4HHTA

T. maritima rnase h2 g21s in complex with nucleic acid substrate and calcium ions
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
229
structure length
220
Chain Sequence
GIDELYKKEFGIVAGVDEASRGCLAGPVVAAAVVLEKEIEGINDSRLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKSVVFRKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease HII
publication title RNase H2 roles in genome integrity revealed by unlinking its activities.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 75
structure length 220
sequence length 229
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hhtA00
1TKTA 4DSKA 1DLOA 3L2RA 2FBVA 3SYZA 1KSPA 4F2SA 1A5WA 4KTWA 4CEAA 3TANA 4FW1A 1NK7A 4CJKA 5C24A 1NJZA 1WSHA 4CEEA 2XY7A 3CFOA 1S9GA 3VQ6A 3AA5X 3AVNA 4CHNA 1EP4A 1IKVA 4M45A 5SZTA 4JS5A 2ATQA 2Q3SA 1TGOA 1QSLA 4KB1A 2HNYA 1A5XA 1VK0A 4E7HA 4CGIA 2B4JA 4IFYA 2YHAA 3OYLA 4RG8A 1ZYQA 1T05A 4HVJA 1R0AA 1QQCA 3HVTA 4PQUA 1TV6A 1VSJA 3QNNA 1VSKA 4FJIA 1C6VA 4O4GA 4B08A 1KLNA 3CFRA 4FK2A 1BIZA 1BGXT 1HJRA 2X78A 3HSTB 1D9DA 3PY8A 2OZSA 1CZ9A 4OKKA 3AA2A 4DFKA 4PA1A 1TL1A 3V9WA 1LWFA 3AVIA 3DLBA 4KI4A 3AO1A 4F3TA 1U45A 1EKEA 1LAWA 3HT3A 3QEVA 3DI6A 1VSHA 4WE1A 2Z1GA 1RDBA 2VWKA 3VQEA 4ELTA 3ZT3A 3M8SA 4H4OA 3T19A 3NF8A 1QS4A 3AVAA 3ZSOA 4DTUA 2E6MA 3KK2A 1QTMA 3DLKA 3M8PA 4DSLA 4FJJA 3ZT1A 1VSFA 4OGEA 3LWMA 3VQ7A 1RBUA 1ASVA 3NH1A 4CECA 4FM2A 4CJEA 4DTNA 1MU2A 4CJVA 4CIEA 1WSJA 1S1UA 2G8VA 2QK9A 5CYMA 1XC9A 3O3FA 2F8SA 4B9SA 3KK1A 4K8ZA 1KVBA 2KW4A 3CG7A 4BWJA 2IOCA 3L2WA 2P5OA 2X6NA 2HVIA 4FLYA 4RW7A 3SQ1A 5D3GA 3LDSA 1W9HA 1HRHA 3RRGA 4CF2A 4CK3A 1WN7A 4W5RA 3QEWA 3ZT2A 1C0UA 3V9XA 2HHWA 4E7JA 1C0TA 3NH0A 4W5QA 1RBRA 3DLEA 4DU3A 1BQNA 1RT2A 3AVHA 3U3GA 3SUPA 3A2FA 4E7IA 1U47A 1X9SA 4JRQA 4B9TA 3PUFA 5HROA 2DFHA 3DLRA 4E7KA 4FXDA 1S6PA 4FJ9A 1NJWA 4N41A 4DTMA 4FK4A 3K59A 1IH7A 3ZT0A 4CIFA 2HHTA 3QINA 4HUFA 1WAFA 3U3YA 4DQPA 1WSGA 4DWIA 3HP6A 3UIQA 1W0HA 3O3GA 1KLMA 4QCLA 2O4GA 1B9DA 3KLGA 1WSFA 1DTQA 3LAKA 1I3AA 4BWMA 4OPJA 4ID1A 3AO5A 4ELUA 1ZBLA 2E6LA 4FJXA 4B3OA 1DTTA 2WOMA 3MEGA 3AO3A 3T1AA 3TAQA 1IKWA 4ID5A 4CERA 4L8RB 1RTHA 3TARA 4IG0A 1N6QA 4KHUA 3RR8A 2QKKA 1G15A 3HM9A 4E3SA 3SUNA 1EXQA 4ELVA 4CEFA 3KKSA 3CQ8A 3S9HA 5CYQA 4FLWA 4CHZA 4BDZA 3WNGA 2KFZA 1GOAA 4E19A 5FRMA 4CCHA 1NK0A 1S9EA 4DS5A 4DSEA 3KK3A 4BE1A 1VRTA 3ZSZA 3OYDA 3NFAA 1SL1A 5CZ1A 4CIGA 4KRFA 4RW8A 1S1VA 4CEDA 3ULDA 4B9UA 1IKYA 3QERA 1X1PA 3NHGA 2PY5A 3RR7A 2G8WA 5E41A 2G8UA 3P1GA 4DSJA 1SKRA 1B92A 4DQQA 3AVFA 5HLFA 3HK2A 3OYEA 4E7LA 1L3SA 2LSNA 1A5VA 4EZ6A 3MEDA 4FZYA 3LP0A 3C94A 1JLEA 3P5JA 2A1RA 2R7YA 3LALA 5KGXA 3VQDA 3PV8A 4CJ4A 3HVRA 4EP4A 1IO2A 4DS4A 1RDDA 3DRSA 3LP2A 4YFUA 1NJXA 4J2BA 2ITGA 4DU4A 3VQCA 4OLAA 1FK9A 3TI0A 1L3TA 4HTUA 4C8MA 5KRSA 3C6UA 2FBXA 2OPRA 3TR8A 3M8RA 3QESA 1L5UA 4FLZA 4E0DA 2IGIA 2HNDA 2P51A 4MQ3A 3S3OA 3KTQA 1D9FA 4AHUA 3RTVA 4AILC 1S5JA 3NF6A 3IG1A 3DOKA 4FZXC 1RCHA 2RPIA 2QKBA 4DQIA 3IS9A 1NKBA 1LWEA 1VSEA 3DRRA 4ZTJA 4KHWA 4O44A 3SV3A 1HNVA 1Q9YA 1K6YA 1CXUA 4CESA 4CFDA 2VG5A 2GV9A 4N47A 2BDPA 3HL8A 1HMVA 4DSFA 3TAGA 2XRIA 1JL2A 4CJRA 3VA0A 4CJ3A 1U04A 3AVCA 4CGJA 4KB0A 4KHYA 4I7FA 3ZSVA 4CK2A 4GVMA 4Z0UA 3LZIA 3KKRA 4M41A 4CFBA 4M3WA 4NCAA 3WNFA 1N5YA 2AJQA 3OYBA 3VQ4A 4FJKA 2HB5A 3O4NA 1TKDA 3AVMA 5EU7A 5KTQA 4QOZB 1JLFA 3H08A 3ISNC 4DFJA 1U49A 4J2EA 4HCBA 1RT5A 4PWDA 3LZJA 5HRNA 4ICLA 3V81A 3PX0A 4AHSA 3JSMA 3SQ2A 2KZMA 4FJ7A 4LSLA 3ZSQA 2HHVA 5JS1A 3C95A 4KREA 1NJYA 3O3HA 2KTQA 3V4IA 4FCYA 3K5OA 3KJVA 4OKEA 2JLEA 4FLUA 4OLBA 2YNHA 2VG7A 3RMBA 2BANA 1RTJA 3DRPA 4I9LA 1SKSA 1CLQA 4CF8A 4CJFA 3HPGA 1S6QA 3L3VA 3NAEA 3VQ9A 3TAEA 4NYNA 3F9KA 4DTJA 3U6FA 3V6DA 3SPYA 3MXJA 4Z4GA 3OVNA 2HVHA 1NOYA 3V9UA 1NKCA 1RT4A 4CJSA 3AO2A 1ASWA 4LSNA 1KCFA 3PO5A 4N5SA 1KFDA 3LWLA 3VN5A 5I42A 3VQBA 4I2PA 4OGCA 3RWUA 1YT3A 3P83D 1EX4A 1VSMA 4YNQA 1HYSA 1ZBFA 4N56A 2D0CA 3I0SA 4CJLA 3AV9A 4KAZA 4KFBA 4B9MA 4CE9A 3DLHA 4FYDA 4AHRA 5DK5A 4PUOA 3V1QA 3NDKA 3SQ4A 1F21A 3ZT4A 3KD1E 4JRPA 4BDPA 1BISA 3FFIA 1QE1A 4CEZA 3B6OA 2D0BA 2KFNA 4CEBA 4DQSA 2ZD1A 3ALYA 1CXQA 3I0RA 3S3MA 1JLAA 1ASUA 3ASMA 4KHSA 1JKHA 1C1AA 4DFMA 4PY5A 4Z4IA 2G8IA 3T3FA 3L2VA 2PYJA 1VRUA 3VA3A 3SCXA 3K58A 3VQ8A 2BE2A 2XY8A 1LW0A 4MFBA 4JS4A 3OYKA 1C1BA 5J2MA 1WSIA 1T8EA 3TAMA 4CJPA 3KLEA 3C6TA 3D45A 3NE6A 1LAVA 4JLHA 3NCIA 3VQPA 3CFPA 4FZZA 1RDCA 4CF0A 3ZSWA 1J54A 4C8NA 4CEOA 4CFAA 2YNIA 2OA8A 4IFVA 3SPZA 2HHXA 1Q9XA 4B9LA 3HP9A 1HYZA 3QEXA 4NCGA 1C1CA 2YKNA 4FVMA 3PX6A 3TAFA 4KO0A 2P1JA 3NF9A 3ZCMA 1TK0A 2HHSA 4XIUA 1LV5A 3OYHA 1TK5A 4G1QA 1UA0A 4LH4A 3KIOA 3HO1A 3AVBA 3HYFA 1HQEA 4I2QA 1QSSA 2XY5A 4M3RA 2HHUA 3AVGA 5KI6A 4H8KA 4Y1CA 3HXMA 5KGWA 3LP1A 4AHVA 4E1NA 5C25A 4DF8A 4FJLA 1WLJA 2F8TA 3JYTA 3VQ5A 1GOCA 2WONA 5HBMA 5HRPA 3TWHA 1RDAA 1SV5A 4GMJB 4W5OA 3L2UA 4NYFA 2IC3A 2Y1IA 4C8KA 1JLCA 4Z4HA 1Z25A 1X9MA 1TAUA 3E01A 2NUBA 4Z4EA 1RT1A 4FJHA 2VG6A 4H4MA 4IDKA 3KLHA 3NBPA 5HRRA 3L2QA 1CZBA 2OPQA 3K57A 4O0JA 3MEEA 4FLXA 1RTDA 4FJGA 4NCBA 2Z1JA 1U4BA 2YKMA 2PZSA 5FRNA 1D5AA 4GW6A 2XY6A 1QHTA 3NF7A 1IG9A 4FJ8A 2EX3A 1RBVA 4LD0A 3SUOA 2PYLA 3LPUA 4CF1A 1NK5A 1L3VA 4IBNA 1JLBA 1KVCA 4N76A 1HNIA 3VQAA 2D5RA 3QIOA 4CJQA 3VQQA 2KZZA 3RMAA 5SWMA 2Z1IA 2QXFA 3SNNA 3IAYA 2XO7A 4UQGA 3BDPA 5FDLA 1T03A 4QAGA 4DLEA 2OYQA 2EHGA 3AA3A 4M3TA 1U48A 4J2DA 3SZ2A 2OPSA 4E1MA 2HW3A 5J2NA 3HPOA 3DOLA 4CHOA 2RN2A 1RBSA 4OJRA 3NGZA 3CM6A 5J2PA 1XHXA 1J5OA 3LP3A 4HUGA 1Q8IA 1RT7A 3OY9A 4B9NA 3KD5E 1TVRA 4M3ZA 4ZHRA 2HHQA 2RKIA 3ITHA 2W42A 1KFSA 1RNHA 4F2RA 1ZBUA 4HHTA 4FM0A 4Q0BA 4CHQA 3OYMA 4M3YA 3OS2A 5I3UA 3D0PA 3ZSXA 1JXBA 4BE2A 4F8RA 5T7BA 3EZ5A 1SL2A 3PO4A 4FJNA 1NKEA 4W5NA 1BCOA 3OYNA 4KTZA 4CJTA 1FKPA 4DU1A 3SI6A 3HJFA 1XHZA 4CJUA 1HQUA 4M3XA 4KHQA 4C8LA 3QNOA 3QEPA 4EZ9A 4I9QA 4FJMA 2FBYA 5DMRA 3V1RA 2HMIA 1RT3A 1YVUA 2DFFA 3CYMA 3AO4A 3NGYA 1KTQA 3KLIA 1UWBA 4FW2A 4LH5A 3QLHA 5K14A 3MAQA 4F3OA 2DY4A 1KRPA 3LPTA 1S1WA 3LANA 3TAPA 2FC0A 1SL0A 3OS0A 3K5MA 3OYAA 1NK4A 3OS1A 4Z4FA 3RMDA 2X6SA 2YV0X 2G8FA 4DTSA 4LY7A 5J1EA 1J53A 4DTOA 3MXMA 3QIPA 4DQRA 1S1TA 1VSLA 4KPYA 3MECA 3LAMA 4CJWA 2ZQBA 4BACA 2Y1JA 3SJJA 1XWLA 2GBZA 2IDOA 4E89A 3K5NA 4O5BA 2B6AA 1WSEA 1BIUA 3B6PA 1HYVA 2ETJA 1O1WA 3AVJA 4M42A 1JLGA 4DTRA 1RBTA 5J2QA 2OZMA 4IKFA 4B8CA 3EYZA 4CGDA 3OYGA 1LW2A 1YTAA 2IAJA 3OYFA 4DFPA 1TAQA 4K8XA 4TSXA 4RW4A 4KV8A 3CM5A 3M8QA 5FROA 4FK0A 1NOZA 3AA4A 3IRXA 1RTIA 2A1SA 4DMNA 4F4KA 1HPZA 3RRHA 4AHCA 3SUQA 1JXEA 5HRSA 1XI1A 2B5JA 2F96A 1NK8A 4FLVA 1L3UA 3ZSYA 3QETA 1ZBHA 4B9VA 3OYCA 3F73A 4Q5VA 4HUEA 3DLGA 3L3UA 4CK1A 4DF4A 3PX4A 1VSIA 2DFEA 3G10A 3G0ZA 4DLGA 1NK6A 4FM1A 1D8YA 1YTUA 4R5PA 3V1OA 3AVLA 5CY4A 3NGIA 3SQ0A 4C8OA 3DM2A 4CEQA 1QSYA 4FJ5A 1TKZA 3WNHA 4B8AB 2RF2A 4CGFA 4BDYA 5HP1A 1S1XA 1GOBA 2XHBA 3HPHA 3DMJA 2FBTA 1REVA 1TKXA 2OPPA 4OVLA 4DG1A 4O0IA 1BI4A 1T7PA 2JGUA 2I5JA 4CGHA 1SUQA 2E4LA 2Z1HA 2G8HA 1C0MA 1FKOA 5JS2A 2D0AA 3V9ZA 2KQ2A 3QEIA 1X9WA 4RW9A 3OJSA 1TL3A 4CJ5A 4KI6A 2BGGA 5CZ2A 3DYAA 4CGGA 1WNSA 4CFCA 3OYIA 4AHTA 1UA1A 2VWJA 4O55A 4CF9A 3BGRA 4CHPA 3WNEA 1RT6A 2YHBA 1BHLA 3O4QA 3TABA 3OJUA 3MXIA 3K2PA 5KRTA 4HCCA 4DSIA 4M3UA 2O4IA 4DTXA 4KKOA 1JLQA 4J2AA 3ZSRA 1ITGA 1B9FA 1BL3A 5C42A 3AVKA 4DTPA 1J9AA 1Z26A 3OYJA 2YNGA 4CHYA 3KLFA 1UAXA 1SKWA 1IKXA 3I8DA 1BCMA 1VSDA 4IG3A 4BE0A 1TK8A 2HNZA 2ZE2A 3THVA 1RILA 2DTUA 1NK9A 4RW6A 2GUIA 3EY1A 3K5LA 2X74A 1JL1A 1ZBIA 4Y1DA 4Z4CA 1LWCA 4KTQA 1UOCA 2P5GA 2G8KA 1BI4B 4W5TA 1WAJA 4OKJA 1FXXA 3SV4A 3RMCA 1Y97A 3V9SA 3NH2A 3S3NA 1BQMA 4OPKA 3QO9A 4AH9A 4ZTFA 1KVAA 1EETA 2YNFA 2IS3A 3L8BA 4EP5A 4KHNA 4FLTA 1I39A
chains in the Genus database with same CATH superfamily
3L2RA 1M90O 5AQPA 1A5WA 4CZLA 3OA9A 5JVHL 4CJKA 1NJZA 4A59A 1VQ8N 1YAGA 1EP4A 1IKVA 4M45A 1TGOA 4CGIA 1VQON 1ATNA 2YHAA 4RG8A 4JI2K 4HVJA 1R0AA 1TV6A 1D4XA 1J6ZA 4C1NI 4FJIA 1C6VA 3R3LA 4O4GA 1BGXT 2X78A 5AQOA 1CZ9A 3D2EA 4X65K 3EE8A 1EKEA 1LAWA 3QICA 4WE1A 3S41A 2Z1GA 4GV6A 4H4OA 4IEIA 4DV4K 4WCEL 2BH1A 3KK2A 3M8PA 1J5EK 1VSFA 2AA4A 4OGEA 1RBUA 4KBOA 4CJEA 1MU2A 4BVOA 1WSJA 2G8VA 2QK9A 4B9SA 3KK1A 2Q31A 1E4FT 4RW7A 1NGDA 5D3GA 3ENOA 3VTIA 3LDSA 4CK3A 1E3MA 5GIOA 3ZT2A 2HHWA 3V9XA 4FSVA 4E7JA 4LF5K 1RT2A 3SUPA 3U3GA 1IBKK 2ZWHA 3TSQA 1X9SA 2P9KB 3MK6A 4JRQA 4B9TA 3PUFA 4NB4A 4QS8A 4E7KA 4BRDA 1S6PA 5JICA 1NJWA 3K59A 2I7PA 2ZF5O 3ZT0A 2HHTA 3U3YA 4DQPA 2FF6A 5FPNA 4CJ7A 3HP6A 3UIQA 2P9SB 5AQLA 4HWIA 4BR5A 4FWSA 4BRQA 3OHRA 4ELUA 1ZBLA 4B3OA 4FJXA 2E2QA 2WOMA 3K9KA 4DR5K 2VQFK 4KHUA 1N6QA 1BG3A 1HLUA 3RR8A 1MWMA 3FE1A 4BRCA 4JKFA 3SUNA 3H1VX 1YUWA 2NRXA 5CYQA 4BDZA 1GOAA 4E19A 4DR1K 5FRMA 1S9EA 2UXCK 3KK3A 4DKWA 1VRTA 3NFAA 2P9LA 5FLXO 1SAZA 2O8FA 3M3ZA 5AQGA 1IKYA 4BG8A 1KAXA 3MN6A 4BC3A 5E41A 4DR2K 5BR8K 3CF5L 4YHHK 3OYEA 3R9PA 2F9TA 3D2FA 4EZ6A 4BR7A 1T6DA 3ZX0A 2UUBK 3C94A 2R7YA 4H0YB 3VQDA 2QA4N 4EP4A 1IO2A 3TSPA 3DRSA 3LP2A 4CZFA 1OVQA 1FK9A 1L3TA 2UUAK 1XC3A 4C8MA 3C6UA 2OPRA 3TR8A 3M8RA 1L5UA 3S3OA 4B1WB 5F1XA 3T1YK 3O4WA 3DOKA 3ZEUB 1RCHA 4DQIA 1NKBA 1VSEA 5AZJB 3SV3A 1CXUA 3HL8A 1HMVA 3TAGA 2XRIA 1N34K 2BUPA 1KXPA 3THWA 4JI0K 3O4NA 3VF6A 1JLFA 4IJNA 4HCBA 4ICLA 2E1ZA 4AHSA 4FJ7A 4LSLA 1U2VA 4FLUA 3CXCM 5TKYA 1N33K 1CLQA 3NAEA 1S6QA 3TAEA 4DTJA 1Q18A 4QS7A 3U6FA 4B1YB 4BY9C 1NKCA 1RT4A 1JCFA 1ASWA 5AJ3K 4FWQA 5AQSA 3NVMA 2Q2RA 3H46O 3VQBA 3P83D 1VSMA 1ZBFA 2D0CA 2V51B 3I0SA 4GNIA 3N4PA 4DHYA 3NDKA 4ISFA 4LF8K 4BRMA 1S22A 2Q0UA 3FFIA 4CEZA 3O08A 3I0RA 2RE2A 1JLAA 4PY5A 3GL1A 2G8IA 2PYJA 3SCXA 4A62A 1LW0A 4MFBA 4JS4A 1NU0A 3OYKA 4I6MB 3CMAN 1SKRA 1LAVA 4JHDA 3WT0A 2UYTA 1VQMN 4C8NA 3G71N 4CFAA 2YNIA 3LDQA 3QEXA 3H3NO 4NCGA 2YKNA 3PX6A 3NF9A 2VQEK 1LV5A 3KK7A 4G1QA 4AQYK 3BEXA 4PKGA 2YJEA 3AVBA 2FF3B 1QSSA 4M3RA 4FJLA 2F8TA 3JYTA 5HBMA 5HRPA 5AZIB 4GMJB 4EHUA 4Z4HA 2ZJPL 3E01A 5AQHA 5AQQA 4BRHA 1RT1A 4B3TK 5HRRA 3JAMO 4NCBA 4FWOA 2QM1A 5FRNA 2YKMA 2XY6A 1OH5A 3NF7A 1ZC6A 1RBVA 2EX3A 3O5BA 3VQAA 2W6LA 1S72N 4JAXA 1HKBA 1GLEG 1CZAN 2QWNA 3SNNA 3J80O 1QZ6A 2EHGA 3AA3A 1BA0A 3MMVA 4NXMK 3DOLA 3CJBA 3B8AX 4JKGB 4ZHRA 4ILJA 2I7NA 3ULEA 4FM0A 4FWLA 4IOCL 4CHQA 1K8KA 4FPAA 1SL2A 1NKEA 4DR4K 4KTZA 4CJTA 4DU1A 3SI6A 4CW7B 1HQUA 4WFBL 2VGMA 4F9OA 3O9SA 3WEEB 1N32K 3NGYA 3CYMA 3KLIA 4F3OA 5C15A 4WYBA 1W2BM 3LPTA 3WXMB 3BZKA 3LANA 5AQNA 3OS0A 4Z4FA 1YJWN 5IT9O 2G8FA 4DTSA 4LY7A 3MWTA 4WQ5C 4YDUC 4DQRA 4JNEA 2NZTA 1S1TA 4BGAA 1HUXA 2Y1JA 2GBZA 3AAQA 4MDAA 2CGJA 4C1NK 3D6RA 1HYVA 4BC2A 3D7EO 2OZMA 4IKFA 3EYZA 4LF4K 1LW2A 1YTAA 2IAJA 4A2BA 3OYFA 3CHWA 4E1JA 1TAQA 4HTLA 3CCMN 4JKCA 4TSXA 4KV8A 3RSEA 2P9PA 3CM5A 3M8QA 5FROA 3AA4A 4IFEA 4DMNA 1HPZA 3ZYYX 3RRHA 3SUQA 2GUPA 5HRSA 1L3UA 4FLVA 2A40A 2Q1NA 3DLGA 4DF4A 4B3MK 3G10A 3G0ZA 3FZMA 1YTUA 3V1OA 3U8XA 4CEQA 1BO5O 3THYB 3WNHA 1P90A 3C6HA 2FBTA 1BI4A 4CGHA 4GV3A 2Z1HA 1C0MA 2GWKA 1DEJA 2D0AA 5BPNA 1T6CA 2IVNA 1NGBA 4H5NA 2BGGA 3CD6N 1VQ6N 1UA1A 2VWJA 2ZGZA 3F9MA 3T69A 3TTDA 1OH6A 1BOTO 1RT6A 3MXIA 4M3UA 3O4QA 4DR7K 4DSIA 1JLQA 4ILGB 4J2AA 1ITGA 1BL3A 1J9AA 5CHIA 1NM1A 3CCSN 3IMXA 3I8DA 2O8EB 4IG3A 2DTUA 3EO3A 1JCEA 1R59O 3U9DA 2X74A 1ZBIA 4Y1DA 3H6EA 1RGIA 1UOCA 5F0XA 2WC9A 1GLFO 5GINA 2NLXA 3NH2A 3S3NA 1GLBG 3QO9A 3L8BA 1I39A 4DSKA 5GAGP 1DLOA 3SYZA 4F2SA 3ZETB 4KTWA 4CEAA 5GADP 1WSHA 5LL6Z 4CEEA 5I9EB 4JD2B 3AA5X 5SZTA 1ILYA 1A5XA 2B4JA 1ZYQA 1T05A 2KHOA 1VQ5N 3LM9A 4B08A 1KLNA 4FK2A 2P9UA 3UKUA 4OKKA 5BR9A 4PA1A 3DXMA 3AVIA 3THYA 3DLBA 1HPMA 3DI6A 3HBTA 5CR4A 3QMLA 4WQ4C 3VQEA 3ZT3A 3O9RA 4FL9A 3DJCA 1QS4A 3MN9A 4DSLA 4FJJA 2UXDK 2O8BA 4FM2A 4CECA 4L3QA 4DTNA 4IO8A 4CI6A 5CYMA 1XC9A 1NG9A 4K8ZA 4BWJA 4U67L 2IOCA 2P5OA 3MX5A 1RDUA 2ITMA 3CERA 4FLYA 2HVIA 1HRHA 3RRGA 4LF9K 2UXBK 1MA9B 1C0UA 5EVZA 1RBRA 3ENHA 1BQNA 3AVHA 3MN7A 3A2FA 1U47A 1Q86O 4A2AA 3NVKA 2DFHA 4N41A 1GLJO 3D2EB 2F9WA 5BRDA 4HUFA 1WAFA 2P9NA 1W0HA 3FLCO 3O3GA 5C10A 2O4GA 3J7ZO 3KLGA 1WSFA 3FGUA 1OKJA 4RTFD 3AO3A 3T1AA 1YI2N 1IKWA 1SS6A 4CERA 3TARA 3M6GA 4CZIA 3J81O 1EXQA 4ELVA 3S9HA 1T3VA 3C6AA 4FLWA 4FO0A 3C65A 2VCPA 4XH1A 4CCHA 4BE1A 3DXKA 3ZSZA 5AQIA 5CZ1A 3Q7BA 2HF4A 2RHKA 4RW8A 4GY2B 3M5RA 3KVGA 2PY5A 2G8WA 4DSJA 1B92A 4DQQA 3AVFA 4E7LA 1L3SA 1Q82O 4K25A 3IDHA 2A3ZA 2LSNA 1W97L 2E2PA 5KGXA 5B8HA 2WTUA 4DS4A 3HM8A 2BTFA 3VQCA 3SAHA 3A5LC 4HTUA 4JKDA 4MO5A 4FWPA 2HNDA 5DM6L 4GVEA 4AHUA 4YOUA 2HHQA 3NF6A 3IG1A 4FZXC 1C0FA 2RPIA 2QWMA 4KHWA 4AF1A 2W41A 1HNVA 1K6YA 5MLCQ 5DM7L 4FVUA 5KPTA 2GV9A 4N47A 2P9LB 4CBWA 2O8FB 4CJRA 4KB0A 4CJ3A 3AVCA 4CGJA 1HKCA 3SJHA 4GVMA 3QFUA 2WFBA 4K0KK 4M41A 4CFBA 4M3WA 3WNFA 3D2FB 3GOIA 3CCVN 4FJKA 5TKWA 4DFJA 4DR6K 4PWDA 5HRNA 3JSMA 3C95A 4KREA 1NJYA 1QZ5A 3V4IA 2CGKA 2JLEA 1QVGM 3A0IX 4OLBA 2YNHA 4DR3K 4I9LA 2VYPA 4G9ZA 3E1YA 1DKGD 4CJFA 3HPGA 3L3VA 3VQ9A 4NYNA 1BDGA 3V6DA 4Z4GA 3OVNA 2HVHA 3V9UA 1HR0K 1OH8A 4XEIA 4YORA 1EX4A 3THWB 4B1VA 4KAZA 4KFBA 4B9MA 4BREA 4FYDA 1F21A 3KD1E 4PL7A 4DUZK 1QVFM 2KFNA 3S3MA 1ASUA 3ASMA 4KHSA 2V7YA 3A5OC 3VF4A 3T3FA 3VA3A 3VQ8A 2AP1A 2BE2A 3SBGA 4FWMA 1U2VB 4CJPA 3KLEA 3C6TA 3CFPA 3W0LA 2GTDA 3EL2A 4FZZA 4NXNK 4CF0A 3MCPA 2HHXA 1OH7A 4KO0A 1XUPO 2P1JA 3ZCMA 1TK0A 1X3MA 1UA0A 4LH4A 3KIOA 3L6QA 3SBTA 5BPLA 3HXMA 4E1NA 3VGMA 3O1BA 2E2NA 1GOCA 2WONA 1FW6A 3BY5A 4DCHA 2KZZA 2Y1IA 4C8KA 1TAUA 4DV3K 1Z25A 1X9MA 2NUBA 4H4MA 3L2QA 4FLXA 3IKMA 2Z1JA 1U4BA 2PZSA 4IJAA 4FJ8A 2PYLA 1L3VA 3ENBA 1WBBA 4IBNA 1HNIA 3VQQA 3CC4N 4JHDB 3CCLN 2NNWA 4PHTX 2XO7A 3VEYA 2OYQA 3ATVA 3G6EN 4J2DA 2V52B 4E1MA 5J2NA 3CI5A 3NGZA 2RN2A 1J5OA 1XHXA 3LP3A 4HUGA 1Q8IA 1RT7A 3OY9A 4M3ZA 1NGCA 4EAHD 1RNHA 4B9QA 3OYMA 3WQUA 2QWLA 3OS2A 4BE2A 3ZSXA 4JI4K 4B3RK 5AQJA 1NGGA 5AQYA 4DUYK 4FJNA 4W5NA 1Z6RA 1BCOA 3HJFA 1XHZA 4CJUA 3QNOA 5LMNK 3QEPA 4I9QA 2FBYA 1RT3A 4FW2A 4Y0WA 5AQZA 4BC5A 1IBLK 1S1WA 5LMUK 2E2OA 1GLDG 3O8MA 4H0PA 3RMDA 2YV0X 3BUZB 1JJ2M 5J1EA 5AQUA 3MXMA 3LL3A 2QEXN 1VSLA 4KPYA 3C7NA 3MECA 2NRHA 3ULEB 3B6PA 2ETJA 1O1WA 4M42A 1JLGA 1K8KB 4B8CA 3AGKA 2ASOA 4NO7A 2QXLA 4DFPA 5AQTA 2QI2A 1H1VA 4F4KA 1T44A 2A1SA 5JVGL 4GV9A 3FFKB 3QETA 2QW9A 3VETA 1ZBHA 3CJCA 4LF7K 2O8DA 4Q5VA 4CK1A 3L3UA 5BRFA 1NK6A 4FM1A 5KQ8A 2NRVA 3AVLA 5CY4A 3NGIA 3CCEN 4C8OA 3DM2A 4FJ5A 1TKZA 2W6KA 3MX2A 5HP1A 3LDOA 3C0BA 5M1KA 1Z05A 4OVLA 1REVA 2OPPA 4O0IA 1T7PA 3E66A 4FWKA 1FKOA 3TU5A 2KQ2A 1X9WA 3BZCA 3MDQA 5EX5A 3EEQA 4JYAK 3J7AP 1WNSA 3RSEB 2P9PB 3H3OB 3VEWA 4AHTA 1K73O 3TTFA 3TABA 1BHLA 3K2PA 4A57A 3DWLA 4DTXA 3PSFA 5AQMA 1NGAA 1KQSM 3VGLA 2HSTA 4BG9A 4CHYA 4UY8O 3KLFA 1BCMA 2OANA 4BE0A 3LDPA 3SAGA 3O9TA 4KTQA 1LWCA 1BI4B 4W5TA 3P39A 1MWKA 3SV4A 2VGNA 1BQMA 1KVAA 4R79A 4FLTA 1TKTA 3SMPA 3CJ1A 3HSCA 3TANA 5C24A 3WUHA 2XY7A 4H0VB 4IXCA 3CFOA 4CHNA 3VQ6A 4JS5A 3AVNA 3I8BA 2ZJQL 1EWQA 2ATQA 1QSLA 2HNYA 4L8RB 4YDUA 4IFYA 3OYLA 4JK8A 1QQCA 4PQUA 4MDBA 4DV7K 4DV5K 1YHQN 3CFRA 1BIZA 1HJRA 1D9DA 2OZSA 1TYQA 3AA2A 4IZ9A 1TL1A 1BWFO 1LWFA 5KPRA 4KI4A 1U45A 2ASMA 2HBLA 4FOIA 1HKGA 4LC9B 4AM6A 3T19A 3AVAA 4DTUA 2E6MA 1QTMA 1QQMA 3LWMA 5KQDA 3NH1A 4CJVA 1S1UA 2OTLN 3O3FA 2F8SA 3AAPA 1KVBA 3CG7A 3L2WA 4KH6A 4BR9A 2O8CA 3VMFB 3SQ1A 1W9HA 3QEWA 1WN7A 4W5RA 1XQSC 2V7ZA 3NH0A 4DU3A 1N36K 3DLEA 4E7IA 2P9UB 4C23A 3UKUB 4DTMA 3DXMB 3O9UA 4FK4A 4H0TB 1N8RO 4CIFA 2ZJRL 2E20A 3THXA 1WSGA 1HX1A 3VGKA 2YHXA 1KLMA 1NMDA 1B9DA 4DV0K 4ID1A 3AO5A 3CPWM 2E6LA 2O8BB 3TAQA 2ZM6K 4IG0A 4LFAK 3TSUA 2YJFA 3HM9A 3I55N 4JK9A 4CEFA 3KKSA 3CQ8A 4CHZA 3FZLA 2KFZA 4H0XB 4FWNA 1NK0A 3VESA 4DS5A 3VOVA 4CD3A 3KWGA 1S1VA 3EKSA 4CEDA 4B9UA 1NGIA 3QERA 1LOTB 2G8UA 1NLVA 4BRNA 3O9QA 5HLFA 3HK2A 3MCAB 5M1FA 3EZWA 5EY4A 4FZYA 3LP0A 2P9NB 3VEOA 4BRPA 3LALA 3HVRA 2ITGA 4OLAA 1P8ZA 5KRSA 2FBXA 3CETA 2A6AA 3CIPA 3PLAA 2UU9K 4B3SK 4CZKA 3KTQA 3ATUA 2QKBA 5FPMA 3PIPL 3IS9A 1LWEA 3DRRA 4ZTJA 3N4QA 3L0QA 4O44A 1Q9YA 4CFDA 4CESA 4YOYA 3DXKB 1YIJN 1U04A 2FLOA 4BVPA 1Q7YO 3LZIA 3KKRA 5C2DA 3NMUA 4NCAA 3GBTA 5HL7L 1N5YA 2AJQA 3OYBA 3VQ4A 1TKDA 3AVMA 2PFUA 4J2EA 3I33A 2NRRA 2E1YA 1RT5A 2KLAA 3LZJA 2HBKA 4JI7K 3PX0A 3ZSQA 3P31A 5JS1A 3CJ7A 3O3HA 2KTQA 2OCEA 3M1FA 4JEPA 4XH4A 5JLHA 4CZEA 2VG7A 3RMBA 1RTJA 1SKSA 1W7AA 4CF8A 3G25A 2KKZA 1NGHA 3MXJA 2NRTA 1NOYA 2FSKA 4CJSA 5BN8A 4LSNA 1KCFA 4N5SA 4IOXA 5I42A 3L4IA 4OGCA 3RWUA 1YT3A 2QWQA 4NLCA 4N56A 3AV9A 3DLHA 4PUOA 3ZT4A 3P38A 4BDPA 1BISA 1QE1A 1ZXOA 2E88A 2D0BA 1EQYA 3O6WA 4DQSA 3ALYA 1CXQA 5IWAK 3ZLJA 1C1AA 4X62K 3RVCA 5AQVA 2XY8A 4IDHA 3BP8A 1C1BA 5FPEA 1WSIA 5J2MA 3CC7N 4BR0A 1DT9A 1Y64A 4JLHA 3NCIA 3VQPA 5AQKA 1RDCA 3VERA 2ZGYA 3ZSWA 4PL8A 4IFVA 3SPZA 1Q9XA 2D4WA 4FVMA 3TAFA 5M1PA 5AQFA 3U9ZA 4XIUA 3OYHA 1TK5A 4ISEA 5AQWA 1HQEA 4I2QA 2XY5A 4Y1CA 4BQLA 5KGWA 4DF8A 4AHVA 3TTCA 4OX9K 3VQ5A 3TWHA 1RDAA 1SV5A 4XH5A 3L2UA 2IC3A 4H5WA 4FJHA 2QWPA 4IDKA 3NBPA 3HTVA 3EKUA 4BRGA 4GW6A 1QHTA 4LD0A 4CF1A 1NK5A 4IEEA 2D5RA 3QIOA 3SK3A 4CJQA 5SWMA 3WXKA 2Z1IA 3LDLA 1KC8O 4UQGA 4QAGA 1GLAG 1NGFA 2D0OA 3SLCA 2OPSA 3R8EA 2HW3A 4CHOA 2Q0RA 1RBSA 4OJRA 1WBDA 3CM6A 3VEZA 3KD5E 3ZX2A 2W42A 2W40A 4PKHA 3O1WA 4F2RA 1ZBUA 3FR0A 4Q0BA 2HF3A 2D1KA 4M3YA 2E8AA 3QB0A 3OTOK 3D0PA 1JXBA 4F8RA 1E4GT 3PO4A 1YXQA 1FKPA 4M7XA 2GEMA 4M3XA 4KHQA 4EZ9A 3CMEN 2HMIA 3VTHA 3KLHA 1UWBA 3MAQA 3QLHA 5K14A 4O5FA 4A61A 2FC0A 1NK4A 1WOQA 3OS1A 4M7YA 1J53A 4PKIA 4DTOA 4WFAL 3JXUA 4BGBA 5HOOA 4O8UA 3LAMA 4BACA 2IDOA 4E89A 4O5BA 4GKKK 5M1QA 1WSEA 1BIUA 1XNQK 1EWRA 3AVJA 3QBWA 4YOWA 4CVNE 3QBXA 4CGDA 3JS6A 4K42A 1NJIO 4X66K 4BQZA 1X9JA 4A5BA 2HOEA 3A5NC 2H3GX 2QWRA 1RTIA 1TUUA 5M1OA 4AHCA 2JWLA 1JXEA 2B5JA 1NK8A 4OPAA 3ZSYA 3KHYA 3OYCA 3F73A 1VSIA 2IVOA 2OTJN 1SZ2A 1ESVA 1D8YA 3SQ0A 4B8AB 1NBWA 2RF2A 4BDYA 1S1XA 1GOBA 3CJAA 3HPHA 3DMJA 1TKXA 5GAEP 4CD1A 3C7NB 1O13A 3CJ9A 3K9JA 1SUQA 2E4LA 1YITN 3KZBA 3W3DA 3QEIA 1IJJA 2YCHA 2A42A 3OJSA 1TL3A 4JKHA 5FPDA 1NNEA 5ADXH 2YX6A 4H5RA 3OYIA 5E26A 3HOTA 4BR2A 4CF9A 3WNEA 4HCCA 4JI1K 3LDNA 2O8DB 3ZSRA 1B9FA 2J4RA 5C42A 3AVKA 4DTPA 1V4TA 2YNGA 2P9IB 3CQXA 1UAXA 2QTDA 1SKWA 1IKXA 1VSDA 1TK8A 2F4VK 1KAYA 2ZE2A 4RW6A 4EHTA 3O80A 5JLFA 2CGLA 4Z4CA 2P5GA 2G8KA 3CCQN 1WAJA 5CE3A 1HNWK 1NMNA 4OKJA 3RMCA 1VHXA 3V9SA 1C0GA 4OPKA 1XMOK 4AH9A 4FWRA 4ZTFA 1EETA 3CQYA 2IS3A 1VQKN 1KSPA 2FBVA 1V4SA 3GG4A 4MLEA 1HNZK 4FW1A 1NK7A 5AQRA 1S9GA 3QEVA 4LFCK 3GDQA 2Q3SA 4KB1A 4JI6K 1VK0A 4E7HA 4BRFA 4CZGA 3HVTA 1VSJA 3PIOL 3QNNA 1VSKA 5AQXA 5AFUH 3DAWA 2P9KA 4V19S 3HSTB 3PY8A 4BC4A 4LF6K 3CPEA 3F5TA 4DFKA 3V9WA 4AM7A 3AO1A 4F3TA 1M1KO 3HT3A 3H45C 3HOSA 1VSHA 3GE1A 4ELTA 1RDBA 2VWKA 3M8SA 2P9SA 3L4QA 3NF8A 3ZSOA 1HNXK 3VPZA 3DLKA 3ZT1A 4H5TA 3VQ7A 2FSNA 1ASVA 3G4SN 4CIEA 4KH5A 1YVNA 3Q7CA 3VEXA 4JK7A 3E9OA 3TPQA 2KW4A 3WQTA 2X6NA 3FZHA 2FXUA 3VENA 4CF2A 1C0TA 4U7BA 5KPZA 4JI3K 4W5QA 3HI0A 3VEVA 4JKBA 2P9IA 1GLLO 5HROA 4JI8K 1TYQB 3DLRA 4FXDA 4FJ9A 3HRGA 5C0YA 3BF1A 3BF3A 1IH7A 1VQNN 3QINA 3WXIA 4YOVA 2HHHK 4DWIA 4QCLA 1VQ7N 4BRLA 1DTQA 3LAKA 1I3AA 3H1QA 4BWMA 4OPJA 2F7TA 3ID8A 1I94K 4BR4A 1DTTA 3MEGA 1VAZA 4ID5A 1RTHA 1NGEA 4RWTA 4WF9L 2QKKA 4YOTA 1G15A 4E3SA 2O8CB 3ZEUA 2A41A 3WNGA 5AZJA 1YF5L 4DSEA 4J8FA 3OYDA 1SL1A 4CIGA 4KRFA 4QS9A 1K8AO 1KAZA 1YJ9N 3ULDA 1X1PA 3NHGA 3RR7A 2WUSA 3P1GA 1A5VA 2GWJA 3MEDA 5EXWA 3THXB 2A1RA 1JLEA 3P5JA 3OW2M 4GKJK 3PV8A 4CJ4A 1FJGK 1RDDA 5H1SQ 4YFUA 4H5VA 4CZMA 1NJXA 4J2BA 4DU4A 4X64K 5BN9A 3TI0A 5E84A 4JN4A 2CH6A 2ASPA 4BRKA 3QESA 3E9LA 4FLZA 4E0DA 2IGIA 3QFPA 2P51A 4MQ3A 4FOEA 3RTVA 3F2KA 2JWKA 4AILC 1XMQK 1S5JA 4K41A 2QWOA 4JKEA 1RFQA 2VG5A 4WQ5A 2BDPA 2DPNA 4DSFA 3VA0A 1JL2A 4KHYA 4I7FA 3ZSVA 4CK2A 3SAFA 1K9MO 4Z0UA 3CCJN 2HMPA 3MWPA 5BRHA 4DV6K 2HB5A 5EU7A 5KTQA 4QOZB 3H08A 3ISNC 1U49A 4EIAA 3KWIA 3OBWA 1OVYA 1ATSA 3UKRB 5C12A 3V81A 4K43A 3UE5A 4BROA 5BPMA 3SQ2A 2KZMA 2HHVA 1VQPN 4I6MA 4FCYA 3K5OA 3KJVA 4OKEA 3QDKA 5A2QO 1LCUA 4Z94A 2D0PA 2BANA 3DRPA 1U6ZA 3IFRA 3T7ZA 3F9KA 3SPYA 3HZ6A 3AO2A 3PO5A 1KFDA 3LWLA 3VN5A 5C2FA 4I2PA 1VQ9N 5LJWA 1HYSA 4YNQA 4DV2K 4CJLA 4DV1K 4CE9A 4AHRA 5DK5A 5AZIA 3V1QA 3SQ4A 4JRPA 3MN5A 1YJNN 3A8YA 2IVPA 2YHYA 3B6OA 4CEBA 2ZD1A 1QHAA 1JKHA 1MDUB 4DFMA 2HBJA 1VRUA 4WFNL 3K58A 4YY3K 4IOAL 1T8EA 3TAMA 3D45A 3NE6A 2Q36A 1J54A 4CEOA 5ADXA 2OA8A 4B9LA 3HP9A 1HYZA 1C1CA 1G99A 1VQLN 1IV0A 5LJVA 2HHSA 4H0OA 3HO1A 5M1NA 3HYFA 4JKGA 3EN9A 2HHUA 3P4IA 3AVGA 5KI6A 4H8KA 1WB9A 3LP1A 5C25A 1WLJA 1BA1A 1ZBSA 3AGRA 5F2RA 1XNRK 4W5OA 4NYFA 1JLCA 1X3NA 4MLHA 3J7YP 3EE9A 4Z4EA 2VG6A 1QQOA 3K57A 4DB3A 1CZBA 2OPQA 1RTDA 4O0JA 3MEEA 4FJGA 3UKRA 1D5AA 1IG9A 2GELA 1Q81O 3U4LA 3WEEA 3SUOA 4KH4A 3LPUA 4N76A 1JLBA 1KVCA 3RMAA 4EFHA 2CH5A 2QXFA 4B1UB 2NRWA 3IAYA 3BDPA 5FDLA 1T03A 3SMSA 4DLEA 5EOYA 4M3TA 1IG8A 3VF2A 5LY3A 1U48A 3DLLL 3SZ2A 4WQ4A 4RCHA 4M63C 3HPOA 4IO9L 5J2PA 1D9FA 4B9NA 1TVRA 2RKIA 3ITHA 4IWVA 3R1XA 5BREA 5AFUA 1KFSA 4CBXA 3AARA 4DQ8A 3PSIA 4HHTA 1HJOA 4CBUA 5I3UA 2PBDA 3UB5A 5T7BA 3EZ5A 1NGJA 3R6MA 3WXJA 3OYNA 2WBNA 4CZHA 3CC2N 1ATRA 4C8LA 2GX9A 4FJMA 5DMRA 3V1RA 3CCRN 2DFFA 4MO4A 1YVUA 4LH5A 3AO4A 3L2VA 1KTQA 3LM2A 2DY4A 4B1ZA 1KRPA 4JV5K 3E9PA 3TAPA 1SL0A 1BU6O 3K5MA 3OYAA 3ID6A 5GIPA 1DGKN 5AR0A 4YOXA 1VQ4N 2X6SA 2FSJA 4JKAA 3QIPA 1RDWX 4KHPK 4A5AA 2A5XA 4CJWA 2ZQBA 3SJJA 1XWLA 1BUPA 3K5NA 3OBYA 2B6AA 4OO1J 4BRIA 4DTRA 1RBTA 5J2QA 3AY9A 3OYGA 4K8XA 4RW4A 3J8AA 3FZFA 4BRAA 4FK0A 1NOZA 3IRXA 1TUYA 5ELZA 2UUCK 1XI1A 4ILHA 2F96A 2PAVA 2NRZA 1SQKA 4B9VA 4HUEA 3PX4A 4B1XB 4Z4IA 2DFEA 3A5MC 3IUCA 4DLGA 2O8EA 4R5PA 1QQNA 1QSYA 4CGFA 2XHBA 2YI1A 4DG1A 1GLCG 4ISGA 2JGUA 2I5JA 1WUAA 3T1HK 2G8HA 2Q97A 4JI5K 4OPHA 5JS2A 3V9ZA 4RW9A 2YHWA 4CJ5A 4KI6A 1NWKA 3K0SA 3ZETA 5CZ2A 3DYAA 4CGGA 4CFCA 4O55A 4JD2A 3BGRA 4H03B 5GAHP 3FZKA 4CHPA 1IBMK 3CCUN 1JCGA 2EWSA 2IIRA 2YHBA 3OJUA 5KRTA 2O4IA 4KKOA 5JMVA 3OYJA 1Z26A 4CZJA 2HBMA 4O8KA 3WXLA 2HNZA 3THVA 1RILA 1NK9A 4NLBA 2VWBA 2GUIA 3EY1A 3K5LA 1JL1A 1KD1O 1EO1A 1FXXA 1Y97A 3I56N 4FPBA 3ZX3A 1S3XA 4LFBK 2YNFA 2E5LK 4EP5A 4KHNA
chains in the Genus database with same CATH topology
1TKTA 4DSKA 1DLOA 3L2RA 2FBVA 3SYZA 1KSPA 4F2SA 1A5WA 4KTWA 4CEAA 3TANA 4FW1A 1NK7A 4CJKA 5C24A 1NJZA 1WSHA 4CEEA 2XY7A 3CFOA 1S9GA 3VQ6A 3AA5X 3AVNA 4CHNA 1EP4A 1IKVA 4M45A 5SZTA 4JS5A 2ATQA 2Q3SA 1TGOA 1QSLA 4KB1A 2HNYA 1A5XA 1VK0A 4E7HA 4CGIA 2B4JA 4IFYA 2YHAA 3OYLA 4RG8A 1ZYQA 1T05A 4HVJA 1R0AA 1QQCA 3HVTA 4PQUA 1TV6A 1VSJA 3QNNA 1VSKA 4FJIA 1C6VA 4O4GA 4B08A 1KLNA 3CFRA 4FK2A 1BIZA 1BGXT 1HJRA 2X78A 3HSTB 1D9DA 3PY8A 2OZSA 1CZ9A 4OKKA 3AA2A 4DFKA 4PA1A 1TL1A 3V9WA 1LWFA 3AVIA 3DLBA 4KI4A 3AO1A 4F3TA 1U45A 1EKEA 1LAWA 3HT3A 3QEVA 3DI6A 1VSHA 4WE1A 2Z1GA 1RDBA 2VWKA 3VQEA 4ELTA 3ZT3A 3M8SA 4H4OA 3T19A 3NF8A 1QS4A 3AVAA 3ZSOA 4DTUA 2E6MA 3KK2A 1QTMA 3DLKA 3M8PA 4DSLA 4FJJA 3ZT1A 1VSFA 4OGEA 3LWMA 3VQ7A 1RBUA 1ASVA 3NH1A 4CECA 4FM2A 4CJEA 4DTNA 1MU2A 4CJVA 4CIEA 1WSJA 1S1UA 2G8VA 2QK9A 5CYMA 1XC9A 3O3FA 2F8SA 4B9SA 3KK1A 4K8ZA 1KVBA 2KW4A 3CG7A 4BWJA 2IOCA 3L2WA 2P5OA 2X6NA 2HVIA 4FLYA 4RW7A 3SQ1A 5D3GA 3LDSA 1W9HA 1HRHA 3RRGA 4CF2A 4CK3A 1WN7A 4W5RA 3QEWA 3ZT2A 1C0UA 3V9XA 2HHWA 4E7JA 1C0TA 3NH0A 4W5QA 1RBRA 3DLEA 4DU3A 1BQNA 1RT2A 3AVHA 3U3GA 3SUPA 3A2FA 4E7IA 1U47A 1X9SA 4JRQA 4B9TA 3PUFA 5HROA 2DFHA 3DLRA 4E7KA 4FXDA 1S6PA 4FJ9A 1NJWA 4N41A 4DTMA 4FK4A 3K59A 1IH7A 3ZT0A 4CIFA 2HHTA 3QINA 4HUFA 1WAFA 3U3YA 4DQPA 1WSGA 4DWIA 3HP6A 3UIQA 1W0HA 3O3GA 1KLMA 4QCLA 2O4GA 1B9DA 3KLGA 1WSFA 1DTQA 3LAKA 1I3AA 4BWMA 4OPJA 4ID1A 3AO5A 4ELUA 1ZBLA 2E6LA 4FJXA 4B3OA 1DTTA 2WOMA 3MEGA 3AO3A 3T1AA 3TAQA 1IKWA 4ID5A 4CERA 4L8RB 1RTHA 3TARA 4IG0A 1N6QA 4KHUA 3RR8A 2QKKA 1G15A 3HM9A 4E3SA 3SUNA 1EXQA 4ELVA 4CEFA 3KKSA 3CQ8A 3S9HA 5CYQA 4FLWA 4CHZA 4BDZA 3WNGA 2KFZA 1GOAA 4E19A 5FRMA 4CCHA 1NK0A 1S9EA 4DS5A 4DSEA 3KK3A 4BE1A 1VRTA 3ZSZA 3OYDA 3NFAA 1SL1A 5CZ1A 4CIGA 4KRFA 4RW8A 1S1VA 4CEDA 3ULDA 4B9UA 1IKYA 3QERA 1X1PA 3NHGA 2PY5A 3RR7A 2G8WA 5E41A 2G8UA 3P1GA 4DSJA 1SKRA 1B92A 4DQQA 3AVFA 5HLFA 3HK2A 3OYEA 4E7LA 1L3SA 2LSNA 1A5VA 4EZ6A 3MEDA 4FZYA 3LP0A 3C94A 1JLEA 3P5JA 2A1RA 2R7YA 3LALA 5KGXA 3VQDA 3PV8A 4CJ4A 3HVRA 4EP4A 1IO2A 4DS4A 1RDDA 3DRSA 3LP2A 4YFUA 1NJXA 4J2BA 2ITGA 4DU4A 3VQCA 4OLAA 1FK9A 3TI0A 1L3TA 4HTUA 4C8MA 5KRSA 3C6UA 2FBXA 2OPRA 3TR8A 3M8RA 3QESA 1L5UA 4FLZA 4E0DA 2IGIA 2HNDA 2P51A 4MQ3A 3S3OA 3KTQA 1D9FA 4AHUA 3RTVA 4AILC 1S5JA 3NF6A 3IG1A 3DOKA 4FZXC 1RCHA 2RPIA 2QKBA 4DQIA 3IS9A 1NKBA 1LWEA 1VSEA 3DRRA 4ZTJA 4KHWA 4O44A 3SV3A 1HNVA 1Q9YA 1K6YA 1CXUA 4CESA 4CFDA 2VG5A 2GV9A 4N47A 2BDPA 3HL8A 1HMVA 4DSFA 3TAGA 2XRIA 1JL2A 4CJRA 3VA0A 4CJ3A 1U04A 3AVCA 4CGJA 4KB0A 4KHYA 4I7FA 3ZSVA 4CK2A 4GVMA 4Z0UA 3LZIA 3KKRA 4M41A 4CFBA 4M3WA 4NCAA 3WNFA 1N5YA 2AJQA 3OYBA 3VQ4A 4FJKA 2HB5A 3O4NA 1TKDA 3AVMA 5EU7A 5KTQA 4QOZB 1JLFA 3H08A 3ISNC 4DFJA 1U49A 4J2EA 4HCBA 1RT5A 4PWDA 3LZJA 5HRNA 4ICLA 3V81A 3PX0A 4AHSA 3JSMA 3SQ2A 2KZMA 4FJ7A 4LSLA 3ZSQA 2HHVA 5JS1A 3C95A 4KREA 1NJYA 3O3HA 2KTQA 3V4IA 4FCYA 3K5OA 3KJVA 4OKEA 2JLEA 4FLUA 4OLBA 2YNHA 2VG7A 3RMBA 2BANA 1RTJA 3DRPA 4I9LA 1SKSA 1CLQA 4CF8A 4CJFA 3HPGA 1S6QA 3L3VA 3NAEA 3VQ9A 3TAEA 4NYNA 3F9KA 4DTJA 3U6FA 3V6DA 3SPYA 3MXJA 4Z4GA 3OVNA 2HVHA 1NOYA 3V9UA 1NKCA 1RT4A 4CJSA 3AO2A 1ASWA 4LSNA 1KCFA 3PO5A 4N5SA 1KFDA 3LWLA 3VN5A 5I42A 3VQBA 4I2PA 4OGCA 3RWUA 1YT3A 3P83D 1EX4A 1VSMA 4YNQA 1HYSA 1ZBFA 4N56A 2D0CA 3I0SA 4CJLA 3AV9A 4KAZA 4KFBA 4B9MA 4CE9A 3DLHA 4FYDA 4AHRA 5DK5A 4PUOA 3V1QA 3NDKA 3SQ4A 1F21A 3ZT4A 3KD1E 4JRPA 4BDPA 1BISA 3FFIA 1QE1A 4CEZA 3B6OA 2D0BA 2KFNA 4CEBA 4DQSA 2ZD1A 3ALYA 1CXQA 3I0RA 3S3MA 1JLAA 1ASUA 3ASMA 4KHSA 1JKHA 1C1AA 4DFMA 4PY5A 4Z4IA 2G8IA 3T3FA 3L2VA 2PYJA 1VRUA 3VA3A 3SCXA 3K58A 3VQ8A 2BE2A 2XY8A 1LW0A 4MFBA 4JS4A 3OYKA 1C1BA 5J2MA 1WSIA 1T8EA 3TAMA 4CJPA 3KLEA 3C6TA 3D45A 3NE6A 1LAVA 4JLHA 3NCIA 3VQPA 3CFPA 4FZZA 1RDCA 4CF0A 3ZSWA 1J54A 4C8NA 4CEOA 4CFAA 2YNIA 2OA8A 4IFVA 3SPZA 2HHXA 1Q9XA 4B9LA 3HP9A 1HYZA 3QEXA 4NCGA 1C1CA 2YKNA 4FVMA 3PX6A 3TAFA 4KO0A 2P1JA 3NF9A 3ZCMA 1TK0A 2HHSA 4XIUA 1LV5A 3OYHA 1TK5A 4G1QA 1UA0A 4LH4A 3KIOA 3HO1A 3AVBA 3HYFA 1HQEA 4I2QA 1QSSA 2XY5A 4M3RA 2HHUA 3AVGA 5KI6A 4H8KA 4Y1CA 3HXMA 5KGWA 3LP1A 4AHVA 4E1NA 5C25A 4DF8A 4FJLA 1WLJA 2F8TA 3JYTA 3VQ5A 1GOCA 2WONA 5HBMA 5HRPA 3TWHA 1RDAA 1SV5A 4GMJB 4W5OA 3L2UA 4NYFA 2IC3A 2Y1IA 4C8KA 1JLCA 4Z4HA 1Z25A 1X9MA 1TAUA 3E01A 2NUBA 4Z4EA 1RT1A 4FJHA 2VG6A 4H4MA 4IDKA 3KLHA 3NBPA 5HRRA 3L2QA 1CZBA 2OPQA 3K57A 4O0JA 3MEEA 4FLXA 1RTDA 4FJGA 4NCBA 2Z1JA 1U4BA 2YKMA 2PZSA 5FRNA 1D5AA 4GW6A 2XY6A 1QHTA 3NF7A 1IG9A 4FJ8A 2EX3A 1RBVA 4LD0A 3SUOA 2PYLA 3LPUA 4CF1A 1NK5A 1L3VA 4IBNA 1JLBA 1KVCA 4N76A 1HNIA 3VQAA 2D5RA 3QIOA 4CJQA 3VQQA 2KZZA 3RMAA 5SWMA 2Z1IA 2QXFA 3SNNA 3IAYA 2XO7A 4UQGA 3BDPA 5FDLA 1T03A 4QAGA 4DLEA 2OYQA 2EHGA 3AA3A 4M3TA 1U48A 4J2DA 3SZ2A 2OPSA 4E1MA 2HW3A 5J2NA 3HPOA 3DOLA 4CHOA 2RN2A 1RBSA 4OJRA 3NGZA 3CM6A 5J2PA 1XHXA 1J5OA 3LP3A 4HUGA 1Q8IA 1RT7A 3OY9A 4B9NA 3KD5E 1TVRA 4M3ZA 4ZHRA 2HHQA 2RKIA 3ITHA 2W42A 1KFSA 1RNHA 4F2RA 1ZBUA 4HHTA 4FM0A 4Q0BA 4CHQA 3OYMA 4M3YA 3OS2A 5I3UA 3D0PA 3ZSXA 1JXBA 4BE2A 4F8RA 5T7BA 3EZ5A 1SL2A 3PO4A 4FJNA 1NKEA 4W5NA 1BCOA 3OYNA 4KTZA 4CJTA 1FKPA 4DU1A 3SI6A 3HJFA 1XHZA 4CJUA 1HQUA 4M3XA 4KHQA 4C8LA 3QNOA 3QEPA 4EZ9A 4I9QA 4FJMA 2FBYA 5DMRA 3V1RA 2HMIA 1RT3A 1YVUA 2DFFA 3CYMA 3AO4A 3NGYA 1KTQA 3KLIA 1UWBA 4FW2A 4LH5A 3QLHA 5K14A 3MAQA 4F3OA 2DY4A 1KRPA 3LPTA 1S1WA 3LANA 3TAPA 2FC0A 1SL0A 3OS0A 3K5MA 3OYAA 1NK4A 3OS1A 4Z4FA 3RMDA 2X6SA 2YV0X 2G8FA 4DTSA 4LY7A 5J1EA 1J53A 4DTOA 3MXMA 3QIPA 4DQRA 1S1TA 1VSLA 4KPYA 3MECA 3LAMA 4CJWA 2ZQBA 4BACA 2Y1JA 3SJJA 1XWLA 2GBZA 2IDOA 4E89A 3K5NA 4O5BA 2B6AA 1WSEA 1BIUA 3B6PA 1HYVA 2ETJA 1O1WA 3AVJA 4M42A 1JLGA 4DTRA 1RBTA 5J2QA 2OZMA 4IKFA 4B8CA 3EYZA 4CGDA 3OYGA 1LW2A 1YTAA 2IAJA 3OYFA 4DFPA 1TAQA 4K8XA 4TSXA 4RW4A 4KV8A 3CM5A 3M8QA 5FROA 4FK0A 1NOZA 3AA4A 3IRXA 1RTIA 2A1SA 4DMNA 4F4KA 1HPZA 3RRHA 4AHCA 3SUQA 1JXEA 5HRSA 1XI1A 2B5JA 2F96A 1NK8A 4FLVA 1L3UA 3ZSYA 3QETA 1ZBHA 4B9VA 3OYCA 3F73A 4Q5VA 4HUEA 3DLGA 3L3UA 4CK1A 4DF4A 3PX4A 1VSIA 2DFEA 3G10A 3G0ZA 4DLGA 1NK6A 4FM1A 1D8YA 1YTUA 4R5PA 3V1OA 3AVLA 5CY4A 3NGIA 3SQ0A 4C8OA 3DM2A 4CEQA 1QSYA 4FJ5A 1TKZA 3WNHA 4B8AB 2RF2A 4CGFA 4BDYA 5HP1A 1S1XA 1GOBA 2XHBA 3HPHA 3DMJA 2FBTA 1REVA 1TKXA 2OPPA 4OVLA 4DG1A 4O0IA 1BI4A 1T7PA 2JGUA 2I5JA 4CGHA 1SUQA 2E4LA 2Z1HA 2G8HA 1C0MA 1FKOA 5JS2A 2D0AA 3V9ZA 2KQ2A 3QEIA 1X9WA 4RW9A 3OJSA 1TL3A 4CJ5A 4KI6A 2BGGA 5CZ2A 3DYAA 4CGGA 1WNSA 4CFCA 3OYIA 4AHTA 1UA1A 2VWJA 4O55A 4CF9A 3BGRA 4CHPA 3WNEA 1RT6A 2YHBA 1BHLA 3O4QA 3TABA 3OJUA 3MXIA 3K2PA 5KRTA 4HCCA 4DSIA 4M3UA 2O4IA 4DTXA 4KKOA 1JLQA 4J2AA 3ZSRA 1ITGA 1B9FA 1BL3A 5C42A 3AVKA 4DTPA 1J9AA 1Z26A 3OYJA 2YNGA 4CHYA 3KLFA 1UAXA 1SKWA 1IKXA 3I8DA 1BCMA 1VSDA 4IG3A 4BE0A 1TK8A 2HNZA 2ZE2A 3THVA 1RILA 2DTUA 1NK9A 4RW6A 2GUIA 3EY1A 3K5LA 2X74A 1JL1A 1ZBIA 4Y1DA 4Z4CA 1LWCA 4KTQA 1UOCA 2P5GA 2G8KA 1BI4B 4W5TA 1WAJA 4OKJA 1FXXA 3SV4A 3RMCA 1Y97A 3V9SA 3NH2A 3S3NA 1BQMA 4OPKA 3QO9A 4AH9A 4ZTFA 1KVAA 1EETA 2YNFA 2IS3A 3L8BA 4EP5A 4KHNA 4FLTA 1I39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKT A;  4DSK A;  1DLO A;  3L2R A;  2FBV A;  3SYZ A;  1KSP A;  4F2S A;  1A5W A;  4KTW A;  4CEA A;  3TAN A;  4FW1 A;  1NK7 A;  4CJK A;  5C24 A;  1NJZ A;  1WSH A;  4CEE A;  2XY7 A;  3CFO A;  1S9G A;  3VQ6 A;  3AA5 X;  3AVN A;  4CHN A;  1EP4 A;  1IKV A;  4M45 A;  5SZT A;  4JS5 A;  2ATQ A;  2Q3S A;  1TGO A;  1QSL A;  4KB1 A;  2HNY A;  1A5X A;  1VK0 A;  4E7H A;  4CGI A;  2B4J A;  4IFY A;  2YHA A;  3OYL A;  4RG8 A;  1ZYQ A;  1T05 A;  4HVJ A;  1R0A A;  1QQC A;  3HVT A;  4PQU A;  1TV6 A;  1VSJ A;  3QNN A;  1VSK A;  4FJI A;  1C6V A;  4O4G A;  4B08 A;  1KLN A;  3CFR A;  4FK2 A;  1BIZ A;  1BGX T;  1HJR A;  2X78 A;  3HST B;  1D9D A;  3PY8 A;  2OZS A;  1CZ9 A;  4OKK A;  3AA2 A;  4DFK A;  4PA1 A;  1TL1 A;  3V9W A;  1LWF A;  3AVI A;  3DLB A;  4KI4 A;  3AO1 A;  4F3T A;  1U45 A;  1EKE A;  1LAW A;  3HT3 A;  3QEV A;  3DI6 A;  1VSH A;  4WE1 A;  2Z1G A;  1RDB A;  2VWK A;  3VQE A;  4ELT A;  3ZT3 A;  3M8S A;  4H4O A;  3T19 A;  3NF8 A;  1QS4 A;  3AVA A;  3ZSO A;  4DTU A;  2E6M A;  3KK2 A;  1QTM A;  3DLK A;  3M8P A;  4DSL A;  4FJJ A;  3ZT1 A;  1VSF A;  4OGE A;  3LWM A;  3VQ7 A;  1RBU A;  1ASV A;  3NH1 A;  4CEC A;  4FM2 A;  4CJE A;  4DTN A;  1MU2 A;  4CJV A;  4CIE A;  1WSJ A;  1S1U A;  2G8V A;  2QK9 A;  5CYM A;  1XC9 A;  3O3F A;  2F8S A;  4B9S A;  3KK1 A;  4K8Z A;  1KVB A;  2KW4 A;  3CG7 A;  4BWJ A;  2IOC A;  3L2W A;  2P5O A;  2X6N A;  2HVI A;  4FLY A;  4RW7 A;  3SQ1 A;  5D3G A;  3LDS A;  1W9H A;  1HRH A;  3RRG A;  4CF2 A;  4CK3 A;  1WN7 A;  4W5R A;  3QEW A;  3ZT2 A;  1C0U A;  3V9X A;  2HHW A;  4E7J A;  1C0T A;  3NH0 A;  4W5Q A;  1RBR A;  3DLE A;  4DU3 A;  1BQN A;  1RT2 A;  3AVH A;  3U3G A;  3SUP A;  3A2F A;  4E7I A;  1U47 A;  1X9S A;  4JRQ A;  4B9T A;  3PUF A;  5HRO A;  2DFH A;  3DLR A;  4E7K A;  4FXD A;  1S6P A;  4FJ9 A;  1NJW A;  4N41 A;  4DTM A;  4FK4 A;  3K59 A;  1IH7 A;  3ZT0 A;  4CIF A;  2HHT A;  3QIN A;  4HUF A;  1WAF A;  3U3Y A;  4DQP A;  1WSG A;  4DWI A;  3HP6 A;  3UIQ A;  1W0H A;  3O3G A;  1KLM A;  4QCL A;  2O4G A;  1B9D A;  3KLG A;  1WSF A;  1DTQ A;  3LAK A;  1I3A A;  4BWM A;  4OPJ A;  4ID1 A;  3AO5 A;  4ELU A;  1ZBL A;  2E6L A;  4FJX A;  4B3O A;  1DTT A;  2WOM A;  3MEG A;  3AO3 A;  3T1A A;  3TAQ A;  1IKW A;  4ID5 A;  4CER A;  4L8R B;  1RTH A;  3TAR A;  4IG0 A;  1N6Q A;  4KHU A;  3RR8 A;  2QKK A;  1G15 A;  3HM9 A;  4E3S A;  3SUN A;  1EXQ A;  4ELV A;  4CEF A;  3KKS A;  3CQ8 A;  3S9H A;  5CYQ A;  4FLW A;  4CHZ A;  4BDZ A;  3WNG A;  2KFZ A;  1GOA A;  4E19 A;  5FRM A;  4CCH A;  1NK0 A;  1S9E A;  4DS5 A;  4DSE A;  3KK3 A;  4BE1 A;  1VRT A;  3ZSZ A;  3OYD A;  3NFA A;  1SL1 A;  5CZ1 A;  4CIG A;  4KRF A;  4RW8 A;  1S1V A;  4CED A;  3ULD A;  4B9U A;  1IKY A;  3QER A;  1X1P A;  3NHG A;  2PY5 A;  3RR7 A;  2G8W A;  5E41 A;  2G8U A;  3P1G A;  4DSJ A;  1SKR A;  1B92 A;  4DQQ A;  3AVF A;  5HLF A;  3HK2 A;  3OYE A;  4E7L A;  1L3S A;  2LSN A;  1A5V A;  4EZ6 A;  3MED A;  4FZY A;  3LP0 A;  3C94 A;  1JLE A;  3P5J A;  2A1R A;  2R7Y A;  3LAL A;  5KGX A;  3VQD A;  3PV8 A;  4CJ4 A;  3HVR A;  4EP4 A;  1IO2 A;  4DS4 A;  1RDD A;  3DRS A;  3LP2 A;  4YFU A;  1NJX A;  4J2B A;  2ITG A;  4DU4 A;  3VQC A;  4OLA A;  1FK9 A;  3TI0 A;  1L3T A;  4HTU A;  4C8M A;  5KRS A;  3C6U A;  2FBX A;  2OPR A;  3TR8 A;  3M8R A;  3QES A;  1L5U A;  4FLZ A;  4E0D A;  2IGI A;  2HND A;  2P51 A;  4MQ3 A;  3S3O A;  3KTQ A;  1D9F A;  4AHU A;  3RTV A;  4AIL C;  1S5J A;  3NF6 A;  3IG1 A;  3DOK A;  4FZX C;  1RCH A;  2RPI A;  2QKB A;  4DQI A;  3IS9 A;  1NKB A;  1LWE A;  1VSE A;  3DRR A;  4ZTJ A;  4KHW A;  4O44 A;  3SV3 A;  1HNV A;  1Q9Y A;  1K6Y A;  1CXU A;  4CES A;  4CFD A;  2VG5 A;  2GV9 A;  4N47 A;  2BDP A;  3HL8 A;  1HMV A;  4DSF A;  3TAG A;  2XRI A;  1JL2 A;  4CJR A;  3VA0 A;  4CJ3 A;  1U04 A;  3AVC A;  4CGJ A;  4KB0 A;  4KHY A;  4I7F A;  3ZSV A;  4CK2 A;  4GVM A;  4Z0U A;  3LZI A;  3KKR A;  4M41 A;  4CFB A;  4M3W A;  4NCA A;  3WNF A;  1N5Y A;  2AJQ A;  3OYB A;  3VQ4 A;  4FJK A;  2HB5 A;  3O4N A;  1TKD A;  3AVM A;  5EU7 A;  5KTQ A;  4QOZ B;  1JLF A;  3H08 A;  3ISN C;  4DFJ A;  1U49 A;  4J2E A;  4HCB A;  1RT5 A;  4PWD A;  3LZJ A;  5HRN A;  4ICL A;  3V81 A;  3PX0 A;  4AHS A;  3JSM A;  3SQ2 A;  2KZM A;  4FJ7 A;  4LSL A;  3ZSQ A;  2HHV A;  5JS1 A;  3C95 A;  4KRE A;  1NJY A;  3O3H A;  2KTQ A;  3V4I A;  4FCY A;  3K5O A;  3KJV A;  4OKE A;  2JLE A;  4FLU A;  4OLB A;  2YNH A;  2VG7 A;  3RMB A;  2BAN A;  1RTJ A;  3DRP A;  4I9L A;  1SKS A;  1CLQ A;  4CF8 A;  4CJF A;  3HPG A;  1S6Q A;  3L3V A;  3NAE A;  3VQ9 A;  3TAE A;  4NYN A;  3F9K A;  4DTJ A;  3U6F A;  3V6D A;  3SPY A;  3MXJ A;  4Z4G A;  3OVN A;  2HVH A;  1NOY A;  3V9U A;  1NKC A;  1RT4 A;  4CJS A;  3AO2 A;  1ASW A;  4LSN A;  1KCF A;  3PO5 A;  4N5S A;  1KFD A;  3LWL A;  3VN5 A;  5I42 A;  3VQB A;  4I2P A;  4OGC A;  3RWU A;  1YT3 A;  3P83 D;  1EX4 A;  1VSM A;  4YNQ A;  1HYS A;  1ZBF A;  4N56 A;  2D0C A;  3I0S A;  4CJL A;  3AV9 A;  4KAZ A;  4KFB A;  4B9M A;  4CE9 A;  3DLH A;  4FYD A;  4AHR A;  5DK5 A;  4PUO A;  3V1Q A;  3NDK A;  3SQ4 A;  1F21 A;  3ZT4 A;  3KD1 E;  4JRP A;  4BDP A;  1BIS A;  3FFI A;  1QE1 A;  4CEZ A;  3B6O A;  2D0B A;  2KFN A;  4CEB A;  4DQS A;  2ZD1 A;  3ALY A;  1CXQ A;  3I0R A;  3S3M A;  1JLA A;  1ASU A;  3ASM A;  4KHS A;  1JKH A;  1C1A A;  4DFM A;  4PY5 A;  4Z4I A;  2G8I A;  3T3F A;  3L2V A;  2PYJ A;  1VRU A;  3VA3 A;  3SCX A;  3K58 A;  3VQ8 A;  2BE2 A;  2XY8 A;  1LW0 A;  4MFB A;  4JS4 A;  3OYK A;  1C1B A;  5J2M A;  1WSI A;  1T8E A;  3TAM A;  4CJP A;  3KLE A;  3C6T A;  3D45 A;  3NE6 A;  1LAV A;  4JLH A;  3NCI A;  3VQP A;  3CFP A;  4FZZ A;  1RDC A;  4CF0 A;  3ZSW A;  1J54 A;  4C8N A;  4CEO A;  4CFA A;  2YNI A;  2OA8 A;  4IFV A;  3SPZ A;  2HHX A;  1Q9X A;  4B9L A;  3HP9 A;  1HYZ A;  3QEX A;  4NCG A;  1C1C A;  2YKN A;  4FVM A;  3PX6 A;  3TAF A;  4KO0 A;  2P1J A;  3NF9 A;  3ZCM A;  1TK0 A;  2HHS A;  4XIU A;  1LV5 A;  3OYH A;  1TK5 A;  4G1Q A;  1UA0 A;  4LH4 A;  3KIO A;  3HO1 A;  3AVB A;  3HYF A;  1HQE A;  4I2Q A;  1QSS A;  2XY5 A;  4M3R A;  2HHU A;  3AVG A;  5KI6 A;  4H8K A;  4Y1C A;  3HXM A;  5KGW A;  3LP1 A;  4AHV A;  4E1N A;  5C25 A;  4DF8 A;  4FJL A;  1WLJ A;  2F8T A;  3JYT A;  3VQ5 A;  1GOC A;  2WON A;  5HBM A;  5HRP A;  3TWH A;  1RDA A;  1SV5 A;  4GMJ B;  4W5O A;  3L2U A;  4NYF A;  2IC3 A;  2Y1I A;  4C8K A;  1JLC A;  4Z4H A;  1Z25 A;  1X9M A;  1TAU A;  3E01 A;  2NUB A;  4Z4E A;  1RT1 A;  4FJH A;  2VG6 A;  4H4M A;  4IDK A;  3KLH A;  3NBP A;  5HRR A;  3L2Q A;  1CZB A;  2OPQ A;  3K57 A;  4O0J A;  3MEE A;  4FLX A;  1RTD A;  4FJG A;  4NCB A;  2Z1J A;  1U4B A;  2YKM A;  2PZS A;  5FRN A;  1D5A A;  4GW6 A;  2XY6 A;  1QHT A;  3NF7 A;  1IG9 A;  4FJ8 A;  2EX3 A;  1RBV A;  4LD0 A;  3SUO A;  2PYL A;  3LPU A;  4CF1 A;  1NK5 A;  1L3V A;  4IBN A;  1JLB A;  1KVC A;  4N76 A;  1HNI A;  3VQA A;  2D5R A;  3QIO A;  4CJQ A;  3VQQ A;  2KZZ A;  3RMA A;  5SWM A;  2Z1I A;  2QXF A;  3SNN A;  3IAY A;  2XO7 A;  4UQG A;  3BDP A;  5FDL A;  1T03 A;  4QAG A;  4DLE A;  2OYQ A;  2EHG A;  3AA3 A;  4M3T A;  1U48 A;  4J2D A;  3SZ2 A;  2OPS A;  4E1M A;  2HW3 A;  5J2N A;  3HPO A;  3DOL A;  4CHO A;  2RN2 A;  1RBS A;  4OJR A;  3NGZ A;  3CM6 A;  5J2P A;  1XHX A;  1J5O A;  3LP3 A;  4HUG A;  1Q8I A;  1RT7 A;  3OY9 A;  4B9N A;  3KD5 E;  1TVR A;  4M3Z A;  4ZHR A;  2HHQ A;  2RKI A;  3ITH A;  2W42 A;  1KFS A;  1RNH A;  4F2R A;  1ZBU A;  4HHT A;  4FM0 A;  4Q0B A;  4CHQ A;  3OYM A;  4M3Y A;  3OS2 A;  5I3U A;  3D0P A;  3ZSX A;  1JXB A;  4BE2 A;  4F8R A;  5T7B A;  3EZ5 A;  1SL2 A;  3PO4 A;  4FJN A;  1NKE A;  4W5N A;  1BCO A;  3OYN A;  4KTZ A;  4CJT A;  1FKP A;  4DU1 A;  3SI6 A;  3HJF A;  1XHZ A;  4CJU A;  1HQU A;  4M3X A;  4KHQ A;  4C8L A;  3QNO A;  3QEP A;  4EZ9 A;  4I9Q A;  4FJM A;  2FBY A;  5DMR A;  3V1R A;  2HMI A;  1RT3 A;  1YVU A;  2DFF A;  3CYM A;  3AO4 A;  3NGY A;  1KTQ A;  3KLI A;  1UWB A;  4FW2 A;  4LH5 A;  3QLH A;  5K14 A;  3MAQ A;  4F3O A;  2DY4 A;  1KRP A;  3LPT A;  1S1W A;  3LAN A;  3TAP A;  2FC0 A;  1SL0 A;  3OS0 A;  3K5M A;  3OYA A;  1NK4 A;  3OS1 A;  4Z4F A;  3RMD A;  2X6S A;  2YV0 X;  2G8F A;  4DTS A;  4LY7 A;  5J1E A;  1J53 A;  4DTO A;  3MXM A;  3QIP A;  4DQR A;  1S1T A;  1VSL A;  4KPY A;  3MEC A;  3LAM A;  4CJW A;  2ZQB A;  4BAC A;  2Y1J A;  3SJJ A;  1XWL A;  2GBZ A;  2IDO A;  4E89 A;  3K5N A;  4O5B A;  2B6A A;  1WSE A;  1BIU A;  3B6P A;  1HYV A;  2ETJ A;  1O1W A;  3AVJ A;  4M42 A;  1JLG A;  4DTR A;  1RBT A;  5J2Q A;  2OZM A;  4IKF A;  4B8C A;  3EYZ A;  4CGD A;  3OYG A;  1LW2 A;  1YTA A;  2IAJ A;  3OYF A;  4DFP A;  1TAQ A;  4K8X A;  4TSX A;  4RW4 A;  4KV8 A;  3CM5 A;  3M8Q A;  5FRO A;  4FK0 A;  1NOZ A;  3AA4 A;  3IRX A;  1RTI A;  2A1S A;  4DMN A;  4F4K A;  1HPZ A;  3RRH A;  4AHC A;  3SUQ A;  1JXE A;  5HRS A;  1XI1 A;  2B5J A;  2F96 A;  1NK8 A;  4FLV A;  1L3U A;  3ZSY A;  3QET A;  1ZBH A;  4B9V A;  3OYC A;  3F73 A;  4Q5V A;  4HUE A;  3DLG A;  3L3U A;  4CK1 A;  4DF4 A;  3PX4 A;  1VSI A;  2DFE A;  3G10 A;  3G0Z A;  4DLG A;  1NK6 A;  4FM1 A;  1D8Y A;  1YTU A;  4R5P A;  3V1O A;  3AVL A;  5CY4 A;  3NGI A;  3SQ0 A;  4C8O A;  3DM2 A;  4CEQ A;  1QSY A;  4FJ5 A;  1TKZ A;  3WNH A;  4B8A B;  2RF2 A;  4CGF A;  4BDY A;  5HP1 A;  1S1X A;  1GOB A;  2XHB A;  3HPH A;  3DMJ A;  2FBT A;  1REV A;  1TKX A;  2OPP A;  4OVL A;  4DG1 A;  4O0I A;  1BI4 A;  1T7P A;  2JGU A;  2I5J A;  4CGH A;  1SUQ A;  2E4L A;  2Z1H A;  2G8H A;  1C0M A;  1FKO A;  5JS2 A;  2D0A A;  3V9Z A;  2KQ2 A;  3QEI A;  1X9W A;  4RW9 A;  3OJS A;  1TL3 A;  4CJ5 A;  4KI6 A;  2BGG A;  5CZ2 A;  3DYA A;  4CGG A;  1WNS A;  4CFC A;  3OYI A;  4AHT A;  1UA1 A;  2VWJ A;  4O55 A;  4CF9 A;  3BGR A;  4CHP A;  3WNE A;  1RT6 A;  2YHB A;  1BHL A;  3O4Q A;  3TAB A;  3OJU A;  3MXI A;  3K2P A;  5KRT A;  4HCC A;  4DSI A;  4M3U A;  2O4I A;  4DTX A;  4KKO A;  1JLQ A;  4J2A A;  3ZSR A;  1ITG A;  1B9F A;  1BL3 A;  5C42 A;  3AVK A;  4DTP A;  1J9A A;  1Z26 A;  3OYJ A;  2YNG A;  4CHY A;  3KLF A;  1UAX A;  1SKW A;  1IKX A;  3I8D A;  1BCM A;  1VSD A;  4IG3 A;  4BE0 A;  1TK8 A;  2HNZ A;  2ZE2 A;  3THV A;  1RIL A;  2DTU A;  1NK9 A;  4RW6 A;  2GUI A;  3EY1 A;  3K5L A;  2X74 A;  1JL1 A;  1ZBI A;  4Y1D A;  4Z4C A;  1LWC A;  4KTQ A;  1UOC A;  2P5G A;  2G8K A;  1BI4 B;  4W5T A;  1WAJ A;  4OKJ A;  1FXX A;  3SV4 A;  3RMC A;  1Y97 A;  3V9S A;  3NH2 A;  3S3N A;  1BQM A;  4OPK A;  3QO9 A;  4AH9 A;  4ZTF A;  1KVA A;  1EET A;  2YNF A;  2IS3 A;  3L8B A;  4EP5 A;  4KHN A;  4FLT A;  1I39 A; 
#chains in the Genus database with same CATH topology
 3L2R A;  1M90 O;  5AQP A;  1A5W A;  4CZL A;  3OA9 A;  5JVH L;  4CJK A;  1NJZ A;  4A59 A;  1VQ8 N;  1YAG A;  1EP4 A;  1IKV A;  4M45 A;  1TGO A;  4CGI A;  1VQO N;  1ATN A;  2YHA A;  4RG8 A;  4JI2 K;  4HVJ A;  1R0A A;  1TV6 A;  1D4X A;  1J6Z A;  4C1N I;  4FJI A;  1C6V A;  3R3L A;  4O4G A;  1BGX T;  2X78 A;  5AQO A;  1CZ9 A;  3D2E A;  4X65 K;  3EE8 A;  1EKE A;  1LAW A;  3QIC A;  4WE1 A;  3S41 A;  2Z1G A;  4GV6 A;  4H4O A;  4IEI A;  4DV4 K;  4WCE L;  2BH1 A;  3KK2 A;  3M8P A;  1J5E K;  1VSF A;  2AA4 A;  4OGE A;  1RBU A;  4KBO A;  4CJE A;  1MU2 A;  4BVO A;  1WSJ A;  2G8V A;  2QK9 A;  4B9S A;  3KK1 A;  2Q31 A;  1E4F T;  4RW7 A;  1NGD A;  5D3G A;  3ENO A;  3VTI A;  3LDS A;  4CK3 A;  1E3M A;  5GIO A;  3ZT2 A;  2HHW A;  3V9X A;  4FSV A;  4E7J A;  4LF5 K;  1RT2 A;  3SUP A;  3U3G A;  1IBK K;  2ZWH A;  3TSQ A;  1X9S A;  2P9K B;  3MK6 A;  4JRQ A;  4B9T A;  3PUF A;  4NB4 A;  4QS8 A;  4E7K A;  4BRD A;  1S6P A;  5JIC A;  1NJW A;  3K59 A;  2I7P A;  2ZF5 O;  3ZT0 A;  2HHT A;  3U3Y A;  4DQP A;  2FF6 A;  5FPN A;  4CJ7 A;  3HP6 A;  3UIQ A;  2P9S B;  5AQL A;  4HWI A;  4BR5 A;  4FWS A;  4BRQ A;  3OHR A;  4ELU A;  1ZBL A;  4B3O A;  4FJX A;  2E2Q A;  2WOM A;  3K9K A;  4DR5 K;  2VQF K;  4KHU A;  1N6Q A;  1BG3 A;  1HLU A;  3RR8 A;  1MWM A;  3FE1 A;  4BRC A;  4JKF A;  3SUN A;  3H1V X;  1YUW A;  2NRX A;  5CYQ A;  4BDZ A;  1GOA A;  4E19 A;  4DR1 K;  5FRM A;  1S9E A;  2UXC K;  3KK3 A;  4DKW A;  1VRT A;  3NFA A;  2P9L A;  5FLX O;  1SAZ A;  2O8F A;  3M3Z A;  5AQG A;  1IKY A;  4BG8 A;  1KAX A;  3MN6 A;  4BC3 A;  5E41 A;  4DR2 K;  5BR8 K;  3CF5 L;  4YHH K;  3OYE A;  3R9P A;  2F9T A;  3D2F A;  4EZ6 A;  4BR7 A;  1T6D A;  3ZX0 A;  2UUB K;  3C94 A;  2R7Y A;  4H0Y B;  3VQD A;  2QA4 N;  4EP4 A;  1IO2 A;  3TSP A;  3DRS A;  3LP2 A;  4CZF A;  1OVQ A;  1FK9 A;  1L3T A;  2UUA K;  1XC3 A;  4C8M A;  3C6U A;  2OPR A;  3TR8 A;  3M8R A;  1L5U A;  3S3O A;  4B1W B;  5F1X A;  3T1Y K;  3O4W A;  3DOK A;  3ZEU B;  1RCH A;  4DQI A;  1NKB A;  1VSE A;  5AZJ B;  3SV3 A;  1CXU A;  3HL8 A;  1HMV A;  3TAG A;  2XRI A;  1N34 K;  2BUP A;  1KXP A;  3THW A;  4JI0 K;  3O4N A;  3VF6 A;  1JLF A;  4IJN A;  4HCB A;  4ICL A;  2E1Z A;  4AHS A;  4FJ7 A;  4LSL A;  1U2V A;  4FLU A;  3CXC M;  5TKY A;  1N33 K;  1CLQ A;  3NAE A;  1S6Q A;  3TAE A;  4DTJ A;  1Q18 A;  4QS7 A;  3U6F A;  4B1Y B;  4BY9 C;  1NKC A;  1RT4 A;  1JCF A;  1ASW A;  5AJ3 K;  4FWQ A;  5AQS A;  3NVM A;  2Q2R A;  3H46 O;  3VQB A;  3P83 D;  1VSM A;  1ZBF A;  2D0C A;  2V51 B;  3I0S A;  4GNI A;  3N4P A;  4DHY A;  3NDK A;  4ISF A;  4LF8 K;  4BRM A;  1S22 A;  2Q0U A;  3FFI A;  4CEZ A;  3O08 A;  3I0R A;  2RE2 A;  1JLA A;  4PY5 A;  3GL1 A;  2G8I A;  2PYJ A;  3SCX A;  4A62 A;  1LW0 A;  4MFB A;  4JS4 A;  1NU0 A;  3OYK A;  4I6M B;  3CMA N;  1SKR A;  1LAV A;  4JHD A;  3WT0 A;  2UYT A;  1VQM N;  4C8N A;  3G71 N;  4CFA A;  2YNI A;  3LDQ A;  3QEX A;  3H3N O;  4NCG A;  2YKN A;  3PX6 A;  3NF9 A;  2VQE K;  1LV5 A;  3KK7 A;  4G1Q A;  4AQY K;  3BEX A;  4PKG A;  2YJE A;  3AVB A;  2FF3 B;  1QSS A;  4M3R A;  4FJL A;  2F8T A;  3JYT A;  5HBM A;  5HRP A;  5AZI B;  4GMJ B;  4EHU A;  4Z4H A;  2ZJP L;  3E01 A;  5AQH A;  5AQQ A;  4BRH A;  1RT1 A;  4B3T K;  5HRR A;  3JAM O;  4NCB A;  4FWO A;  2QM1 A;  5FRN A;  2YKM A;  2XY6 A;  1OH5 A;  3NF7 A;  1ZC6 A;  1RBV A;  2EX3 A;  3O5B A;  3VQA A;  2W6L A;  1S72 N;  4JAX A;  1HKB A;  1GLE G;  1CZA N;  2QWN A;  3SNN A;  3J80 O;  1QZ6 A;  2EHG A;  3AA3 A;  1BA0 A;  3MMV A;  4NXM K;  3DOL A;  3CJB A;  3B8A X;  4JKG B;  4ZHR A;  4ILJ A;  2I7N A;  3ULE A;  4FM0 A;  4FWL A;  4IOC L;  4CHQ A;  1K8K A;  4FPA A;  1SL2 A;  1NKE A;  4DR4 K;  4KTZ A;  4CJT A;  4DU1 A;  3SI6 A;  4CW7 B;  1HQU A;  4WFB L;  2VGM A;  4F9O A;  3O9S A;  3WEE B;  1N32 K;  3NGY A;  3CYM A;  3KLI A;  4F3O A;  5C15 A;  4WYB A;  1W2B M;  3LPT A;  3WXM B;  3BZK A;  3LAN A;  5AQN A;  3OS0 A;  4Z4F A;  1YJW N;  5IT9 O;  2G8F A;  4DTS A;  4LY7 A;  3MWT A;  4WQ5 C;  4YDU C;  4DQR A;  4JNE A;  2NZT A;  1S1T A;  4BGA A;  1HUX A;  2Y1J A;  2GBZ A;  3AAQ A;  4MDA A;  2CGJ A;  4C1N K;  3D6R A;  1HYV A;  4BC2 A;  3D7E O;  2OZM A;  4IKF A;  3EYZ A;  4LF4 K;  1LW2 A;  1YTA A;  2IAJ A;  4A2B A;  3OYF A;  3CHW A;  4E1J A;  1TAQ A;  4HTL A;  3CCM N;  4JKC A;  4TSX A;  4KV8 A;  3RSE A;  2P9P A;  3CM5 A;  3M8Q A;  5FRO A;  3AA4 A;  4IFE A;  4DMN A;  1HPZ A;  3ZYY X;  3RRH A;  3SUQ A;  2GUP A;  5HRS A;  1L3U A;  4FLV A;  2A40 A;  2Q1N A;  3DLG A;  4DF4 A;  4B3M K;  3G10 A;  3G0Z A;  3FZM A;  1YTU A;  3V1O A;  3U8X A;  4CEQ A;  1BO5 O;  3THY B;  3WNH A;  1P90 A;  3C6H A;  2FBT A;  1BI4 A;  4CGH A;  4GV3 A;  2Z1H A;  1C0M A;  2GWK A;  1DEJ A;  2D0A A;  5BPN A;  1T6C A;  2IVN A;  1NGB A;  4H5N A;  2BGG A;  3CD6 N;  1VQ6 N;  1UA1 A;  2VWJ A;  2ZGZ A;  3F9M A;  3T69 A;  3TTD A;  1OH6 A;  1BOT O;  1RT6 A;  3MXI A;  4M3U A;  3O4Q A;  4DR7 K;  4DSI A;  1JLQ A;  4ILG B;  4J2A A;  1ITG A;  1BL3 A;  1J9A A;  5CHI A;  1NM1 A;  3CCS N;  3IMX A;  3I8D A;  2O8E B;  4IG3 A;  2DTU A;  3EO3 A;  1JCE A;  1R59 O;  3U9D A;  2X74 A;  1ZBI A;  4Y1D A;  3H6E A;  1RGI A;  1UOC A;  5F0X A;  2WC9 A;  1GLF O;  5GIN A;  2NLX A;  3NH2 A;  3S3N A;  1GLB G;  3QO9 A;  3L8B A;  1I39 A;  4DSK A;  5GAG P;  1DLO A;  3SYZ A;  4F2S A;  3ZET B;  4KTW A;  4CEA A;  5GAD P;  1WSH A;  5LL6 Z;  4CEE A;  5I9E B;  4JD2 B;  3AA5 X;  5SZT A;  1ILY A;  1A5X A;  2B4J A;  1ZYQ A;  1T05 A;  2KHO A;  1VQ5 N;  3LM9 A;  4B08 A;  1KLN A;  4FK2 A;  2P9U A;  3UKU A;  4OKK A;  5BR9 A;  4PA1 A;  3DXM A;  3AVI A;  3THY A;  3DLB A;  1HPM A;  3DI6 A;  3HBT A;  5CR4 A;  3QML A;  4WQ4 C;  3VQE A;  3ZT3 A;  3O9R A;  4FL9 A;  3DJC A;  1QS4 A;  3MN9 A;  4DSL A;  4FJJ A;  2UXD K;  2O8B A;  4FM2 A;  4CEC A;  4L3Q A;  4DTN A;  4IO8 A;  4CI6 A;  5CYM A;  1XC9 A;  1NG9 A;  4K8Z A;  4BWJ A;  4U67 L;  2IOC A;  2P5O A;  3MX5 A;  1RDU A;  2ITM A;  3CER A;  4FLY A;  2HVI A;  1HRH A;  3RRG A;  4LF9 K;  2UXB K;  1MA9 B;  1C0U A;  5EVZ A;  1RBR A;  3ENH A;  1BQN A;  3AVH A;  3MN7 A;  3A2F A;  1U47 A;  1Q86 O;  4A2A A;  3NVK A;  2DFH A;  4N41 A;  1GLJ O;  3D2E B;  2F9W A;  5BRD A;  4HUF A;  1WAF A;  2P9N A;  1W0H A;  3FLC O;  3O3G A;  5C10 A;  2O4G A;  3J7Z O;  3KLG A;  1WSF A;  3FGU A;  1OKJ A;  4RTF D;  3AO3 A;  3T1A A;  1YI2 N;  1IKW A;  1SS6 A;  4CER A;  3TAR A;  3M6G A;  4CZI A;  3J81 O;  1EXQ A;  4ELV A;  3S9H A;  1T3V A;  3C6A A;  4FLW A;  4FO0 A;  3C65 A;  2VCP A;  4XH1 A;  4CCH A;  4BE1 A;  3DXK A;  3ZSZ A;  5AQI A;  5CZ1 A;  3Q7B A;  2HF4 A;  2RHK A;  4RW8 A;  4GY2 B;  3M5R A;  3KVG A;  2PY5 A;  2G8W A;  4DSJ A;  1B92 A;  4DQQ A;  3AVF A;  4E7L A;  1L3S A;  1Q82 O;  4K25 A;  3IDH A;  2A3Z A;  2LSN A;  1W97 L;  2E2P A;  5KGX A;  5B8H A;  2WTU A;  4DS4 A;  3HM8 A;  2BTF A;  3VQC A;  3SAH A;  3A5L C;  4HTU A;  4JKD A;  4MO5 A;  4FWP A;  2HND A;  5DM6 L;  4GVE A;  4AHU A;  4YOU A;  2HHQ A;  3NF6 A;  3IG1 A;  4FZX C;  1C0F A;  2RPI A;  2QWM A;  4KHW A;  4AF1 A;  2W41 A;  1HNV A;  1K6Y A;  5MLC Q;  5DM7 L;  4FVU A;  5KPT A;  2GV9 A;  4N47 A;  2P9L B;  4CBW A;  2O8F B;  4CJR A;  4KB0 A;  4CJ3 A;  3AVC A;  4CGJ A;  1HKC A;  3SJH A;  4GVM A;  3QFU A;  2WFB A;  4K0K K;  4M41 A;  4CFB A;  4M3W A;  3WNF A;  3D2F B;  3GOI A;  3CCV N;  4FJK A;  5TKW A;  4DFJ A;  4DR6 K;  4PWD A;  5HRN A;  3JSM A;  3C95 A;  4KRE A;  1NJY A;  1QZ5 A;  3V4I A;  2CGK A;  2JLE A;  1QVG M;  3A0I X;  4OLB A;  2YNH A;  4DR3 K;  4I9L A;  2VYP A;  4G9Z A;  3E1Y A;  1DKG D;  4CJF A;  3HPG A;  3L3V A;  3VQ9 A;  4NYN A;  1BDG A;  3V6D A;  4Z4G A;  3OVN A;  2HVH A;  3V9U A;  1HR0 K;  1OH8 A;  4XEI A;  4YOR A;  1EX4 A;  3THW B;  4B1V A;  4KAZ A;  4KFB A;  4B9M A;  4BRE A;  4FYD A;  1F21 A;  3KD1 E;  4PL7 A;  4DUZ K;  1QVF M;  2KFN A;  3S3M A;  1ASU A;  3ASM A;  4KHS A;  2V7Y A;  3A5O C;  3VF4 A;  3T3F A;  3VA3 A;  3VQ8 A;  2AP1 A;  2BE2 A;  3SBG A;  4FWM A;  1U2V B;  4CJP A;  3KLE A;  3C6T A;  3CFP A;  3W0L A;  2GTD A;  3EL2 A;  4FZZ A;  4NXN K;  4CF0 A;  3MCP A;  2HHX A;  1OH7 A;  4KO0 A;  1XUP O;  2P1J A;  3ZCM A;  1TK0 A;  1X3M A;  1UA0 A;  4LH4 A;  3KIO A;  3L6Q A;  3SBT A;  5BPL A;  3HXM A;  4E1N A;  3VGM A;  3O1B A;  2E2N A;  1GOC A;  2WON A;  1FW6 A;  3BY5 A;  4DCH A;  2KZZ A;  2Y1I A;  4C8K A;  1TAU A;  4DV3 K;  1Z25 A;  1X9M A;  2NUB A;  4H4M A;  3L2Q A;  4FLX A;  3IKM A;  2Z1J A;  1U4B A;  2PZS A;  4IJA A;  4FJ8 A;  2PYL A;  1L3V A;  3ENB A;  1WBB A;  4IBN A;  1HNI A;  3VQQ A;  3CC4 N;  4JHD B;  3CCL N;  2NNW A;  4PHT X;  2XO7 A;  3VEY A;  2OYQ A;  3ATV A;  3G6E N;  4J2D A;  2V52 B;  4E1M A;  5J2N A;  3CI5 A;  3NGZ A;  2RN2 A;  1J5O A;  1XHX A;  3LP3 A;  4HUG A;  1Q8I A;  1RT7 A;  3OY9 A;  4M3Z A;  1NGC A;  4EAH D;  1RNH A;  4B9Q A;  3OYM A;  3WQU A;  2QWL A;  3OS2 A;  4BE2 A;  3ZSX A;  4JI4 K;  4B3R K;  5AQJ A;  1NGG A;  5AQY A;  4DUY K;  4FJN A;  4W5N A;  1Z6R A;  1BCO A;  3HJF A;  1XHZ A;  4CJU A;  3QNO A;  5LMN K;  3QEP A;  4I9Q A;  2FBY A;  1RT3 A;  4FW2 A;  4Y0W A;  5AQZ A;  4BC5 A;  1IBL K;  1S1W A;  5LMU K;  2E2O A;  1GLD G;  3O8M A;  4H0P A;  3RMD A;  2YV0 X;  3BUZ B;  1JJ2 M;  5J1E A;  5AQU A;  3MXM A;  3LL3 A;  2QEX N;  1VSL A;  4KPY A;  3C7N A;  3MEC A;  2NRH A;  3ULE B;  3B6P A;  2ETJ A;  1O1W A;  4M42 A;  1JLG A;  1K8K B;  4B8C A;  3AGK A;  2ASO A;  4NO7 A;  2QXL A;  4DFP A;  5AQT A;  2QI2 A;  1H1V A;  4F4K A;  1T44 A;  2A1S A;  5JVG L;  4GV9 A;  3FFK B;  3QET A;  2QW9 A;  3VET A;  1ZBH A;  3CJC A;  4LF7 K;  2O8D A;  4Q5V A;  4CK1 A;  3L3U A;  5BRF A;  1NK6 A;  4FM1 A;  5KQ8 A;  2NRV A;  3AVL A;  5CY4 A;  3NGI A;  3CCE N;  4C8O A;  3DM2 A;  4FJ5 A;  1TKZ A;  2W6K A;  3MX2 A;  5HP1 A;  3LDO A;  3C0B A;  5M1K A;  1Z05 A;  4OVL A;  1REV A;  2OPP A;  4O0I A;  1T7P A;  3E66 A;  4FWK A;  1FKO A;  3TU5 A;  2KQ2 A;  1X9W A;  3BZC A;  3MDQ A;  5EX5 A;  3EEQ A;  4JYA K;  3J7A P;  1WNS A;  3RSE B;  2P9P B;  3H3O B;  3VEW A;  4AHT A;  1K73 O;  3TTF A;  3TAB A;  1BHL A;  3K2P A;  4A57 A;  3DWL A;  4DTX A;  3PSF A;  5AQM A;  1NGA A;  1KQS M;  3VGL A;  2HST A;  4BG9 A;  4CHY A;  4UY8 O;  3KLF A;  1BCM A;  2OAN A;  4BE0 A;  3LDP A;  3SAG A;  3O9T A;  4KTQ A;  1LWC A;  1BI4 B;  4W5T A;  3P39 A;  1MWK A;  3SV4 A;  2VGN A;  1BQM A;  1KVA A;  4R79 A;  4FLT A;  1TKT A;  3SMP A;  3CJ1 A;  3HSC A;  3TAN A;  5C24 A;  3WUH A;  2XY7 A;  4H0V B;  4IXC A;  3CFO A;  4CHN A;  3VQ6 A;  4JS5 A;  3AVN A;  3I8B A;  2ZJQ L;  1EWQ A;  2ATQ A;  1QSL A;  2HNY A;  4L8R B;  4YDU A;  4IFY A;  3OYL A;  4JK8 A;  1QQC A;  4PQU A;  4MDB A;  4DV7 K;  4DV5 K;  1YHQ N;  3CFR A;  1BIZ A;  1HJR A;  1D9D A;  2OZS A;  1TYQ A;  3AA2 A;  4IZ9 A;  1TL1 A;  1BWF O;  1LWF A;  5KPR A;  4KI4 A;  1U45 A;  2ASM A;  2HBL A;  4FOI A;  1HKG A;  4LC9 B;  4AM6 A;  3T19 A;  3AVA A;  4DTU A;  2E6M A;  1QTM A;  1QQM A;  3LWM A;  5KQD A;  3NH1 A;  4CJV A;  1S1U A;  2OTL N;  3O3F A;  2F8S A;  3AAP A;  1KVB A;  3CG7 A;  3L2W A;  4KH6 A;  4BR9 A;  2O8C A;  3VMF B;  3SQ1 A;  1W9H A;  3QEW A;  1WN7 A;  4W5R A;  1XQS C;  2V7Z A;  3NH0 A;  4DU3 A;  1N36 K;  3DLE A;  4E7I A;  2P9U B;  4C23 A;  3UKU B;  4DTM A;  3DXM B;  3O9U A;  4FK4 A;  4H0T B;  1N8R O;  4CIF A;  2ZJR L;  2E20 A;  3THX A;  1WSG A;  1HX1 A;  3VGK A;  2YHX A;  1KLM A;  1NMD A;  1B9D A;  4DV0 K;  4ID1 A;  3AO5 A;  3CPW M;  2E6L A;  2O8B B;  3TAQ A;  2ZM6 K;  4IG0 A;  4LFA K;  3TSU A;  2YJF A;  3HM9 A;  3I55 N;  4JK9 A;  4CEF A;  3KKS A;  3CQ8 A;  4CHZ A;  3FZL A;  2KFZ A;  4H0X B;  4FWN A;  1NK0 A;  3VES A;  4DS5 A;  3VOV A;  4CD3 A;  3KWG A;  1S1V A;  3EKS A;  4CED A;  4B9U A;  1NGI A;  3QER A;  1LOT B;  2G8U A;  1NLV A;  4BRN A;  3O9Q A;  5HLF A;  3HK2 A;  3MCA B;  5M1F A;  3EZW A;  5EY4 A;  4FZY A;  3LP0 A;  2P9N B;  3VEO A;  4BRP A;  3LAL A;  3HVR A;  2ITG A;  4OLA A;  1P8Z A;  5KRS A;  2FBX A;  3CET A;  2A6A A;  3CIP A;  3PLA A;  2UU9 K;  4B3S K;  4CZK A;  3KTQ A;  3ATU A;  2QKB A;  5FPM A;  3PIP L;  3IS9 A;  1LWE A;  3DRR A;  4ZTJ A;  3N4Q A;  3L0Q A;  4O44 A;  1Q9Y A;  4CFD A;  4CES A;  4YOY A;  3DXK B;  1YIJ N;  1U04 A;  2FLO A;  4BVP A;  1Q7Y O;  3LZI A;  3KKR A;  5C2D A;  3NMU A;  4NCA A;  3GBT A;  5HL7 L;  1N5Y A;  2AJQ A;  3OYB A;  3VQ4 A;  1TKD A;  3AVM A;  2PFU A;  4J2E A;  3I33 A;  2NRR A;  2E1Y A;  1RT5 A;  2KLA A;  3LZJ A;  2HBK A;  4JI7 K;  3PX0 A;  3ZSQ A;  3P31 A;  5JS1 A;  3CJ7 A;  3O3H A;  2KTQ A;  2OCE A;  3M1F A;  4JEP A;  4XH4 A;  5JLH A;  4CZE A;  2VG7 A;  3RMB A;  1RTJ A;  1SKS A;  1W7A A;  4CF8 A;  3G25 A;  2KKZ A;  1NGH A;  3MXJ A;  2NRT A;  1NOY A;  2FSK A;  4CJS A;  5BN8 A;  4LSN A;  1KCF A;  4N5S A;  4IOX A;  5I42 A;  3L4I A;  4OGC A;  3RWU A;  1YT3 A;  2QWQ A;  4NLC A;  4N56 A;  3AV9 A;  3DLH A;  4PUO A;  3ZT4 A;  3P38 A;  4BDP A;  1BIS A;  1QE1 A;  1ZXO A;  2E88 A;  2D0B A;  1EQY A;  3O6W A;  4DQS A;  3ALY A;  1CXQ A;  5IWA K;  3ZLJ A;  1C1A A;  4X62 K;  3RVC A;  5AQV A;  2XY8 A;  4IDH A;  3BP8 A;  1C1B A;  5FPE A;  1WSI A;  5J2M A;  3CC7 N;  4BR0 A;  1DT9 A;  1Y64 A;  4JLH A;  3NCI A;  3VQP A;  5AQK A;  1RDC A;  3VER A;  2ZGY A;  3ZSW A;  4PL8 A;  4IFV A;  3SPZ A;  1Q9X A;  2D4W A;  4FVM A;  3TAF A;  5M1P A;  5AQF A;  3U9Z A;  4XIU A;  3OYH A;  1TK5 A;  4ISE A;  5AQW A;  1HQE A;  4I2Q A;  2XY5 A;  4Y1C A;  4BQL A;  5KGW A;  4DF8 A;  4AHV A;  3TTC A;  4OX9 K;  3VQ5 A;  3TWH A;  1RDA A;  1SV5 A;  4XH5 A;  3L2U A;  2IC3 A;  4H5W A;  4FJH A;  2QWP A;  4IDK A;  3NBP A;  3HTV A;  3EKU A;  4BRG A;  4GW6 A;  1QHT A;  4LD0 A;  4CF1 A;  1NK5 A;  4IEE A;  2D5R A;  3QIO A;  3SK3 A;  4CJQ A;  5SWM A;  3WXK A;  2Z1I A;  3LDL A;  1KC8 O;  4UQG A;  4QAG A;  1GLA G;  1NGF A;  2D0O A;  3SLC A;  2OPS A;  3R8E A;  2HW3 A;  4CHO A;  2Q0R A;  1RBS A;  4OJR A;  1WBD A;  3CM6 A;  3VEZ A;  3KD5 E;  3ZX2 A;  2W42 A;  2W40 A;  4PKH A;  3O1W A;  4F2R A;  1ZBU A;  3FR0 A;  4Q0B A;  2HF3 A;  2D1K A;  4M3Y A;  2E8A A;  3QB0 A;  3OTO K;  3D0P A;  1JXB A;  4F8R A;  1E4G T;  3PO4 A;  1YXQ A;  1FKP A;  4M7X A;  2GEM A;  4M3X A;  4KHQ A;  4EZ9 A;  3CME N;  2HMI A;  3VTH A;  3KLH A;  1UWB A;  3MAQ A;  3QLH A;  5K14 A;  4O5F A;  4A61 A;  2FC0 A;  1NK4 A;  1WOQ A;  3OS1 A;  4M7Y A;  1J53 A;  4PKI A;  4DTO A;  4WFA L;  3JXU A;  4BGB A;  5HOO A;  4O8U A;  3LAM A;  4BAC A;  2IDO A;  4E89 A;  4O5B A;  4GKK K;  5M1Q A;  1WSE A;  1BIU A;  1XNQ K;  1EWR A;  3AVJ A;  3QBW A;  4YOW A;  4CVN E;  3QBX A;  4CGD A;  3JS6 A;  4K42 A;  1NJI O;  4X66 K;  4BQZ A;  1X9J A;  4A5B A;  2HOE A;  3A5N C;  2H3G X;  2QWR A;  1RTI A;  1TUU A;  5M1O A;  4AHC A;  2JWL A;  1JXE A;  2B5J A;  1NK8 A;  4OPA A;  3ZSY A;  3KHY A;  3OYC A;  3F73 A;  1VSI A;  2IVO A;  2OTJ N;  1SZ2 A;  1ESV A;  1D8Y A;  3SQ0 A;  4B8A B;  1NBW A;  2RF2 A;  4BDY A;  1S1X A;  1GOB A;  3CJA A;  3HPH A;  3DMJ A;  1TKX A;  5GAE P;  4CD1 A;  3C7N B;  1O13 A;  3CJ9 A;  3K9J A;  1SUQ A;  2E4L A;  1YIT N;  3KZB A;  3W3D A;  3QEI A;  1IJJ A;  2YCH A;  2A42 A;  3OJS A;  1TL3 A;  4JKH A;  5FPD A;  1NNE A;  5ADX H;  2YX6 A;  4H5R A;  3OYI A;  5E26 A;  3HOT A;  4BR2 A;  4CF9 A;  3WNE A;  4HCC A;  4JI1 K;  3LDN A;  2O8D B;  3ZSR A;  1B9F A;  2J4R A;  5C42 A;  3AVK A;  4DTP A;  1V4T A;  2YNG A;  2P9I B;  3CQX A;  1UAX A;  2QTD A;  1SKW A;  1IKX A;  1VSD A;  1TK8 A;  2F4V K;  1KAY A;  2ZE2 A;  4RW6 A;  4EHT A;  3O80 A;  5JLF A;  2CGL A;  4Z4C A;  2P5G A;  2G8K A;  3CCQ N;  1WAJ A;  5CE3 A;  1HNW K;  1NMN A;  4OKJ A;  3RMC A;  1VHX A;  3V9S A;  1C0G A;  4OPK A;  1XMO K;  4AH9 A;  4FWR A;  4ZTF A;  1EET A;  3CQY A;  2IS3 A;  1VQK N;  1KSP A;  2FBV A;  1V4S A;  3GG4 A;  4MLE A;  1HNZ K;  4FW1 A;  1NK7 A;  5AQR A;  1S9G A;  3QEV A;  4LFC K;  3GDQ A;  2Q3S A;  4KB1 A;  4JI6 K;  1VK0 A;  4E7H A;  4BRF A;  4CZG A;  3HVT A;  1VSJ A;  3PIO L;  3QNN A;  1VSK A;  5AQX A;  5AFU H;  3DAW A;  2P9K A;  4V19 S;  3HST B;  3PY8 A;  4BC4 A;  4LF6 K;  3CPE A;  3F5T A;  4DFK A;  3V9W A;  4AM7 A;  3AO1 A;  4F3T A;  1M1K O;  3HT3 A;  3H45 C;  3HOS A;  1VSH A;  3GE1 A;  4ELT A;  1RDB A;  2VWK A;  3M8S A;  2P9S A;  3L4Q A;  3NF8 A;  3ZSO A;  1HNX K;  3VPZ A;  3DLK A;  3ZT1 A;  4H5T A;  3VQ7 A;  2FSN A;  1ASV A;  3G4S N;  4CIE A;  4KH5 A;  1YVN A;  3Q7C A;  3VEX A;  4JK7 A;  3E9O A;  3TPQ A;  2KW4 A;  3WQT A;  2X6N A;  3FZH A;  2FXU A;  3VEN A;  4CF2 A;  1C0T A;  4U7B A;  5KPZ A;  4JI3 K;  4W5Q A;  3HI0 A;  3VEV A;  4JKB A;  2P9I A;  1GLL O;  5HRO A;  4JI8 K;  1TYQ B;  3DLR A;  4FXD A;  4FJ9 A;  3HRG A;  5C0Y A;  3BF1 A;  3BF3 A;  1IH7 A;  1VQN N;  3QIN A;  3WXI A;  4YOV A;  2HHH K;  4DWI A;  4QCL A;  1VQ7 N;  4BRL A;  1DTQ A;  3LAK A;  1I3A A;  3H1Q A;  4BWM A;  4OPJ A;  2F7T A;  3ID8 A;  1I94 K;  4BR4 A;  1DTT A;  3MEG A;  1VAZ A;  4ID5 A;  1RTH A;  1NGE A;  4RWT A;  4WF9 L;  2QKK A;  4YOT A;  1G15 A;  4E3S A;  2O8C B;  3ZEU A;  2A41 A;  3WNG A;  5AZJ A;  1YF5 L;  4DSE A;  4J8F A;  3OYD A;  1SL1 A;  4CIG A;  4KRF A;  4QS9 A;  1K8A O;  1KAZ A;  1YJ9 N;  3ULD A;  1X1P A;  3NHG A;  3RR7 A;  2WUS A;  3P1G A;  1A5V A;  2GWJ A;  3MED A;  5EXW A;  3THX B;  2A1R A;  1JLE A;  3P5J A;  3OW2 M;  4GKJ K;  3PV8 A;  4CJ4 A;  1FJG K;  1RDD A;  5H1S Q;  4YFU A;  4H5V A;  4CZM A;  1NJX A;  4J2B A;  4DU4 A;  4X64 K;  5BN9 A;  3TI0 A;  5E84 A;  4JN4 A;  2CH6 A;  2ASP A;  4BRK A;  3QES A;  3E9L A;  4FLZ A;  4E0D A;  2IGI A;  3QFP A;  2P51 A;  4MQ3 A;  4FOE A;  3RTV A;  3F2K A;  2JWK A;  4AIL C;  1XMQ K;  1S5J A;  4K41 A;  2QWO A;  4JKE A;  1RFQ A;  2VG5 A;  4WQ5 A;  2BDP A;  2DPN A;  4DSF A;  3VA0 A;  1JL2 A;  4KHY A;  4I7F A;  3ZSV A;  4CK2 A;  3SAF A;  1K9M O;  4Z0U A;  3CCJ N;  2HMP A;  3MWP A;  5BRH A;  4DV6 K;  2HB5 A;  5EU7 A;  5KTQ A;  4QOZ B;  3H08 A;  3ISN C;  1U49 A;  4EIA A;  3KWI A;  3OBW A;  1OVY A;  1ATS A;  3UKR B;  5C12 A;  3V81 A;  4K43 A;  3UE5 A;  4BRO A;  5BPM A;  3SQ2 A;  2KZM A;  2HHV A;  1VQP N;  4I6M A;  4FCY A;  3K5O A;  3KJV A;  4OKE A;  3QDK A;  5A2Q O;  1LCU A;  4Z94 A;  2D0P A;  2BAN A;  3DRP A;  1U6Z A;  3IFR A;  3T7Z A;  3F9K A;  3SPY A;  3HZ6 A;  3AO2 A;  3PO5 A;  1KFD A;  3LWL A;  3VN5 A;  5C2F A;  4I2P A;  1VQ9 N;  5LJW A;  1HYS A;  4YNQ A;  4DV2 K;  4CJL A;  4DV1 K;  4CE9 A;  4AHR A;  5DK5 A;  5AZI A;  3V1Q A;  3SQ4 A;  4JRP A;  3MN5 A;  1YJN N;  3A8Y A;  2IVP A;  2YHY A;  3B6O A;  4CEB A;  2ZD1 A;  1QHA A;  1JKH A;  1MDU B;  4DFM A;  2HBJ A;  1VRU A;  4WFN L;  3K58 A;  4YY3 K;  4IOA L;  1T8E A;  3TAM A;  3D45 A;  3NE6 A;  2Q36 A;  1J54 A;  4CEO A;  5ADX A;  2OA8 A;  4B9L A;  3HP9 A;  1HYZ A;  1C1C A;  1G99 A;  1VQL N;  1IV0 A;  5LJV A;  2HHS A;  4H0O A;  3HO1 A;  5M1N A;  3HYF A;  4JKG A;  3EN9 A;  2HHU A;  3P4I A;  3AVG A;  5KI6 A;  4H8K A;  1WB9 A;  3LP1 A;  5C25 A;  1WLJ A;  1BA1 A;  1ZBS A;  3AGR A;  5F2R A;  1XNR K;  4W5O A;  4NYF A;  1JLC A;  1X3N A;  4MLH A;  3J7Y P;  3EE9 A;  4Z4E A;  2VG6 A;  1QQO A;  3K57 A;  4DB3 A;  1CZB A;  2OPQ A;  1RTD A;  4O0J A;  3MEE A;  4FJG A;  3UKR A;  1D5A A;  1IG9 A;  2GEL A;  1Q81 O;  3U4L A;  3WEE A;  3SUO A;  4KH4 A;  3LPU A;  4N76 A;  1JLB A;  1KVC A;  3RMA A;  4EFH A;  2CH5 A;  2QXF A;  4B1U B;  2NRW A;  3IAY A;  3BDP A;  5FDL A;  1T03 A;  3SMS A;  4DLE A;  5EOY A;  4M3T A;  1IG8 A;  3VF2 A;  5LY3 A;  1U48 A;  3DLL L;  3SZ2 A;  4WQ4 A;  4RCH A;  4M63 C;  3HPO A;  4IO9 L;  5J2P A;  1D9F A;  4B9N A;  1TVR A;  2RKI A;  3ITH A;  4IWV A;  3R1X A;  5BRE A;  5AFU A;  1KFS A;  4CBX A;  3AAR A;  4DQ8 A;  3PSI A;  4HHT A;  1HJO A;  4CBU A;  5I3U A;  2PBD A;  3UB5 A;  5T7B A;  3EZ5 A;  1NGJ A;  3R6M A;  3WXJ A;  3OYN A;  2WBN A;  4CZH A;  3CC2 N;  1ATR A;  4C8L A;  2GX9 A;  4FJM A;  5DMR A;  3V1R A;  3CCR N;  2DFF A;  4MO4 A;  1YVU A;  4LH5 A;  3AO4 A;  3L2V A;  1KTQ A;  3LM2 A;  2DY4 A;  4B1Z A;  1KRP A;  4JV5 K;  3E9P A;  3TAP A;  1SL0 A;  1BU6 O;  3K5M A;  3OYA A;  3ID6 A;  5GIP A;  1DGK N;  5AR0 A;  4YOX A;  1VQ4 N;  2X6S A;  2FSJ A;  4JKA A;  3QIP A;  1RDW X;  4KHP K;  4A5A A;  2A5X A;  4CJW A;  2ZQB A;  3SJJ A;  1XWL A;  1BUP A;  3K5N A;  3OBY A;  2B6A A;  4OO1 J;  4BRI A;  4DTR A;  1RBT A;  5J2Q A;  3AY9 A;  3OYG A;  4K8X A;  4RW4 A;  3J8A A;  3FZF A;  4BRA A;  4FK0 A;  1NOZ A;  3IRX A;  1TUY A;  5ELZ A;  2UUC K;  1XI1 A;  4ILH A;  2F96 A;  2PAV A;  2NRZ A;  1SQK A;  4B9V A;  4HUE A;  3PX4 A;  4B1X B;  4Z4I A;  2DFE A;  3A5M C;  3IUC A;  4DLG A;  2O8E A;  4R5P A;  1QQN A;  1QSY A;  4CGF A;  2XHB A;  2YI1 A;  4DG1 A;  1GLC G;  4ISG A;  2JGU A;  2I5J A;  1WUA A;  3T1H K;  2G8H A;  2Q97 A;  4JI5 K;  4OPH A;  5JS2 A;  3V9Z A;  4RW9 A;  2YHW A;  4CJ5 A;  4KI6 A;  1NWK A;  3K0S A;  3ZET A;  5CZ2 A;  3DYA A;  4CGG A;  4CFC A;  4O55 A;  4JD2 A;  3BGR A;  4H03 B;  5GAH P;  3FZK A;  4CHP A;  1IBM K;  3CCU N;  1JCG A;  2EWS A;  2IIR A;  2YHB A;  3OJU A;  5KRT A;  2O4I A;  4KKO A;  5JMV A;  3OYJ A;  1Z26 A;  4CZJ A;  2HBM A;  4O8K A;  3WXL A;  2HNZ A;  3THV A;  1RIL A;  1NK9 A;  4NLB A;  2VWB A;  2GUI A;  3EY1 A;  3K5L A;  1JL1 A;  1KD1 O;  1EO1 A;  1FXX A;  1Y97 A;  3I56 N;  4FPB A;  3ZX3 A;  1S3X A;  4LFB K;  2YNF A;  2E5L K;  4EP5 A;  4KHN A; 
#chains in the Genus database with same CATH homology
 1TKT A;  4DSK A;  1DLO A;  3L2R A;  2FBV A;  3SYZ A;  1KSP A;  4F2S A;  1A5W A;  4KTW A;  4CEA A;  3TAN A;  4FW1 A;  1NK7 A;  4CJK A;  5C24 A;  1NJZ A;  1WSH A;  4CEE A;  2XY7 A;  3CFO A;  1S9G A;  3VQ6 A;  3AA5 X;  3AVN A;  4CHN A;  1EP4 A;  1IKV A;  4M45 A;  5SZT A;  4JS5 A;  2ATQ A;  2Q3S A;  1TGO A;  1QSL A;  4KB1 A;  2HNY A;  1A5X A;  1VK0 A;  4E7H A;  4CGI A;  2B4J A;  4IFY A;  2YHA A;  3OYL A;  4RG8 A;  1ZYQ A;  1T05 A;  4HVJ A;  1R0A A;  1QQC A;  3HVT A;  4PQU A;  1TV6 A;  1VSJ A;  3QNN A;  1VSK A;  4FJI A;  1C6V A;  4O4G A;  4B08 A;  1KLN A;  3CFR A;  4FK2 A;  1BIZ A;  1BGX T;  1HJR A;  2X78 A;  3HST B;  1D9D A;  3PY8 A;  2OZS A;  1CZ9 A;  4OKK A;  3AA2 A;  4DFK A;  4PA1 A;  1TL1 A;  3V9W A;  1LWF A;  3AVI A;  3DLB A;  4KI4 A;  3AO1 A;  4F3T A;  1U45 A;  1EKE A;  1LAW A;  3HT3 A;  3QEV A;  3DI6 A;  1VSH A;  4WE1 A;  2Z1G A;  1RDB A;  2VWK A;  3VQE A;  4ELT A;  3ZT3 A;  3M8S A;  4H4O A;  3T19 A;  3NF8 A;  1QS4 A;  3AVA A;  3ZSO A;  4DTU A;  2E6M A;  3KK2 A;  1QTM A;  3DLK A;  3M8P A;  4DSL A;  4FJJ A;  3ZT1 A;  1VSF A;  4OGE A;  3LWM A;  3VQ7 A;  1RBU A;  1ASV A;  3NH1 A;  4CEC A;  4FM2 A;  4CJE A;  4DTN A;  1MU2 A;  4CJV A;  4CIE A;  1WSJ A;  1S1U A;  2G8V A;  2QK9 A;  5CYM A;  1XC9 A;  3O3F A;  2F8S A;  4B9S A;  3KK1 A;  4K8Z A;  1KVB A;  2KW4 A;  3CG7 A;  4BWJ A;  2IOC A;  3L2W A;  2P5O A;  2X6N A;  2HVI A;  4FLY A;  4RW7 A;  3SQ1 A;  5D3G A;  3LDS A;  1W9H A;  1HRH A;  3RRG A;  4CF2 A;  4CK3 A;  1WN7 A;  4W5R A;  3QEW A;  3ZT2 A;  1C0U A;  3V9X A;  2HHW A;  4E7J A;  1C0T A;  3NH0 A;  4W5Q A;  1RBR A;  3DLE A;  4DU3 A;  1BQN A;  1RT2 A;  3AVH A;  3U3G A;  3SUP A;  3A2F A;  4E7I A;  1U47 A;  1X9S A;  4JRQ A;  4B9T A;  3PUF A;  5HRO A;  2DFH A;  3DLR A;  4E7K A;  4FXD A;  1S6P A;  4FJ9 A;  1NJW A;  4N41 A;  4DTM A;  4FK4 A;  3K59 A;  1IH7 A;  3ZT0 A;  4CIF A;  2HHT A;  3QIN A;  4HUF A;  1WAF A;  3U3Y A;  4DQP A;  1WSG A;  4DWI A;  3HP6 A;  3UIQ A;  1W0H A;  3O3G A;  1KLM A;  4QCL A;  2O4G A;  1B9D A;  3KLG A;  1WSF A;  1DTQ A;  3LAK A;  1I3A A;  4BWM A;  4OPJ A;  4ID1 A;  3AO5 A;  4ELU A;  1ZBL A;  2E6L A;  4FJX A;  4B3O A;  1DTT A;  2WOM A;  3MEG A;  3AO3 A;  3T1A A;  3TAQ A;  1IKW A;  4ID5 A;  4CER A;  4L8R B;  1RTH A;  3TAR A;  4IG0 A;  1N6Q A;  4KHU A;  3RR8 A;  2QKK A;  1G15 A;  3HM9 A;  4E3S A;  3SUN A;  1EXQ A;  4ELV A;  4CEF A;  3KKS A;  3CQ8 A;  3S9H A;  5CYQ A;  4FLW A;  4CHZ A;  4BDZ A;  3WNG A;  2KFZ A;  1GOA A;  4E19 A;  5FRM A;  4CCH A;  1NK0 A;  1S9E A;  4DS5 A;  4DSE A;  3KK3 A;  4BE1 A;  1VRT A;  3ZSZ A;  3OYD A;  3NFA A;  1SL1 A;  5CZ1 A;  4CIG A;  4KRF A;  4RW8 A;  1S1V A;  4CED A;  3ULD A;  4B9U A;  1IKY A;  3QER A;  1X1P A;  3NHG A;  2PY5 A;  3RR7 A;  2G8W A;  5E41 A;  2G8U A;  3P1G A;  4DSJ A;  1SKR A;  1B92 A;  4DQQ A;  3AVF A;  5HLF A;  3HK2 A;  3OYE A;  4E7L A;  1L3S A;  2LSN A;  1A5V A;  4EZ6 A;  3MED A;  4FZY A;  3LP0 A;  3C94 A;  1JLE A;  3P5J A;  2A1R A;  2R7Y A;  3LAL A;  5KGX A;  3VQD A;  3PV8 A;  4CJ4 A;  3HVR A;  4EP4 A;  1IO2 A;  4DS4 A;  1RDD A;  3DRS A;  3LP2 A;  4YFU A;  1NJX A;  4J2B A;  2ITG A;  4DU4 A;  3VQC A;  4OLA A;  1FK9 A;  3TI0 A;  1L3T A;  4HTU A;  4C8M A;  5KRS A;  3C6U A;  2FBX A;  2OPR A;  3TR8 A;  3M8R A;  3QES A;  1L5U A;  4FLZ A;  4E0D A;  2IGI A;  2HND A;  2P51 A;  4MQ3 A;  3S3O A;  3KTQ A;  1D9F A;  4AHU A;  3RTV A;  4AIL C;  1S5J A;  3NF6 A;  3IG1 A;  3DOK A;  4FZX C;  1RCH A;  2RPI A;  2QKB A;  4DQI A;  3IS9 A;  1NKB A;  1LWE A;  1VSE A;  3DRR A;  4ZTJ A;  4KHW A;  4O44 A;  3SV3 A;  1HNV A;  1Q9Y A;  1K6Y A;  1CXU A;  4CES A;  4CFD A;  2VG5 A;  2GV9 A;  4N47 A;  2BDP A;  3HL8 A;  1HMV A;  4DSF A;  3TAG A;  2XRI A;  1JL2 A;  4CJR A;  3VA0 A;  4CJ3 A;  1U04 A;  3AVC A;  4CGJ A;  4KB0 A;  4KHY A;  4I7F A;  3ZSV A;  4CK2 A;  4GVM A;  4Z0U A;  3LZI A;  3KKR A;  4M41 A;  4CFB A;  4M3W A;  4NCA A;  3WNF A;  1N5Y A;  2AJQ A;  3OYB A;  3VQ4 A;  4FJK A;  2HB5 A;  3O4N A;  1TKD A;  3AVM A;  5EU7 A;  5KTQ A;  4QOZ B;  1JLF A;  3H08 A;  3ISN C;  4DFJ A;  1U49 A;  4J2E A;  4HCB A;  1RT5 A;  4PWD A;  3LZJ A;  5HRN A;  4ICL A;  3V81 A;  3PX0 A;  4AHS A;  3JSM A;  3SQ2 A;  2KZM A;  4FJ7 A;  4LSL A;  3ZSQ A;  2HHV A;  5JS1 A;  3C95 A;  4KRE A;  1NJY A;  3O3H A;  2KTQ A;  3V4I A;  4FCY A;  3K5O A;  3KJV A;  4OKE A;  2JLE A;  4FLU A;  4OLB A;  2YNH A;  2VG7 A;  3RMB A;  2BAN A;  1RTJ A;  3DRP A;  4I9L A;  1SKS A;  1CLQ A;  4CF8 A;  4CJF A;  3HPG A;  1S6Q A;  3L3V A;  3NAE A;  3VQ9 A;  3TAE A;  4NYN A;  3F9K A;  4DTJ A;  3U6F A;  3V6D A;  3SPY A;  3MXJ A;  4Z4G A;  3OVN A;  2HVH A;  1NOY A;  3V9U A;  1NKC A;  1RT4 A;  4CJS A;  3AO2 A;  1ASW A;  4LSN A;  1KCF A;  3PO5 A;  4N5S A;  1KFD A;  3LWL A;  3VN5 A;  5I42 A;  3VQB A;  4I2P A;  4OGC A;  3RWU A;  1YT3 A;  3P83 D;  1EX4 A;  1VSM A;  4YNQ A;  1HYS A;  1ZBF A;  4N56 A;  2D0C A;  3I0S A;  4CJL A;  3AV9 A;  4KAZ A;  4KFB A;  4B9M A;  4CE9 A;  3DLH A;  4FYD A;  4AHR A;  5DK5 A;  4PUO A;  3V1Q A;  3NDK A;  3SQ4 A;  1F21 A;  3ZT4 A;  3KD1 E;  4JRP A;  4BDP A;  1BIS A;  3FFI A;  1QE1 A;  4CEZ A;  3B6O A;  2D0B A;  2KFN A;  4CEB A;  4DQS A;  2ZD1 A;  3ALY A;  1CXQ A;  3I0R A;  3S3M A;  1JLA A;  1ASU A;  3ASM A;  4KHS A;  1JKH A;  1C1A A;  4DFM A;  4PY5 A;  4Z4I A;  2G8I A;  3T3F A;  3L2V A;  2PYJ A;  1VRU A;  3VA3 A;  3SCX A;  3K58 A;  3VQ8 A;  2BE2 A;  2XY8 A;  1LW0 A;  4MFB A;  4JS4 A;  3OYK A;  1C1B A;  5J2M A;  1WSI A;  1T8E A;  3TAM A;  4CJP A;  3KLE A;  3C6T A;  3D45 A;  3NE6 A;  1LAV A;  4JLH A;  3NCI A;  3VQP A;  3CFP A;  4FZZ A;  1RDC A;  4CF0 A;  3ZSW A;  1J54 A;  4C8N A;  4CEO A;  4CFA A;  2YNI A;  2OA8 A;  4IFV A;  3SPZ A;  2HHX A;  1Q9X A;  4B9L A;  3HP9 A;  1HYZ A;  3QEX A;  4NCG A;  1C1C A;  2YKN A;  4FVM A;  3PX6 A;  3TAF A;  4KO0 A;  2P1J A;  3NF9 A;  3ZCM A;  1TK0 A;  2HHS A;  4XIU A;  1LV5 A;  3OYH A;  1TK5 A;  4G1Q A;  1UA0 A;  4LH4 A;  3KIO A;  3HO1 A;  3AVB A;  3HYF A;  1HQE A;  4I2Q A;  1QSS A;  2XY5 A;  4M3R A;  2HHU A;  3AVG A;  5KI6 A;  4H8K A;  4Y1C A;  3HXM A;  5KGW A;  3LP1 A;  4AHV A;  4E1N A;  5C25 A;  4DF8 A;  4FJL A;  1WLJ A;  2F8T A;  3JYT A;  3VQ5 A;  1GOC A;  2WON A;  5HBM A;  5HRP A;  3TWH A;  1RDA A;  1SV5 A;  4GMJ B;  4W5O A;  3L2U A;  4NYF A;  2IC3 A;  2Y1I A;  4C8K A;  1JLC A;  4Z4H A;  1Z25 A;  1X9M A;  1TAU A;  3E01 A;  2NUB A;  4Z4E A;  1RT1 A;  4FJH A;  2VG6 A;  4H4M A;  4IDK A;  3KLH A;  3NBP A;  5HRR A;  3L2Q A;  1CZB A;  2OPQ A;  3K57 A;  4O0J A;  3MEE A;  4FLX A;  1RTD A;  4FJG A;  4NCB A;  2Z1J A;  1U4B A;  2YKM A;  2PZS A;  5FRN A;  1D5A A;  4GW6 A;  2XY6 A;  1QHT A;  3NF7 A;  1IG9 A;  4FJ8 A;  2EX3 A;  1RBV A;  4LD0 A;  3SUO A;  2PYL A;  3LPU A;  4CF1 A;  1NK5 A;  1L3V A;  4IBN A;  1JLB A;  1KVC A;  4N76 A;  1HNI A;  3VQA A;  2D5R A;  3QIO A;  4CJQ A;  3VQQ A;  2KZZ A;  3RMA A;  5SWM A;  2Z1I A;  2QXF A;  3SNN A;  3IAY A;  2XO7 A;  4UQG A;  3BDP A;  5FDL A;  1T03 A;  4QAG A;  4DLE A;  2OYQ A;  2EHG A;  3AA3 A;  4M3T A;  1U48 A;  4J2D A;  3SZ2 A;  2OPS A;  4E1M A;  2HW3 A;  5J2N A;  3HPO A;  3DOL A;  4CHO A;  2RN2 A;  1RBS A;  4OJR A;  3NGZ A;  3CM6 A;  5J2P A;  1XHX A;  1J5O A;  3LP3 A;  4HUG A;  1Q8I A;  1RT7 A;  3OY9 A;  4B9N A;  3KD5 E;  1TVR A;  4M3Z A;  4ZHR A;  2HHQ A;  2RKI A;  3ITH A;  2W42 A;  1KFS A;  1RNH A;  4F2R A;  1ZBU A;  4HHT A;  4FM0 A;  4Q0B A;  4CHQ A;  3OYM A;  4M3Y A;  3OS2 A;  5I3U A;  3D0P A;  3ZSX A;  1JXB A;  4BE2 A;  4F8R A;  5T7B A;  3EZ5 A;  1SL2 A;  3PO4 A;  4FJN A;  1NKE A;  4W5N A;  1BCO A;  3OYN A;  4KTZ A;  4CJT A;  1FKP A;  4DU1 A;  3SI6 A;  3HJF A;  1XHZ A;  4CJU A;  1HQU A;  4M3X A;  4KHQ A;  4C8L A;  3QNO A;  3QEP A;  4EZ9 A;  4I9Q A;  4FJM A;  2FBY A;  5DMR A;  3V1R A;  2HMI A;  1RT3 A;  1YVU A;  2DFF A;  3CYM A;  3AO4 A;  3NGY A;  1KTQ A;  3KLI A;  1UWB A;  4FW2 A;  4LH5 A;  3QLH A;  5K14 A;  3MAQ A;  4F3O A;  2DY4 A;  1KRP A;  3LPT A;  1S1W A;  3LAN A;  3TAP A;  2FC0 A;  1SL0 A;  3OS0 A;  3K5M A;  3OYA A;  1NK4 A;  3OS1 A;  4Z4F A;  3RMD A;  2X6S A;  2YV0 X;  2G8F A;  4DTS A;  4LY7 A;  5J1E A;  1J53 A;  4DTO A;  3MXM A;  3QIP A;  4DQR A;  1S1T A;  1VSL A;  4KPY A;  3MEC A;  3LAM A;  4CJW A;  2ZQB A;  4BAC A;  2Y1J A;  3SJJ A;  1XWL A;  2GBZ A;  2IDO A;  4E89 A;  3K5N A;  4O5B A;  2B6A A;  1WSE A;  1BIU A;  3B6P A;  1HYV A;  2ETJ A;  1O1W A;  3AVJ A;  4M42 A;  1JLG A;  4DTR A;  1RBT A;  5J2Q A;  2OZM A;  4IKF A;  4B8C A;  3EYZ A;  4CGD A;  3OYG A;  1LW2 A;  1YTA A;  2IAJ A;  3OYF A;  4DFP A;  1TAQ A;  4K8X A;  4TSX A;  4RW4 A;  4KV8 A;  3CM5 A;  3M8Q A;  5FRO A;  4FK0 A;  1NOZ A;  3AA4 A;  3IRX A;  1RTI A;  2A1S A;  4DMN A;  4F4K A;  1HPZ A;  3RRH A;  4AHC A;  3SUQ A;  1JXE A;  5HRS A;  1XI1 A;  2B5J A;  2F96 A;  1NK8 A;  4FLV A;  1L3U A;  3ZSY A;  3QET A;  1ZBH A;  4B9V A;  3OYC A;  3F73 A;  4Q5V A;  4HUE A;  3DLG A;  3L3U A;  4CK1 A;  4DF4 A;  3PX4 A;  1VSI A;  2DFE A;  3G10 A;  3G0Z A;  4DLG A;  1NK6 A;  4FM1 A;  1D8Y A;  1YTU A;  4R5P A;  3V1O A;  3AVL A;  5CY4 A;  3NGI A;  3SQ0 A;  4C8O A;  3DM2 A;  4CEQ A;  1QSY A;  4FJ5 A;  1TKZ A;  3WNH A;  4B8A B;  2RF2 A;  4CGF A;  4BDY A;  5HP1 A;  1S1X A;  1GOB A;  2XHB A;  3HPH A;  3DMJ A;  2FBT A;  1REV A;  1TKX A;  2OPP A;  4OVL A;  4DG1 A;  4O0I A;  1BI4 A;  1T7P A;  2JGU A;  2I5J A;  4CGH A;  1SUQ A;  2E4L A;  2Z1H A;  2G8H A;  1C0M A;  1FKO A;  5JS2 A;  2D0A A;  3V9Z A;  2KQ2 A;  3QEI A;  1X9W A;  4RW9 A;  3OJS A;  1TL3 A;  4CJ5 A;  4KI6 A;  2BGG A;  5CZ2 A;  3DYA A;  4CGG A;  1WNS A;  4CFC A;  3OYI A;  4AHT A;  1UA1 A;  2VWJ A;  4O55 A;  4CF9 A;  3BGR A;  4CHP A;  3WNE A;  1RT6 A;  2YHB A;  1BHL A;  3O4Q A;  3TAB A;  3OJU A;  3MXI A;  3K2P A;  5KRT A;  4HCC A;  4DSI A;  4M3U A;  2O4I A;  4DTX A;  4KKO A;  1JLQ A;  4J2A A;  3ZSR A;  1ITG A;  1B9F A;  1BL3 A;  5C42 A;  3AVK A;  4DTP A;  1J9A A;  1Z26 A;  3OYJ A;  2YNG A;  4CHY A;  3KLF A;  1UAX A;  1SKW A;  1IKX A;  3I8D A;  1BCM A;  1VSD A;  4IG3 A;  4BE0 A;  1TK8 A;  2HNZ A;  2ZE2 A;  3THV A;  1RIL A;  2DTU A;  1NK9 A;  4RW6 A;  2GUI A;  3EY1 A;  3K5L A;  2X74 A;  1JL1 A;  1ZBI A;  4Y1D A;  4Z4C A;  1LWC A;  4KTQ A;  1UOC A;  2P5G A;  2G8K A;  1BI4 B;  4W5T A;  1WAJ A;  4OKJ A;  1FXX A;  3SV4 A;  3RMC A;  1Y97 A;  3V9S A;  3NH2 A;  3S3N A;  1BQM A;  4OPK A;  3QO9 A;  4AH9 A;  4ZTF A;  1KVA A;  1EET A;  2YNF A;  2IS3 A;  3L8B A;  4EP5 A;  4KHN A;  4FLT A;  1I39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...