4B3OA

Structures of hiv-1 rt and rna-dna complex reveal a unique rt conformation and substrate interface
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
553
structure length
540
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQAIHLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna/rna
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Complexes of HIV-1 RT, Nnrti and RNA/DNA Hybrid Reveal a Structure Compatible with RNA Degradation
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 117
structure length 540
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4b3oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b3oA05
3BGRB 4CK1A 2HAIA 4RW7B 1D9FA 4NRUA 5T7BA 2X6NA 2XRIA 1RT4A 2XGPA 4DS4A 3M8QB 3UPFA 3WNFA 2JLEA 5F9NA 4KAZA 4Y2AA 4Z4FA 4HHTA 4JV0A 2BANB 4N5SA 3DM2A 4ID5A 5KRSA 3N6LA 1S1UB 4Y3CA 3MF5A 2ZE2B 4EP4A 4QWBA 1ZYQA 3NHGA 2HNDA 4DTUA 4IG3A 3KNAA 2WONA 1I3AA 1HYVA 3K58A 2V0NA 4LSNA 2ATQA 2KFZA 4O4GA 3L2UA 4DTJA 4B8CA 4KHSA 3M8PB 5KFHA 3MECA 1D5AA 4PUOB 1HYZA 3OJUA 4K4VA 4I2QB 4YFUA 2J6UA 3QEVA 5KFJA 1WNEA 3AVCA 1Q9XA 3WNEA 1S49A 3FRZA 2YNHB 2B5JB 3EPIA 4Y2CA 4DL2A 1X1PA 3VQBA 4CJEA 2KQ2A 1KTQA 2G8HA 4KB1A 2ZD1B 5C25A 2JEFA 3OVNA 4K8ZA 4ZPBA 3AVIA 2DPJA 3MFHA 2WB4A 1RTIA 2D0BA 1VRUA 4PWDB 4BDZA 1NOYA 3NDKA 4DU3A 1LWCB 4XO0A 2CJQA 4IOBA 3L2WA 2OPPB 1N48A 2IJNA 2IM1A 3SQ4A 1C0TB 1QQCA 4YP3A 1HQUB 3VQ7A 3VQPA 3TAQA 4IKAA 4CGGA 4OGCA 4CF9A 4B9TA 5KFUA 1BI4B 1NOZA 1S0MA 3KHLA 4FLVA 2W9CB 2Z1IA 1RCHA 1RTJA 2B6AA 1S9EA 1JKHB 2A1RA 3EY1A 1HNVA 3SNNA 4Z4EA 1RA7A 3HPOA 2WRMA 3PR4A 3QNOA 4J9PA 2IM0A 4O0JA 2O5DA 3I0RA 3DLHA 4RW6A 2QV6A 2VG5A 1NK7A 5KFSA 1IKYA 4B8AB 2P51A 4FJ8A 1RTDB 1B9FA 1KVBA 4KB7A 2YHBA 3V4IA 5KG7A 1EP4A 1F21A 3SI6A 1RT6B 2KZMA 1HPZB 3JYTB 3K5LA 3HVTB 4WFXA 4Z4CA 4FJ7A 4ECRA 4KFBA 4IR9A 3OYMA 4OL8A 4I2PA 3ITHA 3O3GA 2FJVA 4GW6A 3CO9A 1ASWA 2UVVA 3KLIB 1SKSA 3RMDA 5DG7A 4ZVGA 3CVKA 4DFPA 2BQUA 4J9RA 2HNZA 1HARA 1KSPA 1C1CA 4K50A 4FVMA 1ITGA 3NF7A 4F2RA 4LY7A 1NHVA 1CXUA 4IFVB 3BQ0A 2HHXA 3IAYA 4WFZA 2IA6A 4QWAA 1C0MA 3OS2A 3IGNA 4DFJA 2XGQA 1N56A 4RW8B 4R0EA 2AGQA 5KFOA 1WSGA 4B9NA 3KLHA 2I5JB 2FVRA 3DI6A 5EUHA 3H5XA 4G1QA 4ED1A 4CHQA 2AGOA 2QKKA 4N41A 1HRHA 1SKWA 4CFAA 2FVCA 3MFIA 1IKVB 1SH2A 3SQ2A 2O4GA 3AV9A 3GV7B 4CE9A 3KK2A 5KFVA 3LP2A 2UVUA 5K14A 3A2FA 4FJJA 5J2QA 3DM2B 4ID5B 5J2NA 3OYKA 3DRRA 3D5MA 4WYWA 2HNDB 4IG3B 2VA3A 2WONB 3RMCA 2W7OA 2HHQA 4AHVA 4LSNB 2XI3A 1N5YB 1QSSA 4O4GB 1VSFA 5KI6A 3FDSA 3MECB 1SH0A 2PYJA 4U6PA 3V6DA 3LWMA 3NF6A 1BQMA 1RDDA 3I8DA 4CEQA 2BRLA 4CGIA 4CIGA 3VQCA 4B3OA 4K4TA 3DLRA 3PR5B 1TGOA 5JUMA 4JV1A 1L3SA 4FLWA 3AO5A 3L2VA 1XI1A 5C25B 1OS5A 1WLJA 3M8SA 4EYHB 2AWZA 1VSJA 3LANA 3ZCMA 4WE1A 5C42A 1UOCA 1RTIB 2DFHA 1VRUB 4CJWA 4W5QA 2V9WA 1SL1A 5KTQA 3PJXA 4ZMMA 3KIOA 1A5XA 3QIDA 3NFAA 2XY5A 4CEEA 3QZ7A 4NLQA 2P1JA 1JLEA 3QLHA 3AVGA 5J2MA 5DLFA 4FLZA 4EO6A 4K4ZA 3KOAA 1RTJB 2B6AB 3DOKA 1W9HA 1U48A 2FJXA 4FZYA 4DS5A 4K4WA 1TAQA 1RBUA 3TAEA 1IH7A 3M9MB 4QAGA 3H98A 5DMRA 2FVSA 4DU1A 3I0RB 3IN5A 4IQXA 1TV6B 1LWEB 4RW6B 3OS0A 1U4BA 2VG5B 1XR6A 3UIQA 1VK0A 4CEAA 3I5CA 3KD1E 1R0AA 3ALYA 3SV4A 5SZTA 2YV0X 3OLBA 1EP4B 1WSIA 1QE1A 5D3GB 5L1JA 1EX4A 4CGDA 3AA3A 4EZ9A 4KFBB 1T05A 4CFCA 4I2PB 3AO1A 3ITHB 2OPSA 2HMIA 2XY6A 2E9ZA 1WSFA 3PX6A 3C6TA 2G8UA 1C1CB 3TI0A 1BIZA 3P1GA 3OYCA 4KHWA 4CF0A 4NLUA 1TVRA 4RW7A 1JLGB 4CECA 4BE1A 3TANA 1S6QB 3AVMA 3CJ5A 1VSIA 3AVAA 2UUTA 3ZSRA 4KRFA 3CM6A 3Q8QB 1ZETA 2Q3SA 2O4IA 3ZT3A 3KLHB 2E9RX 1SL2A 3SV3A 4RW4A 1DTQB 2IM2A 2VWJA 3DI6B 3GIIA 3H08A 1S1UA 3CJ4A 3B6OA 3ZT4A 2D3ZA 1GOCA 2ZE2A 2YNGB 4G1QB 2RDJA 4XIUA 3KLVA 3NF9A 4CK2A 3LALA 2I1RA 2HVHA 1D9DA 1ZBLA 2C28A 4CJ4A 4FW2A 3OYFA 2HVIA 3RR8A 3KK2B 4PUOA 2ETJA 5KG0A 2QK9A 4DTSA 1S1VA 5J2NB 2KTQA 3DRRB 2G8WA 5F8JA 4NYZA 4OKKA 3TR8A 4CJLA 3OJSA 3M8RA 1T7PA 4FLUA 1Z4UA 3I0SB 1KFSA 2ZD1A 4J9QA 4CHZA 1LAWA 1RAJA 3O3FA 1JLQA 2V4QA 1RT3B 5FROA 1S1TB 4RW9A 4DTPA 4Q8FA 4PWDA 5CYQB 1K6YA 4M3XA 4FS2A 4DL4A 3TAMA 3ZSWA 3LZJA 4ELVA 1XR7A 4ED2A 1BQMB 3MEGA 1YTUA 4J2DA 5C5JA 3CFPA 3QINA 4UQGA 5HBMA 4ZP7A 4YQWA 3HM9A 1RBVA 3K57A 3SI8A 3L8BA 4KO0A 1KRPA 3WNHA 3LP0B 3CYMA 3L3UA 2E6LA 3CM5A 2X74A 2JC1A 3PHEA 4WE1B 4E1MA 5C42B 4MH8A 5HRRA 4FJ5A 4FBUA 4E89A 4OLAA 1SH3A 2HHTA 1O1WA 4BE2A 1ZTWA 4F50A 1RTDA 4NLRA 4Y1DA 1YVUA 3QEPA 2UUWA 4CGHA 1JLEB 5J2MB 4FBTA 4MK7A 4KTWA 4J2EA 3DOKB 1XWLA 2LSNA 1HPZA 4WXWA 4EBCA 1RYRA 2DFEA 3O4NA 3MEEB 2AU0A 4DTOA 1TKZB 1RT5A 3AVLA 1MU2A 2ASDA 2JC0A 3KLGA 3K5MA 1T94A 1KHVA 1FK9A 2W9BB 5C24A 1FKPB 2OZMA 4Q43A 1R0AB 2D0AA 4LQ9A 2AJQA 3U6FA 3KTQA 3ULDA 2QKBA 4PA1A 3PW4A 3CJ2A 2R8KA 4EO8A 4FJIA 4C8LA 4C8KA 4FCYA 2XY7A 3QEXA 2C2DA 1T05B 2WCXA 2IDOA 4RW8A 3C94A 3SPYA 2HMIB 4I7FB 1J53A 3SQ0A 5L1LA 3V6JA 5I42A 4MFBA 3LZIA 4IH6A 4Q45A 4HUGA 2F8TA 4BWMA 2HNYB 1RYSA 1TVRB 5L1IA 3NCIA 1NHUA 4ED3A 1NJZA 2R2RA 1REVB 4Q0BA 1IKVA 4IG0A 4J9LA 1JLBA 3RTVA 4F4ZA 4C8MA 5KFQA 2GIQA 4FK4A 3U3GA 1NK9A 3T19A 2R7YA 1JIHA 4M3RA 4CHOA 4RW4B 1EKEA 3RRHA 3V9UA 1DLOA 1L3TA 3TABA 2G8VA 3MTKA 5FRMA 2C2EA 3K5OA 4FJ9A 1GX6A 4FM2A 4MKBA 3HO1A 1N5YA 1S10A 1U45A 4URSA 4JS5A 5F9LA 1U04A 3RAQA 1IG9A 3V6HA 4NLGA 1S5JA 3KLEA 3V81B 4IRKA 2R2TA 4QWDA 1BCOA 3HPHA 5FRNA 3QETA 1BCMA 5F8GA 4M3ZA 3S3NA 3V9WA 1S1VB 5KT2A 1NJXA 3LDSA 4DSIA 2YNFA 4Q8EA 4KSEB 4ECZA 4QOZB 4DF8A 5KT6A 2WOMB 4O3SA 2XCAA 1LV5A 3FSIA 5F8MA 4ZP6A 4DQSA 4ZPDA 1JLQB 3I5AA 3NAIA 4J9KA 1I39A 4O5BA 4RW9B 3IRXA 1S6PB 4K4XA 2D5RA 3BR9A 1GOBA 3V6KA 4ZTJA 2W7PA 3IG1A 4KTQA 4DF4A 3TAMB 4URGA 2JGUA 3KK1A 3MEGB 4YR3A 1D1UA 4IRDA 4XPCA 2C22A 3PV8A 1S4FA 5HBMB 1RBSA 5J1EA 1WSJA 4FLTA 5DG8A 5KFRA 1ZBHA 4L8RB 4B9UA 4O3QA 4KO0B 3AVKA 2ASLA 1IKWA 3ZSVA 4AHSA 1RILA 1WAJA 3PO5A 2ITGA 4CJVA 1UA0A 2D0CA 4O55A 3SZ2A 4IR1A 1TV6A 4DEZA 1LWEA 3TARA 4M3UA 4LQ3A 3NBPA 5DQGA 1CLQA 1WSEA 5F8LA 4DFMA 1YVFA 1MMLA 4I9QA 5KFDA 3HVWA 5EWEA 2FJWA 4TSXA 5D3GA 1C1AA 4DQQA 3NKYA 1U09A 5KFFA 3HYFA 4H4OA 3OYHA 1RT5B 5KGXA 1MU2B 3S3OA 3ZSQA 3KLGB 2DTUA 3HP9A 4HKQA 3QIOA 2HWIA 1FK9B 5KG6A 1TKXA 2ILYA 4ECQA 4CJQA 5C24B 4MIBA 3OY9A 3QESA 4FJGA 4RUAA 4HCBA 4HYKA 1VSMA 1JLGA 5EWFA 2FBXA 1S6QA 3V9ZA 3ASMA 2Y1JA 3EZUA 4DG1A 2JEGA 4O3OA 5L1KA 4DTMA 2Z1GA 3AVBA 3H40A 4ECTA 1DTQA 5I42B 4MFBB 4ED7A 3ZSYA 3MEDA 4JUZA 2E9TA 5F8NA 2BGGA 2YNGA 3CG7A 3SCXA 4CFBA 3JSMA 3VQSA 1RDAA 2HHVA 4E7LA 4AHTA 3N6NA 4Q0BB 4IG0B 1JLBB 3OYAA 2EX3A 2FBTA 1YTAA 4DL6A 4IH7A 1B92A 4M3TA 4DSJA 3QZ8A 2IAJA 4DLGA 1JLAA 3I5BA 4MK9A 2IBKA 1N6QA 1DLOB 3VA0A 4ECSA 3I0SA 3OYIA 1CXQA 2Z1JA 4DQIA 4M95A 4WFYA 4CEOA 3RB4A 4FS1A 1RT3A 3FFIA 3HHKA 4CJ5A 1S1TA 1NK6A 2ILZA 3KLEB 3HPGA 3BSOA 5CYQA 1CZ9A 3QO9A 3VQ8A 3RBEA 5DLGA 2IMWP 5KFLA 4ECXA 2FBYA 2YNFB 4J2AA 2CKWA 3HKWA 1NNDA 5KG2A 1NKCA 4F3TA 2YKMA 4M3WA 4N56A 4OLBA 3VA3A 3LP0A 4DL3A 2HHUA 4FK2A 1QAJA 3IRXB 4DSKA 4E7JA 4EZ6A 5HLFA 2AGPA 2ZKUA 5DGAA 1KFDA 3IG1B 1XHXA 4ZTFA 3GIJA 3V1QA 1BHLA 1JL2A 3KK1B 3BSCA 3KKRA 4BE0A 2R2SA 3DRSA 5F8IA 2E6MA 2DFFA 4KI6A 3VN5A 4M94A 4J9MA 5J1EB 1FXXA 3G6VA 4H54A 3KD5E 4Z4GA 4IFYA 5I3UA 1IKWB 1FKOB 3NH0A 3CQ8A 5KFIA 4N47A 4W5OA 4BDYA 1KCFA 3MEEA 3P5JA 4C8OA 3T5KA 4ED6A 4CF8A 1TKZA 3QERA 4KTZA 4Z4HA 4Y34A 2J6TA 3DMJA 3LWLA 3OYDA 4WYLA 1Y97A 5KT3A 2W9BA 3NBPB 4MQ3A 2Z1HA 4DFKA 3OL6A 1FKPA 1QSYA 3V9SA 4CIEA 2HHSA 1XC9A 1NKBA 3MR6A 4RUCA 4FK0A 5FDLA 3QEWA 4O4RA 4HTUA 1EXQA 3PW0A 1YT3A 3O3HA 2XY8A 3MR3A 4H4OB 1HNIA 4F4YA 3G0ZA 3MXMA 3SJJA 3AO2A 4EYIB 4I7FA 3CDWA 3OSNA 1C0UA 4B9MA 1TKXB 2HNYA 3BSNA 5KG1A 4ZPAA 3KK3A 4WZMA 2B43A 4U7CA 5KG3A 1REVA 1IM4A 3KMSA 3TWHA 3C95A 2ATLA 4ECVA 4O0IA 1RT1A 4DG1B 5HRNA 1DTTA 1JXLA 4KE5A 4H8KA 3FQKA 1S97A 4CF2A 2GC8A 2VG7B 3MEDB 3RMAA 2ASJA 4TQSA 2FLNA 3K5NA 2KW4A 4CJTA 4KREA 1S9GA 3JSMB 2P5OA 4KPYA 3HJFA 4IH5A 2OPRB 3AO4A 3B6PA 4BACA 4CHNA 1TAUA 3V81A 2X78A 5DQHA 3MR5A 4WZQA 2R2UA 5HRSA 3QYYA 4RZRA 2HB5A 2R8IA 5CZ2A 2PY5A 2IAJB 1KVAA 2YKNA 1JLAB 4NYFA 4CJKA 2XC9A 1N6QB 4ED8A 1JL1A 3KKSA 2WOMA 3WNGA 4ZVFA 3AVFA 3F9KA 1C2PA 2QE5A 3FFIB 4KKOB 3THVA 1S6PA 2JEIA 4NLVA 3AVJA 1UWBA 4Q5VA 3QO9B 3DLGA 3Q8PB 5JS2A 1NK5A 3KMQA 5KFXA 4NLDA 2Y1IA 1C6VA 2RDIA 4B9LA 4NLYA 2YKMB 3H2LA 3OYBA 3T5HA 4QW9A 4JRPA 4E19A 4DL7A 3OHAA 1S9FA 5KG5A 4YR0A 3VQEA 5CY4A 5HLFB 2WHOA 4MK8A 3ZSXA 3KHRA 4BDPA 5DGBA 2GBZA 3HXMA 3DRSB 3RB3A 3SUOA 4M41A 3ZSZA 3H5SA 2RPIA 4CHYA 3NH2A 2QXFA 4ELUA 3D45A 5KFPA 4KB0A 2GIRA 4IFYB 2FBVA 5I3UB 3QEIA 3OYGA 3RBDA 1W0HA 3QGHA 5KGWA 1X9WA 5DQIA 3GV8B 1NJWA 3VQ4A 4B08A 2FC0A 1TL3A 3DMJB 4CEBA 2BE2B 1J5OA 4J9OA 4DTXA 3IS9A 3NL0A 1Q8IA 4Z4IA 4OJRA 4TYBA 4NZ0A 3DLEA 5L9XA 4ZVHA 4MKAA 4IBNA 5FDLB 3S3MA 2UVRA 1S0OA 3PX4A 4NLOA 4O44A 1HNIB 3C6UA 5KFZA 3IGVA 3GIKA 1K1SA 3P83D 4RG8A 4DMNA 4ELTA 1S1XA 3OHBA 1C0UB 1B9DA 3KJVA 4DSLA 1D0EA 3AVNA 4KHQA 4JRQA 3VQ6A 4QCLA 3KLFB 3KK3B 1WAFA 4KHNA 3DYAA 3KHGA 2BR0A 4LD0A 3BJYA 1XR5A 1JXEA 3VQAA 4RNOA 1HJRA 3ZT1A 4PY5A 1TQLA 3NAEA 3NAHA 4LH4A 4CJRA 3CWJA 4R5PA 1KLMA 1RT1B 4E3SA 2KZZA 3T3FA 3TAGA 1DTTB 3DLKA 5KFYA 4CIFA 3OYNA 4NCBA 4ECYA 4H4MA 5CYMA 2JEJA 3PZPA 3E01A 3L2QA 3UR0A 3MR2A 4LSLA 1S9GB 3M9OB 1UA1A 4KBIA 3H5YA 4F8RA 1TK0A 4TQRA 4FLXA 4FXDA 1BL3A 4NCGA 2KFNA 3AA2A 4E0DA 3L3VA 2DY4A 4EEYA 1QSLA 4ICLA 4TY9A 2YNIB 2XO7A 2YKNB 4Q44A 1GOAA 2AQ4A 3HP6A 4ZP8A 4FM1A 2R8JA 2ALZA 4GVMA 2VA2A 1JXBA 4CGJA 3HL8A 1U47A 1LAVA 1IKXA 1Z26A 1D8YA 1TKDA 1RT2A 3K2PA 1SV5A 3G86A 4ZVEA 1UWBB 2FVPA 1LW0A 1VRTA 2D7SA 1TKTA 4K4YA 3DLGB 4EBDA 4DTRA 1I6JA 5CZ1A 1BIUA 3UDLA 4TY8A 3QIPA 3DDKA 3L2RA 3OLAA 4DSFA 1RTHA 3LPUA 5KRTA 3VQ9A 1FKOA 1JLFB 3LP1A 3D28A 4LH5A 1QUVA 1T8EA 2WK4A 4CJFA 4K4SA 3CFOA 2AX1A 2PZSA 1QAIA 3MXIA 5KG4A 3MXJA 2B4JA 1WNSA 2R8HA 1RDCA 3PUFA 4KHUA 3AO3A 2RN2A 3H59A 4NYNA 4DQRA 3NMAA 1BISA 2XCPA 3PW5A 2G8FA 4HUFA 3V9XA 3LAMA 1CZBA 4ED0A 4RNHA 3CIZA 3QGIA 2A1SA 1X9MA 3PVXA 1X9SA 4F4XA 1RBTA 3DLBA 5JS1A 4KV8A 5EU7A 4CHPA 3ZT2A 1TL3B 3O4QA 3VQQA 4M3YA 5HROB 4CESA 1J5OB 2IC3A 3IS9B 3GQCA 4DL5A 3UQSA 3T5JA 2EHGA 4GC7A 4NRTA 4IDKA 4TN2A 1KLNA 3RR7A 5EDWA 5KFAA 4FJMA 1ASUA 4N76A 3RWUA 3DLEB 3DRPB 2RF2A 4OVLA 2IM3A 5KT4A 3PJWA 4GC6A 4QWCA 4MIAA 3NE6A 4NCAA 4O44B 3LAKA 1QHTA 3C6UB 2HW3A 3M9NB 3SYZA 5KT7A 4J9NA 2OZSA 1S1XB 1ZTTA 4KAIA 2J6SA 1SKRA 3KJVB 1T3NA 4E7HA 4R8UA 2VG7A 4DWIA 4FJXA 1BQNA 4NLXA 5KFWA 4KHRA 3PO4A 1W25A 3TVKA 3DYAB 2VG6B 1S48A 1U49A 2OPRA 3OS1A 2E4LA 1VSDA 1HQEA 4R5PB 1TP7A 1LW2A 1KHWA 4NLPA 1KLMB 4FZZA 4G3IA 1TL1B 4CERA 1SUQA 3DLKB 4E1NA 3V1RA 4H4MB 2IOCA 5CYMB 3SUQA 4M45A 3BDPA 4JV2A 3E01B 4FZXC 1XHZA 3PW2A 4LSLB 4CEZA 1RT4B 2OH2A 3SUPA 4ID1A 3ISNC 5KFBA 5E41A 3H4BA 5KFGA 5SWMA 2P5GA 4F4KA 2OYQA 4KKOA 2W9AA 3BQ2A 1HYSA 4XPEA 3HK2A 4NCGB 2W8KA 3Q8SB 3D0PA 4AHRA 1C1BA 4OGEA 3ZSOA 3G10A 1RA6A 1WN7A 4ICLB 2DPIA 5KFTA 2IJFA 5HP1A 5DK5A 1RDBA 4F4WA 3BSAA 2EC0A 2FVQA 3NGDA 1ZBIA 3CDUA 4CJUA 5KFCA 3SFUA 1JX4A 4X2BA 3CFRA 1IKXB 4O3RA 3RB6A 1RT2B 4QW8A 1L3VA 1SV5B 3ISND 4QPXA 1WSHA 3NGIA 1NKEA 1LW0B 1VRTB 4ZHRA 3E51A 1TKTB 5J2PA 1N4LA 3NGZA 3LP3A 4BWJA 3RRGA 3GIMA 2G8KA 3CJ3A 4B9SA 4PQUA 4KHMA 3FQLA 1A5WA 2OPQA 4TY8B 3QIPB 1JLCA 5EWGA 3VQ5A 2X6SA 1QTMA 2UVWA 1RTHB 2BRKA 3NF8A 1NK8A 3OSPA 1ZBUA 3LP1B 4CK3A 1LWFA 1RBRA 4URQU 2BE2A 2D41A 4CJ3A 2YHAA 4CCHA 3CDEA 3SPZA 3EPGA 4DLEA 2BDPA 1UAXA 3EYZA 2WTFA 1S9EB 4W5RA 3H5UA 4YMEA 2HHWA 1HNVB 1S1WA 3TAFA 1Q9YA 4DSEA 1G15A 3G6YA 3PW7A 2ZQBA 4TLRA 4AHCA 3V1OA 1IKYB 1HMVA 4KV8B 1J9AA 3AA4A 1RT7A 4RNNA 4E7KA 2IC3B 3V4IB 3N6MA 4E7IA 2BQRA 3DOLA 3S9HA 4IDKB 3ZT0A 4Y1CA 4F2SA 4NLSA 3BREA 1EETA 1L5UA 3KLFA 2RF2B 3T1AA 4YR2A 4JS4A 1T03A 2GV9A 1TK8A 1IO2A 2RKIA 1SL0A 2W42A 2VWKA 4Z0UA 2XHBA 4J2BA 4O3PA 4M42A 5KFKA 4FW1A 3OL9A 2HNZB 4OKEA 3ICLA 1J54A 3OYLA 4IRCA 4KI4A 4R8UB 4CJPA 3BGRA 3K59A 1BQNB 3GYNA 2NUBA 4K8XA 4CJSA 3M8QA 3G6XA 1BGXT 4CEDA 1HQEB 2BANA 1LW2B 3H4DA 2AX0A 2PYLA 1CSJA 1TK5A 4TXSA 1VSHA 1SUQB 3OYJA 2C2RA 1K1QA 4OKJA 2YNIA 3AA5X 4ZPCA 4OPJA 4W5NA 3SFGA 3Q8RB 1ZBFA 4ECUA 3M8PA 3PY8A 2G8IA 2HWHA 4RU9A 3QNNA 3T5LA 3LP2B 5KFEA 5K14B 1GX5A 4I2QA 5J2QB 3HVAA 1RNHA 1HYSB 5F8HA 4C8NA 2IS3A 1VSLA 3U3YA 1C1BB 2YNHA 4YNQA 2B5JA 4CEFA 1L3UA 3NH1A 4AILC 4GMJB 3HVRA 4DQPA 4CF1A 5HP1B 4OPKA 2IGIA 2BQ3A 1RDRA 1Z25A 2FLLA 4EBEA 1A5VA 1JLFA 1LWCA 4FM0A 2OPPA 3V6DB 1KVCA 1C0TA 4B3OB 1HQUA 4ZHRB 2GUIA 4I9LA 5J2PB 4DU4A 4O3NA 2V4RA 4FJLA 1VSKA 4AH9A 1BI4A 1QS4A 4PQUB 2OPQB 2W9CA 4CGFA 3SUNA 1JLCB 1JKHA 3NGYA 4ZP9A 3SQ1A 3HSTB 1VSEA 5JXSA 4FJHA 5HRPA 3LPTA 3BQ1A 3OYEA 1LWFB 3VQDA 5HROA 5KT5A 3QGGA 4FLYA 4HUEA 5T14A 3QLHB 2F96A 1RT6A 2XWYA 4HCCA 3GILA 3KHHA 3JYTA 4WXOA 4NLTA 3HVTA 4NLWA 3F73A 3DRPA 1S1WB 4TYAA 4FYDA 3HT3A 2W8LA 3KLIA 2D3UA 3EZ5A 2F8SA 1S0NA 3TQ1A 4IKFA 3RB0A 1HMVB 3MAQA 4J9SA 4RNFA 4HVJA 1RT7B 4QWEA 3OL7A 4FJNA 3RAXA 4CFDA 3TAPA 3PX0A 2F8EX 4ECWA 1ASVA 3DOLB 3RMBA 1QE1B 4AHUA 3AVHA 4IFVA 4RNMA 5KFNA 5DG9A 1EETB 2R8GA 4K4UA 3GV5B 2VG6A 1T03B 2OA8A 4JLHA 2RKIB 4W5TA 2XI2A 2OPSB 5KFMA 4F3OA 4FJKA 1NK4A 1NK0A 4EP5A 2I5JA 3CJ0A 4B9VA 4KHYA 1NJYA 3C6TB 3OL8A 1TL1A 2FLPA 4DTNA
chains in the Genus database with same CATH superfamily
3B4DA 4I56A 1KD1O 3U9DA 1HHTP 3KWGA 5FLXO 3NEKA 3BGLA 4DUYJ 3I4HX 4Y2AA 4ILGB 4KIAA 1Q82O 2QWLA 2BANB 3DM2A 3HT0A 5KRSA 1LXJA 2ZE2B 4EP4A 4QWBA 1BHNA 1ZYQA 4IG3A 4LFCK 1VQLS 3VAMA 1A9NB 3L2UA 4DX7A 4KHSA 3LF0A 3TSPA 1WDTA 5KFHA 4RWXA 4PUOB 3OJUA 3KWIA 3QEVA 4GKKK 2Q43A 2H9ZA 3VZHA 1YJ7A 1T6DA 3WNEA 1CBKA 3MPWA 5E3CA 2GMHA 3CDAA 4KB1A 2JEFA 2WZ1A 5LJ3Y 3WZ0A 3CNQP 2ZOMA 1RTIA 1VRUA 1NOYA 4DU3A 3GZ7A 4IOBA 2OPPB 2IM1A 3ZXWA 3UB5A 4GVLA 3SQ4A 1H72C 1OH8A 1C0TB 3D7EO 1HQUB 3VQ7A 4CGGA 4B9TA 4A8KA 4CH7A 5KFUA 3VEZA 2GEMA 3GBTA 4OZ5A 2B9XA 5LMUK 3NGUA 3SQGB 1EWQA 2Z1IA 1RTJA 2O8FA 1HNVA 3PSFA 3SNNA 1RA7A 3HPOA 2WRMA 4KH5A 3PR4A 4O0JA 3W9JA 4L74A 3W3DA 5A8KA 2YX1A 2NS1B 2FJBB 1IKYA 1XTZA 1OO0B 4FJ8A 1B9FA 3OPKA 1KVBA 1RGIA 5KG7A 3NCPA 3I6PA 1GXUA 6FD1A 3UCUP 2IY5B 4ECRA 4KFBA 4I1TA 4JI2J 1ZM2A 1FD8A 2P6TA 3OYMA 3ITHA 2OI2A 2KLAA 3FCVA 2UVVA 3KLIB 4NEZA 5DG7A 4TNOA 1RHRB 1S5ZA 2HNZA 1C1CA 3BPDA 3IR5B 4K50A 5AQJA 5ETTA 1E4GT 4DUYK 5D15A 2AYBA 4RWTA 3IAYA 2FZGB 4ES1A 1DAXA 1VQ7S 3IGNA 2RQCA 4FYXB 2C2OB 4HL9A 4CH0S 4C0BA 5KFOA 4ZLNA 4WF9Q 4JP8A 2WBRA 3DI6A 2VBZA 2Q0UA 1R8PA 4CBUA 4BRKA 4G1QA 4ED1A 3DRYA 1FRKA 1UJ6A 4N41A 2YY3A 3G6EN 4CFAA 4JKEA 2FVCA 2OTJS 4EFHA 4U9RA 2VPYB 2O4GA 1N5TA 3LQVA 3KK2A 3VEVA 1URRA 1GLJO 3A2FA 4LVOP 2UUCF 2ZH1A 1RWKB 5J2NA 3D5MA 2GX9A 3FZ2A 2HNDB 2CPYA 2P8IA 2W7OA 2HHQA 3UNYA 4LSNB 2XI3A 3MD1A 1XMOJ 2B0GA 1AFIA 1ATNA 2UXCF 1SQFA 4GKJJ 1R8AA 3FDSA 4UUWA 4ENOA 1EKSA 3T6JA 1F60B 4U6PA 3V6DA 1BQMA 3I8DA 2BRLA 3CJCA 4MYTA 3VQCA 3DLRA 3TVZA 3JAMU 4LFAF 4MLHA 2FSNA 4FLWA 2C2MB 2FGCA 2Z8QA 1FX4A 1OS5A 4CJ7A 1WLJA 3M8SA 1QUPA 1VSJA 4AM6A 3LANA 5B0AA 5E3AA 3J8AA 5E2QA 3WUHA 1I3OB 4CJWA 1UOCA 2OFHX 2HFNA 5BN9A 4FF3A 1SCJB 5K8PA 5SUHA 4BRLA 1UP1A 3QIDA 1FJCA 2ZH8A 4JI2K 1PYTA 3BYRA 4NLQA 1WKKA 5J2MA 5DLFA 2H65B 4K4ZA 4OI0A 2J9CA 2B6AB 1AB8A 1W9HA 2FJXA 4DS5A 3HFKA 3TAEA 4P2SA 1TL4A 1IH7A 4QAGA 3QATA 4DU1A 3IN5A 1TV6B 3UN2A 1LWEB 1MW7A 3J7YI 1U26A 2GQQA 4RW6B 3C7NA 3VOVA 1U4BA 3OS0A 2VG5B 3UIQA 3MMAA 3OBIA 3I5CA 2FLOA 3KD1E 4P6QA 4UOHA 2J5AA 5SZTA 4QYZJ 3TUJC 2ZBPA 4M5NA 2IVNA 1WSIA 4IEEA 4MKYA 2A41A 1IBCB 3HSZA 3W2VA 3ZZZA 4CZHA 1T05A 4I2PB 4C3KA 2UUAJ 3K2YA 2XY6A 2LLZA 5CD4A 4OHZA 1S7HA 4DR7J 3C6TA 5E26A 1VCTA 4QOTA 3TI0A 2R7RA 3F41A 3OYCA 1TVRA 4RW7A 1JLGB 3TANA 4I6WA 4ZIVA 1GNKA 3ZTOA 4NLBA 2UUTA 4JKGB 1AYEA 2CFXA 3Q8QB 2O4IA 2DNLA 3HD2A 4GVBB 3KLHB 4PXEA 3R2DJ 2XSJA 3O9SA 2IM2A 4OZ1A 5CH7B 5ETQA 2VWJA 1XMOK 4GV9A 4GKJK 4YOXA 1YHQN 4NXNJ 1EWRA 3CCUN 3HTVA 3NWRA 4CK2A 5ETLA 1UZDA 5ETNA 3BBCA 4IJAA 2MGZA 4OYMA 2HVIA 4FPBA 2PI5A 1UVJA 3PM9A 1O5JA 3RGIA 3QRQA 4C3MA 1S1VA 2V67A 1Q95G 3TR8A 4CJLA 1PG5B 1T7PA 1RDUA 4FLUA 1O8BA 3HKZD 3SAHA 3I0SB 1HW9A 2ZZMA 8AT1B 4LBHA 2V4QA 2XMMA 1RZMA 1QVFR 1H2TZ 3WQPA 4DTPA 4OX9J 3DCAA 2KJVA 3GCWP 3CCQS 4O0NA 4M3XA 4FS2A 4DL4A 3GE9A 3LZJA 2ROPA 1SQKA 3BN7A 4BRQA 4J7CA 5IWAF 2GO9A 2VC1A 1HNZF 2KJWA 4K7QA 3L8BA 2ZFHA 1KRPA 4IOXA 3LP0B 3CMES 2QMUB 3CYMA 1P6TA 2JC1A 4Y6IA 4WE1B 4E1MA 5C42B 1UVLA 4KGMA 3SK3A 4H4KC 4QYZK 3E9PA 1R0BG 1DKGD 3EO3A 4BE2A 1ZTWA 4O8KA 1AA1B 1YVUA 3TX0A 3TRGA 4CI6A 3QEPA 4CGHA 2NXNA 1RHQB 4X62J 2UUAK 4FBTA 4MK7A 2FC8A 4J2EA 4BC5A 5B0GA 1RYRA 1BQXA 1Z05A 1JK9B 4DR7K 2V8DA 3AVLA 2FSKA 4LF4J 1T9YA 4MDAA 1T94A 3HM8A 4JHDA 2W9BB 2CQIA 5DETA 2OZMA 1R0AB 3KTQA 1GXTA 3THYB 3DXSX 3MZIA 3O8WA 4X64F 2XMVA 4K0KF 4LF6J 3ULEA 4C8KA 4FCYA 5LMNJ 2YKOA 3IO1A 2QC3A 2HMIB 4I7FB 4DCPB 1J53A 3H2VE 3ETMA 4NXNK 3AFGA 3V6JA 4MFBA 2DHAA 4IH6A 4PKIA 4FWNA 2Q0RA 4BWMA 4H5NA 3G4SS 1RYSA 4ED3A 2R2RA 3R1XA 1VQ8S 1H2VZ 2RILA 3H6EA 1KOOA 1F9EB 4IO1A 4J9VA 3FZHA 4Y00A 2Z2YB 3HFVA 2QW9A 2F1FA 4M3RA 2GX8A 1S0VA 1IQTA 2MPUA 4OX9K 3G8TA 5ETKA 2F9WA 3AXKA 2G8VA 2XULA 3IFEA 2F9JA 3M1VB 2JFKA 1GX6A 3MCPA 4MKBA 1N5YA 1AW0A 1N88A 1HKBA 3V6HA 4NLGA 2V8GA 4USMA 3KLEA 1QDUB 4DR4J 2R2TA 1PJ6A 2C2KB 5FRNA 3AD7C 1QD1A 4OI6A 2B4VA 5KOWA 2Q1NA 2HFVA 4KSEB 4ECZA 4DF8A 1N0UA 3MDQA 2QEXN 3OBYA 1FESA 2J0SD 4OX8A 4DL0C 1JLQB 1UVIA 3I5AA 3L4BC 3NCQA 4YB5A 1I39A 1VQ9S 1F5AA 1BWEA 3BR9A 1GOBA 2ALYB 2W7PA 5B7WA 4DZ6A 4KTQA 5HMWA 3TAMB 4X62K 4URGA 1U1RA 4YR3A 2E20A 2E1RA 4XPCA 3HHLC 4YOEA 1HI1A 1S4FA 5BR8J 1RBSA 4LF4K 2HBQB 5KFRA 1ZBHA 4B9UA 3M05A 2LQ9A 1WHXA 3OD2A 3I33A 4AT1B 1YTYA 1RILA 3ID8A 1UA0A 3EVMA 4A8WA 2D0CA 5M2UA 4O55A 4L3KA 2XS5A 4UZBA 4DEZA 4FP9A 2PMWA 3G82B 4WU3A 4LF6K 1ZA2B 2A10A 1XMBA 3NVMA 5LMNK 1MMLA 1WKJA 2P9CA 3BEXA 3HSCA 4I9QA 5EWEA 5JJBA 4TSXA 2JSXA 2LXIA 3I82A 3K89A 3CTRA 3WXMB 3HYFA 3CIMA 5A76A 1RT5B 2D9PA 1C4AA 2DTUA 5E0OA 2EG2A 5CABA 3BUZB 5KG6A 1FK9B 4CRJA 4HYKA 3C6HA 5IC6B 3AD9C 3H2UB 3ENQA 2A6MA 4EMDA 2KT2A 2HBMA 4JI3J 5A0YB 2IA0A 1K44A 1EQYA 4X66J 4HVZA 2FF3B 3MI7X 2Z1GA 1VBXA 3IDHA 1U1PA 3AVBA 4CLLA 4HDGA 2VPXB 5GMKa 4ED7A 4YB6A 1K8KA 3HOSA 2XLIA 3MUVP 3CG7A 4DR4K 3SCXA 1G4CA 3PG9A 2HVZA 3K0JA 2HIYA 1FWPA 4YY3F 4Q0BB 3S01A 1RLDA 1M1KT 2MZJA 4IG0B 3S6EA 1FJGF 4DDFA 2EX3A 4Z2XA 1GT8A 3FLCO 3O4WA 1HBOA 2P9NA 2BABA 4M3TA 3QZ8A 4DLGA 1FRXA 4CZKA 3TA2A 1B4SA 2H5IB 3M6UA 3DN9A 2F40A 3LA0A 4B3MJ 3BV8A 3UD4P 2NR0A 1VAZA 3FFIA 5BR8K 3R7BB 4LFCF 3VQ8A 4DZDA 2E5HA 2IMWP 3M32B 4ECXA 2H3EB 1V6HA 1WG1A 3EE3A 4M3WA 5MAOA 4BVOA 4N56A 4OLBA 2XMUA 2HHUA 3O44A 3ELHA 4KH1B 5HLFA 1WC1A 5DGAA 1KFDA 4XAKA 3ZZUA 3IG1B 1XHXA 3V1QA 3KKRA 4BE0A 3DRSA 4PAAA 4CD3A 4J9MA 5J1EB 1NB7A 3CCRS 3I87A 4ETZA 4H54A 3KD5E 2HZAA 1S6OA 1C0GA 5IT9Y 2D69A 3CQ8A 2NRXA 1VQ4N 1T0TV 3MEEA 4C8OA 3FR0A 5JICA 4CF8A 3I31A 5LMUF 3DMJA 4PG5A 2DRAA 3AY0A 3OYDA 3QFWA 4F9OA 1QSYA 4CIEA 1SIZA 1RWNB 1WBDA 3JB9k 4NMXA 1GXLA 4JI3K 1K0VA 2EVZA 1QAYA 2B7BB 2G1DA 4X66K 4X84A 4X65J 1DY3A 3SMSA 3QEWA 2B9YA 2PEHA 4BC2A 3O3HA 1FNOA 3OFGA 2ZC3A 1CQMA 5A6PA 3CCLS 3AO2A 3CDWA 3DOMA 2UV8A 1FNMA 2YPYA 5ETRA 4PYDA 2DO4A 3C6AA 2E1MC 4IJNA 3K9JA 1FE4A 3O3LA 1UMJA 1REVA 3KMSA 4DUYF 2O67A 1OKJA 4EHTA 4DG1B 4B3MK 3M8YA 1R8CA 3RUBL 1WC0A 4M8LA 2MTLA 1RBAA 2VG7B 3AARA 2ASJA 2P9PB 1HD1A 2FLNA 2P2CB 2KW4A 4KREA 1S9GA 1ZM3A 3O9RA 1YI2N 3JSMB 2P5OA 1S4EA 2DITA 1HWKA 2OPRB 4ZA1A 1KS2A 1TAUA 2X78A 2R2UA 2MQ8A 4RZRA 1NWKA 5CZ2A 1S77D 2YKNA 4AD6A 5AFUA 4NYFA 2GS8A 1NM1A 2VQFJ 1WEZA 4ERDA 2LQ8A 3AVFA 2J9EA 3DKDA 2X1AA 2QE5A 3IWLA 3THVA 3IBCB 3D68A 2LU1A 5FIIA 1UWBA 3CJKA 1VIOA 3MM6A 4Q5VA 2M7SA 3QO9B 3DLGA 1OY6A 5E33A 5JS2A 4L73A 5C15A 3FRYA 2GQ2A 2FZKB 3ISZA 2RDIA 1JCEA 2ZH3A 4NLYA 2OTLN 4M7XA 4FPRA 4YOVA 3EGZA 3OYBA 4JRPA 4ILRA 1SS6A 1TUUA 2CJXB 3OHAA 4LRFA 3R7SB 3VQEA 4YB1P 3I96A 2J7KA 4M1KA 2WHOA 4MK8A 3DXMB 4X65K 2B4OA 1D09B 5EN1A 2RHQB 2RPIA 2QXFA 4ELUA 2Y1RI 4EK2A 5KFPA 4OPHA 1W2IA 2Z30B 4B02A 2FBVA 2WBMA 3OYGA 3RBDA 3QGHA 5KGWA 2DHHA 1X9WA 1U2CA 4DPTA 1HL6A 4JI2F 2VHGA 5FPNA 3VQ4A 1M1KO 3THWB 3OFFA 5I9EB 1JNZB 2G2YA 3D2FA 1HKAA 1MWZA 4HWIA 5B08A 3NL0A 5LT5A 4A8XA 4K5RA 4WP8A 3GPAA 4TYBA 4C23A 4IOAQ 2D0OA 4CLYA 5FDLB 3MM5B 4U67L 5LXYA 2MKCA 1X5TA 2W41A 1S0OA 3CHWA 4RJVA 3P83D 5BYQA 2YI1A 4ELTA 1S1XA 1B9DA 4C1NK 2A2CA 1WDDA 3OR1A 3L6QA 1NAQA 3DDIA 3MPUB 4LD0A 3VQAA 4ZVRB 2QFJA 4ZCLA 3NAHA 4LT6A 4UF4A 2LFVA 2VQFK 5KFYA 3OYNA 2QA4G 2DY1A 4LF9J 4UT4A 1S72N 4O8UA 3X1LB 2CNOB 3E01A 2P9LA 3MR2A 1UA1A 3MHYA 3AGRA 3VEWA 3MMBA 4ZPWR 5L39A 1XMOF 2XSFA 2IVFB 4GKJF 7AT1B 1PJ5A 3VEYA 3PTWA 3SDEA 5GAGP 3CF5L 2EEYA 1DZ5A 4OX6A 2YNIB 3W5ZA 4Q44A 2AQ4A 4ZP8A 3FZLA 2ALZA 1VLYA 4IOCL 2VA2A 4LRBA 5IM0B 2NRVA 2NYIA 1JJ2M 1U47A 3K2PA 2P9UA 3G86A 4WK1A 1KKHA 1LW0A 2D7SA 2VASA 2K1RA 1I6JA 3IM8A 2ZGYA 1HW8A 4BC3A 1QAXA 1BIUA 3UDLA 2YHXA 4GMKA 1CG2A 4BRIA 1D8ZA 3D2EA 1I1GA 1PJ7A 1U7LA 3OLAA 3WC0A 1U2VB 3TEGA 4RLEA 4CJFA 3CFOA 2PZSA 4A8OA 3MXIA 3NMUA 3MXJA 2B4JA 1ITPA 4BROA 4KHUA 4NYNA 3H59A 3D6MB 1FDDA 4LF7J 3G2XA 3EICA 4HUFA 1CZBA 2A1SA 3CIZA 1X9MA 2QTWA 3D2WA 3MM7A 1T11A 3A4TA 3BO4A 3DLBA 2YQ0A 2WVDA 2UUAF 2J7UA 3AHPA 4M3YA 4DR3J 3IS9B 4A48A 3UQSA 4DR7F 2V52B 3TSUA 3D3CJ 1U1OA 4N76A 2XMJA 3ET6A 2RF2A 1RU2A 4DV1J 5KT4A 4LF9K 3NE6A 5IV3A 4NCAA 1YBUA 4O44B 4CLSA 1Q1KA 2IDEA 3VF2A 3C6UB 4MT1A 3MUTP 3M9NB 4V19X 1SKRA 1E3MA 5TKYA 4G6VB 2YWWA 2G4BA 4IDHA 4NXNF 4JOUA 3BF1A 1S48A 1UW9A 2ZVSA 2CQ1A 3AD8C 4A5AA 2E4LA 1LW2A 1NCLA 5ETOA 4FZZA 4G3IA 1TL1B 4CERA 3DLKB 1O0PA 1N54B 4AXJA 3ZFVA 5CYMB 1G99A 4QQBA 3SUQA 3VALA 4R25A 3VV2B 2XWXA 1CC8A 2R7SA 1PBAA 1ESVA 2K3KA 4ID1A 1W2BM 3ISNC 2LYVA 2BEFA 4C2MA 1N8RT 1HKGA 4BRAA 3BQ2A 4OX9F 4XPEA 1B70B 3JAMY 3HK2A 1Y10A 2J8SA 1CJVB 4AHRA 1VQKN 3G10A 2NPFA 1WN7A 1HBNA 3A5NC 5AQNA 3DGPA 5JVHQ 5DK5A 1RDBA 1YLXA 2EC0A 2FVQA 2AEMA 1U0SA 4A8YA 1UETA 2QRRA 4V1Ak 1IKXB 3R7NB 1L3VA 1SV5B 1WELA 3EE8A 4PZVA 3BF3A 4LF7K 4IEIA 1VRTB 1TKTB 5J2PA 3NGZA 4BWJA 2O8BA 3QFHA 3NMRA 4B9SA 3EJMA 4OZ2A 1X5SA 4JI7J 2KM8C 1SQGA 2DIUA 3SAGA 4X62F 5JMVA 2UVWA 1RTHB 1VBYA 3NF8A 3OSPA 3CDBA 4DR3K 2ZNZA 3MTJA 1SAZA 4CK3A 4LF4F 2QLWA 4K5SA 2V5HG 2I7NA 2F63A 2BE2A 2HS4A 1Y00A 4BBYA 3ZYYX 4DV1K 3CDEA 3EPGA 2WTFA 1RAHB 1S9EB 2Q3PA 2HHWA 2RHSB 2XMWA 3DJCA 2F5GA 3FCWA 4Z94A 1Q9YA 4NYOA 3G6YA 3C19A 3E1YA 2YH1A 2VF3A 5LMNF 1RWUA 1HMVA 3QFPA 5A8RA 1J9AA 5LM7E 2OMOA 1VYAA 4E7KA 3KK7A 2IC3B 3N6MA 3CJ1A 4ZS6A 4NLSA 1EETA 2ZBCA 3T1AA 2WVFA 3M2RB 4J2BA 1Q86T 4M42A 1I51B 1Q8KA 4FW1A 1B7YB 2O3DA 1VOMA 1NEEA 2CJYB 1X4HA 3SBTA 3A8JA 4IRCA 2GV1A 2GJ2A 1VHXA 1RACB 3UD3P 3T1HJ 4A2BA 5F41A 4K8XA 3G6XA 2HFOA 1BGXT 4L3QA 4A2AA 3JXOA 1HQEB 4ISGA 4DR4F 1KQKA 3H4DA 2PYLA 2DY9A 4Y2IA 2E66A 1YGYA 3QAUA 3AOAA 4H5WA 1WEYA 3AA5X 1ACMB 1ZZNA 4LFBJ 3TX8A 3PKYA 3SMZA 1VQ6S 1ZBFA 1RWXB 5J1PA 3PY8A 4JB8B 3QNNA 3LP2B 5K14B 1GX5A 3HVAA 1RNHA 4JI7K 3D4JA 2YJFA 4I6MB 4OLPA 2B5JA 2JJ4D 4CEFA 2EXUA 5BR8F 4C8YA 4LRCA 4DQPA 2LP4A 1KBRA 3TOQA 2BQ3A 1RDRA 2HLTA 1ULRA 5AXMA 1A5VA 5GMEA 1LWCA 4BRMA 2P9IA 4FM0A 2ZKTA 1T44A 2M9KA 2VJUA 4ZHRB 5GAEP 2DRDA 1BI4A 4ILMA 1QS4A 4PQUB 1GLDG 2OPQB 3SUNA 1JLCB 3VGLA 3Q8VA 1RBOB 3KJQB 3UDCA 3KHYA 4FJHA 5HRPA 3HSDA 3LPTA 4NA1A 5GAGU 3OYEA 3MAAA 1LWFB 2FYXA 3M1FA 2A2DA 4K43A 4FLYA 4WQ5C 2K8GA 1MWQA 3QLHB 1NGGA 2GGPA 4OI4A 3GFXA 4B17A 4HCCA 3WEEA 3KHHA 3ILIA 3JYTA 3GIRA 1U1QA 4NLWA 2CH6A 2DGTA 3SIPB 5CAAA 3HRGA 2W8LA 2VYPA 1FDAA 3CGIA 1RKJA 3ZZTA 1S0NA 4JI3F 3TQ1A 3MPDA 5AQXA 1N8RO 4C7QA 3T1HK 4X66F 4QWEA 1JCGA 4ECWA 1ASVA 3DOLB 4DV6J 2F7VA 2DK2A 2CPXA 1Y11A 1YJ9S 1RWPB 1YITS 2VG6A 1T03B 2RKIB 2XI2A 5KFMA 1Q16B 1P9YA 4C3LA 2K7JA 1UL3A 1YJRA 3CJ0A 2XYHB 4B9VA 4PKGA 1FWKA 4CD1A 1NJYA 4LFBK 4E2FB 2HLUA 3FSXA 1X4GA 3M30B 2WBNA 1C0FA 3EZWA 4CK1A 2HAIA 2BJEA 3W7BA 5T7BA 5LSRA 3GJRB 5E3QA 4B3MF 3LDLA 2XGPA 5BPNA 5C2GA 2JNJA 2APOA 4Z4FA 3RBZA 2HOEA 1HBMB 4HHTA 1IXKA 3FVYA 2AP1A 4JK7A 3OHRA 2W6KA 1S1UB 3KG0A 3AJ2A 4H0OA 2HSEB 3MM8A 2LECA 4QU6A 4DTUA 2RU3A 1TUGB 2Q31A 4YB7A 2V0NA 2ATQA 2KFZA 4O4GA 4DTJA 3MECA 1D5AA 2DEJA 4I2QB 1J27A 3CCWA 2VCPA 3AVCA 4A61A 4DBQA 2YNHB 2GVZA 1M5PC 3FCHA 5IV4A 1KTQA 2G8HA 4K8ZA 1F5CA 4B1UB 2HHPA 3AVIA 4E1JA 4BC7A 3MFHA 2WB4A 3TQEA 4PWDB 5DM7Q 4BDZA 4M5IA 3L2WA 5B0BA 1X5OA 4DJBA 1QQCA 1Q86O 4YP3A 4FWKA 3VQPA 2ZWPA 3HDSA 3RVCA 3E8OA 2JFDA 4OGCA 3WX8A 3GMGA 1S0MA 3KHLA 3T9NA 2G2OA 2H5JB 3FBBA 1RCHA 1JKHB 3TSQA 3EY1A 4WFAL 4X65F 1CQNA 3GDQA 3QNOA 2O5DA 1S12A 2HVEA 2PFFB 1NM2A 1AFJA 4DV6K 1S76D 5B0EA 5KFSA 1RTDB 1H7XA 4P2MA 1SPBP 2HBLA 4KB7A 2YHBA 3V4IA 1F21A 3HZGA 3CC2S 5JVGL 4KRWA 4ES2A 4JI6J 1RT6B 2CYYA 3K5LA 2J0XA 3HVTB 1CVJA 3QSYB 4Z4CA 4FJ7A 2D9OA 2FJVA 4GW6A 3P49B 1ASWA 4CO2A 1H73A 1SKSA 2UV8G 5C10A 3VGMA 2MY7A 4J9RA 1HARA 3MDFA 1KSPA 4FVMA 3CCLN 2OMLA 4LY7A 5THWA 1NHVA 4IFVB 1EKRA 2HHXA 4WFZA 2AJ1A 2MHEA 2CZ4A 1Q5VA 4F67A 1N56A 2F8MA 4R0EA 2FVRA 2Q6BA 4J5OA 3H5XA 3QBWA 3VGSA 2DNMA 1WWHA 2IVOA 1R89A 1TZ0A 2CNLB 2VQFF 2VOPA 3MFIA 1IKVB 2Q79A 2L3MA 4UQTA 3SQ2A 1NBWA 2ZJPQ 3AV9A 4CE9A 2C3YA 4N77A 3TZWA 2UVUA 3SCKE 3OR2B 5CE3A 1QZ5A 1R8HA 1FDNA 3DM2B 4HT7A 4GVEA 3OYKA 3HFZB 2DTJA 2HQDA 2I7PA 1NH7A 1RBLA 4IG3B 1HI0P 1JJ4A 1M5KC 3FZMA 1VSFA 3HF5A 1SH0A 3FEZA 3GR0A 1WF0A 3RAMA 1AUSL 3UKUA 4WP3A 4CEQA 1O51A 4CGIA 3SLCA 4B3OA 1ZA1B 5JUMA 4RWWA 3H3OB 1UJ4A 2B4UA 4U7UK 3L2VA 4EYHB 5DM7L 1T9TA 3CQYA 1M5OC 1MWYA 5J1NA 1RTIB 1VRUB 1H2UX 2B4PA 2F9TA 5DDPC 1KAXA 1HA1A 5KTQA 4JI6K 2RRNA 3PJXA 1VQYA 4ZMMA 1JCFA 1BC6A 1DEJA 3FE1A 3HOTA 2XY5A 4CW7B 3E66A 2P1JA 1JLEA 2I9SA 4EHUA 3L7PA 4ZLPA 1G7CB 4TVAB 4EO6A 1P90A 1RTJB 3UN3A 2ZVIA 1X4BA 1U48A 4AUKA 1A7GE 2EKNA 2V8PA 5DMRA 3MPYA 2FVSA 4UY85 4USWA 1U6BA 3GG0A 5A8KB 3H42A 4FWSA 2CVIA 3N01A 4A4JA 3EN9A 2BE9B 1MSWD 1WG5A 3DU6A 1FT8A 4JI1J 4P10A 1QE1A 4DUTA 2UXBJ 2OD4A 3QT8A 4CGDA 1LK7A 2D0PA 3AA3A 3PXGa 4EZ9A 4KFBB 5AQGA 3ITHB 3V5RA 2E5GA 1TR0A 5GAEU 4OIXA 2PC6A 1ZZFA 3PX6A 1WSFA 2NUHA 3F5TA 2Z0GA 3CUNA 1C1CB 3D1QA 4KGZB 4LF9F 2HSTA 4CF0A 3SXLA 4BE1A 3BKUA 4OV6A 3CJ5A 1EX8A 2DCLA 4RUHA 3CM6A 1ZETA 5CD4H 3P96A 2JVRA 1SL2A 4B1XB 3G6ES 1SC3B 3SV3A 3O1LA 4MDBA 3HJVA 4CO3A 3DI6B 2ZC4A 3GIIA 3H08A 3CJ4A 2JX2A 2NZCA 2D3ZA 1P8ZA 2ZE2A 2YNGB 4G1QB 4WCEQ 4Z37A 2RDJA 5LY3A 2UYTA 4K59A 3VAJA 3NF9A 1HWLA 3LALA 2HVHA 1ZBLA 3GOIA 2Z58B 3H46O 4FW2A 1YAGA 3OYFA 1QVFM 3RR8A 3KK2B 4PUOA 2CWKA 1FTCA 1HWIA 3P4IA 5J2NB 1B0TA 5GIPA 2KTQA 3A1YG 2G8WA 5F8JA 1RCXB 4OKKA 3M8RA 3PSIA 3J80U 5M1QA 4TU8A 2ASOA 1NMNA 2HEKA 2ZH5A 4CHZA 2Y8YA 1LAWA 1SKUB 1RT3B 3I56N 5FROA 2N7CA 1S1TB 4RW9A 3TPQA 2XS7A 3LPEA 3KUGA 2CQHA 4RCHA 4PKDB 5JLHA 3ZSWA 2GCFA 2F9DA 8ATCB 2W40A 1XR7A 1BQMB 5K8MA 5C5JA 1UFWA 3L4IA 5HATA 5HBMA 1LK5A 3GE1A 2V9KA 3HM9A 3K57A 4PYAA 4KO0A 2W4PA 2J76E 1NGIA 4LF7F 1VI7A 4OHYA 2X74A 2ZUGA 4MH8A 2M2BA 3GSIA 2NPIA 1VISA 4JI1K 4FJ5A 4OLAA 2UXBK 1RTZA 2EI5A 3D67A 2WTUA 4DR3F 4NXMJ 1H1VA 4CVNE 2ZM6J 1JMTA 4CM0A 3DGVA 5IT4A 4EWTA 1KN6A 2ASMA 1V3ZA 5J2MB 2P6SA 3H20A 3N4PA 1REGX 1NSKL 2ABYA 2B9EA 3U27A 3FZFA 3O4NA 4PPDA 4DTOA 2KO1A 3R27A 1TKZB 4DV1F 4ZKAA 1MU2A 1PSDA 3MURP 2ASDA 2G1HA 3JS6A 3C7NB 1HNWJ 2V63A 4J9UE 1NJIT 1DRZA 4L76A 2VPZB 3MMAB 5C24A 1FKPB 5IS2A 4Q43A 2D0AA 2YXLA 4HLBA 1V4SA 3U6FA 3ULDA 3PW4A 3CJ2A 2R8KA 4EO8A 3NVKA 4CLKA 4C8LA 2D3OR 4FXVA 2FDNA 3W2VB 1T05B 2WCXA 2Q97A 3C94A 2DXFA 4UY8T 2DR9A 5E3RA 3ADAC 2VGNA 3LZIA 4HUGA 3ZTPA 3DXBA 2HNYB 4N8OA 1GLLO 2IPOB 3PNIA 1TVRB 5L1IA 2GWJA 1NJZA 1U02A 4QZVB 3NGKA 4DPUA 1OVYA 1JLBA 2E2PA 3B54A 1GQEA 5KFQA 4NYPA 1YHQS 1U8SA 3T19A 2R7YA 1JIHA 3HHEA 3CCUS 2MKYA 2XSJB 3G8QA 1WUAA 4WCEL 3CC7N 5IC4B 1YZ7A 2VFSA 4F36A 2V4JA 3OTEA 3UNGC 1HLWA 4UTGA 4BRGA 3T41A 1U45A 4URSA 4JS5A 2MGZB 4C97A 3MM9A 1S5JA 4ZOSA 2W2OP 2AZ3A 3V81B 5AZIA 1BCOA 3HPHA 2R7XA 3QETA 3KYLA 4M3ZA 2EW9A 3V9WA 1S1VB 1NJXA 3LDSA 4JNEA 5KT6A 2WOMB 3Q0AA 2XCAA 1LV5A 3IC1A 1NGAA 4DQSA 4JI7F 1X4AA 3LDQA 2P9SA 1MDUB 4J9KA 4O5BA 4C11A 4NXMK 2ZM6K 4NEYA 4DF4A 3CCJN 2JGUA 3KK1A 1XNRF 1D1UA 2A5XA 2AIRB 1YJUA 3JQKA 3RW7A 1WSJA 1TYQA 3GG1A 2PGCA 1Q79A 3W62A 1R0CB 4OYAA 3ZETA 1HNWK 4AHSA 3PO5A 3GYXB 2ITGA 4CJVA 1N52B 2M5YA 3QFUA 4QYRA 2J9DE 1LWXA 1XJWB 1RHJB 3GFYA 3O9TA 1TV6A 3O5TB 1LWEA 3TARA 1UCNA 3BO3A 2V50A 2HS3A 4M3UA 3C14A 2HQFA 3W8PA 2OGUA 5DQGA 1CLQA 3SCIE 4CBXA 3HHLD 4AE5A 1H7WA 5KFDA 1FWLA 3GWCA 3NKYA 1U09A 4H4OA 1RHUB 2XMTA 3FK4A 5KGXA 2KRRA 3S3OA 1NO8A 3HP9A 4B3SJ 3HBTA 4HKQA 3BF4A 2M52A 3QIOA 3QT7A 2HWIA 1TKXA 4JHDB 4U8VA 4MIBA 1DJ0A 3UWTA 3QESA 2ACMA 4C8ZA 3NXZA 4BR4A 1WEXA 1JLGA 2FBXA 3ULEB 2AEJA 2DD8S 3U02A 3UE2A 5HI7A 2P9KA 2Y1JA 3OA9A 5A2QO 3EDRB 4DTMA 1N33J 2QO3A 4MFBB 2GVDA 2OSQA 2YHWA 3MEDA 4ZVUB 4JUZA 5F8NA 3Q22A 3PIOQ 2ATCB 2HVDA 3BPSP 1K0TA 3W61A 4CFBA 3IWXA 2YWFA 3E9OA 4E98A 3VQSA 2QL5B 4LFBF 4ZK7M 3FKBA 5AQOA 5C2CA 4BR0A 2CQBA 2FBTA 2HBKA 1YTAA 2HGNA 4DL6A 4IH7A 3QJLA 3CCVN 2IAJA 1JQGA 1JLAA 4B1VA 4LVNP 4MK9A 2E2QA 2BX6A 4LR7A 2ZGZA 5CHCB 3I0SA 3OYIA 1SI9A 1UW4A 1WC3A 4FS1A 1NSQA 2RAQA 3G96A 5BPLA 3HHKA 1MWMA 3TP2A 1NK6A 2VBYA 3KLEB 3BSOA 1FVSA 3W0LA 1CZ9A 1FA0A 1YJVA 1OH5A 3NGSA 3D0GE 4CNZA 4QS7A 5KFLA 3RW6A 4DX6A 1H38A 1NJIO 2CKWA 3HKWA 5KG2A 2EBEA 5F3TA 2AYMA 3VA3A 3LP0A 4FK2A 2M0GB 4E7JA 2N4CA 4BRHA 2ZKUA 5F3ZA 5FPMA 3UKRA 3RSEA 4UY8O 2E1ZA 4KI6A 3VN5A 3EL2A 4X4OA 2RRBA 3MXHP 3OW2R 4FN5A 3FSYA 5I3UA 4B3SK 3FC9A 1TMJA 4YDXA 2EFNA 3JAMO 1WACA 4ED6A 3LDOA 1OSDA 2RUGA 3LWLA 4PG4A 1ZAXA 5LJWA 1Y97A 3WXJA 1FXRA 2W9BA 2IVPA 4MQ3A 2Z1HA 2DH9A 1XN9A 1IR1A 3V9SA 1KVJA 4JI4J 2QX0A 3WQTA 2HHSA 5HQMA 1OSCA 1NKBA 2RQKA 4DV6F 3J7Z5 3EKSA 4FK0A 2V2QA 2QSWA 4HTUA 1N33K 3PW0A 4IFEA 3TTDA 2OELA 3OTDA 1YT3A 2ITMA 5AT1B 4JN4A 5EY4A 3MR3A 3G0ZA 3MXMA 3NGRA 2VIHA 2FY1A 4EYIB 4I7FA 1FERA 3C46A 1C0UA 4B9MA 2PBDA 3ILLA 2FJEB 4A8FA 4M5DA 4AF1A 3CQXA 4MLEA 3DFEA 1S57A 4WZMA 2WVEA 1GLEG 4U7CA 3ONQA 5KG3A 1FKAF 4PWUA 3LDPA 2FHMA 3O6QA 3C95A 2ATLA 2UXDJ 4O0IA 2JH3A 4ECVA 5HRNA 2DO0A 1DTTA 2FHKA 1NU4A 3CW2C 3R3LA 3FQKA 1K8KB 2MKKA 2N82B 3CB4A 1NPRA 2O66A 1QJHA 2CQ3A 2V8HA 2HF3A 2VFUA 4LF2A 4F3QA 3GONA 3IWNC 5DQHA 3MR5A 5M2PA 1HBOB 2P9NB 1ZPWX 2R8IA 1XNQJ 3WIVA 2PY5A 2BMBA 1R8BA 4PG6A 2XC9A 3KKSA 2V68A 3AB2B 1E6YA 4FF4A 1FJGJ 2GFFA 2KVQE 5D4NA 3FFIB 4KKOB 4NLVA 2LQ5A 3AVJA 3RBXA 5AFUH 4ILJA 4ES3A 4QR1A 3Q8PB 1N0VC 1PO6A 2IHR1 2HFUA 3KMQA 5KFXA 2A0FB 2Y1IA 1VQPN 1C6VA 1OY9A 1Z1ZA 4B9LA 3B78A 2DR5A 4GO5X 3UD5A 4QW9A 4DL7A 3HLUA 4YR0A 2HF4A 5GAGI 4JI4K 5HLFB 3DRSB 3G82A 3RB3A 1VQ4S 4CZCA 3ZSZA 5LOQA 3D45A 2DNRA 2BKOA 2NRHA 1E6VA 1VDHA 3QQCD 2GIRA 2HK3A 3IBFB 4JI6F 4K2XA 4FDFA 2XMAA 1W0HA 1WTBA 4U7BA 3GV8B 4OZJA 5ADXA 1Q8LA 3THPA 1G1XA 3ENHA 2MKSA 3DMJB 4CEBA 1J5OA 4ZVQB 2KDOA 5CQGA 3LGHA 1RAOA 4L75A 1DQAA 2UXDK 2D1CA 2MZTA 2R7TA 2GQCA 3DLEA 2ZWHA 4FNHA 5L9XA 1U1LA 4MKAA 4IBNA 2KXFA 3PX4A 1JNRB 4ZJOA 4OZNA 1RUSA 1VR6A 2B3TB 2WVBA 3IGVA 3I9V9 1K1SA 2RHKA 3DOMB 1S59A 2YX6A 4DMNA 3OHBA 1SC6A 5BYSA 4ZVPB 1Y0HA 3HI9A 1CULA 2FB0A 3KLFB 4MIWA 1WAFA 3KHGA 2PA3A 3J7ZT 4MKVA 3BJYA 1JXEA 4RNOA 1XNQK 1TQLA 2C3PA 3QAEA 4LH4A 3CCEN 4R5PA 4QIFA 2K7KA 1KLMA 2G13A 1WI6A 4TU7A 3ZNJ1 3TAGA 4CIFA 1YI2S 4ECYA 1FJGK 3CJTA 4FPAA 2JEJA 4WTYA 2Z4PA 4LSLA 1S9GB 1RQ0A 3M9OB 4KBIA 2MQMA 3H3NO 4IWVA 3V2UC 3OVAA 2DY4A 2VZ9A 4OJGA 4ICLA 2YKNB 1GOAA 5AQKA 3HP6A 4G65A 3CD6N 4OLOA 5B0FA 4CI0B 2HBZB 1IR0A 2QTDA 1JXBA 1RXOB 1YJNN 2PMZD 4ZN1A 2KVIA 1Z26A 1TKDA 4HHHA 1RT2A 3P5TL 2JVOA 2FSJA 1UWBB 4I69A 2FVPA 3GJSB 1NBEB 4K4YA 3DLGB 2OTLS 2JL9A 2ZZTA 4DTRA 5CZ1A 1NPKA 2J0QD 2MZSA 2O8DA 4HH1A 3AY9A 4NLCA 3WX4A 5KRTA 3ZTQA 1JLFB 2DNOA 2F65A 1R59O 3DU5A 3LP1A 2NXEA 1QUVA 3A8IA 2WK4A 1T8EA 4H5VA 1YIJN 2V34A 1WNSA 2R8HA 1T9UA 1NUEA 3C15A 2KKHA 4DV5J 4JI1F 1BISA 5D8HB 4FWPA 2VFTA 4P52A 1Q81T 3V9XA 3LAMA 2UXBF 3IFRA 3QGIA 4XEIA 4F4XA 1OYDA 1RAGB 2F4VF 1NZ8A 4FL9A 5EU7A 2Y0SD 3O4QA 3D2FB 5HROB 4CESA 3TZYA 2QWRA 4DL5A 2OEMA 3T5JA 3NOGA 4TN2A 1KLNA 3ZZYA 5EDWA 4WFBL 5KFAA 3CE8A 3ILOA 3RWUA 3HHLA 3PYDA 1OH7A 2B51A 2IM3A 3PJWA 4QWCA 3M6XA 3UI3A 4MIAA 3IP0A 4C48A 4J90A 3SYZA 4J9NA 2DR7A 1N5QA 4JBCA 1S1XB 3QRRA 4R8UA 2VG7A 2YWEA 4DWIA 1BDGA 2ZHBA 1BQNA 3BKTA 4DPOA 5KFWA 4KHRA 2HQGA 2BJ9A 2BJ7A 2OPRA 4FO0A 5AQTA 1S72S 5FJ4A 3EGWB 4DI6A 1TP7A 4NLPA 1KHWA 4YOWA 2BM1A 3MPVA 3T9ZA 1SUQA 2MDAA 4F0KA 1WKLA 1NNEA 4M45A 2QLJB 3E01B 2P9LB 4FZXC 3PW2A 4CEZA 1RT4B 2XMKA 3N5FA 2OH2A 3SUPA 3O1BA 3PYFA 1AZSA 5KFBA 3SSSA 1YBTA 5SWMA 3H4BA 5IOLA 2CPJA 3NOCA 1HBUA 4EI2A 1C1BA 1LFPA 3ZSOA 3SDEB 2BE7D 2DPIA 5IQ6A 4ZCKA 2FJAB 4WJBA 4I67A 2HBRB 2I8EA 1OY8A 1V9OA 5T7LA 3GL1A 4CJUA 5KFCA 5DDQC 3T69A 4X2BA 4YORA 4QW8A 3V4MA 2P9UB 3ISND 1CS4A 4DV5K 3IUCA 3NGIA 4ID8A 4D3HA 1FDBA 1LW0B 3O8MA 1FJEB 3F2KA 1IG8A 3M5RA 1NGCA 2K1RB 1MMDA 2GELA 3CC4N 1ELOA 3FQLA 2NLXA 4JYAJ 1UFKA 5EX0A 2POKA 4NXMF 2ZM6F 3D2EB 3MMJA 1QTMA 1XUPO 2BRKA 2A42A 3I8BA 1ZBUA 1V5IB 1X3MA 3J7ZO 4QIEA 1RFQA 3Q23A 1RBRA 1IM6A 5EOYA 4URQU 3KFWX 2IVMA 3F9MA 1HNWF 3ZNUA 1VHFA 1T9VA 4KGVB 4M5LA 1UAXA 3CXCR 1RWMB 4QS8A 3H5UA 4WP9A 5HSPA 1YBAA 4NL5A 2IBOA 3TAFA 1IN0A 3POTA 2LKZA 3ZC4A 3PW7A 3MM7B 5CXTA 4AHCA 5GAEI 4M63A 3CCZA 2DGWA 5AXLA 5B0CA 1RT7A 4RNNA 2OEJA 3ZZRA 4F2SA 2GZOA 1L5UA 2RF2B 1R7IA 1YDLA 1TK8A 2CNKB 1RGVA 2W42A 4Z0UA 1S22A 1KVKA 1NDPA 4F3MA 5KFKA 2BBEA 4QIVA 5AR0A 2BZ2A 4H5TA 1NDKA 2OO4A 3A13A 1BU6O 1XMQJ 1K47A 5M2RA 4ISFA 2VD3A 3OYLA 2FZCB 1ZS6A 3BGRA 4P74A 4PHTX 3M4XA 4ZPVR 3GYNA 2NUBA 2N3OA 1GK8A 3M8QA 2RNEA 3VAIA 4CEDA 2X51A 1LW2B 1V3SA 2AMCB 1PIEA 2AX0A 3C3LA 2Y3YA 3J80Y 1ATSA 4TXSA 1NGJA 1VSHA 2HRTA 1BLUA 5D77A 1K8AO 2YNIA 4ZPCA 2FIUA 1RI7A 4W5NA 3SFGA 1VQKS 4N8NA 4ECUA 4YDDB 3M8PA 2G8IA 2NRRA 1CJUA 3G9CA 4Y0WA 2HAFA 2MSTA 2HQ3A 5J2QB 1Q81O 1FD2A 4JYAK 5F8HA 2IS3A 3U3YA 3AQOA 4YNQA 3CCSN 2AHOB 2IIRA 2HKEA 4AILC 3F0NA 1HBNB 3DGPB 3HVRA 2YHYA 5F0UA 2IGIA 2YKQA 4LREA 1Z25A 2QLFB 3VZIA 1WHWA 2V6AA 2PT0A 4JV5J 1IJEB 4H0YB 2IYIA 4ZJQA 2B7CB 2DGOA 2GUIA 1PAEX 5J2PB 2BJ1A 2EWHA 1SJQA 4DU4A 2O8BB 3W8GA 1N32J 4FJLA 4AH9A 3C66A 2W9CA 4NI2A 3CCTA 3HX9A 1MWKA 3NGYA 1WC6A 3SQ1A 1F5BA 3HSTB 2D3O1 2RB7A 3N4WA 3HD1A 2YH0A 4H5RA 3D6RA 4ED4A 3N9UC 4B3SF 1IQZA 2ZBRA 1VMBA 4HUEA 4BRPA 1PYSB 1XC3A 3F73A 1QLNA 2C42A 3G71N 1XMQK 4FYDA 2A40A 4BC9A 4ZITA 1RLCL 3EZ5A 2B8QA 1LXNA 1HMVB 2GAGC 5A8RB 4RNFA 4YS2A 3D66A 1NSPA 5JLFA 3OL7A 2EK1A 2D74B 2DVIA 1N33F 3RAXA 3UVJB 2ZOGA 4Y28C 3AVHA 1UZHA 2BOPA 2Z56B 3I55N 4A47A 5DG9A 1EETB 2R8GA 3PIPL 2LVWA 2L9WA 2NSBA 4RBUA 2OPSB 3LGNA 1X7VA 4JK9A 3FNNA 2I5JA 4C0HA 1WOQA 4KHYA 1W97L 1TL1A 2CPIA 2H51B 1KP6A 2IJRA 1ZBTA 4WKRA 3ENAA 5C2FA 2OIHA 1SIWB 4K42A 1D9FA 4NRUA 4USTA 1QVGR 2X6NA 3KDOA 4AXIA 4DS4A 3WNFA 4KAZA 5F9NA 1VQ5N 1U6FA 3W9HA 5DO2A 1X4CA 2W2PP 3CEDA 1U1NA 5AQHA 4USUA 1AROP 4ID5A 2ZJRQ 1UWAA 4Y3CA 5K20B 1YZ6A 4CIOA 3NHGA 3J81U 4JV5K 2WONA 1I3AA 2FJDB 1HYVA 3TEHB 3CJRA 1OJ4A 2CQ4A 4B8CA 1DGKN 3CMAN 1N32K 3U1MA 2J6UA 5KFJA 1WNEA 3FRZA 4BR5A 3NLCA 2B5JB 2KG0A 3EPIA 1X1PA 3VQBA 2R42A 2ZD1B 5C25A 3OVNA 5HN0A 2MEWA 4ANEA 3D3BJ 2E2NA 1RWWB 3GFHA 2G0JA 3NDKA 4PPZA 1VFJA 1LWCB 4OHXA 2P9IB 2DEIA 2IJNA 3NS6A 3MCNA 3VAHA 1RDWX 3QSIA 2XNQA 4CF9A 5AQRA 3OFEA 1D4XA 1BI4B 3FBEA 1NOZA 2KL8A 4FLVA 4JI4F 2HBYB 4DMZA 1S9EA 2Y1LB 5AE1A 3W5YA 1OWXA 5U47A 2A1RA 3JTOA 4Z4EA 4YDUC 1PGZA 2PI4A 2KB2A 2IM0A 1RCOB 3MOJB 3I0RA 4OYOA 1K73T 2J7WA 4QR2A 3MAAB 4CP5A 2P51A 3BKFA 2CDRB 3BR8A 5K9FA 1EP4A 2GGPB 2M8DB 2CPZA 1MMNA 3WEEB 3RU0A 1S6UA 1HPZB 3JYTB 4OHVA 4OX7A 4RO0A 3AAWB 3PRBA 4IR9A 3CO9A 1NGDA 4F02A 3RMDA 2UXDF 4TLQA 3IMXA 3CVKA 5LSLA 1RHKB 3PKMA 1KQSR 3SSQA 1VS3A 3NF7A 4F2RA 1TL7A 4DHVA 2CPEA 1CXUA 3BQ0A 4A59A 2DCUB 2WW4A 2KXNB 2IA6A 1C0MA 3ZX2A 4FF2A 4DFJA 2LMIA 2XGQA 3AQPA 4RW8B 5CA5A 3W66A 2AGQA 4BQLA 4B9NA 1WSGA 5AQVA 4AM7A 4LR9A 1XNQF 4IO8A 2EBGA 2AGOA 3BN4A 4P2XA 2QKKA 1HRHA 4FSVA 1SKWA 3VMFB 3WXIA 1VQOS 1SH2A 2P9GA 5KFVA 2F3JA 3LP2A 2J8AA 4PXCA 2ZJRL 5K14A 2ZH4A 1ZAVA 2QWQA 2O01C 3DRRA 1QZ6A 2CPHA 1X4DA 4WYWA 3MM8B 5A8WB 4P7VA 2NSCA 3RMCA 3NCRA 3QMLA 2XZTB 5ADZA 4A8MP 1NLKL 3M7VA 1QSSA 4O4GB 1U2RA 5HAOA 3P38A 2V7ZA 3MECB 2EFGA 3CIPA 3VTIA 4F25A 3EZOA 2E1AA 3LWMA 1RDDA 2RQ4A 1SZ2A 4CIGA 5AJ3J 4NO7A 1ZAWA 4K4TA 4IUFA 2GVZB 2JZ5A 1PC5A 5CCLA 3PR5B 2WW8A 1TGOA 4JV1A 5KPTA 2DYAA 1KOHA 3TVYA 5CHIA 4BG8A 4KPCA 2RH3A 2W2NP 4M63C 2CH5A 5MLCQ 3DDNA 2DFHA 3J7AP 3TUPA 4W5QA 1HLUA 1SL1A 1F6TA 1CC7A 3VCDA 6AT1B 3L0QA 4ISEA 2ZH6A 3EXYA 3CPWM 1PBUA 2PSZA 2BYCA 2BTFA 1ZXOA 4CTAB 3AVGA 3QLHA 3VGVA 2MKHA 1VBZA 4FLZA 3KOAA 2EK6A 1RAEB 3DOKA 3I9ZA 1KXPA 4FZYA 1C4CA 1VLOA 5C2DA 2Z57B 3VPZA 1RBUA 1X9JA 3M9MB 3H98A 3LO3A 4IQXA 1VK0A 2DJWA 4CEAA 1W26A 2L48A 4PKHA 4XH4A 3ALYA 2GJFA 1BXNA 3MMVA 3W2WA 4FNIA 1V3RA 4BQZA 1HKCA 5D3GB 5L1JA 3R5CA 3DLLQ 4CLUA 3VTHA 1WD6A 4U67Q 1SBRA 4CFCA 4JI0J 1KQGB 3TYTA 4M5GA 1SJRA 4USJC 2E9ZA 2NZTA 4CLFA 2G8UA 3P1GA 4W4MA 3OVBA 4KHWA 1GLBG 4NLUA 3JXUA 2H48B 1S6QB 2JWNA 3AVMA 2MQLA 4KRFA 2Q3SA 1WF1A 3KJFB 1E4FT 4R0JA 3TU5A 1H3DA 2E9RX 4FYVB 4RW4A 1DTQB 3MWBA 1EARA 1S1UA 4BRFA 4Q2LA 2E44A 1LNQA 3KLVA 4DUZJ 3AAPA 4OJ1A 4BC4A 4BR7A 4WWSA 1D9DA 4RKUC 5AJ3K 2C28A 2CA9A 2QZ8A 3ZTSA 1VQNN 2MZQA 3QJJA 2ETJA 5KG0A 2O8CA 2QK9A 3R2CJ 3NG8A 1BWVA 2ASYA 2N3LA 4QU7A 1K73O 4Z7YA 3CF5Q 4NYZA 3NWGA 4JI5J 1Z4UA 4HHUA 4GRSA 2CZVC 4J9QA 1RAJA 3AA9A 3O3FA 2OFGX 4HH0A 2HGLA 4IOCQ 2MQPA 4Q8FA 4PWDA 5CYQB 1K6YA 2W1BA 3BBBA 3P8BB 3MEGA 1YTUA 4J2DA 1G6BA 3PDNA 2KHOA 3B82A 3CFPA 1FRHA 4WQ4C 3CJAA 1CJKA 2W01A 1YJWN 3SI8A 2M3DA 4DV5F 2QLXA 4HACA 4P72A 3S1TA 3R1LA 4ZVTB 3CM5A 1DQ9A 3M3ZA 2KFYA 5HRRA 1ZM9A 3BEGB 1SH3A 2HHTA 3RJMB 3HMJG 1O1WA 4F50A 2HHHF 1RTDA 1WI8A 2NYHA 3MCSA 4NLRA 4ZIWA 4Y1DA 2RT3A 3ZZ0A 1P1TA 4FWOA 4JI0K 5KQDA 1JLEB 4F7VA 1IBMJ 1WUUA 3WBZA 2LSNA 2AYEA 4WXWA 4EBCA 2FTRA 2LDIA 2DFEA 2AU0A 4YOYA 1N36J 1UAWA 3KLGA 3K5MA 1RK8A 2AJQA 4PQAA 3S7RA 4PABA 4C0OC 3DLLL 1LCUA 2HBJA 2OHDA 2HGMA 4HTIA 4FJIA 2XY7A 2IDOA 2BJDA 1GEHA 3SPYA 2ZBIA 1LOUA 5L1LA 1V4TA 4U8YA 3KVGA 1SXLA 5I42A 4DUZK 3L95X 5GINA 2HURA 5G0RA 1MA9B 1F2GA 1M1HA 4BG9A 1NHUA 2QYGA 4BLGA 1IKVA 4WQ5A 4R79A 3RTVA 4JI5K 3OR2A 1FFWB 3OT9A 3U3GA 4FK4A 1X3NA 2E8AA 4CHOA 4JK8A 2WFBA 4P7TA 3ULHA 1DLOA 3UDVA 3MTKA 1RB0A 5FRMA 2LA4A 2CUYA 2EFOA 2DKOB 4KH4A 3HO1A 4DR6J 1S10A 4X4QA 1IG9A 1U04A 3RAQA 4C1NI 1XQIA 2DT9A 4QWDA 5IT0A 5AQQA 3SCJE 5F8GA 3S3NA 3D0HE 5CZVA 5KT2A 4DU8A 3GB0A 2PMHA 2YNFA 3I56S 4CLWA 2W7AA 4QOZB 2F8HA 3JSBA 3FSIA 3CETA 5F8MA 4ZP6A 4JYAF 4KQZA 1NGHA 1HUXA 5IQQA 2C3OA 5HOOA 4WPAA 4RW9B 3FEYB 4BHQA 3IRXA 4CT9A 1S6PB 2D5RA 4ZPTR 3A0IX 3X3UA 4ZTJA 2DNHA 3HSGA 1IBMK 4IRDA 2C22A 3PV8A 4LJMA 3C8YA 5HBMB 2Q36A 4FLTA 3QBCA 4Y65A 2E5IA 3KNGA 1SJFA 4LF5J 5E3PA 1N36K 3MMCB 3OVSA 4L8RB 4O3QA 4KO0B 2HZVA 3AVKA 1IKWA 4L3NA 1VC5A 3AOCA 1MLAA 4WIIA 1WAJA 1SC1B 4C9DA 4IO9Q 4AQYJ 1NGEA 2CQ2A 2QLBB 2DR6A 4IR1A 5CYJA 4LQ3A 3NBPA 4NB4A 3MEKA 3R6GB 5BRDA 5ETMA 4BR9A 4RR5A 3O5BA 1KQFB 1YVFA 5A2QU 2Q2RA 4DQQA 4LRDA 4V19S 4CZGA 1F3FA 2BA9A 3VWSA 1MU2B 2AJ0A 1RAAB 3FGVA 3Q7BA 2Y9HA 3QICA 2ILYA 2E1CA 3BP8A 2YCHA 5C24B 3OY9A 1XMQF 3WDOA 1J2VA 4FJGA 1GAOA 4RUAA 2V7YA 3A5OC 2XEXA 4PWWA 2DH7A 4QJVA 2DNKA 2R3VA 2FHOB 4JD2A 5EWFA 1Y3JA 2I6WA 3V9ZA 4A57A 4PL7A 2AZ1A 3EZUA 5H1SQ 2EKYA 4O3OA 4LRAA 3VAGA 3A3PB 1WORA 1HPMA 1B0VA 3UE5A 3ZSYA 4DR6K 4W98A 2YNGA 1HWUA 1U24A 1VRQC 1VBKA 3FJ2A 3HHNB 4AHTA 3N6NA 3CC7S 1T3OA 2CGJA 2ROEA 2GO8A 1JLBB 1VC6A 3OYAA 3QDKA 1Q53A 4OYWA 1B92A 2VOOA 1BD6A 1TL5A 3I5BA 1NDCA 2V4JB 1N6QA 3VA0A 1YQHA 1CXQA 3ID6A 2Z1JA 4DQIA 4M95A 4WFYA 4CEOA 3OXLA 3RB4A 2CIMA 2DGQA 4DN0A 1RT3A 1S1TA 3MM9B 2ILZA 5AZIB 4JV5F 4LF5K 3N4QA 1D3WA 3RBEA 2E7WA 1IWGA 1HHSA 2SXLA 1SJ3P 4DV2F 4MTPA 4J2AA 1N32F 4AQYK 2ZH2A 1ZOTA 1NKCA 4F3TA 3L09A 2YKMA 3OW2M 3CCJS 3ZEUA 2P9SB 2CPFA 4OMFG 4GV3A 1QAJA 4HDHA 4DSKA 4U96A 4BVPA 3VGTA 4C11B 4EZ6A 3OXFA 1DQ8A 4OPAA 3KK1B 1JL2A 3BSCA 3BS9A 2R2SA 3OTCA 5F8IA 2E6MA 4BY9C 4M94A 4K25A 3BM7A 1TYQB 2LU2A 3M2VA 2X1FA 1FXXA 5HVHA 1N5SA 2FC9A 4IFYA 1ZPVA 4IO9L 1FKOB 3NH0A 3PACA 3K9KA 3NGTA 3ZETB 5KFIA 1BA1A 5KPRA 4W5OA 1KCFA 1FNXH 3T5KA 1TKZA 1XNRJ 3NNHA 1FI4A 1NGFA 4KTZA 4Y34A 2LEBA 4WYLA 3C14B 1FKPA 4CO4A 5M1NA 3MCMA 2YVSA 4IZ9A 4HTJA 1BWFO 2RQMA 2C3MA 3OUYB 3W3SA 1QTNB 3O9QA 1CPZA 3GFZA 4H4OB 1HNIA 4F4YA 3SMPA 2WB1D 2UU9J 3SJJA 1TUWA 2HK2A 4CH1A 3OSNA 2AF6A 3IAS9 4CZLA 1TKXB 4A46A 3NRBA 1V5VA 2NQPA 3A5LC 3H90A 2HNYA 2ERRA 3BSNA 3W1YC 4HEA9 5KG1A 1IUJA 3KK3A 1NMEB 4WYBA 4CYUA 3Q83A 2B43A 4C4WA 4ZCIA 1NB2A 1F9FA 4ALZA 3U1NA 2MY8A 2XHWA 2P9KB 4WF9L 3JS9A 1RT1A 2Y0BB 3KWMA 4KE5A 1X0FA 4CF2A 2GC8A 2CGKA 2GVDB 3MEDB 3RMAA 1FVQA 3ZTRA 3P31A 4XDDA 3DWLA 3HJFA 2R7OA 1NXIA 3AO4A 3CCVS 4BACA 5MLCV 1OH6A 2X3DA 3AGKA 4CHNA 2Q66A 3V81A 2QFIA 2ZJQQ 5HRSA 4O5FA 4DXLA 3QYYA 1BUXA 1UEVA 4WBFA 2WSFC 2IAJB 1KVAA 1JLAB 4MO5A 3MCAB 3CJ7A 4FOIA 5DZ7A 4PXBA 4ED8A 1JL1A 3TTFA 4B1ZA 3DXKA 2C1EB 2WOMA 1UFLA 3WNGA 4ZVFA 1C2PA 4B1WB 2CNNB 2JEIA 2H5EA 4USVA 2BXJA 2OANA 4KGKA 2O8EB 2J9DA 2JRSA 1NK5A 3I32A 5EHHA 4NLDA 1TFYA 2FD2A 4RPFA 1NZAA 1VQMN 1XNRK 1EB0A 2DNNA 3TZXA 3AH6A 3T5HA 2KI2A 4E19A 1S9FA 4LF8J 4GV6A 3AT1B 5ETSA 4PEOA 3J80O 2RDDA 3KHRA 4BDPA 3UKRB 3HXMA 3RSEB 3SUOA 3H5SA 4DV3J 3NH2A 2ZITA 4DR2J 2BACA 4MAKA 2UU9K<