4X64K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4x64K00
4JYAK 4X64K 1HR0K 4B3RK 4DV5K 2F4VK 1IBLK 2VQEK 1IBMK 2UXBK 2UUBK 4DV1K 1HNZK 4DR4K 4DV2K 4K0KK 4JI4K 2UUCK 2E5LK 3J7YP 1I94K 4LF4K 4DV3K 3J81O 4B3TK 1J5EK 4DR5K 4DR6K 4GKKK 4YY3K 4JI8K 4AQYK 4LF8K 3T1HK 1XMQK 1N36K 4DR7K 3JAMO 4JI2K 4DV0K 1XMOK 1XNRK 4LF6K 4B3MK 4DR2K 4B3SK 4DV7K 5BR8K 3T1YK 2ZM6K 4KHPK 4X66K 4DV4K 4DV6K 2UXCK 1N34K 4YHHK 2VQFK 4NXNK 5AJ3K 4GKJK 4JI7K 4V19S 4JI0K 4LFCK 1N33K 4JV5K 5LMUK 1XNQK 4LFBK 4LF7K 4X65K 1HNXK 2UU9K 4LF5K 4DR3K 2UUAK 5LMNK 5LL6Z 2UXDK 4X62K 5A2QO 4DR1K 4JI5K 4JI6K 5IT9O 4LF9K 1IBKK 4CW7B 3OTOK 2HHHK 1FJGK 4DUZK 4NXMK 3J80O 5IWAK 4DUYK 3J7AP 4OX9K 1N32K 4CVNE 4JI3K 1HNWK 4JI1K 5FLXO 4LFAK
chains in the Genus database with same CATH superfamily
2CGJA 3MWTA 2D0AA 4M41A 4YOVA 2OA8A 1V4TA 3GE1A 4X64K 3KZBA 5CE3A 1ZYQA 4HHTA 4FLUA 2KQ2A 4IBNA 1N6QA 3CJ1A 4E1MA 3V9UA 1NGFA 1EO1A 3O3FA 4BROA 5JICA 1B9DA 2E1ZA 4BDYA 4BG9A 4DV3K 1YTAA 3J81O 1E3MA 1NKCA 4CECA 2KZZA 1NK5A 1LW2A 1QQOA 4IKFA 1BGXT 2VGMA 3PX4A 3LPUA 4DTPA 2JWLA 3HPOA 3TR8A 4LF8K 3CC7N 2G8VA 4JKAA 3PSFA 3MDQA 1K8KB 3WNEA 4FVMA 3EKUA 2IIRA 3HVTA 5AQFA 3QBXA 3MEDA 1NGCA 4BGAA 3VQ5A 5AQWA 3DLKA 1D4XA 4NO7A 4H03B 1VK0A 3ULEA 5J2NA 1QQMA 1Q82O 4MQ3A 4N5SA 1RBUA 2ZJRL 3MXJA 3QFPA 4C8OA 3OVNA 1RFQA 3T69A 3QIPA 4IXCA 4JRPA 4FLTA 3WT0A 3SZ2A 4O5FA 4CGDA 1EXQA 1U04A 3H45C 1QSSA 4HUEA 4CEOA 3C65A 1HNXK 4B3OA 4DR3K 3T1AA 3CCSN 3ATVA 5M1OA 3FLCO 1IV0A 4JRQA 4IWVA 3CCLN 5J2PA 3JS6A 1T6DA 3U9ZA 5FRMA 3WQTA 4J2AA 3ZSOA 3BUZB 1L5UA 2O8EB 4M3WA 3DOKA 5EU7A 3CXCM 4CFCA 1X9WA 2WFBA 4GY2B 3UKRB 3E1YA 2QA4N 3OA9A 2HBJA 4DB3A 4KI4A 3LM9A 2GWKA 1NOZA 3TAFA 3O1BA 3TU5A 3OS2A 1HJRA 4KHUA 3QB0A 3HSCA 4H8KA 3NF7A 4EP5A 3S3OA 1KLNA 3NVKA 5I42A 3LAMA 3S41A 4K8XA 2HSTA 4DWIA 4CJ7A 1JLGA 3EO3A 1HYZA 1C0MA 3P83D 3FFIA 5CR4A 2BGGA 4NB4A 5AQTA 2DFEA 3V4IA 3AO5A 3OHRA 3SMSA 4NCBA 3Q7BA 1XWLA 1M90O 4DU1A 2P9KB 3M1FA 1NNEA 1T03A 3OYLA 1UA0A 2X6NA 1G99A 4F3OA 2FXUA 3DLLL 1N5YA 2V52B 3JAMO 3CI5A 4KI6A 5HRRA 4DF4A 3VF6A 4RTFD 2JLEA 3VETA 3K57A 5D3GA 3NH0A 2DY4A 2QWPA 1SQKA 2YCHA 3CQYA 3R3LA 2ZD1A 3TAMA 1QE1A 4CZIA 1NJIO 3VA0A 4M3ZA 4JS5A 1S9GA 1EWQA 1ASUA 1W97L 1SV5A 4H0TB 3HI0A 4CK1A 3ZT0A 1EKEA 1YT3A 1NGEA 1JLQA 2VWBA 4DCHA 4RCHA 4WFBL 5HLFA 4IG3A 3CFPA 4KTWA 5DMRA 4CEEA 4FW1A 4FJ9A 2KKZA 3G71N 3RR8A 5AQQA 3TARA 1IKXA 3K5NA 4BY9C 4C8LA 1TYQA 1HQUA 3AY9A 3TSUA 3G25A 2VG7A 4FWLA 5JVGL 4DQRA 1GOCA 4G1QA 2EWSA 5C24A 1JLFA 3RMAA 1KAZA 3S3MA 3DRRA 2Q3SA 1RDBA 2J4RA 4OVLA 4MDAA 1KAYA 2FBTA 3FZFA 4FM0A 2ZGZA 4R79A 2GWJA 2VQEK 4FWMA 4OKJA 3BY5A 1NGDA 3M3ZA 1HNZK 2P9LB 3KLEA 3SUOA 1WBBA 4YORA 4B9SA 4JNEA 4Y1DA 1U4BA 1I94K 1ZBSA 5CY4A 4F2RA 2RHKA 2CGLA 4AHSA 4E7IA 4I9LA 4YDUA 4GKKK 1Y64A 4M3XA 2HVHA 3AVNA 1QS4A 3K0SA 3QDKA 4GNIA 1E4FT 4JAXA 1NMDA 4M42A 4BQLA 3CD6N 3VN5A 1VQ4N 2IGIA 1BG3A 3M8QA 4IJAA 4DSIA 1LWEA 2B5JA 1S1VA 2D5RA 2RN2A 4B3SK 5CZ2A 3SQ2A 4KHPK 4CBWA 4E7JA 2QI2A 1MDUB 1X1PA 3ZT1A 4J2DA 2Z1GA 4NXNK 2ETJA 3LP2A 2NZTA 3KLHA 2Z1JA 3V9WA 3MXIA 3OJUA 1HKCA 1T8EA 4GVEA 4HTLA 3CF5L 3H1VX 4XH4A 3VENA 2P1JA 4KO0A 3AVCA 4CJ3A 3ZSYA 3LALA 3TPQA 3IUCA 2D0OA 3NF9A 1JL1A 1XC3A 3QNNA 4BE0A 1N8RO 4EZ9A 3LDPA 3RSEB 3WXKA 4CJUA 1IBKK 1JCEA 4OPAA 3R9PA 2FC0A 1NJWA 3ZEUB 4BWMA 1YI2N 4XH5A 2YNFA 1YVNA 4R5PA 2R7YA 3ZX3A 3G10A 3V9XA 1A5VA 4C8MA 3PSIA 3ITHA 1R59O 3CIPA 4CCHA 5E26A 2YHYA 4ELTA 4B1UB 3HO1A 4DSFA 2F4VK 2ITMA 1D9DA 1KLMA 4CHPA 3VQ9A 3SK3A 4XH1A 4CZEA 2E5LK 3CQXA 4LF4K 3CQ8A 2IVNA 3G4SN 4NCAA 1EQYA 5JS1A 3G0ZA 3HYFA 4JEPA 3N4PA 2HF4A 2WC9A 4E7HA 3C94A 1RT3A 4FJNA 4F3TA 1RDUA 4CHYA 2PY5A 4YY3K 5LJVA 4GV9A 1RDDA 4DTMA 3WEEB 3ZX0A 2P9PB 4JHDB 3BZCA 4Z4GA 3BEXA 5C12A 2OZMA 1VQON 3A5MC 5AFUH 2XY7A 3WNGA 2O8DB 1NG9A 3SV4A 2WONA 3JSMA 2EX3A 3FZKA 3H08A 3AVBA 5BR8K 4N41A 4WCEL 4FW2A 3E9LA 2QEXN 2YJEA 3LDSA 3I0RA 3QFUA 2NRZA 2E20A 4FCYA 4OKEA 1B92A 3VEXA 2YNGA 4YOUA 4DG1A 3NGIA 3AA3A 1GLDG 5DM6L 3EKSA 3OYEA 2BTFA 1NGIA 3M6GA 1I3AA 1FKPA 1DT9A 2FF6A 2FSNA 5GIPA 2O4IA 3RMCA 4W5NA 1J9AA 4LF7K 5AQUA 1K73O 1NK0A 3KLFA 1X9JA 1RBRA 2GV9A 4CZKA 3U4LA 5C25A 4BACA 4DMNA 1FW6A 3QEIA 1JJ2M 3FR0A 3J7ZO 4N56A 4B8CA 4OPKA 4CIEA 1KXPA 5EVZA 3DOLA 4CEBA 1S1UA 4B9VA 2E2OA 4UY8O 1N32K 3OW2M 3TTDA 3CMAN 4OJRA 4I7FA 1KCFA 2WTUA 2IS3A 3T19A 1KRPA 2PYLA 3OYFA 1VSIA 2KTQA 3WEEA 1TL1A 1FKOA 4A5BA 3SQ4A 2P9PA 2F9WA 4FJHA 1B9FA 2KFZA 4JS4A 4H4OA 5HRSA 4TSXA 4AHCA 2DPNA 4F9OA 4YNQA 5FPEA 5BN8A 3SQ1A 1ZBHA 4MLHA 3OS1A 2AP1A 1RT2A 5SWMA 4H5NA 4ISEA 4E89A 4CHQA 3OYHA 1KSPA 3F5TA 1WAFA 3V1OA 1RILA 3CCUN 1HKGA 3VEYA 1NGBA 4BG8A 1WAJA 3B6PA 4KH4A 3E9OA 1KVAA 3PLAA 1C0GA 2ZF5O 4EHUA 4OLBA 4DHYA 1G15A 3OYMA 2O8CB 4CHOA 3T1HK 4ISGA 1M1KO 2E88A 4B9TA 1LWCA 4PUOA 2P9SB 4IOXA 1VQMN 3O08A 1W9HA 5AZIA 3NCIA 1JXBA 3A5LC 4F8RA 1XMOK 2JWKA 5KGXA 4DS5A 5KRTA 3CCEN 1ZBFA 3AO1A 3L2WA 5F1XA 2V7ZA 1IKVA 1RTJA 4KTQA 4FOIA 4MO4A 2VQFK 3A5NC 4Z4FA 4EHTA 5GAEP 1T05A 1OH8A 5EXWA 3ZLJA 3MK6A 4CJQA 3PV8A 5SZTA 5MLCQ 3OYJA 4DTSA 1DTQA 1LWFA 4IZ9A 3VQQA 1NJXA 3E01A 4E7LA 5BR9A 4FWKA 5AQLA 3DLBA 4FPBA 3VQDA 4FXDA 4A2BA 1TAQA 3VQ8A 4K43A 1Q9YA 4WQ5A 3PY8A 3G6EN 4E7KA 3OTOK 3C0BA 1WSGA 5LJWA 5E84A 3LAKA 4FVUA 3DYAA 4KFBA 4BR5A 2I7PA 4K42A 1YITN 1W7AA 5AQJA 5FLXO 4FJIA 5AQNA 2GELA 3KD5E 2YHBA 4CE9A 3ATUA 5JMVA 2PAVA 4IG0A 5KGWA 4JYAK 4B1XB 4GVMA 4A57A 4CGFA 1XC9A 2LSNA 5BN9A 2ASPA 3AAPA 2D0PA 3ULEB 2Q36A 3DLEA 3SNNA 1MWMA 2HHXA 1HRHA 3U6FA 3EN9A 4Y0WA 1WSJA 3M8RA 2NLXA 4CJ5A 2KFNA 2HBKA 3S3NA 2BUPA 4MLEA 3ZETB 2OCEA 4BDPA 1HQEA 3KK7A 4Z94A 5M1PA 3UB5A 3R1XA 3TAEA 3PO4A 4BGBA 2VCPA 1LAVA 3LANA 3OYIA 4FJKA 5BRHA 2G8WA 5ADXH 3QEXA 1WLJA 1RBTA 1ATSA 1KFDA 3H46O 2B4JA 3PO5A 3K5MA 3LDOA 3T1YK 1VQ7N 3ENHA 5KI6A 2HHTA 5CHIA 5K14A 4IFYA 5ELZA 4BREA 4B9QA 3H3NO 3RRGA 1RDAA 1YJWN 5EOYA 1N33K 1HNVA 1NK6A 2ZJPL 1VSKA 3VEWA 3QIOA 3VQEA 3KJVA 2QM1A 4KHQA 1XHZA 1A5XA 4M3RA 3PIOL 1GOAA 4YOWA 3HM9A 4OGEA 3RR7A 2O8FA 1NKEA 2P9IA 3MN9A 1NK7A 3HOSA 2QKKA 3MAQA 3B8AX 2O8BA 2YKNA 3ZSVA 5KQ8A 3VEZA 5AQPA 4BC2A 4LSLA 5CZ1A 3IS9A 4DUZK 4NLBA 1X3MA 3J7AP 3ZETA 3VA3A 2A41A 1NK8A 3KKRA 1BWFO 1C0UA 4JI1K 4BRLA 3OJSA 4B1YB 3NE6A 3KD1E 1Q86O 3ZT2A 2G8KA 3VGMA 4C1NI 2RPIA 4DKWA 1IBLK 3QMLA 2UUBK 1QSLA 1HJOA 1SKRA 1HMVA 4LH4A 1H1VA 1OKJA 4BRMA 3I56N 3SYZA 5C0YA 3EL2A 3AVGA 4IDKA 4FZZA 4BE2A 3FGUA 4ELVA 3F9MA 4BRFA 3C6UA 1VSHA 4DFJA 4ZTJA 4FWSA 4JKCA 4I9QA 4PWDA 1YJ9N 3MEGA 4H0VB 3VF4A 3VF2A 2HBLA 4KKOA 5AZJA 4FJ7A 1IH7A 2RF2A 3D7EO 3KVGA 4W5RA 3TSQA 3ENOA 4M7YA 2EHGA 5AQYA 1S72N 3BGRA 2NRVA 3DAWA 3W0LA 1TYQB 3TTFA 5DM7L 2D4WA 3WXMB 2OANA 1VQ5N 5JVHL 4BRAA 4V19S 4BRIA 4JV5K 4KV8A 2ZE2A 4M45A 1J5OA 2VWKA 3P39A 2IVOA 2H3GX 2RKIA 3C6TA 5KRSA 3T3FA 4ICLA 4DU3A 2G8IA 1HNIA 5LMNK 1LV5A 4K41A 4X62K 4O8KA 5BPMA 5A2QO 2A1SA 3LZIA 3THWA 4DR1K 5LY3A 4Z4CA 3VGKA 2VYPA 4JN4A 1NGHA 3KK2A 4FJGA 4LF9K 3HM8A 1JLCA 2QWOA 5AFUA 5BPLA 4CZGA 4DUYK 4RW7A 1TUUA 3CCRN 4DLEA 3LP1A 1S1XA 3OS0A 4DTNA 4FM1A 1TVRA 3TTCA 2IAJA 1WSFA 2NNWA 3PX0A 4CJKA 4UQGA 2A5XA 4DV5K 4M3TA 4JLHA 1X9SA 4DV1K 3NMUA 5GADP 3HP6A 1BQNA 1QVFM 3ZX2A 2I5JA 2P51A 1WNSA 3ENBA 4H5RA 4FLXA 2OYQA 3VQBA 2NRWA 1Q18A 1S3XA 5C42A 3A2FA 1D8YA 5AQRA 2HHQA 3HTVA 3VQ4A 1ILYA 1S1WA 3ZT3A 4FWPA 3NHGA 3AA4A 2YHAA 4FLYA 3AAQA 1IG9A 4KTZA 3O4WA 1SL1A 1BA1A 2IVPA 5AR0A 3QEPA 1BOTO 2NRTA 2OPSA 1BU6O 1IKYA 3P1GA 4H5VA 3WQUA 2X6SA 4DQIA 1L3SA 3CCVN 3VQPA 3SUPA 1VQNN 4DSEA 4BQZA 2HF3A 2GUIA 5GINA 1UAXA 3DM2A 1EETA 3AVAA 1X3NA 5JS2A 1N34K 3MN7A 4CJVA 5HROA 3NVMA 1U47A 1C1CA 3FZMA 4MDBA 4C8NA 2DTUA 2PBDA 2I7NA 3L2RA 4CGHA 1XNQK 4CZJA 3O9QA 4GW6A 1IG8A 1L3TA 4X65K 3CPEA 4H0XB 4BR2A 2KZMA 4NYNA 4PL8A 3CFRA 1VSLA 4YDUC 4CK3A 3AV9A 5AQSA 1YAGA 4BRGA 3VEVA 1TAUA 3SPYA 4RWTA 4CZMA 4WFAL 3WNHA 4FWQA 1RBSA 2P5GA 4GV3A 1VSJA 1NLVA 3F9KA 3H6EA 2F9TA 1W0HA 1RTIA 1S9EA 5J2MA 3SBGA 3OYAA 1CXQA 3GL1A 3O4NA 4QS8A 2YX6A 4C23A 4BRNA 5EY4A 4C1NK 1XUPO 3I55N 1SL0A 3ZSZA 4CD1A 4ID5A 5AQVA 1HR0K 1TKDA 3J8AA 4B3RK 3WUHA 3NFAA 3MXMA 2CH5A 4FLZA 3KTQA 3MN6A 3ZSWA 3DWLA 5HBMA 1ITGA 4K0KK 3D2EA 2HW3A 3QBWA 4JI4K 4L8RB 1CZ9A 4EFHA 3CC4N 3P5JA 3KLGA 3UE5A 4HUGA 3DXMA 5DK5A 4O44A 1JL2A 3KWGA 4WYBA 1JLBA 3QLHA 1D5AA 1BCOA 1K6YA 4JKFA 4EAHD 3A0IX 3O3GA 4DTXA 1ASWA 4BC3A 1U2VA 2YV0X 1MWKA 2DFFA 3LP0A 4JKBA 4B08A 1DKGD 1U45A 1RT1A 5C2DA 4EZ6A 1VHXA 3QEWA 4O4GA 2ZM6K 5GAHP 1BHLA 4WF9L 1KVCA 3DXKA 4E3SA 4ZTFA 4QAGA 4YOYA 3O9UA 3NF8A 4KH6A 4CFAA 1TV6A 1KTQA 4OGCA 4KREA 2VWJA 2W6LA 4WQ4A 3DLRA 2F8TA 3M5RA 3LWMA 1SUQA 2ZQBA 1RT7A 4IFVA 2FSJA 4JK8A 3MN5A 3RRHA 4H0PA 3V1QA 1YHQN 3O9TA 1REVA 1U6ZA 2YKMA 3L6QA 2ZWHA 2HMIA 1SKSA 4CZLA 1JXEA 3AO4A 3K9JA 1R0AA 3C7NA 4RW8A 4AF1A 3AVMA 2GTDA 4GMJB 1VQKN 3P38A 4W5QA 1HLUA 3QETA 4OX9K 2GEMA 3LL3A 3OY9A 2Z1IA 4AILC 4B1VA 5M1QA 4CERA 1BIUA 3MX5A 2XRIA 3EEQA 1U48A 3FZHA 4K25A 2QWMA 3RMDA 4F4KA 2G8HA 5AZIB 4DQ8A 3CCJN 3SUQA 3VQ7A 2HNDA 3ASMA 3LPTA 2OPRA 4DQQA 1J54A 1RCHA 3P4IA 2OTJN 1QQCA 4BRCA 1NWKA 1MU2A 4PA1A 2HNYA 4XEIA 3EE9A 4CF0A 1HPMA 2NRXA 3WXJA 3MCPA 3Q7CA 3KIOA 2W40A 3V9SA 4ILGB 4CJFA 3EZWA 5JLHA 1TK5A 1TKTA 3ZT4A 4BE1A 4H5TA 4JI8K 1NU0A 1BI4A 2E6MA 4FLVA 4F2SA 5TKYA 1BA0A 1BIZA 4KPYA 3QICA 1EP4A 4DR7K 4PQUA 1IJJA 1TK0A 3CFOA 4Z4EA 3F2KA 4DV0K 4DQPA 4CZFA 3HVRA 4DFPA 3CPWM 4J2BA 2HB5A 3OYCA 1V4SA 2O4GA 1IO2A 4RG8A 1LOTB 3DRPA 1OH5A 4DV7K 4FO0A 2HMPA 3I8BA 1QHTA 3L3VA 4W5TA 2Q0UA 4CEDA 4CJLA 3S9HA 2HVIA 4BVOA 2W6KA 2QXLA 2WOMA 4FK2A 3CYMA 2FF3B 1ZXOA 5J2QA 2RE2A 3VGLA 4OPHA 2P9NA 4BRDA 2QXFA 3V81A 4KBOA 4LFBK 5AQHA 3ZCMA 3OBYA 3UKUA 5FPDA 1KQSM 2E2PA 2QW9A 4CI6A 2A42A 2A1RA 1KC8O 4JI5K 3VPZA 1KAXA 3O80A 4A59A 4CIFA 4FZXC 3R8EA 3HK2A 5I9EB 1JLEA 3VMFB 4BR4A 3MX2A 3HL8A 4AM7A 2B6AA 4ISFA 4JKEA 1DLOA 3VTIA 4CF9A 4O5BA 3LDLA 2OPPA 2FBXA 5C15A 4ILHA 4HTUA 2HHSA 1K8AO 3D2FA 4HVJA 1QZ5A 5KPZA 4DR4K 3KHYA 5KQDA 4KB1A 1YUWA 5FPNA 4A2AA 1SZ2A 3BF3A 1ZBLA 4GV6A 4FOEA 5FROA 2E6LA 3QINA 1OH7A 3AVLA 3ZSQA 4FWRA 5AQOA 3JXUA 4BWJA 4AHRA 4E0DA 3AVJA 5HP1A 2E8AA 1ESVA 3AGRA 4U7BA 4FSVA 3IRXA 2QWRA 4CEQA 2ZGYA 4XIUA 1C1AA 3L3UA 2O8FB 2P9IB 5FDLA 1WB9A 2P9UA 4JD2A 2OTLN 4I2QA 4LF6K 2O8BB 2E2NA 1VRUA 4DR2K 1RNHA 4X66K 1WSHA 4EIAA 3LDQA 3K9KA 1GLLO 1WSEA 4C8KA 4MFBA 4KHSA 3HP9A 5AJ3K 3N4QA 3QESA 4CHNA 4AHUA 4CK2A 1A5WA 2FLOA 2BANA 4B1WB 3C6AA 1RDWX 3IDHA 4E1JA 3FFKB 3HT3A 3BP8A 4IJNA 4LC9B 1VSEA 2QWLA 5AQXA 4IOCL 1ATNA 3KWIA 4IFEA 4IDHA 4B9NA 3ZYYX 3VTHA 4CGJA 2ZJQL 4RW9A 3A5OC 4FJ8A 4CBUA 1ATRA 1UWBA 4FWNA 3I0SA 2Q31A 4B9LA 2OZSA 3W3DA 3SCXA 3U9DA 3KK1A 4DS4A 5AZJB 2HNZA 1NBWA 2KLAA 3DMJA 3ISNC 4AM6A 1GOBA 3ID6A 3SAHA 3P31A 1HUXA 3NGYA 2HHVA 3V9ZA 3BDPA 3SBTA 3NAEA 3QNOA 3A8YA 1VRTA 3L8BA 3AVFA 1BISA 3DLHA 4CFDA 3O1WA 4PKHA 1CZAN 5FPMA 4OPJA 5FRNA 4YOTA 5BREA 4KHNA 3J7YP 3IKMA 4WE1A 3SMPA 1P90A 4WFNL 2Y1JA 1TL3A 4B3TK 1SS6A 1J5EK 1QTMA 4CJSA 4DR6K 3IMXA 2PFUA 2VGNA 4CEZA 4Q5VA 3RMBA 1XMQK 4FK4A 2FSKA 1BDGA 3THWB 4OKKA 3QO9A 3V6DA 3AVIA 4M3YA 1VSFA 4EP4A 4BDZA 5CYQA 3AO3A 2KW4A 4LY7A 1VAZA 5BPNA 4CGIA 4DV4K 2CGKA 4JKDA 3HRGA 3ULDA 2UXCK 1XI1A 3M8SA 3DJCA 4N47A 4LSNA 1FXXA 3ALYA 3WNFA 2AJQA 1C0FA 3LP3A 5JLFA 4JI7K 4RW6A 1ASVA 4LFCK 2BDPA 4PY5A 4HCCA 2E2QA 2XY5A 3ZSXA 5F2RA 3LWLA 2Q0RA 3SV3A 4BVPA 1K8KA 5BRFA 2F96A 2UXDK 2YI1A 4CESA 3CG7A 4FWOA 3K5LA 2A40A 5M1KA 1GLAG 4YOXA 3OYGA 3RWUA 3HJFA 3RVCA 2Q97A 3J80O 3I33A 2W42A 2VG6A 3BF1A 3L4QA 4RW4A 1EX4A 4NLCA 4CD3A 3WXIA 3O6WA 1ZBIA 1UA1A 4QS9A 3VESA 1C0TA 3HXMA 1TKZA 1YVUA 2WUSA 4M7XA 4DTOA 3CC2N 4CJWA 5GIOA 4CBXA 4B8AB 4DV2K 5I3UA 3SLCA 3L0QA 4CJEA 1SKWA 1VQ9N 4A5AA 5AQIA 1GLJO 1WUAA 4DR5K 2O8EA 4B9MA 2E4LA 2HHUA 1CXUA 2HOEA 3UKRA 4HWIA 4H4MA 4DTUA 4DTJA 3THVA 5C10A 2IDOA 3GG4A 1UOCA 2D0BA 1N36K 3NGZA 5BRDA 3VERA 4DFKA 1KVBA 1NGJA 1SAZA 5HRNA 1YJNN 1NGAA 5B8HA 2G8UA 2YNIA 3V1RA 3ZSRA 3EY1A 1E4GT 3TI0A 1VQLN 4K8ZA 1YTUA 3AA2A 1Q9XA 3CCQN 1C1BA 1RDCA 5KPTA 2Y1IA 4I2PA 2D1KA 1HYVA 2IOCA 1BUPA 3TWHA 3EE8A 4CJRA 1VQ8N 4Z4HA 1JCGA 1LW0A 4GKJK 4JI0K 3L4IA 4HUFA 5KTQA 3O9SA 5LMUK 1ZC6A 2A3ZA 1NKBA 3VEOA 4E1NA 2P9KA 3SUNA 5J1EA 2UU9K 4LF5K 3L2VA 2G8FA 1RBVA 3K59A 4A61A 2F7TA 2IC3A 3D2EB 4O55A 1NM1A 1QZ6A 4FYDA 3SAFA 2W41A 4O0JA 1X9MA 1HPZA 4PL7A 1BO5O 3AO2A 3DXMB 3NDKA 2D0CA 3AARA 2JGUA 3H3OB 1FJGK 3HOTA 4NXMK 1Z26A 1T3VA 1QQNA 1S6PA 3LZJA 3O4QA 4JK7A 5T7BA 1T6CA 4JI3K 4BRPA 1Z6RA 2ITGA 3C95A 3HZ6A 2BH1A 3NH2A 3MMVA 3OBWA 2PZSA 4LFAK 4L3QA 1U2VB 1HKBA 4DSLA 1RTDA 5HL7L 1IBMK 5M1NA 3AVHA 1Q7YO 4H0YB 1NOYA 4QCLA 4DFMA 3DXKB 3CM6A 1F21A 4H5WA 5F0XA 3K5OA 1JLAA 1RT6A 3TAGA 2ASOA 4HCBA 1BCMA 3PX6A 1VSMA 4CF2A 4CF1A 3LM2A 4FJLA 4YFUA 4PKGA 4JK9A 2QTDA 4DSJA 4AQYK 3AVKA 2NRHA 4ILJA 4CF8A 3UIQA 4JI2K 3U8XA 4B1ZA 1Z05A 3GOIA 3KLIA 1ZBUA 3C7NB 4B3MK 3NF6A 3T7ZA 1DTTA 3OYBA 2WBNA 3B6OA 1Z25A 3F73A 2NRRA 4DLGA 2P9LA 4FJXA 4DF8A 4KB0A 3SAGA 3CM5A 5AQMA 1WBDA 4BR0A 3ID8A 3AA5X 2QK9A 4KRFA 1J6ZA 3C6HA 1GLCG 3M8PA 4OLAA 4W5OA 1TGOA 3CERA 3DRSA 1W2BM 2UUAK 1XQSC 1TKXA 2UYTA 3IFRA 2XO7A 2XHBA 3KKSA 2QWNA 3CJCA 4KAZA 2KHOA 4KHWA 1VQ6N 1VSDA 4NYFA 4AHTA 1Q8IA 1CZBA 4BR9A 1L3UA 2P5OA 2NUBA 3K58A 5IWAK 1D9FA 2F8SA 3JYTA 1BI4B 3O9RA 4E19A 3THXB 4Z4IA 4CVNE 1HNWK 1YF5L 2Z1HA 1RGIA 3TSPA 2ASMA 4U67L 4CEFA 4IO9L 1NK4A 4BRHA 4BRQA 4A62A 4Z0UA 5TKWA 5AQZA 4IEEA 3SJJA 1NJYA 4WQ4C 3MEEA 2V51B 4CJPA 3KK3A 2UXBK 3HSTB 3EYZA 4J2EA 3O8MA 4ID1A 5ADXA 1BL3A 4OO1J 2UUCK 4CJ4A 3SJHA 5CYMA 4CGGA 3RSEA 3CJAA 1Y97A 1O1WA 3VQCA 2P9NB 4LH5A 2YHXA 1TUYA 2X78A 3THYB 2HBMA 1YXQA 2DFHA 3ZEUA 3UKUB 4FK0A 3TAPA 1I39A 1DGKN 2GX9A 2XY8A 1C6VA 2YNHA 4FLWA 3GDQA 1NJZA 1Q81O 1XNRK 2CH6A 2FBYA 3VQ6A 5HRPA 3FE1A 3IG1A 4PKIA 4DV6K 3SPZA 4YHHK 3OYKA 4QOZB 3MCAB 3RTVA 2GBZA 3THXA 1HYSA 1HX1A 4MO5A 4IO8A 1FK9A 3CJBA 4G9ZA 2YHWA 1L3VA 1S1TA 2PYJA 2X74A 3E66A 1O13A 1WOQA 2E1YA 3D2FB 4CJTA 3K2PA 5LL6Z 4BRKA 5KPRA 3OYDA 3H1QA 4JHDA 1KD1O 3E9PA 3IAYA 5C2FA 4JKGB 2O8DA 1GLEG 5IT9O 4CW7B 2HHHK 2FBVA 3HPHA 4JKHA 1RT4A 1NGGA 3FZLA 3HBTA 3L2QA 5EX5A 2Q1NA 3THYA 4FJ5A 2GUPA 2YJFA 4DSKA 4ELUA 3WXLA 2V7YA 2XY6A 1LAWA 1DEJA 2VG5A 3BZKA 3QERA 2P9UB 4JD2B 1QSYA 3SI6A 1OH6A 3CJ7A 1OVYA 1S22A 4DTRA 4I6MB 2HHWA 3D6RA 4PHTX 3AGKA 1TK8A 4FM2A 3MWPA 4AHVA 1VQPN 3LDNA 1P8ZA 1WN7A 2AA4A 3TABA 1XHXA 1U49A 1RT5A 4BC4A 3HPGA 3GBTA 3EZ5A 4DQSA 1GLFO 3SQ0A 4QS7A 2A6AA 4DU4A 1J53A 4CIGA 3CJ9A 5AQGA 1S5JA 3DI6A 4KH5A 3I8DA 4BR7A 1NK9A 3D0PA 3O3HA 4KHYA 3DLGA 3TANA 3D45A 1WSIA 4JKGA 3U3YA 2QWQA 1QHAA 2OPQA 3CHWA 4O0IA 5HOOA 3VOVA 1GLBG 4FJJA 2BE2A 1BQMA 4WQ5C 1K9MO 4FL9A 4CZHA 1NMNA 5M1FA 4IEIA 1RTHA 3OYNA 2ATQA 1OVQA 4B9UA 1KFSA 4CFBA 4N76A 4Q0BA 4J8FA 4AH9A 5GAGP 1EWRA 1MA9B 4IOAL 4ZHRA 2O8CA 3CCMN 3NH1A 4Y1CA 3VQAA 2P9SA 3PUFA 4I6MA 3CETA 3R6MA 4BC5A 3U3GA 4CEAA 4FZYA 5AQKA 4LD0A 4O8UA 4JI6K 3MECA 4CHZA 1T44A 4NCGA 3QEVA 3PIPL 3O5BA 1YIJN 4FPAA 1JCFA 3TAQA 1QVGM 1SL2A 1T7PA 3CMEN 3NBPA 4H0OA 5H1SQ 1LCUA 4M63C 1S6QA 1JKHA 1IKWA 1CLQA 4FJMA 5E41A 2QKBA 2Q2RA 3L2UA 4M3UA
chains in the Genus database with same CATH topology
4JYAK 4X64K 1HR0K 4B3RK 4DV5K 2F4VK 1IBLK 2VQEK 1IBMK 2UXBK 2UUBK 4DV1K 1HNZK 4DR4K 4DV2K 4K0KK 4JI4K 2UUCK 2E5LK 3J7YP 1I94K 4LF4K 4DV3K 3J81O 4B3TK 1J5EK 4DR5K 4DR6K 4GKKK 4YY3K 4JI8K 4AQYK 4LF8K 3T1HK 1XMQK 1N36K 4DR7K 3JAMO 4JI2K 4DV0K 1XMOK 1XNRK 4LF6K 4B3MK 4DR2K 4B3SK 4DV7K 5BR8K 3T1YK 2ZM6K 4KHPK 4X66K 4DV4K 4DV6K 2UXCK 1N34K 4YHHK 2VQFK 4NXNK 5AJ3K 4GKJK 4JI7K 4V19S 4JI0K 4LFCK 1N33K 4JV5K 5LMUK 1XNQK 4LFBK 4LF7K 4X65K 1HNXK 2UU9K 4LF5K 4DR3K 2UUAK 5LMNK 5LL6Z 2UXDK 4X62K 5A2QO 4DR1K 4JI5K 4JI6K 5IT9O 4LF9K 1IBKK 4CW7B 3OTOK 2HHHK 1FJGK 4DUZK 4NXMK 3J80O 5IWAK 4DUYK 3J7AP 4OX9K 1N32K 4CVNE 4JI3K 1HNWK 4JI1K 5FLXO 4LFAK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA K;  4X64 K;  1HR0 K;  4B3R K;  4DV5 K;  2F4V K;  1IBL K;  2VQE K;  1IBM K;  2UXB K;  2UUB K;  4DV1 K;  1HNZ K;  4DR4 K;  4DV2 K;  4K0K K;  4JI4 K;  2UUC K;  2E5L K;  3J7Y P;  1I94 K;  4LF4 K;  4DV3 K;  3J81 O;  4B3T K;  1J5E K;  4DR5 K;  4DR6 K;  4GKK K;  4YY3 K;  4JI8 K;  4AQY K;  4LF8 K;  3T1H K;  1XMQ K;  1N36 K;  4DR7 K;  3JAM O;  4JI2 K;  4DV0 K;  1XMO K;  1XNR K;  4LF6 K;  4B3M K;  4DR2 K;  4B3S K;  4DV7 K;  5BR8 K;  3T1Y K;  2ZM6 K;  4KHP K;  4X66 K;  4DV4 K;  4DV6 K;  2UXC K;  1N34 K;  4YHH K;  2VQF K;  4NXN K;  5AJ3 K;  4GKJ K;  4JI7 K;  4V19 S;  4JI0 K;  4LFC K;  1N33 K;  4JV5 K;  5LMU K;  1XNQ K;  4LFB K;  4LF7 K;  4X65 K;  1HNX K;  2UU9 K;  4LF5 K;  4DR3 K;  2UUA K;  5LMN K;  5LL6 Z;  2UXD K;  4X62 K;  5A2Q O;  4DR1 K;  4JI5 K;  4JI6 K;  5IT9 O;  4LF9 K;  1IBK K;  4CW7 B;  3OTO K;  2HHH K;  1FJG K;  4DUZ K;  4NXM K;  3J80 O;  5IWA K;  4DUY K;  3J7A P;  4OX9 K;  1N32 K;  4CVN E;  4JI3 K;  1HNW K;  4JI1 K;  5FLX O;  4LFA K; 
#chains in the Genus database with same CATH topology
 2CGJ A;  3MWT A;  2D0A A;  4M41 A;  4YOV A;  2OA8 A;  1V4T A;  3GE1 A;  4X64 K;  3KZB A;  5CE3 A;  1ZYQ A;  4HHT A;  4FLU A;  2KQ2 A;  4IBN A;  1N6Q A;  3CJ1 A;  4E1M A;  3V9U A;  1NGF A;  1EO1 A;  3O3F A;  4BRO A;  5JIC A;  1B9D A;  2E1Z A;  4BDY A;  4BG9 A;  4DV3 K;  1YTA A;  3J81 O;  1E3M A;  1NKC A;  4CEC A;  2KZZ A;  1NK5 A;  1LW2 A;  1QQO A;  4IKF A;  1BGX T;  2VGM A;  3PX4 A;  3LPU A;  4DTP A;  2JWL A;  3HPO A;  3TR8 A;  4LF8 K;  3CC7 N;  2G8V A;  4JKA A;  3PSF A;  3MDQ A;  1K8K B;  3WNE A;  4FVM A;  3EKU A;  2IIR A;  3HVT A;  5AQF A;  3QBX A;  3MED A;  1NGC A;  4BGA A;  3VQ5 A;  5AQW A;  3DLK A;  1D4X A;  4NO7 A;  4H03 B;  1VK0 A;  3ULE A;  5J2N A;  1QQM A;  1Q82 O;  4MQ3 A;  4N5S A;  1RBU A;  2ZJR L;  3MXJ A;  3QFP A;  4C8O A;  3OVN A;  1RFQ A;  3T69 A;  3QIP A;  4IXC A;  4JRP A;  4FLT A;  3WT0 A;  3SZ2 A;  4O5F A;  4CGD A;  1EXQ A;  1U04 A;  3H45 C;  1QSS A;  4HUE A;  4CEO A;  3C65 A;  1HNX K;  4B3O A;  4DR3 K;  3T1A A;  3CCS N;  3ATV A;  5M1O A;  3FLC O;  1IV0 A;  4JRQ A;  4IWV A;  3CCL N;  5J2P A;  3JS6 A;  1T6D A;  3U9Z A;  5FRM A;  3WQT A;  4J2A A;  3ZSO A;  3BUZ B;  1L5U A;  2O8E B;  4M3W A;  3DOK A;  5EU7 A;  3CXC M;  4CFC A;  1X9W A;  2WFB A;  4GY2 B;  3UKR B;  3E1Y A;  2QA4 N;  3OA9 A;  2HBJ A;  4DB3 A;  4KI4 A;  3LM9 A;  2GWK A;  1NOZ A;  3TAF A;  3O1B A;  3TU5 A;  3OS2 A;  1HJR A;  4KHU A;  3QB0 A;  3HSC A;  4H8K A;  3NF7 A;  4EP5 A;  3S3O A;  1KLN A;  3NVK A;  5I42 A;  3LAM A;  3S41 A;  4K8X A;  2HST A;  4DWI A;  4CJ7 A;  1JLG A;  3EO3 A;  1HYZ A;  1C0M A;  3P83 D;  3FFI A;  5CR4 A;  2BGG A;  4NB4 A;  5AQT A;  2DFE A;  3V4I A;  3AO5 A;  3OHR A;  3SMS A;  4NCB A;  3Q7B A;  1XWL A;  1M90 O;  4DU1 A;  2P9K B;  3M1F A;  1NNE A;  1T03 A;  3OYL A;  1UA0 A;  2X6N A;  1G99 A;  4F3O A;  2FXU A;  3DLL L;  1N5Y A;  2V52 B;  3JAM O;  3CI5 A;  4KI6 A;  5HRR A;  4DF4 A;  3VF6 A;  4RTF D;  2JLE A;  3VET A;  3K57 A;  5D3G A;  3NH0 A;  2DY4 A;  2QWP A;  1SQK A;  2YCH A;  3CQY A;  3R3L A;  2ZD1 A;  3TAM A;  1QE1 A;  4CZI A;  1NJI O;  3VA0 A;  4M3Z A;  4JS5 A;  1S9G A;  1EWQ A;  1ASU A;  1W97 L;  1SV5 A;  4H0T B;  3HI0 A;  4CK1 A;  3ZT0 A;  1EKE A;  1YT3 A;  1NGE A;  1JLQ A;  2VWB A;  4DCH A;  4RCH A;  4WFB L;  5HLF A;  4IG3 A;  3CFP A;  4KTW A;  5DMR A;  4CEE A;  4FW1 A;  4FJ9 A;  2KKZ A;  3G71 N;  3RR8 A;  5AQQ A;  3TAR A;  1IKX A;  3K5N A;  4BY9 C;  4C8L A;  1TYQ A;  1HQU A;  3AY9 A;  3TSU A;  3G25 A;  2VG7 A;  4FWL A;  5JVG L;  4DQR A;  1GOC A;  4G1Q A;  2EWS A;  5C24 A;  1JLF A;  3RMA A;  1KAZ A;  3S3M A;  3DRR A;  2Q3S A;  1RDB A;  2J4R A;  4OVL A;  4MDA A;  1KAY A;  2FBT A;  3FZF A;  4FM0 A;  2ZGZ A;  4R79 A;  2GWJ A;  2VQE K;  4FWM A;  4OKJ A;  3BY5 A;  1NGD A;  3M3Z A;  1HNZ K;  2P9L B;  3KLE A;  3SUO A;  1WBB A;  4YOR A;  4B9S A;  4JNE A;  4Y1D A;  1U4B A;  1I94 K;  1ZBS A;  5CY4 A;  4F2R A;  2RHK A;  2CGL A;  4AHS A;  4E7I A;  4I9L A;  4YDU A;  4GKK K;  1Y64 A;  4M3X A;  2HVH A;  3AVN A;  1QS4 A;  3K0S A;  3QDK A;  4GNI A;  1E4F T;  4JAX A;  1NMD A;  4M42 A;  4BQL A;  3CD6 N;  3VN5 A;  1VQ4 N;  2IGI A;  1BG3 A;  3M8Q A;  4IJA A;  4DSI A;  1LWE A;  2B5J A;  1S1V A;  2D5R A;  2RN2 A;  4B3S K;  5CZ2 A;  3SQ2 A;  4KHP K;  4CBW A;  4E7J A;  2QI2 A;  1MDU B;  1X1P A;  3ZT1 A;  4J2D A;  2Z1G A;  4NXN K;  2ETJ A;  3LP2 A;  2NZT A;  3KLH A;  2Z1J A;  3V9W A;  3MXI A;  3OJU A;  1HKC A;  1T8E A;  4GVE A;  4HTL A;  3CF5 L;  3H1V X;  4XH4 A;  3VEN A;  2P1J A;  4KO0 A;  3AVC A;  4CJ3 A;  3ZSY A;  3LAL A;  3TPQ A;  3IUC A;  2D0O A;  3NF9 A;  1JL1 A;  1XC3 A;  3QNN A;  4BE0 A;  1N8R O;  4EZ9 A;  3LDP A;  3RSE B;  3WXK A;  4CJU A;  1IBK K;  1JCE A;  4OPA A;  3R9P A;  2FC0 A;  1NJW A;  3ZEU B;  4BWM A;  1YI2 N;  4XH5 A;  2YNF A;  1YVN A;  4R5P A;  2R7Y A;  3ZX3 A;  3G10 A;  3V9X A;  1A5V A;  4C8M A;  3PSI A;  3ITH A;  1R59 O;  3CIP A;  4CCH A;  5E26 A;  2YHY A;  4ELT A;  4B1U B;  3HO1 A;  4DSF A;  2F4V K;  2ITM A;  1D9D A;  1KLM A;  4CHP A;  3VQ9 A;  3SK3 A;  4XH1 A;  4CZE A;  2E5L K;  3CQX A;  4LF4 K;  3CQ8 A;  2IVN A;  3G4S N;  4NCA A;  1EQY A;  5JS1 A;  3G0Z A;  3HYF A;  4JEP A;  3N4P A;  2HF4 A;  2WC9 A;  4E7H A;  3C94 A;  1RT3 A;  4FJN A;  4F3T A;  1RDU A;  4CHY A;  2PY5 A;  4YY3 K;  5LJV A;  4GV9 A;  1RDD A;  4DTM A;  3WEE B;  3ZX0 A;  2P9P B;  4JHD B;  3BZC A;  4Z4G A;  3BEX A;  5C12 A;  2OZM A;  1VQO N;  3A5M C;  5AFU H;  2XY7 A;  3WNG A;  2O8D B;  1NG9 A;  3SV4 A;  2WON A;  3JSM A;  2EX3 A;  3FZK A;  3H08 A;  3AVB A;  5BR8 K;  4N41 A;  4WCE L;  4FW2 A;  3E9L A;  2QEX N;  2YJE A;  3LDS A;  3I0R A;  3QFU A;  2NRZ A;  2E20 A;  4FCY A;  4OKE A;  1B92 A;  3VEX A;  2YNG A;  4YOU A;  4DG1 A;  3NGI A;  3AA3 A;  1GLD G;  5DM6 L;  3EKS A;  3OYE A;  2BTF A;  1NGI A;  3M6G A;  1I3A A;  1FKP A;  1DT9 A;  2FF6 A;  2FSN A;  5GIP A;  2O4I A;  3RMC A;  4W5N A;  1J9A A;  4LF7 K;  5AQU A;  1K73 O;  1NK0 A;  3KLF A;  1X9J A;  1RBR A;  2GV9 A;  4CZK A;  3U4L A;  5C25 A;  4BAC A;  4DMN A;  1FW6 A;  3QEI A;  1JJ2 M;  3FR0 A;  3J7Z O;  4N56 A;  4B8C A;  4OPK A;  4CIE A;  1KXP A;  5EVZ A;  3DOL A;  4CEB A;  1S1U A;  4B9V A;  2E2O A;  4UY8 O;  1N32 K;  3OW2 M;  3TTD A;  3CMA N;  4OJR A;  4I7F A;  1KCF A;  2WTU A;  2IS3 A;  3T19 A;  1KRP A;  2PYL A;  3OYF A;  1VSI A;  2KTQ A;  3WEE A;  1TL1 A;  1FKO A;  4A5B A;  3SQ4 A;  2P9P A;  2F9W A;  4FJH A;  1B9F A;  2KFZ A;  4JS4 A;  4H4O A;  5HRS A;  4TSX A;  4AHC A;  2DPN A;  4F9O A;  4YNQ A;  5FPE A;  5BN8 A;  3SQ1 A;  1ZBH A;  4MLH A;  3OS1 A;  2AP1 A;  1RT2 A;  5SWM A;  4H5N A;  4ISE A;  4E89 A;  4CHQ A;  3OYH A;  1KSP A;  3F5T A;  1WAF A;  3V1O A;  1RIL A;  3CCU N;  1HKG A;  3VEY A;  1NGB A;  4BG8 A;  1WAJ A;  3B6P A;  4KH4 A;  3E9O A;  1KVA A;  3PLA A;  1C0G A;  2ZF5 O;  4EHU A;  4OLB A;  4DHY A;  1G15 A;  3OYM A;  2O8C B;  4CHO A;  3T1H K;  4ISG A;  1M1K O;  2E88 A;  4B9T A;  1LWC A;  4PUO A;  2P9S B;  4IOX A;  1VQM N;  3O08 A;  1W9H A;  5AZI A;  3NCI A;  1JXB A;  3A5L C;  4F8R A;  1XMO K;  2JWK A;  5KGX A;  4DS5 A;  5KRT A;  3CCE N;  1ZBF A;  3AO1 A;  3L2W A;  5F1X A;  2V7Z A;  1IKV A;  1RTJ A;  4KTQ A;  4FOI A;  4MO4 A;  2VQF K;  3A5N C;  4Z4F A;  4EHT A;  5GAE P;  1T05 A;  1OH8 A;  5EXW A;  3ZLJ A;  3MK6 A;  4CJQ A;  3PV8 A;  5SZT A;  5MLC Q;  3OYJ A;  4DTS A;  1DTQ A;  1LWF A;  4IZ9 A;  3VQQ A;  1NJX A;  3E01 A;  4E7L A;  5BR9 A;  4FWK A;  5AQL A;  3DLB A;  4FPB A;  3VQD A;  4FXD A;  4A2B A;  1TAQ A;  3VQ8 A;  4K43 A;  1Q9Y A;  4WQ5 A;  3PY8 A;  3G6E N;  4E7K A;  3OTO K;  3C0B A;  1WSG A;  5LJW A;  5E84 A;  3LAK A;  4FVU A;  3DYA A;  4KFB A;  4BR5 A;  2I7P A;  4K42 A;  1YIT N;  1W7A A;  5AQJ A;  5FLX O;  4FJI A;  5AQN A;  2GEL A;  3KD5 E;  2YHB A;  4CE9 A;  3ATU A;  5JMV A;  2PAV A;  4IG0 A;  5KGW A;  4JYA K;  4B1X B;  4GVM A;  4A57 A;  4CGF A;  1XC9 A;  2LSN A;  5BN9 A;  2ASP A;  3AAP A;  2D0P A;  3ULE B;  2Q36 A;  3DLE A;  3SNN A;  1MWM A;  2HHX A;  1HRH A;  3U6F A;  3EN9 A;  4Y0W A;  1WSJ A;  3M8R A;  2NLX A;  4CJ5 A;  2KFN A;  2HBK A;  3S3N A;  2BUP A;  4MLE A;  3ZET B;  2OCE A;  4BDP A;  1HQE A;  3KK7 A;  4Z94 A;  5M1P A;  3UB5 A;  3R1X A;  3TAE A;  3PO4 A;  4BGB A;  2VCP A;  1LAV A;  3LAN A;  3OYI A;  4FJK A;  5BRH A;  2G8W A;  5ADX H;  3QEX A;  1WLJ A;  1RBT A;  1ATS A;  1KFD A;  3H46 O;  2B4J A;  3PO5 A;  3K5M A;  3LDO A;  3T1Y K;  1VQ7 N;  3ENH A;  5KI6 A;  2HHT A;  5CHI A;  5K14 A;  4IFY A;  5ELZ A;  4BRE A;  4B9Q A;  3H3N O;  3RRG A;  1RDA A;  1YJW N;  5EOY A;  1N33 K;  1HNV A;  1NK6 A;  2ZJP L;  1VSK A;  3VEW A;  3QIO A;  3VQE A;  3KJV A;  2QM1 A;  4KHQ A;  1XHZ A;  1A5X A;  4M3R A;  3PIO L;  1GOA A;  4YOW A;  3HM9 A;  4OGE A;  3RR7 A;  2O8F A;  1NKE A;  2P9I A;  3MN9 A;  1NK7 A;  3HOS A;  2QKK A;  3MAQ A;  3B8A X;  2O8B A;  2YKN A;  3ZSV A;  5KQ8 A;  3VEZ A;  5AQP A;  4BC2 A;  4LSL A;  5CZ1 A;  3IS9 A;  4DUZ K;  4NLB A;  1X3M A;  3J7A P;  3ZET A;  3VA3 A;  2A41 A;  1NK8 A;  3KKR A;  1BWF O;  1C0U A;  4JI1 K;  4BRL A;  3OJS A;  4B1Y B;  3NE6 A;  3KD1 E;  1Q86 O;  3ZT2 A;  2G8K A;  3VGM A;  4C1N I;  2RPI A;  4DKW A;  1IBL K;  3QML A;  2UUB K;  1QSL A;  1HJO A;  1SKR A;  1HMV A;  4LH4 A;  1H1V A;  1OKJ A;  4BRM A;  3I56 N;  3SYZ A;  5C0Y A;  3EL2 A;  3AVG A;  4IDK A;  4FZZ A;  4BE2 A;  3FGU A;  4ELV A;  3F9M A;  4BRF A;  3C6U A;  1VSH A;  4DFJ A;  4ZTJ A;  4FWS A;  4JKC A;  4I9Q A;  4PWD A;  1YJ9 N;  3MEG A;  4H0V B;  3VF4 A;  3VF2 A;  2HBL A;  4KKO A;  5AZJ A;  4FJ7 A;  1IH7 A;  2RF2 A;  3D7E O;  3KVG A;  4W5R A;  3TSQ A;  3ENO A;  4M7Y A;  2EHG A;  5AQY A;  1S72 N;  3BGR A;  2NRV A;  3DAW A;  3W0L A;  1TYQ B;  3TTF A;  5DM7 L;  2D4W A;  3WXM B;  2OAN A;  1VQ5 N;  5JVH L;  4BRA A;  4V19 S;  4BRI A;  4JV5 K;  4KV8 A;  2ZE2 A;  4M45 A;  1J5O A;  2VWK A;  3P39 A;  2IVO A;  2H3G X;  2RKI A;  3C6T A;  5KRS A;  3T3F A;  4ICL A;  4DU3 A;  2G8I A;  1HNI A;  5LMN K;  1LV5 A;  4K41 A;  4X62 K;  4O8K A;  5BPM A;  5A2Q O;  2A1S A;  3LZI A;  3THW A;  4DR1 K;  5LY3 A;  4Z4C A;  3VGK A;  2VYP A;  4JN4 A;  1NGH A;  3KK2 A;  4FJG A;  4LF9 K;  3HM8 A;  1JLC A;  2QWO A;  5AFU A;  5BPL A;  4CZG A;  4DUY K;  4RW7 A;  1TUU A;  3CCR N;  4DLE A;  3LP1 A;  1S1X A;  3OS0 A;  4DTN A;  4FM1 A;  1TVR A;  3TTC A;  2IAJ A;  1WSF A;  2NNW A;  3PX0 A;  4CJK A;  4UQG A;  2A5X A;  4DV5 K;  4M3T A;  4JLH A;  1X9S A;  4DV1 K;  3NMU A;  5GAD P;  3HP6 A;  1BQN A;  1QVF M;  3ZX2 A;  2I5J A;  2P51 A;  1WNS A;  3ENB A;  4H5R A;  4FLX A;  2OYQ A;  3VQB A;  2NRW A;  1Q18 A;  1S3X A;  5C42 A;  3A2F A;  1D8Y A;  5AQR A;  2HHQ A;  3HTV A;  3VQ4 A;  1ILY A;  1S1W A;  3ZT3 A;  4FWP A;  3NHG A;  3AA4 A;  2YHA A;  4FLY A;  3AAQ A;  1IG9 A;  4KTZ A;  3O4W A;  1SL1 A;  1BA1 A;  2IVP A;  5AR0 A;  3QEP A;  1BOT O;  2NRT A;  2OPS A;  1BU6 O;  1IKY A;  3P1G A;  4H5V A;  3WQU A;  2X6S A;  4DQI A;  1L3S A;  3CCV N;  3VQP A;  3SUP A;  1VQN N;  4DSE A;  4BQZ A;  2HF3 A;  2GUI A;  5GIN A;  1UAX A;  3DM2 A;  1EET A;  3AVA A;  1X3N A;  5JS2 A;  1N34 K;  3MN7 A;  4CJV A;  5HRO A;  3NVM A;  1U47 A;  1C1C A;  3FZM A;  4MDB A;  4C8N A;  2DTU A;  2PBD A;  2I7N A;  3L2R A;  4CGH A;  1XNQ K;  4CZJ A;  3O9Q A;  4GW6 A;  1IG8 A;  1L3T A;  4X65 K;  3CPE A;  4H0X B;  4BR2 A;  2KZM A;  4NYN A;  4PL8 A;  3CFR A;  1VSL A;  4YDU C;  4CK3 A;  3AV9 A;  5AQS A;  1YAG A;  4BRG A;  3VEV A;  1TAU A;  3SPY A;  4RWT A;  4CZM A;  4WFA L;  3WNH A;  4FWQ A;  1RBS A;  2P5G A;  4GV3 A;  1VSJ A;  1NLV A;  3F9K A;  3H6E A;  2F9T A;  1W0H A;  1RTI A;  1S9E A;  5J2M A;  3SBG A;  3OYA A;  1CXQ A;  3GL1 A;  3O4N A;  4QS8 A;  2YX6 A;  4C23 A;  4BRN A;  5EY4 A;  4C1N K;  1XUP O;  3I55 N;  1SL0 A;  3ZSZ A;  4CD1 A;  4ID5 A;  5AQV A;  1HR0 K;  1TKD A;  3J8A A;  4B3R K;  3WUH A;  3NFA A;  3MXM A;  2CH5 A;  4FLZ A;  3KTQ A;  3MN6 A;  3ZSW A;  3DWL A;  5HBM A;  1ITG A;  4K0K K;  3D2E A;  2HW3 A;  3QBW A;  4JI4 K;  4L8R B;  1CZ9 A;  4EFH A;  3CC4 N;  3P5J A;  3KLG A;  3UE5 A;  4HUG A;  3DXM A;  5DK5 A;  4O44 A;  1JL2 A;  3KWG A;  4WYB A;  1JLB A;  3QLH A;  1D5A A;  1BCO A;  1K6Y A;  4JKF A;  4EAH D;  3A0I X;  3O3G A;  4DTX A;  1ASW A;  4BC3 A;  1U2V A;  2YV0 X;  1MWK A;  2DFF A;  3LP0 A;  4JKB A;  4B08 A;  1DKG D;  1U45 A;  1RT1 A;  5C2D A;  4EZ6 A;  1VHX A;  3QEW A;  4O4G A;  2ZM6 K;  5GAH P;  1BHL A;  4WF9 L;  1KVC A;  3DXK A;  4E3S A;  4ZTF A;  4QAG A;  4YOY A;  3O9U A;  3NF8 A;  4KH6 A;  4CFA A;  1TV6 A;  1KTQ A;  4OGC A;  4KRE A;  2VWJ A;  2W6L A;  4WQ4 A;  3DLR A;  2F8T A;  3M5R A;  3LWM A;  1SUQ A;  2ZQB A;  1RT7 A;  4IFV A;  2FSJ A;  4JK8 A;  3MN5 A;  3RRH A;  4H0P A;  3V1Q A;  1YHQ N;  3O9T A;  1REV A;  1U6Z A;  2YKM A;  3L6Q A;  2ZWH A;  2HMI A;  1SKS A;  4CZL A;  1JXE A;  3AO4 A;  3K9J A;  1R0A A;  3C7N A;  4RW8 A;  4AF1 A;  3AVM A;  2GTD A;  4GMJ B;  1VQK N;  3P38 A;  4W5Q A;  1HLU A;  3QET A;  4OX9 K;  2GEM A;  3LL3 A;  3OY9 A;  2Z1I A;  4AIL C;  4B1V A;  5M1Q A;  4CER A;  1BIU A;  3MX5 A;  2XRI A;  3EEQ A;  1U48 A;  3FZH A;  4K25 A;  2QWM A;  3RMD A;  4F4K A;  2G8H A;  5AZI B;  4DQ8 A;  3CCJ N;  3SUQ A;  3VQ7 A;  2HND A;  3ASM A;  3LPT A;  2OPR A;  4DQQ A;  1J54 A;  1RCH A;  3P4I A;  2OTJ N;  1QQC A;  4BRC A;  1NWK A;  1MU2 A;  4PA1 A;  2HNY A;  4XEI A;  3EE9 A;  4CF0 A;  1HPM A;  2NRX A;  3WXJ A;  3MCP A;  3Q7C A;  3KIO A;  2W40 A;  3V9S A;  4ILG B;  4CJF A;  3EZW A;  5JLH A;  1TK5 A;  1TKT A;  3ZT4 A;  4BE1 A;  4H5T A;  4JI8 K;  1NU0 A;  1BI4 A;  2E6M A;  4FLV A;  4F2S A;  5TKY A;  1BA0 A;  1BIZ A;  4KPY A;  3QIC A;  1EP4 A;  4DR7 K;  4PQU A;  1IJJ A;  1TK0 A;  3CFO A;  4Z4E A;  3F2K A;  4DV0 K;  4DQP A;  4CZF A;  3HVR A;  4DFP A;  3CPW M;  4J2B A;  2HB5 A;  3OYC A;  1V4S A;  2O4G A;  1IO2 A;  4RG8 A;  1LOT B;  3DRP A;  1OH5 A;  4DV7 K;  4FO0 A;  2HMP A;  3I8B A;  1QHT A;  3L3V A;  4W5T A;  2Q0U A;  4CED A;  4CJL A;  3S9H A;  2HVI A;  4BVO A;  2W6K A;  2QXL A;  2WOM A;  4FK2 A;  3CYM A;  2FF3 B;  1ZXO A;  5J2Q A;  2RE2 A;  3VGL A;  4OPH A;  2P9N A;  4BRD A;  2QXF A;  3V81 A;  4KBO A;  4LFB K;  5AQH A;  3ZCM A;  3OBY A;  3UKU A;  5FPD A;  1KQS M;  2E2P A;  2QW9 A;  4CI6 A;  2A42 A;  2A1R A;  1KC8 O;  4JI5 K;  3VPZ A;  1KAX A;  3O80 A;  4A59 A;  4CIF A;  4FZX C;  3R8E A;  3HK2 A;  5I9E B;  1JLE A;  3VMF B;  4BR4 A;  3MX2 A;  3HL8 A;  4AM7 A;  2B6A A;  4ISF A;  4JKE A;  1DLO A;  3VTI A;  4CF9 A;  4O5B A;  3LDL A;  2OPP A;  2FBX A;  5C15 A;  4ILH A;  4HTU A;  2HHS A;  1K8A O;  3D2F A;  4HVJ A;  1QZ5 A;  5KPZ A;  4DR4 K;  3KHY A;  5KQD A;  4KB1 A;  1YUW A;  5FPN A;  4A2A A;  1SZ2 A;  3BF3 A;  1ZBL A;  4GV6 A;  4FOE A;  5FRO A;  2E6L A;  3QIN A;  1OH7 A;  3AVL A;  3ZSQ A;  4FWR A;  5AQO A;  3JXU A;  4BWJ A;  4AHR A;  4E0D A;  3AVJ A;  5HP1 A;  2E8A A;  1ESV A;  3AGR A;  4U7B A;  4FSV A;  3IRX A;  2QWR A;  4CEQ A;  2ZGY A;  4XIU A;  1C1A A;  3L3U A;  2O8F B;  2P9I B;  5FDL A;  1WB9 A;  2P9U A;  4JD2 A;  2OTL N;  4I2Q A;  4LF6 K;  2O8B B;  2E2N A;  1VRU A;  4DR2 K;  1RNH A;  4X66 K;  1WSH A;  4EIA A;  3LDQ A;  3K9K A;  1GLL O;  1WSE A;  4C8K A;  4MFB A;  4KHS A;  3HP9 A;  5AJ3 K;  3N4Q A;  3QES A;  4CHN A;  4AHU A;  4CK2 A;  1A5W A;  2FLO A;  2BAN A;  4B1W B;  3C6A A;  1RDW X;  3IDH A;  4E1J A;  3FFK B;  3HT3 A;  3BP8 A;  4IJN A;  4LC9 B;  1VSE A;  2QWL A;  5AQX A;  4IOC L;  1ATN A;  3KWI A;  4IFE A;  4IDH A;  4B9N A;  3ZYY X;  3VTH A;  4CGJ A;  2ZJQ L;  4RW9 A;  3A5O C;  4FJ8 A;  4CBU A;  1ATR A;  1UWB A;  4FWN A;  3I0S A;  2Q31 A;  4B9L A;  2OZS A;  3W3D A;  3SCX A;  3U9D A;  3KK1 A;  4DS4 A;  5AZJ B;  2HNZ A;  1NBW A;  2KLA A;  3DMJ A;  3ISN C;  4AM6 A;  1GOB A;  3ID6 A;  3SAH A;  3P31 A;  1HUX A;  3NGY A;  2HHV A;  3V9Z A;  3BDP A;  3SBT A;  3NAE A;  3QNO A;  3A8Y A;  1VRT A;  3L8B A;  3AVF A;  1BIS A;  3DLH A;  4CFD A;  3O1W A;  4PKH A;  1CZA N;  5FPM A;  4OPJ A;  5FRN A;  4YOT A;  5BRE A;  4KHN A;  3J7Y P;  3IKM A;  4WE1 A;  3SMP A;  1P90 A;  4WFN L;  2Y1J A;  1TL3 A;  4B3T K;  1SS6 A;  1J5E K;  1QTM A;  4CJS A;  4DR6 K;  3IMX A;  2PFU A;  2VGN A;  4CEZ A;  4Q5V A;  3RMB A;  1XMQ K;  4FK4 A;  2FSK A;  1BDG A;  3THW B;  4OKK A;  3QO9 A;  3V6D A;  3AVI A;  4M3Y A;  1VSF A;  4EP4 A;  4BDZ A;  5CYQ A;  3AO3 A;  2KW4 A;  4LY7 A;  1VAZ A;  5BPN A;  4CGI A;  4DV4 K;  2CGK A;  4JKD A;  3HRG A;  3ULD A;  2UXC K;  1XI1 A;  3M8S A;  3DJC A;  4N47 A;  4LSN A;  1FXX A;  3ALY A;  3WNF A;  2AJQ A;  1C0F A;  3LP3 A;  5JLF A;  4JI7 K;  4RW6 A;  1ASV A;  4LFC K;  2BDP A;  4PY5 A;  4HCC A;  2E2Q A;  2XY5 A;  3ZSX A;  5F2R A;  3LWL A;  2Q0R A;  3SV3 A;  4BVP A;  1K8K A;  5BRF A;  2F96 A;  2UXD K;  2YI1 A;  4CES A;  3CG7 A;  4FWO A;  3K5L A;  2A40 A;  5M1K A;  1GLA G;  4YOX A;  3OYG A;  3RWU A;  3HJF A;  3RVC A;  2Q97 A;  3J80 O;  3I33 A;  2W42 A;  2VG6 A;  3BF1 A;  3L4Q A;  4RW4 A;  1EX4 A;  4NLC A;  4CD3 A;  3WXI A;  3O6W A;  1ZBI A;  1UA1 A;  4QS9 A;  3VES A;  1C0T A;  3HXM A;  1TKZ A;  1YVU A;  2WUS A;  4M7X A;  4DTO A;  3CC2 N;  4CJW A;  5GIO A;  4CBX A;  4B8A B;  4DV2 K;  5I3U A;  3SLC A;  3L0Q A;  4CJE A;  1SKW A;  1VQ9 N;  4A5A A;  5AQI A;  1GLJ O;  1WUA A;  4DR5 K;  2O8E A;  4B9M A;  2E4L A;  2HHU A;  1CXU A;  2HOE A;  3UKR A;  4HWI A;  4H4M A;  4DTU A;  4DTJ A;  3THV A;  5C10 A;  2IDO A;  3GG4 A;  1UOC A;  2D0B A;  1N36 K;  3NGZ A;  5BRD A;  3VER A;  4DFK A;  1KVB A;  1NGJ A;  1SAZ A;  5HRN A;  1YJN N;  1NGA A;  5B8H A;  2G8U A;  2YNI A;  3V1R A;  3ZSR A;  3EY1 A;  1E4G T;  3TI0 A;  1VQL N;  4K8Z A;  1YTU A;  3AA2 A;  1Q9X A;  3CCQ N;  1C1B A;  1RDC A;  5KPT A;  2Y1I A;  4I2P A;  2D1K A;  1HYV A;  2IOC A;  1BUP A;  3TWH A;  3EE8 A;  4CJR A;  1VQ8 N;  4Z4H A;  1JCG A;  1LW0 A;  4GKJ K;  4JI0 K;  3L4I A;  4HUF A;  5KTQ A;  3O9S A;  5LMU K;  1ZC6 A;  2A3Z A;  1NKB A;  3VEO A;  4E1N A;  2P9K A;  3SUN A;  5J1E A;  2UU9 K;  4LF5 K;  3L2V A;  2G8F A;  1RBV A;  3K59 A;  4A61 A;  2F7T A;  2IC3 A;  3D2E B;  4O55 A;  1NM1 A;  1QZ6 A;  4FYD A;  3SAF A;  2W41 A;  4O0J A;  1X9M A;  1HPZ A;  4PL7 A;  1BO5 O;  3AO2 A;  3DXM B;  3NDK A;  2D0C A;  3AAR A;  2JGU A;  3H3O B;  1FJG K;  3HOT A;  4NXM K;  1Z26 A;  1T3V A;  1QQN A;  1S6P A;  3LZJ A;  3O4Q A;  4JK7 A;  5T7B A;  1T6C A;  4JI3 K;  4BRP A;  1Z6R A;  2ITG A;  3C95 A;  3HZ6 A;  2BH1 A;  3NH2 A;  3MMV A;  3OBW A;  2PZS A;  4LFA K;  4L3Q A;  1U2V B;  1HKB A;  4DSL A;  1RTD A;  5HL7 L;  1IBM K;  5M1N A;  3AVH A;  1Q7Y O;  4H0Y B;  1NOY A;  4QCL A;  4DFM A;  3DXK B;  3CM6 A;  1F21 A;  4H5W A;  5F0X A;  3K5O A;  1JLA A;  1RT6 A;  3TAG A;  2ASO A;  4HCB A;  1BCM A;  3PX6 A;  1VSM A;  4CF2 A;  4CF1 A;  3LM2 A;  4FJL A;  4YFU A;  4PKG A;  4JK9 A;  2QTD A;  4DSJ A;  4AQY K;  3AVK A;  2NRH A;  4ILJ A;  4CF8 A;  3UIQ A;  4JI2 K;  3U8X A;  4B1Z A;  1Z05 A;  3GOI A;  3KLI A;  1ZBU A;  3C7N B;  4B3M K;  3NF6 A;  3T7Z A;  1DTT A;  3OYB A;  2WBN A;  3B6O A;  1Z25 A;  3F73 A;  2NRR A;  4DLG A;  2P9L A;  4FJX A;  4DF8 A;  4KB0 A;  3SAG A;  3CM5 A;  5AQM A;  1WBD A;  4BR0 A;  3ID8 A;  3AA5 X;  2QK9 A;  4KRF A;  1J6Z A;  3C6H A;  1GLC G;  3M8P A;  4OLA A;  4W5O A;  1TGO A;  3CER A;  3DRS A;  1W2B M;  2UUA K;  1XQS C;  1TKX A;  2UYT A;  3IFR A;  2XO7 A;  2XHB A;  3KKS A;  2QWN A;  3CJC A;  4KAZ A;  2KHO A;  4KHW A;  1VQ6 N;  1VSD A;  4NYF A;  4AHT A;  1Q8I A;  1CZB A;  4BR9 A;  1L3U A;  2P5O A;  2NUB A;  3K58 A;  5IWA K;  1D9F A;  2F8S A;  3JYT A;  1BI4 B;  3O9R A;  4E19 A;  3THX B;  4Z4I A;  4CVN E;  1HNW K;  1YF5 L;  2Z1H A;  1RGI A;  3TSP A;  2ASM A;  4U67 L;  4CEF A;  4IO9 L;  1NK4 A;  4BRH A;  4BRQ A;  4A62 A;  4Z0U A;  5TKW A;  5AQZ A;  4IEE A;  3SJJ A;  1NJY A;  4WQ4 C;  3MEE A;  2V51 B;  4CJP A;  3KK3 A;  2UXB K;  3HST B;  3EYZ A;  4J2E A;  3O8M A;  4ID1 A;  5ADX A;  1BL3 A;  4OO1 J;  2UUC K;  4CJ4 A;  3SJH A;  5CYM A;  4CGG A;  3RSE A;  3CJA A;  1Y97 A;  1O1W A;  3VQC A;  2P9N B;  4LH5 A;  2YHX A;  1TUY A;  2X78 A;  3THY B;  2HBM A;  1YXQ A;  2DFH A;  3ZEU A;  3UKU B;  4FK0 A;  3TAP A;  1I39 A;  1DGK N;  2GX9 A;  2XY8 A;  1C6V A;  2YNH A;  4FLW A;  3GDQ A;  1NJZ A;  1Q81 O;  1XNR K;  2CH6 A;  2FBY A;  3VQ6 A;  5HRP A;  3FE1 A;  3IG1 A;  4PKI A;  4DV6 K;  3SPZ A;  4YHH K;  3OYK A;  4QOZ B;  3MCA B;  3RTV A;  2GBZ A;  3THX A;  1HYS A;  1HX1 A;  4MO5 A;  4IO8 A;  1FK9 A;  3CJB A;  4G9Z A;  2YHW A;  1L3V A;  1S1T A;  2PYJ A;  2X74 A;  3E66 A;  1O13 A;  1WOQ A;  2E1Y A;  3D2F B;  4CJT A;  3K2P A;  5LL6 Z;  4BRK A;  5KPR A;  3OYD A;  3H1Q A;  4JHD A;  1KD1 O;  3E9P A;  3IAY A;  5C2F A;  4JKG B;  2O8D A;  1GLE G;  5IT9 O;  4CW7 B;  2HHH K;  2FBV A;  3HPH A;  4JKH A;  1RT4 A;  1NGG A;  3FZL A;  3HBT A;  3L2Q A;  5EX5 A;  2Q1N A;  3THY A;  4FJ5 A;  2GUP A;  2YJF A;  4DSK A;  4ELU A;  3WXL A;  2V7Y A;  2XY6 A;  1LAW A;  1DEJ A;  2VG5 A;  3BZK A;  3QER A;  2P9U B;  4JD2 B;  1QSY A;  3SI6 A;  1OH6 A;  3CJ7 A;  1OVY A;  1S22 A;  4DTR A;  4I6M B;  2HHW A;  3D6R A;  4PHT X;  3AGK A;  1TK8 A;  4FM2 A;  3MWP A;  4AHV A;  1VQP N;  3LDN A;  1P8Z A;  1WN7 A;  2AA4 A;  3TAB A;  1XHX A;  1U49 A;  1RT5 A;  4BC4 A;  3HPG A;  3GBT A;  3EZ5 A;  4DQS A;  1GLF O;  3SQ0 A;  4QS7 A;  2A6A A;  4DU4 A;  1J53 A;  4CIG A;  3CJ9 A;  5AQG A;  1S5J A;  3DI6 A;  4KH5 A;  3I8D A;  4BR7 A;  1NK9 A;  3D0P A;  3O3H A;  4KHY A;  3DLG A;  3TAN A;  3D45 A;  1WSI A;  4JKG A;  3U3Y A;  2QWQ A;  1QHA A;  2OPQ A;  3CHW A;  4O0I A;  5HOO A;  3VOV A;  1GLB G;  4FJJ A;  2BE2 A;  1BQM A;  4WQ5 C;  1K9M O;  4FL9 A;  4CZH A;  1NMN A;  5M1F A;  4IEI A;  1RTH A;  3OYN A;  2ATQ A;  1OVQ A;  4B9U A;  1KFS A;  4CFB A;  4N76 A;  4Q0B A;  4J8F A;  4AH9 A;  5GAG P;  1EWR A;  1MA9 B;  4IOA L;  4ZHR A;  2O8C A;  3CCM N;  3NH1 A;  4Y1C A;  3VQA A;  2P9S A;  3PUF A;  4I6M A;  3CET A;  3R6M A;  4BC5 A;  3U3G A;  4CEA A;  4FZY A;  5AQK A;  4LD0 A;  4O8U A;  4JI6 K;  3MEC A;  4CHZ A;  1T44 A;  4NCG A;  3QEV A;  3PIP L;  3O5B A;  1YIJ N;  4FPA A;  1JCF A;  3TAQ A;  1QVG M;  1SL2 A;  1T7P A;  3CME N;  3NBP A;  4H0O A;  5H1S Q;  1LCU A;  4M63 C;  1S6Q A;  1JKH A;  1IKW A;  1CLQ A;  4FJM A;  5E41 A;  2QKB A;  2Q2R A;  3L2U A;  4M3U A; 
#chains in the Genus database with same CATH homology
 4JYA K;  4X64 K;  1HR0 K;  4B3R K;  4DV5 K;  2F4V K;  1IBL K;  2VQE K;  1IBM K;  2UXB K;  2UUB K;  4DV1 K;  1HNZ K;  4DR4 K;  4DV2 K;  4K0K K;  4JI4 K;  2UUC K;  2E5L K;  3J7Y P;  1I94 K;  4LF4 K;  4DV3 K;  3J81 O;  4B3T K;  1J5E K;  4DR5 K;  4DR6 K;  4GKK K;  4YY3 K;  4JI8 K;  4AQY K;  4LF8 K;  3T1H K;  1XMQ K;  1N36 K;  4DR7 K;  3JAM O;  4JI2 K;  4DV0 K;  1XMO K;  1XNR K;  4LF6 K;  4B3M K;  4DR2 K;  4B3S K;  4DV7 K;  5BR8 K;  3T1Y K;  2ZM6 K;  4KHP K;  4X66 K;  4DV4 K;  4DV6 K;  2UXC K;  1N34 K;  4YHH K;  2VQF K;  4NXN K;  5AJ3 K;  4GKJ K;  4JI7 K;  4V19 S;  4JI0 K;  4LFC K;  1N33 K;  4JV5 K;  5LMU K;  1XNQ K;  4LFB K;  4LF7 K;  4X65 K;  1HNX K;  2UU9 K;  4LF5 K;  4DR3 K;  2UUA K;  5LMN K;  5LL6 Z;  2UXD K;  4X62 K;  5A2Q O;  4DR1 K;  4JI5 K;  4JI6 K;  5IT9 O;  4LF9 K;  1IBK K;  4CW7 B;  3OTO K;  2HHH K;  1FJG K;  4DUZ K;  4NXM K;  3J80 O;  5IWA K;  4DUY K;  3J7A P;  4OX9 K;  1N32 K;  4CVN E;  4JI3 K;  1HNW K;  4JI1 K;  5FLX O;  4LFA K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...