1C0T A;  5TKY A;  4AIL C;  1YJW N;  4CHO A;  4JK8 A;  3C95 A;  1EX4 A;  4LF9 K;  4KFB A;  3RR7 A;  4XEI A;  4Z4I A;  2HHW A;  1RBR A;  1N34 K;  4BE0 A;  3D2E A;  4DR4 K;  3VQ5 A;  2UXD K;  1BI4 A;  3JSM A;  3LDN A;  3FFK B;  4DB3 A;  1UA1 A;  2FSJ A;  4QS7 A;  3CMA N;  1ASW A;  3DRR A;  4BRM A;  3L8B A;  3T7Z A;  1TKX A;  2GWK A;  3SI6 A;  1LW0 A;  4CZL A;  5EOY A;  3RRG A;  3A2F A;  4ID1 A;  4O44 A;  4JI6 K;  2O4I A;  5KQD A;  4KHU A;  3M6G A;  1RDW X;  1KVB A;  4CZJ A;  1S1X A;  1QE1 A;  3L4I A;  2KFN A;  3I8B A;  1SV5 A;  1WLJ A;  2D1K A;  5M1P A;  3T1A A;  4CEF A;  4GY2 B;  3O6W A;  2Q3S A;  2P5O A;  4W5Q A;  3EL2 A;  1MWK A;  5AJ3 K;  4JI3 K;  2DFE A;  1RTJ A;  4CEE A;  1K8K B;  4JNE A;  5AZJ A;  4JRP A;  2YHB A;  4KAZ A;  2NLX A;  1NJY A;  4LF4 K;  4IKF A;  1S1V A;  4H0O A;  4FCY A;  3KD5 E;  3VPZ A;  1SL2 A;  2NRH A;  4OGC A;  4U7B A;  3SQ4 A;  3ZET B;  4YOY A;  4OGE A;  1Q7Y O;  3SLC A;  2UYT A;  3AVK A;  2E2P A;  5BRF A;  4FLZ A;  4DMN A;  1U47 A;  3HVR A;  1EO1 A;  4EP4 A;  1VSK A;  1QZ5 A;  2IVO A;  3MWP A;  1TL3 A;  3SZ2 A;  2IGI A;  1KD1 O;  1IH7 A;  5J2M A;  1G15 A;  1LOT B;  1XC3 A;  4MLH A;  2V51 B;  4FW2 A;  5LJW A;  3UKU B;  4H03 B;  2QK9 A;  4KO0 A;  3K5N A;  2IIR A;  4GKK K;  3WNF A;  4EFH A;  3CER A;  3A5M C;  5B8H A;  5EX5 A;  5JVG L;  1K73 O;  1GLE G;  1BA1 A;  5BRH A;  3AVB A;  3THX B;  1HR0 K;  1E4G T;  5LMU K;  3ZX0 A;  3FGU A;  1OH7 A;  5M1K A;  4DU1 A;  4RWT A;  1XC9 A;  1IJJ A;  4JI1 K;  3ZLJ A;  4JAX A;  3CFP A;  4M3W A;  1CLQ A;  1ZXO A;  1BIZ A;  4EAH D;  1RT5 A;  4H0Y B;  5HRP A;  4IO8 A;  2W40 A;  3TPQ A;  3OYN A;  5DM6 L;  3VQ9 A;  3QEV A;  4DLE A;  4JD2 B;  1VQL N;  1WBD A;  4JHD A;  4CIE A;  2WOM A;  3CI5 A;  1QQC A;  1UWB A;  4FJG A;  4MO4 A;  1HQE A;  2HF4 A;  3GOI A;  5LL6 Z;  4IG3 A;  1KTQ A;  4JI5 K;  3U9Z A;  4FXD A;  2OYQ A;  4LF5 K;  1JCF A;  2YHW A;  2UU9 K;  3PSI A;  3P5J A;  3SV4 A;  3V9U A;  2LSN A;  3MN5 A;  3SAG A;  4KPY A;  2FF6 A;  2CGK A;  5KRT A;  4CJ7 A;  2G8I A;  2Q0R A;  4DR6 K;  3AO1 A;  1KQS M;  5M1N A;  3LM2 A;  2F8S A;  2VWK A;  4OVL A;  2GUP A;  2H3G X;  4JI0 K;  4BG9 A;  1JKH A;  2HHS A;  1K8K A;  5BRD A;  2P51 A;  1KVA A;  2HBL A;  1YF5 L;  3HI0 A;  1QSS A;  4F8R A;  1HNX K;  1NGI A;  3KZB A;  3CC2 N;  1C0F A;  1Z26 A;  3ZET A;  1T6C A;  3FZF A;  3CF5 L;  1C1B A;  2YNI A;  1T7P A;  2CH6 A;  1VQ7 N;  3HT3 A;  4I9L A;  4MDB A;  3V4I A;  1GLC G;  3M5R A;  3L3U A;  2CGJ A;  3VEX A;  3PUF A;  2XY7 A;  3CET A;  5AQU A;  4MFB A;  1DKG D;  2QTD A;  3UKU A;  4O4G A;  2GBZ A;  3H3O B;  2ASM A;  2P5G A;  1C1A A;  5M1F A;  3VQQ A;  4JI4 K;  3QES A;  1KAZ A;  1DT9 A;  2HVH A;  1LW2 A;  3L2R A;  3OYC A;  3F9M A;  3SBG A;  5HP1 A;  3BUZ B;  3THX A;  3V1O A;  3PIP L;  4BC3 A;  1BCM A;  3AVM A;  3CM6 A;  2P9I A;  5C42 A;  2ASO A;  4FL9 A;  4E1M A;  3KLE A;  1KSP A;  2KTQ A;  1B92 A;  2AA4 A;  1HNV A;  2OPQ A;  5C2D A;  4LFC K;  3HRG A;  3O1W A;  3SCX A;  1IKX A;  2XHB A;  1ZBS A;  4C1N I;  1B9F A;  1ZBH A;  3F73 A;  4JLH A;  1SQK A;  3H6E A;  3E1Y A;  4I7F A;  3B8A X;  3MEE A;  2HHH K;  3HM8 A;  2KZM A;  1VQO N;  4K8Z A;  2JWL A;  3DLK A;  4CJU A;  3E9P A;  3AAQ A;  3FZK A;  4I9Q A;  4JK7 A;  1NJX A;  4A5A A;  1JLB A;  4BDP A;  3K5L A;  3P31 A;  4A62 A;  4KHN A;  2ITM A;  1N33 K;  4UQG A;  3U6F A;  4BDY A;  3H08 A;  3RSE B;  3KK3 A;  1N8R O;  4JI7 K;  2HBM A;  4DQ8 A;  2EHG A;  4CEB A;  2OPS A;  1RNH A;  4CCH A;  4E3S A;  2HW3 A;  3WXI A;  5JS2 A;  4L8R B;  4NXN K;  4KKO A;  3LAN A;  3ZSV A;  3EYZ A;  2YX6 A;  2YHA A;  1RT7 A;  3O4W A;  4DTU A;  1NOZ A;  4JKB A;  4J2B A;  4DTP A;  2D5R A;  4YOV A;  4N76 A;  5AQV A;  2E88 A;  4GVE A;  4FJL A;  3SMP A;  3CJ9 A;  1VSF A;  5AQI A;  4Y1D A;  1NGG A;  3THY B;  2ASP A;  2FC0 A;  4B1Z A;  3FFI A;  4O8U A;  2QI2 A;  4FJJ A;  3M8Q A;  1WAJ A;  1ZC6 A;  4HUE A;  4RW4 A;  3KKR A;  2X74 A;  2GEM A;  3ENO A;  1VSJ A;  3CCM N;  4CZI A;  4FM0 A;  3E66 A;  5I3U A;  4DSK A;  5JLF A;  2E5L K;  4OPK A;  3EN9 A;  2O8D B;  2Q0U A;  2YJE A;  3C6T A;  1VQ6 N;  4FJ9 A;  3CJC A;  3AGR A;  4JYA K;  5ADX A;  4B8A B;  4CGH A;  2HBK A;  1D8Y A;  3KKS A;  1HUX A;  4WQ5 A;  2I5J A;  5FRO A;  4JV5 K;  1J5E K;  1MDU B;  3E9L A;  1C0M A;  4CFC A;  1GOB A;  4DQS A;  3SQ0 A;  5AQL A;  1VQP N;  5C10 A;  1Q9Y A;  4BR0 A;  4H4M A;  2ITG A;  2VG5 A;  3R9P A;  1MU2 A;  1CXQ A;  3SUO A;  3RWU A;  3BP8 A;  3GBT A;  4FVM A;  2QA4 N;  4X64 K;  3QFU A;  5F1X A;  4RW8 A;  1BQN A;  4HCC A;  2Q1N A;  4U67 L;  2QWQ A;  4C1N K;  1WNS A;  5CE3 A;  4IDK A;  4K41 A;  3RSE A;  1C6V A;  1WSG A;  1A5X A;  2PY5 A;  2OPP A;  3MN6 A;  4BRA A;  4DR5 K;  1FW6 A;  4C8K A;  3CQ8 A;  1JLC A;  5AQM A;  3BY5 A;  5C2F A;  3QNN A;  3K5M A;  4J2E A;  2BUP A;  1TGO A;  3KHY A;  3SAF A;  1P8Z A;  1WUA A;  3WXM B;  2B4J A;  3SUP A;  4F3T A;  3O9S A;  2IC3 A;  1X9W A;  1OH6 A;  3LZI A;  2ZF5 O;  3CCV N;  2WTU A;  4OKK A;  3ZT3 A;  4IXC A;  3LWL A;  2BTF A;  5GIO A;  4HVJ A;  1RBT A;  2UXB K;  3OYG A;  3M8R A;  1UAX A;  1T6D A;  3AO3 A;  3WXJ A;  4TSX A;  4FM1 A;  4LY7 A;  4E7J A;  4CER A;  2YV0 X;  4BR4 A;  4LD0 A;  4IOC L;  3H45 C;  1S1T A;  3NGI A;  4CEQ A;  1Z05 A;  1CZA N;  4IOX A;  4AHV A;  1NMN A;  4DSI A;  4BVP A;  2Y1I A;  1JLE A;  4ICL A;  2VGM A;  4CES A;  3OYB A;  3CHW A;  4CD1 A;  2R7Y A;  3I0S A;  4O55 A;  4MO5 A;  4CJ3 A;  1X1P A;  1TKT A;  1Q8I A;  2A1R A;  3NBP A;  3W0L A;  4PWD A;  2O8D A;  4BC2 A;  4DR7 K;  5BPM A;  1ILY A;  4ZTJ A;  1XHX A;  5AQN A;  4H5N A;  4DF8 A;  5C12 A;  1WSH A;  4KTZ A;  3DXM B;  1I3A A;  2YI1 A;  3NVM A;  3VET A;  1J9A A;  1I94 K;  3UIQ A;  4GV6 A;  3OYF A;  4QCL A;  5BN9 A;  2VQF K;  3SJH A;  3LDO A;  5E84 A;  1Z6R A;  2A41 A;  4DV5 K;  3DXK B;  3MN9 A;  4H0T B;  3U3G A;  2KFZ A;  5A2Q O;  2YHX A;  2VG7 A;  1S72 N;  4OLA A;  2X78 A;  5HLF A;  3SYZ A;  4B3S K;  3NE6 A;  3R6M A;  1TKD A;  4H8K A;  2RKI A;  4FK2 A;  4WFB L;  4W5N A;  1VAZ A;  1WSI A;  2XY6 A;  3VGM A;  2YCH A;  2ZWH A;  5BR8 K;  3C0B A;  2OZM A;  2I7P A;  4E1N A;  4CK2 A;  2Q97 A;  2GWJ A;  1X3M A;  1FK9 A;  1W97 L;  3KD1 E;  3IS9 A;  3FR0 A;  3O9Q A;  5AFU A;  3AA3 A;  1JL2 A;  1BIS A;  1VSM A;  1X3N A;  3K9J A;  4MDA A;  4AHR A;  3TSP A;  3SK3 A;  1KFS A;  5M1O A;  1W7A A;  1FKO A;  4FJI A;  3P83 D;  3TAF A;  4DQQ A;  3LDP A;  4WFA L;  1GLB G;  2P9U A;  1T03 A;  1S6P A;  3ZX2 A;  4Q5V A;  4QOZ B;  3O9T A;  4CD3 A;  4KI4 A;  5AQH A;  3VEV A;  1U48 A;  3T69 A;  3OYL A;  3KWI A;  2ZM6 K;  3I55 N;  4DS4 A;  1Z25 A;  4CZF A;  5AQK A;  2D0B A;  4BC5 A;  5AFU H;  1J5O A;  4BQL A;  4FLV A;  4WYB A;  1VSI A;  1UA0 A;  1IV0 A;  2OTJ N;  1OH8 A;  3AGK A;  4B3R K;  1RDD A;  4CJW A;  1FJG K;  5HRN A;  3OYH A;  3NH0 A;  4EP5 A;  4FJH A;  5F2R A;  4G9Z A;  4JHD B;  1WN7 A;  1YJ9 N;  4J8F A;  2QWL A;  3HZ6 A;  3O08 A;  2RPI A;  2D0P A;  4CF1 A;  1C0U A;  1JJ2 M;  4CGD A;  4FW1 A;  1J54 A;  3DXM A;  3CPW M;  1TL1 A;  3H1Q A;  4C23 A;  3VQB A;  3QBW A;  4NO7 A;  2QWP A;  1DGK N;  3ISN C;  4BG8 A;  1QVG M;  2E8A A;  1VSE A;  3OYA A;  4CJT A;  2OZS A;  3DXK A;  2VGN A;  3TAR A;  4NXM K;  3VQE A;  2FBT A;  3CCJ N;  3K5O A;  4KRE A;  2YNH A;  1L5U A;  4DR2 K;  4LSL A;  1TAQ A;  3A5O C;  2X6N A;  4M7X A;  2FSN A;  3J8A A;  3DOL A;  4KB0 A;  3THV A;  2X6S A;  3AVA A;  1BQM A;  5AQT A;  3CIP A;  3LP1 A;  2JWK A;  4JKC A;  5EY4 A;  3TWH A;  1RDU A;  4ISF A;  3A5L C;  2OPR A;  1NBW A;  5HRO A;  3CD6 N;  1JLG A;  2UUA K;  4DV3 K;  3QFP A;  3VF4 A;  4DSF A;  3N4Q A;  4CHP A;  3CME N;  1VQN N;  4LFB K;  3TTD A;  4CK3 A;  4EHU A;  1HPZ A;  3C94 A;  4OO1 J;  3SJJ A;  1Q9X A;  1E3M A;  5AQG A;  2KKZ A;  5KQ8 A;  1KFD A;  1DTT A;  3QBX A;  1EWQ A;  4BRE A;  4B9S A;  1XHZ A;  4HHT A;  1NJI O;  3C65 A;  4FOE A;  3HBT A;  4CE9 A;  4FWL A;  4W5R A;  3MN7 A;  1QQN A;  1ZBU A;  2CH5 A;  3SUN A;  2JGU A;  4LF8 K;  4DU3 A;  3QIN A;  3VQD A;  1LV5 A;  4QAG A;  4FVU A;  3OJU A;  3KWG A;  3QEI A;  3O3G A;  2FXU A;  1NK0 A;  4DUZ K;  4DFK A;  5IWA K;  2FBV A;  1H1V A;  2QEX N;  3LZJ A;  4IO9 L;  3OY9 A;  2P9I B;  3ULD A;  1NLV A;  2Z1I A;  2HNZ A;  3MED A;  2ZJQ L;  1ATS A;  2E2O A;  3DOK A;  4JI2 K;  4DTM A;  3VQ7 A;  3QIC A;  1YIT N;  3OYJ A;  1DTQ A;  4PQU A;  3U8X A;  5HRR A;  4CEC A;  4DV2 K;  3NGY A;  4YNQ A;  3SNN A;  2QWR A;  3QB0 A;  3C6U A;  4JKD A;  4CHN A;  3LP2 A;  3VQ8 A;  4WFN L;  3SQ1 A;  4CBX A;  3CC7 N;  5GAD P;  1U2V B;  4KH5 A;  3KLG A;  3NDK A;  4B9V A;  4HCB A;  4DFJ A;  3K59 A;  5I9E B;  4LFA K;  4NYF A;  2F96 A;  1WAF A;  3OA9 A;  5T7B A;  4DSJ A;  5AQP A;  4KTW A;  1EP4 A;  1RFQ A;  3DRS A;  4FJ7 A;  2RE2 A;  3V81 A;  1L3V A;  4Q0B A;  3VQC A;  4DV7 K;  3SPY A;  3A0I X;  3VA0 A;  4JKH A;  3NF7 A;  3K58 A;  4N56 A;  4WQ4 A;  2WUS A;  1RBV A;  1SZ2 A;  3WEE B;  3D2F A;  3A5N C;  4CZK A;  4DQR A;  1CZ9 A;  1JXE A;  4DSL A;  1HRH A;  3TTC A;  3EZW A;  1IBL K;  3AVH A;  2E6M A;  1SS6 A;  1HNZ K;  4FWQ A;  5EU7 A;  4N5S A;  3AY9 A;  4JS5 A;  1S3X A;  1N6Q A;  2GTD A;  1NGF A;  2RF2 A;  3QDK A;  2P9L B;  4FM2 A;  3IAY A;  2P9K A;  3EKS A;  3ITH A;  1NJZ A;  4CJF A;  3DWL A;  2QW9 A;  4DU4 A;  3ZT1 A;  5AQX A;  1EQY A;  3H3N O;  3NF8 A;  4ILH A;  2PZS A;  1QVF M;  1V4S A;  1GLF O;  3TSQ A;  3QEP A;  4PUO A;  4AM7 A;  4MLE A;  5FPD A; 
#chains in the Genus database with same CATH homology
 5FRO A;  2PYL A;  4ZHR A;  3AVJ A;  4DSE A;  3QNO A;  3PY8 A;  4CF2 A;  2OA8 A;  3L2Q A;  1C0M A;  4CFC A;  1GOB A;  4DQS A;  1X9M A;  3SQ0 A;  2D0A A;  4F4K A;  4BWJ A;  4BWM A;  1Q9Y A;  4FK4 A;  4CEO A;  3HXM A;  4Z0U A;  4FZX C;  3DI6 A;  4DFM A;  4H4M A;  4CJ5 A;  1D9F A;  4N41 A;  3AA2 A;  2ITG A;  3L2U A;  4ZTF A;  3RTV A;  3PO5 A;  4Z4E A;  2VG5 A;  4NCG A;  4B3O A;  1HYZ A;  4M3Z A;  4DQI A;  1LWC A;  4BE1 A;  3TAE A;  3S3M A;  3ZT0 A;  3NCI A;  1MU2 A;  3AA5 X;  1NKB A;  1CXQ A;  3SUO A;  2PYJ A;  3RWU A;  3DLE A;  2E6L A;  2HHV A;  4CEZ A;  1SKS A;  4M3Y A;  1BGX T;  4FVM A;  3TAM A;  4KHY A;  3OVN A;  4RW8 A;  1EXQ A;  5KRS A;  3AVG A;  1BQN A;  3NAE A;  3ZSR A;  4HCC A;  2QKB A;  1TK0 A;  1FXX A;  1WNS A;  1RT3 A;  4CGI A;  1RTI A;  4IDK A;  4ELV A;  1TVR A;  4FYD A;  1C6V A;  1WSG A;  4M3R A;  1NOY A;  1XI1 A;  1NJW A;  4AHC A;  1TK5 A;  2KQ2 A;  1A5X A;  4E0D A;  5FRN A;  3JYT A;  1W9H A;  1YT3 A;  4HUF A;  4CED A;  3L2V A;  3LP3 A;  4IFV A;  1QS4 A;  2PY5 A;  1EET A;  1O1W A;  2JLE A;  4Y1C A;  2OPP A;  3HPH A;  3ZT4 A;  3V9W A;  1SKW A;  2QKK A;  5KGW A;  1HYS A;  2DY4 A;  1TKZ A;  3DLB A;  4H4O A;  1I39 A;  4C8K A;  3CQ8 A;  1JLC A;  4FJ5 A;  3KLI A;  2B5J A;  5JS1 A;  2Z1H A;  3DLG A;  3QNN A;  3RMB A;  3BDP A;  3K5M A;  3LPT A;  4RG8 A;  4J2E A;  3TAB A;  2ZE2 A;  4CJQ A;  1TGO A;  1VSL A;  3WNE A;  3AVN A;  3OYE A;  1L3U A;  2B4J A;  4W5O A;  3KK2 A;  4LH5 A;  1VSD A;  4R5P A;  1WSJ A;  3SUP A;  1ZYQ A;  2IC3 A;  5E41 A;  3KK1 A;  1X9W A;  1T05 A;  4F3T A;  3LZI A;  4GVM A;  4E7L A;  4OKK A;  3ZT3 A;  3ASM A;  3QIO A;  1JXB A;  1W0H A;  4LH4 A;  3LWL A;  1C0T A;  3S3N A;  4AIL C;  3LAM A;  4CHO A;  3SUQ A;  3G0Z A;  3C95 A;  1EX4 A;  1RBT A;  4HVJ A;  3OS1 A;  3OYG A;  3M8R A;  1UAX A;  3AO3 A;  1JL1 A;  4TSX A;  1JLQ A;  3OYM A;  4FM1 A;  4LY7 A;  4CF8 A;  4CER A;  4E7J A;  3QEX A;  3PX0 A;  2YV0 X;  4KFB A;  4LD0 A;  2O4G A;  4CJK A;  4EZ6 A;  1IKV A;  3CFO A;  3TAP A;  3RR7 A;  2EX3 A;  3NF6 A;  1S1T A;  3NGI A;  4CEQ A;  4Z4I A;  3HO1 A;  2HHW A;  1RBR A;  4AHV A;  4DSI A;  4BE0 A;  3VQ5 A;  3SPZ A;  2Y1I A;  1A5V A;  4DS5 A;  1BI4 A;  1JLE A;  3NHG A;  1NK7 A;  4ICL A;  3JSM A;  1UA1 A;  1TV6 A;  4CES A;  3OYB A;  2FBX A;  2YKM A;  2BDP A;  1ASW A;  4B9L A;  1TK8 A;  2E4L A;  3DRR A;  3L8B A;  2R7Y A;  3AO5 A;  3I0S A;  4DG1 A;  5C25 A;  1TKX A;  3SI6 A;  4M45 A;  1LW0 A;  4O55 A;  3I0R A;  4CJ3 A;  3M8S A;  4E89 A;  3RRG A;  1X1P A;  1TKT A;  1Q8I A;  1RT4 A;  3A2F A;  4ID1 A;  4O44 A;  4M41 A;  3HP6 A;  3PV8 A;  2A1R A;  3NBP A;  4DTX A;  4PWD A;  4DTR A;  1NK5 A;  2O4I A;  2HHT A;  3L3V A;  1ITG A;  3BGR A;  3DM2 A;  4ZTJ A;  1XHX A;  3NFA A;  4CGF A;  3KLF A;  1REV A;  1ZBL A;  2ETJ A;  3CG7 A;  4N47 A;  4KHU A;  1KLM A;  5SZT A;  1KVB A;  1BCO A;  3AVC A;  4KI6 A;  4M3X A;  4DTS A;  4DF8 A;  3RMA A;  1S1X A;  1QE1 A;  3QER A;  3TAN A;  1NK9 A;  1KCF A;  1WSH A;  1RDC A;  4W5T A;  3QET A;  4IFY A;  4RW7 A;  2KFN A;  1SV5 A;  1WLJ A;  5CYQ A;  4KTZ A;  3T1A A;  4CEF A;  3O3F A;  2Q3S A;  2P5O A;  4W5Q A;  3TI0 A;  1I3A A;  4DLG A;  4FZY A;  4M3U A;  3PX4 A;  3CM5 A;  2IOC A;  2DFE A;  5DK5 A;  1J9A A;  4CF9 A;  3UIQ A;  1RTJ A;  3MXJ A;  3OYF A;  3T19 A;  4CEE A;  4QCL A;  1SL1 A;  4CJP A;  4IBN A;  2IAJ A;  1RIL A;  4JRP A;  2YHB A;  4KAZ A;  2ZQB A;  1RTH A;  1NJY A;  4WE1 A;  4IKF A;  2HND A;  1BL3 A;  1S1V A;  3V1R A;  4FCY A;  1N5Y A;  3KD5 E;  3U3G A;  1SL2 A;  2QXF A;  1Y97 A;  2KFZ A;  1VRT A;  4FLY A;  2VG7 A;  3AO4 A;  4OLA A;  1S1W A;  4AHU A;  2G8V A;  2X78 A;  4FJ8 A;  5KI6 A;  5HLF A;  4OGC A;  3HM9 A;  3S3O A;  3SYZ A;  1WSE A;  5J2Q A;  3SQ4 A;  3HST B;  4OGE A;  1LAV A;  3NE6 A;  3AVK A;  1BHL A;  1TKD A;  3O4Q A;  4H8K A;  4F3O A;  2RKI A;  4FLZ A;  4DMN A;  4FK2 A;  4FZZ A;  1U47 A;  5HRS A;  1KRP A;  3HVR A;  4W5N A;  4EP4 A;  2XO7 A;  1WSI A;  1VSK A;  1ASV A;  4NYN A;  2ZD1 A;  2XY6 A;  2YKN A;  5FRM A;  1TL3 A;  3SZ2 A;  4I2Q A;  2IGI A;  3K57 A;  3PO4 A;  2OZM A;  4E1N A;  1IH7 A;  4MQ3 A;  4CK2 A;  1LAW A;  4FLW A;  1CZB A;  5J2M A;  1G15 A;  1RT6 A;  4FW2 A;  3V6D A;  3SQ2 A;  1D5A A;  1VRU A;  1IO2 A;  4CGJ A;  1FK9 A;  3ZCM A;  2F8T A;  1X9S A;  2QK9 A;  3K2P A;  4KO0 A;  3K5N A;  3KD1 E;  3IS9 A;  3HP9 A;  1SUQ A;  2HHQ A;  3AA3 A;  3WNF A;  3IG1 A;  1JL2 A;  1BIS A;  1VSM A;  4AHR A;  3P1G A;  1YVU A;  1CXU A;  3O4N A;  5HBM A;  2XY8 A;  4B9N A;  4B08 A;  1R0A A;  1KFS A;  3VQ6 A;  3AVB A;  3VN5 A;  4DFP A;  1F21 A;  5CZ2 A;  4HUG A;  1QSY A;  3QIP A;  1FKO A;  3B6P A;  4FJI A;  2DFF A;  3OS0 A;  1HNI A;  3HYF A;  4DU1 A;  3P83 D;  3TAF A;  4DQQ A;  1XC9 A;  3CFP A;  4M3W A;  1S9E A;  3EZ5 A;  4PY5 A;  1CLQ A;  2Z1G A;  3V9X A;  4DWI A;  1K6Y A;  1T03 A;  1S6P A;  1RDA A;  1BIZ A;  4Q5V A;  4QOZ B;  4KI4 A;  1RT5 A;  3D45 A;  5HRP A;  1U48 A;  3OYL A;  4NCB A;  1YTA A;  3OYN A;  2XRI A;  1BIU A;  1RBS A;  3E01 A;  3VQ4 A;  3VQ9 A;  4DLE A;  4DS4 A;  3QEV A;  4OLB A;  2HB5 A;  2IDO A;  1Z25 A;  3QLH A;  4CIE A;  2RN2 A;  2D0B A;  1J5O A;  2WOM A;  2G8W A;  3IRX A;  3T3F A;  4FLV A;  5KGX A;  1UA0 A;  1VSI A;  2G8H A;  2IS3 A;  4C8O A;  1QQC A;  3DMJ A;  1J53 A;  1UWB A;  5K14 A;  1RDD A;  4FJG A;  1HQE A;  4CJW A;  2W42 A;  3KTQ A;  5HRN A;  4CJR A;  3OYH A;  4E7I A;  3NH0 A;  4IG3 A;  1KTQ A;  4EP5 A;  4CJ4 A;  3O3H A;  4E7K A;  4FJH A;  3CFR A;  3TAQ A;  2OYQ A;  4FXD A;  1WN7 A;  1U4B A;  4FJN A;  1JLA A;  2RPI A;  1UOC A;  4CF1 A;  4CJE A;  2HHU A;  2D0C A;  1C0U A;  3P5J A;  3SV4 A;  4CGD A;  2LSN A;  3V9U A;  3RRH A;  4FW1 A;  1NKC A;  2G8F A;  4KPY A;  2VWJ A;  4FJX A;  1J54 A;  3V9Z A;  1TL1 A;  5CZ1 A;  2XY5 A;  3VQB A;  5KRT A;  2DFH A;  4BE2 A;  2G8I A;  3AO1 A;  4J2D A;  3ISN C;  1A5W A;  1U04 A;  4RW9 A;  4XIU A;  4B9U A;  1RT2 A;  2F8S A;  2VWK A;  4OVL A;  4E19 A;  1JKH A;  3L2W A;  2HHS A;  1GOC A;  3HJF A;  1VSE A;  4C8M A;  3HPG A;  3OYA A;  5FDL A;  2P51 A;  1KVA A;  4CJT A;  2OZS A;  4KHQ A;  4CFA A;  3TAR A;  4Z4C A;  4C8N A;  3VQE A;  2FBT A;  1QSS A;  3K5O A;  3CYM A;  4F8R A;  4KRE A;  2YNH A;  1SL0 A;  4O5B A;  5CYM A;  1L5U A;  1WSF A;  4I2P A;  4HTU A;  4DTO A;  1RTD A;  1Z26 A;  1TAQ A;  4LSL A;  4AHT A;  1NK4 A;  4FJM A;  2X6N A;  4CJV A;  4CHQ A;  4CIF A;  4C8L A;  1ZBI A;  3S9H A;  1U49 A;  3DOL A;  1C1B A;  3THV A;  4KB0 A;  2BGG A;  2X6S A;  2YNI A;  3AVA A;  5DMR A;  1T7P A;  1BQM A;  3DLH A;  1EKE A;  3I8D A;  4NCA A;  3AVF A;  3LP1 A;  4CHZ A;  3HT3 A;  1NK6 A;  4I9L A;  3V4I A;  4K8X A;  3TWH A;  3L3U A;  4M3T A;  4Z4H A;  3MAQ A;  4DF4 A;  3PUF A;  3VQA A;  2OPR A;  2XY7 A;  5HRO A;  2DTU A;  1JLG A;  4DQP A;  4OKE A;  4MFB A;  4CHY A;  4DTJ A;  3AVL A;  1YTU A;  4DSF A;  3MEG A;  4CHP A;  1HJR A;  4KV8 A;  4OKJ A;  5J2P A;  4O4G A;  2GBZ A;  4CK3 A;  3NH2 A;  1HPZ A;  3C94 A;  3V9S A;  1KLN A;  4CEA A;  2P5G A;  3SJJ A;  1C1A A;  1Q9X A;  2Y1J A;  3VQQ A;  2HVI A;  4OPJ A;  3QES A;  3EY1 A;  2HVH A;  1LW2 A;  3B6O A;  3L2R A;  1KFD A;  1DTT A;  3M8P A;  3RR8 A;  4B9S A;  3DRP A;  4HHT A;  1XHZ A;  3OYC A;  1HQU A;  5HP1 A;  5KTQ A;  4CE9 A;  3HVT A;  3V1O A;  3HK2 A;  1S9G A;  1BCM A;  5J2N A;  4OJR A;  3AVM A;  4W5R A;  1ZBU A;  2KZZ A;  1S1U A;  3CM6 A;  3F9K A;  3DLR A;  3ZSW A;  4CFB A;  3HL8 A;  4E1M A;  5C42 A;  3KLE A;  3SUN A;  1KSP A;  2JGU A;  2KTQ A;  3LWM A;  4DU3 A;  3QIN A;  3VQD A;  3MXI A;  1LV5 A;  4QAG A;  1B92 A;  4ELU A;  3NH1 A;  4CJL A;  1HNV A;  3OJU A;  2WON A;  3QEI A;  2OPQ A;  4G1Q A;  3AO2 A;  3ZT2 A;  3O3G A;  1NK0 A;  1RDB A;  4DFK A;  4J2A A;  4ID5 A;  2FBV A;  1IKX A;  3SCX A;  1U45 A;  2XHB A;  3LZJ A;  3OYI A;  3AV9 A;  3DYA A;  1C1C A;  1B9F A;  1ZBH A;  3F73 A;  4JLH A;  3OY9 A;  4PA1 A;  4I7F A;  4FK0 A;  3MEE A;  4Z4G A;  2BE2 A;  3ZSX A;  3ULD A;  3OS2 A;  2KZM A;  1NKE A;  4BDZ A;  2Z1I A;  5CY4 A;  4K8Z A;  4B8C A;  2HNZ A;  3MED A;  3MEC A;  4CK1 A;  3LDS A;  1L3T A;  2Z1J A;  3DLK A;  3ZSQ A;  4CJU A;  4FJK A;  4KHS A;  4CF0 A;  4GMJ B;  3OYK A;  5SWM A;  3DOK A;  1NK8 A;  4I9Q A;  4Z4F A;  4CJS A;  3NGZ A;  1RBU A;  3V1Q A;  3D0P A;  3VQ7 A;  1ZBF A;  1JLB A;  4DTM A;  1NJX A;  4BDP A;  3KIO A;  4GW6 A;  4DTN A;  3SV3 A;  2NUB A;  3K5L A;  3LAL A;  3MXM A;  3OYJ A;  1DTQ A;  4KHN A;  4PQU A;  5HRR A;  1RT1 A;  4UQG A;  1D9D A;  3U6F A;  1VK0 A;  4BDY A;  4CEC A;  1XWL A;  3H08 A;  5C24 A;  2HNY A;  3NGY A;  4AH9 A;  4YNQ A;  3KK3 A;  3PX6 A;  3SNN A;  3C6U A;  4CHN A;  3WNH A;  3LP2 A;  1GOA A;  1IG9 A;  2EHG A;  1LWF A;  4CEB A;  3VQ8 A;  2OPS A;  1RNH A;  3VA3 A;  3AA4 A;  4E7H A;  3SQ1 A;  4CCH A;  4E3S A;  2HW3 A;  4JS4 A;  5JS2 A;  4L8R B;  3OJS A;  2KW4 A;  3KLG A;  3NDK A;  1L3S A;  4B9V A;  4KRF A;  4KKO A;  4LSN A;  3LAN A;  1TAU A;  3ZSV A;  3EYZ A;  3TR8 A;  1T8E A;  4HCB A;  2BAN A;  2YHA A;  1RT7 A;  4DTU A;  4M42 A;  2FBY A;  3KLH A;  1NOZ A;  4DFJ A;  3K59 A;  4DTP A;  3ZSY A;  3RMC A;  4J2B A;  2B6A A;  2D5R A;  3KJV A;  4N76 A;  4NYF A;  4FJL A;  2GV9 A;  2F96 A;  1WAF A;  1HYV A;  1ASU A;  5T7B A;  1B9D A;  3QO9 A;  4DSJ A;  3OYD A;  1VSF A;  3TAG A;  1S6Q A;  4KTW A;  4Y1D A;  1EP4 A;  3VQP A;  1QTM A;  2G8K A;  2FC0 A;  1FKP A;  4F2R A;  3DRS A;  3ZSO A;  2VG6 A;  3G10 A;  3HPO A;  1RCH A;  4FJ7 A;  3FFI A;  3QEW A;  1JLF A;  2YNG A;  3ZSZ A;  3V81 A;  1L3V A;  4KTQ A;  4Q0B A;  2HHX A;  4CFD A;  4FJJ A;  4IG0 A;  3M8Q A;  3VQC A;  4YFU A;  5I42 A;  1WAJ A;  4HUE A;  3SPY A;  3VA0 A;  4RW4 A;  3NF7 A;  3WNG A;  3K58 A;  4N56 A;  3KKR A;  2G8U A;  3RMD A;  1RBV A;  2AJQ A;  2X74 A;  1BI4 B;  4DQR A;  1CZ9 A;  1IKY A;  1IKW A;  2A1S A;  4BAC A;  1QHT A;  1VSJ A;  4KHW A;  1JXE A;  1VSH A;  4O0J A;  4CGG A;  4DSL A;  3LP0 A;  5D3G A;  1HRH A;  4CIG A;  4FM0 A;  4DSK A;  5I3U A;  1S5J A;  4AHS A;  3AVH A;  2E6M A;  3U3Y A;  3NF9 A;  4OPK A;  5EU7 A;  2HMI A;  4N5S A;  4JS5 A;  4B9T A;  1N6Q A;  2RF2 A;  4B9M A;  4FLX A;  4FM2 A;  3AVI A;  1KVC A;  3ALY A;  3IAY A;  1HMV A;  1LWE A;  3C6T A;  3LAK A;  4O0I A;  4F2S A;  4KB1 A;  4FJ9 A;  5J1E A;  3ITH A;  4RW6 A;  4FLU A;  4CJF A;  1NJZ A;  1SKR A;  2ATQ A;  2YNF A;  4B8A B;  3LPU A;  4CGH A;  4DU4 A;  3ZT1 A;  2PZS A;  3NF8 A;  4EZ9 A;  1D8Y A;  1DLO A;  2GUI A;  3KKS A;  1QSL A;  3QEP A;  4PUO A;  2P1J A;  4FLT A;  2I5J A;  4ELT A;  4JRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...