2YNGA

Hiv-1 reverse transcriptase in complex with inhibitor gsk560
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
560
structure length
560
Chain Sequence
NSPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Rational Design of Potent Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
total genus 168
structure length 560
sequence length 560
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2yngA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yngA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2yngA05
3ZT3A 2EX3A 3V6HA 4EBCA 4FLYA 3TQ1A 4TY8A 3T5JA 3BSCA 4QWAA 3JYTB 1SL2A 4I2PB 1U09A 4QAGA 1S0NA 2E6LA 4ZVHA 4Q5VA 3OHBA 3QLHB 5CY4A 2BQUA 2UVRA 4F4KA 4HCCA 4M3YA 3MR2A 3MEEB 1RA6A 2V0NA 4B9SA 3OYNA 2BGGA 4I9QA 5F8HA 1ASWA 2ZE2B 3CJ3A 4DQSA 2P5GA 4DL5A 4IFVA 4FJ8A 1JKHB 3V9WA 4EP4A 3AO3A 1Y97A 5KG1A 4ZVEA 5KFLA 2X6SA 1JXLA 3KLGA 4PWDB 1BI4A 1ZYQA 4ECTA 1TKZB 2OPPB 5E41A 1RTJB 5CYMA 2BRLA 3DRRB 4K4SA 3S3MA 3G6XA 4FYDA 1T05B 4F4WA 2HNYB 3OVNA 1T7PA 3IRXA 3P83D 4M3ZA 2P5OA 2VG5B 3FDSA 1HYSA 4QOZB 4QWCA 2B6AB 3AVCA 1C0TB 1SKSA 3OYDA 4FBUA 4FVMA 2FJXA 1IH7A 3ITHA 1S1VA 3QETA 2W9BA 4KKOB 1LWFB 1MU2B 3TVKA 4CHYA 1RTDB 3ZSZA 2YNHB 1YTUA 3LZIA 3I5CA 4K4XA 5KFSA 4KI4A 4FLVA 1D9FA 4J9KA 2VA3A 1HNIB 3IS9B 2B5JA 2OPSB 4M3RA 1RBSA 4OL8A 4R5PA 4CJ4A 1S0MA 4W5TA 1C1CA 3C6UB 3L2UA 3ZT1A 3C6TB 2ILYA 4MIAA 4DTPA 4CEDA 1RYSA 3H4BA 1WSIA 3AA3A 3HVTB 1SV5B 1EETB 1XR7A 3NFAA 1U48A 1IKXB 1RBRA 1LAWA 4DS4A 5EUHA 5KFUA 3RRGA 2FBTA 5CYQA 3CDWA 3HJFA 4FLWA 3DYAB 4DS5A 3KJVB 3KK2B 5KT5A 1WN7A 4KV8A 2RDIA 1FXXA 4E7KA 3H98A 3KIOA 3KLHA 2OPQA 2O4GA 4H54A 4B9UA 1TGOA 1RDAA 2IJFA 4DTJA 3OL6A 3OYAA 4I9LA 4NLOA 4RNNA 4DMNA 4TQRA 1S0OA 3SV4A 4E7HA 4FZYA 4EP5A 3PVXA 3VQ6A 3GIMA 3HT3A 4PUOB 4FJKA 1XI1A 2W9CA 4M3WA 4XO0A 4HUGA 5L9XA 5JS2A 4CFAA 2JC1A 4CHPA 4I2PA 4FLUA 1K1SA 3ZSYA 3KK1B 2ATQA 1TQLA 4BDYA 2HHWA 3VN5A 4DSFA 2HNDB 2G8KA 1S1TB 4OPJA 3V9ZA 4ED3A 3G6VA 5EWEA 4CF1A 2HHXA 2DY4A 1RT6A 2YHAA 1VSMA 1J5OA 2WHOA 4KHQA 3DOKB 4HVJA 2O5DA 2ZE2A 3QO9A 5FDLB 4JLHA 4DEZA 2JGUA 3DLKB 4YR0A 3JSMB 4DL3A 4PWDA 2YNFA 2IDOA 4IH7A 4PA1A 2OPPA 3L3VA 4CESA 1NJXA 1KVAA 1JX4A 4Z4EA 1D5AA 4Y3CA 3DRRA 3HXMA 1CLQA 4CEZA 4NZ0A 4G3IA 4TXSA 1GX6A 1TL1B 4AHSA 4W5NA 4ECXA 3QIPB 4YNQA 2VG5A 2FVPA 3DRPB 1D0EA 3DLHA 3SFGA 2ILZA 1RTHA 4CCHA 1C0TA 3HP6A 2IM2A 4KBIA 1RBVA 4Q8EA 3WNEA 3AVAA 5J2QB 4ZTFA 5KG4A 1RAJA 3QNNA 3B6PA 4DSIA 3QGHA 1GOCA 1LWFA 4MK8A 2PZSA 4ED6A 3DLEB 5EU7A 3QEIA 4FK0A 3LANA 4CJ5A 4CECA 3LDSA 4KHYA 4WFXA 2XI3A 4DQRA 3MR6A 3SQ1A 2WOMB 3CFRA 4IRCA 3DM2A 3ZCMA 3H5XA 3I0SB 1HNIA 2AGPA 4XPCA 4KTQA 3C94A 1REVB 3NHGA 1ZTWA 4IDKB 3LALA 3RB6A 4IG3A 5KRSA 1F21A 5DG7A 4CF9A 3VQ9A 1HQEB 1D9DA 1K6YA 3HVTA 1XWLA 1N6QB 4XIUA 1XHZA 1EETA 4ZPCA 4RW7A 1N5YA 3RMBA 5KG6A 4X2BA 3L2WA 4M95A 1IKXA 1RT7B 4U6PA 5KFVA 4Q43A 2VA2A 4CF2A 3I0RB 4W5OA 3UIQA 1RT5A 3BGRA 5KFJA 4CK1A 4N41A 3KJVA 3KK2A 3HSTB 4FJ7A 4KAIA 1CXQA 4CEOA 1DLOA 4FJ5A 4NLXA 3RAXA 4K50A 5KTQA 1DTQA 3VQDA 4O3QA 4Z4FA 1GOBA 1EP4B 3L8BA 4M3TA 3M8QB 3D45A 1T94A 2GIQA 2UVVA 4E19A 3KOAA 1NJYA 4JV0A 1L5UA 4QW9A 3M9MB 3LP3A 4ZP9A 1SUQB 1FKOB 3CM6A 1RBTA 5F8JA 4XPEA 1Z25A 4DQQA 4ZPAA 3NF8A 1UA0A 4KB1A 1SH3A 1UOCA 2JEGA 1JLCB 4FJIA 4F4XA 3SQ4A 3HVWA 2WONA 3T1AA 1B92A 4BDZA 3O3HA 3CWJA 5SWMA 1LWCA 1S1TA 4YP3A 2P1JA 5KFRA 1HYZA 3OYLA 4YQWA 1TKXA 2BANA 2IM0A 4FXDA 1KVBA 2YKNB 2YKMB 4DTXA 4HKQA 4WXOA 4LY7A 4DFMA 2VG6A 3NAEA 4B9VA 3K5LA 3Q8PB 3PR5B 3OSPA 1IG9A 5FDLA 2HWHA 5KFGA 3TWHA 3DLKA 4JUZA 3B6OA 1QSSA 1RTIA 1S49A 4JV1A 1NKBA 2UVWA 1KLMA 1S9EB 4CK2A 3L2RA 3PX0A 5F8LA 3RR7A 4L8RB 2KFZA 3EZ5A 3EY1A 3SUOA 3CIZA 2XRIA 3QIPA 4OJRA 3KHRA 1UWBB 1A5XA 4DF8A 2OPRB 1S9GB 2WB4A 1FKPB 4O44B 4O0IA 5DLGA 4DSKA 3BSAA 4NCGB 3K57A 4Y1DA 1QUVA 3KHHA 4Q0BB 2ALZA 3LP1B 3DLEA 3MTKA 1QAIA 3RAQA 4B08A 4RNHA 4LSLA 3SQ0A 4LD0A 4CEQA 4FS1A 4NYZA 4E3SA 2X6NA 3HYFA 4FM0A 4PQUB 5L1LA 3I0SA 2QKKA 1NK7A 2R7YA 5J2NB 3RMAA 5F9NA 4IDKA 3AVNA 5I42A 2ITGA 3HPGA 4HHTA 4R8UB 3KLEA 1KHWA 1XHXA 4EYHB 4BWMA 4ECRA 1QHTA 3VQSA 1VSEA 1JLEB 2ZD1B 2C22A 5L1IA 1HMVA 3K59A 1RT4B 4ZVGA 4AHUA 2F96A 3HK2A 2D0CA 4R0EA 4KAZA 2FLPA 1JL2A 2IJNA 3QYYA 1VK0A 3ISNC 3M8SA 4WFYA 5T7BA 3D28A 2W42A 4BE0A 1FK9B 4ICLB 1IKYB 3M9NB 4LQ3A 4OPKA 4KFBB 4ED0A 4Y1CA 2D0AA 4ECVA 3KHGA 1VSKA 1KRPA 4MQ3A 2X78A 1Z4UA 4FJHA 4F8RA 2D5RA 3VQ4A 2VG7B 1JLGB 4G1QA 3GIIA 3AVFA 4NLPA 3SPZA 3HVRA 5HRSA 1S6PB 3RTVA 5K14B 4TYAA 4CEFA 4CJSA 3PJWA 4RUAA 4I7FB 5KFBA 4RW8B 1CZ9A 1TVRA 4CIGA 3RMCA 4O3OA 2RKIB 1SKWA 1U49A 1L3TA 4IKAA 3RBEA 1BIZA 3DMJB 2C28A 2RPIA 5JS1A 1LWEB 2YKNA 1RT1A 2R2RA 4J2DA 2AGOA 4F50A 2V4QA 3UQSA 3V9XA 4OGCA 1X1PA 1C0UB 4TQSA 2E4LA 4J9QA 5C42B 4ID5B 1LW2B 4B9MA 4FJNA 3E01B 1I3AA 3QGIA 2EHGA 3V4IB 3TAMA 5HLFB 1S9EA 4O4GB 1C2PA 3CJ2A 1I39A 3OYEA 3NKYA 3HO1A 4ECZA 3NF6A 5I3UB 4CHZA 3QZ8A 3ZSQA 4FLTA 4CJ3A 3FQKA 4K4VA 4YMEA 1ZBFA 3LPTA 2DFHA 4KTZA 5F8GA 3N6MA 4CGGA 3KTQA 2R2TA 2XGQA 4NRUA 2QK9A 4CE9A 4MFBB 2OPRA 2IS3A 4OKJA 5DQHA 1VSLA 4O44A 3H5YA 4J2AA 4CJQA 3CG7A 4CJTA 3MXIA 3UPFA 4RW9A 4NCGA 5C25A 3T5KA 2JEFA 3CJ4A 3ISND 4Q0BA 4JV2A 3LP1A 1RYRA 4NCAA 4IQXA 3CM5A 1NK0A 3O4QA 3C95A 4QCLA 4Z4IA 1S6QA 5HP1A 4RW4B 3CFOA 4ZVFA 3PHEA 4WFZA 2E9RX 4KHNA 5HBMA 4IFYA 1HQUB 4DL7A 2HMIB 1XR6A 3NGIA 4DL2A 5DG8A 1WSEA 4URGA 4FZXC 3V1QA 2DPJA 4Z0UA 1TV6A 3ALYA 1U4BA 3HP9A 4K8XA 1RT4A 4CK3A 4YFUA 4LSNA 3CQ8A 4ELVA 4MK7A 1WSGA 4EZ6A 1GX5A 4EO6A 1IKYA 2R8HA 4CERA 1NKCA 2XCAA 5KI6A 4N47A 1VRUB 1L3VA 4J9LA 4DTUA 2A1RA 1JLGA 1HNVB 5C24A 4O3RA 1QQCA 3F9KA 4U7CA 3BQ1A 3VQ7A 1WSHA 3V6DA 1T03B 2FVRA 2PYJA 3IAYA 3OHAA 4ECUA 3K2PA 1KCFA 4CEEA 3I5AA 4IKFA 4E7JA 1VRTB 4C8NA 4I7FA 3NMAA 3SI8A 3NF9A 1KVCA 4BE1A 3BSNA 2RF2A 3RR8A 3SPYA 1G15A 3N6NA 4HTUA 4DTOA 1QE1B 3H4DA 5J2MA 4HYKA 2ATLA 4FJXA 3AVMA 2J6TA 4QWDA 1TK8A 3RWUA 3FFIA 4ZPDA 2E9TA 5KGXA 4NLTA 1ASVA 1HRHA 5KFQA 1C0UA 3NH2A 4B8CA 5C42A 3JYTA 4TY9A 4DG1B 5JUMA 4GMJB 1C1BB 3ZSWA 3VQ5A 2IM3A 3HM9A 4IH6A 4ZP8A 5KFTA 1JIHA 4NRTA 3QLHA 4ED8A 5HLFA 3UR0A 3HL8A 1HJRA 2W9AA 3MEEA 5J2PB 4KSEB 3CJ5A 5KFYA 1DTTB 3BREA 2BR0A 1LW0B 4KHMA 1S1WB 4TN2A 3O4NA 3V6JA 1BGXT 4RNMA 2W7OA 3GV8B 1JKHA 3SUPA 4MFBA 4ZHRB 3Q8SB 2A1SA 2OA8A 3KKSA 1IKWB 1TKZA 4CGHA 1RTJA 1TL3B 2IAJB 3VA0A 3OYMA 3PZPA 1JLBB 1T05A 3QEPA 5KFDA 2HNYA 4J9OA 2QKBA 3GQCA 4IBNA 3MXJA 4O0JA 3WNGA 3AVJA 4JRPA 1IO2A 2B6AA 3GIJA 3T3FA 1HQUA 4KKOA 1VSFA 1MU2A 5FRNA 1RTDA 2IC3B 2AWZA 4ZTJA 2YNHA 1N4LA 2Z1JA 4CEBA 3MEGB 3OLBA 4K4UA 3NGDA 5DG9A 2D41A 3ULDA 3VA3A 5HROB 1NJWA 3IS9A 2W8KA 1SH2A 2R8KA 2OPSA 3O3GA 2Y1JA 4ECSA 1C6VA 1QAJA 4E1NA 3WNFA 4K4TA 2W8LA 3FSIA 3C6UA 2E9ZA 3MEDB 4Q8FA 4E7LA 1ZBIA 2DFEA 2JLEA 3C6TA 1HARA 1BL3A 4FZZA 2XWYA 3KK3B 1SV5A 4KTWA 1K1QA 3PW4A 3OL8A 4GC7A 4NLQA 4Z4HA 4HUEA 3D5MA 1HNVA 3RRHA 4DQIA 4RNOA 4K4WA 3U3YA 1RT3B 1KHVA 3DYAA 3RB3A 2IM1A 2HHSA 4Y34A 1XR5A 3G0ZA 3K5MA 3TAEA 1TKTB 1RNHA 4DTMA 2QE5A 2G8VA 4J9NA 2BE2B 1JXBA 3DOLB 3AV9A 2HHVA 3NAHA 3OJUA 2XI2A 4Y2CA 2DPIA 1QE1A 4ELUA 4C8LA 4K4YA 3V9SA 4EEYA 1GOAA 2IA6A 2XGPA 2EC0A 5KG2A 2OZMA 4IRDA 4PUOA 4I2QB 3EPIA 2YNIB 4DG1A 3EZUA 3CDUA 4ECYA 5KGWA 1EKEA 3KK1A 1S48A 1O1WA 2HNDA 3LAMA 4LH5A 1WNSA 1Q8IA 4M45A 3ICLA 1UAXA 1WNEA 2YV0X 3V81B 4J9MA 3DRSB 2XC9A 1BCMA 4RW6B 5HRNA 3DOKA 4H4MB 4FJLA 3TABA 2D3UA 1TKDA 3NBPB 4F4YA 1W0HA 4EZ9A 4DQPA 2VWJA 3JSMA 3AO2A 4CFBA 4KRFA 3Q8RB 4CJLA 3SUNA 4NLVA 4C8OA 4H4OB 3AVKA 3ZSVA 1QSYA 3L2VA 4TY8B 1NK6A 1TL1A 3PJXA 2XCPA 3AO5A 3DRPA 1VSHA 4AILC 3KMQA 3GYNA 2I1RA 4IOBA 1NK8A 4KREA 1W25A 4ZP6A 3SV3A 2XY6A 3NH1A 3U6FA 1TAUA 3L2QA 5DLFA 3AA2A 1LV5A 4CJFA 4YR3A 5J2QA 3BR9A 3AO4A 4W5RA 3LWLA 4MH8A 1VSDA 4GVMA 3H5UA 4Z4GA 3E51A 4CFDA 2IC3A 3KNAA 2FVSA 4BE2A 4FK2A 2KFNA 3AVGA 3MEGA 1XC9A 1JL1A 2WOMA 1BI4B 1U45A 5HROA 3FRZA 1YT3A 3BQ0A 4WE1B 2WCXA 3S3OA 1X9MA 1NHUA 5F8NA 4QWEA 1REVA 1NKEA 1J53A 2ZKUA 4O5BA 3H08A 2C2DA 2G8UA 5EDWA 4DFJA 3G6YA 4URQU 3HPHA 3IRXB 3IGVA 5CZ1A 4FM1A 3BJYA 1HYSB 3MEDA 3O3FA 1WAFA 4FW2A 1ZBLA 2I5JB 4EBEA 2F8SA 1EX4A 1CZBA 3QINA 1HQEA 4CJVA 3KK3A 1N6QA 1Z26A 2YNGB 5KFNA 3IN5A 2W9BB 1TAQA 4OVLA 1RT7A 2Z1IA 3I0RA 4KHUA 4UQGA 4NLDA 1RT3A 4KB7A 3OSNA 2IGIA 3NF7A 4OLBA 4TSXA 2FVQA 5CZ2A 3NGYA 1ASUA 1U47A 3PY8A 3LPUA 2B5JB 1KFSA 1EP4A 3M8QA 5DGBA 3ZT0A 4R5PB 3D0PA 3KLVA 1VSJA 4NLWA 1RT2B 2ASJA 1SUQA 3DI6B 4AHTA 1FKOA 3IGNA 4E7IA 1TP7A 3QEXA 5KFAA 2J6UA 2E6MA 1ITGA 2RN2A 3I8DA 2YNIA 1JLCA 3SYZA 3VQ8A 3QESA 4KHSA 4NLRA 4WYWA 2HVIA 4IR1A 5KG7A 1S9FA 2AU0A 5CYQB 3LWMA 1T8EA 5KFKA 1VSIA 1IKVB 4KV8B 5DQIA 4CHQA 4OKKA 1D1UA 2YKMA 2KTQA 3ASMA 3VQPA 2HNZB 1WAJA 3SUQA 1HPZB 5KG0A 2NUBA 4H4MA 1BHLA 3OYGA 3NE6A 4RUCA 4KHWA 1QTMA 4JRQA 4CIFA 4B8AB 1S1XB 4IH5A 4KHRA 2D7SA 3MECB 4H4OA 3BDPA 2W9CB 2F8TA 5EWGA 4O3SA 4FJGA 3HKWA 4ECWA 4ED7A 1R0AB 4N76A 1UWBA 1SL1A 1NK9A 5KFOA 4WZQA 3V6KA 1WSJA 1S9GA 1KLNA 2G8FA 1FKPA 1YTAA 4BDPA 5F8MA 4LH4A 1RT6B 4NLYA 4ZP7A 4EO8A 1J5OB 4MKBA 2HHQA 2YHBA 3CVKA 4MK9A 1JXEA 5C5JA 3QO9B 2XY5A 3H5SA 2R8GA 3NH0A 3NCIA 1TK5A 4BACA 2WRMA 1WSFA 2Z1HA 2ASLA 3M8PB 4O55A 1YVUA 3TAQA 1ZETA 2YNFB 1NK4A 3TANA 2B4JA 2B43A 4PQUA 3OJSA 4B9TA 4DSJA 4WE1A 4DF4A 5SZTA 4N56A 2FBVA 5J1EB 5T14A 2R8IA 2ZQBA 1KFDA 5J2NA 4CGJA 1D8YA 2GV9A 1A5VA 3HVAA 2FJVA 4R8UA 2PYLA 1BQNB 2JEJA 1CSJA 4KO0B 4DWIA 3OS1A 3TAGA 4K4ZA 2I5JA 4TLRA 1JLEA 2ZD1A 1RTHB 5KG3A 3AA5X 5KFMA 2YNGA 3VQQA 2BQRA 2HHUA 1U04A 4DTRA 3ZSXA 4DU4A 5EWFA 5KFWA 1RILA 2IOCA 4J9SA 2KZMA 1FK9A 4ELTA 4OKEA 4ICLA 4FJJA 2HHTA 3IG1B 4J9PA 4KFBA 1KTQA 5JXSA 2FBXA 5DQGA 5FRMA 2FVCA 2D0BA 5KFHA 3DM2B 2D3ZA 1L3UA 3P5JA 3CDEA 4F3OA 4DSEA 4DTSA 2VG7A 4AH9A 4EYIB 1RT2A 3QIDA 3DI6A 3HHKA 2HVHA 1S6PA 5D3GB 4IG3B 5K14A 4ZMMA 3EPGA 4B9LA 4DU1A 4B3OB 4RW8A 4CJWA 1BQMB 4RNFA 5KG5A 3AVIA 4RW7B 1N5YB 3OYKA 2O4IA 2RKIA 2WTFA 3OS0A 4URSA 3PUFA 2RDJA 1KSPA 3GILA 3THVA 1RT5B 3DMJA 3BGRB 5DGAA 1IKVA 4M42A 3FQLA 4FK4A 1LWEA 1DLOB 5KT7A 1RDBA 1JLQB 3OYFA 4M3XA 4J2EA 2UUTA 2HNZA 3KKRA 3KD1E 1HPZA 3RB4A 3K5OA 1DTQB 2HW3A 3SNNA 3DLBA 3T19A 4ID5A 3AO1A 5KT4A 4DSLA 1LW2A 4NCBA 3E01A 2AQ4A 1EXQA 3N6LA 3CFPA 3V4IA 1S1XA 3GIKA 4O4GA 3MXMA 2P51A 4NYNA 3QNOA 3MECA 2JC0A 5I3UA 2Z1GA 2WK4A 1L3SA 2BQ3A 3SI6A 4CGFA 3BQ2A 1R0AA 3KMSA 2WONB 3MFIA 3P1GA 1QSLA 3VQBA 1RDDA 1LWCB 3PR4A 1TKXB 2BANB 3SQ2A 1NJZA 4IG0B 2LSNA 3DLGB 3VQAA 2FBYA 2VG6B 2BDPA 3OYHA 4HUFA 1YVFA 2AX1A 2PY5A 2KQ2A 1ZTTA 4CHNA 4E89A 4FCYA 2OH2A 3Q8QB 1RTIB 3M8PA 3EYZA 4FM2A 2ASDA 4RW4A 4M94A 5F8IA 4Y2AA 4QWBA 3MFHA 1KLMB 5KT3A 4GC6A 1OS5A 3SJJA 1S1UB 2KZZA 2G8HA 5J1EA 4KE5A 5HRPA 3CJ0A 5FROA 4ED2A 2HMIA 3DDKA 3H2LA 5KFCA 1NOYA 3ZSRA 4C8KA 4IR9A 2R2UA 3OS2A 1BQNA 3TAPA 2ETJA 4KO0A 1RBUA 4CEAA 3LP2B 3KLIB 3QIOA 4FBTA 3QGGA 1RDCA 3CYMA 2V4RA 3K58A 3PW7A 1J9AA 4K8ZA 4CJEA 3PO5A 3KLFB 3IG1A 4LSLB 4OGEA 3G86A 1NNDA 3BSOA 4WZMA 1RCHA 2F8EX 4JS4A 2GC8A 1VRUA 5KT6A 3KHLA 1S4FA 4WXWA 3T5HA 5KFEA 2C2EA 3LAKA 4Q45A 5I42B 3KLEB 4CJKA 1J54A 2Q3SA 5D3GA 1T03A 4Q44A 4NLUA 4CF0A 1VRTA 1HMVB 3S3NA 4B3OA 3TAFA 2OYQA 2C2RA 1BQMA 4W5QA 1UA1A 4RU9A 2FC0A 5KRTA 2UUWA 1CXUA 4CGIA 4J2BA 3VQCA 1B9FA 3QEWA 2VWKA 1JLFB 4DU3A 3LP0B 2AJQA 2FLNA 4NYFA 4WYLA 3SFUA 1JLQA 3PW5A 3AVLA 4O4RA 5KFFA 1N56A 3G10A 3T5LA 1JLAB 4E0DA 1C1BA 4G1QB 2CKWA 4E1MA 3S9HA 3CO9A 4AHRA 4OLAA 3RBDA 2XO7A 5KFIA 3HPOA 1N48A 2OZSA 5F9LA 4C8MA 1S97A 5KFPA 5J2PA 1TVRB 3MAQA 4DLEA 1DTTA 3M8RA 4FJ9A 3RMDA 3NAIA 4QPXA 4F4ZA 3PV8A 1LW0A 3M9OB 1S1WA 4DTNA 2IMWP 3LZJA 4CIEA 4FLXA 1C0MA 1NOZA 2XY8A 4CGDA 1A5WA 4Z4CA 4ZHRA 4LQ9A 4DL4A 3K5NA 2QXFA 2AGQA 3QEVA 4IG0A 1IKWA 4M3UA 1RT1B 4RG8A 3DLGA 3OYIA 1TL3A 3TR8A 2IAJA 4CJPA 4F3TA 5HRRA 3I5BA 5L1KA 1JLBA 4CFCA 4N5SA 3PW2A 3VQEA 2AX0A 4DLGA 3AVHA 1IM4A 2DTUA 1B9DA 3OLAA 2V9WA 3OYJA 1ZBUA 2HAIA 3RB0A 3TAMB 1S1UA 1I6JA 4CHOA 4BWJA 3OYBA 3KD5E 3MF5A 4O3PA 5L1JA 3U3GA 4HCBA 2CJQA 1TK0A 2DFFA 4IFVB 3OYCA 4MIBA 3LP2A 1QS4A 4KI6A 1RA7A 3KLGB 4RW9B 3KLIA 4DFPA 5C25B 1BIUA 2QV6A 3WNHA 2G8IA 5CYMB 4ID1A 1BCOA 3UDLA 4QW8A 1S10A 1SL0A 5DMRA 2J6SA 3SCXA 3KLFA 4ECQA 1X9WA 5KFZA 1S6QB 4CJRA 4KB0A 3SZ2A 5HP1B 1LAVA 3AVBA 1Q9YA 3MR5A 2XY7A 1SH0A 3ZSOA 5HBMB 5KFXA 5DK5A 2HB5A 4IFYB 3QERA 3ITHB 1S1VB 4NLSA 2X74A 3MR3A 2FJWA 4F2SA 1ZBHA 1SKRA 3GV5B 2UVUA 4CF8A 4FJMA 3A2FA 2R2SA 2IBKA 4MKAA 2Y1IA 4AHCA 1X9SA 1TV6B 3OL7A 1BISA 4H8KA 2BRKA 4EBDA 4ZPBA 5KT2A 1TKTA 4LSNB 4GW6A 2BE2A 4O3NA 4AHVA 2XHBA 1NHVA 3DOLA 3ZT2A 4RZRA 4DFKA 3NGZA 1JLFA 3DLRA 3LP0A 3QZ7A 4CJUA 3TARA 1C1CB 3PO4A 4F2RA 4JS5A 4I2QA 4DL6A 3L3UA 4FW1A 1JLAA 4FS2A 4FLZA 3PX4A 5C24B 2JEIA 4NLGA 3V1RA 3NDKA 3F73A 4YR2A 1MMLA 1Q9XA 4IRKA 1C1AA 3V6DB 2GUIA 3ZT4A 3V9UA 1RDRA 4KPYA 3V1OA 3OL9A 1HYVA 4ED1A 3V81A 3TI0A 2HWIA 3DRSA 1S5JA 4TYBA 3GV7B 3KLHB 2OPQB 2KW4A 2R8JA 4RW6A 2RF2B 4M41A 3OY9A 1NK5A 3NL0A 3NBPA 3PW0A 3AA4A 2W7PA 4B9NA 1W9HA 3H40A 5J2MB 2FLLA 2GBZA 4PY5A 3H59A 4J9RA 2G8WA 3FFIB 1T3NA 2GIRA 1WLJA 3PX6A
chains in the Genus database with same CATH superfamily
3ZT3A 3V6HA 4JI3F 4EBCA 5F0UA 3T5JA 2WVEA 3JYTB 3V4MA 2M52A 2M88A 3SDEB 1R6VA 4Q5VA 3IR7B 4OHYA 4FF4A 3QLHB 3WX8A 3E8OA 5HQMA 3N28A 3VHQA 3VESA 3MR2A 3MEEB 2RIJA 4B9SA 2DGXA 3OTDA 2WSCC 5EY4A 2E20A 4EP4A 3AO3A 2X6SA 1T44A 2H4YB 1FRMA 2E5HA 3FZHA 4F3QA 2P6TA 4ZLNA 1SQKA 4K4SA 4C3MA 4DXLA 5A8WB 2DNRA 1M90O 2FY1A 2UU9J 2YWWA 3IRXA 5HJXA 2VG5B 3FDSA 4OI6A 3PIOL 1HYSA 5CHCB 4USMA 1SJ3P 1C0TB 1S7IA 2J7WA 4BC7A 4UY8O 1RADB 1MWZA 4LF4F 2KKZA 3D6MB 5ETMA 3QETA 2W9BA 3GU0A 1MU2B 3TVKA 4JK8A 1FJGK 3N4WA 1RTZA 2XSJB 4KI4A 3G9CA 4FLVA 1D9FA 3THPA 4YDDB 2AEJA 1RHRB 3RBXA 3VETA 4M3RA 4A5AA 1DKGD 5ADXA 4R5PA 3TUJC 2DR5A 1PC5A 2QLBB 1C1CA 2DNQA 2ILYA 3C2PA 4CEDA 1RB0A 4UW2A 3KG4A 1S22A 2NSCA 3FEYB 3NFAA 3MM9A 4LIRA 2QWLA 1IKXB 4DS4A 1Z05A 5EUHA 1Q8LA 2C2OB 3EGVA 3MMBA 3KJVB 5KT5A 4KV8A 3VAKA 3GPAA 2P9SA 1A9NB 1KQSR 3A0IX 2QJ3A 1T9TA 3JQJA 4GKKF 4K0KF 4I9LA 4TU7A 4NLOA 4X4QA 1HQ2A 1JQGA 3ULEA 2R42A 4O5FA 1NH7A 4DUTA 1QJHA 4M5LA 2B51A 2PEBA 2R3VA 3M2RA 3E9PA 4M3WA 2IJRA 4HUGA 5JS2A 4CFAA 2JC1A 3IC1A 3QGPA 2P9IA 5C15A 4FLUA 4CW7B 4BDYA 4DSFA 4DR2F 1S1TB 4OPJA 3G6VA 5EWEA 2F65A 2HHXA 2WHOA 4KHQA 4NA3A 2ZE2A 3HSJA 4G65A 3UCGA 4A8SA 1CJVA 2HF4A 1VR6A 1Z2LA 4Z7CA 3CCES 3EVWA 4PA1A 2OPPA 4DV1J 3L3VA 3CCSS 2MZRA 1D5AA 1ZC6A 4OYOA 4JI0F 3X3UA 3KUGA 4LRCA 1FDNA 4DU7A 4ANEA 1LXNA 1N5VA 2QZ8A 4ECXA 2FVPA 3EN9A 1S5ZA 2F3JA 2YJEA 1VHXA 1EHWA 3CCRN 1RBVA 4NI2B 5E3AA 2GWKA 5KG4A 2CQPA 3B6PA 1GMWD 1LWFA 1HBNB 2PZSA 3DLEB 5C2GA 3CC4N 5EU7A 4FK0A 3WQTA 1BMQB 1GAOA 4JI6F 1F9EB 4KHYA 2K1RA 4UOHA 4N77A 3CFRA 2DHGA 4IRCA 3ZCMA 3H5XA 3I0SB 1HNIA 3W2VA 2HAFA 2GW8A 1O6XA 1LQ9A 2IIRA 3CI5A 1U0SA 4IDKB 1Q95G 2DEIA 5J1NA 3T1HF 3SLCA 2H51B 5KRSA 1TTHB 1F21A 5EN1A 2CQIA 1KQFB 1HQEB 1K6YA 1Y5NB 3S1TA 1NRKA 2FHMA 1EETA 4ZPCA 2F63A 3GE1A 1IXKA 1RT7B 2VA2A 2V5HG 3VGSA 3AFGA 1DGKN 1VQKN 3UIQA 3M8ZA 1FEHA 3BGRA 2ZJRL 1WEXA 2EG1A 4FJ7A 2HFUA 2CWKA 1AXQA 1CXQA 2OFGX 4LUBA 4BC5A 4WP9A 4X4UA 2Y9HA 1Y7PA 4KQZA 2YHYA 1W26A 4O3QA 4CZGA 2M0GB 1YWXA 1F5AA 4LSZB 3KOAA 2E8AA 4ZP9A 1SUQB 2BTFA 4XPEA 4A8XA 1FRLA 2C2MB 4M5KA 1SH3A 4QR0A 2E5LF 1UOCA 3FVYA 2JEGA 1U1PA 4F4XA 1MWYA 4UT4A 3ILJA 4PHTX 3IP0A 3T1AA 1KXPA 1WBBA 3KKFA 2P1JA 1HYZA 2IM0A 3MCMA 2AYGA 3D54A 1RDWX 3AQPA 2YKNB 3C0BA 2P9UB 2HS3A 4WU3A 4BC4A 4HKQA 5K8MA 1N5SA 3NAEA 4NEYA 4CLPA 1QQNA 3BPDA 2RE1A 1HKBA 3DLKA 4JUZA 1X3MA 5F2RA 1NKBA 1UFKA 2UVWA 1KLMA 2BM1A 4JI2K 3PX0A 5F8LA 2PIIA 5E5NA 1O0PA 3R8YA 2KFZA 1R8PA 3EZ5A 4EIAA 2DNMA 3SUOA 2RHKA 2GS8A 1UWBB 4JKGA 1XNQF 1S9GB 3GTYX 1FKPB 2VASA 4O0IA 4AUKA 5B08A 2P9PB 1FT8A 3HD2A 3U27A 2Y1RI 1P8GA 1WOSA 4Y1DA 1XNRF 3KHHA 1WWHA 2O67A 3AT1B 1NEEA 2IDLA 2BACA 1NGAA 4NX9A 2NS1B 2R7SA 4F0KA 4NYZA 3ZETB 1ILYA 3AXKA 3PDNA 3FGVA 3NCQA 4ZCLA 3D67A 3OXGA 2R7YA 4ZN3A 1VJQA 3H8YA 2K2PA 3AVNA 2ITGA 4R8UB 5D0HA 1XHXA 4BWMA 5IV4A 3GONA 1K9MO 3MMCA 3IWLA 2C22A 2N7YA 4AHUA 2C3OA 1LEOA 1NDKA 4PWUA 1P90A 1UJ6A 1VK0A 3W2WA 4WFYA 2W42A 1IKYB 4X4RA 4Y1CA 4ECVA 1XMQF 4IDHA 2QMUB 3LA0A 5GAGU 2YJFA 4MQ3A 4RX6A 4FJHA 3FJ2A 4K43A 5FPDA 1JLGB 5B0BA 1RI7A 3AVFA 5K8NA 4H5RA 2HG4A 1FFWB 3HVRA 1S6PB 2DGOA 1RABB 3PXGa 2ZBCA 4B3TF 1GLFO 4DUYK 5FLXU 2ZBPA 2KJWA 4UF4A 4I6MB 3PJWA 3AD9C 4RW8B 1CZ9A 2AP6A 3OTBA 3EUNA 1U1KA 2R7XA 4O3OA 1N8RO 1SKWA 1WC0A 1U7LA 3RBEA 4DR7J 2F40A 3C65A 2GFFA 4GV6A 4F50A 3CJRA 5ETVA 3UE2A 3IMXA 5E3RA 1X1PA 1C0UB 5CR4A 3J7ZO 3PRVA 2JZ5A 1M1KO 1AYEA 4B9MA 4FJNA 1UZDA 2HHPA 2WW8A 1S9EA 3CJ2A 2H5IB 3SBTA 3HO1A 3PYEA 2BOPA 1Y9OA 3R9LA 2PA8D 2B56A 4I6WA 4FPAA 3TEHB 4FLTA 1ZM4A 1BOTO 4HT7A 3FQKA 4YMEA 3QBWA 1P27B 1SJRA 1U2CA 2ZOMA 3BBCA 2ZH8A 2EG2A 4AFFA 4MFBB 3CHWA 4O44A 3MXIA 4K59A 5C25A 3CJSA 4AT1B 1WOPA 3ISND 3LP1A 2QO3A 4IQXA 5ITHA 2IVMA 3C95A 4HH1A 1S6QA 2QEXS 1FVSA 2MZJA 3SAHA 4DPXA 1FA0A 1GLCG 3VPZA 4X64K 3T1YF 4ZVFA 3PHEA 4WFZA 4KHNA 5HBMA 4IFYA 2HMIB 3S8SA 3P31A 4ZIWA 4JAXA 3O6QA 5DETA 4J9UE 3Q0AA 2IVFB 4K8XA 1PYOB 1FFSB 4YFUA 5AJ3F 1NGJA 2V8VA 1QY7A 5BR8J 4ZKAA 4MK7A 4ELVA 5AE3A 3CCQS 3FLCO 1F3VA 5GAHU 4K5RA 5SUHA 3X1LB 5A8RA 1GX5A 2AA4A 4KHPK 3T9NA 1NKCA 4AQYF 3GBTA 3THWB 2DGWA 3BH7B 2WTUA 3B4MA 3VF2A 3J7AN 4ZK7M 5IC4B 2AW0A 3H20A 3QJJA 5C24A 3MM7A 3CTRA 3F9KA 3LL3A 4U7CA 3VQ7A 2HBJA 1UJ4A 1WDDA 4BRKA 2HQ3A 3J80Y 3JS6A 7FD1A 3NMAA 1VQLS 3NF9A 2ZWPA 1GT8A 1N34F 5E84A 4LF9J 3CE8A 3FR0A 5F0WA 1CBKA 5KQ8A 4WFNL 3RR8A 1G15A 4HTUA 2MQOA 1QE1B 3HMJG 3ID8A 4HYKA 3D6HB 4FXVA 4DCJB 1RCOB 4B02A 1TK8A 2GHWA 2FF6A 2E9TA 3PRDA 1HRHA 2CPIA 4AM6A 5BN8A 4YS2A 3CDBA 5C42A 3JYTA 4TY9A 4GMJB 3ZSWA 1FJ7A 4KH1B 1AW0A 4ZP8A 5KFTA 4CZMA 1RISA 3SDEA 5CA5A 3DXMB 2LKZA 2DNPA 1JIHA 4NRTA 1T95A 3QLHA 4ED8A 3VGLA 1U1NA 3MEEA 4GO7X 5J2PB 3E9OA 3AY0A 3OFGA 3CF5L 1ZBTA 2DNYA 2DT9A 1D4XA 1K8KA 1S1WB 3O4NA 4B1WB 1BGXT 3E2EA 3W8GA 3U7JA 4ZHRB 1C0FA 3Q8SB 2IRXA 2D1KA 2OA8A 4NZ7A 1YJWS 3JAMY 4CGHA 2W2MP 2NUUG 3PZPA 5A8WA 1WC4A 2VWBA 1FW6A 4H4KC 2MZ1A 4LF7F 1M5PC 4RJVA 2Q97A 1WSVA 4IBNA 1FNOA 3JSYA 3PG9A 3LDNA 3WEEB 3TEGA 1NZ8A 3AVJA 2OTLN 4YN3B 3PNIA 1IBMF 4QS9A 1W2IA 3CGIA 2CIMA 5BPMA 4ISGA 4WP8A 1HW9A 2V8PA 2R9LA 4HTIA 1MU2A 3HTVA 2WSFC 3VF0B 2XSJA 2A1BA 3R7BB 5KOWA 1XUPO 2QG9B 2YPZA 4CEBA 1QAXA 1NGFA 3ULDA 1K73T 1VQ4S 2FZKB 2HEKA 2OTJS 1SH2A 2E66A 3O3GA 5IOLA 1IJJA 5ETNA 5BRDA 3P4IA 4OZ3A 1C6VA 5DDRC 3LPEA 4EAHD 1GQEA 2W8LA 2CRLA 1SBRA 3BR8A 3MEDB 4NXMJ 3B8HA 4G6VB 3KK3B 4C11A 2LCWA 4DV3F 2QC3A 4NLQA 2V8DA 3T6BA 1HHTP 3FMWA 3CD0A 3NLCA 4K4WA 1RT3B 2F4VF 3RB3A 4WCEQ 3P38A 1XC3A 4B3RF 4X4OA 1RNHA 3WIVA 3K17A 3OQ2A 2BE2B 3DOLB 4WFBL 3BYRA 4CDIA 4PL8A 4Y2CA 4MLHA 4C8LA 3V9SA 3Q22A 2EC0A 2E1ZA 2OZMA 1EZZB 1Z1ZA 4N7TA 3EPIA 4PYAA 1N32J 4DG1A 1ZPWX 5A2QY 2V68A 5H9EJ 2UXCJ 4U8YA 3LAMA 2M7SA 3BEGB 1WNSA 3ADAC 1Q8IA 3ICLA 1UAXA 3U8XA 4HT5A 2XC9A 4DV5K 3F44A 3NY0A 2MY8A 4H4MB 2FJAB 5CZVA 2D3UA 3LTOA 1Q5VA 2VWJA 2E1YA 4WPAA 3TZWA 4KRFA 2AEMA 4CH1A 5AR0A 3THYB 4H5WA 3PACA 4NXNJ 3ZSVA 4DJBA 1DJ0A 2CPXA 2DNLA 2OEJA 3H1VX 2XCPA 1VQ8S 4AILC 3VGMA 4IOBA 1NK8A 4KREA 1R8BA 1FNMA 2XZDB 2ASOA 2XY6A 2G9OA 3L2QA 1F2GA 1JJCB 3AA2A 3RUBL 1LV5A 4NI2A 4YR3A 2Q6BA 3AO4A 3G6ES 4IOAQ 1VSDA 1HBNA 4GVMA 4DR6J 2V7YA 4CFDA 2BZ2A 4AXIA 2QL5B 1FEEA 2F9WA 5I3PA 2KFNA 3AVGA 1XMOJ 1JL1A 1U45A 2PFFB 4M1KA 5F3TA 3UO0A 3WX4A 5F8NA 2BEFA 4GO5X 2ZH3A 1J53A 3OA9A 1AA1B 4DFJA 5CZ1A 3CC4S 2QFIA 3BJYA 4P7VA 1WAFA 4UY85 3UFCX 4JYAK 3CC7S 1HQEA 4XH1A 1NJIO 5B0EA 4RUHA 4C0BA 1Z26A 3H42A 3THXB 5KFNA 1Q1KA 1RZMA 1TAQA 1RT7A 4B3SF 4IO9Q 5E3CA 3LGNA 1J2VA 1ZZNA 1VQON 5LL6Z 4OLOA 1U1QA 2UP1A 1PYSB 4PXCA 4TSXA 2MKCA 3PY8A 4B3MK 3V2UC 2KFYA 1Z6RA 1MROB 2HHHJ 2EFVA 5GIPA 1SUQA 3DI6B 4NA1A 4CZLA 5G0RA 2AJFE 1Q16B 4KH0B 1UL3A 3W3DA 1R0CB 1UVJA 3I8DA 1ITGA 2GZOA 3R5DA 1C4AA 1UZHA 4O23A 4WYWA 3FBFA 2HVIA 4USUA 5AQMA 2AU0A 2HQGA 2VBYA 3US5A 3LWMA 2QSWA 5KFKA 4DV6J 2MB0B 3R6LB 3PIPQ 2KTQA 4CHQA 2P9UA 3VQPA 2KT2A 1ZAWA 1YITN 3KDOA 4I56A 4RCHA 3A3NB 3EJMA 3OYGA 3NE6A 4K25A 4AM7A 1S4EA 2EW9A 3KK7A 3NMUA 4B8AB 1S59A 4MO4A 4KHRA 3I56N 2D7SA 3MECB 4BRPA 1FE4A 1FRJA 3MUTP 5D15A 2F8TA 2BE9B 1HR0F 2UUAK 4NMXA 2ASMA 1UWBA 2ZNZA 1UKUA 4DU8A 3V6KA 1S9GA 4LFAF 1KLNA 1FKPA 2WW4A 3W5XA 4BDPA 1EQMA 2P9PA 1RT6B 4ILRA 3TVZA 2CNKB 1J5OB 3CVKA 4NLCA 2HGNA 4LVOP 3O9TA 3NS5A 3H5SA 4DZDA 3NH0A 8RUCA 4BACA 1WSFA 3VGUA 3ZETA 1YRUA 3M8PB 2XYPB 2YNFB 4I6AA 4CO1A 1NK4A 2B4JA 2EK6A 1OH8A 3OJSA 5DRKA 4DF4A 3ENWA 2NZ4A 2ZQBA 4BRHA 3WQUA 3LUYA 2ZJQL 4R8UA 2HFNA 3O08A 3QT6A 1NPPA 4GV3A 3MXHP 2JEJA 5JVHL 4DWIA 3W63A 4DV2J 4K4ZA 4X66K 2JHEA 2BABA 1RTHB 1FNXH 5GAHI 2PEHA 3PHTA 3M4XA 3TPQA 4J9SA 2WZ1A 2E88A 4DR3J 4J9PA 2GX9A 2Q1NA 1KTQA 2FBXA 4M7XA 2FVCA 4ILMA 2D3ZA 3K9KA 3ZZZA 3P5JA 3J7YP 4Z94A 4CLUA 4YB5A 1IV0A 2DXEA 5IWAJ 2R7VA 2CZ9A 1S6PA 1CULA 5D3GB 3OVBA 4IG3B 4LF5K 4JK9A 4CZHA 1MSWD 4LJMA 3F5TA 4ITSA 1OJ4A 4ZOSA 4RW8A 1N5YB 2O4IA 4URSA 3PUFA 1G99A 2RDJA 4OHVA 3U9ZA 3BZKA 5IM0B 1M5KC 2GVZB 1RU1A 2LEBA 4XK8C 4Y2IA 2YPYA 1JLQB 2VPYB 4PXDA 3R8EA 4M3XA 1ITPA 1YIJN 3K5OA 1RJJA 3SNNA 1NMDA 3T19A 5KT4A 2QWOA 4IZ9A 1AB8A 3UKUB 1VQNS 3GIKA 1KC8T 3QFUA 1YJ9N 3OTEA 2WK4A 2I0XA 1R0AA 2WONB 3C46A 4WQ5C 3SCJE 3NNAA 3LOUA 1R31A 1KOHA 4I0WA 3FBBA 1M5SA 4HDHA 1RDDA 1LWCB 1NU0A 3PR4A 4OX6A 2NNWA 1QVGM 5KAKA 2OANA 4E2FB 5HVGA 1RWVB 3LM9A 1SQFA 4P75A 1VHIA 2VG6B 4LF4K 3OYHA 2ZFHA 4ZN1A 3MR7A 1ZTTA 1KVJA 3PKYA 3VV2B 4RO0A 1RTIB 4FM2A 4M94A 3JSRA 4Y2AA 3MFHA 3Q8UA 1S1UB 2G8HA 3C6AA 2FY8A 4EHUA 1TL7B 5LSOA 2K7JA 2AF6A 3CMQA 2HMIA 2DXDA 2HF3A 4C8KA 1P6TA 1FWPA 2R2UA 1BWFO 2CQ4A 3TAPA 3AOCA 1JNZB 1OQ6A 4JI5J 1IUJA 3R5BA 3KWMA 4QIVA 3QIOA 4L73A 2VQEK 2JRSA 1RDCA 2BX6A 2WB1D 2DD8S 2XYGB 3PW7A 2KT5A 3PTWA 2KRRA 3AJDA 4JI7J 5JLFA 3KLFB 1KP6A 5C12A 3MPWA 1NNDA 5L39A 4WZMA 1RCHA 4DR4J 3THWA 2DEJA 3M5RA 2MKYA 3U1LA 4YOWA 4FVCA 2XWXA 1S4FA 3T5HA 5KFEA 2C2EA 4DCOB 4JD2B 1RK8A 4C0OC 3LAKA 2MJNA 4WP3A 4K0KK 1IJEB 5FPNA 3NGKA 3P4UB 2Q3SA 4NLUA 4CF0A 4AE5A 4J91A 4B3OA 3I6PA 3NS7B 2C2KB 2A10A 1BQMA 1F5CA 2O8EB 4DX6A 2NREA 5KRTA 1CEZA 1CXUA 1Q86O 4J2BA 2PGCA 3W65A 2VWKA 4P74A 5D0RA 2Y8YA 2E5JA 3AVLA 3OR2B 2MLYA 4NZ6A 3M7VA 4OI0A 4O4RA 3SMSA 2VU5A 4NL5A 4P2FA 2OGUA 2V6AA 3ILOA 3UN2A 3HULA 5A8KB 4AHRA 3CERA 1KR4A 3HCXA 2ATCB 3DXMA 1J5EK 4WQ4A 2CJYB 4HTLA 3FZKA 2VBZA 3I82A 3SXLA 5J2PA 4JI4J 4DLEA 4JI0K 3M8RA 1VCTA 1RHJB 3KUEA 5H1SV 3M9OB 1S1WA 4DTNA 4JKDA 2IMWP 3ZZYA 1P1TA 3TZZA 4DCPB 4FO0A 1WC3A 3L4IA 4CGDA 2B9XA 5E3QA 1BG3A 4ZHRA 3K5NA 1Q7YO 3OBWA 4RG8A 3OYIA 3TR8A 3J7Z5 2LXUA 4CJPA 4CO5A 1ZA2B 4JBCA 4N5SA 2JFDA 4DLGA 3AVHA 2A40A 3ET6B 3WEEA 2HAIA 4JI6K 3TSPA 1KD1T 2CGKA 1T3OA 2UXDF 1CG2A 2MDAA 3MF5A 3U3GA 3OFEA 2AZ3A 3P5BP 4UZCA 2H48B 2DFFA 3DFEA 1KBRA 2R7OA 1RA7A 2NXNA 1WI8A 2YWFA 2F4FA 3KLIA 2V69A 5ELZA 3LW5C 4V19J 4HI2A 3AY9A 2G8IA 5CYMB 4ID1A 4QW8A 5EXWA 1PCAA 3HHLD 2AEFA 1E4GT 4ECQA 1MNEA 1K8AT 2MYFA 2DR9A 3IA0A 2E1CA 1WJ9A 2P9EA 4LF6F 4HEA9 5JMVA 5KFXA 4K41A 3QERA 2GGPB 3BKTA 1Y10A 4F2SA 4CT9A 2F8MA 1SKRA 3N9UC 3G71S 4ZVTB 4U8VA 4MKAA 3TP2A 1TV6B 4BRAA 2R7RA 5BR9A 3M3ZA 3SBGA 3EZOA 3EVMA 4LSNB 3KUHA 4ES2A 3FCHA 1LNQA 4OX9J 2BE2A 4O3NA 5EVZA 1NHVA 3DOLA 3ZX0A 4GRSA 3I9V9 3I32A 4F0HA 4H0VB 3PFEA 5ETSA 3LP0A 4IJAA 1WI6A 1HBOB 1MDUB 3DDNA 2OEKA 5CAAA 1VQ5S 2YY3A 2ZDPA 1DQAA 4FLZA 1YK9A 2VDHA 3DHWC 2IBOA 3F73A 4M5DA 2JX2A 4B1ZA 4IRKA 2MY7A 3B82A 3L4QA 4U67Q 3HD1A 1S76D 2FGCA 3V9UA 1RWKB 3RU0A 4K2JA 2HWIA 3QQCD 1MN7A 2Z2ZA 2OPQB 5GINA 2R8JA 4M41A 2BYCA 3NL0A 1BA1A 1W9HA 1YAGA 3F41A 4KR0B 5J2MB 2EBGA 2FLLA 2GBZA 4UTGA 4BY9C 1FHTA 4DV7J 3VOVA 3FC9A 3THYA 1HUXA 5IT9U 1WACA 2EX3A 3TQ1A 3HX9A 3BSCA 4V19S 4LFBJ 4GVBB 4YY3F 2DGTA 4W90B 3L95X 4QAGA 2E6LA 2L41A 2V51B 5CY4A 2BQUA 1U25A 4HCCA 2V0NA 3RZAA 2C3UA 1KONA 1KKHA 4DR5F 4I9QA 1ASWA 4BRGA 2P5GA 2E2PA 1JKHB 2Z2MA 4BBYA 2IVYA 3EWGA 5EHHA 4C98A 2V2ZA 5KG1A 1Y3JA 2OMOA 4ECTA 1TKZB 5E41A 1SPBP 2KXFA 3BF4A 3DRRB 1R8CA 3BZCA 2HNYB 2YWHA 5M2PA 2E2QA 1HHSA 4QWCA 3IUCA 4HVZA 2B6AB 3AVCA 2LQ5A 1SKSA 3ILLA 5M1FA 3S41A 3KJFB 3Q8YA 4FVMA 3THXA 1IH7A 1XMQK 2MKSA 1YJTA 2A41A 2O8BB 4KKOB 1V3SA 4MYUA 2DR7A 2LDIA 3I4HX 3ZSZA 3J81U 4W98A 2HSEB 1VOMA 1QVFM 2LA6A 2VA3A 1NDPA 3IS9B 3H46O 2CPFA 3N0VA 3D2FB 5IT4A 4OL8A 1MROA 1YBUA 2X1BA 1GLDG 4CJ4A 2W41A 1S0MA 1FWLA 3RBZA 5AQXA 3C6UB 4QIGA 1IBKF 2VQFJ 3L2UA 4DTPA 1RYSA 3MCPA 3CJKA 3AA3A 1SV5B 1OY9A 3ISZA 1VDHA 3QRPA 2RRBA 5ETKA 2BE7D 2FBTA 3J80O 2CNNB 3CDWA 5LMNF 3KK2B 5HK4A 4DS5A 4PG6A 1YDLA 4JI8K 4A47A 4BQLA 1FXXA 4E7KA 2AT1B 4ZVSB 2RHQB 4H54A 2VKZG 3FKBA 4JN4A 4YDXA 3OYAA 4ZDNA 2FSNA 3DAWA 1URRA 5T7LA 3ZZUA 4DMNA 1S0OA 4FZYA 3SV4A 4EP5A 3PVXA 1NMEB 5C2CA 3HT3A 2D3OR 1XI1A 3QFPA 3HZEA 2ZM6F 2Q2RA 4XO0A 5L9XA 4ZLPA 3MHYA 4DR1J 4CHPA 4I2PA 2UUCF 3ZSYA 1PJ5A 2ATQA 1RAAB 2HNDB 3I33A 2G8KA 4WQ4C 4CF1A 1FERA 1VAZA 2OEMA 4WKYA 2DY4A 1RT6A 1TUUA 1J5OA 3T1YK 2GO9A 4HVJA 4PR6A 2QGFB 1ZA1B 5FDLB 4LFCJ 2YQ1A 2XM3A 1FWKA 1RWMB 3K5PA 3JSMB 4RWXA 3JAMO 1B0VA 4PWDA 1HKCA 2YNFA 2A5XA 2IDOA 4F3MA 1JX4A 2EK1A 1RGVA 2DH8A 2VOOA 3HXMA 1M90T 1N33J 3EO3A 4AHSA 3QIPB 4YNQA 4UQTA 2KB2A 3DLHA 3VEYA 4QIWD 5H1SQ 3M1VA 2ILZA 1H1VA 4AQYK 1RTHA 4UY8T 1KDNA 3MM8B 3HP6A 2IM2A 3KVGA 5AFUH 1CJKA 3AVAA 5J2QB 2H9ZA 3VF6A 2GCFA 4JV5F 2EPIA 1N0VC 4ED6A 3U9DA 3LANA 2XZWA 1V3RA 4CJ5A 3LDSA 2QWRA 4DR3F 1E6YA 4CH7A 3MR6A 2VODA 2WOMB 3A3OB 3CCJS 1FI4A 3P8BB 2HMPA 4XPCA 3SSQA 1N34K 1REVB 1AZSA 2GJ2A 3NHGA 3VEZA 3JB9k 1QZ5A 4X65F 2O66A 1ZOTA 2MPUA 4ILJA 3MDFA 4EWTA 4IG3A 2MQ8A 1VJWA 3MGJA 5D8HB 4CF9A 3K7RA 4DB3A 3IWNC 3HVTA 1XWLA 1N6QB 3CW2C 1N5YA 3FZBA 3IR5B 2DR6A 3HHLB 1RU2A 4U6PA 5KFVA 2FHKA 2MQPA 2D1CA 2LQ9A 4CK1A 4K2XA 2K8GA 2VGNA 3CMAS 3W9HA 3GLJA 1H38A 1Y4ZB 2HQIA 5M2UA 3OV7A 4ILHA 3RAXA 1FJGJ 3VQDA 2XLIA 1GOBA 1EP4B 3L3CA 1U2VB 3L8BA 3D45A 2GIQA 4TU9A 4E19A 1IR1A 1TFYA 3QJPA 4QW9A 3T9ZA 1WOQA 3BDEA 2J8SA 1VK3A 5F8JA 4DQQA 2YKOA 3NF8A 4KB1A 4IQMA 4JI1F 4CBWA 1YRXA 1U24A 2RE2A 5A2QO 4YHHJ 3HVWA 2WONA 1N36F 6FD1A 1B92A 3CWJA 4LF7K 1LWCA 3ATVA 5KFRA 3NWRA 4FXDA 2PAVA 3C16B 3D9BA 4QBUA 2YKMB 1W2BR 2YVSA 1UMJA 4LY7A 1IBMK 4DFMA 2VG6A 4J5OA 3TA2A 2VPXB 4B9VA 3K5LA 4ZPVR 1IM6A 4PPZA 1MW7A 5KFGA 2AZ1A 3VAIA 3TWHA 3KNGA 1T9VA 1FRHA 1QSSA 5HL7Q 1RTIA 3CULA 4JV1A 1X3NA 3Q83A 4CK2A 4M5GA 4QYRA 2EC2A 1TL7A 2VD3A 5LMUF 3RR7A 2OD4A 2XS5A 3GJSB 2ZVSA 4BVPA 2E44A 4J37A 4G9ZA 1VHFA 1ZAXA 4IOXA 4W92B 3SEOA 3VAHA 4LF8K 3HDSA 3CXCM 1QUVA 4Q0BB 2GV1A 4DV3K 2Z4PA 2WVCA 4O0NA 3MTKA 2K06A 2CJ9A 2B8PA 4RNHA 3SQ0A 4RUBA 4FS1A 4I6YA 2ZWOA 4E3SA 2PMZD 2X6NA 2W2NP 2F4VK 4DR4F 4PQUB 3B6BA 1NK7A 3QB0A 2J4RA 4QU7A 4B3RK 4JD2A 5J2NB 3TUZC 2HVDA 3TTDA 2IHR1 2V63A 3W64A 4BVOA 4OYBA 1S77D 1HNWF 1KHWA 5GADU 4ECRA 5M1OA 3OBIA 1VSEA 4Q2LA 3EDQB 2J76E 1JLEB 2ZD1B 4OX7A 5L1IA 2OELA 1RT4B 4X62F 3J7YU 4ZVGA 2F96A 3HK2A 2A6OA 2IPOB 1RHMB 2NYHA 2FLPA 2O8EA 3ENQA 2CGJA 3ISNC 3R3LA 3OFFA 3MD3A 2CXEA 3T69A 3OTOF 4KFBB 2GWJA 4FWPA 4Y6IA 3PFOA 5IQQA 2W2OP 2PT0A 2QA1A 3OR2A 1RKJA 1HBUB 1VSKA 4WWSA 3GJRB 2Q36A 1REGX 2X78A 1Z4UA 3MM6B 4F8RA 3IM9A 2VG7B 1DBDA 2Q79A 5A8KA 1DHMA 2B4UA 3RTVA 2GHVC 4TYAA 3MUMP 4CEFA 4V1Ak 4RUAA 3CCTA 4ZLLA 2BJ9A 4CIGA 3ZZ0A 5D4NA 3W61A 2G2YA 4IKAA 1YJNS 3O8MA 2P8IA 1BIZA 4ZCIA 1X4BA 1YTYA 2O8CB 4RTFD 2RPIA 5JS1A 5EX5A 1E3MA 1CQNA 4A2BA 2CDQA 4ZVQB 2V4QA 3UQSA 3CCMS 2E4LA 4ID5B 1WUAA 3E01B 1X7VA 2FC9A 1LXJA 1TUYA 4O4GB 1I39A 3NKYA 1Q4RA 5GAEP 4ECZA 5THWA 4DV4F 2DY9A 3ZSQA 1NGDA 4OJGA 3LPTA 4KTZA 4CGGA 3N6MA 5L9NA 3CCEN 3CCSN 2PI4A 1FX2A 2QK9A 2OPRA 4CJQA 3CG7A 4DV0J 3O1WA 4NCGA 1D9AA 3T5KA 2JEFA 3SAFA 3LDPA 1DARA 2P5VA 1EX8A 2J0XA 4DHYA 3L0QA 4B3SK 3BO4A 3HFKA 4QR1A 1Y00A 4DPTA 2XNQA 3QNWB 3P6YC 1CLFA 2KHDA 2OO4A 4DL7A 1VGYA 2GGPA 4A46A 4DL2A 1F0XA 1FTRA 1F2HA 3D3BJ 3V1QA 2B9WA 3MI7X 1K9MT 2VCPA 4Z0UA 1G3OA 2YCHA 1TV6A 1UWAA 2B4PA 1U4BA 1VFJA 4JI2J 3ALYA 4A8MP 1U2RA 2HBRB 2FIUA 3MCSA 1OYDA 4LSNA 1JJ2R 3CQ8A 1WSGA 2EEYA 1XN9A 2DNZA 3SQGB 4QQBA 4D3GA 1DT9A 4MMOA 3D4JA 3HBTA 1HBOA 4OFZA 1VISA 1H6KX 1V4SA 2HIYA 4EGLA 1Q0NA 2ZNYA 1WELA 5FLXY 1GLEG 4F7VA 1KEKA 2GUPA 2QLJB 4JI4K 1TU0B 3W66A 5ETLA 1Q53A 3BQ1A 2G0CA 4KIAA 5D77A 1WSHA 1MN9A 2PYJA 1T03B 2FVRA 2G13A 9ATCB 2MQQA 1VQ9S 2QLFB 3DRXA 2CPHA 3I5AA 4IKFA 2NRHA 4I7FA 1IVZA 2IY5B 4F67A 1RXOB 1S72S 2MXYA 3UN3A 3I9ZA 1IJFB 2VPZB 2X7IA 4HI1A 5AQUA 5J2MA 3FNNA 2ATLA 4FJXA 3EXCX 2QFJA 4ZPDA 4LFAK 2B8QA 3J7ZT 5MLCV 1M1KT 4GVBA 5JUMA 3VQ5A 2IM3A 4DQ8A 4BRCA 3OVAA 2IIHA 1NSKL 1SXLA 5HLFA 3UR0A 3HL8A 1HJRA 4M8LA 4KSEB 3HI0A 2N3OA 2W2PP 3BREA 2IVOA 4BR0A 4TN2A 4DUYJ 2W7OA 2MGZA 1JKHA 2Q43A 1CC7A 1PGZA 5K20B 5LSLA 4CLWA 1DFDA 5B0CA 3MMJA 1TKZA 3JTPA 3MN6A 2ZOGA 1NZAA 2D0PA 3OYMA 3LDOA 3BKFA 3DKDA 5KFDA 2HNYA 1VBYA 1HBMA 4J9OA 2QKBA 3GQCA 5JVGQ 2DRAA 2DRDA 5C0YA 2B6AA 3VEWA 2MMYA 2VJUA 2KI2A 3DLJA 1OMSA 1V5IB 2N3LA 2YKQA 1HQUA 4FOIA 3Q8VA 5BJRA 2O8BA 2GJFA 4KKOA 3MPYA 2K7KA 2LP4A 2EFGA 3G4SS 4ZTJA 5BREA 1HD1A 1ZBSA 1KTVA 3MEGB 3OLBA 3NGDA 3VA3A 5HROB 3J8AA 3IS9A 4H03B 5TKYA 1HL6A 4NYPA 2C2NA 2ZH7A 4E1NA 3E66A 3CEDA 4K4TA 1IG8A 1X4CA 2BW2A 4A8KA 1ZS6A 4ZITA 3C6UA 1UP1A 1WDTA 4E7LA 4ER8A 2JLEA 3SMPA 1C4CA 2UXBF 1HARA 1FRXA 1D3WA 2B4OA 1SV5A 4KTWA 1K1QA 1V3ZA 4JHDB 4HUEA 3D5MA 1HNVA 3RRHA 4DQIA 4L3KA 2D9PA 1T9YA 2VGMA 2HQFA 1NSAA 3WXKA 4X64J 2W40A 2IM1A 2M8DB 3DNCA 1SS6A 4GKJF 5AQIA 3G0ZA 1UTAA 3K5MA 4BR2A 5CABA 1NPRA 3H3NO 1JXBA 3AV9A 1HWIA 4HL9A 2DPIA 4ELUA 4K4YA 1TUGB 2NXCA 5E33A 5HMXA 4ZIVA 3Q89A 2J0WA 5IXUA 1A7GE 2YNIB 4KHPJ 1HNXF 2ZZNA 4FDFA 2CJBA 3LQVA 3CD7A 1URNA 3OXFA 2GELA 2HNDA 2XEXA 4M45A 1WNEA 3V81B 3O3LA 3GMGA 3OVSA 1W7WA 1BCMA 1GTHA 4LBHA 4IUFA 3TABA 3NBPB 3DOMB 1WG1A 4WCEL 1W0HA 3JSMA 2BKPA 5IZHA 3ZZRA 1U1RA 2RUGA 4CFBA 3PYGA 2E7XA 1BU6O 1SC4B 2CQ0A 2WFBA 1NDCA 2OD6A 1QSYA 4FWNA 4TY8B 3I55S 1SJFA 3MOZA 4BC9A 1DRZA 4ETZA 3TSQA 1UCNA 4OZ5A 2NLXA 1W25A 1YX2A 3MM8A 2QWQA 2JLGA 5DLFA 5ETOA 4QS8A 4CJFA 2D69A 5J2QA 1VIOA 3PKMA 4I68A 2MSTA 3KG0A 2PI5A 1X5OA 3WT0A 3EGWB 3E51A 2IC3A 4OZLA 1HNZK 1O51A 3ENHA 3DC2A 2MZSA 1WHYA 2KXNB 1C0GA 4FK2A 2WOMA 1GTEA 3BQ0A 2HRYA 1NB2A 4ZCMA 2DXFA 3E3XA 4OI3A 1REVA 3UI3A 5C7PA 1BUXA 4Y2KA 3NEKA 4FM1A 3O3FA 3CPEA 1EX4A 3CCQN 2VL1A 1N6QA 3UN5A 2JLFA 3QBXA 2YNGB 5AQLA 3IN5A 2VBXA 5AQVA 4UQGA 1WOOA 1D8ZA 2CYYA 1WHXA 4KB7A 3UKRB 2ZC3A 2J9DE 4IOAL 3A8IA 2FVQA 2LEPA 4PQAA 2B5JB 1EP4A 2HZVA 1U2VA 2HFZA 5AQHA 3T41A 3D0PA 1VSJA 1RT2B 4CLYA 4IJNA 5ETQA 4AHTA 1VQLN 3IGNA 3RSEB 2V4JA 1TP7A 4A57A 2OJ3A 1ZXOA 2E6MA 2RN2A 1SJ4P 1T9XA 3R5CA 3DGPB 4DPYA 3Q24A 4HHHA 4YOVA 4NLRA 2FZGB 2E1RA 2CQDA 3KWIA 1IKVB 1BHNA 4B17A 4A48A 3FZFA 3C16A 2HS4A 4OKKA 2YKMA 2EWSA 4IO9L 2HNZB 2RILA 1HKAA 1WAJA 5KG0A 4TU8A 2NUBA 4PXEA 2UXDK 4FF1A 3OR1B 1NO8A 4YOTA 1U6FA 4ZA1A 4KHWA 2ERRA 2CJAA 4RBUA 4JRQA 3FZ2A 2I7NA 2O8DB 1S1XB 3TW0A 1T6CA 4H4OA 3SCKE 4Y00A 3VR1A 3VMFB 3PLAA 4OZ0A 4FJGA 3C7NB 3HKWA 1B64A 1QD1A 4ED7A 2HBQB 4N76A 2C2ZB 3CJQA 1YJWN 1QUPA 2LLZA 2M5YA 2O8FB 3IBCB 3ZXWA 2G8FA 5DS7A 1YTAA 2Q0RA 3CCWA 4NLYA 2MQMA 4LF6K 4OI2A 2RRAA 1WUUA 3ETMA 1WTFA 4N8NA 4OYXA 1DQ9A 1RBOB 3QO9B 2XY5A 4ZVOB 3UWTA 2R8GA 3PIPL 1TK5A 3EMTA 5MLCQ 2CQHA 3VEXA 2DHHA 5I9EB 4PG4A 3TAQA 2CPJA 4DV5J 3TANA 2B43A 4PQUA 2NCKL 3MAAB 2MSSA 4WE1A 5F3ZA 4N56A 1I94F 2FBVA 2B9EA 3CCLS 3ELHA 5J2NA 2CPDA 5K8PA 3W7BA 1A5VA 2QWPA 3HVAA 2FJVA 3NCRA 1BQNB 2ADBA 1H98A 2HVEA 4KO0B 1VQ4N 2J5AA 2OTJN 2I5JA 1JLEA 2ZD1A 3O5BA 5KG3A 2ZH2A 3DXSX 2HQCA 2HHUA 1U04A 2A6MA 4DU4A 5KFWA 1TYQA 3NRBA 2ZOFA 1WEZA 4ELTA 4FJJA 1RACB 2L9WA 2M3DA 4KFBA 2BMBA 4LR7A 4NE9C 2ZDOA 5FRMA 5KFHA 2QYGA 2OCEA 1OPIA 3CDEA 1GLLO 3NXZA 3MM6A 3CO0P 4MT1A 2VG7A 4EYIB 3H1QA 2A2DA 4YHHK 3CJAA 5HATA 1OKJA 2VB6A 4CZEA 2FJEB 3AGRA 1T11A 2HFVA 2EKNA 4OLPA 3K8WA 2L9NA 2WTFA 3OS0A 2OIHA 4CRJA 3QMLA 4J7CA 1WC5A 1H72C 4JYAJ 4BLGA 3L7OA 3CCZA 5B8HA 4FK4A 5KT7A 2CJKA 2U1AA 5L46A 1HPZA 1UAWA 5L38A 4PKHA 3ID6A 1Y0HA 1VQMS 4DR5K 2V52B 4ID5A 2XMAA 1RHUB 1GLAG 1WG4A 4NCBA 3E01A 1ZZFA 1LK5A 4ZLJA 3KG1A 3KJNB 4O4GA 2DKOB 4NMLA 3WUHA 4B3MJ 4NYNA 2BA9A 1KQSM 1Q78A 2RRNA 1L3SA 1KQKA 3MFIA 3KXDA 1QSLA 1SQGA 3MPUB 5FPMA 3NWGA 1OY6A 1VLOA 1DEJA 3DCAA 2A42A 4IG0B 3R2CJ 4E8UA 3DLGB 3KDNA 5HI7A 2FBYA 1BE4A 2BDPA 3CPWR 1YVFA 1VQ8N 3OW2R 3M30B 4LR9A 1GXTA 3BB5A 4E89A 3TJ8A 4FCYA 5DZ6A 3Q8QB 2ASDA 1X5PA 1EJ7L 3G6EN 2G1DA 1OS5A 3VZHA 5J1EA 4KE5A 3Q23A 1FKAF 3CJ0A 2CVIA 4FYWB 5FROA 4ED2A 1VRQC 4PCQA 2E7WA 3CPWM 2IA0A 3OW2M 4ZVUB 1XBWA 2ETJA 1DZ5A 3LP2B 1JCFA 5DDQC 4AL7A 2DNNA 4FBTA 2UUAJ 2I38A 2YWEA 3ZZPA 4HH0A 1U0HA 3SQGA 4LVNP 3CC7N 3IG1A 4LSLB 1ACMB 2SXLA 3G86A 3BSOA 2H65B 2CG8A 4DX7A 2B0GA 3J81j 1YKWA 5LMNK 4JS4A 5T41A 2GC8A 3KHLA 4A61A 4WXWA 2KG0A 2W4PA 2J0SD 1F3FA 5JJBA 3LO3A 3W5ZA 1YG0A 2ZHBA 4HTJA 4BQZA 5KPRA 1SC6A 1Y11A 1T03A 4RL1A 3PEHA 5AZJA 3P49B 2HIQA 5ADZA 5F0XA 1UW4A 1HMVB 4Y0FA 5LOQA 1OIAA 1HWLA 5G4DA 4RU9A 3RW6A 2KHCA 2DISA 2ZM6K 3POTB 5AQJA 3HHLC 1BA0A 4X66J 1TMMA 3G8TA 3TSUA 3V5RA 2UUCK 4DU3A 7AT1B 2AJQA 3PW5A 5KFFA 1N56A 2WVBA 3EZWA 3T5LA 4TLQA 4E0DA 1O13A 1CJUB 1QAYA 3S9HA 2V50A 2VHGA 4FXWA 3RBDA 2XO7A 5KFIA 3QSYB 4CNZA 2QA4S 3NMRA 4H0XB 1E6VB 2M4MA 3CIMA 5F9LA 1N5QA 2Y3YA 3M1FA 5KFPA 3QT7A 2L08A 4DV0K 9RUBA 3RMDA 2MQNA 4F4ZA 2E5IA 2UZAA 4WTOB 1TZ0A 4LF5J 4CLLA 1KOOA 4FLXA 1C0MA 2I2YA 4DUYF 3TYTA 2VICA 2C3MA 2QXFA 1RT1B 4F4AA 1DAXA 4KRWA 5JICA 4JI3J 2QA4G 3VCDA 5CXTA 3I5BA 4H4KA 4P71A 3W3SA 2LVWA 3VQEA 4JV5K 2DTUA 1IM4A 2Q31A 3R1HA 2CQ2A 2V9WA 2WAQD 3GDQA 3OYJA 3OUYB 4DX8H 2FD2A 5F1XA 2VFRA 1VBZA 1I6JA 1ELOA 4BWJA 1N0UA 2DRBA 4LR8A 3D3CJ 1KNZA 4IWVA 2HBYB 1B0PA 4BREA 1CC8A 1JB0C 2HBLA 2HBKA 4X65K 4KI6A 1CJTA 1V5VA 4LF1A 1RKIA 4DFPA 4QIFA 5DO2A 2CGLA 4I4BA 1M5OC 1IBLK 3WQPA 4ILGB 2ZH9A 5BYQA 5DMRA 2NRZA 2J6SA 2KM8C 2XMJA 4X4PA 3RRKA 2MLXA 5HP1B 1LAVA 5C2DA 4LF4J 2UV8G 2OSQA 4UZBA 3CUNA 4CBXA 5DK5A 2HB5A 1B0TA 1U1MA 4JHDA 1TMJA 3KHYA 1TUWA 4NLSA 2MHEA 5GMDA 3M05A 2DIUA 3M32B 4K42A 2V2KA 2IBKA 3AODA 3EKUA 3OL7A 1S99A 4H8KA 2QA2A 4X64F 3EICA 1H74A 3L7UA 4JI1K 4GW6A 1KAYA 1S57A 3R5JB 1Q86T 1L3KA 3FUYA 2BUPA 4P6QA 4DFKA 5LJWA 3C14A 1EQYA 1JLFA 1H2UX 1N36K 2YQ0A 1HWKA 1RE1B 1C1CB 3VWSA 3PO4A 4F2RA 2VQEJ 3D1OA 2DBBA 1EKRA 4DL6A 2G4BA 1UVKA 2VJVA 1JLAA 1HWUA 3IXQA 3MM9B 3BP8A 1SVDA 3BUZB 3MMBB 1Q9XA 3V6DB 3WXLA 4KPYA 3UDVA 2P9SB 3V81A 2ZH6A 1PO6A 5D4OA 3GV7B 4GKKJ 2AP1A 1Q5YA 4K0KJ 3R6GB 2RF2B 1NK5A 3NBPA 3DOMA 1VQNN 2W7PA 5FJ4A 2GEMA 2DJWA 1Q7YT 1XEZA 4P73A 4J9RA 1WEYA 3FFIB 1WLJA 3M2RB 5HMWA 3PX6A 5A0YA 4TY8A 4UOGA 2G2OA 1ZM3A 1U09A 4DR2J 1S0NA 4ZVHA 2APOA 4WIIA 3OHBA 4MIWA 4DUZF 2UVRA 3TX0A 4F4KA 4FPIA 5DM6Q 4ISFA 1X5SA 3FSXA 1NBEB 1RA6A 3TWZA 4FWSA 4GY2B 4OPAA 5BYRA 1X4HA 5F8HA 4EI2A 1J5EJ 2ZE2B 4DQSA 5BRHA 4U67L 4DL5A 4IFVA 4FJ8A 3M6GA 1HNWK 1Y97A 4ZVEA 4CT8A 3T6JA 2NR0A 3KLGA 1ZYQA 4JI0J 2OPPB 1RTJB 4QZVB 1CS4A 3G6XA 1FTCA 1T05B 1R8AA 3Q7CA 1NNEA 1T7PA 1JXVA 5CHIA 1VS3A 4M3ZA 1P8ZA 3CC2N 4ETXA 3OTOK 4ZJOA 2GJIA 3R7SB 2DCUB 4LF2A 5LY3A 3OYDA 4I67A 3ITHA 1S1VA 1Q8KA 4ZJLA 1BDGA 1LWFB 4FYVB 4A5BA 4JI6J 5JMNA 1YTUA 3LZIA 3I5CA 4LRFA 2BOAA 1Q7LB 3EE8A 4K4XA 1MWKA 1Q79A 2RVJA 2NRWA 5B0FA 4MTPA 3C15B 1HNIB 1N88A 3DU5A 2B5JA 3ILIA 2R7UA 2OPSB 1RDUA 3QATA 4RR5A 3O1BA 3A5MC 4W5TA 3ZTRA 5FLXO 4MIAA 4OZNA 4CI6A 1WSIA 5AQTA 1EETB 5GAGP 1U48A 1RBRA 4FWQA 2N4CA 3HLUA 1QLNA 3HJFA 2D74B 4FLWA 3DYAB 2MKKA 1WN7A 1VYAA 1RGIA 4DPWA 2ACYA 1VC5A 3CIPA 3H98A 3KIOA 3KLHA 4DV4K 2AV5A 4CM0A 4B9UA 5IT9Y 2WUSA 3OR1A 2IJFA 4DTJA 5KOXA 2X3GA 1EWRA 1XTZA 1B70B 1VQ6S 2Z57B 4JEPA 4RNNA 4RBTA 2NZCA 4LRBA 3MPVA 5BPLA 4WTYA 2D9OA 1MLAA 2F1FA 2PD1A 1UEUA 4J8FA 3VQ6A 3UE5A 4PUOB 4FJKA 2QLXA 2V8GA 3EXYA 1VBKA 4YB1P 1K1SA 4KJIA 1PILA 2UUBK 2HHWA 3VN5A 4AL6A 2O8FA 3V9ZA 1K44A 2IVNA 4OI1A 2YHAA 1EAYC 4CD3A 3LDLA 3DOKB 2O5DA 4E1JA 4RLEA 3QO9A 4KGXB 2D4WA 2I7PA 2JNJA 2JGUA 3DLKB 1RHQB 4YR0A 2VUGA 2Z58B 4DL3A 4XH5A 4BC2A 4IH7A 4CESA 3MAAA 4Z4EA 4Y3CA 1M0SA 3A8JA 4C3LA 2KO1A 3EL2A 1GX6A 2P9GA 4W5NA 4EFHA 1VI7A 2UU9F 2VG5A 2POKA 2EVZA 2VV5A 1HFEL 3J81Y 1Q82O 3G82B 4Z37A 4CCHA 1C0TA 4LIWA 1SCJB 3HZ6A 4QS7A 4ZTFA 3QNNA 4DSIA 3QGHA 2QTWA 1EARA 3QEIA 2PFUA 3LM2A 4CECA 1Z2ZA 1B7FA 4DQRA 4C23A 1WC6A 1EKSA 2AGPA 3G71N 1OH5A 2I9SA 4KTQA 5H9FK 2OFHX 1RBAA 1R6YA 3EE3A 2JFKA 4MKYA 5HQLA 1NHKL 3EGNA 4DCHA 1IR2A 1U8SA 2PN6A 2PFDA 2IFXA 4DBQA 4P52A 3Q2TC 3MMCB 2HPUA 2RB7A 3AAPA 2FLOA 4LT6A 3J7AP 4DZ6A 5KG6A 4X2BA 3L2WA 1IKXA 4CF2A 3ZNJ1 1B99A 5KFJA 3KJVA 3GCWP 1VQ5N 2YHWA 2MHNA 4KAIA 2NRVA 4BR4A 1XMQJ 1UFLA 2ASPA 3A4TA 1LFWA 4Z4FA 1F6TA 1ICEB 1T94A 2UVVA 4MLEA 2QIFA 4C2MA 2F9JA 2OP5A 1NM2A 4PG8A 3M9MB 4IEEA 5KPZA 3R1XA 1RBTA 1WKKA 3G8SA 1UA0A 5GMEA 1OPZA 5AQZA 4LBPA 4G1IA 1XMBA 3AB4B 2VC1A 4WQ5A 2IDEA 4U96A 1RAEB 1S6UA 2CQBA 5GAEI 2OMLA 4WK1A 4OX8A 1P9YA 3HHNB 5SWMA 3DN9A 4A8QA 2DCLA 1S1TA 1UVLA 5K5MA 1KVBA 3IMQJ 2UYTA 4DTXA 1O8BA 4WXOA 2XS2A 2VF3A 4H5VA 2GQCA 3Q8PB 5CQGA 4KC5A 2DK2A 3PR5B 3OSPA 2HWHA 4LRDA 4CI0B 2Z2YB 1HW8A 3A5NC 1H0HB 1UW9A 4JI8J 3MN7A 3B6OA 4RKUC 3H2UB 5E3PA 1S9EB 3L2RA 1CZAN 1NAQA 4DV1F 2DTJA 3EY1A 3I4PA 3CIZA 2BW7A 3FCWA 4FWKA 1A5XA 4DF8A 4XEIA 3IAS9 5D0EA 2XLKA 5DM7L 2WB4A 4O44B 2MEWA 2UXBK 4CZJA 2AIRB 3K57A 2MZTA 5M1PA 3LP1B 3DLEA 2M9KA 3RAQA 1WG5A 1JCGA 4LSLA 2BXJA 3CJ9A 3KYLA 1TR0A 3T1YJ 4BRMA 5L1LA 3I0SA 3CJ8A 4GKJK 2HQDA 2VFVA 4PKGA 5F9NA 4MDBA 4P7TA 4IDKA 5A76A 5HL7L 3IFRA 4HHTA 1CQMA 1QHTA 1OQ3A 5AQQA 3M2UB 1OYEA 4IOCQ 3O2IA 1HMVA 3IKMA 2GMJA 2D0CA 1VC6A 1K0TA 4R0EA 4KAZA 5MAOA 2IJNA 3QYYA 1UVMA 3DGVA 2RQ4A 3POTA 3D28A 3NOGA 1K0VA 1P9QC 4ICLB 2W2QP 4AQYJ 1HNXK 4LQ3A 2C42A 2ZBRA 1FF2A 4S0MA 3G2XA 4ED0A 3NGUA 2D0AA 4CLSA 2CJXB 2X51A 3N01A 3KHGA 2QLWA 1G6BA 3R97A 2FHJA 4BGAA 4USTA 3GIIA 3NVMA 4NLPA 2RU3A 1I5OB 1BLUA 5K14B 4NASA 3GFZA 2LECA 1E6VA 3L9ZA 4CJSA 1N34J 4C8ZA 2RNEA 5KFBA 1FJCA 2GQQA 3D1HA 4KGKA 4B9QA 1MWQA 3P39A 3MMVA 2X1FA 2B3TB 2YKNA 3GJQB 1RT1A 2R2RA 4J2DA 2AGOA 2LQJA 2FXUA 3CJ7A 4OGCA 1E4FT 2ZKTA 4TQSA 4J9QA 3PSIA 5A6PA 4DMZA 5C42B 2WVDA 1LW2B 1EIYB 1I3AA 3OUYA 3QGIA 2EHGA 3FBCA 4DOZA 1C2PA 2BVZA 3NF6A 3ENOA 2L3MA 5I3UB 4CHZA 3QZ8A 2YKPA 2Z2LA 5BXIA 1K8KB 3R5GA 1ZBFA 4A2AA 2DFHA 3MOJB 2XGQA 5GVQA 4CE9A 4OKJA 4OZJA 4OJ1A 2ABYA 1VQ7S 3UPFA 2A18A 2XG8A 4JV2A 1RYRA 2RD5C 4LF7J 2C1EB 3CQYA 4NCAA 3CM5A 2QT7A 3O4QA 2LMIA 4QCLA 5EGYA 3C19A 4EFAC 4Z4IA 2VDIA 2NYIA 3RGIA 5HP1A 1NBWA 3DU6A 1IBMJ 3CFOA 4M63C 3S01A 2EI5A 3CCVS 2HK2A 2E9RX 1Q8BA 4LREA 1WSRA 1P1LA 3CJBA 1XR6A 3NGIA 5DG8A 3M32A 1WKJA 2AHOB 4URGA 1WF0A 2DPJA 3CCJN 3HP9A 1QM9A 3SCLE 2QL9B 2AJ1A 2Y0SD 2NPFA 1X31C 4CK3A 3BN7A 3VAJA 1MMNA 3BKUA 2JWNA 3ZTOA 4YOXA 4EZ6A 4ZS6A 1BQXA 4EO6A 1NDLA 4EHTA 1IKYA 4CERA 2QYCA 3IM8A 3SCIE 4LF8J 2XCAA 2EFNA 5KI6A 1AROP 1U2FA 2Q3PA 4N47A 4DV3J 1VRUB 2VQEF 1L3VA 4J9LA 1RLDA 4C11B 5AQRA 1JLGA 3TQEA 1GLJO 3CMAN 1R43A 3UD5A 4Y0WA 1M5VC 3P45B 3UNYA 1X5TA 2F4VJ 4ISEA 3V6DA 3OHAA 4ECUA 1KCFA 4B3RJ 4CEEA 2DH9A 4I6MA 2QSFA 3SI8A 1BC6A 1YF5L 3JQKA 1KVCA 4BE1A 3BSNA 5CCMA 4JI3K 4H0OA 2RF2A 2KLAA 2M2BA 4CO3A 3SAGA 3OTCA 3TJAA 3WXJA 1RHKB 2FF3B 3EEQA 4DTOA 4NA2A 2VFTA 3PYDA 4F0MA 4U7BA 3MTJA 3AVMA 4DR7F 1FDDA 3MCNA 3FFIA 1OSDA 5KGXA 1ASVA 3DJCA 5KFQA 1C0UA 3NH2A 1R27B 5B0AA 4DG1B 1C1BB 1ZH5A 5C10A 4QYZK 3HM9A 3MX2A 3TJ9A 4USKA 1W7AA 1Y64A 2F8HA 1KN6A 1U6ZA 3CD6S 2LYVA 4DI6A 2W9AA 3MK6A 3CJ5A 5KFYA 4USIA 5D6GA 1I94K 1DTTB 2FGOA 2BR0A 1UFWA 1LW0B 4KHMA 2GMLA 4RNMA 3OT9A 1J5EF 1G2EA 3SUPA 4MFBA 3UCZP 2LA4A 3KKSA 1IKWB 1YBAA 1RTJA 1TL3B 1XIQA 3VVTA 2CNLB 4IO1A 4CVNE 1JLBB 1T05A 1R0BG 4ID8A 3QEPA 2XMTA 2FJDB 4O8UA 2DGUA 2G2ZA 4JKHA 3BZQA 3MXJA 4FWRA 5E7OB 4O0JA 4JRPA 3K89A 1IO2A 4M5IA 4OHZA 4ALZA 2YI1A 4XH4A 3T3FA 4FF3A 4A62A 3G25A 1GH8A 2KL8A 3FZLA 1V6HA 4MDAA 3E9LA 1WF1A 5FRNA 4OZ1A 4C1NK 5DZ7A 4USHA 2WVFA 3M2VB 3CC2S 4K4UA 2DYAA 5DG9A 3VAGA 1KS2A 3CCUS 1NJWA 3C15A 4KYZA 4R25A 4AYBD 2R8KA 2OPSA 5BR8F 3F0NA 2Y1JA 4ECSA 3TZYA 2R4FA 2D3O1 4CZKA 3FSIA 2E9ZA 3MN9A 1ZBIA 2DFEA 3N4QA 3W5YA 2H5EA 1BL3A 4FZZA 2XWYA 3FZMA 3TOQA 3PW4A 1GMWA 4B3SJ 1BWEA 5JVGL 8ATCB 2F9TA 4GKKK 1GNKA 2W25A 4ED5A 3U3YA 2GHPA 1KHVA 3DYAA 5IS2A 5CD4A 2HHSA 4Y34A 1XJWB 2COLA 2EFQA 3HSCA 2QE5A 2G8VA 1APSA 2L9DA 4J9NA 4LF9F 3OHRA 1NWKA 1ZPVA 1NSPA 4K8RA 3OJUA 2CPEA 1QE1A 4ZCKA 2XGPA 4DR2K 5G0RB 3HSGA 4IRDA 4PUOA 2IMOA 4DL0C 1YJNN 2VC0A 3CDUA 5KGWA 1VBXA 2RAQA 3G87A 2PE8A 4LH5A 2QM1A 2VZ9A 3ETOA 3CCMN 1FO1A 3P96A 4FWMA 4J9MA 2N7CA 4F9OA 3DRSB 2PC6A 2HLTA 4PWWA 5HRNA 3DOKA 3OPKA 3ZO7A 4FJLA 3DLLQ 4F4YA 3NVKA 3BPSP 3AO2A 2E1MC 5ETPA 4BHQA 3Q8RB 3A1YG 3SUNA 3JQMA 4NLVA 4C8OA 2BH1A 2ACMA 3EGZA 1HR0J 1NK6A 3PM9A 2QX0A 1VSHA 4LFAJ 1VQYA 1LWXA 4ZP6A 1HX1A 3SV3A 3G82A 3U6FA 3QBCA 2ZGYA 2XZTB 3BR9A 1S7HA 4W5RA 1Y3KA 4CO0A 3D6TB 3H5UA 1VQSA 4Z4GA 1LFPA 2B7CB 4JKAA 4WIQA 3T1HK 4BE2A 1XC9A 4CZIA 1BI4B 4ZPTR 1YUWA 1YT3A 3ZEUB 1NHUA 2JWLA 1FRIA 3W62A 4O5BA 5L8RC 2G8UA 5EDWA 4WFAQ 4URQU 2IRYA 4FNIA 3AD7C 2XMVA 3MEDA 1YI2S 4FW2A 3VEOA 4NXMF 3QINA 4CJVA