2YNGA

Hiv-1 reverse transcriptase in complex with inhibitor gsk560
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
560
structure length
560
Chain Sequence
b'NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Hydrolase
total genus 168
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yngA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yngA05
1O1WA 4BACA 4NLUA 4RG8A 3DLBA 2OZSA 4B9TA 4WYWA 4H8KA 1BCOA 3DLGA 2JEFA 4FYDA 3DYAB 5KFRA 1RBUA 1S10A 4EO8A 2R8HA 2R2RA 2P1JA 3L3VA 3HM9A 3GILA 3DOKB 3ZSVA 3DI6B 1SKRA 4WFXA 2D0CA 4QPXA 3TR8A 1JLBB 3PX6A 1S9GA 3BREA 4DTPA 1LWFA 2F8EX 1NOYA 3VQQA 3N6LA 1NOZA 2IC3A 3UPFA 3NHGA 1S97A 3SFUA 2D7SA 2ETJA 2YHBA 4FJ8A 4J9PA 1S1UA 4Y3CA 3MEDB 1VRTA 3SJJA 1J5OA 4KFBA 1D0EA 1VSFA 3RMCA 2ITGA 4B9VA 5KFBA 3PVXA 5KFOA 2HHQA 3C6TA 3H5UA 3SQ2A 1RTIB 2GV9A 4CEQA 1JL1A 4Z0UA 4B9UA 4DL3A 5D3GA 1U04A 1KRPA 5KG7A 4HCBA 2HNYA 3WNGA 1HJRA 3HL8A 1RAJA 2BDPA 1RDDA 4PWDA 3HSTB 3H5SA 2DFHA 4ZHRA 2PYJA 4ED2A 1S1VB 3D45A 1C1AA 1L3VA 5SZTA 5C25A 3CQ8A 4MFBB 5HRSA 1RT3A 2VG7A 3UIQA 3KLIB 4PQUA 4KTZA 4ECYA 2D0BA 2FBXA 4ECUA 4C8KA 4DL5A 4M94A 4E19A 3NL0A 4ZPAA 3FFIB 1Z4UA 2C22A 4CJVA 3HK2A 4YR0A 2D3ZA 3QNOA 2B43A 3OSNA 3WNEA 1L5UA 4FJMA 2YNIA 2FLNA 2WOMA 4B3OB 4CJWA 5FRMA 2G8UA 4CEAA 1QSSA 4Z4GA 4BDYA 1KLMB 3VQCA 4M42A 4QWCA 4DU4A 4J2DA 3OL9A 4O3NA 3DOLB 4W5NA 4O3PA 1ZETA 3ZSOA 4M41A 1KFDA 1QQCA 1VSHA 1N6QA 3AVFA 4FLWA 4ED1A 2KW4A 1BIUA 3LZJA 4CJFA 4J2AA 1JLQB 1WNSA 4IH6A 1IM4A 1LAVA 4NLVA 1TKXB 1KVAA 3ASMA 4CHNA 3HKWA 4U7CA 2ILYA 1BQNA 3RB6A 1OS5A 5HROB 1K1SA 1JIHA 3QEVA 1UWBB 3RTVA 1LW2A 1RT4A 5KFWA 4ED8A 3NF6A 3NDKA 3AV9A 3TAFA 4PA1A 4CEDA 3ZSYA 4ZPCA 1QHTA 3T5LA 5J2MA 4F2RA 3QEIA 1JX4A 1T05B 4H4OB 1DTTA 3CM6A 2R2UA 2IA6A 2FVCA 5KI6A 4ECQA 3KLFA 4IR1A 4OJRA 3OLAA 4L8RB 3T1AA 4KO0A 3QIOA 3OL6A 1C6VA 3QIDA 2IOCA 3Q8QB 3QGHA 5J1EB 3L2RA 2CJQA 1S6QB 4EO6A 4I9QA 4IG0B 5KFUA 2ATLA 4EZ9A 3NGDA 1S9EB 4WYLA 3HPHA 1J54A 3M9MB 3MFHA 4CGIA 4JLHA 2W9CA 3BSOA 4GC6A 1Q9XA 1S1TB 4B8CA 3K5NA 5DGBA 4HTUA 2WCXA 5F9NA 2HB5A 1QSYA 1WAJA 3U6FA 4RW9A 1RT7B 4F2SA 3H40A 4O3OA 3QYYA 4CJ4A 2EHGA 5EWGA 3M8QB 1VRUB 4K8ZA 2AJQA 4DFMA 4LSNA 1YT3A 3P83D 4DG1A 4JS4A 3OYDA 2E6LA 1UA1A 1EP4B 1G15A 2AU0A 2G8WA 1TV6B 3M9OB 3NGYA 4ED0A 4TSXA 4MKAA 1TAUA 4G1QA 1REVB 4I2PB 4JUZA 4H4MB 5KFHA 1KTQA 1W25A 4ICLB 4DFKA 4NLTA 4M45A 5KFIA 4IG3B 1DTQB 1SUQA 2ZE2A 4IH5A 3I0RB 3F73A 4QWBA 1RTDA 4R8UA 1YVUA 2QK9A 3Q8SB 3BGRA 4CHZA 5F8JA 2W7OA 3L2WA 4EEYA 5KG2A 4DTRA 4URQU 3G6VA 4HYKA 1RCHA 3LWMA 2PZSA 3PO5A 1RT1B 4NLYA 4O3QA 3RR7A 2O5DA 2HHVA 2ATQA 2OPQB 4RNHA 3V6HA 4N47A 4FS2A 4DQPA 4E7KA 1XHZA 4FZXC 2I5JB 3CJ5A 2VG6B 3H5XA 3RB0A 1KHWA 4FLZA 1RNHA 3V4IA 3K5MA 4DTOA 5KG5A 1KFSA 2X78A 4IRKA 2F96A 3PJWA 1ZBLA 5HP1A 1S0OA 4WFZA 2B6AB 3HVTB 4UQGA 4DL7A 3TVKA 2X74A 1RTJA 4CK3A 1Y97A 1NK9A 4XPCA 1FK9B 3CO9A 4CJUA 3O3FA 4R5PA 5CYQA 3QESA 5JS2A 1HQEB 4Y1CA 3BSCA 4QWDA 3VQ5A 4J9LA 2FBYA 1HMVA 3MEGB 1VSKA 3KNAA 1T94A 5FRNA 1NJZA 2HMIB 5HBMB 4C8LA 3DLEB 2EX3A 3KD1E 5KT7A 2HVIA 3B6PA 3UQSA 3BQ1A 4PY5A 3AVHA 3OYLA 1C0TB 1TKZA 3D5MA 2XGQA 4Z4HA 1WSFA 5KT6A 4W5TA 4BWJA 3SPYA 3CDEA 1N4LA 3OJUA 4LH5A 1TKTB 3I5AA 2YNFB 4DLEA 2WRMA 2G8VA 3IRXB 4Z4CA 2OYQA 1S0MA 3DOKA 3DI6A 1BQMB 1ASVA 2XGPA 1KVBA 2XY5A 1TK0A 4K8XA 4KAIA 1JLBA 1B92A 5KTQA 4LD0A 4K4YA 1I3AA 4B9NA 4NCGB 1SV5B 1XHXA 1U47A 2FVQA 4BE1A 3GYNA 3MEDA 4N76A 2RKIB 1D9DA 4KB7A 4TY9A 3K5OA 3LAMA 3FQKA 5I42B 2ASDA 1WSJA 1RTIA 4IKAA 2R8IA 3OYBA 4FJ7A 3LP0B 3GIJA 1RBRA 2RDJA 4MK7A 4K4TA 3JSMB 4NLQA 4RW8B 1SL0A 1A5VA 1A5XA 1KSPA 4O55A 3I0SB 1S1VA 3QGGA 3RWUA 2R2SA 1S49A 1TL3B 3KK3B 4MFBA 4AHTA 3NAHA 1BGXT 4U6PA 3MXIA 3KLIA 3TABA 1ZBUA 3OYFA 1NKBA 1TGOA 4F3OA 1JLGB 1YTUA 1R0AB 1BL3A 3FFIA 1ITGA 5KG6A 3DLHA 2VWJA 4CEOA 4CECA 1LW0B 4NLWA 2HNDB 3G10A 4FJJA 2UUTA 4CJTA 1U09A 3NCIA 2BE2B 1HYSB 1S1XB 4B9LA 4ELTA 4FXDA 3L3UA 1LWCB 2V0NA 4B3OA 1Z25A 2V4QA 5J2QB 4CJEA 1KLMA 3TAMB 2VA2A 3AA5X 1D8YA 4EBCA 2E4LA 3DOLA 1J9AA 3OYHA 4F4ZA 3M9NB 4O3RA 3EPIA 3HPGA 1YVFA 4OLBA 4NCBA 2FLLA 2IBKA 5L1JA 1CSJA 2KFNA 2XY7A 3B6OA 2VWKA 3H98A 3HJFA 4J9KA 1JLQA 1C1CB 1GOCA 4ED3A 1TKXA 3TQ1A 2PYLA 1HRHA 2WHOA 2YNGB 4F4KA 4K4ZA 5HROA 3CJ2A 1T3NA 2XY8A 1UWBA 3PW4A 4Q8FA 2ZQBA 4QOZB 4NLDA 2R8KA 2AWZA 3MXJA 1VSLA 3IN5A 3RAQA 1ZBHA 2D3UA 5JUMA 2E9TA 2W8KA 5F9LA 2YV0X 4DL6A 1T05A 4H4OA 3KKSA 1KHVA 3ZSWA 1TVRB 3HPOA 5C5JA 4FJHA 2HW3A 4HUFA 4WZMA 1EKEA 5KG3A 2R8GA 3PW0A 1GOBA 3HXMA 3CG7A 2E9ZA 4ZTJA 2QKKA 1TQLA 3AA4A 4KRFA 5J1EA 1QUVA 4M3RA 4ZVGA 4FJKA 4Y34A 1S6QA 4O4GB 4IG0A 1EETB 3KMQA 2W42A 3PR5B 3VQPA 1GOAA 4ECTA 5EUHA 1S9EA 3OYMA 4QW8A 3PR4A 3DLKB 2E6MA 3TAGA 4RUAA 4YNQA 4ELVA 1HQUB 1HPZB 1S1TA 2UVRA 4DSKA 2R2TA 2RF2B 4HVJA 2ASLA 4FZZA 3SUOA 2XY6A 3AVMA 2G8HA 4ED6A 1SKSA 1RT7A 3V9UA 3G86A 3CWJA 5EWEA 3AA3A 3M8QA 2HWIA 3N6MA 1VRUA 4CE9A 3LALA 2QV6A 3VQDA 2VG5B 3H59A 3ZCMA 4ZVFA 1EP4A 1TV6A 2Y1JA 4FCYA 3KLGB 2YKMB 4G3IA 3VQEA 3FSIA 3O4QA 1QSLA 1REVA 4I2PA 4H4MA 1IKVB 3QNNA 4ICLA 4F3TA 1DTQA 4IG3A 2GIQA 1SH0A 3VQ4A 3I0RA 4FM1A 4LQ3A 1ZBFA 4K4UA 1N48A 3KHRA 1TL1B 4IRDA 1S1WB 4YR3A 2KZZA 4CGGA 2W9BB 2BQUA 3ISNC 3E51A 2ZD1B 4JRQA 1RT1A 1SH3A 4C8NA 3RMAA 4O44B 2WB4A 3CYMA 3L8BA 4KPYA 5T14A 2OPQA 2HAIA 1YTAA 3QIPB 2PY5A 2I5JA 2VG6A 4RNOA 1B9FA 2LSNA 3E01B 2J6TA 3THVA 1JLFB 3SV4A 4FLXA 2XI3A 4NLSA 2B6AA 3HVTA 4DS5A 1RYRA 1U45A 4KHNA 3OS2A 1FK9A 3QZ8A 2RPIA 4EBDA 4GVMA 1HQEA 2ILZA 5FDLB 4URSA 2IMWP 5HRNA 4ZP7A 1NK4A 2JC0A 3NFAA 3MEGA 1RBVA 3NH2A 2GBZA 2IM0A 2HMIA 5HBMA 3DLEA 5KFDA 3VQ6A 1TK8A 4DQRA 3LP2B 1C0TA 4DU3A 5CZ2A 3KLHB 4CF2A 1GX6A 3SQ1A 3GIIA 4EBEA 5J2PB 5KFSA 5E41A 1WSGA 1TKTA 1S5JA 2X6SA 1RDCA 4ECXA 4KBIA 1NJYA 2YNFA 3V81B 3VQBA 4CF1A 4NZ0A 3IRXA 1N56A 1JXEA 4WXWA 1BQMA 1LWEB 1VSIA 1NHUA 5T7BA 3OJSA 2UUWA 4NCAA 4E7IA 4DTJA 4FJXA 4NCGA 1SV5A 2OPPB 3HT3A 3PW7A 3O4NA 2YNHB 4FJ9A 2BGGA 4NLXA 4CIEA 4M3ZA 2RKIA 3L2QA 3SI8A 5I42A 3SV3A 3LP0A 4QWAA 3H2LA 1BCMA 4PUOB 5F8LA 1IG9A 4IRCA 4J9MA 4J9QA 3JSMA 4TQSA 4RW8A 3MEEB 1JLAB 2ZKUA 1BHLA 2G8FA 2R8JA 4E1MA 3I0SA 1Q8IA 3CM5A 3EPGA 1TL3A 4ZP8A 3KK3A 5F8NA 3VQ8A 5DMRA 4FLVA 3AVIA 3ZT4A 4CGFA 3AVNA 5L1KA 4IH7A 2ALZA 2B5JB 3MR6A 2HNZB 3BSAA 1U49A 4M3WA 1JLGA 3ZSXA 1R0AA 1RDBA 3KK1B 1LW0A 3ALYA 5KG0A 5KFEA 2HNDA 1NNDA 4IQXA 1XR6A 4FBUA 3TAEA 3C94A 2Y1IA 4RW7B 2BQ3A 2BE2A 1HYSA 1S1XA 1LWCA 4OPJA 4OL8A 3OYEA 2AX0A 3IG1B 2C2DA 4RU9A 2EC0A 4IFYB 2AGQA 1W0HA 3HP9A 5J2QA 4JV2A 1XR7A 1MU2B 3O3GA 4FBTA 2DY4A 3F9KA 2JGUA 3HHKA 3TAMA 4URGA 1X9MA 4LSLA 1JKHB 3GQCA 1QE1B 1HNVB 3CDWA 4CEEA 3I8DA 3K57A 1UAXA 3M8SA 3KK2B 3GV8B 1QAJA 4N5SA 1RBTA 3TARA 4FK4A 3HP6A 5HLFB 2WTFA 4CGDA 4CJLA 4AHCA 1C1CA 4CJRA 4HUGA 4CJPA 2X6NA 4IDKB 3SNNA 4Y1DA 2BRKA 2YNGA 4OLAA 2KTQA 4F4YA 1TAQA 2GUIA 4GMJB 3U3YA 4TQRA 4KAZA 3RBEA 3NF7A 5JS1A 4CF8A 4WE1B 1K6YA 1WSEA 2IDOA 2O4IA 4KI6A 3FQLA 1L3SA 3OYGA 3NAIA 2Z1HA 1TVRA 1ZTTA 4LQ9A 3HVWA 5F8GA 4JRPA 2AQ4A 2C2EA 1JL2A 5KFAA 4CK2A 3VA3A 4DWIA 4CJSA 2IM3A 1CLQA 4MIBA 3AO4A 2GIRA 3T5KA 4EP5A 3VQ9A 2RDIA 3CJ4A 1NK0A 2YHAA 4O4GA 3V9WA 5KT5A 1JLEB 3ULDA 1EETA 3LP1B 4ECRA 4WFYA 5EU7A 4Z4IA 2Z1GA 4MIAA 2DFEA 4KSEB 5KFVA 3DLKA 3DDKA 4ZP9A 5FROA 4O0IA 3IAYA 1HQUA 1HPZA 4YQWA 1HYVA 4ZVHA 2RF2A 4WXOA 3OHBA 3OVNA 3ITHB 2CKWA 1GX5A 3G6XA 1UOCA 3V1RA 4K4XA 2OZMA 3PX0A 4CHOA 3CJ0A 4OKEA 1ZBIA 2VG5A 3QLHB 3OL8A 2Z1IA 2XWYA 4GW6A 4DTXA 3KLGA 2FVPA 5F8MA 2JEGA 2YKMA 4TY8B 1IKVA 4YMEA 3OYCA 3CIZA 2FBVA 2Q3SA 3AVAA 4I7FB 2P51A 4FJ5A 3DLRA 4ZPDA 3CVKA 3D0PA 4J9RA 4CGHA 3M8RA 3H08A 4O3SA 2IAJB 1TL1A 1S1WA 4DL2A 5KG1A 2W9BA 4Q5VA 3KHGA 3LAKA 3MTKA 2ZD1A 2HHTA 5J2NB 3V9XA 4XO0A 2HHUA 4O44A 4GC7A 4FS1A 4KKOB 4ECVA 3V6JA 3QERA 1X9SA 4Q8EA 1L3UA 5F8IA 3AO3A 4I9LA 5DQGA 2WONB 1NKCA 3LZIA 3IGVA 3SQ0A 5C24B 3KHHA 3QIPA 3BQ0A 4H54A 1CZ9A 3GV7B 1T03B 1JXLA 4CEBA 3E01A 4R0EA 2W7PA 1RA6A 3KJVB 4KTQA 2YKNB 3RB3A 3AA2A 5KFPA 1JLFA 4W5QA 1FXXA 3KLEB 4ECSA 4NLOA 4LSLB 4BE0A 1RTHB 2QE5A 3MAQA 1NK6A 5FDLA 1VSMA 4FK0A 4ZPBA 3IS9B 3WNHA 3L2VA 3QO9B 2OH2A 3DMJB 4F50A 5KFLA 3CFRA 3C95A 1RBSA 3I5BA 5KT2A 3LP2A 5I3UB 3DRSB 1IKXB 4TXSA 1F21A 3P5JA 1NJXA 2KQ2A 4CFAA 3OYNA 3KLHA 2OA8A 1RT6B 4KV8B 3DRPB 1XWLA 2DFFA 3NBPB 4RZRA 4E7LA 5J2PA 1N5YB 1BIZA 3V81A 1LWEA 5EDWA 4Z4FA 3PV8A 4BDZA 4Q45A 1WN7A 1WNEA 4C8MA 2OPPA 4DQQA 4XPEA 2YNHA 5K14B 1LV5A 5JXSA 4OVLA 1XC9A 2XI2A 1BISA 3GIKA 4DTSA 1KLNA 3Q8RB 4J9NA 3CDUA 4PUOA 2NUBA 4M3TA 1SKWA 1FKPB 4CFBA 3DRRB 3EZ5A 1S9FA 4KREA 5L1LA 5KFCA 3MEEA 1JLAA 1MMLA 1D1UA 1IKWB 1ZYQA 4M3YA 4FJIA 4I2QB 1D5AA 3OYAA 4W5OA 4AHRA 4IFVB 2B5JA 1Z26A 1IKYB 2HNZA 1RDAA 2D41A 4CHYA 5DLFA 5DG7A 3KK1A 4QW9A 3PO4A 3SCXA 2OPSB 2FJVA 1T8EA 3OLBA 2V4RA 1SL2A 3OHAA 1HYZA 4LY7A 3P1GA 4RW7A 2Z1JA 2G8KA 1S6PB 4BE2A 4Y2CA 2JEJA 4CF9A 3VQ7A 3K59A 3IG1A 4CFDA 3SZ2A 1HNIB 4IFYA 4KB1A 2AGPA 4J9OA 3O3HA 5F8HA 1MU2A 4OGEA 4KB0A 3AVJA 4YR2A 1JKHA 2BR0A 4Q0BB 4AHUA 4FLYA 1QE1A 1HNVA 2FJWA 4RW6B 4NRTA 2KZMA 4K50A 4O4RA 3T3FA 4RW4B 3KK2A 3OSPA 2HWHA 5DG9A 3OL7A 3Q8PB 5DQIA 5HLFA 4O5BA 3UDLA 5L9XA 4EP4A 3M8PB 2D0AA 4IDKA 1ASUA 3SYZA 4CJ3A 3N6NA 5KFNA 4QCLA 3BSNA 5HRPA 2IJFA 4TLRA 3LPTA 4WE1A 4AH9A 4ID5B 3SI6A 2B4JA 5KFXA 2WK4A 5KFKA 4ZP6A 5EWFA 2UVUA 3V9ZA 4FM2A 1KCFA 4DF4A 4FJGA 3SPZA 2UVWA 1RT2B 4E7HA 1J53A 2QKBA 1IO2A 5KT3A 3OY9A 1ZTWA 1RA7A 5KFGA 3OYIA 2F8TA 5CYMB 2P5OA 3LPUA 4DFPA 1TP7A 3G6YA 4J2BA 1RT5B 3ZT1A 4K4SA 3K58A 3L2UA 1JLEA 3FDSA 3LP1A 4HUEA 4M95A 4FM0A 1JLCB 4J9SA 3RRGA 4CJQA 3UR0A 4DL4A 1C0UB 1DLOB 1U48A 2HHSA 2DPIA 2GC8A 1NK5A 4FLUA 1BI4B 2KFZA 4CK1A 3MFIA 4Y2AA 3ITHA 1C1BB 1NKEA 4CESA 3LWLA 4F8RA 3C6UB 5KFYA 3JYTB 2I1RA 4QWEA 4ELUA 3MXMA 4CJKA 4DTNA 4TYAA 3ZSZA 3VQSA 3RMBA 1D9FA 3V6DB 3RMDA 4ECWA 4E1NA 2BANB 3QLHA 5KRSA 2J6UA 1S4FA 4DTMA 3NKYA 3MECB 2AGOA 1EX4A 3T5HA 4JV1A 1JXBA 4DTUA 4M3UA 3QEPA 3AVKA 4TY8A 4EZ6A 4IBNA 4I7FA 4NLRA 5KFMA 1SH2A 3V9SA 1FKOB 3EY1A 3PX4A 3VQAA 5DLGA 4OPKA 1RILA 2IAJA 4HCCA 3V1QA 4JS5A 3KD5E 5C42B 1W9HA 3IGNA 5L1IA 1X1PA 3RBDA 3NF9A 5J2NA 5DK5A 3ZSQA 1KVCA 4DSJA 4MK9A 4KKOA 5KFTA 3KLVA 3DM2B 2OPRB 2WONA 4IR9A 3WNFA 2JC1A 5C24A 2FBTA 4BWMA 4KI4A 4TYBA 4DSFA 3AO2A 3DLGB 4MH8A 4O0JA 1T03A 3PW5A 4DS4A 2JEIA 3KJVA 2YKNA 2XRIA 3KTQA 4Q44A 3I5CA 1C0MA 3NE6A 4KHWA 1S9GB 3KLEA 3KKRA 5KGWA 1LWFB 4RNMA 4B8AB 4YFUA 1RTHA 2IC3B 4EYHB 2IM1A 4DSEA 3K2PA 4B9MA 1S1UB 1VRTB 2HHWA 1J5OB 3IS9A 4CJ5A 3ISND 3QO9A 4KFBB 3NGIA 5DG8A 3QZ7A 3PHEA 3NH1A 3DMJA 4CHQA 4KHQA 3C6TB 3TI0A 4W5RA 2J6SA 3OYJA 3ZT0A 5D3GB 5I3UA 3DRSA 1IKXA 1VSEA 2HNYB 2VA3A 1RT6A 4ED7A 4KV8A 4FJLA 3DRPA 1NJWA 4PWDB 3NBPA 1CZBA 3U3GA 4FLTA 1N5YA 4CFCA 4ZHRB 1UA0A 4F4XA 3BQ2A 2ASJA 5C25B 4NLPA 1RT3B 1L3TA 2VG7B 4PQUB 1A5WA 4DMNA 5KFJA 4E3SA 1B9DA 4E89A 2FJXA 3SQ4A 3ZSRA 1NK7A 3KHLA 2JLEA 3QGIA 3S9HA 3MF5A 4AHSA 3KMSA 5KGXA 4AILC 3QINA 5CZ1A 3S3OA 5K14A 4BDPA 3RR8A 3VA0A 4FK2A 2FLPA 1NHVA 2HVHA 2YNIB 4KHMA 5DGAA 3NGZA 1QTMA 2WOMB 3H4DA 2O4GA 3RAXA 3S3NA 2AX1A 4OGCA 3SUNA 3T19A 1CXUA 1FKPA 3DRRA 4CGJA 5DQHA 3OS0A 3S3MA 1RYSA 1LAWA 1I6JA 4FVMA 4X2BA 4DF8A 2A1RA 1IKWA 3NH0A 3TAQA 3ICLA 3AVLA 2XHBA 1N6QB 4DLGA 4I2QA 1XI1A 1IH7A 4K4WA 5KFZA 4KHUA 2XO7A 4IFVA 4NLGA 1IKYA 3NMAA 3V1OA 2P5GA 1EXQA 3A2FA 2XC9A 4JV0A 4WZQA 3NAEA 4ECZA 3CJ3A 4XIUA 4J2EA 5SWMA 2OPSA 1BQNB 2RN2A 1WAFA 4RNNA 3DYAA 1K1QA 3KIOA 3RRHA 3H4BA 1LW2B 2D5RA 4DSIA 1RT4B 3OYKA 1QAIA 1S6PA 3PW2A 1X9WA 1HNIA 4FW1A 5J2MB 4CF0A 4IOBA 3SUPA 3G0ZA 4DFJA 2BQRA 3LDSA 3NF8A 4CIGA 1DTTB 4OKKA 4Q0BA 3LANA 3H5YA 4ZVEA 3KLFB 3EZUA 4RW6A 4KHRA 1VSDA 3PZPA 4KO0B 4DU1A 2E9RX 4DSLA 4RW4A 2A1SA 4NRUA 3AVCA 2V9WA 5HRRA 4KHYA 3HVRA 3RB4A 4NYNA 3M8PA 4F4WA 4TN2A 1S0NA 3HYFA 3K5LA 2UVVA 4QAGA 4LH4A 3LP3A 4KTWA 1VK0A 4B9SA 2W9CB 3CFOA 3D28A 5KFFA 2C2RA 2DTUA 3TAPA 4Z4EA 4ID5A 3AO1A 1I39A 1WSHA 4RW9B 3VN5A 2QXFA 4KHSA 3TANA 4FZYA 4RUCA 3ZT3A 1VSJA 4AHVA 2XCPA 3PUFA 4MQ3A 1RT2A 4LSNB 2W8LA 1CXQA 3GIMA 4DG1B 1ASWA 2C28A 5CYMA 1XR5A 3PY8A 4IKFA 1TKDA 3SUQA 4E7JA 2FVRA 1RT5A 4G1QB 4CEFA 2IGIA 3AO5A 3QEXA 4HHTA 2IS3A 3HVAA 4CEZA 2R7YA 4CHPA 4CIFA 3BJYA 4K4VA 1JLCA 3HO1A 1SUQB 4RNFA 2ZE2B 3CFPA 2FVSA 3GV5B 1C2PA 4C8OA 1RTDB 3PJXA 1C0UA 1DLOA 4R8UB 3MR3A 3BGRB 4DQIA 3KOAA 3AVGA 1BI4A 4N41A 3BDPA 1C1BA 2W9AA 3C6UA 5KFQA 3JYTA 2HHXA 4EYIB 3FRZA 4MK8A 4ZTFA 5KRTA 4DEZA 4ID1A 4NYFA 2F8SA 4FJNA 2IM2A 1NK8A 3V6DA 3AVBA 3T5JA 2BANA 3SFGA 5KG4A 4YP3A 3MR5A 3V4IB 3V6KA 1SL1A 3MECA 4NYZA 1RDRA 4ZMMA 2BRLA 2XCAA 4FW2A 3OS1A 5HP1B 3QETA 4KE5A 4B08A 2FC0A 1QS4A 3TWHA 1RTJB 4DQSA 1S48A 4N56A 4HKQA 1HARA 4E0DA 3EYZA 3QEWA 4CERA 4R5PB 5CYQB 1FKOA 4CCHA 2IJNA 2DPJA 1Q9YA 1WSIA 3BR9A 1T7PA 5KT4A 1WLJA 1HMVB 5C42A 4MKBA 1TK5A 4Q43A 3ZT2A 1U4BA 5CY4A 3MR2A 4OKJA 3DM2A 2OPRA 1TKZB 4M3XA 2G8IA
chains in the Genus database with same CATH superfamily
1FW6A 3DLBA 4NLUA 2OZSA 4H8KA 4FYDA 1S10A 2V52B 2Q1NA 4CM0A 1XERA 2R8HA 2B7CB 2R2RA 1YX2A 3DOKB 4QR2A 3DI6B 4DR6F 5BRFA 4DHVA 4QR1A 3BREA 2VQEF 3W7BA 1Q0NA 4WF9Q 1KOHA 1N0UA 1NOZA 2IC3A 2CNOB 3SFUA 5AQZA 2D7SA 2ETJA 1H72C 3SJJA 4A5AA 2V8DA 3H5UA 1WF2A 2XG8A 5BPLA 5SUHA 4DL3A 4NLBA 1PJ7A 4DR1F 1VC6A 3HRGA 3THPA 4HCBA 3WNGA 5AFUH 3OFFA 3E9LA 3HL8A 1RAJA 2UZAA 2ZZNA 1RDDA 3RG6A 4UT4A 1Z2ZA 2RJZA 2CGKA 2DFHA 2JVRA 3D45A 4IO8A 3CQ8A 3EE8A 1Q5YA 4ECYA 3K7RA 4CZFA 3M8ZA 2GJFA 4E19A 3P39A 3NL0A 2QEXN 2WW4A 1PJ5A 1Z4UA 3UB5A 2C22A 1JMTA 2E5LF 2EFGA 3CCES 3HK2A 1U1KA 3EKUA 4FJMA 2FLNA 2O8FA 2Y8WA 4BLGA 3C2PA 4B3OB 1HQ2A 2H65B 4QZVB 1SAZA 4CJWA 2V51B 2VBXA 1FVQA 5A0YA 2FSKA 4BDYA 3L3CA 4J2DA 3OL9A 2XYPB 1LFWA 2GMJA 4K0KF 4B3RK 3FVYA 3CF5L 1BC6A 1ZETA 3ZSOA 1KFDA 2DR5A 1QQCA 1OH7A 2HPUA 1N6QA 5DS7A 4JB8B 2V8HA 3U9DA 4TU9A 4ANCA 1BIUA 4LFBK 4CJFA 4ZCKA 4PPZA 3P49B 4DUYJ 4CHNA 4YDDB 1UJ4A 1R8PA 4FKXA 1X4HA 5HROB 4C2MA 1H0HB 4AXJA 1UWBB 1N34K 3PIPQ 5DM6L 3NDKA 3AQPA 4CO5A 3AV9A 4PA1A 3OTOJ 4ETXA 2XZWA 2YWKA 3T41A 4AF1A 3G6ES 3ZEUB 4WWSA 1JX4A 2RRBA 4H4OB 1K9MT 1TL7A 3CM6A 4OZJA 2RS8A 2IA6A 5E26A 2FVCA 5KI6A 1P90A 3CT9A 2VZ9A 4HHJA 5RUBA 3T1AA 4L8RB 1XNRK 2NNWA 4H0YB 1C6VA 2DRDA 3U8XA 2CJQA 3E9PA 3TJ9A 7FD1A 4JK8A 2ZZMA 1EWRA 2DNMA 1BY9A 3QBCA 2ATLA 3Q89A 2HZCA 3JAMY 3M9MB 3MFHA 2AT1B 1Y5IB 4JLHA 3FCHA 2ITMA 1Q9XA 4B8CA 3J81O 4HTUA 5DDOC 2L08A 5AZJA 2VHGA 1VCTA 2KJVA 1RT7B 4CZJA 2M7SA 3H40A 1T3OA 5EWGA 2GNKA 1QQNA 4WP3A 3BZKA 3QSYB 4OZ0A 4NYPA 1NH8A 3U9ZA 2JVOA 2AU0A 2G8WA 1TV6B 1GEHA 4HHHA 4MKAA 1Q7LB 2PFUA 4P72A 1Z05A 1N36F 1S72N 1HR0K 4FF2A 5A2QU 1NDCA 4RR5A 5KFIA 1DTQB 4IG3B 2BW7A 1RWKB 2ZE2A 5HQLA 1JJHA 4OMFG 1D4XA 3ZLJA 4QWBA 1RTDA 3FR0A 1YVUA 2QK9A 3Q8SB 4ANDA 2YJFA 3L2WA 5KG2A 4DTRA 1VQNS 3RSEA 1FJGJ 2N3LA 2PZSA 3KG1A 5AR0A 3RR7A 3HKZD 3CJQA 4RNHA 4I1TA 3BY5A 2DHHA 4WPAA 4FWKA 1OVYA 1N52B 1OJ4A 2FPHX 5M1NA 1HLWA 3RRKA 4FZXC 3P5TL 1FVSA 3W5ZA 3SK3A 4A57A 4LC9B 1CJUB 4JI7F 1RGVA 2OTJS 1NSQA 1ZBLA 4A8SA 1VYAA 1S0OA 5GAEI 2B6AB 4NZ7A 3TVKA 4RO0A 2XM3A 2YQ3A 4XPCA 3POTB 1B7YB 3D7EO 4PKGA 4LFAJ 1HQEB 4Y1CA 5AQQA 4CZEA 3VGUA 3D6MB 3M4XA 4J9LA 1VSKA 2BE7D 2B4UA 2HMIB 4C8LA 5LSOA 1UFKA 3OR1B 2CG4A 4PY5A 5K8PA 3AVHA 1C0TB 1TKZA 5M1FA 2KHDA 4YEAA 4W90B 1WSFA 4PYDA 1NUEA 2NXNA 3MK6A 1CBKA 3U1LA 1LNQA 4LH5A 4YY3K 3LA0A 4DLEA 4Z4CA 3DOKA 1IJEB 3DI6A 1KVBA 1NZAA 2BUPA 2QWNA 1TK0A 4KAIA 1B92A 5KTQA 1SV5B 1R8BA 2QWPA 2RHKA 5HI7A 1H1VA 2J7WA 3GYNA 2EC2A 3QMLA 3CCLS 3K5OA 1MA9B 3FQKA 2ASDA 2IVMA 2ZHBA 4IKAA 4FJ7A 2MEWA 4DCOB 3GIJA 1JNZB 1OVQA 2CQGA 3TX0A 4DPWA 4MK7A 1XMOJ 1KVIA 1XN9A 2FHMA 4O55A 3MN9A 3I0SB 1S49A 1TL3B 2F8HA 1YGYA 4LF2A 3ETOA 3MXIA 1NCLA 1ZBUA 5BR8F 1TGOA 2RILA 2QLJB 3NCPA 4F3OA 1R0AB 5KG6A 2CQ3A 3B6BA 1GLJO 3M6UA 3TUJC 1K0TA 3G10A 4WP9A 2UUTA 3NCIA 1WHXA 1DGKN 2P6TA 2E66A 4B3OA 4KH4A 1S22A 4C6AA 4D3HA 4LF8F 2FTRA 5HSPA 3AA5X 3R1HA 4EBCA 2E4LA 5AQSA 5AT1B 2CA9A 2E2QA 3MPWA 3SAFA 1VISA 5FD1A 4NCBA 5L1JA 4BC5A 1TUGB 2XY7A 2Q79A 4LVOP 3GYGA 3H98A 2EWSA 3KWMA 2ZHOA 3HJFA 2Z57B 5CH7B 4G9ZA 4JI0K 5GADI 4LF4K 3JTPA 1HRHA 2ZBPA 4X62J 4F4KA 5HROA 1B70B 3CJ2A 4H0TB 1UWBA 4Q8FA 1QQOA 1J5EK 2R8KA 2HSTA 3MXJA 4P52A 5B7WA 2HVDA 4DV0F 2D3UA 5AQNA 3QFPA 2E9TA 3ZEUA 1KC8T 4DV6K 4QIFA 2PA8D 4H4OA 1GLLO 3HPOA 3HFZB 2NXJA 3CIMA 2KO1A 5KG3A 5DM6Q 3CJSA 2R8GA 5CXTA 4I4BA 3GG4A 3GIRA 4EHUA 3CG7A 2HBMA 2HRYA 1VQ9N 3KUHA 4LF5K 3AA4A 2LQ8A 2VPYB 1YZ6A 3TZYA 1SBRA 3KMQA 3TPQA 3J81j 2W2MP 4ECTA 1LK7A 3PR4A 3WUHA 3FFKB 3DLKB 4I6MB 2E6MA 4CBUA 3FZ2A 5ETNA 4H0VB 4RUAA 2LQBA 1GAOA 4H5TA 2CVEA 2YI1A 1NM2A 4DSKA 2B9XA 5BXIA 3OUYB 3I55S 3AVMA 4WQ5C 4ED6A 1RT7A 3V9UA 3ILJA 5LY3A 1OY8A 1FDAA 2ZM6F 3R3LA 3N6MA 1M90O 4USKA 1TL4A 3H59A 1A9NB 3CQYA 1TV6A 3IBFB 4FCYA 2YKMB 1UVKA 3GFHA 4RBVA 1KAYA 2MSSA 3QNNA 4KGVB 1M5KC 2OEJA 3E8OA 4LREA 4F3TA 1DTQA 4IG3A 3MTJA 5GAHU 1SVDA 3QJJA 1ZZNA 3HLUA 4LQ3A 1ZBFA 4HH1A 1TL1B 1EX8A 2W9BB 3E51A 1M1KT 3TVYA 3THYB 4JRQA 1LWXA 3TQEA 1R8AA 5EN1A 2VQFF 4UOGA 4LSZB 4RU2A 2XYGB 3CCQS 5T14A 3ZZTA 2G0IA 4WFNL 1VLOA 1NU0A 1YTAA 4CI0B 3QIPB 2GVDB 1UCNA 1X5PA 4AXIA 2C2OB 1B9FA 2LSNA 1PBUA 3LTOA 1CJUA 1AYEA 4CLYA 4F04B 4TKTA 4B3SJ 2MGZB 3SV4A 4FLXA 1RE1B 2XI3A 2B6AA 3POTA 3CD0A 1R0BG 4Z94A 2X3DA 2YWFA 1IN0A 4JK9A 4WCEL 1HQEA 5FDLB 5HRNA 5AQLA 2GMLA 1RBVA 3HSGA 4Z2XA 3TU5A 2HMIA 1U1OA 1TK8A 3OR1A 3M32B 2HFNA 4HL9A 4DR5F 4ISGA 5CA5A 1C0TA 3CC4N 4KHPK 4A2BA 4PRFA 5ETMA 4PL7A 3GIIA 2B56A 2E44A 3FEXB 2UUBJ 1GMWD 5KFSA 5E41A 2CJXB 1WSRA 3VQBA 1YVNA 4M5KA 4UQTA 2POKA 2RQ4A 5M2UA 1JXEA 1QZ5A 4WXWA 1NMEB 1TZ0A 2Z58B 5T7BA 2BA9A 2UUWA 4CZLA 4O5FA 1SV5A 4OZ3A 2QIFA 1HA1A 1F2GA 1Q86T 4CIEA 4M3ZA 2QT7A 3DFEA 3SI8A 2ASYA 3RZAA 4CZKA 3N4PA 2L9NA 3GTYX 4U67L 3SV3A 2J0XA 2ZITA 4CLKA 3PIOQ 4IRCA 1UJ5A 4J9QA 2N4CA 2OD6A 3ELHA 1JLAB 1SQKA 4MLHA 4E1MA 4B3TK 3I0SA 1Q8IA 1TL3A 3FK4A 2QWQA 4J8FA 1RB0A 2XMWA 3AVNA 5L1KA 2KB2A 1WF0A 3IMXA 3PHTA 4M3WA 4DV2F 1R0AA 2UXCF 5L46A 5KFEA 2C3OA 2UUCK 2KU7A 1YI2N 1EQYA 1PIEA 4FBUA 2DPNA 2ROGA 4X66J 3TAEA 3C94A 3ILLA 4GKKJ 2MKYA 1Y64A 1X4DA 2KL8A 2H3GX 3IWNC 4LF7K 3DAWA 1EJ7L 4YB7A 4JV2A 1XR7A 3O3GA 2AW0A 3HHKA 5LSRA 4URGA 1X9MA 1KXPA 1JKHB 1QE1B 1HNVB 3CDWA 3JB9k 4LF6K 1T11A 4CEEA 2H4WB 2HLTA 3K57A 4JI8K 1UAXA 3R97A 3LF0A 1RBTA 3O8MA 1YBAA 3FRYA 3HP6A 3PYFA 2JHEA 4CGDA 3W66A 4AHCA 2MQLA 4CJRA 1VK3A 2X6NA 5IT9O 5K5MA 5BYQA 4F4YA 1IR1A 1TAQA 3Q7BA 2JOQA 1T44A 3NS6A 3NF7A 4CF8A 4WE1B 3Q8UA 3NGRA 2IDOA 1FESA 1TFWA 3CCUS 1AT1B 3VAJA 4JV5F 3BN4A 3KNGA 1IVZA 2CNLB 3R3TA 4DX7A 1ZTTA 5AJ3J 3WQTA 3HVWA 1FRMA 3OXFA 5F8GA 5KFAA 2VDIA 3FEYB 3VA3A 3I56S 3WQUA 3A0IX 1IWAA 3I87A 5LJ5Y 3CJ4A 1NK0A 2H9ZA 3J7AP 2Q0RA 1WSVA 2Y0SD 1JJ2M 3LP1B 3QAEA 1I51B 1F5AA 2AJ4A 2BJ3A 4YDUA 3DLKA 4I6MA 3DLLL 1MWYA 3IXQA 2VICA 3IAYA 3Q7CA 3ID6A 5LL6Z 3ITHB 3OUYA 2F4FA 2YWHA 2CKWA 5GAHP 4ZPVR 3ZZ0A 1GX5A 2RT3A 2E1YA 3V1RA 4K4XA 1XMBA 1V3SA 2X1FA 5IM0B 3ATVA 3TSPA 4CHOA 4CH1A 3LDLA 2JZ5A 1T02A 1ZBIA 2IHR1 1RXOB 4M5DB 2OKQA 3OL8A 3EM1A 2XWYA 1U1NA 2FVPA 2YKMA 1H2TZ 2GW8A 3UFCX 2V2KA 3WBZA 4GKJJ 2E2PA 3MN7A 4JKHA 3LDPA 5CE3A 2O3DA 2PI5A 2YKOA 4BRHA 3HZGA 4KIAA 4LMZA 4OI3A 3CGIA 3EE9A 3B8HA 2OEMA 5K20B 2R7UA 4ZVRB 3TUIC 3M8RA 4O3SA 2IAJB 1TL1A 1HNZK 3I9ZA 4DL2A 2W9BA 5KG1A 2VFSA 1R6VA 2VF3A 7AT1B 2CQ1A 3THYA 5BRDA 4XO0A 2CQDA 4Y0WA 5EHHA 4FS1A 4KKOB 2MJUA 4ECVA 3V6JA 4ISFA 1HNXF 2WONB 1U2CA 1NKCA 3BN7A 2APOA 3VV2B 2E7WA 3H0PA 3KHHA 1RAIB 3QIPA 2GVDA 3NXZA 2AYMA 1CZ9A 2HFSA 4WQ4A 2KM8B 3KJVB 3AA2A 1YIJN 2MGZA 3NS7B 3CJ7A 1RWNB 3T1YF 4DV4K 5JMNA 4NLOA 3VPZA 1ATNA 4LSLB 1RTHB 2QE5A 4YOEA 5KPRA 1NK6A 5FDLA 4DR2K 4KH6A 1VSMA 4HT5A 2VV5A 3FMBA 2XMUA 3DMJB 5KFLA 1RBSA 4L75A 3A3NB 3M32A 5C0YA 4NXNK 2WC9A 3OVSA 1IBKF 3P5JA 4WCEQ 3OYNA 3TZWA 2OA8A 3UW1A 4BC4A 4R25A 1R8HA 4A2AA 1ZBSA 1RABB 3KJQB 1MWKA 4Z4FA 3CJ1A 3IFEA 2QA4S 1WN7A 4C8MA 4U9RA 3ENAA 1AROP 4ZVQB 3CXCR 3GYXB 4DV7F 4FWNA 1N33K 5LMNK 4BR5A 2KI2A 3PSFA 2G4BA 4FYWB 4U96A 1EQMA 3WHIA 2ZFHA 2M9KA 4M3TA 2DISA 4C3MA 3AGKA 4DR3K 2KG0A 4CFBA 1CZAN 3Q2TC 3DLJA 1SJQA 1JLAA 1YF5L 1D1UA 3TEHB 1IKWB 1TUUA 2HEKA 4ZITA 1X4CA 1MNEA 4YN3B 3OYAA 2CPIA 4W5OA 4AHRA 4JI6F 2D41A 5LMUK 3FZLA 1RWVB 3R9LA 3CC2S 3OLBA 3OHAA 2IYIA 3PKYA 5CAAA 2XB2D 3QPIA 1QAYA 1YQHA 3MMBB 1S6PB 2HSEB 4BE2A 3QICA 3K59A 3SZ2A 2MKSA 3AY9A 4OZ2A 2X7IA 3E2EA 1DFDA 4KB0A 3K0JA 2BJ1A 2GCFA 4FWRA 1JKHA 4CZIA 4AHUA 4UOFA 5ETQA 1QE1A 1HNVA 2W41A 3KK7A 4RW6B 1RKIA 2KZMA 3T3FA 4PL8A 3C16B 2FJEB 3KHYA 4JEPA 1WDTA 4BRNA 3GJRB 3TNVA 3Q8PB 2QYCA 2A5XA 4MDAA 2BABA 5L9XA 3BF3A 3R6MA 2D0AA 5GAGU 1ASUA 4DPXA 5IWAF 2DHAA 4CJ3A 2RRAA 3OPKA 3SCJE 4X4OA 5KFNA 4QCLA 4YHHK 1UPPA 4WE1A 3EGWB 4AH9A 4ID5B 4V19S 1EQ0A 4LBHA 3TX8A 1Q4RA 1UEVA 3MI7X 4CBXA 4E7HA 4JI3F 1HIYA 1ZTWA 5KFGA 2F8TA 4W4MA 2VU5A 2CQIA 2GA7A 2P5OA 1BQXA 4NO7A 2ZVIA 3ZT1A 2H5IB 3LP1A 2J9CA 2QFJA 2DEIA 3D1OA 3BZQA 4USJC 2QN6B 1LOTB 3VZHA 1T9TA 3UR0A 1C0UB 3CMEN 2DPIA 1IG8A 4N8NA 3PG9A 4Y2AA 4F67A 2UXBJ 3ITHA 4CESA 3C6UB 2I1RA 3J80Y 1WJ9A 3D3BJ 1HD1A 5LXYA 2FC8A 2M0GB 1JB0C 3VEWA 5IM0A 2ROPA 3ID8A 3RMDA 4M5DA 1X3NA 2OD4A 4PG4A 2A10A 4EI2A 3C14B 2QYGA 4DTUA 2YX4A 3QEPA 1HI0P 4Z7YA 2QSWA 1MLAA 2CAJA 4X65K 3EY1A 4LFCK 3O6WA 2QL7B 4LRAA 2VJUA 5AQMA 1RHUB 1GFWB 2IAJA 1F1BB 2WZ1A 4JS5A 4H03B 3KD5E 3QRQA 3NF9A 2YHYA 1YSJA 2UUAJ 2ZBIA 4WFBQ 5IS2A 3HHLC 4MK9A 3LDOA 2KFYA 4KKOA 3HD2A 2WONA 4DR4K 1U8WA 3D54A 4OX9K 2XLKA 5HVHA 3P8BB 4E1JA 2CPYA 5E3QA 2C2NA 3AO2A 5EOYA 4O0JA 3PW5A 4OI4A 3KJVA 3CJTA 4LVNP 2I8EA 1C0MA 2CFXA 3MAHA 3KKRA 2H51B 4DV3K 1LWFB 4B8AB 3GFXA 2QL5B 1RTHA 3KFWX 2E1MC 4B9MA 1U0HB 4XAKA 1EWQA 1FEHA 1J5OB 2DH9A 1U26A 3DMJA 1WEYA 2HVZA 2DNZA 4MMOA 1VJWA 4ZPWR 4C97A 5IT4A 1Q82O 2R7VA 5D3GB 4HDGA 4MKVA 1VSEA 1VQKN 5A8KB 4ED7A 1NDPA 1Q79A 3UD3P 2F40A 3K9JA 1AA1B 1U2VB 1LCUA 5DM7Q 1UA0A 1A0OB 3MAAB 1YRUA 4OYOA 3F41A 2E1RA 4PQUB 4B3RF 2BJ7A 4DZ6A 1A5WA 1CS4B 3MPUB 3OTCA 3SQ4A 3N5BA 1NK7A 3ZSRA 2JLEA 2CYYA 3VR1A 4C23A 2LU2A 5KGXA 4AILC 1REGX 1JNRB 3TOQA 3QINA 4BDPA 4CLSA 2DNYA 4FZVA 2YNIB 2EG2A 4KHMA 4M8LA 2HQFA 1U7LA 5DGAA 4JI2K 2EK1A 2WOMB 3RAXA 4FF4A 3S3NA 1N34F 3UCZP 4OPHA 3CE8A 1CXUA 1SXLA 1VQOS 4FWPA 5GAHI 3HM8A 1BG3A 2CJAA 2RS2A 4ILHA 1IKWA 1E4GT 5E3RA 4DLGA 3CC7S 1XI1A 4C0BA 1YBUA 5KFZA 5D0EA 2XO7A 2YWWA 3NMAA 3LPEA 3CCRS 3D9BA 3W1YC 2LQ9A 3N28A 4WZQA 1VAZA 3TWZA 3CJ3A 4OJHA 2ZH6A 4DU7A 3DYAA 4JI1J 3KIOA 3W62A 1LW2B 2NSBA 1AUSL 4JP8A 3MMBA 1S57A 1S6PA 3FBEA 3U1NA 2F4VF 1T9XA 3LDSA 2V8GA 3NF8A 1QVFR 3EDRB 4CIGA 1DTTB 2HURA 4L6V3 2JWNA 5HJXA 4ZVEA 2E29A 4LF9F 4RW6A 1XQIA 3I82A 5BYSA 4BS2A 4ZLPA 5ADXA 1HX1A 4NMLA 1C4AA 3C16A 2E1PA 3S6EA 5B0FA 3CD7A 4IUFA 1WC6A 3AA9A 3BO4A 2CADA 4TN2A 2UYTA 1S0NA 3K5LA 4QAGA 1HR0F 3LP3A 3MMCB 1PYTA 1YKWA 2GGPB 1QTNB 2ZC3A 1XNQJ 4ID5A 3AO1A 4RBUA 4RW9B 4I68A 2QXFA 4OQJA 3J7Z5 3LQVA 1U25A 3GPAA 1VSJA 4AHVA 2ZH2A 4ZLJA 2W8LA 1CXQA 3GIMA 1NJIO 3C15B 3J7A1 1YJUA 2C28A 1XR5A 3PY8A 4IKFA 4DR1K 1TKDA 3AJDA 3CCMN 3RBXA 2FVRA 3QEXA 2IS3A 3KUEA 2R7YA 2IVFB 3OXLA 2LLZA 3HO1A 3GV5B 3JTNA 4RX6A 1DHMA 4C8OA 1C0UA 4R8UB 3MR3A 1ZM2A 1MSWD 3T1HK 3N9UC 2DGSA 3MM9B 5CZVA 5HN0A 2W9AA 3C6UA 2E5LK 3HMJG 4PXDA 2GEMA 3RU0A 4DEZA 4JYAF 3FE1A 4NYFA 2F8SA 3CULA 4A8QA 3X3UA 2HIQA 3N01A 4BGAA 4CO3A 3VENA 4LT6A 4PQAA 2C2KB 3V6KA 1YHQS 4ZMMA 2Q31A 1A7GE 1W7AA 3C14A 2XCAA 5I3PA 3OS1A 5HP1B 2ZH9A 1U02A 4B08A 1QS4A 1B0VA 3U02A 1WBBA 5CCMA 4X4QA 3DU6A 4LIRA 4CCHA 3NGKA 1VBZA 2DPJA 2D74B 3BR9A 3CCTA 4CO4A 1HMVB 2A40A 3H7HB 4MDBA 2Q6CA 4DQ8A 3ZT2A 5DDQC 2VBWA 3MR2A 3K0SA 4OKJA 3GL1A 1JJCB 3MN5A 5EVZA 2G8IA 3SAHA 4B9TA 3UDCA 2BUNA 1N88A 3LH2S 3G8TA 2MLZA 5KFRA 2RAQA 3M6VA 4UTGA 1NLKL 1WB9A 4ILLA 1SKRA 3ZSVA 2GQCA 2MZTA 3MM6B 5F3TA 4QU6A 3PX6A 1JLBB 3TR8A 1Q1KA 3G87A 4DTPA 1LWFA 2QG9B 1NOYA 3PYEA 5J1NA 5CD4H 2K1RB 3VTIA 5C10A 3MDQA 3NHGA 2YHBA 4Q2MA 4Y3CA 3MEDB 1U0HA 1J5OA 5F3ZA 2NRVA 3FZHA 3RMCA 1VQ4N 5KFOA 3SQ2A 1RTIB 2E2OA 2GV9A 5FPNA 5D3GA 3CDBA 5KG7A 3DGVA 2QFIA 3ILOA 5A8KA 2P9PB 1U2VA 2LQJA 3C7NB 4P2MA 4ZK7M 2PYJA 1S1VB 3MOZA 1MROB 3MAAA 1C1AA 4MFBB 5HRSA 2OMLA 2UU9F 3UIQA 4KTZA 4PQUA 4QIEA 3IAM9 1HW8A 4U8YA 4DL5A 1CS4A 4A4JA 3WIUA 1FJEB 1C0GA 3L4IA 3G9CA 3G71N 3QAUA 4C0HA 3HHNB 3AOAA 1N36K 1DZ5A 3QFHA 2XWXA 3QNOA 3D0GE 1M5SA 4FPIA 1L5UA 2R7WA 3DN9A 1VGYA 2YNIA 4DUYK 1F3FA 2WOMA 4FWQA 4JHDB 2G8UA 2RRNA 2A6AA 5DO2A 3NP5A 4OI1A 1K73T 4Z4GA 1YITS 1KLMB 3VQCA 1GXLA 4KY3A 4QWCA 3MWPA 3W63A 4M63C 4O3NA 4ILGB 3OTOK 4W5NA 3QSIA 1O13A 2ZBRA 4DV6F 3EVOA 4TU8A 1BWVA 4FLWA 4H0XB 2VFTA 3LZJA 4UF4A 1WNSA 4IH6A 1NDLA 2Y1LB 4LF5F 1LAVA 2L3MA 1S0VA 1HNWF 1TKXB 3ASMA 1Q8BA 4JI7K 1WI6A 3RB6A 1OS5A 4Y6IA 1R6YA 2AF6A 1LW2A 4ED8A 3AXKA 3NF6A 1NZ8A 2YQ0A 3TAFA 4CEDA 3C8YA 4LJMA 2RVJA 2XMMA 4F2RA 1AZSB 5D8HB 3N0VA 5CYJA 4NX9A 5D0GA 2AJ1A 1UVMA 2X3GA 1T05B 2ZVSA 5FJ4A 1DTTA 3H2UB 4NB4A 2YHXA 4G65A 4J5OA 2ASMA 3OLAA 1MWMA 3NCQA 3OL6A 1P27B 1FX2A 1MW7A 5J1EB 4EO6A 4YUDA 4I9QA 3A8JA 3EJMA 2YTCA 4DOZA 4JKBA 3NGDA 3MR7A 4WYLA 1RLCL 1HI1A 3O1LA 3G82B 3TA1A 3MMCA 2HHPA 3FCVA 2GGPA 5H9EK 2W2OP 3MGJA 1VDHA 1NEEA 1HBNB 5EX5A 1VBXA 3Q86A 5F9NA 2HS0A 4CH0S 3WXLA 2HB5A 2Z30B 5IQ6A 4K25A 4RW9A 4O3OA 3QYYA 2J9EA 1ZC6A 4CJ4A 4K8ZA 3GCWP 1YJRA 3P83D 2NXCA 4JS4A 3C15A 2KXHA 1BA0A 1EP4B 3UCUP 3NGYA 4LBPA 3HSCA 4TSXA 1FNMA 3KKFA 3M1FA 1FJ7A 4JUZA 4H4MB 2WVDA 3SCIE 1KTQA 1W25A 1ZOTA 4NLTA 3I0RB 3VAIA 4R8UA 1DBDA 1G7CB 2I38A 1Y00A 1ESVA 3MM9A 2NUHA 4EEYA 1YRXA 2JH3A 3FMWA 4YOVA 1XMQJ 4E2FB 1RT1B 3DRXA 4O3QA 3M2VB 1IQTA 2HHVA 4XK8C 1NO8A 1NSKL 4B02A 1T9WA 1XHZA 2DXFA 4PG8A 2XS5A 2I5JB 3CJ5A 2V9KA 2FGCA 3O2IA 1VI7A 3CSKA 4ZLLA 4LF8K 3CJ8A 4KHPF 3P3DA 5KG5A 1KFSA 1KVJA 2R3VA 4P10A 4CZGA 3PJWA 5LXRA 5HP1A 2F63A 1HWUA 4FN5A 4WFZA 1HKGA 4DL7A 4V19J 1BDGA 2EXUA 4EGLA 2N7YA 4CK3A 1HWIA 2LMIA 3O3FA 3MM5B 1TUWA 3QMQA 1UFWA 4U7UD 5JS2A 2Q97A 1YJWN 1OPZA 2BJEA 2RU3A 2FBYA 1HMVA 3MEGB 4B1WB 2P9NB 2OLWA 2W1BA 3SLCA 3TZZA 1NU4A 2DNRA 3GJSB 1NJZA 5HBMB 3DLEB 4DUZJ 1IBLF 4W92B 5FLXU 5KT7A 2HVIA 2VPWB 3AH6A 3B6PA 3UQSA 3VETA 3BQ1A 1OYEA 2XGQA 5GAGI 4DV0K 2MPUA 5I4MA 5KT6A 4W5TA 4BWJA 5C7PA 3R1XA 3OJUA 2DR8A 1YJ9N 3I5AA 3OW2M 2WTUA 5LT5A 5H9FK 1Q81T 4QU7A 2G8VA 3IRXB 3O6QA 1NGIA 1XQSC 1XMOK 4ZIWA 5ETOA 1ASVA 2XY5A 4DV5J 4B3TF 2B8QA 3EMTA 3MM6A 2Z2LA 1JLBA 3C0BA 4LD0A 4FNIA 1VQMN 4P71A 4K4YA 1T9VA 2ATCB 2K1RA 2MXYA 1PILA 1U47A 4BE1A 4JI5J 2ZH3A 1K0VA 3SIPB 1QHAA 3J7YI 3MEDA 4F3QA 3LAMA 3A1YG 2UUCF 3Q83A 4OI6A 2UV8G 1RTIA 4MJKA 4AE5A 2R8IA 3LP0B 3HF5A 3NOCA 3NNCA 4CDIA 5B08A 4K4TA 3JSMB 4NLQA 2P9PA 2W40A 1A5VA 2LYVA 4LF7F 3C7NA 2H54B 1S1VA 3QGGA 1MROA 2ZM6K 5A2QO 4ZJOA 4MFBA 3FSYA 3MUVP 1JCFA 4QS7A 3UN2A 2HQIA 3P4UB 2OIHA 1NKBA 3ENHA 2HG4A 3H8YA 1JLGB 1YTUA 3BR8A 2DIUA 4NLWA 4AQYJ 2D3OR 2HNDB 2OSQA 2ZKTA 4ZDNA 3MCMA 3AJ1A 4CJTA 4ZN3A 2BE2B 3AODA 4FXDA 1LWCB 2V0NA 1Q16B 4JHDA 4X62K 2RUGA 3RJMB 2J7UA 1RKJA 4DJBA 3CJRA 1OH6A 2OCEA 1KLMA 2VA2A 4ZCMA 2AMCB 1NPRA 5C2CA 3OYHA 4F4ZA 4NXMF 3A8EA 2VQFK 3J81Y 5E0OA 2FSJA 2OGUA 2E5JA 2K3KA 1OY6A 1CSJA 3FKBA 2HRTA 2HYIB 1GOCA 5C2FA 5DDRC 3B78A 2PYLA 1TKXA 3HOTA 3W9IA 2Z4PA 1N8RT 3CCEN 2G0JA 4RTFD 2XY8A 3DDIA 1UVIA 4TLQA 1I1GA 3GSDA 3W3SA 1RGIA 2AWZA 3CCSS 5M2RA 2CPZA 2VPZB 3EWGA 3RAQA 1E6YB 1AZSA 4OIXA 1MMDA 4ZVOB 2YV0X 1T05A 4DCPB 1TVRB 4BRLA 4HUFA 4WZMA 1EKEA 3WXIA 4DXLA 4DR5K 4MAKA 2QKKA 1TQLA 5J1EA 4ZVGA 4Y34A 3SSSA 3UKRB 4MO5A 1EETB 2W42A 3PR5B 1LK5A 1BWEA 3K5PA 3D67A 4RKUC 5DRKA 3HHDA 3G82A 3MCPA 1RDWX 3LPYA 1BHNA 4DV1J 2CRLA 1HQUB 2GO9A 2UVRA 4OPAA 2R2TA 1HBNA 2I2YA 4QYZK 3G6EN 1SKSA 3A4TA 1HBUB 4QR0A 2CVIA 4CE9A 3S8SA 2A41A 1DQAA 1WHVA 4JI4J 4PXBA 2VG5B 3ZCMA 1EP4A 2GQ2A 2KH9A 3M6GA 1HL6A 4G3IA 3VQEA 1BO5O 1QSLA 4CP5A 4ED4A 5BRHA 4H4MA 4ER8A 4CBWA 5HMZA 1B64A 1RBOB 5KOWA 3VQ4A 3I0RA 4IQMA 2KJWA 1FX4A 1N48A 2NREA 1PYSB 2NQPA 4DV2K 3Q8YA 1JK9B 2UXCK 2A42A 2KZZA 4CGGA 1ZAXA 2VPXB 1RT1A 4C8NA 1HWKA 1MWQA 3M2VA 4KPYA 2ADBA 2G0CA 2OI2A 2HAIA 1PJ6A 2WUSA 2M4MA 5CHIA 2W4PA 1GMVA 2I5JA 3TSUA 1Q18A 4FNHA 1VQ6S 1TTHB 3E01B 3HCXA 2ZOGA 2J6TA 4ZCLA 2MQQA 3CTRA 1O6XA 4NLSA 4DS5A 1N54B 4ZA1A 3G4SS 4KHNA 3BH7B 5I9EB 5C12A 1H3DA 4PKDB 1NH7A 3MM5A 2CQPA 4EBDA 1M0SA 4GVMA 4ZP7A 1T6CA 1YXQA 4JN4A 3L4QA 3MEGA 2P9NA 4DV1F 1VQNN 2OSRA 3PNIA 4QOTA 2GBZA 1S6UA 4OYZA 2AP1A 5HBMA 3H3OB 1KVKA 2F5GA 3DLEA 3AARA 4DQRA 4ES2A 2HBLA 1RHJB 1U8SA 1N33F 4DR7F 5CZ2A 3TTDA 2DNPA 4L3QA 1FRJA 1RCXB 2F8MA 4GVLA 1D9AA 1WSGA 3J7AN 1S5JA 4DR3F 1RDCA 3GDQA 2OTJN 4CF1A 3IRXA 4KH5A 4QJVA 1VSIA 4IO1A 2C3UA 3OJSA 4PG5A 4IFEA 4DTJA 3HT3A 3O4NA 3MZIA 2EFPA 4LFBJ 4ENOA 5C15A 3W60A 1JQGA 2KT2A 3CCWA 3C65A 4P75A 4CZHA 2GWKA 2RU9A 4P2FA 3LP0A 4X66K 3H2LA 5F8LA 4GKKK 2BJ8A 1CG2A 4J9MA 4A8KA 3JSMA 3VAKA 1RADB 4RCHA 4NI2B 5HVFA 2ZKUA 3EPGA 2BJDA 4ZP8A 1BU6O 1GLAG 1APSA 3ZT4A 2ALZA 3QATA 3MR6A 1XNRJ 1Y5NB 1JLGA 4QS8A 3EGVA 1WOSA 3AAWB 2HNDA 3V4MA 1XR6A 3D1HA 4C3LA 4FO0A 3EXCX 2DHGA 1H73A 3VESA 1X60A 1UVLA 2BQ3A 2BE2A 3CCLN 1ILYA 2NRXA 1LWCA 4OPJA 4OL8A 2CJKA 3OYEA 1G6BA 3IG1B 2AX0A 2RIJA 3D68A 2EC0A 1RU1A 1W0HA 4YHHF 3PRVA 4JBCA 4FBTA 2YXLA 3FCWA 4G1IA 4EHTA 2DXEA 4IOAQ 4HACB 2KXFA 4IOCQ 4PKIA 3QGPA 3DCAA 4WK1A 1RAAB 3TTFA 1WEXA 5AJ3K 3GV8B 3DGPB 4PZVA 1WOOA 3TARA 2MB0B 3B82A 4CLFA 4NE9C 1LFPA 4S0MA 1WOQA 1TU0B 4OHWA 1U6FA 2BRKA 1H7XA 2HQ3A 4GMJB 1GXTA 1OWXA 2Z2YB 3RBEA 3T1YK 3Q8VA 4NLCA 1K6YA 1WSEA 1ZAWA 1WUUA 4KBOA 3UD5A 1E6YA 3KJFB 4UY85 2R7RA 3NAIA 3SMPA 1TVRA 1FDBA 4CK2A 2LFVA 4GMKA 1CLQA 5ELZA 2VONA 2GIRA 4FWOA 3QFUA 4H5WA 5T7LB 3VQ9A 3DC2A 3UKRA 1EETA 2A2DA 2AP6A 4HI1A 3GLJA 1BMQB 3VOVA 3WX8A 2DFEA 2F3JA 2NUUG 5KFVA 4J37A 4ZP9A 5FROA 4WU3A 1HQUA 4YQWA 4H5VA 5LJVA 2O8CB 4ZVHA 3OFEA 4OI0A 3QQCD 2HBZB 1BWFO 2AJ0A 1LQ9A 2MZSA 3CPWM 1HBUA 2BZ2A 3CJ0A 2CPXA 4OKEA 1F2HA 2JX2A 2VG5A 4Y2MA 3MN6A 2Z1IA 4GW6A 2IRXA 1T0TV 3TYTA 1PAUB 2W25A 4OX9F 2I0XA 3WIVA 2MMYA 4BVPA 4TY8B 1XUPO 4YMEA 3CIZA 1N5SA 2FBVA 3AVAA 4I7FB 4IDHA 3DLRA 4FVCA 4ZPDA 4JI6K 5D4OA 5KQDA 3JSBA 5FIIA 1FXDA 2WB1D 1RBAA 4DV3F 1KQGB 4R79A 1FERA 2D1CA 4Q5VA 1SIZA 3I55N 2HHTA 3LGHA 4UY8O 2JRSA 2VFUA 1X9SA 2BOAA 2HHHJ 5F8IA 2RQKA 3L0QA 4M5MA 3IGVA 3SQ0A 2PT0A 2ZOMA 2XULA 3BQ0A 4H54A 1BLUA 3MPVA 4WIQA 2OO4A 4K41A 4CEBA 3E01A 2W7PA 2X1BA 1RA6A 4KTQA 1CLFA 2YKNB 2HVEA 2ZDOA 4W5QA 1FRLA 1SQEA 3KLEB 2G9OA 2IVOA 4LR7A 3M6WA 1M1GA 3DOMB 3HSDA 4IEIA 2I7PA 3IS9B 3WNHA 2DGWA 2CQ2A 2HBYB 5IC6B 3MEKA 3PFOA 4F50A 5IWAK 4U95A 3CFRA 1OO0B 3L9ZA 3CCQN 3M5RA 4ZJLA 2WBRA 5KT2A 1NMDA 3PJ9A 1IKXB 4JI2F 3D4JA 4HH0A 4KV8B 3DRPB 2R9LA 2K3IA 2FD2A 2F9DA 4ED5A 3NG8A 3HHEA 3WDOA 1PYOB 4WQ5A 2CQ0A 5CCLA 3QJPA 2W2NP 2GHWA 4JI3K 2WVCA 5EDWA 2H1YA 3PACA 4BDZA 1CULB 4TNOA 1WNEA 3BGLA 4DQQA 3ZTRA 4XPEA 1N32F 1I3OB 3IFRA 1NNEA 5K14B 3HZ6A 4JI0J 4EFAC 4CLTA 4LF4J 2QWLA 2DNKA 3VF2A 4J9NA 5IT9Y 4ZN1A 4HI2A 1J5EJ 5GMEA 3PRBA 2IJRA 4U7UK 4A59A 1SKWA 4DB3A 5L1LA 3R5JB 3THWB 4NI2A 3W0LA 1WG5A 4HDHA 3NMUA 2BKOA 4RLEA 4IFVB 1IQZA 4J91A 3VMFB 3F9MA 1T8EA 3AHPA 1KEKA 4IO9Q 2HGMA 3SJHA 3BP8A 4Y2CA 2JEJA 2EW9A 4CF9A 3IG1A 1ATRA 4KB1A 3EEQA 1BOTO 2AGPA 3DJCA 3O3HA 5F8HA 3ZZZA 3AVJA 3O9SA 2MJNA 2BR0A 1FTRA 1TR0A 3CCVS 5KPTA 4HACA 2P9IB 1K9MO 4RW4B 2XO6A 3OSPA 3DGPA 1VQLS 1JCEA 2CPFA 4GRSA 2UXDJ 4LUBA 5HQMA 2MKJA 1CC7A 3HSZA 5JICA 4QQBA 3UDLA 1KQSM 2HBQB 3MXHP 3UCGA 1NG9A 2CPEA 3VZIA 2MZJA 3N6NA 4H5NA 2XS7A 3I8BA 1KD1T 5HRPA 2IJFA 4TLRA 4X4NA 3LPTA 3CQXA 3SI6A 4MT1A 5KFXA 3T1HF 3EVMA 2CIMA 3R1LA 3FBFA 4ZP6A 5EWFA 4FM2A 2DHXA 3ZETB 1KCFA 5D4PA 2DY1A 2BBEA 2MKHA 1IO2A 1EHWA 2RE1A 4FDFA 2H5EA 5CYMB 1W2IA 3LPUA 1IXKA 5T7LA 2Q2RA 1TP7A 5CR4A 3UDEA 2RUSA 2VB6A 4OLPA 4A8XA 3K58A 1URNA 4AYBD 1P6TA 1X5OA 4HUEA 3GP9A 4M95A 2HFUA 4RPFA 3RRGA 4CJQA 3QRRA 3O9UA 2V7ZA 1DLOB 1U48A 5E2QA 5F2RA 2EK6A 2GC8A 1NK5A 4CLPA 3M30B 1BI4B 2D4WA 5IV3A 4CK1A 2O8CA 2XSJB 3CCUN 3IM8A 4ELUA 4I6AA 4CM2A 2LEPA 5HVGA 2XNQA 3EXYA 3DXMB 4DTNA 1SC1B 3VEYA 3VQSA 1T9UA 2GELA 2F65A 3RMBA 5I3QA 3I56N 4LR9A 3EO3A 1E6VB 2J9DE 4NA2A 5M1PA 1S4FA 3BS9A 4DTMA 3NKYA 2ZGZA 5C2GA 3MECB 2AGOA 3V2UC 2N3OA 1AXQA 4HR2A 2J8AA 4TY8A 3DKDA 4IBNA 2CWKA 3VGMA 4I7FA 1Y3JA 2VJVA 1NGJA 1OYDA 2XYHB 2MZ1A 1AUDA 4OPKA 1DQ9A 3KYLA 3MUTP 1W9HA 2KRRA 2YH0A 3OXGA 3I31A 4I6YA 3RBDA 3MOJB 5DK5A 3AB4B 3ZSQA 4FPRA 1FI4A 2K06A 2OPRB 3EKSA 1MMNA 4YB1P 2JC1A 3RYLA 5GMDA 3DLGB 2F4VK 3I96A 1WF1A 3MDFA 4DS4A 1UJ6A 2YKNA 2FHJD 4LF9K 2PE8A 3O4WA 3NE6A 2HGLA 1R7IA 3MX2A 4KHWA 2NRRA 1S9GB 3KLEA 2EBGA 2F9TA 4E98A 3TJ8A 2XZDB 1UETA 1FCAA 4KH1B 2AYGA 1IR2A 3DOMA 3FGUA 2BJ9A 2IM1A 1S1UB 5GMKa 1VRTB 3IS9A 1K8KB 1T6DA 5DG8A 3PHEA 3NH1A 4KHQA 1ZA1B 4WFAQ 1HKCA 1ZBTA 2BKNA 7FDRA 4MKYA 1IKXA 4DUYF 4KV8A 3DRPA 1NJWA 4BR0A 1CJTB 1WOPA 4PWDB 3I32A 4FLTA 4ZHRB 2HBKA 2C42A 1GH8A 2ASJA 5C25B 4C7QA 4N7TA 2ZH1A 2DH8A 2RNEA 1XC3A 3OTOF 4DMNA 3F5TA 4LF6J 1B3TA 2FJXA 2MQNA 4MYTA 4JI8J 1CULA 1HI8A 3KHLA 4F0KA 1X8DA 3C19A 3QGIA 1PO6A 4OX6A 1SKUB 3KMSA 2U1AA 2XS2A 1OPIA 5K14A 3VQTA 2NZ4A 3RR8A 2HBRB 5D77A 2FLPA 1ULRA 5ETLA 2HGNA 1QTMA 2O4GA 1LOUA 2P9EA 2ZZTA 2V67A 4BRAA 2AX1A 3I9V9 4JI1K 1V4TA 2EG1A 2QJ3A 3DRYA 1U2FA 3MMAB 3AA8A 3RBZA 3THWA 3WXMB 3O1BA 3OS0A 1WC1A 9ATCB 4FVMA 4DF8A 3ICLA 2XHBA 4CI6A 3JAMU 4JYAK 3HHLB 1RUSA 3BGFA 1SS6A 2GS8A 4OJ1A 4IFVA 3NWRA 4A8MP 2P5GA 1EXQA 2FLOA 4JV0A 2QA4N 3NAEA 4ECZA 5ADZA 3CUNA 4J2EA 2J76E 2RN2A 3OBIA 5JVHQ 3O3LA 4Q2LA 1ATSA 3NRBA 1EO1A 1K1QA 3RRHA 3OYKA 2COLA 3R6GB 3W2WB 4WKYA 4DFJA 2DCUB 2QA2A 2WSCC 5AQVA 3TA2A 2Q36A 4G6VB 1SIWB 3LANA 4CNZA 1XNQK 3EZUA 1KC8O 4J9UE 2P9IA 4KO0B 4DU1A 3SSQA 2QWMA 3PLAA 4DSLA 4RW4A 1FJGF 5HRRA 4USVA 1Y10A 4BVOA 3RB4A 1EKSA 1GNKA 2QMUB 4PWWA 1UTAA 3A3PB 4F4WA 3CC2N 2WVBA 1YDLA 4FWSA 4LH4A 1Y4ZB 2EFVA 3D2FB 4KTWA 1CQMA 1VK0A 1UP1A 2JLFA 4USIA 2C2RA 4H4KC 4H5RA 1M5OC 1I39A 1WSHA 4KHSA 2IYGA 3DHXA 3ZTQA 1HNZJ 3ZETA 1WTFA 2O67A 4LSNB 4LFAF 1AFJA 3CO0P 2KVIA 2XNRA 2SXLA 1ASWA 5CYMA 2JFKA 4G1QB 1R59O 2IGIA 4HHTA 3TP2A 2ZC4A 2R7XA 3D6HB 4KGMA 3O5TB 1ZM4A 2UU9K 1SUQB 2PSZA 5AQWA 1VK8A 4KYZA 3CFPA 3W3DA 4FYXB 1S6OA 1P8ZA 1DLOA 3BGRB 3M30A 2DNOA 1BI4A 4DV4J 2XSJA 1VFJA 9RUBA 1UAWA 4DR2J 3CF5Q 2E8AA 3DXMA 3G8QA 3VF6A 4ID1A 3L4BC 2LDYA 3CJKB 1M1KO 4FJNA 4CLLA 2BW2A 1MDUB 1RI7A 1E6VA 4NXNJ 5KG4A 2Q0UA 3V4IB 3ZO7A 1SL1A 3MECA 1H74A 1RDRA 2BRLA 4FW2A 3TUPA 2WW8A 3TWHA 3E9OA 3PKMA 1UZHA 2HQCA 3EYZA 3QEWA 4R5PB 1XMOF 5CYQB 1KQKA 1WUAA 1WSIA 1RBLA 5KT4A 4BRIA 4FYVB 1HNWK 2EVZA 3FJ2A 2HZAA 4DPTA 3R2CJ 2GWJA 2OPRA 1T9YA 2V94A 4M3XA 1OMSA 5LMNJ 4NEYA 1O1WA 4UOHA 3L09A 4WYWA 3DLGA 5HK4A 1RFQA 3GMGA 5C2DA 3SCLE 3L3VA 3HM9A 3GILA 3V5RA 3K8WA 4WYBA 1UZDA 4WFXA 5F0WA 1LKZA 1WWHA 1IV0A 2KHCA 1S9GA 3S41A 3VQQA 3F2KA 3N6LA 1S97A 4J9PA 1S1UA 5LMUJ 1Y11A 1VRTA 3BGUA 4I6WA 3D0HE 1K8KA 1D0EA 1VSFA 3WZ0A 2ITGA 2CQ4A 1X5TA 1BD6A 1NMNA 4FSVA 1Q86O 4CEQA 1S77D 1WELA 1JL1A 2O8EB 2KRBA 1U04A 4KT0C 4FXWA 2GVZB 4DPYA 5TKYA 2EFOA 3SMSA 1WG1A 4X62F 4N77A 2BDPA 1CJTA 4PWDA 4BRKA 3HSTB 2AV5A 1DT9A 2V68A 4ZHRA 4ED2A 4YOTA 1L3VA 5SZTA 5C25A 5K8NA 2D0BA 2FBXA 3DXBA 4C8KA 2Y3YA 2MHNA 4DI6A 4ERDA 2ZH8A 4ZPAA 4F7VA 3EDQB 2FZKB 4EU0A 1WORA 4FKYA 1X0FA 3UE5A 2HK2A 2B43A 3OSNA 3WNEA 5MLCQ 2IIHA 2A3ZA 5FRMA 3A5OC 3SDEB 4CEAA 1QSSA 3AB2B 2NPFA 1QM9A 3MMAA 3NOGA 2A1BA 3DOLB 2PN6A 5L8RC 4BRQA 4MIWA 4O3PA 3CERA 3L95X 4M41A 1VSHA 1Y0HA 2HKEA 3IRWP 3HHLA 4ED1A 3R6LB 3WC0A 4UOCA 5IXUA 3QT6A 1IM4A 4NLVA 1KVAA 1SQFA 2ILYA 2B9EA 1NGHA 1K1SA 1JIHA 4F0MA 3RTVA 5JVGL 5KFWA 1NPPA 1PBAA 1SQGA 3T5LA 2W2QP 3W2WA 3SMZA 4J90A 1VQON 2VIHA 4ECQA 4WJBA 1B4SA 1IBLK 4IR1A 4HVZA 3VEXA 4OJRA 2QW9A 2GHVC 1AB8A 4O8UA 4KO0A 2DO4A 3CC7N 1FD8A 3NMRA 3QGHA 3WEEB 1FTCA 1OQ3A 1NBEB 3CCRN 3THTA 2LKZA 2Z56B 5KFUA 4EZ9A 1SI9A 5GADU 1DURA 3HPHA 3JXOA 4IXCA 4DX8H 3D2FA 2EBEA 3BSOA 4GC6A 4WF9L 4NOHA 3EZOA 1S1TB 8AT1B 2DR9A 3A5LC 4KGXB 3K5NA 4WP8A 2WCXA 3D6TB 4B3SF 1WAJA 5F41A 4X4VA 3VF0B 1SJ4P 2YQ1A 2EHGA 2H4YB 1VRUB 3PXGa 3ZYYX 2AJQA 1ZH5A 3KWIA 4LSNA 1YT3A 4PR6A 1XMQK 3OYDA 1G15A 4Q7AA 2V63A 3M9OB 4DR4J 1Q7YT 3DU5A 5KOXA 1TAUA 4G1QA 1REVB 2VFVA 4FVUA 1UWAA 4ISEA 4JKDA 3VTHA 4Y2IA 4DFKA 3QWPA 3DWLA 5F0UA 3AFGA 2NR0A 1SUQA 2EI5A 4IH5A 1D8ZA 1FE4A 4NA3A 5AXMA 3BKUA 3BGRA 2M8DB 2UUBF 4CHZA 2OFGX 5F8JA 2W7OA 1ZPVA 4URQU 3G6VA 5D0RA 2IFXA 1RCHA 5AZIB 3Q0AA 4NLYA 3R8EA 4NZ6A 2V69A 2O5DA 2CQHA 4K59A 2ATQA 3P38A 2OPQB 4HTLA 3X1LB 1WKLA 3CJKA 1CJVB 4FS2A 3PRDA 5M2PA 3BBFA 4DQPA 3QDKA 4M5GA 2MQOA 3CMAS 1DJ0A 4DUZK 4B17A 2VG6B 3H5XA 2ACMA 2HFZA 1S99A 3V4IA 2X78A 4IOXA 3OV7A 1X5SA 2E20A 4NXMK 2GHPA 4FOIA 3HVTB 4UQGA 1M5VC 1MWZA 1Y97A 1NK9A 3CO9A 1TFYA 1RU2A 4R5PA 2DXDA 5CYQA 4GO5X 4AL7A 1FXLA 2CGJA 4L74A 1PCAA 4QWDA 5B0CA 4JK7A 3KNAA 1T94A 2DRBA 5FRNA 1NRKA 2VCPA 3PIPL 1KKHA 2V2VA 3T9ZA 2EX3A 1R43A 3R5BA 3OYLA 3W5XA 1H38A 3G96A 4Z4HA 4GV6A 4W98A 4U7BA 4X66F 1N4LA 1EAYC 3K9KA 1TKTB 4OO1J 4GKKF 1YHQN 2WRMA 4YOWA 2CZ9A 2OYQA 2QRRA 1BQMB 2AZ3A 2A3JA 4ITSA 1XK8A 2C3MA 4CLZA 2FY8A 4B9NA 1XHXA 2FVQA 1YWXA 4N76A 3AOBA 4KB7A 4TY9A 3THXB 2HF3A 2D69A 3QT8A 3O1WA 4AQYK 3NCRA 2FF6A 3OYBA 3U1MA 2O8EA 1VIOA 1RBRA 1RAOA 1JWWA 2GVZA 1SL0A 4RW8B 2B4PA 2OTLN 4OYMA 2W4DA 3RWUA 2R2SA 3CB4A 2Z2ZA 1BGXT 4U6PA 3TABA 4HLBA 5CHCB 3OYFA 3IUCA 1NXIA 2VGNA 1BL3A 5AJ3F 4NPOA 4CEOA 1RTZA 1LW0B 1HWLA 1RACB 5IOLA 3RW7A 1ELOA 3G25A 2QA1A 4C11B 3P31A 2HAFA 2QO3A 4USTA 1HYSB 4RBTA 2ZNYA 3L3UA 3VGVA 3SCKE 4F0HA 2N82B 1Z25A 4DR6J 4WFNQ 3DXSX 3SDEA 2V4QA 1IR0A 5J2QB 2Q3PA 2VQEJ 2Q1LA 2B51A 4C9DA 4BQLA 3DOLA 4O3RA 2WVFA 3EPIA 3BB5A 3MM8B 4OLBA 3JS6A 2FLLA 3WX4A 1I94J 2IBKA 3VGKA 2EWHA 2KFNA 4ES1A 3OFGA 3B6OA 4ZVUB 4ILRA 1YBTA 4QIWD 2G2ZA 4J9KA 1C1CB 3AY0A 4DR1J 1YJTA 4ED3A 1FFGB 3AXMA 5ADXH 3B54A 1GK8A 4K4ZA 2ZJQL 3ADAC 3EICA 3HI0A 2XHWA 1T3NA 4QIVA 3PW4A 4CH7A 2CJ9A 3BYRA 4QOZB 3VGSA 5AE1A 1FO1A 5FLXO 1W2BM 3T6BA 2ZJRL 5GADP 1VSLA 3TTCA 1ZBHA 4GKJF 5F9LA 1YITN 4DV1K 3ZSWA 3R5DA 3C66A 1SB6A 1C0FA 2IMOA 2ZWPA 2ADCA 2E5LJ 1UVNA 1IJJA 1N5QA 1VOMA 3PW0A 2DRAA 2MZRA 4DR7K 2E9ZA 4ZTJA 5E3PA 1QUVA 4EMDA 3WEEA 4OHVA 4FJKA 2PC6A 2MZQA 1B0TA 3H2VE 1KNZA 4I56A 3VQPA 2FUG9 1GOAA 2CGLA 1WC3A 2KN4A 2PFFB 1QVGM 2QMWA 4K0KJ 2E5GA 2V8PA 4G1PA 2LU1A 4P9SA 4U67Q 1E3MA 1S1TA 1HPZB 2RF2B 4HVJA 4DU8A 2ASLA 2CPJA 2G8HA 3GG0A 3CWJA 5EWEA 3MCSA 3RAMA 4KH0B 3A8IA 4A62A 2HWIA 3CCZA 1VRUA 2ZGYA 4FYYB 2CDQA 4KR0B 4BHQA 4ZVFA 3KLGB 4PG7A 1S12A 3FSIA 1I94F 3ISZA 1REVA 2RB7A 3SQGB 1BUXA 4M63A 4LRBA 3HDSA 4NWBA 4A5BA 3WXJA 3JQMA 2GIQA 1ZM3A 4FM1A 2M5YA 3MPDA 2HIYA 2YWGA 3KHRA 2Q6BA 4IRDA 1S1WB 1QY7A 4YR3A 1FT8A 2BQUA 1KONA 3BGOP 5AZIA 3HFVA 3CYMA 3L8BA 1PC5A 2OPQA 3W65A 2VD3A 3EVWA 1W97L 4OLOA 4J7CA 1V6HA 5A8WB 1CJVA 1KQFB 4UZBA 2H3EB 3FSXA 2PY5A 1HHTP 2Q66A 2VG6A 4RNOA 3I33A 2J4RA 2PO4A 4BRCA 2B0GA 3TA0A 1JLFB 4TVAB 2PDAA 3HVTA 1RYRA 1U45A 3S01A 1RWWB 2PMHA 4BR4A 5A2QY 4URSA 1NK4A 2JC0A 3NFAA 2O8DB 1FDNA 4PABA 4N8OA 2IM0A 1N36J 3VQ6A 2LEAA 3CCJS 3AOCA 3H3NO 2EEYA 1HHSA 3CD6N 2DGQA 3LP2B 2HQGA 4DU3A 1G3OA 2DIVA 3KLHB 3UVJB 4C98A 4CF2A 4BR7A 3SQ1A 4K43A 2DITA 2MKIA 4EK2A 3I6PA 5J2PB 3A8KA 1TKTA 3VWSA 4KBIA 3SBTA 2Z0GA 1N56A 1BQMA 3DLLQ 4RWTA 4FJXA 2JL9A 3MCNA 3ENBA 1UEKA 2VKZG 4FJ9A 2BGGA 2VC0A 4NLXA 4OZ5A 3PTWA 1RCOB 3THXA 1NBWA 2GAHC 4JI7J 3U27A 4QWAA 3NWGA 4CD3A 2YX7A 2B3TB 2VH7A 3OTDA 4TQSA 4RW8A 2ALYB 2R8JA 3D2EB 1A6LA 3HOSA 5F8NA 4FLVA 5DMRA 5ETVA 2YVSA 4IH7A 3ONQA 2VKRA 1CJKB 2CZ4A 1VQ5S 3BSAA 1U49A 1LW0A 3ALYA 1KWMA 3P5BP 5AQHA 1M5HA 4RUHA 3DNCA 4C11A 1FRHA 2DNHA 1HYSA 3B4MA 3OR2B 2O01C 4PWUA 2DB1A 4RU9A 2LQ5A 4IFYB 1VS3A 2AGQA 5FPEA 5J2QA 5H9EJ 2AKWB 1MU2B 2DY4A 2JGUA 4HHUA 4LSLA 3B4DA 4L73A 1TL5A 3TZXA 2YX6A 2G1HA 2CG8A 3I8DA 1KR4A 2ERRA 3MM8A 2NRTA 3M8SA 1WKJA 1K47A 2FDNA 2HK3A 2UXBF 1NB7A 1QAJA 4NASA 4ALZA 5HLFB 2WTFA 3K8VA 1C1CA 3TW0A 4IDKB 1RP5A 2NSCA 3SNNA 3BO2A 4Y1DA 2KTQA 3AJ2A 4TQRA 3U3YA 2L9WA 4CW7B 3J80U 4HT7A 3KG0A 1L3KA 2O4IA 3IAS9 5U47A 4KI6A 5BR8J 4ZLNA 1L3SA 2Z1HA 4ZCIA 5KAKA 3GZ7A 4KGZB 2ZJQQ 4LQ9A 2W6LA 2C2EA 3VAHA 1ROFA 1JL2A 2E1ZA 1SC3B 3EGZA 3W64A 2ZJRQ 2A18A 1NM1A 2IM3A 4ETZA 3AO4A 2MHEA 3T5KA 3IKMA 2LEBA 4L3KA 4JKAA 4BG9A 4LIWA 1FWKA 3QWUA 1NSAA 2RDIA 2UUAF 2PAVA 3ULDA 4ECRA 1VQ7S 2W24A 5EU7A 2J7KA 4LF8J 2Z1GA 2MYFA 4MIAA 4KSEB 4OV6A 2HQDA 5AXKA 4O0IA 2IDEA 1HPZA 1GTHA 2LXIA 3CCSN 2RF2A 2JDJA 3OHBA 2MY8A 1N32K 1QAXA 1SZ2A 3G6XA 4NYOA 3F56A 3FBBA 2J5AA 2OZMA 4HEA9 2BXJA 3PX0A 3PIOL 3IMQJ 3M2RB 1YJNS 1VIXA 1UMJA 5LM7E 3D6FB 3TUZC 3H25A 4IJAA 4DTXA 3KLGA 2HHHK 5F8MA 2ZJPL 4DV0J 2NYIA 3MPYA 1VQPS 3WXKA 2ZH4A 3SQGA 4P7TA 4C1NK 3HHLD 3OYCA 2W2PP 3R7NB 3KG4A 5H9FJ 2P51A 2A2CA 5E33A 4I0WA 2DGXA 4A48A 3ZXWA 4CGHA 3KZBA 3W61A 3BPSP 1S1WA 1QUPA 1U2RA 3KHGA 3LAKA 3MTKA 4DDFA 3VEZA 5J2NB 2BV3A 3V9XA 4FXVA 2MQPA 4M7XA 4F26A 3C6HA 1L3UA 4I9LA 4PCQA 3CPEA 4C0OC 5A8WA 3QFWA 4V1Ak 2A6MA 1LXNA 1T03B 1JXLA 3RB3A 2NYHA 2DKOB 1N5TA 3SBMA 4MO4A