4X64K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4x64K00
5A2QO 4DR4K 4LF6K 4DR5K 5IT9O 4LF4K 1IBKK 4K0KK 4DUYK 5LMUK 2UUAK 4LFCK 4JI7K 4CW7B 4X62K 4LF8K 4DR1K 1HNXK 4YY3K 1N32K 4DV3K 3T1HK 1J5EK 4JV5K 2HHHK 4NXMK 4YHHK 4JI0K 1HR0K 2UXBK 4NXNK 2F4VK 1N33K 5LL6Z 3OTOK 1HNZK 4B3RK 1HNWK 4JI1K 2E5LK 3J80O 2UU9K 2VQFK 4GKKK 1XMQK 4LFAK 1FJGK 4DV4K 4X64K 3T1YK 4DV7K 4GKJK 4DV5K 4JYAK 4B3MK 2UXDK 4X65K 4AQYK 4DR7K 5IWAK 4JI4K 4LF7K 1XMOK 1N36K 2UUBK 4JI2K 5BR8K 2ZM6K 2VQEK 2UUCK 1XNRK 4X66K 4CVNE 3J81O 4LF5K 1N34K 1IBMK 3J7AP 5AJ3K 3J7YP 5FLXO 4JI5K 4DV2K 4DV6K 4DR3K 1I94K 4JI3K 5LMNK 1IBLK 4B3TK 4DR6K 2UXCK 4LF9K 4DV0K 4JI6K 4OX9K 4DV1K 4DUZK 4DR2K 4LFBK 4V19S 4B3SK 1XNQK 3JAMO 4JI8K 4KHPK
chains in the Genus database with same CATH superfamily
4CBXA 1JL1A 4ILGB 1IO2A 4BDZA 1EP4A 2NNWA 3MDQA 5IT9O 2W40A 3O9QA 5I3UA 2JWLA 3AO4A 4DUYK 1K73O 2D0AA 1Q82O 3HL8A 3O9RA 3SBTA 4CD1A 4DR1K 3SPZA 1TAQA 3HBTA 3ZSVA 3L4QA 5JVHL 2NRVA 1X3MA 2OANA 3QNOA 4FPAA 1S3XA 2ZJPL 4CEQA 1VQ5N 3I8DA 3AVGA 3MN7A 2OPRA 4FJGA 3TANA 1VQ8N 3RMAA 3AVKA 1WSHA 2P9SA 5AQNA 1J53A 3QBXA 4JNEA 3AO3A 1HLUA 2QWQA 3TSQA 4C8MA 1RILA 4DV7K 4DV5K 2BDPA 3ZT4A 1E3MA 1TL3A 1NKCA 2UXDK 1DT9A 4OGEA 4N41A 1Q9XA 2X74A 3IUCA 4FWKA 1YTAA 1KVBA 1WNSA 3VEYA 4CJTA 4RTFD 2HHUA 3LP0A 1J9AA 1TKTA 3ZT3A 3AVJA 4Z4IA 1TYQA 2RHKA 5AQIA 3THXB 3H3NO 1YI2N 1REVA 2P9KB 3OA9A 5AQPA 3LZJA 3O9TA 3SAFA 2G8IA 1NK6A 5JS1A 2E2NA 2WTUA 1X1PA 4RG8A 1X9WA 3C94A 4IO8A 4LH4A 3F2KA 1IBLK 1RDCA 3F9MA 3OYCA 4B1VA 3B6OA 3HK2A 1NGGA 4CK3A 1Z25A 1TKXA 2X6NA 5KGXA 1SL2A 2IAJA 3CYMA 1NOZA 2ETJA 4DFMA 4FWPA 1RDAA 4BWMA 4FM2A 2GEMA 4WYBA 3VQ6A 2D0CA 4R79A 1RBTA 4ELVA 1FXXA 2RE2A 5A2QO 3CM5A 3V4IA 2F8TA 1LCUA 3K2PA 5C25A 1S5JA 3VA3A 3QICA 2UUAK 1KAYA 3ZSRA 2NRZA 4CJSA 1RCHA 4JKGA 4CJKA 3RTVA 5M1KA 4CGHA 2QI2A 3UKRB 5DM7L 4DSEA 2PBDA 4Z4HA 3SV3A 4BR9A 1NU0A 4FLUA 1NM1A 3OYEA 1Q18A 2XY5A 3SZ2A 2O8CB 1RT4A 4KRFA 1HQUA 2IGIA 5AQQA 1RTJA 4QS7A 2F96A 4RW7A 2QTDA 3HSCA 4YOTA 4Z4EA 1U4BA 5EY4A 3TSUA 5KQ8A 1IG9A 3QBWA 5F0XA 4DTRA 4GKKK 2WFBA 5M1PA 4RW6A 3IDHA 4FOEA 1Z05A 2O8CA 3DI6A 5HLFA 3FZLA 4C8KA 1HJRA 1VHXA 4DFJA 3ID6A 3WNHA 4CEFA 2O8FB 3DLEA 1NGAA 4Z4CA 3SLCA 5CHIA 1KSPA 4HTUA 3QFUA 2H3GX 2AA4A 2VG5A 3VQ4A 1SZ2A 4CIGA 3AVLA 3LL3A 1WSFA 3V9UA 4Y1CA 3TAGA 5KRTA 3C6UA 3DLRA 3MN9A 2XY6A 4FWLA 3K59A 4AILC 3OYIA 3LZIA 1NK0A 2F7TA 3RMBA 3WNFA 3WXJA 4CZEA 4K43A 3CF5L 2ZGYA 1NGJA 5BN9A 4NCBA 4E1MA 4AH9A 4BGBA 3MECA 1NJZA 4G1QA 4JKFA 1MU2A 2P9IB 3HVRA 1RTDA 1SV5A 1MWKA 4LF9K 4YNQA 2W42A 5E26A 3GOIA 3SAGA 1QQNA 1NGIA 4LFBK 2O8EA 4DSFA 1T05A 5JVGL 2UYTA 3ALYA 5AQGA 1YUWA 1YXQA 1RT2A 4CZLA 4KHPK 3O3FA 2B6AA 2D1KA 5GIPA 4DFKA 1TKDA 3IG1A 3NBPA 4FWNA 4IXCA 2P9NA 3D2EA 1W2BM 4RW4A 1RT6A 1L3UA 4LFCK 2QWPA 5J1EA 3SAHA 4BR5A 3P39A 1C6VA 3CD6N 3AVAA 2NRHA 3CJBA 2HBLA 4ID5A 4RWTA 3IKMA 3FR0A 3CG7A 5KI6A 2VWKA 3NGYA 4FLWA 3VQ9A 3H1QA 3EZWA 1EKEA 2F4VK 2PYLA 1EWRA 3K5MA 2CGKA 3V6DA 4H03B 4JAXA 3KLFA 3DOKA 2Q3SA 3L0QA 4DF8A 4Y1DA 4LY7A 1HNWK 3RR8A 4LSLA 3ZSQA 4BDYA 2NRWA 4CEDA 4FJ9A 3M8SA 3QESA 2DFHA 3NF6A 4E1JA 3A5NC 4CFAA 4CZGA 4YOXA 4DQIA 3E9LA 3EY1A 3EEQA 5AR0A 4JKDA 5CZ2A 3AA2A 3NFAA 1BL3A 4OGCA 3CETA 3R6MA 4PY5A 2YNGA 3BP8A 4MLEA 3CHWA 2WONA 4MQ3A 1C0UA 3J7ZO 1WBDA 4CECA 1WOQA 4DV2K 4MDAA 4LH5A 4PL7A 1KQSM 4B1ZA 1GOCA 4OLBA 3K58A 4IZ9A 3CJCA 2QK9A 4BR0A 3C6AA 1T8EA 4OPAA 4UY8O 1TKZA 3TAMA 3FLCO 1T7PA 1JL2A 1TUUA 3MCPA 4FXDA 4L8RB 1QTMA 5TKWA 1UA1A 2VWBA 3IAYA 1BIZA 3PY8A 2G8HA 3KIOA 3MXIA 3IS9A 3K5OA 3WQTA 3VQAA 1HYZA 4IOAL 2B5JA 4KI4A 1Z6RA 3OJSA 4JI7K 3JYTA 4LF8K 4PKIA 1VSKA 4I9LA 4EZ6A 1QSSA 3MX5A 3V9SA 5HRRA 4R5PA 1VSFA 4KV8A 1NOYA 3C6HA 4CHYA 2ZQBA 2HHHK 3TARA 4CGGA 1X3NA 2GELA 3CFRA 3VQCA 4BGAA 3OS0A 4CZHA 2VGNA 5LL6Z 3WXLA 3D6RA 4PKGA 2FBXA 4NYFA 3M8QA 4H0YB 3KKRA 1T44A 2P1JA 3VEZA 1J5OA 3HVTA 4M3RA 1O13A 4DF4A 1J6ZA 2E6MA 3VERA 5C42A 3V9XA 1ZBIA 2HHTA 3K5NA 4MFBA 2XY7A 4H5RA 3A2FA 1BGXT 1B9FA 4DQRA 5K14A 4FJIA 4FJXA 3UB5A 3LAKA 4AHSA 3K0SA 1QVGM 5GAGP 2CGLA 3KLGA 3VQ5A 1VQ6N 2HB5A 3P83D 4A59A 3VQBA 3O4WA 1BCOA 5AQRA 1I3AA 2HHQA 1GOBA 5M1QA 4M3ZA 3OYDA 1WBBA 4E0DA 2QWLA 5E84A 1A5VA 1XHZA 5CY4A 3OS1A 3O9UA 1DEJA 3GG4A 4JD2A 5C15A 4ZTFA 4O44A 3CCVN 1BI4B 2P9PA 3O3GA 4E1NA 4HUGA 3NVMA 4B9LA 3SUPA 1VQ9N 2AP1A 5SZTA 3TTCA 3JAMO 4EIAA 4N5SA 4JI8K 3SQ0A 4FZXC 1Y64A 3RR7A 4QS9A 4CJ7A 1DLOA 2F8SA 3VF4A 1EQYA 4DR5K 4DQ8A 4ILJA 2Q0UA 3UKUB 5AQWA 3PSIA 4B9NA 5KRSA 1GLFO 4ZHRA 4CW7B 1SKRA 4HUFA 4E7JA 4FLYA 4DTPA 3T69A 4DTOA 1VQ4N 3A5OC 3ULEB 1IG8A 1JLGA 3UKUA 1KVAA 4PWDA 1RFQA 3TTFA 1HR0K 3PSFA 2IDOA 4ELUA 3HI0A 4JLHA 4CHNA 1L5UA 1EXQA 3SUNA 2GWJA 4J2DA 4B1YB 1U04A 3P31A 4IEEA 4BDPA 1VSLA 3SK3A 4BROA 3S3MA 4FWOA 1QQCA 1R0AA 4BC2A 1ATNA 3MN5A 4KB0A 1JLAA 3T1YK 3QNNA 4IBNA 3OJUA 2QM1A 4CJRA 4CHQA 4RW8A 1ZBLA 5IWAK 3L6QA 1YF5L 4GVMA 4JKEA 2UUBK 2FF3B 1Q8IA 1VQ7N 1I39A 3QIOA 2BGGA 1IV0A 5M1OA 2VQEK 4A2AA 1A5WA 3KK1A 1IKYA 1HYSA 3U8XA 3SV4A 1KRPA 4JRQA 1KD1O 3EYZA 4BR7A 4WF9L 4JK8A 4CIEA 3I55N 4H4MA 1BUPA 3JS6A 3VQ7A 1SQKA 2YHAA 4GW6A 2X6SA 4OKEA 4K42A 3F5TA 1LWEA 2KHOA 3SMPA 4V19S 1KTQA 1RGIA 2HOEA 4IDKA 3DXMB 5J2QA 3CCLN 3TAPA 5GAEP 4ISGA 4CFDA 4IG3A 3QEPA 1WSJA 1U2VA 2A42A 2JWKA 4H5TA 1QZ5A 4BRQA 4H8KA 4B08A 2PZSA 3AAPA 3CCEN 3SMSA 1B9DA 1RBUA 3DXMA 4Z4FA 3SJHA 2ZJQL 4FOIA 3U6FA 4FZYA 1NJWA 3FGUA 3ZSXA 3WEEA 1BQMA 2E8AA 1JCEA 1NK8A 5BN8A 4CGIA 4B8CA 3O8MA 4DFPA 2R7YA 4KAZA 5J2NA 3FFKB 2VGMA 4BG9A 1NGBA 3D0PA 3LDOA 3ZSOA 2O4GA 4CESA 1LWCA 3NH1A 4KBOA 4WFBL 1WN7A 1H1VA 4DTMA 2PFUA 4N56A 4JI1K 5F1XA 4NCAA 4IOXA 2P9SB 4JK7A 3ENHA 1MWMA 1FJGK 3H08A 2YKNA 3TU5A 2HSTA 2GV9A 2O8BA 3AVBA 1QZ6A 4DR7K 2Z1IA 1ASWA 4CEAA 3EL2A 4E7KA 5JLFA 1MDUB 2ZM6K 4BRLA 4B8AB 3EE8A 1RTIA 1C0MA 4FLVA 3BUZB 3HP9A 3BDPA 1ZC6A 4X66K 4ICLA 4AHRA 3L2RA 3CC2N 3FZKA 1OVYA 3DM2A 1TYQB 3J7YP 3ZT1A 4FWQA 1CZBA 1HKCA 1BWFO 4O0IA 4CEEA 3VOVA 5BR9A 1NJIO 3SQ4A 4FJLA 5AQJA 4JI3K 2BH1A 1BDGA 1V4TA 1U6ZA 5C12A 4F9OA 3CQ8A 1JCFA 2PY5A 4DV0K 1VQPN 4M7XA 4OX9K 3H6EA 4KHYA 4FJ7A 1RT7A 1ZBFA 3LPUA 4J2AA 2OTJN 3VENA 1S1XA 1SS6A 3DRPA 2G8VA 4FJ8A 4WE1A 3K5LA 2NRRA 4BQZA 4CIFA 3VGLA 2W6LA 3L2WA 3CCUN 1K6YA 1NLVA 1D5AA 3QDKA 1QVFM 4FJMA 1ESVA 4JS5A 1Q9YA 2HNYA 2HW3A 1HNIA 1IH7A 2HHXA 3O9SA 3HOSA 4O8KA 1NK4A 1GOAA 1HNXK 4XH5A 2JLEA 4HVJA 1NWKA 5F2RA 3NVKA 5ELZA 2Q1NA 4JKGB 3W0LA 4JKCA 4YOYA 3CMEN 1U45A 3ULDA 3ZSYA 4N47A 4NXNK 4CF2A 3EO3A 3O1WA 3F73A 1RBRA 3A5MC 4B3RK 4A2BA 2EWSA 2HMPA 1W97L 4EFHA 3D2FA 3THWB 3HTVA 3VEXA 2QKBA 3OYKA 1QQOA 4NLBA 3DAWA 4E19A 5HOOA 1M1KO 3Q7BA 3QETA 4KH6A 1RDWX 1NK7A 4M3WA 3KTQA 2KKZA 3B6PA 4CJLA 3KKSA 2EHGA 4CBWA 2QXLA 3BZKA 4OJRA 5BRHA 3O6WA 3THWA 1VQON 1NMDA 1XNRK 3OW2M 5AQTA 4DSJA 3VGMA 4DKWA 3K9KA 3J7AP 5AJ3K 1HMVA 2I7NA 4BRMA 3JSMA 1S6QA 5AZIA 3R8EA 1ITGA 1CXUA 4C1NI 4H5VA 4CZMA 1ZYQA 3QEXA 1HKBA 3CM6A 2ZGZA 4FVUA 2NUBA 1NGHA 3WXMB 3RSEA 5AQVA 4DUZK 2G8KA 3L3VA 2J4RA 2RPIA 1HPZA 3LPTA 3CJ7A 5DM6L 3N4QA 2O8EB 3CC7N 3NF7A 2O4IA 2KQ2A 5LJVA 2IIRA 3NGIA 3EKSA 4LF6K 3VESA 4FJNA 4CJVA 5C2FA 3HO1A 4B9UA 4YDUA 2FBVA 1TK8A 3WXKA 4FLZA 1BOTO 1S1VA 3RRHA 2OZMA 4ILHA 2KFNA 3O4QA 1LAVA 4FW2A 1RT1A 1TUYA 2P9NB 3D2EB 4DTJA 3FE1A 3ZT0A 5AZJA 4JEPA 3LWMA 1TK0A 4MDBA 4J2EA 4B1UB 3M1FA 3LDQA 3LDSA 2UXBK 2NLXA 1S72N 3AO1A 2PYJA 1NGFA 4BREA 4DQQA 1VSEA 3C0BA 2KZMA 1S9EA 4H0VB 3TAFA 3F9KA 5LY3A 4KH5A 3ZEUA 1BISA 1XMQK 4AHCA 3KK3A 1OH7A 4KO0A 2HBJA 2I7PA 4B3MK 4OPKA 4X65K 4OLAA 4A62A 2F9TA 1IKWA 4B1WB 4PUOA 1XC3A 5AQSA 3TWHA 3PX4A 4Z94A 4FJJA 3TAEA 3QMLA 2ZJRL 4I2PA 3U9ZA 4WCEL 3V1QA 3ZETA 5BPMA 3ZSZA 4UQGA 4LF5K 3CMAN 3ZX2A 4BWJA 1KFSA 1T6DA 3HPOA 3NCIA 2HVIA 4ELTA 5FPDA 4B9MA 3NAEA 3NE6A 4YDUC 4M3XA 4AF1A 5AQKA 5T7BA 1HPMA 4A5AA 4FK2A 3BF3A 1KXPA 3DMJA 3G10A 5LMNK 4IO9L 2HBMA 2DPNA 3MCAB 3LM2A 5AQUA 4CK1A 3THVA 1LAWA 4B9TA 4A61A 5AQXA 3ATUA 4B3SK 3I0RA 4F3OA 4DWIA 3TSPA 1HRHA 4YOWA 5AQYA 4BRPA 3LALA 4BG8A 3AAQA 3VQDA 4FWSA 4O8UA 5KPTA 4ZTJA 1OH8A 2IVNA 1OKJA 1BIUA 2QWOA 1QHAA 4O5BA 3NHGA 2FSJA 4IWVA 3ZCMA 4LF4K 1BHLA 1T03A 2P5GA 1IBKK 1FKPA 4A57A 2VCPA 4CJFA 5LMUK 3MEGA 4FSVA 3RWUA 1GLJO 3K9JA 3SYZA 2YJFA 3WT0A 1TGOA 5FDLA 4OO1J 4F8RA 4C8NA 4AHTA 4MO5A 3QERA 3LP2A 3TI0A 2DY4A 2P9UA 1HQEA 4JV5K 3T1AA 1NG9A 4NXMK 4F3TA 2E2PA 2BE2A 3VN5A 3WQUA 2HHWA 1QSYA 4EHTA 4W5NA 3VEOA 1HNVA 5J2PA 4B9VA 5GINA 4LFAK 4FLXA 1HX1A 4X64K 3LWLA 3QB0A 4DCHA 1S22A 3H1VX 3T7ZA 5FROA 2YV0X 4CF8A 1NJYA 1X9MA 3SJJA 3IMXA 3OHRA 1GLBG 3A5LC 3CI5A 2GUIA 2I5JA 2NRXA 1GLEG 3KZBA 2G8UA 1MA9B 2HBKA 2YHYA 2FC0A 2V7ZA 5BRDA 3KLHA 3VETA 4CBUA 3LDNA 1VRTA 1RTHA 2DFEA 3J8AA 3EN9A 3KD1E 1JLCA 5JLHA 4W5TA 3IFRA 4M7YA 4B3TK 1EETA 3MWTA 3G4SN 3RMCA 1FW6A 3NDKA 5JS2A 4BRIA 1YT3A 4DR2K 3T3FA 2A40A 2RF2A 2YI1A 4M42A 1SKSA 4JD2B 4NCGA 2A5XA 3CJ9A 1RBVA 2P9PB 4LD0A 3ZLJA 4IFVA 3CC4N 3DOLA 4W5OA 3CCSN 1JKHA 2WC9A 4E7LA 3I33A 5EU7A 4OPJA 4CGDA 1T6CA 2WOMA 2ZE2A 3VF2A 1LV5A 4QCLA 2GTDA 1XI1A 3CFPA 4I2QA 3H45C 1N32K 4YOVA 1D9DA 4W5RA 4DV3K 2OTLN 4KTWA 5M1NA 3OYHA 1KC8O 4HTLA 3CIPA 2V7YA 4M63C 2YHWA 3CPWM 1QSLA 4RW9A 4JKHA 3OTOK 2YNIA 4QAGA 3ZX0A 3C65A 3PUFA 2VYPA 3ITHA 4NB4A 3AO5A 3L2UA 3G0ZA 2QA4N 4HWIA 4DTSA 3KD5E 2JGUA 3N4PA 1BA0A 3VEWA 4C8OA 1XUPO 4LF7K 4DQPA 2LSNA 4DG1A 1EX4A 3QLHA 4B9QA 4BE1A 3PV8A 4JI2K 2WUSA 2OYQA 2KFZA 1N6QA 3SBGA 4Z4GA 3LAMA 2P9LA 3UE5A 4JKBA 2Q2RA 3GDQA 3MK6A 4WQ5A 4CHZA 1YJNN 4OVLA 4CF9A 3QFPA 1VRUA 5AFUA 3T19A 4BC4A 3NH0A 1WUAA 1I94K 4K25A 3HP6A 3SPYA 3AARA 4Y0WA 5CYQA 4F2RA 2YNFA 1IKVA 4DV1K 3DRRA 4CI6A 2VG7A 1K8KA 4NLCA 1RBSA 4DSKA 2V52B 4FVMA 3MN6A 3A8YA 2ZF5O 2Q36A 5CYMA 4BACA 3CCJN 4GNIA 5JMVA 3G71N 4CJEA 4DQSA 2FF6A 4KTZA 1NBWA 4CD3A 4B1XB 4E7HA 1VQNN 1DTTA 4HHTA 1U2VB 1YVUA 3HPHA 2WBNA 4O5FA 3HZ6A 3HJFA 3THYA 3IRXA 1UA0A 1R59O 4DLGA 3VQQA 2QWMA 4FLTA 3SNNA 1VSMA 3TR8A 1KFDA 3S3NA 3T1HK 4K8XA 3WEEB 4BC5A 4CF1A 3VA0A 2W6KA 3WNGA 4CJWA 3DJCA 3QEWA 3DRSA 3WNEA 3M6GA 3AY9A 5C2DA 5AFUH 3V1RA 5TKYA 1N33K 5FPEA 1M90O 1HKGA 1CLQA 4ISEA 2Z1JA 1LOTB 1KAXA 1TAUA 3U3YA 5HRNA 4WQ5C 1P90A 4BRNA 5H1SQ 3S41A 1QQMA 3OBWA 4DV4K 1KAZA 4W5QA 3WUHA 1NKBA 1NNEA 4DMNA 1SUQA 1E4FT 1QS4A 4JHDA 5BRFA 2IVOA 4KHNA 2W41A 4H0OA 3O1BA 4JI4K 5J2MA 4CZIA 2A6AA 2O8BB 4E89A 4FL9A 4BRHA 3DXKB 4C23A 3E66A 4CJ5A 3C95A 1RT5A 4H5WA 3J81O 2XO7A 4PQUA 2AJQA 4KHQA 4IEIA 1N5YA 3FZFA 3BEXA 5DMRA 4NO7A 4E7IA 3TABA 3V9ZA 2HF4A 4GV6A 1HYVA 3I56N 1B92A 4M45A 5ADXA 3FFIA 3DXKA 2NRTA 3CCRN 4CGFA 1XHXA 1O1WA 1FK9A 2RKIA 1Q7YO 4OKJA 3QO9A 5AQZA 2D4WA 3MAQA 4Z0UA 2ZWHA 4OKKA 4FW1A 1ILYA 3LANA 2B4JA 3LDPA 3VQEA 1Y97A 1IJJA 2D0BA 2ZD1A 1W9HA 4U67L 1RT3A 3MEDA 2OPQA 3PO5A 4M3TA 4I7FA 3B8AX 1JXEA 1BA1A 3HSTB 4LC9B 3G6EN 1E4GT 3E9PA 3OBYA 4RCHA 4BE0A 1BQNA 4DU1A 1JLFA 1WAFA 4CE9A 4EAHD 3O5BA 3O80A 1RNHA 4PL8A 2A3ZA 1IKXA 1ATSA 4WFAL 4FM0A 5ADXH 1L3VA 1BG3A 1VSHA 4J2BA 1S9GA 3MEEA 1VQMN 5FRNA 3J80O 1SL0A 4KHUA 2UU9K 3ASMA 4BRAA 3UIQA 3S3OA 3D2FB 5CE3A 3L3UA 1YVNA 2VG6A 4MLHA 2G8FA 3OYFA 1C0TA 3AGRA 1C1AA 2HF3A 3THXA 4KH4A 4NYNA 4PKHA 2P9KA 3W3DA 4BRDA 4CFBA 3M3ZA 3TAQA 3PLAA 4Q0BA 2IVPA 3PX6A 3NF8A 1X9JA 1U49A 3FZMA 1N34K 1IBMK 3LDLA 3I8BA 4YFUA 4KI6A 3DLGA 1KLNA 3FZHA 4DR3K 3WXIA 1ASUA 1GLLO 5AZIB 1WAJA 4CF0A 4AM7A 1U48A 1LW2A 3ZYYX 2UXCK 1KLMA 3RMDA 2D0OA 2E2OA 3DLKA 1GLDG 2CGJA 4KREA 3RSEB 3HM9A 1QHTA 1V4SA 1EO1A 4DR4K 3TTDA 3CQXA 3MMVA 4IDHA 3U3GA 2E2QA 1NGEA 3VTHA 3QEIA 1G15A 4DSLA 3UKRA 2KZZA 2HNDA 4K0KK 4IFEA 1VAZA 1ZBSA 2HNZA 3VMFB 2FBTA 3PIOL 3AVNA 1N8RO 4BY9C 1TV6A 1UAXA 3PIPL 1UWBA 3LM9A 4BRKA 5HP1A 4KB1A 3OYAA 5KGWA 4Q5VA 3EZ5A 3CXCM 3DLHA 2IS3A 5AQOA 3V1OA 3V81A 3LP3A 5AZJB 4A5BA 4C8LA 4O55A 5GAHP 2P51A 3R3LA 4KFBA 2F9WA 4XH4A 2O8DB 4M41A 2GX9A 2Q97A 4CJQA 4U7BA 3SI6A 4KKOA 5LJWA 1K9MO 4DSIA 2Q0RA 3P4IA 2VQFK 3ISNC 1GLAG 2O8FA 2OA8A 2KW4A 1YIJN 2Z1HA 3R9PA 1OH5A 4BR2A 4CEBA 3ZEUB 4CK2A 3HYFA 2ATQA 1RDDA 1XC9A 3L2VA 5D3GA 1XMOK 2O8DA 2FXUA 3AGKA 2HVHA 1T3VA 3AVMA 4J8FA 5KTQA 4AHUA 4CHPA 5M1FA 2OZSA 4DB3A 3EKUA 1GLCG 4JKAA 4MO4A 1VK0A 1S1TA 4B9SA 4XEIA 2DTUA 1VSDA 4H4OA 1NGCA 1VSJA 4CVNE 3OYJA 1W7AA 3DWLA 3AVIA 4FPBA 5KQDA 1YHQN 3AVCA 3HXMA 5FLXO 3U9DA 3ZETB 2OPPA 3GE1A 3DYAA 2P9IA 4DV6K 4CZKA 4HCCA 4FYDA 3KK2A 2D0PA 1FKOA 3OYGA 4CCHA 2GUPA 1JLEA 4BVPA 1YJ9N 3I0SA 1XQSC 2ASPA 4CGJA 2BTFA 1ASVA 4KTQA 5HRSA 3H46O 4F4KA 4WQ4A 3R1XA 1C1BA 2VWJA 3VEVA 2YHBA 4HCBA 4KHSA 4F2SA 4CERA 1JLBA 4FK4A 5KPRA 5FRMA 2RN2A 3D45A 2QXFA 3AA5X 2CH5A 1NJXA 4X62K 4IJAA 3ENBA 1JCGA 2FBYA 3ENOA 4CJ3A 3OYBA 3KHYA 3VPZA 1F21A 3E1YA 4XIUA 4FCYA 4FZZA 1J5EK 3AA3A 2D5RA 1C1CA 4EP4A 4BE2A 5BPNA 2E6LA 2P5OA 4EHUA 4KHWA 4EZ9A 2P9UB 3E01A 5FPMA 1J54A 3RVCA 1HNZK 4JN4A 3KLIA 3NF9A 3MXMA 4YORA 4IFYA 4DLEA 1L3SA 2E5LK 4ID1A 1D4XA 3ZSWA 4BVOA 5EOYA 5C10A 4QOZB 4L3QA 5HL7L 4BRCA 2A1RA 1SKWA 4GKJK 4JYAK 3OYNA 4YOUA 1XWLA 4LSNA 4AQYK 2E1ZA 1SAZA 1Z26A 2E20A 4GY2B 4JS4A 4IG0A 3JXUA 1RDBA 1JLQA 1VSIA 5C0YA 1ZBHA 5I9EB 1D8YA 3OY9A 1G99A 2YX6A 3HRGA 5CR4A 4WQ4C 1X9SA 5BPLA 1Q86O 3KVGA 4AM6A 2Y1JA 4EP5A 4GV9A 3S9HA 1WB9A 4G9ZA 4PHTX 1S1UA 1WSIA 3OYMA 1WSEA 2ITGA 3AVHA 3SCXA 2QEXN 3BY5A 2FSNA 1LWFA 1YTUA 4FJHA 1OVQA 5BREA 4JI6K 2X78A 3G25A 4O0JA 4XH1A 4FO0A 1SL1A 3CERA 3TPQA 5I42A 2BANA 4IJNA 3KLEA 1HUXA 1RDUA 4FWMA 1JJ2M 4JRPA 1S6PA 1BO5O 3CCMN 5EX5A 3AVFA 1NMNA 1OH6A 2KLAA 3AV9A 3OS2A 3CJAA 4CJUA 3BF1A 3NGZA 3MXJA 3M5RA 1TL1A 3VTIA 3CQYA 1BCMA 1YITN 1U47A 4K41A 4TSXA 3Q7CA 1K8AO 3P1GA 1NKEA 3MX2A 4QS8A 4DS5A 4GVEA 1DTQA 3KWGA 4YHHK 1C0FA 3CPEA 4CEOA 1CXQA 4CEZA 3A0IX 3KK7A 4DU4A 4FJ5A 2E4LA 3QEVA 4CZJA 3HT3A 1VQLN 1WSGA 3P38A 1BU6O 4N76A 2A1SA 3NH2A 4WFNL 1ZBUA 2GBZA 2Y1IA 2ITMA 3M8RA 1DKGD 4BC3A 3K57A 4H0XB 3NMUA 4FWRA 4K8ZA 1NGDA 5DK5A 4DU3A 3MWPA 4DTNA 1N36K 4I6MB 5BR8K 3C6TA 5EVZA 2FLOA 3DLLL 3CJ1A 2UUCK 3L8BA 2OPSA 3P5JA 3ZX3A 4C1NK 4KPYA 4ISFA 3GBTA 4O4GA 3V9WA 2P9LB 5E41A 1C0GA 4CJPA 5CZ1A 4I6MA 1TK5A 4IKFA 1CZ9A 1QE1A 4FK0A 3M8PA 5AQFA 5C24A 1BI4A 1JXBA 4JK9A 3O3HA 4DR6K 2ASOA 2XY8A 2QW9A 3OYLA 3ID8A 2E1YA 4M3UA 2KTQA 3SQ2A 3SUOA 4AHVA 3DLBA 1UOCA 2NZTA 2G8WA 3ATVA 4CJ4A 3C7NB 3O4NA 3AO2A 4DHYA 2OCEA 3L2QA 1K8KB 3QIPA 4PA1A 2EX3A 4BR4A 1ATRA 4H0TB 5SWMA 5JICA 4BQLA 1WLJA 3KWIA 1CZAN 4DTUA 4GMJB 4HUEA 1EWQA 3VF6A 4H0PA 3C7NA 3H3OB 3ULEA 4YY3K 5GIOA 5AQLA 3HM8A 5MLCQ 3CCQN 3OVNA 2V51B 2Z1GA 2IC3A 1ZXOA 2QWNA 3THYB 3ZT2A 2DFFA 3O08A 2HHSA 3U4LA 5HBMA 3SQ1A 5AQHA 4JI0K 4M3YA 1DGKN 2XHBA 4CHOA 5GADP 3SUQA 5HROA 2XRIA 1P8ZA 2YKMA 2PAVA 1A5XA 3GL1A 4IOCL 2IOCA 4OPHA 4H5NA 5EXWA 3PX0A 3RRGA 1L3TA 1KVCA 2YJEA 5AQMA 2Q31A 2FSKA 1VQKN 2CH6A 1YAGA 3D7EO 4CFCA 3CFOA 1NK9A 4FJKA 2BUPA 4JHDB 3PO4A 3E9OA 3AA4A 4CZFA 2A41A 3QINA 3KJVA 2ASMA 3L4IA 5KPZA 3EE9A 4BRGA 2YNHA 3BGRA 5B8HA 1LW0A 1W0HA 4BRFA 4GV3A 4JI5K 1HJOA 3HOTA 3VQ8A 5HRPA 4B3OA 2HMIA 2YHXA 1NK5A 1TVRA 1KCFA 1S1WA 4FM1A 2HHVA 3VGKA 3HPGA 1D9FA 4E3SA 2E88A 1XNQK 2QKKA 4I9QA 3BZCA 3VQPA 1Q81O 4DS4A 2YCHA 5FPNA 3LP1A 2QWRA 1YJWN 4DTXA 2GWKA
chains in the Genus database with same CATH topology
5A2QO 4DR4K 4LF6K 4DR5K 5IT9O 4LF4K 1IBKK 4K0KK 4DUYK 5LMUK 2UUAK 4LFCK 4JI7K 4CW7B 4X62K 4LF8K 4DR1K 1HNXK 4YY3K 1N32K 4DV3K 3T1HK 1J5EK 4JV5K 2HHHK 4NXMK 4YHHK 4JI0K 1HR0K 2UXBK 4NXNK 2F4VK 1N33K 5LL6Z 3OTOK 1HNZK 4B3RK 1HNWK 4JI1K 2E5LK 3J80O 2UU9K 2VQFK 4GKKK 1XMQK 4LFAK 1FJGK 4DV4K 4X64K 3T1YK 4DV7K 4GKJK 4DV5K 4JYAK 4B3MK 2UXDK 4X65K 4AQYK 4DR7K 5IWAK 4JI4K 4LF7K 1XMOK 1N36K 2UUBK 4JI2K 5BR8K 2ZM6K 2VQEK 2UUCK 1XNRK 4X66K 4CVNE 3J81O 4LF5K 1N34K 1IBMK 3J7AP 5AJ3K 3J7YP 5FLXO 4JI5K 4DV2K 4DV6K 4DR3K 1I94K 4JI3K 5LMNK 1IBLK 4B3TK 4DR6K 2UXCK 4LF9K 4DV0K 4JI6K 4OX9K 4DV1K 4DUZK 4DR2K 4LFBK 4V19S 4B3SK 1XNQK 3JAMO 4JI8K 4KHPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q O;  4DR4 K;  4LF6 K;  4DR5 K;  5IT9 O;  4LF4 K;  1IBK K;  4K0K K;  4DUY K;  5LMU K;  2UUA K;  4LFC K;  4JI7 K;  4CW7 B;  4X62 K;  4LF8 K;  4DR1 K;  1HNX K;  4YY3 K;  1N32 K;  4DV3 K;  3T1H K;  1J5E K;  4JV5 K;  2HHH K;  4NXM K;  4YHH K;  4JI0 K;  1HR0 K;  2UXB K;  4NXN K;  2F4V K;  1N33 K;  5LL6 Z;  3OTO K;  1HNZ K;  4B3R K;  1HNW K;  4JI1 K;  2E5L K;  3J80 O;  2UU9 K;  2VQF K;  4GKK K;  1XMQ K;  4LFA K;  1FJG K;  4DV4 K;  4X64 K;  3T1Y K;  4DV7 K;  4GKJ K;  4DV5 K;  4JYA K;  4B3M K;  2UXD K;  4X65 K;  4AQY K;  4DR7 K;  5IWA K;  4JI4 K;  4LF7 K;  1XMO K;  1N36 K;  2UUB K;  4JI2 K;  5BR8 K;  2ZM6 K;  2VQE K;  2UUC K;  1XNR K;  4X66 K;  4CVN E;  3J81 O;  4LF5 K;  1N34 K;  1IBM K;  3J7A P;  5AJ3 K;  3J7Y P;  5FLX O;  4JI5 K;  4DV2 K;  4DV6 K;  4DR3 K;  1I94 K;  4JI3 K;  5LMN K;  1IBL K;  4B3T K;  4DR6 K;  2UXC K;  4LF9 K;  4DV0 K;  4JI6 K;  4OX9 K;  4DV1 K;  4DUZ K;  4DR2 K;  4LFB K;  4V19 S;  4B3S K;  1XNQ K;  3JAM O;  4JI8 K;  4KHP K; 
#chains in the Genus database with same CATH topology
 4CBX A;  1JL1 A;  4ILG B;  1IO2 A;  4BDZ A;  1EP4 A;  2NNW A;  3MDQ A;  5IT9 O;  2W40 A;  3O9Q A;  5I3U A;  2JWL A;  3AO4 A;  4DUY K;  1K73 O;  2D0A A;  1Q82 O;  3HL8 A;  3O9R A;  3SBT A;  4CD1 A;  4DR1 K;  3SPZ A;  1TAQ A;  3HBT A;  3ZSV A;  3L4Q A;  5JVH L;  2NRV A;  1X3M A;  2OAN A;  3QNO A;  4FPA A;  1S3X A;  2ZJP L;  4CEQ A;  1VQ5 N;  3I8D A;  3AVG A;  3MN7 A;  2OPR A;  4FJG A;  3TAN A;  1VQ8 N;  3RMA A;  3AVK A;  1WSH A;  2P9S A;  5AQN A;  1J53 A;  3QBX A;  4JNE A;  3AO3 A;  1HLU A;  2QWQ A;  3TSQ A;  4C8M A;  1RIL A;  4DV7 K;  4DV5 K;  2BDP A;  3ZT4 A;  1E3M A;  1TL3 A;  1NKC A;  2UXD K;  1DT9 A;  4OGE A;  4N41 A;  1Q9X A;  2X74 A;  3IUC A;  4FWK A;  1YTA A;  1KVB A;  1WNS A;  3VEY A;  4CJT A;  4RTF D;  2HHU A;  3LP0 A;  1J9A A;  1TKT A;  3ZT3 A;  3AVJ A;  4Z4I A;  1TYQ A;  2RHK A;  5AQI A;  3THX B;  3H3N O;  1YI2 N;  1REV A;  2P9K B;  3OA9 A;  5AQP A;  3LZJ A;  3O9T A;  3SAF A;  2G8I A;  1NK6 A;  5JS1 A;  2E2N A;  2WTU A;  1X1P A;  4RG8 A;  1X9W A;  3C94 A;  4IO8 A;  4LH4 A;  3F2K A;  1IBL K;  1RDC A;  3F9M A;  3OYC A;  4B1V A;  3B6O A;  3HK2 A;  1NGG A;  4CK3 A;  1Z25 A;  1TKX A;  2X6N A;  5KGX A;  1SL2 A;  2IAJ A;  3CYM A;  1NOZ A;  2ETJ A;  4DFM A;  4FWP A;  1RDA A;  4BWM A;  4FM2 A;  2GEM A;  4WYB A;  3VQ6 A;  2D0C A;  4R79 A;  1RBT A;  4ELV A;  1FXX A;  2RE2 A;  5A2Q O;  3CM5 A;  3V4I A;  2F8T A;  1LCU A;  3K2P A;  5C25 A;  1S5J A;  3VA3 A;  3QIC A;  2UUA K;  1KAY A;  3ZSR A;  2NRZ A;  4CJS A;  1RCH A;  4JKG A;  4CJK A;  3RTV A;  5M1K A;  4CGH A;  2QI2 A;  3UKR B;  5DM7 L;  4DSE A;  2PBD A;  4Z4H A;  3SV3 A;  4BR9 A;  1NU0 A;  4FLU A;  1NM1 A;  3OYE A;  1Q18 A;  2XY5 A;  3SZ2 A;  2O8C B;  1RT4 A;  4KRF A;  1HQU A;  2IGI A;  5AQQ A;  1RTJ A;  4QS7 A;  2F96 A;  4RW7 A;  2QTD A;  3HSC A;  4YOT A;  4Z4E A;  1U4B A;  5EY4 A;  3TSU A;  5KQ8 A;  1IG9 A;  3QBW A;  5F0X A;  4DTR A;  4GKK K;  2WFB A;  5M1P A;  4RW6 A;  3IDH A;  4FOE A;  1Z05 A;  2O8C A;  3DI6 A;  5HLF A;  3FZL A;  4C8K A;  1HJR A;  1VHX A;  4DFJ A;  3ID6 A;  3WNH A;  4CEF A;  2O8F B;  3DLE A;  1NGA A;  4Z4C A;  3SLC A;  5CHI A;  1KSP A;  4HTU A;  3QFU A;  2H3G X;  2AA4 A;  2VG5 A;  3VQ4 A;  1SZ2 A;  4CIG A;  3AVL A;  3LL3 A;  1WSF A;  3V9U A;  4Y1C A;  3TAG A;  5KRT A;  3C6U A;  3DLR A;  3MN9 A;  2XY6 A;  4FWL A;  3K59 A;  4AIL C;  3OYI A;  3LZI A;  1NK0 A;  2F7T A;  3RMB A;  3WNF A;  3WXJ A;  4CZE A;  4K43 A;  3CF5 L;  2ZGY A;  1NGJ A;  5BN9 A;  4NCB A;  4E1M A;  4AH9 A;  4BGB A;  3MEC A;  1NJZ A;  4G1Q A;  4JKF A;  1MU2 A;  2P9I B;  3HVR A;  1RTD A;  1SV5 A;  1MWK A;  4LF9 K;  4YNQ A;  2W42 A;  5E26 A;  3GOI A;  3SAG A;  1QQN A;  1NGI A;  4LFB K;  2O8E A;  4DSF A;  1T05 A;  5JVG L;  2UYT A;  3ALY A;  5AQG A;  1YUW A;  1YXQ A;  1RT2 A;  4CZL A;  4KHP K;  3O3F A;  2B6A A;  2D1K A;  5GIP A;  4DFK A;  1TKD A;  3IG1 A;  3NBP A;  4FWN A;  4IXC A;  2P9N A;  3D2E A;  1W2B M;  4RW4 A;  1RT6 A;  1L3U A;  4LFC K;  2QWP A;  5J1E A;  3SAH A;  4BR5 A;  3P39 A;  1C6V A;  3CD6 N;  3AVA A;  2NRH A;  3CJB A;  2HBL A;  4ID5 A;  4RWT A;  3IKM A;  3FR0 A;  3CG7 A;  5KI6 A;  2VWK A;  3NGY A;  4FLW A;  3VQ9 A;  3H1Q A;  3EZW A;  1EKE A;  2F4V K;  2PYL A;  1EWR A;  3K5M A;  2CGK A;  3V6D A;  4H03 B;  4JAX A;  3KLF A;  3DOK A;  2Q3S A;  3L0Q A;  4DF8 A;  4Y1D A;  4LY7 A;  1HNW K;  3RR8 A;  4LSL A;  3ZSQ A;  4BDY A;  2NRW A;  4CED A;  4FJ9 A;  3M8S A;  3QES A;  2DFH A;  3NF6 A;  4E1J A;  3A5N C;  4CFA A;  4CZG A;  4YOX A;  4DQI A;  3E9L A;  3EY1 A;  3EEQ A;  5AR0 A;  4JKD A;  5CZ2 A;  3AA2 A;  3NFA A;  1BL3 A;  4OGC A;  3CET A;  3R6M A;  4PY5 A;  2YNG A;  3BP8 A;  4MLE A;  3CHW A;  2WON A;  4MQ3 A;  1C0U A;  3J7Z O;  1WBD A;  4CEC A;  1WOQ A;  4DV2 K;  4MDA A;  4LH5 A;  4PL7 A;  1KQS M;  4B1Z A;  1GOC A;  4OLB A;  3K58 A;  4IZ9 A;  3CJC A;  2QK9 A;  4BR0 A;  3C6A A;  1T8E A;  4OPA A;  4UY8 O;  1TKZ A;  3TAM A;  3FLC O;  1T7P A;  1JL2 A;  1TUU A;  3MCP A;  4FXD A;  4L8R B;  1QTM A;  5TKW A;  1UA1 A;  2VWB A;  3IAY A;  1BIZ A;  3PY8 A;  2G8H A;  3KIO A;  3MXI A;  3IS9 A;  3K5O A;  3WQT A;  3VQA A;  1HYZ A;  4IOA L;  2B5J A;  4KI4 A;  1Z6R A;  3OJS A;  4JI7 K;  3JYT A;  4LF8 K;  4PKI A;  1VSK A;  4I9L A;  4EZ6 A;  1QSS A;  3MX5 A;  3V9S A;  5HRR A;  4R5P A;  1VSF A;  4KV8 A;  1NOY A;  3C6H A;  4CHY A;  2ZQB A;  2HHH K;  3TAR A;  4CGG A;  1X3N A;  2GEL A;  3CFR A;  3VQC A;  4BGA A;  3OS0 A;  4CZH A;  2VGN A;  5LL6 Z;  3WXL A;  3D6R A;  4PKG A;  2FBX A;  4NYF A;  3M8Q A;  4H0Y B;  3KKR A;  1T44 A;  2P1J A;  3VEZ A;  1J5O A;  3HVT A;  4M3R A;  1O13 A;  4DF4 A;  1J6Z A;  2E6M A;  3VER A;  5C42 A;  3V9X A;  1ZBI A;  2HHT A;  3K5N A;  4MFB A;  2XY7 A;  4H5R A;  3A2F A;  1BGX T;  1B9F A;  4DQR A;  5K14 A;  4FJI A;  4FJX A;  3UB5 A;  3LAK A;  4AHS A;  3K0S A;  1QVG M;  5GAG P;  2CGL A;  3KLG A;  3VQ5 A;  1VQ6 N;  2HB5 A;  3P83 D;  4A59 A;  3VQB A;  3O4W A;  1BCO A;  5AQR A;  1I3A A;  2HHQ A;  1GOB A;  5M1Q A;  4M3Z A;  3OYD A;  1WBB A;  4E0D A;  2QWL A;  5E84 A;  1A5V A;  1XHZ A;  5CY4 A;  3OS1 A;  3O9U A;  1DEJ A;  3GG4 A;  4JD2 A;  5C15 A;  4ZTF A;  4O44 A;  3CCV N;  1BI4 B;  2P9P A;  3O3G A;  4E1N A;  4HUG A;  3NVM A;  4B9L A;  3SUP A;  1VQ9 N;  2AP1 A;  5SZT A;  3TTC A;  3JAM O;  4EIA A;  4N5S A;  4JI8 K;  3SQ0 A;  4FZX C;  1Y64 A;  3RR7 A;  4QS9 A;  4CJ7 A;  1DLO A;  2F8S A;  3VF4 A;  1EQY A;  4DR5 K;  4DQ8 A;  4ILJ A;  2Q0U A;  3UKU B;  5AQW A;  3PSI A;  4B9N A;  5KRS A;  1GLF O;  4ZHR A;  4CW7 B;  1SKR A;  4HUF A;  4E7J A;  4FLY A;  4DTP A;  3T69 A;  4DTO A;  1VQ4 N;  3A5O C;  3ULE B;  1IG8 A;  1JLG A;  3UKU A;  1KVA A;  4PWD A;  1RFQ A;  3TTF A;  1HR0 K;  3PSF A;  2IDO A;  4ELU A;  3HI0 A;  4JLH A;  4CHN A;  1L5U A;  1EXQ A;  3SUN A;  2GWJ A;  4J2D A;  4B1Y B;  1U04 A;  3P31 A;  4IEE A;  4BDP A;  1VSL A;  3SK3 A;  4BRO A;  3S3M A;  4FWO A;  1QQC A;  1R0A A;  4BC2 A;  1ATN A;  3MN5 A;  4KB0 A;  1JLA A;  3T1Y K;  3QNN A;  4IBN A;  3OJU A;  2QM1 A;  4CJR A;  4CHQ A;  4RW8 A;  1ZBL A;  5IWA K;  3L6Q A;  1YF5 L;  4GVM A;  4JKE A;  2UUB K;  2FF3 B;  1Q8I A;  1VQ7 N;  1I39 A;  3QIO A;  2BGG A;  1IV0 A;  5M1O A;  2VQE K;  4A2A A;  1A5W A;  3KK1 A;  1IKY A;  1HYS A;  3U8X A;  3SV4 A;  1KRP A;  4JRQ A;  1KD1 O;  3EYZ A;  4BR7 A;  4WF9 L;  4JK8 A;  4CIE A;  3I55 N;  4H4M A;  1BUP A;  3JS6 A;  3VQ7 A;  1SQK A;  2YHA A;  4GW6 A;  2X6S A;  4OKE A;  4K42 A;  3F5T A;  1LWE A;  2KHO A;  3SMP A;  4V19 S;  1KTQ A;  1RGI A;  2HOE A;  4IDK A;  3DXM B;  5J2Q A;  3CCL N;  3TAP A;  5GAE P;  4ISG A;  4CFD A;  4IG3 A;  3QEP A;  1WSJ A;  1U2V A;  2A42 A;  2JWK A;  4H5T A;  1QZ5 A;  4BRQ A;  4H8K A;  4B08 A;  2PZS A;  3AAP A;  3CCE N;  3SMS A;  1B9D A;  1RBU A;  3DXM A;  4Z4F A;  3SJH A;  2ZJQ L;  4FOI A;  3U6F A;  4FZY A;  1NJW A;  3FGU A;  3ZSX A;  3WEE A;  1BQM A;  2E8A A;  1JCE A;  1NK8 A;  5BN8 A;  4CGI A;  4B8C A;  3O8M A;  4DFP A;  2R7Y A;  4KAZ A;  5J2N A;  3FFK B;  2VGM A;  4BG9 A;  1NGB A;  3D0P A;  3LDO A;  3ZSO A;  2O4G A;  4CES A;  1LWC A;  3NH1 A;  4KBO A;  4WFB L;  1WN7 A;  1H1V A;  4DTM A;  2PFU A;  4N56 A;  4JI1 K;  5F1X A;  4NCA A;  4IOX A;  2P9S B;  4JK7 A;  3ENH A;  1MWM A;  1FJG K;  3H08 A;  2YKN A;  3TU5 A;  2HST A;  2GV9 A;  2O8B A;  3AVB A;  1QZ6 A;  4DR7 K;  2Z1I A;  1ASW A;  4CEA A;  3EL2 A;  4E7K A;  5JLF A;  1MDU B;  2ZM6 K;  4BRL A;  4B8A B;  3EE8 A;  1RTI A;  1C0M A;  4FLV A;  3BUZ B;  3HP9 A;  3BDP A;  1ZC6 A;  4X66 K;  4ICL A;  4AHR A;  3L2R A;  3CC2 N;  3FZK A;  1OVY A;  3DM2 A;  1TYQ B;  3J7Y P;  3ZT1 A;  4FWQ A;  1CZB A;  1HKC A;  1BWF O;  4O0I A;  4CEE A;  3VOV A;  5BR9 A;  1NJI O;  3SQ4 A;  4FJL A;  5AQJ A;  4JI3 K;  2BH1 A;  1BDG A;  1V4T A;  1U6Z A;  5C12 A;  4F9O A;  3CQ8 A;  1JCF A;  2PY5 A;  4DV0 K;  1VQP N;  4M7X A;  4OX9 K;  3H6E A;  4KHY A;  4FJ7 A;  1RT7 A;  1ZBF A;  3LPU A;  4J2A A;  2OTJ N;  3VEN A;  1S1X A;  1SS6 A;  3DRP A;  2G8V A;  4FJ8 A;  4WE1 A;  3K5L A;  2NRR A;  4BQZ A;  4CIF A;  3VGL A;  2W6L A;  3L2W A;  3CCU N;  1K6Y A;  1NLV A;  1D5A A;  3QDK A;  1QVF M;  4FJM A;  1ESV A;  4JS5 A;  1Q9Y A;  2HNY A;  2HW3 A;  1HNI A;  1IH7 A;  2HHX A;  3O9S A;  3HOS A;  4O8K A;  1NK4 A;  1GOA A;  1HNX K;  4XH5 A;  2JLE A;  4HVJ A;  1NWK A;  5F2R A;  3NVK A;  5ELZ A;  2Q1N A;  4JKG B;  3W0L A;  4JKC A;  4YOY A;  3CME N;  1U45 A;  3ULD A;  3ZSY A;  4N47 A;  4NXN K;  4CF2 A;  3EO3 A;  3O1W A;  3F73 A;  1RBR A;  3A5M C;  4B3R K;  4A2B A;  2EWS A;  2HMP A;  1W97 L;  4EFH A;  3D2F A;  3THW B;  3HTV A;  3VEX A;  2QKB A;  3OYK A;  1QQO A;  4NLB A;  3DAW A;  4E19 A;  5HOO A;  1M1K O;  3Q7B A;  3QET A;  4KH6 A;  1RDW X;  1NK7 A;  4M3W A;  3KTQ A;  2KKZ A;  3B6P A;  4CJL A;  3KKS A;  2EHG A;  4CBW A;  2QXL A;  3BZK A;  4OJR A;  5BRH A;  3O6W A;  3THW A;  1VQO N;  1NMD A;  1XNR K;  3OW2 M;  5AQT A;  4DSJ A;  3VGM A;  4DKW A;  3K9K A;  3J7A P;  5AJ3 K;  1HMV A;  2I7N A;  4BRM A;  3JSM A;  1S6Q A;  5AZI A;  3R8E A;  1ITG A;  1CXU A;  4C1N I;  4H5V A;  4CZM A;  1ZYQ A;  3QEX A;  1HKB A;  3CM6 A;  2ZGZ A;  4FVU A;  2NUB A;  1NGH A;  3WXM B;  3RSE A;  5AQV A;  4DUZ K;  2G8K A;  3L3V A;  2J4R A;  2RPI A;  1HPZ A;  3LPT A;  3CJ7 A;  5DM6 L;  3N4Q A;  2O8E B;  3CC7 N;  3NF7 A;  2O4I A;  2KQ2 A;  5LJV A;  2IIR A;  3NGI A;  3EKS A;  4LF6 K;  3VES A;  4FJN A;  4CJV A;  5C2F A;  3HO1 A;  4B9U A;  4YDU A;  2FBV A;  1TK8 A;  3WXK A;  4FLZ A;  1BOT O;  1S1V A;  3RRH A;  2OZM A;  4ILH A;  2KFN A;  3O4Q A;  1LAV A;  4FW2 A;  1RT1 A;  1TUY A;  2P9N B;  3D2E B;  4DTJ A;  3FE1 A;  3ZT0 A;  5AZJ A;  4JEP A;  3LWM A;  1TK0 A;  4MDB A;  4J2E A;  4B1U B;  3M1F A;  3LDQ A;  3LDS A;  2UXB K;  2NLX A;  1S72 N;  3AO1 A;  2PYJ A;  1NGF A;  4BRE A;  4DQQ A;  1VSE A;  3C0B A;  2KZM A;  1S9E A;  4H0V B;  3TAF A;  3F9K A;  5LY3 A;  4KH5 A;  3ZEU A;  1BIS A;  1XMQ K;  4AHC A;  3KK3 A;  1OH7 A;  4KO0 A;  2HBJ A;  2I7P A;  4B3M K;  4OPK A;  4X65 K;  4OLA A;  4A62 A;  2F9T A;  1IKW A;  4B1W B;  4PUO A;  1XC3 A;  5AQS A;  3TWH A;  3PX4 A;  4Z94 A;  4FJJ A;  3TAE A;  3QML A;  2ZJR L;  4I2P A;  3U9Z A;  4WCE L;  3V1Q A;  3ZET A;  5BPM A;  3ZSZ A;  4UQG A;  4LF5 K;  3CMA N;  3ZX2 A;  4BWJ A;  1KFS A;  1T6D A;  3HPO A;  3NCI A;  2HVI A;  4ELT A;  5FPD A;  4B9M A;  3NAE A;  3NE6 A;  4YDU C;  4M3X A;  4AF1 A;  5AQK A;  5T7B A;  1HPM A;  4A5A A;  4FK2 A;  3BF3 A;  1KXP A;  3DMJ A;  3G10 A;  5LMN K;  4IO9 L;  2HBM A;  2DPN A;  3MCA B;  3LM2 A;  5AQU A;  4CK1 A;  3THV A;  1LAW A;  4B9T A;  4A61 A;  5AQX A;  3ATU A;  4B3S K;  3I0R A;  4F3O A;  4DWI A;  3TSP A;  1HRH A;  4YOW A;  5AQY A;  4BRP A;  3LAL A;  4BG8 A;  3AAQ A;  3VQD A;  4FWS A;  4O8U A;  5KPT A;  4ZTJ A;  1OH8 A;  2IVN A;  1OKJ A;  1BIU A;  2QWO A;  1QHA A;  4O5B A;  3NHG A;  2FSJ A;  4IWV A;  3ZCM A;  4LF4 K;  1BHL A;  1T03 A;  2P5G A;  1IBK K;  1FKP A;  4A57 A;  2VCP A;  4CJF A;  5LMU K;  3MEG A;  4FSV A;  3RWU A;  1GLJ O;  3K9J A;  3SYZ A;  2YJF A;  3WT0 A;  1TGO A;  5FDL A;  4OO1 J;  4F8R A;  4C8N A;  4AHT A;  4MO5 A;  3QER A;  3LP2 A;  3TI0 A;  2DY4 A;  2P9U A;  1HQE A;  4JV5 K;  3T1A A;  1NG9 A;  4NXM K;  4F3T A;  2E2P A;  2BE2 A;  3VN5 A;  3WQU A;  2HHW A;  1QSY A;  4EHT A;  4W5N A;  3VEO A;  1HNV A;  5J2P A;  4B9V A;  5GIN A;  4LFA K;  4FLX A;  1HX1 A;  4X64 K;  3LWL A;  3QB0 A;  4DCH A;  1S22 A;  3H1V X;  3T7Z A;  5FRO A;  2YV0 X;  4CF8 A;  1NJY A;  1X9M A;  3SJJ A;  3IMX A;  3OHR A;  1GLB G;  3A5L C;  3CI5 A;  2GUI A;  2I5J A;  2NRX A;  1GLE G;  3KZB A;  2G8U A;  1MA9 B;  2HBK A;  2YHY A;  2FC0 A;  2V7Z A;  5BRD A;  3KLH A;  3VET A;  4CBU A;  3LDN A;  1VRT A;  1RTH A;  2DFE A;  3J8A A;  3EN9 A;  3KD1 E;  1JLC A;  5JLH A;  4W5T A;  3IFR A;  4M7Y A;  4B3T K;  1EET A;  3MWT A;  3G4S N;  3RMC A;  1FW6 A;  3NDK A;  5JS2 A;  4BRI A;  1YT3 A;  4DR2 K;  3T3F A;  2A40 A;  2RF2 A;  2YI1 A;  4M42 A;  1SKS A;  4JD2 B;  4NCG A;  2A5X A;  3CJ9 A;  1RBV A;  2P9P B;  4LD0 A;  3ZLJ A;  4IFV A;  3CC4 N;  3DOL A;  4W5O A;  3CCS N;  1JKH A;  2WC9 A;  4E7L A;  3I33 A;  5EU7 A;  4OPJ A;  4CGD A;  1T6C A;  2WOM A;  2ZE2 A;  3VF2 A;  1LV5 A;  4QCL A;  2GTD A;  1XI1 A;  3CFP A;  4I2Q A;  3H45 C;  1N32 K;  4YOV A;  1D9D A;  4W5R A;  4DV3 K;  2OTL N;  4KTW A;  5M1N A;  3OYH A;  1KC8 O;  4HTL A;  3CIP A;  2V7Y A;  4M63 C;  2YHW A;  3CPW M;  1QSL A;  4RW9 A;  4JKH A;  3OTO K;  2YNI A;  4QAG A;  3ZX0 A;  3C65 A;  3PUF A;  2VYP A;  3ITH A;  4NB4 A;  3AO5 A;  3L2U A;  3G0Z A;  2QA4 N;  4HWI A;  4DTS A;  3KD5 E;  2JGU A;  3N4P A;  1BA0 A;  3VEW A;  4C8O A;  1XUP O;  4LF7 K;  4DQP A;  2LSN A;  4DG1 A;  1EX4 A;  3QLH A;  4B9Q A;  4BE1 A;  3PV8 A;  4JI2 K;  2WUS A;  2OYQ A;  2KFZ A;  1N6Q A;  3SBG A;  4Z4G A;  3LAM A;  2P9L A;  3UE5 A;  4JKB A;  2Q2R A;  3GDQ A;  3MK6 A;  4WQ5 A;  4CHZ A;  1YJN N;  4OVL A;  4CF9 A;  3QFP A;  1VRU A;  5AFU A;  3T19 A;  4BC4 A;  3NH0 A;  1WUA A;  1I94 K;  4K25 A;  3HP6 A;  3SPY A;  3AAR A;  4Y0W A;  5CYQ A;  4F2R A;  2YNF A;  1IKV A;  4DV1 K;  3DRR A;  4CI6 A;  2VG7 A;  1K8K A;  4NLC A;  1RBS A;  4DSK A;  2V52 B;  4FVM A;  3MN6 A;  3A8Y A;  2ZF5 O;  2Q36 A;  5CYM A;  4BAC A;  3CCJ N;  4GNI A;  5JMV A;  3G71 N;  4CJE A;  4DQS A;  2FF6 A;  4KTZ A;  1NBW A;  4CD3 A;  4B1X B;  4E7H A;  1VQN N;  1DTT A;  4HHT A;  1U2V B;  1YVU A;  3HPH A;  2WBN A;  4O5F A;  3HZ6 A;  3HJF A;  3THY A;  3IRX A;  1UA0 A;  1R59 O;  4DLG A;  3VQQ A;  2QWM A;  4FLT A;  3SNN A;  1VSM A;  3TR8 A;  1KFD A;  3S3N A;  3T1H K;  4K8X A;  3WEE B;  4BC5 A;  4CF1 A;  3VA0 A;  2W6K A;  3WNG A;  4CJW A;  3DJC A;  3QEW A;  3DRS A;  3WNE A;  3M6G A;  3AY9 A;  5C2D A;  5AFU H;  3V1R A;  5TKY A;  1N33 K;  5FPE A;  1M90 O;  1HKG A;  1CLQ A;  4ISE A;  2Z1J A;  1LOT B;  1KAX A;  1TAU A;  3U3Y A;  5HRN A;  4WQ5 C;  1P90 A;  4BRN A;  5H1S Q;  3S41 A;  1QQM A;  3OBW A;  4DV4 K;  1KAZ A;  4W5Q A;  3WUH A;  1NKB A;  1NNE A;  4DMN A;  1SUQ A;  1E4F T;  1QS4 A;  4JHD A;  5BRF A;  2IVO A;  4KHN A;  2W41 A;  4H0O A;  3O1B A;  4JI4 K;  5J2M A;  4CZI A;  2A6A A;  2O8B B;  4E89 A;  4FL9 A;  4BRH A;  3DXK B;  4C23 A;  3E66 A;  4CJ5 A;  3C95 A;  1RT5 A;  4H5W A;  3J81 O;  2XO7 A;  4PQU A;  2AJQ A;  4KHQ A;  4IEI A;  1N5Y A;  3FZF A;  3BEX A;  5DMR A;  4NO7 A;  4E7I A;  3TAB A;  3V9Z A;  2HF4 A;  4GV6 A;  1HYV A;  3I56 N;  1B92 A;  4M45 A;  5ADX A;  3FFI A;  3DXK A;  2NRT A;  3CCR N;  4CGF A;  1XHX A;  1O1W A;  1FK9 A;  2RKI A;  1Q7Y O;  4OKJ A;  3QO9 A;  5AQZ A;  2D4W A;  3MAQ A;  4Z0U A;  2ZWH A;  4OKK A;  4FW1 A;  1ILY A;  3LAN A;  2B4J A;  3LDP A;  3VQE A;  1Y97 A;  1IJJ A;  2D0B A;  2ZD1 A;  1W9H A;  4U67 L;  1RT3 A;  3MED A;  2OPQ A;  3PO5 A;  4M3T A;  4I7F A;  3B8A X;  1JXE A;  1BA1 A;  3HST B;  4LC9 B;  3G6E N;  1E4G T;  3E9P A;  3OBY A;  4RCH A;  4BE0 A;  1BQN A;  4DU1 A;  1JLF A;  1WAF A;  4CE9 A;  4EAH D;  3O5B A;  3O80 A;  1RNH A;  4PL8 A;  2A3Z A;  1IKX A;  1ATS A;  4WFA L;  4FM0 A;  5ADX H;  1L3V A;  1BG3 A;  1VSH A;  4J2B A;  1S9G A;  3MEE A;  1VQM N;  5FRN A;  3J80 O;  1SL0 A;  4KHU A;  2UU9 K;  3ASM A;  4BRA A;  3UIQ A;  3S3O A;  3D2F B;  5CE3 A;  3L3U A;  1YVN A;  2VG6 A;  4MLH A;  2G8F A;  3OYF A;  1C0T A;  3AGR A;  1C1A A;  2HF3 A;  3THX A;  4KH4 A;  4NYN A;  4PKH A;  2P9K A;  3W3D A;  4BRD A;  4CFB A;  3M3Z A;  3TAQ A;  3PLA A;  4Q0B A;  2IVP A;  3PX6 A;  3NF8 A;  1X9J A;  1U49 A;  3FZM A;  1N34 K;  1IBM K;  3LDL A;  3I8B A;  4YFU A;  4KI6 A;  3DLG A;  1KLN A;  3FZH A;  4DR3 K;  3WXI A;  1ASU A;  1GLL O;  5AZI B;  1WAJ A;  4CF0 A;  4AM7 A;  1U48 A;  1LW2 A;  3ZYY X;  2UXC K;  1KLM A;  3RMD A;  2D0O A;  2E2O A;  3DLK A;  1GLD G;  2CGJ A;  4KRE A;  3RSE B;  3HM9 A;  1QHT A;  1V4S A;  1EO1 A;  4DR4 K;  3TTD A;  3CQX A;  3MMV A;  4IDH A;  3U3G A;  2E2Q A;  1NGE A;  3VTH A;  3QEI A;  1G15 A;  4DSL A;  3UKR A;  2KZZ A;  2HND A;  4K0K K;  4IFE A;  1VAZ A;  1ZBS A;  2HNZ A;  3VMF B;  2FBT A;  3PIO L;  3AVN A;  1N8R O;  4BY9 C;  1TV6 A;  1UAX A;  3PIP L;  1UWB A;  3LM9 A;  4BRK A;  5HP1 A;  4KB1 A;  3OYA A;  5KGW A;  4Q5V A;  3EZ5 A;  3CXC M;  3DLH A;  2IS3 A;  5AQO A;  3V1O A;  3V81 A;  3LP3 A;  5AZJ B;  4A5B A;  4C8L A;  4O55 A;  5GAH P;  2P51 A;  3R3L A;  4KFB A;  2F9W A;  4XH4 A;  2O8D B;  4M41 A;  2GX9 A;  2Q97 A;  4CJQ A;  4U7B A;  3SI6 A;  4KKO A;  5LJW A;  1K9M O;  4DSI A;  2Q0R A;  3P4I A;  2VQF K;  3ISN C;  1GLA G;  2O8F A;  2OA8 A;  2KW4 A;  1YIJ N;  2Z1H A;  3R9P A;  1OH5 A;  4BR2 A;  4CEB A;  3ZEU B;  4CK2 A;  3HYF A;  2ATQ A;  1RDD A;  1XC9 A;  3L2V A;  5D3G A;  1XMO K;  2O8D A;  2FXU A;  3AGK A;  2HVH A;  1T3V A;  3AVM A;  4J8F A;  5KTQ A;  4AHU A;  4CHP A;  5M1F A;  2OZS A;  4DB3 A;  3EKU A;  1GLC G;  4JKA A;  4MO4 A;  1VK0 A;  1S1T A;  4B9S A;  4XEI A;  2DTU A;  1VSD A;  4H4O A;  1NGC A;  1VSJ A;  4CVN E;  3OYJ A;  1W7A A;  3DWL A;  3AVI A;  4FPB A;  5KQD A;  1YHQ N;  3AVC A;  3HXM A;  5FLX O;  3U9D A;  3ZET B;  2OPP A;  3GE1 A;  3DYA A;  2P9I A;  4DV6 K;  4CZK A;  4HCC A;  4FYD A;  3KK2 A;  2D0P A;  1FKO A;  3OYG A;  4CCH A;  2GUP A;  1JLE A;  4BVP A;  1YJ9 N;  3I0S A;  1XQS C;  2ASP A;  4CGJ A;  2BTF A;  1ASV A;  4KTQ A;  5HRS A;  3H46 O;  4F4K A;  4WQ4 A;  3R1X A;  1C1B A;  2VWJ A;  3VEV A;  2YHB A;  4HCB A;  4KHS A;  4F2S A;  4CER A;  1JLB A;  4FK4 A;  5KPR A;  5FRM A;  2RN2 A;  3D45 A;  2QXF A;  3AA5 X;  2CH5 A;  1NJX A;  4X62 K;  4IJA A;  3ENB A;  1JCG A;  2FBY A;  3ENO A;  4CJ3 A;  3OYB A;  3KHY A;  3VPZ A;  1F21 A;  3E1Y A;  4XIU A;  4FCY A;  4FZZ A;  1J5E K;  3AA3 A;  2D5R A;  1C1C A;  4EP4 A;  4BE2 A;  5BPN A;  2E6L A;  2P5O A;  4EHU A;  4KHW A;  4EZ9 A;  2P9U B;  3E01 A;  5FPM A;  1J54 A;  3RVC A;  1HNZ K;  4JN4 A;  3KLI A;  3NF9 A;  3MXM A;  4YOR A;  4IFY A;  4DLE A;  1L3S A;  2E5L K;  4ID1 A;  1D4X A;  3ZSW A;  4BVO A;  5EOY A;  5C10 A;  4QOZ B;  4L3Q A;  5HL7 L;  4BRC A;  2A1R A;  1SKW A;  4GKJ K;  4JYA K;  3OYN A;  4YOU A;  1XWL A;  4LSN A;  4AQY K;  2E1Z A;  1SAZ A;  1Z26 A;  2E20 A;  4GY2 B;  4JS4 A;  4IG0 A;  3JXU A;  1RDB A;  1JLQ A;  1VSI A;  5C0Y A;  1ZBH A;  5I9E B;  1D8Y A;  3OY9 A;  1G99 A;  2YX6 A;  3HRG A;  5CR4 A;  4WQ4 C;  1X9S A;  5BPL A;  1Q86 O;  3KVG A;  4AM6 A;  2Y1J A;  4EP5 A;  4GV9 A;  3S9H A;  1WB9 A;  4G9Z A;  4PHT X;  1S1U A;  1WSI A;  3OYM A;  1WSE A;  2ITG A;  3AVH A;  3SCX A;  2QEX N;  3BY5 A;  2FSN A;  1LWF A;  1YTU A;  4FJH A;  1OVQ A;  5BRE A;  4JI6 K;  2X78 A;  3G25 A;  4O0J A;  4XH1 A;  4FO0 A;  1SL1 A;  3CER A;  3TPQ A;  5I42 A;  2BAN A;  4IJN A;  3KLE A;  1HUX A;  1RDU A;  4FWM A;  1JJ2 M;  4JRP A;  1S6P A;  1BO5 O;  3CCM N;  5EX5 A;  3AVF A;  1NMN A;  1OH6 A;  2KLA A;  3AV9 A;  3OS2 A;  3CJA A;  4CJU A;  3BF1 A;  3NGZ A;  3MXJ A;  3M5R A;  1TL1 A;  3VTI A;  3CQY A;  1BCM A;  1YIT N;  1U47 A;  4K41 A;  4TSX A;  3Q7C A;  1K8A O;  3P1G A;  1NKE A;  3MX2 A;  4QS8 A;  4DS5 A;  4GVE A;  1DTQ A;  3KWG A;  4YHH K;  1C0F A;  3CPE A;  4CEO A;  1CXQ A;  4CEZ A;  3A0I X;  3KK7 A;  4DU4 A;  4FJ5 A;  2E4L A;  3QEV A;  4CZJ A;  3HT3 A;  1VQL N;  1WSG A;  3P38 A;  1BU6 O;  4N76 A;  2A1S A;  3NH2 A;  4WFN L;  1ZBU A;  2GBZ A;  2Y1I A;  2ITM A;  3M8R A;  1DKG D;  4BC3 A;  3K57 A;  4H0X B;  3NMU A;  4FWR A;  4K8Z A;  1NGD A;  5DK5 A;  4DU3 A;  3MWP A;  4DTN A;  1N36 K;  4I6M B;  5BR8 K;  3C6T A;  5EVZ A;  2FLO A;  3DLL L;  3CJ1 A;  2UUC K;  3L8B A;  2OPS A;  3P5J A;  3ZX3 A;  4C1N K;  4KPY A;  4ISF A;  3GBT A;  4O4G A;  3V9W A;  2P9L B;  5E41 A;  1C0G A;  4CJP A;  5CZ1 A;  4I6M A;  1TK5 A;  4IKF A;  1CZ9 A;  1QE1 A;  4FK0 A;  3M8P A;  5AQF A;  5C24 A;  1BI4 A;  1JXB A;  4JK9 A;  3O3H A;  4DR6 K;  2ASO A;  2XY8 A;  2QW9 A;  3OYL A;  3ID8 A;  2E1Y A;  4M3U A;  2KTQ A;  3SQ2 A;  3SUO A;  4AHV A;  3DLB A;  1UOC A;  2NZT A;  2G8W A;  3ATV A;  4CJ4 A;  3C7N B;  3O4N A;  3AO2 A;  4DHY A;  2OCE A;  3L2Q A;  1K8K B;  3QIP A;  4PA1 A;  2EX3 A;  4BR4 A;  1ATR A;  4H0T B;  5SWM A;  5JIC A;  4BQL A;  1WLJ A;  3KWI A;  1CZA N;  4DTU A;  4GMJ B;  4HUE A;  1EWQ A;  3VF6 A;  4H0P A;  3C7N A;  3H3O B;  3ULE A;  4YY3 K;  5GIO A;  5AQL A;  3HM8 A;  5MLC Q;  3CCQ N;  3OVN A;  2V51 B;  2Z1G A;  2IC3 A;  1ZXO A;  2QWN A;  3THY B;  3ZT2 A;  2DFF A;  3O08 A;  2HHS A;  3U4L A;  5HBM A;  3SQ1 A;  5AQH A;  4JI0 K;  4M3Y A;  1DGK N;  2XHB A;  4CHO A;  5GAD P;  3SUQ A;  5HRO A;  2XRI A;  1P8Z A;  2YKM A;  2PAV A;  1A5X A;  3GL1 A;  4IOC L;  2IOC A;  4OPH A;  4H5N A;  5EXW A;  3PX0 A;  3RRG A;  1L3T A;  1KVC A;  2YJE A;  5AQM A;  2Q31 A;  2FSK A;  1VQK N;  2CH6 A;  1YAG A;  3D7E O;  4CFC A;  3CFO A;  1NK9 A;  4FJK A;  2BUP A;  4JHD B;  3PO4 A;  3E9O A;  3AA4 A;  4CZF A;  2A41 A;  3QIN A;  3KJV A;  2ASM A;  3L4I A;  5KPZ A;  3EE9 A;  4BRG A;  2YNH A;  3BGR A;  5B8H A;  1LW0 A;  1W0H A;  4BRF A;  4GV3 A;  4JI5 K;  1HJO A;  3HOT A;  3VQ8 A;  5HRP A;  4B3O A;  2HMI A;  2YHX A;  1NK5 A;  1TVR A;  1KCF A;  1S1W A;  4FM1 A;  2HHV A;  3VGK A;  3HPG A;  1D9F A;  4E3S A;  2E88 A;  1XNQ K;  2QKK A;  4I9Q A;  3BZC A;  3VQP A;  1Q81 O;  4DS4 A;  2YCH A;  5FPN A;  3LP1 A;  2QWR A;  1YJW N;  4DTX A;  2GWK A; 
#chains in the Genus database with same CATH homology
 5A2Q O;  4DR4 K;  4LF6 K;  4DR5 K;  5IT9 O;  4LF4 K;  1IBK K;  4K0K K;  4DUY K;  5LMU K;  2UUA K;  4LFC K;  4JI7 K;  4CW7 B;  4X62 K;  4LF8 K;  4DR1 K;  1HNX K;  4YY3 K;  1N32 K;  4DV3 K;  3T1H K;  1J5E K;  4JV5 K;  2HHH K;  4NXM K;  4YHH K;  4JI0 K;  1HR0 K;  2UXB K;  4NXN K;  2F4V K;  1N33 K;  5LL6 Z;  3OTO K;  1HNZ K;  4B3R K;  1HNW K;  4JI1 K;  2E5L K;  3J80 O;  2UU9 K;  2VQF K;  4GKK K;  1XMQ K;  4LFA K;  1FJG K;  4DV4 K;  4X64 K;  3T1Y K;  4DV7 K;  4GKJ K;  4DV5 K;  4JYA K;  4B3M K;  2UXD K;  4X65 K;  4AQY K;  4DR7 K;  5IWA K;  4JI4 K;  4LF7 K;  1XMO K;  1N36 K;  2UUB K;  4JI2 K;  5BR8 K;  2ZM6 K;  2VQE K;  2UUC K;  1XNR K;  4X66 K;  4CVN E;  3J81 O;  4LF5 K;  1N34 K;  1IBM K;  3J7A P;  5AJ3 K;  3J7Y P;  5FLX O;  4JI5 K;  4DV2 K;  4DV6 K;  4DR3 K;  1I94 K;  4JI3 K;  5LMN K;  1IBL K;  4B3T K;  4DR6 K;  2UXC K;  4LF9 K;  4DV0 K;  4JI6 K;  4OX9 K;  4DV1 K;  4DUZ K;  4DR2 K;  4LFB K;  4V19 S;  4B3S K;  1XNQ K;  3JAM O;  4JI8 K;  4KHP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...