2YNGA

Hiv-1 reverse transcriptase in complex with inhibitor gsk560
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 168
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yngA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yngA05
4FK4A 1HYSB 4NZ0A 1KLMB 3NH2A 4B9NA 4PY5A 4K4UA 2HHSA 3NAHA 4KSEB 1S1WB 2DFHA 3GIKA 1BIZA 3PW2A 4CK1A 3KHLA 3ZT3A 3OYKA 4KHMA 1L3SA 4CJTA 3M8PB 3DLKB 1VSIA 4J9KA 4OPJA 3AA2A 2C2EA 1NK4A 1JKHB 4Q45A 1TVRB 3I5AA 3PW4A 5C42B 1RT1B 1I6JA 4WE1A 5KFMA 3H5XA 5F8NA 3TAGA 5KFBA 3ZSVA 5KFRA 4HUGA 3SJJA 2EC0A 3SNNA 4FZZA 3K5MA 2AJQA 4F50A 1QS4A 4H4MA 4NLGA 4Y2CA 3M8QA 4MK9A 1NKEA 5DLFA 5KFCA 3KMQA 2PYLA 2C28A 1BQMB 4RW4B 3LP2B 2XCAA 5DQHA 3DLHA 3KLIA 2AGQA 2KFNA 1S1VB 3CDWA 4YR3A 5L1KA 4CJKA 2GC8A 5KFXA 2R8GA 2ZE2B 1RA7A 2IC3B 1JIHA 2IMWP 4ECWA 2J6TA 3JSMB 4EZ9A 3RR8A 2XHBA 5HRNA 4EO6A 1TKZA 1TL3A 4IFYB 2VG5A 5KG2A 2HHUA 3IRXB 5KT5A 4J9PA 1KTQA 4FBUA 4ICLB 5J2NA 2JEJA 3WNGA 3HVAA 1S1TA 1B9FA 2UVWA 1S1WA 4F4XA 1S0NA 2AWZA 4B9VA 3Q8SB 1C0UB 3SPZA 1Z4UA 4YQWA 3KLEB 4M3XA 3LPUA 1FKPA 3KK3A 2YNFB 2ZE2A 4KHYA 4Z4FA 4KRFA 1C1AA 5KFLA 4J9SA 4M95A 2FLPA 3KJVA 1TK0A 3A2FA 1TV6B 1BGXT 4CK3A 4KHWA 2WRMA 1TKTA 4M42A 3NCIA 1C0TA 1VRUB 1T05B 1XR5A 4EP4A 4CIFA 4CFDA 4MFBB 4ED3A 4MFBA 4QWAA 4J2BA 2IAJB 3M9MB 3MFIA 3H5UA 3VQDA 3CVKA 2G8IA 1C0TB 1U48A 3ZSXA 1TKTB 3K2PA 3MAQA 4HCCA 3QO9B 1QQCA 1U4BA 2W9AA 3KHRA 3VQ8A 1T05A 3V81B 4IG0B 3ZSOA 4KFBB 3P5JA 4O4GA 2HW3A 3K5OA 4DSLA 3T5JA 3M8PA 2KTQA 3GV8B 3VQSA 3KJVB 2OPSA 2I5JA 2JC0A 4TN2A 1SKRA 2PYJA 1ITGA 2QE5A 4AHUA 1VSDA 3ASMA 1YTAA 3F9KA 4PA1A 1J9AA 4CJWA 2X74A 1U09A 1KFDA 1S5JA 3ZCMA 2JGUA 2UVVA 1D5AA 4KO0B 1HYVA 3V1QA 3NGDA 5J2NB 3QGGA 3DRPA 1T7PA 4I7FA 1N48A 3VQAA 2YKMB 1KHVA 2VG7B 4E89A 2RPIA 2QKKA 4GW6A 1Y97A 1EKEA 3U3GA 4DSJA 4W5NA 3K58A 1Q9YA 4C8LA 2G8FA 1RT4B 3I5BA 3DRRA 1JLFB 4F4ZA 1T03B 4Y1CA 4CJFA 1JL2A 2IJNA 4CJSA 3L8BA 3NBPB 1S0OA 4IRCA 4FLVA 3SQ0A 4DQPA 3DRRB 3SQ2A 1N6QB 3T5HA 4QAGA 3O3GA 5F8LA 4TQSA 2KQ2A 1WAFA 3K5NA 3H59A 3KK1A 3M9NB 1ASVA 2P5OA 5HP1A 2BRKA 3AO3A 4CHYA 4KO0A 2ASJA 2D3UA 1KVCA 4ED6A 3KHGA 1B92A 2B5JB 1RT1A 4RU9A 4CF0A 5J1EA 3MXJA 3GIIA 4OLAA 4FJIA 4B3OA 4DTOA 1BHLA 1DTQA 1JLGB 1RTIA 2F8EX 4Z4GA 1HRHA 1VRTB 4W5OA 2KZMA 3GIMA 4DSKA 4WFZA 4KBIA 1SV5B 4TY8B 4H4OB 2PZSA 3AVNA 4HUEA 2ATLA 5FDLB 4IG0A 4MK8A 1VSMA 2HNZB 4QCLA 4NCGA 3ZT2A 3NF8A 5L1IA 3DOLB 1WSGA 4ECYA 3CQ8A 1FKOB 3PVXA 4ED2A 1ASUA 3QERA 1RT2B 4CEQA 1JLCB 1D1UA 4R5PA 4ID5B 3AVLA 3C6TB 3RB4A 2BE2B 4IG3A 4ID1A 4BE2A 4PQUA 4F8RA 1SUQA 4FVMA 1S1UA 5HRRA 3UPFA 3OYHA 4NLPA 4PWDB 2C2RA 3G6YA 5KG7A 4K4SA 4LD0A 2HNDA 2HNDB 3UR0A 4DFPA 4FCYA 2RDJA 1RDAA 1WSHA 4CEAA 1RBTA 5HRPA 4CF9A 4DTNA 3PW0A 1WSJA 2G8WA 1JKHA 4F2SA 3HSTB 4M45A 2E9TA 1JLQB 4XO0A 2QXFA 5KFNA 1NK6A 4FJ9A 2WONA 4N47A 3KLHB 1N5YA 1S6PA 4EBEA 4CEBA 2OPSB 4ECVA 4IFYA 2XC9A 4Q43A 2O4IA 2HVHA 4CHNA 3VA0A 3ISND 4RW6A 1QE1A 4N56A 2HHTA 3RB6A 3FQKA 3OLAA 3T5KA 3DLGB 1LW2A 1X9MA 1S1XA 4E1NA 1A5XA 2G8HA 4ZP6A 1IM4A 4NLSA 1FK9B 1RT6B 1W0HA 4FJ7A 1QAIA 1WNSA 4KHRA 3OL7A 4NYFA 4CF2A 4EBDA 1SH0A 5KT7A 1NHUA 4HTUA 4MKBA 4DFKA 3FDSA 4FJJA 4BDPA 4CEEA 3V9ZA 5I3UA 1YVUA 4CEOA 1QSLA 4GC7A 1RILA 1J5OB 4NLRA 3QIPB 1BCMA 3MECB 3I5CA 4CESA 5F9NA 1DTQB 3N6MA 4CJQA 4CJVA 2OZSA 4CFBA 1HQUA 3H4BA 4K4YA 4MH8A 2J6SA 2HWHA 2HMIB 3K59A 3TVKA 1CXQA 3QZ8A 3P1GA 1JLAA 1S10A 3AO1A 3HKWA 3E01B 4Y34A 1RT6A 3HPOA 1ASWA 2IC3A 1ZETA 2EHGA 4ZPCA 3CDUA 4RNFA 2FVSA 2WHOA 4IDKA 2RDIA 3VQ9A 2ZD1B 3CJ4A 4FBTA 1IO2A 4QOZB 2IDOA 3LP1A 5HBMA 4E7HA 3HJFA 3PJWA 3BJYA 4HCBA 5KFKA 3IAYA 3C6TA 4L8RB 4DS5A 4DL4A 1TK5A 5L9XA 1ZYQA 2F8SA 1TKXB 4HKQA 1TKXA 5KG0A 1NK0A 3EPIA 3QGHA 1QHTA 1D8YA 4Z4IA 3NMAA 3Q8RB 1Z25A 2VG6A 3OS2A 4N41A 4FLWA 5HBMB 5DQIA 3M8QB 3QEPA 2VWKA 3E01A 3K57A 4B9UA 3TAMB 4B9LA 4I2PA 1HPZB 2RF2B 3TAFA 4ZHRB 3L2UA 2X6NA 2BE2A 2FBTA 3D45A 4FZYA 3ZT0A 2GUIA 4MKAA 2XCPA 1R0AA 1GX6A 2D7SA 5KFGA 1GOBA 4FZXC 3JYTB 4Z4EA 1KVBA 1Q8IA 5K14B 4YP3A 4O3PA 4N76A 3LWLA 4DL2A 1RT5A 1ZBLA 4KB1A 3VQ6A 3LP0B 2C2DA 4NRUA 2OPRB 3LAMA 4NLDA 2HHWA 5I3UB 3GIJA 3HVRA 1LV5A 2IM1A 2WB4A 3E51A 1S9EA 3DOKA 1TP7A 1HMVB 2LSNA 1JLBA 2Z1GA 1RTDA 4E7IA 3PR5B 4J9RA 3QEVA 1ZBIA 1A5VA 1FKPB 3KK3B 3HXMA 1U04A 4IBNA 1D9DA 1DLOB 1TV6A 4O55A 3QESA 2B6AB 4ZMMA 3BDPA 2W7OA 3HYFA 3NL0A 3QEWA 2ILZA 4NLVA 2OA8A 1IH7A 2YKNA 3G6VA 2G8KA 4U6PA 4O5BA 3WNHA 2OYQA 3AVCA 5KI6A 4M3YA 3OYBA 3CJ2A 3JYTA 4E7LA 3QEIA 2AGPA 2OH2A 4OVLA 1LAVA 3H2LA 4XPCA 3KK2A 1QSSA 3V4IA 2D0CA 3LP0A 4KV8B 4K4TA 3SI8A 3OYCA 1S1TB 3DDKA 3HP6A 1LWFA 3CFRA 2BQUA 3VQ4A 4WFYA 2P51A 2Q3SA 3OHBA 4M3UA 4WFXA 4E3SA 2VG5B 4DQQA 2D3ZA 1NJWA 4KKOB 5KFAA 1JLFA 3NAIA 3NAEA 1WSIA 1SL1A 2R8JA 2VG6B 3V6DA 1RBSA 2YHAA 4CHPA 4TQRA 3OSNA 2BRLA 2ZQBA 1L5UA 3QNOA 1RT2A 2B4JA 3KLGB 1TAQA 3LALA 5FRMA 3DRPB 4IG3B 4G3IA 2PY5A 3LP2A 3V9SA 2BDPA 5C24B 4K4VA 3QETA 1U45A 4J2AA 3D0PA 5KFDA 2YKMA 4ZTJA 4AHCA 3ZT1A 3MEEB 1TK8A 4FK0A 4OKEA 1S6QB 4FJMA 4E7JA 2G8UA 4AHVA 1RT5B 4DS4A 4TY8A 3H40A 4WXWA 1IKVB 1MMLA 4B08A 4YMEA 4FLYA 1I3AA 4B8AB 3SUOA 1J54A 3ZSYA 1LAWA 4ZPDA 1RAJA 4DEZA 4NYNA 1GX5A 5HP1B 4CGJA 2XY7A 2XRIA 3OL8A 4PUOB 3KK1B 4FW1A 3RMDA 3VQBA 4NLQA 4K8ZA 4KHSA 1IG9A 3OS1A 2YV0X 3MEGB 2ALZA 2WCXA 4WXOA 2R2RA 3MECA 1TL3B 1YT3A 4DSIA 3KD5E 5KFVA 3OYLA 2W9BA 3CO9A 3G0ZA 4ZP9A 4E7KA 2JEIA 2R2UA 2XY6A 5KT6A 4FLZA 3BQ0A 4F4YA 2VA2A 3MTKA 3L2WA 5KFJA 2W9BB 5SZTA 2FJXA 3TWHA 1W9HA 1ZBUA 3KLIB 2W8LA 5KFIA 4FJ5A 3H98A 5KFOA 1RT4A 5F8JA 5EUHA 1T03A 4FJKA 1UAXA 4OL8A 4RW8A 3RBEA 3O4NA 3KLEA 3QLHB 4I2QB 1D9FA 2OPQB 3H4DA 3MR6A 5KG3A 1BQNA 4HUFA 4JLHA 3MF5A 3FQLA 3Q8QB 3NE6A 4ICLA 2IS3A 1D0EA 2B6AA 4QWEA 3CDEA 1HNVA 3OYNA 3SUQA 5J2MA 5I42A 1ZTWA 2W8KA 3QIDA 4O3RA 5T14A 3V1OA 3ITHB 5J2PB 1QTMA 4M3TA 5KG4A 4FLUA 4RW9B 4IFVA 1RTJA 3MR2A 1HMVA 3V81A 3U3YA 3KMSA 3LWMA 4RW6B 3M8SA 3FRZA 3N6NA 4J9LA 3EZ5A 2V0NA 4BDYA 3L3VA 4CIGA 1C2PA 2A1RA 4RNNA 1S0MA 4LH4A 2HNZA 4IFVB 3VN5A 2R8HA 3NH0A 4CGIA 1NK8A 3H08A 5KRSA 1RTJB 2NUBA 3LAKA 4YR0A 4IH6A 2XWYA 2P5GA 1X9SA 3AVKA 3PX6A 5CYQA 5I42B 4CHZA 4DL6A 4LSLB 5F8GA 1KRPA 5KFHA 4XIUA 1SUQB 2FJWA 4J9MA 3LPTA 4TYAA 3RRHA 3I0SA 3VQPA 1C0UA 1UWBA 4I2PB 1L3VA 4NLWA 1XWLA 3S3NA 4HYKA 4RG8A 4TLRA 4DSFA 4IH5A 1BCOA 4CF1A 3HL8A 3F73A 4H54A 1JXBA 2GV9A 3CJ3A 3H5YA 2IM2A 3LP1B 1T3NA 4FS1A 5KT2A 5DK5A 1S1VA 3EZUA 2IM0A 4O3NA 4IRDA 1VSJA 2F96A 4M3RA 3RMAA 4DQIA 3HVWA 2UVRA 1BISA 5FROA 4JV0A 2YKNB 5T7BA 3FSIA 3MEDB 4DSEA 4GMJB 1NK9A 4XPEA 4J2EA 3DOKB 3C6UA 3RAQA 4H4MB 3TQ1A 4ED0A 1CSJA 3AVFA 1JLGA 4JV2A 5HROB 3OSPA 3TABA 3LP3A 1YTUA 4RW4A 4DWIA 3NHGA 4IH7A 5L1LA 3PO5A 4WE1B 4CJRA 3GILA 4GC6A 2WTFA 5EWFA 5E41A 4HHTA 3U6FA 2Y1JA 2OZMA 3GV5B 3QZ7A 3OYDA 2FVQA 3TANA 3CG7A 4O0JA 2JC1A 3OYIA 3CFOA 2KZZA 4W5RA 5L1JA 3AA3A 5DG8A 4EYHB 4QW9A 3T5LA 3Q8PB 1NNDA 5JS1A 1LWEA 3B6OA 5D3GA 2D0AA 4EBCA 3AVBA 4MK7A 2ASLA 3DMJA 4URQU 1EX4A 3V6JA 2E6MA 1UA1A 4Q8FA 1LW2B 3OL9A 3BGRB 1HYSA 3MEEA 1UA0A 2R8KA 3NF7A 4DQSA 5DG9A 1QE1B 4IRKA 3SUPA 3NF6A 3SZ2A 3AVIA 1S97A 4DLEA 4RW7B 4B9TA 3KLGA 4NYZA 4B8CA 1K1SA 2IOCA 3DLEB 4H8KA 3BSAA 2BQRA 1I39A 4QW8A 2GIRA 2ZKUA 3T19A 1EP4A 5CYMA 3ZSZA 1RYRA 3SFGA 3PX0A 4NRTA 3DYAA 1X9WA 3LANA 4IOBA 1W25A 5J2PA 4J9QA 4BACA 1WN7A 5FRNA 3GYNA 3HM9A 3THVA 4FJGA 2QKBA 4KKOA 3HPHA 4RNOA 4CFAA 2W42A 3VA3A 3ZT4A 2HHQA 4QWCA 3L2QA 2ZD1A 3ZSQA 2A1SA 2AQ4A 2W9CA 4ED8A 5HLFA 1S1UB 4DFMA 3NGZA 3DM2A 2ETJA 1HQUB 2WOMB 2WOMA 2VA3A 3BSCA 1CXUA 5HLFB 3D28A 4K4XA 1JLAB 5F8HA 3RWUA 4CJLA 1FXXA 2R7YA 1JLCA 5KT4A 4O4GB 5KTQA 1HQEB 5KGXA 3IS9A 3BQ2A 3AVAA 1G15A 4CCHA 3QIPA 1RT3A 4CJEA 4O3QA 1DTTB 2HHXA 3UDLA 2AGOA 4G1QA 2CJQA 1IKWA 3OYMA 3OVNA 4KE5A 4ZVFA 2IBKA 4LY7A 2IAJA 4O4RA 1SV5A 2QV6A 4RW7A 3FFIA 5F8IA 3L2VA 4E19A 3SFUA 5KFZA 1RYSA 4JS5A 3LZIA 4LH5A 2DY4A 2ITGA 3ISNC 2BANA 1S9EB 4BE1A 1TAUA 4FM2A 4IR1A 2WONB 4FM0A 2YHBA 3AO2A 4WZQA 3O4QA 2B5JA 4Q0BB 3BQ1A 1S9FA 2E9ZA 1S6PB 4RUAA 4ELTA 3IG1B 5JS2A 3KKSA 1N56A 4DL5A 3SQ1A 3RRGA 1NJZA 1QAJA 3KOAA 1A5WA 1S6QA 4GVMA 4DG1A 5KRTA 4DF4A 4AHRA 3SPYA 4DMNA 3NBPA 3KLFB 1VK0A 3DRSA 4F4KA 4DTSA 1L3UA 4CEZA 2RKIA 2DTUA 5DG7A 1C1CA 3PUFA 4CHOA 1HARA 4ZPAA 3LZJA 1IKWB 4FYDA 5JUMA 4K4ZA 4C8MA 3DRSB 4OGEA 4ZTFA 3TR8A 1DTTA 3CM6A 4JRPA 2YNIA 4DTPA 5DGAA 1NK7A 5FDLA 3CJ5A 3T1AA 3L3UA 1BI4B 3ALYA 4EP5A 1Z26A 1RTHB 4YNQA 1EXQA 4FJNA 4FJXA 3PW7A 4B9MA 2CKWA 1LW0A 3RTVA 3AV9A 2OPQA 1HJRA 3QYYA 5C5JA 1XR6A 4KB0A 2FVCA 3TARA 4H4OA 1NJYA 1RDRA 4I9LA 4LSLA 1KLMA 1XHXA 1SKSA 3GV7B 3L2RA 4ZVHA 4ELUA 3O3FA 1EETB 3AVJA 4CJ5A 1RTIB 1YVFA 3HK2A 5KFEA 2XGPA 1LWCB 4W5QA 1KCFA 1WNEA 3AA4A 2D41A 1KFSA 4M3WA 2E9RX 4CEDA 4B3OB 4OGCA 4O3OA 4QWDA 1C6VA 4R5PB 3NKYA 4O44A 2JLEA 1QUVA 4LSNB 2XY8A 4Z4CA 3QIOA 3V9UA 4K50A 4ZP8A 5DQGA 3SYZA 1TGOA 3DOLA 1N6QA 4RUCA 2J6UA 3TAEA 1U47A 3KTQA 1IKYB 3PHEA 1IKYA 5KFSA 1MU2B 2ILYA 3I0RB 3I0RA 4RW9A 4ECZA 4QWBA 2X6SA 3CJ0A 2W7PA 4O3SA 3AVMA 1RTDB 3ULDA 1S49A 5KG5A 2UUWA 4URGA 3I8DA 4DQRA 4M94A 3MXIA 2GBZA 5C25B 4J9NA 3VQQA 3PX4A 2FLLA 2FLNA 2O4GA 5KFUA 4F2RA 1S9GB 1NOYA 1N5YB 3ITHA 1WLJA 3K5LA 1XC9A 3DLRA 1HYZA 4KPYA 4ELVA 2XO7A 4KAZA 1SKWA 2RF2A 4EO8A 4MIBA 2FVPA 5EU7A 1NKBA 3RBDA 4AH9A 3G10A 2G8VA 3TAMA 1RDDA 2X78A 3NGYA 1K1QA 2E6LA 2FBVA 3LDSA 4FXDA 1RTHA 1C1BB 3JSMA 5EWGA 4CJ3A 4DTRA 2IGIA 4EEYA 3TAPA 3AO5A 1TKZB 3ICLA 5DLGA 2OPPB 3MXMA 2BQ3A 4CHQA 1JXEA 2XY5A 1RBVA 2R2SA 1JXLA 4PWDA 5CZ1A 4WZMA 4PQUB 3VQEA 3O3HA 2Y1IA 4NCAA 1RCHA 3MEDA 5KGWA 4K4WA 1KVAA 4DFJA 3BGRA 1FKOA 4AILC 1C1BA 3PJXA 4NLTA 3EYZA 3OYGA 4NCBA 3S9HA 2R8IA 4PUOA 4DG1B 4LQ3A 1TVRA 3SV4A 3OJSA 3RB0A 4DTJA 4E0DA 4RNHA 4IKFA 3OY9A 4F4WA 4KHUA 4MIAA 2GIQA 4ZHRA 2Z1IA 1VSEA 1VRTA 4LQ9A 4O0IA 2HMIA 3KLVA 1J5OA 4CF8A 3DI6A 3IGVA 4JV1A 2FJVA 2B43A 3TI0A 2XGQA 1NOZA 3HP9A 3V9WA 2KFZA 3SQ4A 4DTUA 4ECQA 4C8OA 2FBYA 3SI6A 3PW5A 4ZPBA 4CFCA 1F21A 3BREA 1IKXB 1BL3A 4ECUA 4FJLA 4EZ6A 4J2DA 4ECXA 2D5RA 2YNIB 1VRUA 5KFFA 3C6UB 2JEFA 4AHTA 4F3TA 1BIUA 1NK5A 4JS4A 3QNNA 3HO1A 1FK9A 2ASDA 3OL6A 3ZSWA 5KG6A 1JX4A 1GOAA 2BR0A 3VQ5A 3WNEA 3SV3A 3HT3A 4WYWA 1UOCA 4CJUA 1RT7B 5KFTA 3UQSA 4R0EA 3VQ7A 4DTXA 1TL1A 3V6DB 2DPIA 3NGIA 4I7FB 1LW0B 3S3MA 4NLYA 1LWFB 4YFUA 1HNIA 2OPPA 4KHNA 3RMBA 3GQCA 4J9OA 1NKCA 2EX3A 3DM2B 4DTMA 1UWBB 3EPGA 4Z4HA 5KT3A 5DGBA 3BSOA 2QK9A 3IGNA 1HNIB 4C8NA 4NLXA 1X1PA 3DYAB 4KTZA 3AVGA 4IKAA 2FBXA 3MR3A 1S48A 2DFFA 1NJXA 4KV8A 4CIEA 4IQXA 4Q8EA 4FJ8A 4DU3A 3PY8A 2V4QA 3DLKA 4CEFA 4CJPA 3DLEA 3RR7A 3V6HA 4CGHA 1BQMA 3HHKA 4CGGA 4NLUA 2HVIA 2AU0A 3V9XA 2C22A 1RT7A 1S1XB 1WAJA 1XHZA 1U49A 3OYFA 5KG1A 3SCXA 1RNHA 4KTQA 1C1CB 4URSA 3NDKA 3V6KA 3H5SA 3VQCA 5C24A 4ECTA 5EWEA 1LWEB 3QO9A 4M41A 1JLBB 3KLFA 4ZVEA 4G1QB 1ZBHA 3HVTA 2VWJA 5C42A 1RT3B 5F8MA 4K8XA 5D3GB 4KAIA 3PO4A 1SH3A 3MEGA 4BE0A 3IS9B 2IJFA 4WYLA 4TXSA 1IKXA 2HHVA 2HNYA 4X2BA 3PV8A 3C94A 1EETA 2BANB 4O44B 4W5TA 4DU4A 2HAIA 3ZSRA 4FLXA 3RAXA 3CIZA 5JXSA 3G86A 3UIQA 4KTWA 4F3OA 3PZPA 4E1MA 2AX0A 1T8EA 1IKVA 1SH2A 4I9QA 3AO4A 1JL1A 4DLGA 2YNHA 3B6PA 4I2QA 1WSFA 4DL3A 1RDCA 2O5DA 4YR2A 4DU1A 3QLHA 3OHAA 5CY4A 1C0MA 4AHSA 1O1WA 3SUNA 2DPJA 4ZP7A 4CGDA 3BR9A 1B9DA 3KD1E 3KNAA 3KKRA 4ZVGA 1RDBA 4DF8A 4NLOA 1KLNA 3QGIA 4U7CA 4C8KA 3M9OB 4BWMA 3CM5A 4KI4A 1VSKA 4KB7A 2BGGA 2RKIB 4EYIB 2VG7A 1T94A 2FC0A 1VSHA 5F9LA 4Y2AA 3KHHA 3CFPA 4OJRA 4Q44A 4RZRA 4Q5VA 1HQEA 2XI2A 3BSNA 5SWMA 3OLBA 1JLQA 3TAQA 5KFPA 3OS0A 4IDKB 4Y1DA 3N6LA 4BWJA 1REVB 4DL7A 2YNHB 2YNGA 4OKJA 5EDWA 4R8UB 1QSYA 3IN5A 2IA6A 2V9WA 4JUZA 3V1RA 2XI3A 1KHWA 5K14A 1XR7A 4FLTA 3IG1A 3DI6B 4KI6A 4RNMA 4ED1A 2E4LA 3OJUA 1R0AB 3G6XA 1RA6A 4KFBA 2KW4A 2P1JA 1OS5A 1ZTTA 4HVJA 2I5JB 4UQGA 5CYQB 3M8RA 2HNYB 4Q0BA 3KK2B 3OYEA 2WK4A 5HRSA 3S3OA 1HPZA 3NH1A 4TSXA 1ZBFA 1CZBA 5KFWA 1EP4B 5CYMB 2UVUA 3FFIB 1JLEB 4QPXA 4FW2A 1TKDA 3RMCA 3CWJA 2IM3A 4CJ4A 4CECA 5KFQA 2V4RA 1DLOA 3RB3A 1MU2A 3DMJB 4MQ3A 1REVA 1JLEA 3OYAA 4CGFA 4OKKA 4OPKA 4IR9A 3OYJA 1SL0A 5J2QB 3QEXA 4LSNA 3HPGA 3AVHA 5DMRA 1L3TA 4ECSA 1RBRA 4FJHA 2I1RA 3P83D 4OLBA 2DFEA 2YNFA 4CERA 4FM1A 1XI1A 2F8TA 3NFAA 3DLBA 2OPRA 5CZ2A 1VSFA 1HNVB 1BQNB 2RN2A 3CYMA 3D5MA 1J53A 5J2MB 2UUTA 5J1EB 4M3ZA 3MFHA 3MR5A 3EY1A 3KLHA 2R2TA 2Z1HA 2JEGA 4R8UA 4TY9A 1N4LA 1NHVA 2YNGB 5HROA 2HB5A 1CZ9A 2FVRA 1KSPA 3WNFA 3T3FA 2ATQA 3AA5X 2W9CB 4ED7A 1VSLA 4N5SA 4B9SA 4Y3CA 3V4IB 1SL2A 3IRXA 1TL1B 1WSEA 4RW8B 4FK2A 1S9GA 4JRQA 4ID5A 5KFYA 2Z1JA 3KIOA 1Q9XA 4CK2A 5C25A 4KHQA 1BI4A 4TYBA 2D0BA 4KREA 1GOCA 1TQLA 2HWIA 1CLQA 3I0SB 3HVTB 4CE9A 1LWCA 3QINA 4Z0UA 3PR4A 3NF9A 1RBUA 4FS2A 4ECRA 3C95A 5J2QA 4BDZA 3DLGA 2AX1A 4NCGB 1S4FA 1K6YA
chains in the Genus database with same CATH superfamily
1HYSB 5D4LA 1KLMB 1HWJA 3I9ZA 1J27A 5C7PA 1YIJS 3VENA 2QSFA 3KHLA 2I9SA 3ZT3A 1T9VA 4KHMA 1L3SA 1VHXA 3HI9A 3UCZP 3ENQA 4NEYA 3PW4A 1PC4A 4WE1A 4YOUA 5KFMA 3UKUA 4OO1J 3TAGA 3I6PA 4O8KA 3SJJA 1ZOTA 2AJ0A 1NGDA 3NWRA 4B3RJ 4M7YA 5LXRA 3VEZA 2HKEA 2Y0SD 1FXLA 2CGJA 3ZETA 2PYLA 2QA4S 1BQMB 2XCAA 2Y3YA 2UV8A 4NZ6A 2DY1A 3J80Y 3CDWA 2XMAA 1GEHA 3OQ2A 4CJKA 5KFXA 4PYAA 2YY3A 2DO0A 2R8GA 2ZE2B 1RA7A 2IC3B 3QMQA 4FNHA 1LWXA 3HX9A 2HG4A 2GJFA 1VQ4N 4IDHA 2VBXA 5AQKA 2VJUA 4J9PA 1VIOA 3IC1A 2ZBPA 5IT0A 4ICLB 3A3NB 2JEJA 2NNWA 5B0BA 1S6UA 1NGFA 2YWFA 2UVWA 1TELA 1S1WA 1TFWA 1S0NA 4NPOA 1IJFB 4FKYA 2ZE2A 3NCPA 2XMMA 2B3TB 4M95A 3RZAA 3FCWA 3THXA 3A2FA 1TV6B 1A0OB 1KC8T 5LJVA 4CK3A 3DDNA 4KHWA 2WRMA 1TKTA 1YHQS 4WF9Q 5C12A 3GBTA 3KWMA 4M42A 3Q2SC 1C0TA 4B1UB 2E5HA 4EU0A 2KXHA 3F41A 1EWQA 4B3SJ 4J2BA 1WDTA 2UXBJ 1WEYA 3DU6A 4DX5A 2K3IA 4TU7A 2G8IA 3WX4A 2WSFC 3MAAA 4B3RF 3ZSXA 1TKTB 4Y2IA 4U9RA 1QQCA 2VHGA 3VQ8A 2NSCA 4X84A 5KPZA 5IFMA 1VBZA 2P9IA 4FDFA 1IBKK 3D1HA 2HW3A 4FPRA 4DSLA 2AYMA 4ISFA 5KAKA 2HSTA 4AT1B 1AUSL 1Y00A 1XMQJ 1NSKL 1ITGA 2ASYA 1WBDA 3OVSA 1KQGB 3T7ZA 3W9JA 4PA1A 3H7HB 1J5EF 3CCUS 3FKBA 3D6HB 2X74A 1S5JA 3ZCMA 4JI7J 3VGTA 2B4UA 3NMRA 3H45C 3DRPA 4QR2A 3TYTA 1N48A 4LRBA 3CMAN 3VQAA 2BKOA 3W5ZA 3FZLA 3SIPB 2RPIA 1IN0A 1XEZA 5BRHA 1YTYA 1EKEA 4LFBJ 2FB0A 4W5NA 5IOLA 4C8LA 2HVEA 4C1NK 1Q79A 3I5BA 3DRRA 4Y1CA 4F4ZA 1I94F 3VGUA 5CCLA 3CCLN 3CD6S 4CZEA 1NEEA 2HS0A 2HRUA 4B3TF 4FYYB 4DQPA 2JZ5A 3W61A 1IBCB 1XBWA 4ZIVA 3M6UA 2KQ2A 1PBAA 4H03B 3K5NA 4JI8J 5U47A 3R5GA 1DT9A 2GQ2A 4M5KA 2ZZTA 1YK9A 3M9NB 4FWQA 1D9AA 4WK1A 1OSCA 3AO3A 4JP8A 1NDKA 4KGXB 1X0PA 3JS9A 1KVCA 2E5LK 4CLPA 4RU9A 3DHWC 5HK4A 5J1EA 3MXJA 3D2EA 3NCRA 4LFAJ 3D6TB 1BHLA 1XQIA 1Q7LB 2YBVA 3FBBA 2GEMA 2EK1A 3EXCX 2W01A 3IBCB 1HRHA 3Q8VA 3JS6A 2NLWA 4C7QA 3I9V9 4DSKA 3Q0AA 2PDAA 1SV5B 4HACB 4TY8B 5B0EA 4UUXA 1ITPA 1IBLJ 3P3DA 4P2SA 2HNZB 5ADXH 2I0XA 4G1PA 3LA0A 4ECYA 4NXNK 1HD0A 1R43A 2XYHB 3U1NA 3PVXA 3VWSA 1JLCB 2BM1A 4R5PA 4ID5B 3CCQS 4WFAL 3AVLA 3OUYA 4A8MP 4BY9C 3Q89A 5KOXA 3NOCA 1EKSA 2VQEF 6FDRA 2R9LA 1YJNS 1FWPA 4ES1A 4BE2A 3PFOA 3DLLQ 4PQUA 4U8YA 3OYHA 4JV5K 4GVBA 3U27A 4PWDB 4OPHA 4XH1A 3MCMA 2Z57B 4K4SA 4ER8A 2GUPA 4CLUA 4DFPA 3K9JA 4IOCL 1RDAA 1FHTA 4OYAA 4JI5K 4WQ5C 3DGVA 4IFEA 3W2VA 4DTNA 4QQBA 4N8NA 3HSTB 3LGHA 3SXLA 4W92B 1WC6A 4XO0A 2ERRA 4FJ9A 3B8AX 2WONA 4N47A 2HBZB 1NLKL 4LFAF 1E3MA 1FEHA 2XC9A 4DV2J 4JK9A 4OQJA 1ZC6A 2MKHA 5FJ4A 3GYGA 4N56A 3EE3A 1KKHA 2O1PA 3FQKA 4IOAQ 2ZJQQ 3OLAA 3BBCA 3VR1A 2J7WA 1LW2A 3M2VA 3MMVA 4E1NA 3VAMA 1IM4A 1ZH5A 5JVHL 4FJ7A 1QAIA 4KHRA 4CF2A 2WVFA 4B1XB 3CCSN 5KT7A 4WFBL 4X64F 1NHUA 3FDSA 4XDDA 3SMPA 1GXUA 3N5FA 4ZOSA 5GAEI 3V9ZA 4CEOA 4L72B 4BR5A 5GAEP 4GC7A 3LPYA 2E5LF 1UW4A 1GLBG 3MECB 2DK2A 4I64A 4CESA 2M4MA 3N6MA 4LBPA 2OZSA 3AT1B 5TKYA 5AJ3F 3CMEN 1HQUA 1YITS 2DR7A 4MH8A 2HWHA 1CXQA 4JI1K 1GMVA 3AO1A 3HKWA 4JI5F 4HHJA 1RT6A 4QYRA 3PRVA 2CPDA 2DISA 3D3BJ 4U8VA 4TVAB 3D7SB 2XNQA 2WHOA 3S7RA 3CD7A 3VQ9A 2ZD1B 1IO2A 5AXKA 1HPMA 1SQFA 2IDOA 4UY8O 3O3LA 2QM1A 3LP1A 2BE7D 1KOOA 3PJWA 3BJYA 3H6EA 5L9XA 2IVMA 1XNQJ 2HSEB 2PFUA 1TKXA 1BA1A 1D8YA 3W2WB 3Q8RB 2LEPA 1Z25A 2VG6A 3V5RA 3OS2A 4N41A 1HLUA 4JKCA 2CQ1A 2DNLA 1GLAG 3M8QB 2ZH1A 3GG1A 5F1XA 3ZZZA 5E3CA 4RJVA 3CPWM 4LF7F 3QJLA 2IRYA 2RF2B 3TAFA 1BXNA 4UZCA 4DR4F 4FZYA 4JI6F 3ZT0A 2GUIA 2YPZA 2GVDA 4MKAA 2WBNA 2XCPA 1R0AA 2MDAA 1Q8LA 4FZXC 4Z4EA 2V5HG 1QZ6A 4JI7K 2NZCA 3MAHA 5K14B 4N76A 3UD3P 5HMYA 1RT5A 5K8PA 1HBMB 2C2DA 5GMKa 5AZIA 4HDGA 2WUSA 2CZVC 5I3UB 2V4JA 3GIJA 1NU4A 1DFDA 4DR6K 2CZ4A 1SJQA 4J9RA 4PG7A 2BABA 2W24A 1U1MA 1ZBIA 3KWIA 5HOOA 1FKPB 2K3KA 3HXMA 4IBNA 1D9DA 1DLOB 3M32B 5CABA 2KT5A 3TRGA 5AQOA 4JD2B 4AM6A 3ENOA 3QT5A 2ILZA 2M9KA 1EKRA 4LFCF 1YX2A 4YOYA 3WNHA 2OYQA 3AVCA 4M3YA 3QEIA 4X65F 2KO1A 3KK2A 3SLCA 2GMLA 1QVGM 5HL7Q 1S1TB 1PG5B 3DDKA 5D0RA 2P9UB 2FHJA 3C16A 3VQ4A 4USIA 2QGFB 2G2OA 4WFYA 3BF3A 3VALA 5A76A 4FYWB 2VG5B 2B56A 3NAEA 3NAIA 3EO3A 2YHXA 3CCJS 4OI3A 4TQRA 2HIYA 5JLFA 3SSQA 4WP9A 2UU9J 3KLGB 1TAQA 3ZNJ1 2XZWA 5FRMA 3UN5A 3LP2A 1H6KX 1FDDA 1WWHA 4NXMF 2LMIA 4OX9F 5C24B 5E3RA 5M1OA 4ZJOA 4L76A 3LQVA 1U45A 4J2AA 5H9EK 4ZTJA 4PWWA 3TR5A 4AHCA 2QL7B 3ZT1A 3MEEB 2QJ3A 2FY1A 4L3NA 1EAYC 1QVFR 3B8HA 1S6QB 4AHVA 4DS4A 1IM6A 4F3MA 1X31C 3PLAA 5KPTA 3CC2S 1MMLA 5AQTA 5GVQA 2QIFA 2QWPA 1BU6O 3ZSYA 2QSWA 3AAQA 4LF9J 3OV7A 3KUEA 4DEZA 2BA9A 5IT4A 1TL4A 2YWEA 4NXMK 1DURA 2XY7A 5AQIA 4AF1A 3KK1B 4FW1A 3VQBA 3W63A 2EI5A 1S79A 1IG9A 3OS1A 2X1AA 2YV0X 3MEGB 2ALZA 4WXOA 2E1RA 3IUCA 2C3YA 3KZBA 2YKQA 1YT3A 4DSIA 4CM2A 2DBBA 1I1GA 1FRMA 2W9BA 3CO9A 5B0AA 3BPDA 3OBWA 1VRQC 1FX2A 4LF5K 2R2UA 5BN8A 4DB3A 4FLZA 3IDHA 4F4YA 1O13A 3POTB 2E44A 2VA2A 3MTKA 1V4TA 2P9CA 2O8DB 1ZBUA 2XZDB 2YX6A 4IEIA 2D69A 2FPHX 2Q66A 5KFIA 3ULEA 5KFOA 4OX7A 1K73T 5F8JA 2G0IA 1QTNB 1WC1A 2XMJA 4KYZA 2H5EA 3A8KA 3DDIA 1L3KA 2AZ1A 2MZRA 3M8WA 3KLEA 5IM0B 1NGAA 1H7WA 3K9KA 3QLHB 3BGFA 2ZOMA 3ZZYA 1GFWB 2OPQB 2YQ3A 1NDCA 4HUFA 1C0GA 3MM5B 3PYGA 2VQEJ 5FPMA 2BUNA 3Q8QB 4QR0A 5C0YA 1F0XA 4JI7F 2EFPA 4ZPWR 2ZC3A 3CMQA 4C6AA 3OYNA 5J2MA 2MLYA 1ZTWA 2WVCA 3QIDA 4O3RA 5B0DA 2CJ9A 4EUVA 4CD3A 3R7BB 1IVZA 4CO0A 3ITHB 4DV7F 4DV5J 3T6BA 1RU2A 3LUYA 1VQ4S 1U7LA 3RAMA 5JVHQ 4J9LA 4JI4J 3EZ5A 2V0NA 4MDAA 1WOQA 5ETKA 3G8SA 2HNZA 1JJ4A 3MZIA 4JYAF 4CGIA 4GVLA 5FPNA 3WXJA 3LAKA 4YR0A 5A2QY 4OYIA 1X9SA 4M5DB 3PX6A 2D4WA 3HSJA 3MWBA 3BO4A 4EFHA 1KRPA 5KFHA 3BEGB 4I6WA 4X4NA 2Q31A 5GAHI 3LPTA 4ANDA 5BN9A 4DUZK 4TYAA 4LMZA 3NG8A 4NOHA 3VQPA 3OXFA 3PFEA 4I2PB 2CQ3A 1WOOA 3T1YJ 1HBOA 4NLWA 1XWLA 3O1LA 4HYKA 3MMAA 4DSFA 4JI2F 3NLCA 4CO1A 3CJBA 1GLEG 1JNRB 3HL8A 4LF4F 5FIIA 2GV9A 2FC8A 2FLOA 1HKCA 2IM2A 4F0KA 2H54B 4J37A 5KT2A 4GV9A 1YIJN 4O3NA 2C1EB 1VSJA 1AROP 3RMAA 4DQIA 1P8ZA 1V3SA 5T7BA 4WCEL 3L09A 3FSIA 3CCES 4D3GA 4QOTA 1MWYA 4CZIA 1WORA 3RAQA 3TQ1A 3PIOQ 4ED0A 1CJVA 1H74A 1JCFA 1JLGA 5HROB 3OSPA 3TABA 3VHQA 3LP3A 3FGUA 3NS7B 1NSQA 3ZNUA 3NHGA 2PO4A 3O08A 1HNXK 1MDUB 1NNEA 2WTFA 5E41A 5EWFA 3U6FA 2Y1JA 3NNCA 3OYDA 3TANA 4BGAA 4DV3F 1YBUA 2ACMA 3CFOA 2ZGYA 5AZJB 3AA3A 1UFWA 3UKRA 4EHUA 3Q8PB 4AQYF 1TMJA 2UUBK 4ZS6A 2KN4A 3PNIA 4MK7A 3J8AA 1AXQA 3DMJA 2E6MA 1F9EB 1UA1A 3ZZ0A 3BGRB 2OP5A 1S3XA 5HJYA 1HYSA 3D2WA 3EDRB 2R8KA 1HA1A 3P49B 3TU5A 1MROA 4DQSA 3C8YA 1EZZB 3SUPA 4UW2A 2NRHA 4ZVRB 3MCNA 4DLEA 2QI2A 5K9FA 4RW7B 3OBIA 3QBWA 4B9TA 1GMWD 5DETA 2OEMA 1I39A 3OVAA 3T19A 1QHAA 2IPOB 3TZXA 3O8WA 3ZSZA 1VQNS 3LO3A 2YCHA 1FVQA 3DYAA 1X9WA 8RUCA 2RJZA 2F4VF 4LRFA 3HRGA 1RWOB 2CJKA 1WG4A 3WC0A 3HM9A 1VS3A 3TO8A 3QAEA 1XMQK 4FJGA 2QKBA 4W90B 2VGMA 4RNOA 4B3TJ 4BREA 3VA3A 2HHQA 2ZJRQ 1HNWK 2IVYA 2A1SA 4ED8A 1Y9OA 1S1UB 1VQLS 1O8BA 3DGPB 4DFMA 2RRNA 3NGZA 3LGNA 2WOMB 3PACA 3EJMA 2ROEA 5F8HA 3RWUA 2R7YA 4BC3A 1ZBSA 2WC9A 2WSEC 3CIMA 3CJAA 5M2PA 4HR2A 1BDGA 1UVIA 1NLVA 1Y5LB 3BQ2A 3F9MA 5M2RA 2VV5A 4FWNA 2ALYB 2JWKA 4CJEA 2RRBA 2ZJQL 4UQTA 3UCUP 2XS7A 4DN9A 3OYMA 4PYDA 1UVMA 3GTYX 4O4RA 1SV5A 1RBAA 2QV6A 4E8UA 1UMJA 4QIGA 3R6MA 3PYEA 3OT9A 5AXMA 4OX9K 2MJUA 1RYSA 1FDNA 1IBKJ 1OWXA 4ES3A 4WF9L 2AYGA 1Q8BA 2KI2A 3D66A 2R7OA 2K06A 4BRAA 1TAUA 3NWGA 4B1YB 1MA9B 2B9YA 4WZQA 2FJDB 4IOCQ 2LQJA 2DH7A 3PRBA 4OZLA 1WHYA 1I51B 1YJTA 1S6PB 3I55S 3IG1B 5JS2A 2OHDA 3SQ1A 1A5WA 4DN0A 1PCAA 1A9NB 4PQAA 4DF4A 3NGKA 4WFAQ 3PKYA 2WSCC 1W97L 1HBNB 3KLFB 3DRSA 4F4KA 3SDEA 3FBCA 3A8IA 1NGCA 2DTUA 4DPYA 1C1CA 1M90T 3PUFA 4ZPAA 2HLUA 2KT3A 4QR1A 1DTTA 1RWKB 5LMNF 4K5SA 4ZN3A 1Z05A 2D3O1 1ELOA 3TX0A 3L3UA 3PJ9A 1NSAA 3CD0A 4X65J 3BH7B 4CZKA 1E4GT 1EXQA 2LU1A 3PW7A 2CKWA 3NY0A 2PSZA 3RTVA 2R7VA 2A40A 4A5AA 1SAZA 5L8RC 4Q2LA 1GQEA 4OLPA 2GJ2A 4KB0A 2FVCA 3J81O 4H4OA 3QWPA 2DNMA 3ULHA 1SJFA 2Z2LA 1SKSA 3O3FA 2CNLB 3THYA 2G9OA 2O8CA 4W5QA 2X1FA 4H4KA 2R3VA 4O3OA 5AJ3J 2B7CB 2EKNA 3ENHA 3NKYA 1XNRK 1VMBA 2GZOA 2E1MC 1YJUA 2O01C 3V9UA 4E98A 5DQGA 3DOLA 3TAEA 4U7BA 1IKYA 4AD6A 1HNWF 3I0RA 4RW9A 2Q3PA 3U8XA 1RTDB 3ULDA 1K0VA 4URGA 4HI1A 2VQFJ 2EBGA 3W8PA 4BRFA 2UXCJ 2O4GA 3EGVA 5LSRA 1U6FA 2ZF5O 4LF6K 1NOYA 2HURA 1B0PA 1XMOJ 2L9WA 3DLRA 2HQGA 3VV2B 2YWKA 3G10A 3AA9A 4PWUA 5MLCQ 2R7UA 3NGYA 1PYTA 2FBVA 4OZ1A 3KG1A 1RTHA 1JJ2R 3P31A 1WF1A 4JI1F 3ILIA 4EEYA 5D6GA 1TKZB 2HK2A 5BR8K 2HZVA 3U4LA 4B02A 3HD1A 3MPWA 4DU7A 2A41A 5DLGA 2OPPB 1Y5IB 4CHQA 2L41A 4LR7A 1PAUB 2V34A 3DNCA 4PWDA 5GAGU 2DGUA 4CD1A 3OUYB 1NH7A 1UEKA 2EFOA 3MEDA 4OYZA 3VCDA 4LF8F 2DHSA 1X9JA 4K4WA 3F2KA 3BN4A 4AILC 4CZCA 3P45B 1KQSM 3EYZA 4NCBA 4G6VB 4DV0J 1N5TA 3AOAA 3MM8A 1EO1A 2DR5A 4WIQA 3ATVA 3W9IA 2DNPA 2QA1A 2VL1A 4F67A 3WZ0A 4ZHRA 4LF1A 5AQYA 4M5IA 2HMIA 3VVUA 1J5OA 3L95X 4LF5J 3DI6A 3IGVA 1Q82T 1MMNA 2FJVA 2J8SA 1PGZA 5D15A 4MKYA 3IR6B 3SQ4A 4M5NA 3GSIA 2FBYA 1TUYA 3G71N 1PC5A 4DV7J 3PW5A 4JN4A 3NXZA 4F25A 3P39A 4YDXA 1IKXB 1BL3A 1OY8A 1V3ZA 1V3RA 3ZEUB 2V2KA 4GVEA 1VRUA 1KP6A 2JEFA 4AHTA 1NK5A 1BIUA 4JS4A 3QNNA 3D1OA 2ASDA 1VGYA 3HZEA 4GKJK 1BD6A 3X3UA 4YB5A 4NA3A 1GMWA 1N52B 2DR9A 1RLDA 4QU7A 4LF8J 2H5IB 4CJUA 1FRHA 1BLUA 3UQSA 4R0EA 3VQ7A 4CZMA 3G25A 3NGIA 4I7FB 3KYLA 1RP5A 3S3MA 5E2QA 3OTCA 1HNIA 4ZA1A 4X62K 1NKCA 4DPOA 2EX3A 4DTMA 3EPGA 1M1KO 3IGNA 4CZJA 4C8NA 4ZVQB 3MN9A 3TUZC 1NJXA 2DFFA 4CYUB 5HMXA 4IQXA 3UDEA 2V4QA 1RTZA 5BRDA 2F65A 2B4OA 4JNEA 5F0XA 3DLEA 3RR7A 2E5IA 3V6HA 4CGHA 2HPUA 3HHKA 4NLUA 2AEMA 1YQHA 2A6OA 2OUGA 1WAJA 2XLJA 3SCXA 2BW7A 2CQPA 1RNHA 4PAAA 4URSA 4OJ1A 3H5SA 3A5MC 1YJRA 3VQCA 4BRPA 2PE8A 4ZVEA 3AXKA 3T9ZA 2G2YA 5A8WB 4H5TA 4B3TK 1F3FA 1RT3B 2ZUGA 4KH6A 4DHYA 3TZYA 3MEGA 3KKFA 3T1HF 3EN9A 3J81Y 2HNYA 3ENVA 3PV8A 4X2BA 3SAGA 4CYUA 2F9JA 4PR6A 1N8RO 2BANB 4DUTA 3W2VB 2HAIA 4FLXA 3TSQA 2MEWA 2HBMA 4I0WA 2MZSA 3BKTA 5H1SV 2HGLA 1IXKA 3MPUB 2B51A 3US5A 1KWMA 2AX0A 1XN9A 1IKVA 1T8EA 1T3VA 4USWA 3AO4A 4DLGA 2CQBA 3RJMB 1RI7A 1P27B 1T3OA 4DL3A 4DU1A 4NX9A 4A62A 1CG2A 3HD2A 1O1WA 4CGDA 2CFXA 4ZVSB 1X5OA 2B9XA 1RDBA 1F5CA 2VU5A 3BYPA 1NRKA 2VDIA 3R97A 3CJCA 2DNQA 4KI4A 1BG3A 3TA2A 1VSKA 4N7TA 2FQQB 3UD5A 2BGGA 1NMDA 2RKIB 3A5NC 1NCLA 1FJGJ 3L7OA 1TU0B 4FPBA 4B1WB 4Q44A 4JI0K 4FPAA 5KQDA 2DNYA 2XI2A 1NB7A 1IG8A 3J7AP 2CQ2A 4FXVA 5DM6L 1A7GE 5KFPA 4DCOB 1SC4B 4WQ4A 4USHA 1CJUA 1FJGK 2QLFB 5EDWA 1FDBA 2RB7A 2ZH9A 4LF9F 5K14A 3IG1A 1XNRJ 4KI6A 2J7KA 2BUPA 1R0AB 4NASA 1N36K 3S8SA 2HRTA 4KFBA 1VI7A 2GVZB 3PIOL 1ZTTA 4OHWA 3M8RA 3JTNA 2BJEA 3S3OA 4ANCA 1MWQA 3EKSA 2F63A 4TSXA 1ZBFA 3MD3A 2CIMA 5KFWA 3BR8A 1NGEA 2C2KB 3F44A 5CYMB 1I94K 3FFIB 4MLEA 4ZN1A 1N5VA 2HK3A 1TKDA 1DLOA 1MU2A 4MQ3A 3G2XA 2EG1A 4CGFA 5GAHP 4OPKA 1Q78A 3OYJA 4I1TA 3QEXA 5D78A 2L9NA 4LSNA 3R9PA 3IP0A 3G4SN 1L3TA 2RS2A 4FJHA 2CAJA 4U7UD 2PI5A 1VQSA 1QVFM 2F8TA 1CULB 3M1VA 2Q0RA 2OPRA 5CZ2A 1VSFA 4OZJA 2ZITA 3ZZRA 1UFLA 2RN2A 2AZ3A 1K44A 1AW0A 1RAGB 2M3DA 1I3OB 2VPYB 3MR5A 4Q7AA 2RD5C 5HSPA 5ETMA 1RU1A 1K73O 1Q5YA 2Q0UA 4TY9A 1NHVA 4U67Q 5HROA 4EI2A 3M30B 2HB5A 2FVRA 1KVKA 5IWAK 3O4WA 3WNFA 2CNNB 1IBMF 3AA5X 3BGUA 3IR7B 4DV6J 4Y3CA 4DBQA 2N3OA 2VPZB 3D1QA 4DR2F 4RW8B 5DDRC 1N8RT 1YRTA 4NL5A 1Q9XA 5KFYA 4M5DA 3AAPA 1X60A 2B4VA 4U7UK 2P9LB 2E29A 5RUBA 3UN3A 1BI4A 5G4DA 2A2CA 3OVBA 2YKOA 4OZ2A 1CLQA 4NMXA 1DEJA 3HVTB 5HQMA 1MLAA 3QINA 4BRNA 3PXGa 4AFFA 3TP2A 1U2RA 1RBUA 1SC6A 2AX1A 4NCGB 5A8RB 2WW4A 1VQMS 4KSEB 5IC4B 3TSUA 4JKFA 3G96A 3LH2S 3DU5A 4C3KA 4HDHA 1H2VZ 1U6ZA 3PW2A 3OYKA 4H5NA 4LSZB 4CLKA 3MM6B 3KXDA 4FVUA 1VSIA 3T1YF 3G6EN 3AA2A 4CLWA 1NK4A 1AUDA 2ZM6F 1JKHB 1S7HA 5H9EJ 4Q45A 3I5AA 5C42B 2I6WA 1M5HA 4XEIA 4DX7A 2AW0A 2LFVA 2EFQA 1F2HA 5F8NA 3M2RA 3ZSVA 4HUGA 3OHRA 3SNNA 4C23A 3K5MA 3TW0A 2BVZA 4H4MA 2DRBA 2QWQA 2GWJA 3L0QA 3IKMA 5KFCA 3PTWA 1TTHB 2DNZA 5AJ3K 3LP2B 1HD1A 3H2UB 2ZM6K 4OMFG 3GB0A 4V19S 3GJSB 4Z7YA 2YWWA 3O5TB 3FRYA 2AGQA 5IWAJ 3QDKA 1S1VB 3D3CJ 4YR3A 2J9DA 2MKKA 2HZAA 3U02A 2GC8A 4FWMA 5CH7B 2HQ3A 4ECWA 4EZ9A 2WBMA 3RR8A 1FERA 1UW9A 2VPXB 5HRNA 2GWKA 3TZWA 3N28A 2HHUA 2W7AA 2JRSA 2RS8A 3KVGA 2V2QA 1G4CA 1JMTA 5A6WA 3D0GE 1B9FA 3Q7BA 1RHRB 3MR7A 4B9VA 2FUG9 5ETRA 1C0UB 1CC8A 4M3XA 3TUJC 2YHWA 3QGPA 4Z4FA 4KRFA 4IZ9A 2IYGA 1C1AA 4J9SA 3O9TA 4CZLA 2FLPA 3KJVA 2F4FA 2EWHA 3NCIA 1HX1A 4RKUC 4P52A 1EWRA 1VRUB 3HFZB 1RHJB 1J2VA 4EP4A 4CIFA 4ED3A 4MFBA 4QWAA 2RT3A 2V7ZA 1V6HA 1XTZA 2A0FB 1WG5A 4DR7K 3U9DA 1PJ5A 1U48A 1Y3JA 2DH9A 3K2PA 1S57A 4WU2A 1T9YA 2HFNA 3QO9B 1S5ZA 2DJWA 3KHRA 4X4OA 3V81B 3FLCO 1ATNA 1OSDA 3H42A 4F02A 3ZSOA 1VQ8N 4A48A 3K5OA 1VBXA 3P8BB 2ROGA 5F41A 3T5JA 1ZPWX 4K25A 2QL9B 3VQSA 2AYEA 1P9QC 1NO8A 1ZZNA 3U1LA 2PYJA 3MM5A 3OW2R 1ILYA 2QE5A 1VSDA 4DR6J 3F9KA 4W98A 3GDQA 1WF0A 3GG4A 1X4EA 3JQKA 4DDFA 4DQ8A 4AQYK 1UWAA 2V7YA 1D5AA 1HYVA 4MYUA 2DHXA 1T7PA 4A8XA 4I7FA 2NRZA 2QKKA 3R5DA 4GW6A 4BRHA 3CETA 2HS4A 2DRAA 3U3GA 4BROA 4DSJA 2UUAF 2JX2A 2G8FA 1GTHA 3VEYA 2P9PB 2PIIA 1URRA 4CJFA 2IJNA 3L8BA 1S0OA 3MAAB 2P9SB 2RHQB 3KDOA 5F8LA 4HH0A 1V4SA 1FJGF 1WAFA 3KG4A 1ASVA 1T11A 1UETA 1RAAB 2HF4A 3CPEA 3MK6A 4CHYA 2D3UA 4ED6A 2D3OR 4JI0F 3W9HA 3GIIA 4OLAA 3W64A 4WJBA 4UY85 2HF3A 1XNQK 4WIIA 5AXNA 1KS2A 2H9ZA 2NS1B 1RTIA 3O9RA 5IQQA 2MGZB 3CF5L 4W5OA 3GIMA 4KBIA 4H4OB 1WG1A 4P9SA 5DZ6A 4IYQA 1MN9A 4MK8A 1VSMA 2J4RA 2JJ4D 3MHYA 3ZT2A 2KVIA 3NF8A 1OYDA 4K43A 2QX0A 5IV3A 3MN5A 2IMOA 4CEQA 2E1CA 3NGTA 5C2GA 1CLFA 2WB1D 4PCQA 5LM7E 3L4BC 3O6QA 3C6TB 1ATRA 1LK5A 1HJOA 4A59A 4KHPK 4ETXA 2MPUA 3CCZA 3THWA 1SUQA 1S1UA 4NB4A 3B82A 2V2ZA 3Q24A 1SC1B 2HNDA 2CYYA 4FCYA 2RDJA 5CR4A 2ZH5A 4ID8A 1DQ8A 4CEAA 3GCXP 1SS6A 5DS7A 4CF9A 3PW0A 2G8WA 1JKHA 4ILMA 2LYVA 4M45A 3MM7B 3HOSA 2D1KA 1ESVA 3NMUA 3GE9A 4DPUA 1YUWA 3FVYA 2IRXA 2DH8A 4EBEA 4CEBA 2OPSB 1Q16B 2LXUA 4IFYA 1Q7YT 2HVHA 1M5PC 1B0TA 2DY9A 3VA0A 3ISND 1EHWA 2IY5B 2N4DA 5AQGA 3RB6A 3T5KA 1Y3KA 3DLGB 4CW7B 4WBFA 1X9MA 3D7EO 1FF2A 3HHNB 1A5XA 4U67L 4ZP6A 3CIPA 1FK9B 1W7AA 5AQXA 1DQ9A 1WNSA 4FF2A 2M8HA 3X1LB 1VBYA 5B7WA 4HTUA 1SQEA 5T7LA 4BDPA 4DU8A 2XULA 5HL7L 2O8FA 2UYTA 4X66K 3TTFA 4YY3J 2A18A 2FZGB 2WBRA 3QIPB 2ZWOA 4DR5K 2ZC4A 5MLCV 3FEZA 1MWMA 5FLXU 2G4BA 2BZ2A 2ACYA 2KM8B 3DLLL 3HKZD 3TUIC 3P1GA 3MM8B 3WXLA 1UKUA 1S10A 1WJ9A 3E01B 2DNRA 2LCWA 5D4PA 3MM9A 1ASWA 3KWGA 1ZETA 5C10A 1HIYA 2NLXA 3CDAA 4ZPCA 3CDUA 2DB1A 3H0PA 2PC6A 1TYQB 2FVSA 3MXHP 2NXJA 1PBUA 1YZ7A 2IA0A 4BRMA 3UB5A 3HJFA 4L8RB 3TOQA 3C6TA 1TMMA 3GFYA 1TK5A 2FJEB 2IBOA 3MN7A 2F8SA 3BBBA 5KG0A 4IO9L 3EPIA 3QGHA 1QHTA 3ZTRA 4Z4IA 2YJEA 3SSSA 1SKUB 2IDLA 3KK7A 4P7VA 4IQMA 1FD8A 4FLWA 3TUPA 4AYBD 2KLAA 3Q86A 2APOA 3TZZA 3UO0A 2QW9A 3E01A 3K57A 4YORA 8AT1B 2A3ZA 3Q8UA 2VWBA 2LDIA 2GJIA 4DR3K 2UXCK 3L2UA 1U02A 2P9IB 2BE2A 5IT9Y 2FBTA 3PSFA 5C2FA 3HT0A 4RWXA 5I3PA 1GX6A 3TVYA 5KFGA 2O3DA 3CC7N 2E66A 4KH5A 1M5KC 1RBOB 3LWLA 2DEJA 4DL2A 1KN6A 3VQ6A 2YQ1A 1S77D 4NRUA 1BO5O 4NLDA 2HHWA 2HBLA 3M5RA 2HQIA 2CPFA 4DUZJ 2IM1A 1TUWA 4KBOA 3E51A 2WZ1A 4DR5F 2Z2ZA 3D0HE 2Z30B 3THXB 1RTDA 1P9YA 4KT0C 3DLJA 4IJNA 2F4VK 1XC3A 4Y28C 2L08A 2DGOA 3QESA 3BDPA 3GZ7A 2W7OA 2FF6A 3HYFA 3QEWA 4LBIA 2BEFA 4NLVA 2A6MA 2OA8A 3G6VA 2G8KA 1FWLA 3CJ2A 4OVLA 4GKJJ 1R7IA 4DV1F 1OVQA 2O66A 3A8YA 3V4IA 2YWHA 4KV8B 3OYCA 1LXNA 2MQMA 4FF4A 2LLZA 3HP6A 1W2IA 4WFBQ 2BQUA 5ETNA 4FVCA 3AD8C 3QRPA 4NXNJ 2JNJA 5H9FJ 4A61A 3IMQJ 3OHBA 2L48A 2OKQA 1WSIA 4HEA9 2VG6B 4FNIA 2CPXA 4ZCKA 3EZOA 2YHAA 2JLGA 4CHPA 3VQTA 2BJ3A 3OSNA 1RK8A 4JI3F 3QNOA 1HNXF 1RKJA 3DRPB 3P5TL 3OTDA 1N54B 4G3IA 3HZGA 1DKGD 4K4VA 2CDQA 3WQPA 3LL3A 2VICA 4DR5J 5KFDA 2YKMA 3HHLB 3UKUB 1SQKA 4MO4A 4OKEA 1XJWB 4P2FA 4E7JA 2ZZMA 1RT5B 4I69A 3R2CJ 1KVJA 1FO1A 5HAOA 2MSSA 1I3AA 1ZAVA 5BYSA 1R89A 4JEPA 3SUOA 4OZ0A 1J54A 3K5PA 1N32J 3FMBA 4KY3A 1GX5A 2UXDF 2XRIA 3QSIA 4PUOB 3R9LA 3TA0A 4OFZA 3RMDA 4NLQA 3HF5A 2YKPA 3QSYB 4OX8A 3IWLA 1CJUB 1T02A 1U8SA 1QQNA 3R8EA 3OXGA 4BRLA 3OYLA 1NJIO 1FI4A 2NXUA 2ROPA 3NRBA 1KR4A 3G0ZA 2XMWA 4E7KA 4ISGA 2XY6A 3R7NB 3BQ0A 2NREA 1BOTO 1Y0HA 3R5AA 3FBFA 2HQFA 2IJRA 3TWHA 3CGIA 2DPNA 1N36F 2QXLA 4X64K 1QUPA 2CPYA 5EUHA 2MZQA 2XLKA 1RSCA 4FN5A 1UAXA 4OL8A 4RW8A 1WC4A 3RBEA 3O4NA 9RUBA 1V5VA 5IT9O 2MZ1A 5EVZA 4I2QB 2DNHA 1FNMA 1D9FA 3VGVA 3H4DA 1NGIA 2GO9A 7FD1A 2PEBA 3JQJA 3MF5A 1FRIA 3FQLA 4F0MA 1XUPO 5C2DA 2M70A 2IS3A 1D0EA 2RU9A 3A8EA 3CT9A 1OPIA 3CDEA 4DV6K 3SUQA 1JQGA 2Y1RI 1P90A 1KQKA 2W8KA 1N0UA 1Q8KA 3M1VB 7AT1B 5CZXA 2E2QA 3ILJA 3SJHA 4RW9B 1VYAA 3LF0A 3U3YA 1WHWA 4RW6B 3FRZA 3QFPA 4GV6A 4WK3A 1JB0C 2A1RA 1ACMB 1S0MA 4OYPA 3CD5A 1UJ5A 4IFVB 3M8ZA 4GNIA 3NH0A 3H08A 2ITMA 1BWVA 4LBHA 4FWPA 2W25A 2BH1A 4OX6A 2P5GA 3AVKA 1FX4A 2K8GA 5CE3A 1RWWB 4CRJA 5JJBA 5CYQA 4JI0J 2G13A 4GRSA 4X4VA 1RGIA 5H1SQ 2DCLA 1SUQB 4BC9A 3RRHA 4DV6F 4RL1A 3I0SA 2YH1A 1OH8A 5C2CA 3SAFA 1VQ9N 3LPEA 4DV4F 2FXUA 4IH5A 5BPNA 1BCOA 3F73A 1Q53A 2E88A 3ZX3A 1RBLA 2VBYA 3H5YA 1GLLO 5AQVA 1E6YB 1NMEB 4FS1A 2IM0A 2OAUA 2YTCA 4M3RA 1PO6A 2B9EA 5FROA 2GX8A 4JV0A 3MEDB 4DSEA 4GMJB 1NK9A 2OSRA 2OTJN 3A0IX 3C6UA 3GPAA 3D2FB 4H4MB 3WEEA 1CSJA 4JV2A 4EAHD 3M4XA 2C2MB 4DWIA 2NYIA 3PO5A 4WE1B 3L9ZA 4OHVA 1Q0NA 3EL2A 3MMAB 4IO1A 3GILA 4GC6A 3BM7A 3GP9A 5E7OB 1WDDA 3SEOA 2OZMA 1HKBA 5DDPC 5D8HB 1QY7A 2FVQA 3N4PA 3CG7A 4O0JA 4DV1K 4DOZA 3WIUA 4W5RA 5L1JA 5DG8A 1YAGA 4QW9A 2FIUA 2JLFA 3CXCR 5CQGA 5JS1A 3B6OA 5D3GA 4EBCA 1Z2ZA 3AVBA 2ASLA 5M1NA 4URQU 1EX4A 3DC2A 2XM3A 3VTIA 4Q8FA 4IWVA 3EXYA 4J5OA 4LR9A 1EIYB 2M5YA 3NF6A 1NMNA 3AVIA 3R27A 1S97A 5AQQA 5G0RB 1S22A 5AFUH 1JWWA 3KLGA 2HVZA 4NYZA 2W6LA 4B8CA 1K1SA 1NSPA 4CT8A 1GNKA 4M5LA 1KAYA 2BQRA 2ZKUA 3IAM9 2P6SA 1EP4A 1FESA 1NU0A 1RYRA 3PX0A 1ZM3A 3LANA 3BO3A 3W66A 1W25A 2ZOGA 3I56N 5J2PA 1HBOB 2J0SD 4BACA 5FRNA 2J9EA 3GYNA 3THVA 1JNZB 1YXQA 3O8MA 4KKOA 3HPHA 1RWMB 3L2QA 2ZD1A 4A47A 4A8KA 2QWRA 2AQ4A 2BX6A 2W2OP 1NPKA 2Y8YA 1G7CB 2ETJA 2LQ8A 4C8YA 3BSCA 4DR2K 3D28A 1R6YA 2NZTA 4K4XA 3ATUA 1UEVA 1ZA2B 2PT0A 2QA4G 2JFDA 1JLCA 3OBYA 3MI7X 3TSPA 4DV7K 5FLXY 5KTQA 3BGLA 1HQEB 4DR4K 3WC2A 5KGXA 1GLDG 2MSTA 3SQOP 4E2FB 1G15A 2DRDA 3BP8A 1M5VC 1TL7A 3AB2B 1YRXA 2VFRA 1DTTB 2AGOA 5CZVA 2CJQA 1JJCB 1HR0K 3QRQA 4C11B 5F8IA 4X4TA 2BACA 2MKCA 3SFUA 1YDLA 3THTA 5KFZA 1MW7A 2OANA 4WKRA 1KTVA 3LZIA 1TL7B 4LH5A 4JBCA 3ISNC 2XS5A 2BANA 1S9EB 1X4AA 2V50A 4BE1A 1HR0J 4FM2A 2WONB 2YHBA 5LY3A 2ZHBA 1VQOS 4PG4A 3AO2A 2B5JA 4Q0BB 4QS8A 3I4PA 3MD1A 3BQ1A 4X65K 4P7TA 3NGRA 1F3VA 2NSBA 2Y8WA 4CQ1A 3I96A 1N56A 5CYJA 1T6CA 3H1VX 5EX0A 1YZ6A 4HWIA 2NRVA 5LMNJ 3WT0A 3KJFB 1U2VA 1S6QA 5KRTA 3LDNA 4AHRA 3QBCA 1K8KA 1YJWS 1RE1B 2RKIA 4TLQA 2ASPA 2WVBA 3VF6A 1HARA 3K2YA 5JUMA 2NQPA 3DFEA 4K4ZA 2QYCA 4ZTFA 3LOUA 4JRPA 2YX4A 2B9WA 1H7XA 4DTPA 5DGAA 5FDLA 3CJ5A 3ALYA 2BKNA 2H51B 1Z26A 1RTHB 2ABYA 4YNQA 1SPBP 2YVSA 2HFVA 1UTAA 4FJNA 4FJXA 4B9MA 1N5SA 2QZ8A 3QYYA 5C5JA 3TARA 3UFCX 1NJYA 1HKAA 5KQ8A 1KLMA 3LM9A 1HI0P 1XHXA 3Q8YA 3L2RA 3CDBA 4CJ5A 1DAXA 3K8VA 2RHSB 1KFSA 1CULA 2D41A 4M3WA 4Q2MA 3AJ1A 5T41A 3N01A 3VZIA 4BC4A 3JAMU 2JLEA 4Z4CA 2MY7A 3QIOA 2O8EA 4V1Ak 3SYZA 3CCJN 3KTQA 4RUCA 1U47A 1D4XA 5KFSA 1MU2B 4ECZA 3NOGA 3K0SA 4BR2A 2N4CA 2OGUA 1LNQA 2W7PA 4O3SA 3QT7A 3AVMA 1S49A 2KHCA 1U6BA 4GKKF 4DQRA 3MDFA 4OLOA 5C25B 4BRIA 4JKGB 1R59O 5KFUA 2ZNYA 1RACB 4XK8C 1CVJA 2OEKA 1R8BA 3K5LA 1XC9A 2RQ4A 4DPWA 3C65A 2N82B 1HYZA 4AL7A 4FL9A 4KAZA 5LMUK 4ILLA 3DGPA 4CZGA 1RCOB 9ATCB 3TNVA 4AH9A 2P9KA 2X78A 3O1BA 2AV5A 3LDSA 4FXDA 1JJ2M 1FE4A 4PXEA 3PYDA 3JSMA 3OR1A 4DV3K 4DTRA 4CP5A 3GJTB 1LOUA 3AO5A 3ULEB 4JI5J 2IRUA 4FPIA 5ETVA 1Q82O 2O8BA 3MXMA 2QLBB 2Z2MA 2ATCB 2XY5A 4DV4J 4MAKA 4PPZA 1RBVA 3O9UA 3I33A 4M1KA 1VQPN 4WZMA 3O3HA 1IQTA 2V94A 4H0TB 1CQMA 3CI5A 4DFJA 3DKDA 3BGRA 1FKOA 2ZH4A 2PA8D 2CVIA 5CAAA 3H1QA 3OYGA 3S9HA 4DG1B 5ETPA 2MJNA 4X62F 3SV4A 1FA0A 4GKKJ 1NBWA 3ID8A 1SJ1A 2CZ9A 3ZX0A 2VFTA 4RNHA 1SJ3P 4IKFA 2GIQA 1VSEA 1ATSA 4CF8A 2NRXA 1T9TA 2NCKL 3W5YA 2XGQA 1NOZA 4L3KA 4USJC 2XHCA 4ECQA 2ZDOA 3CW2C 3J80O 4ZPBA 4RBTA 1F21A 5L9NA 4NXNF 1GTEA 4ECUA 4J2DA 4JKBA 4KH1B 4MO5A 3C6UB 3HO1A 2D9PA 5A8WA 2E1ZA 5KG6A 4C0OC 4M7XA 1JX4A 3KUHA 2NUUG 2G0JA 3HJVA 1GOAA 3HBTA 3WUHA 3OPKA 3BBFA 2XHWA 1WB9A 3HT3A 3R6GB 4EK2A 1HNXJ 1NGHA 1RT7B 5KFTA 1YJWN 4DTXA 4JOUA 3FE1A 3J81U 1GLFO 2V8VA 4JV5J 2V69A 3NGSA 2OPPA 4KHNA 4HHHA 3EMTA 4G65A 3RMBA 3OR1B 3BZCA 1UWBB 4UZBA 3BSOA 2QK9A 5EX3A 5ADXA 4L75A 3CCUN 3ZYYX 1M5OC 4H5VA 3MUTP 4K0KK 3O5BA 3AVGA 4IKAA 4RX6A 3MR3A 5THWA 4UOGA 2F9TA 3LDQA 3QBXA 3JAMO 4Q8EA 2K2PA 3DLKA 5E84A 3M32A 2KXFA 4CEFA 4GV3A 1CEZA 1U0HB 4CJPA 1SIZA 2JFKA 2Y9HA 3UDCA 5AQHA 1H1VA 4CGGA 4OI0A 4LF2A 2C22A 1RT7A 3ENWA 4JKGA 4GKKK 4JI2K 5KG1A 4ZLPA 3BF1A 1C1CB 3NDKA 2RILA 3WHIA 4CTAA 5DO2A 3V6KA 4ECTA 4M41A 4WQ4C 1JLBB 1T9WA 3KLFA 3MX5A 4G1QB 1YBAA 3C6HA 1ZBHA 3R1HA 2VWJA 5F8MA 1X8DA 2DNOA 1UVJA 4MDBA 3PO4A 1SH3A 2EEYA 4WYLA 1GT8A 1K8AT 2POKA 1F5AA 3C94A 2C42A 1G6BA 2BJDA 4O44B 2W2QP 2RMLA 1F9FA 5JXSA 3ZTOA 3G86A 2C2NA 4Y65A 4KTWA 4CBXA 5K8OA 2H3EB 2GELA 4E1MA 1YKWA 2OD4A 2RNEA 1SH2A 3P4IA 5E26A 4I9QA 4YN3B 1OY9A 4YB7A 2YNHA 3QB0A 4I2QA 1WSFA 1RDCA 3VF0B 4YR2A 3JTOA 1S99A 2ZGZA 5CY4A 1C0MA 4AHSA 3KD1E 3K7RA 3FSXA 3KNAA 1UEUA 3AJDA 4ZVGA 3KKRA 3GONA 4NLOA 1KLNA 2M0GB 3G6ES 3QGIA 4BWMA 2LXIA 4XH5A 4KB7A 5CA5A 4CJ7A 1N34J 3RUBL 5F9LA 5CHCB 3CFPA 2V9KA 4OJRA 3ELHA 4Q5VA 1BMQB 2B4PA 3D6RA 2MKSA 3FZ2A 1KONA 5SWMA 3OLBA 2GQCA 3TAQA 4IDKB 4Y1DA 3N6LA 4BWJA 1BC6A 4FOIA 2YNGA 4DHVA 4TNOA 1FWKA 2IA6A 2V9WA 1MN7A 4JUZA 1TZ0A 4G9ZA 5E3AA 1XERA 3GR0A 3UW1A 3LDOA 4FLTA 1X4BA 5LT5A 3DI6B 2OMLA 3C16B 5D4OA 2P8IA 2XS2A 5LMNK 1OS5A 4HVJA 5DJBA 2I5JB 4UQGA 5CYQB 2FY8A 3FC9A 1FFGB 4Q0BA 4KIAA 1RAHB 3OYEA 4EIAA 2B0GA 3VOVA 3P38A 1CZBA 1N32K 3G82B 1VQLN 6FD1A 4B17A 2ZEJA 4QPXA 1ZM9A 2GMJA 4YEAA 2IM3A 4CJ4A 4CECA 3RB3A 1UJ4A 1JLEA 4LF6J 2W1BA 4BR0A 3DXBA 4I6MA 1SIWB 3D9BA 1FXRA 3HPGA 3MMCA 5DMRA 3C7NA 4ECSA 2I1RA 5AQPA 4OLBA 2DFEA 4FM1A 1XI1A 3MPYA 2QO3A 4YDUC 3AY9A 1AA1B 1J53A 2R7QA 3OA9A 3EX7B 2UUTA 4YB1P 2JOQA 4ATNA 4USVA 3KLHA 2R2TA 4DV2F 4R8UA 1N4LA 3J7ZO 3UR3C 5GIPA 2CJYB 3ZTSA 2ZOFA 2QFJA 2CGKA 3TJ9A 3IM9A 4WTOB 4KGKA 3CCVN 2Y1LB 4LRCA 3C0BA 1BE4A 4B9SA 2WFBA 3CQXA 3IRXA 1TL1B 3NCQA 4F9OA 4OHXA 4JRQA 5D0HA 4LF7K 3VAJA 1NM1A 1RKIA 1U24A 2Z1JA 5AQRA 4K0KJ 3J7Z5 4WKYA 4TYBA 5A2QU 3ETMA 3B78A 4CH1A 3CJTA 4DR1J 4J7CA 2KVQE 3I0SB 4Z0UA 4ECRA 3C95A 4BDZA 5J2QA 3I32A 3DLGA 1RJJA 2HHHK 1UJ6A 2ZZNA 4ILHA 3PSIA 4NZ0A 1TYQA 2E2PA 4B9NA 3CCEN 3HSCA 4PY5A 4K4UA 3GG0A 4CNZA 1QJHA 3EVMA 3QATA 2DFHA 2E7XA 3TX8A 3MTJA 2L3MA 4CJTA 3DLKB 4J9KA 4RBUA 3IBFB 1NZAA 3HTVA 4ZCIA 2IFXA 3QT8A 3KFWX 1TVRB 2ZH7A 1T9XA 4J91A 4JI4F 3Q7CA 4LF9K 3VZHA 3FZKA 5A8KA 4FZZA 4F50A 5IXUA 3DXKB 5D77A 1TL5A 2KHDA 4DCJB 3M8QA 2VKRA 5DLFA 3V2UC 4R25A 4ILRA 5DQHA 5JICA 2CG8A 2G2ZA 3IXQA 2FSNA 2NRWA 2XNRA 1VQON 2RUGA 4K0KF 4OX9J 1U1LA 5TKWA 4OHZA 3C14B 8ATCB 4ZLJA 4OYMA 1SB6A 1GAOA 2IMWP 1M1HA 2GQQA 2VFVA 3MPDA 2NPIA 4TU9A 2R7TA 1TKZA 1TL3A 2LU2A 1N33F 2VG5A 5KG2A 3ZEUA 4FBUA 1F2GA 2XSJB 3WNGA 5DRKA 1R8CA 3P6YC 2AHOB 3VF4A 2LQ9A 3IFRA 4B3SK 1FW6A 1S1TA 4F4XA 4P71A 2AWZA 3Q8SB 1T95A 1Z4UA 2HRYA 3KLEB 4YDDB 4YS2A 3KK3A 2YNFB 2F8MA 4KHYA 4FO0A 1RAFB 1TK0A 1WI6A 2FJAB 1BGXT 3M6GA 4K5RA 3W3DA 4LVOP 4TKTA 2DVIA 3A13A 1Q7YO 1RHUB 1XR5A 4CFDA 4L6V3 1DRZA 2UUCF 3M9MB 3H5UA 3LTOA 2F40A 1FTRA 3VQDA 2LEBA 1C0TB 2LDYA 2YHYA 1UPMB 3MAQA 5AZIB 4I68A 1U4BA 1RAEB 4IG0B 3GE1A 4X62J 3QAUA 3P5JA 3PEHA 2E8AA 3KJVB 2I5JA 2JC0A 2XZTB 4AHUA 3ASMA 1RWVB 1YTAA 1YJ7A 5ITHA 2DR8A 2JSXA 3AQPA 1LCUA 1S72S 2YPYA 3UKRB 4CJWA 1U09A 3B4DA 2JGUA 3L4IA 3V1QA 4KO0B 5J2NB 3NGUA 3QGGA 4FF1A 1LKZA 4YHHJ 1RWPB 1VQ8S 4AXJA 4DV2K 4E89A 1YJVA 4A8FA 1H72C 1Y97A 1MSWD 2AJ1A 2AF6A 1Q9YA 5A0YB 3MCOA 1T03B 3OTOJ 3NBPB 1IR1A 2X51A 4BHQA 1B7FA 3MWTA 4FLVA 3SQ0A 1N6QB 3T5HA 4B3MJ 5CXTA 1OMSA 2FJBB 2YH0A 4BQLA 2I8EA 3EGZA 3O3GA 2MKJA 2DGSA 2PEHA 3UNYA 4TQSA 1UZDA 5M1FA 4AE5A 3H59A 3KK1A 3DJCA 5HP1A 2UU9K 4KO0A 2ASJA 1RXOB 1B92A 3C3LA 3OR2A 5HI7A 1BQXA 2OFGX 4CF0A 2UXDK 1QDUB 2HFOA 4ISEA 4FJIA 1CS4A 4B3OA 4FWSA 5AT1B 3G71S 1O5JA 3H46O 2VUGA 3T1YK 2VYPA 3CC2N 1AB8A 3FEXB 2KZMA 2QA2A 4WFZA 2BJ7A 2PZSA 3CJSA 4HUEA 1V5IB 2CH6A 4QCLA 2IIHA 4IEEA 5L1IA 1IBKF 2OEJA 4C11A 1WSGA 2CXEA 3CQ8A 2ZDPA 4ED2A 1ASUA 2QEXN 2IVFB 2A6AA 4MT1A 4M5JA 1UAWA 4LFBF 3NS6A 3RB4A 4LF8K 1J6ZA 4A5BA 5I9EB 1N5QA 4ID1A 2OMOA 4C3MA 4C9DA 2Z58B 3VEWA 2XMVA 4FVMA 3J7ZT 2UP1A 3UPFA 2RUSA 2O8BB 4NLPA 1FFWB 2C2RA 2BW2A 5KG7A 2GTDA 1JXVA 1F60B 5GADI 4LD0A 2CG4A 3UR0A 4CT9A 2LKZA 1X3MA 3VF2A 1DGKN 1WSJA 3SMSA 5DM7L 4UT4A 4BRQA 4K59A 2E9TA 1JLQB 1WD6A 5KFNA 3V4MA 2HFUA 3UI3A 5HO4A 2C3MA 4LFBK 4ETZA 1N5YA 3UVJB 3BEXA 5LSOA 3A3PB 4Q43A 2O4IA 4OYXA 4C3LA 4RW6A 2BOAA 2QLXA 1ULRA 4C98A 2HHTA 2OTLS 2XB2D 4LREA 1UP1A 1S1XA 3QWUA 4CLSA 1N32F 5JLHA 2VFSA 2M52A 4NLSA 1IBLF 2UXDJ 3SAHA 1WKJA 5LSLA 4EBDA 1SH0A 3OFEA 4MKBA 4FJJA 2X3GA 5AZJA 4YOEA 1IQZA 3VEXA 1YVUA 2IVOA 3N4WA 1QSLA 3BY5A 1BCMA 2DIUA 4FOEA 1VHIA 1IJJA 2EC2A 1BUPA 1YF5L 2MQNA 4P74A 2J6SA 1VFJA 2Z2YB 5AQWA 1VLOA 3TVKA 3MM7A 4OI2A 2MKIA 3J7AN 4FWRA 4DR3F 4Y34A 1FD2A 4YOXA 3VEVA 2LA4A 4RNFA 3O2IA 2V8PA 2WVDA 4WFNQ 2RDIA 2MLZA 2VQFF 4FBTA 2PGCA 3TPQA 1E6YA 3CHWA 5HBMA 1WTBA 1P1TA 2IVNA 2P9PA 4E7HA 4HCBA 2B7BB 5KFKA 5AQJA 3CCRN 3IAYA 1ZYQA 3BDEA 3FR0A 4LFCJ 1U8WA 1TKXB 4HKQA 2V8HA 2VOOA 2B8PA 1OIAA 3AD7C 3NMAA 3FMWA 5HBMB 5DQIA 2MQQA 2FHJD 1DHMA 4B9UA 1F6TA 4B9LA 4ZJLA 4XAKA 1GH8A 2VODA 1X4CA 1HPZB 5AQNA 4ZHRB 3D0IE 4C0BA 1PJ7A 3Q23A 3D45A 1HKGA 4Z2XA 2VIHA 2D7SA 2DT9A 1W7WA 4OZ5A 3JYTB 1GOBA 3BGOP 3I31A 1X5TA 5B0GA 2QTDA 1KVBA 4YP3A 4O3PA 1ZBLA 4I4BA 3LP0B 2UU9F 5T7LB 2OPRB 2PMWA 2ZJPL 4NXMJ 3F5TA 4NWBA 2EBEA 3HVRA 1B99A 2WB4A 4ZLLA 1HMVB 2QLJB 1JLBA 2OLWA 2Z1GA 5EY4A 1RFQA 3A8JA 2LP4A 3RSEB 1X0FA 3FFKB 4A57A 5F2RA 1U04A 5DDQC 2UUCJ 1TV6A 2V8DA 4CZFA 4ZMMA 2F5GA 4CLLA 5A6PA 4PG6A 3NL0A 1G99A 3CCQN 2YKNA 4U6PA 4O5BA 5KI6A 4B3SF 3OYBA 2NYHA 3JYTA 3AAWB 4E7LA 2P5VA 2AGPA 5LXYA 2OH2A 4WYBA 3CJ7A 1LAVA 1VJWA 1QSSA 4I56A 3MPVA 4Z37A 2D0CA 3LP0A 1HL6A 4IJAA 3SI8A 3D68A 2GX9A 1U0SA 1LWFA 2P9UA 2FTRA 1XQSC 2AMCB 1VQ6S 1FEEA 3CCMS 1T0TV 1W2BM 4RBVA 2P51A 2Q3SA 4M3UA 4WFXA 4E3SA 4JI4K 5AFUA 4HTJA 2DEIA 1NJWA 1JLFA 2R8JA 2W2NP 3WDOA 2V2VA 3F56A 5LMUF 2HGNA 2PN6A 2BRLA 3VGMA 4I6YA 2ZQBA 1KEKA 1B64A 1PSDA 1L5UA 2X7IA 4GY2B 3LALA 3MGJA 2V63A 1Z2LA 2PY5A 2ZH3A 1VQPS 2HGMA 2L9DA 2W2MP 3GOIA 2BDPA 1X4HA 3DXMA 4LF4K 4N77A 3HI0A 2HHHF 3OTOF 3EGWB 3MMBA 2ZJPQ 4ZVOB 2G1HA 4FK0A 1DBDA 1QAXA 2DHGA 3VGSA 1T44A 3HSDA 2G8UA 3CMES 4NMLA 3UDVA 3H40A 4WXWA 2A3JA 1IKVB 4B08A 1H3DA 4YMEA 4FLYA 2P9EA 3C2PA 2KRRA 2VFUA 4QYZK 2Z8QA 1VJQA 1RAJA 1Y4ZB 4DCHA 2RVJA 4CGJA 3OL8A 4ZK7M 3H25A 3MMBB 2EVZA 4K8ZA 4KHSA 2CQHA 2BMBA 2WCXA 2R2RA 3D6MB 3MECA 3T9NA 2KDOA 1WI8A 3D67A 4LRAA 3KD5E 2RQCA 4ZP9A 2MQLA 2JEIA 2DO4A 5KT6A 5D4NA 1QAYA 2ZVIA 4ANEA 3JB9k 3L2WA 3H3NO 5KFJA 5SZTA 2FJXA 2OELA 3KLIB 1B7YB 5DM6Q 2W8LA 4NZ7A 2XWXA 1G3OA 3H98A 2CWKA 1U2VB 1X5SA 2GAHC 1LEOA 2U1AA 1T03A 4CLZA 2NRTA 2KRBA 4YOTA 1EJ7L 4C48A 4YOVA 2DGXA 2GHPA 3MR6A 1PYOB 1BQNA 1HWKA 1X4DA 5ELZA 1HBUA 2GCFA 4HH1A 3NE6A 4LF4J 4A4JA 2B6AA 3AGKA 1ZZFA 4QWEA 1HNVA 5I42A 3DXSX 5K5MA 3EICA 3ENAA 4CLTA 1U1QA 2CNOB 5J2PB 3RSEA 3EVOA 3AODA 2QT7A 5B0FA 1RTJA 3H20A 3KMSA 3LWMA 3M8SA 2D74B 3N6NA 4AM7A 4BDYA 3CJ1A 5AQMA 3L3VA 4BC5A 1C2PA 4CIGA 5BXIA 4LH4A 2VGNA 3OXLA 4RR5A 2XLIA 3VN5A 3KG0A 2R8HA 5ETSA 1NK8A 4C0HA 2ZH2A 2BTFA 5KRSA 2V67A 1RTJB 4DV0K 3ZZTA 2GVDB 4JI8F 3CB4A 5EHHA 3K0JA 1CQNA 5I42B 4CHZA 4DL6A 4LSLB 5F3ZA 3LDPA 2CJAA 3PYFA 3VAGA 4USKA 1QQMA 1P8GA 2E1YA 3PCOB 4HI2A 2FJWA 4J9MA 1F1BB 3B4MA 5AE3A 1UWBA 3MUMP 1KC8O 3S3NA 1SC3B 4IUFA 4RG8A 4CWBA 1AFIA 4H54A 1JXBA 4JD2A 4BBYA 4Z94A 3C19A 3J7YI 1T9UA 4IRDA 4KH0B 4B9QA 1R31A 5C15A 3DHXA 3HVWA 2UVRA 3FZMA 3A1YG 4DR3J 2YKNB 1WEXA 5LJ3Y 3P96A 4XPEA 3LDLA 3QICA 4J2EA 4EFAC 2CJXB 1UVKA 4D3HA 3AVFA 5IWAF 1YRUA 1YVNA 2ZH8A 3OTEA 2LXFA 1Q95G 1H2TZ 4IH7A