2YNGA

Hiv-1 reverse transcriptase in complex with inhibitor gsk560
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 168
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yngA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yngA05
2YNHB 4H54A 4E0DA 3ZSQA 3O3HA 4IG0A 1ZBFA 3SUQA 1GX5A 4IFVA 3VQAA 2OZSA 4B9VA 4GC6A 4DL4A 4KI4A 1KFSA 4FJJA 3IRXA 1SKSA 4MIAA 2IGIA 3H5UA 2HAIA 2R2SA 3I5CA 3FSIA 1HQUA 3GILA 4DSFA 1D8YA 3KLIB 2P51A 1QAJA 4O3QA 3KLGB 2IAJB 3MTKA 3OYGA 2XO7A 2BDPA 2Z1GA 2RF2A 2HW3A 4EP4A 4KRFA 3ULDA 4NCBA 4N47A 3I0SB 5J1EA 3S3MA 3S3NA 1NNDA 3M8QB 2P1JA 2IBKA 1J5OB 1LWCB 3Q8RB 3QEVA 4FJXA 3V9XA 4DQPA 1X9SA 4B8CA 2WOMA 1DTTA 3L8BA 4F2RA 1TKTB 1BIUA 3SUPA 1TKDA 3RBDA 2A1RA 1MU2B 3HKWA 4J2BA 3V6HA 4H8KA 4MFBB 3OS2A 5HLFB 3MR6A 3V81A 1IKWA 1CZBA 4DG1A 5L1KA 3I0RA 1T03B 3OJSA 4CJRA 1VSKA 4B3OA 4IRDA 1SUQB 3HVAA 1U48A 5CYQB 4I7FA 3NDKA 4ED7A 4KFBA 3VQ7A 2HHSA 3BDPA 1D9DA 4HCBA 4M3RA 3KLVA 2ZE2B 4I2QB 4ECUA 5DLFA 3CDEA 1U04A 2XGPA 4FXDA 1HYVA 1J5OA 3OYFA 1J54A 2JLEA 3K2PA 1BHLA 4NRTA 3NMAA 5J2QB 2XY5A 4PY5A 5I42B 2B5JB 2A1SA 1KHWA 1S6QB 1KSPA 4KTZA 2E4LA 4FJIA 4B9TA 2DFEA 4CEOA 3HK2A 3DRPB 4WZQA 1NK8A 2YNFB 5J2QA 3SCXA 4RW9A 3PX6A 4FK2A 4RW8A 3C6UB 1UWBA 3I0SA 1QS4A 4Q0BA 3DI6B 1A5WA 3D28A 2FLLA 3MR5A 1YTAA 1VRUA 1S6PB 3BSOA 1KHVA 1RAJA 4FJNA 4H4OB 1LAWA 3K58A 4RW7B 5DQGA 4Z4EA 5C5JA 3EYZA 1RT7A 3KHRA 2X74A 5KFZA 5HBMA 2FBVA 5KT6A 5KFHA 3QNOA 1RT2A 4E1NA 4FLZA 4RW6A 4ZPCA 2IM0A 3H40A 4CHNA 2YNHA 1HNIA 1JLFA 2JC0A 4ZHRB 1TK8A 1RYSA 5F9NA 1TK5A 4G1QA 2ZKUA 4ECXA 5KFKA 4KV8A 4NZ0A 4QWDA 1RTJB 2QKKA 4WFZA 4KI6A 4DTXA 5EWFA 4FYDA 2IOCA 2OPSA 5I3UA 2FVRA 1N56A 4ZPBA 1LV5A 4B9UA 3NH2A 5F8HA 1S1XB 4FJGA 4K4VA 1T05B 3NFAA 1WNSA 3SQ2A 4NLVA 2V9WA 2P5OA 3LP2A 4EYIB 5DQHA 2YNGB 4ID5A 4J2DA 3LP0B 4BE0A 1TQLA 4DSLA 2I1RA 2BGGA 4LH5A 3ZSZA 1RT6B 4BDYA 4CEQA 3V6KA 2WTFA 3PW4A 4JRPA 4EZ6A 1LWFB 3M8PA 3Q8QB 4TQRA 2XY7A 3NF6A 1BCMA 1C0TB 3KJVA 4HUEA 4N5SA 4K8ZA 3QIPA 3SPZA 2YHBA 3HVWA 3Q8PB 3CFOA 3NAEA 3HXMA 5L1IA 4CEBA 2OZMA 4MKBA 4AHUA 2G8FA 4B9MA 3UPFA 1Q9XA 4IDKB 1JX4A 3OYNA 4QW9A 5KFYA 3PVXA 4CF8A 3DM2B 3N6NA 1LW0B 4CEAA 4B3OB 4CJVA 1A5XA 3A2FA 1WSEA 3VQQA 1UA1A 5FDLB 2PY5A 3RB4A 3I0RB 1EETA 3DDKA 2GIQA 1TGOA 3I5BA 2D0CA 4CHPA 2WRMA 3HVRA 2GV9A 3HSTB 4UQGA 3T5KA 5J2PA 3RB3A 1XI1A 2OPRB 3OY9A 4X2BA 3AVBA 3T5JA 5CY4A 2VG7A 3K5NA 2YV0X 5KFNA 5KFPA 3IAYA 3HPGA 4Q8EA 2B5JA 4GVMA 3VQ6A 4CEDA 2FLPA 4W5QA 1BGXT 3V1RA 1VSMA 1NK6A 5D3GB 1XC9A 3RWUA 4WE1B 4NLTA 3QEWA 2AX1A 2IS3A 3RB6A 4HUFA 1HNVA 3CFPA 1IKVA 2ASDA 1RBUA 3IRXB 3PW5A 2RN2A 3IG1B 1GOAA 4M42A 2IC3A 3SPYA 4AHTA 4KFBB 3CYMA 3KLEA 4EP5A 4AHVA 4RNFA 4CGGA 2RKIB 3BGRA 2UUTA 3P83D 3JSMB 1S9GB 3NGYA 4E19A 4KKOB 3QZ8A 4FJ8A 5KFJA 1UAXA 3PUFA 2ILZA 2W7PA 1C0UB 1RT5A 2WONA 3KK2A 2C28A 5HLFA 4YP3A 5KRSA 2KTQA 3LDSA 3G0ZA 3OYHA 4C8MA 2ETJA 3H2LA 3V1QA 4CEZA 4KO0A 2O4GA 3GIKA 4PQUB 4K4SA 3KIOA 3T5LA 2W9BA 1BQMA 4DTMA 4ZMMA 3QNNA 2YKMA 1RA6A 4W5OA 4ELVA 4EBCA 1T05A 1SV5B 1KRPA 1RT4B 3QO9B 3OS1A 4NYFA 4C8LA 4KSEB 3M8QA 4J2EA 1HRHA 1YTUA 1JLQB 4M41A 4DSJA 4CHOA 3S9HA 4PUOA 5KG2A 4I9LA 4G3IA 1RA7A 4ZPAA 2FVCA 3P5JA 1VSIA 3KLHB 3OL9A 2HMIA 4IQXA 1NKEA 2F8SA 1NHVA 2R8GA 3OYBA 1T3NA 4IRCA 4FK0A 1QUVA 3NAHA 4EO6A 4MK9A 3OYJA 4NLPA 1JLBB 4TY8B 4Y2AA 1DTQB 2RDJA 3JYTB 1RTIA 4EYHB 1TL3B 5J2PB 4DLEA 2WCXA 1JLCA 4CJ4A 3ZT3A 4CGDA 3ZSOA 1JLEA 2PYLA 4JS5A 1JXLA 1KVBA 2IJFA 3L2WA 5FDLA 3CDUA 1KCFA 3ZT0A 3CFRA 1QTMA 2NUBA 1LW0A 3BGRB 3OL6A 1BCOA 2OA8A 1RT3A 4Y2CA 4CFAA 3DLEB 4DTPA 2HWHA 4QW8A 4NCGA 2AGPA 4I2PA 1Q9YA 1GX6A 1WNEA 3LP1A 3L2RA 5J2NB 1NK9A 3AV9A 4R8UA 1W25A 4Q8FA 3DLRA 3G10A 1SL1A 1ZTWA 1HYZA 4DSEA 4OGEA 3ITHB 3CJ5A 4J9RA 2AU0A 5KG5A 2V4RA 3AO2A 4CESA 3V6JA 1IKYA 4OGCA 1IG9A 4DLGA 3LAKA 2GUIA 3RAXA 2JEGA 3PV8A 5I3UB 3VQPA 3GV8B 1L3SA 3KK1A 4RNOA 3KHGA 4KHQA 3AA4A 4XPEA 2HHXA 2HVHA 3KTQA 2V0NA 3OVNA 1X9MA 2KFNA 3LP2B 4ZP8A 5F8JA 1J53A 3HT3A 3HJFA 4JS4A 3KKSA 1C2PA 4BWMA 4H4MA 1IM4A 2HNDA 3ASMA 3KHLA 2OPQA 1KVCA 4ECSA 1S0MA 2BQRA 4CJFA 4CJ3A 2HB5A 3EZUA 2FC0A 1EETB 3HM9A 2UVUA 4KKOA 4IFYA 5HP1A 3KNAA 2D5RA 4Z0UA 1HPZB 1MU2A 5KFCA 3RMAA 2R8IA 4BDPA 2AJQA 4CGJA 4WXOA 2BE2A 1S10A 2VWKA 2HWIA 1DTTB 4ECQA 5HBMB 4NYZA 2GBZA 1RYRA 1S9FA 3DMJA 1J9AA 3NCIA 4Y3CA 1Q8IA 3MFIA 3KJVB 1U49A 4CFDA 1FXXA 4HHTA 2ATLA 2F96A 2CKWA 2JEIA 3SI8A 4K4XA 4YFUA 2KZZA 1SKWA 3QO9A 4OL8A 1L3UA 5DMRA 1NOYA 3PX0A 5E41A 2B43A 5SZTA 5DGAA 2ZD1A 4DFPA 4J9PA 2R8HA 3OSPA 4KTWA 1CLQA 3AA5X 1RDDA 1KLMB 4CJUA 2RPIA 4I7FB 3BQ0A 2HNZB 4GW6A 2EHGA 4ECRA 3N6MA 4LSLA 3TWHA 3QGHA 1JLGB 4CF2A 4OLBA 4C8KA 3MEDA 4RW4B 4KHNA 4I9QA 2V4QA 3CWJA 4OPJA 1EXQA 4CJSA 4XO0A 3JSMA 3AVJA 2FLNA 1S1WA 1ZBLA 2C2RA 4LQ9A 4M45A 1VSEA 1RTDB 3NGZA 4CK3A 1TL3A 5KRTA 1X9WA 4Z4IA 3DOKA 2WONB 4TLRA 2W42A 3RR8A 3H5XA 4OVLA 3O3GA 3AVMA 3PR5B 3OYIA 4TY9A 1NK7A 1K1SA 1JLCB 1ITGA 1SH0A 4DFJA 5F8NA 2RKIA 2XC9A 3E01A 3TAPA 3DLKA 1CXUA 1KLNA 5EWGA 5KFIA 4CJEA 4CIEA 5KFMA 5KG7A 5D3GA 1BL3A 4DTRA 2JEFA 1QHTA 3LP3A 3LWLA 4CF0A 2XI2A 4E7IA 3QLHB 4DL6A 4J9SA 1QSSA 4E7HA 3OYCA 1JLAB 4DF8A 3KKRA 3CIZA 1I39A 2E6MA 4FJLA 3D0PA 1RBSA 5KT7A 4K4UA 4U6PA 2DFHA 4TYAA 3OLAA 2W9AA 4DL2A 1U45A 2IDOA 4J9QA 4JRQA 4CERA 2X78A 5KG4A 1WLJA 5HRSA 4E7JA 1B92A 5CYMA 3H5SA 1ZBHA 1JLEB 2OPQB 3OHAA 1FKOB 1HNIB 1RTIB 4CEEA 1S97A 4W5TA 4YR3A 3WNHA 5F9LA 3HP9A 3OL8A 4ED6A 4ZTJA 3MEDB 1LAVA 1NOZA 3ZT2A 1ASWA 1JKHA 4FLTA 3V4IB 4RUCA 1IKXB 4KE5A 1ASUA 2QKBA 4LY7A 1IH7A 3HO1A 1NJWA 4B9SA 4QAGA 2HNYB 4CCHA 4RW8B 3DLBA 3OYMA 1IKYB 3KD5E 2AGOA 3EPGA 3MXIA 1F21A 3U3YA 2UVVA 1TP7A 1UOCA 5KFQA 1ZETA 1REVA 3KD1E 4DF4A 1TAQA 3V1OA 4KHWA 3M9OB 3G6VA 4CJ5A 4ECZA 3QIDA 3KK2B 1XWLA 3VA0A 4KHUA 4BE2A 2HHVA 3MECA 4NYNA 4KV8B 2YNIA 3N6LA 2VG6A 1QQCA 1HQEA 5KTQA 1RTDA 1JXBA 2R8JA 2OPPB 4E1MA 4DFKA 1BIZA 1WSIA 1NKCA 1VSLA 3IGVA 4CJKA 4KTQA 4RNNA 4H4OA 4F4YA 4FZYA 3DM2A 4FM0A 4ICLA 5KI6A 4O3RA 1XR7A 1DTQA 2KW4A 4CJPA 4E89A 4GMJB 4M3TA 2VWJA 4BE1A 1SL0A 1IKVB 4KB1A 5L1JA 3K5MA 4K50A 3AVFA 1SV5A 1TKTA 2HHUA 5KFEA 2YKNB 4NLXA 3C6UA 3NBPA 4ZTFA 3VQCA 1SL2A 1C6VA 2HHTA 3G86A 3H5YA 1OS5A 2D3UA 3QGGA 3FQKA 4FBUA 2G8KA 3QIOA 4W5RA 4N76A 5DGBA 4OKEA 2Z1IA 4O4GB 1LWEB 1N4LA 4F3TA 2VG5A 2GC8A 1TVRB 3FFIA 3G6YA 5J2NA 2I5JA 1TK0A 4M3WA 4NLSA 2WB4A 2ITGA 2XY8A 3H08A 1QSYA 4AH9A 4LQ3A 3V9SA 5KG6A 4ZVEA 3DLGA 4DU4A 4IBNA 1I6JA 3F73A 1L5UA 3TABA 5C42B 4HYKA 1A5VA 3TAEA 3VQ8A 1FKPA 3HPOA 3MEGB 3QIPB 3THVA 3CJ3A 5C24B 4E3SA 1N6QA 5L9XA 1JLAA 5KFUA 4NCAA 3AVNA 1Y97A 2J6TA 5FRMA 3BREA 3FRZA 2XGQA 4HTUA 3M9MB 1N48A 3AO4A 3SFGA 2KZMA 3QGIA 1W0HA 2HHQA 3QEPA 4IG3A 1R0AA 3HL8A 4MQ3A 4B9NA 3ZSYA 4YNQA 4ED1A 3VQEA 2F8TA 4ID1A 3Q8SB 3QINA 5J1EB 1D5AA 5SWMA 4BACA 1EX4A 3BSAA 3FQLA 4OPKA 1S6QA 2QK9A 4KHSA 4PQUA 4FLVA 4FJ5A 2BE2B 3CDWA 4NCGB 2FJXA 3OS0A 3LWMA 2O4IA 4U7CA 4KB7A 3AO5A 4ECYA 4EZ9A 3E01B 3IGNA 1TKXA 1D9FA 3C6TA 4E7LA 2IAJA 3VA3A 3MEEA 1S9GA 3RAQA 4K4YA 4M3UA 3I5AA 3KOAA 3V81B 3GIJA 3T3FA 2W8KA 4XIUA 4ECWA 2CJQA 5CYQA 1S48A 5L1LA 2ZD1B 3DYAA 1RT6A 5KFLA 3MEGA 4IKAA 2G8IA 2Z1HA 2KFZA 5CYMB 4OKJA 3ZT1A 1T03A 4MKAA 4DEZA 2W9CA 2Z1JA 4FLUA 3SQ0A 4J9MA 2DPJA 4HCCA 3GV5B 1VRUB 2WOMB 1UA0A 3K57A 4HKQA 4CHZA 4W5NA 4O5BA 4Z4HA 3HP6A 3GYNA 1VRTB 4YR0A 3QEIA 1EP4B 3SUNA 4FM2A 3RRGA 3SV3A 1DLOB 4IH5A 3L2QA 5KGXA 2FJVA 2X6SA 4CEFA 3ZSVA 1LWEA 3VN5A 4O0IA 3E51A 1FK9A 2BANA 4C8NA 2W9BB 2DY4A 4KO0B 1ZYQA 3VQDA 3ZSRA 2XCPA 1NK0A 4O4RA 2IMWP 2D41A 2F8EX 2OYQA 4WFYA 3NH0A 2LSNA 4CF9A 4URQU 1RT3B 3ZT4A 1X1PA 3CM6A 5KFXA 1ZBIA 4RNMA 3B6OA 1RTJA 4WXWA 2FBXA 1QE1B 3BJYA 3KMSA 3MFHA 3H4DA 4QWCA 5KFBA 5DG8A 5HROA 5KFWA 3CVKA 5J2MB 3PW7A 1NKBA 2B6AB 1WSFA 2G8VA 1S1TB 1EKEA 4ZVHA 3M8PB 3ISND 2IM3A 3PW2A 5KT3A 1RT2B 1JLBA 4O0JA 5DG7A 2BQUA 1C0MA 2AQ4A 2WK4A 1IO2A 4ZP7A 2XRIA 1I3AA 1TVRA 3FFIB 3NE6A 2D0AA 4K4TA 1IKWB 3TAFA 4O3OA 4NLWA 4URGA 1Z4UA 4F4ZA 2IM1A 2C2EA 3LAMA 5C25B 2DPIA 3NKYA 3HYFA 3PHEA 4RW9B 2Y1IA 4MK7A 3M9NB 1RBTA 4DQRA 4IRKA 2VG6B 1WAFA 4ECVA 3LPUA 4ID5B 4NLDA 4N41A 4CHYA 4NLOA 4FJMA 5DG9A 1S9EB 4Y1DA 4NRUA 4C8OA 1BQMB 3VQBA 1VSDA 4NLRA 3T5HA 4N56A 3MXJA 3SYZA 3I8DA 4KHMA 4FVMA 3LPTA 4ZVGA 3VQ5A 5FRNA 4IOBA 3NBPB 1REVB 4TSXA 3NF7A 3P1GA 2AX0A 3DRRA 2W9CB 1VSHA 4NLGA 2FVPA 1L3TA 1LW2A 2EC0A 3SZ2A 1WSHA 5KFSA 2B4JA 4CECA 3LP1B 1RBRA 3GIIA 4KHYA 3M8SA 4CGFA 2XHBA 1L3VA 1K1QA 3SQ4A 3LZIA 3DOLA 4IR9A 1SUQA 4QCLA 1RTHA 3NAIA 5HROB 2I5JB 4M94A 1TV6B 2PYJA 3V6DB 3RMBA 3KK3A 1JIHA 4CF1A 5KFVA 1NHUA 2BANB 4ZVFA 4PUOB 4JV0A 5FROA 4Q0BB 3K59A 5F8GA 3K5OA 1LWCA 3AVCA 4YQWA 1JLQA 3TAGA 1FKOA 2J6SA 1W9HA 4ELUA 4TN2A 4CJTA 2YNFA 1G15A 2QXFA 2DFFA 1VRTA 4O44A 4ZPDA 4HVJA 4DU3A 1TAUA 3IS9B 2BQ3A 3RTVA 2JGUA 2YKMB 3NGDA 3C95A 2VG7B 2E9TA 3BQ1A 5I42A 4LSNB 1RDAA 2W8LA 1S4FA 2E6LA 3RMCA 1T8EA 3L3VA 4EO8A 1QAIA 1YT3A 3AO1A 2BRKA 3IN5A 3HPHA 3CO9A 4TYBA 2IJNA 4WYLA 4DL3A 1S1UB 5C24A 4YMEA 1XHZA 4CIFA 1HQUB 1IKXA 1Z25A 1WSGA 3PR4A 3PY8A 2P5GA 3MAQA 2R2TA 4L8RB 2JC1A 3NF8A 4DQIA 4ZHRA 1JL1A 3U3GA 1XR6A 4ED0A 4NLQA 3OHBA 4CGIA 3OYKA 2FVSA 3DRSA 4QWBA 1HJRA 4IFYB 5HP1B 3QEXA 2O5DA 5JUMA 1N5YB 1C0UA 5C42A 4F4XA 4Q5VA 3L2UA 2FBTA 1S6PA 4O4GA 1YVFA 4HUGA 4CJLA 2G8HA 1JLGA 3D5MA 4AHSA 1LWFA 4LSLB 1C1CA 4J9NA 5DLGA 4PWDA 4O55A 1U47A 2G8UA 3RRHA 3LALA 1VSJA 3UDLA 3TQ1A 1TL1B 3QERA 1S9EA 1FK9B 1NK5A 3TANA 5KT5A 5KFAA 4WFXA 4DL7A 2KQ2A 2ASJA 1S1XA 1BI4A 1WAJA 2BR0A 4ED8A 5HRRA 3K5LA 3KLFB 4F4WA 3GQCA 4B8AB 3OL7A 3VQ4A 2OPSB 1N6QB 4FK4A 5EWEA 5F8IA 1HYSA 3TAMB 4KAIA 1ZBUA 2IM2A 4FZZA 3WNGA 2D0BA 5CZ2A 4J9KA 1TV6A 1GOBA 1S1VB 4Q43A 1T94A 2XWYA 3KLGA 1JKHB 3DYAB 3GV7B 1SH3A 4FLYA 1RDRA 1JL2A 4IFVB 4WZMA 1C1BA 3FDSA 3KLIA 3UQSA 4MIBA 2R7YA 4OKKA 2XY6A 2B6AA 1LW2B 2XCAA 1FKPB 3DMJB 3PO4A 3TVKA 4Z4FA 4EEYA 3DRRB 4TXSA 4DG1B 2VG5B 3AA2A 1NK4A 1C0TA 4B08A 4FS1A 3ISNC 5KFRA 5JXSA 5KFDA 3V9WA 2FBYA 3GIMA 3HHKA 2ASLA 4DTNA 4IKFA 3L2VA 3KLEB 3CJ0A 2Q3SA 3NL0A 3BSCA 3QYYA 4TY8A 5EUHA 3LP0A 4FS2A 4DTOA 4NLYA 3MF5A 1S0OA 5F8LA 2HMIB 1D0EA 4FLXA 2HNDB 3V9ZA 4M3YA 3PJWA 3KK1B 5EDWA 5KFFA 2E9RX 3PZPA 4FW1A 2AGQA 2ZQBA 1HMVA 2DTUA 4LSNA 1BI4B 4KBIA 3BSNA 1XR5A 1BISA 3SFUA 5KGWA 4QWAA 4Q45A 3IS9A 3VQSA 4ED2A 3OYDA 4CK2A 4DU1A 3EY1A 1K6YA 2HVIA 1TKZA 1S1TA 1B9FA 3DLEA 3PJXA 5J2MA 4QOZB 4R5PA 1WSJA 3AO3A 3C6TB 3HVTB 5HRPA 4Z4CA 2W7OA 1RT5B 2JEJA 5T14A 2UVRA 1QE1A 4K4ZA 2J6UA 4G1QB 3TI0A 3AVIA 2XI3A 3DLGB 1RTHB 3NGIA 4MFBA 1SKRA 2QE5A 2R2UA 4CHQA 5T7BA 3OYLA 4H4MB 1HQEB 3RB0A 3JYTA 3PX4A 4K8XA 1VK0A 1S5JA 3AA3A 4ZP9A 1RCHA 5CZ1A 4F50A 3SJJA 1S1VA 3B6PA 2HNZA 1KVAA 3OYEA 4F4KA 4FM1A 1VSFA 4WE1A 4GC7A 1KTQA 4FCYA 5DQIA 2D7SA 4RG8A 3MXMA 2IA6A 4DMNA 4DSKA 3TAQA 3MR3A 2RF2B 3C94A 3PW0A 4JV2A 3H98A 4I2QA 1ASVA 2ZE2A 4E7KA 3EPIA 1Z26A 3T19A 4DFMA 1HPZA 2ILYA 4ELTA 4OLAA 3NF9A 1S1WB 4B9LA 1CXQA 3V4IA 2D3ZA 1S0NA 1GOCA 4URSA 1TL1A 4Z4GA 4ECTA 3UIQA 3ZSXA 3O3FA 4FW2A 5KG3A 3ZSWA 4O3PA 4CJQA 3KMQA 4CK1A 3CQ8A 5KT4A 2YNIB 3ZCMA 4Q44A 3ICLA 4DQQA 5HRNA 4DTJA 4KB0A 4AILC 4R5PB 4NLUA 1YVUA 3UR0A 2VA3A 3DRSB 4DL5A 4JV1A 3F9KA 4DWIA 4KREA 1UWBB 4ED3A 4M95A 3DLHA 4CFCA 1RDCA 4BWJA 5KT2A 4FBTA 4DTSA 4M3ZA 2PZSA 3OYAA 3D45A 5KG0A 1XHXA 3DRPA 1RT4A 4XPCA 3SUOA 1HARA 5KFOA 2YHAA 1HYSB 3RMDA 4CIGA 3VQ9A 3CG7A 4DTUA 2HNYA 3DOKB 3V9UA 4DS5A 4KAZA 4IG3B 4M3XA 5EU7A 2R2RA 4F2SA 4Y1CA 2E9ZA 3AVKA 3WNEA 1RNHA 2FVQA 1JXEA 1NJZA 4FJ9A 4RW4A 3CJ2A 3AVHA 4DS4A 3V6DA 3OSNA 4DSIA 4J2AA 3H59A 1RBVA 4JLHA 3QZ7A 3NH1A 1RDBA 2OPPA 4J9OA 3H4BA 1TKZB 2Y1JA 1KLMA 3O4NA 2HHWA 2AWZA 4MK8A 1QSLA 4AHRA 1RT1A 3T1AA 1RT7B 4K4WA 4FJKA 3TARA 4CJWA 3LANA 3L3UA 3U6FA 3KHHA 4KPYA 1TKXB 3OJUA 1S1UA 2C2DA 4O3SA 4IG0B 4RZRA 4CFBA 1HMVB 3RR7A 1T7PA 2IC3B 4IH6A 1ZTTA 3M8RA 4R0EA 4BDZA 3NHGA 2YKNA 2UVWA 4YR2A 3AVGA 1KFDA 4F3OA 3S3OA 3ITHA 5F8MA 3O4QA 2YNGA 1SH2A 1BQNB 5K14B 3G6XA 2OH2A 2WHOA 2ALZA 1CSJA 4FJHA 3SV4A 4O3NA 1NJXA 3KLFA 4FZXC 3DLKB 5KFTA 4PA1A 4PWDB 4ICLB 2X6NA 1R0AB 3SNNA 4Y34A 4EBEA 4IR1A 4LH4A 4MH8A 2FJWA 2R8KA 4RUAA 5KG1A 3BR9A 2EX3A 3EZ5A 2QV6A 1N5YA 4CGHA 3HVTA 4F8RA 5JS2A 4RU9A 3SQ1A 4OJRA 2BRLA 2VA2A 1B9DA 1JLFB 3WNFA 3DOLB 5KFGA 5C25A 4IH7A 1C1CB 1U4BA 3OLBA 4TQSA 1C1BB 3CJ4A 1O1WA 4CE9A 3MECB 4WYWA 3MEEB 4RW7A 4JUZA 3RBEA 3ALYA 2UUWA 2C22A 1C1AA 1D1UA 1S49A 3TAMA 3BQ2A 3AVLA 4RW6B 4QWEA 1MMLA 4IDKA 1WN7A 2ATQA 4RNHA 4LD0A 3IG1A 4ZP6A 1BQNA 5K14A 3TR8A 3QLHA 4FLWA 1HNVB 4EBDA 1CZ9A 3KLHA 3AVAA 2G8WA 3SI6A 4FJ7A 2RDIA 3DI6A 2GIRA 3LZJA 3CM5A 4O44B 1RILA 2OPRA 4I2PB 1DLOA 4QPXA 1EP4A 4J9LA 1NJYA 4DQSA 1RT1B 1U09A 3PO5A 4R8UB 3KK3B 3QESA 3QETA 4AHCA 5JS1A 5DK5A 3MR2A 4KHRA
chains in the Genus database with same CATH superfamily
2CZ9A 3BH7B 2YNHB 2DXDA 3D0GE 4IG0A 2XLKA 3E1YA 1GX5A 3OUYB 1T02A 2OZSA 4KI4A 3RGIA 2E5LF 1SKSA 3PRDA 4CBXA 2HAIA 4AQYJ 3FSIA 5AXKA 4DPUA 3J81Y 2MKIA 4OZ5A 1SC4B 1XMOJ 1D8YA 2W1BA 1T3VA 1NZ8A 4O3QA 3AHPA 4M5DB 4MMOA 3VWSA 1VC5A 3CCVN 2IAJB 2Z2YB 3I9ZA 4CZLA 1KAXA 4RBUA 5LT5A 3ULDA 1R8PA 2QO3A 4C8ZA 1LFWA 4PXEA 3S3NA 1XNRF 2O8BA 3FVYA 2CA9A 3D1QA 1YG0A 1VAZA 4IUFA 3QEVA 3V9XA 3WIVA 2WOMA 3TX0A 4JAXA 4B17A 4DMZA 1M5SA 3SUPA 2MZJA 3GL1A 4JI2J 3JSRA 3W5XA 1RWUA 4J2BA 3CMQA 4H8KA 4MFBB 3OS2A 1VJQA 5AFUA 3VAMA 3V81A 2VICA 1IKWA 5ETMA 4K41A 1T03B 4M5MA 1KDNA 3HJVA 3AARA 4B3OA 2ZZNA 3HVAA 2OMLA 4JI6J 1NDKA 2CH5A 1VGYA 1TMMA 2M8HA 5IXUA 5LSRA 2EWHA 4BRMA 3BBFA 1QTNB 2DXEA 3HX9A 4I2QB 2YJEA 2VQFF 4ECUA 5DLFA 1U04A 4DBQA 1KVKA 2XGPA 1HNXF 5M1OA 3L4BC 1HYVA 1FNXH 5JVHL 3OYFA 2O8CB 2JLEA 3P6YC 3K2PA 2XB2D 3NMAA 5BPLA 3O8MA 5I42B 2VZ9A 4OLOA 3MX5A 2B5JB 3TU5A 1KHWA 2LXFA 3QFWA 1WI6A 1KSPA 5CHIA 4FJIA 4CEOA 5J2QA 4FN5A 2LEAA 3FCWA 3PX6A 4DL0C 3NP5A 3C6UB 2GJIA 4C0OC 3I0SA 3M6WA 1J27A 3EGNA 3ZZRA 2FLLA 3EWGA 1YTAA 1RAJA 4FJNA 2L08A 4Z4EA 1SJQA 4CLZA 3EYZA 2X74A 3GJQB 2FBVA 4C98A 5KFHA 4V19S 3O9TA 3ZZ0A 1ATSA 5ETSA 1NM2A 4FLZA 4RW6A 1ILYA 2IM0A 4CHNA 4DR7F 1JLFA 1FRJA 4HTJA 4CZMA 3ADAC 1TK8A 2NS1B 2KM8C 4BS2A 1Q86T 2Z56B 2B9XA 3ZO7A 2YKOA 1XEZA 4PG6A 5EWFA 5H9FJ 3L7OA 3ZZOA 1N56A 5K9FA 3CJ9A 5ETLA 3NH2A 4ATNA 1K8KB 1S1XB 3I55N 2E5GA 3KJFB 2J9DA 3NFAA 3Q7BA 3MM9B 1LK5A 4J2DA 1V9OA 1C4CA 3IMXA 1I3OB 3BPSP 2I1RA 1M90T 4LH5A 4DX6A 3PW4A 2WTFA 2ZM6K 2RAQA 3TJ8A 3KWGA 3VGTA 4TQRA 1BCMA 1C0TB 4HUEA 4K8ZA 1FNMA 4HACB 3Q8PB 3HXMA 4LF9F 4CEBA 2MYFA 4KH1B 3OYNA 1JX4A 4O5FA 1EKSA 3JXOA 3D6FB 3A2FA 2CUYA 3H42A 3RB4A 2WVBA 1NH8A 5IM0B 3UO0A 2GIQA 3TRGA 2E5IA 1WOOA 3I56S 2KI2A 2WRMA 3HVRA 2GV9A 4QBUA 1CJKB 5HAOA 2F9JA 3ET6B 4G1PA 3RB3A 2AEFA 5IZHA 2CG4A 3AVBA 1N5VA 1NG9A 2VG7A 4A47A 2CPEA 4B3MJ 3I33A 2DISA 2LEPA 2VDHA 1DBDA 1PJ6A 4PG7A 2FLPA 4XEIA 2NUUG 3SQGA 1VLYA 1VSMA 5D3GB 4DUYJ 2XS5A 3VGKA 3RWUA 4WE1B 1FDNA 4NLTA 2YQ1A 4Q2LA 1XQSC 3RB6A 1E6YA 3PM9A 3DHWC 4GMKA 4ZK7M 2ASDA 3IRXB 1F9EB 1LWXA 7FDRA 1BA0A 4B3MF 2Y0SD 4NA3A 2DNQA 5GADU 1W26A 3K5PA 5M1PA 2UUTA 4OI0A 1N33J 4KKOB 2GO8A 4PKHA 5L39A 1UAXA 1SCJB 3BN4A 2CVEA 3J7ZT 1F3VA 3PCOB 2C28A 3TO8A 3LTOA 3QMLA 1KQSM 2KU7A 3V1QA 1Z6RA 2Q0RA 3RW7A 3KIOA 2N7CA 3LW5C 1ZM4A 1ACMB 4DDFA 1T05A 1B0VA 3GSIA 1Q8KA 1TUYA 3B8HA 1TL4A 5C2FA 4NYFA 4KSEB 2LCWA 1HRHA 1JLQB 2Q79A 3P45B 4PUOA 1IJEB 4D3HA 4G3IA 4IOCL 1K47A 1VSIA 1KQFB 2M3DA 4IQXA 1NKEA 1NHVA 1CS4A 3OYBA 2K7KA 3HSZA 4U67Q 4JKBA 4PWUA 1FWKA 1DTQB 3QFPA 2NREA 1TL3B 1YRXA 5J2PB 4DLEA 2PA8D 3RSEA 4W90B 5DO2A 3ZT3A 3ZSOA 2PYLA 4JS5A 5A8WA 4DR3K 2LA4A 4UZCA 2OSQA 4F26A 2E7XA 1EJ7L 3WQUA 2B7CB 4I69A 2UU9F 2VBYA 2DK2A 3ZT0A 1QTMA 1UL3A 2A10A 1BCOA 2OA8A 4CIOA 3CUNA 4CFAA 4DTPA 2E66A 4NCGA 2AP6A 2AGPA 1WNEA 4YB5A 4JEPA 5J2NB 1OH8A 5AE3A 4CLWA 2BTFA 2RIJA 2A5XA 3AO2A 1IKYA 3LAKA 1CEZA 5M1NA 2O8CA 2FC9A 5AQOA 2W2OP 3N4QA 1MSWD 2E1YA 3KHGA 3W9JA 3LDOA 4KHQA 4DV0J 5A2QO 3CNQP 4ILJA 4XPEA 2HHXA 4DV3K 1X9MA 3H46O 5F8JA 1J53A 1JNZB 2F40A 1Y4ZB 4AXJA 3VF4A 3KKSA 3C16A 5B0AA 5AJ3J 4FDFA 5AXLA 2V50A 4JYAK 1RB0A 1WF1A 5LMNK 4K42A 2OPQA 1S0MA 4KGXB 2BQRA 2CJ9A 3EZUA 1IQTA 2FC0A 2I7NA 2QJ3A 4H0YB 1S7IA 3LPYA 4U9RA 2XM3A 2H1YA 3I55S 4IFYA 4LIRA 3W9HA 2R8IA 1KD1O 3A3OB 4WCEL 2ASYA 5FPMA 3OTOF 4OYAA 3DMJA 2QZ8A 4IEIA 1Q8IA 2M88A 3MFIA 3RU0A 1YAGA 2XWXA 1U49A 4CFDA 1EQ0A 4HHTA 2O8BB 2ATLA 2F96A 4RCHA 2MZTA 3SCJE 3IXQA 2CKWA 2W6KA 4YHHK 4M5IA 3SI8A 2KZZA 3QSIA 1Z05A 4F36A 2JJ4D 2HIQA 5DMRA 4RR5A 4OHWA 3R6GB 2ZD1A 2J4RA 2HVZA 4A8MP 2ZZTA 2VDIA 1ZBTA 1KLMB 2RPIA 5HQMA 3GBTA 1DQ9A 1RADB 1APSA 2HNZB 4DOZA 3I56N 4K59A 5IT0A 4ECRA 2P9SB 1B3TA 5FJ4A 4A5BA 4CH7A 5L38A 4OLBA 3MEDA 4I9QA 9ATCB 4RWTA 2WW4A 5A6WA 1ZBLA 3AVJA 3THPA 2C2RA 1VSEA 2UUBK 4CK3A 5KRTA 4Z4IA 2W42A 3RR8A 2B4UA 1Y64A 5CAAA 3PR5B 2IY5B 3AD9C 1PBUA 4JD2A 1N32K 4RBVA 5D4OA 1SH0A 5F8NA 4HI1A 2J0SD 3TPQA 1QQNA 1T9VA 3ZEUA 4W4MA 2KJWA 3NRBA 1CXUA 4TKTA 4CJEA 4ZJOA 2CPXA 2F8MA 1X4HA 3EMTA 3LP3A 1AUDA 5JLHA 4TNOA 5EGYA 4K0KK 4DL6A 2D1CA 3OYCA 3Q2SC 2FGCA 1WC0A 1I39A 4ANDA 3D0PA 3NCQA 4U6PA 2DFHA 4YDUA 3CJTA 2W9AA 1C0GA 3UCGA 1ITPA 3F0NA 1S6UA 5AFUH 4DR5J 5HRSA 4E7JA 1CC7A 1WDDA 1B92A 3H5SA 1RABB 3QJPA 1FE0A 2C2NA 5H1SV 4OX8A 2A40A 1HNWK 1UFKA 2KHDA 1S97A 3H20A 4YR3A 2RQMA 3HP9A 3FZMA 2O1PA 5JMVA 1UCNA 3OL8A 3A13A 2XMVA 3DCAA 2DNYA 1LAVA 5CQGA 1NOZA 1JKHA 4FLTA 3J7YI 1IR0A 2HK2A 1E4FT 3R27A 4DX8H 4X4TA 4KE5A 4DR2K 3KVGA 5G0RB 2MJUA 2HNYB 5D4PA 1RAFB 1XNRK 2W2MP 1SJ1A 3X3UA 1JQGA 2MDAA 2RMLA 3AQOA 2RSQA 1T95A 2QL7B 5CHCB 3U3YA 4FWPA 2YWWA 2UVVA 1TP7A 1HI0P 5F0XA 3A8JA 1UOCA 3BB5A 5KFQA 1X3MA 3BKFA 1H98A 2AZ1A 1QD1A 2KDOA 3KD1E 3QBCA 1VI7A 3NGSA 4DF4A 3V1OA 4KHWA 1NDPA 3BO2A 3G6VA 4CJ5A 1IV0A 4C11A 3QIDA 1WHWA 3KK2B 4BE2A 1VQ7S 5AQYA 4KV8B 3J7YU 3MK6A 3HD1A 3LM2A 3VF2A 5EXWA 3CJKB 3CXCR 1JXBA 2R8JA 2VOPA 4BC3A 1MNEA 1RWXB 4DFKA 4E1MA 2FZGB 1BIZA 4MDAA 2I2YA 1UEVA 2DO4A 1Y3JA 2KJVA 1RHRB 3DNCA 1GTEA 3T1YF 3K7RA 3HF5A 3CD5A 4MLEA 4GO7X 4K5SA 3SIPB 4F9OA 4F3QA 3K5MA 4TU7A 4K50A 3AVFA 3VAFA 3TR5A 3VGVA 1LCUA 4NLXA 3NBPA 4ZTFA 1C6VA 3FR0A 5E3PA 1Q78A 1OS5A 3QGGA 4X4VA 4MO4A 3QIOA 4DV4J 4CNZA 4LF4K 3TUIC 5H9EK 2Z1IA 1ZZFA 3GWCA 3G6YA 5AQSA 1M1KO 5KQDA 3UE2A 2XY8A 3H08A 3I96A 4AH9A 4LQ3A 3V9SA 4CTAA 4DR2F 1KC8O 3CIMA 3W2WA 5JLFA 1RGIA 5C42B 1NMNA 5GAEU 2G0JA 1YRUA 3THVA 2V2KA 1U2VA 2HFNA 3HBTA 4XTTA 4AT1B 5L9XA 1JLAA 4NYPA 4KYZA 2DYAA 2J6TA 1ESVA 2JWLA 5FRMA 3FRZA 3CE8A 2XGQA 1SZ2A 1S57A 5BPMA 2KZMA 3W2VB 4RO0A 2FJEB 1JNRB 3N9UC 4B9NA 1WHYA 2RRAA 1N5SA 3VQEA 5LSOA 3O9RA 2DNOA 3QINA 1WKLA 1FJ7A 1EX4A 3TA1A 4ETZA 1H6KX 4DPTA 1MA9B 3FQLA 3WXIA 2UV8G 1VQ6N 1Z2ZA 4KHSA 4RWWA 4F7VA 2MZSA 4H4KC 1QQOA 3MXHP 4QU6A 3F5TA 3P49B 3CC4S 1VDHA 1H38A 4JI5K 1DY3A 2XZWA 5BN9A 2PEBA 4HDGA 1F5AA 4C48A 3C6TA 3RAQA 3MEEA 1NCLA 4K4YA 1YDLA 2LECA 4CO2A 3W64A 2GAGC 1DQAA 3NVKA 4CO4A 4A8WA 5CYQA 3KG4A 2KFZA 2NRXA 5IWAK 3HT0A 3ZT1A 4AM7A 2W9CA 3SQ0A 1MWZA 1VRUB 2WOMB 2HRYA 1Q7YT 4A59A 1GLLO 3ID8A 4HKQA 4CHZA 2DHXA 2KL8A 3HP6A 4Z4HA 4DV2J 2HZVA 3TZWA 2YWEA 5DETA 4IH5A 2EFGA 1R8AA 2FJVA 4CEFA 5BR8J 4AL5A 1LWEA 3VN5A 4K2XA 2UXDJ 2XNRA 1ZYQA 3GLJA 3VQDA 4Y65A 1RACB 4J5OA 2C2KB 3G6EN 3RAMA 3CCQN 3ZT4A 1X1PA 1ZBIA 4WXWA 1QE1B 2FBXA 4NX9A 3P39A 2VASA 3H4DA 5K5MA 2CYYA 5KFBA 5DG8A 5HROA 1KP6A 3CVKA 1WEZA 3P3DA 5HL7L 2B6AB 1FNOA 1BE4A 4LF8K 4L3NA 2G8VA 4BRDA 4K25A 3CD6N 3M8PB 1OQ3A 4DU8A 3ISND 3PW2A 2XG8A 1QHAA 4ANEA 3HLUA 2WBNA 3RYLA 4C0HA 2QMUB 2AQ4A 4IO9Q 2OCEA 1M1GA 2YKQA 1HIYA 3U7JA 3UD4P 1DJ0A 4YUDA 3PIOL 4F4ZA 1Y10A 5M2RA 2C2EA 5C25B 3PHEA 1OWXA 4DQRA 3QB0A 5I9EB 3N4PA 1AUSL 2VGMA 2DNMA 4Y1DA 4WFNQ 4C8OA 4U95A 3VQBA 1VSDA 3R5GA 4ED5A 4N56A 1U2RA 1X0FA 4Y2IA 3I8DA 5HMWA 4ZVGA 4DX7A 5FRNA 2ZH2A 4TSXA 3NF7A 3HZ6A 2QIFA 2RH3A 3UKUA 3LDNA 1BLUA 1VR6A 3DRRA 2Q66A 1NHKL 1VSHA 4NLGA 1L3TA 2XULA 3T1HJ 1QDUB 3SZ2A 4I64A 4M5DA 5KFSA 2NLXA 1WC5A 5FPNA 3GIIA 4KHYA 1OKJA 2FQQB 1L3VA 2XHBA 3R5AA 1K1QA 3DOLA 4DV1J 1O8BA 4O8UA 4DUZK 1SUQA 2L3MA 2M70A 4QCLA 4AUKA 1PYOB 3V6DB 2J7WA 2VBXA 4K7QA 5KFVA 4JV0A 2HKEA 4P71A 5FROA 4YQWA 2QTDA 3BO4A 1RHUB 1P6TA 5I3QA 5AQQA 1G15A 1OYDA 2DFFA 1VRTA 4KIAA 1TAUA 4YOWA 2BQ3A 2OTJN 3ELHA 4X65J 4WU3A 2D3O1 2ADBA 1RDWX 2UZAA 4YB6A 2F4FA 3MMAB 2FSKA 3TOQA 4X65F 1UW9A 5IT9O 3O44A 5LMNJ 3PXGa 4KH5A 1S4FA 3RMCA 2G2YA 5AQWA 5CZVA 1SJFA 1VK3A 5AQGA 1QAIA 5BJRA 3AO1A 2LMIA 3HPHA 4DL3A 4C4WA 1Y9OA 2GX8A 3SBGA 1HQUB 3BEGB 4CM2A 4DR6F 1MN7A 1WSGA 2VGNA 4L8RB 4PZVA 3HZEA 5LXYA 4X62J 4HHJA 1ZS6A 5HVFA 3OYKA 2QI2A 1FD2A 5C0YA 3GSDA 4QWBA 5BRHA 1I1GA 3FBFA 1E4GT 2VPWB 3JQMA 5HP1B 5DZ6A 2E2OA 3SMPA 5C42A 1RAOA 2HBRB 1FI4A 4O4GA 1BA1A 3SJHA 4MYUA 5EHHA 4U67L 1V5VA 4CH0S 4RLEA 3UFCX 4J9NA 4AXIA 1VQMS 1RAAB 4ED4A 1U47A 5AQJA 3OTCA 2KVQE 4Q2MA 2EFQA 2ROEA 2MKKA 1VISA 3CC2N 1NK5A 1EAYC 3MM8A 5KT5A 3TANA 3WQTA 3QQCD 5KFAA 4PXBA 2R7WA 2HG4A 4ENOA 4YN3B 5JMNA 1EHWA 2UV8A 2OPSB 3W2VA 3U9DA 4QR1A 4GVEA 5ELZA 4D3GA 1VQLS 2XWYA 4BR2A 3GV7B 1RDRA 4UY85 4L73A 2BJ9A 3ZZTA 3R7BB 4MIBA 2R7YA 2XY6A 3T9ZA 3DXMA 1P9YA 3NOGA 1VIXA 2R7QA 1FKPB 3IMQJ 1RISA 1VBXA 1EZZB 4B3TF 4YY3F 2FBYA 4EAHD 2ACMA 2QSFA 3TSQA 4CO1A 2M5YA 3CW2C 3CJ0A 4JI7J 3DOMB 2UUAK 3NL0A 4C3KA 3M6XA 1H2VZ 1XMQJ 3QRQA 4FS2A 2N3OA 1UZHA 5HK4A 3TSPA 1YZ6A 4BQZA 4KHPF 1VHXA 1D0EA 2GHWA 4B1XB 5LJ3Y 3PJWA 3HD2A 1HNZF 5EDWA 3PZPA 4FW1A 1RAEB 4JI8J 1HX1A 2G0IA 3FFKB 2E2QA 3PKMA 4LSNA 4ZN3A 4KBIA 3IFRA 3CGIA 3H1QA 5KGWA 4MYTA 4Q45A 3OYDA 2GUPA 1K6YA 1PC5A 4X64K 3PJXA 2PMWA 4DR2J 5J2MA 2Q1LA 4R5PA 1WSJA 4BG8A 1HNZJ 1SC3B 2M8DB 3HVTB 4Z4CA 4MDBA 1RU1A 5T14A 4I56A 2PN6A 2UVRA 1QE1A 4HT7A 2J6UA 5CR4A 3AVIA 3DLGB 1RTHB 3NGIA 4DPXA 2LA6A 4M63A 5L9NA 1IN0A 2R2UA 3SK3A 2JDJA 3DLLQ 1G6BA 4H4MB 1YJRA 4EGLA 1WOQA 5T7BA 3OYLA 3P31A 2OGUA 3RB0A 2E7VA 4YB1P 2XS2A 1EQMA 2C3PA 2A1BA 4LRBA 3IWNC 3AGKA 3NVMA 5M2UA 2F3JA 3SJJA 1S1VA 3CMEN 3AAQA 2Z57B 1X7VA 5C2CA 1GTHA 3OYEA 4GC7A 4FCYA 1WEXA 5G4DA 3CDAA 4RG8A 1MROA 2IA6A 2B9YA 3DU6A 2E5LJ 4DSKA 3TAQA 2RF2B 2YJFA 1OH7A 1HWUA 4I2QA 1CLFA 1ASVA 3NLCA 4E7KA 2NZCA 1WHXA 2RU3A 2R3VA 5T41A 2H3EB 1Z26A 3T19A 4DFMA 1H7XA 3IWLA 1HPZA 2ILYA 4CT8A 4FO0A 3NF9A 1CXQA 2DRDA 2JLFA 3V4IA 1EB0A 2UXCF 4ECTA 2RVJA 3ZSXA 3M32A 4FW2A 3ZZYA 4CK1A 4CJQA 5B7WA 2OO4A 1FERA 3SDEB 1WUUA 2HFVA 2RHQB 1FDAA 4HI2A 1BUPA 2BJ1A 2VF3A 1WSVA 1T3OA 1PG5B 4NA1A 1NGJA 4AILC 3D2EA 1SS6A 2MGZA 1YVUA 1ZXOA 4LFAF 4E2FB 3ENVA 4M95A 2BMBA 3AOAA 5KT2A 4ZIWA 4FBTA 3OYAA 3ENOA 1BG3A 1HW8A 4B9QA 4CNYA 1JCFA 1HYSB 2A6AA 2R7TA 2HBMA 4NE9C 2ZH5A 3UWTA 1FA0A 3V9UA 5D8HB 1RJJA 4M3XA 2R2RA 1HR0F 2E9ZA 3HI0A 3WNEA 1RNHA 2FVQA 2HVEA 4FJ9A 3IR6B 2UUCK 2CPIA 3AVHA 3EGWB 5GAHI 4HWIA 1CJKA 3PIPL 1DFDA 3O4NA 2HHWA 2DGUA 4DZDA 3ZX0A 3MCPA 1KAZA 4UF4A 1U25A 2ZF5O 1QSLA 2UP1A 5M2PA 4CJWA 1AW0A 3L3UA 1HJOA 5AZIA 4DV6F 3OJUA 4CYUA 1T6DA 4XH1A 1RDUA 2IC3B 4IH6A 2R7VA 4R0EA 4BDZA 3ULEB 3ILOA 3O4QA 1SH2A 3FSXA 4X66F 3HHNB 4F0HA 3SV4A 5A8RA 4FPIA 5T7LB 4UOCA 4CZKA 3D3BJ 4PA1A 4PWDB 4ICLB 1EX8A 2YPYA 2CQHA 3SNNA 2FLOA 4EBEA 4IR1A 4MH8A 4RUAA 5D0EA 4BRFA 2EX3A 1N5YA 3E9OA 5JS2A 4RU9A 4OJRA 2BRLA 1B9DA 3ET6A 1X5OA 1TUGB 3DOLB 1RTZA 3VV2B 2ZOMA 3OLBA 4TQSA 2GAHC 1O1WA 3T6JA 4FL9A 2RQKA 3MEEB 2X51A 1LXNA 4RW7A 5DS7A 3CIPA 3RBEA 5EX5A 1C1AA 3C16B 4BHQA 4JK8A 2B51A 2F7VA 1Q5VA 2VBWA 4XDDA 2NPIA 1S7HA 3ZETA 2V94A 1GLAG 4LRCA 1XTZA 1U1NA 2CNNB 2H48B 4BR4A 2ZOGA 3GFHA 3SI6A 3BF1A 2RDIA 2L9WA 2DGQA 4BQLA 2KG0A 2GIRA 3LZJA 4A8OA 3J7YP 1YJ7A 2OPRA 1UEKA 1N54B 3HHLD 1BC6A 5F0WA 2OTLN 4HH1A 1VIOA 2W01A 1NJYA 3NNAA 3CPWR 4BRQA 2QTWA 4PR6A 1U7LA 1PGZA 4CO5A 3U1MA 1JCEA 5HOOA 1RWVB 1VK8A 2QLJB 4WKYA 1CJUB 4FYWB 2ZDOA 4FKXA 2NLWA 2VYPA 3TQEA 3ZSQA 5D4LA 3AY0A 1QUPA 4GRSA 1GXLA 4B9VA 4FJJA 2HK3A 4MIAA 3H5UA 5EX3A 1HQUA 4USKA 2X1FA 3GILA 4DSFA 3KLIB 3EE8A 1FVSA 3EZWA 2OUGA 2H4YB 3KLGB 2F63A 3FSYA 1ZPVA 3CJBA 1WKKA 3MTKA 4M5LA 2XO7A 3OYGA 1Y7PA 4EP4A 3K2YA 4GVBA 2ZHOA 3T1YK 1V5IB 4WQ5C 2IBKA 3A5NC 1LWCB 1ZM2A 4FJXA 2GO9A 4WIIA 4B8CA 4JV5F 2NRHA 3L8BA 1R6YA 1LFPA 4R25A 3RBDA 1B99A 5B0FA 2PO4A 1IBKF 3V6HA 1HHQA 3A4TA 4JKDA 4WKRA 1GMWA 3MM5B 3OJSA 3GR0A 1YBAA 1P8ZA 4LT6A 4NYOA 4DV0K 2BVZA 2ZVIA 5CYQB 4QJVA 3QT6A 2KLAA 3VVTA 4ED7A 4KFBA 3VQ7A 4HCBA 1YBTA 1G2EA 2W2PP 3IR5B 2LXIA 2R7OA 4M5HA 3M2RB 1SIZA 3CDEA 4HACA 3HHLB 4JYAJ 1V3ZA 1N36J 4DR1J 3NNCA 2LFVA 3GJRB 1J5OA 1NSKL 1J2VA 3FJ2A 1J54A 1CULB 4H5TA 4QOTA 4DR1K 4TLQA 1I94F 2V8VA 4NPOA 3OVAA 2A1SA 5DDPC 1N52B 1Z2LA 5IM0A 4FOIA 3JTNA 2V8HA 3HK2A 5BPNA 3I9V9 2HLUA 2VODA 3QBXA 3SCXA 4RW9A 5HN0A 1CJVB 3HFKA 1YITS 4Q0BA 4YOUA 3MR5A 1S6PB 1VQ4N 1SQKA 4CI6A 4H4OB 4PHTX 2BJ7A 3MPVA 2Q36A 1CZAN 2J8AA 4PWWA 1RWMB 4JK9A 4E1NA 1H1VA 4NZ6A 4AE5A 4G6VB 1S77D 2YNHA 3WX8A 4QYZJ 4DX5A 3TW0A 1TK5A 2CAJA 1UJ5A 4G1QA 4KV8A 2DBBA 1KWMA 2AT1B 3B78A 4JHDA 1NB2A 5HMZA 2RD5C 4DTXA 4WFAL 2HQ3A 5I3UA 3UD5A 3TA0A 3CCWA 4ZPBA 4OI4A 2QSWA 3VZIA 3QAEA 4FXWA 4FJGA 1IBKK 2DGOA 4K4VA 2V4JB 1YJTA 3MM8B 4NLVA 2XLJA 2V9WA 3LP2A 1NZAA 5DQHA 3FK4A 1IUJA 3LP0B 4C11B 1TQLA 5CXTA 3CCLS 4DSLA 4KBOA 4CDIA 1RQ0A 4OV1A 4LFCK 3M2UA 3V6KA 3DGVA 1IBLK 5LMUK 4EZ6A 3TYTA 1VOMA 1JMTA 2HFSA 2V2ZA 1NGDA 2CPHA 3ETOA 3CULA 1HBMB 4XK8C 5HQ8A 4CLYA 3BDEA 2EKNA 3SPZA 4HT5A 1U02A 2NXJA 4B9MA 3UPFA 1Q9XA 5BR8K 2ZUAA 4IDKB 1SIWB 4K0KJ 3BGFA 1VQ8S 3W65A 4IYQA 4ZITA 1LW0B 4CEAA 4CJVA 4ZJLA 1A5XA 2FF3B 1HBOB 5FDLB 1Y0HA 4BC7A 1KQGB 3DDKA 1OYEA 2F4VF 4CHPA 1WBDA 4CTAB 3ZFVA 3T5KA 3L09A 3GDQA 5J2PA 2DCLA 5GAGU 3MHYA 3OY9A 3OTOJ 4LF8J 4X2BA 2AJFE 5CY4A 2MLZA 4USTA 1ZA1B 3BM7A 3D54A 3CSKA 5KFNA 2BJEA 1HNWJ 1NGCA 3HPGA 2DH7A 4Q8EA 4GVMA 3OW2R 1BGXT 1NK6A 3BO3A 1WKJA 3N5BA 2XLIA 3QEWA 3PNIA 2AX1A 2W41A 4KY3A 2IS3A 3HOTA 2UUBF 3WEEA 1IKVA 3H90A 4AL6A 3PW5A 3SCLE 3IG1B 2MLYA 1W2BR 4NXMK 1GOAA 4NO7A 1RHKB 1OQ6A 1BDGA 2XMTA 4AHTA 3KLEA 4EP5A 3Q8UA 1CPZA 3IM9A 1WWHA 5G0RA 5C12A 3EICA 1WC1A 2J9DE 3VVUA 5E3CA 2ZC3A 1DGKN 3NGYA 2PSZA 2ZDPA 2X7IA 2ASPA 1TUUA 5D4NA 3PUFA 2VPXB 1C0UB 1HW9A 4OZLA 3KK2A 4ETXA 3EEQA 2YI1A 2CNOB 3DXBA 3M2UB 1NDLA 3OYHA 2E29A 3H2LA 3G82A 1S12A 2BA9A 2O4GA 4PQUB 4K4SA 2W9BA 3THXB 4DTMA 4WWSA 3QNNA 3MTJA 2DNZA 1JB0C 1RA6A 4ELVA 4EBCA 4C8YA 4DUZJ 1RT4B 4JKHA 2W4CA 3QO9B 3OS1A 4C8LA 4MT1A 3MN7A 5AQPA 4DSJA 1PJ5A 4CHOA 5KG2A 2P9IB 4I9LA 2ZGZA 3D7EO 1HD1A 4OQJA 2CJKA 3MGJA 4KQZA 2N4CA 2QWRA 5M1FA 3DLLL 3J81j 4DQ8A 3M5RA 4FK0A 1QUVA 1WG5A 1JLBB 4X65K 4Y2AA 3JYTB 1RTIA 4Y2KA 2DNHA 3K89A 4CGDA 2WSEC 2NUHA 3BV8A 3OVSA 2AP1A 1JXLA 2QM1A 4DB3A 2KT3A 3KHYA 2U2FA 1KCFA 2HHHJ 1HUXA 3MN5A 2NUBA 1BU6O 3ZTSA 3D4JA 3BGOP 1AFJA 5GADI 2E8AA 5I4MA 1GX6A 1O51A 3LP1A 4A2BA 3L2RA 1NLKL 3AV9A 4R8UA 1W25A 3DLRA 1ZTWA 3BY5A 3VPZA 3GB0A 5ADXA 3IR7B 4LFAK 1X4FA 4CESA 1G99A 2OEKA 3UKUB 1IG9A 4DLGA 1PAUB 3CJAA 5BREA 1Q81T 4KJIA 5A8RB 5I3UB 5IC4B 1L3SA 1LOTB 3AA9A 4RNOA 4PCQA 3FEYB 3AA4A 3PJ9A 4CLSA 1XC3A 4JBCA 5CA5A 2WUSA 1CC8A 2V0NA 3OVNA 1ZBSA 2CIMA 4FPBA 4JD2B 4FNIA 3LP2B 3MM9A 1RHJB 1F6TA 4JI2F 3HT3A 4JS4A 4CZIA 3Q8YA 5DDQC 2QLBB 2O67A 2XEXA 2HNDA 3ASMA 3KHLA 4LF9J 1KVCA 1FE4A 4OYXA 3A8YA 1PYSB 4CJFA 2GVDB 4CJ3A 4UOFA 3G8SA 1TU0B 2JVOA 1EETB 2KM8B 3FLCO 4FWKA 1WF0A 2VPZB 2D5RA 2M2BA 2COLA 2MKHA 3RMAA 1SJRA 4JOUA 4H0PA 3G71N 4NI2B 4CGJA 2F9WA 5GIPA 1FO1A 3BYPA 2PFFB 1P1TA 2VWKA 3GE1A 2HIYA 3CCLN 3QSYB 1DTTB 2FJBB 4PQAA 2FSNA 3LUYA 2GBZA 4Y3CA 1X4DA 3JXUA 3QICA 3C7NB 3AH6A 5LMUF 1QY7A 3MI7X 3UCUP 1FXXA 3ZTPA 2CPZA 1K73T 2JEIA 2Y1LB 4DV3J 3MWBA 2J0QD 2CNLB 5AQIA 4DV3F 1SQGA 3ULHA 3CD6S 4BR7A 2I38A 3QATA 3ILJA 3O1BA 1Q5YA 3PX0A 3OVBA 5DGAA 3Q83A 2CZVC 2YKPA 2V8PA 2P9PB 1RDDA 4CJUA 4X4NA 4JKGA 1HR0J 1WG1A 3ZXWA 2AJ0A 1N32F 1GLEG 2E88A 1VS3A 4GKJK 1JLGB 4M63C 4CF2A 4EUVA 4C8KA 3VF6A 4JI4J 4P2MA 2V4QA 4ES2A 5HATA 3JSMA 2E1CA 2FLNA 4GV3A 4LQ9A 3X1LB 2V2VA 3NGZA 1TL3A 2LEBA 3DOKA 2WONB 1NMEB 4ZCIA 3OYIA 1OSCA 3KG1A 5A8WB 3IFEA 1NK7A 4X64J 4KH4A 2AIRB 4B1VA 3TJ9A 1ITGA 2DNPA 3QT8A 2FJDB 3TAPA 3DLKA 2YX6A 4C1NI 3GIRA 5EWGA 3SCIE 4CIEA 5KFMA 4QIVA 3TZZA 2Z2ZA 4CF0A 2DGSA 1SI9A 1ZAXA 2QWQA 5HMYA 4J9SA 2OHDA 1HWKA 4E7HA 1JLAB 2D74B 4DF8A 1F5CA 3CIZA 3A5MC 3JSBA 2HGNA 3CJ7A 4PG8A 4K4UA 4TYAA 1DZ5A 3GYGA 2IDOA 4J9QA 3NXZA 2CJAA 4JRQA 4CERA 2QWPA 2P6TA 3BH6B 4JKFA 5KG4A 3R8EA 4HL9A 5IWAF 1WLJA 3SCKE 4K2JA 3D6MB 4FPAA 3DXSX 1RTIB 4CEEA 2CJXB 1FKAF 4W5TA 5E5NA 5AT1B 3WNHA 2QA2A 2N7YA 2WVCA 3POTB 3MEDB 2A3JA 1ASWA 2OEMA 4NXNJ 3W60A 3C15A 1RBLA 2ZVSA 3RVCA 1M5KC 5GMKa 2BH1A 4LY7A 4WFBL 4JI3J 2ZFHA 1IH7A 1NJWA 1YIJN 2V8GA 2ZH4A 3C6HA 3T1HK 3Q0AA 1UKUA 3DLBA 4BR5A 3KD5E 2AGOA 1NGAA 3BKUA 4HTIA 3OHRA 3MXIA 3VCDA 1F21A 2FHJA 1FJEB 2MZ1A 1JWWA 1REVA 1ZOTA 4PXDA 4DV7F 5BR9A 1W97L 1NH7A 1TAQA 3L9ZA 1D8ZA 4ECZA 2QA4N 5AE1A 4KHUA 2CQGA 1BD6A 4NYNA 4USMA 2DXFA 1PAEX 1W2IA 1QQCA 3MCMA 1HQEA 2ZHBA 1RTDA 1K9MT 2HHHK 2WAQD 2C3UA 4CZFA 3L95X 1X8DA 1EWQA 3MM5A 4Y6IA 1HBMA 1Q0NA 4FZYA 3DM2A 2QN6B 4FM0A 5KI6A 1R3NA 4O3RA 4RU2A 1OY8A 4DR6J 4M3TA 4GVLA 4CLUA 1TMJA 2VWJA 4BE1A 4DR1F 1C0FA 4KB1A 5L1JA 3OTBA 3QJJA 2F8HA 1UETA 2E44A 4DXLA 3EX7B 2Z30B 2OP5A 4YDUC 5JVGQ 2DKOB 2HHTA 2UUCJ 3U1NA 2CJBA 2D3UA 3FQKA 3CJ1A 1AZSB 4A48A 4W5RA 1LK7A 1JJCB 2VQEJ 3TZYA 1M0SA 1O6XA 4O4GB 1LWEB 2MQ8A 4FYVB 3WDOA 4M3WA 1GMWD 4NLSA 2OTJS 2IVNA 1YSJA 3U9ZA 2BJ3A 4JI0F 3DLGA 4OPHA 2QMXA 2EFOA 4OHVA 4C0BA 3HFVA 1L5UA 2HRTA 9RUBA 4P75A 1A5VA 2VC0A 5DDRC 3MEGB 3QIPB 3QWUA 3O1WA 2ZH9A 1J5EF 2IVYA 1BMQB 4N77A 4NCAA 4DV7K 1UFLA 1EIYB 4HHUA 2B9EA 5BYSA 1CG2A 4EFHA 1HHSA 3SFGA 3SSRA 2V9KA 3QGIA 2YX1A 1T9YA 1W0HA 2HHQA 3QEPA 3D6TB 2CVIA 2OD6A 4IG3A 3HL8A 4MQ3A 1Y3KA 2NCKL 2VKRA 2DD8S 4ED1A 1FDDA 1GK8A 4TU8A 4ID1A 2ZJQL 3S7RA 5J1EB 5SWMA 2AEJA 4BACA 2Z0GA 3PEHA 3BSAA 2UUAJ 1VQMN 4PQUA 1XBWA 1OPIA 4ZLNA 2BE2B 5AQXA 1VQPS 2VIHA 1DKGD 2O4IA 3SXLA 2CQ3A 3M05A 1ZM9A 3CMES 4X62K 1D9FA 3BP8A 4CZHA 2D3OR 4E7LA 2IAJA 3VA3A 2HEKA 5BYRA 3O5BA 4FP9A 1KXPA 1WC4A 3GONA 3T3FA 3NGUA 2YBVA 4BBYA 2QA4G 4U8VA 1RT6A 3MEGA 1SC6A 2Z1HA 1HQ2A 3HCXA 4ZVQB 5CD4H 2V51B 3NNHA 4B1UB 4J9MA 2DPJA 4HCCA 1UA0A 2JZ5A 5HJXA 5E3RA 3CCMN 1HWJA 2Y8YA 1IBMF 3GYNA 3QEIA 1DT9A 1EP4B 2KRBA 4RUBA 2F7TA 3VEVA 3SUNA 2KN4A 3AJDA 1NWKA 4FM2A 3SV3A 3L2QA 4NXMJ 2XSJB 3W5YA 5RUBA 3KNGA 1IWGA 2BANA 5K8NA 1Y11A 3Q89A 2UUBJ 4KO0B 2IMWP 5FLXY 2F8EX 3O2IA 2OYQA 4EI2A 1NM1A 2PMZD 4LR7A 2BOAA 3CM6A 5KFXA 3B6OA 1J5EK 3W1YC 1RTJA 3MCSA 3BJYA 3DGPB 3KMSA 4XAKA 3FCHA 3MFHA 3GFZA 1XK8A 4NXMF 3PW7A 1WSFA 2MQOA 1VQNS 1S1TB 1EKEA 4ZVHA 2IM3A 5THWA 5KT3A 1P1LA 1RT2B 5DG7A 2VFTA 1JCGA 4USUA 1IO2A 3H6EA 1VFJA 1YWXA 4A5AA 3CF5Q 4O3OA 1YGYA 4URGA 4ZKAA 2X1GA 1LQ9A 5KQ8A 1N34K 1KQKA 3HYFA 4MO5A 4RW9B 2CDQA 4QS7A 1RBOB 2VG6B 3ZZPA 4IRKA 1WAFA 3CPWM 3LPUA 5TKWA 4NLDA 2CQ2A 3T9NA 4N41A 4PEOA 4ILGB 1CQMA 2HBQB 4LF6J 3KDOA 4LF4F 2YTCA 4NRUA 3THXA 1BHNA 2AJ1A 3G2XA 3A8KA 1UZDA 2FGOA 3NBPB 1REVB 1U1RA 4LF5J 2JSXA 2HFOA 1DAXA 4UT4A 4F04B 2AX0A 2EEYA 1Q7YO 1LW2A 2EC0A 1HBNA 1WSHA 3OTDA 4CECA 3QJLA 3M8SA 4OI1A 3LZIA 2LDIA 1P8GA 4P73A 4CLKA 1TR0A 4FVCA 3NAIA 5HROB 3BYRA 2MEWA 4CF1A 1NHUA 2BANB 1GLDG 5F8GA 1LWCA 3NS7B 4BRNA 1JLQA 1CVJA 5D0HA 1FKOA 2FY1A 2J6SA 2FZCB 4TN2A 1HNXJ 1E6VB 4LBPA 3IS9B 2YKMB 1FRHA 3C95A 3R3LA 1T0TV 2G4BA 3UN5A 5DM6L 4JP8A 3WUHA 3AGRA 2W8LA 2R7SA 3KK7A 3O9SA 3O9QA 2ROGA 1T8EA 3S6EA 4OYWA 2P9NB 3CO9A 4TYBA 4WYLA 2VQFJ 1XHZA 2HZAA 3LGHA 1IKXA 1Z25A 3PR4A 3PY8A 2R2TA 2JC1A 1JJ4A 4DQIA 1JL1A 2VQFK 3U3GA 4LJMA 4ED0A 1GFWB 2R7UA 4NLQA 3EE9A 3OHBA 3CXCM 4CGIA 2G2OA 4CYUB 3DRSA 4YOTA 1D9AA 4OPAA 4IFYB 1PSDA 2O5DA 1M1KT 1C0UA 5GAEP 2BKOA 1RAHB 4B02A 3L2UA 4LF7K 1FXDA 3A3NB 1YVFA 4HUGA 4AHSA 5ADXH 3C14B 3LQVA 3D1OA 1C1CA 2C2ZB 5GAHU 5DZ7A 5DLGA 4PWDA 1BUXA 3LALA 4LFCJ 3P5BP 1VSJA 4M8LA 3TQ1A 2HS3A 3QERA 1S9EA 1IR1A 1FK9B 4B3SK 1FFWB 1HR0K 5AJ3K 5B0GA 2MB0B 4QIEA 3GCWP 3K5LA 3KLFB 3GQCA 4B8AB 1S22A 3VQ4A 4FF3A 2KKHA 3BZCA 3TUPA 5F8IA 3MR7A 2VC1A 3WNGA 3IA0A 2D0BA 1WC6A 5CZ2A 1H74A 1S1VB 1GOBA 3AXMA 3SAFA 2BEFA 2HZCA 4USJC 1HHTP 4FLYA 4WZMA 4CO3A 1C1BA 3NCPA 1H2TZ 3FDSA 3KLIA 2BZ2A 4IO8A 1RUSA 3GCXP 2D0PA 4B1ZA 5FPEA 2KVIA 2XCAA 5C2DA 4UY8T 3DMJB 1CJTA 3PO4A 4Z4FA 3DRRB 2B8QA 1C0TA 2HGLA 4FS1A 1HNZK 2MKJA 5KFRA 3MCNA 5JXSA 3H25A 1B4SA 2IMOA 3UKRB 4A2AA 3GIMA 2HAFA 4JI1F 2Q3SA 2NRZA 2A18A 3QYYA 5EUHA 2CJYB 2DB1A 1RK8A 5BRDA 1S0OA 1AB8A 4ISGA 2AV5A 5DM6Q 1WUAA 4M3YA 2B56A 3HI9A 4OFZA 1IWAA 5B0EA 3ZC4A 5KFFA 2O8DA 3BS9A 1N88A 4EHTA 3OXLA 1HMVA 2DTUA 5HL7Q 1TYQA 5AQTA 3MM7A 5A76A 4ITSA 1XR5A 3MURP 1UTAA 5F1XA 1BISA 3SFUA 2BM1A 4DPWA 3IS9A 2DY1A 3IBWA 2MLXA 4NXNK 2HVIA 1TKZA 2M9KA 1N32J 2QWLA 2ZHAA 4QOZB 1Y00A 3C6TB 2W7OA 1YK9A 1U2FA 1RT5B 3CCRN 3AFGA 5D6GA 3HKZD 4Y0FA 2IVMA 2XYGB 2OTLS 4G1QB 2G9OA 2ZC4A 4JI7K 4FNHA 1SKRA 4NI2A 3WXJA 2XO6A 5EY4A 4CHQA 3MAAA 3BEXA 2GFFA 3IP0A 2PE8A 4JV5J 3PX4A 6FD1A 3JQKA 1S5JA 5E84A 3AA3A 4P2SA 1HBNB 4ZP9A 3N0VA 4BR0A 5CZ1A 5D0RA 4F50A 3I31A 3O6WA 5GAEI 1YITN 5CZXA 1KVAA 3T1HF 1SC1B 4F4KA 1VSFA 2XMJA 4WE1A 3O5TB 5DQIA 3ZTOA 4CM0A 3ZLJA 3AXKA 3A1YG 1EQYA 3GR1A 3PW0A 3VAKA 3I6PA 3H98A 3MOZA 4A46A 1X31C 4P2FA 3HMJG 2HYIB 4WFAQ 3O4WA 1V4TA 4H5VA 4DUTA 2GHVC 4ZDNA 2A3ZA 4X4QA 3D1HA 3GOIA 3L3CA 1MWMA 1PCAA 4X84A 4OV6A 4NL5A 4ELTA 4B9LA 1BXNA 2DITA 1U6BA 4WFNL 4Z4GA 3UIQA 1FRIA 1HBOA 3O3FA 3W8GA 4BG9A 3IKMA 2QMWA 3FZBA 1X4EA 2Z2LA 5KT4A 1XJWB 2YNIB 4DQQA 1HNXK 5HRNA 2H5JB 4DTJA 4KB0A 4R5PB 4NLUA 2E20A 3DRSB 2P9IA 3VAJA 3J80O 4DWIA 3WC2A 4KREA 2P9PA 4OYOA 4CFCA 4A61A 4BWJA 1D3WA 3D45A 2OJ3A 1W2BM 4CLTA 4ZCMA 5AQFA 3RMDA 4CIGA 1WI8A 2VFUA 4DV1F 3N4WA 4DTUA 4DN9A 5ETTA 3GTYX 4DS5A 2KFYA 4LIWA 2EFPA 2YY3A 4F2SA 2YKAA 3Q86A 1NEEA 3G8QA 3R2CJ 3GYXB 4RWXA 4JN4A 3D66A 3S41A 1FEEA 4DS4A 1QLNA 3V6DA 2IVOA 2P9UA 2X3DA 4JLHA 3QZ7A 4DV4K 1QVGM 2LP4A 1U6ZA 1PIEA 1VQYA 2AYGA 2MHEA 4CH1A 4A62A 2FY8A 2JNJA 4AHRA 3G4SN 2UUAF 2P9KB 3E9LA 4OX6A 1I94K 3W9IA 4FJKA 1B0TA 5HI7A 3G96A 4MLHA 3U6FA 4YY3K 1V6HA 3J7AN 1TKXB 2P9LA 1VQ4S 1S1UA 1TL7A 4C97A 3M8RA 1N36K 3NHGA 2Q1NA 4YR2A 1KFDA 3CCEN 2I8EA 3EM1A 3S3OA 1YJ9N 2E7WA 3O1LA 4PL8A 3HSJA 1XNQF 4ZJQA 2WFBA 2ALZA 1QVFR 4M7XA 4FJHA 3M7VA 2Y1RI 4JI4K 3WBZA 1NJXA 3KLFA 4DZ6A 2GWKA 2HBZB 2HQDA 2X6NA 2NYHA 3J7AP 2R8KA 5KG1A 3BR9A 4FKYA 1MG7A 2LVWA 4X62F 4NEYA 4CGHA 1U1OA 3HVTA 5MAOA 2VA2A 4JI0J 2HQFA 5KFGA 1U4BA 3OT9A 1C1BB 4JI8F 3U8XA 3Q7CA 3MECB 8AT1B 4WYWA 2LLZA 4JUZA 4BCAA 2UUWA 2C22A 3PLAA 2LDYA 3TAMA 2K06A 3F41A 4RW6B 2V52B 2XYPB 2IRXA 1N8RO 2ATQA 2HFZA 2AJ4A 2HSEB 3AD7C 3HHLC 3NOCA 4ZP6A 1BQNA 5DDOC 4FLWA 4BRAA 2UXBJ 3WEEB 4OI6A 2IPOB 2O3DA 3GE9A 3SAGA 4J9UE 5DM7Q 2HQGA 2K3KA 1VQOS 2CZ4A 3CCRS 1AZSA 4I2PB 4H03B 4ZN1A 1CULA 4QPXA 1EP4A 2CQDA 3CETA 4DQSA 3D67A 4JHDB 4JI7F 1RHQB 3PO5A 4UW2A 3ID6A 3KK3B 3QESA 4LC9B 4AHCA 5JS1A 1R8HA 3QNWB 3EE3A 3MR2A 2MKCA 4ZCKA 5LOQA 1FD8A 3TJAA 4E0DA 3O3HA 2HGMA 1ZBFA 3SUQA 2UXDK 3L4QA 4K0KF 4B1WB 4BROA 2KXHA 4OJHA 4GC6A 4DL4A 1KFSA 3IRXA 2IGIA 2DGVA 3I5CA 4GKJF 4M1KA 3AA8A 2FC8A 2EWSA 1V3SA 3H8YA 2QGFB 2F4VJ 1QAJA 1WACA 3PTWA 2ZH3A 2GVZA 2BDPA 3MUMP 2GS8A 2GW8A 2PDAA 3W8PA 4USHA 5J1EA 2GV1A 3S3MA 2EKYA 2QLXA 1NNDA 5CABA 1XN9A 4LF6F 1J5OB 4GNIA 4DR7J 1D09B 3Q8RB 4LSZB 3B54A 4DQPA 4MKVA 1X9SA 1GLJO 4PKIA 2KH9A 3G71S 4F2RA 1TKTB 3MCAB 1UWAA 1BIUA 1TKDA 2A1RA 2BXJA 3HKWA 3O6QA 1B0PA 3TWZA 1SKUB 5HLFB 3MR6A 3JTOA 3JAMO 2Z4PA 1CZBA 3I0RA 5HSPA 1QVGR 1LKZA 1VSKA 4I1TA 3CJRA 3EL2A 3CCUN 1X4BA 1FESA 5F3TA 2DH8A 1SUQB 2RUGA 1U48A 4WYBA 4DR4K 4I7FA 3NDKA 1FRXA 2HHSA 3F9MA 3KLVA 2ZE2B 3MUTP 3KWMA 1O13A 4FXDA 2NXEA 2O8FB 1KOOA 3HFZB 3OR2B 1BHLA 4NRTA 4LMZA 5J2QB 2XY5A 3VGLA 4P2XA 2GQ2A 1ICEB 1IJFB 4A57A 4QS8A 2RRNA 4B3RK 4B9TA 3CI5A 2ERRA 2YNFB 3IBFB 3FEZA 1U24A 4FK2A 1SB6A 1VQKS 1A5WA 3ZEUB 2VB6A 3B82A 5A2QY 1SPBP 1VRUA 3AJ1A 1VQ5N 3M6UA 5K8PA 1LAWA 5DQGA 1RT7A 3KHRA 2ZJQQ 3QNOA 3C8YA 2HF3A 4PPDA 4PPZA 1RT2A 2ZBIA 4LF4J 2ATCB 4ZPCA 3LOUA 3H40A 1AYEA 1HNIA 1FHTA 2OSRA 1HBUA 4KGZB 1ZAVA 1PJ7A 2JC0A 3PFOA 5F9NA 1RI7A 3Q8VA 3CC7S 2HHHF 1IXKA 4ECXA 4LF5F 4LFCF 2C2MB 4QWDA 3R8YA 3J7A1 4QIWD 4WFZA 4KI6A 4GV9A 4Z2XA 5ETNA 2BABA 2J0XA 1F60B 2FVRA 4LBHA 3MM6B 1YKWA 1IVZA 4B9UA 1H3DA 1OVQA 3R5CA 1GH8A 4E8UA 2JVRA 3BGLA 1T05B 3SQ2A 3IDHA 2P5OA 2MQMA 4EYIB 4ID5A 3QDKA 4RL1A 2NZ4A 2H9ZA 2BGGA 3ZSZA 4KGVB 4CEQA 4C2MA 2LQ8A 2OEJA 4GVBB 3PRBA 3FBCA 3N5FA 1LWFB 3M8PA 3NF6A 2IHR1 2YHBA 2ZM6J 5ETKA 4H5NA 4PG5A 2E1ZA 5E7OB 3CFOA 2DHHA 5L1IA 4MKBA 5F2RA 4AHUA 1O0PA 2ABYA 5KFYA 3PVXA 3C2PA 4CF8A 3DM2B 3TP2A 3N6NA 4Z7YA 4B3OB 5DM7L 4JI1K 5F41A 4DCOB 1WSEA 2PY5A 2FD2A 3AT1B 4ZVSB 3EKUA 1MWQA 4CQ1A 3I5BA 4P6QA 3THWA 4A8QA 4JKEA 2IFXA 2ZH1A 4UQGA 2DCUB 3CJKA 1XI1A 1HKAA 5C15A 3DXKB 1ROFA 4BVPA 3K5NA 2YV0X 4ILLA 2B5JA 4W98A 2M4MA 4U8YA 2PC6A 3SMSA 3VQ6A 2MY7A 4W5QA 2VWBA 4LVOP 4KPCA 2AW0A 4FPRA 3V1RA 4RBTA 4J7CA 4ILMA 4X4PA 1XC9A 3C66A 1NXIA 3OBIA 1C4AA 1NRKA 2PD1A 3HULA 2PI5A 5M1KA 5A0YA 2ZKTA 4OHZA 3CFPA 2YQ0A 1RBUA 4CVNE 2RN2A 4JNEA 4DV2F 4M42A 2DTJA 3LPEA 2HMPA 2GEMA 3O8WA 3OBWA 1GLFO 3CYMA 4AHVA 2W25A 2IRYA 3J80Y 3M8WA 3P83D 1S9GB 3MOJB 4I6AA 3BF3A 3QZ8A 1NDCA 2BW7A 2W7PA 1BOTO 1RT5A 4PAAA 5HLFA 4YP3A 5KRSA 4PYAA 2KTQA 3ZYYX 2CQ4A 1QZ5A 3LDSA 1URNA 3G0ZA 4P9SA 2JWKA 4C8MA 5A8KA 4DV5F 2W4DA 4KO0A 1WOSA 3GIKA 5C10A 1BQMA 5AQVA 2YKMA 1HKGA 5IQ6A 1HFEL 5BN8A 2V5HG 1N0VC 1SV5B 1NAQA 3W61A 2BW2A 3T41A 4LF2A 1TYQB 3P8BB 4J2EA 1YTUA 2DNKA 2AEMA 3S9HA 3HSDA 2FVCA 3P5JA 3KLHB 1TUWA 1XERA 3OL9A 2HMIA 5A6PA 5EOYA 2HVDA 3IM8A 2WVFA 2R8GA 2D0OA 1T3NA 2W6LA 2YX4A 4C1NK 3EO3A 3MEKA 4TY8B 2RDJA 4EYHB 3MN6A 4CJ4A 3ZX2A 1JLEA 4WJBA 3J7ZO 3MUVP 1YLXA 4BRLA 4H4KA 4G9ZA 1H73A 2HS4A 4WF9Q 3L2WA 3CDUA 2VQEK 2YHWA 3CFRA 4MIWA 2QA4S 4Y2CA 2HWHA 1FX4A 4QW8A 3S8SA 1FRKA 3QPIA 1M90O 3UW1A 3G10A 2X1BA 1SL1A 4NWBA 3J81U 1NGHA 4OGEA 2G1DA 2AU0A 4ZPVR 3V6JA 1KAYA 3BZKA 4OGCA 3R2DJ 1Y5IB 2XZDB 5IT9Y 4WQ5A 3VQPA 3THTA 2MSTA 3KK1A 2AKWB 4J9VA 2CQ0A 4GO5X 3KUGA 2P5VA 2HVHA 3KTQA 2KFNA 3CCVS 2EG1A 3VEOA 1NGIA 3HSGA 4NEZA 4H4MA 1IM4A 5F0UA 3R9PA 1UAWA 5ETOA 4ECSA 3OFHA 3CTRA 2HB5A 3HM9A 5E26A 5IV4A 3D2WA 2UVUA 4GKKF 4KKOA 2FF6A 4QIFA 1R59O 1MU2A 5KFCA 4NOHA 4BDPA 3SSSA 4WXOA 3VENA 2BE2A 1S10A 1VBYA 1HI1A 1PKUA 5H9FK 2EVZA 2LQJA 3AQPA 3WXKA 3SQOP 4ECQA 3DWLA 4OJ1A 1YHQN 5HBMB 4NYZA 4FYYB 1J9AA 2PA3A 4TU9A 2RS2A 3KJVB 1OY6A 4NMXA 4F02A 1L3KA 3AJ2A 4YFUA 4K4XA 4F3MA 3EGZA 4JI0K 3C65A 2ZJPL 3LO3A 1NOYA 2I9SA 2GVZB 5E41A 2R42A 1BQXA 2JRSA 5HMXA 4WK1A 4J9PA 2R8HA 3R1XA 3OSPA 1CLQA 1V3RA 3R5DA 5B09A 5A8KB 2KXFA 2GIFA 3BQ0A 4UOHA 3TTCA 2EHGA 3D2FB 2XMWA 2P9UB 1GLBG 4RW4B 3O9UA 1SJ3P 3HHLA 1GT8A 2FXUA 3CWJA 3GMGA 1EXQA 4XO0A 4JI5J 2DNGA 1TTHB 1WDTA 4BC2A 1RTDB 2F9DA 3CO0P 2CG8A 2DT9A 4TLRA 4OZ2A 1WTBA 1VQ9N 1KVJA 4X4OA 2LU1A 2CQPA 4J8FA 1K1SA 1RKJA 4I4BA 4FSVA 4DFJA 3GU0A 2XC9A 3A3PB 1R8CA 5E3AA 1GNKA 3AOCA 1S5ZA 5KG7A 5D3GA 2ROPA 1BL3A 4AYBD 2IDLA 1QHTA 2XI2A 4DV2K 4E7IA 1DURA 4LR9A 4NLCA 3CD0A 2ZBPA 1QSSA 3EVMA 1D4XA 3QMQA 3RUBL 3KKRA 3P96A 4FJLA 1RBSA 5KT7A 3OLAA 2FTRA 3T7ZA 1U45A 2SXLA 3UNGC 4F0KA 2YWGA 3PYFA 2ZBCA 3W3SA 2OPQB 2R4FA 4ISFA 3OHAA 1FKOB 1HNIB 5E3QA 3EZOA 1JJ2R 3CERA 5F9LA 4ED6A 4ZTJA 2B9WA 5AQRA 1S76D 2NPFA 4HTLA 3TSUA 2PMHA 1BWEA 3AY9A 4CLPA 1RSCA 2POKA 4RUCA 4OHYA 2FJAB 3HO1A 4B9SA 4QAGA 1H2UX 2MQNA 4CCHA 1R6VA 4RW8B 2E1PA 4S0MA 2C2OB 3OYMA 1CS4B 1IKYB 2DEJA 1VQNN 3FCVA 3EPGA 3NWRA 4MTPA 1PYTA 2C3MA 1VBKA 5HO4A 3DRXA 1G3OA 4ZS6A 1ZETA 1LEOA 1J6ZA 1U1QA 1R8BA 4HLBA 3TUZC 1FF2A 3M9OB 2JFDA 3UVJB 5JJBA 2BUPA 1WD6A 3RZAA 1U0HA 2WVEA 1NMDA 2YNIA 4LF1A 3N6LA 2VG6A 2ZOFA 4DHYA 2GGPA 4WU2A 1KBRA 1UJ6A 2KKZA 4DUZF 4CZCA 2QYCA 1N34F 4Y00A 4IOCQ 1HKBA 3QT5A 1WSIA 4ZVUB 5LL6d 2QWMA 1VSLA 3DU5A 4BRPA 4KTQA 4RNNA 4DR4F 4N7TA 2QWOA 2EK1A 4ICLA 2E1MC 3EXYA 2KW4A 3K0SA 4CJPA 2JH3A 4WK3A 4GMJB 2HQCA 4G1IA 3F44A 4ZLJA 3CJCA 3VESA 2M0GB 2BKNA 2HBJA 2F1FA 2YKNB 2PEHA 3JAMU 3N28A 3C6UA 3R1LA 1SL2A 3VQCA 4ES3A 3VGMA 3G86A 3H5YA 2V7ZA 3H7HB 3FBBA 5D77A 4LRAA 2W40A 5FLXO 3UN2A 4FBUA 2G8KA 2VU5A 4N76A 2PI4A 3MMBB 3GG0A 3MMAA 2D69A 2DJWA 5DGBA 4BC4A 3GFYA 4CI0B 1N4LA 5FPDA 2GC8A 2YWKA 1TVRB 1FEHA 5J2NA 1TK0A 4OJ3A 1E6VA 3BF4A 3FE1A 2NQPA 1REGX 1YHQS 3VTIA 5KG6A 3I4PA 4U7UK 4ZVEA 4U7UD 4DU4A 4NMLA 4IBNA 2A2DA 1I6JA 2V8DA 1FTRA 2CPJA 3F73A 2H4WB 2KT2A 2PGCA 3TABA 2OFHX 4HYKA 2HS0A 3VQ8A 3CJ3A 4WFBQ 4E3SA 3ISZA 3LDLA 1S79A 1GAOA 3UDCA 1BWVA 3Q2TC 1Y97A 1CJUA 2FZKB 4L74A 5DRKA 4HTUA 3M9MB 1N48A 3AO4A 1KTVA 4L76A 2GMLA 3BBBA 1IG8A 2VPYB 1R0AA 3C3LA 3UR3C 3ZSYA 2F8TA 1F2GA 2V7YA 1RWWB 5ETQA 1G1XA 2Y9HA 4ZCLA 4X66J 4FXVA 2AD9A 3V4MA 3PKYA 2FB0A 2QK9A 2E2PA 4FLVA 5GAHP 2BV3A 3CDWA 4NCGB 1OMSA 1U1LA 2LQBA 3LWMA 2VCPA 2GNKA 1FJGJ 4KB7A 3ZTQA 3TA2A 3AO5A 2E2NA 2YXLA 4EZ9A 1RFQA 3E01B 3VAHA 2QEXN 3IGNA 1NU4A 3HZGA 1TKXA 1NUEA 4LRFA