4X64K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4x64K00
2UUBK 4JI8K 1N34K 3OTOK 4JYAK 2VQEK 1IBMK 4JI3K 1XNRK 4JI2K 4LFAK 5IT9O 1XNQK 2UXCK 2VQFK 4DR7K 4DV4K 4CW7B 5A2QO 2HHHK 4KHPK 4X65K 3J7YP 1J5EK 3T1YK 4DR4K 2UUAK 4LF7K 5LMUK 4B3TK 5BR8K 1IBKK 4GKKK 4DR6K 4CVNE 4B3SK 3T1HK 2UXBK 4JV5K 1N36K 4LF5K 4DV6K 4V19S 1HNZK 4JI6K 5AJ3K 4X64K 4JI5K 4YHHK 1N33K 4DV1K 4LF9K 2UXDK 1XMOK 5FLXO 4DUYK 4JI0K 1I94K 1HNXK 5LL6Z 4GKJK 4DUZK 2E5LK 4JI7K 1N32K 4DR1K 4DV7K 4LF6K 4LFBK 4X66K 4X62K 2F4VK 2UU9K 1IBLK 4NXNK 5IWAK 4JI1K 3JAMO 5LMNK 4B3MK 4OX9K 4LF4K 1FJGK 2UUCK 4DV2K 4K0KK 4DR2K 4B3RK 4DR3K 1HNWK 4LF8K 4JI4K 3J81O 4YY3K 4DR5K 3J80O 3J7AP 1HR0K 4DV5K 4DV3K 1XMQK 4DV0K 4LFCK 4AQYK 2ZM6K 4NXMK
chains in the Genus database with same CATH superfamily
3K2PA 1X9MA 1JCFA 1SKRA 5HL7L 4DHYA 3CJAA 4CK2A 3VQ5A 1YIJN 3SPYA 1OKJA 2P1JA 3SQ4A 2A40A 2P9PB 3CJCA 3VN5A 4JKBA 2OPPA 1IG8A 1GOBA 2NLXA 3FZFA 1EX4A 1VQKN 4KH6A 4B9TA 1JCGA 4YNQA 2FF3B 5EXWA 3O4NA 5BR8K 3MX2A 3NFAA 2PZSA 3AO5A 4FW2A 1UA1A 4Z4FA 1VRUA 4EFHA 3THYA 2GTDA 4B8CA 4BR5A 4CD3A 3KWGA 3EEQA 3AA5X 4E1NA 3ATVA 4E1MA 4L3QA 4HCBA 3I33A 4M3UA 2OPRA 3DYAA 4Z4CA 1SL2A 3N4PA 3L4QA 3TAMA 4JI6K 4BE0A 1NJIO 5C25A 3SCXA 4M7YA 3QNOA 1CLQA 3SPZA 3RRHA 4JI0K 4A2BA 1VQ8N 4R79A 3LWLA 2WOMA 3NF7A 1KQSM 1S6QA 4H03B 5AZIB 3K59A 1IBLK 3ZX2A 4KHWA 4CECA 1IV0A 1YXQA 1K9MO 2ZJQL 4JK8A 1TYQA 1WSGA 3DLKA 2P9UB 4JK7A 1TKDA 3KLFA 4LF4K 1FJGK 3E9PA 1KVBA 5HRPA 4JS5A 4MLEA 5HOOA 3J81O 1ITGA 4DWIA 4ZTFA 2X6SA 4NLCA 1X3MA 3QB0A 4C23A 4BC2A 3WT0A 4I6MA 4DTMA 2Z1IA 1R0AA 3L3UA 4BRNA 4MO4A 1HYVA 3I56N 1EP4A 2O8DA 3TTDA 3QINA 3LM9A 4AQYK 4NXMK 4KHNA 4JHDB 4RG8A 3EN9A 3OTOK 4ELUA 4LY7A 4CJ3A 4DTJA 4NYFA 4JYAK 2Q1NA 4CI6A 4BRKA 3CCLN 1BCOA 3LPTA 3TWHA 4GNIA 2IVNA 3WNHA 4ILHA 1NGEA 4BGAA 4IWVA 2KZMA 3QEIA 1J6ZA 5BN9A 3KLEA 4DR6K 1ZYQA 4Y1CA 1D9DA 4WQ4A 5AQLA 3O4QA 3NH2A 4BRPA 4M3RA 3ISNC 5CYMA 3O3HA 3VQ8A 3AVAA 4JRQA 3SUPA 1SL1A 4O8UA 2W6LA 1C0FA 2HBKA 1UAXA 5JLHA 4PWDA 2ZGYA 3TSPA 3BY5A 4BC4A 1S1UA 3AAQA 5DK5A 3RR8A 3TAPA 2Q31A 5AQPA 5LY3A 3VTHA 4DTXA 3LAKA 4H0YB 1QSSA 5AQQA 4LF6K 4IEIA 4CF0A 4J2AA 2YHWA 1KVCA 2GWJA 3AVCA 3LDPA 3J7ZO 4FZXC 5F0XA 5M1NA 3AAPA 4WQ4C 4CCHA 1RT7A 1N5YA 2OTJN 3M3ZA 3DI6A 4FJIA 1HKCA 2JGUA 3K5MA 4WCEL 4DG1A 1KCFA 3F73A 4O8KA 2J4RA 5CE3A 3G4SN 4BR0A 4ID5A 1NOZA 2QXFA 1RBSA 1ZBSA 2KQ2A 3LDLA 5AQYA 4CK1A 1RBVA 3HM8A 2I5JA 1ASVA 2KKZA 4FWPA 1T05A 4YOUA 3CC2N 3VMFB 4CBXA 3LALA 3RMBA 4XEIA 3V6DA 3TTFA 1S9GA 2VWKA 4Y1DA 3V9XA 3L0QA 4EAHD 5CZ2A 1KXPA 5KPRA 1TKTA 3EE9A 3CCJN 4KO0A 1QZ5A 5C24A 1ASUA 3TR8A 4ZHRA 3RMDA 2PBDA 2YV0X 4FLYA 3VESA 1REVA 1RCHA 1V4SA 3EE8A 4BR7A 3QBWA 4OGEA 3UIQA 3EYZA 4YOWA 3CQXA 4OPKA 1IO2A 5DM6L 3RWUA 4OPJA 1WLJA 3JYTA 1TGOA 2HOEA 1K73O 3O5BA 3DAWA 3ZT4A 3ZETA 3O9QA 4CFDA 2FC0A 3ZEUA 4AHTA 5CYQA 1BGXT 4IXCA 1KSPA 1Z05A 3DOKA 4HUFA 4JD2A 4KV8A 3C65A 5AQFA 3HSCA 3K9KA 3S41A 4TSXA 1NK8A 4FWLA 5LMNK 2GBZA 4E7HA 1NGHA 1WAJA 3TAEA 1RTIA 5GAGP 4YOVA 1IKXA 3M8PA 5ELZA 3ZX0A 4ISFA 4Z4IA 4HWIA 3M6GA 4LH4A 1T6CA 2V52B 1NJXA 1Z26A 5AQTA 1WSEA 2ZJPL 2KLAA 3QERA 3QESA 3CJ9A 3SQ0A 4A2AA 1WOQA 4B1XB 2QWQA 5JS2A 2PAVA 4N76A 2QKBA 3MXJA 4H0VB 1C0TA 4CHOA 4DV3K 3A8YA 1T6DA 3C94A 2HHXA 2ASOA 1HLUA 3VQ9A 1IJJA 3T19A 2QEXN 1UWBA 1RDUA 3H6EA 5JVHL 4E7IA 3KKSA 3SK3A 3KLGA 5M1QA 1JKHA 3CPWM 1ZBHA 3VQCA 3VEWA 1YAGA 5AQSA 4R5PA 3OYIA 1VSEA 3QDKA 2QWMA 3SAFA 5F2RA 1O13A 4RW9A 3TPQA 4LSLA 3T1YK 3OHRA 3UKRB 4FJ9A 1BI4A 3AVNA 4E7JA 5I9EB 2W6KA 3IUCA 4BC5A 4IEEA 3PLAA 3PIPL 5AZIA 3D2EB 3BZKA 3HJFA 4AHVA 4IBNA 4NCBA 3THWB 3M8RA 3L2UA 4JK9A 3KD5E 3AO2A 3DMJA 2E1ZA 5F1XA 2P9UA 1VQ5N 4YHHK 2HMIA 4FSVA 2ZWHA 1WSJA 3OYJA 4GV3A 4FK2A 3PIOL 4PKGA 4FLWA 3D0PA 4EIAA 1T03A 3EZWA 2PFUA 4ISGA 3R1XA 1U6ZA 4C8OA 1VSHA 4FLVA 3HBTA 2F96A 3OBWA 3K57A 4J2DA 4M45A 3ULEA 2EWSA 4K42A 3AVIA 3DRSA 3MAQA 1OH8A 1CZ9A 2UUCK 3KK2A 3CMAN 4FW1A 4KHYA 2NRTA 4A61A 3HM9A 4DTSA 4EHUA 4JHDA 4ID1A 5HRRA 2P9KB 2HHQA 2NRZA 4CF9A 4H0OA 2EX3A 4JNEA 4CGFA 5KQDA 4GVEA 2HNDA 3CYMA 4CJEA 4BG8A 3VEOA 3CFPA 2VG6A 1K6YA 2A6AA 3SQ1A 3C6AA 3ZT2A 3CETA 3GBTA 2KZZA 4XH4A 2F8SA 2E4LA 3CQYA 2XO7A 2ZM6K 1L3VA 2OTLN 1ZBIA 2A1SA 2IGIA 2RPIA 1BQNA 3O3FA 3OYBA 3B6OA 3S9HA 1K8AO 2XY8A 3JS6A 2X74A 2AA4A 1LOTB 2KFZA 4AM6A 1ESVA 2I7NA 3E9LA 4H8KA 4A5BA 1IBKK 4MLHA 3CD6N 3VOVA 2FBXA 3KIOA 4K41A 3L4IA 3VQ7A 3RSEB 4JAXA 3CJBA 2KHOA 1N36K 2P9LB 3HVTA 5J2NA 2D0OA 1ZXOA 3WNEA 4EP5A 4M3ZA 2DTUA 1QVFM 3RMCA 1EKEA 5FDLA 3IFRA 3C6UA 1RBTA 4B9QA 4LF9K 3E01A 4KH4A 4B8AB 1NK6A 4BR4A 5AQRA 4DSLA 3WUHA 3HP9A 4M7XA 4RW8A 3BP8A 3CJ1A 4FWRA 4LFBK 4GV6A 3D2FB 4DQ8A 1CZBA 2ZE2A 3CC7N 4ELVA 4HTLA 4OKJA 5KTQA 4IOXA 5IWAK 3EZ5A 4BREA 1JLEA 3AA2A 3MN6A 4JKGB 1ILYA 1JJ2M 3VGMA 3VENA 3NH1A 2GUIA 4ICLA 3AY9A 4CIFA 4WF9L 2P5GA 5GAHP 3OA9A 4AH9A 3SYZA 3THXB 4FM0A 2IOCA 5K14A 3M8QA 4DR5K 3O9TA 4JS4A 1MDUB 4OLAA 2QTDA 4N47A 2QWOA 5HP1A 2ZGZA 5KRSA 1IH7A 1U2VB 2RHKA 3SJHA 3VF4A 3ZT1A 3TSUA 4W5QA 1SL0A 4CJUA 4DTUA 4NCGA 3ZSRA 1XWLA 2A42A 3LDSA 3AVLA 3CCRN 3BDPA 4BG9A 1TAQA 3KKRA 1C1BA 3VPZA 3IAYA 1YJNN 4IJAA 4JI2K 2YHBA 4CEOA 1XNQK 3M8SA 3ZCMA 3KLHA 4FWOA 1VSMA 3QO9A 5A2QO 3CXCM 4DFMA 3H46O 3A5NC 1X9WA 3A5LC 1FXXA 1WSFA 4WYBA 1OH6A 3OYMA 2UYTA 4GKKK 1GLDG 4C8KA 5C15A 4F2SA 3TAFA 3Q7BA 3WXLA 3V9ZA 1JXBA 3V1OA 3QBXA 1YF5L 4DU4A 3BF1A 5AQGA 1S72N 3WXMB 3QFUA 3HI0A 3EO3A 3S3OA 3O4WA 4DTOA 2CH6A 1BA1A 3OYAA 3QFPA 4J2EA 3IG1A 3H1QA 5EY4A 1Q81O 1D5AA 4B1VA 3QIOA 1GOCA 3OS1A 4IJNA 3I55N 4PUOA 2O8EA 1N32K 3VEYA 4KHUA 2W40A 4DF4A 4YORA 2Q0UA 1I39A 2QK9A 4RW6A 2E6LA 1EO1A 1O1WA 1JL2A 3U4LA 4CIGA 1JLGA 4DQRA 4AHSA 1OH7A 4BRMA 1UOCA 2D4WA 1I3AA 1HYSA 4NB4A 5AQJA 3QEPA 2O8FB 4BQLA 2D0BA 3ULDA 4CJQA 4MFBA 4MO5A 2OPQA 3SAGA 1QZ6A 1EWQA 4CJ4A 1QE1A 4CFCA 2AJQA 3AVGA 1EQYA 4GY2B 4G1QA 4E7LA 3H3NO 3P31A 1NKBA 4DQSA 4BRFA 3OS2A 3UKRA 2WC9A 4BVOA 5DM7L 2RF2A 4KFBA 3CERA 4FL9A 3OY9A 3CIPA 4H4MA 3S3MA 4H0TB 1FKPA 3SV3A 1Q9YA 3Q7CA 4Z94A 3LDOA 2BH1A 3SQ2A 2WBNA 5GAEP 1X3NA 2OZSA 5FRMA 4O5FA 2BE2A 5E26A 4W5TA 2FBTA 1JL1A 4BRLA 4F2RA 3GL1A 3CJ7A 3MXMA 4XH1A 1NKCA 4Z4HA 1TKXA 2GEMA 2HBMA 4FPAA 3TARA 2ZJRL 1BIUA 1VQ9N 3H1VX 4K25A 3VETA 2G8VA 1KAZA 3ZX3A 4KB1A 1SV5A 1W9HA 2D0AA 1NKEA 1DLOA 1WSHA 4CEQA 2O8CB 3UKUA 3WQTA 3O9SA 1U04A 1XC9A 4F8RA 1YI2N 5GINA 3MEGA 2Q97A 1QS4A 1Y64A 4AM7A 1LCUA 4IDHA 2DY4A 1ATNA 4DUYK 2BANA 1I94K 5J2PA 4C8NA 5KGXA 4HVJA 1JLFA 4NO7A 3THVA 1NMNA 5EVZA 3SBGA 3ZSOA 3CCVN 2CGKA 2PYLA 3W3DA 3NDKA 3FZKA 3CM5A 1NGAA 4QCLA 4B3OA 5CY4A 4DTRA 3MN7A 2E8AA 3BF3A 5KPTA 4HCCA 3HRGA 3ATUA 5BRFA 4YY3K 3L8BA 2HHSA 2NRHA 1LWFA 3PX4A 5AFUA 4DFKA 4FJHA 1D8YA 4BWJA 3BEXA 2VWBA 4GW6A 4HUEA 3PX6A 5HLFA 3K9JA 1XUPO 3PX0A 2E20A 3VA0A 4FJXA 4JN4A 3NF8A 4DKWA 4M3WA 1M1KO 1BA0A 4BR9A 2JWKA 3CI5A 2V7YA 4CHNA 3K5LA 4IFEA 4CF8A 3RSEA 4FJLA 3O80A 3QICA 4HUGA 2FSKA 1A5WA 5J2QA 3KTQA 4E0DA 3DLLL 2RN2A 3JSMA 4UQGA 5AQVA 1FKOA 1TAUA 1RTDA 4KBOA 3CFOA 3CQ8A 4DS4A 3JXUA 2P9IB 1TVRA 2P9NA 4H4OA 4J2BA 5ADXH 1VQPN 4DSIA 5AQOA 1XQSC 1NGIA 3NBPA 3LZIA 4O5BA 3ZSVA 3OYHA 1Q18A 2D0PA 3IS9A 3W0LA 5KPZA 1T7PA 4B9SA 3D2FA 5C42A 4AHCA 4DSJA 4JV5K 1ASWA 3C7NA 1LW2A 3BUZB 4HHTA 2NRVA 2IVOA 3R3LA 3AA3A 3SAHA 4JKCA 4CJSA 3NCIA 3KLIA 3DWLA 3VEZA 4FVUA 3G10A 1B9DA 2P51A 1DT9A 1YITN 2ATQA 3H45C 4B1ZA 2KW4A 1RBRA 1HNXK 3V9UA 3B6PA 2OCEA 4DUZK 2E5LK 4CEBA 3I8DA 1GLFO 1RDBA 2NRRA 4IO9L 3DXMB 1K8KB 1L3SA 4B9MA 3D45A 3CM6A 1RBUA 1B92A 4M3YA 4JI1K 2A3ZA 4EP4A 4QS9A 1C1AA 1YVNA 5C2FA 3HT3A 3QMLA 3VQBA 2QWNA 4OKKA 5AQKA 5FPDA 4A62A 2QI2A 2FLOA 4H5WA 4NYNA 4K0KK 3CCUN 1D9FA 5LJWA 1E4GT 3MN9A 2O8BA 4K8XA 3PV8A 4DSEA 5FPMA 3WEEB 5FPNA 2JWLA 1MWKA 5BPLA 3DXKB 4WFAL 4CEEA 4FOIA 2D0CA 3O8MA 5AQMA 1P8ZA 3U6FA 4E3SA 1TK0A 4BRQA 5HRSA 1G99A 1VAZA 3O3GA 1EETA 1VSKA 4WQ5A 3TSQA 4CERA 4CJ7A 2HHVA 3ENOA 5M1OA 1JLCA 3FR0A 4N56A 3RTVA 1NNEA 1S22A 2QM1A 1IG9A 4CJKA 2P9PA 3E1YA 4IZ9A 3V4IA 1T8EA 3L2VA 3EL2A 3FE1A 4CW7B 5BR9A 1QVGM 3A5OC 2XY7A 5KGWA 5E41A 3KJVA 4CFAA 2G8HA 1RTJA 1KFDA 3AO1A 3V81A 4KI6A 2HVHA 2EHGA 3ENBA 1LWCA 4BRCA 1GLBG 3V1RA 4GVMA 3NGIA 2VG5A 3VGLA 4OPAA 1YUWA 3SMSA 4WQ5C 4KKOA 3TTCA 4DLEA 2G8UA 1NJZA 1SS6A 4KHSA 1GLEG 3G0ZA 2ASMA 3NE6A 4Y0WA 3CCMN 4IFYA 3N4QA 2IS3A 4KB0A 4JRPA 4W5RA 2QWPA 1NMDA 2JLEA 4CZJA 4DV7K 2E6MA 3I0SA 1S9EA 2Z1GA 4CEAA 4MDBA 1LW0A 4MQ3A 3KVGA 5GADP 1TYQB 4A5AA 1S1XA 4FXDA 1RTHA 4F3TA 2VG7A 1VSFA 2Y1IA 4DR2K 3O6WA 1DKGD 1NU0A 3SMPA 4GV9A 1NBWA 2YHAA 4H5RA 4IFVA 4JI4K 4CHYA 5CHIA 4KRFA 3U9ZA 3OYKA 1Q7YO 2O4GA 3MEEA 2HBLA 3WXJA 3J8AA 4IG3A 3EY1A 3ZSXA 3T1AA 4I6MB 3TI0A 4DB3A 3FZMA 5J1EA 5JMVA 2Q3SA 3L3VA 1KD1O 4FLXA 5SZTA 1Q82O 2OA8A 1QHTA 2XHBA 4JKAA 3KK7A 2XRIA 4DF8A 1GLJO 1RT3A 3OYFA 1LAWA 2F7TA 1Y97A 3DRPA 1ZBLA 4FLUA 4DR4K 2UUAK 4CD1A 1BCMA 3PSIA 4M41A 3VQAA 2KFNA 4I9QA 3RVCA 2VGMA 3OS0A 4XH5A 1NM1A 2IIRA 1NLVA 1MA9B 3T3FA 5GIPA 1QQOA 3DRRA 1GLAG 3E66A 2YCHA 4KPYA 3IDHA 2G8FA 4FK4A 4FOEA 5B8HA 5HROA 4H5VA 1SKSA 2Q2RA 3R8EA 1VHXA 5AQXA 2HHWA 1S1WA 1YTUA 5AQHA 3IKMA 4CJPA 1EXQA 5AFUH 4ILJA 5AQIA 5C2DA 1NJWA 2RKIA 3NH0A 3HVRA 3AVKA 3HP6A 4CZEA 1BDGA 1QSYA 5BN8A 4KHQA 3MEDA 1XHZA 1VQ7N 1YJ9N 4F3OA 2IDOA 1C0MA 3OYCA 5M1KA 3L6QA 4B9LA 3ZSZA 4CGDA 1RDDA 1JLBA 5ADXA 3P38A 2NRXA 2HB5A 1BWFO 2CH5A 3OVNA 4C8LA 4DR3K 1RGIA 4B9NA 4JKHA 1GLCG 3SUQA 3H3OB 1YTAA 1NJYA 4H0XB 2P9IA 4PY5A 5BRDA 4E19A 1S5JA 3GG4A 4QAGA 3R9PA 3GE1A 2WTUA 1C0GA 2HMPA 3TAQA 4DSKA 4H5NA 4Q5VA 2YKNA 5FROA 2X6NA 3O1BA 1NK4A 4DV0K 3A0IX 3LP0A 3DM2A 4CJRA 1NK0A 3OJSA 2E1YA 1XI1A 4B1WB 4IKFA 3BGRA 5BREA 1L3UA 1Q86O 4PHTX 4WE1A 1IBMK 4O4GA 4CJWA 2OYQA 3SLCA 1XNRK 5SWMA 3NVMA 2HHUA 3UE5A 4LSNA 4JEPA 3HOTA 4F9OA 2FBYA 4OJRA 3C6TA 3OYGA 3J7YP 4I9LA 2B4JA 1KLNA 4QS8A 2PY5A 1DTQA 5JICA 1SQKA 4FJ7A 1WNSA 3DXMA 5AQNA 2IC3A 1YVUA 1K8KA 2YNHA 1KC8O 4Z4GA 5C12A 1J5OA 4XIUA 1TL3A 4KREA 3VEVA 3MECA 1HUXA 3O08A 3WQUA 3ZETB 5KRTA 1QQCA 1YT3A 2P5OA 4B1YB 2RE2A 1VQLN 3SUNA 4Z0UA 1BU6O 2WONA 3HPGA 3QIPA 3CC4N 2YI1A 3OW2M 3U8XA 4JD2B 3A5MC 4OO1J 4BVPA 4H0PA 3MXIA 1DEJA 4BGBA 4K8ZA 4AILC 4MDAA 2A41A 1RILA 1A5XA 4CZIA 3H08A 4X62K 3F5TA 1HKBA 4JLHA 1BQMA 2UU9K 4FLTA 2YNIA 1HX1A 4EHTA 1TV6A 4JKFA 4PKIA 3JAMO 3SNNA 3FFKB 3ZSYA 1KVAA 2YKMA 1C1CA 3QEVA 4CE9A 3FZLA 4DV2K 1TUYA 1JLAA 2WUSA 4C8MA 2GWKA 5BPNA 3DJCA 2W42A 5KQ8A 3IRXA 1JCEA 3F2KA 4PL8A 4LC9B 3MN5A 3DLHA 5JS1A 2DFEA 4J8FA 4W5OA 4FM1A 3CG7A 4I2PA 3QEWA 3PUFA 4O0IA 4DV5K 4CZKA 3NMUA 1J53A 4CHQA 1XHXA 2ZF5O 2ETJA 1XMQK 3T69A 3SV4A 3ASMA 1W97L 1CXQA 4F4KA 4FZZA 4CJTA 2ITGA 1U48A 1E3MA 2UUBK 3ZSWA 3SJJA 1ZBFA 2NZTA 1KFSA 4C1NI 5J2MA 3VF2A 3QLHA 3RMAA 2GV9A 2BGGA 4DV4K 4DQQA 4FJ5A 1VSDA 3UB5A 4RTFD 4DU1A 3OBYA 1G15A 5BPMA 5CR4A 3LM2A 2DFHA 1BL3A 1BI4B 2FSJA 4AF1A 3MCPA 3VQEA 1WSIA 2B5JA 2IVPA 3MX5A 4N41A 1DGKN 4B3SK 1NWKA 1E4FT 4CIEA 1NGGA 3D2EA 3P83D 3ZLJA 4E1JA 1NGBA 1HNIA 3THWA 2BTFA 4DV6K 4L8RB 1NK5A 1VQ6N 2WFBA 4BDYA 1SAZA 2E88A 2A1RA 3PY8A 1BIZA 1XMOK 4WFNL 3E9OA 3VGKA 3KK3A 2CGLA 3AVHA 2QA4N 2YJEA 4CZHA 4Z4EA 3DLBA 4A59A 3PSFA 3VEXA 3LWMA 1W7AA 1ZBUA 4CEFA 4B9VA 4CGGA 4CBWA 1N8RO 2HW3A 2YJFA 3MDQA 4CK3A 3CF5L 1WUAA 3ULEB 2D5RA 2E2PA 4M63C 1BOTO 3HZ6A 1NOYA 3FLCO 3K58A 1Z25A 4BRHA 1FW6A 3AA4A 3VQDA 2P9KA 3C6HA 4M3XA 3LP1A 5AR0A 1QSLA 3VQPA 4FWMA 1RT5A 2HSTA 3J7AP 5C0YA 4OGCA 2Q36A 3KZBA 1TK8A 1VSJA 2LSNA 5TKWA 1WN7A 3O9RA 2X78A 4PKHA 1ATRA 3VQ4A 1GLLO 4ILGB 3TABA 2E2NA 1YHQN 3G6EN 3AVFA 2NRWA 3SUOA 3G25A 3RRGA 3HL8A 5AZJB 5M1FA 2ZQBA 2VQEK 5DMRA 1P90A 5IT9O 5D3GA 4FWKA 5M1PA 2VQFK 2I7PA 4FZYA 4FLZA 1S6PA 4LF7K 3FZHA 4CZFA 4BE1A 4B3TK 3FGUA 5EU7A 4KTQA 4IOAL 3K5OA 1NGCA 3VQ6A 1WAFA 1VQNN 2UXBK 2VYPA 3VERA 3P4IA 4ELTA 1EWRA 3RR7A 1SUQA 4B9UA 4LH5A 4CEZA 1Z6RA 2P9LA 4CGHA 4RWTA 4IO8A 5C10A 3MWPA 2O4IA 4CZGA 3VA3A 1Q8IA 4DV1K 1OVYA 3K0SA 3L2RA 3CHWA 1HJOA 3ZT3A 4CJ5A 1HMVA 3AVJA 4JKEA 4CESA 1M90O 1IKWA 4CZLA 4QS7A 4JKDA 2YHYA 2R7YA 4DR1K 4CZMA 4CEDA 3MCAB 4X66K 2GX9A 2OANA 2OPSA 1RDCA 3AVBA 2IAJA 1MWMA 2F9TA 4NXNK 3C95A 5I42A 3DLEA 3B8AX 4CJVA 1LV5A 1NK7A 4JKGA 1KLMA 4OLBA 1JLQA 1X1PA 5BRHA 4A57A 4ISEA 5MLCQ 5EX5A 4LF8K 4CGIA 4BRAA 3THXA 2D1KA 3AVMA 1NGFA 3K5NA 5AQUA 3J80O 4ZTJA 2QWRA 4KAZA 2Q0RA 1LWEA 3ID8A 1U2VA 4YDUA 4O55A 2VGNA 4CJFA 2HVIA 1RT1A 4CHPA 5FRNA 2FF6A 4H5TA 2P9SB 4CF2A 4CGJA 3KK1A 1RFQA 4FWNA 4LD0A 4FWQA 1VQMN 1HRHA 4BRIA 1N34K 1D4XA 3CPEA 3LAMA 4G9ZA 1X9JA 3WNGA 1B9FA 4BROA 4KTWA 4LFAK 4HTUA 3TAGA 2AP1A 1KTQA 3MWTA 5LMUK 1L5UA 4BWMA 2B6AA 2W41A 4NCAA 3FFIA 1W0HA 3G71N 4YDUC 3CCEN 4CJLA 3OYNA 1MU2A 3T1HK 1S1TA 1XC3A 5HBMA 4AHUA 2BDPA 3U3GA 4YOXA 3OYLA 4UY8O 1J9AA 1W2BM 1H1VA 2ASPA 5AQWA 4LF5K 4FJNA 4E89A 4V19S 4W5NA 2VWJA 4JI5K 3LANA 1R59O 4RCHA 3DLRA 4FCYA 5FLXO 5LL6Z 2E2OA 3OYEA 2O8EB 1Q9XA 3THYB 3NF9A 3P1GA 3GOIA 3HOSA 3GDQA 2ITMA 3OJUA 4DTNA 1VRTA 2QXLA 3AO4A 2GUPA 1QQMA 1HNVA 4KTZA 3SI6A 3PO4A 1VSLA 1WB9A 2XY5A 2YNFA 3KD1E 4CBUA 3V9SA 2O8FA 1LAVA 4FYDA 2QWLA 4E7KA 3IMXA 4IDKA 3D7EO 4IOCL 4BC3A 2QKKA 3DOLA 4CFBA 1KAXA 1BISA 3LDNA 5AQZA 1HR0K 4DQPA 4EZ6A 1U4BA 1T3VA 1ZC6A 1VQON 2Y1JA 5T7BA 1J54A 1A5VA 3ZSQA 5FPEA 1GOAA 1IKVA 3AV9A 4QOZB 3NGYA 1OH5A 1S1VA 3ZT0A 1NGDA 3EKUA 5TKYA 1KAYA 3AGRA 2HHHK 4FJGA 4KHPK 4X65K 3EKSA 3HTVA 1C0UA 2FXUA 3I0RA 2O8DB 3MMVA 3L2WA 3CMEN 4M3TA 4U67L 2FBVA 4CVNE 3V9WA 1SZ2A 4DMNA 1OVQA 3SZ2A 3ZYYX 4WFBL 2OZMA 3AO3A 2F9WA 4BACA 4OPHA 2O8CA 3DLGA 4PL7A 4KI4A 3UKUB 1HQEA 4YFUA 1HNZK 3VF6A 5AJ3K 1N6QA 1T44A 4KH5A 4C1NK 2DFFA 3TANA 5E84A 3A2FA 4DS5A 3QETA 3P5JA 1TK5A 2GELA 1HQUA 2CGJA 4JI7K 4FPBA 1BO5O 4BE2A 2HBJA 3QNNA 1NG9A 3I8BA 5KI6A 4DFJA 5CZ1A 2HHTA 3V1QA 4FJMA 2G8WA 4CF1A 3O9UA 4DCHA 1QQNA 1VK0A 4OVLA 2XY6A 2DPNA 1QTMA 2Z1JA 3CCSN 4OX9K 5I3UA 3NGZA 1RDAA 1QHAA 5JVGL 3U9DA 4B3RK 4I7FA 1HNWK 4FO0A 1NK9A 5GIOA 5AZJA 5LJVA 4U7BA 4DFPA 4BRGA 1BUPA 1JXEA 1KRPA 4GMJB 3HSTB 3CCQN 1DTTA 4FJ8A 3HYFA 1HJRA 3S3NA 1U47A 1CZAN 3NVKA 3BZCA 1WBDA 1F21A 3ALYA 2V7ZA 1NGJA 4NLBA 2E2QA 5HRNA 3TU5A 3M1FA 3F9KA 3VQQA 2YX6A 4FVMA 1VQ4N 4LFCK 4BY9C 4PA1A 2G8KA 1CXUA 4FK0A 3F9MA 3AGKA 3KWIA 4BRDA 1U49A 3WNFA 4JI8K 3WXKA 3MK6A 4JI3K 4OKEA 2NUBA 1HPZA 3ID6A 4RW4A 3WXIA 3LDQA 2PYJA 2ZD1A 2UXCK 2V51B 2HNYA 3HXMA 4DR7K 4BDPA 2P9NB 2YHXA 2VCPA 1J5EK 4BQZA 1TUUA 1X9SA 4O44A 1YJWN 4I2QA 3QEXA 3U3YA 4FJJA 1HPMA 3VTIA 4BR2A 3ENHA 4EZ9A 5JLFA 2YNGA 3R6MA 1VSIA 4DU3A 1TKZA 3HPOA 3OYDA 3C7NB 2FSNA 4DTPA 1U45A 3NF6A 2G8IA 1FK9A 2H3GX 3HPHA 4X64K 1N33K 1WBBA 1IKYA 3NAEA 2HNZA 2UXDK 3LL3A 1UA0A 3M5RA 1TL1A 2QW9A 4GKJK 4IG0A 3CFRA 1L3TA 1ATSA 1S3XA 4CHZA 3LP2A 1C6VA 4PQUA 3LP3A 1BG3A 2F4VK 3D6RA 3ITHA 3P39A 1HYZA 4Q0BA 2F8TA 1RT4A 5H1SQ 1V4TA 2Z1HA 3AARA 4B3MK 4AHRA 3O1WA 4K43A 3LPUA 2KTQA 4O0JA 3ZEUB 2P9SA 1SKWA 3C0BA 1HKGA 2HF4A 4N5SA 3PO5A 3NHGA 4RW7A 4FJKA 2O8BB 1BHLA 1RT2A 4M42A 3WEEA 4DSFA 1RNHA 2BUPA 3T7ZA 4DLGA 1RT6A 3DXKA 4YOTA 4DQIA 3HO1A 4B1UB 2HF3A 3LZJA 4B08A 3L2QA 2NNWA 4FWSA 3SBTA 4YOYA 1RDWX 5EOYA 2A5XA 3HK2A 4BDZA 4FM2A 3KHYA
chains in the Genus database with same CATH topology
2UUBK 4JI8K 1N34K 3OTOK 4JYAK 2VQEK 1IBMK 4JI3K 1XNRK 4JI2K 4LFAK 5IT9O 1XNQK 2UXCK 2VQFK 4DR7K 4DV4K 4CW7B 5A2QO 2HHHK 4KHPK 4X65K 3J7YP 1J5EK 3T1YK 4DR4K 2UUAK 4LF7K 5LMUK 4B3TK 5BR8K 1IBKK 4GKKK 4DR6K 4CVNE 4B3SK 3T1HK 2UXBK 4JV5K 1N36K 4LF5K 4DV6K 4V19S 1HNZK 4JI6K 5AJ3K 4X64K 4JI5K 4YHHK 1N33K 4DV1K 4LF9K 2UXDK 1XMOK 5FLXO 4DUYK 4JI0K 1I94K 1HNXK 5LL6Z 4GKJK 4DUZK 2E5LK 4JI7K 1N32K 4DR1K 4DV7K 4LF6K 4LFBK 4X66K 4X62K 2F4VK 2UU9K 1IBLK 4NXNK 5IWAK 4JI1K 3JAMO 5LMNK 4B3MK 4OX9K 4LF4K 1FJGK 2UUCK 4DV2K 4K0KK 4DR2K 4B3RK 4DR3K 1HNWK 4LF8K 4JI4K 3J81O 4YY3K 4DR5K 3J80O 3J7AP 1HR0K 4DV5K 4DV3K 1XMQK 4DV0K 4LFCK 4AQYK 2ZM6K 4NXMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB K;  4JI8 K;  1N34 K;  3OTO K;  4JYA K;  2VQE K;  1IBM K;  4JI3 K;  1XNR K;  4JI2 K;  4LFA K;  5IT9 O;  1XNQ K;  2UXC K;  2VQF K;  4DR7 K;  4DV4 K;  4CW7 B;  5A2Q O;  2HHH K;  4KHP K;  4X65 K;  3J7Y P;  1J5E K;  3T1Y K;  4DR4 K;  2UUA K;  4LF7 K;  5LMU K;  4B3T K;  5BR8 K;  1IBK K;  4GKK K;  4DR6 K;  4CVN E;  4B3S K;  3T1H K;  2UXB K;  4JV5 K;  1N36 K;  4LF5 K;  4DV6 K;  4V19 S;  1HNZ K;  4JI6 K;  5AJ3 K;  4X64 K;  4JI5 K;  4YHH K;  1N33 K;  4DV1 K;  4LF9 K;  2UXD K;  1XMO K;  5FLX O;  4DUY K;  4JI0 K;  1I94 K;  1HNX K;  5LL6 Z;  4GKJ K;  4DUZ K;  2E5L K;  4JI7 K;  1N32 K;  4DR1 K;  4DV7 K;  4LF6 K;  4LFB K;  4X66 K;  4X62 K;  2F4V K;  2UU9 K;  1IBL K;  4NXN K;  5IWA K;  4JI1 K;  3JAM O;  5LMN K;  4B3M K;  4OX9 K;  4LF4 K;  1FJG K;  2UUC K;  4DV2 K;  4K0K K;  4DR2 K;  4B3R K;  4DR3 K;  1HNW K;  4LF8 K;  4JI4 K;  3J81 O;  4YY3 K;  4DR5 K;  3J80 O;  3J7A P;  1HR0 K;  4DV5 K;  4DV3 K;  1XMQ K;  4DV0 K;  4LFC K;  4AQY K;  2ZM6 K;  4NXM K; 
#chains in the Genus database with same CATH topology
 3K2P A;  1X9M A;  1JCF A;  1SKR A;  5HL7 L;  4DHY A;  3CJA A;  4CK2 A;  3VQ5 A;  1YIJ N;  3SPY A;  1OKJ A;  2P1J A;  3SQ4 A;  2A40 A;  2P9P B;  3CJC A;  3VN5 A;  4JKB A;  2OPP A;  1IG8 A;  1GOB A;  2NLX A;  3FZF A;  1EX4 A;  1VQK N;  4KH6 A;  4B9T A;  1JCG A;  4YNQ A;  2FF3 B;  5EXW A;  3O4N A;  5BR8 K;  3MX2 A;  3NFA A;  2PZS A;  3AO5 A;  4FW2 A;  1UA1 A;  4Z4F A;  1VRU A;  4EFH A;  3THY A;  2GTD A;  4B8C A;  4BR5 A;  4CD3 A;  3KWG A;  3EEQ A;  3AA5 X;  4E1N A;  3ATV A;  4E1M A;  4L3Q A;  4HCB A;  3I33 A;  4M3U A;  2OPR A;  3DYA A;  4Z4C A;  1SL2 A;  3N4P A;  3L4Q A;  3TAM A;  4JI6 K;  4BE0 A;  1NJI O;  5C25 A;  3SCX A;  4M7Y A;  3QNO A;  1CLQ A;  3SPZ A;  3RRH A;  4JI0 K;  4A2B A;  1VQ8 N;  4R79 A;  3LWL A;  2WOM A;  3NF7 A;  1KQS M;  1S6Q A;  4H03 B;  5AZI B;  3K59 A;  1IBL K;  3ZX2 A;  4KHW A;  4CEC A;  1IV0 A;  1YXQ A;  1K9M O;  2ZJQ L;  4JK8 A;  1TYQ A;  1WSG A;  3DLK A;  2P9U B;  4JK7 A;  1TKD A;  3KLF A;  4LF4 K;  1FJG K;  3E9P A;  1KVB A;  5HRP A;  4JS5 A;  4MLE A;  5HOO A;  3J81 O;  1ITG A;  4DWI A;  4ZTF A;  2X6S A;  4NLC A;  1X3M A;  3QB0 A;  4C23 A;  4BC2 A;  3WT0 A;  4I6M A;  4DTM A;  2Z1I A;  1R0A A;  3L3U A;  4BRN A;  4MO4 A;  1HYV A;  3I56 N;  1EP4 A;  2O8D A;  3TTD A;  3QIN A;  3LM9 A;  4AQY K;  4NXM K;  4KHN A;  4JHD B;  4RG8 A;  3EN9 A;  3OTO K;  4ELU A;  4LY7 A;  4CJ3 A;  4DTJ A;  4NYF A;  4JYA K;  2Q1N A;  4CI6 A;  4BRK A;  3CCL N;  1BCO A;  3LPT A;  3TWH A;  4GNI A;  2IVN A;  3WNH A;  4ILH A;  1NGE A;  4BGA A;  4IWV A;  2KZM A;  3QEI A;  1J6Z A;  5BN9 A;  3KLE A;  4DR6 K;  1ZYQ A;  4Y1C A;  1D9D A;  4WQ4 A;  5AQL A;  3O4Q A;  3NH2 A;  4BRP A;  4M3R A;  3ISN C;  5CYM A;  3O3H A;  3VQ8 A;  3AVA A;  4JRQ A;  3SUP A;  1SL1 A;  4O8U A;  2W6L A;  1C0F A;  2HBK A;  1UAX A;  5JLH A;  4PWD A;  2ZGY A;  3TSP A;  3BY5 A;  4BC4 A;  1S1U A;  3AAQ A;  5DK5 A;  3RR8 A;  3TAP A;  2Q31 A;  5AQP A;  5LY3 A;  3VTH A;  4DTX A;  3LAK A;  4H0Y B;  1QSS A;  5AQQ A;  4LF6 K;  4IEI A;  4CF0 A;  4J2A A;  2YHW A;  1KVC A;  2GWJ A;  3AVC A;  3LDP A;  3J7Z O;  4FZX C;  5F0X A;  5M1N A;  3AAP A;  4WQ4 C;  4CCH A;  1RT7 A;  1N5Y A;  2OTJ N;  3M3Z A;  3DI6 A;  4FJI A;  1HKC A;  2JGU A;  3K5M A;  4WCE L;  4DG1 A;  1KCF A;  3F73 A;  4O8K A;  2J4R A;  5CE3 A;  3G4S N;  4BR0 A;  4ID5 A;  1NOZ A;  2QXF A;  1RBS A;  1ZBS A;  2KQ2 A;  3LDL A;  5AQY A;  4CK1 A;  1RBV A;  3HM8 A;  2I5J A;  1ASV A;  2KKZ A;  4FWP A;  1T05 A;  4YOU A;  3CC2 N;  3VMF B;  4CBX A;  3LAL A;  3RMB A;  4XEI A;  3V6D A;  3TTF A;  1S9G A;  2VWK A;  4Y1D A;  3V9X A;  3L0Q A;  4EAH D;  5CZ2 A;  1KXP A;  5KPR A;  1TKT A;  3EE9 A;  3CCJ N;  4KO0 A;  1QZ5 A;  5C24 A;  1ASU A;  3TR8 A;  4ZHR A;  3RMD A;  2PBD A;  2YV0 X;  4FLY A;  3VES A;  1REV A;  1RCH A;  1V4S A;  3EE8 A;  4BR7 A;  3QBW A;  4OGE A;  3UIQ A;  3EYZ A;  4YOW A;  3CQX A;  4OPK A;  1IO2 A;  5DM6 L;  3RWU A;  4OPJ A;  1WLJ A;  3JYT A;  1TGO A;  2HOE A;  1K73 O;  3O5B A;  3DAW A;  3ZT4 A;  3ZET A;  3O9Q A;  4CFD A;  2FC0 A;  3ZEU A;  4AHT A;  5CYQ A;  1BGX T;  4IXC A;  1KSP A;  1Z05 A;  3DOK A;  4HUF A;  4JD2 A;  4KV8 A;  3C65 A;  5AQF A;  3HSC A;  3K9K A;  3S41 A;  4TSX A;  1NK8 A;  4FWL A;  5LMN K;  2GBZ A;  4E7H A;  1NGH A;  1WAJ A;  3TAE A;  1RTI A;  5GAG P;  4YOV A;  1IKX A;  3M8P A;  5ELZ A;  3ZX0 A;  4ISF A;  4Z4I A;  4HWI A;  3M6G A;  4LH4 A;  1T6C A;  2V52 B;  1NJX A;  1Z26 A;  5AQT A;  1WSE A;  2ZJP L;  2KLA A;  3QER A;  3QES A;  3CJ9 A;  3SQ0 A;  4A2A A;  1WOQ A;  4B1X B;  2QWQ A;  5JS2 A;  2PAV A;  4N76 A;  2QKB A;  3MXJ A;  4H0V B;  1C0T A;  4CHO A;  4DV3 K;  3A8Y A;  1T6D A;  3C94 A;  2HHX A;  2ASO A;  1HLU A;  3VQ9 A;  1IJJ A;  3T19 A;  2QEX N;  1UWB A;  1RDU A;  3H6E A;  5JVH L;  4E7I A;  3KKS A;  3SK3 A;  3KLG A;  5M1Q A;  1JKH A;  3CPW M;  1ZBH A;  3VQC A;  3VEW A;  1YAG A;  5AQS A;  4R5P A;  3OYI A;  1VSE A;  3QDK A;  2QWM A;  3SAF A;  5F2R A;  1O13 A;  4RW9 A;  3TPQ A;  4LSL A;  3T1Y K;  3OHR A;  3UKR B;  4FJ9 A;  1BI4 A;  3AVN A;  4E7J A;  5I9E B;  2W6K A;  3IUC A;  4BC5 A;  4IEE A;  3PLA A;  3PIP L;  5AZI A;  3D2E B;  3BZK A;  3HJF A;  4AHV A;  4IBN A;  4NCB A;  3THW B;  3M8R A;  3L2U A;  4JK9 A;  3KD5 E;  3AO2 A;  3DMJ A;  2E1Z A;  5F1X A;  2P9U A;  1VQ5 N;  4YHH K;  2HMI A;  4FSV A;  2ZWH A;  1WSJ A;  3OYJ A;  4GV3 A;  4FK2 A;  3PIO L;  4PKG A;  4FLW A;  3D0P A;  4EIA A;  1T03 A;  3EZW A;  2PFU A;  4ISG A;  3R1X A;  1U6Z A;  4C8O A;  1VSH A;  4FLV A;  3HBT A;  2F96 A;  3OBW A;  3K57 A;  4J2D A;  4M45 A;  3ULE A;  2EWS A;  4K42 A;  3AVI A;  3DRS A;  3MAQ A;  1OH8 A;  1CZ9 A;  2UUC K;  3KK2 A;  3CMA N;  4FW1 A;  4KHY A;  2NRT A;  4A61 A;  3HM9 A;  4DTS A;  4EHU A;  4JHD A;  4ID1 A;  5HRR A;  2P9K B;  2HHQ A;  2NRZ A;  4CF9 A;  4H0O A;  2EX3 A;  4JNE A;  4CGF A;  5KQD A;  4GVE A;  2HND A;  3CYM A;  4CJE A;  4BG8 A;  3VEO A;  3CFP A;  2VG6 A;  1K6Y A;  2A6A A;  3SQ1 A;  3C6A A;  3ZT2 A;  3CET A;  3GBT A;  2KZZ A;  4XH4 A;  2F8S A;  2E4L A;  3CQY A;  2XO7 A;  2ZM6 K;  1L3V A;  2OTL N;  1ZBI A;  2A1S A;  2IGI A;  2RPI A;  1BQN A;  3O3F A;  3OYB A;  3B6O A;  3S9H A;  1K8A O;  2XY8 A;  3JS6 A;  2X74 A;  2AA4 A;  1LOT B;  2KFZ A;  4AM6 A;  1ESV A;  2I7N A;  3E9L A;  4H8K A;  4A5B A;  1IBK K;  4MLH A;  3CD6 N;  3VOV A;  2FBX A;  3KIO A;  4K41 A;  3L4I A;  3VQ7 A;  3RSE B;  4JAX A;  3CJB A;  2KHO A;  1N36 K;  2P9L B;  3HVT A;  5J2N A;  2D0O A;  1ZXO A;  3WNE A;  4EP5 A;  4M3Z A;  2DTU A;  1QVF M;  3RMC A;  1EKE A;  5FDL A;  3IFR A;  3C6U A;  1RBT A;  4B9Q A;  4LF9 K;  3E01 A;  4KH4 A;  4B8A B;  1NK6 A;  4BR4 A;  5AQR A;  4DSL A;  3WUH A;  3HP9 A;  4M7X A;  4RW8 A;  3BP8 A;  3CJ1 A;  4FWR A;  4LFB K;  4GV6 A;  3D2F B;  4DQ8 A;  1CZB A;  2ZE2 A;  3CC7 N;  4ELV A;  4HTL A;  4OKJ A;  5KTQ A;  4IOX A;  5IWA K;  3EZ5 A;  4BRE A;  1JLE A;  3AA2 A;  3MN6 A;  4JKG B;  1ILY A;  1JJ2 M;  3VGM A;  3VEN A;  3NH1 A;  2GUI A;  4ICL A;  3AY9 A;  4CIF A;  4WF9 L;  2P5G A;  5GAH P;  3OA9 A;  4AH9 A;  3SYZ A;  3THX B;  4FM0 A;  2IOC A;  5K14 A;  3M8Q A;  4DR5 K;  3O9T A;  4JS4 A;  1MDU B;  4OLA A;  2QTD A;  4N47 A;  2QWO A;  5HP1 A;  2ZGZ A;  5KRS A;  1IH7 A;  1U2V B;  2RHK A;  3SJH A;  3VF4 A;  3ZT1 A;  3TSU A;  4W5Q A;  1SL0 A;  4CJU A;  4DTU A;  4NCG A;  3ZSR A;  1XWL A;  2A42 A;  3LDS A;  3AVL A;  3CCR N;  3BDP A;  4BG9 A;  1TAQ A;  3KKR A;  1C1B A;  3VPZ A;  3IAY A;  1YJN N;  4IJA A;  4JI2 K;  2YHB A;  4CEO A;  1XNQ K;  3M8S A;  3ZCM A;  3KLH A;  4FWO A;  1VSM A;  3QO9 A;  5A2Q O;  3CXC M;  4DFM A;  3H46 O;  3A5N C;  1X9W A;  3A5L C;  1FXX A;  1WSF A;  4WYB A;  1OH6 A;  3OYM A;  2UYT A;  4GKK K;  1GLD G;  4C8K A;  5C15 A;  4F2S A;  3TAF A;  3Q7B A;  3WXL A;  3V9Z A;  1JXB A;  3V1O A;  3QBX A;  1YF5 L;  4DU4 A;  3BF1 A;  5AQG A;  1S72 N;  3WXM B;  3QFU A;  3HI0 A;  3EO3 A;  3S3O A;  3O4W A;  4DTO A;  2CH6 A;  1BA1 A;  3OYA A;  3QFP A;  4J2E A;  3IG1 A;  3H1Q A;  5EY4 A;  1Q81 O;  1D5A A;  4B1V A;  3QIO A;  1GOC A;  3OS1 A;  4IJN A;  3I55 N;  4PUO A;  2O8E A;  1N32 K;  3VEY A;  4KHU A;  2W40 A;  4DF4 A;  4YOR A;  2Q0U A;  1I39 A;  2QK9 A;  4RW6 A;  2E6L A;  1EO1 A;  1O1W A;  1JL2 A;  3U4L A;  4CIG A;  1JLG A;  4DQR A;  4AHS A;  1OH7 A;  4BRM A;  1UOC A;  2D4W A;  1I3A A;  1HYS A;  4NB4 A;  5AQJ A;  3QEP A;  2O8F B;  4BQL A;  2D0B A;  3ULD A;  4CJQ A;  4MFB A;  4MO5 A;  2OPQ A;  3SAG A;  1QZ6 A;  1EWQ A;  4CJ4 A;  1QE1 A;  4CFC A;  2AJQ A;  3AVG A;  1EQY A;  4GY2 B;  4G1Q A;  4E7L A;  3H3N O;  3P31 A;  1NKB A;  4DQS A;  4BRF A;  3OS2 A;  3UKR A;  2WC9 A;  4BVO A;  5DM7 L;  2RF2 A;  4KFB A;  3CER A;  4FL9 A;  3OY9 A;  3CIP A;  4H4M A;  3S3M A;  4H0T B;  1FKP A;  3SV3 A;  1Q9Y A;  3Q7C A;  4Z94 A;  3LDO A;  2BH1 A;  3SQ2 A;  2WBN A;  5GAE P;  1X3N A;  2OZS A;  5FRM A;  4O5F A;  2BE2 A;  5E26 A;  4W5T A;  2FBT A;  1JL1 A;  4BRL A;  4F2R A;  3GL1 A;  3CJ7 A;  3MXM A;  4XH1 A;  1NKC A;  4Z4H A;  1TKX A;  2GEM A;  2HBM A;  4FPA A;  3TAR A;  2ZJR L;  1BIU A;  1VQ9 N;  3H1V X;  4K25 A;  3VET A;  2G8V A;  1KAZ A;  3ZX3 A;  4KB1 A;  1SV5 A;  1W9H A;  2D0A A;  1NKE A;  1DLO A;  1WSH A;  4CEQ A;  2O8C B;  3UKU A;  3WQT A;  3O9S A;  1U04 A;  1XC9 A;  4F8R A;  1YI2 N;  5GIN A;  3MEG A;  2Q97 A;  1QS4 A;  1Y64 A;  4AM7 A;  1LCU A;  4IDH A;  2DY4 A;  1ATN A;  4DUY K;  2BAN A;  1I94 K;  5J2P A;  4C8N A;  5KGX A;  4HVJ A;  1JLF A;  4NO7 A;  3THV A;  1NMN A;  5EVZ A;  3SBG A;  3ZSO A;  3CCV N;  2CGK A;  2PYL A;  3W3D A;  3NDK A;  3FZK A;  3CM5 A;  1NGA A;  4QCL A;  4B3O A;  5CY4 A;  4DTR A;  3MN7 A;  2E8A A;  3BF3 A;  5KPT A;  4HCC A;  3HRG A;  3ATU A;  5BRF A;  4YY3 K;  3L8B A;  2HHS A;  2NRH A;  1LWF A;  3PX4 A;  5AFU A;  4DFK A;  4FJH A;  1D8Y A;  4BWJ A;  3BEX A;  2VWB A;  4GW6 A;  4HUE A;  3PX6 A;  5HLF A;  3K9J A;  1XUP O;  3PX0 A;  2E20 A;  3VA0 A;  4FJX A;  4JN4 A;  3NF8 A;  4DKW A;  4M3W A;  1M1K O;  1BA0 A;  4BR9 A;  2JWK A;  3CI5 A;  2V7Y A;  4CHN A;  3K5L A;  4IFE A;  4CF8 A;  3RSE A;  4FJL A;  3O80 A;  3QIC A;  4HUG A;  2FSK A;  1A5W A;  5J2Q A;  3KTQ A;  4E0D A;  3DLL L;  2RN2 A;  3JSM A;  4UQG A;  5AQV A;  1FKO A;  1TAU A;  1RTD A;  4KBO A;  3CFO A;  3CQ8 A;  4DS4 A;  3JXU A;  2P9I B;  1TVR A;  2P9N A;  4H4O A;  4J2B A;  5ADX H;  1VQP N;  4DSI A;  5AQO A;  1XQS C;  1NGI A;  3NBP A;  3LZI A;  4O5B A;  3ZSV A;  3OYH A;  1Q18 A;  2D0P A;  3IS9 A;  3W0L A;  5KPZ A;  1T7P A;  4B9S A;  3D2F A;  5C42 A;  4AHC A;  4DSJ A;  4JV5 K;  1ASW A;  3C7N A;  1LW2 A;  3BUZ B;  4HHT A;  2NRV A;  2IVO A;  3R3L A;  3AA3 A;  3SAH A;  4JKC A;  4CJS A;  3NCI A;  3KLI A;  3DWL A;  3VEZ A;  4FVU A;  3G10 A;  1B9D A;  2P51 A;  1DT9 A;  1YIT N;  2ATQ A;  3H45 C;  4B1Z A;  2KW4 A;  1RBR A;  1HNX K;  3V9U A;  3B6P A;  2OCE A;  4DUZ K;  2E5L K;  4CEB A;  3I8D A;  1GLF O;  1RDB A;  2NRR A;  4IO9 L;  3DXM B;  1K8K B;  1L3S A;  4B9M A;  3D45 A;  3CM6 A;  1RBU A;  1B92 A;  4M3Y A;  4JI1 K;  2A3Z A;  4EP4 A;  4QS9 A;  1C1A A;  1YVN A;  5C2F A;  3HT3 A;  3QML A;  3VQB A;  2QWN A;  4OKK A;  5AQK A;  5FPD A;  4A62 A;  2QI2 A;  2FLO A;  4H5W A;  4NYN A;  4K0K K;  3CCU N;  1D9F A;  5LJW A;  1E4G T;  3MN9 A;  2O8B A;  4K8X A;  3PV8 A;  4DSE A;  5FPM A;  3WEE B;  5FPN A;  2JWL A;  1MWK A;  5BPL A;  3DXK B;  4WFA L;  4CEE A;  4FOI A;  2D0C A;  3O8M A;  5AQM A;  1P8Z A;  3U6F A;  4E3S A;  1TK0 A;  4BRQ A;  5HRS A;  1G99 A;  1VAZ A;  3O3G A;  1EET A;  1VSK A;  4WQ5 A;  3TSQ A;  4CER A;  4CJ7 A;  2HHV A;  3ENO A;  5M1O A;  1JLC A;  3FR0 A;  4N56 A;  3RTV A;  1NNE A;  1S22 A;  2QM1 A;  1IG9 A;  4CJK A;  2P9P A;  3E1Y A;  4IZ9 A;  3V4I A;  1T8E A;  3L2V A;  3EL2 A;  3FE1 A;  4CW7 B;  5BR9 A;  1QVG M;  3A5O C;  2XY7 A;  5KGW A;  5E41 A;  3KJV A;  4CFA A;  2G8H A;  1RTJ A;  1KFD A;  3AO1 A;  3V81 A;  4KI6 A;  2HVH A;  2EHG A;  3ENB A;  1LWC A;  4BRC A;  1GLB G;  3V1R A;  4GVM A;  3NGI A;  2VG5 A;  3VGL A;  4OPA A;  1YUW A;  3SMS A;  4WQ5 C;  4KKO A;  3TTC A;  4DLE A;  2G8U A;  1NJZ A;  1SS6 A;  4KHS A;  1GLE G;  3G0Z A;  2ASM A;  3NE6 A;  4Y0W A;  3CCM N;  4IFY A;  3N4Q A;  2IS3 A;  4KB0 A;  4JRP A;  4W5R A;  2QWP A;  1NMD A;  2JLE A;  4CZJ A;  4DV7 K;  2E6M A;  3I0S A;  1S9E A;  2Z1G A;  4CEA A;  4MDB A;  1LW0 A;  4MQ3 A;  3KVG A;  5GAD P;  1TYQ B;  4A5A A;  1S1X A;  4FXD A;  1RTH A;  4F3T A;  2VG7 A;  1VSF A;  2Y1I A;  4DR2 K;  3O6W A;  1DKG D;  1NU0 A;  3SMP A;  4GV9 A;  1NBW A;  2YHA A;  4H5R A;  4IFV A;  4JI4 K;  4CHY A;  5CHI A;  4KRF A;  3U9Z A;  3OYK A;  1Q7Y O;  2O4G A;  3MEE A;  2HBL A;  3WXJ A;  3J8A A;  4IG3 A;  3EY1 A;  3ZSX A;  3T1A A;  4I6M B;  3TI0 A;  4DB3 A;  3FZM A;  5J1E A;  5JMV A;  2Q3S A;  3L3V A;  1KD1 O;  4FLX A;  5SZT A;  1Q82 O;  2OA8 A;  1QHT A;  2XHB A;  4JKA A;  3KK7 A;  2XRI A;  4DF8 A;  1GLJ O;  1RT3 A;  3OYF A;  1LAW A;  2F7T A;  1Y97 A;  3DRP A;  1ZBL A;  4FLU A;  4DR4 K;  2UUA K;  4CD1 A;  1BCM A;  3PSI A;  4M41 A;  3VQA A;  2KFN A;  4I9Q A;  3RVC A;  2VGM A;  3OS0 A;  4XH5 A;  1NM1 A;  2IIR A;  1NLV A;  1MA9 B;  3T3F A;  5GIP A;  1QQO A;  3DRR A;  1GLA G;  3E66 A;  2YCH A;  4KPY A;  3IDH A;  2G8F A;  4FK4 A;  4FOE A;  5B8H A;  5HRO A;  4H5V A;  1SKS A;  2Q2R A;  3R8E A;  1VHX A;  5AQX A;  2HHW A;  1S1W A;  1YTU A;  5AQH A;  3IKM A;  4CJP A;  1EXQ A;  5AFU H;  4ILJ A;  5AQI A;  5C2D A;  1NJW A;  2RKI A;  3NH0 A;  3HVR A;  3AVK A;  3HP6 A;  4CZE A;  1BDG A;  1QSY A;  5BN8 A;  4KHQ A;  3MED A;  1XHZ A;  1VQ7 N;  1YJ9 N;  4F3O A;  2IDO A;  1C0M A;  3OYC A;  5M1K A;  3L6Q A;  4B9L A;  3ZSZ A;  4CGD A;  1RDD A;  1JLB A;  5ADX A;  3P38 A;  2NRX A;  2HB5 A;  1BWF O;  2CH5 A;  3OVN A;  4C8L A;  4DR3 K;  1RGI A;  4B9N A;  4JKH A;  1GLC G;  3SUQ A;  3H3O B;  1YTA A;  1NJY A;  4H0X B;  2P9I A;  4PY5 A;  5BRD A;  4E19 A;  1S5J A;  3GG4 A;  4QAG A;  3R9P A;  3GE1 A;  2WTU A;  1C0G A;  2HMP A;  3TAQ A;  4DSK A;  4H5N A;  4Q5V A;  2YKN A;  5FRO A;  2X6N A;  3O1B A;  1NK4 A;  4DV0 K;  3A0I X;  3LP0 A;  3DM2 A;  4CJR A;  1NK0 A;  3OJS A;  2E1Y A;  1XI1 A;  4B1W B;  4IKF A;  3BGR A;  5BRE A;  1L3U A;  1Q86 O;  4PHT X;  4WE1 A;  1IBM K;  4O4G A;  4CJW A;  2OYQ A;  3SLC A;  1XNR K;  5SWM A;  3NVM A;  2HHU A;  3UE5 A;  4LSN A;  4JEP A;  3HOT A;  4F9O A;  2FBY A;  4OJR A;  3C6T A;  3OYG A;  3J7Y P;  4I9L A;  2B4J A;  1KLN A;  4QS8 A;  2PY5 A;  1DTQ A;  5JIC A;  1SQK A;  4FJ7 A;  1WNS A;  3DXM A;  5AQN A;  2IC3 A;  1YVU A;  1K8K A;  2YNH A;  1KC8 O;  4Z4G A;  5C12 A;  1J5O A;  4XIU A;  1TL3 A;  4KRE A;  3VEV A;  3MEC A;  1HUX A;  3O08 A;  3WQU A;  3ZET B;  5KRT A;  1QQC A;  1YT3 A;  2P5O A;  4B1Y B;  2RE2 A;  1VQL N;  3SUN A;  4Z0U A;  1BU6 O;  2WON A;  3HPG A;  3QIP A;  3CC4 N;  2YI1 A;  3OW2 M;  3U8X A;  4JD2 B;  3A5M C;  4OO1 J;  4BVP A;  4H0P A;  3MXI A;  1DEJ A;  4BGB A;  4K8Z A;  4AIL C;  4MDA A;  2A41 A;  1RIL A;  1A5X A;  4CZI A;  3H08 A;  4X62 K;  3F5T A;  1HKB A;  4JLH A;  1BQM A;  2UU9 K;  4FLT A;  2YNI A;  1HX1 A;  4EHT A;  1TV6 A;  4JKF A;  4PKI A;  3JAM O;  3SNN A;  3FFK B;  3ZSY A;  1KVA A;  2YKM A;  1C1C A;  3QEV A;  4CE9 A;  3FZL A;  4DV2 K;  1TUY A;  1JLA A;  2WUS A;  4C8M A;  2GWK A;  5BPN A;  3DJC A;  2W42 A;  5KQ8 A;  3IRX A;  1JCE A;  3F2K A;  4PL8 A;  4LC9 B;  3MN5 A;  3DLH A;  5JS1 A;  2DFE A;  4J8F A;  4W5O A;  4FM1 A;  3CG7 A;  4I2P A;  3QEW A;  3PUF A;  4O0I A;  4DV5 K;  4CZK A;  3NMU A;  1J53 A;  4CHQ A;  1XHX A;  2ZF5 O;  2ETJ A;  1XMQ K;  3T69 A;  3SV4 A;  3ASM A;  1W97 L;  1CXQ A;  4F4K A;  4FZZ A;  4CJT A;  2ITG A;  1U48 A;  1E3M A;  2UUB K;  3ZSW A;  3SJJ A;  1ZBF A;  2NZT A;  1KFS A;  4C1N I;  5J2M A;  3VF2 A;  3QLH A;  3RMA A;  2GV9 A;  2BGG A;  4DV4 K;  4DQQ A;  4FJ5 A;  1VSD A;  3UB5 A;  4RTF D;  4DU1 A;  3OBY A;  1G15 A;  5BPM A;  5CR4 A;  3LM2 A;  2DFH A;  1BL3 A;  1BI4 B;  2FSJ A;  4AF1 A;  3MCP A;  3VQE A;  1WSI A;  2B5J A;  2IVP A;  3MX5 A;  4N41 A;  1DGK N;  4B3S K;  1NWK A;  1E4F T;  4CIE A;  1NGG A;  3D2E A;  3P83 D;  3ZLJ A;  4E1J A;  1NGB A;  1HNI A;  3THW A;  2BTF A;  4DV6 K;  4L8R B;  1NK5 A;  1VQ6 N;  2WFB A;  4BDY A;  1SAZ A;  2E88 A;  2A1R A;  3PY8 A;  1BIZ A;  1XMO K;  4WFN L;  3E9O A;  3VGK A;  3KK3 A;  2CGL A;  3AVH A;  2QA4 N;  2YJE A;  4CZH A;  4Z4E A;  3DLB A;  4A59 A;  3PSF A;  3VEX A;  3LWM A;  1W7A A;  1ZBU A;  4CEF A;  4B9V A;  4CGG A;  4CBW A;  1N8R O;  2HW3 A;  2YJF A;  3MDQ A;  4CK3 A;  3CF5 L;  1WUA A;  3ULE B;  2D5R A;  2E2P A;  4M63 C;  1BOT O;  3HZ6 A;  1NOY A;  3FLC O;  3K58 A;  1Z25 A;  4BRH A;  1FW6 A;  3AA4 A;  3VQD A;  2P9K A;  3C6H A;  4M3X A;  3LP1 A;  5AR0 A;  1QSL A;  3VQP A;  4FWM A;  1RT5 A;  2HST A;  3J7A P;  5C0Y A;  4OGC A;  2Q36 A;  3KZB A;  1TK8 A;  1VSJ A;  2LSN A;  5TKW A;  1WN7 A;  3O9R A;  2X78 A;  4PKH A;  1ATR A;  3VQ4 A;  1GLL O;  4ILG B;  3TAB A;  2E2N A;  1YHQ N;  3G6E N;  3AVF A;  2NRW A;  3SUO A;  3G25 A;  3RRG A;  3HL8 A;  5AZJ B;  5M1F A;  2ZQB A;  2VQE K;  5DMR A;  1P90 A;  5IT9 O;  5D3G A;  4FWK A;  5M1P A;  2VQF K;  2I7P A;  4FZY A;  4FLZ A;  1S6P A;  4LF7 K;  3FZH A;  4CZF A;  4BE1 A;  4B3T K;  3FGU A;  5EU7 A;  4KTQ A;  4IOA L;  3K5O A;  1NGC A;  3VQ6 A;  1WAF A;  1VQN N;  2UXB K;  2VYP A;  3VER A;  3P4I A;  4ELT A;  1EWR A;  3RR7 A;  1SUQ A;  4B9U A;  4LH5 A;  4CEZ A;  1Z6R A;  2P9L A;  4CGH A;  4RWT A;  4IO8 A;  5C10 A;  3MWP A;  2O4I A;  4CZG A;  3VA3 A;  1Q8I A;  4DV1 K;  1OVY A;  3K0S A;  3L2R A;  3CHW A;  1HJO A;  3ZT3 A;  4CJ5 A;  1HMV A;  3AVJ A;  4JKE A;  4CES A;  1M90 O;  1IKW A;  4CZL A;  4QS7 A;  4JKD A;  2YHY A;  2R7Y A;  4DR1 K;  4CZM A;  4CED A;  3MCA B;  4X66 K;  2GX9 A;  2OAN A;  2OPS A;  1RDC A;  3AVB A;  2IAJ A;  1MWM A;  2F9T A;  4NXN K;  3C95 A;  5I42 A;  3DLE A;  3B8A X;  4CJV A;  1LV5 A;  1NK7 A;  4JKG A;  1KLM A;  4OLB A;  1JLQ A;  1X1P A;  5BRH A;  4A57 A;  4ISE A;  5MLC Q;  5EX5 A;  4LF8 K;  4CGI A;  4BRA A;  3THX A;  2D1K A;  3AVM A;  1NGF A;  3K5N A;  5AQU A;  3J80 O;  4ZTJ A;  2QWR A;  4KAZ A;  2Q0R A;  1LWE A;  3ID8 A;  1U2V A;  4YDU A;  4O55 A;  2VGN A;  4CJF A;  2HVI A;  1RT1 A;  4CHP A;  5FRN A;  2FF6 A;  4H5T A;  2P9S B;  4CF2 A;  4CGJ A;  3KK1 A;  1RFQ A;  4FWN A;  4LD0 A;  4FWQ A;  1VQM N;  1HRH A;  4BRI A;  1N34 K;  1D4X A;  3CPE A;  3LAM A;  4G9Z A;  1X9J A;  3WNG A;  1B9F A;  4BRO A;  4KTW A;  4LFA K;  4HTU A;  3TAG A;  2AP1 A;  1KTQ A;  3MWT A;  5LMU K;  1L5U A;  4BWM A;  2B6A A;  2W41 A;  4NCA A;  3FFI A;  1W0H A;  3G71 N;  4YDU C;  3CCE N;  4CJL A;  3OYN A;  1MU2 A;  3T1H K;  1S1T A;  1XC3 A;  5HBM A;  4AHU A;  2BDP A;  3U3G A;  4YOX A;  3OYL A;  4UY8 O;  1J9A A;  1W2B M;  1H1V A;  2ASP A;  5AQW A;  4LF5 K;  4FJN A;  4E89 A;  4V19 S;  4W5N A;  2VWJ A;  4JI5 K;  3LAN A;  1R59 O;  4RCH A;  3DLR A;  4FCY A;  5FLX O;  5LL6 Z;  2E2O A;  3OYE A;  2O8E B;  1Q9X A;  3THY B;  3NF9 A;  3P1G A;  3GOI A;  3HOS A;  3GDQ A;  2ITM A;  3OJU A;  4DTN A;  1VRT A;  2QXL A;  3AO4 A;  2GUP A;  1QQM A;  1HNV A;  4KTZ A;  3SI6 A;  3PO4 A;  1VSL A;  1WB9 A;  2XY5 A;  2YNF A;  3KD1 E;  4CBU A;  3V9S A;  2O8F A;  1LAV A;  4FYD A;  2QWL A;  4E7K A;  3IMX A;  4IDK A;  3D7E O;  4IOC L;  4BC3 A;  2QKK A;  3DOL A;  4CFB A;  1KAX A;  1BIS A;  3LDN A;  5AQZ A;  1HR0 K;  4DQP A;  4EZ6 A;  1U4B A;  1T3V A;  1ZC6 A;  1VQO N;  2Y1J A;  5T7B A;  1J54 A;  1A5V A;  3ZSQ A;  5FPE A;  1GOA A;  1IKV A;  3AV9 A;  4QOZ B;  3NGY A;  1OH5 A;  1S1V A;  3ZT0 A;  1NGD A;  3EKU A;  5TKY A;  1KAY A;  3AGR A;  2HHH K;  4FJG A;  4KHP K;  4X65 K;  3EKS A;  3HTV A;  1C0U A;  2FXU A;  3I0R A;  2O8D B;  3MMV A;  3L2W A;  3CME N;  4M3T A;  4U67 L;  2FBV A;  4CVN E;  3V9W A;  1SZ2 A;  4DMN A;  1OVQ A;  3SZ2 A;  3ZYY X;  4WFB L;  2OZM A;  3AO3 A;  2F9W A;  4BAC A;  4OPH A;  2O8C A;  3DLG A;  4PL7 A;  4KI4 A;  3UKU B;  1HQE A;  4YFU A;  1HNZ K;  3VF6 A;  5AJ3 K;  1N6Q A;  1T44 A;  4KH5 A;  4C1N K;  2DFF A;  3TAN A;  5E84 A;  3A2F A;  4DS5 A;  3QET A;  3P5J A;  1TK5 A;  2GEL A;  1HQU A;  2CGJ A;  4JI7 K;  4FPB A;  1BO5 O;  4BE2 A;  2HBJ A;  3QNN A;  1NG9 A;  3I8B A;  5KI6 A;  4DFJ A;  5CZ1 A;  2HHT A;  3V1Q A;  4FJM A;  2G8W A;  4CF1 A;  3O9U A;  4DCH A;  1QQN A;  1VK0 A;  4OVL A;  2XY6 A;  2DPN A;  1QTM A;  2Z1J A;  3CCS N;  4OX9 K;  5I3U A;  3NGZ A;  1RDA A;  1QHA A;  5JVG L;  3U9D A;  4B3R K;  4I7F A;  1HNW K;  4FO0 A;  1NK9 A;  5GIO A;  5AZJ A;  5LJV A;  4U7B A;  4DFP A;  4BRG A;  1BUP A;  1JXE A;  1KRP A;  4GMJ B;  3HST B;  3CCQ N;  1DTT A;  4FJ8 A;  3HYF A;  1HJR A;  3S3N A;  1U47 A;  1CZA N;  3NVK A;  3BZC A;  1WBD A;  1F21 A;  3ALY A;  2V7Z A;  1NGJ A;  4NLB A;  2E2Q A;  5HRN A;  3TU5 A;  3M1F A;  3F9K A;  3VQQ A;  2YX6 A;  4FVM A;  1VQ4 N;  4LFC K;  4BY9 C;  4PA1 A;  2G8K A;  1CXU A;  4FK0 A;  3F9M A;  3AGK A;  3KWI A;  4BRD A;  1U49 A;  3WNF A;  4JI8 K;  3WXK A;  3MK6 A;  4JI3 K;  4OKE A;  2NUB A;  1HPZ A;  3ID6 A;  4RW4 A;  3WXI A;  3LDQ A;  2PYJ A;  2ZD1 A;  2UXC K;  2V51 B;  2HNY A;  3HXM A;  4DR7 K;  4BDP A;  2P9N B;  2YHX A;  2VCP A;  1J5E K;  4BQZ A;  1TUU A;  1X9S A;  4O44 A;  1YJW N;  4I2Q A;  3QEX A;  3U3Y A;  4FJJ A;  1HPM A;  3VTI A;  4BR2 A;  3ENH A;  4EZ9 A;  5JLF A;  2YNG A;  3R6M A;  1VSI A;  4DU3 A;  1TKZ A;  3HPO A;  3OYD A;  3C7N B;  2FSN A;  4DTP A;  1U45 A;  3NF6 A;  2G8I A;  1FK9 A;  2H3G X;  3HPH A;  4X64 K;  1N33 K;  1WBB A;  1IKY A;  3NAE A;  2HNZ A;  2UXD K;  3LL3 A;  1UA0 A;  3M5R A;  1TL1 A;  2QW9 A;  4GKJ K;  4IG0 A;  3CFR A;  1L3T A;  1ATS A;  1S3X A;  4CHZ A;  3LP2 A;  1C6V A;  4PQU A;  3LP3 A;  1BG3 A;  2F4V K;  3D6R A;  3ITH A;  3P39 A;  1HYZ A;  4Q0B A;  2F8T A;  1RT4 A;  5H1S Q;  1V4T A;  2Z1H A;  3AAR A;  4B3M K;  4AHR A;  3O1W A;  4K43 A;  3LPU A;  2KTQ A;  4O0J A;  3ZEU B;  2P9S A;  1SKW A;  3C0B A;  1HKG A;  2HF4 A;  4N5S A;  3PO5 A;  3NHG A;  4RW7 A;  4FJK A;  2O8B B;  1BHL A;  1RT2 A;  4M42 A;  3WEE A;  4DSF A;  1RNH A;  2BUP A;  3T7Z A;  4DLG A;  1RT6 A;  3DXK A;  4YOT A;  4DQI A;  3HO1 A;  4B1U B;  2HF3 A;  3LZJ A;  4B08 A;  3L2Q A;  2NNW A;  4FWS A;  3SBT A;  4YOY A;  1RDW X;  5EOY A;  2A5X A;  3HK2 A;  4BDZ A;  4FM2 A;  3KHY A; 
#chains in the Genus database with same CATH homology
 2UUB K;  4JI8 K;  1N34 K;  3OTO K;  4JYA K;  2VQE K;  1IBM K;  4JI3 K;  1XNR K;  4JI2 K;  4LFA K;  5IT9 O;  1XNQ K;  2UXC K;  2VQF K;  4DR7 K;  4DV4 K;  4CW7 B;  5A2Q O;  2HHH K;  4KHP K;  4X65 K;  3J7Y P;  1J5E K;  3T1Y K;  4DR4 K;  2UUA K;  4LF7 K;  5LMU K;  4B3T K;  5BR8 K;  1IBK K;  4GKK K;  4DR6 K;  4CVN E;  4B3S K;  3T1H K;  2UXB K;  4JV5 K;  1N36 K;  4LF5 K;  4DV6 K;  4V19 S;  1HNZ K;  4JI6 K;  5AJ3 K;  4X64 K;  4JI5 K;  4YHH K;  1N33 K;  4DV1 K;  4LF9 K;  2UXD K;  1XMO K;  5FLX O;  4DUY K;  4JI0 K;  1I94 K;  1HNX K;  5LL6 Z;  4GKJ K;  4DUZ K;  2E5L K;  4JI7 K;  1N32 K;  4DR1 K;  4DV7 K;  4LF6 K;  4LFB K;  4X66 K;  4X62 K;  2F4V K;  2UU9 K;  1IBL K;  4NXN K;  5IWA K;  4JI1 K;  3JAM O;  5LMN K;  4B3M K;  4OX9 K;  4LF4 K;  1FJG K;  2UUC K;  4DV2 K;  4K0K K;  4DR2 K;  4B3R K;  4DR3 K;  1HNW K;  4LF8 K;  4JI4 K;  3J81 O;  4YY3 K;  4DR5 K;  3J80 O;  3J7A P;  1HR0 K;  4DV5 K;  4DV3 K;  1XMQ K;  4DV0 K;  4LFC K;  4AQY K;  2ZM6 K;  4NXM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...