4HHTA

T. maritima rnase h2 g21s in complex with nucleic acid substrate and calcium ions
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
229
structure length
220
Chain Sequence
GIDELYKKEFGIVAGVDEASRGCLAGPVVAAAVVLEKEIEGINDSRLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKSVVFRKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HII
publication title RNase H2 roles in genome integrity revealed by unlinking its activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/dna
total genus 75
structure length 220
sequence length 229
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hhtA00
4DTMA 1IG9A 1UWBA 2WONA 2KTQA 1TV6A 3OY9A 4B3OA 1QSYA 4N5SA 3LANA 2JGUA 4E19A 4BE1A 4DTOA 2IOCA 3VQ5A 3NFAA 4O5BA 4B9UA 3AVLA 1BQMA 1TKDA 1N6QA 1Q9XA 3TAMA 2HW3A 3OYFA 3KLFA 4M45A 3TAFA 3WNFA 4CJQA 1D5AA 2Z1JA 4CGFA 4BDPA 4DTPA 4HCCA 4LH4A 3AO5A 1TK0A 4DWIA 2ETJA 2ITGA 1QTMA 1BCOA 1BHLA 1XI1A 1KFDA 4OKKA 4DTSA 3AVHA 1VSHA 2E6MA 2Q3SA 4Z0UA 1ZBFA 3IG1A 1JLGA 4ZHRA 1ZBUA 4E0DA 1QE1A 3OYHA 3DLHA 1TL1A 1RBSA 3DLGA 3LPUA 4KFBA 3ZSOA 1B92A 1C0UA 1GOBA 1RBRA 2XY8A 3AVFA 3C95A 4M3RA 4HUEA 1GOCA 2EHGA 3AVMA 2NUBA 3KKRA 3LP3A 4CHZA 1O1WA 4B9MA 2DFEA 4CEFA 3SPZA 1EKEA 4BACA 3SQ1A 5FROA 1VSEA 3OYKA 2G8UA 2D5RA 1L3UA 3OJUA 1FKOA 1RT6A 4B8CA 4N56A 4E7LA 4Q0BA 3HT3A 1RDAA 2KZZA 4DU3A 3NH1A 3S3MA 5DMRA 1JXEA 1WLJA 4CF2A 3CQ8A 1KLMA 4FJKA 3O4QA 4KHUA 2HHVA 2Z1GA 4FM2A 5K14A 2XRIA 5I3UA 4FLTA 5EU7A 2HNZA 3KK1A 2DFFA 1LAWA 1RILA 1WAJA 3MEEA 1S6QA 2F8SA 4FJ9A 4W5RA 4Z4CA 1HPZA 3KK3A 3EYZA 4BDYA 2QK9A 3QIOA 3LP2A 4I2QA 4CEBA 1WAFA 1SL2A 3LP1A 4I9QA 3SUNA 4Z4GA 4E7IA 4KHQA 3F9KA 3OYCA 1TVRA 3MXJA 3AV9A 1BL3A 3SJJA 1NK8A 4B9TA 2R7YA 3IRXA 1RDBA 1WSJA 5E41A 4FLZA 3VQBA 4BWMA 3CYMA 2OPSA 3KLIA 2Y1IA 3RWUA 1TKZA 1IO2A 4W5TA 4I2PA 3TABA 3MXMA 3K5LA 1TKTA 4Z4FA 1BISA 4CHPA 3AVIA 3OYIA 4ID1A 1JLQA 1VRUA 1WN7A 3EY1A 4KHYA 1WSFA 4CJVA 3HJFA 4CEEA 4FJ7A 3VQCA 3MAQA 5HRNA 2RF2A 4F8RA 3SPYA 5I42A 3RMCA 4CEOA 3CM6A 2VWJA 5FRMA 3ZSRA 3NGZA 2YHAA 3OYEA 4HHTA 4M3WA 2F8TA 4OKJA 4FCYA 1U4BA 3PO4A 3T1AA 4DTNA 4CEZA 4XIUA 3V1OA 3RRGA 2D0AA 3AA4A 2BANA 1T05A 2B6AA 4DQRA 1NK4A 1WSHA 3V9SA 2OPPA 2FBYA 5T7BA 3OYNA 4GMJB 3OYLA 3DLBA 4O0IA 3SI6A 4FJGA 2G8IA 3HPGA 4EZ6A 4QCLA 4F4KA 3KLHA 3IAYA 5HBMA 4DS4A 1X9SA 3V9WA 2E6LA 4FJMA 4N41A 2DY4A 2P51A 4FLWA 3HYFA 1ZBIA 1JXBA 3AVAA 1K6YA 3CFRA 4Z4HA 3F73A 4DTJA 2OPRA 3ZCMA 1FKPA 3B6PA 1LAVA 3QLHA 4CK2A 1A5XA 3LZIA 4H4OA 3BDPA 3WNEA 1NK7A 1JLFA 1CXUA 3CM5A 1JLBA 2FBXA 3HP9A 4IG3A 3NH2A 3KLGA 1KRPA 3S9HA 3OJSA 2P1JA 1DLOA 1JLAA 3AO4A 3QINA 1T03A 4B08A 3O4NA 4CJSA 4DFJA 3QEWA 4F3OA 2F96A 4KTWA 4LY7A 5KTQA 1HYSA 4CJLA 4DSKA 3HVTA 1F21A 4IFYA 1VSIA 3O3HA 2OZSA 2KQ2A 2XO7A 4HUFA 4Z4IA 1RCHA 3EZ5A 4DTXA 5J2MA 1G15A 3AA5X 3ULDA 3TR8A 1BCMA 1SKWA 4IKFA 4HCBA 4FZXC 3ZSYA 3K57A 1BI4B 1Q9YA 1VSKA 4MQ3A 1HQUA 1JKHA 5HRSA 5KRSA 4M3YA 2G8HA 1BGXT 4DSEA 4KHSA 1U48A 3ZT4A 1U49A 2YHBA 3HK2A 4NCAA 3P5JA 3V9ZA 4KHNA 2E4LA 1S1VA 1QSSA 3S3OA 4FLYA 2AJQA 2HNDA 3DRRA 3OYAA 1JLCA 3QEVA 2YNIA 4B9NA 4AH9A 3SCXA 1DTQA 4ICLA 4DTUA 2FBVA 1TAQA 3TANA 4OKEA 1A5WA 1S1UA 4CJKA 3CFPA 3HO1A 1DTTA 4I9LA 4KHWA 4QOZB 4OPJA 3ALYA 1RT1A 3FFIA 3LALA 5KGWA 1CXQA 2GUIA 1UA1A 1RDCA 4DLEA 2QKKA 3NH0A 1I39A 3DOKA 4AHCA 1R0AA 4NYNA 4ZTJA 3HPOA 1UOCA 4M3XA 4O4GA 1L3VA 1J53A 3V81A 3C6UA 4W5OA 2BE2A 3HVRA 1J9AA 1W0HA 1HNVA 2XY7A 1LW2A 4O55A 4CERA 4M3UA 1ZBHA 4FJJA 2B5JA 3NBPA 3SUOA 2EX3A 1NK9A 2P5OA 3V9UA 4CEQA 1RT7A 2X6SA 3QIPA 3VQ4A 3KK2A 2ATQA 3L2WA 3PO5A 3HXMA 4CF8A 2FC0A 3OYJA 3WNHA 4CECA 1ASUA 1S1TA 2X6NA 3VA0A 4CJPA 3SUQA 2PYJA 5JS1A 4YFUA 3KD5E 5C24A 3ZSZA 3KKSA 3G10A 3SV4A 2I5JA 1B9FA 4E89A 4B9VA 4CIFA 4CHNA 3PY8A 3K5NA 4LH5A 1X9WA 1U45A 2BGGA 4LD0A 2DTUA 4DU4A 4DSIA 1SUQA 3KJVA 1S1WA 1S9EA 4JLHA 3U3GA 4E3SA 1C1AA 4EP4A 2QXFA 3TAEA 1C1CA 3OS0A 4FJ8A 1KVCA 3NDKA 4C8NA 1FXXA 3C6TA 3PUFA 3PX4A 4G1QA 3DLKA 4W5QA 4FK2A 2GV9A 4QAGA 3LZJA 3PX6A 3S3NA 4H4MA 4ELUA 3LAKA 4AHTA 3M8SA 4FJXA 4FXDA 1LWCA 2YKMA 4NYFA 3ISNC 1WSGA 1CLQA 4LSLA 3TARA 1FK9A 2YNFA 4M3ZA 1T8EA 3P1GA 3ZSVA 1D9FA 3RMBA 4RW8A 2Y1JA 1RTIA 4BE0A 1NJWA 1C6VA 1YTAA 4CK3A 1WSIA 5SWMA 3RR8A 2VG7A 4CIEA 3H08A 3PV8A 3NGIA 4CJUA 1CZ9A 2PYLA 1YTUA 3B6OA 4DQIA 1WSEA 3SNNA 5DK5A 1QS4A 2IC3A 4M41A 3OYBA 3WNGA 3QEPA 2PZSA 1KCFA 2BDPA 2A1SA 5JS2A 4OPKA 3ZT2A 4FM1A 1S6PA 1KSPA 4ELTA 1ZBLA 3RRHA 4JRPA 4AHSA 1U04A 4J2BA 3ZT1A 4CFBA 3AVKA 3AA3A 1L5UA 3LPTA 4PY5A 4AHVA 4CHYA 4KREA 1RNHA 2RKIA 3MEDA 3VQPA 4Q5VA 4KB0A 4DF4A 1XHXA 1X9MA 3RTVA 1N5YA 2HHWA 5CYQA 4KO0A 1EXQA 1J54A 1VSLA 1Z25A 5KI6A 2G8VA 1HRHA 1JLEA 3U3YA 4C8LA 1Q8IA 4I7FA 2RN2A 1ZYQA 1QQCA 1NK5A 3AO3A 1L3SA 3QEXA 4DSJA 2KFZA 2P5GA 4CK1A 1RBTA 4CJTA 2ZQBA 1ITGA 3AVJA 2G8WA 1S1XA 2G8KA 3HPHA 5HRPA 1SKSA 2OYQA 2VWKA 3KD1E 4CJ5A 3L2UA 4J2DA 3AA2A 3VQQA 2XY5A 4CHQA 4AHUA 3NHGA 4DF8A 4DU1A 1LV5A 3LAMA 3V6DA 1WNSA 4CF0A 4CF1A 1HQEA 3VQ7A 1U47A 4J2AA 4AILC 2VG5A 4FZZA 3OVNA 3OS1A 2KFNA 4DQQA 2KZMA 3SUPA 4F3TA 4IG0A 4DG1A 1SKRA 2YKNA 4DFPA 3TI0A 4IBNA 1RT2A 4CGIA 3HM9A 1IKVA 3CFOA 4ZTFA 5HRRA 4DMNA 3HP6A 4RW9A 2QKBA 4KTZA 4FW2A 4CCHA 1Y97A 3DLEA 4CJFA 1IH7A 3OYMA 1TK5A 3QESA 2ZE2A 2HHSA 4ID5A 1CZBA 5CY4A 3VQEA 3SQ2A 4KRFA 2YV0X 4M42A 3SYZA 4DSFA 3ZSQA 1NKCA 1J5OA 4H8KA 3I0SA 3SV3A 4FZYA 4GVMA 4CGJA 4KI4A 4RG8A 1S5JA 4CFCA 3NF8A 1RBUA 4CE9A 3M8QA 3VQAA 4CF9A 1KVBA 3SQ4A 2G8FA 1ASWA 1IKWA 4FK4A 1XHZA 1KTQA 1Z26A 1EP4A 1I3AA 1BI4A 3NF6A 2HMIA 2HHQA 4JS4A 4BWJA 3T19A 1VSMA 1IKYA 1LWEA 3DRPA 1SL0A 2OPQA 4OVLA 4CJWA 3K58A 4O44A 2XY6A 4K8ZA 3VQ6A 3THVA 1KVAA 5FRNA 3QETA 4KTQA 3QEIA 1D9DA 4DS5A 4MFBA 4N76A 3HSTB 1QHTA 2HVHA 1RBVA 4DFKA 4PWDA 3KIOA 2DFHA 5CZ2A 4OGCA 3QNNA 1TGOA 3VA3A 4J2EA 1VRTA 5CZ1A 4CFDA 3RMAA 4JRQA 1QSLA 4EZ9A 1RTDA 4E7JA 4N47A 3M8PA 3L8BA 2IS3A 3DLRA 4O0JA 5KRTA 2Z1IA 5J2NA 3SQ0A 4RW7A 4CGHA 1LWFA 2OZMA 2OA8A 1NKBA 4FJIA 3DMJA 5CYMA 4KAZA 1B9DA 4OLBA 3ASMA 3AO2A 3ZSXA 4B9SA 4NCGA 3DM2A 1C0MA 1VK0A 3VQ9A 1NJZA 4E1NA 4NCBA 1EX4A 2X78A 3LDSA 3KLEA 3NGYA 3VN5A 4C8MA 2W42A 1KFSA 3K5OA 1TKXA 4KPYA 1VSDA 2Z1HA 3L2RA 1C1BA 4FW1A 1EETA 3LWMA 5HROA 4CEAA 4EP5A 1D8YA 2HNYA 3E01A 3OS2A 4IDKA 3MXIA 1A5VA 1C0TA 4DFMA 3DRSA 1LW0A 5D3GA 3DI6A 4FJLA 1VSFA 4LSNA 4CGDA 4KI6A 4F2SA 5KGXA 1RTHA 1VSJA 2JLEA 3V1QA 2VG6A 2LSNA 4YNQA 3TAPA 1JL1A 3ZSWA 2YNGA 1S9GA 2X74A 4DQSA 1MU2A 4FVMA 2HHUA 3QO9A 4DLGA 3A2FA 3DYAA 3LP0A 5J1EA 3L3VA 2HHTA 1XC9A 2D0CA 3QERA 4FYDA 2FBTA 3V4IA 4TSXA 4B9LA 4BE2A 4KB1A 4L8RB 4ELVA 3C94A 2HHXA 4CGGA 4FJNA 1T7PA 2B4JA 3TAGA 4DQPA 4HTUA 4C8OA 3NE6A 4CJ4A 1HJRA 3G0ZA 3M8RA 3MECA 3AVNA 3RMDA 1RT3A 3TWHA 3BGRA 2IGIA 4E7KA 4M3TA 1NJYA 2O4GA 3VQ8A 4B8AB 4CESA 2O4IA 3O3FA 3ZT0A 1RT4A 1SL1A 4DSLA 2GBZA 3QNOA 4E1MA 4Z4EA 3I8DA 1XWLA 4OGEA 4CIGA 3L2VA 5HP1A 3HL8A 3O3GA 4UQGA 4PQUA 2IAJA 2WOMA 4AHRA 5FDLA 1NK6A 5HLFA 3V9XA 4R5PA 3NF9A 5J2PA 4C8KA 3P83D 1ASVA 3ITHA 4OLAA 3PX0A 4CJEA 1NJXA 4HVJA 1BIZA 4HUGA 4WE1A 3MEGA 4FLUA 1REVA 3UIQA 3VQDA 3KTQA 4CEDA 4FK0A 1TL3A 5C25A 5C42A 3NCIA 3U6FA 3D45A 4CJRA 1SV5A 1UAXA 2PY5A 4OJRA 1NKEA 1NOZA 3I0RA 3NF7A 2A1RA 1BIUA 1HNIA 3D0PA 3AVBA 3CG7A 4KV8A 1YVUA 3JYTA 4DTRA 1HMVA 3K59A 2HVIA 3ZT3A 3AVCA 4CJ3A 1W9HA 3LWLA 1BQNA 4FM0A 1TK8A 3OYDA 5SZTA 1HYVA 4PA1A 4FLVA 2YNHA 3TAQA 1GOAA 4FJHA 4E7HA 1RTJA 2D0BA 4Y1CA 2IDOA 1KLNA 2XHBA 3NAEA 3T3FA 1NK0A 4W5NA 1RDDA 2RPIA 3OYGA 4CHOA 5J2QA 4KKOA 4K8XA 3JSMA 4FJ5A 4GW6A 4RW6A 1YT3A 4CFAA 1RT5A 1HYZA 4RW4A 3DOLA 4JS5A 1L3TA 4FLXA 3AVGA 4Y1DA 3V1RA 3L3UA 4PUOA 3K2PA 3AO1A 3SZ2A 3L2QA 3RR7A 1IKXA 1TAUA 1UA0A 1JL2A 4IFVA 2KW4A 4F2RA 3K5MA 1NOYA 2HB5A 3IS9A 1X1PA 4BDZA 2ZD1A
chains in the Genus database with same CATH superfamily
1IG9A 2WONA 2PFUA 3T69A 5LMUK 1NGFA 3OY9A 3CMAN 4B3OA 3E1YA 5AQKA 1KAZA 4B9UA 1BQMA 1XNQK 2UXCK 4X66K 4M45A 1ATSA 2Z1JA 3I56N 4BDPA 3AO5A 3J8AA 3ENOA 2Q3SA 3FZKA 1QVGM 2FF3B 3SAFA 4E0DA 3QDKA 1HX1A 3OYHA 1TL1A 1D9DA 3LPUA 3LZJA 5AQQA 3KD1E 1GOBA 1GOCA 3LP3A 2NUBA 2ASPA 4IDHA 3SPZA 3C7NA 2QA4N 2G8UA 3OJUA 1RT6A 4E7LA 3S3MA 4LF4K 5DMRA 4FJKA 4JD2B 2Z1GA 4FM2A 2XRIA 1YHQN 4QS8A 5EU7A 3HTVA 2UXBK 4QS9A 5M1OA 3DJCA 5DM6L 5GINA 4K41A 3A5OC 3KVGA 3QIOA 1WAFA 3LP1A 3VGLA 1TVRA 3MXJA 3AV9A 2R7YA 4FL9A 3P31A 2Y1IA 3KLIA 4Z4FA 3MXMA 5BR8K 3UE5A 4CHPA 2Q31A 4MDAA 1JLQA 3GDQA 3EY1A 3THXB 1T6CA 4FJ7A 2EWSA 3ZEUB 4F8RA 3SPYA 5JLHA 5I42A 4WQ4C 4HHTA 4O8UA 1QZ5A 4FCYA 3PO4A 3KZBA 4CEZA 2P9UB 4DR6K 2BANA 3V9SA 2OPPA 2FBYA 1O13A 4BVPA 3DLBA 4YOTA 3E9LA 4O0IA 5LJWA 4F4KA 3KLHA 2BTFA 4GV9A 1HNXK 3IAYA 5HBMA 4FJMA 4N41A 1WBDA 3AVAA 1K6YA 3CFRA 4B1VA 4DTJA 3BF3A 1FKPA 1LAVA 4ISEA 4WFAL 4H4OA 4K25A 5AQWA 1BUPA 3WNEA 3WUHA 1CXUA 1JLBA 3QINA 4CW7B 3M3ZA 4IEEA 4KTWA 4H0XB 4CJLA 5F1XA 4EIAA 2KQ2A 3O6WA 2XO7A 4HUFA 4DR2K 4Z4IA 1J6ZA 1D4XA 3EZ5A 1VQLN 1G15A 4BGBA 3AA5X 1BOTO 3CJ9A 4PL8A 2G8HA 2NRRA 2HMPA 3ZT4A 1CZAN 4NCAA 4JKHA 3V9ZA 3S3OA 5AQRA 2F7TA 3DRRA 3OBWA 3ENBA 2QI2A 2OANA 3DWLA 4MLHA 3TANA 3BUZB 4CJ7A 4BR2A 4I9LA 2OCEA 4JKDA 3FFIA 3NH0A 1R0AA 4M3XA 4GKKK 3FZHA 1W0HA 4CERA 3ZLJA 4K43A 1WBBA 1VQNN 1QHAA 3QB0A 2O8DA 4YOXA 5C15A 1W2BM 5KQ8A 2FC0A 3OYJA 3PIOL 2I7NA 2X6NA 1S1TA 1NG9A 3KD5E 3KKSA 3G10A 4FWPA 4B9VA 1K8KA 4CIFA 1Y64A 2DTUA 4DSIA 5F2RA 3WXJA 4E3SA 4WQ5C 2YJEA 1KVCA 3SJHA 3R9PA 4W5QA 4ILHA 4DR4K 3PX6A 4H4MA 1KC8O 2IVPA 3ISNC 1WSGA 3MWPA 1T8EA 4JHDB 1RTIA 1NGHA 3KK7A 5AQXA 1GLFO 1U6ZA 1WSIA 2V7ZA 4CIEA 3B6OA 3SNNA 2HBKA 3OYBA 4M41A 3G6EN 2PZSA 4YY3K 5JS2A 4FM1A 1S6PA 3O9QA 5C2FA 1ZBLA 3RRHA 3SBTA 4JRPA 3IDHA 4DKWA 2GUPA 4CHYA 2VWBA 1RNHA 4Q5VA 3RTVA 2HHWA 3HSCA 4ISFA 1HNZK 2G8VA 4B3RK 1Q8IA 5C10A 3EE9A 1QQCA 5GAGP 3TTDA 3ID8A 3DLLL 2G8KA 3HPHA 1SKSA 3VMFB 2VWKA 4H5TA 3L2UA 5GIOA 4CHQA 4AHUA 3LM2A 2VG5A 4YOWA 1HPMA 4DQQA 3SUPA 4JI4K 4DG1A 3WXKA 4IBNA 4AM6A 4GV6A 3HM9A 3GG4A 4KBOA 4ZTFA 4DMNA 5BRDA 5AZIA 3DLEA 2ZE2A 5CY4A 4JKGB 3LDPA 1K9MO 4H8KA 4DV6K 4FZYA 1S5JA 3CJ7A 2IVNA 4CE9A 2ITMA 3VQAA 4CF9A 2G8FA 3THYB 1IKWA 4FK4A 3CD6N 2HMIA 3NF6A 3KWGA 1IKYA 3DRPA 2OPQA 4XEIA 4CJWA 4K8ZA 1KVAA 4N76A 4JKFA 3QEIA 3C0BA 4MFBA 4DS5A 3HSTB 3I55N 2E2NA 3IFRA 4DFKA 4PWDA 2QXLA 3DXMA 3CMEN 3ATVA 3D6RA 4OGCA 1WUAA 4MDBA 4JRQA 3CETA 1NGCA 1QSLA 4EZ9A 5GAEP 4F9OA 3M8PA 4H0PA 1QQMA 5KRTA 1NKBA 5M1FA 2Q2RA 3ASMA 3AO2A 4NCGA 1C0MA 1VK0A 1TUUA 1EX4A 3DAWA 3SK3A 4ILGB 1KFSA 3QBXA 5E84A 2UUCK 4KPYA 3HOTA 4NLBA 3E01A 1IJJA 4E1JA 3OS2A 1C0TA 1LW0A 1VSFA 4CGDA 4F2SA 5KGXA 1RTHA 1YUWA 3D2FA 1JL1A 4FVMA 2HHUA 1ILYA 3QO9A 3LP0A 5J1EA 2HHTA 4WCEL 4HWIA 1Q81O 3TSPA 2FBTA 3K9JA 4TSXA 3RSEA 3C94A 3VEWA 2B4JA 3TAGA 5LJVA 2E2QA 4YORA 4CZEA 3MECA 1RT3A 3H45C 3TWHA 2OTLN 2RHKA 3VF4A 4CESA 2QTDA 2RE2A 4EFHA 3WQTA 2FSKA 2GBZA 3QNOA 1VQ7N 3HZ6A 5LY3A 1XWLA 4UQGA 2PAVA 2WOMA 4BGAA 3V9XA 3GL1A 2P9SA 3ZX0A 3PX0A 2DPNA 4U67L 4CEDA 3EZWA 5C42A 3NCIA 1VQ4N 1UAXA 2PY5A 4OJRA 1NOZA 5CR4A 3I0RA 2P9NB 1BIUA 1VQ5N 5I9EB 4DTRA 1HMVA 1BQNA 5SZTA 3ZYYX 4FLVA 4U7BA 5AQYA 4BR9A 3T3FA 1YF5L 2RPIA 4K8XA 5BR9A 2Q97A 4B1YB 4XH5A 3DOLA 1L3TA 4FOIA 3F5TA 3W0LA 2QWNA 3AO1A 2P9KA 3RR7A 1TAUA 4BRQA 3JAMO 4FWOA 1VQPN 4IZ9A 4FPBA 2J4RA 4BVOA 3LANA 2JGUA 3CCLN 3NFAA 1J5EK 1EO1A 3AVLA 1N6QA 3O1BA 3TAFA 3SLCA 4JI5K 4DUYK 4DTPA 4DWIA 1DT9A 2ITGA 1XI1A 3CCQN 1KFDA 4OKKA 1XMQK 2PBDA 1VSHA 4Z0UA 4JI2K 4ZHRA 3CCMN 3C95A 2XY8A 1VQ8N 3KKRA 4CHZA 2W6KA 3SQ1A 1VSEA 1VQMN 2D5RA 4B8CA 4Q0BA 1RDAA 2HHHK 3NH1A 3CJBA 3CQ8A 3CPEA 5AZJA 2HHVA 4H0VB 5K14A 1LCUA 3D2FB 1X3MA 5I3UA 4GV3A 4FLTA 5C2DA 3PIPL 3KK1A 2F8SA 1WAJA 3MEEA 1S6QA 3AY9A 4FJ9A 4W5RA 1HPZA 3EYZA 2QK9A 2KZZA 4CEBA 2QWRA 4I9QA 4Z4GA 4E7IA 4KHQA 4O5FA 3SJJA 1BL3A 1NK8A 3IRXA 3RWUA 3VQBA 3WEEA 1S3XA 1GLAG 1TKZA 1IO2A 4I2PA 1TKTA 3OYIA 4ID1A 1VRUA 3TSUA 4CJVA 3MK6A 4BRLA 2P9IB 3RMCA 3ZSRA 4M3WA 2P9SB 3T1AA 1K73O 2Q0RA 3V1OA 1T05A 3MMVA 1GLCG 5T7BA 3OYLA 3SI6A 2HBMA 3FZMA 4DS4A 1X9SA 3QBWA 3F73A 4I6MB 2OPRA 4DR5K 3B6PA 3QLHA 3SMSA 1NK7A 3VENA 4BRHA 3CM5A 2FBXA 3HP9A 3NH2A 3EO3A 1KRPA 3S9HA 2P1JA 1DLOA 3AO4A 1P8ZA 3T1HK 1T03A 4CJSA 2F96A 5E26A 3HVTA 1F21A 4IFYA 1VSIA 4DQ8A 3G71N 2P9KB 3SBGA 4CD1A 3J80O 3Q7BA 2E8AA 3LDQA 4ISGA 3TR8A 1BCMA 2O8EB 4FZXC 1Q9YA 3K57A 1BI4B 1HQUA 3C6HA 4KHSA 3P5JA 1HUXA 2E4LA 3BZKA 2UUAK 5AQLA 3AGKA 3OYAA 1JLCA 2YNIA 4QS7A 4B9NA 3F2KA 3SCXA 1DTQA 4BRAA 5BPLA 3CFPA 5EVZA 3ALYA 1BU6O 3LALA 3FR0A 3DOKA 5AQTA 4ZTJA 3HPOA 4O4GA 1J53A 3V81A 4H0YB 4YDUA 2KLAA 1K8AO 4FWQA 1KAYA 4O55A 1ZBHA 5BREA 3NBPA 3SUOA 5EY4A 1NK9A 2P5OA 1RT7A 1SS6A 3VTIA 2ATQA 3KK2A 4XH1A 3L2WA 4CF8A 3HXMA 4BQZA 1QZ6A 2QWOA 2E2PA 1ASUA 4CJPA 5JS1A 1JCFA 5BPNA 1OVYA 1B9FA 4E89A 1X9JA 4DCHA 4IFEA 4CHNA 4BRPA 1YIJN 2KKZA 1X9WA 4RWTA 1U45A 2BGGA 4LD0A 1SUQA 1S1WA 4JLHA 3A5NC 3TAEA 2QXFA 1C1CA 3OS0A 4FJ8A 5EX5A 4BRGA 1FXXA 5FPNA 3QMLA 2VYPA 3DLKA 2F9WA 2GV9A 3CIPA 1IBMK 2NRZA 4QAGA 4ELUA 3LAKA 4AHTA 4FXDA 4A61A 4NYFA 1CLQA 4LSLA 4A57A 2YNFA 1M1KO 3P1GA 1D9FA 4RW8A 2O8BA 4UY8O 4G9ZA 5SWMA 4H5WA 1S22A 2A1SA 3ZT2A 3CC2N 2YCHA 4PY5A 3SAHA 3AA3A 1R59O 3TSQA 2F9TA 4AHVA 4KREA 3MEDA 1X9MA 1NU0A 1EQYA 2ZJRL 2CGKA 1Z25A 4IWVA 1JLEA 4FPAA 4C8LA 3TTCA 3BP8A 2RN2A 4BREA 3HOSA 3AO3A 5KPRA 2O8FA 3QEXA 4NO7A 3CJAA 4BRKA 2P5GA 1E4GT 4LF7K 2KHOA 1ITGA 1XC3A 4PKHA 1ZC6A 1KXPA 4IEIA 3CC4N 1LV5A 4DF8A 1WNSA 4CF0A 4CF1A 1HQEA 3VQ7A 2P9LB 3G4SN 4F3TA 4DFPA 3TI0A 1NWKA 1RT2A 2WUSA 1GLLO 2HF3A 5HRRA 1TYQA 4DB3A 3HP6A 4RW9A 2QKBA 1HKBA 1YITN 1IH7A 1VQON 3QESA 4BC3A 3SQ2A 4KRFA 4M42A 3SYZA 4DSFA 3ZSQA 1GLBG 3T7ZA 2WBNA 2ZWHA 1MWKA 3NF8A 1RBUA 3TTFA 2QM1A 3SQ4A 3AAQA 3FE1A 4M7XA 1EP4A 1I3AA 4BWJA 3B8AX 3MWTA 4FWNA 2E5LK 4FO0A 3THWA 3UKRA 3C7NB 2XY6A 1Q18A 3K58A 5FRNA 3VOVA 3U8XA 1QHTA 3UB5A 5AQOA 1RBVA 1FW6A 3S41A 3MN5A 1U2VA 5CZ2A 4DR1K 1TGOA 3VA3A 2OTJN 3RMAA 1E3MA 4E7JA 3ZETA 4O0JA 5J2NA 4K42A 3SQ0A 1LWFA 5FLXO 3KHYA 5CYMA 1B9DA 2E20A 4B9SA 3DM2A 1TUYA 4E1NA 4NCBA 3H1VX 3LDSA 3KLEA 4IXCA 4C8MA 1NMDA 2W42A 3K5OA 1TKXA 3O08A 2Z1HA 4LC9B 1EETA 2A6AA 3PSFA 4CEAA 4PL7A 2HNYA 3MXIA 1A5VA 1VAZA 3DRSA 2NRWA 4FSVA 3DI6A 4LSNA 4NLCA 4JI1K 1VSJA 2JLEA 4YNQA 2LSNA 2VG6A 1OH5A 1S9GA 2X74A 4DLGA 3A2FA 3CPWM 3HRGA 4FYDA 4CZJA 3O80A 4KB1A 1VQ6N 4ELVA 2HSTA 3NE6A 5AQUA 1OKJA 2WC9A 2D0OA 4J8FA 4YHHK 3M8RA 4V19S 4BR7A 4E7KA 1NJYA 3NVKA 3C65A 2UUBK 4B8AB 1RT4A 1SL1A 1MA9B 3H46O 4DSLA 2AP1A 4Z4EA 1IG8A 2O8FB 5HP1A 4DV0K 5FDLA 2D1KA 3AARA 2A41A 4BQLA 1BIZA 4JI6K 3UIQA 1REVA 4OPHA 3KTQA 5KPTA 4JYAK 1TL3A 5M1KA 1SV5A 4IOCL 3JXUA 1T6DA 2YX6A 5A2QO 3GOIA 1YVUA 2HBLA 2HVIA 3DXKA 1W9HA 4FM0A 4CZMA 3OYDA 1HYVA 5KQDA 2D4WA 4PA1A 2HOEA 4Y1CA 1IBKK 2XHBA 3GE1A 1RDDA 1BA1A 1RDWX 1BWFO 4GW6A 3G25A 4CFAA 4RW4A 3CCUN 4JI7K 4A62A 3CCVN 3L3UA 2FXUA 1IKXA 3CQXA 5ADXA 2ASOA 3K5MA 5GADP 3IS9A 1X1PA 2ZD1A 4HCBA 4DTMA 2W41A 2KTQA 1NJIO 3UKUA 3MCPA 1Q9XA 4R79A 2HW3A 3OYFA 2O8DB 4WQ4A 3KWIA 4LF9K 3WNFA 1XMOK 1D5AA 3VEVA 4CGFA 4HCCA 4LH4A 4CZIA 3K9KA 2ETJA 1BHLA 4DTSA 1K8KB 1I94K 1JLGA 1ZBUA 4JN4A 1RBSA 4KFBA 3ZSOA 5E41A 1B92A 5AQSA 3MDQA 4M3RA 2EHGA 3ATUA 3M5RA 1O1WA 4B9MA 2DFEA 1EKEA 5FROA 3OYKA 4CZHA 2WTUA 3VEYA 1FKOA 2NRVA 2YI1A 4CVNE 1JXEA 4CF2A 1KLMA 5JLFA 1NGDA 4JK9A 1JCEA 1NGEA 5FPEA 4IO9L 1RILA 3ULEA 4BDYA 3CCEN 4I2QA 3SUNA 3OYCA 3A5MC 4B9TA 3WXLA 3ENHA 5JICA 3J7YP 1RDBA 3D2EA 4FLZA 1GLDG 3TABA 1BISA 3TPQA 1WN7A 2V52B 4KHYA 1WSFA 2VGNA 4CEEA 4BR4A 5HRNA 1HR0K 4JK7A 3IKMA 1ATNA 4KH4A 2I7PA 4CEOA 3CM6A 2VWJA 5FRMA 3NGZA 1V4SA 2YHAA 3IMXA 2F8TA 3RVCA 4DTNA 3J7ZO 3CC7N 2D0AA 4DQRA 3O4WA 1WSHA 4GMJB 4M7YA 4MO4A 4EZ6A 2A5XA 2NRHA 4QCLA 4IJNA 4C1NI 4DV7K 2E6LA 1N8RO 2DY4A 2P51A 1JXBA 3WXMB 4Z4HA 3H1QA 3LZIA 1A5XA 4H5NA 3BDPA 1JLFA 3A8YA 2YHYA 5AZIB 4IG3A 3KLGA 5AQMA 3OJSA 3O4NA 3QEWA 4DR3K 4JEPA 3OA9A 4DSKA 4WQ5A 1QQOA 3CI5A 2JWKA 4M63C 4BRIA 4NXMK 2A3ZA 4AM7A 5JMVA 5H1SQ 3FZLA 1OH8A 1FJGK 5AQGA 1SKWA 5JVGL 4IKFA 4FWLA 4MQ3A 5KRSA 1YJ9N 1U48A 1U49A 2YHBA 3HK2A 1N32K 4H03B 1NBWA 1S1VA 3P38A 4FLYA 2HNDA 3DXMB 4B1WB 3QEVA 4AH9A 4DTUA 4JKEA 2O8CA 4A59A 2FBVA 2HF4A 3BY5A 1N36K 1A5WA 1S1UA 2YHWA 5TKYA 4CI6A 4DR7K 1SQKA 3WQUA 4JI8K 4KHWA 3CCJN 1P90A 2GUIA 4BRDA 1UA1A 4DLEA 1I39A 3U9ZA 4NYNA 4DV4K 1W7AA 1L3VA 1OVQA 4W5OA 3HVRA 1J9AA 1HNVA 4FJJA 4JI0K 3ZX3A 2X6SA 3PO5A 1HKGA 4K0KK 2FLOA 3VERA 4CECA 1YJNN 4YFUA 1DEJA 5C24A 3ZSZA 1HNWK 4FOEA 3SV4A 2CH5A 3K5NA 1GLEG 4DU4A 3OW2M 4CZLA 3U4LA 3U3GA 1C1AA 4EP4A 3RSEB 3NDKA 4H5VA 3PUFA 3PX4A 4G1QA 3VETA 4FK2A 4BY9C 3M8SA 4X62K 1LWCA 2YKMA 4JD2A 4CZGA 2VGMA 5HL7L 4M3ZA 5LMNK 1E4FT 3FZFA 3HM8A 2Y1JA 4BE0A 3P4IA 3RR8A 3VEXA 3H08A 3NGIA 3J81O 4CJUA 1CZ9A 4DQIA 4L3QA 2IC3A 3CF5L 3WNGA 2BDPA 4BC2A 4OPKA 1KSPA 4ELTA 2FF6A 4JKBA 5LL6Z 4WF9L 3FFKB 1U04A 4CFBA 3AVKA 3IUCA 4CD3A 4LF5K 4KB0A 2QWMA 1XHXA 3FLCO 4FWRA 5F0XA 3THXA 4KO0A 1C0FA 3ZEUA 1J54A 1MWMA 4CBXA 3EKUA 1ZYQA 2E88A 3CHWA 1L3SA 4LF8K 2KFZA 1EWRA 4CJTA 2ZQBA 3AVJA 1C0GA 1XUPO 5KPZA 5HRPA 2OYQA 2P9UA 5AQFA 4J2DA 3AA2A 2XY5A 4DU1A 3V6DA 4AILC 4JI3K 2KZMA 4IG0A 1RGIA 1SKRA 2YKNA 4B1UB 4CGIA 3CFOA 3VGMA 3EEQA 4KTZA 4CCHA 3OYMA 4CJFA 2HHSA 4ID5A 3H6EA 2YV0X 4KH5A 5M1QA 3I0SA 3SV3A 4GVMA 4CGJA 4KI4A 4RG8A 4CFCA 3O9SA 4YOUA 3M8QA 1KVBA 5JVHL 3BEXA 4Y0WA 1Z26A 3O1WA 4BC5A 1LWEA 3VF2A 2ZJPL 3L4IA 2IIRA 4O44A 4JKAA 3SMPA 3THVA 4B3TK 1V4TA 3N4PA 2W40A 5HOOA 3QETA 4KTQA 2HVHA 4JK8A 4WYBA 3VTHA 4PKIA 3KIOA 2DFHA 5AZJB 4J2EA 1VRTA 5CZ1A 5AQIA 3L8BA 1ESVA 1BO5O 5EXWA 4CGHA 2OZMA 3DMJA 4KAZA 4OLBA 1NLVA 4JAXA 3R8EA 4C23A 5IT9O 4Z94A 1NJZA 4BROA 2X78A 3QICA 3VN5A 3WEEB 3W3DA 2P9PA 1C1BA 4FW1A 3LWMA 1D8YA 4B1ZA 4IDKA 4FJLA 5AQZA 4KI6A 1YJWN 4LFCK 3V1QA 5ELZA 3ZSWA 2YNGA 2ZM6K 4DQSA 1MU2A 4MLEA 1XQSC 3DYAA 3L3VA 3JS6A 1XC9A 2GELA 3ID6A 5AQPA 3QERA 4B9LA 5GAHP 1YXQA 3F9MA 4KH6A 3L6QA 2UU9K 4L8RB 2HHXA 1HKCA 4CGGA 1T7PA 4DQPA 4OO1J 5EOYA 4C1NK 3LDLA 3G0ZA 2A42A 3AVNA 3RMDA 3BGRA 4M3TA 1N34K 3VQ8A 2O4IA 3O3FA 3R6MA 3ZT0A 4JHDA 1JCGA 3GBTA 4OGEA 4CIGA 3HL8A 3MX2A 1BG3A 3O3GA 2IAJA 4AHRA 3WXIA 1NK6A 5HLFA 2UXDK 4R5PA 3NF9A 3LDNA 4A5BA 5J2PA 4C8KA 3P83D 3ITHA 4CJEA 1NJXA 4HVJA 3MEGA 4GKJK 4FK0A 5C25A 4GVEA 3AGRA 2ZGYA 5GIPA 1HNIA 3D0PA 3CG7A 4KV8A 3ZT3A 1KQSM 3AVCA 3PLAA 2GWKA 1X3NA 2GTDA 1ZXOA 4GNIA 2YNHA 5TKWA 4W5NA 1KLNA 3NAEA 1NK0A 4CHOA 5J2QA 3JSMA 3LDOA 1YT3A 1HYZA 4FWMA 4FLXA 3AVGA 1OH7A 3V1RA 3OTOK 4PUOA 2WFBA 3SZ2A 3R3LA 1UA0A 4X65K 4IFVA 1HLUA 4NB4A 4BDZA 1UWBA 4RTFD 1TV6A 1NGGA 2A40A 1QSYA 4AF1A 4N5SA 3AAPA 4E19A 4BE1A 1BA0A 4DTOA 2IOCA 3VQ5A 3BF1A 4O5BA 1TKDA 4OX9K 4KHPK 3TAMA 3KLFA 4LF6K 2QEXN 4CJQA 4JKGA 4CBWA 3MCAB 1TK0A 3BZCA 1QTMA 1BCOA 4JV5K 3AVHA 2E6MA 1ZBFA 3IG1A 3PSIA 3H3OB 4ILJA 1DKGD 1QE1A 4PKGA 3DLGA 3THYA 3DLHA 1RBRA 1C0UA 1NGAA 3AVFA 5CHIA 4HUEA 3AVMA 5AFUH 4PHTX 4CEFA 4BACA 2QWLA 4IJAA 1S72N 3CCRN 1L3UA 2P9PB 4N56A 3K0SA 3HT3A 4DU3A 1WLJA 3O4QA 1Z05A 4KHUA 5AQJA 2O8BB 3MN6A 2HNZA 1G99A 3H3NO 1N33K 3L0QA 2DFFA 1LAWA 3A5LC 3NMUA 4Z4CA 3KK3A 1SL2A 3LP2A 4H0OA 3F9KA 1SZ2A 1WSJA 4LFBK 4BWMA 3CYMA 2OPSA 4W5TA 2QW9A 3K5LA 3AVIA 3I8BA 3J7AP 3HJFA 4DUZK 1M90O 1HJOA 3VQCA 3MAQA 2RF2A 4BRMA 5BPMA 4A2BA 4H0TB 1KAXA 1ATRA 5M1PA 5CE3A 3OYEA 3C6AA 4OKJA 1U4BA 4EHTA 4H5RA 2D0PA 4XIUA 3E9PA 3RRGA 3AA4A 4MO5A 2B6AA 1NK4A 3A0IX 3L4QA 5C12A 3OYNA 4FJGA 2G8IA 4GY2B 3HPGA 3V9WA 3M1FA 4FLWA 3HYFA 1ZBIA 3O9RA 3NVMA 2YJFA 3ZCMA 3SAGA 1TYQB 4CK2A 4LFAK 1JLAA 1XNRK 4B08A 4F3OA 4DFJA 1IV0A 5KTQA 4LY7A 1HYSA 2FSJA 1NNEA 3O3HA 3P39A 2OZSA 4BRCA 2GX9A 4YOYA 1RCHA 3E66A 2P9NA 4DTXA 5J2MA 5AJ3K 3Q7CA 1Z6RA 3ULDA 3ZSYA 1VSKA 1JKHA 5HRSA 4M3YA 1BGXT 4DSEA 5DM7L 1OH6A 1VQKN 3THWB 3UKRB 1GLJO 5M1NA 4RCHA 4KHNA 1QSSA 2AJQA 1U2VB 1T3VA 5BN9A 1YVNA 4ICLA 3VEZA 1TAQA 4BG8A 3ZETB 4OKEA 4CJKA 3HO1A 1DGKN 1DTTA 3CCSN 4QOZB 4OPJA 1RT1A 5BN8A 5KGWA 1CXQA 4OPAA 1RDCA 2QKKA 1Q86O 4AHCA 2NLXA 1UOCA 3C6UA 2BE2A 1IBLK 2XY7A 1LW2A 4M3UA 2IVOA 2B5JA 2EX3A 1SAZA 1T44A 2Q0UA 4CEQA 3VQ4A 3QIPA 3V9UA 3R1XA 4IO8A 3WNHA 3QFUA 3ZX2A 3VA0A 3SUQA 2PYJA 3HI0A 2I5JA 2E1YA 3PY8A 4LH5A 2VCPA 4XH4A 2UYTA 3KJVA 1S9EA 4C8NA 3C6TA 4YOVA 4CZFA 5IWAK 4B1XB 2BUPA 3O5BA 3S3NA 4FJXA 1JJ2M 3TARA 1FK9A 1QQNA 5AQHA 3ZSVA 3RMBA 4WFNL 2E1ZA 1NJWA 1C6VA 1YTAA 4CK3A 2ZJQL 2VQEK 2VG7A 4BR5A 3PV8A 2PYLA 1YTUA 1WSEA 5DK5A 1QS4A 3QEPA 1WB9A 1KCFA 4A2AA 4JKCA 4AHSA 3LM9A 4IOAL 4J2BA 3ZT1A 1L5UA 3LPTA 2CGLA 2VQFK 2RKIA 3VQPA 4DF4A 4X64K 3EKSA 3QFPA 1VQ9N 1N5YA 5CYQA 1EXQA 1VSLA 4YDUC 5BRFA 5KI6A 1HRHA 3DXKB 2P9IA 3U3YA 4I7FA 3HBTA 5B8HA 3OBYA 1NK5A 4DSJA 4BRNA 2BH1A 1VHXA 4CK1A 1RBTA 4NXNK 2G8WA 1S1XA 3OHRA 3U9DA 1W97L 4CJ5A 3VQQA 3NHGA 5FPMA 3LAMA 4J2AA 1U47A 4FZZA 3OVNA 3OS1A 3CQYA 2ASMA 3TU5A 3O8MA 2KFNA 4B3MK 4O8KA 4BG9A 1IKVA 4BC4A 4I6MA 2CH6A 2YHXA 5AQNA 2W6LA 3EE8A 3FGUA 3UKUB 2NZTA 4FW2A 3MN7A 1Y97A 1TK5A 4A5AA 3WT0A 4FVUA 3CJ1A 1CZBA 3VQEA 2NRXA 1YI2N 1NKCA 1J5OA 3CERA 1NGIA 3VF6A 4IOXA 4EAHD 1KD1O 5AR0A 1ASWA 5AQVA 2O8EA 1MDUB 1KTQA 1XHZA 1BI4A 2HHQA 4JS4A 3T19A 1NGBA 1VSMA 1ZBSA 1SL0A 4OVLA 3VQ6A 2QWQA 4DV2K 2V7YA 1NGJA 1RDUA 3O9UA 3QNNA 4FWKA 4FWSA 4CFDA 4JNEA 1RTDA 4N47A 2IS3A 3DLRA 2Z1IA 4BR0A 4RW7A 4CZKA 3VESA 2OA8A 4FJIA 2ZGZA 3ULEB 3CXCM 1BDGA 3ZSXA 3CJCA 2Q36A 1NMNA 3VQ9A 4DHYA 5BRHA 3M6GA 3NGYA 3D2EB 1VSDA 3L2RA 2GEMA 5HROA 4EP5A 3MX5A 2ZF5O 1H1VA 3EL2A 4DFMA 5ADXH 3I33A 1Q7YO 5D3GA 3VPZA 3TAPA 2Q1NA 2H3GX 3T1YK 3VGKA 2D0CA 3EN9A 3V4IA 5C0YA 2JWLA 4BE2A 4FJNA 2V51B 4HTUA 4C8OA 4CJ4A 1HJRA 2IGIA 2F4VK 3D7EO 2O4GA 4B3SK 4AQYK 4E1MA 3I8DA 1Q82O 3O9TA 5MLCQ 1LOTB 2NNWA 3L2VA 4PQUA 2QWPA 2CGJA 3MN9A 1EWQA 1ASVA 1WOQA 5FPDA 4OLAA 1YAGA 4HUGA 4WE1A 4FLUA 2AA4A 3VQDA 2NRTA 3U6FA 3D45A 4CJRA 1NKEA 2E2OA 4B9QA 3NF7A 2A1RA 1NM1A 3AVBA 2HBJA 3JYTA 3K59A 4CBUA 1TK8A 3LL3A 4CJ3A 3LWLA 1QVFM 4DV3K 3VEOA 4DV1K 4WFBL 3TAQA 1GOAA 4FJHA 4E7HA 1RTJA 2D0BA 5AFUA 2IDOA 4DV5K 3OYGA 2FSNA 4KKOA 4FJ5A 3E9OA 4RW6A 1RT5A 4BRFA 3N4QA 2O8CB 4JS5A 2GWJA 4Y1DA 3K2PA 3L2QA 4HTLA 4EHUA 1JL2A 2P9LA 2KW4A 4F2RA 1NOYA 2HB5A 1RFQA
chains in the Genus database with same CATH topology
4DTMA 1IG9A 1UWBA 2WONA 2KTQA 1TV6A 3OY9A 4B3OA 1QSYA 4N5SA 3LANA 2JGUA 4E19A 4BE1A 4DTOA 2IOCA 3VQ5A 3NFAA 4O5BA 4B9UA 3AVLA 1BQMA 1TKDA 1N6QA 1Q9XA 3TAMA 2HW3A 3OYFA 3KLFA 4M45A 3TAFA 3WNFA 4CJQA 1D5AA 2Z1JA 4CGFA 4BDPA 4DTPA 4HCCA 4LH4A 3AO5A 1TK0A 4DWIA 2ETJA 2ITGA 1QTMA 1BCOA 1BHLA 1XI1A 1KFDA 4OKKA 4DTSA 3AVHA 1VSHA 2E6MA 2Q3SA 4Z0UA 1ZBFA 3IG1A 1JLGA 4ZHRA 1ZBUA 4E0DA 1QE1A 3OYHA 3DLHA 1TL1A 1RBSA 3DLGA 3LPUA 4KFBA 3ZSOA 1B92A 1C0UA 1GOBA 1RBRA 2XY8A 3AVFA 3C95A 4M3RA 4HUEA 1GOCA 2EHGA 3AVMA 2NUBA 3KKRA 3LP3A 4CHZA 1O1WA 4B9MA 2DFEA 4CEFA 3SPZA 1EKEA 4BACA 3SQ1A 5FROA 1VSEA 3OYKA 2G8UA 2D5RA 1L3UA 3OJUA 1FKOA 1RT6A 4B8CA 4N56A 4E7LA 4Q0BA 3HT3A 1RDAA 2KZZA 4DU3A 3NH1A 3S3MA 5DMRA 1JXEA 1WLJA 4CF2A 3CQ8A 1KLMA 4FJKA 3O4QA 4KHUA 2HHVA 2Z1GA 4FM2A 5K14A 2XRIA 5I3UA 4FLTA 5EU7A 2HNZA 3KK1A 2DFFA 1LAWA 1RILA 1WAJA 3MEEA 1S6QA 2F8SA 4FJ9A 4W5RA 4Z4CA 1HPZA 3KK3A 3EYZA 4BDYA 2QK9A 3QIOA 3LP2A 4I2QA 4CEBA 1WAFA 1SL2A 3LP1A 4I9QA 3SUNA 4Z4GA 4E7IA 4KHQA 3F9KA 3OYCA 1TVRA 3MXJA 3AV9A 1BL3A 3SJJA 1NK8A 4B9TA 2R7YA 3IRXA 1RDBA 1WSJA 5E41A 4FLZA 3VQBA 4BWMA 3CYMA 2OPSA 3KLIA 2Y1IA 3RWUA 1TKZA 1IO2A 4W5TA 4I2PA 3TABA 3MXMA 3K5LA 1TKTA 4Z4FA 1BISA 4CHPA 3AVIA 3OYIA 4ID1A 1JLQA 1VRUA 1WN7A 3EY1A 4KHYA 1WSFA 4CJVA 3HJFA 4CEEA 4FJ7A 3VQCA 3MAQA 5HRNA 2RF2A 4F8RA 3SPYA 5I42A 3RMCA 4CEOA 3CM6A 2VWJA 5FRMA 3ZSRA 3NGZA 2YHAA 3OYEA 4HHTA 4M3WA 2F8TA 4OKJA 4FCYA 1U4BA 3PO4A 3T1AA 4DTNA 4CEZA 4XIUA 3V1OA 3RRGA 2D0AA 3AA4A 2BANA 1T05A 2B6AA 4DQRA 1NK4A 1WSHA 3V9SA 2OPPA 2FBYA 5T7BA 3OYNA 4GMJB 3OYLA 3DLBA 4O0IA 3SI6A 4FJGA 2G8IA 3HPGA 4EZ6A 4QCLA 4F4KA 3KLHA 3IAYA 5HBMA 4DS4A 1X9SA 3V9WA 2E6LA 4FJMA 4N41A 2DY4A 2P51A 4FLWA 3HYFA 1ZBIA 1JXBA 3AVAA 1K6YA 3CFRA 4Z4HA 3F73A 4DTJA 2OPRA 3ZCMA 1FKPA 3B6PA 1LAVA 3QLHA 4CK2A 1A5XA 3LZIA 4H4OA 3BDPA 3WNEA 1NK7A 1JLFA 1CXUA 3CM5A 1JLBA 2FBXA 3HP9A 4IG3A 3NH2A 3KLGA 1KRPA 3S9HA 3OJSA 2P1JA 1DLOA 1JLAA 3AO4A 3QINA 1T03A 4B08A 3O4NA 4CJSA 4DFJA 3QEWA 4F3OA 2F96A 4KTWA 4LY7A 5KTQA 1HYSA 4CJLA 4DSKA 3HVTA 1F21A 4IFYA 1VSIA 3O3HA 2OZSA 2KQ2A 2XO7A 4HUFA 4Z4IA 1RCHA 3EZ5A 4DTXA 5J2MA 1G15A 3AA5X 3ULDA 3TR8A 1BCMA 1SKWA 4IKFA 4HCBA 4FZXC 3ZSYA 3K57A 1BI4B 1Q9YA 1VSKA 4MQ3A 1HQUA 1JKHA 5HRSA 5KRSA 4M3YA 2G8HA 1BGXT 4DSEA 4KHSA 1U48A 3ZT4A 1U49A 2YHBA 3HK2A 4NCAA 3P5JA 3V9ZA 4KHNA 2E4LA 1S1VA 1QSSA 3S3OA 4FLYA 2AJQA 2HNDA 3DRRA 3OYAA 1JLCA 3QEVA 2YNIA 4B9NA 4AH9A 3SCXA 1DTQA 4ICLA 4DTUA 2FBVA 1TAQA 3TANA 4OKEA 1A5WA 1S1UA 4CJKA 3CFPA 3HO1A 1DTTA 4I9LA 4KHWA 4QOZB 4OPJA 3ALYA 1RT1A 3FFIA 3LALA 5KGWA 1CXQA 2GUIA 1UA1A 1RDCA 4DLEA 2QKKA 3NH0A 1I39A 3DOKA 4AHCA 1R0AA 4NYNA 4ZTJA 3HPOA 1UOCA 4M3XA 4O4GA 1L3VA 1J53A 3V81A 3C6UA 4W5OA 2BE2A 3HVRA 1J9AA 1W0HA 1HNVA 2XY7A 1LW2A 4O55A 4CERA 4M3UA 1ZBHA 4FJJA 2B5JA 3NBPA 3SUOA 2EX3A 1NK9A 2P5OA 3V9UA 4CEQA 1RT7A 2X6SA 3QIPA 3VQ4A 3KK2A 2ATQA 3L2WA 3PO5A 3HXMA 4CF8A 2FC0A 3OYJA 3WNHA 4CECA 1ASUA 1S1TA 2X6NA 3VA0A 4CJPA 3SUQA 2PYJA 5JS1A 4YFUA 3KD5E 5C24A 3ZSZA 3KKSA 3G10A 3SV4A 2I5JA 1B9FA 4E89A 4B9VA 4CIFA 4CHNA 3PY8A 3K5NA 4LH5A 1X9WA 1U45A 2BGGA 4LD0A 2DTUA 4DU4A 4DSIA 1SUQA 3KJVA 1S1WA 1S9EA 4JLHA 3U3GA 4E3SA 1C1AA 4EP4A 2QXFA 3TAEA 1C1CA 3OS0A 4FJ8A 1KVCA 3NDKA 4C8NA 1FXXA 3C6TA 3PUFA 3PX4A 4G1QA 3DLKA 4W5QA 4FK2A 2GV9A 4QAGA 3LZJA 3PX6A 3S3NA 4H4MA 4ELUA 3LAKA 4AHTA 3M8SA 4FJXA 4FXDA 1LWCA 2YKMA 4NYFA 3ISNC 1WSGA 1CLQA 4LSLA 3TARA 1FK9A 2YNFA 4M3ZA 1T8EA 3P1GA 3ZSVA 1D9FA 3RMBA 4RW8A 2Y1JA 1RTIA 4BE0A 1NJWA 1C6VA 1YTAA 4CK3A 1WSIA 5SWMA 3RR8A 2VG7A 4CIEA 3H08A 3PV8A 3NGIA 4CJUA 1CZ9A 2PYLA 1YTUA 3B6OA 4DQIA 1WSEA 3SNNA 5DK5A 1QS4A 2IC3A 4M41A 3OYBA 3WNGA 3QEPA 2PZSA 1KCFA 2BDPA 2A1SA 5JS2A 4OPKA 3ZT2A 4FM1A 1S6PA 1KSPA 4ELTA 1ZBLA 3RRHA 4JRPA 4AHSA 1U04A 4J2BA 3ZT1A 4CFBA 3AVKA 3AA3A 1L5UA 3LPTA 4PY5A 4AHVA 4CHYA 4KREA 1RNHA 2RKIA 3MEDA 3VQPA 4Q5VA 4KB0A 4DF4A 1XHXA 1X9MA 3RTVA 1N5YA 2HHWA 5CYQA 4KO0A 1EXQA 1J54A 1VSLA 1Z25A 5KI6A 2G8VA 1HRHA 1JLEA 3U3YA 4C8LA 1Q8IA 4I7FA 2RN2A 1ZYQA 1QQCA 1NK5A 3AO3A 1L3SA 3QEXA 4DSJA 2KFZA 2P5GA 4CK1A 1RBTA 4CJTA 2ZQBA 1ITGA 3AVJA 2G8WA 1S1XA 2G8KA 3HPHA 5HRPA 1SKSA 2OYQA 2VWKA 3KD1E 4CJ5A 3L2UA 4J2DA 3AA2A 3VQQA 2XY5A 4CHQA 4AHUA 3NHGA 4DF8A 4DU1A 1LV5A 3LAMA 3V6DA 1WNSA 4CF0A 4CF1A 1HQEA 3VQ7A 1U47A 4J2AA 4AILC 2VG5A 4FZZA 3OVNA 3OS1A 2KFNA 4DQQA 2KZMA 3SUPA 4F3TA 4IG0A 4DG1A 1SKRA 2YKNA 4DFPA 3TI0A 4IBNA 1RT2A 4CGIA 3HM9A 1IKVA 3CFOA 4ZTFA 5HRRA 4DMNA 3HP6A 4RW9A 2QKBA 4KTZA 4FW2A 4CCHA 1Y97A 3DLEA 4CJFA 1IH7A 3OYMA 1TK5A 3QESA 2ZE2A 2HHSA 4ID5A 1CZBA 5CY4A 3VQEA 3SQ2A 4KRFA 2YV0X 4M42A 3SYZA 4DSFA 3ZSQA 1NKCA 1J5OA 4H8KA 3I0SA 3SV3A 4FZYA 4GVMA 4CGJA 4KI4A 4RG8A 1S5JA 4CFCA 3NF8A 1RBUA 4CE9A 3M8QA 3VQAA 4CF9A 1KVBA 3SQ4A 2G8FA 1ASWA 1IKWA 4FK4A 1XHZA 1KTQA 1Z26A 1EP4A 1I3AA 1BI4A 3NF6A 2HMIA 2HHQA 4JS4A 4BWJA 3T19A 1VSMA 1IKYA 1LWEA 3DRPA 1SL0A 2OPQA 4OVLA 4CJWA 3K58A 4O44A 2XY6A 4K8ZA 3VQ6A 3THVA 1KVAA 5FRNA 3QETA 4KTQA 3QEIA 1D9DA 4DS5A 4MFBA 4N76A 3HSTB 1QHTA 2HVHA 1RBVA 4DFKA 4PWDA 3KIOA 2DFHA 5CZ2A 4OGCA 3QNNA 1TGOA 3VA3A 4J2EA 1VRTA 5CZ1A 4CFDA 3RMAA 4JRQA 1QSLA 4EZ9A 1RTDA 4E7JA 4N47A 3M8PA 3L8BA 2IS3A 3DLRA 4O0JA 5KRTA 2Z1IA 5J2NA 3SQ0A 4RW7A 4CGHA 1LWFA 2OZMA 2OA8A 1NKBA 4FJIA 3DMJA 5CYMA 4KAZA 1B9DA 4OLBA 3ASMA 3AO2A 3ZSXA 4B9SA 4NCGA 3DM2A 1C0MA 1VK0A 3VQ9A 1NJZA 4E1NA 4NCBA 1EX4A 2X78A 3LDSA 3KLEA 3NGYA 3VN5A 4C8MA 2W42A 1KFSA 3K5OA 1TKXA 4KPYA 1VSDA 2Z1HA 3L2RA 1C1BA 4FW1A 1EETA 3LWMA 5HROA 4CEAA 4EP5A 1D8YA 2HNYA 3E01A 3OS2A 4IDKA 3MXIA 1A5VA 1C0TA 4DFMA 3DRSA 1LW0A 5D3GA 3DI6A 4FJLA 1VSFA 4LSNA 4CGDA 4KI6A 4F2SA 5KGXA 1RTHA 1VSJA 2JLEA 3V1QA 2VG6A 2LSNA 4YNQA 3TAPA 1JL1A 3ZSWA 2YNGA 1S9GA 2X74A 4DQSA 1MU2A 4FVMA 2HHUA 3QO9A 4DLGA 3A2FA 3DYAA 3LP0A 5J1EA 3L3VA 2HHTA 1XC9A 2D0CA 3QERA 4FYDA 2FBTA 3V4IA 4TSXA 4B9LA 4BE2A 4KB1A 4L8RB 4ELVA 3C94A 2HHXA 4CGGA 4FJNA 1T7PA 2B4JA 3TAGA 4DQPA 4HTUA 4C8OA 3NE6A 4CJ4A 1HJRA 3G0ZA 3M8RA 3MECA 3AVNA 3RMDA 1RT3A 3TWHA 3BGRA 2IGIA 4E7KA 4M3TA 1NJYA 2O4GA 3VQ8A 4B8AB 4CESA 2O4IA 3O3FA 3ZT0A 1RT4A 1SL1A 4DSLA 2GBZA 3QNOA 4E1MA 4Z4EA 3I8DA 1XWLA 4OGEA 4CIGA 3L2VA 5HP1A 3HL8A 3O3GA 4UQGA 4PQUA 2IAJA 2WOMA 4AHRA 5FDLA 1NK6A 5HLFA 3V9XA 4R5PA 3NF9A 5J2PA 4C8KA 3P83D 1ASVA 3ITHA 4OLAA 3PX0A 4CJEA 1NJXA 4HVJA 1BIZA 4HUGA 4WE1A 3MEGA 4FLUA 1REVA 3UIQA 3VQDA 3KTQA 4CEDA 4FK0A 1TL3A 5C25A 5C42A 3NCIA 3U6FA 3D45A 4CJRA 1SV5A 1UAXA 2PY5A 4OJRA 1NKEA 1NOZA 3I0RA 3NF7A 2A1RA 1BIUA 1HNIA 3D0PA 3AVBA 3CG7A 4KV8A 1YVUA 3JYTA 4DTRA 1HMVA 3K59A 2HVIA 3ZT3A 3AVCA 4CJ3A 1W9HA 3LWLA 1BQNA 4FM0A 1TK8A 3OYDA 5SZTA 1HYVA 4PA1A 4FLVA 2YNHA 3TAQA 1GOAA 4FJHA 4E7HA 1RTJA 2D0BA 4Y1CA 2IDOA 1KLNA 2XHBA 3NAEA 3T3FA 1NK0A 4W5NA 1RDDA 2RPIA 3OYGA 4CHOA 5J2QA 4KKOA 4K8XA 3JSMA 4FJ5A 4GW6A 4RW6A 1YT3A 4CFAA 1RT5A 1HYZA 4RW4A 3DOLA 4JS5A 1L3TA 4FLXA 3AVGA 4Y1DA 3V1RA 3L3UA 4PUOA 3K2PA 3AO1A 3SZ2A 3L2QA 3RR7A 1IKXA 1TAUA 1UA0A 1JL2A 4IFVA 2KW4A 4F2RA 3K5MA 1NOYA 2HB5A 3IS9A 1X1PA 4BDZA 2ZD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DTM A;  1IG9 A;  1UWB A;  2WON A;  2KTQ A;  1TV6 A;  3OY9 A;  4B3O A;  1QSY A;  4N5S A;  3LAN A;  2JGU A;  4E19 A;  4BE1 A;  4DTO A;  2IOC A;  3VQ5 A;  3NFA A;  4O5B A;  4B9U A;  3AVL A;  1BQM A;  1TKD A;  1N6Q A;  1Q9X A;  3TAM A;  2HW3 A;  3OYF A;  3KLF A;  4M45 A;  3TAF A;  3WNF A;  4CJQ A;  1D5A A;  2Z1J A;  4CGF A;  4BDP A;  4DTP A;  4HCC A;  4LH4 A;  3AO5 A;  1TK0 A;  4DWI A;  2ETJ A;  2ITG A;  1QTM A;  1BCO A;  1BHL A;  1XI1 A;  1KFD A;  4OKK A;  4DTS A;  3AVH A;  1VSH A;  2E6M A;  2Q3S A;  4Z0U A;  1ZBF A;  3IG1 A;  1JLG A;  4ZHR A;  1ZBU A;  4E0D A;  1QE1 A;  3OYH A;  3DLH A;  1TL1 A;  1RBS A;  3DLG A;  3LPU A;  4KFB A;  3ZSO A;  1B92 A;  1C0U A;  1GOB A;  1RBR A;  2XY8 A;  3AVF A;  3C95 A;  4M3R A;  4HUE A;  1GOC A;  2EHG A;  3AVM A;  2NUB A;  3KKR A;  3LP3 A;  4CHZ A;  1O1W A;  4B9M A;  2DFE A;  4CEF A;  3SPZ A;  1EKE A;  4BAC A;  3SQ1 A;  5FRO A;  1VSE A;  3OYK A;  2G8U A;  2D5R A;  1L3U A;  3OJU A;  1FKO A;  1RT6 A;  4B8C A;  4N56 A;  4E7L A;  4Q0B A;  3HT3 A;  1RDA A;  2KZZ A;  4DU3 A;  3NH1 A;  3S3M A;  5DMR A;  1JXE A;  1WLJ A;  4CF2 A;  3CQ8 A;  1KLM A;  4FJK A;  3O4Q A;  4KHU A;  2HHV A;  2Z1G A;  4FM2 A;  5K14 A;  2XRI A;  5I3U A;  4FLT A;  5EU7 A;  2HNZ A;  3KK1 A;  2DFF A;  1LAW A;  1RIL A;  1WAJ A;  3MEE A;  1S6Q A;  2F8S A;  4FJ9 A;  4W5R A;  4Z4C A;  1HPZ A;  3KK3 A;  3EYZ A;  4BDY A;  2QK9 A;  3QIO A;  3LP2 A;  4I2Q A;  4CEB A;  1WAF A;  1SL2 A;  3LP1 A;  4I9Q A;  3SUN A;  4Z4G A;  4E7I A;  4KHQ A;  3F9K A;  3OYC A;  1TVR A;  3MXJ A;  3AV9 A;  1BL3 A;  3SJJ A;  1NK8 A;  4B9T A;  2R7Y A;  3IRX A;  1RDB A;  1WSJ A;  5E41 A;  4FLZ A;  3VQB A;  4BWM A;  3CYM A;  2OPS A;  3KLI A;  2Y1I A;  3RWU A;  1TKZ A;  1IO2 A;  4W5T A;  4I2P A;  3TAB A;  3MXM A;  3K5L A;  1TKT A;  4Z4F A;  1BIS A;  4CHP A;  3AVI A;  3OYI A;  4ID1 A;  1JLQ A;  1VRU A;  1WN7 A;  3EY1 A;  4KHY A;  1WSF A;  4CJV A;  3HJF A;  4CEE A;  4FJ7 A;  3VQC A;  3MAQ A;  5HRN A;  2RF2 A;  4F8R A;  3SPY A;  5I42 A;  3RMC A;  4CEO A;  3CM6 A;  2VWJ A;  5FRM A;  3ZSR A;  3NGZ A;  2YHA A;  3OYE A;  4HHT A;  4M3W A;  2F8T A;  4OKJ A;  4FCY A;  1U4B A;  3PO4 A;  3T1A A;  4DTN A;  4CEZ A;  4XIU A;  3V1O A;  3RRG A;  2D0A A;  3AA4 A;  2BAN A;  1T05 A;  2B6A A;  4DQR A;  1NK4 A;  1WSH A;  3V9S A;  2OPP A;  2FBY A;  5T7B A;  3OYN A;  4GMJ B;  3OYL A;  3DLB A;  4O0I A;  3SI6 A;  4FJG A;  2G8I A;  3HPG A;  4EZ6 A;  4QCL A;  4F4K A;  3KLH A;  3IAY A;  5HBM A;  4DS4 A;  1X9S A;  3V9W A;  2E6L A;  4FJM A;  4N41 A;  2DY4 A;  2P51 A;  4FLW A;  3HYF A;  1ZBI A;  1JXB A;  3AVA A;  1K6Y A;  3CFR A;  4Z4H A;  3F73 A;  4DTJ A;  2OPR A;  3ZCM A;  1FKP A;  3B6P A;  1LAV A;  3QLH A;  4CK2 A;  1A5X A;  3LZI A;  4H4O A;  3BDP A;  3WNE A;  1NK7 A;  1JLF A;  1CXU A;  3CM5 A;  1JLB A;  2FBX A;  3HP9 A;  4IG3 A;  3NH2 A;  3KLG A;  1KRP A;  3S9H A;  3OJS A;  2P1J A;  1DLO A;  1JLA A;  3AO4 A;  3QIN A;  1T03 A;  4B08 A;  3O4N A;  4CJS A;  4DFJ A;  3QEW A;  4F3O A;  2F96 A;  4KTW A;  4LY7 A;  5KTQ A;  1HYS A;  4CJL A;  4DSK A;  3HVT A;  1F21 A;  4IFY A;  1VSI A;  3O3H A;  2OZS A;  2KQ2 A;  2XO7 A;  4HUF A;  4Z4I A;  1RCH A;  3EZ5 A;  4DTX A;  5J2M A;  1G15 A;  3AA5 X;  3ULD A;  3TR8 A;  1BCM A;  1SKW A;  4IKF A;  4HCB A;  4FZX C;  3ZSY A;  3K57 A;  1BI4 B;  1Q9Y A;  1VSK A;  4MQ3 A;  1HQU A;  1JKH A;  5HRS A;  5KRS A;  4M3Y A;  2G8H A;  1BGX T;  4DSE A;  4KHS A;  1U48 A;  3ZT4 A;  1U49 A;  2YHB A;  3HK2 A;  4NCA A;  3P5J A;  3V9Z A;  4KHN A;  2E4L A;  1S1V A;  1QSS A;  3S3O A;  4FLY A;  2AJQ A;  2HND A;  3DRR A;  3OYA A;  1JLC A;  3QEV A;  2YNI A;  4B9N A;  4AH9 A;  3SCX A;  1DTQ A;  4ICL A;  4DTU A;  2FBV A;  1TAQ A;  3TAN A;  4OKE A;  1A5W A;  1S1U A;  4CJK A;  3CFP A;  3HO1 A;  1DTT A;  4I9L A;  4KHW A;  4QOZ B;  4OPJ A;  3ALY A;  1RT1 A;  3FFI A;  3LAL A;  5KGW A;  1CXQ A;  2GUI A;  1UA1 A;  1RDC A;  4DLE A;  2QKK A;  3NH0 A;  1I39 A;  3DOK A;  4AHC A;  1R0A A;  4NYN A;  4ZTJ A;  3HPO A;  1UOC A;  4M3X A;  4O4G A;  1L3V A;  1J53 A;  3V81 A;  3C6U A;  4W5O A;  2BE2 A;  3HVR A;  1J9A A;  1W0H A;  1HNV A;  2XY7 A;  1LW2 A;  4O55 A;  4CER A;  4M3U A;  1ZBH A;  4FJJ A;  2B5J A;  3NBP A;  3SUO A;  2EX3 A;  1NK9 A;  2P5O A;  3V9U A;  4CEQ A;  1RT7 A;  2X6S A;  3QIP A;  3VQ4 A;  3KK2 A;  2ATQ A;  3L2W A;  3PO5 A;  3HXM A;  4CF8 A;  2FC0 A;  3OYJ A;  3WNH A;  4CEC A;  1ASU A;  1S1T A;  2X6N A;  3VA0 A;  4CJP A;  3SUQ A;  2PYJ A;  5JS1 A;  4YFU A;  3KD5 E;  5C24 A;  3ZSZ A;  3KKS A;  3G10 A;  3SV4 A;  2I5J A;  1B9F A;  4E89 A;  4B9V A;  4CIF A;  4CHN A;  3PY8 A;  3K5N A;  4LH5 A;  1X9W A;  1U45 A;  2BGG A;  4LD0 A;  2DTU A;  4DU4 A;  4DSI A;  1SUQ A;  3KJV A;  1S1W A;  1S9E A;  4JLH A;  3U3G A;  4E3S A;  1C1A A;  4EP4 A;  2QXF A;  3TAE A;  1C1C A;  3OS0 A;  4FJ8 A;  1KVC A;  3NDK A;  4C8N A;  1FXX A;  3C6T A;  3PUF A;  3PX4 A;  4G1Q A;  3DLK A;  4W5Q A;  4FK2 A;  2GV9 A;  4QAG A;  3LZJ A;  3PX6 A;  3S3N A;  4H4M A;  4ELU A;  3LAK A;  4AHT A;  3M8S A;  4FJX A;  4FXD A;  1LWC A;  2YKM A;  4NYF A;  3ISN C;  1WSG A;  1CLQ A;  4LSL A;  3TAR A;  1FK9 A;  2YNF A;  4M3Z A;  1T8E A;  3P1G A;  3ZSV A;  1D9F A;  3RMB A;  4RW8 A;  2Y1J A;  1RTI A;  4BE0 A;  1NJW A;  1C6V A;  1YTA A;  4CK3 A;  1WSI A;  5SWM A;  3RR8 A;  2VG7 A;  4CIE A;  3H08 A;  3PV8 A;  3NGI A;  4CJU A;  1CZ9 A;  2PYL A;  1YTU A;  3B6O A;  4DQI A;  1WSE A;  3SNN A;  5DK5 A;  1QS4 A;  2IC3 A;  4M41 A;  3OYB A;  3WNG A;  3QEP A;  2PZS A;  1KCF A;  2BDP A;  2A1S A;  5JS2 A;  4OPK A;  3ZT2 A;  4FM1 A;  1S6P A;  1KSP A;  4ELT A;  1ZBL A;  3RRH A;  4JRP A;  4AHS A;  1U04 A;  4J2B A;  3ZT1 A;  4CFB A;  3AVK A;  3AA3 A;  1L5U A;  3LPT A;  4PY5 A;  4AHV A;  4CHY A;  4KRE A;  1RNH A;  2RKI A;  3MED A;  3VQP A;  4Q5V A;  4KB0 A;  4DF4 A;  1XHX A;  1X9M A;  3RTV A;  1N5Y A;  2HHW A;  5CYQ A;  4KO0 A;  1EXQ A;  1J54 A;  1VSL A;  1Z25 A;  5KI6 A;  2G8V A;  1HRH A;  1JLE A;  3U3Y A;  4C8L A;  1Q8I A;  4I7F A;  2RN2 A;  1ZYQ A;  1QQC A;  1NK5 A;  3AO3 A;  1L3S A;  3QEX A;  4DSJ A;  2KFZ A;  2P5G A;  4CK1 A;  1RBT A;  4CJT A;  2ZQB A;  1ITG A;  3AVJ A;  2G8W A;  1S1X A;  2G8K A;  3HPH A;  5HRP A;  1SKS A;  2OYQ A;  2VWK A;  3KD1 E;  4CJ5 A;  3L2U A;  4J2D A;  3AA2 A;  3VQQ A;  2XY5 A;  4CHQ A;  4AHU A;  3NHG A;  4DF8 A;  4DU1 A;  1LV5 A;  3LAM A;  3V6D A;  1WNS A;  4CF0 A;  4CF1 A;  1HQE A;  3VQ7 A;  1U47 A;  4J2A A;  4AIL C;  2VG5 A;  4FZZ A;  3OVN A;  3OS1 A;  2KFN A;  4DQQ A;  2KZM A;  3SUP A;  4F3T A;  4IG0 A;  4DG1 A;  1SKR A;  2YKN A;  4DFP A;  3TI0 A;  4IBN A;  1RT2 A;  4CGI A;  3HM9 A;  1IKV A;  3CFO A;  4ZTF A;  5HRR A;  4DMN A;  3HP6 A;  4RW9 A;  2QKB A;  4KTZ A;  4FW2 A;  4CCH A;  1Y97 A;  3DLE A;  4CJF A;  1IH7 A;  3OYM A;  1TK5 A;  3QES A;  2ZE2 A;  2HHS A;  4ID5 A;  1CZB A;  5CY4 A;  3VQE A;  3SQ2 A;  4KRF A;  2YV0 X;  4M42 A;  3SYZ A;  4DSF A;  3ZSQ A;  1NKC A;  1J5O A;  4H8K A;  3I0S A;  3SV3 A;  4FZY A;  4GVM A;  4CGJ A;  4KI4 A;  4RG8 A;  1S5J A;  4CFC A;  3NF8 A;  1RBU A;  4CE9 A;  3M8Q A;  3VQA A;  4CF9 A;  1KVB A;  3SQ4 A;  2G8F A;  1ASW A;  1IKW A;  4FK4 A;  1XHZ A;  1KTQ A;  1Z26 A;  1EP4 A;  1I3A A;  1BI4 A;  3NF6 A;  2HMI A;  2HHQ A;  4JS4 A;  4BWJ A;  3T19 A;  1VSM A;  1IKY A;  1LWE A;  3DRP A;  1SL0 A;  2OPQ A;  4OVL A;  4CJW A;  3K58 A;  4O44 A;  2XY6 A;  4K8Z A;  3VQ6 A;  3THV A;  1KVA A;  5FRN A;  3QET A;  4KTQ A;  3QEI A;  1D9D A;  4DS5 A;  4MFB A;  4N76 A;  3HST B;  1QHT A;  2HVH A;  1RBV A;  4DFK A;  4PWD A;  3KIO A;  2DFH A;  5CZ2 A;  4OGC A;  3QNN A;  1TGO A;  3VA3 A;  4J2E A;  1VRT A;  5CZ1 A;  4CFD A;  3RMA A;  4JRQ A;  1QSL A;  4EZ9 A;  1RTD A;  4E7J A;  4N47 A;  3M8P A;  3L8B A;  2IS3 A;  3DLR A;  4O0J A;  5KRT A;  2Z1I A;  5J2N A;  3SQ0 A;  4RW7 A;  4CGH A;  1LWF A;  2OZM A;  2OA8 A;  1NKB A;  4FJI A;  3DMJ A;  5CYM A;  4KAZ A;  1B9D A;  4OLB A;  3ASM A;  3AO2 A;  3ZSX A;  4B9S A;  4NCG A;  3DM2 A;  1C0M A;  1VK0 A;  3VQ9 A;  1NJZ A;  4E1N A;  4NCB A;  1EX4 A;  2X78 A;  3LDS A;  3KLE A;  3NGY A;  3VN5 A;  4C8M A;  2W42 A;  1KFS A;  3K5O A;  1TKX A;  4KPY A;  1VSD A;  2Z1H A;  3L2R A;  1C1B A;  4FW1 A;  1EET A;  3LWM A;  5HRO A;  4CEA A;  4EP5 A;  1D8Y A;  2HNY A;  3E01 A;  3OS2 A;  4IDK A;  3MXI A;  1A5V A;  1C0T A;  4DFM A;  3DRS A;  1LW0 A;  5D3G A;  3DI6 A;  4FJL A;  1VSF A;  4LSN A;  4CGD A;  4KI6 A;  4F2S A;  5KGX A;  1RTH A;  1VSJ A;  2JLE A;  3V1Q A;  2VG6 A;  2LSN A;  4YNQ A;  3TAP A;  1JL1 A;  3ZSW A;  2YNG A;  1S9G A;  2X74 A;  4DQS A;  1MU2 A;  4FVM A;  2HHU A;  3QO9 A;  4DLG A;  3A2F A;  3DYA A;  3LP0 A;  5J1E A;  3L3V A;  2HHT A;  1XC9 A;  2D0C A;  3QER A;  4FYD A;  2FBT A;  3V4I A;  4TSX A;  4B9L A;  4BE2 A;  4KB1 A;  4L8R B;  4ELV A;  3C94 A;  2HHX A;  4CGG A;  4FJN A;  1T7P A;  2B4J A;  3TAG A;  4DQP A;  4HTU A;  4C8O A;  3NE6 A;  4CJ4 A;  1HJR A;  3G0Z A;  3M8R A;  3MEC A;  3AVN A;  3RMD A;  1RT3 A;  3TWH A;  3BGR A;  2IGI A;  4E7K A;  4M3T A;  1NJY A;  2O4G A;  3VQ8 A;  4B8A B;  4CES A;  2O4I A;  3O3F A;  3ZT0 A;  1RT4 A;  1SL1 A;  4DSL A;  2GBZ A;  3QNO A;  4E1M A;  4Z4E A;  3I8D A;  1XWL A;  4OGE A;  4CIG A;  3L2V A;  5HP1 A;  3HL8 A;  3O3G A;  4UQG A;  4PQU A;  2IAJ A;  2WOM A;  4AHR A;  5FDL A;  1NK6 A;  5HLF A;  3V9X A;  4R5P A;  3NF9 A;  5J2P A;  4C8K A;  3P83 D;  1ASV A;  3ITH A;  4OLA A;  3PX0 A;  4CJE A;  1NJX A;  4HVJ A;  1BIZ A;  4HUG A;  4WE1 A;  3MEG A;  4FLU A;  1REV A;  3UIQ A;  3VQD A;  3KTQ A;  4CED A;  4FK0 A;  1TL3 A;  5C25 A;  5C42 A;  3NCI A;  3U6F A;  3D45 A;  4CJR A;  1SV5 A;  1UAX A;  2PY5 A;  4OJR A;  1NKE A;  1NOZ A;  3I0R A;  3NF7 A;  2A1R A;  1BIU A;  1HNI A;  3D0P A;  3AVB A;  3CG7 A;  4KV8 A;  1YVU A;  3JYT A;  4DTR A;  1HMV A;  3K59 A;  2HVI A;  3ZT3 A;  3AVC A;  4CJ3 A;  1W9H A;  3LWL A;  1BQN A;  4FM0 A;  1TK8 A;  3OYD A;  5SZT A;  1HYV A;  4PA1 A;  4FLV A;  2YNH A;  3TAQ A;  1GOA A;  4FJH A;  4E7H A;  1RTJ A;  2D0B A;  4Y1C A;  2IDO A;  1KLN A;  2XHB A;  3NAE A;  3T3F A;  1NK0 A;  4W5N A;  1RDD A;  2RPI A;  3OYG A;  4CHO A;  5J2Q A;  4KKO A;  4K8X A;  3JSM A;  4FJ5 A;  4GW6 A;  4RW6 A;  1YT3 A;  4CFA A;  1RT5 A;  1HYZ A;  4RW4 A;  3DOL A;  4JS5 A;  1L3T A;  4FLX A;  3AVG A;  4Y1D A;  3V1R A;  3L3U A;  4PUO A;  3K2P A;  3AO1 A;  3SZ2 A;  3L2Q A;  3RR7 A;  1IKX A;  1TAU A;  1UA0 A;  1JL2 A;  4IFV A;  2KW4 A;  4F2R A;  3K5M A;  1NOY A;  2HB5 A;  3IS9 A;  1X1P A;  4BDZ A;  2ZD1 A; 
#chains in the Genus database with same CATH topology
 1IG9 A;  2WON A;  2PFU A;  3T69 A;  5LMU K;  1NGF A;  3OY9 A;  3CMA N;  4B3O A;  3E1Y A;  5AQK A;  1KAZ A;  4B9U A;  1BQM A;  1XNQ K;  2UXC K;  4X66 K;  4M45 A;  1ATS A;  2Z1J A;  3I56 N;  4BDP A;  3AO5 A;  3J8A A;  3ENO A;  2Q3S A;  3FZK A;  1QVG M;  2FF3 B;  3SAF A;  4E0D A;  3QDK A;  1HX1 A;  3OYH A;  1TL1 A;  1D9D A;  3LPU A;  3LZJ A;  5AQQ A;  3KD1 E;  1GOB A;  1GOC A;  3LP3 A;  2NUB A;  2ASP A;  4IDH A;  3SPZ A;  3C7N A;  2QA4 N;  2G8U A;  3OJU A;  1RT6 A;  4E7L A;  3S3M A;  4LF4 K;  5DMR A;  4FJK A;  4JD2 B;  2Z1G A;  4FM2 A;  2XRI A;  1YHQ N;  4QS8 A;  5EU7 A;  3HTV A;  2UXB K;  4QS9 A;  5M1O A;  3DJC A;  5DM6 L;  5GIN A;  4K41 A;  3A5O C;  3KVG A;  3QIO A;  1WAF A;  3LP1 A;  3VGL A;  1TVR A;  3MXJ A;  3AV9 A;  2R7Y A;  4FL9 A;  3P31 A;  2Y1I A;  3KLI A;  4Z4F A;  3MXM A;  5BR8 K;  3UE5 A;  4CHP A;  2Q31 A;  4MDA A;  1JLQ A;  3GDQ A;  3EY1 A;  3THX B;  1T6C A;  4FJ7 A;  2EWS A;  3ZEU B;  4F8R A;  3SPY A;  5JLH A;  5I42 A;  4WQ4 C;  4HHT A;  4O8U A;  1QZ5 A;  4FCY A;  3PO4 A;  3KZB A;  4CEZ A;  2P9U B;  4DR6 K;  2BAN A;  3V9S A;  2OPP A;  2FBY A;  1O13 A;  4BVP A;  3DLB A;  4YOT A;  3E9L A;  4O0I A;  5LJW A;  4F4K A;  3KLH A;  2BTF A;  4GV9 A;  1HNX K;  3IAY A;  5HBM A;  4FJM A;  4N41 A;  1WBD A;  3AVA A;  1K6Y A;  3CFR A;  4B1V A;  4DTJ A;  3BF3 A;  1FKP A;  1LAV A;  4ISE A;  4WFA L;  4H4O A;  4K25 A;  5AQW A;  1BUP A;  3WNE A;  3WUH A;  1CXU A;  1JLB A;  3QIN A;  4CW7 B;  3M3Z A;  4IEE A;  4KTW A;  4H0X B;  4CJL A;  5F1X A;  4EIA A;  2KQ2 A;  3O6W A;  2XO7 A;  4HUF A;  4DR2 K;  4Z4I A;  1J6Z A;  1D4X A;  3EZ5 A;  1VQL N;  1G15 A;  4BGB A;  3AA5 X;  1BOT O;  3CJ9 A;  4PL8 A;  2G8H A;  2NRR A;  2HMP A;  3ZT4 A;  1CZA N;  4NCA A;  4JKH A;  3V9Z A;  3S3O A;  5AQR A;  2F7T A;  3DRR A;  3OBW A;  3ENB A;  2QI2 A;  2OAN A;  3DWL A;  4MLH A;  3TAN A;  3BUZ B;  4CJ7 A;  4BR2 A;  4I9L A;  2OCE A;  4JKD A;  3FFI A;  3NH0 A;  1R0A A;  4M3X A;  4GKK K;  3FZH A;  1W0H A;  4CER A;  3ZLJ A;  4K43 A;  1WBB A;  1VQN N;  1QHA A;  3QB0 A;  2O8D A;  4YOX A;  5C15 A;  1W2B M;  5KQ8 A;  2FC0 A;  3OYJ A;  3PIO L;  2I7N A;  2X6N A;  1S1T A;  1NG9 A;  3KD5 E;  3KKS A;  3G10 A;  4FWP A;  4B9V A;  1K8K A;  4CIF A;  1Y64 A;  2DTU A;  4DSI A;  5F2R A;  3WXJ A;  4E3S A;  4WQ5 C;  2YJE A;  1KVC A;  3SJH A;  3R9P A;  4W5Q A;  4ILH A;  4DR4 K;  3PX6 A;  4H4M A;  1KC8 O;  2IVP A;  3ISN C;  1WSG A;  3MWP A;  1T8E A;  4JHD B;  1RTI A;  1NGH A;  3KK7 A;  5AQX A;  1GLF O;  1U6Z A;  1WSI A;  2V7Z A;  4CIE A;  3B6O A;  3SNN A;  2HBK A;  3OYB A;  4M41 A;  3G6E N;  2PZS A;  4YY3 K;  5JS2 A;  4FM1 A;  1S6P A;  3O9Q A;  5C2F A;  1ZBL A;  3RRH A;  3SBT A;  4JRP A;  3IDH A;  4DKW A;  2GUP A;  4CHY A;  2VWB A;  1RNH A;  4Q5V A;  3RTV A;  2HHW A;  3HSC A;  4ISF A;  1HNZ K;  2G8V A;  4B3R K;  1Q8I A;  5C10 A;  3EE9 A;  1QQC A;  5GAG P;  3TTD A;  3ID8 A;  3DLL L;  2G8K A;  3HPH A;  1SKS A;  3VMF B;  2VWK A;  4H5T A;  3L2U A;  5GIO A;  4CHQ A;  4AHU A;  3LM2 A;  2VG5 A;  4YOW A;  1HPM A;  4DQQ A;  3SUP A;  4JI4 K;  4DG1 A;  3WXK A;  4IBN A;  4AM6 A;  4GV6 A;  3HM9 A;  3GG4 A;  4KBO A;  4ZTF A;  4DMN A;  5BRD A;  5AZI A;  3DLE A;  2ZE2 A;  5CY4 A;  4JKG B;  3LDP A;  1K9M O;  4H8K A;  4DV6 K;  4FZY A;  1S5J A;  3CJ7 A;  2IVN A;  4CE9 A;  2ITM A;  3VQA A;  4CF9 A;  2G8F A;  3THY B;  1IKW A;  4FK4 A;  3CD6 N;  2HMI A;  3NF6 A;  3KWG A;  1IKY A;  3DRP A;  2OPQ A;  4XEI A;  4CJW A;  4K8Z A;  1KVA A;  4N76 A;  4JKF A;  3QEI A;  3C0B A;  4MFB A;  4DS5 A;  3HST B;  3I55 N;  2E2N A;  3IFR A;  4DFK A;  4PWD A;  2QXL A;  3DXM A;  3CME N;  3ATV A;  3D6R A;  4OGC A;  1WUA A;  4MDB A;  4JRQ A;  3CET A;  1NGC A;  1QSL A;  4EZ9 A;  5GAE P;  4F9O A;  3M8P A;  4H0P A;  1QQM A;  5KRT A;  1NKB A;  5M1F A;  2Q2R A;  3ASM A;  3AO2 A;  4NCG A;  1C0M A;  1VK0 A;  1TUU A;  1EX4 A;  3DAW A;  3SK3 A;  4ILG B;  1KFS A;  3QBX A;  5E84 A;  2UUC K;  4KPY A;  3HOT A;  4NLB A;  3E01 A;  1IJJ A;  4E1J A;  3OS2 A;  1C0T A;  1LW0 A;  1VSF A;  4CGD A;  4F2S A;  5KGX A;  1RTH A;  1YUW A;  3D2F A;  1JL1 A;  4FVM A;  2HHU A;  1ILY A;  3QO9 A;  3LP0 A;  5J1E A;  2HHT A;  4WCE L;  4HWI A;  1Q81 O;  3TSP A;  2FBT A;  3K9J A;  4TSX A;  3RSE A;  3C94 A;  3VEW A;  2B4J A;  3TAG A;  5LJV A;  2E2Q A;  4YOR A;  4CZE A;  3MEC A;  1RT3 A;  3H45 C;  3TWH A;  2OTL N;  2RHK A;  3VF4 A;  4CES A;  2QTD A;  2RE2 A;  4EFH A;  3WQT A;  2FSK A;  2GBZ A;  3QNO A;  1VQ7 N;  3HZ6 A;  5LY3 A;  1XWL A;  4UQG A;  2PAV A;  2WOM A;  4BGA A;  3V9X A;  3GL1 A;  2P9S A;  3ZX0 A;  3PX0 A;  2DPN A;  4U67 L;  4CED A;  3EZW A;  5C42 A;  3NCI A;  1VQ4 N;  1UAX A;  2PY5 A;  4OJR A;  1NOZ A;  5CR4 A;  3I0R A;  2P9N B;  1BIU A;  1VQ5 N;  5I9E B;  4DTR A;  1HMV A;  1BQN A;  5SZT A;  3ZYY X;  4FLV A;  4U7B A;  5AQY A;  4BR9 A;  3T3F A;  1YF5 L;  2RPI A;  4K8X A;  5BR9 A;  2Q97 A;  4B1Y B;  4XH5 A;  3DOL A;  1L3T A;  4FOI A;  3F5T A;  3W0L A;  2QWN A;  3AO1 A;  2P9K A;  3RR7 A;  1TAU A;  4BRQ A;  3JAM O;  4FWO A;  1VQP N;  4IZ9 A;  4FPB A;  2J4R A;  4BVO A;  3LAN A;  2JGU A;  3CCL N;  3NFA A;  1J5E K;  1EO1 A;  3AVL A;  1N6Q A;  3O1B A;  3TAF A;  3SLC A;  4JI5 K;  4DUY K;  4DTP A;  4DWI A;  1DT9 A;  2ITG A;  1XI1 A;  3CCQ N;  1KFD A;  4OKK A;  1XMQ K;  2PBD A;  1VSH A;  4Z0U A;  4JI2 K;  4ZHR A;  3CCM N;  3C95 A;  2XY8 A;  1VQ8 N;  3KKR A;  4CHZ A;  2W6K A;  3SQ1 A;  1VSE A;  1VQM N;  2D5R A;  4B8C A;  4Q0B A;  1RDA A;  2HHH K;  3NH1 A;  3CJB A;  3CQ8 A;  3CPE A;  5AZJ A;  2HHV A;  4H0V B;  5K14 A;  1LCU A;  3D2F B;  1X3M A;  5I3U A;  4GV3 A;  4FLT A;  5C2D A;  3PIP L;  3KK1 A;  2F8S A;  1WAJ A;  3MEE A;  1S6Q A;  3AY9 A;  4FJ9 A;  4W5R A;  1HPZ A;  3EYZ A;  2QK9 A;  2KZZ A;  4CEB A;  2QWR A;  4I9Q A;  4Z4G A;  4E7I A;  4KHQ A;  4O5F A;  3SJJ A;  1BL3 A;  1NK8 A;  3IRX A;  3RWU A;  3VQB A;  3WEE A;  1S3X A;  1GLA G;  1TKZ A;  1IO2 A;  4I2P A;  1TKT A;  3OYI A;  4ID1 A;  1VRU A;  3TSU A;  4CJV A;  3MK6 A;  4BRL A;  2P9I B;  3RMC A;  3ZSR A;  4M3W A;  2P9S B;  3T1A A;  1K73 O;  2Q0R A;  3V1O A;  1T05 A;  3MMV A;  1GLC G;  5T7B A;  3OYL A;  3SI6 A;  2HBM A;  3FZM A;  4DS4 A;  1X9S A;  3QBW A;  3F73 A;  4I6M B;  2OPR A;  4DR5 K;  3B6P A;  3QLH A;  3SMS A;  1NK7 A;  3VEN A;  4BRH A;  3CM5 A;  2FBX A;  3HP9 A;  3NH2 A;  3EO3 A;  1KRP A;  3S9H A;  2P1J A;  1DLO A;  3AO4 A;  1P8Z A;  3T1H K;  1T03 A;  4CJS A;  2F96 A;  5E26 A;  3HVT A;  1F21 A;  4IFY A;  1VSI A;  4DQ8 A;  3G71 N;  2P9K B;  3SBG A;  4CD1 A;  3J80 O;  3Q7B A;  2E8A A;  3LDQ A;  4ISG A;  3TR8 A;  1BCM A;  2O8E B;  4FZX C;  1Q9Y A;  3K57 A;  1BI4 B;  1HQU A;  3C6H A;  4KHS A;  3P5J A;  1HUX A;  2E4L A;  3BZK A;  2UUA K;  5AQL A;  3AGK A;  3OYA A;  1JLC A;  2YNI A;  4QS7 A;  4B9N A;  3F2K A;  3SCX A;  1DTQ A;  4BRA A;  5BPL A;  3CFP A;  5EVZ A;  3ALY A;  1BU6 O;  3LAL A;  3FR0 A;  3DOK A;  5AQT A;  4ZTJ A;  3HPO A;  4O4G A;  1J53 A;  3V81 A;  4H0Y B;  4YDU A;  2KLA A;  1K8A O;  4FWQ A;  1KAY A;  4O55 A;  1ZBH A;  5BRE A;  3NBP A;  3SUO A;  5EY4 A;  1NK9 A;  2P5O A;  1RT7 A;  1SS6 A;  3VTI A;  2ATQ A;  3KK2 A;  4XH1 A;  3L2W A;  4CF8 A;  3HXM A;  4BQZ A;  1QZ6 A;  2QWO A;  2E2P A;  1ASU A;  4CJP A;  5JS1 A;  1JCF A;  5BPN A;  1OVY A;  1B9F A;  4E89 A;  1X9J A;  4DCH A;  4IFE A;  4CHN A;  4BRP A;  1YIJ N;  2KKZ A;  1X9W A;  4RWT A;  1U45 A;  2BGG A;  4LD0 A;  1SUQ A;  1S1W A;  4JLH A;  3A5N C;  3TAE A;  2QXF A;  1C1C A;  3OS0 A;  4FJ8 A;  5EX5 A;  4BRG A;  1FXX A;  5FPN A;  3QML A;  2VYP A;  3DLK A;  2F9W A;  2GV9 A;  3CIP A;  1IBM K;  2NRZ A;  4QAG A;  4ELU A;  3LAK A;  4AHT A;  4FXD A;  4A61 A;  4NYF A;  1CLQ A;  4LSL A;  4A57 A;  2YNF A;  1M1K O;  3P1G A;  1D9F A;  4RW8 A;  2O8B A;  4UY8 O;  4G9Z A;  5SWM A;  4H5W A;  1S22 A;  2A1S A;  3ZT2 A;  3CC2 N;  2YCH A;  4PY5 A;  3SAH A;  3AA3 A;  1R59 O;  3TSQ A;  2F9T A;  4AHV A;  4KRE A;  3MED A;  1X9M A;  1NU0 A;  1EQY A;  2ZJR L;  2CGK A;  1Z25 A;  4IWV A;  1JLE A;  4FPA A;  4C8L A;  3TTC A;  3BP8 A;  2RN2 A;  4BRE A;  3HOS A;  3AO3 A;  5KPR A;  2O8F A;  3QEX A;  4NO7 A;  3CJA A;  4BRK A;  2P5G A;  1E4G T;  4LF7 K;  2KHO A;  1ITG A;  1XC3 A;  4PKH A;  1ZC6 A;  1KXP A;  4IEI A;  3CC4 N;  1LV5 A;  4DF8 A;  1WNS A;  4CF0 A;  4CF1 A;  1HQE A;  3VQ7 A;  2P9L B;  3G4S N;  4F3T A;  4DFP A;  3TI0 A;  1NWK A;  1RT2 A;  2WUS A;  1GLL O;  2HF3 A;  5HRR A;  1TYQ A;  4DB3 A;  3HP6 A;  4RW9 A;  2QKB A;  1HKB A;  1YIT N;  1IH7 A;  1VQO N;  3QES A;  4BC3 A;  3SQ2 A;  4KRF A;  4M42 A;  3SYZ A;  4DSF A;  3ZSQ A;  1GLB G;  3T7Z A;  2WBN A;  2ZWH A;  1MWK A;  3NF8 A;  1RBU A;  3TTF A;  2QM1 A;  3SQ4 A;  3AAQ A;  3FE1 A;  4M7X A;  1EP4 A;  1I3A A;  4BWJ A;  3B8A X;  3MWT A;  4FWN A;  2E5L K;  4FO0 A;  3THW A;  3UKR A;  3C7N B;  2XY6 A;  1Q18 A;  3K58 A;  5FRN A;  3VOV A;  3U8X A;  1QHT A;  3UB5 A;  5AQO A;  1RBV A;  1FW6 A;  3S41 A;  3MN5 A;  1U2V A;  5CZ2 A;  4DR1 K;  1TGO A;  3VA3 A;  2OTJ N;  3RMA A;  1E3M A;  4E7J A;  3ZET A;  4O0J A;  5J2N A;  4K42 A;  3SQ0 A;  1LWF A;  5FLX O;  3KHY A;  5CYM A;  1B9D A;  2E20 A;  4B9S A;  3DM2 A;  1TUY A;  4E1N A;  4NCB A;  3H1V X;  3LDS A;  3KLE A;  4IXC A;  4C8M A;  1NMD A;  2W42 A;  3K5O A;  1TKX A;  3O08 A;  2Z1H A;  4LC9 B;  1EET A;  2A6A A;  3PSF A;  4CEA A;  4PL7 A;  2HNY A;  3MXI A;  1A5V A;  1VAZ A;  3DRS A;  2NRW A;  4FSV A;  3DI6 A;  4LSN A;  4NLC A;  4JI1 K;  1VSJ A;  2JLE A;  4YNQ A;  2LSN A;  2VG6 A;  1OH5 A;  1S9G A;  2X74 A;  4DLG A;  3A2F A;  3CPW M;  3HRG A;  4FYD A;  4CZJ A;  3O80 A;  4KB1 A;  1VQ6 N;  4ELV A;  2HST A;  3NE6 A;  5AQU A;  1OKJ A;  2WC9 A;  2D0O A;  4J8F A;  4YHH K;  3M8R A;  4V19 S;  4BR7 A;  4E7K A;  1NJY A;  3NVK A;  3C65 A;  2UUB K;  4B8A B;  1RT4 A;  1SL1 A;  1MA9 B;  3H46 O;  4DSL A;  2AP1 A;  4Z4E A;  1IG8 A;  2O8F B;  5HP1 A;  4DV0 K;  5FDL A;  2D1K A;  3AAR A;  2A41 A;  4BQL A;  1BIZ A;  4JI6 K;  3UIQ A;  1REV A;  4OPH A;  3KTQ A;  5KPT A;  4JYA K;  1TL3 A;  5M1K A;  1SV5 A;  4IOC L;  3JXU A;  1T6D A;  2YX6 A;  5A2Q O;  3GOI A;  1YVU A;  2HBL A;  2HVI A;  3DXK A;  1W9H A;  4FM0 A;  4CZM A;  3OYD A;  1HYV A;  5KQD A;  2D4W A;  4PA1 A;  2HOE A;  4Y1C A;  1IBK K;  2XHB A;  3GE1 A;  1RDD A;  1BA1 A;  1RDW X;  1BWF O;  4GW6 A;  3G25 A;  4CFA A;  4RW4 A;  3CCU N;  4JI7 K;  4A62 A;  3CCV N;  3L3U A;  2FXU A;  1IKX A;  3CQX A;  5ADX A;  2ASO A;  3K5M A;  5GAD P;  3IS9 A;  1X1P A;  2ZD1 A;  4HCB A;  4DTM A;  2W41 A;  2KTQ A;  1NJI O;  3UKU A;  3MCP A;  1Q9X A;  4R79 A;  2HW3 A;  3OYF A;  2O8D B;  4WQ4 A;  3KWI A;  4LF9 K;  3WNF A;  1XMO K;  1D5A A;  3VEV A;  4CGF A;  4HCC A;  4LH4 A;  4CZI A;  3K9K A;  2ETJ A;  1BHL A;  4DTS A;  1K8K B;  1I94 K;  1JLG A;  1ZBU A;  4JN4 A;  1RBS A;  4KFB A;  3ZSO A;  5E41 A;  1B92 A;  5AQS A;  3MDQ A;  4M3R A;  2EHG A;  3ATU A;  3M5R A;  1O1W A;  4B9M A;  2DFE A;  1EKE A;  5FRO A;  3OYK A;  4CZH A;  2WTU A;  3VEY A;  1FKO A;  2NRV A;  2YI1 A;  4CVN E;  1JXE A;  4CF2 A;  1KLM A;  5JLF A;  1NGD A;  4JK9 A;  1JCE A;  1NGE A;  5FPE A;  4IO9 L;  1RIL A;  3ULE A;  4BDY A;  3CCE N;  4I2Q A;  3SUN A;  3OYC A;  3A5M C;  4B9T A;  3WXL A;  3ENH A;  5JIC A;  3J7Y P;  1RDB A;  3D2E A;  4FLZ A;  1GLD G;  3TAB A;  1BIS A;  3TPQ A;  1WN7 A;  2V52 B;  4KHY A;  1WSF A;  2VGN A;  4CEE A;  4BR4 A;  5HRN A;  1HR0 K;  4JK7 A;  3IKM A;  1ATN A;  4KH4 A;  2I7P A;  4CEO A;  3CM6 A;  2VWJ A;  5FRM A;  3NGZ A;  1V4S A;  2YHA A;  3IMX A;  2F8T A;  3RVC A;  4DTN A;  3J7Z O;  3CC7 N;  2D0A A;  4DQR A;  3O4W A;  1WSH A;  4GMJ B;  4M7Y A;  4MO4 A;  4EZ6 A;  2A5X A;  2NRH A;  4QCL A;  4IJN A;  4C1N I;  4DV7 K;  2E6L A;  1N8R O;  2DY4 A;  2P51 A;  1JXB A;  3WXM B;  4Z4H A;  3H1Q A;  3LZI A;  1A5X A;  4H5N A;  3BDP A;  1JLF A;  3A8Y A;  2YHY A;  5AZI B;  4IG3 A;  3KLG A;  5AQM A;  3OJS A;  3O4N A;  3QEW A;  4DR3 K;  4JEP A;  3OA9 A;  4DSK A;  4WQ5 A;  1QQO A;  3CI5 A;  2JWK A;  4M63 C;  4BRI A;  4NXM K;  2A3Z A;  4AM7 A;  5JMV A;  5H1S Q;  3FZL A;  1OH8 A;  1FJG K;  5AQG A;  1SKW A;  5JVG L;  4IKF A;  4FWL A;  4MQ3 A;  5KRS A;  1YJ9 N;  1U48 A;  1U49 A;  2YHB A;  3HK2 A;  1N32 K;  4H03 B;  1NBW A;  1S1V A;  3P38 A;  4FLY A;  2HND A;  3DXM B;  4B1W B;  3QEV A;  4AH9 A;  4DTU A;  4JKE A;  2O8C A;  4A59 A;  2FBV A;  2HF4 A;  3BY5 A;  1N36 K;  1A5W A;  1S1U A;  2YHW A;  5TKY A;  4CI6 A;  4DR7 K;  1SQK A;  3WQU A;  4JI8 K;  4KHW A;  3CCJ N;  1P90 A;  2GUI A;  4BRD A;  1UA1 A;  4DLE A;  1I39 A;  3U9Z A;  4NYN A;  4DV4 K;  1W7A A;  1L3V A;  1OVQ A;  4W5O A;  3HVR A;  1J9A A;  1HNV A;  4FJJ A;  4JI0 K;  3ZX3 A;  2X6S A;  3PO5 A;  1HKG A;  4K0K K;  2FLO A;  3VER A;  4CEC A;  1YJN N;  4YFU A;  1DEJ A;  5C24 A;  3ZSZ A;  1HNW K;  4FOE A;  3SV4 A;  2CH5 A;  3K5N A;  1GLE G;  4DU4 A;  3OW2 M;  4CZL A;  3U4L A;  3U3G A;  1C1A A;  4EP4 A;  3RSE B;  3NDK A;  4H5V A;  3PUF A;  3PX4 A;  4G1Q A;  3VET A;  4FK2 A;  4BY9 C;  3M8S A;  4X62 K;  1LWC A;  2YKM A;  4JD2 A;  4CZG A;  2VGM A;  5HL7 L;  4M3Z A;  5LMN K;  1E4F T;  3FZF A;  3HM8 A;  2Y1J A;  4BE0 A;  3P4I A;  3RR8 A;  3VEX A;  3H08 A;  3NGI A;  3J81 O;  4CJU A;  1CZ9 A;  4DQI A;  4L3Q A;  2IC3 A;  3CF5 L;  3WNG A;  2BDP A;  4BC2 A;  4OPK A;  1KSP A;  4ELT A;  2FF6 A;  4JKB A;  5LL6 Z;  4WF9 L;  3FFK B;  1U04 A;  4CFB A;  3AVK A;  3IUC A;  4CD3 A;  4LF5 K;  4KB0 A;  2QWM A;  1XHX A;  3FLC O;  4FWR A;  5F0X A;  3THX A;  4KO0 A;  1C0F A;  3ZEU A;  1J54 A;  1MWM A;  4CBX A;  3EKU A;  1ZYQ A;  2E88 A;  3CHW A;  1L3S A;  4LF8 K;  2KFZ A;  1EWR A;  4CJT A;  2ZQB A;  3AVJ A;  1C0G A;  1XUP O;  5KPZ A;  5HRP A;  2OYQ A;  2P9U A;  5AQF A;  4J2D A;  3AA2 A;  2XY5 A;  4DU1 A;  3V6D A;  4AIL C;  4JI3 K;  2KZM A;  4IG0 A;  1RGI A;  1SKR A;  2YKN A;  4B1U B;  4CGI A;  3CFO A;  3VGM A;  3EEQ A;  4KTZ A;  4CCH A;  3OYM A;  4CJF A;  2HHS A;  4ID5 A;  3H6E A;  2YV0 X;  4KH5 A;  5M1Q A;  3I0S A;  3SV3 A;  4GVM A;  4CGJ A;  4KI4 A;  4RG8 A;  4CFC A;  3O9S A;  4YOU A;  3M8Q A;  1KVB A;  5JVH L;  3BEX A;  4Y0W A;  1Z26 A;  3O1W A;  4BC5 A;  1LWE A;  3VF2 A;  2ZJP L;  3L4I A;  2IIR A;  4O44 A;  4JKA A;  3SMP A;  3THV A;  4B3T K;  1V4T A;  3N4P A;  2W40 A;  5HOO A;  3QET A;  4KTQ A;  2HVH A;  4JK8 A;  4WYB A;  3VTH A;  4PKI A;  3KIO A;  2DFH A;  5AZJ B;  4J2E A;  1VRT A;  5CZ1 A;  5AQI A;  3L8B A;  1ESV A;  1BO5 O;  5EXW A;  4CGH A;  2OZM A;  3DMJ A;  4KAZ A;  4OLB A;  1NLV A;  4JAX A;  3R8E A;  4C23 A;  5IT9 O;  4Z94 A;  1NJZ A;  4BRO A;  2X78 A;  3QIC A;  3VN5 A;  3WEE B;  3W3D A;  2P9P A;  1C1B A;  4FW1 A;  3LWM A;  1D8Y A;  4B1Z A;  4IDK A;  4FJL A;  5AQZ A;  4KI6 A;  1YJW N;  4LFC K;  3V1Q A;  5ELZ A;  3ZSW A;  2YNG A;  2ZM6 K;  4DQS A;  1MU2 A;  4MLE A;  1XQS C;  3DYA A;  3L3V A;  3JS6 A;  1XC9 A;  2GEL A;  3ID6 A;  5AQP A;  3QER A;  4B9L A;  5GAH P;  1YXQ A;  3F9M A;  4KH6 A;  3L6Q A;  2UU9 K;  4L8R B;  2HHX A;  1HKC A;  4CGG A;  1T7P A;  4DQP A;  4OO1 J;  5EOY A;  4C1N K;  3LDL A;  3G0Z A;  2A42 A;  3AVN A;  3RMD A;  3BGR A;  4M3T A;  1N34 K;  3VQ8 A;  2O4I A;  3O3F A;  3R6M A;  3ZT0 A;  4JHD A;  1JCG A;  3GBT A;  4OGE A;  4CIG A;  3HL8 A;  3MX2 A;  1BG3 A;  3O3G A;  2IAJ A;  4AHR A;  3WXI A;  1NK6 A;  5HLF A;  2UXD K;  4R5P A;  3NF9 A;  3LDN A;  4A5B A;  5J2P A;  4C8K A;  3P83 D;  3ITH A;  4CJE A;  1NJX A;  4HVJ A;  3MEG A;  4GKJ K;  4FK0 A;  5C25 A;  4GVE A;  3AGR A;  2ZGY A;  5GIP A;  1HNI A;  3D0P A;  3CG7 A;  4KV8 A;  3ZT3 A;  1KQS M;  3AVC A;  3PLA A;  2GWK A;  1X3N A;  2GTD A;  1ZXO A;  4GNI A;  2YNH A;  5TKW A;  4W5N A;  1KLN A;  3NAE A;  1NK0 A;  4CHO A;  5J2Q A;  3JSM A;  3LDO A;  1YT3 A;  1HYZ A;  4FWM A;  4FLX A;  3AVG A;  1OH7 A;  3V1R A;  3OTO K;  4PUO A;  2WFB A;  3SZ2 A;  3R3L A;  1UA0 A;  4X65 K;  4IFV A;  1HLU A;  4NB4 A;  4BDZ A;  1UWB A;  4RTF D;  1TV6 A;  1NGG A;  2A40 A;  1QSY A;  4AF1 A;  4N5S A;  3AAP A;  4E19 A;  4BE1 A;  1BA0 A;  4DTO A;  2IOC A;  3VQ5 A;  3BF1 A;  4O5B A;  1TKD A;  4OX9 K;  4KHP K;  3TAM A;  3KLF A;  4LF6 K;  2QEX N;  4CJQ A;  4JKG A;  4CBW A;  3MCA B;  1TK0 A;  3BZC A;  1QTM A;  1BCO A;  4JV5 K;  3AVH A;  2E6M A;  1ZBF A;  3IG1 A;  3PSI A;  3H3O B;  4ILJ A;  1DKG D;  1QE1 A;  4PKG A;  3DLG A;  3THY A;  3DLH A;  1RBR A;  1C0U A;  1NGA A;  3AVF A;  5CHI A;  4HUE A;  3AVM A;  5AFU H;  4PHT X;  4CEF A;  4BAC A;  2QWL A;  4IJA A;  1S72 N;  3CCR N;  1L3U A;  2P9P B;  4N56 A;  3K0S A;  3HT3 A;  4DU3 A;  1WLJ A;  3O4Q A;  1Z05 A;  4KHU A;  5AQJ A;  2O8B B;  3MN6 A;  2HNZ A;  1G99 A;  3H3N O;  1N33 K;  3L0Q A;  2DFF A;  1LAW A;  3A5L C;  3NMU A;  4Z4C A;  3KK3 A;  1SL2 A;  3LP2 A;  4H0O A;  3F9K A;  1SZ2 A;  1WSJ A;  4LFB K;  4BWM A;  3CYM A;  2OPS A;  4W5T A;  2QW9 A;  3K5L A;  3AVI A;  3I8B A;  3J7A P;  3HJF A;  4DUZ K;  1M90 O;  1HJO A;  3VQC A;  3MAQ A;  2RF2 A;  4BRM A;  5BPM A;  4A2B A;  4H0T B;  1KAX A;  1ATR A;  5M1P A;  5CE3 A;  3OYE A;  3C6A A;  4OKJ A;  1U4B A;  4EHT A;  4H5R A;  2D0P A;  4XIU A;  3E9P A;  3RRG A;  3AA4 A;  4MO5 A;  2B6A A;  1NK4 A;  3A0I X;  3L4Q A;  5C12 A;  3OYN A;  4FJG A;  2G8I A;  4GY2 B;  3HPG A;  3V9W A;  3M1F A;  4FLW A;  3HYF A;  1ZBI A;  3O9R A;  3NVM A;  2YJF A;  3ZCM A;  3SAG A;  1TYQ B;  4CK2 A;  4LFA K;  1JLA A;  1XNR K;  4B08 A;  4F3O A;  4DFJ A;  1IV0 A;  5KTQ A;  4LY7 A;  1HYS A;  2FSJ A;  1NNE A;  3O3H A;  3P39 A;  2OZS A;  4BRC A;  2GX9 A;  4YOY A;  1RCH A;  3E66 A;  2P9N A;  4DTX A;  5J2M A;  5AJ3 K;  3Q7C A;  1Z6R A;  3ULD A;  3ZSY A;  1VSK A;  1JKH A;  5HRS A;  4M3Y A;  1BGX T;  4DSE A;  5DM7 L;  1OH6 A;  1VQK N;  3THW B;  3UKR B;  1GLJ O;  5M1N A;  4RCH A;  4KHN A;  1QSS A;  2AJQ A;  1U2V B;  1T3V A;  5BN9 A;  1YVN A;  4ICL A;  3VEZ A;  1TAQ A;  4BG8 A;  3ZET B;  4OKE A;  4CJK A;  3HO1 A;  1DGK N;  1DTT A;  3CCS N;  4QOZ B;  4OPJ A;  1RT1 A;  5BN8 A;  5KGW A;  1CXQ A;  4OPA A;  1RDC A;  2QKK A;  1Q86 O;  4AHC A;  2NLX A;  1UOC A;  3C6U A;  2BE2 A;  1IBL K;  2XY7 A;  1LW2 A;  4M3U A;  2IVO A;  2B5J A;  2EX3 A;  1SAZ A;  1T44 A;  2Q0U A;  4CEQ A;  3VQ4 A;  3QIP A;  3V9U A;  3R1X A;  4IO8 A;  3WNH A;  3QFU A;  3ZX2 A;  3VA0 A;  3SUQ A;  2PYJ A;  3HI0 A;  2I5J A;  2E1Y A;  3PY8 A;  4LH5 A;  2VCP A;  4XH4 A;  2UYT A;  3KJV A;  1S9E A;  4C8N A;  3C6T A;  4YOV A;  4CZF A;  5IWA K;  4B1X B;  2BUP A;  3O5B A;  3S3N A;  4FJX A;  1JJ2 M;  3TAR A;  1FK9 A;  1QQN A;  5AQH A;  3ZSV A;  3RMB A;  4WFN L;  2E1Z A;  1NJW A;  1C6V A;  1YTA A;  4CK3 A;  2ZJQ L;  2VQE K;  2VG7 A;  4BR5 A;  3PV8 A;  2PYL A;  1YTU A;  1WSE A;  5DK5 A;  1QS4 A;  3QEP A;  1WB9 A;  1KCF A;  4A2A A;  4JKC A;  4AHS A;  3LM9 A;  4IOA L;  4J2B A;  3ZT1 A;  1L5U A;  3LPT A;  2CGL A;  2VQF K;  2RKI A;  3VQP A;  4DF4 A;  4X64 K;  3EKS A;  3QFP A;  1VQ9 N;  1N5Y A;  5CYQ A;  1EXQ A;  1VSL A;  4YDU C;  5BRF A;  5KI6 A;  1HRH A;  3DXK B;  2P9I A;  3U3Y A;  4I7F A;  3HBT A;  5B8H A;  3OBY A;  1NK5 A;  4DSJ A;  4BRN A;  2BH1 A;  1VHX A;  4CK1 A;  1RBT A;  4NXN K;  2G8W A;  1S1X A;  3OHR A;  3U9D A;  1W97 L;  4CJ5 A;  3VQQ A;  3NHG A;  5FPM A;  3LAM A;  4J2A A;  1U47 A;  4FZZ A;  3OVN A;  3OS1 A;  3CQY A;  2ASM A;  3TU5 A;  3O8M A;  2KFN A;  4B3M K;  4O8K A;  4BG9 A;  1IKV A;  4BC4 A;  4I6M A;  2CH6 A;  2YHX A;  5AQN A;  2W6L A;  3EE8 A;  3FGU A;  3UKU B;  2NZT A;  4FW2 A;  3MN7 A;  1Y97 A;  1TK5 A;  4A5A A;  3WT0 A;  4FVU A;  3CJ1 A;  1CZB A;  3VQE A;  2NRX A;  1YI2 N;  1NKC A;  1J5O A;  3CER A;  1NGI A;  3VF6 A;  4IOX A;  4EAH D;  1KD1 O;  5AR0 A;  1ASW A;  5AQV A;  2O8E A;  1MDU B;  1KTQ A;  1XHZ A;  1BI4 A;  2HHQ A;  4JS4 A;  3T19 A;  1NGB A;  1VSM A;  1ZBS A;  1SL0 A;  4OVL A;  3VQ6 A;  2QWQ A;  4DV2 K;  2V7Y A;  1NGJ A;  1RDU A;  3O9U A;  3QNN A;  4FWK A;  4FWS A;  4CFD A;  4JNE A;  1RTD A;  4N47 A;  2IS3 A;  3DLR A;  2Z1I A;  4BR0 A;  4RW7 A;  4CZK A;  3VES A;  2OA8 A;  4FJI A;  2ZGZ A;  3ULE B;  3CXC M;  1BDG A;  3ZSX A;  3CJC A;  2Q36 A;  1NMN A;  3VQ9 A;  4DHY A;  5BRH A;  3M6G A;  3NGY A;  3D2E B;  1VSD A;  3L2R A;  2GEM A;  5HRO A;  4EP5 A;  3MX5 A;  2ZF5 O;  1H1V A;  3EL2 A;  4DFM A;  5ADX H;  3I33 A;  1Q7Y O;  5D3G A;  3VPZ A;  3TAP A;  2Q1N A;  2H3G X;  3T1Y K;  3VGK A;  2D0C A;  3EN9 A;  3V4I A;  5C0Y A;  2JWL A;  4BE2 A;  4FJN A;  2V51 B;  4HTU A;  4C8O A;  4CJ4 A;  1HJR A;  2IGI A;  2F4V K;  3D7E O;  2O4G A;  4B3S K;  4AQY K;  4E1M A;  3I8D A;  1Q82 O;  3O9T A;  5MLC Q;  1LOT B;  2NNW A;  3L2V A;  4PQU A;  2QWP A;  2CGJ A;  3MN9 A;  1EWQ A;  1ASV A;  1WOQ A;  5FPD A;  4OLA A;  1YAG A;  4HUG A;  4WE1 A;  4FLU A;  2AA4 A;  3VQD A;  2NRT A;  3U6F A;  3D45 A;  4CJR A;  1NKE A;  2E2O A;  4B9Q A;  3NF7 A;  2A1R A;  1NM1 A;  3AVB A;  2HBJ A;  3JYT A;  3K59 A;  4CBU A;  1TK8 A;  3LL3 A;  4CJ3 A;  3LWL A;  1QVF M;  4DV3 K;  3VEO A;  4DV1 K;  4WFB L;  3TAQ A;  1GOA A;  4FJH A;  4E7H A;  1RTJ A;  2D0B A;  5AFU A;  2IDO A;  4DV5 K;  3OYG A;  2FSN A;  4KKO A;  4FJ5 A;  3E9O A;  4RW6 A;  1RT5 A;  4BRF A;  3N4Q A;  2O8C B;  4JS5 A;  2GWJ A;  4Y1D A;  3K2P A;  3L2Q A;  4HTL A;  4EHU A;  1JL2 A;  2P9L A;  2KW4 A;  4F2R A;  1NOY A;  2HB5 A;  1RFQ A; 
#chains in the Genus database with same CATH homology
 4DTM A;  1IG9 A;  1UWB A;  2WON A;  2KTQ A;  1TV6 A;  3OY9 A;  4B3O A;  1QSY A;  4N5S A;  3LAN A;  2JGU A;  4E19 A;  4BE1 A;  4DTO A;  2IOC A;  3VQ5 A;  3NFA A;  4O5B A;  4B9U A;  3AVL A;  1BQM A;  1TKD A;  1N6Q A;  1Q9X A;  3TAM A;  2HW3 A;  3OYF A;  3KLF A;  4M45 A;  3TAF A;  3WNF A;  4CJQ A;  1D5A A;  2Z1J A;  4CGF A;  4BDP A;  4DTP A;  4HCC A;  4LH4 A;  3AO5 A;  1TK0 A;  4DWI A;  2ETJ A;  2ITG A;  1QTM A;  1BCO A;  1BHL A;  1XI1 A;  1KFD A;  4OKK A;  4DTS A;  3AVH A;  1VSH A;  2E6M A;  2Q3S A;  4Z0U A;  1ZBF A;  3IG1 A;  1JLG A;  4ZHR A;  1ZBU A;  4E0D A;  1QE1 A;  3OYH A;  3DLH A;  1TL1 A;  1RBS A;  3DLG A;  3LPU A;  4KFB A;  3ZSO A;  1B92 A;  1C0U A;  1GOB A;  1RBR A;  2XY8 A;  3AVF A;  3C95 A;  4M3R A;  4HUE A;  1GOC A;  2EHG A;  3AVM A;  2NUB A;  3KKR A;  3LP3 A;  4CHZ A;  1O1W A;  4B9M A;  2DFE A;  4CEF A;  3SPZ A;  1EKE A;  4BAC A;  3SQ1 A;  5FRO A;  1VSE A;  3OYK A;  2G8U A;  2D5R A;  1L3U A;  3OJU A;  1FKO A;  1RT6 A;  4B8C A;  4N56 A;  4E7L A;  4Q0B A;  3HT3 A;  1RDA A;  2KZZ A;  4DU3 A;  3NH1 A;  3S3M A;  5DMR A;  1JXE A;  1WLJ A;  4CF2 A;  3CQ8 A;  1KLM A;  4FJK A;  3O4Q A;  4KHU A;  2HHV A;  2Z1G A;  4FM2 A;  5K14 A;  2XRI A;  5I3U A;  4FLT A;  5EU7 A;  2HNZ A;  3KK1 A;  2DFF A;  1LAW A;  1RIL A;  1WAJ A;  3MEE A;  1S6Q A;  2F8S A;  4FJ9 A;  4W5R A;  4Z4C A;  1HPZ A;  3KK3 A;  3EYZ A;  4BDY A;  2QK9 A;  3QIO A;  3LP2 A;  4I2Q A;  4CEB A;  1WAF A;  1SL2 A;  3LP1 A;  4I9Q A;  3SUN A;  4Z4G A;  4E7I A;  4KHQ A;  3F9K A;  3OYC A;  1TVR A;  3MXJ A;  3AV9 A;  1BL3 A;  3SJJ A;  1NK8 A;  4B9T A;  2R7Y A;  3IRX A;  1RDB A;  1WSJ A;  5E41 A;  4FLZ A;  3VQB A;  4BWM A;  3CYM A;  2OPS A;  3KLI A;  2Y1I A;  3RWU A;  1TKZ A;  1IO2 A;  4W5T A;  4I2P A;  3TAB A;  3MXM A;  3K5L A;  1TKT A;  4Z4F A;  1BIS A;  4CHP A;  3AVI A;  3OYI A;  4ID1 A;  1JLQ A;  1VRU A;  1WN7 A;  3EY1 A;  4KHY A;  1WSF A;  4CJV A;  3HJF A;  4CEE A;  4FJ7 A;  3VQC A;  3MAQ A;  5HRN A;  2RF2 A;  4F8R A;  3SPY A;  5I42 A;  3RMC A;  4CEO A;  3CM6 A;  2VWJ A;  5FRM A;  3ZSR A;  3NGZ A;  2YHA A;  3OYE A;  4HHT A;  4M3W A;  2F8T A;  4OKJ A;  4FCY A;  1U4B A;  3PO4 A;  3T1A A;  4DTN A;  4CEZ A;  4XIU A;  3V1O A;  3RRG A;  2D0A A;  3AA4 A;  2BAN A;  1T05 A;  2B6A A;  4DQR A;  1NK4 A;  1WSH A;  3V9S A;  2OPP A;  2FBY A;  5T7B A;  3OYN A;  4GMJ B;  3OYL A;  3DLB A;  4O0I A;  3SI6 A;  4FJG A;  2G8I A;  3HPG A;  4EZ6 A;  4QCL A;  4F4K A;  3KLH A;  3IAY A;  5HBM A;  4DS4 A;  1X9S A;  3V9W A;  2E6L A;  4FJM A;  4N41 A;  2DY4 A;  2P51 A;  4FLW A;  3HYF A;  1ZBI A;  1JXB A;  3AVA A;  1K6Y A;  3CFR A;  4Z4H A;  3F73 A;  4DTJ A;  2OPR A;  3ZCM A;  1FKP A;  3B6P A;  1LAV A;  3QLH A;  4CK2 A;  1A5X A;  3LZI A;  4H4O A;  3BDP A;  3WNE A;  1NK7 A;  1JLF A;  1CXU A;  3CM5 A;  1JLB A;  2FBX A;  3HP9 A;  4IG3 A;  3NH2 A;  3KLG A;  1KRP A;  3S9H A;  3OJS A;  2P1J A;  1DLO A;  1JLA A;  3AO4 A;  3QIN A;  1T03 A;  4B08 A;  3O4N A;  4CJS A;  4DFJ A;  3QEW A;  4F3O A;  2F96 A;  4KTW A;  4LY7 A;  5KTQ A;  1HYS A;  4CJL A;  4DSK A;  3HVT A;  1F21 A;  4IFY A;  1VSI A;  3O3H A;  2OZS A;  2KQ2 A;  2XO7 A;  4HUF A;  4Z4I A;  1RCH A;  3EZ5 A;  4DTX A;  5J2M A;  1G15 A;  3AA5 X;  3ULD A;  3TR8 A;  1BCM A;  1SKW A;  4IKF A;  4HCB A;  4FZX C;  3ZSY A;  3K57 A;  1BI4 B;  1Q9Y A;  1VSK A;  4MQ3 A;  1HQU A;  1JKH A;  5HRS A;  5KRS A;  4M3Y A;  2G8H A;  1BGX T;  4DSE A;  4KHS A;  1U48 A;  3ZT4 A;  1U49 A;  2YHB A;  3HK2 A;  4NCA A;  3P5J A;  3V9Z A;  4KHN A;  2E4L A;  1S1V A;  1QSS A;  3S3O A;  4FLY A;  2AJQ A;  2HND A;  3DRR A;  3OYA A;  1JLC A;  3QEV A;  2YNI A;  4B9N A;  4AH9 A;  3SCX A;  1DTQ A;  4ICL A;  4DTU A;  2FBV A;  1TAQ A;  3TAN A;  4OKE A;  1A5W A;  1S1U A;  4CJK A;  3CFP A;  3HO1 A;  1DTT A;  4I9L A;  4KHW A;  4QOZ B;  4OPJ A;  3ALY A;  1RT1 A;  3FFI A;  3LAL A;  5KGW A;  1CXQ A;  2GUI A;  1UA1 A;  1RDC A;  4DLE A;  2QKK A;  3NH0 A;  1I39 A;  3DOK A;  4AHC A;  1R0A A;  4NYN A;  4ZTJ A;  3HPO A;  1UOC A;  4M3X A;  4O4G A;  1L3V A;  1J53 A;  3V81 A;  3C6U A;  4W5O A;  2BE2 A;  3HVR A;  1J9A A;  1W0H A;  1HNV A;  2XY7 A;  1LW2 A;  4O55 A;  4CER A;  4M3U A;  1ZBH A;  4FJJ A;  2B5J A;  3NBP A;  3SUO A;  2EX3 A;  1NK9 A;  2P5O A;  3V9U A;  4CEQ A;  1RT7 A;  2X6S A;  3QIP A;  3VQ4 A;  3KK2 A;  2ATQ A;  3L2W A;  3PO5 A;  3HXM A;  4CF8 A;  2FC0 A;  3OYJ A;  3WNH A;  4CEC A;  1ASU A;  1S1T A;  2X6N A;  3VA0 A;  4CJP A;  3SUQ A;  2PYJ A;  5JS1 A;  4YFU A;  3KD5 E;  5C24 A;  3ZSZ A;  3KKS A;  3G10 A;  3SV4 A;  2I5J A;  1B9F A;  4E89 A;  4B9V A;  4CIF A;  4CHN A;  3PY8 A;  3K5N A;  4LH5 A;  1X9W A;  1U45 A;  2BGG A;  4LD0 A;  2DTU A;  4DU4 A;  4DSI A;  1SUQ A;  3KJV A;  1S1W A;  1S9E A;  4JLH A;  3U3G A;  4E3S A;  1C1A A;  4EP4 A;  2QXF A;  3TAE A;  1C1C A;  3OS0 A;  4FJ8 A;  1KVC A;  3NDK A;  4C8N A;  1FXX A;  3C6T A;  3PUF A;  3PX4 A;  4G1Q A;  3DLK A;  4W5Q A;  4FK2 A;  2GV9 A;  4QAG A;  3LZJ A;  3PX6 A;  3S3N A;  4H4M A;  4ELU A;  3LAK A;  4AHT A;  3M8S A;  4FJX A;  4FXD A;  1LWC A;  2YKM A;  4NYF A;  3ISN C;  1WSG A;  1CLQ A;  4LSL A;  3TAR A;  1FK9 A;  2YNF A;  4M3Z A;  1T8E A;  3P1G A;  3ZSV A;  1D9F A;  3RMB A;  4RW8 A;  2Y1J A;  1RTI A;  4BE0 A;  1NJW A;  1C6V A;  1YTA A;  4CK3 A;  1WSI A;  5SWM A;  3RR8 A;  2VG7 A;  4CIE A;  3H08 A;  3PV8 A;  3NGI A;  4CJU A;  1CZ9 A;  2PYL A;  1YTU A;  3B6O A;  4DQI A;  1WSE A;  3SNN A;  5DK5 A;  1QS4 A;  2IC3 A;  4M41 A;  3OYB A;  3WNG A;  3QEP A;  2PZS A;  1KCF A;  2BDP A;  2A1S A;  5JS2 A;  4OPK A;  3ZT2 A;  4FM1 A;  1S6P A;  1KSP A;  4ELT A;  1ZBL A;  3RRH A;  4JRP A;  4AHS A;  1U04 A;  4J2B A;  3ZT1 A;  4CFB A;  3AVK A;  3AA3 A;  1L5U A;  3LPT A;  4PY5 A;  4AHV A;  4CHY A;  4KRE A;  1RNH A;  2RKI A;  3MED A;  3VQP A;  4Q5V A;  4KB0 A;  4DF4 A;  1XHX A;  1X9M A;  3RTV A;  1N5Y A;  2HHW A;  5CYQ A;  4KO0 A;  1EXQ A;  1J54 A;  1VSL A;  1Z25 A;  5KI6 A;  2G8V A;  1HRH A;  1JLE A;  3U3Y A;  4C8L A;  1Q8I A;  4I7F A;  2RN2 A;  1ZYQ A;  1QQC A;  1NK5 A;  3AO3 A;  1L3S A;  3QEX A;  4DSJ A;  2KFZ A;  2P5G A;  4CK1 A;  1RBT A;  4CJT A;  2ZQB A;  1ITG A;  3AVJ A;  2G8W A;  1S1X A;  2G8K A;  3HPH A;  5HRP A;  1SKS A;  2OYQ A;  2VWK A;  3KD1 E;  4CJ5 A;  3L2U A;  4J2D A;  3AA2 A;  3VQQ A;  2XY5 A;  4CHQ A;  4AHU A;  3NHG A;  4DF8 A;  4DU1 A;  1LV5 A;  3LAM A;  3V6D A;  1WNS A;  4CF0 A;  4CF1 A;  1HQE A;  3VQ7 A;  1U47 A;  4J2A A;  4AIL C;  2VG5 A;  4FZZ A;  3OVN A;  3OS1 A;  2KFN A;  4DQQ A;  2KZM A;  3SUP A;  4F3T A;  4IG0 A;  4DG1 A;  1SKR A;  2YKN A;  4DFP A;  3TI0 A;  4IBN A;  1RT2 A;  4CGI A;  3HM9 A;  1IKV A;  3CFO A;  4ZTF A;  5HRR A;  4DMN A;  3HP6 A;  4RW9 A;  2QKB A;  4KTZ A;  4FW2 A;  4CCH A;  1Y97 A;  3DLE A;  4CJF A;  1IH7 A;  3OYM A;  1TK5 A;  3QES A;  2ZE2 A;  2HHS A;  4ID5 A;  1CZB A;  5CY4 A;  3VQE A;  3SQ2 A;  4KRF A;  2YV0 X;  4M42 A;  3SYZ A;  4DSF A;  3ZSQ A;  1NKC A;  1J5O A;  4H8K A;  3I0S A;  3SV3 A;  4FZY A;  4GVM A;  4CGJ A;  4KI4 A;  4RG8 A;  1S5J A;  4CFC A;  3NF8 A;  1RBU A;  4CE9 A;  3M8Q A;  3VQA A;  4CF9 A;  1KVB A;  3SQ4 A;  2G8F A;  1ASW A;  1IKW A;  4FK4 A;  1XHZ A;  1KTQ A;  1Z26 A;  1EP4 A;  1I3A A;  1BI4 A;  3NF6 A;  2HMI A;  2HHQ A;  4JS4 A;  4BWJ A;  3T19 A;  1VSM A;  1IKY A;  1LWE A;  3DRP A;  1SL0 A;  2OPQ A;  4OVL A;  4CJW A;  3K58 A;  4O44 A;  2XY6 A;  4K8Z A;  3VQ6 A;  3THV A;  1KVA A;  5FRN A;  3QET A;  4KTQ A;  3QEI A;  1D9D A;  4DS5 A;  4MFB A;  4N76 A;  3HST B;  1QHT A;  2HVH A;  1RBV A;  4DFK A;  4PWD A;  3KIO A;  2DFH A;  5CZ2 A;  4OGC A;  3QNN A;  1TGO A;  3VA3 A;  4J2E A;  1VRT A;  5CZ1 A;  4CFD A;  3RMA A;  4JRQ A;  1QSL A;  4EZ9 A;  1RTD A;  4E7J A;  4N47 A;  3M8P A;  3L8B A;  2IS3 A;  3DLR A;  4O0J A;  5KRT A;  2Z1I A;  5J2N A;  3SQ0 A;  4RW7 A;  4CGH A;  1LWF A;  2OZM A;  2OA8 A;  1NKB A;  4FJI A;  3DMJ A;  5CYM A;  4KAZ A;  1B9D A;  4OLB A;  3ASM A;  3AO2 A;  3ZSX A;  4B9S A;  4NCG A;  3DM2 A;  1C0M A;  1VK0 A;  3VQ9 A;  1NJZ A;  4E1N A;  4NCB A;  1EX4 A;  2X78 A;  3LDS A;  3KLE A;  3NGY A;  3VN5 A;  4C8M A;  2W42 A;  1KFS A;  3K5O A;  1TKX A;  4KPY A;  1VSD A;  2Z1H A;  3L2R A;  1C1B A;  4FW1 A;  1EET A;  3LWM A;  5HRO A;  4CEA A;  4EP5 A;  1D8Y A;  2HNY A;  3E01 A;  3OS2 A;  4IDK A;  3MXI A;  1A5V A;  1C0T A;  4DFM A;  3DRS A;  1LW0 A;  5D3G A;  3DI6 A;  4FJL A;  1VSF A;  4LSN A;  4CGD A;  4KI6 A;  4F2S A;  5KGX A;  1RTH A;  1VSJ A;  2JLE A;  3V1Q A;  2VG6 A;  2LSN A;  4YNQ A;  3TAP A;  1JL1 A;  3ZSW A;  2YNG A;  1S9G A;  2X74 A;  4DQS A;  1MU2 A;  4FVM A;  2HHU A;  3QO9 A;  4DLG A;  3A2F A;  3DYA A;  3LP0 A;  5J1E A;  3L3V A;  2HHT A;  1XC9 A;  2D0C A;  3QER A;  4FYD A;  2FBT A;  3V4I A;  4TSX A;  4B9L A;  4BE2 A;  4KB1 A;  4L8R B;  4ELV A;  3C94 A;  2HHX A;  4CGG A;  4FJN A;  1T7P A;  2B4J A;  3TAG A;  4DQP A;  4HTU A;  4C8O A;  3NE6 A;  4CJ4 A;  1HJR A;  3G0Z A;  3M8R A;  3MEC A;  3AVN A;  3RMD A;  1RT3 A;  3TWH A;  3BGR A;  2IGI A;  4E7K A;  4M3T A;  1NJY A;  2O4G A;  3VQ8 A;  4B8A B;  4CES A;  2O4I A;  3O3F A;  3ZT0 A;  1RT4 A;  1SL1 A;  4DSL A;  2GBZ A;  3QNO A;  4E1M A;  4Z4E A;  3I8D A;  1XWL A;  4OGE A;  4CIG A;  3L2V A;  5HP1 A;  3HL8 A;  3O3G A;  4UQG A;  4PQU A;  2IAJ A;  2WOM A;  4AHR A;  5FDL A;  1NK6 A;  5HLF A;  3V9X A;  4R5P A;  3NF9 A;  5J2P A;  4C8K A;  3P83 D;  1ASV A;  3ITH A;  4OLA A;  3PX0 A;  4CJE A;  1NJX A;  4HVJ A;  1BIZ A;  4HUG A;  4WE1 A;  3MEG A;  4FLU A;  1REV A;  3UIQ A;  3VQD A;  3KTQ A;  4CED A;  4FK0 A;  1TL3 A;  5C25 A;  5C42 A;  3NCI A;  3U6F A;  3D45 A;  4CJR A;  1SV5 A;  1UAX A;  2PY5 A;  4OJR A;  1NKE A;  1NOZ A;  3I0R A;  3NF7 A;  2A1R A;  1BIU A;  1HNI A;  3D0P A;  3AVB A;  3CG7 A;  4KV8 A;  1YVU A;  3JYT A;  4DTR A;  1HMV A;  3K59 A;  2HVI A;  3ZT3 A;  3AVC A;  4CJ3 A;  1W9H A;  3LWL A;  1BQN A;  4FM0 A;  1TK8 A;  3OYD A;  5SZT A;  1HYV A;  4PA1 A;  4FLV A;  2YNH A;  3TAQ A;  1GOA A;  4FJH A;  4E7H A;  1RTJ A;  2D0B A;  4Y1C A;  2IDO A;  1KLN A;  2XHB A;  3NAE A;  3T3F A;  1NK0 A;  4W5N A;  1RDD A;  2RPI A;  3OYG A;  4CHO A;  5J2Q A;  4KKO A;  4K8X A;  3JSM A;  4FJ5 A;  4GW6 A;  4RW6 A;  1YT3 A;  4CFA A;  1RT5 A;  1HYZ A;  4RW4 A;  3DOL A;  4JS5 A;  1L3T A;  4FLX A;  3AVG A;  4Y1D A;  3V1R A;  3L3U A;  4PUO A;  3K2P A;  3AO1 A;  3SZ2 A;  3L2Q A;  3RR7 A;  1IKX A;  1TAU A;  1UA0 A;  1JL2 A;  4IFV A;  2KW4 A;  4F2R A;  3K5M A;  1NOY A;  2HB5 A;  3IS9 A;  1X1P A;  4BDZ A;  2ZD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...