4B3OA

Structures of hiv-1 rt and rna-dna complex reveal a unique rt conformation and substrate interface
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
553
structure length
540
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQAIHLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Complexes of HIV-1 RT, Nnrti and RNA/DNA Hybrid Reveal a Structure Compatible with RNA Degradation
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/dna/rna
total genus 117
structure length 540
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4b3oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b3oA05
2XY7A 1VSEA 1BI4A 2G8WA 4DQIA 1D5AA 1SL0A 1XR5A 2KFZA 1IKVA 4NLSA 2W9BB 4WFZA 4ZP9A 5KFAA 1QS4A 4AHTA 1IKXA 2W42A 4DQQA 3AVNA 2V4QA 4H4OB 4Q5VA 2W8KA 3U3GA 3PY8A 3RBDA 4HKQA 2IBKA 2YV0X 1JLEA 4M3UA 1TK8A 2WOMB 4WZQA 3VQBA 4Y1DA 1VSKA 4WZMA 4M45A 1N56A 2JLEA 3VQ6A 4CHZA 4FK0A 4CEFA 4IH5A 2P1JA 3OJSA 2A1RA 3MXJA 4RNOA 4J9LA 4IRKA 2ASJA 1WNEA 1RT4B 1X9SA 3VQDA 2VG5B 5KFOA 4FJXA 3KLGB 4OGEA 4B9SA 3TAFA 3AO2A 4M41A 5JUMA 4K8XA 5DG9A 1QSSA 3KOAA 5DGAA 2AX1A 2E6MA 3DLGA 3KKRA 4Q45A 3K5NA 4DQRA 1JL2A 4FJ9A 3CDUA 4K4TA 4DFMA 5SZTA 3H08A 3KLEB 3MTKA 1WSIA 4W5RA 2XI2A 4RZRA 2ZE2A 4KO0B 3KD5E 1RBUA 2HHSA 3D28A 4ELUA 1FKOB 4CGJA 4AHCA 2AQ4A 3MF5A 2YHBA 3RMDA 2G8FA 4O4RA 3DRRA 2B6AA 4LQ3A 1NOZA 1RTIA 4QAGA 1XR7A 3GIMA 3BSOA 4MIBA 4W5QA 1BQMA 4M42A 4CJ3A 5KT7A 5KFPA 3TQ1A 1SL2A 4ECVA 2PYLA 4WYLA 2RF2B 1FXXA 4BE2A 2W9BA 2OZSA 4CK2A 3RB6A 4YQWA 4BE0A 1RBRA 5SWMA 2E9ZA 3VQAA 4CGGA 1ZBLA 4IKFA 3VA3A 4DEZA 2D0BA 1CSJA 1EX4A 4KV8A 2HB5A 2KQ2A 1S1XA 3E01A 4OPJA 2WOMA 2QKBA 3KK2A 1S6PB 4BWJA 2QK9A 5KGXA 3DDKA 2XHBA 1S1VB 4Y1CA 4CJRA 1LWFB 3PJXA 4RNHA 3AVFA 1Z4UA 2X78A 1I6JA 3QNOA 4DTSA 3SCXA 3PZPA 5JS2A 1RTDB 3KLGA 3NAIA 3D5MA 4ELVA 1TVRB 4E7KA 4CJPA 3LP2B 5DGBA 3QESA 1D9FA 4ZP8A 5KFSA 3FFIB 4E7JA 4KI4A 1U09A 1S10A 1HMVB 3VQ7A 4PWDA 4HUEA 3PW2A 1KVAA 3M9MB 3QLHA 3CM5A 1ASVA 1EP4B 1MMLA 1C2PA 4QW8A 4RW7B 4J9QA 3K58A 2WCXA 4DTJA 4ID1A 4KO0A 4MFBB 5KI6A 4KHNA 3OHBA 2C2RA 3L3UA 2HVIA 4B9LA 3V1QA 2R8IA 2OA8A 4WXOA 4E1MA 4DL4A 4NCGB 3KMSA 4ID5B 2YNIB 1IG9A 1O1WA 4NRTA 3HSTB 3HPOA 3LP0B 3OL8A 5KFXA 4DTNA 2EHGA 3D45A 4DTOA 4FCYA 2HWHA 2HNDB 4CJ4A 3SPYA 3CWJA 4RW6A 3RRGA 5KT3A 3ALYA 4J9MA 3H2LA 4CFDA 3O4QA 3H5SA 3OY9A 4BWMA 2YNHB 1LWEB 3MR3A 5F8NA 4FVMA 4Q0BB 1ITGA 1NK9A 2VG6A 1S6PA 5HRRA 3NH0A 2B5JB 1LWFA 5KFJA 2EX3A 1VSFA 5KFVA 1S1UB 1CLQA 1WSFA 4IRCA 2Z1HA 1S0NA 3DLEA 3AA2A 4ECYA 3LPUA 3LDSA 1RTDA 3MR5A 3SUOA 4EP4A 1TVRA 4MK9A 3V9UA 4E3SA 2OZMA 4LH5A 1S1TB 2DFEA 3LP2A 4K4ZA 1T8EA 4DS4A 1NHVA 4NLGA 3IGVA 1J5OB 3LP3A 1HMVA 1IM4A 2Z1GA 4IKAA 2JEIA 3FDSA 3CJ3A 4O3QA 4M3WA 2UUTA 4F3OA 3NBPB 4O0JA 2UVWA 5F8JA 1JLFB 3HHKA 2UUWA 4FLZA 3NF6A 4KSEB 3PV8A 4WYWA 4BDPA 2FLNA 3C94A 2AJQA 3CDWA 3BQ0A 1N4LA 3SZ2A 3RMAA 4HCCA 4J9RA 2FBTA 1NK5A 1JL1A 2DPJA 2HW3A 5KRTA 1W25A 4KB1A 3GIKA 4DL3A 3LP0A 3NDKA 4F4YA 2JEFA 4FXDA 3SQ1A 2HNDA 5KFRA 1ASUA 5KRSA 5KFMA 4CJSA 2UVVA 1HQUB 1HNVB 3ZSYA 4DFPA 4RUCA 1C1AA 4JLHA 1Q9XA 4QWEA 3DMJA 4FM0A 4ZMMA 4DLEA 4ECUA 1S48A 2Z1IA 3HVAA 2YNHA 1QSYA 4R0EA 4KPYA 2WHOA 3FSIA 2B5JA 1BGXT 3L2QA 2HHVA 2XI3A 1C6VA 1BIZA 1JX4A 4CEZA 3KIOA 4JRQA 4GMJB 4MKBA 1I3AA 3UIQA 5KT4A 2GC8A 1ZETA 3NGIA 4G3IA 1S0MA 4F3TA 5JXSA 3SFUA 3NAHA 4XIUA 4OJRA 4BDZA 2FC0A 2C22A 2HMIA 2BQ3A 1A5VA 4CEQA 3OS1A 1J5OA 3LAKA 3TAMB 4H4MB 2B43A 2W7PA 4O5BA 2KTQA 1ZBIA 1TKTB 5I42B 1TAQA 4ZVFA 4CJVA 2AGOA 4ZHRB 5C24B 4QPXA 4FS1A 3HJFA 5L1KA 1U45A 4K4VA 3RTVA 3DLHA 3H4DA 4B8AB 1C1BB 3SQ2A 4DTXA 5HROB 3HXMA 1TKXB 3ZCMA 4W5NA 5I3UB 1QE1B 4MQ3A 3PHEA 1EKEA 1QAJA 4ZVEA 2HNZB 3V1RA 1U4BA 2E9RX 3SNNA 3EY1A 2IS3A 4QWDA 1JLGB 4NYNA 4RU9A 1HQUA 3M8RA 5HBMB 2OPQB 1D0EA 5F8GA 1T03B 3T5HA 1I39A 3G6VA 3H98A 3ITHB 3H5XA 2AU0A 4FJ7A 2AGPA 5J2QB 2W7OA 3GV5B 3PR4A 4ZVHA 3TARA 4B8CA 1L3UA 3CJ0A 3QGIA 2GBZA 4KHMA 3DRSB 4F4ZA 4CJEA 1W0HA 4IRDA 4QW9A 3QEXA 3I8DA 3CO9A 4ZP7A 1C0TA 3I5BA 4E7LA 3RAXA 3HO1A 4ZVGA 5DQHA 5F8IA 1HNIB 2G8KA 3M8PB 5D3GB 4DFKA 3TAMA 4H4MA 4IFVA 5I42A 1DLOA 4KB7A 5C24A 4LH4A 4JS4A 1SL1A 3EYZA 3NE6A 3IN5A 3GYNA 3OYEA 2HHUA 2F96A 1C1BA 3N6MA 4E89A 5J2MA 1LWCB 4Z0UA 4DFJA 4CJ5A 4HHTA 2WB4A 4FJHA 1KVCA 1VSLA 4Y2CA 1VRTB 1FKPB 5J1EB 3MEDA 1WLJA 3QERA 3WNEA 3OSNA 3TANA 5I3UA 3Q8QB 4HCBA 4ZPCA 1QE1A 3IS9B 2HWIA 2HHQA 2A1SA 4LD0A 4M3XA 4ECRA 3OL7A 3MEGB 2XCPA 3SUQA 1Q8IA 4FYDA 3P5JA 4CFCA 3MXIA 2RDJA 5J2PB 1EETA 1YTUA 3OS0A 1RAJA 3KHGA 3ZSZA 4N41A 1JLGA 4FW2A 4FM2A 3DLKB 4JS5A 3QZ8A 1KLNA 1D9DA 3NAEA 2I5JB 5HBMA 1VSJA 3NF9A 2OPQA 1C0MA 5F9NA 1UWBB 3OYDA 2NUBA 2XRIA 3QYYA 4IDKA 2XC9A 1T03A 4DL2A 3VQ8A 4CF9A 2ALZA 1RDBA 3MEEA 1XHZA 4B9MA 3T3FA 3KLIB 4RW4B 4NRUA 1GOAA 3SFGA 3DRSA 4ECXA 4ED6A 1WSHA 3PW4A 2D0AA 1NNDA 2X6SA 1DTQB 4CF1A 2VWJA 3JYTB 3AO1A 2HHWA 5CYMB 4ECQA 1CXUA 4DSIA 4CJKA 1LAVA 1HRHA 3RB4A 2DY4A 4RG8A 1KLMB 2OPRB 4IQXA 4CEBA 1RT5A 1HNIA 1JLBB 3AA4A 2X6NA 3M8PA 5D3GA 4NLVA 1CZBA 2FJWA 3L2WA 2IC3B 4ZPBA 2JEJA 1HYSB 1QUVA 3HT3A 4ECTA 1RT6B 4CFAA 4M3YA 2DTUA 4E19A 4DSKA 3NF7A 3K59A 3SUPA 3DI6B 4EP5A 1VRUA 2IOCA 1XHXA 2DPIA 1VRTA 4RUAA 3SQ4A 3QETA 3ISND 4ED7A 1JXBA 3CJ4A 5DG7A 4Z4EA 3VQQA 3SUNA 1UAXA 3CFPA 3K5LA 1RDRA 3PO4A 4CF2A 3C6TA 4C8NA 1YVFA 3NHGA 3MR2A 1D1UA 3RB3A 4U6PA 3ZT1A 2V4RA 5EDWA 1RT2B 2YNFA 1IH7A 4E1NA 4CEAA 2R2UA 2FBXA 4DU4A 1BISA 4DQSA 3KD1E 1NJYA 3M8QB 4J2EA 4LQ9A 1CXQA 3GILA 4DL6A 1BIUA 3DLKA 1QTMA 2QKKA 3LANA 4Z4GA 3HVWA 3ZT0A 4NLOA 5KTQA 3T5JA 1S9FA 1IKWB 4O3NA 2ETJA 1N48A 1IKYB 4KRFA 5CZ1A 4KB0A 4RNNA 2D0CA 4CE9A 4H4OA 1REVB 1GOCA 4CERA 5KG4A 3THVA 4RW4A 3GIJA 5FRNA 4M3RA 4DSJA 3KK1B 3LP1B 4ICLB 2WRMA 2UVRA 1DTQA 5KFGA 4W5TA 4FLWA 2QV6A 3BREA 1SUQB 2YKNB 1KLMA 2OPRA 1Q9YA 1JLBA 1RT4A 4WE1B 2VG5A 4JRPA 3KMQA 5EWFA 2B4JA 3T19A 3OYMA 2IC3A 4Q43A 2IAJB 4CHOA 3BR9A 1HYSA 4F4XA 3RB0A 2G8IA 1RT6A 2OPSB 4K4UA 1S4FA 1S0OA 4FJNA 4WFXA 1ZYQA 4CGIA 3NGDA 3ZT4A 5J2NB 4KFBB 5L1LA 4TLRA 1YVUA 5C25B 4B9VA 1RILA 4W5OA 3IAYA 3TI0A 3KLEA 3VQSA 4F4KA 1L3SA 1JLAB 1U48A 1FKOA 3TAPA 3HK2A 1GOBA 2KZMA 3WNFA 1NJXA 4TXSA 4CJWA 4CK3A 4DG1B 4EBDA 2BRLA 3KLFB 1RDCA 3AV9A 4FJLA 2VG7B 3F9KA 5KFWA 2QE5A 2R8GA 1SKSA 5HP1B 2RF2A 3K5MA 5KFQA 1IKYA 3NMAA 1S97A 4AHSA 1REVA 3ISNC 4EO8A 3V6JA 4K4SA 3G10A 3KK1A 1JLQB 3LP1A 4OKEA 4ICLA 2ATQA 4YFUA 3O3GA 5FRMA 4J9NA 4EO6A 4KHYA 3BSCA 3HP6A 1S1VA 2V9WA 3KK3B 5FROA 2QXFA 4DSEA 4PY5A 2YKNA 4J9OA 4FZYA 5EWGA 3PUFA 3MR6A 4WE1A 2ASLA 4CJFA 1T7PA 1VSMA 1NKCA 4AHUA 3GIIA 1U04A 2OPSA 4ED1A 3PW7A 3FFIA 2IA6A 2DFHA 4MKAA 4TYAA 1YTAA 3H40A 4G1QB 5J2NA 4KFBA 5KGWA 1NHUA 3SYZA 1X1PA 1TKZB 2BQUA 4M3ZA 3AVGA 3DM2B 3I0RB 4DL5A 2IJNA 1LW0B 2ZD1B 4NLQA 1EP4A 3KHHA 4NYFA 5DLFA 3BJYA 4LSLB 4RW7A 4Q44A 2VA2A 4MFBA 3Q8SB 4DF4A 2LSNA 1JLCB 3SJJA 3QGHA 4DTRA 4O55A 4KHQA 3BQ2A 1GX5A 3QIDA 1HARA 3MAQA 4OLAA 1RDDA 1S9EB 3AVHA 2O4IA 3OL6A 1OS5A 1ZBUA 2ILYA 4NLTA 4ZTFA 4NCGA 4ID5A 3U6FA 2YNIA 3V6DB 1FK9B 1KFDA 1VSDA 1NJZA 3VN5A 4FM1A 1C1CB 5HP1A 4FJJA 3Q8RB 3GV7B 4YR2A 1TV6B 1B9FA 3RR8A 4O4GB 1T05B 4IOBA 3NKYA 2P51A 3T1AA 3OLBA 5JS1A 1W9HA 4KTZA 1BCOA 4CCHA 1LWEA 3DLBA 4Z4FA 4Q0BA 3IGNA 4URSA 2YKMB 3N6NA 1JKHB 2AGQA 3KK3A 3KHLA 3VQEA 2BQRA 1BQNB 1S1UA 5DG8A 3H5UA 3UPFA 3KJVB 4OKKA 4NLYA 4QCLA 4NYZA 4DTMA 3VQPA 3DOLB 1S1TA 1N6QB 2HHXA 5F8HA 3FQKA 3OSPA 1TK0A 5KFBA 3AO5A 3AA3A 4CFBA 1L5UA 3NCIA 2YNGB 2Y1IA 1TKZA 5HLFB 1NJWA 4C8OA 4OLBA 2ZQBA 3DM2A 3S3OA 3I0RA 4YR0A 3TAQA 3P1GA 1LW0A 1A5XA 3NBPA 3FQLA 4CGHA 3S3NA 4XPEA 4LSLA 4MH8A 1JLFA 1WSGA 3C95A 1JLCA 4YMEA 4CIEA 2CJQA 5KFFA 3QEWA 2YHAA 2FVCA 3ZSQA 1QQCA 3DLRA 4FK4A 3OHAA 3OYBA 1B9DA 2FJXA 2R8KA 4EBEA 3LPTA 3TWHA 1HJRA 1DTTB 4KHRA 1JXLA 2VA3A 2IM2A 2WONB 3V6DA 3L2RA 3B6PA 1C1CA 2WTFA 4FW1A 2JC1A 3V9WA 1LW2B 3L8BA 5HRNA 4KAZA 2GIRA 4O4GA 1HNVA 1T05A 1T94A 2CKWA 5C5JA 4FK2A 4HUGA 3V4IB 3AVBA 2R2TA 3NF8A 2R7YA 1ZTTA 3T5KA 1RYRA 4IG3B 3KLHB 3NH2A 3QZ7A 4FS2A 3FRZA 1WAJA 4DQPA 4IR9A 1JKHA 4CIGA 4GC7A 4YR3A 1VK0A 3UR0A 4HYKA 3RR7A 3NGYA 3CFOA 5KT5A 3ZT3A 3PVXA 4ED3A 3SV4A 1X9WA 4TY9A 3KJVA 3L2UA 3P83D 2ITGA 1RCHA 5C42B 3IRXB 1IKXB 4RW8B 3VQ4A 3DOLA 1ZBHA 5DQIA 1ZTWA 1N6QA 2P5OA 3AVLA 2PZSA 4B3OB 1JLEB 4FZZA 4ZP6A 4K4YA 3OVNA 4NLXA 3VQ9A 1TKTA 4OL8A 4CK1A 2YNGA 4O44B 5HLFA 3OJUA 4ZHRA 2ASDA 2O4GA 3OYAA 1XI1A 1WAFA 2D3ZA 2GUIA 1K6YA 4R8UB 3NFAA 3AA5X 4UQGA 4ZTJA 4O0IA 5HROA 3E51A 3SV3A 3QIOA 2D5RA 4KHUA 1TKXA 3CJ5A 3QIPB 3M9OB 2G8VA 4WFYA 1DTTA 4F50A 5KFEA 5EU7A 4ECSA 3PO5A 3ZSVA 4YNQA 2WONA 1WNSA 4TYBA 4QWCA 3NH1A 4KTQA 4JV2A 3TVKA 2HNZA 2O5DA 3L3VA 4DU1A 1KVBA 3BGRB 1U49A 2FLPA 3DRPB 4DSFA 4DSLA 3V9ZA 4EYIB 4CJTA 5L9XA 3H59A 4Q8FA 4FLTA 1Z26A 4O3SA 1BHLA 2Z1JA 3WNGA 3F73A 3ITHA 3SQ0A 1RA7A 2Q3SA 4IG3A 3KLHA 3K57A 2RDIA 5J2QA 4CEOA 5T7BA 2ATLA 4CIFA 4IH7A 4CEDA 1TL1B 2HAIA 4H8KA 3AVKA 3OYJA 3T5LA 4AH9A 1RTJB 3DYAB 4ED8A 4PA1A 4J9SA 3G86A 4Z4IA 1Z25A 5C42A 2FVSA 3IRXA 4RW8A 1QAIA 4DTPA 3ZSXA 4BACA 3SPZA 2XY8A 3Q8PB 1SKWA 2D3UA 4FLVA 4B3OA 3LZJA 3M9NB 2XY5A 4KV8B 3CIZA 1S1XB 3E01B 4NLRA 5EWEA 4F2RA 4EBCA 3KK2B 5CZ2A 4O44A 3QEVA 3OYCA 4MK7A 3TAGA 3RWUA 3HPGA 4FBUA 3TR8A 5KG2A 1NK7A 4GVMA 4K8ZA 3JSMB 3OYKA 1LWCA 1KHVA 3EPGA 4R8UA 4TQSA 3M8SA 2FJVA 4R5PB 1FKPA 5J1EA 4TY8B 2JEGA 4CGFA 1KHWA 2AX0A 1HQEB 5KFTA 1YT3A 2FVQA 4IFYB 3GV8B 2J6SA 3QIPA 4NLDA 1KCFA 3HPHA 2IM1A 3IS9A 1J53A 3RMCA 4PWDB 2G8UA 1L3VA 2FLLA 3O4NA 4QOZB 3ZT2A 1CZ9A 4Y2AA 5KT2A 2OH2A 1KRPA 2PYJA 4J2BA 3OLAA 4XPCA 2I1RA 4TSXA 3UQSA 3MEGA 3QLHB 3BGRA 5KFYA 3DRPA 5J2PA 2JC0A 5KFUA 1S1WB 2I5JA 3PW0A 1HYVA 2BE2B 4OGCA 1UWBA 4RW9B 4HUFA 5L1IA 3G6XA 3G0ZA 2C2EA 1TL1A 3KLIA 3D0PA 1NK4A 3OL9A 4FJ8A 4PUOB 1J9AA 4FZXC 1RT1B 4B08A 3MFHA 1RTJA 3DYAA 3JYTA 4ECZA 3H4BA 4NLWA 1RDAA 4RW6B 5CYMA 4HVJA 4IBNA 4FBTA 3HM9A 4CJUA 1S49A 3V9XA 4M94A 5KFCA 3G6YA 1ASWA 3CDEA 2VG6B 2IGIA 3MFIA 1UA0A 1RTHB 2DFFA 4OKJA 4O3RA 3JSMA 2KZZA 3DLEB 1TGOA 4IR1A 3DI6A 3U3YA 5KFNA 3TAEA 3AVMA 3SI8A 4NLPA 1X9MA 4R5PA 4TY8A 3CQ8A 4N47A 1HQEA 2JGUA 4IFYA 1Y97A 4DS5A 4I2QB 3LALA 1S5JA 4FJGA 2R2SA 3BSAA 4KBIA 1XWLA 2RKIB 3PX0A 3S9HA 4C8MA 5F9LA 1RT2A 4HTUA 3K5OA 3LAMA 5K14B 5FDLB 2W9AA 1KFSA 4CHQA 2HNYB 3M8QA 4RNFA 1S1WA 5F8MA 2BE2A 4PQUB 5KFLA 3N6LA 4B9NA 4RW9A 3BDPA 3HL8A 3NGZA 1IKWA 1HYZA 1U47A 4OVLA 3C6UB 4KI6A 1C0UB 4KTWA 3L2VA 4GW6A 3HVTB 4FLUA 1JIHA 5KG3A 3KNAA 2IJFA 1SH0A 2V0NA 4BE1A 4PUOA 2F8EX 4KKOB 5KFZA 1JXEA 1RT1A 3AVJA 3VQ5A 1SKRA 2R2RA 3QNNA 4CGDA 5F8LA 4IG0B 2W9CB 3I5CA 3EPIA 4DF8A 1NKBA 1N5YB 3HYFA 4DU3A 1SUQA 4Y3CA 4YP3A 3DMJB 3RAQA 3HKWA 1WN7A 1SV5B 3CYMA 1BCMA 2BRKA 1L3TA 4J2DA 4LSNB 4KAIA 2BR0A 3VQCA 1TL3B 1RTHA 2IAJA 1VSIA 4Q8EA 1RT7B 4CECA 5T14A 4O3PA 4IH6A 2EC0A 3V1OA 1K1SA 2FBVA 1NK6A 2BGGA 4I9QA 5C25A 3QO9B 3CVKA 1J54A 2OPPB 4J2AA 3V81B 4I2QA 2KW4A 2HMIB 1JLAA 1NKEA 2OYQA 1R0AB 1RT3B 2RKIA 3OYHA 4AHVA 1T3NA 4FJMA 4CESA 4I7FB 2GIQA 3V9SA 4WXWA 4ELTA 1NK0A 4DG1A 5K14A 4LY7A 5FDLA 4BDYA 2HNYA 4J9KA 2C28A 3PJWA 3KLFA 1TQLA 4KHSA 1TK5A 1MU2B 3QEIA 2J6TA 3LWMA 4F8RA 2J6UA 2VG7A 1SH2A 4L8RB 4N56A 4PQUA 3MECB 2P5GA 4ECWA 4XO0A 1S6QB 1A5WA 3PX4A 2KFNA 3C6UA 3DOKB 1SH3A 4X2BA 4Y34A 4M3TA 4URQU 1C0UA 3AVAA 4NZ0A 4CJLA 4AHRA 3HVTA 5DMRA 1KSPA 3KTQA 3NL0A 1JLQA 4KKOA 1S9GB 1RYSA 3OYLA 1KTQA 2XY6A 2BANB 4NCBA 4IG0A 2W9CA 4M95A 4EZ9A 1N5YA 3PW5A 3GQCA 3OS2A 2RPIA 4OPKA 5KFHA 1SV5A 3ZSWA 5DQGA 1QHTA 3WNHA 4LSNA 2AWZA 3AVCA 3PX6A 1RA6A 1IO2A 4K4WA 3OYFA 4EEYA 2XGPA 1TL3A 4K50A 3LZIA 1RT7A 2E9TA 5CY4A 2FVRA 2XCAA 2C2DA 4FLXA 2XGQA 5KT6A 3KKSA 3V6KA 4ZPAA 4G1QA 5HRSA 1LAWA 2W8LA 4QWBA 5KG5A 1G15A 1ZBFA 1C0TB 2FBYA 4K4XA 2G8HA 3ICLA 4JV0A 3ZSOA 3QO9A 4TN2A 4DL7A 2OPPA 1HPZB 3HVRA 2ZD1A 2E6LA 3V81A 4I2PB 4N76A 1WSEA 4KHWA 1LV5A 4C8LA 5KFKA 1TAUA 3EZUA 2FVPA 1R0AA 4AILC 4IFVB 1RT3A 1DLOB 4CHPA 5KG0A 1NOYA 5EUHA 1UOCA 4F4WA 1S9EA 4I7FA 5CYQB 4CHNA 4E7HA 4F2SA 4C8KA 3CJ2A 5KG6A 4E7IA 3PR5B 2PY5A 5J2MB 1MU2A 1FK9A 1GX6A 5DLGA 4GC6A 3K2PA 5HRPA 3QGGA 3KHRA 3MECA 4EZ6A 1S6QA 3MEDB 3RRHA 2F8SA 1TV6A 3B6OA 4DWIA 3DOKA 2Y1JA 3LWLA 1TP7A 1NK8A 4FJ5A 4MIAA 3H5YA 2XO7A 4O3OA 4URGA 4DLGA 4DMNA 4N5SA 1S9GA 1D8YA 3VA0A 2UVUA 4NCAA 4DTUA 1F21A 3A2FA 3IG1B 3OYIA 4FJIA 1K1QA 4FLYA 3TABA 2YKMA 1EETB 4FJKA 1B92A 2BANA 3CG7A 2F8TA 3UDLA 4TQRA 1RBTA 4CJQA 1EXQA 3I0SB 2HHTA 2IMWP 1BQNA 3S3MA 2ZKUA 1BI4B 3SI6A 4IDKB 4U7CA 1IKVB 4MK8A 2X74A 1QSLA 4B9UA 1VSHA 2RN2A 4H54A 3MEEB 3ASMA 2HVHA 2E4LA 2GV9A 3AO3A 1TKDA 2IDOA 5DK5A 5KG7A 3KLVA 3RBEA 3V6HA 4I9LA 3O3FA 5KFIA 4ZPDA 2XWYA 4B9TA 5KFDA 3MXMA 1HPZA 4KE5A 4EYHB 4E0DA 4CF0A 4I2PA 4CHYA 1RT5B 4CEEA 2D41A 2R8HA 3HP9A 3ZSRA 3QEPA 5E41A 3DLGB 4RNMA 5CYQA 1BL3A 3EZ5A 2ILZA 4Z4HA 3OYNA 3AO4A 1RBVA 3I5AA 5KG1A 3BQ1A 2WK4A 1VRUB 4ED0A 2D7SA 1RBSA 3OYGA 2IM3A 4JUZA 1RNHA 4ED2A 1XR6A 3BSNA 4J9PA 4Z4CA 4QWAA 3O3HA 1LW2A 3RMBA 3C6TB 2ZE2B 1UA1A 2IM0A 4KREA 2BDPA 3V4IA 4JV1A 3CM6A 3AVIA 2VWKA 3QINA 4CF8A 2R8JA 2YNFB 5L1JA 3DRRB 3IG1A 2B6AB 1RTIB 1BQMB 3CFRA 3ULDA 1XC9A 4NLUA 1WSJA 3I0SA
chains in the Genus database with same CATH superfamily
1N5VA 2CQ1A 4DQIA 1D5AA 3QAUA 1WB9A 2OSRA 1Q81T 2W9BB 1U6FA 3HFKA 1QS4A 3L4QA 2FTRA 1IKXA 4HHHA 1JCFA 1K9MT 4LF5J 2IBKA 1BDGA 1S7IA 1C0GA 3LA0A 4M3UA 4M5KA 5M2PA 3VAMA 3MWTA 3VQBA 3CE8A 4YHHJ 2O1PA 3FJ2A 1Q86T 1N56A 3IKMA 1HNWF 4U95A 4CEFA 1U8WA 4USMA 4BS2A 2I6WA 1BWEA 4IRKA 1RT4B 3PXGa 3RU0A 1UFLA 3FZFA 2LU1A 3M2RA 3MM6B 2PI4A 4B9SA 4YOUA 3AGRA 2PEBA 2P5VA 1IBMK 4Q45A 1SVDA 2YWGA 2FYXA 3SCIE 5AFUH 5IM0B 1H38A 3F44A 4I0WA 4PL7A 2QTDA 1F3VA 5H9FJ 1QY7A 2F63A 1HWUA 5SZTA 1VS3A 1V6HA 2WW8A 5IWAJ 2E5IA 5HN0A 5FLXU 1RHJB 1FKOB 5IT9Y 2O8EA 1IJJA 2F4VF 1B0VA 2GTDA 1HQ2A 2HRUA 5CD4H 3RMDA 3AD9C 2ZWPA 3KG0A 3DRRA 4LQ3A 4J7CA 4QAGA 5GAEP 3AODA 3T1YK 5KT7A 4EI2A 3N4PA 3TQ1A 1S77D 2RF2B 2NLWA 2RRNA 5B0FA 4A8QA 2IIRA 3RB6A 1RBRA 2E9ZA 4GKKJ 1NGHA 3B8AX 3VQAA 4IKFA 1RAHB 2KXNB 4DEZA 4AL6A 1CSJA 4KV8A 1PSDA 1M5PC 3M1VB 2QKBA 2GMJA 5KGXA 1FNXH 3J7Z5 3FMWA 3JB9k 2V63A 3DDKA 1NHKL 4KC5A 3PJXA 1KDNA 4JI1F 1PIEA 4RNHA 2ZJPQ 2X78A 3EE3A 1I6JA 1SIZA 4TU9A 3SCXA 4IYQA 3EO3A 3KLGA 1MN9A 2DGTA 3DDIA 3D5MA 3W3DA 4E7KA 4B3RJ 3VAKA 4FSVA 2V52B 4CZGA 5IC6B 1HWLA 4KI4A 2V5HG 1HMVB 3VQ7A 2KU7A 2OHDA 1KVAA 2UU9J 3IRWP 4YEAA 4ID8A 4NLCA 1MMLA 3GYXB 4MAKA 4J9QA 3K58A 1A6LA 4JI6F 2RHSB 5LJVA 1JWWA 2IA0A 2CRLA 1R59O 5BR8F 3NXZA 3VTHA 4WKYA 1QTNB 4USUA 2OA8A 1IG8A 4QJVA 4E1MA 2B9WA 2UXBF 1GH8A 3CMEN 4NCGB 2HFNA 1HD1A 3UB5A 5DO2A 1S57A 5HI7A 2HF4A 4NRTA 3PIOL 3MTJA 3TTFA 5KFXA 4ZVRB 2EHGA 1DHMA 3D45A 2HNDB 3WQUA 4USJC 4MKYA 3OR1B 3VMFB 4CJ4A 2DISA 2YCHA 3SPYA 5AZIB 4WYBA 1VQLN 3ALYA 3O4QA 4OYPA 3H5SA 5T7LA 4HACB 1FNOA 3VZHA 4JI7F 3E9OA 1WF2A 3MM9B 2VG6A 1S6PA 5HRRA 2KL8A 4BY9C 1I51B 1OVQA 1LWFA 5AE3A 4BG8A 1VSFA 4KHPJ 5KFVA 1S1UB 4DX6A 1S0NA 1RAGB 4ECYA 2X3DA 3LPUA 2CQ2A 1RTDA 3MR5A 1WKJA 3J7AN 3SUOA 1NPRA 4E3SA 2OZMA 1S76D 6AT1B 4QIEA 2YJFA 1WOOA 3BYRA 1CBKA 4NZ6A 2UUBK 4RLEA 4OQJA 2JEIA 3H0PA 3FDSA 4QQBA 1FW6A 3VPZA 4M3WA 3MN9A 3O9SA 3OFHA 3UNGC 1RDWX 2IDLA 2ZBCA 4FLZA 4KSEB 3H90A 5HJYA 2MKHA 4BDPA 3CHWA 3RBZA 3TVZA 2FLNA 3C94A 2AJQA 1QVGR 5AQUA 2CG4A 2UV8A 4J9RA 3MMBB 1NK5A 2G2ZA 4F04B 1DBDA 4KB1A 3L09A 3UDEA 5FPEA 5FPMA 4OZJA 4HTIA 2NCKL 3A8KA 4YOXA 4F4YA 1ZPVA 2JEFA 4CJSA 3WX4A 3A1YG 4ILMA 4DFPA 4I6MB 3VF0B 4QWEA 4ECUA 1YHQS 3HVAA 1UETA 1BOTO 2XLKA 3IMQJ 1CJTA 5E2QA 3MPUB 4KPYA 2WHOA 3FSIA 2B5JA 4FF2A 4ZJLA 2E29A 1PILA 1PAEX 4B9QA 3KIOA 1I3AA 2RHKA 2MGZA 4M7XA 2DNRA 2JFDA 2GC8A 1K8KA 5ETNA 2NR0A 5FPNA 5TKYA 2XMVA 4OJRA 4BDZA 2C22A 4OV6A 4D3HA 4KJIA 2OAUA 4A57A 4ZVFA 4HR2A 4CJVA 4ZHRB 2BZ2A 1U45A 4LF2A 2NRHA 3DLHA 3H4DA 4B8AB 4FP9A 2WUSA 3GIRA 5LXYA 1S6UA 5HROB 2GW8A 2OIHA 3DLLL 1X4HA 5GAHI 1Q82O 4CLKA 5KQDA 1RGVA 1QE1B 5AQMA 4MQ3A 3PHEA 3U7JA 1Q7YO 1Y10A 5C2GA 1VDHA 1WBDA 3ZTOA 4P2MA 1QAJA 4YS2A 1U4BA 3SNNA 4FPAA 5BRHA 2JFKA 1T0TV 2ATCB 2QFJA 3M8RA 1U1QA 2LECA 2XZTB 3W9HA 1D0EA 3QQCD 1T03B 2D9PA 1JJ2M 3H5XA 3CMAS 2AGPA 5AXMA 3ULHA 3PR4A 4ZVHA 1DT9A 3MMJA 2OEJA 4B8CA 3TP2A 5BN9A 3CJ0A 3DRSB 4KH5A 5F0WA 1BE4A 5GAEI 4C3KA 2YQ1A 3W65A 4LFAK 3MK6A 3I5BA 3VVUA 2EC2A 5DQHA 2H9ZA 2QRRA 2G8KA 4A4JA 3TAMA 3MGJA 2HF3A 1UJ5A 5BXIA 1UWAA 4KB7A 1G2EA 5C24A 2OJ3A 2V51B 4DV2F 4JS4A 1QZ6A 5DJBA 3IN5A 1X4BA 4YB7A 2GQCA 3SCLE 4E89A 4HHTA 1N36K 1XK8A 4FJHA 3C14B 1Q86O 1OVYA 1HNZJ 4Y2CA 3M2VB 1FKPB 2DRBA 3MEDA 1U6ZA 1ESVA 2LEBA 1W2IA 5IT9O 3WNEA 1UAWA 3UN3A 4KRWA 3PIPQ 2FXUA 1EIYB 2WB1D 4DV3K 2X1AA 3IP0A 1Q8IA 4G1IA 4KH6A 3PRDA 3OS0A 4N41A 3ZSZA 3DLKB 3O9UA 1KLNA 3O1BA 3NAEA 2I5JB 5HBMA 4ZCMA 2YHYA 3NF9A 1BHNA 1AA1B 1NMEB 2NUBA 3GCXP 2ALZA 5AQZA 1RDBA 1SC4B 2EFGA 2V4JB 1NSAA 2YKOA 3IBCB 2VUGA 1XHZA 2GJ2A 1F60B 3TJ8A 5LMNF 1EWRA 4RW4B 4NRUA 5D15A 2NQPA 4ECXA 3IC1A 2P9UB 4ED6A 2X6SA 1DTQB 1SJ3P 3BUZB 3D3BJ 4CF1A 2VWJA 3AO1A 3G4SS 2HHWA 4KPCA 3DGPB 5CYMB 4QYRA 2GAHC 2VWBA 4P7VA 3CCMN 3MEKA 3CTRA 3O08A 2KI2A 3C46A 4LR9A 2UXCK 2X6NA 4NLVA 5KAKA 4CW7B 3OTOK 3BO3A 5DM6Q 3C0BA 3S01A 3DOMB 1J5EJ 2E1MC 5D4OA 3QDKA 3EEQA 1U2CA 3NF7A 3ET6A 5B0CA 2IMOA 3ISZA 1U0SA 3BKTA 3DI6B 3UD4P 1VRUA 2W4DA 1XHXA 2E2PA 3VAGA 1JXBA 2HGLA 5DG7A 3VQQA 3RW7A 2ZC4A 2QM1A 2IVYA 4WF9Q 3GR1A 4C8NA 1YVFA 1F1BB 5FIIA 3C15B 1D1UA 2WTUA 2BOAA 4FPIA 4LSZB 4OX8A 4WP8A 4LF6K 2C2MB 1CXQA 2ZITA 1IM6A 3AQPA 1QTMA 4LF9K 3W0LA 3HVWA 3NCRA 3ZO7A 1IKWB 2ETJA 1U8SA 4BRDA 3NGRA 2PA8D 4KRFA 4RNNA 4U67L 1Y5NB 3D67A 3QT7A 4H4OA 2QLFB 4R25A 3G82B 4M3RA 4DSJA 3KK1B 1JJCB 1G4CA 1ZZNA 1VQ5S 2WRMA 4YY3J 1S72S 5LY3A 5JMNA 2G0CA 3AAWB 2YHXA 4A2AA 4BVOA 3N5BA 4RCHA 4JK8A 3J81j 1SUQB 2K2PA 1PJ7A 1JLBA 3B78A 4JV5F 1KAXA 3T1HF 4JRPA 3KMQA 3SK3A 3MCAB 2W6LA 5HATA 4NEZA 2KKZA 3H3OB 3Q86A 3I4HX 1S0OA 4WFXA 1ZYQA 1ZAVA 2YPYA 4P74A 2RUSA 4C6AA 1HNXJ 1FD2A 5A8RA 1YVUA 5C25B 2E5HA 1YJ9N 2P2CB 1L3SA 4FWSA 4LF7F 3HK2A 3CJAA 1JQGA 4TXSA 3TTDA 1FTCA 3CCES 4DG1B 2FHKA 5E0OA 2GS8A 1M0SA 1RDCA 4UY8O 3CF5Q 2VG7B 4C0OC 3K5MA 1Q5YA 1EQMA 3UR3C 1IKYA 3WQPA 3NMAA 4AHSA 2RDDA 3G10A 4MDAA 1X5OA 2V8DA 3LP1A 4YFUA 2IVPA 4OKEA 3O3GA 4J9NA 4EO6A 3M6WA 3F9MA 3PFOA 2EBEA 4DSEA 3MM5A 4PY5A 4ZS6A 5DDRC 4FZYA 1LK5A 2H4YB 5EWGA 4V19S 1I94K 4CJFA 3ZX2A 1T7PA 1VSMA 5LM7E 3P6YC 4ZLJA 4AHUA 2FC9A 5B0EA 4J9VA 2MLYA 4PYAA 4ED1A 3FFIA 1BC6A 1WACA 5IQ6A 2CNNB 2G1DA 3PEJA 5J2NA 1VIOA 5KGWA 1URNA 3DM2B 3KKFA 2ZD1B 3KHHA 2UZAA 1XMQK 2M5YA 5DLFA 4RW7A 3K9JA 2XMWA 1Q5VA 1SJ1A 3LH2S 1JLCB 3IMXA 4O55A 1GX5A 3MMCB 4BC2A 3MAQA 2EG1A 1HKCA 1J27A 4ZTFA 3NWRA 4B1YB 3QBCA 2VQEJ 1N5QA 3U6FA 1NB2A 1M90O 1VSDA 1BMQB 3VN5A 4C3LA 4FM1A 4MYTA 3MX5A 3M6UA 2RD5C 3GV7B 4YR2A 1LK7A 2AYBA 1MSWD 2W1BA 1B9FA 4ILJA 3RR8A 2XMMA 5LSRA 4IOBA 4CLWA 4ZKAA 3NKYA 4OX6A 4MYUA 4PYDA 3T1AA 2H5EA 4KTZA 2FHJD 3ENOA 1O5JA 2J5AA 4CCHA 4JI0J 4Z4FA 4Q0BA 1TMJA 2YKMB 1XERA 4USVA 2P9PA 2EW9A 3KHLA 2DYAA 1FE0A 4DR4K 3N4WA 4H0TB 2O8DA 2DR8A 4RX6A 3H5UA 3UPFA 3KJVB 1OKJA 3AARA 3FEYB 3VQPA 4CBXA 1KAYA 4USTA 2KHCA 3C6HA 3Q89A 4X64F 4JK9A 5B0AA 3FQKA 5D77A 5KFBA 5M1QA 3VEXA 2Y1LB 2Y1IA 4X4PA 4OLBA 3ULEA 3FE1A 3P1GA 3FQLA 4CGHA 3MR7A 2V68A 1JLFA 2E5LJ 1MROA 4WIIA 2HBZB 3JSYA 3QEWA 2YHAA 3CI5A 4FK4A 5BR9A 2FJXA 2L3MA 2R8KA 4EBEA 1HJRA 2HQGA 1DTTB 4WP9A 1JXLA 2M8DB 4JI8J 2DNMA 4IOCL 3FZMA 5B0BA 2IM2A 3MMVA 5G4DA 2DRAA 5H1SV 3L2RA 3TOQA 3NMRA 1WHWA 1KQSR 1LW2B 5G0RB 5GIOA 1T05A 3IM9A 4NXNK 2R2TA 3NF8A 3OTCA 4HWIA 1OWXA 2AEJA 4HT7A 2N7YA 3D2EB 2JZ5A 3I55S 2ROGA 3CUNA 1WKLA 4X62J 3UR0A 3MCSA 3RR7A 3CFOA 3QWPA 2HOEA 3H8YA 3PVXA 1CULB 3SV4A 4QS7A 1OY6A 3IA0A 3UNYA 4JI2F 2MLXA 1QDUB 3FCWA 3L2UA 1NU4A 2AJ2A 2ITGA 4RW8B 3UN2A 5B0DA 2HVDA 4C98A 2LXFA 1N6QA 5GMEA 1RAIB 4AFFA 2CPZA 2KG1A 4ZP6A 4CLZA 1XMOF 4DR6F 5HLFA 2AHOB 4QPTA 4M5NA 1DAXA 3L4BC 4CTAA 3CCUS 3ZNUA 3BF1A 2HIYA 4JKHA 2O4GA 1RKJA 1DRZA 1WAFA 1IV0A 4R8UB 4MTPA 4UQGA 3AAPA 2D5RA 1HR0K 3GFHA 2LA6A 1AROP 4DX5A 4U9RA 3BZCA 1HPMA 3RJMB 2ZM6K 2ASOA 4JI3F 5EU7A 2NZTA 3PO5A 4ZCLA 1RJJA 3ZSVA 4YNQA 4QWCA 2MKSA 5IFMA 4JV2A 3EZWA 2HNZA 4NO7A 3OW2M 1AFIA 4DR3K 3DRPB 4DSFA 3CC2S 4LFBJ 2LQ5A 1I3OB 3T7ZA 3H59A 4ZN1A 4GMKA 4O3SA 1EARA 4BRAA 4FL9A 4M5HA 3ITHA 3C3LA 1RA7A 2Q3SA 4IG3A 3SQ0A 1OH5A 3KLHA 1JCGA 5J2QA 1KVIA 2K1RB 4IH7A 2VCPA 4WWSA 3QSIA 1C4CA 2HAIA 3MWPA 3R8YA 4ED8A 4J9SA 3CIPA 4BRHA 2DIVA 1Z25A 3HMJG 5C42A 1XC3A 3JQJA 3ZSXA 4BACA 1PBAA 2F40A 3T1YJ 2MXYA 4LUBA 3GCWP 1YQHA 4USKA 1RHUB 4O44A 2LQBA 3BPSP 2QL9B 5KG2A 3QT6A 1NK7A 1HBNA 4M5DA 3OYKA 1UCNA 1KHVA 4KIAA 4WFBQ 2FJVA 2J9DE 5DZ6A 4KH0B 4R5PB 4CGFA 2QSFA 2AX0A 2GZOA 1XNQJ 3ENVA 4K5RA 4PWUA 3HF5A 1KCFA 2DEIA 4OYXA 2HZVA 3O4NA 4QOZB 3D66A 1Y11A 1NSPA 4J2BA 3OLAA 4XPCA 2ZNZA 2I1RA 4OHXA 4TSXA 1ZOTA 3QLHB 3KG4A 4DI6A 3BGRA 5KFYA 1MA9B 2DVIA 5J2PA 1IWAA 3ONQA 3TUIC 4DR1K 3GG1A 5KFUA 2X3GA 5IT4A 2YQ3A 1AUDA 3RZAA 1JNZB 4HUFA 4H4KA 3OUYA 5L1IA 2CNKB 4ITSA 4P2XA 2EPIA 1TL1A 2GVZB 2FC8A 1RB0A 1NK4A 3Q0AA 3OL9A 4DQ8A 3EE8A 2XS5A 3C6AA 6FD1A 4B08A 4J8FA 4RBUA 1VQ9N 1FDAA 1FEHA 3DYAA 3JYTA 2FD2A 4HVJA 1DQ8A 3HM9A 3BBFA 3SQGB 1S49A 3HZGA 3I9ZA 4M94A 1ASWA 2CGJA 3CEDA 4E2FB 3NOCA 2IGIA 3TO8A 2HQDA 3CCWA 4OKJA 2EG2A 5L38A 4A8WA 2KVQE 2DR5A 3UFCX 1TGOA 4IR1A 2VKZG 3GB0A 4GVBA 3R2DJ 2DHGA 1KD1T 3SI8A 4A8FA 4WTOB 2VIHA 3ZZRA 4Z37A 4IFYA 1HNWK 3RSEA 3LALA 1WSRA 2R2SA 2XMKA 4LRDA 1QHAA 3DDNA 1B7FA 3RRKA 1YJUA 3FK4A 2FZGB 2E7VA 4RTFD 2POKA 3LAMA 5K14B 3MN7A 3M8QA 4YOVA 2UUBJ 4LRAA 4NI2B 2XHCA 3HL8A 1X5TA 2Z58B 3IFRA 4OVLA 1BWFO 4L3KA 3ZTRA 2HK2A 1CJVA 1C0UB 1RQ0A 4FLUA 1JIHA 1FEEA 4DX7A 1HKBA 1JJHA 3IXQA 4DB3A 3KWIA 1SH0A 4KKOB 2KFYA 1CJKA 3SJHA 2VV5A 3DLLQ 1N32F 1SKRA 4MLHA 3BKUA 3KJNB 2N82B 4NMLA 4DF8A 1NKBA 3LDNA 4IJNA 4Y3CA 2V8HA 4EU0A 1BCMA 3DRXA 3OV7A 3U1LA 4KAIA 4K0KJ 4BRNA 1K73O 1EO1A 2KHDA 4RWWA 2BOPA 2FSJA 1RTHA 2IAJA 3WZ0A 1VBZA 3R5CA 1JJ4A 4O3PA 2ZDPA 4LRBA 1R43A 2FBVA 3ETOA 1NK6A 2BGGA 4I9QA 2A5XA 4AQYJ 1B70B 2HMIB 5EVZA 4IFEA 3TUZC 2DR7A 4K5SA 1QQOA 3SAGA 3QT5A 3TW0A 5ETKA 1Q95G 3OYHA 1VISA 4JI0F 4I7FB 1KC8T 1NK0A 1PGZA 2GMLA 1PJ6A 3W8PA 4BDYA 2HNYA 1H3DA 1Q18A 1YRXA 1DFDA 4BC7A 4L8RB 2HQCA 4PQUA 3E9LA 2N3OA 3PX4A 2J0QD 3N0VA 1D3WA 3DOKB 1FXRA 4X2BA 2HBJA 3HSZA 3AVAA 2RSQA 3HVTA 5D6GA 5EOYA 4CO3A 2XO6A 4LC9B 5BR8K 1RYSA 3AT1B 4A8XA 2NRRA 3R3TA 1KTQA 2BANB 2J0WA 2GVDA 2UXBK 3QFWA 4PQAA 3OA9A 3OS2A 1SV5A 1VQKN 2XG8A 1VJQA 2AWZA 3PX6A 5LSOA 3THXB 1WELA 4K4WA 4EEYA 3FC9A 4RU2A 1VC6A 1TMMA 4M1KA 3OR2A 1IR2A 5HQMA 2EFOA 5D4NA 3AJ2A 4JHDA 3KKSA 1EKRA 5HRSA 4IQMA 2IBOA 1LAWA 2D69A 3PRBA 2B4PA 2PE8A 4LRCA 5KG5A 1G15A 1C0TB 3R7BB 5E3PA 2LQ9A 2RILA 2HRYA 1NGFA 2E6LA 3V81A 2BH1A 4PXEA 3H7HB 2HFSA 2CPFA 2NZCA 4DV4J 1TAUA 2HQ3A 1GLDG 2QWLA 5KPZA 5KG0A 1UOCA 1S9EA 2OFGX 4F2SA 4E7HA 2AJFE 4ZCKA 2OP5A 5KG6A 3C19A 2IVMA 3PR5B 4LF4J 4X66F 1MU2A 3TEGA 1R27B 2VFUA 5M2RA 1UW4A 4EZ6A 2CJBA 1S6QA 3RRHA 1LCUA 2ZBIA 3TWZA 3D2WA 2XMAA 3JSBA 3LDQA 2HFVA 1LOUA 3N79A 4O3OA 4DLGA 5GMDA 5HL7L 4B1WB 1Z05A 2UVUA 4DTUA 3O4WA 1F21A 1B0TA 4OX7A 4CD1A 1BU6O 3GPAA 1NRKA 1RBTA 4TQRA 4ZPVR 4CJQA 3DHWC 3OTEA 2EWHA 4BQZA 1D09B 1KNZA 1YJVA 2E4LA 2AZ3A 1RWXB 5KG7A 3KLVA 3V6HA 2CXEA 1RWVB 2IJRA 3N01A 4GKJK 7FDRA 3HHLA 3T9NA 4Q2LA 3A8EA 5KPTA 1L3KA 1VOMA 3P3DA 4DZDA 4B1ZA 2V2VA 4CF0A 4WJBA 5E5NA 1RT5B 1HHSA 2VB6A 4L6V3 2F7TA 2M3DA 3FSXA 2UUAF 2R8HA 2CH6A 3K0JA 5C2FA 4RNMA 3ZX3A 3E9PA 1V3RA 1T3OA 2R9LA 2ILZA 3G9CA 3VHQA 1S4EA 3OYNA 3CDBA 5KG1A 3BQ1A 4ED0A 2D7SA 5AE1A 5CE3A 1RNHA 2HHPA 4QWAA 1NZAA 4WQ5C 1WOQA 2E1AA 4H0VB 3BGOP 1Q7LB 3C6TB 2QA4S 3ZNJ1 2BKNA 2BDPA 3V4IA 2A0FB 2QL5B 4CF8A 4K41A 4C23A 2HHHF 2YNFB 5TKWA 4BC5A 3DRRB 4PG7A 4H0XB 5LMUK 2MZSA 1FRKA 1EQYA 4CZIA 3A8YA 1XC9A 3ATVA 3UVJA 1YBTA 4ZLNA 4X65K 2XY7A 3GE1A 1FFSB 1BI4A 4DR2J 4NLSA 4PABA 4ZP9A 5KFAA 1QLNA 4AHTA 4DQQA 3O5BA 4KGMA 2D0PA 2V4QA 4Q5VA 5IV4A 2W8KA 1GXUA 1NGBA 4HKQA 1F3FA 1UP1A 2CUYA 1JLEA 2MYFA 2PFDA 3NMUA 2K3KA 1TUYA 2VFVA 2VDHA 1SI9A 1U2RA 4OFZA 4M45A 3CD6N 4F9OA 4UZBA 2MY8A 3VQ6A 4IH5A 3OJSA 2P1JA 4H5NA 4CWBA 4J9LA 3K89A 1RHKB 1VQ7N 5KFOA 3CCVS 4FJXA 3KLGB 1XIQA 4OZNA 3TAFA 3AO2A 4M41A 5JUMA 2OLWA 5DG9A 2ZHAA 4K8XA 1SC6A 2E6MA 1RK8A 1RDUA 3DLGA 1CZAN 1WI8A 1PC5A 3ENQA 3VWSA 2YH0A 4NYPA 4ZLPA 3O6QA 4DFMA 4QR0A 4P7TA 4LBPA 4DV2K 3H08A 1RKIA 2XM3A 2XI2A 4CGJA 3EUNA 3RAMA 3EXYA 1SC1B 4AHCA 2AQ4A 4JAXA 3MUTP 2EFQA 3MF5A 3DRYA 1NOZA 3IAS9 1XR7A 2CWXA 3LGHA 4B3SJ 4J91A 1DJ0A 1T95A 1QVFR 2YX4A 2JL9A 2LXIA 4HI1A 4DUZF 2ZZTA 1SL2A 3MD1A 4WYLA 3FFKB 2QWRA 5F0UA 4WBFA 4H5VA 4YHHK 2B0GA 4WP3A 5B0GA 2ASYA 3CJ9A 2HK3A 3C65A 5A0YA 2O67A 5SWMA 3BZQA 1ZBLA 3VA3A 2D0BA 3P5BP 5MAOA 2KQ2A 2YWHA 3E01A 2WOMA 1S6PB 2DHAA 4BWJA 2VD3A 3KWGA 3UD3P 1YDLA 1S1VB 1LWFB 3A3NB 4HI2A 4F26A 2C3UA 2LA4A 4OYZA 5HO4A 1T6CA 4DTSA 1WSVA 5JS2A 5HMWA 5DRKA 1RTDB 5H9FK 3DJCA 2ALYB 3EN9A 2XQCA 4CJPA 2V34A 1P8ZA 3QESA 4RJVA 3G6ES 2VJVA 1KKHA 4OHWA 4E7JA 3J7A1 1U09A 3BGLA 1S10A 3AAQA 4LRFA 4HUEA 1I94J 3VZIA 4P10A 3ZTSA 1S5ZA 3H3NO 4C97A 4UW2A 2DNPA 1UW9A 3I33A 1EP4B 2CQBA 2EXUA 5FD1A 3H20A 3GU0A 3I56S 2C2RA 4B9LA 3V1QA 1HBOA 4B1VA 1WBBA 2A40A 2E8AA 1O1WA 3HSTB 1KC8O 2ROPA 1T9VA 3EZOA 1WG4A 4FCYA 4DTOA 2A2CA 2HWHA 4WPAA 4A48A 2G9OA 4RW6A 3PYFA 2VC1A 4V19X 4AQYF 4Z94A 3C8YA 3H2LA 2CQ0A 3GG0A 3CGIA 1U1RA 3OY9A 2HMPA 3GJQB 3TQEA 2RHQB 1LWEB 3MPWA 1NK9A 1J6ZA 2QYGA 2M0GB 1YJWS 2B5JB 5AQQA 2GV1A 2E20A 3ZETB 4B3RK 4D3GA 2EX3A 1UMJA 3NNAA 4IRCA 3FEZA 1VRQC 1R8AA 2Z1HA 4OZLA 4P72A 4UT4A 2MGZB 3LDSA 3QSYB 4XH4A 3TPQA 1TVRA 2QWOA 5AQIA 4LH5A 3LP2A 4K4ZA 3MM7B 3JS9A 3ZC4A 1RI7A 4XK8C 4DV7J 4NLGA 3IGVA 4LMZA 2Z1GA 1IM4A 5JLFA 4IKAA 4JV5K 3T1HK 3JTPA 2YQ0A 4CZEA 4F3OA 1T9UA 3DXKA 3NBPB 2UVWA 3BP8A 5HAOA 5F8JA 4HEA9 4OX9F 2UUWA 3FBEA 3PV8A 4YOTA 2VHGA 4ES1A 3K0SA 2E44A 3SZ2A 4HCCA 3SSSA 3R9LA 2FBTA 2ZVSA 1WC6A 1A0OB 2N4CA 1QQMA 3LOUA 4I64A 3PEHA 4JKGA 3FVYA 3GIKA 3VERA 1VR6A 1H2UX 4DL3A 3OTBA 2KKHA 2KVIA 3R6LB 5KFRA 4O5FA 1RU2A 2IIHA 2QIFA 1VQ4N 5CZVA 2UVVA 4JLHA 1EKSA 4RL1A 4FM0A 1S48A 3OHRA 2YNHA 4AF1A 2E1CA 4DV6J 4QR1A 1KBRA 2YWWA 3NY0A 2HHVA 3W61A 2XI3A 1C6VA 2NPIA 3HSDA 2CVIA 4MKBA 2XLJA 2AJ4A 4FKXA 3U02A 4FZVA 2XLIA 4DUYF 2P9KA 1ZETA 1ZM9A 4G3IA 4OHYA 2CA9A 3UKRB 3SFUA 4PWWA 1YZ7A 3AA8A 2BQ3A 2MZQA 4CEQA 1X31C 3TAMB 2B43A 3SAHA 1R8HA 2KTQA 1TKTB 1IBLF 2EK1A 3AD7C 4WU2A 5C24B 4QPXA 4FS1A 4XDCA 5L1KA 1KEKA 4B1UB 3RTVA 1YJRA 4RWTA 1NDPA 2C3MA 2HIQA 2QWQA 1TKXB 3ZCMA 4FNHA 2HVEA 1S7HA 5ETPA 2CAJA 1B3TA 1V4SA 3EGNA 1NGEA 2W2NP 1DZ5A 5EXWA 4WCEQ 1HR0J 3EY1A 3NCQA 4HH1A 3G96A 4C0BA 5I9EB 1FI4A 2WVBA 2ZFHA 2DGQA 4CO5A 2GIFA 5HBMB 2WVCA 5F8GA 3T5HA 4FJ7A 4Y2MA 4WFNL 1SAZA 2GX8A 3ENBA 3IWNC 2CDRB 5C15A 3BN4A 4F4ZA 5L39A 4CJEA 3UCZP 1UJ6A 1CS4A 1FDDA 2C3OA 4QW9A 4MDBA 4ZP7A 2DPNA 3UKUA 3L7PA 5KOXA 2V50A 3HO1A 2FHJA 2DT9A 3CC4N 3PSFA 4FPBA 3RUBL 2D0OA 4DFKA 4LH4A 1SL1A 3EYZA 2G4BA 1N34J 3JXUA 1UVNA 5AXNA 4X64K 2LMIA 3GYNA 2FB0A 1ZPWX 3ET6B 2HHUA 3DNCA 1K8AO 5JVGL 2JVOA 1C1BA 3N6MA 1VGYA 4Z0UA 4CJ5A 2WB4A 3BS9A 1VSLA 3ELHA 4GV6A 4DR2F 5M1PA 5J1EB 1U1NA 3QERA 5GADP 3OSNA 1A9NB 2DNQA 5C7PA 3CCLN 1NDCA 2W01A 4PXCA 4ZPCA 2AP1A 1RWUA 2RH3A 4LD0A 4ECRA 3CJSA 3QAEA 3SUQA 3BGFA 3TA2A 3MXIA 1RE1B 3CCQN 4NWBA 1RAJA 5HOOA 3BF4A 5F9NA 1UWBB 4DCHA 1HA1A 2XRIA 1ZAWA 1YJNS 4GV3A 3VQ8A 2VOOA 1X4CA 1SZ2A 5JVHQ 4B9MA 3PG9A 5GAGP 1HD0A 3TX0A 4YDDB 1GOAA 3SFGA 3MOJB 3MAAA 2D0AA 3CCZA 3J7YU 1CXUA 3UN5A 2FJBB 3D68A 2KXFA 4ED5A 2F9DA 1HRHA 2ZJRL 4JI5F 3RB4A 4RG8A 2OTJN 4IQXA 2X51A 1HNIA 1JLBB 3M8PA 5D3GA 1Q8BA 1HNZK 3L2WA 3THYA 2FPHX 3VV2B 5HVHA 1ZM4A 5AQOA 4ZPBA 5BRFA 3HT3A 1U0HA 4ECTA 4IO9L 3S8SA 3LO3A 4E19A 4PPZA 2GEMA 5LJ5Y 3K59A 1OJ4A 2E5JA 3SUPA 2IOCA 2RQ4A 5A8RB 3M30A 2DPIA 1VRTA 3QETA 3ISND 3KYLA 3M6VA 1HBUB 2BJ3A 2CPYA 3CFPA 3NHGA 2RS2A 1S3XA 2DNLA 2BKPA 2G0IA 4K59A 5EDWA 3P8BB 3M2UA 3ETMA 1NJIT 2FBXA 4DU4A 2MHNA 1QZ5A 3KD1E 5HJXA 1NJYA 1AZSB 3US5A 1BIUA 2A1BA 1MMDA 4FYYB 1WUAA 4NXMF 3FBBA 3BZKA 4Z4GA 4Q2MA 2OTLS 4O3NA 2PIIA 1GMUA 3FLCO 2NYIA 3G71S 2HQFA 1YJ7A 1IKYB 3CJKB 3WBZA 3Q2SC 4EHUA 3K8WA 1D8ZA 4OI2A 1GOCA 3THVA 5U47A 5FRNA 3LP1B 3W63A 4ZPTR 2PBDA 1E6YB 3U27A 1J5EK 3DXMA 4W5TA 1BXNA 1PO6A 2HEKA 3MM5B 3ILOA 1H1VA 2O8CA 1KLMA 2OPRA 1Q9YA 5AE2A 4C1NK 2B8QA 5EX0A 2F4VJ 1RT4A 2W2PP 1UEKA 2B4JA 3OYMA 3BF3A 3MD3A 3GSIA 2IC3A 4Q43A 4CHOA 2G8IA 1RT6A 4BRFA 3ZZTA 3UE5A 3CPWM 1S4FA 1MMNA 2DIUA 2GA7A 1KQFB 2QC3A 4B3TF 5IM0A 5A8KB 3NGDA 5J2NB 5L1LA 4CZCA 5EGYA 4BRQA 4C8ZA 1RILA 4W5OA 2KJVA 4LREA 3VQSA 2DH8A 1WHXA 3I96A 1UEUA 1U48A 1FKOA 1NPPA 1GOBA 3Q7CA 3P45B 4CJWA 1VBXA 4P73A 2MQ8A 2MMYA 4JOUA 3L3CA 4EBDA 4OJGA 2RU3A 2Q97A 4JI1J 2BW7A 3EGZA 1BG3A 1A7GE 2BUNA 2BRLA 1UTAA 2MJNA 2AJ1A 3G8QA 4FJLA 5AJ3J 2QE5A 3R8EA 4TU8A 2RF2A 1UZDA 5B8HA 2XEXA 2WVDA 2F8MA 2IYGA 1S97A 1REVA 5AQFA 4M5MA 1V3ZA 5I4MA 1JLQB 4ZCIA 4ICLA 2ATQA 5LSLA 4DV0F 3J80O 4M7YA 4P2SA 1YI2N 2MZ1A 3BSCA 3ATUA 1BUXA 1B0PA 3HP6A 2AP6A 1HW9A 3O8WA 8RUCA 2QXFA 1KVKA 4DV1F 2YKNA 5LL6d 4JI6J 5HL7Q 3PUFA 3FZ2A 4WE1A 1FRJA 1HNXK 5E3RA 1FWKA 3CSKA 5BR8J 4JYAF 3KUGA 1NKCA 2UXBJ 2OPSA 2EK6A 1H7XA 1X4FA 2B4VA 4MKAA 1YTAA 3H40A 4A5AA 1NHUA 4M3ZA 3AVGA 3ULEB 1NZ8A 2V94A 5BYSA 5ETRA 4NLQA 4M5JA 2VA2A 4GO5X 4NX9A 1MROB 4CBUA 3BQ2A 4JI7J 3KK7A 1VQPN 1RDDA 3A5NC 3AVHA 4ZPWR 1FD8A 3R5DA 1Q8KA 2EI5A 3F41A 3D6RA 4OZ0A 1RHRB 1ZBUA 4KGVB 4DHVA 5GIPA 4NCGA 1R0CB 1YVNA 3OQ2A 1FK9B 1KFDA 1F5BA 1NJZA 1AB8A 1HX1A 4FJJA 5LJ3Y 4ISGA 1NLKL 3MPVA 3R6GB 2CJAA 1KXPA 1TV6B 3OR1A 3CERA 5AZIA 3M6GA 4FOIA 1NGJA 5K8MA 1T05B 4ANDA 2L9WA 4PG5A 3CJTA 3CJRA 2P51A 2H1YA 3GSDA 2RE1A 5JS1A 1FXDA 2PD1A 3DLBA 3MM9A 1XNRF 4YOWA 3IGNA 4URSA 4OJ1A 3OBYA 3VOVA 3HOSA 3N6NA 4JP8A 5E3QA 3IR6B 1K0VA 5BREA 3KK3A 3NNCA 3PACA 3CD0A 1CG2A 1S1UA 4UOCA 3HFZB 5DG8A 1N8RO 3WT0A 1NBEB 2C2KB 1X7VA 3EMTA 4NLYA 3J80U 1TL7A 2I8EA 3QGPA 2OEMA 1N33F 2DBBA 2DNZA 2ZH9A 1N6QB 2FY8A 2ZF5O 2IVOA 4M8LA 5AXKA 4LFCF 1EQ0A 1NO8A 3K9KA 5GAGI 4U8VA 3HULA 2DO4A 1L5UA 5M1FA 1TKZA 5HLFB 2O3DA 3BEGB 2ZQBA 3J7YP 4YR0A 3TAQA 4CTAB 2RUGA 3BH7B 1LW0A 4J37A 5AQTA 3C16A 4JK7A 2VQEK 4MH8A 4CIEA 3DLRA 5D0GA 3L4IA 3OHAA 5CHIA 2K7KA 2HS3A 3MMBA 2W7AA 3I9V9 2R4FA 3EL2A 4QS8A 1NNEA 1UPPA 1QQNA 3CQYA 7AT1B 3KHYA 4OHZA 1C1CA 2WTFA 4JI0K 1H0HB 4CZKA 4KAZA 2GIRA 3MCOA 4O4GA 4FK2A 4I6MA 4HUGA 1WD6A 3AVBA 2HS0A 3THTA 3TVYA 1MWQA 1ZTTA 3T5KA 4IG3B 3KLHB 4H5WA 4A2BA 2F1FA 3FRZA 1WAJA 4IR9A 4CIGA 4YR3A 1VK0A 2HZAA 4HYKA 2JWLA 1PBUA 3A0IX 3NGYA 5AR0A 5KT5A 1X0FA 2NYHA 4L76A 2GHPA 3W5YA 4H5TA 5C42B 4C3MA 1H98A 2WAQD 1IBMF 2I0XA 3ZEUA 1CPZA 3N4QA 3MN6A 4I68A 3VALA 3AVLA 2E5LK 4E8UA 4FZZA 2R7SA 3OVNA 3VQ9A 2GCFA 1W2BM 4OJHA 2R7XA 4QBUA 2YNGA 4O44B 1MW7A 4UZCA 4ZHRA 2MY7A 2LU2A 4OZ5A 2ZOGA 1HBNB 2N3LA 4M5DB 4JI8K 2GO9A 2ASDA 2ZJQL 4LT6A 1W26A 2GUIA 2BJDA 5HROA 3QIOA 4WFAL 4KHUA 3ZXWA 4OPHA 3UD5A 4ECSA 3GFXA 2WONA 2P6TA 3HJVA 1VQ4S 2P6SA 1X4EA 3BGRB 3MMAA 2IY5B 1U49A 2J7KA 2FLPA 5DZ7A 3THWA 1WUUA 4CLUA 4X62K 2JOQA 5L9XA 3R1HA 4FLTA 4QR2A 1Z26A 3JXOA 3OUYB 3WNGA 3RBXA 4BLGA 2BKOA 4IWVA 4CEOA 2VPYB 2H48B 3BEXA 1M5VC 4DV2J 2ATLA 1SJQA 1GLFO 3SDEA 1TL1B 3AVKA 2ZGYA 1R6VA 5E3CA 3T41A 1YITS 3AH6A 1FRIA 3DYAB 2FDNA 1DKGD 2FVSA 4ZJQA 4DTPA 2Z2LA 3SPZA 2DY9A 2LFVA 3ENAA 2D3UA 3VEOA 2RRBA 4IXCA 4ZVQB 2GJIA 1XUPO 1S1XB 5LT5A 4F2RA 1IWGA 4Z7YA 3KK2B 3QEVA 3OYCA 3EVMA 1VI7A 5C2DA 1IXKA 3D6HB 5IS2A 2WBMA 2VFRA 1Z2ZA 3QB0A 1VQMS 1KS2A 3EPGA 5GAHP 3JTOA 4ANEA 1FKPA 3PKYA 2JEGA 1NSQA 1AXQA 5F3ZA 4IFYB 2XNRA 4LFBK 3RSEB 5LMNJ 3HD2A 2KHOA 3HPHA 1ZA2B 3RMCA 4PWDB 3D0GE 2W24A 2UUAK 3FCVA 1CZ9A 2OH2A 3JS6A 1IR0A 4NYOA 1LQ9A 1NM2A 3WIVA 1T9WA 3EDRB 3CETA 2J0XA 1HI1A 2I5JA 4I1TA 4MMOA 5IT0A 4OGCA 3SQOP 3O9QA 3J7AP 2XMTA 4I6YA 1APSA 4RUHA 4FYVB 4QOTA 1CJVB 3LL3A 2RRAA 3D0PA 4CLFA 2HBKA 4BR2A 2H5JB 1NM1A 2P9UA 1VQNN 2HHHK 1RU1A 4OI0A 4CYUB 5CYMA 4IBNA 1P90A 4FBTA 1HWIA 2MZTA 1VQ6N 1YSJA 4C4WA 2UXDF 3G6YA 3R3LA 2OMLA 4IOXA 3T6BA 1G1XA 3MFIA 1XNQK 1RTHB 3W60A 4I6WA 1IVZA 1ATNA 2HLTA 3POTA 3ZZUA 2KZZA 5AJ3F 3DLEB 3DI6A 5KFNA 3T69A 2ZEJA 2M52A 2BM1A 3SIPB 3HOTA 4A8YA 4TY8A 3CQ8A 4F36A 1NMDA 3EWGA 4N47A 2JGUA 2FHMA 4DS5A 4WK3A 2GHVC 1S5JA 3AOAA 1TTHB 3GFZA 5HANA 3BSAA 3RYLA 5HQ8A 1FRXA 2B7CB 2Z56B 2E2NA 3W9JA 2XTJP 3NG8A 3DXSX 1TU0B 2BJEA 3K5OA 2MLZA 2VQFJ 4CHQA 2HNYB 3J7YI 4AXJA 3QFPA 1XJWB 4JV5J 4ED4A 4PQUB 3N6LA 4OIXA 4UOGA 3T1HJ 1IKWA 4YDXA 1U47A 5AQYA 3D7EO 3L2VA 3HVTB 1VQON 2D4WA 4CVNE 1H7WA 5KG3A 2V0NA 3A5OC 5IZHA 1UL3A 4X4RA 5KFZA 1RABB 1RT1A 3BDEA 3AVJA 3VQ5A 2R2RA 3QNNA 5F8LA 1ZBSA 4ER8A 2OMOA 1SUQA 3DMJB 1LKZA 4LF7J 1SV5B 3D2FA 3CYMA 2BRKA 1L3TA 2BR0A 3VQCA 3M1FA 2Z57B 5E7OB 2GWKA 2ZUAA 2KDOA 1VSIA 2Q2RA 3R27A 2VKRA 4CECA 5T14A 4U7UK 1X5PA 3OR2B 4IH6A 2EC0A 3V1OA 4ILGB 4X4TA 2YJEA 4JHDB 2J9DA 3B82A 4WFNQ 1BD6A 2HS4A 1HWJA 5C25A 3A4TA 3HTVA 1J54A 1F9HA 4FYWB 3V81B 1X60A 4I2QA 4YB6A 4FKYA 1AYEA 5M1NA 4HTLA 3CCJN 2O8FA 3UCGA 2MQPA 4FJMA 3P4UB 2ERRA 3V9SA 3O44A 4A46A 2VBXA 4DG1A 2UYTA 4LY7A 1YKWA 3KXDA 5FPDA 4PG6A 4J9KA 1G7CB 4EUVA 1TQLA 4KHSA 1MU2B 3QEIA 3B4MA 2J6UA 2VG7A 1SH2A 4X4OA 4K7QA 2P5GA 4ECWA 4XO0A 1S6QB 2ZNYA 2GO8A 2KFNA 3C6UA 1SH3A 4Y34A 5H1SQ 5DMRA 5E33A 1KSPA 5AXLA 3GYGA 2BEFA 2JLGA 4V19J 4DX8H 3BY5A 2FIUA 2PI5A 2DJWA 4LFAF 4K0KK 1U2FA 4P52A 4GRSA 2J0SD 2PC6A 4IG0A 2W9CA 4NMXA 3HHLD 4EZ9A 5C12A 5JLHA 3Q8UA 2Q36A 1IO2A 1UZHA 3L7UA 4XH5A 2XGPA 2LXUA 1TL3A 4S0MA 4AQYK 2E9TA 5CY4A 4QIWD 4WQ4C 2FVRA 2XCAA 3HHDA 3W2VA 2C2DA 2C42A 5KT6A 3V6KA 4OPAA 3MHYA 3AGKA 1ZBFA 2G0JA 4H5RA 4TN2A 3VEZA 3SMPA 4ERDA 1WG1A 2OPPA 3DHXA 2ZD1A 3J81U 3SAFA 3SCKE 1WSEA 4CZFA 1LV5A 4C8LA 3EZUA 1MLAA 4BR7A 4IFVB 3PYGA 4DV3F 2F5GA 3VESA 2C2OB 1DLOB 3MMCA 4F4WA 3M7VA 3CCSS 3GL1A 2ZJRQ 3QMQA 3CJ2A 2XZWA 2GJFA 5J2MB 2BABA 5DLGA 5HRPA 4EFAC 4C0HA 1IN0A 3QJLA 3CCRS 3B6OA 4DWIA 2J8AA 2Y1JA 3LWLA 2EWSA 1OSCA 4X64J 3H5YA 2NLXA 2ZH4A 2AEMA 4X4UA 1D8YA 4DR7F 3A2FA 3OYIA 1K1QA 4FLYA 2YKMA 2AW0A 1EETB 4FJKA 5JICA 2F8TA 3CG7A 1YRTA 1MWMA 3UVJB 2NRVA 2HHTA 1RBOB 1BI4B 1URRA 1SJRA 2P9CA 5IV3A 4IDKB 4BBYA 2DD8S 4OI4A 3OTOF 4MKVA 4CI0B 4DN0A 1CJUA 4F0KA 4UQTA 3MEEB 3N9UC 4L3QA 3DXBA 2NRWA 1TKDA 4RPFA 1MWYA 4I9LA 4DV4K 4A61A 2J7WA 5KFIA 2QLBB 2L48A 2DKOB 1HPZA 4FWRA 4J5OA 2L9DA 3GMGA 4E0DA 2BJ8A 4I2PA 1NB7A 1HUXA 2KYXA 4LF4K 2QEXS 4CEEA 1Q81O 5BRDA 1H72C 1OY8A 3HP9A 2I9SA 1K9MO 3DLGB 3OBWA 2RIJA 3EZ5A 4LF6F 5ADZA 4CH1A 3AO4A 4LF9F 4IUFA 1RBVA 2WK4A 4JI2J 1ZZFA 5CYJA 1MN7A 1IBLK 2IM3A 3BSNA 1GK8A 1RWPB 3O3HA 1LW2A 2ZHOA 3GFYA 3J8AA 1UA1A 3ADAC 2DNKA 3SCJE 4KREA 1FF2A 1NCLA 2E7WA 1FDNA 2RT3A 4JV1A 3AVIA 2VWKA 3QINA 1XMOJ 3VGKA 3V2UC 3D2EA 4DR6J 3IG1A 4EWTA 3ULDA 5AQWA 1K44A 3GTYX 4N77A 4AL7A 1U1MA 3M9NB 1WSJA 4CI6A 3I0SA 2CQ3A 3D6MB 5M1OA 3TYTA 2G8WA 3MAHA 3WUHA 1XR5A 2NREA 1ZC6A 2IFXA 4USWA 2DNGA 2C3PA 5A0YB 3BM7A 3U3GA 1W7AA 4XDDA 1I5OB 3RBDA 4GNIA 4JI3J 1HJOA 3H2VE 3PNIA 2GELA 1TK8A 3CC7S 2WOMB 4WZQA 4Y1DA 3C7NA 2Z2YB 2B3TB 4H0PA 3AD8C 4CHZA 2Q0RA 2A1RA 3MXJA 4CZLA 2VPXB 5CCMA 5AQKA 4RNOA 2QYCA 1X9SA 3O1WA 2VG5B 4KQZA 1N5TA 1NPKA 2L41A 2V8VA 3HLUA 4OGEA 1RBLA 3CJ7A 2F7VA 1QSSA 4BC9A 3KKRA 5AQVA 3K5NA 4DQRA 3MXHP 4DBQA 2FQQB 2XMJA 3GLJA 1ZH5A 5ADXA 2EKNA 2W40A 4K4TA 4C48A 4A47A 1ZBTA 2QMUB 3KLEB 3MTKA 1U1OA 1WSIA 1FHTA 4W5RA 1HIYA 3ZZZA 3KD5E 5E26A 2HHSA 3D28A 3D3CJ 4NA1A 1O13A 2OD4A 4DR2K 2YHBA 2JWNA 3P49B 3A12A 3LDPA 2K1RA 1YIJS 1PAUB 4P75A 3O3LA 1RTIA 4F3MA 3BSOA 4MIBA 4W5QA 4M42A 2DITA 2NRZA 2YX7A 4CJ3A 3VR1A 1YTYA 2DGSA 5KFPA 4H4KC 1FXXA 4BE2A 1VK3A 2OZSA 4CK2A 4YQWA 1U1LA 2G1HA 4CJ7A 4ATNA 4RKUC 1M5SA 1QVGM 1FRHA 1NGAA 2GAGC 4USHA 2A18A 2HB5A 4OPJA 3OVAA 3QRQA 2QK9A 3DU6A 2XHBA 1YHQN 4FPRA 2VQFF 1XMQF 1LWXA 3AVFA 1Z4UA 3W7BA 3PIPL 1VQ8S 4IO8A 3NAIA 4ELVA 1XMBA 1TVRB 2JH3A 4CZMA 3VGTA 3LP2B 2QW9A 3W64A 4JI5K 1D9FA 2VGNA 4ZP8A 2QXLA 4DDFA 4N8OA 4G9ZA 2BJ1A 3M9MB 2JRSA 3UO0A 5K8NA 2FGCA 3QLHA 3CM5A 4HLBA 1ASVA 4NE9C 3DXKB 1OH7A 3DU5A 4DTJA 4B3SK 1PKUA 4ID1A 5CR4A 4KO0A 4MFBB 3H1VX 4KHNA 3OHBA 3W5ZA 2QWMA 5J1PA 3L3UA 4F3QA 1RADB 4K42A 4B3MJ 1V5VA 4WXOA 2P9LA 1IBCB 3KMSA 4ID5B 2YNIB 2D3O1 4JKGB 4DR4F 1IG9A 3JAMY 3Q22A 2R7WA 3HPOA 3ILJA 3R9PA 4DTNA 3MCMA 4K8RA 4CO4A 1REGX 1LEOA 1Q78A 5DM6L 4IZ9A 3CWJA 1E4GT 1K0TA 1FFWB 5KT3A 4CFDA 2J4RA 1LFWA 5BPLA 2Q79A 3JQMA 3M32B 4BWMA 4A8KA 3GOIA 3OD2A 2YNHB 2RS8A 3CD5A 5F8NA 4FVMA 1ITGA 1IQZA 3NH0A 3VF4A 4R0JA 3CMAN 4U7UD 4WF9L 4TLQA 3IBFB 4DHYA 1WSFA 2B4OA 2ACMA 1NG9A 5C0YA 4A8MP 2P9KB 3IR5B 5I3QA 3PYEA 4A62A 1S1TB 5AQNA 1GXTA 2VYPA 3E3XA 4DS4A 3LP3A 2XULA 3PDNA 4GY2B 1KN6A 4F7VA 1N32J 2P9SB 1QM9A 1LNQA 4O3QA 2DH9A 1N5SA 2UUTA 4W98A 4O0JA 5GAEU 3KZBA 4NXNF 3HHKA 4DR5F 3NF6A 4ZIWA 1WTBA 1GAOA 3PYDA 5L9NA 2HURA 3D1QA 4MO4A 3ZYYX 2W2QP 2DPJA 2HW3A 5DS7A 1ROFA 4KGZB 2DGVA 1W25A 2ZWHA 2ZH2A 3LP0A 3NDKA 1TZ0A 2VODA 1U26A 2COLA 1RLDA 4FXDA 3SQ1A 1OMSA 2YKQA 2BVZA 4NZ7A 4LF8F 1HNVB 3ZSYA 1C1AA 3E66A 2GQ2A 2LQJA 3R97A 1DQ9A 4ZMMA 1WEXA 2Z1IA 5JMVA 3PTWA 1QSYA 2QN6B 1BGXT 3L2QA 1E3MA 4DV7K 1BIZA 4HDHA 2A10A 4CEZA 1Y3JA 1VHFA 3AQOA 4PKIA 4GMJB 5CZXA 2QX0A 2XZDB 2VFTA 5KT4A 2FF3B 4QU6A 4BRCA 2ZM6F 4F3TA 3PSIA 3G4SN 4DV1K 2HMIA 1A5VA 5F2RA 1J5OA 4PCQA 4O5BA 2CFXA 1Q53A 2P9IA 1TYQA 2AGOA 1Y00A 4ZIVA 1U02A 3AY0A 3RGIA 1GLCG 3VVTA 1C1BB 3SQ2A 3WQTA 1WG5A 4FF1A 1G3OA 3TTCA 1SIWB 3HXMA 3CMES 4ANCA 2VDIA 2HBYB 4HL9A 3AXKA 1KWMA 4CLYA 1IQTA 2CQIA 3W8GA 2PDAA 2B56A 1U1KA 1EKEA 4ZVEA 3HSGA 3V1RA 1DEJA 1XQIA 1VQLS 4DV6K 2LYVA 5EHHA 4NYNA 4RU9A 2Y0BB 1HQUA 2BA9A 2E5GA 4FVCA 3WXMB 3D1HA 1YZ6A 1I39A 1NBWA 4KY3A 4X84A 3GV5B 4BHQA 5B7WA 2OANA 5F1XA 3TARA 1L3UA 2PFUA 3VGLA 2GBZA 4KHMA 4X66J 2WZ1A 3MAAB 5CH7B 1HI0P 2FLOA 3MUMP 3QEXA 3I8DA 1XNRK 1FXLA 1C0TA 1ACMB 4EGLA 4E7LA 2FGOA 1VQ5N 2X1GA 1S72N 4MLEA 1UFKA 2EFVA 3O80A 4CLTA 1CQNA 4ZVGA 4EHTA 5F8IA 1HNIB 2YPZA 3M8PB 5D3GB 3FNNA 3MCNA 2ROEA 4DV5F 4H4MA 3PFEA 4BR0A 5I42A 1Q7YT 2Y1RI 3NGUA 3THYB 2O8BA 1F5CA 2A42A 3LDOA 3A5MC 4UOFA 2HPUA 2BXJA 4DR1F 5CQGA 2KRRA 2HKEA 4C11A 2F96A 1VBKA 4DFJA 1LWCB 1YLXA 2EKYA 4AM7A 1LOTB 2XBPA 2I7PA 1PCAA 3BV8A 4ALZA 3M30B 1VRTB 2SXLA 2BE7D 2E66A 3TANA 5I3UA 3Q8QB 3IS9B 3U1MA 2NSBA 5LJWA 2XHWA 3QRRA 2HWIA 3GR0A 1RAEB 4RUBA 1UPMB 3OL7A 1TL4A 3MEGB 3M2UB 4FYDA 5A76A 1Z1ZA 1UVLA 3KHGA 1JLGA 1ZA1B 4JS5A 2R3VA 3ILLA 5BYQA 3QZ8A 1D9DA 4IEIA 3M8WA 1FESA 2OPQA 4H03B 2UUAJ 3GP9A 2QJ3A 1WKKA 2CGLA 3QYYA 3NGTA 4DL2A 4CF9A 1U7LA 3TR5A 1BA1A 3T3FA 3QICA 3TNVA 3KLIB 4JD2B 2CQCA 1KAZA 3CXCR 1WSHA 3FBCA 3VCDA 4ECQA 3DXMB 4DSIA 4CJKA 3H46O 1N34K 2O8CB 1KLMB 3PIOQ 2OPRB 2YHWA 2H51B 1RT5A 4BG9A 2FJWA 2HHHJ 4YN3B 3VGVA 2CIMA 2H54B 3OFEA 2IC3B 4EK2A 3P39A 2JEJA 1RT6B 4M3YA 2DTUA 4DSKA 4UTGA 1M1HA 1QD1A 1HKGA 2Y3YA 2D1CA 4EP5A 2JX2A 2A3JA 3GONA 2PO4A 1BQXA 3TEHB 3SQ4A 1VHXA 3CJ4A 4Z4EA 1JJ2R 3AHPA 2CZ9A 1YAGA 1RDRA 5D0HA 3PO4A 4OYWA 3C6TA 3FZBA 1RP5A 4JKAA 3JQKA 4O0NA 2PN6A 4BRKA 2ZWOA 4H0OA 3BO4A 4JI4F 1X3MA 1SQKA 1RT2B 2YNFA 2IRYA 1EB0A 3JAMO 1BISA 1JMTA 4DQSA 1MDUB 1Q16B 4J2EA 4LQ9A 4DL6A 2QKKA 3LANA 2GQQA 3ZT0A 5KTQA 3T5JA 4DJBA 1VLYA 2YWKA 2YX1A 1N48A 3RW6A 2B7BB 4NOHA 4YB1P 5CZ1A 1X0PA 2D0CA 4CE9A 1REVB 4CERA 1VQSA 1WOSA 4ICLB 5ELZA 2UVRA 1RSCA 5L46A 1CC7A 3Q8YA 2ACYA 1IBKF 2W4PA 1NLVA 2NXUA 2FF6A 4WTYA 4CBWA 1TUGB 3VAHA 2YKNB 4GO7X 2NZ4A 1GLJO 4WE1B 3TUPA 4DPYA 5A6WA 3T19A 2DHHA 4B3MF 2RQCA 3BR9A 1HYSA 4F4XA 2DHXA 5ETMA 3RB0A 2OPSB 4K4UA 5DDOC 5H9EK 2PEHA 2DR6A 4CGIA 1OPIA 4DUZJ 1X4AA 5C2CA 3ZT4A 2QMWA 4TLRA 4B9VA 1VFJA 4EAHD 4QYZJ 2Y8WA 3IAYA 3W66A 3TI0A 4F4KA 3HI9A 3U1NA 3DAWA 1JLAB 3C66A 4Y00A 3W1YC 4CP5A 3HT0A 4DPTA 3TAPA 2KZMA 4DUTA 2J9CA 4CK3A 4Z7CA 1GLLO 3SBGA 4HT5A 2VC0A 3KLFB 3KJQB 3BB5A 2DTJA 3F9KA 5KFWA 2R8GA 2WVFA 5KFQA 3WEEA 4ZOSA 3KVGA 4UUWA 1WC3A 5CAAA 3FR0A 4JKDA 3JAMU 3FGUA 2BM0A 4G65A 4LBHA 3V6JA 1HKAA 1WC5A 4K4SA 1RZMA 1UFWA 2F4VK 1XBWA 4WFBL 3CCMS 2B9EA 1S1VA 2V9WA 3KK3B 5FROA 3PCOB 1H74A 4P9SA 3I55N 1KQSM 4J9OA 1MG7A 3EM1A 2ASLA 4CRJA 2M7SA 2DO0A 1TL7B 2VASA 3R5AA 1VC0A 1U04A 2IA6A 2AKWB 2UXDK 4G1QB 2HG4A 4KFBA 3SYZA 2WW4A 2MSTA 1TKZB 4UY8T 2BQUA 4DCJB 4DL5A 2IJNA 2FY1A 1U2VA 1LW0B 1EP4A 5CA5A 4JI1K 3C16B 4NYFA 3BJYA 3HZ6A 3QATA 5AJ3K 2LSNA 3CCUN 3SJJA 4LR7A 3FSYA 4DTRA 4KHQA 2ZBPA 2KN4A 2O4IA 3OL6A 2ILYA 3AOBA 2Z8QA 3P38A 1IUJA 3SMZA 4CLPA 2OCEA 1C1CB 5HP1A 3NVKA 5A8WA 1FVQA 1SXLA 4CLSA 1KQGB 4RBVA 4O4GB 3UI3A 3CC2N 3VGMA 3ZLJA 4JI6K 4GKJF 4IOAL 3OLBA 1W9HA 1BCOA 1V4TA 2EFNA 1LWEA 1ILYA 2AZ1A 2VBZA 2V2KA 3EVWA 1FX2A 2RQKA 2AGQA 2XSJB 3ZETA 1FVSA 3VQEA 4OX9J 2XYPB 2BQRA 1BQNB 5LXRA 1FJGJ 4OKKA 4QCLA 4NYZA 1Y64A 3ZEUB 5GMKa 3MM7A 3OSPA 2PAVA 3VGSA 1R3NA 2DXDA 2DXFA 1X4GA 3DGVA 1M90T 3AO5A 4JI7K 3NCIA 2YNGB 1YJ9S 1V3SA 2LEPA 3S3OA 3I0RA 1B7YB 3CXCM 3NBPA 4C9DA 4XPEA 4LSLA 1M5HA 3MM8B 4L75A 3DFEA 1TFYA 3QRPA 5KFFA 4AE5A 5BPMA 3ZSQA 3BPDA 3OYBA 1B9DA 5LMUF 4KHRA 3EGWB 4HHUA 3TSQA 2U2FA 2WONB 3V6DA 4X65F 4QS9A 2C2NA 5HVFA 3B6PA 3MMAB 4DUYJ 2JC1A 3V9WA 3UDCA 3IWLA 1FCAA 4OYOA 4M5IA 4YDUC 1NGGA 3THWB 3L9ZA 3L8BA 1WHYA 4FN5A 5C5JA 1T94A 1Z6RA 5AT1B 2R7YA 1RYRA