3NH2A

Crystal structure of rnase t in complex with a stem dna with a 3' overhang
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
207
structure length
202
Chain Sequence
GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
publication title Structural basis for RNA trimming by RNase T in stable RNA 3'-end maturation
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 202
sequence length 207
chains with identical sequence B, E, F
ec nomenclature ec 3.1.13.-:
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nh2A00
4CHYA 3ULDA 4M3RA 3DLBA 4Z4GA 3OYLA 3RMDA 1K6YA 4CERA 1ASWA 1D9DA 4IFVA 2P1JA 4FCYA 1D5AA 4DTJA 4K8ZA 1QS4A 1RBSA 1VSJA 3MECA 4FLXA 3TAQA 2P51A 3LANA 3ZT4A 4JS4A 4M3UA 4HCBA 3K59A 2OZMA 2KTQA 4R5PA 4CF1A 1B9DA 3HL8A 3KKSA 2LSNA 4W5RA 1TGOA 2IGIA 3AVBA 1G15A 3KIOA 4DTRA 3DLHA 3LWLA 1LAVA 4DTMA 1KVAA 3NE6A 2DY4A 3C6UA 1C6VA 1JLEA 3DRPA 1C0UA 2HVHA 3QEPA 5C42A 2IS3A 4KB0A 4DF8A 3SPYA 3NH2A 4N56A 4DSFA 4RG8A 2G8VA 2WOMA 3CQ8A 2G8FA 4W5QA 3VQPA 3DOKA 4LH4A 3JSMA 2YNIA 3TAEA 4RW6A 1SL0A 3U3YA 4QCLA 3V81A 2G8UA 3AO1A 2JLEA 3ITHA 1X9SA 1CZBA 4CGGA 4CEFA 3SUOA 2F96A 3VQBA 2OYQA 1S1UA 3V1RA 3VQEA 3D0PA 1ASVA 1DTQA 5DK5A 5T7BA 1HMVA 4FM0A 4CHZA 1WLJA 3LPUA 3KLEA 4DQIA 1VK0A 4PA1A 3ALYA 4CEAA 2OPSA 2NUBA 1BI4A 4DS4A 2G8HA 1TAQA 3TAMA 1LWCA 2KFZA 1TK5A 3RMCA 4LY7A 1NJWA 3SYZA 1L3SA 1RILA 1BQMA 4ID5A 3NH1A 4FJHA 1TAUA 2ETJA 4DU1A 4B9TA 3S3MA 2B4JA 4CJEA 4FZZA 3AV9A 1TL1A 5J2NA 4QOZB 2RN2A 2OA8A 4KHUA 2HNZA 3SUQA 4BWJA 4GW6A 4WE1A 3SQ4A 2IDOA 4IDKA 4RW4A 1SL1A 4OGCA 5CYMA 4FZXC 4EP4A 1R0AA 1IKWA 4IFYA 1S1VA 3QIPA 4NCGA 1DTTA 2E4LA 3K5MA 4HUGA 4E7KA 3B6OA 1L5UA 1ZBHA 1WSIA 5HBMA 2YHAA 5KI6A 3OYBA 2Z1GA 3I0SA 1NK4A 3AO4A 1NK7A 4CJ4A 2PYLA 1J5OA 4CJRA 2DTUA 4EZ6A 3C94A 4CFDA 2KZMA 3K2PA 1ZBLA 3CFOA 3AVHA 4E7HA 3DLGA 1LW0A 5FRMA 3NDKA 3OYKA 2B5JA 3LDSA 1YVUA 2F8SA 3DRRA 2F8TA 3G10A 3NH0A 3OYDA 2ZE2A 3TR8A 4FJ9A 2VG5A 2IAJA 3WNEA 4OVLA 1XWLA 3QIOA 2D0CA 4AHVA 3OYIA 2X6SA 3MAQA 1WAFA 3TANA 4AHRA 2VG7A 4CJ3A 4YNQA 4KTQA 4F2RA 3ZCMA 2YV0X 5I42A 4CJUA 4DLGA 1U49A 5CZ2A 3L3VA 4CJKA 4CHPA 1I3AA 1VSHA 2XY5A 4LSLA 1U45A 2HVIA 2YKMA 4BE2A 2GBZA 4E7LA 1CXQA 4CIEA 2KFNA 4N41A 2Y1JA 2G8WA 4LSNA 3RMBA 4Z4IA 3OS2A 3LAMA 4UQGA 2DFEA 4N47A 4JS5A 3VQ8A 4B08A 1LWFA 4CF8A 2ITGA 4FLYA 3ZSVA 5J2PA 5EU7A 3THVA 3AO5A 1UA0A 4BE0A 2EX3A 4OKEA 4B9VA 4KV8A 3SUPA 1HYVA 1JL2A 2YNHA 4B8AB 3T3FA 5J1EA 1XHZA 1IO2A 4O5BA 3O4QA 1RT3A 4FLWA 1RTDA 3HP6A 1VSFA 3VA0A 3AVCA 2PYJA 4CCHA 4Z4FA 3O3GA 1YTUA 1KLMA 4GVMA 4FJLA 4E7IA 1D9FA 4CEOA 4AHTA 4MQ3A 4G1QA 1C0MA 5K14A 4CE9A 4ELTA 4L8RB 1NJXA 3PX0A 4CFCA 1KLNA 1BCMA 1MU2A 2XY7A 4DQPA 4E1MA 4HUFA 5CZ1A 3WNHA 3OJUA 3MXIA 3S9HA 4NYNA 3QEXA 3P83D 4DTUA 4FJMA 1NJYA 1X9WA 3P5JA 1EP4A 5CYQA 1VSIA 1Z25A 1UWBA 2IOCA 1XI1A 1JL1A 2HHXA 5JS1A 1CXUA 3G0ZA 1WN7A 1WNSA 3LP2A 4H8KA 4E19A 4DLEA 3SQ2A 1YT3A 4J2BA 4KREA 1LW2A 4HCCA 4CF0A 3VQDA 1GOCA 4DFPA 1RDDA 1RT5A 3H08A 1F21A 3TI0A 4FW2A 1BIUA 4FLUA 5KTQA 4NCAA 1JLCA 3LP0A 1LV5A 3CYMA 4E0DA 1ZBFA 2OZSA 1C1AA 5HRNA 3L2VA 1S1WA 3VQ4A 3E01A 4CEQA 1Y97A 2HW3A 1JXBA 1WSHA 3HPOA 3KJVA 1HNIA 1RT2A 2D0BA 1HRHA 2OPQA 3QLHA 3NHGA 1JKHA 3IRXA 4I2QA 3EZ5A 3O4NA 1SKRA 2FBVA 2X6NA 3NFAA 3NGZA 4FJNA 1RCHA 3AVGA 1SKWA 1NOYA 2Y1IA 4KHYA 3VQ5A 4MFBA 3OS0A 1X1PA 3U6FA 1EX4A 2HHSA 4FXDA 4DTPA 1ZBIA 1UOCA 3PO4A 3VQCA 2XY8A 3DLEA 3P1GA 3HXMA 2HNDA 3IG1A 1TK8A 3KLIA 2W42A 4B9LA 4AHUA 1J54A 5E41A 2HHTA 4CFBA 4HUEA 4DU4A 3OS1A 5HLFA 4FJKA 3S3NA 4KFBA 4DS5A 2Z1IA 1RBRA 3MXMA 1A5XA 2Z1HA 4BDYA 1D8YA 4W5NA 3KD5E 3L2UA 4FK4A 2D5RA 1HQUA 5KGWA 3OYGA 2BE2A 4FVMA 4M3ZA 3MEDA 3ISNC 2KQ2A 1KCFA 3OYHA 4XIUA 5J2MA 1VRUA 3VQ7A 3ZSOA 1S5JA 1HJRA 2E6LA 1O1WA 3PUFA 4JLHA 4CK2A 3LZJA 1NK5A 1XHXA 4BWMA 4DQRA 5D3GA 4KB1A 1TVRA 3NGYA 4Y1DA 4N5SA 1TKDA 3K57A 4J2DA 4DSLA 1I39A 4DSIA 3VQAA 1U4BA 3EYZA 4M45A 1VSLA 3VA3A 3HPHA 4C8NA 3ASMA 4RW7A 4FLZA 1A5VA 1KVCA 3NGIA 4DFKA 4KHSA 1TV6A 4LH5A 1LWEA 3V9UA 1A5WA 1RNHA 4DQQA 4W5TA 1T7PA 1SUQA 4FJGA 3ZSZA 3V9WA 4FZYA 1RT4A 2VG6A 3ZSXA 1NOZA 1GOBA 4KTWA 3QNOA 3S3OA 3ZSWA 4I2PA 4ELUA 3KKRA 4KAZA 2I5JA 4ZHRA 3HJFA 1EETA 4CGDA 4PUOA 1NK6A 1X9MA 4NCBA 1RBUA 3O3FA 3RR8A 3AA3A 4ELVA 1JLBA 4CEBA 4ZTFA 4E3SA 4CEEA 4HTUA 2XY6A 4BDZA 1Q9XA 2BGGA 3QEIA 1CZ9A 3NAEA 4J2EA 2QKBA 4FJ5A 1VSDA 2GV9A 4JRPA 1REVA 5HP1A 4FK0A 4FJXA 3QINA 3TABA 2P5GA 1N6QA 1KFDA 2Z1JA 4CHNA 4FM2A 1FKOA 3ZSQA 4I7FA 1TKTA 1EXQA 1IH7A 4RW8A 3AVFA 1IG9A 3KK1A 3HP9A 4CHOA 1C0TA 4DSEA 1QSYA 3SUNA 3DI6A 4H4OA 4OKKA 3TARA 3VQQA 1RBVA 2X78A 1IKVA 3KTQA 4B9MA 4KRFA 1DLOA 3ZSRA 2OPRA 4EP5A 1T8EA 4F8RA 2HHQA 3V9ZA 3HK2A 2QXFA 1VSMA 4PY5A 3QO9A 4Z0UA 4E89A 4DMNA 1FXXA 4OGEA 1BHLA 4B8CA 4E7JA 4ICLA 3C95A 4FYDA 3IS9A 3SV3A 3QERA 4OPJA 3NF6A 1NK9A 3LWMA 2YNFA 1CLQA 3RTVA 4IKFA 1L3UA 4DSJA 2HHUA 4CJWA 2KW4A 3F9KA 3OYFA 4O0JA 4DFJA 4CK1A 2FC0A 4KTZA 3KLHA 1RDBA 3PX4A 4B9UA 4FJJA 1RT6A 2ZD1A 2YHBA 4DQSA 3LAKA 3HT3A 2FBTA 1WSFA 1LAWA 4O4GA 5HRSA 3M8PA 3QNNA 4C8LA 3AVNA 3KLFA 3I0RA 3ZT1A 4ZTJA 1BIZA 4CGJA 4IG3A 5FDLA 5HRRA 4OPKA 3QESA 4FK2A 4CJPA 3KK2A 1S9EA 1TKXA 1NKCA 3OY9A 3V1QA 1TK0A 3LALA 3A2FA 5FROA 4DTSA 1L3TA 4CF9A 4KHNA 4RW9A 4CJ5A 3IAYA 4AHSA 3K5LA 5KGXA 1RT7A 2RPIA 2BANA 3V6DA 4M3TA 3EY1A 1S6QA 4CEDA 1UA1A 4DF4A 1JLFA 2A1RA 1FKPA 1C1CA 1NK0A 5SZTA 1WSJA 1S9GA 1IKYA 4Z4CA 4DG1A 4AILC 4B9NA 4NYFA 4CJLA 2IC3A 5FRNA 3DRSA 4ID1A 4DFMA 1WSEA 3OYNA 3NF9A 4AH9A 1GOAA 4I9LA 3NF8A 4JRQA 2KZZA 3LZIA 2ATQA 4DTOA 2X74A 3VQ9A 1B92A 2D0AA 4CGHA 2EHGA 1WSGA 4CECA 4CIGA 3L2RA 3QEVA 3B6PA 3DMJA 1RTIA 2JGUA 3OYAA 3RWUA 4F4KA 1ZBUA 3LP1A 2DFFA 3SPZA 1QSLA 3RRGA 2DFHA 3DLKA 1U48A 1T05A 3RR7A 4KHWA 1YTAA 3M8RA 4FLVA 4PQUA 2A1SA 3AA5X 3QETA 3KK3A 4CGFA 1SKSA 1Q9YA 3V9XA 2HHWA 4IBNA 3V9SA 3TAFA 2HHVA 3K5NA 4HHTA 1BGXT 4CJFA 1RBTA 3SQ0A 1UAXA 2ZQBA 3ZT0A 1JLQA 4C8MA 4FJIA 4Y1CA 3M8QA 3MXJA 3CFPA 4DU3A 1QTMA 4C8OA 3NF7A 1WAJA 4KKOA 3OYCA 1SV5A 3PV8A 4KPYA 1BCOA 4FJ8A 4Z4EA 1QE1A 3LPTA 1HNVA 2HB5A 4M42A 4LD0A 2YNGA 3OYJA 1JLGA 4TSXA 3AO2A 3CM6A 1T03A 4B3OA 3BDPA 4CJVA 3KD1E 3ZT2A 4Q5VA 1QQCA 2QKKA 1RDAA 3KLGA 1HPZA 2Q3SA 4KHQA 3JYTA 2GUIA 5HRPA 4IG0A 4FLTA 1KVBA 1TL3A 1BISA 1BI4B 4Z4HA 3O3HA 1ZYQA 4DWIA 4M3XA 4F3TA 1S1TA 4CK3A 1Q8IA 4C8KA 4Q0BA 5SWMA 4CGIA 3HSTB 3PY8A 4HVJA 3TWHA 3HYFA 1VSKA 5JS2A 4FM1A 2G8IA 3CG7A 4CFAA 2E6MA 3MEGA 1QSSA 4J2AA 1ITGA 4CJSA 4KI6A 4I9QA 3AVAA 3HPGA 4QAGA 1TKZA 1W9HA 1VSEA 3NBPA 3SZ2A 3NCIA 1L3VA 1B9FA 3BGRA 3C6TA 1KSPA 3I8DA 3CM5A 2HNYA 3CFRA 3TAPA 4GMJB 4M3WA 4OLBA 3SJJA 4DTNA 2P5OA 3L2QA 4CJTA 1RTHA 4E1NA 1S6PA 4O0IA 1NKEA 2PZSA 1HYSA 1KTQA 2XRIA 1HYZA 5HROA 4CIFA 3FFIA 1KRPA 3L8BA 1Z26A 3AVJA 3DYAA 4BACA 3AVKA 4CESA 1U47A 1RTJA 3AO3A 3AVLA 4F2SA 3RMAA 4B9SA 1FK9A 3U3GA 1HQEA 1N5YA 3ZSYA 4OKJA 3AA4A 5C25A 4CF2A 4CHQA 2RF2A 1S1XA 3L2WA 3SV4A 4PWDA 2XHBA 4O55A 3M8SA 1JXEA 3T1AA 2R7YA 3F73A 4BE1A 4YFUA 4DTXA 2BDPA 4OLAA 3MEEA 4K8XA 3DM2A 3AVMA 1J9AA 3SCXA 3SI6A 4N76A 4FW1A 1VRTA 3V1OA 1NKBA 2AJQA 1U04A 1EKEA 1ASUA 2VWKA 3SNNA 4EZ9A 1BL3A 2QK9A 5KRTA 3L3UA 3OYMA 1JLAA 4CJQA 3VQ6A 5I3UA 3AA2A 2YKNA 3RRHA 1NJZA 3T19A 1W0HA 3AVIA 1BQNA 3HM9A 3QEWA 4DSKA 1XC9A 4M3YA 3TAGA 2OPPA 4OJRA 4FJ7A 5DMRA 1KFSA 2FBYA 4W5OA 2RKIA 2FBXA 3K5OA 2HMIA 2PY5A 3HO1A 2G8KA 3PX6A 1IKXA 3HVRA 1RT1A 4CEZA 3WNGA 3SQ1A 3K58A 1J53A 3LP3A 4BDPA 2B6AA 2XO7A 2VWJA 4F3OA 5C24A 5CY4A 3HVTA 3DLRA 3ZT3A 1QHTA 4H4MA 3OYEA 3VN5A 1C1BA 3OJSA 1NK8A 3V4IA 1RDCA 3OVNA 3DOLA 4KO0A 3PO5A 4M41A 5J2QA 3UIQA 3WNFA 3D45A 4AHCA 5KRSA 4KI4A 2O4GA 2WONA 4O44A 1SL2A 2O4IA
chains in the Genus database with same CATH superfamily
3ULDA 4BR9A 5MLCQ 4CERA 2P1JA 1D5AA 4K8ZA 4EAHD 4M3UA 3EE9A 4JKFA 3ZT4A 3O5BA 4CF1A 4LFCK 3HL8A 4W5RA 3JAMO 3KIOA 3DLHA 4BQZA 3NE6A 1E3MA 3BF3A 3KWIA 4DSFA 1N33K 1JCEA 2G8FA 4NLBA 4JI2K 1HLUA 3DOKA 1NGAA 3GOIA 1W2BM 1XUPO 2P9LB 3CC7N 2WTUA 4A5BA 3SUOA 3VQEA 3DJCA 3SBGA 1DTQA 4FM0A 3WQUA 1WLJA 3LPUA 3ALYA 2OPSA 1TAQA 1TK5A 3R3LA 4LF5K 4I6MA 4H0YB 1BQMA 1TAUA 2QTDA 3S3MA 3P38A 4QOZB 1NBWA 3ATVA 2GTDA 1S3XA 4IDKA 4FZXC 4HWIA 5HOOA 1IKWA 1R0AA 3QIPA 3HK2A 2ZJRL 2YHAA 5KI6A 3AO4A 1NK7A 3QFPA 2V7ZA 1J5OA 3I55N 4EZ6A 3CFOA 4E7HA 5AQIA 2FF3B 4XH1A 3BUZB 3CQYA 3G10A 2ZE2A 2VG5A 4IDHA 4OVLA 2D0CA 4AHVA 4H03B 2X6SA 5M1NA 5JVHL 3O9UA 4F2RA 1VQPN 1VSHA 4BRMA 1XNRK 2HVIA 2GBZA 3WUHA 4LSNA 4Z4IA 2ITGA 3AAPA 5AQYA 3O9SA 1UA0A 2EX3A 4OKEA 4B9VA 1HYVA 2YNHA 3MMVA 3JS6A 4B8AB 3D2EA 4KH6A 1OH5A 4O5BA 4FLWA 4CCHA 4F9OA 2P9IA 3SLCA 4GVMA 4E7IA 1BG3A 4ILHA 4AHTA 3FZFA 1C0MA 5K14A 4BR2A 3IFRA 1NJXA 3CCQN 3OJUA 1NJYA 3BZKA 5CYQA 1Z25A 3FGUA 1XI1A 1JL1A 2HHXA 5JS1A 3C7NA 1CXUA 4CZJA 4KREA 4J2BA 5AQUA 2E20A 3TI0A 1GOCA 5AQFA 3H08A 3U8XA 3KHYA 4FW2A 2NRHA 4JK8A 1YJNN 3LP0A 1LV5A 1KD1O 5AJ3K 3F2KA 4E0DA 1S1WA 1HKCA 3KJVA 1EO1A 4JN4A 1HNIA 2D0BA 3A5MC 4AM7A 4YOVA 1SKRA 1RCHA 2Y1IA 2VQFK 4JI5K 3U6FA 1J5EK 1EX4A 4JKBA 3QBXA 2HHHK 4EHTA 3VQCA 2HNDA 4B9LA 3KLIA 4BVOA 5E41A 2FLOA 2HHTA 5BRDA 4DS5A 1NGIA 3H46O 3FZKA 1D8YA 4W5NA 4IO8A 5KGWA 1VQ7N 2O8FA 4FVMA 2D4WA 3A5OC 1KCFA 4MDBA 1KC8O 1VRUA 1ATSA 2E6LA 1IBLK 4JLHA 3R8EA 4CK2A 2FSKA 4KB1A 5AR0A 4CBWA 1TKDA 4J2DA 1I39A 3R1XA 3WT0A 3F9MA 3SMSA 4RW7A 5KQ8A 4FLZA 1A5VA 2KLAA 1RDUA 4QS9A 1BWFO 4FWSA 4FZYA 3QNOA 3I33A 4CD3A 1DEJA 3FZMA 4JK7A 2QA4N 3HOTA 3CMAN 4CGDA 3HJFA 3SAHA 2P9SB 4U7BA 2IVOA 1N34K 3CCSN 1IBKK 2W41A 4JKHA 3CETA 4JRPA 4E1JA 1REVA 2GEMA 1KFDA 3OBYA 4BRKA 1FKOA 3O80A 4I7FA 3WXMB 1EXQA 2O8CA 4H0VB 1EQYA 4BG9A 4DR4K 4DV3K 1LOTB 3VQQA 4BC3A 4B9MA 1DLOA 2OPRA 4EP5A 2D1KA 5M1QA 1MA9B 5EY4A 1VSMA 1HKGA 4FYDA 4B8CA 4BR7A 4ICLA 1JCGA 3IS9A 1NGFA 4YORA 4IKFA 1L3UA 4DSJA 2HHUA 3F9KA 3OYFA 4DFJA 4ELTA 1GLDG 2FC0A 5C2FA 2YHBA 3GG4A 3LAKA 4GY2B 3HT3A 1WSFA 1LAWA 3M5RA 5A2QO 1OKJA 4B3TK 3CCJN 5HRRA 4BRGA 4PKGA 3E66A 4MLHA 3OY9A 1TK0A 3LALA 4DV0K 4KHNA 3ENOA 4RW9A 4CBXA 4AHSA 3LDLA 3S41A 2VQEK 3EL2A 3R9PA 4C1NI 2P9NA 1C1CA 1YF5L 3MN9A 1OH7A 2GWJA 4Z4CA 3CJ1A 4B9NA 4CJLA 4DR6K 2IC3A 3DRSA 2YCHA 4ID1A 1C0GA 3OYNA 4AH9A 4I9LA 2KZZA 3LZIA 2ZJQL 4LF8K 3VQ9A 1T6DA 3L2RA 3QEVA 1RTIA 2JGUA 2CH5A 1ZBUA 3LP1A 2DFFA 4H0OA 3SPZA 1T05A 1YTAA 5EOYA 2P9UA 1GLAG 4WFAL 2HHVA 1BGXT 4CJFA 2ZQBA 3BP8A 3ZEUB 4DU3A 1QTMA 1SV5A 3PV8A 4K42A 2GELA 1QE1A 3CXCM 4LD0A 3J7AP 4CZGA 1SAZA 4ISEA 2FXUA 3T7ZA 3ID6A 1DKGD 4KHQA 2GUIA 2Q36A 2UXBK 1TL3A 3KZBA 4CK3A 4Q0BA 5SWMA 4I6MB 4CGIA 3HSTB 2DPNA 3HYFA 3O9QA 4BRNA 3UKRB 4CZKA 4FM1A 3A5LC 3CG7A 2E2NA 1QSSA 3CCEN 5FPEA 1ITGA 4QAGA 5GAGP 1B9FA 5LMNK 3I8DA 3TAPA 2HNYA 1QZ6A 4OLBA 4LF6K 5F1XA 4O0IA 3HZ6A 1HYZA 3L8BA 1Z26A 3DYAA 2Q0UA 4BACA 1D4XA 3AVKA 3D7EO 1RTJA 4CESA 3VEWA 4FOEA 3CC2N 3MCAB 1HQEA 3K0SA 1N5YA 2UU9K 5C25A 4PWDA 4CHQA 3CF5L 1S1XA 3SV4A 4IOXA 4BE1A 3MEEA 3TSUA 3DM2A 3SI6A 1VRTA 1NGGA 1U04A 2AJQA 2VWKA 2NRRA 5EVZA 4JI6K 5EX5A 4X64K 3ID8A 4CJQA 4PL8A 4DV6K 3RRHA 3T19A 3GDQA 3QEWA 3H1VX 1XC9A 2OPPA 4OJRA 5C0YA 4C1NK 2ASMA 3D2EB 2ASPA 2RKIA 2FBXA 3VOVA 2PY5A 3M6GA 2UUBK 2O8BB 2P9IB 3PX6A 3QICA 3HVRA 4FOIA 1RT1A 3SBTA 2VGMA 4F3OA 5C24A 1M1KO 3VN5A 1C1BA 3V4IA 4M41A 3UIQA 5AQOA 4B1XB 3P39A 2KTQA 4BROA 1SL2A 4M3RA 3HI0A 5BPMA 3DLBA 3C7NB 1K6YA 3OA9A 2ZF5O 1TUYA 5M1PA 5BN8A 3MECA 1VSJA 4FLXA 4KH5A 4B1VA 3MN6A 4HCBA 2OZMA 1BU6O 1WB9A 5J2MA 2LSNA 2IGIA 1G15A 3N4QA 3LWLA 1LAVA 1KVAA 1JLEA 1C0UA 3C65A 1FW6A 4CZFA 4RG8A 3OW2M 4FWQA 3TAEA 3U3YA 4QCLA 3V81A 2ZGYA 1X9SA 3ITHA 1CZBA 4CEFA 5CHIA 2F96A 4NO7A 3VQBA 4DUZK 2OYQA 2W6KA 4MLEA 1ASVA 4IO9L 3MX5A 4CHZA 4JYAK 2O8FB 4JI4K 3VEVA 2NUBA 1BI4A 1NMNA 4DV4K 1RILA 4ID5A 3NH1A 3WXLA 1GLLO 2ETJA 4FZZA 4X62K 1TL1A 5BR9A 4KHUA 3KK7A 3SQ4A 3O9TA 4OPAA 4BY9C 1S1VA 4NCGA 4HUGA 1DTTA 1L5UA 2KFNA 3QBWA 3NMUA 2Z1GA 3LL3A 3C94A 2KZMA 3K2PA 4GV6A 3DLGA 1LW0A 2CGLA 4BRIA 2NZTA 5AZIA 5KPZA 3LDSA 1YVUA 3OYDA 4FJ9A 1YUWA 3EE8A 3OYIA 4GV3A 3AGKA 5DM6L 4AHRA 3RVCA 2YV0X 2O8CB 4CJUA 3TU5A 4FPAA 4YOWA 5CZ2A 4U67L 4JI3K 1Z6RA 4J8FA 4KH4A 5GAEP 5CR4A 4N41A 2HBJA 2G8WA 5AQLA 3OS2A 3LAMA 2DFEA 4NLCA 4N47A 2YHWA 4JS5A 4CF8A 5J2PA 3CMEN 1YJ9N 5EU7A 5IWAK 4KV8A 1JL2A 3H45C 1XHZA 1RTDA 3C6AA 3AVCA 4CW7B 3MN5A 4FJLA 3TTDA 3EKUA 4G1QA 1HPMA 1IBMK 4GNIA 4CFCA 1KLNA 1MU2A 4HUFA 2JWKA 1VQON 4MO4A 4FJMA 1X9WA 1EP4A 2IOCA 4AF1A 4E19A 4AM6A 1LW2A 3EKSA 4HCCA 4CF0A 2NRWA 5BN9A 3VQDA 4DFPA 1RDDA 2P9NB 1EWQA 1F21A 5KTQA 5B8HA 1C1AA 3L2VA 1NJIO 1Y64A 2P9KB 4H0XB 3IRXA 4I2QA 4FJNA 3AVGA 4BRCA 1NOYA 4KHYA 1KAZA 3VQ5A 2CGKA 4FWRA 4DV5K 1X1PA 3ZEUA 2HHSA 1UOCA 3MX2A 2WBNA 2XY8A 1VQMN 4YOUA 3PIOL 1TK8A 5KPRA 2P9UB 2W42A 4AHUA 4EHUA 4CFBA 4HUEA 4DU4A 3ENHA 5F2RA 5BPNA 3MXMA 3CHWA 1A5XA 5KPTA 4FK4A 3CIPA 2BE2A 3MEDA 2I7NA 5EXWA 2FSNA 3EN9A 3OYHA 3ZSOA 1NK5A 2PAVA 3PUFA 1O13A 1XHXA 4BWMA 5D3GA 3UKRA 3K57A 3EYZA 4M45A 3BY5A 4C8NA 4IWVA 4DFKA 4IFEA 3AY9A 2QWRA 4FJGA 1RT4A 2VG6A 1NOZA 4KTWA 3ZSWA 3KKRA 3CD6N 3U9DA 4NCBA 4H5NA 3RR8A 4ELVA 4CEBA 4ZTFA 1Q9XA 1CZ9A 3VEOA 4JKAA 4YDUA 2Z1JA 4CHNA 2E8AA 3L4IA 1MWKA 3VF4A 1Q82O 1IG9A 1G99A 3KK1A 1HNXK 4DSEA 1C0TA 2QWLA 4OKKA 3TARA 4A5AA 1QZ5A 3Q7CA 5GADP 3V9ZA 1NGHA 4E89A 4DMNA 4E7JA 4B1YB 1NK9A 1CLQA 3QB0A 4OPJA 2YNFA 3RTVA 4CJWA 4R79A 2O8BA 3LDNA 4G9ZA 1YITN 3KLHA 4B9UA 1RDBA 4FJJA 2ZD1A 4DQSA 3VF6A 1U6ZA 4O4GA 4NXNK 5HRSA 4JK9A 3M8PA 3AVNA 2QXLA 4FSVA 3I0RA 4ZTJA 2HBMA 4CGJA 5FDLA 4FK2A 3MK6A 1S9EA 1TKXA 1NKCA 3A2FA 5FROA 4CJ5A 3IAYA 1NM1A 2FSJA 3ENBA 3VGLA 2J4RA 2RPIA 2BANA 4M3TA 3EY1A 3UKUB 4BRFA 2A1RA 3A0IX 5DM7L 1NK0A 1ILYA 1IKYA 4AILC 4NYFA 3HOSA 5C15A 5AQPA 1GOAA 4JRQA 3NF8A 1IV0A 2ATQA 3DAWA 4DTOA 4UY8O 2D0AA 4CECA 3DMJA 4F4KA 2ASOA 1ATRA 4FWPA 2DFHA 3RR7A 4FLVA 3L4QA 3QETA 3KK3A 1SKSA 2HHWA 1W7AA 3ZT0A 1XMOK 3LDPA 4Y1CA 5LJWA 3MXJA 4C8OA 4Z4EA 3OYCA 4LC9B 4JKGA 3LPTA 4M42A 1JLGA 3J7YP 2IVPA 2UYTA 5H1SQ 1T03A 4A62A 2QI2A 1GLCG 3KD1E 4O5FA 4DV7K 2QKKA 1RDAA 4DQ8A 4M7XA 4YHHK 3JYTA 5HRPA 4IG0A 4FLTA 1KVBA 1BISA 1BI4B 4Z4HA 5TKYA 1VSKA 5JS2A 4J2AA 4A61A 2UUAK 4KI6A 4I9QA 4M63C 3NBPA 1VSEA 3SZ2A 3C6TA 5AQHA 3CFRA 4DV2K 3A8YA 4DTNA 3L2QA 4CJTA 1RTHA 4CZIA 1HYSA 4FWKA 3FFIA 1KRPA 3AVJA 2OCEA 1CZAN 1U47A 3HTVA 5AZIB 3SJHA 1NNEA 3C0BA 4JAXA 2Q97A 4CZLA 2W40A 4C23A 4CF2A 3L2WA 3MWPA 5E84A 2XHBA 4O55A 1Q81O 1JXEA 2BUPA 4DCHA 3F73A 4DTXA 2BDPA 4K8XA 3SCXA 4FW1A 3V1OA 1P8ZA 3SNNA 4B1WB 3BZCA 3L3UA 3OYMA 3CJAA 3AA2A 3P31A 4FWLA 3AVIA 2A6AA 3J8AA 3CJ9A 5ADXA 4M3YA 4LF9K 3DLLL 3O1BA 3I56N 5FPNA 1DGKN 3FE1A 3THYA 5AQNA 4LFBK 1BA1A 2HMPA 3DXKA 3WNGA 4CBUA 1HNZK 1J53A 2B6AA 2VWJA 3OHRA 4ISFA 2ZWHA 3PO5A 5J2QA 4AHCA 4JI0K 2O4GA 3KWGA 4CHYA 3BEXA 1XNQK 3AARA 3OYLA 3D6RA 2P9KA 1ASWA 3THWA 2QEXN 2FF6A 4IFVA 4FCYA 1NWKA 1RBSA 3TAQA 4JS4A 5FPMA 3K59A 3FR0A 5AZJA 3F5TA 3HRGA 4IJAA 1B9DA 3KKSA 4DTRA 1TGOA 3AVBA 2PBDA 3FFKB 1BUPA 4Y0WA 2DY4A 1C6VA 1W97L 2VGNA 2VCPA 4H0TB 3QEPA 5C42A 2IS3A 3R6MA 4DF8A 3SPYA 3NH2A 5AQQA 4EFHA 1QVGM 3H6EA 5AQXA 4W5QA 1WOQA 3VQPA 3JSMA 2YNIA 2IVNA 4RCHA 3G71N 2O8EA 3BF1A 1S22A 4CGGA 3WXIA 3SAGA 5DK5A 5T7BA 1HMVA 1K8AO 4LFAK 3KLEA 1ZXOA 1KAXA 5AQZA 4DQIA 1VK0A 2G8HA 4DS4A 3TAMA 1JCFA 1LWCA 3RMCA 3SYZA 4FJHA 3P4IA 4B9TA 2B4JA 4BWJA 4FWNA 2E88A 2IDOA 4RW4A 1SL1A 4EP4A 3CCMN 4IFYA 3K5MA 5HBMA 3I0SA 2WUSA 3H3OB 3W3DA 4GKJK 5FRMA 4JKEA 2B5JA 3DRRA 1N32K 4B3RK 3NH0A 3TR8A 3WNEA 1JJ2M 3E1YA 1XWLA 4JHDA 2ITMA 3MAQA 1WAFA 4KTQA 2VG7A 4CJ3A 4YNQA 3ZCMA 4JI7K 4CD1A 1K9MO 3L3VA 4CJKA 2QWNA 4CHPA 2XY5A 4LSLA 5ADXH 1VQ8N 2Y1JA 4OO1J 4GVEA 3WQTA 4UQGA 3J7ZO 3VQ8A 4B08A 4FLYA 3THVA 3AO5A 1YVNA 3SUPA 5LMUK 1Q7YO 3T3FA 1P90A 5J1EA 1RDWX 1IO2A 3HP6A 3NVMA 4JI1K 4RWTA 3O3GA 1YTUA 1KLMA 5AQJA 1D9FA 4MQ3A 4BQLA 1HR0K 4L8RB 3PX0A 1YJWN 4JD2A 1M90O 2UUCK 4KPYA 3UKUA 2XY7A 4E1MA 5CZ1A 3WNHA 5CE3A 2NRTA 5GAHP 3MXIA 3S9HA 4NYNA 3QEXA 4DTUA 5C12A 3M3ZA 3P5JA 4CVNE 1VSIA 4XEIA 3W0LA 3G0ZA 1WNSA 4DLEA 1IG8A 3PSFA 2F9WA 4IEIA 4FLUA 4NCAA 1JLCA 1ZBFA 2OZSA 3PLAA 4BC2A 2UXCK 3VQ4A 1WSHA 3HPOA 3EEQA 3NVKA 5JLHA 1RT2A 2OPQA 1HRHA 3QLHA 3NHGA 3EZ5A 2FBVA 3NFAA 2V51B 3LM2A 1SKWA 4MFBA 1QVFM 4X66K 2ZM6K 1NU0A 3IKMA 3ZETA 4DTPA 1VQKN 3TPQA 2OTJN 4IOCL 3HXMA 4A57A 1J54A 3HSCA 1VHXA 3OS1A 1HUXA 1RBRA 3E9PA 2QW9A 2Z1HA 4BDYA 3KD5E 4JKGB 4KHPK 3VMFB 5AFUA 5C10A 4M3ZA 3QFUA 4DR1K 1V4TA 3N4PA 4BRLA 1X3MA 1NGBA 4DQRA 4L3QA 1K8KA 4Y1DA 3ZLJA 4DSIA 3VQAA 3WEEA 1S72N 4WFBL 2CGJA 1VSLA 3VA3A 3ASMA 3NGIA 1KVCA 3AAQA 4KHSA 3V9UA 4LH5A 1LWEA 3T1HK 4DQQA 4W5TA 1T7PA 1SUQA 3ZSZA 3V9WA 5BRHA 4ELUA 3S3OA 4I2PA 2F7TA 2I5JA 5GIPA 1EETA 4PUOA 3CERA 1X9MA 1RBUA 3AA3A 1JLBA 4H5WA 4E3SA 4CEEA 1HKBA 4BDZA 2F4VK 3QEIA 2QKBA 3IDHA 3IUCA 4FJ5A 2GV9A 1WBDA 4FK0A 3QINA 4EIAA 3TABA 4FM2A 3ZSQA 1FJGK 1TKTA 3L6QA 1IH7A 4RW8A 4DR2K 3VPZA 3HP9A 4CHOA 3SUNA 3DI6A 1RBVA 2X78A 1WBBA 4KRFA 3MCPA 3THXB 3ZSRA 2RE2A 5KQDA 2HHQA 2QXFA 3D2FB 4PY5A 3QO9A 4Z0UA 1BHLA 1KAYA 3SV3A 1OVQA 3QERA 3NF6A 3LWMA 4DR3K 3DXMA 4O0JA 4CK1A 1VAZA 3K9JA 3PX4A 1YIJN 3TSPA 3O6WA 4BC4A 4Z94A 2E5LK 3CJBA 3QNNA 2V52B 1J6ZA 3THYB 2HF3A 1BIZA 4DB3A 4IG3A 3DXKB 3O9RA 4KBOA 3QESA 3KK2A 3V1QA 4YDUC 4MO5A 4DTSA 4CF9A 1L3TA 3K5LA 5KGXA 1EWRA 1S6QA 1ZC6A 1UA1A 4A59A 1FKPA 2E1ZA 1S9GA 3THWB 4DG1A 3VEZA 1BA0A 4FO0A 2F9TA 3TTFA 4OPHA 5AZJB 2X74A 1B92A 5M1FA 2EHGA 1WSGA 1SS6A 5LL6Z 2E2OA 3RWUA 4IOAL 1QSLA 3TSQA 1U48A 1NGEA 4KHWA 3QDKA 4PQUA 3AA5X 4CGFA 4NXMK 3MN7A 3V9XA 4IBNA 2YI1A 1C0FA 3K5NA 4DUYK 4HHTA 4JKDA 5AFUH 1RBTA 4WFNL 1UAXA 3SQ0A 1BOTO 2VYPA 2PFUA 4C8MA 3U9ZA 4FJIA 2O8EB 3M8QA 3NF7A 1WAJA 4FJ8A 1TYQA 1BCOA 1HNVA 3CCUN 2YNGA 3VTHA 4B9QA 3AO2A 3CM6A 4DV1K 4B3OA 3ZT2A 4Q5VA 1QQCA 3KLGA 1HPZA 2GX9A 3VETA 2WC9A 4B3SK 3Q7BA 1ZYQA 3VEXA 4F3TA 3IMXA 4C8KA 1Q8IA 2Q31A 3TWHA 2G8IA 3WXKA 5JMVA 1BDGA 3AVAA 1TKZA 1L3VA 1KSPA 1X9JA 4DR7K 3SK3A 4M3WA 3G25A 2QWPA 2PZSA 1KTQA 4IJNA 3T69A 2GUPA 4K41A 3AO3A 3AVLA 4F2SA 4B9SA 1QQOA 3ATUA 3U3GA 3WXJA 3ZSYA 1OH6A 3AA4A 5LY3A 2RF2A 4JHDB 3M8SA 3T1AA 4CI6A 3CI5A 1J9AA 3M1FA 4N76A 1NKBA 4EZ9A 2QK9A 1HX1A 5AQRA 4O8KA 1JLAA 3VQ6A 5I3UA 2WFBA 1T3VA 2QM1A 1RFQA 2Q2RA 3HM9A 4BGAA 3GE1A 4QS8A 3CJ7A 4K0KK 3TAGA 5I9EB 4BC5A 4FJ7A 5DMRA 1KFSA 4W5OA 3CCRN 1ESVA 3HO1A 2JWLA 4CEZA 3SQ1A 1MWMA 3FZHA 2QWQA 3OBWA 1GLBG 3HVTA 4H4MA 5C2DA 1NK8A 1E4FT 4JD2B 1GLJO 3OVNA 4YOYA 3H1QA 5KRSA 2HOEA 2WONA 4O44A 2O4IA 4BVPA 3KVGA 4Z4GA 1GLEG 3RMDA 4BGBA 1D9DA 4DTJA 4BRDA 1MDUB 4ILGB 4K43A 1QS4A 4CZEA 1NK4A 2P51A 3LANA 5BPLA 3RSEA 1BO5O 4R5PA 4PHTX 4V19S 4DTMA 3C6UA 3DRPA 2HVHA 5HL7L 4RTFD 3QMLA 4HTLA 4KB0A 4N56A 1ATNA 2G8VA 1SQKA 4GV9A 2WOMA 3CQ8A 3UB5A 3ZETB 4LH4A 4RW6A 3TTCA 1SL0A 5TKWA 3EO3A 3ULEB 2G8UA 3AO1A 2JLEA 2NRXA 5FPDA 1H1VA 1S1UA 3V1RA 2YJEA 4DKWA 3D0PA 3VGKA 4BR5A 5M1OA 4PA1A 5E26A 4CEAA 4O8UA 4PKHA 1VQ5N 2UXDK 2KFZA 2RHKA 4LY7A 5AQWA 1NJWA 1K8KB 1L3SA 4DU1A 1XC3A 4CJEA 3WEEB 3AV9A 4JEPA 5J2NA 2RN2A 2D0PA 2OA8A 2O8DA 2HNZA 3SUQA 4AQYK 1LCUA 4GW6A 4MDAA 3CCVN 5JVGL 4M7YA 4WE1A 4OGCA 5CYMA 2DTUA 3O4WA 1ZBHA 2E4LA 4E7KA 2YHYA 3B6OA 1WSIA 3OYBA 4WYBA 4CJ4A 2PYLA 4CJRA 4WQ5C 2P9PA 3FZLA 4CFDA 2H3GX 1ZBLA 3AVHA 3H3NO 3NDKA 3MWTA 3OYKA 3SMPA 2F8SA 3VGMA 2F8TA 1WUAA 1HNWK 1OVYA 2IAJA 3QIOA 4YOXA 3THXA 3TANA 3D2FA 5I42A 1U2VA 1XQSC 4DLGA 1U49A 2A41A 1I3AA 3CQXA 1U45A 3PIPL 2YKMA 4BE2A 4E7LA 1CXQA 1T6CA 4CIEA 3RMBA 1KXPA 5AQKA 2HBKA 5ELZA 1LWFA 3ZSVA 4BREA 4BE0A 3DXMB 2KHOA 4IZ9A 4FL9A 3EZWA 1RT3A 3O4QA 2PYJA 3VA0A 1VSFA 2GWKA 4Z4FA 3JXUA 3LDQA 4CEOA 4CE9A 2A3ZA 4B3MK 3O8MA 4FWOA 5BREA 4BRPA 1BCMA 4DQPA 1YAGA 3FLCO 1QQMA 3P83D 4BR4A 1UWBA 2NNWA 1WN7A 4H8KA 3LP2A 3SQ2A 1YT3A 3ZX3A 1RT5A 3VEYA 2D0OA 1BIUA 3ZX2A 3CYMA 2ZGZA 5HRNA 2AP1A 4H5RA 1TUUA 3E01A 4CEQA 1Y97A 2HW3A 1JXBA 4BG8A 3GL1A 2E1YA 3CCLN 4WQ4C 1JKHA 2OTLN 4H0PA 3O4NA 3NGZA 2X6NA 2OANA 1K73O 5JLFA 5JICA 4WQ5A 1RGIA 3DWLA 3OS0A 4QS7A 3E9OA 4ILJA 2HF4A 4FXDA 1ZBIA 4JI8K 3PO4A 3E9LA 3VESA 3DLEA 3P1GA 1SZ2A 2HSTA 3IG1A 1VQ6N 2P9LA 4XH4A 4FJKA 5HLFA 1IJJA 3S3NA 4KFBA 2Z1IA 2BTFA 4LF7K 3LM9A 1QQNA 3L2UA 1TYQB 2D5RA 3OTOK 1HQUA 3OYGA 3ISNC 1V4SA 2KQ2A 4XIUA 3VQ7A 1S5JA 1HJRA 2EWSA 1O1WA 3LZJA 3K9KA 1TVRA 3NGYA 4N5SA 5GIOA 4DR5K 4DSLA 3G4SN 4BRAA 1U4BA 4GKKK 5AQTA 3HPHA 4WCEL 1TV6A 1A5WA 1RNHA 4H5TA 3ZSXA 1GOBA 2KKZA 3CPWM 4KAZA 2CH6A 4ZHRA 2E2QA 2A42A 1NK6A 2VWBA 3O3FA 1Z05A 4HTUA 2XY6A 4OX9K 2BGGA 2AA4A 2A40A 4PL7A 3NAEA 1VQ9N 4J2EA 2BH1A 2YJFA 3J80O 1VSDA 3HBTA 5HP1A 4FJXA 2P5GA 1T44A 1N6QA 2Q1NA 1N36K 3ZX0A 4FVUA 3U4LA 3AVFA 5AQVA 1QSYA 4H4OA 5AQMA 4CJ7A 1IKVA 3KTQA 3HM8A 4WQ4A 1I94K 1T8EA 3O08A 4F8RA 1N8RO 3I8BA 1FXXA 4OGEA 3C95A 3VERA 1NG9A 4FPBA 2KW4A 4YOTA 4BRQA 3VENA 4KTZA 1RT6A 2NRVA 2FBTA 2QWMA 3O1WA 4C8LA 3KLFA 1OH8A 3ZT1A 4B1ZA 4JKCA 3CC4N 5M1KA 4OPKA 4FWMA 4CJPA 2I7PA 5AQSA 1RT7A 3V6DA 4CEDA 2HBLA 4DF4A 1JLFA 3A5NC 5SZTA 1KQSM 1YHQN 1WSJA 4CZHA 3T1YK 1YI2N 1R59O 4DFMA 4WF9L 5FRNA 4JNEA 1WSEA 3NF9A 3RSEB 1VQ4N 4XH5A 1XMQK 5F0XA 4CGHA 4CIGA 5AQGA 3B6PA 3OYAA 3ULEA 3RRGA 3DLKA 3ZYYX 1Q86O 3M8RA 2A1SA 1Q9YA 3V9SA 3TAFA 3UE5A 1JLQA 1X3NA 3CFPA 2ZJPL 4KKOA 3CPEA 1NLVA 2HB5A 4BR0A 3OYJA 2NRZA 4TSXA 3MDQA 3BDPA 4CJVA 3PSIA 4IXCA 2Q3SA 1Q18A 4DHYA 2Q0RA 1VQLN 3O3HA 4DWIA 4M3XA 1S1TA 5BRFA 3LDOA 3PY8A 1NGJA 4HVJA 1GLFO 2YHXA 1HJOA 1NMDA 4CFAA 2E6MA 3MEGA 4LF4K 2YX6A 3SAFA 4CJSA 2O8DB 5BR8K 4JV5K 3HPGA 5FLXO 1W9HA 3GBTA 3NCIA 3BGRA 4ISGA 3CM5A 1NGDA 4GMJB 2P9SA 3SJJA 1VQNN 2E2PA 4BRHA 2P5OA 4E1NA 1NKEA 1S6PA 2XRIA 5HROA 4CIFA 2P9PB 3J81O 1YXQA 4PKIA 3RMAA 1FK9A 2A5XA 4OKJA 5GINA 3C6HA 2W6LA 4YY3K 2R7YA 3VTIA 2V7YA 4YFUA 4OLAA 3AVMA 1U2VB 1EKEA 1ASUA 1BL3A 3VF2A 5KRTA 3B8AX 3G6EN 1NGCA 2YKNA 1NJZA 4NB4A 1W0HA 1BQNA 1E4GT 4DSKA 4CZMA 4A2AA 2FBYA 2NLXA 5LJVA 3K5OA 2HMIA 1ZBSA 5IT9O 3L0QA 2G8KA 1IKXA 4B1UB 3K58A 3LP3A 4BDPA 2XO7A 5CY4A 3DLRA 3ZT3A 4A2BA 1QHTA 2QWOA 3AGRA 3CJCA 4K25A 4X65K 3OYEA 4H5VA 3OJSA 1QHAA 1DT9A 1RDCA 3DOLA 2IIRA 4KO0A 4IEEA 3WNFA 3D45A 4KI4A
chains in the Genus database with same CATH topology
4CHYA 3ULDA 4M3RA 3DLBA 4Z4GA 3OYLA 3RMDA 1K6YA 4CERA 1ASWA 1D9DA 4IFVA 2P1JA 4FCYA 1D5AA 4DTJA 4K8ZA 1QS4A 1RBSA 1VSJA 3MECA 4FLXA 3TAQA 2P51A 3LANA 3ZT4A 4JS4A 4M3UA 4HCBA 3K59A 2OZMA 2KTQA 4R5PA 4CF1A 1B9DA 3HL8A 3KKSA 2LSNA 4W5RA 1TGOA 2IGIA 3AVBA 1G15A 3KIOA 4DTRA 3DLHA 3LWLA 1LAVA 4DTMA 1KVAA 3NE6A 2DY4A 3C6UA 1C6VA 1JLEA 3DRPA 1C0UA 2HVHA 3QEPA 5C42A 2IS3A 4KB0A 4DF8A 3SPYA 3NH2A 4N56A 4DSFA 4RG8A 2G8VA 2WOMA 3CQ8A 2G8FA 4W5QA 3VQPA 3DOKA 4LH4A 3JSMA 2YNIA 3TAEA 4RW6A 1SL0A 3U3YA 4QCLA 3V81A 2G8UA 3AO1A 2JLEA 3ITHA 1X9SA 1CZBA 4CGGA 4CEFA 3SUOA 2F96A 3VQBA 2OYQA 1S1UA 3V1RA 3VQEA 3D0PA 1ASVA 1DTQA 5DK5A 5T7BA 1HMVA 4FM0A 4CHZA 1WLJA 3LPUA 3KLEA 4DQIA 1VK0A 4PA1A 3ALYA 4CEAA 2OPSA 2NUBA 1BI4A 4DS4A 2G8HA 1TAQA 3TAMA 1LWCA 2KFZA 1TK5A 3RMCA 4LY7A 1NJWA 3SYZA 1L3SA 1RILA 1BQMA 4ID5A 3NH1A 4FJHA 1TAUA 2ETJA 4DU1A 4B9TA 3S3MA 2B4JA 4CJEA 4FZZA 3AV9A 1TL1A 5J2NA 4QOZB 2RN2A 2OA8A 4KHUA 2HNZA 3SUQA 4BWJA 4GW6A 4WE1A 3SQ4A 2IDOA 4IDKA 4RW4A 1SL1A 4OGCA 5CYMA 4FZXC 4EP4A 1R0AA 1IKWA 4IFYA 1S1VA 3QIPA 4NCGA 1DTTA 2E4LA 3K5MA 4HUGA 4E7KA 3B6OA 1L5UA 1ZBHA 1WSIA 5HBMA 2YHAA 5KI6A 3OYBA 2Z1GA 3I0SA 1NK4A 3AO4A 1NK7A 4CJ4A 2PYLA 1J5OA 4CJRA 2DTUA 4EZ6A 3C94A 4CFDA 2KZMA 3K2PA 1ZBLA 3CFOA 3AVHA 4E7HA 3DLGA 1LW0A 5FRMA 3NDKA 3OYKA 2B5JA 3LDSA 1YVUA 2F8SA 3DRRA 2F8TA 3G10A 3NH0A 3OYDA 2ZE2A 3TR8A 4FJ9A 2VG5A 2IAJA 3WNEA 4OVLA 1XWLA 3QIOA 2D0CA 4AHVA 3OYIA 2X6SA 3MAQA 1WAFA 3TANA 4AHRA 2VG7A 4CJ3A 4YNQA 4KTQA 4F2RA 3ZCMA 2YV0X 5I42A 4CJUA 4DLGA 1U49A 5CZ2A 3L3VA 4CJKA 4CHPA 1I3AA 1VSHA 2XY5A 4LSLA 1U45A 2HVIA 2YKMA 4BE2A 2GBZA 4E7LA 1CXQA 4CIEA 2KFNA 4N41A 2Y1JA 2G8WA 4LSNA 3RMBA 4Z4IA 3OS2A 3LAMA 4UQGA 2DFEA 4N47A 4JS5A 3VQ8A 4B08A 1LWFA 4CF8A 2ITGA 4FLYA 3ZSVA 5J2PA 5EU7A 3THVA 3AO5A 1UA0A 4BE0A 2EX3A 4OKEA 4B9VA 4KV8A 3SUPA 1HYVA 1JL2A 2YNHA 4B8AB 3T3FA 5J1EA 1XHZA 1IO2A 4O5BA 3O4QA 1RT3A 4FLWA 1RTDA 3HP6A 1VSFA 3VA0A 3AVCA 2PYJA 4CCHA 4Z4FA 3O3GA 1YTUA 1KLMA 4GVMA 4FJLA 4E7IA 1D9FA 4CEOA 4AHTA 4MQ3A 4G1QA 1C0MA 5K14A 4CE9A 4ELTA 4L8RB 1NJXA 3PX0A 4CFCA 1KLNA 1BCMA 1MU2A 2XY7A 4DQPA 4E1MA 4HUFA 5CZ1A 3WNHA 3OJUA 3MXIA 3S9HA 4NYNA 3QEXA 3P83D 4DTUA 4FJMA 1NJYA 1X9WA 3P5JA 1EP4A 5CYQA 1VSIA 1Z25A 1UWBA 2IOCA 1XI1A 1JL1A 2HHXA 5JS1A 1CXUA 3G0ZA 1WN7A 1WNSA 3LP2A 4H8KA 4E19A 4DLEA 3SQ2A 1YT3A 4J2BA 4KREA 1LW2A 4HCCA 4CF0A 3VQDA 1GOCA 4DFPA 1RDDA 1RT5A 3H08A 1F21A 3TI0A 4FW2A 1BIUA 4FLUA 5KTQA 4NCAA 1JLCA 3LP0A 1LV5A 3CYMA 4E0DA 1ZBFA 2OZSA 1C1AA 5HRNA 3L2VA 1S1WA 3VQ4A 3E01A 4CEQA 1Y97A 2HW3A 1JXBA 1WSHA 3HPOA 3KJVA 1HNIA 1RT2A 2D0BA 1HRHA 2OPQA 3QLHA 3NHGA 1JKHA 3IRXA 4I2QA 3EZ5A 3O4NA 1SKRA 2FBVA 2X6NA 3NFAA 3NGZA 4FJNA 1RCHA 3AVGA 1SKWA 1NOYA 2Y1IA 4KHYA 3VQ5A 4MFBA 3OS0A 1X1PA 3U6FA 1EX4A 2HHSA 4FXDA 4DTPA 1ZBIA 1UOCA 3PO4A 3VQCA 2XY8A 3DLEA 3P1GA 3HXMA 2HNDA 3IG1A 1TK8A 3KLIA 2W42A 4B9LA 4AHUA 1J54A 5E41A 2HHTA 4CFBA 4HUEA 4DU4A 3OS1A 5HLFA 4FJKA 3S3NA 4KFBA 4DS5A 2Z1IA 1RBRA 3MXMA 1A5XA 2Z1HA 4BDYA 1D8YA 4W5NA 3KD5E 3L2UA 4FK4A 2D5RA 1HQUA 5KGWA 3OYGA 2BE2A 4FVMA 4M3ZA 3MEDA 3ISNC 2KQ2A 1KCFA 3OYHA 4XIUA 5J2MA 1VRUA 3VQ7A 3ZSOA 1S5JA 1HJRA 2E6LA 1O1WA 3PUFA 4JLHA 4CK2A 3LZJA 1NK5A 1XHXA 4BWMA 4DQRA 5D3GA 4KB1A 1TVRA 3NGYA 4Y1DA 4N5SA 1TKDA 3K57A 4J2DA 4DSLA 1I39A 4DSIA 3VQAA 1U4BA 3EYZA 4M45A 1VSLA 3VA3A 3HPHA 4C8NA 3ASMA 4RW7A 4FLZA 1A5VA 1KVCA 3NGIA 4DFKA 4KHSA 1TV6A 4LH5A 1LWEA 3V9UA 1A5WA 1RNHA 4DQQA 4W5TA 1T7PA 1SUQA 4FJGA 3ZSZA 3V9WA 4FZYA 1RT4A 2VG6A 3ZSXA 1NOZA 1GOBA 4KTWA 3QNOA 3S3OA 3ZSWA 4I2PA 4ELUA 3KKRA 4KAZA 2I5JA 4ZHRA 3HJFA 1EETA 4CGDA 4PUOA 1NK6A 1X9MA 4NCBA 1RBUA 3O3FA 3RR8A 3AA3A 4ELVA 1JLBA 4CEBA 4ZTFA 4E3SA 4CEEA 4HTUA 2XY6A 4BDZA 1Q9XA 2BGGA 3QEIA 1CZ9A 3NAEA 4J2EA 2QKBA 4FJ5A 1VSDA 2GV9A 4JRPA 1REVA 5HP1A 4FK0A 4FJXA 3QINA 3TABA 2P5GA 1N6QA 1KFDA 2Z1JA 4CHNA 4FM2A 1FKOA 3ZSQA 4I7FA 1TKTA 1EXQA 1IH7A 4RW8A 3AVFA 1IG9A 3KK1A 3HP9A 4CHOA 1C0TA 4DSEA 1QSYA 3SUNA 3DI6A 4H4OA 4OKKA 3TARA 3VQQA 1RBVA 2X78A 1IKVA 3KTQA 4B9MA 4KRFA 1DLOA 3ZSRA 2OPRA 4EP5A 1T8EA 4F8RA 2HHQA 3V9ZA 3HK2A 2QXFA 1VSMA 4PY5A 3QO9A 4Z0UA 4E89A 4DMNA 1FXXA 4OGEA 1BHLA 4B8CA 4E7JA 4ICLA 3C95A 4FYDA 3IS9A 3SV3A 3QERA 4OPJA 3NF6A 1NK9A 3LWMA 2YNFA 1CLQA 3RTVA 4IKFA 1L3UA 4DSJA 2HHUA 4CJWA 2KW4A 3F9KA 3OYFA 4O0JA 4DFJA 4CK1A 2FC0A 4KTZA 3KLHA 1RDBA 3PX4A 4B9UA 4FJJA 1RT6A 2ZD1A 2YHBA 4DQSA 3LAKA 3HT3A 2FBTA 1WSFA 1LAWA 4O4GA 5HRSA 3M8PA 3QNNA 4C8LA 3AVNA 3KLFA 3I0RA 3ZT1A 4ZTJA 1BIZA 4CGJA 4IG3A 5FDLA 5HRRA 4OPKA 3QESA 4FK2A 4CJPA 3KK2A 1S9EA 1TKXA 1NKCA 3OY9A 3V1QA 1TK0A 3LALA 3A2FA 5FROA 4DTSA 1L3TA 4CF9A 4KHNA 4RW9A 4CJ5A 3IAYA 4AHSA 3K5LA 5KGXA 1RT7A 2RPIA 2BANA 3V6DA 4M3TA 3EY1A 1S6QA 4CEDA 1UA1A 4DF4A 1JLFA 2A1RA 1FKPA 1C1CA 1NK0A 5SZTA 1WSJA 1S9GA 1IKYA 4Z4CA 4DG1A 4AILC 4B9NA 4NYFA 4CJLA 2IC3A 5FRNA 3DRSA 4ID1A 4DFMA 1WSEA 3OYNA 3NF9A 4AH9A 1GOAA 4I9LA 3NF8A 4JRQA 2KZZA 3LZIA 2ATQA 4DTOA 2X74A 3VQ9A 1B92A 2D0AA 4CGHA 2EHGA 1WSGA 4CECA 4CIGA 3L2RA 3QEVA 3B6PA 3DMJA 1RTIA 2JGUA 3OYAA 3RWUA 4F4KA 1ZBUA 3LP1A 2DFFA 3SPZA 1QSLA 3RRGA 2DFHA 3DLKA 1U48A 1T05A 3RR7A 4KHWA 1YTAA 3M8RA 4FLVA 4PQUA 2A1SA 3AA5X 3QETA 3KK3A 4CGFA 1SKSA 1Q9YA 3V9XA 2HHWA 4IBNA 3V9SA 3TAFA 2HHVA 3K5NA 4HHTA 1BGXT 4CJFA 1RBTA 3SQ0A 1UAXA 2ZQBA 3ZT0A 1JLQA 4C8MA 4FJIA 4Y1CA 3M8QA 3MXJA 3CFPA 4DU3A 1QTMA 4C8OA 3NF7A 1WAJA 4KKOA 3OYCA 1SV5A 3PV8A 4KPYA 1BCOA 4FJ8A 4Z4EA 1QE1A 3LPTA 1HNVA 2HB5A 4M42A 4LD0A 2YNGA 3OYJA 1JLGA 4TSXA 3AO2A 3CM6A 1T03A 4B3OA 3BDPA 4CJVA 3KD1E 3ZT2A 4Q5VA 1QQCA 2QKKA 1RDAA 3KLGA 1HPZA 2Q3SA 4KHQA 3JYTA 2GUIA 5HRPA 4IG0A 4FLTA 1KVBA 1TL3A 1BISA 1BI4B 4Z4HA 3O3HA 1ZYQA 4DWIA 4M3XA 4F3TA 1S1TA 4CK3A 1Q8IA 4C8KA 4Q0BA 5SWMA 4CGIA 3HSTB 3PY8A 4HVJA 3TWHA 3HYFA 1VSKA 5JS2A 4FM1A 2G8IA 3CG7A 4CFAA 2E6MA 3MEGA 1QSSA 4J2AA 1ITGA 4CJSA 4KI6A 4I9QA 3AVAA 3HPGA 4QAGA 1TKZA 1W9HA 1VSEA 3NBPA 3SZ2A 3NCIA 1L3VA 1B9FA 3BGRA 3C6TA 1KSPA 3I8DA 3CM5A 2HNYA 3CFRA 3TAPA 4GMJB 4M3WA 4OLBA 3SJJA 4DTNA 2P5OA 3L2QA 4CJTA 1RTHA 4E1NA 1S6PA 4O0IA 1NKEA 2PZSA 1HYSA 1KTQA 2XRIA 1HYZA 5HROA 4CIFA 3FFIA 1KRPA 3L8BA 1Z26A 3AVJA 3DYAA 4BACA 3AVKA 4CESA 1U47A 1RTJA 3AO3A 3AVLA 4F2SA 3RMAA 4B9SA 1FK9A 3U3GA 1HQEA 1N5YA 3ZSYA 4OKJA 3AA4A 5C25A 4CF2A 4CHQA 2RF2A 1S1XA 3L2WA 3SV4A 4PWDA 2XHBA 4O55A 3M8SA 1JXEA 3T1AA 2R7YA 3F73A 4BE1A 4YFUA 4DTXA 2BDPA 4OLAA 3MEEA 4K8XA 3DM2A 3AVMA 1J9AA 3SCXA 3SI6A 4N76A 4FW1A 1VRTA 3V1OA 1NKBA 2AJQA 1U04A 1EKEA 1ASUA 2VWKA 3SNNA 4EZ9A 1BL3A 2QK9A 5KRTA 3L3UA 3OYMA 1JLAA 4CJQA 3VQ6A 5I3UA 3AA2A 2YKNA 3RRHA 1NJZA 3T19A 1W0HA 3AVIA 1BQNA 3HM9A 3QEWA 4DSKA 1XC9A 4M3YA 3TAGA 2OPPA 4OJRA 4FJ7A 5DMRA 1KFSA 2FBYA 4W5OA 2RKIA 2FBXA 3K5OA 2HMIA 2PY5A 3HO1A 2G8KA 3PX6A 1IKXA 3HVRA 1RT1A 4CEZA 3WNGA 3SQ1A 3K58A 1J53A 3LP3A 4BDPA 2B6AA 2XO7A 2VWJA 4F3OA 5C24A 5CY4A 3HVTA 3DLRA 3ZT3A 1QHTA 4H4MA 3OYEA 3VN5A 1C1BA 3OJSA 1NK8A 3V4IA 1RDCA 3OVNA 3DOLA 4KO0A 3PO5A 4M41A 5J2QA 3UIQA 3WNFA 3D45A 4AHCA 5KRSA 4KI4A 2O4GA 2WONA 4O44A 1SL2A 2O4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHY A;  3ULD A;  4M3R A;  3DLB A;  4Z4G A;  3OYL A;  3RMD A;  1K6Y A;  4CER A;  1ASW A;  1D9D A;  4IFV A;  2P1J A;  4FCY A;  1D5A A;  4DTJ A;  4K8Z A;  1QS4 A;  1RBS A;  1VSJ A;  3MEC A;  4FLX A;  3TAQ A;  2P51 A;  3LAN A;  3ZT4 A;  4JS4 A;  4M3U A;  4HCB A;  3K59 A;  2OZM A;  2KTQ A;  4R5P A;  4CF1 A;  1B9D A;  3HL8 A;  3KKS A;  2LSN A;  4W5R A;  1TGO A;  2IGI A;  3AVB A;  1G15 A;  3KIO A;  4DTR A;  3DLH A;  3LWL A;  1LAV A;  4DTM A;  1KVA A;  3NE6 A;  2DY4 A;  3C6U A;  1C6V A;  1JLE A;  3DRP A;  1C0U A;  2HVH A;  3QEP A;  5C42 A;  2IS3 A;  4KB0 A;  4DF8 A;  3SPY A;  3NH2 A;  4N56 A;  4DSF A;  4RG8 A;  2G8V A;  2WOM A;  3CQ8 A;  2G8F A;  4W5Q A;  3VQP A;  3DOK A;  4LH4 A;  3JSM A;  2YNI A;  3TAE A;  4RW6 A;  1SL0 A;  3U3Y A;  4QCL A;  3V81 A;  2G8U A;  3AO1 A;  2JLE A;  3ITH A;  1X9S A;  1CZB A;  4CGG A;  4CEF A;  3SUO A;  2F96 A;  3VQB A;  2OYQ A;  1S1U A;  3V1R A;  3VQE A;  3D0P A;  1ASV A;  1DTQ A;  5DK5 A;  5T7B A;  1HMV A;  4FM0 A;  4CHZ A;  1WLJ A;  3LPU A;  3KLE A;  4DQI A;  1VK0 A;  4PA1 A;  3ALY A;  4CEA A;  2OPS A;  2NUB A;  1BI4 A;  4DS4 A;  2G8H A;  1TAQ A;  3TAM A;  1LWC A;  2KFZ A;  1TK5 A;  3RMC A;  4LY7 A;  1NJW A;  3SYZ A;  1L3S A;  1RIL A;  1BQM A;  4ID5 A;  3NH1 A;  4FJH A;  1TAU A;  2ETJ A;  4DU1 A;  4B9T A;  3S3M A;  2B4J A;  4CJE A;  4FZZ A;  3AV9 A;  1TL1 A;  5J2N A;  4QOZ B;  2RN2 A;  2OA8 A;  4KHU A;  2HNZ A;  3SUQ A;  4BWJ A;  4GW6 A;  4WE1 A;  3SQ4 A;  2IDO A;  4IDK A;  4RW4 A;  1SL1 A;  4OGC A;  5CYM A;  4FZX C;  4EP4 A;  1R0A A;  1IKW A;  4IFY A;  1S1V A;  3QIP A;  4NCG A;  1DTT A;  2E4L A;  3K5M A;  4HUG A;  4E7K A;  3B6O A;  1L5U A;  1ZBH A;  1WSI A;  5HBM A;  2YHA A;  5KI6 A;  3OYB A;  2Z1G A;  3I0S A;  1NK4 A;  3AO4 A;  1NK7 A;  4CJ4 A;  2PYL A;  1J5O A;  4CJR A;  2DTU A;  4EZ6 A;  3C94 A;  4CFD A;  2KZM A;  3K2P A;  1ZBL A;  3CFO A;  3AVH A;  4E7H A;  3DLG A;  1LW0 A;  5FRM A;  3NDK A;  3OYK A;  2B5J A;  3LDS A;  1YVU A;  2F8S A;  3DRR A;  2F8T A;  3G10 A;  3NH0 A;  3OYD A;  2ZE2 A;  3TR8 A;  4FJ9 A;  2VG5 A;  2IAJ A;  3WNE A;  4OVL A;  1XWL A;  3QIO A;  2D0C A;  4AHV A;  3OYI A;  2X6S A;  3MAQ A;  1WAF A;  3TAN A;  4AHR A;  2VG7 A;  4CJ3 A;  4YNQ A;  4KTQ A;  4F2R A;  3ZCM A;  2YV0 X;  5I42 A;  4CJU A;  4DLG A;  1U49 A;  5CZ2 A;  3L3V A;  4CJK A;  4CHP A;  1I3A A;  1VSH A;  2XY5 A;  4LSL A;  1U45 A;  2HVI A;  2YKM A;  4BE2 A;  2GBZ A;  4E7L A;  1CXQ A;  4CIE A;  2KFN A;  4N41 A;  2Y1J A;  2G8W A;  4LSN A;  3RMB A;  4Z4I A;  3OS2 A;  3LAM A;  4UQG A;  2DFE A;  4N47 A;  4JS5 A;  3VQ8 A;  4B08 A;  1LWF A;  4CF8 A;  2ITG A;  4FLY A;  3ZSV A;  5J2P A;  5EU7 A;  3THV A;  3AO5 A;  1UA0 A;  4BE0 A;  2EX3 A;  4OKE A;  4B9V A;  4KV8 A;  3SUP A;  1HYV A;  1JL2 A;  2YNH A;  4B8A B;  3T3F A;  5J1E A;  1XHZ A;  1IO2 A;  4O5B A;  3O4Q A;  1RT3 A;  4FLW A;  1RTD A;  3HP6 A;  1VSF A;  3VA0 A;  3AVC A;  2PYJ A;  4CCH A;  4Z4F A;  3O3G A;  1YTU A;  1KLM A;  4GVM A;  4FJL A;  4E7I A;  1D9F A;  4CEO A;  4AHT A;  4MQ3 A;  4G1Q A;  1C0M A;  5K14 A;  4CE9 A;  4ELT A;  4L8R B;  1NJX A;  3PX0 A;  4CFC A;  1KLN A;  1BCM A;  1MU2 A;  2XY7 A;  4DQP A;  4E1M A;  4HUF A;  5CZ1 A;  3WNH A;  3OJU A;  3MXI A;  3S9H A;  4NYN A;  3QEX A;  3P83 D;  4DTU A;  4FJM A;  1NJY A;  1X9W A;  3P5J A;  1EP4 A;  5CYQ A;  1VSI A;  1Z25 A;  1UWB A;  2IOC A;  1XI1 A;  1JL1 A;  2HHX A;  5JS1 A;  1CXU A;  3G0Z A;  1WN7 A;  1WNS A;  3LP2 A;  4H8K A;  4E19 A;  4DLE A;  3SQ2 A;  1YT3 A;  4J2B A;  4KRE A;  1LW2 A;  4HCC A;  4CF0 A;  3VQD A;  1GOC A;  4DFP A;  1RDD A;  1RT5 A;  3H08 A;  1F21 A;  3TI0 A;  4FW2 A;  1BIU A;  4FLU A;  5KTQ A;  4NCA A;  1JLC A;  3LP0 A;  1LV5 A;  3CYM A;  4E0D A;  1ZBF A;  2OZS A;  1C1A A;  5HRN A;  3L2V A;  1S1W A;  3VQ4 A;  3E01 A;  4CEQ A;  1Y97 A;  2HW3 A;  1JXB A;  1WSH A;  3HPO A;  3KJV A;  1HNI A;  1RT2 A;  2D0B A;  1HRH A;  2OPQ A;  3QLH A;  3NHG A;  1JKH A;  3IRX A;  4I2Q A;  3EZ5 A;  3O4N A;  1SKR A;  2FBV A;  2X6N A;  3NFA A;  3NGZ A;  4FJN A;  1RCH A;  3AVG A;  1SKW A;  1NOY A;  2Y1I A;  4KHY A;  3VQ5 A;  4MFB A;  3OS0 A;  1X1P A;  3U6F A;  1EX4 A;  2HHS A;  4FXD A;  4DTP A;  1ZBI A;  1UOC A;  3PO4 A;  3VQC A;  2XY8 A;  3DLE A;  3P1G A;  3HXM A;  2HND A;  3IG1 A;  1TK8 A;  3KLI A;  2W42 A;  4B9L A;  4AHU A;  1J54 A;  5E41 A;  2HHT A;  4CFB A;  4HUE A;  4DU4 A;  3OS1 A;  5HLF A;  4FJK A;  3S3N A;  4KFB A;  4DS5 A;  2Z1I A;  1RBR A;  3MXM A;  1A5X A;  2Z1H A;  4BDY A;  1D8Y A;  4W5N A;  3KD5 E;  3L2U A;  4FK4 A;  2D5R A;  1HQU A;  5KGW A;  3OYG A;  2BE2 A;  4FVM A;  4M3Z A;  3MED A;  3ISN C;  2KQ2 A;  1KCF A;  3OYH A;  4XIU A;  5J2M A;  1VRU A;  3VQ7 A;  3ZSO A;  1S5J A;  1HJR A;  2E6L A;  1O1W A;  3PUF A;  4JLH A;  4CK2 A;  3LZJ A;  1NK5 A;  1XHX A;  4BWM A;  4DQR A;  5D3G A;  4KB1 A;  1TVR A;  3NGY A;  4Y1D A;  4N5S A;  1TKD A;  3K57 A;  4J2D A;  4DSL A;  1I39 A;  4DSI A;  3VQA A;  1U4B A;  3EYZ A;  4M45 A;  1VSL A;  3VA3 A;  3HPH A;  4C8N A;  3ASM A;  4RW7 A;  4FLZ A;  1A5V A;  1KVC A;  3NGI A;  4DFK A;  4KHS A;  1TV6 A;  4LH5 A;  1LWE A;  3V9U A;  1A5W A;  1RNH A;  4DQQ A;  4W5T A;  1T7P A;  1SUQ A;  4FJG A;  3ZSZ A;  3V9W A;  4FZY A;  1RT4 A;  2VG6 A;  3ZSX A;  1NOZ A;  1GOB A;  4KTW A;  3QNO A;  3S3O A;  3ZSW A;  4I2P A;  4ELU A;  3KKR A;  4KAZ A;  2I5J A;  4ZHR A;  3HJF A;  1EET A;  4CGD A;  4PUO A;  1NK6 A;  1X9M A;  4NCB A;  1RBU A;  3O3F A;  3RR8 A;  3AA3 A;  4ELV A;  1JLB A;  4CEB A;  4ZTF A;  4E3S A;  4CEE A;  4HTU A;  2XY6 A;  4BDZ A;  1Q9X A;  2BGG A;  3QEI A;  1CZ9 A;  3NAE A;  4J2E A;  2QKB A;  4FJ5 A;  1VSD A;  2GV9 A;  4JRP A;  1REV A;  5HP1 A;  4FK0 A;  4FJX A;  3QIN A;  3TAB A;  2P5G A;  1N6Q A;  1KFD A;  2Z1J A;  4CHN A;  4FM2 A;  1FKO A;  3ZSQ A;  4I7F A;  1TKT A;  1EXQ A;  1IH7 A;  4RW8 A;  3AVF A;  1IG9 A;  3KK1 A;  3HP9 A;  4CHO A;  1C0T A;  4DSE A;  1QSY A;  3SUN A;  3DI6 A;  4H4O A;  4OKK A;  3TAR A;  3VQQ A;  1RBV A;  2X78 A;  1IKV A;  3KTQ A;  4B9M A;  4KRF A;  1DLO A;  3ZSR A;  2OPR A;  4EP5 A;  1T8E A;  4F8R A;  2HHQ A;  3V9Z A;  3HK2 A;  2QXF A;  1VSM A;  4PY5 A;  3QO9 A;  4Z0U A;  4E89 A;  4DMN A;  1FXX A;  4OGE A;  1BHL A;  4B8C A;  4E7J A;  4ICL A;  3C95 A;  4FYD A;  3IS9 A;  3SV3 A;  3QER A;  4OPJ A;  3NF6 A;  1NK9 A;  3LWM A;  2YNF A;  1CLQ A;  3RTV A;  4IKF A;  1L3U A;  4DSJ A;  2HHU A;  4CJW A;  2KW4 A;  3F9K A;  3OYF A;  4O0J A;  4DFJ A;  4CK1 A;  2FC0 A;  4KTZ A;  3KLH A;  1RDB A;  3PX4 A;  4B9U A;  4FJJ A;  1RT6 A;  2ZD1 A;  2YHB A;  4DQS A;  3LAK A;  3HT3 A;  2FBT A;  1WSF A;  1LAW A;  4O4G A;  5HRS A;  3M8P A;  3QNN A;  4C8L A;  3AVN A;  3KLF A;  3I0R A;  3ZT1 A;  4ZTJ A;  1BIZ A;  4CGJ A;  4IG3 A;  5FDL A;  5HRR A;  4OPK A;  3QES A;  4FK2 A;  4CJP A;  3KK2 A;  1S9E A;  1TKX A;  1NKC A;  3OY9 A;  3V1Q A;  1TK0 A;  3LAL A;  3A2F A;  5FRO A;  4DTS A;  1L3T A;  4CF9 A;  4KHN A;  4RW9 A;  4CJ5 A;  3IAY A;  4AHS A;  3K5L A;  5KGX A;  1RT7 A;  2RPI A;  2BAN A;  3V6D A;  4M3T A;  3EY1 A;  1S6Q A;  4CED A;  1UA1 A;  4DF4 A;  1JLF A;  2A1R A;  1FKP A;  1C1C A;  1NK0 A;  5SZT A;  1WSJ A;  1S9G A;  1IKY A;  4Z4C A;  4DG1 A;  4AIL C;  4B9N A;  4NYF A;  4CJL A;  2IC3 A;  5FRN A;  3DRS A;  4ID1 A;  4DFM A;  1WSE A;  3OYN A;  3NF9 A;  4AH9 A;  1GOA A;  4I9L A;  3NF8 A;  4JRQ A;  2KZZ A;  3LZI A;  2ATQ A;  4DTO A;  2X74 A;  3VQ9 A;  1B92 A;  2D0A A;  4CGH A;  2EHG A;  1WSG A;  4CEC A;  4CIG A;  3L2R A;  3QEV A;  3B6P A;  3DMJ A;  1RTI A;  2JGU A;  3OYA A;  3RWU A;  4F4K A;  1ZBU A;  3LP1 A;  2DFF A;  3SPZ A;  1QSL A;  3RRG A;  2DFH A;  3DLK A;  1U48 A;  1T05 A;  3RR7 A;  4KHW A;  1YTA A;  3M8R A;  4FLV A;  4PQU A;  2A1S A;  3AA5 X;  3QET A;  3KK3 A;  4CGF A;  1SKS A;  1Q9Y A;  3V9X A;  2HHW A;  4IBN A;  3V9S A;  3TAF A;  2HHV A;  3K5N A;  4HHT A;  1BGX T;  4CJF A;  1RBT A;  3SQ0 A;  1UAX A;  2ZQB A;  3ZT0 A;  1JLQ A;  4C8M A;  4FJI A;  4Y1C A;  3M8Q A;  3MXJ A;  3CFP A;  4DU3 A;  1QTM A;  4C8O A;  3NF7 A;  1WAJ A;  4KKO A;  3OYC A;  1SV5 A;  3PV8 A;  4KPY A;  1BCO A;  4FJ8 A;  4Z4E A;  1QE1 A;  3LPT A;  1HNV A;  2HB5 A;  4M42 A;  4LD0 A;  2YNG A;  3OYJ A;  1JLG A;  4TSX A;  3AO2 A;  3CM6 A;  1T03 A;  4B3O A;  3BDP A;  4CJV A;  3KD1 E;  3ZT2 A;  4Q5V A;  1QQC A;  2QKK A;  1RDA A;  3KLG A;  1HPZ A;  2Q3S A;  4KHQ A;  3JYT A;  2GUI A;  5HRP A;  4IG0 A;  4FLT A;  1KVB A;  1TL3 A;  1BIS A;  1BI4 B;  4Z4H A;  3O3H A;  1ZYQ A;  4DWI A;  4M3X A;  4F3T A;  1S1T A;  4CK3 A;  1Q8I A;  4C8K A;  4Q0B A;  5SWM A;  4CGI A;  3HST B;  3PY8 A;  4HVJ A;  3TWH A;  3HYF A;  1VSK A;  5JS2 A;  4FM1 A;  2G8I A;  3CG7 A;  4CFA A;  2E6M A;  3MEG A;  1QSS A;  4J2A A;  1ITG A;  4CJS A;  4KI6 A;  4I9Q A;  3AVA A;  3HPG A;  4QAG A;  1TKZ A;  1W9H A;  1VSE A;  3NBP A;  3SZ2 A;  3NCI A;  1L3V A;  1B9F A;  3BGR A;  3C6T A;  1KSP A;  3I8D A;  3CM5 A;  2HNY A;  3CFR A;  3TAP A;  4GMJ B;  4M3W A;  4OLB A;  3SJJ A;  4DTN A;  2P5O A;  3L2Q A;  4CJT A;  1RTH A;  4E1N A;  1S6P A;  4O0I A;  1NKE A;  2PZS A;  1HYS A;  1KTQ A;  2XRI A;  1HYZ A;  5HRO A;  4CIF A;  3FFI A;  1KRP A;  3L8B A;  1Z26 A;  3AVJ A;  3DYA A;  4BAC A;  3AVK A;  4CES A;  1U47 A;  1RTJ A;  3AO3 A;  3AVL A;  4F2S A;  3RMA A;  4B9S A;  1FK9 A;  3U3G A;  1HQE A;  1N5Y A;  3ZSY A;  4OKJ A;  3AA4 A;  5C25 A;  4CF2 A;  4CHQ A;  2RF2 A;  1S1X A;  3L2W A;  3SV4 A;  4PWD A;  2XHB A;  4O55 A;  3M8S A;  1JXE A;  3T1A A;  2R7Y A;  3F73 A;  4BE1 A;  4YFU A;  4DTX A;  2BDP A;  4OLA A;  3MEE A;  4K8X A;  3DM2 A;  3AVM A;  1J9A A;  3SCX A;  3SI6 A;  4N76 A;  4FW1 A;  1VRT A;  3V1O A;  1NKB A;  2AJQ A;  1U04 A;  1EKE A;  1ASU A;  2VWK A;  3SNN A;  4EZ9 A;  1BL3 A;  2QK9 A;  5KRT A;  3L3U A;  3OYM A;  1JLA A;  4CJQ A;  3VQ6 A;  5I3U A;  3AA2 A;  2YKN A;  3RRH A;  1NJZ A;  3T19 A;  1W0H A;  3AVI A;  1BQN A;  3HM9 A;  3QEW A;  4DSK A;  1XC9 A;  4M3Y A;  3TAG A;  2OPP A;  4OJR A;  4FJ7 A;  5DMR A;  1KFS A;  2FBY A;  4W5O A;  2RKI A;  2FBX A;  3K5O A;  2HMI A;  2PY5 A;  3HO1 A;  2G8K A;  3PX6 A;  1IKX A;  3HVR A;  1RT1 A;  4CEZ A;  3WNG A;  3SQ1 A;  3K58 A;  1J53 A;  3LP3 A;  4BDP A;  2B6A A;  2XO7 A;  2VWJ A;  4F3O A;  5C24 A;  5CY4 A;  3HVT A;  3DLR A;  3ZT3 A;  1QHT A;  4H4M A;  3OYE A;  3VN5 A;  1C1B A;  3OJS A;  1NK8 A;  3V4I A;  1RDC A;  3OVN A;  3DOL A;  4KO0 A;  3PO5 A;  4M41 A;  5J2Q A;  3UIQ A;  3WNF A;  3D45 A;  4AHC A;  5KRS A;  4KI4 A;  2O4G A;  2WON A;  4O44 A;  1SL2 A;  2O4I A; 
#chains in the Genus database with same CATH topology
 3ULD A;  4BR9 A;  5MLC Q;  4CER A;  2P1J A;  1D5A A;  4K8Z A;  4EAH D;  4M3U A;  3EE9 A;  4JKF A;  3ZT4 A;  3O5B A;  4CF1 A;  4LFC K;  3HL8 A;  4W5R A;  3JAM O;  3KIO A;  3DLH A;  4BQZ A;  3NE6 A;  1E3M A;  3BF3 A;  3KWI A;  4DSF A;  1N33 K;  1JCE A;  2G8F A;  4NLB A;  4JI2 K;  1HLU A;  3DOK A;  1NGA A;  3GOI A;  1W2B M;  1XUP O;  2P9L B;  3CC7 N;  2WTU A;  4A5B A;  3SUO A;  3VQE A;  3DJC A;  3SBG A;  1DTQ A;  4FM0 A;  3WQU A;  1WLJ A;  3LPU A;  3ALY A;  2OPS A;  1TAQ A;  1TK5 A;  3R3L A;  4LF5 K;  4I6M A;  4H0Y B;  1BQM A;  1TAU A;  2QTD A;  3S3M A;  3P38 A;  4QOZ B;  1NBW A;  3ATV A;  2GTD A;  1S3X A;  4IDK A;  4FZX C;  4HWI A;  5HOO A;  1IKW A;  1R0A A;  3QIP A;  3HK2 A;  2ZJR L;  2YHA A;  5KI6 A;  3AO4 A;  1NK7 A;  3QFP A;  2V7Z A;  1J5O A;  3I55 N;  4EZ6 A;  3CFO A;  4E7H A;  5AQI A;  2FF3 B;  4XH1 A;  3BUZ B;  3CQY A;  3G10 A;  2ZE2 A;  2VG5 A;  4IDH A;  4OVL A;  2D0C A;  4AHV A;  4H03 B;  2X6S A;  5M1N A;  5JVH L;  3O9U A;  4F2R A;  1VQP N;  1VSH A;  4BRM A;  1XNR K;  2HVI A;  2GBZ A;  3WUH A;  4LSN A;  4Z4I A;  2ITG A;  3AAP A;  5AQY A;  3O9S A;  1UA0 A;  2EX3 A;  4OKE A;  4B9V A;  1HYV A;  2YNH A;  3MMV A;  3JS6 A;  4B8A B;  3D2E A;  4KH6 A;  1OH5 A;  4O5B A;  4FLW A;  4CCH A;  4F9O A;  2P9I A;  3SLC A;  4GVM A;  4E7I A;  1BG3 A;  4ILH A;  4AHT A;  3FZF A;  1C0M A;  5K14 A;  4BR2 A;  3IFR A;  1NJX A;  3CCQ N;  3OJU A;  1NJY A;  3BZK A;  5CYQ A;  1Z25 A;  3FGU A;  1XI1 A;  1JL1 A;  2HHX A;  5JS1 A;  3C7N A;  1CXU A;  4CZJ A;  4KRE A;  4J2B A;  5AQU A;  2E20 A;  3TI0 A;  1GOC A;  5AQF A;  3H08 A;  3U8X A;  3KHY A;  4FW2 A;  2NRH A;  4JK8 A;  1YJN N;  3LP0 A;  1LV5 A;  1KD1 O;  5AJ3 K;  3F2K A;  4E0D A;  1S1W A;  1HKC A;  3KJV A;  1EO1 A;  4JN4 A;  1HNI A;  2D0B A;  3A5M C;  4AM7 A;  4YOV A;  1SKR A;  1RCH A;  2Y1I A;  2VQF K;  4JI5 K;  3U6F A;  1J5E K;  1EX4 A;  4JKB A;  3QBX A;  2HHH K;  4EHT A;  3VQC A;  2HND A;  4B9L A;  3KLI A;  4BVO A;  5E41 A;  2FLO A;  2HHT A;  5BRD A;  4DS5 A;  1NGI A;  3H46 O;  3FZK A;  1D8Y A;  4W5N A;  4IO8 A;  5KGW A;  1VQ7 N;  2O8F A;  4FVM A;  2D4W A;  3A5O C;  1KCF A;  4MDB A;  1KC8 O;  1VRU A;  1ATS A;  2E6L A;  1IBL K;  4JLH A;  3R8E A;  4CK2 A;  2FSK A;  4KB1 A;  5AR0 A;  4CBW A;  1TKD A;  4J2D A;  1I39 A;  3R1X A;  3WT0 A;  3F9M A;  3SMS A;  4RW7 A;  5KQ8 A;  4FLZ A;  1A5V A;  2KLA A;  1RDU A;  4QS9 A;  1BWF O;  4FWS A;  4FZY A;  3QNO A;  3I33 A;  4CD3 A;  1DEJ A;  3FZM A;  4JK7 A;  2QA4 N;  3HOT A;  3CMA N;  4CGD A;  3HJF A;  3SAH A;  2P9S B;  4U7B A;  2IVO A;  1N34 K;  3CCS N;  1IBK K;  2W41 A;  4JKH A;  3CET A;  4JRP A;  4E1J A;  1REV A;  2GEM A;  1KFD A;  3OBY A;  4BRK A;  1FKO A;  3O80 A;  4I7F A;  3WXM B;  1EXQ A;  2O8C A;  4H0V B;  1EQY A;  4BG9 A;  4DR4 K;  4DV3 K;  1LOT B;  3VQQ A;  4BC3 A;  4B9M A;  1DLO A;  2OPR A;  4EP5 A;  2D1K A;  5M1Q A;  1MA9 B;  5EY4 A;  1VSM A;  1HKG A;  4FYD A;  4B8C A;  4BR7 A;  4ICL A;  1JCG A;  3IS9 A;  1NGF A;  4YOR A;  4IKF A;  1L3U A;  4DSJ A;  2HHU A;  3F9K A;  3OYF A;  4DFJ A;  4ELT A;  1GLD G;  2FC0 A;  5C2F A;  2YHB A;  3GG4 A;  3LAK A;  4GY2 B;  3HT3 A;  1WSF A;  1LAW A;  3M5R A;  5A2Q O;  1OKJ A;  4B3T K;  3CCJ N;  5HRR A;  4BRG A;  4PKG A;  3E66 A;  4MLH A;  3OY9 A;  1TK0 A;  3LAL A;  4DV0 K;  4KHN A;  3ENO A;  4RW9 A;  4CBX A;  4AHS A;  3LDL A;  3S41 A;  2VQE K;  3EL2 A;  3R9P A;  4C1N I;  2P9N A;  1C1C A;  1YF5 L;  3MN9 A;  1OH7 A;  2GWJ A;  4Z4C A;  3CJ1 A;  4B9N A;  4CJL A;  4DR6 K;  2IC3 A;  3DRS A;  2YCH A;  4ID1 A;  1C0G A;  3OYN A;  4AH9 A;  4I9L A;  2KZZ A;  3LZI A;  2ZJQ L;  4LF8 K;  3VQ9 A;  1T6D A;  3L2R A;  3QEV A;  1RTI A;  2JGU A;  2CH5 A;  1ZBU A;  3LP1 A;  2DFF A;  4H0O A;  3SPZ A;  1T05 A;  1YTA A;  5EOY A;  2P9U A;  1GLA G;  4WFA L;  2HHV A;  1BGX T;  4CJF A;  2ZQB A;  3BP8 A;  3ZEU B;  4DU3 A;  1QTM A;  1SV5 A;  3PV8 A;  4K42 A;  2GEL A;  1QE1 A;  3CXC M;  4LD0 A;  3J7A P;  4CZG A;  1SAZ A;  4ISE A;  2FXU A;  3T7Z A;  3ID6 A;  1DKG D;  4KHQ A;  2GUI A;  2Q36 A;  2UXB K;  1TL3 A;  3KZB A;  4CK3 A;  4Q0B A;  5SWM A;  4I6M B;  4CGI A;  3HST B;  2DPN A;  3HYF A;  3O9Q A;  4BRN A;  3UKR B;  4CZK A;  4FM1 A;  3A5L C;  3CG7 A;  2E2N A;  1QSS A;  3CCE N;  5FPE A;  1ITG A;  4QAG A;  5GAG P;  1B9F A;  5LMN K;  3I8D A;  3TAP A;  2HNY A;  1QZ6 A;  4OLB A;  4LF6 K;  5F1X A;  4O0I A;  3HZ6 A;  1HYZ A;  3L8B A;  1Z26 A;  3DYA A;  2Q0U A;  4BAC A;  1D4X A;  3AVK A;  3D7E O;  1RTJ A;  4CES A;  3VEW A;  4FOE A;  3CC2 N;  3MCA B;  1HQE A;  3K0S A;  1N5Y A;  2UU9 K;  5C25 A;  4PWD A;  4CHQ A;  3CF5 L;  1S1X A;  3SV4 A;  4IOX A;  4BE1 A;  3MEE A;  3TSU A;  3DM2 A;  3SI6 A;  1VRT A;  1NGG A;  1U04 A;  2AJQ A;  2VWK A;  2NRR A;  5EVZ A;  4JI6 K;  5EX5 A;  4X64 K;  3ID8 A;  4CJQ A;  4PL8 A;  4DV6 K;  3RRH A;  3T19 A;  3GDQ A;  3QEW A;  3H1V X;  1XC9 A;  2OPP A;  4OJR A;  5C0Y A;  4C1N K;  2ASM A;  3D2E B;  2ASP A;  2RKI A;  2FBX A;  3VOV A;  2PY5 A;  3M6G A;  2UUB K;  2O8B B;  2P9I B;  3PX6 A;  3QIC A;  3HVR A;  4FOI A;  1RT1 A;  3SBT A;  2VGM A;  4F3O A;  5C24 A;  1M1K O;  3VN5 A;  1C1B A;  3V4I A;  4M41 A;  3UIQ A;  5AQO A;  4B1X B;  3P39 A;  2KTQ A;  4BRO A;  1SL2 A;  4M3R A;  3HI0 A;  5BPM A;  3DLB A;  3C7N B;  1K6Y A;  3OA9 A;  2ZF5 O;  1TUY A;  5M1P A;  5BN8 A;  3MEC A;  1VSJ A;  4FLX A;  4KH5 A;  4B1V A;  3MN6 A;  4HCB A;  2OZM A;  1BU6 O;  1WB9 A;  5J2M A;  2LSN A;  2IGI A;  1G15 A;  3N4Q A;  3LWL A;  1LAV A;  1KVA A;  1JLE A;  1C0U A;  3C65 A;  1FW6 A;  4CZF A;  4RG8 A;  3OW2 M;  4FWQ A;  3TAE A;  3U3Y A;  4QCL A;  3V81 A;  2ZGY A;  1X9S A;  3ITH A;  1CZB A;  4CEF A;  5CHI A;  2F96 A;  4NO7 A;  3VQB A;  4DUZ K;  2OYQ A;  2W6K A;  4MLE A;  1ASV A;  4IO9 L;  3MX5 A;  4CHZ A;  4JYA K;  2O8F B;  4JI4 K;  3VEV A;  2NUB A;  1BI4 A;  1NMN A;  4DV4 K;  1RIL A;  4ID5 A;  3NH1 A;  3WXL A;  1GLL O;  2ETJ A;  4FZZ A;  4X62 K;  1TL1 A;  5BR9 A;  4KHU A;  3KK7 A;  3SQ4 A;  3O9T A;  4OPA A;  4BY9 C;  1S1V A;  4NCG A;  4HUG A;  1DTT A;  1L5U A;  2KFN A;  3QBW A;  3NMU A;  2Z1G A;  3LL3 A;  3C94 A;  2KZM A;  3K2P A;  4GV6 A;  3DLG A;  1LW0 A;  2CGL A;  4BRI A;  2NZT A;  5AZI A;  5KPZ A;  3LDS A;  1YVU A;  3OYD A;  4FJ9 A;  1YUW A;  3EE8 A;  3OYI A;  4GV3 A;  3AGK A;  5DM6 L;  4AHR A;  3RVC A;  2YV0 X;  2O8C B;  4CJU A;  3TU5 A;  4FPA A;  4YOW A;  5CZ2 A;  4U67 L;  4JI3 K;  1Z6R A;  4J8F A;  4KH4 A;  5GAE P;  5CR4 A;  4N41 A;  2HBJ A;  2G8W A;  5AQL A;  3OS2 A;  3LAM A;  2DFE A;  4NLC A;  4N47 A;  2YHW A;  4JS5 A;  4CF8 A;  5J2P A;  3CME N;  1YJ9 N;  5EU7 A;  5IWA K;  4KV8 A;  1JL2 A;  3H45 C;  1XHZ A;  1RTD A;  3C6A A;  3AVC A;  4CW7 B;  3MN5 A;  4FJL A;  3TTD A;  3EKU A;  4G1Q A;  1HPM A;  1IBM K;  4GNI A;  4CFC A;  1KLN A;  1MU2 A;  4HUF A;  2JWK A;  1VQO N;  4MO4 A;  4FJM A;  1X9W A;  1EP4 A;  2IOC A;  4AF1 A;  4E19 A;  4AM6 A;  1LW2 A;  3EKS A;  4HCC A;  4CF0 A;  2NRW A;  5BN9 A;  3VQD A;  4DFP A;  1RDD A;  2P9N B;  1EWQ A;  1F21 A;  5KTQ A;  5B8H A;  1C1A A;  3L2V A;  1NJI O;  1Y64 A;  2P9K B;  4H0X B;  3IRX A;  4I2Q A;  4FJN A;  3AVG A;  4BRC A;  1NOY A;  4KHY A;  1KAZ A;  3VQ5 A;  2CGK A;  4FWR A;  4DV5 K;  1X1P A;  3ZEU A;  2HHS A;  1UOC A;  3MX2 A;  2WBN A;  2XY8 A;  1VQM N;  4YOU A;  3PIO L;  1TK8 A;  5KPR A;  2P9U B;  2W42 A;  4AHU A;  4EHU A;  4CFB A;  4HUE A;  4DU4 A;  3ENH A;  5F2R A;  5BPN A;  3MXM A;  3CHW A;  1A5X A;  5KPT A;  4FK4 A;  3CIP A;  2BE2 A;  3MED A;  2I7N A;  5EXW A;  2FSN A;  3EN9 A;  3OYH A;  3ZSO A;  1NK5 A;  2PAV A;  3PUF A;  1O13 A;  1XHX A;  4BWM A;  5D3G A;  3UKR A;  3K57 A;  3EYZ A;  4M45 A;  3BY5 A;  4C8N A;  4IWV A;  4DFK A;  4IFE A;  3AY9 A;  2QWR A;  4FJG A;  1RT4 A;  2VG6 A;  1NOZ A;  4KTW A;  3ZSW A;  3KKR A;  3CD6 N;  3U9D A;  4NCB A;  4H5N A;  3RR8 A;  4ELV A;  4CEB A;  4ZTF A;  1Q9X A;  1CZ9 A;  3VEO A;  4JKA A;  4YDU A;  2Z1J A;  4CHN A;  2E8A A;  3L4I A;  1MWK A;  3VF4 A;  1Q82 O;  1IG9 A;  1G99 A;  3KK1 A;  1HNX K;  4DSE A;  1C0T A;  2QWL A;  4OKK A;  3TAR A;  4A5A A;  1QZ5 A;  3Q7C A;  5GAD P;  3V9Z A;  1NGH A;  4E89 A;  4DMN A;  4E7J A;  4B1Y B;  1NK9 A;  1CLQ A;  3QB0 A;  4OPJ A;  2YNF A;  3RTV A;  4CJW A;  4R79 A;  2O8B A;  3LDN A;  4G9Z A;  1YIT N;  3KLH A;  4B9U A;  1RDB A;  4FJJ A;  2ZD1 A;  4DQS A;  3VF6 A;  1U6Z A;  4O4G A;  4NXN K;  5HRS A;  4JK9 A;  3M8P A;  3AVN A;  2QXL A;  4FSV A;  3I0R A;  4ZTJ A;  2HBM A;  4CGJ A;  5FDL A;  4FK2 A;  3MK6 A;  1S9E A;  1TKX A;  1NKC A;  3A2F A;  5FRO A;  4CJ5 A;  3IAY A;  1NM1 A;  2FSJ A;  3ENB A;  3VGL A;  2J4R A;  2RPI A;  2BAN A;  4M3T A;  3EY1 A;  3UKU B;  4BRF A;  2A1R A;  3A0I X;  5DM7 L;  1NK0 A;  1ILY A;  1IKY A;  4AIL C;  4NYF A;  3HOS A;  5C15 A;  5AQP A;  1GOA A;  4JRQ A;  3NF8 A;  1IV0 A;  2ATQ A;  3DAW A;  4DTO A;  4UY8 O;  2D0A A;  4CEC A;  3DMJ A;  4F4K A;  2ASO A;  1ATR A;  4FWP A;  2DFH A;  3RR7 A;  4FLV A;  3L4Q A;  3QET A;  3KK3 A;  1SKS A;  2HHW A;  1W7A A;  3ZT0 A;  1XMO K;  3LDP A;  4Y1C A;  5LJW A;  3MXJ A;  4C8O A;  4Z4E A;  3OYC A;  4LC9 B;  4JKG A;  3LPT A;  4M42 A;  1JLG A;  3J7Y P;  2IVP A;  2UYT A;  5H1S Q;  1T03 A;  4A62 A;  2QI2 A;  1GLC G;  3KD1 E;  4O5F A;  4DV7 K;  2QKK A;  1RDA A;  4DQ8 A;  4M7X A;  4YHH K;  3JYT A;  5HRP A;  4IG0 A;  4FLT A;  1KVB A;  1BIS A;  1BI4 B;  4Z4H A;  5TKY A;  1VSK A;  5JS2 A;  4J2A A;  4A61 A;  2UUA K;  4KI6 A;  4I9Q A;  4M63 C;  3NBP A;  1VSE A;  3SZ2 A;  3C6T A;  5AQH A;  3CFR A;  4DV2 K;  3A8Y A;  4DTN A;  3L2Q A;  4CJT A;  1RTH A;  4CZI A;  1HYS A;  4FWK A;  3FFI A;  1KRP A;  3AVJ A;  2OCE A;  1CZA N;  1U47 A;  3HTV A;  5AZI B;  3SJH A;  1NNE A;  3C0B A;  4JAX A;  2Q97 A;  4CZL A;  2W40 A;  4C23 A;  4CF2 A;  3L2W A;  3MWP A;  5E84 A;  2XHB A;  4O55 A;  1Q81 O;  1JXE A;  2BUP A;  4DCH A;  3F73 A;  4DTX A;  2BDP A;  4K8X A;  3SCX A;  4FW1 A;  3V1O A;  1P8Z A;  3SNN A;  4B1W B;  3BZC A;  3L3U A;  3OYM A;  3CJA A;  3AA2 A;  3P31 A;  4FWL A;  3AVI A;  2A6A A;  3J8A A;  3CJ9 A;  5ADX A;  4M3Y A;  4LF9 K;  3DLL L;  3O1B A;  3I56 N;  5FPN A;  1DGK N;  3FE1 A;  3THY A;  5AQN A;  4LFB K;  1BA1 A;  2HMP A;  3DXK A;  3WNG A;  4CBU A;  1HNZ K;  1J53 A;  2B6A A;  2VWJ A;  3OHR A;  4ISF A;  2ZWH A;  3PO5 A;  5J2Q A;  4AHC A;  4JI0 K;  2O4G A;  3KWG A;  4CHY A;  3BEX A;  1XNQ K;  3AAR A;  3OYL A;  3D6R A;  2P9K A;  1ASW A;  3THW A;  2QEX N;  2FF6 A;  4IFV A;  4FCY A;  1NWK A;  1RBS A;  3TAQ A;  4JS4 A;  5FPM A;  3K59 A;  3FR0 A;  5AZJ A;  3F5T A;  3HRG A;  4IJA A;  1B9D A;  3KKS A;  4DTR A;  1TGO A;  3AVB A;  2PBD A;  3FFK B;  1BUP A;  4Y0W A;  2DY4 A;  1C6V A;  1W97 L;  2VGN A;  2VCP A;  4H0T B;  3QEP A;  5C42 A;  2IS3 A;  3R6M A;  4DF8 A;  3SPY A;  3NH2 A;  5AQQ A;  4EFH A;  1QVG M;  3H6E A;  5AQX A;  4W5Q A;  1WOQ A;  3VQP A;  3JSM A;  2YNI A;  2IVN A;  4RCH A;  3G71 N;  2O8E A;  3BF1 A;  1S22 A;  4CGG A;  3WXI A;  3SAG A;  5DK5 A;  5T7B A;  1HMV A;  1K8A O;  4LFA K;  3KLE A;  1ZXO A;  1KAX A;  5AQZ A;  4DQI A;  1VK0 A;  2G8H A;  4DS4 A;  3TAM A;  1JCF A;  1LWC A;  3RMC A;  3SYZ A;  4FJH A;  3P4I A;  4B9T A;  2B4J A;  4BWJ A;  4FWN A;  2E88 A;  2IDO A;  4RW4 A;  1SL1 A;  4EP4 A;  3CCM N;  4IFY A;  3K5M A;  5HBM A;  3I0S A;  2WUS A;  3H3O B;  3W3D A;  4GKJ K;  5FRM A;  4JKE A;  2B5J A;  3DRR A;  1N32 K;  4B3R K;  3NH0 A;  3TR8 A;  3WNE A;  1JJ2 M;  3E1Y A;  1XWL A;  4JHD A;  2ITM A;  3MAQ A;  1WAF A;  4KTQ A;  2VG7 A;  4CJ3 A;  4YNQ A;  3ZCM A;  4JI7 K;  4CD1 A;  1K9M O;  3L3V A;  4CJK A;  2QWN A;  4CHP A;  2XY5 A;  4LSL A;  5ADX H;  1VQ8 N;  2Y1J A;  4OO1 J;  4GVE A;  3WQT A;  4UQG A;  3J7Z O;  3VQ8 A;  4B08 A;  4FLY A;  3THV A;  3AO5 A;  1YVN A;  3SUP A;  5LMU K;  1Q7Y O;  3T3F A;  1P90 A;  5J1E A;  1RDW X;  1IO2 A;  3HP6 A;  3NVM A;  4JI1 K;  4RWT A;  3O3G A;  1YTU A;  1KLM A;  5AQJ A;  1D9F A;  4MQ3 A;  4BQL A;  1HR0 K;  4L8R B;  3PX0 A;  1YJW N;  4JD2 A;  1M90 O;  2UUC K;  4KPY A;  3UKU A;  2XY7 A;  4E1M A;  5CZ1 A;  3WNH A;  5CE3 A;  2NRT A;  5GAH P;  3MXI A;  3S9H A;  4NYN A;  3QEX A;  4DTU A;  5C12 A;  3M3Z A;  3P5J A;  4CVN E;  1VSI A;  4XEI A;  3W0L A;  3G0Z A;  1WNS A;  4DLE A;  1IG8 A;  3PSF A;  2F9W A;  4IEI A;  4FLU A;  4NCA A;  1JLC A;  1ZBF A;  2OZS A;  3PLA A;  4BC2 A;  2UXC K;  3VQ4 A;  1WSH A;  3HPO A;  3EEQ A;  3NVK A;  5JLH A;  1RT2 A;  2OPQ A;  1HRH A;  3QLH A;  3NHG A;  3EZ5 A;  2FBV A;  3NFA A;  2V51 B;  3LM2 A;  1SKW A;  4MFB A;  1QVF M;  4X66 K;  2ZM6 K;  1NU0 A;  3IKM A;  3ZET A;  4DTP A;  1VQK N;  3TPQ A;  2OTJ N;  4IOC L;  3HXM A;  4A57 A;  1J54 A;  3HSC A;  1VHX A;  3OS1 A;  1HUX A;  1RBR A;  3E9P A;  2QW9 A;  2Z1H A;  4BDY A;  3KD5 E;  4JKG B;  4KHP K;  3VMF B;  5AFU A;  5C10 A;  4M3Z A;  3QFU A;  4DR1 K;  1V4T A;  3N4P A;  4BRL A;  1X3M A;  1NGB A;  4DQR A;  4L3Q A;  1K8K A;  4Y1D A;  3ZLJ A;  4DSI A;  3VQA A;  3WEE A;  1S72 N;  4WFB L;  2CGJ A;  1VSL A;  3VA3 A;  3ASM A;  3NGI A;  1KVC A;  3AAQ A;  4KHS A;  3V9U A;  4LH5 A;  1LWE A;  3T1H K;  4DQQ A;  4W5T A;  1T7P A;  1SUQ A;  3ZSZ A;  3V9W A;  5BRH A;  4ELU A;  3S3O A;  4I2P A;  2F7T A;  2I5J A;  5GIP A;  1EET A;  4PUO A;  3CER A;  1X9M A;  1RBU A;  3AA3 A;  1JLB A;  4H5W A;  4E3S A;  4CEE A;  1HKB A;  4BDZ A;  2F4V K;  3QEI A;  2QKB A;  3IDH A;  3IUC A;  4FJ5 A;  2GV9 A;  1WBD A;  4FK0 A;  3QIN A;  4EIA A;  3TAB A;  4FM2 A;  3ZSQ A;  1FJG K;  1TKT A;  3L6Q A;  1IH7 A;  4RW8 A;  4DR2 K;  3VPZ A;  3HP9 A;  4CHO A;  3SUN A;  3DI6 A;  1RBV A;  2X78 A;  1WBB A;  4KRF A;  3MCP A;  3THX B;  3ZSR A;  2RE2 A;  5KQD A;  2HHQ A;  2QXF A;  3D2F B;  4PY5 A;  3QO9 A;  4Z0U A;  1BHL A;  1KAY A;  3SV3 A;  1OVQ A;  3QER A;  3NF6 A;  3LWM A;  4DR3 K;  3DXM A;  4O0J A;  4CK1 A;  1VAZ A;  3K9J A;  3PX4 A;  1YIJ N;  3TSP A;  3O6W A;  4BC4 A;  4Z94 A;  2E5L K;  3CJB A;  3QNN A;  2V52 B;  1J6Z A;  3THY B;  2HF3 A;  1BIZ A;  4DB3 A;  4IG3 A;  3DXK B;  3O9R A;  4KBO A;  3QES A;  3KK2 A;  3V1Q A;  4YDU C;  4MO5 A;  4DTS A;  4CF9 A;  1L3T A;  3K5L A;  5KGX A;  1EWR A;  1S6Q A;  1ZC6 A;  1UA1 A;  4A59 A;  1FKP A;  2E1Z A;  1S9G A;  3THW B;  4DG1 A;  3VEZ A;  1BA0 A;  4FO0 A;  2F9T A;  3TTF A;  4OPH A;  5AZJ B;  2X74 A;  1B92 A;  5M1F A;  2EHG A;  1WSG A;  1SS6 A;  5LL6 Z;  2E2O A;  3RWU A;  4IOA L;  1QSL A;  3TSQ A;  1U48 A;  1NGE A;  4KHW A;  3QDK A;  4PQU A;  3AA5 X;  4CGF A;  4NXM K;  3MN7 A;  3V9X A;  4IBN A;  2YI1 A;  1C0F A;  3K5N A;  4DUY K;  4HHT A;  4JKD A;  5AFU H;  1RBT A;  4WFN L;  1UAX A;  3SQ0 A;  1BOT O;  2VYP A;  2PFU A;  4C8M A;  3U9Z A;  4FJI A;  2O8E B;  3M8Q A;  3NF7 A;  1WAJ A;  4FJ8 A;  1TYQ A;  1BCO A;  1HNV A;  3CCU N;  2YNG A;  3VTH A;  4B9Q A;  3AO2 A;  3CM6 A;  4DV1 K;  4B3O A;  3ZT2 A;  4Q5V A;  1QQC A;  3KLG A;  1HPZ A;  2GX9 A;  3VET A;  2WC9 A;  4B3S K;  3Q7B A;  1ZYQ A;  3VEX A;  4F3T A;  3IMX A;  4C8K A;  1Q8I A;  2Q31 A;  3TWH A;  2G8I A;  3WXK A;  5JMV A;  1BDG A;  3AVA A;  1TKZ A;  1L3V A;  1KSP A;  1X9J A;  4DR7 K;  3SK3 A;  4M3W A;  3G25 A;  2QWP A;  2PZS A;  1KTQ A;  4IJN A;  3T69 A;  2GUP A;  4K41 A;  3AO3 A;  3AVL A;  4F2S A;  4B9S A;  1QQO A;  3ATU A;  3U3G A;  3WXJ A;  3ZSY A;  1OH6 A;  3AA4 A;  5LY3 A;  2RF2 A;  4JHD B;  3M8S A;  3T1A A;  4CI6 A;  3CI5 A;  1J9A A;  3M1F A;  4N76 A;  1NKB A;  4EZ9 A;  2QK9 A;  1HX1 A;  5AQR A;  4O8K A;  1JLA A;  3VQ6 A;  5I3U A;  2WFB A;  1T3V A;  2QM1 A;  1RFQ A;  2Q2R A;  3HM9 A;  4BGA A;  3GE1 A;  4QS8 A;  3CJ7 A;  4K0K K;  3TAG A;  5I9E B;  4BC5 A;  4FJ7 A;  5DMR A;  1KFS A;  4W5O A;  3CCR N;  1ESV A;  3HO1 A;  2JWL A;  4CEZ A;  3SQ1 A;  1MWM A;  3FZH A;  2QWQ A;  3OBW A;  1GLB G;  3HVT A;  4H4M A;  5C2D A;  1NK8 A;  1E4F T;  4JD2 B;  1GLJ O;  3OVN A;  4YOY A;  3H1Q A;  5KRS A;  2HOE A;  2WON A;  4O44 A;  2O4I A;  4BVP A;  3KVG A;  4Z4G A;  1GLE G;  3RMD A;  4BGB A;  1D9D A;  4DTJ A;  4BRD A;  1MDU B;  4ILG B;  4K43 A;  1QS4 A;  4CZE A;  1NK4 A;  2P51 A;  3LAN A;  5BPL A;  3RSE A;  1BO5 O;  4R5P A;  4PHT X;  4V19 S;  4DTM A;  3C6U A;  3DRP A;  2HVH A;  5HL7 L;  4RTF D;  3QML A;  4HTL A;  4KB0 A;  4N56 A;  1ATN A;  2G8V A;  1SQK A;  4GV9 A;  2WOM A;  3CQ8 A;  3UB5 A;  3ZET B;  4LH4 A;  4RW6 A;  3TTC A;  1SL0 A;  5TKW A;  3EO3 A;  3ULE B;  2G8U A;  3AO1 A;  2JLE A;  2NRX A;  5FPD A;  1H1V A;  1S1U A;  3V1R A;  2YJE A;  4DKW A;  3D0P A;  3VGK A;  4BR5 A;  5M1O A;  4PA1 A;  5E26 A;  4CEA A;  4O8U A;  4PKH A;  1VQ5 N;  2UXD K;  2KFZ A;  2RHK A;  4LY7 A;  5AQW A;  1NJW A;  1K8K B;  1L3S A;  4DU1 A;  1XC3 A;  4CJE A;  3WEE B;  3AV9 A;  4JEP A;  5J2N A;  2RN2 A;  2D0P A;  2OA8 A;  2O8D A;  2HNZ A;  3SUQ A;  4AQY K;  1LCU A;  4GW6 A;  4MDA A;  3CCV N;  5JVG L;  4M7Y A;  4WE1 A;  4OGC A;  5CYM A;  2DTU A;  3O4W A;  1ZBH A;  2E4L A;  4E7K A;  2YHY A;  3B6O A;  1WSI A;  3OYB A;  4WYB A;  4CJ4 A;  2PYL A;  4CJR A;  4WQ5 C;  2P9P A;  3FZL A;  4CFD A;  2H3G X;  1ZBL A;  3AVH A;  3H3N O;  3NDK A;  3MWT A;  3OYK A;  3SMP A;  2F8S A;  3VGM A;  2F8T A;  1WUA A;  1HNW K;  1OVY A;  2IAJ A;  3QIO A;  4YOX A;  3THX A;  3TAN A;  3D2F A;  5I42 A;  1U2V A;  1XQS C;  4DLG A;  1U49 A;  2A41 A;  1I3A A;  3CQX A;  1U45 A;  3PIP L;  2YKM A;  4BE2 A;  4E7L A;  1CXQ A;  1T6C A;  4CIE A;  3RMB A;  1KXP A;  5AQK A;  2HBK A;  5ELZ A;  1LWF A;  3ZSV A;  4BRE A;  4BE0 A;  3DXM B;  2KHO A;  4IZ9 A;  4FL9 A;  3EZW A;  1RT3 A;  3O4Q A;  2PYJ A;  3VA0 A;  1VSF A;  2GWK A;  4Z4F A;  3JXU A;  3LDQ A;  4CEO A;  4CE9 A;  2A3Z A;  4B3M K;  3O8M A;  4FWO A;  5BRE A;  4BRP A;  1BCM A;  4DQP A;  1YAG A;  3FLC O;  1QQM A;  3P83 D;  4BR4 A;  1UWB A;  2NNW A;  1WN7 A;  4H8K A;  3LP2 A;  3SQ2 A;  1YT3 A;  3ZX3 A;  1RT5 A;  3VEY A;  2D0O A;  1BIU A;  3ZX2 A;  3CYM A;  2ZGZ A;  5HRN A;  2AP1 A;  4H5R A;  1TUU A;  3E01 A;  4CEQ A;  1Y97 A;  2HW3 A;  1JXB A;  4BG8 A;  3GL1 A;  2E1Y A;  3CCL N;  4WQ4 C;  1JKH A;  2OTL N;  4H0P A;  3O4N A;  3NGZ A;  2X6N A;  2OAN A;  1K73 O;  5JLF A;  5JIC A;  4WQ5 A;  1RGI A;  3DWL A;  3OS0 A;  4QS7 A;  3E9O A;  4ILJ A;  2HF4 A;  4FXD A;  1ZBI A;  4JI8 K;  3PO4 A;  3E9L A;  3VES A;  3DLE A;  3P1G A;  1SZ2 A;  2HST A;  3IG1 A;  1VQ6 N;  2P9L A;  4XH4 A;  4FJK A;  5HLF A;  1IJJ A;  3S3N A;  4KFB A;  2Z1I A;  2BTF A;  4LF7 K;  3LM9 A;  1QQN A;  3L2U A;  1TYQ B;  2D5R A;  3OTO K;  1HQU A;  3OYG A;  3ISN C;  1V4S A;  2KQ2 A;  4XIU A;  3VQ7 A;  1S5J A;  1HJR A;  2EWS A;  1O1W A;  3LZJ A;  3K9K A;  1TVR A;  3NGY A;  4N5S A;  5GIO A;  4DR5 K;  4DSL A;  3G4S N;  4BRA A;  1U4B A;  4GKK K;  5AQT A;  3HPH A;  4WCE L;  1TV6 A;  1A5W A;  1RNH A;  4H5T A;  3ZSX A;  1GOB A;  2KKZ A;  3CPW M;  4KAZ A;  2CH6 A;  4ZHR A;  2E2Q A;  2A42 A;  1NK6 A;  2VWB A;  3O3F A;  1Z05 A;  4HTU A;  2XY6 A;  4OX9 K;  2BGG A;  2AA4 A;  2A40 A;  4PL7 A;  3NAE A;  1VQ9 N;  4J2E A;  2BH1 A;  2YJF A;  3J80 O;  1VSD A;  3HBT A;  5HP1 A;  4FJX A;  2P5G A;  1T44 A;  1N6Q A;  2Q1N A;  1N36 K;  3ZX0 A;  4FVU A;  3U4L A;  3AVF A;  5AQV A;  1QSY A;  4H4O A;  5AQM A;  4CJ7 A;  1IKV A;  3KTQ A;  3HM8 A;  4WQ4 A;  1I94 K;  1T8E A;  3O08 A;  4F8R A;  1N8R O;  3I8B A;  1FXX A;  4OGE A;  3C95 A;  3VER A;  1NG9 A;  4FPB A;  2KW4 A;  4YOT A;  4BRQ A;  3VEN A;  4KTZ A;  1RT6 A;  2NRV A;  2FBT A;  2QWM A;  3O1W A;  4C8L A;  3KLF A;  1OH8 A;  3ZT1 A;  4B1Z A;  4JKC A;  3CC4 N;  5M1K A;  4OPK A;  4FWM A;  4CJP A;  2I7P A;  5AQS A;  1RT7 A;  3V6D A;  4CED A;  2HBL A;  4DF4 A;  1JLF A;  3A5N C;  5SZT A;  1KQS M;  1YHQ N;  1WSJ A;  4CZH A;  3T1Y K;  1YI2 N;  1R59 O;  4DFM A;  4WF9 L;  5FRN A;  4JNE A;  1WSE A;  3NF9 A;  3RSE B;  1VQ4 N;  4XH5 A;  1XMQ K;  5F0X A;  4CGH A;  4CIG A;  5AQG A;  3B6P A;  3OYA A;  3ULE A;  3RRG A;  3DLK A;  3ZYY X;  1Q86 O;  3M8R A;  2A1S A;  1Q9Y A;  3V9S A;  3TAF A;  3UE5 A;  1JLQ A;  1X3N A;  3CFP A;  2ZJP L;  4KKO A;  3CPE A;  1NLV A;  2HB5 A;  4BR0 A;  3OYJ A;  2NRZ A;  4TSX A;  3MDQ A;  3BDP A;  4CJV A;  3PSI A;  4IXC A;  2Q3S A;  1Q18 A;  4DHY A;  2Q0R A;  1VQL N;  3O3H A;  4DWI A;  4M3X A;  1S1T A;  5BRF A;  3LDO A;  3PY8 A;  1NGJ A;  4HVJ A;  1GLF O;  2YHX A;  1HJO A;  1NMD A;  4CFA A;  2E6M A;  3MEG A;  4LF4 K;  2YX6 A;  3SAF A;  4CJS A;  2O8D B;  5BR8 K;  4JV5 K;  3HPG A;  5FLX O;  1W9H A;  3GBT A;  3NCI A;  3BGR A;  4ISG A;  3CM5 A;  1NGD A;  4GMJ B;  2P9S A;  3SJJ A;  1VQN N;  2E2P A;  4BRH A;  2P5O A;  4E1N A;  1NKE A;  1S6P A;  2XRI A;  5HRO A;  4CIF A;  2P9P B;  3J81 O;  1YXQ A;  4PKI A;  3RMA A;  1FK9 A;  2A5X A;  4OKJ A;  5GIN A;  3C6H A;  2W6L A;  4YY3 K;  2R7Y A;  3VTI A;  2V7Y A;  4YFU A;  4OLA A;  3AVM A;  1U2V B;  1EKE A;  1ASU A;  1BL3 A;  3VF2 A;  5KRT A;  3B8A X;  3G6E N;  1NGC A;  2YKN A;  1NJZ A;  4NB4 A;  1W0H A;  1BQN A;  1E4G T;  4DSK A;  4CZM A;  4A2A A;  2FBY A;  2NLX A;  5LJV A;  3K5O A;  2HMI A;  1ZBS A;  5IT9 O;  3L0Q A;  2G8K A;  1IKX A;  4B1U B;  3K58 A;  3LP3 A;  4BDP A;  2XO7 A;  5CY4 A;  3DLR A;  3ZT3 A;  4A2B A;  1QHT A;  2QWO A;  3AGR A;  3CJC A;  4K25 A;  4X65 K;  3OYE A;  4H5V A;  3OJS A;  1QHA A;  1DT9 A;  1RDC A;  3DOL A;  2IIR A;  4KO0 A;  4IEE A;  3WNF A;  3D45 A;  4KI4 A; 
#chains in the Genus database with same CATH homology
 4CHY A;  3ULD A;  4M3R A;  3DLB A;  4Z4G A;  3OYL A;  3RMD A;  1K6Y A;  4CER A;  1ASW A;  1D9D A;  4IFV A;  2P1J A;  4FCY A;  1D5A A;  4DTJ A;  4K8Z A;  1QS4 A;  1RBS A;  1VSJ A;  3MEC A;  4FLX A;  3TAQ A;  2P51 A;  3LAN A;  3ZT4 A;  4JS4 A;  4M3U A;  4HCB A;  3K59 A;  2OZM A;  2KTQ A;  4R5P A;  4CF1 A;  1B9D A;  3HL8 A;  3KKS A;  2LSN A;  4W5R A;  1TGO A;  2IGI A;  3AVB A;  1G15 A;  3KIO A;  4DTR A;  3DLH A;  3LWL A;  1LAV A;  4DTM A;  1KVA A;  3NE6 A;  2DY4 A;  3C6U A;  1C6V A;  1JLE A;  3DRP A;  1C0U A;  2HVH A;  3QEP A;  5C42 A;  2IS3 A;  4KB0 A;  4DF8 A;  3SPY A;  3NH2 A;  4N56 A;  4DSF A;  4RG8 A;  2G8V A;  2WOM A;  3CQ8 A;  2G8F A;  4W5Q A;  3VQP A;  3DOK A;  4LH4 A;  3JSM A;  2YNI A;  3TAE A;  4RW6 A;  1SL0 A;  3U3Y A;  4QCL A;  3V81 A;  2G8U A;  3AO1 A;  2JLE A;  3ITH A;  1X9S A;  1CZB A;  4CGG A;  4CEF A;  3SUO A;  2F96 A;  3VQB A;  2OYQ A;  1S1U A;  3V1R A;  3VQE A;  3D0P A;  1ASV A;  1DTQ A;  5DK5 A;  5T7B A;  1HMV A;  4FM0 A;  4CHZ A;  1WLJ A;  3LPU A;  3KLE A;  4DQI A;  1VK0 A;  4PA1 A;  3ALY A;  4CEA A;  2OPS A;  2NUB A;  1BI4 A;  4DS4 A;  2G8H A;  1TAQ A;  3TAM A;  1LWC A;  2KFZ A;  1TK5 A;  3RMC A;  4LY7 A;  1NJW A;  3SYZ A;  1L3S A;  1RIL A;  1BQM A;  4ID5 A;  3NH1 A;  4FJH A;  1TAU A;  2ETJ A;  4DU1 A;  4B9T A;  3S3M A;  2B4J A;  4CJE A;  4FZZ A;  3AV9 A;  1TL1 A;  5J2N A;  4QOZ B;  2RN2 A;  2OA8 A;  4KHU A;  2HNZ A;  3SUQ A;  4BWJ A;  4GW6 A;  4WE1 A;  3SQ4 A;  2IDO A;  4IDK A;  4RW4 A;  1SL1 A;  4OGC A;  5CYM A;  4FZX C;  4EP4 A;  1R0A A;  1IKW A;  4IFY A;  1S1V A;  3QIP A;  4NCG A;  1DTT A;  2E4L A;  3K5M A;  4HUG A;  4E7K A;  3B6O A;  1L5U A;  1ZBH A;  1WSI A;  5HBM A;  2YHA A;  5KI6 A;  3OYB A;  2Z1G A;  3I0S A;  1NK4 A;  3AO4 A;  1NK7 A;  4CJ4 A;  2PYL A;  1J5O A;  4CJR A;  2DTU A;  4EZ6 A;  3C94 A;  4CFD A;  2KZM A;  3K2P A;  1ZBL A;  3CFO A;  3AVH A;  4E7H A;  3DLG A;  1LW0 A;  5FRM A;  3NDK A;  3OYK A;  2B5J A;  3LDS A;  1YVU A;  2F8S A;  3DRR A;  2F8T A;  3G10 A;  3NH0 A;  3OYD A;  2ZE2 A;  3TR8 A;  4FJ9 A;  2VG5 A;  2IAJ A;  3WNE A;  4OVL A;  1XWL A;  3QIO A;  2D0C A;  4AHV A;  3OYI A;  2X6S A;  3MAQ A;  1WAF A;  3TAN A;  4AHR A;  2VG7 A;  4CJ3 A;  4YNQ A;  4KTQ A;  4F2R A;  3ZCM A;  2YV0 X;  5I42 A;  4CJU A;  4DLG A;  1U49 A;  5CZ2 A;  3L3V A;  4CJK A;  4CHP A;  1I3A A;  1VSH A;  2XY5 A;  4LSL A;  1U45 A;  2HVI A;  2YKM A;  4BE2 A;  2GBZ A;  4E7L A;  1CXQ A;  4CIE A;  2KFN A;  4N41 A;  2Y1J A;  2G8W A;  4LSN A;  3RMB A;  4Z4I A;  3OS2 A;  3LAM A;  4UQG A;  2DFE A;  4N47 A;  4JS5 A;  3VQ8 A;  4B08 A;  1LWF A;  4CF8 A;  2ITG A;  4FLY A;  3ZSV A;  5J2P A;  5EU7 A;  3THV A;  3AO5 A;  1UA0 A;  4BE0 A;  2EX3 A;  4OKE A;  4B9V A;  4KV8 A;  3SUP A;  1HYV A;  1JL2 A;  2YNH A;  4B8A B;  3T3F A;  5J1E A;  1XHZ A;  1IO2 A;  4O5B A;  3O4Q A;  1RT3 A;  4FLW A;  1RTD A;  3HP6 A;  1VSF A;  3VA0 A;  3AVC A;  2PYJ A;  4CCH A;  4Z4F A;  3O3G A;  1YTU A;  1KLM A;  4GVM A;  4FJL A;  4E7I A;  1D9F A;  4CEO A;  4AHT A;  4MQ3 A;  4G1Q A;  1C0M A;  5K14 A;  4CE9 A;  4ELT A;  4L8R B;  1NJX A;  3PX0 A;  4CFC A;  1KLN A;  1BCM A;  1MU2 A;  2XY7 A;  4DQP A;  4E1M A;  4HUF A;  5CZ1 A;  3WNH A;  3OJU A;  3MXI A;  3S9H A;  4NYN A;  3QEX A;  3P83 D;  4DTU A;  4FJM A;  1NJY A;  1X9W A;  3P5J A;  1EP4 A;  5CYQ A;  1VSI A;  1Z25 A;  1UWB A;  2IOC A;  1XI1 A;  1JL1 A;  2HHX A;  5JS1 A;  1CXU A;  3G0Z A;  1WN7 A;  1WNS A;  3LP2 A;  4H8K A;  4E19 A;  4DLE A;  3SQ2 A;  1YT3 A;  4J2B A;  4KRE A;  1LW2 A;  4HCC A;  4CF0 A;  3VQD A;  1GOC A;  4DFP A;  1RDD A;  1RT5 A;  3H08 A;  1F21 A;  3TI0 A;  4FW2 A;  1BIU A;  4FLU A;  5KTQ A;  4NCA A;  1JLC A;  3LP0 A;  1LV5 A;  3CYM A;  4E0D A;  1ZBF A;  2OZS A;  1C1A A;  5HRN A;  3L2V A;  1S1W A;  3VQ4 A;  3E01 A;  4CEQ A;  1Y97 A;  2HW3 A;  1JXB A;  1WSH A;  3HPO A;  3KJV A;  1HNI A;  1RT2 A;  2D0B A;  1HRH A;  2OPQ A;  3QLH A;  3NHG A;  1JKH A;  3IRX A;  4I2Q A;  3EZ5 A;  3O4N A;  1SKR A;  2FBV A;  2X6N A;  3NFA A;  3NGZ A;  4FJN A;  1RCH A;  3AVG A;  1SKW A;  1NOY A;  2Y1I A;  4KHY A;  3VQ5 A;  4MFB A;  3OS0 A;  1X1P A;  3U6F A;  1EX4 A;  2HHS A;  4FXD A;  4DTP A;  1ZBI A;  1UOC A;  3PO4 A;  3VQC A;  2XY8 A;  3DLE A;  3P1G A;  3HXM A;  2HND A;  3IG1 A;  1TK8 A;  3KLI A;  2W42 A;  4B9L A;  4AHU A;  1J54 A;  5E41 A;  2HHT A;  4CFB A;  4HUE A;  4DU4 A;  3OS1 A;  5HLF A;  4FJK A;  3S3N A;  4KFB A;  4DS5 A;  2Z1I A;  1RBR A;  3MXM A;  1A5X A;  2Z1H A;  4BDY A;  1D8Y A;  4W5N A;  3KD5 E;  3L2U A;  4FK4 A;  2D5R A;  1HQU A;  5KGW A;  3OYG A;  2BE2 A;  4FVM A;  4M3Z A;  3MED A;  3ISN C;  2KQ2 A;  1KCF A;  3OYH A;  4XIU A;  5J2M A;  1VRU A;  3VQ7 A;  3ZSO A;  1S5J A;  1HJR A;  2E6L A;  1O1W A;  3PUF A;  4JLH A;  4CK2 A;  3LZJ A;  1NK5 A;  1XHX A;  4BWM A;  4DQR A;  5D3G A;  4KB1 A;  1TVR A;  3NGY A;  4Y1D A;  4N5S A;  1TKD A;  3K57 A;  4J2D A;  4DSL A;  1I39 A;  4DSI A;  3VQA A;  1U4B A;  3EYZ A;  4M45 A;  1VSL A;  3VA3 A;  3HPH A;  4C8N A;  3ASM A;  4RW7 A;  4FLZ A;  1A5V A;  1KVC A;  3NGI A;  4DFK A;  4KHS A;  1TV6 A;  4LH5 A;  1LWE A;  3V9U A;  1A5W A;  1RNH A;  4DQQ A;  4W5T A;  1T7P A;  1SUQ A;  4FJG A;  3ZSZ A;  3V9W A;  4FZY A;  1RT4 A;  2VG6 A;  3ZSX A;  1NOZ A;  1GOB A;  4KTW A;  3QNO A;  3S3O A;  3ZSW A;  4I2P A;  4ELU A;  3KKR A;  4KAZ A;  2I5J A;  4ZHR A;  3HJF A;  1EET A;  4CGD A;  4PUO A;  1NK6 A;  1X9M A;  4NCB A;  1RBU A;  3O3F A;  3RR8 A;  3AA3 A;  4ELV A;  1JLB A;  4CEB A;  4ZTF A;  4E3S A;  4CEE A;  4HTU A;  2XY6 A;  4BDZ A;  1Q9X A;  2BGG A;  3QEI A;  1CZ9 A;  3NAE A;  4J2E A;  2QKB A;  4FJ5 A;  1VSD A;  2GV9 A;  4JRP A;  1REV A;  5HP1 A;  4FK0 A;  4FJX A;  3QIN A;  3TAB A;  2P5G A;  1N6Q A;  1KFD A;  2Z1J A;  4CHN A;  4FM2 A;  1FKO A;  3ZSQ A;  4I7F A;  1TKT A;  1EXQ A;  1IH7 A;  4RW8 A;  3AVF A;  1IG9 A;  3KK1 A;  3HP9 A;  4CHO A;  1C0T A;  4DSE A;  1QSY A;  3SUN A;  3DI6 A;  4H4O A;  4OKK A;  3TAR A;  3VQQ A;  1RBV A;  2X78 A;  1IKV A;  3KTQ A;  4B9M A;  4KRF A;  1DLO A;  3ZSR A;  2OPR A;  4EP5 A;  1T8E A;  4F8R A;  2HHQ A;  3V9Z A;  3HK2 A;  2QXF A;  1VSM A;  4PY5 A;  3QO9 A;  4Z0U A;  4E89 A;  4DMN A;  1FXX A;  4OGE A;  1BHL A;  4B8C A;  4E7J A;  4ICL A;  3C95 A;  4FYD A;  3IS9 A;  3SV3 A;  3QER A;  4OPJ A;  3NF6 A;  1NK9 A;  3LWM A;  2YNF A;  1CLQ A;  3RTV A;  4IKF A;  1L3U A;  4DSJ A;  2HHU A;  4CJW A;  2KW4 A;  3F9K A;  3OYF A;  4O0J A;  4DFJ A;  4CK1 A;  2FC0 A;  4KTZ A;  3KLH A;  1RDB A;  3PX4 A;  4B9U A;  4FJJ A;  1RT6 A;  2ZD1 A;  2YHB A;  4DQS A;  3LAK A;  3HT3 A;  2FBT A;  1WSF A;  1LAW A;  4O4G A;  5HRS A;  3M8P A;  3QNN A;  4C8L A;  3AVN A;  3KLF A;  3I0R A;  3ZT1 A;  4ZTJ A;  1BIZ A;  4CGJ A;  4IG3 A;  5FDL A;  5HRR A;  4OPK A;  3QES A;  4FK2 A;  4CJP A;  3KK2 A;  1S9E A;  1TKX A;  1NKC A;  3OY9 A;  3V1Q A;  1TK0 A;  3LAL A;  3A2F A;  5FRO A;  4DTS A;  1L3T A;  4CF9 A;  4KHN A;  4RW9 A;  4CJ5 A;  3IAY A;  4AHS A;  3K5L A;  5KGX A;  1RT7 A;  2RPI A;  2BAN A;  3V6D A;  4M3T A;  3EY1 A;  1S6Q A;  4CED A;  1UA1 A;  4DF4 A;  1JLF A;  2A1R A;  1FKP A;  1C1C A;  1NK0 A;  5SZT A;  1WSJ A;  1S9G A;  1IKY A;  4Z4C A;  4DG1 A;  4AIL C;  4B9N A;  4NYF A;  4CJL A;  2IC3 A;  5FRN A;  3DRS A;  4ID1 A;  4DFM A;  1WSE A;  3OYN A;  3NF9 A;  4AH9 A;  1GOA A;  4I9L A;  3NF8 A;  4JRQ A;  2KZZ A;  3LZI A;  2ATQ A;  4DTO A;  2X74 A;  3VQ9 A;  1B92 A;  2D0A A;  4CGH A;  2EHG A;  1WSG A;  4CEC A;  4CIG A;  3L2R A;  3QEV A;  3B6P A;  3DMJ A;  1RTI A;  2JGU A;  3OYA A;  3RWU A;  4F4K A;  1ZBU A;  3LP1 A;  2DFF A;  3SPZ A;  1QSL A;  3RRG A;  2DFH A;  3DLK A;  1U48 A;  1T05 A;  3RR7 A;  4KHW A;  1YTA A;  3M8R A;  4FLV A;  4PQU A;  2A1S A;  3AA5 X;  3QET A;  3KK3 A;  4CGF A;  1SKS A;  1Q9Y A;  3V9X A;  2HHW A;  4IBN A;  3V9S A;  3TAF A;  2HHV A;  3K5N A;  4HHT A;  1BGX T;  4CJF A;  1RBT A;  3SQ0 A;  1UAX A;  2ZQB A;  3ZT0 A;  1JLQ A;  4C8M A;  4FJI A;  4Y1C A;  3M8Q A;  3MXJ A;  3CFP A;  4DU3 A;  1QTM A;  4C8O A;  3NF7 A;  1WAJ A;  4KKO A;  3OYC A;  1SV5 A;  3PV8 A;  4KPY A;  1BCO A;  4FJ8 A;  4Z4E A;  1QE1 A;  3LPT A;  1HNV A;  2HB5 A;  4M42 A;  4LD0 A;  2YNG A;  3OYJ A;  1JLG A;  4TSX A;  3AO2 A;  3CM6 A;  1T03 A;  4B3O A;  3BDP A;  4CJV A;  3KD1 E;  3ZT2 A;  4Q5V A;  1QQC A;  2QKK A;  1RDA A;  3KLG A;  1HPZ A;  2Q3S A;  4KHQ A;  3JYT A;  2GUI A;  5HRP A;  4IG0 A;  4FLT A;  1KVB A;  1TL3 A;  1BIS A;  1BI4 B;  4Z4H A;  3O3H A;  1ZYQ A;  4DWI A;  4M3X A;  4F3T A;  1S1T A;  4CK3 A;  1Q8I A;  4C8K A;  4Q0B A;  5SWM A;  4CGI A;  3HST B;  3PY8 A;  4HVJ A;  3TWH A;  3HYF A;  1VSK A;  5JS2 A;  4FM1 A;  2G8I A;  3CG7 A;  4CFA A;  2E6M A;  3MEG A;  1QSS A;  4J2A A;  1ITG A;  4CJS A;  4KI6 A;  4I9Q A;  3AVA A;  3HPG A;  4QAG A;  1TKZ A;  1W9H A;  1VSE A;  3NBP A;  3SZ2 A;  3NCI A;  1L3V A;  1B9F A;  3BGR A;  3C6T A;  1KSP A;  3I8D A;  3CM5 A;  2HNY A;  3CFR A;  3TAP A;  4GMJ B;  4M3W A;  4OLB A;  3SJJ A;  4DTN A;  2P5O A;  3L2Q A;  4CJT A;  1RTH A;  4E1N A;  1S6P A;  4O0I A;  1NKE A;  2PZS A;  1HYS A;  1KTQ A;  2XRI A;  1HYZ A;  5HRO A;  4CIF A;  3FFI A;  1KRP A;  3L8B A;  1Z26 A;  3AVJ A;  3DYA A;  4BAC A;  3AVK A;  4CES A;  1U47 A;  1RTJ A;  3AO3 A;  3AVL A;  4F2S A;  3RMA A;  4B9S A;  1FK9 A;  3U3G A;  1HQE A;  1N5Y A;  3ZSY A;  4OKJ A;  3AA4 A;  5C25 A;  4CF2 A;  4CHQ A;  2RF2 A;  1S1X A;  3L2W A;  3SV4 A;  4PWD A;  2XHB A;  4O55 A;  3M8S A;  1JXE A;  3T1A A;  2R7Y A;  3F73 A;  4BE1 A;  4YFU A;  4DTX A;  2BDP A;  4OLA A;  3MEE A;  4K8X A;  3DM2 A;  3AVM A;  1J9A A;  3SCX A;  3SI6 A;  4N76 A;  4FW1 A;  1VRT A;  3V1O A;  1NKB A;  2AJQ A;  1U04 A;  1EKE A;  1ASU A;  2VWK A;  3SNN A;  4EZ9 A;  1BL3 A;  2QK9 A;  5KRT A;  3L3U A;  3OYM A;  1JLA A;  4CJQ A;  3VQ6 A;  5I3U A;  3AA2 A;  2YKN A;  3RRH A;  1NJZ A;  3T19 A;  1W0H A;  3AVI A;  1BQN A;  3HM9 A;  3QEW A;  4DSK A;  1XC9 A;  4M3Y A;  3TAG A;  2OPP A;  4OJR A;  4FJ7 A;  5DMR A;  1KFS A;  2FBY A;  4W5O A;  2RKI A;  2FBX A;  3K5O A;  2HMI A;  2PY5 A;  3HO1 A;  2G8K A;  3PX6 A;  1IKX A;  3HVR A;  1RT1 A;  4CEZ A;  3WNG A;  3SQ1 A;  3K58 A;  1J53 A;  3LP3 A;  4BDP A;  2B6A A;  2XO7 A;  2VWJ A;  4F3O A;  5C24 A;  5CY4 A;  3HVT A;  3DLR A;  3ZT3 A;  1QHT A;  4H4M A;  3OYE A;  3VN5 A;  1C1B A;  3OJS A;  1NK8 A;  3V4I A;  1RDC A;  3OVN A;  3DOL A;  4KO0 A;  3PO5 A;  4M41 A;  5J2Q A;  3UIQ A;  3WNF A;  3D45 A;  4AHC A;  5KRS A;  4KI4 A;  2O4G A;  2WON A;  4O44 A;  1SL2 A;  2O4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...