4B3OA

Structures of hiv-1 rt and rna-dna complex reveal a unique rt conformation and substrate interface
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
553
structure length
540
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQAIHLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of HIV-1 RT, Nnrti and RNA/DNA Hybrid Reveal a Structure Compatible with RNA Degradation
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/dna/rna
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 117
structure length 540
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4b3oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b3oA05
2RF2B 4F50A 4GC6A 1WSIA 3V9WA 3MEGB 1WSFA 3OYNA 1VK0A 1T03B 4B8AB 1SH0A 1TL1B 4FJJA 3KLGA 4IOBA 1RDBA 3H2LA 3VQSA 3AA5X 3JSMA 4AHTA 1W9HA 4NRTA 5KGXA 4AILC 1X9SA 2HAIA 4TSXA 3AO3A 2DFHA 1N48A 4RUAA 4DL7A 3I8DA 4CEBA 4CJRA 1L3TA 4FCYA 3SV4A 4RW9A 2ITGA 4KREA 1S9EA 3AVIA 3OYJA 4E3SA 3F9KA 1CLQA 5KFPA 4FJIA 4CF1A 1HQEA 1S1VB 1IKWB 3AV9A 3IGVA 1DTTA 2W42A 4F3TA 5HROB 2HHQA 2XY6A 3MFHA 3SV3A 5KG0A 1VSHA 3I5BA 2JLEA 4AHRA 3EZUA 4EYHB 3OJSA 3B6PA 2P1JA 3KLVA 4DTMA 4FW1A 1S1XA 3AVLA 3AVKA 4B3OA 3DMJB 3OLBA 5DG7A 1HNVB 3SUQA 4KHQA 4F4ZA 3QEWA 2OA8A 3V6JA 4CFAA 5F8JA 3IGNA 2BQUA 3VQBA 1FKOB 1BISA 3T5LA 1IKYB 4ZP8A 4EO8A 1LW0B 2DTUA 4IDKA 1NJWA 3BDPA 1HYZA 4R5PA 2XCPA 3I0SA 3OSNA 4CEDA 2BE2A 3T3FA 2ZE2B 2YKMA 5HRRA 2HNDB 3VQ5A 1QHTA 1JLBB 3OVNA 1VRUA 4I9QA 4CJEA 3AA2A 1HPZB 4Q44A 2B6AB 4TYAA 1TKTB 5I3UB 3K5NA 4FJLA 3H5SA 4PWDA 5CY4A 3KTQA 4WZMA 5KT3A 4CFBA 5KI6A 1HYSB 3KLEB 1KLNA 3DM2A 4CGDA 5T14A 1XC9A 3OYIA 1C1AA 4I2QA 1O1WA 4AHVA 5CYQB 4IG3A 5C25B 3V81B 1LWFB 3VA3A 3KHRA 3DOLA 2RN2A 3NGIA 3HVTB 1SUQA 2FVCA 4WYLA 4CJKA 4K8ZA 3V9UA 1B9DA 3HL8A 2O5DA 4C8LA 3PX6A 2KZZA 1S9EB 4RW6A 3NF7A 3PW4A 2UVRA 4GW6A 5T7BA 5DK5A 3ZSXA 2PY5A 4PQUB 3OSPA 3BR9A 1DTQA 4CJ3A 1EX4A 4KO0A 3V6DB 4FBTA 4TXSA 4ZVEA 4IFVA 2BANB 4IKFA 3IRXB 1U47A 1XR5A 4KI6A 5L1KA 4QW9A 4CJ4A 4UQGA 3BJYA 4RU9A 4CGJA 4NZ0A 3AO2A 1QE1A 1K1SA 5EU7A 3L8BA 1ZYQA 1SL0A 1RT2B 3TABA 1S1UA 1RT4A 4FK2A 3C6TB 3QGIA 4BACA 3TQ1A 2RF2A 3MEDB 3N6MA 4CFDA 5KT7A 4LQ3A 2YHBA 1JLCA 4EP4A 1RBUA 4TQRA 2W9CB 4DU3A 3V1OA 2HHXA 2O4IA 3ITHA 2O4GA 3F73A 3UDLA 2QK9A 1RT4B 3QZ8A 4QWBA 3BSOA 1JLQB 4KHNA 3KK3B 3NE6A 3DI6A 3E01A 4CJUA 4K8XA 4ID5A 3CFPA 4M41A 4CJLA 1LW2A 2QE5A 3O4QA 3C94A 3O3FA 3IS9B 5D3GA 5I42A 1IG9A 3PZPA 4CJTA 3KNAA 2HMIA 4KFBA 3OL9A 2WONB 3DLRA 4RW8A 2V4RA 4DSLA 3ZT0A 4CJ5A 4QCLA 4RNMA 2HHTA 4DLGA 2HVHA 4F2RA 2IM3A 1JL2A 1WAJA 3GIMA 5KFNA 1ZBHA 5FRMA 2KFZA 2UVVA 3LWMA 3CJ4A 2Z1JA 4FJNA 5HLFB 4IQXA 1XWLA 4CIEA 1BIZA 2HHSA 4EYIB 3NGDA 3NH2A 4JV0A 1QS4A 2RPIA 4Z0UA 4IKAA 3T19A 4DQQA 2R8GA 3RB0A 1VSIA 3P5JA 1D8YA 2JEJA 5HLFA 4KB0A 4CIFA 4FZYA 4CJSA 3ZSRA 4O4GB 1LWFA 1BL3A 1C1CA 2FBTA 3VQEA 3V9XA 4R0EA 2AU0A 5KFUA 2AGQA 3LP1B 3RRHA 1S1TB 2CKWA 5J1EB 4BE2A 1Q9YA 1N5YB 4KTZA 4ZMMA 4CJFA 4Z4IA 3NF9A 1RT1A 3OS1A 2GV9A 5J2MB 5CZ2A 4K4VA 5KRSA 3P1GA 3HKWA 4BE1A 4CGHA 3BQ2A 2KQ2A 3CFRA 3NGYA 3FFIA 2G8FA 4ZHRA 3GILA 2KFNA 4CECA 4KHUA 2XGQA 1SKRA 3KHGA 2IM1A 1RBRA 3KKRA 3VQ4A 3KJVA 3AO1A 1QTMA 1RTHA 2FVSA 5KT5A 3FQKA 3PJXA 1NK6A 1HMVA 1S6QA 1KSPA 5KT6A 2XY8A 3RRGA 5HRNA 4MFBB 3VQ8A 1JLGA 3PR4A 2IJFA 4EO6A 4LH5A 1JL1A 1LW2B 1T94A 2QXFA 1TV6A 4YMEA 4URGA 1NKBA 2ZKUA 5FDLB 1RT2A 1ZBUA 2AGPA 1RT6A 3ZSOA 3KK3A 4CHQA 3K2PA 3CDUA 3OYAA 5C5JA 4NLYA 3OLAA 1FKPB 2IA6A 2R7YA 4Y34A 1JKHA 2EHGA 4DS5A 3LP0B 2BDPA 3KJVB 4M94A 4RNOA 5FDLA 3OYBA 3LANA 3SFGA 3LP3A 4L8RB 4K50A 3JYTB 4ECRA 3GIKA 4DTXA 4Z4FA 4J9LA 1CXQA 4OJRA 4J2BA 4ZTFA 3RMCA 4KB1A 5KG3A 3NFAA 3NCIA 2ETJA 4CF0A 2VG5A 2VG6B 3EPGA 5KFRA 4PY5A 3L2QA 3OYGA 3HT3A 3RB6A 2FJWA 1S1UB 3IG1B 2I5JB 3TAFA 4W5NA 1L5UA 4YR3A 3HVAA 3OYFA 4NCBA 2WCXA 3KLFA 4DTOA 5KFXA 3ZSVA 3VN5A 3VQ7A 2HHWA 3NF8A 4DQPA 3ASMA 4MK7A 1JKHB 5KFIA 4KV8A 1WN7A 3S3MA 3PY8A 1HNIB 3KLEA 1NK8A 1ASWA 5KG6A 3AVAA 3T5KA 1G15A 2HB5A 3DOLB 5JS1A 2PYJA 2HNDA 2X74A 3DRRA 4IFYB 2FBVA 3EYZA 2P5GA 2QKBA 1RA7A 1EETA 5C24A 5L9XA 1RDCA 4OGCA 2C28A 4NCGB 3G6VA 4CF8A 2B6AA 2IM0A 4JRPA 2HHUA 1WSJA 1IO2A 1B92A 3SUNA 5I42B 3SUOA 4FXDA 1SV5B 2XI3A 5HROA 2BRKA 4R5PB 3PW7A 1RCHA 1ZTWA 2YNFB 3FRZA 1KFDA 4RW4B 5DLFA 1SUQB 2D0CA 4M3ZA 2GUIA 4O4RA 4F2SA 5F8LA 1VSJA 4M3RA 4Q43A 4ZPCA 3KK2B 4I2QB 4RW8B 4XO0A 1J54A 3OYDA 3HVRA 4Q0BB 4O4GA 3MAQA 3HPHA 3LDSA 1VSEA 3DLKA 1RBSA 3OL6A 4K4TA 2JEGA 3QLHA 3MEEA 2ZD1A 3UPFA 3OYLA 2OZMA 1IKWA 4J9MA 4CHOA 1SL2A 4FJGA 1TK8A 1Z26A 3VQ9A 1WNEA 4HUGA 5KFYA 4OPKA 4FJ7A 3HM9A 2VG6A 3MEEB 4C8OA 4J9NA 1DTQB 1K1QA 5DQGA 2YKNB 1JX4A 1D1UA 1QSYA 1C0MA 4PQUA 2ASLA 2XRIA 4AHCA 5DLGA 3GV8B 3LWLA 3M9MB 4DTSA 4FK0A 3LP0A 3OS0A 4J9RA 4NLQA 1T03A 2UUWA 4DL3A 3VA0A 2FLNA 4G1QB 1JLAB 2JC1A 2ATLA 5KG2A 1C0TA 4O55A 1SV5A 3RB3A 4E7LA 3DRSA 3M8QA 1NK0A 2OZSA 4DTUA 4H4MB 3WNHA 3PO5A 4KKOA 4GVMA 4TY9A 4JV1A 5K14A 1TGOA 3ALYA 4NLVA 1HYSA 4JUZA 2D5RA 3TI0A 4Z4EA 4LSNA 1WAFA 1XHXA 3M8QB 3HP9A 3SI8A 1NNDA 2XCAA 1ASVA 3AVCA 4NYZA 5DGBA 1YVUA 4J9QA 4U7CA 3TAMA 1RYRA 2JGUA 2HNZA 1KLMB 4FZXC 3RMDA 3NKYA 2IJNA 3HP6A 3L2WA 1TKZA 1XHZA 1A5WA 3O3HA 4PWDB 2BRLA 4DF8A 1DLOB 1JXLA 4F4WA 4HHTA 3QYYA 4DSIA 1KRPA 4ECYA 3AVJA 2FLPA 1I3AA 1VRTB 4MIBA 3SCXA 4DL2A 3GV7B 3EPIA 3EZ5A 2WOMB 4CJPA 1DTTB 1FXXA 1N4LA 2HNYA 5EWGA 1D0EA 3U3YA 3L2RA 1U45A 1FKOA 3MF5A 3K59A 1UWBB 3H59A 4O3NA 2BGGA 4IH6A 3NH1A 4RW9B 1LAWA 5KFOA 4C8NA 3DYAA 3E51A 4LSLB 5C42A 2LSNA 2D0AA 4KKOB 1EXQA 4IRDA 2UVWA 1D9FA 4XIUA 5HBMB 3SQ0A 5JS2A 4RW4A 4RZRA 3PX4A 1U09A 4CK1A 1NOZA 1BQNB 4CGFA 3OY9A 1QSLA 3BREA 2DPIA 2VWJA 1NK5A 3TVKA 2BQRA 4TLRA 3D0PA 4JS4A 4DMNA 1WSGA 4R8UA 4WFXA 3VQCA 4NCGA 1VSKA 2G8VA 1IKVB 4LY7A 1TKZB 4Z4HA 4KV8B 3QETA 4DSJA 4DSEA 1S6PA 1QUVA 4IRCA 1SH3A 3QZ7A 4MIAA 3PJWA 1JLQA 1C2PA 5K14B 1WNSA 4ECXA 4ZVFA 1S1WB 4KAZA 2DY4A 4RW7B 3M8PB 3RR8A 2E6LA 4QWAA 1JLFB 3QLHB 1ZBIA 4MFBA 1S6PB 3HO1A 4ELVA 4B08A 5EDWA 1RTJB 2OPQB 2Z1GA 2BR0A 2QKKA 5EWFA 5KFEA 4BWMA 4H4MA 2A1SA 1N6QA 3UIQA 2E9TA 2YKNA 2RDIA 2R2TA 3TAQA 1UA1A 4OPJA 1REVA 4B9UA 3SFUA 2W8KA 2IM2A 1EKEA 4DLEA 2VG7A 1UA0A 4AHUA 4TYBA 4RW6B 1YVFA 3O3GA 2FVRA 2B43A 3MFIA 1C1BA 2D0BA 1CSJA 4ECTA 3OYMA 4B9SA 4J2DA 1TK5A 2W7OA 4ZVHA 4CJQA 3V81A 1I6JA 1U48A 1UWBA 3RMAA 3PX0A 3CDEA 3CIZA 3QESA 1S49A 1Z4UA 4HCCA 2FJVA 3ICLA 5J2PB 1TAUA 2IOCA 1WLJA 3V6HA 3NGZA 2YNGB 5J2NB 2C22A 3BQ1A 4KAIA 2JC0A 5EWEA 3H5UA 4OKKA 3NBPB 3CJ5A 2R8KA 4FLTA 2J6SA 5CZ1A 3ZSYA 4Y1DA 4M95A 1RTJA 4WYWA 4DFKA 3LPUA 1EETB 5C24B 1GX6A 4E19A 4HUFA 4ZHRB 4CIGA 2OYQA 2F96A 4FW2A 1B9FA 4NLWA 4F3OA 2WONA 4DS4A 4F4XA 4ED6A 2D7SA 4M3TA 4YP3A 3SQ4A 5KFMA 3AVNA 3AVGA 4CFCA 1RT3B 4K4YA 2XWYA 2G8WA 4FJ5A 5HP1A 3WNGA 4CJVA 4XPEA 1BCMA 1ZBLA 4N5SA 3LP2B 1ASUA 1N56A 1BQMB 3GV5B 3I5CA 3V4IA 4J9PA 3KK1B 2EC0A 4Y1CA 1MMLA 2B5JA 1TVRA 1RAJA 2RKIB 3L3UA 2XGPA 3O4NA 3V6KA 2I5JA 4NRUA 4CEFA 1A5VA 1IKXB 3SPZA 1T05B 2UVUA 1S6QB 1LWCB 3T1AA 4NLRA 4CGGA 3SQ1A 4FLWA 1RDRA 1RILA 3MEGA 3G0ZA 1RT5A 1FKPA 2ASDA 3V9ZA 2BANA 3THVA 3D5MA 4WZQA 4F4YA 4DTRA 3QERA 4I9LA 3ITHB 3SUPA 1SL1A 3CM5A 4BDZA 3QIOA 3U6FA 4NLGA 2ZD1B 2AWZA 5JUMA 4B9LA 1Z25A 2HNYB 3LAMA 3ZT1A 3HJFA 3KK1A 2R8IA 3C6UB 4FLXA 3M8PA 3K5MA 3VQQA 3FSIA 4FJXA 1TVRB 4FLVA 1S9GA 2X6NA 4JV2A 4O44A 5KG4A 4E7IA 4URSA 5JXSA 3ISND 1WSHA 1BIUA 4AH9A 3DRPB 5SWMA 3OYHA 4ICLB 3EY1A 1R0AB 3M8SA 3L2VA 3B6OA 4KSEB 4JRQA 2HVIA 5KFWA 3OJUA 4DQSA 1J53A 2AQ4A 1TV6B 4CHPA 3KLHB 1RDAA 4ZPDA 4DG1A 3DOKB 4LD0A 3CQ8A 3NH0A 3T5JA 1HPZA 4HVJA 4O3OA 1Y97A 4ED1A 4BDYA 2AJQA 1KVAA 3RBDA 4W5TA 4CK3A 2GIQA 4OGEA 1RT1B 1NKEA 2VWKA 4DSKA 4ZTJA 3HVTA 2BE2B 3G86A 5KFZA 1NJZA 1N5YA 4O44B 4DU4A 4B3OB 3DM2B 2FVQA 4DFMA 4IH7A 4OVLA 4W5OA 3T5HA 1QAJA 1QAIA 3P83D 4Q45A 5KFHA 1JXEA 3MECA 2EX3A 4QWCA 4DQRA 4MKAA 1KLMA 4NLPA 3DLHA 3KHHA 5F8GA 1FK9B 4EEYA 3LP1A 2W9BB 3KLIA 4B9TA 4DSFA 4O3SA 3QIPB 4W5QA 4NCAA 2X78A 1JLEB 3MTKA 3MR6A 1JLCB 1RYSA 3D45A 3ZT2A 3MR5A 3OHAA 2OPSB 4J9KA 3RTVA 4KHSA 3A2FA 3RWUA 1CXUA 4URQU 4JS5A 4KFBB 1SKSA 1QE1B 4RNNA 2ZE2A 3OS2A 4OLBA 2RKIA 3S3OA 1NHVA 1KTQA 3IRXA 3V9SA 4DL6A 3IAYA 4FJHA 2Z1HA 1TL1A 3HK2A 3H5XA 2PZSA 2VA3A 4Q0BA 3CVKA 3DI6B 2D3ZA 5C42B 1U49A 5F8HA 5FROA 3DMJA 5HP1B 4MK9A 3KK2A 1RT6B 4CESA 2FBXA 4EZ9A 5KFLA 3GIJA 4U6PA 1W0HA 2P5OA 4FM0A 3DLGB 4FS2A 4F4KA 1JIHA 2IBKA 3NDKA 4MH8A 3N6NA 1S5JA 3KKSA 3HPOA 4I7FB 1X9WA 2DPJA 1J5OA 3SPYA 4ZPBA 4O3RA 3ULDA 2ILZA 4ID5B 2IC3A 2R2SA 3V6DA 3PO4A 1RTHB 3FQLA 3I0SB 2VA2A 3QNNA 4ZVGA 1I39A 4B8CA 4E89A 2FBYA 3TAPA 1IKVA 2IGIA 4DF4A 3NBPA 1D9DA 2E6MA 5DQIA 1KVBA 4FVMA 4KE5A 3H5YA 4H54A 1BI4B 3DRRB 4IFYA 2YNGA 4WXWA 4EBDA 3KLGB 4Q8EA 3NMAA 1J9AA 3QEPA 4YNQA 1GX5A 4FLZA 4M3XA 3CM6A 3QO9A 1EP4B 2OPPB 4IG3B 5C25A 4ELUA 4IRKA 5J1EA 1S1TA 5L1JA 4KI4A 2F8EX 3BQ0A 4DQIA 1LWEB 1NKCA 2KZMA 2R8JA 1MU2B 3PW0A 1S97A 4KBIA 4O3PA 2DFEA 2C2RA 5I3UA 3DYAB 1F21A 1XR7A 3CFOA 1LAVA 4Y2CA 4WFYA 4EP5A 2D3UA 3MR3A 1OS5A 4LH4A 4PA1A 1NJXA 2HNZB 3QEVA 3BGRB 3KD5E 4ECQA 3H40A 5DMRA 2YNFA 4ECVA 1BI4A 3JSMB 4G1QA 3M8RA 4IG0B 3DLEA 2ALZA 2V4QA 4FJMA 4MKBA 2XHBA 1T3NA 3DOKA 3Q8PB 3PV8A 3BGRA 4ECZA 3TAGA 4XPCA 2W8LA 3QINA 3AVBA 5L1LA 4KTQA 1RBTA 2OPQA 4B9MA 4TY8B 3Q8RB 5FRNA 4ED2A 4ED3A 5KFTA 2IC3B 1RTIA 2VG7B 4HKQA 3MR2A 3UR0A 1J5OB 3ZCMA 1LWEA 1RDDA 1REVB 1NOYA 4NLDA 2IMWP 4O3QA 1ZTTA 3G10A 4KHMA 1HQEB 3C6UA 1C0UA 4FS1A 2W9AA 3AA3A 1HRHA 4M3WA 2WK4A 4E7KA 1LWCA 2BQ3A 2F8SA 3DLGA 3LPTA 1VSMA 2F8TA 2JEFA 4CE9A 4FJKA 3KMQA 3GIIA 4DL4A 4Q8FA 3RAQA 4RUCA 2W9CA 1S0OA 2A1RA 1GOAA 1JLFA 3ZSWA 3TARA 1JLAA 3H08A 1ZETA 5KT2A 2Y1IA 1RT7A 1HQUA 4QOZB 4EBEA 4M42A 1TL3B 1RT7B 4FM1A 1C6VA 1RT3A 4CF9A 1S9FA 4M45A 3MECB 4NLTA 2HWIA 4X2BA 4C8KA 3HXMA 4Y2AA 4IBNA 1JLEA 3MXIA 2C2EA 2R8HA 4IG0A 2KW4A 1BQNA 4B9NA 1HMVB 3RMBA 4ELTA 4DTPA 3BSAA 3SYZA 4F8RA 3NAHA 4QW8A 3C95A 1RNHA 2G8KA 2RDJA 4HTUA 4QAGA 1XI1A 1RBVA 5L1IA 4PUOA 4YR0A 2JEIA 2YNIA 1NK4A 1L3VA 5KFSA 4NYNA 3H4BA 3DLKB 2DFFA 2B4JA 3PW2A 2J6TA 4O0JA 4E1NA 3K57A 4ICLA 3RB4A 3SI6A 4K4SA 1KCFA 4TY8A 3LZJA 2GC8A 3GYNA 4E0DA 5E41A 1BHLA 2W9BA 4FJ9A 4HUEA 5KFCA 1TKDA 1QQCA 4CEOA 4CCHA 3IG1A 4IH5A 2IAJA 4BE0A 4ZP7A 2OPRA 4DG1B 4RG8A 1IM4A 2FJXA 3QGHA 3I0RB 4FM2A 5SZTA 2UUTA 5CYMB 3RBEA 2WB4A 3BSNA 4LSNB 3KLHA 1X1PA 4JLHA 4CK2A 4DTNA 4ECWA 3KMSA 4W5RA 3FDSA 1VSDA 1CZ9A 3OYCA 3KLFB 3PHEA 4OLAA 2V0NA 1Q9XA 4KHRA 3TAMB 4EZ6A 1MU2A 1C1CB 4LQ9A 4QPXA 3L2UA 2R2RA 2G8UA 2ILYA 3SJJA 4N47A 2Q3SA 3H98A 3I5AA 2KTQA 3AA4A 2HHVA 1S1VA 1UAXA 3QO9B 1NHUA 3SNNA 3ISNC 4YFUA 2IS3A 1T05A 5DG8A 1T7PA 4RNFA 3TR8A 4KHYA 2VG5B 4CHZA 5F9LA 4ID1A 2YNHB 1RT5B 1NK7A 4HYKA 3Q8SB 4KO0B 3KOAA 2P51A 3DRPA 1TAQA 4E7HA 4RW7A 4EBCA 4WXOA 2YHAA 1D5AA 4B9VA 1ZBFA 4O0IA 2D41A 3OYEA 1HJRA 1IKXA 1YT3A 4OKEA 2Y1JA 4Z4GA 4Y3CA 3G6YA 1X9MA 2OPSA 3MXJA 1TQLA 4CJWA 3MXMA 3UQSA 2PYLA 4ED8A 4ZPAA 1JLGB 3K5OA 3WNFA 4FJ8A 3AVFA 2G8HA 3CJ2A 3V4IB 4CERA 4I2PB 3AVHA 3JYTA 4N56A 1KHVA 4OKJA 3C6TA 3QIDA 3KLIB 5EUHA 4HCBA 5KG5A 4FBUA 3VQPA 3PUFA 3DDKA 4ED7A 2C2DA 3SZ2A 3M9OB 1BQMA 4IFVB 4I2PA 5CYMA 4M3UA 4WFZA 1GOBA 2YNHA 1QSSA 4AHSA 1TP7A 1SKWA 4QWEA 4GC7A 1JLBA 3LZIA 1WSEA 2YV0X 3HSTB 5HRPA 5J2MA 5KFAA 3BSCA 2IAJB 3OL7A 2WHOA 4NYFA 4TN2A 1UOCA 4FLUA 4FZZA 3WNEA 2XI2A 3I0RA 2R2UA 3PW5A 2XY7A 3D28A 5F8NA 2B5JB 5KFFA 3QEXA 1S48A 1T8EA 3QIPA 3U3GA 4ED0A 5J2PA 4J2EA 3AVMA 5CYQA 1JXBA 2HW3A 4KHWA 5DQHA 3OHBA 1RTDA 5J2NA 3H4DA 3NAEA 4DEZA 2CJQA 1KFSA 3TANA 1HNIA 5KFGA 4ZP9A 1VRUB 1HQUB 2XO7A 3CYMA 4PUOB 2AGOA 4FK4A 4KB7A 2FC0A 4C8MA 1TKXB 5KG1A 3S3NA 1S9GB 1HYVA 4G3IA 3ZT4A 2GIRA 3NF6A 3VQ6A 1C1BB 2E9ZA 3VQDA 1GOCA 2G8IA 2AX1A 3QEIA 3CJ0A 2ATQA 1NK9A 4O5BA 1L3SA 3HPGA 4K4UA 5KFQA 1A5XA 4Z4CA 3L3VA 4DU1A 2V9WA 1IH7A 2ASJA 2E4LA 2HMIB 1C0UB 2OPRB 3K5LA 4K4XA 3DLBA 4K4ZA 3TAEA 3K58A 4N41A 4H4OA 1R0AA 5KGWA 4IDKB 5HRSA 3CDWA 2WRMA 1N6QB 1RTIB 2W7PA 4CGIA 3HHKA 3NAIA 4K4WA 1S1WA 1S0NA 4YQWA 1CZBA 4E1MA 3IS9A 5D3GB 4KTWA 4TQSA 4CEEA 3PR5B 3LALA 4BWJA 1KVCA 1S10A 4CF2A 3V1QA 4Q5VA 2AX0A 3AO5A 4NLUA 1U04A 3V1RA 3KIOA 3MEDA 3OL8A 2X6SA 5F8MA 4DFJA 1VSFA 2Z1IA 3LP2A 4YR2A 3E01B 5HBMA 3Q8QB 3RAXA 4NLSA 1BCOA 4R8UB 1YTAA 5KRTA 5KTQA 3N6LA 3ZSZA 1NJYA 3QNOA 1XR6A 5KG7A 3FFIB 1K6YA 5KFBA 4NLXA 3HVWA 5F9NA 1FK9A 3DLEB 3AO4A 2J6UA 4DL5A 3OYKA 1S4FA 2XC9A 3QGGA 2WOMA 4E7JA 3CG7A 1LW0A 2WTFA 3S9HA 5J2QA 4DTJA 1TKXA 1VRTA 2E9RX 4KPYA 4J9SA 4OL8A 1HARA 4LSLA 1KHWA 3TWHA 4CEQA 4J2AA 3ZT3A 5KFJA 4FYDA 1DLOA 2FLLA 2FVPA 4ZP6A 4KRFA 1TKTA 1RTDB 1BGXT 4IR9A 4CHNA 4IR1A 3KD1E 4WE1A 3CO9A 1L3UA 5KFVA 1EP4A 2OPPA 4CHYA 3SQ2A 4J9OA 4GMJB 3LAKA 4WE1B 1S0MA 3NL0A 4DFPA 4CEZA 3PVXA 4MQ3A 4N76A 2HWHA 3KHLA 1ITGA 5DG9A 2QV6A 3HYFA 1RA6A 4H8KA 3VQAA 1W25A 3G6XA 1TL3A 3CJ3A 2YKMB 1U4BA 4I7FA 4M3YA 5J2QB 1YTUA 1LV5A 1C0TB 5KT4A 5KFDA 3ZSQA 2YNIB 3CWJA 4NLOA 1VSLA 4FLYA 4BDPA 4RNHA 1SH2A 2NUBA 1HNVA 4ECUA 2IDOA 5DGAA 5F8IA 3RR7A 4ECSA 3M9NB 1Q8IA 4DWIA 1TK0A 1IKYA 2XY5A 4QWDA 2ZQBA 2GBZA 4CEAA 3IN5A 3NHGA 3GQCA 3DRSB 5KFKA 4H4OB 2I1RA 1S1XB 2OH2A 4MK8A
chains in the Genus database with same CATH superfamily
2RF2B 3MEGB 3HSGA 2N82B 2NLWA 2YKAA 2X1AA 3MM7B 4OHWA 2DHXA 1K8KB 3AA5X 4AHTA 1NU0A 4Z94A 1W7WA 2V5HG 1HNZJ 1TZ0A 2GO9A 1X9SA 2LDYA 1SJ1A 3AO3A 4OZJA 1N48A 3W2VB 3I8DA 5BR8F 4CEBA 4CJRA 1L3TA 2EBEA 3SV4A 4RW9A 2ATCB 2ITGA 4KREA 3AVIA 4E3SA 1CLQA 4DUZK 2W2PP 2AKWB 1T6DA 3IGVA 4F3TA 1HHQA 2G1DA 5HROB 1UJ6A 3PFEA 2JLEA 3ZTPA 4EYHB 4ISEA 2HHHK 1HLUA 3TOQA 2F63A 3KLVA 1S1XA 2QLJB 1F3VA 1HNVB 5B0GA 1TTHB 2ZVIA 3K9KA 3QEWA 2V9KA 1UVIA 3VQBA 2BX6A 3KWMA 2V4JB 3GFHA 1IWGA 5AR0A 4DPYA 6FDRA 1NJWA 1HYZA 2Q31A 4R5PA 3I0SA 1ZXOA 4YOTA 5AZJA 1I5OB 5AQZA 4QQBA 3T3FA 3NLCA 2ZE2B 3IKMA 3THXB 1OH8A 5HRRA 1YVNA 3HBTA 1JLBB 3SBGA 2JLFA 2HBMA 3OVNA 2HFNA 5FJ4A 1HL6A 3DU5A 1GLCG 1NSKL 5E3RA 4AT1B 2B6AB 1TKTB 3M2RB 4BG8A 2CPYA 4FXWA 4X65J 3LQVA 2IYIA 1XC9A 4I2QA 1MWKA 4MLEA 1I1GA 1SBRA 1HD0A 4CNYA 5C25B 1Q8LA 3DOLA 3HVTB 3THPA 2UV8A 1NUEA 2AJFE 3EGWB 1JWWA 4CJKA 4Z7YA 1N32F 1BG3A 5B08A 3HL8A 2BA9A 1HLWA 2KZZA 1PIEA 4LSZB 2XTJP 2LXFA 4GW6A 9ATCB 2O3DA 8ATCB 2KO1A 4PQUB 1NJIO 1FHTA 1KQSM 2DNHA 1CJTA 4CJ3A 4J5OA 2NRRA 3NXZA 1NGDA 2YVSA 2GMHA 1RK8A 3IRXB 2I0XA 1XR5A 4KI6A 4AM6A 4JK9A 4QW9A 4CJ4A 4RU9A 4NZ0A 3AO2A 1SC6A 1K1SA 4HI2A 2LU2A 1RT2B 3OT9A 2YXLA 3QGIA 2JFKA 3N6MA 3NGKA 3W8PA 4LQ3A 2YHBA 2OI2A 4HEA9 3UI3A 3I9ZA 2HHXA 2ZJQQ 3ITHA 2QK9A 5AFUH 3E3XA 3MN9A 3TA1A 3BSOA 1JLQB 4OX7A 4BRMA 3NE6A 4A8OA 3JS6A 4ID5A 1U26A 5HL7L 1LW2A 2WW4A 3D0HE 3SEOA 3W63A 4DV5K 2HMIA 4YOVA 2R7XA 3OL9A 2WONB 3HD2A 5E5NA 5B0DA 3ZT0A 1R8BA 1TUUA 5GADU 2Y8WA 2HHTA 5BYQA 4F2RA 2IM3A 3ZXWA 2QI2A 3ATVA 2XMMA 3AAQA 1SXLA 3GIMA 1IXKA 4B9QA 5KFNA 2DHSA 3J81Y 4FJNA 4IQXA 3DFEA 5ETSA 1BIZA 2W2MP 4ZJLA 3W66A 4EYIB 3NGDA 2RPIA 2DNOA 3KUGA 4BY9C 1WDTA 4IKAA 4DV6J 2LEAA 5LMUK 3RB0A 3NRBA 4OJ1A 3CCQS 2L9NA 5HLFA 4LVNP 1VLYA 2E5IA 3G71N 2AU0A 5KFUA 2BYCA 2B8QA 1OH6A 3DXKB 2DNGA 4KTZA 1WEZA 1DKGD 2DXEA 3MCMA 2GV9A 5CZ2A 4K4VA 3P1GA 3HKWA 1DRZA 2ROEA 4CGHA 1RJJA 2P9LA 3NGYA 5M1KA 3VALA 4ZHRA 4CECA 3OBYA 4KHUA 4NXNJ 1SKRA 3KHGA 1OYDA 2KI2A 3VQ4A 1N52B 3KK7A 3AO1A 4HTLA 3I82A 2FVSA 3K5PA 1NMEB 3PJXA 5BPMA 2FY8A 4WWSA 3HMJG 1HMVA 4A8QA 3QRPA 2O67A 2XY8A 4OYOA 3LGMA 2DD8S 3O5TB 3VQ8A 2PI5A 2OTLS 2IJFA 1CJUA 3QT8A 1LW2B 1T94A 3C15B 2QXFA 5H1SQ 2DGVA 2DR5A 2V7YA 5FDLB 1RT2A 2AGPA 1RT6A 3ZSOA 5K8MA 1TFYA 3OYAA 2C3PA 3DKDA 2UYTA 4IO8A 5C5JA 5HVFA 2VC1A 4MT1A 2R7YA 1JKHA 3DXBA 5KAKA 3OTEA 3L7PA 4ZOSA 3KJVB 2ZNZA 3H25A 4OI6A 1IBCB 4QYZK 3LANA 4DR4K 3VF0B 1R6VA 4C98A 1CXQA 3UNYA 3NWGA 4JI5F 2NXJA 1WOQA 1YHQS 2VG6B 5CZXA 4HR2A 3OYGA 3HT3A 2FJWA 5BJRA 3IG1B 1YXQA 4H0XB 3VF2A 2I5JB 4W5NA 2X1FA 3HVAA 4NCBA 2HVEA 3HSJA 3VQ7A 2YWEA 1X31C 1RUSA 1JKHB 5KFIA 2O8DB 2QMXA 3J81O 3KLEA 5ETOA 1NK8A 1PJ7A 1ASWA 3R7BB 2XNQA 1A9NB 3T5KA 5JS1A 2PYJA 4GV6A 5IV3A 1EQYA 2FBVA 2OAUA 5DDPC 3O9TA 3M1VB 4F3MA 2QTWA 3DLLL 4NCGB 3G6VA 4CF8A 4B3RK 2E5LJ 4LF9K 1X0FA 2HHUA 4DV2J 1HHSA 5F0UA 3D2WA 3GE1A 5C2CA 2BJ1A 3K0JA 3SUOA 2XI3A 3SQGA 5HROA 3HHLC 4I68A 4DOZA 3P5TL 2QYCA 4LREA 4IO9Q 1RCHA 2YNFB 4JI0K 3FRZA 1VQLN 4M3ZA 1SUQB 3FBEA 2NQPA 3VAJA 3MN6A 3MOJB 1WC4A 1RHJB 5F8LA 1VLOA 4P71A 4M3RA 4Q43A 3CC4S 2QN6B 4L3QA 3W0LA 1AUDA 3OYDA 4O4GA 4FWRA 2R3VA 3DLKA 1VHFA 3QLHA 5IXUA 4M5LA 2MY8A 2ZD1A 2OZMA 3C6AA 2JNJA 1KC8O 2HBJA 2XULA 2RSQA 1Z26A 4HUGA 5KFYA 3CCUS 3ZZRA 4FJ7A 3HM9A 4NEYA 4C8OA 1K0VA 2FJBB 4Q2MA 4ZLNA 1K1QA 5DQGA 2F8MA 2HS0A 1QSYA 2GMJA 2ASLA 3OTOK 3OD2A 2XRIA 5DLGA 3CC2N 4FK0A 2LXIA 3P8BB 3CMAN 4LBIA 4U96A 3F5TA 4NLQA 3HZ6A 1T03A 1S79A 3QICA 3D66A 3VEVA 1JLAB 1HNZK 2ATLA 3KJQB 3CO0P 3RB3A 3M8QA 4H4MB 4KKOA 1U1NA 4JV1A 3MM5B 3IBFB 4NLVA 1HYSA 3TP2A 3BH7B 2D5RA 4KT0C 2GHVC 4P7TA 1ATRA 4ES3A 4RJVA 2XCAA 1ASVA 3J80O 1YVUA 4TU9A 1WOOA 2LDIA 5LOQA 2HNZA 3I6PA 1YG0A 2HVDA 3LM2A 3A5OC 2CQ3A 2IJNA 4FKYA 1TKZA 1A5WA 3UD3P 3CCRS 3UVJB 4PWDB 3IR5B 4F4WA 2JFDA 2VCPA 1EARA 4J8FA 2PFUA 3A5NC 4HHTA 2KHDA 1KRPA 2RAQA 4ECYA 1NDCA 3Q23A 1VRTB 4MIBA 1RADB 2NUUG 2BOAA 1DTTB 1N4LA 1FXXA 2KYZA 2HF4A 4A8MP 2M0GB 3A0IX 4DXLA 1LWXA 1DZ5A 3PTWA 1U45A 4E8UA 3K17A 1UWBB 2RILA 3WXIA 4O3NA 2CVIA 4IH6A 3NH1A 3GCXP 4LR9A 1DY3A 2LVWA 5H9EK 1LAWA 4WKRA 2QFIA 2LSNA 4NXNK 2B8PA 4NLCA 2A0FB 3FR0A 2BBEA 4RW4A 1H0HB 3S7RA 3P96A 4ENOA 4OYIA 3ZZUA 3OY9A 2DPIA 4A4JA 1NK5A 2VWJA 1HI1A 1WF0A 2WW8A 4EWTA 1U1RA 4WQ5A 3D0PA 1CEZA 1Z6RA 4R8UA 1U2VA 1HPMA 3ENWA 4U95A 1VSKA 3PIOQ 1DQ8A 1SH3A 3U1NA 5AQLA 5M1FA 2AEFA 4MIAA 3PJWA 4H0VB 1WNSA 1UWAA 2ZBCA 3LDNA 1Y0HA 2VBWA 3ZZ0A 1YRXA 4OYXA 4LR7A 3CCUN 4M5GA 1BUPA 3HO1A 3HHLA 4ELVA 3J7ZT 3GU0A 4JI2K 4TU8A 1R8PA 1JB0C 2WSEC 5E3CA 2H4WB 2XYHB 2ZGYA 2QKKA 3OHRA 1T9UA 4H4MA 1YGYA 2F9JA 2RDIA 2K1RA 2XZDB 2R2TA 4WIQA 2CJKA 1U0HB 2H51B 3TUZC 3DLLQ 2NPFA 2ZDOA 4DPTA 4Z7CA 1UA0A 2VV5A 3CCJS 4RBVA 1VQLS 2MSSA 3BV8A 3T6JA 1RISA 3DRXA 3O08A 2PO4A 1TK5A 1X4AA 1YIJN 2LQ5A 3ULEA 4AQYJ 1S49A 3J81j 2FJVA 2LQ9A 5J2PB 3ZLJA 3D9BA 3CERA 1WLJA 3V6HA 3NGZA 4B3SJ 3VGVA 3C7NB 3MMBA 4WF9Q 2DR7A 2ZJRL 1X4HA 4O5FA 5AQYA 2JC0A 4OKKA 3NBPB 3CJ5A 2R8KA 2VPWB 2J6SA 2YHXA 5CZ1A 2HURA 3ZSYA 3DHWC 2NRTA 1M5VC 2DIUA 1MNEA 2BH1A 1AZSB 2GWJA 4DFKA 3K8VA 3OVSA 3LPUA 1AYEA 3R5JB 1QQNA 3SQGB 4ZCMA 1NNEA 1OSCA 1T0TV 3MAAB 4ED6A 5B0CA 2X51A 5KFMA 3BGOP 4FJ5A 4OZ0A 2ZH9A 1BCMA 3WQTA 1WDDA 3SLCA 3I5CA 3V4IA 3I4PA 4IJAA 3KK1B 2EC0A 3WQUA 1MMLA 4BQLA 4RBUA 5HJXA 2DBBA 3J7YU 4HTIA 1EQMA 4FYXB 2VQEF 3C8YA 3R9PA 1IKXB 1B0PA 4KGMA 2FXUA 1T05B 2E7VA 1S6QB 1LWCB 4ILJA 2HFUA 5K8PA 4DR5F 1P8GA 4NLRA 4K0KF 4FLWA 2MZQA 4JKBA 3MEGA 3AJ1A 4XAKA 4DUYF 4JI1K 2HZCA 5FPMA 2VFTA 4WZQA 1MG7A 1BOTO 1F1BB 3ZX0A 4QIVA 3M2RA 2F40A 4NLGA 2ZD1B 2AWZA 5JUMA 3U6FA 4B9LA 2KJWA 1U25A 2DNMA 2WSCC 3JB9k 2VKZG 3FSIA 1W2BR 4FLVA 2X6NA 4E7IA 4O44A 5KG4A 3WT0A 2FHJD 4URSA 5JXSA 1W7AA 5IT4A 3OYHA 1Y3KA 1HWJA 2IBOA 1KS2A 2H54B 3VGTA 3EY1A 3RVCA 4GKKK 5IWAJ 4DPUA 4DR2F 2ZHBA 1J53A 3O6WA 1TV6B 2ZZTA 3KLHB 4AYBD 1ZOTA 4LD0A 3CQ8A 3NH0A 2RQCA 1VC5A 2AJQA 4BDYA 4WFNQ 1KVAA 3RBDA 4W5TA 3W5ZA 1Q81T 4JYAK 1RZMA 4FNHA 3SSRA 2HK2A 2Q6CA 2OP5A 1NKEA 5CR4A 2VWKA 2GNKA 3BF3A 1NJZA 5KQDA 4O44B 2CQPA 2W24A 2QWLA 1D9AA 4K43A 3DM2B 4DFMA 1SJQA 4ZCIA 1REGX 5C0YA 3R3LA 5IM0A 1VQKN 2EKYA 4DQRA 3MWTA 4MKAA 3DLHA 4FVUA 4LF5J 1WC0A 2XMKA 1YITS 1ZM9A 4FZVA 2UUAJ 2ZBRA 4B9TA 4IEEA 4ILGB 2QIFA 1SQGA 1T9XA 3BEGB 1YJ9N 3QIPB 4YDUA 1JNRB 4W5QA 1VQMN 4IFEA 2GVZA 4HDHA 1JJCB 1SPBP 1G99A 4IO1A 3RSEB 3PACA 1G4CA 1UW9A 3ZT2A 3OHAA 4ILMA 4KHSA 2RRAA 3X3UA 4URQU 4KFBB 1SKSA 5E33A 1QE1B 5DM6Q 3S3OA 1NHVA 3D0GE 4BRQA 4FJHA 2Z1HA 4GY2B 1TL1A 3HK2A 3IR7B 2A6AA 3C66A 2PZSA 2A3JA 2VA3A 3C19A 2D3ZA 5C42B 1QVGM 3DMJA 3KK2A 2MQMA 2QC3A 3N5BA 2FBXA 4ILHA 2RQ4A 2YWWA 5KFLA 2U2FA 2ASOA 2A1BA 3U9DA 4FM0A 4GV9A 4FS2A 1PG5B 2IBKA 4MH8A 2NRHA 1FEEA 3KKSA 2Z0GA 4X66K 2ILZA 4ID5B 1KTVA 3KJNB 1VFJA 3V6DA 3JAMU 2D69A 2VOPA 2VA2A 4ZVGA 4B8CA 2MKJA 4E89A 3TAPA 2Q6BA 2MDAA 1KVBA 2QYGA 4KE5A 4DV4K 1NMDA 4EBDA 3DRRB 4IFYA 2YNGA 4N77A 3OFEA 4WXWA 4Q8EA 4DI6A 1J9AA 3QEPA 3FBFA 1SJFA 3GCWP 2POKA 2OTLN 1S1TA 2Q1LA 4KI4A 1KAYA 3BQ0A 5H9FJ 2JVOA 2FJAB 4NPOA 2CDRB 1S7IA 1LWEB 5DRKA 1S97A 5I3UA 4CNZA 1XR7A 4JKGB 4F36A 4CT9A 1OS5A 4LH4A 3CULA 2PE8A 4IOCL 3GJQB 1BI4A 3JSMB 5F3ZA 4G1QA 4I6MB 5AQTA 2ALZA 2V4QA 2XM3A 1T95A 3Q8PB 5JLHA 1Q86O 2VIHA 4B3MK 2DHGA 3F41A 1SIWB 1RAOA 3AB4B 4ED3A 3BS9A 2IC3B 3M2VB 3UR0A 4ZK7M 1LWEA 1NHKL 1ZH5A 2YX7A 1CQNA 1YJUA 1NM2A 4KHMA 1HQEB 4YDXA 4PWWA 3C6UA 1C0UA 3P5BP 4L76A 2M52A 3ENQA 3MEKA 4O8UA 3GIIA 5BR9A 1E6YA 3AQOA 3SXLA 3H45C 2RQKA 5HQLA 2ZBQA 1GOAA 3I33A 5M2RA 5GIPA 3RYLA 4RO0A 3H08A 2RNEA 5D78A 4I6WA 1P27B 1Y10A 5GAGP 4C1NK 1FDBA 2BM0A 2Y1IA 4QYZJ 4OZNA 2D3OR 3CPWR 1N33K 2OO4A 5AQIA 1C6VA 1TYQA 4S0MA 4A8YA 3T9NA 1A6LA 2HWIA 4X2BA 4Y2AA 2V2ZA 4KPCA 3T1YJ 3OR2A 3UKUB 4BRLA 2HBZB 3FMBA 3NGRA 3BEXA 2VWBA 1BQNA 3MUTP 3TZXA 4DTPA 1AT1B 2D9PA 1VHXA 2W6KA 2PMHA 3LTOA 4C9DA 3KYLA 5MLCQ 1HBNB 3HHLD 4YDDB 3SAFA 2JL9A 2YNIA 1NO8A 2UXCK 1IG8A 4OI1A 3DLKB 2Y0SD 1NPKA 4F04B 3E9PA 4O0JA 4DV6K 5HK4A 1S99A 3SI6A 1VR6A 2UXCJ 3VEZA 2GC8A 3GYNA 5E41A 3SAGA 4FJ9A 3BGFA 4HUEA 4M63C 4CEOA 4CCHA 3J8AA 1WUAA 1IM4A 3H90A 5M1QA 2KJVA 2UUTA 4B3RF 1VQSA 2EFPA 4LSNB 1X1PA 2EFGA 1H98A 1YTYA 3KMSA 2CA9A 5ETVA 1H2VZ 2GX9A 1VSDA 4JBCA 1GT8A 3KLFB 2GMLA 1Q9XA 4KHRA 4I0WA 1YJRA 2R2RA 5BRHA 3VVUA 3SJJA 4N47A 3I5AA 2A6MA 2RRNA 5F1XA 3A8JA 3WIUA 1YJNS 1NHUA 3SNNA 5ELZA 1R7IA 1T05A 4RNFA 3TR8A 3QT5A 3H1VX 4KHYA 5F9LA 2YNHB 1PC5A 1RT5B 1TFWA 2ROGA 1IBKK 2BUNA 3M5RA 4HYKA 4KO0B 2CRLA 3DRPA 1TAQA 4E7HA 4WXOA 2YHAA 2B51A 4RCHA 1R59O 1D5AA 4B9VA 1RHUB 1ZBFA 1OJ4A 3OYEA 2KB2A 2COLA 7FDRA 4P72A 1P8ZA 2OPSA 1TQLA 3QB0A 3MWBA 2PN6A 3UQSA 1YSJA 2PYLA 1F9EB 3H1QA 2CPHA 1VQ9S 5GMEA 3WNFA 3W64A 4CERA 4I2PB 1KHVA 3C6TA 2G2ZA 4FBUA 2VZ9A 2HQGA 3M9OB 1FRLA 4IFVB 2LYVA 4I2PA 5CYMA 2HRTA 2VJVA 4M3UA 2MTLA 4WFZA 3ZNUA 2YNHA 3MCAB 4P52A 5HQ8A 1NWKA 2QWMA 4X62K 1X7VA 1VQPN 3LZIA 3GTYX 2EFOA 1F5BA 5HRPA 2XS5A 5KFAA 3MK6A 2IAJB 4P2SA 4BVPA 4NYFA 3CQXA 1EJ7L 1FO1A 4UOHA 3WNEA 2ZKTA 5EX0A 2B5JB 5KFFA 1WC5A 1EKSA 3D2EB 1LEOA 1FFGB 4CTAA 1NGJA 4J2EA 3JSYA 2I38A 2HW3A 2EBGA 2U1AA 5DQHA 4F0KA 4HWIA 2HWTA 4Y00A 3KVGA 1B4SA 1S6OA 3AFGA 2UXDK 3NAEA 2CQGA 1PBUA 2XLJA 2MGZA 5M1NA 1NDPA 2BOPA 1HNIA 2DNPA 1QVFM 4LRAA 1HQUB 3CYMA 4PUOB 2AGOA 2R7SA 2FC0A 3MAHA 2NRVA 1YQHA 2R7UA 2I7NA 1VS3A 5HATA 5T41A 3VTHA 3OFGA 3VQ6A 4OV1A 3QFUA 3AD8C 4K25A 3VQDA 2G8IA 4JAXA 2ATQA 1L3SA 5AQOA 4G1IA 3RJMB 5KFQA 4Z4CA 3L3VA 4YHHK 2V9WA 3UN3A 5E0OA 2ASJA 4LMZA 1S72S 2DIVA 1TYQB 4HTJA 3DU6A 2HMIB 2E88A 5LSOA 3UNGC 2NRWA 4IOXA 1X4EA 2V50A 2UP1A 1GH8A 5JMNA 3WEEB 2O8BB 4YHHJ 3MXHP 2HBLA 4IDKB 5HRSA 2WRMA 2ASMA 4CGIA 1WWHA 1S0NA 1S6UA 4CM2A 5D3GB 3FZKA 2FTRA 3AH6A 4DN9A 4TQSA 4CEEA 2R7OA 2RHQB 3MMJA 4PL8A 4CF2A 3CC7N 1S0VA 4Q5VA 1QLNA 1U04A 1BWFO 3JAMY 3IO1A 1X4CA 3O80A 3MEDA 4OJGA 2ZC4A 2MMYA 1MN9A 3IAM9 3H8YA 2Y0BB 2HPUA 5A2QO 4NLSA 4L75A 3PRBA 3RG6A 3AOAA 1FWPA 4CT8A 4H5WA 1R8CA 5KRTA 4FKXA 4AXIA 4CZHA 4BRDA 4X66J 4Z2XA 3DJCA 2CJAA 1R27B 3ZSZA 3W1YC 1XR6A 1K6YA 4JI2F 5KG7A 3CE8A 3HHLB 4CZIA 3IM9A 1I94J 5GAHU 2K3KA 3OV7A 1FJ7A 4KYZA 5D6GA 4NZ7A 1GAOA 4AUKA 1CZAN 3PIPL 4KHPF 3QT6A 4UOFA 3QGGA 3NNCA 2CFXA 4BC9A 4E7JA 1B3TA 1RAHB 1GXUA 1TKXA 1VRTA 4KPYA 5IS2A 1U1OA 1O5JA 4NZ6A 4YOEA 3O1WA 2QM1A 1HARA 2WVEA 2YI1A 4ZVQB 3ZT3A 5AQWA 3UKRA 5KFJA 1B7FA 4AL5A 5A8KB 4FL9A 1YBAA 2DCLA 4ZP6A 3IWXA 1YJNN 1TKTA 2Z2ZA 2UUCJ 4UF4A 3NP5A 4WE1A 3CO9A 2VDIA 4NA3A 2QO3A 2J9EA 5CZVA 1DARA 2VDHA 3THXA 4QIFA 1JCFA 2HVZA 4DR7F 2E44A 3M4XA 5CH7B 3NY0A 4XDCA 3TQEA 4EK2A 3CJKB 3W2WB 4H8KA 4KBOA 2EXUA 2V6AA 1SIZA 2YKMB 5MAOA 2ASYA 4I7FA 4DX7A 1K8AO 1T11A 3MR7A 4QS9A 3SCKE 3CWJA 4U8YA 3G6EN 3G8QA 3V4MA 1XC3A 2ZJPL 2IDOA 4CLLA 5DGAA 1KXPA 3RR7A 1Q8IA 1E6YB 4R25A 2ZQBA 4MDBA 4ILRA 4H4OB 2I1RA 4CDIA 1S1XB 3NS5A 1BXNA 4F50A 4GC6A 4V19J 1WSIA 4DCOB 1Y3JA 3OYNA 1MWMA 1FE0A 1RDBA 5ETTA 3SSQA 3H2LA 4Y2KA 4JI0J 2ZM6J 1W9HA 4NRTA 4JHDA 2VODA 1VQOS 4WF9L 3W2WA 3HSZA 2C3YA 2NREA 1Y4ZB 4G65A 3KG4A 4JKCA 3C6HA 3EGNA 4DL7A 4PCQA 4BR9A 1C4CA 4FCYA 4X4OA 2P9NA 1S9EA 3JSRA 3F9KA 5KFPA 4CZGA 2EEYA 1HQEA 2IPOB 1S1VB 1WORA 1IKWB 5A6WA 2HS4A 1SQFA 1HA1A 2W42A 3THYB 1W97L 3OUYA 2HHQA 2QG9B 2XY6A 3MFHA 5KG0A 3D2FA 4PG7A 1BQXA 3EZUA 3MOZA 3PKYA 3OJSA 5AQUA 4FW1A 5T7LA 4Y0FA 4B3OA 4A5BA 2JOQA 2DGQA 3V6JA 3WC0A 3RSEA 5F8JA 1RKJA 3T5LA 1XQSC 3ULHA 4EO8A 4IDKA 2WVDA 1NB2A 4C0BA 4CEDA 5GMDA 5LMUJ 3J7YI 2YKMA 2HNDB 1KC8T 1WHWA 1K9MO 1VRUA 1QDUB 2XQCA 4F02A 3QBXA 3D3CJ 1IUJA 3K5NA 1WHXA 3KTQA 1VBZA 3TSQA 1GXTA 5KT3A 2ZBPA 3DLJA 3R97A 3KLEB 2FSJA 3DM2A 2Y8YA 4CGDA 5BXIA 1FX4A 2YH1A 3CGIA 3LDOA 2DO0A 1BWVA 3VA3A 4ALZA 1E3MA 1XMOK 2FVCA 1YZ6A 4WYLA 3FEYB 1Q81O 4MKVA 4YB5A 5A0YA 2BMBA 1CC7A 3ZZPA 4OYMA 2O1PA 1XIQA 3KXDA 5FIIA 2K7JA 3PX6A 2KG0A 1FJGF 3NF7A 1EB0A 1HI0P 1ZAVA 4FPBA 4ZVEA 2CJBA 2W6LA 1CJVB 1RHMB 4C11A 5L1KA 3QSIA 4UQGA 3MWPA 1YWXA 3BJYA 1QE1A 3L8BA 1UEKA 1RWNB 4DL0C 4B3TJ 3TABA 4N8NA 4GVLA 1RT4A 4ITSA 4RU2A 3TQ1A 1WHYA 1ZM4A 1GLFO 2YWHA 1JJ4A 4CLTA 4B3TK 2MLYA 5GVQA 5KT7A 2BE7D 4FPRA 1RBUA 4TQRA 3LM9A 5ETPA 1O0PA 3E8OA 2O4GA 3T69A 1RT4B 2QA1A 2KKZA 4KGVB 4KHNA 1FW6A 3DI6A 3CFPA 3K89A 3FFKB 4M41A 1IR1A 3D6RA 5AQGA 2E2NA 5DDRC 4X4PA 1RKIA 3O3FA 3IS9B 4GV3A 4IOAL 4M5MA 1IG9A 3PZPA 4CJTA 2QL5B 3VCDA 3FCWA 4LFBK 2V2VA 3DLRA 4QBUA 3AB2B 2V4RA 1WC3A 4CJ5A 3M6VA 3BKFA 4B3SF 2IVFB 3EGZA 2PEHA 4A8SA 4X64F 1ZBHA 5D0RA 2Z1JA 1FKAF 1ACMB 1XWLA 5CCLA 3NCQA 3NH2A 3RW6A 4JV0A 1Q78A 2R8GA 2PFDA 1SZ2A 3PIOL 3VEXA 1WJ9A 1N5VA 1D8YA 4IWVA 4OV6A 4CIFA 1LWFA 3HFKA 1BL3A 3B82A 2FBTA 3DXKA 5LJWA 3V9XA 3MPDA 2AGQA 3LP1B 3RRHA 1HR0F 2EK1A 2CKWA 5J1EB 4BE2A 4OYAA 1YJTA 4HL9A 2DO4A 1WG1A 4NXMJ 2GGPB 4Z4IA 3NF9A 2OD6A 4YY3J 1RT1A 1RTZA 3MPYA 4RUBA 3MAAA 3R5DA 2NXUA 3M30A 3BQ2A 3FFIA 2BM1A 5G4DA 2G8FA 2KFNA 2GZOA 2XGQA 2RHKA 3KKRA 3KJVA 2AYBA 1QTMA 1RTHA 1FRHA 3FQKA 1VBKA 3D4JA 2B9YA 1S6QA 1KSPA 2XG8A 2J9DE 4MFBB 3PR4A 2F7VA 3OR2B 3GONA 4LH5A 1JL1A 2EPIA 2B4PA 1KVJA 3D2FB 2FC8A 4YMEA 4URGA 4AQYF 2ZKUA 1B0VA 3KK3A 4Q7AA 3TJ8A 4CHQA 3OTOJ 3K2PA 3CDUA 5AE1A 4XK8C 3TZWA 4C48A 2IA6A 2EHGA 1KBRA 2VPXB 3LP0B 1FRMA 1JJHA 4M94A 3GBTA 3OYBA 3LP3A 3ENVA 4DV5F 1A7GE 1IBMK 3NS6A 4Z4FA 3IXQA 2E5JA 3RMCA 4KB1A 3NCIA 1QQMA 3S41A 3EPGA 2V8DA 4PY5A 4M5KA 3L2QA 1DJ0A 4QR0A 5HMZA 3TAFA 3CI5A 2ZUGA 1L5UA 3FCVA 1QVGR 1YKWA 2QLFB 4DTOA 3KLFA 4LC9B 5KFXA 2BKNA 3PKMA 4RUHA 2HHWA 4DQPA 5CCMA 4MK7A 2P9LB 4B1WB 2L3MA 3S3MA 2CAJA 4C3LA 5LMUF 3PY8A 3MCPA 1YF5L 4UTGA 2VQFF 2CG8A 2DTJA 1N8RO 4E2FB 3D1HA 5KG6A 3ET6A 2HNDA 1AXQA 2MZ1A 4ISFA 3MMCB 4JI8J 1MA9B 3EYZA 1NGFA 2CGKA 1GLBG 3CXCR 4H0YB 1EETA 1RDCA 1BWEA 3GP9A 1TUYA 4JP8A 5ADZA 1RWVB 5G0RB 1B92A 3Q83A 2RD5C 4ISGA 1UAWA 4WFBQ 1SV5B 2NZCA 1F0XA 4TU7A 4CVNE 3R1XA 1I3OB 2DGUA 4QIWD 3AGRA 4GNIA 4F7VA 2DR8A 3E9OA 1NZAA 4AF1A 2VOOA 4RW8B 1H1VA 3ZC4A 3DOMB 2ZH6A 4Q0BB 3MAQA 1ZM2A 3A5LC 1VMBA 1VSEA 1SJ4P 1RBSA 3FBBA 4K4TA 3MEEA 3UPFA 4DR6J 4LF4K 4J9MA 3CF5L 1N36J 1SL2A 4DV2K 5TKWA 4FJGA 1G7CB 5AQJA 3ZNJ1 3EE9A 4OPKA 3CJQA 4ZA1A 5KOXA 2H5EA 3MEEB 1NB7A 1LOTB 4CI0B 4H4KC 3AODA 3MUVP 4PQUA 4TVAB 3UCGA 5F2RA 4AHCA 2K7KA 1WKKA 4EFAC 3LWLA 2F4VJ 2MKIA 3M9MB 2RH3A 2MQPA 3LP0A 3OS0A 3FKBA 3VA0A 4PAAA 4G1QB 5KG2A 1K8KA 1C0TA 4P10A 4MDAA 4E7LA 2FZGB 4ED4A 4M7XA 3L0QA 3L95X 2ZEJA 4C8ZA 2XS2A 4XH1A 2DT9A 3KDNA 3Q22A 2R42A 3D7SB 3W60A 3CC4N 2W1BA 4ETXA 3CPWM 2A41A 2ZF5O 3QGPA 2GA7A 1OQ6A 2VB6A 1S77D 4PL7A 3H3NO 1SQEA 3AVCA 1ZPVA 3UD5A 3LDPA 1UL3A 3BF4A 2MHEA 1KOOA 3MGJA 3R1LA 1YI2N 2P9KB 3OA9A 3BZCA 4JI8F 2E1RA 3LDLA 3K7RA 4QZVB 1L3KA 3MMVA 3L2WA 1XHZA 1T3VA 1OPIA 2RUGA 4DF8A 3VF4A 5DM6L 1EWRA 2ZUAA 3PEHA 1ZBTA 2G0CA 3CNQP 1NGGA 3QYYA 4DSIA 3CC7S 5AZIB 3WUHA 4OLPA 4A62A 3SCXA 3NOGA 3GV7B 3CMAS 2PA8D 1JCGA 3EPIA 1RWOB 2RU3A 1OVYA 4CJPA 5EVZA 2ZVSA 2HNYA 1HKAA 1S5ZA 3ZX3A 1NGEA 1S57A 4CLKA 3O8WA 3MF5A 4ZLJA 4WBFA 4LUBA 2FHOB 3OR1B 4M5IA 5L8RC 2DK2A 4HHUA 4YOWA 2PMWA 3I9V9 4KKOB 2D0AA 2QJ3A 1M1KO 2DB1A 3H2UB 5LJ3Y 4XIUA 3A8KA 3SQ0A 5JS2A 2HRYA 3QRQA 4PXDA 1U09A 4A5AA 1NOZA 3L4QA 2MQLA 1QY7A 1K73T 2L08A 2W7AA 1QSLA 3BREA 1R3NA 3TVKA 1U1PA 3U1LA 1MDUB 4O8KA 1GEHA 1HWLA 2HQIA 1RLDA 1KEKA 3DNCA 1G3OA 1FTCA 2FJDB 3VQCA 3TVZA 4IO9L 1WC6A 3WX4A 3CC2S 4H5RA 1YK9A 2HS3A 1IKVB 4LY7A 4DV7F 4Z4HA 5JJBA 2LECA 4DSJA 1S6PA 2KRRA 2NPIA 5K14B 2V8PA 1VC0A 1NGAA 4CQ1A 2D4WA 1S1WB 4OHZA 4CLZA 3RR8A 2RIJA 4P9SA 3PLAA 1P9QC 1JLFB 2BE9B 3QLHB 3HDSA 1DGKN 3SBMA 4I67A 1F9FA 3OW2M 4C7QA 2KN4A 3S8SA 3C65A 4B3MJ 2OKQA 1U24A 1RTJB 2OPQB 1GMWA 1H74A 5KFEA 4UUXA 5EWFA 2PSZA 1XNRJ 2A1SA 3EUNA 2YKNA 5JLFA 1UA1A 1T6CA 4MO4A 2DNKA 1NZ8A 1KNZA 1XMOJ 2IM2A 4RW6B 5HOOA 1YVFA 2FVRA 4DUZF 2X3DA 1U6FA 5AJ3F 3MFIA 4OQJA 1C1BA 3R27A 4HDGA 4B9SA 4J2DA 2GQCA 2V68A 2W7OA 4ZVHA 1I6JA 3DOMA 5HL7Q 3RAMA 7FD1A 3GB0A 3QESA 4MAKA 4X64J 1GTEA 2YPYA 2IOCA 2KKHA 3SCIE 4X4TA 1F5AA 1FA0A 4IUFA 4CD1A 1Z05A 1FNXH 3PSFA 3O1LA 3W5XA 1B0TA 3EDRB 4FLTA 4Y1DA 1VHIA 3NOCA 2BJ3A 4OYWA 3HF5A 5A8RB 5AXNA 5C24B 1GX6A 2M2BA 3R9LA 1VQ7N 4ZHRB 2X7IA 4BR0A 2OYQA 3QNWB 2MB0B 3VZHA 4OO1J 4F3OA 1JMTA 2D7SA 4M3TA 2HZAA 3C15A 3SQ4A 3AVNA 4CFCA 2XWYA 1RE1B 1UPMB 2V94A 5HP1A 2APOA 4KH1B 3CF5Q 2BKOA 1ASUA 4JI4J 3LGHA 4BRHA 2C2MB 4LF7J 1KKHA 3WIVA 2A10A 2RKIB 2RMLA 3O4NA 1Y9OA 3VAGA 4A46A 3AD7C 1UFWA 4NRUA 4CEFA 1VQON 1VC6A 3M2UB 2DHAA 3WQPA 1F60B 4LF7K 2I8EA 2HQCA 1PKUA 2UVUA 4GKJK 4CGGA 3SQ1A 4DV7J 4QU6A 2N3LA 3B8HA 3G0ZA 1RT5A 1FKPA 4UQTA 4B3RJ 3THVA 2MKSA 3D5MA 3CCVN 1W2IA 4LJMA 4YOUA 3CCJN 4I9LA 1ZC6A 2UXBF 3P45B 4JI5J 3CM5A 3HJVA 3VTIA 4X65F 2HNYB 2FD2A 2V69A 3WC2A 1T44A 1HNXJ 3KK1A 2R8IA 2VASA 3AY0A 2AP1A 4ANDA 4I1TA 2RS8A 1S9GA 4JV2A 3ISND 4N7TA 2E20A 2ZHAA 1WSHA 1BIUA 4AH9A 3JTNA 1MROA 5EXWA 3M8SA 5L9NA 3BPSP 3B6OA 2DYAA 4JRQA 2OHDA 5KFWA 3OJUA 4K0KJ 3KG1A 3NGTA 4DPXA 4USJC 1LK7A 2LQ8A 4WQ4C 4O3OA 2H3GX 4ED1A 1IBKJ 2B3TB 1X4GA 4LT6A 4JI4K 3CDAA 2RU9A 4OGEA 1NCLA 4DCHA 1FRXA 5KFZA 1CJTB 1N5YA 5LMNF 3W9JA 2YTCA 1KD1O 3M32A 4HACA 4W90B 1WHVA 3IC1A 2LXUA 4IH7A 3D54A 2BKPA 3T5HA 2G13A 4M5DA 4DMZA 2IA0A 4MKYA 3MI7X 2EX3A 4QWCA 1KOHA 2CWXA 1GK8A 4CYUB 3LP1A 2ZM6F 5HANA 4HH0A 1RBAA 4DSFA 4O3SA 3OXGA 4P7VA 1KQKA 2DRAA 1JLEB 1FJGK 1JLCB 1KDNA 4LR8A 4TKTA 3RBZA 2J0SD 1XUPO 4RWWA 1SC4B 2QWQA 3RWUA 5HMYA 4G9ZA 2CQIA 1GLEG 3OXFA 4RNNA 4DUYK 4UY8O 2RKIA 4O23A 4OI3A 3HSDA 1VK3A 4P2XA 3IRXA 3FEZA 3FZHA 2JLGA 4XH4A 3H5XA 4Q0BA 2B9XA 3DI6B 1U49A 5F8HA 5FROA 3FCHA 3AXKA 4NXMK 3ILJA 3VAIA 1VQ4S 3LDQA 3GIJA 3EGVA 4U6PA 4USTA 4JKHA 1VQ8S 2KM8B 5ETRA 4HT7A 3N6NA 1S5JA 4I7FB 3A3PB 3SPYA 4ZPBA 5DETA 4WCEL 5CD4A 2IC3A 2GHPA 1CG2A 4ZPTR 5BN8A 4ZLPA 5DDOC 3T1HF 1RTHB 1M90O 3FQLA 3I0SB 4CIOA 1MWQA 3B78A 5A2QU 3MD1A 3QNNA 2FBYA 4UOCA 1IKVA 3HOSA 1D9DA 2P9IA 5DQIA 1Z1ZA 3SDEB 3A3OB 4JYAF 2YY3A 4B3SK 3H5YA 4H54A 1BI4B 3ZZYA 4JYAJ 3BBBA 1Q79A 4X64K 1GX5A 4FLZA 4IG3B 2QRRA 2EWHA 3UE5A 5A0YB 5L1JA 1VDHA 3RRKA 4DQIA 1S76D 1NKCA 2R8JA 1RWXB 1MU2B 1U7LA 1GQEA 4KBIA 2C3UA 2VBZA 1YJ9S 3LW5C 1N0UA 4J9VA 4JI7F 4LFAF 5E84A 3DYAB 1U8WA 1QQOA 1I94F 4CBXA 2LQJA 3CFOA 1QUPA 1LAVA 2OELA 4WFYA 5IC6B 4FF4A 3AA8A 1NJXA 2AJ1A 4ECQA 2ZNYA 5DMRA 2YNFA 2XLKA 4I56A 1RP5A 4ECVA 4DX6A 3TJ9A 3M8RA 4IG0B 2C2KB 4LF9F 4CZJA 3J7ZO 4FJMA 2XHBA 1XJWB 4DR6F 4OI4A 4ECZA 3JQMA 2AW0A 2XYPB 2W8LA 5IQQA 1S12A 5L1LA 4B9MA 1YDLA 3GSDA 4ED2A 2MKHA 1NXIA 4V1Ak 2M70A 3MR2A 4LIRA 2OFGX 3TJAA 1YZ7A 1RDDA 5MLCV 1REVB 4QS8A 2O01C 2MY7A 8AT1B 4FS1A 2V51B 1LWCA 1WI6A 3DLGA 4NE9C 3QRRA 2CNOB 4DL4A 3BO3A 4Q8FA 4AQYK 5AQMA 1S0OA 1M1KT 3FZBA 3THWA 3CW2C 3FZ2A 1JLFA 3PYEA 1H2TZ 3ZSWA 1I51B 3TARA 1JLAA 1ZETA 4DJBA 4ZVTB 5KT2A 2DPNA 3C14A 3VWSA 2FHJA 1X0PA 1EWQA 1HQUA 4EBEA 3MD3A 4UZBA 4M42A 1URNA 1RT7B 4FM1A 4X4QA 1YUWA 2P9PB 1DBDA 1JJ2R 4CF9A 1S9FA 5C2DA 1H7WA 1ZS6A 1GFWB 3HXMA 1FFWB 2FSKA 2N7CA 4GVBA 1GXLA 2AD9A 4WU3A 2G9OA 4IG0A 4FF2A 3A4TA 3RMBA 3WXJA 4DR1J 4F8RA 2IYGA 5SUHA 6FD1A 4K7QA 4LF8K 1RNHA 2G8KA 4QAGA 1XI1A 2JEIA 2XYGB 4RX6A 1RU2A 1SC3B 4TNOA 5KFSA 2C2NA 3NWRA 2VFUA 1XMQF 2DFFA 2VHGA 2F7TA 3RBXA 3DCAA 2J6TA 3UN5A 1RHKB 4E1NA 4ICLA 4KJIA 3FSYA 4P2MA 1KCFA 1IQZA 4TY8A 1LK5A 1CLFA 3LZJA 4A8FA 1BHLA 2CGJA 3IG1A 4IH5A 4GO5X 4BE0A 1FVSA 4ZP7A 4DG1B 4I69A 2FJXA 3I4HX 5SZTA 2WB1D 4PXCA 1Q86T 1UETA 2ZWOA 3BSNA 4JLHA 1UKUA 2DNZA 4FDFA 3J80U 4W5RA 1QHAA 3FDSA 2B0GA 1CZ9A 3PHEA 3TAMB 4YORA 1C1CB 4M8LA 3CSKA 3G87A 3N79A 3M6UA 3H98A 2MJUA 4NXNF 3CCMS 3IBWA 5HQMA 2J0XA 4YFUA 2IS3A 4DR3F 4P75A 1T7PA 2HLTA 1QTNB 1FCAA 4CHZA 2BJ7A 3CJSA 4USWA 4F67A 1QVFR 3VENA 4H03B 3X1LB 3ZYYX 3Q8SB 2V8VA 4ER8A 5CHIA 4C4WA 1IKXA 4Y3CA 5CD4H 2Q1NA 3FSXA 1HBUB 1RU1A 3AJ2A 2AZ3A 4LF6K 3MXMA 1PYTA 2LQBA 4ED8A 3CCZA 5KOWA 3CJ2A 4J7CA 5AQNA 2DRDA 2QLBB 3JYTA 2NS1B 1VJQA 3M32B 4HACB 2QA4S 2VPZB 1ZA1B 5EUHA 2KVQE 4DCPB 5KG5A 3OXLA 5FLXY 3PUFA 1BQMA 4JEPA 1R89A 3QBCA 2VKRA 1SKWA 4V19X 4EHTA 1FRJA 4CO5A 2JWKA 1BMQB 2BTFA 5J2MA 5G0RA 3G25A 3ILIA 2PFFB 4KH0B 4TN2A 1UOCA 3DDNA 4I6MA 2XI2A 3I0RA 2R2UA 4C0HA 3D28A 3P4UB 3QEXA 4WJBA 3QIPA 4ED0A 2ZH7A 3MN7A 4CZFA 4CO0A 2FHMA 1H2UX 1PJ5A 1RXOB 1JXBA 1RACB 2NZTA 4KHWA 3HOTA 3H4DA 3QATA 1IJFB 5C15A 4DEZA 4JI6F 4NYPA 1OYEA 4DR1K 2A40A 2PIIA 5BYRA 4WP9A 2OMOA 1U1KA 4ZP9A 4DHYA 2VD3A 1BA0A 3TZZA 2GTDA 2V67A 1VQ9N 4JV5K 4C8MA 4DV1K 1TKXB 3UDEA 4PXBA 2XBPA 1YJWS 3ZT4A 2D9OA 3CIMA 2KXNB 3NF6A 3M6GA 1GOCA 2EFQA 6AT1B 1NK9A 4O5BA 4CO1A 1HKCA 4DU1A 3H7HB 4OX9F 2BXJA 1C0UB 2OPRB 2HSEB 3TPQA 3AY9A 2IRYA 1T9WA 3TAEA 3K58A 2RVJA 4H4OA 1R0AA 1T02A 1WEYA 4J9UE 1N6QB 4YOYA 2EW9A 1RTIB 2YJFA 2G1HA 5B09A 4CJ7A 1S1WA 3N5FA 1CZBA 3A5MC 4KTWA 1N36F 3K8WA 3Q8YA 2AF6A 1G1XA 2BJEA 2MJNA 3C3LA 2K3IA 1G6BA 3O9QA 2CIMA 1P9YA 3V1RA 3OL8A 1ATNA 1VSFA 2Z1IA 3LP2A 3E01B 4Y2MA 3DGPA 3T1YF 3CCWA 4DR4J 3Q8QB 4DU7A 4ZKAA 4R8UB 1Y7PA 3P3DA 1RWPB 4OHXA 4JKGA 2QZ8A 3ID6A 2DH7A 5KTQA 3N6LA 4ZITA 3UDCA 3F0NA 4OHYA 5KFBA 4NOHA 4UOGA 2UU9J 2EKNA 1XNRK 1PAEX 5IT9Y 3IAS9 1FK9A 3GFXA 2HBQB 2ZZNA 3DLEB 3AO4A 2J6UA 3OYKA 1EAYC 5L39A 1DQAA 1SC1B 3CG7A 1FJEB 2WTFA 4PKDB 4X62J 5GINA 1VIXA 2UXDF 1NRKA 2B7BB 3D1QA 3IUCA 5AJ3K 4C97A 3C46A 1KHWA 5LMNJ 4CEQA 3OTBA 3OPKA 1S7HA 2DXDA 3P6YC 4OZLA 3MM6A 2IJRA 2GGPA 4D3HA 1BGXT 4IR9A 4IR1A 4NYOA 5HVGA 4GKKJ 2DEIA 3OVBA 3ZTSA 3GLJA 4CHYA 3PG9A 2ACYA 3BZQA 4DFPA 1SKUB 3G4SN 2V4JA 4C3KA 1SVDA 1NH7A 3O5BA 1HWKA 2HWHA 1J6ZA 4LFCJ 3KWGA 5ETLA 1ITGA 3L9ZA 3HYFA 1RA6A 1V4TA 1CPZA 3MM5A 1IBLF 4PPDA 3VQAA 3G6XA 1K0TA 4A2BA 4M3YA 4UY85 1OKJA 3I87A 1SCJB 3CTRA 4GMKA 5KT4A 3ZSQA 5LM7E 2YNIB 5GAEU 2Y1LB 1Y64A 2E7XA 1VSLA 4FLYA 3DXMB 4RNHA 4FWOA 1HNVA 2QA4N 5DM7L 5CE3A 2XLIA 3M9NB 2EK6A 1IKYA 4JI3F 2GBZA 1MWYA 2W2QP 3VEYA 2J5AA 1JQGA 4PYAA 4ZDNA 1X3MA 1T03B 4GO7X 1SJRA 4IOBA 3VQSA 3W61A 2NXCA 4NEZA 2DY1A 3FEXB 5BR8K 4AILC 4EAHD 3W9HA 4DKWA 4TSXA 2P9NB 3N28A 3H3OB 2DFHA 4RUAA 4LF7F 3NGUA 3EVMA 1RLCL 3OYJA 1NDKA 2P8IA 3F56A 4CF1A 3A8EA 3IM8A 3DXSX 4KR0B 1WOSA 3AV9A 1HIYA 4WTOB 1ZZNA 4AHRA 3B6PA 3PJ9A 1VJWA 3AVLA 1U2RA 3AVKA 2GCFA 5DG7A 4KHQA 2OA8A 4X66F 2BQUA 1BISA 2HHHF 2DTUA 1IJEB 1Q5YA 3EZOA 5IWAF 3RU0A 3BP8A 2XCPA 3OSNA 1R31A 2BE2A 1VI7A 4NX9A 3HKZD 1AFIA 4CJEA 1N33J 3TEHB 4TYAA 2NNWA 4DV4F 1HW8A 3BO4A 5CQGA 4FJLA 3H5SA 5CY4A 3D3BJ 4WZMA 2UUAF 1FWLA 2QT7A 5KI6A 2HFSA 3CJ8A 4LF5F 1KLNA 2FGOA 5T14A 3OYIA 1O1WA 4AHVA 3GFYA 1V4SA 3M6WA 5CYQB 3S1TA 4IG3A 2Z2LA 1Y5NB 3V5RA 3NGIA 3CD7A 2UU9K 3AGKA 4PPZA 5CHCB 5AXKA 1RWMB 2C3OA 3BBCA 1TUWA 2V8HA 5JVGQ 1CBKA 1B9DA 3I32A 2RDDA 4C8LA 3OBWA 1S9EB 4FP9A 1T9YA 4YN3B 4B1YB 5T7BA 1O6XA 3E1YA 5DK5A 3ZSXA 2PY5A 9RUBA 3OSPA 1RCXB 3BR9A 1EX4A 4KO0A 2K1RB 2E5GA 4TXSA 4L3KA 3ZTQA 3R6LB 2ZM6K 2FUG9 4IKFA 1U47A 4RLEA 4LRBA 4CYUA 1ZYQA 1SL0A 1S1UA 1CQMA 3HLUA 1N34K 1RAGB 4DQ8A 2CZ9A 2Q36A 3MEDB 4W92B 3RUBL 1JLCA 5IT9U 1WOPA 5I9EB 3U8XA 4DU3A 4OX8A 2NYIA 1NGIA 4ATNA 3F73A 3SSSA 1W2BM 3QZ8A 4QWBA 3TYTA 2H3EB 2YKPA 2Q43A 1FWKA 2AV5A 4CJUA 1OMSA 3U9ZA 3KHYA 2QE5A 4U67Q 3KG0A 3O4QA 3C94A 4M5DB 1HR0J 1BHNA 3S01A 4KFBA 4RW8A 4DSLA 4BRCA 3CCLS 2JSXA 3N01A 4QCLA 4ZVPB 2HVHA 2YBVA 1N33F 2Q2RA 1JL2A 1WAJA 2CQHA 5GAGU 1M0SA 4QIGA 2KFZA 5FRMA 1Q82T 3CJ4A 3T9ZA 5HLFB 4ZJQA 1JXVA 4I64A 2HGLA 4CIEA 2HHSA 4OZ3A 4HHHA 1FDNA 1DT9A 3BF1A 1QS4A 3AQPA 1AA1B 3T19A 4DQQA 3WXKA 2IMOA 5FD1A 2WVBA 1VSIA 2JEJA 1X3NA 1SS6A 1FEHA 3ZSRA 4O4GB 1C1CA 1X4FA 3VQEA 4PYDA 2VC0A 1RDUA 3R5AA 1S1TB 5LT5A 5DM7Q 1Q9YA 3UR3C 4USMA 2N7YA 3O9UA 3V2UC 4CJFA 4DB3A 1AUSL 5J2MB 3SMPA 5KRSA 1CJKA 5E3AA 3MDQA 2KQ2A 3CFRA 2E1YA 2CPEA 3GILA 2CZVC 1N88A 4B17A 4X4RA 2IM1A 1LCUA 1RBRA 1UPPA 4X4VA 1J27A 2B4VA 4WU2A 2ZJRQ 4PZVA 3CXCM 1X5SA 3ENBA 2GQQA 2JZ5A 3PM9A 4DR6K 2ZH8A 4PG8A 3UO0A 3RRGA 5EHHA 4WFBL 4C3MA 5EOYA 2GJIA 4EO6A 1RCOB 2DEJA 2BACA 4H0OA 1TV6A 1NKBA 1FNMA 3ZEUA 3FNNA 3RZAA 3OLAA 1FKPB 1BDGA 4Y34A 4U9RA 2IVPA 3VOVA 1K47A 2BDPA 3I56N 3SFGA 4L8RB 2CWKA 4ECRA 4DTXA 1NAQA 2N4DA 1K44A 3FUYA 4J9LA 4J2BA 2L9WA 5EY4A 4ZTFA 1OY8A 3NFAA 2V8GA 2ETJA 2KXFA 3QFHA 3H6EA 4DPOA 1HWUA 3C16A 3LUYA 5K5MA 4C0OC 3CPEA 3H46O 3RB6A 4WQ4A 2CZ4A 1FESA 2LKZA 4YR3A 3R5GA 3OYFA 1B99A 2WCXA 4KRWA 4CO3A 3ZSVA 3SBTA 3NF8A 1QD1A 3ASMA 4KV8A 4A8XA 1PC4A 3VQTA 4ES1A 1RABB 4USIA 4RR5A 4C8YA 2AP6A 1HNIB 1Q4RA 3R8EA 3PCOB 2HB5A 3DOLB 1U2CA 4YB1P 1CJUB 1UJ5A 3DRRA 4IFYB 3D67A 4PKGA 1WTBA 4WKYA 4CTAB 2AJ2A 3UWTA 5L9XA 2P9EA 4OGCA 1TU0B 3IWNC 4V19S 5C2FA 3MUMP 2B6AA 2B56A 1XMQK 2HIYA 2WAQD 1QJHA 5DS7A 4F25A 4MJKA 1WF1A 2QA4G 4JRPA 4X4NA 1AB8A 1WC1A 1HX1A 1IO2A 3SUNA 5DDQC 2DGXA 5I42B 2BRKA 3EWGA 4R5PB 2PC6A 3TRGA 4MTPA 2J8AA 2D0CA 2GUIA 4O4RA 4H0PA 3EEQA 3TU5A 2VICA 3EE8A 2HFOA 1D8ZA 4ZPCA 3KK2B 3CCTA 2HGMA 4FO0A 4XO0A 2NZ4A 4JI0F 3W2VA 2HQ3A 2MQQA 1J54A 4K2XA 3E66A 3HVRA 3P31A 3HPHA 3L09A 3OL6A 3EXCX 4PABA 2JEGA 2VPYB 5U47A 3H0PA 2X3GA 5E3PA 2NLXA 3DGPB 1A0OB 3VQ9A 4PRFA 3CEDA 3O9SA 2VG6A 2XSFA 4ZN3A 2DVIA 1DTQB 3ZTRA 2ZGZA 1JX4A 4OPHA 1C0MA 4OZ2A 3N9UC 3EJMA 5FLXU 4QIEA 2KHOA 1ROFA 3GV8B 3WBZA 4NASA 4HHJA 4CLYA 2IDLA 3TTDA 4J9RA 3I96A 2UUWA 3OTOF 1CULB 2FLNA 4PR6A 2JC1A 2OCEA 1NSAA 4BHQA 3FK4A 1ZPWX 1TELA 3M6XA 2MSTA 3JS9A 4O55A 3VAFA 3CD6N 1NGHA 1FXRA 2QMWA 3DRSA 2CNKB 5AZIA 1NK0A 3FBCA 2OZSA 3PO5A 4TY9A 4WFAL 3HULA 1O8BA 3L4BC 1TGOA 3KDOA 1U1QA 3ALYA 3EKSA 2VQFK 2UV8G 3L6QA 1HNXK 1W26A 5M1OA 3GPAA 4Z4EA 4DV3F 3HX9A 2KH9A 4LSNA 1WAFA 1XHXA 4E1JA 3HP9A 3NMUA 3L3CA 4BRGA 2KT2A 5C12A 1J5EJ 1TMJA 1NNDA 3M1VA 2QWRA 3VV2B 4NYZA 5C2GA 4J9QA 3GG0A 4U7CA 3AAPA 4YUDA 3BY5A 2GEMA 4IDHA 1KLMB 4BRIA 2HQFA 3G82A 3HI9A 3RMDA 2YX6A 1VRQC 3NKYA 4OX6A 3L7UA 3O3HA 1IN0A 3BH6B 2O66A 1FVQA 1V6HA 1JXLA 3W9IA 3T6BA 1E4FT 1EHWA 3LGNA 2FLPA 2MKYA 3HD1A 1I3AA 2CJ9A 4DL2A 4CLUA 3QMQA 4DV0J 5EWGA 1FD8A 1MN7A 1D0EA 1BO5O 3L2RA 3ID8A 2WTUA 2IDEA 1FKOA 3QPIA 5A6PA 3B4MA 2BGGA 4LF9J 2E5LK 3B4DA 3CJKA 2R7RA 4C8NA 3Q8UA 4LSLB 2DKOB 3G4SS 4IRDA 1D9FA 2HSTA 2P9KA 4DV1F 1ITPA 3G8SA 5HBMB 3KUEA 4RZRA 1TL4A 3Q2TC 4CK1A 1BQNB 2B9EA 2BQRA 2FF3B 3BM7A 4JS4A 2Y1RI 5ADXH 1M1GA 2J76E 4WFXA 2IRXA 2WBMA 2G8VA 1TKZB 2B7CB 2JX2A 2P9SB 4JHDB 3FGUA 1PYSB 3QZ7A 2E1CA 1JLQA 4ECXA 4ZVFA 2LEBA 4KAZA 4M7YA 2DY4A 2OANA 3VGMA 2VQEJ 3M8PB 4QWAA 2Q3PA 2QWNA 4FWLA 2KDOA 1ZBIA 2QW9A 3QDKA 4BG9A 3LL3A 5HVHA 4C6AA 5EGYA 1QM9A 1SQKA 4LF6J 5D0GA 4B08A 3EO3A 2GJFA 1GLJO 2MLZA 1XMBA 1XNQF 2E66A 4HLBA 5KPRA 4BWMA 3VETA 3UIQA 2E9TA 1HNWK 3SCLE 5LXYA 3T1YK 3W62A 2PD1A 3TAQA 3CD5A 2GELA 3IBCB 1YAGA 3RGIA 3L7OA 4B9UA 1HNWJ 2W8KA 5GAEI 2OSQA 2VG7A 4DLEA 3ETOA 3O6QA 1LQ9A 3GJTB 2HRUA 4BGBA 1H7XA 4ECTA 3GSIA 3R6GB 1MLAA 5HAOA 1UWBA 1FD2A 1YLXA 3RMAA 4P2FA 1Y00A 3PX0A 4NMLA 3CIZA 1IR2A 1Z4UA 3WEEA 4HCCA 1N34J 3ICLA 3UDVA 2XNRA 4CW7B 3PSIA 5BPNA 2HOEA 2YNGB 1UVKA 1NBEB 2CNNB 5J2NB 2C22A 3S6EA 3BQ1A 2YHYA 2CH6A 4K2JA 4FN5A 3QJJA 2CVEA 1BD6A 1LKZA 4IQMA 3H5UA 3W8GA 3TX0A 3VAKA 4M95A 2IIHA 2VYPA 4WYWA 3DC2A 2IVMA 4E19A 3IMXA 4HVZA 2IVOA 3J7A1 4HUFA 3A3NB 3QFPA 4CIGA 2W01A 1X8DA 1GLDG 2F96A 5IT9O 4NLWA 2GVDA 4DS4A 2AZ1A 2G2YA 2FC9A 4EI2A 4YP3A 3FZMA 5LJVA 2OEJA 1RT3B 1WG5A 2OJ3A 2LEPA 4XPEA 1Q82O 4N5SA 1N56A 3GV5B 5D0EA 3EZWA 2CQBA 4Y1CA 2VU5A 3HHDA 1N8RT 2B5JA 3CJCA 4FYWB 1RAJA 1UJ4A 5D4LA 3PRDA 4JI3K 2GHWA 2I5JA 2FLOA 4BRPA 4DR5K 4K0KK 2XO6A 1A5VA 1ICEB 5LL6d 4X4SA 3UCUP 1R8HA 3EX7B 2OEMA 4FPAA 2BW2A 3VESA 2RUSA 1R43A 2V2QA 1RDRA 2ZWHA 5E2QA 1X5TA 2YHWA 2DITA 2ASDA 1TL5A 3V9ZA 2BANA 1Z2LA 1KVIA 4F4YA 2D1CA 5AQSA 1U0SA 4BDZA 3KUHA 2ALYB 1T9VA 3CUNA 3NVMA 2F65A 1FDAA 4CH7A 2H5JB 2OUGA 3THTA 4ZPWR 2KL8A 2CQ1A 4ZVOB 3K5MA 5EN1A 1TL7A 3HTVA 4JN4A 1C4AA 3D0IE 2KLAA 1IM6A 4OFZA 2ZBIA 4DR2K 2JWNA 1OVQA 4LF8J 3DRPB 5SWMA 4ICLB 4U7BA 1R0AB 2Q97A 4IJNA 3L2VA 2D3O1 3CCVS 4LFCF 2MKCA 5ADXA 5B0FA 2ZOGA 1EIYB 4MLHA 4CHPA 3N4WA 1BUXA 2ZITA 1P6TA 4ZPDA 4DG1A 3DOKB 3DN9A 3T5JA 1HPZA 5THWA 4GKKF 1Y97A 5IWAK 1HW9A 4CK3A 4Q2LA 2GIQA 1F2GA 2QXLA 1CJVA 2WC9A 3W3SA 4FWSA 1KR4A 2ROPA 3DDIA