2YNGA

Hiv-1 reverse transcriptase in complex with inhibitor gsk560
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
total genus 168
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yngA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yngA05
3OYBA 1L3TA 1KHWA 2C28A 1BGXT 3HVTA 4N76A 5J2MA 1GX5A 3PW4A 5KT5A 4PQUA 4N5SA 4FW1A 5HRRA 4FJ5A 3JSMA 1N6QB 2O5DA 3EZUA 3MEGB 4FLVA 4KHWA 3RB4A 4R5PB 3KLGB 4W5NA 3THVA 4ED0A 1NJXA 4YQWA 2OPPA 4H4MB 3PX0A 2B5JB 3SV4A 4TXSA 2HHTA 2DTUA 2PYLA 4CEBA 3LAKA 5I42A 2YNHB 3S3MA 4I9QA 3TAEA 4WYWA 4H4OA 4CF2A 2DFEA 3EYZA 4CJ3A 2A1RA 1JLGA 5HP1B 1BQNA 4M94A 2ATQA 4CJ5A 3KLFB 2FLPA 3HM9A 5DG8A 4YNQA 2B6AA 5KFSA 3D28A 1C0UB 3QGIA 4H54A 1TKTB 3KK1B 1T03B 5F8JA 1QS4A 3FFIB 5JXSA 4Y3CA 4IG3B 5CYQB 3PW7A 2XY8A 3BJYA 3E01B 2HMIA 2C2EA 2QKBA 5C42A 3A2FA 2XGPA 4ZHRA 3U3GA 4IQXA 1I3AA 2B43A 4NYFA 2G8UA 5KFXA 1EX4A 3ZSVA 2QE5A 2VA2A 4AHUA 2WTFA 3PUFA 3OS2A 5KFZA 3BSNA 4NLPA 4ZTJA 3DI6B 3Q8QB 4CEOA 2D3ZA 3OYEA 1D9DA 1Z26A 3L2RA 3PO4A 4M3XA 3UQSA 1JLCB 1EETB 4NZ0A 4PUOA 3M8PB 1X9SA 1A5VA 3H4BA 4M45A 1NOZA 3OYCA 5JS2A 3L3UA 4BE2A 2ASJA 3DLEB 4KHYA 3LZIA 3IRXB 4QCLA 4J9RA 2UVVA 2V4QA 4Z0UA 4CIGA 3PO5A 2OA8A 5CYMA 1IM4A 1TVRB 3HVAA 4EO6A 4Q8EA 3IAYA 4DF4A 4EZ6A 4AHRA 1KLMB 3DOLB 3AVCA 4O44B 3FQKA 3TI0A 4TLRA 2G8VA 2OPRB 2C2RA 2DFFA 4LD0A 4Y1DA 4IDKB 2XCAA 3LP3A 1SKRA 1Q9XA 3K58A 4LH5A 3VQ9A 3RRGA 4OVLA 4CHNA 1UA1A 3NAHA 1QSSA 1C1CA 3NGDA 2F8EX 1LAWA 1NK0A 4RW6B 1YTUA 2JLEA 4RNMA 5C25B 4ELTA 1RT2A 2KZZA 1ZBUA 2HHWA 4IH6A 3OL6A 4NCGB 4FJJA 4DWIA 4ELVA 1W25A 4YR3A 3PX6A 3OVNA 3CJ2A 4E89A 4NCBA 2UUWA 4N41A 1HARA 3C6UB 4CHYA 3HJFA 3ITHB 1RTJA 4B9MA 3JYTA 3NF7A 5I42B 3PV8A 1D1UA 4DG1A 1T05B 4DL3A 3C6TA 4GC6A 4IFYB 4OKJA 1S0OA 1KTQA 2P51A 3L2QA 1U09A 4FS2A 4F8RA 3S9HA 3KLIB 1HYSA 5DG9A 2VG5B 2AX1A 1WLJA 4NRTA 1U04A 1X9MA 3V9UA 4DSFA 2YV0X 3GV8B 2R8GA 4KREA 3G0ZA 1HMVB 1QSLA 4IRCA 1DLOA 2IC3A 1QAJA 2UVRA 1IG9A 1S6QA 4KTWA 1T7PA 5D3GA 3ULDA 4ID1A 3CJ3A 5C42B 4E19A 4CEFA 4B9LA 1ZYQA 1K1SA 2RF2B 2JEFA 2RDIA 1JLAB 1ZBHA 3LWMA 4EEYA 4ZVGA 1TKXA 3T1AA 4MFBB 3CO9A 4CERA 3G10A 4J9QA 1TKZA 2VG7B 1NJWA 4KB0A 4FK0A 5J1EB 3OJSA 4PUOB 4KSEB 4RNOA 2VG6A 2VA3A 1U4BA 4IFVA 3H59A 5CY4A 2YHBA 3QEVA 2EC0A 3BSCA 1JLBB 5L1KA 3AVHA 4O4GA 3L2UA 1WAFA 2IGIA 3MEDA 2A1SA 1SH2A 2X6SA 3MR2A 2HHUA 2HWHA 1RBVA 2AGOA 1KFDA 2UVUA 3ISNC 2CJQA 4KFBA 4KB7A 4LSLA 4FK2A 4FM0A 4DQRA 3NF8A 1S48A 1J54A 2QXFA 3V9ZA 3MF5A 2BRKA 5C24A 5KFWA 4JV2A 4B08A 4DQPA 1ASUA 1UWBB 3AA3A 1S1UB 4KTZA 1LWFB 3M8RA 3I0RA 3KLHB 3RRHA 2OPSB 3DM2A 3KNAA 3ZSQA 5SZTA 1SKSA 5KFTA 2JGUA 4CJEA 1NK9A 5JS1A 4CGGA 2HNZB 2C22A 1SKWA 4ZPAA 4DQIA 1S1VA 1EP4B 4RW9A 3PR5B 4CEDA 1RTJB 3QYYA 2B4JA 4DTNA 1MU2A 5I3UB 3RBEA 1WN7A 1RDAA 3H4DA 2G8FA 4B8CA 2UVWA 5T14A 4IOBA 3VQPA 5DQIA 3L2WA 4IRDA 1S6PB 3IG1B 3VN5A 4CJSA 4JUZA 2ZD1A 3QZ7A 4E7IA 1RBUA 4Z4HA 2WHOA 3ZSWA 1DLOB 1S1WA 1XR7A 2IC3B 4QWCA 5F8LA 4MK8A 1YVFA 2E6MA 4IG0B 2W9BB 5KT2A 4IBNA 4M3UA 3K5LA 4NLSA 1VSFA 2W7PA 4FJNA 4HKQA 4W5RA 1W9HA 2D3UA 2FVCA 3I8DA 1TP7A 4W5OA 3NH1A 3KTQA 2GIQA 3I5BA 2PYJA 2QKKA 2R2TA 4WXOA 4Z4FA 3ZT2A 3AV9A 5L9XA 4FLYA 4NLTA 3OYFA 1S9EB 1LW2A 4ZPCA 4ZP9A 1ZETA 1G15A 4WFYA 1TL1B 3RAXA 3V6DB 5FDLB 3TANA 3DRRB 4Q5VA 1BIZA 1U49A 4CJUA 2AU0A 3VA0A 1JLFB 1VSMA 4E7LA 4TQRA 1S9GA 4DU3A 4ECRA 4NLRA 1LAVA 4ED6A 1IKVB 4W5QA 1JLQA 5KT4A 3CM5A 5JUMA 4C8OA 2HNDB 4M3TA 3CIZA 4FW2A 4KTQA 4AILC 4BWMA 4LSLB 3HPOA 3MEEA 5KGWA 4DLGA 3PW0A 2OZMA 4ECXA 3V9XA 4FJLA 4DSIA 4CEAA 4JS4A 2HNYA 1S4FA 4DFPA 1N6QA 4B9SA 1TGOA 5EWFA 2WONB 4FLZA 3MEGA 3DLKB 4R5PA 3KLGA 5KFAA 3NMAA 4IKFA 4O0IA 5HRPA 2V9WA 4F4KA 2BQRA 3OHBA 4OL8A 2B5JA 4AH9A 2R8IA 2ATLA 1RYRA 1N48A 3K59A 4ECYA 1FKPB 1RTHB 1T94A 2P1JA 4N56A 1TK0A 3L2VA 1JXBA 3RMAA 5HP1A 5KI6A 5T7BA 1RDCA 2XY7A 3KLFA 1RA6A 2IM3A 4DTXA 4CHZA 2YKMA 3ASMA 2W9AA 1YVUA 3H5XA 1C0UA 2P5GA 3T5KA 3TVKA 1TKTA 3MFHA 3KK1A 1T03A 4M3RA 4F2RA 2HVIA 3FFIA 3KK2B 1S1WB 2UUTA 4IG3A 3BQ2A 5CYQA 4JRQA 3E01A 2WCXA 4G3IA 4LSNB 3RMDA 5KFLA 1A5XA 1BI4B 1XI1A 3OLBA 2FBVA 4J9OA 2ALZA 4CF8A 1RT4B 1JLEA 4I2QB 1WSHA 4XPCA 3DI6A 4K50A 2G8WA 5HRNA 1XR6A 4J9LA 4CFDA 1Z25A 2IAJB 4DTPA 1JLCA 1EETA 5KG0A 3M8PA 3OS1A 5DK5A 4HCCA 3BQ1A 3RR8A 1ZBIA 2Z1GA 4NLOA 2BRLA 3DLEA 3IRXA 2HW3A 4DL2A 3DRSB 3QIDA 3TAPA 1BQMB 1N5YB 1TVRA 4XIUA 3SPYA 4FLXA 4MIBA 1KLMA 3DOLA 4ICLB 4O44A 2XWYA 3B6PA 2OPRA 3FRZA 3GQCA 4AHTA 4IDKA 3H40A 2XRIA 4WYLA 4J9SA 4WFZA 2R8JA 1T3NA 4CIFA 3HXMA 4ECSA 3VQQA 2HAIA 3KK3A 3IGNA 4TN2A 3HP6A 2JC0A 4RW6A 2HNYB 5C25A 4M41A 3DMJB 4OGCA 3F9KA 4MQ3A 3SQ4A 4KHMA 4NCGA 3KHLA 4RZRA 3SQ0A 1SH3A 4O3OA 5KFRA 2QK9A 2XY5A 2AQ4A 3C6UA 3OYGA 3ITHA 3TQ1A 1JIHA 3KLVA 1IKYB 3GIJA 2IS3A 1KFSA 5KT6A 1T05A 4NCAA 4IFYA 4J9KA 3SQ2A 3M8QB 2RDJA 1VRUB 2JEGA 4FJKA 3ISND 4E7HA 4DL5A 2G8KA 4NLQA 3KLIA 3AA4A 2KFZA 4TSXA 2VG5A 3LP1B 4PA1A 2YKMB 1HMVA 5F8MA 3ZT3A 3MECB 2HB5A 4K4XA 2HWIA 4TY8B 4FLTA 2GBZA 3VQEA 1JL1A 1WSJA 5J2PB 4FBTA 4J9MA 1FKOB 4LY7A 4FJHA 2OH2A 3UPFA 4ED1A 2X6NA 2RF2A 1C1BB 1JLAA 4CECA 3CQ8A 1JLEB 1J5OB 2BQ3A 1QSYA 3K5MA 3KKRA 4H8KA 3KLEB 4MFBA 1HJRA 3RMCA 4NYNA 2D7SA 1B9DA 4NLWA 1A5WA 2VG7A 4QW8A 3QEPA 3SUPA 3NAIA 5J1EA 5DGAA 3SI6A 3LWLA 3TAQA 2AGPA 3CDWA 3V4IB 4GW6A 3O3FA 1SH0A 3MXJA 2ZE2B 4F4WA 2HHVA 3CJ5A 1JLBA 4KB1A 1SL2A 4KKOB 1VSLA 5CZ2A 3VQCA 2R8HA 4AHCA 3SUNA 3WNFA 1BCOA 3P5JA 3ZT4A 4OKKA 4ED3A 2JEJA 1IKWB 5DLGA 3AVGA 2W8KA 2D0BA 1RT6B 4HUGA 3QLHB 3PJWA 5F9NA 3KK3B 2KZMA 3T5LA 5KFJA 3T5JA 2IJFA 1S97A 4OPJA 3F73A 2R2SA 1UWBA 4HUEA 1S1UA 2HHSA 4Y34A 3AVNA 1LWFA 1GX6A 3CG7A 4HHTA 3KLHA 4CE9A 2OPSA 1SUQB 4YMEA 3K5NA 4FLWA 1Y97A 3V6KA 1D0EA 2XY6A 3CFRA 2HNZA 4CEEA 1BCMA 1EP4A 4TYBA 4DTMA 1XR5A 1TAUA 3KHRA 1RT3B 1ZTTA 5I3UA 1X9WA 1REVB 1ASVA 3GV5B 4ED7A 2ZQBA 3ZCMA 3ZSRA 4ED8A 2WRMA 5KFDA 1QHTA 1S49A 3Q8SB 4ZVEA 2J6TA 3VA3A 4YR0A 1S6PA 4IR9A 3NL0A 2ETJA 3IG1A 4F4YA 5KG6A 4RW8B 4O3SA 5F8IA 4RNHA 4JS5A 5KG5A 3SNNA 3GIKA 4BDYA 3T5HA 3ZSYA 5HROB 3RAQA 3AA2A 4IG0A 2IM0A 2W9BA 1WNSA 3KMQA 1MMLA 4U6PA 4DSLA 4DMNA 5EWGA 4DL7A 1RCHA 1S1TB 3DLGB 4R8UB 3MTKA 3DDKA 3AO3A 3B6OA 3OYKA 2F8SA 4DEZA 1N56A 1VSHA 1T8EA 4J9PA 1U47A 4KBIA 2HVHA 3CYMA 1S9EA 1QAIA 4J9NA 1RAJA 3K5OA 1KSPA 4Z4EA 3VQ7A 4K4TA 3P83D 1TL1A 4ECVA 3QZ8A 4MK9A 3V1RA 4Y1CA 3V6DA 5FDLA 3K57A 1CSJA 1HPZB 3DRRA 4J2DA 4CFBA 1LWCB 4IH5A 5KFHA 3LALA 1JLFA 4RNFA 5DQGA 2KTQA 4QWDA 1IKVA 3DLBA 4Z4CA 2ASLA 2HNDA 4CJFA 4EP4A 4CIEA 3OYIA 3QIPB 3OS0A 3SJJA 1OS5A 4ECWA 2V4RA 1TV6B 3LP0B 1S1XA 4YP3A 1LWEA 4NLVA 4ECZA 2BANB 3PW5A 3O3HA 2WONA 4KPYA 3DLKA 2RPIA 4Q44A 3GILA 3WNGA 4BACA 4DTOA 4FLUA 5E41A 3V81B 4MK7A 5EWEA 3RB3A 2QV6A 1TKDA 4XO0A 4B9NA 1FKPA 1RTHA 4OLAA 2YNFA 4QOZB 4OLBA 4EBDA 4I2PB 4FZYA 1RT1B 4OPKA 1KCFA 3NGIA 4CGFA 2XGQA 2Z1JA 4BDPA 3TAGA 5KT7A 4G1QB 3H2LA 2DPIA 3AA5X 3OYDA 1NK8A 5L1JA 2YHAA 3KK2A 4CF0A 5DLFA 1DTQB 1CXUA 3T19A 3SV3A 3IGVA 3CFPA 4DU1A 4LSNA 4XPEA 4EO8A 4EYHB 1BI4A 1NKCA 4BDZA 2J6UA 4KI4A 3NDKA 2R2RA 1EXQA 1RT4A 1LV5A 4I2QA 4CK2A 5KFIA 3M9OB 2OPQB 3GV7B 3OY9A 1NHVA 4KHUA 1UA0A 3CVKA 2IAJA 4ZPBA 4Q0BB 2FJWA 5KFCA 4R0EA 3CJ4A 5KFEA 3CFOA 4QWEA 5KGXA 1K1QA 3MR3A 2O4GA 2ASDA 3KKSA 3O4QA 3VQ8A 4CFCA 2FLNA 3U3YA 1WAJA 3OSPA 4OGEA 1JX4A 3H5YA 2D0AA 3DRSA 1BQMA 1N5YA 1Q8IA 4CGHA 1JL2A 3SCXA 3TAMA 1X1PA 2WK4A 4HUFA 1NK7A 4ICLA 1BL3A 3HT3A 1D8YA 4CJVA 1RDBA 4NRUA 3NF6A 3HSTB 5KFNA 4AHSA 3QNNA 1S1XB 2D5RA 4Y2CA 2FLLA 1LWEB 3KHGA 2FVSA 3LP2B 3G6VA 3V9WA 3DMJA 4B3OB 1I39A 4O3PA 4CJLA 4MH8A 3OL8A 2O4IA 3M9MB 3VQ4A 1SL0A 3H5SA 1ZBLA 2W9CB 3DOKB 3FDSA 1TAQA 3BSOA 1YT3A 1UOCA 4KRFA 5FRMA 4HTUA 1RT7B 2PZSA 4FCYA 1IKYA 3BSAA 2YNFB 3M8QA 3Q8RB 2ILZA 4ZP7A 4FJ9A 3QIOA 1VRUA 3L3VA 3FSIA 4E7JA 3SQ1A 3FQLA 5EU7A 3CWJA 4B9UA 4ZVHA 2P5OA 2YNIB 3LP1A 2V0NA 3QNOA 4CCHA 3ZT1A 5KFGA 2F96A 5F9LA 3U6FA 1HQUB 3K2PA 3MECA 4I7FB 1DTTB 2BR0A 4FJMA 4TY8A 1IKXB 4K4SA 3HPHA 5J2PA 1FXXA 1NK6A 3G6YA 5J2QB 5KRSA 1FKOA 2KQ2A 3P1GA 4CEQA 1RTDB 5KG4A 1C1BA 1JXLA 2XCPA 1J5OA 3ZT0A 2WOMB 3CM6A 4F2SA 4KHSA 2FJVA 3HL8A 3KLEA 3BREA 3QESA 1C6VA 4TQSA 1RTIB 1VRTB 3HYFA 1C2PA 4F4XA 4DL4A 3V6JA 2GIRA 1RYSA 2E4LA 3NHGA 3V4IA 3AVIA 2BE2B 1L3VA 2BGGA 3GIMA 2ZE2A 4DTUA 1NJZA 2IJNA 3M8SA 3HP9A 4OJRA 3OYLA 3QO9B 1TL3B 3DYAB 4KKOA 1S9FA 3QGGA 3TR8A 4O4RA 3CDEA 2AX0A 3TAMB 1RDDA 4PWDB 1NJYA 2R2UA 4HCBA 2JEIA 4ZTFA 1L5UA 1XHZA 4FBUA 4FVMA 3SPZA 5KG7A 1IKWA 3OHAA 1HRHA 3AO5A 3ICLA 4O3NA 3PHEA 3SUQA 1RT6A 1VSIA 4CHQA 3QLHA 1NK4A 3BGRA 3NH0A 1JKHA 5KFUA 2Y1JA 3TARA 3VQSA 4J2EA 3HVRA 3AVFA 3AVAA 3O3GA 3Q8PB 2E9TA 1ASWA 4RG8A 4GVMA 1SUQA 4URGA 4HYKA 4KHQA 4JLHA 3DLRA 4AHVA 3KD5E 4FJ7A 1NKEA 4KV8A 3RMBA 2RKIA 1WSFA 2DPJA 4WE1A 1GOBA 3CDUA 4NLGA 5KT3A 3WNHA 4CF1A 3PW2A 4ECQA 1RT3A 1VSEA 4ZVFA 3O4NA 1REVA 3NE6A 4CESA 1HNIA 2FVPA 2EX3A 3OYHA 4ZP8A 2C2DA 2ITGA 4L8RB 3UR0A 5FRNA 2AJQA 4ZP6A 4RW8A 3OLAA 4WZQA 2OZSA 4K8ZA 3D5MA 1C0TB 2BDPA 4F4ZA 4M3WA 3LAMA 3E51A 4PY5A 5HROA 3WNEA 3S3NA 4MKBA 1QE1B 2I5JB 4Q45A 2Z1IA 1SV5B 3BQ0A 1S1TA 3DLGA 1RBRA 4R8UA 5KFKA 5J2NB 3KJVB 5K14A 1RT5B 2YKNB 1S5JA 1I6JA 3ZSZA 1GOAA 1HNVB 4J2BA 3PR4A 1BHLA 1NOYA 1RA7A 1CLQA 4F3TA 1F21A 1RDRA 4KAIA 2D0CA 2W7OA 3V1QA 1J9AA 3KHHA 3NKYA 3RB0A 2Z1HA 1HPZA 3RTVA 3SI8A 1BIUA 1LWCA 4CHPA 3OJUA 3EY1A 3NBPB 4QAGA 4ID5B 2GUIA 4LH4A 4RW7B 2FBXA 1ZBFA 2FVQA 3N6MA 1CXQA 5DGBA 1W0HA 3RBDA 3HKWA 4FJ8A 5HLFB 3N6NA 1B92A 4DU4A 3VQDA 4IRKA 4TYAA 1R0AB 3QIPA 4C8KA 4O3RA 4DFJA 4QWBA 4EYIB 2AWZA 3BGRB 1TV6A 4CGDA 4HVJA 4DFMA 3LP0A 1JKHB 3TWHA 4DSKA 1U45A 1LW0B 4K4UA 3NF9A 3TAFA 3OYJA 4B8AB 2BANA 4W5TA 3DRPB 4RNNA 4KHNA 1HQEB 4NLXA 1EKEA 4CFAA 4Z4IA 5HBMB 1VK0A 2VWKA 4NYZA 2EHGA 4YR2A 4M42A 4J2AA 4KV8B 3HVTB 2RKIB 2G8IA 2GV9A 3V81A 5DQHA 1VSDA 5J2MB 4FM1A 4WE1B 4PQUB 4CGIA 2XI3A 4ECTA 5HRSA 4DFKA 3JSMB 1RBTA 3MAQA 2BQUA 4BWJA 1HNIB 5KFYA 4QW9A 4DTSA 4JV1A 4LQ3A 3OSNA 4I2PA 2D41A 1RILA 1KLNA 2OPPB 1RT1A 4ZPDA 4URQU 4CHOA 1KVAA 4NLUA 4E0DA 1RBSA 4CJ4A 4M95A 2RN2A 1JXEA 4K8XA 4BE1A 4G1QA 3VQ6A 3IS9A 4FZZA 4UQGA 2Y1IA 4CJWA 2HHQA 1DTQA 4C8MA 4H4OB 2NUBA 4KHRA 2LSNA 1JLGB 5KFMA 1BQNB 4I9LA 3VQAA 5SWMA 4RU9A 2B6AB 4MIAA 4NLYA 2IBKA 4IKAA 2R8KA 3C95A 4JRPA 2OPQA 3HPGA 5K14B 4E7KA 2YNGA 5KFFA 4LQ9A 3KD1E 2HMIB 2DY4A 2ILYA 2KFNA 4QPXA 2DFHA 2E9ZA 3T3FA 4ZHRB 1WSIA 5KRTA 4Q0BA 3G6XA 2G8HA 1S0NA 2CKWA 3LANA 4C8LA 2OYQA 3L8BA 3I5CA 3H5UA 4WFXA 2R7YA 3NCIA 1K6YA 4RUAA 5KFQA 3RWUA 3HO1A 1J53A 3AVMA 1RNHA 3SUOA 4FZXC 3PX4A 4DQQA 3G86A 5KG3A 3OYAA 3VQBA 3KOAA 4E3SA 4KO0A 1IH7A 4EP5A 4KAZA 1BISA 4FS1A 4O0JA 4DSEA 4NLDA 3GIIA 3PVXA 5CYMB 1WSEA 3H98A 3QETA 3AO4A 4DTJA 3LP2A 4CF9A 4CJPA 1C0MA 4Y2AA 4CJRA 4B3OA 4B9TA 4K4VA 2FBTA 1WNEA 3SFUA 2JC1A 3QEXA 3C94A 3V9SA 5DG7A 2W9CA 3DOKA 2GC8A 1C1CB 4RW4A 1ZTWA 1D9FA 3N6LA 1RT7A 1RT2B 3D0PA 4EZ9A 3KMSA 5F8GA 4K4ZA 4IH7A 2VWJA 4DLEA 1IO2A 4DF8A 1L3UA 1WSGA 5F8NA 4EBEA 3ZSXA 3V1OA 2X74A 4FJIA 3KIOA 5KFBA 2YNIA 3HK2A 4U7CA 3PZPA 4Q43A 2WB4A 3JYTB 4O3QA 3AVLA 1VSKA 1HQUA 3IS9B 4DG1B 4MKAA 3C6TB 4I7FA 3OYMA 1DTTA 3SFGA 1FK9A 1IKXA 4FYDA 3GYNA 4WZMA 2IA6A 3MXIA 4F3OA 1HYSB 3AO1A 5J2QA 2XHBA 4WXWA 5KFPA 1RTDA 3HVWA 3NGZA 1C1AA 4X2BA 2WOMA 1KVCA 3OL9A 1NKBA 5EDWA 4RUCA 5KFVA 4N47A 1S6QB 5KTQA 2YNGB 1KVBA 3I0SA 5D3GB 3H08A 1RTIA 5L1LA 2E6LA 1VRTA 4ZMMA 5CZ1A 1HYZA 2KW4A 4Q8FA 2J6SA 1TK5A 3D45A 3QEWA 3AVJA 4KI6A 1TKXB 1XHXA 3M9NB 4CK3A 2BE2A 3DLHA 3LZJA 1CZ9A 3IN5A 4YFUA 4BE0A 3MR6A 1TKZB 4K4YA 4FJXA 2HHXA 3QO9A 1TL3A 3DYAA 3BR9A 2VG6B 3UDLA 4DSJA 4IFVB 2IMWP 4PWDA 1YTAA 4KO0B 1O1WA 3CJ0A 3MR5A 1VSJA 2IM1A 4DL6A 3MXMA 4O4GB 2FC0A 4K4WA 4GMJB 3MEDB 4B9VA 1D5AA 4CEZA 3TABA 4E1MA 3RB6A 4DTRA 1NNDA 2IDOA 1QTMA 4KFBB 4M3ZA 2FBYA 3SYZA 1QQCA 3ALYA 3EPGA 1TK8A 2XI2A 4C8NA 3QEIA 4CJTA 4QWAA 1SL1A 2W8LA 2Q3SA 4DQSA 5F8HA 4RW4B 5C24B 1HYVA 1QUVA 1UAXA 3I0RB 3DM2B 5KFOA 5KG2A 4IR1A 2XO7A 2FVRA 4FXDA 4H4MA 4ECUA 1S1VB 4FM2A 2E9RX 1Q9YA 4RW9B 4FK4A 4CGJA 2FJXA 1CZBA 1C0TA 2YNHA 1MU2B 5C5JA 3NAEA 3UIQA 2ZKUA 4JV0A 4KE5A 1GOCA 1XWLA 1FK9B 4DS4A 1XC9A 1QE1A 2I5JA 3NH2A 4GC7A 3SZ2A 3AO2A 5EUHA 4CJQA 1SV5A 3LPTA 3QINA 1Z4UA 2ZD1B 4CK1A 2IOCA 5J2NA 1NK5A 3KJVA 4FJGA 4O5BA 3LPUA 1RT5A 2YKNA 3I0SB 1ITGA 2F8TA 1HNVA 4DS5A 5DMRA 5KG1A 1L3SA 3EPIA 3AVKA 2I1RA 1S0MA 3OL7A 1NHUA 3RR7A 1U48A 3EZ5A 3QGHA 4TY9A 1LW2B 3S3OA 3NBPA 2X78A 3BDPA 2XC9A 4ID5A 4CJKA 4O55A 4E1NA 4F50A 5L1IA 4OKEA 4RW7A 3AVBA 4URSA 3MFIA 3I5AA 5HLFA 1KHVA 4EBCA 1R0AA 1N4LA 2PY5A 1S10A 4Z4GA 1KRPA 3V6HA 1B9FA 3ZSOA 3HHKA 1S9GB 1LW0A 2W42A 1JLQB 3NGYA 3PY8A 3LDSA 3VQ5A 2AGQA 3OYNA 4M3YA 3QERA 3DRPA 3PJXA 3NFAA 1HQEA 2IM2A 4ED2A 1TQLA 5FROA 5HBMA 4ELUA 3MEEB
chains in the Genus database with same CATH superfamily
2VOPA 3FBEA 1BGXT 4KC5A 5J2MA 1GX5A 3LTOA 4N5SA 4FW1A 2FZGB 4FJ5A 1F60B 2RD5C 5A6WA 5HSPA 1LXJA 1P1TA 2E5LJ 4WQ4C 3C66A 1NSKL 4W5NA 4EFHA 4H4MB 4BC2A 3UD3P 4ES2A 2FSKA 1N32K 2HHTA 5I9EB 1RWMB 2VPZB 2YNHB 1FVSA 3OBYA 3S3MA 4LRBA 2IRXA 1MN9A 5D78A 3TAEA 4WYWA 4CF2A 4CJ3A 5KPTA 1JLGA 1IN0A 2XNRA 2Q36A 2EFQA 2ZH1A 2B6AA 1W26A 3R9LA 4DV3F 3QGIA 4LR9A 1T03B 4UOHA 1Z05A 2GX9A 3D1HA 3PW7A 2LA6A 3AQPA 1U1OA 2J9DA 5L8RC 5C42A 3ADAC 2AF6A 3AXKA 2DGQA 2VUGA 2R7TA 2B43A 1RXOB 1P8ZA 5KFXA 3GSIA 1EX4A 2VA2A 2WTFA 4ZLLA 4Z2XA 3DI6B 2PBDA 3PFOA 2EKYA 2NRHA 2PE8A 4CLLA 1Z26A 3L2RA 5A8RB 2KVIA 2VDIA 1NU0A 5AQMA 3H42A 2PI5A 4IO8A 4X4QA 3OYCA 1ZOTA 3L3UA 4BE2A 3GDQA 4FF4A 5LJ3Y 3DLEB 3MD1A 1WUAA 3S1TA 3C7NB 4J9RA 2UVVA 3MM8B 1TVRB 1NSPA 4EO6A 1T11A 2DNNA 2V8HA 4DV4K 4O44B 3FQKA 3TI0A 2C2RA 4JI5K 2DFFA 4QU7A 1U25A 3VMFB 1XMQK 4UQTA 1KD1T 3VQ9A 3PRDA 4OVLA 3P38A 1PBUA 2BKPA 3FJ2A 3KHYA 2PT0A 3NGDA 1LAWA 3C65A 3R1XA 2JLEA 2GELA 1YX2A 4IOAL 2YVSA 5BREA 3KUEA 8ATCB 2HWTA 4IH6A 2HHWA 4NCGB 3CJKB 1BWFO 1KDNA 5BXIA 1PSDA 2C2ZB 3C6UB 1RTJA 3JYTA 2ZNZA 2ZWOA 2OMOA 3PV8A 1D1UA 3BV8A 3I55S 4XH4A 3C6TA 4HT7A 1AUSL 2P51A 3L2QA 4FS2A 3RGIA 4F8RA 4DJBA 4XDCA 1HYSA 4WFNQ 4RJVA 4DV4F 4DUZJ 3F41A 1U04A 4JI5F 1UVMA 2W40A 2YV0X 3GV8B 2R8GA 3MM7A 1XMQF 1HMVB 4QYZK 1IJJA 4A8WA 1TZ0A 5D3GA 1SB6A 2XB2D 1MW7A 3CJ3A 5C42B 1RBOB 1K1SA 2E7XA 3VEXA 2PEBA 3KJQB 2NS1B 4H5WA 4AFFA 1N5SA 1ZBHA 2HEKA 1IBCB 4EWTA 1TKXA 3TUJC 2KHOA 3T1AA 2V2KA 4MFBB 5A2QY 2HOEA 1NPKA 4M5MA 1GMWA 4LF9J 3PFEA 2I7NA 2GHWA 1NJWA 3J7AN 2P9SB 1Q4RA 4CZEA 1JJHA 3WIVA 2QI2A 5A0YA 1S72S 3W2WB 2VA3A 4ZIWA 2BUNA 2ZUGA 3CMAS 4J7CA 2YHBA 4BR4A 1Z1ZA 3Q8YA 3FK4A 3I6PA 2RRAA 3Q89A 4BRAA 2R7OA 1I94J 1WAFA 2R7SA 2YWGA 1VIXA 2A1SA 2V94A 2X6SA 3OR2B 3MR2A 1SQGA 1JJCB 2UZAA 2AGOA 2EK6A 1OH6A 4KFBA 1W7AA 2Y3YA 1NEEA 1XNQK 2M88A 4FK2A 1S48A 1J54A 3F5TA 2Z57B 3MF5A 3V9ZA 3T1HJ 3NCPA 4B08A 5AQJA 1PO6A 2BJ7A 4MT1A 1UWBB 1LWFB 3WDOA 2YBVA 3K8VA 5SZTA 1SKSA 3ZSQA 2JGUA 1NK9A 5JS1A 2HNZB 2C22A 3AOCA 5CAAA 1EP4B 4CEDA 2E2QA 1RTJB 3QYYA 3CC4N 1RHQB 4DTNA 3VOVA 1MU2A 2VU5A 3FMWA 2H5IB 3BPSP 1RDAA 3G9CA 2G8FA 1RBLA 1F5CA 4IRDA 5BR8J 1KR4A 1ZAWA 4CJSA 2HFUA 5AXMA 2RE2A 3NS6A 1K0VA 2E20A 1XBWA 1XNQF 5LSRA 3QRQA 1MN7A 3CTRA 1YVFA 2YY3A 5H1SQ 4IBNA 4A46A 5M2UA 2LQBA 5C15A 1WOQA 2W7PA 2D3UA 3IWLA 4OV6A 1FDAA 4FZVA 2K06A 3IUCA 2O8DB 5G0RB 2QKKA 4WXOA 1HPMA 5IWAJ 5L9XA 4Z7CA 4NLTA 3VGSA 3JAMY 4ZP9A 1S7IA 2XM3A 1FXDA 3R5JB 1U2VB 3RAXA 2A18A 3DRRB 2ZM6J 2OD4A 3L4BC 3HULA 2AU0A 3VA0A 3DLLL 3Q8UA 1JLFB 1RKIA 1MNEA 4A8OA 1S9GA 2ASMA 2R42A 3ZEUA 4ED6A 1IWGA 1JLQA 5KT4A 3CM5A 2AW0A 3CIZA 4HR2A 3PIOL 4KPCA 2QLBB 3CCSS 4AILC 5FLXU 3MEEA 2XO6A 2Q79A 3PW0A 5B8HA 4FJLA 4DSIA 4BBYA 4CEAA 3WIUA 2HNYA 4X4PA 4JS4A 2QWNA 1FT8A 4FLZA 2RRNA 2ZHOA 3MEGA 4OYZA 3KLGA 2GO8A 1PAUB 2ZC4A 1F5AA 5E3PA 2V9WA 4E8UA 3GZ7A 5JLHA 1Y3JA 2V5HG 3R6GB 3W64A 1RYRA 1N48A 1K8KA 1Q53A 2QA1A 3L7OA 1R8PA 3UN3A 1U1NA 5BPNA 3I56N 4LF6F 2F40A 2XEXA 2CQGA 2XY7A 3KLFA 4DTXA 1Y4ZB 4ZVUB 2P5GA 2VZ9A 3T5KA 1TKTA 4CTAB 1MMDA 4P75A 4M3RA 1WEYA 3LDOA 3THWB 3SDEA 1NLVA 4RBVA 4IG3A 1E6YA 2CPDA 3BQ2A 3BEXA 4DV5J 3E01A 4LSNB 3RMDA 2GHVC 4J9OA 4U96A 4H5TA 4GKJK 3WXMB 5AQHA 1X4GA 3KUHA 4OZ5A 2G8WA 2D1KA 3LGMA 2A2CA 3VENA 3MXHP 1YJ9S 1JLCA 1EETA 1T3OA 4DR6J 2LDYA 2RUGA 4X4UA 2GW8A 4EI2A 2WB1D 3W62A 3LDPA 1LK5A 3UVJB 2WBNA 4DL2A 2EBEA 3HSZA 2KKHA 1Y3KA 4JKFA 3TAPA 2ZNYA 2L48A 1BO5O 1T0TV 1NB2A 2V7YA 4OJ1A 2JSXA 2XWYA 3QT8A 3FRZA 3RYLA 4DV2K 3R2DJ 2M0GB 3VQQA 2HAIA 4MTPA 3KK3A 4RW6A 3HKZD 2HNYB 1YBAA 5C25A 3BM7A 2X1AA 2GAHC 1SCJB 3OR1A 4KHMA 1TYQA 4ISGA 1SH3A 1WC4A 4O3OA 3Q7CA 3MAAB 5KFRA 2AA4A 1GTEA 3ITHA 4M8LA 1ZPVA 2LU1A 3BH6B 4PPDA 3GIJA 1T05A 2AHOB 4C3LA 4IFYA 1CJVA 2PFFB 3M8QB 4WIQA 2RDJA 3A5NC 4BRNA 4IO1A 3KLIA 4GKKF 2KFZA 2VG5A 4FL9A 2HZAA 1EQYA 2DRAA 3P31A 3C14B 4PYDA 3MECB 4DV2F 4K4XA 2CADA 3VGTA 3VQEA 4FLTA 3H3OB 3J80O 3M2VB 4BC3A 4FBTA 1FKOB 2OH2A 4ED1A 2K8GA 2X6NA 3O3LA 4CECA 2AIRB 3LO3A 2R7WA 3KKRA 4H8KA 2FC9A 3RMCA 2MHNA 1LNQA 1B9DA 5IT0A 3IM8A 2DHXA 3MWPA 3SUPA 2N7YA 1YJWS 3AODA 2A0FB 5DGAA 3TAQA 3PIPQ 4GW6A 1NGCA 3CF5Q 2L08A 2XYHB 3MXJA 1SC4B 4F4WA 2AZ1A 2LXUA 4TVAB 2HHVA 1JLBA 2ZITA 4KB1A 3BF3A 3CNQP 3D1QA 1VSLA 1VR6A 2DO0A 4AHCA 3SUNA 3L7UA 4I64A 1RHMB 4C8YA 1H98A 2C3MA 3CQXA 3BP8A 2BACA 2NSBA 3JSRA 3PJWA 5F9NA 3KK3B 1RABB 2IJRA 2KZMA 1ICEB 1WC3A 3NOGA 3DCAA 3WHIA 3QJJA 2IPOB 4ILGB 2R2SA 2MMYA 2DH8A 4YOWA 3KLHA 3R5AA 1S7HA 4F04B 2OPSA 4YMEA 3OR1B 1TYQB 3AARA 1Y97A 1HI1A 1P8GA 4CQ1A 1D0EA 1VIOA 3VGUA 1XR5A 2WVFA 1TAUA 2UXBJ 5B0AA 2RMLA 4HACA 1X9WA 1TTHB 3M2UB 1ASVA 3I9ZA 1ACMB 1CJVB 3Q86A 4DR3J 2ZQBA 2ZGYA 3ZSRA 2WVBA 3CPWR 2WRMA 4R79A 1QHTA 2MQNA 4A48A 2AV5A 3VA3A 4XK8C 2ETJA 1RFQA 4F4YA 4RW8B 5F8IA 1BU6O 2CPHA 3SNNA 2JWLA 3EGZA 1VLYA 1TFYA 4B1UB 3T5HA 1MLAA 1WHWA 1S12A 2CUYA 2VQEK 3AA2A 2A5XA 2VC0A 2IM0A 1WNSA 4ENOA 3HFKA 2YTCA 1VQKN 3DLGB 1WG1A 3T9NA 1UVIA 3MTKA 4P73A 3B54A 3DXBA 1VSHA 1XNRK 4J9PA 1U47A 4B3TJ 2V8GA 2A41A 1H7XA 4I1TA 4V19S 1QAIA 2NNWA 1FEEA 3MN7A 3QAUA 5IQQA 1XN9A 3VQ7A 2QIFA 3G4SS 2NZTA 1X31C 1RI7A 4MK9A 3MMVA 1RB0A 3MM9A 4OHZA 3D2WA 2ZJRL 4IH5A 2QA4N 3BR8A 2FJBB 3HBTA 3IWNC 4E98A 4PKHA 3VF0B 5KFHA 3LALA 2O8BB 1JJ2M 3FEZA 4QWDA 2HBYB 2VQEF 1WTFA 5B0FA 1YUWA 3C15B 2OKQA 2HNDA 4CJFA 3ENBA 1WI6A 1OS5A 1NGEA 2QC3A 2AJ1A 3FKBA 4RCHA 2L9DA 1GAOA 3TWZA 4PXBA 1XNRF 2P9IB 4ECZA 3DLKA 3B6BA 1CJKA 2V7ZA 1JXVA 4C6AA 4L6V3 3GILA 1C0FA 2EI5A 4FLUA 5E41A 5C2DA 4FPBA 1KN6A 2KG1A 4P7VA 5L38A 1YKWA 1TKDA 2QZ8A 2RJZA 2ZDOA 4B9NA 4G65A 2E1MC 4QOZB 4OLBA 4I6AA 4C0HA 4PXCA 2P9KA 1N88A 4WF9Q 4FZYA 1NZAA 3PXGa 3E2EA 1NGBA 1KCFA 3UDVA 4CGFA 5KT7A 4G1QB 3H2LA 3TTCA 1WC1A 2YHAA 2QX0A 3MMBB 5ETPA 3IGVA 1CZAN 5HJYA 1HBMA 2F65A 5ITHA 1BI4A 2EFVA 4ITSA 1RCOB 3MUMP 2J6UA 3MX5A 4USMA 1EXQA 1RT4A 1RWNB 1MWYA 3NGRA 1IM6A 2G0JA 4B3MJ 5LMUF 2VB6A 3OY9A 1NHVA 3A1YG 2D4WA 2GX8A 2IAJA 1WC6A 2ZUAA 1Q7YO 3CUNA 5GAGI 3CFOA 5KGXA 3MR3A 1K73O 3VQ8A 3VAKA 1NNEA 1JX4A 4P71A 1GLLO 3I33A 4WIIA 3RJMB 3CCQS 1JL2A 4BVPA 1NK7A 4BR0A 3ZZRA 3LL3A 3UKUA 1RDBA 1QY7A 3NF6A 2FJEB 4KHPJ 2I6WA 1YXQA 4AHSA 2HRUA 4CP5A 1J2VA 2E1PA 3KHGA 1RU2A 1PGZA 2KVQE 1WI8A 3M30A 4CLPA 3AD7C 4O3PA 3NY0A 3OL8A 4NEYA 4FF1A 2P9LA 3M9MB 5L39A 5D4NA 3VQ4A 1RAGB 2HURA 2CRLA 3FDSA 1NJIO 1UOCA 3CDAA 1Z6RA 4HTUA 5FRMA 1RT7B 2OEMA 3D2EB 1VQ4S 4ZP7A 2IY5B 3QIOA 2YH0A 5DRKA 4B9UA 3VGKA 3CJQA 4V1Ak 4ZVHA 2JVRA 3LP1A 5KFGA 5F9LA 2UUCJ 4X62J 4LF4K 2YHWA 3ZC4A 2M8DB 1IKXB 3P39A 5KRSA 2WVDA 4CEQA 4GVBA 1C1BA 1JXLA 2EFGA 3BGOP 1J5OA 2WOMB 4DR6K 1CS4B 3QWPA 3GBTA 3M8YA 2V2QA 3VETA 4TQSA 2IIHA 1RTIB 3EKUA 3VGMA 3CCRS 1E3MA 1C2PA 4P72A 5C0YA 1UEVA 2GIRA 3KZBA 3D7SB 3V4IA 3OW2M 1L3VA 5DZ7A 2CJAA 3H2VE 2ZE2A 4DTUA 1CQNA 3P5TL 3OYLA 2ZBRA 4KKOA 2KN4A 3QGGA 2QT7A 3TR8A 3E1YA 4LF4F 4YB1P 1RDDA 2E1AA 1QJHA 3DJCA 2JEIA 3R8YA 4ZTFA 5AQQA 1JCEA 1XHZA 2RHSB 4GV6A 2HKEA 1IKWA 3OHAA 2ZC3A 3AO5A 2YWWA 2LXFA 1TUYA 3CO0P 2BA9A 4WFNL 1JKHA 4A8SA 2Y1JA 3TARA 1KP6A 3MD3A 3BH7B 4K7QA 2MQ8A 2QTDA 4GVMA 4URGA 2KJWA 4JLHA 3KD5E 3NWGA 3A8EA 2LMIA 2FGCA 5HVFA 2DPJA 4WE1A 1GOBA 2ZOMA 4QPTA 4NLGA 5KT3A 3WNHA 4CF1A 1S6UA 3TW0A 1RT3A 1VSEA 1YIJN 1REVA 4CESA 5F3ZA 3W60A 2QLFB 3MURP 3OYHA 2K2PA 1U1PA 1BY9A 3UR0A 4NXMJ 2DHGA 4FWSA 4ZP6A 1I51B 3G2XA 2V51B 2NXUA 1AFIA 3H3NO 4F4ZA 3CDBA 3N4QA 3H1QA 3E51A 4PY5A 5HROA 5E33A 1KAZA 1BWVA 2ZVIA 1YSJA 3TEGA 3GYXB 4Q45A 1HKCA 2W2QP 2Z1IA 5CZVA 4R8UA 1OPIA 1HWKA 2E2NA 5KFKA 3KUGA 4CLYA 5J2NB 4ES3A 1GMWD 1HWIA 1SJRA 3CMQA 3W5YA 1Q8BA 2X1BA 1BHLA 2OD6A 3O1LA 1HI0P 1DT9A 2D0CA 3WQUA 3LPYA 3UFCX 3ZTQA 3KHHA 4OYIA 3AY0A 3QRRA 1HPZA 2NXCA 3SBMA 4ALZA 1LWCA 3IRWP 3Q8VA 3OJUA 3EY1A 3V4MA 2L41A 3NBPB 3KJFB 1ZM3A 4FWPA 1W0HA 4CO2A 3FZFA 3HKWA 4DU4A 3N6NA 2V34A 4C8KA 4YB7A 2V2ZA 3FEYB 3D9BA 3FGUA 1TV6A 4CGDA 2GNKA 1JKHB 3TWHA 4DSKA 1U45A 4OZLA 4CLUA 3NS7B 1LW0B 2C2MB 3HOSA 2PEHA 3TAFA 4B8AB 4EGLA 4W5TA 3DRPB 4BGBA 4KHNA 4NLXA 3IBCB 4C11A 3G71S 5HBMB 2VWKA 1R0BG 4J2AA 3BBFA 5AQXA 1VSDA 2XSJB 4WE1B 3D67A 2MKIA 1V4SA 2X1GA 4CGIA 1HHQA 3CERA 3O6QA 5FLXO 4DFKA 3MAQA 1LXNA 1RJJA 2FY1A 3G96A 3ZTRA 3M6UA 2ZWHA 2DNLA 1RT1A 4URQU 4JKGB 4CHOA 1Y9OA 4NLUA 2C3PA 3M6WA 4K8XA 1YDLA 4C7QA 5AXKA 3IS9A 2DTJA 4UQGA 2M70A 1NDKA 4BQLA 4OJGA 1BQNB 1U1RA 3VQAA 1JNZB 3BO2A 4RU9A 4FDFA 4MIAA 3C95A 3GONA 4E7KA 2MLZA 3ZZZA 4QPXA 4ZPWR 4ZHRB 3VV2B 1WSIA 5KRTA 1N5QA 4IEIA 2P9PA 3VWSA 3ETMA 5E3CA 3MHYA 1VJQA 3CD6S 3H5UA 4KH0B 3HM8A 2HFNA 4J9VA 1HL6A 4CM2A 1K6YA 5KFQA 3WC2A 3THPA 1H72C 4H0VB 3IM9A 3B8HA 2CGKA 4FZXC 5FIIA 3PX4A 2AZ3A 2D69A 4DQQA 3VR1A 2Z56B 5DDQC 3G86A 1Q95G 3NWRA 2G9OA 4KO0A 1BISA 1VQMN 4AQYK 1V9OA 2PMZD 3GIIA 5C7PA 1X9JA 3J7YI 3CT9A 5B0CA 2B4VA 4CJPA 2J0XA 4B3OA 1HW9A 4C11B 1HBUB 4B9TA 2FBTA 1OJ4A 2AT1B 1ESVA 2KFYA 1O0PA 2JC1A 1N5VA 1L3KA 2Z8QA 4L3NA 5DG7A 4USKA 3DOKA 2EKNA 2NXJA 2HS0A 4BR9A 2NZ4A 1D9FA 1RT2B 3D0PA 5F8GA 1U0HA 2PO4A 3JQMA 1AXQA 2J0SD 1KWMA 2DH7A 1FRMA 1E6VA 5LSLA 2X74A 1YWXA 4LRCA 4OLOA 2YNIA 4AD6A 4O3QA 1GXUA 2DCLA 3HSCA 3IS9B 2VWBA 4AQYF 2HLTA 3OYMA 1FK9A 2DVIA 4JYAK 4BRGA 2IA6A 2CDQA 2F8HA 2LLZA 2XHBA 4WXWA 4DV7J 3HOTA 5ELZA 2HBZB 5KFPA 3HVWA 3OFHA 3PKYA 5DM6L 2VPXB 4ETXA 5AFUA 5EDWA 4RUCA 3DRYA 1T9XA 2E2PA 5ETKA 4YB6A 2E6LA 3D4JA 3R1LA 4DV1F 5I4MA 5CZ1A 2KW4A 2LQ5A 4RUBA 1YJUA 3CCJN 1V3SA 5DDOC 3FR0A 3QEWA 3AVJA 1ZM4A 4K5RA 4ANEA 1XHXA 3THYB 3GCWP 3W65A 3CCLS 1PYSB 3DLHA 2XMVA 2WBMA 2ZH7A 1CZ9A 3IN5A 4BE0A 3MR6A 4A8FA 4FJXA 2HHXA 2VL1A 4KHPK 1TL3A 1HIYA 5THWA 2VONA 2MJNA 2Q0RA 4ZVOB 2Y9HA 2VG6B 2IMWP 4PWDA 1YTAA 1FD8A 4K8RA 4KO0B 4JYAF 4DMZA 1VSJA 3N4PA 3SCKE 1VQYA 2ZHBA 5M1OA 3A5OC 1OIAA 4O4GB 3VZIA 4K4WA 1M1KO 2B4UA 4H5RA 1U2FA 4DTRA 3ULHA 1J5EK 1SJ4P 2V67A 4RKUC 4WQ5A 4M7YA 3SYZA 5GMEA 3ALYA 3C6AA 3I4PA 1TK8A 1B0PA 3O80A 1V5IB 3THXA 3N28A 5C24B 1HYVA 3D3CJ 3SBGA 3I0RB 3R97A 4X62K 3DM2B 3EGVA 1GLBG 3PYGA 2XO7A 4IR1A 2FVRA 3POTB 1S1VB 4EMDA 3BYPA 1X5PA 3PIPL 2FJXA 3CCWA 1C0TA 2VICA 3UIQA 4JV0A 3CF5L 3L7PA 1WUUA 1V6HA 1GOCA 1YI2S 1FK9B 1XC9A 1QE1A 2RB7A 2VFVA 3SZ2A 1J5EF 5CCMA 2YX1A 1OH5A 2ZD1B 2HK3A 2H9ZA 2WFBA 4P10A 3W61A 4CK1A 4JK8A 2VF3A 1EKRA 5AXLA 3KJVA 1BMQB 2YKNA 4ZLNA 2V2VA 1HNVA 1ZA1B 3L09A 3EPIA 1ATSA 2I1RA 3H20A 1U48A 1JJ4A 3M6GA 1X3MA 5EXWA 3ZLJA 3J81Y 1DRZA 3CCVS 1LW2B 4Y2MA 2M52A 3W2VA 3VGVA 2X78A 3GL1A 3BDPA 4O55A 4E1NA 1ZS6A 1FRHA 2MEWA 2N4DA 1YLXA 2AJFE 4OI2A 2OFHX 1KHVA 4EBCA 4CD3A 1N4LA 3HI0A 3ZSOA 3OFFA 2DNQA 4BQZA 3DFEA 1NZ8A 1BC6A 2KU7A 4P2MA 4CYUB 3NFAA 3AXMA 5M1QA 2F1FA 3THXB 3OYBA 1L3TA 3HVTA 2YH1A 1M5HA 5KT5A 5KAKA 5HRRA 2DNHA 5B0EA 3UW1A 3EZWA 1I5OB 1HBNB 4JOUA 1WDDA 3CETA 2DK2A 2N3OA 4KHWA 2P9GA 4R5PB 4YQWA 2OPPA 3GG4A 2A3ZA 4LFBJ 3CJ7A 3SV4A 2E1ZA 5DETA 3LAKA 2ZBCA 4DV0J 4H5VA 1K8AT 4ILRA 2IVOA 2PDAA 2IBOA 1IXKA 2A1RA 4B3SK 4X65J 2J7KA 3B82A 2ATQA 4CJ5A 1YZ6A 2FLPA 2OTJS 4ANCA 5DG8A 2DEJA 3AJDA 5F8JA 3O9RA 2BJEA 3VQTA 4G9ZA 2HGNA 3BJYA 2QKBA 4BREA 1H73A 1NGJA 3U3GA 4LF7J 2QE5A 3VAHA 4AHUA 5EX5A 3BF1A 5MLCQ 5KFZA 2OJ3A 2KH9A 4NLPA 2HMPA 4ZTJA 2P9NB 1TU0B 3DKDA 1ZBSA 4FWQA 2D3ZA 3F56A 2W24A 1UETA 3AQOA 2DGTA 4PUOA 2XQCA 3K89A 4XAKA 5A8KA 3H4BA 3HHDA 2HGMA 1NOZA 4JKAA 5JS2A 2ASJA 1X5TA 4B3SF 1TFWA 1NMDA 4KHYA 4RLEA 3IRXB 2BMBA 4WF9L 2KRBA 2V4QA 4Z0UA 4CIGA 2OA8A 1N34K 3HVAA 4OHVA 2GMHA 3IAYA 4CBWA 1KLMB 1W7WA 3AVCA 1Q78A 5AQIA 2O8CB 4LD0A 4Y1DA 9RUBA 3LP3A 2FHOB 4LH5A 2F4VK 3CPWM 4CHNA 1QSSA 2ROPA 1C1CA 2F8EX 3BDEA 1YTUA 1NBWA 4RNMA 2KT2A 4ELTA 1LFWA 4XEIA 4BRKA 4RBUA 1ZBUA 2QLXA 2OCEA 4DWIA 3IMQJ 1PYTA 2YWKA 1W25A 4ELVA 3MPYA 3OVNA 4NCBA 4YY3F 3F0NA 3WQTA 5C10A 4I6MA 3OTOK 4X66J 3VAMA 4B9MA 1FRLA 3TTDA 4DG1A 4DL3A 3OTDA 1UVLA 2NRVA 3GWCA 1R7IA 3FBCA 4IOCQ 3SCJE 1N34F 4JD2A 2AX1A 2B8PA 4NRTA 3V9UA 4HHHA 2CAJA 4KREA 5LM7E 5K20B 2F4VF 2IC3A 1QAJA 2UVRA 1S6QA 4LFAJ 4KTWA 1HD1A 3MDFA 2UUAJ 2IVPA 4K43A 2CNOB 4CEFA 1IR0A 2RF2B 2RDIA 2UV8G 1JLAB 4Y0WA 5FPEA 4OZJA 2ZH5A 4C0BA 1BUXA 1A6LA 3LWMA 4EEYA 4ZVGA 5JMNA 5HATA 3MM5A 3CO9A 4CERA 5J1PA 3G10A 5BJRA 3HLUA 3OTOF 2VG7B 1E4FT 4DB3A 1HNXJ 5J1EB 3OJSA 4PUOB 3DXMA 4RNOA 4USIA 4IFVA 2GAGC 2Z0GA 3H59A 4OPHA 3VAFA 3QEVA 2EC0A 3QQCD 3KWMA 4QIEA 3R3LA 5E84A 4DR7J 2IGIA 3MAHA 1WTBA 2HHUA 1GLCG 1RBVA 1U8WA 2Q6CA 2I7PA 2CJQA 1YJ7A 2E1YA 2X7IA 3GJQB 2XWXA 1X4EA 1YJNS 4HHJA 2W01A 3R5GA 4DQRA 4FM0A 1PAEX 1T9UA 2QXFA 1YITS 5KFWA 2IVFB 5AQPA 3QRPA 1ASUA 1S1UB 4HTLA 1U6BA 2DHSA 2DGXA 3LF0A 2R7RA 2HGLA 5CA5A 4CJEA 2V8PA 2Q2RA 1SKWA 1GMVA 5ETRA 1BA0A 3PR5B 4QIFA 2B4JA 2U1AA 4CWBA 1MDUB 4JI3J 5I3UB 4L75A 1GLDG 3TSQA 3LPEA 4A47A 1CULA 4GVLA 1R89A 3H4DA 3ET6A 1K47A 4H4KA 5DQIA 3BBCA 3UWTA 1S6PB 2C42A 5E2QA 2QWMA 3JS6A 4WWSA 4YORA 4CO5A 2N3LA 4RU2A 1F5BA 1XR7A 2D74B 2IC3B 1N0VC 5F8LA 5H9FK 4MK8A 3ENVA 1WEXA 2H5JB 4IG0B 2W9BB 1HWJA 5KT2A 1H1VA 2UU9F 1VQNN 1JMTA 4ZCLA 4HKQA 4W5RA 2XMMA 4DPUA 3M2RB 1HR0K 1VQ6N 2HRYA 3CE8A 2QWOA 3I5BA 2PYJA 2Q43A 3GP9A 4C1NK 2CZ4A 3AV9A 4P2SA 1S9EB 2WVEA 2E7VA 3C16B 1H2VZ 4JI4J 1Q81T 3M1FA 3TQEA 1ZETA 1G15A 5H9EK 4WFYA 1TL1B 2R4FA 3HFVA 4B1YB 3UNGC 5HAOA 3BUZB 3UKRA 3V6DB 3HSGA 4OQJA 2RVJA 5LXRA 2MXYA 3MEKA 1VSMA 3OXLA 3UE2A 3WEEA 1IKVB 4B3RJ 1UZHA 1IR2A 1WACA 4M3TA 4EAHD 3CCUS 4BWMA 4F7VA 1ATRA 1LQ9A 2D9PA 2Z30B 1HR0F 2EPIA 1U7LA 1N6QA 1UFWA 1WG5A 5EWFA 2WONB 3QGPA 1MWMA 4QIWD 3EL2A 4DV6J 4JNEA 4BRLA 5KFAA 2AD9A 4OZ2A 2OIHA 4DPXA 2JLGA 2VPYB 3FBFA 1F3VA 2JDJA 2BQRA 4IWVA 1Y5LB 3BYRA 2B5JA 1M5SA 2F9JA 2ATLA 3AOBA 1BHNA 6FD1A 3H2UB 1RTHB 3IAM9 3M6XA 1TK0A 2DNRA 3MCSA 1JXBA 3RMAA 5HP1A 1B0VA 1NH8A 5T7BA 2YKMA 2KM8C 3AAWB 2W9AA 3TP2A 3CXCR 1C0UA 3TVKA 1OPZA 3MFHA 3KK1A 2PGCA 4ER8A 2HVIA 3FFIA 3KK2B 4OX6A 4BC9A 1FE0A 3J8AA 1HFEL 3ZO7A 4U95A 4BRDA 5CYQA 4JRQA 2WCXA 1IJEB 1EIYB 4CZCA 4WQ5C 4I69A 4D3HA 2GJ2A 4PQAA 3OLBA 1HNWJ 4A8MP 1BG3A 4CF8A 5AE1A 3VF6A 3A12A 2RQKA 4LBIA 2HBRB 2CWXA 4WJBA 4PWUA 2VODA 1XR6A 1Z25A 3HHLA 4GRSA 2C3YA 4NE9C 1QD1A 1O5JA 4QS9A 1D8ZA 3M8PA 2W2OP 4AUKA 4HCCA 5LL6d 4N8OA 2ITMA 2Z1GA 1AB8A 1T9YA 1M5KC 3K9KA 4HT5A 1SC1B 3PYEA 2EWSA 2N82B 3DRSB 4NXNK 1N5YB 1X4CA 3AB4B 2A42A 1S79A 3WEEB 3CC7S 3DOLA 3C2PA 2AJ4A 3B6PA 2OPRA 3N5FA 4AHTA 3W5XA 4IDKA 3H40A 1VQPN 1PKUA 3HXMA 4ID8A 1IBLJ 1IG8A 3HP6A 2JC0A 3CHWA 2YWHA 2QYGA 1UCNA 2RH3A 2VASA 4MQ3A 4DR2J 4DV0K 1FRXA 2F9TA 3SAFA 3KHLA 2GVZA 3WUHA 2GO9A 2MKHA 3OYGA 5CHCB 5IC6B 3J7YP 1TMJA 1IKYB 4NASA 2YWEA 3SQ2A 4NXNF 4JHDB 4WTOB 2JEGA 4ZPVR 5HQ8A 3G87A 3MMAA 1RAHB 4IUFA 4E7HA 2G8KA 3AA4A 4L74A 3VAIA 4OFZA 2YKMB 4F02A 3MK6A 1HBOB 4QIGA 4TY8B 4CLWA 2CZ9A 4J9MA 3MCOA 2G0IA 4QZVB 3UPFA 1ELOA 2RU3A 2BQ3A 4DV0F 2JLFA 1MWZA 3MGJA 2B51A 3PM9A 3ENOA 4OHYA 3QDKA 2KB2A 2XMTA 4ILMA 1VHXA 4ZDNA 3D0HE 3D2FA 1A5WA 3QEPA 4DX6A 1U2RA 1XMOK 2HFVA 1SIZA 3M1VA 3KWIA 2EBGA 1IBKJ 4LC9B 1XC3A 3CJ5A 2M4MA 3VQCA 3WNFA 1Y7PA 4K5SA 5A8WB 2GMLA 4OKKA 5H1SV 4JP8A 2EG1A 4ILJA 2JEJA 1NGHA 5DLGA 2XBPA 3AVGA 2D0BA 5AQVA 4GV9A 4U9RA 2ZBQA 3SCIE 1K9MT 4ZCKA 2R7VA 5KFJA 2OEKA 3T5JA 2IJFA 4OPJA 2W6LA 2GGPB 1X5SA 1SQFA 4CI6A 3AVNA 1VCTA 5CXTA 3CG7A 4JI7K 4CE9A 1SUQB 4CDIA 2ZH6A 3CI5A 3PJ9A 4I0WA 2CYYA 1XMOF 1N52B 1YHQS 3HMJG 1FXRA 4TYBA 3T7ZA 2MZRA 1NSAA 3KHRA 4MJKA 2HIQA 1FF2A 3GV5B 4ED7A 3I8BA 3OTCA 3DLJA 4LFAK 1FXLA 3Q8SB 4ZVEA 2ZDPA 2UUAK 2J5AA 4YR0A 2XLKA 3NL0A 3IG1A 1Q79A 4RNHA 4JS5A 3D54A 3IFEA 4L72B 2SXLA 3RAQA 4UUWA 1KQSR 3JTNA 4C48A 1MMLA 4LF8J 4DSLA 4DMNA 1GLEG 5EWGA 4DL7A 1HNXK 2YJEA 4JI7F 5K8OA 2GJFA 3U9DA 3B6OA 3OYKA 1U0SA 1GMUA 2MGZB 3OFEA 1T8EA 1N56A 2HVHA 4KBIA 2APOA 2YWFA 3DOMB 5E0OA 4HEA9 4V19J 1RAJA 3K5OA 1RWWB 1N0UA 3M8WA 1IUJA 4K4TA 1B3TA 4ECVA 2IVYA 2B4OA 3M1VB 1H2UX 1CJTB 3HSDA 3KJNB 4K2JA 5FDLA 4GY2B 1CSJA 4JI0J 2MZQA 1WC0A 1QZ5A 4C1NI 4CFBA 2V4JA 2CNKB 4X64J 1VQ7S 2A1BA 1XUPO 2DO4A 2MJUA 3S41A 2LA4A 3EWGA 2RSQA 4CIEA 1F9EB 1RU1A 3LP0B 1S1XA 3MCAB 2HVZA 1LWEA 4O5FA 2PC6A 3BBBA 5FLXY 3GCXP 3PW5A 1QAXA 4KPYA 3I9V9 2CQHA 4YOVA 1G3OA 5AJ3J 4BR2A 1GLAG 5B08A 1WF2A 4JI6J 1HHTP 2JX2A 4NOHA 2OO4A 2AYGA 2J8SA 1FKPA 1RAOA 2YNFA 2RAQA 2IDLA 3H46O 4I2PB 3PG9A 4DUYJ 3SQGA 3VEYA 1QHAA 2ZHAA 4QBUA 3WX4A 3J80U 1HNZK 2XGQA 3TAGA 1P9YA 2QTWA 3QNWB 4GV3A 4FSVA 3OVBA 4CF0A 3BGLA 3J7YU 1HI8A 4DN9A 1BA1A 5ETVA 2Q31A 4EO8A 3R5CA 3TTFA 1X4DA 4KI4A 3NDKA 2R2RA 3I55N 4JI4K 1NBEB 1LV5A 4I2QA 2Q3PA 2ROGA 1UWAA 3GV7B 4RWXA 3DGPB 4KHUA 4I6YA 2DJWA 1IBMJ 4ZPBA 4Q0BB 3MPVA 1WOOA 5KFEA 3ISZA 2O4GA 3FGVA 3G8QA 3O4QA 4G1IA 4CFCA 5BPLA 2BKNA 3B78A 3FZ2A 2E5HA 2RIJA 4HHUA 7FDRA 4ZJOA 1TUUA 4YS2A 1HNZF 1BQMA 1Q8IA 3IAS9 3SCXA 3CQYA 3U1NA 1U02A 4H4KC 1X1PA 2WK4A 4HUFA 4DR1K 4ICLA 4NLBA 1U6ZA 1KD1O 1AUDA 4C0OC 1D8YA 2GCFA 2NPFA 1WOSA 3CJTA 5KFNA 3DXKB 3QNNA 1FW6A 4MKYA 1S1XB 2GVDB 1LWEB 2O8EB 3CMAN 3LP2B 1PC4A 3VPZA 3DMJA 4LREA 2I8EA 2X1FA 1JCGA 3TUIC 2O4IA 4FKYA 3IR6B 3SLCA 3IKMA 4BS2A 1TMMA 4OX9J 2CPEA 2MKKA 4FCYA 2MTLA 2YNFB 1WWHA 2W2PP 3IMXA 1VRUA 2ADCA 3L3VA 3FSXA 2H3GX 2CJBA 5GADP 3FQLA 5EU7A 3SQ1A 1RSCA 4DR1F 3UE5A 4P7TA 5B0BA 2RRBA 3QNOA 1HKGA 2F96A 2YKAA 1HQUB 2FZCB 3OUYB 1F6TA 4I7FB 2LXIA 1FD2A 1KBRA 2BR0A 2CQ3A 4JV5K 3HPHA 5J2PA 1FXXA 2J9DE 4FKXA 1IVZA 4IQMA 2KQ2A 1RTDB 1M0SA 2XCPA 3ZT0A 4BRMA 2IRUA 3CM6A 1D3WA 3HL8A 2AEMA 3KLEA 3BREA 5IV4A 4P2XA 1EZZB 3H7HB 1NAQA 1VRTB 4PKGA 1EX8A 3L4IA 1TL4A 5IZHA 2FC8A 2P9UA 3GYGA 1N5TA 2XSFA 3V6JA 1RYSA 3SEOA 3H90A 1SJ1A 2JFDA 2E4LA 3NHGA 3AVIA 4K25A 4JKEA 2IJNA 2YX4A 3EMTA 5GMDA 3DYAB 1PG5B 3CC2S 3HZ6A 1EJ7L 4YDXA 2QA4G 1R6VA 4PG5A 3CDEA 1ATNA 2XZDB 1Q8KA 3FZLA 2CQIA 1G4CA 1P1LA 2P5VA 4F0KA 5LMNJ 4JV5F 1L5UA 2XG8A 1FRJA 3R2CJ 3SAGA 3B8AX 4IOCL 5FJ4A 3MPDA 3ZNUA 2I9SA 5AZIA 1RT6A 4YOTA 2NLXA 3QLHA 3H0PA 4BR7A 4IZ9A 2XYPB 1K0TA 3VQSA 3E66A 4J2EA 5FPNA 4RWTA 3HVRA 4KIAA 4X4VA 3O3GA 2E9TA 1MMNA 5HANA 2XMAA 4HYKA 4KHQA 4AHVA 1HW8A 1WKLA 3Q2TC 4FJ7A 2NRTA 2YXLA 1QVFR 1WEZA 1AZSB 1WSFA 2A6OA 2GQQA 4OI0A 1S22A 4FYXB 4FWRA 4A8KA 1D4XA 4JI2K 3PW2A 2VGMA 3OV7A 1ZA2B 2Q0UA 3HHLC 2OGUA 5CCLA 3G6ES 4OI3A 3CCSN 2J0WA 4M5HA 4ILHA 2XTJP 3U4LA 1VOMA 3K17A 2AEJA 1FEHA 1SAZA 3BGUA 1N36J 3HD1A 4PWWA 1UKUA 4K8ZA 1X60A 2AYEA 2F9DA 3E9OA 3WNEA 3S3NA 4CZLA 3PNIA 4MKBA 4PG6A 1SV5B 2V52B 4KGZB 3BQ0A 1S1TA 4NYOA 1RBRA 2M7SA 3LA0A 4YDDB 2LDIA 1H74A 2BW2A 4CVNE 3L4QA 3RZAA 4BCAA 3T6JA 1IWAA 2HYIB 3U9ZA 1RT5B 2HVDA 1UW9A 4J2BA 2C3UA 4JI2F 4F3TA 1F21A 2P9UB 3ETOA 4KAIA 3ZX3A 4DBQA 1J9AA 2YKQA 2Z1HA 3SI8A 1N32F 4CLTA 4JI1K 2HHHJ 4BRFA 1RHUB 1O51A 4FF3A 3GMGA 4AYBD 3QBWA 2GUIA 2FBXA 3N6MA 3RBDA 4FJ8A 3QPIA 3VQDA 4IRKA 4TYAA 2YQ0A 3QIPA 1YJ9N 4NB4A 4EYIB 1RCXB 2AWZA 5SUHA 3FZMA 1IR1A 3OYJA 2BANA 1RAFB 3UCGA 1EKEA 4LF5J 2VDHA 1N8RT 5JVGQ 4TU9A 2GV9A 3V81A 5J2MB 4NMLA 4ECTA 2OSRA 5HRSA 3BZCA 1RBTA 2BQUA 2YHYA 2CJXB 1RWOB 1ZBTA 2O8FA 1BLUA 1ZXOA 4JI1F 2FHJA 4I68A 4DTSA 2UXCJ 4JV1A 5F3TA 3OSNA 1URNA 1RILA 3MPUB 4WTYA 3ID6A 1VC6A 3PYFA 4DR5K 1RBSA 2PMHA 1RADB 3CJSA 3PHTA 4W4MA 5GAEU 1CJUA 3S01A 5K8NA 4ZKAA 4CD1A 2H51B 1DTQA 4C8MA 3N4WA 1E4GT 2LSNA 2A6MA 1JLGB 4YHHK 4UY8T 1PJ6A 2DHAA 5TKYA 2B6AB 2CQCA 2J9EA 5GADU 1VC0A 1OO0B 2R8KA 3NGKA 1LKZA 2OPQA 3SSSA 4F0MA 4MLHA 2DYAA 4F4AA 4FPRA 3T3FA 4EHTA 1F9HA 2JL9A 3VTHA 1SC3B 2DBBA 1S0NA 2DRBA 1ZPWX 3I5CA 3BS9A 2BM1A 2CGJA 4A62A 2R7YA 3W5ZA 4RUAA 3RWUA 4HVZA 4DR5F 3JAMO 2UUBJ 1J53A 1RHRB 3OBWA 3AVMA 1RNHA 2BW7A 3KVGA 2EFPA 2ZH8A 5GAHI 1T02A 1Y0HA 1EQ0A 2IMOA 3KOAA 2QYCA 1IH7A 1VISA 4KAZA 2EWHA 2K3IA 4YHHF 3P6YC 3FMBA 5AJ3K 1WSEA 3QETA 3AO4A 1VBZA 1X0PA 2E2OA 5EX0A 1C0MA 4CT9A 2QW9A 1NGAA 3SFUA 3C94A 3P8BB 5M1FA 1O13A 2W9CA 3EKSA 5IT9U 2JHEA 4GO5X 1RAIB 2WSEC 2CQ0A 2QL5B 4K4ZA 4IH7A 3G82A 1IO2A 2D1CA 4A8QA 1L3UA 4JI8J 3ZSXA 2ZBPA 3KIOA 4U7CA 2WB4A 3JYTB 4BRQA 3AVLA 1NG9A 1VSKA 4USVA 3C6TB 2XLJA 1HD0A 2VBWA 2LFVA 1DTTA 1VAZA 3OPKA 2XMJA 4NO7A 4WZMA 2H3EB 3MXIA 1HYSB 5J2QA 4OO1J 3CD7A 3NOCA 4PAAA 2AP1A 3NGZA 1IBMK 1VJWA 3MM7B 3OL9A 4ERDA 4C3KA 1KVCA 2VBXA 4FNIA 4N47A 2MKJA 5D3GB 5L1LA 3SMSA 3HHLD 4ZMMA 2R3VA 3VVUA 1HYZA 1NM1A 1TK5A 2NRRA 2LQJA 2DGVA 4KI6A 1TKXB 1VRQC 3CCES 2BE2A 2FHMA 1NGDA 2FHKA 3LZJA 2W2MP 1VQ9S 3VAGA 3U1MA 3MCMA 4K4YA 3ZZ0A 3QO9A 3AGRA 3EUNA 5D0RA 2RU9A 5A0YB 4J37A 1G1XA 3PSFA 1VYAA 3UDLA 3OVSA 2WW4A 3SMZA 4FN5A 3A8YA 1O1WA 2HQCA 3MR5A 4MLEA 4DL6A 4UW2A 1YK9A 2IFXA 1CC8A 1IBMF 1WSVA 3G4SN 1D5AA 3CJBA 3TABA 4E1MA 3LQVA 3GFXA 1N33K 2FZKB 8AT1B 3HD2A 4K0KJ 2GWJA 4OX7A 1QTMA 4KFBB 4M3ZA 3M6VA 4EK2A 1WD6A 2XI2A 4USTA 4YOUA 4CJTA 3LOUA 1YAGA 3P96A 3QFHA 5BPMA 4Y28C 1OSCA 4USUA 3CXCM 2AYMA 1TL7A 4HI1A 4CLZA 4FXDA 1KKHA 4FM2A 1Q9YA 4FK4A 1MU2B 3HJVA 4KE5A 5HOOA 4M5IA 4CO1A 4OZNA 2UXDJ 2HHPA 1KVIA 2I5JA 4GC7A 1N33F 5EUHA 4AT1B 1Z4UA 2EK1A 4A8YA 4BRIA 1OSDA 4OYWA 3MDQA 2IOCA 1NK5A 3LPUA 1GTHA 4JK7A 1RWKB 2F8TA 1VQ5S 4LFCJ 3VF4A 4Q2MA 1L3SA 3Q23A 4A59A 3AVKA 3OHRA 1NMEB 4IO9L 2MHEA 5LMNK 2CJKA 2I38A 1K44A 8RUCA 3QGHA 2DEIA 3GE1A 2QM1A 4WKYA 4ID5A 4CJKA 2F8MA 5L1IA 4RW7A 3MZIA 5HLFA 5D77A 3MMCA 1R0AA 2KHCA 1S10A 4Z4GA 1KRPA 4H0YB 4OI6A 3HHKA 2F5GA 1WELA 1S9GB 3LUYA 5DM6Q 2G0CA 3ZEUB 1JLQB 3PY8A 3LDSA 3VQ5A 2AGQA 2VBZA 4M3YA 3QERA 2G1HA 1HQEA 2QMUB 2B3TB 2E5LK 3TA2A 3MEEB 3AT1B 1KHWA 5AZJA 3RSEA 4GKJF 4PQUA 1IQTA 4PG7A 3KYLA 3ZTPA 4DV3J 4RTFD 3JSMA 2O5DA 2DT9A 1Z2ZA 3MEGB 4FLVA 1RQ0A 3RB4A 3KLGB 4MIWA 4ED0A 1FTCA 2BX6A 1C4CA 1NJXA 5M2RA 2CGLA 4BG9A 3PX0A 2B9EA 3R6MA 4RBTA 2DTUA 3Q83A 1K8KB 3P5BP 4KY3A 2HS4A 3BZQA 1DAXA 4I9QA 1DARA 2KL8A 2XMUA 4Q7AA 4DU7A 4H4OA 2FIUA 2DFEA 2E66A 5AQRA 2FD2A 3EYZA 2OFGX 1SPBP 1Q8LA 4Y65A 5E7OB 3KLFB 5HK4A 4C97A 4YNQA 5KFSA 3D28A 4IYQA 4DPTA 1TKTB 1QS4A 1VQ4N 2E5LF 3SDEB 3TUPA 2MSSA 5JXSA 1MROA 1U1KA 4IG3B 1E6YB 2FQQB 2V69A 4DI6A 3E01B 2HMIA 2C2EA 1MWKA 3TOQA 3KG1A 1Y64A 4IQXA 1I3AA 4NYFA 2G8UA 1EQMA 4Y6IA 3OS2A 2OTLN 3BSNA 5JVHQ 1W97L 4CEOA 3OYEA 4MDBA 3ENQA 4O0NA 1B7YB 4M3XA 1JLCB 1EETB 4NZ0A 1Q1KA 3E9PA 1Q82O 1TUWA 2BE7D 2FJDB 3VTIA 3MOJB 4ZN3A 1EO1A 5KPRA 4QCLA 3PO5A 5CYMA 1IM4A 4Q8EA 2ACYA 4EZ6A 3ZZYA 4AHRA 2CNNB 3GB0A 3QT6A 2G8VA 3TRGA 3M32A 5CE3A 4TLQA 3PRBA 3R7NB 1JK9B 2E1CA 1SKRA 2V8VA 3O8WA 3RRGA 2UXCK 1J6ZA 4LRAA 2DXEA 3ZETA 4KYZA 5IM0A 3SAHA 1FDNA 4DV4J 1NK0A 4RW6B 1DJ0A 5C25B 4JI5J 4F0HA 4QJVA 1WB9A 5C2CA 2W25A 3ZTOA 1FNMA 4LVNP 3D6MB 3OL6A 4FJJA 1KQSM 3PX6A 3QMQA 3CJ2A 1GEHA 2DIVA 2ZZNA 4N41A 4CZFA 3ITHB 4DUZK 5K5MA 3EXYA 3NF7A 3AOAA 1T05B 4GC6A 4IFYB 3ATVA 1S0OA 3S9HA 3KLIB 5DG9A 2VG5B 1WLJA 3IC1A 1KOHA 1X9MA 4DSFA 3VERA 3TNVA 1WHYA 4FYWB 3W8PA 2DGWA 2ZH9A 1DLOA 5F2RA 1T7PA 3K2YA 4FPIA 4CM0A 4ID1A 2DHHA 4E19A 4WFBQ 4X4OA 4LF9K 4IJNA 2JEFA 2QWQA 3NS5A 2B56A 3ILIA 3NCQA 1CEZA 1RLDA 4UF4A 1ZAXA 4QYZJ 3E3XA 5I3PA 1WC5A 3ULEA 1BE4A 3EE3A 3EX7B 4NA3A 4J9QA 2IVMA 4G1PA 3UR3C 1TKZA 4KB0A 1U8SA 4FK0A 4DUZF 1SJFA 4KSEB 4MO5A 1I94K 4HTIA 1FJCA 3EDRB 3U02A 2DNPA 3RU0A 1QVGR 2BV3A 4U67Q 3K5PA 2FJAB 3BSCA 1Q7LB 1JLBB 2QLJB 2HK2A 5F1XA 1UJ4A 3MEDA 3UDCA 4NA1A 1URRA 3T1HK 5AQNA 1VQ8S 2UVUA 1QAYA 4MYTA 2Y1LB 3M32B 3VEZA 2QRRA 3KXDA 4LF9F 4KB7A 4LSLA 2DY1A 2QO3A 2YQ3A 4JI8K 4CT8A 2BVZA 2BRKA 4DQPA 4A5AA 4JV2A 2IIRA 5T7LA 2YX7A 3M8RA 1NB7A 3KLHB 2QWLA 2OPSB 5C2FA 5DO2A 1XNQJ 3KNAA 5B0DA 1I94F 1KAXA 3JQKA 4OJ3A 4ZPAA 5BR8K 4RW9A 4RL1A 2P2CB 5KQ8A 4HACB 3G71N 2QEXS 1WN7A 2EVZA 4OHWA 3PLAA 3QBCA 5HQMA 4B8CA 2UVWA 4IOBA 5HMYA 5JLFA 4IFEA 3VN5A 3T1HF 4JUZA 3QZ7A 5LSOA 3M7VA 4E7IA 1PIEA 1LCUA 1QQNA 3LGHA 4Z4HA 3ZSWA 1DLOB 1S1WA 4NA2A 1RZMA 4JI8F 2E6MA 3S6EA 2KG0A 4C9DA 1WDTA 5IWAK 1W2BR 2CPJA 1FTRA 4HDHA 4NLSA 4BVOA 3M8ZA 3FFKB 5E5NA 3EN9A 1FERA 4O23A 4W5OA 2VD3A 2WC9A 2DNYA 4Z4FA 1OMSA 3ZZOA 5BR8F 3ZT2A 2ZM6K 3IBFB 2L9WA 2DGUA 2WTUA 2VQFJ 2HBJA 3MM6A 2DNMA 3ONQA 3MM9B 4PZVA 2Y0SD 2OP5A 3K0JA 2ZZTA 2C3OA 2VC1A 3CD6N 1IQZA 2IYIA 4NI2A 4W5QA 5C12A 5JUMA 3FZHA 4LMZA 2MY7A 2HNDB 3TZYA 4DKWA 4RX6A 4U7BA 4KTQA 1CVJA 5IWAF 4OYOA 4LSLB 3HPOA 3BN4A 2G2OA 4LF6J 2HF4A 5MLCV 2OZMA 3V9XA 2D0OA 3RVCA 5AQWA 1S4FA 4DFPA 4B9SA 4ES1A 2P6SA 4XH1A 2ZH3A 5AFUH 3DLKB 2ZM6F 1CJKB 3NMAA 4OX8A 4IKFA 1UFKA 5HRPA 2OANA 4F4KA 3AD8C 2E7WA 1Z2LA 2HRTA 3OHBA 1FDDA 3GU0A 2YQ1A 1MWQA 1Y10A 1GXTA 5BRFA 4ZIVA 2JFKA 3CD0A 3CJRA 2IRYA 3TO8A 2P9KB 4WP9A 4DV5K 4PPZA 1VQLS 5KI6A 1RA6A 4LFCK 4CHZA 3ASMA 1YVUA 3BY5A 1T03A 3CULA 1S1WB 4ILLA 2UUTA 2VJVA 1HBMB 5KFLA 1DBDA 1UJ6A 1BI4B 1C0GA 4ZPTR 2O01C 4X4NA 4W98A 3GFHA 5EN1A 3DHXA 1T6CA 2FBVA 2CQBA 4UOCA 1RT4B 3O9SA 5IS2A 4H0PA 3O1BA 4XPCA 3OTBA 3CMES 5T41A 3O44A 3EO3A 1HQ2A 3DI6A 4AL5A 5AQUA 3MPWA 2KXNB 5HRNA 5JVGL 2IAJB 3HI9A 2EEYA 4DTPA 2VPWB 1B70B 3LM9A 5A8RA 1ITPA 1R0CB 3A3OB 4CO3A 2VJUA 2G4BA 1APSA 5DK5A 4QR0A 1Q5VA 1ZBIA 2JZ5A 5M2PA 2BRLA 4DV5F 3DLEA 3RW7A 3QMLA 2CFXA 2HW3A 2KYZA 2O1PA 3C7NA 2DITA 3QIDA 2HS3A 1QVFM 4DR4J 1D09B 3MM8A 1TVRA 1SQKA 3T41A 3SCLE 3CCLN 4O44A 3UKUB 3GQCA 4FWMA 5F0XA 4QQBA 2XRIA 2OHDA 4WYLA 4J9SA 2R8JA 1T3NA 2NUHA 4ECSA 2W4PA 3TVZA 2F7VA 3IGNA 4GKKJ 2NRZA 2BJ9A 4DR6F 4TN2A 1G99A 2IDEA 2B4PA 5GAHP 3M30B 2KJVA 2FHJD 3F9KA 1NU4A 2AEFA 2ZOGA 4DV2J 3S8SA 2J9CA 4NCGA 3CJKA 2P9LB 1FDBA 2ALYB 1XEZA 2XY5A 3C6UA 4JK9A 3R7SB 3CJ8A 5KT6A 4OYPA 3P3DA 4J9KA 1U1LA 4E2FB 2MZTA 5IT9O 3RBZA 4FJKA 5ETTA 1GQEA 4NLQA 3LP1B 1FWKA 1UAWA 4M5JA 1FWPA 4WPAA 2CPFA 1EWRA 1HMVA 2NXEA 5F8MA 3ZT3A 4CZJA 3UCZP 2GBZA 2ZGZA 1JL1A 1WSJA 5BN8A 4BHQA 3FCVA 3BKTA 4LY7A 1GT8A 3C19A 1LWXA 1UPMB 4GVBB 1C1BB 3GR1A 1DKGD 1HKBA 3CQ8A 1J5OB 1QSYA 3K5MA 1YI2N 4MFBA 1HJRA 4NYNA 2X3GA 3EJMA 1NM2A 3NNHA 4LJMA 3DDNA 1D9AA 4H5NA 2P9SA 2NR0A 3NAIA 4DXLA 4YOYA 3W2WA 1WBDA 1PJ5A 2AGPA 3CDWA 1FHTA 3FCHA 2FLOA 2JVOA 3V4IB 2W1BA 2YPZA 3GJSB 3GJTB 5B7WA 2ZE2B 3JSYA 4ZLPA 3LM2A 1SL2A 4PG8A 4KKOB 1VS3A 5CZ2A 1M1HA 2R8HA 1UFLA 1UEUA 1BCOA 4AE5A 3OR2A 3BKFA 5ETMA 2ROEA 2R7UA 4ED3A 1IKWB 2NQPA 3CCVN 2W8KA 7FD1A 3ILJA 5M1NA 4J91A 4G6VB 3ZXWA 2XZTB 2ZJQQ 2VBYA 3F73A 3ENAA 1UWBA 4FXWA 2HHSA 1HHSA 4Y34A 1LWFA 1DZ5A 4ED5A 4HHTA 2UXBK 1UVJA 4H0TB 4CNYA 2V63A 3PTWA 4DR3K 2LEPA 3CFRA 2HNZA 4CEEA 1JCFA 1S99A 2F4FA 2U2FA 1BCMA 1EP4A 3H6EA 4K41A 4ZVSB 3AH6A 1RT3B 1JQGA 1REVB 1SJ3P 3ZCMA 2FY8A 4ED8A 4USWA 4TNOA 5KFDA 2VFUA 1S49A 2J6TA 3W3DA 2I2YA 2E88A 2AYBA 1H7WA 4O3SA 4WYBA 5B09A 3K0SA 3GIKA 4BDYA 2QG9B 4M5NA 5HROB 4B3TK 3AD9C 1GXLA 3KG4A 4R8UB 2UXBF 1DURA 2CG8A 3AO3A 3O08A 4TU8A 4UTGA 2VQEJ 4DR3F 2O8DA 5G0RA 2GV1A 2GUPA 2OTJN 2DKOB 4J9NA 4OZ3A 1Q18A 1KSPA 3P83D 3ZZTA 1U2VA 3J7AP 3HHEA 3QZ8A 3UD5A 1XNRJ 4Y1CA 3K57A 2DCUB 1HPZB 3DRRA 4X4SA 3L6QA 1LWCB 3R1HA 2MQQA 4LIRA 3NGSA 5IV3A 1R8CA 1JLFA 3AHPA 1NGGA 1NHKL 5DQGA 2LEBA 3U27A 1FJEB 1NRKA 3BB5A 3KDOA 2XYGB 4B3TF 4EP4A 2VGNA 1ULRA 4RWWA 3OYIA 5BRDA 4K42A 3VEOA 2PD1A 1M90O 3AA9A 1TV6B 4YP3A 4WU2A 3THTA 2QLWA 4NLVA 4NL5A 4V19X 4CO4A 3O3HA 1NH7A 3JTOA 2B0GA 1LK7A 3KG0A 4OPAA 2RPIA 3X1LB 3WNGA 3W7BA 4DTOA 5GVQA 1VHIA 2LQ9A 2IYGA 4QS7A 1K8AO 3QICA 3TEHB 5EWEA 1RBAA 3MUTP 3A3PB 4XO0A 1V3RA 4WK3A 5LMUJ 5GAHU 1RT1B 3DC2A 4BG8A 3TA1A 5FPMA 3NGIA 2Y8WA 2Z1JA 4PABA 3AA5X 2DPIA 4CTAA 1NK8A 3THWA 4U8YA 3P45B 5DLFA 2QN6B 4B3MK 2YKPA 1HLUA 4DU1A 3CFPA 4LSNA 4DDFA 4XPEA 1AYEA 4A4JA 2NREA 3Q2SC 1C4AA 1NDPA 4OYMA 1F3FA 2VQFK 1UW4A 4CK2A 5KFIA 4XDDA 4Z94A 4O8KA 1UL3A 3QFWA 2YX6A 1UA0A 4ZVPB 2P9PB 2FJWA 1WORA 4U7UD 5KFCA 1FVQA 4R0EA 4JKCA 5E26A 4HWIA 3J81O 1R59O 2MQOA 3X3UA 4UUXA 2FLNA 3U3YA 3UVJA 1WAJA 3H5YA 2D0AA 4LF6K 4HI2A 3FNNA 1JWWA 3TAMA 2MQLA 3HT3A 4KGXB 4B3MF 1IV0A 2XULA 2HBKA 4CJVA 4F26A 4NRUA 1OYDA 3E8OA 3ZYYX 2B7CB 2DB1A 1RLCL 5FPDA 2VQFF 2D5RA 2J7WA 3AGKA 3W66A 4B3OB 2RDDA 4MH8A 3LDLA 1YG0A 2AKWB 2BOPA 3DOKB 3MAAA 2ZVSA 1RDUA 3BSOA 1YT3A 2H65B 1ZAVA 1CG2A 5D4OA 4ZCIA 1EARA 1YJNN 1U0HB 3BSAA 5JVHL 2UUCK 2LKZA 4KHPF 3M8QA 3Q8RB 2ILZA 4QYRA 4FJ9A 1E6VB 2DNZA 1T6DA 4E7JA 1YITN 1F1BB 1WJ9A 3NGUA 2YNIB 4CCHA 3ZT1A 4BRPA 2Z2ZA 3C14A 3MECA 1ZM9A 2EFNA 2V8DA 4FJMA 6AT1B 3P4UB 3M2VA 4USJC 4K4SA 5ETLA 2L9NA 4M5GA 4MKVA 3G6YA 4OIXA 1FKOA 1CBKA