4X64K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4x64K00
4LFCK 1HNWK 4JI1K 4YHHK 1J5EK 2ZM6K 1HNZK 2UUBK 2VQFK 4JI7K 2UUCK 1XNQK 2UXBK 1N36K 4JI0K 5BR8K 4JI2K 4DR5K 1XMOK 4LF5K 5IWAK 4JI4K 4GKJK 4LF7K 4B3RK 4DR2K 4LFAK 4DR3K 4DV5K 3T1YK 5LMNK 4JI5K 4LF6K 4OX9K 4DR6K 4JI3K 2UUAK 1IBMK 5A2QO 1N34K 4B3SK 1HNXK 5IT9O 1N32K 4K0KK 4X62K 5LMUK 3T1HK 5LL6Z 4AQYK 1IBKK 1FJGK 4DV3K 2E5LK 1N33K 4NXNK 3JAMO 4DR1K 4JI6K 3J81O 4B3TK 4KHPK 4DUZK 4YY3K 4CVNE 3J7AP 2UXCK 3OTOK 4LF8K 4DV4K 2F4VK 4DV7K 4DV0K 4JI8K 4B3MK 4LF9K 4DV6K 4X64K 4X66K 3J80O 1HR0K 4JYAK 4GKKK 2HHHK 2VQEK 1IBLK 4CW7B 4DV1K 5AJ3K 4NXMK 5FLXO 4X65K 1XNRK 2UU9K 4LFBK 4DUYK 1XMQK 4JV5K 1I94K 4DR7K 4DV2K 4LF4K 4V19S 4DR4K 2UXDK 3J7YP
chains in the Genus database with same CATH superfamily
4F9OA 4CEOA 3H1QA 2LSNA 5AZJA 4W5NA 4CF2A 3TTDA 4YHHK 1NBWA 2VG5A 4FJ5A 5KPZA 1D8YA 3RTVA 3HOSA 4IOAL 1OVYA 2DY4A 1HPZA 4KHYA 3KWGA 3LAMA 1T6CA 1Q7YO 1SL1A 3KLEA 3SBTA 2DFHA 3HPHA 2E2QA 3CG7A 3FZFA 4E7HA 5J2NA 4PHTX 4N56A 3MK6A 2ZJPL 1XMOK 2QEXN 3OYAA 2WONA 3SMSA 1JLQA 4B3RK 2R7YA 1S5JA 3CMEN 2E4LA 4F4KA 3G10A 3CXCM 1FKPA 1T03A 5M1QA 5B8HA 3D6RA 4M7XA 1DEJA 3C0BA 1HKCA 5IT9O 4XH4A 4IFVA 1WB9A 3AO2A 4KREA 4KH6A 2P9LA 3ZETB 5D3GA 3FZLA 4I7FA 3O9QA 3CC2N 4O44A 3C7NA 4A2AA 1DTTA 3LP2A 2HOEA 3M1FA 4FPBA 2OA8A 4OGCA 5HRSA 4KHPK 3QDKA 3KJVA 4CERA 2JWKA 1KD1O 2E88A 4KH4A 4DV4K 4E19A 1S3XA 3ZSOA 4JRPA 4BRCA 3CM5A 3SQ0A 3WXMB 4JKCA 3CI5A 1SQKA 4DS5A 4RWTA 3L2UA 3RRGA 3CJCA 1XQSC 3MXJA 1NGDA 3FE1A 3PIOL 3CCUN 1JLCA 1VQPN 1RTHA 3D2EB 4PKHA 4ZHRA 2Q0RA 4NYNA 3DRRA 4CJRA 3PO4A 1NGAA 3K9KA 1BQNA 3C95A 3HZ6A 5AQYA 3DJCA 5AQMA 5JLFA 4DQRA 2OZMA 4I9QA 3TAPA 4OO1J 3SAHA 3HL8A 1NGBA 1GOCA 3IFRA 2UUBK 4F3TA 3E9OA 3G4SN 1NJZA 2UUCK 2Q3SA 1WOQA 3L4QA 2NRZA 3OYLA 4GY2B 4BRFA 3AGRA 4CFBA 2QM1A 4LF7K 2QWQA 4CHZA 3ZSRA 4FWMA 5ADXH 1B9DA 3BZCA 3RWUA 3ULDA 4KTQA 4C1NK 3B8AX 4H4MA 2BH1A 3M5RA 1BDGA 1UA1A 4CBXA 2FSKA 3R9PA 1GLCG 3OYIA 3AVHA 2IOCA 1ZBLA 4JKGB 4EIAA 5HLFA 2HSTA 1GLDG 4Q0BA 2B5JA 1EWQA 2WC9A 3ISNC 1NK5A 4NLCA 1C1BA 2D5RA 2PFUA 3KLFA 1NK8A 4DSEA 1D4XA 3WXJA 2P51A 4CHPA 4CGHA 5M1NA 3RSEB 5C10A 1NK9A 4HUFA 4M41A 3CCRN 4FLXA 5GINA 1U45A 4CEAA 5C0YA 2HMIA 3QINA 3F9KA 1JJ2M 4OKJA 3TTCA 2Y1JA 3CCMN 4B1UB 3DRPA 2E2PA 2HBLA 3GL1A 3CERA 4M3XA 5HRRA 4DLGA 5AFUH 1D5AA 3QB0A 2OPPA 3MCAB 4IBNA 4JKBA 4CF0A 1T3VA 4IKFA 1TK5A 4N47A 3CMAN 4L8RB 3DXMB 2P9IB 3WNHA 3O3GA 1QQCA 3QIOA 2YHWA 3CPEA 4BROA 1RTIA 3THYA 4KPYA 3CJ9A 3HT3A 2YI1A 1P90A 3NVKA 4K8ZA 4BQLA 4WYBA 1HKBA 4K8XA 4EAHD 2VYPA 4B9SA 1U04A 2D0PA 1MU2A 3QBWA 2O8DB 4FLUA 2A5XA 1EO1A 3SAGA 2G8WA 4LH5A 4EFHA 3TTFA 3LWMA 4BRDA 1BUPA 2KQ2A 4FLVA 2E6MA 3RMDA 3WNGA 4B08A 3LDPA 4BWMA 3SZ2A 4LF5K 1NLVA 3AVMA 3VGLA 4DSFA 1YIJN 3KKSA 4CE9A 4DR2K 4DR3K 4KHQA 3SQ2A 2RE2A 4E1MA 3LPTA 3I55N 1K8AO 3UKUB 2F9TA 4DR6K 4JI3K 4BE2A 3VQPA 3OJSA 1N34K 3G0ZA 3ATUA 1HNXK 4H0PA 5KRSA 3E9PA 3T1HK 4AQYK 4J2DA 1IH7A 4UQGA 1FJGK 3WQUA 3O3FA 3MEEA 4IG3A 4B9QA 3OYDA 3U3YA 4L3QA 1BISA 3ZT3A 1NJWA 1EXQA 2GX9A 4BR9A 3A5LC 4BC4A 3OA9A 4W5TA 4B3TK 4PQUA 1QSLA 1RGIA 4BR4A 4KB1A 5FDLA 1OKJA 1RDBA 1ZBUA 4IWVA 1JCFA 3FZKA 1WSIA 4CF9A 4IXCA 5HL7L 3HJFA 3HSTB 5BRHA 1EQYA 3LM2A 4ZTFA 3IMXA 1TKDA 4FZXC 3CC4N 1BOTO 3D2FB 3FFIA 2NRTA 2QXLA 1V4TA 2PZSA 3PX6A 4EZ9A 2ZQBA 4HCBA 4QAGA 5AQOA 1SAZA 3VEZA 4BRLA 1TK0A 1VSEA 3AO1A 5GIOA 3SJHA 1DTQA 4MLHA 4DKWA 4EP4A 3CJAA 1KC8O 3G71N 2HHXA 3O1BA 4KV8A 1HLUA 2E1ZA 1R59O 3K5MA 2OCEA 1RBUA 3EKSA 1YUWA 5F1XA 1YTUA 1Q9YA 3E01A 4DSLA 1SKRA 2KHOA 1ESVA 1XC9A 5AQWA 3P5JA 3QIPA 4FXDA 1XWLA 3THWB 4R79A 1CLQA 1QSSA 1TGOA 3SJJA 3VTIA 4CHYA 1TYQB 3HVTA 2A6AA 4DTRA 4H5RA 3OYJA 4IFYA 1IKXA 4J8FA 1B9FA 5SZTA 3BF3A 1G99A 4DV5K 4IJNA 2A3ZA 1FKOA 3MDQA 4HVJA 2BANA 2P9KB 4AILC 4JHDA 2FSNA 3TSUA 5LMUK 3KKRA 1HPMA 3HTVA 1J9AA 3TANA 1GOBA 1QHTA 4H5WA 1BL3A 1KAYA 2CGLA 3HM9A 3H3OB 3ENOA 4KO0A 4DLEA 2HW3A 4DUZK 1MA9B 1L3SA 4CF8A 3A5OC 1RT2A 2F7TA 3AO4A 2UXCK 4DS4A 3D7EO 4NYFA 1YF5L 5I3UA 1K8KA 4C23A 3GG4A 3CFOA 3BY5A 4ISFA 3ZT4A 4I6MA 4DB3A 1HR0K 4FJKA 4ISGA 4CD1A 1TVRA 1GLBG 1EKEA 3OBWA 3EE9A 4Y1DA 4OPJA 4O0JA 4RW7A 4IDKA 4ELVA 3NF7A 1XNRK 3S9HA 3M6GA 3QESA 2AP1A 3SUOA 1XUPO 4E89A 3TAMA 3DMJA 4FJHA 5GIPA 1QE1A 3F5TA 4QS8A 2HF4A 4OKKA 1SS6A 4RW8A 3PLAA 4AHSA 2O8CA 3O9RA 2RPIA 3ENBA 3NHGA 1CZAN 4MLEA 2IC3A 1VSKA 4DFKA 4B9UA 2E1YA 1GLLO 4WQ5A 3TAFA 4Z4EA 1LWEA 4YORA 3LM9A 3K0SA 2UXBK 1HMVA 5KPTA 2KKZA 5J2QA 4JS5A 1WBDA 4CJ3A 3H45C 1VRTA 4CIEA 4FCYA 4JKHA 1UA0A 1NGGA 4ILHA 4BE0A 2FF3B 5LJWA 1DGKN 4YDUA 5F0XA 1QHAA 1NK7A 2RHKA 2HBMA 4BWJA 3VEYA 3MEGA 1JCEA 1KRPA 4CFCA 1HX1A 4CJTA 2IAJA 3SYZA 3PY8A 4Z4FA 2D4WA 5GADP 4CJ7A 2XY5A 2Q0UA 3SPYA 4BVOA 4B3SK 4C8MA 3DXMA 4JS4A 4LH4A 4CZGA 1IBKK 2FC0A 1S72N 3K57A 2KW4A 3WXIA 4YOWA 1N33K 4PA1A 2AA4A 4CFAA 3K5OA 4LC9B 3AVGA 4N76A 3F2KA 3AARA 3D0PA 3DOKA 4BRHA 1RT5A 4HHTA 3FZHA 4CVNE 3NGYA 3OTOK 4WCEL 2YJFA 1NMNA 2FBYA 4DV7K 4DSKA 1TAQA 4BC2A 2Q1NA 4FLYA 1MDUB 2A1RA 4DQSA 1JLFA 3SK3A 2NZTA 3K5NA 3LALA 4OLAA 2Q31A 3OS2A 4CEQA 2HHUA 1NKCA 4M3ZA 2V7YA 2XY8A 2ZWHA 3OVNA 3EZ5A 2I7NA 3UB5A 1I94K 3UKUA 1RDCA 5EXWA 1X9JA 4CZHA 3CCSN 4CD3A 4BE1A 2PY5A 4KB0A 5AZIB 1BI4B 3U3GA 3OYBA 1C1CA 5DM7L 2D0AA 3TARA 3WNEA 3IKMA 1C0UA 2HF3A 1YJWN 3KHYA 2HHSA 3LDSA 4DTSA 3NE6A 1U6ZA 4CJEA 3HPOA 2DTUA 3VF2A 2OPQA 4IJAA 4KKOA 4JEPA 1KAZA 4JAXA 3ULEB 1QVFM 4DSJA 5BN8A 2ATQA 1N6QA 1TV6A 2HVIA 4K43A 4FK4A 3DAWA 5DK5A 5HOOA 1WSGA 2V51B 3NF6A 5KQ8A 4FWSA 3ZSZA 1GOAA 1Z6RA 1NJYA 2V7ZA 3SNNA 1JKHA 4TSXA 1VQ5N 1KAXA 3ZT2A 4DFPA 3DLGA 2D1KA 1Y97A 3VMFB 1VQ4N 2Z1JA 4NCGA 1GLJO 4CEDA 4CZKA 2YHYA 1ASVA 3KK2A 4F3OA 1QS4A 1J6ZA 3UKRB 2E2OA 2IS3A 1W97L 4FL9A 2NRVA 3H08A 4BQZA 4OPHA 4JD2A 4B3MK 3UIQA 3FLCO 4DV6K 1S22A 3SV4A 1HNIA 5FPMA 3LANA 2ZJRL 3B6OA 1VQKN 4FZZA 1A5XA 3VEVA 3RMCA 3O8MA 2XO7A 4H0XB 4CW7B 4CI6A 3MWPA 2OTLN 1VQ9N 2FBVA 3DLKA 3C6UA 3DLLL 4X65K 1BO5O 3PSFA 4DFJA 1NKBA 3KD1E 1BU6O 1VSIA 5M1FA 2P9KA 4BGBA 5M1OA 1M1KO 3IAYA 1Y64A 2HMPA 3S3NA 1NM1A 2Y1IA 3FZMA 3NVMA 4HUGA 5AQPA 3HXMA 3O9TA 4ILJA 3BF1A 4B9LA 3I8DA 4WFAL 4HUEA 3PO5A 1E4FT 4JI7K 4E1NA 1BA0A 4WQ5C 3VF6A 2P9NB 3SUNA 3VF4A 2KFZA 3VGKA 4DR5K 3SCXA 3L8BA 1U2VA 3O4NA 4C1NI 1BA1A 3QO9A 1L5UA 3AA2A 3EL2A 4GVEA 3MEDA 3ZSWA 2O8BA 3T1YK 2QXFA 3V9XA 4BRIA 1FXXA 3WNFA 4OJRA 4UY8O 1WSFA 2AJQA 3PV8A 2UUAK 1IBMK 1C0FA 1ZC6A 3J7ZO 2Q36A 1BG3A 2G8IA 3P83D 3OYKA 2WUSA 2W40A 3I8BA 1QQMA 3VQ9A 3DM2A 4JNEA 4A5AA 4DCHA 1NJIO 4BR2A 2PBDA 4B8AB 1K6YA 3DWLA 5FPDA 2OYQA 2OPSA 3JS6A 5AQIA 3TAGA 4FJ9A 4YY3K 1P8ZA 3MN6A 4ILGB 4PKGA 1OH6A 3AA5X 4BR5A 1MWMA 3OYMA 3DLRA 1E3MA 5AQVA 4GW6A 4CK3A 4IFEA 4E7KA 3CJ1A 3K59A 1BHLA 3QNOA 2NRHA 1NOYA 1F21A 3EE8A 4JK8A 4LF9K 2A41A 3VQ7A 1VSHA 4HTUA 3VEOA 3T19A 4DF8A 2O8FB 1TKTA 1VSJA 3Q7BA 4EP5A 3CCVN 4GVMA 3ZLJA 3LDOA 4M63C 2ZE2A 1L3TA 3LDLA 2HHVA 4O0IA 4AM6A 3L3UA 1TUUA 2PAVA 1U4BA 4DTNA 1VSMA 2ETJA 2UU9K 5TKYA 1LWCA 3JSMA 1W2BM 4LSLA 5BN9A 5LJVA 5C42A 3U6FA 1VSDA 2HHTA 2P9PA 1NNEA 4CZIA 3MN7A 4LFCK 2O8EA 1YAGA 2BTFA 3EZWA 3LDNA 2DPNA 3VQ5A 4DWIA 2WOMA 4BR0A 1TAUA 5DMRA 3ENHA 4GNIA 4DU3A 1VSFA 2P9SB 3NF9A 1FK9A 2YKMA 2WBNA 2OPRA 3VA0A 1EX4A 3SUQA 3OYCA 1Q81O 1GLEG 1X3MA 3ATVA 3VESA 2EWSA 1VRUA 2FBTA 4QOZB 4LY7A 3ZEUB 1YI2N 3RR7A 3SI6A 3K58A 3SV3A 3HPGA 1LAWA 2P9UB 1QTMA 3CYMA 5K14A 1HQEA 5A2QO 1N32K 3P31A 3C6HA 3RMAA 1RTDA 3EN9A 1QSYA 4K42A 1HQUA 5J2PA 4M3TA 4DF4A 3QFUA 2CH5A 4DQPA 2YNHA 3BDPA 3I56N 1KVCA 3U8XA 4DQ8A 4LD0A 1NGCA 2P1JA 3VGMA 5AZIA 2YHBA 2G8FA 2D0BA 1VSLA 4F2SA 1ITGA 4A5BA 4LF8K 3J7AP 4JK7A 1SKSA 4FWKA 5AQUA 3TWHA 2BGGA 1NGHA 3M8QA 4Z4CA 1CZ9A 3A0IX 2W42A 1RT1A 3THXA 4H5TA 3MXIA 3A2FA 4NO7A 4YOXA 4B9MA 5C12A 4CJ4A 2JWLA 1IBLK 2YKNA 4KTZA 4C8NA 4IOXA 1RT4A 3GE1A 3KWIA 1VQ8N 3CM6A 1RT3A 4XEIA 3CF5L 2XY6A 3AVKA 1NK4A 4DTPA 4MDAA 3N4PA 1RILA 3KIOA 4IO9L 4WFBL 3WEEB 4OLBA 1HYVA 3U4LA 3VQBA 3NH1A 4O8UA 4GMJB 5I42A 5AR0A 3QEVA 3K9JA 2B4JA 5E41A 3ZCMA 1J5EK 4JKDA 4JK9A 2ZM6K 3AVCA 4HTLA 4QS9A 2QKBA 5CZ2A 2DFEA 3Q7CA 2VQFK 1LOTB 4WF9L 4NCAA 5AQNA 1ZYQA 5C15A 5MLCQ 3F73A 1XNQK 2O4IA 5AZJB 4H0VB 4OKEA 3VQDA 1BWFO 3VETA 3EO3A 4AHCA 2IVNA 4CHOA 1BIUA 1LWFA 2P5GA 4GKJK 4JI4K 3AVAA 3SQ1A 3C6TA 4M3RA 1VQON 4XH1A 3ZETA 1ZXOA 3KLIA 2QW9A 4AHUA 5AQGA 4U7BA 4FM2A 3V4IA 5JS1A 1RBRA 1RDUA 4PUOA 3OYGA 4EZ6A 3PSIA 3OYFA 4BG9A 2ZJQL 5FPEA 3TAQA 1ZBHA 1XHZA 1LV5A 3NCIA 5AQXA 1NJXA 1C0GA 4NXNK 1J54A 2CGJA 4J2BA 1IKVA 1TKZA 4M3UA 4BRMA 1TUYA 3IDHA 1XHXA 1KFDA 4Q5VA 4A61A 2X74A 4B9VA 2QK9A 2F4VK 4BVPA 3C7NB 3THVA 3D2EA 2HVHA 5JMVA 4DV0K 1KSPA 4GV9A 5E26A 2A1SA 4BG8A 3VTHA 4FOIA 1OH7A 3M8RA 4J2EA 1TKXA 2VGNA 4FWLA 4JYAK 1LW0A 4FLWA 4B1VA 3M3ZA 4H0YB 4JRQA 1NMDA 1VQNN 5JVGL 3O1WA 2HBJA 1GLAG 1SKWA 4FZYA 3ZYYX 3CQ8A 1IJJA 2ITGA 1KVBA 1QZ5A 1DT9A 2FSJA 4NLBA 4OGEA 4AHVA 4MFBA 1IG9A 4ID5A 1Q82O 1JXBA 2QWLA 5AFUA 4FW2A 4YOYA 1RBSA 1VAZA 4ID1A 4B9NA 4Z4HA 2I7PA 3QEIA 1XI1A 2A42A 1R0AA 2KTQA 4CEEA 2VWBA 5BREA 1VQLN 4DTJA 3CC7N 4OVLA 3V9SA 1RTJA 1A5WA 4OPKA 5C25A 5EX5A 4JI0K 4CZEA 3NAEA 1Q9XA 5CZ1A 2ZGYA 3TABA 3OS1A 4F2RA 3AO3A 5FRMA 5H1SQ 4JKGA 4CBUA 2J4RA 3TPQA 4FJXA 1NWKA 4C8LA 4FJIA 4CK2A 4XH5A 4IG0A 4MO4A 4AM7A 2VGMA 4QS7A 2VCPA 3R6MA 3E9LA 3WXLA 1YVNA 1C1AA 3RSEA 3BP8A 4MQ3A 4X62K 2YJEA 5CYQA 3AAPA 4CBWA 2HHWA 2F96A 5JS2A 2GELA 2HNYA 3FR0A 3TU5A 1YHQN 3BEXA 3CHWA 3O80A 4DR1K 1Z25A 2ASOA 1HYSA 5FROA 2QWOA 3KVGA 3MWTA 2YCHA 4BDPA 4CCHA 4EHUA 1V4SA 5HBMA 3O9UA 2P9IA 3OW2M 3L3VA 3L2WA 2FLOA 3ZSVA 3PIPL 3BGRA 3MN5A 4BDZA 4CGDA 4CK1A 1WLJA 4CZJA 3HM8A 4KI6A 1YT3A 1YVUA 5BRFA 1YJ9N 1KTQA 2QWMA 2HHHK 2HBKA 5GAGP 4CJFA 3AVJA 3NH0A 2ITMA 1WSEA 2RN2A 2IIRA 1NG9A 3U9ZA 5J2MA 3DLEA 1A5VA 3IRXA 3LL3A 2O8DA 1MWKA 4DV2K 4V19S 2UXDK 4CGFA 1KFSA 4A62A 3VEWA 3T69A 3MX2A 2G8HA 4JI1K 4FJNA 3D45A 3CCEN 4A59A 3THYB 4BRAA 3EYZA 4WE1A 1HNZK 3I33A 2HNZA 2KZZA 4FPAA 1RBTA 3R3LA 1X9SA 4OPAA 3B6PA 3DXKB 3KLHA 2W6KA 5DM6L 3KK1A 1RNHA 3P38A 4FVMA 4H0TB 3LWLA 3KZBA 1FW6A 1WUAA 4PY5A 2F9WA 4M45A 1S1XA 4IOCL 3S3MA 2Q2RA 5KGWA 2VWJA 4BDYA 2QWNA 1WNSA 5HRPA 4CECA 1I39A 3S41A 4E1JA 5KGXA 4H5VA 1L3VA 4E0DA 1LW2A 4CJWA 2B6AA 3AGKA 4JLHA 3VQ4A 1OH8A 3N4QA 3JAMO 5AQLA 1UOCA 3OYNA 1RBVA 3ITHA 2X6NA 3J81O 1N5YA 5F2RA 1G15A 2F8TA 3D2FA 5JVHL 2WFBA 1EWRA 3L0QA 4CJSA 3IUCA 3OHRA 2GV9A 4I2QA 3O08A 4W5OA 3K2PA 5BPNA 2O4GA 3J8AA 3ID8A 1ATRA 3CFPA 4M3WA 3AA4A 3A5MC 2OANA 4GKKK 2VG7A 5M1KA 4ZTJA 3O5BA 1Q8IA 1S1VA 1BCMA 3PUFA 1WSHA 5AJ3K 1NK6A 3NDKA 3C65A 3AAQA 4DUYK 4DR7K 2EHGA 3LZIA 4W5RA 3VQEA 4A57A 3OS0A 2P5OA 1SL0A 4DU4A 1CXQA 4CJVA 1GLFO 1CXUA 3THWA 2YHAA 3QMLA 1TYQA 3HI0A 1NU0A 4O55A 4H4OA 1B92A 1W7AA 5KQDA 4KFBA 1RFQA 4YNQA 4IEIA 2ZD1A 3CD6N 4FWRA 1X9MA 4BR7A 4DQIA 3I0SA 4M3YA 1JLBA 2RKIA 2ASPA 2JLEA 1IV0A 5HP1A 4YFUA 1WAFA 4O4GA 1RDAA 1JCGA 2NRRA 5CY4A 1J5OA 4H8KA 1S1TA 1S1UA 3HP6A 3ZX0A 4FSVA 4DTOA 2X78A 1D9DA 2YNGA 2HB5A 1QZ6A 2PYLA 1D9FA 3ZSXA 3E1YA 3V1RA 3EY1A 4C8KA 4G9ZA 4CHQA 4CEBA 4HCCA 3ALYA 5HROA 1C0TA 4MO5A 1HNVA 3QEXA 4CHNA 5HRNA 1T05A 4I2PA 5C2DA 3QETA 4JHDB 1LAVA 5CR4A 3WT0A 4FJMA 4JI6K 4YDUC 2XRIA 3T7ZA 3O6WA 5EVZA 2I5JA 3UE5A 4DHYA 4RW6A 1H1VA 1T6DA 2XHBA 2NNWA 2YNFA 4YOVA 1ZBFA 1OH5A 1HJRA 3TI0A 2JGUA 3V9WA 3KK3A 4JI8K 1ZBSA 1X3NA 2YHXA 3G25A 1NGEA 4KHSA 4BC5A 4X66K 2OTJN 1DKGD 3J80O 1U48A 5AQQA 4N41A 1T44A 2BUPA 2QI2A 4BRNA 4AH9A 3MAQA 1HYZA 1K8KB 4H5NA 1NKEA 2KZMA 2D0CA 1NGJA 3HOTA 4HWIA 4I6MB 4JV5K 5T7BA 4E7JA 3VA3A 2GWJA 3S3OA 4LF4K 2FF6A 2G8UA 1SZ2A 4KI4A 4NB4A 3VQ6A 1DLOA 4CIFA 1O1WA 1TL1A 3P1GA 3MECA 3HK2A 3DOLA 4E7LA 3MXMA 3MX5A 3H46O 3NF8A 5LY3A 2A40A 1K9MO 3K5LA 5KRTA 3LP3A 3A8YA 2G8VA 3ZSQA 2QWRA 2YV0X 4BRQA 3ZX3A 4KH5A 4FK0A 5AQHA 2O8CB 3AVNA 4BRPA 4DG1A 3AVBA 3A5NC 4B9TA 1HRHA 1C6VA 4FW1A 3SQ4A 3AA3A 4CJ5A 3QEPA 1K73O 1ASUA 3PX0A 4FJLA 3GDQA 4B1YB 4JI5K 4FLTA 1JXEA 3HP9A 1EP4A 4CJPA 4DFMA 1WSJA 2GBZA 3BUZB 3E66A 5EU7A 3HO1A 2QTDA 3NMUA 4MDBA 4DV3K 2HNDA 1RDWX 4O8KA 2VWKA 1KXPA 1YTAA 4GV6A 4PKIA 2GUIA 3MN9A 4BACA 2KLAA 4E3SA 2Z1IA 3BZKA 3AVLA 5CYMA 4PWDA 1T7PA 2RF2A 2IGIA 1JL1A 1Z05A 3O9SA 4CESA 4IZ9A 4A2BA 1NK0A 1I3AA 2QKKA 1C0MA 3DLBA 3OYHA 1U47A 2HHQA 4DSIA 1RDDA 3L2QA 4KTWA 3DRSA 2GWKA 4CEFA 3M8SA 3DXKA 1ATSA 2VG6A 4BRGA 1SL2A 1IKYA 4CZFA 3LAKA 2X6SA 4CEZA 1IO2A 1BI4A 4JKFA 4CJQA 5FLXO 3VERA 3W3DA 3LZJA 4DU1A 4LFBK 3VOVA 5AQTA 3TR8A 4O5FA 3ZSYA 4DR4K 1X9WA 1KVAA 2F8SA 1Q18A 4YOTA 3ZX2A 5KTQA 4FYDA 3W0LA 4FWNA 1IG8A 4Z0UA 1JL2A 4KAZA 3IG1A 3ULEA 1YJNN 2E2NA 1T8EA 4RTFD 4JKAA 5C24A 1S6QA 3OJUA 1ATNA 3LDQA 2G8KA 4FJ7A 3QERA 3SLCA 3M8PA 3IS9A 4I9LA 5BR8K 4B3OA 3ZT0A 3JYTA 2ASMA 2IVPA 5ELZA 4LSNA 2Z1HA 4W5QA 5TKWA 1S9GA 5BPMA 3GOIA 5J1EA 3NGIA 3ASMA 3QEWA 4DMNA 4CGJA 4FWQA 4IEEA 3OBYA 3V81A 2XY7A 3EKUA 1VK0A 4ELTA 3PX4A 4LF6K 3KTQA 4H0OA 3CQYA 5AQJA 4PL8A 3I0RA 4ISEA 4Y0WA 4K0KK 1S9EA 4CFDA 5CHIA 3UKRA 3R1XA 1S6PA 4FJ8A 3T3FA 1HJOA 3O4WA 4WQ4A 3VQAA 4CF1A 3QLHA 5AQKA 4WFNL 4FO0A 2YNIA 1NOZA 4Z94A 3HRGA 4KHNA 3AV9A 4K41A 2E20A 3VQCA 3RR8A 3CCLN 4N5SA 2GTDA 1YITN 4JKEA 5BR9A 4FK2A 4KHUA 1JLGA 4EHTA 3TAEA 1W0HA 4FJGA 4KRFA 3HVRA 3RRHA 2GUPA 5ADXA 2GEMA 3MCPA 3F9MA 2VQEK 4RCHA 4JD2B 5GAHP 3CCJN 2P9LB 4IDHA 1NGIA 1QQOA 1VHXA 4B8CA 4AHRA 3SAFA 2NUBA 4KHWA 2PYJA 3CETA 1XMQK 5JLHA 1XC3A 2WTUA 1QQNA 4RW9A 3RVCA 1BQMA 4B1WB 1J53A 4NCBA 4FM1A 2P9NA 4AF1A 2NRXA 3ID6A 3AY9A 3G6EN 3DLHA 1CZBA 3V1OA 3AVFA 2IDOA 2DFFA 3LP0A 4R5PA 4M42A 1WBBA 5GAEP 1N36K 3ZT1A 4CJLA 4DTMA 3QBXA 4H03B 4B1ZA 1UAXA 4F8RA 3MMVA 5IWAK 5JICA 3CFRA 4FJJA 2BE2A 3QFPA 4LFAK 3CJBA 3H6EA 4CGIA 5AQFA 3TSQA 4DTUA 1REVA 5LMNK 4QCLA 1RT7A 4OX9K 1E4GT 1S1WA 1ZBIA 4K25A 4CZLA 3AO5A 1BGXT 1U2VB 2QWPA 4ELUA 2O8BB 4CIGA 3HYFA 4CJUA 3LPUA 3VQQA 5I9EB 1KLMA 4FWPA 3VEXA 5BRDA 2E5LK 4FOEA 3SBGA 5CE3A 1RCHA 3VN5A 4KBOA 1KLNA 4BREA 3U9DA 3CQXA 1ASWA 3H1VX 3VPZA 5EY4A 1KQSM 2O8FA 4IO8A 3KK7A 1Z26A 2FXUA 3CJ7A 3SPZA 3L2RA 3CPWM 1QVGM 3AVIA 3VQ8A 4DQQA 1HKGA 5M1PA 1O13A 5EOYA 1U49A 1SUQA 4X64K 4BY9C 2E8AA 3FGUA 1VQ6N 1WAJA 2W6LA 1EETA 3NGZA 3KD5E 2CH6A 3P39A 5AQSA 4O5BA 4C8OA 4CJKA 4FLZA 4DV1K 4FWOA 1TL3A 3JXUA 3WXKA 4BC3A 4BRKA 1ILYA 5KPRA 1L3UA 4YOUA 3QNNA 1LCUA 2D0OA 3O4QA 2P9SA 3RMBA 3C6AA 2ZF5O 3DYAA 3O3HA 1HNWK 3V9ZA 2OZSA 2ZGZA 2E6LA 1SV5A 4Y1CA 3SUPA 4RW4A 1VQ7N 4Z4GA 1W9HA 1VQMN 3HSCA 4DTXA 4BGAA 3NFAA 3H3NO 5E84A 5FRNA 2CGKA 3DI6A 2P9PB 3V9UA 2O8EB 3ZEUA 3V6DA 3NBPA 1NGFA 4JI2K 2P9UA 3L2VA 1JLAA 4XIUA 3HBTA 2IVOA 1M90O 2YX6A 2EX3A 1WN7A 1Q86O 4RG8A 3P4IA 3NH2A 5AQRA 1JLEA 4FM0A 3R8EA 4JN4A 2KFNA 2Z1GA 4PL7A 3OYEA 5BPLA 5LL6Z 2UYTA 3L4IA 5SWMA 4ICLA 1KCFA 2V52B 4AHTA 3C94A 1X1PA 4E7IA 4Z4IA 4M7YA 3L6QA 3QICA 1UWBA 4WQ4C 1IKWA 2FBXA 3T1AA 2NLXA 1YXQA 1HUXA 2QA4N 4J2AA 5AQZA 2W41A 3CIPA 3GBTA 3WQTA 5C2FA 5KI6A 1RT6A 3V1QA 3WUHA 2Q97A 2BDPA 3SMPA 1TK8A 1OVQA 2H3GX 1BIZA 3VENA 1N8RO 4FVUA 3CCQN 1BCOA 3WEEA 4GV3A 5FPNA 4CGGA 2NRWA 4G1QA 3FFKB 3LP1A 4NXMK 3TSPA 3EEQA 3THXB 3OY9A 4B1XB 3KLGA 4U67L 4CZMA 3J7YP
chains in the Genus database with same CATH topology
4LFCK 1HNWK 4JI1K 4YHHK 1J5EK 2ZM6K 1HNZK 2UUBK 2VQFK 4JI7K 2UUCK 1XNQK 2UXBK 1N36K 4JI0K 5BR8K 4JI2K 4DR5K 1XMOK 4LF5K 5IWAK 4JI4K 4GKJK 4LF7K 4B3RK 4DR2K 4LFAK 4DR3K 4DV5K 3T1YK 5LMNK 4JI5K 4LF6K 4OX9K 4DR6K 4JI3K 2UUAK 1IBMK 5A2QO 1N34K 4B3SK 1HNXK 5IT9O 1N32K 4K0KK 4X62K 5LMUK 3T1HK 5LL6Z 4AQYK 1IBKK 1FJGK 4DV3K 2E5LK 1N33K 4NXNK 3JAMO 4DR1K 4JI6K 3J81O 4B3TK 4KHPK 4DUZK 4YY3K 4CVNE 3J7AP 2UXCK 3OTOK 4LF8K 4DV4K 2F4VK 4DV7K 4DV0K 4JI8K 4B3MK 4LF9K 4DV6K 4X64K 4X66K 3J80O 1HR0K 4JYAK 4GKKK 2HHHK 2VQEK 1IBLK 4CW7B 4DV1K 5AJ3K 4NXMK 5FLXO 4X65K 1XNRK 2UU9K 4LFBK 4DUYK 1XMQK 4JV5K 1I94K 4DR7K 4DV2K 4LF4K 4V19S 4DR4K 2UXDK 3J7YP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC K;  1HNW K;  4JI1 K;  4YHH K;  1J5E K;  2ZM6 K;  1HNZ K;  2UUB K;  2VQF K;  4JI7 K;  2UUC K;  1XNQ K;  2UXB K;  1N36 K;  4JI0 K;  5BR8 K;  4JI2 K;  4DR5 K;  1XMO K;  4LF5 K;  5IWA K;  4JI4 K;  4GKJ K;  4LF7 K;  4B3R K;  4DR2 K;  4LFA K;  4DR3 K;  4DV5 K;  3T1Y K;  5LMN K;  4JI5 K;  4LF6 K;  4OX9 K;  4DR6 K;  4JI3 K;  2UUA K;  1IBM K;  5A2Q O;  1N34 K;  4B3S K;  1HNX K;  5IT9 O;  1N32 K;  4K0K K;  4X62 K;  5LMU K;  3T1H K;  5LL6 Z;  4AQY K;  1IBK K;  1FJG K;  4DV3 K;  2E5L K;  1N33 K;  4NXN K;  3JAM O;  4DR1 K;  4JI6 K;  3J81 O;  4B3T K;  4KHP K;  4DUZ K;  4YY3 K;  4CVN E;  3J7A P;  2UXC K;  3OTO K;  4LF8 K;  4DV4 K;  2F4V K;  4DV7 K;  4DV0 K;  4JI8 K;  4B3M K;  4LF9 K;  4DV6 K;  4X64 K;  4X66 K;  3J80 O;  1HR0 K;  4JYA K;  4GKK K;  2HHH K;  2VQE K;  1IBL K;  4CW7 B;  4DV1 K;  5AJ3 K;  4NXM K;  5FLX O;  4X65 K;  1XNR K;  2UU9 K;  4LFB K;  4DUY K;  1XMQ K;  4JV5 K;  1I94 K;  4DR7 K;  4DV2 K;  4LF4 K;  4V19 S;  4DR4 K;  2UXD K;  3J7Y P; 
#chains in the Genus database with same CATH topology
 4F9O A;  4CEO A;  3H1Q A;  2LSN A;  5AZJ A;  4W5N A;  4CF2 A;  3TTD A;  4YHH K;  1NBW A;  2VG5 A;  4FJ5 A;  5KPZ A;  1D8Y A;  3RTV A;  3HOS A;  4IOA L;  1OVY A;  2DY4 A;  1HPZ A;  4KHY A;  3KWG A;  3LAM A;  1T6C A;  1Q7Y O;  1SL1 A;  3KLE A;  3SBT A;  2DFH A;  3HPH A;  2E2Q A;  3CG7 A;  3FZF A;  4E7H A;  5J2N A;  4PHT X;  4N56 A;  3MK6 A;  2ZJP L;  1XMO K;  2QEX N;  3OYA A;  2WON A;  3SMS A;  1JLQ A;  4B3R K;  2R7Y A;  1S5J A;  3CME N;  2E4L A;  4F4K A;  3G10 A;  3CXC M;  1FKP A;  1T03 A;  5M1Q A;  5B8H A;  3D6R A;  4M7X A;  1DEJ A;  3C0B A;  1HKC A;  5IT9 O;  4XH4 A;  4IFV A;  1WB9 A;  3AO2 A;  4KRE A;  4KH6 A;  2P9L A;  3ZET B;  5D3G A;  3FZL A;  4I7F A;  3O9Q A;  3CC2 N;  4O44 A;  3C7N A;  4A2A A;  1DTT A;  3LP2 A;  2HOE A;  3M1F A;  4FPB A;  2OA8 A;  4OGC A;  5HRS A;  4KHP K;  3QDK A;  3KJV A;  4CER A;  2JWK A;  1KD1 O;  2E88 A;  4KH4 A;  4DV4 K;  4E19 A;  1S3X A;  3ZSO A;  4JRP A;  4BRC A;  3CM5 A;  3SQ0 A;  3WXM B;  4JKC A;  3CI5 A;  1SQK A;  4DS5 A;  4RWT A;  3L2U A;  3RRG A;  3CJC A;  1XQS C;  3MXJ A;  1NGD A;  3FE1 A;  3PIO L;  3CCU N;  1JLC A;  1VQP N;  1RTH A;  3D2E B;  4PKH A;  4ZHR A;  2Q0R A;  4NYN A;  3DRR A;  4CJR A;  3PO4 A;  1NGA A;  3K9K A;  1BQN A;  3C95 A;  3HZ6 A;  5AQY A;  3DJC A;  5AQM A;  5JLF A;  4DQR A;  2OZM A;  4I9Q A;  3TAP A;  4OO1 J;  3SAH A;  3HL8 A;  1NGB A;  1GOC A;  3IFR A;  2UUB K;  4F3T A;  3E9O A;  3G4S N;  1NJZ A;  2UUC K;  2Q3S A;  1WOQ A;  3L4Q A;  2NRZ A;  3OYL A;  4GY2 B;  4BRF A;  3AGR A;  4CFB A;  2QM1 A;  4LF7 K;  2QWQ A;  4CHZ A;  3ZSR A;  4FWM A;  5ADX H;  1B9D A;  3BZC A;  3RWU A;  3ULD A;  4KTQ A;  4C1N K;  3B8A X;  4H4M A;  2BH1 A;  3M5R A;  1BDG A;  1UA1 A;  4CBX A;  2FSK A;  3R9P A;  1GLC G;  3OYI A;  3AVH A;  2IOC A;  1ZBL A;  4JKG B;  4EIA A;  5HLF A;  2HST A;  1GLD G;  4Q0B A;  2B5J A;  1EWQ A;  2WC9 A;  3ISN C;  1NK5 A;  4NLC A;  1C1B A;  2D5R A;  2PFU A;  3KLF A;  1NK8 A;  4DSE A;  1D4X A;  3WXJ A;  2P51 A;  4CHP A;  4CGH A;  5M1N A;  3RSE B;  5C10 A;  1NK9 A;  4HUF A;  4M41 A;  3CCR N;  4FLX A;  5GIN A;  1U45 A;  4CEA A;  5C0Y A;  2HMI A;  3QIN A;  3F9K A;  1JJ2 M;  4OKJ A;  3TTC A;  2Y1J A;  3CCM N;  4B1U B;  3DRP A;  2E2P A;  2HBL A;  3GL1 A;  3CER A;  4M3X A;  5HRR A;  4DLG A;  5AFU H;  1D5A A;  3QB0 A;  2OPP A;  3MCA B;  4IBN A;  4JKB A;  4CF0 A;  1T3V A;  4IKF A;  1TK5 A;  4N47 A;  3CMA N;  4L8R B;  3DXM B;  2P9I B;  3WNH A;  3O3G A;  1QQC A;  3QIO A;  2YHW A;  3CPE A;  4BRO A;  1RTI A;  3THY A;  4KPY A;  3CJ9 A;  3HT3 A;  2YI1 A;  1P90 A;  3NVK A;  4K8Z A;  4BQL A;  4WYB A;  1HKB A;  4K8X A;  4EAH D;  2VYP A;  4B9S A;  1U04 A;  2D0P A;  1MU2 A;  3QBW A;  2O8D B;  4FLU A;  2A5X A;  1EO1 A;  3SAG A;  2G8W A;  4LH5 A;  4EFH A;  3TTF A;  3LWM A;  4BRD A;  1BUP A;  2KQ2 A;  4FLV A;  2E6M A;  3RMD A;  3WNG A;  4B08 A;  3LDP A;  4BWM A;  3SZ2 A;  4LF5 K;  1NLV A;  3AVM A;  3VGL A;  4DSF A;  1YIJ N;  3KKS A;  4CE9 A;  4DR2 K;  4DR3 K;  4KHQ A;  3SQ2 A;  2RE2 A;  4E1M A;  3LPT A;  3I55 N;  1K8A O;  3UKU B;  2F9T A;  4DR6 K;  4JI3 K;  4BE2 A;  3VQP A;  3OJS A;  1N34 K;  3G0Z A;  3ATU A;  1HNX K;  4H0P A;  5KRS A;  3E9P A;  3T1H K;  4AQY K;  4J2D A;  1IH7 A;  4UQG A;  1FJG K;  3WQU A;  3O3F A;  3MEE A;  4IG3 A;  4B9Q A;  3OYD A;  3U3Y A;  4L3Q A;  1BIS A;  3ZT3 A;  1NJW A;  1EXQ A;  2GX9 A;  4BR9 A;  3A5L C;  4BC4 A;  3OA9 A;  4W5T A;  4B3T K;  4PQU A;  1QSL A;  1RGI A;  4BR4 A;  4KB1 A;  5FDL A;  1OKJ A;  1RDB A;  1ZBU A;  4IWV A;  1JCF A;  3FZK A;  1WSI A;  4CF9 A;  4IXC A;  5HL7 L;  3HJF A;  3HST B;  5BRH A;  1EQY A;  3LM2 A;  4ZTF A;  3IMX A;  1TKD A;  4FZX C;  3CC4 N;  1BOT O;  3D2F B;  3FFI A;  2NRT A;  2QXL A;  1V4T A;  2PZS A;  3PX6 A;  4EZ9 A;  2ZQB A;  4HCB A;  4QAG A;  5AQO A;  1SAZ A;  3VEZ A;  4BRL A;  1TK0 A;  1VSE A;  3AO1 A;  5GIO A;  3SJH A;  1DTQ A;  4MLH A;  4DKW A;  4EP4 A;  3CJA A;  1KC8 O;  3G71 N;  2HHX A;  3O1B A;  4KV8 A;  1HLU A;  2E1Z A;  1R59 O;  3K5M A;  2OCE A;  1RBU A;  3EKS A;  1YUW A;  5F1X A;  1YTU A;  1Q9Y A;  3E01 A;  4DSL A;  1SKR A;  2KHO A;  1ESV A;  1XC9 A;  5AQW A;  3P5J A;  3QIP A;  4FXD A;  1XWL A;  3THW B;  4R79 A;  1CLQ A;  1QSS A;  1TGO A;  3SJJ A;  3VTI A;  4CHY A;  1TYQ B;  3HVT A;  2A6A A;  4DTR A;  4H5R A;  3OYJ A;  4IFY A;  1IKX A;  4J8F A;  1B9F A;  5SZT A;  3BF3 A;  1G99 A;  4DV5 K;  4IJN A;  2A3Z A;  1FKO A;  3MDQ A;  4HVJ A;  2BAN A;  2P9K B;  4AIL C;  4JHD A;  2FSN A;  3TSU A;  5LMU K;  3KKR A;  1HPM A;  3HTV A;  1J9A A;  3TAN A;  1GOB A;  1QHT A;  4H5W A;  1BL3 A;  1KAY A;  2CGL A;  3HM9 A;  3H3O B;  3ENO A;  4KO0 A;  4DLE A;  2HW3 A;  4DUZ K;  1MA9 B;  1L3S A;  4CF8 A;  3A5O C;  1RT2 A;  2F7T A;  3AO4 A;  2UXC K;  4DS4 A;  3D7E O;  4NYF A;  1YF5 L;  5I3U A;  1K8K A;  4C23 A;  3GG4 A;  3CFO A;  3BY5 A;  4ISF A;  3ZT4 A;  4I6M A;  4DB3 A;  1HR0 K;  4FJK A;  4ISG A;  4CD1 A;  1TVR A;  1GLB G;  1EKE A;  3OBW A;  3EE9 A;  4Y1D A;  4OPJ A;  4O0J A;  4RW7 A;  4IDK A;  4ELV A;  3NF7 A;  1XNR K;  3S9H A;  3M6G A;  3QES A;  2AP1 A;  3SUO A;  1XUP O;  4E89 A;  3TAM A;  3DMJ A;  4FJH A;  5GIP A;  1QE1 A;  3F5T A;  4QS8 A;  2HF4 A;  4OKK A;  1SS6 A;  4RW8 A;  3PLA A;  4AHS A;  2O8C A;  3O9R A;  2RPI A;  3ENB A;  3NHG A;  1CZA N;  4MLE A;  2IC3 A;  1VSK A;  4DFK A;  4B9U A;  2E1Y A;  1GLL O;  4WQ5 A;  3TAF A;  4Z4E A;  1LWE A;  4YOR A;  3LM9 A;  3K0S A;  2UXB K;  1HMV A;  5KPT A;  2KKZ A;  5J2Q A;  4JS5 A;  1WBD A;  4CJ3 A;  3H45 C;  1VRT A;  4CIE A;  4FCY A;  4JKH A;  1UA0 A;  1NGG A;  4ILH A;  4BE0 A;  2FF3 B;  5LJW A;  1DGK N;  4YDU A;  5F0X A;  1QHA A;  1NK7 A;  2RHK A;  2HBM A;  4BWJ A;  3VEY A;  3MEG A;  1JCE A;  1KRP A;  4CFC A;  1HX1 A;  4CJT A;  2IAJ A;  3SYZ A;  3PY8 A;  4Z4F A;  2D4W A;  5GAD P;  4CJ7 A;  2XY5 A;  2Q0U A;  3SPY A;  4BVO A;  4B3S K;  4C8M A;  3DXM A;  4JS4 A;  4LH4 A;  4CZG A;  1IBK K;  2FC0 A;  1S72 N;  3K57 A;  2KW4 A;  3WXI A;  4YOW A;  1N33 K;  4PA1 A;  2AA4 A;  4CFA A;  3K5O A;  4LC9 B;  3AVG A;  4N76 A;  3F2K A;  3AAR A;  3D0P A;  3DOK A;  4BRH A;  1RT5 A;  4HHT A;  3FZH A;  4CVN E;  3NGY A;  3OTO K;  4WCE L;  2YJF A;  1NMN A;  2FBY A;  4DV7 K;  4DSK A;  1TAQ A;  4BC2 A;  2Q1N A;  4FLY A;  1MDU B;  2A1R A;  4DQS A;  1JLF A;  3SK3 A;  2NZT A;  3K5N A;  3LAL A;  4OLA A;  2Q31 A;  3OS2 A;  4CEQ A;  2HHU A;  1NKC A;  4M3Z A;  2V7Y A;  2XY8 A;  2ZWH A;  3OVN A;  3EZ5 A;  2I7N A;  3UB5 A;  1I94 K;  3UKU A;  1RDC A;  5EXW A;  1X9J A;  4CZH A;  3CCS N;  4CD3 A;  4BE1 A;  2PY5 A;  4KB0 A;  5AZI B;  1BI4 B;  3U3G A;  3OYB A;  1C1C A;  5DM7 L;  2D0A A;  3TAR A;  3WNE A;  3IKM A;  1C0U A;  2HF3 A;  1YJW N;  3KHY A;  2HHS A;  3LDS A;  4DTS A;  3NE6 A;  1U6Z A;  4CJE A;  3HPO A;  2DTU A;  3VF2 A;  2OPQ A;  4IJA A;  4KKO A;  4JEP A;  1KAZ A;  4JAX A;  3ULE B;  1QVF M;  4DSJ A;  5BN8 A;  2ATQ A;  1N6Q A;  1TV6 A;  2HVI A;  4K43 A;  4FK4 A;  3DAW A;  5DK5 A;  5HOO A;  1WSG A;  2V51 B;  3NF6 A;  5KQ8 A;  4FWS A;  3ZSZ A;  1GOA A;  1Z6R A;  1NJY A;  2V7Z A;  3SNN A;  1JKH A;  4TSX A;  1VQ5 N;  1KAX A;  3ZT2 A;  4DFP A;  3DLG A;  2D1K A;  1Y97 A;  3VMF B;  1VQ4 N;  2Z1J A;  4NCG A;  1GLJ O;  4CED A;  4CZK A;  2YHY A;  1ASV A;  3KK2 A;  4F3O A;  1QS4 A;  1J6Z A;  3UKR B;  2E2O A;  2IS3 A;  1W97 L;  4FL9 A;  2NRV A;  3H08 A;  4BQZ A;  4OPH A;  4JD2 A;  4B3M K;  3UIQ A;  3FLC O;  4DV6 K;  1S22 A;  3SV4 A;  1HNI A;  5FPM A;  3LAN A;  2ZJR L;  3B6O A;  1VQK N;  4FZZ A;  1A5X A;  3VEV A;  3RMC A;  3O8M A;  2XO7 A;  4H0X B;  4CW7 B;  4CI6 A;  3MWP A;  2OTL N;  1VQ9 N;  2FBV A;  3DLK A;  3C6U A;  3DLL L;  4X65 K;  1BO5 O;  3PSF A;  4DFJ A;  1NKB A;  3KD1 E;  1BU6 O;  1VSI A;  5M1F A;  2P9K A;  4BGB A;  5M1O A;  1M1K O;  3IAY A;  1Y64 A;  2HMP A;  3S3N A;  1NM1 A;  2Y1I A;  3FZM A;  3NVM A;  4HUG A;  5AQP A;  3HXM A;  3O9T A;  4ILJ A;  3BF1 A;  4B9L A;  3I8D A;  4WFA L;  4HUE A;  3PO5 A;  1E4F T;  4JI7 K;  4E1N A;  1BA0 A;  4WQ5 C;  3VF6 A;  2P9N B;  3SUN A;  3VF4 A;  2KFZ A;  3VGK A;  4DR5 K;  3SCX A;  3L8B A;  1U2V A;  3O4N A;  4C1N I;  1BA1 A;  3QO9 A;  1L5U A;  3AA2 A;  3EL2 A;  4GVE A;  3MED A;  3ZSW A;  2O8B A;  3T1Y K;  2QXF A;  3V9X A;  4BRI A;  1FXX A;  3WNF A;  4OJR A;  4UY8 O;  1WSF A;  2AJQ A;  3PV8 A;  2UUA K;  1IBM K;  1C0F A;  1ZC6 A;  3J7Z O;  2Q36 A;  1BG3 A;  2G8I A;  3P83 D;  3OYK A;  2WUS A;  2W40 A;  3I8B A;  1QQM A;  3VQ9 A;  3DM2 A;  4JNE A;  4A5A A;  4DCH A;  1NJI O;  4BR2 A;  2PBD A;  4B8A B;  1K6Y A;  3DWL A;  5FPD A;  2OYQ A;  2OPS A;  3JS6 A;  5AQI A;  3TAG A;  4FJ9 A;  4YY3 K;  1P8Z A;  3MN6 A;  4ILG B;  4PKG A;  1OH6 A;  3AA5 X;  4BR5 A;  1MWM A;  3OYM A;  3DLR A;  1E3M A;  5AQV A;  4GW6 A;  4CK3 A;  4IFE A;  4E7K A;  3CJ1 A;  3K59 A;  1BHL A;  3QNO A;  2NRH A;  1NOY A;  1F21 A;  3EE8 A;  4JK8 A;  4LF9 K;  2A41 A;  3VQ7 A;  1VSH A;  4HTU A;  3VEO A;  3T19 A;  4DF8 A;  2O8F B;  1TKT A;  1VSJ A;  3Q7B A;  4EP5 A;  3CCV N;  4GVM A;  3ZLJ A;  3LDO A;  4M63 C;  2ZE2 A;  1L3T A;  3LDL A;  2HHV A;  4O0I A;  4AM6 A;  3L3U A;  1TUU A;  2PAV A;  1U4B A;  4DTN A;  1VSM A;  2ETJ A;  2UU9 K;  5TKY A;  1LWC A;  3JSM A;  1W2B M;  4LSL A;  5BN9 A;  5LJV A;  5C42 A;  3U6F A;  1VSD A;  2HHT A;  2P9P A;  1NNE A;  4CZI A;  3MN7 A;  4LFC K;  2O8E A;  1YAG A;  2BTF A;  3EZW A;  3LDN A;  2DPN A;  3VQ5 A;  4DWI A;  2WOM A;  4BR0 A;  1TAU A;  5DMR A;  3ENH A;  4GNI A;  4DU3 A;  1VSF A;  2P9S B;  3NF9 A;  1FK9 A;  2YKM A;  2WBN A;  2OPR A;  3VA0 A;  1EX4 A;  3SUQ A;  3OYC A;  1Q81 O;  1GLE G;  1X3M A;  3ATV A;  3VES A;  2EWS A;  1VRU A;  2FBT A;  4QOZ B;  4LY7 A;  3ZEU B;  1YI2 N;  3RR7 A;  3SI6 A;  3K58 A;  3SV3 A;  3HPG A;  1LAW A;  2P9U B;  1QTM A;  3CYM A;  5K14 A;  1HQE A;  5A2Q O;  1N32 K;  3P31 A;  3C6H A;  3RMA A;  1RTD A;  3EN9 A;  1QSY A;  4K42 A;  1HQU A;  5J2P A;  4M3T A;  4DF4 A;  3QFU A;  2CH5 A;  4DQP A;  2YNH A;  3BDP A;  3I56 N;  1KVC A;  3U8X A;  4DQ8 A;  4LD0 A;  1NGC A;  2P1J A;  3VGM A;  5AZI A;  2YHB A;  2G8F A;  2D0B A;  1VSL A;  4F2S A;  1ITG A;  4A5B A;  4LF8 K;  3J7A P;  4JK7 A;  1SKS A;  4FWK A;  5AQU A;  3TWH A;  2BGG A;  1NGH A;  3M8Q A;  4Z4C A;  1CZ9 A;  3A0I X;  2W42 A;  1RT1 A;  3THX A;  4H5T A;  3MXI A;  3A2F A;  4NO7 A;  4YOX A;  4B9M A;  5C12 A;  4CJ4 A;  2JWL A;  1IBL K;  2YKN A;  4KTZ A;  4C8N A;  4IOX A;  1RT4 A;  3GE1 A;  3KWI A;  1VQ8 N;  3CM6 A;  1RT3 A;  4XEI A;  3CF5 L;  2XY6 A;  3AVK A;  1NK4 A;  4DTP A;  4MDA A;  3N4P A;  1RIL A;  3KIO A;  4IO9 L;  4WFB L;  3WEE B;  4OLB A;  1HYV A;  3U4L A;  3VQB A;  3NH1 A;  4O8U A;  4GMJ B;  5I42 A;  5AR0 A;  3QEV A;  3K9J A;  2B4J A;  5E41 A;  3ZCM A;  1J5E K;  4JKD A;  4JK9 A;  2ZM6 K;  3AVC A;  4HTL A;  4QS9 A;  2QKB A;  5CZ2 A;  2DFE A;  3Q7C A;  2VQF K;  1LOT B;  4WF9 L;  4NCA A;  5AQN A;  1ZYQ A;  5C15 A;  5MLC Q;  3F73 A;  1XNQ K;  2O4I A;  5AZJ B;  4H0V B;  4OKE A;  3VQD A;  1BWF O;  3VET A;  3EO3 A;  4AHC A;  2IVN A;  4CHO A;  1BIU A;  1LWF A;  2P5G A;  4GKJ K;  4JI4 K;  3AVA A;  3SQ1 A;  3C6T A;  4M3R A;  1VQO N;  4XH1 A;  3ZET A;  1ZXO A;  3KLI A;  2QW9 A;  4AHU A;  5AQG A;  4U7B A;  4FM2 A;  3V4I A;  5JS1 A;  1RBR A;  1RDU A;  4PUO A;  3OYG A;  4EZ6 A;  3PSI A;  3OYF A;  4BG9 A;  2ZJQ L;  5FPE A;  3TAQ A;  1ZBH A;  1XHZ A;  1LV5 A;  3NCI A;  5AQX A;  1NJX A;  1C0G A;  4NXN K;  1J54 A;  2CGJ A;  4J2B A;  1IKV A;  1TKZ A;  4M3U A;  4BRM A;  1TUY A;  3IDH A;  1XHX A;  1KFD A;  4Q5V A;  4A61 A;  2X74 A;  4B9V A;  2QK9 A;  2F4V K;  4BVP A;  3C7N B;  3THV A;  3D2E A;  2HVH A;  5JMV A;  4DV0 K;  1KSP A;  4GV9 A;  5E26 A;  2A1S A;  4BG8 A;  3VTH A;  4FOI A;  1OH7 A;  3M8R A;  4J2E A;  1TKX A;  2VGN A;  4FWL A;  4JYA K;  1LW0 A;  4FLW A;  4B1V A;  3M3Z A;  4H0Y B;  4JRQ A;  1NMD A;  1VQN N;  5JVG L;  3O1W A;  2HBJ A;  1GLA G;  1SKW A;  4FZY A;  3ZYY X;  3CQ8 A;  1IJJ A;  2ITG A;  1KVB A;  1QZ5 A;  1DT9 A;  2FSJ A;  4NLB A;  4OGE A;  4AHV A;  4MFB A;  1IG9 A;  4ID5 A;  1Q82 O;  1JXB A;  2QWL A;  5AFU A;  4FW2 A;  4YOY A;  1RBS A;  1VAZ A;  4ID1 A;  4B9N A;  4Z4H A;  2I7P A;  3QEI A;  1XI1 A;  2A42 A;  1R0A A;  2KTQ A;  4CEE A;  2VWB A;  5BRE A;  1VQL N;  4DTJ A;  3CC7 N;  4OVL A;  3V9S A;  1RTJ A;  1A5W A;  4OPK A;  5C25 A;  5EX5 A;  4JI0 K;  4CZE A;  3NAE A;  1Q9X A;  5CZ1 A;  2ZGY A;  3TAB A;  3OS1 A;  4F2R A;  3AO3 A;  5FRM A;  5H1S Q;  4JKG A;  4CBU A;  2J4R A;  3TPQ A;  4FJX A;  1NWK A;  4C8L A;  4FJI A;  4CK2 A;  4XH5 A;  4IG0 A;  4MO4 A;  4AM7 A;  2VGM A;  4QS7 A;  2VCP A;  3R6M A;  3E9L A;  3WXL A;  1YVN A;  1C1A A;  3RSE A;  3BP8 A;  4MQ3 A;  4X62 K;  2YJE A;  5CYQ A;  3AAP A;  4CBW A;  2HHW A;  2F96 A;  5JS2 A;  2GEL A;  2HNY A;  3FR0 A;  3TU5 A;  1YHQ N;  3BEX A;  3CHW A;  3O80 A;  4DR1 K;  1Z25 A;  2ASO A;  1HYS A;  5FRO A;  2QWO A;  3KVG A;  3MWT A;  2YCH A;  4BDP A;  4CCH A;  4EHU A;  1V4S A;  5HBM A;  3O9U A;  2P9I A;  3OW2 M;  3L3V A;  3L2W A;  2FLO A;  3ZSV A;  3PIP L;  3BGR A;  3MN5 A;  4BDZ A;  4CGD A;  4CK1 A;  1WLJ A;  4CZJ A;  3HM8 A;  4KI6 A;  1YT3 A;  1YVU A;  5BRF A;  1YJ9 N;  1KTQ A;  2QWM A;  2HHH K;  2HBK A;  5GAG P;  4CJF A;  3AVJ A;  3NH0 A;  2ITM A;  1WSE A;  2RN2 A;  2IIR A;  1NG9 A;  3U9Z A;  5J2M A;  3DLE A;  1A5V A;  3IRX A;  3LL3 A;  2O8D A;  1MWK A;  4DV2 K;  4V19 S;  2UXD K;  4CGF A;  1KFS A;  4A62 A;  3VEW A;  3T69 A;  3MX2 A;  2G8H A;  4JI1 K;  4FJN A;  3D45 A;  3CCE N;  4A59 A;  3THY B;  4BRA A;  3EYZ A;  4WE1 A;  1HNZ K;  3I33 A;  2HNZ A;  2KZZ A;  4FPA A;  1RBT A;  3R3L A;  1X9S A;  4OPA A;  3B6P A;  3DXK B;  3KLH A;  2W6K A;  5DM6 L;  3KK1 A;  1RNH A;  3P38 A;  4FVM A;  4H0T B;  3LWL A;  3KZB A;  1FW6 A;  1WUA A;  4PY5 A;  2F9W A;  4M45 A;  1S1X A;  4IOC L;  3S3M A;  2Q2R A;  5KGW A;  2VWJ A;  4BDY A;  2QWN A;  1WNS A;  5HRP A;  4CEC A;  1I39 A;  3S41 A;  4E1J A;  5KGX A;  4H5V A;  1L3V A;  4E0D A;  1LW2 A;  4CJW A;  2B6A A;  3AGK A;  4JLH A;  3VQ4 A;  1OH8 A;  3N4Q A;  3JAM O;  5AQL A;  1UOC A;  3OYN A;  1RBV A;  3ITH A;  2X6N A;  3J81 O;  1N5Y A;  5F2R A;  1G15 A;  2F8T A;  3D2F A;  5JVH L;  2WFB A;  1EWR A;  3L0Q A;  4CJS A;  3IUC A;  3OHR A;  2GV9 A;  4I2Q A;  3O08 A;  4W5O A;  3K2P A;  5BPN A;  2O4G A;  3J8A A;  3ID8 A;  1ATR A;  3CFP A;  4M3W A;  3AA4 A;  3A5M C;  2OAN A;  4GKK K;  2VG7 A;  5M1K A;  4ZTJ A;  3O5B A;  1Q8I A;  1S1V A;  1BCM A;  3PUF A;  1WSH A;  5AJ3 K;  1NK6 A;  3NDK A;  3C65 A;  3AAQ A;  4DUY K;  4DR7 K;  2EHG A;  3LZI A;  4W5R A;  3VQE A;  4A57 A;  3OS0 A;  2P5O A;  1SL0 A;  4DU4 A;  1CXQ A;  4CJV A;  1GLF O;  1CXU A;  3THW A;  2YHA A;  3QML A;  1TYQ A;  3HI0 A;  1NU0 A;  4O55 A;  4H4O A;  1B92 A;  1W7A A;  5KQD A;  4KFB A;  1RFQ A;  4YNQ A;  4IEI A;  2ZD1 A;  3CD6 N;  4FWR A;  1X9M A;  4BR7 A;  4DQI A;  3I0S A;  4M3Y A;  1JLB A;  2RKI A;  2ASP A;  2JLE A;  1IV0 A;  5HP1 A;  4YFU A;  1WAF A;  4O4G A;  1RDA A;  1JCG A;  2NRR A;  5CY4 A;  1J5O A;  4H8K A;  1S1T A;  1S1U A;  3HP6 A;  3ZX0 A;  4FSV A;  4DTO A;  2X78 A;  1D9D A;  2YNG A;  2HB5 A;  1QZ6 A;  2PYL A;  1D9F A;  3ZSX A;  3E1Y A;  3V1R A;  3EY1 A;  4C8K A;  4G9Z A;  4CHQ A;  4CEB A;  4HCC A;  3ALY A;  5HRO A;  1C0T A;  4MO5 A;  1HNV A;  3QEX A;  4CHN A;  5HRN A;  1T05 A;  4I2P A;  5C2D A;  3QET A;  4JHD B;  1LAV A;  5CR4 A;  3WT0 A;  4FJM A;  4JI6 K;  4YDU C;  2XRI A;  3T7Z A;  3O6W A;  5EVZ A;  2I5J A;  3UE5 A;  4DHY A;  4RW6 A;  1H1V A;  1T6D A;  2XHB A;  2NNW A;  2YNF A;  4YOV A;  1ZBF A;  1OH5 A;  1HJR A;  3TI0 A;  2JGU A;  3V9W A;  3KK3 A;  4JI8 K;  1ZBS A;  1X3N A;  2YHX A;  3G25 A;  1NGE A;  4KHS A;  4BC5 A;  4X66 K;  2OTJ N;  1DKG D;  3J80 O;  1U48 A;  5AQQ A;  4N41 A;  1T44 A;  2BUP A;  2QI2 A;  4BRN A;  4AH9 A;  3MAQ A;  1HYZ A;  1K8K B;  4H5N A;  1NKE A;  2KZM A;  2D0C A;  1NGJ A;  3HOT A;  4HWI A;  4I6M B;  4JV5 K;  5T7B A;  4E7J A;  3VA3 A;  2GWJ A;  3S3O A;  4LF4 K;  2FF6 A;  2G8U A;  1SZ2 A;  4KI4 A;  4NB4 A;  3VQ6 A;  1DLO A;  4CIF A;  1O1W A;  1TL1 A;  3P1G A;  3MEC A;  3HK2 A;  3DOL A;  4E7L A;  3MXM A;  3MX5 A;  3H46 O;  3NF8 A;  5LY3 A;  2A40 A;  1K9M O;  3K5L A;  5KRT A;  3LP3 A;  3A8Y A;  2G8V A;  3ZSQ A;  2QWR A;  2YV0 X;  4BRQ A;  3ZX3 A;  4KH5 A;  4FK0 A;  5AQH A;  2O8C B;  3AVN A;  4BRP A;  4DG1 A;  3AVB A;  3A5N C;  4B9T A;  1HRH A;  1C6V A;  4FW1 A;  3SQ4 A;  3AA3 A;  4CJ5 A;  3QEP A;  1K73 O;  1ASU A;  3PX0 A;  4FJL A;  3GDQ A;  4B1Y B;  4JI5 K;  4FLT A;  1JXE A;  3HP9 A;  1EP4 A;  4CJP A;  4DFM A;  1WSJ A;  2GBZ A;  3BUZ B;  3E66 A;  5EU7 A;  3HO1 A;  2QTD A;  3NMU A;  4MDB A;  4DV3 K;  2HND A;  1RDW X;  4O8K A;  2VWK A;  1KXP A;  1YTA A;  4GV6 A;  4PKI A;  2GUI A;  3MN9 A;  4BAC A;  2KLA A;  4E3S A;  2Z1I A;  3BZK A;  3AVL A;  5CYM A;  4PWD A;  1T7P A;  2RF2 A;  2IGI A;  1JL1 A;  1Z05 A;  3O9S A;  4CES A;  4IZ9 A;  4A2B A;  1NK0 A;  1I3A A;  2QKK A;  1C0M A;  3DLB A;  3OYH A;  1U47 A;  2HHQ A;  4DSI A;  1RDD A;  3L2Q A;  4KTW A;  3DRS A;  2GWK A;  4CEF A;  3M8S A;  3DXK A;  1ATS A;  2VG6 A;  4BRG A;  1SL2 A;  1IKY A;  4CZF A;  3LAK A;  2X6S A;  4CEZ A;  1IO2 A;  1BI4 A;  4JKF A;  4CJQ A;  5FLX O;  3VER A;  3W3D A;  3LZJ A;  4DU1 A;  4LFB K;  3VOV A;  5AQT A;  3TR8 A;  4O5F A;  3ZSY A;  4DR4 K;  1X9W A;  1KVA A;  2F8S A;  1Q18 A;  4YOT A;  3ZX2 A;  5KTQ A;  4FYD A;  3W0L A;  4FWN A;  1IG8 A;  4Z0U A;  1JL2 A;  4KAZ A;  3IG1 A;  3ULE A;  1YJN N;  2E2N A;  1T8E A;  4RTF D;  4JKA A;  5C24 A;  1S6Q A;  3OJU A;  1ATN A;  3LDQ A;  2G8K A;  4FJ7 A;  3QER A;  3SLC A;  3M8P A;  3IS9 A;  4I9L A;  5BR8 K;  4B3O A;  3ZT0 A;  3JYT A;  2ASM A;  2IVP A;  5ELZ A;  4LSN A;  2Z1H A;  4W5Q A;  5TKW A;  1S9G A;  5BPM A;  3GOI A;  5J1E A;  3NGI A;  3ASM A;  3QEW A;  4DMN A;  4CGJ A;  4FWQ A;  4IEE A;  3OBY A;  3V81 A;  2XY7 A;  3EKU A;  1VK0 A;  4ELT A;  3PX4 A;  4LF6 K;  3KTQ A;  4H0O A;  3CQY A;  5AQJ A;  4PL8 A;  3I0R A;  4ISE A;  4Y0W A;  4K0K K;  1S9E A;  4CFD A;  5CHI A;  3UKR A;  3R1X A;  1S6P A;  4FJ8 A;  3T3F A;  1HJO A;  3O4W A;  4WQ4 A;  3VQA A;  4CF1 A;  3QLH A;  5AQK A;  4WFN L;  4FO0 A;  2YNI A;  1NOZ A;  4Z94 A;  3HRG A;  4KHN A;  3AV9 A;  4K41 A;  2E20 A;  3VQC A;  3RR8 A;  3CCL N;  4N5S A;  2GTD A;  1YIT N;  4JKE A;  5BR9 A;  4FK2 A;  4KHU A;  1JLG A;  4EHT A;  3TAE A;  1W0H A;  4FJG A;  4KRF A;  3HVR A;  3RRH A;  2GUP A;  5ADX A;  2GEM A;  3MCP A;  3F9M A;  2VQE K;  4RCH A;  4JD2 B;  5GAH P;  3CCJ N;  2P9L B;  4IDH A;  1NGI A;  1QQO A;  1VHX A;  4B8C A;  4AHR A;  3SAF A;  2NUB A;  4KHW A;  2PYJ A;  3CET A;  1XMQ K;  5JLH A;  1XC3 A;  2WTU A;  1QQN A;  4RW9 A;  3RVC A;  1BQM A;  4B1W B;  1J53 A;  4NCB A;  4FM1 A;  2P9N A;  4AF1 A;  2NRX A;  3ID6 A;  3AY9 A;  3G6E N;  3DLH A;  1CZB A;  3V1O A;  3AVF A;  2IDO A;  2DFF A;  3LP0 A;  4R5P A;  4M42 A;  1WBB A;  5GAE P;  1N36 K;  3ZT1 A;  4CJL A;  4DTM A;  3QBX A;  4H03 B;  4B1Z A;  1UAX A;  4F8R A;  3MMV A;  5IWA K;  5JIC A;  3CFR A;  4FJJ A;  2BE2 A;  3QFP A;  4LFA K;  3CJB A;  3H6E A;  4CGI A;  5AQF A;  3TSQ A;  4DTU A;  1REV A;  5LMN K;  4QCL A;  1RT7 A;  4OX9 K;  1E4G T;  1S1W A;  1ZBI A;  4K25 A;  4CZL A;  3AO5 A;  1BGX T;  1U2V B;  2QWP A;  4ELU A;  2O8B B;  4CIG A;  3HYF A;  4CJU A;  3LPU A;  3VQQ A;  5I9E B;  1KLM A;  4FWP A;  3VEX A;  5BRD A;  2E5L K;  4FOE A;  3SBG A;  5CE3 A;  1RCH A;  3VN5 A;  4KBO A;  1KLN A;  4BRE A;  3U9D A;  3CQX A;  1ASW A;  3H1V X;  3VPZ A;  5EY4 A;  1KQS M;  2O8F A;  4IO8 A;  3KK7 A;  1Z26 A;  2FXU A;  3CJ7 A;  3SPZ A;  3L2R A;  3CPW M;  1QVG M;  3AVI A;  3VQ8 A;  4DQQ A;  1HKG A;  5M1P A;  1O13 A;  5EOY A;  1U49 A;  1SUQ A;  4X64 K;  4BY9 C;  2E8A A;  3FGU A;  1VQ6 N;  1WAJ A;  2W6L A;  1EET A;  3NGZ A;  3KD5 E;  2CH6 A;  3P39 A;  5AQS A;  4O5B A;  4C8O A;  4CJK A;  4FLZ A;  4DV1 K;  4FWO A;  1TL3 A;  3JXU A;  3WXK A;  4BC3 A;  4BRK A;  1ILY A;  5KPR A;  1L3U A;  4YOU A;  3QNN A;  1LCU A;  2D0O A;  3O4Q A;  2P9S A;  3RMB A;  3C6A A;  2ZF5 O;  3DYA A;  3O3H A;  1HNW K;  3V9Z A;  2OZS A;  2ZGZ A;  2E6L A;  1SV5 A;  4Y1C A;  3SUP A;  4RW4 A;  1VQ7 N;  4Z4G A;  1W9H A;  1VQM N;  3HSC A;  4DTX A;  4BGA A;  3NFA A;  3H3N O;  5E84 A;  5FRN A;  2CGK A;  3DI6 A;  2P9P B;  3V9U A;  2O8E B;  3ZEU A;  3V6D A;  3NBP A;  1NGF A;  4JI2 K;  2P9U A;  3L2V A;  1JLA A;  4XIU A;  3HBT A;  2IVO A;  1M90 O;  2YX6 A;  2EX3 A;  1WN7 A;  1Q86 O;  4RG8 A;  3P4I A;  3NH2 A;  5AQR A;  1JLE A;  4FM0 A;  3R8E A;  4JN4 A;  2KFN A;  2Z1G A;  4PL7 A;  3OYE A;  5BPL A;  5LL6 Z;  2UYT A;  3L4I A;  5SWM A;  4ICL A;  1KCF A;  2V52 B;  4AHT A;  3C94 A;  1X1P A;  4E7I A;  4Z4I A;  4M7Y A;  3L6Q A;  3QIC A;  1UWB A;  4WQ4 C;  1IKW A;  2FBX A;  3T1A A;  2NLX A;  1YXQ A;  1HUX A;  2QA4 N;  4J2A A;  5AQZ A;  2W41 A;  3CIP A;  3GBT A;  3WQT A;  5C2F A;  5KI6 A;  1RT6 A;  3V1Q A;  3WUH A;  2Q97 A;  2BDP A;  3SMP A;  1TK8 A;  1OVQ A;  2H3G X;  1BIZ A;  3VEN A;  1N8R O;  4FVU A;  3CCQ N;  1BCO A;  3WEE A;  4GV3 A;  5FPN A;  4CGG A;  2NRW A;  4G1Q A;  3FFK B;  3LP1 A;  4NXM K;  3TSP A;  3EEQ A;  3THX B;  3OY9 A;  4B1X B;  3KLG A;  4U67 L;  4CZM A;  3J7Y P; 
#chains in the Genus database with same CATH homology
 4LFC K;  1HNW K;  4JI1 K;  4YHH K;  1J5E K;  2ZM6 K;  1HNZ K;  2UUB K;  2VQF K;  4JI7 K;  2UUC K;  1XNQ K;  2UXB K;  1N36 K;  4JI0 K;  5BR8 K;  4JI2 K;  4DR5 K;  1XMO K;  4LF5 K;  5IWA K;  4JI4 K;  4GKJ K;  4LF7 K;  4B3R K;  4DR2 K;  4LFA K;  4DR3 K;  4DV5 K;  3T1Y K;  5LMN K;  4JI5 K;  4LF6 K;  4OX9 K;  4DR6 K;  4JI3 K;  2UUA K;  1IBM K;  5A2Q O;  1N34 K;  4B3S K;  1HNX K;  5IT9 O;  1N32 K;  4K0K K;  4X62 K;  5LMU K;  3T1H K;  5LL6 Z;  4AQY K;  1IBK K;  1FJG K;  4DV3 K;  2E5L K;  1N33 K;  4NXN K;  3JAM O;  4DR1 K;  4JI6 K;  3J81 O;  4B3T K;  4KHP K;  4DUZ K;  4YY3 K;  4CVN E;  3J7A P;  2UXC K;  3OTO K;  4LF8 K;  4DV4 K;  2F4V K;  4DV7 K;  4DV0 K;  4JI8 K;  4B3M K;  4LF9 K;  4DV6 K;  4X64 K;  4X66 K;  3J80 O;  1HR0 K;  4JYA K;  4GKK K;  2HHH K;  2VQE K;  1IBL K;  4CW7 B;  4DV1 K;  5AJ3 K;  4NXM K;  5FLX O;  4X65 K;  1XNR K;  2UU9 K;  4LFB K;  4DUY K;  1XMQ K;  4JV5 K;  1I94 K;  4DR7 K;  4DV2 K;  4LF4 K;  4V19 S;  4DR4 K;  2UXD K;  3J7Y P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...