3NH2A

Crystal structure of rnase t in complex with a stem dna with a 3' overhang
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
207
structure length
202
Chain Sequence
GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
total genus 62
structure length 202
sequence length 207
chains with identical sequence B, E, F
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh2A00
4RG8A 4CHOA 2HMIA 2HNYA 4OKKA 3NF9A 3EY1A 5J1EA 3MXMA 3TAEA 3DRPA 1DLOA 4DSEA 4C8KA 3OYKA 3LPUA 1C6VA 3MAQA 4OLBA 2HVIA 3OYIA 4KHYA 1CLQA 1RDBA 3L3UA 1NK7A 4O4GA 1LW2A 3OS0A 3ZCMA 2O4GA 3SZ2A 4Z4CA 1C1CA 4DG1A 4M3RA 3VQAA 3NE6A 2KFNA 1RNHA 4DFPA 1T05A 1RBTA 3P1GA 3LDSA 3ULDA 2AJQA 1YTAA 3VA0A 1BCMA 4KHUA 3TANA 1KSPA 2W42A 4FLVA 1FKOA 1BISA 4DSLA 2VG5A 5E41A 5HP1A 3TAPA 1XI1A 3HPGA 4CJSA 2YNHA 3D45A 4LH5A 3KTQA 5FRMA 3QETA 1RDDA 4ELTA 3IS9A 4CGJA 1W0HA 3QIOA 1S1WA 4AILC 1WSJA 4E7LA 1G15A 2PZSA 4OGEA 4E89A 1N5YA 2HNZA 2HHSA 2IS3A 4CJ5A 4DTSA 4PA1A 4OVLA 3V1QA 4FJIA 3QNNA 1XWLA 2HNDA 2IC3A 4CGIA 4FLTA 3KLFA 3SUNA 4Q0BA 3RR8A 1QSYA 4RW6A 3WNHA 1Y97A 4C8NA 3TI0A 4FLUA 2RN2A 5HRNA 4CEAA 4KTQA 1TVRA 1BQMA 2B6AA 3AO5A 2FC0A 4NCAA 4KTWA 2B4JA 4YNQA 1FXXA 1RT3A 3ZSWA 4DS5A 3OYMA 3JSMA 3KD5E 1S6PA 2ZE2A 3DLRA 4I2PA 4FM2A 1ASWA 4LSLA 4C8LA 3KLEA 1I3AA 1RDCA 4CJFA 1U4BA 3CFOA 4BDYA 2OPPA 4B08A 1NOYA 1SUQA 4E19A 3VQ6A 3RMCA 1HNVA 4DTUA 4M3XA 2KFZA 3HYFA 3TR8A 3NDKA 3CFPA 1N6QA 2A1RA 2G8FA 5DK5A 4CEBA 1LW0A 2P51A 1NJYA 4M42A 5HROA 3SUOA 3QEPA 3K2PA 1JLGA 5JS2A 4UQGA 5C24A 5HLFA 2PYJA 4CJQA 2QK9A 3NGYA 5C25A 1C0TA 3QEVA 1QHTA 3F9KA 4ICLA 1NJWA 4B9NA 4J2AA 1S9GA 3AVLA 1JXEA 2D0BA 3L2VA 2Z1JA 3V1OA 3PX0A 1GOAA 3SQ4A 3ZSOA 3AVNA 4B8CA 1RBUA 1TL3A 3B6PA 1GOBA 4KB0A 4E7KA 1WSHA 4DTOA 4LH4A 4CECA 4CEOA 1VSIA 4E7IA 4DTMA 2G8VA 3V9XA 2G8HA 4BWJA 3KK1A 3DLKA 4AHRA 4EP4A 4AHSA 3SJJA 1NOZA 2EX3A 1T8EA 2LSNA 4RW9A 1VSDA 1ZBLA 3TARA 3PUFA 4W5OA 4Q5VA 1HMVA 1HQEA 4NYNA 1B92A 3SUPA 3ZSQA 1QE1A 1TK5A 3VQ9A 3K5OA 4ZHRA 3SV4A 1YT3A 2DFFA 1C1BA 3LPTA 4G1QA 5FDLA 3LP0A 5CZ2A 2IOCA 3NCIA 4J2DA 3KKSA 4Z4FA 3M8QA 3OJUA 4FJGA 4O0IA 1NJZA 4GVMA 3HP9A 4DTNA 1U48A 4JRQA 1UA0A 3OY9A 4O0JA 2HHXA 3AA2A 3LP2A 4CHQA 3KK3A 4E3SA 4BE1A 1DTQA 4CGHA 3OYLA 1TL1A 3DM2A 1EXQA 2BE2A 5EU7A 3AO4A 3OYCA 3VA3A 4DFJA 1NK8A 1D9FA 4F8RA 3HL8A 3VQQA 5HRSA 3KIOA 1J54A 1XHXA 4FK4A 1LV5A 2F8SA 4CGGA 5J2PA 1T03A 1KFSA 1VSKA 3PX4A 3DLHA 4F3OA 2EHGA 3CG7A 3U3GA 4HTUA 3L8BA 2DY4A 1Q9XA 3JYTA 4CFBA 3D0PA 4JRPA 4IKFA 4EZ9A 4FM0A 4DQSA 4HCBA 4K8ZA 1D5AA 3ZSRA 4KB1A 1IO2A 1SL0A 2R7YA 3AVGA 1L3VA 4E7HA 4KPYA 4CERA 1KTQA 4KHSA 3QESA 1BL3A 4CF9A 4B9SA 1UOCA 2YNFA 5CZ1A 2PY5A 2YNGA 3K5NA 3KKRA 1VSJA 2OPSA 4O55A 3K57A 1NK4A 3HK2A 4DQQA 1TAUA 4NYFA 1IKYA 1TK0A 2O4IA 1ASVA 1ZBFA 2ZD1A 3ZSVA 4W5TA 3V1RA 1HYZA 1W9HA 1J5OA 3TAQA 4PWDA 1NKBA 4FK2A 4CK3A 3MXJA 1O1WA 3HSTB 1EX4A 3PV8A 1KRPA 1RTDA 4W5NA 2XHBA 3L3VA 3TAGA 4CF0A 1GOCA 1J9AA 3T1AA 4FJ8A 4F2RA 4O44A 2XO7A 3S3OA 4JS4A 4Z4IA 2FBXA 3KJVA 3ZT0A 1B9FA 1B9DA 3DYAA 3OYFA 3VQ8A 1RT5A 3OYGA 3LAMA 2YV0X 1HYVA 3KLIA 1ZBHA 4LSNA 4DTXA 1Q8IA 3AVAA 2Q3SA 4EZ6A 1KVBA 3HPOA 5J2NA 4I9QA 4FJXA 3ZT2A 3ITHA 1A5WA 3VQEA 2X6NA 1BCOA 3K5LA 1LAWA 1NK5A 1A5XA 2ATQA 4N47A 3NH1A 1RT4A 3AA4A 3VQ4A 1U47A 3VQDA 2HVHA 3TABA 4F2SA 1HPZA 4CJ3A 4EP5A 3MECA 5KTQA 2I5JA 4IBNA 3L2WA 4OKJA 2D5RA 4DQIA 5D3GA 4ZTJA 1REVA 2G8KA 3HXMA 4KI6A 4FZZA 1NK6A 1BIZA 1L3SA 1UWBA 2G8UA 3KD1E 1A5VA 1NKCA 4QOZB 3DLGA 4BDZA 4KHQA 3PY8A 3ZT4A 3RWUA 1S1UA 2RKIA 4M3YA 1RBVA 4FK0A 3CM5A 1JLFA 3NH2A 3I0RA 3S3MA 4L8RB 1WAFA 4I2QA 4DTRA 3A2FA 4FYDA 4WE1A 4ELUA 1VSHA 3C6UA 1WSIA 3QNOA 2XY6A 4DFMA 2WONA 1S1XA 4DF4A 4H4MA 4CJEA 4DQRA 2E4LA 1NK0A 4M45A 4FJ7A 3EZ5A 3WNEA 3MXIA 2E6LA 2KW4A 5HRPA 4M3UA 4CK1A 3NBPA 5K14A 4FLXA 2OPRA 4CHNA 3LZIA 3I0SA 1SKSA 4FJ5A 1IH7A 2F96A 4FVMA 3DI6A 2D0CA 4LY7A 2Y1IA 5C42A 4CHPA 1T7PA 2XY7A 3M8SA 2Z1IA 1TKXA 4DQPA 3PO5A 4BACA 1VK0A 2GV9A 2IAJA 4BE2A 3DMJA 4DU3A 5SWMA 1TKTA 1BI4A 4C8OA 4RW7A 4OPKA 4DLEA 4Y1DA 4E1MA 1WSGA 1YVUA 4DF8A 3K58A 4CIEA 1ITGA 2Z1GA 3VQCA 3HVRA 4FLZA 4FZXC 2YNIA 4Y1CA 3QEIA 4DU1A 1CXUA 1JLBA 1VRUA 4CEDA 4KRFA 3G0ZA 4R5PA 4KI4A 1S6QA 1BGXT 4N5SA 4DLGA 4DTJA 1WSFA 1WNSA 4IFYA 2DFHA 3K59A 3HO1A 3L2UA 1I39A 4FW2A 3V9UA 1LWEA 2X74A 2RPIA 1ZYQA 1LWFA 1Z25A 3SPZA 2BGGA 1BIUA 4BDPA 1CZBA 1CZ9A 1XHZA 2KTQA 1SKRA 5CYQA 2FBTA 2Z1HA 1RDAA 4LD0A 3SUQA 4DMNA 4CJPA 4DWIA 1EETA 4BWMA 4MQ3A 1U45A 3F73A 3C6TA 3QEWA 2Y1JA 3RRGA 3OYJA 4CJTA 1R0AA 4NCBA 3P83D 1C0UA 3LANA 2DTUA 3O4QA 1JLCA 3L2RA 4H8KA 3QO9A 3O3FA 4FJMA 2IGIA 1JXBA 1KCFA 1RBRA 4HUGA 4FJLA 4RW8A 4DSFA 4ID5A 3L2QA 3AVJA 4OJRA 3S9HA 4M41A 2HHTA 4CIGA 3SPYA 4AHTA 4F4KA 4W5RA 1HQUA 3ZSXA 3RMDA 3NH0A 3H08A 3WNFA 1S9EA 1ZBUA 4AHUA 4N76A 1RTJA 4C8MA 3WNGA 2E6MA 4AH9A 4FM1A 3QEXA 2QKKA 4HCCA 4KAZA 4AHCA 2JLEA 3OYEA 3AVHA 1VSLA 1K6YA 3V9ZA 1TKZA 1TAQA 1SKWA 4HVJA 2VWKA 3V6DA 3TAFA 5KGXA 1QS4A 1JKHA 1L3UA 4CJWA 3MEEA 5J2MA 3OJSA 3DOLA 3QINA 2X78A 3ISNC 1RT7A 3T19A 4CF8A 4CEZA 4CF2A 3NAEA 2B5JA 3U3YA 2PYLA 3AVIA 1L3TA 1TV6A 1WLJA 3SQ2A 1KVCA 1XC9A 3OYAA 2HHVA 4AHVA 1IG9A 2HB5A 3C95A 3VQ7A 3ZSZA 3HM9A 2P5GA 2A1SA 1RT2A 1SV5A 1WSEA 5KGWA 4FCYA 4CGDA 4DFKA 4DS4A 3OYNA 4N41A 3HJFA 3CQ8A 2QXFA 1WAJA 2P1JA 3M8RA 4IG3A 3OS1A 3AV9A 3T3FA 4CCHA 3NFAA 1EP4A 1F21A 3ZT3A 3P5JA 5T7BA 1KFDA 3HT3A 4J2EA 2OYQA 4B3OA 3O3GA 4PQUA 2KZZA 3VQPA 4Z4HA 1U49A 4E1NA 3KLGA 3KLHA 2D0AA 3RTVA 4FLWA 4FLYA 2YHBA 3SCXA 4FJ9A 1L5UA 5FRNA 2HHQA 2OPQA 4ID1A 3OYDA 1TKDA 4DSIA 2X6SA 3I8DA 1Z26A 3ALYA 4CJVA 1RBSA 1BI4B 1VSFA 4XIUA 4CGFA 3NGIA 4KHWA 3NF8A 3HP6A 5I3UA 3QLHA 4KO0A 3O4NA 4KV8A 4JS5A 5J2QA 3CM6A 1BQNA 1C1AA 4KKOA 4M3TA 4HUEA 3AA3A 3NHGA 3LWMA 4E7JA 1KLNA 2HHWA 4B8AB 1IKVA 3IG1A 3THVA 4ZTFA 4TSXA 4OGCA 4B9TA 1JLEA 4NCGA 4FW1A 1JLAA 3NGZA 3K5MA 1S1VA 4GMJB 2F8TA 1RCHA 5CYMA 1QQCA 1X9WA 4MFBA 5FROA 1RT6A 1D9DA 4KFBA 4QAGA 4CIFA 1BHLA 4HUFA 1QSSA 4M3ZA 3DRSA 5KRTA 2GUIA 1HJRA 4HHTA 4Z4EA 1NJXA 1QSLA 4J2BA 1NK9A 3OYHA 3FFIA 2P5OA 4CE9A 3UIQA 2VWJA 1HNIA 4CEQA 4YFUA 1IKXA 4N56A 3TWHA 2OA8A 2ETJA 4CJRA 5SZTA 3BDPA 1VSEA 2YHAA 1EKEA 2NUBA 1RT1A 2XY8A 4KTZA 4O5BA 4CJKA 4OPJA 4JLHA 1X9SA 1X9MA 4DSKA 2HW3A 2HHUA 1JL2A 4K8XA 2OZSA 4DTPA 3SQ0A 3VN5A 2WOMA 3ASMA 4IFVA 3LZJA 4Z0UA 1JL1A 1MU2A 1ZBIA 2QKBA 1Q9YA 1YTUA 3CYMA 4ELVA 2JGUA 3G10A 3LP3A 1SL1A 3NF6A 5KI6A 3ZT1A 4FJJA 3SNNA 4FXDA 3M8PA 3C94A 3V4IA 3SQ1A 2YKMA 1KVAA 5HRRA 2VG6A 4KHNA 1X1PA 1IKWA 2BANA 3OVNA 1NKEA 3RR7A 1C0MA 2GBZA 4DU4A 3SV3A 1QTMA 4CF1A 4B9LA 4OKEA 1DTTA 2RF2A 4FJNA 3OS2A 4BE0A 3DRRA 4B9MA 4CJLA 4F3TA 3IRXA 3V81A 1UA1A 3EYZA 4OLAA 3VQ5A 1VSMA 4B9VA 3O3HA 3AA5X 2IDOA 4CFDA 1SL2A 1RTIA 3LAKA 3LALA 3B6OA 4FJKA 3RMAA 4PUOA 4CK2A 3V9SA 2ITGA 1S5JA 1LWCA 5HBMA 4CEEA 3MEDA 4M3WA 4CEFA 1WN7A 2YKNA 4CFAA 1JLQA 3AVCA 3SYZA 3BGRA 3RRHA 5JS1A 4PY5A 3DLBA 3LP1A 2XY5A 5DMRA 3AVMA 3VQBA 3AVBA 4H4OA 4CHZA 5CY4A 5KRSA 4GW6A 3SI6A 3S3NA 1J53A 3DLEA 1HYSA 2FBYA 3AO3A 3CFRA 3V9WA 4RW4A 3HPHA 2FBVA 2G8IA 4IDKA 2ZQBA 4CESA 4CHYA 4W5QA 4I9LA 1FK9A 1FKPA 4FJHA 2VG7A 3AO1A 3AO2A 3U6FA 1VRTA 3E01A 2G8WA 1TGOA 3PX6A 3IAYA 1CXQA 2KQ2A 1U04A 4DSJA 2KZMA 4CJUA 1RILA 1RTHA 2DFEA 3DOKA 4E0DA 2XRIA 1LAVA 3HVTA 3KK2A 1TK8A 3AVKA 4Z4GA 3AVFA 3QERA 1KLMA 4B9UA 3QIPA 3OYBA 4IG0A 3LWLA 1HRHA 3MEGA 3TAMA 4FZYA 3NF7A 4KREA 1D8YA 2BDPA 3PO4A 4QCLA 4CFCA 2OZMA 5I42A 4I7FA 3ZSYA 1S1TA 4CJ4A 3RMBA 1ASUA 1UAXA
chains in the Genus database with same CATH superfamily
1XMQK 1K73O 3EY1A 4OKKA 4FWKA 3MXMA 2NRTA 4YY3K 4C8KA 1K8AO 4A57A 5H1SQ 3LPUA 4NXMK 3MAQA 1CLQA 5AQJA 4DV7K 1LW2A 4Z4CA 1C1CA 4DG1A 3O9SA 2KFNA 3SAFA 4DFPA 3O9RA 4IXCA 3LDSA 1T3VA 2O8DB 2I7PA 5AZJA 3VA0A 3TANA 1NWKA 5KQ8A 4EAHD 4B1UB 4NXNK 5HP1A 4JKHA 4JHDA 1XI1A 3HPGA 2YNHA 3D45A 3KTQA 3QETA 4CD3A 3KHYA 1G15A 4FVUA 4OGEA 1BA0A 4DTSA 1NGIA 4FSVA 4PA1A 1XWLA 4FLTA 3SUNA 3DXMA 4IO9L 1QSYA 3WNHA 4KTQA 2Q2RA 2NRZA 4NCAA 2W6LA 3H3NO 4YNQA 3QFUA 1FXXA 1RT3A 4DS5A 3D2EA 4I2PA 3DLRA 4CBUA 2A40A 3SK3A 1WUAA 4BDYA 1EO1A 2KKZA 4B08A 1SUQA 4DV2K 4FWMA 4B3SK 4F9OA 2P9KB 1NJYA 4LF6K 4M42A 3SUOA 3K2PA 1JLGA 4UQGA 3THYA 5HLFA 3NGYA 3QEVA 5C0YA 4ISGA 4B3RK 3JAMO 4B9NA 4K25A 1JXEA 3L2VA 2Z1JA 4M63C 4WQ4A 1VQMN 3K9KA 1GOBA 4KB0A 2Q0UA 4BROA 5BPNA 1VSIA 1QZ6A 2G8VA 3CXCM 2A3ZA 1NOZA 1VSDA 1ZBLA 1S3XA 2VGMA 3PUFA 2O8FA 4IEEA 4H5VA 3TU5A 1QE1A 3ZSQA 3K5OA 4ZHRA 3LPTA 2UU9K 1QZ5A 2Q97A 3OY9A 3MCAB 3KK3A 4E3SA 3Q7BA 4WQ5C 4BE1A 3OYLA 2CH5A 4JN4A 1EXQA 5EU7A 1D9FA 5AQZA 2ZF5O 3KIOA 2NRVA 4DUZK 4CGGA 1Y64A 3PX4A 3L8BA 5HL7L 3CCUN 4HCBA 3TSQA 1SL0A 2R7YA 1L3VA 4KPYA 4CERA 3QESA 4IDHA 1VQ4N 3SJHA 3H1VX 3LM2A 1N8RO 1ZBFA 4FK2A 4W5NA 3HSTB 2FSKA 4FJ8A 3WEEA 4Z4IA 4NLCA 3GL1A 4JS4A 1JCGA 3KJVA 5AQOA 4LC9B 2E2QA 2BUPA 2ZJQL 2YV0X 1DGKN 1ZBHA 4DTXA 1Q8IA 1KVBA 5J2NA 1ATNA 3ZT2A 5GIPA 3VGMA 4GV6A 3J81O 1A5XA 4H5NA 5EY4A 1IBMK 3VQ4A 3VQDA 2OCEA 2I5JA 3J7YP 2D5RA 4ZTJA 4CZJA 1UWBA 3KD1E 5AQLA 1HKBA 3DLGA 3IKMA 4BDZA 4KHQA 3CMEN 3ZLJA 1GLFO 2RKIA 1RBVA 1NGEA 1D4XA 1QQNA 4A62A 4FYDA 4I2QA 2HHHK 3QNOA 5ADXA 3RVCA 4DF4A 1NK0A 4FWRA 3CD6N 3MXIA 1BWFO 2HOEA 4IO8A 3VEXA 1SKSA 4BRQA 4FJ5A 2F96A 1KC8O 1V4SA 5C42A 1T7PA 4DQPA 1TKXA 1VK0A 2HBJA 2IAJA 4YDUA 3GBTA 4OPKA 4E1MA 1WSGA 4CIEA 1ITGA 1NNEA 1NMNA 4FZXC 4YOYA 1N34K 4LFBK 4JV5K 2QTDA 3EEQA 4JKDA 4XEIA 1KAZA 3R9PA 4BQZA 2DFHA 3K59A 1I39A 4FW2A 2X74A 2BGGA 1BIUA 2F9TA 1XHZA 2P9UB 3IDHA 3RSEB 1SKRA 4V19S 2A42A 2FBTA 1RDAA 1HNWK 2O8DA 4MQ3A 1U45A 1R0AA 4NCBA 2YHYA 3O4WA 3O4QA 3C7NB 1QVGM 4H8KA 2DTUA 3QO9A 1JXBA 1KCFA 3O9TA 1HKGA 3CJCA 4M41A 4AHTA 4KH6A 3IUCA 4BRGA 3NH0A 3DXMB 3WNFA 4IZ9A 4C8MA 4AH9A 2QKKA 4JI0K 2VWKA 1QS4A 3MEEA 5J2MA 3OJSA 3DOLA 4JI6K 3T19A 2X78A 1RT7A 1V4TA 1ATRA 1L3TA 1TV6A 1KVCA 1RDWX 4BR5A 5AQYA 4AHVA 2F9WA 2UYTA 3C95A 3CPEA 3ZSZA 1WSEA 4JK8A 4DFKA 2W40A 3OS1A 1Q82O 3NFAA 5T7BA 5F1XA 4J2EA 4CZEA 4B1ZA 4B3OA 3CCRN 4E1NA 3RTVA 1OH5A 2V7ZA 5FRNA 3IFRA 3THWB 2OPQA 3FGUA 2GELA 2GTDA 2P9SB 1Z26A 3OBYA 3L0QA 1VSFA 3A0IX 3E1YA 4KHWA 3NF8A 3FFKB 3U4LA 2HF3A 1KLNA 3IG1A 4TSXA 2FF6A 4NCGA 4FW1A 3C6HA 4GMJB 4M7YA 1QQCA 1X9WA 1D9DA 3EO3A 4JKFA 4BRFA 1HJRA 4GV9A 5E84A 1NU0A 3FFIA 3UIQA 2GWJA 5EX5A 4N56A 1IKXA 2ZM6K 1OH8A 4CJRA 5JMVA 4BR9A 3BDPA 5AQSA 1EKEA 2NUBA 3CJAA 4WFBL 4JLHA 2HW3A 4JI3K 2WOMA 1WOQA 4DR5K 1JL1A 1MU2A 4JI4K 2QKBA 1Q9YA 4A2BA 3LP3A 5KI6A 4Y0WA 4CI6A 1N32K 1KVAA 1S22A 2P9KA 1NGGA 1NKEA 1C0MA 3VEZA 3HOTA 2E1YA 1SAZA 3DRRA 4CJLA 3HRGA 3V81A 3VGKA 2KHOA 4WYBA 1P90A 4CFDA 4DV0K 5C12A 4PUOA 5LMNK 3WXKA 1S5JA 2QWPA 4CEEA 2ASMA 2NRXA 1WN7A 3J8AA 3C0BA 1VQNN 3RRHA 2XY5A 3AVMA 2QWQA 4WQ5A 4RW4A 1MWMA 3F2KA 2ZQBA 4BG8A 4I9LA 1FKPA 3UKRB 2VG7A 3E01A 4HWIA 3HVTA 3KK2A 4ISEA 1SZ2A 1Q7YO 5M1QA 3AVFA 3QERA 1HUXA 3QIPA 3LWLA 1HRHA 3ZYYX 3MEGA 4FZYA 4KREA 3PO4A 3LM9A 2J4RA 5I42A 1S1TA 4JKBA 3ID6A 3ZX2A 3QBXA 1UAXA 4H5RA 3MWPA 3ZETA 3DRPA 3QB0A 4BRHA 1VQKN 2ZGZA 4JK9A 4JD2B 4DCHA 1T05A 1RBTA 3P1GA 1YUWA 1BCMA 4KHUA 4LFAK 3LL3A 4FLVA 1BISA 1HX1A 2VG5A 3TAPA 3MK6A 4DR2K 3FZFA 4AF1A 4LH5A 4ELTA 3UB5A 1S1WA 4AILC 1WSJA 2HNZA 2NZTA 3O08A 3SAGA 4YOUA 4OVLA 3V1QA 4PKHA 4Q0BA 3F9MA 3KLFA 3VF4A 4QS9A 2NRHA 1K9MO 4RWTA 1Y97A 4C8NA 1MDUB 4CEAA 2IIRA 1BQMA 3HM8A 5M1PA 3JSMA 3BUZB 1S6PA 4NO7A 3THXA 4C8LA 3MN5A 3GOIA 1NOYA 5F0XA 2UXDK 2KFZA 2F4VK 3TR8A 5DK5A 2UXCK 1Q18A 3QEPA 2QK9A 5C24A 3EKUA 3OBWA 5C25A 3U9ZA 1E4FT 2FSJA 4J2AA 1S9GA 2E2PA 5BN8A 3SQ4A 2PAVA 3EL2A 3AVNA 3ZSOA 1RBUA 4CVNE 4E7KA 1WSHA 4JKEA 4E7IA 3KK1A 1NGDA 2P9NA 4AHRA 3O9UA 5AQRA 4IFEA 2LSNA 4U7BA 3TARA 1HMVA 1ESVA 1TK5A 3CJ1A 5FDLA 3LP0A 4DQ8A 3NCIA 3AAPA 1SS6A 4DTNA 1UA0A 2ZJRL 2VQFK 3LP2A 3MX5A 1BDGA 4CGHA 1TL1A 3KWGA 2EWSA 4FJGA 2BE2A 3OYCA 4EFHA 4DFJA 1BO5O 5M1OA 3VQQA 3UKRA 2YJEA 1XHXA 2HSTA 2PFUA 3CJ9A 5M1NA 1T03A 1E3MA 1VSKA 3O80A 5LJWA 5CHIA 4MLEA 3U3GA 2DY4A 3TSPA 3VPZA 4JRPA 1XMOK 5TKWA 4FM0A 4DQSA 1M1KO 4KB1A 3N4QA 3ZX0A 2E2OA 1UOCA 2PY5A 3KKRA 1VSJA 2OPSA 1NK4A 4DQQA 4NYFA 5C2FA 2O4IA 3ZSVA 1HYZA 3A5LC 1NKBA 4CK3A 3PV8A 5GAEP 1EX4A 1RTDA 3JXUA 3TTDA 4WQ4C 4CZHA 2E8AA 1B9FA 1B9DA 3DYAA 4EIAA 3VQ8A 1RT5A 4LSNA 4EZ6A 3HPOA 4CZGA 3FZHA 3VQEA 2X6NA 5AQXA 4JAXA 2ASOA 1HNZK 4R79A 4C1NI 1Z05A 3TABA 4I6MA 4CJ3A 3MECA 4YOWA 3PIOL 4GKJK 4C23A 4OKJA 4DQIA 1JJ2M 1REVA 4AQYK 4FZZA 1BIZA 3O5BA 4X65K 1NKCA 1VQLN 5AQWA 1TUYA 3ZT4A 1IJJA 3CM5A 4L8RB 3I0RA 1WAFA 3A2FA 1VSHA 1JCEA 2XY6A 1S1XA 4DQRA 5JVHL 4IJNA 2E4LA 4FJ7A 4WFAL 2QEXN 2E6LA 1DT9A 5AZIB 4M3UA 4CK1A 2GWKA 2OPRA 3QFPA 4CHNA 1IH7A 3DI6A 2D0CA 2Q1NA 3ENBA 2XY7A 3M8SA 5FPDA 3BEXA 4BRNA 2P9PB 3DMJA 5SWMA 3D7EO 1SQKA 4LF5K 5AJ3K 1YVUA 4DF8A 3HVRA 1T6DA 4FLZA 1IG8A 3D2FB 3OA9A 1BUPA 5C2DA 3QEIA 3EKSA 1JLBA 1HJOA 4ILHA 1GLEG 4R5PA 4O5FA 4BR7A 1S6QA 4DTJA 1WNSA 4IFYA 2QW9A 4GV3A 1ZYQA 1WBDA 1LWFA 3SPZA 3FR0A 4BDPA 5CR4A 4XH5A 2KTQA 5GIOA 3SUQA 4CJPA 1EETA 4NLBA 3GG4A 4H5TA 2E20A 3F73A 3C6TA 3QEWA 3RRGA 3H6EA 3SMSA 4OO1J 3LANA 3NMUA 3LDNA 1JLCA 3L2RA 4DR1K 4BY9C 4LF7K 5F2RA 3C6AA 2WBNA 1TUUA 4ID5A 4JKCA 3CCSN 3DWLA 4JI5K 3QICA 4A61A 3RMDA 5IT9O 1ZBUA 4X64K 4FM1A 2E6MA 4HCCA 1TKZA 1TAQA 5ELZA 4A2AA 3VETA 1JKHA 1L3UA 4CJWA 2QI2A 3QINA 3ISNC 4CF2A 4OX9K 2PYLA 3NAEA 3AVIA 3VERA 4YDUC 3SQ2A 2WUSA 1XC9A 1NMDA 2UUCK 2HHVA 1NGBA 1IG9A 2P5GA 3VOVA 2A1SA 3O6WA 1SV5A 2IVOA 5KGWA 2RHKA 4B1WB 4K43A 3OYNA 4N41A 1JCFA 4YHHK 2P1JA 2CH6A 4CCHA 1EP4A 1KFDA 1N33K 2KZZA 3O3GA 3CQYA 2GX9A 1YJWN 4Z4HA 3KLGA 4FLWA 2NNWA 2YHBA 2HHQA 3OYDA 2X6SA 4O8UA 1C0FA 4DR6K 4I6MB 3ALYA 4CJVA 4XIUA 4JKAA 2DPNA 3O4NA 1C1AA 4DV6K 2HHWA 1IKVA 4ZTFA 3I55N 4B9TA 4OGCA 3WXLA 3M6GA 3NGZA 1X3NA 2F8TA 1RCHA 2VCPA 1RT6A 3FZLA 1ZBSA 4QAGA 5A2QO 4BC2A 1NK9A 3LDLA 4CE9A 5BN9A 4DHYA 3P39A 2OA8A 3BF1A 2ETJA 4BC4A 1X9MA 2XY8A 3BZKA 1GLDG 5CE3A 4DSKA 2OZSA 4BRIA 3BP8A 3ASMA 2JGUA 5AFUA 5BR8K 4FJJA 4FXDA 3M8PA 4BRAA 2KLAA 1QQMA 1I94K 3UKUA 2VG6A 2FLOA 3OW2M 1FJGK 1IKWA 4EHTA 3RR7A 4MDBA 3SV3A 1QTMA 4FJNA 1VQ7N 2RF2A 1NGHA 2CGLA 3GDQA 4B9MA 4F3TA 3N4PA 4WCEL 1UA1A 2V52B 1VSMA 4B9VA 3O3HA 3S41A 3DXKA 3AAQA 1RTIA 1QHAA 3LALA 4DR7K 4FJKA 5HBMA 3ZEUA 3K9JA 4CEFA 2YKNA 4PY5A 3DLBA 1U2VA 3VQBA 3B8AX 3S3NA 1IBLK 1HYSA 4GW6A 4M7XA 3DLEA 3CI5A 3HPHA 4BVPA 2VGNA 1E4GT 4CESA 1YAGA 1KD1O 4NB4A 3CC7N 1XNRK 2AA4A 5AQHA 3U6FA 4BRKA 1U04A 4DSJA 3G25A 3E9PA 1RTHA 4X62K 4EHUA 1TK8A 1HPMA 3OYBA 3NF7A 1D8YA 4QCLA 4JNEA 4CFCA 4CZKA 3FE1A 4I7FA 3ZSYA 4CJ4A 5JLHA 5KRSA 3QBWA 3ULEB 1YITN 3NF9A 1DLOA 4OLBA 1C6VA 2HVIA 4KHYA 3TPQA 1K8KA 1RDBA 3L3UA 4O4GA 3ZCMA 2O4GA 3SZ2A 3NE6A 4M3RA 5FPNA 1RNHA 1OKJA 3ULDA 2NRRA 1YTAA 3R8EA 1KSPA 1YI2N 4DSLA 1W97L 1XNQK 3PSIA 3CF5L 4FWOA 3TTFA 3WQUA 2IVPA 5FRMA 4CGJA 3OTOK 3QIOA 1KQSM 4FWSA 4E7LA 4E89A 1N5YA 5FPMA 3QNNA 2HNDA 2IC3A 3D2EB 4RW6A 1KAXA 4FLUA 1EWRA 2B6AA 2UXBK 1VQ9N 4KTWA 1DEJA 3VF6A 3OYMA 4BRMA 3KD5E 1BG3A 2ZE2A 1YJ9N 4JK7A 1ASWA 4UY8O 3NVMA 1X3MA 1I3AA 1RDCA 1U4BA 4KHPK 2HBLA 2OPPA 2P9IA 5C15A 4E19A 2QWRA 4DV5K 1HNVA 3RMCA 1OH6A 3HYFA 2G8FA 4CEBA 1LW0A 1XC3A 5JS2A 4LF9K 4JEPA 3F9KA 3W3DA 4DUYK 5M1FA 4BRPA 5AZJB 4B9QA 2D0BA 3ENHA 3V1OA 3PX0A 1GLLO 5BRFA 4A5BA 1YXQA 4B8CA 3TSUA 2O8BB 1TL3A 2JWLA 4KH4A 3C65A 2QA4N 1Q81O 4CEOA 3P4IA 4DTMA 2JWKA 3V9XA 1C0GA 2P9IB 4AHSA 3G71N 3SJJA 4JI7K 4W5OA 1TYQA 3SUPA 4NYNA 1B92A 5HOOA 1QQOA 3VQ9A 3CMAN 3SV4A 1YT3A 4G1QA 2IOCA 3M8QA 3VTHA 3OJUA 4PKIA 4GVMA 2H3GX 4JRQA 4O0JA 3CJBA 3AA2A 3KZBA 1DTQA 3DLLL 5DM7L 3DM2A 3I8BA 4KI4A 3AO4A 1NK8A 3VA3A 4F8RA 3J7AP 2GUPA 3HL8A 5HRSA 4YORA 4ILJA 1J54A 4ILGB 4YOXA 5J2PA 3E9LA 3DLHA 2EHGA 5E26A 3CC2N 1EQYA 1Q9XA 4DR3K 3D0PA 3W0LA 4CBXA 5AQIA 3ZSRA 1IO2A 2F7TA 1W2BM 3AVGA 4E7HA 1KTQA 3AGRA 1BL3A 4B9SA 2YNFA 5CZ1A 5AQTA 2YNGA 3K57A 4O55A 1TAUA 4OPAA 1X9JA 1IKYA 1NGAA 4DV1K 1TK0A 1ASVA 4W5TA 3V1RA 4BR0A 1W9HA 5GADP 3TAQA 1J5OA 3G4SN 4PWDA 3MXJA 1O1WA 1RFQA 3TAGA 1GOCA 1J9AA 4F2RA 4O44A 4BRDA 3ZT0A 5KPRA 2OTJN 1YHQN 3J7ZO 1HYVA 4FOIA 3VTIA 1VAZA 3AVAA 2D0OA 5DM6L 2A6AA 4I9QA 3ITHA 1A5WA 1BCOA 3K5LA 4N47A 4LF4K 3NH1A 3BF3A 3AA4A 2HVHA 2CGJA 1HPZA 4IBNA 1IBKK 2GEMA 3LDOA 2G8KA 3HXMA 1NK6A 1L3SA 1A5VA 2O8EA 4QOZB 3PY8A 4LFCK 3RWUA 4M3YA 4BGAA 1YVNA 3NH2A 2BTFA 3S3MA 4DTRA 3C6UA 3ZX3A 4DFMA 2WONA 4H4MA 4CJEA 4M45A 3E66A 4H5WA 1FW6A 2KW4A 1GLCG 4FLXA 3I0SA 4CHPA 1KAYA 4JI8K 1R59O 4CZIA 3PO5A 4BACA 5JVGL 4BE2A 3ENOA 1TKTA 1YIJN 3CCMN 3L6QA 1TYQB 4Y1DA 3VQCA 2Z1GA 1CZAN 5AQQA 4U67L 2YNIA 4Y1CA 4DU1A 1VRUA 3G0ZA 4AM6A 3C7NA 1BGXT 4DLGA 1BA1A 1XQSC 3L2UA 3V9UA 2RPIA 4FOEA 4FWLA 5KPTA 5AR0A 4XH1A 1CZ9A 1VQ6N 4XH4A 5AQPA 4O8KA 2Z1HA 4LD0A 2E88A 3FZKA 1HLUA 2Y1JA 1W7AA 2YCHA 3O8MA 1O13A 1J5EK 4PL7A 1K8KB 3O3FA 4HUGA 5GAGP 4DSFA 3L2QA 3AVJA 4OJRA 4B1YB 2HHTA 3SPYA 2Q31A 5TKYA 3H08A 1S9EA 1RTJA 3WNGA 3OYEA 2JLEA 3V9ZA 3AVHA 3CJ7A 1SKWA 5KGXA 1BOTO 2HMPA 1T6CA 3K0SA 3I33A 4CF8A 4CEZA 3U3YA 2B5JA 3CPWM 3WT0A 1NBWA 2YX6A 5AQFA 1HKCA 2HB5A 3VQ7A 4PHTX 3HM9A 1Q86O 1RT2A 4K41A 4CGDA 5BRDA 3CQ8A 1WAJA 3M8RA 1RDUA 1F21A 1U49A 4F4KA 2D0AA 3FZMA 4FLYA 3ULEA 1TKDA 2P9LB 1BI4B 3NGIA 3KVGA 3HP6A 5I3UA 3QLHA 4KV8A 5J2QA 4JS5A 4HTLA 2E1ZA 4KKOA 4WF9L 4M3TA 4HUEA 3NHGA 3LWMA 4E7JA 3THVA 4DV4K 1QVFM 3K5MA 3L4QA 1S1VA 4FO0A 3WEEB 5FROA 4HUFA 1QSSA 1BHLA 4M3ZA 3VEOA 3DRSA 4HHTA 1NJXA 3SBGA 3THWA 1QSLA 4J2BA 3WUHA 2WTUA 2FSNA 2P5OA 5C10A 4CEQA 5KPZA 3TWHA 5SZTA 1U2VB 4GVEA 1RT1A 4H0OA 4DTPA 3SQ0A 1MWKA 4Z0UA 1HNXK 3PLAA 1N36K 3CYMA 4ELVA 4PKGA 3PIPL 5AQKA 3CETA 3CCQN 5HRRA 4KHNA 2BANA 3BZCA 3OVNA 2HBKA 3ATUA 4C1NK 1DTTA 2ZJPL 1ZC6A 3P38A 3A5OC 4BE0A 2PBDA 3EE8A 3T1HK 1NGFA 3IRXA 4OLAA 3VQ5A 1MA9B 2V51B 4OPHA 3AARA 3SAHA 3UKUB 1SL2A 5AZIA 4B1VA 2O8FB 4H0VB 2ITGA 1GLAG 1LWCA 3MEDA 3H45C 4M3WA 4CFAA 3SYZA 4A5AA 5JS1A 3Q7CA 3LP1A 4J8FA 3AVBA 5KQDA 4CHZA 5CY4A 3SI6A 1T8EA 1VQ8N 1M90O 1J53A 5FPEA 3CC4N 4JI2K 5LL6Z 3CFRA 2P9UA 3A8YA 4Z94A 3V9WA 4DR4K 3VEYA 4W5QA 1FK9A 4FJHA 4K42A 3AO1A 3AO2A 2G8WA 3HBTA 3PX6A 1CXQA 2KQ2A 2OANA 4GY2B 2ITMA 2ZWHA 1RILA 4CJUA 2DFEA 5JLFA 2E2NA 1KXPA 5LY3A 2XRIA 4E0DA 3JS6A 4Z4GA 3DAWA 4B9UA 1KLMA 4IG0A 2BDPA 5B8HA 2A5XA 3R6MA 3AGKA 3IAYA 4RG8A 4CHOA 1J6ZA 2FXUA 2HNYA 5J1EA 3TAEA 4DSEA 2D1KA 3VEVA 3VF2A 3OYKA 1YJNN 3H1QA 3OYIA 2QWOA 3BY5A 1NK7A 3OS0A 3VQAA 2V7YA 1VHXA 2AJQA 5I9EB 3VEWA 2VQEK 4CZMA 2O8CA 1NG9A 4JHDB 4WFNL 2W42A 1FKOA 5E41A 3SBTA 2NRWA 4CJSA 2HBMA 3MN7A 1RDDA 3EN9A 3IS9A 1W0HA 2PZSA 2HHSA 1GLJO 2IS3A 2QWMA 3ZEUB 4CJ5A 5BPMA 4FJIA 5JICA 3CHWA 3WXJA 4CGIA 3RR8A 1NLVA 3TI0A 2RN2A 5HRNA 1TVRA 3AO5A 2FC0A 2OTLN 3DXKB 2B4JA 3ZSWA 4QS7A 4FM2A 4BC3A 4LSLA 3KLEA 5AQVA 4CJFA 3D6RA 3CFOA 2P9NB 3VQ6A 4M3XA 4DTUA 3CFPA 3NDKA 1N6QA 3GE1A 2A1RA 4IEIA 2P51A 4RCHA 5HROA 2PYJA 4CJQA 5AQNA 4BREA 1C0TA 1QHTA 2O8CB 4ICLA 1NJWA 3EE9A 3HSCA 3AVLA 4FWQA 1BU6O 1GOAA 4X66K 1NJIO 4AM7A 3B6PA 1Z6RA 4DTOA 3MCPA 4LH4A 4CECA 3DJCA 3PSFA 2G8HA 4BWJA 3DLKA 4BR4A 4EP4A 2EX3A 2AP1A 4RW9A 5GAHP 3HI0A 4Q5VA 1HQEA 4CZFA 2DFFA 1C1BA 3VESA 5CZ2A 4J2DA 2FF3B 3KKSA 4LF8K 4O0IA 1NJZA 3HP9A 1U48A 4YOTA 3H46O 4CHQA 3VENA 2CGKA 5GINA 1G99A 3EZWA 4FK4A 2QWLA 5AFUH 1LV5A 2F8SA 1KFSA 4F3OA 3SMPA 4H0PA 3CG7A 3QDKA 5ADXH 4HTUA 2ASPA 3U9DA 3JYTA 5FLXO 4CFBA 2UUBK 4IKFA 4G9ZA 4EZ9A 4K8ZA 1D5AA 4JD2A 3MN9A 4KHSA 4CF9A 3P31A 3K5NA 4CBWA 3HK2A 3LDQA 3A5NC 3THYB 2ZD1A 1OVYA 3ZETB 3HOSA 4IJAA 4BRLA 1KRPA 4YOVA 2XHBA 3L3VA 3M1FA 4CF0A 3VGLA 3T1AA 2XO7A 3S3OA 3HTVA 2FBXA 3MMVA 1ZXOA 5LMUK 3L4IA 3OYFA 2D4WA 3OYGA 3LAMA 4A59A 3KLIA 5BPLA 2Q3SA 4FJXA 4MO5A 1NK5A 5MLCQ 1LAWA 4KBOA 2ATQA 1S72N 2HF4A 1RT4A 1U47A 3ATVA 4F2SA 4EP5A 5KTQA 3L2WA 4L3QA 5M1KA 5D3GA 4KI6A 2G8UA 2VWBA 1NGJA 1S1UA 2ZGYA 4FK0A 3O9QA 1JLFA 2HHXA 3G6EN 4WE1A 2UUAK 4ELUA 4B3MK 1WSIA 3WXIA 2WFBA 3NVKA 2QWNA 2YHWA 2Q0RA 3UE5A 3WNEA 3EZ5A 4FWPA 5HRPA 2E5LK 3NBPA 5K14A 3LZIA 1RGIA 2W6KA 2YJFA 4FVMA 4LY7A 3WXMB 2Y1IA 4RTFD 3VMFB 2Z1IA 3D2FA 2GV9A 4DU3A 4IWVA 3MWTA 1DKGD 1BI4A 4C8OA 1LCUA 4RW7A 4DLEA 2P9LA 3K58A 3QMLA 3R3LA 2P9PA 3HZ6A 4JI1K 1CXUA 4CEDA 4KRFA 5AQUA 4N5SA 3MX2A 1WSFA 3U8XA 5BREA 3HO1A 1LWEA 1YF5L 1Z25A 1CZBA 3T69A 5CYQA 4DMNA 1NGCA 3CCEN 4DWIA 3CCVN 4BWMA 3F5TA 4JYAK 4BC5A 3OYJA 1NM1A 3ID8A 4CJTA 3TTCA 3P83D 4MO4A 1C0UA 1ILYA 4FJMA 2IGIA 3CERA 1RBRA 5IWAK 1LOTB 4KH5A 4FJLA 5BR9A 4RW8A 3S9HA 2D0PA 4JKGB 4CIGA 4W5RA 1HQUA 2YHXA 3ZSXA 4AHUA 4N76A 4E1JA 4KAZA 4CZLA 3QEXA 4AHCA 2Q36A 1VSLA 1K6YA 4HVJA 3V6DA 3TAFA 1U6ZA 1OVQA 3J80O 4B3TK 3H3OB 2HMIA 4CW7B 2O8BA 3A5MC 1WLJA 1VQON 3OYAA 4MDAA 4IOXA 3IMXA 4FCYA 3E9OA 4DS4A 3HJFA 2QXFA 4IG3A 3AV9A 3T3FA 3LDPA 3CQXA 1H1VA 4MLHA 3ZT3A 3P5JA 3HT3A 2OYQA 3CIPA 4PQUA 4ISFA 3OHRA 5AQGA 3VQPA 3KLHA 3SCXA 4DV3K 3T1YK 4FJ9A 1L5UA 5EOYA 4ID1A 4DSIA 3I8DA 4H0TB 1HR0K 1P8ZA 1RBSA 5BRHA 4CGFA 1T44A 4KO0A 3CM6A 1BQNA 3M5RA 3KWIA 3WQTA 4BRCA 4QS8A 3AA3A 1ATSA 4B8AB 1JLEA 4BVOA 4BQLA 4FL9A 1JLAA 4BG9A 5AQMA 5CYMA 4MFBA 4KFBA 2NLXA 4CIFA 3AY9A 4H0YB 5KRTA 2GUIA 2RE2A 4Z4EA 4H0XB 3OYHA 3RSEA 2VWJA 4DB3A 1HNIA 4YFUA 2QM1A 3O1BA 1VSEA 2YHAA 4KTZA 4O5BA 2I7NA 1WBBA 4CJKA 4OPJA 1OH7A 2O8EB 1X9SA 2HHUA 4BGBA 1JL2A 3CCJN 4K8XA 1GLBG 3FLCO 3VN5A 4IFVA 3LZJA 1ZBIA 1YTUA 3G10A 1SL1A 3NF6A 3ZT1A 3SNNA 3C94A 3V4IA 3SQ1A 2QXLA 2YKMA 3MN6A 1X1PA 4DKWA 4CD1A 1XUPO 4PL8A 2GBZA 4DU4A 5EXWA 1VQ5N 4CF1A 4B9LA 4OKEA 3OS2A 2A41A 4FPAA 3THXB 5LJVA 3EYZA 4H03B 3AA5X 4JKGA 2IDOA 3O1WA 1VQPN 3T7ZA 4CJ7A 3M3ZA 3LAKA 1WB9A 3B6OA 3RMAA 4K0KK 2P9SA 2W41A 3I56N 4CK2A 3V9SA 2YI1A 4IOCL 1EWQA 1JLQA 3AVCA 3BGRA 1IV0A 4GNIA 5DMRA 4Z4FA 4H4OA 4GKKK 2FBYA 3R1XA 3AO3A 4FPBA 3KK7A 2FBVA 2G8IA 4IDKA 4BR2A 4CHYA 2VYPA 2BH1A 1VRTA 2IVNA 1TGOA 3SLCA 2WC9A 2KZMA 4FWNA 3DOKA 4IOAL 1LAVA 3AVKA 3MDQA 3TAMA 4B1XB 3CCLN 2OZMA 3RMBA 1ASUA 5EVZA
chains in the Genus database with same CATH topology
4RG8A 4CHOA 2HMIA 2HNYA 4OKKA 3NF9A 3EY1A 5J1EA 3MXMA 3TAEA 3DRPA 1DLOA 4DSEA 4C8KA 3OYKA 3LPUA 1C6VA 3MAQA 4OLBA 2HVIA 3OYIA 4KHYA 1CLQA 1RDBA 3L3UA 1NK7A 4O4GA 1LW2A 3OS0A 3ZCMA 2O4GA 3SZ2A 4Z4CA 1C1CA 4DG1A 4M3RA 3VQAA 3NE6A 2KFNA 1RNHA 4DFPA 1T05A 1RBTA 3P1GA 3LDSA 3ULDA 2AJQA 1YTAA 3VA0A 1BCMA 4KHUA 3TANA 1KSPA 2W42A 4FLVA 1FKOA 1BISA 4DSLA 2VG5A 5E41A 5HP1A 3TAPA 1XI1A 3HPGA 4CJSA 2YNHA 3D45A 4LH5A 3KTQA 5FRMA 3QETA 1RDDA 4ELTA 3IS9A 4CGJA 1W0HA 3QIOA 1S1WA 4AILC 1WSJA 4E7LA 1G15A 2PZSA 4OGEA 4E89A 1N5YA 2HNZA 2HHSA 2IS3A 4CJ5A 4DTSA 4PA1A 4OVLA 3V1QA 4FJIA 3QNNA 1XWLA 2HNDA 2IC3A 4CGIA 4FLTA 3KLFA 3SUNA 4Q0BA 3RR8A 1QSYA 4RW6A 3WNHA 1Y97A 4C8NA 3TI0A 4FLUA 2RN2A 5HRNA 4CEAA 4KTQA 1TVRA 1BQMA 2B6AA 3AO5A 2FC0A 4NCAA 4KTWA 2B4JA 4YNQA 1FXXA 1RT3A 3ZSWA 4DS5A 3OYMA 3JSMA 3KD5E 1S6PA 2ZE2A 3DLRA 4I2PA 4FM2A 1ASWA 4LSLA 4C8LA 3KLEA 1I3AA 1RDCA 4CJFA 1U4BA 3CFOA 4BDYA 2OPPA 4B08A 1NOYA 1SUQA 4E19A 3VQ6A 3RMCA 1HNVA 4DTUA 4M3XA 2KFZA 3HYFA 3TR8A 3NDKA 3CFPA 1N6QA 2A1RA 2G8FA 5DK5A 4CEBA 1LW0A 2P51A 1NJYA 4M42A 5HROA 3SUOA 3QEPA 3K2PA 1JLGA 5JS2A 4UQGA 5C24A 5HLFA 2PYJA 4CJQA 2QK9A 3NGYA 5C25A 1C0TA 3QEVA 1QHTA 3F9KA 4ICLA 1NJWA 4B9NA 4J2AA 1S9GA 3AVLA 1JXEA 2D0BA 3L2VA 2Z1JA 3V1OA 3PX0A 1GOAA 3SQ4A 3ZSOA 3AVNA 4B8CA 1RBUA 1TL3A 3B6PA 1GOBA 4KB0A 4E7KA 1WSHA 4DTOA 4LH4A 4CECA 4CEOA 1VSIA 4E7IA 4DTMA 2G8VA 3V9XA 2G8HA 4BWJA 3KK1A 3DLKA 4AHRA 4EP4A 4AHSA 3SJJA 1NOZA 2EX3A 1T8EA 2LSNA 4RW9A 1VSDA 1ZBLA 3TARA 3PUFA 4W5OA 4Q5VA 1HMVA 1HQEA 4NYNA 1B92A 3SUPA 3ZSQA 1QE1A 1TK5A 3VQ9A 3K5OA 4ZHRA 3SV4A 1YT3A 2DFFA 1C1BA 3LPTA 4G1QA 5FDLA 3LP0A 5CZ2A 2IOCA 3NCIA 4J2DA 3KKSA 4Z4FA 3M8QA 3OJUA 4FJGA 4O0IA 1NJZA 4GVMA 3HP9A 4DTNA 1U48A 4JRQA 1UA0A 3OY9A 4O0JA 2HHXA 3AA2A 3LP2A 4CHQA 3KK3A 4E3SA 4BE1A 1DTQA 4CGHA 3OYLA 1TL1A 3DM2A 1EXQA 2BE2A 5EU7A 3AO4A 3OYCA 3VA3A 4DFJA 1NK8A 1D9FA 4F8RA 3HL8A 3VQQA 5HRSA 3KIOA 1J54A 1XHXA 4FK4A 1LV5A 2F8SA 4CGGA 5J2PA 1T03A 1KFSA 1VSKA 3PX4A 3DLHA 4F3OA 2EHGA 3CG7A 3U3GA 4HTUA 3L8BA 2DY4A 1Q9XA 3JYTA 4CFBA 3D0PA 4JRPA 4IKFA 4EZ9A 4FM0A 4DQSA 4HCBA 4K8ZA 1D5AA 3ZSRA 4KB1A 1IO2A 1SL0A 2R7YA 3AVGA 1L3VA 4E7HA 4KPYA 4CERA 1KTQA 4KHSA 3QESA 1BL3A 4CF9A 4B9SA 1UOCA 2YNFA 5CZ1A 2PY5A 2YNGA 3K5NA 3KKRA 1VSJA 2OPSA 4O55A 3K57A 1NK4A 3HK2A 4DQQA 1TAUA 4NYFA 1IKYA 1TK0A 2O4IA 1ASVA 1ZBFA 2ZD1A 3ZSVA 4W5TA 3V1RA 1HYZA 1W9HA 1J5OA 3TAQA 4PWDA 1NKBA 4FK2A 4CK3A 3MXJA 1O1WA 3HSTB 1EX4A 3PV8A 1KRPA 1RTDA 4W5NA 2XHBA 3L3VA 3TAGA 4CF0A 1GOCA 1J9AA 3T1AA 4FJ8A 4F2RA 4O44A 2XO7A 3S3OA 4JS4A 4Z4IA 2FBXA 3KJVA 3ZT0A 1B9FA 1B9DA 3DYAA 3OYFA 3VQ8A 1RT5A 3OYGA 3LAMA 2YV0X 1HYVA 3KLIA 1ZBHA 4LSNA 4DTXA 1Q8IA 3AVAA 2Q3SA 4EZ6A 1KVBA 3HPOA 5J2NA 4I9QA 4FJXA 3ZT2A 3ITHA 1A5WA 3VQEA 2X6NA 1BCOA 3K5LA 1LAWA 1NK5A 1A5XA 2ATQA 4N47A 3NH1A 1RT4A 3AA4A 3VQ4A 1U47A 3VQDA 2HVHA 3TABA 4F2SA 1HPZA 4CJ3A 4EP5A 3MECA 5KTQA 2I5JA 4IBNA 3L2WA 4OKJA 2D5RA 4DQIA 5D3GA 4ZTJA 1REVA 2G8KA 3HXMA 4KI6A 4FZZA 1NK6A 1BIZA 1L3SA 1UWBA 2G8UA 3KD1E 1A5VA 1NKCA 4QOZB 3DLGA 4BDZA 4KHQA 3PY8A 3ZT4A 3RWUA 1S1UA 2RKIA 4M3YA 1RBVA 4FK0A 3CM5A 1JLFA 3NH2A 3I0RA 3S3MA 4L8RB 1WAFA 4I2QA 4DTRA 3A2FA 4FYDA 4WE1A 4ELUA 1VSHA 3C6UA 1WSIA 3QNOA 2XY6A 4DFMA 2WONA 1S1XA 4DF4A 4H4MA 4CJEA 4DQRA 2E4LA 1NK0A 4M45A 4FJ7A 3EZ5A 3WNEA 3MXIA 2E6LA 2KW4A 5HRPA 4M3UA 4CK1A 3NBPA 5K14A 4FLXA 2OPRA 4CHNA 3LZIA 3I0SA 1SKSA 4FJ5A 1IH7A 2F96A 4FVMA 3DI6A 2D0CA 4LY7A 2Y1IA 5C42A 4CHPA 1T7PA 2XY7A 3M8SA 2Z1IA 1TKXA 4DQPA 3PO5A 4BACA 1VK0A 2GV9A 2IAJA 4BE2A 3DMJA 4DU3A 5SWMA 1TKTA 1BI4A 4C8OA 4RW7A 4OPKA 4DLEA 4Y1DA 4E1MA 1WSGA 1YVUA 4DF8A 3K58A 4CIEA 1ITGA 2Z1GA 3VQCA 3HVRA 4FLZA 4FZXC 2YNIA 4Y1CA 3QEIA 4DU1A 1CXUA 1JLBA 1VRUA 4CEDA 4KRFA 3G0ZA 4R5PA 4KI4A 1S6QA 1BGXT 4N5SA 4DLGA 4DTJA 1WSFA 1WNSA 4IFYA 2DFHA 3K59A 3HO1A 3L2UA 1I39A 4FW2A 3V9UA 1LWEA 2X74A 2RPIA 1ZYQA 1LWFA 1Z25A 3SPZA 2BGGA 1BIUA 4BDPA 1CZBA 1CZ9A 1XHZA 2KTQA 1SKRA 5CYQA 2FBTA 2Z1HA 1RDAA 4LD0A 3SUQA 4DMNA 4CJPA 4DWIA 1EETA 4BWMA 4MQ3A 1U45A 3F73A 3C6TA 3QEWA 2Y1JA 3RRGA 3OYJA 4CJTA 1R0AA 4NCBA 3P83D 1C0UA 3LANA 2DTUA 3O4QA 1JLCA 3L2RA 4H8KA 3QO9A 3O3FA 4FJMA 2IGIA 1JXBA 1KCFA 1RBRA 4HUGA 4FJLA 4RW8A 4DSFA 4ID5A 3L2QA 3AVJA 4OJRA 3S9HA 4M41A 2HHTA 4CIGA 3SPYA 4AHTA 4F4KA 4W5RA 1HQUA 3ZSXA 3RMDA 3NH0A 3H08A 3WNFA 1S9EA 1ZBUA 4AHUA 4N76A 1RTJA 4C8MA 3WNGA 2E6MA 4AH9A 4FM1A 3QEXA 2QKKA 4HCCA 4KAZA 4AHCA 2JLEA 3OYEA 3AVHA 1VSLA 1K6YA 3V9ZA 1TKZA 1TAQA 1SKWA 4HVJA 2VWKA 3V6DA 3TAFA 5KGXA 1QS4A 1JKHA 1L3UA 4CJWA 3MEEA 5J2MA 3OJSA 3DOLA 3QINA 2X78A 3ISNC 1RT7A 3T19A 4CF8A 4CEZA 4CF2A 3NAEA 2B5JA 3U3YA 2PYLA 3AVIA 1L3TA 1TV6A 1WLJA 3SQ2A 1KVCA 1XC9A 3OYAA 2HHVA 4AHVA 1IG9A 2HB5A 3C95A 3VQ7A 3ZSZA 3HM9A 2P5GA 2A1SA 1RT2A 1SV5A 1WSEA 5KGWA 4FCYA 4CGDA 4DFKA 4DS4A 3OYNA 4N41A 3HJFA 3CQ8A 2QXFA 1WAJA 2P1JA 3M8RA 4IG3A 3OS1A 3AV9A 3T3FA 4CCHA 3NFAA 1EP4A 1F21A 3ZT3A 3P5JA 5T7BA 1KFDA 3HT3A 4J2EA 2OYQA 4B3OA 3O3GA 4PQUA 2KZZA 3VQPA 4Z4HA 1U49A 4E1NA 3KLGA 3KLHA 2D0AA 3RTVA 4FLWA 4FLYA 2YHBA 3SCXA 4FJ9A 1L5UA 5FRNA 2HHQA 2OPQA 4ID1A 3OYDA 1TKDA 4DSIA 2X6SA 3I8DA 1Z26A 3ALYA 4CJVA 1RBSA 1BI4B 1VSFA 4XIUA 4CGFA 3NGIA 4KHWA 3NF8A 3HP6A 5I3UA 3QLHA 4KO0A 3O4NA 4KV8A 4JS5A 5J2QA 3CM6A 1BQNA 1C1AA 4KKOA 4M3TA 4HUEA 3AA3A 3NHGA 3LWMA 4E7JA 1KLNA 2HHWA 4B8AB 1IKVA 3IG1A 3THVA 4ZTFA 4TSXA 4OGCA 4B9TA 1JLEA 4NCGA 4FW1A 1JLAA 3NGZA 3K5MA 1S1VA 4GMJB 2F8TA 1RCHA 5CYMA 1QQCA 1X9WA 4MFBA 5FROA 1RT6A 1D9DA 4KFBA 4QAGA 4CIFA 1BHLA 4HUFA 1QSSA 4M3ZA 3DRSA 5KRTA 2GUIA 1HJRA 4HHTA 4Z4EA 1NJXA 1QSLA 4J2BA 1NK9A 3OYHA 3FFIA 2P5OA 4CE9A 3UIQA 2VWJA 1HNIA 4CEQA 4YFUA 1IKXA 4N56A 3TWHA 2OA8A 2ETJA 4CJRA 5SZTA 3BDPA 1VSEA 2YHAA 1EKEA 2NUBA 1RT1A 2XY8A 4KTZA 4O5BA 4CJKA 4OPJA 4JLHA 1X9SA 1X9MA 4DSKA 2HW3A 2HHUA 1JL2A 4K8XA 2OZSA 4DTPA 3SQ0A 3VN5A 2WOMA 3ASMA 4IFVA 3LZJA 4Z0UA 1JL1A 1MU2A 1ZBIA 2QKBA 1Q9YA 1YTUA 3CYMA 4ELVA 2JGUA 3G10A 3LP3A 1SL1A 3NF6A 5KI6A 3ZT1A 4FJJA 3SNNA 4FXDA 3M8PA 3C94A 3V4IA 3SQ1A 2YKMA 1KVAA 5HRRA 2VG6A 4KHNA 1X1PA 1IKWA 2BANA 3OVNA 1NKEA 3RR7A 1C0MA 2GBZA 4DU4A 3SV3A 1QTMA 4CF1A 4B9LA 4OKEA 1DTTA 2RF2A 4FJNA 3OS2A 4BE0A 3DRRA 4B9MA 4CJLA 4F3TA 3IRXA 3V81A 1UA1A 3EYZA 4OLAA 3VQ5A 1VSMA 4B9VA 3O3HA 3AA5X 2IDOA 4CFDA 1SL2A 1RTIA 3LAKA 3LALA 3B6OA 4FJKA 3RMAA 4PUOA 4CK2A 3V9SA 2ITGA 1S5JA 1LWCA 5HBMA 4CEEA 3MEDA 4M3WA 4CEFA 1WN7A 2YKNA 4CFAA 1JLQA 3AVCA 3SYZA 3BGRA 3RRHA 5JS1A 4PY5A 3DLBA 3LP1A 2XY5A 5DMRA 3AVMA 3VQBA 3AVBA 4H4OA 4CHZA 5CY4A 5KRSA 4GW6A 3SI6A 3S3NA 1J53A 3DLEA 1HYSA 2FBYA 3AO3A 3CFRA 3V9WA 4RW4A 3HPHA 2FBVA 2G8IA 4IDKA 2ZQBA 4CESA 4CHYA 4W5QA 4I9LA 1FK9A 1FKPA 4FJHA 2VG7A 3AO1A 3AO2A 3U6FA 1VRTA 3E01A 2G8WA 1TGOA 3PX6A 3IAYA 1CXQA 2KQ2A 1U04A 4DSJA 2KZMA 4CJUA 1RILA 1RTHA 2DFEA 3DOKA 4E0DA 2XRIA 1LAVA 3HVTA 3KK2A 1TK8A 3AVKA 4Z4GA 3AVFA 3QERA 1KLMA 4B9UA 3QIPA 3OYBA 4IG0A 3LWLA 1HRHA 3MEGA 3TAMA 4FZYA 3NF7A 4KREA 1D8YA 2BDPA 3PO4A 4QCLA 4CFCA 2OZMA 5I42A 4I7FA 3ZSYA 1S1TA 4CJ4A 3RMBA 1ASUA 1UAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG8 A;  4CHO A;  2HMI A;  2HNY A;  4OKK A;  3NF9 A;  3EY1 A;  5J1E A;  3MXM A;  3TAE A;  3DRP A;  1DLO A;  4DSE A;  4C8K A;  3OYK A;  3LPU A;  1C6V A;  3MAQ A;  4OLB A;  2HVI A;  3OYI A;  4KHY A;  1CLQ A;  1RDB A;  3L3U A;  1NK7 A;  4O4G A;  1LW2 A;  3OS0 A;  3ZCM A;  2O4G A;  3SZ2 A;  4Z4C A;  1C1C A;  4DG1 A;  4M3R A;  3VQA A;  3NE6 A;  2KFN A;  1RNH A;  4DFP A;  1T05 A;  1RBT A;  3P1G A;  3LDS A;  3ULD A;  2AJQ A;  1YTA A;  3VA0 A;  1BCM A;  4KHU A;  3TAN A;  1KSP A;  2W42 A;  4FLV A;  1FKO A;  1BIS A;  4DSL A;  2VG5 A;  5E41 A;  5HP1 A;  3TAP A;  1XI1 A;  3HPG A;  4CJS A;  2YNH A;  3D45 A;  4LH5 A;  3KTQ A;  5FRM A;  3QET A;  1RDD A;  4ELT A;  3IS9 A;  4CGJ A;  1W0H A;  3QIO A;  1S1W A;  4AIL C;  1WSJ A;  4E7L A;  1G15 A;  2PZS A;  4OGE A;  4E89 A;  1N5Y A;  2HNZ A;  2HHS A;  2IS3 A;  4CJ5 A;  4DTS A;  4PA1 A;  4OVL A;  3V1Q A;  4FJI A;  3QNN A;  1XWL A;  2HND A;  2IC3 A;  4CGI A;  4FLT A;  3KLF A;  3SUN A;  4Q0B A;  3RR8 A;  1QSY A;  4RW6 A;  3WNH A;  1Y97 A;  4C8N A;  3TI0 A;  4FLU A;  2RN2 A;  5HRN A;  4CEA A;  4KTQ A;  1TVR A;  1BQM A;  2B6A A;  3AO5 A;  2FC0 A;  4NCA A;  4KTW A;  2B4J A;  4YNQ A;  1FXX A;  1RT3 A;  3ZSW A;  4DS5 A;  3OYM A;  3JSM A;  3KD5 E;  1S6P A;  2ZE2 A;  3DLR A;  4I2P A;  4FM2 A;  1ASW A;  4LSL A;  4C8L A;  3KLE A;  1I3A A;  1RDC A;  4CJF A;  1U4B A;  3CFO A;  4BDY A;  2OPP A;  4B08 A;  1NOY A;  1SUQ A;  4E19 A;  3VQ6 A;  3RMC A;  1HNV A;  4DTU A;  4M3X A;  2KFZ A;  3HYF A;  3TR8 A;  3NDK A;  3CFP A;  1N6Q A;  2A1R A;  2G8F A;  5DK5 A;  4CEB A;  1LW0 A;  2P51 A;  1NJY A;  4M42 A;  5HRO A;  3SUO A;  3QEP A;  3K2P A;  1JLG A;  5JS2 A;  4UQG A;  5C24 A;  5HLF A;  2PYJ A;  4CJQ A;  2QK9 A;  3NGY A;  5C25 A;  1C0T A;  3QEV A;  1QHT A;  3F9K A;  4ICL A;  1NJW A;  4B9N A;  4J2A A;  1S9G A;  3AVL A;  1JXE A;  2D0B A;  3L2V A;  2Z1J A;  3V1O A;  3PX0 A;  1GOA A;  3SQ4 A;  3ZSO A;  3AVN A;  4B8C A;  1RBU A;  1TL3 A;  3B6P A;  1GOB A;  4KB0 A;  4E7K A;  1WSH A;  4DTO A;  4LH4 A;  4CEC A;  4CEO A;  1VSI A;  4E7I A;  4DTM A;  2G8V A;  3V9X A;  2G8H A;  4BWJ A;  3KK1 A;  3DLK A;  4AHR A;  4EP4 A;  4AHS A;  3SJJ A;  1NOZ A;  2EX3 A;  1T8E A;  2LSN A;  4RW9 A;  1VSD A;  1ZBL A;  3TAR A;  3PUF A;  4W5O A;  4Q5V A;  1HMV A;  1HQE A;  4NYN A;  1B92 A;  3SUP A;  3ZSQ A;  1QE1 A;  1TK5 A;  3VQ9 A;  3K5O A;  4ZHR A;  3SV4 A;  1YT3 A;  2DFF A;  1C1B A;  3LPT A;  4G1Q A;  5FDL A;  3LP0 A;  5CZ2 A;  2IOC A;  3NCI A;  4J2D A;  3KKS A;  4Z4F A;  3M8Q A;  3OJU A;  4FJG A;  4O0I A;  1NJZ A;  4GVM A;  3HP9 A;  4DTN A;  1U48 A;  4JRQ A;  1UA0 A;  3OY9 A;  4O0J A;  2HHX A;  3AA2 A;  3LP2 A;  4CHQ A;  3KK3 A;  4E3S A;  4BE1 A;  1DTQ A;  4CGH A;  3OYL A;  1TL1 A;  3DM2 A;  1EXQ A;  2BE2 A;  5EU7 A;  3AO4 A;  3OYC A;  3VA3 A;  4DFJ A;  1NK8 A;  1D9F A;  4F8R A;  3HL8 A;  3VQQ A;  5HRS A;  3KIO A;  1J54 A;  1XHX A;  4FK4 A;  1LV5 A;  2F8S A;  4CGG A;  5J2P A;  1T03 A;  1KFS A;  1VSK A;  3PX4 A;  3DLH A;  4F3O A;  2EHG A;  3CG7 A;  3U3G A;  4HTU A;  3L8B A;  2DY4 A;  1Q9X A;  3JYT A;  4CFB A;  3D0P A;  4JRP A;  4IKF A;  4EZ9 A;  4FM0 A;  4DQS A;  4HCB A;  4K8Z A;  1D5A A;  3ZSR A;  4KB1 A;  1IO2 A;  1SL0 A;  2R7Y A;  3AVG A;  1L3V A;  4E7H A;  4KPY A;  4CER A;  1KTQ A;  4KHS A;  3QES A;  1BL3 A;  4CF9 A;  4B9S A;  1UOC A;  2YNF A;  5CZ1 A;  2PY5 A;  2YNG A;  3K5N A;  3KKR A;  1VSJ A;  2OPS A;  4O55 A;  3K57 A;  1NK4 A;  3HK2 A;  4DQQ A;  1TAU A;  4NYF A;  1IKY A;  1TK0 A;  2O4I A;  1ASV A;  1ZBF A;  2ZD1 A;  3ZSV A;  4W5T A;  3V1R A;  1HYZ A;  1W9H A;  1J5O A;  3TAQ A;  4PWD A;  1NKB A;  4FK2 A;  4CK3 A;  3MXJ A;  1O1W A;  3HST B;  1EX4 A;  3PV8 A;  1KRP A;  1RTD A;  4W5N A;  2XHB A;  3L3V A;  3TAG A;  4CF0 A;  1GOC A;  1J9A A;  3T1A A;  4FJ8 A;  4F2R A;  4O44 A;  2XO7 A;  3S3O A;  4JS4 A;  4Z4I A;  2FBX A;  3KJV A;  3ZT0 A;  1B9F A;  1B9D A;  3DYA A;  3OYF A;  3VQ8 A;  1RT5 A;  3OYG A;  3LAM A;  2YV0 X;  1HYV A;  3KLI A;  1ZBH A;  4LSN A;  4DTX A;  1Q8I A;  3AVA A;  2Q3S A;  4EZ6 A;  1KVB A;  3HPO A;  5J2N A;  4I9Q A;  4FJX A;  3ZT2 A;  3ITH A;  1A5W A;  3VQE A;  2X6N A;  1BCO A;  3K5L A;  1LAW A;  1NK5 A;  1A5X A;  2ATQ A;  4N47 A;  3NH1 A;  1RT4 A;  3AA4 A;  3VQ4 A;  1U47 A;  3VQD A;  2HVH A;  3TAB A;  4F2S A;  1HPZ A;  4CJ3 A;  4EP5 A;  3MEC A;  5KTQ A;  2I5J A;  4IBN A;  3L2W A;  4OKJ A;  2D5R A;  4DQI A;  5D3G A;  4ZTJ A;  1REV A;  2G8K A;  3HXM A;  4KI6 A;  4FZZ A;  1NK6 A;  1BIZ A;  1L3S A;  1UWB A;  2G8U A;  3KD1 E;  1A5V A;  1NKC A;  4QOZ B;  3DLG A;  4BDZ A;  4KHQ A;  3PY8 A;  3ZT4 A;  3RWU A;  1S1U A;  2RKI A;  4M3Y A;  1RBV A;  4FK0 A;  3CM5 A;  1JLF A;  3NH2 A;  3I0R A;  3S3M A;  4L8R B;  1WAF A;  4I2Q A;  4DTR A;  3A2F A;  4FYD A;  4WE1 A;  4ELU A;  1VSH A;  3C6U A;  1WSI A;  3QNO A;  2XY6 A;  4DFM A;  2WON A;  1S1X A;  4DF4 A;  4H4M A;  4CJE A;  4DQR A;  2E4L A;  1NK0 A;  4M45 A;  4FJ7 A;  3EZ5 A;  3WNE A;  3MXI A;  2E6L A;  2KW4 A;  5HRP A;  4M3U A;  4CK1 A;  3NBP A;  5K14 A;  4FLX A;  2OPR A;  4CHN A;  3LZI A;  3I0S A;  1SKS A;  4FJ5 A;  1IH7 A;  2F96 A;  4FVM A;  3DI6 A;  2D0C A;  4LY7 A;  2Y1I A;  5C42 A;  4CHP A;  1T7P A;  2XY7 A;  3M8S A;  2Z1I A;  1TKX A;  4DQP A;  3PO5 A;  4BAC A;  1VK0 A;  2GV9 A;  2IAJ A;  4BE2 A;  3DMJ A;  4DU3 A;  5SWM A;  1TKT A;  1BI4 A;  4C8O A;  4RW7 A;  4OPK A;  4DLE A;  4Y1D A;  4E1M A;  1WSG A;  1YVU A;  4DF8 A;  3K58 A;  4CIE A;  1ITG A;  2Z1G A;  3VQC A;  3HVR A;  4FLZ A;  4FZX C;  2YNI A;  4Y1C A;  3QEI A;  4DU1 A;  1CXU A;  1JLB A;  1VRU A;  4CED A;  4KRF A;  3G0Z A;  4R5P A;  4KI4 A;  1S6Q A;  1BGX T;  4N5S A;  4DLG A;  4DTJ A;  1WSF A;  1WNS A;  4IFY A;  2DFH A;  3K59 A;  3HO1 A;  3L2U A;  1I39 A;  4FW2 A;  3V9U A;  1LWE A;  2X74 A;  2RPI A;  1ZYQ A;  1LWF A;  1Z25 A;  3SPZ A;  2BGG A;  1BIU A;  4BDP A;  1CZB A;  1CZ9 A;  1XHZ A;  2KTQ A;  1SKR A;  5CYQ A;  2FBT A;  2Z1H A;  1RDA A;  4LD0 A;  3SUQ A;  4DMN A;  4CJP A;  4DWI A;  1EET A;  4BWM A;  4MQ3 A;  1U45 A;  3F73 A;  3C6T A;  3QEW A;  2Y1J A;  3RRG A;  3OYJ A;  4CJT A;  1R0A A;  4NCB A;  3P83 D;  1C0U A;  3LAN A;  2DTU A;  3O4Q A;  1JLC A;  3L2R A;  4H8K A;  3QO9 A;  3O3F A;  4FJM A;  2IGI A;  1JXB A;  1KCF A;  1RBR A;  4HUG A;  4FJL A;  4RW8 A;  4DSF A;  4ID5 A;  3L2Q A;  3AVJ A;  4OJR A;  3S9H A;  4M41 A;  2HHT A;  4CIG A;  3SPY A;  4AHT A;  4F4K A;  4W5R A;  1HQU A;  3ZSX A;  3RMD A;  3NH0 A;  3H08 A;  3WNF A;  1S9E A;  1ZBU A;  4AHU A;  4N76 A;  1RTJ A;  4C8M A;  3WNG A;  2E6M A;  4AH9 A;  4FM1 A;  3QEX A;  2QKK A;  4HCC A;  4KAZ A;  4AHC A;  2JLE A;  3OYE A;  3AVH A;  1VSL A;  1K6Y A;  3V9Z A;  1TKZ A;  1TAQ A;  1SKW A;  4HVJ A;  2VWK A;  3V6D A;  3TAF A;  5KGX A;  1QS4 A;  1JKH A;  1L3U A;  4CJW A;  3MEE A;  5J2M A;  3OJS A;  3DOL A;  3QIN A;  2X78 A;  3ISN C;  1RT7 A;  3T19 A;  4CF8 A;  4CEZ A;  4CF2 A;  3NAE A;  2B5J A;  3U3Y A;  2PYL A;  3AVI A;  1L3T A;  1TV6 A;  1WLJ A;  3SQ2 A;  1KVC A;  1XC9 A;  3OYA A;  2HHV A;  4AHV A;  1IG9 A;  2HB5 A;  3C95 A;  3VQ7 A;  3ZSZ A;  3HM9 A;  2P5G A;  2A1S A;  1RT2 A;  1SV5 A;  1WSE A;  5KGW A;  4FCY A;  4CGD A;  4DFK A;  4DS4 A;  3OYN A;  4N41 A;  3HJF A;  3CQ8 A;  2QXF A;  1WAJ A;  2P1J A;  3M8R A;  4IG3 A;  3OS1 A;  3AV9 A;  3T3F A;  4CCH A;  3NFA A;  1EP4 A;  1F21 A;  3ZT3 A;  3P5J A;  5T7B A;  1KFD A;  3HT3 A;  4J2E A;  2OYQ A;  4B3O A;  3O3G A;  4PQU A;  2KZZ A;  3VQP A;  4Z4H A;  1U49 A;  4E1N A;  3KLG A;  3KLH A;  2D0A A;  3RTV A;  4FLW A;  4FLY A;  2YHB A;  3SCX A;  4FJ9 A;  1L5U A;  5FRN A;  2HHQ A;  2OPQ A;  4ID1 A;  3OYD A;  1TKD A;  4DSI A;  2X6S A;  3I8D A;  1Z26 A;  3ALY A;  4CJV A;  1RBS A;  1BI4 B;  1VSF A;  4XIU A;  4CGF A;  3NGI A;  4KHW A;  3NF8 A;  3HP6 A;  5I3U A;  3QLH A;  4KO0 A;  3O4N A;  4KV8 A;  4JS5 A;  5J2Q A;  3CM6 A;  1BQN A;  1C1A A;  4KKO A;  4M3T A;  4HUE A;  3AA3 A;  3NHG A;  3LWM A;  4E7J A;  1KLN A;  2HHW A;  4B8A B;  1IKV A;  3IG1 A;  3THV A;  4ZTF A;  4TSX A;  4OGC A;  4B9T A;  1JLE A;  4NCG A;  4FW1 A;  1JLA A;  3NGZ A;  3K5M A;  1S1V A;  4GMJ B;  2F8T A;  1RCH A;  5CYM A;  1QQC A;  1X9W A;  4MFB A;  5FRO A;  1RT6 A;  1D9D A;  4KFB A;  4QAG A;  4CIF A;  1BHL A;  4HUF A;  1QSS A;  4M3Z A;  3DRS A;  5KRT A;  2GUI A;  1HJR A;  4HHT A;  4Z4E A;  1NJX A;  1QSL A;  4J2B A;  1NK9 A;  3OYH A;  3FFI A;  2P5O A;  4CE9 A;  3UIQ A;  2VWJ A;  1HNI A;  4CEQ A;  4YFU A;  1IKX A;  4N56 A;  3TWH A;  2OA8 A;  2ETJ A;  4CJR A;  5SZT A;  3BDP A;  1VSE A;  2YHA A;  1EKE A;  2NUB A;  1RT1 A;  2XY8 A;  4KTZ A;  4O5B A;  4CJK A;  4OPJ A;  4JLH A;  1X9S A;  1X9M A;  4DSK A;  2HW3 A;  2HHU A;  1JL2 A;  4K8X A;  2OZS A;  4DTP A;  3SQ0 A;  3VN5 A;  2WOM A;  3ASM A;  4IFV A;  3LZJ A;  4Z0U A;  1JL1 A;  1MU2 A;  1ZBI A;  2QKB A;  1Q9Y A;  1YTU A;  3CYM A;  4ELV A;  2JGU A;  3G10 A;  3LP3 A;  1SL1 A;  3NF6 A;  5KI6 A;  3ZT1 A;  4FJJ A;  3SNN A;  4FXD A;  3M8P A;  3C94 A;  3V4I A;  3SQ1 A;  2YKM A;  1KVA A;  5HRR A;  2VG6 A;  4KHN A;  1X1P A;  1IKW A;  2BAN A;  3OVN A;  1NKE A;  3RR7 A;  1C0M A;  2GBZ A;  4DU4 A;  3SV3 A;  1QTM A;  4CF1 A;  4B9L A;  4OKE A;  1DTT A;  2RF2 A;  4FJN A;  3OS2 A;  4BE0 A;  3DRR A;  4B9M A;  4CJL A;  4F3T A;  3IRX A;  3V81 A;  1UA1 A;  3EYZ A;  4OLA A;  3VQ5 A;  1VSM A;  4B9V A;  3O3H A;  3AA5 X;  2IDO A;  4CFD A;  1SL2 A;  1RTI A;  3LAK A;  3LAL A;  3B6O A;  4FJK A;  3RMA A;  4PUO A;  4CK2 A;  3V9S A;  2ITG A;  1S5J A;  1LWC A;  5HBM A;  4CEE A;  3MED A;  4M3W A;  4CEF A;  1WN7 A;  2YKN A;  4CFA A;  1JLQ A;  3AVC A;  3SYZ A;  3BGR A;  3RRH A;  5JS1 A;  4PY5 A;  3DLB A;  3LP1 A;  2XY5 A;  5DMR A;  3AVM A;  3VQB A;  3AVB A;  4H4O A;  4CHZ A;  5CY4 A;  5KRS A;  4GW6 A;  3SI6 A;  3S3N A;  1J53 A;  3DLE A;  1HYS A;  2FBY A;  3AO3 A;  3CFR A;  3V9W A;  4RW4 A;  3HPH A;  2FBV A;  2G8I A;  4IDK A;  2ZQB A;  4CES A;  4CHY A;  4W5Q A;  4I9L A;  1FK9 A;  1FKP A;  4FJH A;  2VG7 A;  3AO1 A;  3AO2 A;  3U6F A;  1VRT A;  3E01 A;  2G8W A;  1TGO A;  3PX6 A;  3IAY A;  1CXQ A;  2KQ2 A;  1U04 A;  4DSJ A;  2KZM A;  4CJU A;  1RIL A;  1RTH A;  2DFE A;  3DOK A;  4E0D A;  2XRI A;  1LAV A;  3HVT A;  3KK2 A;  1TK8 A;  3AVK A;  4Z4G A;  3AVF A;  3QER A;  1KLM A;  4B9U A;  3QIP A;  3OYB A;  4IG0 A;  3LWL A;  1HRH A;  3MEG A;  3TAM A;  4FZY A;  3NF7 A;  4KRE A;  1D8Y A;  2BDP A;  3PO4 A;  4QCL A;  4CFC A;  2OZM A;  5I42 A;  4I7F A;  3ZSY A;  1S1T A;  4CJ4 A;  3RMB A;  1ASU A;  1UAX A; 
#chains in the Genus database with same CATH topology
 1XMQ K;  1K73 O;  3EY1 A;  4OKK A;  4FWK A;  3MXM A;  2NRT A;  4YY3 K;  4C8K A;  1K8A O;  4A57 A;  5H1S Q;  3LPU A;  4NXM K;  3MAQ A;  1CLQ A;  5AQJ A;  4DV7 K;  1LW2 A;  4Z4C A;  1C1C A;  4DG1 A;  3O9S A;  2KFN A;  3SAF A;  4DFP A;  3O9R A;  4IXC A;  3LDS A;  1T3V A;  2O8D B;  2I7P A;  5AZJ A;  3VA0 A;  3TAN A;  1NWK A;  5KQ8 A;  4EAH D;  4B1U B;  4NXN K;  5HP1 A;  4JKH A;  4JHD A;  1XI1 A;  3HPG A;  2YNH A;  3D45 A;  3KTQ A;  3QET A;  4CD3 A;  3KHY A;  1G15 A;  4FVU A;  4OGE A;  1BA0 A;  4DTS A;  1NGI A;  4FSV A;  4PA1 A;  1XWL A;  4FLT A;  3SUN A;  3DXM A;  4IO9 L;  1QSY A;  3WNH A;  4KTQ A;  2Q2R A;  2NRZ A;  4NCA A;  2W6L A;  3H3N O;  4YNQ A;  3QFU A;  1FXX A;  1RT3 A;  4DS5 A;  3D2E A;  4I2P A;  3DLR A;  4CBU A;  2A40 A;  3SK3 A;  1WUA A;  4BDY A;  1EO1 A;  2KKZ A;  4B08 A;  1SUQ A;  4DV2 K;  4FWM A;  4B3S K;  4F9O A;  2P9K B;  1NJY A;  4LF6 K;  4M42 A;  3SUO A;  3K2P A;  1JLG A;  4UQG A;  3THY A;  5HLF A;  3NGY A;  3QEV A;  5C0Y A;  4ISG A;  4B3R K;  3JAM O;  4B9N A;  4K25 A;  1JXE A;  3L2V A;  2Z1J A;  4M63 C;  4WQ4 A;  1VQM N;  3K9K A;  1GOB A;  4KB0 A;  2Q0U A;  4BRO A;  5BPN A;  1VSI A;  1QZ6 A;  2G8V A;  3CXC M;  2A3Z A;  1NOZ A;  1VSD A;  1ZBL A;  1S3X A;  2VGM A;  3PUF A;  2O8F A;  4IEE A;  4H5V A;  3TU5 A;  1QE1 A;  3ZSQ A;  3K5O A;  4ZHR A;  3LPT A;  2UU9 K;  1QZ5 A;  2Q97 A;  3OY9 A;  3MCA B;  3KK3 A;  4E3S A;  3Q7B A;  4WQ5 C;  4BE1 A;  3OYL A;  2CH5 A;  4JN4 A;  1EXQ A;  5EU7 A;  1D9F A;  5AQZ A;  2ZF5 O;  3KIO A;  2NRV A;  4DUZ K;  4CGG A;  1Y64 A;  3PX4 A;  3L8B A;  5HL7 L;  3CCU N;  4HCB A;  3TSQ A;  1SL0 A;  2R7Y A;  1L3V A;  4KPY A;  4CER A;  3QES A;  4IDH A;  1VQ4 N;  3SJH A;  3H1V X;  3LM2 A;  1N8R O;  1ZBF A;  4FK2 A;  4W5N A;  3HST B;  2FSK A;  4FJ8 A;  3WEE A;  4Z4I A;  4NLC A;  3GL1 A;  4JS4 A;  1JCG A;  3KJV A;  5AQO A;  4LC9 B;  2E2Q A;  2BUP A;  2ZJQ L;  2YV0 X;  1DGK N;  1ZBH A;  4DTX A;  1Q8I A;  1KVB A;  5J2N A;  1ATN A;  3ZT2 A;  5GIP A;  3VGM A;  4GV6 A;  3J81 O;  1A5X A;  4H5N A;  5EY4 A;  1IBM K;  3VQ4 A;  3VQD A;  2OCE A;  2I5J A;  3J7Y P;  2D5R A;  4ZTJ A;  4CZJ A;  1UWB A;  3KD1 E;  5AQL A;  1HKB A;  3DLG A;  3IKM A;  4BDZ A;  4KHQ A;  3CME N;  3ZLJ A;  1GLF O;  2RKI A;  1RBV A;  1NGE A;  1D4X A;  1QQN A;  4A62 A;  4FYD A;  4I2Q A;  2HHH K;  3QNO A;  5ADX A;  3RVC A;  4DF4 A;  1NK0 A;  4FWR A;  3CD6 N;  3MXI A;  1BWF O;  2HOE A;  4IO8 A;  3VEX A;  1SKS A;  4BRQ A;  4FJ5 A;  2F96 A;  1KC8 O;  1V4S A;  5C42 A;  1T7P A;  4DQP A;  1TKX A;  1VK0 A;  2HBJ A;  2IAJ A;  4YDU A;  3GBT A;  4OPK A;  4E1M A;  1WSG A;  4CIE A;  1ITG A;  1NNE A;  1NMN A;  4FZX C;  4YOY A;  1N34 K;  4LFB K;  4JV5 K;  2QTD A;  3EEQ A;  4JKD A;  4XEI A;  1KAZ A;  3R9P A;  4BQZ A;  2DFH A;  3K59 A;  1I39 A;  4FW2 A;  2X74 A;  2BGG A;  1BIU A;  2F9T A;  1XHZ A;  2P9U B;  3IDH A;  3RSE B;  1SKR A;  4V19 S;  2A42 A;  2FBT A;  1RDA A;  1HNW K;  2O8D A;  4MQ3 A;  1U45 A;  1R0A A;  4NCB A;  2YHY A;  3O4W A;  3O4Q A;  3C7N B;  1QVG M;  4H8K A;  2DTU A;  3QO9 A;  1JXB A;  1KCF A;  3O9T A;  1HKG A;  3CJC A;  4M41 A;  4AHT A;  4KH6 A;  3IUC A;  4BRG A;  3NH0 A;  3DXM B;  3WNF A;  4IZ9 A;  4C8M A;  4AH9 A;  2QKK A;  4JI0 K;  2VWK A;  1QS4 A;  3MEE A;  5J2M A;  3OJS A;  3DOL A;  4JI6 K;  3T19 A;  2X78 A;  1RT7 A;  1V4T A;  1ATR A;  1L3T A;  1TV6 A;  1KVC A;  1RDW X;  4BR5 A;  5AQY A;  4AHV A;  2F9W A;  2UYT A;  3C95 A;  3CPE A;  3ZSZ A;  1WSE A;  4JK8 A;  4DFK A;  2W40 A;  3OS1 A;  1Q82 O;  3NFA A;  5T7B A;  5F1X A;  4J2E A;  4CZE A;  4B1Z A;  4B3O A;  3CCR N;  4E1N A;  3RTV A;  1OH5 A;  2V7Z A;  5FRN A;  3IFR A;  3THW B;  2OPQ A;  3FGU A;  2GEL A;  2GTD A;  2P9S B;  1Z26 A;  3OBY A;  3L0Q A;  1VSF A;  3A0I X;  3E1Y A;  4KHW A;  3NF8 A;  3FFK B;  3U4L A;  2HF3 A;  1KLN A;  3IG1 A;  4TSX A;  2FF6 A;  4NCG A;  4FW1 A;  3C6H A;  4GMJ B;  4M7Y A;  1QQC A;  1X9W A;  1D9D A;  3EO3 A;  4JKF A;  4BRF A;  1HJR A;  4GV9 A;  5E84 A;  1NU0 A;  3FFI A;  3UIQ A;  2GWJ A;  5EX5 A;  4N56 A;  1IKX A;  2ZM6 K;  1OH8 A;  4CJR A;  5JMV A;  4BR9 A;  3BDP A;  5AQS A;  1EKE A;  2NUB A;  3CJA A;  4WFB L;  4JLH A;  2HW3 A;  4JI3 K;  2WOM A;  1WOQ A;  4DR5 K;  1JL1 A;  1MU2 A;  4JI4 K;  2QKB A;  1Q9Y A;  4A2B A;  3LP3 A;  5KI6 A;  4Y0W A;  4CI6 A;  1N32 K;  1KVA A;  1S22 A;  2P9K A;  1NGG A;  1NKE A;  1C0M A;  3VEZ A;  3HOT A;  2E1Y A;  1SAZ A;  3DRR A;  4CJL A;  3HRG A;  3V81 A;  3VGK A;  2KHO A;  4WYB A;  1P90 A;  4CFD A;  4DV0 K;  5C12 A;  4PUO A;  5LMN K;  3WXK A;  1S5J A;  2QWP A;  4CEE A;  2ASM A;  2NRX A;  1WN7 A;  3J8A A;  3C0B A;  1VQN N;  3RRH A;  2XY5 A;  3AVM A;  2QWQ A;  4WQ5 A;  4RW4 A;  1MWM A;  3F2K A;  2ZQB A;  4BG8 A;  4I9L A;  1FKP A;  3UKR B;  2VG7 A;  3E01 A;  4HWI A;  3HVT A;  3KK2 A;  4ISE A;  1SZ2 A;  1Q7Y O;  5M1Q A;  3AVF A;  3QER A;  1HUX A;  3QIP A;  3LWL A;  1HRH A;  3ZYY X;  3MEG A;  4FZY A;  4KRE A;  3PO4 A;  3LM9 A;  2J4R A;  5I42 A;  1S1T A;  4JKB A;  3ID6 A;  3ZX2 A;  3QBX A;  1UAX A;  4H5R A;  3MWP A;  3ZET A;  3DRP A;  3QB0 A;  4BRH A;  1VQK N;  2ZGZ A;  4JK9 A;  4JD2 B;  4DCH A;  1T05 A;  1RBT A;  3P1G A;  1YUW A;  1BCM A;  4KHU A;  4LFA K;  3LL3 A;  4FLV A;  1BIS A;  1HX1 A;  2VG5 A;  3TAP A;  3MK6 A;  4DR2 K;  3FZF A;  4AF1 A;  4LH5 A;  4ELT A;  3UB5 A;  1S1W A;  4AIL C;  1WSJ A;  2HNZ A;  2NZT A;  3O08 A;  3SAG A;  4YOU A;  4OVL A;  3V1Q A;  4PKH A;  4Q0B A;  3F9M A;  3KLF A;  3VF4 A;  4QS9 A;  2NRH A;  1K9M O;  4RWT A;  1Y97 A;  4C8N A;  1MDU B;  4CEA A;  2IIR A;  1BQM A;  3HM8 A;  5M1P A;  3JSM A;  3BUZ B;  1S6P A;  4NO7 A;  3THX A;  4C8L A;  3MN5 A;  3GOI A;  1NOY A;  5F0X A;  2UXD K;  2KFZ A;  2F4V K;  3TR8 A;  5DK5 A;  2UXC K;  1Q18 A;  3QEP A;  2QK9 A;  5C24 A;  3EKU A;  3OBW A;  5C25 A;  3U9Z A;  1E4F T;  2FSJ A;  4J2A A;  1S9G A;  2E2P A;  5BN8 A;  3SQ4 A;  2PAV A;  3EL2 A;  3AVN A;  3ZSO A;  1RBU A;  4CVN E;  4E7K A;  1WSH A;  4JKE A;  4E7I A;  3KK1 A;  1NGD A;  2P9N A;  4AHR A;  3O9U A;  5AQR A;  4IFE A;  2LSN A;  4U7B A;  3TAR A;  1HMV A;  1ESV A;  1TK5 A;  3CJ1 A;  5FDL A;  3LP0 A;  4DQ8 A;  3NCI A;  3AAP A;  1SS6 A;  4DTN A;  1UA0 A;  2ZJR L;  2VQF K;  3LP2 A;  3MX5 A;  1BDG A;  4CGH A;  1TL1 A;  3KWG A;  2EWS A;  4FJG A;  2BE2 A;  3OYC A;  4EFH A;  4DFJ A;  1BO5 O;  5M1O A;  3VQQ A;  3UKR A;  2YJE A;  1XHX A;  2HST A;  2PFU A;  3CJ9 A;  5M1N A;  1T03 A;  1E3M A;  1VSK A;  3O80 A;  5LJW A;  5CHI A;  4MLE A;  3U3G A;  2DY4 A;  3TSP A;  3VPZ A;  4JRP A;  1XMO K;  5TKW A;  4FM0 A;  4DQS A;  1M1K O;  4KB1 A;  3N4Q A;  3ZX0 A;  2E2O A;  1UOC A;  2PY5 A;  3KKR A;  1VSJ A;  2OPS A;  1NK4 A;  4DQQ A;  4NYF A;  5C2F A;  2O4I A;  3ZSV A;  1HYZ A;  3A5L C;  1NKB A;  4CK3 A;  3PV8 A;  5GAE P;  1EX4 A;  1RTD A;  3JXU A;  3TTD A;  4WQ4 C;  4CZH A;  2E8A A;  1B9F A;  1B9D A;  3DYA A;  4EIA A;  3VQ8 A;  1RT5 A;  4LSN A;  4EZ6 A;  3HPO A;  4CZG A;  3FZH A;  3VQE A;  2X6N A;  5AQX A;  4JAX A;  2ASO A;  1HNZ K;  4R79 A;  4C1N I;  1Z05 A;  3TAB A;  4I6M A;  4CJ3 A;  3MEC A;  4YOW A;  3PIO L;  4GKJ K;  4C23 A;  4OKJ A;  4DQI A;  1JJ2 M;  1REV A;  4AQY K;  4FZZ A;  1BIZ A;  3O5B A;  4X65 K;  1NKC A;  1VQL N;  5AQW A;  1TUY A;  3ZT4 A;  1IJJ A;  3CM5 A;  4L8R B;  3I0R A;  1WAF A;  3A2F A;  1VSH A;  1JCE A;  2XY6 A;  1S1X A;  4DQR A;  5JVH L;  4IJN A;  2E4L A;  4FJ7 A;  4WFA L;  2QEX N;  2E6L A;  1DT9 A;  5AZI B;  4M3U A;  4CK1 A;  2GWK A;  2OPR A;  3QFP A;  4CHN A;  1IH7 A;  3DI6 A;  2D0C A;  2Q1N A;  3ENB A;  2XY7 A;  3M8S A;  5FPD A;  3BEX A;  4BRN A;  2P9P B;  3DMJ A;  5SWM A;  3D7E O;  1SQK A;  4LF5 K;  5AJ3 K;  1YVU A;  4DF8 A;  3HVR A;  1T6D A;  4FLZ A;  1IG8 A;  3D2F B;  3OA9 A;  1BUP A;  5C2D A;  3QEI A;  3EKS A;  1JLB A;  1HJO A;  4ILH A;  1GLE G;  4R5P A;  4O5F A;  4BR7 A;  1S6Q A;  4DTJ A;  1WNS A;  4IFY A;  2QW9 A;  4GV3 A;  1ZYQ A;  1WBD A;  1LWF A;  3SPZ A;  3FR0 A;  4BDP A;  5CR4 A;  4XH5 A;  2KTQ A;  5GIO A;  3SUQ A;  4CJP A;  1EET A;  4NLB A;  3GG4 A;  4H5T A;  2E20 A;  3F73 A;  3C6T A;  3QEW A;  3RRG A;  3H6E A;  3SMS A;  4OO1 J;  3LAN A;  3NMU A;  3LDN A;  1JLC A;  3L2R A;  4DR1 K;  4BY9 C;  4LF7 K;  5F2R A;  3C6A A;  2WBN A;  1TUU A;  4ID5 A;  4JKC A;  3CCS N;  3DWL A;  4JI5 K;  3QIC A;  4A61 A;  3RMD A;  5IT9 O;  1ZBU A;  4X64 K;  4FM1 A;  2E6M A;  4HCC A;  1TKZ A;  1TAQ A;  5ELZ A;  4A2A A;  3VET A;  1JKH A;  1L3U A;  4CJW A;  2QI2 A;  3QIN A;  3ISN C;  4CF2 A;  4OX9 K;  2PYL A;  3NAE A;  3AVI A;  3VER A;  4YDU C;  3SQ2 A;  2WUS A;  1XC9 A;  1NMD A;  2UUC K;  2HHV A;  1NGB A;  1IG9 A;  2P5G A;  3VOV A;  2A1S A;  3O6W A;  1SV5 A;  2IVO A;  5KGW A;  2RHK A;  4B1W B;  4K43 A;  3OYN A;  4N41 A;  1JCF A;  4YHH K;  2P1J A;  2CH6 A;  4CCH A;  1EP4 A;  1KFD A;  1N33 K;  2KZZ A;  3O3G A;  3CQY A;  2GX9 A;  1YJW N;  4Z4H A;  3KLG A;  4FLW A;  2NNW A;  2YHB A;  2HHQ A;  3OYD A;  2X6S A;  4O8U A;  1C0F A;  4DR6 K;  4I6M B;  3ALY A;  4CJV A;  4XIU A;  4JKA A;  2DPN A;  3O4N A;  1C1A A;  4DV6 K;  2HHW A;  1IKV A;  4ZTF A;  3I55 N;  4B9T A;  4OGC A;  3WXL A;  3M6G A;  3NGZ A;  1X3N A;  2F8T A;  1RCH A;  2VCP A;  1RT6 A;  3FZL A;  1ZBS A;  4QAG A;  5A2Q O;  4BC2 A;  1NK9 A;  3LDL A;  4CE9 A;  5BN9 A;  4DHY A;  3P39 A;  2OA8 A;  3BF1 A;  2ETJ A;  4BC4 A;  1X9M A;  2XY8 A;  3BZK A;  1GLD G;  5CE3 A;  4DSK A;  2OZS A;  4BRI A;  3BP8 A;  3ASM A;  2JGU A;  5AFU A;  5BR8 K;  4FJJ A;  4FXD A;  3M8P A;  4BRA A;  2KLA A;  1QQM A;  1I94 K;  3UKU A;  2VG6 A;  2FLO A;  3OW2 M;  1FJG K;  1IKW A;  4EHT A;  3RR7 A;  4MDB A;  3SV3 A;  1QTM A;  4FJN A;  1VQ7 N;  2RF2 A;  1NGH A;  2CGL A;  3GDQ A;  4B9M A;  4F3T A;  3N4P A;  4WCE L;  1UA1 A;  2V52 B;  1VSM A;  4B9V A;  3O3H A;  3S41 A;  3DXK A;  3AAQ A;  1RTI A;  1QHA A;  3LAL A;  4DR7 K;  4FJK A;  5HBM A;  3ZEU A;  3K9J A;  4CEF A;  2YKN A;  4PY5 A;  3DLB A;  1U2V A;  3VQB A;  3B8A X;  3S3N A;  1IBL K;  1HYS A;  4GW6 A;  4M7X A;  3DLE A;  3CI5 A;  3HPH A;  4BVP A;  2VGN A;  1E4G T;  4CES A;  1YAG A;  1KD1 O;  4NB4 A;  3CC7 N;  1XNR K;  2AA4 A;  5AQH A;  3U6F A;  4BRK A;  1U04 A;  4DSJ A;  3G25 A;  3E9P A;  1RTH A;  4X62 K;  4EHU A;  1TK8 A;  1HPM A;  3OYB A;  3NF7 A;  1D8Y A;  4QCL A;  4JNE A;  4CFC A;  4CZK A;  3FE1 A;  4I7F A;  3ZSY A;  4CJ4 A;  5JLH A;  5KRS A;  3QBW A;  3ULE B;  1YIT N;  3NF9 A;  1DLO A;  4OLB A;  1C6V A;  2HVI A;  4KHY A;  3TPQ A;  1K8K A;  1RDB A;  3L3U A;  4O4G A;  3ZCM A;  2O4G A;  3SZ2 A;  3NE6 A;  4M3R A;  5FPN A;  1RNH A;  1OKJ A;  3ULD A;  2NRR A;  1YTA A;  3R8E A;  1KSP A;  1YI2 N;  4DSL A;  1W97 L;  1XNQ K;  3PSI A;  3CF5 L;  4FWO A;  3TTF A;  3WQU A;  2IVP A;  5FRM A;  4CGJ A;  3OTO K;  3QIO A;  1KQS M;  4FWS A;  4E7L A;  4E89 A;  1N5Y A;  5FPM A;  3QNN A;  2HND A;  2IC3 A;  3D2E B;  4RW6 A;  1KAX A;  4FLU A;  1EWR A;  2B6A A;  2UXB K;  1VQ9 N;  4KTW A;  1DEJ A;  3VF6 A;  3OYM A;  4BRM A;  3KD5 E;  1BG3 A;  2ZE2 A;  1YJ9 N;  4JK7 A;  1ASW A;  4UY8 O;  3NVM A;  1X3M A;  1I3A A;  1RDC A;  1U4B A;  4KHP K;  2HBL A;  2OPP A;  2P9I A;  5C15 A;  4E19 A;  2QWR A;  4DV5 K;  1HNV A;  3RMC A;  1OH6 A;  3HYF A;  2G8F A;  4CEB A;  1LW0 A;  1XC3 A;  5JS2 A;  4LF9 K;  4JEP A;  3F9K A;  3W3D A;  4DUY K;  5M1F A;  4BRP A;  5AZJ B;  4B9Q A;  2D0B A;  3ENH A;  3V1O A;  3PX0 A;  1GLL O;  5BRF A;  4A5B A;  1YXQ A;  4B8C A;  3TSU A;  2O8B B;  1TL3 A;  2JWL A;  4KH4 A;  3C65 A;  2QA4 N;  1Q81 O;  4CEO A;  3P4I A;  4DTM A;  2JWK A;  3V9X A;  1C0G A;  2P9I B;  4AHS A;  3G71 N;  3SJJ A;  4JI7 K;  4W5O A;  1TYQ A;  3SUP A;  4NYN A;  1B92 A;  5HOO A;  1QQO A;  3VQ9 A;  3CMA N;  3SV4 A;  1YT3 A;  4G1Q A;  2IOC A;  3M8Q A;  3VTH A;  3OJU A;  4PKI A;  4GVM A;  2H3G X;  4JRQ A;  4O0J A;  3CJB A;  3AA2 A;  3KZB A;  1DTQ A;  3DLL L;  5DM7 L;  3DM2 A;  3I8B A;  4KI4 A;  3AO4 A;  1NK8 A;  3VA3 A;  4F8R A;  3J7A P;  2GUP A;  3HL8 A;  5HRS A;  4YOR A;  4ILJ A;  1J54 A;  4ILG B;  4YOX A;  5J2P A;  3E9L A;  3DLH A;  2EHG A;  5E26 A;  3CC2 N;  1EQY A;  1Q9X A;  4DR3 K;  3D0P A;  3W0L A;  4CBX A;  5AQI A;  3ZSR A;  1IO2 A;  2F7T A;  1W2B M;  3AVG A;  4E7H A;  1KTQ A;  3AGR A;  1BL3 A;  4B9S A;  2YNF A;  5CZ1 A;  5AQT A;  2YNG A;  3K57 A;  4O55 A;  1TAU A;  4OPA A;  1X9J A;  1IKY A;  1NGA A;  4DV1 K;  1TK0 A;  1ASV A;  4W5T A;  3V1R A;  4BR0 A;  1W9H A;  5GAD P;  3TAQ A;  1J5O A;  3G4S N;  4PWD A;  3MXJ A;  1O1W A;  1RFQ A;  3TAG A;  1GOC A;  1J9A A;  4F2R A;  4O44 A;  4BRD A;  3ZT0 A;  5KPR A;  2OTJ N;  1YHQ N;  3J7Z O;  1HYV A;  4FOI A;  3VTI A;  1VAZ A;  3AVA A;  2D0O A;  5DM6 L;  2A6A A;  4I9Q A;  3ITH A;  1A5W A;  1BCO A;  3K5L A;  4N47 A;  4LF4 K;  3NH1 A;  3BF3 A;  3AA4 A;  2HVH A;  2CGJ A;  1HPZ A;  4IBN A;  1IBK K;  2GEM A;  3LDO A;  2G8K A;  3HXM A;  1NK6 A;  1L3S A;  1A5V A;  2O8E A;  4QOZ B;  3PY8 A;  4LFC K;  3RWU A;  4M3Y A;  4BGA A;  1YVN A;  3NH2 A;  2BTF A;  3S3M A;  4DTR A;  3C6U A;  3ZX3 A;  4DFM A;  2WON A;  4H4M A;  4CJE A;  4M45 A;  3E66 A;  4H5W A;  1FW6 A;  2KW4 A;  1GLC G;  4FLX A;  3I0S A;  4CHP A;  1KAY A;  4JI8 K;  1R59 O;  4CZI A;  3PO5 A;  4BAC A;  5JVG L;  4BE2 A;  3ENO A;  1TKT A;  1YIJ N;  3CCM N;  3L6Q A;  1TYQ B;  4Y1D A;  3VQC A;  2Z1G A;  1CZA N;  5AQQ A;  4U67 L;  2YNI A;  4Y1C A;  4DU1 A;  1VRU A;  3G0Z A;  4AM6 A;  3C7N A;  1BGX T;  4DLG A;  1BA1 A;  1XQS C;  3L2U A;  3V9U A;  2RPI A;  4FOE A;  4FWL A;  5KPT A;  5AR0 A;  4XH1 A;  1CZ9 A;  1VQ6 N;  4XH4 A;  5AQP A;  4O8K A;  2Z1H A;  4LD0 A;  2E88 A;  3FZK A;  1HLU A;  2Y1J A;  1W7A A;  2YCH A;  3O8M A;  1O13 A;  1J5E K;  4PL7 A;  1K8K B;  3O3F A;  4HUG A;  5GAG P;  4DSF A;  3L2Q A;  3AVJ A;  4OJR A;  4B1Y B;  2HHT A;  3SPY A;  2Q31 A;  5TKY A;  3H08 A;  1S9E A;  1RTJ A;  3WNG A;  3OYE A;  2JLE A;  3V9Z A;  3AVH A;  3CJ7 A;  1SKW A;  5KGX A;  1BOT O;  2HMP A;  1T6C A;  3K0S A;  3I33 A;  4CF8 A;  4CEZ A;  3U3Y A;  2B5J A;  3CPW M;  3WT0 A;  1NBW A;  2YX6 A;  5AQF A;  1HKC A;  2HB5 A;  3VQ7 A;  4PHT X;  3HM9 A;  1Q86 O;  1RT2 A;  4K41 A;  4CGD A;  5BRD A;  3CQ8 A;  1WAJ A;  3M8R A;  1RDU A;  1F21 A;  1U49 A;  4F4K A;  2D0A A;  3FZM A;  4FLY A;  3ULE A;  1TKD A;  2P9L B;  1BI4 B;  3NGI A;  3KVG A;  3HP6 A;  5I3U A;  3QLH A;  4KV8 A;  5J2Q A;  4JS5 A;  4HTL A;  2E1Z A;  4KKO A;  4WF9 L;  4M3T A;  4HUE A;  3NHG A;  3LWM A;  4E7J A;  3THV A;  4DV4 K;  1QVF M;  3K5M A;  3L4Q A;  1S1V A;  4FO0 A;  3WEE B;  5FRO A;  4HUF A;  1QSS A;  1BHL A;  4M3Z A;  3VEO A;  3DRS A;  4HHT A;  1NJX A;  3SBG A;  3THW A;  1QSL A;  4J2B A;  3WUH A;  2WTU A;  2FSN A;  2P5O A;  5C10 A;  4CEQ A;  5KPZ A;  3TWH A;  5SZT A;  1U2V B;  4GVE A;  1RT1 A;  4H0O A;  4DTP A;  3SQ0 A;  1MWK A;  4Z0U A;  1HNX K;  3PLA A;  1N36 K;  3CYM A;  4ELV A;  4PKG A;  3PIP L;  5AQK A;  3CET A;  3CCQ N;  5HRR A;  4KHN A;  2BAN A;  3BZC A;  3OVN A;  2HBK A;  3ATU A;  4C1N K;  1DTT A;  2ZJP L;  1ZC6 A;  3P38 A;  3A5O C;  4BE0 A;  2PBD A;  3EE8 A;  3T1H K;  1NGF A;  3IRX A;  4OLA A;  3VQ5 A;  1MA9 B;  2V51 B;  4OPH A;  3AAR A;  3SAH A;  3UKU B;  1SL2 A;  5AZI A;  4B1V A;  2O8F B;  4H0V B;  2ITG A;  1GLA G;  1LWC A;  3MED A;  3H45 C;  4M3W A;  4CFA A;  3SYZ A;  4A5A A;  5JS1 A;  3Q7C A;  3LP1 A;  4J8F A;  3AVB A;  5KQD A;  4CHZ A;  5CY4 A;  3SI6 A;  1T8E A;  1VQ8 N;  1M90 O;  1J53 A;  5FPE A;  3CC4 N;  4JI2 K;  5LL6 Z;  3CFR A;  2P9U A;  3A8Y A;  4Z94 A;  3V9W A;  4DR4 K;  3VEY A;  4W5Q A;  1FK9 A;  4FJH A;  4K42 A;  3AO1 A;  3AO2 A;  2G8W A;  3HBT A;  3PX6 A;  1CXQ A;  2KQ2 A;  2OAN A;  4GY2 B;  2ITM A;  2ZWH A;  1RIL A;  4CJU A;  2DFE A;  5JLF A;  2E2N A;  1KXP A;  5LY3 A;  2XRI A;  4E0D A;  3JS6 A;  4Z4G A;  3DAW A;  4B9U A;  1KLM A;  4IG0 A;  2BDP A;  5B8H A;  2A5X A;  3R6M A;  3AGK A;  3IAY A;  4RG8 A;  4CHO A;  1J6Z A;  2FXU A;  2HNY A;  5J1E A;  3TAE A;  4DSE A;  2D1K A;  3VEV A;  3VF2 A;  3OYK A;  1YJN N;  3H1Q A;  3OYI A;  2QWO A;  3BY5 A;  1NK7 A;  3OS0 A;  3VQA A;  2V7Y A;  1VHX A;  2AJQ A;  5I9E B;  3VEW A;  2VQE K;  4CZM A;  2O8C A;  1NG9 A;  4JHD B;  4WFN L;  2W42 A;  1FKO A;  5E41 A;  3SBT A;  2NRW A;  4CJS A;  2HBM A;  3MN7 A;  1RDD A;  3EN9 A;  3IS9 A;  1W0H A;  2PZS A;  2HHS A;  1GLJ O;  2IS3 A;  2QWM A;  3ZEU B;  4CJ5 A;  5BPM A;  4FJI A;  5JIC A;  3CHW A;  3WXJ A;  4CGI A;  3RR8 A;  1NLV A;  3TI0 A;  2RN2 A;  5HRN A;  1TVR A;  3AO5 A;  2FC0 A;  2OTL N;  3DXK B;  2B4J A;  3ZSW A;  4QS7 A;  4FM2 A;  4BC3 A;  4LSL A;  3KLE A;  5AQV A;  4CJF A;  3D6R A;  3CFO A;  2P9N B;  3VQ6 A;  4M3X A;  4DTU A;  3CFP A;  3NDK A;  1N6Q A;  3GE1 A;  2A1R A;  4IEI A;  2P51 A;  4RCH A;  5HRO A;  2PYJ A;  4CJQ A;  5AQN A;  4BRE A;  1C0T A;  1QHT A;  2O8C B;  4ICL A;  1NJW A;  3EE9 A;  3HSC A;  3AVL A;  4FWQ A;  1BU6 O;  1GOA A;  4X66 K;  1NJI O;  4AM7 A;  3B6P A;  1Z6R A;  4DTO A;  3MCP A;  4LH4 A;  4CEC A;  3DJC A;  3PSF A;  2G8H A;  4BWJ A;  3DLK A;  4BR4 A;  4EP4 A;  2EX3 A;  2AP1 A;  4RW9 A;  5GAH P;  3HI0 A;  4Q5V A;  1HQE A;  4CZF A;  2DFF A;  1C1B A;  3VES A;  5CZ2 A;  4J2D A;  2FF3 B;  3KKS A;  4LF8 K;  4O0I A;  1NJZ A;  3HP9 A;  1U48 A;  4YOT A;  3H46 O;  4CHQ A;  3VEN A;  2CGK A;  5GIN A;  1G99 A;  3EZW A;  4FK4 A;  2QWL A;  5AFU H;  1LV5 A;  2F8S A;  1KFS A;  4F3O A;  3SMP A;  4H0P A;  3CG7 A;  3QDK A;  5ADX H;  4HTU A;  2ASP A;  3U9D A;  3JYT A;  5FLX O;  4CFB A;  2UUB K;  4IKF A;  4G9Z A;  4EZ9 A;  4K8Z A;  1D5A A;  4JD2 A;  3MN9 A;  4KHS A;  4CF9 A;  3P31 A;  3K5N A;  4CBW A;  3HK2 A;  3LDQ A;  3A5N C;  3THY B;  2ZD1 A;  1OVY A;  3ZET B;  3HOS A;  4IJA A;  4BRL A;  1KRP A;  4YOV A;  2XHB A;  3L3V A;  3M1F A;  4CF0 A;  3VGL A;  3T1A A;  2XO7 A;  3S3O A;  3HTV A;  2FBX A;  3MMV A;  1ZXO A;  5LMU K;  3L4I A;  3OYF A;  2D4W A;  3OYG A;  3LAM A;  4A59 A;  3KLI A;  5BPL A;  2Q3S A;  4FJX A;  4MO5 A;  1NK5 A;  5MLC Q;  1LAW A;  4KBO A;  2ATQ A;  1S72 N;  2HF4 A;  1RT4 A;  1U47 A;  3ATV A;  4F2S A;  4EP5 A;  5KTQ A;  3L2W A;  4L3Q A;  5M1K A;  5D3G A;  4KI6 A;  2G8U A;  2VWB A;  1NGJ A;  1S1U A;  2ZGY A;  4FK0 A;  3O9Q A;  1JLF A;  2HHX A;  3G6E N;  4WE1 A;  2UUA K;  4ELU A;  4B3M K;  1WSI A;  3WXI A;  2WFB A;  3NVK A;  2QWN A;  2YHW A;  2Q0R A;  3UE5 A;  3WNE A;  3EZ5 A;  4FWP A;  5HRP A;  2E5L K;  3NBP A;  5K14 A;  3LZI A;  1RGI A;  2W6K A;  2YJF A;  4FVM A;  4LY7 A;  3WXM B;  2Y1I A;  4RTF D;  3VMF B;  2Z1I A;  3D2F A;  2GV9 A;  4DU3 A;  4IWV A;  3MWT A;  1DKG D;  1BI4 A;  4C8O A;  1LCU A;  4RW7 A;  4DLE A;  2P9L A;  3K58 A;  3QML A;  3R3L A;  2P9P A;  3HZ6 A;  4JI1 K;  1CXU A;  4CED A;  4KRF A;  5AQU A;  4N5S A;  3MX2 A;  1WSF A;  3U8X A;  5BRE A;  3HO1 A;  1LWE A;  1YF5 L;  1Z25 A;  1CZB A;  3T69 A;  5CYQ A;  4DMN A;  1NGC A;  3CCE N;  4DWI A;  3CCV N;  4BWM A;  3F5T A;  4JYA K;  4BC5 A;  3OYJ A;  1NM1 A;  3ID8 A;  4CJT A;  3TTC A;  3P83 D;  4MO4 A;  1C0U A;  1ILY A;  4FJM A;  2IGI A;  3CER A;  1RBR A;  5IWA K;  1LOT B;  4KH5 A;  4FJL A;  5BR9 A;  4RW8 A;  3S9H A;  2D0P A;  4JKG B;  4CIG A;  4W5R A;  1HQU A;  2YHX A;  3ZSX A;  4AHU A;  4N76 A;  4E1J A;  4KAZ A;  4CZL A;  3QEX A;  4AHC A;  2Q36 A;  1VSL A;  1K6Y A;  4HVJ A;  3V6D A;  3TAF A;  1U6Z A;  1OVQ A;  3J80 O;  4B3T K;  3H3O B;  2HMI A;  4CW7 B;  2O8B A;  3A5M C;  1WLJ A;  1VQO N;  3OYA A;  4MDA A;  4IOX A;  3IMX A;  4FCY A;  3E9O A;  4DS4 A;  3HJF A;  2QXF A;  4IG3 A;  3AV9 A;  3T3F A;  3LDP A;  3CQX A;  1H1V A;  4MLH A;  3ZT3 A;  3P5J A;  3HT3 A;  2OYQ A;  3CIP A;  4PQU A;  4ISF A;  3OHR A;  5AQG A;  3VQP A;  3KLH A;  3SCX A;  4DV3 K;  3T1Y K;  4FJ9 A;  1L5U A;  5EOY A;  4ID1 A;  4DSI A;  3I8D A;  4H0T B;  1HR0 K;  1P8Z A;  1RBS A;  5BRH A;  4CGF A;  1T44 A;  4KO0 A;  3CM6 A;  1BQN A;  3M5R A;  3KWI A;  3WQT A;  4BRC A;  4QS8 A;  3AA3 A;  1ATS A;  4B8A B;  1JLE A;  4BVO A;  4BQL A;  4FL9 A;  1JLA A;  4BG9 A;  5AQM A;  5CYM A;  4MFB A;  4KFB A;  2NLX A;  4CIF A;  3AY9 A;  4H0Y B;  5KRT A;  2GUI A;  2RE2 A;  4Z4E A;  4H0X B;  3OYH A;  3RSE A;  2VWJ A;  4DB3 A;  1HNI A;  4YFU A;  2QM1 A;  3O1B A;  1VSE A;  2YHA A;  4KTZ A;  4O5B A;  2I7N A;  1WBB A;  4CJK A;  4OPJ A;  1OH7 A;  2O8E B;  1X9S A;  2HHU A;  4BGB A;  1JL2 A;  3CCJ N;  4K8X A;  1GLB G;  3FLC O;  3VN5 A;  4IFV A;  3LZJ A;  1ZBI A;  1YTU A;  3G10 A;  1SL1 A;  3NF6 A;  3ZT1 A;  3SNN A;  3C94 A;  3V4I A;  3SQ1 A;  2QXL A;  2YKM A;  3MN6 A;  1X1P A;  4DKW A;  4CD1 A;  1XUP O;  4PL8 A;  2GBZ A;  4DU4 A;  5EXW A;  1VQ5 N;  4CF1 A;  4B9L A;  4OKE A;  3OS2 A;  2A41 A;  4FPA A;  3THX B;  5LJV A;  3EYZ A;  4H03 B;  3AA5 X;  4JKG A;  2IDO A;  3O1W A;  1VQP N;  3T7Z A;  4CJ7 A;  3M3Z A;  3LAK A;  1WB9 A;  3B6O A;  3RMA A;  4K0K K;  2P9S A;  2W41 A;  3I56 N;  4CK2 A;  3V9S A;  2YI1 A;  4IOC L;  1EWQ A;  1JLQ A;  3AVC A;  3BGR A;  1IV0 A;  4GNI A;  5DMR A;  4Z4F A;  4H4O A;  4GKK K;  2FBY A;  3R1X A;  3AO3 A;  4FPB A;  3KK7 A;  2FBV A;  2G8I A;  4IDK A;  4BR2 A;  4CHY A;  2VYP A;  2BH1 A;  1VRT A;  2IVN A;  1TGO A;  3SLC A;  2WC9 A;  2KZM A;  4FWN A;  3DOK A;  4IOA L;  1LAV A;  3AVK A;  3MDQ A;  3TAM A;  4B1X B;  3CCL N;  2OZM A;  3RMB A;  1ASU A;  5EVZ A; 
#chains in the Genus database with same CATH homology
 4RG8 A;  4CHO A;  2HMI A;  2HNY A;  4OKK A;  3NF9 A;  3EY1 A;  5J1E A;  3MXM A;  3TAE A;  3DRP A;  1DLO A;  4DSE A;  4C8K A;  3OYK A;  3LPU A;  1C6V A;  3MAQ A;  4OLB A;  2HVI A;  3OYI A;  4KHY A;  1CLQ A;  1RDB A;  3L3U A;  1NK7 A;  4O4G A;  1LW2 A;  3OS0 A;  3ZCM A;  2O4G A;  3SZ2 A;  4Z4C A;  1C1C A;  4DG1 A;  4M3R A;  3VQA A;  3NE6 A;  2KFN A;  1RNH A;  4DFP A;  1T05 A;  1RBT A;  3P1G A;  3LDS A;  3ULD A;  2AJQ A;  1YTA A;  3VA0 A;  1BCM A;  4KHU A;  3TAN A;  1KSP A;  2W42 A;  4FLV A;  1FKO A;  1BIS A;  4DSL A;  2VG5 A;  5E41 A;  5HP1 A;  3TAP A;  1XI1 A;  3HPG A;  4CJS A;  2YNH A;  3D45 A;  4LH5 A;  3KTQ A;  5FRM A;  3QET A;  1RDD A;  4ELT A;  3IS9 A;  4CGJ A;  1W0H A;  3QIO A;  1S1W A;  4AIL C;  1WSJ A;  4E7L A;  1G15 A;  2PZS A;  4OGE A;  4E89 A;  1N5Y A;  2HNZ A;  2HHS A;  2IS3 A;  4CJ5 A;  4DTS A;  4PA1 A;  4OVL A;  3V1Q A;  4FJI A;  3QNN A;  1XWL A;  2HND A;  2IC3 A;  4CGI A;  4FLT A;  3KLF A;  3SUN A;  4Q0B A;  3RR8 A;  1QSY A;  4RW6 A;  3WNH A;  1Y97 A;  4C8N A;  3TI0 A;  4FLU A;  2RN2 A;  5HRN A;  4CEA A;  4KTQ A;  1TVR A;  1BQM A;  2B6A A;  3AO5 A;  2FC0 A;  4NCA A;  4KTW A;  2B4J A;  4YNQ A;  1FXX A;  1RT3 A;  3ZSW A;  4DS5 A;  3OYM A;  3JSM A;  3KD5 E;  1S6P A;  2ZE2 A;  3DLR A;  4I2P A;  4FM2 A;  1ASW A;  4LSL A;  4C8L A;  3KLE A;  1I3A A;  1RDC A;  4CJF A;  1U4B A;  3CFO A;  4BDY A;  2OPP A;  4B08 A;  1NOY A;  1SUQ A;  4E19 A;  3VQ6 A;  3RMC A;  1HNV A;  4DTU A;  4M3X A;  2KFZ A;  3HYF A;  3TR8 A;  3NDK A;  3CFP A;  1N6Q A;  2A1R A;  2G8F A;  5DK5 A;  4CEB A;  1LW0 A;  2P51 A;  1NJY A;  4M42 A;  5HRO A;  3SUO A;  3QEP A;  3K2P A;  1JLG A;  5JS2 A;  4UQG A;  5C24 A;  5HLF A;  2PYJ A;  4CJQ A;  2QK9 A;  3NGY A;  5C25 A;  1C0T A;  3QEV A;  1QHT A;  3F9K A;  4ICL A;  1NJW A;  4B9N A;  4J2A A;  1S9G A;  3AVL A;  1JXE A;  2D0B A;  3L2V A;  2Z1J A;  3V1O A;  3PX0 A;  1GOA A;  3SQ4 A;  3ZSO A;  3AVN A;  4B8C A;  1RBU A;  1TL3 A;  3B6P A;  1GOB A;  4KB0 A;  4E7K A;  1WSH A;  4DTO A;  4LH4 A;  4CEC A;  4CEO A;  1VSI A;  4E7I A;  4DTM A;  2G8V A;  3V9X A;  2G8H A;  4BWJ A;  3KK1 A;  3DLK A;  4AHR A;  4EP4 A;  4AHS A;  3SJJ A;  1NOZ A;  2EX3 A;  1T8E A;  2LSN A;  4RW9 A;  1VSD A;  1ZBL A;  3TAR A;  3PUF A;  4W5O A;  4Q5V A;  1HMV A;  1HQE A;  4NYN A;  1B92 A;  3SUP A;  3ZSQ A;  1QE1 A;  1TK5 A;  3VQ9 A;  3K5O A;  4ZHR A;  3SV4 A;  1YT3 A;  2DFF A;  1C1B A;  3LPT A;  4G1Q A;  5FDL A;  3LP0 A;  5CZ2 A;  2IOC A;  3NCI A;  4J2D A;  3KKS A;  4Z4F A;  3M8Q A;  3OJU A;  4FJG A;  4O0I A;  1NJZ A;  4GVM A;  3HP9 A;  4DTN A;  1U48 A;  4JRQ A;  1UA0 A;  3OY9 A;  4O0J A;  2HHX A;  3AA2 A;  3LP2 A;  4CHQ A;  3KK3 A;  4E3S A;  4BE1 A;  1DTQ A;  4CGH A;  3OYL A;  1TL1 A;  3DM2 A;  1EXQ A;  2BE2 A;  5EU7 A;  3AO4 A;  3OYC A;  3VA3 A;  4DFJ A;  1NK8 A;  1D9F A;  4F8R A;  3HL8 A;  3VQQ A;  5HRS A;  3KIO A;  1J54 A;  1XHX A;  4FK4 A;  1LV5 A;  2F8S A;  4CGG A;  5J2P A;  1T03 A;  1KFS A;  1VSK A;  3PX4 A;  3DLH A;  4F3O A;  2EHG A;  3CG7 A;  3U3G A;  4HTU A;  3L8B A;  2DY4 A;  1Q9X A;  3JYT A;  4CFB A;  3D0P A;  4JRP A;  4IKF A;  4EZ9 A;  4FM0 A;  4DQS A;  4HCB A;  4K8Z A;  1D5A A;  3ZSR A;  4KB1 A;  1IO2 A;  1SL0 A;  2R7Y A;  3AVG A;  1L3V A;  4E7H A;  4KPY A;  4CER A;  1KTQ A;  4KHS A;  3QES A;  1BL3 A;  4CF9 A;  4B9S A;  1UOC A;  2YNF A;  5CZ1 A;  2PY5 A;  2YNG A;  3K5N A;  3KKR A;  1VSJ A;  2OPS A;  4O55 A;  3K57 A;  1NK4 A;  3HK2 A;  4DQQ A;  1TAU A;  4NYF A;  1IKY A;  1TK0 A;  2O4I A;  1ASV A;  1ZBF A;  2ZD1 A;  3ZSV A;  4W5T A;  3V1R A;  1HYZ A;  1W9H A;  1J5O A;  3TAQ A;  4PWD A;  1NKB A;  4FK2 A;  4CK3 A;  3MXJ A;  1O1W A;  3HST B;  1EX4 A;  3PV8 A;  1KRP A;  1RTD A;  4W5N A;  2XHB A;  3L3V A;  3TAG A;  4CF0 A;  1GOC A;  1J9A A;  3T1A A;  4FJ8 A;  4F2R A;  4O44 A;  2XO7 A;  3S3O A;  4JS4 A;  4Z4I A;  2FBX A;  3KJV A;  3ZT0 A;  1B9F A;  1B9D A;  3DYA A;  3OYF A;  3VQ8 A;  1RT5 A;  3OYG A;  3LAM A;  2YV0 X;  1HYV A;  3KLI A;  1ZBH A;  4LSN A;  4DTX A;  1Q8I A;  3AVA A;  2Q3S A;  4EZ6 A;  1KVB A;  3HPO A;  5J2N A;  4I9Q A;  4FJX A;  3ZT2 A;  3ITH A;  1A5W A;  3VQE A;  2X6N A;  1BCO A;  3K5L A;  1LAW A;  1NK5 A;  1A5X A;  2ATQ A;  4N47 A;  3NH1 A;  1RT4 A;  3AA4 A;  3VQ4 A;  1U47 A;  3VQD A;  2HVH A;  3TAB A;  4F2S A;  1HPZ A;  4CJ3 A;  4EP5 A;  3MEC A;  5KTQ A;  2I5J A;  4IBN A;  3L2W A;  4OKJ A;  2D5R A;  4DQI A;  5D3G A;  4ZTJ A;  1REV A;  2G8K A;  3HXM A;  4KI6 A;  4FZZ A;  1NK6 A;  1BIZ A;  1L3S A;  1UWB A;  2G8U A;  3KD1 E;  1A5V A;  1NKC A;  4QOZ B;  3DLG A;  4BDZ A;  4KHQ A;  3PY8 A;  3ZT4 A;  3RWU A;  1S1U A;  2RKI A;  4M3Y A;  1RBV A;  4FK0 A;  3CM5 A;  1JLF A;  3NH2 A;  3I0R A;  3S3M A;  4L8R B;  1WAF A;  4I2Q A;  4DTR A;  3A2F A;  4FYD A;  4WE1 A;  4ELU A;  1VSH A;  3C6U A;  1WSI A;  3QNO A;  2XY6 A;  4DFM A;  2WON A;  1S1X A;  4DF4 A;  4H4M A;  4CJE A;  4DQR A;  2E4L A;  1NK0 A;  4M45 A;  4FJ7 A;  3EZ5 A;  3WNE A;  3MXI A;  2E6L A;  2KW4 A;  5HRP A;  4M3U A;  4CK1 A;  3NBP A;  5K14 A;  4FLX A;  2OPR A;  4CHN A;  3LZI A;  3I0S A;  1SKS A;  4FJ5 A;  1IH7 A;  2F96 A;  4FVM A;  3DI6 A;  2D0C A;  4LY7 A;  2Y1I A;  5C42 A;  4CHP A;  1T7P A;  2XY7 A;  3M8S A;  2Z1I A;  1TKX A;  4DQP A;  3PO5 A;  4BAC A;  1VK0 A;  2GV9 A;  2IAJ A;  4BE2 A;  3DMJ A;  4DU3 A;  5SWM A;  1TKT A;  1BI4 A;  4C8O A;  4RW7 A;  4OPK A;  4DLE A;  4Y1D A;  4E1M A;  1WSG A;  1YVU A;  4DF8 A;  3K58 A;  4CIE A;  1ITG A;  2Z1G A;  3VQC A;  3HVR A;  4FLZ A;  4FZX C;  2YNI A;  4Y1C A;  3QEI A;  4DU1 A;  1CXU A;  1JLB A;  1VRU A;  4CED A;  4KRF A;  3G0Z A;  4R5P A;  4KI4 A;  1S6Q A;  1BGX T;  4N5S A;  4DLG A;  4DTJ A;  1WSF A;  1WNS A;  4IFY A;  2DFH A;  3K59 A;  3HO1 A;  3L2U A;  1I39 A;  4FW2 A;  3V9U A;  1LWE A;  2X74 A;  2RPI A;  1ZYQ A;  1LWF A;  1Z25 A;  3SPZ A;  2BGG A;  1BIU A;  4BDP A;  1CZB A;  1CZ9 A;  1XHZ A;  2KTQ A;  1SKR A;  5CYQ A;  2FBT A;  2Z1H A;  1RDA A;  4LD0 A;  3SUQ A;  4DMN A;  4CJP A;  4DWI A;  1EET A;  4BWM A;  4MQ3 A;  1U45 A;  3F73 A;  3C6T A;  3QEW A;  2Y1J A;  3RRG A;  3OYJ A;  4CJT A;  1R0A A;  4NCB A;  3P83 D;  1C0U A;  3LAN A;  2DTU A;  3O4Q A;  1JLC A;  3L2R A;  4H8K A;  3QO9 A;  3O3F A;  4FJM A;  2IGI A;  1JXB A;  1KCF A;  1RBR A;  4HUG A;  4FJL A;  4RW8 A;  4DSF A;  4ID5 A;  3L2Q A;  3AVJ A;  4OJR A;  3S9H A;  4M41 A;  2HHT A;  4CIG A;  3SPY A;  4AHT A;  4F4K A;  4W5R A;  1HQU A;  3ZSX A;  3RMD A;  3NH0 A;  3H08 A;  3WNF A;  1S9E A;  1ZBU A;  4AHU A;  4N76 A;  1RTJ A;  4C8M A;  3WNG A;  2E6M A;  4AH9 A;  4FM1 A;  3QEX A;  2QKK A;  4HCC A;  4KAZ A;  4AHC A;  2JLE A;  3OYE A;  3AVH A;  1VSL A;  1K6Y A;  3V9Z A;  1TKZ A;  1TAQ A;  1SKW A;  4HVJ A;  2VWK A;  3V6D A;  3TAF A;  5KGX A;  1QS4 A;  1JKH A;  1L3U A;  4CJW A;  3MEE A;  5J2M A;  3OJS A;  3DOL A;  3QIN A;  2X78 A;  3ISN C;  1RT7 A;  3T19 A;  4CF8 A;  4CEZ A;  4CF2 A;  3NAE A;  2B5J A;  3U3Y A;  2PYL A;  3AVI A;  1L3T A;  1TV6 A;  1WLJ A;  3SQ2 A;  1KVC A;  1XC9 A;  3OYA A;  2HHV A;  4AHV A;  1IG9 A;  2HB5 A;  3C95 A;  3VQ7 A;  3ZSZ A;  3HM9 A;  2P5G A;  2A1S A;  1RT2 A;  1SV5 A;  1WSE A;  5KGW A;  4FCY A;  4CGD A;  4DFK A;  4DS4 A;  3OYN A;  4N41 A;  3HJF A;  3CQ8 A;  2QXF A;  1WAJ A;  2P1J A;  3M8R A;  4IG3 A;  3OS1 A;  3AV9 A;  3T3F A;  4CCH A;  3NFA A;  1EP4 A;  1F21 A;  3ZT3 A;  3P5J A;  5T7B A;  1KFD A;  3HT3 A;  4J2E A;  2OYQ A;  4B3O A;  3O3G A;  4PQU A;  2KZZ A;  3VQP A;  4Z4H A;  1U49 A;  4E1N A;  3KLG A;  3KLH A;  2D0A A;  3RTV A;  4FLW A;  4FLY A;  2YHB A;  3SCX A;  4FJ9 A;  1L5U A;  5FRN A;  2HHQ A;  2OPQ A;  4ID1 A;  3OYD A;  1TKD A;  4DSI A;  2X6S A;  3I8D A;  1Z26 A;  3ALY A;  4CJV A;  1RBS A;  1BI4 B;  1VSF A;  4XIU A;  4CGF A;  3NGI A;  4KHW A;  3NF8 A;  3HP6 A;  5I3U A;  3QLH A;  4KO0 A;  3O4N A;  4KV8 A;  4JS5 A;  5J2Q A;  3CM6 A;  1BQN A;  1C1A A;  4KKO A;  4M3T A;  4HUE A;  3AA3 A;  3NHG A;  3LWM A;  4E7J A;  1KLN A;  2HHW A;  4B8A B;  1IKV A;  3IG1 A;  3THV A;  4ZTF A;  4TSX A;  4OGC A;  4B9T A;  1JLE A;  4NCG A;  4FW1 A;  1JLA A;  3NGZ A;  3K5M A;  1S1V A;  4GMJ B;  2F8T A;  1RCH A;  5CYM A;  1QQC A;  1X9W A;  4MFB A;  5FRO A;  1RT6 A;  1D9D A;  4KFB A;  4QAG A;  4CIF A;  1BHL A;  4HUF A;  1QSS A;  4M3Z A;  3DRS A;  5KRT A;  2GUI A;  1HJR A;  4HHT A;  4Z4E A;  1NJX A;  1QSL A;  4J2B A;  1NK9 A;  3OYH A;  3FFI A;  2P5O A;  4CE9 A;  3UIQ A;  2VWJ A;  1HNI A;  4CEQ A;  4YFU A;  1IKX A;  4N56 A;  3TWH A;  2OA8 A;  2ETJ A;  4CJR A;  5SZT A;  3BDP A;  1VSE A;  2YHA A;  1EKE A;  2NUB A;  1RT1 A;  2XY8 A;  4KTZ A;  4O5B A;  4CJK A;  4OPJ A;  4JLH A;  1X9S A;  1X9M A;  4DSK A;  2HW3 A;  2HHU A;  1JL2 A;  4K8X A;  2OZS A;  4DTP A;  3SQ0 A;  3VN5 A;  2WOM A;  3ASM A;  4IFV A;  3LZJ A;  4Z0U A;  1JL1 A;  1MU2 A;  1ZBI A;  2QKB A;  1Q9Y A;  1YTU A;  3CYM A;  4ELV A;  2JGU A;  3G10 A;  3LP3 A;  1SL1 A;  3NF6 A;  5KI6 A;  3ZT1 A;  4FJJ A;  3SNN A;  4FXD A;  3M8P A;  3C94 A;  3V4I A;  3SQ1 A;  2YKM A;  1KVA A;  5HRR A;  2VG6 A;  4KHN A;  1X1P A;  1IKW A;  2BAN A;  3OVN A;  1NKE A;  3RR7 A;  1C0M A;  2GBZ A;  4DU4 A;  3SV3 A;  1QTM A;  4CF1 A;  4B9L A;  4OKE A;  1DTT A;  2RF2 A;  4FJN A;  3OS2 A;  4BE0 A;  3DRR A;  4B9M A;  4CJL A;  4F3T A;  3IRX A;  3V81 A;  1UA1 A;  3EYZ A;  4OLA A;  3VQ5 A;  1VSM A;  4B9V A;  3O3H A;  3AA5 X;  2IDO A;  4CFD A;  1SL2 A;  1RTI A;  3LAK A;  3LAL A;  3B6O A;  4FJK A;  3RMA A;  4PUO A;  4CK2 A;  3V9S A;  2ITG A;  1S5J A;  1LWC A;  5HBM A;  4CEE A;  3MED A;  4M3W A;  4CEF A;  1WN7 A;  2YKN A;  4CFA A;  1JLQ A;  3AVC A;  3SYZ A;  3BGR A;  3RRH A;  5JS1 A;  4PY5 A;  3DLB A;  3LP1 A;  2XY5 A;  5DMR A;  3AVM A;  3VQB A;  3AVB A;  4H4O A;  4CHZ A;  5CY4 A;  5KRS A;  4GW6 A;  3SI6 A;  3S3N A;  1J53 A;  3DLE A;  1HYS A;  2FBY A;  3AO3 A;  3CFR A;  3V9W A;  4RW4 A;  3HPH A;  2FBV A;  2G8I A;  4IDK A;  2ZQB A;  4CES A;  4CHY A;  4W5Q A;  4I9L A;  1FK9 A;  1FKP A;  4FJH A;  2VG7 A;  3AO1 A;  3AO2 A;  3U6F A;  1VRT A;  3E01 A;  2G8W A;  1TGO A;  3PX6 A;  3IAY A;  1CXQ A;  2KQ2 A;  1U04 A;  4DSJ A;  2KZM A;  4CJU A;  1RIL A;  1RTH A;  2DFE A;  3DOK A;  4E0D A;  2XRI A;  1LAV A;  3HVT A;  3KK2 A;  1TK8 A;  3AVK A;  4Z4G A;  3AVF A;  3QER A;  1KLM A;  4B9U A;  3QIP A;  3OYB A;  4IG0 A;  3LWL A;  1HRH A;  3MEG A;  3TAM A;  4FZY A;  3NF7 A;  4KRE A;  1D8Y A;  2BDP A;  3PO4 A;  4QCL A;  4CFC A;  2OZM A;  5I42 A;  4I7F A;  3ZSY A;  1S1T A;  4CJ4 A;  3RMB A;  1ASU A;  1UAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...