4B3OA

Structures of hiv-1 rt and rna-dna complex reveal a unique rt conformation and substrate interface
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
553
structure length
540
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQAIHLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of HIV-1 RT, Nnrti and RNA/DNA Hybrid Reveal a Structure Compatible with RNA Degradation
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/dna/rna
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 117
structure length 540
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4b3oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b3oA05
2D3UA 2YHBA 2A1SA 3ZSRA 4IR1A 3HVTA 3PX4A 4TY8B 1T05B 3DMJA 4KB0A 1X1PA 1YVFA 3VA0A 1ZBLA 1RCHA 5F9NA 4DG1B 3EPGA 4TY8A 2IM0A 4FJ7A 3V81B 1J53A 1Y97A 3BQ2A 2IAJB 5KFKA 4CERA 4BWJA 1C1AA 1NK0A 1JXLA 1A5XA 4I9LA 2RDJA 4CEZA 3CFRA 1L3SA 4F4YA 4CK1A 4O3SA 3K57A 4CJSA 4RG8A 5F8GA 4CIEA 2IBKA 2HNYB 4ECTA 1RTHA 3NF6A 4FLTA 3H5UA 3NAIA 5JXSA 5EUHA 3LP3A 3BGRA 4NLRA 2KQ2A 5HRRA 4O5BA 3DRRB 2Q3SA 2FVRA 3ZSWA 4E1MA 1TKTA 3E01B 2Z1IA 3SFUA 3C95A 1YTUA 4FM0A 1BGXT 3SPZA 1RDCA 3SQ0A 4FJLA 4ZPCA 4YR3A 3KMQA 3MFHA 2ZD1B 3ZSZA 3OS2A 3HPHA 2XY5A 1DTQB 4PUOA 4B9NA 1T7PA 1JLGB 1VSHA 5KRSA 3RB0A 2XGQA 1JLCA 2OPRA 4EZ9A 3HPOA 1VRUB 4FM2A 3MEEA 3MXIA 4E0DA 3LP0A 3IG1B 2JC1A 1Q9XA 3LAKA 1JLBB 1LAVA 2FBYA 2KTQA 3KK2B 3NF8A 3MXMA 5FRMA 3TAGA 3BR9A 1UWBB 4FLYA 5DG7A 4AHSA 4RNFA 3OSNA 5KG2A 1KTQA 2XY7A 3ZSQA 4M3XA 3U6FA 5EDWA 3Q8PB 4IOBA 4TXSA 4RW9B 3MR3A 5DGBA 4EEYA 4M94A 3M9NB 4DF8A 4KAIA 1NK5A 2JEIA 1VSEA 4K50A 4I7FA 3VQEA 4RW9A 4KFBA 4J9QA 1A5VA 1LWEB 1L3UA 1S49A 2IMWP 1RT7A 3AA4A 1RAJA 4RUCA 4NLXA 2IA6A 3NAEA 4CGJA 1T94A 3DRPA 4MIBA 2HMIA 1BI4B 5J2PB 1RT2A 4ED1A 2XRIA 1REVA 1BQMA 3VQ6A 4LSNA 4TLRA 4E7JA 3MXJA 3I0RB 4FLUA 1RBSA 1LWFA 2R8IA 2AGPA 4F4ZA 2FLLA 2F8EX 1K6YA 4EBCA 2V4QA 3ASMA 4R5PA 2O4GA 3KKSA 3OJSA 3HSTB 1YVUA 3PV8A 2HHTA 1TK8A 5KTQA 3SUNA 3I5BA 3V6HA 4NLTA 4WFZA 4ECXA 4IG0B 5KFWA 5F8LA 3Q8QB 3NF7A 1T8EA 1QE1A 3L2RA 2FJWA 4QWDA 4FLWA 3ZCMA 4QOZB 2IC3B 1QAJA 3N6LA 4M3TA 2B43A 1TQLA 2DPJA 4DTMA 4LSLB 3NGIA 2GC8A 2BE2A 3TAQA 1SKWA 4FJMA 3QGIA 2XI3A 1ASVA 4FW1A 3L3VA 4E7LA 4FJGA 2HWIA 1EP4B 4TQSA 2W8KA 5KFOA 1HNVA 3DLGA 1L5UA 3MAQA 1DTTA 4J9MA 4B9TA 2IOCA 4YNQA 2G8VA 1RDBA 4NLVA 4EO8A 3MFIA 4NYFA 4AHCA 5KT2A 2UVUA 4BE1A 1HYSB 4CJ5A 1D9DA 3KHLA 1VSLA 5EU7A 3OL7A 1WN7A 3I0SA 4FJNA 3PY8A 4MFBA 2UUTA 4R8UB 1I6JA 3CQ8A 4MK8A 1S1WB 1N5YB 3CJ2A 4Y1CA 3CJ5A 3AA3A 1U49A 3ZT3A 4CJPA 1IH7A 4N5SA 1LWCA 3U3YA 4IBNA 1WNEA 2VWKA 4DMNA 3AVNA 2WTFA 1N56A 1WSHA 1XC9A 3RTVA 3NH2A 1S1VA 3QNNA 5FRNA 1C6VA 3AVAA 5KFRA 3T1AA 4FXDA 2HMIB 1SH3A 2AQ4A 3DMJB 3RMAA 4DQRA 4K4XA 3ZSYA 3I8DA 3DYAB 3K2PA 3S3MA 3AA5X 2QKKA 3OYBA 3S9HA 4BE2A 2OPSA 2IJFA 3K5OA 3HKWA 3MTKA 1TKXB 2D0BA 2R8HA 1BHLA 3M8RA 1IKVA 3TAMB 1HMVA 2R8KA 4URGA 2OPSB 1TKZA 1WSJA 1JLFB 3RBDA 4DL3A 5J2NA 1IKVB 4UQGA 1RTDA 3BJYA 4G3IA 4WZQA 5D3GA 3L2WA 1NJXA 2WK4A 4M3RA 3G0ZA 4IG0A 1GOCA 4ZP7A 4RNMA 3OYMA 1BQNB 1HQUA 4HUFA 4KHMA 1CLQA 4CEBA 1LW0A 4ZTFA 5KRTA 5K14A 4FM1A 3O4QA 3V6DA 2IC3A 1KSPA 1NK7A 4DFMA 4KB7A 2YNGB 4U7CA 1RTHB 2XO7A 4WFYA 1MU2A 4G1QA 4E89A 4JS4A 1QSLA 1NK9A 2E6MA 1GX5A 2DFEA 3OSPA 2BDPA 5KFBA 4J9SA 5CZ2A 5KFQA 3KKRA 2GV9A 4CEFA 2E4LA 4FK4A 4MQ3A 4KAZA 3RAXA 2W8LA 4CJRA 3H2LA 4FJ5A 2JEGA 2ITGA 2XWYA 3S3OA 2ZD1A 3SI6A 3NBPB 4URQU 4F4XA 3CWJA 2J6TA 3QERA 3NGZA 5FROA 2P1JA 4XIUA 2DFHA 4QWCA 1RT6A 2YNHB 2FVCA 5EWGA 3TQ1A 3RBEA 1DTTB 4I2QA 5F8IA 3AVFA 1N48A 5KFIA 4Q0BB 1JKHA 3H4BA 3D0PA 3BREA 3HT3A 2OYQA 3SPYA 2YNIA 4CGDA 3RB3A 3ZT0A 1RA7A 3CDWA 4CJ4A 1NOZA 4IH5A 3FSIA 3GILA 2YKMB 3GIJA 4J9KA 4JV0A 4ZP6A 1TKTB 5KFSA 3QEXA 4C8KA 4O44B 4CE9A 3T5HA 4F3OA 2RDIA 3LZIA 5HLFB 3CYMA 2KFNA 5F8JA 4QCLA 4Y1DA 4CJ3A 3LP1A 2ZQBA 3H5SA 2RKIA 1S1XB 3T5JA 4EO6A 4B8AB 3QLHA 3TABA 3M9OB 3THVA 1N5YA 3HL8A 3V4IB 1EXQA 4DL5A 2GIRA 4KI6A 3F9KA 2G8IA 3KTQA 1Q9YA 1KCFA 1NK4A 1TK0A 2B5JA 3QYYA 3JYTA 1WNSA 1LW2A 4B9VA 1S1UB 4IKAA 4FJ8A 3MR6A 3BSOA 4FS2A 2XHBA 3CJ4A 2Z1GA 3CM5A 1C0MA 1REVB 4NCBA 4BDYA 4CIFA 3SJJA 2W7PA 1JIHA 4NCGB 1B9DA 1TKDA 2OPPB 4FJ9A 1O1WA 3MEDB 3L2QA 2G8FA 4Z0UA 1BI4A 4ID1A 2AWZA 5HRPA 1U04A 1TV6A 3IS9B 1FKPB 4FJJA 1NNDA 4RW8B 2BGGA 4O0JA 4EBEA 4I7FB 2XY8A 3GV7B 4WXOA 4FBTA 1S1TB 4NLDA 4DFJA 3BDPA 4NYNA 4ID5B 1GX6A 4M95A 3TI0A 2EHGA 3I5CA 3RAQA 1JLAA 4B9LA 4ICLA 3QZ7A 1TP7A 4C8LA 3AVCA 1KFSA 2I1RA 3AVBA 1IKYA 5C5JA 4O0IA 4HUGA 1RT6B 2YNHA 2XCPA 2UVRA 1MU2B 4G1QB 3WNEA 3DLRA 3VQPA 4AHVA 1HNIB 2EC0A 1OS5A 1TVRA 3V1QA 4DLGA 4ECRA 2DY4A 3H5XA 3AV9A 3IN5A 2IAJA 1WAJA 3KLHA 3FFIA 4WE1B 5KT5A 2DFFA 4W5RA 1TL1A 3ZT4A 5CZ1A 2BQ3A 5L1KA 3AO1A 4KV8A 4OVLA 1XWLA 5KFCA 2RF2B 3LAMA 4B8CA 1T3NA 3KJVB 3LP2A 4QWEA 4B3OB 4HCCA 5I42B 2DPIA 1XHZA 3KJVA 5KG1A 2E6LA 3HJFA 4KFBB 4YP3A 2WONB 4HYKA 5HROA 3LP0B 1RBVA 3IRXB 4OPKA 2OH2A 3KIOA 1JLEB 3C6UA 1QTMA 4NLGA 4N56A 4IDKA 1SL0A 4ECZA 1T03A 3SFGA 3KOAA 3NH1A 1LWCB 2P5GA 2OPQA 1XR6A 4Y2AA 4H4MA 4EP4A 4KHUA 1XR7A 3H4DA 2PYLA 1S1VB 4H4MB 4WYLA 3AVMA 3DDKA 1S9FA 3QLHB 4Q5VA 1ZBIA 3DRSB 3K59A 3CJ0A 3PR4A 4GMJB 1CZ9A 3D45A 4DU1A 5J1EB 3OS0A 4F3TA 1KFDA 3HXMA 4RW7A 2ATLA 4NZ0A 2FBVA 4O3RA 2FVQA 4QPXA 3CDUA 2ASJA 3KHRA 5HBMB 1RA6A 1UWBA 4O3NA 3V9XA 1QQCA 5KFMA 1TGOA 4IKFA 1LAWA 3LWMA 3MECB 3DOKA 1RTIB 2V0NA 3QIPA 2V4RA 4CK3A 4LQ9A 2DTUA 3HVTB 3VN5A 2W7OA 4MK9A 5HP1A 5J2QB 3KD5E 1S1TA 3MECA 2AX0A 4DTSA 4CFCA 1UA1A 1UAXA 3PW5A 1J9AA 3T3FA 4OLAA 3M8PB 4TN2A 3O3HA 3HP6A 1HMVB 3KHGA 5K14B 2G8UA 2FVPA 4ED0A 1HRHA 2R2RA 4CJQA 4QW9A 3QEPA 4WYWA 3BQ0A 4FZYA 3L3UA 4DL2A 1NOYA 4K8ZA 3H98A 1VRTA 4ID5A 5KFVA 3TWHA 3LZJA 3ISNC 1XHXA 2UVWA 4PUOB 4AILC 5DG8A 3K5MA 2VG5A 2BANA 5HRNA 4YMEA 5L1IA 4B9SA 1C1CA 3DLEA 1SH2A 2C28A 3UR0A 1U47A 4TYBA 2Z1JA 4LSNB 4DSFA 4DSJA 1QS4A 4I2QB 4C8NA 3AA2A 3KLEA 3NKYA 4CJFA 4KTQA 1LWFB 4CESA 4JS5A 1JXEA 4DU3A 4B08A 1D9FA 4ICLB 3FFIB 3I5AA 1R0AA 4KO0B 1S9EA 4Q8EA 3CDEA 3CIZA 5KFAA 3HVWA 4WXWA 4BE0A 5KG6A 4DL7A 5SZTA 1TL1B 4TY9A 4KSEB 3VQ4A 3ZSVA 2GIQA 4ECUA 1RYSA 3DLGB 4MKAA 1CZBA 1BISA 3DRRA 1IKXB 3QEVA 1HPZA 2ASDA 2YKMA 2AGOA 3NFAA 4IRKA 2LSNA 5C24A 1ZTTA 2OZSA 3OYJA 4Z4EA 1HPZB 3PUFA 4FJIA 3SUPA 2W9BB 4F50A 2G8WA 2C2RA 4KHWA 4NLSA 1T03B 3EY1A 1TL3B 1WSFA 4CEEA 3SV3A 1S1XA 2GBZA 4ZMMA 4CEAA 1RNHA 1S6PA 1EETA 3KLIA 1LW2B 3NL0A 5CYMA 4CFDA 1TKXA 3BSCA 3OYAA 1VRUA 2FVSA 4MKBA 4DTOA 3DOLB 1TKZB 5SWMA 5HBMA 1IG9A 4W5OA 3QO9B 1JKHB 2BQUA 5KFLA 3UPFA 3OLAA 1S0MA 1RDAA 1SUQA 2XY6A 4NRTA 4MFBB 2XI2A 2HVHA 4O4GA 3V1RA 2HHQA 4Y2CA 4RUAA 1EX4A 1KVAA 4RW6A 5KFNA 3V6DB 3N6MA 3SI8A 3NE6A 4HCBA 4ELUA 5DK5A 3JSMB 5L1JA 4ZVFA 4DG1A 5HLFA 3UQSA 4IFYA 1NHUA 2JC0A 3AO5A 1S6QA 3C6TA 1SH0A 1CSJA 3M8PA 5L1LA 3RWUA 2BE2B 1S6QB 2D7SA 4E7HA 2FJVA 4HUEA 5C42B 1G15A 3V6JA 4BWMA 3TAEA 1WLJA 3G6YA 3OYCA 3G10A 5KFYA 2ZKUA 3OYEA 1SL1A 2VG6A 3KHHA 2HB5A 2HW3A 4RW8A 3OLBA 1WSGA 1HQEA 3RMBA 3MEEB 4J2EA 4ZP8A 1RTJA 3E01A 1RT5A 4PWDB 1Z25A 2W9AA 3SZ2A 1RBUA 4NCAA 4O4RA 1QUVA 4AH9A 3QZ8A 1S9GA 5KFFA 4CFAA 2OPPA 3DM2A 4PY5A 3KLFA 4FJKA 1KLMB 3QETA 2D5RA 2VG7A 3QNOA 3ITHA 3PJXA 3T5KA 5DG9A 1C1CB 5KT3A 1DLOA 4Z4GA 4O3OA 3PZPA 3RMCA 4EYHB 3HVAA 2FLNA 2PY5A 1T05A 2WCXA 3QGHA 1HNIA 3MR5A 2A1RA 3U3GA 1JLQB 1S5JA 3L2VA 4DQSA 1MMLA 2BRKA 1RYRA 5DLFA 4CF9A 1W9HA 5KGXA 3I0SB 4KV8B 3C6UB 3H5YA 4JLHA 1S48A 4DF4A 1NJWA 1DTQA 2ZE2B 1RDRA 2WB4A 2YV0X 3GV5B 4NYZA 4OJRA 2ATQA 3Q8RB 4ECSA 4DQPA 4LH4A 5KFJA 2WONA 1CXQA 2HHSA 4Z4IA 2RPIA 1SUQB 4KI4A 4ZVHA 4J9PA 2Z1HA 3OL9A 1LV5A 2IM1A 3RB4A 3VQ8A 2R7YA 4CGGA 3M8QB 1N6QA 2HAIA 1NKEA 3SCXA 4NLYA 4KHYA 1K1SA 1HJRA 1XI1A 1RBRA 1C0UB 2QE5A 3H08A 4KTWA 4F8RA 4J2DA 1U48A 4E7IA 1VSFA 3OY9A 4H54A 1UOCA 4M3WA 2OPQB 1JLAB 3QIDA 3OYNA 3NDKA 4E7KA 5JS2A 3WNFA 3AO3A 1F21A 4CCHA 2E9TA 4R5PB 4I2PB 4PA1A 3AVIA 4CJTA 4KKOA 4FZZA 3V6KA 4F4KA 1S0NA 3VQAA 2O4IA 1QAIA 1ZYQA 5HP1B 3OYDA 2FJXA 4PQUB 2HHWA 1VSDA 4CJWA 2HHVA 3PR5B 4TQRA 3VQ7A 2X6SA 3PJWA 4DLEA 3RR8A 1VSMA 2VG5B 2YNGA 5I3UA 4K4SA 1RT4B 4I9QA 1NK8A 3C6TB 3PHEA 4RW4B 3GIMA 1S9GB 3C94A 3TVKA 3IGVA 1RT4A 3GIIA 5KFZA 4H8KA 3AVLA 2HNZA 4CHNA 3KLFB 2HNDA 4ZTJA 5F8MA 3UIQA 3VQ5A 3B6OA 2FC0A 3QEWA 3K5NA 1RDDA 4NRUA 3V1OA 4KBIA 4K8XA 4DL4A 4K4ZA 4B3OA 3LANA 1W25A 4OKEA 1JL2A 4O55A 5J2QA 3DLEB 1QSYA 4F4WA 4ECWA 4CHYA 4HTUA 2IJNA 4ZPDA 1ZBFA 3ITHB 3FQKA 1HNVB 1J54A 2J6UA 4K4TA 4FLVA 1JLCB 1HYZA 5C24B 2UUWA 3V9ZA 4DS5A 2R2TA 4M3UA 3E51A 1D0EA 1IKXA 4Q0BA 3HP9A 4KREA 4DS4A 3OYKA 5EWFA 3EZ5A 2YNIB 4DTRA 3LPUA 2GUIA 4NLWA 4IG3A 3P5JA 4CGHA 5CYMB 4ED3A 4GVMA 3TAPA 4KHNA 3TANA 4KHQA 4ED8A 2QKBA 3DRSA 2B5JB 4ZP9A 1JLGA 2CKWA 3CFPA 3MR2A 4J2BA 1RT3A 4GC6A 2OPRB 4R0EA 2G8KA 1J5OB 1C0TB 1SV5B 5KFPA 4N41A 2F8SA 4C8OA 4W5TA 3M9MB 3OJUA 4ECQA 2R8JA 5KI6A 5DQIA 1NKCA 4ZVEA 1RTDB 2RKIB 5KFXA 5KGWA 1U09A 3LALA 3RRGA 4JRPA 3HPGA 1FKOB 2ZE2A 1HYVA 5J2MB 1C1BA 2OZMA 1JL1A 4KE5A 4OGEA 4W5NA 4O3QA 1TAUA 1BCMA 4FLXA 1A5WA 4KRFA 4DTUA 2E9ZA 5DMRA 5J2PA 1QHTA 3JYTB 3LDSA 4TYAA 4Z4FA 4H4OA 1I3AA 3AVJA 3LWLA 4L8RB 3OL6A 1FK9A 1Q8IA 2PYJA 4JV1A 2W9BA 3OL8A 4JUZA 2AX1A 3RB6A 1JXBA 3AVHA 4HKQA 5JS1A 1NJYA 4PQUA 4M41A 4CJLA 4CJUA 3O4NA 3BQ1A 1S6PB 3VQBA 4ED2A 1VSKA 3D5MA 4CEDA 1TV6B 3OVNA 1S0OA 4CHQA 5C42A 3RR7A 5KG3A 1YTAA 4RU9A 2BRLA 2V9WA 4QW8A 2YNFB 5CYQA 2ETJA 4K4WA 3PX0A 4DSKA 1RILA 4M42A 2PZSA 4FS1A 4OL8A 5C25A 3MEGA 3KD1E 2ILYA 2WOMA 2IM3A 4CHZA 1ZBHA 3KLGA 2AJQA 3HO1A 3QIPB 2KZZA 3NGDA 4AHTA 4IRDA 1BQNA 1N4LA 2ALZA 5I42A 4EP5A 4U6PA 2VG6B 5KFDA 1FKPA 4K4YA 4DQIA 4EYIB 4CGIA 4RNHA 1BCOA 1UA0A 3KLEB 2VA2A 4DFPA 2AGQA 3Q8SB 1JX4A 1L3TA 4B9UA 3AO2A 4IH7A 4WE1A 1HARA 4DSLA 1S97A 3WNGA 5J2NB 3VQDA 5F9LA 4IRCA 4MK7A 4ZVGA 1KLNA 1BIZA 4NLPA 3OYGA 1S1WA 3GQCA 1IKYB 4M3YA 3FRZA 3PVXA 1I39A 1U4BA 4KPYA 2HHUA 2QV6A 3DLKB 1S1UA 2JGUA 2JEJA 1IKWA 3VQCA 3ZSXA 3SQ4A 4FYDA 4MIAA 4DTXA 3OS1A 2ILZA 3ZT1A 2HWHA 4DTJA 1IKWB 1SKSA 2D3ZA 1D1UA 4HVJA 3AVKA 1LWEA 2KZMA 2WRMA 1C1BB 2XCAA 3RRHA 4LSLA 4O3PA 3DI6A 3KK3B 3SQ2A 3ISND 1KHWA 4RW6B 4CGFA 3N6NA 3V4IA 1ASUA 4J9LA 3NAHA 2Y1IA 1SKRA 2YKNB 3LP2B 5KG0A 3IS9A 3PO5A 4DSEA 3DRPB 1S10A 5KFTA 1WAFA 3SNNA 3M8QA 4Y3CA 1X9MA 4NLQA 4IR9A 4FK0A 4DL6A 5T14A 3QIOA 3ULDA 3UDLA 2R2SA 3SUQA 1D5AA 3NGYA 3KK1B 3LP1B 1VSIA 3IG1A 3T19A 2C22A 4E1NA 3CJ3A 1GOAA 3KK1A 3PX6A 4CJEA 4Z4CA 2HVIA 3G6VA 3RMDA 2R2UA 5DQGA 3HK2A 3O3GA 3PW4A 3TAFA 4K4VA 4IQXA 4ED7A 4WZMA 1IM4A 2D41A 4RNNA 3HVRA 1BQMB 5J1EA 2B4JA 5KT6A 5KT7A 3A2FA 3BSNA 4OLBA 3G86A 5I3UB 3AVGA 2W9CA 5KG7A 1KVBA 1JLFA 3PW0A 1ASWA 4BDZA 4I2PA 2VG7B 3V9WA 5D3GB 4O4GB 3GIKA 2JLEA 4QWBA 4KB1A 1N6QB 4N76A 5KFEA 2AU0A 4CEQA 2HNDB 1WSIA 3WNHA 1LW0B 2E9RX 3L2UA 4IFVA 1C0UA 4LD0A 4CHOA 4YFUA 3QEIA 4KTZA 4M45A 4FW2A 4IFVB 4DQQA 3VQSA 4IDKB 3KLHB 4EBDA 3DLBA 3S3NA 4FK2A 2QXFA 2Y1JA 4OPJA 1X9SA 3TARA 2JEFA 3TR8A 3KLGB 1KLMA 4DEZA 2IS3A 1Z4UA 5KFGA 4KKOB 5KT4A 5DQHA 4DU4A 2BANB 4FLZA 4NLUA 1KVCA 3H59A 3OYLA 3KMSA 3SV4A 3EYZA 3VQQA 3DOLA 4CEOA 2HHXA 1RTJB 1ITGA 4Z4HA 3MF5A 3EPIA 2FLPA 3HYFA 4PWDA 4C8MA 3QO9A 5DGAA 3VA3A 4AHUA 4ZHRA 3V9SA 3OYFA 4AHRA 3NMAA 4E3SA 3CM6A 3KK2A 4J9RA 4HHTA 1B9FA 4MH8A 3BSAA 2KW4A 1NKBA 4XO0A 4CK2A 3V9UA 3OYHA 1FXXA 2IM2A 4OGCA 4Y34A 3ALYA 2X74A 4EZ6A 2UVVA 4ELVA 3F73A 5HROB 2IGIA 4JRQA 3GV8B 3GYNA 4OKJA 2F96A 4RW7B 3P1GA 3SYZA 3SUOA 4CHPA 3K5LA 4DSIA 4RNOA 3I0RA 1RT1B 5EWEA 1VRTB 1QSSA 4BACA 3DI6B 3KK3A 4NCGA 1JLBA 1XR5A 4BDPA 4IG3B 1RT1A 4ELTA 2YKNA 3MEDA 3FDSA 4ECYA 3QESA 3DOKB 3ZSOA 4R8UA 3B6PA 3G6XA 3OHAA 2IDOA 1ZBUA 3M8SA 4ZPBA 3AO4A 2CJQA 3EZUA 1VK0A 4FZXC 4CF2A 5JUMA 4H4OB 1RT2B 1VSJA 5T7BA 5KG5A 3QINA 4IFYB 4J9NA 4O44A 2HNZB 5FDLB 1YT3A 2C2EA 3IRXA 3L8BA 2D0AA 5KG4A 2G8HA 2EX3A 4TSXA 5FDLA 4QWAA 1K1QA 3P83D 3O3FA 2W42A 4KO0A 5CY4A 4FJXA 4M3ZA 4CF1A 3IGNA 1RBTA 3CO9A 4FBUA 1C2PA 4J2AA 3KLVA 4CJKA 1NHVA 4DTNA 2HNYA 1HQUB 5C25B 4KHRA 4CIGA 3V81A 2O5DA 4DTPA 3JSMA 3BGRB 2YNFA 4CFBA 3IAYA 1BIUA 1B92A 5F8HA 4NLOA 4ECVA 4XPEA 3CG7A 1FK9B 5CYQB 1KHVA 1RT5B 1JLQA 4CF0A 2XGPA 3NH0A 2X78A 4J9OA 3TAMA 1HYSA 5KFUA 3MEGB 3FQLA 4JV2A 4LY7A 1W0HA 2FBXA 4ED6A 2XC9A 4DWIA 3PW7A 1QE1B 2B6AA 2RF2A 1ZTWA 4Q45A 1CXUA 3DLKA 1RTIA 1GOBA 3VQ9A 1RT3B 1EP4A 3HHKA 2B6AB 2C2DA 3NCIA 3NBPA 1HQEB 2OA8A 4URSA 4ZHRB 3ZT2A 4CJVA 4W5QA 4Q8FA 4RW4A 2WHOA 3CVKA 4K4UA 2YHAA 4DFKA 4WFXA 1TVRB 1KRPA 1WSEA 1TAQA 2P51A 3LPTA 3DM2B 2X6NA 3HM9A 5KFHA 2I5JB 1S9EB 1SL2A 4YQWA 1ZETA 1X9WA 3CFOA 5E41A 1DLOB 4LH5A 3NHGA 1EETB 3KLIB 2I5JA 4LQ3A 4B9MA 2VA3A 1S4FA 4Q43A 2ASLA 1BL3A 3PW2A 5DLGA 1D8YA 1J5OA 3SQ1A 3NF9A 3ICLA 4F2SA 1TK5A 4IH6A 3QGGA 4N47A 3OYIA 2P5OA 1JLEA 5HRSA 2R8GA 4CECA 1U45A 1L3VA 2KFZA 3H40A 4FJHA 4FVMA 1FKOA 4KHSA 4GW6A 2QK9A 2BQRA 4E19A 2F8TA 1TL3A 5F8NA 1R0AB 1NK6A 4Q44A 2D0CA 4ZPAA 4GC7A 1IO2A 1EKEA 2NUBA 1C0TA 1SV5A 4FCYA 4YR2A 3PO4A 3KNAA 4X2BA 3D28A 4RZRA 3OHBA 3K58A 4QAGA 1Z26A 1RT7B 1NJZA 2BR0A 4XPCA 2VWJA 4CF8A 3T5LA 4YR0A 2FBTA 2WOMB 3DYAA 4OKKA 2J6SA 5J2MA 4F2RA 5L9XA 2W9CB 2RN2A 3DLHA
chains in the Genus database with same CATH superfamily
2YHBA 4LF2A 1DARA 2FF3B 4TY8B 1T05B 4KB0A 4CZEA 2R3VA 1ZBLA 1WC5A 4FDFA 5F9NA 4DG1B 3MCOA 4HH1A 1URRA 3T7ZA 2E2NA 2IM0A 4MDBA 1KAXA 4JKCA 3FZLA 1WF1A 2CQ4A 1N52B 2IAJB 2RRBA 5KFKA 1A5XA 3CQXA 4I9LA 3GSDA 1NB7A 2PI5A 3EE9A 1L3SA 4ZLJA 4ECTA 4F0HA 3NAIA 3VAKA 3JTPA 4YOVA 1RAGB 4NLRA 2FDNA 3G4SN 3NCQA 2MGZB 5D15A 4LF5J 3HSJA 4AQYJ 3Q86A 2AZ3A 2XSFA 2C2ZB 3I32A 4ZPCA 1R89A 3OTOF 4YR3A 3SDEB 2GA7A 2VKRA 1VOMA 1B4SA 5C2CA 3ZSZA 1NDPA 3M2RA 2KM8B 1RLCL 2ZJPL 4AL6A 2XY5A 1LEOA 1DTQB 3H42A 2F8MA 2J7KA 2ZOMA 5G4DA 4M5LA 4M7YA 3J7YP 2ROEA 1JLCA 3M6WA 1I5OB 4FM2A 5HSPA 2UU9J 1MN7A 4L6V3 4X84A 3MK6A 5IOLA 1JLBB 2HF3A 1BXNA 3VOVA 3MXMA 4L76A 5FRMA 4KHPK 2M88A 4LFCF 1VQ7N 5D0GA 1UWBB 2FQQB 1VGYA 3NNHA 3VENA 2CDQA 1R8PA 4F25A 1Q5YA 2VQEK 3U6FA 2O3DA 2CQPA 3UCZP 1HNZJ 4RW9B 2FJDB 5G0RB 4RUBA 2QSFA 4TVAB 2DHSA 4KAIA 3SQGB 4K50A 3VQEA 2CPYA 4KFBA 4J9QA 3KZBA 1LWEB 1WBDA 4KJIA 1ICEB 1NUEA 5BPMA 1PSDA 1TU0B 3N28A 1Q79A 2AJFE 4DV2F 2UXDK 4B1WB 2DGXA 4EI2A 1T94A 4WPAA 1WKLA 4CO5A 3DRPA 2HMIA 4OYZA 1GLEG 1WG1A 3HHLD 4ED1A 3CJTA 2JOQA 4QOTA 1X4EA 3G8TA 2N3OA 1FJCA 3OBWA 2F8EX 2BW7A 3K9JA 1K6YA 1OPIA 3ASMA 4R5PA 1FDNA 2O4GA 3B54A 1R7IA 3HSTB 1X4GA 4A46A 5KTQA 3SMSA 5E0OA 4NLTA 5KFWA 1T9VA 1A6LA 2IRXA 3A8YA 3Q8QB 3A3NB 1QE1A 2FJWA 4JI1K 3O3LA 3ZCMA 2IC3B 2GNKA 3R7NB 2B43A 3HFVA 1YBTA 4LSLB 1BUPA 1N5VA 4YB6A 3R6MA 1TUYA 3P38A 3NGIA 2NRTA 3CNQP 1MG7A 4BRIA 2MZSA 2WVFA 4CW7B 3M8YA 4FJMA 5M1NA 1ASVA 3L3VA 2GV1A 1ITPA 4A8SA 3RU0A 4KGVB 4TQSA 1A0OB 2MKCA 3TA2A 2QL7B 3DLGA 1L5UA 1DTTA 4B9TA 1FJEB 3DFEA 4YNQA 3HF5A 2G1DA 2LQBA 3H25A 4EO8A 4KC5A 2UVUA 3R3TA 3J7Z5 1HYSB 1VQNS 4CJ5A 1D9DA 2A40A 2V7YA 4BR9A 3KHLA 2HURA 2RT3A 4KGMA 4V19J 4OO1J 4MFBA 2UUTA 2QO3A 4MK8A 4C11B 2CAJA 5I4MA 2ZH7A 5AZJB 3PIPQ 1SAZA 5IT9U 2AIRB 3CI5A 2D9OA 3HZGA 5EX0A 4DR2F 2ZM6F 3R5CA 2VWKA 4DMNA 1L3KA 5HAOA 4NL5A 3AVNA 1G3OA 4A8MP 3OFFA 1XC9A 1S1VA 5FRNA 3UCUP 4PG4A 1C6VA 4DV0F 3AHPA 3DMJB 2NRWA 3RMAA 4DQRA 4ITSA 3I8DA 3DYAB 1LOTB 1I94F 4KH5A 3K2PA 5A2QU 3EEQA 3B4MA 3OYBA 2BKPA 2CJYB 1N34F 4MTPA 3ZTSA 1PJ7A 2AD9A 2R8HA 1BHLA 1OJ4A 3TAMB 5LMUK 3GJRB 3FC9A 4U95A 1WSJA 1FNOA 4RWWA 4JI7J 5J2NA 3Q2SC 3I56N 4UQGA 4G3IA 4WZQA 2HFNA 2L3MA 2E8AA 2HRUA 4CLLA 3G25A 3RGIA 4ZP7A 2HQIA 4RNMA 1GAOA 3CJSA 5E33A 1V3SA 4HUFA 2HBRB 3AXKA 3ILLA 4DCOB 1LW0A 4B3RK 5DETA 5K14A 4FM1A 5AQMA 3VF0B 2VBXA 1NK7A 4DFMA 4KB7A 4DR1K 3AY9A 4UY8O 4WF9Q 1QSLA 4B3SK 3SCIE 3QSYB 2DFEA 4CD1A 2BDPA 3PSIA 3D1HA 5AQKA 2X3DA 3KKRA 3BBCA 1I3OB 4JKGB 3BZKA 3IP0A 4CJRA 2HPUA 3H2LA 3R1XA 1RAAB 4GO5X 4RBTA 3NBPB 2J6TA 4CVNE 3CCJS 3C46A 1WD6A 1FJGJ 2W41A 2D9PA 1BY9A 4QYRA 1RT6A 2YNHB 2WAQD 3PIPL 2J8SA 1DTTB 1FKAF 4I2QA 3FCVA 2CQ1A 5KFIA 4C0HA 4HHHA 3H4BA 3FZKA 3D0PA 3J80U 3BREA 3HT3A 2OYQA 2PGCA 3WEEA 4CJ4A 3HZEA 3HOTA 3IMQJ 4M5GA 3GILA 2Y8YA 2JX2A 3PYFA 2LEBA 2O1PA 7FD1A 4MLHA 1S5ZA 4X64F 5EX3A 2G4BA 1SIZA 2F65A 2NYIA 3I6PA 4H0OA 3GCWP 3D2EA 1SC3B 4BRQA 2KFNA 3J8AA 2RVJA 2LDIA 5M2PA 2P9NA 2KXFA 5CAAA 2FJEB 1WF2A 2EFPA 3T5JA 1QQOA 3Q7BA 3M9OB 4CT9A 4WKYA 2HQCA 4DV3F 2J9CA 2QZ8A 4FF4A 3F9KA 2VF3A 1Q9YA 1NK4A 3JYTA 1LW2A 4B9VA 4IKAA 3RAMA 4A48A 5GAHI 5GINA 4Y65A 3CM5A 2EBGA 1C0MA 2NPFA 2P9UB 4QJVA 3MEKA 2P9KB 2YY3A 1B9DA 1TKDA 2RNEA 2HG4A 2RD5C 4H03B 5A6WA 3P5TL 4H0YB 3WUHA 1U04A 1SQEA 4ZLPA 5AJ3K 4Q2MA 4KH0B 1B3TA 1NNDA 4RW8B 2BACA 4O0JA 1NNEA 2YWFA 2XY8A 4WXOA 1QVFM 2E7WA 2KG1A 4NLDA 2V2KA 4B1UB 1KQSM 2HK3A 4M95A 2DGSA 1NXIA 1TR0A 1IR1A 3EMTA 2EHGA 2MJNA 3RAQA 2BYCA 4YOYA 1FD2A 1YJ7A 1EWQA 1KDNA 3QZ7A 2VU5A 1S79A 2DXFA 1TP7A 4C8LA 1JCFA 2VQFF 3AVBA 4BRGA 1RT6B 2YNHA 1CZAN 2L9DA 4OI1A 1VMBA 4AL5A 3AQOA 2FHJD 3QFHA 1X0PA 3IAM9 3V1QA 1RB0A 3KJNB 3L3CA 1WI6A 3LL3A 4V19S 2PSZA 3KLHA 5BR8K 3FFIA 1NG9A 3IUCA 2ZBIA 1HWKA 3I82A 1TL1A 4PYAA 3ZT4A 3IFRA 2BQ3A 3AO1A 1CVJA 2CYYA 5A8RB 4JI4K 2NS1B 3KJVB 4J7CA 2EW9A 2DPIA 4BS2A 4LF4F 5HMYA 4YP3A 5HROA 5CCMA 4OPKA 3SBMA 1JLEB 1QTMA 4NLGA 4N56A 5HO4A 1SL0A 4ECZA 4ER8A 1T03A 1A9NB 3KOAA 3NH1A 1LWCB 3BEGB 2F4VK 5D4PA 3PKYA 2DK2A 2IRUA 4KHUA 3QFWA 4CQ1A 3MAAA 1K44A 2ZWHA 3MMAB 3CCVS 3AVMA 4YORA 2RILA 4HT7A 4ZVSB 1S9FA 2OSQA 1ZBIA 3DRSB 3CJ0A 3PR4A 4NXMJ 2Y0BB 2QIFA 2QA2A 1E6YB 1CZ9A 4ES2A 4F3TA 2Z57B 2BJ3A 3OR2B 1SPBP 4LF7J 1KD1T 3KHRA 3KNGA 4CI0B 2ZBRA 1UWBA 3V9XA 3UN5A 1QQMA 3EICA 1LAWA 2QL9B 4ID8A 5HI7A 3ZX2A 1DHMA 3DOKA 4CK3A 1NGCA 2DTUA 2W7OA 5J2QB 3JQMA 2OJ3A 3VALA 4DTSA 3ADAC 3WXLA 1UAXA 1UETA 3PW5A 1RHMB 3D3BJ 5B0CA 2OIHA 3T3FA 4OLAA 1HMVB 5LMUF 2KFYA 1VQPS 3BGUA 3CEDA 4ED0A 2D74B 2NCKL 3QEPA 3L3UA 5HMXA 3H98A 4ILMA 4OLOA 3CTRA 2LXIA 2DGVA 5E3PA 3SCJE 2K06A 2UXCK 3AOBA 1IV0A 2BANA 4YMEA 5L1IA 3WBZA 5CA5A 2H1YA 3TUPA 1FVQA 1U47A 2KKZA 1QS4A 2VIHA 2NSBA 3BF1A 2PN6A 4KTQA 1LWFB 3FZBA 4JS5A 5LJ5Y 4DU3A 4NXNK 4FYYB 4GMKA 2RQKA 3C14A 2HK2A 1D9FA 4NXNF 3MPYA 1VYAA 3GLJA 2KT5A 1F5CA 5B0GA 4ICLB 3UWTA 4KO0B 1S9EA 4QR0A 2O67A 3SAFA 1N36J 2YWEA 4BE0A 1GLFO 4TY9A 4KSEB 1RWVB 1U6ZA 1RYSA 3DLGB 3D2EB 3WT0A 3DRRA 1HI0P 4CBWA 2J76E 1HPZA 2ASDA 1RXOB 4QPTA 4LJMA 3CF5Q 1ZTTA 1FI4A 2DH8A 3R8EA 3J7A1 3FFKB 2G8WA 2YQ0A 4NLSA 1T03B 2L48A 2GBZA 1S6PA 3KLIA 1FERA 5IWAJ 1ZS6A 3CW2C 3OYAA 2F9JA 4DTOA 2XMKA 2EFQA 1ZBTA 4TLQA 2AYBA 2QLWA 2UV8A 1YJNN 2N7YA 5HBMA 1WC1A 2QLFB 1RWNB 3DC2A 2BE9B 5B0AA 4NB4A 2HFSA 2B4UA 1RDAA 5DS7A 4MFBB 2FHJA 2E20A 4L73A 4TU7A 5DDQC 5HANA 1G6BA 1KVAA 2K8GA 5KFNA 3V6DB 4AUKA 4KYZA 2NXNA 1IR2A 3NE6A 1V9OA 4ELUA 1FA0A 1AFJA 3VEVA 4OV1A 2IVFB 5L1JA 4F0MA 3B78A 2LMIA 4PG6A 3T9NA 1CJUB 3AO5A 4WFNQ 1N33J 2WUSA 1Q16B 2DRAA 5DM7L 2D7SA 3L7UA 4X65J 5C42B 1G15A 3GFXA 1SKUB 3QPIA 2EFVA 3FGUA 2QN6B 2ZKUA 2FSKA 5B8HA 3OYEA 1TYQB 2VG6A 3KHHA 2HW3A 4RW8A 1KEKA 4ZP8A 3E01A 3VVUA 4LVNP 2W9AA 4NCAA 3JS6A 2M8HA 4O4RA 4JI1F 1FE0A 2P9PB 2NUHA 2H4YB 4PY5A 5HK4A 3KLFA 4FJKA 2VFRA 4LF4K 4MAKA 2D5RA 4A8WA 1YJVA 1C1CB 1DRZA 3W65A 4Z4GA 2NXEA 4FWPA 5LMNK 1VJWA 2FLNA 1P6TA 2DNLA 2WCXA 1HNIA 2LLZA 3SEOA 3F56A 4M5KA 2QYCA 2A1RA 2X1AA 1S5JA 3L2VA 1BU6O 2BRKA 2BKNA 4OLPA 1EB0A 2J0QD 3G9CA 3C6UB 1SQGA 3H5YA 4JLHA 1S48A 2J9EA 2HLUA 4ISFA 3MAAB 2CPFA 3ZTQA 3NCPA 4IJAA 3EXYA 4LH4A 4A8KA 1CXQA 5LJVA 3GL1A 3NP5A 3NMUA 2QFIA 3VEOA 2VICA 1GLJO 1UJ6A 3NXZA 1FNXH 1VISA 1CEZA 3AB4B 4I6AA 2R7YA 2R7TA 2QEXN 1N6QA 4QIWD 4NLYA 1K1SA 3NLCA 1W97L 4MLEA 4KTWA 4F8RA 1U48A 3KHYA 1VSFA 2O8DA 2RB7A 4DR4K 3QIDA 3AO3A 1F21A 4CCHA 2E9TA 5H9FK 3T1YJ 3JB9k 4R5PB 3A3OB 1NRKA 2MQNA 2GAHC 4B9QA 4RBUA 3AVIA 5I3PA 2QTWA 4CJTA 4F4KA 3C0BA 1QAIA 1ZYQA 3H2VE 4D3GA 2ZZMA 1VSMA 1E6YA 4MJKA 1KC8O 3GR1A 4CZHA 1UW9A 5LL6Z 1R59O 3ID8A 1NK8A 3GIMA 1K9MO 4H8KA 4LF8J 4B3MJ 4CHNA 5F8MA 2NYHA 3K5NA 1XNQK 8AT1B 4KBIA 4K8XA 4DL4A 2LEPA 4B3OA 3C65A 3LANA 2YKOA 1JL2A 2CH6A 2JFDA 3D0IE 4IUFA 3LDQA 4ECWA 1JXVA 3OUYB 1RZMA 2F4VJ 3TUZC 3ITHB 1F5AA 3FQKA 2FGOA 2FXUA 2CZ9A 2R2TA 2ZH1A 3MM7A 2CJ9A 3OXLA 1D0EA 2YPYA 3KUEA 1PBAA 4K59A 4DN9A 4DTRA 3LPUA 1NPPA 2GUIA 1JCEA 4IG3A 4ED3A 4GVMA 2QKBA 2UP1A 1BLUA 4ZVPB 1ZM2A 3MR2A 4LBPA 3MM8A 1C0TB 3OBYA 2NXUA 5DQIA 1SI9A 1RTDB 1HBUB 4R25A 1U09A 1HL6A 1ZZNA 4HL9A 1FKOB 2XLKA 3SDEA 1HYVA 2HFZA 1JL1A 1RHKB 1YSJA 4KE5A 4W5NA 3EX7B 3OHRA 1Y5NB 4G65A 4B3RF 4A8FA 1A5WA 2OP5A 4L3NA 2P8IA 5AT1B 5J2PA 2XWXA 2EK1A 4WK3A 4Z4FA 3AFGA 3R9PA 4QIFA 3VF4A 1NH8A 2RJZA 3UD5A 3OL6A 1FK9A 3C7NA 3C19A 4EIAA 2EKNA 2AX1A 4I4BA 7AT1B 2BXJA 4RPFA 5JS1A 3W3SA 2KRRA 4PQUA 4ZCMA 4JI3K 3THXB 3BZQA 1TL7B 3NY0A 1TUGB 4JYAF 3H3NO 2KKHA 2HYIB 1S0OA 1CJKA 2O01C 4LREA 5DO2A 1KOHA 4IOXA 1F6TA 1MDUB 2G9OA 4Y2KA 4QW8A 2YNFB 3ETMA 4BVOA 2ETJA 4YDUC 4P52A 4DSKA 1EKRA 1DJ0A 2NRHA 2GUPA 1MNEA 5C25A 3KD1E 2ILYA 3X1LB 1ZBHA 4DV1J 3IWLA 2JDJA 2XZTB 2ALZA 4I1TA 4AL7A 4K4YA 4DR4J 2JVOA 2RS2A 4EYIB 3ZEUA 3HJVA 4FVCA 4LFAF 1ATSA 1L3TA 4JI3F 3AO2A 3R5BA 4WE1A 3HTVA 1SJ4P 1HNXJ 3MDQA 1YQHA 2KJVA 2C3OA 1AT1B 3ILIA 1WC3A 4MMOA 3V5RA 4H5WA 4BGBA 2QRRA 2GMLA 2NNWA 3VV2B 4CP5A 1UVJA 1OH5A 3MURP 1IKYB 1SCJB 4M3YA 4RKUC 4K2JA 3E9PA 3PVXA 4KPYA 5F3TA 2HHUA 1IKWA 3VQCA 5L8RC 3K0SA 2RU9A 3WX4A 4JKDA 1NGHA 4DTXA 3OS1A 3ET6B 5ETVA 5AQZA 3TZXA 2YVSA 2WRMA 4A8OA 3RRHA 1DQAA 2PMWA 3MM6B 4O3PA 3P4IA 3N4WA 4V19X 4ES3A 3DI6A 3SQ2A 2K2PA 1KHWA 2E88A 3N6NA 1UVLA 2XMUA 3V4IA 1ASUA 3NAHA 1O51A 1SKRA 3UKRA 3R5GA 4WFAQ 3ENHA 5FPMA 1K0TA 2YH0A 3IR6B 4DSEA 4ZPWR 1HLUA 4IR9A 3OPKA 2GJFA 5G0RA 1KS2A 5T14A 3S1TA 2RQMA 4USMA 2RE2A 2FSNA 2R2SA 3VF6A 3LP1B 3C15B 3IKMA 4RWXA 1H2VZ 2WFBA 1GOAA 4JI3J 5IZHA 3KK1A 3DKDA 3A8IA 3E66A 2HVDA 2HVIA 2R2UA 1PIEA 2BUPA 3HK2A 3O3GA 4WFNL 4ED7A 2RAQA 1IM4A 2FHOB 2RDDA 4CZKA 3A2FA 4W92B 5I3UB 1DAXA 5KG7A 3BUZB 1JLFA 3Q23A 4HACB 1ASWA 2VG7B 3BB5A 4O4GB 3IWNC 1MSWD 2JLEA 2HNDB 3VEXA 1YJ9N 2DR9A 1FRLA 2HSEB 2Q2RA 3SLCA 4F3MA 1OMSA 1QVGR 5LSRA 2H4WB 4YFUA 3TZWA 4M45A 2CPJA 2KO1A 4IFVB 4DQQA 3ZO7A 5EGYA 3D9BA 5HMWA 4NYOA 4DUYJ 3CCTA 3S3NA 4FK2A 2XYHB 4ZOSA 3TARA 2JEFA 3TR8A 3FBCA 4X4NA 1KLMA 3ISZA 1F3FA 2AEFA 2RUGA 2CQ0A 4ED4A 4DU4A 5HATA 4FLZA 3EL2A 1ATRA 4H0TB 1XMOJ 1RTJB 2XS7A 2ZWPA 3WC0A 1RI7A 5FD1A 3OTOK 5L9NA 2XEXA 2A1BA 2WW4A 1RWOB 3A5LC 4C7QA 4FF3A 3U02A 1U7LA 5GAHU 1WI8A 3NMAA 4OZ0A 3CM6A 2EWHA 4LVOP 2HWTA 4J9RA 3SAGA 4NE9C 3MR7A 5LY3A 5DZ6A 1FXXA 2ZDPA 4DUZJ 1I94K 1DT9A 1VQMS 3T9ZA 4GV3A 1R6YA 1M1KO 2CPEA 1MN9A 3GCXP 4JRQA 2Z30B 4LR7A 3GYNA 3GV8B 4ILRA 3SYZA 3P1GA 3K5LA 4CHPA 4BC4A 4RNOA 2BJ1A 1HW8A 5EWEA 2B51A 1VRTB 5IT9Y 3KK3A 4CLFA 4IG3B 2KT2A 4PEOA 3KWGA 2CWXA 4ECYA 2HHHJ 3DOKB 3PLAA 3ZSOA 4R8UA 3B82A 4HEA9 5A6PA 2IDOA 2F7TA 3SMPA 3PRDA 2F9TA 1EQYA 4YB1P 2GX8A 3C8YA 1DBDA 1Z2LA 4X4UA 2RQCA 3LDNA 4A4JA 1CJUA 4H0VB 2HAFA 3CC2N 2C2EA 3D4JA 2YH1A 4OI3A 3EJMA 3NGTA 4JI5F 5CY4A 4FJXA 4M3ZA 4CF1A 4K41A 1IVZA 3DRYA 4J2AA 2DNYA 3KLVA 4DTNA 2JH3A 2N82B 4ANCA 4F04B 3V81A 2DT9A 3VQTA 4DTPA 3BGRB 2CQ3A 1BIUA 3CERA 5TKWA 5F8HA 3C7NB 1FK9B 1NSKL 1KHVA 3MXHP 2X78A 3TAMA 1YBUA 3MEGB 2X3GA 3UE5A 4JV2A 4LY7A 2IVMA 3SBGA 2FBXA 1SJ1A 4FXVA 4ZPVR 2HHHF 1CXUA 1RTIA 1QDUB 3MN7A 5AQRA 2CZ4A 3BN4A 1EP4A 3VERA 2C2DA 3DJCA 3NCIA 3NBPA 1HQEB 2DNOA 1QTNB 1CJTB 2YHAA 3AA9A 4A5AA 4JYAJ 1KRPA 1NGJA 4Y0WA 1TAQA 2X6NA 2NRRA 1M5SA 3CDAA 3IR5B 3ZNUA 5KFHA 1AYEA 4FOIA 4JI6K 2I5JA 4LQ3A 3DOMA 3ONQA 4OZ1A 4PCQA 1BL3A 4FKXA 2BABA 3HDSA 1RAEB 3W66A 1TK5A 1KQKA 3QGGA 4N47A 3P8BB 3BDEA 4DV4J 1T9UA 4JI8J 4UT4A 4UOFA 1U45A 5FPEA 2KVIA 3LDLA 3OFEA 1HJOA 2WSCC 1OO0B 1JNZB 5K8NA 4FVMA 4WQ4A 5D6GA 3FMWA 4GY2B 1TL3A 1JJ4A 5AQFA 5M1OA 1R0AB 1FNMA 4RWTA 3LUYA 3O4WA 3GJSB 4PRFA 4JI2J 3BBFA 2NUBA 3CCMN 1ZA1B 4FCYA 5AE1A 2CG8A 5GVQA 4OZLA 5BN9A 4DX8H 5HVFA 2MPUA 2BR0A 4FF2A 2KI2A 3VAJA 3AOAA 4DV5F 3T5LA 4YR0A 2XLJA 2WOMB 1K8KA 3KFWX 4X66K 5CHCB 4P73A 4CYUB 3CCRN 2A1SA 3ZSRA 4IR1A 3K8VA 3HVTA 3PX4A 1RTZA 2PD1A 3VA0A 3HLUA 1LK5A 4ZCIA 5ETPA 2UXCJ 3EPGA 2XULA 3RBXA 3V81B 4WP9A 1GT8A 1J53A 2P5VA 3BQ2A 4EFAC 1NK0A 2KYZA 3W2VB 4C48A 2RDJA 4CZCA 3CFRA 4F4YA 2L41A 2JL9A 2RMLA 4CK1A 4O3SA 1Q7LB 2IBKA 2HNYB 1QVGM 1IXKA 1Q78A 1N33F 5BRHA 3W8PA 2B9XA 3LP3A 3VGSA 4P2XA 2YWGA 5EY4A 4V1Ak 4O5BA 5HRRA 2Q3SA 2I0XA 3ET6A 2W2MP 4P72A 4E1MA 2RUSA 1TKTA 4DUZK 4M5DA 2IY5B 1FO1A 1SC4B 4DUZF 5JLFA 4USKA 2H54B 3KMQA 2OTLS 3MDFA 2FY8A 3OS2A 2CJBA 1QD1A 2E2OA 1T7PA 4UOCA 3K17A 4NEZA 1XERA 1JLGB 3RB0A 2XGQA 4JD2A 4EZ9A 4M8LA 3HPOA 1I51B 4ILJA 4WJBA 3PFEA 4E0DA 2QC3A 3IG1B 2JC1A 3LAKA 3KDNA 5DM6Q 3KK2B 1WDDA 1HD0A 2WVBA 1VQ7S 2Q6BA 1AZSA 3W0LA 5BPNA 2ZH2A 1BQXA 4AHSA 3H1QA 4K43A 3OSNA 4WCEL 4DX5A 2V6AA 1QM9A 4DR2K 1QAYA 2V2VA 4X64J 4F26A 3KVGA 3MR3A 2G0IA 2NLXA 2MQLA 4WU2A 2JEIA 3DCAA 1BE4A 1A5VA 4ISEA 4GKJK 2OTLN 3QRRA 1YITN 5E5NA 1RT7A 4RUCA 1NPKA 2IA6A 2CNLB 4U7UD 4CGJA 3ATVA 5IM0A 3MMAA 2ZVSA 1R31A 4FZVA 1BI4B 3SBTA 1RU2A 4NO7A 4FOEA 1BQMA 3VQ6A 4TLRA 2CQ2A 2AHOB 3BH7B 4E7JA 1Q1KA 3NNAA 3I0RB 3M4XA 3VAHA 5B09A 4FLUA 4DPXA 2AGPA 3H3OB 1FDAA 2FLLA 2CQDA 4DV6J 1YVUA 3PV8A 4IOCQ 4P6QA 2QTDA 3I96A 4F3QA 4WFZA 4ECXA 3CCEN 2JZ5A 4CBXA 3TEHB 5F8LA 3CXCR 1RE1B 3G71S 2CADA 1O6XA 4IEIA 4FLWA 4B1YB 4QOZB 2ACYA 4H0PA 1QAJA 1Q8LA 4M3TA 4P7VA 1TMMA 3MHYA 4A59A 2ZHOA 1GTEA 5IQQA 1H74A 2BE2A 4WP8A 3TAQA 1SKWA 4AD6A 4E7LA 4I0WA 3A5MC 4FJGA 1XQSC 3GG4A 4ZKAA 3EVMA 1CBKA 3L7OA 5KFOA 3M8WA 1Z2ZA 5F2RA 2A5XA 3HHLC 2DRBA 3BF4A 2IOCA 1C4AA 1I94J 4AM6A 1WHVA 2NREA 1RDBA 5U47A 2V2QA 2BUNA 2AJ2A 5GMEA 4NYFA 4FYXB 5KT2A 4AHCA 1YJTA 3QT5A 5CD4A 5D4LA 3THYA 2VODA 2QLBB 1WN7A 4FJNA 1X4CA 3PY8A 2XO6A 5HVGA 1WG4A 2Z56B 4DCPB 2DGQA 3W9IA 1CC7A 4E2FB 4Y1CA 3CJ5A 2QMWA 4FPIA 2E2PA 1J5EF 3GB0A 1VHFA 5IT4A 4U8VA 1FE4A 3D6FB 2H3EB 3L09A 1YK9A 4LFAJ 2OEKA 3GOIA 1HNWK 4N5SA 1FW6A 2F3JA 3AAPA 4IBNA 5T41A 2PFFB 3SSQA 4MDAA 3RTVA 3QT7A 4ZA1A 3NH2A 4PKDB 4GVBB 3J81U 3I33A 1T6DA 2ZITA 3W9HA 2MEWA 3QSIA 3TNVA 2AQ4A 3K5PA 4DV1K 3TA0A 4DR3F 2H5EA 1CJKB 3S3MA 3AA5X 5AQGA 1S7IA 2CNKB 2QKKA 3S9HA 4BE2A 4ZPTR 2OPSA 3K5OA 2A10A 4KT0C 3M8RA 3LPYA 1IKVA 4CWBA 2EG2A 1HMVA 2R8KA 1TKZA 5SUHA 2JSXA 2RU3A 4WTOB 1JLFB 3RBDA 2C3MA 1OSCA 2VV5A 4U8YA 1IKVB 2O8BA 2H3GX 1RTDA 3BJYA 2FC9A 1NJXA 4MYUA 1GOCA 2XMTA 2MHNA 5F0WA 1LWXA 1HQUA 3KK7A 2WVEA 2BMBA 4KHMA 3T1YK 5KRTA 3D2FA 3TZZA 3FUYA 2Y8WA 1YX2A 1HKGA 1RCXB 2YNGB 4U7CA 1RTHB 3M6UA 2XO7A 4DV7K 1MU2A 4G1QA 4YUDA 3DAWA 3GG0A 1GX5A 4YOXA 4FYWB 3EWGA 4JI7K 1Q8BA 2ACMA 2MKJA 3I4PA 3HKZD 1HI8A 3UB5A 3G4SS 4FK4A 3RAXA 3DOMB 4FJ5A 2JEGA 3A12A 2ITGA 4DMZA 2R4FA 3S3OA 4FN5A 4XH4A 4F4XA 3CWJA 1VQ9S 5FROA 3KWIA 2XS5A 2DR6A 4NEYA 1TTHB 2D1CA 3TQ1A 2ASOA 4LMZA 3AVFA 3FEXB 1V5IB 1YF5L 3RB3A 3ZT0A 3LM2A 2DNRA 1EWRA 1U0HB 5D0RA 4UY85 3FSIA 2OUGA 4QBUA 2YKMB 3WEEB 1HWUA 3BKFA 4S0MA 4C2MA 4JV0A 4ZP6A 1TKTB 5MAOA 1KP6A 4C8KA 2ZH8A 3T5HA 4X4TA 5HQLA 1SXLA 1VLYA 5F8JA 4QCLA 4Y1DA 3FBFA 4JBCA 2G2YA 4LBIA 1ZAXA 2FHMA 2YKQA 2MB0B 4EO6A 3HL8A 3MCMA 3W62A 1EXQA 3J7AN 4DL5A 4KI6A 2CQHA 2AKWB 1KCFA 5E3AA 4ALZA 2B5JA 1WJ9A 3MR6A 4C3KA 3BSOA 1AROP 2Z1GA 1YKWA 2VONA 4NCBA 3C15A 3D68A 3O2IA 5D0EA 2G2ZA 1X3MA 2UUBJ 1HLWA 2OPPB 3OVAA 4DR7K 3CSKA 3FSYA 1O1WA 3HHNB 1RUSA 3CD7A 2DD8S 1BI4A 4ID1A 2AWZA 1OVQA 5AZIB 4LF5F 1FKPB 2CGKA 3NS7B 4K2XA 3JSRA 2LU2A 2A0FB 2VC0A 3ENQA 4DHYA 2J5AA 2BGGA 3S41A 3OR1A 1XQIA 4DFJA 5ETMA 3BDPA 3CF5L 4NYNA 2Z2YB 1AXQA 5IS2A 4KGKA 1JLAA 3A1YG 4B9LA 3IRWP 2W25A 4C3LA 1HD1A 4JNEA 4DV6K 1M1GA 1QQNA 2I1RA 4AE5A 5GAEI 4BRPA 5BYRA 1IKYA 3ZTOA 5C5JA 3FCHA 4O0IA 4HUGA 1MU2B 3DLRA 3EGZA 2EC0A 1OS5A 4Y2MA 1TVRA 1M90O 2DY4A 4BLGA 4CH0S 1UEKA 1WAJA 3EDRB 4RJVA 1ZC6A 1HKCA 4JI0J 5F1XA 4E98A 2DFFA 5A8KA 1GLCG 3MPDA 2QGFB 5CZ1A 1WSVA 2JWKA 5L1KA 1IUJA 1XWLA 2RF2B 2VC1A 4B8CA 2B9EA 1VC5A 4QZVB 1BA0A 4QWEA 1FFWB 4HCCA 1XHZA 2HBMA 5H1SV 4KFBB 4HYKA 4J9UE 3LP0B 2DEJA 3MUTP 1RBVA 3KIOA 2UUCK 3PRBA 3UN3A 3MAHA 2OPQA 2UUCF 2LA4A 2Y9HA 4C11A 1XR7A 2E1ZA 2IIRA 3C66A 2M8DB 2AYMA 1WF0A 2PYLA 4CH1A 3JQJA 4JK7A 4Q5VA 5K8MA 3VPZA 3CCMS 5C12A 2WZ1A 1WB9A 5CZXA 3K59A 1BDGA 4NYPA 3W9JA 1KR4A 1FT8A 1EKSA 4DU1A 5J1EB 1H0HB 1HW9A 4OX9F 1JQGA 2ASPA 2KT3A 2YQ1A 2FVQA 2FLOA 2ZJQQ 5HBMB 1FESA 2I9SA 1BC6A 1TGOA 3LWMA 2VPYB 2V0NA 1RTIB 3QIPA 4L74A 3AGKA 4LQ9A 4CLZA 4ZVTB 4U67L 3HVTB 4AQYF 4GV6A 3VN5A 3EGWB 4CIOA 1FDDA 3MECA 3M2UB 4WU3A 3ZEUB 4CFCA 4OX6A 1J9AA 3M8PB 1Y9OA 4DCHA 3O3HA 5LOQA 3HP6A 3M1FA 2CZVC 3KHGA 2NQPA 4JI1J 3D2FB 3GYXB 2G8UA 1HRHA 4CJQA 4NWBA 3BQ0A 2BJDA 1NOYA 1NCLA 1OY9A 4K8ZA 4EHUA 1OYDA 1XHXA 2VB6A 3QB0A 2LKZA 2VG5A 3MGJA 3VGMA 3HSGA 5D0HA 2HFUA 3Q83A 1SH2A 1FF2A 5A2QO 2C28A 1SJQA 4TYBA 2Z1JA 4LSNB 1P9YA 1KXPA 3NKYA 2P9LB 1JXEA 3QWUA 2XMMA 4B08A 4ZCKA 2D0PA 4W90B 3GZ7A 1Z05A 1PGZA 2Z8QA 1R0AA 3I5AA 3ID6A 1K0VA 4PKGA 1K73T 4BG9A 5LXRA 4P71A 4ZLLA 1TL1B 4DHVA 3R27A 1CZBA 4OYWA 4JI2K 3D6MB 2VL1A 1BISA 1RSCA 5LSLA 1IKXB 3QEVA 2DNMA 4TU9A 2EK6A 1YHQS 4LC9B 1X31C 3ZETA 4GNIA 4IRKA 3G82A 2LSNA 5C24A 1FRJA 3U9DA 3PUFA 4ETXA 4FJIA 4TKTA 2MSSA 3THYB 4OZ5A 2R7OA 1HBUA 3E9LA 4JI0K 3AT1B 2C2RA 4KHWA 2UXBF 1RWKB 2DNHA 2KM8C 1HIYA 5BN8A 1VIXA 2I7NA 4DX6A 1LW2B 2MLYA 2Q1NA 1U1RA 1TKXA 4J90A 3BSCA 3GPAA 3E2EA 4X4VA 4CLPA 4MKBA 1CJTA 5SWMA 3THWB 4W5OA 4PYDA 1AA1B 1S4EA 1HBNB 2Q6CA 3UPFA 4YDDB 2EEYA 3WHIA 2W7AA 2XY6A 1VQOS 4NRTA 5KQDA 4P7TA 4O4GA 2G1HA 2HHQA 2DGOA 4Y2CA 1S7HA 1VQ6N 1VQMN 1F9EB 4BRDA 4RW6A 3KDOA 1HWIA 1U1PA 4QS7A 4FYVB 1NJIT 5HLFA 1IBLJ 2B9WA 1NHUA 3NVMA 1F1BB 1DGKN 1CSJA 3M8PA 4P2FA 4Y28C 3M32A 2QLXA 4E7HA 2FJVA 1KTVA 4EK2A 2PA3A 4IJNA 3N5BA 4DV7F 1ZXOA 4DOZA 5GAGP 1H6KX 1BO5O 4DPYA 4BWMA 3NS6A 4ANDA 2CQCA 1P8ZA 3OYCA 2UUBK 3HHLB 3G10A 2V51B 1SL1A 1N0VC 3OLBA 5AXMA 4O0NA 3MUVP 3RMBA 2AYGA 2N7CA 3M6GA 1FFGB 2HQDA 3BGFA 2MDAA 2YWKA 2MZRA 3WIUA 2KXHA 1RBUA 3HOSA 2YBVA 3VEZA 4OJ1A 3CGIA 2BJ9A 3T1HK 1YRUA 3QETA 2VG7A 4NI2A 2VOPA 5DG9A 1LOUA 5KT3A 3ENBA 1WEYA 2HVZA 4IWVA 3PXGa 2HBZB 3HVAA 2PY5A 2XQCA 2IDEA 2NRVA 1T05A 2QSWA 3QGHA 3AD8C 3R97A 3AH6A 2FGCA 3TUJC 2XYPB 3MWPA 1REGX 2OMOA 1RYRA 4UQTA 5IT9O 1W9HA 2IBOA 1GQEA 5KGXA 3I0SB 4KV8B 1R27B 5BRFA 4B1ZA 1HFEL 5K9FA 1NGEA 3HMJG 2PDAA 3SJHA 1DTQA 3JAMU 4J37A 1OQ3A 3G2XA 4KH1B 1WOPA 3GV5B 2ATQA 4ZVRB 3Q8RB 4ECSA 2DO4A 2IYGA 2VBWA 2MTLA 1NGFA 3O1BA 1RCOB 3FSXA 3M30A 3MMCA 2QFJA 4BR7A 1R0BG 1U2VA 2RPIA 5AE3A 4KI4A 4M63A 2VBYA 2B3TB 3UKRB 3QJLA 2EWSA 2JVRA 1LV5A 4PXEA 1GLAG 4K42A 4FPAA 2XM3A 3VQ8A 1VI7A 4CZFA 3N01A 2E7XA 2HAIA 1YHQN 4KHYA 3LW5C 1NPRA 3JTOA 4DR1J 1E3MA 3QBXA 1XMQK 5C10A 3BEXA 4IO9L 4P10A 2R9LA 4E7IA 4JK9A 3ULEB 1T0TV 1FDBA 3EXCX 4M3WA 4IQMA 5GIOA 4OYBA 3WNFA 3G6ES 3RG6A 4U9RA 3UKUA 1O0PA 1QY7A 5AQNA 4I2PB 4LFCK 2FYXA 4KKOA 3V6KA 2PFDA 5HP1B 2B8PA 3ELHA 2FJXA 2HHWA 1VSDA 2HHVA 5EHHA 2X6SA 3CCLN 2A6OA 1LXNA 4MYTA 3CJ8A 2VG5B 5I3UA 4K4SA 2B9YA 1RT4B 4JI7F 5KAKA 3R7SB 4I9QA 3RVCA 3CJ1A 1W2IA 3TVKA 3Q24A 3QRQA 3C94A 1F60B 1RT4A 3GIIA 5KFZA 4CLYA 3GR0A 3K7RA 2HNDA 1GMWD 2NRZA 2EBEA 4R79A 3UIQA 2F7VA 2QXLA 5B0EA 5CR4A 3PDNA 3QEWA 1RDDA 4NRUA 4DQ8A 1M5HA 2VGNA 3CC7S 4K4ZA 1W25A 2NUUG 3DLEB 2RSQA 2E44A 1UZDA 4F4WA 4OPAA 4CHYA 4HTUA 2IJNA 1ZBFA 1LK7A 2MQPA 3LF0A 1HNVB 2CPIA 4L72B 2HBQB 4DR2J 2QWMA 1HBOA 2RRNA 5C24B 2UUWA 3PSFA 3V9ZA 3X3UA 3OFHA 4DZDA 2MSTA 4M3UA 5A8WA 1U1NA 3E51A 1RAHB 3K8WA 1IKXA 3MMJA 4CZMA 3HP9A 2JLFA 3GDQA 1T95A 3DXBA 5EWFA 2OHDA 2MLZA 1FVSA 1GLBG 4YY3K 4XEIA 4CGHA 5CYMB 4KHNA 5IC4B 2B5JB 2CKWA 2ZJPQ 1RT3A 2OPRB 4RCHA 2G8KA 1SV5B 3OJUA 1VJQA 4KBOA 3VF2A 5KI6A 1Q81O 1W2BR 1NKCA 4ANEA 5DM7Q 5KFXA 5KGWA 1NU0A 1Y0HA 3RRGA 3BYPA 4OGEA 2IHR1 2P9GA 3W7BA 4I6YA 1BCMA 3RJMB 3OVSA 4KRFA 5D4NA 2E9ZA 3NG8A 1B64A 2ZZNA 1QHTA 2IYIA 3LDSA 5CCLA 4L3QA 1RWXB 1OIAA 4H4OA 5AQTA 4L8RB 2K7JA 1Q8IA 3QATA 2PYJA 4B3MF 2GEMA 1CC8A 4JV1A 1K8AT 4JUZA 4KHPJ 3QFUA 3EE3A 1VHXA 4CJLA 1VSKA 4X62K 3TX0A 1RHUB 3OVNA 5AZJA 5C42A 1ZM3A 1NH7A 1VQLS 3EGVA 1T6CA 2V9WA 4G6VB 2I8EA 2DNNA 2QM1A 1R8CA 1XK8A 1UVMA 1Q5VA 2A3ZA 4K4WA 3PX0A 1RILA 4M42A 5LSOA 1VQ4S 3HX9A 1FRXA 1VC6A 4JYAK 4CHZA 2OFGX 3HO1A 4EU0A 3NGDA 3QFPA 1VQON 3M5RA 4EP5A 4U6PA 3SQOP 4DQIA 1Q0NA 4CGIA 1RK8A 5GADP 3CCWA 5B7WA 4DFPA 3DU5A 4BRLA 2CJKA 2GGPA 4B9UA 1GTHA 1PAEX 1HARA 4DSLA 1S97A 3WNGA 3LPEA 3PM9A 3WIVA 2CGLA 4KHPF 4IRCA 2E5HA 5AQSA 3AD7C 5CHIA 3HD1A 1K8AO 2DH7A 3OYGA 1SQFA 4K0KF 4RTFD 2LXUA 1BMQB 2AT1B 3UW1A 2Q0RA 3DLKB 1S1UA 2JEJA 4JD2B 3UFCX 2ILZA 1M5PC 2HWHA 5D4OA 4HVJA 4EUVA 2M2BA 4U7UK 2XCAA 5E3QA 4LSLA 4GVBA 4DV3K 4E8UA 2GQ2A 4QQBA 5L39A 3LA0A 4ILGB 1JJ2M 2Y1IA 2W1BA 4Z7YA 4OYIA 5LMNF 1YTYA 3IMXA 3DRPB 3DN9A 4YB7A 2FZGB 2F9DA 3MN6A 4DU8A 5EOYA 2IA0A 1XNRK 3QBCA 3UDLA 3VAMA 1D5AA 3NGYA 1D4XA 3T19A 3QICA 3T69A 4KRWA 4DPOA 3CJCA 4PL7A 2HQFA 1WHWA 5ETNA 5A2QY 2CH5A 4CJEA 3Q8VA 4Z4CA 5K20B 4DV4K 2M3DA 3D1OA 5DQGA 4ZITA 3PW4A 1RBOB 3N79A 3TAFA 2RQ4A 3D6HB 3AJ1A 3PRVA 2Z0GA 3MCSA 3CUNA 1YZ6A 3HVRA 2B4JA 2HIQA 3ZZTA 4OLBA 5ADXH 2W6LA 1KVBA 2HMPA 3BKUA 3VGUA 1AFIA 2LQ9A 3V9WA 2BV3A 4DV2J 4I6WA 4QWBA 4N76A 4KB1A 5KFEA 2AU0A 4CEQA 2YX7A 1HHSA 4DV0J 4HI1A 3M7VA 4RLEA 3TJ9A 1PO6A 4BC3A 4CHOA 4B3SF 4KTZA 1NLKL 2M5YA 4X66F 4X4OA 1M1KT 3J80O 2CNNB 4IDKB 4EBDA 3DLBA 5HOOA 4LSZB 1URNA 4JKFA 4O8KA 2GO8A 2QXFA 2Y1JA 3A3PB 2XHWA 3I56S 3UD3P 1Z4UA 5KFGA 4KKOB 4LF1A 5KT4A 2E5LF 5DQHA 2O66A 2AJ4A 2CPXA 4ZN1A 4OJGA 3CPWR 3SV4A 2GJIA 3EYZA 2OANA 2SXLA 3DOLA 4CEOA 2HHXA 3EKSA 3MCPA 2HS4A 3MF5A 2IPOB 3H90A 2OO4A 2FLPA 3HYFA 5LM7E 4C8MA 4OYXA 3ULHA 3ZC4A 5DGAA 2MKSA 4BBYA 7FDRA 1F5BA 3A5OC 2A2CA 3R5JB 2Q43A 2CXEA 3CO0P 4HHTA 5ITHA 3TTDA 4MH8A 1NKBA 4CK2A 3OYHA 3PKMA 1C4CA 1EQMA 2BA9A 3BO4A 1FWPA 2DKOB 4OGCA 3NWRA 2X74A 4DN0A 4HI2A 2P9IB 2FD2A 2ROPA 2A42A 2DIUA 2IGIA 3CIPA 4OKJA 4RW7B 3O6QA 1Q86T 2B7CB 3RBZA 5KOXA 2G0JA 2F63A 2RHKA 2ZBPA 4NCGA 1JLBA 4OX8A 3GONA 4HTIA 1UAWA 1RT1A 4ELTA 2WB1D 2YKNA 3MEDA 1FEHA 3FDSA 1KNZA 3QESA 1RKIA 4K8RA 4JN4A 4NZ7A 1OH6A 3B6PA 2PMHA 3OHAA 1ZBUA 1DY3A 2J4RA 2R7SA 1VK0A 4K7QA 3SIPB 3ZZPA 1RT2B 3NEKA 2Q79A 3CD5A 3QINA 1K9MT 4USTA 2KHOA 3OW2R 3FLCO 5KG4A 2G8HA 5AQYA 1JJHA 3WC2A 5FDLA 3P83D 1WSRA 3TJ8A 3O3FA 1KWMA 2W42A 2IVOA 1U26A 4KO0A 4A2BA 2CNOB 3MWBA 1Y3KA 2MJUA 3PJ9A 3OUYA 4FPRA 4HDHA 3TOQA 4KHRA 1P8GA 3JSMA 2YNFA 4ZVOB 2V5HG 2O8FA 4NLOA 3CG7A 3ZETB 4CF0A 2H48B 1NGIA 2ZGZA 1Y11A 1VQKS 1HYSA 3UR3C 1AB8A 5KFUA 3ENWA 1F3VA 1UVIA 2COLA 1N0UA 1W0HA 4X65K 3Q8UA 2DVIA 4JOUA 3PW7A 3MM9A 4OHYA 4JI4F 1ZTWA 4Q45A 2DNGA 5JVGQ 5BYQA 1GOBA 1RDUA 1HX1A 4URSA 4CJVA 3GFYA 3VZHA 2WHOA 3CVKA 1UZHA 3MWTA 2QLJB 1Y64A 2BJEA 1WSEA 4PKHA 2VJVA 3LPTA 3MX5A 1SC6A 1HA1A 2RHQB 3G71N 3HM9A 2HSTA 2R7VA 2V4JA 4CBUA 3OA9A 2I5JB 1N54B 4BRNA 2O8EA 2L08A 4HLBA 3CFOA 1NU4A 3NHGA 2V7ZA 1EETB 4JV5K 4IO9Q 3D7SB 3NF9A 2CQIA 4F2SA 4QU6A 4X62J 3G8QA 3OYIA 2P5OA 1JLEA 2M9KA 1WC6A 4KH4A 4KIAA 1L3VA 3VGVA 4AF1A 5C7PA 4FJHA 1MMDA 3VAIA 2QK9A 2Z2LA 3KJQB 2R7UA 5F8NA 4O8UA 2V34A 2BTFA 1OH7A 4CM0A 3F44A 3MPVA 1EKEA 4JKHA 5AQJA 4QYZJ 1SQKA 4YR2A 3KNAA 3OVBA 4RZRA 4BR2A 1E6VA 3K58A 1KQSR 3TSQA 4QAGA 1RT7B 1NJZA 2VWJA 3BGLA 4CF8A 2RIJA 5FPNA 2E29A 4OKKA 4C1NI 1U8WA 2MY7A 1X5OA 4DCJB 1OWXA 2D3UA 4WQ4C 3HT0A 2I2YA 2KJWA 2ZDOA 3DMJA 4RBVA 1HBOB 1YVFA 2C42A 1WOSA 1RCHA 4NA1A 4OZNA 5JVGL 4HVZA 4YY3J 1Y97A 2PC6A 4FWOA 5BR8F 3VAFA 4CERA 4NZ6A 1C1AA 2KDOA 1N5TA 2UXDJ 1M0SA 1VQ8S 1HNXK 3BM7A 3W63A 4JKBA 4CJSA 4RG8A 4CIEA 5M1PA 3NF6A 1U8SA 5JXSA 4LRCA 3BGRA 2GO9A 3DRRB 2FVRA 3ZSWA 2YXLA 2DBBA 3C95A 1YTUA 4FM0A 2AV5A 1RABB 3U4LA 3IA0A 2V63A 3UNYA 2ZD1B 2WSEC 1S76D 3WXJA 3HPHA 4GRSA 4PUOA 3P45B 3P31A 3FZ2A 5JICA 1KVJA 1VQKN 5KRSA 1VIOA 3W8GA 3PHTA 3QT6A 1VRUB 3MEEA 4DR6K 3MXIA 4PQAA 3LP0A 2H9ZA 1SB6A 3DHWC 1Q9XA 3U1LA 1LAVA 4H4KC 3NF8A 2E1MC 4FWKA 3TAGA 4MO5A 3BR9A 2I7PA 4LRAA 4OX7A 5DG7A 4OHVA 3S6EA 2BH1A 3ZTPA 1KTQA 5KG2A 3GJTB 3ZSQA 1OKJA 4M3XA 3CHWA 3NNCA 4IOBA 2J0WA 3H0PA 2AYEA 2N4CA 2W2QP 5D77A 5DGBA 2Q3PA 3A4TA 3M9NB 3EUNA 4DF8A 2CFXA 1NK5A 1VSEA 3F2KA 4I7FA 4EWTA 4RW9A 2POKA 5FJ4A 2YTCA 1L3UA 2FPHX 3KG1A 2KH9A 3G8SA 1S49A 4ZIWA 2QT7A 4F4AA 1WUAA 4U7BA 1RAJA 2HHPA 3HHDA 1LFWA 4NLXA 3AA8A 1NEEA 4P2MA 2QA4G 1GK8A 4MIBA 1KQFB 5IQ6A 5I9EB 2XRIA 1REVA 1HNXF 4OI2A 4GO7X 3RW7A 3MXJA 1XNQF 2Q36A 4DB3A 1VR6A 1LWFA 4FO0A 2R8IA 2QWNA 3CMAN 4F4ZA 3BS9A 1CULB 2V4QA 2L9WA 1F9FA 4PWWA 3OJSA 3ENVA 3B4DA 5CD4H 3NVKA 1TK8A 1KONA 3AAQA 2Q66A 3V6HA 1PAUB 3ILJA 2BE7D 2HZVA 4CJ7A 2KVQE 2HBLA 2J9DE 1Q95G 3FRYA 8ATCB 2K1RA 3MM9B 3IBWA 2PT0A 1D9AA 1TL5A 1UFLA 2XSJA 2ZHAA 4TNOA 3WXIA 3N6LA 1Q7YO 4A8QA 1EZZB 1GEHA 1NGGA 1XMQJ 1TQLA 2DPJA 4DTMA 3PACA 2XSJB 2MLXA 4M5DB 1T3VA 2RS8A 2PBDA 2WSFC 3L9ZA 2ZBCA 4FNHA 2W2OP 4LF6K 3QGIA 2XI3A 3QDKA 4FW1A 2Y0SD 1EP4B 4R0JA 5ETOA 1PJ6A 2W8KA 3O44A 1HNVA 5GAEP 2CGJA 4CM2A 4J9MA 3OFGA 1BG3A 2JFKA 2G8VA 1HKAA 3MFIA 5ADXA 2QA4N 4BE1A 4NOHA 5CE3A 3DXMA 4A5BA 5DRKA 1VSLA 5EU7A 4WIIA 3CPEA 1EO1A 1J6ZA 3NGRA 3W5ZA 4R8UB 1I6JA 2M0GB 2IVYA 3E3XA 2VFTA 1VQ4N 4USHA 3AA3A 3BY5A 2GZOA 3ZT3A 4CJPA 1WUUA 1IH7A 1LWCA 2ZJRQ 3U3YA 3NOCA 5C2FA 4NLCA 1WNEA 4I6MB 3D2WA 4CO2A 1Q7YT 2X7IA 5FIIA 3QNNA 4TU8A 3BO3A 4O23A 3AVAA 3TR5A 1NZAA 4DPUA 5KFRA 3T1AA 1UL3A 3QT8A 3JAMY 1X5TA 4OYPA 1QVFR 4IOCL 4FWSA 4DV2K 2HRTA 2RHSB 4B3MK 2IJFA 2GQCA 1E6VB 4KH6A 3LM9A 1NAQA 4B17A 2DIVA 4URGA 4DL3A 1QUPA 4M3RA 3VVTA 4IG0A 1VQLN 5HQMA 1CULA 4PG7A 3OYMA 2QWPA 1BQNB 1CLQA 4CEBA 3O9QA 4ZTFA 4OHZA 2IC3A 1KSPA 1FWLA 1RLDA 2GMHA 2W2NP 3MPUB 1WHYA 1N33K 2DHGA 2GVDB 3JS9A 4LF8F 4XH5A 4WQ5C 3G6EN 4USIA 5KFBA 5GAEU 4J9SA 5CZ2A 1HBMA 4M63C 4WCEQ 2E4LA 4MQ3A 2W8LA 5ETKA 2GWJA 2ZC3A 2XWYA 2HKEA 1TFWA 2Z4PA 1OYEA 4OZJA 4G9ZA 4URQU 3U7JA 3AAWB 2LA6A 2E5GA 2QWRA 2DR5A 4XIUA 2P1JA 1OY6A 4QWCA 2P2CB 1ZOTA 3RBEA 3ZNJ1 5AQIA 1ZM9A 2ZZTA 4Q0BB 2UXBJ 2VWBA 1D8ZA 1NBEB 4HHUA 3M2RB 3IBFB 2YNIA 4CGDA 1FRIA 4GKKJ 1NOZA 1DFDA 2D3OR 2IIHA 3GIJA 1MMNA 4J9KA 5KFSA 4QU7A 3QEXA 5F0XA 2RDIA 4OJHA 6FD1A 3LZIA 5HLFB 1U25A 3CYMA 1BA1A 2RKIA 4A8XA 4B8AB 2VHGA 3QLHA 3U9ZA 3THVA 1N5YA 3CXCM 1UMJA 4LR9A 3V4IB 2D1KA 4DV0K 4BRFA 2GIRA 3UVJA 1Y10A 1MW7A 2F40A 2G8IA 3KTQA 3L6QA 3TA1A 1YAGA 1TK0A 3QYYA 1EJ7L 5GIPA 4FS2A 1UVNA 4CNZA 2XHBA 4L3KA 1HR0K 2OTJN 4RR5A 3I4HX 4CIFA 2W7PA 1X60A 1UWAA 2P9PA 2P9SA 2YHYA 4RU2A 2J8AA 3MEDB 2HBJA 3L2QA 4A8YA 1R8BA 5FLXO 4GKJJ 4H5TA 3D6TB 5HRPA 3IS9B 4FJJA 1TYQA 4UF4A 3ZX0A 4I7FB 3GV7B 1LNQA 3L0QA 4NLBA 1S1TB 2ZGYA 4ID5B 1GX6A 2Q1LA 2PO4A 3TI0A 3UE2A 4DR7F 1H72C 3VZIA 1NMDA 3EE8A 3LO3A 1IJEB 3I5CA 3CDBA 3F5TA 1WC4A 5E3CA 2VPXB 3AVCA 1KFSA 2J9DA 2BM0A 1KVIA 4X65F 4ZLNA 2KXNB 1GLLO 2GWKA 2LEAA 4M7XA 2UVRA 4G1QB 3WNEA 4AHVA 3VQPA 1HNIB 3VAGA 1HWLA 1SJ3P 3L7PA 4ECRA 3H5XA 4NXMK 3IN5A 3RUBL 5FLXU 4WE1B 5B0BA 3TPQA 4I68A 4RO0A 1O8BA 4HACA 4YHHK 2UUCJ 1JWWA 5KFCA 3LAMA 5AQWA 1T3NA 3UN2A 3LP2A 1GH8A 2LCWA 2FIUA 5I42B 1MWMA 5LXYA 3GP9A 2VQEJ 2E6LA 4IDHA 1NLVA 3MMBA 1TFYA 2CG4A 2HS3A 4BR5A 3IRXB 2GHWA 2OH2A 1NB2A 1O5JA 2KG0A 4JI0F 4CRJA 2IMOA 2QYGA 1XR6A 2QWOA 1RBLA 5F0UA 4EP4A 2XTJP 2R7XA 3H4DA 2HIYA 1N36K 4OYOA 1SS6A 3DXKB 1ZA2B 2GFFA 3Q8YA 1S1VB 4JKAA 4WYLA 3B8HA 3DDKA 1NDLA 4P74A 4K0KK 4KR0B 3R5DA 4LFBJ 3OTCA 3D45A 4BCAA 2DPNA 4DUTA 1KFDA 2ATLA 4NZ0A 4CO1A 1UKUA 5AQOA 3C3LA 4IO8A 2B0GA 2ASJA 5MLCV 3CMEN 2AMCB 1QQCA 5KFMA 4IKFA 5ETQA 1MROA 4LF6J 1FTRA 5HL7L 2DNPA 4WFBL 3KD5E 1S1TA 2AX0A 4YB5A 1WBBA 1UA1A 4X4PA 2BJ7A 1HNZK 5K14B 2FVPA 4CLUA 4QW9A 5TKYA 4FZYA 4DL2A 1HPMA 4FVUA 4LF9J 1SBRA 1NM2A 5KFVA 3LZJA 3ISNC 4CZLA 1Q18A 3R1HA 5DG8A 1HKBA 3K5MA 2XG8A 5HRNA 1T44A 5AJ3F 1C1CA 1VLOA 1HUXA 3L4IA 3O9SA 3DLEA 1PILA 5BPLA 2YHXA 3UR0A 3GIRA 4WIQA 4XTTA 1VAZA 4DSFA 3J7ZT 2ZOGA 2HLTA 3AA2A 4CJFA 3WDOA 4YN3B 4QIGA 3CE8A 4CESA 3AB2B 4FXWA 5T7LB 1DQ9A 1RACB 1PYTA 3MM5B 3CC7N 4Q8EA 2O8EB 5KFAA 3B6BA 3HVWA 4WXWA 4N77A 5KG6A 4DL7A 3VQ4A 2C1EB 2GIQA 3TSUA 4NI2B 1TUUA 1MWQA 1WOQA 3DDIA 5D8HB 5DZ7A 2AGOA 4YDUA 2OZSA 1X4AA 5H9EJ 3OYJA 4Z4EA 1HPZB 2DRDA 2DCUB 2MHEA 3G82B 3GSIA 5K8OA 4F50A 5AFUH 3J7AP 2PEHA 3EY1A 1XNRJ 1TL3B 3PEJA 5J1PA 5LL6d 4DV4F 2LECA 1RNHA 1EETA 3U1NA 3C16A 3O8WA 4CFDA 2ZWOA 3R7BB 1VRUA 2FVSA 1QJHA 1OVYA 3DOLB 1TKZB 3CB4A 1UPMB 1LXJA 2ZUAA 3GWCA 3QO9B 1JKHB 4NA3A 2BQUA 5KFLA 4GV9A 1S0MA 1U2VB 3OQ2A 1I1GA 2HVHA 2XI2A 4LF9K 2PMZD 1WHXA 3V1RA 1HBNA 4OJ3A 4B3SJ 1TUVA 2V8PA 2NXCA 3CJQA 5H9EK 3QMLA 9RUBA 4DV7J 3N6MA 2HBYB 4HCBA 4DG1A 1KD1O 3UQSA 3OXGA 4IFYA 3BN7A 1KC8T 1S6QA 3C6TA 3THPA 3J81j 3VETA 3HM8A 3RWUA 2DR7A 2BE2B 1YWXA 4ISGA 4IEEA 4USUA 4HUEA 2C2KB 2MQ8A 4JAXA 1FJ7A 3Q7CA 3V6JA 3TAEA 8RUCA 5AXLA 1U0SA 5KFYA 4HDGA 3MX2A 2ITMA 2HB5A 4L75A 3DU6A 1WSGA 3MEEB 1CJVB 3O9UA 1RTJA 1X5PA 1IBLF 1RT5A 3G87A 5AQXA 1Z25A 4FNIA 2DHHA 4D3HA 3SZ2A 1NBWA 2O8CB 1QUVA 4AH9A 4DR5K 4LT6A 3QZ8A 5KFFA 1KLMB 4ZS6A 3PJXA 3T5KA 2ZJQL 4USJC 2W4CA 2BX6A 4WYBA 3PZPA 3RMCA 2GS8A 3UI3A 4EYHB 3K9KA 1VK8A 4JKEA 1V3RA 4OHXA 4JI2F 1YRXA 3DWLA 3U3GA 3MMVA 3LH2S 1JLQB 4DQSA 5A8KB 3MTJA 5DLFA 3CT9A 3JXUA 5JMNA 1XTZA 3VTHA 1RDRA 3O6WA 2WB4A 1HQ2A 1ILYA 4PKIA 4YEAA 2GJ2A 1ULRA 5JVHQ 2WONA 3TZYA 3FZHA 3P96A 1X4FA 2M7SA 1SUQB 1YUWA 4ZVHA 1UPPA 4J9PA 3W5YA 3UDEA 4DPTA 2DYAA 4BR4A