4HHTA

T. maritima rnase h2 g21s in complex with nucleic acid substrate and calcium ions
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
229
structure length
220
Chain Sequence
GIDELYKKEFGIVAGVDEASRGCLAGPVVAAAVVLEKEIEGINDSRLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKSVVFRKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNase H2 roles in genome integrity revealed by unlinking its activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/dna
molecule keywords Ribonuclease HII
total genus 75
structure length 220
sequence length 229
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hhtA00
5CYMA 4E7IA 2OPPA 1WAJA 3BDPA 1WSIA 3V4IA 4PUOA 1G15A 5DK5A 3K5MA 2QKBA 3NF6A 3QNOA 1S6PA 4E3SA 3T3FA 1YT3A 4DFPA 3CFRA 1KLNA 3LP3A 5CYQA 3KK3A 4Z4GA 3OS2A 1FK9A 1HQUA 1RDBA 1D5AA 3P83D 3L3UA 3OYCA 1NJYA 3AVHA 4M3XA 4EP5A 3AO1A 5SZTA 1WSFA 4CK1A 3OYHA 3MAQA 4C8LA 2HVIA 3EYZA 3T19A 2X74A 5HRNA 3E01A 3HK2A 3PO4A 4B08A 4B9UA 3LP0A 3CFPA 4F3TA 4FLZA 2OA8A 3TANA 2G8WA 4J2EA 1R0AA 3AO5A 3KKSA 3V9ZA 3HVRA 1NJZA 3MXJA 2HHXA 3KK1A 1UA1A 4KO0A 1RTDA 3RRGA 1T05A 1O1WA 1QTMA 4L8RB 4FCYA 1VRUA 2ETJA 5T7BA 3SPZA 4M3YA 3ISNC 3RMAA 4I7FA 3P1GA 4NYNA 5FROA 1I3AA 3DLRA 2QK9A 3T1AA 2GBZA 3V9XA 3V81A 4KI6A 3LANA 4ELVA 4R5PA 1BL3A 1C6VA 3O3HA 1NOZA 4AHUA 4O0JA 5J2MA 4KREA 4ELUA 1B92A 4E19A 3V6DA 3LAMA 1L3VA 4OVLA 1HYZA 1QSSA 1IH7A 2HHSA 1SL1A 4CEBA 1HRHA 4JS5A 3LAKA 1S1TA 5CZ1A 3VQ7A 1TK8A 2HMIA 4B8CA 4CJUA 1DLOA 2G8UA 1WSHA 4IFYA 4CJ4A 4KTWA 3TAFA 4N76A 2Z1IA 1LW0A 2YNGA 1IKWA 1HNVA 3V1RA 1WSGA 1ITGA 3DRSA 3KJVA 1RNHA 3V1OA 1ZYQA 3KLHA 1CLQA 2EX3A 3MEDA 4Q5VA 1JLBA 1RBUA 1S1UA 4DS5A 3QEPA 4B9NA 4DFJA 1Q9YA 2FBTA 4W5TA 2X78A 4B9MA 3O3GA 3QLHA 1WAFA 3KLGA 1FKOA 4BE2A 2HNDA 3AO4A 4CK3A 4DTUA 4AHCA 4FJLA 1L3UA 2OZSA 4DSFA 4DLGA 1A5WA 4AH9A 3VQDA 4CHNA 4OLBA 4CJFA 3AVBA 3PY8A 3HSTB 4WE1A 3QIOA 4DTSA 1L3TA 4DQSA 4E1NA 1J53A 1VSJA 2PZSA 1BI4A 4CEOA 4CJPA 1IKVA 1C1AA 4AHSA 1SKWA 3TI0A 2A1RA 3SI6A 1U49A 2NUBA 3DRPA 4KTQA 3AV9A 1W9HA 4RW4A 4CCHA 1YVUA 3TARA 2IDOA 5HRPA 3HT3A 4O4GA 1KLMA 4ELTA 3OYMA 1S9EA 3F9KA 3SUNA 4KB0A 2YKMA 2O4GA 4LY7A 3M8SA 3L2VA 3KD5E 4E7LA 4CJLA 4QAGA 4YFUA 3VA0A 1JLAA 2FBXA 4CF1A 1X9WA 1B9FA 1VRTA 4HUEA 4Q0BA 3OYAA 3VQ8A 2D5RA 4FJGA 3VN5A 4JS4A 2HHWA 4FLWA 4F3OA 3TAPA 4CEEA 3DI6A 3VQ6A 1LAVA 3IAYA 1XHXA 5DMRA 4IBNA 3RRHA 4E7JA 4JLHA 3LWMA 4K8ZA 1ZBIA 1S1WA 1QE1A 4PY5A 3HL8A 4CHOA 3B6PA 3RTVA 1RBTA 3RR7A 2XY5A 3QEIA 4NCGA 4DQRA 4O44A 4MFBA 4DLEA 4QOZB 3TAMA 1U45A 2XY8A 3NGYA 3SUPA 3ITHA 4C8OA 3LPTA 1TK0A 4W5OA 1NK5A 3SZ2A 3VA3A 1RT3A 1Z25A 2KZMA 3NF8A 1JXBA 3ZSRA 4CEAA 5CZ2A 3KKRA 4XIUA 3I0RA 4FJ7A 3VQBA 4BWJA 1Q8IA 2ZE2A 3QIPA 4FK0A 3AVFA 4DTOA 3RR8A 4O5BA 1HYVA 1T03A 2YHBA 2HHQA 3OYGA 3AO2A 3PV8A 4FJNA 4ID5A 3HO1A 4E7KA 4CJRA 1TKZA 1CZ9A 4LH4A 4CJTA 1X1PA 2Q3SA 2HNYA 2KQ2A 3OYIA 4F2RA 3VQQA 4Y1DA 3NGZA 4FZXC 4FXDA 3HPHA 1NK7A 3HYFA 1SKRA 4OPKA 4W5NA 4F8RA 5KI6A 1D9DA 4IDKA 3AO3A 1UAXA 4OKEA 4G1QA 2DFHA 4O55A 1N6QA 2D0BA 2OPQA 2G8HA 2PY5A 2QKKA 3DLEA 3AVGA 1BQMA 1LV5A 4OGCA 4H4MA 3ASMA 4GW6A 5JS1A 4DWIA 5C24A 2DTUA 1SKSA 3C6UA 5I3UA 2XO7A 4OJRA 3C94A 3ZSOA 2IOCA 3LP2A 3ZSYA 3I0SA 4BE0A 1XC9A 2WOMA 3HP9A 4KTZA 1LWEA 4CIFA 1TK5A 2ATQA 1IKXA 1VSIA 4E0DA 4IKFA 1MU2A 4H8KA 4B3OA 5KRSA 4CE9A 3OY9A 4F4KA 4HUGA 1HMVA 3MECA 3ZSXA 1TL1A 4HUFA 3SV4A 2Z1JA 5HLFA 3H08A 1T8EA 4OGEA 1RDCA 4FVMA 2G8VA 2F8SA 4LH5A 3NH2A 1WN7A 1XHZA 4CFBA 3ZT0A 4FJKA 1WSJA 1NKBA 3PUFA 3K57A 3DOLA 4HTUA 4N47A 4CHPA 4FLYA 1RT1A 3B6OA 3OJSA 3VQ4A 3OYFA 3L2UA 3WNEA 4DQQA 4Z4CA 3K5NA 4FLVA 2G8KA 4DF8A 1JLCA 2E6LA 3NHGA 1GOBA 1GOCA 4DTXA 1JL2A 3EZ5A 3ZCMA 3KLFA 1Q9XA 4RW9A 4DTJA 2VWKA 1RT2A 1K6YA 1TAQA 3NFAA 3L2WA 4C8KA 3DMJA 4CEFA 3HM9A 3OYJA 3VQCA 1U48A 2WONA 4IG0A 1NJXA 4LSLA 4FJMA 1TV6A 1Y97A 2OPSA 3ZSZA 3QEXA 4RG8A 3SJJA 4DQIA 1J54A 4F2SA 1RBRA 4K8XA 4M42A 2RN2A 1X9SA 4FJ8A 2IC3A 5E41A 1JLQA 3AA3A 3ALYA 3DLKA 3NH0A 3NGIA 4BACA 2RKIA 1U4BA 2F96A 3CFOA 3DLGA 1U47A 1A5VA 1LWCA 4M3TA 5FRMA 1TAUA 2E6MA 3OYBA 4Z4HA 4I2PA 3VQAA 3LZJA 1QQCA 2KFNA 1S1VA 4Z0UA 4N56A 1N5YA 1KSPA 4M3UA 3WNGA 1HYSA 4DS4A 1U04A 2GUIA 2KFZA 1KRPA 3D45A 1TVRA 4CHQA 2ITGA 4B9SA 4CEZA 2AJQA 4JRQA 2KZZA 1LAWA 3L3VA 3ZT2A 3DLBA 1C0UA 4ID1A 1UOCA 3OS0A 3OYDA 1HJRA 4DU3A 1ZBFA 2HNZA 2B4JA 4DF4A 4FK2A 4NCAA 3SPYA 4FM1A 1GOAA 1KVBA 3DRRA 3NH1A 2HW3A 3PX0A 4DTMA 3TAEA 2B5JA 3L2RA 3NE6A 3S3MA 1YTAA 5C25A 3F73A 1JXEA 2P5OA 4CGHA 3UIQA 1CXUA 4KHSA 1JLGA 1RTJA 4KPYA 1VK0A 1DTTA 4CFCA 2DY4A 4J2AA 4J2DA 1WSEA 3D0PA 3V9UA 1ZBLA 1F21A 1BIUA 3HXMA 2E4LA 2P1JA 2XY7A 1NK8A 4EZ9A 5HRRA 3IG1A 3FFIA 3LALA 2FC0A 3TABA 4FW1A 4M45A 4CFDA 3KIOA 4B8AB 1RT7A 4I2QA 3TAGA 3KTQA 1X9MA 1J9AA 5JS2A 1VSKA 3AVJA 3RWUA 2VWJA 2IGIA 1S9GA 2KW4A 1RT6A 4DMNA 2BDPA 4FLTA 4M41A 5KGWA 4ZHRA 4DSKA 4M3ZA 4ZTJA 4Z4EA 4B9TA 1BGXT 3NF9A 4OKKA 3SCXA 4I9QA 5K14A 3P5JA 4W5QA 3QEWA 3LWLA 4H4OA 3O4QA 3K5LA 4FM0A 1VSFA 1SL2A 1LWFA 1ASVA 3ZSQA 4CF8A 3PX6A 5HP1A 2B6AA 4W5RA 4DFKA 3EY1A 4OPJA 5EU7A 4KAZA 3MEGA 4FLUA 4HCCA 1JLEA 3TWHA 4FLXA 2VG5A 2HHUA 1NKEA 4CGGA 4FK4A 1EETA 3AVCA 3HVTA 3DM2A 4CF2A 3U6FA 1KVAA 3QINA 3K59A 3HPOA 2XRIA 4CHZA 2OZMA 3VQPA 3OJUA 5CY4A 4CJ3A 4E1MA 1WNSA 1BI4B 3CG7A 4IG3A 3WNHA 2GV9A 4DFMA 3MXMA 2PYJA 3PO5A 4KHWA 3K58A 4YNQA 3ULDA 4CJEA 1SL0A 4CGDA 4GVMA 4OKJA 4CGFA 3LDSA 3LPUA 4O0IA 4ZTFA 4KFBA 2FBVA 4FJIA 4HCBA 4Z4FA 3IRXA 3S3NA 1NKCA 3AA4A 2XY6A 4CGJA 2G8FA 1BCMA 3OYEA 1EXQA 4AHRA 4AHVA 3L2QA 3C6TA 1WLJA 2YKNA 3AVMA 4KRFA 1HQEA 4QCLA 1KFDA 2VG6A 1KCFA 4GMJB 4CGIA 1TKDA 3ZT4A 1JKHA 4CJWA 1L5UA 4FJ9A 4CJKA 4KHNA 3ZT3A 1D9FA 4N41A 1EP4A 1C0TA 4I9LA 1XWLA 4FJJA 2BANA 2YV0X 4FZZA 3SQ4A 4CEDA 1NJWA 1NK0A 2HB5A 3JYTA 4CEQA 3PX4A 1A5XA 3OYNA 5HRSA 3THVA 1C0MA 4B9LA 3MEEA 4KHUA 3KD1E 4DTNA 2X6SA 4M3WA 4UQGA 1RTHA 1UWBA 4DSJA 3VQ9A 3OYKA 3ZSWA 4CHYA 2P5GA 2RF2A 2HVHA 1S5JA 3AVNA 1NOYA 1VSMA 3G0ZA 2DFEA 3V9SA 4IFVA 4DG1A 1IO2A 1BISA 5HBMA 4NCBA 2JLEA 4MQ3A 5I42A 2Y1IA 4B9VA 4C8MA 3SUQA 1ASUA 4AHTA 3ZT1A 3SNNA 1I39A 2D0CA 4CESA 1C1CA 4FJHA 1UA0A 3SV3A 1BCOA 4DSIA 3I8DA 1VSLA 3OYLA 5FRNA 4KI4A 4E89A 1CXQA 4LSNA 1IG9A 3HPGA 5C42A 1RCHA 3KK2A 3NDKA 2HHTA 1VSDA 1EKEA 5HROA 1ZBHA 1T7PA 3SQ2A 4CERA 4CJVA 4KKOA 3KLIA 1CZBA 3O3FA 1NK4A 1J5OA 1VSEA 1KVCA 3LP1A 1QHTA 1RBVA 2IAJA 4FW2A 3RMCA 3RMDA 2HHVA 3G10A 4CF0A 4LD0A 4DSEA 3CM6A 2IS3A 3TR8A 4BWMA 3ZSVA 3S9HA 3AA5X 1YTUA 3NBPA 2YHAA 1JLFA 3JSMA 4BDYA 3U3GA 3KLEA 1LW2A 2R7YA 2PYLA 2OYQA 4KHQA 3DOKA 2O4IA 4CF9A 2YNIA 1QS4A 4PWDA 2Y1JA 4C8NA 3DYAA 2JGUA 1S1XA 3A2FA 4HHTA 3CYMA 4KV8A 3M8RA 1RTIA 1TKTA 2EHGA 2YNHA 1RILA 3K2PA 5KGXA 2RPIA 4DTPA 4BDPA 1ASWA 3V9WA 1W0HA 2XHBA 4KHYA 2ZD1A 4FM2A 5J2NA 3S3OA 4FJ5A 3CQ8A 3SQ1A 1RT4A 3O4NA 4CFAA 2Z1HA 2YNFA 4FZYA 1BIZA 1QSYA 1RDDA 3SYZA 3HP6A 2OPRA 1KFSA 3CM5A 2P51A 4EP4A 3BGRA 1S6QA 4FJXA 4PQUA 1TL3A 3SQ0A 1NK6A 3LZIA 1HPZA 3VQ5A 1D8YA 3VQEA 3NAEA 2F8TA 1QSLA 3OVNA 2BE2A 3AVKA 3M8QA 3QEVA 3AVAA 1REVA 4CK2A 1L3SA 4OLAA 1HNIA 4E7HA 4TSXA 5J1EA 3OS1A 4EZ6A 5J2PA 4FYDA 4RW7A 1ZBUA 4HVJA 3NCIA 1B9DA 4AILC 1Z26A 5FDLA 1RDAA 4CECA 3AA2A 4CIGA 4RW6A 4JRPA 1C1BA 2DFFA 4ICLA 4NYFA 3QESA 2Z1GA 1RBSA 2W42A 4DSLA 2A1SA 3IS9A 1DTQA 2G8IA 2I5JA 1RT5A 3QETA 1NK9A 1FKPA 3WNFA 4CJ5A 4CJQA 3DLHA 2ZQBA 3K5OA 4PA1A 4Z4IA 3QNNA 1EX4A 1TGOA 5D3GA 4CIEA 3RMBA 1BHLA 1XI1A 2QXFA 3MXIA 5KRTA 3AVLA 3HJFA 2X6NA 3QO9A 4RW8A 3V1QA 1SV5A 1SUQA 3C95A 1VSHA 4KB1A 3U3YA 3TAQA 3L8BA 1TKXA 3QERA 4N5SA 4DU1A 3SUOA 2BGGA 2KTQA 4CJSA 3AVIA 4BE1A 2VG7A 4Y1CA 3M8PA 1FXXA 5SWMA 4DQPA 5KTQA 4DTRA 1JL1A 2LSNA 1IKYA 4BDZA 5J2QA 2D0AA 3NF7A 4J2BA 1BQNA 4M3RA 2FBYA 4DU4A 1KTQA
chains in the Genus database with same CATH superfamily
2PBDA 4E7IA 3O1WA 4B3TK 2UYTA 1QVGM 5M1QA 1WSIA 3VOVA 3V4IA 4PUOA 3K5MA 4BVPA 2QWPA 3T3FA 4DFPA 3CFRA 3LP3A 1Z6RA 4Z4GA 3L3UA 3AVHA 4EP5A 4C23A 3E01A 3HTVA 3LP0A 4F3TA 4LFAK 3TANA 3KKSA 2CH5A 2P9SB 3KK1A 1UA1A 3C0BA 4BREA 4FCYA 5T7BA 3WUHA 3P1GA 5FROA 3VENA 4CZEA 4EHTA 2QI2A 1K73O 4WFAL 2QK9A 3FZHA 3V81A 3ID6A 1BL3A 1NOZA 4O0JA 2ZM6K 4KREA 1S3XA 3VF6A 4JK9A 4B1ZA 1HYZA 1NU0A 2HHSA 4WCEL 5GIOA 1HRHA 1BA1A 4LF6K 3VQ7A 4AM6A 1TK8A 4B8CA 2G8UA 4IFYA 4CJ4A 2FSNA 2YNGA 3R9PA 4JKBA 2NRTA 4B1WB 2HHHK 1CLQA 1JLBA 1RBUA 1S1UA 4DFJA 3ZETB 2FLOA 2X78A 4H5NA 1BUPA 1XMQK 4DTUA 4BRIA 3VF4A 5GAHP 4CHNA 3VQDA 2O8EA 3M1FA 3HSTB 2V52B 3QIOA 4WE1A 4WQ4C 1L3TA 5JLFA 4DQSA 4E1NA 1J53A 1VSJA 2CGLA 4CEOA 1C1AA 4AHSA 3ID8A 3SMPA 1U49A 4KTQA 3AV9A 1YVUA 3TARA 2IDOA 3ENBA 4O4GA 1KLMA 4ELTA 1C0GA 3H6EA 3TSPA 3M8SA 3L2VA 5AQIA 1HNXK 3AAQA 4FWLA 5A2QO 2E2NA 4YFUA 3ENOA 4CF1A 1NGAA 2FBXA 1X9WA 4Q0BA 3IKMA 3ZLJA 4F3OA 3TAPA 3O4WA 1LAVA 3IAYA 4IBNA 5LL6Z 4JLHA 3LWMA 1ZBIA 1S1WA 3RR7A 3P4IA 4GV3A 4O44A 4MFBA 4DLEA 4IFEA 1U45A 3FGUA 3ITHA 3SUPA 2RHKA 3LPTA 3VA3A 1RT3A 1Z25A 3FFKB 2KZMA 4BRDA 1VQ5N 1NGFA 2ZE2A 3LDPA 4YOUA 4GVEA 4CJ7A 4FK0A 1HUXA 1OH8A 2YHBA 2HHQA 4AF1A 3AO2A 4ID5A 4CJRA 4LH4A 1X1PA 3SJHA 2Q3SA 2KQ2A 1N34K 1IJJA 4F2RA 2WBNA 3HYFA 1HNWK 1UAXA 4BRCA 2DFHA 2CGJA 2PY5A 2G8HA 5AQWA 2QKKA 1BQMA 3VEVA 1NGEA 3OHRA 4PL7A 4K43A 5I3UA 2XO7A 4OJRA 2IOCA 3LP2A 4QS9A 3I0SA 3ZSYA 3CJ7A 3UKUB 4CIFA 2VQEK 5C0YA 4IOXA 1TK5A 4IKFA 1MU2A 3CJBA 4O8KA 5KRSA 3OY9A 1VQKN 3NH2A 3DXMA 4FJKA 3O8MA 4CHPA 1IG8A 3CC4N 3OJSA 4CZLA 3K5NA 1SAZA 3DXMB 2G8KA 4CBUA 1JLCA 2E6LA 4DCHA 3L0QA 4DTXA 1JL2A 3EZ5A 3ZCMA 1EO1A 3KLFA 1Q9XA 4RW9A 4DTJA 2VWKA 4U67L 1HR0K 3ATUA 4CEFA 4DKWA 1NJXA 3ZSZA 2V51B 2O8DB 3R8EA 3T7ZA 3QEXA 3SJJA 1VQON 2RN2A 1VQ9N 2IC3A 1JLQA 3AA3A 3ALYA 3DLKA 4DR2K 4YOYA 2RKIA 4BC5A 4OO1J 2F96A 3CFOA 1U47A 4RTFD 1A5VA 4M3TA 5FRMA 1BA0A 2E6MA 1NMDA 4Z4HA 3VQAA 1YI2N 4M3UA 3HOTA 4DS4A 2F4VK 4FOEA 4CHQA 4QS7A 2OANA 4JRQA 3ZT2A 4DR3K 4DU3A 2HNZA 4BRAA 2B4JA 3WXJA 5CE3A 4B9QA 1GLDG 3DRRA 3L2RA 3PIOL 4KHSA 1RTJA 4BRPA 4WQ4A 4J2DA 1WSEA 3D0PA 2YHWA 3VEZA 3IG1A 2F9WA 1GLFO 3D2EB 2VWJA 4FOIA 4FLTA 4M41A 2RE2A 4B9TA 4BR0A 3VGKA 3SCXA 4LF5K 3QEWA 3LWLA 4H4OA 4FM0A 1O13A 2Q97A 3PX6A 3EY1A 4KAZA 3CCUN 4FLUA 4FLXA 4H0TB 2HHUA 4FK4A 1EETA 1WUAA 3DXKB 3QINA 4DV3K 2XRIA 4M7YA 4CHZA 4BRNA 5CY4A 5I42A 3MXMA 1HKGA 3PO5A 4KHWA 2PYJA 1OH6A 5IT9O 4WQ5C 4OKJA 3CJ9A 3EKUA 3LPUA 3O6WA 5AQZA 4FJIA 4IOAL 3Q7BA 3S3NA 1YJ9N 2D0PA 2Q2RA 4A5AA 2UUAK 3L2QA 1WLJA 1HQEA 1V4TA 2W41A 4CGIA 4YOTA 2GELA 3GOIA 1C0TA 1XWLA 4FJJA 1NJWA 2I7NA 1WBDA 1MDUB 5HRSA 3THVA 1C0MA 3MEEA 1RTHA 3OYKA 1TUYA 3ZSWA 2P5GA 2RF2A 3KWGA 4IEIA 4K25A 1NOYA 4ISFA 2F9TA 3D2FB 3V9SA 1GLEG 1IO2A 5HBMA 4LFBK 4MQ3A 2Y1IA 3EE9A 1YITN 4C8MA 1ASUA 4AHTA 3ZT1A 2VGMA 1C1CA 4JN4A 1VSLA 5FRNA 4KI4A 4E89A 1CXQA 4LSNA 2NZTA 5C42A 2QTDA 2ZGZA 5HROA 2P9IB 3EZWA 2QW9A 2A6AA 3KLIA 1J5OA 4DUYK 4C1NK 1LOTB 4LD0A 1VQLN 3M5RA 3K0SA 3NBPA 1JLFA 3AY9A 3G4SN 4GY2B 4UY8O 2PYLA 1E4GT 1EQYA 2Y1JA 2JGUA 3A2FA 4KV8A 1RTIA 5KGXA 3K2PA 4EHUA 2ZD1A 5J2NA 5TKYA 3O4NA 3CCJN 2IVNA 5C2FA 3HP6A 1KFSA 2P51A 3U9DA 4EP4A 1VQMN 3CPWM 4XH1A 3CETA 3LDOA 3CXCM 3VQEA 2F8TA 1QSLA 5AZIA 1REVA 4CK2A 4OLAA 4E7HA 5AQRA 3OA9A 3OS1A 3ULEA 2YJFA 4FYDA 4RW7A 1NGGA 5GAGP 2QWOA 3ZYYX 4CECA 1YJNN 3CMEN 4JAXA 4K0KK 2A1SA 1DTQA 2G8IA 1NK9A 3GDQA 2OCEA 3MCPA 3QNNA 1EX4A 3HI0A 1BHLA 4F9OA 5TKWA 1VQ8N 3HJFA 2X6NA 4RW8A 1VSHA 2J4RA 4KB1A 1TKXA 4PKGA 3SUOA 3AVIA 3DWLA 3M8PA 1FXXA 5SWMA 3DJCA 4BDZA 4J2BA 1BQNA 3TSQA 4PY5A 3NF6A 1KTQA 3PX0A 3FR0A 1NGCA 3H1QA 1NBWA 4I6MA 4ISGA 1RDWX 5DM6L 3THXB 1G15A 5DK5A 5FLXO 2QKBA 3ZX3A 4BGBA 4IZ9A 1NJIO 2GX9A 3AO1A 3QFPA 5SZTA 2HVIA 3OYHA 1ZC6A 5HRNA 4B08A 4C1NI 3V9ZA 1O1WA 3SLCA 4L8RB 1VRUA 3ISNC 3P31A 3DLRA 2GBZA 3CPEA 4ELVA 3ATVA 5LJVA 3R1XA 4ELUA 4MDAA 4E19A 3V6DA 5IWAK 4JS5A 3LAKA 5CZ1A 2I7PA 3MX2A 4CJUA 1DLOA 1IKWA 2YCHA 3V1RA 1WSGA 1ITGA 3V1OA 3KLHA 4CW7B 1VHXA 1H1VA 4YOVA 3HRGA 5DM7L 4BE2A 3AO4A 4CK3A 1JCEA 1L3UA 3MN9A 1P90A 1K8AO 4CD1A 3AVBA 3TU5A 1BI4A 1SKWA 2A1RA 4JHDA 2GTDA 3OYMA 4LY7A 4H5WA 4E7LA 1ATRA 4CJLA 3THYA 1JLAA 1B9FA 1WOQA 4HUEA 5GIPA 4FSVA 4JS4A 1M1KO 4CEEA 5DMRA 4E7JA 3EKSA 3HL8A 3B6PA 2XY5A 1QZ5A 1RGIA 3NGYA 4BR4A 4AM7A 2PFUA 1Y64A 4LFCK 4IO9L 3ZSRA 4XIUA 3KKRA 4DV0K 3AVFA 4DTOA 4YDUC 1T03A 1XC3A 3PV8A 4FJNA 3O9TA 5AQVA 3NGZA 4FXDA 1NK7A 4B3SK 1SKRA 4OPKA 1D9DA 4IDKA 1I94K 2P9NA 4OKEA 4G1QA 1Q82O 4H5VA 2D0BA 4WYBA 3CJCA 3DLEA 3ASMA 4DWIA 5EY4A 3KHYA 1BU6O 4BE0A 2WOMA 3VERA 2UXCK 4EAHD 5AFUH 1KD1O 2ATQA 3MN7A 1VSIA 3H3NO 4FL9A 4JEPA 3I33A 5M1PA 2BUPA 2EWSA 1YXQA 3MECA 1HNZK 1TL1A 5HLFA 2Z1JA 3H08A 1W97L 1RDCA 4FVMA 4OPHA 2G8VA 4G9ZA 1WN7A 4H03B 1NKBA 5KQ8A 3A5NC 3DOLA 5KPZA 4HTUA 4BC2A 4FLYA 1GLLO 2YHYA 3L2UA 1KAZA 4DQQA 4Z4CA 5FPDA 4DF8A 1GOBA 1GOCA 3MWPA 4MDBA 4CZMA 5KQDA 4XH5A 1K6YA 2NRXA 1N8RO 4C8KA 3DMJA 1S22A 3HM9A 1U48A 4JI8K 2BTFA 2WONA 1TV6A 5AFUA 3EE8A 4RG8A 3IFRA 1RBRA 4ILJA 5E41A 3NGIA 2VCPA 3DLGA 3T69A 2UUBK 3OYBA 2ZJRL 4B1YB 3LZJA 1KRPA 3D45A 4OPAA 1VQPN 3BZKA 2UXDK 5F0XA 2AJQA 4QS8A 3DLBA 3A5LC 2FF6A 4JKEA 1GOAA 1KVBA 3H46O 3NH1A 2HW3A 5F2RA 4DTMA 3F73A 5AQQA 2P9IA 3HBTA 2F7TA 3VTIA 4J2AA 1BIUA 4JYAK 3HXMA 1XQSC 2FC0A 3BF1A 5KPRA 1HKCA 4CFDA 4B8AB 4XEIA 3CQYA 3KTQA 5JMVA 1VSKA 3UKRA 2KHOA 3T1YK 3IMXA 2KW4A 4DMNA 1NM1A 4ZTJA 4MO4A 3SAFA 4DR6K 2FXUA 3NF9A 3CJ1A 4I9QA 3O9UA 5K14A 3K5LA 1SL2A 1LWFA 3O80A 1ASVA 3GBTA 3ZEUB 2VG5A 3U6FA 2QXLA 3HPOA 3OJUA 4CJ3A 4H5TA 4E1MA 2ASOA 4JI3K 4IG3A 1BDGA 3QBWA 5KPTA 2A3ZA 4CJEA 1SL0A 4CGDA 4NLCA 4HWIA 4X62K 4KFBA 2FBVA 4HCBA 3IRXA 3AA4A 2XY6A 4CGJA 2G8FA 2O8FA 1EXQA 3C6TA 4QCLA 1KFDA 2P9NB 1KCFA 4GMJB 1V4SA 1Q7YO 2VGNA 4FJ9A 4CJKA 4KHNA 1D9FA 1EP4A 2QWMA 1IV0A 5AQLA 2HB5A 3JYTA 2IVPA 3PX4A 1A5XA 3KK7A 3P39A 4KHUA 2X6SA 1W2BM 2ZJPL 2HVHA 3AVNA 1VSMA 3BZCA 3MCAB 4DG1A 1BISA 4BQLA 2FSJA 3SNNA 4A59A 4FJHA 4BC4A 1UA0A 3I8DA 4BG8A 1IG9A 5H1SQ 3KK2A 3NDKA 4B1VA 1EKEA 4FPAA 1ZBHA 3THYB 1CZBA 3G10A 5LMUK 4JI2K 5HL7L 3CM6A 3VESA 2ZF5O 2UUCK 3S9HA 3AA5X 1YTUA 1GLJO 2R7YA 3AGRA 2YNIA 1IBLK 1S1XA 3M8RA 5CHIA 1YHQN 1TKTA 2EHGA 2YNHA 1RILA 3C65A 2O8CA 1ASWA 4FM2A 3S3OA 3CQ8A 5M1NA 1RT4A 4CFAA 3SQ1A 5C2DA 1RDDA 1DEJA 3AGKA 3BGRA 4EFHA 4GV9A 3SQ0A 5LJWA 1U6ZA 3CD6N 1EWQA 3AVKA 5F1XA 3U9ZA 3M8QA 4DV6K 4NXNK 4CI6A 3THWA 5J1EA 4PKHA 2W6KA 1B9DA 4AILC 5FDLA 4CIGA 3AA2A 4DR1K 4NYFA 3GG4A 4DSLA 2I5JA 3WXIA 4DR4K 1N36K 5GINA 4CJ5A 4CJQA 1NLVA 3K5OA 4Z4IA 1TGOA 3UKUA 3EO3A 4DUZK 1XI1A 3WQTA 4YOXA 3QO9A 1SV5A 3C95A 4KH5A 4CJSA 4BE1A 4CZJA 2LSNA 5GAEP 2D0AA 3NF7A 4E1JA 2JWKA 2FBYA 3LM9A 1ZXOA 3THXA 1XNRK 3BDPA 3QNOA 1S6PA 3O9SA 1YT3A 5CYQA 3DLLL 3EN9A 3OS2A 1RDBA 1NJYA 1D5AA 3OYCA 4M3XA 3JS6A 1WSFA 1MWMA 4JK7A 4CK1A 4C8LA 3EYZA 3HK2A 4B9UA 5FPNA 4IOCL 4J2EA 1R0AA 4JD2B 3AO5A 3NVKA 3W3DA 2WTUA 1NJZA 2HHXA 4KO0A 4RCHA 5AR0A 4XH4A 3SPZA 4M3YA 3RMAA 2A42A 4NYNA 3V9XA 3D6RA 4R5PA 1C6VA 5J2MA 1B92A 4PKIA 3ULEB 2A40A 1QSSA 3H1VX 1SL1A 4CEBA 3VETA 5I9EB 2BH1A 3MDQA 3L6QA 3TTDA 4N76A 2Z1IA 1LW0A 3DRSA 4YORA 4GKJK 2EX3A 3MEDA 4DS5A 3QEPA 3J7ZO 4B9NA 1Q9YA 2FBTA 4M63C 2HF4A 3A5OC 3O3GA 3QLHA 3WXMB 4JV5K 2HNDA 1MA9B 1KQSM 4GNIA 4AHCA 2Q0UA 4FJLA 4DSFA 5BPMA 3RSEA 2A41A 3PY8A 3EEQA 4DTSA 3M3ZA 3F9MA 2PZSA 4WFNL 1IKVA 5BR8K 4DV1K 3TI0A 4MO5A 2QWNA 3SI6A 2NUBA 3DRPA 1BG3A 4DV2K 4JKAA 4ILGB 1QQOA 3HT3A 5EX5A 4LF7K 4JKGB 1S9EA 4KB0A 4IWVA 1DGKN 4DR7K 3EL2A 4JK8A 5AQFA 5AQGA 3FZFA 3SK3A 3VQ8A 5ADXA 2O8BA 4JKDA 3DI6A 3S41A 3RRHA 1WB9A 4ILHA 4L3QA 4CHOA 1T3VA 3RTVA 2JWLA 1RBTA 3D2FA 2NLXA 1NGJA 4QOZB 4PHTX 3FZMA 2WC9A 3TAMA 1TK0A 4W5OA 1NK5A 1NGBA 4YDUA 3MX5A 3NF8A 4BRQA 5AQUA 4FJ7A 4RWTA 2E88A 3I0RA 3VQBA 4BWJA 1Q8IA 1QVFM 3RR8A 5C12A 3F2KA 4LC9B 2GWJA 4O5BA 4O8UA 1HYVA 4E7KA 1CZ9A 4CJTA 3I56N 4DR5K 2HNYA 3BUZB 2WFBA 4FWPA 4Y1DA 3VQQA 3HPHA 2P9KA 3R6MA 2UXBK 5JICA 4W5NA 4F8RA 5C10A 5KI6A 3AO3A 1N6QA 4O55A 2OPQA 4FWSA 4LF9K 3IDHA 5AQHA 3AVGA 4OGCA 4GW6A 2D1KA 5C24A 3RSEB 2YHXA 5E26A 4JI6K 2P9PB 5B8HA 3LL3A 3HP9A 4KTZA 1LWEA 3VTHA 3BF3A 1HJOA 1NGIA 1IKXA 1YAGA 3GE1A 3DXKA 4E0DA 3E66A 4H8KA 3MN5A 3KWIA 3VMFB 4HUGA 3IUCA 1HMVA 1KAYA 4HUFA 1T8EA 4B1UB 3J7AP 2F8SA 1XHZA 4NXMK 3K57A 4N47A 5BN9A 3B6OA 3VQ4A 3WNEA 4FLVA 4J8FA 1E4FT 4DV5K 3NVMA 3CCSN 4IXCA 3JXUA 2GEMA 2HSTA 5AQNA 3D2EA 1T6DA 3CF5L 3HZ6A 3VEOA 4KH4A 1RT2A 4O5FA 1TAQA 3NFAA 3L2WA 5BRFA 3OYJA 3VQCA 3O9QA 1VAZA 4FJMA 3WQUA 1Y97A 4DQIA 2ITMA 4F2SA 4M42A 2P9PA 1QHAA 1X9SA 3SBTA 4FPBA 3LM2A 3NH0A 2E5LK 4BRKA 2PAVA 2YJEA 3L4QA 4X65K 3CQXA 4BGAA 1QQCA 1Z05A 1EWRA 1N5YA 1KSPA 1HYSA 3E9LA 3CI5A 2P9KB 2KZZA 2QWLA 3L3VA 3OS0A 1UOCA 1HJRA 2D4WA 1ZBFA 5M1KA 4WF9L 4FK2A 4NCAA 3BY5A 3SPYA 5EVZA 3J8AA 2P5OA 1JXEA 3O08A 4CGHA 1RFQA 1CXUA 2KLAA 2W6LA 1HLUA 1VK0A 1ZBLA 1F21A 3NMUA 2E4LA 2P1JA 2XY7A 1NK8A 1Q81O 1OKJA 2QWQA 2NRHA 2O8DA 5LY3A 1SQKA 3TABA 4CZFA 1RT7A 4I2QA 2W40A 1P8ZA 3AVJA 2E2QA 4CVNE 2KKZA 2O8BB 5BREA 4Z4EA 3C7NB 4WQ5A 1BGXT 3VPZA 4OKKA 4YY3K 4BR7A 1GLAG 3VGLA 1KC8O 3O4QA 2P9UA 5FPMA 1JJ2M 3Q7CA 3ZSQA 4CF8A 4JKGA 4ISEA 4BROA 1JLEA 2QWRA 1NKEA 4CGGA 4FWKA 3HVTA 3DM2A 5BN8A 3VQPA 2FSKA 3MK6A 1ZBSA 3WNHA 3K58A 4YNQA 3ULDA 4ZTFA 4CGFA 4GVMA 4BR5A 4O0IA 2O8CB 4H0OA 3CC7N 1NKCA 3TSUA 1BCMA 3OYEA 4AHRA 2YX6A 4FO0A 2YKNA 3AVMA 4KRFA 2VG6A 5M1FA 1BWFO 3SMSA 5BPNA 1JKHA 1XNQK 4N41A 4B1XB 4FWOA 4I9LA 1C0FA 4FZZA 1G99A 4KBOA 4CEQA 3OYNA 3KD1E 4DTNA 4M3WA 1OVQA 4DSJA 3VQ9A 1NG9A 4NLBA 5AQJA 1S5JA 3G0ZA 2A5XA 2DFEA 1YVNA 4NCBA 3SUQA 4BRGA 4X66K 2D0CA 4JD2A 3F5TA 3SV3A 3OYLA 2V7YA 1RCHA 2Q36A 5EXWA 1VSDA 5ADXH 3AARA 3SQ2A 4CJVA 3VGMA 4KKOA 3C6AA 1NK4A 3LP1A 3RMCA 1RBVA 2IAJA 3P38A 4BRLA 3RMDA 1Q86O 4FVUA 3R3LA 3TR8A 3BEXA 4U7BA 3A0IX 3ZSVA 1MWKA 2YHAA 3JSMA 4Z94A 3U3GA 1LW2A 1NWKA 2O4IA 3DAWA 1QS4A 4C8NA 1M90O 1HKBA 5FPEA 4BVOA 3TPQA 2O8EB 1YUWA 3V9WA 1W0HA 4IO8A 1HPMA 3PIPL 4FJ5A 1FW6A 1QQMA 2YNFA 3SYZA 2H3GX 2OPRA 3CM5A 3ZETA 3UE5A 4CZHA 1NK6A 3LZIA 3VQ5A 1NGDA 3NAEA 3PSFA 3OVNA 3ZEUA 1L3SA 1HNIA 2E20A 5AZJB 4KHPK 5J2PA 1ZBUA 5AQTA 1Z26A 4K41A 3JAMO 1RDAA 4OX9K 3THWB 4V19S 3QICA 5JVGL 1YF5L 4ICLA 3QESA 2Z1GA 3IS9A 1RT5A 3QETA 1WBBA 2P9SA 3WT0A 2ZQBA 4DQ8A 2UU9K 4MLHA 3HOSA 1OVYA 4GKKK 2QXFA 5KRTA 3AVLA 3H3OB 3G71N 3TTCA 3U3YA 3TAQA 3QERA 2OTLN 4N5SA 3SAHA 2VG7A 5KTQA 4DTRA 2NRVA 3PSIA 1IKYA 5J2QA 3CHWA 4M3RA 3CCVN 4DU4A 5CYMA 3O1BA 2OPPA 1WAJA 3CCRN 4DHYA 1TYQA 2HMPA 4E3SA 1KLNA 3T1HK 3KK3A 1FK9A 1HQUA 1U2VB 3P83D 5AJ3K 2E1YA 1TUUA 3E9PA 3J80O 3MAQA 1JCGA 3T19A 2X74A 4B3RK 3PO4A 3CFPA 4YHHK 4FLZA 2OA8A 3A5MC 2G8WA 1ATSA 2NRWA 5HOOA 2Q31A 1S72N 3HVRA 3MXJA 4IJAA 4KH6A 1W7AA 1T6CA 1GLBG 3A8YA 1RTDA 3RRGA 1T05A 1QTMA 2Q1NA 2QEXN 2ETJA 1SZ2A 2VYPA 4I7FA 2CGKA 4DB3A 1I3AA 3T1AA 4KI6A 3WXKA 3LANA 5AQXA 3O3HA 4AHUA 1IBKK 5CR4A 4H5RA 2HOEA 3LDNA 3LAMA 4HTLA 1L3VA 4OVLA 1IH7A 1S1TA 2HMIA 2FF3B 4JI1K 3H45C 1RDUA 1WSHA 4KTWA 3TAFA 3KJVA 1HNVA 1ZYQA 1RNHA 1FJGK 3KZBA 3WEEA 3TTFA 4Q5VA 3KVGA 5AQMA 3MWTA 1KAXA 3UB5A 4YOWA 4W5TA 4B9MA 3O5BA 1WAFA 3KLGA 3QB0A 1FKOA 3U8XA 2O8FB 2OZSA 4DLGA 5AQKA 1A5WA 2ZWHA 4AH9A 4OLBA 4CJFA 3L4IA 1NNEA 4CJPA 4FWNA 1W9HA 3G25A 4RW4A 4CCHA 5HRPA 2NRZA 2AA4A 5LMNK 3F9KA 4M7XA 4R79A 3SUNA 4MLEA 2YKMA 2O4GA 3CJAA 3KD5E 1J5EK 1ILYA 4FWMA 3K9KA 4QAGA 5BR9A 3VA0A 1X9JA 4BRFA 1VRTA 4JI7K 3J7YP 3OYAA 2D5RA 4FJGA 3VN5A 2HHWA 4FLWA 3FZKA 5ELZA 3VQ6A 1XHXA 3UKRB 4K8ZA 2ZGYA 2HBLA 1K9MO 1QE1A 5E84A 3HSCA 3QEIA 4NCGA 4DQRA 2CH6A 1HX1A 2XY8A 4C8OA 4A57A 3SZ2A 3FLCO 1JXBA 4CEAA 5CZ2A 4LF4K 3QIPA 1K8KB 3SAGA 4H0VB 3M6GA 3K9JA 2V7ZA 3CERA 4CBXA 3OYGA 3I55N 3HO1A 1TKZA 3FZLA 3OYIA 1DKGD 4FZXC 4BG9A 3G6EN 1XMOK 2HBJA 2ASMA 4B3MK 1LV5A 4H4MA 5JS1A 4JNEA 2DTUA 3CIPA 1SKSA 3C6UA 1XUPO 3C94A 3ZSOA 1XC9A 1VQ7N 4BQZA 5AQSA 4B3OA 1Q18A 1KXPA 3D7EO 3O9RA 4CE9A 1T44A 4F4KA 3OTOK 3SV4A 3ZSXA 4OGEA 4LH5A 4CFBA 3ZT0A 1WSJA 3PUFA 4LF8K 2P9LA 1RT1A 4JKCA 5BPLA 3OYFA 3CCEN 4BC3A 4AQYK 5AZJA 4EIAA 2IVOA 2E2PA 3NHGA 1N32K 1E3MA 3J81O 4GV6A 2E1ZA 4IDHA 4IG0A 4LSLA 2OPSA 3B8AX 3W0LA 2GUPA 4K8XA 1J54A 3QBXA 4K42A 4FJ8A 1OH5A 1DT9A 3FE1A 4BACA 1U4BA 1LWCA 1TAUA 3VF2A 4I2PA 2KFNA 4CD3A 3OBWA 1S1VA 3AAPA 4Z0UA 3C6HA 4IEEA 4N56A 3ZX2A 3WNGA 1U04A 2GUIA 2KFZA 2QM1A 1TVRA 3ZX0A 2ITGA 3I8BA 5M1OA 4B9SA 4CEZA 2WUSA 1LAWA 2HBMA 1C0UA 4ID1A 3OYDA 4DF4A 4FM1A 3QDKA 3S3MA 3TAEA 2B5JA 4PQUA 3NE6A 1YTAA 5C25A 3UIQA 1X3MA 1JLGA 4KPYA 4H0XB 1DTTA 4CFCA 4DV4K 4A62A 2DY4A 1N33K 3ENHA 3V9UA 4EZ9A 5HRRA 3FFIA 3LALA 4FW1A 4M45A 1BO5O 3KIOA 4JKFA 2YI1A 4WFBL 3CCMN 3TAGA 4FWQA 2HF3A 1X9MA 1J9AA 1NGHA 5JS2A 3RWUA 3CC2N 3CMAN 2IGIA 1S9GA 1RT6A 2BDPA 5KGWA 4ZHRA 3CCQN 4DSKA 4M3ZA 1J6ZA 1YJWN 4BR2A 1QZ6A 3P5JA 4W5QA 2P9LB 1VQNN 1VSFA 5HP1A 2B6AA 5AQPA 4W5RA 4DFKA 4OPJA 3QFUA 5EU7A 3MEGA 1YIJN 4HCCA 3TWHA 3RVCA 2E8AA 4JI4K 4BRHA 3AVCA 4Y0WA 4JHDB 4CF2A 1KVAA 3K59A 5JLHA 4NO7A 2OZMA 2GWKA 5AQYA 1SS6A 4DFMA 1WNSA 1BI4B 3CG7A 2GV9A 3LDSA 3MMVA 1X3NA 4Z4FA 3HM8A 4JI5K 2ZJQL 2VWBA 2NNWA 4AHVA 3E9OA 4IJNA 3CCLN 4BRMA 3VEWA 2HBKA 1TKDA 3ZT4A 4CJWA 2QA4N 4PL8A 4BR9A 1L5UA 3ZT3A 3N4QA 3SBGA 5EOYA 4CBWA 2BANA 2YV0X 3SQ4A 4CEDA 1NK0A 4A61A 4FWRA 4H0PA 3GL1A 2P9UB 3BP8A 4B9LA 1K8KA 4CZGA 4A5BA 4H0YB 4UQGA 1UWBA 1ATNA 4CHYA 3C7NA 1IBMK 5JVHL 4BY9C 4IFVA 2JLEA 4NB4A 4B9VA 3WXLA 1I39A 4JI0K 4CESA 1BCOA 4DSIA 1BOTO 2AP1A 3HPGA 4DV7K 2HHTA 1T7PA 4CERA 3MN6A 3O3FA 1VSEA 1KVCA 4FW2A 1QHTA 2HHVA 4CF0A 2D0OA 4DSEA 4A2AA 2IS3A 4BWMA 4I6MB 4BDYA 3KLEA 2OYQA 1JCFA 4KHQA 4X64K 3DOKA 4CF9A 4PWDA 3DYAA 4HHTA 3CYMA 3N4PA 4DTPA 2RPIA 3VEYA 1LCUA 2IIRA 4BDPA 5GADP 2XHBA 4KHYA 1GLCG 3PLAA 2Z1HA 4CZIA 4FZYA 1BIZA 1QSYA 3LDLA 3OW2M 1S6QA 4FJXA 1TL3A 3LDQA 1HPZA 3WEEB 1D8YA 2BE2A 3QEVA 3AVAA 1D4XA 4A2BA 3E1YA 4TSXA 3U4LA 3QMLA 4JKHA 4EZ6A 2VQFK 2ASPA 4HVJA 3NCIA 5AQOA 1CZAN 5BRDA 4RW6A 4JRPA 1C1BA 2DFFA 2DPNA 1OH7A 1VQ4N 5AZIB 1RBSA 2W42A 5C15A 5BRHA 3OBYA 2NRRA 1VQ6N 1FKPA 1QQNA 3WNFA 4CZKA 3DLHA 4PA1A 3VEXA 5D3GA 4CIEA 1NMNA 3RMBA 2OTJN 3MXIA 3V1QA 1SUQA 3L8BA 4DU1A 2BGGA 1U2VA 2KTQA 5MLCQ 4Y1CA 2Q0RA 4DQPA 1R59O 1JL1A 2E2OA 1ESVA 1TYQB
chains in the Genus database with same CATH topology
5CYMA 4E7IA 2OPPA 1WAJA 3BDPA 1WSIA 3V4IA 4PUOA 1G15A 5DK5A 3K5MA 2QKBA 3NF6A 3QNOA 1S6PA 4E3SA 3T3FA 1YT3A 4DFPA 3CFRA 1KLNA 3LP3A 5CYQA 3KK3A 4Z4GA 3OS2A 1FK9A 1HQUA 1RDBA 1D5AA 3P83D 3L3UA 3OYCA 1NJYA 3AVHA 4M3XA 4EP5A 3AO1A 5SZTA 1WSFA 4CK1A 3OYHA 3MAQA 4C8LA 2HVIA 3EYZA 3T19A 2X74A 5HRNA 3E01A 3HK2A 3PO4A 4B08A 4B9UA 3LP0A 3CFPA 4F3TA 4FLZA 2OA8A 3TANA 2G8WA 4J2EA 1R0AA 3AO5A 3KKSA 3V9ZA 3HVRA 1NJZA 3MXJA 2HHXA 3KK1A 1UA1A 4KO0A 1RTDA 3RRGA 1T05A 1O1WA 1QTMA 4L8RB 4FCYA 1VRUA 2ETJA 5T7BA 3SPZA 4M3YA 3ISNC 3RMAA 4I7FA 3P1GA 4NYNA 5FROA 1I3AA 3DLRA 2QK9A 3T1AA 2GBZA 3V9XA 3V81A 4KI6A 3LANA 4ELVA 4R5PA 1BL3A 1C6VA 3O3HA 1NOZA 4AHUA 4O0JA 5J2MA 4KREA 4ELUA 1B92A 4E19A 3V6DA 3LAMA 1L3VA 4OVLA 1HYZA 1QSSA 1IH7A 2HHSA 1SL1A 4CEBA 1HRHA 4JS5A 3LAKA 1S1TA 5CZ1A 3VQ7A 1TK8A 2HMIA 4B8CA 4CJUA 1DLOA 2G8UA 1WSHA 4IFYA 4CJ4A 4KTWA 3TAFA 4N76A 2Z1IA 1LW0A 2YNGA 1IKWA 1HNVA 3V1RA 1WSGA 1ITGA 3DRSA 3KJVA 1RNHA 3V1OA 1ZYQA 3KLHA 1CLQA 2EX3A 3MEDA 4Q5VA 1JLBA 1RBUA 1S1UA 4DS5A 3QEPA 4B9NA 4DFJA 1Q9YA 2FBTA 4W5TA 2X78A 4B9MA 3O3GA 3QLHA 1WAFA 3KLGA 1FKOA 4BE2A 2HNDA 3AO4A 4CK3A 4DTUA 4AHCA 4FJLA 1L3UA 2OZSA 4DSFA 4DLGA 1A5WA 4AH9A 3VQDA 4CHNA 4OLBA 4CJFA 3AVBA 3PY8A 3HSTB 4WE1A 3QIOA 4DTSA 1L3TA 4DQSA 4E1NA 1J53A 1VSJA 2PZSA 1BI4A 4CEOA 4CJPA 1IKVA 1C1AA 4AHSA 1SKWA 3TI0A 2A1RA 3SI6A 1U49A 2NUBA 3DRPA 4KTQA 3AV9A 1W9HA 4RW4A 4CCHA 1YVUA 3TARA 2IDOA 5HRPA 3HT3A 4O4GA 1KLMA 4ELTA 3OYMA 1S9EA 3F9KA 3SUNA 4KB0A 2YKMA 2O4GA 4LY7A 3M8SA 3L2VA 3KD5E 4E7LA 4CJLA 4QAGA 4YFUA 3VA0A 1JLAA 2FBXA 4CF1A 1X9WA 1B9FA 1VRTA 4HUEA 4Q0BA 3OYAA 3VQ8A 2D5RA 4FJGA 3VN5A 4JS4A 2HHWA 4FLWA 4F3OA 3TAPA 4CEEA 3DI6A 3VQ6A 1LAVA 3IAYA 1XHXA 5DMRA 4IBNA 3RRHA 4E7JA 4JLHA 3LWMA 4K8ZA 1ZBIA 1S1WA 1QE1A 4PY5A 3HL8A 4CHOA 3B6PA 3RTVA 1RBTA 3RR7A 2XY5A 3QEIA 4NCGA 4DQRA 4O44A 4MFBA 4DLEA 4QOZB 3TAMA 1U45A 2XY8A 3NGYA 3SUPA 3ITHA 4C8OA 3LPTA 1TK0A 4W5OA 1NK5A 3SZ2A 3VA3A 1RT3A 1Z25A 2KZMA 3NF8A 1JXBA 3ZSRA 4CEAA 5CZ2A 3KKRA 4XIUA 3I0RA 4FJ7A 3VQBA 4BWJA 1Q8IA 2ZE2A 3QIPA 4FK0A 3AVFA 4DTOA 3RR8A 4O5BA 1HYVA 1T03A 2YHBA 2HHQA 3OYGA 3AO2A 3PV8A 4FJNA 4ID5A 3HO1A 4E7KA 4CJRA 1TKZA 1CZ9A 4LH4A 4CJTA 1X1PA 2Q3SA 2HNYA 2KQ2A 3OYIA 4F2RA 3VQQA 4Y1DA 3NGZA 4FZXC 4FXDA 3HPHA 1NK7A 3HYFA 1SKRA 4OPKA 4W5NA 4F8RA 5KI6A 1D9DA 4IDKA 3AO3A 1UAXA 4OKEA 4G1QA 2DFHA 4O55A 1N6QA 2D0BA 2OPQA 2G8HA 2PY5A 2QKKA 3DLEA 3AVGA 1BQMA 1LV5A 4OGCA 4H4MA 3ASMA 4GW6A 5JS1A 4DWIA 5C24A 2DTUA 1SKSA 3C6UA 5I3UA 2XO7A 4OJRA 3C94A 3ZSOA 2IOCA 3LP2A 3ZSYA 3I0SA 4BE0A 1XC9A 2WOMA 3HP9A 4KTZA 1LWEA 4CIFA 1TK5A 2ATQA 1IKXA 1VSIA 4E0DA 4IKFA 1MU2A 4H8KA 4B3OA 5KRSA 4CE9A 3OY9A 4F4KA 4HUGA 1HMVA 3MECA 3ZSXA 1TL1A 4HUFA 3SV4A 2Z1JA 5HLFA 3H08A 1T8EA 4OGEA 1RDCA 4FVMA 2G8VA 2F8SA 4LH5A 3NH2A 1WN7A 1XHZA 4CFBA 3ZT0A 4FJKA 1WSJA 1NKBA 3PUFA 3K57A 3DOLA 4HTUA 4N47A 4CHPA 4FLYA 1RT1A 3B6OA 3OJSA 3VQ4A 3OYFA 3L2UA 3WNEA 4DQQA 4Z4CA 3K5NA 4FLVA 2G8KA 4DF8A 1JLCA 2E6LA 3NHGA 1GOBA 1GOCA 4DTXA 1JL2A 3EZ5A 3ZCMA 3KLFA 1Q9XA 4RW9A 4DTJA 2VWKA 1RT2A 1K6YA 1TAQA 3NFAA 3L2WA 4C8KA 3DMJA 4CEFA 3HM9A 3OYJA 3VQCA 1U48A 2WONA 4IG0A 1NJXA 4LSLA 4FJMA 1TV6A 1Y97A 2OPSA 3ZSZA 3QEXA 4RG8A 3SJJA 4DQIA 1J54A 4F2SA 1RBRA 4K8XA 4M42A 2RN2A 1X9SA 4FJ8A 2IC3A 5E41A 1JLQA 3AA3A 3ALYA 3DLKA 3NH0A 3NGIA 4BACA 2RKIA 1U4BA 2F96A 3CFOA 3DLGA 1U47A 1A5VA 1LWCA 4M3TA 5FRMA 1TAUA 2E6MA 3OYBA 4Z4HA 4I2PA 3VQAA 3LZJA 1QQCA 2KFNA 1S1VA 4Z0UA 4N56A 1N5YA 1KSPA 4M3UA 3WNGA 1HYSA 4DS4A 1U04A 2GUIA 2KFZA 1KRPA 3D45A 1TVRA 4CHQA 2ITGA 4B9SA 4CEZA 2AJQA 4JRQA 2KZZA 1LAWA 3L3VA 3ZT2A 3DLBA 1C0UA 4ID1A 1UOCA 3OS0A 3OYDA 1HJRA 4DU3A 1ZBFA 2HNZA 2B4JA 4DF4A 4FK2A 4NCAA 3SPYA 4FM1A 1GOAA 1KVBA 3DRRA 3NH1A 2HW3A 3PX0A 4DTMA 3TAEA 2B5JA 3L2RA 3NE6A 3S3MA 1YTAA 5C25A 3F73A 1JXEA 2P5OA 4CGHA 3UIQA 1CXUA 4KHSA 1JLGA 1RTJA 4KPYA 1VK0A 1DTTA 4CFCA 2DY4A 4J2AA 4J2DA 1WSEA 3D0PA 3V9UA 1ZBLA 1F21A 1BIUA 3HXMA 2E4LA 2P1JA 2XY7A 1NK8A 4EZ9A 5HRRA 3IG1A 3FFIA 3LALA 2FC0A 3TABA 4FW1A 4M45A 4CFDA 3KIOA 4B8AB 1RT7A 4I2QA 3TAGA 3KTQA 1X9MA 1J9AA 5JS2A 1VSKA 3AVJA 3RWUA 2VWJA 2IGIA 1S9GA 2KW4A 1RT6A 4DMNA 2BDPA 4FLTA 4M41A 5KGWA 4ZHRA 4DSKA 4M3ZA 4ZTJA 4Z4EA 4B9TA 1BGXT 3NF9A 4OKKA 3SCXA 4I9QA 5K14A 3P5JA 4W5QA 3QEWA 3LWLA 4H4OA 3O4QA 3K5LA 4FM0A 1VSFA 1SL2A 1LWFA 1ASVA 3ZSQA 4CF8A 3PX6A 5HP1A 2B6AA 4W5RA 4DFKA 3EY1A 4OPJA 5EU7A 4KAZA 3MEGA 4FLUA 4HCCA 1JLEA 3TWHA 4FLXA 2VG5A 2HHUA 1NKEA 4CGGA 4FK4A 1EETA 3AVCA 3HVTA 3DM2A 4CF2A 3U6FA 1KVAA 3QINA 3K59A 3HPOA 2XRIA 4CHZA 2OZMA 3VQPA 3OJUA 5CY4A 4CJ3A 4E1MA 1WNSA 1BI4B 3CG7A 4IG3A 3WNHA 2GV9A 4DFMA 3MXMA 2PYJA 3PO5A 4KHWA 3K58A 4YNQA 3ULDA 4CJEA 1SL0A 4CGDA 4GVMA 4OKJA 4CGFA 3LDSA 3LPUA 4O0IA 4ZTFA 4KFBA 2FBVA 4FJIA 4HCBA 4Z4FA 3IRXA 3S3NA 1NKCA 3AA4A 2XY6A 4CGJA 2G8FA 1BCMA 3OYEA 1EXQA 4AHRA 4AHVA 3L2QA 3C6TA 1WLJA 2YKNA 3AVMA 4KRFA 1HQEA 4QCLA 1KFDA 2VG6A 1KCFA 4GMJB 4CGIA 1TKDA 3ZT4A 1JKHA 4CJWA 1L5UA 4FJ9A 4CJKA 4KHNA 3ZT3A 1D9FA 4N41A 1EP4A 1C0TA 4I9LA 1XWLA 4FJJA 2BANA 2YV0X 4FZZA 3SQ4A 4CEDA 1NJWA 1NK0A 2HB5A 3JYTA 4CEQA 3PX4A 1A5XA 3OYNA 5HRSA 3THVA 1C0MA 4B9LA 3MEEA 4KHUA 3KD1E 4DTNA 2X6SA 4M3WA 4UQGA 1RTHA 1UWBA 4DSJA 3VQ9A 3OYKA 3ZSWA 4CHYA 2P5GA 2RF2A 2HVHA 1S5JA 3AVNA 1NOYA 1VSMA 3G0ZA 2DFEA 3V9SA 4IFVA 4DG1A 1IO2A 1BISA 5HBMA 4NCBA 2JLEA 4MQ3A 5I42A 2Y1IA 4B9VA 4C8MA 3SUQA 1ASUA 4AHTA 3ZT1A 3SNNA 1I39A 2D0CA 4CESA 1C1CA 4FJHA 1UA0A 3SV3A 1BCOA 4DSIA 3I8DA 1VSLA 3OYLA 5FRNA 4KI4A 4E89A 1CXQA 4LSNA 1IG9A 3HPGA 5C42A 1RCHA 3KK2A 3NDKA 2HHTA 1VSDA 1EKEA 5HROA 1ZBHA 1T7PA 3SQ2A 4CERA 4CJVA 4KKOA 3KLIA 1CZBA 3O3FA 1NK4A 1J5OA 1VSEA 1KVCA 3LP1A 1QHTA 1RBVA 2IAJA 4FW2A 3RMCA 3RMDA 2HHVA 3G10A 4CF0A 4LD0A 4DSEA 3CM6A 2IS3A 3TR8A 4BWMA 3ZSVA 3S9HA 3AA5X 1YTUA 3NBPA 2YHAA 1JLFA 3JSMA 4BDYA 3U3GA 3KLEA 1LW2A 2R7YA 2PYLA 2OYQA 4KHQA 3DOKA 2O4IA 4CF9A 2YNIA 1QS4A 4PWDA 2Y1JA 4C8NA 3DYAA 2JGUA 1S1XA 3A2FA 4HHTA 3CYMA 4KV8A 3M8RA 1RTIA 1TKTA 2EHGA 2YNHA 1RILA 3K2PA 5KGXA 2RPIA 4DTPA 4BDPA 1ASWA 3V9WA 1W0HA 2XHBA 4KHYA 2ZD1A 4FM2A 5J2NA 3S3OA 4FJ5A 3CQ8A 3SQ1A 1RT4A 3O4NA 4CFAA 2Z1HA 2YNFA 4FZYA 1BIZA 1QSYA 1RDDA 3SYZA 3HP6A 2OPRA 1KFSA 3CM5A 2P51A 4EP4A 3BGRA 1S6QA 4FJXA 4PQUA 1TL3A 3SQ0A 1NK6A 3LZIA 1HPZA 3VQ5A 1D8YA 3VQEA 3NAEA 2F8TA 1QSLA 3OVNA 2BE2A 3AVKA 3M8QA 3QEVA 3AVAA 1REVA 4CK2A 1L3SA 4OLAA 1HNIA 4E7HA 4TSXA 5J1EA 3OS1A 4EZ6A 5J2PA 4FYDA 4RW7A 1ZBUA 4HVJA 3NCIA 1B9DA 4AILC 1Z26A 5FDLA 1RDAA 4CECA 3AA2A 4CIGA 4RW6A 4JRPA 1C1BA 2DFFA 4ICLA 4NYFA 3QESA 2Z1GA 1RBSA 2W42A 4DSLA 2A1SA 3IS9A 1DTQA 2G8IA 2I5JA 1RT5A 3QETA 1NK9A 1FKPA 3WNFA 4CJ5A 4CJQA 3DLHA 2ZQBA 3K5OA 4PA1A 4Z4IA 3QNNA 1EX4A 1TGOA 5D3GA 4CIEA 3RMBA 1BHLA 1XI1A 2QXFA 3MXIA 5KRTA 3AVLA 3HJFA 2X6NA 3QO9A 4RW8A 3V1QA 1SV5A 1SUQA 3C95A 1VSHA 4KB1A 3U3YA 3TAQA 3L8BA 1TKXA 3QERA 4N5SA 4DU1A 3SUOA 2BGGA 2KTQA 4CJSA 3AVIA 4BE1A 2VG7A 4Y1CA 3M8PA 1FXXA 5SWMA 4DQPA 5KTQA 4DTRA 1JL1A 2LSNA 1IKYA 4BDZA 5J2QA 2D0AA 3NF7A 4J2BA 1BQNA 4M3RA 2FBYA 4DU4A 1KTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CYM A;  4E7I A;  2OPP A;  1WAJ A;  3BDP A;  1WSI A;  3V4I A;  4PUO A;  1G15 A;  5DK5 A;  3K5M A;  2QKB A;  3NF6 A;  3QNO A;  1S6P A;  4E3S A;  3T3F A;  1YT3 A;  4DFP A;  3CFR A;  1KLN A;  3LP3 A;  5CYQ A;  3KK3 A;  4Z4G A;  3OS2 A;  1FK9 A;  1HQU A;  1RDB A;  1D5A A;  3P83 D;  3L3U A;  3OYC A;  1NJY A;  3AVH A;  4M3X A;  4EP5 A;  3AO1 A;  5SZT A;  1WSF A;  4CK1 A;  3OYH A;  3MAQ A;  4C8L A;  2HVI A;  3EYZ A;  3T19 A;  2X74 A;  5HRN A;  3E01 A;  3HK2 A;  3PO4 A;  4B08 A;  4B9U A;  3LP0 A;  3CFP A;  4F3T A;  4FLZ A;  2OA8 A;  3TAN A;  2G8W A;  4J2E A;  1R0A A;  3AO5 A;  3KKS A;  3V9Z A;  3HVR A;  1NJZ A;  3MXJ A;  2HHX A;  3KK1 A;  1UA1 A;  4KO0 A;  1RTD A;  3RRG A;  1T05 A;  1O1W A;  1QTM A;  4L8R B;  4FCY A;  1VRU A;  2ETJ A;  5T7B A;  3SPZ A;  4M3Y A;  3ISN C;  3RMA A;  4I7F A;  3P1G A;  4NYN A;  5FRO A;  1I3A A;  3DLR A;  2QK9 A;  3T1A A;  2GBZ A;  3V9X A;  3V81 A;  4KI6 A;  3LAN A;  4ELV A;  4R5P A;  1BL3 A;  1C6V A;  3O3H A;  1NOZ A;  4AHU A;  4O0J A;  5J2M A;  4KRE A;  4ELU A;  1B92 A;  4E19 A;  3V6D A;  3LAM A;  1L3V A;  4OVL A;  1HYZ A;  1QSS A;  1IH7 A;  2HHS A;  1SL1 A;  4CEB A;  1HRH A;  4JS5 A;  3LAK A;  1S1T A;  5CZ1 A;  3VQ7 A;  1TK8 A;  2HMI A;  4B8C A;  4CJU A;  1DLO A;  2G8U A;  1WSH A;  4IFY A;  4CJ4 A;  4KTW A;  3TAF A;  4N76 A;  2Z1I A;  1LW0 A;  2YNG A;  1IKW A;  1HNV A;  3V1R A;  1WSG A;  1ITG A;  3DRS A;  3KJV A;  1RNH A;  3V1O A;  1ZYQ A;  3KLH A;  1CLQ A;  2EX3 A;  3MED A;  4Q5V A;  1JLB A;  1RBU A;  1S1U A;  4DS5 A;  3QEP A;  4B9N A;  4DFJ A;  1Q9Y A;  2FBT A;  4W5T A;  2X78 A;  4B9M A;  3O3G A;  3QLH A;  1WAF A;  3KLG A;  1FKO A;  4BE2 A;  2HND A;  3AO4 A;  4CK3 A;  4DTU A;  4AHC A;  4FJL A;  1L3U A;  2OZS A;  4DSF A;  4DLG A;  1A5W A;  4AH9 A;  3VQD A;  4CHN A;  4OLB A;  4CJF A;  3AVB A;  3PY8 A;  3HST B;  4WE1 A;  3QIO A;  4DTS A;  1L3T A;  4DQS A;  4E1N A;  1J53 A;  1VSJ A;  2PZS A;  1BI4 A;  4CEO A;  4CJP A;  1IKV A;  1C1A A;  4AHS A;  1SKW A;  3TI0 A;  2A1R A;  3SI6 A;  1U49 A;  2NUB A;  3DRP A;  4KTQ A;  3AV9 A;  1W9H A;  4RW4 A;  4CCH A;  1YVU A;  3TAR A;  2IDO A;  5HRP A;  3HT3 A;  4O4G A;  1KLM A;  4ELT A;  3OYM A;  1S9E A;  3F9K A;  3SUN A;  4KB0 A;  2YKM A;  2O4G A;  4LY7 A;  3M8S A;  3L2V A;  3KD5 E;  4E7L A;  4CJL A;  4QAG A;  4YFU A;  3VA0 A;  1JLA A;  2FBX A;  4CF1 A;  1X9W A;  1B9F A;  1VRT A;  4HUE A;  4Q0B A;  3OYA A;  3VQ8 A;  2D5R A;  4FJG A;  3VN5 A;  4JS4 A;  2HHW A;  4FLW A;  4F3O A;  3TAP A;  4CEE A;  3DI6 A;  3VQ6 A;  1LAV A;  3IAY A;  1XHX A;  5DMR A;  4IBN A;  3RRH A;  4E7J A;  4JLH A;  3LWM A;  4K8Z A;  1ZBI A;  1S1W A;  1QE1 A;  4PY5 A;  3HL8 A;  4CHO A;  3B6P A;  3RTV A;  1RBT A;  3RR7 A;  2XY5 A;  3QEI A;  4NCG A;  4DQR A;  4O44 A;  4MFB A;  4DLE A;  4QOZ B;  3TAM A;  1U45 A;  2XY8 A;  3NGY A;  3SUP A;  3ITH A;  4C8O A;  3LPT A;  1TK0 A;  4W5O A;  1NK5 A;  3SZ2 A;  3VA3 A;  1RT3 A;  1Z25 A;  2KZM A;  3NF8 A;  1JXB A;  3ZSR A;  4CEA A;  5CZ2 A;  3KKR A;  4XIU A;  3I0R A;  4FJ7 A;  3VQB A;  4BWJ A;  1Q8I A;  2ZE2 A;  3QIP A;  4FK0 A;  3AVF A;  4DTO A;  3RR8 A;  4O5B A;  1HYV A;  1T03 A;  2YHB A;  2HHQ A;  3OYG A;  3AO2 A;  3PV8 A;  4FJN A;  4ID5 A;  3HO1 A;  4E7K A;  4CJR A;  1TKZ A;  1CZ9 A;  4LH4 A;  4CJT A;  1X1P A;  2Q3S A;  2HNY A;  2KQ2 A;  3OYI A;  4F2R A;  3VQQ A;  4Y1D A;  3NGZ A;  4FZX C;  4FXD A;  3HPH A;  1NK7 A;  3HYF A;  1SKR A;  4OPK A;  4W5N A;  4F8R A;  5KI6 A;  1D9D A;  4IDK A;  3AO3 A;  1UAX A;  4OKE A;  4G1Q A;  2DFH A;  4O55 A;  1N6Q A;  2D0B A;  2OPQ A;  2G8H A;  2PY5 A;  2QKK A;  3DLE A;  3AVG A;  1BQM A;  1LV5 A;  4OGC A;  4H4M A;  3ASM A;  4GW6 A;  5JS1 A;  4DWI A;  5C24 A;  2DTU A;  1SKS A;  3C6U A;  5I3U A;  2XO7 A;  4OJR A;  3C94 A;  3ZSO A;  2IOC A;  3LP2 A;  3ZSY A;  3I0S A;  4BE0 A;  1XC9 A;  2WOM A;  3HP9 A;  4KTZ A;  1LWE A;  4CIF A;  1TK5 A;  2ATQ A;  1IKX A;  1VSI A;  4E0D A;  4IKF A;  1MU2 A;  4H8K A;  4B3O A;  5KRS A;  4CE9 A;  3OY9 A;  4F4K A;  4HUG A;  1HMV A;  3MEC A;  3ZSX A;  1TL1 A;  4HUF A;  3SV4 A;  2Z1J A;  5HLF A;  3H08 A;  1T8E A;  4OGE A;  1RDC A;  4FVM A;  2G8V A;  2F8S A;  4LH5 A;  3NH2 A;  1WN7 A;  1XHZ A;  4CFB A;  3ZT0 A;  4FJK A;  1WSJ A;  1NKB A;  3PUF A;  3K57 A;  3DOL A;  4HTU A;  4N47 A;  4CHP A;  4FLY A;  1RT1 A;  3B6O A;  3OJS A;  3VQ4 A;  3OYF A;  3L2U A;  3WNE A;  4DQQ A;  4Z4C A;  3K5N A;  4FLV A;  2G8K A;  4DF8 A;  1JLC A;  2E6L A;  3NHG A;  1GOB A;  1GOC A;  4DTX A;  1JL2 A;  3EZ5 A;  3ZCM A;  3KLF A;  1Q9X A;  4RW9 A;  4DTJ A;  2VWK A;  1RT2 A;  1K6Y A;  1TAQ A;  3NFA A;  3L2W A;  4C8K A;  3DMJ A;  4CEF A;  3HM9 A;  3OYJ A;  3VQC A;  1U48 A;  2WON A;  4IG0 A;  1NJX A;  4LSL A;  4FJM A;  1TV6 A;  1Y97 A;  2OPS A;  3ZSZ A;  3QEX A;  4RG8 A;  3SJJ A;  4DQI A;  1J54 A;  4F2S A;  1RBR A;  4K8X A;  4M42 A;  2RN2 A;  1X9S A;  4FJ8 A;  2IC3 A;  5E41 A;  1JLQ A;  3AA3 A;  3ALY A;  3DLK A;  3NH0 A;  3NGI A;  4BAC A;  2RKI A;  1U4B A;  2F96 A;  3CFO A;  3DLG A;  1U47 A;  1A5V A;  1LWC A;  4M3T A;  5FRM A;  1TAU A;  2E6M A;  3OYB A;  4Z4H A;  4I2P A;  3VQA A;  3LZJ A;  1QQC A;  2KFN A;  1S1V A;  4Z0U A;  4N56 A;  1N5Y A;  1KSP A;  4M3U A;  3WNG A;  1HYS A;  4DS4 A;  1U04 A;  2GUI A;  2KFZ A;  1KRP A;  3D45 A;  1TVR A;  4CHQ A;  2ITG A;  4B9S A;  4CEZ A;  2AJQ A;  4JRQ A;  2KZZ A;  1LAW A;  3L3V A;  3ZT2 A;  3DLB A;  1C0U A;  4ID1 A;  1UOC A;  3OS0 A;  3OYD A;  1HJR A;  4DU3 A;  1ZBF A;  2HNZ A;  2B4J A;  4DF4 A;  4FK2 A;  4NCA A;  3SPY A;  4FM1 A;  1GOA A;  1KVB A;  3DRR A;  3NH1 A;  2HW3 A;  3PX0 A;  4DTM A;  3TAE A;  2B5J A;  3L2R A;  3NE6 A;  3S3M A;  1YTA A;  5C25 A;  3F73 A;  1JXE A;  2P5O A;  4CGH A;  3UIQ A;  1CXU A;  4KHS A;  1JLG A;  1RTJ A;  4KPY A;  1VK0 A;  1DTT A;  4CFC A;  2DY4 A;  4J2A A;  4J2D A;  1WSE A;  3D0P A;  3V9U A;  1ZBL A;  1F21 A;  1BIU A;  3HXM A;  2E4L A;  2P1J A;  2XY7 A;  1NK8 A;  4EZ9 A;  5HRR A;  3IG1 A;  3FFI A;  3LAL A;  2FC0 A;  3TAB A;  4FW1 A;  4M45 A;  4CFD A;  3KIO A;  4B8A B;  1RT7 A;  4I2Q A;  3TAG A;  3KTQ A;  1X9M A;  1J9A A;  5JS2 A;  1VSK A;  3AVJ A;  3RWU A;  2VWJ A;  2IGI A;  1S9G A;  2KW4 A;  1RT6 A;  4DMN A;  2BDP A;  4FLT A;  4M41 A;  5KGW A;  4ZHR A;  4DSK A;  4M3Z A;  4ZTJ A;  4Z4E A;  4B9T A;  1BGX T;  3NF9 A;  4OKK A;  3SCX A;  4I9Q A;  5K14 A;  3P5J A;  4W5Q A;  3QEW A;  3LWL A;  4H4O A;  3O4Q A;  3K5L A;  4FM0 A;  1VSF A;  1SL2 A;  1LWF A;  1ASV A;  3ZSQ A;  4CF8 A;  3PX6 A;  5HP1 A;  2B6A A;  4W5R A;  4DFK A;  3EY1 A;  4OPJ A;  5EU7 A;  4KAZ A;  3MEG A;  4FLU A;  4HCC A;  1JLE A;  3TWH A;  4FLX A;  2VG5 A;  2HHU A;  1NKE A;  4CGG A;  4FK4 A;  1EET A;  3AVC A;  3HVT A;  3DM2 A;  4CF2 A;  3U6F A;  1KVA A;  3QIN A;  3K59 A;  3HPO A;  2XRI A;  4CHZ A;  2OZM A;  3VQP A;  3OJU A;  5CY4 A;  4CJ3 A;  4E1M A;  1WNS A;  1BI4 B;  3CG7 A;  4IG3 A;  3WNH A;  2GV9 A;  4DFM A;  3MXM A;  2PYJ A;  3PO5 A;  4KHW A;  3K58 A;  4YNQ A;  3ULD A;  4CJE A;  1SL0 A;  4CGD A;  4GVM A;  4OKJ A;  4CGF A;  3LDS A;  3LPU A;  4O0I A;  4ZTF A;  4KFB A;  2FBV A;  4FJI A;  4HCB A;  4Z4F A;  3IRX A;  3S3N A;  1NKC A;  3AA4 A;  2XY6 A;  4CGJ A;  2G8F A;  1BCM A;  3OYE A;  1EXQ A;  4AHR A;  4AHV A;  3L2Q A;  3C6T A;  1WLJ A;  2YKN A;  3AVM A;  4KRF A;  1HQE A;  4QCL A;  1KFD A;  2VG6 A;  1KCF A;  4GMJ B;  4CGI A;  1TKD A;  3ZT4 A;  1JKH A;  4CJW A;  1L5U A;  4FJ9 A;  4CJK A;  4KHN A;  3ZT3 A;  1D9F A;  4N41 A;  1EP4 A;  1C0T A;  4I9L A;  1XWL A;  4FJJ A;  2BAN A;  2YV0 X;  4FZZ A;  3SQ4 A;  4CED A;  1NJW A;  1NK0 A;  2HB5 A;  3JYT A;  4CEQ A;  3PX4 A;  1A5X A;  3OYN A;  5HRS A;  3THV A;  1C0M A;  4B9L A;  3MEE A;  4KHU A;  3KD1 E;  4DTN A;  2X6S A;  4M3W A;  4UQG A;  1RTH A;  1UWB A;  4DSJ A;  3VQ9 A;  3OYK A;  3ZSW A;  4CHY A;  2P5G A;  2RF2 A;  2HVH A;  1S5J A;  3AVN A;  1NOY A;  1VSM A;  3G0Z A;  2DFE A;  3V9S A;  4IFV A;  4DG1 A;  1IO2 A;  1BIS A;  5HBM A;  4NCB A;  2JLE A;  4MQ3 A;  5I42 A;  2Y1I A;  4B9V A;  4C8M A;  3SUQ A;  1ASU A;  4AHT A;  3ZT1 A;  3SNN A;  1I39 A;  2D0C A;  4CES A;  1C1C A;  4FJH A;  1UA0 A;  3SV3 A;  1BCO A;  4DSI A;  3I8D A;  1VSL A;  3OYL A;  5FRN A;  4KI4 A;  4E89 A;  1CXQ A;  4LSN A;  1IG9 A;  3HPG A;  5C42 A;  1RCH A;  3KK2 A;  3NDK A;  2HHT A;  1VSD A;  1EKE A;  5HRO A;  1ZBH A;  1T7P A;  3SQ2 A;  4CER A;  4CJV A;  4KKO A;  3KLI A;  1CZB A;  3O3F A;  1NK4 A;  1J5O A;  1VSE A;  1KVC A;  3LP1 A;  1QHT A;  1RBV A;  2IAJ A;  4FW2 A;  3RMC A;  3RMD A;  2HHV A;  3G10 A;  4CF0 A;  4LD0 A;  4DSE A;  3CM6 A;  2IS3 A;  3TR8 A;  4BWM A;  3ZSV A;  3S9H A;  3AA5 X;  1YTU A;  3NBP A;  2YHA A;  1JLF A;  3JSM A;  4BDY A;  3U3G A;  3KLE A;  1LW2 A;  2R7Y A;  2PYL A;  2OYQ A;  4KHQ A;  3DOK A;  2O4I A;  4CF9 A;  2YNI A;  1QS4 A;  4PWD A;  2Y1J A;  4C8N A;  3DYA A;  2JGU A;  1S1X A;  3A2F A;  4HHT A;  3CYM A;  4KV8 A;  3M8R A;  1RTI A;  1TKT A;  2EHG A;  2YNH A;  1RIL A;  3K2P A;  5KGX A;  2RPI A;  4DTP A;  4BDP A;  1ASW A;  3V9W A;  1W0H A;  2XHB A;  4KHY A;  2ZD1 A;  4FM2 A;  5J2N A;  3S3O A;  4FJ5 A;  3CQ8 A;  3SQ1 A;  1RT4 A;  3O4N A;  4CFA A;  2Z1H A;  2YNF A;  4FZY A;  1BIZ A;  1QSY A;  1RDD A;  3SYZ A;  3HP6 A;  2OPR A;  1KFS A;  3CM5 A;  2P51 A;  4EP4 A;  3BGR A;  1S6Q A;  4FJX A;  4PQU A;  1TL3 A;  3SQ0 A;  1NK6 A;  3LZI A;  1HPZ A;  3VQ5 A;  1D8Y A;  3VQE A;  3NAE A;  2F8T A;  1QSL A;  3OVN A;  2BE2 A;  3AVK A;  3M8Q A;  3QEV A;  3AVA A;  1REV A;  4CK2 A;  1L3S A;  4OLA A;  1HNI A;  4E7H A;  4TSX A;  5J1E A;  3OS1 A;  4EZ6 A;  5J2P A;  4FYD A;  4RW7 A;  1ZBU A;  4HVJ A;  3NCI A;  1B9D A;  4AIL C;  1Z26 A;  5FDL A;  1RDA A;  4CEC A;  3AA2 A;  4CIG A;  4RW6 A;  4JRP A;  1C1B A;  2DFF A;  4ICL A;  4NYF A;  3QES A;  2Z1G A;  1RBS A;  2W42 A;  4DSL A;  2A1S A;  3IS9 A;  1DTQ A;  2G8I A;  2I5J A;  1RT5 A;  3QET A;  1NK9 A;  1FKP A;  3WNF A;  4CJ5 A;  4CJQ A;  3DLH A;  2ZQB A;  3K5O A;  4PA1 A;  4Z4I A;  3QNN A;  1EX4 A;  1TGO A;  5D3G A;  4CIE A;  3RMB A;  1BHL A;  1XI1 A;  2QXF A;  3MXI A;  5KRT A;  3AVL A;  3HJF A;  2X6N A;  3QO9 A;  4RW8 A;  3V1Q A;  1SV5 A;  1SUQ A;  3C95 A;  1VSH A;  4KB1 A;  3U3Y A;  3TAQ A;  3L8B A;  1TKX A;  3QER A;  4N5S A;  4DU1 A;  3SUO A;  2BGG A;  2KTQ A;  4CJS A;  3AVI A;  4BE1 A;  2VG7 A;  4Y1C A;  3M8P A;  1FXX A;  5SWM A;  4DQP A;  5KTQ A;  4DTR A;  1JL1 A;  2LSN A;  1IKY A;  4BDZ A;  5J2Q A;  2D0A A;  3NF7 A;  4J2B A;  1BQN A;  4M3R A;  2FBY A;  4DU4 A;  1KTQ A; 
#chains in the Genus database with same CATH topology
 2PBD A;  4E7I A;  3O1W A;  4B3T K;  2UYT A;  1QVG M;  5M1Q A;  1WSI A;  3VOV A;  3V4I A;  4PUO A;  3K5M A;  4BVP A;  2QWP A;  3T3F A;  4DFP A;  3CFR A;  3LP3 A;  1Z6R A;  4Z4G A;  3L3U A;  3AVH A;  4EP5 A;  4C23 A;  3E01 A;  3HTV A;  3LP0 A;  4F3T A;  4LFA K;  3TAN A;  3KKS A;  2CH5 A;  2P9S B;  3KK1 A;  1UA1 A;  3C0B A;  4BRE A;  4FCY A;  5T7B A;  3WUH A;  3P1G A;  5FRO A;  3VEN A;  4CZE A;  4EHT A;  2QI2 A;  1K73 O;  4WFA L;  2QK9 A;  3FZH A;  3V81 A;  3ID6 A;  1BL3 A;  1NOZ A;  4O0J A;  2ZM6 K;  4KRE A;  1S3X A;  3VF6 A;  4JK9 A;  4B1Z A;  1HYZ A;  1NU0 A;  2HHS A;  4WCE L;  5GIO A;  1HRH A;  1BA1 A;  4LF6 K;  3VQ7 A;  4AM6 A;  1TK8 A;  4B8C A;  2G8U A;  4IFY A;  4CJ4 A;  2FSN A;  2YNG A;  3R9P A;  4JKB A;  2NRT A;  4B1W B;  2HHH K;  1CLQ A;  1JLB A;  1RBU A;  1S1U A;  4DFJ A;  3ZET B;  2FLO A;  2X78 A;  4H5N A;  1BUP A;  1XMQ K;  4DTU A;  4BRI A;  3VF4 A;  5GAH P;  4CHN A;  3VQD A;  2O8E A;  3M1F A;  3HST B;  2V52 B;  3QIO A;  4WE1 A;  4WQ4 C;  1L3T A;  5JLF A;  4DQS A;  4E1N A;  1J53 A;  1VSJ A;  2CGL A;  4CEO A;  1C1A A;  4AHS A;  3ID8 A;  3SMP A;  1U49 A;  4KTQ A;  3AV9 A;  1YVU A;  3TAR A;  2IDO A;  3ENB A;  4O4G A;  1KLM A;  4ELT A;  1C0G A;  3H6E A;  3TSP A;  3M8S A;  3L2V A;  5AQI A;  1HNX K;  3AAQ A;  4FWL A;  5A2Q O;  2E2N A;  4YFU A;  3ENO A;  4CF1 A;  1NGA A;  2FBX A;  1X9W A;  4Q0B A;  3IKM A;  3ZLJ A;  4F3O A;  3TAP A;  3O4W A;  1LAV A;  3IAY A;  4IBN A;  5LL6 Z;  4JLH A;  3LWM A;  1ZBI A;  1S1W A;  3RR7 A;  3P4I A;  4GV3 A;  4O44 A;  4MFB A;  4DLE A;  4IFE A;  1U45 A;  3FGU A;  3ITH A;  3SUP A;  2RHK A;  3LPT A;  3VA3 A;  1RT3 A;  1Z25 A;  3FFK B;  2KZM A;  4BRD A;  1VQ5 N;  1NGF A;  2ZE2 A;  3LDP A;  4YOU A;  4GVE A;  4CJ7 A;  4FK0 A;  1HUX A;  1OH8 A;  2YHB A;  2HHQ A;  4AF1 A;  3AO2 A;  4ID5 A;  4CJR A;  4LH4 A;  1X1P A;  3SJH A;  2Q3S A;  2KQ2 A;  1N34 K;  1IJJ A;  4F2R A;  2WBN A;  3HYF A;  1HNW K;  1UAX A;  4BRC A;  2DFH A;  2CGJ A;  2PY5 A;  2G8H A;  5AQW A;  2QKK A;  1BQM A;  3VEV A;  1NGE A;  3OHR A;  4PL7 A;  4K43 A;  5I3U A;  2XO7 A;  4OJR A;  2IOC A;  3LP2 A;  4QS9 A;  3I0S A;  3ZSY A;  3CJ7 A;  3UKU B;  4CIF A;  2VQE K;  5C0Y A;  4IOX A;  1TK5 A;  4IKF A;  1MU2 A;  3CJB A;  4O8K A;  5KRS A;  3OY9 A;  1VQK N;  3NH2 A;  3DXM A;  4FJK A;  3O8M A;  4CHP A;  1IG8 A;  3CC4 N;  3OJS A;  4CZL A;  3K5N A;  1SAZ A;  3DXM B;  2G8K A;  4CBU A;  1JLC A;  2E6L A;  4DCH A;  3L0Q A;  4DTX A;  1JL2 A;  3EZ5 A;  3ZCM A;  1EO1 A;  3KLF A;  1Q9X A;  4RW9 A;  4DTJ A;  2VWK A;  4U67 L;  1HR0 K;  3ATU A;  4CEF A;  4DKW A;  1NJX A;  3ZSZ A;  2V51 B;  2O8D B;  3R8E A;  3T7Z A;  3QEX A;  3SJJ A;  1VQO N;  2RN2 A;  1VQ9 N;  2IC3 A;  1JLQ A;  3AA3 A;  3ALY A;  3DLK A;  4DR2 K;  4YOY A;  2RKI A;  4BC5 A;  4OO1 J;  2F96 A;  3CFO A;  1U47 A;  4RTF D;  1A5V A;  4M3T A;  5FRM A;  1BA0 A;  2E6M A;  1NMD A;  4Z4H A;  3VQA A;  1YI2 N;  4M3U A;  3HOT A;  4DS4 A;  2F4V K;  4FOE A;  4CHQ A;  4QS7 A;  2OAN A;  4JRQ A;  3ZT2 A;  4DR3 K;  4DU3 A;  2HNZ A;  4BRA A;  2B4J A;  3WXJ A;  5CE3 A;  4B9Q A;  1GLD G;  3DRR A;  3L2R A;  3PIO L;  4KHS A;  1RTJ A;  4BRP A;  4WQ4 A;  4J2D A;  1WSE A;  3D0P A;  2YHW A;  3VEZ A;  3IG1 A;  2F9W A;  1GLF O;  3D2E B;  2VWJ A;  4FOI A;  4FLT A;  4M41 A;  2RE2 A;  4B9T A;  4BR0 A;  3VGK A;  3SCX A;  4LF5 K;  3QEW A;  3LWL A;  4H4O A;  4FM0 A;  1O13 A;  2Q97 A;  3PX6 A;  3EY1 A;  4KAZ A;  3CCU N;  4FLU A;  4FLX A;  4H0T B;  2HHU A;  4FK4 A;  1EET A;  1WUA A;  3DXK B;  3QIN A;  4DV3 K;  2XRI A;  4M7Y A;  4CHZ A;  4BRN A;  5CY4 A;  5I42 A;  3MXM A;  1HKG A;  3PO5 A;  4KHW A;  2PYJ A;  1OH6 A;  5IT9 O;  4WQ5 C;  4OKJ A;  3CJ9 A;  3EKU A;  3LPU A;  3O6W A;  5AQZ A;  4FJI A;  4IOA L;  3Q7B A;  3S3N A;  1YJ9 N;  2D0P A;  2Q2R A;  4A5A A;  2UUA K;  3L2Q A;  1WLJ A;  1HQE A;  1V4T A;  2W41 A;  4CGI A;  4YOT A;  2GEL A;  3GOI A;  1C0T A;  1XWL A;  4FJJ A;  1NJW A;  2I7N A;  1WBD A;  1MDU B;  5HRS A;  3THV A;  1C0M A;  3MEE A;  1RTH A;  3OYK A;  1TUY A;  3ZSW A;  2P5G A;  2RF2 A;  3KWG A;  4IEI A;  4K25 A;  1NOY A;  4ISF A;  2F9T A;  3D2F B;  3V9S A;  1GLE G;  1IO2 A;  5HBM A;  4LFB K;  4MQ3 A;  2Y1I A;  3EE9 A;  1YIT N;  4C8M A;  1ASU A;  4AHT A;  3ZT1 A;  2VGM A;  1C1C A;  4JN4 A;  1VSL A;  5FRN A;  4KI4 A;  4E89 A;  1CXQ A;  4LSN A;  2NZT A;  5C42 A;  2QTD A;  2ZGZ A;  5HRO A;  2P9I B;  3EZW A;  2QW9 A;  2A6A A;  3KLI A;  1J5O A;  4DUY K;  4C1N K;  1LOT B;  4LD0 A;  1VQL N;  3M5R A;  3K0S A;  3NBP A;  1JLF A;  3AY9 A;  3G4S N;  4GY2 B;  4UY8 O;  2PYL A;  1E4G T;  1EQY A;  2Y1J A;  2JGU A;  3A2F A;  4KV8 A;  1RTI A;  5KGX A;  3K2P A;  4EHU A;  2ZD1 A;  5J2N A;  5TKY A;  3O4N A;  3CCJ N;  2IVN A;  5C2F A;  3HP6 A;  1KFS A;  2P51 A;  3U9D A;  4EP4 A;  1VQM N;  3CPW M;  4XH1 A;  3CET A;  3LDO A;  3CXC M;  3VQE A;  2F8T A;  1QSL A;  5AZI A;  1REV A;  4CK2 A;  4OLA A;  4E7H A;  5AQR A;  3OA9 A;  3OS1 A;  3ULE A;  2YJF A;  4FYD A;  4RW7 A;  1NGG A;  5GAG P;  2QWO A;  3ZYY X;  4CEC A;  1YJN N;  3CME N;  4JAX A;  4K0K K;  2A1S A;  1DTQ A;  2G8I A;  1NK9 A;  3GDQ A;  2OCE A;  3MCP A;  3QNN A;  1EX4 A;  3HI0 A;  1BHL A;  4F9O A;  5TKW A;  1VQ8 N;  3HJF A;  2X6N A;  4RW8 A;  1VSH A;  2J4R A;  4KB1 A;  1TKX A;  4PKG A;  3SUO A;  3AVI A;  3DWL A;  3M8P A;  1FXX A;  5SWM A;  3DJC A;  4BDZ A;  4J2B A;  1BQN A;  3TSQ A;  4PY5 A;  3NF6 A;  1KTQ A;  3PX0 A;  3FR0 A;  1NGC A;  3H1Q A;  1NBW A;  4I6M A;  4ISG A;  1RDW X;  5DM6 L;  3THX B;  1G15 A;  5DK5 A;  5FLX O;  2QKB A;  3ZX3 A;  4BGB A;  4IZ9 A;  1NJI O;  2GX9 A;  3AO1 A;  3QFP A;  5SZT A;  2HVI A;  3OYH A;  1ZC6 A;  5HRN A;  4B08 A;  4C1N I;  3V9Z A;  1O1W A;  3SLC A;  4L8R B;  1VRU A;  3ISN C;  3P31 A;  3DLR A;  2GBZ A;  3CPE A;  4ELV A;  3ATV A;  5LJV A;  3R1X A;  4ELU A;  4MDA A;  4E19 A;  3V6D A;  5IWA K;  4JS5 A;  3LAK A;  5CZ1 A;  2I7P A;  3MX2 A;  4CJU A;  1DLO A;  1IKW A;  2YCH A;  3V1R A;  1WSG A;  1ITG A;  3V1O A;  3KLH A;  4CW7 B;  1VHX A;  1H1V A;  4YOV A;  3HRG A;  5DM7 L;  4BE2 A;  3AO4 A;  4CK3 A;  1JCE A;  1L3U A;  3MN9 A;  1P90 A;  1K8A O;  4CD1 A;  3AVB A;  3TU5 A;  1BI4 A;  1SKW A;  2A1R A;  4JHD A;  2GTD A;  3OYM A;  4LY7 A;  4H5W A;  4E7L A;  1ATR A;  4CJL A;  3THY A;  1JLA A;  1B9F A;  1WOQ A;  4HUE A;  5GIP A;  4FSV A;  4JS4 A;  1M1K O;  4CEE A;  5DMR A;  4E7J A;  3EKS A;  3HL8 A;  3B6P A;  2XY5 A;  1QZ5 A;  1RGI A;  3NGY A;  4BR4 A;  4AM7 A;  2PFU A;  1Y64 A;  4LFC K;  4IO9 L;  3ZSR A;  4XIU A;  3KKR A;  4DV0 K;  3AVF A;  4DTO A;  4YDU C;  1T03 A;  1XC3 A;  3PV8 A;  4FJN A;  3O9T A;  5AQV A;  3NGZ A;  4FXD A;  1NK7 A;  4B3S K;  1SKR A;  4OPK A;  1D9D A;  4IDK A;  1I94 K;  2P9N A;  4OKE A;  4G1Q A;  1Q82 O;  4H5V A;  2D0B A;  4WYB A;  3CJC A;  3DLE A;  3ASM A;  4DWI A;  5EY4 A;  3KHY A;  1BU6 O;  4BE0 A;  2WOM A;  3VER A;  2UXC K;  4EAH D;  5AFU H;  1KD1 O;  2ATQ A;  3MN7 A;  1VSI A;  3H3N O;  4FL9 A;  4JEP A;  3I33 A;  5M1P A;  2BUP A;  2EWS A;  1YXQ A;  3MEC A;  1HNZ K;  1TL1 A;  5HLF A;  2Z1J A;  3H08 A;  1W97 L;  1RDC A;  4FVM A;  4OPH A;  2G8V A;  4G9Z A;  1WN7 A;  4H03 B;  1NKB A;  5KQ8 A;  3A5N C;  3DOL A;  5KPZ A;  4HTU A;  4BC2 A;  4FLY A;  1GLL O;  2YHY A;  3L2U A;  1KAZ A;  4DQQ A;  4Z4C A;  5FPD A;  4DF8 A;  1GOB A;  1GOC A;  3MWP A;  4MDB A;  4CZM A;  5KQD A;  4XH5 A;  1K6Y A;  2NRX A;  1N8R O;  4C8K A;  3DMJ A;  1S22 A;  3HM9 A;  1U48 A;  4JI8 K;  2BTF A;  2WON A;  1TV6 A;  5AFU A;  3EE8 A;  4RG8 A;  3IFR A;  1RBR A;  4ILJ A;  5E41 A;  3NGI A;  2VCP A;  3DLG A;  3T69 A;  2UUB K;  3OYB A;  2ZJR L;  4B1Y B;  3LZJ A;  1KRP A;  3D45 A;  4OPA A;  1VQP N;  3BZK A;  2UXD K;  5F0X A;  2AJQ A;  4QS8 A;  3DLB A;  3A5L C;  2FF6 A;  4JKE A;  1GOA A;  1KVB A;  3H46 O;  3NH1 A;  2HW3 A;  5F2R A;  4DTM A;  3F73 A;  5AQQ A;  2P9I A;  3HBT A;  2F7T A;  3VTI A;  4J2A A;  1BIU A;  4JYA K;  3HXM A;  1XQS C;  2FC0 A;  3BF1 A;  5KPR A;  1HKC A;  4CFD A;  4B8A B;  4XEI A;  3CQY A;  3KTQ A;  5JMV A;  1VSK A;  3UKR A;  2KHO A;  3T1Y K;  3IMX A;  2KW4 A;  4DMN A;  1NM1 A;  4ZTJ A;  4MO4 A;  3SAF A;  4DR6 K;  2FXU A;  3NF9 A;  3CJ1 A;  4I9Q A;  3O9U A;  5K14 A;  3K5L A;  1SL2 A;  1LWF A;  3O80 A;  1ASV A;  3GBT A;  3ZEU B;  2VG5 A;  3U6F A;  2QXL A;  3HPO A;  3OJU A;  4CJ3 A;  4H5T A;  4E1M A;  2ASO A;  4JI3 K;  4IG3 A;  1BDG A;  3QBW A;  5KPT A;  2A3Z A;  4CJE A;  1SL0 A;  4CGD A;  4NLC A;  4HWI A;  4X62 K;  4KFB A;  2FBV A;  4HCB A;  3IRX A;  3AA4 A;  2XY6 A;  4CGJ A;  2G8F A;  2O8F A;  1EXQ A;  3C6T A;  4QCL A;  1KFD A;  2P9N B;  1KCF A;  4GMJ B;  1V4S A;  1Q7Y O;  2VGN A;  4FJ9 A;  4CJK A;  4KHN A;  1D9F A;  1EP4 A;  2QWM A;  1IV0 A;  5AQL A;  2HB5 A;  3JYT A;  2IVP A;  3PX4 A;  1A5X A;  3KK7 A;  3P39 A;  4KHU A;  2X6S A;  1W2B M;  2ZJP L;  2HVH A;  3AVN A;  1VSM A;  3BZC A;  3MCA B;  4DG1 A;  1BIS A;  4BQL A;  2FSJ A;  3SNN A;  4A59 A;  4FJH A;  4BC4 A;  1UA0 A;  3I8D A;  4BG8 A;  1IG9 A;  5H1S Q;  3KK2 A;  3NDK A;  4B1V A;  1EKE A;  4FPA A;  1ZBH A;  3THY B;  1CZB A;  3G10 A;  5LMU K;  4JI2 K;  5HL7 L;  3CM6 A;  3VES A;  2ZF5 O;  2UUC K;  3S9H A;  3AA5 X;  1YTU A;  1GLJ O;  2R7Y A;  3AGR A;  2YNI A;  1IBL K;  1S1X A;  3M8R A;  5CHI A;  1YHQ N;  1TKT A;  2EHG A;  2YNH A;  1RIL A;  3C65 A;  2O8C A;  1ASW A;  4FM2 A;  3S3O A;  3CQ8 A;  5M1N A;  1RT4 A;  4CFA A;  3SQ1 A;  5C2D A;  1RDD A;  1DEJ A;  3AGK A;  3BGR A;  4EFH A;  4GV9 A;  3SQ0 A;  5LJW A;  1U6Z A;  3CD6 N;  1EWQ A;  3AVK A;  5F1X A;  3U9Z A;  3M8Q A;  4DV6 K;  4NXN K;  4CI6 A;  3THW A;  5J1E A;  4PKH A;  2W6K A;  1B9D A;  4AIL C;  5FDL A;  4CIG A;  3AA2 A;  4DR1 K;  4NYF A;  3GG4 A;  4DSL A;  2I5J A;  3WXI A;  4DR4 K;  1N36 K;  5GIN A;  4CJ5 A;  4CJQ A;  1NLV A;  3K5O A;  4Z4I A;  1TGO A;  3UKU A;  3EO3 A;  4DUZ K;  1XI1 A;  3WQT A;  4YOX A;  3QO9 A;  1SV5 A;  3C95 A;  4KH5 A;  4CJS A;  4BE1 A;  4CZJ A;  2LSN A;  5GAE P;  2D0A A;  3NF7 A;  4E1J A;  2JWK A;  2FBY A;  3LM9 A;  1ZXO A;  3THX A;  1XNR K;  3BDP A;  3QNO A;  1S6P A;  3O9S A;  1YT3 A;  5CYQ A;  3DLL L;  3EN9 A;  3OS2 A;  1RDB A;  1NJY A;  1D5A A;  3OYC A;  4M3X A;  3JS6 A;  1WSF A;  1MWM A;  4JK7 A;  4CK1 A;  4C8L A;  3EYZ A;  3HK2 A;  4B9U A;  5FPN A;  4IOC L;  4J2E A;  1R0A A;  4JD2 B;  3AO5 A;  3NVK A;  3W3D A;  2WTU A;  1NJZ A;  2HHX A;  4KO0 A;  4RCH A;  5AR0 A;  4XH4 A;  3SPZ A;  4M3Y A;  3RMA A;  2A42 A;  4NYN A;  3V9X A;  3D6R A;  4R5P A;  1C6V A;  5J2M A;  1B92 A;  4PKI A;  3ULE B;  2A40 A;  1QSS A;  3H1V X;  1SL1 A;  4CEB A;  3VET A;  5I9E B;  2BH1 A;  3MDQ A;  3L6Q A;  3TTD A;  4N76 A;  2Z1I A;  1LW0 A;  3DRS A;  4YOR A;  4GKJ K;  2EX3 A;  3MED A;  4DS5 A;  3QEP A;  3J7Z O;  4B9N A;  1Q9Y A;  2FBT A;  4M63 C;  2HF4 A;  3A5O C;  3O3G A;  3QLH A;  3WXM B;  4JV5 K;  2HND A;  1MA9 B;  1KQS M;  4GNI A;  4AHC A;  2Q0U A;  4FJL A;  4DSF A;  5BPM A;  3RSE A;  2A41 A;  3PY8 A;  3EEQ A;  4DTS A;  3M3Z A;  3F9M A;  2PZS A;  4WFN L;  1IKV A;  5BR8 K;  4DV1 K;  3TI0 A;  4MO5 A;  2QWN A;  3SI6 A;  2NUB A;  3DRP A;  1BG3 A;  4DV2 K;  4JKA A;  4ILG B;  1QQO A;  3HT3 A;  5EX5 A;  4LF7 K;  4JKG B;  1S9E A;  4KB0 A;  4IWV A;  1DGK N;  4DR7 K;  3EL2 A;  4JK8 A;  5AQF A;  5AQG A;  3FZF A;  3SK3 A;  3VQ8 A;  5ADX A;  2O8B A;  4JKD A;  3DI6 A;  3S41 A;  3RRH A;  1WB9 A;  4ILH A;  4L3Q A;  4CHO A;  1T3V A;  3RTV A;  2JWL A;  1RBT A;  3D2F A;  2NLX A;  1NGJ A;  4QOZ B;  4PHT X;  3FZM A;  2WC9 A;  3TAM A;  1TK0 A;  4W5O A;  1NK5 A;  1NGB A;  4YDU A;  3MX5 A;  3NF8 A;  4BRQ A;  5AQU A;  4FJ7 A;  4RWT A;  2E88 A;  3I0R A;  3VQB A;  4BWJ A;  1Q8I A;  1QVF M;  3RR8 A;  5C12 A;  3F2K A;  4LC9 B;  2GWJ A;  4O5B A;  4O8U A;  1HYV A;  4E7K A;  1CZ9 A;  4CJT A;  3I56 N;  4DR5 K;  2HNY A;  3BUZ B;  2WFB A;  4FWP A;  4Y1D A;  3VQQ A;  3HPH A;  2P9K A;  3R6M A;  2UXB K;  5JIC A;  4W5N A;  4F8R A;  5C10 A;  5KI6 A;  3AO3 A;  1N6Q A;  4O55 A;  2OPQ A;  4FWS A;  4LF9 K;  3IDH A;  5AQH A;  3AVG A;  4OGC A;  4GW6 A;  2D1K A;  5C24 A;  3RSE B;  2YHX A;  5E26 A;  4JI6 K;  2P9P B;  5B8H A;  3LL3 A;  3HP9 A;  4KTZ A;  1LWE A;  3VTH A;  3BF3 A;  1HJO A;  1NGI A;  1IKX A;  1YAG A;  3GE1 A;  3DXK A;  4E0D A;  3E66 A;  4H8K A;  3MN5 A;  3KWI A;  3VMF B;  4HUG A;  3IUC A;  1HMV A;  1KAY A;  4HUF A;  1T8E A;  4B1U B;  3J7A P;  2F8S A;  1XHZ A;  4NXM K;  3K57 A;  4N47 A;  5BN9 A;  3B6O A;  3VQ4 A;  3WNE A;  4FLV A;  4J8F A;  1E4F T;  4DV5 K;  3NVM A;  3CCS N;  4IXC A;  3JXU A;  2GEM A;  2HST A;  5AQN A;  3D2E A;  1T6D A;  3CF5 L;  3HZ6 A;  3VEO A;  4KH4 A;  1RT2 A;  4O5F A;  1TAQ A;  3NFA A;  3L2W A;  5BRF A;  3OYJ A;  3VQC A;  3O9Q A;  1VAZ A;  4FJM A;  3WQU A;  1Y97 A;  4DQI A;  2ITM A;  4F2S A;  4M42 A;  2P9P A;  1QHA A;  1X9S A;  3SBT A;  4FPB A;  3LM2 A;  3NH0 A;  2E5L K;  4BRK A;  2PAV A;  2YJE A;  3L4Q A;  4X65 K;  3CQX A;  4BGA A;  1QQC A;  1Z05 A;  1EWR A;  1N5Y A;  1KSP A;  1HYS A;  3E9L A;  3CI5 A;  2P9K B;  2KZZ A;  2QWL A;  3L3V A;  3OS0 A;  1UOC A;  1HJR A;  2D4W A;  1ZBF A;  5M1K A;  4WF9 L;  4FK2 A;  4NCA A;  3BY5 A;  3SPY A;  5EVZ A;  3J8A A;  2P5O A;  1JXE A;  3O08 A;  4CGH A;  1RFQ A;  1CXU A;  2KLA A;  2W6L A;  1HLU A;  1VK0 A;  1ZBL A;  1F21 A;  3NMU A;  2E4L A;  2P1J A;  2XY7 A;  1NK8 A;  1Q81 O;  1OKJ A;  2QWQ A;  2NRH A;  2O8D A;  5LY3 A;  1SQK A;  3TAB A;  4CZF A;  1RT7 A;  4I2Q A;  2W40 A;  1P8Z A;  3AVJ A;  2E2Q A;  4CVN E;  2KKZ A;  2O8B B;  5BRE A;  4Z4E A;  3C7N B;  4WQ5 A;  1BGX T;  3VPZ A;  4OKK A;  4YY3 K;  4BR7 A;  1GLA G;  3VGL A;  1KC8 O;  3O4Q A;  2P9U A;  5FPM A;  1JJ2 M;  3Q7C A;  3ZSQ A;  4CF8 A;  4JKG A;  4ISE A;  4BRO A;  1JLE A;  2QWR A;  1NKE A;  4CGG A;  4FWK A;  3HVT A;  3DM2 A;  5BN8 A;  3VQP A;  2FSK A;  3MK6 A;  1ZBS A;  3WNH A;  3K58 A;  4YNQ A;  3ULD A;  4ZTF A;  4CGF A;  4GVM A;  4BR5 A;  4O0I A;  2O8C B;  4H0O A;  3CC7 N;  1NKC A;  3TSU A;  1BCM A;  3OYE A;  4AHR A;  2YX6 A;  4FO0 A;  2YKN A;  3AVM A;  4KRF A;  2VG6 A;  5M1F A;  1BWF O;  3SMS A;  5BPN A;  1JKH A;  1XNQ K;  4N41 A;  4B1X B;  4FWO A;  4I9L A;  1C0F A;  4FZZ A;  1G99 A;  4KBO A;  4CEQ A;  3OYN A;  3KD1 E;  4DTN A;  4M3W A;  1OVQ A;  4DSJ A;  3VQ9 A;  1NG9 A;  4NLB A;  5AQJ A;  1S5J A;  3G0Z A;  2A5X A;  2DFE A;  1YVN A;  4NCB A;  3SUQ A;  4BRG A;  4X66 K;  2D0C A;  4JD2 A;  3F5T A;  3SV3 A;  3OYL A;  2V7Y A;  1RCH A;  2Q36 A;  5EXW A;  1VSD A;  5ADX H;  3AAR A;  3SQ2 A;  4CJV A;  3VGM A;  4KKO A;  3C6A A;  1NK4 A;  3LP1 A;  3RMC A;  1RBV A;  2IAJ A;  3P38 A;  4BRL A;  3RMD A;  1Q86 O;  4FVU A;  3R3L A;  3TR8 A;  3BEX A;  4U7B A;  3A0I X;  3ZSV A;  1MWK A;  2YHA A;  3JSM A;  4Z94 A;  3U3G A;  1LW2 A;  1NWK A;  2O4I A;  3DAW A;  1QS4 A;  4C8N A;  1M90 O;  1HKB A;  5FPE A;  4BVO A;  3TPQ A;  2O8E B;  1YUW A;  3V9W A;  1W0H A;  4IO8 A;  1HPM A;  3PIP L;  4FJ5 A;  1FW6 A;  1QQM A;  2YNF A;  3SYZ A;  2H3G X;  2OPR A;  3CM5 A;  3ZET A;  3UE5 A;  4CZH A;  1NK6 A;  3LZI A;  3VQ5 A;  1NGD A;  3NAE A;  3PSF A;  3OVN A;  3ZEU A;  1L3S A;  1HNI A;  2E20 A;  5AZJ B;  4KHP K;  5J2P A;  1ZBU A;  5AQT A;  1Z26 A;  4K41 A;  3JAM O;  1RDA A;  4OX9 K;  3THW B;  4V19 S;  3QIC A;  5JVG L;  1YF5 L;  4ICL A;  3QES A;  2Z1G A;  3IS9 A;  1RT5 A;  3QET A;  1WBB A;  2P9S A;  3WT0 A;  2ZQB A;  4DQ8 A;  2UU9 K;  4MLH A;  3HOS A;  1OVY A;  4GKK K;  2QXF A;  5KRT A;  3AVL A;  3H3O B;  3G71 N;  3TTC A;  3U3Y A;  3TAQ A;  3QER A;  2OTL N;  4N5S A;  3SAH A;  2VG7 A;  5KTQ A;  4DTR A;  2NRV A;  3PSI A;  1IKY A;  5J2Q A;  3CHW A;  4M3R A;  3CCV N;  4DU4 A;  5CYM A;  3O1B A;  2OPP A;  1WAJ A;  3CCR N;  4DHY A;  1TYQ A;  2HMP A;  4E3S A;  1KLN A;  3T1H K;  3KK3 A;  1FK9 A;  1HQU A;  1U2V B;  3P83 D;  5AJ3 K;  2E1Y A;  1TUU A;  3E9P A;  3J80 O;  3MAQ A;  1JCG A;  3T19 A;  2X74 A;  4B3R K;  3PO4 A;  3CFP A;  4YHH K;  4FLZ A;  2OA8 A;  3A5M C;  2G8W A;  1ATS A;  2NRW A;  5HOO A;  2Q31 A;  1S72 N;  3HVR A;  3MXJ A;  4IJA A;  4KH6 A;  1W7A A;  1T6C A;  1GLB G;  3A8Y A;  1RTD A;  3RRG A;  1T05 A;  1QTM A;  2Q1N A;  2QEX N;  2ETJ A;  1SZ2 A;  2VYP A;  4I7F A;  2CGK A;  4DB3 A;  1I3A A;  3T1A A;  4KI6 A;  3WXK A;  3LAN A;  5AQX A;  3O3H A;  4AHU A;  1IBK K;  5CR4 A;  4H5R A;  2HOE A;  3LDN A;  3LAM A;  4HTL A;  1L3V A;  4OVL A;  1IH7 A;  1S1T A;  2HMI A;  2FF3 B;  4JI1 K;  3H45 C;  1RDU A;  1WSH A;  4KTW A;  3TAF A;  3KJV A;  1HNV A;  1ZYQ A;  1RNH A;  1FJG K;  3KZB A;  3WEE A;  3TTF A;  4Q5V A;  3KVG A;  5AQM A;  3MWT A;  1KAX A;  3UB5 A;  4YOW A;  4W5T A;  4B9M A;  3O5B A;  1WAF A;  3KLG A;  3QB0 A;  1FKO A;  3U8X A;  2O8F B;  2OZS A;  4DLG A;  5AQK A;  1A5W A;  2ZWH A;  4AH9 A;  4OLB A;  4CJF A;  3L4I A;  1NNE A;  4CJP A;  4FWN A;  1W9H A;  3G25 A;  4RW4 A;  4CCH A;  5HRP A;  2NRZ A;  2AA4 A;  5LMN K;  3F9K A;  4M7X A;  4R79 A;  3SUN A;  4MLE A;  2YKM A;  2O4G A;  3CJA A;  3KD5 E;  1J5E K;  1ILY A;  4FWM A;  3K9K A;  4QAG A;  5BR9 A;  3VA0 A;  1X9J A;  4BRF A;  1VRT A;  4JI7 K;  3J7Y P;  3OYA A;  2D5R A;  4FJG A;  3VN5 A;  2HHW A;  4FLW A;  3FZK A;  5ELZ A;  3VQ6 A;  1XHX A;  3UKR B;  4K8Z A;  2ZGY A;  2HBL A;  1K9M O;  1QE1 A;  5E84 A;  3HSC A;  3QEI A;  4NCG A;  4DQR A;  2CH6 A;  1HX1 A;  2XY8 A;  4C8O A;  4A57 A;  3SZ2 A;  3FLC O;  1JXB A;  4CEA A;  5CZ2 A;  4LF4 K;  3QIP A;  1K8K B;  3SAG A;  4H0V B;  3M6G A;  3K9J A;  2V7Z A;  3CER A;  4CBX A;  3OYG A;  3I55 N;  3HO1 A;  1TKZ A;  3FZL A;  3OYI A;  1DKG D;  4FZX C;  4BG9 A;  3G6E N;  1XMO K;  2HBJ A;  2ASM A;  4B3M K;  1LV5 A;  4H4M A;  5JS1 A;  4JNE A;  2DTU A;  3CIP A;  1SKS A;  3C6U A;  1XUP O;  3C94 A;  3ZSO A;  1XC9 A;  1VQ7 N;  4BQZ A;  5AQS A;  4B3O A;  1Q18 A;  1KXP A;  3D7E O;  3O9R A;  4CE9 A;  1T44 A;  4F4K A;  3OTO K;  3SV4 A;  3ZSX A;  4OGE A;  4LH5 A;  4CFB A;  3ZT0 A;  1WSJ A;  3PUF A;  4LF8 K;  2P9L A;  1RT1 A;  4JKC A;  5BPL A;  3OYF A;  3CCE N;  4BC3 A;  4AQY K;  5AZJ A;  4EIA A;  2IVO A;  2E2P A;  3NHG A;  1N32 K;  1E3M A;  3J81 O;  4GV6 A;  2E1Z A;  4IDH A;  4IG0 A;  4LSL A;  2OPS A;  3B8A X;  3W0L A;  2GUP A;  4K8X A;  1J54 A;  3QBX A;  4K42 A;  4FJ8 A;  1OH5 A;  1DT9 A;  3FE1 A;  4BAC A;  1U4B A;  1LWC A;  1TAU A;  3VF2 A;  4I2P A;  2KFN A;  4CD3 A;  3OBW A;  1S1V A;  3AAP A;  4Z0U A;  3C6H A;  4IEE A;  4N56 A;  3ZX2 A;  3WNG A;  1U04 A;  2GUI A;  2KFZ A;  2QM1 A;  1TVR A;  3ZX0 A;  2ITG A;  3I8B A;  5M1O A;  4B9S A;  4CEZ A;  2WUS A;  1LAW A;  2HBM A;  1C0U A;  4ID1 A;  3OYD A;  4DF4 A;  4FM1 A;  3QDK A;  3S3M A;  3TAE A;  2B5J A;  4PQU A;  3NE6 A;  1YTA A;  5C25 A;  3UIQ A;  1X3M A;  1JLG A;  4KPY A;  4H0X B;  1DTT A;  4CFC A;  4DV4 K;  4A62 A;  2DY4 A;  1N33 K;  3ENH A;  3V9U A;  4EZ9 A;  5HRR A;  3FFI A;  3LAL A;  4FW1 A;  4M45 A;  1BO5 O;  3KIO A;  4JKF A;  2YI1 A;  4WFB L;  3CCM N;  3TAG A;  4FWQ A;  2HF3 A;  1X9M A;  1J9A A;  1NGH A;  5JS2 A;  3RWU A;  3CC2 N;  3CMA N;  2IGI A;  1S9G A;  1RT6 A;  2BDP A;  5KGW A;  4ZHR A;  3CCQ N;  4DSK A;  4M3Z A;  1J6Z A;  1YJW N;  4BR2 A;  1QZ6 A;  3P5J A;  4W5Q A;  2P9L B;  1VQN N;  1VSF A;  5HP1 A;  2B6A A;  5AQP A;  4W5R A;  4DFK A;  4OPJ A;  3QFU A;  5EU7 A;  3MEG A;  1YIJ N;  4HCC A;  3TWH A;  3RVC A;  2E8A A;  4JI4 K;  4BRH A;  3AVC A;  4Y0W A;  4JHD B;  4CF2 A;  1KVA A;  3K59 A;  5JLH A;  4NO7 A;  2OZM A;  2GWK A;  5AQY A;  1SS6 A;  4DFM A;  1WNS A;  1BI4 B;  3CG7 A;  2GV9 A;  3LDS A;  3MMV A;  1X3N A;  4Z4F A;  3HM8 A;  4JI5 K;  2ZJQ L;  2VWB A;  2NNW A;  4AHV A;  3E9O A;  4IJN A;  3CCL N;  4BRM A;  3VEW A;  2HBK A;  1TKD A;  3ZT4 A;  4CJW A;  2QA4 N;  4PL8 A;  4BR9 A;  1L5U A;  3ZT3 A;  3N4Q A;  3SBG A;  5EOY A;  4CBW A;  2BAN A;  2YV0 X;  3SQ4 A;  4CED A;  1NK0 A;  4A61 A;  4FWR A;  4H0P A;  3GL1 A;  2P9U B;  3BP8 A;  4B9L A;  1K8K A;  4CZG A;  4A5B A;  4H0Y B;  4UQG A;  1UWB A;  1ATN A;  4CHY A;  3C7N A;  1IBM K;  5JVH L;  4BY9 C;  4IFV A;  2JLE A;  4NB4 A;  4B9V A;  3WXL A;  1I39 A;  4JI0 K;  4CES A;  1BCO A;  4DSI A;  1BOT O;  2AP1 A;  3HPG A;  4DV7 K;  2HHT A;  1T7P A;  4CER A;  3MN6 A;  3O3F A;  1VSE A;  1KVC A;  4FW2 A;  1QHT A;  2HHV A;  4CF0 A;  2D0O A;  4DSE A;  4A2A A;  2IS3 A;  4BWM A;  4I6M B;  4BDY A;  3KLE A;  2OYQ A;  1JCF A;  4KHQ A;  4X64 K;  3DOK A;  4CF9 A;  4PWD A;  3DYA A;  4HHT A;  3CYM A;  3N4P A;  4DTP A;  2RPI A;  3VEY A;  1LCU A;  2IIR A;  4BDP A;  5GAD P;  2XHB A;  4KHY A;  1GLC G;  3PLA A;  2Z1H A;  4CZI A;  4FZY A;  1BIZ A;  1QSY A;  3LDL A;  3OW2 M;  1S6Q A;  4FJX A;  1TL3 A;  3LDQ A;  1HPZ A;  3WEE B;  1D8Y A;  2BE2 A;  3QEV A;  3AVA A;  1D4X A;  4A2B A;  3E1Y A;  4TSX A;  3U4L A;  3QML A;  4JKH A;  4EZ6 A;  2VQF K;  2ASP A;  4HVJ A;  3NCI A;  5AQO A;  1CZA N;  5BRD A;  4RW6 A;  4JRP A;  1C1B A;  2DFF A;  2DPN A;  1OH7 A;  1VQ4 N;  5AZI B;  1RBS A;  2W42 A;  5C15 A;  5BRH A;  3OBY A;  2NRR A;  1VQ6 N;  1FKP A;  1QQN A;  3WNF A;  4CZK A;  3DLH A;  4PA1 A;  3VEX A;  5D3G A;  4CIE A;  1NMN A;  3RMB A;  2OTJ N;  3MXI A;  3V1Q A;  1SUQ A;  3L8B A;  4DU1 A;  2BGG A;  1U2V A;  2KTQ A;  5MLC Q;  4Y1C A;  2Q0R A;  4DQP A;  1R59 O;  1JL1 A;  2E2O A;  1ESV A;  1TYQ B; 
#chains in the Genus database with same CATH homology
 5CYM A;  4E7I A;  2OPP A;  1WAJ A;  3BDP A;  1WSI A;  3V4I A;  4PUO A;  1G15 A;  5DK5 A;  3K5M A;  2QKB A;  3NF6 A;  3QNO A;  1S6P A;  4E3S A;  3T3F A;  1YT3 A;  4DFP A;  3CFR A;  1KLN A;  3LP3 A;  5CYQ A;  3KK3 A;  4Z4G A;  3OS2 A;  1FK9 A;  1HQU A;  1RDB A;  1D5A A;  3P83 D;  3L3U A;  3OYC A;  1NJY A;  3AVH A;  4M3X A;  4EP5 A;  3AO1 A;  5SZT A;  1WSF A;  4CK1 A;  3OYH A;  3MAQ A;  4C8L A;  2HVI A;  3EYZ A;  3T19 A;  2X74 A;  5HRN A;  3E01 A;  3HK2 A;  3PO4 A;  4B08 A;  4B9U A;  3LP0 A;  3CFP A;  4F3T A;  4FLZ A;  2OA8 A;  3TAN A;  2G8W A;  4J2E A;  1R0A A;  3AO5 A;  3KKS A;  3V9Z A;  3HVR A;  1NJZ A;  3MXJ A;  2HHX A;  3KK1 A;  1UA1 A;  4KO0 A;  1RTD A;  3RRG A;  1T05 A;  1O1W A;  1QTM A;  4L8R B;  4FCY A;  1VRU A;  2ETJ A;  5T7B A;  3SPZ A;  4M3Y A;  3ISN C;  3RMA A;  4I7F A;  3P1G A;  4NYN A;  5FRO A;  1I3A A;  3DLR A;  2QK9 A;  3T1A A;  2GBZ A;  3V9X A;  3V81 A;  4KI6 A;  3LAN A;  4ELV A;  4R5P A;  1BL3 A;  1C6V A;  3O3H A;  1NOZ A;  4AHU A;  4O0J A;  5J2M A;  4KRE A;  4ELU A;  1B92 A;  4E19 A;  3V6D A;  3LAM A;  1L3V A;  4OVL A;  1HYZ A;  1QSS A;  1IH7 A;  2HHS A;  1SL1 A;  4CEB A;  1HRH A;  4JS5 A;  3LAK A;  1S1T A;  5CZ1 A;  3VQ7 A;  1TK8 A;  2HMI A;  4B8C A;  4CJU A;  1DLO A;  2G8U A;  1WSH A;  4IFY A;  4CJ4 A;  4KTW A;  3TAF A;  4N76 A;  2Z1I A;  1LW0 A;  2YNG A;  1IKW A;  1HNV A;  3V1R A;  1WSG A;  1ITG A;  3DRS A;  3KJV A;  1RNH A;  3V1O A;  1ZYQ A;  3KLH A;  1CLQ A;  2EX3 A;  3MED A;  4Q5V A;  1JLB A;  1RBU A;  1S1U A;  4DS5 A;  3QEP A;  4B9N A;  4DFJ A;  1Q9Y A;  2FBT A;  4W5T A;  2X78 A;  4B9M A;  3O3G A;  3QLH A;  1WAF A;  3KLG A;  1FKO A;  4BE2 A;  2HND A;  3AO4 A;  4CK3 A;  4DTU A;  4AHC A;  4FJL A;  1L3U A;  2OZS A;  4DSF A;  4DLG A;  1A5W A;  4AH9 A;  3VQD A;  4CHN A;  4OLB A;  4CJF A;  3AVB A;  3PY8 A;  3HST B;  4WE1 A;  3QIO A;  4DTS A;  1L3T A;  4DQS A;  4E1N A;  1J53 A;  1VSJ A;  2PZS A;  1BI4 A;  4CEO A;  4CJP A;  1IKV A;  1C1A A;  4AHS A;  1SKW A;  3TI0 A;  2A1R A;  3SI6 A;  1U49 A;  2NUB A;  3DRP A;  4KTQ A;  3AV9 A;  1W9H A;  4RW4 A;  4CCH A;  1YVU A;  3TAR A;  2IDO A;  5HRP A;  3HT3 A;  4O4G A;  1KLM A;  4ELT A;  3OYM A;  1S9E A;  3F9K A;  3SUN A;  4KB0 A;  2YKM A;  2O4G A;  4LY7 A;  3M8S A;  3L2V A;  3KD5 E;  4E7L A;  4CJL A;  4QAG A;  4YFU A;  3VA0 A;  1JLA A;  2FBX A;  4CF1 A;  1X9W A;  1B9F A;  1VRT A;  4HUE A;  4Q0B A;  3OYA A;  3VQ8 A;  2D5R A;  4FJG A;  3VN5 A;  4JS4 A;  2HHW A;  4FLW A;  4F3O A;  3TAP A;  4CEE A;  3DI6 A;  3VQ6 A;  1LAV A;  3IAY A;  1XHX A;  5DMR A;  4IBN A;  3RRH A;  4E7J A;  4JLH A;  3LWM A;  4K8Z A;  1ZBI A;  1S1W A;  1QE1 A;  4PY5 A;  3HL8 A;  4CHO A;  3B6P A;  3RTV A;  1RBT A;  3RR7 A;  2XY5 A;  3QEI A;  4NCG A;  4DQR A;  4O44 A;  4MFB A;  4DLE A;  4QOZ B;  3TAM A;  1U45 A;  2XY8 A;  3NGY A;  3SUP A;  3ITH A;  4C8O A;  3LPT A;  1TK0 A;  4W5O A;  1NK5 A;  3SZ2 A;  3VA3 A;  1RT3 A;  1Z25 A;  2KZM A;  3NF8 A;  1JXB A;  3ZSR A;  4CEA A;  5CZ2 A;  3KKR A;  4XIU A;  3I0R A;  4FJ7 A;  3VQB A;  4BWJ A;  1Q8I A;  2ZE2 A;  3QIP A;  4FK0 A;  3AVF A;  4DTO A;  3RR8 A;  4O5B A;  1HYV A;  1T03 A;  2YHB A;  2HHQ A;  3OYG A;  3AO2 A;  3PV8 A;  4FJN A;  4ID5 A;  3HO1 A;  4E7K A;  4CJR A;  1TKZ A;  1CZ9 A;  4LH4 A;  4CJT A;  1X1P A;  2Q3S A;  2HNY A;  2KQ2 A;  3OYI A;  4F2R A;  3VQQ A;  4Y1D A;  3NGZ A;  4FZX C;  4FXD A;  3HPH A;  1NK7 A;  3HYF A;  1SKR A;  4OPK A;  4W5N A;  4F8R A;  5KI6 A;  1D9D A;  4IDK A;  3AO3 A;  1UAX A;  4OKE A;  4G1Q A;  2DFH A;  4O55 A;  1N6Q A;  2D0B A;  2OPQ A;  2G8H A;  2PY5 A;  2QKK A;  3DLE A;  3AVG A;  1BQM A;  1LV5 A;  4OGC A;  4H4M A;  3ASM A;  4GW6 A;  5JS1 A;  4DWI A;  5C24 A;  2DTU A;  1SKS A;  3C6U A;  5I3U A;  2XO7 A;  4OJR A;  3C94 A;  3ZSO A;  2IOC A;  3LP2 A;  3ZSY A;  3I0S A;  4BE0 A;  1XC9 A;  2WOM A;  3HP9 A;  4KTZ A;  1LWE A;  4CIF A;  1TK5 A;  2ATQ A;  1IKX A;  1VSI A;  4E0D A;  4IKF A;  1MU2 A;  4H8K A;  4B3O A;  5KRS A;  4CE9 A;  3OY9 A;  4F4K A;  4HUG A;  1HMV A;  3MEC A;  3ZSX A;  1TL1 A;  4HUF A;  3SV4 A;  2Z1J A;  5HLF A;  3H08 A;  1T8E A;  4OGE A;  1RDC A;  4FVM A;  2G8V A;  2F8S A;  4LH5 A;  3NH2 A;  1WN7 A;  1XHZ A;  4CFB A;  3ZT0 A;  4FJK A;  1WSJ A;  1NKB A;  3PUF A;  3K57 A;  3DOL A;  4HTU A;  4N47 A;  4CHP A;  4FLY A;  1RT1 A;  3B6O A;  3OJS A;  3VQ4 A;  3OYF A;  3L2U A;  3WNE A;  4DQQ A;  4Z4C A;  3K5N A;  4FLV A;  2G8K A;  4DF8 A;  1JLC A;  2E6L A;  3NHG A;  1GOB A;  1GOC A;  4DTX A;  1JL2 A;  3EZ5 A;  3ZCM A;  3KLF A;  1Q9X A;  4RW9 A;  4DTJ A;  2VWK A;  1RT2 A;  1K6Y A;  1TAQ A;  3NFA A;  3L2W A;  4C8K A;  3DMJ A;  4CEF A;  3HM9 A;  3OYJ A;  3VQC A;  1U48 A;  2WON A;  4IG0 A;  1NJX A;  4LSL A;  4FJM A;  1TV6 A;  1Y97 A;  2OPS A;  3ZSZ A;  3QEX A;  4RG8 A;  3SJJ A;  4DQI A;  1J54 A;  4F2S A;  1RBR A;  4K8X A;  4M42 A;  2RN2 A;  1X9S A;  4FJ8 A;  2IC3 A;  5E41 A;  1JLQ A;  3AA3 A;  3ALY A;  3DLK A;  3NH0 A;  3NGI A;  4BAC A;  2RKI A;  1U4B A;  2F96 A;  3CFO A;  3DLG A;  1U47 A;  1A5V A;  1LWC A;  4M3T A;  5FRM A;  1TAU A;  2E6M A;  3OYB A;  4Z4H A;  4I2P A;  3VQA A;  3LZJ A;  1QQC A;  2KFN A;  1S1V A;  4Z0U A;  4N56 A;  1N5Y A;  1KSP A;  4M3U A;  3WNG A;  1HYS A;  4DS4 A;  1U04 A;  2GUI A;  2KFZ A;  1KRP A;  3D45 A;  1TVR A;  4CHQ A;  2ITG A;  4B9S A;  4CEZ A;  2AJQ A;  4JRQ A;  2KZZ A;  1LAW A;  3L3V A;  3ZT2 A;  3DLB A;  1C0U A;  4ID1 A;  1UOC A;  3OS0 A;  3OYD A;  1HJR A;  4DU3 A;  1ZBF A;  2HNZ A;  2B4J A;  4DF4 A;  4FK2 A;  4NCA A;  3SPY A;  4FM1 A;  1GOA A;  1KVB A;  3DRR A;  3NH1 A;  2HW3 A;  3PX0 A;  4DTM A;  3TAE A;  2B5J A;  3L2R A;  3NE6 A;  3S3M A;  1YTA A;  5C25 A;  3F73 A;  1JXE A;  2P5O A;  4CGH A;  3UIQ A;  1CXU A;  4KHS A;  1JLG A;  1RTJ A;  4KPY A;  1VK0 A;  1DTT A;  4CFC A;  2DY4 A;  4J2A A;  4J2D A;  1WSE A;  3D0P A;  3V9U A;  1ZBL A;  1F21 A;  1BIU A;  3HXM A;  2E4L A;  2P1J A;  2XY7 A;  1NK8 A;  4EZ9 A;  5HRR A;  3IG1 A;  3FFI A;  3LAL A;  2FC0 A;  3TAB A;  4FW1 A;  4M45 A;  4CFD A;  3KIO A;  4B8A B;  1RT7 A;  4I2Q A;  3TAG A;  3KTQ A;  1X9M A;  1J9A A;  5JS2 A;  1VSK A;  3AVJ A;  3RWU A;  2VWJ A;  2IGI A;  1S9G A;  2KW4 A;  1RT6 A;  4DMN A;  2BDP A;  4FLT A;  4M41 A;  5KGW A;  4ZHR A;  4DSK A;  4M3Z A;  4ZTJ A;  4Z4E A;  4B9T A;  1BGX T;  3NF9 A;  4OKK A;  3SCX A;  4I9Q A;  5K14 A;  3P5J A;  4W5Q A;  3QEW A;  3LWL A;  4H4O A;  3O4Q A;  3K5L A;  4FM0 A;  1VSF A;  1SL2 A;  1LWF A;  1ASV A;  3ZSQ A;  4CF8 A;  3PX6 A;  5HP1 A;  2B6A A;  4W5R A;  4DFK A;  3EY1 A;  4OPJ A;  5EU7 A;  4KAZ A;  3MEG A;  4FLU A;  4HCC A;  1JLE A;  3TWH A;  4FLX A;  2VG5 A;  2HHU A;  1NKE A;  4CGG A;  4FK4 A;  1EET A;  3AVC A;  3HVT A;  3DM2 A;  4CF2 A;  3U6F A;  1KVA A;  3QIN A;  3K59 A;  3HPO A;  2XRI A;  4CHZ A;  2OZM A;  3VQP A;  3OJU A;  5CY4 A;  4CJ3 A;  4E1M A;  1WNS A;  1BI4 B;  3CG7 A;  4IG3 A;  3WNH A;  2GV9 A;  4DFM A;  3MXM A;  2PYJ A;  3PO5 A;  4KHW A;  3K58 A;  4YNQ A;  3ULD A;  4CJE A;  1SL0 A;  4CGD A;  4GVM A;  4OKJ A;  4CGF A;  3LDS A;  3LPU A;  4O0I A;  4ZTF A;  4KFB A;  2FBV A;  4FJI A;  4HCB A;  4Z4F A;  3IRX A;  3S3N A;  1NKC A;  3AA4 A;  2XY6 A;  4CGJ A;  2G8F A;  1BCM A;  3OYE A;  1EXQ A;  4AHR A;  4AHV A;  3L2Q A;  3C6T A;  1WLJ A;  2YKN A;  3AVM A;  4KRF A;  1HQE A;  4QCL A;  1KFD A;  2VG6 A;  1KCF A;  4GMJ B;  4CGI A;  1TKD A;  3ZT4 A;  1JKH A;  4CJW A;  1L5U A;  4FJ9 A;  4CJK A;  4KHN A;  3ZT3 A;  1D9F A;  4N41 A;  1EP4 A;  1C0T A;  4I9L A;  1XWL A;  4FJJ A;  2BAN A;  2YV0 X;  4FZZ A;  3SQ4 A;  4CED A;  1NJW A;  1NK0 A;  2HB5 A;  3JYT A;  4CEQ A;  3PX4 A;  1A5X A;  3OYN A;  5HRS A;  3THV A;  1C0M A;  4B9L A;  3MEE A;  4KHU A;  3KD1 E;  4DTN A;  2X6S A;  4M3W A;  4UQG A;  1RTH A;  1UWB A;  4DSJ A;  3VQ9 A;  3OYK A;  3ZSW A;  4CHY A;  2P5G A;  2RF2 A;  2HVH A;  1S5J A;  3AVN A;  1NOY A;  1VSM A;  3G0Z A;  2DFE A;  3V9S A;  4IFV A;  4DG1 A;  1IO2 A;  1BIS A;  5HBM A;  4NCB A;  2JLE A;  4MQ3 A;  5I42 A;  2Y1I A;  4B9V A;  4C8M A;  3SUQ A;  1ASU A;  4AHT A;  3ZT1 A;  3SNN A;  1I39 A;  2D0C A;  4CES A;  1C1C A;  4FJH A;  1UA0 A;  3SV3 A;  1BCO A;  4DSI A;  3I8D A;  1VSL A;  3OYL A;  5FRN A;  4KI4 A;  4E89 A;  1CXQ A;  4LSN A;  1IG9 A;  3HPG A;  5C42 A;  1RCH A;  3KK2 A;  3NDK A;  2HHT A;  1VSD A;  1EKE A;  5HRO A;  1ZBH A;  1T7P A;  3SQ2 A;  4CER A;  4CJV A;  4KKO A;  3KLI A;  1CZB A;  3O3F A;  1NK4 A;  1J5O A;  1VSE A;  1KVC A;  3LP1 A;  1QHT A;  1RBV A;  2IAJ A;  4FW2 A;  3RMC A;  3RMD A;  2HHV A;  3G10 A;  4CF0 A;  4LD0 A;  4DSE A;  3CM6 A;  2IS3 A;  3TR8 A;  4BWM A;  3ZSV A;  3S9H A;  3AA5 X;  1YTU A;  3NBP A;  2YHA A;  1JLF A;  3JSM A;  4BDY A;  3U3G A;  3KLE A;  1LW2 A;  2R7Y A;  2PYL A;  2OYQ A;  4KHQ A;  3DOK A;  2O4I A;  4CF9 A;  2YNI A;  1QS4 A;  4PWD A;  2Y1J A;  4C8N A;  3DYA A;  2JGU A;  1S1X A;  3A2F A;  4HHT A;  3CYM A;  4KV8 A;  3M8R A;  1RTI A;  1TKT A;  2EHG A;  2YNH A;  1RIL A;  3K2P A;  5KGX A;  2RPI A;  4DTP A;  4BDP A;  1ASW A;  3V9W A;  1W0H A;  2XHB A;  4KHY A;  2ZD1 A;  4FM2 A;  5J2N A;  3S3O A;  4FJ5 A;  3CQ8 A;  3SQ1 A;  1RT4 A;  3O4N A;  4CFA A;  2Z1H A;  2YNF A;  4FZY A;  1BIZ A;  1QSY A;  1RDD A;  3SYZ A;  3HP6 A;  2OPR A;  1KFS A;  3CM5 A;  2P51 A;  4EP4 A;  3BGR A;  1S6Q A;  4FJX A;  4PQU A;  1TL3 A;  3SQ0 A;  1NK6 A;  3LZI A;  1HPZ A;  3VQ5 A;  1D8Y A;  3VQE A;  3NAE A;  2F8T A;  1QSL A;  3OVN A;  2BE2 A;  3AVK A;  3M8Q A;  3QEV A;  3AVA A;  1REV A;  4CK2 A;  1L3S A;  4OLA A;  1HNI A;  4E7H A;  4TSX A;  5J1E A;  3OS1 A;  4EZ6 A;  5J2P A;  4FYD A;  4RW7 A;  1ZBU A;  4HVJ A;  3NCI A;  1B9D A;  4AIL C;  1Z26 A;  5FDL A;  1RDA A;  4CEC A;  3AA2 A;  4CIG A;  4RW6 A;  4JRP A;  1C1B A;  2DFF A;  4ICL A;  4NYF A;  3QES A;  2Z1G A;  1RBS A;  2W42 A;  4DSL A;  2A1S A;  3IS9 A;  1DTQ A;  2G8I A;  2I5J A;  1RT5 A;  3QET A;  1NK9 A;  1FKP A;  3WNF A;  4CJ5 A;  4CJQ A;  3DLH A;  2ZQB A;  3K5O A;  4PA1 A;  4Z4I A;  3QNN A;  1EX4 A;  1TGO A;  5D3G A;  4CIE A;  3RMB A;  1BHL A;  1XI1 A;  2QXF A;  3MXI A;  5KRT A;  3AVL A;  3HJF A;  2X6N A;  3QO9 A;  4RW8 A;  3V1Q A;  1SV5 A;  1SUQ A;  3C95 A;  1VSH A;  4KB1 A;  3U3Y A;  3TAQ A;  3L8B A;  1TKX A;  3QER A;  4N5S A;  4DU1 A;  3SUO A;  2BGG A;  2KTQ A;  4CJS A;  3AVI A;  4BE1 A;  2VG7 A;  4Y1C A;  3M8P A;  1FXX A;  5SWM A;  4DQP A;  5KTQ A;  4DTR A;  1JL1 A;  2LSN A;  1IKY A;  4BDZ A;  5J2Q A;  2D0A A;  3NF7 A;  4J2B A;  1BQN A;  4M3R A;  2FBY A;  4DU4 A;  1KTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...