3NH2A

Crystal structure of rnase t in complex with a stem dna with a 3' overhang
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
207
structure length
202
Chain Sequence
GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 62
structure length 202
sequence length 207
chains with identical sequence B, E, F
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh2A00
3RRHA 1TKXA 1U47A 2YNIA 4C8NA 4B08A 3QLHA 1WSJA 3AA4A 4CEFA 4B8AB 4EP5A 4IFYA 2LSNA 1WN7A 1W9HA 4Q5VA 1VSMA 4CF8A 3SQ1A 2XO7A 5KTQA 3TAPA 1CZ9A 1TKTA 4LSLA 1FK9A 2HNYA 3CM6A 4JRQA 3D45A 1C0UA 4DFMA 1RBTA 1X9MA 4ZHRA 1IKXA 4C8MA 3AO3A 1DTQA 2B5JA 5CZ1A 4B9NA 3RMCA 1T03A 4F8RA 4QOZB 1TAUA 4Z4IA 2P5GA 4JLHA 4CEEA 1QQCA 3G0ZA 3OYCA 1IH7A 1QTMA 1BCOA 2YNHA 4FK2A 5HRPA 4K8ZA 1D5AA 4DF8A 3AVCA 3KKSA 1REVA 1B9DA 2KW4A 3CFPA 3DLHA 3L8BA 1UOCA 4KHUA 2E4LA 3NF7A 4CHNA 3EYZA 3VA0A 3BDPA 2YKNA 3DYAA 3V1QA 3ZT0A 4M3RA 1ZBIA 3V81A 4FXDA 2Z1JA 3EY1A 3DLGA 3TAMA 4CJPA 4FW1A 4DTPA 1G15A 3QNOA 3ZT1A 2AJQA 1HYSA 1VSHA 2RPIA 3KLHA 1JLQA 4DQPA 3OYAA 1A5XA 1YT3A 3ZSRA 3NE6A 2Y1IA 1NOYA 4DSFA 2PYLA 2HHWA 3L2UA 3AVAA 4DTUA 3CFRA 3AVGA 1QHTA 4HCBA 3SNNA 4EP4A 3K5OA 1JXEA 3K58A 3QO9A 3AVLA 1BIZA 4CEQA 3TI0A 3AVHA 4W5TA 3OYHA 3KK1A 3ZT4A 4Z0UA 5J2NA 3UIQA 4W5NA 2VWKA 2VG6A 4KHYA 1T8EA 4GW6A 3KD5E 1TK8A 3OYKA 4FLWA 4DFKA 1L3SA 1RBVA 4CJEA 5FRNA 1C1CA 2A1SA 4E7HA 3OJSA 4FM1A 3DI6A 4FJXA 4H4OA 1WSHA 3O3GA 4FJ8A 3QINA 1U04A 2YKMA 3BGRA 1DLOA 1GOCA 3S3MA 1U45A 4JRPA 2I5JA 1SV5A 2YNGA 3AO4A 3AVNA 3DLKA 4RW4A 4IFVA 4E7JA 4DU1A 1LWFA 1Q9YA 2QK9A 4FYDA 4RW6A 2X6SA 3SV4A 3T3FA 3TAFA 3WNGA 3VQ9A 4DSLA 1VRUA 4DF4A 3H08A 3DLRA 3V1OA 4B9SA 1B9FA 3V9SA 4F3TA 2HHVA 4CECA 2HNZA 3OS1A 5C25A 4OGEA 5DK5A 3AO2A 1XWLA 4KTQA 3AVIA 1C1AA 1JL1A 4BDYA 3LANA 2OZSA 5C24A 3LP2A 4TSXA 4DTOA 4WE1A 4IBNA 4CHQA 4CJKA 4DQRA 4KI4A 1HPZA 4FM0A 3QETA 4CFAA 4YFUA 3TABA 5JS2A 3AVBA 1S5JA 4Z4HA 3LDSA 3ZSQA 4DWIA 4Q0BA 2F96A 3K5LA 3HO1A 3A2FA 1N6QA 1DTTA 4O0IA 1VSJA 1R0AA 4PQUA 2EX3A 4E1MA 3MAQA 4I9QA 4OVLA 2BDPA 1NK7A 2Z1GA 3NFAA 4EZ6A 4KREA 2E6MA 3O4QA 3P5JA 5E41A 1ZYQA 4LD0A 4AHRA 3OYMA 5J1EA 4FJJA 1WSGA 2G8KA 4CEDA 2HW3A 4FLYA 4KRFA 1IG9A 3FFIA 4IG0A 3OYNA 3V9WA 1JXBA 2OPSA 1KFSA 2OPRA 4KKOA 1C1BA 2QKKA 1ASVA 4OPJA 3U3GA 4CE9A 1ASWA 1SL0A 1HJRA 1RBRA 4CJFA 3QEPA 1EX4A 1TKDA 4E19A 4DU3A 2F8TA 2A1RA 1UAXA 4NCGA 4HUGA 4ELTA 4M3WA 5HP1A 2GV9A 3VQEA 4RW9A 2HHQA 1CLQA 5KRSA 5J2QA 2HHSA 3VQBA 1JLCA 3C95A 3E01A 2PYJA 4E7IA 1S1UA 3B6OA 1B92A 1SKRA 4Z4GA 1A5WA 4AHUA 3K5MA 4OLAA 1D9DA 5CYMA 1KSPA 4F3OA 1MU2A 1RDBA 4M45A 2YHBA 4DSEA 3U6FA 4N41A 4E89A 2G8HA 1HYZA 3P83D 3AA3A 4MQ3A 4C8LA 4KTWA 4LH5A 5HRSA 5C42A 2DFHA 3NHGA 4BDZA 2DY4A 4HHTA 3DOKA 2B6AA 3M8QA 4OJRA 3PY8A 4CJRA 1TKZA 1X9WA 3KTQA 2P1JA 4J2AA 1RNHA 1BI4B 1BISA 3SJJA 1SKSA 1NJXA 2BANA 4OKJA 4AHVA 4KAZA 1JLGA 3KIOA 1X9SA 1KLNA 4FJ5A 4CF0A 2PZSA 2RN2A 3CQ8A 3MXIA 3IAYA 1S1XA 2G8FA 1VSKA 1EP4A 2DFFA 4FLZA 1NK5A 1IKVA 3VQ6A 4J2EA 3SQ4A 2WOMA 4KHNA 3DM2A 1KRPA 2D0AA 3ZSYA 3LAMA 1KTQA 2DTUA 1U48A 4HCCA 4NCAA 4JS5A 3ZSOA 1TL1A 1UA0A 4RG8A 1L3UA 3QEVA 3MECA 4Y1CA 3SUNA 1XHZA 1NOZA 4CK1A 1NJYA 1L5UA 3HJFA 1NK9A 3ZCMA 3L2RA 1J53A 2HMIA 1RT7A 4DLEA 3TARA 4CFDA 4E7LA 3ITHA 3KD1E 4CFCA 1S6QA 5SWMA 1D9FA 1ZBLA 1RT4A 2KQ2A 4CJLA 4AHTA 4FVMA 4CJ3A 3OVNA 1ASUA 1J9AA 1RT5A 3SPYA 3CG7A 4QCLA 4PA1A 3ALYA 4CEZA 2G8UA 3PX4A 4BWMA 1BIUA 3CFOA 4CEBA 2HNDA 1QS4A 4O0JA 4KV8A 4CGHA 1X1PA 1LW0A 4PWDA 3U3YA 2P51A 3S9HA 4CEAA 1Q9XA 3QEXA 1BQNA 4MFBA 1FKOA 1SKWA 1CXUA 1GOAA 5HRRA 5J2MA 3QEWA 4ZTFA 3ZSVA 4FLVA 3QIPA 3M8RA 4FJHA 4AHCA 4ELUA 2VWJA 5KGXA 3NCIA 3O3FA 2IS3A 1A5VA 1JKHA 3PV8A 3SZ2A 4DS5A 3V9XA 1UWBA 3P1GA 4CJSA 5HROA 3IG1A 3O4NA 4N76A 4AHSA 2Y1JA 1WSIA 3NH0A 3RWUA 4DSKA 4CERA 3KK3A 1J5OA 5D3GA 4FJIA 4BE0A 4CJQA 1XC9A 4F2SA 4G1QA 3AO5A 3AVFA 2D0CA 4O55A 2ATQA 5KI6A 3LAKA 4RW8A 3OYFA 1SL2A 1LWEA 4B9MA 1T05A 1KFDA 4OPKA 4CGIA 4Z4CA 4LSNA 4BE2A 4IKFA 1NJZA 4FJLA 1RDCA 3HVTA 4CGFA 2FBTA 3KLFA 4R5PA 4GVMA 4M3XA 4M41A 4HUEA 2HVHA 4KHSA 3AO1A 1LV5A 3HPHA 1C6VA 1JLEA 5I3UA 4DMNA 4H8KA 2HHUA 2O4IA 3IS9A 2KFNA 3DMJA 4DLGA 2GUIA 3HM9A 1NK4A 4EZ9A 3DRSA 3F9KA 4KTZA 4CF2A 4XIUA 1IKWA 4CFBA 2X6NA 3ZT3A 3SUOA 3HL8A 3HYFA 2XHBA 4JS4A 4W5OA 3RRGA 4CHPA 4FJKA 4DQIA 1RT2A 1K6YA 2RF2A 1XI1A 3V9ZA 3TAQA 2XY7A 3DOLA 3K2PA 2KZMA 4B3OA 5HLFA 2IOCA 2BGGA 4B8CA 2PY5A 4KO0A 4E7KA 1N5YA 1W0HA 2X74A 4HUFA 3DRRA 4B9TA 3C6UA 5KRTA 1LWCA 3TANA 5HBMA 2HB5A 3SI6A 1YTAA 1T7PA 1RTJA 2QKBA 2HHXA 1NK8A 1HRHA 1RDDA 4CGDA 4W5QA 5JS1A 2FC0A 4ID1A 1LW2A 1RT3A 3CM5A 3NGYA 4CGJA 3ULDA 1EXQA 3K57A 3QIOA 3VQCA 3JYTA 4FJ7A 4Z4FA 1BGXT 1YVUA 3PX6A 4FZYA 4OGCA 3K5NA 4FJNA 2F8SA 3DLBA 4O44A 4CF1A 3D0PA 2X78A 3OY9A 3L3VA 3RR8A 4AILC 3M8PA 1NKEA 4DTJA 3AVJA 3O3HA 3L2QA 3NGZA 4FM2A 3V6DA 2O4GA 1KLMA 2EHGA 3VQPA 3QNNA 1GOBA 1S1TA 4YNQA 3M8SA 4OKEA 3G10A 4CIGA 4CHYA 2JGUA 3I8DA 5DMRA 3LZJA 1VSDA 1Q8IA 1RILA 3L2WA 4IDKA 1RDAA 1U4BA 4KPYA 2YV0X 3NF6A 1HQEA 1TK5A 3NH2A 4O4GA 1LAWA 2OZMA 4NCBA 4KI6A 1KVBA 4UQGA 3OYEA 1HMVA 2DFEA 4DTMA 4CK3A 1Z25A 3RR7A 3OS2A 4FW2A 4ICLA 3KK2A 4FLTA 3LPUA 3K59A 1QSYA 1F21A 1RTHA 2XRIA 3T1AA 3HPGA 2E6LA 1YTUA 1VSLA 1CZBA 4PUOA 2VG7A 3WNHA 4Z4EA 3OYJA 3NDKA 1BHLA 4CHOA 1C0MA 4N5SA 1S1WA 1NK0A 4I2QA 4FK0A 4DTNA 4DQSA 4CIEA 4ZTJA 4I2PA 1VSIA 2YNFA 1WLJA 3IRXA 3LALA 3NF8A 3ZT2A 4E1NA 3OJUA 3NGIA 1C0TA 1NKCA 1QE1A 1TVRA 3OS0A 2D5RA 4DFJA 3C94A 1EETA 5FRMA 4L8RB 1S9EA 4CEOA 3ASMA 3EZ5A 5I42A 4ID5A 3NBPA 1KVAA 1RBUA 4HTUA 3V9UA 3SQ0A 4ELVA 2KTQA 2G8VA 3HP9A 3F73A 1HNIA 1LAVA 3LP0A 4CJUA 4B9LA 4DSJA 3SV3A 3S3NA 1NJWA 3WNEA 3OYBA 4BWJA 1Y97A 1HYVA 3MEGA 4DTSA 4E3SA 4CJVA 4Y1DA 5HRNA 3AA5X 2FBYA 3SQ2A 3SPZA 1TK0A 2W42A 3SUQA 3AVKA 2IC3A 3HVRA 3PX0A 2BE2A 2OYQA 2ETJA 4CK2A 1BCMA 5CZ2A 4CJ5A 4CJ4A 3VQ8A 2B4JA 1J54A 1RBSA 4BACA 1EKEA 5CYQA 3RMDA 1QSLA 4E0DA 4KB0A 3I0RA 3LP3A 1JLBA 4NYNA 2NUBA 2XY8A 4KHWA 1HNVA 3HT3A 3OYLA 1S9GA 3HXMA 1O1WA 3VQ7A 3PUFA 3JSMA 4M3UA 1IO2A 1VRTA 3KLGA 3KLIA 4FJMA 3B6PA 3HSTB 2KZZA 3HP6A 2KFZA 1FKPA 4FJGA 4M3ZA 3ZSZA 1Z26A 4KFBA 1I39A 5T7BA 2IAJA 1TGOA 2OPPA 2D0BA 1WSEA 4KHQA 1BQMA 4W5RA 4B9VA 5K14A 2IDOA 4FLXA 4I9LA 1JLAA 1ITGA 1ZBFA 4RW7A 4J2DA 4OKKA 1I3AA 3MXJA 3VQ4A 4AH9A 4CJWA 1JL2A 3VA3A 2YHAA 3RTVA 4H4MA 5FDLA 3I0SA 3HPOA 3NH1A 3AV9A 4HVJA 4PY5A 1VSEA 4CHZA 4CIFA 4DTXA 3TAEA 3LWLA 1ZBUA 3DRPA 1SL1A 3THVA 3KKRA 2GBZA 3VQQA 3TWHA 3TAGA 4M3TA 4FJ9A 5KGWA 4DQQA 1VK0A 1WAJA 1IKYA 3V1RA 4BE1A 3SUPA 3RMAA 2ITGA 5CY4A 1TV6A 1QSSA 2HHTA 2XY6A 1L3VA 1WNSA 2VG5A 2WONA 4CF9A 3HK2A 1RTDA 4M42A 2ZE2A 1NK6A 2OA8A 1RTIA 4IG3A 2OPQA 4GMJB 3PO4A 1HQUA 3L2VA 3QEIA 4M3YA 3VN5A 4CJTA 1WSFA 3VQ5A 4F4KA 4LY7A 3NF9A 3KLEA 2R7YA 3MXMA 3ZSWA 1D8YA 4FZXC 4LH4A 2P5OA 3OYIA 4FLUA 1UA1A 3SYZA 4FK4A 4CCHA 1L3TA 3AA2A 4K8XA 3MEEA 3RMBA 5FROA 4B9UA 4DSIA 3L3UA 3OYGA 3KJVA 1ZBHA 1TAQA 3LP1A 2XY5A 4O5BA 3T19A 4OLBA 1RCHA 5SZTA 2FBXA 3WNFA 3VQAA 4F2RA 3LZIA 1U49A 3C6TA 3LPTA 4QAGA 1XHXA 2ZD1A 2RKIA 4I7FA 3SCXA 4BDPA 4J2BA 3QESA 3DLEA 3VQDA 5EU7A 1SUQA 1CXQA 3NAEA 3S3OA 1VSFA 3CYMA 2G8WA 2IGIA 1TL3A 4FZZA 2FBVA 1S1VA 4NYFA 2QXFA 4C8OA 4KB1A 1RT6A 3MEDA 5J2PA 3AVMA 4DFPA 1RT1A 3V4IA 1FXXA 3ISNC 3QERA 4CGGA 4N56A 4N47A 2ZQBA 1S6PA 3LWMA 1NKBA 1BL3A 4FCYA 3PO5A 3TR8A 1KVCA 3ZSXA 4CESA 1JLFA 4DG1A 3OYDA 2Z1IA 2HVIA 1BI4A 1KCFA 4C8KA 2G8IA 1WAFA 2Q3SA 4DS4A 4DTRA 4DU4A 2JLEA 2Z1HA
chains in the Genus database with same CATH superfamily
1TKXA 3EO3A 4C1NI 5EX5A 3QLHA 1WSJA 3AA4A 4B8AB 4IFYA 1WN7A 1W9HA 4H0OA 2HNYA 3AAQA 4JRQA 3D45A 2QWMA 1OH5A 4DFMA 2A40A 2HBKA 3LL3A 1X9MA 1QVFM 4CZFA 1T3VA 2CGLA 3LDQA 4IFEA 4WFNL 4B9NA 1XNRK 4QOZB 4Z4IA 2P5GA 1IH7A 2YNHA 1E4GT 5HRPA 4X65K 1KAXA 4K8ZA 3AVCA 1REVA 3C7NB 4K41A 5AZIB 3L8BA 2QXLA 3W0LA 3EYZA 2YKNA 3DLGA 4FW1A 4O5FA 1G15A 1RFQA 2P9UA 2GELA 5AQNA 1JLQA 1YT3A 3CJ1A 4DSFA 3CFRA 3SNNA 4EP4A 3K5OA 3QO9A 1U6ZA 2FXUA 4A2AA 4WYBA 3CJ9A 3AVHA 2P9SA 4WFBL 3KK1A 5J2NA 2BUPA 4FOIA 1ILYA 1T8EA 3KD5E 1TK8A 4DFKA 2HF4A 3VOVA 3OJSA 3ZYYX 3MDQA 5AQMA 4H5WA 3O3GA 1U04A 2YKMA 1SV5A 2I7NA 3AO4A 3AVNA 3LM2A 4FYDA 3WNGA 3VQ9A 3UE5A 3ZX2A 2YHYA 3DLRA 3H08A 4MO5A 3V1OA 1SQKA 4CZEA 4F3TA 2HHVA 3THYA 2YJFA 3OS1A 4B1WB 4OGEA 1XMOK 1C1AA 4BDYA 3LANA 4CZGA 4WE1A 3AGRA 3GL1A 4FM0A 2W6LA 3TABA 5JS2A 1S5JA 4Z4HA 4M63C 1QQOA 4IEIA 3HO1A 1N6QA 1DTTA 1HX1A 4O0IA 3N4PA 4PQUA 3MAQA 2VWBA 4NB4A 3VTIA 4BRGA 2Z1GA 2ZJPL 3EL2A 4QS9A 3OYMA 3MWPA 1YF5L 1IG9A 4BR2A 4IG0A 3VETA 3V9WA 1JXBA 1KFSA 1C1BA 1ASVA 4OPJA 3U3GA 3ENHA 4EAHD 3P4IA 4GKKK 3ENOA 4NCGA 2GV9A 1CLQA 3VQBA 3E01A 5F0XA 1YITN 4WFAL 4E7IA 1SKRA 1A5WA 2P9NB 2QWOA 1BWFO 5CYMA 1KSPA 4F3OA 4M45A 3THWA 3U6FA 3CERA 4E89A 5AQJA 4DR2K 3UB5A 3TTDA 4LH5A 3CCQN 5HRSA 1BDGA 3SAHA 4HHTA 3DOKA 5BN9A 1X9WA 3OHRA 1HPMA 3W3DA 3EZWA 2UYTA 4DR4K 3MXIA 4B3MK 2ASPA 2PAVA 3M6GA 4EIAA 3SQ4A 3DM2A 4IEEA 2DTUA 4A5BA 3BF3A 4JAXA 4MDBA 2P9LA 5GIOA 3ZSOA 1UA0A 1YVNA 3L2RA 2HMIA 3ENBA 3KD1E 4CFCA 5SWMA 1D9FA 1RT4A 2KQ2A 4CJ3A 1J9AA 1RT5A 3CCEN 1NLVA 3ALYA 2GEMA 4KV8A 3D2EB 4O0JA 4YHHK 4LF7K 1LW0A 5AQTA 1GOAA 5J2MA 4ZTFA 3L0QA 3QIPA 4AHCA 2P9UB 1VQ7N 4ELUA 1NWKA 1A5VA 1YHQN 3SZ2A 4CJSA 3U9ZA 3A5MC 1WSIA 2E2QA 1HLUA 4BE0A 1XC9A 4M7YA 4F2SA 3U9DA 4O55A 2P9SB 4RCHA 2UXDK 4IOXA 4NLCA 4OPKA 4JKEA 1NJZA 1VQPN 4R5PA 3DXMA 4HUEA 3AO1A 1C6VA 4JNEA 1Q82O 2O4IA 3IS9A 4DLGA 1NK4A 3DRSA 1J5EK 3O08A 4CF2A 1IKWA 4XEIA 2XHBA 4W5OA 1GLEG 1BA0A 5IWAK 3DOLA 3F5TA 2IOCA 3E9LA 4FWQA 2KHOA 2J4RA 2PY5A 2DPNA 4KO0A 1N5YA 1HKBA 1NGCA 4BVOA 4NXMK 4B1YB 2QKBA 2HB5A 1YTAA 5LY3A 1RTJA 4KHPK 3QB0A 2NRWA 3O8MA 3CC4N 3NGYA 3CM5A 4PL8A 4BR5A 4Z4FA 3WQTA 2F8SA 3KK7A 3D0PA 2QWNA 2X78A 3CC2N 2QEXN 3DJCA 4FWKA 2JWLA 4JN4A 5CE3A 3CJ7A 2AP1A 3G10A 4CIGA 3I8DA 4IWVA 4DUZK 4KPYA 4IDKA 2YV0X 2OZMA 4NCBA 1KVBA 4BC4A 4WCEL 4DTMA 2DFEA 1Z25A 3FLCO 3O9TA 4B1VA 3PLAA 2Q36A 4FW2A 3T1AA 1RTHA 1VQ4N 5LMUK 1VSLA 4C1NK 3WNHA 4H0TB 1BHLA 1C0MA 1S1WA 1U2VA 4DQSA 4A61A 3IRXA 3NF8A 1C0TA 5JICA 4L8RB 4BQLA 3O1WA 3EZ5A 2VQFK 4BRDA 1KVAA 3V9UA 2QWRA 4CJUA 4BC5A 3SV3A 3BY5A 1VQ8N 1QQNA 4BRMA 1ATNA 4E3SA 1EWQA 5C2FA 3SPZA 1TK0A 3AVKA 3HVRA 3PX0A 2BE2A 2ETJA 4CK2A 4CJ5A 4U67L 1J54A 3HT3A 1S9GA 3VQ7A 4BRAA 4M3UA 5BPNA 3R9PA 3KLGA 4CZJA 5EOYA 2KZZA 4YY3K 1WSEA 1YXQA 3O9SA 2F4VK 2VGNA 4FLXA 2F9WA 3OA9A 3MXJA 4AH9A 3A0IX 4H4MA 4EFHA 4JI4K 4PY5A 4CHZA 4DTXA 1YJ9N 3THVA 4DV7K 2O8EA 4DQQA 4JK7A 4G9ZA 1T44A 5BR8K 1QSSA 2ZGYA 3HK2A 4EHTA 2NNWA 3VGKA 5AQHA 1NK6A 2OA8A 3QFUA 2GTDA 3L2VA 2HBJA 4F4KA 3VQ5A 4XH5A 2R7YA 4FZXC 2P9IA 3OYIA 1GLBG 4DKWA 3ZX0A 4DR5K 5C15A 4FSVA 3CPWM 4OLBA 3SAGA 1RCHA 2FBXA 1K8KA 1U49A 3LDLA 3C6TA 4I7FA 4J2BA 5AQZA 3NAEA 3S3OA 4FZZA 4NYFA 4C8OA 3MEDA 1TYQB 2V51B 3VEZA 4A5AA 4LFBK 3SLCA 3A8YA 1SS6A 4FCYA 4LF9K 3TR8A 4CESA 3OYDA 4DG1A 4AQYK 3CCVN 2O8CA 4JI3K 3PIOL 2Z1HA 3RRHA 1U47A 4BRLA 4EP5A 5AFUA 4Q5VA 4CF8A 1TUUA 2XO7A 5KTQA 3ZETA 4CVNE 1TKTA 4LSLA 3CM6A 5M1OA 1RBTA 5KQDA 4M7XA 1IKXA 4C8MA 5JLHA 3J8AA 1DTQA 3WUHA 1IJJA 2B5JA 4F8RA 1GLDG 2E2NA 2Q97A 1QQCA 4FK2A 4FPAA 1U2VB 3HZ6A 3HTVA 3CJBA 3KKSA 1B9DA 2E4LA 3VA0A 3BDPA 2NRZA 5KPZA 1NBWA 1VQ6N 4BG8A 4DTPA 2FSJA 3KLHA 4FVUA 3ZSRA 2HHWA 3CCLN 4ILGB 3ATVA 3AVAA 3OBYA 2ASOA 1HNZK 3AVGA 1QHTA 3A5LC 1JXEA 3WXLA 3AVLA 3TI0A 2GX9A 2VWKA 1D4XA 3E66A 2QWPA 4ILHA 4KHYA 3WXIA 3WEEA 1RBVA 4CJEA 2EWSA 5FRNA 1C0FA 4H4OA 1HKCA 2HBMA 4JV5K 3O5BA 3QINA 4FJ8A 1XNQK 1DLOA 1GOCA 3UKRB 2ZGZA 1Q9YA 1LWFA 4RW6A 3TAFA 4DSLA 4CZMA 4B9SA 3V9SA 1IG8A 4JKAA 2HNZA 5FPEA 2F7TA 5C25A 4J8FA 2OZSA 4TSXA 3VEXA 4IBNA 3LDOA 4CHQA 4KI4A 3QETA 5AR0A 2HSTA 4BRPA 4DWIA 4KH4A 1Z05A 4Q0BA 1NGDA 1T6CA 2YCHA 1R0AA 5BRFA 2VGMA 2EX3A 4OVLA 5HL7L 3NFAA 2E6MA 2O8FB 3O4QA 4FJJA 1WBDA 2YI1A 1OH8A 4KRFA 2P9KA 2OPSA 2P9IB 2QKKA 3T7ZA 1HJRA 3HSCA 3KZBA 5M1PA 4H0PA 3VESA 5HP1A 1Q18A 3VQEA 4RW9A 3PSIA 3A5NC 5J2QA 1C0GA 1JLCA 4X62K 2PYJA 4B1XB 4IDHA 1S1UA 3B6OA 1B92A 3IFRA 2E2OA 2JWKA 4JKFA 5TKYA 4DSEA 2G8HA 3HBTA 4IO9L 2GWKA 3KWIA 4IJNA 3CC7N 3CPEA 4BDZA 3PY8A 2E8AA 4CJ7A 3KTQA 3CD6N 1SKSA 3SJJA 1NJXA 4JK9A 1WUAA 4DCHA 4KAZA 1JLGA 2YHWA 2ZF5O 3DAWA 4CF0A 2QWQA 3CQ8A 3J80O 2G8FA 1EP4A 4FLZA 3VQ6A 3J81O 5BRDA 4A59A 4KHNA 1KTQA 3FZLA 1VQ5N 5GADP 4IOCL 3QEVA 4CK1A 1NJYA 3ULEB 3HJFA 1J53A 4DLEA 3JS6A 3G6EN 5ADXH 3OW2M 1S6QA 1ZBLA 2O8BB 4FVMA 3OVNA 1ZC6A 1ASUA 3ID6A 4QCLA 1BOTO 3CFOA 1QS4A 1X1PA 5LJVA 3THXB 3U3YA 4MDAA 3M3ZA 3S9HA 4JHDA 1V4SA 1BQNA 1SKWA 1FKOA 4FLVA 3M8RA 3MX2A 5E26A 5FPMA 3NCIA 1VAZA 1YUWA 4N76A 4AHSA 2A6AA 4JI0K 3KK3A 1J5OA 5D3GA 4JD2B 1NGFA 3AO5A 2ATQA 1N32K 4B9MA 3EE9A 1T05A 5CR4A 2P9PB 3WEEB 2E1YA 3OTOK 4IKFA 4FJLA 3HVTA 4CGFA 2FBTA 4M41A 3O1BA 5AQUA 1LV5A 4KHSA 3HPHA 3UKUA 4K42A 3DMJA 1GLCG 3HM9A 2IVOA 4CFBA 2X6NA 3HL8A 4JS4A 4OPAA 3IMXA 2XY7A 1VQKN 4B3OA 5HLFA 2BGGA 4B8CA 3J7YP 1KD1O 4B9TA 5KRTA 2HHXA 5GAEP 4YOWA 1KC8O 2WBNA 5JS1A 1RT3A 3I56N 5BN8A 1EXQA 3QIOA 4CD1A 4FZYA 4OGCA 4FJNA 4O44A 3L3VA 4DTJA 4FM2A 3V6DA 2O4GA 1KLMA 3QNNA 4B3TK 3QBXA 3QFPA 2JGUA 3LZJA 3L2WA 2E20A 1RDAA 1TK5A 3KWGA 3NH2A 4O4GA 3R8EA 4DV1K 1LAWA 1OVQA 4CK3A 3RR7A 3KK2A 4K0KK 1MDUB 2XRIA 3AARA 2E6LA 1CZBA 3VEOA 3PIPL 4Z4EA 3O9QA 3OYJA 3D6RA 3NDKA 4CHOA 5AQKA 4FK0A 5AQXA 4I2QA 5BRHA 4CIEA 1VSIA 2V7YA 1WLJA 3OJUA 1NKCA 4DR3K 1QE1A 4H5NA 1EETA 1S9EA 4WQ4C 1RBUA 4HTUA 2G8VA 4B9LA 3LP0A 5I9EB 4FWRA 4AM7A 3MEGA 3T1YK 1E4FT 2V52B 5DM7L 2W42A 2OYQA 3S41A 4FWNA 1BCMA 5CZ2A 3C0BA 5CYQA 4E0DA 4JEPA 3LP3A 5EXWA 4KHWA 1HNVA 3OYLA 4IXCA 4BRKA 1IO2A 1SAZA 4YDUC 3U4LA 1BUPA 4FJMA 3HSTB 1I94K 4JKCA 2BH1A 5FPDA 3J7AP 4H0VB 4W5RA 4B9VA 1OH6A 5JMVA 1ZBFA 4JHDB 1JL2A 3VA3A 2YHAA 1NU0A 4HVJA 2VQEK 1ZBUA 3DRPA 4M3TA 3MN9A 3TWHA 3FZHA 5KPRA 1VK0A 1WAJA 1IKYA 1OVYA 4BE1A 3SUPA 2ITGA 5CY4A 1HKGA 1L3VA 1WNSA 4CF9A 3BF1A 3THYB 2IVNA 3TSPA 3CJAA 3SAFA 3G71N 2RE2A 2OPQA 5C2DA 1HQUA 3MWTA 4OX9K 3EKSA 4LY7A 3KLEA 4H5TA 4FLUA 1XC3A 1L3TA 4CCHA 3AA2A 3T1HK 4K8XA 4DSIA 3L3UA 3OYGA 4I6MA 1ZBHA 2NRHA 3D2FA 3DXKA 4F2RA 5M1FA 1DGKN 3LPTA 4QAGA 2F9TA 5KQ8A 3SCXA 2QM1A 2YJEA 2NLXA 3DLEA 3VQDA 4E1JA 1SUQA 1VSFA 3CYMA 2G8WA 4B9QA 1TL3A 2H3GX 5AQYA 1S1VA 1QHAA 2QXFA 5J2PA 2NRXA 3ISNC 3QERA 4CD3A 1Q7YO 4N47A 3WXKA 2ZQBA 3LWMA 1BL3A 3PO5A 3ZSXA 4LF8K 4BC2A 2FLOA 2Q0UA 1BI4A 1KCFA 4C8KA 4K43A 3CETA 2Q3SA 4DTRA 3P38A 4L3QA 4GKJK 3N4QA 4B08A 1OKJA 5AQQA 4CW7B 2LSNA 3THWB 3SQ1A 4BR9A 1NGBA 1Z6RA 3FZFA 3ATUA 2Q31A 5CZ1A 3MK6A 3RMCA 3OYCA 2CGJA 4RWTA 4DHYA 5C0YA 4DF8A 3O9UA 4PKIA 4LC9B 2KW4A 4FWPA 1ATSA 4DB3A 1N34K 1UOCA 4H0YB 4CHNA 4BREA 2P9LB 1IBKK 4BQZA 3ZT0A 4M3RA 5IT9O 1VHXA 1ZBIA 4FXDA 3VF6A 3TAMA 3FFKB 3RSEA 3JXUA 3ZT1A 1NMNA 2AJQA 4GV9A 2NRRA 1HYSA 4BRCA 1A5XA 3OYAA 2Y1IA 1NOYA 1XMQK 4DTUA 4HCBA 4JKBA 1VQNN 3ZT4A 4Z0UA 3UIQA 4W5NA 5BPMA 2VG6A 3VMFB 4FLWA 4WQ5C 1L3SA 1WBBA 1BO5O 2WUSA 3WQUA 4FJXA 1RDWX 1WSHA 4BGBA 3BGRA 3S3MA 1U45A 2WTUA 2A41A 4JKDA 4DR7K 2I5JA 4B1UB 4RW4A 4DU1A 4IFVA 5DM6L 5AZJA 3T3FA 5CHIA 1VRUA 3VERA 4CECA 5AQGA 5DK5A 2D1KA 3AO2A 3TSUA 1XWLA 1JL1A 2Q0RA 5C24A 3DXMB 3LP2A 4DTOA 5H1SQ 3G4SN 4DQRA 1EO1A 1HPZA 3HM8A 4BR0A 4CFAA 3AVBA 3BZKA 3LDSA 2ZWHA 3ZSQA 1XUPO 3A2FA 1VSJA 1GLFO 4DUYK 2BDPA 1NK7A 2VYPA 3SMPA 4EZ6A 4KREA 3GG4A 3P5JA 3FZMA 5E41A 1ZYQA 4LD0A 1WOQA 2QWLA 4FLYA 4R79A 3OYNA 4KKOA 3FGUA 4CE9A 4IOAL 1SL0A 4CJFA 3LDPA 4I6MB 3QEPA 1TKDA 1K9MO 1HUXA 4E19A 5C12A 2A1RA 4M3WA 2UXBK 2CGKA 1HNXK 2HHQA 4BY9C 2HHSA 3JAMO 1BA1A 4BROA 3C6AA 4Z4GA 4AHUA 4OLAA 4LF6K 2YX6A 1D9DA 2KLAA 1MU2A 2YHBA 2OTLN 1HYZA 4GV6A 4YOTA 1YJWN 4YORA 4C8LA 3R3LA 5C42A 2DFHA 2DY4A 3BZCA 4ISFA 2B6AA 4OJRA 1ZXOA 1KXPA 4J2AA 1BI4B 1BISA 4OKJA 1SZ2A 3KHYA 3KIOA 4FJ5A 2RN2A 2IVPA 1S1XA 1VSKA 1NK5A 1IKVA 3WXMB 2WOMA 5AZIA 1KRPA 3P31A 4HCCA 4NCAA 3G25A 3VPZA 4JS5A 1L3UA 3TPQA 4Y1CA 5AQVA 3SUNA 1MWKA 3H3NO 1NK9A 3ZCMA 4K25A 1RT7A 4E7LA 3VENA 2KKZA 4CZKA 1P8ZA 2WC9A 4BRHA 3AAPA 3SBTA 1MA9B 5GINA 4V19S 4BWMA 4CEBA 2HNDA 4PWDA 1XQSC 1M1KO 4A57A 1Q9XA 3QEXA 4MFBA 1CXUA 5HRRA 4FJHA 5AQWA 2HBLA 3PSFA 4YOVA 5KGXA 2VWJA 3O3FA 3PV8A 1JKHA 4DS5A 1NGAA 1DKGD 3P1GA 5HROA 3IG1A 2OANA 2CH6A 3CQXA 4CBXA 4FJIA 5HOOA 4CJQA 3AVFA 2D0CA 5KI6A 3LAKA 3OYFA 1SL2A 4MO4A 5AQOA 1KFDA 4CGIA 1JCGA 4LSNA 4BRQA 4BE2A 1IV0A 1RDCA 3KLFA 1BG3A 4GVMA 4M3XA 4X64K 4BG9A 2HVHA 1JLEA 5I3UA 4FPBA 2KFNA 2GUIA 2O8EB 2WFBA 1NGEA 4KTZA 3K9JA 3ZT3A 3MCPA 3L4QA 3HYFA 5B8HA 4DQIA 2Q2RA 5M1NA 2KZMA 3DWLA 4GY2B 3O80A 4HUFA 3DRRA 1LWCA 3TANA 5HBMA 3HOSA 3SI6A 4JK8A 1T7PA 3H1VX 1T6DA 3L4IA 1NK8A 3CMEN 1RDDA 4CGDA 4W5QA 2FC0A 4ID1A 4WQ4A 3ULDA 3TSQA 3K57A 3JYTA 4GNIA 1YVUA 1K8KB 3K5NA 4PL7A 2UU9K 3DLBA 3RR8A 3OBWA 3GOIA 3M8PA 1X3MA 3NGZA 1YAGA 2EHGA 3MMVA 4CBWA 1G99A 3M8SA 4OKEA 3CI5A 4CHYA 3MN7A 1FW6A 1VSDA 1Q8IA 1RILA 3EEQA 4Y0WA 3NF6A 1HQEA 2E5LK 1NGJA 5AJ3K 4KI6A 4UQGA 1HMVA 4DV2K 3OS2A 4FLTA 1QSYA 3LPUA 1F21A 4YDUA 3HPGA 2O8CB 4LFAK 4PHTX 1YTUA 4PUOA 2VG7A 4CZHA 4DQ8A 5AQPA 1NK0A 4DTNA 4ZTJA 3QMLA 3ZETB 4FL9A 4DFJA 3QDKA 3TU5A 4CEOA 3ASMA 3NBPA 4ELVA 3HP9A 1LAVA 4DSJA 1KAZA 3SMSA 3VTHA 4NO7A 1NGHA 4PKHA 1IBLK 3AA5X 4XH1A 4JKHA 2HMPA 2FBYA 3FR0A 3I8BA 4YOXA 3D2EA 4CJ4A 1LCUA 4FOEA 2B4JA 1QSLA 4KB0A 3F2KA 3I0RA 5ELZA 4NYNA 2NUBA 3HXMA 3PUFA 3FE1A 3VGMA 2NZTA 5LL6Z 3KLIA 4O8UA 1O13A 1J6ZA 4H5VA 2KFZA 5AQFA 1I39A 1TGOA 5BPLA 2D0PA 4AF1A 1BQMA 5K14A 2IDOA 5GAGP 4I9LA 1JLAA 1ITGA 4OKKA 1I3AA 3K9KA 2ITMA 3EKUA 5FDLA 3HPOA 2FF3B 3NH1A 4BGAA 3LWLA 1SL1A 4JI2K 4DR6K 3O4WA 5KGWA 4UY8O 4F9OA 3RMAA 2HHTA 2XY6A 5FLXO 2VG5A 2YHXA 1RTDA 1X3NA 4M42A 4OO1J 2ZE2A 4GMJB 4GV3A 3CF5L 3M1FA 3VN5A 1Y64A 3NF9A 3MXMA 3HOTA 1UA1A 3FZKA 3RMBA 2NRVA 4B9UA 4NXNK 3CXCM 2W6KA 3CQYA 3KJVA 1TAQA 3LP1A 2XY5A 3T19A 5SZTA 1QZ6A 1NJIO 2E2PA 3LM9A 3LZIA 2RKIA 2HHHK 4IO8A 1Q86O 3QESA 2FSNA 5EU7A 4DV5K 2IGIA 4KB1A 2P9KB 1S3XA 5E84A 3AVMA 5LMNK 4DFPA 2UXCK 2D0OA 4N56A 1HJOA 4PKGA 3B8AX 5JVGL 1KVCA 2RHKA 3T69A 1V4TA 2ZM6K 2HVIA 3NVKA 2G8IA 1WAFA 4DS4A 1DT9A 4KH6A 3QEWA 3E9PA 5GIPA 2YNIA 4C8NA 4LF4K 4CEFA 2E88A 1VSMA 2PBDA 3TAPA 1CZ9A 5AQRA 1ATRA 1FK9A 3WXJA 1C0UA 3CHWA 4WQ5A 4B3RK 4ZHRA 3AO3A 5ADXA 5M1QA 1TAUA 1T03A 4JLHA 4CEEA 2QI2A 3G0ZA 3WT0A 1QTMA 3P39A 1BCOA 4FWMA 1VQLN 1D5AA 1NMDA 3GBTA 3CFPA 3DLHA 4QS8A 4KHUA 4BR4A 2QA4N 3NF7A 3O9RA 3DYAA 3V1QA 5JVHL 3V81A 2Z1JA 3BP8A 4KBOA 3EY1A 4CJPA 3TTFA 3VEVA 3QNOA 3VEYA 1VSHA 2RPIA 4DQPA 1NG9A 3MN6A 3NE6A 2PYLA 3L2UA 4FO0A 3K58A 1FJGK 2ASMA 1BIZA 4CEQA 4YOYA 4W5TA 3OYHA 3U8XA 2QTDA 1YJNN 1W7AA 4YOUA 3BEXA 4GW6A 3E1YA 3ZX3A 1S22A 3OYKA 4DR1K 4HTLA 1C1CA 2A1SA 4E7HA 4FM1A 3DI6A 3IKMA 4JRPA 2YNGA 1HNWK 3DLKA 4E7JA 2QK9A 2X6SA 3J7ZO 3SV4A 4DF4A 1B9FA 1Q81O 5JLFA 3SJHA 1GLJO 4FWSA 1RDUA 4DV6K 4KTQA 3AVIA 4JYAK 4CJKA 4DV3K 3C6HA 3UKUB 4JI5K 4YFUA 2UUBK 1W2BM 2F96A 3K5LA 5F1XA 3IUCA 4FWLA 2E1ZA 4E1MA 4BC3A 4I9QA 4B3SK 1NGIA 1VQ9N 1NNEA 2AA4A 4AHRA 5J1EA 1WSGA 2G8KA 4CEDA 2HW3A 3AY9A 3FFIA 4H5RA 1TYQA 2OPRA 2PFUA 3MN5A 1ASWA 1H1VA 1RBRA 2O8DA 1EX4A 4DU3A 5MLCQ 2F8TA 4HWIA 1UAXA 4CI6A 4HUGA 4ELTA 3D7EO 5KRSA 3BUZB 1S72N 3EE8A 3C95A 1KAYA 4JI1K 1N33K 5AQIA 3VEWA 3K5MA 1OH7A 1RDBA 4N41A 3P83D 2UUAK 1EWRA 1QQMA 3AA3A 3H45C 4MQ3A 3CJCA 4KTWA 3NHGA 3NMUA 3M8QA 4CJRA 1TKZA 3Q7CA 2P1JA 3CMAN 1RNHA 3K0SA 2BANA 4AHVA 1X9SA 1KLNA 1W97L 2PZSA 3QBWA 3IAYA 2QW9A 2DFFA 5FPNA 4J2EA 3CCSN 5AFUH 2D0AA 3ZSYA 3LAMA 1U48A 2HOEA 2OCEA 1TL1A 1WB9A 4RG8A 3LDNA 2FSKA 3MECA 1XHZA 1NOZA 3VF2A 5M1KA 5KPTA 1L5UA 1MWMA 3TARA 4CFDA 3ITHA 3F9MA 1M90O 1JCFA 4CJLA 4AHTA 4AM6A 2IIRA 3SPYA 3CG7A 4PA1A 3SBGA 4CEZA 2G8UA 2ZJRL 1JCEA 4CZLA 1BIUA 3PX4A 3Q7BA 4CGHA 3QICA 2P51A 5TKWA 4JI7K 4CEAA 4BRIA 1IBMK 3ZSVA 2IS3A 1NGGA 4OPHA 3V9XA 1UWBA 5EY4A 3O4NA 3UKRA 2Y1JA 2D4WA 2FF6A 3NH0A 3H6EA 3RWUA 4DSKA 4CERA 5BR9A 4IJAA 4GVEA 3CCJN 3CCMN 3I33A 5AQSA 4G1QA 5A2QO 4RW8A 1LWEA 3VGLA 4Z4CA 4CBUA 2HHUA 4DMNA 4H8KA 1RGIA 1E3MA 4EZ9A 3F9KA 4XIUA 3SUOA 4FJKA 3RRGA 4CHPA 1RT2A 1K6YA 2RF2A 1XI1A 3V9ZA 3TAQA 1KQSM 3K2PA 2O8FA 4E7KA 1W0HA 2X74A 3ZEUA 4LFCK 3C6UA 2GUPA 4H0XB 5EVZA 3VF4A 2I7PA 1HRHA 4CZIA 1N36K 4WF9L 4JI8K 1LW2A 4CGJA 1LOTB 4FJ7A 3VQCA 3D2FB 1BGXT 3DXKB 3PX6A 1TUYA 4BVPA 4CF1A 3L6QA 3OY9A 4JKGA 4AILC 1YI2N 1NKEA 3AVJA 3O3HA 3L2QA 1R59O 4ISEA 3VQPA 1GOBA 1S1TA 4YNQA 2A5XA 5DMRA 3CCUN 2V7ZA 3NVMA 5GAHP 1U4BA 4XH4A 1YIJN 1CZAN 1BU6O 1HR0K 2O8DB 1K8AO 3OYEA 4DV4K 5BREA 4BRNA 4ICLA 4KH5A 3K59A 4U7BA 3KVGA 3CCRN 2W40A 4N5SA 1VQMN 4I2PA 1DEJA 2YNFA 3AGKA 3LALA 3C7NA 3ZT2A 4E1NA 3NGIA 3TTCA 1TVRA 3OS0A 2D5RA 4MLEA 3C94A 5FRMA 5C10A 3SK3A 4NLBA 5I42A 4ID5A 4LF5K 3ULEA 2KTQA 3SQ0A 4BR7A 3F73A 1HNIA 3I55N 3S3NA 1NJWA 1N8RO 3WNEA 3OYBA 4BWJA 4RTFD 1Y97A 1HYVA 3CIPA 2O8BA 4DTSA 2NRTA 2A3ZA 4CJVA 4Y1DA 4IZ9A 5HRNA 3R1XA 3SQ2A 3SUQA 2IC3A 4C23A 4A2BA 3MCAB 3THXA 3VQ8A 1RBSA 4BACA 1EKEA 3RMDA 1JJ2M 3GDQA 1JLBA 2XY8A 3RSEB 1O1WA 3JSMA 1VRTA 1GLAG 3B6PA 3HP6A 1FKPA 4FJGA 2HF3A 4M3ZA 3ZSZA 1Z26A 4KFBA 5T7BA 2IAJA 2OPPA 2D0BA 4JD2A 4KHQA 3GE1A 5AQLA 3H46O 4RW7A 3R6MA 2UUCK 4J2DA 3VQ4A 4DV0K 2Q1NA 4CJWA 1QZ5A 1P90A 2P9PA 3RTVA 1K73O 4B1ZA 3I0SA 2GWJA 3AV9A 1VSEA 4CIFA 3TAEA 3KKRA 2GBZA 3VQQA 3TAGA 4FJ9A 5AZJB 3V1RA 4O8KA 1QVGM 3EN9A 1TV6A 2A42A 2WONA 2ZJQL 1RTIA 1EQYA 2W41A 5LJWA 4IG3A 3PO4A 4A62A 3QEIA 1X9JA 4M3YA 4CJTA 1WSFA 3ZSWA 4BRFA 1D8YA 4LH4A 2P5OA 3SYZA 4FK4A 4MLHA 3MEEA 3MX5A 2BTFA 5FROA 3ZLJA 3DLLL 4JI6K 4ILJA 3O6WA 4O5BA 1ESVA 3H3OB 1VQON 4Z94A 3WNFA 3RVCA 3VQAA 4X66K 3HI0A 1GLLO 1XHXA 2ZD1A 1ZBSA 2CH5A 5F2RA 3A5OC 4H03B 4BDPA 1CXQA 2P9NA 3ID8A 3ZEUB 2FBVA 3H1QA 1RT6A 1RT1A 2VCPA 3V4IA 1FXXA 4CGGA 1NM1A 3E9OA 3IDHA 1S6PA 2OTJN 4FWOA 1NKBA 3M5RA 1JLFA 4ISGA 2Z1IA 4EHUA 4QS7A 4JKGB 3C65A 3HRGA 4DU4A 2JLEA
chains in the Genus database with same CATH topology
3RRHA 1TKXA 1U47A 2YNIA 4C8NA 4B08A 3QLHA 1WSJA 3AA4A 4CEFA 4B8AB 4EP5A 4IFYA 2LSNA 1WN7A 1W9HA 4Q5VA 1VSMA 4CF8A 3SQ1A 2XO7A 5KTQA 3TAPA 1CZ9A 1TKTA 4LSLA 1FK9A 2HNYA 3CM6A 4JRQA 3D45A 1C0UA 4DFMA 1RBTA 1X9MA 4ZHRA 1IKXA 4C8MA 3AO3A 1DTQA 2B5JA 5CZ1A 4B9NA 3RMCA 1T03A 4F8RA 4QOZB 1TAUA 4Z4IA 2P5GA 4JLHA 4CEEA 1QQCA 3G0ZA 3OYCA 1IH7A 1QTMA 1BCOA 2YNHA 4FK2A 5HRPA 4K8ZA 1D5AA 4DF8A 3AVCA 3KKSA 1REVA 1B9DA 2KW4A 3CFPA 3DLHA 3L8BA 1UOCA 4KHUA 2E4LA 3NF7A 4CHNA 3EYZA 3VA0A 3BDPA 2YKNA 3DYAA 3V1QA 3ZT0A 4M3RA 1ZBIA 3V81A 4FXDA 2Z1JA 3EY1A 3DLGA 3TAMA 4CJPA 4FW1A 4DTPA 1G15A 3QNOA 3ZT1A 2AJQA 1HYSA 1VSHA 2RPIA 3KLHA 1JLQA 4DQPA 3OYAA 1A5XA 1YT3A 3ZSRA 3NE6A 2Y1IA 1NOYA 4DSFA 2PYLA 2HHWA 3L2UA 3AVAA 4DTUA 3CFRA 3AVGA 1QHTA 4HCBA 3SNNA 4EP4A 3K5OA 1JXEA 3K58A 3QO9A 3AVLA 1BIZA 4CEQA 3TI0A 3AVHA 4W5TA 3OYHA 3KK1A 3ZT4A 4Z0UA 5J2NA 3UIQA 4W5NA 2VWKA 2VG6A 4KHYA 1T8EA 4GW6A 3KD5E 1TK8A 3OYKA 4FLWA 4DFKA 1L3SA 1RBVA 4CJEA 5FRNA 1C1CA 2A1SA 4E7HA 3OJSA 4FM1A 3DI6A 4FJXA 4H4OA 1WSHA 3O3GA 4FJ8A 3QINA 1U04A 2YKMA 3BGRA 1DLOA 1GOCA 3S3MA 1U45A 4JRPA 2I5JA 1SV5A 2YNGA 3AO4A 3AVNA 3DLKA 4RW4A 4IFVA 4E7JA 4DU1A 1LWFA 1Q9YA 2QK9A 4FYDA 4RW6A 2X6SA 3SV4A 3T3FA 3TAFA 3WNGA 3VQ9A 4DSLA 1VRUA 4DF4A 3H08A 3DLRA 3V1OA 4B9SA 1B9FA 3V9SA 4F3TA 2HHVA 4CECA 2HNZA 3OS1A 5C25A 4OGEA 5DK5A 3AO2A 1XWLA 4KTQA 3AVIA 1C1AA 1JL1A 4BDYA 3LANA 2OZSA 5C24A 3LP2A 4TSXA 4DTOA 4WE1A 4IBNA 4CHQA 4CJKA 4DQRA 4KI4A 1HPZA 4FM0A 3QETA 4CFAA 4YFUA 3TABA 5JS2A 3AVBA 1S5JA 4Z4HA 3LDSA 3ZSQA 4DWIA 4Q0BA 2F96A 3K5LA 3HO1A 3A2FA 1N6QA 1DTTA 4O0IA 1VSJA 1R0AA 4PQUA 2EX3A 4E1MA 3MAQA 4I9QA 4OVLA 2BDPA 1NK7A 2Z1GA 3NFAA 4EZ6A 4KREA 2E6MA 3O4QA 3P5JA 5E41A 1ZYQA 4LD0A 4AHRA 3OYMA 5J1EA 4FJJA 1WSGA 2G8KA 4CEDA 2HW3A 4FLYA 4KRFA 1IG9A 3FFIA 4IG0A 3OYNA 3V9WA 1JXBA 2OPSA 1KFSA 2OPRA 4KKOA 1C1BA 2QKKA 1ASVA 4OPJA 3U3GA 4CE9A 1ASWA 1SL0A 1HJRA 1RBRA 4CJFA 3QEPA 1EX4A 1TKDA 4E19A 4DU3A 2F8TA 2A1RA 1UAXA 4NCGA 4HUGA 4ELTA 4M3WA 5HP1A 2GV9A 3VQEA 4RW9A 2HHQA 1CLQA 5KRSA 5J2QA 2HHSA 3VQBA 1JLCA 3C95A 3E01A 2PYJA 4E7IA 1S1UA 3B6OA 1B92A 1SKRA 4Z4GA 1A5WA 4AHUA 3K5MA 4OLAA 1D9DA 5CYMA 1KSPA 4F3OA 1MU2A 1RDBA 4M45A 2YHBA 4DSEA 3U6FA 4N41A 4E89A 2G8HA 1HYZA 3P83D 3AA3A 4MQ3A 4C8LA 4KTWA 4LH5A 5HRSA 5C42A 2DFHA 3NHGA 4BDZA 2DY4A 4HHTA 3DOKA 2B6AA 3M8QA 4OJRA 3PY8A 4CJRA 1TKZA 1X9WA 3KTQA 2P1JA 4J2AA 1RNHA 1BI4B 1BISA 3SJJA 1SKSA 1NJXA 2BANA 4OKJA 4AHVA 4KAZA 1JLGA 3KIOA 1X9SA 1KLNA 4FJ5A 4CF0A 2PZSA 2RN2A 3CQ8A 3MXIA 3IAYA 1S1XA 2G8FA 1VSKA 1EP4A 2DFFA 4FLZA 1NK5A 1IKVA 3VQ6A 4J2EA 3SQ4A 2WOMA 4KHNA 3DM2A 1KRPA 2D0AA 3ZSYA 3LAMA 1KTQA 2DTUA 1U48A 4HCCA 4NCAA 4JS5A 3ZSOA 1TL1A 1UA0A 4RG8A 1L3UA 3QEVA 3MECA 4Y1CA 3SUNA 1XHZA 1NOZA 4CK1A 1NJYA 1L5UA 3HJFA 1NK9A 3ZCMA 3L2RA 1J53A 2HMIA 1RT7A 4DLEA 3TARA 4CFDA 4E7LA 3ITHA 3KD1E 4CFCA 1S6QA 5SWMA 1D9FA 1ZBLA 1RT4A 2KQ2A 4CJLA 4AHTA 4FVMA 4CJ3A 3OVNA 1ASUA 1J9AA 1RT5A 3SPYA 3CG7A 4QCLA 4PA1A 3ALYA 4CEZA 2G8UA 3PX4A 4BWMA 1BIUA 3CFOA 4CEBA 2HNDA 1QS4A 4O0JA 4KV8A 4CGHA 1X1PA 1LW0A 4PWDA 3U3YA 2P51A 3S9HA 4CEAA 1Q9XA 3QEXA 1BQNA 4MFBA 1FKOA 1SKWA 1CXUA 1GOAA 5HRRA 5J2MA 3QEWA 4ZTFA 3ZSVA 4FLVA 3QIPA 3M8RA 4FJHA 4AHCA 4ELUA 2VWJA 5KGXA 3NCIA 3O3FA 2IS3A 1A5VA 1JKHA 3PV8A 3SZ2A 4DS5A 3V9XA 1UWBA 3P1GA 4CJSA 5HROA 3IG1A 3O4NA 4N76A 4AHSA 2Y1JA 1WSIA 3NH0A 3RWUA 4DSKA 4CERA 3KK3A 1J5OA 5D3GA 4FJIA 4BE0A 4CJQA 1XC9A 4F2SA 4G1QA 3AO5A 3AVFA 2D0CA 4O55A 2ATQA 5KI6A 3LAKA 4RW8A 3OYFA 1SL2A 1LWEA 4B9MA 1T05A 1KFDA 4OPKA 4CGIA 4Z4CA 4LSNA 4BE2A 4IKFA 1NJZA 4FJLA 1RDCA 3HVTA 4CGFA 2FBTA 3KLFA 4R5PA 4GVMA 4M3XA 4M41A 4HUEA 2HVHA 4KHSA 3AO1A 1LV5A 3HPHA 1C6VA 1JLEA 5I3UA 4DMNA 4H8KA 2HHUA 2O4IA 3IS9A 2KFNA 3DMJA 4DLGA 2GUIA 3HM9A 1NK4A 4EZ9A 3DRSA 3F9KA 4KTZA 4CF2A 4XIUA 1IKWA 4CFBA 2X6NA 3ZT3A 3SUOA 3HL8A 3HYFA 2XHBA 4JS4A 4W5OA 3RRGA 4CHPA 4FJKA 4DQIA 1RT2A 1K6YA 2RF2A 1XI1A 3V9ZA 3TAQA 2XY7A 3DOLA 3K2PA 2KZMA 4B3OA 5HLFA 2IOCA 2BGGA 4B8CA 2PY5A 4KO0A 4E7KA 1N5YA 1W0HA 2X74A 4HUFA 3DRRA 4B9TA 3C6UA 5KRTA 1LWCA 3TANA 5HBMA 2HB5A 3SI6A 1YTAA 1T7PA 1RTJA 2QKBA 2HHXA 1NK8A 1HRHA 1RDDA 4CGDA 4W5QA 5JS1A 2FC0A 4ID1A 1LW2A 1RT3A 3CM5A 3NGYA 4CGJA 3ULDA 1EXQA 3K57A 3QIOA 3VQCA 3JYTA 4FJ7A 4Z4FA 1BGXT 1YVUA 3PX6A 4FZYA 4OGCA 3K5NA 4FJNA 2F8SA 3DLBA 4O44A 4CF1A 3D0PA 2X78A 3OY9A 3L3VA 3RR8A 4AILC 3M8PA 1NKEA 4DTJA 3AVJA 3O3HA 3L2QA 3NGZA 4FM2A 3V6DA 2O4GA 1KLMA 2EHGA 3VQPA 3QNNA 1GOBA 1S1TA 4YNQA 3M8SA 4OKEA 3G10A 4CIGA 4CHYA 2JGUA 3I8DA 5DMRA 3LZJA 1VSDA 1Q8IA 1RILA 3L2WA 4IDKA 1RDAA 1U4BA 4KPYA 2YV0X 3NF6A 1HQEA 1TK5A 3NH2A 4O4GA 1LAWA 2OZMA 4NCBA 4KI6A 1KVBA 4UQGA 3OYEA 1HMVA 2DFEA 4DTMA 4CK3A 1Z25A 3RR7A 3OS2A 4FW2A 4ICLA 3KK2A 4FLTA 3LPUA 3K59A 1QSYA 1F21A 1RTHA 2XRIA 3T1AA 3HPGA 2E6LA 1YTUA 1VSLA 1CZBA 4PUOA 2VG7A 3WNHA 4Z4EA 3OYJA 3NDKA 1BHLA 4CHOA 1C0MA 4N5SA 1S1WA 1NK0A 4I2QA 4FK0A 4DTNA 4DQSA 4CIEA 4ZTJA 4I2PA 1VSIA 2YNFA 1WLJA 3IRXA 3LALA 3NF8A 3ZT2A 4E1NA 3OJUA 3NGIA 1C0TA 1NKCA 1QE1A 1TVRA 3OS0A 2D5RA 4DFJA 3C94A 1EETA 5FRMA 4L8RB 1S9EA 4CEOA 3ASMA 3EZ5A 5I42A 4ID5A 3NBPA 1KVAA 1RBUA 4HTUA 3V9UA 3SQ0A 4ELVA 2KTQA 2G8VA 3HP9A 3F73A 1HNIA 1LAVA 3LP0A 4CJUA 4B9LA 4DSJA 3SV3A 3S3NA 1NJWA 3WNEA 3OYBA 4BWJA 1Y97A 1HYVA 3MEGA 4DTSA 4E3SA 4CJVA 4Y1DA 5HRNA 3AA5X 2FBYA 3SQ2A 3SPZA 1TK0A 2W42A 3SUQA 3AVKA 2IC3A 3HVRA 3PX0A 2BE2A 2OYQA 2ETJA 4CK2A 1BCMA 5CZ2A 4CJ5A 4CJ4A 3VQ8A 2B4JA 1J54A 1RBSA 4BACA 1EKEA 5CYQA 3RMDA 1QSLA 4E0DA 4KB0A 3I0RA 3LP3A 1JLBA 4NYNA 2NUBA 2XY8A 4KHWA 1HNVA 3HT3A 3OYLA 1S9GA 3HXMA 1O1WA 3VQ7A 3PUFA 3JSMA 4M3UA 1IO2A 1VRTA 3KLGA 3KLIA 4FJMA 3B6PA 3HSTB 2KZZA 3HP6A 2KFZA 1FKPA 4FJGA 4M3ZA 3ZSZA 1Z26A 4KFBA 1I39A 5T7BA 2IAJA 1TGOA 2OPPA 2D0BA 1WSEA 4KHQA 1BQMA 4W5RA 4B9VA 5K14A 2IDOA 4FLXA 4I9LA 1JLAA 1ITGA 1ZBFA 4RW7A 4J2DA 4OKKA 1I3AA 3MXJA 3VQ4A 4AH9A 4CJWA 1JL2A 3VA3A 2YHAA 3RTVA 4H4MA 5FDLA 3I0SA 3HPOA 3NH1A 3AV9A 4HVJA 4PY5A 1VSEA 4CHZA 4CIFA 4DTXA 3TAEA 3LWLA 1ZBUA 3DRPA 1SL1A 3THVA 3KKRA 2GBZA 3VQQA 3TWHA 3TAGA 4M3TA 4FJ9A 5KGWA 4DQQA 1VK0A 1WAJA 1IKYA 3V1RA 4BE1A 3SUPA 3RMAA 2ITGA 5CY4A 1TV6A 1QSSA 2HHTA 2XY6A 1L3VA 1WNSA 2VG5A 2WONA 4CF9A 3HK2A 1RTDA 4M42A 2ZE2A 1NK6A 2OA8A 1RTIA 4IG3A 2OPQA 4GMJB 3PO4A 1HQUA 3L2VA 3QEIA 4M3YA 3VN5A 4CJTA 1WSFA 3VQ5A 4F4KA 4LY7A 3NF9A 3KLEA 2R7YA 3MXMA 3ZSWA 1D8YA 4FZXC 4LH4A 2P5OA 3OYIA 4FLUA 1UA1A 3SYZA 4FK4A 4CCHA 1L3TA 3AA2A 4K8XA 3MEEA 3RMBA 5FROA 4B9UA 4DSIA 3L3UA 3OYGA 3KJVA 1ZBHA 1TAQA 3LP1A 2XY5A 4O5BA 3T19A 4OLBA 1RCHA 5SZTA 2FBXA 3WNFA 3VQAA 4F2RA 3LZIA 1U49A 3C6TA 3LPTA 4QAGA 1XHXA 2ZD1A 2RKIA 4I7FA 3SCXA 4BDPA 4J2BA 3QESA 3DLEA 3VQDA 5EU7A 1SUQA 1CXQA 3NAEA 3S3OA 1VSFA 3CYMA 2G8WA 2IGIA 1TL3A 4FZZA 2FBVA 1S1VA 4NYFA 2QXFA 4C8OA 4KB1A 1RT6A 3MEDA 5J2PA 3AVMA 4DFPA 1RT1A 3V4IA 1FXXA 3ISNC 3QERA 4CGGA 4N56A 4N47A 2ZQBA 1S6PA 3LWMA 1NKBA 1BL3A 4FCYA 3PO5A 3TR8A 1KVCA 3ZSXA 4CESA 1JLFA 4DG1A 3OYDA 2Z1IA 2HVIA 1BI4A 1KCFA 4C8KA 2G8IA 1WAFA 2Q3SA 4DS4A 4DTRA 4DU4A 2JLEA 2Z1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRH A;  1TKX A;  1U47 A;  2YNI A;  4C8N A;  4B08 A;  3QLH A;  1WSJ A;  3AA4 A;  4CEF A;  4B8A B;  4EP5 A;  4IFY A;  2LSN A;  1WN7 A;  1W9H A;  4Q5V A;  1VSM A;  4CF8 A;  3SQ1 A;  2XO7 A;  5KTQ A;  3TAP A;  1CZ9 A;  1TKT A;  4LSL A;  1FK9 A;  2HNY A;  3CM6 A;  4JRQ A;  3D45 A;  1C0U A;  4DFM A;  1RBT A;  1X9M A;  4ZHR A;  1IKX A;  4C8M A;  3AO3 A;  1DTQ A;  2B5J A;  5CZ1 A;  4B9N A;  3RMC A;  1T03 A;  4F8R A;  4QOZ B;  1TAU A;  4Z4I A;  2P5G A;  4JLH A;  4CEE A;  1QQC A;  3G0Z A;  3OYC A;  1IH7 A;  1QTM A;  1BCO A;  2YNH A;  4FK2 A;  5HRP A;  4K8Z A;  1D5A A;  4DF8 A;  3AVC A;  3KKS A;  1REV A;  1B9D A;  2KW4 A;  3CFP A;  3DLH A;  3L8B A;  1UOC A;  4KHU A;  2E4L A;  3NF7 A;  4CHN A;  3EYZ A;  3VA0 A;  3BDP A;  2YKN A;  3DYA A;  3V1Q A;  3ZT0 A;  4M3R A;  1ZBI A;  3V81 A;  4FXD A;  2Z1J A;  3EY1 A;  3DLG A;  3TAM A;  4CJP A;  4FW1 A;  4DTP A;  1G15 A;  3QNO A;  3ZT1 A;  2AJQ A;  1HYS A;  1VSH A;  2RPI A;  3KLH A;  1JLQ A;  4DQP A;  3OYA A;  1A5X A;  1YT3 A;  3ZSR A;  3NE6 A;  2Y1I A;  1NOY A;  4DSF A;  2PYL A;  2HHW A;  3L2U A;  3AVA A;  4DTU A;  3CFR A;  3AVG A;  1QHT A;  4HCB A;  3SNN A;  4EP4 A;  3K5O A;  1JXE A;  3K58 A;  3QO9 A;  3AVL A;  1BIZ A;  4CEQ A;  3TI0 A;  3AVH A;  4W5T A;  3OYH A;  3KK1 A;  3ZT4 A;  4Z0U A;  5J2N A;  3UIQ A;  4W5N A;  2VWK A;  2VG6 A;  4KHY A;  1T8E A;  4GW6 A;  3KD5 E;  1TK8 A;  3OYK A;  4FLW A;  4DFK A;  1L3S A;  1RBV A;  4CJE A;  5FRN A;  1C1C A;  2A1S A;  4E7H A;  3OJS A;  4FM1 A;  3DI6 A;  4FJX A;  4H4O A;  1WSH A;  3O3G A;  4FJ8 A;  3QIN A;  1U04 A;  2YKM A;  3BGR A;  1DLO A;  1GOC A;  3S3M A;  1U45 A;  4JRP A;  2I5J A;  1SV5 A;  2YNG A;  3AO4 A;  3AVN A;  3DLK A;  4RW4 A;  4IFV A;  4E7J A;  4DU1 A;  1LWF A;  1Q9Y A;  2QK9 A;  4FYD A;  4RW6 A;  2X6S A;  3SV4 A;  3T3F A;  3TAF A;  3WNG A;  3VQ9 A;  4DSL A;  1VRU A;  4DF4 A;  3H08 A;  3DLR A;  3V1O A;  4B9S A;  1B9F A;  3V9S A;  4F3T A;  2HHV A;  4CEC A;  2HNZ A;  3OS1 A;  5C25 A;  4OGE A;  5DK5 A;  3AO2 A;  1XWL A;  4KTQ A;  3AVI A;  1C1A A;  1JL1 A;  4BDY A;  3LAN A;  2OZS A;  5C24 A;  3LP2 A;  4TSX A;  4DTO A;  4WE1 A;  4IBN A;  4CHQ A;  4CJK A;  4DQR A;  4KI4 A;  1HPZ A;  4FM0 A;  3QET A;  4CFA A;  4YFU A;  3TAB A;  5JS2 A;  3AVB A;  1S5J A;  4Z4H A;  3LDS A;  3ZSQ A;  4DWI A;  4Q0B A;  2F96 A;  3K5L A;  3HO1 A;  3A2F A;  1N6Q A;  1DTT A;  4O0I A;  1VSJ A;  1R0A A;  4PQU A;  2EX3 A;  4E1M A;  3MAQ A;  4I9Q A;  4OVL A;  2BDP A;  1NK7 A;  2Z1G A;  3NFA A;  4EZ6 A;  4KRE A;  2E6M A;  3O4Q A;  3P5J A;  5E41 A;  1ZYQ A;  4LD0 A;  4AHR A;  3OYM A;  5J1E A;  4FJJ A;  1WSG A;  2G8K A;  4CED A;  2HW3 A;  4FLY A;  4KRF A;  1IG9 A;  3FFI A;  4IG0 A;  3OYN A;  3V9W A;  1JXB A;  2OPS A;  1KFS A;  2OPR A;  4KKO A;  1C1B A;  2QKK A;  1ASV A;  4OPJ A;  3U3G A;  4CE9 A;  1ASW A;  1SL0 A;  1HJR A;  1RBR A;  4CJF A;  3QEP A;  1EX4 A;  1TKD A;  4E19 A;  4DU3 A;  2F8T A;  2A1R A;  1UAX A;  4NCG A;  4HUG A;  4ELT A;  4M3W A;  5HP1 A;  2GV9 A;  3VQE A;  4RW9 A;  2HHQ A;  1CLQ A;  5KRS A;  5J2Q A;  2HHS A;  3VQB A;  1JLC A;  3C95 A;  3E01 A;  2PYJ A;  4E7I A;  1S1U A;  3B6O A;  1B92 A;  1SKR A;  4Z4G A;  1A5W A;  4AHU A;  3K5M A;  4OLA A;  1D9D A;  5CYM A;  1KSP A;  4F3O A;  1MU2 A;  1RDB A;  4M45 A;  2YHB A;  4DSE A;  3U6F A;  4N41 A;  4E89 A;  2G8H A;  1HYZ A;  3P83 D;  3AA3 A;  4MQ3 A;  4C8L A;  4KTW A;  4LH5 A;  5HRS A;  5C42 A;  2DFH A;  3NHG A;  4BDZ A;  2DY4 A;  4HHT A;  3DOK A;  2B6A A;  3M8Q A;  4OJR A;  3PY8 A;  4CJR A;  1TKZ A;  1X9W A;  3KTQ A;  2P1J A;  4J2A A;  1RNH A;  1BI4 B;  1BIS A;  3SJJ A;  1SKS A;  1NJX A;  2BAN A;  4OKJ A;  4AHV A;  4KAZ A;  1JLG A;  3KIO A;  1X9S A;  1KLN A;  4FJ5 A;  4CF0 A;  2PZS A;  2RN2 A;  3CQ8 A;  3MXI A;  3IAY A;  1S1X A;  2G8F A;  1VSK A;  1EP4 A;  2DFF A;  4FLZ A;  1NK5 A;  1IKV A;  3VQ6 A;  4J2E A;  3SQ4 A;  2WOM A;  4KHN A;  3DM2 A;  1KRP A;  2D0A A;  3ZSY A;  3LAM A;  1KTQ A;  2DTU A;  1U48 A;  4HCC A;  4NCA A;  4JS5 A;  3ZSO A;  1TL1 A;  1UA0 A;  4RG8 A;  1L3U A;  3QEV A;  3MEC A;  4Y1C A;  3SUN A;  1XHZ A;  1NOZ A;  4CK1 A;  1NJY A;  1L5U A;  3HJF A;  1NK9 A;  3ZCM A;  3L2R A;  1J53 A;  2HMI A;  1RT7 A;  4DLE A;  3TAR A;  4CFD A;  4E7L A;  3ITH A;  3KD1 E;  4CFC A;  1S6Q A;  5SWM A;  1D9F A;  1ZBL A;  1RT4 A;  2KQ2 A;  4CJL A;  4AHT A;  4FVM A;  4CJ3 A;  3OVN A;  1ASU A;  1J9A A;  1RT5 A;  3SPY A;  3CG7 A;  4QCL A;  4PA1 A;  3ALY A;  4CEZ A;  2G8U A;  3PX4 A;  4BWM A;  1BIU A;  3CFO A;  4CEB A;  2HND A;  1QS4 A;  4O0J A;  4KV8 A;  4CGH A;  1X1P A;  1LW0 A;  4PWD A;  3U3Y A;  2P51 A;  3S9H A;  4CEA A;  1Q9X A;  3QEX A;  1BQN A;  4MFB A;  1FKO A;  1SKW A;  1CXU A;  1GOA A;  5HRR A;  5J2M A;  3QEW A;  4ZTF A;  3ZSV A;  4FLV A;  3QIP A;  3M8R A;  4FJH A;  4AHC A;  4ELU A;  2VWJ A;  5KGX A;  3NCI A;  3O3F A;  2IS3 A;  1A5V A;  1JKH A;  3PV8 A;  3SZ2 A;  4DS5 A;  3V9X A;  1UWB A;  3P1G A;  4CJS A;  5HRO A;  3IG1 A;  3O4N A;  4N76 A;  4AHS A;  2Y1J A;  1WSI A;  3NH0 A;  3RWU A;  4DSK A;  4CER A;  3KK3 A;  1J5O A;  5D3G A;  4FJI A;  4BE0 A;  4CJQ A;  1XC9 A;  4F2S A;  4G1Q A;  3AO5 A;  3AVF A;  2D0C A;  4O55 A;  2ATQ A;  5KI6 A;  3LAK A;  4RW8 A;  3OYF A;  1SL2 A;  1LWE A;  4B9M A;  1T05 A;  1KFD A;  4OPK A;  4CGI A;  4Z4C A;  4LSN A;  4BE2 A;  4IKF A;  1NJZ A;  4FJL A;  1RDC A;  3HVT A;  4CGF A;  2FBT A;  3KLF A;  4R5P A;  4GVM A;  4M3X A;  4M41 A;  4HUE A;  2HVH A;  4KHS A;  3AO1 A;  1LV5 A;  3HPH A;  1C6V A;  1JLE A;  5I3U A;  4DMN A;  4H8K A;  2HHU A;  2O4I A;  3IS9 A;  2KFN A;  3DMJ A;  4DLG A;  2GUI A;  3HM9 A;  1NK4 A;  4EZ9 A;  3DRS A;  3F9K A;  4KTZ A;  4CF2 A;  4XIU A;  1IKW A;  4CFB A;  2X6N A;  3ZT3 A;  3SUO A;  3HL8 A;  3HYF A;  2XHB A;  4JS4 A;  4W5O A;  3RRG A;  4CHP A;  4FJK A;  4DQI A;  1RT2 A;  1K6Y A;  2RF2 A;  1XI1 A;  3V9Z A;  3TAQ A;  2XY7 A;  3DOL A;  3K2P A;  2KZM A;  4B3O A;  5HLF A;  2IOC A;  2BGG A;  4B8C A;  2PY5 A;  4KO0 A;  4E7K A;  1N5Y A;  1W0H A;  2X74 A;  4HUF A;  3DRR A;  4B9T A;  3C6U A;  5KRT A;  1LWC A;  3TAN A;  5HBM A;  2HB5 A;  3SI6 A;  1YTA A;  1T7P A;  1RTJ A;  2QKB A;  2HHX A;  1NK8 A;  1HRH A;  1RDD A;  4CGD A;  4W5Q A;  5JS1 A;  2FC0 A;  4ID1 A;  1LW2 A;  1RT3 A;  3CM5 A;  3NGY A;  4CGJ A;  3ULD A;  1EXQ A;  3K57 A;  3QIO A;  3VQC A;  3JYT A;  4FJ7 A;  4Z4F A;  1BGX T;  1YVU A;  3PX6 A;  4FZY A;  4OGC A;  3K5N A;  4FJN A;  2F8S A;  3DLB A;  4O44 A;  4CF1 A;  3D0P A;  2X78 A;  3OY9 A;  3L3V A;  3RR8 A;  4AIL C;  3M8P A;  1NKE A;  4DTJ A;  3AVJ A;  3O3H A;  3L2Q A;  3NGZ A;  4FM2 A;  3V6D A;  2O4G A;  1KLM A;  2EHG A;  3VQP A;  3QNN A;  1GOB A;  1S1T A;  4YNQ A;  3M8S A;  4OKE A;  3G10 A;  4CIG A;  4CHY A;  2JGU A;  3I8D A;  5DMR A;  3LZJ A;  1VSD A;  1Q8I A;  1RIL A;  3L2W A;  4IDK A;  1RDA A;  1U4B A;  4KPY A;  2YV0 X;  3NF6 A;  1HQE A;  1TK5 A;  3NH2 A;  4O4G A;  1LAW A;  2OZM A;  4NCB A;  4KI6 A;  1KVB A;  4UQG A;  3OYE A;  1HMV A;  2DFE A;  4DTM A;  4CK3 A;  1Z25 A;  3RR7 A;  3OS2 A;  4FW2 A;  4ICL A;  3KK2 A;  4FLT A;  3LPU A;  3K59 A;  1QSY A;  1F21 A;  1RTH A;  2XRI A;  3T1A A;  3HPG A;  2E6L A;  1YTU A;  1VSL A;  1CZB A;  4PUO A;  2VG7 A;  3WNH A;  4Z4E A;  3OYJ A;  3NDK A;  1BHL A;  4CHO A;  1C0M A;  4N5S A;  1S1W A;  1NK0 A;  4I2Q A;  4FK0 A;  4DTN A;  4DQS A;  4CIE A;  4ZTJ A;  4I2P A;  1VSI A;  2YNF A;  1WLJ A;  3IRX A;  3LAL A;  3NF8 A;  3ZT2 A;  4E1N A;  3OJU A;  3NGI A;  1C0T A;  1NKC A;  1QE1 A;  1TVR A;  3OS0 A;  2D5R A;  4DFJ A;  3C94 A;  1EET A;  5FRM A;  4L8R B;  1S9E A;  4CEO A;  3ASM A;  3EZ5 A;  5I42 A;  4ID5 A;  3NBP A;  1KVA A;  1RBU A;  4HTU A;  3V9U A;  3SQ0 A;  4ELV A;  2KTQ A;  2G8V A;  3HP9 A;  3F73 A;  1HNI A;  1LAV A;  3LP0 A;  4CJU A;  4B9L A;  4DSJ A;  3SV3 A;  3S3N A;  1NJW A;  3WNE A;  3OYB A;  4BWJ A;  1Y97 A;  1HYV A;  3MEG A;  4DTS A;  4E3S A;  4CJV A;  4Y1D A;  5HRN A;  3AA5 X;  2FBY A;  3SQ2 A;  3SPZ A;  1TK0 A;  2W42 A;  3SUQ A;  3AVK A;  2IC3 A;  3HVR A;  3PX0 A;  2BE2 A;  2OYQ A;  2ETJ A;  4CK2 A;  1BCM A;  5CZ2 A;  4CJ5 A;  4CJ4 A;  3VQ8 A;  2B4J A;  1J54 A;  1RBS A;  4BAC A;  1EKE A;  5CYQ A;  3RMD A;  1QSL A;  4E0D A;  4KB0 A;  3I0R A;  3LP3 A;  1JLB A;  4NYN A;  2NUB A;  2XY8 A;  4KHW A;  1HNV A;  3HT3 A;  3OYL A;  1S9G A;  3HXM A;  1O1W A;  3VQ7 A;  3PUF A;  3JSM A;  4M3U A;  1IO2 A;  1VRT A;  3KLG A;  3KLI A;  4FJM A;  3B6P A;  3HST B;  2KZZ A;  3HP6 A;  2KFZ A;  1FKP A;  4FJG A;  4M3Z A;  3ZSZ A;  1Z26 A;  4KFB A;  1I39 A;  5T7B A;  2IAJ A;  1TGO A;  2OPP A;  2D0B A;  1WSE A;  4KHQ A;  1BQM A;  4W5R A;  4B9V A;  5K14 A;  2IDO A;  4FLX A;  4I9L A;  1JLA A;  1ITG A;  1ZBF A;  4RW7 A;  4J2D A;  4OKK A;  1I3A A;  3MXJ A;  3VQ4 A;  4AH9 A;  4CJW A;  1JL2 A;  3VA3 A;  2YHA A;  3RTV A;  4H4M A;  5FDL A;  3I0S A;  3HPO A;  3NH1 A;  3AV9 A;  4HVJ A;  4PY5 A;  1VSE A;  4CHZ A;  4CIF A;  4DTX A;  3TAE A;  3LWL A;  1ZBU A;  3DRP A;  1SL1 A;  3THV A;  3KKR A;  2GBZ A;  3VQQ A;  3TWH A;  3TAG A;  4M3T A;  4FJ9 A;  5KGW A;  4DQQ A;  1VK0 A;  1WAJ A;  1IKY A;  3V1R A;  4BE1 A;  3SUP A;  3RMA A;  2ITG A;  5CY4 A;  1TV6 A;  1QSS A;  2HHT A;  2XY6 A;  1L3V A;  1WNS A;  2VG5 A;  2WON A;  4CF9 A;  3HK2 A;  1RTD A;  4M42 A;  2ZE2 A;  1NK6 A;  2OA8 A;  1RTI A;  4IG3 A;  2OPQ A;  4GMJ B;  3PO4 A;  1HQU A;  3L2V A;  3QEI A;  4M3Y A;  3VN5 A;  4CJT A;  1WSF A;  3VQ5 A;  4F4K A;  4LY7 A;  3NF9 A;  3KLE A;  2R7Y A;  3MXM A;  3ZSW A;  1D8Y A;  4FZX C;  4LH4 A;  2P5O A;  3OYI A;  4FLU A;  1UA1 A;  3SYZ A;  4FK4 A;  4CCH A;  1L3T A;  3AA2 A;  4K8X A;  3MEE A;  3RMB A;  5FRO A;  4B9U A;  4DSI A;  3L3U A;  3OYG A;  3KJV A;  1ZBH A;  1TAQ A;  3LP1 A;  2XY5 A;  4O5B A;  3T19 A;  4OLB A;  1RCH A;  5SZT A;  2FBX A;  3WNF A;  3VQA A;  4F2R A;  3LZI A;  1U49 A;  3C6T A;  3LPT A;  4QAG A;  1XHX A;  2ZD1 A;  2RKI A;  4I7F A;  3SCX A;  4BDP A;  4J2B A;  3QES A;  3DLE A;  3VQD A;  5EU7 A;  1SUQ A;  1CXQ A;  3NAE A;  3S3O A;  1VSF A;  3CYM A;  2G8W A;  2IGI A;  1TL3 A;  4FZZ A;  2FBV A;  1S1V A;  4NYF A;  2QXF A;  4C8O A;  4KB1 A;  1RT6 A;  3MED A;  5J2P A;  3AVM A;  4DFP A;  1RT1 A;  3V4I A;  1FXX A;  3ISN C;  3QER A;  4CGG A;  4N56 A;  4N47 A;  2ZQB A;  1S6P A;  3LWM A;  1NKB A;  1BL3 A;  4FCY A;  3PO5 A;  3TR8 A;  1KVC A;  3ZSX A;  4CES A;  1JLF A;  4DG1 A;  3OYD A;  2Z1I A;  2HVI A;  1BI4 A;  1KCF A;  4C8K A;  2G8I A;  1WAF A;  2Q3S A;  4DS4 A;  4DTR A;  4DU4 A;  2JLE A;  2Z1H A; 
#chains in the Genus database with same CATH topology
 1TKX A;  3EO3 A;  4C1N I;  5EX5 A;  3QLH A;  1WSJ A;  3AA4 A;  4B8A B;  4IFY A;  1WN7 A;  1W9H A;  4H0O A;  2HNY A;  3AAQ A;  4JRQ A;  3D45 A;  2QWM A;  1OH5 A;  4DFM A;  2A40 A;  2HBK A;  3LL3 A;  1X9M A;  1QVF M;  4CZF A;  1T3V A;  2CGL A;  3LDQ A;  4IFE A;  4WFN L;  4B9N A;  1XNR K;  4QOZ B;  4Z4I A;  2P5G A;  1IH7 A;  2YNH A;  1E4G T;  5HRP A;  4X65 K;  1KAX A;  4K8Z A;  3AVC A;  1REV A;  3C7N B;  4K41 A;  5AZI B;  3L8B A;  2QXL A;  3W0L A;  3EYZ A;  2YKN A;  3DLG A;  4FW1 A;  4O5F A;  1G15 A;  1RFQ A;  2P9U A;  2GEL A;  5AQN A;  1JLQ A;  1YT3 A;  3CJ1 A;  4DSF A;  3CFR A;  3SNN A;  4EP4 A;  3K5O A;  3QO9 A;  1U6Z A;  2FXU A;  4A2A A;  4WYB A;  3CJ9 A;  3AVH A;  2P9S A;  4WFB L;  3KK1 A;  5J2N A;  2BUP A;  4FOI A;  1ILY A;  1T8E A;  3KD5 E;  1TK8 A;  4DFK A;  2HF4 A;  3VOV A;  3OJS A;  3ZYY X;  3MDQ A;  5AQM A;  4H5W A;  3O3G A;  1U04 A;  2YKM A;  1SV5 A;  2I7N A;  3AO4 A;  3AVN A;  3LM2 A;  4FYD A;  3WNG A;  3VQ9 A;  3UE5 A;  3ZX2 A;  2YHY A;  3DLR A;  3H08 A;  4MO5 A;  3V1O A;  1SQK A;  4CZE A;  4F3T A;  2HHV A;  3THY A;  2YJF A;  3OS1 A;  4B1W B;  4OGE A;  1XMO K;  1C1A A;  4BDY A;  3LAN A;  4CZG A;  4WE1 A;  3AGR A;  3GL1 A;  4FM0 A;  2W6L A;  3TAB A;  5JS2 A;  1S5J A;  4Z4H A;  4M63 C;  1QQO A;  4IEI A;  3HO1 A;  1N6Q A;  1DTT A;  1HX1 A;  4O0I A;  3N4P A;  4PQU A;  3MAQ A;  2VWB A;  4NB4 A;  3VTI A;  4BRG A;  2Z1G A;  2ZJP L;  3EL2 A;  4QS9 A;  3OYM A;  3MWP A;  1YF5 L;  1IG9 A;  4BR2 A;  4IG0 A;  3VET A;  3V9W A;  1JXB A;  1KFS A;  1C1B A;  1ASV A;  4OPJ A;  3U3G A;  3ENH A;  4EAH D;  3P4I A;  4GKK K;  3ENO A;  4NCG A;  2GV9 A;  1CLQ A;  3VQB A;  3E01 A;  5F0X A;  1YIT N;  4WFA L;  4E7I A;  1SKR A;  1A5W A;  2P9N B;  2QWO A;  1BWF O;  5CYM A;  1KSP A;  4F3O A;  4M45 A;  3THW A;  3U6F A;  3CER A;  4E89 A;  5AQJ A;  4DR2 K;  3UB5 A;  3TTD A;  4LH5 A;  3CCQ N;  5HRS A;  1BDG A;  3SAH A;  4HHT A;  3DOK A;  5BN9 A;  1X9W A;  3OHR A;  1HPM A;  3W3D A;  3EZW A;  2UYT A;  4DR4 K;  3MXI A;  4B3M K;  2ASP A;  2PAV A;  3M6G A;  4EIA A;  3SQ4 A;  3DM2 A;  4IEE A;  2DTU A;  4A5B A;  3BF3 A;  4JAX A;  4MDB A;  2P9L A;  5GIO A;  3ZSO A;  1UA0 A;  1YVN A;  3L2R A;  2HMI A;  3ENB A;  3KD1 E;  4CFC A;  5SWM A;  1D9F A;  1RT4 A;  2KQ2 A;  4CJ3 A;  1J9A A;  1RT5 A;  3CCE N;  1NLV A;  3ALY A;  2GEM A;  4KV8 A;  3D2E B;  4O0J A;  4YHH K;  4LF7 K;  1LW0 A;  5AQT A;  1GOA A;  5J2M A;  4ZTF A;  3L0Q A;  3QIP A;  4AHC A;  2P9U B;  1VQ7 N;  4ELU A;  1NWK A;  1A5V A;  1YHQ N;  3SZ2 A;  4CJS A;  3U9Z A;  3A5M C;  1WSI A;  2E2Q A;  1HLU A;  4BE0 A;  1XC9 A;  4M7Y A;  4F2S A;  3U9D A;  4O55 A;  2P9S B;  4RCH A;  2UXD K;  4IOX A;  4NLC A;  4OPK A;  4JKE A;  1NJZ A;  1VQP N;  4R5P A;  3DXM A;  4HUE A;  3AO1 A;  1C6V A;  4JNE A;  1Q82 O;  2O4I A;  3IS9 A;  4DLG A;  1NK4 A;  3DRS A;  1J5E K;  3O08 A;  4CF2 A;  1IKW A;  4XEI A;  2XHB A;  4W5O A;  1GLE G;  1BA0 A;  5IWA K;  3DOL A;  3F5T A;  2IOC A;  3E9L A;  4FWQ A;  2KHO A;  2J4R A;  2PY5 A;  2DPN A;  4KO0 A;  1N5Y A;  1HKB A;  1NGC A;  4BVO A;  4NXM K;  4B1Y B;  2QKB A;  2HB5 A;  1YTA A;  5LY3 A;  1RTJ A;  4KHP K;  3QB0 A;  2NRW A;  3O8M A;  3CC4 N;  3NGY A;  3CM5 A;  4PL8 A;  4BR5 A;  4Z4F A;  3WQT A;  2F8S A;  3KK7 A;  3D0P A;  2QWN A;  2X78 A;  3CC2 N;  2QEX N;  3DJC A;  4FWK A;  2JWL A;  4JN4 A;  5CE3 A;  3CJ7 A;  2AP1 A;  3G10 A;  4CIG A;  3I8D A;  4IWV A;  4DUZ K;  4KPY A;  4IDK A;  2YV0 X;  2OZM A;  4NCB A;  1KVB A;  4BC4 A;  4WCE L;  4DTM A;  2DFE A;  1Z25 A;  3FLC O;  3O9T A;  4B1V A;  3PLA A;  2Q36 A;  4FW2 A;  3T1A A;  1RTH A;  1VQ4 N;  5LMU K;  1VSL A;  4C1N K;  3WNH A;  4H0T B;  1BHL A;  1C0M A;  1S1W A;  1U2V A;  4DQS A;  4A61 A;  3IRX A;  3NF8 A;  1C0T A;  5JIC A;  4L8R B;  4BQL A;  3O1W A;  3EZ5 A;  2VQF K;  4BRD A;  1KVA A;  3V9U A;  2QWR A;  4CJU A;  4BC5 A;  3SV3 A;  3BY5 A;  1VQ8 N;  1QQN A;  4BRM A;  1ATN A;  4E3S A;  1EWQ A;  5C2F A;  3SPZ A;  1TK0 A;  3AVK A;  3HVR A;  3PX0 A;  2BE2 A;  2ETJ A;  4CK2 A;  4CJ5 A;  4U67 L;  1J54 A;  3HT3 A;  1S9G A;  3VQ7 A;  4BRA A;  4M3U A;  5BPN A;  3R9P A;  3KLG A;  4CZJ A;  5EOY A;  2KZZ A;  4YY3 K;  1WSE A;  1YXQ A;  3O9S A;  2F4V K;  2VGN A;  4FLX A;  2F9W A;  3OA9 A;  3MXJ A;  4AH9 A;  3A0I X;  4H4M A;  4EFH A;  4JI4 K;  4PY5 A;  4CHZ A;  4DTX A;  1YJ9 N;  3THV A;  4DV7 K;  2O8E A;  4DQQ A;  4JK7 A;  4G9Z A;  1T44 A;  5BR8 K;  1QSS A;  2ZGY A;  3HK2 A;  4EHT A;  2NNW A;  3VGK A;  5AQH A;  1NK6 A;  2OA8 A;  3QFU A;  2GTD A;  3L2V A;  2HBJ A;  4F4K A;  3VQ5 A;  4XH5 A;  2R7Y A;  4FZX C;  2P9I A;  3OYI A;  1GLB G;  4DKW A;  3ZX0 A;  4DR5 K;  5C15 A;  4FSV A;  3CPW M;  4OLB A;  3SAG A;  1RCH A;  2FBX A;  1K8K A;  1U49 A;  3LDL A;  3C6T A;  4I7F A;  4J2B A;  5AQZ A;  3NAE A;  3S3O A;  4FZZ A;  4NYF A;  4C8O A;  3MED A;  1TYQ B;  2V51 B;  3VEZ A;  4A5A A;  4LFB K;  3SLC A;  3A8Y A;  1SS6 A;  4FCY A;  4LF9 K;  3TR8 A;  4CES A;  3OYD A;  4DG1 A;  4AQY K;  3CCV N;  2O8C A;  4JI3 K;  3PIO L;  2Z1H A;  3RRH A;  1U47 A;  4BRL A;  4EP5 A;  5AFU A;  4Q5V A;  4CF8 A;  1TUU A;  2XO7 A;  5KTQ A;  3ZET A;  4CVN E;  1TKT A;  4LSL A;  3CM6 A;  5M1O A;  1RBT A;  5KQD A;  4M7X A;  1IKX A;  4C8M A;  5JLH A;  3J8A A;  1DTQ A;  3WUH A;  1IJJ A;  2B5J A;  4F8R A;  1GLD G;  2E2N A;  2Q97 A;  1QQC A;  4FK2 A;  4FPA A;  1U2V B;  3HZ6 A;  3HTV A;  3CJB A;  3KKS A;  1B9D A;  2E4L A;  3VA0 A;  3BDP A;  2NRZ A;  5KPZ A;  1NBW A;  1VQ6 N;  4BG8 A;  4DTP A;  2FSJ A;  3KLH A;  4FVU A;  3ZSR A;  2HHW A;  3CCL N;  4ILG B;  3ATV A;  3AVA A;  3OBY A;  2ASO A;  1HNZ K;  3AVG A;  1QHT A;  3A5L C;  1JXE A;  3WXL A;  3AVL A;  3TI0 A;  2GX9 A;  2VWK A;  1D4X A;  3E66 A;  2QWP A;  4ILH A;  4KHY A;  3WXI A;  3WEE A;  1RBV A;  4CJE A;  2EWS A;  5FRN A;  1C0F A;  4H4O A;  1HKC A;  2HBM A;  4JV5 K;  3O5B A;  3QIN A;  4FJ8 A;  1XNQ K;  1DLO A;  1GOC A;  3UKR B;  2ZGZ A;  1Q9Y A;  1LWF A;  4RW6 A;  3TAF A;  4DSL A;  4CZM A;  4B9S A;  3V9S A;  1IG8 A;  4JKA A;  2HNZ A;  5FPE A;  2F7T A;  5C25 A;  4J8F A;  2OZS A;  4TSX A;  3VEX A;  4IBN A;  3LDO A;  4CHQ A;  4KI4 A;  3QET A;  5AR0 A;  2HST A;  4BRP A;  4DWI A;  4KH4 A;  1Z05 A;  4Q0B A;  1NGD A;  1T6C A;  2YCH A;  1R0A A;  5BRF A;  2VGM A;  2EX3 A;  4OVL A;  5HL7 L;  3NFA A;  2E6M A;  2O8F B;  3O4Q A;  4FJJ A;  1WBD A;  2YI1 A;  1OH8 A;  4KRF A;  2P9K A;  2OPS A;  2P9I B;  2QKK A;  3T7Z A;  1HJR A;  3HSC A;  3KZB A;  5M1P A;  4H0P A;  3VES A;  5HP1 A;  1Q18 A;  3VQE A;  4RW9 A;  3PSI A;  3A5N C;  5J2Q A;  1C0G A;  1JLC A;  4X62 K;  2PYJ A;  4B1X B;  4IDH A;  1S1U A;  3B6O A;  1B92 A;  3IFR A;  2E2O A;  2JWK A;  4JKF A;  5TKY A;  4DSE A;  2G8H A;  3HBT A;  4IO9 L;  2GWK A;  3KWI A;  4IJN A;  3CC7 N;  3CPE A;  4BDZ A;  3PY8 A;  2E8A A;  4CJ7 A;  3KTQ A;  3CD6 N;  1SKS A;  3SJJ A;  1NJX A;  4JK9 A;  1WUA A;  4DCH A;  4KAZ A;  1JLG A;  2YHW A;  2ZF5 O;  3DAW A;  4CF0 A;  2QWQ A;  3CQ8 A;  3J80 O;  2G8F A;  1EP4 A;  4FLZ A;  3VQ6 A;  3J81 O;  5BRD A;  4A59 A;  4KHN A;  1KTQ A;  3FZL A;  1VQ5 N;  5GAD P;  4IOC L;  3QEV A;  4CK1 A;  1NJY A;  3ULE B;  3HJF A;  1J53 A;  4DLE A;  3JS6 A;  3G6E N;  5ADX H;  3OW2 M;  1S6Q A;  1ZBL A;  2O8B B;  4FVM A;  3OVN A;  1ZC6 A;  1ASU A;  3ID6 A;  4QCL A;  1BOT O;  3CFO A;  1QS4 A;  1X1P A;  5LJV A;  3THX B;  3U3Y A;  4MDA A;  3M3Z A;  3S9H A;  4JHD A;  1V4S A;  1BQN A;  1SKW A;  1FKO A;  4FLV A;  3M8R A;  3MX2 A;  5E26 A;  5FPM A;  3NCI A;  1VAZ A;  1YUW A;  4N76 A;  4AHS A;  2A6A A;  4JI0 K;  3KK3 A;  1J5O A;  5D3G A;  4JD2 B;  1NGF A;  3AO5 A;  2ATQ A;  1N32 K;  4B9M A;  3EE9 A;  1T05 A;  5CR4 A;  2P9P B;  3WEE B;  2E1Y A;  3OTO K;  4IKF A;  4FJL A;  3HVT A;  4CGF A;  2FBT A;  4M41 A;  3O1B A;  5AQU A;  1LV5 A;  4KHS A;  3HPH A;  3UKU A;  4K42 A;  3DMJ A;  1GLC G;  3HM9 A;  2IVO A;  4CFB A;  2X6N A;  3HL8 A;  4JS4 A;  4OPA A;  3IMX A;  2XY7 A;  1VQK N;  4B3O A;  5HLF A;  2BGG A;  4B8C A;  3J7Y P;  1KD1 O;  4B9T A;  5KRT A;  2HHX A;  5GAE P;  4YOW A;  1KC8 O;  2WBN A;  5JS1 A;  1RT3 A;  3I56 N;  5BN8 A;  1EXQ A;  3QIO A;  4CD1 A;  4FZY A;  4OGC A;  4FJN A;  4O44 A;  3L3V A;  4DTJ A;  4FM2 A;  3V6D A;  2O4G A;  1KLM A;  3QNN A;  4B3T K;  3QBX A;  3QFP A;  2JGU A;  3LZJ A;  3L2W A;  2E20 A;  1RDA A;  1TK5 A;  3KWG A;  3NH2 A;  4O4G A;  3R8E A;  4DV1 K;  1LAW A;  1OVQ A;  4CK3 A;  3RR7 A;  3KK2 A;  4K0K K;  1MDU B;  2XRI A;  3AAR A;  2E6L A;  1CZB A;  3VEO A;  3PIP L;  4Z4E A;  3O9Q A;  3OYJ A;  3D6R A;  3NDK A;  4CHO A;  5AQK A;  4FK0 A;  5AQX A;  4I2Q A;  5BRH A;  4CIE A;  1VSI A;  2V7Y A;  1WLJ A;  3OJU A;  1NKC A;  4DR3 K;  1QE1 A;  4H5N A;  1EET A;  1S9E A;  4WQ4 C;  1RBU A;  4HTU A;  2G8V A;  4B9L A;  3LP0 A;  5I9E B;  4FWR A;  4AM7 A;  3MEG A;  3T1Y K;  1E4F T;  2V52 B;  5DM7 L;  2W42 A;  2OYQ A;  3S41 A;  4FWN A;  1BCM A;  5CZ2 A;  3C0B A;  5CYQ A;  4E0D A;  4JEP A;  3LP3 A;  5EXW A;  4KHW A;  1HNV A;  3OYL A;  4IXC A;  4BRK A;  1IO2 A;  1SAZ A;  4YDU C;  3U4L A;  1BUP A;  4FJM A;  3HST B;  1I94 K;  4JKC A;  2BH1 A;  5FPD A;  3J7A P;  4H0V B;  4W5R A;  4B9V A;  1OH6 A;  5JMV A;  1ZBF A;  4JHD B;  1JL2 A;  3VA3 A;  2YHA A;  1NU0 A;  4HVJ A;  2VQE K;  1ZBU A;  3DRP A;  4M3T A;  3MN9 A;  3TWH A;  3FZH A;  5KPR A;  1VK0 A;  1WAJ A;  1IKY A;  1OVY A;  4BE1 A;  3SUP A;  2ITG A;  5CY4 A;  1HKG A;  1L3V A;  1WNS A;  4CF9 A;  3BF1 A;  3THY B;  2IVN A;  3TSP A;  3CJA A;  3SAF A;  3G71 N;  2RE2 A;  2OPQ A;  5C2D A;  1HQU A;  3MWT A;  4OX9 K;  3EKS A;  4LY7 A;  3KLE A;  4H5T A;  4FLU A;  1XC3 A;  1L3T A;  4CCH A;  3AA2 A;  3T1H K;  4K8X A;  4DSI A;  3L3U A;  3OYG A;  4I6M A;  1ZBH A;  2NRH A;  3D2F A;  3DXK A;  4F2R A;  5M1F A;  1DGK N;  3LPT A;  4QAG A;  2F9T A;  5KQ8 A;  3SCX A;  2QM1 A;  2YJE A;  2NLX A;  3DLE A;  3VQD A;  4E1J A;  1SUQ A;  1VSF A;  3CYM A;  2G8W A;  4B9Q A;  1TL3 A;  2H3G X;  5AQY A;  1S1V A;  1QHA A;  2QXF A;  5J2P A;  2NRX A;  3ISN C;  3QER A;  4CD3 A;  1Q7Y O;  4N47 A;  3WXK A;  2ZQB A;  3LWM A;  1BL3 A;  3PO5 A;  3ZSX A;  4LF8 K;  4BC2 A;  2FLO A;  2Q0U A;  1BI4 A;  1KCF A;  4C8K A;  4K43 A;  3CET A;  2Q3S A;  4DTR A;  3P38 A;  4L3Q A;  4GKJ K;  3N4Q A;  4B08 A;  1OKJ A;  5AQQ A;  4CW7 B;  2LSN A;  3THW B;  3SQ1 A;  4BR9 A;  1NGB A;  1Z6R A;  3FZF A;  3ATU A;  2Q31 A;  5CZ1 A;  3MK6 A;  3RMC A;  3OYC A;  2CGJ A;  4RWT A;  4DHY A;  5C0Y A;  4DF8 A;  3O9U A;  4PKI A;  4LC9 B;  2KW4 A;  4FWP A;  1ATS A;  4DB3 A;  1N34 K;  1UOC A;  4H0Y B;  4CHN A;  4BRE A;  2P9L B;  1IBK K;  4BQZ A;  3ZT0 A;  4M3R A;  5IT9 O;  1VHX A;  1ZBI A;  4FXD A;  3VF6 A;  3TAM A;  3FFK B;  3RSE A;  3JXU A;  3ZT1 A;  1NMN A;  2AJQ A;  4GV9 A;  2NRR A;  1HYS A;  4BRC A;  1A5X A;  3OYA A;  2Y1I A;  1NOY A;  1XMQ K;  4DTU A;  4HCB A;  4JKB A;  1VQN N;  3ZT4 A;  4Z0U A;  3UIQ A;  4W5N A;  5BPM A;  2VG6 A;  3VMF B;  4FLW A;  4WQ5 C;  1L3S A;  1WBB A;  1BO5 O;  2WUS A;  3WQU A;  4FJX A;  1RDW X;  1WSH A;  4BGB A;  3BGR A;  3S3M A;  1U45 A;  2WTU A;  2A41 A;  4JKD A;  4DR7 K;  2I5J A;  4B1U B;  4RW4 A;  4DU1 A;  4IFV A;  5DM6 L;  5AZJ A;  3T3F A;  5CHI A;  1VRU A;  3VER A;  4CEC A;  5AQG A;  5DK5 A;  2D1K A;  3AO2 A;  3TSU A;  1XWL A;  1JL1 A;  2Q0R A;  5C24 A;  3DXM B;  3LP2 A;  4DTO A;  5H1S Q;  3G4S N;  4DQR A;  1EO1 A;  1HPZ A;  3HM8 A;  4BR0 A;  4CFA A;  3AVB A;  3BZK A;  3LDS A;  2ZWH A;  3ZSQ A;  1XUP O;  3A2F A;  1VSJ A;  1GLF O;  4DUY K;  2BDP A;  1NK7 A;  2VYP A;  3SMP A;  4EZ6 A;  4KRE A;  3GG4 A;  3P5J A;  3FZM A;  5E41 A;  1ZYQ A;  4LD0 A;  1WOQ A;  2QWL A;  4FLY A;  4R79 A;  3OYN A;  4KKO A;  3FGU A;  4CE9 A;  4IOA L;  1SL0 A;  4CJF A;  3LDP A;  4I6M B;  3QEP A;  1TKD A;  1K9M O;  1HUX A;  4E19 A;  5C12 A;  2A1R A;  4M3W A;  2UXB K;  2CGK A;  1HNX K;  2HHQ A;  4BY9 C;  2HHS A;  3JAM O;  1BA1 A;  4BRO A;  3C6A A;  4Z4G A;  4AHU A;  4OLA A;  4LF6 K;  2YX6 A;  1D9D A;  2KLA A;  1MU2 A;  2YHB A;  2OTL N;  1HYZ A;  4GV6 A;  4YOT A;  1YJW N;  4YOR A;  4C8L A;  3R3L A;  5C42 A;  2DFH A;  2DY4 A;  3BZC A;  4ISF A;  2B6A A;  4OJR A;  1ZXO A;  1KXP A;  4J2A A;  1BI4 B;  1BIS A;  4OKJ A;  1SZ2 A;  3KHY A;  3KIO A;  4FJ5 A;  2RN2 A;  2IVP A;  1S1X A;  1VSK A;  1NK5 A;  1IKV A;  3WXM B;  2WOM A;  5AZI A;  1KRP A;  3P31 A;  4HCC A;  4NCA A;  3G25 A;  3VPZ A;  4JS5 A;  1L3U A;  3TPQ A;  4Y1C A;  5AQV A;  3SUN A;  1MWK A;  3H3N O;  1NK9 A;  3ZCM A;  4K25 A;  1RT7 A;  4E7L A;  3VEN A;  2KKZ A;  4CZK A;  1P8Z A;  2WC9 A;  4BRH A;  3AAP A;  3SBT A;  1MA9 B;  5GIN A;  4V19 S;  4BWM A;  4CEB A;  2HND A;  4PWD A;  1XQS C;  1M1K O;  4A57 A;  1Q9X A;  3QEX A;  4MFB A;  1CXU A;  5HRR A;  4FJH A;  5AQW A;  2HBL A;  3PSF A;  4YOV A;  5KGX A;  2VWJ A;  3O3F A;  3PV8 A;  1JKH A;  4DS5 A;  1NGA A;  1DKG D;  3P1G A;  5HRO A;  3IG1 A;  2OAN A;  2CH6 A;  3CQX A;  4CBX A;  4FJI A;  5HOO A;  4CJQ A;  3AVF A;  2D0C A;  5KI6 A;  3LAK A;  3OYF A;  1SL2 A;  4MO4 A;  5AQO A;  1KFD A;  4CGI A;  1JCG A;  4LSN A;  4BRQ A;  4BE2 A;  1IV0 A;  1RDC A;  3KLF A;  1BG3 A;  4GVM A;  4M3X A;  4X64 K;  4BG9 A;  2HVH A;  1JLE A;  5I3U A;  4FPB A;  2KFN A;  2GUI A;  2O8E B;  2WFB A;  1NGE A;  4KTZ A;  3K9J A;  3ZT3 A;  3MCP A;  3L4Q A;  3HYF A;  5B8H A;  4DQI A;  2Q2R A;  5M1N A;  2KZM A;  3DWL A;  4GY2 B;  3O80 A;  4HUF A;  3DRR A;  1LWC A;  3TAN A;  5HBM A;  3HOS A;  3SI6 A;  4JK8 A;  1T7P A;  3H1V X;  1T6D A;  3L4I A;  1NK8 A;  3CME N;  1RDD A;  4CGD A;  4W5Q A;  2FC0 A;  4ID1 A;  4WQ4 A;  3ULD A;  3TSQ A;  3K57 A;  3JYT A;  4GNI A;  1YVU A;  1K8K B;  3K5N A;  4PL7 A;  2UU9 K;  3DLB A;  3RR8 A;  3OBW A;  3GOI A;  3M8P A;  1X3M A;  3NGZ A;  1YAG A;  2EHG A;  3MMV A;  4CBW A;  1G99 A;  3M8S A;  4OKE A;  3CI5 A;  4CHY A;  3MN7 A;  1FW6 A;  1VSD A;  1Q8I A;  1RIL A;  3EEQ A;  4Y0W A;  3NF6 A;  1HQE A;  2E5L K;  1NGJ A;  5AJ3 K;  4KI6 A;  4UQG A;  1HMV A;  4DV2 K;  3OS2 A;  4FLT A;  1QSY A;  3LPU A;  1F21 A;  4YDU A;  3HPG A;  2O8C B;  4LFA K;  4PHT X;  1YTU A;  4PUO A;  2VG7 A;  4CZH A;  4DQ8 A;  5AQP A;  1NK0 A;  4DTN A;  4ZTJ A;  3QML A;  3ZET B;  4FL9 A;  4DFJ A;  3QDK A;  3TU5 A;  4CEO A;  3ASM A;  3NBP A;  4ELV A;  3HP9 A;  1LAV A;  4DSJ A;  1KAZ A;  3SMS A;  3VTH A;  4NO7 A;  1NGH A;  4PKH A;  1IBL K;  3AA5 X;  4XH1 A;  4JKH A;  2HMP A;  2FBY A;  3FR0 A;  3I8B A;  4YOX A;  3D2E A;  4CJ4 A;  1LCU A;  4FOE A;  2B4J A;  1QSL A;  4KB0 A;  3F2K A;  3I0R A;  5ELZ A;  4NYN A;  2NUB A;  3HXM A;  3PUF A;  3FE1 A;  3VGM A;  2NZT A;  5LL6 Z;  3KLI A;  4O8U A;  1O13 A;  1J6Z A;  4H5V A;  2KFZ A;  5AQF A;  1I39 A;  1TGO A;  5BPL A;  2D0P A;  4AF1 A;  1BQM A;  5K14 A;  2IDO A;  5GAG P;  4I9L A;  1JLA A;  1ITG A;  4OKK A;  1I3A A;  3K9K A;  2ITM A;  3EKU A;  5FDL A;  3HPO A;  2FF3 B;  3NH1 A;  4BGA A;  3LWL A;  1SL1 A;  4JI2 K;  4DR6 K;  3O4W A;  5KGW A;  4UY8 O;  4F9O A;  3RMA A;  2HHT A;  2XY6 A;  5FLX O;  2VG5 A;  2YHX A;  1RTD A;  1X3N A;  4M42 A;  4OO1 J;  2ZE2 A;  4GMJ B;  4GV3 A;  3CF5 L;  3M1F A;  3VN5 A;  1Y64 A;  3NF9 A;  3MXM A;  3HOT A;  1UA1 A;  3FZK A;  3RMB A;  2NRV A;  4B9U A;  4NXN K;  3CXC M;  2W6K A;  3CQY A;  3KJV A;  1TAQ A;  3LP1 A;  2XY5 A;  3T19 A;  5SZT A;  1QZ6 A;  1NJI O;  2E2P A;  3LM9 A;  3LZI A;  2RKI A;  2HHH K;  4IO8 A;  1Q86 O;  3QES A;  2FSN A;  5EU7 A;  4DV5 K;  2IGI A;  4KB1 A;  2P9K B;  1S3X A;  5E84 A;  3AVM A;  5LMN K;  4DFP A;  2UXC K;  2D0O A;  4N56 A;  1HJO A;  4PKG A;  3B8A X;  5JVG L;  1KVC A;  2RHK A;  3T69 A;  1V4T A;  2ZM6 K;  2HVI A;  3NVK A;  2G8I A;  1WAF A;  4DS4 A;  1DT9 A;  4KH6 A;  3QEW A;  3E9P A;  5GIP A;  2YNI A;  4C8N A;  4LF4 K;  4CEF A;  2E88 A;  1VSM A;  2PBD A;  3TAP A;  1CZ9 A;  5AQR A;  1ATR A;  1FK9 A;  3WXJ A;  1C0U A;  3CHW A;  4WQ5 A;  4B3R K;  4ZHR A;  3AO3 A;  5ADX A;  5M1Q A;  1TAU A;  1T03 A;  4JLH A;  4CEE A;  2QI2 A;  3G0Z A;  3WT0 A;  1QTM A;  3P39 A;  1BCO A;  4FWM A;  1VQL N;  1D5A A;  1NMD A;  3GBT A;  3CFP A;  3DLH A;  4QS8 A;  4KHU A;  4BR4 A;  2QA4 N;  3NF7 A;  3O9R A;  3DYA A;  3V1Q A;  5JVH L;  3V81 A;  2Z1J A;  3BP8 A;  4KBO A;  3EY1 A;  4CJP A;  3TTF A;  3VEV A;  3QNO A;  3VEY A;  1VSH A;  2RPI A;  4DQP A;  1NG9 A;  3MN6 A;  3NE6 A;  2PYL A;  3L2U A;  4FO0 A;  3K58 A;  1FJG K;  2ASM A;  1BIZ A;  4CEQ A;  4YOY A;  4W5T A;  3OYH A;  3U8X A;  2QTD A;  1YJN N;  1W7A A;  4YOU A;  3BEX A;  4GW6 A;  3E1Y A;  3ZX3 A;  1S22 A;  3OYK A;  4DR1 K;  4HTL A;  1C1C A;  2A1S A;  4E7H A;  4FM1 A;  3DI6 A;  3IKM A;  4JRP A;  2YNG A;  1HNW K;  3DLK A;  4E7J A;  2QK9 A;  2X6S A;  3J7Z O;  3SV4 A;  4DF4 A;  1B9F A;  1Q81 O;  5JLF A;  3SJH A;  1GLJ O;  4FWS A;  1RDU A;  4DV6 K;  4KTQ A;  3AVI A;  4JYA K;  4CJK A;  4DV3 K;  3C6H A;  3UKU B;  4JI5 K;  4YFU A;  2UUB K;  1W2B M;  2F96 A;  3K5L A;  5F1X A;  3IUC A;  4FWL A;  2E1Z A;  4E1M A;  4BC3 A;  4I9Q A;  4B3S K;  1NGI A;  1VQ9 N;  1NNE A;  2AA4 A;  4AHR A;  5J1E A;  1WSG A;  2G8K A;  4CED A;  2HW3 A;  3AY9 A;  3FFI A;  4H5R A;  1TYQ A;  2OPR A;  2PFU A;  3MN5 A;  1ASW A;  1H1V A;  1RBR A;  2O8D A;  1EX4 A;  4DU3 A;  5MLC Q;  2F8T A;  4HWI A;  1UAX A;  4CI6 A;  4HUG A;  4ELT A;  3D7E O;  5KRS A;  3BUZ B;  1S72 N;  3EE8 A;  3C95 A;  1KAY A;  4JI1 K;  1N33 K;  5AQI A;  3VEW A;  3K5M A;  1OH7 A;  1RDB A;  4N41 A;  3P83 D;  2UUA K;  1EWR A;  1QQM A;  3AA3 A;  3H45 C;  4MQ3 A;  3CJC A;  4KTW A;  3NHG A;  3NMU A;  3M8Q A;  4CJR A;  1TKZ A;  3Q7C A;  2P1J A;  3CMA N;  1RNH A;  3K0S A;  2BAN A;  4AHV A;  1X9S A;  1KLN A;  1W97 L;  2PZS A;  3QBW A;  3IAY A;  2QW9 A;  2DFF A;  5FPN A;  4J2E A;  3CCS N;  5AFU H;  2D0A A;  3ZSY A;  3LAM A;  1U48 A;  2HOE A;  2OCE A;  1TL1 A;  1WB9 A;  4RG8 A;  3LDN A;  2FSK A;  3MEC A;  1XHZ A;  1NOZ A;  3VF2 A;  5M1K A;  5KPT A;  1L5U A;  1MWM A;  3TAR A;  4CFD A;  3ITH A;  3F9M A;  1M90 O;  1JCF A;  4CJL A;  4AHT A;  4AM6 A;  2IIR A;  3SPY A;  3CG7 A;  4PA1 A;  3SBG A;  4CEZ A;  2G8U A;  2ZJR L;  1JCE A;  4CZL A;  1BIU A;  3PX4 A;  3Q7B A;  4CGH A;  3QIC A;  2P51 A;  5TKW A;  4JI7 K;  4CEA A;  4BRI A;  1IBM K;  3ZSV A;  2IS3 A;  1NGG A;  4OPH A;  3V9X A;  1UWB A;  5EY4 A;  3O4N A;  3UKR A;  2Y1J A;  2D4W A;  2FF6 A;  3NH0 A;  3H6E A;  3RWU A;  4DSK A;  4CER A;  5BR9 A;  4IJA A;  4GVE A;  3CCJ N;  3CCM N;  3I33 A;  5AQS A;  4G1Q A;  5A2Q O;  4RW8 A;  1LWE A;  3VGL A;  4Z4C A;  4CBU A;  2HHU A;  4DMN A;  4H8K A;  1RGI A;  1E3M A;  4EZ9 A;  3F9K A;  4XIU A;  3SUO A;  4FJK A;  3RRG A;  4CHP A;  1RT2 A;  1K6Y A;  2RF2 A;  1XI1 A;  3V9Z A;  3TAQ A;  1KQS M;  3K2P A;  2O8F A;  4E7K A;  1W0H A;  2X74 A;  3ZEU A;  4LFC K;  3C6U A;  2GUP A;  4H0X B;  5EVZ A;  3VF4 A;  2I7P A;  1HRH A;  4CZI A;  1N36 K;  4WF9 L;  4JI8 K;  1LW2 A;  4CGJ A;  1LOT B;  4FJ7 A;  3VQC A;  3D2F B;  1BGX T;  3DXK B;  3PX6 A;  1TUY A;  4BVP A;  4CF1 A;  3L6Q A;  3OY9 A;  4JKG A;  4AIL C;  1YI2 N;  1NKE A;  3AVJ A;  3O3H A;  3L2Q A;  1R59 O;  4ISE A;  3VQP A;  1GOB A;  1S1T A;  4YNQ A;  2A5X A;  5DMR A;  3CCU N;  2V7Z A;  3NVM A;  5GAH P;  1U4B A;  4XH4 A;  1YIJ N;  1CZA N;  1BU6 O;  1HR0 K;  2O8D B;  1K8A O;  3OYE A;  4DV4 K;  5BRE A;  4BRN A;  4ICL A;  4KH5 A;  3K59 A;  4U7B A;  3KVG A;  3CCR N;  2W40 A;  4N5S A;  1VQM N;  4I2P A;  1DEJ A;  2YNF A;  3AGK A;  3LAL A;  3C7N A;  3ZT2 A;  4E1N A;  3NGI A;  3TTC A;  1TVR A;  3OS0 A;  2D5R A;  4MLE A;  3C94 A;  5FRM A;  5C10 A;  3SK3 A;  4NLB A;  5I42 A;  4ID5 A;  4LF5 K;  3ULE A;  2KTQ A;  3SQ0 A;  4BR7 A;  3F73 A;  1HNI A;  3I55 N;  3S3N A;  1NJW A;  1N8R O;  3WNE A;  3OYB A;  4BWJ A;  4RTF D;  1Y97 A;  1HYV A;  3CIP A;  2O8B A;  4DTS A;  2NRT A;  2A3Z A;  4CJV A;  4Y1D A;  4IZ9 A;  5HRN A;  3R1X A;  3SQ2 A;  3SUQ A;  2IC3 A;  4C23 A;  4A2B A;  3MCA B;  3THX A;  3VQ8 A;  1RBS A;  4BAC A;  1EKE A;  3RMD A;  1JJ2 M;  3GDQ A;  1JLB A;  2XY8 A;  3RSE B;  1O1W A;  3JSM A;  1VRT A;  1GLA G;  3B6P A;  3HP6 A;  1FKP A;  4FJG A;  2HF3 A;  4M3Z A;  3ZSZ A;  1Z26 A;  4KFB A;  5T7B A;  2IAJ A;  2OPP A;  2D0B A;  4JD2 A;  4KHQ A;  3GE1 A;  5AQL A;  3H46 O;  4RW7 A;  3R6M A;  2UUC K;  4J2D A;  3VQ4 A;  4DV0 K;  2Q1N A;  4CJW A;  1QZ5 A;  1P90 A;  2P9P A;  3RTV A;  1K73 O;  4B1Z A;  3I0S A;  2GWJ A;  3AV9 A;  1VSE A;  4CIF A;  3TAE A;  3KKR A;  2GBZ A;  3VQQ A;  3TAG A;  4FJ9 A;  5AZJ B;  3V1R A;  4O8K A;  1QVG M;  3EN9 A;  1TV6 A;  2A42 A;  2WON A;  2ZJQ L;  1RTI A;  1EQY A;  2W41 A;  5LJW A;  4IG3 A;  3PO4 A;  4A62 A;  3QEI A;  1X9J A;  4M3Y A;  4CJT A;  1WSF A;  3ZSW A;  4BRF A;  1D8Y A;  4LH4 A;  2P5O A;  3SYZ A;  4FK4 A;  4MLH A;  3MEE A;  3MX5 A;  2BTF A;  5FRO A;  3ZLJ A;  3DLL L;  4JI6 K;  4ILJ A;  3O6W A;  4O5B A;  1ESV A;  3H3O B;  1VQO N;  4Z94 A;  3WNF A;  3RVC A;  3VQA A;  4X66 K;  3HI0 A;  1GLL O;  1XHX A;  2ZD1 A;  1ZBS A;  2CH5 A;  5F2R A;  3A5O C;  4H03 B;  4BDP A;  1CXQ A;  2P9N A;  3ID8 A;  3ZEU B;  2FBV A;  3H1Q A;  1RT6 A;  1RT1 A;  2VCP A;  3V4I A;  1FXX A;  4CGG A;  1NM1 A;  3E9O A;  3IDH A;  1S6P A;  2OTJ N;  4FWO A;  1NKB A;  3M5R A;  1JLF A;  4ISG A;  2Z1I A;  4EHU A;  4QS7 A;  4JKG B;  3C65 A;  3HRG A;  4DU4 A;  2JLE A; 
#chains in the Genus database with same CATH homology
 3RRH A;  1TKX A;  1U47 A;  2YNI A;  4C8N A;  4B08 A;  3QLH A;  1WSJ A;  3AA4 A;  4CEF A;  4B8A B;  4EP5 A;  4IFY A;  2LSN A;  1WN7 A;  1W9H A;  4Q5V A;  1VSM A;  4CF8 A;  3SQ1 A;  2XO7 A;  5KTQ A;  3TAP A;  1CZ9 A;  1TKT A;  4LSL A;  1FK9 A;  2HNY A;  3CM6 A;  4JRQ A;  3D45 A;  1C0U A;  4DFM A;  1RBT A;  1X9M A;  4ZHR A;  1IKX A;  4C8M A;  3AO3 A;  1DTQ A;  2B5J A;  5CZ1 A;  4B9N A;  3RMC A;  1T03 A;  4F8R A;  4QOZ B;  1TAU A;  4Z4I A;  2P5G A;  4JLH A;  4CEE A;  1QQC A;  3G0Z A;  3OYC A;  1IH7 A;  1QTM A;  1BCO A;  2YNH A;  4FK2 A;  5HRP A;  4K8Z A;  1D5A A;  4DF8 A;  3AVC A;  3KKS A;  1REV A;  1B9D A;  2KW4 A;  3CFP A;  3DLH A;  3L8B A;  1UOC A;  4KHU A;  2E4L A;  3NF7 A;  4CHN A;  3EYZ A;  3VA0 A;  3BDP A;  2YKN A;  3DYA A;  3V1Q A;  3ZT0 A;  4M3R A;  1ZBI A;  3V81 A;  4FXD A;  2Z1J A;  3EY1 A;  3DLG A;  3TAM A;  4CJP A;  4FW1 A;  4DTP A;  1G15 A;  3QNO A;  3ZT1 A;  2AJQ A;  1HYS A;  1VSH A;  2RPI A;  3KLH A;  1JLQ A;  4DQP A;  3OYA A;  1A5X A;  1YT3 A;  3ZSR A;  3NE6 A;  2Y1I A;  1NOY A;  4DSF A;  2PYL A;  2HHW A;  3L2U A;  3AVA A;  4DTU A;  3CFR A;  3AVG A;  1QHT A;  4HCB A;  3SNN A;  4EP4 A;  3K5O A;  1JXE A;  3K58 A;  3QO9 A;  3AVL A;  1BIZ A;  4CEQ A;  3TI0 A;  3AVH A;  4W5T A;  3OYH A;  3KK1 A;  3ZT4 A;  4Z0U A;  5J2N A;  3UIQ A;  4W5N A;  2VWK A;  2VG6 A;  4KHY A;  1T8E A;  4GW6 A;  3KD5 E;  1TK8 A;  3OYK A;  4FLW A;  4DFK A;  1L3S A;  1RBV A;  4CJE A;  5FRN A;  1C1C A;  2A1S A;  4E7H A;  3OJS A;  4FM1 A;  3DI6 A;  4FJX A;  4H4O A;  1WSH A;  3O3G A;  4FJ8 A;  3QIN A;  1U04 A;  2YKM A;  3BGR A;  1DLO A;  1GOC A;  3S3M A;  1U45 A;  4JRP A;  2I5J A;  1SV5 A;  2YNG A;  3AO4 A;  3AVN A;  3DLK A;  4RW4 A;  4IFV A;  4E7J A;  4DU1 A;  1LWF A;  1Q9Y A;  2QK9 A;  4FYD A;  4RW6 A;  2X6S A;  3SV4 A;  3T3F A;  3TAF A;  3WNG A;  3VQ9 A;  4DSL A;  1VRU A;  4DF4 A;  3H08 A;  3DLR A;  3V1O A;  4B9S A;  1B9F A;  3V9S A;  4F3T A;  2HHV A;  4CEC A;  2HNZ A;  3OS1 A;  5C25 A;  4OGE A;  5DK5 A;  3AO2 A;  1XWL A;  4KTQ A;  3AVI A;  1C1A A;  1JL1 A;  4BDY A;  3LAN A;  2OZS A;  5C24 A;  3LP2 A;  4TSX A;  4DTO A;  4WE1 A;  4IBN A;  4CHQ A;  4CJK A;  4DQR A;  4KI4 A;  1HPZ A;  4FM0 A;  3QET A;  4CFA A;  4YFU A;  3TAB A;  5JS2 A;  3AVB A;  1S5J A;  4Z4H A;  3LDS A;  3ZSQ A;  4DWI A;  4Q0B A;  2F96 A;  3K5L A;  3HO1 A;  3A2F A;  1N6Q A;  1DTT A;  4O0I A;  1VSJ A;  1R0A A;  4PQU A;  2EX3 A;  4E1M A;  3MAQ A;  4I9Q A;  4OVL A;  2BDP A;  1NK7 A;  2Z1G A;  3NFA A;  4EZ6 A;  4KRE A;  2E6M A;  3O4Q A;  3P5J A;  5E41 A;  1ZYQ A;  4LD0 A;  4AHR A;  3OYM A;  5J1E A;  4FJJ A;  1WSG A;  2G8K A;  4CED A;  2HW3 A;  4FLY A;  4KRF A;  1IG9 A;  3FFI A;  4IG0 A;  3OYN A;  3V9W A;  1JXB A;  2OPS A;  1KFS A;  2OPR A;  4KKO A;  1C1B A;  2QKK A;  1ASV A;  4OPJ A;  3U3G A;  4CE9 A;  1ASW A;  1SL0 A;  1HJR A;  1RBR A;  4CJF A;  3QEP A;  1EX4 A;  1TKD A;  4E19 A;  4DU3 A;  2F8T A;  2A1R A;  1UAX A;  4NCG A;  4HUG A;  4ELT A;  4M3W A;  5HP1 A;  2GV9 A;  3VQE A;  4RW9 A;  2HHQ A;  1CLQ A;  5KRS A;  5J2Q A;  2HHS A;  3VQB A;  1JLC A;  3C95 A;  3E01 A;  2PYJ A;  4E7I A;  1S1U A;  3B6O A;  1B92 A;  1SKR A;  4Z4G A;  1A5W A;  4AHU A;  3K5M A;  4OLA A;  1D9D A;  5CYM A;  1KSP A;  4F3O A;  1MU2 A;  1RDB A;  4M45 A;  2YHB A;  4DSE A;  3U6F A;  4N41 A;  4E89 A;  2G8H A;  1HYZ A;  3P83 D;  3AA3 A;  4MQ3 A;  4C8L A;  4KTW A;  4LH5 A;  5HRS A;  5C42 A;  2DFH A;  3NHG A;  4BDZ A;  2DY4 A;  4HHT A;  3DOK A;  2B6A A;  3M8Q A;  4OJR A;  3PY8 A;  4CJR A;  1TKZ A;  1X9W A;  3KTQ A;  2P1J A;  4J2A A;  1RNH A;  1BI4 B;  1BIS A;  3SJJ A;  1SKS A;  1NJX A;  2BAN A;  4OKJ A;  4AHV A;  4KAZ A;  1JLG A;  3KIO A;  1X9S A;  1KLN A;  4FJ5 A;  4CF0 A;  2PZS A;  2RN2 A;  3CQ8 A;  3MXI A;  3IAY A;  1S1X A;  2G8F A;  1VSK A;  1EP4 A;  2DFF A;  4FLZ A;  1NK5 A;  1IKV A;  3VQ6 A;  4J2E A;  3SQ4 A;  2WOM A;  4KHN A;  3DM2 A;  1KRP A;  2D0A A;  3ZSY A;  3LAM A;  1KTQ A;  2DTU A;  1U48 A;  4HCC A;  4NCA A;  4JS5 A;  3ZSO A;  1TL1 A;  1UA0 A;  4RG8 A;  1L3U A;  3QEV A;  3MEC A;  4Y1C A;  3SUN A;  1XHZ A;  1NOZ A;  4CK1 A;  1NJY A;  1L5U A;  3HJF A;  1NK9 A;  3ZCM A;  3L2R A;  1J53 A;  2HMI A;  1RT7 A;  4DLE A;  3TAR A;  4CFD A;  4E7L A;  3ITH A;  3KD1 E;  4CFC A;  1S6Q A;  5SWM A;  1D9F A;  1ZBL A;  1RT4 A;  2KQ2 A;  4CJL A;  4AHT A;  4FVM A;  4CJ3 A;  3OVN A;  1ASU A;  1J9A A;  1RT5 A;  3SPY A;  3CG7 A;  4QCL A;  4PA1 A;  3ALY A;  4CEZ A;  2G8U A;  3PX4 A;  4BWM A;  1BIU A;  3CFO A;  4CEB A;  2HND A;  1QS4 A;  4O0J A;  4KV8 A;  4CGH A;  1X1P A;  1LW0 A;  4PWD A;  3U3Y A;  2P51 A;  3S9H A;  4CEA A;  1Q9X A;  3QEX A;  1BQN A;  4MFB A;  1FKO A;  1SKW A;  1CXU A;  1GOA A;  5HRR A;  5J2M A;  3QEW A;  4ZTF A;  3ZSV A;  4FLV A;  3QIP A;  3M8R A;  4FJH A;  4AHC A;  4ELU A;  2VWJ A;  5KGX A;  3NCI A;  3O3F A;  2IS3 A;  1A5V A;  1JKH A;  3PV8 A;  3SZ2 A;  4DS5 A;  3V9X A;  1UWB A;  3P1G A;  4CJS A;  5HRO A;  3IG1 A;  3O4N A;  4N76 A;  4AHS A;  2Y1J A;  1WSI A;  3NH0 A;  3RWU A;  4DSK A;  4CER A;  3KK3 A;  1J5O A;  5D3G A;  4FJI A;  4BE0 A;  4CJQ A;  1XC9 A;  4F2S A;  4G1Q A;  3AO5 A;  3AVF A;  2D0C A;  4O55 A;  2ATQ A;  5KI6 A;  3LAK A;  4RW8 A;  3OYF A;  1SL2 A;  1LWE A;  4B9M A;  1T05 A;  1KFD A;  4OPK A;  4CGI A;  4Z4C A;  4LSN A;  4BE2 A;  4IKF A;  1NJZ A;  4FJL A;  1RDC A;  3HVT A;  4CGF A;  2FBT A;  3KLF A;  4R5P A;  4GVM A;  4M3X A;  4M41 A;  4HUE A;  2HVH A;  4KHS A;  3AO1 A;  1LV5 A;  3HPH A;  1C6V A;  1JLE A;  5I3U A;  4DMN A;  4H8K A;  2HHU A;  2O4I A;  3IS9 A;  2KFN A;  3DMJ A;  4DLG A;  2GUI A;  3HM9 A;  1NK4 A;  4EZ9 A;  3DRS A;  3F9K A;  4KTZ A;  4CF2 A;  4XIU A;  1IKW A;  4CFB A;  2X6N A;  3ZT3 A;  3SUO A;  3HL8 A;  3HYF A;  2XHB A;  4JS4 A;  4W5O A;  3RRG A;  4CHP A;  4FJK A;  4DQI A;  1RT2 A;  1K6Y A;  2RF2 A;  1XI1 A;  3V9Z A;  3TAQ A;  2XY7 A;  3DOL A;  3K2P A;  2KZM A;  4B3O A;  5HLF A;  2IOC A;  2BGG A;  4B8C A;  2PY5 A;  4KO0 A;  4E7K A;  1N5Y A;  1W0H A;  2X74 A;  4HUF A;  3DRR A;  4B9T A;  3C6U A;  5KRT A;  1LWC A;  3TAN A;  5HBM A;  2HB5 A;  3SI6 A;  1YTA A;  1T7P A;  1RTJ A;  2QKB A;  2HHX A;  1NK8 A;  1HRH A;  1RDD A;  4CGD A;  4W5Q A;  5JS1 A;  2FC0 A;  4ID1 A;  1LW2 A;  1RT3 A;  3CM5 A;  3NGY A;  4CGJ A;  3ULD A;  1EXQ A;  3K57 A;  3QIO A;  3VQC A;  3JYT A;  4FJ7 A;  4Z4F A;  1BGX T;  1YVU A;  3PX6 A;  4FZY A;  4OGC A;  3K5N A;  4FJN A;  2F8S A;  3DLB A;  4O44 A;  4CF1 A;  3D0P A;  2X78 A;  3OY9 A;  3L3V A;  3RR8 A;  4AIL C;  3M8P A;  1NKE A;  4DTJ A;  3AVJ A;  3O3H A;  3L2Q A;  3NGZ A;  4FM2 A;  3V6D A;  2O4G A;  1KLM A;  2EHG A;  3VQP A;  3QNN A;  1GOB A;  1S1T A;  4YNQ A;  3M8S A;  4OKE A;  3G10 A;  4CIG A;  4CHY A;  2JGU A;  3I8D A;  5DMR A;  3LZJ A;  1VSD A;  1Q8I A;  1RIL A;  3L2W A;  4IDK A;  1RDA A;  1U4B A;  4KPY A;  2YV0 X;  3NF6 A;  1HQE A;  1TK5 A;  3NH2 A;  4O4G A;  1LAW A;  2OZM A;  4NCB A;  4KI6 A;  1KVB A;  4UQG A;  3OYE A;  1HMV A;  2DFE A;  4DTM A;  4CK3 A;  1Z25 A;  3RR7 A;  3OS2 A;  4FW2 A;  4ICL A;  3KK2 A;  4FLT A;  3LPU A;  3K59 A;  1QSY A;  1F21 A;  1RTH A;  2XRI A;  3T1A A;  3HPG A;  2E6L A;  1YTU A;  1VSL A;  1CZB A;  4PUO A;  2VG7 A;  3WNH A;  4Z4E A;  3OYJ A;  3NDK A;  1BHL A;  4CHO A;  1C0M A;  4N5S A;  1S1W A;  1NK0 A;  4I2Q A;  4FK0 A;  4DTN A;  4DQS A;  4CIE A;  4ZTJ A;  4I2P A;  1VSI A;  2YNF A;  1WLJ A;  3IRX A;  3LAL A;  3NF8 A;  3ZT2 A;  4E1N A;  3OJU A;  3NGI A;  1C0T A;  1NKC A;  1QE1 A;  1TVR A;  3OS0 A;  2D5R A;  4DFJ A;  3C94 A;  1EET A;  5FRM A;  4L8R B;  1S9E A;  4CEO A;  3ASM A;  3EZ5 A;  5I42 A;  4ID5 A;  3NBP A;  1KVA A;  1RBU A;  4HTU A;  3V9U A;  3SQ0 A;  4ELV A;  2KTQ A;  2G8V A;  3HP9 A;  3F73 A;  1HNI A;  1LAV A;  3LP0 A;  4CJU A;  4B9L A;  4DSJ A;  3SV3 A;  3S3N A;  1NJW A;  3WNE A;  3OYB A;  4BWJ A;  1Y97 A;  1HYV A;  3MEG A;  4DTS A;  4E3S A;  4CJV A;  4Y1D A;  5HRN A;  3AA5 X;  2FBY A;  3SQ2 A;  3SPZ A;  1TK0 A;  2W42 A;  3SUQ A;  3AVK A;  2IC3 A;  3HVR A;  3PX0 A;  2BE2 A;  2OYQ A;  2ETJ A;  4CK2 A;  1BCM A;  5CZ2 A;  4CJ5 A;  4CJ4 A;  3VQ8 A;  2B4J A;  1J54 A;  1RBS A;  4BAC A;  1EKE A;  5CYQ A;  3RMD A;  1QSL A;  4E0D A;  4KB0 A;  3I0R A;  3LP3 A;  1JLB A;  4NYN A;  2NUB A;  2XY8 A;  4KHW A;  1HNV A;  3HT3 A;  3OYL A;  1S9G A;  3HXM A;  1O1W A;  3VQ7 A;  3PUF A;  3JSM A;  4M3U A;  1IO2 A;  1VRT A;  3KLG A;  3KLI A;  4FJM A;  3B6P A;  3HST B;  2KZZ A;  3HP6 A;  2KFZ A;  1FKP A;  4FJG A;  4M3Z A;  3ZSZ A;  1Z26 A;  4KFB A;  1I39 A;  5T7B A;  2IAJ A;  1TGO A;  2OPP A;  2D0B A;  1WSE A;  4KHQ A;  1BQM A;  4W5R A;  4B9V A;  5K14 A;  2IDO A;  4FLX A;  4I9L A;  1JLA A;  1ITG A;  1ZBF A;  4RW7 A;  4J2D A;  4OKK A;  1I3A A;  3MXJ A;  3VQ4 A;  4AH9 A;  4CJW A;  1JL2 A;  3VA3 A;  2YHA A;  3RTV A;  4H4M A;  5FDL A;  3I0S A;  3HPO A;  3NH1 A;  3AV9 A;  4HVJ A;  4PY5 A;  1VSE A;  4CHZ A;  4CIF A;  4DTX A;  3TAE A;  3LWL A;  1ZBU A;  3DRP A;  1SL1 A;  3THV A;  3KKR A;  2GBZ A;  3VQQ A;  3TWH A;  3TAG A;  4M3T A;  4FJ9 A;  5KGW A;  4DQQ A;  1VK0 A;  1WAJ A;  1IKY A;  3V1R A;  4BE1 A;  3SUP A;  3RMA A;  2ITG A;  5CY4 A;  1TV6 A;  1QSS A;  2HHT A;  2XY6 A;  1L3V A;  1WNS A;  2VG5 A;  2WON A;  4CF9 A;  3HK2 A;  1RTD A;  4M42 A;  2ZE2 A;  1NK6 A;  2OA8 A;  1RTI A;  4IG3 A;  2OPQ A;  4GMJ B;  3PO4 A;  1HQU A;  3L2V A;  3QEI A;  4M3Y A;  3VN5 A;  4CJT A;  1WSF A;  3VQ5 A;  4F4K A;  4LY7 A;  3NF9 A;  3KLE A;  2R7Y A;  3MXM A;  3ZSW A;  1D8Y A;  4FZX C;  4LH4 A;  2P5O A;  3OYI A;  4FLU A;  1UA1 A;  3SYZ A;  4FK4 A;  4CCH A;  1L3T A;  3AA2 A;  4K8X A;  3MEE A;  3RMB A;  5FRO A;  4B9U A;  4DSI A;  3L3U A;  3OYG A;  3KJV A;  1ZBH A;  1TAQ A;  3LP1 A;  2XY5 A;  4O5B A;  3T19 A;  4OLB A;  1RCH A;  5SZT A;  2FBX A;  3WNF A;  3VQA A;  4F2R A;  3LZI A;  1U49 A;  3C6T A;  3LPT A;  4QAG A;  1XHX A;  2ZD1 A;  2RKI A;  4I7F A;  3SCX A;  4BDP A;  4J2B A;  3QES A;  3DLE A;  3VQD A;  5EU7 A;  1SUQ A;  1CXQ A;  3NAE A;  3S3O A;  1VSF A;  3CYM A;  2G8W A;  2IGI A;  1TL3 A;  4FZZ A;  2FBV A;  1S1V A;  4NYF A;  2QXF A;  4C8O A;  4KB1 A;  1RT6 A;  3MED A;  5J2P A;  3AVM A;  4DFP A;  1RT1 A;  3V4I A;  1FXX A;  3ISN C;  3QER A;  4CGG A;  4N56 A;  4N47 A;  2ZQB A;  1S6P A;  3LWM A;  1NKB A;  1BL3 A;  4FCY A;  3PO5 A;  3TR8 A;  1KVC A;  3ZSX A;  4CES A;  1JLF A;  4DG1 A;  3OYD A;  2Z1I A;  2HVI A;  1BI4 A;  1KCF A;  4C8K A;  2G8I A;  1WAF A;  2Q3S A;  4DS4 A;  4DTR A;  4DU4 A;  2JLE A;  2Z1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...