4B3OA

Structures of hiv-1 rt and rna-dna complex reveal a unique rt conformation and substrate interface
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
553
structure length
540
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWVPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQAIHLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Complexes of HIV-1 RT, Nnrti and RNA/DNA Hybrid Reveal a Structure Compatible with RNA Degradation
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/dna/rna
total genus 117
structure length 540
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4b3oA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3oA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b3oA05
1DLOA 4B9UA 1N6QB 2BQRA 3QGIA 4ECTA 3V4IA 3EZUA 3VQCA 4FJJA 1T8EA 4W5RA 3DLRA 3GQCA 1TK8A 3KIOA 3P5JA 3TANA 1HNIB 3DYAB 4B9NA 2F8EX 4DU1A 4KFBB 5L9XA 2FVPA 4JV0A 4JS4A 1S0NA 3SV3A 3THVA 4C8MA 1VK0A 4OKJA 4Q8EA 4X2BA 1HRHA 3LP3A 3SI8A 4KTWA 4O4GB 2AGPA 1C1AA 3VQQA 3RAXA 3CDUA 4QW8A 4HHTA 5I3UA 3TAEA 4ZHRA 3AV9A 3VN5A 4RW6A 3VQ7A 2OPRA 4KE5A 4FS2A 1EP4B 4DTSA 3I5CA 1S48A 3NGZA 1S4FA 4C8LA 1JXLA 4CHNA 4TQRA 2X78A 3OL8A 4Z0UA 1BQMA 3AA4A 2HNYA 4FZZA 5KFZA 4RNOA 1UA1A 2E4LA 1TKTA 3SPZA 3NKYA 1KLMB 1S9GB 2XY5A 3CJ5A 3SZ2A 5KG1A 4B9VA 1KHVA 2JEJA 1D9DA 3QEVA 1NKBA 3PX4A 4J2BA 3I0SA 3O3FA 4KHWA 4AH9A 3KLHA 3NCIA 4UQGA 3V6JA 1RT1B 3DLGB 5KFTA 4CF2A 1QUVA 3GIMA 1C0MA 1BQNA 2HWIA 1RT7B 3L8BA 1N4LA 3C6UA 2JEGA 3LZIA 2XC9A 1C2PA 3N6NA 4WFXA 3ZSQA 3NDKA 5KRTA 1CXQA 2QK9A 3OYGA 3AA3A 4ELVA 3PW0A 5C24B 3G10A 2AJQA 1WNSA 2IA6A 4OPJA 5FDLB 1QAIA 3TAPA 3LDSA 3BGRA 4FLXA 5KG5A 1RTIB 3C94A 2ZQBA 3F73A 1QSYA 4FJIA 3KJVA 4FVMA 4FJ5A 4Z4FA 2HNZB 4WFZA 4DTUA 1Z26A 1TKZA 3QGGA 2PZSA 4BDZA 1C1BA 3T1AA 2YKMB 4KBIA 4KHYA 2Y1JA 3QNNA 4MFBB 2R2TA 3RMBA 4WYWA 3I5AA 3TAFA 2C22A 5K14B 4CEQA 4NZ0A 5DK5A 3C6TB 3M9NB 4FW2A 3S3MA 3OL7A 1IKXB 4U6PA 1T3NA 1C0UA 5KTQA 1GX6A 4IH5A 4ECRA 1VSIA 3KK3A 1CLQA 3HK2A 2W42A 4TSXA 3GIIA 5CZ1A 1TL3A 4ZTFA 3DI6B 3ZT1A 4J9QA 1VRTA 3NE6A 4RW8B 1WN7A 4XO0A 4IRCA 3LWLA 3L3UA 2JC0A 2VG5A 1TK0A 3K2PA 4DTXA 3DLKB 3E01A 4FK0A 1SKRA 4KPYA 3DRSA 1S10A 2ETJA 3T3FA 1L5UA 4FLYA 2O4GA 3TWHA 4F8RA 2W9BA 3OY9A 4EBEA 2F8SA 4M3TA 4TLRA 4K4ZA 1Z25A 2IAJA 2OZMA 5HROA 2WB4A 4ED3A 3CQ8A 4EP5A 5DQHA 3H2LA 4RW9B 2IM2A 1I3AA 1XR5A 4OJRA 3OS1A 2FBYA 3ZT4A 1BIZA 4RUCA 3DLHA 1ASUA 1RYSA 4DWIA 1NNDA 2X74A 1QE1A 1SUQB 3VQEA 2FVQA 4CEOA 4HVJA 4IG0A 3ITHA 3AVFA 1BL3A 4CIGA 3AVHA 3FQKA 4ED1A 4KO0B 4KB1A 4CJFA 1D1UA 4OVLA 3PR4A 3MR6A 3U3GA 2XGPA 1RT6A 4HUFA 3V9UA 4FM2A 2HHTA 1DTTA 2C28A 2RF2B 2AWZA 1S6QA 4B8CA 3AO4A 3OS0A 4YFUA 2DFHA 1T03A 3H5SA 2IM1A 3TAMB 4JV1A 1D0EA 3SQ2A 4FYDA 1J5OB 1R0AA 4M3YA 4LH4A 3NFAA 3KLIB 1NJZA 2VG7A 1W9HA 1JLCB 3V81A 4FJMA 4B9MA 3AVAA 4OGCA 2G8HA 4IDKB 3JSMA 1IG9A 2KZZA 4FJHA 3HL8A 2AGOA 3QEPA 3MEEB 2W9BB 2P51A 2R8KA 2Y1IA 3TABA 1S1TA 4ECUA 5EWGA 1C1CB 5C42B 4OGEA 1IM4A 4ZP7A 4G1QB 2NUBA 5HROB 3FQLA 3OL9A 2HHXA 3QLHB 4CF1A 3IN5A 3HVTA 3E51A 4YMEA 3WNEA 3QO9A 4CEDA 5J2QA 1EETB 2O5DA 1S1XB 2HWHA 3WNGA 1HNVA 1RDCA 1B9FA 3Q8PB 4U7CA 4B8AB 3EPGA 4O5BA 3I0RA 4OKKA 3PVXA 2VG6B 3HJFA 4F3TA 2YNFA 3CJ4A 4CJ5A 4JUZA 4H4MA 4OPKA 2EX3A 2BE2B 1CXUA 3HPHA 2QKBA 4L8RB 4DL2A 1ASVA 3M8PB 1GX5A 2JGUA 4Y1CA 1SH0A 3SFGA 4IKFA 3S3OA 3L2VA 5HRPA 1JLGA 2XI2A 2R8GA 4CJQA 1MMLA 4CJUA 3EPIA 4WE1B 3ISND 4TY8B 3CWJA 4MKAA 3G86A 5KT7A 5KG6A 4PUOA 4H8KA 3RMAA 5JS1A 3D45A 2AX1A 3VQ4A 4DSFA 1ZBLA 1S1VA 3AO3A 2ZE2B 4FM1A 1TKXA 1SV5A 1KRPA 4LSLA 4K50A 4CIEA 3V6DB 2OPQB 4H54A 4BDYA 4HCCA 1HPZA 4Q44A 4CEEA 3MR3A 3ZSOA 3CFRA 4NLXA 4PWDA 3MEDB 3IS9B 1N5YA 4HYKA 1OS5A 4K4WA 4I7FB 3OYAA 3LPTA 2G8IA 2PY5A 4RUAA 1N6QA 3QNOA 2RPIA 3TAQA 1KFSA 1A5VA 1U47A 1L3TA 2IBKA 1X9WA 1HYSB 1EX4A 4CFDA 3MFHA 3I5BA 1HNIA 3DYAA 1YVFA 3CFOA 4KFBA 2FVSA 4KREA 2D5RA 4O0IA 4ZP8A 2QXFA 3DMJB 3ZT2A 3KHRA 5L1IA 4O4GA 4H4OB 1GOCA 3H40A 4FM0A 2FBXA 4ZTJA 3H4BA 4W5NA 3QEWA 2UVUA 1L3SA 2YNIB 1RA7A 2ILYA 1TAUA 2ILZA 5KG0A 1EP4A 2ASLA 5EWFA 3N6MA 3NAEA 2OH2A 1KVBA 3NL0A 4O44B 4E0DA 3DRRB 2YKNB 3AVLA 1RDAA 1WSFA 4Q0BB 2DFFA 3KK2B 3QEXA 4W5TA 5FRMA 1FKOB 3BSNA 1NK9A 3OJUA 5KT3A 4DLEA 4ECVA 2FJWA 4NLQA 1YTUA 4CFBA 4RZRA 1SL0A 3VQAA 2F96A 3DOKB 3NMAA 1YVUA 3QGHA 4YR0A 4CJWA 1KLMA 5C5JA 1S9GA 5KFSA 4WFYA 5HRSA 5KT6A 4WXWA 2XCPA 4F4KA 4F4XA 3MEGB 3G6VA 4ZP9A 2I5JB 3LPUA 2KFZA 4R8UB 2WK4A 4LY7A 1IKWB 1RTHB 2BRKA 4BE1A 2Z1IA 3AVMA 2FLPA 1RT1A 3DLGA 5KFVA 4Y1DA 4IQXA 4W5QA 5KFRA 4CJSA 1ZTWA 4ZP6A 2AGQA 1NKEA 1S0MA 2D7SA 4FBUA 2XRIA 4I2QB 5I42B 3NAIA 2HHVA 4ID5B 1TGOA 1VSJA 1S1WB 5CY4A 1EXQA 3M8SA 3NF9A 3KMQA 2RDJA 1SL1A 3NGDA 4DL7A 2XGQA 2FLLA 1K1QA 5C24A 3OYHA 4HUEA 2O4IA 4FJGA 4GC7A 5FDLA 2D0CA 4N5SA 1ZTTA 4MK9A 1N48A 1D8YA 1FXXA 1RTIA 4KSEB 2OA8A 3NGYA 4FZYA 3RB3A 2YV0X 2HNZA 1RDRA 4KHSA 4QPXA 3ISNC 4DQIA 2X6NA 2XY8A 2HHWA 5KFWA 4M95A 1Y97A 3OYIA 1UOCA 2YKMA 2IDOA 2R8JA 5HRNA 2ALZA 3KHGA 4MFBA 4LSNB 3VA0A 4RG8A 3T5LA 1NKCA 4Y2CA 3TARA 4KB7A 3L2QA 5KG3A 3P1GA 4DSEA 5K14A 2RKIB 4EZ6A 3OVNA 3C6TA 4IKAA 2HVIA 3IRXB 3VQ6A 3AO5A 4I9QA 4ED0A 1IKXA 5F9NA 1BISA 2FJVA 1BCMA 1JLBB 1W25A 1QQCA 3HO1A 5F8MA 3V9XA 3IG1B 3DI6A 1U49A 2DFEA 4CF8A 4AHUA 4RW8A 4Z4HA 1S9EB 4E19A 3SQ0A 4EO8A 5HRRA 1SKSA 5F8GA 3EZ5A 2HNDB 2ITGA 3DLKA 2DPIA 4FS1A 3RMCA 3QIPB 2B4JA 5J2NB 1A5XA 2OYQA 3T19A 4FLUA 4QOZB 4FJLA 4M94A 3MAQA 1SH3A 4IFYB 2D3ZA 3SCXA 4DFKA 1BHLA 1NJXA 1ASWA 3M9MB 3H08A 2ZD1B 1MU2B 2P5GA 2A1RA 3UR0A 3OSNA 4G3IA 3NF7A 1RCHA 3VQPA 4RW9A 1RT2B 2XWYA 3KLEB 2D0BA 2BGGA 4NCAA 2DY4A 1T05B 2W9CA 4K4VA 4DL4A 4HKQA 3C95A 4Q43A 2BQUA 1RBSA 1S1UB 1JIHA 3QETA 1IKYB 3KOAA 3NBPB 2G8FA 4RW7B 2F8TA 4O55A 1SUQA 1RTDB 1LW2B 5KFPA 3LP2B 4FXDA 4RNMA 4EBDA 1HQUB 3M8QB 2VA2A 4ZPBA 4KO0A 4BE2A 4DSLA 4AHTA 3KK1B 5KG7A 1JXEA 3BQ1A 2UVVA 4CK2A 1NK8A 4DTOA 1X9SA 3T5JA 3O3GA 2RF2A 3LAKA 3SNNA 1UA0A 2ASDA 3RTVA 3WNHA 4XPCA 3TAMA 2R7YA 2GIRA 1WSHA 1J5OA 2HW3A 3DOLB 1KCFA 1J54A 5SWMA 4CE9A 4NLTA 4ZMMA 2CKWA 4F4YA 3KLIA 1GOAA 2BRLA 2QKKA 1JLCA 3PUFA 3BREA 4E1MA 3RWUA 4DMNA 4I9LA 4FK2A 4IDKA 3EYZA 2R2UA 2WOMB 4NLDA 4XPEA 3LP1B 4CJRA 4NLRA 3MEEA 3PV8A 1BCOA 4QWCA 1N56A 5D3GB 5KG4A 2OZSA 2XHBA 1C1CA 5C42A 3QYYA 1JLAB 4G1QA 3K5NA 2R2RA 2YHBA 2DPJA 3KHLA 1REVB 4Z4GA 1TL1B 4ECSA 2PYLA 4DFPA 2WONB 4KI4A 3CM6A 1SL2A 3QLHA 4MQ3A 4AHCA 1I6JA 2W9CB 3OS2A 1TVRB 2XO7A 3QESA 1JLEB 4NLUA 1VSEA 2BQ3A 4DEZA 4CHYA 1EETA 1S1XA 4LD0A 3JYTB 2W9AA 4CESA 4B9SA 3AVBA 3PX0A 3QERA 5DG8A 2B43A 2VG6A 4K4YA 2KFNA 1NK6A 3PJWA 5KT5A 4NLVA 1RAJA 1QHTA 4CEBA 3VQ5A 4ZPDA 3WNFA 2BE2A 4FJXA 3RBEA 3DM2B 2XCAA 4RNFA 3M8PA 3SUQA 1VRUB 1QSSA 2OPPB 1B92A 2W7PA 2FJXA 3HHKA 4ECZA 3G0ZA 3PY8A 4WE1A 4TY8A 3CDWA 1ZBHA 3CDEA 3S3NA 1UWBB 4K4XA 2V4QA 4B9LA 1GOBA 4URGA 4HTUA 2ZE2A 2Z1JA 2W8LA 1KVCA 4E7LA 1U4BA 4QWAA 3V6DA 2OPQA 3PW5A 1NK7A 4CK3A 1RILA 4DFMA 4CK1A 4DL5A 2JLEA 4R5PB 4DQQA 3MEDA 3IS9A 3G6YA 3KHHA 1TAQA 2XY7A 4I7FA 3RB0A 4NLYA 2HHUA 3KKRA 4NLOA 1TQLA 3V6KA 3HPGA 4NCBA 2Z1GA 3B6PA 2IOCA 1D5AA 1HYSA 2UUWA 3D0PA 3PO5A 1DTQB 4NLPA 2E9ZA 2WTFA 1XR7A 4RW4B 4KAZA 2XY6A 5CYMB 4ICLB 2VA3A 1JLFB 3DMJA 1WLJA 3P83D 4CJKA 5KFJA 4CJLA 5KG2A 3LP0B 4J2AA 4H4OA 5CYQB 4TYBA 1Q9XA 4OLBA 5L1LA 4PQUA 3S9HA 2YNIA 3AVCA 1ZBFA 3SI6A 1XR6A 4FLWA 2FC0A 4O44A 3DDKA 1XWLA 3DRRA 2YKNA 4DQSA 4Q0BA 3ZSYA 2BANB 3KK2A 3AO2A 4MKBA 3KLFB 3OYEA 4Q5VA 1FKOA 3FFIB 4DU4A 1CZ9A 3V9SA 3H5YA 3DRPB 1RYRA 1S0OA 3DOKA 3OSPA 2YNHB 5HLFB 5KT4A 4Q8FA 1NJWA 3K5LA 5EUHA 3KNAA 3KD1E 1VSLA 4CIFA 3ICLA 2VWKA 3CYMA 3MEGA 4C8OA 3BQ2A 4K4UA 3LALA 1X1PA 2I5JA 1X9MA 4KV8B 4R8UA 1A5WA 2KW4A 3SYZA 1IKWA 4O3QA 1RTHA 1LWCB 4M42A 3DLBA 4YR2A 3OYJA 3OHAA 3OYLA 3QZ8A 2D0AA 3H5XA 1Q8IA 2J6UA 3BSAA 4F4WA 1YTAA 4I2QA 5I42A 4ID5A 4DTJA 1JLQB 1S1WA 4KHNA 3U6FA 2G8WA 2G8UA 3H4DA 4CF9A 1ZBIA 4EBCA 1L3UA 1S9FA 4LQ3A 4B08A 3OYDA 4NLWA 3CJ3A 3PZPA 1KLNA 4DQPA 3AVNA 4I2PB 1VSMA 5KFQA 4ZPAA 5J2MB 5J2PB 3Q8RB 3RB4A 4CHQA 4IG3B 3VQDA 1RT3B 4IH6A 4NYZA 1WAFA 5JXSA 5JUMA 2E6LA 4KAIA 4NRUA 4EO6A 1WAJA 1HARA 2JEIA 5C25B 4PQUB 3V1OA 3F9KA 3BQ0A 1HJRA 4KKOA 4ECQA 4IH7A 4IOBA 4J9PA 1JL1A 3OYMA 1LV5A 3IAYA 3DLEB 4LSNA 5J1EB 3CIZA 1RT5B 4O3SA 4FW1A 4J9RA 2IS3A 5EDWA 2FVRA 5KFYA 1RBUA 3PHEA 4BWJA 2GBZA 2RKIA 4DU3A 1QS4A 2CJQA 4HCBA 1TV6B 5F8HA 1IH7A 1RBVA 4NYFA 1FKPB 3IRXA 4IRDA 4QWBA 5DQGA 5DMRA 1NHUA 3V9ZA 1D9FA 4JRQA 1S5JA 3O3HA 1JLBA 3OYFA 3GIJA 3AO1A 3IG1A 2YNGB 4ELTA 4Y2AA 3D28A 3VQ8A 4AILC 4AHRA 4XIUA 4DTMA 4ED8A 4ECYA 3BSCA 1S9EA 4KHMA 5DGBA 4M3ZA 2P5OA 3MECB 1Q9YA 3K5OA 2IJNA 1HMVB 2G8KA 1S6PB 2HNDA 4IRKA 1KHWA 1CSJA 3QIPA 4WXOA 5J2NA 1XHZA 4RNHA 3Q8SB 4WZQA 4BWMA 3TVKA 1C0TB 4ZVFA 3B6OA 4M3RA 4IFYA 4OL8A 2V4RA 2KQ2A 3K57A 2B6AB 1ZBUA 3QZ7A 4YP3A 2ZD1A 1MU2A 3GV7B 4FJ7A 1RT4B 4PY5A 4E89A 4CFAA 4B3OB 5KGWA 4AHSA 2I1RA 4MIBA 5FROA 1RT2A 1RTJB 3VA3A 3GYNA 3H59A 3KLEA 1LWFB 3NH1A 1T05A 5KFBA 2HHSA 1KFDA 4JS5A 3MR2A 4FCYA 1S1UA 1IKYA 2ASJA 1LAWA 3NBPA 4DTRA 3M8RA 4KKOB 4RW7A 4IFVB 1RTDA 1LW2A 5KFDA 4QWEA 4CGFA 4F50A 4KTQA 3LP2A 1S97A 4CEFA 5KFKA 1HQUA 3TR8A 3RBDA 3M8QA 4N56A 3LAMA 1LWEB 4DL6A 3HPOA 3OL6A 3KK1A 4NCGA 4GW6A 3VQSA 4F2RA 4NYNA 2EC0A 4URSA 2OPSB 3A2FA 4DG1B 4QAGA 3PO4A 1BIUA 5L1KA 3PR5B 4CJEA 2KTQA 3PW7A 1SKWA 2IC3B 1FK9A 4CJ4A 5KT2A 3ULDA 1JKHB 4DFJA 3DOLA 4WZMA 5HBMB 3I8DA 4GVMA 5KFOA 1I39A 3NH2A 3FSIA 4JLHA 3MXIA 3OLAA 2B5JB 2D3UA 5KFHA 3MFIA 3GILA 4QCLA 4K4SA 3SJJA 1BI4A 3KLVA 3HP6A 2HAIA 2UUTA 5KI6A 4B9TA 4FJ8A 3HP9A 4O4RA 4Z4EA 2FLNA 1KVAA 5DG7A 4QW9A 1RNHA 2Q3SA 5T14A 4JV2A 3AVKA 4DS4A 2WOMA 3HVAA 3KLGB 4E7JA 3LP1A 4FLTA 3AA2A 1LW0B 2HMIB 3QIOA 1HQEB 4E7IA 5D3GA 1JX4A 4CGDA 1J53A 5HP1B 3NF8A 1JLAA 3OYCA 4ELUA 4F3OA 1REVA 2ATLA 1DLOB 4OLAA 1TL1A 3PW4A 3KKSA 4R0EA 3V6HA 1Z4UA 2WONA 3V4IB 4ZPCA 4CJPA 4W5OA 1TVRA 4ED7A 4M41A 4YNQA 3UIQA 1JLEA 4FJ9A 2UVRA 3H98A 3RR8A 4C8KA 3V9WA 2D41A 4Q45A 4CEZA 2XI3A 3L2RA 4DF8A 4E3SA 3JYTA 1WSGA 1VSKA 5KFIA 3HVWA 3BDPA 1U04A 3GV5B 2W8KA 4E7KA 3G6XA 5I3UB 4ZHRB 1QAJA 4YQWA 4RW6B 3ASMA 4NCGB 2OPRB 1K1SA 1VSHA 3RAQA 2E6MA 3DM2A 2V9WA 1VRUA 1RA6A 4KB0A 4FJNA 2AX0A 2OPPA 2GC8A 3ALYA 1W0HA 3SFUA 3AVIA 2P1JA 4M45A 1FK9B 3HVRA 1BQMB 1NHVA 2R2SA 2HNYB 3PW2A 1YT3A 1TKTB 3N6LA 3CJ0A 2IM3A 4DSKA 3ZT3A 3T5KA 3SV4A 3PJXA 2LSNA 1S49A 1B9DA 1UWBA 3OYNA 1BI4B 3HT3A 4DLGA 4RNNA 3Q8QB 3NAHA 3I0SB 3K59A 3CJ2A 3OLBA 3QEIA 3RMDA 3KLHB 1XHXA 4J9OA 2R8IA 4KHRA 4O3OA 2HHQA 1U45A 4QWDA 2GV9A 1ZYQA 4TY9A 2BR0A 1BQNB 3NF6A 3ZSXA 4R5PA 1RDBA 4GMJB 3C6UB 4MK8A 1WSJA 3KTQA 4M3WA 5KFGA 2IGIA 4CGGA 1VSFA 4E1NA 3MF5A 4CJ3A 3O4NA 3EY1A 2C2EA 1DTQA 5KGXA 4DTPA 3V1QA 4ZVHA 4RW4A 1RDDA 2JC1A 4CF0A 3BGRB 5CYMA 4ICLA 4PA1A 3TI0A 3KD5E 1JLFA 3T5HA 4CJTA 2E9TA 1HYVA 3CM5A 4K8ZA 3KJVB 4MIAA 3LP0A 4Z4IA 4O3PA 3FRZA 2E9RX 5CYQA 2ZKUA 5DLFA 3MXJA 1TKZB 4HUGA 1C1BB 3TAGA 3SUOA 3SQ4A 1XC9A 2GUIA 4ZVEA 4CEAA 3L2UA 4FBTA 2BANA 4LH5A 1WNEA 3KLFA 2RN2A 2C2DA 1O1WA 3FFIA 5F9LA 1T7PA 2W7OA 4NRTA 3DRPA 5CZ2A 3PX6A 4BDPA 1C0UB 2YNHA 5HLFA 3RB6A 3SPYA 4TYAA 4DF4A 3KK3B 4K8XA 5DG9A 4J2EA 1UAXA 4CERA 2JEFA 1ITGA 3RRHA 1TL3B 4EYHB 1VRTB 4KV8A 4YR3A 5KFUA 3ZSRA 4IR9A 4DS5A 4CGJA 1IO2A 4BE0A 1LWCA 4DL3A 2VG5B 3HYFA 1NJYA 2PYJA 4Y34A 3E01B 5L1JA 3LWMA 4ED6A 3DRSB 1JLQA 3SUNA 4FJKA 1LAVA 1U09A 2QV6A 3HXMA 4EEYA 5F8LA 2IAJB 5F8NA 1U48A 3OJSA 4O3NA 4J9SA 3CG7A 3VQ9A 3O4QA 3RRGA 4I2PA 3NHGA 4Z4CA 5J2MA 5J2PA 4IG3A 4MK7A 2IMWP 1RT3A 3UDLA 2WRMA 1C6VA 4JRPA 3D5MA 2FBVA 4J9KA 4CJVA 1T94A 3MTKA 5C25A 2EHGA 4FZXC 5E41A 1ZETA 1QE1B 4IG0B 1F21A 3ITHB 1K6YA 4URQU 4MH8A 3ZCMA 3DLEA 5J1EA 3HKWA 2J6SA 1RT5A 4LQ9A 1HYZA 5KFEA 5F8IA 1TKDA 3HSTB 1NOYA 1XI1A 4TXSA 1TP7A 3ZT0A 4TQSA 1TV6A 1RT6B 1FKPA 3SQ1A 3TQ1A 3K5MA 4ECXA 3MXMA 4EZ9A 1DTTB 3CFPA 1S6QB 1T03B 3FDSA 3IGNA 2HVHA 1BGXT 3UQSA 4F2SA 4RU9A 1KTQA 2DTUA 5KFFA 2WHOA 5KFAA 1R0AB 4J9LA 2YHAA 1J9AA 2YNGA 2WCXA 5KFNA 4F4ZA 4E7HA 1NK0A 3UPFA 4CGHA 3CO9A 4CFCA 4KHUA 2VG7B 2J6TA 3BR9A 3V81B 3AVGA 2VWJA 1KSPA 3MECA 2C2RA 2FBTA 1NK5A 1HMVA 3JSMB 3OYBA 1S6PA 1QTMA 1JXBA 5JS2A 3LANA 3L2WA 4ED2A 5SZTA 2GIQA 4KHQA 4NLGA 3AVJA 3ZSWA 1S1TB 1C0TA 5EU7A 1SH2A 2FVCA 1WSIA 3QINA 2RDIA 4IR1A 3NGIA 4J9MA 4CCHA 2B6AA 4ID1A 1IKVA 4N47A 4CHPA 1RT4A 2G8VA 4CHOA 3L3VA 2A1SA 4B3OA 4DSIA 5KFCA 3HVTB 4EP4A 4FLZA 1RTJA 4WYLA 3M9OB 1LWFA 3QO9B 1L3VA 3CVKA 3QIDA 3VQBA 5J2QB 1G15A 1TK5A 3ZSVA 1HNVB 2KZMA 5DLGA 3BSOA 3K58A 3I0RB 1WSEA 3V1RA 4IFVA 1QSLA 4CHZA 2V0NA 3HM9A 5EWEA 4BACA 2YNFB 5T7BA 3NH0A 4H4MB 1JL2A 2IJFA 3GV8B 3U3YA 4DSJA 1NK4A 4ZVGA 2IM0A 1LWEA 2AQ4A 5F8JA 4FK4A 5DGAA 3ZSZA 4M3XA 3OHBA 3KMSA 2Z1HA 4N76A 2OPSA 4DG1A 3BJYA 3LZJA 1JLGB 1RBRA 4O0JA 3MR5A 4KTZA 1EKEA 3OYKA 4N41A 4C8NA 4TN2A 4FLVA 2IC3A 4AHVA 3SUPA 2BDPA 1RBTA 2ATQA 4DQRA 4PUOB 4KI6A 1JKHA 5HBMA 4IBNA 4CECA 3GIKA 2X6SA 4OKEA 4M3UA 5FRNA 1VSDA 1S1VB 2B5JA 3IGVA 3H5UA 4CGIA 5DQIA 5KFLA 1TKXB 1CZBA 4K4TA 2HB5A 2QE5A 1SV5B 5KFXA 4LSLB 3RR7A 4O3RA 4KRFA 3KLGA 4NLSA 1HPZB 4EYIB 5KRSA 2UVWA 5KFMA 1LW0A 2HMIA 1HQEA 4PWDB 1N5YB 4GC6A 1IKVB 1RT7A 4Y3CA 5HP1A 2AU0A 2R8HA 4ECWA 4J2DA 4J9NA 3AA5X 1NOZA 4DTNA
chains in the Genus database with same CATH superfamily
4IJNA 4JBCA 1TK8A 3KIOA 1FE0A 3P5JA 1HNIB 2HVDA 2QLWA 3LOUA 3H46O 3DGVA 4ZOSA 2BE7D 4M5MA 4LF6J 5EXWA 3I87A 2YX1A 4KTWA 4B3SF 2AGPA 3S7RA 1C1AA 1U2RA 2UP1A 2NPIA 4QW8A 3TAEA 3VETA 4BGBA 3AV9A 3VN5A 3HMJG 4FS2A 4ISFA 2P6SA 1RCOB 3L7UA 1S48A 5AE3A 4LFCF 4OI1A 2XS5A 4JV5J 1S4FA 2ZM6F 1EX8A 4CHNA 3OL8A 1FNMA 3M6GA 4JKEA 2HNYA 4JI4K 3VF4A 4AE5A 4CLFA 5AQXA 3RUBL 4C3MA 1VGYA 1RAOA 2Q97A 1GAOA 3SZ2A 2LEPA 5ETNA 2OANA 4H5RA 2VU5A 3QEVA 3P38A 4B1VA 3I0SA 3HI0A 4L75A 4BC4A 2MZTA 3EDRB 3KLHA 4AXJA 3NCIA 4OJHA 1I94J 4CF2A 4LF7K 4CZCA 3O8WA 3FRYA 5JMVA 2EWSA 4J7CA 2F7TA 1URNA 4L74A 1CXQA 2CDQA 3W63A 3RRKA 3G10A 2AJQA 1WNSA 4O5FA 4YB5A 2IA6A 4OPJA 2GQ2A 2UUAJ 4FOEA 2R7QA 4JI6F 5DM7L 2BKNA 1S7IA 1RTIB 3VOVA 4A46A 3F73A 5JMNA 2WFBA 1QSYA 3N4QA 1MW7A 4MAKA 2HFOA 3D1OA 4C11A 2HNZB 3N4PA 4WFZA 4MKVA 4WKYA 4DTUA 4GO7X 2DNLA 3A4TA 4KHYA 2Y1JA 3RMBA 2HZVA 4OZJA 4WYWA 1LOUA 3JAMY 5E2QA 5GAGP 4F4AA 5K14B 2J7KA 4YEAA 3C6TB 5HSPA 4FW2A 3NMRA 2K8GA 4FWMA 2F63A 4CH0S 1IKXB 4MLHA 1T3NA 4LFBK 5KTQA 5JVGQ 3IBWA 2M70A 1ZH5A 1CLQA 3NWGA 2W42A 1IV0A 4TSXA 3N01A 3GIIA 1PBAA 3DI6B 3G87A 3BH6B 1WN7A 2A0FB 4IRCA 3UB5A 1XQSC 3GG0A 4IO1A 4YDXA 5M1PA 2NZCA 3K2PA 4BR9A 4CO2A 2HK3A 1URRA 1M5KC 2YTCA 5B8HA 1FDBA 3E01A 4HDHA 4FK0A 3RZAA 4KPYA 3DRSA 2KYZA 1S10A 3OTOF 3BEXA 1U02A 2CPZA 2EFNA 2R7RA 4U7UK 2B7CB 5CE3A 1Z25A 2KXHA 2IAJA 4ZN1A 2F8MA 4K0KJ 5HROA 3B8AX 3H2LA 2J76E 1I3AA 2PO4A 2GQQA 1EQYA 2MMYA 3ZEUB 4NZ7A 4RUCA 3EZWA 5E3RA 2FF6A 1WG1A 4DWIA 3LDLA 2X74A 4DBQA 2V4JA 2BM1A 4CEOA 5E7OB 3KYLA 1RU2A 3QMQA 3FQKA 3CPEA 3B6BA 1UVLA 2CGKA 1D1UA 3IWNC 3G8SA 3PR4A 2K7KA 1DEJA 1RT6A 2BJ1A 3V9UA 1DTTA 4FKYA 3QICA 3Q8UA 4USUA 3MM7B 2IM1A 3TAMB 1D0EA 5DO2A 1J5OB 5IC6B 4JI2J 4M3YA 3D3BJ 4OHZA 4YB7A 4OFZA 1X5OA 2E29A 3D9BA 1W9HA 1NLKL 2BEFA 3JSMA 4FJHA 3NG8A 5T41A 3A5OC 2AGOA 3MEEB 1KR4A 5GAGU 2P51A 2R8KA 3Q7BA 2QIFA 2Y1IA 3QWUA 3TABA 3PEJA 2VHGA 2V94A 1IM4A 4ZP7A 4G1QB 3R1HA 4KH0B 4DCHA 4RBTA 3MM6B 2XZWA 3ZZPA 4C0HA 3OL9A 3CJ7A 5B0EA 1RDWX 2B8PA 2YKOA 4NA1A 3HVTA 3E51A 2XLKA 4NMLA 3ID8A 1FD2A 1GLLO 3PFEA 1KS2A 2HWHA 1HNVA 5TKYA 2HHHJ 3Q8PB 4U7CA 2DO0A 1UVIA 2FHJA 5IT4A 4F3TA 2LQBA 5BXIA 4OIXA 2O8EA 1Q8KA 4OPKA 1FX4A 3SMSA 2MKJA 3HPHA 2CPFA 4L8RB 1VHXA 3M8PB 1SH0A 1DBDA 2MQOA 4USIA 2QEXS 3TO8A 2KT3A 2PMHA 2FTRA 3EPIA 1SQGA 4MKAA 3GB0A 3G86A 5KT7A 2FSNA 4H8KA 4XDCA 5DS7A 2NRRA 4AFFA 3CCZA 1YK9A 3FBCA 1SJFA 2QA4G 1SV5A 3D1HA 2ZH8A 4JI7F 4HCCA 4Q44A 3CC7N 4PWDA 3IS9B 3LA0A 4K4WA 4I7FB 1VQPN 5IT9Y 3CJKB 3OYAA 3LPTA 1E4GT 1N36F 4CLPA 1N6QA 3PNIA 2RPIA 3R3TA 4WFNQ 1PAUB 5EOYA 1NJIO 1A5VA 1Q8BA 3MMCA 1L3TA 1HYSB 5EHHA 1EX4A 3MM9A 3BF1A 2B4UA 4YY3F 3CFOA 4KFBA 1IN0A 4F9OA 2NZTA 3DMJB 3OW2R 4KHPJ 3TRGA 3FZMA 4IEEA 3A8EA 4F3MA 4O4GA 5J1NA 4H4OB 4Y6IA 4FM0A 4DUYJ 4ZTJA 3UE5A 4W5NA 2VQEF 5A6WA 2UVUA 2RRBA 2J9CA 4OHXA 3AY0A 2RQCA 2YI1A 3NCRA 2OH2A 4E0DA 3HFVA 3DRRB 3CJAA 3AVLA 1NGIA 2DFFA 3LH2S 3PSFA 4W5TA 3B8HA 2YX6A 2YXLA 3CC2S 3OJUA 5KT3A 5JVHQ 4CFBA 4RZRA 1SL0A 1KVJA 2YQ1A 4CRJA 1XUPO 1HBOB 1CBKA 3P4UB 5C5JA 1S9GA 1FERA 4LBIA 1RHRB 4DV4F 4LF6K 1NSAA 2XCPA 4PZVA 3G6VA 4FSVA 1XNQF 2P9KA 3LPUA 4FYVB 4R8UB 4LY7A 2DNNA 1NGEA 1RTHB 3TA1A 4EHTA 3DLGA 1X5PA 3OR2B 5KFRA 1NPRA 3UCGA 3T9NA 4DU8A 4P74A 5I42B 3NAIA 1NJIT 2CH5A 2Y9HA 4LVNP 2RUGA 3H7HB 4FKXA 2ERRA 2RDJA 3O2IA 3NGDA 4CO5A 4CLSA 2OJ3A 2FLLA 1KAYA 5C24A 1LK7A 1VQKS 2B7BB 2D0CA 1O5JA 4DV6F 3NCQA 1X4BA 4LFAF 2GHPA 3MMAB 2HBMA 4LRAA 4DXLA 4ZLJA 4NZ6A 2CGLA 3D7SB 3HD2A 3BGFA 3C0BA 4OZ5A 3JTPA 1RDRA 4FL9A 2HBQB 4GKJJ 3NVKA 2YKMA 3GCWP 1Y5IB 4RX6A 2R8JA 1RI7A 3KHGA 3EM1A 4C2MA 2J0WA 1NKCA 2L48A 2RKIB 5A8RB 1VJWA 1UJ5A 4I9QA 1SQKA 1XMOF 4XH1A 2DT9A 2UUAK 1BISA 4TLQA 2FJVA 2MKIA 4OPAA 3V9XA 4A62A 3KDNA 2FXUA 2YQ0A 1O6XA 5ETQA 1ZZNA 2DFEA 4X4SA 4CF8A 4RW8A 4DR7K 1WHWA 2MDAA 4E19A 1V3ZA 3SQ0A 3IM9A 4RU2A 1SC6A 5LJVA 1BHNA 2HSEB 5EX5A 5LXRA 3CCUN 1DGKN 2FGOA 5CHIA 2OYQA 4A5AA 4M94A 3MAQA 2VQFF 4LVOP 1V5VA 3QPIA 4DUZJ 1HBNB 3CNQP 3K5PA 1NJXA 2EFVA 3H08A 1MU2B 1X0PA 4B1ZA 3OSNA 3NF7A 3VQPA 2J8AA 3VGUA 3AOAA 3UR3C 3B82A 4HKQA 2W4PA 1R27B 1GLBG 3W5ZA 3G71S 4NXNJ 2BQUA 1RBSA 1JIHA 1IKYB 1BXNA 5D4OA 3NBPB 3R5JB 1AZSB 2DNRA 3UDCA 2F8TA 4O55A 2B4PA 4X4OA 2QMUB 5KFPA 3LP2B 4RNMA 3TTDA 1HQUB 4ZDNA 2VA2A 1WSRA 4DSLA 2C2KB 2Z30B 4I6WA 4UZCA 3KK1B 3B4MA 1HR0J 2FC9A 4AQYJ 4K0KK 4TU8A 1X9SA 5GADI 3SNNA 5C12A 4P72A 3M2VA 1HBMA 3WNHA 4ZPWR 1M1HA 2YHWA 2ZGZA 2EFOA 3DOLB 4XAKA 5LJWA 3M2RA 1SI9A 3UVJA 2MGZA 3O08A 3FC9A 1GOAA 1NGHA 4IDHA 2BRLA 2DNPA 2CH6A 3PUFA 3THWB 4DMNA 1XK8A 4IDKA 3PKMA 2FHJD 4NLDA 3DOMA 3LP1B 3OBIA 1TUUA 1GLFO 3Q24A 2OZSA 4LFCJ 4R0JA 3K5NA 2R2RA 3ENOA 3E8OA 2P9IB 4DFPA 1F5CA 4IOCL 3NGKA 3CM6A 1SL2A 7AT1B 3OS2A 2XO7A 1NEEA 2Q36A 4NLUA 5AQPA 2XMMA 6AT1B 1S1XA 4LD0A 1VQNN 3JYTB 2W9AA 3OUYB 3VEVA 3AVBA 3FEZA 3HSGA 3LGHA 4ED4A 2VG6A 3N79A 3R7NB 1R0BG 4NLVA 2P9UB 1CJTB 4KJIA 1QHTA 5L39A 3VQ5A 3OHRA 4ZPDA 3M5RA 4FJXA 3RBEA 2MKHA 3IBCB 1T6DA 4RNFA 3BGOP 3C7NA 4CZIA 2OPPB 3L9ZA 1V4SA 4HLBA 3SQGA 3CDWA 3PYEA 3UD3P 5CAAA 3HHLD 1NBWA 3HF5A 4JI6J 2HFVA 3PYDA 4CZKA 1UWBB 2D3OR 2V4QA 4LF9K 2MEWA 3IWLA 4LF8F 1VBKA 3H25A 2FC8A 5D0RA 3MURP 3PDNA 4QWAA 3V6DA 2OPQA 2H51B 3PW5A 1NK7A 2NCKL 4CK1A 1P90A 4FPBA 4H5VA 3MEDA 3G6YA 1AB8A 5DETA 1VQ7S 4NLYA 4FN5A 4M5IA 4FP9A 3ZZYA 2OTLS 4NCBA 3IM8A 9RUBA 5FIIA 1AROP 1N33J 5F1XA 2UUWA 3KZBA 3SBGA 3CIMA 4NLPA 5A2QY 2XY6A 4JD2B 4NXMK 3U1MA 2VA3A 2W2NP 4B1YB 3P83D 2V7ZA 5KFJA 4J2AA 2HHPA 2L08A 4TYBA 1P1TA 4PQUA 2MZSA 3S9HA 2HFNA 3DGPA 4ANDA 2PI5A 2HAFA 2M3DA 1T9UA 1W7WA 2FC0A 5AQFA 1PGZA 4Q0BA 4K2JA 2BANB 5A8WB 3KK2A 1IG8A 3E9OA 2ASOA 5C2GA 4IJAA 3KLFB 3A5MC 4ZN3A 3FFIB 4YDUC 4OZ2A 2KJVA 1CZ9A 3SAGA 4JI1J 1N5QA 2D69A 3ELHA 5ELZA 1RYRA 1O8BA 1S0OA 3DOKA 5ITHA 2YNHB 5HLFB 3PHTA 4ANEA 4CZHA 1NJWA 1H74A 4X64K 1WC4A 2OIHA 3AJ2A 2MZ1A 1B3TA 3MEGA 2CPXA 3BQ2A 3QBWA 4C4WA 4LIRA 3M1VA 1A5WA 3AY9A 4DUYK 1IKWA 2COLA 4O3QA 4K43A 3DLBA 3OYJA 3TX0A 3QRPA 3OHAA 3LM9A 3OYLA 1VISA 1NNEA 4UOFA 4PG8A 3H5XA 3L4IA 4WK1A 1TYQB 1K8AO 3SBTA 3W9JA 2JL9A 4F4WA 4BVPA 1FNOA 1HL6A 4WTYA 1FJ7A 4ID5A 1S1WA 1WC3A 3TSQA 4FNIA 1WHYA 2P9EA 4EBCA 1S9FA 3OYDA 1GXUA 2BX6A 3WC2A 5M2RA 4M7YA 3BN7A 4MMOA 1KLNA 2ZBIA 4DQPA 4FXVA 4I2PB 1H2TZ 4ES2A 5J2MB 5IV4A 4CHQA 1IM6A 3VQDA 5JJBA 2ZKTA 1RT3B 4C98A 4NYZA 1WAFA 2HLTA 4EO6A 2G2OA 2PIIA 3QFHA 4EIAA 3V1OA 3F9KA 2QA1A 4CNYA 2R7TA 1M5PC 3HHLC 2DRAA 3T1YF 3BKFA 1BD6A 4IH7A 3SAHA 3NGRA 4J9PA 3OYMA 4LSNA 2ZOFA 1Z2LA 2G2ZA 5EX0A 4HI2A 1RT5B 4BWJA 1E6YB 3LDPA 1QS4A 2XULA 2I6WA 4AL6A 3BKUA 3MM8B 1FKPB 3IRXA 1PCAA 4QWBA 3O9RA 5DQGA 1VQ6S 4U7UD 4XH5A 1D9FA 3O3HA 2HFUA 3OYFA 8RUCA 3AO1A 1BY9A 4Y2AA 5LMNJ 4K25A 4DTMA 3MPVA 4ED8A 1S9EA 2ZZTA 1WTFA 4GKJK 2LXUA 4M3ZA 1VRQC 2QL7B 5LMUK 2P5OA 2DHGA 1X4DA 2IJNA 3F0NA 3CQYA 2G8KA 3NS5A 3JAMU 3D2FB 2ZC4A 1E3MA 2QGFB 3J7YI 4ZVFA 4M3RA 4IFYA 2V4RA 3ZZTA 3IO1A 2LXIA 3AAPA 3G2XA 4YP3A 2GCFA 5C15A 2FJBB 2Q79A 3ATVA 4FJ7A 1RT4B 3TOQA 1SJRA 2H48B 4CP5A 3CHWA 4FYXB 5KGWA 2HRUA 3OA9A 3GYNA 3HHLB 4OYWA 1LWFB 3NH1A 5L9NA 5FD1A 2HHSA 5I9EB 2OD6A 4FCYA 5IXUA 4FDFA 3RSEA 2ZWHA 1BC6A 4RW7A 2ZH4A 1LW2A 4F50A 4BCAA 4BG8A 3EICA 4JI7J 4CT8A 3RBDA 4N56A 2GMLA 3LAMA 4ZJQA 4H0OA 3ETMA 4DUZK 3C15B 3AB4B 2P5VA 3IMXA 2WBNA 3JQKA 4NYNA 1S12A 2OFGX 4URSA 3A2FA 4QAGA 1FKAF 5BR9A 3PR5B 3FGUA 2ZFHA 5GMEA 2IMOA 2RHKA 4XTTA 1UVNA 3QGPA 4YY3J 1CC8A 4ZVPB 2ASPA 2LEBA 4NXNK 3VWSA 3W7BA 5KFOA 1YJ9S 4JLHA 3GR0A 2UXDF 2V2ZA 4K4SA 3KLVA 2J9DE 3R5AA 2DVIA 4B9TA 1WSVA 4BRMA 3ZO7A 3CCJS 3HP9A 5DG7A 5T14A 1D9AA 1H0HB 3CMES 3ZETB 2XTJP 2HMIB 1TELA 2VZ9A 2Q66A 3QIOA 3TW0A 5D3GA 1CJKA 4CGDA 1NMDA 3VEZA 1JLAA 4ELUA 5CQGA 1WWHA 1R43A 4G1IA 3KKSA 3V6HA 2UXCF 2K3KA 3O8MA 3V4IB 1P6TA 5AQTA 2V6AA 3POTA 2NYIA 2CDRB 4CJPA 3QJJA 1K9MO 4ED7A 2IHR1 1IJEB 1JLEA 4FJ9A 3H98A 3V9WA 2OMOA 1FEEA 5HQMA 1XNQJ 4B3SK 1WBBA 1LQ9A 3GV5B 4ZLNA 1JJCB 3N0VA 4EU0A 5AQKA 4FWRA 2O8BB 3W2VB 4YQWA 4RW6B 3D1QA 4GV6A 1HX1A 4LFCK 1VSHA 3J7Z5 1Z1ZA 4KH1B 5D4NA 3Q7CA 2ZM6K 4QBUA 4OYZA 3HLUA 1VRUA 4KB0A 4FJNA 2HMPA 1XC3A 5TKWA 1HJOA 2GC8A 1T9WA 2K1RB 2C42A 3HVRA 2C2MB 4W90B 3PW2A 4UY85 1TKTB 3N6LA 3TVZA 4DSKA 2IRUA 3L7OA 3O44A 3N5BA 4LFAJ 3H1QA 3VZHA 2HEKA 3VAMA 3OYNA 1BI4B 4DLGA 4CZLA 2G0JA 3BF4A 3OLBA 4OLOA 2O67A 1E4FT 2FDNA 2LVWA 3BS9A 1HD1A 2QTDA 4Z37A 4J9OA 1H3DA 1BUPA 1YRUA 1UVMA 1G4CA 4O3OA 2ZHBA 2JFKA 2Q0RA 3HSCA 1HI1A 3PLAA 2KKZA 7FDRA 2YQ3A 1BQNB 4I6AA 1WC5A 3ZSXA 4RO0A 4PR6A 4GMJB 3C6UB 4ES3A 1R8CA 4M3WA 1GXLA 5KFGA 2MSTA 1CQMA 3C3LA 1T9XA 3CD7A 2G2YA 4WP9A 4DPXA 2JX2A 4DTPA 1HHQA 3W8PA 1U24A 4USVA 4ZVHA 3BO4A 1RDDA 1JLFA 3UKUB 3BUZB 3CM5A 4YB1P 2DIUA 4FVUA 3WQTA 4CLUA 4Y0FA 4OYIA 5HL7Q 2KH9A 2ZKUA 3L6QA 3JAMO 3AGKA 1FRKA 1KVIA 3VEYA 3SUOA 3SQ4A 2HBLA 1N34K 3U1NA 5IT9U 4CEAA 4TNOA 2DGVA 4O8KA 3DXSX 2DEJA 3O5BA 3OVAA 4LH5A 3QB0A 1WNEA 4EFAC 1F1BB 4OJ3A 2VQFJ 2C2DA 2YH1A 3DLLL 1WC0A 2QEXN 3GG4A 3PX6A 1BWVA 4DX6A 2PDAA 1F60B 2RHQB 1UAXA 4CERA 1ITGA 5D8HB 1TL3B 1ILYA 3GJTB 3FZBA 2UYTA 1YIJS 3ZSRA 1UFWA 4IR9A 1HWKA 4DL3A 1AYEA 1U1NA 4Y2MA 2H5EA 4GVBB 4DR3K 4MKYA 3J8AA 1UTAA 2CA9A 3OTOK 2V51B 2HSTA 3PIOL 4FWSA 2AV5A 3SUNA 2A42A 4Z2XA 4XEIA 4DCJB 1Q7YO 3A12A 2FZGB 5F8NA 4LF4F 1R7IA 4O3NA 2BBEA 3CG7A 3VQ9A 3DNCA 3RRGA 2X51A 4Z4CA 3HZ6A 4DV3J 4MK7A 4DR5F 2IMWP 3UDLA 2QSWA 1FWLA 1X8DA 2QM1A 3PACA 4C8YA 1T94A 2IPOB 3K89A 5E41A 1NDKA 1LFPA 1ZETA 5DDOC 1JCGA 1MROA 5JLHA 4MH8A 4BRLA 5J1EA 1HYZA 5F8IA 3ZZOA 2OTJS 2PEHA 1NOYA 1TP7A 2HK2A 1L3KA 3I82A 2VBYA 4IOAL 3TQ1A 4ECXA 3CFPA 1VIXA 1S6QB 1VQ8S 3CC2N 3FDSA 5IWAJ 4CBWA 2OP5A 2DTUA 5KFFA 4OI4A 2WHOA 1R0AB 4UW2A 6FD1A 5D4PA 2CQGA 2GTDA 3R7BB 5BREA 3MAHA 3UPFA 4CGHA 3WX4A 2KN4A 4U8VA 1ZA2B 3P45B 2VG7B 2J6TA 3V81B 3AVGA 2E1YA 1KQSM 2VYPA 5BRDA 5M2PA 1JXBA 5JS2A 1RBAA 1Q7YT 4P2FA 3I31A 4CDIA 2FHOB 1CVJA 5EU7A 5F0WA 3QINA 3NGIA 2NQPA 1Q0NA 5K5MA 4KGMA 2HS0A 2B6AA 3MUTP 1A0OB 4ID1A 4CHPA 3M2UB 2G8VA 3L3VA 4DSIA 3RBXA 3IAM9 2OUGA 1VQKN 3W64A 4BRFA 4C1NK 1OQ6A 4B17A 2LFVA 2LECA 4BS2A 1YWXA 5J2QB 3T41A 4I67A 2KZMA 4OI0A 3V1RA 1QSLA 4OZ0A 3HM9A 4BACA 3PEHA 1ZOTA 2YNFB 1H6KX 1RHJB 1NMNA 5T7BA 3CI5A 1RCXB 4HT5A 4ZLPA 3DN9A 2DIVA 4ZVGA 4KH4A 4RUHA 2ZGYA 2DRDA 2MZQA 2AQ4A 1XNRF 4FK4A 5DGAA 1VOMA 4M3XA 2E5GA 1EHWA 3FSYA 2QFJA 2KRRA 3LZJA 3VHQA 1RBRA 4O0JA 2VFVA 4KTZA 2NXNA 4B1WB 3OYKA 3CW2C 1VBZA 4C8NA 2DB1A 3TA0A 2ATQA 2H3EB 4DQRA 4KI6A 1JKHA 5HBMA 4WQ4A 2UU9K 3GIKA 2RVJA 2BACA 3HRGA 1PJ6A 4M3UA 2KM8B 4K59A 5KFLA 2HB5A 1F9FA 4LSLB 4JI7K 3NGUA 5IT9O 1XJWB 1TFYA 3CDBA 1TUGB 1FJGF 2Y8YA 1HNXF 4WIIA 5IC4B 3PG9A 2AYBA 1OH7A 3HDSA 2LCWA 1IKVB 3H45C 1C0FA 1N36K 4PXCA 4M5DA 1WKKA 4YY3K 2HVZA 4DU1A 2DHXA 4ISGA 3QT6A 1NGAA 3THVA 4C8MA 1VK0A 4N8OA 2KL8A 1JXVA 3G71N 3QT7A 3PKYA 1MWQA 3M4XA 1VLYA 2VQEK 3EMTA 1NBEB 2GGPB 4HHTA 5I3UA 2XO6A 2KI2A 2OPRA 4KE5A 1RFQA 4PG4A 2O8CB 1EP4B 2QG9B 2KO1A 2QW9A 2K2PA 2YX4A 5M1QA 3F5TA 2GNKA 4TQRA 1OJ4A 2X78A 3ZZUA 3BR8A 1FF2A 3Q2SC 3MHYA 3OXGA 4RNOA 1UA1A 2PMWA 3GJRB 2E4LA 3KJQB 2YH0A 1KLMB 2P9PA 1K47A 5K9FA 2XY5A 3KK7A 4DV4K 5KG1A 1WF1A 2Q3PA 2JEJA 2HYIB 1NKBA 4NI2A 3AAWB 4JKGB 1RT1B 4WWSA 5DZ6A 3T1YJ 1RT7B 3L8BA 4P6QA 5B0FA 3LZIA 4X4TA 2XC9A 3N6NA 1JNRB 3OT9A 4EK2A 2CNOB 1FDNA 1FRJA 1OSCA 3THYB 4I6YA 5G4DA 2O1PA 3OV7A 2WVEA 3KJFB 3OPKA 2GO8A 4DV6K 5FDLB 4GKKF 4LFAK 1QAIA 3TAPA 3L0QA 2LQ9A 3BGRA 4HACB 3KNGA 2V50A 1S72S 4NMXA 4FVMA 5FLXO 4Z4FA 4I69A 3K2YA 5FPMA 5AQQA 3SSQA 3HOSA 1C1BA 3T1AA 2HLUA 5E0OA 4CLYA 2R2TA 4XDDA 2UUCF 3I55S 3I5AA 2CPJA 1X3MA 4H0YB 3K9JA 4A2BA 5DK5A 4X65J 3KG4A 5GAGI 3S6EA 4DR2F 4WF9L 1XMOK 2VC0A 3HOTA 4Y28C 4U6PA 4FZVA 1H2VZ 1C0UA 5IV3A 5A2QU 1RAGB 5CR4A 1GX6A 3UCZP 2WVCA 3E3XA 4ZCKA 3KK3A 3HK2A 3Q2TC 1NDLA 2JLGA 2KG1A 3DWLA 5CZ1A 4O8UA 3ZT1A 1FRXA 4J9QA 1OY6A 1KOOA 4XO0A 2U1AA 4M5KA 5T7LA 1H72C 2IIHA 4JKCA 3VGVA 1RAEB 2VG5A 3C46A 2F7VA 4U95A 3D2EB 4WQ5C 3DLKB 5M1FA 5KPRA 1SKRA 1F5BA 2ETJA 3VCDA 2O4GA 4F8RA 2NUHA 3J7ZO 3NVMA 2W9BA 2ZF5O 3OY9A 4NA2A 3TWZA 4EBEA 1RGIA 4A8YA 2MKSA 5KQ8A 1VQ7N 3ZC4A 4M3TA 2OTLN 2OZMA 1CJVA 2WB4A 4QR0A 5DQHA 3GU0A 2ZH7A 2XB2D 2UXBK 5F3ZA 4Q2MA 4OJRA 1GMVA 3TTFA 3OS1A 1YSJA 2XWXA 2FBYA 2IIRA 2GJ2A 4K7QA 1BIZA 4C6AA 1ASUA 2UXDJ 1ROFA 1N5TA 2IVMA 3OTEA 2XNRA 1QE1A 3A3PB 2MPUA 5LSLA 4HVJA 2HS3A 3ULEA 3ITHA 2HFSA 1WI6A 2Z2LA 2CGJA 3CD0A 3W0LA 3R6GB 4CJFA 3NWRA 3U3GA 4NLBA 4B3MK 4FM2A 4CD3A 2RF2B 3FEXB 2C28A 3DLJA 3VF2A 4YFUA 4JI5F 2DFHA 1T03A 1T9YA 1PBUA 3UW1A 1TL4A 4FYDA 1S59A 1XMQK 1RDUA 2WSFC 3MMBB 4H4KC 3A13A 3R3LA 1FTRA 5ETVA 4V19X 4FJMA 3AVAA 2XG8A 2CQCA 2IDEA 2KZZA 2DCLA 1QAYA 3FGVA 3N4WA 1S1TA 5GVQA 4ECUA 5EWGA 1C1CB 2VOOA 5C42B 4OYXA 4OGEA 5HROB 2WVBA 4PRFA 1K8KA 4CF1A 3H2UB 3IN5A 1UEUA 2E8AA 1MNEA 3UNYA 2AJFE 3WNEA 3QO9A 4CEDA 3TTCA 1X4HA 2RT3A 3GG1A 2GEMA 4CBXA 3DC2A 2E2PA 3WNGA 1B9FA 2BW7A 2LMIA 1R8HA 1FWKA 2FSJA 4O5BA 4OKKA 1U0SA 1G3OA 3CCTA 1RKJA 1K0TA 1GTHA 1AT1B 4H4MA 3WXMB 5IT0A 3CF5Q 1WDTA 4MDBA 5BN9A 4WP3A 1CXUA 5CA5A 5ETPA 4I68A 4FO0A 4OI6A 2J7UA 1CS4A 5C2CA 4CYUB 3VENA 1AUSL 3G4SS 3QAUA 2CJAA 3MWBA 4CJQA 1SKUB 3ISZA 3BZKA 2P8IA 4CJUA 2GIFA 5BR8J 1K44A 4DV1F 1OYEA 3ISND 1VQ6N 1R3NA 4PUOA 2ATCB 4RBUA 3D45A 3G82B 2JRSA 4LF8K 1S1VA 3AO3A 2H5IB 4QS7A 2GVDB 1WD6A 2E1PA 4F04B 5F2RA 1RXOB 4IYQA 2JWNA 3SAFA 4CEEA 3D2WA 3ZSOA 2YCHA 3ENWA 1Q4RA 3IAS9 2G1DA 4JV5F 1VIOA 5A2QO 1YHQS 1KFSA 3UD4P 3VAHA 1U47A 2WW4A 2EXUA 2IBKA 1RADB 1HNIA 1ZC6A 2FVSA 1I51B 4KREA 2O8DB 3LW5C 2KKHA 2POKA 2QXFA 1IQTA 5AQWA 5L1IA 2V2QA 2IYGA 4D3HA 3H4BA 1UVKA 3D66A 4QIVA 2YNIB 4O23A 1XBWA 2ILZA 3MD1A 5EWFA 1SQFA 3NAEA 3NL0A 4O44B 4F67A 3QMLA 1ZA1B 2KHOA 3S1TA 4NWBA 4A8QA 1VQ4S 2BE9B 1N8RT 4DR1K 2FJWA 2BW2A 4LF4J 3VQAA 2BJEA 3KHYA 5A6PA 2HG4A 4YR0A 2NRZA 4CJWA 1IBLF 4H5NA 5HRSA 3X1LB 5KT6A 2RB7A 3JB9k 4F4XA 4DR5J 3HD1A 3L7PA 3VGMA 2I5JB 2A10A 4B3RF 2VV5A 1WI8A 1YJ9N 2ZJPQ 2NZ4A 4FYWB 1CZAN 3TX8A 4IQXA 4A59A 4RTFD 1NKEA 4FBUA 3F41A 3T6JA 4WP8A 2F40A 2WBRA 3FFKB 3CMEN 3WQPA 2E5JA 3K0JA 4WKRA 1Q7LB 4DL7A 4QIGA 1K1QA 3FMWA 4A8XA 4HUEA 3GFYA 2O4IA 3M32B 2CUYA 1GXTA 4GC7A 4DCOB 4N5SA 2ALYB 3IBFB 3WQUA 2KHCA 4DOZA 3AJ1A 3LQVA 1RTIA 3P6YC 1IBMK 1XIQA 1YJTA 3RB3A 5B0GA 2HNZA 2YV0X 2DHSA 2IVOA 2Y0BB 4KHSA 2ABYA 4QPXA 3ISNC 4DQIA 3FJ2A 2HHWA 5KFWA 4LBPA 1Y97A 3OYIA 2L41A 2IDOA 5HRNA 3JQJA 2ALZA 3HSDA 2GHWA 3M6VA 3O4WA 4QIWD 2VFTA 4Y2CA 3TARA 2O66A 4Z7YA 3ZZRA 3P1GA 5K14A 4EZ6A 1CULB 3C6TA 1Y5NB 4Y65A 1NRKA 1UEKA 4E8UA 2DBBA 3C6HA 3WEEB 4ED0A 1IKXA 2V8HA 5F9NA 1Q81O 1KVKA 4WCEL 1JLBB 5F8MA 2ZJRL 1QVGR 1YZ6A 3JSYA 3DI6A 2CPYA 1U49A 4Z4HA 1PC5A 3H3OB 4EO8A 5I3QA 4C9DA 2W4DA 5F8GA 3D68A 2HNDB 5ETOA 3L3CA 4FS1A 2ZJQL 2XYHB 3BH7B 1A5XA 4HEA9 3T19A 4F36A 4FJLA 1VK8A 4YHHF 1M1GA 3JTOA 3ZX3A 2AYMA 2EEYA 3MPUB 3SCIE 1GTEA 3M9MB 2ZD1B 3THTA 2A1RA 5K8MA 1FRHA 1PIEA 4LF1A 1QHAA 1D09B 4M5NA 2Y3YA 3NCPA 2W2MP 2ZDPA 4WFBL 5DRKA 2BGGA 2D0BA 2DY4A 1T05B 1F2GA 2W9CA 3ZEUA 3C95A 4UOHA 4JI2F 1GNKA 4JHDA 3A8JA 2ZC3A 4JOUA 2IBOA 1IJFB 2G8FA 4W4MA 4EI2A 1W26A 3CCMS 4H0XB 1OPZA 3MM5B 1R31A 4ZPBA 1HNXJ 4AHTA 1YJNS 2R7SA 2KT2A 1JXEA 3BQ1A 3G25A 3G6ES 2QL5B 1HBUB 4FF2A 3R7SB 3I32A 1Q86T 3T5JA 3QWPA 2VDHA 3RTVA 2D1KA 4BQZA 4EAHD 3MM7A 5AR0A 3TAMA 4X66F 4OI3A 3Q83A 2L9DA 1J5OA 4JN4A 2HW3A 1KCFA 3GSDA 3EKUA 4DV2K 5H9EJ 5SWMA 1NHKL 2E7WA 3GSIA 2UXDK 2DD8S 4ZMMA 5ETKA 3ZLJA 2LP4A 4E1MA 1YIJN 2QWQA 2UUBF 4FWOA 1M0SA 3EYZA 2WOMB 3R9LA 5KPTA 2WZ1A 5CCLA 1RHMB 3MEEA 1CPZA 2NLXA 1N56A 3M8YA 1N32F 1EZZB 5KG4A 8AT1B 5KPZA 2XHBA 2GV1A 2MJNA 4Q2LA 5DM6L 4G1QA 1YBTA 3QJPA 2X1FA 1TL1B 4AT1B 5LSOA 2PYLA 2UXCK 3MM6A 4DN9A 3CUNA 5BPMA 1RWUA 2BYCA 1TVRB 1ZAXA 1ATSA 1VSEA 2BQ3A 4DEZA 4CHYA 4K5RA 3FSXA 4CESA 3OQ2A 3PX0A 2RE1A 3QERA 1BE4A 3SQOP 2UV8G 2KFNA 1NK6A 4KIAA 3KWGA 2B9WA 5GINA 2FZKB 2EWHA 2CWKA 1PSDA 2W40A 4YOWA 2FD2A 1QQMA 2F5GA 3DM2B 3M8PA 2OTJN 3A8IA 3LDQA 2G1HA 1VBXA 5GAEI 3C14B 2BKPA 2CRLA 3CCQS 4ECZA 2D74B 4IUFA 3PY8A 4H0PA 4ERDA 2RQ4A 4IFEA 3IKMA 2MTLA 3H20A 1VQ8N 4JI3J 1ZBHA 1VLOA 4GKKJ 4JYAF 4U67Q 2CVEA 3TSUA 2XMTA 3CJ8A 1JWWA 1ICEB 2I7NA 4AF1A 2HGLA 4X4RA 1GOBA 4HTUA 2GWKA 4NYOA 4L3NA 4E7LA 3DOMB 3P31A 3ILOA 4QYZK 1WC6A 2UUCJ 1YRXA 1OY9A 3IS9A 4OHWA 1DKGD 2XY7A 4I7FA 1BU6O 4A8FA 2CPHA 3CJKA 3KKRA 1RWKB 2CQ2A 1JQGA 1G99A 1VS3A 2DY1A 1D4XA 4J37A 4DR2J 1AFIA 1O0PA 1HYSA 3JS9A 1KD1T 4TU9A 3JS6A 2WTFA 4RW4B 4A61A 2RNEA 5CYMB 1IR0A 1NH8A 4N7TA 3R5DA 3DMJA 4MJKA 4P52A 3GR1A 1ZPVA 4DPUA 3O1BA 4H4OA 5CYQB 1QTNB 2J8SA 1Q9XA 2RD5C 1NGDA 2NNWA 1MN9A 1ZBFA 1U6FA 1XR6A 5AQZA 4IO9L 4EUVA 3DRRA 4DQSA 3ZSYA 3H0PA 2EK1A 2J9DA 3CMAS 1GLEG 4Q5VA 4DU4A 3GJSB 2CQ0A 3H5YA 1X4EA 4OPHA 5KT4A 1HBOA 3Q23A 3KD1E 4CIFA 2AD9A 3ICLA 5G0RB 2V8DA 3TUIC 4DU7A 1F3FA 3LALA 4AM6A 2NPFA 4KV8B 4R8UA 4HI1A 3SYZA 1RTHA 1LWCB 4YR2A 1ZXOA 4RWXA 3RW7A 5BPLA 3OR2A 1Q8IA 2M0GB 2QJ3A 1X4CA 3CCWA 5IQQA 5I42A 1MWYA 4DTJA 3J80Y 1JLQB 1YJ7A 1NM1A 3U6FA 3HTVA 4BG9A 2G8WA 4UZBA 3U9ZA 4OQJA 1FRIA 4LF4K 1Z2ZA 1LOTB 4JI8J 3CJ3A 3D3CJ 2BXJA 5AJ3J 4JI5J 1VSMA 3MMAA 4DR5K 4IG3B 1J5EK 4PL7A 3FK4A 4IH6A 5JUMA 1WAJA 4PQUB 2I2YA 3UO0A 4RJVA 2RHSB 1RJJA 2GFFA 4J9RA 2IS3A 2FLOA 5KFYA 1RBUA 3PHEA 2GBZA 3G9CA 2RKIA 4F0KA 3H90A 4DU3A 3WC0A 2RQMA 4U7BA 5A8RA 4H5WA 3HHDA 2DJWA 2BKOA 5DMRA 5LJ3Y 1NHUA 3V9ZA 2W4CA 3KWMA 2HZAA 2YNGB 1T02A 3VQ8A 1VDHA 2KU7A 2D0OA 3BSCA 1NGGA 5AXNA 3KG1A 3EGWB 1YDLA 3MECB 4DV7J 2QA2A 5FPDA 3D67A 2CVIA 1RHQB 5LXYA 1CSJA 1YJUA 2HBRB 2JNJA 1XHZA 4RNHA 4WZQA 3TVKA 1C0TB 2DXFA 3C16B 1VMBA 4OZ3A 4OL8A 4ZCMA 1HBNA 5HMXA 3AXMA 3BBCA 1KNZA 2V8PA 5DDRC 4KR0B 1U1KA 1HR0F 3G8QA 1MU2A 2LKZA 3GV7B 4AQYF 4PY5A 4E89A 2CFXA 4TU7A 4B3OB 3VR1A 4DV1J 4JKHA 5BYRA 3EGZA 2OHDA 5FROA 1RTJB 2W25A 4J8FA 3H59A 3SBMA 3DXKB 5KFBA 4JS5A 1S72N 3VAJA 4LMZA 1IKYA 1SB6A 4DTRA 3NBPA 4PXEA 1AZSA 2FUG9 5CCMA 4KTQA 5K20B 3LP2A 5C0YA 2EBGA 5KFKA 1HQUA 1X60A 5F0UA 2E2OA 3NRBA 2VD3A 1XNRK 4DR6F 3I55N 1VQ9S 3KK1A 2CAJA 4NCGA 1B0TA 4P2SA 4M1KA 2B0GA 5CABA 1NGJA 2EC0A 2OPSB 1BIUA 2GJIA 2IVNA 3CC4S 2GS8A 3LGMA 3PW7A 1TL5A 4QIEA 2V8GA 2IC3B 1FK9A 4CJ4A 4DX8H 1K0VA 4ZJLA 3DOLA 2VASA 2UZAA 3ZZ0A 4GVMA 2M5YA 1I39A 5KFHA 1XQIA 1NU4A 3MFIA 3GILA 3SJJA 2G0CA 3THWA 2HAIA 2FYXA 2UUTA 3UN3A 5KI6A 4DHYA 4FJ8A 3GP9A 1KVAA 2GMJA 1RNHA 4GO5X 3KLGB 3LP1A 2AP1A 1FJGK 1HNXK 1WDDA 1UJ4A 1LW0B 1EB0A 1HQEB 3DJCA 5HP1B 3NF8A 4B1XB 1DLOB 3PW4A 4R0EA 1HW8A 2D1CA 3LF0A 4W5OA 4CLLA 2VFUA 4M41A 5H9EK 1IBLJ 3UIQA 4C8KA 3AH6A 2VPXB 4Q45A 3CDAA 3JYTA 3OUYA 3FKBA 3JQMA 1U2CA 1ZM9A 3CJCA 4B3RJ 2W8KA 4E7KA 3G6XA 1YVNA 4QS8A 2VC1A 2P9UA 2Q43A 2HS4A 1CJTA 4ZHRB 3ASMA 3EKSA 2AZ3A 1U6BA 4IO8A 2N4DA 3AD8C 1BA0A 2OPPA 3KUGA 1TU0B 2P1JA 4M45A 1BQMB 1XEZA 3AODA 2IM3A 1N33F 2JOQA 3ZT3A 3MN5A 3F2KA 1WG4A 2XMUA 4UOCA 2AF6A 3PJXA 4CLZA 2LSNA 1B9DA 6FDRA 1UWBA 2JWKA 2Q0UA 3OXLA 3NS7B 1RWVB 2E44A 2Z4PA 3T9ZA 1IBKF 3BZCA 2RS8A 3RMDA 1BWEA 3QDKA 1H7XA 2M7SA 2MY8A 1U45A 4QS9A 3LTOA 1VK3A 5C7PA 1MWKA 3NF6A 4QJVA 4KC5A 4FPRA 2AJ0A 2A1BA 2ZBQA 5ETTA 4PWUA 1VSFA 1S77D 1MN7A 2VPWB 4E1NA 2QA4S 3O4NA 2P9SB 4GKKK 2C2EA 4JI1F 2IVYA 5GAHI 2ROEA 3V1QA 4JD2A 4LSZB 4PA1A 3TI0A 3KD5E 3T5HA 4CJTA 3KJVB 4PPDA 4O3PA 2HQCA 5DM7Q 2E9RX 3FRZA 3NOCA 3UE2A 1TKZB 4OI2A 5AT1B 4PG5A 3ZX0A 2JWLA 1ZBTA 1RHKB 2GUIA 1T11A 3P5BP 1I1GA 4CI0B 1WUAA 2BANA 5A8WA 1BLUA 4LF5F 2M52A 4WFAL 3KLFA 4YHHJ 3FFIA 3OTBA 1T7PA 1APSA 2DR6A 1YJWS 2CJBA 2R7WA 3G4SN 2G4BA 1YF5L 5CZ2A 3MGJA 4OYBA 2YNHA 5HLFA 4TYAA 2RAQA 3E66A 3CSKA 2JEFA 3QSIA 2C3PA 3C2PA 1TTHB 3BPDA 3MAAB 4EYHB 1Q1KA 1VRTB 3TP2A 1FJCA 5E3PA 4C3KA 1IO2A 1HLUA 4GVEA 4OMFG 1NJYA 3HYFA 2PYJA 2WTUA 1OH6A 3BBFA 1TYQA 3CCES 1W2BM 2OKQA 4IXCA 3LWMA 5E5NA 2D9OA 2JH3A 4OYAA 2HIQA 2YBVA 4FJKA 2IVFB 1PJ7A 3ZXWA 4W98A 3AA9A 2ZH6A 4EEYA 2MHNA 1DQ9A 4L73A 3UKRB 2OLWA 1U48A 1YHQN 4K2XA 4P2XA 3MMVA 3O4QA 3BY5A 2QI2A 4I2PA 1LXNA 4X66J 4YB6A 5J2MA 2ZWPA 1VI7A 2R3VA 1W2BR 1RT3A 1C6VA 5HMWA 1N52B 4OZLA 2HVEA 4FZXC 5LMNF 1GEHA 2E5HA 2E20A 2FZCB 1U1LA 4IG0B 2UUBJ 2MZJA 1YKWA 2DR5A 4YDUA 3ATUA 1SZ2A 4AL7A 1RT5A 3ETOA 1S4EA 1Y10A 4LQ9A 1WJ9A 1TKDA 2N3OA 1HWJA 1XI1A 1E6YA 1N32J 1UJ6A 3GCXP 3Q89A 4AD6A 1FHTA 1IXKA 1SJ1A 4WFAQ 3MM8A 1FKPA 1RTZA 3R5GA 3MXMA 1VQ4N 2PMZD 2WW8A 4JI5K 3EXCX 4OV1A 4J9VA 2BVZA 3UQSA 3DFEA 1KTQA 2P9CA 4L6V3 3GJQB 2O01C 4J9LA 2YHAA 4X4QA 1J9AA 4UTGA 4YORA 2DGOA 4C0BA 4ED5A 1HNZK 1O13A 4CM0A 3FBEA 1VC0A 2DNQA 4KGKA 3HHNB 2AT1B 1CJUB 3L2WA 3D2FA 1QD1A 4A8SA 2F4FA 3OW2M 2FVCA 2K3IA 2RDIA 2DTJA 4J9MA 5D77A 1OKJA 3U27A 2WVFA 1X5TA 4N47A 1FCAA 1RT4A 2HQFA 2F8HA 3FZLA 1Y3JA 3ZX2A 3BYRA 4CTAB 3HHLA 4JYAJ 1LWFA 2J4RA 1L3VA 4HTIA 3CVKA 3QIDA 3VQBA 4ANCA 3BSOA 3K58A 1QM9A 2MQLA 3I0RB 1XMBA 3C8YA 2V0NA 4BBYA 2C2OB 1XERA 4BR5A 3MZIA 3JTNA 3NH0A 4V19S 5AQSA 2IJFA 3GV8B 4DSJA 2HFZA 2IM0A 5BN8A 5BYSA 1SC4B 3VALA 5F8JA 3WIVA 3C15A 4ZVUB 3ZSZA 1I5OB 2H1YA 2Z1HA 2HIYA 2RIJA 3BJYA 1JLGB 3MR5A 4DV1K 1GLAG 2IRYA 4TN2A 1V3SA 4FLVA 4X62J 1RBTA 1Q16B 2DH7A 3MTJA 2DGQA 2VFSA 4CECA 2X6SA 4OKEA 4DR7F 2KG0A 3AQPA 2HURA 2V8VA 1KQFB 5AFUH 2PEBA 1VSDA 2CG8A 4CGIA 1TKXB 3O6WA 4M5HA 4K4TA 2QE5A 1B99A 4I64A 2QO3A 3OFGA 2XS7A 2HZCA 3JXOA 4RUBA 3VERA 3RR7A 4P75A 1DQ8A 3RU0A 4O3RA 2BJ9A 1HPZB 4EYIB 2NREA 3IRWP 3ZETA 5KFMA 4DI6A 2HMIA 1N5YB 3R27A 4DCPB 3K9KA 4Y3CA 2AU0A 4JV5K 1Q8LA 4J2DA 4J9NA 3I8BA 2EFPA 4DTNA 2MB0B 2ZDOA 3CD6S 3RGIA 4KPCA 1U0HB 4NASA 2VGNA 4EFHA 4ECTA 3SCLE 3V4IA 3EZUA 4FJJA 1HI8A 4W5RA 3GQCA 3TANA 3DYAB 4B9NA 1ZM3A 4ILRA 1REGX 2FJDB 4JV0A 1YBUA 4OJ1A 1HKGA 4PYAA 3SV3A 4OKJA 3BO2A 4X2BA 3LP3A 3IWXA 1SAZA 3SI8A 4A8OA 3VQQA 2ZH1A 3A3NB 3QNWB 1QVFR 2O8BA 3W2VA 3KJNB 1LXJA 3CCMN 4RW6A 4PPZA 3UN2A 1I94K 4RL1A 2JDJA 4DTSA 3I5CA 2XSJB 4ZK7M 5FLXY 2GW8A 5A0YB 3K7RA 4C8LA 1YJNN 5LM7E 2K1RA 2KDOA 1X9JA 3G6EN 2PBDA 1H7WA 5KFZA 4CVNE 1JCFA 1TKTA 3SPZA 2BABA 2AIRB 4B3TF 1IBLK 3MK6A 2DITA 2KJWA 2FF3B 4B9VA 4F0HA 1KHVA 2YKPA 2D0PA 1D9DA 5BRHA 5HQ8A 3VPZA 1EIYB 4NE9C 1UP1A 2XNQA 1YTYA 1KTVA 4KHWA 2RU9A 4DZDA 5ETRA 2W1BA 3ET6B 1C0MA 1BQNA 2FHMA 1N4LA 4R79A 1KAXA 3C6UA 2JEGA 4WFXA 3NDKA 2PFFB 2PFUA 5KRTA 2LA6A 5A8KB 2QK9A 3OYGA 4ELVA 5AQUA 3TVYA 2P9NB 4JI4J 4S0MA 3LM2A 1SC1B 2QLJB 1KQKA 2BJ8A 2KLAA 3HSZA 3F44A 3E2EA 3LDSA 2R42A 3C94A 2ZQBA 5EX3A 3UKUA 4FJIA 3Q0AA 1T95A 4FJ5A 5RUBA 4I1TA 4P7VA 4PKDB 3WZ0A 1Z26A 2OEMA 3TUZC 2A18A 4BDZA 4C97A 3EZOA 2ZNZA 4KBIA 2AYEA 3QNNA 4MFBB 2MQ8A 4USTA 1UVJA 3GTYX 2C22A 1E6VB 2LLZA 3TEGA 1VQ5S 3M9NB 3S3MA 3CJBA 2L9WA 3NNHA 3CCQN 4DPWA 2AEFA 4P10A 3U9DA 1VSIA 4CO3A 2DHAA 3CXCR 1OVYA 1W97L 3UCUP 4U96A 1TL3A 2VBWA 1WF0A 4ZTFA 4DV3F 2CWXA 3GFHA 3NE6A 2VICA 3L3UA 2JC0A 3TUPA 4PL8A 3KFWX 4G6VB 4FXWA 4GVBA 4DTXA 2APOA 4OYMA 2KYXA 3T3FA 3TWHA 1WORA 2CIMA 4DR6J 3VAFA 2F8SA 4KT0C 2ZZNA 4LFBJ 1CLFA 2YWGA 4ED3A 3CQ8A 3H1VX 4EP5A 4USMA 4NXMF 4RW9B 2IM2A 1NDPA 3W8GA 4MTPA 5IWAF 4FWLA 4BRKA 4JI2K 4V19J 3THXB 3DLHA 2AEJA 1RYSA 1IR1A 1MSWD 1NNDA 1FESA 2G13A 2M4MA 3W60A 3SJHA 1SUQB 3VQEA 2VKZG 2FVQA 2DXEA 4A4JA 1VYAA 3AVFA 1BL3A 3GZ7A 1B70B 3AVHA 3J80U 4H03B 5MAOA 4KO0B 2CQDA 4OX9F 5ETMA 4ILLA 2IY5B 4OVLA 3RBZA 1S57A 2MHEA 2XGPA 4FF3A 4DQ8A 2HHTA 3CMAN 2AWZA 1S6QA 4NL5A 4B8CA 3AO4A 3OS0A 2XSFA 3NEKA 3H5SA 4X66K 1M5SA 5JLFA 2XMVA 3SQ2A 3K0SA 1NG9A 1NXIA 3C6AA 1R0AA 3S41A 3AGRA 4LH4A 3NFAA 3KLIB 2OELA 2VG7A 2HHHK 1JLCB 3V81A 5D78A 3QEPA 2W9BB 2DY9A 3H6EA 3O5TB 1V5IB 2B51A 5EN1A 3OR1B 3MD3A 2MSSA 3UFCX 2NUBA 5MLCV 1RZMA 3TSPA 1KONA 2O3DA 2HHXA 3QLHB 3DAWA 5E84A 4HHUA 1EAYC 1VC5A 2QT7A 3PJ9A 4RKUC 4YMEA 4IOCQ 5M2UA 1Y11A 3OFEA 4X4NA 1YX2A 2ZUAA 5J2QA 1EETB 3DXMB 2O5DA 5SUHA 3OTDA 3AA8A 3FLCO 3EPGA 1IBKJ 2B4OA 4W92B 3HJFA 3MXHP 3R8EA 1C4CA 3PRVA 1DQAA 2YNFA 3Q8YA 3WXKA 1GK8A 2PE8A 2BE2B 4BRGA 2QX0A 2QKBA 3KUEA 1ASVA 1X3NA 2LXFA 2JGUA 4ILMA 4IKFA 3S3OA 3HX9A 3WX8A 1GMWD 3EE3A 5CD4H 2XI2A 2DK2A 1MMLA 4JEPA 3K17A 4WE1B 2NUUG 3CCRS 3IR6B 5FPEA 1Q78A 4TY8B 3CWJA 3HZEA 4L76A 3HFKA 2OD4A 5KG6A 3RMAA 2VJVA 5JS1A 5HMZA 1SQEA 3VQ4A 1GLDG 1A6LA 3J81Y 1C0GA 4DSFA 1ZBLA 4KHPK 2ZE2B 2YWFA 2CPIA 1KRPA 4LSLA 4K50A 2MY7A 4CIEA 4H54A 2YWWA 1HLWA 4DJBA 4QPTA 1RQ0A 1SVDA 1QAXA 1UZDA 3CFRA 5HQLA 4QIFA 3HSJA 4HYKA 1OS5A 5HVHA 3OFHA 2VWBA 2Q31A 4LF5J 5HVFA 5AQVA 5CHCB 1MWMA 1VJQA 3QNOA 2C2ZB 4JB8B 2W2PP 2GVZB 3I33A 2I0XA 1X9WA 2MKYA 4ZVRB 4CFDA 3MFHA 4USKA 3SDEB 1YVFA 3W5YA 3B4DA 3ZTPA 1F6TA 2RJZA 2D5RA 1UL3A 5MLCQ 4ZP8A 1R59O 2Q2RA 1F9EB 4M7XA 1GOCA 3TEHB 3H40A 3TZZA 2GGPA 3QEWA 1L3SA 1TAUA 4BC3A 2O8CA 8ATCB 1EP4A 2ASLA 1KVBA 2YKNB 1RDAA 1DT9A 3QEXA 2NR0A 1VQ9N 5FRMA 1FKOB 3A0IX 3I96A 3I56S 3BF3A 2B9EA 4CH7A 5AZJB 4CO1A 1YTUA 3S01A 2F96A 3NMAA 3CC4N 4OV6A 1RE1B 1HNWF 1KLMA 2WC9A 3AARA 5KFSA 2V63A 4F4KA 4ZP9A 2KFZA 1RU1A 3PRDA 4JKGA 4WU2A 2BRKA 1M5VC 4GVLA 2FLPA 2GX8A 4ZKAA 3J80O 1RT1A 5FPNA 1K8AT 4Y1DA 2JLFA 4WK3A 4W5QA 2QWNA 1ZTWA 2DH9A 3B54A 4YS2A 4I2QB 2ITMA 1TGOA 1VSJA 5CY4A 4A8KA 1ELOA 3M8SA 3NF9A 4CLKA 3THYA 3R5CA 2DNOA 3KMQA 4HR2A 5AZIB 1Q5YA 3D0GE 2CJXB 2V2KA 4X65F 3OYHA 3W5XA 4YN3B 4HVZA 5KAKA 3OBWA 4BRCA 2MZRA 2V34A 5FDLA 3AT1B 2EK6A 4MK9A 1N48A 2ADBA 2LQ5A 1YZ7A 1D8YA 4HACA 1FXXA 4PKGA 3W3SA 1UW4A 2FHKA 3NGYA 2A2DA 3BZQA 2W2OP 4FZYA 4WTOB 2XMWA 4WBFA 4CZGA 2X6NA 2QL9B 1A9NB 2NRTA 2AP6A 2XY8A 4M95A 1UOCA 3I6PA 4PKIA 1X4AA 3KG0A 3FUYA 3GYGA 3VA0A 4RG8A 2EW9A 4KB7A 3ENBA 3L2QA 1KKHA 5KG3A 2V68A 5CH7B 4LRFA 2V5HG 3CD5A 5JVGL 4PQAA 3AO5A 4OHVA 1R0CB 1BCMA 2PC6A 1W25A 3HO1A 3IG1B 2QLXA 5BJRA 3K8VA 1TMJA 4ZLLA 2BA9A 1WACA 1YLXA 2H4WB 4BREA 4UQTA 2SXLA 5HRRA 1SKSA 4BC7A 3EZ5A 3D2EA 2D3O1 1AUDA 5KQDA 3DLKA 2DPIA 4H0TB 3RMCA 3QIPB 1PILA 2BV3A 1G1XA 5F3TA 5J2NB 1WTBA 3CO0P 4QOZB 3DRYA 2MYFA 1FJEB 2D3ZA 1JNZB 1YBAA 1WELA 3EJMA 1HR0K 2DR9A 4AQYK 2P5GA 5LJ5Y 3UR0A 4G3IA 1IBCB 1RCHA 1ATRA 2QA4N 3I9ZA 4ZPTR 4QU6A 1RT2B 3CEDA 2XWYA 3KLEB 3IMQJ 1EARA 4K4VA 1UMJA 1RP5A 4Q43A 4DR7J 1S1UB 3QETA 1XN9A 1MMDA 3KOAA 3I4PA 4JKBA 2YKQA 1NB7A 2J5AA 1NPPA 1RTDB 4MYUA 3ILIA 4HDGA 4FXDA 4DR4F 2LA4A 1N34F 4EBDA 3HHEA 3M8QB 2K7JA 3AXKA 2LDYA 5B0BA 5AFUA 1V9OA 4DR6K 4BE2A 4AUKA 2W2QP 3VZIA 2UVVA 4CK2A 2O8FB 2DNMA 4DTOA 1U2VB 2RF2A 1YJWN 2R7YA 1UZHA 2PT0A 2GIRA 3CJSA 2GHVC 1HKAA 1ULRA 4ETZA 4CE9A 3MMBA 4WQ5A 4NLTA 2CKWA 4F4YA 3VGTA 4I6MB 4F26A 2GA7A 4DR3F 3WXIA 4KGXB 2OEKA 4I4BA 1MG7A 5KOXA 2DKOB 2P9LB 4NLRA 3R8YA 4R25A 4QWCA 3CCEN 3SK3A 4WPAA 1AW0A 1LKZA 1U1RA 1C1CA 3W9HA 5C42A 3QYYA 1REVB 4Z4GA 2QRRA 4ECSA 2WONB 2U2FA 3MOZA 1K9MT 4MQ3A 1RAAB 5BR8F 2W9CB 3AB2B 4B3TJ 4JHDB 3PTWA 3VESA 2EG2A 3A8YA 5HANA 4JI6K 5A76A 5B0DA 1TL7B 4K4YA 5KT5A 2M8HA 3W2WB 1RAJA 2ACYA 1WHXA 1GMUA 4HH0A 1RWOB 2Z0GA 2KXNB 1Q82O 3OXFA 2XCAA 2KFYA 3VMFB 2ZH5A 1QSSA 4CYUA 1NH7A 1KXPA 1B92A 2W7PA 2FJXA 2NRXA 3VEOA 4H4KA 2BH1A 4CZFA 3ZTOA 5U47A 1N33K 2B9YA 2QLFB 3R2CJ 2HGMA 2V2VA 1RISA 3Q22A 2Y1LB 3VEWA 1UWAA 2E2NA 3B78A 3G82A 4B9LA 1IBKK 3R5BA 4URGA 2RS2A 3DRXA 3M30B 2Z1JA 2YJEA 2GVDA 2YWEA 4H5TA 2H5JB 2F1FA 3PCOB 3TJ8A 4CK3A 4ZJOA 4DFMA 2C3OA 1LCUA 3THPA 2W6LA 4CZJA 4R5PB 4DQQA 4WFNL 1Y4ZB 3RB0A 1VBYA 1WUUA 4UUWA 3M8ZA 3V6KA 1S22A 3HPGA 3UDEA 2H54B 3B6PA 2IOCA 2Z56B 4JI1K 3D0PA 1VCTA 2AYGA 1C4AA 1DTQB 2E9ZA 3VGSA 1XR7A 5BRFA 2DPNA 2O8DA 4DHVA 4ICLB 4LF9J 4B1UB 4CJKA 4CJLA 2MQMA 2W6KA 3LP0B 3M3ZA 1SPBP 5ADXH 2RMLA 1Q82T 4BROA 2P2CB 2YNIA 3LPEA 3AVCA 5DZ7A 3QT8A 4LT6A 1NAQA 4FLWA 2MLYA 4O44A 3ZNUA 4LF5K 3MCAB 2QWLA 5JVHL 4MKBA 2W01A 3GMGA 3W65A 1BA1A 2YJFA 3V9SA 1DHMA 3DRPB 3O6QA 1SCJB 1KDNA 2ZNYA 2UU9F 3DLLQ 3EE8A 3K5LA 4NXMJ 1VSLA 3M8WA 4YOXA 1SJ3P 2VWKA 2VPZB 3QFWA 4LR7A 4C8OA 4K4UA 9ATCB 2I5JA 1X9MA 4YDDB 3EGVA 4IQMA 2CPEA 2FIUA 4M42A 1P27B 2D0AA 3QRRA 5AQYA 5FLXU 2J6UA 1X7VA 1YTAA 2EI5A 1Q79A 3EGNA 5HAOA 4OX9J 4J5OA 2KM8C 3R2DJ 4BRDA 4PYDA 3H4DA 3JSRA 3FZKA 2IDLA 4CF9A 1ZBIA 1L3UA 1X4GA 3PIOQ 4LQ3A 4B08A 3R9PA 4FPAA 3CB4A 5F0XA 3CD6N 3M32A 3PZPA 2J0SD 4X64J 5KFQA 4ZPAA 5J2PB 3Q8RB 3RB4A 1TUVA