2YNGA

Hiv-1 reverse transcriptase in complex with inhibitor gsk560
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 168
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yngA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yngA05
3KTQA 1L3SA 4WE1B 1B9FA 2IAJB 1RT4B 1HRHA 4MK7A 1RDAA 4KSEB 5JS1A 3IN5A 1X1PA 4DG1A 1S9FA 5J2NB 1NJZA 3H40A 3QGGA 1Q9XA 4FJ8A 2XC9A 4NLPA 4KPYA 1DLOB 3SPZA 3ZSOA 1JLCA 3HL8A 3NAIA 3KKSA 2IM3A 3K59A 3SUNA 1FKPB 4EP4A 4FYDA 2QKBA 4URGA 1VSHA 2R2RA 3AVAA 3DLGB 4ICLA 5DGBA 4Q8EA 1GOBA 1WSJA 4M3YA 3DLKA 3ZSXA 3HP6A 4FK2A 1UWBB 3PW7A 1S9EB 4FLXA 3DLEB 2W8KA 2KZZA 2YKMB 3KLVA 2OZMA 2IC3B 4HUEA 2HW3A 1I39A 2OYQA 3KMQA 3TANA 2OZSA 4KRFA 3ITHA 4KKOA 3V1RA 3UPFA 2JEGA 3AVNA 2FJWA 2BDPA 3BQ1A 4MQ3A 4ECRA 2J6TA 1CZ9A 2WRMA 1ASVA 4DFPA 2OPPA 3SPYA 4NLQA 5F8IA 4PWDA 3NCIA 3ZSYA 1XHZA 4RW9A 5F8MA 3QIOA 1GX6A 2E6LA 5DQHA 4FJNA 1BL3A 2W9CA 4KHWA 4FLUA 4RW9B 4J9OA 3C95A 1KFDA 3ZSVA 3KK1B 2OPSB 4DWIA 4FM1A 1U4BA 4I9QA 2UVRA 1S1VA 4IR1A 4DTMA 4DF4A 4IRKA 1KCFA 2PYLA 5KFIA 1HNIB 2IM1A 1ZBIA 3KJVB 4ZVGA 4E7LA 4TY8B 1LWFA 3GIJA 1NK5A 3IG1B 1Q9YA 1UA0A 3MEDB 4ED8A 2C22A 4IKAA 3EPGA 1SV5B 4C8LA 5HLFA 3HYFA 5D3GB 4XIUA 4IDKB 1BIZA 3T3FA 2VA3A 4ED1A 3OL9A 2BQUA 4J9PA 3DI6B 5DGAA 3I0SB 2UVUA 1NK0A 2B4JA 1RTHB 4RNNA 1A5WA 1ZBFA 4DTJA 2F96A 1O1WA 4J2DA 2YNHA 2W9AA 1RDCA 2A1SA 3T19A 2ETJA 4FVMA 5KGWA 1JLGB 2HMIB 3V9SA 4BDPA 1X9WA 2R8KA 1L5UA 3DRPA 1KTQA 4E89A 1NKBA 4CFBA 4DTRA 4K4XA 3TARA 4DQIA 1IKVA 1WSEA 2KFNA 4CESA 3VQ9A 2ASLA 3K57A 3SZ2A 4DL5A 5FDLA 4G1QB 3GIIA 2FVQA 4HHTA 4MIAA 2W9BB 3L2WA 4DQRA 3L2QA 2I5JB 3IS9A 4LSNB 5KFUA 1RT3A 3ISND 4I2QB 4X2BA 3TAGA 4LSLA 1QSLA 1T94A 4YNQA 3BSAA 2QKKA 2FJVA 1RT2A 4ED3A 2D3UA 2YNHB 5SWMA 3LP1B 5KG4A 3KLEA 4O44B 1XI1A 2C2EA 3NGZA 2WB4A 3LANA 3CJ3A 4NRUA 3BJYA 3RB6A 3H98A 5L1LA 1TVRB 4E1MA 4K4WA 3M8PA 4CJVA 4RNMA 3DOLA 3TAMB 4J2AA 1SH0A 4IH7A 4HVJA 1JLCB 4NRTA 4O3OA 2XO7A 1LWFB 3M8PB 3QETA 1REVB 5KRSA 2BGGA 1NK8A 3SUQA 2O4GA 1RA6A 1K1QA 4J9MA 4OGCA 4DU4A 3IRXB 1I3AA 4N76A 1HYSB 4MKAA 3DLGA 3PHEA 2O5DA 1VSFA 4R8UB 1ZBLA 4RW8A 4CFAA 3L2VA 4DF8A 3MECB 5EUHA 1HYSA 2R8GA 3M9NB 2WHOA 3BGRA 4NLRA 1TP7A 3HSTB 3S3OA 3V1OA 3H5UA 4R5PB 3H5YA 1Q8IA 3H08A 4B8CA 4JS5A 3LZJA 3KHLA 4I7FA 1QSSA 3MTKA 3NF6A 2E6MA 3C94A 3OYIA 4B9SA 2BQRA 1FKOA 3TAMA 1Z25A 3ITHB 3QO9A 3GV8B 3MXIA 2BRLA 4BACA 4N41A 1NOYA 1S1XB 2DFHA 1VRUA 4IKFA 4FJ5A 4LQ9A 4JLHA 2P1JA 1IH7A 1LAVA 4BWJA 1RT7A 1UWBA 2VG6B 3O3GA 2YKMA 1CXQA 1R0AA 3NGIA 3RRGA 5KFLA 4J9QA 4DL3A 4BWMA 4CJTA 1S1WA 4KV8A 4ZP9A 3TQ1A 2FJXA 2DPJA 3LWMA 4O3NA 4EZ9A 4CF0A 4AHTA 4IFYB 1U49A 1DLOA 1K1SA 2XGQA 2RKIA 3WNFA 3L2RA 4DS5A 5L9XA 5L1KA 4QWEA 1S1UA 3S9HA 4HTUA 2RKIB 5CY4A 4BE1A 4H8KA 3KKRA 1TKTB 2BE2A 4K4SA 2X6NA 1S49A 3FDSA 2ASDA 2HNZB 2EC0A 1RYSA 2J6UA 3KK1A 1W0HA 2B5JA 1DTTB 1L3UA 4IBNA 3ZSZA 4TXSA 1BQMB 2G8WA 2D0BA 3SV4A 4CK3A 5K14B 3DI6A 3VQ8A 4KB7A 1NK6A 3EZ5A 3AV9A 4DTPA 4F50A 5J2PB 3KHHA 4URSA 3PR4A 1HPZA 4M3TA 4NLVA 5KFHA 3RB4A 4JV2A 1JL1A 4ECVA 4G3IA 3AA2A 1HPZB 2E9ZA 4B9TA 4B3OB 3OYBA 2PYJA 1EKEA 2FBTA 2ILZA 4QOZB 4KHSA 4ELTA 3HKWA 1U04A 4K4ZA 1TV6A 4FJMA 1LW0A 4RW4A 5KT6A 2ZQBA 3DRSA 4RNFA 1JX4A 4C8MA 2YNGB 4EYHB 1ZETA 3OYNA 3G86A 4HKQA 1S1TB 2UUWA 3AVLA 1SKSA 4FJ7A 2FLLA 1C0TA 3LAMA 1A5XA 2B6AB 1S97A 1QHTA 2RF2A 3OS2A 3NMAA 3VQEA 3PY8A 4ZPBA 1B9DA 3U3YA 3TWHA 5HBMB 3G0ZA 3KOAA 4DSFA 2IMWP 1W25A 5EWGA 1RBRA 4CJQA 3NH1A 2IA6A 4QW8A 3WNGA 3AO5A 2UUTA 3AVBA 2QK9A 4E0DA 2XI2A 2B6AA 1JXBA 4E19A 4FK0A 2AU0A 4EBEA 4Z4GA 2D0CA 3KK2A 4FJHA 5L1JA 4LH5A 1QE1A 4F4XA 2ASJA 2FVCA 1N6QB 1RAJA 4CF9A 3VQSA 3DRSB 3HPOA 1MU2B 3PJXA 3QEXA 1LW0B 5KFJA 2KQ2A 3IGVA 4IRDA 1EXQA 4TN2A 3D45A 3H5XA 3V6HA 1A5VA 2X74A 3RRHA 2FLPA 5HROB 3QYYA 4NCGB 5T14A 4ECWA 3VQ5A 2HNYA 4AHRA 1TL3A 2ILYA 1JXLA 4TLRA 4QWDA 4JV1A 4K4YA 3BSCA 3I0RB 4NLDA 4ELVA 3PX6A 3CFPA 1HNVB 4AILC 2HNDB 3LP2A 1JLQB 1ZBUA 3OY9A 4N56A 2HHTA 1SL1A 1XC9A 5I42B 2IDOA 5KFRA 3RMAA 1KLNA 3V6DA 4GC6A 3BDPA 2HHSA 4HYKA 3HVAA 1C1BB 3SI8A 2VG5A 2WONA 3U6FA 2A1RA 2BR0A 3TABA 4W5TA 3JSMA 1RDDA 4DTSA 1JL2A 3SJJA 3KD1E 4O4RA 4F8RA 1JLAB 1S48A 2ZE2A 4CHPA 3G6VA 1S6QB 4CJ4A 4PQUA 1VRTB 3M9OB 1QAIA 4DQPA 5JXSA 5HRSA 5CZ2A 3HVTA 4KKOB 4E7KA 4O3PA 4Z0UA 1RBTA 2EX3A 4M42A 2YNIA 2IS3A 1KLMA 3ZSQA 3QZ8A 2CKWA 3M8SA 1JLEB 4CJFA 4PY5A 3EZUA 3V81B 3OS1A 3QIDA 4PUOB 5C24A 1DTTA 3O3HA 1NKCA 1T3NA 1NHVA 2KFZA 2ITGA 2X6SA 4LSNA 2HNZA 3L3UA 4TQRA 1RA7A 3QERA 3HVTB 5KFZA 2G8HA 4KHUA 1T03B 3G10A 1NJYA 1RDBA 3IG1A 3L2UA 3LP0A 4CEEA 2OPPB 3O4NA 4G1QA 4CJEA 3CO9A 3ZT3A 4ECYA 4WE1A 4QPXA 2OPRB 5C42A 1RT1B 4RNHA 1HQUA 3LZIA 2GIQA 4H54A 4BE2A 2PY5A 4O3QA 4EP5A 5KFYA 1QS4A 5KT5A 3S3MA 3FFIA 2UVWA 1N56A 1TAQA 2VG6A 2D5RA 2Z1IA 4Z4HA 4FJJA 3B6OA 1N6QA 3KHGA 1BHLA 3OJUA 1JKHB 1HQEB 2RN2A 3VQPA 5KFQA 4IG3A 1QUVA 2JEJA 4DTXA 3NF7A 3DM2B 3PVXA 3MFIA 3K58A 3CFOA 4NCBA 4CFCA 3MEEA 4TY9A 3OYGA 3HT3A 3T5HA 4IG3B 4WFYA 4N5SA 5F8GA 4JV0A 4NYZA 3V9ZA 2AGOA 1C0UB 4ECXA 4DSKA 3OYKA 3DRRB 1KVAA 4O44A 1LWCB 4CIEA 4O3RA 4FM0A 4RW6B 3AO3A 1HYZA 3N6LA 1QE1B 3V6KA 5HRRA 2VG5B 1B92A 3JSMB 2YKNA 3OL7A 4EYIB 2G8UA 3LWLA 1BQMA 1SUQB 4J9KA 4FLYA 4M95A 4FLZA 4LSLB 1RT1A 4CF1A 4CEZA 5DG7A 3IS9B 3V6DB 2ZD1B 3IRXA 4PWDB 1BI4A 4FJIA 1C0UA 4KAZA 2JEIA 2JC1A 1GX5A 2IJNA 4IFYA 1UA1A 2BANB 4FZYA 4CF2A 3Q8RB 4KV8B 4O0JA 5KFMA 5FROA 1XWLA 1D9DA 4M45A 1RBVA 4K4TA 3TAEA 4I9LA 3KK3B 1K6YA 1S0OA 1JLBB 4FJLA 1D9FA 4PUOA 3NAEA 3AVMA 4J9SA 3UR0A 3QEPA 4RU9A 1BCMA 4OJRA 1RCHA 1EX4A 3I0SA 1TV6B 2O4IA 1U45A 3G6YA 5KT7A 1NKEA 4ICLB 5HLFB 4C8KA 3GIMA 2I5JA 3UIQA 1LWEA 3HJFA 1TQLA 1N5YB 5EU7A 1NK9A 5I3UB 2AX0A 3BREA 3H2LA 2BANA 3NGDA 2FBYA 3SUOA 4OLAA 4YR2A 4ECSA 4WFZA 2XY8A 4OPJA 4QAGA 5DG9A 3T5LA 4EO6A 1DTQA 3RMBA 2XCAA 4WXOA 2I1RA 2F8EX 2VWJA 3LP3A 3S3NA 4R0EA 1C0MA 1RT4A 4ECQA 4WZMA 2YNGA 4F3TA 4J9LA 4KI4A 3DRRA 3LPUA 5F8JA 4QWAA 3V4IA 5KFSA 3PW5A 1UOCA 4W5NA 1CZBA 4ZPCA 1QSYA 5F9NA 1TK8A 4MFBA 1Z4UA 2VA2A 4LY7A 3MEEB 1YVUA 1VRUB 3FQLA 3T1AA 1RTDB 3QIPB 3QGIA 1VSEA 3FQKA 1WN7A 3RBDA 5C5JA 3RBEA 4QWBA 4KFBA 4LH4A 3UQSA 2QXFA 1RTDA 4NCGA 3NDKA 1ASWA 4KHRA 1C1CB 1TVRA 5HRPA 2WTFA 4RZRA 3WNEA 1L3VA 3V9UA 5KG1A 3SCXA 4M94A 2FC0A 3RAQA 1U48A 1WNEA 3U3GA 4ZTJA 3NBPA 3O3FA 3V4IB 4FS1A 4KI6A 3B6PA 3CM5A 2X78A 4H4OB 4RW8B 1ITGA 1TKTA 3QO9B 1BISA 1FKPA 3AVHA 1GOCA 1D5AA 2AQ4A 1VSJA 2HHUA 2DTUA 1SL0A 4DSLA 4KB0A 4KAIA 3V1QA 4M3WA 2XI3A 3C6UB 2GUIA 3QEIA 4AHCA 3T5JA 4I7FB 3H59A 2ZKUA 3MXJA 3ZT4A 3RTVA 3OJSA 3SV3A 4IRCA 1TKXB 4B9NA 1BGXT 3KLIA 1HARA 3F9KA 4CK2A 5CYQA 3HM9A 4JRQA 2WCXA 1MU2A 1D0EA 2G8KA 2DFFA 1TGOA 3OLBA 3NF8A 2OA8A 4O4GA 1S6PA 3QINA 5C25B 1REVA 2D0AA 4GC7A 3MAQA 2DY4A 2V4RA 3H4DA 4CK1A 3NFAA 2OPQB 4FJXA 1YTAA 5KFXA 3HXMA 1SH2A 3ZSWA 4WYLA 1VRTA 1TK0A 4YMEA 1IKYB 3BR9A 2F8SA 4IR9A 1S9GB 2HVIA 3SUPA 1D1UA 3VA0A 3LP0B 5CYMA 1SKWA 4WZQA 4O55A 3AVJA 4TY8A 1S1VB 1S6QA 4CJ3A 4FK4A 3BGRB 3CFRA 4Z4IA 3KLFA 1WSGA 3BQ2A 1JIHA 3AO4A 3ZT0A 1C1BA 2HWIA 3FFIB 3CDWA 4LD0A 1SUQA 4Q0BA 3QEVA 1NNDA 3CJ5A 5C24B 3BQ0A 2C28A 4UQGA 5KRTA 4TSXA 4IH5A 1YT3A 3WNHA 2HVHA 3LAKA 4CEFA 5KG2A 2VG7B 4N47A 1RTHA 4RW4B 4BDYA 4NCAA 4CEOA 1S10A 3Q8PB 3PZPA 5DLGA 1SH3A 3ALYA 4C8OA 2B43A 5KT4A 3AVCA 2XY5A 5CYMB 2WK4A 1Y97A 1T03A 4FW1A 3JYTA 4DL7A 1OS5A 5HROA 4WYWA 2HB5A 4OKKA 3SQ0A 5JS2A 3ZT2A 4CHQA 3MFHA 3KJVA 4B8AB 2HHXA 2HWHA 4CJKA 5KFKA 2C2DA 4ZPDA 2E4LA 1XR7A 2E9RX 3KK2B 1T7PA 2R2UA 4BE0A 3AO1A 4CGDA 4DLEA 1EP4A 1NK4A 5EDWA 3MR5A 3HVWA 2B5JB 4RUAA 2WONB 3OYFA 1WNSA 4F2RA 4NLUA 4Q0BB 1RT6B 3MR3A 5J1EB 3N6NA 4NLYA 2DFEA 5KTQA 4Y2CA 2Q3SA 1HQUB 4ED0A 2W9BA 4AHVA 4NLTA 5F8LA 2RPIA 5EWFA 1U09A 3LPTA 3CQ8A 4IQXA 1QAJA 3HPGA 3DLHA 1N4LA 2CJQA 3NGYA 1FK9A 1HNIA 3QNOA 4NLSA 3AO2A 1WSIA 4MIBA 3TI0A 2D3ZA 3KLHA 4OKJA 3RB0A 2C2RA 4I2PB 3MEGB 3PX4A 2RF2B 4IG0A 1JLGA 2HMIA 3QEWA 5KFCA 3CVKA 1S6PB 1BCOA 2YKNB 3V81A 4B9LA 4J9RA 1RTIA 3OYJA 5KG5A 3AVIA 2XHBA 4K50A 1JXEA 1JLBA 4M41A 4EZ6A 5KFGA 1TKDA 4K4VA 1VSMA 4FLWA 5KFDA 3ZSRA 3CJ0A 4ED6A 4WFXA 4DTNA 1C6VA 4FJKA 3DLBA 4M3ZA 5KFEA 4CEDA 4CEQA 3I5AA 4E7HA 4CGIA 1ZYQA 3OYAA 3PV8A 4FJ9A 4W5QA 2ZE2B 1X9SA 1BI4B 3OYHA 4DG1B 5F8NA 2JEFA 2GIRA 4CCHA 1J54A 4F4YA 1S9EA 3PW2A 2AGPA 3KLGB 2AJQA 4HCBA 3ZCMA 3SI6A 4O3SA 4CJLA 4FJGA 4ZP7A 4F4ZA 1EETB 2BE2B 4KREA 4OVLA 3A2FA 4NLOA 3M9MB 2JLEA 3HPHA 2VWKA 1MMLA 4B9VA 5I42A 1S4FA 3DYAA 4YP3A 4YQWA 1S5JA 2IM2A 3K2PA 4ZPAA 4KHNA 3HP9A 2G8IA 4TQSA 3CYMA 1N5YA 3DDKA 4KHQA 5HBMA 1U47A 3NH2A 3BSOA 1IKWB 3M8QA 3I8DA 3DOLB 3SQ1A 3TAQA 1LWEB 4BDZA 3PO4A 4J2EA 3SYZA 4F4KA 1T05A 1CLQA 4Q44A 4JUZA 3D0PA 4O0IA 1ZTWA 4DSJA 3T5KA 3PW4A 4F2SA 1RT5A 3DMJB 3CM6A 1EP4B 3V9WA 4CF8A 5J2QB 4DL6A 3OVNA 4ID5A 4WXWA 2HHWA 2Y1IA 5SZTA 4FS2A 2R2TA 4CJPA 3DMJA 1T8EA 3SQ4A 1VSIA 2GV9A 3HHKA 2WOMA 3IAYA 5JUMA 4ZP6A 1IKWA 3M8QB 1VSKA 3JYTB 2D41A 2BQ3A 2JC0A 1XR5A 1FK9B 3DOKA 3AVFA 4XPCA 4CEAA 4ECUA 3KNAA 3VN5A 5FRNA 2XY7A 1NJWA 4CJ5A 2IM0A 3OYCA 3NF9A 4HUFA 5J2NA 4YR3A 2BRKA 4K8XA 2XCPA 2ZD1A 5HRNA 4R8UA 3P83D 1VSLA 1WLJA 1S0MA 1HMVA 1S1WB 3NBPB 3N6MA 4KE5A 4LQ3A 4RW6A 4E3SA 4CJWA 3EY1A 4EO8A 3ZT1A 3GQCA 4Q5VA 3FSIA 4J9NA 2R8IA 1RT7B 2R8JA 3MR6A 1RT5B 2YHAA 3Q8QB 2ALZA 4CIGA 3OHBA 4Q45A 4ZMMA 4IDKA 4DSIA 2YNIB 3QLHA 5D3GA 4CGJA 1JLFB 3HVRA 1IKXA 4KBIA 1WAFA 1F21A 4CHNA 1YTUA 3VQ7A 4U6PA 1N48A 4KO0B 3CDUA 4NLGA 3ASMA 5KG3A 1TAUA 3D28A 1NK7A 4QCLA 3OLAA 3THVA 3TAPA 3V6JA 3SFGA 5DG8A 1RT2B 4KHYA 4NZ0A 4MK8A 4IOBA 3OYDA 3LP1A 2P51A 3OHAA 3O4QA 3LALA 3GIKA 2FBVA 2GC8A 1W9HA 1RT3B 4ZTFA 3RR8A 2E9TA 4Q43A 1C1AA 4QWCA 4W5RA 4I2QA 2HHQA 2QV6A 5KT3A 3PO5A 3HK2A 1RILA 1HNVA 3VQDA 3OS0A 5KG6A 4CIFA 4RNOA 2YNFA 3DOKB 1KRPA 3OSPA 3RWUA 2XY6A 2UVVA 4NYNA 1TL3B 4Z4FA 3L3VA 2D7SA 3AA5X 2FVSA 2G8FA 3AVGA 1HQEA 4DSEA 5F9LA 1TL1B 4E7IA 3QESA 2R8HA 1UAXA 4DEZA 1RTJB 1LWCA 3OYLA 4Y2AA 5KT2A 1TL1A 3OYMA 5J2QA 5CYQB 4CHZA 3K5NA 1JLEA 2EHGA 2W7PA 3P5JA 4ELUA 4DFKA 4CJRA 2F8TA 1RBSA 4KB1A 3NE6A 2OPRA 5E41A 3H5SA 2J6SA 2KW4A 1TKZA 1BQNA 4FLTA 3MEDA 1WSHA 4Y1CA 1LW2B 2FVPA 1QTMA 4CEBA 1IKXB 4HUGA 1JKHA 3VQCA 4FCYA 1RDRA 1GOAA 4MFBB 4R5PA 1Z26A 3H4BA 1IM4A 3DRPB 5KFPA 2G8VA 4RW7A 4F4WA 3GYNA 4IG0B 5FRMA 2OPSA 3E01A 2PZSA 1J5OA 1EETA 4DQSA 4ZVHA 4CGHA 4F3OA 1JLQA 4K8ZA 3ULDA 5T7BA 3OL6A 3D5MA 4DTOA 2JGUA 2Y1JA 3KIOA 3QZ7A 3RR7A 1XR6A 1LAWA 4CGGA 4Y34A 2KZMA 4B9UA 3VQAA 5KG7A 4KTZA 4KO0A 1C2PA 2OPQA 2IGIA 1SKRA 3P1GA 3AA4A 3CWJA 4KFBB 1TK5A 3SFUA 3VA3A 4OLBA 3NAHA 4EEYA 3KD5E 4IH6A 3DM2A 1IO2A 4OPKA 1LV5A 4DU1A 2AGQA 1ZBHA 2W42A 5KFBA 2GBZA 3PR5B 3PJWA 5DK5A 2FBXA 2AWZA 4M3UA 3OSNA 4MKBA 2YHBA 4OL8A 3VQ4A 4M3RA 1NJXA 1ASUA 4XPEA 1RTIB 4Z4EA 4URQU 3DLRA 4AH9A 2ATLA 2AX1A 3CJ4A 3PW0A 4RUCA 4GVMA 1KHVA 3NL0A 1TKXA 5C42B 1CXUA 2R7YA 2HNDA 3MR2A 1IKVB 4PA1A 3I5CA 4CFDA 4TYBA 1S9GA 2YNFB 2W8LA 4NYFA 5FDLB 4DQQA 2FLNA 1ZTTA 2IAJA 4GW6A 4CJUA 3K5OA 5J1EA 4DFJA 4CERA 2HNYB 3VQQA 4AHSA 4Z4CA 3E01B 4ZVFA 4YR0A 4EBDA 3MECA 1S0NA 2V9WA 2Z1HA 3OYEA 1IG9A 1HYVA 4FZZA 4CJSA 2DPIA 1WSFA 1VK0A 4KTWA 4CHOA 3CDEA 5KFWA 2KTQA 4K4UA 4TYAA 3DLEA 4FM2A 3VQBA 5KFOA 3HO1A 1S1XA 2P5GA 3MXMA 5KFNA 4FBUA 3SNNA 3NKYA 3KMSA 4DLGA 1CSJA 2IJFA 5L1IA 2R2SA 3NH0A 1D8YA 3GV7B 4ID1A 3FRZA 4FZXC 4AHUA 2P5OA 4CE9A 4J2BA 1I6JA 5KFTA 3CJ2A 2IC3A 1JLAA 2FVRA 1FXXA 1HJRA 4O4GB 4Y1DA 2VG7A 4FLVA 3KLEB 4C8NA 4PQUB 5DMRA 1KHWA 3IGNA 5J2MB 3ISNC 4CECA 4DL4A 4ZP8A 2LSNA 2W9CB 1KVCA 4RW7B 4M3XA 3MEGA 4HCCA 2V0NA 3KLFB 3AVKA 4E1NA 3KLHB 3V9XA 3MF5A 2NUBA 2YV0X 2V4QA 3M8RA 1VSDA 5HP1A 3QNNA 3I0RA 3EPIA 2ATQA 4O5BA 4KHMA 1RNHA 4EBCA 4B3OA 3GV5B 1J53A 3L8BA 1NOZA 5I3UA 3C6TB 3RMDA 2RDJA 1IKYA 4E7JA 1C0TB 1TKZB 5C25A 3TVKA 4MK9A 4H4OA 3RB3A 3QLHB 4B08A 4YFUA 5J2PA 3CG7A 4DFMA 1RTJA 4KTQA 5KI6A 2XGPA 3DLKB 4H4MB 4MH8A 3VQ6A 4ED7A 5KFAA 4OKEA 4DTUA 3KLIB 1KLMB 1T05B 4IFVB 5KG0A 3C6TA 2IBKA 3CIZA 3OL8A 3EYZA 3NHGA 1KSPA 4DMNA 4QW9A 2IOCA 5KFVA 1RBUA 3BSNA 1X9MA 1YVFA 3I5BA 5F8HA 3F73A 4FW2A 1QQCA 5HP1B 3PX0A 2Z1JA 3PUFA 1S1UB 4RG8A 3C6UA 4DS4A 4NLWA 3TR8A 1KFSA 1NHUA 2HHVA 4DL2A 2QE5A 4JS4A 3DYAB 3K5MA 3LDSA 2XWYA 3AA3A 4ED2A 3TAFA 1S1TA 1RT6A 4IFVA 1J5OB 3KLGA 4Q8FA 1HMVB 3G6XA 1G15A 5DLFA 4ZVEA 1R0AB 1SL2A 4ZHRA 1J9AA 1KVBA 4ID5B 2Z1GA 3ICLA 1DTQB 1WAJA 5J2MA 1BIUA 3GILA 3KHRA 3RMCA 3LP2B 1RYRA 5CZ1A 3E51A 4XO0A 5DQGA 1L3TA 4ECZA 1SV5A 5DQIA 2XRIA 2OH2A 3KK3A 1C1CA 1LW2A 4OGEA 2W7OA 3UDLA 1BQNB 1FKOB 5KGXA 2WOMB 4B9MA 5EWEA 2RDIA 4U7CA 3QIPA 4L8RB 1XHXA 5K14A 1JLFA 3Q8SB 4JRPA 3SQ2A 4CHYA 4H4MA 4GMJB 4FBTA 4CGFA 4FXDA 4DU3A 2HAIA 4ZHRB 4ECTA 3RAXA 3QGHA 4W5OA 4I2PA 5KFFA 4NLXA 4Y3CA 3K5LA
chains in the Genus database with same CATH superfamily
1YIJN 5AQXA 1L3SA 4WE1B 3Q86A 4LFAF 1RT4B 1WACA 4KSEB 2HGLA 1N88A 4FNIA 1S9FA 1YBTA 2O8EA 1WELA 2ZGZA 2XC9A 4KPYA 2P9IB 5CABA 1DLOB 3SPZA 1HD1A 4X4QA 4TU9A 3GJQB 4YHHK 3TX8A 3K59A 5KQDA 4U67L 3SUNA 1FKPB 5DZ6A 2QKBA 3GOIA 2RQCA 3AVAA 3DLGB 4V19X 4BC9A 3U4LA 1N32F 3VTHA 2Y3YA 1WSJA 3ZSXA 3HP6A 4FF2A 3MOJB 4JYAK 1HKCA 2OKQA 3KLVA 3MWTA 2HW3A 2OYQA 2VQEJ 1JJ2M 4UY8O 2OZSA 1KEKA 3ITHA 3QBXA 2JEGA 5AXMA 4LIRA 2C3UA 2AKWB 3BQ1A 2PFFB 2J6TA 4DDFA 3ZXWA 1ASVA 4DFPA 4BG9A 2P9PA 3SPYA 2W2NP 3I6PA 2HURA 5JMNA 5F8IA 1ZBSA 3T6BA 2LEPA 5E3QA 1T0TV 4RW9A 5F8MA 1UVLA 3QIOA 1QZ6A 5LMNF 3O6WA 4KHWA 1WWHA 4FLUA 2LQJA 2HK2A 3DWLA 3ZSVA 4DWIA 3L7UA 4LRCA 3ENAA 2HHPA 1U4BA 1QY7A 3C0BA 2IM1A 1ZBIA 3EMTA 3KJVB 3FZFA 5ETSA 4E7LA 3C7NB 1M1KT 2Q0UA 1VQKS 4RBVA 2VB6A 5BN8A 2BKNA 2DB1A 4Y28C 3ZX3A 3DXKA 1ZPVA 2C22A 3ZZOA 2Z8QA 4OZ5A 1UTAA 4WQ4C 3HYFA 1EAYC 1BIZA 2V4JA 3A3NB 2DEJA 4J9PA 3FR0A 4B3RK 4RNNA 1NWKA 2D0OA 1F60B 3MCMA 2PMHA 1Q7YT 2CG8A 4B1XB 4KGMA 2W9AA 2D0PA 2LP4A 1CJVA 3V9SA 1L5UA 4A2BA 1RCOB 1VC5A 4DR4F 3OR2B 4CFBA 1IKVA 3H2UB 1WSEA 4CESA 5JLFA 2XYGB 3L9ZA 3K57A 2ZITA 4DL5A 5FDLA 3S7RA 4G1QB 2ASYA 2JRSA 2FZKB 1YBUA 3CEDA 4Y00A 3A5OC 1N33F 2KRBA 2W9BB 1QQOA 4ZVRB 4DQRA 5A8RB 5AFUH 5KFUA 4LF5J 4WU3A 1RT3A 2NRXA 3ISND 2JWLA 4LSLA 2GHPA 4G1IA 1YTYA 1UETA 2RQ4A 2FXUA 4YOEA 5TKYA 1CQMA 1K73O 4A5AA 4OZNA 2D3O1 2YNHB 4EGLA 3UKUB 1LQ9A 3LP1B 1SJQA 3VGVA 2WB4A 3LQVA 3BJYA 4FWRA 3DOLA 5CYJA 3LPYA 3HI0A 5GADP 2V8HA 1XMQK 1C4AA 3FEXB 3E3XA 1TFWA 2YX4A 2BUPA 1OSDA 3TX0A 3M8PB 2FGCA 1P90A 3W2WB 1YQHA 5KRSA 4CLZA 3DKDA 1RA6A 1K1QA 1WKKA 4DU4A 4DHYA 2YKQA 1HYSB 2DH8A 4MKAA 3PHEA 2PA8D 1VSFA 3L2VA 3C14B 4OZ2A 1U1QA 3GTYX 2QEXN 1N5QA 3T1HF 3CQXA 3S01A 3TSQA 3BGRA 1N32K 4PG8A 3QRRA 2OUGA 1Q8IA 4B17A 1U7LA 2BJ9A 3RU0A 1QSSA 3CJTA 3NF6A 3NEKA 4LRBA 3TRGA 3OYIA 3Q23A 5AQQA 2O8CB 3CCQS 1NH7A 3ITHB 3GV8B 1VS3A 3MXIA 1TELA 1VQYA 3R8EA 2R7OA 3H6EA 1S1XB 2DFHA 4CLYA 3DLLQ 2KT3A 1IH7A 1LAVA 5AQOA 1ESVA 2VG6B 2N4DA 4P6QA 1CXQA 3H1VX 1OY8A 1NMDA 4J9QA 2B9WA 4KH1B 2KI2A 3IP0A 3EGZA 3MMBB 2L9NA 2DPJA 1D4XA 2Q1LA 3FCWA 2ROGA 1DLOA 1K1SA 1XQSC 2HBRB 1IBLF 2MQLA 2KKHA 1NSKL 1Y5NB 1S1UA 2SXLA 3S9HA 3HFKA 2P5VA 2NS1B 5CY4A 4WFAL 3UKRB 3M7VA 1XERA 3M4XA 4JEPA 4Y6IA 2EFNA 3MM9B 2ASDA 3G9CA 3K89A 2J6UA 1VGYA 3M6GA 1W0HA 1DTTB 3H0PA 1L3UA 4I6YA 2K1RA 4TXSA 3JTNA 7FD1A 2C3PA 5ITHA 2G8WA 3H1QA 2DGWA 1M90O 4KB7A 3MUVP 2I7NA 3EZ5A 3AV9A 2XBPA 4D3GA 2PI4A 2OMOA 1U2VB 1QD1A 3RB4A 2CAJA 3AA2A 3CC4S 3GJTB 3POTA 4JOUA 2VC0A 4B9TA 4PG5A 3ZLJA 1UJ4A 3UDCA 1EKEA 2ILZA 1IQTA 4UUXA 4KHSA 3HKWA 1TV6A 3MM8A 5KT6A 4L75A 2AJ0A 1JX4A 4EYHB 1G2EA 1ZETA 2KG1A 5EX5A 1R8PA 1YJWN 4HKQA 2UUWA 2B51A 1C0TA 1A5XA 1QHTA 3A8IA 9ATCB 4DR4J 3H25A 4C97A 1B9DA 3DJCA 2RRAA 4USJC 4ZN1A 4IOCQ 2GJIA 1HWJA 2IMWP 3F5TA 5EWGA 3QSYB 2IA6A 4QW8A 4OYZA 4H0YB 1U0SA 2YI1A 3MX5A 4WP3A 2QK9A 1QVGR 4A57A 3BGOP 4E0DA 3ENQA 2B6AA 3ENOA 3ZTPA 3S6EA 2F7VA 5GVQA 3SCIE 2GX8A 4F4XA 4JI5J 2ASJA 4MYTA 3G4SS 3AFGA 5BXIA 4CO0A 5KFJA 4CI0B 1EXQA 4L76A 4TN2A 4OHWA 2X74A 3M1FA 3QYYA 3VQ5A 2HNYA 3K9KA 2YH0A 4TLRA 4DU8A 4QWDA 2ZH3A 2OLWA 3SDEA 4NLDA 3HSCA 5IS2A 5F0XA 1RU2A 4AILC 3QMLA 3OR1B 4R0JA 3WXKA 1VQMN 1SL1A 3HT0A 5KFRA 4I0WA 3R5BA 5HMWA 2OD4A 1KLNA 3RMAA 2LDYA 4HYKA 1C1BB 3UO0A 3SI8A 2VG5A 4U9RA 2WONA 4OO1J 2A1RA 2ZHOA 1NCLA 4M5MA 1RDDA 4IDHA 3KD1E 3R6MA 4GO7X 1JLAB 1HLWA 1V5IB 3L09A 2FHMA 3J7YP 1VRTB 4C1NK 2OP5A 2QLJB 2M88A 4RBUA 4KKOB 1TZ0A 1DJ0A 2E1RA 2Z58B 2BYCA 3FCHA 4WTOB 4Z0UA 2FJBB 2J9DA 1P9YA 4M42A 3NNCA 1KLMA 2YWWA 3QZ8A 3M8SA 4CJFA 1JQGA 3K0SA 1LFWA 2VFRA 3HHLC 2GX9A 3QIDA 4PUOB 3GE1A 2DK2A 2AMCB 5FPDA 2NRVA 1MWQA 4DV4J 4NXNF 1OH5A 5D0RA 2X6SA 3TUIC 3U9ZA 3L3UA 2P6TA 4JYAF 2M2BA 3H90A 3UD5A 2P9SA 1TR0A 1Q16B 2CVEA 3HVTB 2G8HA 4BGAA 3M6XA 1FVQA 3P8BB 4ZLJA 3IG1A 3K8VA 1RLCL 2OPPB 3ENBA 1JNZB 2W6LA 4KH6A 4RNHA 1WG1A 4BE2A 5HOOA 1X5PA 4FNHA 3S3MA 1EARA 2UVWA 1HFEL 4GKJK 1ZM9A 2VG6A 1W2IA 1RP5A 1DT9A 2DNZA 1PJ5A 4TKTA 4QQBA 4A2AA 1KQSM 3GSIA 4JD2B 4DTXA 3NF7A 1WF0A 3PVXA 1R0BG 2X3GA 4MKVA 3ONQA 3CC7N 1XEZA 5F8GA 3JXUA 4JV0A 1LEOA 4NYZA 2AGOA 2AYGA 3VEZA 2HYIB 4X64F 4NZ7A 4WF9L 3OYKA 3DRRB 4O44A 1LWCB 1M1HA 4UW2A 1HYZA 5GAGU 2O8BA 5L38A 3MM6B 1B92A 3JSMB 4EYIB 2G8UA 2EK6A 2QL7B 2ZH7A 1IVZA 4AD6A 4CEZA 5DG7A 3IS9B 2Z2MA 4MMOA 2ZHBA 4PWDB 1QTNB 1S0VA 4FJIA 5M1FA 3MD1A 2NUHA 2JC1A 4FKYA 4ZIWA 1K73T 2MKIA 3CCJN 1AA1B 1OJ4A 2CPXA 4OX6A 1ACMB 2ROPA 5KFMA 1D9DA 1XWLA 3KWMA 2C42A 4ZCLA 3SEOA 3DOMB 5IM0A 4K2XA 2NSBA 1JLBB 6FD1A 1BHNA 3HOTA 4HT7A 3NGUA 3NAEA 3GJSB 4RU9A 1BCMA 4OJRA 1M1GA 2ZHAA 2K1RB 2O4IA 1U45A 4CZMA 4LIWA 1NKEA 3M6VA 3CCSN 5HLFB 4C8KA 2I5JA 4B1UB 3UIQA 1LWEA 1N5YB 2P9EA 1T02A 3CJSA 3ZX2A 3I9ZA 5EU7A 1KC8T 3KG1A 1IWAA 4JI8K 4OLAA 4YR2A 2R4FA 4BRGA 3T1YJ 5CR4A 3ZYYX 2VDIA 2OFHX 4WXOA 1X5TA 2I1RA 2QMUB 3SBTA 2UUCF 2R9LA 3DXMA 4DR5K 4R0EA 1RT4A 1XNQJ 2X1AA 3KDNA 5HN0A 4LFCJ 1URRA 3LPUA 2RUGA 1MWKA 3NVMA 4B1VA 3CJ1A 4FWOA 1CZBA 3SAGA 3L3CA 4LF8K 5F9NA 1Z4UA 2VA2A 2RB7A 4N8NA 4OI0A 3T1AA 1RTDB 4HACB 3FQKA 3ETMA 5C5JA 4BLGA 4KFBA 4BC5A 3OXLA 4JKEA 1S72S 2Q79A 2CRLA 4CLFA 4JNEA 2WBRA 4B3SF 4RZRA 4ITSA 5HVGA 3NG8A 3O3FA 1CC8A 5AJ3F 2VOOA 3N01A 4MYUA 1PC4A 2F4VJ 1ITGA 4QIVA 1FHTA 2DGSA 4ZN3A 2VASA 4ZK7M 4ER8A 2AQ4A 4OX8A 3PKMA 2PO4A 4DSLA 4KAIA 2VODA 3V1QA 4M3WA 2XI3A 4OV1A 4C48A 4YB6A 2GUIA 2XZTB 3T5JA 1F9FA 2G1HA 3RG6A 3MXJA 3VF0B 3SV3A 2YJFA 2CWKA 4IRCA 1HA1A 4HEA9 3L4QA 3DRYA 4B9NA 2WW8A 3OXGA 2IDEA 1HARA 2FZCB 3F9KA 3A1YG 5CYQA 3W8GA 3ZX0A 2CQ2A 4JRQA 1SIWB 3MTJA 3MCNA 4E1JA 1MU2A 2ZH2A 2GQQA 3ZFVA 1KXPA 3HHLD 4B02A 5CH7B 1R59O 1R43A 3OLBA 4DR7J 1NNEA 4ZPWR 2DNMA 1NMNA 3DXKB 2DY4A 3H4DA 1YTAA 2V67A 3HXMA 1VRTA 2DR9A 2F8SA 2NPFA 4IR9A 4C1NI 5CYMA 2W40A 2QWMA 2H9ZA 4O55A 2VH7A 1QM9A 4QOTA 4BR0A 3D6FB 3BGRB 3ZZUA 5JVGL 2V2ZA 8AT1B 3AO4A 5CD4H 2HWIA 3CMEN 1F9EB 3VF4A 1YRTA 3P49B 3QEVA 2FF6A 1HWLA 1R8HA 3F41A 3W61A 5KRTA 3LDPA 3D2WA 2GZOA 3LAKA 2Z2LA 4MT1A 4CEFA 2VG7B 2FHJD 4FO0A 4CEOA 3Q8PB 5DLGA 3W2WA 5E3RA 2ZH8A 2KH9A 1DARA 3BYRA 2F9TA 4UOFA 2HBLA 5HROA 2WZ1A 3VVTA 4LR8A 3KJVA 4OLPA 4CJKA 4OYXA 2E4LA 3G8QA 2O66A 2IYIA 4BE0A 4B3MJ 3Q89A 4CWBA 3JAMU 3HVWA 1V3SA 1WNSA 1KVIA 3IA0A 2ZBPA 5J1EB 2ZM6K 4Y2CA 3G82B 5AE2A 1HQUB 4ED0A 4AHVA 3QDKA 2O8FB 1X0PA 4LF7F 1LXNA 1PJ6A 4IQXA 5IT0A 3UCZP 1HNIA 1UVNA 3KK7A 3L7OA 2A1BA 3KLHA 4OKJA 3RB0A 1H38A 3UW1A 2Q97A 1SC6A 4I2PB 3VAGA 2E5GA 1S6PB 1VBYA 4J9RA 2Q1NA 5KG5A 3CJ9A 3AVIA 1VBKA 1VC0A 4DV5K 3THXA 5A76A 3ILIA 1VSMA 3PRBA 4JB8B 4DV2F 1FEHA 3FLCO 3ZSRA 3CJ0A 2IVFB 4ED6A 4DTNA 4LFBF 2NREA 2OEJA 1WEXA 1NGBA 4CGIA 1ZYQA 1RI7A 4IOXA 2ZE2B 3DU6A 2P9CA 2V7ZA 3OYHA 4LF5K 3CCJS 3A0IX 1S9EA 5BYQA 1BY9A 2CPEA 1W7AA 4B3TK 3QT5A 3IWLA 4WK3A 2AJQA 3BO4A 3ZCMA 3SI6A 4CJLA 1YI2N 2BABA 1GLLO 1EETB 4KREA 4OVLA 1KOOA 3MMCA 4BBYA 3A2FA 2HG4A 1IN0A 3A3PB 3M9MB 1ZZFA 4KBOA 4LRDA 1WEYA 5I42A 5FJ4A 3DYAA 1FEEA 4OZ1A 1P1TA 2DH7A 5AQNA 4CW7B 3R9LA 5AE1A 4KHNA 4TQSA 3CHWA 1N5YA 4GV6A 3A8EA 5HBMA 4BG8A 1PILA 2OANA 3AGKA 1K47A 3NH2A 3TTDA 2NUUG 2YX7A 5BYSA 3B8AX 1IXKA 4OYMA 1TTHB 5JLHA 3PO4A 1CLQA 5BYRA 1EWQA 3D0PA 4O0IA 1R8CA 2F8MA 3PW4A 2UUBF 2E2NA 1Y0HA 3M2VA 3DMJB 1EP4B 4OHXA 2ZBIA 3K8WA 3GJRB 4WXWA 4LFAK 4NX9A 2HHWA 2U1AA 3M8ZA 2Y1IA 1M5HA 2Y1RI 1T8EA 1VSIA 2C2MB 1F5AA 4X62F 4FXWA 1QAYA 4DR3J 2WOMA 1IBLJ 4ZP6A 5K8NA 4X62J 2JC0A 2BQ3A 1XR5A 2PFUA 1FK9B 3DOKA 3FSXA 4OI3A 3EVMA 1VQ9N 3IDHA 1RAEB 1GXLA 1FJGK 3VN5A 1NU4A 2XY7A 3Q2TC 5KOXA 2BXJA 3MCAB 4CJ5A 3IMQJ 4NYOA 4CYUB 2CJKA 2Z0GA 4HUFA 2ZD1A 4FZVA 3P83D 1VSLA 1WLJA 1HMVA 2GTDA 5AQFA 4L3NA 1X4HA 4QS8A 3CC2N 2BBEA 4RW6A 1V6HA 4X84A 5LT5A 3CSKA 4V19S 3FSIA 1RT7B 2WAQD 2ITMA 3MR6A 2YHAA 4WWSA 3ATUA 3BF4A 3OHBA 4Q45A 4ZMMA 4IDKA 2MHEA 3QLHA 1UCNA 2GEMA 4KBIA 1KQFB 1F21A 4WP9A 3A5LC 4XEIA 4BRQA 2MQMA 3VQ7A 2GCFA 1N48A 4JI0J 3CDUA 4NLGA 3R6LB 1TAUA 4BRPA 5H9FJ 2A0FB 4JKGA 3TAPA 4OYBA 1XC3A 1B99A 1RT2B 1FT8A 3R7SB 4CBWA 2LDIA 3HSJA 5U47A 3BY5A 5LSRA 2GC8A 1W9HA 1Y5LB 1C1AA 4I2QA 2HHQA 1KOHA 1N5SA 1LKZA 1CJUB 5GADU 2CJAA 4AXJA 3AH6A 4C98A 4PG6A 3VQDA 3OS0A 5KG6A 4CIFA 3X3UA 5LSOA 3HLUA 4F02A 2CXEA 2L08A 3WQTA 2V69A 2QWPA 2UVVA 3AA9A 3BF1A 4Z4FA 1MROA 3A5NC 1Q82T 1MG7A 2D7SA 2C3YA 2EG2A 2XSJA 5LM7E 1NDKA 2DXEA 4U7UD 2R8HA 3IMXA 3OYLA 4FWKA 5H1SQ 3SJHA 3HM8A 3W9HA 1ATRA 3N4PA 2FSJA 4DR2K 1MMNA 2CGLA 3NE6A 5E41A 2J6SA 1RWXB 2E20A 2KW4A 5HSPA 1LW2B 1OWXA 1RUSA 2FVPA 4CEBA 2CADA 1IKXB 4HUGA 3LW5C 1JKHA 3VQCA 2LXFA 3VGSA 3BS9A 4DPYA 1OH7A 4R5PA 3BBBA 3RAMA 2GQ2A 1KQKA 4H5WA 3NS7B 1IM4A 4GMKA 2KXNB 3DRPB 1Q5YA 4TU8A 5AJ3K 1EKSA 5KFPA 2QC3A 2C2OB 3GYNA 4ZA1A 4B3SK 2P2CB 4M7YA 3AQOA 2QMXA 3R1XA 3SMSA 3ULDA 2Y1JA 3RR7A 1XR6A 4BRAA 2KZMA 1X5SA 3WQUA 3SQGA 5HMZA 5CCLA 2CG4A 2ZBRA 2OSQA 4MJKA 1C2PA 4G6VB 2KL8A 1C0GA 2CH6A 1PIEA 3FJ2A 2Z4PA 1A0OB 1AZSA 3MURP 4RPFA 3AOCA 4OYWA 1NLKL 2XNRA 3SBGA 1E4GT 2J8AA 4JI4F 5GMDA 5F3TA 2GBZA 5DK5A 2FBXA 2AWZA 3MK6A 4G65A 2YHBA 4OL8A 1CJKA 3ETOA 2HOEA 4P72A 4LMZA 1RTIB 2EG1A 1X4FA 4Q2MA 1J5EK 1X4DA 2M3DA 2ZZNA 1TUWA 2BKOA 2AX1A 3CJ4A 1MW7A 5H9FK 1I94K 3NL0A 3E9PA 1OYEA 1WC1A 2R7YA 2HNDA 5HL7Q 4FYYB 4DR1J 1IKVB 2FF3B 4TYBA 1RDUA 1X0FA 2W8LA 2VU5A 5FDLB 1I3OB 5A8KA 1ZTTA 1H3DA 1U6FA 4GW6A 4CJUA 4DFJA 3CC7S 3VQQA 1XNQF 1IWGA 4CIOA 4Z4CA 2NZTA 3H7HB 1S0NA 5AJ3J 1HWUA 4HDGA 5F41A 4CJSA 1VQNN 4CQ1A 4AFFA 5KFWA 5BREA 4PXCA 4USVA 3KJFB 4JKGB 3O6QA 2XLKA 4CBXA 5KFNA 3SQOP 1BD6A 1U6ZA 3KG0A 3NKYA 3NH0A 4JK9A 2HFZA 3ZZRA 4P2MA 4Y2KA 2ZWHA 4C3LA 3B54A 1R6YA 1WJ9A 2IC3A 2FVRA 4O4GB 4QJVA 3CMAN 1BDGA 1KD1O 4LVOP 3IGNA 5J2MB 1GMWD 4FPIA 2LSNA 1ZAXA 3MD3A 3MN5A 1FO1A 2ZZTA 2CPZA 3KLFB 1WKLA 2VFSA 4CZKA 2V4QA 3MUTP 1DGKN 3VERA 2DGXA 1X7VA 3TZZA 4ZVOB 1K8AT 3ZETA 5GAEP 3N5FA 3GFXA 4EBCA 2RDJA 2HQCA 2KHOA 2ZGYA 3TVKA 1U8WA 1DZ5A 2ROEA 3IR5B 4HTJA 3SSSA 2QYGA 4MO5A 2XGPA 1RBOB 1RCXB 4BR5A 1JCFA 4BR7A 1RAAB 3EUNA 2NXCA 4BHQA 1SBRA 2MZRA 1BOTO 3QWUA 1FJGF 4IFVB 4PZVA 5KG0A 3C6TA 2YH1A 2RQKA 2JL9A 4QW9A 1TYQA 2IOCA 4JK8A 3BSNA 3I5BA 4ZJLA 2QWLA 3D6RA 1SAZA 4FW2A 1S1UB 3G8TA 4P71A 3C6UA 4UT4A 4DS4A 2BH1A 1NHUA 2HHVA 2ZH6A 4PQAA 2W4PA 4RWWA 1I94J 4ED2A 2CDRB 3KWGA 4YOXA 4JI3K 1JXVA 4LF5F 3KLGA 4Q2LA 4DOZA 2NXEA 5IXUA 4WKRA 2DY1A 4PPDA 1NPPA 1X3NA 5DLFA 1RBAA 4ZVEA 3T9NA 4ID5B 3CCZA 2A41A 1V3RA 1TMMA 1WC3A 3UB5A 3KWIA 2B9YA 3RMCA 3LP2B 5CZ1A 4JI2K 4ECZA 1SV5A 5DQIA 3KK3A 1LW2A 4ILHA 2W7OA 3M2UB 3W9IA 1U2VA 5DETA 3T1YK 2CPJA 1VHIA 2DNHA 1FD2A 3VMFB 2RU3A 1T9WA 2XMKA 1RWUA 2FDNA 4U7CA 3WXIA 1JLFA 1EWRA 4JI7F 2AJ2A 3HHLB 4CHYA 4GMJB 2D69A 1YJTA 4ECTA 4W5OA 5KFFA 4G9ZA 4Y3CA 3KTQA 2K7JA 2G2YA 3BH7B 3O5BA 2I9SA 2UXDK 1P8ZA 4ZKAA 5J2NB 3QGGA 3PFOA 1LCUA 5ELZA 4LC9B 5CZVA 1TUUA 4ERDA 4BRNA 1KWMA 2QZ8A 2O8EB 3DN9A 4DV6K 3HL8A 3NLCA 2MPUA 3KKSA 2IM3A 4B3SJ 4JKCA 3MXHP 4U8YA 3A8YA 4FYDA 2AF6A 5G4DA 1VSHA 2R2RA 5DGBA 1GOBA 4M3YA 3DLKA 1CLFA 1UWBB 1UL3A 4FLXA 1YSJA 1H2VZ 3SMZA 2DGOA 3DDIA 2NRHA 3I82A 2OZMA 2IC3B 1A9NB 4HUEA 2J0XA 1W7WA 1I39A 2DNYA 2CPIA 3B78A 3MN6A 2HZCA 4LREA 3QFUA 4OJ1A 4KKOA 3R7BB 3UPFA 3TEGA 4JI2F 2HQGA 4MQ3A 2XNQA 3MOZA 4QYRA 4LJMA 2GAHC 4R79A 2IBOA 2WC9A 3NCIA 2ZF5O 2HBYB 3GLJA 3O9UA 2EXUA 4P74A 5AQTA 3GWCA 1MN7A 2E6LA 1T9XA 2XLJA 1NRKA 1BL3A 2W9CA 3IWNC 4CM2A 4RW9B 3RGIA 4J9OA 5AXNA 1Q82O 4I9QA 1KTVA 2UVRA 4DR3F 4DTMA 4AYBD 3TR5A 4IRKA 1KCFA 2QT7A 5KFIA 1HNIB 2ZBCA 3R5AA 3VQTA 2QX0A 3GIJA 3IG1B 2B4UA 4AE5A 1WHXA 1HNXF 5GMEA 1UA0A 5E26A 1ITPA 1RAOA 3G82A 5LJ3Y 1ZBTA 4A48A 1VISA 3TEHB 3CCUS 4QU7A 1REGX 4CVNE 2FLOA 1SV5B 4K43A 3AQPA 2QLXA 2J0WA 3MDQA 4KGVB 4ED1A 3VGUA 1JCEA 1DRZA 3TP2A 1I94F 3HI9A 1QUPA 3EE9A 3I56N 1O1WA 2PSZA 3T19A 3TO8A 4M5HA 4FVMA 3E1YA 3R3TA 1KTQA 5JICA 1J5EJ 2P9IA 4RX6A 3RW6A 3I55S 2KFNA 2H65B 4NPOA 2MKCA 3BKFA 3UD4P 2M5YA 4YY3K 3D54A 4MIAA 2MHNA 2GO8A 3UE5A 3GFZA 3L2QA 1F6TA 4A4JA 2NLXA 4LSNB 2RQMA 4X2BA 1UFWA 1WORA 1RWWB 2APOA 4DPUA 4A5BA 3CCSS 2FJVA 5SWMA 1FRHA 1N34J 3HDSA 3NVKA 2EKYA 2FIUA 2Q6CA 1NSQA 3LANA 1XMOJ 3CJ3A 4NRUA 3Q8UA 2CH5A 4DR6F 1GT8A 2RSQA 4RNMA 4B9QA 1N33J 2GV1A 5FPMA 1VQOS 2XS5A 4I1TA 2HBKA 3I32A 5FLXO 3QETA 1FXLA 1REVB 5ETPA 4LF6F 1XMQF 4OV6A 1SXLA 5HQ8A 3RW7A 3DLGA 5C0YA 2ACYA 2O5DA 4R8UB 1ZBLA 4RW8A 4CFAA 1VQ7S 4DF8A 4LF6K 3MECB 1OPZA 1HYSA 5EUHA 3M9NB 2W4DA 3WIVA 4F04B 5D4OA 2WHOA 1PYSB 4IO1A 4NLRA 3GPAA 4DL0C 3HSTB 3S3OA 1ILYA 4CO2A 1R89A 5DDOC 4B8CA 4O5FA 4I7FA 3ET6A 3W0LA 2E6MA 1AROP 2Y8WA 2BQRA 4YOUA 2QLWA 4JI3J 1Z25A 3Q2SC 3QO9A 2XYPB 2BRLA 4BACA 1NOYA 4IZ9A 4A8OA 5FD1A 2OMLA 4LQ9A 2P1JA 2IVNA 4UY8T 3OW2R 3IFRA 4DUYJ 1RT7A 2NSCA 4KRWA 1M5OC 4I6AA 2VFVA 1TL5A 1Q81T 5BPMA 1R0AA 3RRGA 3NGIA 1SI9A 3CCLN 4OZ3A 3O9QA 4IEIA 4KV8A 2YQ3A 4ZP9A 3CJKA 3UNGC 4M63C 3KNGA 1HBUA 1CQNA 3LWMA 2O01C 2X51A 2H5IB 4EZ9A 1HI8A 4CF0A 4AHTA 1BA1A 3L2RA 1EKRA 3CD6S 2VIHA 1IG8A 3AAQA 3UCGA 2A10A 5L9XA 5L1KA 1VRQC 2MGZB 1FXRA 2YPZA 1MLAA 4BE1A 2GVDA 1TKTB 2BE2A 2VZ9A 2X6NA 2VBWA 3FDSA 3MGJA 3QRQA 2B5JA 2UXDJ 4IBNA 4H0PA 2FD2A 2GGPA 3CCMN 1HBMA 1JJ2R 2D0BA 3PFEA 2JSXA 4CZCA 5K14B 3R7NB 3W60A 3VAJA 3VQ8A 1AFIA 1IUJA 3KHHA 4DPOA 3ZZ0A 3DOMA 5IM0B 3PR4A 4DR1F 1HPZA 2GS8A 3BKTA 1JL1A 3LDLA 4G3IA 2BV3A 4GV3A 2LMIA 2MQNA 3W65A 5IT4A 4B3OB 3VEOA 1OY9A 3OYBA 2PYJA 3U27A 3PIOL 2G13A 3PM9A 2CNKB 4K4ZA 2QN6B 4UY85 3OTEA 1RWKB 2UUAK 5B0CA 1LW0A 2F5GA 4O0NA 4RNFA 1UVMA 2RJZA 2CQGA 4K2JA 1HHSA 1S1TB 1YJVA 1SKSA 1UVJA 4B3RJ 1NGJA 2FLLA 4FJ7A 3LAMA 1VQ4N 3OS2A 4ZPBA 2CNLB 3U3YA 1HIYA 4C4WA 4S0MA 3DC2A 5AQJA 2CQHA 1MNEA 2KYZA 1W25A 4NLBA 1UW9A 2DD8S 2EFOA 3A13A 4KT0C 4CJQA 4PKIA 3C16B 2IFXA 3P6YC 3TOQA 3R5JB 1YHQS 3AO5A 4I69A 2Z56B 3BH6B 2PMZD 3O08A 2QTWA 2XI2A 4FPRA 1M5KC 5JJBA 3WZ0A 4E19A 1HR0K 1P1LA 3BN7A 3U9DA 3O2IA 4EBEA 4LT6A 5ETLA 4Z4GA 2D0CA 5LJWA 3KK2A 3FBBA 5L1JA 1QE1A 2FVCA 3MPVA 1RAJA 1MU2B 3PJXA 3QEXA 4PXBA 2XS2A 4QBUA 2EBEA 2KQ2A 1WOPA 2BJ8A 1VQ5S 3ID6A 4IRDA 3D45A 1A5VA 3RRHA 1AZSB 2FLPA 5HROB 4BY9C 1TL3A 1XNRK 2BJ1A 2RHQB 4JV1A 2DEIA 4K4YA 2O8CA 2UXBK 3I0RB 3FK4A 3CFPA 1HNVB 1VCTA 2V34A 1BXNA 1ZBUA 3VEXA 1F5BA 2VOPA 1XC9A 3CCES 2IDOA 3M2RB 3R9PA 2HHSA 4DN9A 3HVAA 1D09B 4JI7K 1Q8LA 1LK7A 2MDAA 1VQLS 5AQLA 2KHDA 3IR6B 2XMUA 3TABA 4DV4K 2F8HA 4F67A 4JAXA 1VK8A 2E1PA 2PA3A 4CHPA 2DGTA 1CVJA 4OHYA 2ZKTA 2HF4A 3F9MA 4Z7YA 3IR7B 4JV5K 3C3LA 4RL1A 3P38A 2RMLA 4E7KA 4P2XA 4O3PA 3BGLA 2EX3A 4YOTA 3CJKB 4DV6F 2ZJQL 2YNIA 1WHYA 4I6MA 1JLEB 1HR0J 3E8OA 1ULRA 4NEYA 1TFYA 3EZUA 3THXB 3OS1A 5B0GA 1Y4ZB 1DTTA 1GXTA 5DM6L 1HBOA 2ITGA 1SC1B 3B8HA 1NGDA 2V68A 2V52B 1RA7A 5KFZA 4KHUA 1NJYA 3G10A 2ABYA 1J6ZA 3WXMB 4WTYA 5K20B 4X4TA 3L2UA 5F0WA 3PNIA 4CEEA 3MR7A 2BEFA 4BC7A 3ZT3A 4QS9A 4WE1A 4QPXA 3ATVA 5M2PA 2AZ3A 2OPRB 1RT1B 4QIEA 1HQUA 1A7GE 2GIFA 2I6WA 2GIQA 1S22A 4O3QA 1QS4A 2CQCA 1OQ6A 1DFDA 1JMTA 4ETXA 4CZGA 1N36J 3FFIA 1N56A 3PYEA 4KYZA 5A6PA 1BO5O 2VHGA 2Z1IA 4Z4HA 4FJJA 1KAXA 3D2FB 3FVYA 2AHOB 1NGFA 2V51B 2KN4A 2D1KA 4FDFA 5KFQA 4IG3A 1Y11A 2JEJA 1UMJA 4A8FA 2BUNA 3OD2A 3L6QA 3CFOA 4DV0J 3T5HA 3CUNA 1B7YB 1W2BM 1YIJS 4U67Q 1C0UB 5GAHU 4DSKA 1QJHA 2OD6A 4WK1A 1CG2A 2FSKA 3C7NA 4CIEA 4O3RA 1B3TA 1PYOB 2FY1A 3N6LA 5HRRA 2KG0A 2VG5B 1H73A 2NCKL 4AXIA 3U8XA 4J9KA 1SUQB 1FJ7A 5E7OB 1KQSR 5GADI 3WIUA 3IRXA 2QXLA 1FFSB 1BI4A 4KAZA 4PR6A 3R5DA 3EEQA 4IFYA 4E98A 5HQLA 5I9EB 4CLWA 1YX2A 3S8SA 2BANB 4FZYA 4DV3K 2GVZA 2WVEA 5GAEU 2DRBA 3Q8RB 2P9NB 2OIHA 5FROA 3TAEA 3BB5A 4FWSA 1CJVB 4L3QA 1P6TA 5ETMA 5IZHA 4PUOA 4PKHA 3QEPA 2CGJA 1HHQA 4V1Ak 4USIA 1VAZA 4EK2A 3I0SA 1GMVA 2CGKA 3BBFA 4DUYK 9RUBA 4JI6F 2V4JB 3QFPA 3P3DA 5KT7A 1OIAA 5A8WA 1YBAA 3T41A 3PSFA 3BDEA 3HJFA 2E2QA 4DKWA 4QU6A 2AX0A 1W97L 2W1BA 2FBYA 3IO1A 3SUOA 1U1LA 4OYOA 4ILMA 5DG9A 2EC2A 4EO6A 2XCAA 4WJBA 2F8EX 1R8BA 1J2VA 2DJWA 4GVBA 2GMJA 3MMAB 4IEEA 2YNGA 3I4PA 4NL5A 5IWAK 4J9LA 1BUXA 3U1MA 3DRRA 5F8JA 5KFSA 1NXIA 2UUCK 1UOCA 4FXVA 5B0AA 4MFBA 2DPNA 3KKFA 4BREA 4LY7A 1R3NA 1DQ8A 1YVUA 1Z05A 1TMJA 1VRUB 3QGIA 1VSEA 1EO1A 1S12A 3MPYA 3RBEA 1XNQK 3KVGA 3ULHA 4QWBA 4KQZA 4UQTA 4LH4A 2QXFA 2CJ9A 1RTDA 2JDJA 2B8PA 4PYAA 3DGPB 4NCGA 2E7XA 3NDKA 8ATCB 1FI4A 5EX0A 2J4RA 5HRPA 4KH5A 2W2QP 2R7TA 3LTOA 1YXQA 4M94A 1NU0A 3U3GA 2R7SA 5B8HA 3V4IB 1H0HB 2E29A 4KI6A 3D6TB 3D6MB 2CQ4A 3PXGa 4U7UK 4J91A 3FZLA 4CLKA 1FRXA 3H8YA 1BISA 2IRUA 1VSJA 1WKJA 2DH9A 3OHRA 2DTUA 2DRAA 2OCEA 5T41A 1FE0A 4KPCA 1EHWA 1NB7A 4DU7A 3VF6A 3ISZA 2OEMA 3OJSA 2C1EB 3OQ2A 4RUHA 2V5HG 4O8KA 4X66F 3QBCA 5JVGQ 3KLIA 4CK2A 1S3XA 1BU6O 4F36A 1D0EA 2G8KA 3UDEA 1VMBA 3VAKA 4NA1A 5GAEI 1NJIT 5ETRA 2V94A 5ADXH 1IR2A 3BPSP 3QINA 4BRHA 3KHYA 4CK1A 2O8DA 4KC5A 1SH2A 1NPKA 3VESA 2CZ4A 1IKYB 3BR9A 4DR4K 3CIPA 1PAUB 2AP6A 3A3OB 3CJCA 2DNLA 4ILLA 1S6QA 4WQ5C 4CJ3A 4BC4A 1HWKA 1QAXA 4ZLLA 1JIHA 3ZT0A 2IJRA 3U1NA 3FFIB 1HL6A 2RIJA 1S4EA 5T7LA 2E5LJ 3AY9A 4LD0A 4Q0BA 3MM5A 2QA4N 1NNDA 5LMNJ 4Y0FA 2E5LF 2C28A 4UQGA 4IH5A 1YT3A 3JAMO 3WNHA 4YN3B 2CVIA 2ZWPA 3NGTA 4BDYA 3E2EA 3H46O 2YWGA 1WC4A 2XY5A 1WB9A 2Q6BA 1Y97A 4YHHF 3JYTA 4DL7A 4JKHA 5HJYA 2XMVA 1U1NA 2H54B 5IWAJ 2MTLA 3O1LA 3VTIA 4OKKA 4OJ3A 4CO4A 5JS2A 1UVKA 3ZT2A 3OBWA 2JH3A 2KYXA 5GIOA 2HHXA 2HWHA 3G8SA 3ADAC 3MMJA 4ZPDA 3FEYB 2E9RX 4FF4A 2VPXB 1T7PA 1FF2A 3D68A 3AO1A 4DLEA 2QWQA 1VQSA 3OYFA 4F2RA 3MR3A 4C6AA 3N6NA 5K8MA 3HD2A 2DFEA 2Q3SA 2V6AA 3HRGA 3IM9A 4ZS6A 5F8LA 2VKRA 5EWFA 1U09A 4RO0A 4Q7AA 2CJQA 2BKPA 4CLPA 3EX7B 1WSIA 3Q22A 4DZ6A 1Q7YO 3QAEA 1NJIO 5EX3A 2HWTA 2MMYA 1DEJA 2HMIA 4LBIA 4NA2A 1BCOA 4B9LA 2ZBQA 1RTIA 1MA9B 4KH0B 2XHBA 3RBXA 2VDHA 4M41A 1M5PC 5KFGA 2AEJA 4JKDA 1YLXA 1F1BB 1C6VA 1RACB 5KFEA 4H0OA 1YJUA 4CEDA 1WF1A 4JI0F 3I5AA 4E7HA 4NMXA 4B1YB 2IYGA 3OYAA 2A3ZA 4FJ9A 4X66J 3EKSA 1X9SA 1W26A 4DG1B 1G6BA 5F8NA 1EIYB 2JEFA 4ZCMA 2DNRA 1J54A 5ETVA 4F4YA 3CDAA 3PW2A 4GVBB 3KXDA 3MPDA 4CJ7A 2B9XA 1TL7B 2GMLA 3CCTA 4DPTA 3WQPA 4NLOA 1SS6A 5T7LB 2JLEA 2VWKA 1MMLA 3O9TA 3OR1A 4YP3A 3J80U 3LDOA 2AYBA 5HATA 4B3TJ 3DDKA 3I87A 4KHQA 2CFXA 5LMNK 2O8FA 1NGHA 3M8QA 3I8DA 4D3HA 2COLA 4DCJB 3SQ1A 5J1NA 3OTDA 1YWXA 3L4IA 3NWGA 2G0JA 4J2EA 4CH1A 5HMYA 4Q44A 1U6BA 2QM1A 4F2SA 1RT5A 2A6AA 4NYPA 3HFZB 4ID5A 3MM8B 4I67A 2VC1A 2E44A 3FZHA 2R2TA 2LECA 4CJPA 1UZHA 3PSIA 5E3CA 3ILJA 1TUYA 3IAYA 5JUMA 1WUUA 1IKWA 1NMEB 4W4MA 1U1OA 3WT0A 3QNWB 2H3GX 1NJWA 4LBPA 1RAGB 1WOOA 4K0KJ 1V5VA 3WDOA 4YR3A 1TU0B 2XCPA 5HRNA 1S1WB 4FWNA 2HQDA 2JJ4D 1MSWD 4KE5A 1PSDA 2OSRA 4CJWA 3EY1A 1NDCA 2V9KA 4FPAA 4I4BA 4OI4A 4QIGA 4USKA 3NOGA 1FJGJ 3CT9A 4Q5VA 3SK3A 3OW2M 4CD1A 3Q8QB 4CIGA 4KGKA 4JHDA 4DSIA 2ATCB 5AQZA 3JSBA 2HLUA 3Q8YA 1WAFA 2D3OR 3CJRA 1QVFR 3CCMS 4K42A 1S99A 1XN9A 2EK1A 4LSZB 2NYIA 4M5DB 2DR6A 3D28A 3KUEA 4FWMA 1HNZK 3CCWA 4MK8A 4IOBA 3LP1A 2UV8A 4NI2A 3LALA 4YB7A 3ENHA 3D6HB 2FBVA 1J27A 2QLFB 4DX6A 1B0PA 3MM5B 3EXYA 4YORA 1TL7A 1SC4B 2CQ1A 4A8WA 3AB2B 4Q43A 4PG4A 4W5RA 3NGKA 3NCRA 2D1CA 2ZVSA 1HNVA 2KJVA 1HI0P 2O67A 5IQQA 2DO0A 3RWUA 2XY6A 1TL3B 4BR9A 4PG7A 1N32J 3AA5X 5AQKA 3TA0A 1T9VA 2FVSA 5HANA 2G8FA 3AVGA 3PTWA 1T3OA 4YB1P 3O1WA 5B0BA 1LK5A 4J37A 3FZKA 3W3SA 3CGIA 3QESA 5AQVA 4ALZA 1RTJB 4X65K 1EQMA 2MKJA 4CHZA 3K5NA 3X1LB 4CTAB 4CJRA 2F8TA 4ETZA 2HZAA 1RBSA 1FRIA 2OAUA 2OPRA 4HTLA 3H5SA 4J7CA 5JVHQ 1BQNA 2YHYA 2K7KA 2FTRA 1WSHA 5KPZA 2CJXB 1IBKK 3G4SN 3J7AN 2MQQA 4FCYA 2O1PA 1RDRA 1GOAA 1Z26A 4BRLA 3H4BA 3QT8A 2NPIA 3TW0A 1Q79A 4RW7A 4F4WA 4A61A 2HS4A 3CI5A 5AR0A 4AUKA 1J5OA 1RAFB 4LF8J 1EETA 4ZVHA 4CGHA 2I2YA 3AHPA 4F3OA 1UAWA 2W2MP 3OL6A 2ZOMA 3HZGA 3QZ7A 4J9VA 3HZEA 4BR2A 4LF9J 2G2OA 4PXDA 4KTZA 5JVHL 4M5NA 2OPQA 3GYGA 3AA4A 2J0QD 5B0EA 2LLZA 3JAMY 4JKFA 4PYDA 4OI6A 1VBZA 3W3DA 3K17A 4EEYA 3KD5E 4DN0A 3SMPA 4OPKA 2G0CA 2EPIA 3CF5Q 2AGQA 1ZBHA 2F4VK 5KFBA 4WYBA 2IA0A 3PR5B 1FX4A 4IJNA 3OSNA 4JI7J 2P9UB 4MKBA 3EGNA 4CNYA 2H3EB 3D7SB 3G71S 1URNA 2UU9K 2FHKA 1ASUA 4X65J 4X4UA 5AQUA 4HWIA 3DLRA 5DS7A 2JVRA 3ZTRA 4DUZF 4AH9A 4DCHA 2HRTA 2F9WA 2M8HA 1YI2S 4EHUA 3QJLA 1XQIA 1MMDA 4B1ZA 2XM3A 4WU2A 3MR2A 2DNKA 1FCAA 3M1VA 4CFDA 5F0UA 1S9GA 4DQQA 3OUYB 3HSDA 5D0EA 1T44A 3OTOJ 5D0GA 4AHSA 2AJFE 3E01B 4EBDA 1IJEB 1UJ5A 3MECA 3DCAA 1FTRA 2J8SA 4M63A 5L46A 3NP5A 4UOGA 4C3MA 2DPIA 3RYLA 4DV4F 4NB4A 1Y3JA 4CHOA 1IBMJ 3GDQA 4TYAA 3DLEA 1OQ3A 4W98A 1VQON 4B3MK 1S1XA 3MXMA 1XMOF 4FBUA 4UF4A 2EFPA 2IJFA 5LL6d 3POTB 2YKAA 1O0PA 3R1HA 5EOYA 4AHUA 4CE9A 1KAYA 4J2BA 4OX7A 2C2ZB 4ZVUB 5KFTA 4Y1DA 3QMQA 2VG7A 1K0TA 3LOUA 3BKUA 4C8NA 3J81Y 4GNIA 5AE3A 3EN9A 5ETQA 2E88A 4CECA 3M5RA 1HKGA 5HI7A 2Y0BB 4USHA 4ZP8A 1ZH5A 3AOAA 3FFKB 2VPYB 4LFCK 5HMXA 4DR7F 4RW7B 2XB2D 3D0IE 4HCCA 2UYTA 2V0NA 1DQ9A 3AVKA 4E1NA 1B64A 2YV0X 4CLUA 3C6HA 4OIXA 2P9KA 2K3IA 2RS2A 2CPFA 4K0KK 3FC9A 4QYZK 2Z2ZA 2ZJRL 1Y00A 4ZVSB 1NOZA 5D0HA 3TZWA 3MMBA 4DV7F 2L3MA 3VZIA 4CTAA 1RJJA 1KKHA 2KB2A 4NE9C 5HVHA 4B08A 4XDCA 3PEJA 3CG7A 2F63A 4F3MA 4DFMA 1RTJA 5CQGA 3SSRA 3UE2A 3DXSX 2EBGA 4GVEA 4WQ5A 3R8YA 1A6LA 3CETA 2E1ZA 4CD3A 1RHQB 1VOMA 2DNGA 3D2EB 3MX2A 4OZ0A 2VQFK 1T05B 1RHKB 2AZ1A 2IBKA 3CIZA 4JI6J 2M4MA 1KSPA 2RVJA 5ETOA 1RBUA 1TL4A 3DHWC 2ZJRQ 4EUVA 3PX0A 2MGZA 3VAMA 4RG8A 1M90T 3BF3A 2IRYA 4RLEA 2GA7A 1KFSA 4NWBA 1T9UA 4USMA 1U2RA 1QZ5A 3B4DA 1WSVA 3AA3A 4LBHA 1S1TA 3ULEA 1J5OB 1HR0F 1M1KO 2BOAA 1R0AB 5IV4A 2RT3A 1KVBA 2Z1GA 5FPNA 2HKEA 1I1GA 3MM7A 4LFCF 4FVCA 1WAJA 5J2MA 3KHRA 1RYRA 2X1BA 3E51A 4LFAJ 1L3TA 1U0HA 3SDEB 1VQ6S 5DM7L 3KG4A 2C3OA 3RUBL 3VF2A 1GXUA 1BQNB 1FKOB 4WF9Q 4B9MA 5EWEA 2RDIA 1BWVA 2L41A 4DB3A 2ZJPL 2OGUA 3SAFA 1RAHB 3DDNA 5DO2A 3ZTOA 2DR8A 4JRPA 3RSEA 2UXBJ 4H4MA 4ZHRB 3RVCA 3QGHA 2ZUGA 3D3CJ 1WEZA 4FWQA 4I2PA 1GLCG 1GH8A 2HHHJ 4NLXA 3K5LA 3VGMA 1ZA2B 1N36F 5DDQC 3HCXA 4OMFG 2ZOGA 4F0MA 1HRHA 1IBMF 3U1LA 2YHXA 2VYPA 5JS1A 1RISA 3CMQA 4AL5A 1NJZA 3J7ZO 4NLPA 2DR5A 4LF4K 2NNWA 3ZSOA 1FKAF 1GLFO 1JLCA 5D4LA 3NAIA 2XWXA 4DV0F 2O8DB 3CMES 4EP4A 1NLVA 2OELA 4JV5J 4URGA 2PBDA 1H72C 4OQJA 2Q31A 4ICLA 1U1PA 3GE9A 1G4CA 4FKXA 4H0XB 1S9EB 2A3JA 3DLEB 1OO0B 1HD0A 3LA0A 2AV5A 2A6OA 3J7AP 3EWGA 2VONA 2YKMB 4C8YA 4HHUA 3M3ZA 2QGFB 3SCJE 3KMQA 3T1HJ 3TANA 4KRFA 2QWNA 3CNQP 3N9UC 4O23A 5CCMA 4ZLPA 3AVNA 1KD1T 5D4PA 3WEEA 3O3LA 2JFDA 4ECRA 1T9YA 2PN6A 2VJVA 4JI1F 2OPPA 1M5SA 1NH8A 2WW4A 1E6VA 3BZKA 3D0HE 3CMAS 1XHZA 4JI6K 3CD7A 1Q86O 4JBCA 1VLOA 2E1AA 3EE3A 1VI7A 3ZZPA 5DQHA 4FJNA 3KJQB 2LQ5A 5BRDA 2LA6A 3C95A 4C7QA 3KK1B 1YRXA 2ZDPA 3PKYA 2L9DA 4FM1A 3OFHA 2LCWA 4MTPA 4IR1A 4DF4A 5LSLA 1N5TA 4ZVGA 1LWFA 1S6OA 1NK5A 4FF3A 3OA9A 1OYDA 3MEDB 1CS4B 2HBJA 4IKAA 3Q7BA 3EPGA 4I56A 5D3GB 5IWAF 4XIUA 3V5RA 1AT1B 4IDKB 3T3FA 2VA3A 1NSPA 4DV0K 3OL9A 5ETTA 2UVUA 1GQEA 3FZMA 2B4JA 3NS5A 1RTHB 4WFBQ 2KFYA 3GFHA 3VR1A 4CZEA 4DTJA 2F96A 1RHRB 4J2DA 2YNHA 3OT9A 1RDCA 2A1SA 1N34K 5KGWA 2HMIB 4B3RF 4BDPA 1X9WA 3CC2S 3AD9C 1WHVA 3FRYA 4DUZJ 3VENA 2R7VA 4C11B 1WSRA 3I33A 1NKBA 3BM7A 4DTRA 3ZEUA 2X1GA 3VQ9A 3SZ2A 3GB0A 3SAHA 5AT1B 4IYQA 4YS2A 3CCUN 3GIIA 2YY3A 4EU0A 4C8ZA 1GFWB 1VDHA 2XZDB 4DCPB 4RTFD 1X9JA 3L2WA 2IIHA 1CJUA 3IS9A 4N7TA 4TLQA 4I2QB 3TAGA 4F26A 1X4EA 4YY3F 4WFBL 3B4MA 4YNQA 3ZO7A 2OHDA 4HDHA 2R7XA 1RT2A 4ED3A 4DR6K 2HZVA 4OPAA 3TUJC 1FJEB 3NNAA 5KG4A 1NGIA 5TKWA 3KLEA 4O44B 4M5DA 1XI1A 2C2EA 2A2DA 2CQ0A 1BQXA 5L1LA 1TVRB 4P52A 4JP8A 3M8PA 3O1BA 3TAMB 3W2VA 4J2AA 4CLTA 1FFGB 4MIWA 5IOLA 1SH0A 4IH7A 4O3OA 2XO7A 2QA4S 2LXUA 5C2CA 4OI1A 2RS8A 3MN7A 2HBZB 3SUQA 2RE1A 2O4GA 1S5ZA 1SC3B 1YJ9N 5E3PA 1OKJA 3T1HK 3OBIA 3W62A 4LR7A 3GBTA 4KGXB 2AEFA 1O5JA 3MM9A 4PL7A 2R8GA 2DHAA 2QEXS 3V1OA 4R5PB 5C12A 4KY3A 4K41A 3H5YA 2C3MA 4BRKA 3H08A 2EW9A 2I0XA 3KHLA 1ZAVA 2WSFC 2DNOA 2RE2A 3EKUA 3C94A 4B9SA 2LQ8A 1FKOA 1JNRB 1RGIA 2JWNA 2EFVA 4J9UE 4WQ4A 1NAQA 3BO2A 4IKFA 4FJ5A 1ZM4A 3UNYA 1FJCA 1PG5B 5DJBA 3QICA 3AT1B 4AQYF 3UKUA 3R97A 3R5CA 1UWBA 1ROFA 1YJ7A 2OTJN 1UFLA 3QFHA 5A2QU 5KFLA 4CJTA 2HF3A 4DQ8A 1S1WA 3TQ1A 3MEKA 2FJXA 2AYEA 1YG0A 3BUZB 2BW7A 1FRKA 1FESA 4IFYB 3P39A 2XGQA 5DDPC 2RKIA 1VIXA 4DS5A 1WC5A 4QWEA 4HTUA 1AB8A 1CULA 4GKKF 4H8KA 3KKRA 4K4SA 3W8PA 4ID8A 2EC0A 3KK1A 1RHMB 2R42A 2B4OA 3A5MC 3ZSZA 2RAQA 2M8DB 1LOTB 3SV4A 5E84A 1UKUA 4CK3A 1VR6A 1NK6A 4UOCA 5J2PB 4URSA 4LF7J 2Z2YB 1HNXJ 3C66A 1PGZA 3DU5A 4M3TA 3AARA 5KFHA 4OX9K 3C15A 2YX1A 4JV2A 3G25A 1HPZB 2DYAA 1FWLA 1P9QC 2FBTA 3BEXA 2OEKA 3NOCA 5GINA 4K7QA 3E66A 2VKZG 3W9JA 4FJMA 1V4SA 3GG1A 2W2PP 4RW4A 1VJWA 2ZQBA 3DRSA 3QT7A 2KU7A 2YNGB 2CQDA 1JJ4A 1H6KX 3AVLA 2XQCA 2B6AB 1S97A 2RF2A 2DNPA 3NMAA 1YF5L 3VQEA 2E5LK 2BACA 1ZXOA 2CJBA 1S6UA 3PYGA 3TWHA 3GYXB 4WP8A 3G0ZA 2M9KA 3KOAA 5M1NA 4DSFA 2FPHX 3CPWR 1RBRA 3NH1A 3D3BJ 1K44A 4CO1A 3WNGA 3EE8A 4DXLA 3AVBA 4EFAC 1JXBA 1MWZA 1B0TA 1CJTB 1T95A 1N6QB 2R3VA 4CF9A 3VQSA 2JZ5A 3IAS9 1LW0B 3EL2A 2KLAA 5AQHA 2B8QA 3H5XA 4ILJA 4NCGB 4DX5A 4AHRA 2ILYA 1O13A 1WDDA 1Q53A 1QHAA 1K8KB 1TUGB 3O8MA 4GV9A 3PX6A 2VPWB 2HNDB 3LP2A 2YTCA 1GLBG 3OY9A 4F25A 1YUWA 2MKSA 4DV6J 4Y2MA 2MQ8A 4ANDA 3V6DA 4GC6A 4CI6A 3U6FA 1JL2A 2QWRA 3SJJA 1PAEX 2NQPA 4O4RA 2VJUA 3NNHA 3HMJG 2LU2A 4CJ4A 3GIRA 1YGYA 4LR9A 4OJGA 1NEEA 5M1QA 2DGQA 1XTZA 4XH5A 1UFKA 3M9OB 4DQPA 5JXSA 5CZ2A 3K5PA 3HVTA 4AT1B 1ZC6A 2JX2A 5EVZA 1RBTA 5A2QY 3IBFB 1YKWA 2CKWA 3CE8A 7AT1B 2Y9HA 4PY5A 3UVJA 1CC7A 2YWEA 4OX9J 1HBMB 3G96A 5IT9O 1NKCA 1CBKA 1RSCA 2KFZA 1KDNA 4ANCA 5ETNA 2FJEB 4JI1K 3PJ9A 3T69A 1UPPA 2E2OA 1MWMA 2QL9B 1JWWA 3I96A 3CJAA 4M5KA 2P9PB 3G71N 1N8RT 4CJEA 5M1OA 3CO9A 2QMWA 5M1PA 4ECYA 3SCLE 3OR2A 3H2VE 4HTIA 2R7UA 3PIPQ 1Y10A 3D2EA 1HNWF 4H54A 4EP5A 5KFYA 2YCHA 5KT5A 3MDFA 4ZJQA 3DGVA 2C2KB 2CYYA 2D5RA 1ATNA 3B6OA 2J0SD 1N6QA 3D0GE 3KHGA 5AZJB 1BHLA 1HNWK 1HQ2A 1HQEB 2RN2A 1ZS6A 1NGEA 3DM2B 1XIQA 1HW9A 3B6BA 4NCBA 2HFUA 3MEEA 1JCGA 4F3QA 1H7XA 3VALA 3L0QA 3V9ZA 1G7CB 2G4BA 4LF4F 3CCRS 4IQMA 4FM0A 2QSFA 4RW6B 3C46A 4X64J 1WI6A 2HQ3A 5B0DA 3MMCB 1QE1B 1UJ6A 1I51B 3FEZA 4RKUC 3LWLA 3TU5A 3LDNA 4FLYA 4Z2XA 4KJIA 1UVIA 3CDBA 1RT1A 3ZZZA 3V6DB 2ZD1B 3OVSA 3O80A 1BUPA 2MXYA 2ADCA 1RAIB 1GX5A 1RABB 3B82A 5L9NA 2IJNA 3ELHA 4TNOA 3EGVA 3AXMA 4CF2A 1XBWA 3UD3P 4O0JA 3THYA 5FLXY 1UEKA 4I9LA 3KK3B 2ZNZA 1K6YA 2CIMA 3LDQA 1S0OA 3MZIA 1R7IA 4FJLA 1D9FA 3AVMA 3UR0A 3VVUA 3ZTQA 2FC8A 4YOYA 3HHLA 4IFEA 2FC9A 4W90B 3NMRA 4ZCIA 4JN4A 3VAHA 2DTJA 4P10A 3BZQA 1TQLA 3JSRA 4CYUA 3HHEA 5I3UB 3EVOA 3BREA 2HRYA 3NGDA 4DR3K 2B56A 1ZA1B 1NZ8A 4X62K 4ECSA 4WFZA 4QAGA 1D3WA 4X4RA 2PAVA 2P8IA 3C6AA 3J7YI 2VWJA 2AT1B 4X64K 3MM6A 1C0MA 5AXLA 1FWPA 4M5LA 2GHVC 4PHTX 1AUDA 3VAIA 4DR2F 4H03B 1WBDA 5AQIA 3M32A 2VBXA 1GLAG 2VD3A 1WN7A 5ADXA 3UN5A 4OLOA 3UQSA 3L95X 4MKYA 4JK7A 2OFGX 1ASWA 1EB0A 4DX7A 2UUCJ 2AW0A 1QQMA 2MB0B 4ZJOA 1BMQB 1L3VA 2DNQA 2NXNA 3F0NA 3SCXA 1U48A 2FC0A 3RAQA 1WNEA 2CQPA 2W01A 3TPQA 3FNNA 5IC4B 3GL1A 4H4OB 3CIMA 3UI3A 3EZWA 2XEXA 3QO9B 3IC1A 3AODA 1GOCA 2HHUA 4LF1A 1SL0A 2E1CA 4KB0A 1FDAA 5LJVA 1GLDG 4LF2A 4AHCA 3FBCA 2HVDA 3WHIA 1B7FA 2ZKUA 3CF5L 3ZT4A 2UXCK 4DV1J 2D9OA 3OVAA 3AB4B 1TKXB 1QVFM 1BGXT 2PMWA 2RRBA 1XMQJ 2WCXA 2DFFA 1SJ1A 2MZTA 2WVCA 3NF8A 2RILA 2W24A 3PEHA 3G6EN 2DHGA 3FZ2A 5C25B 3VGTA 1REVA 2D0AA 4GC7A 3MAQA 4P75A 1CS4A 3M8YA 1MROB 2UU9J 2V4RA 3NFAA 2OPQB 2QL5B 4FJXA 5KFXA 1PJ7A 2MJUA 1JB0C 4NXMK 1TK0A 3VWSA 4EI2A 2DNNA 2HVIA 1NB2A 3JQKA 2FHJA 4WIQA 3VA0A 1SKWA 4WZQA 1S1VB 4OHZA 2KO1A 4FK4A 2VQEK 1YDLA 3KLFA 1WSGA 3TSPA 1FRMA 1RLDA 4MLEA 3CDWA 1BG3A 1SUQA 3GFYA 3THWB 5C24B 3GONA 4HI2A 2UXDF 3NGSA 4TSXA 3CB4A 1E6VB 4YDUC 1AW0A 4N47A 1RTHA 1XMOK 3AA8A 4FWLA 3W5XA 1HWIA 4NXNJ 1D8ZA 3ALYA 4C8OA 2ADBA 3R3LA 5KT4A 4DI6A 3AVCA 5FIIA 5CYMB 2WK4A 3PIOQ 4FW1A 4CZJA 5HAOA 1N0UA 4LRAA 2QG9B 4PABA 3GMGA 1S72N 2P9SB 5H9EJ 3SQ0A 3LGNA 4C9DA 5AZIA 3CCVS 1FE4A 3MFHA 5GAHP 2Q0RA 2ZM6F 5KFKA 1XR7A 3O8WA 4DR2J 4HHJA 3MMAA 4OPHA 4H5RA 2B5JB 4RUAA 5GMKa 4NLUA 4Q0BB 1RT6B 1X4AA 2DR7A 2F4VF 2G1DA 3LM9A 5KTQA 2WSEC 1Z6RA 1ZAWA 3OFEA 4FYVB 2XG8A 2RPIA 1U1MA 2CUYA 4M1KA 3LPTA 3CQ8A 3R2DJ 3HPGA