4HHTA

T. maritima rnase h2 g21s in complex with nucleic acid substrate and calcium ions
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
229
structure length
220
Chain Sequence
GIDELYKKEFGIVAGVDEASRGCLAGPVVAAAVVLEKEIEGINDSRLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFFEKGLISENRFERILNLLGARKSVVFRKER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNase H2 roles in genome integrity revealed by unlinking its activities.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase/dna
molecule keywords Ribonuclease HII
total genus 75
structure length 220
sequence length 229
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4hhtA00
3LWMA 3HPHA 2XRIA 4IG3A 4N47A 5HLFA 4B8AB 4FCYA 3U6FA 4F2RA 2VG6A 4RG8A 2Z1IA 3HVTA 3LAKA 4CGDA 3DYAA 3AO2A 1RTHA 4FVMA 1L5UA 4CEBA 4BWMA 2DY4A 4DTJA 3V9SA 2D0BA 3K2PA 4KTWA 3MAQA 1KFDA 1VSEA 3DRSA 2HHXA 3DRPA 3ZSQA 3HJFA 2WOMA 4DWIA 3OJUA 2IGIA 3E01A 1RT5A 4O4GA 4Q5VA 3U3YA 1Q9YA 4J2EA 1NJZA 3I0RA 4ELVA 2WONA 2G8HA 4IG0A 1RBRA 3KLIA 4HCBA 2Y1JA 3V1RA 3DRRA 4FM1A 3AVIA 1A5VA 4HHTA 1RT1A 1S9EA 2OPRA 2X74A 3M8PA 4CJLA 3I8DA 5J2PA 2Y1IA 4AILC 2KQ2A 3TI0A 1NK0A 4I7FA 3AVKA 1LV5A 1D9FA 1U49A 4CEOA 1IKYA 3DLEA 1HYZA 4DF4A 3LPUA 4FLVA 1VSKA 2FBVA 3I0SA 3S9HA 2XHBA 4F2SA 3EYZA 3M8SA 1JLEA 2XY6A 3OYFA 2F8SA 3KLGA 3K59A 3QNOA 3AVBA 1U04A 1HQEA 1RTJA 5HRSA 4DG1A 3MXIA 1RNHA 1F21A 3VQPA 3L3VA 5E41A 4L8RB 3AA4A 3ZT1A 4DSEA 1D9DA 4W5TA 4FJMA 2YHBA 1TAUA 3B6OA 2OPPA 1DLOA 4AHRA 3ZSXA 3ALYA 2HB5A 3AA5X 4GVMA 3VQ8A 4JRQA 3PX0A 4KI6A 4FLYA 4CEQA 4CGJA 1XWLA 4FJ7A 3H08A 4E1MA 2OPQA 1T7PA 3PY8A 4CGIA 2O4IA 2HHQA 2OZSA 4HCCA 3HK2A 2IC3A 2DFHA 4DQPA 5EU7A 3CM6A 3EY1A 1KFSA 4O44A 5CZ2A 1SKWA 1IKXA 1BI4A 1HMVA 1BCOA 1LWFA 1WSJA 4E3SA 3D45A 2A1RA 1TL1A 2PYJA 1BQNA 4B9UA 1D5AA 4B3OA 3LAMA 1NK5A 4DS4A 4HUEA 1HYSA 3NCIA 3SNNA 4XIUA 4OGCA 3OYCA 1HNIA 5KI6A 3NH2A 1JXBA 3NDKA 1JLBA 1GOCA 1B92A 1W9HA 1KTQA 1CZ9A 4GW6A 3OYMA 2ITGA 4ZTFA 3UIQA 4M3UA 1SL0A 1NKBA 4ELUA 1C0MA 1HNVA 3ZSWA 1ASWA 2ZQBA 3MEDA 4ID1A 3VQ7A 1XI1A 4FJGA 5KRSA 3OYKA 2D5RA 3AVLA 1RBUA 1TV6A 1FK9A 3VQ9A 4EP4A 3CM5A 4DTPA 4QAGA 2IS3A 1JLCA 3AV9A 3K5NA 4CJWA 1HJRA 4K8ZA 3CFOA 4J2AA 3HPOA 3O4QA 4RW6A 2HW3A 5DK5A 4DTOA 3BGRA 4B9MA 5HRRA 4JS5A 1SL2A 2HVHA 1ASUA 3PX4A 2G8UA 4AHCA 3V9ZA 1VSMA 4Q0BA 1G15A 3L3UA 1JL1A 3AO1A 1Q8IA 4B08A 2GV9A 1WLJA 4KO0A 4Y1DA 3SV3A 4KTQA 4M42A 4JRPA 1RT2A 3G0ZA 4PA1A 2EHGA 1EETA 3SQ1A 1RDBA 1L3SA 1HQUA 5T7BA 1KSPA 4N41A 3P5JA 3L2QA 3QEVA 4BACA 4DTUA 1C6VA 3DM2A 3NF7A 2G8WA 3NGIA 3SV4A 4AHVA 4FLTA 3QO9A 3RR8A 1O1WA 2R7YA 4DF8A 3OYNA 1J53A 4CE9A 3LZIA 3TARA 1NJYA 1T05A 1DTTA 2RKIA 2YV0X 3KK1A 2AJQA 4C8MA 4CFAA 4DLEA 1IH7A 4DSIA 5FDLA 3HXMA 4BDZA 3V9WA 4YNQA 4OPJA 1JLFA 3NF6A 5SZTA 3OS0A 1L3UA 2HNYA 1XHXA 3C95A 3MEEA 1BHLA 4ELTA 1MU2A 1NK7A 1YTAA 4DQRA 1RDCA 4CJVA 4C8KA 2BANA 3QERA 3QINA 4IKFA 4DLGA 3KIOA 3RMAA 4E19A 4CK1A 1N6QA 4B9VA 4LH5A 4Z4IA 3VQEA 2Z1JA 3C6UA 5FROA 1A5WA 1FXXA 3WNGA 4B9NA 3WNHA 3V1QA 3DLBA 1QQCA 3L2UA 3V4IA 1BIZA 1SUQA 1QTMA 4FJ9A 2E6LA 2B6AA 3SQ4A 1CXUA 4DMNA 4PQUA 3OYJA 3S3OA 3KJVA 3O3FA 4FJIA 3SZ2A 3D0PA 4O0IA 3RTVA 1YVUA 1U48A 4CJ3A 4DFPA 3ULDA 1Z25A 3AO3A 4FJNA 1S1XA 3MXJA 4CEDA 1NK4A 5C24A 1TKDA 3F73A 4DU3A 3AA3A 3HO1A 1C0UA 1EX4A 4DTMA 4DFKA 1JXEA 5JS1A 4FK0A 3LP1A 1Z26A 1VSFA 1X1PA 3TAEA 4CCHA 4CHOA 4CJ5A 2YKNA 3K5OA 1C1CA 4CHQA 2XO7A 4HUFA 1TGOA 3OYAA 2ZE2A 1VSLA 3V81A 4DSFA 4QOZB 3ZT0A 2DFEA 3AVAA 4CEZA 4Z4EA 1IKWA 2P51A 1FKPA 3T3FA 1KRPA 1VSDA 3NAEA 1KLNA 2OYQA 2KTQA 3M8RA 1VRUA 3NHGA 2P5OA 1UWBA 1LAWA 2XY5A 3TAGA 3LP2A 4B9LA 1RTIA 3QEWA 1NKCA 1IO2A 3T19A 4CJKA 3L2RA 2YNHA 2ETJA 4ID5A 3VA3A 3SUQA 4W5OA 3OYHA 3DOLA 1X9WA 1RBTA 2VG7A 2KZZA 1RT6A 5CY4A 1FKOA 1ASVA 3NFAA 4CK2A 4CIGA 2YNFA 4Z4HA 4KTZA 3L2WA 1T03A 3AVMA 4I2PA 1J9AA 1NOZA 4OVLA 4RW4A 4OLBA 4DTSA 4AH9A 1NK9A 2F96A 3OY9A 3TAPA 1EKEA 3P83D 3VQ4A 2HHUA 5CYQA 1I3AA 4JS4A 3K57A 1U4BA 3O3HA 4ZHRA 1TK8A 2HVIA 5SWMA 1WAFA 2FC0A 3HP9A 4BDYA 5FRNA 4FLZA 3VQBA 2QXFA 2IDOA 2OZMA 1CZBA 3KLEA 4FZXC 1KVBA 3OYIA 1ITGA 1RT3A 4C8LA 3FFIA 4I9LA 2P1JA 4CF0A 4LSLA 4I2QA 1Q9XA 4CECA 2DTUA 4IDKA 4CEAA 3OYGA 1BL3A 3WNEA 4DQQA 4CGFA 4EZ9A 1C0TA 4KAZA 4B8CA 4M41A 1KVAA 4CHPA 4CFCA 1B9DA 1NJXA 4NCGA 2RF2A 2E6MA 3NE6A 3SJJA 2HMIA 4M3WA 1D8YA 1GOBA 1ZYQA 4CJPA 1TL3A 4CJEA 3S3NA 4BE2A 2X6SA 4KFBA 2F8TA 4FJ5A 4FW1A 2QK9A 4E7JA 4FM2A 3VQDA 3KK3A 1N5YA 2IAJA 3BDPA 4CIEA 1ZBFA 4G1QA 4ICLA 2HNDA 2G8KA 2HHTA 3AO4A 1YTUA 4W5RA 4DTRA 3A2FA 4M3RA 3HVRA 3SCXA 3HYFA 1XHZA 3HSTB 2XY8A 1SL1A 1A5XA 1LW0A 1S1WA 4HTUA 4H8KA 4E7LA 5I42A 4PUOA 5K14A 4KHWA 1VK0A 1VRTA 1CXQA 4M3ZA 2BE2A 5HP1A 1UA0A 3LALA 4H4OA 3K5LA 1RTDA 3PO4A 1WAJA 3NGYA 4H4MA 3SUNA 4FJLA 4N5SA 5C42A 1UOCA 3TWHA 3KTQA 4E7IA 1L3TA 1SV5A 1YT3A 1ZBUA 3RRHA 1S6QA 4OKJA 3T1AA 1SKRA 4F3TA 2B5JA 3AO5A 3OYLA 4DTXA 3QETA 2ZD1A 2HHVA 1JLQA 1TK5A 4CHZA 4CHNA 4CJ4A 2KZMA 1SKSA 4ZTJA 3K58A 1R0AA 3KLFA 1LW2A 1DTQA 3QLHA 4CJSA 3NH0A 3LDSA 1QHTA 4FJ8A 2HHWA 4AHSA 1RBVA 4LD0A 1UA1A 3TAMA 3ASMA 3G10A 4OGEA 4CJQA 4M3XA 4CHYA 1QSLA 1NK6A 2NUBA 1IG9A 2BDPA 1RDAA 1EXQA 4KI4A 3NF8A 3RMCA 2IOCA 2O4GA 4HUGA 5HRPA 3AA2A 5JS2A 4FK2A 1T8EA 4DSLA 1B9FA 4KB1A 3U3GA 4CF9A 3HP6A 5J2QA 3RMDA 1JKHA 1LAVA 3RMBA 5HBMA 4NYNA 3CQ8A 3DOKA 3CFPA 4FW2A 1ZBIA 1WN7A 3V1OA 3AVCA 3C94A 3VQAA 5J1EA 1S9GA 1VSHA 2FBYA 3LP0A 3VA0A 1TKTA 3S3MA 4Z4GA 1EP4A 2D0AA 3VQCA 4CJUA 4JLHA 2PZSA 4CF8A 4KHYA 4FK4A 1HRHA 2XY7A 3DLKA 1J54A 4KKOA 3WNFA 4Z0UA 3QIOA 1U47A 4MFBA 3ZSRA 2LSNA 1WNSA 4R5PA 1S1TA 3DMJA 3OVNA 4CF2A 4DU1A 3AVHA 3MXMA 1WSIA 1RT4A 1Y97A 4TSXA 2Q3SA 4CJFA 3OYBA 3OYDA 4BE1A 3TABA 5D3GA 5CZ1A 5HROA 3O4NA 1JLGA 4YFUA 3TR8A 5J2NA 3OJSA 4LY7A 4DFJA 4N76A 3ZT3A 4DTNA 5HRNA 2HHSA 4CJTA 3ISNC 3P1GA 3ZSYA 4QCLA 4CFDA 1NK8A 4Z4FA 4F3OA 3KKRA 3AVJA 4M3YA 2EX3A 1KVCA 4KB0A 4KHNA 3QESA 2VWKA 3SQ2A 4FYDA 4CK3A 1RCHA 3ZSZA 4AHTA 2P5GA 5FRMA 2FBXA 1RT7A 1XC9A 3QEPA 2JLEA 2I5JA 1HYVA 4C8OA 3RR7A 3O3GA 3DLRA 1J5OA 4OKKA 4NCBA 4FJHA 3IG1A 5J2MA 5CYMA 4Y1CA 2QKBA 1UAXA 3AVNA 1REVA 1VSIA 1RILA 5KGXA 4B9TA 4F8RA 3NF9A 3JSMA 3L2VA 3EZ5A 2VWJA 4MQ3A 3MECA 3TANA 3TAQA 4HVJA 4KV8A 4WE1A 1S1UA 2DFFA 3B6PA 3C6TA 4CGHA 3ITHA 1L3VA 4DSJA 2Z1HA 3ZSOA 3MEGA 1NKEA 2YNIA 4LSNA 2BGGA 3THVA 3L8BA 4IBNA 2HNZA 1ZBLA 4DSKA 1NJWA 2X6NA 2E4LA 3KD5E 1WSEA 1LWEA 3CFRA 4FLXA 4BWJA 4OLAA 4UQGA 1WSFA 4FZYA 3KD1E 3AVGA 4M45A 4KHSA 4BDPA 1RDDA 1RBSA 4CJRA 3SI6A 2G8IA 4DFMA 1IKVA 4RW9A 1S1VA 3KLHA 2GBZA 3SPZA 1HPZA 4NYFA 3F9KA 1WSGA 4M3TA 3NH1A 1BISA 3RRGA 3NGZA 1TKXA 4W5NA 4CERA 5KGWA 1LWCA 3ZCMA 3OS1A 3LANA 1QE1A 2RN2A 4BE0A 4IFVA 3PUFA 4FM0A 1U45A 1W0HA 4AHUA 2FBTA 3LPTA 4W5QA 2QKKA 3RWUA 2KFNA 3M8QA 2ATQA 3DI6A 4KHUA 3AVFA 4NCAA 4FXDA 4CEFA 4RW8A 1C1AA 4OJRA 2YHAA 3ZT4A 3OS2A 3LP3A 2OA8A 1JLAA 2PYLA 1BGXT 3QEIA 4O5BA 4FLUA 1BCMA 3QEXA 2YNGA 4CFBA 2D0CA 4E7HA 4CEEA 1KLMA 2B4JA 1WSHA 3CYMA 3VQ6A 2PY5A 1BI4B 3KKSA 4RW7A 4GMJB 4CIFA 4OPKA 2YKMA 3VN5A 4O55A 3PV8A 1QSYA 4E89A 3ZT2A 1ZBHA 4E1NA 4DU4A 1BIUA 3V9UA 3DLGA 3NBPA 3HL8A 1VSJA 3VQ5A 3JYTA 1S6PA 3SYZA 4J2DA 3DLHA 1TVRA 2G8FA 1I39A 3ZSVA 2RPIA 3LWLA 1S5JA 1JL2A 3SQ0A 2KW4A 3SPYA 3VQQA 3QNNA 4N56A 4J2BA 5DMRA 2Z1GA 4LH4A 2X78A 1QSSA 3IS9A 3IAYA 4KHQA 3QIPA 4C8NA 1BQMA 2GUIA 4DQSA 4FLWA 3V6DA 4PY5A 4KRFA 3HPGA 4F4KA 3K5MA 4FJKA 4O0JA 1TKZA 4CESA 1CLQA 1KCFA 4EZ6A 4OKEA 4KPYA 2G8VA 4I9QA 3IRXA 1GOAA 1QS4A 4KREA 2JGUA 3V9XA 4DS5A 3OYEA 2KFZA 4EP5A 2VG5A 4K8XA 4E0DA 3PX6A 3SUPA 1TK0A 2OPSA 4CGGA 1NOYA 4B9SA 4IFYA 4FJXA 1K6YA 1TAQA 3HT3A 3KK2A 3LZJA 1C1BA 5KRTA 3PO5A 3TAFA 4DQIA 2W42A 3CG7A 4CF1A 5KTQA 4FJJA 1X9SA 5I3UA 4Z4CA 4FZZA 3SUOA 4E7KA 2A1SA 3HM9A 5C25A 4PWDA 1X9MA
chains in the Genus database with same CATH superfamily
3LWMA 4F2RA 3LDQA 3DYAA 3AO2A 1RTHA 1V4TA 2DY4A 1N36K 2D0BA 3TU5A 4JKBA 1VSEA 3BF3A 1D4XA 5LJVA 3DRPA 2WOMA 5FPNA 2IGIA 1RT5A 3U3YA 4Q5VA 4J2EA 4F9OA 3CCEN 1RBRA 2FF3B 3AVIA 1RT1A 2X74A 3M8PA 4AILC 2KQ2A 4CEOA 2WTUA 4DF4A 3F2KA 4BC4A 4FLVA 2XHBA 1NGDA 3M8SA 1JLEA 3OYFA 2W40A 1JCGA 1KXPA 3CCSN 3QNOA 3QFUA 1K8AO 1RTJA 4A2AA 1RNHA 1F21A 3VQPA 3VENA 4FJMA 3B6OA 4BRFA 4IFEA 4BREA 3HOTA 3VQ8A 3AA5X 3MX2A 3WQTA 4BRGA 4CZEA 3PY8A 4B3RK 2DFHA 2P9PB 5CHIA 4C1NK 1NGJA 4O44A 5TKYA 3AARA 4BQZA 4KH5A 4CZFA 4E3SA 3D45A 1TL1A 2OCEA 1D5AA 1LCUA 4CZIA 4U7BA 3HM8A 4HUEA 3SNNA 3FLCO 3NH2A 4BG9A 2HF3A 3TTCA 1K9MO 1W9HA 4M3UA 1NKBA 2ZQBA 4ID1A 3OYKA 2D5RA 3PSIA 2QWLA 1TV6A 3VQ9A 4QAGA 1JCFA 2IS3A 1JLCA 3AV9A 4BRNA 4RW6A 1P8ZA 2NRXA 2HW3A 5AQHA 4JS5A 5BRFA 2G8UA 1U2VA 1G15A 3L3UA 2ASPA 3AO1A 2HBKA 2GV9A 1WLJA 4CD3A 3SV3A 4JRPA 2EHGA 4DR6K 1S3XA 3AGKA 1KSPA 5AQIA 3P5JA 3QEVA 4FWLA 3DM2A 3KZBA 3SK3A 1O1WA 2R7YA 3D2FB 3D2EA 4JI5K 4JKGB 3I55N 2RKIA 1OVYA 2YV0X 3O8MA 4IZ9A 3TTFA 4YNQA 4OPJA 1JLFA 3G25A 5SZTA 3OS0A 3DAWA 4ELTA 1RDCA 1HLUA 2V7YA 3QERA 4IKFA 4DLGA 4B3TK 1NGGA 2Z1JA 3C6UA 3LDOA 1VQ4N 3E1YA 2NRZA 4FJ9A 1QQOA 2B6AA 4JK7A 5AQGA 2E8AA 3R8EA 3KJVA 4YY3K 2KLAA 4CJ7A 5M1KA 4DFPA 3MXJA 1NK4A 4Z94A 5C24A 1TKDA 1C0UA 4DTMA 2E20A 5JS1A 2P9IA 1Z26A 1VSFA 3SMSA 2HBLA 2YKNA 3K5OA 2UUCK 1C1CA 2ZE2A 1VSLA 4QOZB 1W7AA 3ZT0A 3AVAA 4CEZA 1IKWA 1FKPA 3EL2A 4BRQA 5C2DA 5KPZA 3NAEA 2OYQA 3NHGA 1UWBA 3LP2A 3N4PA 1NMDA 3T19A 5A2QO 1NLVA 4WF9L 3OYHA 1GLEG 1RT6A 1T03A 4A62A 3AVMA 2P9LB 1J9AA 1NOZA 4RW4A 4JHDB 4B1VA 2F96A 3TAPA 2JWKA 4BGAA 4FWNA 3K57A 3CCQN 1TK8A 3WXLA 5ADXA 1J5EK 4FLZA 1K73O 3VF4A 2OZMA 4IEIA 3K9KA 5AQFA 1ILYA 3AGRA 4LF5K 1RT3A 4C8LA 3FFIA 4CF0A 3CF5L 4IDKA 5DM6L 5BR9A 4CGFA 4KAZA 1VQNN 1YHQN 1B9DA 3ATVA 4AM7A 3SJJA 2HMIA 4FWQA 2UXBK 1GOBA 1ZYQA 3S3NA 3I8BA 4FM2A 3A5MC 3VQDA 1N5YA 5HOOA 2NLXA 2HNDA 2G8KA 4IOAL 3AO4A 4KBOA 4W5RA 3P39A 3A2FA 4EFHA 4M3RA 2XY8A 1SL1A 2JWLA 3DJCA 4M7XA 4DV7K 4H8KA 5M1OA 2QTDA 4PUOA 1VRTA 2NRVA 4H4OA 4IOCL 4N5SA 3ZETA 3KTQA 1GLJO 3TWHA 4E7IA 3E66A 4BRCA 1ZBUA 3MN5A 3T1AA 2A5XA 5ADXH 3AO5A 3CD6N 3QETA 3VOVA 3L4QA 4CHZA 1SKSA 5KPRA 3QLHA 4JV5K 1KC8O 3FZHA 2A3ZA 5LMNK 1QHAA 1IG9A 5EX5A 3NF8A 5AQUA 1NM1A 5HRPA 3NMUA 5JS2A 4FK2A 1T8EA 2YHYA 4KB1A 3U3GA 1HUXA 3OBWA 5J2QA 3RSEA 5HBMA 1SQKA 3DOKA 3CFPA 3CJ1A 1NGIA 3MX5A 4GVEA 5GAEP 2Q2RA 3V1OA 5J1EA 1VSHA 2FBYA 2QWMA 1TKTA 1EP4A 4JHDA 1XC3A 2XY7A 3WNFA 1J54A 1TYQA 3QIOA 1U47A 4R5PA 4IEEA 3AVHA 3DXMA 4JKCA 5EVZA 2P9UB 4XEIA 3GDQA 3O4NA 1JLGA 4LY7A 1TUYA 3CHWA 2HF4A 4CFDA 3J8AA 4IO9L 3UKRA 4F3OA 3KKRA 4M3YA 4KHNA 4K25A 3QESA 4ILJA 4FYDA 1GLBG 4CK3A 2A6AA 4AHTA 2FBXA 1RT7A 2E2OA 3QEPA 2I5JA 2YCHA 2VGNA 1YXQA 3IG1A 4Y1CA 3WXJA 1UAXA 1REVA 4KHPK 3FE1A 4B9TA 4F8RA 3NF9A 4BR5A 3JSMA 4JI1K 1HR0K 2VWJA 3TANA 4HVJA 4WE1A 4K41A 1GLDG 3B6PA 2VCPA 3ZSOA 3VMFB 3R9PA 4C23A 3THVA 3L8BA 4CZLA 2P9NA 4BQLA 1WSEA 3CFRA 1YI2N 3UE5A 4OLAA 3KD1E 1IKVA 4RW9A 2GBZA 4M3TA 3NH1A 4W5NA 5KGWA 1LWCA 3ZCMA 4WQ5C 4FM0A 2FBTA 1IG8A 3M8QA 3DI6A 4FXDA 2ASMA 2CH5A 4BC5A 2YHAA 3SBGA 3LP3A 2O8CA 4PWDA 1C0GA 1BGXT 2V7ZA 2QWRA 1KAZA 5AQRA 3QEXA 4A2BA 2P9SA 2O8EA 1KLMA 2WBNA 2E88A 1QVGM 3VQ6A 3CYMA 2AP1A 4QS8A 3PV8A 1QVFM 4E89A 3CIPA 1BIUA 3V9UA 3HL8A 5C0YA 2P9KB 4J2DA 2GWJA 2Q1NA 3VF6A 3LWLA 1HNZK 3SQ0A 2IIRA 1HKGA 2KW4A 2VQFK 3PIOL 3QNNA 3VF2A 4JD2B 4GV3A 4LH4A 3IAYA 4KHQA 4C8NA 4O8KA 4AM6A 5AQOA 4PY5A 3HPGA 4CBWA 4EIAA 3DLLL 4DR7K 4O0JA 4CESA 5M1QA 1GOAA 3V9XA 4RTFD 4EP5A 4B3MK 4IFYA 3TPQA 1K6YA 1TAQA 3HT3A 3LZJA 3CG7A 2ITMA 5KTQA 4E7KA 3H3NO 5BRDA 1FW6A 4R79A 5C25A 3CJAA 1KD1O 1Q7YO 5GIPA 4RG8A 3KHYA 4CGDA 2KHOA 2ZWHA 4FVMA 5I9EB 3V9SA 4YOYA 1KFDA 3SAGA 3ZSQA 3OJUA 1EWRA 3I0RA 3CC2N 2WONA 4HCBA 3DRRA 1A5VA 4CZGA 4CZMA 4HHTA 4CJLA 1S9EA 2Y1IA 5CE3A 1NK5A 1NK0A 2BGGA 4I7FA 3AY9A 2ZF5O 5AQZA 2FBVA 3I0SA 5AZIA 3D2EB 4F2SA 3SJHA 3KLGA 3K59A 1VQ9N 5HRSA 3MXIA 4CD1A 3L3VA 4L8RB 2QI2A 2YHBA 2ZGZA 3PX0A 3ZSXA 2HB5A 3TTDA 4FLYA 4CEQA 1XWLA 3H08A 2O4IA 4DKWA 4CGIA 2O8DA 2O8DB 2OZSA 2IC3A 4DQPA 5JICA 5CZ2A 1SKWA 1IKXA 1BCOA 1OH6A 4B3OA 4FOIA 1VQ5N 2H3GX 3T69A 2YJEA 4OGCA 5KI6A 4O8UA 5IWAK 3H46O 1H1VA 3EEQA 1ATNA 3UIQA 1KTQA 3FR0A 1WOQA 4ELUA 3ZSWA 3EO3A 4FJGA 1S72N 3RVCA 1XI1A 2WUSA 2ZJRL 1RBUA 4EP4A 4A61A 4JK9A 1YF5L 3QB0A 4GV6A 5AQYA 3K5NA 3PSFA 3MN6A 3VPZA 5AQSA 5DK5A 1P90A 4CBXA 4B9MA 3OBYA 3QFPA 1ASUA 3PX4A 2HVHA 2YHXA 2EWSA 3O9SA 1EWQA 1L3SA 1EETA 1BWFO 3ID6A 5GADP 4JKAA 3G6EN 2G8WA 5F0XA 4JK8A 3NGIA 4AHVA 4GKJK 1W2BM 4LF7K 3QICA 3LZIA 1NJYA 3C6HA 4C8MA 4DLEA 1IH7A 4A59A 4BDZA 1M90O 2Q31A 3VTHA 2HOEA 1L3UA 1XHXA 3MEEA 4BC2A 1MU2A 4DQRA 2BANA 2HSTA 4FWRA 1QZ6A 5EOYA 3RMAA 1N6QA 3VGKA 4B9VA 4LH5A 4Z4IA 3VQEA 4WQ5A 5JVGL 4BVPA 3DLBA 1QQCA 1BUPA 3V4IA 1BIZA 1QTMA 4GKKK 3SQ4A 4H5WA 3H45C 4NO7A 4DMNA 4PQUA 4WQ4A 4XH1A 4CJ3A 3CCRN 1Z25A 3ULDA 1S1XA 3HOSA 3HO1A 3MCAB 1EX4A 4RWTA 5C12A 3O9QA 4M63C 2A42A 4HUFA 3LL3A 4MLEA 3SMPA 4DSFA 3KWGA 1TUUA 4J8FA 4Z4EA 2F9TA 2P51A 1KRPA 1VSDA 3M8RA 1VRUA 3ENHA 5M1FA 4CZHA 3BF1A 3O08A 4W5OA 3DOLA 2VG7A 1FKOA 3NFAA 3CPEA 4YOTA 4OLBA 4AH9A 1FJGK 5LMUK 1VAZA 3VQ4A 2HHUA 1I3AA 4ZHRA 5BPNA 2ZM6K 1WAFA 5CR4A 4BDYA 4LFAK 3TSUA 4FWMA 4DV3K 2D1KA 2NRTA 2VQEK 3KLEA 5AFUH 4FZXC 4BRDA 4LSLA 4I2QA 1Q9XA 2HBMA 3OYGA 2VYPA 4DQ8A 3I56N 3ENOA 4CZJA 3D7EO 1E4GT 4NCGA 4LFBK 5MLCQ 1HNXK 3HTVA 4CJPA 3ENBA 4FW1A 3O1BA 3CCLN 4G1QA 4ICLA 1YTUA 4L3QA 4BRHA 3HVRA 3HYFA 3WT0A 4IO8A 4FL9A 1K8KA 4HTUA 2QA4N 4E7LA 3BZKA 4KHWA 3LALA 3PO4A 3VEYA 1WAJA 5C42A 1SV5A 1IJJA 1S6QA 1LOTB 2B5JA 3OYLA 4DTXA 5F2RA 2KZMA 4ZTJA 3K58A 3EKUA 1DTQA 4B3SK 3NH0A 3FZLA 4AHSA 1UA1A 3Q7BA 2YX6A 3G10A 1C0FA 4FPBA 4OGEA 4CJQA 5GINA 4M3XA 4CHYA 2GELA 2IOCA 1S22A 2O4GA 3U9DA 1GLCG 4DSLA 1B9FA 3HP6A 4PHTX 3RMDA 1WN7A 3AVCA 3C94A 4I6MB 3VQAA 3LP0A 4Z4GA 5KQ8A 3SAHA 2D0AA 5FPMA 4CJUA 4DCHA 4CF8A 4KHYA 3DLKA 5AQNA 2O8CB 3ZSRA 1WNSA 2PBDA 3DMJA 3TSPA 4DU1A 3ZETB 3L0QA 3MXMA 1WSIA 1Y97A 5C15A 4CJFA 3OYBA 4OO1J 1Z6RA 3TABA 5CZ1A 4LC9B 3IUCA 4DFJA 3BY5A 5HRNA 4H0XB 3M1FA 1X9JA 4Z4FA 3VEOA 4KB0A 4OPHA 4JKEA 5AFUA 4WFAL 3T7ZA 3ZSZA 2P5GA 1XC9A 3DLRA 4OKKA 4RCHA 2QKBA 5CYMA 5AQTA 1VSIA 3AVNA 1RILA 1DKGD 3TAQA 4PKIA 3VTIA 1S1UA 2FF6A 1L3VA 3ITHA 3E9OA 1NKEA 4JKHA 4LSNA 3AAPA 3LDNA 4DSKA 3T1HK 3HI0A 4JAXA 1NGAA 4PKGA 3THYB 3ATUA 3FZFA 4UQGA 4FZYA 1W97L 4DV6K 4BDPA 4CJRA 1RFQA 5FLXO 4DV1K 3JXUA 3SPZA 3F9KA 1WSGA 3NGZA 1TKXA 1JJ2M 4BE0A 3OS1A 1QE1A 2RN2A 3J7AP 4IFVA 4BVOA 2ATQA 4KHUA 3AVFA 4OJRA 1ATSA 2OA8A 3FZMA 3QEIA 4FLUA 1BCMA 4DV0K 2FSJA 4CFBA 2D0CA 3EE9A 1OH8A 4BRPA 4BC3A 5DM7L 1JCEA 1BI4B 3FGUA 3O6WA 2GUPA 2HBJA 5AQWA 4OPKA 3G71N 3VN5A 1ZC6A 4E1NA 4DU4A 3DLGA 3C0BA 4JKGA 3DLHA 2RPIA 4K42A 1JL2A 1BOTO 4N56A 4J2BA 5DMRA 2Z1GA 3VERA 1BO5O 5AQVA 3JS6A 2GUIA 1WUAA 3QBXA 4YOVA 3VEZA 1K8KB 3WXKA 3V6DA 4KRFA 4F4KA 1CLQA 3M5RA 1KCFA 4KREA 1BA0A 3OYEA 2QWQA 2KFZA 2P9IB 3SUPA 2OPSA 4CGGA 4FJXA 1VQLN 1Y64A 4H5RA 1YAGA 3KK2A 5KRTA 4FJJA 4FZZA 2CH6A 2NNWA 3WUHA 3HM9A 5JVHL 3O9RA 2XRIA 4IG3A 4N47A 4BY9C 2YJFA 4B8AB 4FCYA 3P4IA 2VG6A 3HVTA 1YJNN 1L5UA 1N32K 4BWMA 3K2PA 4KTWA 3MAQA 3DRSA 4BR2A 3U4LA 4DWIA 1IV0A 3E01A 4O4GA 2O8FA 1Q9YA 1NWKA 3KLIA 3H3OB 4LF6K 3V1RA 4NCBA 4BRAA 1U2VB 5AQMA 3TI0A 3AVKA 1U49A 3DLEA 3H6EA 3LPUA 3UKUB 1VSKA 3S9HA 2UXDK 2XY6A 4DR4K 1YITN 2F8SA 3AVBA 4DG1A 3A8YA 3MK6A 4DV4K 4DSEA 1IBLK 1TAUA 2V51B 3K9JA 3CC7N 2OPPA 1DLOA 4FLXA 2P9KA 3ALYA 4GVMA 5JLHA 4V19S 4CGJA 4FJ7A 1VQ6N 1RGIA 4E1MA 1XNQK 1DEJA 2ASOA 1T7PA 3NVKA 1XMQK 3HK2A 1X3MA 5EU7A 3CM6A 1KFSA 5C2FA 1NGHA 3KWIA 1BI4A 1MWMA 3E9PA 1BQNA 4NB4A 3P31A 3RSEB 4XIUA 3OYCA 3G4SN 3OHRA 3NDKA 1KAYA 1JLBA 3R6MA 1B92A 4GW6A 4H5VA 1E3MA 3S41A 1SL0A 4YOUA 1C0MA 1ASWA 1GLFO 3UKUA 5KRSA 1SAZA 1FK9A 3CM5A 5AR0A 1KAXA 4CVNE 2RHKA 4JI4K 4CJWA 4ILHA 1HJRA 1XMOK 3BUZB 3HPOA 3CERA 4J2AA 3O4QA 3L4IA 2QXLA 4DTOA 3BGRA 5HRRA 3FZKA 1SL2A 1NJIO 4H5NA 3W0LA 1JL1A 1Q8IA 4B08A 4Y1DA 4M42A 1RT2A 3U8XA 3G0ZA 3EN9A 4PA1A 3SQ1A 1RDBA 5FPDA 4BACA 4DTUA 1C6VA 3NF7A 3SV4A 3RR8A 3QO9A 5AQPA 1J6ZA 4DF8A 4ISGA 1J53A 5GAHP 4CE9A 1T05A 3KK1A 2AJQA 3A0IX 4CFAA 1OVQA 3EZWA 3HXMA 4DR2K 2OTLN 3NF6A 3UB5A 3C95A 1BHLA 3WXIA 1NK7A 4B1ZA 4X65K 4C8KA 4UY8O 2P9NB 5F1XA 3KIOA 2PFUA 5EXWA 4CK1A 4A5BA 3B8AX 5FROA 1YIJN 1FXXA 3WNGA 4B9NA 3WNHA 3V1QA 1SUQA 1NGFA 2A41A 2E6LA 2F9WA 3EKSA 3OYJA 4FJIA 3O3FA 3SZ2A 3D0PA 4O0IA 4PL8A 1U48A 4FJNA 1O13A 4BRKA 3Q7CA 3F73A 4AQYK 4BR9A 2NRHA 3LP1A 4WFBL 4CCHA 4FK0A 1G99A 3TAEA 4IXCA 4CHOA 4CJ5A 4JI7K 4H0PA 4CHQA 3J7YP 2XO7A 4BR4A 3MN9A 2W6KA 4JEPA 2UUBK 2P9UA 4MO4A 3ID8A 3DXMB 2KTQA 2P5OA 1LAWA 2XY5A 4XH5A 4B9LA 1RTIA 3QEWA 1NKCA 1IO2A 2HMPA 5M1NA 2NRRA 4CJKA 3L2RA 3VA3A 1HKBA 5E84A 1X9WA 4CK2A 1ASVA 2RE2A 4CIGA 2YNFA 4KTZA 3L2WA 4OVLA 5LJWA 3OTOK 4DTSA 1NK9A 3F9MA 4MDAA 1V4SA 1EKEA 1T3VA 2GWKA 1XNRK 3CPWM 5LY3A 3OA9A 4DV2K 2FC0A 3HP9A 5M1PA 3NVMA 3VQBA 2IDOA 3CCMN 1QQNA 1VQKN 4BROA 3CC4N 3OYIA 1ITGA 3O80A 3CMEN 2P1JA 3A5LC 4CECA 4WCEL 4CEAA 3WNEA 4EZ9A 4LFCK 4ISFA 4B8CA 4M41A 4CHPA 3PIPL 5E26A 2E6MA 1NGEA 3LM2A 4M3WA 1D8YA 4IOXA 1TL3A 5JLFA 2FXUA 2F8TA 4FJ5A 5AQJA 3KK3A 2IAJA 4JI6K 4DUYK 2O8FB 3CJ9A 5ELZA 4DTRA 3SCXA 3HSTB 1A5XA 2QEXN 1S1WA 2E2PA 1DGKN 5I42A 1OH7A 3GG4A 4YHHK 1VQON 1HX1A 1VK0A 1CXQA 4M3ZA 4XH4A 5HP1A 4B1UB 1UA0A 3K5LA 2KZZA 4E1JA 3NGYA 4H4MA 3QBWA 4CBUA 3M6GA 3MWPA 1YT3A 4OKJA 2P9LA 4F3TA 2HHHK 4B9QA 2ZD1A 2HHVA 5BPMA 1JLQA 1TK5A 4CJ4A 4YOWA 1R0AA 3KLFA 4FJ8A 1QHTA 3LDLA 2O8BA 3WEEB 4BGBA 2FSNA 1QSLA 1NK6A 4KI4A 3RMCA 1Z05A 4FWOA 4HUGA 3AA2A 5H1SQ 1MA9B 4H0TB 4PKHA 3RMBA 3CQ8A 4NYNA 4FW2A 1S9GA 3S3MA 1VQ7N 5AQXA 2VGMA 4DR1K 2PZSA 4K43A 4FK4A 1HRHA 3VEWA 2Q36A 4MFBA 1T6CA 3ZYYX 3CCUN 3ZLJA 1ZXOA 1RT4A 3ULEB 3OYDA 4ISEA 5HROA 4DUZK 4YFUA 3PLAA 3TR8A 3OJSA 2HHSA 3ZEUB 1Q82O 3P1GA 3DWLA 3SBTA 1YJ9N 4WFNL 3AVJA 2EX3A 1KVCA 4FWKA 1RCHA 3KVGA 1MWKA 5FRMA 1HYVA 3RR7A 1J5OA 5J2MA 4NXNK 5KGXA 3QDKA 2PAVA 3EZ5A 3ZEUA 3C6AA 3UKRB 4KV8A 4CGHA 1BU6O 2Z1HA 4FO0A 3MEGA 2YNIA 2NZTA 4IBNA 1ZBLA 2X6NA 3CCVN 5FPEA 5AZJA 4BWJA 3AVGA 4JI3K 4FWPA 5BN8A 4KHSA 2ZGYA 4GNIA 5AQKA 4AF1A 4CW7B 3SI6A 2G8IA 5HL7L 4DFMA 1S1VA 3DXKB 2IVOA 3N4QA 3KLHA 4YOXA 3O9UA 4NYFA 3RRGA 4CERA 5GIOA 1U45A 1Q18A 2KFNA 4JN4A 4U67L 3GBTA 3HRGA 3ZT4A 1TYQB 1NBWA 1JLAA 2PYLA 3A5NC 2GEMA 3U9ZA 2I7NA 4IDHA 5BPLA 4A57A 4CI6A 2YNGA 4E7HA 2PY5A 1WBDA 4RW7A 4CIFA 5JMVA 1VQMN 1ZBHA 3D6RA 4WQ4C 4H0OA 3NBPA 3SYZA 3KK7A 4GY2B 1I39A 3H1QA 4BR0A 3VQQA 2X78A 1QSSA 2DPNA 3QIPA 1YJWN 1BQMA 1NG9A 1WBBA 2E5LK 4B1WB 1SZ2A 3A5OC 5LL6Z 2W6LA 4OKEA 4KPYA 4OX9K 1NMNA 2G8VA 3IRXA 1QS4A 2JGUA 3J81O 4DS5A 4K0KK 4K8XA 1TK0A 1C1BA 2QW9A 4DQIA 2W42A 1X9SA 5I3UA 3SUOA 3IDHA 3HBTA 3VEVA 3HPHA 5HLFA 3U6FA 2Z1IA 4NLBA 3LAKA 3THWA 4CEBA 4DTJA 3TSQA 2HHXA 3VESA 4DV5K 3HJFA 2P9SB 1NJZA 4ELVA 2NRWA 4IG0A 2G8HA 1Q86O 1Q81O 2Y1JA 4FM1A 2OPRA 3I8DA 5J2PA 1LV5A 1D9FA 1IKYA 1HYZA 3DXKA 3O4WA 1OH5A 1VQ8N 3EYZA 3IFRA 1ATRA 4LF8K 1U04A 1HQEA 2QM1A 5E41A 3AA4A 3ZT1A 4ILGB 1D9DA 4W5TA 2UYTA 4DHYA 2Q97A 4AHRA 4KI6A 4JRQA 4FPAA 2F4VK 2OPQA 4I6MA 2HHQA 2E1YA 4HCCA 2BH1A 3EY1A 4MDBA 4WYBA 1WSJA 1HMVA 1LWFA 1NGCA 4B9UA 3BZCA 2A1RA 2UU9K 2PYJA 1E4FT 3LAMA 2GTDA 4DS4A 3THYA 3NCIA 4FVUA 3THXB 1HYSA 5TKWA 1EO1A 1HNIA 1T44A 1JXBA 3R3LA 4JYAK 4H0VB 1GOCA 3OYMA 4ZTFA 1CZ9A 2BTFA 2ITGA 4DB3A 4DR3K 1HNVA 4Q0BA 3MEDA 3VQ7A 3AVLA 1YUWA 4DTPA 1GLLO 4QS7A 4K8ZA 3CFOA 4NLCA 4AHCA 3V9ZA 3THWB 1VSMA 2FLOA 2AA4A 4KO0A 2UUAK 4KTQA 4M7YA 3GOIA 1HQUA 3FFKB 5T7BA 2ZJPL 4N41A 3L2QA 1HPMA 3J80O 4FLTA 1WB9A 3OYNA 1NNEA 3TARA 1DTTA 3CXCM 4DSIA 3ZX3A 5FDLA 3WQUA 4JD2A 3V9WA 4GV9A 3OW2M 3WEEA 2HNYA 1BG3A 4BRLA 1YTAA 3M3ZA 4CJVA 3QINA 4E19A 4IJNA 4KH4A 1A5WA 3J7ZO 3L2UA 2D0PA 4X62K 4JI0K 1CXUA 1RDUA 2BUPA 3S3OA 3F5TA 5AZIB 3RTVA 4OPAA 1YVUA 3AO3A 4BRMA 4CEDA 3ZX2A 1YVNA 1BDGA 2Q0RA 3CQYA 4DU3A 3AA3A 2OTJN 4DFKA 2VWBA 1JXEA 4YDUA 4H03B 1X1PA 3I33A 3HSCA 2CGJA 2ZJQL 3V81A 1TGOA 3OYAA 2DFEA 3LM9A 5AJ3K 3CJ7A 2D0OA 3T3FA 1KLNA 2I7PA 3QMLA 3TAGA 4X64K 3VEXA 4FOEA 2YNHA 2ETJA 4ID5A 4BG8A 2FSKA 4C1NI 3SUQA 3O1WA 2E2QA 1I94K 1RBTA 1X3NA 5CY4A 4Z4HA 2IVNA 4I2PA 3VGMA 5BR8K 1RDWX 1XQSC 3BP8A 3OY9A 4HTLA 3P83D 5CYQA 4JS4A 1U4BA 3O3HA 2HVIA 5SWMA 4KH6A 5AZJB 4LF4K 5FRNA 2QXFA 1CZBA 5IT9O 1KVBA 2OANA 2Q0UA 4I9LA 1VQPN 3LDPA 2DTUA 1KQSM 3VGLA 4JKDA 1BL3A 4DQQA 1C0TA 3K0SA 1KVAA 4CFCA 1NJXA 2RF2A 3NE6A 3CQXA 3WXMB 4CJEA 5BREA 4BE2A 1M1KO 2X6SA 4KFBA 1HKCA 4E7JA 2QK9A 3BDPA 4CIEA 1ZBFA 2HHTA 2F7TA 3CJCA 3H1VX 3SAFA 1XHZA 1GLAG 5BN9A 4B1YB 1LW0A 4EHTA 4HWIA 5K14A 3CJBA 2BE2A 1U6ZA 1RTDA 4FJLA 3SUNA 2WC9A 1UOCA 1L3TA 3RRHA 1CZAN 1SKRA 4JI2K 3L6QA 1EQYA 4FWSA 2D4WA 4MLHA 4YDUC 4CHNA 4CZKA 1LW2A 2HHWA 4CJSA 3LDSA 1RBVA 4LD0A 3TAMA 2O8BB 1VHXA 3ASMA 1N34K 2CGLA 2NUBA 4JKFA 2BDPA 1RDAA 1EXQA 3E9LA 2WFBA 1OKJA 4X66K 3R1XA 3GL1A 1DT9A 2V52B 4IWVA 4CF9A 3THXA 1JKHA 1LAVA 1ZBIA 4YORA 1IBKK 4MO5A 3VA0A 3VQCA 4JLHA 4Y0WA 4KKOA 4Z0UA 2LSNA 1NU0A 1MDUB 2O8EB 1S1TA 3OVNA 2KKZA 4CF2A 1HNWK 1IBMK 4TSXA 2Q3SA 4BE1A 5D3GA 3C7NB 5J2NA 1HJOA 3IKMA 4N76A 3ZT3A 4DTNA 4B1XB 4CJTA 3ISNC 3ZSYA 4QCLA 3P38A 1NK8A 3C65A 2VWKA 3O5BA 2E2NA 3EE8A 3SQ2A 3CCJN 2JLEA 4C8OA 3O3GA 4H0YB 4FJHA 5B8HA 3C7NA 1ESVA 3L2VA 4PL7A 3IMXA 3W3DA 2QWNA 4MQ3A 3MECA 5BRHA 2DFFA 3MMVA 3C6TA 4DSJA 4LF9K 3MWTA 3SLCA 1XUPO 2HNZA 2W41A 1NJWA 2E4LA 5EY4A 3KD5E 3MDQA 1LWEA 3CETA 3O9TA 2P9PA 4BRIA 1WSFA 4M45A 1RDDA 1RBSA 2GX9A 1BA1A 1HPZA 1R59O 1BISA 3LANA 3PUFA 2E1ZA 3RWUA 1W0HA 4AHUA 3HZ6A 3LPTA 4W5QA 2QKKA 1SS6A 4EHUA 3ULEA 4NCAA 4CEFA 4RW8A 1C1AA 3T1YK 4G9ZA 4QS9A 3OS2A 1N33K 4O5BA 4CEEA 2A40A 2B4JA 1WSHA 4BR7A 2J4RA 3KKSA 4O5FA 5C10A 4GMJB 2YKMA 4O55A 3CI5A 4A5AA 1QSYA 3ZT2A 2CGKA 3GE1A 3JYTA 1VSJA 3VQ5A 5KQDA 1S6PA 1TVRA 2G8FA 4NXMK 3ZSVA 3JAMO 1S5JA 4JI8K 3SPYA 1QZ5A 2IVPA 3IS9A 4H5TA 4JNEA 5GAGP 3CMAN 4DQSA 4FLWA 1T6DA 3K5MA 4FJKA 1QQMA 3MN7A 1TKZA 5AQLA 4EZ6A 1ZBSA 3VETA 4I9QA 3AAQA 3MCPA 2QWPA 3BEXA 2YI1A 2VG5A 4IJAA 2YHWA 3PX6A 4E0DA 2UXCK 5AQQA 4B9SA 1NOYA 2QWOA 1N8RO 4FSVA 4EAHD 3PO5A 3D2FA 3TAFA 4CF1A 5KPTA 4DR5K 4Z4CA 2A1SA 1NGBA 3ZX0A 1X9MA
chains in the Genus database with same CATH topology
3LWMA 3HPHA 2XRIA 4IG3A 4N47A 5HLFA 4B8AB 4FCYA 3U6FA 4F2RA 2VG6A 4RG8A 2Z1IA 3HVTA 3LAKA 4CGDA 3DYAA 3AO2A 1RTHA 4FVMA 1L5UA 4CEBA 4BWMA 2DY4A 4DTJA 3V9SA 2D0BA 3K2PA 4KTWA 3MAQA 1KFDA 1VSEA 3DRSA 2HHXA 3DRPA 3ZSQA 3HJFA 2WOMA 4DWIA 3OJUA 2IGIA 3E01A 1RT5A 4O4GA 4Q5VA 3U3YA 1Q9YA 4J2EA 1NJZA 3I0RA 4ELVA 2WONA 2G8HA 4IG0A 1RBRA 3KLIA 4HCBA 2Y1JA 3V1RA 3DRRA 4FM1A 3AVIA 1A5VA 4HHTA 1RT1A 1S9EA 2OPRA 2X74A 3M8PA 4CJLA 3I8DA 5J2PA 2Y1IA 4AILC 2KQ2A 3TI0A 1NK0A 4I7FA 3AVKA 1LV5A 1D9FA 1U49A 4CEOA 1IKYA 3DLEA 1HYZA 4DF4A 3LPUA 4FLVA 1VSKA 2FBVA 3I0SA 3S9HA 2XHBA 4F2SA 3EYZA 3M8SA 1JLEA 2XY6A 3OYFA 2F8SA 3KLGA 3K59A 3QNOA 3AVBA 1U04A 1HQEA 1RTJA 5HRSA 4DG1A 3MXIA 1RNHA 1F21A 3VQPA 3L3VA 5E41A 4L8RB 3AA4A 3ZT1A 4DSEA 1D9DA 4W5TA 4FJMA 2YHBA 1TAUA 3B6OA 2OPPA 1DLOA 4AHRA 3ZSXA 3ALYA 2HB5A 3AA5X 4GVMA 3VQ8A 4JRQA 3PX0A 4KI6A 4FLYA 4CEQA 4CGJA 1XWLA 4FJ7A 3H08A 4E1MA 2OPQA 1T7PA 3PY8A 4CGIA 2O4IA 2HHQA 2OZSA 4HCCA 3HK2A 2IC3A 2DFHA 4DQPA 5EU7A 3CM6A 3EY1A 1KFSA 4O44A 5CZ2A 1SKWA 1IKXA 1BI4A 1HMVA 1BCOA 1LWFA 1WSJA 4E3SA 3D45A 2A1RA 1TL1A 2PYJA 1BQNA 4B9UA 1D5AA 4B3OA 3LAMA 1NK5A 4DS4A 4HUEA 1HYSA 3NCIA 3SNNA 4XIUA 4OGCA 3OYCA 1HNIA 5KI6A 3NH2A 1JXBA 3NDKA 1JLBA 1GOCA 1B92A 1W9HA 1KTQA 1CZ9A 4GW6A 3OYMA 2ITGA 4ZTFA 3UIQA 4M3UA 1SL0A 1NKBA 4ELUA 1C0MA 1HNVA 3ZSWA 1ASWA 2ZQBA 3MEDA 4ID1A 3VQ7A 1XI1A 4FJGA 5KRSA 3OYKA 2D5RA 3AVLA 1RBUA 1TV6A 1FK9A 3VQ9A 4EP4A 3CM5A 4DTPA 4QAGA 2IS3A 1JLCA 3AV9A 3K5NA 4CJWA 1HJRA 4K8ZA 3CFOA 4J2AA 3HPOA 3O4QA 4RW6A 2HW3A 5DK5A 4DTOA 3BGRA 4B9MA 5HRRA 4JS5A 1SL2A 2HVHA 1ASUA 3PX4A 2G8UA 4AHCA 3V9ZA 1VSMA 4Q0BA 1G15A 3L3UA 1JL1A 3AO1A 1Q8IA 4B08A 2GV9A 1WLJA 4KO0A 4Y1DA 3SV3A 4KTQA 4M42A 4JRPA 1RT2A 3G0ZA 4PA1A 2EHGA 1EETA 3SQ1A 1RDBA 1L3SA 1HQUA 5T7BA 1KSPA 4N41A 3P5JA 3L2QA 3QEVA 4BACA 4DTUA 1C6VA 3DM2A 3NF7A 2G8WA 3NGIA 3SV4A 4AHVA 4FLTA 3QO9A 3RR8A 1O1WA 2R7YA 4DF8A 3OYNA 1J53A 4CE9A 3LZIA 3TARA 1NJYA 1T05A 1DTTA 2RKIA 2YV0X 3KK1A 2AJQA 4C8MA 4CFAA 4DLEA 1IH7A 4DSIA 5FDLA 3HXMA 4BDZA 3V9WA 4YNQA 4OPJA 1JLFA 3NF6A 5SZTA 3OS0A 1L3UA 2HNYA 1XHXA 3C95A 3MEEA 1BHLA 4ELTA 1MU2A 1NK7A 1YTAA 4DQRA 1RDCA 4CJVA 4C8KA 2BANA 3QERA 3QINA 4IKFA 4DLGA 3KIOA 3RMAA 4E19A 4CK1A 1N6QA 4B9VA 4LH5A 4Z4IA 3VQEA 2Z1JA 3C6UA 5FROA 1A5WA 1FXXA 3WNGA 4B9NA 3WNHA 3V1QA 3DLBA 1QQCA 3L2UA 3V4IA 1BIZA 1SUQA 1QTMA 4FJ9A 2E6LA 2B6AA 3SQ4A 1CXUA 4DMNA 4PQUA 3OYJA 3S3OA 3KJVA 3O3FA 4FJIA 3SZ2A 3D0PA 4O0IA 3RTVA 1YVUA 1U48A 4CJ3A 4DFPA 3ULDA 1Z25A 3AO3A 4FJNA 1S1XA 3MXJA 4CEDA 1NK4A 5C24A 1TKDA 3F73A 4DU3A 3AA3A 3HO1A 1C0UA 1EX4A 4DTMA 4DFKA 1JXEA 5JS1A 4FK0A 3LP1A 1Z26A 1VSFA 1X1PA 3TAEA 4CCHA 4CHOA 4CJ5A 2YKNA 3K5OA 1C1CA 4CHQA 2XO7A 4HUFA 1TGOA 3OYAA 2ZE2A 1VSLA 3V81A 4DSFA 4QOZB 3ZT0A 2DFEA 3AVAA 4CEZA 4Z4EA 1IKWA 2P51A 1FKPA 3T3FA 1KRPA 1VSDA 3NAEA 1KLNA 2OYQA 2KTQA 3M8RA 1VRUA 3NHGA 2P5OA 1UWBA 1LAWA 2XY5A 3TAGA 3LP2A 4B9LA 1RTIA 3QEWA 1NKCA 1IO2A 3T19A 4CJKA 3L2RA 2YNHA 2ETJA 4ID5A 3VA3A 3SUQA 4W5OA 3OYHA 3DOLA 1X9WA 1RBTA 2VG7A 2KZZA 1RT6A 5CY4A 1FKOA 1ASVA 3NFAA 4CK2A 4CIGA 2YNFA 4Z4HA 4KTZA 3L2WA 1T03A 3AVMA 4I2PA 1J9AA 1NOZA 4OVLA 4RW4A 4OLBA 4DTSA 4AH9A 1NK9A 2F96A 3OY9A 3TAPA 1EKEA 3P83D 3VQ4A 2HHUA 5CYQA 1I3AA 4JS4A 3K57A 1U4BA 3O3HA 4ZHRA 1TK8A 2HVIA 5SWMA 1WAFA 2FC0A 3HP9A 4BDYA 5FRNA 4FLZA 3VQBA 2QXFA 2IDOA 2OZMA 1CZBA 3KLEA 4FZXC 1KVBA 3OYIA 1ITGA 1RT3A 4C8LA 3FFIA 4I9LA 2P1JA 4CF0A 4LSLA 4I2QA 1Q9XA 4CECA 2DTUA 4IDKA 4CEAA 3OYGA 1BL3A 3WNEA 4DQQA 4CGFA 4EZ9A 1C0TA 4KAZA 4B8CA 4M41A 1KVAA 4CHPA 4CFCA 1B9DA 1NJXA 4NCGA 2RF2A 2E6MA 3NE6A 3SJJA 2HMIA 4M3WA 1D8YA 1GOBA 1ZYQA 4CJPA 1TL3A 4CJEA 3S3NA 4BE2A 2X6SA 4KFBA 2F8TA 4FJ5A 4FW1A 2QK9A 4E7JA 4FM2A 3VQDA 3KK3A 1N5YA 2IAJA 3BDPA 4CIEA 1ZBFA 4G1QA 4ICLA 2HNDA 2G8KA 2HHTA 3AO4A 1YTUA 4W5RA 4DTRA 3A2FA 4M3RA 3HVRA 3SCXA 3HYFA 1XHZA 3HSTB 2XY8A 1SL1A 1A5XA 1LW0A 1S1WA 4HTUA 4H8KA 4E7LA 5I42A 4PUOA 5K14A 4KHWA 1VK0A 1VRTA 1CXQA 4M3ZA 2BE2A 5HP1A 1UA0A 3LALA 4H4OA 3K5LA 1RTDA 3PO4A 1WAJA 3NGYA 4H4MA 3SUNA 4FJLA 4N5SA 5C42A 1UOCA 3TWHA 3KTQA 4E7IA 1L3TA 1SV5A 1YT3A 1ZBUA 3RRHA 1S6QA 4OKJA 3T1AA 1SKRA 4F3TA 2B5JA 3AO5A 3OYLA 4DTXA 3QETA 2ZD1A 2HHVA 1JLQA 1TK5A 4CHZA 4CHNA 4CJ4A 2KZMA 1SKSA 4ZTJA 3K58A 1R0AA 3KLFA 1LW2A 1DTQA 3QLHA 4CJSA 3NH0A 3LDSA 1QHTA 4FJ8A 2HHWA 4AHSA 1RBVA 4LD0A 1UA1A 3TAMA 3ASMA 3G10A 4OGEA 4CJQA 4M3XA 4CHYA 1QSLA 1NK6A 2NUBA 1IG9A 2BDPA 1RDAA 1EXQA 4KI4A 3NF8A 3RMCA 2IOCA 2O4GA 4HUGA 5HRPA 3AA2A 5JS2A 4FK2A 1T8EA 4DSLA 1B9FA 4KB1A 3U3GA 4CF9A 3HP6A 5J2QA 3RMDA 1JKHA 1LAVA 3RMBA 5HBMA 4NYNA 3CQ8A 3DOKA 3CFPA 4FW2A 1ZBIA 1WN7A 3V1OA 3AVCA 3C94A 3VQAA 5J1EA 1S9GA 1VSHA 2FBYA 3LP0A 3VA0A 1TKTA 3S3MA 4Z4GA 1EP4A 2D0AA 3VQCA 4CJUA 4JLHA 2PZSA 4CF8A 4KHYA 4FK4A 1HRHA 2XY7A 3DLKA 1J54A 4KKOA 3WNFA 4Z0UA 3QIOA 1U47A 4MFBA 3ZSRA 2LSNA 1WNSA 4R5PA 1S1TA 3DMJA 3OVNA 4CF2A 4DU1A 3AVHA 3MXMA 1WSIA 1RT4A 1Y97A 4TSXA 2Q3SA 4CJFA 3OYBA 3OYDA 4BE1A 3TABA 5D3GA 5CZ1A 5HROA 3O4NA 1JLGA 4YFUA 3TR8A 5J2NA 3OJSA 4LY7A 4DFJA 4N76A 3ZT3A 4DTNA 5HRNA 2HHSA 4CJTA 3ISNC 3P1GA 3ZSYA 4QCLA 4CFDA 1NK8A 4Z4FA 4F3OA 3KKRA 3AVJA 4M3YA 2EX3A 1KVCA 4KB0A 4KHNA 3QESA 2VWKA 3SQ2A 4FYDA 4CK3A 1RCHA 3ZSZA 4AHTA 2P5GA 5FRMA 2FBXA 1RT7A 1XC9A 3QEPA 2JLEA 2I5JA 1HYVA 4C8OA 3RR7A 3O3GA 3DLRA 1J5OA 4OKKA 4NCBA 4FJHA 3IG1A 5J2MA 5CYMA 4Y1CA 2QKBA 1UAXA 3AVNA 1REVA 1VSIA 1RILA 5KGXA 4B9TA 4F8RA 3NF9A 3JSMA 3L2VA 3EZ5A 2VWJA 4MQ3A 3MECA 3TANA 3TAQA 4HVJA 4KV8A 4WE1A 1S1UA 2DFFA 3B6PA 3C6TA 4CGHA 3ITHA 1L3VA 4DSJA 2Z1HA 3ZSOA 3MEGA 1NKEA 2YNIA 4LSNA 2BGGA 3THVA 3L8BA 4IBNA 2HNZA 1ZBLA 4DSKA 1NJWA 2X6NA 2E4LA 3KD5E 1WSEA 1LWEA 3CFRA 4FLXA 4BWJA 4OLAA 4UQGA 1WSFA 4FZYA 3KD1E 3AVGA 4M45A 4KHSA 4BDPA 1RDDA 1RBSA 4CJRA 3SI6A 2G8IA 4DFMA 1IKVA 4RW9A 1S1VA 3KLHA 2GBZA 3SPZA 1HPZA 4NYFA 3F9KA 1WSGA 4M3TA 3NH1A 1BISA 3RRGA 3NGZA 1TKXA 4W5NA 4CERA 5KGWA 1LWCA 3ZCMA 3OS1A 3LANA 1QE1A 2RN2A 4BE0A 4IFVA 3PUFA 4FM0A 1U45A 1W0HA 4AHUA 2FBTA 3LPTA 4W5QA 2QKKA 3RWUA 2KFNA 3M8QA 2ATQA 3DI6A 4KHUA 3AVFA 4NCAA 4FXDA 4CEFA 4RW8A 1C1AA 4OJRA 2YHAA 3ZT4A 3OS2A 3LP3A 2OA8A 1JLAA 2PYLA 1BGXT 3QEIA 4O5BA 4FLUA 1BCMA 3QEXA 2YNGA 4CFBA 2D0CA 4E7HA 4CEEA 1KLMA 2B4JA 1WSHA 3CYMA 3VQ6A 2PY5A 1BI4B 3KKSA 4RW7A 4GMJB 4CIFA 4OPKA 2YKMA 3VN5A 4O55A 3PV8A 1QSYA 4E89A 3ZT2A 1ZBHA 4E1NA 4DU4A 1BIUA 3V9UA 3DLGA 3NBPA 3HL8A 1VSJA 3VQ5A 3JYTA 1S6PA 3SYZA 4J2DA 3DLHA 1TVRA 2G8FA 1I39A 3ZSVA 2RPIA 3LWLA 1S5JA 1JL2A 3SQ0A 2KW4A 3SPYA 3VQQA 3QNNA 4N56A 4J2BA 5DMRA 2Z1GA 4LH4A 2X78A 1QSSA 3IS9A 3IAYA 4KHQA 3QIPA 4C8NA 1BQMA 2GUIA 4DQSA 4FLWA 3V6DA 4PY5A 4KRFA 3HPGA 4F4KA 3K5MA 4FJKA 4O0JA 1TKZA 4CESA 1CLQA 1KCFA 4EZ6A 4OKEA 4KPYA 2G8VA 4I9QA 3IRXA 1GOAA 1QS4A 4KREA 2JGUA 3V9XA 4DS5A 3OYEA 2KFZA 4EP5A 2VG5A 4K8XA 4E0DA 3PX6A 3SUPA 1TK0A 2OPSA 4CGGA 1NOYA 4B9SA 4IFYA 4FJXA 1K6YA 1TAQA 3HT3A 3KK2A 3LZJA 1C1BA 5KRTA 3PO5A 3TAFA 4DQIA 2W42A 3CG7A 4CF1A 5KTQA 4FJJA 1X9SA 5I3UA 4Z4CA 4FZZA 3SUOA 4E7KA 2A1SA 3HM9A 5C25A 4PWDA 1X9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWM A;  3HPH A;  2XRI A;  4IG3 A;  4N47 A;  5HLF A;  4B8A B;  4FCY A;  3U6F A;  4F2R A;  2VG6 A;  4RG8 A;  2Z1I A;  3HVT A;  3LAK A;  4CGD A;  3DYA A;  3AO2 A;  1RTH A;  4FVM A;  1L5U A;  4CEB A;  4BWM A;  2DY4 A;  4DTJ A;  3V9S A;  2D0B A;  3K2P A;  4KTW A;  3MAQ A;  1KFD A;  1VSE A;  3DRS A;  2HHX A;  3DRP A;  3ZSQ A;  3HJF A;  2WOM A;  4DWI A;  3OJU A;  2IGI A;  3E01 A;  1RT5 A;  4O4G A;  4Q5V A;  3U3Y A;  1Q9Y A;  4J2E A;  1NJZ A;  3I0R A;  4ELV A;  2WON A;  2G8H A;  4IG0 A;  1RBR A;  3KLI A;  4HCB A;  2Y1J A;  3V1R A;  3DRR A;  4FM1 A;  3AVI A;  1A5V A;  4HHT A;  1RT1 A;  1S9E A;  2OPR A;  2X74 A;  3M8P A;  4CJL A;  3I8D A;  5J2P A;  2Y1I A;  4AIL C;  2KQ2 A;  3TI0 A;  1NK0 A;  4I7F A;  3AVK A;  1LV5 A;  1D9F A;  1U49 A;  4CEO A;  1IKY A;  3DLE A;  1HYZ A;  4DF4 A;  3LPU A;  4FLV A;  1VSK A;  2FBV A;  3I0S A;  3S9H A;  2XHB A;  4F2S A;  3EYZ A;  3M8S A;  1JLE A;  2XY6 A;  3OYF A;  2F8S A;  3KLG A;  3K59 A;  3QNO A;  3AVB A;  1U04 A;  1HQE A;  1RTJ A;  5HRS A;  4DG1 A;  3MXI A;  1RNH A;  1F21 A;  3VQP A;  3L3V A;  5E41 A;  4L8R B;  3AA4 A;  3ZT1 A;  4DSE A;  1D9D A;  4W5T A;  4FJM A;  2YHB A;  1TAU A;  3B6O A;  2OPP A;  1DLO A;  4AHR A;  3ZSX A;  3ALY A;  2HB5 A;  3AA5 X;  4GVM A;  3VQ8 A;  4JRQ A;  3PX0 A;  4KI6 A;  4FLY A;  4CEQ A;  4CGJ A;  1XWL A;  4FJ7 A;  3H08 A;  4E1M A;  2OPQ A;  1T7P A;  3PY8 A;  4CGI A;  2O4I A;  2HHQ A;  2OZS A;  4HCC A;  3HK2 A;  2IC3 A;  2DFH A;  4DQP A;  5EU7 A;  3CM6 A;  3EY1 A;  1KFS A;  4O44 A;  5CZ2 A;  1SKW A;  1IKX A;  1BI4 A;  1HMV A;  1BCO A;  1LWF A;  1WSJ A;  4E3S A;  3D45 A;  2A1R A;  1TL1 A;  2PYJ A;  1BQN A;  4B9U A;  1D5A A;  4B3O A;  3LAM A;  1NK5 A;  4DS4 A;  4HUE A;  1HYS A;  3NCI A;  3SNN A;  4XIU A;  4OGC A;  3OYC A;  1HNI A;  5KI6 A;  3NH2 A;  1JXB A;  3NDK A;  1JLB A;  1GOC A;  1B92 A;  1W9H A;  1KTQ A;  1CZ9 A;  4GW6 A;  3OYM A;  2ITG A;  4ZTF A;  3UIQ A;  4M3U A;  1SL0 A;  1NKB A;  4ELU A;  1C0M A;  1HNV A;  3ZSW A;  1ASW A;  2ZQB A;  3MED A;  4ID1 A;  3VQ7 A;  1XI1 A;  4FJG A;  5KRS A;  3OYK A;  2D5R A;  3AVL A;  1RBU A;  1TV6 A;  1FK9 A;  3VQ9 A;  4EP4 A;  3CM5 A;  4DTP A;  4QAG A;  2IS3 A;  1JLC A;  3AV9 A;  3K5N A;  4CJW A;  1HJR A;  4K8Z A;  3CFO A;  4J2A A;  3HPO A;  3O4Q A;  4RW6 A;  2HW3 A;  5DK5 A;  4DTO A;  3BGR A;  4B9M A;  5HRR A;  4JS5 A;  1SL2 A;  2HVH A;  1ASU A;  3PX4 A;  2G8U A;  4AHC A;  3V9Z A;  1VSM A;  4Q0B A;  1G15 A;  3L3U A;  1JL1 A;  3AO1 A;  1Q8I A;  4B08 A;  2GV9 A;  1WLJ A;  4KO0 A;  4Y1D A;  3SV3 A;  4KTQ A;  4M42 A;  4JRP A;  1RT2 A;  3G0Z A;  4PA1 A;  2EHG A;  1EET A;  3SQ1 A;  1RDB A;  1L3S A;  1HQU A;  5T7B A;  1KSP A;  4N41 A;  3P5J A;  3L2Q A;  3QEV A;  4BAC A;  4DTU A;  1C6V A;  3DM2 A;  3NF7 A;  2G8W A;  3NGI A;  3SV4 A;  4AHV A;  4FLT A;  3QO9 A;  3RR8 A;  1O1W A;  2R7Y A;  4DF8 A;  3OYN A;  1J53 A;  4CE9 A;  3LZI A;  3TAR A;  1NJY A;  1T05 A;  1DTT A;  2RKI A;  2YV0 X;  3KK1 A;  2AJQ A;  4C8M A;  4CFA A;  4DLE A;  1IH7 A;  4DSI A;  5FDL A;  3HXM A;  4BDZ A;  3V9W A;  4YNQ A;  4OPJ A;  1JLF A;  3NF6 A;  5SZT A;  3OS0 A;  1L3U A;  2HNY A;  1XHX A;  3C95 A;  3MEE A;  1BHL A;  4ELT A;  1MU2 A;  1NK7 A;  1YTA A;  4DQR A;  1RDC A;  4CJV A;  4C8K A;  2BAN A;  3QER A;  3QIN A;  4IKF A;  4DLG A;  3KIO A;  3RMA A;  4E19 A;  4CK1 A;  1N6Q A;  4B9V A;  4LH5 A;  4Z4I A;  3VQE A;  2Z1J A;  3C6U A;  5FRO A;  1A5W A;  1FXX A;  3WNG A;  4B9N A;  3WNH A;  3V1Q A;  3DLB A;  1QQC A;  3L2U A;  3V4I A;  1BIZ A;  1SUQ A;  1QTM A;  4FJ9 A;  2E6L A;  2B6A A;  3SQ4 A;  1CXU A;  4DMN A;  4PQU A;  3OYJ A;  3S3O A;  3KJV A;  3O3F A;  4FJI A;  3SZ2 A;  3D0P A;  4O0I A;  3RTV A;  1YVU A;  1U48 A;  4CJ3 A;  4DFP A;  3ULD A;  1Z25 A;  3AO3 A;  4FJN A;  1S1X A;  3MXJ A;  4CED A;  1NK4 A;  5C24 A;  1TKD A;  3F73 A;  4DU3 A;  3AA3 A;  3HO1 A;  1C0U A;  1EX4 A;  4DTM A;  4DFK A;  1JXE A;  5JS1 A;  4FK0 A;  3LP1 A;  1Z26 A;  1VSF A;  1X1P A;  3TAE A;  4CCH A;  4CHO A;  4CJ5 A;  2YKN A;  3K5O A;  1C1C A;  4CHQ A;  2XO7 A;  4HUF A;  1TGO A;  3OYA A;  2ZE2 A;  1VSL A;  3V81 A;  4DSF A;  4QOZ B;  3ZT0 A;  2DFE A;  3AVA A;  4CEZ A;  4Z4E A;  1IKW A;  2P51 A;  1FKP A;  3T3F A;  1KRP A;  1VSD A;  3NAE A;  1KLN A;  2OYQ A;  2KTQ A;  3M8R A;  1VRU A;  3NHG A;  2P5O A;  1UWB A;  1LAW A;  2XY5 A;  3TAG A;  3LP2 A;  4B9L A;  1RTI A;  3QEW A;  1NKC A;  1IO2 A;  3T19 A;  4CJK A;  3L2R A;  2YNH A;  2ETJ A;  4ID5 A;  3VA3 A;  3SUQ A;  4W5O A;  3OYH A;  3DOL A;  1X9W A;  1RBT A;  2VG7 A;  2KZZ A;  1RT6 A;  5CY4 A;  1FKO A;  1ASV A;  3NFA A;  4CK2 A;  4CIG A;  2YNF A;  4Z4H A;  4KTZ A;  3L2W A;  1T03 A;  3AVM A;  4I2P A;  1J9A A;  1NOZ A;  4OVL A;  4RW4 A;  4OLB A;  4DTS A;  4AH9 A;  1NK9 A;  2F96 A;  3OY9 A;  3TAP A;  1EKE A;  3P83 D;  3VQ4 A;  2HHU A;  5CYQ A;  1I3A A;  4JS4 A;  3K57 A;  1U4B A;  3O3H A;  4ZHR A;  1TK8 A;  2HVI A;  5SWM A;  1WAF A;  2FC0 A;  3HP9 A;  4BDY A;  5FRN A;  4FLZ A;  3VQB A;  2QXF A;  2IDO A;  2OZM A;  1CZB A;  3KLE A;  4FZX C;  1KVB A;  3OYI A;  1ITG A;  1RT3 A;  4C8L A;  3FFI A;  4I9L A;  2P1J A;  4CF0 A;  4LSL A;  4I2Q A;  1Q9X A;  4CEC A;  2DTU A;  4IDK A;  4CEA A;  3OYG A;  1BL3 A;  3WNE A;  4DQQ A;  4CGF A;  4EZ9 A;  1C0T A;  4KAZ A;  4B8C A;  4M41 A;  1KVA A;  4CHP A;  4CFC A;  1B9D A;  1NJX A;  4NCG A;  2RF2 A;  2E6M A;  3NE6 A;  3SJJ A;  2HMI A;  4M3W A;  1D8Y A;  1GOB A;  1ZYQ A;  4CJP A;  1TL3 A;  4CJE A;  3S3N A;  4BE2 A;  2X6S A;  4KFB A;  2F8T A;  4FJ5 A;  4FW1 A;  2QK9 A;  4E7J A;  4FM2 A;  3VQD A;  3KK3 A;  1N5Y A;  2IAJ A;  3BDP A;  4CIE A;  1ZBF A;  4G1Q A;  4ICL A;  2HND A;  2G8K A;  2HHT A;  3AO4 A;  1YTU A;  4W5R A;  4DTR A;  3A2F A;  4M3R A;  3HVR A;  3SCX A;  3HYF A;  1XHZ A;  3HST B;  2XY8 A;  1SL1 A;  1A5X A;  1LW0 A;  1S1W A;  4HTU A;  4H8K A;  4E7L A;  5I42 A;  4PUO A;  5K14 A;  4KHW A;  1VK0 A;  1VRT A;  1CXQ A;  4M3Z A;  2BE2 A;  5HP1 A;  1UA0 A;  3LAL A;  4H4O A;  3K5L A;  1RTD A;  3PO4 A;  1WAJ A;  3NGY A;  4H4M A;  3SUN A;  4FJL A;  4N5S A;  5C42 A;  1UOC A;  3TWH A;  3KTQ A;  4E7I A;  1L3T A;  1SV5 A;  1YT3 A;  1ZBU A;  3RRH A;  1S6Q A;  4OKJ A;  3T1A A;  1SKR A;  4F3T A;  2B5J A;  3AO5 A;  3OYL A;  4DTX A;  3QET A;  2ZD1 A;  2HHV A;  1JLQ A;  1TK5 A;  4CHZ A;  4CHN A;  4CJ4 A;  2KZM A;  1SKS A;  4ZTJ A;  3K58 A;  1R0A A;  3KLF A;  1LW2 A;  1DTQ A;  3QLH A;  4CJS A;  3NH0 A;  3LDS A;  1QHT A;  4FJ8 A;  2HHW A;  4AHS A;  1RBV A;  4LD0 A;  1UA1 A;  3TAM A;  3ASM A;  3G10 A;  4OGE A;  4CJQ A;  4M3X A;  4CHY A;  1QSL A;  1NK6 A;  2NUB A;  1IG9 A;  2BDP A;  1RDA A;  1EXQ A;  4KI4 A;  3NF8 A;  3RMC A;  2IOC A;  2O4G A;  4HUG A;  5HRP A;  3AA2 A;  5JS2 A;  4FK2 A;  1T8E A;  4DSL A;  1B9F A;  4KB1 A;  3U3G A;  4CF9 A;  3HP6 A;  5J2Q A;  3RMD A;  1JKH A;  1LAV A;  3RMB A;  5HBM A;  4NYN A;  3CQ8 A;  3DOK A;  3CFP A;  4FW2 A;  1ZBI A;  1WN7 A;  3V1O A;  3AVC A;  3C94 A;  3VQA A;  5J1E A;  1S9G A;  1VSH A;  2FBY A;  3LP0 A;  3VA0 A;  1TKT A;  3S3M A;  4Z4G A;  1EP4 A;  2D0A A;  3VQC A;  4CJU A;  4JLH A;  2PZS A;  4CF8 A;  4KHY A;  4FK4 A;  1HRH A;  2XY7 A;  3DLK A;  1J54 A;  4KKO A;  3WNF A;  4Z0U A;  3QIO A;  1U47 A;  4MFB A;  3ZSR A;  2LSN A;  1WNS A;  4R5P A;  1S1T A;  3DMJ A;  3OVN A;  4CF2 A;  4DU1 A;  3AVH A;  3MXM A;  1WSI A;  1RT4 A;  1Y97 A;  4TSX A;  2Q3S A;  4CJF A;  3OYB A;  3OYD A;  4BE1 A;  3TAB A;  5D3G A;  5CZ1 A;  5HRO A;  3O4N A;  1JLG A;  4YFU A;  3TR8 A;  5J2N A;  3OJS A;  4LY7 A;  4DFJ A;  4N76 A;  3ZT3 A;  4DTN A;  5HRN A;  2HHS A;  4CJT A;  3ISN C;  3P1G A;  3ZSY A;  4QCL A;  4CFD A;  1NK8 A;  4Z4F A;  4F3O A;  3KKR A;  3AVJ A;  4M3Y A;  2EX3 A;  1KVC A;  4KB0 A;  4KHN A;  3QES A;  2VWK A;  3SQ2 A;  4FYD A;  4CK3 A;  1RCH A;  3ZSZ A;  4AHT A;  2P5G A;  5FRM A;  2FBX A;  1RT7 A;  1XC9 A;  3QEP A;  2JLE A;  2I5J A;  1HYV A;  4C8O A;  3RR7 A;  3O3G A;  3DLR A;  1J5O A;  4OKK A;  4NCB A;  4FJH A;  3IG1 A;  5J2M A;  5CYM A;  4Y1C A;  2QKB A;  1UAX A;  3AVN A;  1REV A;  1VSI A;  1RIL A;  5KGX A;  4B9T A;  4F8R A;  3NF9 A;  3JSM A;  3L2V A;  3EZ5 A;  2VWJ A;  4MQ3 A;  3MEC A;  3TAN A;  3TAQ A;  4HVJ A;  4KV8 A;  4WE1 A;  1S1U A;  2DFF A;  3B6P A;  3C6T A;  4CGH A;  3ITH A;  1L3V A;  4DSJ A;  2Z1H A;  3ZSO A;  3MEG A;  1NKE A;  2YNI A;  4LSN A;  2BGG A;  3THV A;  3L8B A;  4IBN A;  2HNZ A;  1ZBL A;  4DSK A;  1NJW A;  2X6N A;  2E4L A;  3KD5 E;  1WSE A;  1LWE A;  3CFR A;  4FLX A;  4BWJ A;  4OLA A;  4UQG A;  1WSF A;  4FZY A;  3KD1 E;  3AVG A;  4M45 A;  4KHS A;  4BDP A;  1RDD A;  1RBS A;  4CJR A;  3SI6 A;  2G8I A;  4DFM A;  1IKV A;  4RW9 A;  1S1V A;  3KLH A;  2GBZ A;  3SPZ A;  1HPZ A;  4NYF A;  3F9K A;  1WSG A;  4M3T A;  3NH1 A;  1BIS A;  3RRG A;  3NGZ A;  1TKX A;  4W5N A;  4CER A;  5KGW A;  1LWC A;  3ZCM A;  3OS1 A;  3LAN A;  1QE1 A;  2RN2 A;  4BE0 A;  4IFV A;  3PUF A;  4FM0 A;  1U45 A;  1W0H A;  4AHU A;  2FBT A;  3LPT A;  4W5Q A;  2QKK A;  3RWU A;  2KFN A;  3M8Q A;  2ATQ A;  3DI6 A;  4KHU A;  3AVF A;  4NCA A;  4FXD A;  4CEF A;  4RW8 A;  1C1A A;  4OJR A;  2YHA A;  3ZT4 A;  3OS2 A;  3LP3 A;  2OA8 A;  1JLA A;  2PYL A;  1BGX T;  3QEI A;  4O5B A;  4FLU A;  1BCM A;  3QEX A;  2YNG A;  4CFB A;  2D0C A;  4E7H A;  4CEE A;  1KLM A;  2B4J A;  1WSH A;  3CYM A;  3VQ6 A;  2PY5 A;  1BI4 B;  3KKS A;  4RW7 A;  4GMJ B;  4CIF A;  4OPK A;  2YKM A;  3VN5 A;  4O55 A;  3PV8 A;  1QSY A;  4E89 A;  3ZT2 A;  1ZBH A;  4E1N A;  4DU4 A;  1BIU A;  3V9U A;  3DLG A;  3NBP A;  3HL8 A;  1VSJ A;  3VQ5 A;  3JYT A;  1S6P A;  3SYZ A;  4J2D A;  3DLH A;  1TVR A;  2G8F A;  1I39 A;  3ZSV A;  2RPI A;  3LWL A;  1S5J A;  1JL2 A;  3SQ0 A;  2KW4 A;  3SPY A;  3VQQ A;  3QNN A;  4N56 A;  4J2B A;  5DMR A;  2Z1G A;  4LH4 A;  2X78 A;  1QSS A;  3IS9 A;  3IAY A;  4KHQ A;  3QIP A;  4C8N A;  1BQM A;  2GUI A;  4DQS A;  4FLW A;  3V6D A;  4PY5 A;  4KRF A;  3HPG A;  4F4K A;  3K5M A;  4FJK A;  4O0J A;  1TKZ A;  4CES A;  1CLQ A;  1KCF A;  4EZ6 A;  4OKE A;  4KPY A;  2G8V A;  4I9Q A;  3IRX A;  1GOA A;  1QS4 A;  4KRE A;  2JGU A;  3V9X A;  4DS5 A;  3OYE A;  2KFZ A;  4EP5 A;  2VG5 A;  4K8X A;  4E0D A;  3PX6 A;  3SUP A;  1TK0 A;  2OPS A;  4CGG A;  1NOY A;  4B9S A;  4IFY A;  4FJX A;  1K6Y A;  1TAQ A;  3HT3 A;  3KK2 A;  3LZJ A;  1C1B A;  5KRT A;  3PO5 A;  3TAF A;  4DQI A;  2W42 A;  3CG7 A;  4CF1 A;  5KTQ A;  4FJJ A;  1X9S A;  5I3U A;  4Z4C A;  4FZZ A;  3SUO A;  4E7K A;  2A1S A;  3HM9 A;  5C25 A;  4PWD A;  1X9M A; 
#chains in the Genus database with same CATH topology
 3LWM A;  4F2R A;  3LDQ A;  3DYA A;  3AO2 A;  1RTH A;  1V4T A;  2DY4 A;  1N36 K;  2D0B A;  3TU5 A;  4JKB A;  1VSE A;  3BF3 A;  1D4X A;  5LJV A;  3DRP A;  2WOM A;  5FPN A;  2IGI A;  1RT5 A;  3U3Y A;  4Q5V A;  4J2E A;  4F9O A;  3CCE N;  1RBR A;  2FF3 B;  3AVI A;  1RT1 A;  2X74 A;  3M8P A;  4AIL C;  2KQ2 A;  4CEO A;  2WTU A;  4DF4 A;  3F2K A;  4BC4 A;  4FLV A;  2XHB A;  1NGD A;  3M8S A;  1JLE A;  3OYF A;  2W40 A;  1JCG A;  1KXP A;  3CCS N;  3QNO A;  3QFU A;  1K8A O;  1RTJ A;  4A2A A;  1RNH A;  1F21 A;  3VQP A;  3VEN A;  4FJM A;  3B6O A;  4BRF A;  4IFE A;  4BRE A;  3HOT A;  3VQ8 A;  3AA5 X;  3MX2 A;  3WQT A;  4BRG A;  4CZE A;  3PY8 A;  4B3R K;  2DFH A;  2P9P B;  5CHI A;  4C1N K;  1NGJ A;  4O44 A;  5TKY A;  3AAR A;  4BQZ A;  4KH5 A;  4CZF A;  4E3S A;  3D45 A;  1TL1 A;  2OCE A;  1D5A A;  1LCU A;  4CZI A;  4U7B A;  3HM8 A;  4HUE A;  3SNN A;  3FLC O;  3NH2 A;  4BG9 A;  2HF3 A;  3TTC A;  1K9M O;  1W9H A;  4M3U A;  1NKB A;  2ZQB A;  4ID1 A;  3OYK A;  2D5R A;  3PSI A;  2QWL A;  1TV6 A;  3VQ9 A;  4QAG A;  1JCF A;  2IS3 A;  1JLC A;  3AV9 A;  4BRN A;  4RW6 A;  1P8Z A;  2NRX A;  2HW3 A;  5AQH A;  4JS5 A;  5BRF A;  2G8U A;  1U2V A;  1G15 A;  3L3U A;  2ASP A;  3AO1 A;  2HBK A;  2GV9 A;  1WLJ A;  4CD3 A;  3SV3 A;  4JRP A;  2EHG A;  4DR6 K;  1S3X A;  3AGK A;  1KSP A;  5AQI A;  3P5J A;  3QEV A;  4FWL A;  3DM2 A;  3KZB A;  3SK3 A;  1O1W A;  2R7Y A;  3D2F B;  3D2E A;  4JI5 K;  4JKG B;  3I55 N;  2RKI A;  1OVY A;  2YV0 X;  3O8M A;  4IZ9 A;  3TTF A;  4YNQ A;  4OPJ A;  1JLF A;  3G25 A;  5SZT A;  3OS0 A;  3DAW A;  4ELT A;  1RDC A;  1HLU A;  2V7Y A;  3QER A;  4IKF A;  4DLG A;  4B3T K;  1NGG A;  2Z1J A;  3C6U A;  3LDO A;  1VQ4 N;  3E1Y A;  2NRZ A;  4FJ9 A;  1QQO A;  2B6A A;  4JK7 A;  5AQG A;  2E8A A;  3R8E A;  3KJV A;  4YY3 K;  2KLA A;  4CJ7 A;  5M1K A;  4DFP A;  3MXJ A;  1NK4 A;  4Z94 A;  5C24 A;  1TKD A;  1C0U A;  4DTM A;  2E20 A;  5JS1 A;  2P9I A;  1Z26 A;  1VSF A;  3SMS A;  2HBL A;  2YKN A;  3K5O A;  2UUC K;  1C1C A;  2ZE2 A;  1VSL A;  4QOZ B;  1W7A A;  3ZT0 A;  3AVA A;  4CEZ A;  1IKW A;  1FKP A;  3EL2 A;  4BRQ A;  5C2D A;  5KPZ A;  3NAE A;  2OYQ A;  3NHG A;  1UWB A;  3LP2 A;  3N4P A;  1NMD A;  3T19 A;  5A2Q O;  1NLV A;  4WF9 L;  3OYH A;  1GLE G;  1RT6 A;  1T03 A;  4A62 A;  3AVM A;  2P9L B;  1J9A A;  1NOZ A;  4RW4 A;  4JHD B;  4B1V A;  2F96 A;  3TAP A;  2JWK A;  4BGA A;  4FWN A;  3K57 A;  3CCQ N;  1TK8 A;  3WXL A;  5ADX A;  1J5E K;  4FLZ A;  1K73 O;  3VF4 A;  2OZM A;  4IEI A;  3K9K A;  5AQF A;  1ILY A;  3AGR A;  4LF5 K;  1RT3 A;  4C8L A;  3FFI A;  4CF0 A;  3CF5 L;  4IDK A;  5DM6 L;  5BR9 A;  4CGF A;  4KAZ A;  1VQN N;  1YHQ N;  1B9D A;  3ATV A;  4AM7 A;  3SJJ A;  2HMI A;  4FWQ A;  2UXB K;  1GOB A;  1ZYQ A;  3S3N A;  3I8B A;  4FM2 A;  3A5M C;  3VQD A;  1N5Y A;  5HOO A;  2NLX A;  2HND A;  2G8K A;  4IOA L;  3AO4 A;  4KBO A;  4W5R A;  3P39 A;  3A2F A;  4EFH A;  4M3R A;  2XY8 A;  1SL1 A;  2JWL A;  3DJC A;  4M7X A;  4DV7 K;  4H8K A;  5M1O A;  2QTD A;  4PUO A;  1VRT A;  2NRV A;  4H4O A;  4IOC L;  4N5S A;  3ZET A;  3KTQ A;  1GLJ O;  3TWH A;  4E7I A;  3E66 A;  4BRC A;  1ZBU A;  3MN5 A;  3T1A A;  2A5X A;  5ADX H;  3AO5 A;  3CD6 N;  3QET A;  3VOV A;  3L4Q A;  4CHZ A;  1SKS A;  5KPR A;  3QLH A;  4JV5 K;  1KC8 O;  3FZH A;  2A3Z A;  5LMN K;  1QHA A;  1IG9 A;  5EX5 A;  3NF8 A;  5AQU A;  1NM1 A;  5HRP A;  3NMU A;  5JS2 A;  4FK2 A;  1T8E A;  2YHY A;  4KB1 A;  3U3G A;  1HUX A;  3OBW A;  5J2Q A;  3RSE A;  5HBM A;  1SQK A;  3DOK A;  3CFP A;  3CJ1 A;  1NGI A;  3MX5 A;  4GVE A;  5GAE P;  2Q2R A;  3V1O A;  5J1E A;  1VSH A;  2FBY A;  2QWM A;  1TKT A;  1EP4 A;  4JHD A;  1XC3 A;  2XY7 A;  3WNF A;  1J54 A;  1TYQ A;  3QIO A;  1U47 A;  4R5P A;  4IEE A;  3AVH A;  3DXM A;  4JKC A;  5EVZ A;  2P9U B;  4XEI A;  3GDQ A;  3O4N A;  1JLG A;  4LY7 A;  1TUY A;  3CHW A;  2HF4 A;  4CFD A;  3J8A A;  4IO9 L;  3UKR A;  4F3O A;  3KKR A;  4M3Y A;  4KHN A;  4K25 A;  3QES A;  4ILJ A;  4FYD A;  1GLB G;  4CK3 A;  2A6A A;  4AHT A;  2FBX A;  1RT7 A;  2E2O A;  3QEP A;  2I5J A;  2YCH A;  2VGN A;  1YXQ A;  3IG1 A;  4Y1C A;  3WXJ A;  1UAX A;  1REV A;  4KHP K;  3FE1 A;  4B9T A;  4F8R A;  3NF9 A;  4BR5 A;  3JSM A;  4JI1 K;  1HR0 K;  2VWJ A;  3TAN A;  4HVJ A;  4WE1 A;  4K41 A;  1GLD G;  3B6P A;  2VCP A;  3ZSO A;  3VMF B;  3R9P A;  4C23 A;  3THV A;  3L8B A;  4CZL A;  2P9N A;  4BQL A;  1WSE A;  3CFR A;  1YI2 N;  3UE5 A;  4OLA A;  3KD1 E;  1IKV A;  4RW9 A;  2GBZ A;  4M3T A;  3NH1 A;  4W5N A;  5KGW A;  1LWC A;  3ZCM A;  4WQ5 C;  4FM0 A;  2FBT A;  1IG8 A;  3M8Q A;  3DI6 A;  4FXD A;  2ASM A;  2CH5 A;  4BC5 A;  2YHA A;  3SBG A;  3LP3 A;  2O8C A;  4PWD A;  1C0G A;  1BGX T;  2V7Z A;  2QWR A;  1KAZ A;  5AQR A;  3QEX A;  4A2B A;  2P9S A;  2O8E A;  1KLM A;  2WBN A;  2E88 A;  1QVG M;  3VQ6 A;  3CYM A;  2AP1 A;  4QS8 A;  3PV8 A;  1QVF M;  4E89 A;  3CIP A;  1BIU A;  3V9U A;  3HL8 A;  5C0Y A;  2P9K B;  4J2D A;  2GWJ A;  2Q1N A;  3VF6 A;  3LWL A;  1HNZ K;  3SQ0 A;  2IIR A;  1HKG A;  2KW4 A;  2VQF K;  3PIO L;  3QNN A;  3VF2 A;  4JD2 B;  4GV3 A;  4LH4 A;  3IAY A;  4KHQ A;  4C8N A;  4O8K A;  4AM6 A;  5AQO A;  4PY5 A;  3HPG A;  4CBW A;  4EIA A;  3DLL L;  4DR7 K;  4O0J A;  4CES A;  5M1Q A;  1GOA A;  3V9X A;  4RTF D;  4EP5 A;  4B3M K;  4IFY A;  3TPQ A;  1K6Y A;  1TAQ A;  3HT3 A;  3LZJ A;  3CG7 A;  2ITM A;  5KTQ A;  4E7K A;  3H3N O;  5BRD A;  1FW6 A;  4R79 A;  5C25 A;  3CJA A;  1KD1 O;  1Q7Y O;  5GIP A;  4RG8 A;  3KHY A;  4CGD A;  2KHO A;  2ZWH A;  4FVM A;  5I9E B;  3V9S A;  4YOY A;  1KFD A;  3SAG A;  3ZSQ A;  3OJU A;  1EWR A;  3I0R A;  3CC2 N;  2WON A;  4HCB A;  3DRR A;  1A5V A;  4CZG A;  4CZM A;  4HHT A;  4CJL A;  1S9E A;  2Y1I A;  5CE3 A;  1NK5 A;  1NK0 A;  2BGG A;  4I7F A;  3AY9 A;  2ZF5 O;  5AQZ A;  2FBV A;  3I0S A;  5AZI A;  3D2E B;  4F2S A;  3SJH A;  3KLG A;  3K59 A;  1VQ9 N;  5HRS A;  3MXI A;  4CD1 A;  3L3V A;  4L8R B;  2QI2 A;  2YHB A;  2ZGZ A;  3PX0 A;  3ZSX A;  2HB5 A;  3TTD A;  4FLY A;  4CEQ A;  1XWL A;  3H08 A;  2O4I A;  4DKW A;  4CGI A;  2O8D A;  2O8D B;  2OZS A;  2IC3 A;  4DQP A;  5JIC A;  5CZ2 A;  1SKW A;  1IKX A;  1BCO A;  1OH6 A;  4B3O A;  4FOI A;  1VQ5 N;  2H3G X;  3T69 A;  2YJE A;  4OGC A;  5KI6 A;  4O8U A;  5IWA K;  3H46 O;  1H1V A;  3EEQ A;  1ATN A;  3UIQ A;  1KTQ A;  3FR0 A;  1WOQ A;  4ELU A;  3ZSW A;  3EO3 A;  4FJG A;  1S72 N;  3RVC A;  1XI1 A;  2WUS A;  2ZJR L;  1RBU A;  4EP4 A;  4A61 A;  4JK9 A;  1YF5 L;  3QB0 A;  4GV6 A;  5AQY A;  3K5N A;  3PSF A;  3MN6 A;  3VPZ A;  5AQS A;  5DK5 A;  1P90 A;  4CBX A;  4B9M A;  3OBY A;  3QFP A;  1ASU A;  3PX4 A;  2HVH A;  2YHX A;  2EWS A;  3O9S A;  1EWQ A;  1L3S A;  1EET A;  1BWF O;  3ID6 A;  5GAD P;  4JKA A;  3G6E N;  2G8W A;  5F0X A;  4JK8 A;  3NGI A;  4AHV A;  4GKJ K;  1W2B M;  4LF7 K;  3QIC A;  3LZI A;  1NJY A;  3C6H A;  4C8M A;  4DLE A;  1IH7 A;  4A59 A;  4BDZ A;  1M90 O;  2Q31 A;  3VTH A;  2HOE A;  1L3U A;  1XHX A;  3MEE A;  4BC2 A;  1MU2 A;  4DQR A;  2BAN A;  2HST A;  4FWR A;  1QZ6 A;  5EOY A;  3RMA A;  1N6Q A;  3VGK A;  4B9V A;  4LH5 A;  4Z4I A;  3VQE A;  4WQ5 A;  5JVG L;  4BVP A;  3DLB A;  1QQC A;  1BUP A;  3V4I A;  1BIZ A;  1QTM A;  4GKK K;  3SQ4 A;  4H5W A;  3H45 C;  4NO7 A;  4DMN A;  4PQU A;  4WQ4 A;  4XH1 A;  4CJ3 A;  3CCR N;  1Z25 A;  3ULD A;  1S1X A;  3HOS A;  3HO1 A;  3MCA B;  1EX4 A;  4RWT A;  5C12 A;  3O9Q A;  4M63 C;  2A42 A;  4HUF A;  3LL3 A;  4MLE A;  3SMP A;  4DSF A;  3KWG A;  1TUU A;  4J8F A;  4Z4E A;  2F9T A;  2P51 A;  1KRP A;  1VSD A;  3M8R A;  1VRU A;  3ENH A;  5M1F A;  4CZH A;  3BF1 A;  3O08 A;  4W5O A;  3DOL A;  2VG7 A;  1FKO A;  3NFA A;  3CPE A;  4YOT A;  4OLB A;  4AH9 A;  1FJG K;  5LMU K;  1VAZ A;  3VQ4 A;  2HHU A;  1I3A A;  4ZHR A;  5BPN A;  2ZM6 K;  1WAF A;  5CR4 A;  4BDY A;  4LFA K;  3TSU A;  4FWM A;  4DV3 K;  2D1K A;  2NRT A;  2VQE K;  3KLE A;  5AFU H;  4FZX C;  4BRD A;  4LSL A;  4I2Q A;  1Q9X A;  2HBM A;  3OYG A;  2VYP A;  4DQ8 A;  3I56 N;  3ENO A;  4CZJ A;  3D7E O;  1E4G T;  4NCG A;  4LFB K;  5MLC Q;  1HNX K;  3HTV A;  4CJP A;  3ENB A;  4FW1 A;  3O1B A;  3CCL N;  4G1Q A;  4ICL A;  1YTU A;  4L3Q A;  4BRH A;  3HVR A;  3HYF A;  3WT0 A;  4IO8 A;  4FL9 A;  1K8K A;  4HTU A;  2QA4 N;  4E7L A;  3BZK A;  4KHW A;  3LAL A;  3PO4 A;  3VEY A;  1WAJ A;  5C42 A;  1SV5 A;  1IJJ A;  1S6Q A;  1LOT B;  2B5J A;  3OYL A;  4DTX A;  5F2R A;  2KZM A;  4ZTJ A;  3K58 A;  3EKU A;  1DTQ A;  4B3S K;  3NH0 A;  3FZL A;  4AHS A;  1UA1 A;  3Q7B A;  2YX6 A;  3G10 A;  1C0F A;  4FPB A;  4OGE A;  4CJQ A;  5GIN A;  4M3X A;  4CHY A;  2GEL A;  2IOC A;  1S22 A;  2O4G A;  3U9D A;  1GLC G;  4DSL A;  1B9F A;  3HP6 A;  4PHT X;  3RMD A;  1WN7 A;  3AVC A;  3C94 A;  4I6M B;  3VQA A;  3LP0 A;  4Z4G A;  5KQ8 A;  3SAH A;  2D0A A;  5FPM A;  4CJU A;  4DCH A;  4CF8 A;  4KHY A;  3DLK A;  5AQN A;  2O8C B;  3ZSR A;  1WNS A;  2PBD A;  3DMJ A;  3TSP A;  4DU1 A;  3ZET B;  3L0Q A;  3MXM A;  1WSI A;  1Y97 A;  5C15 A;  4CJF A;  3OYB A;  4OO1 J;  1Z6R A;  3TAB A;  5CZ1 A;  4LC9 B;  3IUC A;  4DFJ A;  3BY5 A;  5HRN A;  4H0X B;  3M1F A;  1X9J A;  4Z4F A;  3VEO A;  4KB0 A;  4OPH A;  4JKE A;  5AFU A;  4WFA L;  3T7Z A;  3ZSZ A;  2P5G A;  1XC9 A;  3DLR A;  4OKK A;  4RCH A;  2QKB A;  5CYM A;  5AQT A;  1VSI A;  3AVN A;  1RIL A;  1DKG D;  3TAQ A;  4PKI A;  3VTI A;  1S1U A;  2FF6 A;  1L3V A;  3ITH A;  3E9O A;  1NKE A;  4JKH A;  4LSN A;  3AAP A;  3LDN A;  4DSK A;  3T1H K;  3HI0 A;  4JAX A;  1NGA A;  4PKG A;  3THY B;  3ATU A;  3FZF A;  4UQG A;  4FZY A;  1W97 L;  4DV6 K;  4BDP A;  4CJR A;  1RFQ A;  5FLX O;  4DV1 K;  3JXU A;  3SPZ A;  3F9K A;  1WSG A;  3NGZ A;  1TKX A;  1JJ2 M;  4BE0 A;  3OS1 A;  1QE1 A;  2RN2 A;  3J7A P;  4IFV A;  4BVO A;  2ATQ A;  4KHU A;  3AVF A;  4OJR A;  1ATS A;  2OA8 A;  3FZM A;  3QEI A;  4FLU A;  1BCM A;  4DV0 K;  2FSJ A;  4CFB A;  2D0C A;  3EE9 A;  1OH8 A;  4BRP A;  4BC3 A;  5DM7 L;  1JCE A;  1BI4 B;  3FGU A;  3O6W A;  2GUP A;  2HBJ A;  5AQW A;  4OPK A;  3G71 N;  3VN5 A;  1ZC6 A;  4E1N A;  4DU4 A;  3DLG A;  3C0B A;  4JKG A;  3DLH A;  2RPI A;  4K42 A;  1JL2 A;  1BOT O;  4N56 A;  4J2B A;  5DMR A;  2Z1G A;  3VER A;  1BO5 O;  5AQV A;  3JS6 A;  2GUI A;  1WUA A;  3QBX A;  4YOV A;  3VEZ A;  1K8K B;  3WXK A;  3V6D A;  4KRF A;  4F4K A;  1CLQ A;  3M5R A;  1KCF A;  4KRE A;  1BA0 A;  3OYE A;  2QWQ A;  2KFZ A;  2P9I B;  3SUP A;  2OPS A;  4CGG A;  4FJX A;  1VQL N;  1Y64 A;  4H5R A;  1YAG A;  3KK2 A;  5KRT A;  4FJJ A;  4FZZ A;  2CH6 A;  2NNW A;  3WUH A;  3HM9 A;  5JVH L;  3O9R A;  2XRI A;  4IG3 A;  4N47 A;  4BY9 C;  2YJF A;  4B8A B;  4FCY A;  3P4I A;  2VG6 A;  3HVT A;  1YJN N;  1L5U A;  1N32 K;  4BWM A;  3K2P A;  4KTW A;  3MAQ A;  3DRS A;  4BR2 A;  3U4L A;  4DWI A;  1IV0 A;  3E01 A;  4O4G A;  2O8F A;  1Q9Y A;  1NWK A;  3KLI A;  3H3O B;  4LF6 K;  3V1R A;  4NCB A;  4BRA A;  1U2V B;  5AQM A;  3TI0 A;  3AVK A;  1U49 A;  3DLE A;  3H6E A;  3LPU A;  3UKU B;  1VSK A;  3S9H A;  2UXD K;  2XY6 A;  4DR4 K;  1YIT N;  2F8S A;  3AVB A;  4DG1 A;  3A8Y A;  3MK6 A;  4DV4 K;  4DSE A;  1IBL K;  1TAU A;  2V51 B;  3K9J A;  3CC7 N;  2OPP A;  1DLO A;  4FLX A;  2P9K A;  3ALY A;  4GVM A;  5JLH A;  4V19 S;  4CGJ A;  4FJ7 A;  1VQ6 N;  1RGI A;  4E1M A;  1XNQ K;  1DEJ A;  2ASO A;  1T7P A;  3NVK A;  1XMQ K;  3HK2 A;  1X3M A;  5EU7 A;  3CM6 A;  1KFS A;  5C2F A;  1NGH A;  3KWI A;  1BI4 A;  1MWM A;  3E9P A;  1BQN A;  4NB4 A;  3P31 A;  3RSE B;  4XIU A;  3OYC A;  3G4S N;  3OHR A;  3NDK A;  1KAY A;  1JLB A;  3R6M A;  1B92 A;  4GW6 A;  4H5V A;  1E3M A;  3S41 A;  1SL0 A;  4YOU A;  1C0M A;  1ASW A;  1GLF O;  3UKU A;  5KRS A;  1SAZ A;  1FK9 A;  3CM5 A;  5AR0 A;  1KAX A;  4CVN E;  2RHK A;  4JI4 K;  4CJW A;  4ILH A;  1HJR A;  1XMO K;  3BUZ B;  3HPO A;  3CER A;  4J2A A;  3O4Q A;  3L4I A;  2QXL A;  4DTO A;  3BGR A;  5HRR A;  3FZK A;  1SL2 A;  1NJI O;  4H5N A;  3W0L A;  1JL1 A;  1Q8I A;  4B08 A;  4Y1D A;  4M42 A;  1RT2 A;  3U8X A;  3G0Z A;  3EN9 A;  4PA1 A;  3SQ1 A;  1RDB A;  5FPD A;  4BAC A;  4DTU A;  1C6V A;  3NF7 A;  3SV4 A;  3RR8 A;  3QO9 A;  5AQP A;  1J6Z A;  4DF8 A;  4ISG A;  1J53 A;  5GAH P;  4CE9 A;  1T05 A;  3KK1 A;  2AJQ A;  3A0I X;  4CFA A;  1OVQ A;  3EZW A;  3HXM A;  4DR2 K;  2OTL N;  3NF6 A;  3UB5 A;  3C95 A;  1BHL A;  3WXI A;  1NK7 A;  4B1Z A;  4X65 K;  4C8K A;  4UY8 O;  2P9N B;  5F1X A;  3KIO A;  2PFU A;  5EXW A;  4CK1 A;  4A5B A;  3B8A X;  5FRO A;  1YIJ N;  1FXX A;  3WNG A;  4B9N A;  3WNH A;  3V1Q A;  1SUQ A;  1NGF A;  2A41 A;  2E6L A;  2F9W A;  3EKS A;  3OYJ A;  4FJI A;  3O3F A;  3SZ2 A;  3D0P A;  4O0I A;  4PL8 A;  1U48 A;  4FJN A;  1O13 A;  4BRK A;  3Q7C A;  3F73 A;  4AQY K;  4BR9 A;  2NRH A;  3LP1 A;  4WFB L;  4CCH A;  4FK0 A;  1G99 A;  3TAE A;  4IXC A;  4CHO A;  4CJ5 A;  4JI7 K;  4H0P A;  4CHQ A;  3J7Y P;  2XO7 A;  4BR4 A;  3MN9 A;  2W6K A;  4JEP A;  2UUB K;  2P9U A;  4MO4 A;  3ID8 A;  3DXM B;  2KTQ A;  2P5O A;  1LAW A;  2XY5 A;  4XH5 A;  4B9L A;  1RTI A;  3QEW A;  1NKC A;  1IO2 A;  2HMP A;  5M1N A;  2NRR A;  4CJK A;  3L2R A;  3VA3 A;  1HKB A;  5E84 A;  1X9W A;  4CK2 A;  1ASV A;  2RE2 A;  4CIG A;  2YNF A;  4KTZ A;  3L2W A;  4OVL A;  5LJW A;  3OTO K;  4DTS A;  1NK9 A;  3F9M A;  4MDA A;  1V4S A;  1EKE A;  1T3V A;  2GWK A;  1XNR K;  3CPW M;  5LY3 A;  3OA9 A;  4DV2 K;  2FC0 A;  3HP9 A;  5M1P A;  3NVM A;  3VQB A;  2IDO A;  3CCM N;  1QQN A;  1VQK N;  4BRO A;  3CC4 N;  3OYI A;  1ITG A;  3O80 A;  3CME N;  2P1J A;  3A5L C;  4CEC A;  4WCE L;  4CEA A;  3WNE A;  4EZ9 A;  4LFC K;  4ISF A;  4B8C A;  4M41 A;  4CHP A;  3PIP L;  5E26 A;  2E6M A;  1NGE A;  3LM2 A;  4M3W A;  1D8Y A;  4IOX A;  1TL3 A;  5JLF A;  2FXU A;  2F8T A;  4FJ5 A;  5AQJ A;  3KK3 A;  2IAJ A;  4JI6 K;  4DUY K;  2O8F B;  3CJ9 A;  5ELZ A;  4DTR A;  3SCX A;  3HST B;  1A5X A;  2QEX N;  1S1W A;  2E2P A;  1DGK N;  5I42 A;  1OH7 A;  3GG4 A;  4YHH K;  1VQO N;  1HX1 A;  1VK0 A;  1CXQ A;  4M3Z A;  4XH4 A;  5HP1 A;  4B1U B;  1UA0 A;  3K5L A;  2KZZ A;  4E1J A;  3NGY A;  4H4M A;  3QBW A;  4CBU A;  3M6G A;  3MWP A;  1YT3 A;  4OKJ A;  2P9L A;  4F3T A;  2HHH K;  4B9Q A;  2ZD1 A;  2HHV A;  5BPM A;  1JLQ A;  1TK5 A;  4CJ4 A;  4YOW A;  1R0A A;  3KLF A;  4FJ8 A;  1QHT A;  3LDL A;  2O8B A;  3WEE B;  4BGB A;  2FSN A;  1QSL A;  1NK6 A;  4KI4 A;  3RMC A;  1Z05 A;  4FWO A;  4HUG A;  3AA2 A;  5H1S Q;  1MA9 B;  4H0T B;  4PKH A;  3RMB A;  3CQ8 A;  4NYN A;  4FW2 A;  1S9G A;  3S3M A;  1VQ7 N;  5AQX A;  2VGM A;  4DR1 K;  2PZS A;  4K43 A;  4FK4 A;  1HRH A;  3VEW A;  2Q36 A;  4MFB A;  1T6C A;  3ZYY X;  3CCU N;  3ZLJ A;  1ZXO A;  1RT4 A;  3ULE B;  3OYD A;  4ISE A;  5HRO A;  4DUZ K;  4YFU A;  3PLA A;  3TR8 A;  3OJS A;  2HHS A;  3ZEU B;  1Q82 O;  3P1G A;  3DWL A;  3SBT A;  1YJ9 N;  4WFN L;  3AVJ A;  2EX3 A;  1KVC A;  4FWK A;  1RCH A;  3KVG A;  1MWK A;  5FRM A;  1HYV A;  3RR7 A;  1J5O A;  5J2M A;  4NXN K;  5KGX A;  3QDK A;  2PAV A;  3EZ5 A;  3ZEU A;  3C6A A;  3UKR B;  4KV8 A;  4CGH A;  1BU6 O;  2Z1H A;  4FO0 A;  3MEG A;  2YNI A;  2NZT A;  4IBN A;  1ZBL A;  2X6N A;  3CCV N;  5FPE A;  5AZJ A;  4BWJ A;  3AVG A;  4JI3 K;  4FWP A;  5BN8 A;  4KHS A;  2ZGY A;  4GNI A;  5AQK A;  4AF1 A;  4CW7 B;  3SI6 A;  2G8I A;  5HL7 L;  4DFM A;  1S1V A;  3DXK B;  2IVO A;  3N4Q A;  3KLH A;  4YOX A;  3O9U A;  4NYF A;  3RRG A;  4CER A;  5GIO A;  1U45 A;  1Q18 A;  2KFN A;  4JN4 A;  4U67 L;  3GBT A;  3HRG A;  3ZT4 A;  1TYQ B;  1NBW A;  1JLA A;  2PYL A;  3A5N C;  2GEM A;  3U9Z A;  2I7N A;  4IDH A;  5BPL A;  4A57 A;  4CI6 A;  2YNG A;  4E7H A;  2PY5 A;  1WBD A;  4RW7 A;  4CIF A;  5JMV A;  1VQM N;  1ZBH A;  3D6R A;  4WQ4 C;  4H0O A;  3NBP A;  3SYZ A;  3KK7 A;  4GY2 B;  1I39 A;  3H1Q A;  4BR0 A;  3VQQ A;  2X78 A;  1QSS A;  2DPN A;  3QIP A;  1YJW N;  1BQM A;  1NG9 A;  1WBB A;  2E5L K;  4B1W B;  1SZ2 A;  3A5O C;  5LL6 Z;  2W6L A;  4OKE A;  4KPY A;  4OX9 K;  1NMN A;  2G8V A;  3IRX A;  1QS4 A;  2JGU A;  3J81 O;  4DS5 A;  4K0K K;  4K8X A;  1TK0 A;  1C1B A;  2QW9 A;  4DQI A;  2W42 A;  1X9S A;  5I3U A;  3SUO A;  3IDH A;  3HBT A;  3VEV A;  3HPH A;  5HLF A;  3U6F A;  2Z1I A;  4NLB A;  3LAK A;  3THW A;  4CEB A;  4DTJ A;  3TSQ A;  2HHX A;  3VES A;  4DV5 K;  3HJF A;  2P9S B;  1NJZ A;  4ELV A;  2NRW A;  4IG0 A;  2G8H A;  1Q86 O;  1Q81 O;  2Y1J A;  4FM1 A;  2OPR A;  3I8D A;  5J2P A;  1LV5 A;  1D9F A;  1IKY A;  1HYZ A;  3DXK A;  3O4W A;  1OH5 A;  1VQ8 N;  3EYZ A;  3IFR A;  1ATR A;  4LF8 K;  1U04 A;  1HQE A;  2QM1 A;  5E41 A;  3AA4 A;  3ZT1 A;  4ILG B;  1D9D A;  4W5T A;  2UYT A;  4DHY A;  2Q97 A;  4AHR A;  4KI6 A;  4JRQ A;  4FPA A;  2F4V K;  2OPQ A;  4I6M A;  2HHQ A;  2E1Y A;  4HCC A;  2BH1 A;  3EY1 A;  4MDB A;  4WYB A;  1WSJ A;  1HMV A;  1LWF A;  1NGC A;  4B9U A;  3BZC A;  2A1R A;  2UU9 K;  2PYJ A;  1E4F T;  3LAM A;  2GTD A;  4DS4 A;  3THY A;  3NCI A;  4FVU A;  3THX B;  1HYS A;  5TKW A;  1EO1 A;  1HNI A;  1T44 A;  1JXB A;  3R3L A;  4JYA K;  4H0V B;  1GOC A;  3OYM A;  4ZTF A;  1CZ9 A;  2BTF A;  2ITG A;  4DB3 A;  4DR3 K;  1HNV A;  4Q0B A;  3MED A;  3VQ7 A;  3AVL A;  1YUW A;  4DTP A;  1GLL O;  4QS7 A;  4K8Z A;  3CFO A;  4NLC A;  4AHC A;  3V9Z A;  3THW B;  1VSM A;  2FLO A;  2AA4 A;  4KO0 A;  2UUA K;  4KTQ A;  4M7Y A;  3GOI A;  1HQU A;  3FFK B;  5T7B A;  2ZJP L;  4N41 A;  3L2Q A;  1HPM A;  3J80 O;  4FLT A;  1WB9 A;  3OYN A;  1NNE A;  3TAR A;  1DTT A;  3CXC M;  4DSI A;  3ZX3 A;  5FDL A;  3WQU A;  4JD2 A;  3V9W A;  4GV9 A;  3OW2 M;  3WEE A;  2HNY A;  1BG3 A;  4BRL A;  1YTA A;  3M3Z A;  4CJV A;  3QIN A;  4E19 A;  4IJN A;  4KH4 A;  1A5W A;  3J7Z O;  3L2U A;  2D0P A;  4X62 K;  4JI0 K;  1CXU A;  1RDU A;  2BUP A;  3S3O A;  3F5T A;  5AZI B;  3RTV A;  4OPA A;  1YVU A;  3AO3 A;  4BRM A;  4CED A;  3ZX2 A;  1YVN A;  1BDG A;  2Q0R A;  3CQY A;  4DU3 A;  3AA3 A;  2OTJ N;  4DFK A;  2VWB A;  1JXE A;  4YDU A;  4H03 B;  1X1P A;  3I33 A;  3HSC A;  2CGJ A;  2ZJQ L;  3V81 A;  1TGO A;  3OYA A;  2DFE A;  3LM9 A;  5AJ3 K;  3CJ7 A;  2D0O A;  3T3F A;  1KLN A;  2I7P A;  3QML A;  3TAG A;  4X64 K;  3VEX A;  4FOE A;  2YNH A;  2ETJ A;  4ID5 A;  4BG8 A;  2FSK A;  4C1N I;  3SUQ A;  3O1W A;  2E2Q A;  1I94 K;  1RBT A;  1X3N A;  5CY4 A;  4Z4H A;  2IVN A;  4I2P A;  3VGM A;  5BR8 K;  1RDW X;  1XQS C;  3BP8 A;  3OY9 A;  4HTL A;  3P83 D;  5CYQ A;  4JS4 A;  1U4B A;  3O3H A;  2HVI A;  5SWM A;  4KH6 A;  5AZJ B;  4LF4 K;  5FRN A;  2QXF A;  1CZB A;  5IT9 O;  1KVB A;  2OAN A;  2Q0U A;  4I9L A;  1VQP N;  3LDP A;  2DTU A;  1KQS M;  3VGL A;  4JKD A;  1BL3 A;  4DQQ A;  1C0T A;  3K0S A;  1KVA A;  4CFC A;  1NJX A;  2RF2 A;  3NE6 A;  3CQX A;  3WXM B;  4CJE A;  5BRE A;  4BE2 A;  1M1K O;  2X6S A;  4KFB A;  1HKC A;  4E7J A;  2QK9 A;  3BDP A;  4CIE A;  1ZBF A;  2HHT A;  2F7T A;  3CJC A;  3H1V X;  3SAF A;  1XHZ A;  1GLA G;  5BN9 A;  4B1Y B;  1LW0 A;  4EHT A;  4HWI A;  5K14 A;  3CJB A;  2BE2 A;  1U6Z A;  1RTD A;  4FJL A;  3SUN A;  2WC9 A;  1UOC A;  1L3T A;  3RRH A;  1CZA N;  1SKR A;  4JI2 K;  3L6Q A;  1EQY A;  4FWS A;  2D4W A;  4MLH A;  4YDU C;  4CHN A;  4CZK A;  1LW2 A;  2HHW A;  4CJS A;  3LDS A;  1RBV A;  4LD0 A;  3TAM A;  2O8B B;  1VHX A;  3ASM A;  1N34 K;  2CGL A;  2NUB A;  4JKF A;  2BDP A;  1RDA A;  1EXQ A;  3E9L A;  2WFB A;  1OKJ A;  4X66 K;  3R1X A;  3GL1 A;  1DT9 A;  2V52 B;  4IWV A;  4CF9 A;  3THX A;  1JKH A;  1LAV A;  1ZBI A;  4YOR A;  1IBK K;  4MO5 A;  3VA0 A;  3VQC A;  4JLH A;  4Y0W A;  4KKO A;  4Z0U A;  2LSN A;  1NU0 A;  1MDU B;  2O8E B;  1S1T A;  3OVN A;  2KKZ A;  4CF2 A;  1HNW K;  1IBM K;  4TSX A;  2Q3S A;  4BE1 A;  5D3G A;  3C7N B;  5J2N A;  1HJO A;  3IKM A;  4N76 A;  3ZT3 A;  4DTN A;  4B1X B;  4CJT A;  3ISN C;  3ZSY A;  4QCL A;  3P38 A;  1NK8 A;  3C65 A;  2VWK A;  3O5B A;  2E2N A;  3EE8 A;  3SQ2 A;  3CCJ N;  2JLE A;  4C8O A;  3O3G A;  4H0Y B;  4FJH A;  5B8H A;  3C7N A;  1ESV A;  3L2V A;  4PL7 A;  3IMX A;  3W3D A;  2QWN A;  4MQ3 A;  3MEC A;  5BRH A;  2DFF A;  3MMV A;  3C6T A;  4DSJ A;  4LF9 K;  3MWT A;  3SLC A;  1XUP O;  2HNZ A;  2W41 A;  1NJW A;  2E4L A;  5EY4 A;  3KD5 E;  3MDQ A;  1LWE A;  3CET A;  3O9T A;  2P9P A;  4BRI A;  1WSF A;  4M45 A;  1RDD A;  1RBS A;  2GX9 A;  1BA1 A;  1HPZ A;  1R59 O;  1BIS A;  3LAN A;  3PUF A;  2E1Z A;  3RWU A;  1W0H A;  4AHU A;  3HZ6 A;  3LPT A;  4W5Q A;  2QKK A;  1SS6 A;  4EHU A;  3ULE A;  4NCA A;  4CEF A;  4RW8 A;  1C1A A;  3T1Y K;  4G9Z A;  4QS9 A;  3OS2 A;  1N33 K;  4O5B A;  4CEE A;  2A40 A;  2B4J A;  1WSH A;  4BR7 A;  2J4R A;  3KKS A;  4O5F A;  5C10 A;  4GMJ B;  2YKM A;  4O55 A;  3CI5 A;  4A5A A;  1QSY A;  3ZT2 A;  2CGK A;  3GE1 A;  3JYT A;  1VSJ A;  3VQ5 A;  5KQD A;  1S6P A;  1TVR A;  2G8F A;  4NXM K;  3ZSV A;  3JAM O;  1S5J A;  4JI8 K;  3SPY A;  1QZ5 A;  2IVP A;  3IS9 A;  4H5T A;  4JNE A;  5GAG P;  3CMA N;  4DQS A;  4FLW A;  1T6D A;  3K5M A;  4FJK A;  1QQM A;  3MN7 A;  1TKZ A;  5AQL A;  4EZ6 A;  1ZBS A;  3VET A;  4I9Q A;  3AAQ A;  3MCP A;  2QWP A;  3BEX A;  2YI1 A;  2VG5 A;  4IJA A;  2YHW A;  3PX6 A;  4E0D A;  2UXC K;  5AQQ A;  4B9S A;  1NOY A;  2QWO A;  1N8R O;  4FSV A;  4EAH D;  3PO5 A;  3D2F A;  3TAF A;  4CF1 A;  5KPT A;  4DR5 K;  4Z4C A;  2A1S A;  1NGB A;  3ZX0 A;  1X9M A; 
#chains in the Genus database with same CATH homology
 3LWM A;  3HPH A;  2XRI A;  4IG3 A;  4N47 A;  5HLF A;  4B8A B;  4FCY A;  3U6F A;  4F2R A;  2VG6 A;  4RG8 A;  2Z1I A;  3HVT A;  3LAK A;  4CGD A;  3DYA A;  3AO2 A;  1RTH A;  4FVM A;  1L5U A;  4CEB A;  4BWM A;  2DY4 A;  4DTJ A;  3V9S A;  2D0B A;  3K2P A;  4KTW A;  3MAQ A;  1KFD A;  1VSE A;  3DRS A;  2HHX A;  3DRP A;  3ZSQ A;  3HJF A;  2WOM A;  4DWI A;  3OJU A;  2IGI A;  3E01 A;  1RT5 A;  4O4G A;  4Q5V A;  3U3Y A;  1Q9Y A;  4J2E A;  1NJZ A;  3I0R A;  4ELV A;  2WON A;  2G8H A;  4IG0 A;  1RBR A;  3KLI A;  4HCB A;  2Y1J A;  3V1R A;  3DRR A;  4FM1 A;  3AVI A;  1A5V A;  4HHT A;  1RT1 A;  1S9E A;  2OPR A;  2X74 A;  3M8P A;  4CJL A;  3I8D A;  5J2P A;  2Y1I A;  4AIL C;  2KQ2 A;  3TI0 A;  1NK0 A;  4I7F A;  3AVK A;  1LV5 A;  1D9F A;  1U49 A;  4CEO A;  1IKY A;  3DLE A;  1HYZ A;  4DF4 A;  3LPU A;  4FLV A;  1VSK A;  2FBV A;  3I0S A;  3S9H A;  2XHB A;  4F2S A;  3EYZ A;  3M8S A;  1JLE A;  2XY6 A;  3OYF A;  2F8S A;  3KLG A;  3K59 A;  3QNO A;  3AVB A;  1U04 A;  1HQE A;  1RTJ A;  5HRS A;  4DG1 A;  3MXI A;  1RNH A;  1F21 A;  3VQP A;  3L3V A;  5E41 A;  4L8R B;  3AA4 A;  3ZT1 A;  4DSE A;  1D9D A;  4W5T A;  4FJM A;  2YHB A;  1TAU A;  3B6O A;  2OPP A;  1DLO A;  4AHR A;  3ZSX A;  3ALY A;  2HB5 A;  3AA5 X;  4GVM A;  3VQ8 A;  4JRQ A;  3PX0 A;  4KI6 A;  4FLY A;  4CEQ A;  4CGJ A;  1XWL A;  4FJ7 A;  3H08 A;  4E1M A;  2OPQ A;  1T7P A;  3PY8 A;  4CGI A;  2O4I A;  2HHQ A;  2OZS A;  4HCC A;  3HK2 A;  2IC3 A;  2DFH A;  4DQP A;  5EU7 A;  3CM6 A;  3EY1 A;  1KFS A;  4O44 A;  5CZ2 A;  1SKW A;  1IKX A;  1BI4 A;  1HMV A;  1BCO A;  1LWF A;  1WSJ A;  4E3S A;  3D45 A;  2A1R A;  1TL1 A;  2PYJ A;  1BQN A;  4B9U A;  1D5A A;  4B3O A;  3LAM A;  1NK5 A;  4DS4 A;  4HUE A;  1HYS A;  3NCI A;  3SNN A;  4XIU A;  4OGC A;  3OYC A;  1HNI A;  5KI6 A;  3NH2 A;  1JXB A;  3NDK A;  1JLB A;  1GOC A;  1B92 A;  1W9H A;  1KTQ A;  1CZ9 A;  4GW6 A;  3OYM A;  2ITG A;  4ZTF A;  3UIQ A;  4M3U A;  1SL0 A;  1NKB A;  4ELU A;  1C0M A;  1HNV A;  3ZSW A;  1ASW A;  2ZQB A;  3MED A;  4ID1 A;  3VQ7 A;  1XI1 A;  4FJG A;  5KRS A;  3OYK A;  2D5R A;  3AVL A;  1RBU A;  1TV6 A;  1FK9 A;  3VQ9 A;  4EP4 A;  3CM5 A;  4DTP A;  4QAG A;  2IS3 A;  1JLC A;  3AV9 A;  3K5N A;  4CJW A;  1HJR A;  4K8Z A;  3CFO A;  4J2A A;  3HPO A;  3O4Q A;  4RW6 A;  2HW3 A;  5DK5 A;  4DTO A;  3BGR A;  4B9M A;  5HRR A;  4JS5 A;  1SL2 A;  2HVH A;  1ASU A;  3PX4 A;  2G8U A;  4AHC A;  3V9Z A;  1VSM A;  4Q0B A;  1G15 A;  3L3U A;  1JL1 A;  3AO1 A;  1Q8I A;  4B08 A;  2GV9 A;  1WLJ A;  4KO0 A;  4Y1D A;  3SV3 A;  4KTQ A;  4M42 A;  4JRP A;  1RT2 A;  3G0Z A;  4PA1 A;  2EHG A;  1EET A;  3SQ1 A;  1RDB A;  1L3S A;  1HQU A;  5T7B A;  1KSP A;  4N41 A;  3P5J A;  3L2Q A;  3QEV A;  4BAC A;  4DTU A;  1C6V A;  3DM2 A;  3NF7 A;  2G8W A;  3NGI A;  3SV4 A;  4AHV A;  4FLT A;  3QO9 A;  3RR8 A;  1O1W A;  2R7Y A;  4DF8 A;  3OYN A;  1J53 A;  4CE9 A;  3LZI A;  3TAR A;  1NJY A;  1T05 A;  1DTT A;  2RKI A;  2YV0 X;  3KK1 A;  2AJQ A;  4C8M A;  4CFA A;  4DLE A;  1IH7 A;  4DSI A;  5FDL A;  3HXM A;  4BDZ A;  3V9W A;  4YNQ A;  4OPJ A;  1JLF A;  3NF6 A;  5SZT A;  3OS0 A;  1L3U A;  2HNY A;  1XHX A;  3C95 A;  3MEE A;  1BHL A;  4ELT A;  1MU2 A;  1NK7 A;  1YTA A;  4DQR A;  1RDC A;  4CJV A;  4C8K A;  2BAN A;  3QER A;  3QIN A;  4IKF A;  4DLG A;  3KIO A;  3RMA A;  4E19 A;  4CK1 A;  1N6Q A;  4B9V A;  4LH5 A;  4Z4I A;  3VQE A;  2Z1J A;  3C6U A;  5FRO A;  1A5W A;  1FXX A;  3WNG A;  4B9N A;  3WNH A;  3V1Q A;  3DLB A;  1QQC A;  3L2U A;  3V4I A;  1BIZ A;  1SUQ A;  1QTM A;  4FJ9 A;  2E6L A;  2B6A A;  3SQ4 A;  1CXU A;  4DMN A;  4PQU A;  3OYJ A;  3S3O A;  3KJV A;  3O3F A;  4FJI A;  3SZ2 A;  3D0P A;  4O0I A;  3RTV A;  1YVU A;  1U48 A;  4CJ3 A;  4DFP A;  3ULD A;  1Z25 A;  3AO3 A;  4FJN A;  1S1X A;  3MXJ A;  4CED A;  1NK4 A;  5C24 A;  1TKD A;  3F73 A;  4DU3 A;  3AA3 A;  3HO1 A;  1C0U A;  1EX4 A;  4DTM A;  4DFK A;  1JXE A;  5JS1 A;  4FK0 A;  3LP1 A;  1Z26 A;  1VSF A;  1X1P A;  3TAE A;  4CCH A;  4CHO A;  4CJ5 A;  2YKN A;  3K5O A;  1C1C A;  4CHQ A;  2XO7 A;  4HUF A;  1TGO A;  3OYA A;  2ZE2 A;  1VSL A;  3V81 A;  4DSF A;  4QOZ B;  3ZT0 A;  2DFE A;  3AVA A;  4CEZ A;  4Z4E A;  1IKW A;  2P51 A;  1FKP A;  3T3F A;  1KRP A;  1VSD A;  3NAE A;  1KLN A;  2OYQ A;  2KTQ A;  3M8R A;  1VRU A;  3NHG A;  2P5O A;  1UWB A;  1LAW A;  2XY5 A;  3TAG A;  3LP2 A;  4B9L A;  1RTI A;  3QEW A;  1NKC A;  1IO2 A;  3T19 A;  4CJK A;  3L2R A;  2YNH A;  2ETJ A;  4ID5 A;  3VA3 A;  3SUQ A;  4W5O A;  3OYH A;  3DOL A;  1X9W A;  1RBT A;  2VG7 A;  2KZZ A;  1RT6 A;  5CY4 A;  1FKO A;  1ASV A;  3NFA A;  4CK2 A;  4CIG A;  2YNF A;  4Z4H A;  4KTZ A;  3L2W A;  1T03 A;  3AVM A;  4I2P A;  1J9A A;  1NOZ A;  4OVL A;  4RW4 A;  4OLB A;  4DTS A;  4AH9 A;  1NK9 A;  2F96 A;  3OY9 A;  3TAP A;  1EKE A;  3P83 D;  3VQ4 A;  2HHU A;  5CYQ A;  1I3A A;  4JS4 A;  3K57 A;  1U4B A;  3O3H A;  4ZHR A;  1TK8 A;  2HVI A;  5SWM A;  1WAF A;  2FC0 A;  3HP9 A;  4BDY A;  5FRN A;  4FLZ A;  3VQB A;  2QXF A;  2IDO A;  2OZM A;  1CZB A;  3KLE A;  4FZX C;  1KVB A;  3OYI A;  1ITG A;  1RT3 A;  4C8L A;  3FFI A;  4I9L A;  2P1J A;  4CF0 A;  4LSL A;  4I2Q A;  1Q9X A;  4CEC A;  2DTU A;  4IDK A;  4CEA A;  3OYG A;  1BL3 A;  3WNE A;  4DQQ A;  4CGF A;  4EZ9 A;  1C0T A;  4KAZ A;  4B8C A;  4M41 A;  1KVA A;  4CHP A;  4CFC A;  1B9D A;  1NJX A;  4NCG A;  2RF2 A;  2E6M A;  3NE6 A;  3SJJ A;  2HMI A;  4M3W A;  1D8Y A;  1GOB A;  1ZYQ A;  4CJP A;  1TL3 A;  4CJE A;  3S3N A;  4BE2 A;  2X6S A;  4KFB A;  2F8T A;  4FJ5 A;  4FW1 A;  2QK9 A;  4E7J A;  4FM2 A;  3VQD A;  3KK3 A;  1N5Y A;  2IAJ A;  3BDP A;  4CIE A;  1ZBF A;  4G1Q A;  4ICL A;  2HND A;  2G8K A;  2HHT A;  3AO4 A;  1YTU A;  4W5R A;  4DTR A;  3A2F A;  4M3R A;  3HVR A;  3SCX A;  3HYF A;  1XHZ A;  3HST B;  2XY8 A;  1SL1 A;  1A5X A;  1LW0 A;  1S1W A;  4HTU A;  4H8K A;  4E7L A;  5I42 A;  4PUO A;  5K14 A;  4KHW A;  1VK0 A;  1VRT A;  1CXQ A;  4M3Z A;  2BE2 A;  5HP1 A;  1UA0 A;  3LAL A;  4H4O A;  3K5L A;  1RTD A;  3PO4 A;  1WAJ A;  3NGY A;  4H4M A;  3SUN A;  4FJL A;  4N5S A;  5C42 A;  1UOC A;  3TWH A;  3KTQ A;  4E7I A;  1L3T A;  1SV5 A;  1YT3 A;  1ZBU A;  3RRH A;  1S6Q A;  4OKJ A;  3T1A A;  1SKR A;  4F3T A;  2B5J A;  3AO5 A;  3OYL A;  4DTX A;  3QET A;  2ZD1 A;  2HHV A;  1JLQ A;  1TK5 A;  4CHZ A;  4CHN A;  4CJ4 A;  2KZM A;  1SKS A;  4ZTJ A;  3K58 A;  1R0A A;  3KLF A;  1LW2 A;  1DTQ A;  3QLH A;  4CJS A;  3NH0 A;  3LDS A;  1QHT A;  4FJ8 A;  2HHW A;  4AHS A;  1RBV A;  4LD0 A;  1UA1 A;  3TAM A;  3ASM A;  3G10 A;  4OGE A;  4CJQ A;  4M3X A;  4CHY A;  1QSL A;  1NK6 A;  2NUB A;  1IG9 A;  2BDP A;  1RDA A;  1EXQ A;  4KI4 A;  3NF8 A;  3RMC A;  2IOC A;  2O4G A;  4HUG A;  5HRP A;  3AA2 A;  5JS2 A;  4FK2 A;  1T8E A;  4DSL A;  1B9F A;  4KB1 A;  3U3G A;  4CF9 A;  3HP6 A;  5J2Q A;  3RMD A;  1JKH A;  1LAV A;  3RMB A;  5HBM A;  4NYN A;  3CQ8 A;  3DOK A;  3CFP A;  4FW2 A;  1ZBI A;  1WN7 A;  3V1O A;  3AVC A;  3C94 A;  3VQA A;  5J1E A;  1S9G A;  1VSH A;  2FBY A;  3LP0 A;  3VA0 A;  1TKT A;  3S3M A;  4Z4G A;  1EP4 A;  2D0A A;  3VQC A;  4CJU A;  4JLH A;  2PZS A;  4CF8 A;  4KHY A;  4FK4 A;  1HRH A;  2XY7 A;  3DLK A;  1J54 A;  4KKO A;  3WNF A;  4Z0U A;  3QIO A;  1U47 A;  4MFB A;  3ZSR A;  2LSN A;  1WNS A;  4R5P A;  1S1T A;  3DMJ A;  3OVN A;  4CF2 A;  4DU1 A;  3AVH A;  3MXM A;  1WSI A;  1RT4 A;  1Y97 A;  4TSX A;  2Q3S A;  4CJF A;  3OYB A;  3OYD A;  4BE1 A;  3TAB A;  5D3G A;  5CZ1 A;  5HRO A;  3O4N A;  1JLG A;  4YFU A;  3TR8 A;  5J2N A;  3OJS A;  4LY7 A;  4DFJ A;  4N76 A;  3ZT3 A;  4DTN A;  5HRN A;  2HHS A;  4CJT A;  3ISN C;  3P1G A;  3ZSY A;  4QCL A;  4CFD A;  1NK8 A;  4Z4F A;  4F3O A;  3KKR A;  3AVJ A;  4M3Y A;  2EX3 A;  1KVC A;  4KB0 A;  4KHN A;  3QES A;  2VWK A;  3SQ2 A;  4FYD A;  4CK3 A;  1RCH A;  3ZSZ A;  4AHT A;  2P5G A;  5FRM A;  2FBX A;  1RT7 A;  1XC9 A;  3QEP A;  2JLE A;  2I5J A;  1HYV A;  4C8O A;  3RR7 A;  3O3G A;  3DLR A;  1J5O A;  4OKK A;  4NCB A;  4FJH A;  3IG1 A;  5J2M A;  5CYM A;  4Y1C A;  2QKB A;  1UAX A;  3AVN A;  1REV A;  1VSI A;  1RIL A;  5KGX A;  4B9T A;  4F8R A;  3NF9 A;  3JSM A;  3L2V A;  3EZ5 A;  2VWJ A;  4MQ3 A;  3MEC A;  3TAN A;  3TAQ A;  4HVJ A;  4KV8 A;  4WE1 A;  1S1U A;  2DFF A;  3B6P A;  3C6T A;  4CGH A;  3ITH A;  1L3V A;  4DSJ A;  2Z1H A;  3ZSO A;  3MEG A;  1NKE A;  2YNI A;  4LSN A;  2BGG A;  3THV A;  3L8B A;  4IBN A;  2HNZ A;  1ZBL A;  4DSK A;  1NJW A;  2X6N A;  2E4L A;  3KD5 E;  1WSE A;  1LWE A;  3CFR A;  4FLX A;  4BWJ A;  4OLA A;  4UQG A;  1WSF A;  4FZY A;  3KD1 E;  3AVG A;  4M45 A;  4KHS A;  4BDP A;  1RDD A;  1RBS A;  4CJR A;  3SI6 A;  2G8I A;  4DFM A;  1IKV A;  4RW9 A;  1S1V A;  3KLH A;  2GBZ A;  3SPZ A;  1HPZ A;  4NYF A;  3F9K A;  1WSG A;  4M3T A;  3NH1 A;  1BIS A;  3RRG A;  3NGZ A;  1TKX A;  4W5N A;  4CER A;  5KGW A;  1LWC A;  3ZCM A;  3OS1 A;  3LAN A;  1QE1 A;  2RN2 A;  4BE0 A;  4IFV A;  3PUF A;  4FM0 A;  1U45 A;  1W0H A;  4AHU A;  2FBT A;  3LPT A;  4W5Q A;  2QKK A;  3RWU A;  2KFN A;  3M8Q A;  2ATQ A;  3DI6 A;  4KHU A;  3AVF A;  4NCA A;  4FXD A;  4CEF A;  4RW8 A;  1C1A A;  4OJR A;  2YHA A;  3ZT4 A;  3OS2 A;  3LP3 A;  2OA8 A;  1JLA A;  2PYL A;  1BGX T;  3QEI A;  4O5B A;  4FLU A;  1BCM A;  3QEX A;  2YNG A;  4CFB A;  2D0C A;  4E7H A;  4CEE A;  1KLM A;  2B4J A;  1WSH A;  3CYM A;  3VQ6 A;  2PY5 A;  1BI4 B;  3KKS A;  4RW7 A;  4GMJ B;  4CIF A;  4OPK A;  2YKM A;  3VN5 A;  4O55 A;  3PV8 A;  1QSY A;  4E89 A;  3ZT2 A;  1ZBH A;  4E1N A;  4DU4 A;  1BIU A;  3V9U A;  3DLG A;  3NBP A;  3HL8 A;  1VSJ A;  3VQ5 A;  3JYT A;  1S6P A;  3SYZ A;  4J2D A;  3DLH A;  1TVR A;  2G8F A;  1I39 A;  3ZSV A;  2RPI A;  3LWL A;  1S5J A;  1JL2 A;  3SQ0 A;  2KW4 A;  3SPY A;  3VQQ A;  3QNN A;  4N56 A;  4J2B A;  5DMR A;  2Z1G A;  4LH4 A;  2X78 A;  1QSS A;  3IS9 A;  3IAY A;  4KHQ A;  3QIP A;  4C8N A;  1BQM A;  2GUI A;  4DQS A;  4FLW A;  3V6D A;  4PY5 A;  4KRF A;  3HPG A;  4F4K A;  3K5M A;  4FJK A;  4O0J A;  1TKZ A;  4CES A;  1CLQ A;  1KCF A;  4EZ6 A;  4OKE A;  4KPY A;  2G8V A;  4I9Q A;  3IRX A;  1GOA A;  1QS4 A;  4KRE A;  2JGU A;  3V9X A;  4DS5 A;  3OYE A;  2KFZ A;  4EP5 A;  2VG5 A;  4K8X A;  4E0D A;  3PX6 A;  3SUP A;  1TK0 A;  2OPS A;  4CGG A;  1NOY A;  4B9S A;  4IFY A;  4FJX A;  1K6Y A;  1TAQ A;  3HT3 A;  3KK2 A;  3LZJ A;  1C1B A;  5KRT A;  3PO5 A;  3TAF A;  4DQI A;  2W42 A;  3CG7 A;  4CF1 A;  5KTQ A;  4FJJ A;  1X9S A;  5I3U A;  4Z4C A;  4FZZ A;  3SUO A;  4E7K A;  2A1S A;  3HM9 A;  5C25 A;  4PWD A;  1X9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...