3NH2A

Crystal structure of rnase t in complex with a stem dna with a 3' overhang
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
207
structure length
202
Chain Sequence
GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 62
structure length 202
sequence length 207
chains with identical sequence B, E, F
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh2A00
2ATQA 2B4JA 4CIFA 1QS4A 3T1AA 1X9SA 3NAEA 5HLFA 1BHLA 4B8CA 4OLBA 4KV8A 1WSIA 4M3WA 3M8RA 4XIUA 2X78A 4HUGA 1NK7A 1U04A 3HM9A 3PX4A 2BGGA 3ASMA 3AVJA 3KKRA 4OKKA 3KK1A 5D3GA 2LSNA 3IG1A 3TR8A 4CEDA 2GV9A 5HROA 3AVCA 1NKEA 4B9TA 4CF0A 5FROA 1TAUA 3IRXA 3OJUA 3K5MA 3HPGA 1TK8A 1ASVA 4JLHA 4CEZA 4FK4A 4B9VA 4CEBA 3NH0A 3K58A 4CECA 4PQUA 4Q0BA 1RTJA 4CEEA 4CFDA 5C24A 3VQDA 1BIZA 4FJXA 1BISA 4C8MA 5HRPA 3OYMA 5K14A 3BGRA 2EHGA 4NCGA 4H8KA 4CGFA 3VQ8A 2OA8A 3RR8A 2D5RA 3KD5E 2DY4A 3SUQA 4IFVA 3TANA 3NGIA 3MAQA 1C6VA 3TAQA 1D9FA 2YKMA 3ZCMA 1LV5A 4F8RA 3AVMA 4DFKA 1U47A 3RMDA 3OS2A 5JS2A 3DM2A 3LAKA 2XHBA 1TV6A 2XO7A 4KKOA 4NYFA 3WNEA 4FJHA 3C94A 1BQNA 1VSDA 3O3HA 4N76A 3CFRA 3HO1A 2ZQBA 4IG3A 4BDPA 1VSLA 3QO9A 4RW8A 2I5JA 2RF2A 4FW1A 4B08A 3OS1A 4E7KA 3K5OA 3ZSWA 3RMCA 4DTUA 1NKBA 1R0AA 1EETA 3NDKA 3DOKA 3AVHA 4C8OA 2RN2A 1BIUA 1C0UA 1S1VA 4OPKA 3S3NA 2X74A 4DQQA 4FJ7A 4KREA 5KTQA 3HK2A 3V9XA 1KTQA 2Z1GA 3CFOA 4ID1A 1JLCA 1TKZA 3HPOA 3TABA 1RBTA 4NCBA 4RW4A 3L2RA 1JLQA 4FJKA 3OYCA 4FJNA 4O4GA 5T7BA 3P83D 1EXQA 4DS5A 2G8UA 1MU2A 1S6PA 1Q9YA 4OLAA 3WNFA 1ZBLA 1NK9A 3AVNA 1D5AA 2A1SA 1REVA 4IG0A 2HHVA 2HNYA 1RBVA 4HUFA 5FRNA 1KSPA 2YKNA 1UA0A 1NK5A 4FK2A 3QNOA 4Z4IA 1RT4A 2FBVA 2KZZA 1SL2A 1NOYA 1VRUA 2KFZA 4FLTA 4FK0A 3OYEA 3FFIA 4DU1A 2O4IA 1LW2A 2P51A 5CZ2A 1RBSA 1DLOA 4E19A 4FCYA 4FLWA 4DTNA 2OZMA 3I8DA 4BE1A 1WSGA 3DRPA 4B8AB 3TAMA 2HNDA 1UA1A 4CJUA 3PV8A 3LDSA 4CF8A 2HVIA 2E6MA 5J2PA 4I9LA 3DYAA 4AHSA 1TVRA 4BDZA 1WSHA 3WNGA 1XI1A 3P5JA 3KTQA 2DTUA 1TGOA 3DLEA 1NKCA 4CK1A 4CJEA 3HT3A 3M8QA 3F9KA 4FJMA 1SUQA 3SV3A 2VG7A 3V9SA 1B9DA 4CHZA 3TAGA 4M3ZA 4CJRA 1GOCA 1XWLA 2XY7A 3NFAA 1W0HA 1WAJA 4DSFA 1J5OA 4DTJA 3ZT3A 4C8NA 2QK9A 3L8BA 3T3FA 4N41A 1J9AA 1HNVA 4Y1DA 1QSYA 3V1OA 3DLHA 2YNFA 4KHSA 4C8KA 1YVUA 2HB5A 2KFNA 4QAGA 3DRRA 3F73A 3SV4A 3SUNA 3PO4A 1TKXA 4TSXA 4FW2A 3LAMA 4OGCA 1NJXA 4DTMA 1SL0A 3T19A 1J54A 4M3TA 1Q9XA 4M3XA 4ZTFA 4DSKA 3DLRA 3KLFA 3L2WA 4HHTA 1KLMA 1NJZA 4KO0A 4CE9A 2DFEA 2RPIA 3V9WA 3HYFA 5DMRA 3UIQA 3NF8A 1C0TA 1JLFA 4DFMA 4CJLA 2XRIA 4DSEA 4E3SA 4PY5A 3L3VA 1VSMA 1RDDA 5SZTA 1S1WA 4CJ4A 4FJ9A 4PWDA 4ELVA 1RT7A 1BL3A 4O5BA 4N47A 4CGJA 1C1AA 4CGGA 5I42A 4LY7A 3SZ2A 1QTMA 3QEWA 2HHSA 2E4LA 1O1WA 2DFFA 3HVTA 4CIEA 3QEXA 3VQBA 3LWMA 3EYZA 3MXIA 4DG1A 5KRTA 4OKEA 5CYMA 1JLEA 4DF4A 3QNNA 4CJKA 1RTDA 1RDAA 4YFUA 4JS5A 3QEVA 4J2EA 3NHGA 1CZBA 4B3OA 3LP1A 1A5XA 3AV9A 4CHPA 3KLGA 3TAFA 4I7FA 2FBYA 4CESA 4QOZB 1VRTA 1QHTA 1U4BA 3HP9A 1X9MA 3RTVA 3G0ZA 3NGZA 1XC9A 3C6TA 3L2UA 1TKTA 3VQEA 1ITGA 3OYIA 4KB0A 1RILA 2HVHA 1BCOA 4KTQA 2E6LA 3SUPA 1HQUA 3CYMA 4IDKA 4DQPA 3TAPA 1CXQA 3AVIA 3MEEA 3KKSA 1TKDA 4EP4A 3ZT4A 4F3TA 3DLGA 1SKRA 1I39A 4I2QA 5EU7A 4L8RB 1KCFA 3OVNA 4FLZA 4E7LA 3JSMA 3MECA 4CEOA 2HHWA 4E1MA 4FYDA 2AJQA 3SQ4A 4E89A 4H4OA 3PX0A 1SKSA 4OPJA 5SWMA 3MEDA 4EP5A 3OYFA 4NYNA 3V81A 3O4NA 4J2AA 1KVAA 3NE6A 1VSIA 3OYKA 3K57A 4DLEA 1S1TA 1RTIA 4CJ5A 4CGHA 4GW6A 3HPHA 3NH2A 4DWIA 5C25A 1UOCA 2IGIA 4N56A 4FM2A 1Q8IA 2JLEA 1WNSA 3VQ5A 4Z4HA 4CF2A 3ZSXA 4OVLA 1S9EA 4FZYA 2XY5A 1HYSA 1NJWA 1F21A 3ZT2A 3CFPA 4DSLA 3AO4A 4OJRA 3SI6A 1HQEA 2G8HA 2G8IA 4FXDA 1A5VA 1HPZA 3HJFA 1KVBA 2PYJA 4F2SA 1C1CA 5HRRA 1IKWA 3HP6A 4E7JA 4CCHA 2OPQA 4O0IA 4M41A 3DRSA 2HHUA 3LALA 3LP0A 2FBTA 3AVBA 2QXFA 3NGYA 4LH4A 2D0BA 3C95A 4MQ3A 4W5OA 1UAXA 4PA1A 1LWFA 1I3AA 4AHTA 4Q5VA 3OYBA 4GMJB 4DFJA 5J2QA 4DF8A 2PZSA 3OYGA 2YNHA 3ZT0A 3EY1A 3K59A 2OYQA 2HNZA 3SUOA 4CHNA 2WONA 4LH5A 4FJLA 3PUFA 4FJ8A 3AA5X 2D0CA 4K8ZA 1HYZA 4O0JA 1IG9A 1ASUA 1FK9A 2KW4A 2F96A 3NF7A 4BDYA 5J2NA 1EP4A 3OY9A 3DOLA 4DTPA 2VG6A 2OPPA 3D45A 4BWJA 3SJJA 4ELTA 1HJRA 1RDBA 3U6FA 5HRSA 4CEAA 4AHUA 1RBUA 4DMNA 1N6QA 5FRMA 2XY8A 1IKVA 2F8SA 4FJJA 4RG8A 3OYNA 1T03A 3LP3A 3A2FA 1VK0A 2ITGA 2F8TA 2Q3SA 1NJYA 3QERA 1Z25A 1JXBA 3OS0A 1ASWA 1GOBA 4DTXA 3I0SA 2OPRA 1XHZA 2G8WA 3VN5A 4M3YA 1D8YA 4M45A 1VSJA 3HVRA 3B6OA 1RDCA 2YHBA 3ISNC 1U45A 2QKBA 3DLKA 5J2MA 3ULDA 4F4KA 1B9FA 3THVA 2EX3A 1BQMA 4EZ9A 4DTRA 3AVGA 3RMAA 3LANA 2A1RA 3DI6A 1QQCA 4DQSA 3EZ5A 1S1UA 3JYTA 1TK0A 4FJIA 1YTUA 3IAYA 1BCMA 3ZT1A 4AHVA 5CZ1A 4E7HA 3S3MA 1NK0A 1TL1A 3O3FA 1J53A 3I0RA 3OYAA 3AO3A 4CGIA 4WE1A 1L3UA 2ETJA 4I2PA 1JL2A 2O4GA 3L2VA 1KLNA 2KQ2A 1WSEA 1TL3A 3AA4A 1VSHA 1T7PA 4EZ6A 3DLBA 4B9UA 4CJSA 1W9HA 3MXMA 4KFBA 1FXXA 3QEPA 1ZBHA 4W5RA 1S6QA 2G8KA 4FLYA 4CFCA 1CZ9A 4F3OA 2W42A 2ZD1A 3AO1A 4JRQA 4KHNA 1NOZA 3CM5A 2IAJA 5C42A 2OZSA 4E7IA 3LPUA 3KD1E 2G8FA 4JS4A 1A5WA 4CEQA 3V6DA 1N5YA 4KHQA 3ZSYA 3HSTB 4DU3A 5J1EA 1BI4A 4FZXC 3V9UA 3PX6A 2FC0A 3VQ7A 4J2BA 4KHUA 4KPYA 3SQ0A 5DK5A 2P5GA 1HYVA 3U3GA 5CY4A 1C1BA 3OYDA 4MFBA 3TARA 3QLHA 4UQGA 3H08A 3SQ1A 1NK4A 3ZSRA 4LD0A 1S9GA 3M8PA 3SPYA 1YT3A 1T8EA 4W5TA 1DTTA 1YTAA 2HHXA 3S3OA 3QIPA 2IOCA 1RT1A 2D0AA 3QINA 4OGEA 4M3RA 1RTHA 3LZIA 2RKIA 1NK6A 3RR7A 1X9WA 4CF1A 1WSFA 3U3YA 4W5NA 2X6NA 4RW9A 3S9HA 3LP2A 2R7YA 1JL1A 3KLHA 1RNHA 4J2DA 2IDOA 4AH9A 3V1RA 1CLQA 4ICLA 2Z1IA 4FM0A 1UWBA 3M8SA 1C0MA 4FLUA 3SNNA 3ITHA 4FLXA 4CFAA 3SPZA 4YNQA 5FDLA 3E01A 4B9NA 2GBZA 4CJVA 4CJPA 1KRPA 4AHCA 4FZZA 4R5PA 4RW6A 1LW0A 2B6AA 4Z4CA 3NH1A 2BE2A 4IFYA 3VQ9A 2YV0X 4KB1A 1G15A 4KI4A 3NF6A 3TWHA 1FKPA 1HNIA 3RMBA 4BACA 3P1GA 1T05A 1WSJA 2VWJA 3SQ2A 4H4MA 4BE2A 4CERA 2DFHA 4GVMA 4QCLA 2PY5A 1LWEA 4CEFA 1JXEA 3AO5A 4NCAA 1VSEA 4KHYA 1GOAA 2NUBA 3ALYA 3ZSQA 3DMJA 4F2RA 3V9ZA 4FJGA 3ZSZA 3AO2A 1QSSA 3RRGA 1JLAA 3NBPA 2Z1HA 3KK3A 1NK8A 4Z4EA 2KZMA 1VSFA 2IC3A 1Z26A 3D0PA 3LZJA 4DQRA 4HCCA 4JRPA 2YNGA 1KVCA 1WLJA 2PYLA 4BWMA 3TAEA 3QEIA 5HP1A 2G8VA 4KRFA 2BANA 4PUOA 1ZBUA 1IH7A 1DTQA 2OPSA 3C6UA 3HXMA 4E0DA 4LSLA 1LAWA 3B6PA 5HBMA 4E1NA 3OJSA 3KJVA 4Z4FA 1EX4A 3AVFA 5CYQA 2FBXA 1L5UA 1TK5A 3KLIA 4Y1CA 5KRSA 3AVAA 1CXUA 4KTZA 1IO2A 4DQIA 3NF9A 1S1XA 2HMIA 4C8LA 1RCHA 3VQQA 2P1JA 3O4QA 2VWKA 4G1QA 2VG5A 4HTUA 4FM1A 4DTSA 3VQ6A 1JLBA 2X6SA 1L3TA 4KI6A 4BE0A 1BI4B 2IS3A 2WOMA 3QIOA 3AVLA 3AVKA 4DLGA 4CK3A 3MXJA 2Y1IA 4KHWA 2GUIA 3RWUA 4K8XA 2Z1JA 4CIGA 4M42A 4AILC 3OYLA 3ZSVA 1S5JA 3AA3A 1HMVA 5HRNA 4CJWA 3LWLA 3NCIA 4B9MA 2HHTA 3CG7A 1JLGA 3WNHA 3RRHA 3KK2A 4DSJA 2B5JA 3VQ4A 4CHYA 2P5OA 1FKOA 4I9QA 3OYJA 2YNIA 1LAVA 3VA3A 3IS9A 1VSKA 1HRHA 1TAQA 5JS1A 3PO5A 4M3UA 3VQCA 1U49A 1SV5A 3K5NA 4HVJA 1RT2A 4Z4GA 3MEGA 3VQPA 4LSNA 3SYZA 1KFSA 3LPTA 3HL8A 4CGDA 3SCXA 2ZE2A 4OKJA 4B9SA 1IKYA 4O55A 2HHQA 3CQ8A 4ELUA 1EKEA 2BDPA 4CJTA 1L3VA 4HUEA 3AA2A 1U48A 3KLEA 4FJ5A 4O44A 3ZSOA 4ZHRA 1ZBFA 1RT5A 3BDPA 4Z0UA 2KTQA 4CFBA 1RT6A 4ZTJA 4KAZA 1XHXA 4DFPA 4AHRA 4DU4A 1L3SA 3QETA 4IKFA 4IBNA 3L3UA 3K5LA 3G10A 4KTWA 4CK2A 3PY8A 1KFDA 4HCBA 5E41A 3OYHA 2QKKA 2HW3A 1QSLA 1SKWA 1QE1A 4FLVA 4W5QA 5KI6A 3K2PA 1K6YA 1RBRA 4CJ3A 4RW7A 3VA0A 3CM6A 4FVMA 4DS4A 4ID5A 4CHQA 1SL1A 1RT3A 4CJQA 1Y97A 5KGWA 1B92A 1WN7A 4CJFA 2XY6A 5KGXA 5I3UA 1D9DA 3QESA 1JKHA 1LWCA 1BGXT 3TI0A 1ZYQA 3L2QA 4DSIA 1X1PA 4CHOA 1IKXA 1WAFA 3V1QA 2YHAA 3O3GA 4B9LA 4CF9A 3V4IA 1ZBIA 3KIOA 2JGUA 3VQAA 4DTOA 4N5SA 2Y1JA
chains in the Genus database with same CATH superfamily
4JKCA 3NAEA 5HLFA 3KVGA 3MWPA 4XIUA 1N33K 4H5RA 3ASMA 3KK1A 4OKKA 2D0OA 3G4SN 3IG1A 3J7YP 1NKEA 2GV9A 4B9TA 3AVCA 4CEZA 4B9VA 4YOUA 3ZEUA 1RGIA 4H0YB 4Q0BA 1X3NA 3IDHA 3VGLA 4C8MA 2UUAK 3GBTA 3RR8A 3F9MA 4IFVA 1ZXOA 1HKCA 2YKMA 3AVMA 5AQYA 1U47A 4FWMA 3OS2A 5JS2A 3LAKA 1HPMA 3VESA 3O3HA 2FLOA 3CFRA 2HOEA 1VSLA 3WQUA 1GLAG 2A5XA 4CI6A 3OS1A 4E7KA 1QVGM 4H0XB 3WXIA 3LDQA 1NGBA 4PL7A 5KTQA 3IMXA 1KTQA 2Z1GA 5AZIA 2QWNA 4RCHA 4FJNA 1JLQA 4FJKA 5T7BA 1GLBG 5C2FA 4BRDA 4F9OA 1MU2A 3L4IA 4OLAA 1NK9A 2ASMA 2A1SA 2HHVA 3G71N 5TKWA 4YOYA 1KSPA 4FK2A 3QNOA 2FBVA 2KZZA 3E66A 3OBYA 4OPHA 2KFZA 4DHYA 5KQDA 3TPQA 5FPMA 2E1ZA 3FFIA 3FZFA 1VQPN 3LM2A 2O4IA 5C0YA 1MWMA 1DLOA 2F9WA 2NRRA 4FCYA 1GLCG 3UKUA 1WOQA 3TAMA 3J80O 4CJUA 3LDSA 4RTFD 4YY3K 5BRFA 4BDZA 3WNGA 3KTQA 3P5JA 5AQUA 3M8QA 3F9KA 3FZLA 3HOSA 4JKDA 3TSUA 3CCUN 3V9SA 3UKRA 3OW2M 2XY7A 1XWLA 4X62K 3ZEUB 3J7ZO 4C1NK 3VF2A 3PLAA 1EO1A 2QK9A 3T3FA 1LCUA 1HNVA 2YNFA 3DRRA 1VQKN 3SUNA 3F2KA 3LAMA 2HBKA 3MN6A 4M3TA 1Q9XA 4ZTFA 3DLRA 1KLMA 1NJZA 4KO0A 4CE9A 2E2OA 1GLEG 5GAGP 2XRIA 4DSEA 4R79A 3O4WA 5C10A 3L3VA 4PWDA 3S41A 4CGGA 2HHSA 1D4XA 2DFFA 2P9UA 3L0QA 4CIEA 3QEXA 5AZJB 5ADXA 3MXIA 1JLEA 4LC9B 1RDAA 3HOTA 1WBDA 4JS5A 2W6KA 3AV9A 5LJWA 3TAFA 5AZIB 3THXA 2E88A 1QHTA 2P9NB 1X9MA 1MDUB 3CCQN 3I55N 3OYIA 4BC4A 4DR2K 1HQUA 4DQPA 1TKDA 4EP4A 2F4VK 1VQNN 4E7LA 4JKBA 4CEOA 2IVPA 2W40A 1NLVA 3UKUB 3FGUA 4E89A 4H4OA 3PX0A 4OPJA 3O1WA 3V81A 1RTIA 4BGBA 4CJ5A 2Q1NA 4CGHA 3NH2A 3KZBA 3BY5A 4LF6K 2ZJQL 2IVNA 4DR4K 5AQKA 3UKRB 3FE1A 4DSLA 5TKYA 2G8IA 1HQEA 1YVNA 1A5VA 3RSEA 1KVBA 4F2SA 4JKHA 2ZJRL 3PSIA 2YX6A 5HRRA 4FSVA 3HP6A 1K8KA 5BRDA 2OPQA 4M41A 4MQ3A 1I3AA 1HKBA 4AHTA 3OYBA 4CZEA 2PZSA 2HNZA 4DTOA 3PUFA 3AA5X 1S22A 2QTDA 4O0JA 1ASUA 4DR3K 2F96A 2KW4A 2BUPA 2VG6A 4BWJA 3SJJA 3AGRA 5AQQA 3U6FA 2P9UB 1N6QA 4AHUA 3OBWA 2F8SA 3LP3A 1KAYA 2ITGA 2UXBK 2F8TA 1Z25A 4BVPA 1GOBA 4DTXA 3THXB 2OPRA 3SLCA 3I56N 3HVRA 1BG3A 3B6OA 3ISNC 2QKBA 3THYA 5J2MA 1BQMA 4DTRA 5AFUA 1H1VA 2A1RA 4H5VA 4DQSA 3H45C 1YTUA 2HHHK 3CHWA 3ZT1A 3S3MA 3O3FA 4H03B 5KPRA 3THWA 2O8BA 4A5BA 3H1QA 4ISGA 4WYBA 4A5AA 4CZLA 1WSEA 1TL3A 4BR9A 1T7PA 1W7AA 3MXMA 4KFBA 3QEPA 3E9OA 3T1YK 4CFCA 1CZ9A 3AO1A 2NNWA 1NOZA 2QWQA 2IAJA 3R9PA 3KD1E 4FWQA 3EN9A 1A5WA 1GLFO 1ATRA 2ITMA 2E8AA 3RSEB 1CZAN 4J2BA 1K8KB 4K41A 1HYVA 3GL1A 3K0SA 3TARA 3QLHA 1OVQA 2NRTA 1YIJN 1NK4A 4JEPA 3ENBA 2HHXA 3U4LA 4AM6A 2D0AA 3QINA 1RTHA 2RKIA 1WSFA 4W5NA 3KWGA 5CE3A 2QW9A 4EFHA 1SQKA 4JHDA 2IDOA 4LF5K 3SAFA 1C0MA 1DGKN 4KH5A 3ITHA 4YOWA 4CZKA 2GBZA 4CJPA 3HZ6A 3DWLA 4R5PA 2B6AA 2UU9K 3GG4A 5IWAK 3C6HA 3KK7A 4JI6K 3TWHA 4BACA 4BRIA 4BR5A 3CMAN 4BRHA 4CD3A 3THYB 4CERA 4GVMA 4CEFA 1E4GT 2NUBA 3DMJA 2CGJA 1YJ9N 3ZSZA 4CZIA 4FVUA 1JLAA 3FZMA 2KZMA 1VSFA 1KVCA 1WLJA 4ILHA 3THWB 1S72N 2O8BB 3TAEA 2IIRA 3A5LC 4PUOA 5M1PA 4GKKK 1ZBUA 1DTQA 3HXMA 3N4QA 4LSLA 1LAWA 5HBMA 1IG8A 3OJSA 1TK5A 3KLIA 4B1YB 5KRSA 3SBTA 1CXUA 2CH5A 2ZGYA 3NF9A 1M1KO 1OVYA 4DTSA 4KI6A 4FWPA 3VEVA 5F1XA 2WOMA 2Y1IA 3BZKA 4M42A 2QWLA 4BG8A 3ZSVA 3AA3A 1HMVA 1YXQA 4KH6A 3CG7A 4FWNA 3WNHA 5BPNA 2O8CA 2P5OA 3CCLN 4I9QA 5HL7L 5JS1A 3VQCA 1KAXA 1RT2A 3E9LA 4JK8A 4JHDB 4DUYK 3H3OB 1KFSA 3LPTA 4CGDA 4WQ4A 2ZE2A 4MLEA 2OTJN 1EKEA 1L3VA 1U48A 3W3DA 4O44A 2F7TA 3O9RA 1ZBFA 1HR0K 5AQPA 4Z0UA 4CFBA 1RT6A 4ZTJA 3OTOK 3QETA 4IKFA 3CMEN 3CXCM 2OANA 3L3UA 4A57A 4CK2A 4HCBA 1KFDA 5E41A 3OYHA 1JCFA 2QWOA 1SZ2A 4W5QA 1DKGD 1RBRA 4WCEL 1BA0A 2V51B 4DS4A 5FPEA 1RT3A 2QI2A 4DR5K 1Y97A 2Q97A 1B92A 4CJFA 5FPNA 1JKHA 3MWTA 1GLLO 1NMNA 4CHOA 1IKXA 4B9LA 5CHIA 1MA9B 3MN9A 2ATQA 3WEEA 2Y1JA 1QS4A 3T1AA 4BRKA 1BHLA 4B8CA 4OLBA 3H3NO 4M3WA 1NK7A 4HUGA 2HF3A 3PX4A 1VQ5N 1KAZA 3K5MA 3QMLA 1TK8A 4JLHA 4FK4A 1XNRK 3P38A 2O8CB 1SAZA 3K58A 2YJEA 4PQUA 4DV0K 4CFDA 5C24A 4BROA 4XH1A 5IT9O 2A41A 5K14A 4NCGA 4CGFA 3VQ8A 2OA8A 3KD5E 3E9PA 2DY4A 3SUQA 2O8DA 1D9FA 2PFUA 1LV5A 1YITN 4F8RA 4J8FA 2OCEA 4DFKA 2VQFK 3DM2A 2XHBA 4FJHA 3C94A 1BQNA 4DR1K 1Q7YO 2RF2A 3K5OA 4DTUA 3R3LA 4K25A 5EY4A 4Y0WA 2QXLA 2RN2A 4DQQA 4FJ7A 5FPDA 3HPOA 3KHYA 1RBTA 2WFBA 4IEEA 4O4GA 2AP1A 5DM6L 3EKUA 1S6PA 3FR0A 1Q9YA 1ZBLA 4IG0A 1REVA 2HNYA 1RBVA 2QWRA 1YI2N 1NOYA 4FK0A 2A42A 2P51A 3WEEB 4E19A 3I8DA 1WSGA 5DM7L 4K43A 3CJ9A 4JYAK 4I9LA 3CETA 1WSHA 3LDOA 1S3XA 3C0BA 1NGJA 3O80A 1SUQA 3TAGA 4M3ZA 1M90O 1W0HA 1J5OA 2P9SA 3RVCA 5KQ8A 4N41A 4Y1DA 5AQRA 3V1OA 1QSYA 4IFEA 4C8KA 1YVUA 2HB5A 4FWOA 2O8DB 2JWKA 3T19A 1J54A 3A5NC 4DSKA 4PKIA 3A8YA 3P4IA 5DMRA 3NF8A 4CJLA 4E3SA 4OPAA 2E20A 1VSMA 4B1ZA 3C6AA 4N47A 1BL3A 4CGJA 5I42A 3QEWA 5AQXA 2E4LA 1O1WA 3HVTA 2FF6A 4BR2A 4JI0K 3EYZA 2QEXN 5CYMA 1NGCA 1WUAA 4JAXA 3LP1A 3KLGA 4CESA 4QOZB 1VRTA 1U4BA 5AQWA 3PIPL 3TSQA 1TYQA 2VQEK 1OH6A 4KTQA 3SUPA 2D1KA 3CYMA 3TAPA 1CXQA 2ZM6K 3QICA 3ZT4A 3EEQA 3DLGA 4I2QA 4L8RB 3WXJA 4XH4A 1QZ5A 5JMVA 5AQFA 2HF4A 1VQ8N 1SS6A 4FYDA 1VQ9N 1BU6O 3DXKA 4EP5A 4NYNA 3O4NA 4O8UA 2CGKA 2W6LA 2WC9A 3OYKA 5BREA 1XQSC 2P9PA 1N36K 1BOTO 3ULEA 4DWIA 1UOCA 5JVHL 2JLEA 1WNSA 4A2AA 2XY5A 4JKAA 2P9SB 2G8HA 1HPZA 1GLDG 3HJFA 5AZJA 2PYJA 5KPTA 1IKWA 2GELA 4CZFA 4O0IA 3SMSA 3DRSA 2HHUA 1V4SA 3LP0A 3O9QA 3AVBA 2QWMA 4BQZA 3C95A 4DUZK 3T69A 2P9NA 2Q2RA 2OYQA 3LL3A 4DF8A 3OYGA 2YNHA 1X9JA 3K59A 3SUOA 4LH5A 1BDGA 4K8ZA 4IOCL 4B9MA 4L3QA 1EP4A 5LMUK 2GEMA 2OPPA 1HJRA 4DMNA 5JLFA 1IKVA 3MMVA 2BH1A 2Q3SA 2QWPA 3QERA 3OS0A 3O9TA 3ZX3A 1EWRA 3OA9A 4A59A 4DR7K 4CVNE 2V7YA 3VN5A 1NG9A 1TYQB 4M45A 3VGMA 3DXMA 4WQ4C 5AQMA 3DLKA 5AQLA 1NGDA 4F4KA 4EZ9A 3AVGA 5GIOA 3DI6A 1QQCA 3ATVA 2KKZA 5BR9A 1TK0A 3TTFA 4AHVA 1T6DA 1BWFO 3P39A 4BQLA 1J53A 3AO3A 4CGIA 3FZHA 4I2PA 3CQYA 3DXKB 3L2VA 4M7YA 1EWQA 3AA4A 1WBBA 2A6AA 4BRLA 4CJSA 2P9PB 4BY9C 1FXXA 5JLHA 3ULEB 4F3OA 2W42A 2ZD1A 1OKJA 3CM5A 2OZSA 5C42A 3CCRN 2G8FA 4KHQA 3CJAA 3ZSYA 4FZXC 3V9UA 4KHUA 2FC0A 3VQ7A 1VQLN 2NLXA 2NRZA 2P5GA 5DK5A 3VEZA 1QVFM 4CZGA 4MFBA 3M3ZA 4BVOA 3ZSRA 1S9GA 1T8EA 2JWLA 3O9UA 4W5TA 4ISEA 1DTTA 3G25A 2PBDA 1NGAA 5CR4A 4IZ9A 4OGEA 4M3RA 3LZIA 5MLCQ 3CQXA 3RR7A 1IBKK 3GOIA 2GWJA 3LP2A 2R7YA 4H0PA 3VF6A 1UWBA 3SNNA 4WFBL 4FLXA 3SPZA 5FDLA 4X64K 2F9TA 2HBJA 3I33A 2NZTA 4KB1A 4IFYA 3LM9A 1G15A 4QS9A 3RMBA 1HNIA 3P1GA 3DXMB 5C2DA 4BE2A 4B3TK 1TUUA 4JI8K 3WXLA 1LWEA 4NCAA 1JXEA 3AO5A 4KHYA 1GOAA 3V9ZA 2Q0RA 3AO2A 1QSSA 3NBPA 2Z1HA 3CC2N 1NK8A 3CERA 4ILGB 1Z26A 3LZJA 1T6CA 2UXCK 1YHQN 5HP1A 3QEIA 2G8VA 4KRFA 4BRQA 4FOEA 1Q18A 3HSCA 2OPSA 4E0DA 4E1NA 3AVFA 2E2NA 5CYQA 1L5UA 1O13A 1VQ7N 3AVAA 4CZJA 3J8AA 1U6ZA 1E4FT 3C7NA 4K0KK 2HMIA 2VYPA 1RCHA 4HTUA 2ASPA 1VQ4N 3D2FA 3VQ6A 4BE0A 4IWVA 4DLGA 3MXJA 3O1BA 2GUIA 4K8XA 1IBMK 4CIGA 3T1HK 3O5BA 3JAMO 3WXMB 3RRHA 3VQ4A 5LJVA 3CCJN 3IS9A 3VETA 1HRHA 4FO0A 4M3UA 4A62A 1SV5A 4HVJA 4CBWA 1LOTB 4BC3A 1U2VA 2Q36A 3FFKB 4LSNA 1WB9A 1RDWX 3HL8A 2ASOA 2HBLA 4B9SA 3CQ8A 2BDPA 3R8EA 3A0IX 4HUEA 3VENA 4FJ5A 3K9KA 1RT5A 2ZF5O 3BDPA 1Z05A 4DQ8A 3AAQA 5E84A 4KAZA 4DFPA 4CZHA 4BR4A 4KTWA 2HW3A 2QKKA 2Q0UA 4DV1K 3UB5A 5GAHP 3QBXA 1SKWA 1BA1A 2FSNA 2HBMA 5KI6A 1K6YA 4B1VA 2YHYA 1YJWN 4B1UB 3I8BA 4RW7A 3CM6A 4FVMA 4ID5A 4CJQA 5AQHA 4X66K 2QA4N 3T7ZA 5I3UA 1D9DA 1LWCA 3TI0A 4JNEA 1ZYQA 3L2QA 1X1PA 3V1QA 4LF8K 3C7NB 1ATSA 2CGLA 3D2FB 2B4JA 1QHAA 3M8RA 2X78A 3LDNA 3HM9A 3O6WA 2BGGA 3KKRA 4I6MA 5EVZA 5D3GA 3VTIA 4CEDA 3TR8A 4JI3K 1TAUA 4IJNA 3OJUA 3QFPA 1ZBSA 4EAHD 3NH0A 4YORA 4CECA 3FZKA 5LMNK 1RTJA 4CEEA 4FJXA 3VQDA 1BIZA 1BISA 2O8EA 5HRPA 1E3MA 3BGRA 4YOXA 4U7BA 2D5RA 1XNQK 3TANA 3NGIA 3MAQA 1C6VA 1U2VB 5EXWA 3C65A 3ZCMA 3SAHA 4MDAA 2P9LA 4NXNK 4KKOA 4NYFA 3WNEA 4N76A 4FWLA 1RDUA 2ZQBA 4IG3A 4BDPA 5HOOA 4RW8A 2I5JA 4JI2K 4B08A 1EETA 3NDKA 1C0FA 3AVHA 1BIUA 4OPKA 1S1VA 2UXDK 3R1XA 5BPMA 2X74A 5AQJA 4KREA 3HK2A 4ILJA 3V9XA 3UE5A 3ZX0A 3BUZB 1MWKA 1T3VA 3QBWA 4H5WA 2G8UA 3CD6N 4U67L 4HUFA 4IOAL 5FRNA 1NK5A 1J5EK 1RT4A 1ATNA 1NBWA 3SBGA 1LW2A 2OZMA 4BRCA 4BE1A 4B8AB 2HNDA 1UA1A 4MO5A 4CF8A 2E6MA 3DYAA 1TVRA 4I6MB 1XI1A 4DKWA 2DTUA 3D2EA 1TGOA 3DLEA 1NKCA 4CK1A 4CJEA 4BC2A 3CJBA 4PHTX 1HNXK 3B8AX 2VG7A 1B9DA 4CHZA 4XH5A 4CJRA 1GOCA 4ISFA 1WAJA 4DSFA 2A3ZA 2FSKA 2KLAA 4DTJA 4C8NA 2O8EB 2YHXA 3L8BA 3NVMA 1J9AA 3WXKA 2ZWHA 4QAGA 1P90A 3SV4A 1TKXA 4FW2A 1NJXA 3H1VX 4H0TB 2UUCK 3ID8A 3WT0A 3KLFA 4DV4K 3L2WA 2P9LB 3N4PA 2DFEA 2RPIA 2ZGZA 3HYFA 3UIQA 1JLFA 4DFMA 4PY5A 4NO7A 1VQ6N 1RDDA 5SZTA 4FJ9A 4ELVA 1C1AA 4LY7A 3SZ2A 1FJGK 5BN8A 3ZETA 3VQBA 3TSPA 5KRTA 4OKEA 1IBLK 4FPBA 3QEVA 4J2EA 3NHGA 1CZBA 2AA4A 5ADXH 5AJ3K 2DPNA 4I7FA 3RTVA 3NGZA 1XC9A 3L2UA 3HTVA 1TKTA 3VQEA 3VOVA 5AQVA 1RILA 1KXPA 3DJCA 2E6LA 3KKSA 4F3TA 1I39A 1QZ6A 5EU7A 1KCFA 3SMPA 4FLZA 1K8AO 4MLHA 4WF9L 3E1YA 5JVGL 2O8FA 3SQ4A 5SWMA 3MEDA 4DV3K 4C23A 3BP8A 1KVAA 3NE6A 1VSIA 4WQ5A 3K57A 4DLEA 1S1TA 3D2EB 3L4QA 4BRAA 3GE1A 5BN9A 5C25A 1Q81O 4DV2K 2IGIA 4B3MK 3MDQA 4N56A 4FM2A 3VQ5A 1Q8IA 3HI0A 4CF2A 5AQIA 3ZSXA 1NWKA 1S9EA 4OVLA 1OH5A 3AO4A 4OJRA 3SI6A 2UYTA 5LL6Z 3SK3A 1I94K 4B9QA 5M1FA 2QXFA 4LH4A 2D0BA 4Q5VA 4A2BA 5J2QA 4GMJB 4M7XA 3MN5A 4WFAL 3MN7A 3VTHA 2D0CA 1IG9A 4BRMA 1FK9A 4BDYA 4CBXA 5J2NA 1G99A 1HUXA 3DOLA 3HRGA 4DTPA 1ILYA 3ID6A 1C0GA 4CEAA 5FRMA 3ZETB 2XY8A 2PAVA 3CC7N 4FWRA 1T03A 3M6GA 1VK0A 2FSJA 5FLXO 1JCGA 3TTCA 1JXBA 3VPZA 1ASWA 2VCPA 4M3YA 1TUYA 1D8YA 1J6ZA 4B1XB 2OTLN 4KH4A 3ULDA 1B9FA 4B1WB 3THVA 3A5MC 4QS8A 4IOXA 3Q7CA 4C1NI 4FJIA 3IAYA 1BCMA 4E7HA 1W97L 1TL1A 5AFUH 3I0RA 2O8FB 4WE1A 1JL2A 1KLNA 2GTDA 4FWKA 5AQZA 1QQMA 4BG9A 1W9HA 1S6QA 2G8KA 4FLYA 4KHNA 4JRQA 4JI4K 3LPUA 3P31A 4JS4A 1N5YA 3PSFA 5H1SQ 3HSTB 4PL8A 4IXCA 5J1EA 3HM8A 3PX6A 3SQ0A 1N8RO 4HWIA 4JN4A 3U3GA 1C1BA 3OYDA 4AM7A 4LD0A 3M8PA 5GIPA 1YTAA 3QIPA 4X65K 1NK6A 1X9WA 4LF9K 3S9HA 2NRVA 1JL1A 2P9IA 3KLHA 1RNHA 4GY2B 4AH9A 3V1RA 1CLQA 4ICLA 1V4TA 2Z1IA 4FM0A 1YAGA 4CFAA 4YNQA 3CI5A 3E01A 2E2PA 4FZZA 4IEIA 4Z4CA 1IV0A 2HMPA 2NRWA 3VQ9A 3MX2A 3LDLA 3R6MA 3NF6A 1FKPA 1WSJA 1XC3A 5F2RA 4H4MA 2VGNA 2DFHA 1Q86O 2PY5A 4QCLA 1VSEA 3ZSQA 4F2RA 4OX9K 4IO9L 3FLCO 4DR6K 3KK3A 4Z4EA 5F0XA 3D0PA 4JKFA 4DQRA 1OH8A 1ZC6A 4JRPA 4BRPA 4GV6A 1OH7A 1NGGA 1W2BM 2BANA 3BF1A 1IH7A 3B6PA 4BRGA 3K9JA 4QS7A 3G6EN 2J4RA 5M1QA 4KTZA 4C8LA 4FM1A 3O4QA 2VWKA 4G1QA 2VG5A 1XUPO 4HCCA 2Q31A 2X6SA 2IS3A 3MCAB 3AVKA 1P8ZA 4CK3A 4BGAA 3JXUA 3O9SA 3RWUA 3ENHA 5BPLA 2Z1JA 5GAEP 4JI1K 4CJWA 1JLGA 4DSJA 3KK2A 2B5JA 4CHYA 4O8KA 3D6RA 1IJJA 1VSKA 1GLJO 4YOVA 1XMQK 5GINA 3CJ1A 3VEOA 3MEGA 2P9IB 3SYZA 3AAPA 5AR0A 1YJNN 1NU0A 3ZX2A 4B3RK 2HHQA 4ELUA 3WUHA 3AA2A 1K73O 3GDQA 1HJOA 4ZHRA 1NGHA 3SAGA 3CCVN 5EOYA 4FPAA 1NJIO 1XHXA 5AQSA 4JK7A 1XMOK 3PY8A 1QSLA 1HX1A 2H3GX 4FLVA 3CPEA 3J81O 4V19S 3F5TA 1NMDA 4YDUA 4CHQA 3IKMA 5ELZA 4YOTA 5AQGA 3QESA 1BGXT 4DSIA 2GUPA 4YHHK 3W0LA 1WAFA 1HLUA 3O3GA 1ZBIA 3V4IA 3VQAA 4N5SA 4CBUA 4CIFA 1X9SA 4EHTA 3CCEN 4KV8A 2P9KA 1WSIA 3M5RA 3BF3A 3CIPA 1U04A 3ZLJA 2YCHA 3AVJA 2LSNA 5HROA 4CF0A 5FROA 3IRXA 3HPGA 1ASVA 2NRXA 4CEBA 3OHRA 2QM1A 2YHWA 4WQ5C 3O8MA 3ENOA 1Z6RA 1KD1O 3OYMA 2EHGA 4H8KA 2VGMA 4KBOA 3TAQA 4IDHA 4A61A 4DV7K 2EWSA 3RMDA 4H5TA 1TV6A 2XO7A 3KWIA 1VSDA 3HO1A 1VHXA 3QO9A 4FW1A 5EX5A 3U9ZA 3ZSWA 3RMCA 4CW7B 1NKBA 1R0AA 1DEJA 3VEXA 3WQTA 4JD2A 3DOKA 4C8OA 2BTFA 1C0UA 4AQYK 3S3NA 2KHOA 1JJ2M 3CFOA 3TABA 3QDKA 1JLCA 1TKZA 4ID1A 4O5FA 3IUCA 2WTUA 4NCBA 4RW4A 3L2RA 3OYCA 2E5LK 3P83D 1EXQA 4DS5A 3WNFA 1YUWA 3AVNA 1D5AA 3NMUA 2GX9A 4G9ZA 2YKNA 1UA0A 2HSTA 4Z4IA 1SL2A 4E1JA 1VRUA 1NGIA 5I9EB 4FLTA 3OYEA 2WUSA 4DU1A 5CZ2A 1RBSA 4FLWA 4DTNA 3DRPA 2I7NA 2P9KB 3PV8A 2HVIA 2WBNA 5J2PA 4AHSA 5AQNA 3TU5A 1HNZK 3BEXA 3VEWA 3HT3A 1NM1A 3IFRA 2VWBA 4H0VB 4FJMA 4GKJK 3SV3A 4LFAK 2CH6A 3NFAA 4EHUA 2UUBK 3ZT3A 4BC5A 3H46O 4LF4K 3DLHA 4KHSA 2KFNA 1EQYA 4H0OA 3F73A 3PO4A 4TSXA 4OGCA 4DTMA 2V52B 1SL0A 4M3XA 2NRHA 4BREA 4DB3A 3QB0A 2FF3B 4HHTA 3V9WA 5B8HA 3H6EA 5AQTA 1C0TA 4KHPK 1QQOA 4DV6K 1S1WA 4CJ4A 1RT7A 4JV5K 4O5BA 1QTMA 4JD2B 3LWMA 4DG1A 4DF4A 3QNNA 1RTDA 4CJKA 5M1KA 4YFUA 4B3OA 1A5XA 4JI5K 4CHPA 2FBYA 3VERA 4GNIA 3HP9A 3G0ZA 3C6TA 1ITGA 4KB0A 2HVHA 1BCOA 4IDKA 3AVIA 3MEEA 4GV9A 1N32K 1SKRA 3ZYYX 3OVNA 3JSMA 3MECA 2HHWA 4E1MA 2AJQA 5GADP 1SKSA 4CJ7A 3OYFA 4J2AA 4LFCK 3U8XA 3HBTA 4GW6A 3HPHA 4FL9A 3MK6A 4FZYA 4Z4HA 1HYSA 1NJWA 1F21A 3ZT2A 3CFPA 4FXDA 3U9DA 1C1CA 4E7JA 4CCHA 3CCSN 3LALA 4IJAA 2FBTA 3NGYA 1R59O 4W5OA 1UAXA 1VAZA 3A5OC 1LWFA 2YI1A 4PA1A 4DFJA 4MDBA 3ZT0A 3EY1A 5BRHA 4CHNA 2WONA 4FJLA 4FJ8A 1Y64A 1HYZA 3NF7A 3OY9A 4FOIA 3D45A 4BRFA 4ELTA 1RDBA 5HRSA 1RBUA 4DCHA 4FJJA 4RG8A 3OYNA 3A2FA 2W41A 1NJYA 2IVOA 3I0SA 1XHZA 2G8WA 4Z94A 1VSJA 3CJCA 1RDCA 5BR8K 2YHBA 1U45A 2EX3A 3RMAA 3LANA 1X3MA 4H5NA 3EZ5A 1S1UA 3JYTA 1KQSM 1RFQA 3LDPA 5CZ1A 1NK0A 3OYAA 1HKGA 1L3UA 4CZMA 2ETJA 2O4GA 2KQ2A 3AGKA 3L6QA 3EE9A 1VSHA 2ZJPL 4EZ6A 3DLBA 4JI7K 4B9UA 2V7ZA 5C15A 4PKGA 1ZBHA 4W5RA 4E7IA 4YDUC 3V6DA 4CEQA 3AY9A 5C12A 5A2QO 3DAWA 4DV5K 4NLCA 4DU3A 1BUPA 4BR0A 1BI4A 3CF5L 4B3SK 3VF4A 3O08A 3CJ7A 4KPYA 5CY4A 4UQGA 3H08A 3SQ1A 1FW6A 3SPYA 1YT3A 1NGEA 4FWSA 1NNEA 3S3OA 2IOCA 1RT1A 2YJFA 4AF1A 4CF1A 4XEIA 3U3YA 2X6NA 4JKGA 4RW9A 4RWTA 4EIAA 3PIOL 4J2DA 4IO8A 3DLLL 3M8SA 4FLUA 4B9NA 4CJVA 1KRPA 1Q82O 4AHCA 3EL2A 4RW6A 1LW0A 3NVKA 3NH1A 2BE2A 2YV0X 4KI4A 1T05A 2VWJA 3SQ2A 1ESVA 3VMFB 3ALYA 1JCEA 4FJGA 3Q7BA 1KC8O 2I7PA 3SJHA 5E26A 3RRGA 4LFBK 3MCPA 2IC3A 3BZCA 2PYLA 2YNGA 4BWMA 4NXMK 3C6UA 3VEYA 3ATUA 3D7EO 4UY8O 4Z4FA 3KJVA 1EX4A 2FBXA 4M63C 4Y1CA 1IO2A 4DQIA 3TTDA 1S1XA 2E2QA 4GV3A 3VQQA 2P1JA 1L3TA 1JLBA 1BI4B 4LF7K 3QIOA 4KHWA 3AVLA 5LY3A 4OO1J 3J7AP 2GWKA 4AILC 2A40A 3VGKA 3OYLA 1S5JA 5HRNA 3LWLA 3NCIA 2HHTA 1YF5L 3EZWA 3CPWM 4HTLA 4PKHA 3CC4N 1FKOA 3OYJA 2YNIA 4GVEA 1LAVA 3VA3A 2RHKA 1HNWK 1TAQA 3PO5A 4MO4A 3CCMN 1DT9A 4JKGB 1U49A 3K5NA 3EKSA 4Z4GA 3VQPA 1QQNA 3AARA 3EO3A 4WFNL 3SCXA 2FXUA 3JS6A 4OKJA 1IKYA 1NGFA 4O55A 4CD1A 4CJTA 3KLEA 3M1FA 4NLBA 2D0PA 3ZSOA 4K42A 2KTQA 4BRNA 1T44A 4AHRA 4DU4A 1L3SA 5M1OA 4IBNA 3K5LA 3G10A 2RE2A 4JK9A 2E1YA 1VQON 1BO5O 1QE1A 3K2PA 5JICA 3EE8A 1N34K 1VQMN 4CJ3A 3VA0A 2D4WA 1SL1A 5M1NA 3MX5A 5KGWA 1WN7A 5KPZA 4JKEA 2XY6A 5KGXA 5AQOA 3QFUA 1K9MO 4NB4A 2YHAA 4CF9A 3KIOA 2JGUA 4BR7A
chains in the Genus database with same CATH topology
2ATQA 2B4JA 4CIFA 1QS4A 3T1AA 1X9SA 3NAEA 5HLFA 1BHLA 4B8CA 4OLBA 4KV8A 1WSIA 4M3WA 3M8RA 4XIUA 2X78A 4HUGA 1NK7A 1U04A 3HM9A 3PX4A 2BGGA 3ASMA 3AVJA 3KKRA 4OKKA 3KK1A 5D3GA 2LSNA 3IG1A 3TR8A 4CEDA 2GV9A 5HROA 3AVCA 1NKEA 4B9TA 4CF0A 5FROA 1TAUA 3IRXA 3OJUA 3K5MA 3HPGA 1TK8A 1ASVA 4JLHA 4CEZA 4FK4A 4B9VA 4CEBA 3NH0A 3K58A 4CECA 4PQUA 4Q0BA 1RTJA 4CEEA 4CFDA 5C24A 3VQDA 1BIZA 4FJXA 1BISA 4C8MA 5HRPA 3OYMA 5K14A 3BGRA 2EHGA 4NCGA 4H8KA 4CGFA 3VQ8A 2OA8A 3RR8A 2D5RA 3KD5E 2DY4A 3SUQA 4IFVA 3TANA 3NGIA 3MAQA 1C6VA 3TAQA 1D9FA 2YKMA 3ZCMA 1LV5A 4F8RA 3AVMA 4DFKA 1U47A 3RMDA 3OS2A 5JS2A 3DM2A 3LAKA 2XHBA 1TV6A 2XO7A 4KKOA 4NYFA 3WNEA 4FJHA 3C94A 1BQNA 1VSDA 3O3HA 4N76A 3CFRA 3HO1A 2ZQBA 4IG3A 4BDPA 1VSLA 3QO9A 4RW8A 2I5JA 2RF2A 4FW1A 4B08A 3OS1A 4E7KA 3K5OA 3ZSWA 3RMCA 4DTUA 1NKBA 1R0AA 1EETA 3NDKA 3DOKA 3AVHA 4C8OA 2RN2A 1BIUA 1C0UA 1S1VA 4OPKA 3S3NA 2X74A 4DQQA 4FJ7A 4KREA 5KTQA 3HK2A 3V9XA 1KTQA 2Z1GA 3CFOA 4ID1A 1JLCA 1TKZA 3HPOA 3TABA 1RBTA 4NCBA 4RW4A 3L2RA 1JLQA 4FJKA 3OYCA 4FJNA 4O4GA 5T7BA 3P83D 1EXQA 4DS5A 2G8UA 1MU2A 1S6PA 1Q9YA 4OLAA 3WNFA 1ZBLA 1NK9A 3AVNA 1D5AA 2A1SA 1REVA 4IG0A 2HHVA 2HNYA 1RBVA 4HUFA 5FRNA 1KSPA 2YKNA 1UA0A 1NK5A 4FK2A 3QNOA 4Z4IA 1RT4A 2FBVA 2KZZA 1SL2A 1NOYA 1VRUA 2KFZA 4FLTA 4FK0A 3OYEA 3FFIA 4DU1A 2O4IA 1LW2A 2P51A 5CZ2A 1RBSA 1DLOA 4E19A 4FCYA 4FLWA 4DTNA 2OZMA 3I8DA 4BE1A 1WSGA 3DRPA 4B8AB 3TAMA 2HNDA 1UA1A 4CJUA 3PV8A 3LDSA 4CF8A 2HVIA 2E6MA 5J2PA 4I9LA 3DYAA 4AHSA 1TVRA 4BDZA 1WSHA 3WNGA 1XI1A 3P5JA 3KTQA 2DTUA 1TGOA 3DLEA 1NKCA 4CK1A 4CJEA 3HT3A 3M8QA 3F9KA 4FJMA 1SUQA 3SV3A 2VG7A 3V9SA 1B9DA 4CHZA 3TAGA 4M3ZA 4CJRA 1GOCA 1XWLA 2XY7A 3NFAA 1W0HA 1WAJA 4DSFA 1J5OA 4DTJA 3ZT3A 4C8NA 2QK9A 3L8BA 3T3FA 4N41A 1J9AA 1HNVA 4Y1DA 1QSYA 3V1OA 3DLHA 2YNFA 4KHSA 4C8KA 1YVUA 2HB5A 2KFNA 4QAGA 3DRRA 3F73A 3SV4A 3SUNA 3PO4A 1TKXA 4TSXA 4FW2A 3LAMA 4OGCA 1NJXA 4DTMA 1SL0A 3T19A 1J54A 4M3TA 1Q9XA 4M3XA 4ZTFA 4DSKA 3DLRA 3KLFA 3L2WA 4HHTA 1KLMA 1NJZA 4KO0A 4CE9A 2DFEA 2RPIA 3V9WA 3HYFA 5DMRA 3UIQA 3NF8A 1C0TA 1JLFA 4DFMA 4CJLA 2XRIA 4DSEA 4E3SA 4PY5A 3L3VA 1VSMA 1RDDA 5SZTA 1S1WA 4CJ4A 4FJ9A 4PWDA 4ELVA 1RT7A 1BL3A 4O5BA 4N47A 4CGJA 1C1AA 4CGGA 5I42A 4LY7A 3SZ2A 1QTMA 3QEWA 2HHSA 2E4LA 1O1WA 2DFFA 3HVTA 4CIEA 3QEXA 3VQBA 3LWMA 3EYZA 3MXIA 4DG1A 5KRTA 4OKEA 5CYMA 1JLEA 4DF4A 3QNNA 4CJKA 1RTDA 1RDAA 4YFUA 4JS5A 3QEVA 4J2EA 3NHGA 1CZBA 4B3OA 3LP1A 1A5XA 3AV9A 4CHPA 3KLGA 3TAFA 4I7FA 2FBYA 4CESA 4QOZB 1VRTA 1QHTA 1U4BA 3HP9A 1X9MA 3RTVA 3G0ZA 3NGZA 1XC9A 3C6TA 3L2UA 1TKTA 3VQEA 1ITGA 3OYIA 4KB0A 1RILA 2HVHA 1BCOA 4KTQA 2E6LA 3SUPA 1HQUA 3CYMA 4IDKA 4DQPA 3TAPA 1CXQA 3AVIA 3MEEA 3KKSA 1TKDA 4EP4A 3ZT4A 4F3TA 3DLGA 1SKRA 1I39A 4I2QA 5EU7A 4L8RB 1KCFA 3OVNA 4FLZA 4E7LA 3JSMA 3MECA 4CEOA 2HHWA 4E1MA 4FYDA 2AJQA 3SQ4A 4E89A 4H4OA 3PX0A 1SKSA 4OPJA 5SWMA 3MEDA 4EP5A 3OYFA 4NYNA 3V81A 3O4NA 4J2AA 1KVAA 3NE6A 1VSIA 3OYKA 3K57A 4DLEA 1S1TA 1RTIA 4CJ5A 4CGHA 4GW6A 3HPHA 3NH2A 4DWIA 5C25A 1UOCA 2IGIA 4N56A 4FM2A 1Q8IA 2JLEA 1WNSA 3VQ5A 4Z4HA 4CF2A 3ZSXA 4OVLA 1S9EA 4FZYA 2XY5A 1HYSA 1NJWA 1F21A 3ZT2A 3CFPA 4DSLA 3AO4A 4OJRA 3SI6A 1HQEA 2G8HA 2G8IA 4FXDA 1A5VA 1HPZA 3HJFA 1KVBA 2PYJA 4F2SA 1C1CA 5HRRA 1IKWA 3HP6A 4E7JA 4CCHA 2OPQA 4O0IA 4M41A 3DRSA 2HHUA 3LALA 3LP0A 2FBTA 3AVBA 2QXFA 3NGYA 4LH4A 2D0BA 3C95A 4MQ3A 4W5OA 1UAXA 4PA1A 1LWFA 1I3AA 4AHTA 4Q5VA 3OYBA 4GMJB 4DFJA 5J2QA 4DF8A 2PZSA 3OYGA 2YNHA 3ZT0A 3EY1A 3K59A 2OYQA 2HNZA 3SUOA 4CHNA 2WONA 4LH5A 4FJLA 3PUFA 4FJ8A 3AA5X 2D0CA 4K8ZA 1HYZA 4O0JA 1IG9A 1ASUA 1FK9A 2KW4A 2F96A 3NF7A 4BDYA 5J2NA 1EP4A 3OY9A 3DOLA 4DTPA 2VG6A 2OPPA 3D45A 4BWJA 3SJJA 4ELTA 1HJRA 1RDBA 3U6FA 5HRSA 4CEAA 4AHUA 1RBUA 4DMNA 1N6QA 5FRMA 2XY8A 1IKVA 2F8SA 4FJJA 4RG8A 3OYNA 1T03A 3LP3A 3A2FA 1VK0A 2ITGA 2F8TA 2Q3SA 1NJYA 3QERA 1Z25A 1JXBA 3OS0A 1ASWA 1GOBA 4DTXA 3I0SA 2OPRA 1XHZA 2G8WA 3VN5A 4M3YA 1D8YA 4M45A 1VSJA 3HVRA 3B6OA 1RDCA 2YHBA 3ISNC 1U45A 2QKBA 3DLKA 5J2MA 3ULDA 4F4KA 1B9FA 3THVA 2EX3A 1BQMA 4EZ9A 4DTRA 3AVGA 3RMAA 3LANA 2A1RA 3DI6A 1QQCA 4DQSA 3EZ5A 1S1UA 3JYTA 1TK0A 4FJIA 1YTUA 3IAYA 1BCMA 3ZT1A 4AHVA 5CZ1A 4E7HA 3S3MA 1NK0A 1TL1A 3O3FA 1J53A 3I0RA 3OYAA 3AO3A 4CGIA 4WE1A 1L3UA 2ETJA 4I2PA 1JL2A 2O4GA 3L2VA 1KLNA 2KQ2A 1WSEA 1TL3A 3AA4A 1VSHA 1T7PA 4EZ6A 3DLBA 4B9UA 4CJSA 1W9HA 3MXMA 4KFBA 1FXXA 3QEPA 1ZBHA 4W5RA 1S6QA 2G8KA 4FLYA 4CFCA 1CZ9A 4F3OA 2W42A 2ZD1A 3AO1A 4JRQA 4KHNA 1NOZA 3CM5A 2IAJA 5C42A 2OZSA 4E7IA 3LPUA 3KD1E 2G8FA 4JS4A 1A5WA 4CEQA 3V6DA 1N5YA 4KHQA 3ZSYA 3HSTB 4DU3A 5J1EA 1BI4A 4FZXC 3V9UA 3PX6A 2FC0A 3VQ7A 4J2BA 4KHUA 4KPYA 3SQ0A 5DK5A 2P5GA 1HYVA 3U3GA 5CY4A 1C1BA 3OYDA 4MFBA 3TARA 3QLHA 4UQGA 3H08A 3SQ1A 1NK4A 3ZSRA 4LD0A 1S9GA 3M8PA 3SPYA 1YT3A 1T8EA 4W5TA 1DTTA 1YTAA 2HHXA 3S3OA 3QIPA 2IOCA 1RT1A 2D0AA 3QINA 4OGEA 4M3RA 1RTHA 3LZIA 2RKIA 1NK6A 3RR7A 1X9WA 4CF1A 1WSFA 3U3YA 4W5NA 2X6NA 4RW9A 3S9HA 3LP2A 2R7YA 1JL1A 3KLHA 1RNHA 4J2DA 2IDOA 4AH9A 3V1RA 1CLQA 4ICLA 2Z1IA 4FM0A 1UWBA 3M8SA 1C0MA 4FLUA 3SNNA 3ITHA 4FLXA 4CFAA 3SPZA 4YNQA 5FDLA 3E01A 4B9NA 2GBZA 4CJVA 4CJPA 1KRPA 4AHCA 4FZZA 4R5PA 4RW6A 1LW0A 2B6AA 4Z4CA 3NH1A 2BE2A 4IFYA 3VQ9A 2YV0X 4KB1A 1G15A 4KI4A 3NF6A 3TWHA 1FKPA 1HNIA 3RMBA 4BACA 3P1GA 1T05A 1WSJA 2VWJA 3SQ2A 4H4MA 4BE2A 4CERA 2DFHA 4GVMA 4QCLA 2PY5A 1LWEA 4CEFA 1JXEA 3AO5A 4NCAA 1VSEA 4KHYA 1GOAA 2NUBA 3ALYA 3ZSQA 3DMJA 4F2RA 3V9ZA 4FJGA 3ZSZA 3AO2A 1QSSA 3RRGA 1JLAA 3NBPA 2Z1HA 3KK3A 1NK8A 4Z4EA 2KZMA 1VSFA 2IC3A 1Z26A 3D0PA 3LZJA 4DQRA 4HCCA 4JRPA 2YNGA 1KVCA 1WLJA 2PYLA 4BWMA 3TAEA 3QEIA 5HP1A 2G8VA 4KRFA 2BANA 4PUOA 1ZBUA 1IH7A 1DTQA 2OPSA 3C6UA 3HXMA 4E0DA 4LSLA 1LAWA 3B6PA 5HBMA 4E1NA 3OJSA 3KJVA 4Z4FA 1EX4A 3AVFA 5CYQA 2FBXA 1L5UA 1TK5A 3KLIA 4Y1CA 5KRSA 3AVAA 1CXUA 4KTZA 1IO2A 4DQIA 3NF9A 1S1XA 2HMIA 4C8LA 1RCHA 3VQQA 2P1JA 3O4QA 2VWKA 4G1QA 2VG5A 4HTUA 4FM1A 4DTSA 3VQ6A 1JLBA 2X6SA 1L3TA 4KI6A 4BE0A 1BI4B 2IS3A 2WOMA 3QIOA 3AVLA 3AVKA 4DLGA 4CK3A 3MXJA 2Y1IA 4KHWA 2GUIA 3RWUA 4K8XA 2Z1JA 4CIGA 4M42A 4AILC 3OYLA 3ZSVA 1S5JA 3AA3A 1HMVA 5HRNA 4CJWA 3LWLA 3NCIA 4B9MA 2HHTA 3CG7A 1JLGA 3WNHA 3RRHA 3KK2A 4DSJA 2B5JA 3VQ4A 4CHYA 2P5OA 1FKOA 4I9QA 3OYJA 2YNIA 1LAVA 3VA3A 3IS9A 1VSKA 1HRHA 1TAQA 5JS1A 3PO5A 4M3UA 3VQCA 1U49A 1SV5A 3K5NA 4HVJA 1RT2A 4Z4GA 3MEGA 3VQPA 4LSNA 3SYZA 1KFSA 3LPTA 3HL8A 4CGDA 3SCXA 2ZE2A 4OKJA 4B9SA 1IKYA 4O55A 2HHQA 3CQ8A 4ELUA 1EKEA 2BDPA 4CJTA 1L3VA 4HUEA 3AA2A 1U48A 3KLEA 4FJ5A 4O44A 3ZSOA 4ZHRA 1ZBFA 1RT5A 3BDPA 4Z0UA 2KTQA 4CFBA 1RT6A 4ZTJA 4KAZA 1XHXA 4DFPA 4AHRA 4DU4A 1L3SA 3QETA 4IKFA 4IBNA 3L3UA 3K5LA 3G10A 4KTWA 4CK2A 3PY8A 1KFDA 4HCBA 5E41A 3OYHA 2QKKA 2HW3A 1QSLA 1SKWA 1QE1A 4FLVA 4W5QA 5KI6A 3K2PA 1K6YA 1RBRA 4CJ3A 4RW7A 3VA0A 3CM6A 4FVMA 4DS4A 4ID5A 4CHQA 1SL1A 1RT3A 4CJQA 1Y97A 5KGWA 1B92A 1WN7A 4CJFA 2XY6A 5KGXA 5I3UA 1D9DA 3QESA 1JKHA 1LWCA 1BGXT 3TI0A 1ZYQA 3L2QA 4DSIA 1X1PA 4CHOA 1IKXA 1WAFA 3V1QA 2YHAA 3O3GA 4B9LA 4CF9A 3V4IA 1ZBIA 3KIOA 2JGUA 3VQAA 4DTOA 4N5SA 2Y1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATQ A;  2B4J A;  4CIF A;  1QS4 A;  3T1A A;  1X9S A;  3NAE A;  5HLF A;  1BHL A;  4B8C A;  4OLB A;  4KV8 A;  1WSI A;  4M3W A;  3M8R A;  4XIU A;  2X78 A;  4HUG A;  1NK7 A;  1U04 A;  3HM9 A;  3PX4 A;  2BGG A;  3ASM A;  3AVJ A;  3KKR A;  4OKK A;  3KK1 A;  5D3G A;  2LSN A;  3IG1 A;  3TR8 A;  4CED A;  2GV9 A;  5HRO A;  3AVC A;  1NKE A;  4B9T A;  4CF0 A;  5FRO A;  1TAU A;  3IRX A;  3OJU A;  3K5M A;  3HPG A;  1TK8 A;  1ASV A;  4JLH A;  4CEZ A;  4FK4 A;  4B9V A;  4CEB A;  3NH0 A;  3K58 A;  4CEC A;  4PQU A;  4Q0B A;  1RTJ A;  4CEE A;  4CFD A;  5C24 A;  3VQD A;  1BIZ A;  4FJX A;  1BIS A;  4C8M A;  5HRP A;  3OYM A;  5K14 A;  3BGR A;  2EHG A;  4NCG A;  4H8K A;  4CGF A;  3VQ8 A;  2OA8 A;  3RR8 A;  2D5R A;  3KD5 E;  2DY4 A;  3SUQ A;  4IFV A;  3TAN A;  3NGI A;  3MAQ A;  1C6V A;  3TAQ A;  1D9F A;  2YKM A;  3ZCM A;  1LV5 A;  4F8R A;  3AVM A;  4DFK A;  1U47 A;  3RMD A;  3OS2 A;  5JS2 A;  3DM2 A;  3LAK A;  2XHB A;  1TV6 A;  2XO7 A;  4KKO A;  4NYF A;  3WNE A;  4FJH A;  3C94 A;  1BQN A;  1VSD A;  3O3H A;  4N76 A;  3CFR A;  3HO1 A;  2ZQB A;  4IG3 A;  4BDP A;  1VSL A;  3QO9 A;  4RW8 A;  2I5J A;  2RF2 A;  4FW1 A;  4B08 A;  3OS1 A;  4E7K A;  3K5O A;  3ZSW A;  3RMC A;  4DTU A;  1NKB A;  1R0A A;  1EET A;  3NDK A;  3DOK A;  3AVH A;  4C8O A;  2RN2 A;  1BIU A;  1C0U A;  1S1V A;  4OPK A;  3S3N A;  2X74 A;  4DQQ A;  4FJ7 A;  4KRE A;  5KTQ A;  3HK2 A;  3V9X A;  1KTQ A;  2Z1G A;  3CFO A;  4ID1 A;  1JLC A;  1TKZ A;  3HPO A;  3TAB A;  1RBT A;  4NCB A;  4RW4 A;  3L2R A;  1JLQ A;  4FJK A;  3OYC A;  4FJN A;  4O4G A;  5T7B A;  3P83 D;  1EXQ A;  4DS5 A;  2G8U A;  1MU2 A;  1S6P A;  1Q9Y A;  4OLA A;  3WNF A;  1ZBL A;  1NK9 A;  3AVN A;  1D5A A;  2A1S A;  1REV A;  4IG0 A;  2HHV A;  2HNY A;  1RBV A;  4HUF A;  5FRN A;  1KSP A;  2YKN A;  1UA0 A;  1NK5 A;  4FK2 A;  3QNO A;  4Z4I A;  1RT4 A;  2FBV A;  2KZZ A;  1SL2 A;  1NOY A;  1VRU A;  2KFZ A;  4FLT A;  4FK0 A;  3OYE A;  3FFI A;  4DU1 A;  2O4I A;  1LW2 A;  2P51 A;  5CZ2 A;  1RBS A;  1DLO A;  4E19 A;  4FCY A;  4FLW A;  4DTN A;  2OZM A;  3I8D A;  4BE1 A;  1WSG A;  3DRP A;  4B8A B;  3TAM A;  2HND A;  1UA1 A;  4CJU A;  3PV8 A;  3LDS A;  4CF8 A;  2HVI A;  2E6M A;  5J2P A;  4I9L A;  3DYA A;  4AHS A;  1TVR A;  4BDZ A;  1WSH A;  3WNG A;  1XI1 A;  3P5J A;  3KTQ A;  2DTU A;  1TGO A;  3DLE A;  1NKC A;  4CK1 A;  4CJE A;  3HT3 A;  3M8Q A;  3F9K A;  4FJM A;  1SUQ A;  3SV3 A;  2VG7 A;  3V9S A;  1B9D A;  4CHZ A;  3TAG A;  4M3Z A;  4CJR A;  1GOC A;  1XWL A;  2XY7 A;  3NFA A;  1W0H A;  1WAJ A;  4DSF A;  1J5O A;  4DTJ A;  3ZT3 A;  4C8N A;  2QK9 A;  3L8B A;  3T3F A;  4N41 A;  1J9A A;  1HNV A;  4Y1D A;  1QSY A;  3V1O A;  3DLH A;  2YNF A;  4KHS A;  4C8K A;  1YVU A;  2HB5 A;  2KFN A;  4QAG A;  3DRR A;  3F73 A;  3SV4 A;  3SUN A;  3PO4 A;  1TKX A;  4TSX A;  4FW2 A;  3LAM A;  4OGC A;  1NJX A;  4DTM A;  1SL0 A;  3T19 A;  1J54 A;  4M3T A;  1Q9X A;  4M3X A;  4ZTF A;  4DSK A;  3DLR A;  3KLF A;  3L2W A;  4HHT A;  1KLM A;  1NJZ A;  4KO0 A;  4CE9 A;  2DFE A;  2RPI A;  3V9W A;  3HYF A;  5DMR A;  3UIQ A;  3NF8 A;  1C0T A;  1JLF A;  4DFM A;  4CJL A;  2XRI A;  4DSE A;  4E3S A;  4PY5 A;  3L3V A;  1VSM A;  1RDD A;  5SZT A;  1S1W A;  4CJ4 A;  4FJ9 A;  4PWD A;  4ELV A;  1RT7 A;  1BL3 A;  4O5B A;  4N47 A;  4CGJ A;  1C1A A;  4CGG A;  5I42 A;  4LY7 A;  3SZ2 A;  1QTM A;  3QEW A;  2HHS A;  2E4L A;  1O1W A;  2DFF A;  3HVT A;  4CIE A;  3QEX A;  3VQB A;  3LWM A;  3EYZ A;  3MXI A;  4DG1 A;  5KRT A;  4OKE A;  5CYM A;  1JLE A;  4DF4 A;  3QNN A;  4CJK A;  1RTD A;  1RDA A;  4YFU A;  4JS5 A;  3QEV A;  4J2E A;  3NHG A;  1CZB A;  4B3O A;  3LP1 A;  1A5X A;  3AV9 A;  4CHP A;  3KLG A;  3TAF A;  4I7F A;  2FBY A;  4CES A;  4QOZ B;  1VRT A;  1QHT A;  1U4B A;  3HP9 A;  1X9M A;  3RTV A;  3G0Z A;  3NGZ A;  1XC9 A;  3C6T A;  3L2U A;  1TKT A;  3VQE A;  1ITG A;  3OYI A;  4KB0 A;  1RIL A;  2HVH A;  1BCO A;  4KTQ A;  2E6L A;  3SUP A;  1HQU A;  3CYM A;  4IDK A;  4DQP A;  3TAP A;  1CXQ A;  3AVI A;  3MEE A;  3KKS A;  1TKD A;  4EP4 A;  3ZT4 A;  4F3T A;  3DLG A;  1SKR A;  1I39 A;  4I2Q A;  5EU7 A;  4L8R B;  1KCF A;  3OVN A;  4FLZ A;  4E7L A;  3JSM A;  3MEC A;  4CEO A;  2HHW A;  4E1M A;  4FYD A;  2AJQ A;  3SQ4 A;  4E89 A;  4H4O A;  3PX0 A;  1SKS A;  4OPJ A;  5SWM A;  3MED A;  4EP5 A;  3OYF A;  4NYN A;  3V81 A;  3O4N A;  4J2A A;  1KVA A;  3NE6 A;  1VSI A;  3OYK A;  3K57 A;  4DLE A;  1S1T A;  1RTI A;  4CJ5 A;  4CGH A;  4GW6 A;  3HPH A;  3NH2 A;  4DWI A;  5C25 A;  1UOC A;  2IGI A;  4N56 A;  4FM2 A;  1Q8I A;  2JLE A;  1WNS A;  3VQ5 A;  4Z4H A;  4CF2 A;  3ZSX A;  4OVL A;  1S9E A;  4FZY A;  2XY5 A;  1HYS A;  1NJW A;  1F21 A;  3ZT2 A;  3CFP A;  4DSL A;  3AO4 A;  4OJR A;  3SI6 A;  1HQE A;  2G8H A;  2G8I A;  4FXD A;  1A5V A;  1HPZ A;  3HJF A;  1KVB A;  2PYJ A;  4F2S A;  1C1C A;  5HRR A;  1IKW A;  3HP6 A;  4E7J A;  4CCH A;  2OPQ A;  4O0I A;  4M41 A;  3DRS A;  2HHU A;  3LAL A;  3LP0 A;  2FBT A;  3AVB A;  2QXF A;  3NGY A;  4LH4 A;  2D0B A;  3C95 A;  4MQ3 A;  4W5O A;  1UAX A;  4PA1 A;  1LWF A;  1I3A A;  4AHT A;  4Q5V A;  3OYB A;  4GMJ B;  4DFJ A;  5J2Q A;  4DF8 A;  2PZS A;  3OYG A;  2YNH A;  3ZT0 A;  3EY1 A;  3K59 A;  2OYQ A;  2HNZ A;  3SUO A;  4CHN A;  2WON A;  4LH5 A;  4FJL A;  3PUF A;  4FJ8 A;  3AA5 X;  2D0C A;  4K8Z A;  1HYZ A;  4O0J A;  1IG9 A;  1ASU A;  1FK9 A;  2KW4 A;  2F96 A;  3NF7 A;  4BDY A;  5J2N A;  1EP4 A;  3OY9 A;  3DOL A;  4DTP A;  2VG6 A;  2OPP A;  3D45 A;  4BWJ A;  3SJJ A;  4ELT A;  1HJR A;  1RDB A;  3U6F A;  5HRS A;  4CEA A;  4AHU A;  1RBU A;  4DMN A;  1N6Q A;  5FRM A;  2XY8 A;  1IKV A;  2F8S A;  4FJJ A;  4RG8 A;  3OYN A;  1T03 A;  3LP3 A;  3A2F A;  1VK0 A;  2ITG A;  2F8T A;  2Q3S A;  1NJY A;  3QER A;  1Z25 A;  1JXB A;  3OS0 A;  1ASW A;  1GOB A;  4DTX A;  3I0S A;  2OPR A;  1XHZ A;  2G8W A;  3VN5 A;  4M3Y A;  1D8Y A;  4M45 A;  1VSJ A;  3HVR A;  3B6O A;  1RDC A;  2YHB A;  3ISN C;  1U45 A;  2QKB A;  3DLK A;  5J2M A;  3ULD A;  4F4K A;  1B9F A;  3THV A;  2EX3 A;  1BQM A;  4EZ9 A;  4DTR A;  3AVG A;  3RMA A;  3LAN A;  2A1R A;  3DI6 A;  1QQC A;  4DQS A;  3EZ5 A;  1S1U A;  3JYT A;  1TK0 A;  4FJI A;  1YTU A;  3IAY A;  1BCM A;  3ZT1 A;  4AHV A;  5CZ1 A;  4E7H A;  3S3M A;  1NK0 A;  1TL1 A;  3O3F A;  1J53 A;  3I0R A;  3OYA A;  3AO3 A;  4CGI A;  4WE1 A;  1L3U A;  2ETJ A;  4I2P A;  1JL2 A;  2O4G A;  3L2V A;  1KLN A;  2KQ2 A;  1WSE A;  1TL3 A;  3AA4 A;  1VSH A;  1T7P A;  4EZ6 A;  3DLB A;  4B9U A;  4CJS A;  1W9H A;  3MXM A;  4KFB A;  1FXX A;  3QEP A;  1ZBH A;  4W5R A;  1S6Q A;  2G8K A;  4FLY A;  4CFC A;  1CZ9 A;  4F3O A;  2W42 A;  2ZD1 A;  3AO1 A;  4JRQ A;  4KHN A;  1NOZ A;  3CM5 A;  2IAJ A;  5C42 A;  2OZS A;  4E7I A;  3LPU A;  3KD1 E;  2G8F A;  4JS4 A;  1A5W A;  4CEQ A;  3V6D A;  1N5Y A;  4KHQ A;  3ZSY A;  3HST B;  4DU3 A;  5J1E A;  1BI4 A;  4FZX C;  3V9U A;  3PX6 A;  2FC0 A;  3VQ7 A;  4J2B A;  4KHU A;  4KPY A;  3SQ0 A;  5DK5 A;  2P5G A;  1HYV A;  3U3G A;  5CY4 A;  1C1B A;  3OYD A;  4MFB A;  3TAR A;  3QLH A;  4UQG A;  3H08 A;  3SQ1 A;  1NK4 A;  3ZSR A;  4LD0 A;  1S9G A;  3M8P A;  3SPY A;  1YT3 A;  1T8E A;  4W5T A;  1DTT A;  1YTA A;  2HHX A;  3S3O A;  3QIP A;  2IOC A;  1RT1 A;  2D0A A;  3QIN A;  4OGE A;  4M3R A;  1RTH A;  3LZI A;  2RKI A;  1NK6 A;  3RR7 A;  1X9W A;  4CF1 A;  1WSF A;  3U3Y A;  4W5N A;  2X6N A;  4RW9 A;  3S9H A;  3LP2 A;  2R7Y A;  1JL1 A;  3KLH A;  1RNH A;  4J2D A;  2IDO A;  4AH9 A;  3V1R A;  1CLQ A;  4ICL A;  2Z1I A;  4FM0 A;  1UWB A;  3M8S A;  1C0M A;  4FLU A;  3SNN A;  3ITH A;  4FLX A;  4CFA A;  3SPZ A;  4YNQ A;  5FDL A;  3E01 A;  4B9N A;  2GBZ A;  4CJV A;  4CJP A;  1KRP A;  4AHC A;  4FZZ A;  4R5P A;  4RW6 A;  1LW0 A;  2B6A A;  4Z4C A;  3NH1 A;  2BE2 A;  4IFY A;  3VQ9 A;  2YV0 X;  4KB1 A;  1G15 A;  4KI4 A;  3NF6 A;  3TWH A;  1FKP A;  1HNI A;  3RMB A;  4BAC A;  3P1G A;  1T05 A;  1WSJ A;  2VWJ A;  3SQ2 A;  4H4M A;  4BE2 A;  4CER A;  2DFH A;  4GVM A;  4QCL A;  2PY5 A;  1LWE A;  4CEF A;  1JXE A;  3AO5 A;  4NCA A;  1VSE A;  4KHY A;  1GOA A;  2NUB A;  3ALY A;  3ZSQ A;  3DMJ A;  4F2R A;  3V9Z A;  4FJG A;  3ZSZ A;  3AO2 A;  1QSS A;  3RRG A;  1JLA A;  3NBP A;  2Z1H A;  3KK3 A;  1NK8 A;  4Z4E A;  2KZM A;  1VSF A;  2IC3 A;  1Z26 A;  3D0P A;  3LZJ A;  4DQR A;  4HCC A;  4JRP A;  2YNG A;  1KVC A;  1WLJ A;  2PYL A;  4BWM A;  3TAE A;  3QEI A;  5HP1 A;  2G8V A;  4KRF A;  2BAN A;  4PUO A;  1ZBU A;  1IH7 A;  1DTQ A;  2OPS A;  3C6U A;  3HXM A;  4E0D A;  4LSL A;  1LAW A;  3B6P A;  5HBM A;  4E1N A;  3OJS A;  3KJV A;  4Z4F A;  1EX4 A;  3AVF A;  5CYQ A;  2FBX A;  1L5U A;  1TK5 A;  3KLI A;  4Y1C A;  5KRS A;  3AVA A;  1CXU A;  4KTZ A;  1IO2 A;  4DQI A;  3NF9 A;  1S1X A;  2HMI A;  4C8L A;  1RCH A;  3VQQ A;  2P1J A;  3O4Q A;  2VWK A;  4G1Q A;  2VG5 A;  4HTU A;  4FM1 A;  4DTS A;  3VQ6 A;  1JLB A;  2X6S A;  1L3T A;  4KI6 A;  4BE0 A;  1BI4 B;  2IS3 A;  2WOM A;  3QIO A;  3AVL A;  3AVK A;  4DLG A;  4CK3 A;  3MXJ A;  2Y1I A;  4KHW A;  2GUI A;  3RWU A;  4K8X A;  2Z1J A;  4CIG A;  4M42 A;  4AIL C;  3OYL A;  3ZSV A;  1S5J A;  3AA3 A;  1HMV A;  5HRN A;  4CJW A;  3LWL A;  3NCI A;  4B9M A;  2HHT A;  3CG7 A;  1JLG A;  3WNH A;  3RRH A;  3KK2 A;  4DSJ A;  2B5J A;  3VQ4 A;  4CHY A;  2P5O A;  1FKO A;  4I9Q A;  3OYJ A;  2YNI A;  1LAV A;  3VA3 A;  3IS9 A;  1VSK A;  1HRH A;  1TAQ A;  5JS1 A;  3PO5 A;  4M3U A;  3VQC A;  1U49 A;  1SV5 A;  3K5N A;  4HVJ A;  1RT2 A;  4Z4G A;  3MEG A;  3VQP A;  4LSN A;  3SYZ A;  1KFS A;  3LPT A;  3HL8 A;  4CGD A;  3SCX A;  2ZE2 A;  4OKJ A;  4B9S A;  1IKY A;  4O55 A;  2HHQ A;  3CQ8 A;  4ELU A;  1EKE A;  2BDP A;  4CJT A;  1L3V A;  4HUE A;  3AA2 A;  1U48 A;  3KLE A;  4FJ5 A;  4O44 A;  3ZSO A;  4ZHR A;  1ZBF A;  1RT5 A;  3BDP A;  4Z0U A;  2KTQ A;  4CFB A;  1RT6 A;  4ZTJ A;  4KAZ A;  1XHX A;  4DFP A;  4AHR A;  4DU4 A;  1L3S A;  3QET A;  4IKF A;  4IBN A;  3L3U A;  3K5L A;  3G10 A;  4KTW A;  4CK2 A;  3PY8 A;  1KFD A;  4HCB A;  5E41 A;  3OYH A;  2QKK A;  2HW3 A;  1QSL A;  1SKW A;  1QE1 A;  4FLV A;  4W5Q A;  5KI6 A;  3K2P A;  1K6Y A;  1RBR A;  4CJ3 A;  4RW7 A;  3VA0 A;  3CM6 A;  4FVM A;  4DS4 A;  4ID5 A;  4CHQ A;  1SL1 A;  1RT3 A;  4CJQ A;  1Y97 A;  5KGW A;  1B92 A;  1WN7 A;  4CJF A;  2XY6 A;  5KGX A;  5I3U A;  1D9D A;  3QES A;  1JKH A;  1LWC A;  1BGX T;  3TI0 A;  1ZYQ A;  3L2Q A;  4DSI A;  1X1P A;  4CHO A;  1IKX A;  1WAF A;  3V1Q A;  2YHA A;  3O3G A;  4B9L A;  4CF9 A;  3V4I A;  1ZBI A;  3KIO A;  2JGU A;  3VQA A;  4DTO A;  4N5S A;  2Y1J A; 
#chains in the Genus database with same CATH topology
 4JKC A;  3NAE A;  5HLF A;  3KVG A;  3MWP A;  4XIU A;  1N33 K;  4H5R A;  3ASM A;  3KK1 A;  4OKK A;  2D0O A;  3G4S N;  3IG1 A;  3J7Y P;  1NKE A;  2GV9 A;  4B9T A;  3AVC A;  4CEZ A;  4B9V A;  4YOU A;  3ZEU A;  1RGI A;  4H0Y B;  4Q0B A;  1X3N A;  3IDH A;  3VGL A;  4C8M A;  2UUA K;  3GBT A;  3RR8 A;  3F9M A;  4IFV A;  1ZXO A;  1HKC A;  2YKM A;  3AVM A;  5AQY A;  1U47 A;  4FWM A;  3OS2 A;  5JS2 A;  3LAK A;  1HPM A;  3VES A;  3O3H A;  2FLO A;  3CFR A;  2HOE A;  1VSL A;  3WQU A;  1GLA G;  2A5X A;  4CI6 A;  3OS1 A;  4E7K A;  1QVG M;  4H0X B;  3WXI A;  3LDQ A;  1NGB A;  4PL7 A;  5KTQ A;  3IMX A;  1KTQ A;  2Z1G A;  5AZI A;  2QWN A;  4RCH A;  4FJN A;  1JLQ A;  4FJK A;  5T7B A;  1GLB G;  5C2F A;  4BRD A;  4F9O A;  1MU2 A;  3L4I A;  4OLA A;  1NK9 A;  2ASM A;  2A1S A;  2HHV A;  3G71 N;  5TKW A;  4YOY A;  1KSP A;  4FK2 A;  3QNO A;  2FBV A;  2KZZ A;  3E66 A;  3OBY A;  4OPH A;  2KFZ A;  4DHY A;  5KQD A;  3TPQ A;  5FPM A;  2E1Z A;  3FFI A;  3FZF A;  1VQP N;  3LM2 A;  2O4I A;  5C0Y A;  1MWM A;  1DLO A;  2F9W A;  2NRR A;  4FCY A;  1GLC G;  3UKU A;  1WOQ A;  3TAM A;  3J80 O;  4CJU A;  3LDS A;  4RTF D;  4YY3 K;  5BRF A;  4BDZ A;  3WNG A;  3KTQ A;  3P5J A;  5AQU A;  3M8Q A;  3F9K A;  3FZL A;  3HOS A;  4JKD A;  3TSU A;  3CCU N;  3V9S A;  3UKR A;  3OW2 M;  2XY7 A;  1XWL A;  4X62 K;  3ZEU B;  3J7Z O;  4C1N K;  3VF2 A;  3PLA A;  1EO1 A;  2QK9 A;  3T3F A;  1LCU A;  1HNV A;  2YNF A;  3DRR A;  1VQK N;  3SUN A;  3F2K A;  3LAM A;  2HBK A;  3MN6 A;  4M3T A;  1Q9X A;  4ZTF A;  3DLR A;  1KLM A;  1NJZ A;  4KO0 A;  4CE9 A;  2E2O A;  1GLE G;  5GAG P;  2XRI A;  4DSE A;  4R79 A;  3O4W A;  5C10 A;  3L3V A;  4PWD A;  3S41 A;  4CGG A;  2HHS A;  1D4X A;  2DFF A;  2P9U A;  3L0Q A;  4CIE A;  3QEX A;  5AZJ B;  5ADX A;  3MXI A;  1JLE A;  4LC9 B;  1RDA A;  3HOT A;  1WBD A;  4JS5 A;  2W6K A;  3AV9 A;  5LJW A;  3TAF A;  5AZI B;  3THX A;  2E88 A;  1QHT A;  2P9N B;  1X9M A;  1MDU B;  3CCQ N;  3I55 N;  3OYI A;  4BC4 A;  4DR2 K;  1HQU A;  4DQP A;  1TKD A;  4EP4 A;  2F4V K;  1VQN N;  4E7L A;  4JKB A;  4CEO A;  2IVP A;  2W40 A;  1NLV A;  3UKU B;  3FGU A;  4E89 A;  4H4O A;  3PX0 A;  4OPJ A;  3O1W A;  3V81 A;  1RTI A;  4BGB A;  4CJ5 A;  2Q1N A;  4CGH A;  3NH2 A;  3KZB A;  3BY5 A;  4LF6 K;  2ZJQ L;  2IVN A;  4DR4 K;  5AQK A;  3UKR B;  3FE1 A;  4DSL A;  5TKY A;  2G8I A;  1HQE A;  1YVN A;  1A5V A;  3RSE A;  1KVB A;  4F2S A;  4JKH A;  2ZJR L;  3PSI A;  2YX6 A;  5HRR A;  4FSV A;  3HP6 A;  1K8K A;  5BRD A;  2OPQ A;  4M41 A;  4MQ3 A;  1I3A A;  1HKB A;  4AHT A;  3OYB A;  4CZE A;  2PZS A;  2HNZ A;  4DTO A;  3PUF A;  3AA5 X;  1S22 A;  2QTD A;  4O0J A;  1ASU A;  4DR3 K;  2F96 A;  2KW4 A;  2BUP A;  2VG6 A;  4BWJ A;  3SJJ A;  3AGR A;  5AQQ A;  3U6F A;  2P9U B;  1N6Q A;  4AHU A;  3OBW A;  2F8S A;  3LP3 A;  1KAY A;  2ITG A;  2UXB K;  2F8T A;  1Z25 A;  4BVP A;  1GOB A;  4DTX A;  3THX B;  2OPR A;  3SLC A;  3I56 N;  3HVR A;  1BG3 A;  3B6O A;  3ISN C;  2QKB A;  3THY A;  5J2M A;  1BQM A;  4DTR A;  5AFU A;  1H1V A;  2A1R A;  4H5V A;  4DQS A;  3H45 C;  1YTU A;  2HHH K;  3CHW A;  3ZT1 A;  3S3M A;  3O3F A;  4H03 B;  5KPR A;  3THW A;  2O8B A;  4A5B A;  3H1Q A;  4ISG A;  4WYB A;  4A5A A;  4CZL A;  1WSE A;  1TL3 A;  4BR9 A;  1T7P A;  1W7A A;  3MXM A;  4KFB A;  3QEP A;  3E9O A;  3T1Y K;  4CFC A;  1CZ9 A;  3AO1 A;  2NNW A;  1NOZ A;  2QWQ A;  2IAJ A;  3R9P A;  3KD1 E;  4FWQ A;  3EN9 A;  1A5W A;  1GLF O;  1ATR A;  2ITM A;  2E8A A;  3RSE B;  1CZA N;  4J2B A;  1K8K B;  4K41 A;  1HYV A;  3GL1 A;  3K0S A;  3TAR A;  3QLH A;  1OVQ A;  2NRT A;  1YIJ N;  1NK4 A;  4JEP A;  3ENB A;  2HHX A;  3U4L A;  4AM6 A;  2D0A A;  3QIN A;  1RTH A;  2RKI A;  1WSF A;  4W5N A;  3KWG A;  5CE3 A;  2QW9 A;  4EFH A;  1SQK A;  4JHD A;  2IDO A;  4LF5 K;  3SAF A;  1C0M A;  1DGK N;  4KH5 A;  3ITH A;  4YOW A;  4CZK A;  2GBZ A;  4CJP A;  3HZ6 A;  3DWL A;  4R5P A;  2B6A A;  2UU9 K;  3GG4 A;  5IWA K;  3C6H A;  3KK7 A;  4JI6 K;  3TWH A;  4BAC A;  4BRI A;  4BR5 A;  3CMA N;  4BRH A;  4CD3 A;  3THY B;  4CER A;  4GVM A;  4CEF A;  1E4G T;  2NUB A;  3DMJ A;  2CGJ A;  1YJ9 N;  3ZSZ A;  4CZI A;  4FVU A;  1JLA A;  3FZM A;  2KZM A;  1VSF A;  1KVC A;  1WLJ A;  4ILH A;  3THW B;  1S72 N;  2O8B B;  3TAE A;  2IIR A;  3A5L C;  4PUO A;  5M1P A;  4GKK K;  1ZBU A;  1DTQ A;  3HXM A;  3N4Q A;  4LSL A;  1LAW A;  5HBM A;  1IG8 A;  3OJS A;  1TK5 A;  3KLI A;  4B1Y B;  5KRS A;  3SBT A;  1CXU A;  2CH5 A;  2ZGY A;  3NF9 A;  1M1K O;  1OVY A;  4DTS A;  4KI6 A;  4FWP A;  3VEV A;  5F1X A;  2WOM A;  2Y1I A;  3BZK A;  4M42 A;  2QWL A;  4BG8 A;  3ZSV A;  3AA3 A;  1HMV A;  1YXQ A;  4KH6 A;  3CG7 A;  4FWN A;  3WNH A;  5BPN A;  2O8C A;  2P5O A;  3CCL N;  4I9Q A;  5HL7 L;  5JS1 A;  3VQC A;  1KAX A;  1RT2 A;  3E9L A;  4JK8 A;  4JHD B;  4DUY K;  3H3O B;  1KFS A;  3LPT A;  4CGD A;  4WQ4 A;  2ZE2 A;  4MLE A;  2OTJ N;  1EKE A;  1L3V A;  1U48 A;  3W3D A;  4O44 A;  2F7T A;  3O9R A;  1ZBF A;  1HR0 K;  5AQP A;  4Z0U A;  4CFB A;  1RT6 A;  4ZTJ A;  3OTO K;  3QET A;  4IKF A;  3CME N;  3CXC M;  2OAN A;  3L3U A;  4A57 A;  4CK2 A;  4HCB A;  1KFD A;  5E41 A;  3OYH A;  1JCF A;  2QWO A;  1SZ2 A;  4W5Q A;  1DKG D;  1RBR A;  4WCE L;  1BA0 A;  2V51 B;  4DS4 A;  5FPE A;  1RT3 A;  2QI2 A;  4DR5 K;  1Y97 A;  2Q97 A;  1B92 A;  4CJF A;  5FPN A;  1JKH A;  3MWT A;  1GLL O;  1NMN A;  4CHO A;  1IKX A;  4B9L A;  5CHI A;  1MA9 B;  3MN9 A;  2ATQ A;  3WEE A;  2Y1J A;  1QS4 A;  3T1A A;  4BRK A;  1BHL A;  4B8C A;  4OLB A;  3H3N O;  4M3W A;  1NK7 A;  4HUG A;  2HF3 A;  3PX4 A;  1VQ5 N;  1KAZ A;  3K5M A;  3QML A;  1TK8 A;  4JLH A;  4FK4 A;  1XNR K;  3P38 A;  2O8C B;  1SAZ A;  3K58 A;  2YJE A;  4PQU A;  4DV0 K;  4CFD A;  5C24 A;  4BRO A;  4XH1 A;  5IT9 O;  2A41 A;  5K14 A;  4NCG A;  4CGF A;  3VQ8 A;  2OA8 A;  3KD5 E;  3E9P A;  2DY4 A;  3SUQ A;  2O8D A;  1D9F A;  2PFU A;  1LV5 A;  1YIT N;  4F8R A;  4J8F A;  2OCE A;  4DFK A;  2VQF K;  3DM2 A;  2XHB A;  4FJH A;  3C94 A;  1BQN A;  4DR1 K;  1Q7Y O;  2RF2 A;  3K5O A;  4DTU A;  3R3L A;  4K25 A;  5EY4 A;  4Y0W A;  2QXL A;  2RN2 A;  4DQQ A;  4FJ7 A;  5FPD A;  3HPO A;  3KHY A;  1RBT A;  2WFB A;  4IEE A;  4O4G A;  2AP1 A;  5DM6 L;  3EKU A;  1S6P A;  3FR0 A;  1Q9Y A;  1ZBL A;  4IG0 A;  1REV A;  2HNY A;  1RBV A;  2QWR A;  1YI2 N;  1NOY A;  4FK0 A;  2A42 A;  2P51 A;  3WEE B;  4E19 A;  3I8D A;  1WSG A;  5DM7 L;  4K43 A;  3CJ9 A;  4JYA K;  4I9L A;  3CET A;  1WSH A;  3LDO A;  1S3X A;  3C0B A;  1NGJ A;  3O80 A;  1SUQ A;  3TAG A;  4M3Z A;  1M90 O;  1W0H A;  1J5O A;  2P9S A;  3RVC A;  5KQ8 A;  4N41 A;  4Y1D A;  5AQR A;  3V1O A;  1QSY A;  4IFE A;  4C8K A;  1YVU A;  2HB5 A;  4FWO A;  2O8D B;  2JWK A;  3T19 A;  1J54 A;  3A5N C;  4DSK A;  4PKI A;  3A8Y A;  3P4I A;  5DMR A;  3NF8 A;  4CJL A;  4E3S A;  4OPA A;  2E20 A;  1VSM A;  4B1Z A;  3C6A A;  4N47 A;  1BL3 A;  4CGJ A;  5I42 A;  3QEW A;  5AQX A;  2E4L A;  1O1W A;  3HVT A;  2FF6 A;  4BR2 A;  4JI0 K;  3EYZ A;  2QEX N;  5CYM A;  1NGC A;  1WUA A;  4JAX A;  3LP1 A;  3KLG A;  4CES A;  4QOZ B;  1VRT A;  1U4B A;  5AQW A;  3PIP L;  3TSQ A;  1TYQ A;  2VQE K;  1OH6 A;  4KTQ A;  3SUP A;  2D1K A;  3CYM A;  3TAP A;  1CXQ A;  2ZM6 K;  3QIC A;  3ZT4 A;  3EEQ A;  3DLG A;  4I2Q A;  4L8R B;  3WXJ A;  4XH4 A;  1QZ5 A;  5JMV A;  5AQF A;  2HF4 A;  1VQ8 N;  1SS6 A;  4FYD A;  1VQ9 N;  1BU6 O;  3DXK A;  4EP5 A;  4NYN A;  3O4N A;  4O8U A;  2CGK A;  2W6L A;  2WC9 A;  3OYK A;  5BRE A;  1XQS C;  2P9P A;  1N36 K;  1BOT O;  3ULE A;  4DWI A;  1UOC A;  5JVH L;  2JLE A;  1WNS A;  4A2A A;  2XY5 A;  4JKA A;  2P9S B;  2G8H A;  1HPZ A;  1GLD G;  3HJF A;  5AZJ A;  2PYJ A;  5KPT A;  1IKW A;  2GEL A;  4CZF A;  4O0I A;  3SMS A;  3DRS A;  2HHU A;  1V4S A;  3LP0 A;  3O9Q A;  3AVB A;  2QWM A;  4BQZ A;  3C95 A;  4DUZ K;  3T69 A;  2P9N A;  2Q2R A;  2OYQ A;  3LL3 A;  4DF8 A;  3OYG A;  2YNH A;  1X9J A;  3K59 A;  3SUO A;  4LH5 A;  1BDG A;  4K8Z A;  4IOC L;  4B9M A;  4L3Q A;  1EP4 A;  5LMU K;  2GEM A;  2OPP A;  1HJR A;  4DMN A;  5JLF A;  1IKV A;  3MMV A;  2BH1 A;  2Q3S A;  2QWP A;  3QER A;  3OS0 A;  3O9T A;  3ZX3 A;  1EWR A;  3OA9 A;  4A59 A;  4DR7 K;  4CVN E;  2V7Y A;  3VN5 A;  1NG9 A;  1TYQ B;  4M45 A;  3VGM A;  3DXM A;  4WQ4 C;  5AQM A;  3DLK A;  5AQL A;  1NGD A;  4F4K A;  4EZ9 A;  3AVG A;  5GIO A;  3DI6 A;  1QQC A;  3ATV A;  2KKZ A;  5BR9 A;  1TK0 A;  3TTF A;  4AHV A;  1T6D A;  1BWF O;  3P39 A;  4BQL A;  1J53 A;  3AO3 A;  4CGI A;  3FZH A;  4I2P A;  3CQY A;  3DXK B;  3L2V A;  4M7Y A;  1EWQ A;  3AA4 A;  1WBB A;  2A6A A;  4BRL A;  4CJS A;  2P9P B;  4BY9 C;  1FXX A;  5JLH A;  3ULE B;  4F3O A;  2W42 A;  2ZD1 A;  1OKJ A;  3CM5 A;  2OZS A;  5C42 A;  3CCR N;  2G8F A;  4KHQ A;  3CJA A;  3ZSY A;  4FZX C;  3V9U A;  4KHU A;  2FC0 A;  3VQ7 A;  1VQL N;  2NLX A;  2NRZ A;  2P5G A;  5DK5 A;  3VEZ A;  1QVF M;  4CZG A;  4MFB A;  3M3Z A;  4BVO A;  3ZSR A;  1S9G A;  1T8E A;  2JWL A;  3O9U A;  4W5T A;  4ISE A;  1DTT A;  3G25 A;  2PBD A;  1NGA A;  5CR4 A;  4IZ9 A;  4OGE A;  4M3R A;  3LZI A;  5MLC Q;  3CQX A;  3RR7 A;  1IBK K;  3GOI A;  2GWJ A;  3LP2 A;  2R7Y A;  4H0P A;  3VF6 A;  1UWB A;  3SNN A;  4WFB L;  4FLX A;  3SPZ A;  5FDL A;  4X64 K;  2F9T A;  2HBJ A;  3I33 A;  2NZT A;  4KB1 A;  4IFY A;  3LM9 A;  1G15 A;  4QS9 A;  3RMB A;  1HNI A;  3P1G A;  3DXM B;  5C2D A;  4BE2 A;  4B3T K;  1TUU A;  4JI8 K;  3WXL A;  1LWE A;  4NCA A;  1JXE A;  3AO5 A;  4KHY A;  1GOA A;  3V9Z A;  2Q0R A;  3AO2 A;  1QSS A;  3NBP A;  2Z1H A;  3CC2 N;  1NK8 A;  3CER A;  4ILG B;  1Z26 A;  3LZJ A;  1T6C A;  2UXC K;  1YHQ N;  5HP1 A;  3QEI A;  2G8V A;  4KRF A;  4BRQ A;  4FOE A;  1Q18 A;  3HSC A;  2OPS A;  4E0D A;  4E1N A;  3AVF A;  2E2N A;  5CYQ A;  1L5U A;  1O13 A;  1VQ7 N;  3AVA A;  4CZJ A;  3J8A A;  1U6Z A;  1E4F T;  3C7N A;  4K0K K;  2HMI A;  2VYP A;  1RCH A;  4HTU A;  2ASP A;  1VQ4 N;  3D2F A;  3VQ6 A;  4BE0 A;  4IWV A;  4DLG A;  3MXJ A;  3O1B A;  2GUI A;  4K8X A;  1IBM K;  4CIG A;  3T1H K;  3O5B A;  3JAM O;  3WXM B;  3RRH A;  3VQ4 A;  5LJV A;  3CCJ N;  3IS9 A;  3VET A;  1HRH A;  4FO0 A;  4M3U A;  4A62 A;  1SV5 A;  4HVJ A;  4CBW A;  1LOT B;  4BC3 A;  1U2V A;  2Q36 A;  3FFK B;  4LSN A;  1WB9 A;  1RDW X;  3HL8 A;  2ASO A;  2HBL A;  4B9S A;  3CQ8 A;  2BDP A;  3R8E A;  3A0I X;  4HUE A;  3VEN A;  4FJ5 A;  3K9K A;  1RT5 A;  2ZF5 O;  3BDP A;  1Z05 A;  4DQ8 A;  3AAQ A;  5E84 A;  4KAZ A;  4DFP A;  4CZH A;  4BR4 A;  4KTW A;  2HW3 A;  2QKK A;  2Q0U A;  4DV1 K;  3UB5 A;  5GAH P;  3QBX A;  1SKW A;  1BA1 A;  2FSN A;  2HBM A;  5KI6 A;  1K6Y A;  4B1V A;  2YHY A;  1YJW N;  4B1U B;  3I8B A;  4RW7 A;  3CM6 A;  4FVM A;  4ID5 A;  4CJQ A;  5AQH A;  4X66 K;  2QA4 N;  3T7Z A;  5I3U A;  1D9D A;  1LWC A;  3TI0 A;  4JNE A;  1ZYQ A;  3L2Q A;  1X1P A;  3V1Q A;  4LF8 K;  3C7N B;  1ATS A;  2CGL A;  3D2F B;  2B4J A;  1QHA A;  3M8R A;  2X78 A;  3LDN A;  3HM9 A;  3O6W A;  2BGG A;  3KKR A;  4I6M A;  5EVZ A;  5D3G A;  3VTI A;  4CED A;  3TR8 A;  4JI3 K;  1TAU A;  4IJN A;  3OJU A;  3QFP A;  1ZBS A;  4EAH D;  3NH0 A;  4YOR A;  4CEC A;  3FZK A;  5LMN K;  1RTJ A;  4CEE A;  4FJX A;  3VQD A;  1BIZ A;  1BIS A;  2O8E A;  5HRP A;  1E3M A;  3BGR A;  4YOX A;  4U7B A;  2D5R A;  1XNQ K;  3TAN A;  3NGI A;  3MAQ A;  1C6V A;  1U2V B;  5EXW A;  3C65 A;  3ZCM A;  3SAH A;  4MDA A;  2P9L A;  4NXN K;  4KKO A;  4NYF A;  3WNE A;  4N76 A;  4FWL A;  1RDU A;  2ZQB A;  4IG3 A;  4BDP A;  5HOO A;  4RW8 A;  2I5J A;  4JI2 K;  4B08 A;  1EET A;  3NDK A;  1C0F A;  3AVH A;  1BIU A;  4OPK A;  1S1V A;  2UXD K;  3R1X A;  5BPM A;  2X74 A;  5AQJ A;  4KRE A;  3HK2 A;  4ILJ A;  3V9X A;  3UE5 A;  3ZX0 A;  3BUZ B;  1MWK A;  1T3V A;  3QBW A;  4H5W A;  2G8U A;  3CD6 N;  4U67 L;  4HUF A;  4IOA L;  5FRN A;  1NK5 A;  1J5E K;  1RT4 A;  1ATN A;  1NBW A;  3SBG A;  1LW2 A;  2OZM A;  4BRC A;  4BE1 A;  4B8A B;  2HND A;  1UA1 A;  4MO5 A;  4CF8 A;  2E6M A;  3DYA A;  1TVR A;  4I6M B;  1XI1 A;  4DKW A;  2DTU A;  3D2E A;  1TGO A;  3DLE A;  1NKC A;  4CK1 A;  4CJE A;  4BC2 A;  3CJB A;  4PHT X;  1HNX K;  3B8A X;  2VG7 A;  1B9D A;  4CHZ A;  4XH5 A;  4CJR A;  1GOC A;  4ISF A;  1WAJ A;  4DSF A;  2A3Z A;  2FSK A;  2KLA A;  4DTJ A;  4C8N A;  2O8E B;  2YHX A;  3L8B A;  3NVM A;  1J9A A;  3WXK A;  2ZWH A;  4QAG A;  1P90 A;  3SV4 A;  1TKX A;  4FW2 A;  1NJX A;  3H1V X;  4H0T B;  2UUC K;  3ID8 A;  3WT0 A;  3KLF A;  4DV4 K;  3L2W A;  2P9L B;  3N4P A;  2DFE A;  2RPI A;  2ZGZ A;  3HYF A;  3UIQ A;  1JLF A;  4DFM A;  4PY5 A;  4NO7 A;  1VQ6 N;  1RDD A;  5SZT A;  4FJ9 A;  4ELV A;  1C1A A;  4LY7 A;  3SZ2 A;  1FJG K;  5BN8 A;  3ZET A;  3VQB A;  3TSP A;  5KRT A;  4OKE A;  1IBL K;  4FPB A;  3QEV A;  4J2E A;  3NHG A;  1CZB A;  2AA4 A;  5ADX H;  5AJ3 K;  2DPN A;  4I7F A;  3RTV A;  3NGZ A;  1XC9 A;  3L2U A;  3HTV A;  1TKT A;  3VQE A;  3VOV A;  5AQV A;  1RIL A;  1KXP A;  3DJC A;  2E6L A;  3KKS A;  4F3T A;  1I39 A;  1QZ6 A;  5EU7 A;  1KCF A;  3SMP A;  4FLZ A;  1K8A O;  4MLH A;  4WF9 L;  3E1Y A;  5JVG L;  2O8F A;  3SQ4 A;  5SWM A;  3MED A;  4DV3 K;  4C23 A;  3BP8 A;  1KVA A;  3NE6 A;  1VSI A;  4WQ5 A;  3K57 A;  4DLE A;  1S1T A;  3D2E B;  3L4Q A;  4BRA A;  3GE1 A;  5BN9 A;  5C25 A;  1Q81 O;  4DV2 K;  2IGI A;  4B3M K;  3MDQ A;  4N56 A;  4FM2 A;  3VQ5 A;  1Q8I A;  3HI0 A;  4CF2 A;  5AQI A;  3ZSX A;  1NWK A;  1S9E A;  4OVL A;  1OH5 A;  3AO4 A;  4OJR A;  3SI6 A;  2UYT A;  5LL6 Z;  3SK3 A;  1I94 K;  4B9Q A;  5M1F A;  2QXF A;  4LH4 A;  2D0B A;  4Q5V A;  4A2B A;  5J2Q A;  4GMJ B;  4M7X A;  3MN5 A;  4WFA L;  3MN7 A;  3VTH A;  2D0C A;  1IG9 A;  4BRM A;  1FK9 A;  4BDY A;  4CBX A;  5J2N A;  1G99 A;  1HUX A;  3DOL A;  3HRG A;  4DTP A;  1ILY A;  3ID6 A;  1C0G A;  4CEA A;  5FRM A;  3ZET B;  2XY8 A;  2PAV A;  3CC7 N;  4FWR A;  1T03 A;  3M6G A;  1VK0 A;  2FSJ A;  5FLX O;  1JCG A;  3TTC A;  1JXB A;  3VPZ A;  1ASW A;  2VCP A;  4M3Y A;  1TUY A;  1D8Y A;  1J6Z A;  4B1X B;  2OTL N;  4KH4 A;  3ULD A;  1B9F A;  4B1W B;  3THV A;  3A5M C;  4QS8 A;  4IOX A;  3Q7C A;  4C1N I;  4FJI A;  3IAY A;  1BCM A;  4E7H A;  1W97 L;  1TL1 A;  5AFU H;  3I0R A;  2O8F B;  4WE1 A;  1JL2 A;  1KLN A;  2GTD A;  4FWK A;  5AQZ A;  1QQM A;  4BG9 A;  1W9H A;  1S6Q A;  2G8K A;  4FLY A;  4KHN A;  4JRQ A;  4JI4 K;  3LPU A;  3P31 A;  4JS4 A;  1N5Y A;  3PSF A;  5H1S Q;  3HST B;  4PL8 A;  4IXC A;  5J1E A;  3HM8 A;  3PX6 A;  3SQ0 A;  1N8R O;  4HWI A;  4JN4 A;  3U3G A;  1C1B A;  3OYD A;  4AM7 A;  4LD0 A;  3M8P A;  5GIP A;  1YTA A;  3QIP A;  4X65 K;  1NK6 A;  1X9W A;  4LF9 K;  3S9H A;  2NRV A;  1JL1 A;  2P9I A;  3KLH A;  1RNH A;  4GY2 B;  4AH9 A;  3V1R A;  1CLQ A;  4ICL A;  1V4T A;  2Z1I A;  4FM0 A;  1YAG A;  4CFA A;  4YNQ A;  3CI5 A;  3E01 A;  2E2P A;  4FZZ A;  4IEI A;  4Z4C A;  1IV0 A;  2HMP A;  2NRW A;  3VQ9 A;  3MX2 A;  3LDL A;  3R6M A;  3NF6 A;  1FKP A;  1WSJ A;  1XC3 A;  5F2R A;  4H4M A;  2VGN A;  2DFH A;  1Q86 O;  2PY5 A;  4QCL A;  1VSE A;  3ZSQ A;  4F2R A;  4OX9 K;  4IO9 L;  3FLC O;  4DR6 K;  3KK3 A;  4Z4E A;  5F0X A;  3D0P A;  4JKF A;  4DQR A;  1OH8 A;  1ZC6 A;  4JRP A;  4BRP A;  4GV6 A;  1OH7 A;  1NGG A;  1W2B M;  2BAN A;  3BF1 A;  1IH7 A;  3B6P A;  4BRG A;  3K9J A;  4QS7 A;  3G6E N;  2J4R A;  5M1Q A;  4KTZ A;  4C8L A;  4FM1 A;  3O4Q A;  2VWK A;  4G1Q A;  2VG5 A;  1XUP O;  4HCC A;  2Q31 A;  2X6S A;  2IS3 A;  3MCA B;  3AVK A;  1P8Z A;  4CK3 A;  4BGA A;  3JXU A;  3O9S A;  3RWU A;  3ENH A;  5BPL A;  2Z1J A;  5GAE P;  4JI1 K;  4CJW A;  1JLG A;  4DSJ A;  3KK2 A;  2B5J A;  4CHY A;  4O8K A;  3D6R A;  1IJJ A;  1VSK A;  1GLJ O;  4YOV A;  1XMQ K;  5GIN A;  3CJ1 A;  3VEO A;  3MEG A;  2P9I B;  3SYZ A;  3AAP A;  5AR0 A;  1YJN N;  1NU0 A;  3ZX2 A;  4B3R K;  2HHQ A;  4ELU A;  3WUH A;  3AA2 A;  1K73 O;  3GDQ A;  1HJO A;  4ZHR A;  1NGH A;  3SAG A;  3CCV N;  5EOY A;  4FPA A;  1NJI O;  1XHX A;  5AQS A;  4JK7 A;  1XMO K;  3PY8 A;  1QSL A;  1HX1 A;  2H3G X;  4FLV A;  3CPE A;  3J81 O;  4V19 S;  3F5T A;  1NMD A;  4YDU A;  4CHQ A;  3IKM A;  5ELZ A;  4YOT A;  5AQG A;  3QES A;  1BGX T;  4DSI A;  2GUP A;  4YHH K;  3W0L A;  1WAF A;  1HLU A;  3O3G A;  1ZBI A;  3V4I A;  3VQA A;  4N5S A;  4CBU A;  4CIF A;  1X9S A;  4EHT A;  3CCE N;  4KV8 A;  2P9K A;  1WSI A;  3M5R A;  3BF3 A;  3CIP A;  1U04 A;  3ZLJ A;  2YCH A;  3AVJ A;  2LSN A;  5HRO A;  4CF0 A;  5FRO A;  3IRX A;  3HPG A;  1ASV A;  2NRX A;  4CEB A;  3OHR A;  2QM1 A;  2YHW A;  4WQ5 C;  3O8M A;  3ENO A;  1Z6R A;  1KD1 O;  3OYM A;  2EHG A;  4H8K A;  2VGM A;  4KBO A;  3TAQ A;  4IDH A;  4A61 A;  4DV7 K;  2EWS A;  3RMD A;  4H5T A;  1TV6 A;  2XO7 A;  3KWI A;  1VSD A;  3HO1 A;  1VHX A;  3QO9 A;  4FW1 A;  5EX5 A;  3U9Z A;  3ZSW A;  3RMC A;  4CW7 B;  1NKB A;  1R0A A;  1DEJ A;  3VEX A;  3WQT A;  4JD2 A;  3DOK A;  4C8O A;  2BTF A;  1C0U A;  4AQY K;  3S3N A;  2KHO A;  1JJ2 M;  3CFO A;  3TAB A;  3QDK A;  1JLC A;  1TKZ A;  4ID1 A;  4O5F A;  3IUC A;  2WTU A;  4NCB A;  4RW4 A;  3L2R A;  3OYC A;  2E5L K;  3P83 D;  1EXQ A;  4DS5 A;  3WNF A;  1YUW A;  3AVN A;  1D5A A;  3NMU A;  2GX9 A;  4G9Z A;  2YKN A;  1UA0 A;  2HST A;  4Z4I A;  1SL2 A;  4E1J A;  1VRU A;  1NGI A;  5I9E B;  4FLT A;  3OYE A;  2WUS A;  4DU1 A;  5CZ2 A;  1RBS A;  4FLW A;  4DTN A;  3DRP A;  2I7N A;  2P9K B;  3PV8 A;  2HVI A;  2WBN A;  5J2P A;  4AHS A;  5AQN A;  3TU5 A;  1HNZ K;  3BEX A;  3VEW A;  3HT3 A;  1NM1 A;  3IFR A;  2VWB A;  4H0V B;  4FJM A;  4GKJ K;  3SV3 A;  4LFA K;  2CH6 A;  3NFA A;  4EHU A;  2UUB K;  3ZT3 A;  4BC5 A;  3H46 O;  4LF4 K;  3DLH A;  4KHS A;  2KFN A;  1EQY A;  4H0O A;  3F73 A;  3PO4 A;  4TSX A;  4OGC A;  4DTM A;  2V52 B;  1SL0 A;  4M3X A;  2NRH A;  4BRE A;  4DB3 A;  3QB0 A;  2FF3 B;  4HHT A;  3V9W A;  5B8H A;  3H6E A;  5AQT A;  1C0T A;  4KHP K;  1QQO A;  4DV6 K;  1S1W A;  4CJ4 A;  1RT7 A;  4JV5 K;  4O5B A;  1QTM A;  4JD2 B;  3LWM A;  4DG1 A;  4DF4 A;  3QNN A;  1RTD A;  4CJK A;  5M1K A;  4YFU A;  4B3O A;  1A5X A;  4JI5 K;  4CHP A;  2FBY A;  3VER A;  4GNI A;  3HP9 A;  3G0Z A;  3C6T A;  1ITG A;  4KB0 A;  2HVH A;  1BCO A;  4IDK A;  3AVI A;  3MEE A;  4GV9 A;  1N32 K;  1SKR A;  3ZYY X;  3OVN A;  3JSM A;  3MEC A;  2HHW A;  4E1M A;  2AJQ A;  5GAD P;  1SKS A;  4CJ7 A;  3OYF A;  4J2A A;  4LFC K;  3U8X A;  3HBT A;  4GW6 A;  3HPH A;  4FL9 A;  3MK6 A;  4FZY A;  4Z4H A;  1HYS A;  1NJW A;  1F21 A;  3ZT2 A;  3CFP A;  4FXD A;  3U9D A;  1C1C A;  4E7J A;  4CCH A;  3CCS N;  3LAL A;  4IJA A;  2FBT A;  3NGY A;  1R59 O;  4W5O A;  1UAX A;  1VAZ A;  3A5O C;  1LWF A;  2YI1 A;  4PA1 A;  4DFJ A;  4MDB A;  3ZT0 A;  3EY1 A;  5BRH A;  4CHN A;  2WON A;  4FJL A;  4FJ8 A;  1Y64 A;  1HYZ A;  3NF7 A;  3OY9 A;  4FOI A;  3D45 A;  4BRF A;  4ELT A;  1RDB A;  5HRS A;  1RBU A;  4DCH A;  4FJJ A;  4RG8 A;  3OYN A;  3A2F A;  2W41 A;  1NJY A;  2IVO A;  3I0S A;  1XHZ A;  2G8W A;  4Z94 A;  1VSJ A;  3CJC A;  1RDC A;  5BR8 K;  2YHB A;  1U45 A;  2EX3 A;  3RMA A;  3LAN A;  1X3M A;  4H5N A;  3EZ5 A;  1S1U A;  3JYT A;  1KQS M;  1RFQ A;  3LDP A;  5CZ1 A;  1NK0 A;  3OYA A;  1HKG A;  1L3U A;  4CZM A;  2ETJ A;  2O4G A;  2KQ2 A;  3AGK A;  3L6Q A;  3EE9 A;  1VSH A;  2ZJP L;  4EZ6 A;  3DLB A;  4JI7 K;  4B9U A;  2V7Z A;  5C15 A;  4PKG A;  1ZBH A;  4W5R A;  4E7I A;  4YDU C;  3V6D A;  4CEQ A;  3AY9 A;  5C12 A;  5A2Q O;  3DAW A;  4DV5 K;  4NLC A;  4DU3 A;  1BUP A;  4BR0 A;  1BI4 A;  3CF5 L;  4B3S K;  3VF4 A;  3O08 A;  3CJ7 A;  4KPY A;  5CY4 A;  4UQG A;  3H08 A;  3SQ1 A;  1FW6 A;  3SPY A;  1YT3 A;  1NGE A;  4FWS A;  1NNE A;  3S3O A;  2IOC A;  1RT1 A;  2YJF A;  4AF1 A;  4CF1 A;  4XEI A;  3U3Y A;  2X6N A;  4JKG A;  4RW9 A;  4RWT A;  4EIA A;  3PIO L;  4J2D A;  4IO8 A;  3DLL L;  3M8S A;  4FLU A;  4B9N A;  4CJV A;  1KRP A;  1Q82 O;  4AHC A;  3EL2 A;  4RW6 A;  1LW0 A;  3NVK A;  3NH1 A;  2BE2 A;  2YV0 X;  4KI4 A;  1T05 A;  2VWJ A;  3SQ2 A;  1ESV A;  3VMF B;  3ALY A;  1JCE A;  4FJG A;  3Q7B A;  1KC8 O;  2I7P A;  3SJH A;  5E26 A;  3RRG A;  4LFB K;  3MCP A;  2IC3 A;  3BZC A;  2PYL A;  2YNG A;  4BWM A;  4NXM K;  3C6U A;  3VEY A;  3ATU A;  3D7E O;  4UY8 O;  4Z4F A;  3KJV A;  1EX4 A;  2FBX A;  4M63 C;  4Y1C A;  1IO2 A;  4DQI A;  3TTD A;  1S1X A;  2E2Q A;  4GV3 A;  3VQQ A;  2P1J A;  1L3T A;  1JLB A;  1BI4 B;  4LF7 K;  3QIO A;  4KHW A;  3AVL A;  5LY3 A;  4OO1 J;  3J7A P;  2GWK A;  4AIL C;  2A40 A;  3VGK A;  3OYL A;  1S5J A;  5HRN A;  3LWL A;  3NCI A;  2HHT A;  1YF5 L;  3EZW A;  3CPW M;  4HTL A;  4PKH A;  3CC4 N;  1FKO A;  3OYJ A;  2YNI A;  4GVE A;  1LAV A;  3VA3 A;  2RHK A;  1HNW K;  1TAQ A;  3PO5 A;  4MO4 A;  3CCM N;  1DT9 A;  4JKG B;  1U49 A;  3K5N A;  3EKS A;  4Z4G A;  3VQP A;  1QQN A;  3AAR A;  3EO3 A;  4WFN L;  3SCX A;  2FXU A;  3JS6 A;  4OKJ A;  1IKY A;  1NGF A;  4O55 A;  4CD1 A;  4CJT A;  3KLE A;  3M1F A;  4NLB A;  2D0P A;  3ZSO A;  4K42 A;  2KTQ A;  4BRN A;  1T44 A;  4AHR A;  4DU4 A;  1L3S A;  5M1O A;  4IBN A;  3K5L A;  3G10 A;  2RE2 A;  4JK9 A;  2E1Y A;  1VQO N;  1BO5 O;  1QE1 A;  3K2P A;  5JIC A;  3EE8 A;  1N34 K;  1VQM N;  4CJ3 A;  3VA0 A;  2D4W A;  1SL1 A;  5M1N A;  3MX5 A;  5KGW A;  1WN7 A;  5KPZ A;  4JKE A;  2XY6 A;  5KGX A;  5AQO A;  3QFU A;  1K9M O;  4NB4 A;  2YHA A;  4CF9 A;  3KIO A;  2JGU A;  4BR7 A; 
#chains in the Genus database with same CATH homology
 2ATQ A;  2B4J A;  4CIF A;  1QS4 A;  3T1A A;  1X9S A;  3NAE A;  5HLF A;  1BHL A;  4B8C A;  4OLB A;  4KV8 A;  1WSI A;  4M3W A;  3M8R A;  4XIU A;  2X78 A;  4HUG A;  1NK7 A;  1U04 A;  3HM9 A;  3PX4 A;  2BGG A;  3ASM A;  3AVJ A;  3KKR A;  4OKK A;  3KK1 A;  5D3G A;  2LSN A;  3IG1 A;  3TR8 A;  4CED A;  2GV9 A;  5HRO A;  3AVC A;  1NKE A;  4B9T A;  4CF0 A;  5FRO A;  1TAU A;  3IRX A;  3OJU A;  3K5M A;  3HPG A;  1TK8 A;  1ASV A;  4JLH A;  4CEZ A;  4FK4 A;  4B9V A;  4CEB A;  3NH0 A;  3K58 A;  4CEC A;  4PQU A;  4Q0B A;  1RTJ A;  4CEE A;  4CFD A;  5C24 A;  3VQD A;  1BIZ A;  4FJX A;  1BIS A;  4C8M A;  5HRP A;  3OYM A;  5K14 A;  3BGR A;  2EHG A;  4NCG A;  4H8K A;  4CGF A;  3VQ8 A;  2OA8 A;  3RR8 A;  2D5R A;  3KD5 E;  2DY4 A;  3SUQ A;  4IFV A;  3TAN A;  3NGI A;  3MAQ A;  1C6V A;  3TAQ A;  1D9F A;  2YKM A;  3ZCM A;  1LV5 A;  4F8R A;  3AVM A;  4DFK A;  1U47 A;  3RMD A;  3OS2 A;  5JS2 A;  3DM2 A;  3LAK A;  2XHB A;  1TV6 A;  2XO7 A;  4KKO A;  4NYF A;  3WNE A;  4FJH A;  3C94 A;  1BQN A;  1VSD A;  3O3H A;  4N76 A;  3CFR A;  3HO1 A;  2ZQB A;  4IG3 A;  4BDP A;  1VSL A;  3QO9 A;  4RW8 A;  2I5J A;  2RF2 A;  4FW1 A;  4B08 A;  3OS1 A;  4E7K A;  3K5O A;  3ZSW A;  3RMC A;  4DTU A;  1NKB A;  1R0A A;  1EET A;  3NDK A;  3DOK A;  3AVH A;  4C8O A;  2RN2 A;  1BIU A;  1C0U A;  1S1V A;  4OPK A;  3S3N A;  2X74 A;  4DQQ A;  4FJ7 A;  4KRE A;  5KTQ A;  3HK2 A;  3V9X A;  1KTQ A;  2Z1G A;  3CFO A;  4ID1 A;  1JLC A;  1TKZ A;  3HPO A;  3TAB A;  1RBT A;  4NCB A;  4RW4 A;  3L2R A;  1JLQ A;  4FJK A;  3OYC A;  4FJN A;  4O4G A;  5T7B A;  3P83 D;  1EXQ A;  4DS5 A;  2G8U A;  1MU2 A;  1S6P A;  1Q9Y A;  4OLA A;  3WNF A;  1ZBL A;  1NK9 A;  3AVN A;  1D5A A;  2A1S A;  1REV A;  4IG0 A;  2HHV A;  2HNY A;  1RBV A;  4HUF A;  5FRN A;  1KSP A;  2YKN A;  1UA0 A;  1NK5 A;  4FK2 A;  3QNO A;  4Z4I A;  1RT4 A;  2FBV A;  2KZZ A;  1SL2 A;  1NOY A;  1VRU A;  2KFZ A;  4FLT A;  4FK0 A;  3OYE A;  3FFI A;  4DU1 A;  2O4I A;  1LW2 A;  2P51 A;  5CZ2 A;  1RBS A;  1DLO A;  4E19 A;  4FCY A;  4FLW A;  4DTN A;  2OZM A;  3I8D A;  4BE1 A;  1WSG A;  3DRP A;  4B8A B;  3TAM A;  2HND A;  1UA1 A;  4CJU A;  3PV8 A;  3LDS A;  4CF8 A;  2HVI A;  2E6M A;  5J2P A;  4I9L A;  3DYA A;  4AHS A;  1TVR A;  4BDZ A;  1WSH A;  3WNG A;  1XI1 A;  3P5J A;  3KTQ A;  2DTU A;  1TGO A;  3DLE A;  1NKC A;  4CK1 A;  4CJE A;  3HT3 A;  3M8Q A;  3F9K A;  4FJM A;  1SUQ A;  3SV3 A;  2VG7 A;  3V9S A;  1B9D A;  4CHZ A;  3TAG A;  4M3Z A;  4CJR A;  1GOC A;  1XWL A;  2XY7 A;  3NFA A;  1W0H A;  1WAJ A;  4DSF A;  1J5O A;  4DTJ A;  3ZT3 A;  4C8N A;  2QK9 A;  3L8B A;  3T3F A;  4N41 A;  1J9A A;  1HNV A;  4Y1D A;  1QSY A;  3V1O A;  3DLH A;  2YNF A;  4KHS A;  4C8K A;  1YVU A;  2HB5 A;  2KFN A;  4QAG A;  3DRR A;  3F73 A;  3SV4 A;  3SUN A;  3PO4 A;  1TKX A;  4TSX A;  4FW2 A;  3LAM A;  4OGC A;  1NJX A;  4DTM A;  1SL0 A;  3T19 A;  1J54 A;  4M3T A;  1Q9X A;  4M3X A;  4ZTF A;  4DSK A;  3DLR A;  3KLF A;  3L2W A;  4HHT A;  1KLM A;  1NJZ A;  4KO0 A;  4CE9 A;  2DFE A;  2RPI A;  3V9W A;  3HYF A;  5DMR A;  3UIQ A;  3NF8 A;  1C0T A;  1JLF A;  4DFM A;  4CJL A;  2XRI A;  4DSE A;  4E3S A;  4PY5 A;  3L3V A;  1VSM A;  1RDD A;  5SZT A;  1S1W A;  4CJ4 A;  4FJ9 A;  4PWD A;  4ELV A;  1RT7 A;  1BL3 A;  4O5B A;  4N47 A;  4CGJ A;  1C1A A;  4CGG A;  5I42 A;  4LY7 A;  3SZ2 A;  1QTM A;  3QEW A;  2HHS A;  2E4L A;  1O1W A;  2DFF A;  3HVT A;  4CIE A;  3QEX A;  3VQB A;  3LWM A;  3EYZ A;  3MXI A;  4DG1 A;  5KRT A;  4OKE A;  5CYM A;  1JLE A;  4DF4 A;  3QNN A;  4CJK A;  1RTD A;  1RDA A;  4YFU A;  4JS5 A;  3QEV A;  4J2E A;  3NHG A;  1CZB A;  4B3O A;  3LP1 A;  1A5X A;  3AV9 A;  4CHP A;  3KLG A;  3TAF A;  4I7F A;  2FBY A;  4CES A;  4QOZ B;  1VRT A;  1QHT A;  1U4B A;  3HP9 A;  1X9M A;  3RTV A;  3G0Z A;  3NGZ A;  1XC9 A;  3C6T A;  3L2U A;  1TKT A;  3VQE A;  1ITG A;  3OYI A;  4KB0 A;  1RIL A;  2HVH A;  1BCO A;  4KTQ A;  2E6L A;  3SUP A;  1HQU A;  3CYM A;  4IDK A;  4DQP A;  3TAP A;  1CXQ A;  3AVI A;  3MEE A;  3KKS A;  1TKD A;  4EP4 A;  3ZT4 A;  4F3T A;  3DLG A;  1SKR A;  1I39 A;  4I2Q A;  5EU7 A;  4L8R B;  1KCF A;  3OVN A;  4FLZ A;  4E7L A;  3JSM A;  3MEC A;  4CEO A;  2HHW A;  4E1M A;  4FYD A;  2AJQ A;  3SQ4 A;  4E89 A;  4H4O A;  3PX0 A;  1SKS A;  4OPJ A;  5SWM A;  3MED A;  4EP5 A;  3OYF A;  4NYN A;  3V81 A;  3O4N A;  4J2A A;  1KVA A;  3NE6 A;  1VSI A;  3OYK A;  3K57 A;  4DLE A;  1S1T A;  1RTI A;  4CJ5 A;  4CGH A;  4GW6 A;  3HPH A;  3NH2 A;  4DWI A;  5C25 A;  1UOC A;  2IGI A;  4N56 A;  4FM2 A;  1Q8I A;  2JLE A;  1WNS A;  3VQ5 A;  4Z4H A;  4CF2 A;  3ZSX A;  4OVL A;  1S9E A;  4FZY A;  2XY5 A;  1HYS A;  1NJW A;  1F21 A;  3ZT2 A;  3CFP A;  4DSL A;  3AO4 A;  4OJR A;  3SI6 A;  1HQE A;  2G8H A;  2G8I A;  4FXD A;  1A5V A;  1HPZ A;  3HJF A;  1KVB A;  2PYJ A;  4F2S A;  1C1C A;  5HRR A;  1IKW A;  3HP6 A;  4E7J A;  4CCH A;  2OPQ A;  4O0I A;  4M41 A;  3DRS A;  2HHU A;  3LAL A;  3LP0 A;  2FBT A;  3AVB A;  2QXF A;  3NGY A;  4LH4 A;  2D0B A;  3C95 A;  4MQ3 A;  4W5O A;  1UAX A;  4PA1 A;  1LWF A;  1I3A A;  4AHT A;  4Q5V A;  3OYB A;  4GMJ B;  4DFJ A;  5J2Q A;  4DF8 A;  2PZS A;  3OYG A;  2YNH A;  3ZT0 A;  3EY1 A;  3K59 A;  2OYQ A;  2HNZ A;  3SUO A;  4CHN A;  2WON A;  4LH5 A;  4FJL A;  3PUF A;  4FJ8 A;  3AA5 X;  2D0C A;  4K8Z A;  1HYZ A;  4O0J A;  1IG9 A;  1ASU A;  1FK9 A;  2KW4 A;  2F96 A;  3NF7 A;  4BDY A;  5J2N A;  1EP4 A;  3OY9 A;  3DOL A;  4DTP A;  2VG6 A;  2OPP A;  3D45 A;  4BWJ A;  3SJJ A;  4ELT A;  1HJR A;  1RDB A;  3U6F A;  5HRS A;  4CEA A;  4AHU A;  1RBU A;  4DMN A;  1N6Q A;  5FRM A;  2XY8 A;  1IKV A;  2F8S A;  4FJJ A;  4RG8 A;  3OYN A;  1T03 A;  3LP3 A;  3A2F A;  1VK0 A;  2ITG A;  2F8T A;  2Q3S A;  1NJY A;  3QER A;  1Z25 A;  1JXB A;  3OS0 A;  1ASW A;  1GOB A;  4DTX A;  3I0S A;  2OPR A;  1XHZ A;  2G8W A;  3VN5 A;  4M3Y A;  1D8Y A;  4M45 A;  1VSJ A;  3HVR A;  3B6O A;  1RDC A;  2YHB A;  3ISN C;  1U45 A;  2QKB A;  3DLK A;  5J2M A;  3ULD A;  4F4K A;  1B9F A;  3THV A;  2EX3 A;  1BQM A;  4EZ9 A;  4DTR A;  3AVG A;  3RMA A;  3LAN A;  2A1R A;  3DI6 A;  1QQC A;  4DQS A;  3EZ5 A;  1S1U A;  3JYT A;  1TK0 A;  4FJI A;  1YTU A;  3IAY A;  1BCM A;  3ZT1 A;  4AHV A;  5CZ1 A;  4E7H A;  3S3M A;  1NK0 A;  1TL1 A;  3O3F A;  1J53 A;  3I0R A;  3OYA A;  3AO3 A;  4CGI A;  4WE1 A;  1L3U A;  2ETJ A;  4I2P A;  1JL2 A;  2O4G A;  3L2V A;  1KLN A;  2KQ2 A;  1WSE A;  1TL3 A;  3AA4 A;  1VSH A;  1T7P A;  4EZ6 A;  3DLB A;  4B9U A;  4CJS A;  1W9H A;  3MXM A;  4KFB A;  1FXX A;  3QEP A;  1ZBH A;  4W5R A;  1S6Q A;  2G8K A;  4FLY A;  4CFC A;  1CZ9 A;  4F3O A;  2W42 A;  2ZD1 A;  3AO1 A;  4JRQ A;  4KHN A;  1NOZ A;  3CM5 A;  2IAJ A;  5C42 A;  2OZS A;  4E7I A;  3LPU A;  3KD1 E;  2G8F A;  4JS4 A;  1A5W A;  4CEQ A;  3V6D A;  1N5Y A;  4KHQ A;  3ZSY A;  3HST B;  4DU3 A;  5J1E A;  1BI4 A;  4FZX C;  3V9U A;  3PX6 A;  2FC0 A;  3VQ7 A;  4J2B A;  4KHU A;  4KPY A;  3SQ0 A;  5DK5 A;  2P5G A;  1HYV A;  3U3G A;  5CY4 A;  1C1B A;  3OYD A;  4MFB A;  3TAR A;  3QLH A;  4UQG A;  3H08 A;  3SQ1 A;  1NK4 A;  3ZSR A;  4LD0 A;  1S9G A;  3M8P A;  3SPY A;  1YT3 A;  1T8E A;  4W5T A;  1DTT A;  1YTA A;  2HHX A;  3S3O A;  3QIP A;  2IOC A;  1RT1 A;  2D0A A;  3QIN A;  4OGE A;  4M3R A;  1RTH A;  3LZI A;  2RKI A;  1NK6 A;  3RR7 A;  1X9W A;  4CF1 A;  1WSF A;  3U3Y A;  4W5N A;  2X6N A;  4RW9 A;  3S9H A;  3LP2 A;  2R7Y A;  1JL1 A;  3KLH A;  1RNH A;  4J2D A;  2IDO A;  4AH9 A;  3V1R A;  1CLQ A;  4ICL A;  2Z1I A;  4FM0 A;  1UWB A;  3M8S A;  1C0M A;  4FLU A;  3SNN A;  3ITH A;  4FLX A;  4CFA A;  3SPZ A;  4YNQ A;  5FDL A;  3E01 A;  4B9N A;  2GBZ A;  4CJV A;  4CJP A;  1KRP A;  4AHC A;  4FZZ A;  4R5P A;  4RW6 A;  1LW0 A;  2B6A A;  4Z4C A;  3NH1 A;  2BE2 A;  4IFY A;  3VQ9 A;  2YV0 X;  4KB1 A;  1G15 A;  4KI4 A;  3NF6 A;  3TWH A;  1FKP A;  1HNI A;  3RMB A;  4BAC A;  3P1G A;  1T05 A;  1WSJ A;  2VWJ A;  3SQ2 A;  4H4M A;  4BE2 A;  4CER A;  2DFH A;  4GVM A;  4QCL A;  2PY5 A;  1LWE A;  4CEF A;  1JXE A;  3AO5 A;  4NCA A;  1VSE A;  4KHY A;  1GOA A;  2NUB A;  3ALY A;  3ZSQ A;  3DMJ A;  4F2R A;  3V9Z A;  4FJG A;  3ZSZ A;  3AO2 A;  1QSS A;  3RRG A;  1JLA A;  3NBP A;  2Z1H A;  3KK3 A;  1NK8 A;  4Z4E A;  2KZM A;  1VSF A;  2IC3 A;  1Z26 A;  3D0P A;  3LZJ A;  4DQR A;  4HCC A;  4JRP A;  2YNG A;  1KVC A;  1WLJ A;  2PYL A;  4BWM A;  3TAE A;  3QEI A;  5HP1 A;  2G8V A;  4KRF A;  2BAN A;  4PUO A;  1ZBU A;  1IH7 A;  1DTQ A;  2OPS A;  3C6U A;  3HXM A;  4E0D A;  4LSL A;  1LAW A;  3B6P A;  5HBM A;  4E1N A;  3OJS A;  3KJV A;  4Z4F A;  1EX4 A;  3AVF A;  5CYQ A;  2FBX A;  1L5U A;  1TK5 A;  3KLI A;  4Y1C A;  5KRS A;  3AVA A;  1CXU A;  4KTZ A;  1IO2 A;  4DQI A;  3NF9 A;  1S1X A;  2HMI A;  4C8L A;  1RCH A;  3VQQ A;  2P1J A;  3O4Q A;  2VWK A;  4G1Q A;  2VG5 A;  4HTU A;  4FM1 A;  4DTS A;  3VQ6 A;  1JLB A;  2X6S A;  1L3T A;  4KI6 A;  4BE0 A;  1BI4 B;  2IS3 A;  2WOM A;  3QIO A;  3AVL A;  3AVK A;  4DLG A;  4CK3 A;  3MXJ A;  2Y1I A;  4KHW A;  2GUI A;  3RWU A;  4K8X A;  2Z1J A;  4CIG A;  4M42 A;  4AIL C;  3OYL A;  3ZSV A;  1S5J A;  3AA3 A;  1HMV A;  5HRN A;  4CJW A;  3LWL A;  3NCI A;  4B9M A;  2HHT A;  3CG7 A;  1JLG A;  3WNH A;  3RRH A;  3KK2 A;  4DSJ A;  2B5J A;  3VQ4 A;  4CHY A;  2P5O A;  1FKO A;  4I9Q A;  3OYJ A;  2YNI A;  1LAV A;  3VA3 A;  3IS9 A;  1VSK A;  1HRH A;  1TAQ A;  5JS1 A;  3PO5 A;  4M3U A;  3VQC A;  1U49 A;  1SV5 A;  3K5N A;  4HVJ A;  1RT2 A;  4Z4G A;  3MEG A;  3VQP A;  4LSN A;  3SYZ A;  1KFS A;  3LPT A;  3HL8 A;  4CGD A;  3SCX A;  2ZE2 A;  4OKJ A;  4B9S A;  1IKY A;  4O55 A;  2HHQ A;  3CQ8 A;  4ELU A;  1EKE A;  2BDP A;  4CJT A;  1L3V A;  4HUE A;  3AA2 A;  1U48 A;  3KLE A;  4FJ5 A;  4O44 A;  3ZSO A;  4ZHR A;  1ZBF A;  1RT5 A;  3BDP A;  4Z0U A;  2KTQ A;  4CFB A;  1RT6 A;  4ZTJ A;  4KAZ A;  1XHX A;  4DFP A;  4AHR A;  4DU4 A;  1L3S A;  3QET A;  4IKF A;  4IBN A;  3L3U A;  3K5L A;  3G10 A;  4KTW A;  4CK2 A;  3PY8 A;  1KFD A;  4HCB A;  5E41 A;  3OYH A;  2QKK A;  2HW3 A;  1QSL A;  1SKW A;  1QE1 A;  4FLV A;  4W5Q A;  5KI6 A;  3K2P A;  1K6Y A;  1RBR A;  4CJ3 A;  4RW7 A;  3VA0 A;  3CM6 A;  4FVM A;  4DS4 A;  4ID5 A;  4CHQ A;  1SL1 A;  1RT3 A;  4CJQ A;  1Y97 A;  5KGW A;  1B92 A;  1WN7 A;  4CJF A;  2XY6 A;  5KGX A;  5I3U A;  1D9D A;  3QES A;  1JKH A;  1LWC A;  1BGX T;  3TI0 A;  1ZYQ A;  3L2Q A;  4DSI A;  1X1P A;  4CHO A;  1IKX A;  1WAF A;  3V1Q A;  2YHA A;  3O3G A;  4B9L A;  4CF9 A;  3V4I A;  1ZBI A;  3KIO A;  2JGU A;  3VQA A;  4DTO A;  4N5S A;  2Y1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...