3ZT0A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt0A00
3H08A 5CYMA 3VA3A 4GMJB 2FBVA 4DTSA 2B6AA 1CXUA 4FLVA 1NOZA 1RNHA 3D0PA 5J2MA 3HJFA 1NK6A 3V9SA 4LY7A 4BE0A 3AVGA 3SQ1A 1S9GA 3IRXA 5KI6A 3K5MA 1TL1A 4Z4FA 1RTHA 3E01A 4CJ4A 3HXMA 3SPZA 4BE2A 2E6MA 4KHSA 1D9FA 1HMVA 4B08A 3RTVA 5HRRA 4QAGA 5J2NA 3AVKA 1RBRA 4JS5A 1NK9A 1RT3A 4KHUA 1VSIA 4KTQA 3OYJA 1XI1A 4CGFA 5HRSA 3O3GA 1KTQA 4O44A 4N47A 2D0AA 3C6UA 3OS0A 4AHSA 4KHWA 1FK9A 3OYEA 4CJPA 1C0UA 1RCHA 3QINA 3DM2A 4DTPA 4KAZA 4DLEA 3AA2A 4O5BA 2X6NA 3SUQA 4YFUA 4ELTA 4ZTJA 3OYAA 1HRHA 4N41A 1SV5A 3V1OA 1UOCA 1HYZA 1TAQA 1VSDA 1L3UA 3K5NA 1RILA 3SV3A 1U48A 4FJKA 4Q5VA 1BL3A 3U3YA 4AHUA 1IG9A 3JYTA 3OJSA 4M45A 3LP2A 1JL1A 3HVTA 4Y1CA 3TAMA 3RRHA 3TAEA 1IO2A 4DFJA 5I42A 2B5JA 1C0TA 2E4LA 2RKIA 3KD1E 4CJWA 1EP4A 4K8ZA 5CYQA 1SUQA 3SI6A 3ZT0A 3KLFA 4B9TA 3T1AA 2F8TA 4CHNA 1QE1A 4FK2A 2KZZA 4FZXC 4B9UA 4HUFA 3ZSOA 4E89A 1NK4A 4HUGA 1JXEA 1RT7A 3CFOA 4OKJA 1S1VA 2YKMA 3ISNC 3TANA 1TKDA 3NAEA 3WNHA 4JS4A 5HRPA 4PY5A 1L3VA 3AO3A 1LV5A 1YT3A 2ITGA 1ASUA 1BIUA 2EHGA 3G10A 4CGJA 1QQCA 1TL3A 4DTRA 1VSMA 2FC0A 3NHGA 3TABA 2A1SA 3U6FA 2IOCA 4IG3A 4Z4EA 4DTXA 3SUNA 1JKHA 4CJLA 1JXBA 3OYLA 2KFZA 4C8KA 4FCYA 3NF6A 3RMBA 2E6LA 1W0HA 2F96A 5CZ2A 3CFRA 3V4IA 1BQNA 3S3NA 3MXMA 1NJYA 1N5YA 3JSMA 2G8FA 4KB1A 4FK4A 1T7PA 4RW6A 3PX6A 5HROA 1S1TA 3NBPA 4CHYA 2BGGA 1EXQA 3I0SA 1CXQA 3B6OA 4ZTFA 4CK2A 2Z1JA 4N56A 5J1EA 3M8RA 3ASMA 1ZBIA 4CJFA 4DLGA 1BI4A 4IKFA 2HHUA 4FJIA 2P5GA 1SKWA 3AVHA 1D5AA 3SQ0A 4FJJA 2FBTA 3LWLA 1X9MA 5D3GA 3HT3A 3KLEA 4OLBA 1UAXA 3VQ8A 2O4IA 3NE6A 1EX4A 2VG5A 4E1NA 1IH7A 4DSEA 3AVIA 4N76A 1RDAA 3C6TA 2QKKA 4KI6A 1ZYQA 3OYCA 4DQIA 3WNEA 5FRNA 3QNOA 1Z25A 4NCGA 3K57A 4CGGA 1VSEA 3HPOA 4KREA 3ZSZA 4CJVA 5E41A 3T3FA 5EU7A 1UWBA 4F2SA 1LW2A 4BDYA 1TK5A 2ZD1A 4OKEA 3K5LA 3LZIA 3QNNA 4NCBA 5KRTA 3HVRA 4FLZA 2G8IA 4DSFA 3AA5X 1KVAA 2WONA 4RW9A 3ZT3A 3AV9A 3AO5A 4IBNA 4CFBA 4CHQA 4C8OA 3G0ZA 4MQ3A 3RWUA 4PWDA 2KFNA 3VQ5A 3QEVA 1S1WA 3K59A 3SQ4A 2PYJA 3ZSQA 4R5PA 3KLIA 3SV4A 3NDKA 4BWMA 4H4MA 1NKBA 1WN7A 1S9EA 4NCAA 2YKNA 1TKXA 1RBUA 2VG7A 3LP3A 2D0CA 3OYFA 5HP1A 4RW4A 3LALA 1XHZA 3V1QA 4HHTA 2DFFA 1J5OA 4CJUA 4YNQA 4CHZA 4CF2A 3U3GA 3V81A 3SUOA 4O0IA 4CEOA 3KJVA 4OKKA 1Z26A 3AO4A 1EKEA 3LAMA 4LH5A 4M42A 3SQ2A 1JLBA 4CK1A 2I5JA 3AVJA 3OYKA 1BGXT 5J2PA 4FJ8A 3VQEA 4CEAA 3VQ6A 4CFAA 4M3WA 4CJ5A 2OPQA 3L2UA 1S1XA 2ATQA 4KHQA 3I8DA 1SKRA 1IKWA 2XY6A 3ZT1A 2PZSA 4DSLA 4B8CA 4DTOA 1D9DA 3TAPA 3L3VA 1QHTA 1SL0A 4FJ5A 2O4GA 3EZ5A 4FK0A 4F3OA 4FJLA 4J2BA 2OPPA 1WSEA 2YHBA 3DOLA 4FVMA 5FROA 4CERA 2G8WA 1I39A 1TKZA 4W5NA 1Q9XA 3MXJA 4CK3A 5HRNA 4I7FA 3RRGA 2IGIA 2F8SA 3KKRA 4O0JA 3OY9A 4BE1A 3QEPA 3M8SA 2GUIA 3CM5A 3AA3A 1ASVA 3P5JA 2JLEA 2PYLA 2DTUA 3PX4A 4MFBA 4HTUA 1T05A 2ZE2A 3HSTB 5KRSA 1K6YA 4BACA 3NH1A 3DLGA 1MU2A 4AHCA 2JGUA 1L5UA 2G8HA 2YNGA 5HBMA 4FJHA 1REVA 2RN2A 1T8EA 4CJEA 2YV0X 2OYQA 4Z4IA 2KQ2A 4CJRA 1BQMA 4IDKA 3KLGA 3ZSVA 4CJSA 4OGEA 1J9AA 2BE2A 3NGZA 3CM6A 3S9HA 4KHNA 4CECA 4CF1A 3L8BA 4FLXA 1WLJA 3L3UA 1XHXA 4EZ9A 4DTMA 2D5RA 1GOBA 2ZQBA 3HP9A 2YNHA 1ITGA 3O4QA 3OS1A 3SYZA 3VQ9A 3ZT4A 3V9XA 4Z4HA 1RBSA 3PV8A 1U4BA 2HHXA 3P83D 3DMJA 1NOYA 3ZSYA 2HNZA 1U45A 4LH4A 4OJRA 1LW0A 3HPGA 4CHPA 3KK1A 4CGDA 1QSLA 4DTJA 3P1GA 3F73A 3C94A 3LP0A 4CJTA 4KO0A 4B9SA 4RG8A 3AVMA 5JS1A 1RBVA 2HHSA 4DQRA 2KW4A 2DFHA 4ICLA 4NYFA 3CYMA 1KLMA 2HNYA 3RMAA 2VWJA 1HJRA 1NJXA 3DRRA 1NK0A 4FJNA 5SZTA 2KZMA 2DY4A 2XHBA 4CIEA 3O4NA 3SZ2A 1EETA 3TWHA 4CEDA 3S3MA 1J53A 4GW6A 2QK9A 4KTZA 3ZSRA 2ETJA 4K8XA 1SL2A 3DLEA 4F2RA 3VQ4A 3DLKA 5CY4A 3O3FA 4AH9A 1UA0A 1VRTA 4EP5A 1S6QA 2GV9A 4NYNA 3HK2A 2XY7A 1VSLA 2B4JA 2HHVA 3ULDA 1TVRA 1FXXA 2EX3A 3NF8A 4FZYA 4J2EA 3CFPA 1N6QA 2OZSA 4FJGA 3O3HA 4KKOA 3IAYA 1U47A 1HPZA 3K2PA 4DU3A 3LPTA 3PO4A 1U04A 1IKXA 3NGIA 1A5XA 1S6PA 3VQDA 4F4KA 2P1JA 3KLHA 4IFYA 1NK7A 4KPYA 4B8AB 4DTUA 4E7HA 4OLAA 4LD0A 2HMIA 4FM2A 4KRFA 3THVA 2OPRA 3D45A 4DSKA 3HYFA 2X74A 3HPHA 4PQUA 1WSIA 4DU4A 3K5OA 2IAJA 1UA1A 3QLHA 4M3YA 4PUOA 3AVLA 2XO7A 1Y97A 3V1RA 4LSLA 2XRIA 4FJ7A 4ELUA 1TGOA 4DQSA 1JLFA 5FDLA 1HQEA 4I2PA 2Y1IA 3S3OA 3A2FA 4O4GA 3QETA 1RTDA 2HHQA 2PY5A 1WAFA 4FW1A 4IG0A 4ZHRA 4FW2A 1HQUA 1X1PA 4HVJA 4FJ9A 1J54A 1NK8A 3OVNA 1C6VA 1LWCA 4E7LA 1BCMA 1RTJA 1RT1A 1ASWA 1VSFA 1DTTA 4DS5A 4FLWA 5I3UA 1F21A 1G15A 1JLQA 4G1QA 3DRPA 1SL1A 3DOKA 4FJMA 5K14A 1B9DA 4E7IA 3AVAA 5C42A 3DRSA 1YVUA 1A5VA 4WE1A 1KRPA 1TV6A 1ZBUA 2Y1JA 4J2AA 2QXFA 4ID1A 3DI6A 1CLQA 3NF9A 1WSFA 2NUBA 4IFVA 1NJWA 5KGWA 3AO2A 3CG7A 3IS9A 2HHWA 2VG6A 1FKOA 1D8YA 1BCOA 1JLEA 4CJ3A 1RDCA 4Y1DA 1BIZA 2IDOA 4OPKA 4H8KA 1TK8A 1L3SA 2HW3A 4CF8A 1NK5A 2RPIA 3M8QA 1JL2A 5CZ1A 2R7YA 4DQPA 4FLYA 3WNFA 1QSYA 2GBZA 4W5RA 1B9FA 3RR8A 2FBYA 1BI4B 2YHAA 3BGRA 1SKSA 4CFDA 2P5OA 3UIQA 4FYDA 4HCBA 1JLCA 1WSJA 3RMCA 1W9HA 2HB5A 2Z1GA 3AVFA 5DMRA 4JRQA 2OZMA 1YTUA 1C1AA 1WSGA 3MEEA 2WOMA 3KKSA 2G8KA 4EP4A 3TI0A 3B6PA 4OPJA 2A1RA 3ALYA 4CCHA 4CF9A 3HM9A 3L2WA 4DTNA 1KFDA 1NKCA 1JLAA 3LP1A 4C8MA 4HUEA 4B9VA 4UQGA 3SJJA 4KFBA 2IS3A 4FM1A 3TAGA 4E7JA 3PO5A 3FFIA 3L2QA 3LANA 3L2RA 4FLTA 2G8UA 3ITHA 5KTQA 3WNGA 3AA4A 3VA0A 4LSNA 5C24A 1QS4A 4DS4A 4DFPA 1NJZA 2YNIA 1RT4A 1LAVA 3ZSXA 4E19A 4FJXA 1C1CA 4Q0BA 3MAQA 4FXDA 3MEGA 3L2VA 4CIGA 4CF0A 1Q9YA 4CHOA 3T19A 3PUFA 1A5WA 3KTQA 4CFCA 3VQAA 3CQ8A 1VSHA 2Z1IA 1X9SA 2Q3SA 4ELVA 1KLNA 3QERA 1QTMA 1KSPA 1R0AA 3RR7A 3QEXA 1RDBA 2OPSA 2VWKA 1C0MA 1RDDA 1TKTA 4O55A 4AHRA 3EYZA 1RTIA 3K58A 4ID5A 4CIFA 3NF7A 4DU1A 3QEIA 2QKBA 1X9WA 4CGIA 4BDZA 4W5TA 4DG1A 3LWMA 4CJQA 3AVNA 4DSJA 4BDPA 1CZBA 1U49A 1NKEA 3KIOA 1TAUA 1ZBFA 3OYDA 4BWJA 1KVCA 4OVLA 1KCFA 3QEWA 3LPUA 3BDPA 3V9WA 3LAKA 4C8NA 4M3TA 3EY1A 4Z4CA 4DFKA 1WSHA 2BDPA 4DSIA 3AVCA 4W5QA 2OA8A 4F3TA 1IKYA 1CZ9A 3DLBA 1DLOA 1RT6A 1L3TA 4B9LA 4QOZB 3QO9A 4DQQA 1LAWA 1T03A 4B9MA 5DK5A 1WNSA 4RW7A 3V9ZA 1S1UA 1C1BA 2BANA 4FLUA 4M3RA 4F8RA 3SNNA 4JLHA 3SUPA 1KFSA 2XY5A 1I3AA 3KK3A 1HYVA 1VRUA 2XY8A 3NH2A 4CEZA 2HHTA 4L8RB 5KGXA 4M41A 1JLGA 5C25A 3ZT2A 2Z1HA 3V6DA 2IC3A 3OYIA 3I0RA 1ZBHA 1BHLA 4CEQA 3SPYA 4CE9A 2LSNA 4E3SA 2W42A 3V9UA 1KVBA 3OJUA 4B3OA 3QIOA 4J2DA 4CESA 3OYGA 3AVBA 4TSXA 4CGHA 1VSKA 3KK2A 3MXIA 1LWEA 4KB0A 3C95A 3M8PA 1RBTA 3HL8A 4CEBA 3VQQA 2HVHA 1YTAA 1GOAA 3DLRA 3VQPA 1VSJA 4CEFA 3HP6A 4FM0A 4E1MA 4DFMA 4DWIA 1QSSA 2DFEA 3F9KA 3LDSA 1BISA 1RT2A 3QIPA 4M3XA 4I2QA 4FZZA 4Z0UA 4XIUA 1FKPA 1RT5A 1LWFA 4EZ6A 4I9LA 1Q8IA 2HNDA 2D0BA 2X78A 3TARA 4HCCA 4E7KA 3VQ7A 4N5SA 4JRPA 1DTQA 5JS2A 4CJKA 3NCIA 3TAFA 4CEEA 2KTQA 2FBXA 3NGYA 1HNIA 3ZCMA 4C8LA 3OYHA 3LZJA 1ZBLA 3QESA 4KV8A 3PY8A 4M3ZA 3TR8A 3AO1A 4GVMA 4DF4A 4I9QA 4H4OA 3VQCA 2HVIA 4E0DA 3NFAA 4Z4GA 2P51A 3HO1A 3MECA 2X6SA 3RMDA 4PA1A 3DLHA 3NH0A 1GOCA 1WAJA 3OS2A 4DF8A 3MEDA 3OYBA 4RW8A 4AILC 4QCLA 1S5JA 4M3UA 3PX0A 4AHTA 1TK0A 3SCXA 1O1WA 3TAQA 4AHVA 2AJQA 1XWLA 4B9NA 4KTWA 4KHYA 3DYAA 3VN5A 1HNVA 5J2QA 1VK0A 3OYMA 3KD5E 4W5OA 2G8VA 2RF2A 3IG1A 4OGCA 3OYNA 4DMNA 3ZSWA 5FRMA 1B92A 3VQBA 1XC9A 1IKVA 2YNFA 5HLFA 5T7BA 1HYSA 5SWMA 4KI4A
chains in the Genus database with same CATH superfamily
5CYMA 4R79A 3JS6A 4JK8A 3HJFA 3V9SA 1S9GA 3IRXA 3AY9A 1Q82O 3SPZA 4BE2A 2E6MA 1D9FA 3TTFA 4B08A 1HKBA 2NRTA 5AQUA 1RBRA 1RT3A 4KTQA 3M5RA 3IKMA 5M1OA 3O3GA 5HRSA 4O44A 2D0AA 3C6UA 4OPHA 1ATSA 3L6QA 1FK9A 1VQON 2X6NA 1HRHA 4N41A 1SV5A 3V1OA 3R1XA 3O08A 1VSDA 1WOQA 3K5NA 4X65K 4C1NK 4FJKA 4Q5VA 3F9MA 3WXLA 4AHUA 3LP2A 1JL1A 3HVTA 4Y1CA 1IO2A 4DFJA 2B5JA 1C0TA 2E4LA 4YDUA 3PIOL 4JI8K 5CYQA 3SI6A 3G25A 3ZT0A 3A8YA 4B9TA 4HWIA 2F8TA 4CHNA 2KZZA 4JK7A 1K8KA 4E89A 4OKJA 1NMDA 3ISNC 1BU6O 4BRIA 5HRPA 4PY5A 4IEEA 3AO3A 4B1UB 4WQ4C 1TL3A 2FC0A 1D4XA 3J8AA 3GOIA 4DR4K 5LMNK 1NGBA 5CZ2A 4DV6K 3S3NA 1BQNA 4DUZK 1XMQK 1NGEA 1T7PA 3PX6A 5HROA 3ATVA 3NBPA 5GIOA 2YJFA 1EXQA 4ZTFA 2ZF5O 3VESA 3M8RA 4BR2A 3ASMA 5DM6L 5AFUA 3AVHA 2FBTA 1U2VA 1ZXOA 4CBWA 1X9MA 2CH5A 3VQ8A 2HF3A 3AVIA 1NJIO 3THWB 2QKKA 4EHUA 4KH6A 5FRNA 1Z25A 1VSEA 4KREA 3ZSZA 4BC2A 2HBJA 4F2SA 1TK5A 4OKEA 3K5LA 3AA5X 2WONA 3AV9A 4IBNA 1HNWK 3CPEA 4A2BA 3HTVA 4I6MA 1S1WA 4FPBA 3SQ4A 3EO3A 5H1SQ 3ZSQA 1NM1A 4H4MA 1NKBA 1S9EA 2YKNA 1TKXA 1RBUA 3OYFA 2DFFA 4YNQA 4EFHA 4CEOA 4GVEA 4LH5A 3SQ2A 4CK1A 2ZJRL 3H1QA 3LM2A 4M3WA 1S1XA 1NLVA 1IKWA 3ZLJA 3I8BA 2PZSA 4B8CA 3L3VA 4FJLA 3H45C 4BC4A 1SQKA 4DQ8A 4CERA 5AQJA 1WBBA 3J81O 4O0JA 3OY9A 3SMSA 1XMOK 2GTDA 4BR9A 4MO4A 4YOWA 2DTUA 3TSQA 2UU9K 3EKSA 3WXJA 4HTUA 5JVGL 1QZ6A 1X9JA 4PL8A 5KQDA 4LC9B 4A61A 1MU2A 5JVHL 2JGUA 3HRGA 3Q7BA 2G8HA 4FJHA 1T8EA 4BVOA 4IOCL 4CJEA 2YV0X 2OYQA 4Z4IA 3VERA 4CJSA 4KHNA 1S3XA 1YAGA 1WLJA 4H0OA 4DTMA 1GOBA 3OS1A 3VQ9A 4Z4HA 4FO0A 1NOYA 3U4LA 2E8AA 3C94A 3LP0A 2YCHA 1QZ5A 4B9SA 2HHSA 3ID6A 3DRRA 5AQIA 4BY9C 4FJNA 4MO5A 4BRKA 2QTDA 3S3MA 1J53A 3H46O 2A41A 4K8XA 2ETJA 5AZIB 4BRQA 3MMVA 4EP5A 1S6QA 3H3NO 3VGMA 2O8EB 2F4VK 1FXXA 2OZSA 4IFEA 4FJGA 4KKOA 1U47A 1SZ2A 3UKRA 3TTCA 4M7YA 1A5XA 2O8BA 4JHDB 3VTIA 4DTUA 3FZKA 4X66K 2QWOA 3UKUA 3THVA 4DSKA 4YOTA 3HYFA 4O5FA 3HPHA 4H5TA 4JI5K 5EXWA 3D7EO 4PUOA 1BA0A 3E9OA 3RSEB 3CQXA 1JLFA 5FDLA 4I2PA 2Y1IA 4O4GA 2QW9A 3QETA 1HQUA 1NK8A 4CVNE 1ASWA 4DS5A 5FPNA 1TYQA 5I3UA 1XNRK 4M7XA 1JLQA 4G1QA 3DRPA 3DOKA 4JV5K 5K14A 2OTLN 1B9DA 5AJ3K 4DR5K 1GLLO 4J2AA 4ID1A 3NF9A 1WSFA 2NUBA 3OW2M 4JD2B 1NJWA 1BCOA 1JLEA 1W2BM 1RDCA 1CLQA 2A5XA 1NGIA 3C7NA 4DQPA 4FLYA 3WNFA 2GBZA 4W5RA 2ITMA 1BI4B 1SKSA 4CFDA 2A40A 4HCBA 1Q18A 5KQ8A 1YTUA 3A5LC 3O9SA 1C1AA 3VF4A 3KKSA 3L4QA 3TI0A 4B3TK 4YORA 4OPJA 4H0TB 4BRLA 4DTNA 4JKCA 1NKCA 1JLAA 3LP1A 4HUEA 3SJJA 3LANA 3D2FA 3WNGA 3AA4A 1QHAA 2Q0UA 5LMUK 1LAVA 3ZSXA 1C1CA 2A42A 3MEGA 1NBWA 4CHOA 4BG9A 3PUFA 1VSHA 1KLNA 3QERA 3QEXA 5M1QA 2VWKA 4O55A 1RTIA 4XH5A 4MLHA 3E9LA 3DXMA 3H3OB 5AQFA 4DV2K 3BDPA 2WC9A 1DKGD 5AQVA 5IT9O 4Z4CA 3PIPL 4JKBA 2P9PB 1GLBG 4DSIA 4NXNK 2OA8A 1CZ9A 5HOOA 1DLOA 1RT6A 1RGIA 4DQQA 1WNSA 1DEJA 3DXKB 1BUPA 5F2RA 4ISFA 4F8RA 3SNNA 1VRUA 3NH2A 2HHTA 2YHYA 3D2EB 2Z1HA 2CH6A 2IC3A 4CE9A 2LSNA 3VEVA 3OJUA 3MXIA 1LWEA 4KB0A 2P9NB 1QQOA 4CEBA 3VQQA 1YTAA 4E1MA 1QSSA 3F9KA 4H0PA 1RT5A 2FLOA 5M1KA 4BRFA 2D0BA 3VQ7A 4N5SA 1KAYA 4H5NA 4C8LA 5AQKA 4BRHA 3OYHA 3LZJA 4M3ZA 3TR8A 3AO1A 4Z4GA 3NFAA 3HO1A 2IVOA 4B3MK 3MEDA 4AILC 4MDBA 3SCXA 1O1WA 4ISGA 4AHVA 3TAQA 2F7TA 3K0SA 1IJJA 3DYAA 1K73O 1VK0A 3OYMA 3KD5E 2G8VA 2RF2A 3QFUA 4OGCA 4LF4K 2W6KA 1B92A 3VQBA 1XC9A 5JLFA 1NGHA 4B9QA 5HLFA 4XH4A 4AF1A 2FBVA 1G99A 4DTSA 1BOTO 2B6AA 1VQ8N 3O1WA 1NOZA 4Z94A 3ENBA 3AVGA 3KHYA 3SMPA 3LL3A 4Z4FA 5AQRA 1IBLK 3EE8A 3R6MA 3CD6N 1HMVA 3RTVA 3A5OC 2P9LB 3F2KA 3AVKA 1VSIA 3HOTA 4N47A 3FLCO 3K9JA 3OS0A 4AHSA 1C0UA 1RCHA 3QINA 3G71N 4KAZA 2Q0RA 4ELTA 4ZTJA 3PSIA 3OYAA 1L3UA 2IIRA 4XH1A 1RILA 1GLFO 2HBLA 1BL3A 4AM6A 1IG9A 3JYTA 4H03B 5F0XA 3TAMA 3RRHA 2P9IB 3ATUA 4LF7K 3KLFA 5C2DA 2UUCK 1QE1A 2HOEA 1YF5L 2QXLA 5TKWA 4FZXC 3I56N 3ZSOA 1NK4A 3THYA 3M1FA 3CFOA 1S1VA 2P9KA 3NAEA 3WNHA 3WXKA 3ZETB 2J4RA 4J8FA 1L3VA 1YT3A 1ASUA 4CGJA 3G10A 3ZYYX 3O4WA 2VGMA 3EE9A 4HTLA 4DTRA 4FOEA 4Z4EA 2IOCA 1VQKN 3VMFB 3SUNA 3J7ZO 4CJLA 3OYLA 1JXBA 1KAZA 2KFZA 4C8KA 2IVNA 3NF6A 3WUHA 5BRFA 1W0HA 4A5AA 3V4IA 2G8FA 3MXMA 1NGFA 4JKAA 5AQMA 5TKYA 4WF9L 4CHYA 3I0SA 1CXQA 4CK2A 4N56A 5J1EA 1J5EK 2O8DB 4CJFA 4JKEA 4FJIA 5JLHA 2P5GA 4OLBA 3U9DA 2O4IA 2VG5A 4F9OA 1IH7A 1DGKN 4N76A 3G6EN 4KI6A 4DQIA 1GLEG 4BG8A 4CJVA 1UWBA 2AA4A 2Q2RA 5AQSA 3WEEB 1BWFO 3LZIA 3QNNA 4FLZA 2G8IA 3CCSN 2W6LA 3G0ZA 2ZJQL 4GKJK 4PWDA 2KFNA 3QEVA 1NNEA 1C0GA 3O9UA 5BR8K 4LF5K 4B1WB 2GWKA 3KZBA 5F1XA 1HKCA 4NCAA 3VGKA 3DWLA 5HP1A 4RW4A 5C0YA 3ZX2A 4CF2A 3MN7A 4O0IA 2P9SB 1Z26A 4M42A 5AQYA 2VYPA 2GX9A 5J2PA 3VQEA 1YVNA 3VQ6A 2OPQA 4KHQA 3I8DA 1SKRA 4BRAA 2O4GA 4FK0A 2OPPA 1WSEA 4FVMA 3DOLA 2Q36A 3VEYA 4BRPA 4FWQA 1Q9XA 3CCUN 1Y64A 5HRNA 3QMLA 3SBGA 4I7FA 2UXBK 2EWSA 3CF5L 2GUIA 3CM5A 3VEWA 1CZAN 4MFBA 1T05A 5KRSA 1K6YA 2VQFK 3DLGA 3VEOA 4PKGA 3CCQN 5HBMA 3KK7A 2OTJN 1EWRA 1MWMA 1KAXA 2KQ2A 1ZC6A 1BQMA 2NRZA 1N32K 3THXA 5EY4A 5KPZA 2QM1A 1HJOA 3CHWA 4CF1A 3L8BA 4FLXA 1XHXA 2ZQBA 3HP9A 5FPMA 3EZWA 3V9XA 3PV8A 1RBSA 3DMJA 3EN9A 4L3QA 4OJRA 3HPGA 4BC5A 2FSNA 3MK6A 5KPRA 1ATNA 2PBDA 5JS1A 1RBVA 5AQPA 4ICLA 3CQYA 3CYMA 2QWQA 2HNYA 1FJGK 1HJRA 1NK0A 4WQ5A 2DY4A 2XHBA 4DCHA 4CIEA 5IWAK 4MLEA 1EETA 4CEDA 4LFCK 2ZGYA 2P9UB 5JICA 2QK9A 4H0XB 1W97L 5GIPA 5BN8A 1RDUA 1SL2A 3DLEA 3J7AP 3VQ4A 3DLKA 3O3FA 1UA0A 3ZEUB 4O8UA 4NYNA 3HK2A 4GV6A 2B4JA 1TVRA 3NF8A 5AQTA 2V7YA 3CFPA 2IVPA 3CCRN 1HPZA 3PO4A 3MX5A 3NGIA 4IFYA 4Y0WA 4KPYA 4B8AB 2KHOA 2UXCK 2RHKA 2V7ZA 3QDKA 5AR0A 4JI2K 2Q31A 4DU4A 3K5OA 5E26A 3VENA 3U8XA 1VQPN 4IWVA 1NG9A 4IOAL 4JI4K 4ELUA 5AQOA 5CE3A 2W40A 3IUCA 1RTDA 4XEIA 4FWPA 4DR1K 3A2FA 4IG0A 1EO1A 4ZHRA 4PKIA 2Q1NA 1C6VA 1RTJA 4M63C 3AAQA 2H3GX 4E7IA 3VETA 2QWRA 1ZBUA 2FSJA 4IFVA 3AO2A 3IS9A 2VG6A 1D8YA 4LF6K 4QS7A 1BIZA 1L3SA 4CF8A 5MLCQ 2QI2A 1B9FA 3SAGA 3BGRA 1BO5O 4A5BA 1NGGA 3CJCA 4FYDA 1U2VB 2BUPA 1WSGA 1VQMN 2WOMA 4EP4A 2QA4N 2HHHK 4CCHA 2NRHA 3HM9A 3L2WA 4KB1A 5AZIA 2NRVA 4KFBA 2IS3A 2ZM6K 4FM1A 3L2QA 2G8UA 3ITHA 1QVGM 4LSNA 1QS4A 2O8EA 3CIPA 1NJZA 2YNIA 1RT4A 3MAQA 4FXDA 2E88A 3BP8A 4I6MB 4JKDA 5M1FA 1Q9YA 3T19A 4ELVA 4JHDA 3CQ8A 3KWGA 3E9PA 4IZ9A 2Z1IA 1X9SA 4FSVA 4ILHA 4BR5A 3RR7A 2OPSA 1RDDA 4AHRA 4ID5A 4CIFA 3NF7A 5AQGA 4W5TA 5A2QO 2A6AA 3AVNA 4BRGA 4BDPA 4NLCA 3KIOA 3KVGA 1TAUA 1XUPO 5LJVA 3V9WA 4BRMA 4C8NA 4DKWA 1T6CA 5LJWA 3M6GA 3AVCA 2WTUA 3QO9A 4CZKA 5DK5A 2RE2A 3LM9A 4RW7A 5B8HA 4FLUA 3MCPA 1EWQA 3MN6A 4U67L 2CGJA 4JLHA 4IO9L 1T3VA 5BPMA 5KGXA 4M41A 3ZT2A 4ILGB 3V6DA 3MN5A 2WBNA 3WXMB 1ZBHA 1BHLA 1VQLN 4B1ZA 4E3SA 3C65A 1KVBA 3KK2A 4FOIA 4A59A 3C95A 3M8PA 2NRRA 2CGKA 3VQPA 1GOAA 3DLRA 2CGLA 1VSJA 1YUWA 4CEFA 3AARA 5AQZA 3LDSA 4M3XA 2PFUA 4MDAA 4FZZA 4JI3K 4EIAA 1LWFA 3AGKA 4NLBA 3QFPA 4GV9A 3TARA 1I94K 5JS2A 2OANA 2FBXA 5AFUH 3AGRA 3NVKA 4CZLA 1HUXA 3QESA 1ZBLA 3CETA 4H0YB 3VQCA 4BROA 3MECA 4JN4A 1V4TA 3DLHA 3KWIA 1XNQK 1GOCA 3ZX0A 4DF8A 4JAXA 3OYBA 4RW8A 4M3UA 1TK0A 4ISEA 4B9NA 5DM7L 1LOTB 3OBWA 4KHYA 4DV4K 3VN5A 3CJBA 5J2QA 3OYNA 3WQTA 3QBXA 3VOVA 5FRMA 3FGUA 5T7BA 5SWMA 3AAPA 4KI4A 2NZTA 5C2FA 2KKZA 4FLVA 3D0PA 1NK6A 4LY7A 4BE0A 3FZFA 5KI6A 3W0LA 3HI0A 2P9PA 4CJ4A 2O8BB 4KHSA 5HRRA 4QAGA 5J2NA 3UKUB 4JS5A 1NK9A 4KHUA 3DXKA 3OYJA 1XI1A 3B8AX 4CGFA 1RFQA 4KHWA 3D2EA 3OYEA 2VWBA 4CJPA 3DM2A 4DTPA 1E4FT 3AA2A 4DLEA 3SUQA 4YFUA 3JXUA 3FZLA 4WFNL 2E1ZA 1GLCG 2O8FB 1TAQA 3OBYA 3T1YK 3A5NC 4CZFA 3SV3A 1U48A 1K9MO 2E2PA 2NRXA 3OJSA 4M45A 5GAEP 4O8KA 5AQQA 1TYQB 4JYAK 3CJ7A 3K9KA 2RKIA 4CJWA 3CJ1A 3T1AA 5BPLA 4DB3A 4FK2A 1VQ6N 4HUFA 3DAWA 4HUGA 1JXEA 1RT7A 4BR0A 3TANA 1TKDA 4JS4A 1XC3A 4AM7A 5C15A 4DV5K 3CXCM 2EHGA 5ADXH 1OH5A 3TABA 2A1SA 4DTXA 3CCEN 4FCYA 3RMBA 2E6LA 2F96A 3CFRA 4FK4A 3JSMA 1JJ2M 3JAMO 1GLAG 1NMNA 4RW6A 3B6OA 4DR7K 2W41A 3D2FB 3LDNA 4KHPK 2D0PA 1ZBIA 4DLGA 2HHUA 1SKWA 1SAZA 2O8CA 5D3GA 3KLEA 1EX4A 4FWKA 2E5LK 1RDAA 4V19S 4IOXA 1ZYQA 3OYCA 4BR4A 1C0FA 3K57A 4CGGA 3VGLA 4WFAL 3EKUA 5AQHA 2P9LA 1X3MA 1LW2A 2HSTA 3DXMB 5GAGP 3O8MA 4DHYA 3HVRA 4BC3A 1KVAA 4RW9A 3AO5A 4CFBA 5AQWA 4CHQA 4MQ3A 3LDLA 3TSPA 3VEXA 5BREA 2UXDK 3K59A 1HX1A 3PSFA 5BRHA 3UE5A 4R5PA 1NGAA 3NDKA 4BWMA 4QS9A 4BQLA 3CERA 1GLDG 3WQUA 1X3NA 2VG7A 3TU5A 1XHZA 5EVZA 3ID8A 4CJUA 4CI6A 2P9IA 5FLXO 3BF3A 1EKEA 1JLBA 4IXCA 3OYKA 4FJ8A 4CFAA 2HF4A 2XY6A 3ZT1A 3FZMA 4DTOA 3TAPA 1D9DA 1QHTA 1SL0A 4FJ5A 2E2NA 4K25A 2UUAK 4F3OA 4J2BA 1BG3A 5FROA 2G8WA 1I39A 1TKZA 4W5NA 4WFBL 1HKGA 3MXJA 4CJ7A 5AQNA 4LF9K 3C6AA 1YJNN 4GV3A 3RRGA 3QEPA 4K43A 1YHQN 1ASVA 2OCEA 2E2QA 2JLEA 4CZGA 3PX4A 2HBKA 3ULEA 5KPTA 4JNEA 5GINA 4BACA 4AHCA 1L5UA 1REVA 3WXIA 3EEQA 5AZJB 4IDKA 4CZIA 4CJRA 3SAFA 2JWKA 4IO8A 3KLGA 3NGZA 4OGEA 2BE2A 3T1HK 4LFAK 3CM6A 3OHRA 4H5VA 4JKFA 4CECA 1M1KO 2D5RA 3U9ZA 3SYZA 4YOUA 3ZT4A 4JI0K 1IG8A 1O13A 3ZSYA 3WT0A 5BN9A 2V51B 1VQ7N 4CHPA 3KK1A 4CGDA 1VQ5N 4GKKK 3P1GA 4DV3K 3L0QA 3F73A 3WEEA 4UY8O 4CJTA 4KO0A 3AVMA 2D1KA 3GG4A 4DQRA 3MWPA 2KW4A 2DFHA 4NYFA 4K41A 1KLMA 1QQMA 3ENHA 2VWJA 2KZMA 5LL6Z 5SZTA 3UB5A 1YI2N 3P4IA 1QQNA 3TWHA 3MWTA 4GW6A 3O5BA 4KTZA 5ELZA 4F2RA 2PAVA 4BGBA 4RTFD 4AH9A 3QBWA 3QB0A 1VSLA 2HHVA 4CZJA 2EX3A 2VCPA 3P38A 1N6QA 1GLJO 5FPDA 2QWPA 3O9RA 4DU3A 3LPTA 3CCLN 3VQDA 4F4KA 3A5MC 3VF6A 2P1JA 3KLHA 5FPEA 3OTOK 1NK7A 2ZWHA 4LD0A 2HMIA 4AQYK 1LCUA 2OPRA 3D45A 4WQ4A 4FWOA 3OA9A 2E2OA 1Q86O 2X74A 4PQUA 3MX2A 4DV1K 3HBTA 3AVLA 3BZKA 4IDHA 3TPQA 1Y97A 3V1RA 3J80O 3S41A 1TGOA 4DQSA 3BEXA 4JI1K 4X64K 1HQEA 2HHQA 2P9KB 4FW2A 4HVJA 4FJ9A 4FWNA 1J54A 4DV0K 1LWCA 3FFKB 1HNZK 2NRWA 1NGCA 5GAHP 5CR4A 1G15A 1WB9A 1SL1A 4FJMA 1KXPA 4JI7K 3AVAA 5C42A 1A5VA 1KRPA 2QXFA 4JKGB 3DI6A 1T44A 1KD1O 2F9TA 3CG7A 2HHWA 2FXUA 1FKOA 4BRDA 3SLCA 4OPKA 4Y1DA 1W7AA 1TK8A 4H8KA 2HW3A 4LF8K 5CZ1A 3M8QA 1JL2A 2R7YA 1NGJA 2VGNA 1QSYA 3RR8A 2FBYA 3IDHA 1JLCA 1WSJA 5DMRA 2Z1GA 3AVFA 3GDQA 1YJWN 4IJAA 4YOVA 2P9UA 3B6PA 4YY3K 4CF9A 3CJ9A 4B9VA 5I9EB 1VHXA 3BF1A 3PO5A 3FFIA 4FLTA 2VQEK 3ZEUA 4CZHA 4C1NI 3O9TA 4DS4A 3EL2A 4E19A 3L2VA 3C0BA 4CIGA 3O6WA 3THWA 3NVMA 1KC8O 3KTQA 4CFCA 2Q3SA 4KH5A 1R0AA 1RDBA 3SAHA 5C10A 1TKTA 3EYZA 1HPMA 1X9WA 2YJEA 4DG1A 3LWMA 3O80A 1NWKA 4DSJA 3R3LA 5LY3A 1NKEA 1KVCA 4OVLA 1KCFA 3QEWA 3LAKA 2UYTA 3EY1A 1TUUA 2BDPA 3E1YA 3J7YP 1VQ9N 4B9LA 4PKHA 1T03A 1LAWA 4B9MA 1BDGA 4NXMK 3FE1A 3V9ZA 1S1UA 1C1BA 3Q7CA 1KFSA 2QEXN 4EAHD 3KK3A 1HYVA 2E20A 4L8RB 2QWNA 3VTHA 5C25A 1JLGA 2ZJPL 3OYIA 2ASOA 4CEQA 4FWLA 2W42A 4DR6K 4OO1J 3H1VX 2FSKA 4TSXA 1VSKA 1RBTA 5CHIA 4FM0A 4KBOA 3HP6A 4DFMA 1BISA 1RT2A 3CC2N 1HR0K 3THXB 1FKPA 4FPAA 4I9LA 1Q8IA 2X78A 2ASMA 4JRPA 1DTQA 3NCIA 4CJKA 3TAFA 1K8KB 3ZCMA 1MDUB 2HMPA 4KV8A 4K42A 4GVMA 4I9QA 4H4OA 4YHHK 4E0DA 2P51A 4BVPA 2X6SA 5BRDA 3VF2A 3OS2A 4JEPA 1ZBSA 1TUYA 4QCLA 3PX0A 4AHTA 2AJQA 1XWLA 2D4WA 5E84A 1HNVA 3C6HA 1OVYA 4GY2B 4WCEL 3IG1A 4DMNA 1BA1A 2HBMA 1IKVA 1HYSA 2ZGZA 3H08A 3VA3A 2NLXA 4GMJB 1CXUA 1RNHA 5J2MA 4YDUC 4GNIA 2I7PA 3SQ1A 5AQLA 1KQSM 3K5MA 5C12A 1TL1A 4BGAA 1RTHA 3E01A 3HXMA 3CCMN 3MN9A 1HLUA 1Q81O 1MWKA 3ENOA 4FL9A 1KTQA 1J6ZA 4B3SK 1NU0A 3H6EA 4WQ5C 1JCGA 2GWJA 3SK3A 4O5BA 3O1BA 1UOCA 3ZX3A 1HYZA 4BREA 3W3DA 1WBDA 3U3YA 3TAEA 3N4PA 5I42A 4YOYA 2UUBK 4CBUA 1IBMK 2YI1A 3KD1E 1EP4A 4K8ZA 1XQSC 1SUQA 5ADXA 3RSEA 4B9UA 2I7NA 1VQNN 1S22A 5BPNA 3CI5A 2YKMA 4X62K 2KLAA 4BQZA 2ITGA 2NNWA 1LV5A 1BIUA 1QQCA 1VSMA 2ASPA 3NHGA 3U6FA 4IG3A 1JKHA 4JI6K 4B3RK 3IMXA 1N5YA 1NJYA 1Z05A 4JD2A 4FWRA 5EOYA 3N4QA 1S1TA 3CPWM 1DT9A 3CCVN 2BGGA 2Z1JA 1P90A 3DLLL 2V52B 4IKFA 1BI4A 4JKHA 4YOXA 1YJ9N 4FJJA 4IEIA 3SQ0A 1D5AA 3LWLA 3HT3A 1UAXA 3F5TA 3NE6A 2A3ZA 4E1NA 4DSEA 1N33K 3C6TA 4H5RA 3WNEA 3QNOA 4NCGA 3HPOA 4BRNA 5E41A 1Q7YO 3T3FA 2WFBA 5EU7A 4BDYA 2GUPA 2ZD1A 4FWSA 4NCBA 5KRTA 4DSFA 4DUYK 4PL7A 4QS8A 3ZT3A 4DR2K 3SJHA 3BUZB 4C8OA 3RWUA 2YHWA 3VQ5A 2YHXA 2PYJA 2FF3B 3KLIA 2O8FA 2E1YA 3SV4A 1WN7A 3RVCA 3LP3A 2D0CA 1FW6A 3LALA 1J5OA 3V1QA 4HHTA 1IBKK 4CHZA 3V81A 3U3GA 3SUOA 3KJVA 3MDQA 4OKKA 3AO4A 3LAMA 4CZEA 3LDPA 2I5JA 3AVJA 3R9PA 1BGXT 3UKRB 4B1YB 4CEAA 4CJ5A 3L2UA 2ATQA 4EHTA 3FR0A 3P39A 4DSLA 4U7BA 3EZ5A 2YHBA 3PLAA 1N36K 4CK3A 3IFRA 2F8SA 2IGIA 3KKRA 4BE1A 3M8SA 4A62A 3AA3A 4CW7B 3P5JA 2PYLA 3R8EA 2AP1A 1ILYA 4NB4A 2ZE2A 3HSTB 1H1VA 3NH1A 2FF6A 3A0IX 2QWMA 2P9NA 2F9WA 2YNGA 1E3MA 2RN2A 1EQYA 4FWMA 2BTFA 3ZSVA 3FZHA 1J9AA 3S9HA 3L3UA 4EZ9A 3O4QA 2YNHA 1ITGA 1IV0A 1T6DA 1U4BA 2HHXA 4KH4A 2GEMA 3P83D 3I33A 1U45A 2HNZA 4LH4A 1LW0A 3L4IA 1QSLA 3C7NB 4DTJA 4RG8A 5M1PA 1MA9B 1NJXA 3RMAA 4RWTA 3O4NA 4BRCA 4H0VB 3SZ2A 3ZSRA 3I55N 3GL1A 3E66A 1ESVA 5CY4A 3HZ6A 1VRTA 2GV9A 2XY7A 3ULDA 4FZYA 3BZCA 4J2EA 3O3HA 1YIJN 3IAYA 1Z6RA 3K2PA 1V4SA 1U04A 1IKXA 4A2AA 1S6PA 4E7HA 4OLAA 1R59O 4FM2A 4KRFA 1WUAA 4B1XB 3BY5A 1OVQA 1WSIA 2BH1A 3HOSA 2QWLA 1HNXK 2IAJA 1UA1A 3QLHA 4M3YA 1SS6A 4K0KK 2GELA 2XO7A 4ILJA 4LSLA 2XRIA 4FJ7A 3S3OA 3VEZA 2PY5A 1WAFA 4FW1A 1X1PA 1YITN 1M90O 3OVNA 5EX5A 4E7LA 1BCMA 3TSUA 1RT1A 1VSFA 1DTTA 4FLWA 5AZJA 1F21A 4RCHA 3MCAB 3DRSA 1YVUA 4WE1A 4H5WA 1TV6A 2Y1JA 3CC7N 5KGWA 1YXQA 4CJ3A 3ZETA 5GADP 2IDOA 3CJAA 5AQXA 1NK5A 1K8AO 2RPIA 4DV7K 2YHAA 3UIQA 2P5OA 2O8CB 3RMCA 1W9HA 2HB5A 2OZMA 4JRQA 4C23A 2YX6A 3MEEA 2G8KA 5BR9A 3HM8A 4CD1A 2A1RA 3ALYA 1ATRA 1KFDA 1U6ZA 4C8MA 3CMEN 4UQGA 3P31A 3TAGA 4E7JA 1P8ZA 2DPNA 3L2RA 4CZMA 5KTQA 3VA0A 2O8DA 5C24A 3T7ZA 2D0OA 4CBXA 2WUSA 4DFPA 4JK9A 3T69A 4FJXA 2Q97A 4Q0BA 3CMAN 4E1JA 4CF0A 1A5WA 1JCEA 3VQAA 1QVFM 1KSPA 1QTMA 1C0MA 3K58A 4B1VA 1JCFA 4DU1A 3QEIA 3HSCA 2QKBA 4CGIA 4BDZA 4CJQA 3QICA 1VAZA 1CZBA 4OPAA 1U49A 1ZBFA 1N34K 3OYDA 4BWJA 3LPUA 5JMVA 2JWLA 4M3TA 4DFKA 1OH6A 1WSHA 4W5QA 1OKJA 4F3TA 1IKYA 3DLBA 3DJCA 1L3TA 4QOZB 1E4GT 2BANA 4M3RA 1NGDA 3SUPA 4DR3K 4OX9K 2XY5A 3G4SN 1I3AA 3M3ZA 2P9SA 3NMUA 2XY8A 4CD3A 3GE1A 4CEZA 4BR7A 3I0RA 3SPYA 3ULEB 4JKGA 3V9UA 4B3OA 3QIOA 4J2DA 4CESA 3OYGA 3AVBA 1OH8A 4CGHA 3VPZA 3CC4N 3SBTA 1VQ4N 3HL8A 2HVHA 4LFBK 1RDWX 5M1NA 4FVUA 3D6RA 4DWIA 2DFEA 3QIPA 1S72N 4I2QA 3GBTA 4Z0UA 4XIUA 3LDQA 4EZ6A 4G9ZA 4A57A 2HNDA 4HCCA 4E7KA 2KTQA 4CEEA 1OH7A 3NGYA 1HNIA 3THYB 4IJNA 4WYBA 3PY8A 4DF4A 3TTDA 2HVIA 3O9QA 3CCJN 1N8RO 3RMDA 4NO7A 4PA1A 3NH0A 1WAJA 1S5JA 4PHTX 4KTWA 4W5OA 3ZSWA 3LDOA 2YNFA 5HL7L
chains in the Genus database with same CATH topology
3H08A 5CYMA 3VA3A 4GMJB 2FBVA 4DTSA 2B6AA 1CXUA 4FLVA 1NOZA 1RNHA 3D0PA 5J2MA 3HJFA 1NK6A 3V9SA 4LY7A 4BE0A 3AVGA 3SQ1A 1S9GA 3IRXA 5KI6A 3K5MA 1TL1A 4Z4FA 1RTHA 3E01A 4CJ4A 3HXMA 3SPZA 4BE2A 2E6MA 4KHSA 1D9FA 1HMVA 4B08A 3RTVA 5HRRA 4QAGA 5J2NA 3AVKA 1RBRA 4JS5A 1NK9A 1RT3A 4KHUA 1VSIA 4KTQA 3OYJA 1XI1A 4CGFA 5HRSA 3O3GA 1KTQA 4O44A 4N47A 2D0AA 3C6UA 3OS0A 4AHSA 4KHWA 1FK9A 3OYEA 4CJPA 1C0UA 1RCHA 3QINA 3DM2A 4DTPA 4KAZA 4DLEA 3AA2A 4O5BA 2X6NA 3SUQA 4YFUA 4ELTA 4ZTJA 3OYAA 1HRHA 4N41A 1SV5A 3V1OA 1UOCA 1HYZA 1TAQA 1VSDA 1L3UA 3K5NA 1RILA 3SV3A 1U48A 4FJKA 4Q5VA 1BL3A 3U3YA 4AHUA 1IG9A 3JYTA 3OJSA 4M45A 3LP2A 1JL1A 3HVTA 4Y1CA 3TAMA 3RRHA 3TAEA 1IO2A 4DFJA 5I42A 2B5JA 1C0TA 2E4LA 2RKIA 3KD1E 4CJWA 1EP4A 4K8ZA 5CYQA 1SUQA 3SI6A 3ZT0A 3KLFA 4B9TA 3T1AA 2F8TA 4CHNA 1QE1A 4FK2A 2KZZA 4FZXC 4B9UA 4HUFA 3ZSOA 4E89A 1NK4A 4HUGA 1JXEA 1RT7A 3CFOA 4OKJA 1S1VA 2YKMA 3ISNC 3TANA 1TKDA 3NAEA 3WNHA 4JS4A 5HRPA 4PY5A 1L3VA 3AO3A 1LV5A 1YT3A 2ITGA 1ASUA 1BIUA 2EHGA 3G10A 4CGJA 1QQCA 1TL3A 4DTRA 1VSMA 2FC0A 3NHGA 3TABA 2A1SA 3U6FA 2IOCA 4IG3A 4Z4EA 4DTXA 3SUNA 1JKHA 4CJLA 1JXBA 3OYLA 2KFZA 4C8KA 4FCYA 3NF6A 3RMBA 2E6LA 1W0HA 2F96A 5CZ2A 3CFRA 3V4IA 1BQNA 3S3NA 3MXMA 1NJYA 1N5YA 3JSMA 2G8FA 4KB1A 4FK4A 1T7PA 4RW6A 3PX6A 5HROA 1S1TA 3NBPA 4CHYA 2BGGA 1EXQA 3I0SA 1CXQA 3B6OA 4ZTFA 4CK2A 2Z1JA 4N56A 5J1EA 3M8RA 3ASMA 1ZBIA 4CJFA 4DLGA 1BI4A 4IKFA 2HHUA 4FJIA 2P5GA 1SKWA 3AVHA 1D5AA 3SQ0A 4FJJA 2FBTA 3LWLA 1X9MA 5D3GA 3HT3A 3KLEA 4OLBA 1UAXA 3VQ8A 2O4IA 3NE6A 1EX4A 2VG5A 4E1NA 1IH7A 4DSEA 3AVIA 4N76A 1RDAA 3C6TA 2QKKA 4KI6A 1ZYQA 3OYCA 4DQIA 3WNEA 5FRNA 3QNOA 1Z25A 4NCGA 3K57A 4CGGA 1VSEA 3HPOA 4KREA 3ZSZA 4CJVA 5E41A 3T3FA 5EU7A 1UWBA 4F2SA 1LW2A 4BDYA 1TK5A 2ZD1A 4OKEA 3K5LA 3LZIA 3QNNA 4NCBA 5KRTA 3HVRA 4FLZA 2G8IA 4DSFA 3AA5X 1KVAA 2WONA 4RW9A 3ZT3A 3AV9A 3AO5A 4IBNA 4CFBA 4CHQA 4C8OA 3G0ZA 4MQ3A 3RWUA 4PWDA 2KFNA 3VQ5A 3QEVA 1S1WA 3K59A 3SQ4A 2PYJA 3ZSQA 4R5PA 3KLIA 3SV4A 3NDKA 4BWMA 4H4MA 1NKBA 1WN7A 1S9EA 4NCAA 2YKNA 1TKXA 1RBUA 2VG7A 3LP3A 2D0CA 3OYFA 5HP1A 4RW4A 3LALA 1XHZA 3V1QA 4HHTA 2DFFA 1J5OA 4CJUA 4YNQA 4CHZA 4CF2A 3U3GA 3V81A 3SUOA 4O0IA 4CEOA 3KJVA 4OKKA 1Z26A 3AO4A 1EKEA 3LAMA 4LH5A 4M42A 3SQ2A 1JLBA 4CK1A 2I5JA 3AVJA 3OYKA 1BGXT 5J2PA 4FJ8A 3VQEA 4CEAA 3VQ6A 4CFAA 4M3WA 4CJ5A 2OPQA 3L2UA 1S1XA 2ATQA 4KHQA 3I8DA 1SKRA 1IKWA 2XY6A 3ZT1A 2PZSA 4DSLA 4B8CA 4DTOA 1D9DA 3TAPA 3L3VA 1QHTA 1SL0A 4FJ5A 2O4GA 3EZ5A 4FK0A 4F3OA 4FJLA 4J2BA 2OPPA 1WSEA 2YHBA 3DOLA 4FVMA 5FROA 4CERA 2G8WA 1I39A 1TKZA 4W5NA 1Q9XA 3MXJA 4CK3A 5HRNA 4I7FA 3RRGA 2IGIA 2F8SA 3KKRA 4O0JA 3OY9A 4BE1A 3QEPA 3M8SA 2GUIA 3CM5A 3AA3A 1ASVA 3P5JA 2JLEA 2PYLA 2DTUA 3PX4A 4MFBA 4HTUA 1T05A 2ZE2A 3HSTB 5KRSA 1K6YA 4BACA 3NH1A 3DLGA 1MU2A 4AHCA 2JGUA 1L5UA 2G8HA 2YNGA 5HBMA 4FJHA 1REVA 2RN2A 1T8EA 4CJEA 2YV0X 2OYQA 4Z4IA 2KQ2A 4CJRA 1BQMA 4IDKA 3KLGA 3ZSVA 4CJSA 4OGEA 1J9AA 2BE2A 3NGZA 3CM6A 3S9HA 4KHNA 4CECA 4CF1A 3L8BA 4FLXA 1WLJA 3L3UA 1XHXA 4EZ9A 4DTMA 2D5RA 1GOBA 2ZQBA 3HP9A 2YNHA 1ITGA 3O4QA 3OS1A 3SYZA 3VQ9A 3ZT4A 3V9XA 4Z4HA 1RBSA 3PV8A 1U4BA 2HHXA 3P83D 3DMJA 1NOYA 3ZSYA 2HNZA 1U45A 4LH4A 4OJRA 1LW0A 3HPGA 4CHPA 3KK1A 4CGDA 1QSLA 4DTJA 3P1GA 3F73A 3C94A 3LP0A 4CJTA 4KO0A 4B9SA 4RG8A 3AVMA 5JS1A 1RBVA 2HHSA 4DQRA 2KW4A 2DFHA 4ICLA 4NYFA 3CYMA 1KLMA 2HNYA 3RMAA 2VWJA 1HJRA 1NJXA 3DRRA 1NK0A 4FJNA 5SZTA 2KZMA 2DY4A 2XHBA 4CIEA 3O4NA 3SZ2A 1EETA 3TWHA 4CEDA 3S3MA 1J53A 4GW6A 2QK9A 4KTZA 3ZSRA 2ETJA 4K8XA 1SL2A 3DLEA 4F2RA 3VQ4A 3DLKA 5CY4A 3O3FA 4AH9A 1UA0A 1VRTA 4EP5A 1S6QA 2GV9A 4NYNA 3HK2A 2XY7A 1VSLA 2B4JA 2HHVA 3ULDA 1TVRA 1FXXA 2EX3A 3NF8A 4FZYA 4J2EA 3CFPA 1N6QA 2OZSA 4FJGA 3O3HA 4KKOA 3IAYA 1U47A 1HPZA 3K2PA 4DU3A 3LPTA 3PO4A 1U04A 1IKXA 3NGIA 1A5XA 1S6PA 3VQDA 4F4KA 2P1JA 3KLHA 4IFYA 1NK7A 4KPYA 4B8AB 4DTUA 4E7HA 4OLAA 4LD0A 2HMIA 4FM2A 4KRFA 3THVA 2OPRA 3D45A 4DSKA 3HYFA 2X74A 3HPHA 4PQUA 1WSIA 4DU4A 3K5OA 2IAJA 1UA1A 3QLHA 4M3YA 4PUOA 3AVLA 2XO7A 1Y97A 3V1RA 4LSLA 2XRIA 4FJ7A 4ELUA 1TGOA 4DQSA 1JLFA 5FDLA 1HQEA 4I2PA 2Y1IA 3S3OA 3A2FA 4O4GA 3QETA 1RTDA 2HHQA 2PY5A 1WAFA 4FW1A 4IG0A 4ZHRA 4FW2A 1HQUA 1X1PA 4HVJA 4FJ9A 1J54A 1NK8A 3OVNA 1C6VA 1LWCA 4E7LA 1BCMA 1RTJA 1RT1A 1ASWA 1VSFA 1DTTA 4DS5A 4FLWA 5I3UA 1F21A 1G15A 1JLQA 4G1QA 3DRPA 1SL1A 3DOKA 4FJMA 5K14A 1B9DA 4E7IA 3AVAA 5C42A 3DRSA 1YVUA 1A5VA 4WE1A 1KRPA 1TV6A 1ZBUA 2Y1JA 4J2AA 2QXFA 4ID1A 3DI6A 1CLQA 3NF9A 1WSFA 2NUBA 4IFVA 1NJWA 5KGWA 3AO2A 3CG7A 3IS9A 2HHWA 2VG6A 1FKOA 1D8YA 1BCOA 1JLEA 4CJ3A 1RDCA 4Y1DA 1BIZA 2IDOA 4OPKA 4H8KA 1TK8A 1L3SA 2HW3A 4CF8A 1NK5A 2RPIA 3M8QA 1JL2A 5CZ1A 2R7YA 4DQPA 4FLYA 3WNFA 1QSYA 2GBZA 4W5RA 1B9FA 3RR8A 2FBYA 1BI4B 2YHAA 3BGRA 1SKSA 4CFDA 2P5OA 3UIQA 4FYDA 4HCBA 1JLCA 1WSJA 3RMCA 1W9HA 2HB5A 2Z1GA 3AVFA 5DMRA 4JRQA 2OZMA 1YTUA 1C1AA 1WSGA 3MEEA 2WOMA 3KKSA 2G8KA 4EP4A 3TI0A 3B6PA 4OPJA 2A1RA 3ALYA 4CCHA 4CF9A 3HM9A 3L2WA 4DTNA 1KFDA 1NKCA 1JLAA 3LP1A 4C8MA 4HUEA 4B9VA 4UQGA 3SJJA 4KFBA 2IS3A 4FM1A 3TAGA 4E7JA 3PO5A 3FFIA 3L2QA 3LANA 3L2RA 4FLTA 2G8UA 3ITHA 5KTQA 3WNGA 3AA4A 3VA0A 4LSNA 5C24A 1QS4A 4DS4A 4DFPA 1NJZA 2YNIA 1RT4A 1LAVA 3ZSXA 4E19A 4FJXA 1C1CA 4Q0BA 3MAQA 4FXDA 3MEGA 3L2VA 4CIGA 4CF0A 1Q9YA 4CHOA 3T19A 3PUFA 1A5WA 3KTQA 4CFCA 3VQAA 3CQ8A 1VSHA 2Z1IA 1X9SA 2Q3SA 4ELVA 1KLNA 3QERA 1QTMA 1KSPA 1R0AA 3RR7A 3QEXA 1RDBA 2OPSA 2VWKA 1C0MA 1RDDA 1TKTA 4O55A 4AHRA 3EYZA 1RTIA 3K58A 4ID5A 4CIFA 3NF7A 4DU1A 3QEIA 2QKBA 1X9WA 4CGIA 4BDZA 4W5TA 4DG1A 3LWMA 4CJQA 3AVNA 4DSJA 4BDPA 1CZBA 1U49A 1NKEA 3KIOA 1TAUA 1ZBFA 3OYDA 4BWJA 1KVCA 4OVLA 1KCFA 3QEWA 3LPUA 3BDPA 3V9WA 3LAKA 4C8NA 4M3TA 3EY1A 4Z4CA 4DFKA 1WSHA 2BDPA 4DSIA 3AVCA 4W5QA 2OA8A 4F3TA 1IKYA 1CZ9A 3DLBA 1DLOA 1RT6A 1L3TA 4B9LA 4QOZB 3QO9A 4DQQA 1LAWA 1T03A 4B9MA 5DK5A 1WNSA 4RW7A 3V9ZA 1S1UA 1C1BA 2BANA 4FLUA 4M3RA 4F8RA 3SNNA 4JLHA 3SUPA 1KFSA 2XY5A 1I3AA 3KK3A 1HYVA 1VRUA 2XY8A 3NH2A 4CEZA 2HHTA 4L8RB 5KGXA 4M41A 1JLGA 5C25A 3ZT2A 2Z1HA 3V6DA 2IC3A 3OYIA 3I0RA 1ZBHA 1BHLA 4CEQA 3SPYA 4CE9A 2LSNA 4E3SA 2W42A 3V9UA 1KVBA 3OJUA 4B3OA 3QIOA 4J2DA 4CESA 3OYGA 3AVBA 4TSXA 4CGHA 1VSKA 3KK2A 3MXIA 1LWEA 4KB0A 3C95A 3M8PA 1RBTA 3HL8A 4CEBA 3VQQA 2HVHA 1YTAA 1GOAA 3DLRA 3VQPA 1VSJA 4CEFA 3HP6A 4FM0A 4E1MA 4DFMA 4DWIA 1QSSA 2DFEA 3F9KA 3LDSA 1BISA 1RT2A 3QIPA 4M3XA 4I2QA 4FZZA 4Z0UA 4XIUA 1FKPA 1RT5A 1LWFA 4EZ6A 4I9LA 1Q8IA 2HNDA 2D0BA 2X78A 3TARA 4HCCA 4E7KA 3VQ7A 4N5SA 4JRPA 1DTQA 5JS2A 4CJKA 3NCIA 3TAFA 4CEEA 2KTQA 2FBXA 3NGYA 1HNIA 3ZCMA 4C8LA 3OYHA 3LZJA 1ZBLA 3QESA 4KV8A 3PY8A 4M3ZA 3TR8A 3AO1A 4GVMA 4DF4A 4I9QA 4H4OA 3VQCA 2HVIA 4E0DA 3NFAA 4Z4GA 2P51A 3HO1A 3MECA 2X6SA 3RMDA 4PA1A 3DLHA 3NH0A 1GOCA 1WAJA 3OS2A 4DF8A 3MEDA 3OYBA 4RW8A 4AILC 4QCLA 1S5JA 4M3UA 3PX0A 4AHTA 1TK0A 3SCXA 1O1WA 3TAQA 4AHVA 2AJQA 1XWLA 4B9NA 4KTWA 4KHYA 3DYAA 3VN5A 1HNVA 5J2QA 1VK0A 3OYMA 3KD5E 4W5OA 2G8VA 2RF2A 3IG1A 4OGCA 3OYNA 4DMNA 3ZSWA 5FRMA 1B92A 3VQBA 1XC9A 1IKVA 2YNFA 5HLFA 5T7BA 1HYSA 5SWMA 4KI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H08 A;  5CYM A;  3VA3 A;  4GMJ B;  2FBV A;  4DTS A;  2B6A A;  1CXU A;  4FLV A;  1NOZ A;  1RNH A;  3D0P A;  5J2M A;  3HJF A;  1NK6 A;  3V9S A;  4LY7 A;  4BE0 A;  3AVG A;  3SQ1 A;  1S9G A;  3IRX A;  5KI6 A;  3K5M A;  1TL1 A;  4Z4F A;  1RTH A;  3E01 A;  4CJ4 A;  3HXM A;  3SPZ A;  4BE2 A;  2E6M A;  4KHS A;  1D9F A;  1HMV A;  4B08 A;  3RTV A;  5HRR A;  4QAG A;  5J2N A;  3AVK A;  1RBR A;  4JS5 A;  1NK9 A;  1RT3 A;  4KHU A;  1VSI A;  4KTQ A;  3OYJ A;  1XI1 A;  4CGF A;  5HRS A;  3O3G A;  1KTQ A;  4O44 A;  4N47 A;  2D0A A;  3C6U A;  3OS0 A;  4AHS A;  4KHW A;  1FK9 A;  3OYE A;  4CJP A;  1C0U A;  1RCH A;  3QIN A;  3DM2 A;  4DTP A;  4KAZ A;  4DLE A;  3AA2 A;  4O5B A;  2X6N A;  3SUQ A;  4YFU A;  4ELT A;  4ZTJ A;  3OYA A;  1HRH A;  4N41 A;  1SV5 A;  3V1O A;  1UOC A;  1HYZ A;  1TAQ A;  1VSD A;  1L3U A;  3K5N A;  1RIL A;  3SV3 A;  1U48 A;  4FJK A;  4Q5V A;  1BL3 A;  3U3Y A;  4AHU A;  1IG9 A;  3JYT A;  3OJS A;  4M45 A;  3LP2 A;  1JL1 A;  3HVT A;  4Y1C A;  3TAM A;  3RRH A;  3TAE A;  1IO2 A;  4DFJ A;  5I42 A;  2B5J A;  1C0T A;  2E4L A;  2RKI A;  3KD1 E;  4CJW A;  1EP4 A;  4K8Z A;  5CYQ A;  1SUQ A;  3SI6 A;  3ZT0 A;  3KLF A;  4B9T A;  3T1A A;  2F8T A;  4CHN A;  1QE1 A;  4FK2 A;  2KZZ A;  4FZX C;  4B9U A;  4HUF A;  3ZSO A;  4E89 A;  1NK4 A;  4HUG A;  1JXE A;  1RT7 A;  3CFO A;  4OKJ A;  1S1V A;  2YKM A;  3ISN C;  3TAN A;  1TKD A;  3NAE A;  3WNH A;  4JS4 A;  5HRP A;  4PY5 A;  1L3V A;  3AO3 A;  1LV5 A;  1YT3 A;  2ITG A;  1ASU A;  1BIU A;  2EHG A;  3G10 A;  4CGJ A;  1QQC A;  1TL3 A;  4DTR A;  1VSM A;  2FC0 A;  3NHG A;  3TAB A;  2A1S A;  3U6F A;  2IOC A;  4IG3 A;  4Z4E A;  4DTX A;  3SUN A;  1JKH A;  4CJL A;  1JXB A;  3OYL A;  2KFZ A;  4C8K A;  4FCY A;  3NF6 A;  3RMB A;  2E6L A;  1W0H A;  2F96 A;  5CZ2 A;  3CFR A;  3V4I A;  1BQN A;  3S3N A;  3MXM A;  1NJY A;  1N5Y A;  3JSM A;  2G8F A;  4KB1 A;  4FK4 A;  1T7P A;  4RW6 A;  3PX6 A;  5HRO A;  1S1T A;  3NBP A;  4CHY A;  2BGG A;  1EXQ A;  3I0S A;  1CXQ A;  3B6O A;  4ZTF A;  4CK2 A;  2Z1J A;  4N56 A;  5J1E A;  3M8R A;  3ASM A;  1ZBI A;  4CJF A;  4DLG A;  1BI4 A;  4IKF A;  2HHU A;  4FJI A;  2P5G A;  1SKW A;  3AVH A;  1D5A A;  3SQ0 A;  4FJJ A;  2FBT A;  3LWL A;  1X9M A;  5D3G A;  3HT3 A;  3KLE A;  4OLB A;  1UAX A;  3VQ8 A;  2O4I A;  3NE6 A;  1EX4 A;  2VG5 A;  4E1N A;  1IH7 A;  4DSE A;  3AVI A;  4N76 A;  1RDA A;  3C6T A;  2QKK A;  4KI6 A;  1ZYQ A;  3OYC A;  4DQI A;  3WNE A;  5FRN A;  3QNO A;  1Z25 A;  4NCG A;  3K57 A;  4CGG A;  1VSE A;  3HPO A;  4KRE A;  3ZSZ A;  4CJV A;  5E41 A;  3T3F A;  5EU7 A;  1UWB A;  4F2S A;  1LW2 A;  4BDY A;  1TK5 A;  2ZD1 A;  4OKE A;  3K5L A;  3LZI A;  3QNN A;  4NCB A;  5KRT A;  3HVR A;  4FLZ A;  2G8I A;  4DSF A;  3AA5 X;  1KVA A;  2WON A;  4RW9 A;  3ZT3 A;  3AV9 A;  3AO5 A;  4IBN A;  4CFB A;  4CHQ A;  4C8O A;  3G0Z A;  4MQ3 A;  3RWU A;  4PWD A;  2KFN A;  3VQ5 A;  3QEV A;  1S1W A;  3K59 A;  3SQ4 A;  2PYJ A;  3ZSQ A;  4R5P A;  3KLI A;  3SV4 A;  3NDK A;  4BWM A;  4H4M A;  1NKB A;  1WN7 A;  1S9E A;  4NCA A;  2YKN A;  1TKX A;  1RBU A;  2VG7 A;  3LP3 A;  2D0C A;  3OYF A;  5HP1 A;  4RW4 A;  3LAL A;  1XHZ A;  3V1Q A;  4HHT A;  2DFF A;  1J5O A;  4CJU A;  4YNQ A;  4CHZ A;  4CF2 A;  3U3G A;  3V81 A;  3SUO A;  4O0I A;  4CEO A;  3KJV A;  4OKK A;  1Z26 A;  3AO4 A;  1EKE A;  3LAM A;  4LH5 A;  4M42 A;  3SQ2 A;  1JLB A;  4CK1 A;  2I5J A;  3AVJ A;  3OYK A;  1BGX T;  5J2P A;  4FJ8 A;  3VQE A;  4CEA A;  3VQ6 A;  4CFA A;  4M3W A;  4CJ5 A;  2OPQ A;  3L2U A;  1S1X A;  2ATQ A;  4KHQ A;  3I8D A;  1SKR A;  1IKW A;  2XY6 A;  3ZT1 A;  2PZS A;  4DSL A;  4B8C A;  4DTO A;  1D9D A;  3TAP A;  3L3V A;  1QHT A;  1SL0 A;  4FJ5 A;  2O4G A;  3EZ5 A;  4FK0 A;  4F3O A;  4FJL A;  4J2B A;  2OPP A;  1WSE A;  2YHB A;  3DOL A;  4FVM A;  5FRO A;  4CER A;  2G8W A;  1I39 A;  1TKZ A;  4W5N A;  1Q9X A;  3MXJ A;  4CK3 A;  5HRN A;  4I7F A;  3RRG A;  2IGI A;  2F8S A;  3KKR A;  4O0J A;  3OY9 A;  4BE1 A;  3QEP A;  3M8S A;  2GUI A;  3CM5 A;  3AA3 A;  1ASV A;  3P5J A;  2JLE A;  2PYL A;  2DTU A;  3PX4 A;  4MFB A;  4HTU A;  1T05 A;  2ZE2 A;  3HST B;  5KRS A;  1K6Y A;  4BAC A;  3NH1 A;  3DLG A;  1MU2 A;  4AHC A;  2JGU A;  1L5U A;  2G8H A;  2YNG A;  5HBM A;  4FJH A;  1REV A;  2RN2 A;  1T8E A;  4CJE A;  2YV0 X;  2OYQ A;  4Z4I A;  2KQ2 A;  4CJR A;  1BQM A;  4IDK A;  3KLG A;  3ZSV A;  4CJS A;  4OGE A;  1J9A A;  2BE2 A;  3NGZ A;  3CM6 A;  3S9H A;  4KHN A;  4CEC A;  4CF1 A;  3L8B A;  4FLX A;  1WLJ A;  3L3U A;  1XHX A;  4EZ9 A;  4DTM A;  2D5R A;  1GOB A;  2ZQB A;  3HP9 A;  2YNH A;  1ITG A;  3O4Q A;  3OS1 A;  3SYZ A;  3VQ9 A;  3ZT4 A;  3V9X A;  4Z4H A;  1RBS A;  3PV8 A;  1U4B A;  2HHX A;  3P83 D;  3DMJ A;  1NOY A;  3ZSY A;  2HNZ A;  1U45 A;  4LH4 A;  4OJR A;  1LW0 A;  3HPG A;  4CHP A;  3KK1 A;  4CGD A;  1QSL A;  4DTJ A;  3P1G A;  3F73 A;  3C94 A;  3LP0 A;  4CJT A;  4KO0 A;  4B9S A;  4RG8 A;  3AVM A;  5JS1 A;  1RBV A;  2HHS A;  4DQR A;  2KW4 A;  2DFH A;  4ICL A;  4NYF A;  3CYM A;  1KLM A;  2HNY A;  3RMA A;  2VWJ A;  1HJR A;  1NJX A;  3DRR A;  1NK0 A;  4FJN A;  5SZT A;  2KZM A;  2DY4 A;  2XHB A;  4CIE A;  3O4N A;  3SZ2 A;  1EET A;  3TWH A;  4CED A;  3S3M A;  1J53 A;  4GW6 A;  2QK9 A;  4KTZ A;  3ZSR A;  2ETJ A;  4K8X A;  1SL2 A;  3DLE A;  4F2R A;  3VQ4 A;  3DLK A;  5CY4 A;  3O3F A;  4AH9 A;  1UA0 A;  1VRT A;  4EP5 A;  1S6Q A;  2GV9 A;  4NYN A;  3HK2 A;  2XY7 A;  1VSL A;  2B4J A;  2HHV A;  3ULD A;  1TVR A;  1FXX A;  2EX3 A;  3NF8 A;  4FZY A;  4J2E A;  3CFP A;  1N6Q A;  2OZS A;  4FJG A;  3O3H A;  4KKO A;  3IAY A;  1U47 A;  1HPZ A;  3K2P A;  4DU3 A;  3LPT A;  3PO4 A;  1U04 A;  1IKX A;  3NGI A;  1A5X A;  1S6P A;  3VQD A;  4F4K A;  2P1J A;  3KLH A;  4IFY A;  1NK7 A;  4KPY A;  4B8A B;  4DTU A;  4E7H A;  4OLA A;  4LD0 A;  2HMI A;  4FM2 A;  4KRF A;  3THV A;  2OPR A;  3D45 A;  4DSK A;  3HYF A;  2X74 A;  3HPH A;  4PQU A;  1WSI A;  4DU4 A;  3K5O A;  2IAJ A;  1UA1 A;  3QLH A;  4M3Y A;  4PUO A;  3AVL A;  2XO7 A;  1Y97 A;  3V1R A;  4LSL A;  2XRI A;  4FJ7 A;  4ELU A;  1TGO A;  4DQS A;  1JLF A;  5FDL A;  1HQE A;  4I2P A;  2Y1I A;  3S3O A;  3A2F A;  4O4G A;  3QET A;  1RTD A;  2HHQ A;  2PY5 A;  1WAF A;  4FW1 A;  4IG0 A;  4ZHR A;  4FW2 A;  1HQU A;  1X1P A;  4HVJ A;  4FJ9 A;  1J54 A;  1NK8 A;  3OVN A;  1C6V A;  1LWC A;  4E7L A;  1BCM A;  1RTJ A;  1RT1 A;  1ASW A;  1VSF A;  1DTT A;  4DS5 A;  4FLW A;  5I3U A;  1F21 A;  1G15 A;  1JLQ A;  4G1Q A;  3DRP A;  1SL1 A;  3DOK A;  4FJM A;  5K14 A;  1B9D A;  4E7I A;  3AVA A;  5C42 A;  3DRS A;  1YVU A;  1A5V A;  4WE1 A;  1KRP A;  1TV6 A;  1ZBU A;  2Y1J A;  4J2A A;  2QXF A;  4ID1 A;  3DI6 A;  1CLQ A;  3NF9 A;  1WSF A;  2NUB A;  4IFV A;  1NJW A;  5KGW A;  3AO2 A;  3CG7 A;  3IS9 A;  2HHW A;  2VG6 A;  1FKO A;  1D8Y A;  1BCO A;  1JLE A;  4CJ3 A;  1RDC A;  4Y1D A;  1BIZ A;  2IDO A;  4OPK A;  4H8K A;  1TK8 A;  1L3S A;  2HW3 A;  4CF8 A;  1NK5 A;  2RPI A;  3M8Q A;  1JL2 A;  5CZ1 A;  2R7Y A;  4DQP A;  4FLY A;  3WNF A;  1QSY A;  2GBZ A;  4W5R A;  1B9F A;  3RR8 A;  2FBY A;  1BI4 B;  2YHA A;  3BGR A;  1SKS A;  4CFD A;  2P5O A;  3UIQ A;  4FYD A;  4HCB A;  1JLC A;  1WSJ A;  3RMC A;  1W9H A;  2HB5 A;  2Z1G A;  3AVF A;  5DMR A;  4JRQ A;  2OZM A;  1YTU A;  1C1A A;  1WSG A;  3MEE A;  2WOM A;  3KKS A;  2G8K A;  4EP4 A;  3TI0 A;  3B6P A;  4OPJ A;  2A1R A;  3ALY A;  4CCH A;  4CF9 A;  3HM9 A;  3L2W A;  4DTN A;  1KFD A;  1NKC A;  1JLA A;  3LP1 A;  4C8M A;  4HUE A;  4B9V A;  4UQG A;  3SJJ A;  4KFB A;  2IS3 A;  4FM1 A;  3TAG A;  4E7J A;  3PO5 A;  3FFI A;  3L2Q A;  3LAN A;  3L2R A;  4FLT A;  2G8U A;  3ITH A;  5KTQ A;  3WNG A;  3AA4 A;  3VA0 A;  4LSN A;  5C24 A;  1QS4 A;  4DS4 A;  4DFP A;  1NJZ A;  2YNI A;  1RT4 A;  1LAV A;  3ZSX A;  4E19 A;  4FJX A;  1C1C A;  4Q0B A;  3MAQ A;  4FXD A;  3MEG A;  3L2V A;  4CIG A;  4CF0 A;  1Q9Y A;  4CHO A;  3T19 A;  3PUF A;  1A5W A;  3KTQ A;  4CFC A;  3VQA A;  3CQ8 A;  1VSH A;  2Z1I A;  1X9S A;  2Q3S A;  4ELV A;  1KLN A;  3QER A;  1QTM A;  1KSP A;  1R0A A;  3RR7 A;  3QEX A;  1RDB A;  2OPS A;  2VWK A;  1C0M A;  1RDD A;  1TKT A;  4O55 A;  4AHR A;  3EYZ A;  1RTI A;  3K58 A;  4ID5 A;  4CIF A;  3NF7 A;  4DU1 A;  3QEI A;  2QKB A;  1X9W A;  4CGI A;  4BDZ A;  4W5T A;  4DG1 A;  3LWM A;  4CJQ A;  3AVN A;  4DSJ A;  4BDP A;  1CZB A;  1U49 A;  1NKE A;  3KIO A;  1TAU A;  1ZBF A;  3OYD A;  4BWJ A;  1KVC A;  4OVL A;  1KCF A;  3QEW A;  3LPU A;  3BDP A;  3V9W A;  3LAK A;  4C8N A;  4M3T A;  3EY1 A;  4Z4C A;  4DFK A;  1WSH A;  2BDP A;  4DSI A;  3AVC A;  4W5Q A;  2OA8 A;  4F3T A;  1IKY A;  1CZ9 A;  3DLB A;  1DLO A;  1RT6 A;  1L3T A;  4B9L A;  4QOZ B;  3QO9 A;  4DQQ A;  1LAW A;  1T03 A;  4B9M A;  5DK5 A;  1WNS A;  4RW7 A;  3V9Z A;  1S1U A;  1C1B A;  2BAN A;  4FLU A;  4M3R A;  4F8R A;  3SNN A;  4JLH A;  3SUP A;  1KFS A;  2XY5 A;  1I3A A;  3KK3 A;  1HYV A;  1VRU A;  2XY8 A;  3NH2 A;  4CEZ A;  2HHT A;  4L8R B;  5KGX A;  4M41 A;  1JLG A;  5C25 A;  3ZT2 A;  2Z1H A;  3V6D A;  2IC3 A;  3OYI A;  3I0R A;  1ZBH A;  1BHL A;  4CEQ A;  3SPY A;  4CE9 A;  2LSN A;  4E3S A;  2W42 A;  3V9U A;  1KVB A;  3OJU A;  4B3O A;  3QIO A;  4J2D A;  4CES A;  3OYG A;  3AVB A;  4TSX A;  4CGH A;  1VSK A;  3KK2 A;  3MXI A;  1LWE A;  4KB0 A;  3C95 A;  3M8P A;  1RBT A;  3HL8 A;  4CEB A;  3VQQ A;  2HVH A;  1YTA A;  1GOA A;  3DLR A;  3VQP A;  1VSJ A;  4CEF A;  3HP6 A;  4FM0 A;  4E1M A;  4DFM A;  4DWI A;  1QSS A;  2DFE A;  3F9K A;  3LDS A;  1BIS A;  1RT2 A;  3QIP A;  4M3X A;  4I2Q A;  4FZZ A;  4Z0U A;  4XIU A;  1FKP A;  1RT5 A;  1LWF A;  4EZ6 A;  4I9L A;  1Q8I A;  2HND A;  2D0B A;  2X78 A;  3TAR A;  4HCC A;  4E7K A;  3VQ7 A;  4N5S A;  4JRP A;  1DTQ A;  5JS2 A;  4CJK A;  3NCI A;  3TAF A;  4CEE A;  2KTQ A;  2FBX A;  3NGY A;  1HNI A;  3ZCM A;  4C8L A;  3OYH A;  3LZJ A;  1ZBL A;  3QES A;  4KV8 A;  3PY8 A;  4M3Z A;  3TR8 A;  3AO1 A;  4GVM A;  4DF4 A;  4I9Q A;  4H4O A;  3VQC A;  2HVI A;  4E0D A;  3NFA A;  4Z4G A;  2P51 A;  3HO1 A;  3MEC A;  2X6S A;  3RMD A;  4PA1 A;  3DLH A;  3NH0 A;  1GOC A;  1WAJ A;  3OS2 A;  4DF8 A;  3MED A;  3OYB A;  4RW8 A;  4AIL C;  4QCL A;  1S5J A;  4M3U A;  3PX0 A;  4AHT A;  1TK0 A;  3SCX A;  1O1W A;  3TAQ A;  4AHV A;  2AJQ A;  1XWL A;  4B9N A;  4KTW A;  4KHY A;  3DYA A;  3VN5 A;  1HNV A;  5J2Q A;  1VK0 A;  3OYM A;  3KD5 E;  4W5O A;  2G8V A;  2RF2 A;  3IG1 A;  4OGC A;  3OYN A;  4DMN A;  3ZSW A;  5FRM A;  1B92 A;  3VQB A;  1XC9 A;  1IKV A;  2YNF A;  5HLF A;  5T7B A;  1HYS A;  5SWM A;  4KI4 A; 
#chains in the Genus database with same CATH topology
 5CYM A;  4R79 A;  3JS6 A;  4JK8 A;  3HJF A;  3V9S A;  1S9G A;  3IRX A;  3AY9 A;  1Q82 O;  3SPZ A;  4BE2 A;  2E6M A;  1D9F A;  3TTF A;  4B08 A;  1HKB A;  2NRT A;  5AQU A;  1RBR A;  1RT3 A;  4KTQ A;  3M5R A;  3IKM A;  5M1O A;  3O3G A;  5HRS A;  4O44 A;  2D0A A;  3C6U A;  4OPH A;  1ATS A;  3L6Q A;  1FK9 A;  1VQO N;  2X6N A;  1HRH A;  4N41 A;  1SV5 A;  3V1O A;  3R1X A;  3O08 A;  1VSD A;  1WOQ A;  3K5N A;  4X65 K;  4C1N K;  4FJK A;  4Q5V A;  3F9M A;  3WXL A;  4AHU A;  3LP2 A;  1JL1 A;  3HVT A;  4Y1C A;  1IO2 A;  4DFJ A;  2B5J A;  1C0T A;  2E4L A;  4YDU A;  3PIO L;  4JI8 K;  5CYQ A;  3SI6 A;  3G25 A;  3ZT0 A;  3A8Y A;  4B9T A;  4HWI A;  2F8T A;  4CHN A;  2KZZ A;  4JK7 A;  1K8K A;  4E89 A;  4OKJ A;  1NMD A;  3ISN C;  1BU6 O;  4BRI A;  5HRP A;  4PY5 A;  4IEE A;  3AO3 A;  4B1U B;  4WQ4 C;  1TL3 A;  2FC0 A;  1D4X A;  3J8A A;  3GOI A;  4DR4 K;  5LMN K;  1NGB A;  5CZ2 A;  4DV6 K;  3S3N A;  1BQN A;  4DUZ K;  1XMQ K;  1NGE A;  1T7P A;  3PX6 A;  5HRO A;  3ATV A;  3NBP A;  5GIO A;  2YJF A;  1EXQ A;  4ZTF A;  2ZF5 O;  3VES A;  3M8R A;  4BR2 A;  3ASM A;  5DM6 L;  5AFU A;  3AVH A;  2FBT A;  1U2V A;  1ZXO A;  4CBW A;  1X9M A;  2CH5 A;  3VQ8 A;  2HF3 A;  3AVI A;  1NJI O;  3THW B;  2QKK A;  4EHU A;  4KH6 A;  5FRN A;  1Z25 A;  1VSE A;  4KRE A;  3ZSZ A;  4BC2 A;  2HBJ A;  4F2S A;  1TK5 A;  4OKE A;  3K5L A;  3AA5 X;  2WON A;  3AV9 A;  4IBN A;  1HNW K;  3CPE A;  4A2B A;  3HTV A;  4I6M A;  1S1W A;  4FPB A;  3SQ4 A;  3EO3 A;  5H1S Q;  3ZSQ A;  1NM1 A;  4H4M A;  1NKB A;  1S9E A;  2YKN A;  1TKX A;  1RBU A;  3OYF A;  2DFF A;  4YNQ A;  4EFH A;  4CEO A;  4GVE A;  4LH5 A;  3SQ2 A;  4CK1 A;  2ZJR L;  3H1Q A;  3LM2 A;  4M3W A;  1S1X A;  1NLV A;  1IKW A;  3ZLJ A;  3I8B A;  2PZS A;  4B8C A;  3L3V A;  4FJL A;  3H45 C;  4BC4 A;  1SQK A;  4DQ8 A;  4CER A;  5AQJ A;  1WBB A;  3J81 O;  4O0J A;  3OY9 A;  3SMS A;  1XMO K;  2GTD A;  4BR9 A;  4MO4 A;  4YOW A;  2DTU A;  3TSQ A;  2UU9 K;  3EKS A;  3WXJ A;  4HTU A;  5JVG L;  1QZ6 A;  1X9J A;  4PL8 A;  5KQD A;  4LC9 B;  4A61 A;  1MU2 A;  5JVH L;  2JGU A;  3HRG A;  3Q7B A;  2G8H A;  4FJH A;  1T8E A;  4BVO A;  4IOC L;  4CJE A;  2YV0 X;  2OYQ A;  4Z4I A;  3VER A;  4CJS A;  4KHN A;  1S3X A;  1YAG A;  1WLJ A;  4H0O A;  4DTM A;  1GOB A;  3OS1 A;  3VQ9 A;  4Z4H A;  4FO0 A;  1NOY A;  3U4L A;  2E8A A;  3C94 A;  3LP0 A;  2YCH A;  1QZ5 A;  4B9S A;  2HHS A;  3ID6 A;  3DRR A;  5AQI A;  4BY9 C;  4FJN A;  4MO5 A;  4BRK A;  2QTD A;  3S3M A;  1J53 A;  3H46 O;  2A41 A;  4K8X A;  2ETJ A;  5AZI B;  4BRQ A;  3MMV A;  4EP5 A;  1S6Q A;  3H3N O;  3VGM A;  2O8E B;  2F4V K;  1FXX A;  2OZS A;  4IFE A;  4FJG A;  4KKO A;  1U47 A;  1SZ2 A;  3UKR A;  3TTC A;  4M7Y A;  1A5X A;  2O8B A;  4JHD B;  3VTI A;  4DTU A;  3FZK A;  4X66 K;  2QWO A;  3UKU A;  3THV A;  4DSK A;  4YOT A;  3HYF A;  4O5F A;  3HPH A;  4H5T A;  4JI5 K;  5EXW A;  3D7E O;  4PUO A;  1BA0 A;  3E9O A;  3RSE B;  3CQX A;  1JLF A;  5FDL A;  4I2P A;  2Y1I A;  4O4G A;  2QW9 A;  3QET A;  1HQU A;  1NK8 A;  4CVN E;  1ASW A;  4DS5 A;  5FPN A;  1TYQ A;  5I3U A;  1XNR K;  4M7X A;  1JLQ A;  4G1Q A;  3DRP A;  3DOK A;  4JV5 K;  5K14 A;  2OTL N;  1B9D A;  5AJ3 K;  4DR5 K;  1GLL O;  4J2A A;  4ID1 A;  3NF9 A;  1WSF A;  2NUB A;  3OW2 M;  4JD2 B;  1NJW A;  1BCO A;  1JLE A;  1W2B M;  1RDC A;  1CLQ A;  2A5X A;  1NGI A;  3C7N A;  4DQP A;  4FLY A;  3WNF A;  2GBZ A;  4W5R A;  2ITM A;  1BI4 B;  1SKS A;  4CFD A;  2A40 A;  4HCB A;  1Q18 A;  5KQ8 A;  1YTU A;  3A5L C;  3O9S A;  1C1A A;  3VF4 A;  3KKS A;  3L4Q A;  3TI0 A;  4B3T K;  4YOR A;  4OPJ A;  4H0T B;  4BRL A;  4DTN A;  4JKC A;  1NKC A;  1JLA A;  3LP1 A;  4HUE A;  3SJJ A;  3LAN A;  3D2F A;  3WNG A;  3AA4 A;  1QHA A;  2Q0U A;  5LMU K;  1LAV A;  3ZSX A;  1C1C A;  2A42 A;  3MEG A;  1NBW A;  4CHO A;  4BG9 A;  3PUF A;  1VSH A;  1KLN A;  3QER A;  3QEX A;  5M1Q A;  2VWK A;  4O55 A;  1RTI A;  4XH5 A;  4MLH A;  3E9L A;  3DXM A;  3H3O B;  5AQF A;  4DV2 K;  3BDP A;  2WC9 A;  1DKG D;  5AQV A;  5IT9 O;  4Z4C A;  3PIP L;  4JKB A;  2P9P B;  1GLB G;  4DSI A;  4NXN K;  2OA8 A;  1CZ9 A;  5HOO A;  1DLO A;  1RT6 A;  1RGI A;  4DQQ A;  1WNS A;  1DEJ A;  3DXK B;  1BUP A;  5F2R A;  4ISF A;  4F8R A;  3SNN A;  1VRU A;  3NH2 A;  2HHT A;  2YHY A;  3D2E B;  2Z1H A;  2CH6 A;  2IC3 A;  4CE9 A;  2LSN A;  3VEV A;  3OJU A;  3MXI A;  1LWE A;  4KB0 A;  2P9N B;  1QQO A;  4CEB A;  3VQQ A;  1YTA A;  4E1M A;  1QSS A;  3F9K A;  4H0P A;  1RT5 A;  2FLO A;  5M1K A;  4BRF A;  2D0B A;  3VQ7 A;  4N5S A;  1KAY A;  4H5N A;  4C8L A;  5AQK A;  4BRH A;  3OYH A;  3LZJ A;  4M3Z A;  3TR8 A;  3AO1 A;  4Z4G A;  3NFA A;  3HO1 A;  2IVO A;  4B3M K;  3MED A;  4AIL C;  4MDB A;  3SCX A;  1O1W A;  4ISG A;  4AHV A;  3TAQ A;  2F7T A;  3K0S A;  1IJJ A;  3DYA A;  1K73 O;  1VK0 A;  3OYM A;  3KD5 E;  2G8V A;  2RF2 A;  3QFU A;  4OGC A;  4LF4 K;  2W6K A;  1B92 A;  3VQB A;  1XC9 A;  5JLF A;  1NGH A;  4B9Q A;  5HLF A;  4XH4 A;  4AF1 A;  2FBV A;  1G99 A;  4DTS A;  1BOT O;  2B6A A;  1VQ8 N;  3O1W A;  1NOZ A;  4Z94 A;  3ENB A;  3AVG A;  3KHY A;  3SMP A;  3LL3 A;  4Z4F A;  5AQR A;  1IBL K;  3EE8 A;  3R6M A;  3CD6 N;  1HMV A;  3RTV A;  3A5O C;  2P9L B;  3F2K A;  3AVK A;  1VSI A;  3HOT A;  4N47 A;  3FLC O;  3K9J A;  3OS0 A;  4AHS A;  1C0U A;  1RCH A;  3QIN A;  3G71 N;  4KAZ A;  2Q0R A;  4ELT A;  4ZTJ A;  3PSI A;  3OYA A;  1L3U A;  2IIR A;  4XH1 A;  1RIL A;  1GLF O;  2HBL A;  1BL3 A;  4AM6 A;  1IG9 A;  3JYT A;  4H03 B;  5F0X A;  3TAM A;  3RRH A;  2P9I B;  3ATU A;  4LF7 K;  3KLF A;  5C2D A;  2UUC K;  1QE1 A;  2HOE A;  1YF5 L;  2QXL A;  5TKW A;  4FZX C;  3I56 N;  3ZSO A;  1NK4 A;  3THY A;  3M1F A;  3CFO A;  1S1V A;  2P9K A;  3NAE A;  3WNH A;  3WXK A;  3ZET B;  2J4R A;  4J8F A;  1L3V A;  1YT3 A;  1ASU A;  4CGJ A;  3G10 A;  3ZYY X;  3O4W A;  2VGM A;  3EE9 A;  4HTL A;  4DTR A;  4FOE A;  4Z4E A;  2IOC A;  1VQK N;  3VMF B;  3SUN A;  3J7Z O;  4CJL A;  3OYL A;  1JXB A;  1KAZ A;  2KFZ A;  4C8K A;  2IVN A;  3NF6 A;  3WUH A;  5BRF A;  1W0H A;  4A5A A;  3V4I A;  2G8F A;  3MXM A;  1NGF A;  4JKA A;  5AQM A;  5TKY A;  4WF9 L;  4CHY A;  3I0S A;  1CXQ A;  4CK2 A;  4N56 A;  5J1E A;  1J5E K;  2O8D B;  4CJF A;  4JKE A;  4FJI A;  5JLH A;  2P5G A;  4OLB A;  3U9D A;  2O4I A;  2VG5 A;  4F9O A;  1IH7 A;  1DGK N;  4N76 A;  3G6E N;  4KI6 A;  4DQI A;  1GLE G;  4BG8 A;  4CJV A;  1UWB A;  2AA4 A;  2Q2R A;  5AQS A;  3WEE B;  1BWF O;  3LZI A;  3QNN A;  4FLZ A;  2G8I A;  3CCS N;  2W6L A;  3G0Z A;  2ZJQ L;  4GKJ K;  4PWD A;  2KFN A;  3QEV A;  1NNE A;  1C0G A;  3O9U A;  5BR8 K;  4LF5 K;  4B1W B;  2GWK A;  3KZB A;  5F1X A;  1HKC A;  4NCA A;  3VGK A;  3DWL A;  5HP1 A;  4RW4 A;  5C0Y A;  3ZX2 A;  4CF2 A;  3MN7 A;  4O0I A;  2P9S B;  1Z26 A;  4M42 A;  5AQY A;  2VYP A;  2GX9 A;  5J2P A;  3VQE A;  1YVN A;  3VQ6 A;  2OPQ A;  4KHQ A;  3I8D A;  1SKR A;  4BRA A;  2O4G A;  4FK0 A;  2OPP A;  1WSE A;  4FVM A;  3DOL A;  2Q36 A;  3VEY A;  4BRP A;  4FWQ A;  1Q9X A;  3CCU N;  1Y64 A;  5HRN A;  3QML A;  3SBG A;  4I7F A;  2UXB K;  2EWS A;  3CF5 L;  2GUI A;  3CM5 A;  3VEW A;  1CZA N;  4MFB A;  1T05 A;  5KRS A;  1K6Y A;  2VQF K;  3DLG A;  3VEO A;  4PKG A;  3CCQ N;  5HBM A;  3KK7 A;  2OTJ N;  1EWR A;  1MWM A;  1KAX A;  2KQ2 A;  1ZC6 A;  1BQM A;  2NRZ A;  1N32 K;  3THX A;  5EY4 A;  5KPZ A;  2QM1 A;  1HJO A;  3CHW A;  4CF1 A;  3L8B A;  4FLX A;  1XHX A;  2ZQB A;  3HP9 A;  5FPM A;  3EZW A;  3V9X A;  3PV8 A;  1RBS A;  3DMJ A;  3EN9 A;  4L3Q A;  4OJR A;  3HPG A;  4BC5 A;  2FSN A;  3MK6 A;  5KPR A;  1ATN A;  2PBD A;  5JS1 A;  1RBV A;  5AQP A;  4ICL A;  3CQY A;  3CYM A;  2QWQ A;  2HNY A;  1FJG K;  1HJR A;  1NK0 A;  4WQ5 A;  2DY4 A;  2XHB A;  4DCH A;  4CIE A;  5IWA K;  4MLE A;  1EET A;  4CED A;  4LFC K;  2ZGY A;  2P9U B;  5JIC A;  2QK9 A;  4H0X B;  1W97 L;  5GIP A;  5BN8 A;  1RDU A;  1SL2 A;  3DLE A;  3J7A P;  3VQ4 A;  3DLK A;  3O3F A;  1UA0 A;  3ZEU B;  4O8U A;  4NYN A;  3HK2 A;  4GV6 A;  2B4J A;  1TVR A;  3NF8 A;  5AQT A;  2V7Y A;  3CFP A;  2IVP A;  3CCR N;  1HPZ A;  3PO4 A;  3MX5 A;  3NGI A;  4IFY A;  4Y0W A;  4KPY A;  4B8A B;  2KHO A;  2UXC K;  2RHK A;  2V7Z A;  3QDK A;  5AR0 A;  4JI2 K;  2Q31 A;  4DU4 A;  3K5O A;  5E26 A;  3VEN A;  3U8X A;  1VQP N;  4IWV A;  1NG9 A;  4IOA L;  4JI4 K;  4ELU A;  5AQO A;  5CE3 A;  2W40 A;  3IUC A;  1RTD A;  4XEI A;  4FWP A;  4DR1 K;  3A2F A;  4IG0 A;  1EO1 A;  4ZHR A;  4PKI A;  2Q1N A;  1C6V A;  1RTJ A;  4M63 C;  3AAQ A;  2H3G X;  4E7I A;  3VET A;  2QWR A;  1ZBU A;  2FSJ A;  4IFV A;  3AO2 A;  3IS9 A;  2VG6 A;  1D8Y A;  4LF6 K;  4QS7 A;  1BIZ A;  1L3S A;  4CF8 A;  5MLC Q;  2QI2 A;  1B9F A;  3SAG A;  3BGR A;  1BO5 O;  4A5B A;  1NGG A;  3CJC A;  4FYD A;  1U2V B;  2BUP A;  1WSG A;  1VQM N;  2WOM A;  4EP4 A;  2QA4 N;  2HHH K;  4CCH A;  2NRH A;  3HM9 A;  3L2W A;  4KB1 A;  5AZI A;  2NRV A;  4KFB A;  2IS3 A;  2ZM6 K;  4FM1 A;  3L2Q A;  2G8U A;  3ITH A;  1QVG M;  4LSN A;  1QS4 A;  2O8E A;  3CIP A;  1NJZ A;  2YNI A;  1RT4 A;  3MAQ A;  4FXD A;  2E88 A;  3BP8 A;  4I6M B;  4JKD A;  5M1F A;  1Q9Y A;  3T19 A;  4ELV A;  4JHD A;  3CQ8 A;  3KWG A;  3E9P A;  4IZ9 A;  2Z1I A;  1X9S A;  4FSV A;  4ILH A;  4BR5 A;  3RR7 A;  2OPS A;  1RDD A;  4AHR A;  4ID5 A;  4CIF A;  3NF7 A;  5AQG A;  4W5T A;  5A2Q O;  2A6A A;  3AVN A;  4BRG A;  4BDP A;  4NLC A;  3KIO A;  3KVG A;  1TAU A;  1XUP O;  5LJV A;  3V9W A;  4BRM A;  4C8N A;  4DKW A;  1T6C A;  5LJW A;  3M6G A;  3AVC A;  2WTU A;  3QO9 A;  4CZK A;  5DK5 A;  2RE2 A;  3LM9 A;  4RW7 A;  5B8H A;  4FLU A;  3MCP A;  1EWQ A;  3MN6 A;  4U67 L;  2CGJ A;  4JLH A;  4IO9 L;  1T3V A;  5BPM A;  5KGX A;  4M41 A;  3ZT2 A;  4ILG B;  3V6D A;  3MN5 A;  2WBN A;  3WXM B;  1ZBH A;  1BHL A;  1VQL N;  4B1Z A;  4E3S A;  3C65 A;  1KVB A;  3KK2 A;  4FOI A;  4A59 A;  3C95 A;  3M8P A;  2NRR A;  2CGK A;  3VQP A;  1GOA A;  3DLR A;  2CGL A;  1VSJ A;  1YUW A;  4CEF A;  3AAR A;  5AQZ A;  3LDS A;  4M3X A;  2PFU A;  4MDA A;  4FZZ A;  4JI3 K;  4EIA A;  1LWF A;  3AGK A;  4NLB A;  3QFP A;  4GV9 A;  3TAR A;  1I94 K;  5JS2 A;  2OAN A;  2FBX A;  5AFU H;  3AGR A;  3NVK A;  4CZL A;  1HUX A;  3QES A;  1ZBL A;  3CET A;  4H0Y B;  3VQC A;  4BRO A;  3MEC A;  4JN4 A;  1V4T A;  3DLH A;  3KWI A;  1XNQ K;  1GOC A;  3ZX0 A;  4DF8 A;  4JAX A;  3OYB A;  4RW8 A;  4M3U A;  1TK0 A;  4ISE A;  4B9N A;  5DM7 L;  1LOT B;  3OBW A;  4KHY A;  4DV4 K;  3VN5 A;  3CJB A;  5J2Q A;  3OYN A;  3WQT A;  3QBX A;  3VOV A;  5FRM A;  3FGU A;  5T7B A;  5SWM A;  3AAP A;  4KI4 A;  2NZT A;  5C2F A;  2KKZ A;  4FLV A;  3D0P A;  1NK6 A;  4LY7 A;  4BE0 A;  3FZF A;  5KI6 A;  3W0L A;  3HI0 A;  2P9P A;  4CJ4 A;  2O8B B;  4KHS A;  5HRR A;  4QAG A;  5J2N A;  3UKU B;  4JS5 A;  1NK9 A;  4KHU A;  3DXK A;  3OYJ A;  1XI1 A;  3B8A X;  4CGF A;  1RFQ A;  4KHW A;  3D2E A;  3OYE A;  2VWB A;  4CJP A;  3DM2 A;  4DTP A;  1E4F T;  3AA2 A;  4DLE A;  3SUQ A;  4YFU A;  3JXU A;  3FZL A;  4WFN L;  2E1Z A;  1GLC G;  2O8F B;  1TAQ A;  3OBY A;  3T1Y K;  3A5N C;  4CZF A;  3SV3 A;  1U48 A;  1K9M O;  2E2P A;  2NRX A;  3OJS A;  4M45 A;  5GAE P;  4O8K A;  5AQQ A;  1TYQ B;  4JYA K;  3CJ7 A;  3K9K A;  2RKI A;  4CJW A;  3CJ1 A;  3T1A A;  5BPL A;  4DB3 A;  4FK2 A;  1VQ6 N;  4HUF A;  3DAW A;  4HUG A;  1JXE A;  1RT7 A;  4BR0 A;  3TAN A;  1TKD A;  4JS4 A;  1XC3 A;  4AM7 A;  5C15 A;  4DV5 K;  3CXC M;  2EHG A;  5ADX H;  1OH5 A;  3TAB A;  2A1S A;  4DTX A;  3CCE N;  4FCY A;  3RMB A;  2E6L A;  2F96 A;  3CFR A;  4FK4 A;  3JSM A;  1JJ2 M;  3JAM O;  1GLA G;  1NMN A;  4RW6 A;  3B6O A;  4DR7 K;  2W41 A;  3D2F B;  3LDN A;  4KHP K;  2D0P A;  1ZBI A;  4DLG A;  2HHU A;  1SKW A;  1SAZ A;  2O8C A;  5D3G A;  3KLE A;  1EX4 A;  4FWK A;  2E5L K;  1RDA A;  4V19 S;  4IOX A;  1ZYQ A;  3OYC A;  4BR4 A;  1C0F A;  3K57 A;  4CGG A;  3VGL A;  4WFA L;  3EKU A;  5AQH A;  2P9L A;  1X3M A;  1LW2 A;  2HST A;  3DXM B;  5GAG P;  3O8M A;  4DHY A;  3HVR A;  4BC3 A;  1KVA A;  4RW9 A;  3AO5 A;  4CFB A;  5AQW A;  4CHQ A;  4MQ3 A;  3LDL A;  3TSP A;  3VEX A;  5BRE A;  2UXD K;  3K59 A;  1HX1 A;  3PSF A;  5BRH A;  3UE5 A;  4R5P A;  1NGA A;  3NDK A;  4BWM A;  4QS9 A;  4BQL A;  3CER A;  1GLD G;  3WQU A;  1X3N A;  2VG7 A;  3TU5 A;  1XHZ A;  5EVZ A;  3ID8 A;  4CJU A;  4CI6 A;  2P9I A;  5FLX O;  3BF3 A;  1EKE A;  1JLB A;  4IXC A;  3OYK A;  4FJ8 A;  4CFA A;  2HF4 A;  2XY6 A;  3ZT1 A;  3FZM A;  4DTO A;  3TAP A;  1D9D A;  1QHT A;  1SL0 A;  4FJ5 A;  2E2N A;  4K25 A;  2UUA K;  4F3O A;  4J2B A;  1BG3 A;  5FRO A;  2G8W A;  1I39 A;  1TKZ A;  4W5N A;  4WFB L;  1HKG A;  3MXJ A;  4CJ7 A;  5AQN A;  4LF9 K;  3C6A A;  1YJN N;  4GV3 A;  3RRG A;  3QEP A;  4K43 A;  1YHQ N;  1ASV A;  2OCE A;  2E2Q A;  2JLE A;  4CZG A;  3PX4 A;  2HBK A;  3ULE A;  5KPT A;  4JNE A;  5GIN A;  4BAC A;  4AHC A;  1L5U A;  1REV A;  3WXI A;  3EEQ A;  5AZJ B;  4IDK A;  4CZI A;  4CJR A;  3SAF A;  2JWK A;  4IO8 A;  3KLG A;  3NGZ A;  4OGE A;  2BE2 A;  3T1H K;  4LFA K;  3CM6 A;  3OHR A;  4H5V A;  4JKF A;  4CEC A;  1M1K O;  2D5R A;  3U9Z A;  3SYZ A;  4YOU A;  3ZT4 A;  4JI0 K;  1IG8 A;  1O13 A;  3ZSY A;  3WT0 A;  5BN9 A;  2V51 B;  1VQ7 N;  4CHP A;  3KK1 A;  4CGD A;  1VQ5 N;  4GKK K;  3P1G A;  4DV3 K;  3L0Q A;  3F73 A;  3WEE A;  4UY8 O;  4CJT A;  4KO0 A;  3AVM A;  2D1K A;  3GG4 A;  4DQR A;  3MWP A;  2KW4 A;  2DFH A;  4NYF A;  4K41 A;  1KLM A;  1QQM A;  3ENH A;  2VWJ A;  2KZM A;  5LL6 Z;  5SZT A;  3UB5 A;  1YI2 N;  3P4I A;  1QQN A;  3TWH A;  3MWT A;  4GW6 A;  3O5B A;  4KTZ A;  5ELZ A;  4F2R A;  2PAV A;  4BGB A;  4RTF D;  4AH9 A;  3QBW A;  3QB0 A;  1VSL A;  2HHV A;  4CZJ A;  2EX3 A;  2VCP A;  3P38 A;  1N6Q A;  1GLJ O;  5FPD A;  2QWP A;  3O9R A;  4DU3 A;  3LPT A;  3CCL N;  3VQD A;  4F4K A;  3A5M C;  3VF6 A;  2P1J A;  3KLH A;  5FPE A;  3OTO K;  1NK7 A;  2ZWH A;  4LD0 A;  2HMI A;  4AQY K;  1LCU A;  2OPR A;  3D45 A;  4WQ4 A;  4FWO A;  3OA9 A;  2E2O A;  1Q86 O;  2X74 A;  4PQU A;  3MX2 A;  4DV1 K;  3HBT A;  3AVL A;  3BZK A;  4IDH A;  3TPQ A;  1Y97 A;  3V1R A;  3J80 O;  3S41 A;  1TGO A;  4DQS A;  3BEX A;  4JI1 K;  4X64 K;  1HQE A;  2HHQ A;  2P9K B;  4FW2 A;  4HVJ A;  4FJ9 A;  4FWN A;  1J54 A;  4DV0 K;  1LWC A;  3FFK B;  1HNZ K;  2NRW A;  1NGC A;  5GAH P;  5CR4 A;  1G15 A;  1WB9 A;  1SL1 A;  4FJM A;  1KXP A;  4JI7 K;  3AVA A;  5C42 A;  1A5V A;  1KRP A;  2QXF A;  4JKG B;  3DI6 A;  1T44 A;  1KD1 O;  2F9T A;  3CG7 A;  2HHW A;  2FXU A;  1FKO A;  4BRD A;  3SLC A;  4OPK A;  4Y1D A;  1W7A A;  1TK8 A;  4H8K A;  2HW3 A;  4LF8 K;  5CZ1 A;  3M8Q A;  1JL2 A;  2R7Y A;  1NGJ A;  2VGN A;  1QSY A;  3RR8 A;  2FBY A;  3IDH A;  1JLC A;  1WSJ A;  5DMR A;  2Z1G A;  3AVF A;  3GDQ A;  1YJW N;  4IJA A;  4YOV A;  2P9U A;  3B6P A;  4YY3 K;  4CF9 A;  3CJ9 A;  4B9V A;  5I9E B;  1VHX A;  3BF1 A;  3PO5 A;  3FFI A;  4FLT A;  2VQE K;  3ZEU A;  4CZH A;  4C1N I;  3O9T A;  4DS4 A;  3EL2 A;  4E19 A;  3L2V A;  3C0B A;  4CIG A;  3O6W A;  3THW A;  3NVM A;  1KC8 O;  3KTQ A;  4CFC A;  2Q3S A;  4KH5 A;  1R0A A;  1RDB A;  3SAH A;  5C10 A;  1TKT A;  3EYZ A;  1HPM A;  1X9W A;  2YJE A;  4DG1 A;  3LWM A;  3O80 A;  1NWK A;  4DSJ A;  3R3L A;  5LY3 A;  1NKE A;  1KVC A;  4OVL A;  1KCF A;  3QEW A;  3LAK A;  2UYT A;  3EY1 A;  1TUU A;  2BDP A;  3E1Y A;  3J7Y P;  1VQ9 N;  4B9L A;  4PKH A;  1T03 A;  1LAW A;  4B9M A;  1BDG A;  4NXM K;  3FE1 A;  3V9Z A;  1S1U A;  1C1B A;  3Q7C A;  1KFS A;  2QEX N;  4EAH D;  3KK3 A;  1HYV A;  2E20 A;  4L8R B;  2QWN A;  3VTH A;  5C25 A;  1JLG A;  2ZJP L;  3OYI A;  2ASO A;  4CEQ A;  4FWL A;  2W42 A;  4DR6 K;  4OO1 J;  3H1V X;  2FSK A;  4TSX A;  1VSK A;  1RBT A;  5CHI A;  4FM0 A;  4KBO A;  3HP6 A;  4DFM A;  1BIS A;  1RT2 A;  3CC2 N;  1HR0 K;  3THX B;  1FKP A;  4FPA A;  4I9L A;  1Q8I A;  2X78 A;  2ASM A;  4JRP A;  1DTQ A;  3NCI A;  4CJK A;  3TAF A;  1K8K B;  3ZCM A;  1MDU B;  2HMP A;  4KV8 A;  4K42 A;  4GVM A;  4I9Q A;  4H4O A;  4YHH K;  4E0D A;  2P51 A;  4BVP A;  2X6S A;  5BRD A;  3VF2 A;  3OS2 A;  4JEP A;  1ZBS A;  1TUY A;  4QCL A;  3PX0 A;  4AHT A;  2AJQ A;  1XWL A;  2D4W A;  5E84 A;  1HNV A;  3C6H A;  1OVY A;  4GY2 B;  4WCE L;  3IG1 A;  4DMN A;  1BA1 A;  2HBM A;  1IKV A;  1HYS A;  2ZGZ A;  3H08 A;  3VA3 A;  2NLX A;  4GMJ B;  1CXU A;  1RNH A;  5J2M A;  4YDU C;  4GNI A;  2I7P A;  3SQ1 A;  5AQL A;  1KQS M;  3K5M A;  5C12 A;  1TL1 A;  4BGA A;  1RTH A;  3E01 A;  3HXM A;  3CCM N;  3MN9 A;  1HLU A;  1Q81 O;  1MWK A;  3ENO A;  4FL9 A;  1KTQ A;  1J6Z A;  4B3S K;  1NU0 A;  3H6E A;  4WQ5 C;  1JCG A;  2GWJ A;  3SK3 A;  4O5B A;  3O1B A;  1UOC A;  3ZX3 A;  1HYZ A;  4BRE A;  3W3D A;  1WBD A;  3U3Y A;  3TAE A;  3N4P A;  5I42 A;  4YOY A;  2UUB K;  4CBU A;  1IBM K;  2YI1 A;  3KD1 E;  1EP4 A;  4K8Z A;  1XQS C;  1SUQ A;  5ADX A;  3RSE A;  4B9U A;  2I7N A;  1VQN N;  1S22 A;  5BPN A;  3CI5 A;  2YKM A;  4X62 K;  2KLA A;  4BQZ A;  2ITG A;  2NNW A;  1LV5 A;  1BIU A;  1QQC A;  1VSM A;  2ASP A;  3NHG A;  3U6F A;  4IG3 A;  1JKH A;  4JI6 K;  4B3R K;  3IMX A;  1N5Y A;  1NJY A;  1Z05 A;  4JD2 A;  4FWR A;  5EOY A;  3N4Q A;  1S1T A;  3CPW M;  1DT9 A;  3CCV N;  2BGG A;  2Z1J A;  1P90 A;  3DLL L;  2V52 B;  4IKF A;  1BI4 A;  4JKH A;  4YOX A;  1YJ9 N;  4FJJ A;  4IEI A;  3SQ0 A;  1D5A A;  3LWL A;  3HT3 A;  1UAX A;  3F5T A;  3NE6 A;  2A3Z A;  4E1N A;  4DSE A;  1N33 K;  3C6T A;  4H5R A;  3WNE A;  3QNO A;  4NCG A;  3HPO A;  4BRN A;  5E41 A;  1Q7Y O;  3T3F A;  2WFB A;  5EU7 A;  4BDY A;  2GUP A;  2ZD1 A;  4FWS A;  4NCB A;  5KRT A;  4DSF A;  4DUY K;  4PL7 A;  4QS8 A;  3ZT3 A;  4DR2 K;  3SJH A;  3BUZ B;  4C8O A;  3RWU A;  2YHW A;  3VQ5 A;  2YHX A;  2PYJ A;  2FF3 B;  3KLI A;  2O8F A;  2E1Y A;  3SV4 A;  1WN7 A;  3RVC A;  3LP3 A;  2D0C A;  1FW6 A;  3LAL A;  1J5O A;  3V1Q A;  4HHT A;  1IBK K;  4CHZ A;  3V81 A;  3U3G A;  3SUO A;  3KJV A;  3MDQ A;  4OKK A;  3AO4 A;  3LAM A;  4CZE A;  3LDP A;  2I5J A;  3AVJ A;  3R9P A;  1BGX T;  3UKR B;  4B1Y B;  4CEA A;  4CJ5 A;  3L2U A;  2ATQ A;  4EHT A;  3FR0 A;  3P39 A;  4DSL A;  4U7B A;  3EZ5 A;  2YHB A;  3PLA A;  1N36 K;  4CK3 A;  3IFR A;  2F8S A;  2IGI A;  3KKR A;  4BE1 A;  3M8S A;  4A62 A;  3AA3 A;  4CW7 B;  3P5J A;  2PYL A;  3R8E A;  2AP1 A;  1ILY A;  4NB4 A;  2ZE2 A;  3HST B;  1H1V A;  3NH1 A;  2FF6 A;  3A0I X;  2QWM A;  2P9N A;  2F9W A;  2YNG A;  1E3M A;  2RN2 A;  1EQY A;  4FWM A;  2BTF A;  3ZSV A;  3FZH A;  1J9A A;  3S9H A;  3L3U A;  4EZ9 A;  3O4Q A;  2YNH A;  1ITG A;  1IV0 A;  1T6D A;  1U4B A;  2HHX A;  4KH4 A;  2GEM A;  3P83 D;  3I33 A;  1U45 A;  2HNZ A;  4LH4 A;  1LW0 A;  3L4I A;  1QSL A;  3C7N B;  4DTJ A;  4RG8 A;  5M1P A;  1MA9 B;  1NJX A;  3RMA A;  4RWT A;  3O4N A;  4BRC A;  4H0V B;  3SZ2 A;  3ZSR A;  3I55 N;  3GL1 A;  3E66 A;  1ESV A;  5CY4 A;  3HZ6 A;  1VRT A;  2GV9 A;  2XY7 A;  3ULD A;  4FZY A;  3BZC A;  4J2E A;  3O3H A;  1YIJ N;  3IAY A;  1Z6R A;  3K2P A;  1V4S A;  1U04 A;  1IKX A;  4A2A A;  1S6P A;  4E7H A;  4OLA A;  1R59 O;  4FM2 A;  4KRF A;  1WUA A;  4B1X B;  3BY5 A;  1OVQ A;  1WSI A;  2BH1 A;  3HOS A;  2QWL A;  1HNX K;  2IAJ A;  1UA1 A;  3QLH A;  4M3Y A;  1SS6 A;  4K0K K;  2GEL A;  2XO7 A;  4ILJ A;  4LSL A;  2XRI A;  4FJ7 A;  3S3O A;  3VEZ A;  2PY5 A;  1WAF A;  4FW1 A;  1X1P A;  1YIT N;  1M90 O;  3OVN A;  5EX5 A;  4E7L A;  1BCM A;  3TSU A;  1RT1 A;  1VSF A;  1DTT A;  4FLW A;  5AZJ A;  1F21 A;  4RCH A;  3MCA B;  3DRS A;  1YVU A;  4WE1 A;  4H5W A;  1TV6 A;  2Y1J A;  3CC7 N;  5KGW A;  1YXQ A;  4CJ3 A;  3ZET A;  5GAD P;  2IDO A;  3CJA A;  5AQX A;  1NK5 A;  1K8A O;  2RPI A;  4DV7 K;  2YHA A;  3UIQ A;  2P5O A;  2O8C B;  3RMC A;  1W9H A;  2HB5 A;  2OZM A;  4JRQ A;  4C23 A;  2YX6 A;  3MEE A;  2G8K A;  5BR9 A;  3HM8 A;  4CD1 A;  2A1R A;  3ALY A;  1ATR A;  1KFD A;  1U6Z A;  4C8M A;  3CME N;  4UQG A;  3P31 A;  3TAG A;  4E7J A;  1P8Z A;  2DPN A;  3L2R A;  4CZM A;  5KTQ A;  3VA0 A;  2O8D A;  5C24 A;  3T7Z A;  2D0O A;  4CBX A;  2WUS A;  4DFP A;  4JK9 A;  3T69 A;  4FJX A;  2Q97 A;  4Q0B A;  3CMA N;  4E1J A;  4CF0 A;  1A5W A;  1JCE A;  3VQA A;  1QVF M;  1KSP A;  1QTM A;  1C0M A;  3K58 A;  4B1V A;  1JCF A;  4DU1 A;  3QEI A;  3HSC A;  2QKB A;  4CGI A;  4BDZ A;  4CJQ A;  3QIC A;  1VAZ A;  1CZB A;  4OPA A;  1U49 A;  1ZBF A;  1N34 K;  3OYD A;  4BWJ A;  3LPU A;  5JMV A;  2JWL A;  4M3T A;  4DFK A;  1OH6 A;  1WSH A;  4W5Q A;  1OKJ A;  4F3T A;  1IKY A;  3DLB A;  3DJC A;  1L3T A;  4QOZ B;  1E4G T;  2BAN A;  4M3R A;  1NGD A;  3SUP A;  4DR3 K;  4OX9 K;  2XY5 A;  3G4S N;  1I3A A;  3M3Z A;  2P9S A;  3NMU A;  2XY8 A;  4CD3 A;  3GE1 A;  4CEZ A;  4BR7 A;  3I0R A;  3SPY A;  3ULE B;  4JKG A;  3V9U A;  4B3O A;  3QIO A;  4J2D A;  4CES A;  3OYG A;  3AVB A;  1OH8 A;  4CGH A;  3VPZ A;  3CC4 N;  3SBT A;  1VQ4 N;  3HL8 A;  2HVH A;  4LFB K;  1RDW X;  5M1N A;  4FVU A;  3D6R A;  4DWI A;  2DFE A;  3QIP A;  1S72 N;  4I2Q A;  3GBT A;  4Z0U A;  4XIU A;  3LDQ A;  4EZ6 A;  4G9Z A;  4A57 A;  2HND A;  4HCC A;  4E7K A;  2KTQ A;  4CEE A;  1OH7 A;  3NGY A;  1HNI A;  3THY B;  4IJN A;  4WYB A;  3PY8 A;  4DF4 A;  3TTD A;  2HVI A;  3O9Q A;  3CCJ N;  1N8R O;  3RMD A;  4NO7 A;  4PA1 A;  3NH0 A;  1WAJ A;  1S5J A;  4PHT X;  4KTW A;  4W5O A;  3ZSW A;  3LDO A;  2YNF A;  5HL7 L; 
#chains in the Genus database with same CATH homology
 3H08 A;  5CYM A;  3VA3 A;  4GMJ B;  2FBV A;  4DTS A;  2B6A A;  1CXU A;  4FLV A;  1NOZ A;  1RNH A;  3D0P A;  5J2M A;  3HJF A;  1NK6 A;  3V9S A;  4LY7 A;  4BE0 A;  3AVG A;  3SQ1 A;  1S9G A;  3IRX A;  5KI6 A;  3K5M A;  1TL1 A;  4Z4F A;  1RTH A;  3E01 A;  4CJ4 A;  3HXM A;  3SPZ A;  4BE2 A;  2E6M A;  4KHS A;  1D9F A;  1HMV A;  4B08 A;  3RTV A;  5HRR A;  4QAG A;  5J2N A;  3AVK A;  1RBR A;  4JS5 A;  1NK9 A;  1RT3 A;  4KHU A;  1VSI A;  4KTQ A;  3OYJ A;  1XI1 A;  4CGF A;  5HRS A;  3O3G A;  1KTQ A;  4O44 A;  4N47 A;  2D0A A;  3C6U A;  3OS0 A;  4AHS A;  4KHW A;  1FK9 A;  3OYE A;  4CJP A;  1C0U A;  1RCH A;  3QIN A;  3DM2 A;  4DTP A;  4KAZ A;  4DLE A;  3AA2 A;  4O5B A;  2X6N A;  3SUQ A;  4YFU A;  4ELT A;  4ZTJ A;  3OYA A;  1HRH A;  4N41 A;  1SV5 A;  3V1O A;  1UOC A;  1HYZ A;  1TAQ A;  1VSD A;  1L3U A;  3K5N A;  1RIL A;  3SV3 A;  1U48 A;  4FJK A;  4Q5V A;  1BL3 A;  3U3Y A;  4AHU A;  1IG9 A;  3JYT A;  3OJS A;  4M45 A;  3LP2 A;  1JL1 A;  3HVT A;  4Y1C A;  3TAM A;  3RRH A;  3TAE A;  1IO2 A;  4DFJ A;  5I42 A;  2B5J A;  1C0T A;  2E4L A;  2RKI A;  3KD1 E;  4CJW A;  1EP4 A;  4K8Z A;  5CYQ A;  1SUQ A;  3SI6 A;  3ZT0 A;  3KLF A;  4B9T A;  3T1A A;  2F8T A;  4CHN A;  1QE1 A;  4FK2 A;  2KZZ A;  4FZX C;  4B9U A;  4HUF A;  3ZSO A;  4E89 A;  1NK4 A;  4HUG A;  1JXE A;  1RT7 A;  3CFO A;  4OKJ A;  1S1V A;  2YKM A;  3ISN C;  3TAN A;  1TKD A;  3NAE A;  3WNH A;  4JS4 A;  5HRP A;  4PY5 A;  1L3V A;  3AO3 A;  1LV5 A;  1YT3 A;  2ITG A;  1ASU A;  1BIU A;  2EHG A;  3G10 A;  4CGJ A;  1QQC A;  1TL3 A;  4DTR A;  1VSM A;  2FC0 A;  3NHG A;  3TAB A;  2A1S A;  3U6F A;  2IOC A;  4IG3 A;  4Z4E A;  4DTX A;  3SUN A;  1JKH A;  4CJL A;  1JXB A;  3OYL A;  2KFZ A;  4C8K A;  4FCY A;  3NF6 A;  3RMB A;  2E6L A;  1W0H A;  2F96 A;  5CZ2 A;  3CFR A;  3V4I A;  1BQN A;  3S3N A;  3MXM A;  1NJY A;  1N5Y A;  3JSM A;  2G8F A;  4KB1 A;  4FK4 A;  1T7P A;  4RW6 A;  3PX6 A;  5HRO A;  1S1T A;  3NBP A;  4CHY A;  2BGG A;  1EXQ A;  3I0S A;  1CXQ A;  3B6O A;  4ZTF A;  4CK2 A;  2Z1J A;  4N56 A;  5J1E A;  3M8R A;  3ASM A;  1ZBI A;  4CJF A;  4DLG A;  1BI4 A;  4IKF A;  2HHU A;  4FJI A;  2P5G A;  1SKW A;  3AVH A;  1D5A A;  3SQ0 A;  4FJJ A;  2FBT A;  3LWL A;  1X9M A;  5D3G A;  3HT3 A;  3KLE A;  4OLB A;  1UAX A;  3VQ8 A;  2O4I A;  3NE6 A;  1EX4 A;  2VG5 A;  4E1N A;  1IH7 A;  4DSE A;  3AVI A;  4N76 A;  1RDA A;  3C6T A;  2QKK A;  4KI6 A;  1ZYQ A;  3OYC A;  4DQI A;  3WNE A;  5FRN A;  3QNO A;  1Z25 A;  4NCG A;  3K57 A;  4CGG A;  1VSE A;  3HPO A;  4KRE A;  3ZSZ A;  4CJV A;  5E41 A;  3T3F A;  5EU7 A;  1UWB A;  4F2S A;  1LW2 A;  4BDY A;  1TK5 A;  2ZD1 A;  4OKE A;  3K5L A;  3LZI A;  3QNN A;  4NCB A;  5KRT A;  3HVR A;  4FLZ A;  2G8I A;  4DSF A;  3AA5 X;  1KVA A;  2WON A;  4RW9 A;  3ZT3 A;  3AV9 A;  3AO5 A;  4IBN A;  4CFB A;  4CHQ A;  4C8O A;  3G0Z A;  4MQ3 A;  3RWU A;  4PWD A;  2KFN A;  3VQ5 A;  3QEV A;  1S1W A;  3K59 A;  3SQ4 A;  2PYJ A;  3ZSQ A;  4R5P A;  3KLI A;  3SV4 A;  3NDK A;  4BWM A;  4H4M A;  1NKB A;  1WN7 A;  1S9E A;  4NCA A;  2YKN A;  1TKX A;  1RBU A;  2VG7 A;  3LP3 A;  2D0C A;  3OYF A;  5HP1 A;  4RW4 A;  3LAL A;  1XHZ A;  3V1Q A;  4HHT A;  2DFF A;  1J5O A;  4CJU A;  4YNQ A;  4CHZ A;  4CF2 A;  3U3G A;  3V81 A;  3SUO A;  4O0I A;  4CEO A;  3KJV A;  4OKK A;  1Z26 A;  3AO4 A;  1EKE A;  3LAM A;  4LH5 A;  4M42 A;  3SQ2 A;  1JLB A;  4CK1 A;  2I5J A;  3AVJ A;  3OYK A;  1BGX T;  5J2P A;  4FJ8 A;  3VQE A;  4CEA A;  3VQ6 A;  4CFA A;  4M3W A;  4CJ5 A;  2OPQ A;  3L2U A;  1S1X A;  2ATQ A;  4KHQ A;  3I8D A;  1SKR A;  1IKW A;  2XY6 A;  3ZT1 A;  2PZS A;  4DSL A;  4B8C A;  4DTO A;  1D9D A;  3TAP A;  3L3V A;  1QHT A;  1SL0 A;  4FJ5 A;  2O4G A;  3EZ5 A;  4FK0 A;  4F3O A;  4FJL A;  4J2B A;  2OPP A;  1WSE A;  2YHB A;  3DOL A;  4FVM A;  5FRO A;  4CER A;  2G8W A;  1I39 A;  1TKZ A;  4W5N A;  1Q9X A;  3MXJ A;  4CK3 A;  5HRN A;  4I7F A;  3RRG A;  2IGI A;  2F8S A;  3KKR A;  4O0J A;  3OY9 A;  4BE1 A;  3QEP A;  3M8S A;  2GUI A;  3CM5 A;  3AA3 A;  1ASV A;  3P5J A;  2JLE A;  2PYL A;  2DTU A;  3PX4 A;  4MFB A;  4HTU A;  1T05 A;  2ZE2 A;  3HST B;  5KRS A;  1K6Y A;  4BAC A;  3NH1 A;  3DLG A;  1MU2 A;  4AHC A;  2JGU A;  1L5U A;  2G8H A;  2YNG A;  5HBM A;  4FJH A;  1REV A;  2RN2 A;  1T8E A;  4CJE A;  2YV0 X;  2OYQ A;  4Z4I A;  2KQ2 A;  4CJR A;  1BQM A;  4IDK A;  3KLG A;  3ZSV A;  4CJS A;  4OGE A;  1J9A A;  2BE2 A;  3NGZ A;  3CM6 A;  3S9H A;  4KHN A;  4CEC A;  4CF1 A;  3L8B A;  4FLX A;  1WLJ A;  3L3U A;  1XHX A;  4EZ9 A;  4DTM A;  2D5R A;  1GOB A;  2ZQB A;  3HP9 A;  2YNH A;  1ITG A;  3O4Q A;  3OS1 A;  3SYZ A;  3VQ9 A;  3ZT4 A;  3V9X A;  4Z4H A;  1RBS A;  3PV8 A;  1U4B A;  2HHX A;  3P83 D;  3DMJ A;  1NOY A;  3ZSY A;  2HNZ A;  1U45 A;  4LH4 A;  4OJR A;  1LW0 A;  3HPG A;  4CHP A;  3KK1 A;  4CGD A;  1QSL A;  4DTJ A;  3P1G A;  3F73 A;  3C94 A;  3LP0 A;  4CJT A;  4KO0 A;  4B9S A;  4RG8 A;  3AVM A;  5JS1 A;  1RBV A;  2HHS A;  4DQR A;  2KW4 A;  2DFH A;  4ICL A;  4NYF A;  3CYM A;  1KLM A;  2HNY A;  3RMA A;  2VWJ A;  1HJR A;  1NJX A;  3DRR A;  1NK0 A;  4FJN A;  5SZT A;  2KZM A;  2DY4 A;  2XHB A;  4CIE A;  3O4N A;  3SZ2 A;  1EET A;  3TWH A;  4CED A;  3S3M A;  1J53 A;  4GW6 A;  2QK9 A;  4KTZ A;  3ZSR A;  2ETJ A;  4K8X A;  1SL2 A;  3DLE A;  4F2R A;  3VQ4 A;  3DLK A;  5CY4 A;  3O3F A;  4AH9 A;  1UA0 A;  1VRT A;  4EP5 A;  1S6Q A;  2GV9 A;  4NYN A;  3HK2 A;  2XY7 A;  1VSL A;  2B4J A;  2HHV A;  3ULD A;  1TVR A;  1FXX A;  2EX3 A;  3NF8 A;  4FZY A;  4J2E A;  3CFP A;  1N6Q A;  2OZS A;  4FJG A;  3O3H A;  4KKO A;  3IAY A;  1U47 A;  1HPZ A;  3K2P A;  4DU3 A;  3LPT A;  3PO4 A;  1U04 A;  1IKX A;  3NGI A;  1A5X A;  1S6P A;  3VQD A;  4F4K A;  2P1J A;  3KLH A;  4IFY A;  1NK7 A;  4KPY A;  4B8A B;  4DTU A;  4E7H A;  4OLA A;  4LD0 A;  2HMI A;  4FM2 A;  4KRF A;  3THV A;  2OPR A;  3D45 A;  4DSK A;  3HYF A;  2X74 A;  3HPH A;  4PQU A;  1WSI A;  4DU4 A;  3K5O A;  2IAJ A;  1UA1 A;  3QLH A;  4M3Y A;  4PUO A;  3AVL A;  2XO7 A;  1Y97 A;  3V1R A;  4LSL A;  2XRI A;  4FJ7 A;  4ELU A;  1TGO A;  4DQS A;  1JLF A;  5FDL A;  1HQE A;  4I2P A;  2Y1I A;  3S3O A;  3A2F A;  4O4G A;  3QET A;  1RTD A;  2HHQ A;  2PY5 A;  1WAF A;  4FW1 A;  4IG0 A;  4ZHR A;  4FW2 A;  1HQU A;  1X1P A;  4HVJ A;  4FJ9 A;  1J54 A;  1NK8 A;  3OVN A;  1C6V A;  1LWC A;  4E7L A;  1BCM A;  1RTJ A;  1RT1 A;  1ASW A;  1VSF A;  1DTT A;  4DS5 A;  4FLW A;  5I3U A;  1F21 A;  1G15 A;  1JLQ A;  4G1Q A;  3DRP A;  1SL1 A;  3DOK A;  4FJM A;  5K14 A;  1B9D A;  4E7I A;  3AVA A;  5C42 A;  3DRS A;  1YVU A;  1A5V A;  4WE1 A;  1KRP A;  1TV6 A;  1ZBU A;  2Y1J A;  4J2A A;  2QXF A;  4ID1 A;  3DI6 A;  1CLQ A;  3NF9 A;  1WSF A;  2NUB A;  4IFV A;  1NJW A;  5KGW A;  3AO2 A;  3CG7 A;  3IS9 A;  2HHW A;  2VG6 A;  1FKO A;  1D8Y A;  1BCO A;  1JLE A;  4CJ3 A;  1RDC A;  4Y1D A;  1BIZ A;  2IDO A;  4OPK A;  4H8K A;  1TK8 A;  1L3S A;  2HW3 A;  4CF8 A;  1NK5 A;  2RPI A;  3M8Q A;  1JL2 A;  5CZ1 A;  2R7Y A;  4DQP A;  4FLY A;  3WNF A;  1QSY A;  2GBZ A;  4W5R A;  1B9F A;  3RR8 A;  2FBY A;  1BI4 B;  2YHA A;  3BGR A;  1SKS A;  4CFD A;  2P5O A;  3UIQ A;  4FYD A;  4HCB A;  1JLC A;  1WSJ A;  3RMC A;  1W9H A;  2HB5 A;  2Z1G A;  3AVF A;  5DMR A;  4JRQ A;  2OZM A;  1YTU A;  1C1A A;  1WSG A;  3MEE A;  2WOM A;  3KKS A;  2G8K A;  4EP4 A;  3TI0 A;  3B6P A;  4OPJ A;  2A1R A;  3ALY A;  4CCH A;  4CF9 A;  3HM9 A;  3L2W A;  4DTN A;  1KFD A;  1NKC A;  1JLA A;  3LP1 A;  4C8M A;  4HUE A;  4B9V A;  4UQG A;  3SJJ A;  4KFB A;  2IS3 A;  4FM1 A;  3TAG A;  4E7J A;  3PO5 A;  3FFI A;  3L2Q A;  3LAN A;  3L2R A;  4FLT A;  2G8U A;  3ITH A;  5KTQ A;  3WNG A;  3AA4 A;  3VA0 A;  4LSN A;  5C24 A;  1QS4 A;  4DS4 A;  4DFP A;  1NJZ A;  2YNI A;  1RT4 A;  1LAV A;  3ZSX A;  4E19 A;  4FJX A;  1C1C A;  4Q0B A;  3MAQ A;  4FXD A;  3MEG A;  3L2V A;  4CIG A;  4CF0 A;  1Q9Y A;  4CHO A;  3T19 A;  3PUF A;  1A5W A;  3KTQ A;  4CFC A;  3VQA A;  3CQ8 A;  1VSH A;  2Z1I A;  1X9S A;  2Q3S A;  4ELV A;  1KLN A;  3QER A;  1QTM A;  1KSP A;  1R0A A;  3RR7 A;  3QEX A;  1RDB A;  2OPS A;  2VWK A;  1C0M A;  1RDD A;  1TKT A;  4O55 A;  4AHR A;  3EYZ A;  1RTI A;  3K58 A;  4ID5 A;  4CIF A;  3NF7 A;  4DU1 A;  3QEI A;  2QKB A;  1X9W A;  4CGI A;  4BDZ A;  4W5T A;  4DG1 A;  3LWM A;  4CJQ A;  3AVN A;  4DSJ A;  4BDP A;  1CZB A;  1U49 A;  1NKE A;  3KIO A;  1TAU A;  1ZBF A;  3OYD A;  4BWJ A;  1KVC A;  4OVL A;  1KCF A;  3QEW A;  3LPU A;  3BDP A;  3V9W A;  3LAK A;  4C8N A;  4M3T A;  3EY1 A;  4Z4C A;  4DFK A;  1WSH A;  2BDP A;  4DSI A;  3AVC A;  4W5Q A;  2OA8 A;  4F3T A;  1IKY A;  1CZ9 A;  3DLB A;  1DLO A;  1RT6 A;  1L3T A;  4B9L A;  4QOZ B;  3QO9 A;  4DQQ A;  1LAW A;  1T03 A;  4B9M A;  5DK5 A;  1WNS A;  4RW7 A;  3V9Z A;  1S1U A;  1C1B A;  2BAN A;  4FLU A;  4M3R A;  4F8R A;  3SNN A;  4JLH A;  3SUP A;  1KFS A;  2XY5 A;  1I3A A;  3KK3 A;  1HYV A;  1VRU A;  2XY8 A;  3NH2 A;  4CEZ A;  2HHT A;  4L8R B;  5KGX A;  4M41 A;  1JLG A;  5C25 A;  3ZT2 A;  2Z1H A;  3V6D A;  2IC3 A;  3OYI A;  3I0R A;  1ZBH A;  1BHL A;  4CEQ A;  3SPY A;  4CE9 A;  2LSN A;  4E3S A;  2W42 A;  3V9U A;  1KVB A;  3OJU A;  4B3O A;  3QIO A;  4J2D A;  4CES A;  3OYG A;  3AVB A;  4TSX A;  4CGH A;  1VSK A;  3KK2 A;  3MXI A;  1LWE A;  4KB0 A;  3C95 A;  3M8P A;  1RBT A;  3HL8 A;  4CEB A;  3VQQ A;  2HVH A;  1YTA A;  1GOA A;  3DLR A;  3VQP A;  1VSJ A;  4CEF A;  3HP6 A;  4FM0 A;  4E1M A;  4DFM A;  4DWI A;  1QSS A;  2DFE A;  3F9K A;  3LDS A;  1BIS A;  1RT2 A;  3QIP A;  4M3X A;  4I2Q A;  4FZZ A;  4Z0U A;  4XIU A;  1FKP A;  1RT5 A;  1LWF A;  4EZ6 A;  4I9L A;  1Q8I A;  2HND A;  2D0B A;  2X78 A;  3TAR A;  4HCC A;  4E7K A;  3VQ7 A;  4N5S A;  4JRP A;  1DTQ A;  5JS2 A;  4CJK A;  3NCI A;  3TAF A;  4CEE A;  2KTQ A;  2FBX A;  3NGY A;  1HNI A;  3ZCM A;  4C8L A;  3OYH A;  3LZJ A;  1ZBL A;  3QES A;  4KV8 A;  3PY8 A;  4M3Z A;  3TR8 A;  3AO1 A;  4GVM A;  4DF4 A;  4I9Q A;  4H4O A;  3VQC A;  2HVI A;  4E0D A;  3NFA A;  4Z4G A;  2P51 A;  3HO1 A;  3MEC A;  2X6S A;  3RMD A;  4PA1 A;  3DLH A;  3NH0 A;  1GOC A;  1WAJ A;  3OS2 A;  4DF8 A;  3MED A;  3OYB A;  4RW8 A;  4AIL C;  4QCL A;  1S5J A;  4M3U A;  3PX0 A;  4AHT A;  1TK0 A;  3SCX A;  1O1W A;  3TAQ A;  4AHV A;  2AJQ A;  1XWL A;  4B9N A;  4KTW A;  4KHY A;  3DYA A;  3VN5 A;  1HNV A;  5J2Q A;  1VK0 A;  3OYM A;  3KD5 E;  4W5O A;  2G8V A;  2RF2 A;  3IG1 A;  4OGC A;  3OYN A;  4DMN A;  3ZSW A;  5FRM A;  1B92 A;  3VQB A;  1XC9 A;  1IKV A;  2YNF A;  5HLF A;  5T7B A;  1HYS A;  5SWM A;  4KI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...