4HHTA

T. maritima rnase h2 g21s in complex with nucleic acid substrate and calcium ions
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
229
structure length
220
Chain Sequence
GIDELYKKEFGIVAGVDEASRGCLAGPVVAAAVVLEKEIEGINDSRLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKSVVFRKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNase H2 roles in genome integrity revealed by unlinking its activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/dna
molecule keywords Ribonuclease HII
total genus 75
structure length 220
sequence length 229
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hhtA00
3NH1A 2FBXA 3AVFA 3E01A 3P1GA 5DMRA 1UA1A 1NKEA 1NKCA 4B9SA 4FJGA 4K8XA 4J2DA 4EZ6A 4Q5VA 4LSNA 4FK0A 3VQ8A 1HQUA 1WSEA 3LWMA 3AO5A 4B9TA 2IDOA 2OPSA 1VSFA 5KGWA 3OYEA 1IKXA 3LP0A 4DTOA 3TI0A 2YV0X 1FKPA 1ZBLA 4E0DA 4FVMA 1CXUA 1KCFA 2O4IA 1T05A 3PX0A 4DQIA 3AO3A 1VSLA 3M8RA 2HVIA 4CK1A 4CJRA 2A1RA 4B08A 4ELVA 3ZSWA 3SUNA 3NF8A 4KPYA 4ID5A 3ZT1A 1VSDA 2JLEA 4DTSA 1WSGA 4FZXC 1CZ9A 4KO0A 1C0UA 4CIEA 4CEQA 1ZBHA 1DTQA 2Z1GA 4HUGA 2ETJA 2A1SA 3AVHA 3QIOA 3QO9A 4E7IA 1XHZA 4W5RA 2PZSA 4CJKA 4IKFA 4FM0A 4DQRA 2QXFA 1C1AA 1RBSA 2D0CA 2IOCA 3LP2A 3LP1A 1XWLA 5KI6A 3BDPA 3VQPA 4FJHA 1JXBA 1Y97A 4DFJA 1NK4A 3VQDA 4E89A 3HPGA 1X9MA 2G8VA 1I3AA 4QOZB 4OLBA 1IKYA 4BE1A 1RILA 3IAYA 3VQCA 4JRQA 3NHGA 3RMDA 1ASWA 5CZ1A 5CYMA 5HROA 1U4BA 4F3TA 4B8AB 3UIQA 4O55A 3SQ2A 1D9DA 4Z4GA 3SQ1A 5C24A 4RG8A 4E7LA 3CG7A 5HRRA 3RTVA 1CZBA 2GUIA 3V4IA 2Z1JA 3F73A 1GOBA 1RT3A 3ZT4A 4CK2A 4DTUA 3S3OA 3VA3A 4FW2A 1WSJA 4ID1A 4CEZA 5C42A 1J9AA 1NK5A 4DF8A 2HHQA 1TGOA 4E3SA 3AVBA 2HNZA 1VSMA 4OJRA 1BI4B 3ZSQA 2D0BA 3AA5X 3ZSOA 3CYMA 1GOAA 3IS9A 1NK9A 4B9UA 4E1MA 1RT5A 4CJSA 2HMIA 2KZZA 4BE0A 3ISNC 4CFAA 1TV6A 4LH5A 3CFRA 3V9UA 3O3FA 1L3VA 3PY8A 3HP9A 3HSTB 1JLAA 3AA3A 4CGGA 2O4GA 4PQUA 3L3UA 4FJIA 5KRSA 4RW4A 3NGYA 1K6YA 4Y1DA 2RN2A 3LPUA 3OYMA 4DS4A 4KHSA 1S1TA 1KVAA 3I0RA 1SL1A 4HCCA 4FZYA 4DSJA 3AVNA 1BI4A 1S5JA 3DRSA 3S3NA 2OPRA 1CXQA 5J2PA 3IG1A 3VQ9A 4K8ZA 5J2QA 4MFBA 4KI4A 1TAQA 3DYAA 3NF9A 4DQSA 4FLYA 2GBZA 4BDPA 3NBPA 4DWIA 4J2AA 3KKRA 3NE6A 4KRFA 4DQQA 3U6FA 1Z25A 4C8MA 2NUBA 1UOCA 4B9MA 3SNNA 3QEPA 4PY5A 3SYZA 4DFKA 4E7KA 1LWFA 1WAFA 4TSXA 2PY5A 2QK9A 3RMAA 4EP5A 1HYVA 4M3RA 3VQ6A 1O1WA 4CGDA 3QEXA 3OYDA 3L2RA 4Z4FA 2D5RA 3HXMA 2KZMA 3D45A 2IS3A 5SZTA 3MXMA 3LDSA 3TAQA 1CLQA 1REVA 1D8YA 4OGCA 2HHSA 1TKDA 3B6OA 3TARA 2D0AA 4FJ5A 4CJFA 1BIUA 1I39A 4CHNA 4CJUA 3SQ4A 1L3SA 1YT3A 3AA2A 3ITHA 4DS5A 3AA4A 4AHRA 1U48A 4BE2A 1RTDA 1YVUA 3QLHA 1RTHA 1BQMA 5HRPA 4ELTA 3F9KA 3M8QA 5CY4A 3SQ0A 4M42A 4CIFA 3OYHA 3MXIA 1S1UA 1KVBA 3SJJA 4FJMA 3ZCMA 2B6AA 1KVCA 4DSKA 4CE9A 4OGEA 2G8UA 4CHQA 3V81A 3OS2A 4O5BA 4H4OA 2XO7A 1WSIA 4CJEA 3DM2A 2KTQA 1B9DA 1JLQA 4CGFA 4KTQA 3PV8A 4DTNA 1L5UA 4Z4IA 1YTUA 3DLRA 3OS1A 1VSHA 3KD1E 1JLFA 2XY5A 4KKOA 2G8KA 1C6VA 2YNIA 4CJPA 3DLEA 1HNVA 4O0IA 1U47A 4NYNA 2YHBA 4CHOA 1ITGA 1D9FA 4EP4A 3OJUA 1RDCA 1TKXA 3PX6A 1HNIA 4PUOA 1NJYA 3HK2A 3DLGA 1RNHA 4CGHA 4NCGA 4KV8A 1LV5A 3SI6A 4RW8A 4JLHA 3RRHA 2OPPA 4AHUA 1IH7A 4E7HA 3HPOA 1BCOA 3LALA 1HYZA 3QNNA 3NF7A 3EYZA 3OYNA 1JLEA 1TAUA 1RT6A 3TABA 1RT1A 2F8SA 4JS5A 1N6QA 4FJXA 1N5YA 3VQQA 3MECA 4DTRA 4CEDA 4CCHA 3ALYA 3AVIA 4IBNA 3CQ8A 1BL3A 4Z0UA 2OZMA 1SKWA 3VQBA 3OYAA 3KLEA 1U45A 3AVAA 3NFAA 4LD0A 1NJWA 3WNFA 2YNGA 3O3HA 4W5OA 3QESA 3AO4A 4EZ9A 1RBUA 3K5OA 4AHSA 1TK0A 3MAQA 3V1QA 3HO1A 1NOYA 3TAMA 4M45A 2PYJA 4OKJA 5K14A 2VG5A 3L3VA 4CGJA 1WNSA 3O3GA 4CF2A 3K58A 4DLGA 1DLOA 4I9QA 3L2QA 1YTAA 1RDAA 1U49A 1SL2A 2G8WA 2PYLA 1S1VA 2IGIA 3KKSA 3LP3A 4R5PA 3EY1A 3THVA 1NK7A 1LW0A 2YKMA 4KHQA 4NCBA 3ZT0A 1QSSA 4C8OA 3NGIA 2HHUA 3VN5A 4FJ9A 2GV9A 2P5GA 5KTQA 2ATQA 4DSFA 4XIUA 4IDKA 1IO2A 1L3TA 3I8DA 3ZT3A 1D5AA 4CJWA 1MU2A 4DSLA 3OYGA 1QE1A 4CERA 4CESA 4CJQA 3T3FA 3CM6A 3DRRA 5I3UA 2HHWA 4I2PA 4FJ7A 1BIZA 2DFEA 4CECA 3KK1A 2XY8A 3DLHA 4OVLA 1KTQA 1RCHA 3TAEA 5I42A 4NCAA 4CHYA 2B4JA 1QHTA 3QEIA 4FJNA 2LSNA 1SKRA 4IFVA 2XRIA 1XHXA 3LPTA 3VQAA 2YNHA 3RMBA 4Q0BA 4GMJB 4M3YA 1X1PA 3M8PA 4G1QA 4ELUA 1SUQA 2HNDA 3JYTA 4CEAA 3KLHA 3SCXA 1S1WA 5HRNA 2HHTA 3C95A 1ASUA 4FLVA 4HHTA 5FDLA 3K5LA 1ZBIA 3L8BA 2DY4A 1ASVA 3O4NA 4IFYA 3K2PA 3LAKA 1R0AA 2E4LA 4OPKA 1C1BA 2YKNA 3PUFA 3FFIA 1C0TA 3AVJA 2F96A 3QERA 3RMCA 4CJTA 3QEWA 2DTUA 4FM2A 2XY7A 3TAPA 2HHVA 3HYFA 5J2MA 3OYJA 4FJ8A 2FBVA 3O4QA 3P83D 3RWUA 1RT7A 4BACA 3NDKA 5HLFA 3C94A 1RBTA 3AO1A 1RTJA 3DMJA 3BGRA 3K5MA 4BDZA 4DU4A 3C6UA 4CK3A 3NH0A 1VRTA 4PA1A 3AVGA 1FKOA 1KLNA 3K59A 3MXJA 1TK5A 1TK8A 1ZBFA 1LWCA 3L2VA 4N76A 4DG1A 1HPZA 1S6PA 1LAVA 4KTWA 4FLTA 3SUOA 1VSJA 4KFBA 4B9NA 2ITGA 3NCIA 4HVJA 4FLXA 1W9HA 1Z26A 4FLUA 3TAFA 3ZSVA 1JLGA 4M3WA 1NKBA 1UAXA 1NJZA 4UQGA 1TKZA 3PX4A 5D3GA 1JL2A 4YFUA 3L2UA 1S1XA 3EZ5A 1KSPA 4B9VA 1VSEA 4ZHRA 1FXXA 3OYBA 4Y1CA 4HUFA 3OS0A 3V9SA 2G8IA 1C0MA 4F3OA 1EKEA 3ZSRA 4KB0A 1HQEA 3DI6A 4M41A 1VRUA 4J2BA 4CF0A 3OY9A 3K5NA 1HJRA 2QKBA 4BWMA 1VSKA 3L2WA 2R7YA 1QSLA 3G0ZA 1RT2A 2KFNA 1A5XA 4O4GA 3LZIA 4CHZA 3V9ZA 2Y1IA 3SV3A 3C6TA 1WSFA 4NYFA 3OVNA 3P5JA 5DK5A 3VQEA 4AHTA 3QETA 2X78A 1VK0A 4LSLA 3V9XA 1WSHA 3T1AA 5HP1A 2RF2A 3HL8A 4OKKA 2BANA 1KLMA 2JGUA 2HB5A 5C25A 4PWDA 4AH9A 3B6PA 4CFDA 4DSEA 4FM1A 2BE2A 1SV5A 4WE1A 1RDDA 1TL3A 4N47A 2Q3SA 3HT3A 1X9SA 2G8HA 2VG6A 1NK0A 2DFFA 3KIOA 5HRSA 1UA0A 1KRPA 4KI6A 1JL1A 2IC3A 1SL0A 4FLZA 1IG9A 2FC0A 3HPHA 2X74A 5FROA 3OYKA 3KJVA 1IKWA 3OJSA 3KK2A 4N5SA 3NH2A 1RDBA 2P5OA 1IKVA 4LH4A 5SWMA 4DTPA 2G8FA 3ASMA 4DFPA 2XY6A 5CZ2A 1QSYA 4CEFA 4W5QA 5KGXA 4DSIA 2HW3A 1BCMA 3TWHA 4CFBA 3NAEA 3OYFA 1XC9A 4KB1A 3S9HA 2EHGA 1S9GA 2X6SA 3WNGA 3KK3A 2BDPA 3ZSYA 4FXDA 4H8KA 4JRPA 4DQPA 3HJFA 2OZSA 4RW6A 1HYSA 3QIPA 3IRXA 1JXEA 4KHWA 2Y1JA 3T19A 4E19A 3LAMA 3U3GA 3KLFA 4JS4A 1Q8IA 4GVMA 4HCBA 1QQCA 4AILC 2WOMA 3V1OA 1QTMA 2F8TA 3LANA 1GOCA 1JLCA 4E7JA 3AVLA 4N41A 4I9LA 4C8NA 1KFDA 2HVHA 4BDYA 4W5NA 2HNYA 2E6MA 4MQ3A 2KW4A 2KQ2A 2ZE2A 3SUPA 3CFPA 1JLBA 4KTZA 5KRTA 1XI1A 2FBYA 4Z4EA 1DTTA 2OYQA 1C1CA 4CEBA 5JS2A 4CJVA 5J1EA 1RT4A 2YHAA 4F2SA 3TAGA 1EXQA 2QKKA 3QEVA 3AVMA 4B8CA 5E41A 1JKHA 4I2QA 3DLBA 3DLKA 1T8EA 2IAJA 2XHBA 4IG3A 4FZZA 1TKTA 4CJ5A 4F8RA 4J2EA 3CM5A 1G15A 4RW7A 1WAJA 2X6NA 3SPYA 1EETA 3H08A 3RR8A 1S6QA 4AHVA 2EX3A 3SPZA 3TANA 3HVRA 2ZD1A 3VQ4A 1ZBUA 3KD5E 4FK2A 3MEDA 4AHCA 4B3OA 2AJQA 1SKSA 4C8KA 4LY7A 4DLEA 4ICLA 3PO5A 3I0SA 4FK4A 4L8RB 4FW1A 5EU7A 1HMVA 1EX4A 3KLGA 1WN7A 4DTXA 1NJXA 5FRNA 2P1JA 1TVRA 3AVKA 1NOZA 3K57A 1NK8A 3KTQA 4M3UA 4QAGA 2RPIA 4OPJA 3D0PA 3NGZA 2W42A 1TL1A 3VQ7A 3OYLA 2RKIA 2VWKA 4F4KA 2DFHA 2Z1HA 4BWJA 3KLIA 4KHYA 3V1RA 4O0JA 3ULDA 3RR7A 4B9LA 3AVCA 4KREA 1U04A 4FLWA 4CF9A 1S9EA 4DU3A 4CIGA 4F2RA 1Q9YA 3QINA 2VWJA 4HUEA 2Z1IA 3SV4A 1ZYQA 2BGGA 4CJLA 4OLAA 5HBMA 3HP6A 3ZT2A 1BISA 4I7FA 1BQNA 5FRMA 1RBRA 4KHNA 4CJ4A 4CGIA 1EP4A 4Z4HA 3CFOA 1A5WA 3SZ2A 2OPQA 4DFMA 2E6LA 5J2NA 4Z4CA 1HRHA 3WNHA 3ZSZA 4FCYA 1NK6A 1RTIA 4ZTJA 4O44A 3SUQA 1T03A 3PO4A 4DTJA 4DTMA 1A5VA 4YNQA 4DF4A 4M3XA 4CEEA 4KAZA 1RBVA 3A2FA 4H4MA 1X9WA 3AO2A 3G10A 1BGXT 3HM9A 5T7BA 2YNFA 1KFSA 4FJJA 3DRPA 3MEGA 4W5TA 3MEEA 3JSMA 4DMNA 4M3TA 3AV9A 1UWBA 5CYQA 2HHXA 3DOKA 3M8SA 2FBTA 1B92A 3U3YA 4N56A 3NF6A 4E1NA 4CF1A 4FJLA 3S3MA 1B9FA 5JS1A 3VA0A 4OKEA 4RW9A 2KFZA 1WLJA 4CF8A 4GW6A 3WNEA 4ZTFA 1L3UA 4IG0A 3VQ5A 3ZSXA 3DOLA 1W0HA 1BHLA 2ZQBA 3OYIA 1Q9XA 2OA8A 1F21A 1LWEA 2P51A 1FK9A 2VG7A 3HVTA 1VSIA 3OYCA 2I5JA 4CJ3A 3LWLA 4HTUA 4DU1A 2B5JA 4FYDA 1LW2A 4C8LA 3TR8A 1J54A 3LZJA 3QNOA 3RRGA 4QCLA 4FJKA 1J5OA 1LAWA 4CHPA 1QS4A 4KHUA 1J53A 1T7PA 3V6DA 4CFCA 2WONA 3V9WA 4CEOA 4M3ZA
chains in the Genus database with same CATH superfamily
2QWNA 2FBXA 1NKEA 4B9SA 4Q5VA 3VQ8A 3T7ZA 4CZGA 5HOOA 3O4WA 5KGWA 3RSEA 3D7EO 4IEEA 3LL3A 1T05A 3PX0A 1VSLA 3R3LA 3ATUA 5JICA 1K8AO 3ZSWA 4V19S 3ZT1A 1VSDA 3SAHA 1NWKA 4FZXC 3P38A 1C0UA 3EKSA 1ZBHA 1DTQA 4HUGA 2ETJA 2A1SA 4IOCL 4FOEA 4W5RA 4YOTA 4XEIA 1C1AA 1RBSA 1VQPN 3BZCA 1JXBA 1XQSC 3HPGA 1I3AA 4JKAA 1RILA 5LMUK 3VQCA 4DCHA 3W3DA 1J6ZA 3E9OA 4CZIA 4DV7K 5C24A 4RG8A 4E7LA 2YJFA 4JHDB 1CZBA 3V4IA 1GOBA 4DTUA 1WSJA 4CEZA 2HHQA 1J9AA 4DF8A 3AVBA 4X66K 3CYMA 1GOAA 4E1MA 2OTLN 4BE0A 3ISNC 5FLXO 4A2AA 4LH5A 3V9UA 1L3VA 2QWLA 3PY8A 5KRSA 4Y1DA 3F9MA 1X3NA 4Z94A 4GVEA 3S3NA 1CXQA 4MFBA 4DQSA 2GBZA 1NMDA 3U6FA 2NUBA 4B9MA 3FZLA 3SNNA 3QEPA 4PY5A 2UYTA 3C65A 3C7NB 3DJCA 4JKDA 1GLAG 3VQ6A 3J80O 3HXMA 2KZMA 3DLLL 3OBWA 1CLQA 3LDSA 5TKWA 4DKWA 2HHSA 3B6OA 2D0AA 3PIPL 3KWGA 4EHTA 4CJFA 3SQ4A 4DHYA 3AA2A 3WXIA 4AHRA 1U48A 1BU6O 1RTDA 4ELTA 1RTHA 4MLHA 3J7YP 3MWTA 2YX6A 3VPZA 4CIFA 3MXIA 4FJMA 3SJJA 2B6AA 3CCEN 3P4IA 3THWB 1WSIA 4CJEA 1S72N 4CGFA 3PV8A 1HNXK 3CJ9A 1QZ5A 1KXPA 4CJPA 4ILHA 3T1YK 3DLEA 4O0IA 4NYNA 1ITGA 1VQ8N 3OJUA 1RDCA 3KWIA 4PUOA 3ENBA 1NJYA 1KAZA 4NCGA 3EO3A 2OPPA 4AHUA 3T1HK 1HYZA 2F8SA 3Q7CA 3R6MA 4FJXA 2FXUA 2QXLA 4IBNA 1BL3A 5AJ3K 1SKWA 3VQBA 3ZEUB 1U45A 3NFAA 4FWOA 4MO5A 3PSIA 3K5OA 1ATSA 2UXCK 4CGJA 4JHDA 3L3VA 5EY4A 3UKRB 3PIOL 2PYLA 4C8OA 2HHUA 3NGIA 3VN5A 2P9PB 4H5RA 2ATQA 4YOWA 1IO2A 4JI4K 3I8DA 5AFUA 1VQ9N 1GLJO 4I6MB 3THXA 4CERA 3T3FA 3CM6A 3DRRA 4BC2A 3MWPA 1BIZA 5DM6L 3KK1A 1MA9B 3DLHA 3TAEA 1HKCA 4NCAA 4OPAA 2B4JA 4CHYA 2LSNA 2XRIA 1XHXA 4BR0A 3VQAA 4M3YA 2HNDA 3KLHA 1S1WA 2HHTA 3VGMA 4GKKK 4HHTA 3K5LA 3L4QA 2NRZA 3QERA 3PUFA 3AVJA 3FFIA 4IOXA 4NXMK 3RMCA 2DTUA 4FM2A 5J2MA 3P83D 2ZM6K 3RWUA 2FF3B 3SAGA 3NDKA 3ZX2A 4BACA 1RTJA 3S41A 3K5MA 3C6UA 5AQSA 1XMQK 3AVGA 5FPDA 1ZBFA 1LWCA 3L2VA 1HPZA 1S6PA 4ILGB 3HOTA 4KFBA 1O13A 2ITGA 3KHYA 3VEZA 1QVGM 2E2QA 3TAFA 5FPMA 4PKIA 4UQGA 1VAZA 4WYBA 3L2UA 2Q0RA 4DR5K 2W40A 4H0YB 5BPLA 3EN9A 4RCHA 4F3OA 1EKEA 1IJJA 3O8MA 1VRUA 1D4XA 2Q31A 5BR8K 1YJWN 4YOVA 1NGJA 4DV5K 2O8FB 4CZHA 4O4GA 4CHZA 3V9ZA 3C6TA 3P5JA 4OLAA 3QETA 3E9LA 2X78A 1VK0A 4LSLA 4XH4A 4OKKA 2E88A 1KLMA 3DXMA 5C25A 2ZJRL 4K0KK 5LJWA 4DR3K 1TL3A 2Q3SA 3O9TA 1NK0A 1KRPA 5HRSA 3H3OB 1JL1A 2IC3A 1NU0A 3TSQA 3SLCA 3KK2A 4N5SA 2P5OA 1ILYA 4DTPA 3ASMA 5AQTA 4DFPA 3A8YA 2KLAA 3TSPA 5KGXA 1BCMA 4DB3A 3D2EA 4L3QA 4DQPA 4DV3K 3CCQN 4JI2K 4BR9A 1BO5O 2Y1JA 4E19A 2A40A 2IVNA 3LAMA 5KPZA 1Q8IA 2GEMA 4GVMA 4LC9B 2WOMA 4AM6A 1HX1A 4A59A 4CZMA 1GLCG 4BDYA 4W5NA 2E6MA 1IG8A 5C15A 1HKBA 4JD2B 3OBYA 1DEJA 5GADP 2YHAA 1EXQA 4B1YB 3DAWA 2IAJA 4DUYK 4IG3A 4JKFA 3SMPA 4PKGA 4CJ5A 4CZJA 4RW7A 1N36K 1QQMA 3SPYA 1QVFM 4IWVA 1DGKN 2EX3A 3WQTA 3WXKA 2AJQA 1SS6A 4NO7A 4C8KA 3GG4A 2HMPA 3CCJN 5EU7A 2PBDA 1NJXA 4DTXA 4M7XA 2P1JA 1TVRA 3AVKA 3KTQA 4M3UA 4M63C 4OPJA 3D0PA 3NGZA 3VQ7A 5AQHA 1XNRK 4H03B 4KHYA 3IDHA 2O8EA 4B9LA 4KREA 3BUZB 1S9EA 2Z1IA 1N8RO 3LDNA 5AZIB 3CJAA 4DR2K 4CGIA 1TYQA 4DFMA 1YIJN 2E6LA 5J2NA 5BR9A 1RDUA 4FCYA 1T03A 5LL6Z 1FW6A 4H4MA 2CGJA 2WC9A 1BGXT 2P9IA 3MEGA 4W5TA 4YOYA 2E2PA 3M8SA 2FBTA 4JI8K 3U3YA 4N56A 5M1KA 5JLFA 3F5TA 3M5RA 4RW9A 5C2DA 3H6EA 1WLJA 4GW6A 2CGKA 2D4WA 2HF3A 3MCAB 3DOLA 1F21A 2VCPA 1VSIA 4HTUA 2I5JA 4DU1A 4FYDA 2V52B 3TR8A 3TPQA 4WQ4C 4C23A 1J53A 3V6DA 4B1ZA 1VQ4N 1ZC6A 1NKCA 3P1GA 4IO8A 2NRHA 3H3NO 4J2DA 5GAEP 3HRGA 1WSEA 3A5LC 4QS9A 3OYEA 4DTOA 3TI0A 1ZBLA 1FKPA 5CE3A 4FVMA 2O4IA 4DQIA 4GKJK 3AO3A 1EWQA 2ZJPL 3DWLA 3VEOA 5AQMA 5CHIA 1WSGA 4FWRA 3I55N 4OPHA 2QEXN 4JNEA 4RTFD 2PZSA 3QIOA 1HPMA 4O8UA 4IXCA 2O8CB 4JEPA 3I56N 2D0CA 3MX2A 5KI6A 3VQPA 1Y97A 4E89A 2G8VA 1ZXOA 1IKYA 5HROA 1HR0K 1WOQA 1D9DA 4JKEA 3Q7BA 3CG7A 2Z1JA 2FSJA 5KPRA 1RT3A 3F73A 1ZBSA 1GLEG 1MDUB 2NRVA 4FW2A 4ID1A 5C42A 3JS6A 4E3SA 4PHTX 1VSMA 2FSKA 1ATNA 1NK9A 1E3MA 3CJBA 4KH6A 2OCEA 4CJSA 3THWA 2VYPA 5EXWA 4OO1J 3CFRA 2F7TA 4CGGA 4FJIA 1NGHA 4BROA 4GNIA 1K6YA 4KHSA 2RN2A 3VENA 1S5JA 2OPRA 5J2PA 4DR7K 3IG1A 1TAQA 1XUPO 4FLYA 1YI2N 4AQYK 1ATRA 3KKRA 3NE6A 4KRFA 1Z25A 3EE8A 1UOCA 2GWJA 3C7NA 3CXCM 2A42A 4TSXA 2QK9A 3RMAA 4JI6K 4M3RA 4Z4FA 4DV6K 2D5RA 2IS3A 5SZTA 1REVA 4OGCA 1TKDA 1NMNA 3ENOA 3TARA 1BIUA 4CJUA 2HHHK 1L3SA 5C10A 1YT3A 3ITHA 4DR4K 3ZETA 3QLHA 3F9KA 3M8QA 2GX9A 4BRHA 1R59O 3ZCMA 4CHQA 3V81A 3N4QA 2XO7A 3DM2A 1B9DA 5ELZA 4DTNA 4ISGA 1YTUA 3DLRA 3OS1A 2P9UA 4C1NK 3FE1A 4KKOA 2G8KA 3AAPA 4LFAK 3L0QA 4EIAA 4K42A 3ZX3A 2F9WA 4CGHA 1LV5A 3SI6A 4JLHA 4JKBA 4JI1K 3QNNA 1JLEA 4H5NA 3F2KA 3VQQA 4K41A 3VEVA 3AVIA 5LJVA 3KLEA 2YNGA 5AQLA 4W5OA 3O3HA 3QESA 3AO4A 4AHSA 3CI5A 1OH6A 3LDOA 3FR0A 5HL7L 2V7YA 3TAMA 3OA9A 4M45A 2PYJA 4OKJA 3O3GA 2VG5A 4DQ8A 4DLGA 3L2QA 1YTAA 1RDAA 2G8WA 4M3TA 4R5PA 1YITN 3LP3A 1NK7A 1RDWX 4IJAA 1HUXA 4FJ9A 2GV9A 2P5GA 5KTQA 4DSFA 3G4SN 4A5AA 1WBDA 4DSLA 1QE1A 1WB9A 2NLXA 2HHWA 4I2PA 4FJ7A 2DFEA 4OVLA 1H1VA 1QHTA 4WQ5A 4AM7A 4IFVA 1KAYA 4H5WA 1T6DA 4Q0BA 4G1QA 2W6LA 4ELUA 5BRFA 3JYTA 3VF4A 5HRNA 3K9JA 1ZBIA 1YF5L 4IFYA 2DPNA 4OPKA 1J5EK 2RE2A 4CJTA 4H0PA 3QEWA 2XY7A 3TAPA 3KZBA 3HYFA 4FJ8A 1EWRA 4H0OA 1OH7A 4BRAA 5HLFA 3C94A 2ASMA 1RBTA 3BEXA 3BGRA 4BDZA 3HBTA 1K8KB 2OTJN 3EE9A 5LY3A 3R9PA 4EHUA 3MMVA 1FKOA 1KLNA 5BRDA 3MXJA 1TK5A 2QWRA 5GAGP 3GDQA 2E5LK 4N76A 4KTWA 4FLTA 3SUOA 1NGEA 1Z26A 4ILJA 4FLUA 4M3WA 3VETA 4BRDA 1NKBA 1NJZA 3J8AA 3O1BA 5D3GA 1KSPA 2PAVA 3EZ5A 4B1XB 4HUFA 1I94K 5IT9O 1HQEA 3DI6A 3THXB 1JCFA 4CF0A 3OY9A 3K5NA 2O8CA 1VSKA 1QSLA 3U4LA 3G0ZA 4BRKA 4DUZK 1RT2A 4CI6A 1RFQA 4WQ4A 1VQON 1WSFA 3CJCA 4NYFA 3OVNA 4I6MA 5HP1A 1WSHA 3T1AA 5KQDA 3HL8A 1BOTO 3MN6A 2JGUA 1BDGA 4KHPK 3A0IX 2BE2A 2O8DA 1RDDA 3HT3A 2HBLA 2O8EB 1Z05A 2X74A 5FROA 3UKUA 3J7AP 3OJSA 3NH2A 4LH4A 3TTFA 3N4PA 4CEFA 4ISEA 4W5QA 2HW3A 3J7ZO 3TWHA 4CFBA 1XC9A 5C0YA 2EHGA 2X6SA 4BRCA 4FXDA 3HJFA 4LFCK 1HYSA 3QIPA 2A41A 1JXEA 1Q7YO 4KHWA 3T19A 3U3GA 2QM1A 3V1OA 1QTMA 2F8TA 3LANA 2D1KA 4CVNE 4E7JA 1VQMN 4I9LA 1NNEA 5AQPA 2FLOA 2HNYA 4MQ3A 2KW4A 1EO1A 3BP8A 2FBYA 3LDLA 5EOYA 1DTTA 4CJ7A 3THYA 1C1CA 2OYQA 5BN9A 5J1EA 3MN7A 1C0GA 3KVGA 4F2SA 3QEVA 5E41A 1JKHA 1M90O 1T8EA 3HZ6A 3QMLA 1TKTA 1G15A 3ID8A 4BRQA 2X6NA 1EETA 3JAMO 3NVKA 1S6QA 3SPZA 3TANA 3MEDA 4B3OA 4LY7A 4DLEA 4ICLA 3UKRA 3I0SA 3VESA 4FW1A 1HMVA 1ESVA 3K57A 3HSCA 2YCHA 3A5NC 3EKUA 3CCRN 4A62A 2VWKA 1Q86O 4BWJA 4JI3K 3RR7A 3AVCA 1U04A 4FLWA 3QBXA 4HUEA 2BGGA 4E1JA 5HBMA 3ZT2A 1BQNA 1RBRA 4CJ4A 1EP4A 3SZ2A 4YORA 5M1OA 1VQKN 4Z4CA 1NGGA 3WNHA 1NK6A 4FVUA 1RTIA 4ZTJA 4KBOA 1K8KA 4DTJA 2D0OA 4MO4A 4DTMA 1A5VA 4EAHD 4KAZA 1RBVA 4WFBL 4HWIA 2UU9K 3HM9A 3P31A 5T7BA 2YNFA 3CJ7A 2NRWA 1NGBA 4GV3A 3MEEA 5AQGA 3AV9A 4FOIA 1YXQA 2KFZA 4MDAA 4JYAK 1WBBA 4ZTFA 4IDHA 1L3UA 4IG0A 3VQ5A 1C0FA 1W0HA 1BHLA 3MN5A 3OYIA 2YI1A 4JKCA 1U49A 2VG7A 5AR0A 4CJ3A 3ATVA 3D2EB 4C8LA 3QNOA 3LZJA 4LFBK 1J5OA 4CHPA 1QS4A 2AA4A 5AQXA 2ASPA 4KHUA 2UUBK 3MN9A 4PKHA 1T7PA 2WONA 4LF4K 5DMRA 4K8XA 3O6WA 4FWNA 1QQNA 4LSNA 3LWMA 3W0LA 3AO5A 4B9TA 2IDOA 2OPSA 1IKXA 4E0DA 2GWKA 1CXUA 4NLBA 3M8RA 2J4RA 4CJRA 2A1RA 3SUNA 1YVNA 2E1ZA 2JLEA 5TKYA 4JI5K 3CJ1A 3FZFA 4CEQA 3DXKB 3AVHA 3QO9A 4E7IA 4CJKA 4IKFA 2QXFA 3LP1A 2IOCA 1XWLA 2HF4A 3IKMA 4BRGA 3BDPA 4FJHA 1NK4A 4DFJA 3VQDA 1S3XA 3HTVA 4LF8K 5JMVA 3CIPA 4JRQA 3NHGA 3OW2M 3RMDA 1ASWA 3MCPA 5CZ1A 4RWTA 4F3TA 3UIQA 3SQ2A 3I8BA 3CC7N 2GTDA 5AQWA 2Q2RA 3E1YA 4IEIA 3ZT4A 4FPBA 4CBUA 5M1FA 4G9ZA 1NK5A 1TGOA 2HNZA 1BI4B 2D0BA 5AQZA 3IS9A 2HMIA 4CFAA 2NRXA 1JCGA 3O3FA 3HP9A 3HSTB 3AA3A 3CCLN 4O8KA 2QWMA 4A2BA 1IBMK 4PQUA 4RW4A 3NGYA 4DS4A 1S1TA 3AGRA 5I9EB 4FZYA 4DSJA 2KKZA 1IBKK 4IO9L 1QZ6A 2OANA 3A5OC 1MWKA 1JJ2M 4K8ZA 1YJNN 4CZLA 5J2QA 2HOEA 3NF9A 2I7NA 1IV0A 2ASOA 4A57A 3SYZA 4GY2B 1LWFA 1WAFA 1W97L 1M1KO 1HYVA 4XH5A 3VEXA 4YHHK 1O1WA 2V7ZA 4CBWA 4B1UB 3OYDA 2E1YA 3C6AA 3GL1A 1D8YA 3TTDA 3QB0A 4FJ5A 1I39A 3BZKA 4CHNA 4DS5A 4XH1A 4BE2A 1YVUA 5CY4A 4M42A 3OYHA 3OTOK 1S1UA 4OGEA 2G8UA 1W7AA 2KTQA 3LDQA 4KTQA 3O9RA 2YHYA 3CCMN 2NRTA 1L5UA 4KH5A 1VSHA 4BQLA 1C6VA 1NBWA 1HNVA 1U47A 3WT0A 4EFHA 4CHOA 5IWAK 4EP4A 3PX6A 1HNIA 2F9TA 3DLGA 4H0VB 4KV8A 3CC2N 2E20A 4E7HA 1BCOA 3LALA 3VOVA 1IBLK 1TAUA 3EEQA 3TABA 1RT1A 5FPNA 3ID6A 5E84A 5AQOA 1N5YA 3VEWA 1S22A 4CCHA 4CEDA 1LOTB 5CR4A 3LDPA 3CQ8A 1OH5A 1MWMA 4Z0UA 3O80A 3OYAA 3AVAA 4LD0A 1NJWA 3WNFA 3G25A 2CH6A 3CMAN 3VTHA 3UB5A 1TK0A 3HO1A 1NOYA 1U2VA 5K14A 4I9QA 3VF6A 1S1VA 1LW0A 1P8ZA 2YKMA 5F0XA 4O5FA 1Q82O 3MDQA 4IJNA 1TUUA 4CJWA 1MU2A 1HNWK 1OVQA 3VERA 5I3UA 4CECA 1KTQA 2WTUA 3QEIA 4FJNA 1SKRA 3CETA 3O1WA 2P9KA 4BRNA 2YNHA 3WEEA 3PLAA 2NZTA 1SUQA 3CCVN 2IVOA 3C95A 1ASUA 3L8BA 1ASVA 3LM9A 3O4NA 4FWPA 3DXMB 3K2PA 3LAKA 2E4LA 2F96A 3CCUN 4FL9A 3WEEB 2P9KB 2HHVA 3L4IA 3O4QA 1RT7A 3DMJA 4B9QA 3NH0A 1VRTA 3VF2A 5AZJA 4BRFA 1E4GT 3AAQA 3K59A 4NB4A 5JLHA 4BREA 4B3TK 1VSJA 5A2QO 2P9LA 4FWSA 3NCIA 1W9HA 3AGKA 5H1SQ 3H45C 3I33A 3ZSVA 1JLGA 4JAXA 3SJHA 2NNWA 1TKZA 1JL2A 1S1XA 4ZHRA 1FXXA 1NJIO 4BRMA 1C0MA 4BC4A 5JVHL 4UY8O 3OHRA 1GLLO 4M41A 3FGUA 1HJRA 2QKBA 1VHXA 3WUHA 3CQXA 4AF1A 2CGLA 2CH5A 2D0PA 3FFKB 1DT9A 3H46O 4AHTA 3R8EA 4H0XB 5KQ8A 1N33K 3CCSN 4NXNK 3ULEA 4WCEL 1X9JA 4PWDA 4AH9A 3B6PA 4DSEA 5GINA 1SV5A 4WE1A 4N47A 1X9SA 2DFFA 1UA0A 4KI6A 4BR4A 1Q81O 4FLZA 1IG9A 2FC0A 2VQFK 2W41A 3CF5L 1IKWA 2UXDK 1RDBA 3ULEB 4BG9A 1LCUA 5SWMA 5GIOA 2XY6A 5CZ2A 1QSYA 4DSIA 1VQLN 4KB1A 3S9HA 1S9GA 3ZSYA 4JRPA 2OZSA 4RW6A 1QQCA 5E26A 1JLCA 4N41A 4C8NA 1KFDA 2HVHA 2ZE2A 2VQEK 3SUPA 3CFPA 4KTZA 4BRLA 4BR2A 4WFNL 2VWBA 3THYB 1HLUA 5JS2A 4CJVA 1NGAA 2Q36A 3VGKA 1T6CA 2QKKA 4CZFA 4I2QA 3DLKA 3CM5A 3H08A 4M7YA 3VTIA 3D2FB 3RR8A 3WQUA 4AHVA 3HVRA 2ZD1A 4FK2A 1ZBUA 3ZYYX 4YDUC 4F9OA 4FK4A 5B8HA 3KLGA 3ZX0A 5M1QA 1NK8A 4CW7B 2RPIA 4IOAL 3CERA 3VEYA 4F4KA 2DFHA 1KC8O 2HBJA 3V1RA 4O0JA 2O8BB 2ZJQL 4F2RA 3CMEN 1Q9YA 1YJ9N 2VWJA 4CJLA 3TU5A 4DV2K 5FRMA 1BISA 3NVMA 3IFRA 1GLBG 4JK7A 4KHNA 5AQYA 1A5WA 2OPQA 3AARA 4MDBA 3ZSZA 2A6AA 3SUQA 3FZHA 3PO4A 3TTCA 3QDKA 4M3XA 4JV5K 2QW9A 1KFSA 4FJJA 2GELA 4X64K 4JKGB 1YUWA 5CYQA 2HHXA 3DOKA 3HOSA 3NF6A 1RGIA 3FZMA 4YDUA 3ZEUA 3S3MA 1B9FA 2UUCK 1U6ZA 5JS1A 4OKEA 4OX9K 2GUPA 4CF8A 4LF7K 3ENHA 3WNEA 3ZSXA 5F1XA 1Q9XA 2ZQBA 4A61A 2OA8A 5AQVA 1FK9A 3VMFB 3LWLA 2B5JA 3RRGA 3U9DA 2BTFA 4QCLA 4FJKA 1LAWA 1NGIA 4CZEA 1KAXA 1T3VA 3H1VX 5LMNK 1OH8A 4CFCA 3V9WA 3O9SA 3NH1A 1NGDA 3AVFA 3E01A 1UA1A 4FJGA 3UKUB 4EZ6A 4FK0A 2A5XA 1HQUA 1BG3A 1KQSM 1VSFA 3LP0A 4GV9A 2YV0X 4JKHA 1KCFA 3O5BA 1CZAN 2HVIA 4CK1A 4B08A 4ELVA 4KPYA 1DKGD 3NF8A 4ID5A 4DTSA 1CZ9A 4KO0A 5AZJB 4CIEA 2Q97A 2Z1GA 1SZ2A 1XHZA 1N34K 2QTDA 4FM0A 2E8AA 3SBTA 4DQRA 3LP2A 4ISFA 4CZKA 3JXUA 1X9MA 3LM2A 4QOZB 4OLBA 2BH1A 4BE1A 3IAYA 2HBKA 3O08A 5AQQA 1U4BA 5CYMA 1Y64A 2P9SA 2JWKA 4B8AB 4O55A 1VQNN 2QWOA 1Z6RA 2ITMA 4JKGA 4Z4GA 1HJOA 3SQ1A 5HRRA 3RTVA 2GUIA 3U9ZA 2YJEA 4CK2A 3S3OA 3VA3A 5AQJA 4BG8A 3HI0A 4OJRA 3ZSQA 3AA5X 3ZSOA 4B9UA 2ZGYA 3QFPA 4WQ5C 1RT5A 2KZZA 1TV6A 1TYQB 2BUPA 1JLAA 5KPTA 4JI0K 4DR6K 2O4GA 3L3UA 3OYMA 3LPUA 1KVAA 3I0RA 1SL1A 4HCCA 4WF9L 1K73O 3AVNA 1BI4A 2QA4N 3DRSA 2IIRA 2O8DB 3VQ9A 4YY3K 4KI4A 1FJGK 3DYAA 4K25A 4BDPA 3NBPA 4BR5A 4DWIA 4J2AA 4DQQA 4MLEA 4X65K 4C8MA 3GE1A 3BF3A 3QBWA 3VGLA 4DFKA 4E7KA 3HM8A 4PL8A 2PY5A 4EP5A 4CGDA 2ZWHA 3DXKA 3QEXA 3L2RA 3D45A 3MXMA 3TAQA 1YHQN 3UE5A 3WXJA 3AA4A 2IVPA 1BQMA 1BUPA 5HRPA 3SQ0A 2F4VK 2H3GX 2A3ZA 1KVBA 1KVCA 4DSKA 4CE9A 3OS2A 4U7BA 4O5BA 4H4OA 3K0SA 4A5BA 2QI2A 1JLQA 5AQUA 4Z4IA 5M1PA 3KD1E 2VGMA 1JLFA 3P39A 2XY5A 2YNIA 2YHBA 1D9FA 4JN4A 2FF6A 1V4SA 1QQOA 1TKXA 1P90A 3GOIA 4QS7A 1Q18A 3HK2A 2AP1A 1BWFO 1RNHA 1EQYA 4RW8A 1QHAA 3R1XA 4H5VA 4BVOA 3RRHA 4BGAA 3CQYA 1IH7A 3HPOA 2YHWA 4JK9A 3NF7A 3EYZA 3OYNA 1RT6A 1X3MA 4JS5A 1N6QA 3MECA 3G6EN 4DTRA 3M3ZA 3ALYA 3B8AX 2RHKA 3WXMB 2OZMA 4FWKA 4IZ9A 1XC3A 4EZ9A 2EWSA 1RBUA 1G99A 2VGNA 3MAQA 3V1QA 2UXBK 3K58A 1WNSA 4CF2A 1DLOA 1SL2A 2IGIA 3EL2A 3KKSA 3EY1A 3THVA 4KHQA 4NCBA 4J8FA 1N32K 3TSUA 3ZT0A 1QSSA 3D2FA 4XIUA 4IDKA 1L3TA 1KD1O 2QWPA 3ZT3A 1D5AA 3QFUA 3OYGA 4CJQA 4CESA 3PSFA 5AQIA 4LF5K 4DV4K 1XMOK 2XY8A 1RCHA 5I42A 3CPEA 4B1VA 1SAZA 3LPTA 5BN8A 4GMJB 1X1PA 3M8PA 3SK3A 1K9MO 4LF9K 4CEAA 5AQNA 3SCXA 2I7PA 2DY4A 4FLVA 4IFEA 5FDLA 5JVGL 3M1FA 1R0AA 1WUAA 1C1BA 2YKNA 1C0TA 5BREA 2PFUA 1SQKA 4BQZA 3QICA 3OYJA 3CD6N 4DV0K 2FBVA 1GLDG 3IMXA 3AO1A 1XNQK 4DU4A 1YAGA 4CK3A 4PA1A 2KHOA 5AQFA 4JK8A 4U67L 1TK8A 3K9KA 4DG1A 1HNZK 1LAVA 3MK6A 4B3MK 4BRIA 4B9NA 4BY9C 4HVJA 4FLXA 1TUYA 1UAXA 2P9SB 3AY9A 3BY5A 3M6GA 3PX4A 4YFUA 2P9NB 4FO0A 4B9VA 1VSEA 5AFUH 4C1NI 5FPEA 3OYBA 1NLVA 4Y1CA 3V9SA 3OS0A 2Q0UA 2G8IA 3O9QA 1NM1A 1V4TA 3ZSRA 4Y0WA 3E9PA 4KB0A 4FPAA 4J2BA 3E66A 1VQ5N 3NMUA 5EX5A 4BWMA 3L2WA 5MLCQ 2R7YA 2O8FA 5AQKA 2KFNA 1A5XA 3LZIA 2Y1IA 3U8XA 1BA0A 3C6HA 3SV3A 4FSVA 1W2BM 3RMBA 3VQEA 5DK5A 3V9XA 1NG9A 2RF2A 2BANA 2HB5A 4WFAL 4CFDA 4FM1A 4CD3A 3FLCO 4BRPA 2G8HA 1T44A 2VG6A 3CHWA 3KIOA 1SL0A 3CPWM 3ZLJA 3HPHA 3OYKA 3KJVA 2P9UB 5BPNA 1IKVA 2E2NA 2G8FA 2FSNA 3NAEA 4BC3A 3OYFA 1NGFA 5EVZA 4KH4A 3WNGA 3KK3A 4FWQA 2BDPA 4H8KA 4FWMA 3IRXA 1HKGA 2WUSA 3ZETB 3SAFA 3KLFA 5GAHP 4JS4A 4HCBA 4CBXA 4AILC 3EZWA 1GOCA 3AVLA 4PL7A 3RSEB 5GIPA 5C12A 2KQ2A 3IUCA 1JLBA 1XI1A 3KK7A 5KRTA 2UUAK 3C0BA 4B3SK 4Z4EA 1VQ6N 4CEBA 2Q1NA 3FZKA 1RT4A 1JCEA 3TAGA 4JI7K 1OVYA 3AVMA 4B8CA 5C2FA 3H1QA 3DLBA 2HBMA 2XHBA 4FZZA 4YOXA 4DR1K 4F8RA 4J2EA 2YHXA 5ADXA 1WAJA 4QS8A 5BRHA 2P9PA 3J81O 5AZIA 3KD5E 3VQ4A 4CD1A 4AHCA 1SKSA 4DV1K 3PO5A 4L8RB 2O8BA 5DM7L 5FRNA 1EX4A 1WN7A 1U2VB 2ZF5O 4H0TB 4GV6A 1NOZA 2W6KA 4B1WB 4QAGA 2E2OA 2W42A 1TL1A 4BGBA 3OYLA 2RKIA 2Z1HA 3KLIA 4BVPA 2P9NA 2QWQA 3ULDA 3A5MC 4DU3A 1E4FT 4CF9A 4CIGA 4BR7A 3QINA 1ZYQA 3SV4A 4LF6K 2WBNA 3HP6A 4I7FA 1OKJA 4Z4HA 1GLFO 3CC4N 3CFOA 2V51B 3L6QA 4X62K 5BPMA 1HRHA 3O9UA 4B3RK 1NGCA 4O44A 4BC5A 4NLCA 2WFBA 5M1NA 4HTLA 4YNQA 4DF4A 1BA1A 4CEEA 3A2FA 1X9WA 3AO2A 4JD2A 3G10A 2P9IB 5AQRA 3DRPA 3D6RA 3JSMA 3GBTA 4FWLA 4DMNA 3G71N 1UWBA 2NRRA 1B92A 4K43A 4E1NA 4YOUA 4CF1A 4FJLA 3WXLA 3VA0A 5F2RA 5ADXH 4R79A 4H5TA 3SBGA 3SMSA 2P9LB 2HSTA 1LWEA 2P51A 3HVTA 3OYCA 1VQ7N 1LW2A 3RVCA 1J54A 3BF1A 3MX5A 3T69A 2JWLA 2ZGZA 4CEOA 4M3ZA
chains in the Genus database with same CATH topology
3NH1A 2FBXA 3AVFA 3E01A 3P1GA 5DMRA 1UA1A 1NKEA 1NKCA 4B9SA 4FJGA 4K8XA 4J2DA 4EZ6A 4Q5VA 4LSNA 4FK0A 3VQ8A 1HQUA 1WSEA 3LWMA 3AO5A 4B9TA 2IDOA 2OPSA 1VSFA 5KGWA 3OYEA 1IKXA 3LP0A 4DTOA 3TI0A 2YV0X 1FKPA 1ZBLA 4E0DA 4FVMA 1CXUA 1KCFA 2O4IA 1T05A 3PX0A 4DQIA 3AO3A 1VSLA 3M8RA 2HVIA 4CK1A 4CJRA 2A1RA 4B08A 4ELVA 3ZSWA 3SUNA 3NF8A 4KPYA 4ID5A 3ZT1A 1VSDA 2JLEA 4DTSA 1WSGA 4FZXC 1CZ9A 4KO0A 1C0UA 4CIEA 4CEQA 1ZBHA 1DTQA 2Z1GA 4HUGA 2ETJA 2A1SA 3AVHA 3QIOA 3QO9A 4E7IA 1XHZA 4W5RA 2PZSA 4CJKA 4IKFA 4FM0A 4DQRA 2QXFA 1C1AA 1RBSA 2D0CA 2IOCA 3LP2A 3LP1A 1XWLA 5KI6A 3BDPA 3VQPA 4FJHA 1JXBA 1Y97A 4DFJA 1NK4A 3VQDA 4E89A 3HPGA 1X9MA 2G8VA 1I3AA 4QOZB 4OLBA 1IKYA 4BE1A 1RILA 3IAYA 3VQCA 4JRQA 3NHGA 3RMDA 1ASWA 5CZ1A 5CYMA 5HROA 1U4BA 4F3TA 4B8AB 3UIQA 4O55A 3SQ2A 1D9DA 4Z4GA 3SQ1A 5C24A 4RG8A 4E7LA 3CG7A 5HRRA 3RTVA 1CZBA 2GUIA 3V4IA 2Z1JA 3F73A 1GOBA 1RT3A 3ZT4A 4CK2A 4DTUA 3S3OA 3VA3A 4FW2A 1WSJA 4ID1A 4CEZA 5C42A 1J9AA 1NK5A 4DF8A 2HHQA 1TGOA 4E3SA 3AVBA 2HNZA 1VSMA 4OJRA 1BI4B 3ZSQA 2D0BA 3AA5X 3ZSOA 3CYMA 1GOAA 3IS9A 1NK9A 4B9UA 4E1MA 1RT5A 4CJSA 2HMIA 2KZZA 4BE0A 3ISNC 4CFAA 1TV6A 4LH5A 3CFRA 3V9UA 3O3FA 1L3VA 3PY8A 3HP9A 3HSTB 1JLAA 3AA3A 4CGGA 2O4GA 4PQUA 3L3UA 4FJIA 5KRSA 4RW4A 3NGYA 1K6YA 4Y1DA 2RN2A 3LPUA 3OYMA 4DS4A 4KHSA 1S1TA 1KVAA 3I0RA 1SL1A 4HCCA 4FZYA 4DSJA 3AVNA 1BI4A 1S5JA 3DRSA 3S3NA 2OPRA 1CXQA 5J2PA 3IG1A 3VQ9A 4K8ZA 5J2QA 4MFBA 4KI4A 1TAQA 3DYAA 3NF9A 4DQSA 4FLYA 2GBZA 4BDPA 3NBPA 4DWIA 4J2AA 3KKRA 3NE6A 4KRFA 4DQQA 3U6FA 1Z25A 4C8MA 2NUBA 1UOCA 4B9MA 3SNNA 3QEPA 4PY5A 3SYZA 4DFKA 4E7KA 1LWFA 1WAFA 4TSXA 2PY5A 2QK9A 3RMAA 4EP5A 1HYVA 4M3RA 3VQ6A 1O1WA 4CGDA 3QEXA 3OYDA 3L2RA 4Z4FA 2D5RA 3HXMA 2KZMA 3D45A 2IS3A 5SZTA 3MXMA 3LDSA 3TAQA 1CLQA 1REVA 1D8YA 4OGCA 2HHSA 1TKDA 3B6OA 3TARA 2D0AA 4FJ5A 4CJFA 1BIUA 1I39A 4CHNA 4CJUA 3SQ4A 1L3SA 1YT3A 3AA2A 3ITHA 4DS5A 3AA4A 4AHRA 1U48A 4BE2A 1RTDA 1YVUA 3QLHA 1RTHA 1BQMA 5HRPA 4ELTA 3F9KA 3M8QA 5CY4A 3SQ0A 4M42A 4CIFA 3OYHA 3MXIA 1S1UA 1KVBA 3SJJA 4FJMA 3ZCMA 2B6AA 1KVCA 4DSKA 4CE9A 4OGEA 2G8UA 4CHQA 3V81A 3OS2A 4O5BA 4H4OA 2XO7A 1WSIA 4CJEA 3DM2A 2KTQA 1B9DA 1JLQA 4CGFA 4KTQA 3PV8A 4DTNA 1L5UA 4Z4IA 1YTUA 3DLRA 3OS1A 1VSHA 3KD1E 1JLFA 2XY5A 4KKOA 2G8KA 1C6VA 2YNIA 4CJPA 3DLEA 1HNVA 4O0IA 1U47A 4NYNA 2YHBA 4CHOA 1ITGA 1D9FA 4EP4A 3OJUA 1RDCA 1TKXA 3PX6A 1HNIA 4PUOA 1NJYA 3HK2A 3DLGA 1RNHA 4CGHA 4NCGA 4KV8A 1LV5A 3SI6A 4RW8A 4JLHA 3RRHA 2OPPA 4AHUA 1IH7A 4E7HA 3HPOA 1BCOA 3LALA 1HYZA 3QNNA 3NF7A 3EYZA 3OYNA 1JLEA 1TAUA 1RT6A 3TABA 1RT1A 2F8SA 4JS5A 1N6QA 4FJXA 1N5YA 3VQQA 3MECA 4DTRA 4CEDA 4CCHA 3ALYA 3AVIA 4IBNA 3CQ8A 1BL3A 4Z0UA 2OZMA 1SKWA 3VQBA 3OYAA 3KLEA 1U45A 3AVAA 3NFAA 4LD0A 1NJWA 3WNFA 2YNGA 3O3HA 4W5OA 3QESA 3AO4A 4EZ9A 1RBUA 3K5OA 4AHSA 1TK0A 3MAQA 3V1QA 3HO1A 1NOYA 3TAMA 4M45A 2PYJA 4OKJA 5K14A 2VG5A 3L3VA 4CGJA 1WNSA 3O3GA 4CF2A 3K58A 4DLGA 1DLOA 4I9QA 3L2QA 1YTAA 1RDAA 1U49A 1SL2A 2G8WA 2PYLA 1S1VA 2IGIA 3KKSA 3LP3A 4R5PA 3EY1A 3THVA 1NK7A 1LW0A 2YKMA 4KHQA 4NCBA 3ZT0A 1QSSA 4C8OA 3NGIA 2HHUA 3VN5A 4FJ9A 2GV9A 2P5GA 5KTQA 2ATQA 4DSFA 4XIUA 4IDKA 1IO2A 1L3TA 3I8DA 3ZT3A 1D5AA 4CJWA 1MU2A 4DSLA 3OYGA 1QE1A 4CERA 4CESA 4CJQA 3T3FA 3CM6A 3DRRA 5I3UA 2HHWA 4I2PA 4FJ7A 1BIZA 2DFEA 4CECA 3KK1A 2XY8A 3DLHA 4OVLA 1KTQA 1RCHA 3TAEA 5I42A 4NCAA 4CHYA 2B4JA 1QHTA 3QEIA 4FJNA 2LSNA 1SKRA 4IFVA 2XRIA 1XHXA 3LPTA 3VQAA 2YNHA 3RMBA 4Q0BA 4GMJB 4M3YA 1X1PA 3M8PA 4G1QA 4ELUA 1SUQA 2HNDA 3JYTA 4CEAA 3KLHA 3SCXA 1S1WA 5HRNA 2HHTA 3C95A 1ASUA 4FLVA 4HHTA 5FDLA 3K5LA 1ZBIA 3L8BA 2DY4A 1ASVA 3O4NA 4IFYA 3K2PA 3LAKA 1R0AA 2E4LA 4OPKA 1C1BA 2YKNA 3PUFA 3FFIA 1C0TA 3AVJA 2F96A 3QERA 3RMCA 4CJTA 3QEWA 2DTUA 4FM2A 2XY7A 3TAPA 2HHVA 3HYFA 5J2MA 3OYJA 4FJ8A 2FBVA 3O4QA 3P83D 3RWUA 1RT7A 4BACA 3NDKA 5HLFA 3C94A 1RBTA 3AO1A 1RTJA 3DMJA 3BGRA 3K5MA 4BDZA 4DU4A 3C6UA 4CK3A 3NH0A 1VRTA 4PA1A 3AVGA 1FKOA 1KLNA 3K59A 3MXJA 1TK5A 1TK8A 1ZBFA 1LWCA 3L2VA 4N76A 4DG1A 1HPZA 1S6PA 1LAVA 4KTWA 4FLTA 3SUOA 1VSJA 4KFBA 4B9NA 2ITGA 3NCIA 4HVJA 4FLXA 1W9HA 1Z26A 4FLUA 3TAFA 3ZSVA 1JLGA 4M3WA 1NKBA 1UAXA 1NJZA 4UQGA 1TKZA 3PX4A 5D3GA 1JL2A 4YFUA 3L2UA 1S1XA 3EZ5A 1KSPA 4B9VA 1VSEA 4ZHRA 1FXXA 3OYBA 4Y1CA 4HUFA 3OS0A 3V9SA 2G8IA 1C0MA 4F3OA 1EKEA 3ZSRA 4KB0A 1HQEA 3DI6A 4M41A 1VRUA 4J2BA 4CF0A 3OY9A 3K5NA 1HJRA 2QKBA 4BWMA 1VSKA 3L2WA 2R7YA 1QSLA 3G0ZA 1RT2A 2KFNA 1A5XA 4O4GA 3LZIA 4CHZA 3V9ZA 2Y1IA 3SV3A 3C6TA 1WSFA 4NYFA 3OVNA 3P5JA 5DK5A 3VQEA 4AHTA 3QETA 2X78A 1VK0A 4LSLA 3V9XA 1WSHA 3T1AA 5HP1A 2RF2A 3HL8A 4OKKA 2BANA 1KLMA 2JGUA 2HB5A 5C25A 4PWDA 4AH9A 3B6PA 4CFDA 4DSEA 4FM1A 2BE2A 1SV5A 4WE1A 1RDDA 1TL3A 4N47A 2Q3SA 3HT3A 1X9SA 2G8HA 2VG6A 1NK0A 2DFFA 3KIOA 5HRSA 1UA0A 1KRPA 4KI6A 1JL1A 2IC3A 1SL0A 4FLZA 1IG9A 2FC0A 3HPHA 2X74A 5FROA 3OYKA 3KJVA 1IKWA 3OJSA 3KK2A 4N5SA 3NH2A 1RDBA 2P5OA 1IKVA 4LH4A 5SWMA 4DTPA 2G8FA 3ASMA 4DFPA 2XY6A 5CZ2A 1QSYA 4CEFA 4W5QA 5KGXA 4DSIA 2HW3A 1BCMA 3TWHA 4CFBA 3NAEA 3OYFA 1XC9A 4KB1A 3S9HA 2EHGA 1S9GA 2X6SA 3WNGA 3KK3A 2BDPA 3ZSYA 4FXDA 4H8KA 4JRPA 4DQPA 3HJFA 2OZSA 4RW6A 1HYSA 3QIPA 3IRXA 1JXEA 4KHWA 2Y1JA 3T19A 4E19A 3LAMA 3U3GA 3KLFA 4JS4A 1Q8IA 4GVMA 4HCBA 1QQCA 4AILC 2WOMA 3V1OA 1QTMA 2F8TA 3LANA 1GOCA 1JLCA 4E7JA 3AVLA 4N41A 4I9LA 4C8NA 1KFDA 2HVHA 4BDYA 4W5NA 2HNYA 2E6MA 4MQ3A 2KW4A 2KQ2A 2ZE2A 3SUPA 3CFPA 1JLBA 4KTZA 5KRTA 1XI1A 2FBYA 4Z4EA 1DTTA 2OYQA 1C1CA 4CEBA 5JS2A 4CJVA 5J1EA 1RT4A 2YHAA 4F2SA 3TAGA 1EXQA 2QKKA 3QEVA 3AVMA 4B8CA 5E41A 1JKHA 4I2QA 3DLBA 3DLKA 1T8EA 2IAJA 2XHBA 4IG3A 4FZZA 1TKTA 4CJ5A 4F8RA 4J2EA 3CM5A 1G15A 4RW7A 1WAJA 2X6NA 3SPYA 1EETA 3H08A 3RR8A 1S6QA 4AHVA 2EX3A 3SPZA 3TANA 3HVRA 2ZD1A 3VQ4A 1ZBUA 3KD5E 4FK2A 3MEDA 4AHCA 4B3OA 2AJQA 1SKSA 4C8KA 4LY7A 4DLEA 4ICLA 3PO5A 3I0SA 4FK4A 4L8RB 4FW1A 5EU7A 1HMVA 1EX4A 3KLGA 1WN7A 4DTXA 1NJXA 5FRNA 2P1JA 1TVRA 3AVKA 1NOZA 3K57A 1NK8A 3KTQA 4M3UA 4QAGA 2RPIA 4OPJA 3D0PA 3NGZA 2W42A 1TL1A 3VQ7A 3OYLA 2RKIA 2VWKA 4F4KA 2DFHA 2Z1HA 4BWJA 3KLIA 4KHYA 3V1RA 4O0JA 3ULDA 3RR7A 4B9LA 3AVCA 4KREA 1U04A 4FLWA 4CF9A 1S9EA 4DU3A 4CIGA 4F2RA 1Q9YA 3QINA 2VWJA 4HUEA 2Z1IA 3SV4A 1ZYQA 2BGGA 4CJLA 4OLAA 5HBMA 3HP6A 3ZT2A 1BISA 4I7FA 1BQNA 5FRMA 1RBRA 4KHNA 4CJ4A 4CGIA 1EP4A 4Z4HA 3CFOA 1A5WA 3SZ2A 2OPQA 4DFMA 2E6LA 5J2NA 4Z4CA 1HRHA 3WNHA 3ZSZA 4FCYA 1NK6A 1RTIA 4ZTJA 4O44A 3SUQA 1T03A 3PO4A 4DTJA 4DTMA 1A5VA 4YNQA 4DF4A 4M3XA 4CEEA 4KAZA 1RBVA 3A2FA 4H4MA 1X9WA 3AO2A 3G10A 1BGXT 3HM9A 5T7BA 2YNFA 1KFSA 4FJJA 3DRPA 3MEGA 4W5TA 3MEEA 3JSMA 4DMNA 4M3TA 3AV9A 1UWBA 5CYQA 2HHXA 3DOKA 3M8SA 2FBTA 1B92A 3U3YA 4N56A 3NF6A 4E1NA 4CF1A 4FJLA 3S3MA 1B9FA 5JS1A 3VA0A 4OKEA 4RW9A 2KFZA 1WLJA 4CF8A 4GW6A 3WNEA 4ZTFA 1L3UA 4IG0A 3VQ5A 3ZSXA 3DOLA 1W0HA 1BHLA 2ZQBA 3OYIA 1Q9XA 2OA8A 1F21A 1LWEA 2P51A 1FK9A 2VG7A 3HVTA 1VSIA 3OYCA 2I5JA 4CJ3A 3LWLA 4HTUA 4DU1A 2B5JA 4FYDA 1LW2A 4C8LA 3TR8A 1J54A 3LZJA 3QNOA 3RRGA 4QCLA 4FJKA 1J5OA 1LAWA 4CHPA 1QS4A 4KHUA 1J53A 1T7PA 3V6DA 4CFCA 2WONA 3V9WA 4CEOA 4M3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NH1 A;  2FBX A;  3AVF A;  3E01 A;  3P1G A;  5DMR A;  1UA1 A;  1NKE A;  1NKC A;  4B9S A;  4FJG A;  4K8X A;  4J2D A;  4EZ6 A;  4Q5V A;  4LSN A;  4FK0 A;  3VQ8 A;  1HQU A;  1WSE A;  3LWM A;  3AO5 A;  4B9T A;  2IDO A;  2OPS A;  1VSF A;  5KGW A;  3OYE A;  1IKX A;  3LP0 A;  4DTO A;  3TI0 A;  2YV0 X;  1FKP A;  1ZBL A;  4E0D A;  4FVM A;  1CXU A;  1KCF A;  2O4I A;  1T05 A;  3PX0 A;  4DQI A;  3AO3 A;  1VSL A;  3M8R A;  2HVI A;  4CK1 A;  4CJR A;  2A1R A;  4B08 A;  4ELV A;  3ZSW A;  3SUN A;  3NF8 A;  4KPY A;  4ID5 A;  3ZT1 A;  1VSD A;  2JLE A;  4DTS A;  1WSG A;  4FZX C;  1CZ9 A;  4KO0 A;  1C0U A;  4CIE A;  4CEQ A;  1ZBH A;  1DTQ A;  2Z1G A;  4HUG A;  2ETJ A;  2A1S A;  3AVH A;  3QIO A;  3QO9 A;  4E7I A;  1XHZ A;  4W5R A;  2PZS A;  4CJK A;  4IKF A;  4FM0 A;  4DQR A;  2QXF A;  1C1A A;  1RBS A;  2D0C A;  2IOC A;  3LP2 A;  3LP1 A;  1XWL A;  5KI6 A;  3BDP A;  3VQP A;  4FJH A;  1JXB A;  1Y97 A;  4DFJ A;  1NK4 A;  3VQD A;  4E89 A;  3HPG A;  1X9M A;  2G8V A;  1I3A A;  4QOZ B;  4OLB A;  1IKY A;  4BE1 A;  1RIL A;  3IAY A;  3VQC A;  4JRQ A;  3NHG A;  3RMD A;  1ASW A;  5CZ1 A;  5CYM A;  5HRO A;  1U4B A;  4F3T A;  4B8A B;  3UIQ A;  4O55 A;  3SQ2 A;  1D9D A;  4Z4G A;  3SQ1 A;  5C24 A;  4RG8 A;  4E7L A;  3CG7 A;  5HRR A;  3RTV A;  1CZB A;  2GUI A;  3V4I A;  2Z1J A;  3F73 A;  1GOB A;  1RT3 A;  3ZT4 A;  4CK2 A;  4DTU A;  3S3O A;  3VA3 A;  4FW2 A;  1WSJ A;  4ID1 A;  4CEZ A;  5C42 A;  1J9A A;  1NK5 A;  4DF8 A;  2HHQ A;  1TGO A;  4E3S A;  3AVB A;  2HNZ A;  1VSM A;  4OJR A;  1BI4 B;  3ZSQ A;  2D0B A;  3AA5 X;  3ZSO A;  3CYM A;  1GOA A;  3IS9 A;  1NK9 A;  4B9U A;  4E1M A;  1RT5 A;  4CJS A;  2HMI A;  2KZZ A;  4BE0 A;  3ISN C;  4CFA A;  1TV6 A;  4LH5 A;  3CFR A;  3V9U A;  3O3F A;  1L3V A;  3PY8 A;  3HP9 A;  3HST B;  1JLA A;  3AA3 A;  4CGG A;  2O4G A;  4PQU A;  3L3U A;  4FJI A;  5KRS A;  4RW4 A;  3NGY A;  1K6Y A;  4Y1D A;  2RN2 A;  3LPU A;  3OYM A;  4DS4 A;  4KHS A;  1S1T A;  1KVA A;  3I0R A;  1SL1 A;  4HCC A;  4FZY A;  4DSJ A;  3AVN A;  1BI4 A;  1S5J A;  3DRS A;  3S3N A;  2OPR A;  1CXQ A;  5J2P A;  3IG1 A;  3VQ9 A;  4K8Z A;  5J2Q A;  4MFB A;  4KI4 A;  1TAQ A;  3DYA A;  3NF9 A;  4DQS A;  4FLY A;  2GBZ A;  4BDP A;  3NBP A;  4DWI A;  4J2A A;  3KKR A;  3NE6 A;  4KRF A;  4DQQ A;  3U6F A;  1Z25 A;  4C8M A;  2NUB A;  1UOC A;  4B9M A;  3SNN A;  3QEP A;  4PY5 A;  3SYZ A;  4DFK A;  4E7K A;  1LWF A;  1WAF A;  4TSX A;  2PY5 A;  2QK9 A;  3RMA A;  4EP5 A;  1HYV A;  4M3R A;  3VQ6 A;  1O1W A;  4CGD A;  3QEX A;  3OYD A;  3L2R A;  4Z4F A;  2D5R A;  3HXM A;  2KZM A;  3D45 A;  2IS3 A;  5SZT A;  3MXM A;  3LDS A;  3TAQ A;  1CLQ A;  1REV A;  1D8Y A;  4OGC A;  2HHS A;  1TKD A;  3B6O A;  3TAR A;  2D0A A;  4FJ5 A;  4CJF A;  1BIU A;  1I39 A;  4CHN A;  4CJU A;  3SQ4 A;  1L3S A;  1YT3 A;  3AA2 A;  3ITH A;  4DS5 A;  3AA4 A;  4AHR A;  1U48 A;  4BE2 A;  1RTD A;  1YVU A;  3QLH A;  1RTH A;  1BQM A;  5HRP A;  4ELT A;  3F9K A;  3M8Q A;  5CY4 A;  3SQ0 A;  4M42 A;  4CIF A;  3OYH A;  3MXI A;  1S1U A;  1KVB A;  3SJJ A;  4FJM A;  3ZCM A;  2B6A A;  1KVC A;  4DSK A;  4CE9 A;  4OGE A;  2G8U A;  4CHQ A;  3V81 A;  3OS2 A;  4O5B A;  4H4O A;  2XO7 A;  1WSI A;  4CJE A;  3DM2 A;  2KTQ A;  1B9D A;  1JLQ A;  4CGF A;  4KTQ A;  3PV8 A;  4DTN A;  1L5U A;  4Z4I A;  1YTU A;  3DLR A;  3OS1 A;  1VSH A;  3KD1 E;  1JLF A;  2XY5 A;  4KKO A;  2G8K A;  1C6V A;  2YNI A;  4CJP A;  3DLE A;  1HNV A;  4O0I A;  1U47 A;  4NYN A;  2YHB A;  4CHO A;  1ITG A;  1D9F A;  4EP4 A;  3OJU A;  1RDC A;  1TKX A;  3PX6 A;  1HNI A;  4PUO A;  1NJY A;  3HK2 A;  3DLG A;  1RNH A;  4CGH A;  4NCG A;  4KV8 A;  1LV5 A;  3SI6 A;  4RW8 A;  4JLH A;  3RRH A;  2OPP A;  4AHU A;  1IH7 A;  4E7H A;  3HPO A;  1BCO A;  3LAL A;  1HYZ A;  3QNN A;  3NF7 A;  3EYZ A;  3OYN A;  1JLE A;  1TAU A;  1RT6 A;  3TAB A;  1RT1 A;  2F8S A;  4JS5 A;  1N6Q A;  4FJX A;  1N5Y A;  3VQQ A;  3MEC A;  4DTR A;  4CED A;  4CCH A;  3ALY A;  3AVI A;  4IBN A;  3CQ8 A;  1BL3 A;  4Z0U A;  2OZM A;  1SKW A;  3VQB A;  3OYA A;  3KLE A;  1U45 A;  3AVA A;  3NFA A;  4LD0 A;  1NJW A;  3WNF A;  2YNG A;  3O3H A;  4W5O A;  3QES A;  3AO4 A;  4EZ9 A;  1RBU A;  3K5O A;  4AHS A;  1TK0 A;  3MAQ A;  3V1Q A;  3HO1 A;  1NOY A;  3TAM A;  4M45 A;  2PYJ A;  4OKJ A;  5K14 A;  2VG5 A;  3L3V A;  4CGJ A;  1WNS A;  3O3G A;  4CF2 A;  3K58 A;  4DLG A;  1DLO A;  4I9Q A;  3L2Q A;  1YTA A;  1RDA A;  1U49 A;  1SL2 A;  2G8W A;  2PYL A;  1S1V A;  2IGI A;  3KKS A;  3LP3 A;  4R5P A;  3EY1 A;  3THV A;  1NK7 A;  1LW0 A;  2YKM A;  4KHQ A;  4NCB A;  3ZT0 A;  1QSS A;  4C8O A;  3NGI A;  2HHU A;  3VN5 A;  4FJ9 A;  2GV9 A;  2P5G A;  5KTQ A;  2ATQ A;  4DSF A;  4XIU A;  4IDK A;  1IO2 A;  1L3T A;  3I8D A;  3ZT3 A;  1D5A A;  4CJW A;  1MU2 A;  4DSL A;  3OYG A;  1QE1 A;  4CER A;  4CES A;  4CJQ A;  3T3F A;  3CM6 A;  3DRR A;  5I3U A;  2HHW A;  4I2P A;  4FJ7 A;  1BIZ A;  2DFE A;  4CEC A;  3KK1 A;  2XY8 A;  3DLH A;  4OVL A;  1KTQ A;  1RCH A;  3TAE A;  5I42 A;  4NCA A;  4CHY A;  2B4J A;  1QHT A;  3QEI A;  4FJN A;  2LSN A;  1SKR A;  4IFV A;  2XRI A;  1XHX A;  3LPT A;  3VQA A;  2YNH A;  3RMB A;  4Q0B A;  4GMJ B;  4M3Y A;  1X1P A;  3M8P A;  4G1Q A;  4ELU A;  1SUQ A;  2HND A;  3JYT A;  4CEA A;  3KLH A;  3SCX A;  1S1W A;  5HRN A;  2HHT A;  3C95 A;  1ASU A;  4FLV A;  4HHT A;  5FDL A;  3K5L A;  1ZBI A;  3L8B A;  2DY4 A;  1ASV A;  3O4N A;  4IFY A;  3K2P A;  3LAK A;  1R0A A;  2E4L A;  4OPK A;  1C1B A;  2YKN A;  3PUF A;  3FFI A;  1C0T A;  3AVJ A;  2F96 A;  3QER A;  3RMC A;  4CJT A;  3QEW A;  2DTU A;  4FM2 A;  2XY7 A;  3TAP A;  2HHV A;  3HYF A;  5J2M A;  3OYJ A;  4FJ8 A;  2FBV A;  3O4Q A;  3P83 D;  3RWU A;  1RT7 A;  4BAC A;  3NDK A;  5HLF A;  3C94 A;  1RBT A;  3AO1 A;  1RTJ A;  3DMJ A;  3BGR A;  3K5M A;  4BDZ A;  4DU4 A;  3C6U A;  4CK3 A;  3NH0 A;  1VRT A;  4PA1 A;  3AVG A;  1FKO A;  1KLN A;  3K59 A;  3MXJ A;  1TK5 A;  1TK8 A;  1ZBF A;  1LWC A;  3L2V A;  4N76 A;  4DG1 A;  1HPZ A;  1S6P A;  1LAV A;  4KTW A;  4FLT A;  3SUO A;  1VSJ A;  4KFB A;  4B9N A;  2ITG A;  3NCI A;  4HVJ A;  4FLX A;  1W9H A;  1Z26 A;  4FLU A;  3TAF A;  3ZSV A;  1JLG A;  4M3W A;  1NKB A;  1UAX A;  1NJZ A;  4UQG A;  1TKZ A;  3PX4 A;  5D3G A;  1JL2 A;  4YFU A;  3L2U A;  1S1X A;  3EZ5 A;  1KSP A;  4B9V A;  1VSE A;  4ZHR A;  1FXX A;  3OYB A;  4Y1C A;  4HUF A;  3OS0 A;  3V9S A;  2G8I A;  1C0M A;  4F3O A;  1EKE A;  3ZSR A;  4KB0 A;  1HQE A;  3DI6 A;  4M41 A;  1VRU A;  4J2B A;  4CF0 A;  3OY9 A;  3K5N A;  1HJR A;  2QKB A;  4BWM A;  1VSK A;  3L2W A;  2R7Y A;  1QSL A;  3G0Z A;  1RT2 A;  2KFN A;  1A5X A;  4O4G A;  3LZI A;  4CHZ A;  3V9Z A;  2Y1I A;  3SV3 A;  3C6T A;  1WSF A;  4NYF A;  3OVN A;  3P5J A;  5DK5 A;  3VQE A;  4AHT A;  3QET A;  2X78 A;  1VK0 A;  4LSL A;  3V9X A;  1WSH A;  3T1A A;  5HP1 A;  2RF2 A;  3HL8 A;  4OKK A;  2BAN A;  1KLM A;  2JGU A;  2HB5 A;  5C25 A;  4PWD A;  4AH9 A;  3B6P A;  4CFD A;  4DSE A;  4FM1 A;  2BE2 A;  1SV5 A;  4WE1 A;  1RDD A;  1TL3 A;  4N47 A;  2Q3S A;  3HT3 A;  1X9S A;  2G8H A;  2VG6 A;  1NK0 A;  2DFF A;  3KIO A;  5HRS A;  1UA0 A;  1KRP A;  4KI6 A;  1JL1 A;  2IC3 A;  1SL0 A;  4FLZ A;  1IG9 A;  2FC0 A;  3HPH A;  2X74 A;  5FRO A;  3OYK A;  3KJV A;  1IKW A;  3OJS A;  3KK2 A;  4N5S A;  3NH2 A;  1RDB A;  2P5O A;  1IKV A;  4LH4 A;  5SWM A;  4DTP A;  2G8F A;  3ASM A;  4DFP A;  2XY6 A;  5CZ2 A;  1QSY A;  4CEF A;  4W5Q A;  5KGX A;  4DSI A;  2HW3 A;  1BCM A;  3TWH A;  4CFB A;  3NAE A;  3OYF A;  1XC9 A;  4KB1 A;  3S9H A;  2EHG A;  1S9G A;  2X6S A;  3WNG A;  3KK3 A;  2BDP A;  3ZSY A;  4FXD A;  4H8K A;  4JRP A;  4DQP A;  3HJF A;  2OZS A;  4RW6 A;  1HYS A;  3QIP A;  3IRX A;  1JXE A;  4KHW A;  2Y1J A;  3T19 A;  4E19 A;  3LAM A;  3U3G A;  3KLF A;  4JS4 A;  1Q8I A;  4GVM A;  4HCB A;  1QQC A;  4AIL C;  2WOM A;  3V1O A;  1QTM A;  2F8T A;  3LAN A;  1GOC A;  1JLC A;  4E7J A;  3AVL A;  4N41 A;  4I9L A;  4C8N A;  1KFD A;  2HVH A;  4BDY A;  4W5N A;  2HNY A;  2E6M A;  4MQ3 A;  2KW4 A;  2KQ2 A;  2ZE2 A;  3SUP A;  3CFP A;  1JLB A;  4KTZ A;  5KRT A;  1XI1 A;  2FBY A;  4Z4E A;  1DTT A;  2OYQ A;  1C1C A;  4CEB A;  5JS2 A;  4CJV A;  5J1E A;  1RT4 A;  2YHA A;  4F2S A;  3TAG A;  1EXQ A;  2QKK A;  3QEV A;  3AVM A;  4B8C A;  5E41 A;  1JKH A;  4I2Q A;  3DLB A;  3DLK A;  1T8E A;  2IAJ A;  2XHB A;  4IG3 A;  4FZZ A;  1TKT A;  4CJ5 A;  4F8R A;  4J2E A;  3CM5 A;  1G15 A;  4RW7 A;  1WAJ A;  2X6N A;  3SPY A;  1EET A;  3H08 A;  3RR8 A;  1S6Q A;  4AHV A;  2EX3 A;  3SPZ A;  3TAN A;  3HVR A;  2ZD1 A;  3VQ4 A;  1ZBU A;  3KD5 E;  4FK2 A;  3MED A;  4AHC A;  4B3O A;  2AJQ A;  1SKS A;  4C8K A;  4LY7 A;  4DLE A;  4ICL A;  3PO5 A;  3I0S A;  4FK4 A;  4L8R B;  4FW1 A;  5EU7 A;  1HMV A;  1EX4 A;  3KLG A;  1WN7 A;  4DTX A;  1NJX A;  5FRN A;  2P1J A;  1TVR A;  3AVK A;  1NOZ A;  3K57 A;  1NK8 A;  3KTQ A;  4M3U A;  4QAG A;  2RPI A;  4OPJ A;  3D0P A;  3NGZ A;  2W42 A;  1TL1 A;  3VQ7 A;  3OYL A;  2RKI A;  2VWK A;  4F4K A;  2DFH A;  2Z1H A;  4BWJ A;  3KLI A;  4KHY A;  3V1R A;  4O0J A;  3ULD A;  3RR7 A;  4B9L A;  3AVC A;  4KRE A;  1U04 A;  4FLW A;  4CF9 A;  1S9E A;  4DU3 A;  4CIG A;  4F2R A;  1Q9Y A;  3QIN A;  2VWJ A;  4HUE A;  2Z1I A;  3SV4 A;  1ZYQ A;  2BGG A;  4CJL A;  4OLA A;  5HBM A;  3HP6 A;  3ZT2 A;  1BIS A;  4I7F A;  1BQN A;  5FRM A;  1RBR A;  4KHN A;  4CJ4 A;  4CGI A;  1EP4 A;  4Z4H A;  3CFO A;  1A5W A;  3SZ2 A;  2OPQ A;  4DFM A;  2E6L A;  5J2N A;  4Z4C A;  1HRH A;  3WNH A;  3ZSZ A;  4FCY A;  1NK6 A;  1RTI A;  4ZTJ A;  4O44 A;  3SUQ A;  1T03 A;  3PO4 A;  4DTJ A;  4DTM A;  1A5V A;  4YNQ A;  4DF4 A;  4M3X A;  4CEE A;  4KAZ A;  1RBV A;  3A2F A;  4H4M A;  1X9W A;  3AO2 A;  3G10 A;  1BGX T;  3HM9 A;  5T7B A;  2YNF A;  1KFS A;  4FJJ A;  3DRP A;  3MEG A;  4W5T A;  3MEE A;  3JSM A;  4DMN A;  4M3T A;  3AV9 A;  1UWB A;  5CYQ A;  2HHX A;  3DOK A;  3M8S A;  2FBT A;  1B92 A;  3U3Y A;  4N56 A;  3NF6 A;  4E1N A;  4CF1 A;  4FJL A;  3S3M A;  1B9F A;  5JS1 A;  3VA0 A;  4OKE A;  4RW9 A;  2KFZ A;  1WLJ A;  4CF8 A;  4GW6 A;  3WNE A;  4ZTF A;  1L3U A;  4IG0 A;  3VQ5 A;  3ZSX A;  3DOL A;  1W0H A;  1BHL A;  2ZQB A;  3OYI A;  1Q9X A;  2OA8 A;  1F21 A;  1LWE A;  2P51 A;  1FK9 A;  2VG7 A;  3HVT A;  1VSI A;  3OYC A;  2I5J A;  4CJ3 A;  3LWL A;  4HTU A;  4DU1 A;  2B5J A;  4FYD A;  1LW2 A;  4C8L A;  3TR8 A;  1J54 A;  3LZJ A;  3QNO A;  3RRG A;  4QCL A;  4FJK A;  1J5O A;  1LAW A;  4CHP A;  1QS4 A;  4KHU A;  1J53 A;  1T7P A;  3V6D A;  4CFC A;  2WON A;  3V9W A;  4CEO A;  4M3Z A; 
#chains in the Genus database with same CATH topology
 2QWN A;  2FBX A;  1NKE A;  4B9S A;  4Q5V A;  3VQ8 A;  3T7Z A;  4CZG A;  5HOO A;  3O4W A;  5KGW A;  3RSE A;  3D7E O;  4IEE A;  3LL3 A;  1T05 A;  3PX0 A;  1VSL A;  3R3L A;  3ATU A;  5JIC A;  1K8A O;  3ZSW A;  4V19 S;  3ZT1 A;  1VSD A;  3SAH A;  1NWK A;  4FZX C;  3P38 A;  1C0U A;  3EKS A;  1ZBH A;  1DTQ A;  4HUG A;  2ETJ A;  2A1S A;  4IOC L;  4FOE A;  4W5R A;  4YOT A;  4XEI A;  1C1A A;  1RBS A;  1VQP N;  3BZC A;  1JXB A;  1XQS C;  3HPG A;  1I3A A;  4JKA A;  1RIL A;  5LMU K;  3VQC A;  4DCH A;  3W3D A;  1J6Z A;  3E9O A;  4CZI A;  4DV7 K;  5C24 A;  4RG8 A;  4E7L A;  2YJF A;  4JHD B;  1CZB A;  3V4I A;  1GOB A;  4DTU A;  1WSJ A;  4CEZ A;  2HHQ A;  1J9A A;  4DF8 A;  3AVB A;  4X66 K;  3CYM A;  1GOA A;  4E1M A;  2OTL N;  4BE0 A;  3ISN C;  5FLX O;  4A2A A;  4LH5 A;  3V9U A;  1L3V A;  2QWL A;  3PY8 A;  5KRS A;  4Y1D A;  3F9M A;  1X3N A;  4Z94 A;  4GVE A;  3S3N A;  1CXQ A;  4MFB A;  4DQS A;  2GBZ A;  1NMD A;  3U6F A;  2NUB A;  4B9M A;  3FZL A;  3SNN A;  3QEP A;  4PY5 A;  2UYT A;  3C65 A;  3C7N B;  3DJC A;  4JKD A;  1GLA G;  3VQ6 A;  3J80 O;  3HXM A;  2KZM A;  3DLL L;  3OBW A;  1CLQ A;  3LDS A;  5TKW A;  4DKW A;  2HHS A;  3B6O A;  2D0A A;  3PIP L;  3KWG A;  4EHT A;  4CJF A;  3SQ4 A;  4DHY A;  3AA2 A;  3WXI A;  4AHR A;  1U48 A;  1BU6 O;  1RTD A;  4ELT A;  1RTH A;  4MLH A;  3J7Y P;  3MWT A;  2YX6 A;  3VPZ A;  4CIF A;  3MXI A;  4FJM A;  3SJJ A;  2B6A A;  3CCE N;  3P4I A;  3THW B;  1WSI A;  4CJE A;  1S72 N;  4CGF A;  3PV8 A;  1HNX K;  3CJ9 A;  1QZ5 A;  1KXP A;  4CJP A;  4ILH A;  3T1Y K;  3DLE A;  4O0I A;  4NYN A;  1ITG A;  1VQ8 N;  3OJU A;  1RDC A;  3KWI A;  4PUO A;  3ENB A;  1NJY A;  1KAZ A;  4NCG A;  3EO3 A;  2OPP A;  4AHU A;  3T1H K;  1HYZ A;  2F8S A;  3Q7C A;  3R6M A;  4FJX A;  2FXU A;  2QXL A;  4IBN A;  1BL3 A;  5AJ3 K;  1SKW A;  3VQB A;  3ZEU B;  1U45 A;  3NFA A;  4FWO A;  4MO5 A;  3PSI A;  3K5O A;  1ATS A;  2UXC K;  4CGJ A;  4JHD A;  3L3V A;  5EY4 A;  3UKR B;  3PIO L;  2PYL A;  4C8O A;  2HHU A;  3NGI A;  3VN5 A;  2P9P B;  4H5R A;  2ATQ A;  4YOW A;  1IO2 A;  4JI4 K;  3I8D A;  5AFU A;  1VQ9 N;  1GLJ O;  4I6M B;  3THX A;  4CER A;  3T3F A;  3CM6 A;  3DRR A;  4BC2 A;  3MWP A;  1BIZ A;  5DM6 L;  3KK1 A;  1MA9 B;  3DLH A;  3TAE A;  1HKC A;  4NCA A;  4OPA A;  2B4J A;  4CHY A;  2LSN A;  2XRI A;  1XHX A;  4BR0 A;  3VQA A;  4M3Y A;  2HND A;  3KLH A;  1S1W A;  2HHT A;  3VGM A;  4GKK K;  4HHT A;  3K5L A;  3L4Q A;  2NRZ A;  3QER A;  3PUF A;  3AVJ A;  3FFI A;  4IOX A;  4NXM K;  3RMC A;  2DTU A;  4FM2 A;  5J2M A;  3P83 D;  2ZM6 K;  3RWU A;  2FF3 B;  3SAG A;  3NDK A;  3ZX2 A;  4BAC A;  1RTJ A;  3S41 A;  3K5M A;  3C6U A;  5AQS A;  1XMQ K;  3AVG A;  5FPD A;  1ZBF A;  1LWC A;  3L2V A;  1HPZ A;  1S6P A;  4ILG B;  3HOT A;  4KFB A;  1O13 A;  2ITG A;  3KHY A;  3VEZ A;  1QVG M;  2E2Q A;  3TAF A;  5FPM A;  4PKI A;  4UQG A;  1VAZ A;  4WYB A;  3L2U A;  2Q0R A;  4DR5 K;  2W40 A;  4H0Y B;  5BPL A;  3EN9 A;  4RCH A;  4F3O A;  1EKE A;  1IJJ A;  3O8M A;  1VRU A;  1D4X A;  2Q31 A;  5BR8 K;  1YJW N;  4YOV A;  1NGJ A;  4DV5 K;  2O8F B;  4CZH A;  4O4G A;  4CHZ A;  3V9Z A;  3C6T A;  3P5J A;  4OLA A;  3QET A;  3E9L A;  2X78 A;  1VK0 A;  4LSL A;  4XH4 A;  4OKK A;  2E88 A;  1KLM A;  3DXM A;  5C25 A;  2ZJR L;  4K0K K;  5LJW A;  4DR3 K;  1TL3 A;  2Q3S A;  3O9T A;  1NK0 A;  1KRP A;  5HRS A;  3H3O B;  1JL1 A;  2IC3 A;  1NU0 A;  3TSQ A;  3SLC A;  3KK2 A;  4N5S A;  2P5O A;  1ILY A;  4DTP A;  3ASM A;  5AQT A;  4DFP A;  3A8Y A;  2KLA A;  3TSP A;  5KGX A;  1BCM A;  4DB3 A;  3D2E A;  4L3Q A;  4DQP A;  4DV3 K;  3CCQ N;  4JI2 K;  4BR9 A;  1BO5 O;  2Y1J A;  4E19 A;  2A40 A;  2IVN A;  3LAM A;  5KPZ A;  1Q8I A;  2GEM A;  4GVM A;  4LC9 B;  2WOM A;  4AM6 A;  1HX1 A;  4A59 A;  4CZM A;  1GLC G;  4BDY A;  4W5N A;  2E6M A;  1IG8 A;  5C15 A;  1HKB A;  4JD2 B;  3OBY A;  1DEJ A;  5GAD P;  2YHA A;  1EXQ A;  4B1Y B;  3DAW A;  2IAJ A;  4DUY K;  4IG3 A;  4JKF A;  3SMP A;  4PKG A;  4CJ5 A;  4CZJ A;  4RW7 A;  1N36 K;  1QQM A;  3SPY A;  1QVF M;  4IWV A;  1DGK N;  2EX3 A;  3WQT A;  3WXK A;  2AJQ A;  1SS6 A;  4NO7 A;  4C8K A;  3GG4 A;  2HMP A;  3CCJ N;  5EU7 A;  2PBD A;  1NJX A;  4DTX A;  4M7X A;  2P1J A;  1TVR A;  3AVK A;  3KTQ A;  4M3U A;  4M63 C;  4OPJ A;  3D0P A;  3NGZ A;  3VQ7 A;  5AQH A;  1XNR K;  4H03 B;  4KHY A;  3IDH A;  2O8E A;  4B9L A;  4KRE A;  3BUZ B;  1S9E A;  2Z1I A;  1N8R O;  3LDN A;  5AZI B;  3CJA A;  4DR2 K;  4CGI A;  1TYQ A;  4DFM A;  1YIJ N;  2E6L A;  5J2N A;  5BR9 A;  1RDU A;  4FCY A;  1T03 A;  5LL6 Z;  1FW6 A;  4H4M A;  2CGJ A;  2WC9 A;  1BGX T;  2P9I A;  3MEG A;  4W5T A;  4YOY A;  2E2P A;  3M8S A;  2FBT A;  4JI8 K;  3U3Y A;  4N56 A;  5M1K A;  5JLF A;  3F5T A;  3M5R A;  4RW9 A;  5C2D A;  3H6E A;  1WLJ A;  4GW6 A;  2CGK A;  2D4W A;  2HF3 A;  3MCA B;  3DOL A;  1F21 A;  2VCP A;  1VSI A;  4HTU A;  2I5J A;  4DU1 A;  4FYD A;  2V52 B;  3TR8 A;  3TPQ A;  4WQ4 C;  4C23 A;  1J53 A;  3V6D A;  4B1Z A;  1VQ4 N;  1ZC6 A;  1NKC A;  3P1G A;  4IO8 A;  2NRH A;  3H3N O;  4J2D A;  5GAE P;  3HRG A;  1WSE A;  3A5L C;  4QS9 A;  3OYE A;  4DTO A;  3TI0 A;  1ZBL A;  1FKP A;  5CE3 A;  4FVM A;  2O4I A;  4DQI A;  4GKJ K;  3AO3 A;  1EWQ A;  2ZJP L;  3DWL A;  3VEO A;  5AQM A;  5CHI A;  1WSG A;  4FWR A;  3I55 N;  4OPH A;  2QEX N;  4JNE A;  4RTF D;  2PZS A;  3QIO A;  1HPM A;  4O8U A;  4IXC A;  2O8C B;  4JEP A;  3I56 N;  2D0C A;  3MX2 A;  5KI6 A;  3VQP A;  1Y97 A;  4E89 A;  2G8V A;  1ZXO A;  1IKY A;  5HRO A;  1HR0 K;  1WOQ A;  1D9D A;  4JKE A;  3Q7B A;  3CG7 A;  2Z1J A;  2FSJ A;  5KPR A;  1RT3 A;  3F73 A;  1ZBS A;  1GLE G;  1MDU B;  2NRV A;  4FW2 A;  4ID1 A;  5C42 A;  3JS6 A;  4E3S A;  4PHT X;  1VSM A;  2FSK A;  1ATN A;  1NK9 A;  1E3M A;  3CJB A;  4KH6 A;  2OCE A;  4CJS A;  3THW A;  2VYP A;  5EXW A;  4OO1 J;  3CFR A;  2F7T A;  4CGG A;  4FJI A;  1NGH A;  4BRO A;  4GNI A;  1K6Y A;  4KHS A;  2RN2 A;  3VEN A;  1S5J A;  2OPR A;  5J2P A;  4DR7 K;  3IG1 A;  1TAQ A;  1XUP O;  4FLY A;  1YI2 N;  4AQY K;  1ATR A;  3KKR A;  3NE6 A;  4KRF A;  1Z25 A;  3EE8 A;  1UOC A;  2GWJ A;  3C7N A;  3CXC M;  2A42 A;  4TSX A;  2QK9 A;  3RMA A;  4JI6 K;  4M3R A;  4Z4F A;  4DV6 K;  2D5R A;  2IS3 A;  5SZT A;  1REV A;  4OGC A;  1TKD A;  1NMN A;  3ENO A;  3TAR A;  1BIU A;  4CJU A;  2HHH K;  1L3S A;  5C10 A;  1YT3 A;  3ITH A;  4DR4 K;  3ZET A;  3QLH A;  3F9K A;  3M8Q A;  2GX9 A;  4BRH A;  1R59 O;  3ZCM A;  4CHQ A;  3V81 A;  3N4Q A;  2XO7 A;  3DM2 A;  1B9D A;  5ELZ A;  4DTN A;  4ISG A;  1YTU A;  3DLR A;  3OS1 A;  2P9U A;  4C1N K;  3FE1 A;  4KKO A;  2G8K A;  3AAP A;  4LFA K;  3L0Q A;  4EIA A;  4K42 A;  3ZX3 A;  2F9W A;  4CGH A;  1LV5 A;  3SI6 A;  4JLH A;  4JKB A;  4JI1 K;  3QNN A;  1JLE A;  4H5N A;  3F2K A;  3VQQ A;  4K41 A;  3VEV A;  3AVI A;  5LJV A;  3KLE A;  2YNG A;  5AQL A;  4W5O A;  3O3H A;  3QES A;  3AO4 A;  4AHS A;  3CI5 A;  1OH6 A;  3LDO A;  3FR0 A;  5HL7 L;  2V7Y A;  3TAM A;  3OA9 A;  4M45 A;  2PYJ A;  4OKJ A;  3O3G A;  2VG5 A;  4DQ8 A;  4DLG A;  3L2Q A;  1YTA A;  1RDA A;  2G8W A;  4M3T A;  4R5P A;  1YIT N;  3LP3 A;  1NK7 A;  1RDW X;  4IJA A;  1HUX A;  4FJ9 A;  2GV9 A;  2P5G A;  5KTQ A;  4DSF A;  3G4S N;  4A5A A;  1WBD A;  4DSL A;  1QE1 A;  1WB9 A;  2NLX A;  2HHW A;  4I2P A;  4FJ7 A;  2DFE A;  4OVL A;  1H1V A;  1QHT A;  4WQ5 A;  4AM7 A;  4IFV A;  1KAY A;  4H5W A;  1T6D A;  4Q0B A;  4G1Q A;  2W6L A;  4ELU A;  5BRF A;  3JYT A;  3VF4 A;  5HRN A;  3K9J A;  1ZBI A;  1YF5 L;  4IFY A;  2DPN A;  4OPK A;  1J5E K;  2RE2 A;  4CJT A;  4H0P A;  3QEW A;  2XY7 A;  3TAP A;  3KZB A;  3HYF A;  4FJ8 A;  1EWR A;  4H0O A;  1OH7 A;  4BRA A;  5HLF A;  3C94 A;  2ASM A;  1RBT A;  3BEX A;  3BGR A;  4BDZ A;  3HBT A;  1K8K B;  2OTJ N;  3EE9 A;  5LY3 A;  3R9P A;  4EHU A;  3MMV A;  1FKO A;  1KLN A;  5BRD A;  3MXJ A;  1TK5 A;  2QWR A;  5GAG P;  3GDQ A;  2E5L K;  4N76 A;  4KTW A;  4FLT A;  3SUO A;  1NGE A;  1Z26 A;  4ILJ A;  4FLU A;  4M3W A;  3VET A;  4BRD A;  1NKB A;  1NJZ A;  3J8A A;  3O1B A;  5D3G A;  1KSP A;  2PAV A;  3EZ5 A;  4B1X B;  4HUF A;  1I94 K;  5IT9 O;  1HQE A;  3DI6 A;  3THX B;  1JCF A;  4CF0 A;  3OY9 A;  3K5N A;  2O8C A;  1VSK A;  1QSL A;  3U4L A;  3G0Z A;  4BRK A;  4DUZ K;  1RT2 A;  4CI6 A;  1RFQ A;  4WQ4 A;  1VQO N;  1WSF A;  3CJC A;  4NYF A;  3OVN A;  4I6M A;  5HP1 A;  1WSH A;  3T1A A;  5KQD A;  3HL8 A;  1BOT O;  3MN6 A;  2JGU A;  1BDG A;  4KHP K;  3A0I X;  2BE2 A;  2O8D A;  1RDD A;  3HT3 A;  2HBL A;  2O8E B;  1Z05 A;  2X74 A;  5FRO A;  3UKU A;  3J7A P;  3OJS A;  3NH2 A;  4LH4 A;  3TTF A;  3N4P A;  4CEF A;  4ISE A;  4W5Q A;  2HW3 A;  3J7Z O;  3TWH A;  4CFB A;  1XC9 A;  5C0Y A;  2EHG A;  2X6S A;  4BRC A;  4FXD A;  3HJF A;  4LFC K;  1HYS A;  3QIP A;  2A41 A;  1JXE A;  1Q7Y O;  4KHW A;  3T19 A;  3U3G A;  2QM1 A;  3V1O A;  1QTM A;  2F8T A;  3LAN A;  2D1K A;  4CVN E;  4E7J A;  1VQM N;  4I9L A;  1NNE A;  5AQP A;  2FLO A;  2HNY A;  4MQ3 A;  2KW4 A;  1EO1 A;  3BP8 A;  2FBY A;  3LDL A;  5EOY A;  1DTT A;  4CJ7 A;  3THY A;  1C1C A;  2OYQ A;  5BN9 A;  5J1E A;  3MN7 A;  1C0G A;  3KVG A;  4F2S A;  3QEV A;  5E41 A;  1JKH A;  1M90 O;  1T8E A;  3HZ6 A;  3QML A;  1TKT A;  1G15 A;  3ID8 A;  4BRQ A;  2X6N A;  1EET A;  3JAM O;  3NVK A;  1S6Q A;  3SPZ A;  3TAN A;  3MED A;  4B3O A;  4LY7 A;  4DLE A;  4ICL A;  3UKR A;  3I0S A;  3VES A;  4FW1 A;  1HMV A;  1ESV A;  3K57 A;  3HSC A;  2YCH A;  3A5N C;  3EKU A;  3CCR N;  4A62 A;  2VWK A;  1Q86 O;  4BWJ A;  4JI3 K;  3RR7 A;  3AVC A;  1U04 A;  4FLW A;  3QBX A;  4HUE A;  2BGG A;  4E1J A;  5HBM A;  3ZT2 A;  1BQN A;  1RBR A;  4CJ4 A;  1EP4 A;  3SZ2 A;  4YOR A;  5M1O A;  1VQK N;  4Z4C A;  1NGG A;  3WNH A;  1NK6 A;  4FVU A;  1RTI A;  4ZTJ A;  4KBO A;  1K8K A;  4DTJ A;  2D0O A;  4MO4 A;  4DTM A;  1A5V A;  4EAH D;  4KAZ A;  1RBV A;  4WFB L;  4HWI A;  2UU9 K;  3HM9 A;  3P31 A;  5T7B A;  2YNF A;  3CJ7 A;  2NRW A;  1NGB A;  4GV3 A;  3MEE A;  5AQG A;  3AV9 A;  4FOI A;  1YXQ A;  2KFZ A;  4MDA A;  4JYA K;  1WBB A;  4ZTF A;  4IDH A;  1L3U A;  4IG0 A;  3VQ5 A;  1C0F A;  1W0H A;  1BHL A;  3MN5 A;  3OYI A;  2YI1 A;  4JKC A;  1U49 A;  2VG7 A;  5AR0 A;  4CJ3 A;  3ATV A;  3D2E B;  4C8L A;  3QNO A;  3LZJ A;  4LFB K;  1J5O A;  4CHP A;  1QS4 A;  2AA4 A;  5AQX A;  2ASP A;  4KHU A;  2UUB K;  3MN9 A;  4PKH A;  1T7P A;  2WON A;  4LF4 K;  5DMR A;  4K8X A;  3O6W A;  4FWN A;  1QQN A;  4LSN A;  3LWM A;  3W0L A;  3AO5 A;  4B9T A;  2IDO A;  2OPS A;  1IKX A;  4E0D A;  2GWK A;  1CXU A;  4NLB A;  3M8R A;  2J4R A;  4CJR A;  2A1R A;  3SUN A;  1YVN A;  2E1Z A;  2JLE A;  5TKY A;  4JI5 K;  3CJ1 A;  3FZF A;  4CEQ A;  3DXK B;  3AVH A;  3QO9 A;  4E7I A;  4CJK A;  4IKF A;  2QXF A;  3LP1 A;  2IOC A;  1XWL A;  2HF4 A;  3IKM A;  4BRG A;  3BDP A;  4FJH A;  1NK4 A;  4DFJ A;  3VQD A;  1S3X A;  3HTV A;  4LF8 K;  5JMV A;  3CIP A;  4JRQ A;  3NHG A;  3OW2 M;  3RMD A;  1ASW A;  3MCP A;  5CZ1 A;  4RWT A;  4F3T A;  3UIQ A;  3SQ2 A;  3I8B A;  3CC7 N;  2GTD A;  5AQW A;  2Q2R A;  3E1Y A;  4IEI A;  3ZT4 A;  4FPB A;  4CBU A;  5M1F A;  4G9Z A;  1NK5 A;  1TGO A;  2HNZ A;  1BI4 B;  2D0B A;  5AQZ A;  3IS9 A;  2HMI A;  4CFA A;  2NRX A;  1JCG A;  3O3F A;  3HP9 A;  3HST B;  3AA3 A;  3CCL N;  4O8K A;  2QWM A;  4A2B A;  1IBM K;  4PQU A;  4RW4 A;  3NGY A;  4DS4 A;  1S1T A;  3AGR A;  5I9E B;  4FZY A;  4DSJ A;  2KKZ A;  1IBK K;  4IO9 L;  1QZ6 A;  2OAN A;  3A5O C;  1MWK A;  1JJ2 M;  4K8Z A;  1YJN N;  4CZL A;  5J2Q A;  2HOE A;  3NF9 A;  2I7N A;  1IV0 A;  2ASO A;  4A57 A;  3SYZ A;  4GY2 B;  1LWF A;  1WAF A;  1W97 L;  1M1K O;  1HYV A;  4XH5 A;  3VEX A;  4YHH K;  1O1W A;  2V7Z A;  4CBW A;  4B1U B;  3OYD A;  2E1Y A;  3C6A A;  3GL1 A;  1D8Y A;  3TTD A;  3QB0 A;  4FJ5 A;  1I39 A;  3BZK A;  4CHN A;  4DS5 A;  4XH1 A;  4BE2 A;  1YVU A;  5CY4 A;  4M42 A;  3OYH A;  3OTO K;  1S1U A;  4OGE A;  2G8U A;  1W7A A;  2KTQ A;  3LDQ A;  4KTQ A;  3O9R A;  2YHY A;  3CCM N;  2NRT A;  1L5U A;  4KH5 A;  1VSH A;  4BQL A;  1C6V A;  1NBW A;  1HNV A;  1U47 A;  3WT0 A;  4EFH A;  4CHO A;  5IWA K;  4EP4 A;  3PX6 A;  1HNI A;  2F9T A;  3DLG A;  4H0V B;  4KV8 A;  3CC2 N;  2E20 A;  4E7H A;  1BCO A;  3LAL A;  3VOV A;  1IBL K;  1TAU A;  3EEQ A;  3TAB A;  1RT1 A;  5FPN A;  3ID6 A;  5E84 A;  5AQO A;  1N5Y A;  3VEW A;  1S22 A;  4CCH A;  4CED A;  1LOT B;  5CR4 A;  3LDP A;  3CQ8 A;  1OH5 A;  1MWM A;  4Z0U A;  3O80 A;  3OYA A;  3AVA A;  4LD0 A;  1NJW A;  3WNF A;  3G25 A;  2CH6 A;  3CMA N;  3VTH A;  3UB5 A;  1TK0 A;  3HO1 A;  1NOY A;  1U2V A;  5K14 A;  4I9Q A;  3VF6 A;  1S1V A;  1LW0 A;  1P8Z A;  2YKM A;  5F0X A;  4O5F A;  1Q82 O;  3MDQ A;  4IJN A;  1TUU A;  4CJW A;  1MU2 A;  1HNW K;  1OVQ A;  3VER A;  5I3U A;  4CEC A;  1KTQ A;  2WTU A;  3QEI A;  4FJN A;  1SKR A;  3CET A;  3O1W A;  2P9K A;  4BRN A;  2YNH A;  3WEE A;  3PLA A;  2NZT A;  1SUQ A;  3CCV N;  2IVO A;  3C95 A;  1ASU A;  3L8B A;  1ASV A;  3LM9 A;  3O4N A;  4FWP A;  3DXM B;  3K2P A;  3LAK A;  2E4L A;  2F96 A;  3CCU N;  4FL9 A;  3WEE B;  2P9K B;  2HHV A;  3L4I A;  3O4Q A;  1RT7 A;  3DMJ A;  4B9Q A;  3NH0 A;  1VRT A;  3VF2 A;  5AZJ A;  4BRF A;  1E4G T;  3AAQ A;  3K59 A;  4NB4 A;  5JLH A;  4BRE A;  4B3T K;  1VSJ A;  5A2Q O;  2P9L A;  4FWS A;  3NCI A;  1W9H A;  3AGK A;  5H1S Q;  3H45 C;  3I33 A;  3ZSV A;  1JLG A;  4JAX A;  3SJH A;  2NNW A;  1TKZ A;  1JL2 A;  1S1X A;  4ZHR A;  1FXX A;  1NJI O;  4BRM A;  1C0M A;  4BC4 A;  5JVH L;  4UY8 O;  3OHR A;  1GLL O;  4M41 A;  3FGU A;  1HJR A;  2QKB A;  1VHX A;  3WUH A;  3CQX A;  4AF1 A;  2CGL A;  2CH5 A;  2D0P A;  3FFK B;  1DT9 A;  3H46 O;  4AHT A;  3R8E A;  4H0X B;  5KQ8 A;  1N33 K;  3CCS N;  4NXN K;  3ULE A;  4WCE L;  1X9J A;  4PWD A;  4AH9 A;  3B6P A;  4DSE A;  5GIN A;  1SV5 A;  4WE1 A;  4N47 A;  1X9S A;  2DFF A;  1UA0 A;  4KI6 A;  4BR4 A;  1Q81 O;  4FLZ A;  1IG9 A;  2FC0 A;  2VQF K;  2W41 A;  3CF5 L;  1IKW A;  2UXD K;  1RDB A;  3ULE B;  4BG9 A;  1LCU A;  5SWM A;  5GIO A;  2XY6 A;  5CZ2 A;  1QSY A;  4DSI A;  1VQL N;  4KB1 A;  3S9H A;  1S9G A;  3ZSY A;  4JRP A;  2OZS A;  4RW6 A;  1QQC A;  5E26 A;  1JLC A;  4N41 A;  4C8N A;  1KFD A;  2HVH A;  2ZE2 A;  2VQE K;  3SUP A;  3CFP A;  4KTZ A;  4BRL A;  4BR2 A;  4WFN L;  2VWB A;  3THY B;  1HLU A;  5JS2 A;  4CJV A;  1NGA A;  2Q36 A;  3VGK A;  1T6C A;  2QKK A;  4CZF A;  4I2Q A;  3DLK A;  3CM5 A;  3H08 A;  4M7Y A;  3VTI A;  3D2F B;  3RR8 A;  3WQU A;  4AHV A;  3HVR A;  2ZD1 A;  4FK2 A;  1ZBU A;  3ZYY X;  4YDU C;  4F9O A;  4FK4 A;  5B8H A;  3KLG A;  3ZX0 A;  5M1Q A;  1NK8 A;  4CW7 B;  2RPI A;  4IOA L;  3CER A;  3VEY A;  4F4K A;  2DFH A;  1KC8 O;  2HBJ A;  3V1R A;  4O0J A;  2O8B B;  2ZJQ L;  4F2R A;  3CME N;  1Q9Y A;  1YJ9 N;  2VWJ A;  4CJL A;  3TU5 A;  4DV2 K;  5FRM A;  1BIS A;  3NVM A;  3IFR A;  1GLB G;  4JK7 A;  4KHN A;  5AQY A;  1A5W A;  2OPQ A;  3AAR A;  4MDB A;  3ZSZ A;  2A6A A;  3SUQ A;  3FZH A;  3PO4 A;  3TTC A;  3QDK A;  4M3X A;  4JV5 K;  2QW9 A;  1KFS A;  4FJJ A;  2GEL A;  4X64 K;  4JKG B;  1YUW A;  5CYQ A;  2HHX A;  3DOK A;  3HOS A;  3NF6 A;  1RGI A;  3FZM A;  4YDU A;  3ZEU A;  3S3M A;  1B9F A;  2UUC K;  1U6Z A;  5JS1 A;  4OKE A;  4OX9 K;  2GUP A;  4CF8 A;  4LF7 K;  3ENH A;  3WNE A;  3ZSX A;  5F1X A;  1Q9X A;  2ZQB A;  4A61 A;  2OA8 A;  5AQV A;  1FK9 A;  3VMF B;  3LWL A;  2B5J A;  3RRG A;  3U9D A;  2BTF A;  4QCL A;  4FJK A;  1LAW A;  1NGI A;  4CZE A;  1KAX A;  1T3V A;  3H1V X;  5LMN K;  1OH8 A;  4CFC A;  3V9W A;  3O9S A;  3NH1 A;  1NGD A;  3AVF A;  3E01 A;  1UA1 A;  4FJG A;  3UKU B;  4EZ6 A;  4FK0 A;  2A5X A;  1HQU A;  1BG3 A;  1KQS M;  1VSF A;  3LP0 A;  4GV9 A;  2YV0 X;  4JKH A;  1KCF A;  3O5B A;  1CZA N;  2HVI A;  4CK1 A;  4B08 A;  4ELV A;  4KPY A;  1DKG D;  3NF8 A;  4ID5 A;  4DTS A;  1CZ9 A;  4KO0 A;  5AZJ B;  4CIE A;  2Q97 A;  2Z1G A;  1SZ2 A;  1XHZ A;  1N34 K;  2QTD A;  4FM0 A;  2E8A A;  3SBT A;  4DQR A;  3LP2 A;  4ISF A;  4CZK A;  3JXU A;  1X9M A;  3LM2 A;  4QOZ B;  4OLB A;  2BH1 A;  4BE1 A;  3IAY A;  2HBK A;  3O08 A;  5AQQ A;  1U4B A;  5CYM A;  1Y64 A;  2P9S A;  2JWK A;  4B8A B;  4O55 A;  1VQN N;  2QWO A;  1Z6R A;  2ITM A;  4JKG A;  4Z4G A;  1HJO A;  3SQ1 A;  5HRR A;  3RTV A;  2GUI A;  3U9Z A;  2YJE A;  4CK2 A;  3S3O A;  3VA3 A;  5AQJ A;  4BG8 A;  3HI0 A;  4OJR A;  3ZSQ A;  3AA5 X;  3ZSO A;  4B9U A;  2ZGY A;  3QFP A;  4WQ5 C;  1RT5 A;  2KZZ A;  1TV6 A;  1TYQ B;  2BUP A;  1JLA A;  5KPT A;  4JI0 K;  4DR6 K;  2O4G A;  3L3U A;  3OYM A;  3LPU A;  1KVA A;  3I0R A;  1SL1 A;  4HCC A;  4WF9 L;  1K73 O;  3AVN A;  1BI4 A;  2QA4 N;  3DRS A;  2IIR A;  2O8D B;  3VQ9 A;  4YY3 K;  4KI4 A;  1FJG K;  3DYA A;  4K25 A;  4BDP A;  3NBP A;  4BR5 A;  4DWI A;  4J2A A;  4DQQ A;  4MLE A;  4X65 K;  4C8M A;  3GE1 A;  3BF3 A;  3QBW A;  3VGL A;  4DFK A;  4E7K A;  3HM8 A;  4PL8 A;  2PY5 A;  4EP5 A;  4CGD A;  2ZWH A;  3DXK A;  3QEX A;  3L2R A;  3D45 A;  3MXM A;  3TAQ A;  1YHQ N;  3UE5 A;  3WXJ A;  3AA4 A;  2IVP A;  1BQM A;  1BUP A;  5HRP A;  3SQ0 A;  2F4V K;  2H3G X;  2A3Z A;  1KVB A;  1KVC A;  4DSK A;  4CE9 A;  3OS2 A;  4U7B A;  4O5B A;  4H4O A;  3K0S A;  4A5B A;  2QI2 A;  1JLQ A;  5AQU A;  4Z4I A;  5M1P A;  3KD1 E;  2VGM A;  1JLF A;  3P39 A;  2XY5 A;  2YNI A;  2YHB A;  1D9F A;  4JN4 A;  2FF6 A;  1V4S A;  1QQO A;  1TKX A;  1P90 A;  3GOI A;  4QS7 A;  1Q18 A;  3HK2 A;  2AP1 A;  1BWF O;  1RNH A;  1EQY A;  4RW8 A;  1QHA A;  3R1X A;  4H5V A;  4BVO A;  3RRH A;  4BGA A;  3CQY A;  1IH7 A;  3HPO A;  2YHW A;  4JK9 A;  3NF7 A;  3EYZ A;  3OYN A;  1RT6 A;  1X3M A;  4JS5 A;  1N6Q A;  3MEC A;  3G6E N;  4DTR A;  3M3Z A;  3ALY A;  3B8A X;  2RHK A;  3WXM B;  2OZM A;  4FWK A;  4IZ9 A;  1XC3 A;  4EZ9 A;  2EWS A;  1RBU A;  1G99 A;  2VGN A;  3MAQ A;  3V1Q A;  2UXB K;  3K58 A;  1WNS A;  4CF2 A;  1DLO A;  1SL2 A;  2IGI A;  3EL2 A;  3KKS A;  3EY1 A;  3THV A;  4KHQ A;  4NCB A;  4J8F A;  1N32 K;  3TSU A;  3ZT0 A;  1QSS A;  3D2F A;  4XIU A;  4IDK A;  1L3T A;  1KD1 O;  2QWP A;  3ZT3 A;  1D5A A;  3QFU A;  3OYG A;  4CJQ A;  4CES A;  3PSF A;  5AQI A;  4LF5 K;  4DV4 K;  1XMO K;  2XY8 A;  1RCH A;  5I42 A;  3CPE A;  4B1V A;  1SAZ A;  3LPT A;  5BN8 A;  4GMJ B;  1X1P A;  3M8P A;  3SK3 A;  1K9M O;  4LF9 K;  4CEA A;  5AQN A;  3SCX A;  2I7P A;  2DY4 A;  4FLV A;  4IFE A;  5FDL A;  5JVG L;  3M1F A;  1R0A A;  1WUA A;  1C1B A;  2YKN A;  1C0T A;  5BRE A;  2PFU A;  1SQK A;  4BQZ A;  3QIC A;  3OYJ A;  3CD6 N;  4DV0 K;  2FBV A;  1GLD G;  3IMX A;  3AO1 A;  1XNQ K;  4DU4 A;  1YAG A;  4CK3 A;  4PA1 A;  2KHO A;  5AQF A;  4JK8 A;  4U67 L;  1TK8 A;  3K9K A;  4DG1 A;  1HNZ K;  1LAV A;  3MK6 A;  4B3M K;  4BRI A;  4B9N A;  4BY9 C;  4HVJ A;  4FLX A;  1TUY A;  1UAX A;  2P9S B;  3AY9 A;  3BY5 A;  3M6G A;  3PX4 A;  4YFU A;  2P9N B;  4FO0 A;  4B9V A;  1VSE A;  5AFU H;  4C1N I;  5FPE A;  3OYB A;  1NLV A;  4Y1C A;  3V9S A;  3OS0 A;  2Q0U A;  2G8I A;  3O9Q A;  1NM1 A;  1V4T A;  3ZSR A;  4Y0W A;  3E9P A;  4KB0 A;  4FPA A;  4J2B A;  3E66 A;  1VQ5 N;  3NMU A;  5EX5 A;  4BWM A;  3L2W A;  5MLC Q;  2R7Y A;  2O8F A;  5AQK A;  2KFN A;  1A5X A;  3LZI A;  2Y1I A;  3U8X A;  1BA0 A;  3C6H A;  3SV3 A;  4FSV A;  1W2B M;  3RMB A;  3VQE A;  5DK5 A;  3V9X A;  1NG9 A;  2RF2 A;  2BAN A;  2HB5 A;  4WFA L;  4CFD A;  4FM1 A;  4CD3 A;  3FLC O;  4BRP A;  2G8H A;  1T44 A;  2VG6 A;  3CHW A;  3KIO A;  1SL0 A;  3CPW M;  3ZLJ A;  3HPH A;  3OYK A;  3KJV A;  2P9U B;  5BPN A;  1IKV A;  2E2N A;  2G8F A;  2FSN A;  3NAE A;  4BC3 A;  3OYF A;  1NGF A;  5EVZ A;  4KH4 A;  3WNG A;  3KK3 A;  4FWQ A;  2BDP A;  4H8K A;  4FWM A;  3IRX A;  1HKG A;  2WUS A;  3ZET B;  3SAF A;  3KLF A;  5GAH P;  4JS4 A;  4HCB A;  4CBX A;  4AIL C;  3EZW A;  1GOC A;  3AVL A;  4PL7 A;  3RSE B;  5GIP A;  5C12 A;  2KQ2 A;  3IUC A;  1JLB A;  1XI1 A;  3KK7 A;  5KRT A;  2UUA K;  3C0B A;  4B3S K;  4Z4E A;  1VQ6 N;  4CEB A;  2Q1N A;  3FZK A;  1RT4 A;  1JCE A;  3TAG A;  4JI7 K;  1OVY A;  3AVM A;  4B8C A;  5C2F A;  3H1Q A;  3DLB A;  2HBM A;  2XHB A;  4FZZ A;  4YOX A;  4DR1 K;  4F8R A;  4J2E A;  2YHX A;  5ADX A;  1WAJ A;  4QS8 A;  5BRH A;  2P9P A;  3J81 O;  5AZI A;  3KD5 E;  3VQ4 A;  4CD1 A;  4AHC A;  1SKS A;  4DV1 K;  3PO5 A;  4L8R B;  2O8B A;  5DM7 L;  5FRN A;  1EX4 A;  1WN7 A;  1U2V B;  2ZF5 O;  4H0T B;  4GV6 A;  1NOZ A;  2W6K A;  4B1W B;  4QAG A;  2E2O A;  2W42 A;  1TL1 A;  4BGB A;  3OYL A;  2RKI A;  2Z1H A;  3KLI A;  4BVP A;  2P9N A;  2QWQ A;  3ULD A;  3A5M C;  4DU3 A;  1E4F T;  4CF9 A;  4CIG A;  4BR7 A;  3QIN A;  1ZYQ A;  3SV4 A;  4LF6 K;  2WBN A;  3HP6 A;  4I7F A;  1OKJ A;  4Z4H A;  1GLF O;  3CC4 N;  3CFO A;  2V51 B;  3L6Q A;  4X62 K;  5BPM A;  1HRH A;  3O9U A;  4B3R K;  1NGC A;  4O44 A;  4BC5 A;  4NLC A;  2WFB A;  5M1N A;  4HTL A;  4YNQ A;  4DF4 A;  1BA1 A;  4CEE A;  3A2F A;  1X9W A;  3AO2 A;  4JD2 A;  3G10 A;  2P9I B;  5AQR A;  3DRP A;  3D6R A;  3JSM A;  3GBT A;  4FWL A;  4DMN A;  3G71 N;  1UWB A;  2NRR A;  1B92 A;  4K43 A;  4E1N A;  4YOU A;  4CF1 A;  4FJL A;  3WXL A;  3VA0 A;  5F2R A;  5ADX H;  4R79 A;  4H5T A;  3SBG A;  3SMS A;  2P9L B;  2HST A;  1LWE A;  2P51 A;  3HVT A;  3OYC A;  1VQ7 N;  1LW2 A;  3RVC A;  1J54 A;  3BF1 A;  3MX5 A;  3T69 A;  2JWL A;  2ZGZ A;  4CEO A;  4M3Z A; 
#chains in the Genus database with same CATH homology
 3NH1 A;  2FBX A;  3AVF A;  3E01 A;  3P1G A;  5DMR A;  1UA1 A;  1NKE A;  1NKC A;  4B9S A;  4FJG A;  4K8X A;  4J2D A;  4EZ6 A;  4Q5V A;  4LSN A;  4FK0 A;  3VQ8 A;  1HQU A;  1WSE A;  3LWM A;  3AO5 A;  4B9T A;  2IDO A;  2OPS A;  1VSF A;  5KGW A;  3OYE A;  1IKX A;  3LP0 A;  4DTO A;  3TI0 A;  2YV0 X;  1FKP A;  1ZBL A;  4E0D A;  4FVM A;  1CXU A;  1KCF A;  2O4I A;  1T05 A;  3PX0 A;  4DQI A;  3AO3 A;  1VSL A;  3M8R A;  2HVI A;  4CK1 A;  4CJR A;  2A1R A;  4B08 A;  4ELV A;  3ZSW A;  3SUN A;  3NF8 A;  4KPY A;  4ID5 A;  3ZT1 A;  1VSD A;  2JLE A;  4DTS A;  1WSG A;  4FZX C;  1CZ9 A;  4KO0 A;  1C0U A;  4CIE A;  4CEQ A;  1ZBH A;  1DTQ A;  2Z1G A;  4HUG A;  2ETJ A;  2A1S A;  3AVH A;  3QIO A;  3QO9 A;  4E7I A;  1XHZ A;  4W5R A;  2PZS A;  4CJK A;  4IKF A;  4FM0 A;  4DQR A;  2QXF A;  1C1A A;  1RBS A;  2D0C A;  2IOC A;  3LP2 A;  3LP1 A;  1XWL A;  5KI6 A;  3BDP A;  3VQP A;  4FJH A;  1JXB A;  1Y97 A;  4DFJ A;  1NK4 A;  3VQD A;  4E89 A;  3HPG A;  1X9M A;  2G8V A;  1I3A A;  4QOZ B;  4OLB A;  1IKY A;  4BE1 A;  1RIL A;  3IAY A;  3VQC A;  4JRQ A;  3NHG A;  3RMD A;  1ASW A;  5CZ1 A;  5CYM A;  5HRO A;  1U4B A;  4F3T A;  4B8A B;  3UIQ A;  4O55 A;  3SQ2 A;  1D9D A;  4Z4G A;  3SQ1 A;  5C24 A;  4RG8 A;  4E7L A;  3CG7 A;  5HRR A;  3RTV A;  1CZB A;  2GUI A;  3V4I A;  2Z1J A;  3F73 A;  1GOB A;  1RT3 A;  3ZT4 A;  4CK2 A;  4DTU A;  3S3O A;  3VA3 A;  4FW2 A;  1WSJ A;  4ID1 A;  4CEZ A;  5C42 A;  1J9A A;  1NK5 A;  4DF8 A;  2HHQ A;  1TGO A;  4E3S A;  3AVB A;  2HNZ A;  1VSM A;  4OJR A;  1BI4 B;  3ZSQ A;  2D0B A;  3AA5 X;  3ZSO A;  3CYM A;  1GOA A;  3IS9 A;  1NK9 A;  4B9U A;  4E1M A;  1RT5 A;  4CJS A;  2HMI A;  2KZZ A;  4BE0 A;  3ISN C;  4CFA A;  1TV6 A;  4LH5 A;  3CFR A;  3V9U A;  3O3F A;  1L3V A;  3PY8 A;  3HP9 A;  3HST B;  1JLA A;  3AA3 A;  4CGG A;  2O4G A;  4PQU A;  3L3U A;  4FJI A;  5KRS A;  4RW4 A;  3NGY A;  1K6Y A;  4Y1D A;  2RN2 A;  3LPU A;  3OYM A;  4DS4 A;  4KHS A;  1S1T A;  1KVA A;  3I0R A;  1SL1 A;  4HCC A;  4FZY A;  4DSJ A;  3AVN A;  1BI4 A;  1S5J A;  3DRS A;  3S3N A;  2OPR A;  1CXQ A;  5J2P A;  3IG1 A;  3VQ9 A;  4K8Z A;  5J2Q A;  4MFB A;  4KI4 A;  1TAQ A;  3DYA A;  3NF9 A;  4DQS A;  4FLY A;  2GBZ A;  4BDP A;  3NBP A;  4DWI A;  4J2A A;  3KKR A;  3NE6 A;  4KRF A;  4DQQ A;  3U6F A;  1Z25 A;  4C8M A;  2NUB A;  1UOC A;  4B9M A;  3SNN A;  3QEP A;  4PY5 A;  3SYZ A;  4DFK A;  4E7K A;  1LWF A;  1WAF A;  4TSX A;  2PY5 A;  2QK9 A;  3RMA A;  4EP5 A;  1HYV A;  4M3R A;  3VQ6 A;  1O1W A;  4CGD A;  3QEX A;  3OYD A;  3L2R A;  4Z4F A;  2D5R A;  3HXM A;  2KZM A;  3D45 A;  2IS3 A;  5SZT A;  3MXM A;  3LDS A;  3TAQ A;  1CLQ A;  1REV A;  1D8Y A;  4OGC A;  2HHS A;  1TKD A;  3B6O A;  3TAR A;  2D0A A;  4FJ5 A;  4CJF A;  1BIU A;  1I39 A;  4CHN A;  4CJU A;  3SQ4 A;  1L3S A;  1YT3 A;  3AA2 A;  3ITH A;  4DS5 A;  3AA4 A;  4AHR A;  1U48 A;  4BE2 A;  1RTD A;  1YVU A;  3QLH A;  1RTH A;  1BQM A;  5HRP A;  4ELT A;  3F9K A;  3M8Q A;  5CY4 A;  3SQ0 A;  4M42 A;  4CIF A;  3OYH A;  3MXI A;  1S1U A;  1KVB A;  3SJJ A;  4FJM A;  3ZCM A;  2B6A A;  1KVC A;  4DSK A;  4CE9 A;  4OGE A;  2G8U A;  4CHQ A;  3V81 A;  3OS2 A;  4O5B A;  4H4O A;  2XO7 A;  1WSI A;  4CJE A;  3DM2 A;  2KTQ A;  1B9D A;  1JLQ A;  4CGF A;  4KTQ A;  3PV8 A;  4DTN A;  1L5U A;  4Z4I A;  1YTU A;  3DLR A;  3OS1 A;  1VSH A;  3KD1 E;  1JLF A;  2XY5 A;  4KKO A;  2G8K A;  1C6V A;  2YNI A;  4CJP A;  3DLE A;  1HNV A;  4O0I A;  1U47 A;  4NYN A;  2YHB A;  4CHO A;  1ITG A;  1D9F A;  4EP4 A;  3OJU A;  1RDC A;  1TKX A;  3PX6 A;  1HNI A;  4PUO A;  1NJY A;  3HK2 A;  3DLG A;  1RNH A;  4CGH A;  4NCG A;  4KV8 A;  1LV5 A;  3SI6 A;  4RW8 A;  4JLH A;  3RRH A;  2OPP A;  4AHU A;  1IH7 A;  4E7H A;  3HPO A;  1BCO A;  3LAL A;  1HYZ A;  3QNN A;  3NF7 A;  3EYZ A;  3OYN A;  1JLE A;  1TAU A;  1RT6 A;  3TAB A;  1RT1 A;  2F8S A;  4JS5 A;  1N6Q A;  4FJX A;  1N5Y A;  3VQQ A;  3MEC A;  4DTR A;  4CED A;  4CCH A;  3ALY A;  3AVI A;  4IBN A;  3CQ8 A;  1BL3 A;  4Z0U A;  2OZM A;  1SKW A;  3VQB A;  3OYA A;  3KLE A;  1U45 A;  3AVA A;  3NFA A;  4LD0 A;  1NJW A;  3WNF A;  2YNG A;  3O3H A;  4W5O A;  3QES A;  3AO4 A;  4EZ9 A;  1RBU A;  3K5O A;  4AHS A;  1TK0 A;  3MAQ A;  3V1Q A;  3HO1 A;  1NOY A;  3TAM A;  4M45 A;  2PYJ A;  4OKJ A;  5K14 A;  2VG5 A;  3L3V A;  4CGJ A;  1WNS A;  3O3G A;  4CF2 A;  3K58 A;  4DLG A;  1DLO A;  4I9Q A;  3L2Q A;  1YTA A;  1RDA A;  1U49 A;  1SL2 A;  2G8W A;  2PYL A;  1S1V A;  2IGI A;  3KKS A;  3LP3 A;  4R5P A;  3EY1 A;  3THV A;  1NK7 A;  1LW0 A;  2YKM A;  4KHQ A;  4NCB A;  3ZT0 A;  1QSS A;  4C8O A;  3NGI A;  2HHU A;  3VN5 A;  4FJ9 A;  2GV9 A;  2P5G A;  5KTQ A;  2ATQ A;  4DSF A;  4XIU A;  4IDK A;  1IO2 A;  1L3T A;  3I8D A;  3ZT3 A;  1D5A A;  4CJW A;  1MU2 A;  4DSL A;  3OYG A;  1QE1 A;  4CER A;  4CES A;  4CJQ A;  3T3F A;  3CM6 A;  3DRR A;  5I3U A;  2HHW A;  4I2P A;  4FJ7 A;  1BIZ A;  2DFE A;  4CEC A;  3KK1 A;  2XY8 A;  3DLH A;  4OVL A;  1KTQ A;  1RCH A;  3TAE A;  5I42 A;  4NCA A;  4CHY A;  2B4J A;  1QHT A;  3QEI A;  4FJN A;  2LSN A;  1SKR A;  4IFV A;  2XRI A;  1XHX A;  3LPT A;  3VQA A;  2YNH A;  3RMB A;  4Q0B A;  4GMJ B;  4M3Y A;  1X1P A;  3M8P A;  4G1Q A;  4ELU A;  1SUQ A;  2HND A;  3JYT A;  4CEA A;  3KLH A;  3SCX A;  1S1W A;  5HRN A;  2HHT A;  3C95 A;  1ASU A;  4FLV A;  4HHT A;  5FDL A;  3K5L A;  1ZBI A;  3L8B A;  2DY4 A;  1ASV A;  3O4N A;  4IFY A;  3K2P A;  3LAK A;  1R0A A;  2E4L A;  4OPK A;  1C1B A;  2YKN A;  3PUF A;  3FFI A;  1C0T A;  3AVJ A;  2F96 A;  3QER A;  3RMC A;  4CJT A;  3QEW A;  2DTU A;  4FM2 A;  2XY7 A;  3TAP A;  2HHV A;  3HYF A;  5J2M A;  3OYJ A;  4FJ8 A;  2FBV A;  3O4Q A;  3P83 D;  3RWU A;  1RT7 A;  4BAC A;  3NDK A;  5HLF A;  3C94 A;  1RBT A;  3AO1 A;  1RTJ A;  3DMJ A;  3BGR A;  3K5M A;  4BDZ A;  4DU4 A;  3C6U A;  4CK3 A;  3NH0 A;  1VRT A;  4PA1 A;  3AVG A;  1FKO A;  1KLN A;  3K59 A;  3MXJ A;  1TK5 A;  1TK8 A;  1ZBF A;  1LWC A;  3L2V A;  4N76 A;  4DG1 A;  1HPZ A;  1S6P A;  1LAV A;  4KTW A;  4FLT A;  3SUO A;  1VSJ A;  4KFB A;  4B9N A;  2ITG A;  3NCI A;  4HVJ A;  4FLX A;  1W9H A;  1Z26 A;  4FLU A;  3TAF A;  3ZSV A;  1JLG A;  4M3W A;  1NKB A;  1UAX A;  1NJZ A;  4UQG A;  1TKZ A;  3PX4 A;  5D3G A;  1JL2 A;  4YFU A;  3L2U A;  1S1X A;  3EZ5 A;  1KSP A;  4B9V A;  1VSE A;  4ZHR A;  1FXX A;  3OYB A;  4Y1C A;  4HUF A;  3OS0 A;  3V9S A;  2G8I A;  1C0M A;  4F3O A;  1EKE A;  3ZSR A;  4KB0 A;  1HQE A;  3DI6 A;  4M41 A;  1VRU A;  4J2B A;  4CF0 A;  3OY9 A;  3K5N A;  1HJR A;  2QKB A;  4BWM A;  1VSK A;  3L2W A;  2R7Y A;  1QSL A;  3G0Z A;  1RT2 A;  2KFN A;  1A5X A;  4O4G A;  3LZI A;  4CHZ A;  3V9Z A;  2Y1I A;  3SV3 A;  3C6T A;  1WSF A;  4NYF A;  3OVN A;  3P5J A;  5DK5 A;  3VQE A;  4AHT A;  3QET A;  2X78 A;  1VK0 A;  4LSL A;  3V9X A;  1WSH A;  3T1A A;  5HP1 A;  2RF2 A;  3HL8 A;  4OKK A;  2BAN A;  1KLM A;  2JGU A;  2HB5 A;  5C25 A;  4PWD A;  4AH9 A;  3B6P A;  4CFD A;  4DSE A;  4FM1 A;  2BE2 A;  1SV5 A;  4WE1 A;  1RDD A;  1TL3 A;  4N47 A;  2Q3S A;  3HT3 A;  1X9S A;  2G8H A;  2VG6 A;  1NK0 A;  2DFF A;  3KIO A;  5HRS A;  1UA0 A;  1KRP A;  4KI6 A;  1JL1 A;  2IC3 A;  1SL0 A;  4FLZ A;  1IG9 A;  2FC0 A;  3HPH A;  2X74 A;  5FRO A;  3OYK A;  3KJV A;  1IKW A;  3OJS A;  3KK2 A;  4N5S A;  3NH2 A;  1RDB A;  2P5O A;  1IKV A;  4LH4 A;  5SWM A;  4DTP A;  2G8F A;  3ASM A;  4DFP A;  2XY6 A;  5CZ2 A;  1QSY A;  4CEF A;  4W5Q A;  5KGX A;  4DSI A;  2HW3 A;  1BCM A;  3TWH A;  4CFB A;  3NAE A;  3OYF A;  1XC9 A;  4KB1 A;  3S9H A;  2EHG A;  1S9G A;  2X6S A;  3WNG A;  3KK3 A;  2BDP A;  3ZSY A;  4FXD A;  4H8K A;  4JRP A;  4DQP A;  3HJF A;  2OZS A;  4RW6 A;  1HYS A;  3QIP A;  3IRX A;  1JXE A;  4KHW A;  2Y1J A;  3T19 A;  4E19 A;  3LAM A;  3U3G A;  3KLF A;  4JS4 A;  1Q8I A;  4GVM A;  4HCB A;  1QQC A;  4AIL C;  2WOM A;  3V1O A;  1QTM A;  2F8T A;  3LAN A;  1GOC A;  1JLC A;  4E7J A;  3AVL A;  4N41 A;  4I9L A;  4C8N A;  1KFD A;  2HVH A;  4BDY A;  4W5N A;  2HNY A;  2E6M A;  4MQ3 A;  2KW4 A;  2KQ2 A;  2ZE2 A;  3SUP A;  3CFP A;  1JLB A;  4KTZ A;  5KRT A;  1XI1 A;  2FBY A;  4Z4E A;  1DTT A;  2OYQ A;  1C1C A;  4CEB A;  5JS2 A;  4CJV A;  5J1E A;  1RT4 A;  2YHA A;  4F2S A;  3TAG A;  1EXQ A;  2QKK A;  3QEV A;  3AVM A;  4B8C A;  5E41 A;  1JKH A;  4I2Q A;  3DLB A;  3DLK A;  1T8E A;  2IAJ A;  2XHB A;  4IG3 A;  4FZZ A;  1TKT A;  4CJ5 A;  4F8R A;  4J2E A;  3CM5 A;  1G15 A;  4RW7 A;  1WAJ A;  2X6N A;  3SPY A;  1EET A;  3H08 A;  3RR8 A;  1S6Q A;  4AHV A;  2EX3 A;  3SPZ A;  3TAN A;  3HVR A;  2ZD1 A;  3VQ4 A;  1ZBU A;  3KD5 E;  4FK2 A;  3MED A;  4AHC A;  4B3O A;  2AJQ A;  1SKS A;  4C8K A;  4LY7 A;  4DLE A;  4ICL A;  3PO5 A;  3I0S A;  4FK4 A;  4L8R B;  4FW1 A;  5EU7 A;  1HMV A;  1EX4 A;  3KLG A;  1WN7 A;  4DTX A;  1NJX A;  5FRN A;  2P1J A;  1TVR A;  3AVK A;  1NOZ A;  3K57 A;  1NK8 A;  3KTQ A;  4M3U A;  4QAG A;  2RPI A;  4OPJ A;  3D0P A;  3NGZ A;  2W42 A;  1TL1 A;  3VQ7 A;  3OYL A;  2RKI A;  2VWK A;  4F4K A;  2DFH A;  2Z1H A;  4BWJ A;  3KLI A;  4KHY A;  3V1R A;  4O0J A;  3ULD A;  3RR7 A;  4B9L A;  3AVC A;  4KRE A;  1U04 A;  4FLW A;  4CF9 A;  1S9E A;  4DU3 A;  4CIG A;  4F2R A;  1Q9Y A;  3QIN A;  2VWJ A;  4HUE A;  2Z1I A;  3SV4 A;  1ZYQ A;  2BGG A;  4CJL A;  4OLA A;  5HBM A;  3HP6 A;  3ZT2 A;  1BIS A;  4I7F A;  1BQN A;  5FRM A;  1RBR A;  4KHN A;  4CJ4 A;  4CGI A;  1EP4 A;  4Z4H A;  3CFO A;  1A5W A;  3SZ2 A;  2OPQ A;  4DFM A;  2E6L A;  5J2N A;  4Z4C A;  1HRH A;  3WNH A;  3ZSZ A;  4FCY A;  1NK6 A;  1RTI A;  4ZTJ A;  4O44 A;  3SUQ A;  1T03 A;  3PO4 A;  4DTJ A;  4DTM A;  1A5V A;  4YNQ A;  4DF4 A;  4M3X A;  4CEE A;  4KAZ A;  1RBV A;  3A2F A;  4H4M A;  1X9W A;  3AO2 A;  3G10 A;  1BGX T;  3HM9 A;  5T7B A;  2YNF A;  1KFS A;  4FJJ A;  3DRP A;  3MEG A;  4W5T A;  3MEE A;  3JSM A;  4DMN A;  4M3T A;  3AV9 A;  1UWB A;  5CYQ A;  2HHX A;  3DOK A;  3M8S A;  2FBT A;  1B92 A;  3U3Y A;  4N56 A;  3NF6 A;  4E1N A;  4CF1 A;  4FJL A;  3S3M A;  1B9F A;  5JS1 A;  3VA0 A;  4OKE A;  4RW9 A;  2KFZ A;  1WLJ A;  4CF8 A;  4GW6 A;  3WNE A;  4ZTF A;  1L3U A;  4IG0 A;  3VQ5 A;  3ZSX A;  3DOL A;  1W0H A;  1BHL A;  2ZQB A;  3OYI A;  1Q9X A;  2OA8 A;  1F21 A;  1LWE A;  2P51 A;  1FK9 A;  2VG7 A;  3HVT A;  1VSI A;  3OYC A;  2I5J A;  4CJ3 A;  3LWL A;  4HTU A;  4DU1 A;  2B5J A;  4FYD A;  1LW2 A;  4C8L A;  3TR8 A;  1J54 A;  3LZJ A;  3QNO A;  3RRG A;  4QCL A;  4FJK A;  1J5O A;  1LAW A;  4CHP A;  1QS4 A;  4KHU A;  1J53 A;  1T7P A;  3V6D A;  4CFC A;  2WON A;  3V9W A;  4CEO A;  4M3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...