4HHTA

T. maritima rnase h2 g21s in complex with nucleic acid substrate and calcium ions
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
229
structure length
220
Chain Sequence
b'GIDELYKKEFGIVAGVDEASRGCLAGPVVAAAVVLEKEIEGINDSRLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKSVVFRKER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title RNase H2 roles in genome integrity revealed by unlinking its activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/dna
total genus 75
structure length 220
sequence length 229
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hhtA00
1TK8A 4FLWA 1NK4A 3QEIA 1BISA 1IKYA 3E01A 3LDSA 4RW9A 4CJWA 3B6OA 3UIQA 3HSTB 4FJ8A 3HP6A 1J54A 1RBUA 3SV3A 3MXIA 4FJIA 1RT3A 2KFZA 3LP2A 1QSSA 1LWEA 1QE1A 1QSYA 4FM0A 5FROA 1REVA 4ZHRA 1QQCA 5CYMA 3V1QA 1SKWA 1U48A 1Y97A 3NH0A 2VWKA 3CM6A 4KV8A 4IDKA 5CZ1A 4CGGA 3CQ8A 4BDYA 1VRUA 3SQ2A 4Y1CA 2PZSA 3SPYA 1S1XA 2DFFA 4UQGA 4N76A 1BQMA 2YHBA 4LY7A 3SUQA 1HYSA 1RBVA 3MEDA 2VG5A 1ASVA 4XIUA 3EZ5A 2JLEA 4BDPA 1Q9XA 1RBTA 1RDBA 4OKJA 4L8RB 1KFDA 1YTUA 4FLXA 1FXXA 4FJKA 4M42A 3TAFA 4CEEA 4E1NA 1HPZA 1RT2A 3LPTA 3ZSOA 1HYVA 4CJ4A 2Z1HA 1U47A 4QOZB 4O4GA 4FZXC 1RT4A 4DQRA 5JS1A 1TGOA 2G8WA 3DI6A 2B6AA 1VSMA 1RTJA 4CF0A 4CJPA 3HT3A 1LV5A 5C25A 1FKPA 3V9SA 1ZBFA 2ZQBA 3DLGA 4CGFA 4KAZA 1JLAA 3F73A 4KKOA 3L2QA 2IC3A 3AA4A 3OYMA 4CJSA 1RT6A 4BE2A 3MEEA 1JLQA 1UA0A 2OPQA 5J2MA 1T7PA 4W5QA 4JRQA 1S9GA 2YHAA 3AVBA 4DLGA 2OPSA 3ITHA 3VQ9A 1KLMA 1A5WA 2VG7A 3LANA 3V4IA 1N6QA 4FJNA 4M3TA 4KRFA 2HVHA 2Z1GA 1D9DA 3TAQA 1DTTA 1A5VA 1RTHA 3DLKA 3ZT0A 2FBTA 3OS0A 5HP1A 1RBRA 4OGEA 2A1RA 2HMIA 1BQNA 4B08A 3OYCA 1BIZA 4C8OA 4FJMA 4KHNA 2EHGA 2KQ2A 1T8EA 1ITGA 3K5NA 3G0ZA 3OVNA 3LPUA 1KVCA 3DLRA 4PY5A 4HUEA 3C6TA 2FBXA 2KZMA 2YV0X 3RMCA 2HHWA 3HPGA 4FLVA 4KHQA 1WSFA 1CZBA 2OPPA 3U3GA 3ZT4A 3QERA 1C1CA 4Z4CA 3PX4A 3DLBA 1GOBA 1SUQA 3VA0A 3PO5A 3KK3A 2O4GA 1BL3A 4FM1A 3QIPA 1IO2A 1R0AA 2ATQA 3AVFA 3KD5E 4M3UA 1CLQA 3SZ2A 2F8SA 4YNQA 5EU7A 4PUOA 4CFAA 2HW3A 1XHXA 4C8NA 2XHBA 3ISNC 4M45A 4I7FA 4IFVA 2VWJA 1IH7A 1TV6A 4FYDA 4R5PA 1NK8A 4FJ7A 1IG9A 4B8CA 2ITGA 4NCGA 4DMNA 4CJLA 4CIEA 2D0BA 4RW8A 1Q8IA 4I9LA 4DTJA 3RMDA 3AVIA 4KO0A 3SI6A 4PA1A 4BDZA 3RRHA 2YNIA 1NOYA 1KTQA 3KLFA 4FM2A 1TK5A 3SUPA 5KTQA 2P51A 4ID1A 1ZBLA 1TAQA 3AO1A 3SYZA 4M3WA 1QSLA 4E7HA 1JLGA 3M8PA 3AVGA 2XY7A 4CFDA 3MAQA 1NKEA 4FJXA 4K8XA 4J2DA 3O4QA 3NGIA 3LP1A 2W42A 3DYAA 5D3GA 1VSLA 4DLEA 2X6NA 5T7BA 4HUFA 3NCIA 3A2FA 4JS4A 1C0UA 4LD0A 3OYDA 1EX4A 3ZSYA 4CHYA 3LZJA 4DTUA 2G8KA 2X78A 1SL1A 1IKXA 5J1EA 2P5OA 3M8SA 4CFBA 5HROA 3ZT1A 3BDPA 4B9NA 1S1WA 2OZSA 2Y1JA 1L5UA 1L3TA 1EETA 4DSKA 4CJ3A 3O4NA 1L3VA 4CF1A 4DWIA 3AA5X 2KZZA 4C8LA 3QEVA 4F2SA 1FKOA 1F21A 1HQEA 1S1TA 3AO2A 3S3NA 4B3OA 1S6QA 2FC0A 2IAJA 1XI1A 4ICLA 1JL1A 4DSJA 3C95A 5KI6A 3ZT3A 1BCOA 2PYJA 1VSJA 5J2NA 3KJVA 4FZYA 3OYLA 1X9MA 1IKVA 1RDAA 3ASMA 4N56A 4I2QA 4E7LA 3RR7A 4KHWA 3NGZA 4OLAA 4DTPA 4DQIA 3AVMA 4MQ3A 2Q3SA 5DK5A 3T19A 1QHTA 2GUIA 4WE1A 1X9WA 1NK0A 3ULDA 4CHPA 3S3MA 3I0SA 4DU3A 4DQPA 4NYFA 3QEWA 2HHVA 4Z4EA 3G10A 4DFMA 1U49A 3OYAA 4J2EA 3LAKA 3K59A 4Z4HA 3NFAA 1YVUA 4KB1A 4M41A 3PX6A 2QKBA 4FJGA 2YKMA 3L2UA 2HHQA 2OPRA 3HO1A 3B6PA 1C6VA 4PQUA 4DS5A 1X1PA 4IKFA 2KFNA 2HNYA 4IG3A 1VSFA 2IDOA 5CYQA 3NAEA 3QEPA 4F3OA 3TI0A 1ZBIA 3PUFA 4B8AB 4CF2A 4NCAA 4KI4A 1GOCA 4CEOA 1TKDA 4CF9A 3RWUA 4I2PA 4N47A 4M3ZA 2G8IA 2ZE2A 2EX3A 3P5JA 3OYFA 4EP4A 4DFJA 1HYZA 1VSDA 4OPJA 1T03A 3T1AA 1I39A 3VQQA 3QEXA 5HBMA 3NE6A 3AVKA 1SKRA 3NDKA 5FRNA 4K8ZA 4N41A 4CK3A 1CXUA 1UAXA 3OS1A 3IRXA 3K58A 2Z1IA 4QCLA 2OYQA 1JLEA 3EYZA 4PWDA 3DOLA 3K5OA 3AVJA 4CJUA 4CJVA 4FJ9A 3PX0A 5HRRA 1EP4A 3ZSZA 2D5RA 3V1OA 4O5BA 4FLUA 3ZT2A 4DSFA 4KHYA 1S6PA 4E1MA 1VSHA 4O0JA 4NYNA 2ETJA 4E7KA 1NKCA 4HHTA 4AHCA 1ZYQA 2PYLA 4HVJA 4CGJA 3LWLA 3KD1E 1RBSA 1VSKA 3VQAA 4AHRA 2ZD1A 4IFYA 2DY4A 1WSHA 3OS2A 4CEAA 3PY8A 4Q0BA 5HRSA 3PV8A 4CE9A 4CERA 3OYGA 3AO5A 4YFUA 3U6FA 4HCCA 4FK4A 2DFHA 1Z26A 1LWFA 3ZCMA 1CXQA 2FBYA 3F9KA 3MECA 4CFCA 1BCMA 3ALYA 4DSEA 2O4IA 3VQBA 4DTOA 4FZZA 1S5JA 4OJRA 3C6UA 4CEFA 3TAMA 5KGXA 1BI4A 4FLYA 1NJYA 3RRGA 1NJZA 2BGGA 4FK0A 5CY4A 4LH5A 1YT3A 2JGUA 1UA1A 4DF8A 3V1RA 3L8BA 4M3YA 1NJWA 3HYFA 1SKSA 1L3UA 3LAMA 3M8RA 2HVIA 1WAFA 4H4MA 3V9UA 1U45A 3L2WA 1NK6A 3KKSA 4FJHA 2IOCA 1RTIA 1NK9A 4F2RA 1TVRA 3K2PA 3SPZA 3TR8A 3VQDA 1J53A 1WSGA 3P1GA 4W5RA 4EZ6A 3OYJA 2E6LA 2HHTA 3AVNA 4EP5A 3HPHA 1NOZA 4F3TA 3AVLA 4JLHA 1RNHA 1NK5A 1VK0A 3QINA 1BHLA 1KFSA 2BANA 4GVMA 3HJFA 1JLFA 1C0MA 3MEGA 3TARA 3RR8A 4KREA 1VRTA 4CF8A 3ZSXA 2QKKA 4CESA 3T3FA 3U3YA 1BIUA 3TANA 3HVTA 4LSLA 3FFIA 4DQSA 1KLNA 1CZ9A 1RILA 4CJFA 1LW0A 5FRMA 2BDPA 4HTUA 2HNDA 4DTMA 1TL3A 2Z1JA 4CEQA 2HHXA 2NUBA 2G8VA 3HM9A 1T05A 3L2VA 3P83D 1GOAA 4BWJA 1LAWA 4G1QA 3VQ5A 4O0IA 3S3OA 1JLCA 1J5OA 5KRSA 4ID5A 4CEZA 3D0PA 3L3UA 3RMBA 4ELVA 4H4OA 5CZ2A 3OYBA 4AHUA 4KB0A 3KTQA 3VA3A 2FBVA 4E89A 3OYNA 4QAGA 3KK2A 2XY8A 1HJRA 3QO9A 4EZ9A 3O3GA 3L2RA 2HB5A 4CHZA 2P5GA 2X74A 1WNSA 4DFKA 4Z4IA 3TAEA 1WAJA 5E41A 4ELTA 1LAVA 2GV9A 2KTQA 3O3HA 5KGWA 2HHUA 3VQCA 4AHTA 1KCFA 4BE0A 4DU1A 4CGHA 2DFEA 1JXBA 2I5JA 3C94A 1WSJA 1G15A 3H08A 2XY5A 1C1BA 1UOCA 3RTVA 3SNNA 3DLEA 5SZTA 3JYTA 2XY6A 1RT1A 1W9HA 1S1VA 3AO3A 1RDDA 4OKKA 1QTMA 3PO4A 3KK1A 4CGIA 2XO7A 5DMRA 3HK2A 1D9FA 3V81A 4F4KA 2LSNA 2GBZA 3HL8A 4CHNA 1Z25A 1NJXA 3NHGA 4HCBA 3SUOA 1HNVA 2RF2A 1WSIA 4M3RA 1C1AA 2IGIA 4H8KA 4FJLA 4E0DA 3ZSWA 3HP9A 2OA8A 4N5SA 1ASUA 3KIOA 4C8MA 1HMVA 4CJKA 1JLBA 4E3SA 4FLTA 5FDLA 3ZSVA 3OYKA 1D5AA 2XRIA 2OZMA 1D8YA 1NK7A 3AV9A 1VSIA 4RW7A 2BE2A 3DRPA 3NGYA 3CFPA 1O1WA 4J2BA 2PY5A 3IG1A 3OYIA 1TKZA 3L3VA 4KHUA 2WONA 4GMJB 1DTQA 1SV5A 1XHZA 3DLHA 4M3XA 3NBPA 2G8UA 2VG6A 4BWMA 1B9DA 2A1SA 3LZIA 4OGCA 4W5TA 3V6DA 4KTQA 4NCBA 1RDCA 4ELUA 4O55A 1RT7A 3O3FA 2WOMA 3OJUA 2QK9A 2G8FA 1WSEA 4IG0A 2QXFA 3K57A 2YNGA 4FCYA 4AH9A 3BGRA 4E19A 3SQ4A 4DTXA 4CJEA 1B92A 1K6YA 1ZBUA 3NH1A 3V9XA 1EXQA 1L3SA 3VN5A 2AJQA 1TKXA 4DSLA 3K5MA 4CJRA 1KSPA 3LALA 1W0HA 3DRRA 3KLHA 5KRTA 4CECA 4DFPA 1YTAA 1ZBHA 3QNOA 4CCHA 1C0TA 3AA2A 4KHSA 1A5XA 4CHQA 3D45A 2E4LA 4ZTJA 3M8QA 3THVA 5C24A 1J9AA 3SUNA 1S1UA 2HNZA 3VQ6A 4B9MA 1RT5A 1HQUA 4AHSA 4J2AA 4FJ5A 1I3AA 2F96A 3LP3A 4CJTA 4HUGA 3VQEA 3HPOA 1RTDA 3KLIA 2B4JA 1TL1A 3VQPA 3OY9A 3OYHA 5J2PA 4AILC 3VQ7A 2HHSA 3NF6A 4MFBA 1FK9A 4CHOA 3JSMA 3CYMA 5HLFA 1WN7A 2G8HA 3QLHA 3QIOA 3NF8A 3QNNA 4LSNA 4DF4A 4B9UA 5HRNA 3CM5A 4FVMA 4O44A 3RMAA 3CG7A 2DTUA 3WNGA 2D0AA 4RG8A 4BE1A 1VSEA 3IS9A 4CJQA 3KLEA 3QESA 3TAGA 2RKIA 4CK2A 3DM2A 5HRPA 3IAYA 5K14A 1QS4A 4OPKA 1UWBA 2R7YA 3EY1A 4W5NA 4I9QA 3AVCA 3WNHA 4FXDA 4RW6A 4AHVA 4CIFA 1LW2A 1JXEA 1XWLA 2X6SA 2Y1IA 4IBNA 3DRSA 1U4BA 1SL2A 4ZTFA 4FK2A 3WNEA 3HXMA 3SQ0A 1ASWA 1DLOA 4RW4A 3KLGA 3S9HA 2D0CA 3KKRA 3AA3A 4DS4A 1TK0A 4KTZA 4Q5VA 2E6MA 4DTSA 1JL2A 4F8RA 1SL0A 2P1JA 4DQQA 1KVAA 3V9WA 3K5LA 5SWMA 4Z4GA 4B9SA 1MU2A 3AO4A 2B5JA 1U04A 4B9LA 1KVBA 4OVLA 3LWMA 1HRHA 3NF9A 4KTWA 4BACA 5I42A 4E7JA 1BI4B 2YNHA 4DU4A 3TAPA 3TWHA 1X9SA 4KFBA 4Z4FA 3HVRA 3SCXA 3AVAA 4CEDA 1WLJA 3OYEA 2KW4A 4DSIA 1Q9YA 4OKEA 1NKBA 3LP0A 3NF7A 4DTRA 1XC9A 4FJJA 4CJ5A 3SJJA 1N5YA 3AVHA 1HNIA 4LH4A 4DTNA 4CGDA 4KPYA 1JKHA 4FW1A 4CK1A 3WNFA 3DOKA 3SV4A 1BGXT 3OJSA 3CFOA 3ZSRA 1RCHA 1KRPA 3ZSQA 3I8DA 3V9ZA 3SQ1A 4W5OA 4KI6A 4C8KA 4FW2A 3VQ4A 4FLZA 3QETA 1TKTA 4E7IA 4JS5A 2YNFA 4Z0UA 3I0RA 5JS2A 1TAUA 4OLBA 2F8TA 1EKEA 3DMJA 1S9EA 3CFRA 4CIGA 1B9FA 4B9TA 5I3UA 2IS3A 4CEBA 4B9VA 2YKNA 3NH2A 4Y1DA 3MXMA 1LWCA 3TABA 4JRPA 4GW6A 4TSXA 2RN2A 2RPIA 5C42A 5J2QA 3VQ8A 1IKWA 3MXJA 4DG1A
chains in the Genus database with same CATH superfamily
4FLWA 3MN9A 3QEIA 1BISA 4YOXA 3NMUA 4CJWA 4BQLA 3LP2A 4QS8A 1QSSA 1E3MA 5FROA 2QWOA 2VWKA 5CZ1A 4LF8K 3GDQA 3VEYA 2PZSA 3SPYA 1S1XA 2Q0RA 1BQMA 1HYSA 2O8CA 3MEDA 1ASVA 4JI6K 3G25A 1RBTA 4OKJA 1QQNA 1I94K 4FLXA 3THYA 3RSEA 4FJKA 4M42A 5HL7L 4CEEA 4E1NA 3LPTA 1K8KB 1U47A 3VF2A 4DQRA 3J7AP 1VSMA 1RTJA 1LV5A 1IBKK 5C25A 1FKPA 3CJ7A 3V9SA 3DLGA 3N4QA 4KKOA 3L2QA 3O9SA 4H0YB 5M1FA 1UA0A 5J2MA 4H0OA 3R6MA 3H46O 2YHAA 1WBDA 1GLFO 5AQNA 2OPSA 1NBWA 4FJNA 4BR9A 2NRHA 2AP1A 4M3TA 2HVHA 5HP1A 3DLKA 1RBRA 1BQNA 3B8AX 3OYCA 1ITGA 3OVNA 4BR2A 1KVCA 3DLRA 4PY5A 1IV0A 4QS7A 3RMCA 4FLVA 4KHQA 1K73O 3ZT4A 3PX4A 3DLBA 4K41A 4BQZA 3SLCA 2O4GA 1BL3A 4JI3K 1R0AA 2GTDA 4CZHA 5BRDA 4CFAA 1QZ5A 3R1XA 5JVHL 4IFVA 3GG4A 4MO5A 1N34K 4FJ7A 4B8CA 4NCGA 2FSKA 4YOWA 4CJLA 2YHYA 4WFNL 3M3ZA 4KO0A 2YNIA 5KTQA 3AO1A 3SYZA 5BRFA 4KHPK 2XY7A 1NKEA 4WFBL 2Q36A 4J2DA 3ZYYX 5CR4A 3LP1A 5D3GA 3ZEUA 1VSLA 2RE2A 5T7BA 3VEWA 1C0UA 3OYDA 4BRMA 4B1YB 3ZSYA 3LZJA 2Q0UA 1NGJA 4OPAA 4YOVA 5A2QO 3O80A 4O5FA 1ZBSA 3O4NA 4CF1A 4DWIA 2JWLA 3ENHA 2UYTA 2IAJA 4ICLA 4B3TK 2WBNA 4MO4A 4FZYA 5C10A 3ASMA 4LF5K 5M1QA 3CD6N 4C1NK 4DV3K 2Q2RA 4WE1A 5AQQA 2HF4A 2YHXA 3A8YA 3S3MA 1HKGA 4B1UB 4Z4EA 3OYAA 5JLFA 4J8FA 4M7XA 5F1XA 3B6PA 3O9TA 4WQ5C 2HNYA 5EY4A 2IDOA 4CBXA 3NAEA 3QEPA 4F3OA 3BY5A 4CF2A 3ZETA 1GOCA 2PAVA 5KPRA 5ADXA 3RWUA 2ZE2A 3VGLA 1HYZA 2A5XA 3MCAB 4OPJA 3WUHA 4K8ZA 3TU5A 4CK3A 3K58A 3ATUA 3MCPA 1JLEA 2A3ZA 1OH8A 4FWPA 4CJVA 5M1KA 2D5RA 3KHYA 4O5BA 1VSHA 4O0JA 3TSQA 4E7KA 1NKCA 5LMUK 5KPZA 4JD2A 4CGJA 1RBSA 2DY4A 4CE9A 4CZGA 4CERA 3U6FA 2HMPA 4YFUA 4HCCA 1J5EK 1CXQA 2P9NB 4DTOA 3JS6A 1T3VA 4FZZA 1S5JA 3RRGA 2KKZA 2BGGA 1HKBA 3HOTA 3CC2N 3DXKB 2JGUA 1UA1A 3L8BA 3CJ9A 3D2FA 1NJWA 1U45A 1NK6A 2NRTA 5ELZA 2IOCA 5BN8A 3G6EN 1NK9A 2IVPA 3K2PA 2I7NA 3P1GA 5JVGL 4JHDA 3EKUA 3AGKA 4YORA 3VF4A 4JKFA 2BANA 5F0XA 4KREA 4CF8A 3T3FA 3TANA 3C0BA 3SBGA 2RHKA 4Y0WA 2HNDA 4DTMA 2E1YA 4JN4A 3W3DA 1T05A 3L2VA 3P83D 1GOAA 1N33K 3S3OA 3VQ5A 1MA9B 2WFBA 3OA9A 3D0PA 1KQSM 3OYBA 4AHUA 5B8HA 4KB0A 3OYNA 4E89A 3KK2A 4DR2K 3EEQA 3QO9A 5AQJA 4EZ9A 2W40A 2X74A 4EHUA 4DFKA 1WAJA 4ELTA 2KTQA 2O8FB 5AQUA 5KGWA 1GLEG 3O1BA 3ZX0A 2J4RA 4DU1A 4BRLA 3ENBA 4K43A 3KK7A 4H5VA 3DLEA 4LF9K 3ZX2A 1S1VA 3TPQA 2FF6A 5EVZA 3V81A 3EO3A 4F4KA 3HL8A 4HCBA 3QFPA 1HNVA 2RF2A 4FJLA 1NJIO 4E0DA 4FWKA 3ZSWA 5KQ8A 4N5SA 1ASUA 5H1SQ 4E3SA 1HMVA 1LCUA 5GAEP 3QBXA 3C7NB 5FDLA 3ZSVA 3OYKA 3AV9A 3NGYA 4KHUA 4H5RA 1O13A 3M1FA 4GMJB 1BG3A 1DTQA 3WXMB 3E9LA 3E66A 3OJUA 1QQMA 1OVQA 3K57A 4FCYA 4AH9A 1B92A 1K6YA 1EXQA 5EXWA 4GKKK 5AZJA 3I33A 2E8AA 1YTAA 1XC3A 3QNOA 3VEVA 1HUXA 4KHSA 1A5XA 3D45A 3M8QA 3SUNA 4X62K 3QICA 3VQ6A 4B9MA 1RT5A 4FJ5A 3LP3A 4CJTA 1XMOK 3KLIA 1TL1A 3CQXA 3OYHA 4AILC 1OH5A 5AR0A 5BN9A 2O8EA 2G8HA 5FPEA 4DF4A 4XH1A 3RMAA 4YDUC 1MWMA 1K8AO 2QWPA 4BE1A 3BZKA 2P9IB 3SK3A 2RKIA 1MWKA 5HRPA 1BA1A 5AQZA 3EY1A 4I9QA 4AHVA 1XWLA 2P9UA 1U4BA 4FK2A 1ZC6A 3IUCA 1X3MA 4JK8A 3SQ0A 1ASWA 1DLOA 4PKIA 3AA3A 1E4FT 4DQQA 1KVAA 5JLHA 2ZJQL 4Z4GA 4B9SA 3AO4A 1U04A 3LWMA 1HRHA 5I42A 2PFUA 4YOUA 3WEEA 1BI4B 1VQMN 2HF3A 4DU4A 2O8BB 3TAPA 1X9SA 3HVRA 3SCXA 1WLJA 2KW4A 1WBBA 1Q9YA 1YF5L 3WQTA 3SJJA 4LH4A 1VQ4N 4KPYA 3VEXA 2ZM6K 3DOKA 4FWLA 5IT9O 3ZSQA 3JAMO 3HTVA 1TKTA 4JS5A 2YNFA 5JS2A 4FWMA 5AQPA 1B9FA 3WXLA 5I3UA 3H1VX 1LWCA 3PIPL 1YXQA 3VQ8A 4BGAA 3SNNA 3E01A 5CHIA 3LDSA 4DR5K 5FLXO 4GV9A 2UUCK 1J54A 3SV3A 4FWQA 4XH5A 2A42A 4BC4A 1QSYA 3SAHA 1QQCA 5CYMA 4NXMK 2E2PA 1Y97A 3KVGA 4A5AA 4KV8A 3SQ2A 4IDKA 3I8BA 1HX1A 1KAZA 2YHBA 3SUQA 4A2BA 1RBVA 2WTUA 4DR1K 3EZ5A 2JLEA 4BDPA 1NGAA 1YHQN 1Q9XA 3O1WA 1RDBA 4L8RB 1MDUB 3ZSOA 3DXKA 3TTDA 4CJ4A 1NU0A 3VENA 4H5NA 3T1YK 1TGOA 4CF0A 4CJPA 2P9KA 1H1VA 3HT3A 2ASPA 4CGFA 4KAZA 3BEXA 2AA4A 3HBTA 3AA4A 3OYMA 4JRQA 3VQ9A 3UKRB 3CF5L 2VG7A 3LANA 4BRIA 3TAQA 1DTTA 1A5VA 4FOEA 2A1RA 1FW6A 1Y64A 4C8OA 4FJMA 4CD1A 2KQ2A 4GKJK 3G0ZA 2FBXA 3THWA 3J8AA 3QDKA 2VQFK 1RGIA 1WSFA 4I6MB 2OPPA 3QERA 3KWGA 4Z4CA 1GOBA 3VA0A 3KK3A 1IO2A 3LDLA 3MN5A 1ATSA 3AVFA 3OTOK 4M3UA 5EU7A 2HW3A 4M45A 4I7FA 1TV6A 4FYDA 4BC3A 4R5PA 2A41A 1IG9A 1SZ2A 2O8FA 1NGBA 5GADP 1YJ9N 3O8MA 2D0BA 1NGDA 1Q8IA 4PA1A 5AQWA 4AM6A 4FM2A 2PBDA 4DV2K 2P51A 4ID1A 4M63C 1QSLA 1JLGA 1OKJA 3M8PA 5F2RA 2Q1NA 2VQEK 3O4QA 3NGIA 2W42A 3DYAA 1NGHA 4HUFA 3CJ1A 4OPHA 4BVOA 4DTUA 5HROA 4BRPA 1V4SA 1L5UA 1L3TA 4DSKA 3BZCA 1WUAA 4WF9L 3AA5X 3QEVA 4GV6A 1FKOA 5M1NA 2VYPA 1S1TA 3AO2A 5TKYA 1BU6O 1JL1A 4DSJA 3C95A 1VSJA 3KJVA 4BRQA 3CC4N 4PKGA 4E7LA 4CZKA 4BRKA 3IDHA 3NGZA 4OLAA 4DQIA 4MQ3A 4DR7K 1QHTA 2A40A 1VQON 5M1PA 4CHPA 3ULEA 4DU3A 3G4SN 3QEWA 4K42A 3G10A 3IFRA 4DFMA 4CVNE 1X9JA 3K59A 4Z4HA 1QQOA 2FSJA 4M41A 4KB1A 3PX6A 2YKMA 1C0GA 2HHQA 4IOAL 3TSPA 4PQUA 4DS5A 1ZBIA 3DXMB 4NCAA 4M3ZA 2G8IA 4I2PA 1XUPO 2EX3A 1DEJA 3OYFA 4DFJA 1VSDA 1KC8O 4EHTA 4H0TB 1SKRA 1NWKA 4DR4K 4ILJA 1VQKN 3OBYA 4QCLA 3IRXA 2NLXA 4LF6K 3VEOA 4FJ9A 1VAZA 3PX0A 5HRRA 1EP4A 4DSFA 3FZFA 3V1OA 4FLUA 1S6PA 1ZYQA 3LWLA 4IFYA 1WSHA 4EFHA 2F9TA 4Q0BA 3PV8A 4XH4A 4LF4K 3AO5A 3M5RA 2DFHA 3ZCMA 2FBYA 3MECA 1BWFO 4DSEA 4EAHD 2O4IA 3C6UA 5C15A 1BI4A 4LC9B 2I7PA 1JCGA 4LH5A 2BTFA 3L4QA 4Z94A 3V1RA 1JJ2M 3CCLN 3HSCA 2HVIA 3FZLA 3SMPA 1WSGA 3CIPA 4NO7A 3AGRA 4PHTX 4W5RA 3OYJA 3AVNA 3FLCO 3D2EA 5FPMA 3AVLA 4YHHK 2ZWHA 1VK0A 1BHLA 2HBJA 4DCHA 1KFSA 1JLFA 1C0MA 3RR8A 1IBMK 4ISGA 2OTJN 4BRFA 3ZSXA 1W7AA 4DQSA 1CZ9A 3ZLJA 2ASOA 1HKCA 5FRMA 2BDPA 5AQRA 3UKUA 3KZBA 4IO9L 3BF3A 4CEQA 2HHXA 2P9LA 3P31A 1NG9A 4BWJA 2CH6A 3VERA 2WUSA 3L3UA 4FWOA 3RMBA 4DR6K 4OX9K 4QAGA 2V51B 3O3GA 3L2RA 4CHZA 3CPEA 1WNSA 5E41A 3VGMA 3O3HA 3A5MC 3VESA 3VQCA 5JMVA 3QFUA 4AHTA 1KCFA 3C94A 1G15A 3CXCM 1C1BA 4JI8K 5SZTA 1RT1A 3W0LA 4CGIA 5I9EB 1GLAG 3MN6A 4FOIA 2FLOA 3SUOA 1WSIA 1C1AA 4FVUA 3F2KA 2ZGYA 1WOQA 1RDUA 1JLBA 2XRIA 2GEMA 1D8YA 1NK7A 4RW7A 3DRPA 2IVOA 3CFPA 1NGIA 4K0KK 5AQLA 3IG1A 3UKRA 1QVFM 5BPMA 4X66K 4HTLA 1SV5A 4M3XA 1U2VB 3NBPA 2VG6A 4BWMA 3VETA 4O55A 1RT7A 3O3FA 3A5NC 2YNGA 1S3XA 2GUPA 1ZBUA 3H45C 3NH1A 4BY9C 3V9XA 4I6MA 2QI2A 4DSLA 1GLDG 2FSNA 3K5MA 2KLAA 3Q7CA 3LALA 5KRTA 4DFPA 1C0TA 1DKGD 5AQFA 5AQVA 5C24A 2P9PB 4IXCA 4YY3K 1J9AA 1J6ZA 4J2AA 5AQSA 3Q7BA 1I3AA 5C0YA 3VQ7A 3NF6A 4CZIA 3JSMA 3CYMA 2JWKA 3QIOA 3QBWA 4NLBA 4LSNA 5C2DA 4BRGA 4IEEA 4A57A 4BR7A 2DTUA 3THXB 1VSEA 3IS9A 4CJQA 3HM8A 3CMEN 4CK2A 3IAYA 1C0FA 2E1ZA 4W5NA 3CERA 3AVCA 3WNHA 4RW6A 4CIFA 4IBNA 3DRSA 3HXMA 4RW4A 3KLGA 1E4GT 4DS4A 1TK0A 3P4IA 5SWMA 1TYQB 2B5JA 4B9LA 1KVBA 1NGCA 4E7JA 5E84A 2YNHA 4KFBA 2W41A 1EWQA 3AVAA 4CEDA 3OYEA 4OKEA 4H0PA 4CGDA 4MLEA 4CK1A 5AQIA 3GBTA 1KRPA 3V9ZA 3SQ1A 4W5OA 4FW2A 3VQ4A 1TAUA 4OLBA 3DXMA 4CIGA 4V19S 1BO5O 1K8KA 1XNRK 2IS3A 3O9RA 3C6AA 3O9UA 5C42A 3MXJA 2QXLA 2HBLA 1TK8A 4B3RK 3VMFB 2GWJA 4RW9A 4B3MK 3UIQA 3HSTB 4FJ8A 1RBUA 1RT3A 4H5TA 1LWEA 1QE1A 4FM0A 3PSIA 4ZHRA 1SKWA 3V1QA 3CJAA 1G99A 3NH0A 1QVGM 3CM6A 2NRXA 3FGUA 3QMLA 4BDYA 1VRUA 3DAWA 3AAQA 1ATRA 4UQGA 1D4XA 3L0QA 4JI2K 4LY7A 3JXUA 4JKHA 4BREA 4DV4K 4UY8O 4XIUA 4JEPA 3VTHA 2VCPA 4PL7A 1KFDA 1YTUA 2D4WA 1FXXA 1KD1O 1HPZA 1RT2A 4QOZB 1HYVA 4WQ4C 2Z1HA 3DJCA 3E9OA 5JS1A 3EL2A 3DI6A 2IVNA 4JK9A 2ZQBA 1JLAA 3F73A 3GL1A 3NVKA 4WQ4A 1DT9A 4BE2A 3MEEA 2OPQA 1VQ7N 3EE8A 4W5QA 1S9GA 3AVBA 1Q7YO 4DLGA 3ITHA 1KLMA 3V4IA 1XNQK 4ILHA 4GVEA 3ZT0A 2FBTA 3OS0A 3CPWM 4KHNA 4ISEA 1N32K 3K5NA 4HUEA 3C6TA 4B1XB 4L3QA 5AQMA 3HPGA 2W6KA 2HHWA 1IBLK 3U3GA 1C1CA 3VPZA 1BA0A 4HWIA 3KD5E 1CLQA 1SS6A 4DV6K 4YNQA 1TUYA 4PUOA 2ASMA 2XHBA 3ISNC 2QWMA 1IH7A 4KH6A 3EE9A 1NK8A 1P90A 2F7TA 5FPDA 4FPBA 2ITGA 3AAPA 4DV0K 4CI6A 3A5OC 4CIEA 4H0VB 1NLVA 4DTJA 4BDZA 3RRHA 1NOYA 5LJWA 3KLFA 1VQ5N 4M7YA 3SUPA 4H03B 1ZBLA 1TAQA 3OW2M 2V52B 4E7HA 4BRAA 4CFDA 3MAQA 4CZFA 4FJXA 2D0PA 1HNZK 3O9QA 5AQKA 5GIOA 1U6ZA 4K8XA 1JCFA 2KHOA 4DLEA 2X6NA 3WXKA 4JS4A 4LD0A 1EX4A 1YJWN 2FF3B 2QTDA 3IKMA 3FZHA 2P5OA 3KWIA 3ZT1A 1YI2N 2Y1JA 1EETA 4CJ3A 1U2VA 1L3VA 3BP8A 4F2SA 4MDAA 1S6QA 1XI1A 1S22A 3ZT3A 2PYJA 1BCOA 5J2NA 4JK7A 3A0IX 3OYLA 1X9MA 5IWAK 4DTPA 5LJVA 3AVMA 2Q3SA 3T19A 4JV5K 2GUIA 2HHHK 1NK0A 3ULDA 3I0SA 2YJEA 3SAGA 2HHVA 1YITN 2P9PA 4J2EA 5GAHP 4BGBA 2YJFA 1DGKN 1NGGA 3O5BA 1LOTB 4BRCA 2P9NA 3LDPA 2KFNA 4IG3A 3TI0A 3PUFA 4KBOA 4CEOA 1TKDA 4CF9A 4N47A 4BROA 4H0XB 3P5JA 1T03A 4EP4A 3T1AA 5FRNA 3AVKA 3NDKA 4N41A 4JKEA 3OS1A 1CXUA 2NNWA 3THXA 4LF7K 4PWDA 3MX2A 4CJUA 3ZSZA 4KHYA 2YHWA 2ETJA 4BG8A 2P9SB 2PYLA 4HVJA 1VSKA 5AQYA 3VQAA 2Q97A 4MLHA 4CEAA 3H3OB 1IJJA 3EZWA 1Z26A 1LWFA 3F9KA 4CFCA 1BCMA 3G71N 3PLAA 4BC2A 5AQTA 3R8EA 1VHXA 3LDQA 4CEFA 1T6DA 3TAMA 1NJYA 4KH5A 1NJZA 2GELA 5CY4A 5TKWA 3ATVA 1YT3A 5BREA 3TSUA 2YCHA 4M3YA 5DM6L 1SKSA 3LAMA 4CZLA 1ATNA 1R59O 1WAFA 5HOOA 1W97L 3V9UA 4FJHA 1RTIA 1TVRA 3SPZA 2VGMA 3VQDA 4EZ6A 1NMDA 2DPNA 5GAGP 4IDHA 5BRHA 3HPHA 4FL9A 1ILYA 1N36K 3LDOA 4F3TA 4YOYA 1WB9A 4JLHA 3QINA 5AJ3K 4GVMA 3HJFA 4NLCA 3I55N 4GNIA 3MEGA 1VRTA 2QKKA 4CESA 3U3YA 3D7EO 4LSLA 5E26A 1RILA 4CJFA 1OVYA 2UXDK 3C7NA 2G8VA 4FSVA 2UUAK 3VTIA 1OH6A 1JLCA 1J5OA 5KRSA 4ID5A 4C23A 4CEZA 4ELVA 5CZ2A 4CW7B 2E20A 3KTQA 3VA3A 3D2FB 2FBVA 2XY8A 1HJRA 5EOYA 2HB5A 4Z4IA 2GV9A 2HHUA 5BPNA 1BUPA 4CGHA 2DFEA 2I5JA 1WSJA 3H08A 4JHDB 3U9ZA 1UOCA 4WFAL 3CCSN 3RTVA 2EWSA 3JYTA 3LDNA 3AO3A 1QTMA 4OKKA 3WT0A 3KK1A 5DMRA 3HK2A 1D9FA 4JI4K 1QZ6A 4KTQA 4CHNA 4M3RA 4IZ9A 2IGIA 4H8KA 3I56N 2UXCK 3HP9A 2OA8A 4CJKA 4FLTA 5AZIB 1ESVA 1BOTO 2BE2A 2NZTA 4DUZK 2PY5A 3L3VA 4YOTA 1KXPA 5DM7L 3PSFA 3DLHA 2OCEA 4JYAK 3LZIA 2A1SA 1XQSC 3FZMA 4OGCA 4X65K 4W5TA 1RDCA 1QHAA 5C12A 3CJCA 2QK9A 4BG9A 2P9IA 2G8FA 1WSEA 4IG0A 2QXFA 3J81O 1Z6RA 3MX5A 3J7ZO 3SQ4A 1L3SA 1TKXA 4CJRA 1W0HA 3DRRA 2V7YA 3E1YA 3AA2A 3HI0A 4CHQA 3L4IA 3H6EA 2HNZA 1HQUA 2F96A 5BR8K 1VQ8N 3HPOA 1RTDA 2HHSA 3UE5A 2CGJA 2O8BA 2QM1A 4CZMA 2BUPA 3QLHA 3NF8A 3T7ZA 3QNNA 1SQKA 5BR9A 4B9UA 4FVMA 2W6LA 3CCUN 3WNGA 2D0AA 1X3NA 4JNEA 3KLEA 3SJHA 3DM2A 4BRDA 1QS4A 4JI0K 1UWBA 2R7YA 2E2NA 5LL6Z 2HSTA 4FXDA 5AZJB 1JXEA 1YVNA 2X6SA 3ID6A 2Y1IA 3WNEA 3OHRA 3VF6A 3S9HA 2D0CA 4KTZA 4DTSA 1JL2A 4F8RA 1NM1A 1MU2A 4DQ8A 3NF9A 2QWQA 4KTWA 4EIAA 4ISFA 3OBWA 3TTCA 2O8EB 2HOEA 3F9MA 1CZAN 3WXJA 4IFEA 4DSIA 1NKBA 3LP0A 4DTRA 1XC9A 4FJJA 4CJ5A 1N5YA 3AVHA 1HNIA 3WNFA 1ZXOA 1RCHA 3AY9A 3MMVA 4Z0UA 3I0RA 1EKEA 3DMJA 4FWSA 2P9UB 3CI5A 4BRHA 4JI5K 3LM2A 3NH2A 2A6AA 4JRPA 2RN2A 3LL3A 4A62A 5J2QA 1IKWA 1NK4A 2GX9A 3EN9A 1IKYA 1XMQK 4U67L 3PIOL 2O8DB 3WEEB 3B6OA 3T69A 3HP6A 4GV3A 4FJIA 3MXIA 2KFZA 1JCEA 1EQYA 3TTFA 2P9SA 1REVA 1U48A 4A59A 4CGGA 3CQ8A 1V4TA 4Y1CA 2F9WA 2DFFA 3RVCA 1KAYA 4N76A 3CCJN 4IOCL 2VG5A 5FPNA 1P8ZA 3T1HK 3TAFA 1K9MO 2Q31A 4O4GA 4FZXC 1RT4A 2G8WA 2B6AA 4B1ZA 3HRGA 4WQ5A 4F9OA 1ZBFA 2E88A 2IC3A 3IMXA 2GWKA 4CJSA 1RT6A 4RTFD 2ZF5O 1JLQA 4H5WA 2UXBK 3CCRN 1T7PA 1KAXA 2OANA 3H1QA 1A5WA 1N6QA 1Q81O 1IG8A 1Z05A 4KRFA 2V7ZA 2Z1GA 1D9DA 1RTHA 2HMIA 4OGEA 4B08A 1BIZA 3K9JA 5GINA 2EHGA 4C1NI 1T8EA 1FJGK 1M90O 3LPUA 4NXNK 2KZMA 2YV0X 2ZJRL 3VEZA 2HBMA 1CZBA 2ZGZA 1SUQA 3PO5A 4FM1A 4IEIA 3R3LA 3QIPA 2ATQA 1NGEA 1GLCG 2F4VK 3SZ2A 2F8SA 4JKCA 3GOIA 2P9KB 1XHXA 4C8NA 2VWJA 2QWRA 5AQGA 3MN7A 3K0SA 4B1WB 4DMNA 4RWTA 4RW8A 4I9LA 4K25A 4DV1K 3RMDA 3AVIA 3J80O 3SI6A 3O6WA 4BR4A 4DR3K 1KTQA 1TK5A 4PL8A 4M3WA 4FPAA 3CCMN 3AVGA 4LFCK 1YIJN 1VQLN 3MWTA 1RFQA 4DB3A 3NCIA 3THWB 3A2FA 4B9QA 5AZIA 5M1OA 4CHYA 2G8KA 2X78A 1SL1A 1IKXA 5J1EA 3S41A 3VGKA 3M8SA 3CC7N 4CFBA 3E9PA 3BDPA 4B9NA 1S1WA 2OZSA 4JKGB 5BPLA 2VWBA 4CBUA 1Q18A 4WCEL 2KZZA 4C8LA 1F21A 1HJOA 1HQEA 3S3NA 4B3OA 2FC0A 2NRZA 2E2OA 5KI6A 3MK6A 1M1KO 3BUZB 3BF1A 1IKVA 1RDAA 4N56A 3RR7A 4I2QA 4JKBA 3WQUA 4KHWA 5DK5A 1X9WA 1W2BM 2E5LK 1HNWK 3O08A 3AARA 4GY2B 4DQPA 4NYFA 1U49A 5AFUH 3LAKA 3NFAA 1YVUA 2QKBA 4FJGA 3L2UA 2ZJPL 2OPRA 3HO1A 1C6VA 3CJBA 4IKFA 1X1PA 1VSFA 5CYQA 3FR0A 4B8AB 4AQYK 2D0OA 4KI4A 3MWPA 1NMNA 3P38A 1I39A 3VQQA 3QEXA 5HBMA 3NE6A 1UAXA 2Z1IA 2OYQA 3EYZA 3DOLA 3K5OA 3AVJA 1GLBG 3SMSA 3GE1A 3CQYA 3VOVA 3ZT2A 4E1MA 4NYNA 3M6GA 4HHTA 3HZ6A 3A5LC 3K9KA 4AHCA 3KD1E 2QA4N 4AHRA 2ZD1A 3ULEB 3OS2A 4QS9A 3PY8A 3CETA 5HRSA 2BH1A 2QW9A 3OYGA 4FK4A 4FO0A 2IIRA 1NNEA 2O8CB 1HLUA 3ALYA 3L6QA 1Q86O 3VQBA 1S72N 4OJRA 5KGXA 4FLYA 3THYB 3RSEB 4FK0A 4MDBA 4JKDA 1HPMA 4XEIA 4DF8A 3HYFA 1L3UA 4U7BA 3M8RA 4ILGB 4H4MA 3L2WA 3KKSA 1TUUA 4F2RA 3D6RA 3TR8A 1J53A 2CGKA 2HHTA 2E6LA 4EP5A 4BVPA 4BC5A 2YI1A 3SAFA 1NOZA 2QWNA 4YDUA 4NB4A 1EWRA 1RNHA 1NK5A 4B1VA 4CJ7A 5KQDA 1HR0K 2D1KA 3TARA 4B9TA 4O8UA 1BIUA 3HVTA 1KLNA 3FFIA 4DHYA 1Q82O 1LW0A 3C6HA 4HTUA 1TL3A 2Z1JA 2O8DA 2NUBA 1T6CA 5C2FA 3HM9A 3H3NO 1LAWA 4G1QA 4O0IA 4JI1K 5JICA 4DV5K 4H4OA 3FZKA 4IOXA 2P5GA 1T44A 3TAEA 1EO1A 4E1JA 1LAVA 3U9DA 5AQHA 1OH7A 5LY3A 4IO8A 4BE0A 1JXBA 1YJNN 1GLLO 4AM7A 2XY5A 3D2EB 3DWLA 2YX6A 2ITMA 2XY6A 1W9HA 4DUYK 3CCEN 1RDDA 3PO4A 4JI7K 2XO7A 3ENOA 1VQ6N 1GLJO 2LSNA 3ID8A 3R9PA 2GBZA 2NRRA 2OTLN 1NJXA 1Z25A 3NHGA 2QWLA 4DKWA 3ZEUB 3UKUB 4A5BA 4CBWA 1HNXK 3KIOA 4C8MA 2VGNA 1D5AA 2OZMA 2P9LB 2HBKA 1VSIA 5MLCQ 4J2BA 1O1WA 1YAGA 1TKZA 3F5TA 3OYIA 1VQPN 4B3SK 5LMNK 2NRWA 2WONA 5CE3A 4LFBK 2H3GX 2FXUA 1XHZA 2G8UA 1B9DA 4KH4A 3V6DA 4R79A 4NCBA 3QB0A 4ELUA 3HOSA 3CCQN 3DLLL 2WOMA 4FWRA 1RDWX 3BGRA 4E19A 4DTXA 5AQXA 3SBTA 4CJEA 2AJQA 3VN5A 4AF1A 4DV7K 2QEXN 1NGFA 1KSPA 3U8XA 3KLHA 4A61A 4CECA 4O8KA 1ZBHA 1SAZA 3O4WA 4CCHA 3CMAN 4BRNA 4FWNA 2E4LA 4ZTJA 3THVA 5GIPA 1S1UA 4AHSA 1TYQA 5ADXH 4HUGA 3VQEA 1VQ9N 4CZEA 2B4JA 3VQPA 3OY9A 4JAXA 5J2PA 4MFBA 3ZETB 1FK9A 4CHOA 5HLFA 1WN7A 4BR5A 3C65A 1YUWA 3CHWA 5HRNA 3CM5A 4O44A 2CGLA 3CG7A 4RG8A 5EX5A 4WYBA 3QESA 4G9ZA 3TAGA 4CZJA 3WXIA 5K14A 4IJNA 1BDGA 1VQNN 4OPKA 2UUBK 3NVMA 1LW2A 1SL2A 4JD2B 4ZTFA 3U4LA 4JKGA 3KKRA 3FE1A 4IJAA 4Q5VA 2E6MA 4RCHA 1SL0A 2P1JA 3LM9A 3V9WA 3K5LA 2WC9A 4OVLA 5KPTA 4BACA 3CCVN 4BR0A 2NRVA 3TWHA 3P39A 4CD3A 4Z4FA 3ZX3A 4LFAK 4IWVA 3J7YP 3NF7A 4DTNA 1JKHA 4FW1A 4A2AA 3SV4A 1BGXT 3OJSA 3CFOA 3FFKB 3ZSRA 3N4PA 5AQOA 4JKAA 3I8DA 2CH5A 4C8KA 3MDQA 4PKHA 4FLZA 4KI6A 3QETA 4E7IA 3UB5A 5AFUA 1N8RO 2F8TA 1S9EA 3CFRA 4OO1J 3EKSA 4X64K 4CEBA 4B9VA 2YKNA 4Y1DA 3MXMA 3TABA 2UU9K 2E2QA 4GW6A 4TSXA 2RPIA 4DG1A
chains in the Genus database with same CATH topology
1TK8A 4FLWA 1NK4A 3QEIA 1BISA 1IKYA 3E01A 3LDSA 4RW9A 4CJWA 3B6OA 3UIQA 3HSTB 4FJ8A 3HP6A 1J54A 1RBUA 3SV3A 3MXIA 4FJIA 1RT3A 2KFZA 3LP2A 1QSSA 1LWEA 1QE1A 1QSYA 4FM0A 5FROA 1REVA 4ZHRA 1QQCA 5CYMA 3V1QA 1SKWA 1U48A 1Y97A 3NH0A 2VWKA 3CM6A 4KV8A 4IDKA 5CZ1A 4CGGA 3CQ8A 4BDYA 1VRUA 3SQ2A 4Y1CA 2PZSA 3SPYA 1S1XA 2DFFA 4UQGA 4N76A 1BQMA 2YHBA 4LY7A 3SUQA 1HYSA 1RBVA 3MEDA 2VG5A 1ASVA 4XIUA 3EZ5A 2JLEA 4BDPA 1Q9XA 1RBTA 1RDBA 4OKJA 4L8RB 1KFDA 1YTUA 4FLXA 1FXXA 4FJKA 4M42A 3TAFA 4CEEA 4E1NA 1HPZA 1RT2A 3LPTA 3ZSOA 1HYVA 4CJ4A 2Z1HA 1U47A 4QOZB 4O4GA 4FZXC 1RT4A 4DQRA 5JS1A 1TGOA 2G8WA 3DI6A 2B6AA 1VSMA 1RTJA 4CF0A 4CJPA 3HT3A 1LV5A 5C25A 1FKPA 3V9SA 1ZBFA 2ZQBA 3DLGA 4CGFA 4KAZA 1JLAA 3F73A 4KKOA 3L2QA 2IC3A 3AA4A 3OYMA 4CJSA 1RT6A 4BE2A 3MEEA 1JLQA 1UA0A 2OPQA 5J2MA 1T7PA 4W5QA 4JRQA 1S9GA 2YHAA 3AVBA 4DLGA 2OPSA 3ITHA 3VQ9A 1KLMA 1A5WA 2VG7A 3LANA 3V4IA 1N6QA 4FJNA 4M3TA 4KRFA 2HVHA 2Z1GA 1D9DA 3TAQA 1DTTA 1A5VA 1RTHA 3DLKA 3ZT0A 2FBTA 3OS0A 5HP1A 1RBRA 4OGEA 2A1RA 2HMIA 1BQNA 4B08A 3OYCA 1BIZA 4C8OA 4FJMA 4KHNA 2EHGA 2KQ2A 1T8EA 1ITGA 3K5NA 3G0ZA 3OVNA 3LPUA 1KVCA 3DLRA 4PY5A 4HUEA 3C6TA 2FBXA 2KZMA 2YV0X 3RMCA 2HHWA 3HPGA 4FLVA 4KHQA 1WSFA 1CZBA 2OPPA 3U3GA 3ZT4A 3QERA 1C1CA 4Z4CA 3PX4A 3DLBA 1GOBA 1SUQA 3VA0A 3PO5A 3KK3A 2O4GA 1BL3A 4FM1A 3QIPA 1IO2A 1R0AA 2ATQA 3AVFA 3KD5E 4M3UA 1CLQA 3SZ2A 2F8SA 4YNQA 5EU7A 4PUOA 4CFAA 2HW3A 1XHXA 4C8NA 2XHBA 3ISNC 4M45A 4I7FA 4IFVA 2VWJA 1IH7A 1TV6A 4FYDA 4R5PA 1NK8A 4FJ7A 1IG9A 4B8CA 2ITGA 4NCGA 4DMNA 4CJLA 4CIEA 2D0BA 4RW8A 1Q8IA 4I9LA 4DTJA 3RMDA 3AVIA 4KO0A 3SI6A 4PA1A 4BDZA 3RRHA 2YNIA 1NOYA 1KTQA 3KLFA 4FM2A 1TK5A 3SUPA 5KTQA 2P51A 4ID1A 1ZBLA 1TAQA 3AO1A 3SYZA 4M3WA 1QSLA 4E7HA 1JLGA 3M8PA 3AVGA 2XY7A 4CFDA 3MAQA 1NKEA 4FJXA 4K8XA 4J2DA 3O4QA 3NGIA 3LP1A 2W42A 3DYAA 5D3GA 1VSLA 4DLEA 2X6NA 5T7BA 4HUFA 3NCIA 3A2FA 4JS4A 1C0UA 4LD0A 3OYDA 1EX4A 3ZSYA 4CHYA 3LZJA 4DTUA 2G8KA 2X78A 1SL1A 1IKXA 5J1EA 2P5OA 3M8SA 4CFBA 5HROA 3ZT1A 3BDPA 4B9NA 1S1WA 2OZSA 2Y1JA 1L5UA 1L3TA 1EETA 4DSKA 4CJ3A 3O4NA 1L3VA 4CF1A 4DWIA 3AA5X 2KZZA 4C8LA 3QEVA 4F2SA 1FKOA 1F21A 1HQEA 1S1TA 3AO2A 3S3NA 4B3OA 1S6QA 2FC0A 2IAJA 1XI1A 4ICLA 1JL1A 4DSJA 3C95A 5KI6A 3ZT3A 1BCOA 2PYJA 1VSJA 5J2NA 3KJVA 4FZYA 3OYLA 1X9MA 1IKVA 1RDAA 3ASMA 4N56A 4I2QA 4E7LA 3RR7A 4KHWA 3NGZA 4OLAA 4DTPA 4DQIA 3AVMA 4MQ3A 2Q3SA 5DK5A 3T19A 1QHTA 2GUIA 4WE1A 1X9WA 1NK0A 3ULDA 4CHPA 3S3MA 3I0SA 4DU3A 4DQPA 4NYFA 3QEWA 2HHVA 4Z4EA 3G10A 4DFMA 1U49A 3OYAA 4J2EA 3LAKA 3K59A 4Z4HA 3NFAA 1YVUA 4KB1A 4M41A 3PX6A 2QKBA 4FJGA 2YKMA 3L2UA 2HHQA 2OPRA 3HO1A 3B6PA 1C6VA 4PQUA 4DS5A 1X1PA 4IKFA 2KFNA 2HNYA 4IG3A 1VSFA 2IDOA 5CYQA 3NAEA 3QEPA 4F3OA 3TI0A 1ZBIA 3PUFA 4B8AB 4CF2A 4NCAA 4KI4A 1GOCA 4CEOA 1TKDA 4CF9A 3RWUA 4I2PA 4N47A 4M3ZA 2G8IA 2ZE2A 2EX3A 3P5JA 3OYFA 4EP4A 4DFJA 1HYZA 1VSDA 4OPJA 1T03A 3T1AA 1I39A 3VQQA 3QEXA 5HBMA 3NE6A 3AVKA 1SKRA 3NDKA 5FRNA 4K8ZA 4N41A 4CK3A 1CXUA 1UAXA 3OS1A 3IRXA 3K58A 2Z1IA 4QCLA 2OYQA 1JLEA 3EYZA 4PWDA 3DOLA 3K5OA 3AVJA 4CJUA 4CJVA 4FJ9A 3PX0A 5HRRA 1EP4A 3ZSZA 2D5RA 3V1OA 4O5BA 4FLUA 3ZT2A 4DSFA 4KHYA 1S6PA 4E1MA 1VSHA 4O0JA 4NYNA 2ETJA 4E7KA 1NKCA 4HHTA 4AHCA 1ZYQA 2PYLA 4HVJA 4CGJA 3LWLA 3KD1E 1RBSA 1VSKA 3VQAA 4AHRA 2ZD1A 4IFYA 2DY4A 1WSHA 3OS2A 4CEAA 3PY8A 4Q0BA 5HRSA 3PV8A 4CE9A 4CERA 3OYGA 3AO5A 4YFUA 3U6FA 4HCCA 4FK4A 2DFHA 1Z26A 1LWFA 3ZCMA 1CXQA 2FBYA 3F9KA 3MECA 4CFCA 1BCMA 3ALYA 4DSEA 2O4IA 3VQBA 4DTOA 4FZZA 1S5JA 4OJRA 3C6UA 4CEFA 3TAMA 5KGXA 1BI4A 4FLYA 1NJYA 3RRGA 1NJZA 2BGGA 4FK0A 5CY4A 4LH5A 1YT3A 2JGUA 1UA1A 4DF8A 3V1RA 3L8BA 4M3YA 1NJWA 3HYFA 1SKSA 1L3UA 3LAMA 3M8RA 2HVIA 1WAFA 4H4MA 3V9UA 1U45A 3L2WA 1NK6A 3KKSA 4FJHA 2IOCA 1RTIA 1NK9A 4F2RA 1TVRA 3K2PA 3SPZA 3TR8A 3VQDA 1J53A 1WSGA 3P1GA 4W5RA 4EZ6A 3OYJA 2E6LA 2HHTA 3AVNA 4EP5A 3HPHA 1NOZA 4F3TA 3AVLA 4JLHA 1RNHA 1NK5A 1VK0A 3QINA 1BHLA 1KFSA 2BANA 4GVMA 3HJFA 1JLFA 1C0MA 3MEGA 3TARA 3RR8A 4KREA 1VRTA 4CF8A 3ZSXA 2QKKA 4CESA 3T3FA 3U3YA 1BIUA 3TANA 3HVTA 4LSLA 3FFIA 4DQSA 1KLNA 1CZ9A 1RILA 4CJFA 1LW0A 5FRMA 2BDPA 4HTUA 2HNDA 4DTMA 1TL3A 2Z1JA 4CEQA 2HHXA 2NUBA 2G8VA 3HM9A 1T05A 3L2VA 3P83D 1GOAA 4BWJA 1LAWA 4G1QA 3VQ5A 4O0IA 3S3OA 1JLCA 1J5OA 5KRSA 4ID5A 4CEZA 3D0PA 3L3UA 3RMBA 4ELVA 4H4OA 5CZ2A 3OYBA 4AHUA 4KB0A 3KTQA 3VA3A 2FBVA 4E89A 3OYNA 4QAGA 3KK2A 2XY8A 1HJRA 3QO9A 4EZ9A 3O3GA 3L2RA 2HB5A 4CHZA 2P5GA 2X74A 1WNSA 4DFKA 4Z4IA 3TAEA 1WAJA 5E41A 4ELTA 1LAVA 2GV9A 2KTQA 3O3HA 5KGWA 2HHUA 3VQCA 4AHTA 1KCFA 4BE0A 4DU1A 4CGHA 2DFEA 1JXBA 2I5JA 3C94A 1WSJA 1G15A 3H08A 2XY5A 1C1BA 1UOCA 3RTVA 3SNNA 3DLEA 5SZTA 3JYTA 2XY6A 1RT1A 1W9HA 1S1VA 3AO3A 1RDDA 4OKKA 1QTMA 3PO4A 3KK1A 4CGIA 2XO7A 5DMRA 3HK2A 1D9FA 3V81A 4F4KA 2LSNA 2GBZA 3HL8A 4CHNA 1Z25A 1NJXA 3NHGA 4HCBA 3SUOA 1HNVA 2RF2A 1WSIA 4M3RA 1C1AA 2IGIA 4H8KA 4FJLA 4E0DA 3ZSWA 3HP9A 2OA8A 4N5SA 1ASUA 3KIOA 4C8MA 1HMVA 4CJKA 1JLBA 4E3SA 4FLTA 5FDLA 3ZSVA 3OYKA 1D5AA 2XRIA 2OZMA 1D8YA 1NK7A 3AV9A 1VSIA 4RW7A 2BE2A 3DRPA 3NGYA 3CFPA 1O1WA 4J2BA 2PY5A 3IG1A 3OYIA 1TKZA 3L3VA 4KHUA 2WONA 4GMJB 1DTQA 1SV5A 1XHZA 3DLHA 4M3XA 3NBPA 2G8UA 2VG6A 4BWMA 1B9DA 2A1SA 3LZIA 4OGCA 4W5TA 3V6DA 4KTQA 4NCBA 1RDCA 4ELUA 4O55A 1RT7A 3O3FA 2WOMA 3OJUA 2QK9A 2G8FA 1WSEA 4IG0A 2QXFA 3K57A 2YNGA 4FCYA 4AH9A 3BGRA 4E19A 3SQ4A 4DTXA 4CJEA 1B92A 1K6YA 1ZBUA 3NH1A 3V9XA 1EXQA 1L3SA 3VN5A 2AJQA 1TKXA 4DSLA 3K5MA 4CJRA 1KSPA 3LALA 1W0HA 3DRRA 3KLHA 5KRTA 4CECA 4DFPA 1YTAA 1ZBHA 3QNOA 4CCHA 1C0TA 3AA2A 4KHSA 1A5XA 4CHQA 3D45A 2E4LA 4ZTJA 3M8QA 3THVA 5C24A 1J9AA 3SUNA 1S1UA 2HNZA 3VQ6A 4B9MA 1RT5A 1HQUA 4AHSA 4J2AA 4FJ5A 1I3AA 2F96A 3LP3A 4CJTA 4HUGA 3VQEA 3HPOA 1RTDA 3KLIA 2B4JA 1TL1A 3VQPA 3OY9A 3OYHA 5J2PA 4AILC 3VQ7A 2HHSA 3NF6A 4MFBA 1FK9A 4CHOA 3JSMA 3CYMA 5HLFA 1WN7A 2G8HA 3QLHA 3QIOA 3NF8A 3QNNA 4LSNA 4DF4A 4B9UA 5HRNA 3CM5A 4FVMA 4O44A 3RMAA 3CG7A 2DTUA 3WNGA 2D0AA 4RG8A 4BE1A 1VSEA 3IS9A 4CJQA 3KLEA 3QESA 3TAGA 2RKIA 4CK2A 3DM2A 5HRPA 3IAYA 5K14A 1QS4A 4OPKA 1UWBA 2R7YA 3EY1A 4W5NA 4I9QA 3AVCA 3WNHA 4FXDA 4RW6A 4AHVA 4CIFA 1LW2A 1JXEA 1XWLA 2X6SA 2Y1IA 4IBNA 3DRSA 1U4BA 1SL2A 4ZTFA 4FK2A 3WNEA 3HXMA 3SQ0A 1ASWA 1DLOA 4RW4A 3KLGA 3S9HA 2D0CA 3KKRA 3AA3A 4DS4A 1TK0A 4KTZA 4Q5VA 2E6MA 4DTSA 1JL2A 4F8RA 1SL0A 2P1JA 4DQQA 1KVAA 3V9WA 3K5LA 5SWMA 4Z4GA 4B9SA 1MU2A 3AO4A 2B5JA 1U04A 4B9LA 1KVBA 4OVLA 3LWMA 1HRHA 3NF9A 4KTWA 4BACA 5I42A 4E7JA 1BI4B 2YNHA 4DU4A 3TAPA 3TWHA 1X9SA 4KFBA 4Z4FA 3HVRA 3SCXA 3AVAA 4CEDA 1WLJA 3OYEA 2KW4A 4DSIA 1Q9YA 4OKEA 1NKBA 3LP0A 3NF7A 4DTRA 1XC9A 4FJJA 4CJ5A 3SJJA 1N5YA 3AVHA 1HNIA 4LH4A 4DTNA 4CGDA 4KPYA 1JKHA 4FW1A 4CK1A 3WNFA 3DOKA 3SV4A 1BGXT 3OJSA 3CFOA 3ZSRA 1RCHA 1KRPA 3ZSQA 3I8DA 3V9ZA 3SQ1A 4W5OA 4KI6A 4C8KA 4FW2A 3VQ4A 4FLZA 3QETA 1TKTA 4E7IA 4JS5A 2YNFA 4Z0UA 3I0RA 5JS2A 1TAUA 4OLBA 2F8TA 1EKEA 3DMJA 1S9EA 3CFRA 4CIGA 1B9FA 4B9TA 5I3UA 2IS3A 4CEBA 4B9VA 2YKNA 3NH2A 4Y1DA 3MXMA 1LWCA 3TABA 4JRPA 4GW6A 4TSXA 2RN2A 2RPIA 5C42A 5J2QA 3VQ8A 1IKWA 3MXJA 4DG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TK8 A;  4FLW A;  1NK4 A;  3QEI A;  1BIS A;  1IKY A;  3E01 A;  3LDS A;  4RW9 A;  4CJW A;  3B6O A;  3UIQ A;  3HST B;  4FJ8 A;  3HP6 A;  1J54 A;  1RBU A;  3SV3 A;  3MXI A;  4FJI A;  1RT3 A;  2KFZ A;  3LP2 A;  1QSS A;  1LWE A;  1QE1 A;  1QSY A;  4FM0 A;  5FRO A;  1REV A;  4ZHR A;  1QQC A;  5CYM A;  3V1Q A;  1SKW A;  1U48 A;  1Y97 A;  3NH0 A;  2VWK A;  3CM6 A;  4KV8 A;  4IDK A;  5CZ1 A;  4CGG A;  3CQ8 A;  4BDY A;  1VRU A;  3SQ2 A;  4Y1C A;  2PZS A;  3SPY A;  1S1X A;  2DFF A;  4UQG A;  4N76 A;  1BQM A;  2YHB A;  4LY7 A;  3SUQ A;  1HYS A;  1RBV A;  3MED A;  2VG5 A;  1ASV A;  4XIU A;  3EZ5 A;  2JLE A;  4BDP A;  1Q9X A;  1RBT A;  1RDB A;  4OKJ A;  4L8R B;  1KFD A;  1YTU A;  4FLX A;  1FXX A;  4FJK A;  4M42 A;  3TAF A;  4CEE A;  4E1N A;  1HPZ A;  1RT2 A;  3LPT A;  3ZSO A;  1HYV A;  4CJ4 A;  2Z1H A;  1U47 A;  4QOZ B;  4O4G A;  4FZX C;  1RT4 A;  4DQR A;  5JS1 A;  1TGO A;  2G8W A;  3DI6 A;  2B6A A;  1VSM A;  1RTJ A;  4CF0 A;  4CJP A;  3HT3 A;  1LV5 A;  5C25 A;  1FKP A;  3V9S A;  1ZBF A;  2ZQB A;  3DLG A;  4CGF A;  4KAZ A;  1JLA A;  3F73 A;  4KKO A;  3L2Q A;  2IC3 A;  3AA4 A;  3OYM A;  4CJS A;  1RT6 A;  4BE2 A;  3MEE A;  1JLQ A;  1UA0 A;  2OPQ A;  5J2M A;  1T7P A;  4W5Q A;  4JRQ A;  1S9G A;  2YHA A;  3AVB A;  4DLG A;  2OPS A;  3ITH A;  3VQ9 A;  1KLM A;  1A5W A;  2VG7 A;  3LAN A;  3V4I A;  1N6Q A;  4FJN A;  4M3T A;  4KRF A;  2HVH A;  2Z1G A;  1D9D A;  3TAQ A;  1DTT A;  1A5V A;  1RTH A;  3DLK A;  3ZT0 A;  2FBT A;  3OS0 A;  5HP1 A;  1RBR A;  4OGE A;  2A1R A;  2HMI A;  1BQN A;  4B08 A;  3OYC A;  1BIZ A;  4C8O A;  4FJM A;  4KHN A;  2EHG A;  2KQ2 A;  1T8E A;  1ITG A;  3K5N A;  3G0Z A;  3OVN A;  3LPU A;  1KVC A;  3DLR A;  4PY5 A;  4HUE A;  3C6T A;  2FBX A;  2KZM A;  2YV0 X;  3RMC A;  2HHW A;  3HPG A;  4FLV A;  4KHQ A;  1WSF A;  1CZB A;  2OPP A;  3U3G A;  3ZT4 A;  3QER A;  1C1C A;  4Z4C A;  3PX4 A;  3DLB A;  1GOB A;  1SUQ A;  3VA0 A;  3PO5 A;  3KK3 A;  2O4G A;  1BL3 A;  4FM1 A;  3QIP A;  1IO2 A;  1R0A A;  2ATQ A;  3AVF A;  3KD5 E;  4M3U A;  1CLQ A;  3SZ2 A;  2F8S A;  4YNQ A;  5EU7 A;  4PUO A;  4CFA A;  2HW3 A;  1XHX A;  4C8N A;  2XHB A;  3ISN C;  4M45 A;  4I7F A;  4IFV A;  2VWJ A;  1IH7 A;  1TV6 A;  4FYD A;  4R5P A;  1NK8 A;  4FJ7 A;  1IG9 A;  4B8C A;  2ITG A;  4NCG A;  4DMN A;  4CJL A;  4CIE A;  2D0B A;  4RW8 A;  1Q8I A;  4I9L A;  4DTJ A;  3RMD A;  3AVI A;  4KO0 A;  3SI6 A;  4PA1 A;  4BDZ A;  3RRH A;  2YNI A;  1NOY A;  1KTQ A;  3KLF A;  4FM2 A;  1TK5 A;  3SUP A;  5KTQ A;  2P51 A;  4ID1 A;  1ZBL A;  1TAQ A;  3AO1 A;  3SYZ A;  4M3W A;  1QSL A;  4E7H A;  1JLG A;  3M8P A;  3AVG A;  2XY7 A;  4CFD A;  3MAQ A;  1NKE A;  4FJX A;  4K8X A;  4J2D A;  3O4Q A;  3NGI A;  3LP1 A;  2W42 A;  3DYA A;  5D3G A;  1VSL A;  4DLE A;  2X6N A;  5T7B A;  4HUF A;  3NCI A;  3A2F A;  4JS4 A;  1C0U A;  4LD0 A;  3OYD A;  1EX4 A;  3ZSY A;  4CHY A;  3LZJ A;  4DTU A;  2G8K A;  2X78 A;  1SL1 A;  1IKX A;  5J1E A;  2P5O A;  3M8S A;  4CFB A;  5HRO A;  3ZT1 A;  3BDP A;  4B9N A;  1S1W A;  2OZS A;  2Y1J A;  1L5U A;  1L3T A;  1EET A;  4DSK A;  4CJ3 A;  3O4N A;  1L3V A;  4CF1 A;  4DWI A;  3AA5 X;  2KZZ A;  4C8L A;  3QEV A;  4F2S A;  1FKO A;  1F21 A;  1HQE A;  1S1T A;  3AO2 A;  3S3N A;  4B3O A;  1S6Q A;  2FC0 A;  2IAJ A;  1XI1 A;  4ICL A;  1JL1 A;  4DSJ A;  3C95 A;  5KI6 A;  3ZT3 A;  1BCO A;  2PYJ A;  1VSJ A;  5J2N A;  3KJV A;  4FZY A;  3OYL A;  1X9M A;  1IKV A;  1RDA A;  3ASM A;  4N56 A;  4I2Q A;  4E7L A;  3RR7 A;  4KHW A;  3NGZ A;  4OLA A;  4DTP A;  4DQI A;  3AVM A;  4MQ3 A;  2Q3S A;  5DK5 A;  3T19 A;  1QHT A;  2GUI A;  4WE1 A;  1X9W A;  1NK0 A;  3ULD A;  4CHP A;  3S3M A;  3I0S A;  4DU3 A;  4DQP A;  4NYF A;  3QEW A;  2HHV A;  4Z4E A;  3G10 A;  4DFM A;  1U49 A;  3OYA A;  4J2E A;  3LAK A;  3K59 A;  4Z4H A;  3NFA A;  1YVU A;  4KB1 A;  4M41 A;  3PX6 A;  2QKB A;  4FJG A;  2YKM A;  3L2U A;  2HHQ A;  2OPR A;  3HO1 A;  3B6P A;  1C6V A;  4PQU A;  4DS5 A;  1X1P A;  4IKF A;  2KFN A;  2HNY A;  4IG3 A;  1VSF A;  2IDO A;  5CYQ A;  3NAE A;  3QEP A;  4F3O A;  3TI0 A;  1ZBI A;  3PUF A;  4B8A B;  4CF2 A;  4NCA A;  4KI4 A;  1GOC A;  4CEO A;  1TKD A;  4CF9 A;  3RWU A;  4I2P A;  4N47 A;  4M3Z A;  2G8I A;  2ZE2 A;  2EX3 A;  3P5J A;  3OYF A;  4EP4 A;  4DFJ A;  1HYZ A;  1VSD A;  4OPJ A;  1T03 A;  3T1A A;  1I39 A;  3VQQ A;  3QEX A;  5HBM A;  3NE6 A;  3AVK A;  1SKR A;  3NDK A;  5FRN A;  4K8Z A;  4N41 A;  4CK3 A;  1CXU A;  1UAX A;  3OS1 A;  3IRX A;  3K58 A;  2Z1I A;  4QCL A;  2OYQ A;  1JLE A;  3EYZ A;  4PWD A;  3DOL A;  3K5O A;  3AVJ A;  4CJU A;  4CJV A;  4FJ9 A;  3PX0 A;  5HRR A;  1EP4 A;  3ZSZ A;  2D5R A;  3V1O A;  4O5B A;  4FLU A;  3ZT2 A;  4DSF A;  4KHY A;  1S6P A;  4E1M A;  1VSH A;  4O0J A;  4NYN A;  2ETJ A;  4E7K A;  1NKC A;  4HHT A;  4AHC A;  1ZYQ A;  2PYL A;  4HVJ A;  4CGJ A;  3LWL A;  3KD1 E;  1RBS A;  1VSK A;  3VQA A;  4AHR A;  2ZD1 A;  4IFY A;  2DY4 A;  1WSH A;  3OS2 A;  4CEA A;  3PY8 A;  4Q0B A;  5HRS A;  3PV8 A;  4CE9 A;  4CER A;  3OYG A;  3AO5 A;  4YFU A;  3U6F A;  4HCC A;  4FK4 A;  2DFH A;  1Z26 A;  1LWF A;  3ZCM A;  1CXQ A;  2FBY A;  3F9K A;  3MEC A;  4CFC A;  1BCM A;  3ALY A;  4DSE A;  2O4I A;  3VQB A;  4DTO A;  4FZZ A;  1S5J A;  4OJR A;  3C6U A;  4CEF A;  3TAM A;  5KGX A;  1BI4 A;  4FLY A;  1NJY A;  3RRG A;  1NJZ A;  2BGG A;  4FK0 A;  5CY4 A;  4LH5 A;  1YT3 A;  2JGU A;  1UA1 A;  4DF8 A;  3V1R A;  3L8B A;  4M3Y A;  1NJW A;  3HYF A;  1SKS A;  1L3U A;  3LAM A;  3M8R A;  2HVI A;  1WAF A;  4H4M A;  3V9U A;  1U45 A;  3L2W A;  1NK6 A;  3KKS A;  4FJH A;  2IOC A;  1RTI A;  1NK9 A;  4F2R A;  1TVR A;  3K2P A;  3SPZ A;  3TR8 A;  3VQD A;  1J53 A;  1WSG A;  3P1G A;  4W5R A;  4EZ6 A;  3OYJ A;  2E6L A;  2HHT A;  3AVN A;  4EP5 A;  3HPH A;  1NOZ A;  4F3T A;  3AVL A;  4JLH A;  1RNH A;  1NK5 A;  1VK0 A;  3QIN A;  1BHL A;  1KFS A;  2BAN A;  4GVM A;  3HJF A;  1JLF A;  1C0M A;  3MEG A;  3TAR A;  3RR8 A;  4KRE A;  1VRT A;  4CF8 A;  3ZSX A;  2QKK A;  4CES A;  3T3F A;  3U3Y A;  1BIU A;  3TAN A;  3HVT A;  4LSL A;  3FFI A;  4DQS A;  1KLN A;  1CZ9 A;  1RIL A;  4CJF A;  1LW0 A;  5FRM A;  2BDP A;  4HTU A;  2HND A;  4DTM A;  1TL3 A;  2Z1J A;  4CEQ A;  2HHX A;  2NUB A;  2G8V A;  3HM9 A;  1T05 A;  3L2V A;  3P83 D;  1GOA A;  4BWJ A;  1LAW A;  4G1Q A;  3VQ5 A;  4O0I A;  3S3O A;  1JLC A;  1J5O A;  5KRS A;  4ID5 A;  4CEZ A;  3D0P A;  3L3U A;  3RMB A;  4ELV A;  4H4O A;  5CZ2 A;  3OYB A;  4AHU A;  4KB0 A;  3KTQ A;  3VA3 A;  2FBV A;  4E89 A;  3OYN A;  4QAG A;  3KK2 A;  2XY8 A;  1HJR A;  3QO9 A;  4EZ9 A;  3O3G A;  3L2R A;  2HB5 A;  4CHZ A;  2P5G A;  2X74 A;  1WNS A;  4DFK A;  4Z4I A;  3TAE A;  1WAJ A;  5E41 A;  4ELT A;  1LAV A;  2GV9 A;  2KTQ A;  3O3H A;  5KGW A;  2HHU A;  3VQC A;  4AHT A;  1KCF A;  4BE0 A;  4DU1 A;  4CGH A;  2DFE A;  1JXB A;  2I5J A;  3C94 A;  1WSJ A;  1G15 A;  3H08 A;  2XY5 A;  1C1B A;  1UOC A;  3RTV A;  3SNN A;  3DLE A;  5SZT A;  3JYT A;  2XY6 A;  1RT1 A;  1W9H A;  1S1V A;  3AO3 A;  1RDD A;  4OKK A;  1QTM A;  3PO4 A;  3KK1 A;  4CGI A;  2XO7 A;  5DMR A;  3HK2 A;  1D9F A;  3V81 A;  4F4K A;  2LSN A;  2GBZ A;  3HL8 A;  4CHN A;  1Z25 A;  1NJX A;  3NHG A;  4HCB A;  3SUO A;  1HNV A;  2RF2 A;  1WSI A;  4M3R A;  1C1A A;  2IGI A;  4H8K A;  4FJL A;  4E0D A;  3ZSW A;  3HP9 A;  2OA8 A;  4N5S A;  1ASU A;  3KIO A;  4C8M A;  1HMV A;  4CJK A;  1JLB A;  4E3S A;  4FLT A;  5FDL A;  3ZSV A;  3OYK A;  1D5A A;  2XRI A;  2OZM A;  1D8Y A;  1NK7 A;  3AV9 A;  1VSI A;  4RW7 A;  2BE2 A;  3DRP A;  3NGY A;  3CFP A;  1O1W A;  4J2B A;  2PY5 A;  3IG1 A;  3OYI A;  1TKZ A;  3L3V A;  4KHU A;  2WON A;  4GMJ B;  1DTQ A;  1SV5 A;  1XHZ A;  3DLH A;  4M3X A;  3NBP A;  2G8U A;  2VG6 A;  4BWM A;  1B9D A;  2A1S A;  3LZI A;  4OGC A;  4W5T A;  3V6D A;  4KTQ A;  4NCB A;  1RDC A;  4ELU A;  4O55 A;  1RT7 A;  3O3F A;  2WOM A;  3OJU A;  2QK9 A;  2G8F A;  1WSE A;  4IG0 A;  2QXF A;  3K57 A;  2YNG A;  4FCY A;  4AH9 A;  3BGR A;  4E19 A;  3SQ4 A;  4DTX A;  4CJE A;  1B92 A;  1K6Y A;  1ZBU A;  3NH1 A;  3V9X A;  1EXQ A;  1L3S A;  3VN5 A;  2AJQ A;  1TKX A;  4DSL A;  3K5M A;  4CJR A;  1KSP A;  3LAL A;  1W0H A;  3DRR A;  3KLH A;  5KRT A;  4CEC A;  4DFP A;  1YTA A;  1ZBH A;  3QNO A;  4CCH A;  1C0T A;  3AA2 A;  4KHS A;  1A5X A;  4CHQ A;  3D45 A;  2E4L A;  4ZTJ A;  3M8Q A;  3THV A;  5C24 A;  1J9A A;  3SUN A;  1S1U A;  2HNZ A;  3VQ6 A;  4B9M A;  1RT5 A;  1HQU A;  4AHS A;  4J2A A;  4FJ5 A;  1I3A A;  2F96 A;  3LP3 A;  4CJT A;  4HUG A;  3VQE A;  3HPO A;  1RTD A;  3KLI A;  2B4J A;  1TL1 A;  3VQP A;  3OY9 A;  3OYH A;  5J2P A;  4AIL C;  3VQ7 A;  2HHS A;  3NF6 A;  4MFB A;  1FK9 A;  4CHO A;  3JSM A;  3CYM A;  5HLF A;  1WN7 A;  2G8H A;  3QLH A;  3QIO A;  3NF8 A;  3QNN A;  4LSN A;  4DF4 A;  4B9U A;  5HRN A;  3CM5 A;  4FVM A;  4O44 A;  3RMA A;  3CG7 A;  2DTU A;  3WNG A;  2D0A A;  4RG8 A;  4BE1 A;  1VSE A;  3IS9 A;  4CJQ A;  3KLE A;  3QES A;  3TAG A;  2RKI A;  4CK2 A;  3DM2 A;  5HRP A;  3IAY A;  5K14 A;  1QS4 A;  4OPK A;  1UWB A;  2R7Y A;  3EY1 A;  4W5N A;  4I9Q A;  3AVC A;  3WNH A;  4FXD A;  4RW6 A;  4AHV A;  4CIF A;  1LW2 A;  1JXE A;  1XWL A;  2X6S A;  2Y1I A;  4IBN A;  3DRS A;  1U4B A;  1SL2 A;  4ZTF A;  4FK2 A;  3WNE A;  3HXM A;  3SQ0 A;  1ASW A;  1DLO A;  4RW4 A;  3KLG A;  3S9H A;  2D0C A;  3KKR A;  3AA3 A;  4DS4 A;  1TK0 A;  4KTZ A;  4Q5V A;  2E6M A;  4DTS A;  1JL2 A;  4F8R A;  1SL0 A;  2P1J A;  4DQQ A;  1KVA A;  3V9W A;  3K5L A;  5SWM A;  4Z4G A;  4B9S A;  1MU2 A;  3AO4 A;  2B5J A;  1U04 A;  4B9L A;  1KVB A;  4OVL A;  3LWM A;  1HRH A;  3NF9 A;  4KTW A;  4BAC A;  5I42 A;  4E7J A;  1BI4 B;  2YNH A;  4DU4 A;  3TAP A;  3TWH A;  1X9S A;  4KFB A;  4Z4F A;  3HVR A;  3SCX A;  3AVA A;  4CED A;  1WLJ A;  3OYE A;  2KW4 A;  4DSI A;  1Q9Y A;  4OKE A;  1NKB A;  3LP0 A;  3NF7 A;  4DTR A;  1XC9 A;  4FJJ A;  4CJ5 A;  3SJJ A;  1N5Y A;  3AVH A;  1HNI A;  4LH4 A;  4DTN A;  4CGD A;  4KPY A;  1JKH A;  4FW1 A;  4CK1 A;  3WNF A;  3DOK A;  3SV4 A;  1BGX T;  3OJS A;  3CFO A;  3ZSR A;  1RCH A;  1KRP A;  3ZSQ A;  3I8D A;  3V9Z A;  3SQ1 A;  4W5O A;  4KI6 A;  4C8K A;  4FW2 A;  3VQ4 A;  4FLZ A;  3QET A;  1TKT A;  4E7I A;  4JS5 A;  2YNF A;  4Z0U A;  3I0R A;  5JS2 A;  1TAU A;  4OLB A;  2F8T A;  1EKE A;  3DMJ A;  1S9E A;  3CFR A;  4CIG A;  1B9F A;  4B9T A;  5I3U A;  2IS3 A;  4CEB A;  4B9V A;  2YKN A;  3NH2 A;  4Y1D A;  3MXM A;  1LWC A;  3TAB A;  4JRP A;  4GW6 A;  4TSX A;  2RN2 A;  2RPI A;  5C42 A;  5J2Q A;  3VQ8 A;  1IKW A;  3MXJ A;  4DG1 A; 
#chains in the Genus database with same CATH topology
 4FLW A;  3MN9 A;  3QEI A;  1BIS A;  4YOX A;  3NMU A;  4CJW A;  4BQL A;  3LP2 A;  4QS8 A;  1QSS A;  1E3M A;  5FRO A;  2QWO A;  2VWK A;  5CZ1 A;  4LF8 K;  3GDQ A;  3VEY A;  2PZS A;  3SPY A;  1S1X A;  2Q0R A;  1BQM A;  1HYS A;  2O8C A;  3MED A;  1ASV A;  4JI6 K;  3G25 A;  1RBT A;  4OKJ A;  1QQN A;  1I94 K;  4FLX A;  3THY A;  3RSE A;  4FJK A;  4M42 A;  5HL7 L;  4CEE A;  4E1N A;  3LPT A;  1K8K B;  1U47 A;  3VF2 A;  4DQR A;  3J7A P;  1VSM A;  1RTJ A;  1LV5 A;  1IBK K;  5C25 A;  1FKP A;  3CJ7 A;  3V9S A;  3DLG A;  3N4Q A;  4KKO A;  3L2Q A;  3O9S A;  4H0Y B;  5M1F A;  1UA0 A;  5J2M A;  4H0O A;  3R6M A;  3H46 O;  2YHA A;  1WBD A;  1GLF O;  5AQN A;  2OPS A;  1NBW A;  4FJN A;  4BR9 A;  2NRH A;  2AP1 A;  4M3T A;  2HVH A;  5HP1 A;  3DLK A;  1RBR A;  1BQN A;  3B8A X;  3OYC A;  1ITG A;  3OVN A;  4BR2 A;  1KVC A;  3DLR A;  4PY5 A;  1IV0 A;  4QS7 A;  3RMC A;  4FLV A;  4KHQ A;  1K73 O;  3ZT4 A;  3PX4 A;  3DLB A;  4K41 A;  4BQZ A;  3SLC A;  2O4G A;  1BL3 A;  4JI3 K;  1R0A A;  2GTD A;  4CZH A;  5BRD A;  4CFA A;  1QZ5 A;  3R1X A;  5JVH L;  4IFV A;  3GG4 A;  4MO5 A;  1N34 K;  4FJ7 A;  4B8C A;  4NCG A;  2FSK A;  4YOW A;  4CJL A;  2YHY A;  4WFN L;  3M3Z A;  4KO0 A;  2YNI A;  5KTQ A;  3AO1 A;  3SYZ A;  5BRF A;  4KHP K;  2XY7 A;  1NKE A;  4WFB L;  2Q36 A;  4J2D A;  3ZYY X;  5CR4 A;  3LP1 A;  5D3G A;  3ZEU A;  1VSL A;  2RE2 A;  5T7B A;  3VEW A;  1C0U A;  3OYD A;  4BRM A;  4B1Y B;  3ZSY A;  3LZJ A;  2Q0U A;  1NGJ A;  4OPA A;  4YOV A;  5A2Q O;  3O80 A;  4O5F A;  1ZBS A;  3O4N A;  4CF1 A;  4DWI A;  2JWL A;  3ENH A;  2UYT A;  2IAJ A;  4ICL A;  4B3T K;  2WBN A;  4MO4 A;  4FZY A;  5C10 A;  3ASM A;  4LF5 K;  5M1Q A;  3CD6 N;  4C1N K;  4DV3 K;  2Q2R A;  4WE1 A;  5AQQ A;  2HF4 A;  2YHX A;  3A8Y A;  3S3M A;  1HKG A;  4B1U B;  4Z4E A;  3OYA A;  5JLF A;  4J8F A;  4M7X A;  5F1X A;  3B6P A;  3O9T A;  4WQ5 C;  2HNY A;  5EY4 A;  2IDO A;  4CBX A;  3NAE A;  3QEP A;  4F3O A;  3BY5 A;  4CF2 A;  3ZET A;  1GOC A;  2PAV A;  5KPR A;  5ADX A;  3RWU A;  2ZE2 A;  3VGL A;  1HYZ A;  2A5X A;  3MCA B;  4OPJ A;  3WUH A;  4K8Z A;  3TU5 A;  4CK3 A;  3K58 A;  3ATU A;  3MCP A;  1JLE A;  2A3Z A;  1OH8 A;  4FWP A;  4CJV A;  5M1K A;  2D5R A;  3KHY A;  4O5B A;  1VSH A;  4O0J A;  3TSQ A;  4E7K A;  1NKC A;  5LMU K;  5KPZ A;  4JD2 A;  4CGJ A;  1RBS A;  2DY4 A;  4CE9 A;  4CZG A;  4CER A;  3U6F A;  2HMP A;  4YFU A;  4HCC A;  1J5E K;  1CXQ A;  2P9N B;  4DTO A;  3JS6 A;  1T3V A;  4FZZ A;  1S5J A;  3RRG A;  2KKZ A;  2BGG A;  1HKB A;  3HOT A;  3CC2 N;  3DXK B;  2JGU A;  1UA1 A;  3L8B A;  3CJ9 A;  3D2F A;  1NJW A;  1U45 A;  1NK6 A;  2NRT A;  5ELZ A;  2IOC A;  5BN8 A;  3G6E N;  1NK9 A;  2IVP A;  3K2P A;  2I7N A;  3P1G A;  5JVG L;  4JHD A;  3EKU A;  3AGK A;  4YOR A;  3VF4 A;  4JKF A;  2BAN A;  5F0X A;  4KRE A;  4CF8 A;  3T3F A;  3TAN A;  3C0B A;  3SBG A;  2RHK A;  4Y0W A;  2HND A;  4DTM A;  2E1Y A;  4JN4 A;  3W3D A;  1T05 A;  3L2V A;  3P83 D;  1GOA A;  1N33 K;  3S3O A;  3VQ5 A;  1MA9 B;  2WFB A;  3OA9 A;  3D0P A;  1KQS M;  3OYB A;  4AHU A;  5B8H A;  4KB0 A;  3OYN A;  4E89 A;  3KK2 A;  4DR2 K;  3EEQ A;  3QO9 A;  5AQJ A;  4EZ9 A;  2W40 A;  2X74 A;  4EHU A;  4DFK A;  1WAJ A;  4ELT A;  2KTQ A;  2O8F B;  5AQU A;  5KGW A;  1GLE G;  3O1B A;  3ZX0 A;  2J4R A;  4DU1 A;  4BRL A;  3ENB A;  4K43 A;  3KK7 A;  4H5V A;  3DLE A;  4LF9 K;  3ZX2 A;  1S1V A;  3TPQ A;  2FF6 A;  5EVZ A;  3V81 A;  3EO3 A;  4F4K A;  3HL8 A;  4HCB A;  3QFP A;  1HNV A;  2RF2 A;  4FJL A;  1NJI O;  4E0D A;  4FWK A;  3ZSW A;  5KQ8 A;  4N5S A;  1ASU A;  5H1S Q;  4E3S A;  1HMV A;  1LCU A;  5GAE P;  3QBX A;  3C7N B;  5FDL A;  3ZSV A;  3OYK A;  3AV9 A;  3NGY A;  4KHU A;  4H5R A;  1O13 A;  3M1F A;  4GMJ B;  1BG3 A;  1DTQ A;  3WXM B;  3E9L A;  3E66 A;  3OJU A;  1QQM A;  1OVQ A;  3K57 A;  4FCY A;  4AH9 A;  1B92 A;  1K6Y A;  1EXQ A;  5EXW A;  4GKK K;  5AZJ A;  3I33 A;  2E8A A;  1YTA A;  1XC3 A;  3QNO A;  3VEV A;  1HUX A;  4KHS A;  1A5X A;  3D45 A;  3M8Q A;  3SUN A;  4X62 K;  3QIC A;  3VQ6 A;  4B9M A;  1RT5 A;  4FJ5 A;  3LP3 A;  4CJT A;  1XMO K;  3KLI A;  1TL1 A;  3CQX A;  3OYH A;  4AIL C;  1OH5 A;  5AR0 A;  5BN9 A;  2O8E A;  2G8H A;  5FPE A;  4DF4 A;  4XH1 A;  3RMA A;  4YDU C;  1MWM A;  1K8A O;  2QWP A;  4BE1 A;  3BZK A;  2P9I B;  3SK3 A;  2RKI A;  1MWK A;  5HRP A;  1BA1 A;  5AQZ A;  3EY1 A;  4I9Q A;  4AHV A;  1XWL A;  2P9U A;  1U4B A;  4FK2 A;  1ZC6 A;  3IUC A;  1X3M A;  4JK8 A;  3SQ0 A;  1ASW A;  1DLO A;  4PKI A;  3AA3 A;  1E4F T;  4DQQ A;  1KVA A;  5JLH A;  2ZJQ L;  4Z4G A;  4B9S A;  3AO4 A;  1U04 A;  3LWM A;  1HRH A;  5I42 A;  2PFU A;  4YOU A;  3WEE A;  1BI4 B;  1VQM N;  2HF3 A;  4DU4 A;  2O8B B;  3TAP A;  1X9S A;  3HVR A;  3SCX A;  1WLJ A;  2KW4 A;  1WBB A;  1Q9Y A;  1YF5 L;  3WQT A;  3SJJ A;  4LH4 A;  1VQ4 N;  4KPY A;  3VEX A;  2ZM6 K;  3DOK A;  4FWL A;  5IT9 O;  3ZSQ A;  3JAM O;  3HTV A;  1TKT A;  4JS5 A;  2YNF A;  5JS2 A;  4FWM A;  5AQP A;  1B9F A;  3WXL A;  5I3U A;  3H1V X;  1LWC A;  3PIP L;  1YXQ A;  3VQ8 A;  4BGA A;  3SNN A;  3E01 A;  5CHI A;  3LDS A;  4DR5 K;  5FLX O;  4GV9 A;  2UUC K;  1J54 A;  3SV3 A;  4FWQ A;  4XH5 A;  2A42 A;  4BC4 A;  1QSY A;  3SAH A;  1QQC A;  5CYM A;  4NXM K;  2E2P A;  1Y97 A;  3KVG A;  4A5A A;  4KV8 A;  3SQ2 A;  4IDK A;  3I8B A;  1HX1 A;  1KAZ A;  2YHB A;  3SUQ A;  4A2B A;  1RBV A;  2WTU A;  4DR1 K;  3EZ5 A;  2JLE A;  4BDP A;  1NGA A;  1YHQ N;  1Q9X A;  3O1W A;  1RDB A;  4L8R B;  1MDU B;  3ZSO A;  3DXK A;  3TTD A;  4CJ4 A;  1NU0 A;  3VEN A;  4H5N A;  3T1Y K;  1TGO A;  4CF0 A;  4CJP A;  2P9K A;  1H1V A;  3HT3 A;  2ASP A;  4CGF A;  4KAZ A;  3BEX A;  2AA4 A;  3HBT A;  3AA4 A;  3OYM A;  4JRQ A;  3VQ9 A;  3UKR B;  3CF5 L;  2VG7 A;  3LAN A;  4BRI A;  3TAQ A;  1DTT A;  1A5V A;  4FOE A;  2A1R A;  1FW6 A;  1Y64 A;  4C8O A;  4FJM A;  4CD1 A;  2KQ2 A;  4GKJ K;  3G0Z A;  2FBX A;  3THW A;  3J8A A;  3QDK A;  2VQF K;  1RGI A;  1WSF A;  4I6M B;  2OPP A;  3QER A;  3KWG A;  4Z4C A;  1GOB A;  3VA0 A;  3KK3 A;  1IO2 A;  3LDL A;  3MN5 A;  1ATS A;  3AVF A;  3OTO K;  4M3U A;  5EU7 A;  2HW3 A;  4M45 A;  4I7F A;  1TV6 A;  4FYD A;  4BC3 A;  4R5P A;  2A41 A;  1IG9 A;  1SZ2 A;  2O8F A;  1NGB A;  5GAD P;  1YJ9 N;  3O8M A;  2D0B A;  1NGD A;  1Q8I A;  4PA1 A;  5AQW A;  4AM6 A;  4FM2 A;  2PBD A;  4DV2 K;  2P51 A;  4ID1 A;  4M63 C;  1QSL A;  1JLG A;  1OKJ A;  3M8P A;  5F2R A;  2Q1N A;  2VQE K;  3O4Q A;  3NGI A;  2W42 A;  3DYA A;  1NGH A;  4HUF A;  3CJ1 A;  4OPH A;  4BVO A;  4DTU A;  5HRO A;  4BRP A;  1V4S A;  1L5U A;  1L3T A;  4DSK A;  3BZC A;  1WUA A;  4WF9 L;  3AA5 X;  3QEV A;  4GV6 A;  1FKO A;  5M1N A;  2VYP A;  1S1T A;  3AO2 A;  5TKY A;  1BU6 O;  1JL1 A;  4DSJ A;  3C95 A;  1VSJ A;  3KJV A;  4BRQ A;  3CC4 N;  4PKG A;  4E7L A;  4CZK A;  4BRK A;  3IDH A;  3NGZ A;  4OLA A;  4DQI A;  4MQ3 A;  4DR7 K;  1QHT A;  2A40 A;  1VQO N;  5M1P A;  4CHP A;  3ULE A;  4DU3 A;  3G4S N;  3QEW A;  4K42 A;  3G10 A;  3IFR A;  4DFM A;  4CVN E;  1X9J A;  3K59 A;  4Z4H A;  1QQO A;  2FSJ A;  4M41 A;  4KB1 A;  3PX6 A;  2YKM A;  1C0G A;  2HHQ A;  4IOA L;  3TSP A;  4PQU A;  4DS5 A;  1ZBI A;  3DXM B;  4NCA A;  4M3Z A;  2G8I A;  4I2P A;  1XUP O;  2EX3 A;  1DEJ A;  3OYF A;  4DFJ A;  1VSD A;  1KC8 O;  4EHT A;  4H0T B;  1SKR A;  1NWK A;  4DR4 K;  4ILJ A;  1VQK N;  3OBY A;  4QCL A;  3IRX A;  2NLX A;  4LF6 K;  3VEO A;  4FJ9 A;  1VAZ A;  3PX0 A;  5HRR A;  1EP4 A;  4DSF A;  3FZF A;  3V1O A;  4FLU A;  1S6P A;  1ZYQ A;  3LWL A;  4IFY A;  1WSH A;  4EFH A;  2F9T A;  4Q0B A;  3PV8 A;  4XH4 A;  4LF4 K;  3AO5 A;  3M5R A;  2DFH A;  3ZCM A;  2FBY A;  3MEC A;  1BWF O;  4DSE A;  4EAH D;  2O4I A;  3C6U A;  5C15 A;  1BI4 A;  4LC9 B;  2I7P A;  1JCG A;  4LH5 A;  2BTF A;  3L4Q A;  4Z94 A;  3V1R A;  1JJ2 M;  3CCL N;  3HSC A;  2HVI A;  3FZL A;  3SMP A;  1WSG A;  3CIP A;  4NO7 A;  3AGR A;  4PHT X;  4W5R A;  3OYJ A;  3AVN A;  3FLC O;  3D2E A;  5FPM A;  3AVL A;  4YHH K;  2ZWH A;  1VK0 A;  1BHL A;  2HBJ A;  4DCH A;  1KFS A;  1JLF A;  1C0M A;  3RR8 A;  1IBM K;  4ISG A;  2OTJ N;  4BRF A;  3ZSX A;  1W7A A;  4DQS A;  1CZ9 A;  3ZLJ A;  2ASO A;  1HKC A;  5FRM A;  2BDP A;  5AQR A;  3UKU A;  3KZB A;  4IO9 L;  3BF3 A;  4CEQ A;  2HHX A;  2P9L A;  3P31 A;  1NG9 A;  4BWJ A;  2CH6 A;  3VER A;  2WUS A;  3L3U A;  4FWO A;  3RMB A;  4DR6 K;  4OX9 K;  4QAG A;  2V51 B;  3O3G A;  3L2R A;  4CHZ A;  3CPE A;  1WNS A;  5E41 A;  3VGM A;  3O3H A;  3A5M C;  3VES A;  3VQC A;  5JMV A;  3QFU A;  4AHT A;  1KCF A;  3C94 A;  1G15 A;  3CXC M;  1C1B A;  4JI8 K;  5SZT A;  1RT1 A;  3W0L A;  4CGI A;  5I9E B;  1GLA G;  3MN6 A;  4FOI A;  2FLO A;  3SUO A;  1WSI A;  1C1A A;  4FVU A;  3F2K A;  2ZGY A;  1WOQ A;  1RDU A;  1JLB A;  2XRI A;  2GEM A;  1D8Y A;  1NK7 A;  4RW7 A;  3DRP A;  2IVO A;  3CFP A;  1NGI A;  4K0K K;  5AQL A;  3IG1 A;  3UKR A;  1QVF M;  5BPM A;  4X66 K;  4HTL A;  1SV5 A;  4M3X A;  1U2V B;  3NBP A;  2VG6 A;  4BWM A;  3VET A;  4O55 A;  1RT7 A;  3O3F A;  3A5N C;  2YNG A;  1S3X A;  2GUP A;  1ZBU A;  3H45 C;  3NH1 A;  4BY9 C;  3V9X A;  4I6M A;  2QI2 A;  4DSL A;  1GLD G;  2FSN A;  3K5M A;  2KLA A;  3Q7C A;  3LAL A;  5KRT A;  4DFP A;  1C0T A;  1DKG D;  5AQF A;  5AQV A;  5C24 A;  2P9P B;  4IXC A;  4YY3 K;  1J9A A;  1J6Z A;  4J2A A;  5AQS A;  3Q7B A;  1I3A A;  5C0Y A;  3VQ7 A;  3NF6 A;  4CZI A;  3JSM A;  3CYM A;  2JWK A;  3QIO A;  3QBW A;  4NLB A;  4LSN A;  5C2D A;  4BRG A;  4IEE A;  4A57 A;  4BR7 A;  2DTU A;  3THX B;  1VSE A;  3IS9 A;  4CJQ A;  3HM8 A;  3CME N;  4CK2 A;  3IAY A;  1C0F A;  2E1Z A;  4W5N A;  3CER A;  3AVC A;  3WNH A;  4RW6 A;  4CIF A;  4IBN A;  3DRS A;  3HXM A;  4RW4 A;  3KLG A;  1E4G T;  4DS4 A;  1TK0 A;  3P4I A;  5SWM A;  1TYQ B;  2B5J A;  4B9L A;  1KVB A;  1NGC A;  4E7J A;  5E84 A;  2YNH A;  4KFB A;  2W41 A;  1EWQ A;  3AVA A;  4CED A;  3OYE A;  4OKE A;  4H0P A;  4CGD A;  4MLE A;  4CK1 A;  5AQI A;  3GBT A;  1KRP A;  3V9Z A;  3SQ1 A;  4W5O A;  4FW2 A;  3VQ4 A;  1TAU A;  4OLB A;  3DXM A;  4CIG A;  4V19 S;  1BO5 O;  1K8K A;  1XNR K;  2IS3 A;  3O9R A;  3C6A A;  3O9U A;  5C42 A;  3MXJ A;  2QXL A;  2HBL A;  1TK8 A;  4B3R K;  3VMF B;  2GWJ A;  4RW9 A;  4B3M K;  3UIQ A;  3HST B;  4FJ8 A;  1RBU A;  1RT3 A;  4H5T A;  1LWE A;  1QE1 A;  4FM0 A;  3PSI A;  4ZHR A;  1SKW A;  3V1Q A;  3CJA A;  1G99 A;  3NH0 A;  1QVG M;  3CM6 A;  2NRX A;  3FGU A;  3QML A;  4BDY A;  1VRU A;  3DAW A;  3AAQ A;  1ATR A;  4UQG A;  1D4X A;  3L0Q A;  4JI2 K;  4LY7 A;  3JXU A;  4JKH A;  4BRE A;  4DV4 K;  4UY8 O;  4XIU A;  4JEP A;  3VTH A;  2VCP A;  4PL7 A;  1KFD A;  1YTU A;  2D4W A;  1FXX A;  1KD1 O;  1HPZ A;  1RT2 A;  4QOZ B;  1HYV A;  4WQ4 C;  2Z1H A;  3DJC A;  3E9O A;  5JS1 A;  3EL2 A;  3DI6 A;  2IVN A;  4JK9 A;  2ZQB A;  1JLA A;  3F73 A;  3GL1 A;  3NVK A;  4WQ4 A;  1DT9 A;  4BE2 A;  3MEE A;  2OPQ A;  1VQ7 N;  3EE8 A;  4W5Q A;  1S9G A;  3AVB A;  1Q7Y O;  4DLG A;  3ITH A;  1KLM A;  3V4I A;  1XNQ K;  4ILH A;  4GVE A;  3ZT0 A;  2FBT A;  3OS0 A;  3CPW M;  4KHN A;  4ISE A;  1N32 K;  3K5N A;  4HUE A;  3C6T A;  4B1X B;  4L3Q A;  5AQM A;  3HPG A;  2W6K A;  2HHW A;  1IBL K;  3U3G A;  1C1C A;  3VPZ A;  1BA0 A;  4HWI A;  3KD5 E;  1CLQ A;  1SS6 A;  4DV6 K;  4YNQ A;  1TUY A;  4PUO A;  2ASM A;  2XHB A;  3ISN C;  2QWM A;  1IH7 A;  4KH6 A;  3EE9 A;  1NK8 A;  1P90 A;  2F7T A;  5FPD A;  4FPB A;  2ITG A;  3AAP A;  4DV0 K;  4CI6 A;  3A5O C;  4CIE A;  4H0V B;  1NLV A;  4DTJ A;  4BDZ A;  3RRH A;  1NOY A;  5LJW A;  3KLF A;  1VQ5 N;  4M7Y A;  3SUP A;  4H03 B;  1ZBL A;  1TAQ A;  3OW2 M;  2V52 B;  4E7H A;  4BRA A;  4CFD A;  3MAQ A;  4CZF A;  4FJX A;  2D0P A;  1HNZ K;  3O9Q A;  5AQK A;  5GIO A;  1U6Z A;  4K8X A;  1JCF A;  2KHO A;  4DLE A;  2X6N A;  3WXK A;  4JS4 A;  4LD0 A;  1EX4 A;  1YJW N;  2FF3 B;  2QTD A;  3IKM A;  3FZH A;  2P5O A;  3KWI A;  3ZT1 A;  1YI2 N;  2Y1J A;  1EET A;  4CJ3 A;  1U2V A;  1L3V A;  3BP8 A;  4F2S A;  4MDA A;  1S6Q A;  1XI1 A;  1S22 A;  3ZT3 A;  2PYJ A;  1BCO A;  5J2N A;  4JK7 A;  3A0I X;  3OYL A;  1X9M A;  5IWA K;  4DTP A;  5LJV A;  3AVM A;  2Q3S A;  3T19 A;  4JV5 K;  2GUI A;  2HHH K;  1NK0 A;  3ULD A;  3I0S A;  2YJE A;  3SAG A;  2HHV A;  1YIT N;  2P9P A;  4J2E A;  5GAH P;  4BGB A;  2YJF A;  1DGK N;  1NGG A;  3O5B A;  1LOT B;  4BRC A;  2P9N A;  3LDP A;  2KFN A;  4IG3 A;  3TI0 A;  3PUF A;  4KBO A;  4CEO A;  1TKD A;  4CF9 A;  4N47 A;  4BRO A;  4H0X B;  3P5J A;  1T03 A;  4EP4 A;  3T1A A;  5FRN A;  3AVK A;  3NDK A;  4N41 A;  4JKE A;  3OS1 A;  1CXU A;  2NNW A;  3THX A;  4LF7 K;  4PWD A;  3MX2 A;  4CJU A;  3ZSZ A;  4KHY A;  2YHW A;  2ETJ A;  4BG8 A;  2P9S B;  2PYL A;  4HVJ A;  1VSK A;  5AQY A;  3VQA A;  2Q97 A;  4MLH A;  4CEA A;  3H3O B;  1IJJ A;  3EZW A;  1Z26 A;  1LWF A;  3F9K A;  4CFC A;  1BCM A;  3G71 N;  3PLA A;  4BC2 A;  5AQT A;  3R8E A;  1VHX A;  3LDQ A;  4CEF A;  1T6D A;  3TAM A;  1NJY A;  4KH5 A;  1NJZ A;  2GEL A;  5CY4 A;  5TKW A;  3ATV A;  1YT3 A;  5BRE A;  3TSU A;  2YCH A;  4M3Y A;  5DM6 L;  1SKS A;  3LAM A;  4CZL A;  1ATN A;  1R59 O;  1WAF A;  5HOO A;  1W97 L;  3V9U A;  4FJH A;  1RTI A;  1TVR A;  3SPZ A;  2VGM A;  3VQD A;  4EZ6 A;  1NMD A;  2DPN A;  5GAG P;  4IDH A;  5BRH A;  3HPH A;  4FL9 A;  1ILY A;  1N36 K;  3LDO A;  4F3T A;  4YOY A;  1WB9 A;  4JLH A;  3QIN A;  5AJ3 K;  4GVM A;  3HJF A;  4NLC A;  3I55 N;  4GNI A;  3MEG A;  1VRT A;  2QKK A;  4CES A;  3U3Y A;  3D7E O;  4LSL A;  5E26 A;  1RIL A;  4CJF A;  1OVY A;  2UXD K;  3C7N A;  2G8V A;  4FSV A;  2UUA K;  3VTI A;  1OH6 A;  1JLC A;  1J5O A;  5KRS A;  4ID5 A;  4C23 A;  4CEZ A;  4ELV A;  5CZ2 A;  4CW7 B;  2E20 A;  3KTQ A;  3VA3 A;  3D2F B;  2FBV A;  2XY8 A;  1HJR A;  5EOY A;  2HB5 A;  4Z4I A;  2GV9 A;  2HHU A;  5BPN A;  1BUP A;  4CGH A;  2DFE A;  2I5J A;  1WSJ A;  3H08 A;  4JHD B;  3U9Z A;  1UOC A;  4WFA L;  3CCS N;  3RTV A;  2EWS A;  3JYT A;  3LDN A;  3AO3 A;  1QTM A;  4OKK A;  3WT0 A;  3KK1 A;  5DMR A;  3HK2 A;  1D9F A;  4JI4 K;  1QZ6 A;  4KTQ A;  4CHN A;  4M3R A;  4IZ9 A;  2IGI A;  4H8K A;  3I56 N;  2UXC K;  3HP9 A;  2OA8 A;  4CJK A;  4FLT A;  5AZI B;  1ESV A;  1BOT O;  2BE2 A;  2NZT A;  4DUZ K;  2PY5 A;  3L3V A;  4YOT A;  1KXP A;  5DM7 L;  3PSF A;  3DLH A;  2OCE A;  4JYA K;  3LZI A;  2A1S A;  1XQS C;  3FZM A;  4OGC A;  4X65 K;  4W5T A;  1RDC A;  1QHA A;  5C12 A;  3CJC A;  2QK9 A;  4BG9 A;  2P9I A;  2G8F A;  1WSE A;  4IG0 A;  2QXF A;  3J81 O;  1Z6R A;  3MX5 A;  3J7Z O;  3SQ4 A;  1L3S A;  1TKX A;  4CJR A;  1W0H A;  3DRR A;  2V7Y A;  3E1Y A;  3AA2 A;  3HI0 A;  4CHQ A;  3L4I A;  3H6E A;  2HNZ A;  1HQU A;  2F96 A;  5BR8 K;  1VQ8 N;  3HPO A;  1RTD A;  2HHS A;  3UE5 A;  2CGJ A;  2O8B A;  2QM1 A;  4CZM A;  2BUP A;  3QLH A;  3NF8 A;  3T7Z A;  3QNN A;  1SQK A;  5BR9 A;  4B9U A;  4FVM A;  2W6L A;  3CCU N;  3WNG A;  2D0A A;  1X3N A;  4JNE A;  3KLE A;  3SJH A;  3DM2 A;  4BRD A;  1QS4 A;  4JI0 K;  1UWB A;  2R7Y A;  2E2N A;  5LL6 Z;  2HST A;  4FXD A;  5AZJ B;  1JXE A;  1YVN A;  2X6S A;  3ID6 A;  2Y1I A;  3WNE A;  3OHR A;  3VF6 A;  3S9H A;  2D0C A;  4KTZ A;  4DTS A;  1JL2 A;  4F8R A;  1NM1 A;  1MU2 A;  4DQ8 A;  3NF9 A;  2QWQ A;  4KTW A;  4EIA A;  4ISF A;  3OBW A;  3TTC A;  2O8E B;  2HOE A;  3F9M A;  1CZA N;  3WXJ A;  4IFE A;  4DSI A;  1NKB A;  3LP0 A;  4DTR A;  1XC9 A;  4FJJ A;  4CJ5 A;  1N5Y A;  3AVH A;  1HNI A;  3WNF A;  1ZXO A;  1RCH A;  3AY9 A;  3MMV A;  4Z0U A;  3I0R A;  1EKE A;  3DMJ A;  4FWS A;  2P9U B;  3CI5 A;  4BRH A;  4JI5 K;  3LM2 A;  3NH2 A;  2A6A A;  4JRP A;  2RN2 A;  3LL3 A;  4A62 A;  5J2Q A;  1IKW A;  1NK4 A;  2GX9 A;  3EN9 A;  1IKY A;  1XMQ K;  4U67 L;  3PIO L;  2O8D B;  3WEE B;  3B6O A;  3T69 A;  3HP6 A;  4GV3 A;  4FJI A;  3MXI A;  2KFZ A;  1JCE A;  1EQY A;  3TTF A;  2P9S A;  1REV A;  1U48 A;  4A59 A;  4CGG A;  3CQ8 A;  1V4T A;  4Y1C A;  2F9W A;  2DFF A;  3RVC A;  1KAY A;  4N76 A;  3CCJ N;  4IOC L;  2VG5 A;  5FPN A;  1P8Z A;  3T1H K;  3TAF A;  1K9M O;  2Q31 A;  4O4G A;  4FZX C;  1RT4 A;  2G8W A;  2B6A A;  4B1Z A;  3HRG A;  4WQ5 A;  4F9O A;  1ZBF A;  2E88 A;  2IC3 A;  3IMX A;  2GWK A;  4CJS A;  1RT6 A;  4RTF D;  2ZF5 O;  1JLQ A;  4H5W A;  2UXB K;  3CCR N;  1T7P A;  1KAX A;  2OAN A;  3H1Q A;  1A5W A;  1N6Q A;  1Q81 O;  1IG8 A;  1Z05 A;  4KRF A;  2V7Z A;  2Z1G A;  1D9D A;  1RTH A;  2HMI A;  4OGE A;  4B08 A;  1BIZ A;  3K9J A;  5GIN A;  2EHG A;  4C1N I;  1T8E A;  1FJG K;  1M90 O;  3LPU A;  4NXN K;  2KZM A;  2YV0 X;  2ZJR L;  3VEZ A;  2HBM A;  1CZB A;  2ZGZ A;  1SUQ A;  3PO5 A;  4FM1 A;  4IEI A;  3R3L A;  3QIP A;  2ATQ A;  1NGE A;  1GLC G;  2F4V K;  3SZ2 A;  2F8S A;  4JKC A;  3GOI A;  2P9K B;  1XHX A;  4C8N A;  2VWJ A;  2QWR A;  5AQG A;  3MN7 A;  3K0S A;  4B1W B;  4DMN A;  4RWT A;  4RW8 A;  4I9L A;  4K25 A;  4DV1 K;  3RMD A;  3AVI A;  3J80 O;  3SI6 A;  3O6W A;  4BR4 A;  4DR3 K;  1KTQ A;  1TK5 A;  4PL8 A;  4M3W A;  4FPA A;  3CCM N;  3AVG A;  4LFC K;  1YIJ N;  1VQL N;  3MWT A;  1RFQ A;  4DB3 A;  3NCI A;  3THW B;  3A2F A;  4B9Q A;  5AZI A;  5M1O A;  4CHY A;  2G8K A;  2X78 A;  1SL1 A;  1IKX A;  5J1E A;  3S41 A;  3VGK A;  3M8S A;  3CC7 N;  4CFB A;  3E9P A;  3BDP A;  4B9N A;  1S1W A;  2OZS A;  4JKG B;  5BPL A;  2VWB A;  4CBU A;  1Q18 A;  4WCE L;  2KZZ A;  4C8L A;  1F21 A;  1HJO A;  1HQE A;  3S3N A;  4B3O A;  2FC0 A;  2NRZ A;  2E2O A;  5KI6 A;  3MK6 A;  1M1K O;  3BUZ B;  3BF1 A;  1IKV A;  1RDA A;  4N56 A;  3RR7 A;  4I2Q A;  4JKB A;  3WQU A;  4KHW A;  5DK5 A;  1X9W A;  1W2B M;  2E5L K;  1HNW K;  3O08 A;  3AAR A;  4GY2 B;  4DQP A;  4NYF A;  1U49 A;  5AFU H;  3LAK A;  3NFA A;  1YVU A;  2QKB A;  4FJG A;  3L2U A;  2ZJP L;  2OPR A;  3HO1 A;  1C6V A;  3CJB A;  4IKF A;  1X1P A;  1VSF A;  5CYQ A;  3FR0 A;  4B8A B;  4AQY K;  2D0O A;  4KI4 A;  3MWP A;  1NMN A;  3P38 A;  1I39 A;  3VQQ A;  3QEX A;  5HBM A;  3NE6 A;  1UAX A;  2Z1I A;  2OYQ A;  3EYZ A;  3DOL A;  3K5O A;  3AVJ A;  1GLB G;  3SMS A;  3GE1 A;  3CQY A;  3VOV A;  3ZT2 A;  4E1M A;  4NYN A;  3M6G A;  4HHT A;  3HZ6 A;  3A5L C;  3K9K A;  4AHC A;  3KD1 E;  2QA4 N;  4AHR A;  2ZD1 A;  3ULE B;  3OS2 A;  4QS9 A;  3PY8 A;  3CET A;  5HRS A;  2BH1 A;  2QW9 A;  3OYG A;  4FK4 A;  4FO0 A;  2IIR A;  1NNE A;  2O8C B;  1HLU A;  3ALY A;  3L6Q A;  1Q86 O;  3VQB A;  1S72 N;  4OJR A;  5KGX A;  4FLY A;  3THY B;  3RSE B;  4FK0 A;  4MDB A;  4JKD A;  1HPM A;  4XEI A;  4DF8 A;  3HYF A;  1L3U A;  4U7B A;  3M8R A;  4ILG B;  4H4M A;  3L2W A;  3KKS A;  1TUU A;  4F2R A;  3D6R A;  3TR8 A;  1J53 A;  2CGK A;  2HHT A;  2E6L A;  4EP5 A;  4BVP A;  4BC5 A;  2YI1 A;  3SAF A;  1NOZ A;  2QWN A;  4YDU A;  4NB4 A;  1EWR A;  1RNH A;  1NK5 A;  4B1V A;  4CJ7 A;  5KQD A;  1HR0 K;  2D1K A;  3TAR A;  4B9T A;  4O8U A;  1BIU A;  3HVT A;  1KLN A;  3FFI A;  4DHY A;  1Q82 O;  1LW0 A;  3C6H A;  4HTU A;  1TL3 A;  2Z1J A;  2O8D A;  2NUB A;  1T6C A;  5C2F A;  3HM9 A;  3H3N O;  1LAW A;  4G1Q A;  4O0I A;  4JI1 K;  5JIC A;  4DV5 K;  4H4O A;  3FZK A;  4IOX A;  2P5G A;  1T44 A;  3TAE A;  1EO1 A;  4E1J A;  1LAV A;  3U9D A;  5AQH A;  1OH7 A;  5LY3 A;  4IO8 A;  4BE0 A;  1JXB A;  1YJN N;  1GLL O;  4AM7 A;  2XY5 A;  3D2E B;  3DWL A;  2YX6 A;  2ITM A;  2XY6 A;  1W9H A;  4DUY K;  3CCE N;  1RDD A;  3PO4 A;  4JI7 K;  2XO7 A;  3ENO A;  1VQ6 N;  1GLJ O;  2LSN A;  3ID8 A;  3R9P A;  2GBZ A;  2NRR A;  2OTL N;  1NJX A;  1Z25 A;  3NHG A;  2QWL A;  4DKW A;  3ZEU B;  3UKU B;  4A5B A;  4CBW A;  1HNX K;  3KIO A;  4C8M A;  2VGN A;  1D5A A;  2OZM A;  2P9L B;  2HBK A;  1VSI A;  5MLC Q;  4J2B A;  1O1W A;  1YAG A;  1TKZ A;  3F5T A;  3OYI A;  1VQP N;  4B3S K;  5LMN K;  2NRW A;  2WON A;  5CE3 A;  4LFB K;  2H3G X;  2FXU A;  1XHZ A;  2G8U A;  1B9D A;  4KH4 A;  3V6D A;  4R79 A;  4NCB A;  3QB0 A;  4ELU A;  3HOS A;  3CCQ N;  3DLL L;  2WOM A;  4FWR A;  1RDW X;  3BGR A;  4E19 A;  4DTX A;  5AQX A;  3SBT A;  4CJE A;  2AJQ A;  3VN5 A;  4AF1 A;  4DV7 K;  2QEX N;  1NGF A;  1KSP A;  3U8X A;  3KLH A;  4A61 A;  4CEC A;  4O8K A;  1ZBH A;  1SAZ A;  3O4W A;  4CCH A;  3CMA N;  4BRN A;  4FWN A;  2E4L A;  4ZTJ A;  3THV A;  5GIP A;  1S1U A;  4AHS A;  1TYQ A;  5ADX H;  4HUG A;  3VQE A;  1VQ9 N;  4CZE A;  2B4J A;  3VQP A;  3OY9 A;  4JAX A;  5J2P A;  4MFB A;  3ZET B;  1FK9 A;  4CHO A;  5HLF A;  1WN7 A;  4BR5 A;  3C65 A;  1YUW A;  3CHW A;  5HRN A;  3CM5 A;  4O44 A;  2CGL A;  3CG7 A;  4RG8 A;  5EX5 A;  4WYB A;  3QES A;  4G9Z A;  3TAG A;  4CZJ A;  3WXI A;  5K14 A;  4IJN A;  1BDG A;  1VQN N;  4OPK A;  2UUB K;  3NVM A;  1LW2 A;  1SL2 A;  4JD2 B;  4ZTF A;  3U4L A;  4JKG A;  3KKR A;  3FE1 A;  4IJA A;  4Q5V A;  2E6M A;  4RCH A;  1SL0 A;  2P1J A;  3LM9 A;  3V9W A;  3K5L A;  2WC9 A;  4OVL A;  5KPT A;  4BAC A;  3CCV N;  4BR0 A;  2NRV A;  3TWH A;  3P39 A;  4CD3 A;  4Z4F A;  3ZX3 A;  4LFA K;  4IWV A;  3J7Y P;  3NF7 A;  4DTN A;  1JKH A;  4FW1 A;  4A2A A;  3SV4 A;  1BGX T;  3OJS A;  3CFO A;  3FFK B;  3ZSR A;  3N4P A;  5AQO A;  4JKA A;  3I8D A;  2CH5 A;  4C8K A;  3MDQ A;  4PKH A;  4FLZ A;  4KI6 A;  3QET A;  4E7I A;  3UB5 A;  5AFU A;  1N8R O;  2F8T A;  1S9E A;  3CFR A;  4OO1 J;  3EKS A;  4X64 K;  4CEB A;  4B9V A;  2YKN A;  4Y1D A;  3MXM A;  3TAB A;  2UU9 K;  2E2Q A;  4GW6 A;  4TSX A;  2RPI A;  4DG1 A; 
#chains in the Genus database with same CATH homology
 1TK8 A;  4FLW A;  1NK4 A;  3QEI A;  1BIS A;  1IKY A;  3E01 A;  3LDS A;  4RW9 A;  4CJW A;  3B6O A;  3UIQ A;  3HST B;  4FJ8 A;  3HP6 A;  1J54 A;  1RBU A;  3SV3 A;  3MXI A;  4FJI A;  1RT3 A;  2KFZ A;  3LP2 A;  1QSS A;  1LWE A;  1QE1 A;  1QSY A;  4FM0 A;  5FRO A;  1REV A;  4ZHR A;  1QQC A;  5CYM A;  3V1Q A;  1SKW A;  1U48 A;  1Y97 A;  3NH0 A;  2VWK A;  3CM6 A;  4KV8 A;  4IDK A;  5CZ1 A;  4CGG A;  3CQ8 A;  4BDY A;  1VRU A;  3SQ2 A;  4Y1C A;  2PZS A;  3SPY A;  1S1X A;  2DFF A;  4UQG A;  4N76 A;  1BQM A;  2YHB A;  4LY7 A;  3SUQ A;  1HYS A;  1RBV A;  3MED A;  2VG5 A;  1ASV A;  4XIU A;  3EZ5 A;  2JLE A;  4BDP A;  1Q9X A;  1RBT A;  1RDB A;  4OKJ A;  4L8R B;  1KFD A;  1YTU A;  4FLX A;  1FXX A;  4FJK A;  4M42 A;  3TAF A;  4CEE A;  4E1N A;  1HPZ A;  1RT2 A;  3LPT A;  3ZSO A;  1HYV A;  4CJ4 A;  2Z1H A;  1U47 A;  4QOZ B;  4O4G A;  4FZX C;  1RT4 A;  4DQR A;  5JS1 A;  1TGO A;  2G8W A;  3DI6 A;  2B6A A;  1VSM A;  1RTJ A;  4CF0 A;  4CJP A;  3HT3 A;  1LV5 A;  5C25 A;  1FKP A;  3V9S A;  1ZBF A;  2ZQB A;  3DLG A;  4CGF A;  4KAZ A;  1JLA A;  3F73 A;  4KKO A;  3L2Q A;  2IC3 A;  3AA4 A;  3OYM A;  4CJS A;  1RT6 A;  4BE2 A;  3MEE A;  1JLQ A;  1UA0 A;  2OPQ A;  5J2M A;  1T7P A;  4W5Q A;  4JRQ A;  1S9G A;  2YHA A;  3AVB A;  4DLG A;  2OPS A;  3ITH A;  3VQ9 A;  1KLM A;  1A5W A;  2VG7 A;  3LAN A;  3V4I A;  1N6Q A;  4FJN A;  4M3T A;  4KRF A;  2HVH A;  2Z1G A;  1D9D A;  3TAQ A;  1DTT A;  1A5V A;  1RTH A;  3DLK A;  3ZT0 A;  2FBT A;  3OS0 A;  5HP1 A;  1RBR A;  4OGE A;  2A1R A;  2HMI A;  1BQN A;  4B08 A;  3OYC A;  1BIZ A;  4C8O A;  4FJM A;  4KHN A;  2EHG A;  2KQ2 A;  1T8E A;  1ITG A;  3K5N A;  3G0Z A;  3OVN A;  3LPU A;  1KVC A;  3DLR A;  4PY5 A;  4HUE A;  3C6T A;  2FBX A;  2KZM A;  2YV0 X;  3RMC A;  2HHW A;  3HPG A;  4FLV A;  4KHQ A;  1WSF A;  1CZB A;  2OPP A;  3U3G A;  3ZT4 A;  3QER A;  1C1C A;  4Z4C A;  3PX4 A;  3DLB A;  1GOB A;  1SUQ A;  3VA0 A;  3PO5 A;  3KK3 A;  2O4G A;  1BL3 A;  4FM1 A;  3QIP A;  1IO2 A;  1R0A A;  2ATQ A;  3AVF A;  3KD5 E;  4M3U A;  1CLQ A;  3SZ2 A;  2F8S A;  4YNQ A;  5EU7 A;  4PUO A;  4CFA A;  2HW3 A;  1XHX A;  4C8N A;  2XHB A;  3ISN C;  4M45 A;  4I7F A;  4IFV A;  2VWJ A;  1IH7 A;  1TV6 A;  4FYD A;  4R5P A;  1NK8 A;  4FJ7 A;  1IG9 A;  4B8C A;  2ITG A;  4NCG A;  4DMN A;  4CJL A;  4CIE A;  2D0B A;  4RW8 A;  1Q8I A;  4I9L A;  4DTJ A;  3RMD A;  3AVI A;  4KO0 A;  3SI6 A;  4PA1 A;  4BDZ A;  3RRH A;  2YNI A;  1NOY A;  1KTQ A;  3KLF A;  4FM2 A;  1TK5 A;  3SUP A;  5KTQ A;  2P51 A;  4ID1 A;  1ZBL A;  1TAQ A;  3AO1 A;  3SYZ A;  4M3W A;  1QSL A;  4E7H A;  1JLG A;  3M8P A;  3AVG A;  2XY7 A;  4CFD A;  3MAQ A;  1NKE A;  4FJX A;  4K8X A;  4J2D A;  3O4Q A;  3NGI A;  3LP1 A;  2W42 A;  3DYA A;  5D3G A;  1VSL A;  4DLE A;  2X6N A;  5T7B A;  4HUF A;  3NCI A;  3A2F A;  4JS4 A;  1C0U A;  4LD0 A;  3OYD A;  1EX4 A;  3ZSY A;  4CHY A;  3LZJ A;  4DTU A;  2G8K A;  2X78 A;  1SL1 A;  1IKX A;  5J1E A;  2P5O A;  3M8S A;  4CFB A;  5HRO A;  3ZT1 A;  3BDP A;  4B9N A;  1S1W A;  2OZS A;  2Y1J A;  1L5U A;  1L3T A;  1EET A;  4DSK A;  4CJ3 A;  3O4N A;  1L3V A;  4CF1 A;  4DWI A;  3AA5 X;  2KZZ A;  4C8L A;  3QEV A;  4F2S A;  1FKO A;  1F21 A;  1HQE A;  1S1T A;  3AO2 A;  3S3N A;  4B3O A;  1S6Q A;  2FC0 A;  2IAJ A;  1XI1 A;  4ICL A;  1JL1 A;  4DSJ A;  3C95 A;  5KI6 A;  3ZT3 A;  1BCO A;  2PYJ A;  1VSJ A;  5J2N A;  3KJV A;  4FZY A;  3OYL A;  1X9M A;  1IKV A;  1RDA A;  3ASM A;  4N56 A;  4I2Q A;  4E7L A;  3RR7 A;  4KHW A;  3NGZ A;  4OLA A;  4DTP A;  4DQI A;  3AVM A;  4MQ3 A;  2Q3S A;  5DK5 A;  3T19 A;  1QHT A;  2GUI A;  4WE1 A;  1X9W A;  1NK0 A;  3ULD A;  4CHP A;  3S3M A;  3I0S A;  4DU3 A;  4DQP A;  4NYF A;  3QEW A;  2HHV A;  4Z4E A;  3G10 A;  4DFM A;  1U49 A;  3OYA A;  4J2E A;  3LAK A;  3K59 A;  4Z4H A;  3NFA A;  1YVU A;  4KB1 A;  4M41 A;  3PX6 A;  2QKB A;  4FJG A;  2YKM A;  3L2U A;  2HHQ A;  2OPR A;  3HO1 A;  3B6P A;  1C6V A;  4PQU A;  4DS5 A;  1X1P A;  4IKF A;  2KFN A;  2HNY A;  4IG3 A;  1VSF A;  2IDO A;  5CYQ A;  3NAE A;  3QEP A;  4F3O A;  3TI0 A;  1ZBI A;  3PUF A;  4B8A B;  4CF2 A;  4NCA A;  4KI4 A;  1GOC A;  4CEO A;  1TKD A;  4CF9 A;  3RWU A;  4I2P A;  4N47 A;  4M3Z A;  2G8I A;  2ZE2 A;  2EX3 A;  3P5J A;  3OYF A;  4EP4 A;  4DFJ A;  1HYZ A;  1VSD A;  4OPJ A;  1T03 A;  3T1A A;  1I39 A;  3VQQ A;  3QEX A;  5HBM A;  3NE6 A;  3AVK A;  1SKR A;  3NDK A;  5FRN A;  4K8Z A;  4N41 A;  4CK3 A;  1CXU A;  1UAX A;  3OS1 A;  3IRX A;  3K58 A;  2Z1I A;  4QCL A;  2OYQ A;  1JLE A;  3EYZ A;  4PWD A;  3DOL A;  3K5O A;  3AVJ A;  4CJU A;  4CJV A;  4FJ9 A;  3PX0 A;  5HRR A;  1EP4 A;  3ZSZ A;  2D5R A;  3V1O A;  4O5B A;  4FLU A;  3ZT2 A;  4DSF A;  4KHY A;  1S6P A;  4E1M A;  1VSH A;  4O0J A;  4NYN A;  2ETJ A;  4E7K A;  1NKC A;  4HHT A;  4AHC A;  1ZYQ A;  2PYL A;  4HVJ A;  4CGJ A;  3LWL A;  3KD1 E;  1RBS A;  1VSK A;  3VQA A;  4AHR A;  2ZD1 A;  4IFY A;  2DY4 A;  1WSH A;  3OS2 A;  4CEA A;  3PY8 A;  4Q0B A;  5HRS A;  3PV8 A;  4CE9 A;  4CER A;  3OYG A;  3AO5 A;  4YFU A;  3U6F A;  4HCC A;  4FK4 A;  2DFH A;  1Z26 A;  1LWF A;  3ZCM A;  1CXQ A;  2FBY A;  3F9K A;  3MEC A;  4CFC A;  1BCM A;  3ALY A;  4DSE A;  2O4I A;  3VQB A;  4DTO A;  4FZZ A;  1S5J A;  4OJR A;  3C6U A;  4CEF A;  3TAM A;  5KGX A;  1BI4 A;  4FLY A;  1NJY A;  3RRG A;  1NJZ A;  2BGG A;  4FK0 A;  5CY4 A;  4LH5 A;  1YT3 A;  2JGU A;  1UA1 A;  4DF8 A;  3V1R A;  3L8B A;  4M3Y A;  1NJW A;  3HYF A;  1SKS A;  1L3U A;  3LAM A;  3M8R A;  2HVI A;  1WAF A;  4H4M A;  3V9U A;  1U45 A;  3L2W A;  1NK6 A;  3KKS A;  4FJH A;  2IOC A;  1RTI A;  1NK9 A;  4F2R A;  1TVR A;  3K2P A;  3SPZ A;  3TR8 A;  3VQD A;  1J53 A;  1WSG A;  3P1G A;  4W5R A;  4EZ6 A;  3OYJ A;  2E6L A;  2HHT A;  3AVN A;  4EP5 A;  3HPH A;  1NOZ A;  4F3T A;  3AVL A;  4JLH A;  1RNH A;  1NK5 A;  1VK0 A;  3QIN A;  1BHL A;  1KFS A;  2BAN A;  4GVM A;  3HJF A;  1JLF A;  1C0M A;  3MEG A;  3TAR A;  3RR8 A;  4KRE A;  1VRT A;  4CF8 A;  3ZSX A;  2QKK A;  4CES A;  3T3F A;  3U3Y A;  1BIU A;  3TAN A;  3HVT A;  4LSL A;  3FFI A;  4DQS A;  1KLN A;  1CZ9 A;  1RIL A;  4CJF A;  1LW0 A;  5FRM A;  2BDP A;  4HTU A;  2HND A;  4DTM A;  1TL3 A;  2Z1J A;  4CEQ A;  2HHX A;  2NUB A;  2G8V A;  3HM9 A;  1T05 A;  3L2V A;  3P83 D;  1GOA A;  4BWJ A;  1LAW A;  4G1Q A;  3VQ5 A;  4O0I A;  3S3O A;  1JLC A;  1J5O A;  5KRS A;  4ID5 A;  4CEZ A;  3D0P A;  3L3U A;  3RMB A;  4ELV A;  4H4O A;  5CZ2 A;  3OYB A;  4AHU A;  4KB0 A;  3KTQ A;  3VA3 A;  2FBV A;  4E89 A;  3OYN A;  4QAG A;  3KK2 A;  2XY8 A;  1HJR A;  3QO9 A;  4EZ9 A;  3O3G A;  3L2R A;  2HB5 A;  4CHZ A;  2P5G A;  2X74 A;  1WNS A;  4DFK A;  4Z4I A;  3TAE A;  1WAJ A;  5E41 A;  4ELT A;  1LAV A;  2GV9 A;  2KTQ A;  3O3H A;  5KGW A;  2HHU A;  3VQC A;  4AHT A;  1KCF A;  4BE0 A;  4DU1 A;  4CGH A;  2DFE A;  1JXB A;  2I5J A;  3C94 A;  1WSJ A;  1G15 A;  3H08 A;  2XY5 A;  1C1B A;  1UOC A;  3RTV A;  3SNN A;  3DLE A;  5SZT A;  3JYT A;  2XY6 A;  1RT1 A;  1W9H A;  1S1V A;  3AO3 A;  1RDD A;  4OKK A;  1QTM A;  3PO4 A;  3KK1 A;  4CGI A;  2XO7 A;  5DMR A;  3HK2 A;  1D9F A;  3V81 A;  4F4K A;  2LSN A;  2GBZ A;  3HL8 A;  4CHN A;  1Z25 A;  1NJX A;  3NHG A;  4HCB A;  3SUO A;  1HNV A;  2RF2 A;  1WSI A;  4M3R A;  1C1A A;  2IGI A;  4H8K A;  4FJL A;  4E0D A;  3ZSW A;  3HP9 A;  2OA8 A;  4N5S A;  1ASU A;  3KIO A;  4C8M A;  1HMV A;  4CJK A;  1JLB A;  4E3S A;  4FLT A;  5FDL A;  3ZSV A;  3OYK A;  1D5A A;  2XRI A;  2OZM A;  1D8Y A;  1NK7 A;  3AV9 A;  1VSI A;  4RW7 A;  2BE2 A;  3DRP A;  3NGY A;  3CFP A;  1O1W A;  4J2B A;  2PY5 A;  3IG1 A;  3OYI A;  1TKZ A;  3L3V A;  4KHU A;  2WON A;  4GMJ B;  1DTQ A;  1SV5 A;  1XHZ A;  3DLH A;  4M3X A;  3NBP A;  2G8U A;  2VG6 A;  4BWM A;  1B9D A;  2A1S A;  3LZI A;  4OGC A;  4W5T A;  3V6D A;  4KTQ A;  4NCB A;  1RDC A;  4ELU A;  4O55 A;  1RT7 A;  3O3F A;  2WOM A;  3OJU A;  2QK9 A;  2G8F A;  1WSE A;  4IG0 A;  2QXF A;  3K57 A;  2YNG A;  4FCY A;  4AH9 A;  3BGR A;  4E19 A;  3SQ4 A;  4DTX A;  4CJE A;  1B92 A;  1K6Y A;  1ZBU A;  3NH1 A;  3V9X A;  1EXQ A;  1L3S A;  3VN5 A;  2AJQ A;  1TKX A;  4DSL A;  3K5M A;  4CJR A;  1KSP A;  3LAL A;  1W0H A;  3DRR A;  3KLH A;  5KRT A;  4CEC A;  4DFP A;  1YTA A;  1ZBH A;  3QNO A;  4CCH A;  1C0T A;  3AA2 A;  4KHS A;  1A5X A;  4CHQ A;  3D45 A;  2E4L A;  4ZTJ A;  3M8Q A;  3THV A;  5C24 A;  1J9A A;  3SUN A;  1S1U A;  2HNZ A;  3VQ6 A;  4B9M A;  1RT5 A;  1HQU A;  4AHS A;  4J2A A;  4FJ5 A;  1I3A A;  2F96 A;  3LP3 A;  4CJT A;  4HUG A;  3VQE A;  3HPO A;  1RTD A;  3KLI A;  2B4J A;  1TL1 A;  3VQP A;  3OY9 A;  3OYH A;  5J2P A;  4AIL C;  3VQ7 A;  2HHS A;  3NF6 A;  4MFB A;  1FK9 A;  4CHO A;  3JSM A;  3CYM A;  5HLF A;  1WN7 A;  2G8H A;  3QLH A;  3QIO A;  3NF8 A;  3QNN A;  4LSN A;  4DF4 A;  4B9U A;  5HRN A;  3CM5 A;  4FVM A;  4O44 A;  3RMA A;  3CG7 A;  2DTU A;  3WNG A;  2D0A A;  4RG8 A;  4BE1 A;  1VSE A;  3IS9 A;  4CJQ A;  3KLE A;  3QES A;  3TAG A;  2RKI A;  4CK2 A;  3DM2 A;  5HRP A;  3IAY A;  5K14 A;  1QS4 A;  4OPK A;  1UWB A;  2R7Y A;  3EY1 A;  4W5N A;  4I9Q A;  3AVC A;  3WNH A;  4FXD A;  4RW6 A;  4AHV A;  4CIF A;  1LW2 A;  1JXE A;  1XWL A;  2X6S A;  2Y1I A;  4IBN A;  3DRS A;  1U4B A;  1SL2 A;  4ZTF A;  4FK2 A;  3WNE A;  3HXM A;  3SQ0 A;  1ASW A;  1DLO A;  4RW4 A;  3KLG A;  3S9H A;  2D0C A;  3KKR A;  3AA3 A;  4DS4 A;  1TK0 A;  4KTZ A;  4Q5V A;  2E6M A;  4DTS A;  1JL2 A;  4F8R A;  1SL0 A;  2P1J A;  4DQQ A;  1KVA A;  3V9W A;  3K5L A;  5SWM A;  4Z4G A;  4B9S A;  1MU2 A;  3AO4 A;  2B5J A;  1U04 A;  4B9L A;  1KVB A;  4OVL A;  3LWM A;  1HRH A;  3NF9 A;  4KTW A;  4BAC A;  5I42 A;  4E7J A;  1BI4 B;  2YNH A;  4DU4 A;  3TAP A;  3TWH A;  1X9S A;  4KFB A;  4Z4F A;  3HVR A;  3SCX A;  3AVA A;  4CED A;  1WLJ A;  3OYE A;  2KW4 A;  4DSI A;  1Q9Y A;  4OKE A;  1NKB A;  3LP0 A;  3NF7 A;  4DTR A;  1XC9 A;  4FJJ A;  4CJ5 A;  3SJJ A;  1N5Y A;  3AVH A;  1HNI A;  4LH4 A;  4DTN A;  4CGD A;  4KPY A;  1JKH A;  4FW1 A;  4CK1 A;  3WNF A;  3DOK A;  3SV4 A;  1BGX T;  3OJS A;  3CFO A;  3ZSR A;  1RCH A;  1KRP A;  3ZSQ A;  3I8D A;  3V9Z A;  3SQ1 A;  4W5O A;  4KI6 A;  4C8K A;  4FW2 A;  3VQ4 A;  4FLZ A;  3QET A;  1TKT A;  4E7I A;  4JS5 A;  2YNF A;  4Z0U A;  3I0R A;  5JS2 A;  1TAU A;  4OLB A;  2F8T A;  1EKE A;  3DMJ A;  1S9E A;  3CFR A;  4CIG A;  1B9F A;  4B9T A;  5I3U A;  2IS3 A;  4CEB A;  4B9V A;  2YKN A;  3NH2 A;  4Y1D A;  3MXM A;  1LWC A;  3TAB A;  4JRP A;  4GW6 A;  4TSX A;  2RN2 A;  2RPI A;  5C42 A;  5J2Q A;  3VQ8 A;  1IKW A;  3MXJ A;  4DG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...