3NH2A

Crystal structure of rnase t in complex with a stem dna with a 3' overhang
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
207
structure length
202
Chain Sequence
b'GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 62
structure length 202
sequence length 207
chains with identical sequence B, E, F
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh2A00
4CGJA 4KI6A 4M3XA 1LAWA 3VQBA 1EP4A 1VSIA 2Z1IA 3TAEA 4KO0A 4ELUA 4CGFA 4B9NA 3L8BA 3VN5A 2HHTA 4W5TA 3NCIA 4LSLA 4NYFA 1WN7A 4I2PA 2G8VA 1S9EA 3K5MA 1SUQA 3OS0A 3BGRA 3RR8A 4FM0A 2F8TA 1FXXA 1CZBA 3L2QA 1TK5A 5CY4A 1RNHA 3QIPA 3PO5A 1JXBA 3P1GA 3AVBA 4M45A 1QSYA 1KFSA 4K8XA 3AA2A 3HXMA 4Z4HA 4FLVA 1YTAA 4KI4A 4Z4EA 4PQUA 1T05A 4W5QA 4HUEA 2D0CA 4M3RA 4CJSA 2OPPA 4CHPA 3SQ2A 1T8EA 3CFOA 1NK5A 5C42A 2VG6A 3TABA 5CYMA 3OVNA 1VSJA 5EU7A 1A5WA 3QINA 3ALYA 1JLGA 2KW4A 4CIFA 3NE6A 1UA0A 2P5OA 4CJWA 4C8KA 1BQNA 1B92A 1Q8IA 3SUOA 3O3FA 4CJRA 1C1BA 3MAQA 3DRRA 1DTQA 3C95A 3K5OA 1IH7A 3AVFA 3OYHA 4O55A 4CEOA 3TANA 1XWLA 4H4MA 4E89A 3WNEA 1QS4A 3HP9A 1LV5A 4QAGA 4BWJA 4BE0A 2B5JA 2P51A 1JLAA 3AVHA 1JKHA 1I3AA 3ZSXA 4DLEA 4CFCA 1U49A 4CJ5A 1UAXA 1QE1A 4OKJA 1KLNA 1HNIA 1VSEA 4DQRA 3QEIA 1X9MA 3LP1A 3C94A 4FZZA 1QTMA 1VSMA 2RF2A 3H08A 3ZT4A 3AVGA 3RWUA 3BDPA 1Z25A 2IS3A 3KD1E 1KVAA 1YT3A 4ELTA 3DRSA 1BISA 4RW7A 1TKTA 1S9GA 1U48A 1X9WA 3HP6A 2YNFA 1D8YA 1ZBFA 3IS9A 4F2RA 4I9LA 3C6UA 4OKEA 1BIZA 2XHBA 4OGCA 1X9SA 2Z1HA 5I42A 4HVJA 3F73A 4W5NA 3QEVA 4B9LA 2HHQA 3NH1A 5KGWA 2P1JA 1CXUA 4F3TA 4QOZB 2O4GA 4FJGA 2QKBA 1NJXA 4Q0BA 3LP3A 4AHSA 3D45A 2HMIA 2RPIA 4RG8A 4L8RB 3S3NA 3CG7A 4HHTA 1J54A 1SKWA 1Z26A 4DQSA 3OYLA 1BI4B 1N5YA 4J2BA 1VRTA 2OYQA 3AO4A 3L2UA 2E6MA 3DI6A 1W9HA 1JL2A 1WSEA 5HRPA 3OYFA 3CQ8A 4DTNA 4CEBA 4W5OA 4KTWA 1WLJA 3KTQA 2OPRA 3QIOA 5HP1A 1NK7A 2BE2A 1QSLA 3K5NA 2D0BA 3SPYA 3DOKA 3OYIA 5C25A 3AVIA 3AVKA 4DU4A 3VQ5A 3SUQA 4DTJA 3SI6A 4CK2A 2VWJA 4CJFA 4I7FA 1WSJA 4CJTA 4LD0A 2A1SA 4DWIA 3QESA 4F4KA 4EZ6A 3V9WA 4DSEA 5FRMA 1K6YA 2FBYA 4N47A 1RT6A 4CEEA 1SKRA 3V9ZA 4DFPA 4FK0A 3ZT1A 4M3ZA 2P5GA 3AVMA 1S6PA 4B8AB 3V4IA 1RDBA 4FLUA 4DQPA 4CECA 3S9HA 4FLYA 4N5SA 2R7YA 5D3GA 4NCAA 2YNHA 4CGGA 2W42A 2AJQA 3WNFA 1NJYA 4DSJA 2KZZA 4CEZA 1JLBA 4CGIA 3DLHA 1B9DA 4IG3A 3OYKA 2PYLA 4J2DA 4JRPA 5T7BA 4DS5A 1NKBA 3LP0A 2PYJA 1Y97A 2YHAA 4FW2A 4DTSA 4ELVA 2QKKA 1S1WA 4KHUA 2ITGA 3ZSOA 3ZSQA 1X1PA 4RW6A 2HB5A 4C8NA 3HM9A 2IAJA 5J2NA 4FZXC 4ZHRA 4FJKA 1FKPA 3PX6A 4FJXA 4CIEA 3MEGA 5KRTA 3V9UA 5HRSA 3UIQA 4DFJA 1VK0A 3IAYA 4FJHA 3ZSYA 1IKYA 1SKSA 1D9FA 3CM6A 2DFHA 3SNNA 4E0DA 4CF2A 1VSFA 4DU1A 5FDLA 3SZ2A 3T19A 4N56A 2EHGA 3K57A 3NF7A 3S3MA 1L3SA 4C8LA 2XO7A 1RDCA 1XHZA 2D0AA 2HHWA 4ID1A 4ZTJA 2HHVA 3NHGA 2IOCA 3NF8A 3RMCA 4BACA 4MFBA 4OVLA 5J2PA 4E7KA 4E7IA 4FJ8A 4CJUA 2Y1IA 4CJVA 4FK4A 3SQ1A 4BDZA 4AH9A 4DFKA 3HSTB 3HO1A 3MXJA 4E7HA 2RN2A 3L3VA 3KIOA 4CK3A 3VQDA 3TAMA 1RT1A 2XY6A 4KFBA 1I39A 1QQCA 4FYDA 2Z1JA 4F8RA 1B9FA 1RBVA 2G8WA 4Z4GA 4CFDA 1REVA 2VG5A 3G0ZA 3JSMA 1QSSA 3KKRA 4KV8A 1ITGA 4IKFA 4CE9A 1LWEA 2YNGA 4PWDA 2D5RA 3A2FA 1DTTA 3AVCA 3CM5A 3HPHA 1W0HA 3O3GA 3DRPA 3WNGA 1D9DA 4LY7A 3VQEA 1CXQA 4DFMA 4CESA 1L5UA 3I8DA 4CF9A 3SJJA 3LAMA 4NYNA 3M8QA 1NJWA 4DSIA 3OY9A 3LALA 2F96A 1TL1A 4JRQA 1Q9XA 4DSFA 1GOBA 4OJRA 1J5OA 4N41A 1EETA 5JS2A 3THVA 1C0UA 3LPUA 3L3UA 3RRGA 3M8SA 3T3FA 2E4LA 3ZSRA 3OYCA 1TK8A 4IDKA 1HQUA 1KCFA 2ZE2A 1QHTA 3ZCMA 3AVJA 3MXMA 4FK2A 3C6TA 2QXFA 4J2AA 3NFAA 4DLGA 4M3UA 3L2RA 2BDPA 4KB0A 4FM2A 3B6OA 4AILC 2EX3A 4MQ3A 5HROA 1L3TA 2HHUA 4FW1A 4FJJA 4CIGA 2B6AA 3DLKA 1HQEA 4B08A 4DQIA 3SQ4A 1TL3A 2WONA 1U4BA 4M41A 2B4JA 4CEFA 1RBSA 3QEPA 5DMRA 3KLHA 2KQ2A 3LPTA 4E19A 3V81A 4CEDA 1NK9A 4CHQA 1TAUA 1JXEA 4DU3A 4OLBA 3DM2A 1U04A 1WSGA 4FJ7A 2F8SA 2ZQBA 3DLEA 4YFUA 1SL0A 4DQQA 4RW4A 4BE1A 2BGGA 1C0MA 5HLFA 3S3OA 1J53A 3ULDA 4CF1A 2PY5A 3TWHA 1NOYA 3NGIA 3ITHA 1BCMA 1S1UA 2WOMA 4CJ3A 1RTIA 3VQQA 2G8FA 4KHQA 4O0IA 1TKZA 1NKCA 3QLHA 1RT4A 1C6VA 1LAVA 5KRSA 1UA1A 2OA8A 4BDYA 4KREA 1RT5A 2X6SA 1RBRA 2OPSA 1FK9A 3AVNA 3NAEA 3KLFA 3B6PA 3WNHA 3VA3A 3NH0A 1T03A 3K58A 1SL2A 1CZ9A 3QERA 1WAJA 3AVAA 1BCOA 3MXIA 3RTVA 4DTUA 4KHNA 4M3WA 3QO9A 5KI6A 3OYDA 3ZSZA 1FKOA 4Z4IA 3DMJA 4O4GA 2PZSA 2G8UA 5CZ2A 1RILA 5E41A 4GMJB 4OLAA 4KHSA 1JLQA 3TI0A 4HUGA 3KLIA 4B9VA 3AV9A 2VG7A 3V1RA 1F21A 3ZSVA 4FVMA 3KKSA 1RBTA 4CCHA 3LZJA 2OZSA 3NF9A 3O4QA 2Z1GA 4FZYA 1WSHA 1HNVA 4H4OA 1S1VA 5HBMA 3DOLA 4C8MA 4YNQA 4DTMA 4TSXA 1RTHA 4DF4A 2LSNA 3PUFA 3HPGA 2XY5A 3U3YA 3OS1A 3TAPA 4CFAA 4M42A 1KVCA 4OKKA 1NOZA 1WNSA 4CEQA 4FJ5A 4FJMA 3IRXA 2YHBA 4LSNA 2Q3SA 1C1AA 3I0RA 1C1CA 3KK2A 3NGYA 4OPKA 4E7JA 2OZMA 2YNIA 1L3VA 1ASUA 3HJFA 2IC3A 1HYVA 1HYZA 1XI1A 3AO5A 4IBNA 1N6QA 3V9XA 4J2EA 5K14A 3EZ5A 4KKOA 4CK1A 5J2QA 4FJNA 4IG0A 2KZMA 4XIUA 5I3UA 3VA0A 3VQ8A 4AHVA 4O44A 1BI4A 4RW9A 1TVRA 3MEDA 3LWMA 2I5JA 4ICLA 3LP2A 4IFVA 1TV6A 3MECA 1HYSA 1JLFA 4LH4A 1LWFA 4CJPA 4F2SA 4DS4A 4AHCA 4FLWA 1RT3A 3HK2A 4WE1A 3ISNC 3VQAA 1ZBUA 4CJEA 3KK1A 3RR7A 3P83D 1NK6A 1RBUA 4CHNA 5JS1A 3RRHA 4CJLA 2ATQA 3LDSA 1TGOA 4JS4A 3L2WA 3TAQA 1S1XA 2NUBA 4FCYA 3SQ0A 2DFFA 2ETJA 3OYAA 1HJRA 3K59A 3SV3A 3V9SA 4DF8A 1HPZA 3U3GA 3HT3A 1NKEA 1BL3A 3F9KA 3O3HA 1YVUA 4JS5A 3QEXA 4NCGA 4QCLA 2GV9A 4DTOA 3AVLA 4M3TA 3QNOA 3PX0A 1RCHA 3ZSWA 3KLEA 4N76A 3NGZA 3SCXA 1D5AA 1LWCA 2IDOA 2HVHA 1TK0A 3SUNA 2KTQA 4I9QA 3KD5E 3KLGA 4DMNA 4PUOA 4IFYA 4M3YA 2HVIA 1T7PA 1UWBA 4CHZA 5C24A 4CHYA 1ASWA 3RMAA 1TKDA 3QEWA 1G15A 1LW2A 3SYZA 3MEEA 4DG1A 1GOCA 4FJLA 3OYNA 4CERA 3SV4A 3VQ9A 3HL8A 4OPJA 4CF0A 4HTUA 1IO2A 3V1OA 3ZT0A 4O0JA 4FM1A 1NJZA 1BIUA 2IGIA 3AA5X 2FBTA 5KTQA 4UQGA 1S1TA 1S6QA 1IKXA 4AHUA 3TARA 1VRUA 3OYGA 1KLMA 3DLGA 3JYTA 3IG1A 1VSLA 3OJUA 3ZT3A 4FJ9A 1R0AA 3VQ7A 5SWMA 2QK9A 3FFIA 1KRPA 4GW6A 2YV0X 4DSKA 4DTPA 4PY5A 3HPOA 3SPZA 3LANA 1ZYQA 5HRNA 3L2VA 3EYZA 4LH5A 1KFDA 1TAQA 3PY8A 2GUIA 3O4NA 1HRHA 4AHTA 1IKVA 1LW0A 3OJSA 4G1QA 4C8OA 3KJVA 3DLBA 4HCCA 1S5JA 1NK4A 1JLEA 4E3SA 3G10A 3NF6A 2G8KA 2YKMA 1VSHA 1SV5A 2O4IA 4W5RA 2DFEA 2HNDA 3KK3A 2HNZA 3AA3A 3I0SA 1RDDA 4Z4CA 4B9UA 4F3OA 1TKXA 1A5XA 2ZD1A 4H8KA 4BWMA 4E7LA 4KHYA 4B9MA 1ZBIA 3CYMA 3PO4A 3VQ6A 4KRFA 2A1RA 1VSDA 4CEAA 1RTDA 3OYMA 4B9SA 4ID5A 4KHWA 3HVRA 4HCBA 4KTZA 5HRRA 4R5PA 4DSLA 4CGDA 3OYEA 1RTJA 1DLOA 4ZTFA 1WAFA 2OPQA 3VQ4A 3HVTA 2X6NA 4EP4A 1IKWA 4Q5VA 4EZ9A 2FBXA 3T1AA 2XY8A 3OS2A 3V1QA 3RMDA 4PA1A 1VSKA 1HMVA 3AO1A 1KTQA 1XHXA 3DYAA 3QNNA 1ZBLA 4FJIA 4NCBA 2HHXA 4FLZA 2GBZA 4B3OA 2VWKA 4I2QA 1JL1A 3PV8A 1RT2A 1EKEA 5J2MA 1XC9A 4CFBA 1U45A 1NK0A 1BQMA 3RMBA 2RKIA 3LAKA 1J9AA 4BE2A 3V6DA 1O1WA 3CFPA 2HHSA 1NK8A 2FC0A 1KVBA 2KFNA 5KGXA 4AHRA 4KTQA 1C0TA 3HYFA 5CYQA 2X78A 1GOAA 5CZ1A 3VQPA 3EY1A 1ZBHA 3E01A 4K8ZA 3AO2A 4B8CA 1A5VA 5J1EA 4KPYA 4CJ4A 2XY7A 4Z4FA 4EP5A 3QETA 3ZT2A 4O5BA 2DTUA 3D0PA 4Y1CA 1JLCA 4DTXA 3AA4A 1WSFA 1EX4A 1WSIA 5FROA 4CJKA 1IG9A 3OYBA 4Y1DA 3CFRA 4KAZA 4FXDA 3U6FA 1EXQA 1MU2A 1KSPA 2BANA 3K5LA 3TAFA 2HW3A 3TAGA 3NBPA 3LWLA 4CGHA 3OYJA 3DLRA 2XRIA 2KFZA 4JLHA 2X74A 1YTUA 4E1NA 1RT7A 3SUPA 2FBVA 4FLXA 4GVMA 1L3UA 4HUFA 3K2PA 5FRNA 1SL1A 2YKNA 1CLQA 3VQCA 5SZTA 4OGEA 4RW8A 4DTRA 4KB1A 1U47A 3ASMA 1BGXT 4CJQA 4CF8A 4E1MA 3NH2A 3LZIA 3AO3A 3P5JA 2JGUA 5DK5A 3TR8A 4CHOA 1UOCA 3PX4A 1RDAA 2DY4A 1ASVA 1BHLA 2G8HA 4B9TA 1Q9YA 3NDKA 4Z0UA 2HNYA 3M8RA 4BDPA 2JLEA 2E6LA 4FLTA 2G8IA 2Y1JA 3M8PA
chains in the Genus database with same CATH superfamily
4CGJA 4FWSA 3F5TA 4CZEA 4B1VA 4FPBA 3VN5A 4W5TA 4NYFA 3SBTA 1WN7A 5M1FA 4QS8A 5LMUK 3K5MA 2QWMA 2EWSA 3RR8A 4FM0A 2A40A 1JXBA 3P1GA 2P9IA 3AVBA 4M45A 1Q18A 2NRVA 4CBWA 1T05A 3EKSA 4HUEA 3JAMO 3ZLJA 2OPPA 4CHPA 3SQ2A 1T8EA 1NK5A 2VG6A 1VSJA 5CE3A 4CIFA 2P5OA 3ALYA 5ELZA 3NE6A 4CJWA 1B92A 4BC2A 4IO9L 3MAQA 3FFKB 4DR1K 2NLXA 3VEWA 3TANA 4GKJK 5HL7L 3M1FA 4JK9A 3WNEA 4BE0A 2B5JA 2P51A 3AVHA 1I3AA 4CFCA 4YY3K 4CJ5A 1QE1A 1KLNA 2NRXA 1VSMA 5GAGP 3RWUA 2IS3A 1HKGA 4IJNA 5ADXH 3FZMA 1QQNA 3BF3A 4ELTA 1BISA 3VGKA 3H3OB 1X9WA 3L6QA 5H1SQ 1ZBFA 4F2RA 2P9PA 1HNWK 4JNEA 4FPAA 4CBXA 3FZKA 5TKWA 4B3MK 2P1JA 3UKRB 1CXUA 5I9EB 4BRQA 4FJGA 5AQUA 4X62K 1S72N 4AHSA 2HMIA 3MX2A 5AQVA 3Q7BA 4HHTA 1J54A 1SKWA 1BI4B 1SAZA 2E6MA 1W9HA 1JL2A 5HRPA 3CQ8A 4DTNA 3QIOA 2D0BA 3SPYA 3DOKA 2NRZA 5C25A 5AQIA 3AVKA 5F0XA 4DU4A 4XEIA 3SUQA 2H3GX 4LF6K 3HBTA 2FSNA 2A1SA 3KK7A 3LDOA 2A6AA 4EZ6A 4F4KA 4DSEA 3H6EA 2QWRA 4N47A 4YOWA 4DCHA 4B8AB 3V4IA 3ULEB 4DV2K 1WOQA 4FLUA 2UXDK 3O9UA 4N5SA 1QVFM 5D3GA 4JK8A 1XNQK 4CGGA 1HX1A 4DSJA 4DV6K 2KZZA 4CEZA 3DLHA 1B9DA 4IG3A 2ASOA 1NKBA 3GG4A 3HRGA 4DTSA 1S1WA 5E84A 3ZSOA 1X1PA 4RW6A 4C8NA 3UKUA 1G99A 4FZXC 4BQLA 3RSEA 5AQMA 2NRHA 2DFHA 3WQTA 4DU1A 3CCJN 4N56A 2EHGA 5GAHP 3K57A 1L3SA 2XO7A 3OW2M 2D0AA 4ID1A 3O1WA 1K8KB 4OVLA 4CJUA 1IBKK 4FWLA 4BRGA 3WUHA 2P9NB 3VQDA 4JI8K 1HKBA 2Z1JA 3DXKA 1BU6O 1B9FA 1K9MO 4F8RA 4CFDA 2VG5A 1QSSA 4KV8A 4CE9A 1LWEA 4OPHA 3DRPA 4GY2B 1D9DA 4GVEA 4DFMA 4CESA 1ILYA 4IEEA 3M8QA 1KAZA 3CC4N 1J5OA 1IBLK 2CGJA 3NVMA 2E4LA 1TK8A 4GV3A 4CVNE 3MXMA 3L2RA 2EX3A 4MQ3A 2HHUA 4CIGA 1HJOA 4B08A 5BR8K 3ATVA 3EZWA 3SLCA 1KC8O 4M41A 3VF2A 3CCRN 2O8EB 5EOYA 2E2NA 1RDUA 4JD2B 4CEDA 3KWIA 4CHQA 1WSGA 4YOXA 2F8SA 2Q31A 2ZQBA 3DLEA 4YFUA 4JI7K 4DQQA 3S3OA 4KH4A 3ULDA 4JI0K 4JN4A 1S1UA 2WOMA 4KHQA 3QLHA 1C6VA 2WC9A 5KRSA 2QWOA 2CH5A 5AJ3K 2OPSA 4Z94A 4WF9L 3NAEA 1T03A 3KLFA 3B6PA 4N76A 4FWRA 3O9SA 1CZ9A 4IWVA 3CQYA 4KHNA 2P9KA 1FKOA 4AM6A 3DMJA 2PZSA 3THWB 1RILA 5E41A 1BA0A 2ZJRL 1HUXA 3AV9A 1RBTA 3GDQA 1ESVA 4CCHA 1N34K 3D7EO 3FGUA 3CCMN 4FZYA 1WSHA 4DR5K 4H4OA 3HSCA 3CJCA 2F9TA 1IJJA 4OX9K 4NLBA 2LSNA 3OBYA 2P9IB 1C0FA 3U3YA 3D2FA 4ISFA 4CFAA 1KVCA 4FJ5A 4HWIA 5AFUA 2ZM6K 4E7JA 2OZMA 1L3VA 2YCHA 1T6CA 1HYVA 2CGLA 3AO5A 1ATNA 3EZ5A 3L4QA 4YOYA 1XQSC 4AHVA 3O1BA 4BGAA 4RW9A 3VEVA 4JHDB 3LP2A 4BQZA 1KXPA 4FO0A 3M5RA 3LDPA 3HK2A 4WE1A 3KK1A 1NG9A 3P83D 5JVHL 4CHNA 4CJLA 4JS4A 3BY5A 1S1XA 4FCYA 1HPZA 3U3GA 4JS5A 4NCGA 3PX0A 3O5BA 3ZSWA 2JWLA 3SCXA 1LWCA 2IDOA 1BWFO 5EVZA 4BRDA 2FXUA 3KD5E 4M3YA 3FE1A 3ZX0A 1T3VA 2FSJA 1E3MA 3QICA 3SMPA 3SYZA 2W6KA 4BG9A 3MEEA 1GOCA 3OYNA 3HOTA 1IO2A 3V1OA 3SBGA 1BIUA 3AA5X 3VGLA 3D2EB 4BRFA 2FBTA 4IOAL 1BDGA 3TSQA 2BH1A 5BN8A 1ZBSA 3ZX3A 5AQOA 3VQ7A 4BRLA 4JI6K 1OH8A 1NGEA 2GUIA 1IKVA 1X3MA 3ZEUA 1LW0A 4OO1J 5AQJA 4HCCA 4BROA 4E3SA 3G10A 1VSHA 3FLCO 3CJ7A 2NRRA 3KK3A 2HNZA 3I0SA 1TKXA 4E7LA 4KRFA 2YI1A 2A1RA 1H1VA 1VSDA 3HVRA 4KTZA 4DSLA 4CGDA 1WBDA 5EX5A 3IMXA 2X6NA 3A5MC 5AQXA 3CMEN 4YOTA 1HMVA 3MN9A 1FJGK 1KTQA 2UYTA 1ZBLA 5C2FA 4FLZA 4IJAA 5AQFA 2VWKA 4I2QA 3PV8A 1U45A 5J2MA 4CFBA 1BQMA 3J81O 1V4TA 3V6DA 1WBBA 2Q36A 1OH6A 2AA4A 1GOAA 3VQPA 3WQUA 3E01A 4H5WA 4K8ZA 3U9ZA 1XMOK 5J1EA 3C7NB 4O5FA 3QETA 4LF9K 2UXCK 2DTUA 4DV4K 4CD3A 1EX4A 5F1XA 3MWTA 4CJKA 1IG9A 4Y1DA 4H0XB 1MU2A 1Q86O 3TTFA 3NBPA 3LWLA 4CGHA 2XRIA 2UU9K 3SUPA 3F9MA 4FLXA 1L3UA 4KHPK 4RW8A 1U47A 3VOVA 3NH2A 3L4IA 5DK5A 1UOCA 3PX4A 4PL7A 1YF5L 5FLXO 4BDPA 2JLEA 2HHHK 2G8IA 3SJHA 4ELUA 4CGFA 3L8BA 2HHTA 4LSLA 2GTDA 4JI1K 4I2PA 1S9EA 5C15A 5KQDA 3BGRA 3O80A 4H0VB 2F8TA 1D4XA 3THYA 1TK5A 1RNHA 3QIPA 3THXA 3AA2A 2CH6A 1YTAA 3CF5L 3CFOA 1Q82O 4OPAA 3OVNA 3QINA 4BR7A 1JLGA 1UA0A 2QW9A 1BQNA 1Q8IA 1FW6A 4B1ZA 2HBJA 3BUZB 1M90O 1DTQA 3C95A 3AVFA 3MCAB 5DM6L 1DEJA 3HP9A 3LM9A 1ATRA 3O9QA 3ZSXA 3E9PA 1P90A 4LFCK 4OKJA 4DQRA 3C94A 4JKFA 1VAZA 4QS9A 1YJWN 3ZT4A 5IT9O 1Z25A 2O8CB 2HBKA 3CERA 3DRSA 4JKEA 4GV6A 1WUAA 3FZHA 2YNFA 2KLAA 1D8YA 4IFEA 4GKKK 3WT0A 4I9LA 4OKEA 2XHBA 5I42A 1HKCA 2NZTA 3F73A 5AQLA 1GLDG 4W5NA 5EY4A 4FWQA 3WXKA 3NH1A 4C23A 2O4GA 2QKBA 3WEEA 4WFBL 3D45A 5TKYA 4BR5A 4RG8A 3WXIA 3G6EN 4L8RB 2VQEK 4U67L 1Z26A 2O8BA 1N5YA 1VRTA 1JCFA 2OYQA 3AO4A 3DI6A 4ZTJA 1WSEA 3OYFA 4W5OA 1WLJA 5AQQA 1QSLA 3K5NA 3HI0A 1EQYA 4DTJA 3SI6A 4CK2A 4DWIA 2FBYA 4CEEA 1SKRA 4M3ZA 2P5GA 1NGIA 1TUYA 2Q0RA 4DQPA 3CI5A 4DQ8A 4B3SK 2R7YA 1JLBA 2E5LK 2VWBA 2E8AA 3HZ6A 4JEPA 2PYLA 3E1YA 5BR9A 4WQ5A 4B1YB 2PYJA 3VF4A 2V7YA 2ITGA 4KHUA 2IAJA 3CJAA 4ZHRA 4FJKA 1FKPA 2E20A 3QFUA 4DFJA 3DAWA 2GELA 1IKYA 1D9FA 1GLJO 4E0DA 3M3ZA 5FDLA 3T19A 4C8LA 3GE1A 1XHZA 1RDCA 2HHWA 1QVGM 4FOIA 4H5TA 4LF8K 4B3RK 4EHUA 3GBTA 4DR3K 5J2PA 4E7KA 4E7IA 2Y1IA 4CJVA 4FK4A 3HO1A 1HLUA 3L3VA 4CK3A 4ISEA 3TAMA 5F2RA 1QQCA 4FYDA 3VTIA 1RBVA 4CZIA 2G8WA 3G0ZA 3KKRA 1ITGA 4IKFA 5AQTA 3AVCA 3CM5A 1W0HA 1CXQA 3I8DA 4CF9A 3SJJA 4DSIA 3ENOA 1GOBA 4DR6K 2YHWA 2QXLA 1HQUA 1KCFA 2ZE2A 3JXUA 3MMVA 4LC9B 4DV0K 4FK2A 4Y0WA 4J2AA 4DLGA 2YJFA 2BDPA 1TUUA 4FM2A 3B6OA 1L3TA 4CBUA 3AGRA 2WBNA 3SQ4A 4DV5K 2WONA 4RTFD 1U4BA 3J80O 3C0BA 2WUSA 4PKGA 2B4JA 4CEFA 1RBSA 5DM7L 2HF3A 3KLHA 5BRHA 1KD1O 4CZHA 3DM2A 1TYQA 4RW4A 3I55N 4BE1A 3E9LA 4J8FA 1J5EK 1BOTO 4CF1A 2PY5A 3H1QA 1NOYA 2ASMA 1RFQA 1TKZA 1RT4A 1UA1A 2OA8A 1RT5A 2X6SA 2YJEA 1FK9A 3VA3A 3NH0A 3I8BA 4BRNA 5AQYA 3QERA 3CJBA 1BCOA 3MXIA 2QWNA 4DTUA 4ILJA 2QEXN 4M3WA 2W41A 3QO9A 4H5RA 4FSVA 4O4GA 3HOSA 4GMJB 3SK3A 4KHSA 4B9VA 3V1RA 1U2VB 3KKSA 2OZSA 3E9OA 3O4QA 4B9QA 5E26A 3U9DA 1HNVA 4YNQA 5C10A 2PAVA 4TSXA 3ID6A 3HTVA 2XY5A 3VMFB 1QZ5A 4M42A 3O9TA 1NOZA 4LSNA 4RCHA 3DJCA 4OPKA 2YNIA 3HJFA 2IC3A 4KBOA 3R6MA 1VQ4N 2CGKA 2KZMA 4O44A 4DHYA 4B1UB 2I5JA 4CI6A 3W0LA 3MECA 1HYSA 1JLFA 1LWFA 2ZJPL 4AHCA 4B1XB 1ZBUA 2P9LA 1RBUA 1JJ2M 3RRHA 1IV0A 3V9SA 2G8HA 1NWKA 3F9KA 1VQ6N 2GV9A 4DTOA 4K0KK 1RCHA 3KLEA 1D5AA 2HVHA 1TK0A 4LF4K 4DMNA 2ZGZA 1T7PA 3RMAA 5LY3A 1TKDA 3QEWA 4WQ5C 2UXBK 2NRTA 2P9UA 4HTUA 2FF3B 1S6QA 1IKXA 3EN9A 4AHUA 4DV7K 2VGNA 1VQKN 3C6AA 1NGFA 3OJUA 3G25A 4FJ9A 5SWMA 5AZIA 3FFIA 4GW6A 3P4IA 4AF1A 3CJ9A 3SPZA 4FL9A 4I6MA 1ZYQA 5HRNA 3WXJA 4CD1A 4LH5A 1KFDA 1VQNN 3AAQA 1HRHA 4AHTA 4JKHA 3CCSN 4FWPA 4BR4A 4C1NK 1MDUB 3OJSA 3DLBA 1S5JA 5LL6Z 4FVUA 3I56N 5KPRA 4FOEA 4U7BA 1SV5A 5JLFA 5BPLA 1VQON 3RVCA 2KHOA 1RDDA 4B9UA 2O8FB 2O8DA 1X9JA 4BWMA 3CYMA 5AQWA 3VQ6A 1T6DA 5GAEP 3OYMA 4B9SA 1BUPA 1ATSA 4ID5A 4KHWA 3MN6A 5HRRA 3OYEA 1RTJA 1DLOA 2OPQA 4CZMA 2Q1NA 1IKWA 3T1AA 2XY8A 4MLEA 3V1QA 1VSKA 5BREA 3DYAA 5C12A 2HHXA 3CQXA 1KAYA 2HSTA 1NK0A 3KZBA 2RKIA 2E88A 3CFPA 2OTLN 1GLFO 1W7AA 4AHRA 4KTQA 3T7ZA 3HYFA 2X78A 3ZETA 2QWPA 4DB3A 4FWMA 4Z4FA 4EP5A 3IUCA 4JAXA 3D0PA 1E4GT 1JLCA 1N33K 3AA4A 1IBMK 4CJ7A 2V51B 4LFBK 4JKCA 4KAZA 4FXDA 2IVPA 3U6FA 4WFAL 1KSPA 3K5LA 3TAGA 2WFBA 2X74A 1XNRK 2FBVA 4C1NI 4GVMA 5FRNA 1SL1A 1CLQA 3W3DA 3ZX2A 1GLCG 3H46O 4EIAA 3AO3A 2RE2A 1RDAA 1BHLA 3LDNA 4Z0UA 2HNYA 4BR9A 3M8RA 2OANA 4JRQA 4KI6A 3N4PA 4M3XA 5MLCQ 4UY8O 2P9SA 5GADP 4A57A 4KO0A 4BC5A 1ZC6A 3PSIA 4B9NA 4H0PA 1YVNA 2G8VA 3O08A 3OS0A 4M7XA 4IZ9A 4JKGA 1E4FT 1CZBA 1YIJN 5KQ8A 2P9PB 1BG3A 1QSYA 1KFSA 3HXMA 4Z4EA 4PQUA 4M3RA 4CJSA 4BVPA 5CHIA 5C42A 2OCEA 3DXMA 5GINA 5CYMA 4PKIA 4DV3K 3E66A 3CMAN 1A5WA 2KW4A 4C8KA 3SUOA 4NB4A 3O3FA 4CJRA 1XMQK 3DRRA 3UB5A 3K5OA 3IDHA 1IH7A 4O55A 4CEOA 3A5LC 4E89A 4BRIA 1QS4A 4BWJA 1JLAA 1JKHA 4ILHA 2QWLA 2A3ZA 2ZGYA 1X9MA 3LP1A 1HNXK 4FZZA 1QTMA 3H08A 3BEXA 3EO3A 1YT3A 4RW7A 3KHYA 1TKTA 1N32K 4JI4K 1S9GA 3HP6A 3QFPA 3G71N 3P31A 3IS9A 4OGCA 1X9SA 4XH1A 2Z1HA 4B9LA 2HHQA 3JS6A 5KGWA 2QWQA 3U8XA 4F3TA 2Q97A 4QOZB 3EEQA 3LP3A 3UKUB 2GWJA 1C0GA 5C2DA 2RPIA 5M1PA 3S3NA 3CG7A 2PFUA 3OYLA 2E2QA 4J2BA 3RSEB 5EXWA 4X64K 3L2UA 3NMUA 5AQRA 2QTDA 3KTQA 2OPRA 3O8MA 3OA9A 1R59O 3MN7A 3VQ5A 3B8AX 2DPNA 2I7PA 2YHXA 4LFAK 1V4SA 3V9WA 1HPMA 3O4WA 5FRMA 4DFPA 4K25A 3ZT1A 4FK0A 4ILGB 3AVMA 4DUZK 4WQ4A 3DXKB 3DWLA 4CECA 3S9HA 4FLYA 1EO1A 3VEOA 4NCAA 3GL1A 2W42A 1NMNA 2A5XA 5T7BA 1MWMA 3UKRA 2YHAA 4FW2A 1Q81O 4A2AA 4ELVA 3T1HK 3ZSQA 2HB5A 3CPWM 5AQNA 4BC3A 4CIEA 5KRTA 5HRSA 3CD6N 4FJHA 1VK0A 3A0IX 1SKSA 5BRFA 4BC4A 3CM6A 3SNNA 1VQ8N 4MLHA 4CF2A 3AAPA 2D1KA 4IOCL 3SZ2A 5AQHA 3S3MA 4XH5A 2Q0UA 2IOCA 3NF8A 5AFUH 3RMCA 4MFBA 2E2PA 1YJNN 4BDZA 4AH9A 4CZGA 3MXJA 3CCUN 1RT1A 4YDUA 1I39A 2V52B 3QMLA 5ADXA 5JVGL 3ULEA 4Z4GA 3J8AA 4IXCA 3JSMA 2YNGA 3HPHA 5LMNK 3WNGA 5AQGA 1U6ZA 4NYNA 1QQOA 2P9KB 3EE9A 3OY9A 3LALA 2F96A 1TL1A 1EETA 2HF4A 5JS2A 3THVA 1C0UA 3L3UA 3M8SA 3T3FA 1N36K 3OYCA 4IDKA 4IO8A 3KWGA 3PIOL 3ZCMA 3AVJA 2QXFA 3NFAA 4PL8A 3TSUA 4AILC 4FJJA 2B6AA 3DLKA 1HQEA 3TSPA 1TL3A 4BREA 3D2FB 4IDHA 2HBLA 3QEPA 5DMRA 5GIOA 1K8KA 4MDAA 4NLCA 4PHTX 3LPTA 4E19A 3V81A 2JWKA 4OLBA 1U04A 4FJ7A 5IWAK 3QBXA 5HLFA 1J53A 4MO5A 3ITHA 2W40A 3QDKA 4CJ3A 3VEZA 3VQQA 4O0IA 1NKCA 4KREA 1LAVA 3G4SN 4BDYA 5AR0A 4KH5A 1SL2A 3K58A 5AQPA 3RTVA 4JK7A 4YOUA 4NO7A 3OYDA 1YAGA 3ZSZA 4Z4IA 2G8UA 1MA9B 4O8KA 4OLAA 2NRWA 1F21A 2Z1GA 1OKJA 1S1VA 3DOLA 4C8MA 4FWKA 3PUFA 2ZJQL 4O8UA 5CR4A 3TTCA 4FJMA 3IRXA 2YHBA 1C1AA 1C1CA 3ENHA 4JD2A 4AM7A 3NGYA 3KK2A 4CZLA 1HYZA 4BRKA 1XI1A 5K14A 4F9OA 4KKOA 4CK1A 5J2QA 3IFRA 4IG0A 4XIUA 5I3UA 3VA0A 3VQ8A 1I94K 2VYPA 1GLBG 1TVRA 3MEDA 5KPZA 2BTFA 1N8RO 4JI3K 1TV6A 2FF6A 1BO5O 3ZEUB 3R3LA 4F2SA 4DS4A 4CJEA 1YITN 3RR7A 4JI5K 1NK6A 5JS1A 2ATQA 2V7ZA 3LDSA 3L2WA 2ETJA 4BR0A 4DF8A 1HJRA 4WQ4C 3WXMB 1HNZK 3O3HA 1YVUA 3PIPL 1LOTB 1XC3A 4M3TA 3QNOA 1YJ9N 3NGZA 4K42A 3KLGA 4PUOA 4IFYA 2HVIA 1UWBA 4CHZA 5C24A 4CHYA 3CC7N 1G15A 1LW2A 3CIPA 3AGKA 5FPNA 3SV4A 4CF0A 5C0YA 3ZT0A 4FM1A 1NJZA 3MX5A 3N4QA 4UQGA 1VRUA 3OYGA 1KLMA 4X65K 4H0YB 3IG1A 4A2BA 1VSLA 3JYTA 1R0AA 2QK9A 1KRPA 1Y64A 4PY5A 3CC2N 2HOEA 3L2VA 3EYZA 4JHDA 3BZCA 1TAQA 3SMSA 3NVKA 3CCEN 3KVGA 4G1QA 3OTOK 4C8OA 1NGAA 4MDBA 1EWRA 4JKBA 4YDUC 2YKMA 1KQSM 3ATUA 2VCPA 1SQKA 3L0QA 4KH6A 2DFEA 4W5RA 1Z6RA 2ITMA 3AA3A 2FSKA 5M1KA 1Q7YO 4H8KA 4IOXA 1NM1A 3BP8A 1VQ9N 1NLVA 1QHAA 3LDQA 2IVOA 3PSFA 2I7NA 2NNWA 4HCBA 4X66K 2BUPA 4ZTFA 3VQ4A 1OVQA 4Q5VA 4EZ9A 5KPTA 3RMDA 3D2EA 1XHXA 3QNNA 5B8HA 5AQZA 2E1ZA 2GBZA 4B3OA 1XC9A 1RT2A 3K9KA 3LAKA 4BE2A 1O1WA 1M1KO 2HHSA 1NK8A 1KVBA 2A41A 5AQSA 3SAHA 1GLAG 5CYQA 3EY1A 3THYB 1ZBHA 3THXB 4JKDA 4B8CA 3CCVN 1A5VA 5LJVA 4KPYA 3ZT2A 4BRMA 1NNEA 3R8EA 4FWNA 3OYBA 3S41A 3CFRA 3O9RA 2J4RA 1BA1A 1OH7A 2HW3A 2KFZA 3OYJA 4DR7K 1RT7A 3K2PA 3MWPA 5BPMA 5SZTA 4OGEA 4DTRA 1K8AO 4KB1A 1BGXT 3OHRA 2F7TA 4CF8A 4E1MA 3LZIA 5LJWA 2JGUA 4GNIA 3TR8A 3PLAA 1ASVA 4BG8A 3M8PA 2Y1JA 1LAWA 3MN5A 1EP4A 1VSIA 2Z1IA 3VQBA 3TAEA 4A5AA 4HTLA 3VERA 1LCUA 2ZWHA 3NCIA 1SUQA 4EAHD 3BF1A 3VESA 4R79A 1FXXA 1S3XA 3L2QA 5M1NA 2QA4N 5CY4A 3J7ZO 3PO5A 1CZAN 4K8XA 3C7NA 3FZLA 4Z4HA 4H5NA 4FLVA 4KI4A 4W5QA 2D0CA 3HM8A 1Z05A 4BY9C 3TABA 5EU7A 4M63C 3WEEB 4LF7K 3R9PA 5AZJA 1C1BA 2O8BB 3OYHA 5M1OA 2QM1A 1XWLA 4BVOA 4H4MA 1O13A 1LV5A 4QAGA 4DR4K 4DLEA 1U49A 1UAXA 4DUYK 5BPNA 4CZJA 4YOVA 1HNIA 1VSEA 4PKHA 3QEIA 2F4VK 1NJIO 2RF2A 3AVGA 2F9WA 3BDPA 2GWKA 4DR2K 3KD1E 1KVAA 1OH5A 3C65A 4WCEL 1U48A 4RWTA 1W97L 2PBDA 4LF5K 3C6UA 1BIZA 1YI2N 1KAXA 4WYBA 4HVJA 3QEVA 1VQ7N 3J7YP 1NJXA 3CCQN 4Q0BA 4A5BA 4H5VA 3VEYA 4DQSA 4CEBA 4KTWA 4M7YA 2UUAK 2VGMA 5HP1A 1NK7A 2BE2A 1NGDA 2GEMA 3OYIA 3AVIA 3H3NO 4BRPA 3H1VX 2VWJA 1XUPO 4CJFA 4I7FA 1WSJA 4CJTA 4LD0A 3QESA 1IG8A 1K6YA 1RT6A 3V9ZA 2O8CA 1S6PA 1RDBA 3I33A 2YX6A 1NGHA 2YHYA 3CJ1A 1VQ5N 4BRHA 2YNHA 2AJQA 3WNFA 1NJYA 3A5NC 3CCLN 4NXMK 1YXQA 4CGIA 5JLHA 3OYKA 4J2DA 3CETA 4K41A 4BRAA 4JRPA 4DS5A 4QS7A 3LP0A 1Y97A 3VEXA 2QKKA 4A61A 3HM9A 5J2NA 3PX6A 4FJXA 3V9UA 3MEGA 3O6WA 3UIQA 3IAYA 3ZSYA 3EKUA 1NBWA 1K73O 3EE8A 1VSFA 5BN9A 3NF7A 3FZFA 3T69A 2W6LA 4DKWA 2HHVA 3NHGA 4EFHA 4BACA 2IVNA 4FJ8A 3QB0A 3SQ1A 5AQKA 4DFKA 3HSTB 3EL2A 1TYQB 4E7HA 2RN2A 3KIOA 4MO4A 4B1WB 4KFBA 3DLLL 2XY6A 4V19S 3TPQA 1REVA 4PWDA 2D5RA 3A2FA 1DTTA 3O3GA 3CPEA 3H45C 4LY7A 3VQEA 3A8YA 1L5UA 3LAMA 1NJWA 4YHHK 1Q9XA 4DSFA 4OJRA 4N41A 3K0SA 3ID8A 3LPUA 3TU5A 3RRGA 3ZSRA 1QHTA 2ZF5O 4IEIA 1GLEG 4XH4A 3C6TA 2UUCK 4H03B 4M3UA 1RGIA 4KB0A 1HR0K 2OTJN 2GX9A 5HROA 4FW1A 1VHXA 1NGGA 4ISGA 4EHTA 4DQIA 2AP1A 3LDLA 1DKGD 1J6ZA 2KQ2A 1NK9A 1TAUA 1JXEA 4DU3A 4CW7B 1SL0A 2BGGA 1C0MA 1MWKA 1P8ZA 1SZ2A 5JICA 3TWHA 3NGIA 3D6RA 1BCMA 1WB9A 1RTIA 2G8FA 3C6HA 4BRCA 4DV1K 1QQMA 1RBRA 3A5OC 3AVNA 3WNHA 4YORA 4JI2K 1WAJA 3AVAA 2P9LB 1JCGA 5KI6A 3U4LA 3K9JA 5CZ2A 1JLQA 3TI0A 4HUGA 3KLIA 4E1JA 2VG7A 3ZSVA 4FVMA 1GLLO 3LZJA 3TTDA 5FPEA 1QZ6A 3NF9A 4G9ZA 2E1YA 3FR0A 3R1XA 2D0PA 5HBMA 4DTMA 3AY9A 2HBMA 3VPZA 1NGJA 1RTHA 2UUBK 4JYAK 4DF4A 2D0OA 3HPGA 1SS6A 3OS1A 3TAPA 4OKKA 1DT9A 1WNSA 4CEQA 2P9UB 2Q3SA 3F2KA 3I0RA 3VF6A 1ASUA 1OVYA 1N6QA 4IBNA 3OBWA 3V9XA 5AZJB 4J2EA 1NGCA 3P38A 4FJNA 5AZIB 2A42A 5FPMA 5FPDA 2WTUA 1BI4A 3J7AP 4I6MB 3M6GA 3LWMA 4ICLA 4CZKA 4IFVA 4LH4A 4CJPA 2IIRA 2QI2A 4FLWA 1RT3A 2HMPA 3ISNC 3VQAA 1NU0A 4CZFA 3MCPA 3TAQA 1TGOA 3MDQA 4DSKA 2NUBA 3SQ0A 2DFFA 3OYAA 3SV3A 3K59A 1NKEA 3HT3A 1BL3A 3QEXA 4QCLA 1U2VA 2D4WA 4B3TK 3AVLA 3QBWA 4WFNL 2O8DB 3SUNA 2KTQA 4I9QA 5HOOA 4H0TB 3CHWA 1ASWA 4JV5K 4BGBA 4DG1A 4FJLA 4K43A 4CERA 3VQ9A 3HL8A 4OPJA 3VENA 1ZXOA 4O0JA 2IGIA 5KTQA 1S1TA 3TARA 2Q2RA 3P39A 3DLGA 3ZT3A 5M1QA 2YV0X 3ENBA 4DTPA 3HPOA 3LANA 2KKZA 3MK6A 3PY8A 3ZYYX 3O4NA 3VGMA 3ZETB 1RDWX 1T44A 3KJVA 4L3QA 1NK4A 1JLEA 1EWQA 3NF6A 2G8KA 3SAGA 2O4IA 2HNDA 1JCEA 2RHKA 4Z4CA 4F3OA 3Q7CA 2P9NA 4KHYA 1A5XA 2ZD1A 5A2QO 4B9MA 1ZBIA 3PO4A 2VQFK 2GUPA 4CEAA 1RTDA 3AARA 4JKAA 4R5PA 1WAFA 3HVTA 5BRDA 4EP4A 4A62A 2FBXA 3OS2A 4PA1A 3AO1A 5JMVA 4FJIA 4NCBA 4GV9A 1JL1A 2P9SB 1EKEA 4H0OA 4A59A 3RMBA 1J9AA 4NXNK 1NMDA 5GIPA 3BZKA 2FC0A 4JKGB 1VQLN 5KGXA 1VQPN 2KFNA 1C0TA 1NGBA 5CZ1A 3AO2A 3CXCM 4CJ4A 2XY7A 3VTHA 4O5BA 2O8EA 4Y1CA 4DTXA 1WSFA 1WSIA 3DXMB 5FROA 3LL3A 1YHQN 1W2BM 1EXQA 2O8FA 1S22A 2E2OA 2BANA 3TAFA 3DLRA 3GOIA 4JLHA 3SAFA 1YTUA 4E1NA 3LM2A 4HUFA 1VQMN 2YKNA 4FWOA 3VQCA 3UE5A 3ASMA 2ASPA 4CJQA 3P5JA 3VETA 4CHOA 3T1YK 1X3NA 1YUWA 2DY4A 2FLOA 1DGKN 3IKMA 4B9TA 1Q9YA 3NDKA 4BR2A 2E6LA 4AQYK 4FLTA 3THWA 3WXLA
chains in the Genus database with same CATH topology
4CGJA 4KI6A 4M3XA 1LAWA 3VQBA 1EP4A 1VSIA 2Z1IA 3TAEA 4KO0A 4ELUA 4CGFA 4B9NA 3L8BA 3VN5A 2HHTA 4W5TA 3NCIA 4LSLA 4NYFA 1WN7A 4I2PA 2G8VA 1S9EA 3K5MA 1SUQA 3OS0A 3BGRA 3RR8A 4FM0A 2F8TA 1FXXA 1CZBA 3L2QA 1TK5A 5CY4A 1RNHA 3QIPA 3PO5A 1JXBA 3P1GA 3AVBA 4M45A 1QSYA 1KFSA 4K8XA 3AA2A 3HXMA 4Z4HA 4FLVA 1YTAA 4KI4A 4Z4EA 4PQUA 1T05A 4W5QA 4HUEA 2D0CA 4M3RA 4CJSA 2OPPA 4CHPA 3SQ2A 1T8EA 3CFOA 1NK5A 5C42A 2VG6A 3TABA 5CYMA 3OVNA 1VSJA 5EU7A 1A5WA 3QINA 3ALYA 1JLGA 2KW4A 4CIFA 3NE6A 1UA0A 2P5OA 4CJWA 4C8KA 1BQNA 1B92A 1Q8IA 3SUOA 3O3FA 4CJRA 1C1BA 3MAQA 3DRRA 1DTQA 3C95A 3K5OA 1IH7A 3AVFA 3OYHA 4O55A 4CEOA 3TANA 1XWLA 4H4MA 4E89A 3WNEA 1QS4A 3HP9A 1LV5A 4QAGA 4BWJA 4BE0A 2B5JA 2P51A 1JLAA 3AVHA 1JKHA 1I3AA 3ZSXA 4DLEA 4CFCA 1U49A 4CJ5A 1UAXA 1QE1A 4OKJA 1KLNA 1HNIA 1VSEA 4DQRA 3QEIA 1X9MA 3LP1A 3C94A 4FZZA 1QTMA 1VSMA 2RF2A 3H08A 3ZT4A 3AVGA 3RWUA 3BDPA 1Z25A 2IS3A 3KD1E 1KVAA 1YT3A 4ELTA 3DRSA 1BISA 4RW7A 1TKTA 1S9GA 1U48A 1X9WA 3HP6A 2YNFA 1D8YA 1ZBFA 3IS9A 4F2RA 4I9LA 3C6UA 4OKEA 1BIZA 2XHBA 4OGCA 1X9SA 2Z1HA 5I42A 4HVJA 3F73A 4W5NA 3QEVA 4B9LA 2HHQA 3NH1A 5KGWA 2P1JA 1CXUA 4F3TA 4QOZB 2O4GA 4FJGA 2QKBA 1NJXA 4Q0BA 3LP3A 4AHSA 3D45A 2HMIA 2RPIA 4RG8A 4L8RB 3S3NA 3CG7A 4HHTA 1J54A 1SKWA 1Z26A 4DQSA 3OYLA 1BI4B 1N5YA 4J2BA 1VRTA 2OYQA 3AO4A 3L2UA 2E6MA 3DI6A 1W9HA 1JL2A 1WSEA 5HRPA 3OYFA 3CQ8A 4DTNA 4CEBA 4W5OA 4KTWA 1WLJA 3KTQA 2OPRA 3QIOA 5HP1A 1NK7A 2BE2A 1QSLA 3K5NA 2D0BA 3SPYA 3DOKA 3OYIA 5C25A 3AVIA 3AVKA 4DU4A 3VQ5A 3SUQA 4DTJA 3SI6A 4CK2A 2VWJA 4CJFA 4I7FA 1WSJA 4CJTA 4LD0A 2A1SA 4DWIA 3QESA 4F4KA 4EZ6A 3V9WA 4DSEA 5FRMA 1K6YA 2FBYA 4N47A 1RT6A 4CEEA 1SKRA 3V9ZA 4DFPA 4FK0A 3ZT1A 4M3ZA 2P5GA 3AVMA 1S6PA 4B8AB 3V4IA 1RDBA 4FLUA 4DQPA 4CECA 3S9HA 4FLYA 4N5SA 2R7YA 5D3GA 4NCAA 2YNHA 4CGGA 2W42A 2AJQA 3WNFA 1NJYA 4DSJA 2KZZA 4CEZA 1JLBA 4CGIA 3DLHA 1B9DA 4IG3A 3OYKA 2PYLA 4J2DA 4JRPA 5T7BA 4DS5A 1NKBA 3LP0A 2PYJA 1Y97A 2YHAA 4FW2A 4DTSA 4ELVA 2QKKA 1S1WA 4KHUA 2ITGA 3ZSOA 3ZSQA 1X1PA 4RW6A 2HB5A 4C8NA 3HM9A 2IAJA 5J2NA 4FZXC 4ZHRA 4FJKA 1FKPA 3PX6A 4FJXA 4CIEA 3MEGA 5KRTA 3V9UA 5HRSA 3UIQA 4DFJA 1VK0A 3IAYA 4FJHA 3ZSYA 1IKYA 1SKSA 1D9FA 3CM6A 2DFHA 3SNNA 4E0DA 4CF2A 1VSFA 4DU1A 5FDLA 3SZ2A 3T19A 4N56A 2EHGA 3K57A 3NF7A 3S3MA 1L3SA 4C8LA 2XO7A 1RDCA 1XHZA 2D0AA 2HHWA 4ID1A 4ZTJA 2HHVA 3NHGA 2IOCA 3NF8A 3RMCA 4BACA 4MFBA 4OVLA 5J2PA 4E7KA 4E7IA 4FJ8A 4CJUA 2Y1IA 4CJVA 4FK4A 3SQ1A 4BDZA 4AH9A 4DFKA 3HSTB 3HO1A 3MXJA 4E7HA 2RN2A 3L3VA 3KIOA 4CK3A 3VQDA 3TAMA 1RT1A 2XY6A 4KFBA 1I39A 1QQCA 4FYDA 2Z1JA 4F8RA 1B9FA 1RBVA 2G8WA 4Z4GA 4CFDA 1REVA 2VG5A 3G0ZA 3JSMA 1QSSA 3KKRA 4KV8A 1ITGA 4IKFA 4CE9A 1LWEA 2YNGA 4PWDA 2D5RA 3A2FA 1DTTA 3AVCA 3CM5A 3HPHA 1W0HA 3O3GA 3DRPA 3WNGA 1D9DA 4LY7A 3VQEA 1CXQA 4DFMA 4CESA 1L5UA 3I8DA 4CF9A 3SJJA 3LAMA 4NYNA 3M8QA 1NJWA 4DSIA 3OY9A 3LALA 2F96A 1TL1A 4JRQA 1Q9XA 4DSFA 1GOBA 4OJRA 1J5OA 4N41A 1EETA 5JS2A 3THVA 1C0UA 3LPUA 3L3UA 3RRGA 3M8SA 3T3FA 2E4LA 3ZSRA 3OYCA 1TK8A 4IDKA 1HQUA 1KCFA 2ZE2A 1QHTA 3ZCMA 3AVJA 3MXMA 4FK2A 3C6TA 2QXFA 4J2AA 3NFAA 4DLGA 4M3UA 3L2RA 2BDPA 4KB0A 4FM2A 3B6OA 4AILC 2EX3A 4MQ3A 5HROA 1L3TA 2HHUA 4FW1A 4FJJA 4CIGA 2B6AA 3DLKA 1HQEA 4B08A 4DQIA 3SQ4A 1TL3A 2WONA 1U4BA 4M41A 2B4JA 4CEFA 1RBSA 3QEPA 5DMRA 3KLHA 2KQ2A 3LPTA 4E19A 3V81A 4CEDA 1NK9A 4CHQA 1TAUA 1JXEA 4DU3A 4OLBA 3DM2A 1U04A 1WSGA 4FJ7A 2F8SA 2ZQBA 3DLEA 4YFUA 1SL0A 4DQQA 4RW4A 4BE1A 2BGGA 1C0MA 5HLFA 3S3OA 1J53A 3ULDA 4CF1A 2PY5A 3TWHA 1NOYA 3NGIA 3ITHA 1BCMA 1S1UA 2WOMA 4CJ3A 1RTIA 3VQQA 2G8FA 4KHQA 4O0IA 1TKZA 1NKCA 3QLHA 1RT4A 1C6VA 1LAVA 5KRSA 1UA1A 2OA8A 4BDYA 4KREA 1RT5A 2X6SA 1RBRA 2OPSA 1FK9A 3AVNA 3NAEA 3KLFA 3B6PA 3WNHA 3VA3A 3NH0A 1T03A 3K58A 1SL2A 1CZ9A 3QERA 1WAJA 3AVAA 1BCOA 3MXIA 3RTVA 4DTUA 4KHNA 4M3WA 3QO9A 5KI6A 3OYDA 3ZSZA 1FKOA 4Z4IA 3DMJA 4O4GA 2PZSA 2G8UA 5CZ2A 1RILA 5E41A 4GMJB 4OLAA 4KHSA 1JLQA 3TI0A 4HUGA 3KLIA 4B9VA 3AV9A 2VG7A 3V1RA 1F21A 3ZSVA 4FVMA 3KKSA 1RBTA 4CCHA 3LZJA 2OZSA 3NF9A 3O4QA 2Z1GA 4FZYA 1WSHA 1HNVA 4H4OA 1S1VA 5HBMA 3DOLA 4C8MA 4YNQA 4DTMA 4TSXA 1RTHA 4DF4A 2LSNA 3PUFA 3HPGA 2XY5A 3U3YA 3OS1A 3TAPA 4CFAA 4M42A 1KVCA 4OKKA 1NOZA 1WNSA 4CEQA 4FJ5A 4FJMA 3IRXA 2YHBA 4LSNA 2Q3SA 1C1AA 3I0RA 1C1CA 3KK2A 3NGYA 4OPKA 4E7JA 2OZMA 2YNIA 1L3VA 1ASUA 3HJFA 2IC3A 1HYVA 1HYZA 1XI1A 3AO5A 4IBNA 1N6QA 3V9XA 4J2EA 5K14A 3EZ5A 4KKOA 4CK1A 5J2QA 4FJNA 4IG0A 2KZMA 4XIUA 5I3UA 3VA0A 3VQ8A 4AHVA 4O44A 1BI4A 4RW9A 1TVRA 3MEDA 3LWMA 2I5JA 4ICLA 3LP2A 4IFVA 1TV6A 3MECA 1HYSA 1JLFA 4LH4A 1LWFA 4CJPA 4F2SA 4DS4A 4AHCA 4FLWA 1RT3A 3HK2A 4WE1A 3ISNC 3VQAA 1ZBUA 4CJEA 3KK1A 3RR7A 3P83D 1NK6A 1RBUA 4CHNA 5JS1A 3RRHA 4CJLA 2ATQA 3LDSA 1TGOA 4JS4A 3L2WA 3TAQA 1S1XA 2NUBA 4FCYA 3SQ0A 2DFFA 2ETJA 3OYAA 1HJRA 3K59A 3SV3A 3V9SA 4DF8A 1HPZA 3U3GA 3HT3A 1NKEA 1BL3A 3F9KA 3O3HA 1YVUA 4JS5A 3QEXA 4NCGA 4QCLA 2GV9A 4DTOA 3AVLA 4M3TA 3QNOA 3PX0A 1RCHA 3ZSWA 3KLEA 4N76A 3NGZA 3SCXA 1D5AA 1LWCA 2IDOA 2HVHA 1TK0A 3SUNA 2KTQA 4I9QA 3KD5E 3KLGA 4DMNA 4PUOA 4IFYA 4M3YA 2HVIA 1T7PA 1UWBA 4CHZA 5C24A 4CHYA 1ASWA 3RMAA 1TKDA 3QEWA 1G15A 1LW2A 3SYZA 3MEEA 4DG1A 1GOCA 4FJLA 3OYNA 4CERA 3SV4A 3VQ9A 3HL8A 4OPJA 4CF0A 4HTUA 1IO2A 3V1OA 3ZT0A 4O0JA 4FM1A 1NJZA 1BIUA 2IGIA 3AA5X 2FBTA 5KTQA 4UQGA 1S1TA 1S6QA 1IKXA 4AHUA 3TARA 1VRUA 3OYGA 1KLMA 3DLGA 3JYTA 3IG1A 1VSLA 3OJUA 3ZT3A 4FJ9A 1R0AA 3VQ7A 5SWMA 2QK9A 3FFIA 1KRPA 4GW6A 2YV0X 4DSKA 4DTPA 4PY5A 3HPOA 3SPZA 3LANA 1ZYQA 5HRNA 3L2VA 3EYZA 4LH5A 1KFDA 1TAQA 3PY8A 2GUIA 3O4NA 1HRHA 4AHTA 1IKVA 1LW0A 3OJSA 4G1QA 4C8OA 3KJVA 3DLBA 4HCCA 1S5JA 1NK4A 1JLEA 4E3SA 3G10A 3NF6A 2G8KA 2YKMA 1VSHA 1SV5A 2O4IA 4W5RA 2DFEA 2HNDA 3KK3A 2HNZA 3AA3A 3I0SA 1RDDA 4Z4CA 4B9UA 4F3OA 1TKXA 1A5XA 2ZD1A 4H8KA 4BWMA 4E7LA 4KHYA 4B9MA 1ZBIA 3CYMA 3PO4A 3VQ6A 4KRFA 2A1RA 1VSDA 4CEAA 1RTDA 3OYMA 4B9SA 4ID5A 4KHWA 3HVRA 4HCBA 4KTZA 5HRRA 4R5PA 4DSLA 4CGDA 3OYEA 1RTJA 1DLOA 4ZTFA 1WAFA 2OPQA 3VQ4A 3HVTA 2X6NA 4EP4A 1IKWA 4Q5VA 4EZ9A 2FBXA 3T1AA 2XY8A 3OS2A 3V1QA 3RMDA 4PA1A 1VSKA 1HMVA 3AO1A 1KTQA 1XHXA 3DYAA 3QNNA 1ZBLA 4FJIA 4NCBA 2HHXA 4FLZA 2GBZA 4B3OA 2VWKA 4I2QA 1JL1A 3PV8A 1RT2A 1EKEA 5J2MA 1XC9A 4CFBA 1U45A 1NK0A 1BQMA 3RMBA 2RKIA 3LAKA 1J9AA 4BE2A 3V6DA 1O1WA 3CFPA 2HHSA 1NK8A 2FC0A 1KVBA 2KFNA 5KGXA 4AHRA 4KTQA 1C0TA 3HYFA 5CYQA 2X78A 1GOAA 5CZ1A 3VQPA 3EY1A 1ZBHA 3E01A 4K8ZA 3AO2A 4B8CA 1A5VA 5J1EA 4KPYA 4CJ4A 2XY7A 4Z4FA 4EP5A 3QETA 3ZT2A 4O5BA 2DTUA 3D0PA 4Y1CA 1JLCA 4DTXA 3AA4A 1WSFA 1EX4A 1WSIA 5FROA 4CJKA 1IG9A 3OYBA 4Y1DA 3CFRA 4KAZA 4FXDA 3U6FA 1EXQA 1MU2A 1KSPA 2BANA 3K5LA 3TAFA 2HW3A 3TAGA 3NBPA 3LWLA 4CGHA 3OYJA 3DLRA 2XRIA 2KFZA 4JLHA 2X74A 1YTUA 4E1NA 1RT7A 3SUPA 2FBVA 4FLXA 4GVMA 1L3UA 4HUFA 3K2PA 5FRNA 1SL1A 2YKNA 1CLQA 3VQCA 5SZTA 4OGEA 4RW8A 4DTRA 4KB1A 1U47A 3ASMA 1BGXT 4CJQA 4CF8A 4E1MA 3NH2A 3LZIA 3AO3A 3P5JA 2JGUA 5DK5A 3TR8A 4CHOA 1UOCA 3PX4A 1RDAA 2DY4A 1ASVA 1BHLA 2G8HA 4B9TA 1Q9YA 3NDKA 4Z0UA 2HNYA 3M8RA 4BDPA 2JLEA 2E6LA 4FLTA 2G8IA 2Y1JA 3M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGJ A;  4KI6 A;  4M3X A;  1LAW A;  3VQB A;  1EP4 A;  1VSI A;  2Z1I A;  3TAE A;  4KO0 A;  4ELU A;  4CGF A;  4B9N A;  3L8B A;  3VN5 A;  2HHT A;  4W5T A;  3NCI A;  4LSL A;  4NYF A;  1WN7 A;  4I2P A;  2G8V A;  1S9E A;  3K5M A;  1SUQ A;  3OS0 A;  3BGR A;  3RR8 A;  4FM0 A;  2F8T A;  1FXX A;  1CZB A;  3L2Q A;  1TK5 A;  5CY4 A;  1RNH A;  3QIP A;  3PO5 A;  1JXB A;  3P1G A;  3AVB A;  4M45 A;  1QSY A;  1KFS A;  4K8X A;  3AA2 A;  3HXM A;  4Z4H A;  4FLV A;  1YTA A;  4KI4 A;  4Z4E A;  4PQU A;  1T05 A;  4W5Q A;  4HUE A;  2D0C A;  4M3R A;  4CJS A;  2OPP A;  4CHP A;  3SQ2 A;  1T8E A;  3CFO A;  1NK5 A;  5C42 A;  2VG6 A;  3TAB A;  5CYM A;  3OVN A;  1VSJ A;  5EU7 A;  1A5W A;  3QIN A;  3ALY A;  1JLG A;  2KW4 A;  4CIF A;  3NE6 A;  1UA0 A;  2P5O A;  4CJW A;  4C8K A;  1BQN A;  1B92 A;  1Q8I A;  3SUO A;  3O3F A;  4CJR A;  1C1B A;  3MAQ A;  3DRR A;  1DTQ A;  3C95 A;  3K5O A;  1IH7 A;  3AVF A;  3OYH A;  4O55 A;  4CEO A;  3TAN A;  1XWL A;  4H4M A;  4E89 A;  3WNE A;  1QS4 A;  3HP9 A;  1LV5 A;  4QAG A;  4BWJ A;  4BE0 A;  2B5J A;  2P51 A;  1JLA A;  3AVH A;  1JKH A;  1I3A A;  3ZSX A;  4DLE A;  4CFC A;  1U49 A;  4CJ5 A;  1UAX A;  1QE1 A;  4OKJ A;  1KLN A;  1HNI A;  1VSE A;  4DQR A;  3QEI A;  1X9M A;  3LP1 A;  3C94 A;  4FZZ A;  1QTM A;  1VSM A;  2RF2 A;  3H08 A;  3ZT4 A;  3AVG A;  3RWU A;  3BDP A;  1Z25 A;  2IS3 A;  3KD1 E;  1KVA A;  1YT3 A;  4ELT A;  3DRS A;  1BIS A;  4RW7 A;  1TKT A;  1S9G A;  1U48 A;  1X9W A;  3HP6 A;  2YNF A;  1D8Y A;  1ZBF A;  3IS9 A;  4F2R A;  4I9L A;  3C6U A;  4OKE A;  1BIZ A;  2XHB A;  4OGC A;  1X9S A;  2Z1H A;  5I42 A;  4HVJ A;  3F73 A;  4W5N A;  3QEV A;  4B9L A;  2HHQ A;  3NH1 A;  5KGW A;  2P1J A;  1CXU A;  4F3T A;  4QOZ B;  2O4G A;  4FJG A;  2QKB A;  1NJX A;  4Q0B A;  3LP3 A;  4AHS A;  3D45 A;  2HMI A;  2RPI A;  4RG8 A;  4L8R B;  3S3N A;  3CG7 A;  4HHT A;  1J54 A;  1SKW A;  1Z26 A;  4DQS A;  3OYL A;  1BI4 B;  1N5Y A;  4J2B A;  1VRT A;  2OYQ A;  3AO4 A;  3L2U A;  2E6M A;  3DI6 A;  1W9H A;  1JL2 A;  1WSE A;  5HRP A;  3OYF A;  3CQ8 A;  4DTN A;  4CEB A;  4W5O A;  4KTW A;  1WLJ A;  3KTQ A;  2OPR A;  3QIO A;  5HP1 A;  1NK7 A;  2BE2 A;  1QSL A;  3K5N A;  2D0B A;  3SPY A;  3DOK A;  3OYI A;  5C25 A;  3AVI A;  3AVK A;  4DU4 A;  3VQ5 A;  3SUQ A;  4DTJ A;  3SI6 A;  4CK2 A;  2VWJ A;  4CJF A;  4I7F A;  1WSJ A;  4CJT A;  4LD0 A;  2A1S A;  4DWI A;  3QES A;  4F4K A;  4EZ6 A;  3V9W A;  4DSE A;  5FRM A;  1K6Y A;  2FBY A;  4N47 A;  1RT6 A;  4CEE A;  1SKR A;  3V9Z A;  4DFP A;  4FK0 A;  3ZT1 A;  4M3Z A;  2P5G A;  3AVM A;  1S6P A;  4B8A B;  3V4I A;  1RDB A;  4FLU A;  4DQP A;  4CEC A;  3S9H A;  4FLY A;  4N5S A;  2R7Y A;  5D3G A;  4NCA A;  2YNH A;  4CGG A;  2W42 A;  2AJQ A;  3WNF A;  1NJY A;  4DSJ A;  2KZZ A;  4CEZ A;  1JLB A;  4CGI A;  3DLH A;  1B9D A;  4IG3 A;  3OYK A;  2PYL A;  4J2D A;  4JRP A;  5T7B A;  4DS5 A;  1NKB A;  3LP0 A;  2PYJ A;  1Y97 A;  2YHA A;  4FW2 A;  4DTS A;  4ELV A;  2QKK A;  1S1W A;  4KHU A;  2ITG A;  3ZSO A;  3ZSQ A;  1X1P A;  4RW6 A;  2HB5 A;  4C8N A;  3HM9 A;  2IAJ A;  5J2N A;  4FZX C;  4ZHR A;  4FJK A;  1FKP A;  3PX6 A;  4FJX A;  4CIE A;  3MEG A;  5KRT A;  3V9U A;  5HRS A;  3UIQ A;  4DFJ A;  1VK0 A;  3IAY A;  4FJH A;  3ZSY A;  1IKY A;  1SKS A;  1D9F A;  3CM6 A;  2DFH A;  3SNN A;  4E0D A;  4CF2 A;  1VSF A;  4DU1 A;  5FDL A;  3SZ2 A;  3T19 A;  4N56 A;  2EHG A;  3K57 A;  3NF7 A;  3S3M A;  1L3S A;  4C8L A;  2XO7 A;  1RDC A;  1XHZ A;  2D0A A;  2HHW A;  4ID1 A;  4ZTJ A;  2HHV A;  3NHG A;  2IOC A;  3NF8 A;  3RMC A;  4BAC A;  4MFB A;  4OVL A;  5J2P A;  4E7K A;  4E7I A;  4FJ8 A;  4CJU A;  2Y1I A;  4CJV A;  4FK4 A;  3SQ1 A;  4BDZ A;  4AH9 A;  4DFK A;  3HST B;  3HO1 A;  3MXJ A;  4E7H A;  2RN2 A;  3L3V A;  3KIO A;  4CK3 A;  3VQD A;  3TAM A;  1RT1 A;  2XY6 A;  4KFB A;  1I39 A;  1QQC A;  4FYD A;  2Z1J A;  4F8R A;  1B9F A;  1RBV A;  2G8W A;  4Z4G A;  4CFD A;  1REV A;  2VG5 A;  3G0Z A;  3JSM A;  1QSS A;  3KKR A;  4KV8 A;  1ITG A;  4IKF A;  4CE9 A;  1LWE A;  2YNG A;  4PWD A;  2D5R A;  3A2F A;  1DTT A;  3AVC A;  3CM5 A;  3HPH A;  1W0H A;  3O3G A;  3DRP A;  3WNG A;  1D9D A;  4LY7 A;  3VQE A;  1CXQ A;  4DFM A;  4CES A;  1L5U A;  3I8D A;  4CF9 A;  3SJJ A;  3LAM A;  4NYN A;  3M8Q A;  1NJW A;  4DSI A;  3OY9 A;  3LAL A;  2F96 A;  1TL1 A;  4JRQ A;  1Q9X A;  4DSF A;  1GOB A;  4OJR A;  1J5O A;  4N41 A;  1EET A;  5JS2 A;  3THV A;  1C0U A;  3LPU A;  3L3U A;  3RRG A;  3M8S A;  3T3F A;  2E4L A;  3ZSR A;  3OYC A;  1TK8 A;  4IDK A;  1HQU A;  1KCF A;  2ZE2 A;  1QHT A;  3ZCM A;  3AVJ A;  3MXM A;  4FK2 A;  3C6T A;  2QXF A;  4J2A A;  3NFA A;  4DLG A;  4M3U A;  3L2R A;  2BDP A;  4KB0 A;  4FM2 A;  3B6O A;  4AIL C;  2EX3 A;  4MQ3 A;  5HRO A;  1L3T A;  2HHU A;  4FW1 A;  4FJJ A;  4CIG A;  2B6A A;  3DLK A;  1HQE A;  4B08 A;  4DQI A;  3SQ4 A;  1TL3 A;  2WON A;  1U4B A;  4M41 A;  2B4J A;  4CEF A;  1RBS A;  3QEP A;  5DMR A;  3KLH A;  2KQ2 A;  3LPT A;  4E19 A;  3V81 A;  4CED A;  1NK9 A;  4CHQ A;  1TAU A;  1JXE A;  4DU3 A;  4OLB A;  3DM2 A;  1U04 A;  1WSG A;  4FJ7 A;  2F8S A;  2ZQB A;  3DLE A;  4YFU A;  1SL0 A;  4DQQ A;  4RW4 A;  4BE1 A;  2BGG A;  1C0M A;  5HLF A;  3S3O A;  1J53 A;  3ULD A;  4CF1 A;  2PY5 A;  3TWH A;  1NOY A;  3NGI A;  3ITH A;  1BCM A;  1S1U A;  2WOM A;  4CJ3 A;  1RTI A;  3VQQ A;  2G8F A;  4KHQ A;  4O0I A;  1TKZ A;  1NKC A;  3QLH A;  1RT4 A;  1C6V A;  1LAV A;  5KRS A;  1UA1 A;  2OA8 A;  4BDY A;  4KRE A;  1RT5 A;  2X6S A;  1RBR A;  2OPS A;  1FK9 A;  3AVN A;  3NAE A;  3KLF A;  3B6P A;  3WNH A;  3VA3 A;  3NH0 A;  1T03 A;  3K58 A;  1SL2 A;  1CZ9 A;  3QER A;  1WAJ A;  3AVA A;  1BCO A;  3MXI A;  3RTV A;  4DTU A;  4KHN A;  4M3W A;  3QO9 A;  5KI6 A;  3OYD A;  3ZSZ A;  1FKO A;  4Z4I A;  3DMJ A;  4O4G A;  2PZS A;  2G8U A;  5CZ2 A;  1RIL A;  5E41 A;  4GMJ B;  4OLA A;  4KHS A;  1JLQ A;  3TI0 A;  4HUG A;  3KLI A;  4B9V A;  3AV9 A;  2VG7 A;  3V1R A;  1F21 A;  3ZSV A;  4FVM A;  3KKS A;  1RBT A;  4CCH A;  3LZJ A;  2OZS A;  3NF9 A;  3O4Q A;  2Z1G A;  4FZY A;  1WSH A;  1HNV A;  4H4O A;  1S1V A;  5HBM A;  3DOL A;  4C8M A;  4YNQ A;  4DTM A;  4TSX A;  1RTH A;  4DF4 A;  2LSN A;  3PUF A;  3HPG A;  2XY5 A;  3U3Y A;  3OS1 A;  3TAP A;  4CFA A;  4M42 A;  1KVC A;  4OKK A;  1NOZ A;  1WNS A;  4CEQ A;  4FJ5 A;  4FJM A;  3IRX A;  2YHB A;  4LSN A;  2Q3S A;  1C1A A;  3I0R A;  1C1C A;  3KK2 A;  3NGY A;  4OPK A;  4E7J A;  2OZM A;  2YNI A;  1L3V A;  1ASU A;  3HJF A;  2IC3 A;  1HYV A;  1HYZ A;  1XI1 A;  3AO5 A;  4IBN A;  1N6Q A;  3V9X A;  4J2E A;  5K14 A;  3EZ5 A;  4KKO A;  4CK1 A;  5J2Q A;  4FJN A;  4IG0 A;  2KZM A;  4XIU A;  5I3U A;  3VA0 A;  3VQ8 A;  4AHV A;  4O44 A;  1BI4 A;  4RW9 A;  1TVR A;  3MED A;  3LWM A;  2I5J A;  4ICL A;  3LP2 A;  4IFV A;  1TV6 A;  3MEC A;  1HYS A;  1JLF A;  4LH4 A;  1LWF A;  4CJP A;  4F2S A;  4DS4 A;  4AHC A;  4FLW A;  1RT3 A;  3HK2 A;  4WE1 A;  3ISN C;  3VQA A;  1ZBU A;  4CJE A;  3KK1 A;  3RR7 A;  3P83 D;  1NK6 A;  1RBU A;  4CHN A;  5JS1 A;  3RRH A;  4CJL A;  2ATQ A;  3LDS A;  1TGO A;  4JS4 A;  3L2W A;  3TAQ A;  1S1X A;  2NUB A;  4FCY A;  3SQ0 A;  2DFF A;  2ETJ A;  3OYA A;  1HJR A;  3K59 A;  3SV3 A;  3V9S A;  4DF8 A;  1HPZ A;  3U3G A;  3HT3 A;  1NKE A;  1BL3 A;  3F9K A;  3O3H A;  1YVU A;  4JS5 A;  3QEX A;  4NCG A;  4QCL A;  2GV9 A;  4DTO A;  3AVL A;  4M3T A;  3QNO A;  3PX0 A;  1RCH A;  3ZSW A;  3KLE A;  4N76 A;  3NGZ A;  3SCX A;  1D5A A;  1LWC A;  2IDO A;  2HVH A;  1TK0 A;  3SUN A;  2KTQ A;  4I9Q A;  3KD5 E;  3KLG A;  4DMN A;  4PUO A;  4IFY A;  4M3Y A;  2HVI A;  1T7P A;  1UWB A;  4CHZ A;  5C24 A;  4CHY A;  1ASW A;  3RMA A;  1TKD A;  3QEW A;  1G15 A;  1LW2 A;  3SYZ A;  3MEE A;  4DG1 A;  1GOC A;  4FJL A;  3OYN A;  4CER A;  3SV4 A;  3VQ9 A;  3HL8 A;  4OPJ A;  4CF0 A;  4HTU A;  1IO2 A;  3V1O A;  3ZT0 A;  4O0J A;  4FM1 A;  1NJZ A;  1BIU A;  2IGI A;  3AA5 X;  2FBT A;  5KTQ A;  4UQG A;  1S1T A;  1S6Q A;  1IKX A;  4AHU A;  3TAR A;  1VRU A;  3OYG A;  1KLM A;  3DLG A;  3JYT A;  3IG1 A;  1VSL A;  3OJU A;  3ZT3 A;  4FJ9 A;  1R0A A;  3VQ7 A;  5SWM A;  2QK9 A;  3FFI A;  1KRP A;  4GW6 A;  2YV0 X;  4DSK A;  4DTP A;  4PY5 A;  3HPO A;  3SPZ A;  3LAN A;  1ZYQ A;  5HRN A;  3L2V A;  3EYZ A;  4LH5 A;  1KFD A;  1TAQ A;  3PY8 A;  2GUI A;  3O4N A;  1HRH A;  4AHT A;  1IKV A;  1LW0 A;  3OJS A;  4G1Q A;  4C8O A;  3KJV A;  3DLB A;  4HCC A;  1S5J A;  1NK4 A;  1JLE A;  4E3S A;  3G10 A;  3NF6 A;  2G8K A;  2YKM A;  1VSH A;  1SV5 A;  2O4I A;  4W5R A;  2DFE A;  2HND A;  3KK3 A;  2HNZ A;  3AA3 A;  3I0S A;  1RDD A;  4Z4C A;  4B9U A;  4F3O A;  1TKX A;  1A5X A;  2ZD1 A;  4H8K A;  4BWM A;  4E7L A;  4KHY A;  4B9M A;  1ZBI A;  3CYM A;  3PO4 A;  3VQ6 A;  4KRF A;  2A1R A;  1VSD A;  4CEA A;  1RTD A;  3OYM A;  4B9S A;  4ID5 A;  4KHW A;  3HVR A;  4HCB A;  4KTZ A;  5HRR A;  4R5P A;  4DSL A;  4CGD A;  3OYE A;  1RTJ A;  1DLO A;  4ZTF A;  1WAF A;  2OPQ A;  3VQ4 A;  3HVT A;  2X6N A;  4EP4 A;  1IKW A;  4Q5V A;  4EZ9 A;  2FBX A;  3T1A A;  2XY8 A;  3OS2 A;  3V1Q A;  3RMD A;  4PA1 A;  1VSK A;  1HMV A;  3AO1 A;  1KTQ A;  1XHX A;  3DYA A;  3QNN A;  1ZBL A;  4FJI A;  4NCB A;  2HHX A;  4FLZ A;  2GBZ A;  4B3O A;  2VWK A;  4I2Q A;  1JL1 A;  3PV8 A;  1RT2 A;  1EKE A;  5J2M A;  1XC9 A;  4CFB A;  1U45 A;  1NK0 A;  1BQM A;  3RMB A;  2RKI A;  3LAK A;  1J9A A;  4BE2 A;  3V6D A;  1O1W A;  3CFP A;  2HHS A;  1NK8 A;  2FC0 A;  1KVB A;  2KFN A;  5KGX A;  4AHR A;  4KTQ A;  1C0T A;  3HYF A;  5CYQ A;  2X78 A;  1GOA A;  5CZ1 A;  3VQP A;  3EY1 A;  1ZBH A;  3E01 A;  4K8Z A;  3AO2 A;  4B8C A;  1A5V A;  5J1E A;  4KPY A;  4CJ4 A;  2XY7 A;  4Z4F A;  4EP5 A;  3QET A;  3ZT2 A;  4O5B A;  2DTU A;  3D0P A;  4Y1C A;  1JLC A;  4DTX A;  3AA4 A;  1WSF A;  1EX4 A;  1WSI A;  5FRO A;  4CJK A;  1IG9 A;  3OYB A;  4Y1D A;  3CFR A;  4KAZ A;  4FXD A;  3U6F A;  1EXQ A;  1MU2 A;  1KSP A;  2BAN A;  3K5L A;  3TAF A;  2HW3 A;  3TAG A;  3NBP A;  3LWL A;  4CGH A;  3OYJ A;  3DLR A;  2XRI A;  2KFZ A;  4JLH A;  2X74 A;  1YTU A;  4E1N A;  1RT7 A;  3SUP A;  2FBV A;  4FLX A;  4GVM A;  1L3U A;  4HUF A;  3K2P A;  5FRN A;  1SL1 A;  2YKN A;  1CLQ A;  3VQC A;  5SZT A;  4OGE A;  4RW8 A;  4DTR A;  4KB1 A;  1U47 A;  3ASM A;  1BGX T;  4CJQ A;  4CF8 A;  4E1M A;  3NH2 A;  3LZI A;  3AO3 A;  3P5J A;  2JGU A;  5DK5 A;  3TR8 A;  4CHO A;  1UOC A;  3PX4 A;  1RDA A;  2DY4 A;  1ASV A;  1BHL A;  2G8H A;  4B9T A;  1Q9Y A;  3NDK A;  4Z0U A;  2HNY A;  3M8R A;  4BDP A;  2JLE A;  2E6L A;  4FLT A;  2G8I A;  2Y1J A;  3M8P A; 
#chains in the Genus database with same CATH topology
 4CGJ A;  4FWS A;  3F5T A;  4CZE A;  4B1V A;  4FPB A;  3VN5 A;  4W5T A;  4NYF A;  3SBT A;  1WN7 A;  5M1F A;  4QS8 A;  5LMU K;  3K5M A;  2QWM A;  2EWS A;  3RR8 A;  4FM0 A;  2A40 A;  1JXB A;  3P1G A;  2P9I A;  3AVB A;  4M45 A;  1Q18 A;  2NRV A;  4CBW A;  1T05 A;  3EKS A;  4HUE A;  3JAM O;  3ZLJ A;  2OPP A;  4CHP A;  3SQ2 A;  1T8E A;  1NK5 A;  2VG6 A;  1VSJ A;  5CE3 A;  4CIF A;  2P5O A;  3ALY A;  5ELZ A;  3NE6 A;  4CJW A;  1B92 A;  4BC2 A;  4IO9 L;  3MAQ A;  3FFK B;  4DR1 K;  2NLX A;  3VEW A;  3TAN A;  4GKJ K;  5HL7 L;  3M1F A;  4JK9 A;  3WNE A;  4BE0 A;  2B5J A;  2P51 A;  3AVH A;  1I3A A;  4CFC A;  4YY3 K;  4CJ5 A;  1QE1 A;  1KLN A;  2NRX A;  1VSM A;  5GAG P;  3RWU A;  2IS3 A;  1HKG A;  4IJN A;  5ADX H;  3FZM A;  1QQN A;  3BF3 A;  4ELT A;  1BIS A;  3VGK A;  3H3O B;  1X9W A;  3L6Q A;  5H1S Q;  1ZBF A;  4F2R A;  2P9P A;  1HNW K;  4JNE A;  4FPA A;  4CBX A;  3FZK A;  5TKW A;  4B3M K;  2P1J A;  3UKR B;  1CXU A;  5I9E B;  4BRQ A;  4FJG A;  5AQU A;  4X62 K;  1S72 N;  4AHS A;  2HMI A;  3MX2 A;  5AQV A;  3Q7B A;  4HHT A;  1J54 A;  1SKW A;  1BI4 B;  1SAZ A;  2E6M A;  1W9H A;  1JL2 A;  5HRP A;  3CQ8 A;  4DTN A;  3QIO A;  2D0B A;  3SPY A;  3DOK A;  2NRZ A;  5C25 A;  5AQI A;  3AVK A;  5F0X A;  4DU4 A;  4XEI A;  3SUQ A;  2H3G X;  4LF6 K;  3HBT A;  2FSN A;  2A1S A;  3KK7 A;  3LDO A;  2A6A A;  4EZ6 A;  4F4K A;  4DSE A;  3H6E A;  2QWR A;  4N47 A;  4YOW A;  4DCH A;  4B8A B;  3V4I A;  3ULE B;  4DV2 K;  1WOQ A;  4FLU A;  2UXD K;  3O9U A;  4N5S A;  1QVF M;  5D3G A;  4JK8 A;  1XNQ K;  4CGG A;  1HX1 A;  4DSJ A;  4DV6 K;  2KZZ A;  4CEZ A;  3DLH A;  1B9D A;  4IG3 A;  2ASO A;  1NKB A;  3GG4 A;  3HRG A;  4DTS A;  1S1W A;  5E84 A;  3ZSO A;  1X1P A;  4RW6 A;  4C8N A;  3UKU A;  1G99 A;  4FZX C;  4BQL A;  3RSE A;  5AQM A;  2NRH A;  2DFH A;  3WQT A;  4DU1 A;  3CCJ N;  4N56 A;  2EHG A;  5GAH P;  3K57 A;  1L3S A;  2XO7 A;  3OW2 M;  2D0A A;  4ID1 A;  3O1W A;  1K8K B;  4OVL A;  4CJU A;  1IBK K;  4FWL A;  4BRG A;  3WUH A;  2P9N B;  3VQD A;  4JI8 K;  1HKB A;  2Z1J A;  3DXK A;  1BU6 O;  1B9F A;  1K9M O;  4F8R A;  4CFD A;  2VG5 A;  1QSS A;  4KV8 A;  4CE9 A;  1LWE A;  4OPH A;  3DRP A;  4GY2 B;  1D9D A;  4GVE A;  4DFM A;  4CES A;  1ILY A;  4IEE A;  3M8Q A;  1KAZ A;  3CC4 N;  1J5O A;  1IBL K;  2CGJ A;  3NVM A;  2E4L A;  1TK8 A;  4GV3 A;  4CVN E;  3MXM A;  3L2R A;  2EX3 A;  4MQ3 A;  2HHU A;  4CIG A;  1HJO A;  4B08 A;  5BR8 K;  3ATV A;  3EZW A;  3SLC A;  1KC8 O;  4M41 A;  3VF2 A;  3CCR N;  2O8E B;  5EOY A;  2E2N A;  1RDU A;  4JD2 B;  4CED A;  3KWI A;  4CHQ A;  1WSG A;  4YOX A;  2F8S A;  2Q31 A;  2ZQB A;  3DLE A;  4YFU A;  4JI7 K;  4DQQ A;  3S3O A;  4KH4 A;  3ULD A;  4JI0 K;  4JN4 A;  1S1U A;  2WOM A;  4KHQ A;  3QLH A;  1C6V A;  2WC9 A;  5KRS A;  2QWO A;  2CH5 A;  5AJ3 K;  2OPS A;  4Z94 A;  4WF9 L;  3NAE A;  1T03 A;  3KLF A;  3B6P A;  4N76 A;  4FWR A;  3O9S A;  1CZ9 A;  4IWV A;  3CQY A;  4KHN A;  2P9K A;  1FKO A;  4AM6 A;  3DMJ A;  2PZS A;  3THW B;  1RIL A;  5E41 A;  1BA0 A;  2ZJR L;  1HUX A;  3AV9 A;  1RBT A;  3GDQ A;  1ESV A;  4CCH A;  1N34 K;  3D7E O;  3FGU A;  3CCM N;  4FZY A;  1WSH A;  4DR5 K;  4H4O A;  3HSC A;  3CJC A;  2F9T A;  1IJJ A;  4OX9 K;  4NLB A;  2LSN A;  3OBY A;  2P9I B;  1C0F A;  3U3Y A;  3D2F A;  4ISF A;  4CFA A;  1KVC A;  4FJ5 A;  4HWI A;  5AFU A;  2ZM6 K;  4E7J A;  2OZM A;  1L3V A;  2YCH A;  1T6C A;  1HYV A;  2CGL A;  3AO5 A;  1ATN A;  3EZ5 A;  3L4Q A;  4YOY A;  1XQS C;  4AHV A;  3O1B A;  4BGA A;  4RW9 A;  3VEV A;  4JHD B;  3LP2 A;  4BQZ A;  1KXP A;  4FO0 A;  3M5R A;  3LDP A;  3HK2 A;  4WE1 A;  3KK1 A;  1NG9 A;  3P83 D;  5JVH L;  4CHN A;  4CJL A;  4JS4 A;  3BY5 A;  1S1X A;  4FCY A;  1HPZ A;  3U3G A;  4JS5 A;  4NCG A;  3PX0 A;  3O5B A;  3ZSW A;  2JWL A;  3SCX A;  1LWC A;  2IDO A;  1BWF O;  5EVZ A;  4BRD A;  2FXU A;  3KD5 E;  4M3Y A;  3FE1 A;  3ZX0 A;  1T3V A;  2FSJ A;  1E3M A;  3QIC A;  3SMP A;  3SYZ A;  2W6K A;  4BG9 A;  3MEE A;  1GOC A;  3OYN A;  3HOT A;  1IO2 A;  3V1O A;  3SBG A;  1BIU A;  3AA5 X;  3VGL A;  3D2E B;  4BRF A;  2FBT A;  4IOA L;  1BDG A;  3TSQ A;  2BH1 A;  5BN8 A;  1ZBS A;  3ZX3 A;  5AQO A;  3VQ7 A;  4BRL A;  4JI6 K;  1OH8 A;  1NGE A;  2GUI A;  1IKV A;  1X3M A;  3ZEU A;  1LW0 A;  4OO1 J;  5AQJ A;  4HCC A;  4BRO A;  4E3S A;  3G10 A;  1VSH A;  3FLC O;  3CJ7 A;  2NRR A;  3KK3 A;  2HNZ A;  3I0S A;  1TKX A;  4E7L A;  4KRF A;  2YI1 A;  2A1R A;  1H1V A;  1VSD A;  3HVR A;  4KTZ A;  4DSL A;  4CGD A;  1WBD A;  5EX5 A;  3IMX A;  2X6N A;  3A5M C;  5AQX A;  3CME N;  4YOT A;  1HMV A;  3MN9 A;  1FJG K;  1KTQ A;  2UYT A;  1ZBL A;  5C2F A;  4FLZ A;  4IJA A;  5AQF A;  2VWK A;  4I2Q A;  3PV8 A;  1U45 A;  5J2M A;  4CFB A;  1BQM A;  3J81 O;  1V4T A;  3V6D A;  1WBB A;  2Q36 A;  1OH6 A;  2AA4 A;  1GOA A;  3VQP A;  3WQU A;  3E01 A;  4H5W A;  4K8Z A;  3U9Z A;  1XMO K;  5J1E A;  3C7N B;  4O5F A;  3QET A;  4LF9 K;  2UXC K;  2DTU A;  4DV4 K;  4CD3 A;  1EX4 A;  5F1X A;  3MWT A;  4CJK A;  1IG9 A;  4Y1D A;  4H0X B;  1MU2 A;  1Q86 O;  3TTF A;  3NBP A;  3LWL A;  4CGH A;  2XRI A;  2UU9 K;  3SUP A;  3F9M A;  4FLX A;  1L3U A;  4KHP K;  4RW8 A;  1U47 A;  3VOV A;  3NH2 A;  3L4I A;  5DK5 A;  1UOC A;  3PX4 A;  4PL7 A;  1YF5 L;  5FLX O;  4BDP A;  2JLE A;  2HHH K;  2G8I A;  3SJH A;  4ELU A;  4CGF A;  3L8B A;  2HHT A;  4LSL A;  2GTD A;  4JI1 K;  4I2P A;  1S9E A;  5C15 A;  5KQD A;  3BGR A;  3O80 A;  4H0V B;  2F8T A;  1D4X A;  3THY A;  1TK5 A;  1RNH A;  3QIP A;  3THX A;  3AA2 A;  2CH6 A;  1YTA A;  3CF5 L;  3CFO A;  1Q82 O;  4OPA A;  3OVN A;  3QIN A;  4BR7 A;  1JLG A;  1UA0 A;  2QW9 A;  1BQN A;  1Q8I A;  1FW6 A;  4B1Z A;  2HBJ A;  3BUZ B;  1M90 O;  1DTQ A;  3C95 A;  3AVF A;  3MCA B;  5DM6 L;  1DEJ A;  3HP9 A;  3LM9 A;  1ATR A;  3O9Q A;  3ZSX A;  3E9P A;  1P90 A;  4LFC K;  4OKJ A;  4DQR A;  3C94 A;  4JKF A;  1VAZ A;  4QS9 A;  1YJW N;  3ZT4 A;  5IT9 O;  1Z25 A;  2O8C B;  2HBK A;  3CER A;  3DRS A;  4JKE A;  4GV6 A;  1WUA A;  3FZH A;  2YNF A;  2KLA A;  1D8Y A;  4IFE A;  4GKK K;  3WT0 A;  4I9L A;  4OKE A;  2XHB A;  5I42 A;  1HKC A;  2NZT A;  3F73 A;  5AQL A;  1GLD G;  4W5N A;  5EY4 A;  4FWQ A;  3WXK A;  3NH1 A;  4C23 A;  2O4G A;  2QKB A;  3WEE A;  4WFB L;  3D45 A;  5TKY A;  4BR5 A;  4RG8 A;  3WXI A;  3G6E N;  4L8R B;  2VQE K;  4U67 L;  1Z26 A;  2O8B A;  1N5Y A;  1VRT A;  1JCF A;  2OYQ A;  3AO4 A;  3DI6 A;  4ZTJ A;  1WSE A;  3OYF A;  4W5O A;  1WLJ A;  5AQQ A;  1QSL A;  3K5N A;  3HI0 A;  1EQY A;  4DTJ A;  3SI6 A;  4CK2 A;  4DWI A;  2FBY A;  4CEE A;  1SKR A;  4M3Z A;  2P5G A;  1NGI A;  1TUY A;  2Q0R A;  4DQP A;  3CI5 A;  4DQ8 A;  4B3S K;  2R7Y A;  1JLB A;  2E5L K;  2VWB A;  2E8A A;  3HZ6 A;  4JEP A;  2PYL A;  3E1Y A;  5BR9 A;  4WQ5 A;  4B1Y B;  2PYJ A;  3VF4 A;  2V7Y A;  2ITG A;  4KHU A;  2IAJ A;  3CJA A;  4ZHR A;  4FJK A;  1FKP A;  2E20 A;  3QFU A;  4DFJ A;  3DAW A;  2GEL A;  1IKY A;  1D9F A;  1GLJ O;  4E0D A;  3M3Z A;  5FDL A;  3T19 A;  4C8L A;  3GE1 A;  1XHZ A;  1RDC A;  2HHW A;  1QVG M;  4FOI A;  4H5T A;  4LF8 K;  4B3R K;  4EHU A;  3GBT A;  4DR3 K;  5J2P A;  4E7K A;  4E7I A;  2Y1I A;  4CJV A;  4FK4 A;  3HO1 A;  1HLU A;  3L3V A;  4CK3 A;  4ISE A;  3TAM A;  5F2R A;  1QQC A;  4FYD A;  3VTI A;  1RBV A;  4CZI A;  2G8W A;  3G0Z A;  3KKR A;  1ITG A;  4IKF A;  5AQT A;  3AVC A;  3CM5 A;  1W0H A;  1CXQ A;  3I8D A;  4CF9 A;  3SJJ A;  4DSI A;  3ENO A;  1GOB A;  4DR6 K;  2YHW A;  2QXL A;  1HQU A;  1KCF A;  2ZE2 A;  3JXU A;  3MMV A;  4LC9 B;  4DV0 K;  4FK2 A;  4Y0W A;  4J2A A;  4DLG A;  2YJF A;  2BDP A;  1TUU A;  4FM2 A;  3B6O A;  1L3T A;  4CBU A;  3AGR A;  2WBN A;  3SQ4 A;  4DV5 K;  2WON A;  4RTF D;  1U4B A;  3J80 O;  3C0B A;  2WUS A;  4PKG A;  2B4J A;  4CEF A;  1RBS A;  5DM7 L;  2HF3 A;  3KLH A;  5BRH A;  1KD1 O;  4CZH A;  3DM2 A;  1TYQ A;  4RW4 A;  3I55 N;  4BE1 A;  3E9L A;  4J8F A;  1J5E K;  1BOT O;  4CF1 A;  2PY5 A;  3H1Q A;  1NOY A;  2ASM A;  1RFQ A;  1TKZ A;  1RT4 A;  1UA1 A;  2OA8 A;  1RT5 A;  2X6S A;  2YJE A;  1FK9 A;  3VA3 A;  3NH0 A;  3I8B A;  4BRN A;  5AQY A;  3QER A;  3CJB A;  1BCO A;  3MXI A;  2QWN A;  4DTU A;  4ILJ A;  2QEX N;  4M3W A;  2W41 A;  3QO9 A;  4H5R A;  4FSV A;  4O4G A;  3HOS A;  4GMJ B;  3SK3 A;  4KHS A;  4B9V A;  3V1R A;  1U2V B;  3KKS A;  2OZS A;  3E9O A;  3O4Q A;  4B9Q A;  5E26 A;  3U9D A;  1HNV A;  4YNQ A;  5C10 A;  2PAV A;  4TSX A;  3ID6 A;  3HTV A;  2XY5 A;  3VMF B;  1QZ5 A;  4M42 A;  3O9T A;  1NOZ A;  4LSN A;  4RCH A;  3DJC A;  4OPK A;  2YNI A;  3HJF A;  2IC3 A;  4KBO A;  3R6M A;  1VQ4 N;  2CGK A;  2KZM A;  4O44 A;  4DHY A;  4B1U B;  2I5J A;  4CI6 A;  3W0L A;  3MEC A;  1HYS A;  1JLF A;  1LWF A;  2ZJP L;  4AHC A;  4B1X B;  1ZBU A;  2P9L A;  1RBU A;  1JJ2 M;  3RRH A;  1IV0 A;  3V9S A;  2G8H A;  1NWK A;  3F9K A;  1VQ6 N;  2GV9 A;  4DTO A;  4K0K K;  1RCH A;  3KLE A;  1D5A A;  2HVH A;  1TK0 A;  4LF4 K;  4DMN A;  2ZGZ A;  1T7P A;  3RMA A;  5LY3 A;  1TKD A;  3QEW A;  4WQ5 C;  2UXB K;  2NRT A;  2P9U A;  4HTU A;  2FF3 B;  1S6Q A;  1IKX A;  3EN9 A;  4AHU A;  4DV7 K;  2VGN A;  1VQK N;  3C6A A;  1NGF A;  3OJU A;  3G25 A;  4FJ9 A;  5SWM A;  5AZI A;  3FFI A;  4GW6 A;  3P4I A;  4AF1 A;  3CJ9 A;  3SPZ A;  4FL9 A;  4I6M A;  1ZYQ A;  5HRN A;  3WXJ A;  4CD1 A;  4LH5 A;  1KFD A;  1VQN N;  3AAQ A;  1HRH A;  4AHT A;  4JKH A;  3CCS N;  4FWP A;  4BR4 A;  4C1N K;  1MDU B;  3OJS A;  3DLB A;  1S5J A;  5LL6 Z;  4FVU A;  3I56 N;  5KPR A;  4FOE A;  4U7B A;  1SV5 A;  5JLF A;  5BPL A;  1VQO N;  3RVC A;  2KHO A;  1RDD A;  4B9U A;  2O8F B;  2O8D A;  1X9J A;  4BWM A;  3CYM A;  5AQW A;  3VQ6 A;  1T6D A;  5GAE P;  3OYM A;  4B9S A;  1BUP A;  1ATS A;  4ID5 A;  4KHW A;  3MN6 A;  5HRR A;  3OYE A;  1RTJ A;  1DLO A;  2OPQ A;  4CZM A;  2Q1N A;  1IKW A;  3T1A A;  2XY8 A;  4MLE A;  3V1Q A;  1VSK A;  5BRE A;  3DYA A;  5C12 A;  2HHX A;  3CQX A;  1KAY A;  2HST A;  1NK0 A;  3KZB A;  2RKI A;  2E88 A;  3CFP A;  2OTL N;  1GLF O;  1W7A A;  4AHR A;  4KTQ A;  3T7Z A;  3HYF A;  2X78 A;  3ZET A;  2QWP A;  4DB3 A;  4FWM A;  4Z4F A;  4EP5 A;  3IUC A;  4JAX A;  3D0P A;  1E4G T;  1JLC A;  1N33 K;  3AA4 A;  1IBM K;  4CJ7 A;  2V51 B;  4LFB K;  4JKC A;  4KAZ A;  4FXD A;  2IVP A;  3U6F A;  4WFA L;  1KSP A;  3K5L A;  3TAG A;  2WFB A;  2X74 A;  1XNR K;  2FBV A;  4C1N I;  4GVM A;  5FRN A;  1SL1 A;  1CLQ A;  3W3D A;  3ZX2 A;  1GLC G;  3H46 O;  4EIA A;  3AO3 A;  2RE2 A;  1RDA A;  1BHL A;  3LDN A;  4Z0U A;  2HNY A;  4BR9 A;  3M8R A;  2OAN A;  4JRQ A;  4KI6 A;  3N4P A;  4M3X A;  5MLC Q;  4UY8 O;  2P9S A;  5GAD P;  4A57 A;  4KO0 A;  4BC5 A;  1ZC6 A;  3PSI A;  4B9N A;  4H0P A;  1YVN A;  2G8V A;  3O08 A;  3OS0 A;  4M7X A;  4IZ9 A;  4JKG A;  1E4F T;  1CZB A;  1YIJ N;  5KQ8 A;  2P9P B;  1BG3 A;  1QSY A;  1KFS A;  3HXM A;  4Z4E A;  4PQU A;  4M3R A;  4CJS A;  4BVP A;  5CHI A;  5C42 A;  2OCE A;  3DXM A;  5GIN A;  5CYM A;  4PKI A;  4DV3 K;  3E66 A;  3CMA N;  1A5W A;  2KW4 A;  4C8K A;  3SUO A;  4NB4 A;  3O3F A;  4CJR A;  1XMQ K;  3DRR A;  3UB5 A;  3K5O A;  3IDH A;  1IH7 A;  4O55 A;  4CEO A;  3A5L C;  4E89 A;  4BRI A;  1QS4 A;  4BWJ A;  1JLA A;  1JKH A;  4ILH A;  2QWL A;  2A3Z A;  2ZGY A;  1X9M A;  3LP1 A;  1HNX K;  4FZZ A;  1QTM A;  3H08 A;  3BEX A;  3EO3 A;  1YT3 A;  4RW7 A;  3KHY A;  1TKT A;  1N32 K;  4JI4 K;  1S9G A;  3HP6 A;  3QFP A;  3G71 N;  3P31 A;  3IS9 A;  4OGC A;  1X9S A;  4XH1 A;  2Z1H A;  4B9L A;  2HHQ A;  3JS6 A;  5KGW A;  2QWQ A;  3U8X A;  4F3T A;  2Q97 A;  4QOZ B;  3EEQ A;  3LP3 A;  3UKU B;  2GWJ A;  1C0G A;  5C2D A;  2RPI A;  5M1P A;  3S3N A;  3CG7 A;  2PFU A;  3OYL A;  2E2Q A;  4J2B A;  3RSE B;  5EXW A;  4X64 K;  3L2U A;  3NMU A;  5AQR A;  2QTD A;  3KTQ A;  2OPR A;  3O8M A;  3OA9 A;  1R59 O;  3MN7 A;  3VQ5 A;  3B8A X;  2DPN A;  2I7P A;  2YHX A;  4LFA K;  1V4S A;  3V9W A;  1HPM A;  3O4W A;  5FRM A;  4DFP A;  4K25 A;  3ZT1 A;  4FK0 A;  4ILG B;  3AVM A;  4DUZ K;  4WQ4 A;  3DXK B;  3DWL A;  4CEC A;  3S9H A;  4FLY A;  1EO1 A;  3VEO A;  4NCA A;  3GL1 A;  2W42 A;  1NMN A;  2A5X A;  5T7B A;  1MWM A;  3UKR A;  2YHA A;  4FW2 A;  1Q81 O;  4A2A A;  4ELV A;  3T1H K;  3ZSQ A;  2HB5 A;  3CPW M;  5AQN A;  4BC3 A;  4CIE A;  5KRT A;  5HRS A;  3CD6 N;  4FJH A;  1VK0 A;  3A0I X;  1SKS A;  5BRF A;  4BC4 A;  3CM6 A;  3SNN A;  1VQ8 N;  4MLH A;  4CF2 A;  3AAP A;  2D1K A;  4IOC L;  3SZ2 A;  5AQH A;  3S3M A;  4XH5 A;  2Q0U A;  2IOC A;  3NF8 A;  5AFU H;  3RMC A;  4MFB A;  2E2P A;  1YJN N;  4BDZ A;  4AH9 A;  4CZG A;  3MXJ A;  3CCU N;  1RT1 A;  4YDU A;  1I39 A;  2V52 B;  3QML A;  5ADX A;  5JVG L;  3ULE A;  4Z4G A;  3J8A A;  4IXC A;  3JSM A;  2YNG A;  3HPH A;  5LMN K;  3WNG A;  5AQG A;  1U6Z A;  4NYN A;  1QQO A;  2P9K B;  3EE9 A;  3OY9 A;  3LAL A;  2F96 A;  1TL1 A;  1EET A;  2HF4 A;  5JS2 A;  3THV A;  1C0U A;  3L3U A;  3M8S A;  3T3F A;  1N36 K;  3OYC A;  4IDK A;  4IO8 A;  3KWG A;  3PIO L;  3ZCM A;  3AVJ A;  2QXF A;  3NFA A;  4PL8 A;  3TSU A;  4AIL C;  4FJJ A;  2B6A A;  3DLK A;  1HQE A;  3TSP A;  1TL3 A;  4BRE A;  3D2F B;  4IDH A;  2HBL A;  3QEP A;  5DMR A;  5GIO A;  1K8K A;  4MDA A;  4NLC A;  4PHT X;  3LPT A;  4E19 A;  3V81 A;  2JWK A;  4OLB A;  1U04 A;  4FJ7 A;  5IWA K;  3QBX A;  5HLF A;  1J53 A;  4MO5 A;  3ITH A;  2W40 A;  3QDK A;  4CJ3 A;  3VEZ A;  3VQQ A;  4O0I A;  1NKC A;  4KRE A;  1LAV A;  3G4S N;  4BDY A;  5AR0 A;  4KH5 A;  1SL2 A;  3K58 A;  5AQP A;  3RTV A;  4JK7 A;  4YOU A;  4NO7 A;  3OYD A;  1YAG A;  3ZSZ A;  4Z4I A;  2G8U A;  1MA9 B;  4O8K A;  4OLA A;  2NRW A;  1F21 A;  2Z1G A;  1OKJ A;  1S1V A;  3DOL A;  4C8M A;  4FWK A;  3PUF A;  2ZJQ L;  4O8U A;  5CR4 A;  3TTC A;  4FJM A;  3IRX A;  2YHB A;  1C1A A;  1C1C A;  3ENH A;  4JD2 A;  4AM7 A;  3NGY A;  3KK2 A;  4CZL A;  1HYZ A;  4BRK A;  1XI1 A;  5K14 A;  4F9O A;  4KKO A;  4CK1 A;  5J2Q A;  3IFR A;  4IG0 A;  4XIU A;  5I3U A;  3VA0 A;  3VQ8 A;  1I94 K;  2VYP A;  1GLB G;  1TVR A;  3MED A;  5KPZ A;  2BTF A;  1N8R O;  4JI3 K;  1TV6 A;  2FF6 A;  1BO5 O;  3ZEU B;  3R3L A;  4F2S A;  4DS4 A;  4CJE A;  1YIT N;  3RR7 A;  4JI5 K;  1NK6 A;  5JS1 A;  2ATQ A;  2V7Z A;  3LDS A;  3L2W A;  2ETJ A;  4BR0 A;  4DF8 A;  1HJR A;  4WQ4 C;  3WXM B;  1HNZ K;  3O3H A;  1YVU A;  3PIP L;  1LOT B;  1XC3 A;  4M3T A;  3QNO A;  1YJ9 N;  3NGZ A;  4K42 A;  3KLG A;  4PUO A;  4IFY A;  2HVI A;  1UWB A;  4CHZ A;  5C24 A;  4CHY A;  3CC7 N;  1G15 A;  1LW2 A;  3CIP A;  3AGK A;  5FPN A;  3SV4 A;  4CF0 A;  5C0Y A;  3ZT0 A;  4FM1 A;  1NJZ A;  3MX5 A;  3N4Q A;  4UQG A;  1VRU A;  3OYG A;  1KLM A;  4X65 K;  4H0Y B;  3IG1 A;  4A2B A;  1VSL A;  3JYT A;  1R0A A;  2QK9 A;  1KRP A;  1Y64 A;  4PY5 A;  3CC2 N;  2HOE A;  3L2V A;  3EYZ A;  4JHD A;  3BZC A;  1TAQ A;  3SMS A;  3NVK A;  3CCE N;  3KVG A;  4G1Q A;  3OTO K;  4C8O A;  1NGA A;  4MDB A;  1EWR A;  4JKB A;  4YDU C;  2YKM A;  1KQS M;  3ATU A;  2VCP A;  1SQK A;  3L0Q A;  4KH6 A;  2DFE A;  4W5R A;  1Z6R A;  2ITM A;  3AA3 A;  2FSK A;  5M1K A;  1Q7Y O;  4H8K A;  4IOX A;  1NM1 A;  3BP8 A;  1VQ9 N;  1NLV A;  1QHA A;  3LDQ A;  2IVO A;  3PSF A;  2I7N A;  2NNW A;  4HCB A;  4X66 K;  2BUP A;  4ZTF A;  3VQ4 A;  1OVQ A;  4Q5V A;  4EZ9 A;  5KPT A;  3RMD A;  3D2E A;  1XHX A;  3QNN A;  5B8H A;  5AQZ A;  2E1Z A;  2GBZ A;  4B3O A;  1XC9 A;  1RT2 A;  3K9K A;  3LAK A;  4BE2 A;  1O1W A;  1M1K O;  2HHS A;  1NK8 A;  1KVB A;  2A41 A;  5AQS A;  3SAH A;  1GLA G;  5CYQ A;  3EY1 A;  3THY B;  1ZBH A;  3THX B;  4JKD A;  4B8C A;  3CCV N;  1A5V A;  5LJV A;  4KPY A;  3ZT2 A;  4BRM A;  1NNE A;  3R8E A;  4FWN A;  3OYB A;  3S41 A;  3CFR A;  3O9R A;  2J4R A;  1BA1 A;  1OH7 A;  2HW3 A;  2KFZ A;  3OYJ A;  4DR7 K;  1RT7 A;  3K2P A;  3MWP A;  5BPM A;  5SZT A;  4OGE A;  4DTR A;  1K8A O;  4KB1 A;  1BGX T;  3OHR A;  2F7T A;  4CF8 A;  4E1M A;  3LZI A;  5LJW A;  2JGU A;  4GNI A;  3TR8 A;  3PLA A;  1ASV A;  4BG8 A;  3M8P A;  2Y1J A;  1LAW A;  3MN5 A;  1EP4 A;  1VSI A;  2Z1I A;  3VQB A;  3TAE A;  4A5A A;  4HTL A;  3VER A;  1LCU A;  2ZWH A;  3NCI A;  1SUQ A;  4EAH D;  3BF1 A;  3VES A;  4R79 A;  1FXX A;  1S3X A;  3L2Q A;  5M1N A;  2QA4 N;  5CY4 A;  3J7Z O;  3PO5 A;  1CZA N;  4K8X A;  3C7N A;  3FZL A;  4Z4H A;  4H5N A;  4FLV A;  4KI4 A;  4W5Q A;  2D0C A;  3HM8 A;  1Z05 A;  4BY9 C;  3TAB A;  5EU7 A;  4M63 C;  3WEE B;  4LF7 K;  3R9P A;  5AZJ A;  1C1B A;  2O8B B;  3OYH A;  5M1O A;  2QM1 A;  1XWL A;  4BVO A;  4H4M A;  1O13 A;  1LV5 A;  4QAG A;  4DR4 K;  4DLE A;  1U49 A;  1UAX A;  4DUY K;  5BPN A;  4CZJ A;  4YOV A;  1HNI A;  1VSE A;  4PKH A;  3QEI A;  2F4V K;  1NJI O;  2RF2 A;  3AVG A;  2F9W A;  3BDP A;  2GWK A;  4DR2 K;  3KD1 E;  1KVA A;  1OH5 A;  3C65 A;  4WCE L;  1U48 A;  4RWT A;  1W97 L;  2PBD A;  4LF5 K;  3C6U A;  1BIZ A;  1YI2 N;  1KAX A;  4WYB A;  4HVJ A;  3QEV A;  1VQ7 N;  3J7Y P;  1NJX A;  3CCQ N;  4Q0B A;  4A5B A;  4H5V A;  3VEY A;  4DQS A;  4CEB A;  4KTW A;  4M7Y A;  2UUA K;  2VGM A;  5HP1 A;  1NK7 A;  2BE2 A;  1NGD A;  2GEM A;  3OYI A;  3AVI A;  3H3N O;  4BRP A;  3H1V X;  2VWJ A;  1XUP O;  4CJF A;  4I7F A;  1WSJ A;  4CJT A;  4LD0 A;  3QES A;  1IG8 A;  1K6Y A;  1RT6 A;  3V9Z A;  2O8C A;  1S6P A;  1RDB A;  3I33 A;  2YX6 A;  1NGH A;  2YHY A;  3CJ1 A;  1VQ5 N;  4BRH A;  2YNH A;  2AJQ A;  3WNF A;  1NJY A;  3A5N C;  3CCL N;  4NXM K;  1YXQ A;  4CGI A;  5JLH A;  3OYK A;  4J2D A;  3CET A;  4K41 A;  4BRA A;  4JRP A;  4DS5 A;  4QS7 A;  3LP0 A;  1Y97 A;  3VEX A;  2QKK A;  4A61 A;  3HM9 A;  5J2N A;  3PX6 A;  4FJX A;  3V9U A;  3MEG A;  3O6W A;  3UIQ A;  3IAY A;  3ZSY A;  3EKU A;  1NBW A;  1K73 O;  3EE8 A;  1VSF A;  5BN9 A;  3NF7 A;  3FZF A;  3T69 A;  2W6L A;  4DKW A;  2HHV A;  3NHG A;  4EFH A;  4BAC A;  2IVN A;  4FJ8 A;  3QB0 A;  3SQ1 A;  5AQK A;  4DFK A;  3HST B;  3EL2 A;  1TYQ B;  4E7H A;  2RN2 A;  3KIO A;  4MO4 A;  4B1W B;  4KFB A;  3DLL L;  2XY6 A;  4V19 S;  3TPQ A;  1REV A;  4PWD A;  2D5R A;  3A2F A;  1DTT A;  3O3G A;  3CPE A;  3H45 C;  4LY7 A;  3VQE A;  3A8Y A;  1L5U A;  3LAM A;  1NJW A;  4YHH K;  1Q9X A;  4DSF A;  4OJR A;  4N41 A;  3K0S A;  3ID8 A;  3LPU A;  3TU5 A;  3RRG A;  3ZSR A;  1QHT A;  2ZF5 O;  4IEI A;  1GLE G;  4XH4 A;  3C6T A;  2UUC K;  4H03 B;  4M3U A;  1RGI A;  4KB0 A;  1HR0 K;  2OTJ N;  2GX9 A;  5HRO A;  4FW1 A;  1VHX A;  1NGG A;  4ISG A;  4EHT A;  4DQI A;  2AP1 A;  3LDL A;  1DKG D;  1J6Z A;  2KQ2 A;  1NK9 A;  1TAU A;  1JXE A;  4DU3 A;  4CW7 B;  1SL0 A;  2BGG A;  1C0M A;  1MWK A;  1P8Z A;  1SZ2 A;  5JIC A;  3TWH A;  3NGI A;  3D6R A;  1BCM A;  1WB9 A;  1RTI A;  2G8F A;  3C6H A;  4BRC A;  4DV1 K;  1QQM A;  1RBR A;  3A5O C;  3AVN A;  3WNH A;  4YOR A;  4JI2 K;  1WAJ A;  3AVA A;  2P9L B;  1JCG A;  5KI6 A;  3U4L A;  3K9J A;  5CZ2 A;  1JLQ A;  3TI0 A;  4HUG A;  3KLI A;  4E1J A;  2VG7 A;  3ZSV A;  4FVM A;  1GLL O;  3LZJ A;  3TTD A;  5FPE A;  1QZ6 A;  3NF9 A;  4G9Z A;  2E1Y A;  3FR0 A;  3R1X A;  2D0P A;  5HBM A;  4DTM A;  3AY9 A;  2HBM A;  3VPZ A;  1NGJ A;  1RTH A;  2UUB K;  4JYA K;  4DF4 A;  2D0O A;  3HPG A;  1SS6 A;  3OS1 A;  3TAP A;  4OKK A;  1DT9 A;  1WNS A;  4CEQ A;  2P9U B;  2Q3S A;  3F2K A;  3I0R A;  3VF6 A;  1ASU A;  1OVY A;  1N6Q A;  4IBN A;  3OBW A;  3V9X A;  5AZJ B;  4J2E A;  1NGC A;  3P38 A;  4FJN A;  5AZI B;  2A42 A;  5FPM A;  5FPD A;  2WTU A;  1BI4 A;  3J7A P;  4I6M B;  3M6G A;  3LWM A;  4ICL A;  4CZK A;  4IFV A;  4LH4 A;  4CJP A;  2IIR A;  2QI2 A;  4FLW A;  1RT3 A;  2HMP A;  3ISN C;  3VQA A;  1NU0 A;  4CZF A;  3MCP A;  3TAQ A;  1TGO A;  3MDQ A;  4DSK A;  2NUB A;  3SQ0 A;  2DFF A;  3OYA A;  3SV3 A;  3K59 A;  1NKE A;  3HT3 A;  1BL3 A;  3QEX A;  4QCL A;  1U2V A;  2D4W A;  4B3T K;  3AVL A;  3QBW A;  4WFN L;  2O8D B;  3SUN A;  2KTQ A;  4I9Q A;  5HOO A;  4H0T B;  3CHW A;  1ASW A;  4JV5 K;  4BGB A;  4DG1 A;  4FJL A;  4K43 A;  4CER A;  3VQ9 A;  3HL8 A;  4OPJ A;  3VEN A;  1ZXO A;  4O0J A;  2IGI A;  5KTQ A;  1S1T A;  3TAR A;  2Q2R A;  3P39 A;  3DLG A;  3ZT3 A;  5M1Q A;  2YV0 X;  3ENB A;  4DTP A;  3HPO A;  3LAN A;  2KKZ A;  3MK6 A;  3PY8 A;  3ZYY X;  3O4N A;  3VGM A;  3ZET B;  1RDW X;  1T44 A;  3KJV A;  4L3Q A;  1NK4 A;  1JLE A;  1EWQ A;  3NF6 A;  2G8K A;  3SAG A;  2O4I A;  2HND A;  1JCE A;  2RHK A;  4Z4C A;  4F3O A;  3Q7C A;  2P9N A;  4KHY A;  1A5X A;  2ZD1 A;  5A2Q O;  4B9M A;  1ZBI A;  3PO4 A;  2VQF K;  2GUP A;  4CEA A;  1RTD A;  3AAR A;  4JKA A;  4R5P A;  1WAF A;  3HVT A;  5BRD A;  4EP4 A;  4A62 A;  2FBX A;  3OS2 A;  4PA1 A;  3AO1 A;  5JMV A;  4FJI A;  4NCB A;  4GV9 A;  1JL1 A;  2P9S B;  1EKE A;  4H0O A;  4A59 A;  3RMB A;  1J9A A;  4NXN K;  1NMD A;  5GIP A;  3BZK A;  2FC0 A;  4JKG B;  1VQL N;  5KGX A;  1VQP N;  2KFN A;  1C0T A;  1NGB A;  5CZ1 A;  3AO2 A;  3CXC M;  4CJ4 A;  2XY7 A;  3VTH A;  4O5B A;  2O8E A;  4Y1C A;  4DTX A;  1WSF A;  1WSI A;  3DXM B;  5FRO A;  3LL3 A;  1YHQ N;  1W2B M;  1EXQ A;  2O8F A;  1S22 A;  2E2O A;  2BAN A;  3TAF A;  3DLR A;  3GOI A;  4JLH A;  3SAF A;  1YTU A;  4E1N A;  3LM2 A;  4HUF A;  1VQM N;  2YKN A;  4FWO A;  3VQC A;  3UE5 A;  3ASM A;  2ASP A;  4CJQ A;  3P5J A;  3VET A;  4CHO A;  3T1Y K;  1X3N A;  1YUW A;  2DY4 A;  2FLO A;  1DGK N;  3IKM A;  4B9T A;  1Q9Y A;  3NDK A;  4BR2 A;  2E6L A;  4AQY K;  4FLT A;  3THW A;  3WXL A; 
#chains in the Genus database with same CATH homology
 4CGJ A;  4KI6 A;  4M3X A;  1LAW A;  3VQB A;  1EP4 A;  1VSI A;  2Z1I A;  3TAE A;  4KO0 A;  4ELU A;  4CGF A;  4B9N A;  3L8B A;  3VN5 A;  2HHT A;  4W5T A;  3NCI A;  4LSL A;  4NYF A;  1WN7 A;  4I2P A;  2G8V A;  1S9E A;  3K5M A;  1SUQ A;  3OS0 A;  3BGR A;  3RR8 A;  4FM0 A;  2F8T A;  1FXX A;  1CZB A;  3L2Q A;  1TK5 A;  5CY4 A;  1RNH A;  3QIP A;  3PO5 A;  1JXB A;  3P1G A;  3AVB A;  4M45 A;  1QSY A;  1KFS A;  4K8X A;  3AA2 A;  3HXM A;  4Z4H A;  4FLV A;  1YTA A;  4KI4 A;  4Z4E A;  4PQU A;  1T05 A;  4W5Q A;  4HUE A;  2D0C A;  4M3R A;  4CJS A;  2OPP A;  4CHP A;  3SQ2 A;  1T8E A;  3CFO A;  1NK5 A;  5C42 A;  2VG6 A;  3TAB A;  5CYM A;  3OVN A;  1VSJ A;  5EU7 A;  1A5W A;  3QIN A;  3ALY A;  1JLG A;  2KW4 A;  4CIF A;  3NE6 A;  1UA0 A;  2P5O A;  4CJW A;  4C8K A;  1BQN A;  1B92 A;  1Q8I A;  3SUO A;  3O3F A;  4CJR A;  1C1B A;  3MAQ A;  3DRR A;  1DTQ A;  3C95 A;  3K5O A;  1IH7 A;  3AVF A;  3OYH A;  4O55 A;  4CEO A;  3TAN A;  1XWL A;  4H4M A;  4E89 A;  3WNE A;  1QS4 A;  3HP9 A;  1LV5 A;  4QAG A;  4BWJ A;  4BE0 A;  2B5J A;  2P51 A;  1JLA A;  3AVH A;  1JKH A;  1I3A A;  3ZSX A;  4DLE A;  4CFC A;  1U49 A;  4CJ5 A;  1UAX A;  1QE1 A;  4OKJ A;  1KLN A;  1HNI A;  1VSE A;  4DQR A;  3QEI A;  1X9M A;  3LP1 A;  3C94 A;  4FZZ A;  1QTM A;  1VSM A;  2RF2 A;  3H08 A;  3ZT4 A;  3AVG A;  3RWU A;  3BDP A;  1Z25 A;  2IS3 A;  3KD1 E;  1KVA A;  1YT3 A;  4ELT A;  3DRS A;  1BIS A;  4RW7 A;  1TKT A;  1S9G A;  1U48 A;  1X9W A;  3HP6 A;  2YNF A;  1D8Y A;  1ZBF A;  3IS9 A;  4F2R A;  4I9L A;  3C6U A;  4OKE A;  1BIZ A;  2XHB A;  4OGC A;  1X9S A;  2Z1H A;  5I42 A;  4HVJ A;  3F73 A;  4W5N A;  3QEV A;  4B9L A;  2HHQ A;  3NH1 A;  5KGW A;  2P1J A;  1CXU A;  4F3T A;  4QOZ B;  2O4G A;  4FJG A;  2QKB A;  1NJX A;  4Q0B A;  3LP3 A;  4AHS A;  3D45 A;  2HMI A;  2RPI A;  4RG8 A;  4L8R B;  3S3N A;  3CG7 A;  4HHT A;  1J54 A;  1SKW A;  1Z26 A;  4DQS A;  3OYL A;  1BI4 B;  1N5Y A;  4J2B A;  1VRT A;  2OYQ A;  3AO4 A;  3L2U A;  2E6M A;  3DI6 A;  1W9H A;  1JL2 A;  1WSE A;  5HRP A;  3OYF A;  3CQ8 A;  4DTN A;  4CEB A;  4W5O A;  4KTW A;  1WLJ A;  3KTQ A;  2OPR A;  3QIO A;  5HP1 A;  1NK7 A;  2BE2 A;  1QSL A;  3K5N A;  2D0B A;  3SPY A;  3DOK A;  3OYI A;  5C25 A;  3AVI A;  3AVK A;  4DU4 A;  3VQ5 A;  3SUQ A;  4DTJ A;  3SI6 A;  4CK2 A;  2VWJ A;  4CJF A;  4I7F A;  1WSJ A;  4CJT A;  4LD0 A;  2A1S A;  4DWI A;  3QES A;  4F4K A;  4EZ6 A;  3V9W A;  4DSE A;  5FRM A;  1K6Y A;  2FBY A;  4N47 A;  1RT6 A;  4CEE A;  1SKR A;  3V9Z A;  4DFP A;  4FK0 A;  3ZT1 A;  4M3Z A;  2P5G A;  3AVM A;  1S6P A;  4B8A B;  3V4I A;  1RDB A;  4FLU A;  4DQP A;  4CEC A;  3S9H A;  4FLY A;  4N5S A;  2R7Y A;  5D3G A;  4NCA A;  2YNH A;  4CGG A;  2W42 A;  2AJQ A;  3WNF A;  1NJY A;  4DSJ A;  2KZZ A;  4CEZ A;  1JLB A;  4CGI A;  3DLH A;  1B9D A;  4IG3 A;  3OYK A;  2PYL A;  4J2D A;  4JRP A;  5T7B A;  4DS5 A;  1NKB A;  3LP0 A;  2PYJ A;  1Y97 A;  2YHA A;  4FW2 A;  4DTS A;  4ELV A;  2QKK A;  1S1W A;  4KHU A;  2ITG A;  3ZSO A;  3ZSQ A;  1X1P A;  4RW6 A;  2HB5 A;  4C8N A;  3HM9 A;  2IAJ A;  5J2N A;  4FZX C;  4ZHR A;  4FJK A;  1FKP A;  3PX6 A;  4FJX A;  4CIE A;  3MEG A;  5KRT A;  3V9U A;  5HRS A;  3UIQ A;  4DFJ A;  1VK0 A;  3IAY A;  4FJH A;  3ZSY A;  1IKY A;  1SKS A;  1D9F A;  3CM6 A;  2DFH A;  3SNN A;  4E0D A;  4CF2 A;  1VSF A;  4DU1 A;  5FDL A;  3SZ2 A;  3T19 A;  4N56 A;  2EHG A;  3K57 A;  3NF7 A;  3S3M A;  1L3S A;  4C8L A;  2XO7 A;  1RDC A;  1XHZ A;  2D0A A;  2HHW A;  4ID1 A;  4ZTJ A;  2HHV A;  3NHG A;  2IOC A;  3NF8 A;  3RMC A;  4BAC A;  4MFB A;  4OVL A;  5J2P A;  4E7K A;  4E7I A;  4FJ8 A;  4CJU A;  2Y1I A;  4CJV A;  4FK4 A;  3SQ1 A;  4BDZ A;  4AH9 A;  4DFK A;  3HST B;  3HO1 A;  3MXJ A;  4E7H A;  2RN2 A;  3L3V A;  3KIO A;  4CK3 A;  3VQD A;  3TAM A;  1RT1 A;  2XY6 A;  4KFB A;  1I39 A;  1QQC A;  4FYD A;  2Z1J A;  4F8R A;  1B9F A;  1RBV A;  2G8W A;  4Z4G A;  4CFD A;  1REV A;  2VG5 A;  3G0Z A;  3JSM A;  1QSS A;  3KKR A;  4KV8 A;  1ITG A;  4IKF A;  4CE9 A;  1LWE A;  2YNG A;  4PWD A;  2D5R A;  3A2F A;  1DTT A;  3AVC A;  3CM5 A;  3HPH A;  1W0H A;  3O3G A;  3DRP A;  3WNG A;  1D9D A;  4LY7 A;  3VQE A;  1CXQ A;  4DFM A;  4CES A;  1L5U A;  3I8D A;  4CF9 A;  3SJJ A;  3LAM A;  4NYN A;  3M8Q A;  1NJW A;  4DSI A;  3OY9 A;  3LAL A;  2F96 A;  1TL1 A;  4JRQ A;  1Q9X A;  4DSF A;  1GOB A;  4OJR A;  1J5O A;  4N41 A;  1EET A;  5JS2 A;  3THV A;  1C0U A;  3LPU A;  3L3U A;  3RRG A;  3M8S A;  3T3F A;  2E4L A;  3ZSR A;  3OYC A;  1TK8 A;  4IDK A;  1HQU A;  1KCF A;  2ZE2 A;  1QHT A;  3ZCM A;  3AVJ A;  3MXM A;  4FK2 A;  3C6T A;  2QXF A;  4J2A A;  3NFA A;  4DLG A;  4M3U A;  3L2R A;  2BDP A;  4KB0 A;  4FM2 A;  3B6O A;  4AIL C;  2EX3 A;  4MQ3 A;  5HRO A;  1L3T A;  2HHU A;  4FW1 A;  4FJJ A;  4CIG A;  2B6A A;  3DLK A;  1HQE A;  4B08 A;  4DQI A;  3SQ4 A;  1TL3 A;  2WON A;  1U4B A;  4M41 A;  2B4J A;  4CEF A;  1RBS A;  3QEP A;  5DMR A;  3KLH A;  2KQ2 A;  3LPT A;  4E19 A;  3V81 A;  4CED A;  1NK9 A;  4CHQ A;  1TAU A;  1JXE A;  4DU3 A;  4OLB A;  3DM2 A;  1U04 A;  1WSG A;  4FJ7 A;  2F8S A;  2ZQB A;  3DLE A;  4YFU A;  1SL0 A;  4DQQ A;  4RW4 A;  4BE1 A;  2BGG A;  1C0M A;  5HLF A;  3S3O A;  1J53 A;  3ULD A;  4CF1 A;  2PY5 A;  3TWH A;  1NOY A;  3NGI A;  3ITH A;  1BCM A;  1S1U A;  2WOM A;  4CJ3 A;  1RTI A;  3VQQ A;  2G8F A;  4KHQ A;  4O0I A;  1TKZ A;  1NKC A;  3QLH A;  1RT4 A;  1C6V A;  1LAV A;  5KRS A;  1UA1 A;  2OA8 A;  4BDY A;  4KRE A;  1RT5 A;  2X6S A;  1RBR A;  2OPS A;  1FK9 A;  3AVN A;  3NAE A;  3KLF A;  3B6P A;  3WNH A;  3VA3 A;  3NH0 A;  1T03 A;  3K58 A;  1SL2 A;  1CZ9 A;  3QER A;  1WAJ A;  3AVA A;  1BCO A;  3MXI A;  3RTV A;  4DTU A;  4KHN A;  4M3W A;  3QO9 A;  5KI6 A;  3OYD A;  3ZSZ A;  1FKO A;  4Z4I A;  3DMJ A;  4O4G A;  2PZS A;  2G8U A;  5CZ2 A;  1RIL A;  5E41 A;  4GMJ B;  4OLA A;  4KHS A;  1JLQ A;  3TI0 A;  4HUG A;  3KLI A;  4B9V A;  3AV9 A;  2VG7 A;  3V1R A;  1F21 A;  3ZSV A;  4FVM A;  3KKS A;  1RBT A;  4CCH A;  3LZJ A;  2OZS A;  3NF9 A;  3O4Q A;  2Z1G A;  4FZY A;  1WSH A;  1HNV A;  4H4O A;  1S1V A;  5HBM A;  3DOL A;  4C8M A;  4YNQ A;  4DTM A;  4TSX A;  1RTH A;  4DF4 A;  2LSN A;  3PUF A;  3HPG A;  2XY5 A;  3U3Y A;  3OS1 A;  3TAP A;  4CFA A;  4M42 A;  1KVC A;  4OKK A;  1NOZ A;  1WNS A;  4CEQ A;  4FJ5 A;  4FJM A;  3IRX A;  2YHB A;  4LSN A;  2Q3S A;  1C1A A;  3I0R A;  1C1C A;  3KK2 A;  3NGY A;  4OPK A;  4E7J A;  2OZM A;  2YNI A;  1L3V A;  1ASU A;  3HJF A;  2IC3 A;  1HYV A;  1HYZ A;  1XI1 A;  3AO5 A;  4IBN A;  1N6Q A;  3V9X A;  4J2E A;  5K14 A;  3EZ5 A;  4KKO A;  4CK1 A;  5J2Q A;  4FJN A;  4IG0 A;  2KZM A;  4XIU A;  5I3U A;  3VA0 A;  3VQ8 A;  4AHV A;  4O44 A;  1BI4 A;  4RW9 A;  1TVR A;  3MED A;  3LWM A;  2I5J A;  4ICL A;  3LP2 A;  4IFV A;  1TV6 A;  3MEC A;  1HYS A;  1JLF A;  4LH4 A;  1LWF A;  4CJP A;  4F2S A;  4DS4 A;  4AHC A;  4FLW A;  1RT3 A;  3HK2 A;  4WE1 A;  3ISN C;  3VQA A;  1ZBU A;  4CJE A;  3KK1 A;  3RR7 A;  3P83 D;  1NK6 A;  1RBU A;  4CHN A;  5JS1 A;  3RRH A;  4CJL A;  2ATQ A;  3LDS A;  1TGO A;  4JS4 A;  3L2W A;  3TAQ A;  1S1X A;  2NUB A;  4FCY A;  3SQ0 A;  2DFF A;  2ETJ A;  3OYA A;  1HJR A;  3K59 A;  3SV3 A;  3V9S A;  4DF8 A;  1HPZ A;  3U3G A;  3HT3 A;  1NKE A;  1BL3 A;  3F9K A;  3O3H A;  1YVU A;  4JS5 A;  3QEX A;  4NCG A;  4QCL A;  2GV9 A;  4DTO A;  3AVL A;  4M3T A;  3QNO A;  3PX0 A;  1RCH A;  3ZSW A;  3KLE A;  4N76 A;  3NGZ A;  3SCX A;  1D5A A;  1LWC A;  2IDO A;  2HVH A;  1TK0 A;  3SUN A;  2KTQ A;  4I9Q A;  3KD5 E;  3KLG A;  4DMN A;  4PUO A;  4IFY A;  4M3Y A;  2HVI A;  1T7P A;  1UWB A;  4CHZ A;  5C24 A;  4CHY A;  1ASW A;  3RMA A;  1TKD A;  3QEW A;  1G15 A;  1LW2 A;  3SYZ A;  3MEE A;  4DG1 A;  1GOC A;  4FJL A;  3OYN A;  4CER A;  3SV4 A;  3VQ9 A;  3HL8 A;  4OPJ A;  4CF0 A;  4HTU A;  1IO2 A;  3V1O A;  3ZT0 A;  4O0J A;  4FM1 A;  1NJZ A;  1BIU A;  2IGI A;  3AA5 X;  2FBT A;  5KTQ A;  4UQG A;  1S1T A;  1S6Q A;  1IKX A;  4AHU A;  3TAR A;  1VRU A;  3OYG A;  1KLM A;  3DLG A;  3JYT A;  3IG1 A;  1VSL A;  3OJU A;  3ZT3 A;  4FJ9 A;  1R0A A;  3VQ7 A;  5SWM A;  2QK9 A;  3FFI A;  1KRP A;  4GW6 A;  2YV0 X;  4DSK A;  4DTP A;  4PY5 A;  3HPO A;  3SPZ A;  3LAN A;  1ZYQ A;  5HRN A;  3L2V A;  3EYZ A;  4LH5 A;  1KFD A;  1TAQ A;  3PY8 A;  2GUI A;  3O4N A;  1HRH A;  4AHT A;  1IKV A;  1LW0 A;  3OJS A;  4G1Q A;  4C8O A;  3KJV A;  3DLB A;  4HCC A;  1S5J A;  1NK4 A;  1JLE A;  4E3S A;  3G10 A;  3NF6 A;  2G8K A;  2YKM A;  1VSH A;  1SV5 A;  2O4I A;  4W5R A;  2DFE A;  2HND A;  3KK3 A;  2HNZ A;  3AA3 A;  3I0S A;  1RDD A;  4Z4C A;  4B9U A;  4F3O A;  1TKX A;  1A5X A;  2ZD1 A;  4H8K A;  4BWM A;  4E7L A;  4KHY A;  4B9M A;  1ZBI A;  3CYM A;  3PO4 A;  3VQ6 A;  4KRF A;  2A1R A;  1VSD A;  4CEA A;  1RTD A;  3OYM A;  4B9S A;  4ID5 A;  4KHW A;  3HVR A;  4HCB A;  4KTZ A;  5HRR A;  4R5P A;  4DSL A;  4CGD A;  3OYE A;  1RTJ A;  1DLO A;  4ZTF A;  1WAF A;  2OPQ A;  3VQ4 A;  3HVT A;  2X6N A;  4EP4 A;  1IKW A;  4Q5V A;  4EZ9 A;  2FBX A;  3T1A A;  2XY8 A;  3OS2 A;  3V1Q A;  3RMD A;  4PA1 A;  1VSK A;  1HMV A;  3AO1 A;  1KTQ A;  1XHX A;  3DYA A;  3QNN A;  1ZBL A;  4FJI A;  4NCB A;  2HHX A;  4FLZ A;  2GBZ A;  4B3O A;  2VWK A;  4I2Q A;  1JL1 A;  3PV8 A;  1RT2 A;  1EKE A;  5J2M A;  1XC9 A;  4CFB A;  1U45 A;  1NK0 A;  1BQM A;  3RMB A;  2RKI A;  3LAK A;  1J9A A;  4BE2 A;  3V6D A;  1O1W A;  3CFP A;  2HHS A;  1NK8 A;  2FC0 A;  1KVB A;  2KFN A;  5KGX A;  4AHR A;  4KTQ A;  1C0T A;  3HYF A;  5CYQ A;  2X78 A;  1GOA A;  5CZ1 A;  3VQP A;  3EY1 A;  1ZBH A;  3E01 A;  4K8Z A;  3AO2 A;  4B8C A;  1A5V A;  5J1E A;  4KPY A;  4CJ4 A;  2XY7 A;  4Z4F A;  4EP5 A;  3QET A;  3ZT2 A;  4O5B A;  2DTU A;  3D0P A;  4Y1C A;  1JLC A;  4DTX A;  3AA4 A;  1WSF A;  1EX4 A;  1WSI A;  5FRO A;  4CJK A;  1IG9 A;  3OYB A;  4Y1D A;  3CFR A;  4KAZ A;  4FXD A;  3U6F A;  1EXQ A;  1MU2 A;  1KSP A;  2BAN A;  3K5L A;  3TAF A;  2HW3 A;  3TAG A;  3NBP A;  3LWL A;  4CGH A;  3OYJ A;  3DLR A;  2XRI A;  2KFZ A;  4JLH A;  2X74 A;  1YTU A;  4E1N A;  1RT7 A;  3SUP A;  2FBV A;  4FLX A;  4GVM A;  1L3U A;  4HUF A;  3K2P A;  5FRN A;  1SL1 A;  2YKN A;  1CLQ A;  3VQC A;  5SZT A;  4OGE A;  4RW8 A;  4DTR A;  4KB1 A;  1U47 A;  3ASM A;  1BGX T;  4CJQ A;  4CF8 A;  4E1M A;  3NH2 A;  3LZI A;  3AO3 A;  3P5J A;  2JGU A;  5DK5 A;  3TR8 A;  4CHO A;  1UOC A;  3PX4 A;  1RDA A;  2DY4 A;  1ASV A;  1BHL A;  2G8H A;  4B9T A;  1Q9Y A;  3NDK A;  4Z0U A;  2HNY A;  3M8R A;  4BDP A;  2JLE A;  2E6L A;  4FLT A;  2G8I A;  2Y1J A;  3M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...