3ZT0A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt0A00
2BGGA 4IFVA 3OVNA 3V1QA 1ZBLA 1ZBHA 3MXMA 4CGHA 1KVAA 4DLEA 1KVBA 1LWEA 5HRPA 1DLOA 2P5GA 1RCHA 3ZSQA 4FW2A 1NKCA 4L8RB 3DLEA 3LZJA 3VQDA 4M42A 3DYAA 4CHOA 1RDCA 2HMIA 1TV6A 4N76A 3AVCA 2BE2A 2IDOA 2HNYA 4WE1A 3P83D 4OGEA 4CEQA 4CFAA 2FBVA 4KFBA 4CJQA 1LWFA 4CFDA 3UIQA 4FJ5A 3HXMA 1VRTA 3HP6A 4E3SA 1I3AA 1N6QA 3PO5A 4DU1A 2YNGA 3DRSA 3KLHA 2P5OA 3H08A 1DTTA 4CE9A 5DMRA 1VSJA 4J2AA 3K5OA 2HHVA 3LP3A 3VQAA 4CJPA 4ID1A 4LH5A 1RTDA 3OS1A 4CFCA 3PX0A 2OPRA 2G8VA 4PY5A 4BWMA 1JL1A 4B8AB 1Q9YA 2HHQA 2Q3SA 1U48A 5DK5A 1U4BA 3NFAA 3OS2A 1ZBUA 4OGCA 2VG7A 4KO0A 2O4IA 1JXEA 3AA5X 4Z4FA 1CXQA 4E7HA 1A5VA 2HHSA 4KI6A 3AO2A 4CJ5A 4I2PA 1KFDA 3RMDA 4W5NA 3DMJA 4OJRA 1UOCA 4CK2A 3VQCA 4IG0A 2OPQA 4HHTA 3PV8A 4O0IA 4BDPA 1T03A 4FLVA 1NK6A 1S1XA 4E7LA 3ZCMA 4FLTA 2KQ2A 4MQ3A 2Z1JA 4M3RA 2XY7A 3PO4A 3P1GA 4UQGA 2QK9A 1BHLA 4KTQA 2PZSA 2HHWA 4M3WA 4LSNA 1WAFA 4OVLA 2G8HA 3WNHA 1LW0A 1RDDA 3DLGA 1HNIA 4E19A 4LSLA 4CJWA 4CCHA 1UAXA 1S9GA 5FROA 2E6MA 4B9TA 1RT1A 4NYFA 4CGIA 3O3HA 3L2QA 3AO3A 3TAEA 3V6DA 3V9ZA 4KREA 5HRNA 2KFZA 4FVMA 3SUOA 4DF4A 1KTQA 3KKSA 3NF8A 3K57A 3CFRA 1NKEA 1T8EA 4DTPA 3MXJA 2I5JA 1S1VA 3NAEA 2JGUA 5SZTA 3U6FA 1KSPA 3NGZA 1F21A 3KK1A 4ZTFA 4CEEA 4N47A 2F96A 3AVBA 3CG7A 4CECA 4B8CA 4CERA 3OJUA 1IG9A 4CJTA 4DSIA 2G8KA 4M3XA 2RPIA 1J53A 4J2EA 4FZZA 5D3GA 3L2VA 1C0TA 3I0SA 4C8MA 3NH2A 4DTRA 4QCLA 1BI4B 4CJFA 1ASVA 1BQMA 1RBRA 3LPUA 3IRXA 4CFBA 4FM2A 3A2FA 1FKPA 4YNQA 1HYVA 1O1WA 3QLHA 3SQ2A 4RW4A 1NJXA 4N41A 1SKSA 4CGGA 3OYCA 3HPOA 4DSJA 3NF9A 2OPPA 1QSLA 4DS5A 1DTQA 3AA3A 3CM6A 3SI6A 1RBSA 2R7YA 2WONA 3ZT2A 1TK8A 2X78A 1VSIA 1L3UA 1QTMA 1ZBIA 1WSIA 1S1UA 1L3VA 1EETA 1ZYQA 1NOYA 3O3FA 3HO1A 3ZSZA 4BE2A 3DRPA 4OKEA 4J2DA 4CEOA 3OYMA 3KLIA 1TGOA 4O55A 3F9KA 4DFPA 4DTOA 1FKOA 1RBUA 4DQQA 4FJ9A 1KRPA 4DQRA 4DF8A 2YNHA 3LALA 3TAMA 3S3OA 1RTHA 5HP1A 1CLQA 4KHQA 1KLNA 1D5AA 3QINA 2X6SA 2QKBA 2D0CA 2B4JA 4RW6A 3BGRA 3C95A 3DLRA 4CIGA 2HNZA 1X1PA 3LANA 1S6QA 3VN5A 4RG8A 3QIPA 3TANA 4IDKA 4M3UA 1W9HA 2LSNA 3AVIA 3CYMA 3NDKA 2KZZA 2HHUA 2YKNA 3M8QA 3LZIA 4MFBA 1VSMA 4ZTJA 4Z4HA 4LH4A 3NE6A 2PY5A 4B9LA 3OYEA 4GVMA 2D5RA 2PYJA 2YKMA 3G10A 4E0DA 4EP4A 3KLEA 3K2PA 4B3OA 2PYLA 4B9NA 4IFYA 4C8NA 4CJRA 3OYFA 4Z4CA 4Q0BA 3JSMA 3AVKA 1SL0A 4KTZA 4AHTA 3M8RA 1S6PA 1C0MA 2GV9A 3ZT3A 1QSYA 4GW6A 3OJSA 5HROA 1RTJA 3HVRA 3NGIA 1D9FA 1SL1A 3VQ9A 3V4IA 3V1OA 4K8XA 3IS9A 1RNHA 3K5MA 3SZ2A 4E89A 1HYZA 3AO4A 3RRHA 4DQIA 2ATQA 5E41A 3MECA 4M41A 3K5NA 3L2WA 2B5JA 1VSEA 3E01A 1NK8A 3B6PA 4FZXC 3DLKA 3TARA 4KV8A 4W5OA 2YV0X 1Q8IA 3FFIA 3LWLA 3THVA 1D9DA 2RF2A 2X74A 5J2MA 3T3FA 2Z1IA 3L2RA 2KTQA 4AHRA 1FXXA 3QEWA 1U49A 3ZSXA 1C0UA 1LAVA 2XY5A 4B9MA 3LP2A 4CJUA 2RN2A 1L3TA 3HL8A 3QERA 1SKRA 4H4OA 3AVHA 2O4GA 4KTWA 1JKHA 3OYJA 4CGDA 4CJVA 4ZHRA 1JLFA 3IAYA 2ZE2A 2KFNA 1KCFA 4IBNA 4AHCA 4FYDA 3HVTA 3RMBA 3D0PA 4CJKA 1BGXT 3KIOA 3V1RA 4N56A 3CQ8A 4DTNA 3QEIA 2Y1JA 4Z4EA 1QE1A 1QHTA 1W0HA 4FJLA 1BIUA 1HNVA 3VQEA 2HNDA 4PA1A 1WSFA 1TL1A 2IGIA 1RBVA 3AVAA 4BWJA 4E1MA 2Z1HA 4HTUA 2YNFA 3ULDA 4CHPA 5KTQA 4JRQA 2Y1IA 3HT3A 4KB0A 3HJFA 4C8OA 1VSLA 4Y1CA 1Q9XA 2YHBA 3O4QA 4AHVA 1UWBA 2FC0A 1C1AA 4FLZA 3KLFA 3QEXA 1TAUA 4F8RA 1TK0A 3DI6A 4H8KA 3SCXA 2E6LA 2HVIA 4BDYA 1NK4A 1ITGA 4E7KA 2NUBA 2A1SA 3ITHA 2B6AA 4RW8A 5CY4A 3V81A 1ASWA 1RBTA 3AVGA 3DLHA 3D45A 1NK7A 1GOAA 4PWDA 1B9FA 1HQEA 4HUFA 3SQ4A 2IC3A 4HVJA 4FJIA 4FJHA 4QAGA 1UA1A 3NH0A 3QNOA 1A5XA 3G0ZA 4I9LA 2XY8A 4DFJA 4KKOA 4JLHA 1NJWA 4DSLA 3RMCA 1IKXA 4KHSA 4Z0UA 1RTIA 1XWLA 1WSJA 3ZT0A 4DG1A 3OS0A 4NCGA 4M45A 2VWJA 3PUFA 2KW4A 1GOBA 5CZ2A 4Z4GA 1IKVA 4CHZA 3QIOA 3AVFA 4E1NA 4CF1A 4FZYA 3O3GA 4CGFA 1U45A 1NK5A 1TKZA 1YTAA 4NCAA 5JS1A 4DTMA 2DFFA 3AO5A 3ALYA 3AO1A 3DLBA 1NOZA 1LW2A 1KVCA 3S3MA 4HUEA 1S5JA 3V9XA 1JLCA 1RDBA 3KLGA 3QEPA 4KI4A 3SV3A 4FW1A 1LWCA 4RW7A 1J9AA 3HPGA 1I39A 1TAQA 1R0AA 2QKKA 3NF7A 3ZSOA 1VSKA 3SPYA 4CGJA 4FJMA 1BCMA 2P1JA 2X6NA 3PX6A 1UA0A 4B9UA 1RT3A 2DFHA 2FBYA 3MEEA 1RDAA 3I8DA 4FJKA 3OYAA 4HCCA 4AHUA 1HRHA 1S9EA 4PUOA 2DTUA 1B92A 3AVMA 4LY7A 4W5TA 3T1AA 5HRSA 1EP4A 1BCOA 4W5QA 4CEBA 2YHAA 3V9SA 4QOZB 3VQPA 3CFPA 1XHXA 1YTUA 1RT2A 1JXBA 3QO9A 1XC9A 4DSKA 1JLEA 3V9WA 2XRIA 5KRSA 3OYGA 4CJSA 2BDPA 1CZ9A 1RT5A 3LP1A 4CF9A 5SWMA 3TAGA 4EZ6A 3MAQA 2VG6A 3ZSVA 2E4LA 3KKRA 4KHYA 5KGWA 3KD1E 4OLAA 2F8SA 3DOLA 1LV5A 5KGXA 4FK2A 4CESA 1RT6A 4R5PA 4XIUA 4OLBA 4M3YA 4O44A 4CK3A 1K6YA 1XHZA 1U47A 2EX3A 4CHYA 4M3TA 3P5JA 4G1QA 1C1BA 3KJVA 1YVUA 4KHNA 3LP0A 4RW9A 1T7PA 3RWUA 2VG5A 5J2PA 3S3NA 4OKJA 4FK0A 2BANA 1BIZA 4F3TA 4H4MA 3QESA 5J2NA 2DY4A 1L3SA 3TAQA 1KFSA 1BISA 3MXIA 1BI4A 3LWMA 4GMJB 4FJ7A 1HMVA 3U3GA 4FM0A 1Z26A 2HB5A 4CJ4A 3B6OA 4DTXA 3TI0A 1WLJA 4KHWA 3NGYA 3NF6A 4DS4A 1WNSA 2KZMA 1TL3A 1WSGA 3OYLA 1EXQA 1SL2A 2RKIA 1IH7A 3VQ7A 3OYBA 1TKXA 5FDLA 4BDZA 1LAWA 1X9WA 3AA4A 3AVJA 4Z4IA 1D8YA 1HQUA 1TK5A 4B9VA 1RT4A 1QQCA 3SQ1A 3U3YA 2D0BA 1QSSA 4O4GA 5JS2A 3VQ4A 4CJLA 4DMNA 1IO2A 2DFEA 4EP5A 1G15A 2ETJA 3NCIA 3TAPA 2OA8A 1GOCA 3SV4A 2OPSA 5HBMA 3NH1A 2OYQA 4PQUA 5CYMA 4E7IA 3SPZA 2G8WA 2ZQBA 3EYZA 4DWIA 4F3OA 4Y1DA 4JRPA 3OYIA 4CF2A 4DU4A 1SKWA 1YT3A 3QNNA 1IKWA 4DU3A 3MEDA 3OY9A 4HCBA 4CHNA 3L3VA 1JLBA 4DLGA 5EU7A 1ZBFA 4BE1A 1NK9A 1NJZA 4JS5A 1C1CA 4FJNA 4CJ3A 3OYKA 4B9SA 1FK9A 4CEAA 1KLMA 1WN7A 3SQ0A 2XO7A 3VA0A 2P51A 1WSHA 1REVA 4FJXA 2W42A 5FRMA 4DSEA 4CF8A 3K59A 2ITGA 2GBZA 1NJYA 2ZD1A 4O0JA 4IKFA 3AA2A 2QXFA 3SUPA 2HHTA 4F2SA 5FRNA 3ASMA 3VA3A 4DFKA 4KAZA 3RTVA 4KHUA 3VQ6A 2GUIA 1J54A 3K58A 4BACA 4ELUA 3ZT4A 1X9SA 1T05A 3HP9A 3TABA 1X9MA 4B08A 4M3ZA 4I7FA 2OZMA 1NKBA 3CM5A 3AV9A 1N5YA 4ELVA 4OPJA 4CK1A 5C42A 1HPZA 4DTSA 4OKKA 1SV5A 3RR8A 4AILC 3OYDA 5K14A 2FBTA 1TVRA 1VK0A 3HYFA 2F8TA 3M8SA 4CIFA 3ZT1A 4CHQA 4K8ZA 4YFUA 3EZ5A 3SJJA 1Y97A 4NYNA 1CXUA 4FM1A 1BQNA 3MEGA 5KRTA 3OYHA 3F73A 3PY8A 3BDPA 4F4KA 3LAKA 4I9QA 4ELTA 2OZSA 4CF0A 4NCBA 4ID5A 3QEVA 4I2QA 3V9UA 4JS4A 1J5OA 3LPTA 4CEZA 3RMAA 3L3UA 5C25A 3RRGA 1CZBA 2G8FA 3ZSYA 3NHGA 1IKYA 2IAJA 5HLFA 3O4NA 4CIEA 1ASUA 1TKDA 2G8UA 3HPHA 3HM9A 2WOMA 4EZ9A 5C24A 3SNNA 2G8IA 3VQQA 5CZ1A 3I0RA 1VRUA 1NK0A 4FK4A 1U04A 1HYSA 3SUQA 2JLEA 4DQPA 4DTJA 3WNEA 3EY1A 2XHBA 3TR8A 3HK2A 4FJ8A 1MU2A 1QS4A 1SUQA 3WNFA 3KK3A 3M8PA 5CYQA 3WNGA 5I42A 3TWHA 3L8BA 4C8KA 2YNIA 3DOKA 3KTQA 3SYZA 3C6TA 4DSFA 1JLGA 3AVNA 1BL3A 4IG3A 1S1WA 4FLXA 1L5UA 1EX4A 2IS3A 2HVHA 3DM2A 3HSTB 3ISNC 4O5BA 4KB1A 2EHGA 1S1TA 3PX4A 4Q5VA 1A5WA 4DFMA 1TKTA 1VSHA 3LDSA 4E7JA 5J2QA 2HHXA 2VWKA 4LD0A 1JLAA 3TAFA 4DQSA 4BE0A 2XY6A 5KI6A 3DRRA 3KK2A 4F2RA 4KPYA 4FCYA 3RR7A 3L2UA 3KD5E 3S9HA 4CEFA 3AVLA 4J2BA 1JL2A 1HJRA 3VQ8A 4DTUA 1VSDA 4KRFA 4CJEA 3CFOA 4FLWA 1XI1A 4HUGA 1WAJA 1C6VA 4AHSA 4TSXA 3ZSRA 3IG1A 3JYTA 1WSEA 3ZSWA 4FLYA 1RILA 3QETA 3SUNA 2D0AA 5HRRA 4FJJA 3T19A 3VQ5A 3C94A 5J1EA 4FJGA 2HW3A 3K5LA 1B9DA 1EKEA 3OYNA 4FXDA 3LAMA 1Z25A 4W5RA 5I3UA 4CEDA 3NBPA 4N5SA 4C8LA 3C6UA 5T7BA 1JLQA 4ICLA 2A1RA 4OPKA 4AH9A 4FLUA 1RT7A 2AJQA 2Z1GA 2IOCA 2FBXA 1VSFA 3VQBA
chains in the Genus database with same CATH superfamily
3HOTA 4DV5K 3OVNA 1ZBLA 3J80O 3MXMA 2ZJQL 1LWEA 4A5BA 3GOIA 2VQFK 1OKJA 3AAPA 3LZJA 3O9SA 1MDUB 3CMEN 2HMIA 1TV6A 4LFBK 4CEQA 1NGDA 4CZEA 1N6QA 4YOTA 2FSJA 4BC3A 4DUYK 5GAGP 2ZJRL 3LP3A 4IOCL 3OS1A 3PX0A 1HKCA 4X66K 1U48A 5DK5A 1QZ6A 4OGCA 4KO0A 2O4IA 2NRXA 5M1OA 1GLEG 1WB9A 3BP8A 1A5VA 4CJ5A 1KFDA 4JI7K 4W5NA 4OJRA 3VQCA 4C1NI 2OPQA 4HHTA 3C7NA 4BDPA 1T03A 3PO4A 2KQ2A 2Z1JA 2D1KA 3D2FB 1MA9B 1WAFA 4JKHA 1JCGA 2J4RA 4E19A 1RFQA 4B9TA 3L2QA 1OVQA 3P38A 5HRNA 4FVMA 2E5LK 4FVUA 4G9ZA 3C6AA 3HZ6A 1KSPA 1VQPN 2FXUA 4JKCA 4ZTFA 2Q97A 4CEEA 3AVBA 5AQGA 4B8CA 4CJTA 1J53A 1IBKK 4J2EA 4QCLA 4DTRA 1YITN 4BRDA 1BQMA 3LPUA 2W41A 2Q31A 3QLHA 1V4SA 4RW4A 3OYCA 2NRWA 3L6QA 2R7YA 3D2EB 3GG4A 3ZT2A 1HNZK 4DV2K 5FPEA 3HO1A 4OKEA 1NM1A 3TSUA 3PSFA 2O8CA 4DF8A 2YNHA 3EKSA 3CXCM 1KLNA 2X6SA 2B4JA 3JYTA 3VN5A 1X1PA 4JI5K 1YXQA 3CERA 3QIPA 3TANA 4IDKA 3BZCA 1M1KO 5EXWA 2KZZA 3DJCA 2HHUA 3SAGA 3VF2A 1YAGA 1VSMA 2PY5A 2HBLA 5BR9A 4GVMA 3SAFA 3Q7CA 2YHXA 4Q0BA 2A6AA 3VF6A 3B8AX 1HUXA 1SL0A 4KTZA 3M8RA 4CZKA 1QSYA 5LL6Z 3V4IA 4A57A 4FWMA 1HYZA 3RRHA 2ATQA 3U8XA 3K5NA 3CQYA 5AQLA 3THYA 1QHAA 5C2DA 3THVA 3LWLA 3ZX0A 1U2VA 4FWRA 3OBWA 2GUPA 2YCHA 3L2RA 4AHRA 1LAVA 5MLCQ 2RN2A 3QERA 3TSPA 4H4OA 2VWBA 4L3QA 4KTWA 4CGDA 4CJVA 1V4TA 2P9KB 4PL7A 3RMBA 3D0PA 3AAQA 3KIOA 4PKHA 3V1RA 4CJKA 4N56A 3G71N 3G4SN 1S72N 2UUBK 1QHTA 1WSFA 4GKKK 2Y1IA 4DV4K 4CHPA 4JRQA 3VETA 4C8OA 1XQSC 3S41A 2YHBA 4QS9A 1TK0A 4H8KA 2E6LA 2V7YA 4EAHD 1T6CA 2P9UB 3UKRA 1ITGA 2NUBA 3ATVA 1SQKA 4AM6A 3FZKA 1B9FA 3CCQN 2IC3A 4H5RA 5AQZA 2P9SB 3VEVA 1UA1A 4I9LA 4JLHA 1NJWA 3PLAA 4Z0UA 3OS0A 4DG1A 4NCGA 2VWJA 1Y64A 2P9IB 1IKVA 4CHZA 4E1NA 1YUWA 3O3GA 1VQNN 3VGKA 4DTMA 3UE5A 1G99A 1NOZA 4HUEA 4DR4K 4RW7A 3NF7A 1VSKA 4CGJA 3GDQA 2V52B 2FBYA 3I8DA 4B1UB 4A62A 4AHUA 4HCCA 3UB5A 4PUOA 2DTUA 5AQKA 4W5QA 1BCOA 1EWRA 4JHDA 4ISEA 4YORA 3TPQA 4DR5K 4WQ5A 1VQ8N 3OA9A 1RT2A 3QO9A 4JAXA 4BR2A 1JLEA 5SWMA 3MAQA 3KKRA 3FE1A 4OLAA 1LV5A 1DGKN 4CESA 1RT6A 4R5PA 1Q7YO 4XIUA 4CK3A 4MDBA 3F2KA 2EX3A 1SS6A 5BRFA 2VCPA 4KHNA 4U7BA 2VG5A 3S3NA 2BANA 2QTDA 4A5AA 4DV0K 2DY4A 2V51B 4WFNL 3TAQA 1BISA 4BGAA 3U3GA 3CHWA 3CJ7A 1SAZA 3DAWA 3U9DA 4KHWA 3E1YA 4X64K 3BF3A 3OYLA 1S22A 3I8BA 2RKIA 4JNEA 3OYBA 5FDLA 5E84A 4BDZA 1Q18A 1D8YA 4B9VA 3IFRA 1RT4A 4O4GA 4KAZA 4CJLA 3TAPA 2DFEA 4BRGA 4BQLA 4NXNK 4JKEA 2ZGYA 3SPZA 2ASPA 2ZQBA 4DWIA 3OYIA 4CF2A 1YF5L 3QNNA 4DU3A 1NGEA 3MEDA 3F9MA 1MWKA 3IMXA 3ZEUB 1JLBA 1QQNA 5EU7A 4BE1A 1NJZA 2GTDA 4FJNA 4CJ3A 4B9SA 1VAZA 4K43A 3SQ0A 1RDUA 2P51A 5AZJB 4EHTA 1T44A 4AF1A 4BR4A 3K59A 4IOAL 5I9EB 1NJYA 1K73O 1NMNA 4YOYA 4AM7A 5JVHL 3VA3A 3LDOA 4ELUA 1X9SA 2HBJA 3R9PA 3TABA 4JI8K 3VEYA 4DTSA 1SV5A 1GLFO 5K14A 2FBTA 4X62K 4DB3A 5JICA 2F8TA 1YJ9N 4CIFA 3G6EN 3SJHA 2F4VK 3EZ5A 1NNEA 3SLCA 3W0LA 4F4KA 3F73A 4CJ7A 4BC5A 3KVGA 3V9UA 4JS4A 4JI4K 3L3UA 4DR6K 1K8AO 3MDQA 1IKYA 2E1YA 3SBGA 1Z05A 2WOMA 4EZ9A 5C24A 2CGLA 4YOUA 4B3SK 4FK4A 3SUQA 4CZIA 4DQPA 2HSTA 5IWAK 4FOIA 5LJWA 3WNFA 2QI2A 3BY5A 3KK3A 3WNGA 3WEEB 4C8KA 2YNIA 4JKGB 1GLJO 4BR0A 4DSFA 2IS3A 2A41A 3ISNC 4PKIA 5EVZA 1NWKA 5LMNK 2A5XA 4WQ4A 5J2QA 3KWGA 2FF3B 2VWKA 3LDLA 3PSIA 4LD0A 1K9MO 3TAFA 4BE0A 5KI6A 3DRRA 3KK2A 4F2RA 4GNIA 4WYBA 3VF4A 3AVLA 4WFAL 4B3MK 3DXMB 3VQ8A 3VTIA 4CJEA 4FLWA 1XI1A 4JI3K 1C6VA 4KH5A 3ULEA 4JI0K 3IG1A 4FLYA 4FJJA 3QETA 1JJ2M 3VEZA 1EO1A 3VQ5A 4FJGA 5EY4A 1VQKN 1EKEA 3OYNA 3LAMA 1Z25A 5EOYA 4CEDA 5AQWA 3AARA 1JLQA 4ICLA 3K0SA 2NRZA 4BRQA 2Z1GA 3QINA 2FBXA 1S1WA 3VQBA 4DV1K 4AQYK 1ZBHA 5AR0A 3ZETA 3CI5A 4CBXA 1KVBA 3GL1A 5HRPA 1DLOA 3A5OC 5AZIA 3DLEA 4M42A 4CHOA 5AQHA 4LF5K 2BE2A 2HNYA 3CPEA 3P83D 4OGEA 4CJQA 1VRTA 3HP6A 4E3SA 3C6HA 2P9LA 5C10A 1DTTA 4CE9A 4C1NK 3K5OA 3N4PA 2CGKA 4BWMA 2Q3SA 3R3LA 1XUPO 1W97L 2Q0UA 2VG7A 3AA5X 1CXQA 2RHKA 4KI6A 5AQYA 3P4IA 3DMJA 4CK2A 4IG0A 3CCJN 3PV8A 3DXKA 1NK6A 1W2BM 4IWVA 4JV5K 3E9LA 3EE9A 3P1GA 1BHLA 4KTQA 3ZLJA 4M3WA 4OVLA 2G8HA 2IVPA 3WNHA 1RDDA 3DLGA 4IFEA 3A5MC 4CJWA 5JLFA 2E6MA 3AO3A 3V6DA 3V9ZA 2KFZA 1GLDG 1BWFO 3CJAA 4DF4A 3NF8A 3K57A 1T8EA 4DTPA 1EQYA 2I5JA 1WBDA 1F21A 3LM9A 4N47A 4BROA 3H3NO 2G8KA 4PY5A 4YDUA 3I0SA 4C8MA 3NH2A 1VQ9N 2WFBA 3ULEB 4CJFA 4CFBA 3T1YK 4FM2A 1FKPA 2P9PA 4DUZK 1O1WA 4O8KA 2A3ZA 3BEXA 4CGGA 1MWMA 4DSJA 2OPPA 1M90O 4DV3K 1DTQA 3CM6A 3SI6A 1S3XA 2QM1A 1RGIA 4FWLA 1QTMA 2O8EA 1VSIA 1WSIA 1S1UA 3THWB 1ZYQA 4BRKA 3ZSZA 1XNRK 4J2DA 4PKGA 3KLIA 3WT0A 2QXLA 3F9KA 4H5WA 1FKOA 4FJ9A 3CMAN 2BUPA 3LALA 5BPLA 3O8MA 3R6MA 5AQFA 1VQ5N 2HNZA 2HMPA 1J6ZA 2LSNA 3AVIA 5HOOA 2YKNA 3I56N 4MFBA 4ZTJA 3NE6A 3LM2A 2NRVA 4B9LA 1QVGM 2VYPA 4B3OA 4OO1J 5FPNA 4AHTA 1C0MA 1C0GA 5BR8K 3OJSA 5HROA 3NGIA 3IS9A 1RNHA 3AO4A 1GLBG 1GLCG 4MLEA 4DV6K 3R8EA 2B5JA 4FZXC 1NK8A 1T6DA 4KV8A 1D9DA 5TKYA 3EEQA 4BQZA 3T3FA 4X65K 3QEWA 2WC9A 3QBXA 4CJUA 3HL8A 1SKRA 5BN8A 1JKHA 4JI1K 3OYJA 1JLFA 2ZE2A 5AQIA 1KCFA 1X3NA 5BREA 2KFNA 3FFKB 4FYDA 3HVTA 5C15A 3A0IX 1BGXT 4BRIA 2IVOA 2UXDK 5AQQA 3VQEA 4PA1A 1VHXA 3AVAA 2IGIA 4H0YB 1RBVA 3M5RA 4BWJA 4E1MA 4HTUA 3ULDA 3U4LA 1SKSA 1NBWA 1ZC6A 1Q9XA 3O4QA 5JMVA 1FW6A 4F8RA 4E7KA 3ITHA 2B6AA 5F0XA 5CY4A 1X9JA 1GOAA 3GE1A 1KQSM 4FJHA 3CIPA 3G0ZA 2OTLN 4DFJA 1DEJA 4DSLA 4KHSA 5DM6L 4M45A 4XH4A 2KW4A 3ZX3A 3A5NC 4MDAA 1BDGA 4CF1A 4H5NA 1K8KB 1NK5A 4YOWA 4NCAA 4BRLA 1LW2A 3PIPL 1S5JA 1JLCA 3KLGA 1LWCA 4FWKA 1I39A 3WQTA 1VQLN 2P1JA 4K0KK 1RT3A 4MLHA 4WQ4C 4FJKA 1BO5O 3AVMA 5HRSA 1EP4A 3ATUA 2YHAA 1OVYA 4QOZB 1YTUA 1XC9A 5AQPA 3OYGA 4MO5A 4EZ6A 3HOSA 3EO3A 4KHYA 3KD1E 4FK2A 2NRRA 1BA1A 4JKFA 4B1YB 1FJGK 4O44A 5AFUH 4DR7K 2CGJA 2D4WA 4CBUA 3CCSN 3I55N 3KJVA 4B9QA 1NGCA 3L0QA 3CCMN 3VEWA 2AP1A 4F3TA 3CJCA 5J2NA 3FZMA 1L3SA 1YIJN 1BI4A 3LWMA 1HMVA 4NXMK 2HB5A 2OANA 4CJ4A 3B6OA 4DTXA 3TI0A 1QZ5A 3NF6A 5FLXO 4DS4A 3HTVA 1TL3A 1EXQA 3SMSA 3VQ7A 1OH6A 4FWPA 3AVJA 4M7YA 3C7NB 3U3YA 4DMNA 1ZBSA 4U67L 2OPSA 3NH1A 2OYQA 1QQOA 2E2NA 4K25A 2KLAA 3IUCA 4F3OA 3EYZA 4JRPA 4Y0WA 2PAVA 2W40A 1NGFA 5TKWA 3FZFA 2VGNA 5ADXH 4CHNA 5KPZA 4BRAA 1ZBFA 1C1CA 2QWRA 4H0VB 4CEAA 4JKDA 1WSHA 1REVA 2W42A 5FRMA 4IJNA 4CF8A 2GBZA 1TYQA 3DLLL 4JN4A 2ZD1A 4IKFA 4FWNA 2QXFA 4O8UA 3SUPA 2ASOA 1N36K 5FRNA 1CZAN 1NGHA 4IEIA 4DR1K 4FSVA 1X9MA 3AV9A 4ELVA 3EN9A 1HPZA 3CD6N 1VQ7N 4I6MA 4ILJA 4A61A 4WF9L 1TVRA 3H3OB 2E2OA 2ITMA 3GBTA 3SJJA 2FLOA 2O8CB 4NYNA 4CD1A 5AFUA 3PY8A 4YDUC 3KZBA 2OZSA 3VPZA 2QWQA 2P9NA 3LPTA 3PIOL 1I94K 4B1XB 1NMDA 1DKGD 4QS8A 3CC7N 1NGGA 2FF6A 4FL9A 3HPHA 2G8UA 3SNNA 3VQQA 2QEXN 1HYSA 1JCEA 4CZJA 4FJ8A 3CCVN 5JVGL 3VMFB 5I42A 3L8BA 3DOKA 3QFPA 3SYZA 1NG9A 1JLGA 1BL3A 2EHGA 1S1TA 3PX4A 1A5WA 3THYB 1TKTA 4JI6K 1VSHA 5CR4A 3LDSA 3VGLA 3C0BA 4E7JA 3O1BA 1U2VB 4H0OA 1WBBA 5ADXA 4BC4A 4H5TA 4FCYA 3S9HA 1TUYA 4J2BA 2O8FA 3QMLA 3KK7A 1VSDA 3QBWA 2BTFA 3RSEA 1YVNA 3R1XA 4MO4A 1KD1O 4AHSA 1P90A 5A2QO 1RILA 5HRRA 1BU6O 3T19A 2HW3A 3C94A 1HR0K 5AQRA 3NVMA 3K5LA 1HLUA 3MN5A 2O8DA 5I3UA 3OW2M 5KQ8A 5CE3A 3UKRB 2HF4A 2AJQA 1VSFA 2BGGA 4IFVA 4CGHA 3IKMA 4IDHA 3WXKA 1RCHA 4L8RB 3O4WA 4UY8O 4N76A 3AVCA 2IDOA 4WE1A 4CFAA 4EFHA 4KFBA 3CQXA 4BG8A 1XNQK 1I3AA 3PO5A 2NRHA 1Q81O 2YNGA 3KLHA 2P5OA 4YY3K 5DMRA 1VSJA 4HWIA 4CJPA 4ID1A 1RTDA 4CZMA 2D0PA 2HBKA 3MMVA 2G8VA 4B8AB 1JL1A 1XC3A 2HHQA 1U4BA 1ZBUA 3K9JA 4IEEA 4BR5A 4WCEL 2E2QA 4Z4FA 4E7HA 2HHSA 3AO2A 2YJFA 4JK8A 4I2PA 3U9ZA 2A40A 1D4XA 4CBWA 3RMDA 1WUAA 4JHDB 4ISFA 1E4GT 4FLVA 3ZX2A 3O5BA 4KBOA 4MQ3A 4GV6A 4UQGA 5IT9O 4JI2K 3VESA 3AGRA 3THXA 2O8BA 3FLCO 4PHTX 1LW0A 3CJ9A 1HNIA 4CCHA 4LSLA 3Q7BA 1UAXA 3WXLA 3CPWM 4CGIA 3TAEA 2QW9A 3SUOA 1NKEA 3MXJA 3H6EA 1S1VA 3VEOA 3U6FA 2WTUA 2FSKA 3NGZA 1NGBA 3KK1A 4CECA 4I9QA 3CG7A 2QA4N 4M7XA 4M3XA 4BVPA 3L2VA 1ASVA 3IRXA 4DQ8A 3EE8A 3A2FA 4YNQA 3O9QA 4BC2A 4N41A 3HPOA 3NF9A 3WXMB 3OTOK 5GIPA 4DS5A 4GKJK 1LCUA 1RBSA 2WONA 1ZBIA 2QWMA 4FWOA 4BE2A 3DRPA 3OYMA 1TGOA 4NLBA 4O55A 4DFPA 4DTOA 4DQQA 1KRPA 4DQRA 1RTHA 2QKBA 1IG8A 2D0CA 1GLAG 4E1JA 3DLRA 3LANA 4RG8A 3J8AA 3CYMA 1KAZA 4Z4HA 2D5RA 3G10A 3K2PA 4YHHK 4BGBA 2NRTA 2PYLA 3OYFA 4CJRA 4Z4CA 3QICA 3JSMA 1S6PA 2GV9A 3UKUA 4GW6A 1SL1A 3V1OA 5FPMA 3O9UA 3K5MA 2V7ZA 4E89A 3H45C 4DQIA 2UYTA 3MECA 2CH6A 3E01A 4C23A 3DLKA 3TARA 4W5OA 2YV0X 1Q8IA 2X74A 4ISGA 5J2MA 2Z1IA 2ZJPL 2KTQA 1FXXA 2Q2RA 3ZSXA 1C0UA 2BH1A 2XY5A 2JWKA 3AVHA 1HKGA 2NZTA 4ZHRA 1C0FA 2NNWA 4H03B 4IBNA 4AHCA 3J7AP 2QWPA 1Q82O 5AQOA 1IJJA 3MX2A 1QE1A 4FJLA 1BIUA 2VGMA 1HNVA 2HNDA 1TL1A 4FJXA 2Z1HA 2YNFA 5KTQA 3HT3A 5AQMA 1VSLA 4Y1CA 4PL8A 4KH4A 4AHVA 1C1AA 5B8HA 4FLZA 3WXIA 3I33A 4V19S 3DI6A 4BR9A 2HVIA 4JD2A 1NK4A 4LF4K 4RW8A 1ASWA 3TTDA 3D45A 1NK7A 4PWDA 4NB4A 1OH7A 2E88A 3NH0A 2XY8A 3D7EO 4KKOA 1X3MA 4JEPA 3RMCA 1WSJA 5CZ2A 4CW7B 5F1XA 4Z4GA 4DR2K 3M3ZA 3QIOA 4FZYA 4CGFA 1U45A 5JS1A 3HBTA 2DFFA 4FOEA 3SAHA 4WQ5C 3ALYA 3AO1A 2E8AA 1KVCA 4LFCK 2WBNA 1RDBA 4KI4A 5M1NA 4H5VA 1R0AA 2QKKA 4BRCA 3SPYA 4FJMA 1BCMA 3PX6A 1UA0A 5AQSA 4B9UA 2Q1NA 2DFHA 1HRHA 1HNXK 4LY7A 4W5TA 3T1AA 2ASMA 5CHIA 5GAHP 1IBMK 3CFPA 1JXBA 4DSKA 2BDPA 4CVNE 2XRIA 5KRSA 1QQMA 4H0XB 4CJSA 3ZETB 1RT5A 3LP1A 4CF9A 3TAGA 3D2FA 3TTCA 2VG6A 3H46O 5AZIB 3DOLA 5KGXA 1N32K 1U6ZA 1OH5A 4OLBA 4M3YA 5KPTA 1K6YA 4IO9L 1U47A 4M3TA 4CHYA 2P9LB 3O6WA 4G1QA 4KH6A 2HOEA 5F2RA 5J2PA 3QESA 3C65A 3MXIA 4GMJB 4NO7A 1Z26A 1WLJA 4BRNA 1WNSA 1WSGA 1TKXA 1LAWA 3AA4A 4Z4IA 2UU9K 1HQUA 3DXKB 4BY9C 1E3MA 3D2EA 1QQCA 4LF8K 2D0BA 3VQ4A 4JD2B 1G15A 2ETJA 1HPMA 3SV4A 5HBMA 4B3TK 4Z94A 4PQUA 2G8WA 3NVKA 1SKWA 1YT3A 2YHWA 3OY9A 3L3VA 3MN6A 3E9OA 1IBLK 4DLGA 3BZKA 4EHUA 5AJ3K 4JS5A 3WXJA 1KLMA 2YJEA 3E9PA 3CCEN 3DWLA 4BG9A 4DKWA 5LY3A 2A42A 4O0JA 3ZYYX 2OTJN 3TSQA 3P31A 4F2SA 2P9PB 3VQ6A 3K58A 4BACA 4JK9A 1T05A 3HP9A 2DPNA 4B08A 4M3ZA 4I7FA 2OZMA 3CM5A 1N5YA 4OPJA 4CK1A 4OKKA 2QWNA 3BUZB 3RR8A 2O8EB 4A2BA 3M8SA 4ILGB 2UXBK 4YFUA 2GELA 1Y97A 1CXUA 4FM1A 5KRTA 3BDPA 4K41A 4ELTA 4NCBA 4ID5A 3QEVA 1XMOK 1J5OA 3RMAA 5C25A 2P9KA 1ZXOA 1CZBA 3O1WA 3RRGA 3QFUA 4CIEA 1ASUA 3HM9A 4IJAA 1NGIA 2G8IA 5CZ1A 3FZHA 4NLCA 2JLEA 3LL3A 3WNEA 4LFAK 3EY1A 2XHBA 3HK2A 1MU2A 1QS4A 4IO8A 3M8PA 3TWHA 3KTQA 2P9UA 3C6TA 1L5UA 2HVHA 3HSTB 4O5BA 1QVFM 3MWPA 4DFMA 5AQVA 2P9SA 3J7YP 3VERA 2HHXA 3ID6A 2W6KA 3SBTA 2GX9A 1JLAA 4CZFA 2P9IA 3G25A 4KPYA 1JL2A 3W3DA 1EWQA 4KRFA 3CETA 3A5LC 1WAJA 2YX6A 1E4FT 3ZSRA 1WSEA 3ZSWA 2D0AA 5C2FA 2QWOA 5J1EA 4BREA 3VOVA 1NGAA 3J7ZO 2ZGZA 2JWLA 4FXDA 2E1ZA 3CJBA 5BRHA 1JCFA 5T7BA 1BOTO 4HTLA 2A1RA 4AH9A 4FLUA 3MK6A 3SMPA 2HF3A 3ENHA 3AGKA 3V1QA 4B1ZA 1KVAA 3EZWA 4DLEA 1NJIO 2AA4A 4LF6K 2F7TA 3JXUA 3VENA 2P5GA 1VQ6N 3ZSQA 4FW2A 1NKCA 4KHPK 4H0PA 3VQDA 5KPRA 3DYAA 1RDCA 1BG3A 3IAYA 4CFDA 2FBVA 1N8RO 4FWSA 1LWFA 3UIQA 3HI0A 2H3GX 4FJ5A 3HXMA 1RDWX 4DU1A 3DRSA 3FR0A 3H08A 4J2AA 4DR3K 2HHVA 4LF7K 3VQAA 4LH5A 2GWJA 3MN7A 4CFCA 4BRPA 2OPRA 1Q9YA 3D6RA 2YI1A 3NFAA 3P39A 4CZHA 3OS2A 3ENBA 3MCPA 3CC2N 3T1HK 1JXEA 3L4IA 1UOCA 5H1SQ 1XMQK 1HX1A 4O0IA 3CF5L 4GV9A 1S1XA 4E7LA 3ZCMA 4FLTA 2XY7A 4M3RA 2QK9A 2PZSA 2HHWA 4RWTA 4LSNA 4O5FA 2YHYA 4XH1A 1S9GA 5AQNA 5FROA 1RT1A 4NYFA 3O3HA 4QS7A 5GIOA 3ZEUA 4KREA 1BUPA 1KTQA 3KKSA 3VTHA 3CFRA 4EIAA 3NAEA 2JGUA 5SZTA 5AZJA 4YOXA 1IG9A 3OJUA 2F96A 4DSIA 4CERA 2RPIA 4FZZA 2PBDA 5D3GA 1C0TA 1DT9A 1BI4B 1RBRA 3HM8A 1HYVA 3SQ2A 3J81O 1HJOA 1NJXA 2UUAK 4IXCA 4K42A 1ILYA 1QSLA 2ZM6K 2W6LA 1WOQA 3AA3A 4LC9B 3O9RA 3JS6A 1TK8A 2X78A 1L3UA 1L3VA 1EETA 1NOYA 3O3FA 4CEOA 1HNWK 1RBUA 2PFUA 1YJNN 3TAMA 3S3OA 1CLQA 5HP1A 4KHQA 1D5AA 4RW6A 3BGRA 3C95A 4CI6A 4CIGA 1S6QA 2F9TA 3MX5A 5FPDA 4R79A 4M3UA 3LDPA 1W9HA 1NU0A 3NDKA 2UUCK 3VEXA 3M8QA 3LZIA 4LH4A 5HL7L 2VQEK 3OYEA 2HBMA 2PYJA 2YKMA 4E0DA 1TYQB 4EP4A 3KLEA 3MCAB 3VGMA 3NMUA 4B9NA 4IFYA 4C8NA 2ZWHA 3AVKA 3WEEA 3MN9A 4JKGA 3ZT3A 3LDNA 1D9FA 1RTJA 3HVRA 1HKBA 3VQ9A 3SZ2A 5JLHA 1OH8A 5E41A 4FPAA 4I6MB 4M41A 5ELZA 3L2WA 3H1QA 3OHRA 1VSEA 4K8XA 3B6PA 3IDHA 3FFIA 2RF2A 1U49A 4DHYA 4B9MA 3LP2A 3CC4N 2IIRA 1L3TA 1IV0A 3DXMA 4ILHA 2O4GA 2P9NB 1J5EK 3EL2A 4JK7A 1YHQN 3OBYA 3E66A 4DTNA 3CQ8A 5BPNA 3QEIA 2Y1JA 4Z4EA 1W0HA 4B1VA 4J8FA 5C12A 4KB0A 3HJFA 1UWBA 2FC0A 3KLFA 3QEXA 1TAUA 4GY2B 3SCXA 3ENOA 1KC8O 4BDYA 3O80A 2A1SA 3V81A 1RBTA 3AVGA 3QDKA 3DLHA 5AQJA 4BRMA 1HQEA 4HUFA 3SQ4A 4FJIA 4HVJA 4QAGA 3QNOA 1A5XA 2WUSA 2ZF5O 5BRDA 5BN9A 3CJ1A 1IKXA 3ZT0A 1RTIA 1XWLA 2RE2A 5AQXA 1BA0A 3PUFA 1GOBA 4OPAA 3A8YA 4H0TB 2Q36A 1GLLO 1ATRA 2Q0RA 3AVFA 2O8FB 1TKZA 1YTAA 1ESVA 4A2AA 1YJWN 4BVOA 3AO5A 3RSEB 3DLBA 3CCUN 3S3MA 3V9XA 3QEPA 3KHYA 4XEIA 4B3RK 5M1FA 3SV3A 1KAYA 4FW1A 1J9AA 3HPGA 1TAQA 3ZSOA 5AQUA 1VQON 4LF9K 3K9KA 2X6NA 2O8DB 3MEEA 1RDAA 3OYAA 2F9WA 5M1QA 1S9EA 1B92A 4CEBA 4GV3A 3V9SA 3QB0A 3VQPA 1XHXA 5M1PA 3V9WA 3N4QA 5AQTA 4CZLA 1CZ9A 3ZSVA 2E4LA 5KGWA 4CD3A 2F8SA 3M1FA 3EKUA 3FGUA 4F9OA 5GAEP 3O08A 4CZGA 1XHZA 3BF1A 3F5TA 3O9TA 3P5JA 1C1BA 1VQMN 2KHOA 4YOVA 1YVUA 3LP0A 4RW9A 1T7PA 3HRGA 3RWUA 1N33K 4FK0A 4OKJA 1BIZA 4H4MA 4OPHA 3T7ZA 5BPMA 1W7AA 1KFSA 4FJ7A 4FM0A 4BRHA 3NGYA 3CCRN 2KZMA 3T69A 1SL2A 3MWTA 1IH7A 4JKAA 3SK3A 1X9WA 5M1KA 1TK5A 3ID8A 3SQ1A 1QSSA 5JS2A 1LOTB 1IO2A 4FWQA 4EP5A 3NCIA 3THWA 2OA8A 2E2PA 1NLVA 5C0YA 1GOCA 4JKBA 2O8BB 3THXB 5LMUK 5CYMA 4E7IA 4FO0A 4Y1DA 4DU4A 4BR7A 1IKWA 2I7PA 5E26A 4HCBA 2UXCK 2QWLA 2IVNA 4WFBL 2CH5A 1NK9A 3OYKA 1FK9A 5EX5A 1WN7A 2XO7A 3VA0A 2E20A 3KWIA 4M63C 3L4QA 4DCHA 4DSEA 3LDQA 4A59A 2FSNA 2ITGA 2NLXA 3AA2A 5GADP 2HHTA 3ASMA 4DFKA 3RTVA 4KHUA 2GUIA 1J54A 3TU5A 3ZT4A 1P8ZA 1NGJA 4IOXA 1YI2N 4DV7K 1NKBA 5C42A 1T3VA 1Q86O 4AILC 3OYDA 4OX9K 3WQUA 1VK0A 3HYFA 4XH5A 3ZT1A 4CHQA 4K8ZA 1VQ4N 1BQNA 3MEGA 3OYHA 3LAKA 3HSCA 4CF0A 4I2QA 4CEZA 2G8FA 3ZSYA 3NHGA 2IAJA 5HLFA 3O4NA 1TKDA 3I0RA 1VRUA 1NK0A 1U04A 2OCEA 4DTJA 2D0OA 3H1VX 3TR8A 1SUQA 2GEMA 5CYQA 3JAMO 3RVCA 1KAXA 3UKUB 3TTFA 3M6GA 1N34K 3AVNA 4IG3A 4FLXA 4JYAK 1EX4A 3DM2A 1SZ2A 5DM7L 4KB1A 4Q5VA 2I7NA 4RTFD 5LJVA 1ATNA 1TUUA 4FPBA 4DQSA 2XY6A 5GINA 4B1WB 3CCLN 3L2UA 3RR7A 3KD5E 4CEFA 1K8KA 3AY9A 1HJRA 2GWKA 4DTUA 1O13A 2KKZA 3CFOA 4RCHA 4BRFA 4HUGA 3WUHA 1H1VA 4TSXA 3SUNA 3FZLA 1KXPA 2EWSA 4GVEA 1B9DA 4W5RA 4IZ9A 3NBPA 4N5SA 4C8LA 1Z6RA 2HHHK 3C6UA 4OPKA 1ATSA 1RT7A 1R59O 2IOCA 5KQDA
chains in the Genus database with same CATH topology
2BGGA 4IFVA 3OVNA 3V1QA 1ZBLA 1ZBHA 3MXMA 4CGHA 1KVAA 4DLEA 1KVBA 1LWEA 5HRPA 1DLOA 2P5GA 1RCHA 3ZSQA 4FW2A 1NKCA 4L8RB 3DLEA 3LZJA 3VQDA 4M42A 3DYAA 4CHOA 1RDCA 2HMIA 1TV6A 4N76A 3AVCA 2BE2A 2IDOA 2HNYA 4WE1A 3P83D 4OGEA 4CEQA 4CFAA 2FBVA 4KFBA 4CJQA 1LWFA 4CFDA 3UIQA 4FJ5A 3HXMA 1VRTA 3HP6A 4E3SA 1I3AA 1N6QA 3PO5A 4DU1A 2YNGA 3DRSA 3KLHA 2P5OA 3H08A 1DTTA 4CE9A 5DMRA 1VSJA 4J2AA 3K5OA 2HHVA 3LP3A 3VQAA 4CJPA 4ID1A 4LH5A 1RTDA 3OS1A 4CFCA 3PX0A 2OPRA 2G8VA 4PY5A 4BWMA 1JL1A 4B8AB 1Q9YA 2HHQA 2Q3SA 1U48A 5DK5A 1U4BA 3NFAA 3OS2A 1ZBUA 4OGCA 2VG7A 4KO0A 2O4IA 1JXEA 3AA5X 4Z4FA 1CXQA 4E7HA 1A5VA 2HHSA 4KI6A 3AO2A 4CJ5A 4I2PA 1KFDA 3RMDA 4W5NA 3DMJA 4OJRA 1UOCA 4CK2A 3VQCA 4IG0A 2OPQA 4HHTA 3PV8A 4O0IA 4BDPA 1T03A 4FLVA 1NK6A 1S1XA 4E7LA 3ZCMA 4FLTA 2KQ2A 4MQ3A 2Z1JA 4M3RA 2XY7A 3PO4A 3P1GA 4UQGA 2QK9A 1BHLA 4KTQA 2PZSA 2HHWA 4M3WA 4LSNA 1WAFA 4OVLA 2G8HA 3WNHA 1LW0A 1RDDA 3DLGA 1HNIA 4E19A 4LSLA 4CJWA 4CCHA 1UAXA 1S9GA 5FROA 2E6MA 4B9TA 1RT1A 4NYFA 4CGIA 3O3HA 3L2QA 3AO3A 3TAEA 3V6DA 3V9ZA 4KREA 5HRNA 2KFZA 4FVMA 3SUOA 4DF4A 1KTQA 3KKSA 3NF8A 3K57A 3CFRA 1NKEA 1T8EA 4DTPA 3MXJA 2I5JA 1S1VA 3NAEA 2JGUA 5SZTA 3U6FA 1KSPA 3NGZA 1F21A 3KK1A 4ZTFA 4CEEA 4N47A 2F96A 3AVBA 3CG7A 4CECA 4B8CA 4CERA 3OJUA 1IG9A 4CJTA 4DSIA 2G8KA 4M3XA 2RPIA 1J53A 4J2EA 4FZZA 5D3GA 3L2VA 1C0TA 3I0SA 4C8MA 3NH2A 4DTRA 4QCLA 1BI4B 4CJFA 1ASVA 1BQMA 1RBRA 3LPUA 3IRXA 4CFBA 4FM2A 3A2FA 1FKPA 4YNQA 1HYVA 1O1WA 3QLHA 3SQ2A 4RW4A 1NJXA 4N41A 1SKSA 4CGGA 3OYCA 3HPOA 4DSJA 3NF9A 2OPPA 1QSLA 4DS5A 1DTQA 3AA3A 3CM6A 3SI6A 1RBSA 2R7YA 2WONA 3ZT2A 1TK8A 2X78A 1VSIA 1L3UA 1QTMA 1ZBIA 1WSIA 1S1UA 1L3VA 1EETA 1ZYQA 1NOYA 3O3FA 3HO1A 3ZSZA 4BE2A 3DRPA 4OKEA 4J2DA 4CEOA 3OYMA 3KLIA 1TGOA 4O55A 3F9KA 4DFPA 4DTOA 1FKOA 1RBUA 4DQQA 4FJ9A 1KRPA 4DQRA 4DF8A 2YNHA 3LALA 3TAMA 3S3OA 1RTHA 5HP1A 1CLQA 4KHQA 1KLNA 1D5AA 3QINA 2X6SA 2QKBA 2D0CA 2B4JA 4RW6A 3BGRA 3C95A 3DLRA 4CIGA 2HNZA 1X1PA 3LANA 1S6QA 3VN5A 4RG8A 3QIPA 3TANA 4IDKA 4M3UA 1W9HA 2LSNA 3AVIA 3CYMA 3NDKA 2KZZA 2HHUA 2YKNA 3M8QA 3LZIA 4MFBA 1VSMA 4ZTJA 4Z4HA 4LH4A 3NE6A 2PY5A 4B9LA 3OYEA 4GVMA 2D5RA 2PYJA 2YKMA 3G10A 4E0DA 4EP4A 3KLEA 3K2PA 4B3OA 2PYLA 4B9NA 4IFYA 4C8NA 4CJRA 3OYFA 4Z4CA 4Q0BA 3JSMA 3AVKA 1SL0A 4KTZA 4AHTA 3M8RA 1S6PA 1C0MA 2GV9A 3ZT3A 1QSYA 4GW6A 3OJSA 5HROA 1RTJA 3HVRA 3NGIA 1D9FA 1SL1A 3VQ9A 3V4IA 3V1OA 4K8XA 3IS9A 1RNHA 3K5MA 3SZ2A 4E89A 1HYZA 3AO4A 3RRHA 4DQIA 2ATQA 5E41A 3MECA 4M41A 3K5NA 3L2WA 2B5JA 1VSEA 3E01A 1NK8A 3B6PA 4FZXC 3DLKA 3TARA 4KV8A 4W5OA 2YV0X 1Q8IA 3FFIA 3LWLA 3THVA 1D9DA 2RF2A 2X74A 5J2MA 3T3FA 2Z1IA 3L2RA 2KTQA 4AHRA 1FXXA 3QEWA 1U49A 3ZSXA 1C0UA 1LAVA 2XY5A 4B9MA 3LP2A 4CJUA 2RN2A 1L3TA 3HL8A 3QERA 1SKRA 4H4OA 3AVHA 2O4GA 4KTWA 1JKHA 3OYJA 4CGDA 4CJVA 4ZHRA 1JLFA 3IAYA 2ZE2A 2KFNA 1KCFA 4IBNA 4AHCA 4FYDA 3HVTA 3RMBA 3D0PA 4CJKA 1BGXT 3KIOA 3V1RA 4N56A 3CQ8A 4DTNA 3QEIA 2Y1JA 4Z4EA 1QE1A 1QHTA 1W0HA 4FJLA 1BIUA 1HNVA 3VQEA 2HNDA 4PA1A 1WSFA 1TL1A 2IGIA 1RBVA 3AVAA 4BWJA 4E1MA 2Z1HA 4HTUA 2YNFA 3ULDA 4CHPA 5KTQA 4JRQA 2Y1IA 3HT3A 4KB0A 3HJFA 4C8OA 1VSLA 4Y1CA 1Q9XA 2YHBA 3O4QA 4AHVA 1UWBA 2FC0A 1C1AA 4FLZA 3KLFA 3QEXA 1TAUA 4F8RA 1TK0A 3DI6A 4H8KA 3SCXA 2E6LA 2HVIA 4BDYA 1NK4A 1ITGA 4E7KA 2NUBA 2A1SA 3ITHA 2B6AA 4RW8A 5CY4A 3V81A 1ASWA 1RBTA 3AVGA 3DLHA 3D45A 1NK7A 1GOAA 4PWDA 1B9FA 1HQEA 4HUFA 3SQ4A 2IC3A 4HVJA 4FJIA 4FJHA 4QAGA 1UA1A 3NH0A 3QNOA 1A5XA 3G0ZA 4I9LA 2XY8A 4DFJA 4KKOA 4JLHA 1NJWA 4DSLA 3RMCA 1IKXA 4KHSA 4Z0UA 1RTIA 1XWLA 1WSJA 3ZT0A 4DG1A 3OS0A 4NCGA 4M45A 2VWJA 3PUFA 2KW4A 1GOBA 5CZ2A 4Z4GA 1IKVA 4CHZA 3QIOA 3AVFA 4E1NA 4CF1A 4FZYA 3O3GA 4CGFA 1U45A 1NK5A 1TKZA 1YTAA 4NCAA 5JS1A 4DTMA 2DFFA 3AO5A 3ALYA 3AO1A 3DLBA 1NOZA 1LW2A 1KVCA 3S3MA 4HUEA 1S5JA 3V9XA 1JLCA 1RDBA 3KLGA 3QEPA 4KI4A 3SV3A 4FW1A 1LWCA 4RW7A 1J9AA 3HPGA 1I39A 1TAQA 1R0AA 2QKKA 3NF7A 3ZSOA 1VSKA 3SPYA 4CGJA 4FJMA 1BCMA 2P1JA 2X6NA 3PX6A 1UA0A 4B9UA 1RT3A 2DFHA 2FBYA 3MEEA 1RDAA 3I8DA 4FJKA 3OYAA 4HCCA 4AHUA 1HRHA 1S9EA 4PUOA 2DTUA 1B92A 3AVMA 4LY7A 4W5TA 3T1AA 5HRSA 1EP4A 1BCOA 4W5QA 4CEBA 2YHAA 3V9SA 4QOZB 3VQPA 3CFPA 1XHXA 1YTUA 1RT2A 1JXBA 3QO9A 1XC9A 4DSKA 1JLEA 3V9WA 2XRIA 5KRSA 3OYGA 4CJSA 2BDPA 1CZ9A 1RT5A 3LP1A 4CF9A 5SWMA 3TAGA 4EZ6A 3MAQA 2VG6A 3ZSVA 2E4LA 3KKRA 4KHYA 5KGWA 3KD1E 4OLAA 2F8SA 3DOLA 1LV5A 5KGXA 4FK2A 4CESA 1RT6A 4R5PA 4XIUA 4OLBA 4M3YA 4O44A 4CK3A 1K6YA 1XHZA 1U47A 2EX3A 4CHYA 4M3TA 3P5JA 4G1QA 1C1BA 3KJVA 1YVUA 4KHNA 3LP0A 4RW9A 1T7PA 3RWUA 2VG5A 5J2PA 3S3NA 4OKJA 4FK0A 2BANA 1BIZA 4F3TA 4H4MA 3QESA 5J2NA 2DY4A 1L3SA 3TAQA 1KFSA 1BISA 3MXIA 1BI4A 3LWMA 4GMJB 4FJ7A 1HMVA 3U3GA 4FM0A 1Z26A 2HB5A 4CJ4A 3B6OA 4DTXA 3TI0A 1WLJA 4KHWA 3NGYA 3NF6A 4DS4A 1WNSA 2KZMA 1TL3A 1WSGA 3OYLA 1EXQA 1SL2A 2RKIA 1IH7A 3VQ7A 3OYBA 1TKXA 5FDLA 4BDZA 1LAWA 1X9WA 3AA4A 3AVJA 4Z4IA 1D8YA 1HQUA 1TK5A 4B9VA 1RT4A 1QQCA 3SQ1A 3U3YA 2D0BA 1QSSA 4O4GA 5JS2A 3VQ4A 4CJLA 4DMNA 1IO2A 2DFEA 4EP5A 1G15A 2ETJA 3NCIA 3TAPA 2OA8A 1GOCA 3SV4A 2OPSA 5HBMA 3NH1A 2OYQA 4PQUA 5CYMA 4E7IA 3SPZA 2G8WA 2ZQBA 3EYZA 4DWIA 4F3OA 4Y1DA 4JRPA 3OYIA 4CF2A 4DU4A 1SKWA 1YT3A 3QNNA 1IKWA 4DU3A 3MEDA 3OY9A 4HCBA 4CHNA 3L3VA 1JLBA 4DLGA 5EU7A 1ZBFA 4BE1A 1NK9A 1NJZA 4JS5A 1C1CA 4FJNA 4CJ3A 3OYKA 4B9SA 1FK9A 4CEAA 1KLMA 1WN7A 3SQ0A 2XO7A 3VA0A 2P51A 1WSHA 1REVA 4FJXA 2W42A 5FRMA 4DSEA 4CF8A 3K59A 2ITGA 2GBZA 1NJYA 2ZD1A 4O0JA 4IKFA 3AA2A 2QXFA 3SUPA 2HHTA 4F2SA 5FRNA 3ASMA 3VA3A 4DFKA 4KAZA 3RTVA 4KHUA 3VQ6A 2GUIA 1J54A 3K58A 4BACA 4ELUA 3ZT4A 1X9SA 1T05A 3HP9A 3TABA 1X9MA 4B08A 4M3ZA 4I7FA 2OZMA 1NKBA 3CM5A 3AV9A 1N5YA 4ELVA 4OPJA 4CK1A 5C42A 1HPZA 4DTSA 4OKKA 1SV5A 3RR8A 4AILC 3OYDA 5K14A 2FBTA 1TVRA 1VK0A 3HYFA 2F8TA 3M8SA 4CIFA 3ZT1A 4CHQA 4K8ZA 4YFUA 3EZ5A 3SJJA 1Y97A 4NYNA 1CXUA 4FM1A 1BQNA 3MEGA 5KRTA 3OYHA 3F73A 3PY8A 3BDPA 4F4KA 3LAKA 4I9QA 4ELTA 2OZSA 4CF0A 4NCBA 4ID5A 3QEVA 4I2QA 3V9UA 4JS4A 1J5OA 3LPTA 4CEZA 3RMAA 3L3UA 5C25A 3RRGA 1CZBA 2G8FA 3ZSYA 3NHGA 1IKYA 2IAJA 5HLFA 3O4NA 4CIEA 1ASUA 1TKDA 2G8UA 3HPHA 3HM9A 2WOMA 4EZ9A 5C24A 3SNNA 2G8IA 3VQQA 5CZ1A 3I0RA 1VRUA 1NK0A 4FK4A 1U04A 1HYSA 3SUQA 2JLEA 4DQPA 4DTJA 3WNEA 3EY1A 2XHBA 3TR8A 3HK2A 4FJ8A 1MU2A 1QS4A 1SUQA 3WNFA 3KK3A 3M8PA 5CYQA 3WNGA 5I42A 3TWHA 3L8BA 4C8KA 2YNIA 3DOKA 3KTQA 3SYZA 3C6TA 4DSFA 1JLGA 3AVNA 1BL3A 4IG3A 1S1WA 4FLXA 1L5UA 1EX4A 2IS3A 2HVHA 3DM2A 3HSTB 3ISNC 4O5BA 4KB1A 2EHGA 1S1TA 3PX4A 4Q5VA 1A5WA 4DFMA 1TKTA 1VSHA 3LDSA 4E7JA 5J2QA 2HHXA 2VWKA 4LD0A 1JLAA 3TAFA 4DQSA 4BE0A 2XY6A 5KI6A 3DRRA 3KK2A 4F2RA 4KPYA 4FCYA 3RR7A 3L2UA 3KD5E 3S9HA 4CEFA 3AVLA 4J2BA 1JL2A 1HJRA 3VQ8A 4DTUA 1VSDA 4KRFA 4CJEA 3CFOA 4FLWA 1XI1A 4HUGA 1WAJA 1C6VA 4AHSA 4TSXA 3ZSRA 3IG1A 3JYTA 1WSEA 3ZSWA 4FLYA 1RILA 3QETA 3SUNA 2D0AA 5HRRA 4FJJA 3T19A 3VQ5A 3C94A 5J1EA 4FJGA 2HW3A 3K5LA 1B9DA 1EKEA 3OYNA 4FXDA 3LAMA 1Z25A 4W5RA 5I3UA 4CEDA 3NBPA 4N5SA 4C8LA 3C6UA 5T7BA 1JLQA 4ICLA 2A1RA 4OPKA 4AH9A 4FLUA 1RT7A 2AJQA 2Z1GA 2IOCA 2FBXA 1VSFA 3VQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BGG A;  4IFV A;  3OVN A;  3V1Q A;  1ZBL A;  1ZBH A;  3MXM A;  4CGH A;  1KVA A;  4DLE A;  1KVB A;  1LWE A;  5HRP A;  1DLO A;  2P5G A;  1RCH A;  3ZSQ A;  4FW2 A;  1NKC A;  4L8R B;  3DLE A;  3LZJ A;  3VQD A;  4M42 A;  3DYA A;  4CHO A;  1RDC A;  2HMI A;  1TV6 A;  4N76 A;  3AVC A;  2BE2 A;  2IDO A;  2HNY A;  4WE1 A;  3P83 D;  4OGE A;  4CEQ A;  4CFA A;  2FBV A;  4KFB A;  4CJQ A;  1LWF A;  4CFD A;  3UIQ A;  4FJ5 A;  3HXM A;  1VRT A;  3HP6 A;  4E3S A;  1I3A A;  1N6Q A;  3PO5 A;  4DU1 A;  2YNG A;  3DRS A;  3KLH A;  2P5O A;  3H08 A;  1DTT A;  4CE9 A;  5DMR A;  1VSJ A;  4J2A A;  3K5O A;  2HHV A;  3LP3 A;  3VQA A;  4CJP A;  4ID1 A;  4LH5 A;  1RTD A;  3OS1 A;  4CFC A;  3PX0 A;  2OPR A;  2G8V A;  4PY5 A;  4BWM A;  1JL1 A;  4B8A B;  1Q9Y A;  2HHQ A;  2Q3S A;  1U48 A;  5DK5 A;  1U4B A;  3NFA A;  3OS2 A;  1ZBU A;  4OGC A;  2VG7 A;  4KO0 A;  2O4I A;  1JXE A;  3AA5 X;  4Z4F A;  1CXQ A;  4E7H A;  1A5V A;  2HHS A;  4KI6 A;  3AO2 A;  4CJ5 A;  4I2P A;  1KFD A;  3RMD A;  4W5N A;  3DMJ A;  4OJR A;  1UOC A;  4CK2 A;  3VQC A;  4IG0 A;  2OPQ A;  4HHT A;  3PV8 A;  4O0I A;  4BDP A;  1T03 A;  4FLV A;  1NK6 A;  1S1X A;  4E7L A;  3ZCM A;  4FLT A;  2KQ2 A;  4MQ3 A;  2Z1J A;  4M3R A;  2XY7 A;  3PO4 A;  3P1G A;  4UQG A;  2QK9 A;  1BHL A;  4KTQ A;  2PZS A;  2HHW A;  4M3W A;  4LSN A;  1WAF A;  4OVL A;  2G8H A;  3WNH A;  1LW0 A;  1RDD A;  3DLG A;  1HNI A;  4E19 A;  4LSL A;  4CJW A;  4CCH A;  1UAX A;  1S9G A;  5FRO A;  2E6M A;  4B9T A;  1RT1 A;  4NYF A;  4CGI A;  3O3H A;  3L2Q A;  3AO3 A;  3TAE A;  3V6D A;  3V9Z A;  4KRE A;  5HRN A;  2KFZ A;  4FVM A;  3SUO A;  4DF4 A;  1KTQ A;  3KKS A;  3NF8 A;  3K57 A;  3CFR A;  1NKE A;  1T8E A;  4DTP A;  3MXJ A;  2I5J A;  1S1V A;  3NAE A;  2JGU A;  5SZT A;  3U6F A;  1KSP A;  3NGZ A;  1F21 A;  3KK1 A;  4ZTF A;  4CEE A;  4N47 A;  2F96 A;  3AVB A;  3CG7 A;  4CEC A;  4B8C A;  4CER A;  3OJU A;  1IG9 A;  4CJT A;  4DSI A;  2G8K A;  4M3X A;  2RPI A;  1J53 A;  4J2E A;  4FZZ A;  5D3G A;  3L2V A;  1C0T A;  3I0S A;  4C8M A;  3NH2 A;  4DTR A;  4QCL A;  1BI4 B;  4CJF A;  1ASV A;  1BQM A;  1RBR A;  3LPU A;  3IRX A;  4CFB A;  4FM2 A;  3A2F A;  1FKP A;  4YNQ A;  1HYV A;  1O1W A;  3QLH A;  3SQ2 A;  4RW4 A;  1NJX A;  4N41 A;  1SKS A;  4CGG A;  3OYC A;  3HPO A;  4DSJ A;  3NF9 A;  2OPP A;  1QSL A;  4DS5 A;  1DTQ A;  3AA3 A;  3CM6 A;  3SI6 A;  1RBS A;  2R7Y A;  2WON A;  3ZT2 A;  1TK8 A;  2X78 A;  1VSI A;  1L3U A;  1QTM A;  1ZBI A;  1WSI A;  1S1U A;  1L3V A;  1EET A;  1ZYQ A;  1NOY A;  3O3F A;  3HO1 A;  3ZSZ A;  4BE2 A;  3DRP A;  4OKE A;  4J2D A;  4CEO A;  3OYM A;  3KLI A;  1TGO A;  4O55 A;  3F9K A;  4DFP A;  4DTO A;  1FKO A;  1RBU A;  4DQQ A;  4FJ9 A;  1KRP A;  4DQR A;  4DF8 A;  2YNH A;  3LAL A;  3TAM A;  3S3O A;  1RTH A;  5HP1 A;  1CLQ A;  4KHQ A;  1KLN A;  1D5A A;  3QIN A;  2X6S A;  2QKB A;  2D0C A;  2B4J A;  4RW6 A;  3BGR A;  3C95 A;  3DLR A;  4CIG A;  2HNZ A;  1X1P A;  3LAN A;  1S6Q A;  3VN5 A;  4RG8 A;  3QIP A;  3TAN A;  4IDK A;  4M3U A;  1W9H A;  2LSN A;  3AVI A;  3CYM A;  3NDK A;  2KZZ A;  2HHU A;  2YKN A;  3M8Q A;  3LZI A;  4MFB A;  1VSM A;  4ZTJ A;  4Z4H A;  4LH4 A;  3NE6 A;  2PY5 A;  4B9L A;  3OYE A;  4GVM A;  2D5R A;  2PYJ A;  2YKM A;  3G10 A;  4E0D A;  4EP4 A;  3KLE A;  3K2P A;  4B3O A;  2PYL A;  4B9N A;  4IFY A;  4C8N A;  4CJR A;  3OYF A;  4Z4C A;  4Q0B A;  3JSM A;  3AVK A;  1SL0 A;  4KTZ A;  4AHT A;  3M8R A;  1S6P A;  1C0M A;  2GV9 A;  3ZT3 A;  1QSY A;  4GW6 A;  3OJS A;  5HRO A;  1RTJ A;  3HVR A;  3NGI A;  1D9F A;  1SL1 A;  3VQ9 A;  3V4I A;  3V1O A;  4K8X A;  3IS9 A;  1RNH A;  3K5M A;  3SZ2 A;  4E89 A;  1HYZ A;  3AO4 A;  3RRH A;  4DQI A;  2ATQ A;  5E41 A;  3MEC A;  4M41 A;  3K5N A;  3L2W A;  2B5J A;  1VSE A;  3E01 A;  1NK8 A;  3B6P A;  4FZX C;  3DLK A;  3TAR A;  4KV8 A;  4W5O A;  2YV0 X;  1Q8I A;  3FFI A;  3LWL A;  3THV A;  1D9D A;  2RF2 A;  2X74 A;  5J2M A;  3T3F A;  2Z1I A;  3L2R A;  2KTQ A;  4AHR A;  1FXX A;  3QEW A;  1U49 A;  3ZSX A;  1C0U A;  1LAV A;  2XY5 A;  4B9M A;  3LP2 A;  4CJU A;  2RN2 A;  1L3T A;  3HL8 A;  3QER A;  1SKR A;  4H4O A;  3AVH A;  2O4G A;  4KTW A;  1JKH A;  3OYJ A;  4CGD A;  4CJV A;  4ZHR A;  1JLF A;  3IAY A;  2ZE2 A;  2KFN A;  1KCF A;  4IBN A;  4AHC A;  4FYD A;  3HVT A;  3RMB A;  3D0P A;  4CJK A;  1BGX T;  3KIO A;  3V1R A;  4N56 A;  3CQ8 A;  4DTN A;  3QEI A;  2Y1J A;  4Z4E A;  1QE1 A;  1QHT A;  1W0H A;  4FJL A;  1BIU A;  1HNV A;  3VQE A;  2HND A;  4PA1 A;  1WSF A;  1TL1 A;  2IGI A;  1RBV A;  3AVA A;  4BWJ A;  4E1M A;  2Z1H A;  4HTU A;  2YNF A;  3ULD A;  4CHP A;  5KTQ A;  4JRQ A;  2Y1I A;  3HT3 A;  4KB0 A;  3HJF A;  4C8O A;  1VSL A;  4Y1C A;  1Q9X A;  2YHB A;  3O4Q A;  4AHV A;  1UWB A;  2FC0 A;  1C1A A;  4FLZ A;  3KLF A;  3QEX A;  1TAU A;  4F8R A;  1TK0 A;  3DI6 A;  4H8K A;  3SCX A;  2E6L A;  2HVI A;  4BDY A;  1NK4 A;  1ITG A;  4E7K A;  2NUB A;  2A1S A;  3ITH A;  2B6A A;  4RW8 A;  5CY4 A;  3V81 A;  1ASW A;  1RBT A;  3AVG A;  3DLH A;  3D45 A;  1NK7 A;  1GOA A;  4PWD A;  1B9F A;  1HQE A;  4HUF A;  3SQ4 A;  2IC3 A;  4HVJ A;  4FJI A;  4FJH A;  4QAG A;  1UA1 A;  3NH0 A;  3QNO A;  1A5X A;  3G0Z A;  4I9L A;  2XY8 A;  4DFJ A;  4KKO A;  4JLH A;  1NJW A;  4DSL A;  3RMC A;  1IKX A;  4KHS A;  4Z0U A;  1RTI A;  1XWL A;  1WSJ A;  3ZT0 A;  4DG1 A;  3OS0 A;  4NCG A;  4M45 A;  2VWJ A;  3PUF A;  2KW4 A;  1GOB A;  5CZ2 A;  4Z4G A;  1IKV A;  4CHZ A;  3QIO A;  3AVF A;  4E1N A;  4CF1 A;  4FZY A;  3O3G A;  4CGF A;  1U45 A;  1NK5 A;  1TKZ A;  1YTA A;  4NCA A;  5JS1 A;  4DTM A;  2DFF A;  3AO5 A;  3ALY A;  3AO1 A;  3DLB A;  1NOZ A;  1LW2 A;  1KVC A;  3S3M A;  4HUE A;  1S5J A;  3V9X A;  1JLC A;  1RDB A;  3KLG A;  3QEP A;  4KI4 A;  3SV3 A;  4FW1 A;  1LWC A;  4RW7 A;  1J9A A;  3HPG A;  1I39 A;  1TAQ A;  1R0A A;  2QKK A;  3NF7 A;  3ZSO A;  1VSK A;  3SPY A;  4CGJ A;  4FJM A;  1BCM A;  2P1J A;  2X6N A;  3PX6 A;  1UA0 A;  4B9U A;  1RT3 A;  2DFH A;  2FBY A;  3MEE A;  1RDA A;  3I8D A;  4FJK A;  3OYA A;  4HCC A;  4AHU A;  1HRH A;  1S9E A;  4PUO A;  2DTU A;  1B92 A;  3AVM A;  4LY7 A;  4W5T A;  3T1A A;  5HRS A;  1EP4 A;  1BCO A;  4W5Q A;  4CEB A;  2YHA A;  3V9S A;  4QOZ B;  3VQP A;  3CFP A;  1XHX A;  1YTU A;  1RT2 A;  1JXB A;  3QO9 A;  1XC9 A;  4DSK A;  1JLE A;  3V9W A;  2XRI A;  5KRS A;  3OYG A;  4CJS A;  2BDP A;  1CZ9 A;  1RT5 A;  3LP1 A;  4CF9 A;  5SWM A;  3TAG A;  4EZ6 A;  3MAQ A;  2VG6 A;  3ZSV A;  2E4L A;  3KKR A;  4KHY A;  5KGW A;  3KD1 E;  4OLA A;  2F8S A;  3DOL A;  1LV5 A;  5KGX A;  4FK2 A;  4CES A;  1RT6 A;  4R5P A;  4XIU A;  4OLB A;  4M3Y A;  4O44 A;  4CK3 A;  1K6Y A;  1XHZ A;  1U47 A;  2EX3 A;  4CHY A;  4M3T A;  3P5J A;  4G1Q A;  1C1B A;  3KJV A;  1YVU A;  4KHN A;  3LP0 A;  4RW9 A;  1T7P A;  3RWU A;  2VG5 A;  5J2P A;  3S3N A;  4OKJ A;  4FK0 A;  2BAN A;  1BIZ A;  4F3T A;  4H4M A;  3QES A;  5J2N A;  2DY4 A;  1L3S A;  3TAQ A;  1KFS A;  1BIS A;  3MXI A;  1BI4 A;  3LWM A;  4GMJ B;  4FJ7 A;  1HMV A;  3U3G A;  4FM0 A;  1Z26 A;  2HB5 A;  4CJ4 A;  3B6O A;  4DTX A;  3TI0 A;  1WLJ A;  4KHW A;  3NGY A;  3NF6 A;  4DS4 A;  1WNS A;  2KZM A;  1TL3 A;  1WSG A;  3OYL A;  1EXQ A;  1SL2 A;  2RKI A;  1IH7 A;  3VQ7 A;  3OYB A;  1TKX A;  5FDL A;  4BDZ A;  1LAW A;  1X9W A;  3AA4 A;  3AVJ A;  4Z4I A;  1D8Y A;  1HQU A;  1TK5 A;  4B9V A;  1RT4 A;  1QQC A;  3SQ1 A;  3U3Y A;  2D0B A;  1QSS A;  4O4G A;  5JS2 A;  3VQ4 A;  4CJL A;  4DMN A;  1IO2 A;  2DFE A;  4EP5 A;  1G15 A;  2ETJ A;  3NCI A;  3TAP A;  2OA8 A;  1GOC A;  3SV4 A;  2OPS A;  5HBM A;  3NH1 A;  2OYQ A;  4PQU A;  5CYM A;  4E7I A;  3SPZ A;  2G8W A;  2ZQB A;  3EYZ A;  4DWI A;  4F3O A;  4Y1D A;  4JRP A;  3OYI A;  4CF2 A;  4DU4 A;  1SKW A;  1YT3 A;  3QNN A;  1IKW A;  4DU3 A;  3MED A;  3OY9 A;  4HCB A;  4CHN A;  3L3V A;  1JLB A;  4DLG A;  5EU7 A;  1ZBF A;  4BE1 A;  1NK9 A;  1NJZ A;  4JS5 A;  1C1C A;  4FJN A;  4CJ3 A;  3OYK A;  4B9S A;  1FK9 A;  4CEA A;  1KLM A;  1WN7 A;  3SQ0 A;  2XO7 A;  3VA0 A;  2P51 A;  1WSH A;  1REV A;  4FJX A;  2W42 A;  5FRM A;  4DSE A;  4CF8 A;  3K59 A;  2ITG A;  2GBZ A;  1NJY A;  2ZD1 A;  4O0J A;  4IKF A;  3AA2 A;  2QXF A;  3SUP A;  2HHT A;  4F2S A;  5FRN A;  3ASM A;  3VA3 A;  4DFK A;  4KAZ A;  3RTV A;  4KHU A;  3VQ6 A;  2GUI A;  1J54 A;  3K58 A;  4BAC A;  4ELU A;  3ZT4 A;  1X9S A;  1T05 A;  3HP9 A;  3TAB A;  1X9M A;  4B08 A;  4M3Z A;  4I7F A;  2OZM A;  1NKB A;  3CM5 A;  3AV9 A;  1N5Y A;  4ELV A;  4OPJ A;  4CK1 A;  5C42 A;  1HPZ A;  4DTS A;  4OKK A;  1SV5 A;  3RR8 A;  4AIL C;  3OYD A;  5K14 A;  2FBT A;  1TVR A;  1VK0 A;  3HYF A;  2F8T A;  3M8S A;  4CIF A;  3ZT1 A;  4CHQ A;  4K8Z A;  4YFU A;  3EZ5 A;  3SJJ A;  1Y97 A;  4NYN A;  1CXU A;  4FM1 A;  1BQN A;  3MEG A;  5KRT A;  3OYH A;  3F73 A;  3PY8 A;  3BDP A;  4F4K A;  3LAK A;  4I9Q A;  4ELT A;  2OZS A;  4CF0 A;  4NCB A;  4ID5 A;  3QEV A;  4I2Q A;  3V9U A;  4JS4 A;  1J5O A;  3LPT A;  4CEZ A;  3RMA A;  3L3U A;  5C25 A;  3RRG A;  1CZB A;  2G8F A;  3ZSY A;  3NHG A;  1IKY A;  2IAJ A;  5HLF A;  3O4N A;  4CIE A;  1ASU A;  1TKD A;  2G8U A;  3HPH A;  3HM9 A;  2WOM A;  4EZ9 A;  5C24 A;  3SNN A;  2G8I A;  3VQQ A;  5CZ1 A;  3I0R A;  1VRU A;  1NK0 A;  4FK4 A;  1U04 A;  1HYS A;  3SUQ A;  2JLE A;  4DQP A;  4DTJ A;  3WNE A;  3EY1 A;  2XHB A;  3TR8 A;  3HK2 A;  4FJ8 A;  1MU2 A;  1QS4 A;  1SUQ A;  3WNF A;  3KK3 A;  3M8P A;  5CYQ A;  3WNG A;  5I42 A;  3TWH A;  3L8B A;  4C8K A;  2YNI A;  3DOK A;  3KTQ A;  3SYZ A;  3C6T A;  4DSF A;  1JLG A;  3AVN A;  1BL3 A;  4IG3 A;  1S1W A;  4FLX A;  1L5U A;  1EX4 A;  2IS3 A;  2HVH A;  3DM2 A;  3HST B;  3ISN C;  4O5B A;  4KB1 A;  2EHG A;  1S1T A;  3PX4 A;  4Q5V A;  1A5W A;  4DFM A;  1TKT A;  1VSH A;  3LDS A;  4E7J A;  5J2Q A;  2HHX A;  2VWK A;  4LD0 A;  1JLA A;  3TAF A;  4DQS A;  4BE0 A;  2XY6 A;  5KI6 A;  3DRR A;  3KK2 A;  4F2R A;  4KPY A;  4FCY A;  3RR7 A;  3L2U A;  3KD5 E;  3S9H A;  4CEF A;  3AVL A;  4J2B A;  1JL2 A;  1HJR A;  3VQ8 A;  4DTU A;  1VSD A;  4KRF A;  4CJE A;  3CFO A;  4FLW A;  1XI1 A;  4HUG A;  1WAJ A;  1C6V A;  4AHS A;  4TSX A;  3ZSR A;  3IG1 A;  3JYT A;  1WSE A;  3ZSW A;  4FLY A;  1RIL A;  3QET A;  3SUN A;  2D0A A;  5HRR A;  4FJJ A;  3T19 A;  3VQ5 A;  3C94 A;  5J1E A;  4FJG A;  2HW3 A;  3K5L A;  1B9D A;  1EKE A;  3OYN A;  4FXD A;  3LAM A;  1Z25 A;  4W5R A;  5I3U A;  4CED A;  3NBP A;  4N5S A;  4C8L A;  3C6U A;  5T7B A;  1JLQ A;  4ICL A;  2A1R A;  4OPK A;  4AH9 A;  4FLU A;  1RT7 A;  2AJQ A;  2Z1G A;  2IOC A;  2FBX A;  1VSF A;  3VQB A; 
#chains in the Genus database with same CATH topology
 3HOT A;  4DV5 K;  3OVN A;  1ZBL A;  3J80 O;  3MXM A;  2ZJQ L;  1LWE A;  4A5B A;  3GOI A;  2VQF K;  1OKJ A;  3AAP A;  3LZJ A;  3O9S A;  1MDU B;  3CME N;  2HMI A;  1TV6 A;  4LFB K;  4CEQ A;  1NGD A;  4CZE A;  1N6Q A;  4YOT A;  2FSJ A;  4BC3 A;  4DUY K;  5GAG P;  2ZJR L;  3LP3 A;  4IOC L;  3OS1 A;  3PX0 A;  1HKC A;  4X66 K;  1U48 A;  5DK5 A;  1QZ6 A;  4OGC A;  4KO0 A;  2O4I A;  2NRX A;  5M1O A;  1GLE G;  1WB9 A;  3BP8 A;  1A5V A;  4CJ5 A;  1KFD A;  4JI7 K;  4W5N A;  4OJR A;  3VQC A;  4C1N I;  2OPQ A;  4HHT A;  3C7N A;  4BDP A;  1T03 A;  3PO4 A;  2KQ2 A;  2Z1J A;  2D1K A;  3D2F B;  1MA9 B;  1WAF A;  4JKH A;  1JCG A;  2J4R A;  4E19 A;  1RFQ A;  4B9T A;  3L2Q A;  1OVQ A;  3P38 A;  5HRN A;  4FVM A;  2E5L K;  4FVU A;  4G9Z A;  3C6A A;  3HZ6 A;  1KSP A;  1VQP N;  2FXU A;  4JKC A;  4ZTF A;  2Q97 A;  4CEE A;  3AVB A;  5AQG A;  4B8C A;  4CJT A;  1J53 A;  1IBK K;  4J2E A;  4QCL A;  4DTR A;  1YIT N;  4BRD A;  1BQM A;  3LPU A;  2W41 A;  2Q31 A;  3QLH A;  1V4S A;  4RW4 A;  3OYC A;  2NRW A;  3L6Q A;  2R7Y A;  3D2E B;  3GG4 A;  3ZT2 A;  1HNZ K;  4DV2 K;  5FPE A;  3HO1 A;  4OKE A;  1NM1 A;  3TSU A;  3PSF A;  2O8C A;  4DF8 A;  2YNH A;  3EKS A;  3CXC M;  1KLN A;  2X6S A;  2B4J A;  3JYT A;  3VN5 A;  1X1P A;  4JI5 K;  1YXQ A;  3CER A;  3QIP A;  3TAN A;  4IDK A;  3BZC A;  1M1K O;  5EXW A;  2KZZ A;  3DJC A;  2HHU A;  3SAG A;  3VF2 A;  1YAG A;  1VSM A;  2PY5 A;  2HBL A;  5BR9 A;  4GVM A;  3SAF A;  3Q7C A;  2YHX A;  4Q0B A;  2A6A A;  3VF6 A;  3B8A X;  1HUX A;  1SL0 A;  4KTZ A;  3M8R A;  4CZK A;  1QSY A;  5LL6 Z;  3V4I A;  4A57 A;  4FWM A;  1HYZ A;  3RRH A;  2ATQ A;  3U8X A;  3K5N A;  3CQY A;  5AQL A;  3THY A;  1QHA A;  5C2D A;  3THV A;  3LWL A;  3ZX0 A;  1U2V A;  4FWR A;  3OBW A;  2GUP A;  2YCH A;  3L2R A;  4AHR A;  1LAV A;  5MLC Q;  2RN2 A;  3QER A;  3TSP A;  4H4O A;  2VWB A;  4L3Q A;  4KTW A;  4CGD A;  4CJV A;  1V4T A;  2P9K B;  4PL7 A;  3RMB A;  3D0P A;  3AAQ A;  3KIO A;  4PKH A;  3V1R A;  4CJK A;  4N56 A;  3G71 N;  3G4S N;  1S72 N;  2UUB K;  1QHT A;  1WSF A;  4GKK K;  2Y1I A;  4DV4 K;  4CHP A;  4JRQ A;  3VET A;  4C8O A;  1XQS C;  3S41 A;  2YHB A;  4QS9 A;  1TK0 A;  4H8K A;  2E6L A;  2V7Y A;  4EAH D;  1T6C A;  2P9U B;  3UKR A;  1ITG A;  2NUB A;  3ATV A;  1SQK A;  4AM6 A;  3FZK A;  1B9F A;  3CCQ N;  2IC3 A;  4H5R A;  5AQZ A;  2P9S B;  3VEV A;  1UA1 A;  4I9L A;  4JLH A;  1NJW A;  3PLA A;  4Z0U A;  3OS0 A;  4DG1 A;  4NCG A;  2VWJ A;  1Y64 A;  2P9I B;  1IKV A;  4CHZ A;  4E1N A;  1YUW A;  3O3G A;  1VQN N;  3VGK A;  4DTM A;  3UE5 A;  1G99 A;  1NOZ A;  4HUE A;  4DR4 K;  4RW7 A;  3NF7 A;  1VSK A;  4CGJ A;  3GDQ A;  2V52 B;  2FBY A;  3I8D A;  4B1U B;  4A62 A;  4AHU A;  4HCC A;  3UB5 A;  4PUO A;  2DTU A;  5AQK A;  4W5Q A;  1BCO A;  1EWR A;  4JHD A;  4ISE A;  4YOR A;  3TPQ A;  4DR5 K;  4WQ5 A;  1VQ8 N;  3OA9 A;  1RT2 A;  3QO9 A;  4JAX A;  4BR2 A;  1JLE A;  5SWM A;  3MAQ A;  3KKR A;  3FE1 A;  4OLA A;  1LV5 A;  1DGK N;  4CES A;  1RT6 A;  4R5P A;  1Q7Y O;  4XIU A;  4CK3 A;  4MDB A;  3F2K A;  2EX3 A;  1SS6 A;  5BRF A;  2VCP A;  4KHN A;  4U7B A;  2VG5 A;  3S3N A;  2BAN A;  2QTD A;  4A5A A;  4DV0 K;  2DY4 A;  2V51 B;  4WFN L;  3TAQ A;  1BIS A;  4BGA A;  3U3G A;  3CHW A;  3CJ7 A;  1SAZ A;  3DAW A;  3U9D A;  4KHW A;  3E1Y A;  4X64 K;  3BF3 A;  3OYL A;  1S22 A;  3I8B A;  2RKI A;  4JNE A;  3OYB A;  5FDL A;  5E84 A;  4BDZ A;  1Q18 A;  1D8Y A;  4B9V A;  3IFR A;  1RT4 A;  4O4G A;  4KAZ A;  4CJL A;  3TAP A;  2DFE A;  4BRG A;  4BQL A;  4NXN K;  4JKE A;  2ZGY A;  3SPZ A;  2ASP A;  2ZQB A;  4DWI A;  3OYI A;  4CF2 A;  1YF5 L;  3QNN A;  4DU3 A;  1NGE A;  3MED A;  3F9M A;  1MWK A;  3IMX A;  3ZEU B;  1JLB A;  1QQN A;  5EU7 A;  4BE1 A;  1NJZ A;  2GTD A;  4FJN A;  4CJ3 A;  4B9S A;  1VAZ A;  4K43 A;  3SQ0 A;  1RDU A;  2P51 A;  5AZJ B;  4EHT A;  1T44 A;  4AF1 A;  4BR4 A;  3K59 A;  4IOA L;  5I9E B;  1NJY A;  1K73 O;  1NMN A;  4YOY A;  4AM7 A;  5JVH L;  3VA3 A;  3LDO A;  4ELU A;  1X9S A;  2HBJ A;  3R9P A;  3TAB A;  4JI8 K;  3VEY A;  4DTS A;  1SV5 A;  1GLF O;  5K14 A;  2FBT A;  4X62 K;  4DB3 A;  5JIC A;  2F8T A;  1YJ9 N;  4CIF A;  3G6E N;  3SJH A;  2F4V K;  3EZ5 A;  1NNE A;  3SLC A;  3W0L A;  4F4K A;  3F73 A;  4CJ7 A;  4BC5 A;  3KVG A;  3V9U A;  4JS4 A;  4JI4 K;  3L3U A;  4DR6 K;  1K8A O;  3MDQ A;  1IKY A;  2E1Y A;  3SBG A;  1Z05 A;  2WOM A;  4EZ9 A;  5C24 A;  2CGL A;  4YOU A;  4B3S K;  4FK4 A;  3SUQ A;  4CZI A;  4DQP A;  2HST A;  5IWA K;  4FOI A;  5LJW A;  3WNF A;  2QI2 A;  3BY5 A;  3KK3 A;  3WNG A;  3WEE B;  4C8K A;  2YNI A;  4JKG B;  1GLJ O;  4BR0 A;  4DSF A;  2IS3 A;  2A41 A;  3ISN C;  4PKI A;  5EVZ A;  1NWK A;  5LMN K;  2A5X A;  4WQ4 A;  5J2Q A;  3KWG A;  2FF3 B;  2VWK A;  3LDL A;  3PSI A;  4LD0 A;  1K9M O;  3TAF A;  4BE0 A;  5KI6 A;  3DRR A;  3KK2 A;  4F2R A;  4GNI A;  4WYB A;  3VF4 A;  3AVL A;  4WFA L;  4B3M K;  3DXM B;  3VQ8 A;  3VTI A;  4CJE A;  4FLW A;  1XI1 A;  4JI3 K;  1C6V A;  4KH5 A;  3ULE A;  4JI0 K;  3IG1 A;  4FLY A;  4FJJ A;  3QET A;  1JJ2 M;  3VEZ A;  1EO1 A;  3VQ5 A;  4FJG A;  5EY4 A;  1VQK N;  1EKE A;  3OYN A;  3LAM A;  1Z25 A;  5EOY A;  4CED A;  5AQW A;  3AAR A;  1JLQ A;  4ICL A;  3K0S A;  2NRZ A;  4BRQ A;  2Z1G A;  3QIN A;  2FBX A;  1S1W A;  3VQB A;  4DV1 K;  4AQY K;  1ZBH A;  5AR0 A;  3ZET A;  3CI5 A;  4CBX A;  1KVB A;  3GL1 A;  5HRP A;  1DLO A;  3A5O C;  5AZI A;  3DLE A;  4M42 A;  4CHO A;  5AQH A;  4LF5 K;  2BE2 A;  2HNY A;  3CPE A;  3P83 D;  4OGE A;  4CJQ A;  1VRT A;  3HP6 A;  4E3S A;  3C6H A;  2P9L A;  5C10 A;  1DTT A;  4CE9 A;  4C1N K;  3K5O A;  3N4P A;  2CGK A;  4BWM A;  2Q3S A;  3R3L A;  1XUP O;  1W97 L;  2Q0U A;  2VG7 A;  3AA5 X;  1CXQ A;  2RHK A;  4KI6 A;  5AQY A;  3P4I A;  3DMJ A;  4CK2 A;  4IG0 A;  3CCJ N;  3PV8 A;  3DXK A;  1NK6 A;  1W2B M;  4IWV A;  4JV5 K;  3E9L A;  3EE9 A;  3P1G A;  1BHL A;  4KTQ A;  3ZLJ A;  4M3W A;  4OVL A;  2G8H A;  2IVP A;  3WNH A;  1RDD A;  3DLG A;  4IFE A;  3A5M C;  4CJW A;  5JLF A;  2E6M A;  3AO3 A;  3V6D A;  3V9Z A;  2KFZ A;  1GLD G;  1BWF O;  3CJA A;  4DF4 A;  3NF8 A;  3K57 A;  1T8E A;  4DTP A;  1EQY A;  2I5J A;  1WBD A;  1F21 A;  3LM9 A;  4N47 A;  4BRO A;  3H3N O;  2G8K A;  4PY5 A;  4YDU A;  3I0S A;  4C8M A;  3NH2 A;  1VQ9 N;  2WFB A;  3ULE B;  4CJF A;  4CFB A;  3T1Y K;  4FM2 A;  1FKP A;  2P9P A;  4DUZ K;  1O1W A;  4O8K A;  2A3Z A;  3BEX A;  4CGG A;  1MWM A;  4DSJ A;  2OPP A;  1M90 O;  4DV3 K;  1DTQ A;  3CM6 A;  3SI6 A;  1S3X A;  2QM1 A;  1RGI A;  4FWL A;  1QTM A;  2O8E A;  1VSI A;  1WSI A;  1S1U A;  3THW B;  1ZYQ A;  4BRK A;  3ZSZ A;  1XNR K;  4J2D A;  4PKG A;  3KLI A;  3WT0 A;  2QXL A;  3F9K A;  4H5W A;  1FKO A;  4FJ9 A;  3CMA N;  2BUP A;  3LAL A;  5BPL A;  3O8M A;  3R6M A;  5AQF A;  1VQ5 N;  2HNZ A;  2HMP A;  1J6Z A;  2LSN A;  3AVI A;  5HOO A;  2YKN A;  3I56 N;  4MFB A;  4ZTJ A;  3NE6 A;  3LM2 A;  2NRV A;  4B9L A;  1QVG M;  2VYP A;  4B3O A;  4OO1 J;  5FPN A;  4AHT A;  1C0M A;  1C0G A;  5BR8 K;  3OJS A;  5HRO A;  3NGI A;  3IS9 A;  1RNH A;  3AO4 A;  1GLB G;  1GLC G;  4MLE A;  4DV6 K;  3R8E A;  2B5J A;  4FZX C;  1NK8 A;  1T6D A;  4KV8 A;  1D9D A;  5TKY A;  3EEQ A;  4BQZ A;  3T3F A;  4X65 K;  3QEW A;  2WC9 A;  3QBX A;  4CJU A;  3HL8 A;  1SKR A;  5BN8 A;  1JKH A;  4JI1 K;  3OYJ A;  1JLF A;  2ZE2 A;  5AQI A;  1KCF A;  1X3N A;  5BRE A;  2KFN A;  3FFK B;  4FYD A;  3HVT A;  5C15 A;  3A0I X;  1BGX T;  4BRI A;  2IVO A;  2UXD K;  5AQQ A;  3VQE A;  4PA1 A;  1VHX A;  3AVA A;  2IGI A;  4H0Y B;  1RBV A;  3M5R A;  4BWJ A;  4E1M A;  4HTU A;  3ULD A;  3U4L A;  1SKS A;  1NBW A;  1ZC6 A;  1Q9X A;  3O4Q A;  5JMV A;  1FW6 A;  4F8R A;  4E7K A;  3ITH A;  2B6A A;  5F0X A;  5CY4 A;  1X9J A;  1GOA A;  3GE1 A;  1KQS M;  4FJH A;  3CIP A;  3G0Z A;  2OTL N;  4DFJ A;  1DEJ A;  4DSL A;  4KHS A;  5DM6 L;  4M45 A;  4XH4 A;  2KW4 A;  3ZX3 A;  3A5N C;  4MDA A;  1BDG A;  4CF1 A;  4H5N A;  1K8K B;  1NK5 A;  4YOW A;  4NCA A;  4BRL A;  1LW2 A;  3PIP L;  1S5J A;  1JLC A;  3KLG A;  1LWC A;  4FWK A;  1I39 A;  3WQT A;  1VQL N;  2P1J A;  4K0K K;  1RT3 A;  4MLH A;  4WQ4 C;  4FJK A;  1BO5 O;  3AVM A;  5HRS A;  1EP4 A;  3ATU A;  2YHA A;  1OVY A;  4QOZ B;  1YTU A;  1XC9 A;  5AQP A;  3OYG A;  4MO5 A;  4EZ6 A;  3HOS A;  3EO3 A;  4KHY A;  3KD1 E;  4FK2 A;  2NRR A;  1BA1 A;  4JKF A;  4B1Y B;  1FJG K;  4O44 A;  5AFU H;  4DR7 K;  2CGJ A;  2D4W A;  4CBU A;  3CCS N;  3I55 N;  3KJV A;  4B9Q A;  1NGC A;  3L0Q A;  3CCM N;  3VEW A;  2AP1 A;  4F3T A;  3CJC A;  5J2N A;  3FZM A;  1L3S A;  1YIJ N;  1BI4 A;  3LWM A;  1HMV A;  4NXM K;  2HB5 A;  2OAN A;  4CJ4 A;  3B6O A;  4DTX A;  3TI0 A;  1QZ5 A;  3NF6 A;  5FLX O;  4DS4 A;  3HTV A;  1TL3 A;  1EXQ A;  3SMS A;  3VQ7 A;  1OH6 A;  4FWP A;  3AVJ A;  4M7Y A;  3C7N B;  3U3Y A;  4DMN A;  1ZBS A;  4U67 L;  2OPS A;  3NH1 A;  2OYQ A;  1QQO A;  2E2N A;  4K25 A;  2KLA A;  3IUC A;  4F3O A;  3EYZ A;  4JRP A;  4Y0W A;  2PAV A;  2W40 A;  1NGF A;  5TKW A;  3FZF A;  2VGN A;  5ADX H;  4CHN A;  5KPZ A;  4BRA A;  1ZBF A;  1C1C A;  2QWR A;  4H0V B;  4CEA A;  4JKD A;  1WSH A;  1REV A;  2W42 A;  5FRM A;  4IJN A;  4CF8 A;  2GBZ A;  1TYQ A;  3DLL L;  4JN4 A;  2ZD1 A;  4IKF A;  4FWN A;  2QXF A;  4O8U A;  3SUP A;  2ASO A;  1N36 K;  5FRN A;  1CZA N;  1NGH A;  4IEI A;  4DR1 K;  4FSV A;  1X9M A;  3AV9 A;  4ELV A;  3EN9 A;  1HPZ A;  3CD6 N;  1VQ7 N;  4I6M A;  4ILJ A;  4A61 A;  4WF9 L;  1TVR A;  3H3O B;  2E2O A;  2ITM A;  3GBT A;  3SJJ A;  2FLO A;  2O8C B;  4NYN A;  4CD1 A;  5AFU A;  3PY8 A;  4YDU C;  3KZB A;  2OZS A;  3VPZ A;  2QWQ A;  2P9N A;  3LPT A;  3PIO L;  1I94 K;  4B1X B;  1NMD A;  1DKG D;  4QS8 A;  3CC7 N;  1NGG A;  2FF6 A;  4FL9 A;  3HPH A;  2G8U A;  3SNN A;  3VQQ A;  2QEX N;  1HYS A;  1JCE A;  4CZJ A;  4FJ8 A;  3CCV N;  5JVG L;  3VMF B;  5I42 A;  3L8B A;  3DOK A;  3QFP A;  3SYZ A;  1NG9 A;  1JLG A;  1BL3 A;  2EHG A;  1S1T A;  3PX4 A;  1A5W A;  3THY B;  1TKT A;  4JI6 K;  1VSH A;  5CR4 A;  3LDS A;  3VGL A;  3C0B A;  4E7J A;  3O1B A;  1U2V B;  4H0O A;  1WBB A;  5ADX A;  4BC4 A;  4H5T A;  4FCY A;  3S9H A;  1TUY A;  4J2B A;  2O8F A;  3QML A;  3KK7 A;  1VSD A;  3QBW A;  2BTF A;  3RSE A;  1YVN A;  3R1X A;  4MO4 A;  1KD1 O;  4AHS A;  1P90 A;  5A2Q O;  1RIL A;  5HRR A;  1BU6 O;  3T19 A;  2HW3 A;  3C94 A;  1HR0 K;  5AQR A;  3NVM A;  3K5L A;  1HLU A;  3MN5 A;  2O8D A;  5I3U A;  3OW2 M;  5KQ8 A;  5CE3 A;  3UKR B;  2HF4 A;  2AJQ A;  1VSF A;  2BGG A;  4IFV A;  4CGH A;  3IKM A;  4IDH A;  3WXK A;  1RCH A;  4L8R B;  3O4W A;  4UY8 O;  4N76 A;  3AVC A;  2IDO A;  4WE1 A;  4CFA A;  4EFH A;  4KFB A;  3CQX A;  4BG8 A;  1XNQ K;  1I3A A;  3PO5 A;  2NRH A;  1Q81 O;  2YNG A;  3KLH A;  2P5O A;  4YY3 K;  5DMR A;  1VSJ A;  4HWI A;  4CJP A;  4ID1 A;  1RTD A;  4CZM A;  2D0P A;  2HBK A;  3MMV A;  2G8V A;  4B8A B;  1JL1 A;  1XC3 A;  2HHQ A;  1U4B A;  1ZBU A;  3K9J A;  4IEE A;  4BR5 A;  4WCE L;  2E2Q A;  4Z4F A;  4E7H A;  2HHS A;  3AO2 A;  2YJF A;  4JK8 A;  4I2P A;  3U9Z A;  2A40 A;  1D4X A;  4CBW A;  3RMD A;  1WUA A;  4JHD B;  4ISF A;  1E4G T;  4FLV A;  3ZX2 A;  3O5B A;  4KBO A;  4MQ3 A;  4GV6 A;  4UQG A;  5IT9 O;  4JI2 K;  3VES A;  3AGR A;  3THX A;  2O8B A;  3FLC O;  4PHT X;  1LW0 A;  3CJ9 A;  1HNI A;  4CCH A;  4LSL A;  3Q7B A;  1UAX A;  3WXL A;  3CPW M;  4CGI A;  3TAE A;  2QW9 A;  3SUO A;  1NKE A;  3MXJ A;  3H6E A;  1S1V A;  3VEO A;  3U6F A;  2WTU A;  2FSK A;  3NGZ A;  1NGB A;  3KK1 A;  4CEC A;  4I9Q A;  3CG7 A;  2QA4 N;  4M7X A;  4M3X A;  4BVP A;  3L2V A;  1ASV A;  3IRX A;  4DQ8 A;  3EE8 A;  3A2F A;  4YNQ A;  3O9Q A;  4BC2 A;  4N41 A;  3HPO A;  3NF9 A;  3WXM B;  3OTO K;  5GIP A;  4DS5 A;  4GKJ K;  1LCU A;  1RBS A;  2WON A;  1ZBI A;  2QWM A;  4FWO A;  4BE2 A;  3DRP A;  3OYM A;  1TGO A;  4NLB A;  4O55 A;  4DFP A;  4DTO A;  4DQQ A;  1KRP A;  4DQR A;  1RTH A;  2QKB A;  1IG8 A;  2D0C A;  1GLA G;  4E1J A;  3DLR A;  3LAN A;  4RG8 A;  3J8A A;  3CYM A;  1KAZ A;  4Z4H A;  2D5R A;  3G10 A;  3K2P A;  4YHH K;  4BGB A;  2NRT A;  2PYL A;  3OYF A;  4CJR A;  4Z4C A;  3QIC A;  3JSM A;  1S6P A;  2GV9 A;  3UKU A;  4GW6 A;  1SL1 A;  3V1O A;  5FPM A;  3O9U A;  3K5M A;  2V7Z A;  4E89 A;  3H45 C;  4DQI A;  2UYT A;  3MEC A;  2CH6 A;  3E01 A;  4C23 A;  3DLK A;  3TAR A;  4W5O A;  2YV0 X;  1Q8I A;  2X74 A;  4ISG A;  5J2M A;  2Z1I A;  2ZJP L;  2KTQ A;  1FXX A;  2Q2R A;  3ZSX A;  1C0U A;  2BH1 A;  2XY5 A;  2JWK A;  3AVH A;  1HKG A;  2NZT A;  4ZHR A;  1C0F A;  2NNW A;  4H03 B;  4IBN A;  4AHC A;  3J7A P;  2QWP A;  1Q82 O;  5AQO A;  1IJJ A;  3MX2 A;  1QE1 A;  4FJL A;  1BIU A;  2VGM A;  1HNV A;  2HND A;  1TL1 A;  4FJX A;  2Z1H A;  2YNF A;  5KTQ A;  3HT3 A;  5AQM A;  1VSL A;  4Y1C A;  4PL8 A;  4KH4 A;  4AHV A;  1C1A A;  5B8H A;  4FLZ A;  3WXI A;  3I33 A;  4V19 S;  3DI6 A;  4BR9 A;  2HVI A;  4JD2 A;  1NK4 A;  4LF4 K;  4RW8 A;  1ASW A;  3TTD A;  3D45 A;  1NK7 A;  4PWD A;  4NB4 A;  1OH7 A;  2E88 A;  3NH0 A;  2XY8 A;  3D7E O;  4KKO A;  1X3M A;  4JEP A;  3RMC A;  1WSJ A;  5CZ2 A;  4CW7 B;  5F1X A;  4Z4G A;  4DR2 K;  3M3Z A;  3QIO A;  4FZY A;  4CGF A;  1U45 A;  5JS1 A;  3HBT A;  2DFF A;  4FOE A;  3SAH A;  4WQ5 C;  3ALY A;  3AO1 A;  2E8A A;  1KVC A;  4LFC K;  2WBN A;  1RDB A;  4KI4 A;  5M1N A;  4H5V A;  1R0A A;  2QKK A;  4BRC A;  3SPY A;  4FJM A;  1BCM A;  3PX6 A;  1UA0 A;  5AQS A;  4B9U A;  2Q1N A;  2DFH A;  1HRH A;  1HNX K;  4LY7 A;  4W5T A;  3T1A A;  2ASM A;  5CHI A;  5GAH P;  1IBM K;  3CFP A;  1JXB A;  4DSK A;  2BDP A;  4CVN E;  2XRI A;  5KRS A;  1QQM A;  4H0X B;  4CJS A;  3ZET B;  1RT5 A;  3LP1 A;  4CF9 A;  3TAG A;  3D2F A;  3TTC A;  2VG6 A;  3H46 O;  5AZI B;  3DOL A;  5KGX A;  1N32 K;  1U6Z A;  1OH5 A;  4OLB A;  4M3Y A;  5KPT A;  1K6Y A;  4IO9 L;  1U47 A;  4M3T A;  4CHY A;  2P9L B;  3O6W A;  4G1Q A;  4KH6 A;  2HOE A;  5F2R A;  5J2P A;  3QES A;  3C65 A;  3MXI A;  4GMJ B;  4NO7 A;  1Z26 A;  1WLJ A;  4BRN A;  1WNS A;  1WSG A;  1TKX A;  1LAW A;  3AA4 A;  4Z4I A;  2UU9 K;  1HQU A;  3DXK B;  4BY9 C;  1E3M A;  3D2E A;  1QQC A;  4LF8 K;  2D0B A;  3VQ4 A;  4JD2 B;  1G15 A;  2ETJ A;  1HPM A;  3SV4 A;  5HBM A;  4B3T K;  4Z94 A;  4PQU A;  2G8W A;  3NVK A;  1SKW A;  1YT3 A;  2YHW A;  3OY9 A;  3L3V A;  3MN6 A;  3E9O A;  1IBL K;  4DLG A;  3BZK A;  4EHU A;  5AJ3 K;  4JS5 A;  3WXJ A;  1KLM A;  2YJE A;  3E9P A;  3CCE N;  3DWL A;  4BG9 A;  4DKW A;  5LY3 A;  2A42 A;  4O0J A;  3ZYY X;  2OTJ N;  3TSQ A;  3P31 A;  4F2S A;  2P9P B;  3VQ6 A;  3K58 A;  4BAC A;  4JK9 A;  1T05 A;  3HP9 A;  2DPN A;  4B08 A;  4M3Z A;  4I7F A;  2OZM A;  3CM5 A;  1N5Y A;  4OPJ A;  4CK1 A;  4OKK A;  2QWN A;  3BUZ B;  3RR8 A;  2O8E B;  4A2B A;  3M8S A;  4ILG B;  2UXB K;  4YFU A;  2GEL A;  1Y97 A;  1CXU A;  4FM1 A;  5KRT A;  3BDP A;  4K41 A;  4ELT A;  4NCB A;  4ID5 A;  3QEV A;  1XMO K;  1J5O A;  3RMA A;  5C25 A;  2P9K A;  1ZXO A;  1CZB A;  3O1W A;  3RRG A;  3QFU A;  4CIE A;  1ASU A;  3HM9 A;  4IJA A;  1NGI A;  2G8I A;  5CZ1 A;  3FZH A;  4NLC A;  2JLE A;  3LL3 A;  3WNE A;  4LFA K;  3EY1 A;  2XHB A;  3HK2 A;  1MU2 A;  1QS4 A;  4IO8 A;  3M8P A;  3TWH A;  3KTQ A;  2P9U A;  3C6T A;  1L5U A;  2HVH A;  3HST B;  4O5B A;  1QVF M;  3MWP A;  4DFM A;  5AQV A;  2P9S A;  3J7Y P;  3VER A;  2HHX A;  3ID6 A;  2W6K A;  3SBT A;  2GX9 A;  1JLA A;  4CZF A;  2P9I A;  3G25 A;  4KPY A;  1JL2 A;  3W3D A;  1EWQ A;  4KRF A;  3CET A;  3A5L C;  1WAJ A;  2YX6 A;  1E4F T;  3ZSR A;  1WSE A;  3ZSW A;  2D0A A;  5C2F A;  2QWO A;  5J1E A;  4BRE A;  3VOV A;  1NGA A;  3J7Z O;  2ZGZ A;  2JWL A;  4FXD A;  2E1Z A;  3CJB A;  5BRH A;  1JCF A;  5T7B A;  1BOT O;  4HTL A;  2A1R A;  4AH9 A;  4FLU A;  3MK6 A;  3SMP A;  2HF3 A;  3ENH A;  3AGK A;  3V1Q A;  4B1Z A;  1KVA A;  3EZW A;  4DLE A;  1NJI O;  2AA4 A;  4LF6 K;  2F7T A;  3JXU A;  3VEN A;  2P5G A;  1VQ6 N;  3ZSQ A;  4FW2 A;  1NKC A;  4KHP K;  4H0P A;  3VQD A;  5KPR A;  3DYA A;  1RDC A;  1BG3 A;  3IAY A;  4CFD A;  2FBV A;  1N8R O;  4FWS A;  1LWF A;  3UIQ A;  3HI0 A;  2H3G X;  4FJ5 A;  3HXM A;  1RDW X;  4DU1 A;  3DRS A;  3FR0 A;  3H08 A;  4J2A A;  4DR3 K;  2HHV A;  4LF7 K;  3VQA A;  4LH5 A;  2GWJ A;  3MN7 A;  4CFC A;  4BRP A;  2OPR A;  1Q9Y A;  3D6R A;  2YI1 A;  3NFA A;  3P39 A;  4CZH A;  3OS2 A;  3ENB A;  3MCP A;  3CC2 N;  3T1H K;  1JXE A;  3L4I A;  1UOC A;  5H1S Q;  1XMQ K;  1HX1 A;  4O0I A;  3CF5 L;  4GV9 A;  1S1X A;  4E7L A;  3ZCM A;  4FLT A;  2XY7 A;  4M3R A;  2QK9 A;  2PZS A;  2HHW A;  4RWT A;  4LSN A;  4O5F A;  2YHY A;  4XH1 A;  1S9G A;  5AQN A;  5FRO A;  1RT1 A;  4NYF A;  3O3H A;  4QS7 A;  5GIO A;  3ZEU A;  4KRE A;  1BUP A;  1KTQ A;  3KKS A;  3VTH A;  3CFR A;  4EIA A;  3NAE A;  2JGU A;  5SZT A;  5AZJ A;  4YOX A;  1IG9 A;  3OJU A;  2F96 A;  4DSI A;  4CER A;  2RPI A;  4FZZ A;  2PBD A;  5D3G A;  1C0T A;  1DT9 A;  1BI4 B;  1RBR A;  3HM8 A;  1HYV A;  3SQ2 A;  3J81 O;  1HJO A;  1NJX A;  2UUA K;  4IXC A;  4K42 A;  1ILY A;  1QSL A;  2ZM6 K;  2W6L A;  1WOQ A;  3AA3 A;  4LC9 B;  3O9R A;  3JS6 A;  1TK8 A;  2X78 A;  1L3U A;  1L3V A;  1EET A;  1NOY A;  3O3F A;  4CEO A;  1HNW K;  1RBU A;  2PFU A;  1YJN N;  3TAM A;  3S3O A;  1CLQ A;  5HP1 A;  4KHQ A;  1D5A A;  4RW6 A;  3BGR A;  3C95 A;  4CI6 A;  4CIG A;  1S6Q A;  2F9T A;  3MX5 A;  5FPD A;  4R79 A;  4M3U A;  3LDP A;  1W9H A;  1NU0 A;  3NDK A;  2UUC K;  3VEX A;  3M8Q A;  3LZI A;  4LH4 A;  5HL7 L;  2VQE K;  3OYE A;  2HBM A;  2PYJ A;  2YKM A;  4E0D A;  1TYQ B;  4EP4 A;  3KLE A;  3MCA B;  3VGM A;  3NMU A;  4B9N A;  4IFY A;  4C8N A;  2ZWH A;  3AVK A;  3WEE A;  3MN9 A;  4JKG A;  3ZT3 A;  3LDN A;  1D9F A;  1RTJ A;  3HVR A;  1HKB A;  3VQ9 A;  3SZ2 A;  5JLH A;  1OH8 A;  5E41 A;  4FPA A;  4I6M B;  4M41 A;  5ELZ A;  3L2W A;  3H1Q A;  3OHR A;  1VSE A;  4K8X A;  3B6P A;  3IDH A;  3FFI A;  2RF2 A;  1U49 A;  4DHY A;  4B9M A;  3LP2 A;  3CC4 N;  2IIR A;  1L3T A;  1IV0 A;  3DXM A;  4ILH A;  2O4G A;  2P9N B;  1J5E K;  3EL2 A;  4JK7 A;  1YHQ N;  3OBY A;  3E66 A;  4DTN A;  3CQ8 A;  5BPN A;  3QEI A;  2Y1J A;  4Z4E A;  1W0H A;  4B1V A;  4J8F A;  5C12 A;  4KB0 A;  3HJF A;  1UWB A;  2FC0 A;  3KLF A;  3QEX A;  1TAU A;  4GY2 B;  3SCX A;  3ENO A;  1KC8 O;  4BDY A;  3O80 A;  2A1S A;  3V81 A;  1RBT A;  3AVG A;  3QDK A;  3DLH A;  5AQJ A;  4BRM A;  1HQE A;  4HUF A;  3SQ4 A;  4FJI A;  4HVJ A;  4QAG A;  3QNO A;  1A5X A;  2WUS A;  2ZF5 O;  5BRD A;  5BN9 A;  3CJ1 A;  1IKX A;  3ZT0 A;  1RTI A;  1XWL A;  2RE2 A;  5AQX A;  1BA0 A;  3PUF A;  1GOB A;  4OPA A;  3A8Y A;  4H0T B;  2Q36 A;  1GLL O;  1ATR A;  2Q0R A;  3AVF A;  2O8F B;  1TKZ A;  1YTA A;  1ESV A;  4A2A A;  1YJW N;  4BVO A;  3AO5 A;  3RSE B;  3DLB A;  3CCU N;  3S3M A;  3V9X A;  3QEP A;  3KHY A;  4XEI A;  4B3R K;  5M1F A;  3SV3 A;  1KAY A;  4FW1 A;  1J9A A;  3HPG A;  1TAQ A;  3ZSO A;  5AQU A;  1VQO N;  4LF9 K;  3K9K A;  2X6N A;  2O8D B;  3MEE A;  1RDA A;  3OYA A;  2F9W A;  5M1Q A;  1S9E A;  1B92 A;  4CEB A;  4GV3 A;  3V9S A;  3QB0 A;  3VQP A;  1XHX A;  5M1P A;  3V9W A;  3N4Q A;  5AQT A;  4CZL A;  1CZ9 A;  3ZSV A;  2E4L A;  5KGW A;  4CD3 A;  2F8S A;  3M1F A;  3EKU A;  3FGU A;  4F9O A;  5GAE P;  3O08 A;  4CZG A;  1XHZ A;  3BF1 A;  3F5T A;  3O9T A;  3P5J A;  1C1B A;  1VQM N;  2KHO A;  4YOV A;  1YVU A;  3LP0 A;  4RW9 A;  1T7P A;  3HRG A;  3RWU A;  1N33 K;  4FK0 A;  4OKJ A;  1BIZ A;  4H4M A;  4OPH A;  3T7Z A;  5BPM A;  1W7A A;  1KFS A;  4FJ7 A;  4FM0 A;  4BRH A;  3NGY A;  3CCR N;  2KZM A;  3T69 A;  1SL2 A;  3MWT A;  1IH7 A;  4JKA A;  3SK3 A;  1X9W A;  5M1K A;  1TK5 A;  3ID8 A;  3SQ1 A;  1QSS A;  5JS2 A;  1LOT B;  1IO2 A;  4FWQ A;  4EP5 A;  3NCI A;  3THW A;  2OA8 A;  2E2P A;  1NLV A;  5C0Y A;  1GOC A;  4JKB A;  2O8B B;  3THX B;  5LMU K;  5CYM A;  4E7I A;  4FO0 A;  4Y1D A;  4DU4 A;  4BR7 A;  1IKW A;  2I7P A;  5E26 A;  4HCB A;  2UXC K;  2QWL A;  2IVN A;  4WFB L;  2CH5 A;  1NK9 A;  3OYK A;  1FK9 A;  5EX5 A;  1WN7 A;  2XO7 A;  3VA0 A;  2E20 A;  3KWI A;  4M63 C;  3L4Q A;  4DCH A;  4DSE A;  3LDQ A;  4A59 A;  2FSN A;  2ITG A;  2NLX A;  3AA2 A;  5GAD P;  2HHT A;  3ASM A;  4DFK A;  3RTV A;  4KHU A;  2GUI A;  1J54 A;  3TU5 A;  3ZT4 A;  1P8Z A;  1NGJ A;  4IOX A;  1YI2 N;  4DV7 K;  1NKB A;  5C42 A;  1T3V A;  1Q86 O;  4AIL C;  3OYD A;  4OX9 K;  3WQU A;  1VK0 A;  3HYF A;  4XH5 A;  3ZT1 A;  4CHQ A;  4K8Z A;  1VQ4 N;  1BQN A;  3MEG A;  3OYH A;  3LAK A;  3HSC A;  4CF0 A;  4I2Q A;  4CEZ A;  2G8F A;  3ZSY A;  3NHG A;  2IAJ A;  5HLF A;  3O4N A;  1TKD A;  3I0R A;  1VRU A;  1NK0 A;  1U04 A;  2OCE A;  4DTJ A;  2D0O A;  3H1V X;  3TR8 A;  1SUQ A;  2GEM A;  5CYQ A;  3JAM O;  3RVC A;  1KAX A;  3UKU B;  3TTF A;  3M6G A;  1N34 K;  3AVN A;  4IG3 A;  4FLX A;  4JYA K;  1EX4 A;  3DM2 A;  1SZ2 A;  5DM7 L;  4KB1 A;  4Q5V A;  2I7N A;  4RTF D;  5LJV A;  1ATN A;  1TUU A;  4FPB A;  4DQS A;  2XY6 A;  5GIN A;  4B1W B;  3CCL N;  3L2U A;  3RR7 A;  3KD5 E;  4CEF A;  1K8K A;  3AY9 A;  1HJR A;  2GWK A;  4DTU A;  1O13 A;  2KKZ A;  3CFO A;  4RCH A;  4BRF A;  4HUG A;  3WUH A;  1H1V A;  4TSX A;  3SUN A;  3FZL A;  1KXP A;  2EWS A;  4GVE A;  1B9D A;  4W5R A;  4IZ9 A;  3NBP A;  4N5S A;  4C8L A;  1Z6R A;  2HHH K;  3C6U A;  4OPK A;  1ATS A;  1RT7 A;  1R59 O;  2IOC A;  5KQD A; 
#chains in the Genus database with same CATH homology
 2BGG A;  4IFV A;  3OVN A;  3V1Q A;  1ZBL A;  1ZBH A;  3MXM A;  4CGH A;  1KVA A;  4DLE A;  1KVB A;  1LWE A;  5HRP A;  1DLO A;  2P5G A;  1RCH A;  3ZSQ A;  4FW2 A;  1NKC A;  4L8R B;  3DLE A;  3LZJ A;  3VQD A;  4M42 A;  3DYA A;  4CHO A;  1RDC A;  2HMI A;  1TV6 A;  4N76 A;  3AVC A;  2BE2 A;  2IDO A;  2HNY A;  4WE1 A;  3P83 D;  4OGE A;  4CEQ A;  4CFA A;  2FBV A;  4KFB A;  4CJQ A;  1LWF A;  4CFD A;  3UIQ A;  4FJ5 A;  3HXM A;  1VRT A;  3HP6 A;  4E3S A;  1I3A A;  1N6Q A;  3PO5 A;  4DU1 A;  2YNG A;  3DRS A;  3KLH A;  2P5O A;  3H08 A;  1DTT A;  4CE9 A;  5DMR A;  1VSJ A;  4J2A A;  3K5O A;  2HHV A;  3LP3 A;  3VQA A;  4CJP A;  4ID1 A;  4LH5 A;  1RTD A;  3OS1 A;  4CFC A;  3PX0 A;  2OPR A;  2G8V A;  4PY5 A;  4BWM A;  1JL1 A;  4B8A B;  1Q9Y A;  2HHQ A;  2Q3S A;  1U48 A;  5DK5 A;  1U4B A;  3NFA A;  3OS2 A;  1ZBU A;  4OGC A;  2VG7 A;  4KO0 A;  2O4I A;  1JXE A;  3AA5 X;  4Z4F A;  1CXQ A;  4E7H A;  1A5V A;  2HHS A;  4KI6 A;  3AO2 A;  4CJ5 A;  4I2P A;  1KFD A;  3RMD A;  4W5N A;  3DMJ A;  4OJR A;  1UOC A;  4CK2 A;  3VQC A;  4IG0 A;  2OPQ A;  4HHT A;  3PV8 A;  4O0I A;  4BDP A;  1T03 A;  4FLV A;  1NK6 A;  1S1X A;  4E7L A;  3ZCM A;  4FLT A;  2KQ2 A;  4MQ3 A;  2Z1J A;  4M3R A;  2XY7 A;  3PO4 A;  3P1G A;  4UQG A;  2QK9 A;  1BHL A;  4KTQ A;  2PZS A;  2HHW A;  4M3W A;  4LSN A;  1WAF A;  4OVL A;  2G8H A;  3WNH A;  1LW0 A;  1RDD A;  3DLG A;  1HNI A;  4E19 A;  4LSL A;  4CJW A;  4CCH A;  1UAX A;  1S9G A;  5FRO A;  2E6M A;  4B9T A;  1RT1 A;  4NYF A;  4CGI A;  3O3H A;  3L2Q A;  3AO3 A;  3TAE A;  3V6D A;  3V9Z A;  4KRE A;  5HRN A;  2KFZ A;  4FVM A;  3SUO A;  4DF4 A;  1KTQ A;  3KKS A;  3NF8 A;  3K57 A;  3CFR A;  1NKE A;  1T8E A;  4DTP A;  3MXJ A;  2I5J A;  1S1V A;  3NAE A;  2JGU A;  5SZT A;  3U6F A;  1KSP A;  3NGZ A;  1F21 A;  3KK1 A;  4ZTF A;  4CEE A;  4N47 A;  2F96 A;  3AVB A;  3CG7 A;  4CEC A;  4B8C A;  4CER A;  3OJU A;  1IG9 A;  4CJT A;  4DSI A;  2G8K A;  4M3X A;  2RPI A;  1J53 A;  4J2E A;  4FZZ A;  5D3G A;  3L2V A;  1C0T A;  3I0S A;  4C8M A;  3NH2 A;  4DTR A;  4QCL A;  1BI4 B;  4CJF A;  1ASV A;  1BQM A;  1RBR A;  3LPU A;  3IRX A;  4CFB A;  4FM2 A;  3A2F A;  1FKP A;  4YNQ A;  1HYV A;  1O1W A;  3QLH A;  3SQ2 A;  4RW4 A;  1NJX A;  4N41 A;  1SKS A;  4CGG A;  3OYC A;  3HPO A;  4DSJ A;  3NF9 A;  2OPP A;  1QSL A;  4DS5 A;  1DTQ A;  3AA3 A;  3CM6 A;  3SI6 A;  1RBS A;  2R7Y A;  2WON A;  3ZT2 A;  1TK8 A;  2X78 A;  1VSI A;  1L3U A;  1QTM A;  1ZBI A;  1WSI A;  1S1U A;  1L3V A;  1EET A;  1ZYQ A;  1NOY A;  3O3F A;  3HO1 A;  3ZSZ A;  4BE2 A;  3DRP A;  4OKE A;  4J2D A;  4CEO A;  3OYM A;  3KLI A;  1TGO A;  4O55 A;  3F9K A;  4DFP A;  4DTO A;  1FKO A;  1RBU A;  4DQQ A;  4FJ9 A;  1KRP A;  4DQR A;  4DF8 A;  2YNH A;  3LAL A;  3TAM A;  3S3O A;  1RTH A;  5HP1 A;  1CLQ A;  4KHQ A;  1KLN A;  1D5A A;  3QIN A;  2X6S A;  2QKB A;  2D0C A;  2B4J A;  4RW6 A;  3BGR A;  3C95 A;  3DLR A;  4CIG A;  2HNZ A;  1X1P A;  3LAN A;  1S6Q A;  3VN5 A;  4RG8 A;  3QIP A;  3TAN A;  4IDK A;  4M3U A;  1W9H A;  2LSN A;  3AVI A;  3CYM A;  3NDK A;  2KZZ A;  2HHU A;  2YKN A;  3M8Q A;  3LZI A;  4MFB A;  1VSM A;  4ZTJ A;  4Z4H A;  4LH4 A;  3NE6 A;  2PY5 A;  4B9L A;  3OYE A;  4GVM A;  2D5R A;  2PYJ A;  2YKM A;  3G10 A;  4E0D A;  4EP4 A;  3KLE A;  3K2P A;  4B3O A;  2PYL A;  4B9N A;  4IFY A;  4C8N A;  4CJR A;  3OYF A;  4Z4C A;  4Q0B A;  3JSM A;  3AVK A;  1SL0 A;  4KTZ A;  4AHT A;  3M8R A;  1S6P A;  1C0M A;  2GV9 A;  3ZT3 A;  1QSY A;  4GW6 A;  3OJS A;  5HRO A;  1RTJ A;  3HVR A;  3NGI A;  1D9F A;  1SL1 A;  3VQ9 A;  3V4I A;  3V1O A;  4K8X A;  3IS9 A;  1RNH A;  3K5M A;  3SZ2 A;  4E89 A;  1HYZ A;  3AO4 A;  3RRH A;  4DQI A;  2ATQ A;  5E41 A;  3MEC A;  4M41 A;  3K5N A;  3L2W A;  2B5J A;  1VSE A;  3E01 A;  1NK8 A;  3B6P A;  4FZX C;  3DLK A;  3TAR A;  4KV8 A;  4W5O A;  2YV0 X;  1Q8I A;  3FFI A;  3LWL A;  3THV A;  1D9D A;  2RF2 A;  2X74 A;  5J2M A;  3T3F A;  2Z1I A;  3L2R A;  2KTQ A;  4AHR A;  1FXX A;  3QEW A;  1U49 A;  3ZSX A;  1C0U A;  1LAV A;  2XY5 A;  4B9M A;  3LP2 A;  4CJU A;  2RN2 A;  1L3T A;  3HL8 A;  3QER A;  1SKR A;  4H4O A;  3AVH A;  2O4G A;  4KTW A;  1JKH A;  3OYJ A;  4CGD A;  4CJV A;  4ZHR A;  1JLF A;  3IAY A;  2ZE2 A;  2KFN A;  1KCF A;  4IBN A;  4AHC A;  4FYD A;  3HVT A;  3RMB A;  3D0P A;  4CJK A;  1BGX T;  3KIO A;  3V1R A;  4N56 A;  3CQ8 A;  4DTN A;  3QEI A;  2Y1J A;  4Z4E A;  1QE1 A;  1QHT A;  1W0H A;  4FJL A;  1BIU A;  1HNV A;  3VQE A;  2HND A;  4PA1 A;  1WSF A;  1TL1 A;  2IGI A;  1RBV A;  3AVA A;  4BWJ A;  4E1M A;  2Z1H A;  4HTU A;  2YNF A;  3ULD A;  4CHP A;  5KTQ A;  4JRQ A;  2Y1I A;  3HT3 A;  4KB0 A;  3HJF A;  4C8O A;  1VSL A;  4Y1C A;  1Q9X A;  2YHB A;  3O4Q A;  4AHV A;  1UWB A;  2FC0 A;  1C1A A;  4FLZ A;  3KLF A;  3QEX A;  1TAU A;  4F8R A;  1TK0 A;  3DI6 A;  4H8K A;  3SCX A;  2E6L A;  2HVI A;  4BDY A;  1NK4 A;  1ITG A;  4E7K A;  2NUB A;  2A1S A;  3ITH A;  2B6A A;  4RW8 A;  5CY4 A;  3V81 A;  1ASW A;  1RBT A;  3AVG A;  3DLH A;  3D45 A;  1NK7 A;  1GOA A;  4PWD A;  1B9F A;  1HQE A;  4HUF A;  3SQ4 A;  2IC3 A;  4HVJ A;  4FJI A;  4FJH A;  4QAG A;  1UA1 A;  3NH0 A;  3QNO A;  1A5X A;  3G0Z A;  4I9L A;  2XY8 A;  4DFJ A;  4KKO A;  4JLH A;  1NJW A;  4DSL A;  3RMC A;  1IKX A;  4KHS A;  4Z0U A;  1RTI A;  1XWL A;  1WSJ A;  3ZT0 A;  4DG1 A;  3OS0 A;  4NCG A;  4M45 A;  2VWJ A;  3PUF A;  2KW4 A;  1GOB A;  5CZ2 A;  4Z4G A;  1IKV A;  4CHZ A;  3QIO A;  3AVF A;  4E1N A;  4CF1 A;  4FZY A;  3O3G A;  4CGF A;  1U45 A;  1NK5 A;  1TKZ A;  1YTA A;  4NCA A;  5JS1 A;  4DTM A;  2DFF A;  3AO5 A;  3ALY A;  3AO1 A;  3DLB A;  1NOZ A;  1LW2 A;  1KVC A;  3S3M A;  4HUE A;  1S5J A;  3V9X A;  1JLC A;  1RDB A;  3KLG A;  3QEP A;  4KI4 A;  3SV3 A;  4FW1 A;  1LWC A;  4RW7 A;  1J9A A;  3HPG A;  1I39 A;  1TAQ A;  1R0A A;  2QKK A;  3NF7 A;  3ZSO A;  1VSK A;  3SPY A;  4CGJ A;  4FJM A;  1BCM A;  2P1J A;  2X6N A;  3PX6 A;  1UA0 A;  4B9U A;  1RT3 A;  2DFH A;  2FBY A;  3MEE A;  1RDA A;  3I8D A;  4FJK A;  3OYA A;  4HCC A;  4AHU A;  1HRH A;  1S9E A;  4PUO A;  2DTU A;  1B92 A;  3AVM A;  4LY7 A;  4W5T A;  3T1A A;  5HRS A;  1EP4 A;  1BCO A;  4W5Q A;  4CEB A;  2YHA A;  3V9S A;  4QOZ B;  3VQP A;  3CFP A;  1XHX A;  1YTU A;  1RT2 A;  1JXB A;  3QO9 A;  1XC9 A;  4DSK A;  1JLE A;  3V9W A;  2XRI A;  5KRS A;  3OYG A;  4CJS A;  2BDP A;  1CZ9 A;  1RT5 A;  3LP1 A;  4CF9 A;  5SWM A;  3TAG A;  4EZ6 A;  3MAQ A;  2VG6 A;  3ZSV A;  2E4L A;  3KKR A;  4KHY A;  5KGW A;  3KD1 E;  4OLA A;  2F8S A;  3DOL A;  1LV5 A;  5KGX A;  4FK2 A;  4CES A;  1RT6 A;  4R5P A;  4XIU A;  4OLB A;  4M3Y A;  4O44 A;  4CK3 A;  1K6Y A;  1XHZ A;  1U47 A;  2EX3 A;  4CHY A;  4M3T A;  3P5J A;  4G1Q A;  1C1B A;  3KJV A;  1YVU A;  4KHN A;  3LP0 A;  4RW9 A;  1T7P A;  3RWU A;  2VG5 A;  5J2P A;  3S3N A;  4OKJ A;  4FK0 A;  2BAN A;  1BIZ A;  4F3T A;  4H4M A;  3QES A;  5J2N A;  2DY4 A;  1L3S A;  3TAQ A;  1KFS A;  1BIS A;  3MXI A;  1BI4 A;  3LWM A;  4GMJ B;  4FJ7 A;  1HMV A;  3U3G A;  4FM0 A;  1Z26 A;  2HB5 A;  4CJ4 A;  3B6O A;  4DTX A;  3TI0 A;  1WLJ A;  4KHW A;  3NGY A;  3NF6 A;  4DS4 A;  1WNS A;  2KZM A;  1TL3 A;  1WSG A;  3OYL A;  1EXQ A;  1SL2 A;  2RKI A;  1IH7 A;  3VQ7 A;  3OYB A;  1TKX A;  5FDL A;  4BDZ A;  1LAW A;  1X9W A;  3AA4 A;  3AVJ A;  4Z4I A;  1D8Y A;  1HQU A;  1TK5 A;  4B9V A;  1RT4 A;  1QQC A;  3SQ1 A;  3U3Y A;  2D0B A;  1QSS A;  4O4G A;  5JS2 A;  3VQ4 A;  4CJL A;  4DMN A;  1IO2 A;  2DFE A;  4EP5 A;  1G15 A;  2ETJ A;  3NCI A;  3TAP A;  2OA8 A;  1GOC A;  3SV4 A;  2OPS A;  5HBM A;  3NH1 A;  2OYQ A;  4PQU A;  5CYM A;  4E7I A;  3SPZ A;  2G8W A;  2ZQB A;  3EYZ A;  4DWI A;  4F3O A;  4Y1D A;  4JRP A;  3OYI A;  4CF2 A;  4DU4 A;  1SKW A;  1YT3 A;  3QNN A;  1IKW A;  4DU3 A;  3MED A;  3OY9 A;  4HCB A;  4CHN A;  3L3V A;  1JLB A;  4DLG A;  5EU7 A;  1ZBF A;  4BE1 A;  1NK9 A;  1NJZ A;  4JS5 A;  1C1C A;  4FJN A;  4CJ3 A;  3OYK A;  4B9S A;  1FK9 A;  4CEA A;  1KLM A;  1WN7 A;  3SQ0 A;  2XO7 A;  3VA0 A;  2P51 A;  1WSH A;  1REV A;  4FJX A;  2W42 A;  5FRM A;  4DSE A;  4CF8 A;  3K59 A;  2ITG A;  2GBZ A;  1NJY A;  2ZD1 A;  4O0J A;  4IKF A;  3AA2 A;  2QXF A;  3SUP A;  2HHT A;  4F2S A;  5FRN A;  3ASM A;  3VA3 A;  4DFK A;  4KAZ A;  3RTV A;  4KHU A;  3VQ6 A;  2GUI A;  1J54 A;  3K58 A;  4BAC A;  4ELU A;  3ZT4 A;  1X9S A;  1T05 A;  3HP9 A;  3TAB A;  1X9M A;  4B08 A;  4M3Z A;  4I7F A;  2OZM A;  1NKB A;  3CM5 A;  3AV9 A;  1N5Y A;  4ELV A;  4OPJ A;  4CK1 A;  5C42 A;  1HPZ A;  4DTS A;  4OKK A;  1SV5 A;  3RR8 A;  4AIL C;  3OYD A;  5K14 A;  2FBT A;  1TVR A;  1VK0 A;  3HYF A;  2F8T A;  3M8S A;  4CIF A;  3ZT1 A;  4CHQ A;  4K8Z A;  4YFU A;  3EZ5 A;  3SJJ A;  1Y97 A;  4NYN A;  1CXU A;  4FM1 A;  1BQN A;  3MEG A;  5KRT A;  3OYH A;  3F73 A;  3PY8 A;  3BDP A;  4F4K A;  3LAK A;  4I9Q A;  4ELT A;  2OZS A;  4CF0 A;  4NCB A;  4ID5 A;  3QEV A;  4I2Q A;  3V9U A;  4JS4 A;  1J5O A;  3LPT A;  4CEZ A;  3RMA A;  3L3U A;  5C25 A;  3RRG A;  1CZB A;  2G8F A;  3ZSY A;  3NHG A;  1IKY A;  2IAJ A;  5HLF A;  3O4N A;  4CIE A;  1ASU A;  1TKD A;  2G8U A;  3HPH A;  3HM9 A;  2WOM A;  4EZ9 A;  5C24 A;  3SNN A;  2G8I A;  3VQQ A;  5CZ1 A;  3I0R A;  1VRU A;  1NK0 A;  4FK4 A;  1U04 A;  1HYS A;  3SUQ A;  2JLE A;  4DQP A;  4DTJ A;  3WNE A;  3EY1 A;  2XHB A;  3TR8 A;  3HK2 A;  4FJ8 A;  1MU2 A;  1QS4 A;  1SUQ A;  3WNF A;  3KK3 A;  3M8P A;  5CYQ A;  3WNG A;  5I42 A;  3TWH A;  3L8B A;  4C8K A;  2YNI A;  3DOK A;  3KTQ A;  3SYZ A;  3C6T A;  4DSF A;  1JLG A;  3AVN A;  1BL3 A;  4IG3 A;  1S1W A;  4FLX A;  1L5U A;  1EX4 A;  2IS3 A;  2HVH A;  3DM2 A;  3HST B;  3ISN C;  4O5B A;  4KB1 A;  2EHG A;  1S1T A;  3PX4 A;  4Q5V A;  1A5W A;  4DFM A;  1TKT A;  1VSH A;  3LDS A;  4E7J A;  5J2Q A;  2HHX A;  2VWK A;  4LD0 A;  1JLA A;  3TAF A;  4DQS A;  4BE0 A;  2XY6 A;  5KI6 A;  3DRR A;  3KK2 A;  4F2R A;  4KPY A;  4FCY A;  3RR7 A;  3L2U A;  3KD5 E;  3S9H A;  4CEF A;  3AVL A;  4J2B A;  1JL2 A;  1HJR A;  3VQ8 A;  4DTU A;  1VSD A;  4KRF A;  4CJE A;  3CFO A;  4FLW A;  1XI1 A;  4HUG A;  1WAJ A;  1C6V A;  4AHS A;  4TSX A;  3ZSR A;  3IG1 A;  3JYT A;  1WSE A;  3ZSW A;  4FLY A;  1RIL A;  3QET A;  3SUN A;  2D0A A;  5HRR A;  4FJJ A;  3T19 A;  3VQ5 A;  3C94 A;  5J1E A;  4FJG A;  2HW3 A;  3K5L A;  1B9D A;  1EKE A;  3OYN A;  4FXD A;  3LAM A;  1Z25 A;  4W5R A;  5I3U A;  4CED A;  3NBP A;  4N5S A;  4C8L A;  3C6U A;  5T7B A;  1JLQ A;  4ICL A;  2A1R A;  4OPK A;  4AH9 A;  4FLU A;  1RT7 A;  2AJQ A;  2Z1G A;  2IOC A;  2FBX A;  1VSF A;  3VQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...