2G8WA

B. halodurans rnase h catalytic domain e188a mutant in complex with ca2+ and rna/dna hybrid
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
KEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGAIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna/dna
molecule keywords 5'-R(P*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 39
structure length 134
sequence length 134
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8wA00
4OJRA 3ZT1A 2HNZA 3OYGA 4N5SA 3V81A 5T7BA 4DG1A 3IAYA 4KREA 5FROA 3TR8A 1Q9YA 2BGGA 3THVA 2FBVA 3TANA 1KFDA 3ISNC 3DOLA 3NF7A 3DLHA 2G8VA 4FZYA 2YHAA 3LP2A 1VSDA 1NK7A 3QEWA 2HHWA 5KGXA 3PO4A 4RW8A 2D0BA 4FLVA 5HP1A 3LAKA 4O0JA 3CG7A 1G15A 4OKEA 3AVGA 1WAFA 3ZT4A 1SKSA 4B9SA 3ZSVA 2OZMA 1RBTA 1RDCA 2Y1IA 1XHZA 4HUEA 3L2WA 1JLCA 1RTJA 3NF8A 4IG3A 3O3FA 5I3UA 1U48A 3ASMA 4B9VA 1BI4A 1EKEA 3AVIA 1IKWA 3AA5X 4CJ3A 3P5JA 2A1RA 1RILA 3V9ZA 2HMIA 3D45A 1T03A 1YTAA 2X74A 4CGHA 4J2DA 4YNQA 4KHSA 4OKKA 4DSIA 5HLFA 3OYFA 4ID1A 2IOCA 4CFAA 4ELVA 3DRRA 4FW2A 4BE2A 4KHNA 1HNIA 1UWBA 4G1QA 2I5JA 5FDLA 4DTPA 4KI6A 2IAJA 2YNHA 1LAVA 4CEAA 3MAQA 4KO0A 3RMDA 1KFSA 4B9LA 3OYDA 2Z1HA 2X6NA 1TK8A 2FBTA 1NKBA 4DQSA 1K6YA 4FZXC 1RT7A 1KVCA 5CYMA 3M8RA 1XI1A 3ALYA 3NE6A 1S1XA 5HRPA 2EHGA 3V1QA 4C8NA 4E7JA 1QE1A 3AVCA 3RR8A 4AHRA 1UOCA 4KTZA 3HXMA 4FK4A 1TV6A 2D5RA 4I7FA 1XHXA 4E1NA 3HVRA 2HW3A 1EP4A 4BACA 5J2MA 4CJUA 3ZSWA 3RRHA 4OKJA 3MEDA 4FCYA 1D9FA 4KI4A 4LD0A 3SV3A 4CJ5A 1KVAA 4DU4A 1NK5A 2G8KA 1IKYA 2BDPA 4CEQA 2HHXA 4WE1A 1GOAA 1RT4A 1TKXA 2E4LA 3ZT3A 4F2RA 4Q0BA 3A2FA 2RF2A 2RKIA 1HJRA 2F96A 4ICLA 2XO7A 1VSKA 3V4IA 4CEFA 3OYBA 2HHVA 5J2NA 4I9LA 1JLBA 2P5GA 4E7IA 4M3XA 1BCMA 4EZ9A 1NJYA 1FKOA 1W0HA 2HB5A 1REVA 4ZHRA 1T7PA 3I0RA 1C0UA 1S9EA 3LDSA 4M3ZA 1N5YA 4H4OA 1J54A 2VG6A 3AA3A 3AO1A 3AVMA 1RBRA 1RTHA 3KLFA 4Z4GA 4HUGA 4C8MA 5KGWA 4EZ6A 2DY4A 1KLMA 1L3VA 4CJWA 4CFCA 3DRPA 3VQ4A 2QKBA 3SNNA 2HVIA 1HRHA 3SUOA 3KLGA 3TAPA 1XC9A 3KLIA 1TL3A 1MU2A 4FLYA 2YNFA 3WNEA 1ITGA 3KKSA 4DQRA 1WAJA 1HYZA 3HVTA 3KK2A 4DS4A 4W5TA 4JS4A 3QNNA 4FK2A 5FRNA 1ZBLA 3VQ7A 4EP4A 3OS1A 4CEZA 4H4MA 3WNGA 4CF2A 1HPZA 4PY5A 4Y1DA 4DFJA 1TKTA 1BI4B 3S9HA 1IH7A 5KRTA 1SL2A 1RDDA 1DTTA 2DFFA 3S3MA 2FBXA 4FJIA 4CERA 1JLEA 3O3HA 3CQ8A 4HTUA 1RTDA 4CGJA 1TK5A 1Q8IA 3MEGA 4KHQA 1IG9A 4K8XA 4DTXA 3JSMA 3VA0A 5SZTA 1A5WA 4B8CA 4FYDA 1Z26A 3OYAA 1TAUA 3O4NA 1T8EA 2KFZA 3AA4A 2IGIA 2Q3SA 3PV8A 1UA0A 3NF9A 1KRPA 2W42A 3SPYA 3JYTA 1BISA 3K5LA 2F8SA 1ASVA 3DI6A 5CZ2A 3ZT2A 3OYKA 3S3OA 2DFHA 3KLEA 3K2PA 4KHYA 1QSYA 3VQ9A 4CJQA 4W5NA 4ELTA 1VSIA 4R5PA 3OYCA 3VQAA 4CECA 4E7LA 1KLNA 1QSLA 5KRSA 1VSMA 3KK1A 1NK8A 1D5AA 2DTUA 4CIFA 4L8RB 4F3OA 1C0MA 3VN5A 4N47A 3SI6A 4FJ9A 1WNSA 1ZBHA 1JXBA 1JLQA 3T1AA 1C6VA 1EX4A 3P1GA 4ZTJA 3HPHA 3KK3A 3HM9A 2FBYA 4KFBA 3ZCMA 3LP0A 2OZSA 4CK1A 3HL8A 2P1JA 4BWMA 4CJLA 3SV4A 1A5VA 4CGGA 3MXMA 4YFUA 4CGDA 3HP9A 3TAMA 4LY7A 3NGZA 3TAEA 4E0DA 4DWIA 1ASWA 1S1WA 4B8AB 3HT3A 3V6DA 1NJWA 2QKKA 3LP1A 2XRIA 3KJVA 3VA3A 2B5JA 1LWCA 1QQCA 4CE9A 4OGEA 3DLEA 3MECA 4DTOA 2OPSA 2GV9A 3OY9A 1JLFA 4CK3A 4IFVA 4IDKA 4CJ4A 1CLQA 3AVFA 4CHZA 4OVLA 5C42A 4LH4A 3CYMA 1C1AA 4Z4HA 3EZ5A 3C95A 4NCBA 2YKMA 4B3OA 3OYIA 4DTRA 3QEIA 3VQEA 2HHSA 1YTUA 4F2SA 4IG0A 4DF4A 4FJHA 3P83D 4N56A 4DFKA 1RTIA 3PUFA 4CEEA 2XY5A 4CESA 3NH2A 1RT3A 4FJ8A 1RT1A 2QXFA 1VRUA 3DLKA 3O4QA 4PA1A 5DK5A 4Z4FA 4W5RA 3QESA 1S9GA 4AHSA 1S6QA 2Z1JA 2D0AA 3LP3A 4CHPA 4FLTA 1NK6A 1LWFA 4DTJA 4E19A 4Q5VA 3OYLA 4DSFA 3PX0A 1I39A 3KTQA 3AO3A 3CFRA 1KSPA 4TSXA 1LW0A 1KVBA 2HNDA 2ZQBA 3NDKA 3AA2A 3K5MA 4O5BA 1WSGA 4CF0A 1ZBUA 5HRRA 3SJJA 1T05A 1J9AA 4DU3A 1SUQA 4OLAA 1QHTA 3ZSXA 3ULDA 2Z1GA 4M3WA 4F3TA 4IFYA 2KW4A 3NBPA 1HYSA 3RR7A 4FJMA 3QEVA 4HVJA 4FW1A 4QCLA 5J1EA 1YT3A 4CF1A 2YNIA 5JS2A 3OYNA 4DQQA 4CHOA 1WSEA 3RMCA 2JLEA 3SQ0A 1X9SA 4C8KA 3L3UA 4AHTA 4CJTA 4JRQA 3DLBA 2YNGA 1O1WA 3V1OA 3RMBA 1L3SA 3AVAA 4B9UA 3DMJA 5HRNA 4M3UA 2HVHA 4HHTA 1JKHA 3K59A 3F9KA 2G8UA 2OYQA 4N76A 4F8RA 4RW6A 3SUNA 2KZZA 3AVHA 4CF8A 4AHCA 4DLGA 4CJFA 3VQ6A 3SZ2A 3G0ZA 4O55A 1RDAA 2BE2A 4EP5A 1BIZA 4E3SA 4DFMA 3TAQA 1SL1A 2PYJA 4LSLA 1WLJA 4RG8A 4CEDA 1TKDA 1RBSA 5HRSA 1ZBIA 4DU1A 4DMNA 1TGOA 3KKRA 3U6FA 1LV5A 4BDPA 4M41A 4KV8A 1I3AA 2RN2A 4DFPA 4JS5A 2PZSA 1NKCA 4M45A 3M8QA 3VQBA 3V9SA 1QS4A 3VQ8A 1SKRA 4FXDA 4Z0UA 4CGIA 2PY5A 4FJ5A 3NGIA 3NAEA 4QOZB 3L3VA 1S6PA 1UAXA 3OYHA 4DTMA 3L2RA 4BE1A 2OPPA 3AV9A 1RNHA 4FM1A 3S3NA 3AVJA 4ZTFA 1X9MA 4I9QA 1HMVA 3IG1A 1FK9A 1D8YA 1WSHA 3DLRA 4RW9A 2ETJA 4ID5A 1B9FA 2NUBA 4OGCA 4DS5A 2VWJA 3QETA 4O0IA 2X6SA 3C6TA 4E7HA 2G8WA 1VSHA 4IKFA 1B92A 4NCAA 3DRSA 4M42A 4OLBA 2AJQA 4BDYA 2ITGA 2P5OA 3MXIA 2KTQA 1XWLA 4OPJA 1VSFA 1LW2A 4CEBA 3BDPA 3ZSQA 4E89A 1R0AA 3TARA 1RCHA 3I0SA 4Y1CA 4DSLA 4FK0A 3LALA 3V9XA 2GBZA 1C1BA 4RW4A 3LAMA 2VG7A 4CF9A 4CHQA 5I42A 4FVMA 2HHUA 3F73A 4K8ZA 1HNVA 3RTVA 3VQPA 3VQDA 3NHGA 1QTMA 4FJNA 4KB0A 1X9WA 3I8DA 1TK0A 4CHNA 1WSIA 3AO5A 3HPOA 4J2EA 4PWDA 1RBUA 1Q9XA 3E01A 4LH5A 4O4GA 2B6AA 3VQQA 5CYQA 5J2QA 1CXUA 3OS0A 3HSTB 3AO4A 2VG5A 1S5JA 1KTQA 3AO2A 3ZT0A 4CHYA 1RT6A 3NFAA 1ZYQA 1VSLA 3QIPA 4J2BA 1U4BA 3HP6A 3WNHA 3V1RA 3AVLA 3L2UA 3BGRA 3G10A 4KKOA 1BL3A 2A1SA 3U3GA 4CFBA 3QERA 3OJSA 2XY7A 3C94A 1RT2A 3SPZA 2KFNA 1BQNA 2E6MA 1L3TA 4DSKA 1NK4A 2HNYA 3ZSZA 2HHQA 1F21A 1JLGA 3SUPA 4Z4IA 4FM0A 3K5NA 1C0TA 1CXQA 2OPQA 4CJKA 4KHWA 2O4IA 4DLEA 4OPKA 1U45A 4HUFA 1JL1A 3ZSYA 4FLUA 3EYZA 4XIUA 4O44A 2D0CA 3KD5E 4RW7A 3CM6A 3SQ2A 5HROA 4M3RA 3D0PA 1S1VA 2Z1IA 4KTWA 5E41A 4DTNA 4KAZA 4DF8A 2B4JA 4CJSA 3HO1A 3QIOA 4CJPA 4F4KA 3NGYA 1FXXA 1BCOA 4CK2A 4CCHA 2XY8A 5HBMA 4AH9A 3UIQA 4FJJA 1EETA 1LWEA 2G8FA 2ZD1A 1VK0A 1WSFA 1S1UA 2FC0A 3DYAA 3PX4A 3RWUA 2O4GA 1RT5A 3LZJA 1YVUA 1QSSA 4UQGA 3RMAA 4B9TA 3B6PA 2YHBA 1U47A 4B9MA 2WONA 2XY6A 2RPIA 4Z4EA 3MXJA 3DLGA 4LSNA 1BIUA 1TL1A 2DFEA 3TWHA 1UA1A 4FJGA 3HK2A 3HJFA 3L2QA 1N6QA 4DQPA 1TKZA 4N41A 1FKPA 4JLHA 5KI6A 5KTQA 3OYMA 3IRXA 2GUIA 4JRPA 1U04A 1TVRA 5SWMA 3HYFA 1U49A 3V9UA 3QEXA 4PQUA 2YKNA 2YV0X 3SQ1A 4FZZA 3QLHA 2X78A 3C6UA 4NYFA 1CZ9A 4BDZA 4I2QA 4FLXA 2JGUA 4HCBA 1SKWA 1NOZA 1W9HA 1SV5A 4FJ7A 3WNFA 3H08A 3EY1A 4AILC 1RBVA 3KIOA 2G8IA 4CJVA 3OYEA 2G8HA 1CZBA 3LPTA 4CIEA 5CY4A 5EU7A 4C8OA 1GOCA 2HHTA 3L2VA 3QO9A 1IKXA 4IBNA 4KHUA 3T19A 3OJUA 4KRFA 2IC3A 4M3YA 5JS1A 3ZSRA 4MFBA 3LWMA 4FM2A 2IS3A 3M8SA 2Y1JA 1X1PA 4KB1A 1IKVA 1LAWA 2ATQA 2OPRA 4CJRA 4MQ3A 2VWKA 3TAGA 3SQ4A 4HCCA 4J2AA 2KZMA 4GW6A 3NCIA 1L5UA 3PX6A 5FRMA 4E1MA 2R7YA 4CJEA 3CM5A 3PY8A 2IDOA 4BWJA 4GVMA 4AHUA 4I2PA 2QK9A 2P51A 5CZ1A 3LZIA 4E7KA 4FJKA 5D3GA 5J2PA 5DMRA 1NKEA 3IS9A 4PUOA 3NF6A 4Z4CA 1J53A 4FLZA 4FJLA 1NK9A 2XHBA 3VQCA 1SL0A 1RDBA 1NOYA 3CFOA 2KQ2A 3DOKA 4CEOA 1NJXA 3AVNA 4DTUA 3SUQA 4FJXA 1VRTA 1IO2A 2WOMA 3OS2A 4W5OA 3HPGA 3SYZA 3NH1A 1B9DA 4B08A 3QEPA 1HQUA 3M8PA 5C25A 4ELUA 1JXEA 2ZE2A 1BHLA 3LWLA 1VSJA 1J5OA 3QINA 3FFIA 3TI0A 1L3UA 2OA8A 3RRGA 1JL2A 4M3TA 4DSEA 3KLHA 1S1TA 4CFDA 1C1CA 5K14A 3QNOA 3PO5A 3OVNA 3SCXA 1HQEA 3MEEA 1ASUA 3AVKA 1VSEA 4DQIA 3LANA 4NCGA 1TAQA 1NK0A 4CGFA 4AHVA 1BGXT 1BQMA 1GOBA 1Z25A 4KTQA 2E6LA 4C8LA 3ITHA 2LSNA 4H8KA 1DTQA 3KD1E 3VQ5A 1A5XA 1WSJA 4BE0A 4KPYA 3TAFA 3V9WA 4B9NA 1EXQA 1KCFA 1HYVA 2PYLA 3CFPA 5C24A 3K5OA 3L8BA 3AVBA 4FLWA 1Y97A 1D9DA 3U3YA 3ZSOA 1ZBFA 4W5QA 1JLAA 4DTSA 2F8TA 3K58A 3DM2A 1DLOA 1WN7A 4CIGA 4DSJA 1NJZA 3OYJA 4QAGA 3NH0A 2BANA 3LPUA 4NYNA 4GMJB 3O3GA 3T3FA 3TABA 3K57A 2EX3A 3B6OA
chains in the Genus database with same CATH superfamily
4H5TA 2HNZA 1Q9YA 4B1XB 2NRXA 3R8EA 1KFDA 3DLHA 3QEWA 2YHXA 2FLOA 2D0BA 5HP1A 3A5MC 2O8EA 4OKEA 3G6EN 1SKSA 1ZXOA 1EQYA 3UKUB 1XHZA 3L2WA 3O3FA 3WXMB 1U48A 1EKEA 1IKWA 3NMUA 4CJ3A 4DV3K 2HF3A 3E9PA 4CGHA 4KHSA 4DSIA 5HLFA 3OYFA 4ID1A 3DRRA 2PBDA 1R59O 4BRIA 2I5JA 2IAJA 4LF4K 1KFSA 2QWPA 3CMEN 3OYDA 1K6YA 1RT7A 3ZYYX 1KVCA 3ALYA 4GV6A 3DJCA 4E7JA 4C8NA 3M6GA 4JN4A 5AQWA 3RR8A 4FWLA 1VQ4N 1UOCA 3HXMA 3VTIA 4FK4A 1TV6A 2HW3A 4I7FA 1XHXA 1NMNA 2BDPA 1GOAA 2E4LA 3L0QA 4F2RA 3A2FA 4ICLA 3K9JA 1VSKA 3OYBA 1JLBA 5GINA 4E7IA 1BCMA 1NJYA 1T7PA 1NGHA 2HOEA 2UYTA 3CHWA 2Q0UA 2QWLA 2VG6A 3AA3A 5BPLA 4DR7K 4HUGA 4EZ6A 5KGWA 3DRPA 3SNNA 1HRHA 3TAPA 5M1QA 2YNFA 1WAJA 1HYZA 3HVTA 4JKEA 5JVHL 4JS4A 3DAWA 2ASOA 2NRWA 3QNNA 5FRNA 4H4MA 5BRFA 4PY5A 1BI4B 1SL2A 2J4RA 4OO1J 1RDDA 2DFFA 1JLEA 4PKIA 1Q8IA 1U6ZA 4KHQA 4DTXA 3RVCA 4JKCA 5AQNA 2QWQA 1T8EA 2KFZA 3O1WA 2Q3SA 3NF9A 1KRPA 3RSEB 1BISA 4NB4A 4DKWA 3K5LA 3DI6A 3S3OA 1W2BM 5C0YA 2P9LA 4NLBA 1XNRK 4R5PA 4E7LA 4CECA 1NK8A 5F1XA 3VF6A 3QDKA 4FJ9A 1YJ9N 2O8CA 1C6VA 4CZEA 3J80O 1EX4A 2Q0RA 3HPHA 2RE2A 4KFBA 2P1JA 2IVOA 4YFUA 1CZAN 4LFAK 1ASWA 3J7AP 4DR3K 4WQ4C 4CJ7A 4DTOA 4X66K 3K9KA 4CK3A 4IFVA 2E2PA 4CHZA 3TSQA 3C95A 3QMLA 4NCBA 2YKMA 4DUYK 2FSJA 4JI4K 3OYIA 1GLDG 1OH8A 1YTUA 3THXB 5FPEA 4FJHA 3P83D 4N56A 5AJ3K 3PUFA 4CESA 1RT3A 1VRUA 2GX9A 3LDPA 1WBDA 3QESA 2Z1JA 1NLVA 4DTJA 4E19A 4DSFA 3KTQA 3AO3A 3CFRA 2ZQBA 2KLAA 2CH5A 4O5BA 3BY5A 4DV1K 1SUQA 2YHWA 2E2OA 2V52B 1QHTA 3ULDA 4IFYA 3NBPA 4FJMA 4HVJA 5J1EA 3N4QA 3RMCA 1NK9A 4O8KA 4F2SA 3A5LC 2JLEA 3C7NB 4C8KA 1IBKK 3GG4A 3DLBA 3RMBA 5EY4A 4B9UA 3MK6A 4IO8A 1WUAA 4C1NI 4JD2B 4JKFA 4WQ4A 4N76A 4Y0WA 3D7EO 1BU6O 3AVHA 4AHCA 3VQ6A 1RDAA 4DFMA 1RFQA 5BPNA 1WLJA 1NM1A 2JWLA 1RBSA 3VEWA 4FWPA 4M41A 4JS5A 2PZSA 3V9SA 1SKRA 3VQ8A 4CGIA 3KK7A 3H1VX 3NGIA 1BG3A 4QOZB 1KXPA 1S6PA 4BVPA 4B1WB 5AQXA 5C10A 3S3NA 4A5AA 2QM1A 1HMVA 3IG1A 1FK9A 3SBTA 2A6AA 1D8YA 2QEXN 2ETJA 4LC9B 4O0IA 3C6TA 1MWMA 3MN5A 1FJGK 4M42A 2AJQA 5KPTA 2E88A 3D2EB 5AQLA 4OPJA 3EEQA 4ISFA 1VSFA 1HKBA 1T6DA 1VQ8N 1RCHA 4BVOA 3HM8A 4DB3A 1SAZA 1VQ9N 3V9XA 4CHQA 1C1BA 4CF9A 3SAGA 5I42A 4WFAL 4NXNK 1K9MO 1HNVA 1OH5A 3VQPA 3NHGA 1QTMA 1E4GT 3I8DA 1VQMN 4KBOA 4LH5A 3HI0A 2BH1A 3VESA 3PIOL 3UKRB 3AO4A 1GLJO 1S5JA 1RT6A 2GTDA 3NFAA 3QBXA 4PL8A 3VF4A 4DQ8A 3AVLA 3BGRA 4KKOA 5JICA 3C94A 1RT2A 3SPZA 2KFNA 4KH5A 1C0FA 3O80A 3K5NA 1W97L 2O8DA 4KHWA 3SJHA 4OPKA 1GLLO 3ENOA 2FF6A 4XIUA 2HHHK 4BROA 3ZETB 3WXIA 2QXLA 2NRHA 4RW7A 4M3RA 2Z1IA 5E41A 1U2VA 1QZ6A 3ULEB 3HO1A 3SK3A 3QIOA 3NGYA 4MDBA 4BRAA 1NMDA 2UUBK 3VENA 2G8FA 1VK0A 1XQSC 3WXLA 4A2BA 2E1ZA 1RT5A 4IEIA 4B9TA 2E2NA 5E26A 2XY6A 1S72N 4YOWA 1UA1A 1TL1A 4WF9L 3L2QA 1NU0A 4CBWA 2O8BB 1TVRA 3DXMB 5SWMA 2YKNA 2X78A 4NYFA 4FLXA 4FJ7A 4BRFA 2QW9A 3WNFA 3O9RA 1RBVA 3OYEA 3LPTA 5CY4A 4FWOA 5M1PA 5H1SQ 3P31A 4KHUA 3T19A 2IC3A 1D4XA 5JS1A 3ZSRA 3UB5A 4KB1A 5JMVA 4MQ3A 2VWKA 1SQKA 3NCIA 3PX6A 3FGUA 1YUWA 3CM5A 5AFUH 1XMQK 2QK9A 5B8HA 4Z4CA 3UKUA 4JK7A 3VQCA 3DOKA 3VERA 3SUQA 1IO2A 3OS2A 3L4QA 4GV9A 1VQ6N 4HTLA 1B9DA 4B08A 2V7YA 3M8PA 4M63C 5KQ8A 1BHLA 2VQFK 2UUAK 3H6EA 5TKWA 4DSEA 4MLHA 4CFDA 3CCQN 3MEEA 5GIPA 4CGFA 4H5WA 1BQMA 1GOBA 5CE3A 4B1YB 4WYBA 1TUUA 4KH4A 4H8KA 1DTQA 3KD1E 3EKSA 1JJ2M 1A5XA 1HX1A 4BE0A 4KPYA 3WQTA 3V9WA 5AQQA 3CFPA 3AVBA 1D9DA 4V19S 1NGGA 3DM2A 1QVFM 3D2FB 3A5NC 3CCSN 4H0OA 4DR2K 4B3TK 1IV0A 1WOQA 4OJRA 3OYGA 5TKYA 2ZGYA 4BR4A 3TR8A 2BGGA 1NGEA 3TANA 4MO5A 3NF7A 4H0TB 1O13A 3PO4A 4O0JA 3CG7A 1G15A 2VWBA 3EL2A 1WAFA 3EE9A 4FWSA 3ZSVA 1RBTA 2Y1IA 4HUEA 1JLCA 5GADP 1BI4A 3AVIA 2A1RA 3P5JA 4BR7A 3T69A 1T03A 5EXWA 4FSVA 2X74A 2IOCA 4FW2A 4BE2A 1HNIA 2E1YA 4G1QA 4XH5A 2YNHA 3HRGA 4KO0A 3RMDA 4UY8O 5ADXH 1HKGA 2P9SB 4JI2K 2Z1HA 2X6NA 3RSEA 1T6CA 3O6WA 5CYMA 2GWKA 4O8UA 1XI1A 3NE6A 3V1QA 1QE1A 4AHRA 3HVRA 5HL7L 3ZSWA 3RRHA 4OKJA 1JCEA 4B3RK 1D9FA 4LD0A 2QWOA 1ILYA 4DU4A 3QBWA 4BGAA 1NK5A 2G8KA 3ZT3A 3C6AA 4BRLA 4EZ9A 2HB5A 1REVA 2IIRA 3I0RA 4KHPK 2A42A 1N5YA 4B3MK 4H4OA 1J54A 3AVMA 4IJAA 1J5EK 2DY4A 3M3ZA 1OH6A 1KLMA 4CJWA 3KLGA 1XC9A 4JI8K 3KLIA 3TTCA 3OW2M 4YOVA 1T3VA 1ITGA 3THXA 3KK2A 4DS4A 4JHDA 4RWTA 4JI1K 3VQ7A 4CEZA 2BUPA 4Y1DA 3BZCA 2F7TA 3TSPA 3S9HA 1IH7A 5KRTA 3S3MA 1I94K 4FJIA 1HNXK 3JXUA 5AQMA 4JKHA 1IG9A 3VA0A 1BA1A 1ESVA 3OYAA 2IVPA 3PV8A 5BN9A 1EWRA 5IWAK 2W42A 3JYTA 4G9ZA 5LJVA 1ASVA 5CZ2A 1EO1A 4GVEA 4JEPA 1QSYA 4CJQA 4JK9A 3OYCA 1VSMA 1ATNA 1D5AA 4CIFA 3VN5A 1XUPO 4N47A 1YIJN 1JXBA 1JLQA 1NJIO 4JD2A 3KK3A 2OZSA 3O9SA 3ZCMA 3JAMO 4CK1A 3HL8A 4CJLA 3SV4A 1A5VA 3M1FA 5KQDA 5GAEP 4CVNE 3NGZA 3AARA 5E84A 3OTOK 1NJWA 2F9TA 3LP1A 2XRIA 3KJVA 2B5JA 4CE9A 1VQKN 4YHHK 3J7ZO 1IG8A 2OANA 2OPSA 3O8MA 1JLFA 1CLQA 3AVFA 5C42A 4OVLA 3THYA 3CYMA 4BRCA 1C1AA 1E3MA 4Z4HA 3FZKA 1NGAA 5JLHA 3QEIA 4JI6K 5DM6L 4OPAA 3U8XA 3I33A 4CZIA 4DFKA 3AGRA 2W40A 5AQTA 2QXFA 2FF3B 4FOIA 5DK5A 3KWGA 4W5RA 2UU9K 1RDUA 1S6QA 3LP3A 4CHPA 4BC4A 1NK6A 1VAZA 3S41A 3CJAA 4Q5VA 1I39A 2NRVA 4A57A 4TSXA 3AA2A 2KKZA 5HRRA 4DU3A 3R6MA 4BR9A 3ZSXA 4M3WA 4HWIA 4NXMK 1HYSA 2E8AA 4BR5A 4FW1A 4ISEA 2QI2A 3OYNA 1WSEA 1X9SA 1M1KO 3L3UA 3MN7A 3VEZA 4AHTA 4CJTA 2YNGA 4IFEA 3CPEA 3V1OA 3ZX0A 2P9UB 3UKRA 1JKHA 4JI3K 3K59A 2G8UA 1NGDA 3TPQA 3BF1A 3LDNA 3SMPA 2KZZA 5AQPA 4BC3A 4CJFA 4LF5K 4E3SA 4MDAA 4RG8A 4CEDA 1TKDA 4BRPA 4DU1A 4AM6A 1I3AA 4DFPA 3TSUA 4BRKA 2P9NB 2PY5A 1ZC6A 1YVNA 4CZGA 5C12A 1OKJA 3ZETA 1UAXA 3OYHA 4DTMA 5GAGP 3L2RA 4BE1A 1RNHA 1G99A 3N4PA 4LFBK 1X9MA 1WSHA 3GL1A 1SS6A 3A0IX 4RW9A 1B9FA 2NUBA 4H0XB 3FR0A 3QETA 2G8WA 1VSHA 1B92A 4NCAA 1OVQA 4BC2A 3H46O 3QFUA 3MXIA 2KTQA 1LCUA 1LW2A 4CEBA 3BDPA 4E89A 4JNEA 3EN9A 1YITN 3CCLN 5M1NA 4DSLA 4FK0A 5AQUA 4FVMA 2HHUA 3MCPA 4IOAL 2O8BA 2UXBK 5HOOA 4DV7K 3DXMA 3EKUA 1WSIA 3AO5A 2A5XA 4PWDA 3CJ7A 1Q9XA 2B6AA 1KC8O 4JK8A 5CYQA 3OS0A 2Q1NA 2YX6A 1KTQA 1ZYQA 3LDQA 1VQPN 1VSLA 3T7ZA 1M90O 3WNHA 3V1RA 2A41A 2OCEA 3E9LA 2E6MA 3GBTA 1L3TA 1FW6A 3ZSZA 4Z4IA 4FM0A 1DKGD 2NNWA 2OPQA 3ZX2A 4BG8A 4BQZA 1U45A 1JL1A 3DLLL 3EYZA 2A40A 2D0CA 3KD5E 1S1VA 4KTWA 4CJSA 4F4KA 1FXXA 1BCOA 4CK2A 1TUYA 4AH9A 2ZD1A 3PX4A 4BR0A 5LY3A 5C15A 3RMAA 4YOUA 5I9EB 3B6PA 4BRMA 5LMNK 3CC2N 4DUZK 2WONA 2NLXA 4LSNA 3DLGA 3VEYA 3HJFA 4N41A 1TKZA 5KI6A 3IRXA 5AQGA 1U04A 4XH4A 4IWVA 1U49A 2P9PB 2YV0X 2GWJA 3SQ1A 3QLHA 3C6UA 1TYQB 4HCBA 2JGUA 3SAFA 3BEXA 1QZ5A 3EY1A 1BA0A 2G8IA 2D1KA 1CZBA 3D2FA 5F0XA 4C8OA 1GOCA 2HHTA 3L2VA 1IKXA 3BZKA 4M3YA 3J7YP 3VEXA 2O8FB 3PSIA 2IS3A 3MN9A 2Y1JA 2OPRA 3WEEB 3R1XA 4CZHA 4J2AA 2KZMA 4GW6A 1L5UA 5FRMA 3MWTA 4IOXA 5BPMA 4CJEA 1T44A 2IDOA 4JKGB 4I2PA 1K8AO 5D3GA 4BGBA 2PFUA 3IS9A 2Q2RA 1KAYA 4BRNA 4FLZA 2JWKA 4WQ5C 3CCUN 1HNWK 1P8ZA 5FPDA 5FPMA 1YXQA 1W7AA 1NNEA 1VRTA 2UXCK 4W5OA 3HPGA 3NH1A 1BO5O 3AAPA 1HQUA 5C25A 3WXJA 3U9ZA 4OX9K 3E66A 4M3TA 3L4IA 3QINA 1YAGA 3PO5A 3OVNA 2P9SA 3SCXA 3AVKA 1VSEA 4EHUA 2VCPA 4EHTA 1Z25A 1IBLK 2E6LA 4C8LA 2LSNA 3VQ5A 4ISGA 1WSJA 3LM9A 4FPBA 4B9NA 2HBKA 3MWPA 4K43A 3K5OA 5BRHA 4FLWA 1Y97A 4LF7K 3BF3A 3U3YA 1EWQA 5C2DA 2F8TA 4LF8K 2ITMA 1KQSM 4DV0K 3H1QA 3CJ1A 5KPZA 1HPMA 3T1YK 3K57A 1Q7YO 1GLCG 4I6MB 5FPNA 3V81A 3IAYA 3CQXA 5FROA 4Z94A 4JI0K 3DOLA 4WQ5A 2G8VA 3LP2A 4A61A 3ATVA 2F9WA 3LAKA 4FWQA 3AVGA 3MN6A 4B9SA 1RDCA 5AQRA 2HBJA 4PL7A 4QS8A 1RTJA 4IG3A 3NF8A 1NGJA 4K0KK 3AA5X 2AA4A 3V9ZA 2WBNA 4YNQA 3CCRN 4OKKA 1OVYA 4ELVA 4CFAA 5FDLA 3KZBA 4F9OA 3MAQA 4B9LA 2PAVA 3KHYA 5AQOA 1IBMK 3P39A 3M8RA 5HRPA 3ATUA 2NRTA 2CGKA 2GUPA 4H5RA 5J2MA 3I55N 1DEJA 3MEDA 3FLCO 3QICA 4BRQA 4WE1A 4DR4K 2RKIA 1HJRA 5BREA 3V4IA 5J2NA 4I9LA 2P5GA 3KVGA 4M3XA 4FWNA 4ZHRA 5GIOA 1NGFA 1S9EA 3AO1A 3FZHA 4C8MA 1L3VA 4CFCA 2HVIA 1YJWN 2NRZA 1TL3A 1MU2A 4FLYA 3WNEA 4IO9L 4DQRA 2QTDA 4W5TA 4C1NK 3VEOA 4FK2A 3G71N 4EP4A 3OS1A 3WNGA 4CF2A 1HPZA 3CF5L 1X3NA 4DFJA 2GELA 1TKTA 4GV3A 4JAXA 2QA4N 2Q36A 3O3HA 3CQ8A 4HTUA 1S3XA 1TK5A 4A5BA 1NGBA 2DPNA 1J6ZA 3MEGA 4K8XA 3LL3A 3JSMA 3ID8A 5SZTA 1A5WA 4B8CA 1TAUA 3O4NA 3HTVA 3SAHA 1N8RO 4JYAK 5BRDA 3ZT2A 3OYKA 2DFHA 1LOTB 4KHYA 3VQ9A 4W5NA 4ELTA 4DHYA 2ZF5O 4EAHD 4NLCA 1QSLA 2CH6A 3KK1A 5JVGL 4WFBL 4F3OA 2QWNA 3P1GA 2FBYA 1Q18A 3FZFA 4BWMA 3Q7BA 2FSNA 3W0LA 4FL9A 4DR5K 5KPRA 1S1WA 3V6DA 5LJWA 3IFRA 4WCEL 3DLEA 3MECA 2GV9A 4IZ9A 2I7PA 4BQLA 3VGMA 3WT0A 1DGKN 1E4FT 3C0BA 3DXKB 2WTUA 4B1VA 3EZ5A 3JS6A 3VEVA 1X9JA 3VQEA 4U67L 3CPWM 4JKBA 1BDGA 4B3SK 3P38A 4AF1A 1RTIA 2XY5A 1RT1A 2ASMA 3DLKA 3O4QA 4Z4FA 3O5BA 1S9GA 2QWMA 1K8KB 3IKMA 5CR4A 5FLXO 2W6LA 3J8AA 1LW0A 1KVBA 2HNDA 5I3UA 3K5MA 1VQLN 4CF0A 1J9AA 4OLAA 2Z1GA 4F3TA 3FFKB 3RR7A 3QEVA 2HMIA 4DQQA 5JS2A 4CHOA 3SQ0A 5AQZA 3CCVN 1MA9B 4J8FA 4JRQA 4C23A 1L3SA 2HBLA 4O5FA 4M3UA 1KAZA 2HVHA 4HHTA 3LM2A 1OH7A 4YORA 4RW6A 2IVNA 4O55A 4EP5A 3CCMN 3TAQA 1SL1A 2PYJA 3HBTA 5MLCQ 4BG9A 1Z05A 3KKRA 4KV8A 3VETA 4M45A 3M8QA 5ELZA 1QS4A 2ZM6K 3EE8A 4Z0UA 2F4VK 4FJ5A 4X65K 1VHXA 3O9TA 4AM7A 1HKCA 2OPPA 3AV9A 3GDQA 3QB0A 3L6QA 1Y64A 4ZTFA 4I9QA 2W41A 4BREA 4X62K 3QFPA 3DLRA 3I8BA 4ID5A 4OGCA 4DS5A 3H45C 1U2VB 4E7HA 4OLBA 3DRSA 4M7XA 3ZEUB 2ITGA 3ENBA 4CBUA 4CZFA 3ZLJA 4L3QA 3O08A 1Q82O 3PLAA 3ZSQA 3H3OB 3TARA 3I0SA 1YF5L 2NRRA 3LALA 5EVZA 2UXDK 2GBZA 4RW4A 3LAMA 3C7NA 1BUPA 4K41A 3AAQA 1ATRA 4H0PA 3CQYA 4FJNA 5LMUK 4MO4A 1TK0A 4J2EA 3OBWA 2P9PA 2HBMA 1RBUA 1QQOA 3E01A 4O4GA 3VQQA 1TYQA 5AQHA 5J2QA 3HSTB 2VG5A 2FXUA 3ZT0A 4CHYA 4U7BA 3F2KA 4J2BA 1U4BA 4YY3K 3TTFA 2O8FA 3L2UA 3G10A 3U3GA 1BL3A 2A1SA 4CFBA 3K0SA 3IUCA 3WEEA 1BQNA 4DSKA 1NK4A 2HNYA 2D0OA 1JLGA 3SUPA 3FZLA 3O1BA 2E5LK 2V7ZA 1N34K 3CC7N 4IOCL 4JKGA 3ZSYA 4FLUA 4O44A 2V51B 3CM6A 5HROA 3VMFB 4CJPA 3THWB 4IXCA 3VF2A 3D2EA 1XC3A 4CCHA 2XY8A 5HBMA 5AR0A 4FJJA 2ASPA 1LWEA 2FC0A 3EO3A 3RWUA 3LZJA 1QSSA 3MX5A 2H3GX 5AQSA 3FZMA 1QQMA 2YCHA 2YHBA 1U47A 4B9MA 5ADXA 4Z4EA 4CBXA 3HK2A 3TWHA 2DFEA 3PSFA 4FJGA 1N6QA 4JLHA 5KTQA 3OYMA 4JRPA 2GUIA 3QEXA 4PQUA 4BC5A 4RCHA 4BDZA 1CZ9A 3MX2A 3NVMA 1SKWA 1W9HA 1ATSA 1SV5A 1GLBG 4NO7A 3H08A 3KIOA 2G8HA 4CIEA 1NG9A 4YOTA 3QO9A 3D6RA 4IBNA 5AZIB 3OJUA 4KRFA 2ZGZA 4I6MA 4FM2A 3M8SA 1X1PA 1IKVA 1LAWA 2ATQA 4B1UB 4HCCA 4XEIA 2YI1A 4E1MA 2R7YA 4GVMA 2D4WA 5CZ1A 3ULEA 3CD6N 4E7KA 4IJNA 2E2QA 4FJLA 2XHBA 4OPHA 1RDBA 1NOYA 4ILGB 3AVNA 4DTUA 4FJXA 3SYZA 3QEPA 4ELUA 1JXEA 4PKGA 2ZE2A 3CC4N 3LDLA 1J5OA 3TI0A 3FFIA 3RRGA 4MLEA 2WC9A 2YHYA 1S1TA 1C1CA 5K14A 4PHTX 5AQFA 4DQIA 4NCGA 1TAQA 5M1FA 1NK0A 4RTFD 1BGXT 2CGLA 2KHOA 3ITHA 3F9MA 3TAFA 1EXQA 3CETA 2P9IB 1HYVA 2PYLA 3P4IA 2ZJPL 1HJOA 2AP1A 5AQVA 4W5QA 1ZBFA 4BY9C 1JLAA 3CJCA 4DTSA 3IDHA 4DSJA 3IMXA 1VQNN 4DR1K 1NJZA 3OYJA 4QAGA 3NH0A 2BANA 4NYNA 3HOTA 3O9QA 3TABA 3B8AX 2EX3A 2A3ZA 3ZT1A 4K42A 3ZX3A 4N5SA 5T7BA 4DG1A 1Q86O 4KREA 1GLAG 3THVA 2FBVA 3CMAN 1KAXA 3ISNC 5AZJB 3G4SN 4FZYA 2HHWA 2YHAA 1XNQK 1VSDA 3H3NO 1NK7A 3LDOA 2RHKA 5KGXA 1NGCA 4RW8A 4BRDA 5BR8K 4FLVA 5M1KA 3ZT4A 1YHQN 2OZMA 3GE1A 1RGIA 4B9VA 4FPAA 3NVKA 5C2FA 3ASMA 3HZ6A 3SBGA 1RILA 3D45A 4JHDB 3BP8A 1YTAA 4DR6K 4J2DA 4KHNA 4FVUA 1UWBA 1MDUB 4DTPA 4KI6A 1LAVA 2E20A 4JKDA 3U9DA 4CEAA 4EFHA 1TK8A 2FBTA 1MWKA 1NKBA 4DQSA 1Q81O 4FZXC 1S1XA 2EHGA 3KWIA 1GLFO 4CZMA 3AVCA 4KTZA 1NBWA 2D5RA 4E1NA 4GY2B 1EP4A 5A2QO 2VQEK 4CJUA 4BACA 4FCYA 4KI4A 3SV3A 4CJ5A 1KVAA 1IKYA 2P9KB 3E9OA 4CEQA 2HHXA 1RT4A 1TKXA 4Q0BA 2UUCK 2RF2A 1XMOK 2F96A 2XO7A 4AQYK 4CEFA 2HHVA 1H1VA 3GOIA 4DCHA 1FKOA 1W0HA 4FWMA 4YOYA 1C0UA 2FSKA 3SMSA 3LDSA 2HSTA 4DV6K 1QQNA 4M3ZA 5EX5A 1V4SA 3HOSA 1RBRA 1RTHA 3KLFA 4Z4GA 3VTHA 4LFCK 3DXKA 3VQ4A 3C65A 2QKBA 3SUOA 3KKSA 2O8EB 4DV2K 3CIPA 3THYB 4CZLA 3M5RA 1ZBLA 1DTTA 2FBXA 4CERA 1K8KA 1RTDA 4CGJA 3PIPL 4B1ZA 1WBBA 2Q31A 1HR0K 4FYDA 2W6KA 1Z26A 3AA4A 2IGIA 3MMVA 3VGKA 1UA0A 3SPYA 2F8SA 4ILHA 3KLEA 3K2PA 4FOEA 3VGLA 3A5OC 1VSIA 1KLNA 3VQAA 4CD3A 5KRSA 4BR2A 2DTUA 4L8RB 1P90A 1C0MA 4KH6A 5AQYA 3SI6A 1WNSA 1ZBHA 3T1AA 1VQON 4ZTJA 3HM9A 4A2AA 3LP0A 4CGGA 3MXMA 4CGDA 3HP9A 3TAMA 4LY7A 1QHAA 3TAEA 4E0DA 4R79A 4H03B 4DWIA 3HT3A 4B8AB 2QKKA 3VA3A 4QS9A 1LWCA 1QQCA 4OGEA 2NZTA 3CI5A 4FWRA 3OY9A 2Q97A 3O4WA 4IDKA 4CJ4A 4LH4A 1VQ5N 4B3OA 4DTRA 2HHSA 2BTFA 4GKJK 3AY9A 4IG0A 4DF4A 2HMPA 1N36K 4CEEA 4LF9K 3NH2A 4FJ8A 4PA1A 2WUSA 4AHSA 4FLTA 2D0AA 3ZEUA 3CCJN 3CJ9A 1LWFA 1QVGM 3UE5A 3OYLA 3PX0A 5CHIA 1KSPA 3VOVA 3NDKA 1K73O 1T05A 1WSGA 5AQKA 1ZBUA 3SJJA 2KW4A 4FO0A 4QCLA 2P9LB 1YT3A 4CF1A 2YNIA 2OYQA 4H0VB 3WXKA 4EIAA 4YDUC 1O1WA 4DV4K 3AVAA 3DMJA 5HRNA 2O8CB 3F9KA 5BN8A 4F8RA 3SUNA 3WUHA 4CF8A 2D0PA 4DLGA 1KD1O 3EZWA 3SZ2A 4JI7K 3G0ZA 2BE2A 1BIZA 5AQJA 4LSLA 3CXCM 3E1YA 5HRSA 1ZBIA 4DMNA 1TGOA 1Z6RA 3U6FA 1BOTO 1LV5A 4K25A 4BDPA 3ID6A 2RN2A 4XH1A 2OTLN 1NKCA 3VQBA 4FXDA 1HLUA 5BR9A 3NAEA 3O9UA 3SLCA 4A62A 3L3VA 3R9PA 3W3DA 4FM1A 3AVJA 3THWA 4H0YB 2HF4A 1V4TA 2VWJA 1SZ2A 2X6SA 4IKFA 2YJFA 4BDYA 5EOYA 2P5OA 1XWLA 2GEMA 1R0AA 1DT9A 3BUZB 4Y1CA 4BRHA 1N32K 4YDUA 2VGNA 2VG7A 3F73A 4K8ZA 3AGKA 2I7NA 3RTVA 4WFNL 1VQ7N 3VQDA 4QS7A 4CI6A 2P9UA 1YI2N 1X9WA 4KB0A 1JCFA 4CHNA 3HPOA 1C0GA 3G25A 5F2RA 1RDWX 1CXUA 3VPZA 4ILJA 4BRGA 1NWKA 3AO2A 5DM7L 3QIPA 5AZIA 3HP6A 4JKAA 4DV5K 3OHRA 3QERA 3OJSA 2XY7A 2P9NA 4JI5K 5LL6Z 2HHQA 1F21A 4JV5K 5M1OA 1X3MA 3FE1A 4CZJA 1C0TA 1CXQA 4CJKA 2O4IA 4DLEA 4HUFA 4CW7B 3CJBA 2YJEA 3OA9A 3SQ2A 3D0PA 4DTNA 4KAZA 4DF8A 2B4JA 5JLFA 3Q7CA 4GKKK 2ZJQL 3UIQA 1EETA 2WFBA 2VYPA 1WSFA 1S1UA 3TU5A 3DYAA 2O4GA 1YVUA 2VGMA 4FWKA 4UQGA 4IDHA 1GLEG 4A59A 3J81O 2RPIA 3OBYA 5GAHP 3MXJA 3ENHA 1BIUA 2CGJA 4CZKA 4DQPA 4CD1A 1FKPA 4IEEA 3HYFA 2P9IA 2ZWHA 3V9UA 3F5TA 1N33K 4FZZA 4I2QA 1NOZA 4M7YA 4H5VA 4AILC 4CJVA 3CCEN 5EU7A 1HNZK 2QWRA 3U4LA 4B9QA 3HSCA 1S22A 2ZJRL 4MFBA 3LWMA 4CJRA 3TAGA 3SQ4A 3CERA 2OTJN 3T1HK 5AFUA 3C6HA 5AZJA 3MCAB 2O8DB 3PY8A 2EWSA 4BWJA 4AHUA 2P51A 3LZIA 5IT9O 5AQIA 4FJKA 5J2PA 5DMRA 1NKEA 4PUOA 3NF6A 4E1JA 1J53A 4GNIA 1SL0A 3CFOA 4PKHA 2KQ2A 1IJJA 1ZBSA 4CEOA 3R3LA 1NJXA 2WOMA 1HUXA 3LWLA 1NGIA 1VSJA 2OA8A 1L3UA 1JL2A 3KLHA 3I56N 3QNOA 3MDQA 1HQEA 1ASUA 3LANA 4YOXA 4AHVA 4KTQA 4LF6K 4H5NA 3WQUA 1KCFA 3A8YA 3TTDA 1JCGA 5C24A 3L8BA 3DWLA 3ZSOA 2P9KA 1YJNN 3K58A 4X64K 1DLOA 1BWFO 1WN7A 4CIGA 3LPUA 4GMJB 3O3GA 1WB9A 3T3FA 3B6OA
chains in the Genus database with same CATH topology
4OJRA 3ZT1A 2HNZA 3OYGA 4N5SA 3V81A 5T7BA 4DG1A 3IAYA 4KREA 5FROA 3TR8A 1Q9YA 2BGGA 3THVA 2FBVA 3TANA 1KFDA 3ISNC 3DOLA 3NF7A 3DLHA 2G8VA 4FZYA 2YHAA 3LP2A 1VSDA 1NK7A 3QEWA 2HHWA 5KGXA 3PO4A 4RW8A 2D0BA 4FLVA 5HP1A 3LAKA 4O0JA 3CG7A 1G15A 4OKEA 3AVGA 1WAFA 3ZT4A 1SKSA 4B9SA 3ZSVA 2OZMA 1RBTA 1RDCA 2Y1IA 1XHZA 4HUEA 3L2WA 1JLCA 1RTJA 3NF8A 4IG3A 3O3FA 5I3UA 1U48A 3ASMA 4B9VA 1BI4A 1EKEA 3AVIA 1IKWA 3AA5X 4CJ3A 3P5JA 2A1RA 1RILA 3V9ZA 2HMIA 3D45A 1T03A 1YTAA 2X74A 4CGHA 4J2DA 4YNQA 4KHSA 4OKKA 4DSIA 5HLFA 3OYFA 4ID1A 2IOCA 4CFAA 4ELVA 3DRRA 4FW2A 4BE2A 4KHNA 1HNIA 1UWBA 4G1QA 2I5JA 5FDLA 4DTPA 4KI6A 2IAJA 2YNHA 1LAVA 4CEAA 3MAQA 4KO0A 3RMDA 1KFSA 4B9LA 3OYDA 2Z1HA 2X6NA 1TK8A 2FBTA 1NKBA 4DQSA 1K6YA 4FZXC 1RT7A 1KVCA 5CYMA 3M8RA 1XI1A 3ALYA 3NE6A 1S1XA 5HRPA 2EHGA 3V1QA 4C8NA 4E7JA 1QE1A 3AVCA 3RR8A 4AHRA 1UOCA 4KTZA 3HXMA 4FK4A 1TV6A 2D5RA 4I7FA 1XHXA 4E1NA 3HVRA 2HW3A 1EP4A 4BACA 5J2MA 4CJUA 3ZSWA 3RRHA 4OKJA 3MEDA 4FCYA 1D9FA 4KI4A 4LD0A 3SV3A 4CJ5A 1KVAA 4DU4A 1NK5A 2G8KA 1IKYA 2BDPA 4CEQA 2HHXA 4WE1A 1GOAA 1RT4A 1TKXA 2E4LA 3ZT3A 4F2RA 4Q0BA 3A2FA 2RF2A 2RKIA 1HJRA 2F96A 4ICLA 2XO7A 1VSKA 3V4IA 4CEFA 3OYBA 2HHVA 5J2NA 4I9LA 1JLBA 2P5GA 4E7IA 4M3XA 1BCMA 4EZ9A 1NJYA 1FKOA 1W0HA 2HB5A 1REVA 4ZHRA 1T7PA 3I0RA 1C0UA 1S9EA 3LDSA 4M3ZA 1N5YA 4H4OA 1J54A 2VG6A 3AA3A 3AO1A 3AVMA 1RBRA 1RTHA 3KLFA 4Z4GA 4HUGA 4C8MA 5KGWA 4EZ6A 2DY4A 1KLMA 1L3VA 4CJWA 4CFCA 3DRPA 3VQ4A 2QKBA 3SNNA 2HVIA 1HRHA 3SUOA 3KLGA 3TAPA 1XC9A 3KLIA 1TL3A 1MU2A 4FLYA 2YNFA 3WNEA 1ITGA 3KKSA 4DQRA 1WAJA 1HYZA 3HVTA 3KK2A 4DS4A 4W5TA 4JS4A 3QNNA 4FK2A 5FRNA 1ZBLA 3VQ7A 4EP4A 3OS1A 4CEZA 4H4MA 3WNGA 4CF2A 1HPZA 4PY5A 4Y1DA 4DFJA 1TKTA 1BI4B 3S9HA 1IH7A 5KRTA 1SL2A 1RDDA 1DTTA 2DFFA 3S3MA 2FBXA 4FJIA 4CERA 1JLEA 3O3HA 3CQ8A 4HTUA 1RTDA 4CGJA 1TK5A 1Q8IA 3MEGA 4KHQA 1IG9A 4K8XA 4DTXA 3JSMA 3VA0A 5SZTA 1A5WA 4B8CA 4FYDA 1Z26A 3OYAA 1TAUA 3O4NA 1T8EA 2KFZA 3AA4A 2IGIA 2Q3SA 3PV8A 1UA0A 3NF9A 1KRPA 2W42A 3SPYA 3JYTA 1BISA 3K5LA 2F8SA 1ASVA 3DI6A 5CZ2A 3ZT2A 3OYKA 3S3OA 2DFHA 3KLEA 3K2PA 4KHYA 1QSYA 3VQ9A 4CJQA 4W5NA 4ELTA 1VSIA 4R5PA 3OYCA 3VQAA 4CECA 4E7LA 1KLNA 1QSLA 5KRSA 1VSMA 3KK1A 1NK8A 1D5AA 2DTUA 4CIFA 4L8RB 4F3OA 1C0MA 3VN5A 4N47A 3SI6A 4FJ9A 1WNSA 1ZBHA 1JXBA 1JLQA 3T1AA 1C6VA 1EX4A 3P1GA 4ZTJA 3HPHA 3KK3A 3HM9A 2FBYA 4KFBA 3ZCMA 3LP0A 2OZSA 4CK1A 3HL8A 2P1JA 4BWMA 4CJLA 3SV4A 1A5VA 4CGGA 3MXMA 4YFUA 4CGDA 3HP9A 3TAMA 4LY7A 3NGZA 3TAEA 4E0DA 4DWIA 1ASWA 1S1WA 4B8AB 3HT3A 3V6DA 1NJWA 2QKKA 3LP1A 2XRIA 3KJVA 3VA3A 2B5JA 1LWCA 1QQCA 4CE9A 4OGEA 3DLEA 3MECA 4DTOA 2OPSA 2GV9A 3OY9A 1JLFA 4CK3A 4IFVA 4IDKA 4CJ4A 1CLQA 3AVFA 4CHZA 4OVLA 5C42A 4LH4A 3CYMA 1C1AA 4Z4HA 3EZ5A 3C95A 4NCBA 2YKMA 4B3OA 3OYIA 4DTRA 3QEIA 3VQEA 2HHSA 1YTUA 4F2SA 4IG0A 4DF4A 4FJHA 3P83D 4N56A 4DFKA 1RTIA 3PUFA 4CEEA 2XY5A 4CESA 3NH2A 1RT3A 4FJ8A 1RT1A 2QXFA 1VRUA 3DLKA 3O4QA 4PA1A 5DK5A 4Z4FA 4W5RA 3QESA 1S9GA 4AHSA 1S6QA 2Z1JA 2D0AA 3LP3A 4CHPA 4FLTA 1NK6A 1LWFA 4DTJA 4E19A 4Q5VA 3OYLA 4DSFA 3PX0A 1I39A 3KTQA 3AO3A 3CFRA 1KSPA 4TSXA 1LW0A 1KVBA 2HNDA 2ZQBA 3NDKA 3AA2A 3K5MA 4O5BA 1WSGA 4CF0A 1ZBUA 5HRRA 3SJJA 1T05A 1J9AA 4DU3A 1SUQA 4OLAA 1QHTA 3ZSXA 3ULDA 2Z1GA 4M3WA 4F3TA 4IFYA 2KW4A 3NBPA 1HYSA 3RR7A 4FJMA 3QEVA 4HVJA 4FW1A 4QCLA 5J1EA 1YT3A 4CF1A 2YNIA 5JS2A 3OYNA 4DQQA 4CHOA 1WSEA 3RMCA 2JLEA 3SQ0A 1X9SA 4C8KA 3L3UA 4AHTA 4CJTA 4JRQA 3DLBA 2YNGA 1O1WA 3V1OA 3RMBA 1L3SA 3AVAA 4B9UA 3DMJA 5HRNA 4M3UA 2HVHA 4HHTA 1JKHA 3K59A 3F9KA 2G8UA 2OYQA 4N76A 4F8RA 4RW6A 3SUNA 2KZZA 3AVHA 4CF8A 4AHCA 4DLGA 4CJFA 3VQ6A 3SZ2A 3G0ZA 4O55A 1RDAA 2BE2A 4EP5A 1BIZA 4E3SA 4DFMA 3TAQA 1SL1A 2PYJA 4LSLA 1WLJA 4RG8A 4CEDA 1TKDA 1RBSA 5HRSA 1ZBIA 4DU1A 4DMNA 1TGOA 3KKRA 3U6FA 1LV5A 4BDPA 4M41A 4KV8A 1I3AA 2RN2A 4DFPA 4JS5A 2PZSA 1NKCA 4M45A 3M8QA 3VQBA 3V9SA 1QS4A 3VQ8A 1SKRA 4FXDA 4Z0UA 4CGIA 2PY5A 4FJ5A 3NGIA 3NAEA 4QOZB 3L3VA 1S6PA 1UAXA 3OYHA 4DTMA 3L2RA 4BE1A 2OPPA 3AV9A 1RNHA 4FM1A 3S3NA 3AVJA 4ZTFA 1X9MA 4I9QA 1HMVA 3IG1A 1FK9A 1D8YA 1WSHA 3DLRA 4RW9A 2ETJA 4ID5A 1B9FA 2NUBA 4OGCA 4DS5A 2VWJA 3QETA 4O0IA 2X6SA 3C6TA 4E7HA 2G8WA 1VSHA 4IKFA 1B92A 4NCAA 3DRSA 4M42A 4OLBA 2AJQA 4BDYA 2ITGA 2P5OA 3MXIA 2KTQA 1XWLA 4OPJA 1VSFA 1LW2A 4CEBA 3BDPA 3ZSQA 4E89A 1R0AA 3TARA 1RCHA 3I0SA 4Y1CA 4DSLA 4FK0A 3LALA 3V9XA 2GBZA 1C1BA 4RW4A 3LAMA 2VG7A 4CF9A 4CHQA 5I42A 4FVMA 2HHUA 3F73A 4K8ZA 1HNVA 3RTVA 3VQPA 3VQDA 3NHGA 1QTMA 4FJNA 4KB0A 1X9WA 3I8DA 1TK0A 4CHNA 1WSIA 3AO5A 3HPOA 4J2EA 4PWDA 1RBUA 1Q9XA 3E01A 4LH5A 4O4GA 2B6AA 3VQQA 5CYQA 5J2QA 1CXUA 3OS0A 3HSTB 3AO4A 2VG5A 1S5JA 1KTQA 3AO2A 3ZT0A 4CHYA 1RT6A 3NFAA 1ZYQA 1VSLA 3QIPA 4J2BA 1U4BA 3HP6A 3WNHA 3V1RA 3AVLA 3L2UA 3BGRA 3G10A 4KKOA 1BL3A 2A1SA 3U3GA 4CFBA 3QERA 3OJSA 2XY7A 3C94A 1RT2A 3SPZA 2KFNA 1BQNA 2E6MA 1L3TA 4DSKA 1NK4A 2HNYA 3ZSZA 2HHQA 1F21A 1JLGA 3SUPA 4Z4IA 4FM0A 3K5NA 1C0TA 1CXQA 2OPQA 4CJKA 4KHWA 2O4IA 4DLEA 4OPKA 1U45A 4HUFA 1JL1A 3ZSYA 4FLUA 3EYZA 4XIUA 4O44A 2D0CA 3KD5E 4RW7A 3CM6A 3SQ2A 5HROA 4M3RA 3D0PA 1S1VA 2Z1IA 4KTWA 5E41A 4DTNA 4KAZA 4DF8A 2B4JA 4CJSA 3HO1A 3QIOA 4CJPA 4F4KA 3NGYA 1FXXA 1BCOA 4CK2A 4CCHA 2XY8A 5HBMA 4AH9A 3UIQA 4FJJA 1EETA 1LWEA 2G8FA 2ZD1A 1VK0A 1WSFA 1S1UA 2FC0A 3DYAA 3PX4A 3RWUA 2O4GA 1RT5A 3LZJA 1YVUA 1QSSA 4UQGA 3RMAA 4B9TA 3B6PA 2YHBA 1U47A 4B9MA 2WONA 2XY6A 2RPIA 4Z4EA 3MXJA 3DLGA 4LSNA 1BIUA 1TL1A 2DFEA 3TWHA 1UA1A 4FJGA 3HK2A 3HJFA 3L2QA 1N6QA 4DQPA 1TKZA 4N41A 1FKPA 4JLHA 5KI6A 5KTQA 3OYMA 3IRXA 2GUIA 4JRPA 1U04A 1TVRA 5SWMA 3HYFA 1U49A 3V9UA 3QEXA 4PQUA 2YKNA 2YV0X 3SQ1A 4FZZA 3QLHA 2X78A 3C6UA 4NYFA 1CZ9A 4BDZA 4I2QA 4FLXA 2JGUA 4HCBA 1SKWA 1NOZA 1W9HA 1SV5A 4FJ7A 3WNFA 3H08A 3EY1A 4AILC 1RBVA 3KIOA 2G8IA 4CJVA 3OYEA 2G8HA 1CZBA 3LPTA 4CIEA 5CY4A 5EU7A 4C8OA 1GOCA 2HHTA 3L2VA 3QO9A 1IKXA 4IBNA 4KHUA 3T19A 3OJUA 4KRFA 2IC3A 4M3YA 5JS1A 3ZSRA 4MFBA 3LWMA 4FM2A 2IS3A 3M8SA 2Y1JA 1X1PA 4KB1A 1IKVA 1LAWA 2ATQA 2OPRA 4CJRA 4MQ3A 2VWKA 3TAGA 3SQ4A 4HCCA 4J2AA 2KZMA 4GW6A 3NCIA 1L5UA 3PX6A 5FRMA 4E1MA 2R7YA 4CJEA 3CM5A 3PY8A 2IDOA 4BWJA 4GVMA 4AHUA 4I2PA 2QK9A 2P51A 5CZ1A 3LZIA 4E7KA 4FJKA 5D3GA 5J2PA 5DMRA 1NKEA 3IS9A 4PUOA 3NF6A 4Z4CA 1J53A 4FLZA 4FJLA 1NK9A 2XHBA 3VQCA 1SL0A 1RDBA 1NOYA 3CFOA 2KQ2A 3DOKA 4CEOA 1NJXA 3AVNA 4DTUA 3SUQA 4FJXA 1VRTA 1IO2A 2WOMA 3OS2A 4W5OA 3HPGA 3SYZA 3NH1A 1B9DA 4B08A 3QEPA 1HQUA 3M8PA 5C25A 4ELUA 1JXEA 2ZE2A 1BHLA 3LWLA 1VSJA 1J5OA 3QINA 3FFIA 3TI0A 1L3UA 2OA8A 3RRGA 1JL2A 4M3TA 4DSEA 3KLHA 1S1TA 4CFDA 1C1CA 5K14A 3QNOA 3PO5A 3OVNA 3SCXA 1HQEA 3MEEA 1ASUA 3AVKA 1VSEA 4DQIA 3LANA 4NCGA 1TAQA 1NK0A 4CGFA 4AHVA 1BGXT 1BQMA 1GOBA 1Z25A 4KTQA 2E6LA 4C8LA 3ITHA 2LSNA 4H8KA 1DTQA 3KD1E 3VQ5A 1A5XA 1WSJA 4BE0A 4KPYA 3TAFA 3V9WA 4B9NA 1EXQA 1KCFA 1HYVA 2PYLA 3CFPA 5C24A 3K5OA 3L8BA 3AVBA 4FLWA 1Y97A 1D9DA 3U3YA 3ZSOA 1ZBFA 4W5QA 1JLAA 4DTSA 2F8TA 3K58A 3DM2A 1DLOA 1WN7A 4CIGA 4DSJA 1NJZA 3OYJA 4QAGA 3NH0A 2BANA 3LPUA 4NYNA 4GMJB 3O3GA 3T3FA 3TABA 3K57A 2EX3A 3B6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJR A;  3ZT1 A;  2HNZ A;  3OYG A;  4N5S A;  3V81 A;  5T7B A;  4DG1 A;  3IAY A;  4KRE A;  5FRO A;  3TR8 A;  1Q9Y A;  2BGG A;  3THV A;  2FBV A;  3TAN A;  1KFD A;  3ISN C;  3DOL A;  3NF7 A;  3DLH A;  2G8V A;  4FZY A;  2YHA A;  3LP2 A;  1VSD A;  1NK7 A;  3QEW A;  2HHW A;  5KGX A;  3PO4 A;  4RW8 A;  2D0B A;  4FLV A;  5HP1 A;  3LAK A;  4O0J A;  3CG7 A;  1G15 A;  4OKE A;  3AVG A;  1WAF A;  3ZT4 A;  1SKS A;  4B9S A;  3ZSV A;  2OZM A;  1RBT A;  1RDC A;  2Y1I A;  1XHZ A;  4HUE A;  3L2W A;  1JLC A;  1RTJ A;  3NF8 A;  4IG3 A;  3O3F A;  5I3U A;  1U48 A;  3ASM A;  4B9V A;  1BI4 A;  1EKE A;  3AVI A;  1IKW A;  3AA5 X;  4CJ3 A;  3P5J A;  2A1R A;  1RIL A;  3V9Z A;  2HMI A;  3D45 A;  1T03 A;  1YTA A;  2X74 A;  4CGH A;  4J2D A;  4YNQ A;  4KHS A;  4OKK A;  4DSI A;  5HLF A;  3OYF A;  4ID1 A;  2IOC A;  4CFA A;  4ELV A;  3DRR A;  4FW2 A;  4BE2 A;  4KHN A;  1HNI A;  1UWB A;  4G1Q A;  2I5J A;  5FDL A;  4DTP A;  4KI6 A;  2IAJ A;  2YNH A;  1LAV A;  4CEA A;  3MAQ A;  4KO0 A;  3RMD A;  1KFS A;  4B9L A;  3OYD A;  2Z1H A;  2X6N A;  1TK8 A;  2FBT A;  1NKB A;  4DQS A;  1K6Y A;  4FZX C;  1RT7 A;  1KVC A;  5CYM A;  3M8R A;  1XI1 A;  3ALY A;  3NE6 A;  1S1X A;  5HRP A;  2EHG A;  3V1Q A;  4C8N A;  4E7J A;  1QE1 A;  3AVC A;  3RR8 A;  4AHR A;  1UOC A;  4KTZ A;  3HXM A;  4FK4 A;  1TV6 A;  2D5R A;  4I7F A;  1XHX A;  4E1N A;  3HVR A;  2HW3 A;  1EP4 A;  4BAC A;  5J2M A;  4CJU A;  3ZSW A;  3RRH A;  4OKJ A;  3MED A;  4FCY A;  1D9F A;  4KI4 A;  4LD0 A;  3SV3 A;  4CJ5 A;  1KVA A;  4DU4 A;  1NK5 A;  2G8K A;  1IKY A;  2BDP A;  4CEQ A;  2HHX A;  4WE1 A;  1GOA A;  1RT4 A;  1TKX A;  2E4L A;  3ZT3 A;  4F2R A;  4Q0B A;  3A2F A;  2RF2 A;  2RKI A;  1HJR A;  2F96 A;  4ICL A;  2XO7 A;  1VSK A;  3V4I A;  4CEF A;  3OYB A;  2HHV A;  5J2N A;  4I9L A;  1JLB A;  2P5G A;  4E7I A;  4M3X A;  1BCM A;  4EZ9 A;  1NJY A;  1FKO A;  1W0H A;  2HB5 A;  1REV A;  4ZHR A;  1T7P A;  3I0R A;  1C0U A;  1S9E A;  3LDS A;  4M3Z A;  1N5Y A;  4H4O A;  1J54 A;  2VG6 A;  3AA3 A;  3AO1 A;  3AVM A;  1RBR A;  1RTH A;  3KLF A;  4Z4G A;  4HUG A;  4C8M A;  5KGW A;  4EZ6 A;  2DY4 A;  1KLM A;  1L3V A;  4CJW A;  4CFC A;  3DRP A;  3VQ4 A;  2QKB A;  3SNN A;  2HVI A;  1HRH A;  3SUO A;  3KLG A;  3TAP A;  1XC9 A;  3KLI A;  1TL3 A;  1MU2 A;  4FLY A;  2YNF A;  3WNE A;  1ITG A;  3KKS A;  4DQR A;  1WAJ A;  1HYZ A;  3HVT A;  3KK2 A;  4DS4 A;  4W5T A;  4JS4 A;  3QNN A;  4FK2 A;  5FRN A;  1ZBL A;  3VQ7 A;  4EP4 A;  3OS1 A;  4CEZ A;  4H4M A;  3WNG A;  4CF2 A;  1HPZ A;  4PY5 A;  4Y1D A;  4DFJ A;  1TKT A;  1BI4 B;  3S9H A;  1IH7 A;  5KRT A;  1SL2 A;  1RDD A;  1DTT A;  2DFF A;  3S3M A;  2FBX A;  4FJI A;  4CER A;  1JLE A;  3O3H A;  3CQ8 A;  4HTU A;  1RTD A;  4CGJ A;  1TK5 A;  1Q8I A;  3MEG A;  4KHQ A;  1IG9 A;  4K8X A;  4DTX A;  3JSM A;  3VA0 A;  5SZT A;  1A5W A;  4B8C A;  4FYD A;  1Z26 A;  3OYA A;  1TAU A;  3O4N A;  1T8E A;  2KFZ A;  3AA4 A;  2IGI A;  2Q3S A;  3PV8 A;  1UA0 A;  3NF9 A;  1KRP A;  2W42 A;  3SPY A;  3JYT A;  1BIS A;  3K5L A;  2F8S A;  1ASV A;  3DI6 A;  5CZ2 A;  3ZT2 A;  3OYK A;  3S3O A;  2DFH A;  3KLE A;  3K2P A;  4KHY A;  1QSY A;  3VQ9 A;  4CJQ A;  4W5N A;  4ELT A;  1VSI A;  4R5P A;  3OYC A;  3VQA A;  4CEC A;  4E7L A;  1KLN A;  1QSL A;  5KRS A;  1VSM A;  3KK1 A;  1NK8 A;  1D5A A;  2DTU A;  4CIF A;  4L8R B;  4F3O A;  1C0M A;  3VN5 A;  4N47 A;  3SI6 A;  4FJ9 A;  1WNS A;  1ZBH A;  1JXB A;  1JLQ A;  3T1A A;  1C6V A;  1EX4 A;  3P1G A;  4ZTJ A;  3HPH A;  3KK3 A;  3HM9 A;  2FBY A;  4KFB A;  3ZCM A;  3LP0 A;  2OZS A;  4CK1 A;  3HL8 A;  2P1J A;  4BWM A;  4CJL A;  3SV4 A;  1A5V A;  4CGG A;  3MXM A;  4YFU A;  4CGD A;  3HP9 A;  3TAM A;  4LY7 A;  3NGZ A;  3TAE A;  4E0D A;  4DWI A;  1ASW A;  1S1W A;  4B8A B;  3HT3 A;  3V6D A;  1NJW A;  2QKK A;  3LP1 A;  2XRI A;  3KJV A;  3VA3 A;  2B5J A;  1LWC A;  1QQC A;  4CE9 A;  4OGE A;  3DLE A;  3MEC A;  4DTO A;  2OPS A;  2GV9 A;  3OY9 A;  1JLF A;  4CK3 A;  4IFV A;  4IDK A;  4CJ4 A;  1CLQ A;  3AVF A;  4CHZ A;  4OVL A;  5C42 A;  4LH4 A;  3CYM A;  1C1A A;  4Z4H A;  3EZ5 A;  3C95 A;  4NCB A;  2YKM A;  4B3O A;  3OYI A;  4DTR A;  3QEI A;  3VQE A;  2HHS A;  1YTU A;  4F2S A;  4IG0 A;  4DF4 A;  4FJH A;  3P83 D;  4N56 A;  4DFK A;  1RTI A;  3PUF A;  4CEE A;  2XY5 A;  4CES A;  3NH2 A;  1RT3 A;  4FJ8 A;  1RT1 A;  2QXF A;  1VRU A;  3DLK A;  3O4Q A;  4PA1 A;  5DK5 A;  4Z4F A;  4W5R A;  3QES A;  1S9G A;  4AHS A;  1S6Q A;  2Z1J A;  2D0A A;  3LP3 A;  4CHP A;  4FLT A;  1NK6 A;  1LWF A;  4DTJ A;  4E19 A;  4Q5V A;  3OYL A;  4DSF A;  3PX0 A;  1I39 A;  3KTQ A;  3AO3 A;  3CFR A;  1KSP A;  4TSX A;  1LW0 A;  1KVB A;  2HND A;  2ZQB A;  3NDK A;  3AA2 A;  3K5M A;  4O5B A;  1WSG A;  4CF0 A;  1ZBU A;  5HRR A;  3SJJ A;  1T05 A;  1J9A A;  4DU3 A;  1SUQ A;  4OLA A;  1QHT A;  3ZSX A;  3ULD A;  2Z1G A;  4M3W A;  4F3T A;  4IFY A;  2KW4 A;  3NBP A;  1HYS A;  3RR7 A;  4FJM A;  3QEV A;  4HVJ A;  4FW1 A;  4QCL A;  5J1E A;  1YT3 A;  4CF1 A;  2YNI A;  5JS2 A;  3OYN A;  4DQQ A;  4CHO A;  1WSE A;  3RMC A;  2JLE A;  3SQ0 A;  1X9S A;  4C8K A;  3L3U A;  4AHT A;  4CJT A;  4JRQ A;  3DLB A;  2YNG A;  1O1W A;  3V1O A;  3RMB A;  1L3S A;  3AVA A;  4B9U A;  3DMJ A;  5HRN A;  4M3U A;  2HVH A;  4HHT A;  1JKH A;  3K59 A;  3F9K A;  2G8U A;  2OYQ A;  4N76 A;  4F8R A;  4RW6 A;  3SUN A;  2KZZ A;  3AVH A;  4CF8 A;  4AHC A;  4DLG A;  4CJF A;  3VQ6 A;  3SZ2 A;  3G0Z A;  4O55 A;  1RDA A;  2BE2 A;  4EP5 A;  1BIZ A;  4E3S A;  4DFM A;  3TAQ A;  1SL1 A;  2PYJ A;  4LSL A;  1WLJ A;  4RG8 A;  4CED A;  1TKD A;  1RBS A;  5HRS A;  1ZBI A;  4DU1 A;  4DMN A;  1TGO A;  3KKR A;  3U6F A;  1LV5 A;  4BDP A;  4M41 A;  4KV8 A;  1I3A A;  2RN2 A;  4DFP A;  4JS5 A;  2PZS A;  1NKC A;  4M45 A;  3M8Q A;  3VQB A;  3V9S A;  1QS4 A;  3VQ8 A;  1SKR A;  4FXD A;  4Z0U A;  4CGI A;  2PY5 A;  4FJ5 A;  3NGI A;  3NAE A;  4QOZ B;  3L3V A;  1S6P A;  1UAX A;  3OYH A;  4DTM A;  3L2R A;  4BE1 A;  2OPP A;  3AV9 A;  1RNH A;  4FM1 A;  3S3N A;  3AVJ A;  4ZTF A;  1X9M A;  4I9Q A;  1HMV A;  3IG1 A;  1FK9 A;  1D8Y A;  1WSH A;  3DLR A;  4RW9 A;  2ETJ A;  4ID5 A;  1B9F A;  2NUB A;  4OGC A;  4DS5 A;  2VWJ A;  3QET A;  4O0I A;  2X6S A;  3C6T A;  4E7H A;  2G8W A;  1VSH A;  4IKF A;  1B92 A;  4NCA A;  3DRS A;  4M42 A;  4OLB A;  2AJQ A;  4BDY A;  2ITG A;  2P5O A;  3MXI A;  2KTQ A;  1XWL A;  4OPJ A;  1VSF A;  1LW2 A;  4CEB A;  3BDP A;  3ZSQ A;  4E89 A;  1R0A A;  3TAR A;  1RCH A;  3I0S A;  4Y1C A;  4DSL A;  4FK0 A;  3LAL A;  3V9X A;  2GBZ A;  1C1B A;  4RW4 A;  3LAM A;  2VG7 A;  4CF9 A;  4CHQ A;  5I42 A;  4FVM A;  2HHU A;  3F73 A;  4K8Z A;  1HNV A;  3RTV A;  3VQP A;  3VQD A;  3NHG A;  1QTM A;  4FJN A;  4KB0 A;  1X9W A;  3I8D A;  1TK0 A;  4CHN A;  1WSI A;  3AO5 A;  3HPO A;  4J2E A;  4PWD A;  1RBU A;  1Q9X A;  3E01 A;  4LH5 A;  4O4G A;  2B6A A;  3VQQ A;  5CYQ A;  5J2Q A;  1CXU A;  3OS0 A;  3HST B;  3AO4 A;  2VG5 A;  1S5J A;  1KTQ A;  3AO2 A;  3ZT0 A;  4CHY A;  1RT6 A;  3NFA A;  1ZYQ A;  1VSL A;  3QIP A;  4J2B A;  1U4B A;  3HP6 A;  3WNH A;  3V1R A;  3AVL A;  3L2U A;  3BGR A;  3G10 A;  4KKO A;  1BL3 A;  2A1S A;  3U3G A;  4CFB A;  3QER A;  3OJS A;  2XY7 A;  3C94 A;  1RT2 A;  3SPZ A;  2KFN A;  1BQN A;  2E6M A;  1L3T A;  4DSK A;  1NK4 A;  2HNY A;  3ZSZ A;  2HHQ A;  1F21 A;  1JLG A;  3SUP A;  4Z4I A;  4FM0 A;  3K5N A;  1C0T A;  1CXQ A;  2OPQ A;  4CJK A;  4KHW A;  2O4I A;  4DLE A;  4OPK A;  1U45 A;  4HUF A;  1JL1 A;  3ZSY A;  4FLU A;  3EYZ A;  4XIU A;  4O44 A;  2D0C A;  3KD5 E;  4RW7 A;  3CM6 A;  3SQ2 A;  5HRO A;  4M3R A;  3D0P A;  1S1V A;  2Z1I A;  4KTW A;  5E41 A;  4DTN A;  4KAZ A;  4DF8 A;  2B4J A;  4CJS A;  3HO1 A;  3QIO A;  4CJP A;  4F4K A;  3NGY A;  1FXX A;  1BCO A;  4CK2 A;  4CCH A;  2XY8 A;  5HBM A;  4AH9 A;  3UIQ A;  4FJJ A;  1EET A;  1LWE A;  2G8F A;  2ZD1 A;  1VK0 A;  1WSF A;  1S1U A;  2FC0 A;  3DYA A;  3PX4 A;  3RWU A;  2O4G A;  1RT5 A;  3LZJ A;  1YVU A;  1QSS A;  4UQG A;  3RMA A;  4B9T A;  3B6P A;  2YHB A;  1U47 A;  4B9M A;  2WON A;  2XY6 A;  2RPI A;  4Z4E A;  3MXJ A;  3DLG A;  4LSN A;  1BIU A;  1TL1 A;  2DFE A;  3TWH A;  1UA1 A;  4FJG A;  3HK2 A;  3HJF A;  3L2Q A;  1N6Q A;  4DQP A;  1TKZ A;  4N41 A;  1FKP A;  4JLH A;  5KI6 A;  5KTQ A;  3OYM A;  3IRX A;  2GUI A;  4JRP A;  1U04 A;  1TVR A;  5SWM A;  3HYF A;  1U49 A;  3V9U A;  3QEX A;  4PQU A;  2YKN A;  2YV0 X;  3SQ1 A;  4FZZ A;  3QLH A;  2X78 A;  3C6U A;  4NYF A;  1CZ9 A;  4BDZ A;  4I2Q A;  4FLX A;  2JGU A;  4HCB A;  1SKW A;  1NOZ A;  1W9H A;  1SV5 A;  4FJ7 A;  3WNF A;  3H08 A;  3EY1 A;  4AIL C;  1RBV A;  3KIO A;  2G8I A;  4CJV A;  3OYE A;  2G8H A;  1CZB A;  3LPT A;  4CIE A;  5CY4 A;  5EU7 A;  4C8O A;  1GOC A;  2HHT A;  3L2V A;  3QO9 A;  1IKX A;  4IBN A;  4KHU A;  3T19 A;  3OJU A;  4KRF A;  2IC3 A;  4M3Y A;  5JS1 A;  3ZSR A;  4MFB A;  3LWM A;  4FM2 A;  2IS3 A;  3M8S A;  2Y1J A;  1X1P A;  4KB1 A;  1IKV A;  1LAW A;  2ATQ A;  2OPR A;  4CJR A;  4MQ3 A;  2VWK A;  3TAG A;  3SQ4 A;  4HCC A;  4J2A A;  2KZM A;  4GW6 A;  3NCI A;  1L5U A;  3PX6 A;  5FRM A;  4E1M A;  2R7Y A;  4CJE A;  3CM5 A;  3PY8 A;  2IDO A;  4BWJ A;  4GVM A;  4AHU A;  4I2P A;  2QK9 A;  2P51 A;  5CZ1 A;  3LZI A;  4E7K A;  4FJK A;  5D3G A;  5J2P A;  5DMR A;  1NKE A;  3IS9 A;  4PUO A;  3NF6 A;  4Z4C A;  1J53 A;  4FLZ A;  4FJL A;  1NK9 A;  2XHB A;  3VQC A;  1SL0 A;  1RDB A;  1NOY A;  3CFO A;  2KQ2 A;  3DOK A;  4CEO A;  1NJX A;  3AVN A;  4DTU A;  3SUQ A;  4FJX A;  1VRT A;  1IO2 A;  2WOM A;  3OS2 A;  4W5O A;  3HPG A;  3SYZ A;  3NH1 A;  1B9D A;  4B08 A;  3QEP A;  1HQU A;  3M8P A;  5C25 A;  4ELU A;  1JXE A;  2ZE2 A;  1BHL A;  3LWL A;  1VSJ A;  1J5O A;  3QIN A;  3FFI A;  3TI0 A;  1L3U A;  2OA8 A;  3RRG A;  1JL2 A;  4M3T A;  4DSE A;  3KLH A;  1S1T A;  4CFD A;  1C1C A;  5K14 A;  3QNO A;  3PO5 A;  3OVN A;  3SCX A;  1HQE A;  3MEE A;  1ASU A;  3AVK A;  1VSE A;  4DQI A;  3LAN A;  4NCG A;  1TAQ A;  1NK0 A;  4CGF A;  4AHV A;  1BGX T;  1BQM A;  1GOB A;  1Z25 A;  4KTQ A;  2E6L A;  4C8L A;  3ITH A;  2LSN A;  4H8K A;  1DTQ A;  3KD1 E;  3VQ5 A;  1A5X A;  1WSJ A;  4BE0 A;  4KPY A;  3TAF A;  3V9W A;  4B9N A;  1EXQ A;  1KCF A;  1HYV A;  2PYL A;  3CFP A;  5C24 A;  3K5O A;  3L8B A;  3AVB A;  4FLW A;  1Y97 A;  1D9D A;  3U3Y A;  3ZSO A;  1ZBF A;  4W5Q A;  1JLA A;  4DTS A;  2F8T A;  3K58 A;  3DM2 A;  1DLO A;  1WN7 A;  4CIG A;  4DSJ A;  1NJZ A;  3OYJ A;  4QAG A;  3NH0 A;  2BAN A;  3LPU A;  4NYN A;  4GMJ B;  3O3G A;  3T3F A;  3TAB A;  3K57 A;  2EX3 A;  3B6O A; 
#chains in the Genus database with same CATH topology
 4H5T A;  2HNZ A;  1Q9Y A;  4B1X B;  2NRX A;  3R8E A;  1KFD A;  3DLH A;  3QEW A;  2YHX A;  2FLO A;  2D0B A;  5HP1 A;  3A5M C;  2O8E A;  4OKE A;  3G6E N;  1SKS A;  1ZXO A;  1EQY A;  3UKU B;  1XHZ A;  3L2W A;  3O3F A;  3WXM B;  1U48 A;  1EKE A;  1IKW A;  3NMU A;  4CJ3 A;  4DV3 K;  2HF3 A;  3E9P A;  4CGH A;  4KHS A;  4DSI A;  5HLF A;  3OYF A;  4ID1 A;  3DRR A;  2PBD A;  1R59 O;  4BRI A;  2I5J A;  2IAJ A;  4LF4 K;  1KFS A;  2QWP A;  3CME N;  3OYD A;  1K6Y A;  1RT7 A;  3ZYY X;  1KVC A;  3ALY A;  4GV6 A;  3DJC A;  4E7J A;  4C8N A;  3M6G A;  4JN4 A;  5AQW A;  3RR8 A;  4FWL A;  1VQ4 N;  1UOC A;  3HXM A;  3VTI A;  4FK4 A;  1TV6 A;  2HW3 A;  4I7F A;  1XHX A;  1NMN A;  2BDP A;  1GOA A;  2E4L A;  3L0Q A;  4F2R A;  3A2F A;  4ICL A;  3K9J A;  1VSK A;  3OYB A;  1JLB A;  5GIN A;  4E7I A;  1BCM A;  1NJY A;  1T7P A;  1NGH A;  2HOE A;  2UYT A;  3CHW A;  2Q0U A;  2QWL A;  2VG6 A;  3AA3 A;  5BPL A;  4DR7 K;  4HUG A;  4EZ6 A;  5KGW A;  3DRP A;  3SNN A;  1HRH A;  3TAP A;  5M1Q A;  2YNF A;  1WAJ A;  1HYZ A;  3HVT A;  4JKE A;  5JVH L;  4JS4 A;  3DAW A;  2ASO A;  2NRW A;  3QNN A;  5FRN A;  4H4M A;  5BRF A;  4PY5 A;  1BI4 B;  1SL2 A;  2J4R A;  4OO1 J;  1RDD A;  2DFF A;  1JLE A;  4PKI A;  1Q8I A;  1U6Z A;  4KHQ A;  4DTX A;  3RVC A;  4JKC A;  5AQN A;  2QWQ A;  1T8E A;  2KFZ A;  3O1W A;  2Q3S A;  3NF9 A;  1KRP A;  3RSE B;  1BIS A;  4NB4 A;  4DKW A;  3K5L A;  3DI6 A;  3S3O A;  1W2B M;  5C0Y A;  2P9L A;  4NLB A;  1XNR K;  4R5P A;  4E7L A;  4CEC A;  1NK8 A;  5F1X A;  3VF6 A;  3QDK A;  4FJ9 A;  1YJ9 N;  2O8C A;  1C6V A;  4CZE A;  3J80 O;  1EX4 A;  2Q0R A;  3HPH A;  2RE2 A;  4KFB A;  2P1J A;  2IVO A;  4YFU A;  1CZA N;  4LFA K;  1ASW A;  3J7A P;  4DR3 K;  4WQ4 C;  4CJ7 A;  4DTO A;  4X66 K;  3K9K A;  4CK3 A;  4IFV A;  2E2P A;  4CHZ A;  3TSQ A;  3C95 A;  3QML A;  4NCB A;  2YKM A;  4DUY K;  2FSJ A;  4JI4 K;  3OYI A;  1GLD G;  1OH8 A;  1YTU A;  3THX B;  5FPE A;  4FJH A;  3P83 D;  4N56 A;  5AJ3 K;  3PUF A;  4CES A;  1RT3 A;  1VRU A;  2GX9 A;  3LDP A;  1WBD A;  3QES A;  2Z1J A;  1NLV A;  4DTJ A;  4E19 A;  4DSF A;  3KTQ A;  3AO3 A;  3CFR A;  2ZQB A;  2KLA A;  2CH5 A;  4O5B A;  3BY5 A;  4DV1 K;  1SUQ A;  2YHW A;  2E2O A;  2V52 B;  1QHT A;  3ULD A;  4IFY A;  3NBP A;  4FJM A;  4HVJ A;  5J1E A;  3N4Q A;  3RMC A;  1NK9 A;  4O8K A;  4F2S A;  3A5L C;  2JLE A;  3C7N B;  4C8K A;  1IBK K;  3GG4 A;  3DLB A;  3RMB A;  5EY4 A;  4B9U A;  3MK6 A;  4IO8 A;  1WUA A;  4C1N I;  4JD2 B;  4JKF A;  4WQ4 A;  4N76 A;  4Y0W A;  3D7E O;  1BU6 O;  3AVH A;  4AHC A;  3VQ6 A;  1RDA A;  4DFM A;  1RFQ A;  5BPN A;  1WLJ A;  1NM1 A;  2JWL A;  1RBS A;  3VEW A;  4FWP A;  4M41 A;  4JS5 A;  2PZS A;  3V9S A;  1SKR A;  3VQ8 A;  4CGI A;  3KK7 A;  3H1V X;  3NGI A;  1BG3 A;  4QOZ B;  1KXP A;  1S6P A;  4BVP A;  4B1W B;  5AQX A;  5C10 A;  3S3N A;  4A5A A;  2QM1 A;  1HMV A;  3IG1 A;  1FK9 A;  3SBT A;  2A6A A;  1D8Y A;  2QEX N;  2ETJ A;  4LC9 B;  4O0I A;  3C6T A;  1MWM A;  3MN5 A;  1FJG K;  4M42 A;  2AJQ A;  5KPT A;  2E88 A;  3D2E B;  5AQL A;  4OPJ A;  3EEQ A;  4ISF A;  1VSF A;  1HKB A;  1T6D A;  1VQ8 N;  1RCH A;  4BVO A;  3HM8 A;  4DB3 A;  1SAZ A;  1VQ9 N;  3V9X A;  4CHQ A;  1C1B A;  4CF9 A;  3SAG A;  5I42 A;  4WFA L;  4NXN K;  1K9M O;  1HNV A;  1OH5 A;  3VQP A;  3NHG A;  1QTM A;  1E4G T;  3I8D A;  1VQM N;  4KBO A;  4LH5 A;  3HI0 A;  2BH1 A;  3VES A;  3PIO L;  3UKR B;  3AO4 A;  1GLJ O;  1S5J A;  1RT6 A;  2GTD A;  3NFA A;  3QBX A;  4PL8 A;  3VF4 A;  4DQ8 A;  3AVL A;  3BGR A;  4KKO A;  5JIC A;  3C94 A;  1RT2 A;  3SPZ A;  2KFN A;  4KH5 A;  1C0F A;  3O80 A;  3K5N A;  1W97 L;  2O8D A;  4KHW A;  3SJH A;  4OPK A;  1GLL O;  3ENO A;  2FF6 A;  4XIU A;  2HHH K;  4BRO A;  3ZET B;  3WXI A;  2QXL A;  2NRH A;  4RW7 A;  4M3R A;  2Z1I A;  5E41 A;  1U2V A;  1QZ6 A;  3ULE B;  3HO1 A;  3SK3 A;  3QIO A;  3NGY A;  4MDB A;  4BRA A;  1NMD A;  2UUB K;  3VEN A;  2G8F A;  1VK0 A;  1XQS C;  3WXL A;  4A2B A;  2E1Z A;  1RT5 A;  4IEI A;  4B9T A;  2E2N A;  5E26 A;  2XY6 A;  1S72 N;  4YOW A;  1UA1 A;  1TL1 A;  4WF9 L;  3L2Q A;  1NU0 A;  4CBW A;  2O8B B;  1TVR A;  3DXM B;  5SWM A;  2YKN A;  2X78 A;  4NYF A;  4FLX A;  4FJ7 A;  4BRF A;  2QW9 A;  3WNF A;  3O9R A;  1RBV A;  3OYE A;  3LPT A;  5CY4 A;  4FWO A;  5M1P A;  5H1S Q;  3P31 A;  4KHU A;  3T19 A;  2IC3 A;  1D4X A;  5JS1 A;  3ZSR A;  3UB5 A;  4KB1 A;  5JMV A;  4MQ3 A;  2VWK A;  1SQK A;  3NCI A;  3PX6 A;  3FGU A;  1YUW A;  3CM5 A;  5AFU H;  1XMQ K;  2QK9 A;  5B8H A;  4Z4C A;  3UKU A;  4JK7 A;  3VQC A;  3DOK A;  3VER A;  3SUQ A;  1IO2 A;  3OS2 A;  3L4Q A;  4GV9 A;  1VQ6 N;  4HTL A;  1B9D A;  4B08 A;  2V7Y A;  3M8P A;  4M63 C;  5KQ8 A;  1BHL A;  2VQF K;  2UUA K;  3H6E A;  5TKW A;  4DSE A;  4MLH A;  4CFD A;  3CCQ N;  3MEE A;  5GIP A;  4CGF A;  4H5W A;  1BQM A;  1GOB A;  5CE3 A;  4B1Y B;  4WYB A;  1TUU A;  4KH4 A;  4H8K A;  1DTQ A;  3KD1 E;  3EKS A;  1JJ2 M;  1A5X A;  1HX1 A;  4BE0 A;  4KPY A;  3WQT A;  3V9W A;  5AQQ A;  3CFP A;  3AVB A;  1D9D A;  4V19 S;  1NGG A;  3DM2 A;  1QVF M;  3D2F B;  3A5N C;  3CCS N;  4H0O A;  4DR2 K;  4B3T K;  1IV0 A;  1WOQ A;  4OJR A;  3OYG A;  5TKY A;  2ZGY A;  4BR4 A;  3TR8 A;  2BGG A;  1NGE A;  3TAN A;  4MO5 A;  3NF7 A;  4H0T B;  1O13 A;  3PO4 A;  4O0J A;  3CG7 A;  1G15 A;  2VWB A;  3EL2 A;  1WAF A;  3EE9 A;  4FWS A;  3ZSV A;  1RBT A;  2Y1I A;  4HUE A;  1JLC A;  5GAD P;  1BI4 A;  3AVI A;  2A1R A;  3P5J A;  4BR7 A;  3T69 A;  1T03 A;  5EXW A;  4FSV A;  2X74 A;  2IOC A;  4FW2 A;  4BE2 A;  1HNI A;  2E1Y A;  4G1Q A;  4XH5 A;  2YNH A;  3HRG A;  4KO0 A;  3RMD A;  4UY8 O;  5ADX H;  1HKG A;  2P9S B;  4JI2 K;  2Z1H A;  2X6N A;  3RSE A;  1T6C A;  3O6W A;  5CYM A;  2GWK A;  4O8U A;  1XI1 A;  3NE6 A;  3V1Q A;  1QE1 A;  4AHR A;  3HVR A;  5HL7 L;  3ZSW A;  3RRH A;  4OKJ A;  1JCE A;  4B3R K;  1D9F A;  4LD0 A;  2QWO A;  1ILY A;  4DU4 A;  3QBW A;  4BGA A;  1NK5 A;  2G8K A;  3ZT3 A;  3C6A A;  4BRL A;  4EZ9 A;  2HB5 A;  1REV A;  2IIR A;  3I0R A;  4KHP K;  2A42 A;  1N5Y A;  4B3M K;  4H4O A;  1J54 A;  3AVM A;  4IJA A;  1J5E K;  2DY4 A;  3M3Z A;  1OH6 A;  1KLM A;  4CJW A;  3KLG A;  1XC9 A;  4JI8 K;  3KLI A;  3TTC A;  3OW2 M;  4YOV A;  1T3V A;  1ITG A;  3THX A;  3KK2 A;  4DS4 A;  4JHD A;  4RWT A;  4JI1 K;  3VQ7 A;  4CEZ A;  2BUP A;  4Y1D A;  3BZC A;  2F7T A;  3TSP A;  3S9H A;  1IH7 A;  5KRT A;  3S3M A;  1I94 K;  4FJI A;  1HNX K;  3JXU A;  5AQM A;  4JKH A;  1IG9 A;  3VA0 A;  1BA1 A;  1ESV A;  3OYA A;  2IVP A;  3PV8 A;  5BN9 A;  1EWR A;  5IWA K;  2W42 A;  3JYT A;  4G9Z A;  5LJV A;  1ASV A;  5CZ2 A;  1EO1 A;  4GVE A;  4JEP A;  1QSY A;  4CJQ A;  4JK9 A;  3OYC A;  1VSM A;  1ATN A;  1D5A A;  4CIF A;  3VN5 A;  1XUP O;  4N47 A;  1YIJ N;  1JXB A;  1JLQ A;  1NJI O;  4JD2 A;  3KK3 A;  2OZS A;  3O9S A;  3ZCM A;  3JAM O;  4CK1 A;  3HL8 A;  4CJL A;  3SV4 A;  1A5V A;  3M1F A;  5KQD A;  5GAE P;  4CVN E;  3NGZ A;  3AAR A;  5E84 A;  3OTO K;  1NJW A;  2F9T A;  3LP1 A;  2XRI A;  3KJV A;  2B5J A;  4CE9 A;  1VQK N;  4YHH K;  3J7Z O;  1IG8 A;  2OAN A;  2OPS A;  3O8M A;  1JLF A;  1CLQ A;  3AVF A;  5C42 A;  4OVL A;  3THY A;  3CYM A;  4BRC A;  1C1A A;  1E3M A;  4Z4H A;  3FZK A;  1NGA A;  5JLH A;  3QEI A;  4JI6 K;  5DM6 L;  4OPA A;  3U8X A;  3I33 A;  4CZI A;  4DFK A;  3AGR A;  2W40 A;  5AQT A;  2QXF A;  2FF3 B;  4FOI A;  5DK5 A;  3KWG A;  4W5R A;  2UU9 K;  1RDU A;  1S6Q A;  3LP3 A;  4CHP A;  4BC4 A;  1NK6 A;  1VAZ A;  3S41 A;  3CJA A;  4Q5V A;  1I39 A;  2NRV A;  4A57 A;  4TSX A;  3AA2 A;  2KKZ A;  5HRR A;  4DU3 A;  3R6M A;  4BR9 A;  3ZSX A;  4M3W A;  4HWI A;  4NXM K;  1HYS A;  2E8A A;  4BR5 A;  4FW1 A;  4ISE A;  2QI2 A;  3OYN A;  1WSE A;  1X9S A;  1M1K O;  3L3U A;  3MN7 A;  3VEZ A;  4AHT A;  4CJT A;  2YNG A;  4IFE A;  3CPE A;  3V1O A;  3ZX0 A;  2P9U B;  3UKR A;  1JKH A;  4JI3 K;  3K59 A;  2G8U A;  1NGD A;  3TPQ A;  3BF1 A;  3LDN A;  3SMP A;  2KZZ A;  5AQP A;  4BC3 A;  4CJF A;  4LF5 K;  4E3S A;  4MDA A;  4RG8 A;  4CED A;  1TKD A;  4BRP A;  4DU1 A;  4AM6 A;  1I3A A;  4DFP A;  3TSU A;  4BRK A;  2P9N B;  2PY5 A;  1ZC6 A;  1YVN A;  4CZG A;  5C12 A;  1OKJ A;  3ZET A;  1UAX A;  3OYH A;  4DTM A;  5GAG P;  3L2R A;  4BE1 A;  1RNH A;  1G99 A;  3N4P A;  4LFB K;  1X9M A;  1WSH A;  3GL1 A;  1SS6 A;  3A0I X;  4RW9 A;  1B9F A;  2NUB A;  4H0X B;  3FR0 A;  3QET A;  2G8W A;  1VSH A;  1B92 A;  4NCA A;  1OVQ A;  4BC2 A;  3H46 O;  3QFU A;  3MXI A;  2KTQ A;  1LCU A;  1LW2 A;  4CEB A;  3BDP A;  4E89 A;  4JNE A;  3EN9 A;  1YIT N;  3CCL N;  5M1N A;  4DSL A;  4FK0 A;  5AQU A;  4FVM A;  2HHU A;  3MCP A;  4IOA L;  2O8B A;  2UXB K;  5HOO A;  4DV7 K;  3DXM A;  3EKU A;  1WSI A;  3AO5 A;  2A5X A;  4PWD A;  3CJ7 A;  1Q9X A;  2B6A A;  1KC8 O;  4JK8 A;  5CYQ A;  3OS0 A;  2Q1N A;  2YX6 A;  1KTQ A;  1ZYQ A;  3LDQ A;  1VQP N;  1VSL A;  3T7Z A;  1M90 O;  3WNH A;  3V1R A;  2A41 A;  2OCE A;  3E9L A;  2E6M A;  3GBT A;  1L3T A;  1FW6 A;  3ZSZ A;  4Z4I A;  4FM0 A;  1DKG D;  2NNW A;  2OPQ A;  3ZX2 A;  4BG8 A;  4BQZ A;  1U45 A;  1JL1 A;  3DLL L;  3EYZ A;  2A40 A;  2D0C A;  3KD5 E;  1S1V A;  4KTW A;  4CJS A;  4F4K A;  1FXX A;  1BCO A;  4CK2 A;  1TUY A;  4AH9 A;  2ZD1 A;  3PX4 A;  4BR0 A;  5LY3 A;  5C15 A;  3RMA A;  4YOU A;  5I9E B;  3B6P A;  4BRM A;  5LMN K;  3CC2 N;  4DUZ K;  2WON A;  2NLX A;  4LSN A;  3DLG A;  3VEY A;  3HJF A;  4N41 A;  1TKZ A;  5KI6 A;  3IRX A;  5AQG A;  1U04 A;  4XH4 A;  4IWV A;  1U49 A;  2P9P B;  2YV0 X;  2GWJ A;  3SQ1 A;  3QLH A;  3C6U A;  1TYQ B;  4HCB A;  2JGU A;  3SAF A;  3BEX A;  1QZ5 A;  3EY1 A;  1BA0 A;  2G8I A;  2D1K A;  1CZB A;  3D2F A;  5F0X A;  4C8O A;  1GOC A;  2HHT A;  3L2V A;  1IKX A;  3BZK A;  4M3Y A;  3J7Y P;  3VEX A;  2O8F B;  3PSI A;  2IS3 A;  3MN9 A;  2Y1J A;  2OPR A;  3WEE B;  3R1X A;  4CZH A;  4J2A A;  2KZM A;  4GW6 A;  1L5U A;  5FRM A;  3MWT A;  4IOX A;  5BPM A;  4CJE A;  1T44 A;  2IDO A;  4JKG B;  4I2P A;  1K8A O;  5D3G A;  4BGB A;  2PFU A;  3IS9 A;  2Q2R A;  1KAY A;  4BRN A;  4FLZ A;  2JWK A;  4WQ5 C;  3CCU N;  1HNW K;  1P8Z A;  5FPD A;  5FPM A;  1YXQ A;  1W7A A;  1NNE A;  1VRT A;  2UXC K;  4W5O A;  3HPG A;  3NH1 A;  1BO5 O;  3AAP A;  1HQU A;  5C25 A;  3WXJ A;  3U9Z A;  4OX9 K;  3E66 A;  4M3T A;  3L4I A;  3QIN A;  1YAG A;  3PO5 A;  3OVN A;  2P9S A;  3SCX A;  3AVK A;  1VSE A;  4EHU A;  2VCP A;  4EHT A;  1Z25 A;  1IBL K;  2E6L A;  4C8L A;  2LSN A;  3VQ5 A;  4ISG A;  1WSJ A;  3LM9 A;  4FPB A;  4B9N A;  2HBK A;  3MWP A;  4K43 A;  3K5O A;  5BRH A;  4FLW A;  1Y97 A;  4LF7 K;  3BF3 A;  3U3Y A;  1EWQ A;  5C2D A;  2F8T A;  4LF8 K;  2ITM A;  1KQS M;  4DV0 K;  3H1Q A;  3CJ1 A;  5KPZ A;  1HPM A;  3T1Y K;  3K57 A;  1Q7Y O;  1GLC G;  4I6M B;  5FPN A;  3V81 A;  3IAY A;  3CQX A;  5FRO A;  4Z94 A;  4JI0 K;  3DOL A;  4WQ5 A;  2G8V A;  3LP2 A;  4A61 A;  3ATV A;  2F9W A;  3LAK A;  4FWQ A;  3AVG A;  3MN6 A;  4B9S A;  1RDC A;  5AQR A;  2HBJ A;  4PL7 A;  4QS8 A;  1RTJ A;  4IG3 A;  3NF8 A;  1NGJ A;  4K0K K;  3AA5 X;  2AA4 A;  3V9Z A;  2WBN A;  4YNQ A;  3CCR N;  4OKK A;  1OVY A;  4ELV A;  4CFA A;  5FDL A;  3KZB A;  4F9O A;  3MAQ A;  4B9L A;  2PAV A;  3KHY A;  5AQO A;  1IBM K;  3P39 A;  3M8R A;  5HRP A;  3ATU A;  2NRT A;  2CGK A;  2GUP A;  4H5R A;  5J2M A;  3I55 N;  1DEJ A;  3MED A;  3FLC O;  3QIC A;  4BRQ A;  4WE1 A;  4DR4 K;  2RKI A;  1HJR A;  5BRE A;  3V4I A;  5J2N A;  4I9L A;  2P5G A;  3KVG A;  4M3X A;  4FWN A;  4ZHR A;  5GIO A;  1NGF A;  1S9E A;  3AO1 A;  3FZH A;  4C8M A;  1L3V A;  4CFC A;  2HVI A;  1YJW N;  2NRZ A;  1TL3 A;  1MU2 A;  4FLY A;  3WNE A;  4IO9 L;  4DQR A;  2QTD A;  4W5T A;  4C1N K;  3VEO A;  4FK2 A;  3G71 N;  4EP4 A;  3OS1 A;  3WNG A;  4CF2 A;  1HPZ A;  3CF5 L;  1X3N A;  4DFJ A;  2GEL A;  1TKT A;  4GV3 A;  4JAX A;  2QA4 N;  2Q36 A;  3O3H A;  3CQ8 A;  4HTU A;  1S3X A;  1TK5 A;  4A5B A;  1NGB A;  2DPN A;  1J6Z A;  3MEG A;  4K8X A;  3LL3 A;  3JSM A;  3ID8 A;  5SZT A;  1A5W A;  4B8C A;  1TAU A;  3O4N A;  3HTV A;  3SAH A;  1N8R O;  4JYA K;  5BRD A;  3ZT2 A;  3OYK A;  2DFH A;  1LOT B;  4KHY A;  3VQ9 A;  4W5N A;  4ELT A;  4DHY A;  2ZF5 O;  4EAH D;  4NLC A;  1QSL A;  2CH6 A;  3KK1 A;  5JVG L;  4WFB L;  4F3O A;  2QWN A;  3P1G A;  2FBY A;  1Q18 A;  3FZF A;  4BWM A;  3Q7B A;  2FSN A;  3W0L A;  4FL9 A;  4DR5 K;  5KPR A;  1S1W A;  3V6D A;  5LJW A;  3IFR A;  4WCE L;  3DLE A;  3MEC A;  2GV9 A;  4IZ9 A;  2I7P A;  4BQL A;  3VGM A;  3WT0 A;  1DGK N;  1E4F T;  3C0B A;  3DXK B;  2WTU A;  4B1V A;  3EZ5 A;  3JS6 A;  3VEV A;  1X9J A;  3VQE A;  4U67 L;  3CPW M;  4JKB A;  1BDG A;  4B3S K;  3P38 A;  4AF1 A;  1RTI A;  2XY5 A;  1RT1 A;  2ASM A;  3DLK A;  3O4Q A;  4Z4F A;  3O5B A;  1S9G A;  2QWM A;  1K8K B;  3IKM A;  5CR4 A;  5FLX O;  2W6L A;  3J8A A;  1LW0 A;  1KVB A;  2HND A;  5I3U A;  3K5M A;  1VQL N;  4CF0 A;  1J9A A;  4OLA A;  2Z1G A;  4F3T A;  3FFK B;  3RR7 A;  3QEV A;  2HMI A;  4DQQ A;  5JS2 A;  4CHO A;  3SQ0 A;  5AQZ A;  3CCV N;  1MA9 B;  4J8F A;  4JRQ A;  4C23 A;  1L3S A;  2HBL A;  4O5F A;  4M3U A;  1KAZ A;  2HVH A;  4HHT A;  3LM2 A;  1OH7 A;  4YOR A;  4RW6 A;  2IVN A;  4O55 A;  4EP5 A;  3CCM N;  3TAQ A;  1SL1 A;  2PYJ A;  3HBT A;  5MLC Q;  4BG9 A;  1Z05 A;  3KKR A;  4KV8 A;  3VET A;  4M45 A;  3M8Q A;  5ELZ A;  1QS4 A;  2ZM6 K;  3EE8 A;  4Z0U A;  2F4V K;  4FJ5 A;  4X65 K;  1VHX A;  3O9T A;  4AM7 A;  1HKC A;  2OPP A;  3AV9 A;  3GDQ A;  3QB0 A;  3L6Q A;  1Y64 A;  4ZTF A;  4I9Q A;  2W41 A;  4BRE A;  4X62 K;  3QFP A;  3DLR A;  3I8B A;  4ID5 A;  4OGC A;  4DS5 A;  3H45 C;  1U2V B;  4E7H A;  4OLB A;  3DRS A;  4M7X A;  3ZEU B;  2ITG A;  3ENB A;  4CBU A;  4CZF A;  3ZLJ A;  4L3Q A;  3O08 A;  1Q82 O;  3PLA A;  3ZSQ A;  3H3O B;  3TAR A;  3I0S A;  1YF5 L;  2NRR A;  3LAL A;  5EVZ A;  2UXD K;  2GBZ A;  4RW4 A;  3LAM A;  3C7N A;  1BUP A;  4K41 A;  3AAQ A;  1ATR A;  4H0P A;  3CQY A;  4FJN A;  5LMU K;  4MO4 A;  1TK0 A;  4J2E A;  3OBW A;  2P9P A;  2HBM A;  1RBU A;  1QQO A;  3E01 A;  4O4G A;  3VQQ A;  1TYQ A;  5AQH A;  5J2Q A;  3HST B;  2VG5 A;  2FXU A;  3ZT0 A;  4CHY A;  4U7B A;  3F2K A;  4J2B A;  1U4B A;  4YY3 K;  3TTF A;  2O8F A;  3L2U A;  3G10 A;  3U3G A;  1BL3 A;  2A1S A;  4CFB A;  3K0S A;  3IUC A;  3WEE A;  1BQN A;  4DSK A;  1NK4 A;  2HNY A;  2D0O A;  1JLG A;  3SUP A;  3FZL A;  3O1B A;  2E5L K;  2V7Z A;  1N34 K;  3CC7 N;  4IOC L;  4JKG A;  3ZSY A;  4FLU A;  4O44 A;  2V51 B;  3CM6 A;  5HRO A;  3VMF B;  4CJP A;  3THW B;  4IXC A;  3VF2 A;  3D2E A;  1XC3 A;  4CCH A;  2XY8 A;  5HBM A;  5AR0 A;  4FJJ A;  2ASP A;  1LWE A;  2FC0 A;  3EO3 A;  3RWU A;  3LZJ A;  1QSS A;  3MX5 A;  2H3G X;  5AQS A;  3FZM A;  1QQM A;  2YCH A;  2YHB A;  1U47 A;  4B9M A;  5ADX A;  4Z4E A;  4CBX A;  3HK2 A;  3TWH A;  2DFE A;  3PSF A;  4FJG A;  1N6Q A;  4JLH A;  5KTQ A;  3OYM A;  4JRP A;  2GUI A;  3QEX A;  4PQU A;  4BC5 A;  4RCH A;  4BDZ A;  1CZ9 A;  3MX2 A;  3NVM A;  1SKW A;  1W9H A;  1ATS A;  1SV5 A;  1GLB G;  4NO7 A;  3H08 A;  3KIO A;  2G8H A;  4CIE A;  1NG9 A;  4YOT A;  3QO9 A;  3D6R A;  4IBN A;  5AZI B;  3OJU A;  4KRF A;  2ZGZ A;  4I6M A;  4FM2 A;  3M8S A;  1X1P A;  1IKV A;  1LAW A;  2ATQ A;  4B1U B;  4HCC A;  4XEI A;  2YI1 A;  4E1M A;  2R7Y A;  4GVM A;  2D4W A;  5CZ1 A;  3ULE A;  3CD6 N;  4E7K A;  4IJN A;  2E2Q A;  4FJL A;  2XHB A;  4OPH A;  1RDB A;  1NOY A;  4ILG B;  3AVN A;  4DTU A;  4FJX A;  3SYZ A;  3QEP A;  4ELU A;  1JXE A;  4PKG A;  2ZE2 A;  3CC4 N;  3LDL A;  1J5O A;  3TI0 A;  3FFI A;  3RRG A;  4MLE A;  2WC9 A;  2YHY A;  1S1T A;  1C1C A;  5K14 A;  4PHT X;  5AQF A;  4DQI A;  4NCG A;  1TAQ A;  5M1F A;  1NK0 A;  4RTF D;  1BGX T;  2CGL A;  2KHO A;  3ITH A;  3F9M A;  3TAF A;  1EXQ A;  3CET A;  2P9I B;  1HYV A;  2PYL A;  3P4I A;  2ZJP L;  1HJO A;  2AP1 A;  5AQV A;  4W5Q A;  1ZBF A;  4BY9 C;  1JLA A;  3CJC A;  4DTS A;  3IDH A;  4DSJ A;  3IMX A;  1VQN N;  4DR1 K;  1NJZ A;  3OYJ A;  4QAG A;  3NH0 A;  2BAN A;  4NYN A;  3HOT A;  3O9Q A;  3TAB A;  3B8A X;  2EX3 A;  2A3Z A;  3ZT1 A;  4K42 A;  3ZX3 A;  4N5S A;  5T7B A;  4DG1 A;  1Q86 O;  4KRE A;  1GLA G;  3THV A;  2FBV A;  3CMA N;  1KAX A;  3ISN C;  5AZJ B;  3G4S N;  4FZY A;  2HHW A;  2YHA A;  1XNQ K;  1VSD A;  3H3N O;  1NK7 A;  3LDO A;  2RHK A;  5KGX A;  1NGC A;  4RW8 A;  4BRD A;  5BR8 K;  4FLV A;  5M1K A;  3ZT4 A;  1YHQ N;  2OZM A;  3GE1 A;  1RGI A;  4B9V A;  4FPA A;  3NVK A;  5C2F A;  3ASM A;  3HZ6 A;  3SBG A;  1RIL A;  3D45 A;  4JHD B;  3BP8 A;  1YTA A;  4DR6 K;  4J2D A;  4KHN A;  4FVU A;  1UWB A;  1MDU B;  4DTP A;  4KI6 A;  1LAV A;  2E20 A;  4JKD A;  3U9D A;  4CEA A;  4EFH A;  1TK8 A;  2FBT A;  1MWK A;  1NKB A;  4DQS A;  1Q81 O;  4FZX C;  1S1X A;  2EHG A;  3KWI A;  1GLF O;  4CZM A;  3AVC A;  4KTZ A;  1NBW A;  2D5R A;  4E1N A;  4GY2 B;  1EP4 A;  5A2Q O;  2VQE K;  4CJU A;  4BAC A;  4FCY A;  4KI4 A;  3SV3 A;  4CJ5 A;  1KVA A;  1IKY A;  2P9K B;  3E9O A;  4CEQ A;  2HHX A;  1RT4 A;  1TKX A;  4Q0B A;  2UUC K;  2RF2 A;  1XMO K;  2F96 A;  2XO7 A;  4AQY K;  4CEF A;  2HHV A;  1H1V A;  3GOI A;  4DCH A;  1FKO A;  1W0H A;  4FWM A;  4YOY A;  1C0U A;  2FSK A;  3SMS A;  3LDS A;  2HST A;  4DV6 K;  1QQN A;  4M3Z A;  5EX5 A;  1V4S A;  3HOS A;  1RBR A;  1RTH A;  3KLF A;  4Z4G A;  3VTH A;  4LFC K;  3DXK A;  3VQ4 A;  3C65 A;  2QKB A;  3SUO A;  3KKS A;  2O8E B;  4DV2 K;  3CIP A;  3THY B;  4CZL A;  3M5R A;  1ZBL A;  1DTT A;  2FBX A;  4CER A;  1K8K A;  1RTD A;  4CGJ A;  3PIP L;  4B1Z A;  1WBB A;  2Q31 A;  1HR0 K;  4FYD A;  2W6K A;  1Z26 A;  3AA4 A;  2IGI A;  3MMV A;  3VGK A;  1UA0 A;  3SPY A;  2F8S A;  4ILH A;  3KLE A;  3K2P A;  4FOE A;  3VGL A;  3A5O C;  1VSI A;  1KLN A;  3VQA A;  4CD3 A;  5KRS A;  4BR2 A;  2DTU A;  4L8R B;  1P90 A;  1C0M A;  4KH6 A;  5AQY A;  3SI6 A;  1WNS A;  1ZBH A;  3T1A A;  1VQO N;  4ZTJ A;  3HM9 A;  4A2A A;  3LP0 A;  4CGG A;  3MXM A;  4CGD A;  3HP9 A;  3TAM A;  4LY7 A;  1QHA A;  3TAE A;  4E0D A;  4R79 A;  4H03 B;  4DWI A;  3HT3 A;  4B8A B;  2QKK A;  3VA3 A;  4QS9 A;  1LWC A;  1QQC A;  4OGE A;  2NZT A;  3CI5 A;  4FWR A;  3OY9 A;  2Q97 A;  3O4W A;  4IDK A;  4CJ4 A;  4LH4 A;  1VQ5 N;  4B3O A;  4DTR A;  2HHS A;  2BTF A;  4GKJ K;  3AY9 A;  4IG0 A;  4DF4 A;  2HMP A;  1N36 K;  4CEE A;  4LF9 K;  3NH2 A;  4FJ8 A;  4PA1 A;  2WUS A;  4AHS A;  4FLT A;  2D0A A;  3ZEU A;  3CCJ N;  3CJ9 A;  1LWF A;  1QVG M;  3UE5 A;  3OYL A;  3PX0 A;  5CHI A;  1KSP A;  3VOV A;  3NDK A;  1K73 O;  1T05 A;  1WSG A;  5AQK A;  1ZBU A;  3SJJ A;  2KW4 A;  4FO0 A;  4QCL A;  2P9L B;  1YT3 A;  4CF1 A;  2YNI A;  2OYQ A;  4H0V B;  3WXK A;  4EIA A;  4YDU C;  1O1W A;  4DV4 K;  3AVA A;  3DMJ A;  5HRN A;  2O8C B;  3F9K A;  5BN8 A;  4F8R A;  3SUN A;  3WUH A;  4CF8 A;  2D0P A;  4DLG A;  1KD1 O;  3EZW A;  3SZ2 A;  4JI7 K;  3G0Z A;  2BE2 A;  1BIZ A;  5AQJ A;  4LSL A;  3CXC M;  3E1Y A;  5HRS A;  1ZBI A;  4DMN A;  1TGO A;  1Z6R A;  3U6F A;  1BOT O;  1LV5 A;  4K25 A;  4BDP A;  3ID6 A;  2RN2 A;  4XH1 A;  2OTL N;  1NKC A;  3VQB A;  4FXD A;  1HLU A;  5BR9 A;  3NAE A;  3O9U A;  3SLC A;  4A62 A;  3L3V A;  3R9P A;  3W3D A;  4FM1 A;  3AVJ A;  3THW A;  4H0Y B;  2HF4 A;  1V4T A;  2VWJ A;  1SZ2 A;  2X6S A;  4IKF A;  2YJF A;  4BDY A;  5EOY A;  2P5O A;  1XWL A;  2GEM A;  1R0A A;  1DT9 A;  3BUZ B;  4Y1C A;  4BRH A;  1N32 K;  4YDU A;  2VGN A;  2VG7 A;  3F73 A;  4K8Z A;  3AGK A;  2I7N A;  3RTV A;  4WFN L;  1VQ7 N;  3VQD A;  4QS7 A;  4CI6 A;  2P9U A;  1YI2 N;  1X9W A;  4KB0 A;  1JCF A;  4CHN A;  3HPO A;  1C0G A;  3G25 A;  5F2R A;  1RDW X;  1CXU A;  3VPZ A;  4ILJ A;  4BRG A;  1NWK A;  3AO2 A;  5DM7 L;  3QIP A;  5AZI A;  3HP6 A;  4JKA A;  4DV5 K;  3OHR A;  3QER A;  3OJS A;  2XY7 A;  2P9N A;  4JI5 K;  5LL6 Z;  2HHQ A;  1F21 A;  4JV5 K;  5M1O A;  1X3M A;  3FE1 A;  4CZJ A;  1C0T A;  1CXQ A;  4CJK A;  2O4I A;  4DLE A;  4HUF A;  4CW7 B;  3CJB A;  2YJE A;  3OA9 A;  3SQ2 A;  3D0P A;  4DTN A;  4KAZ A;  4DF8 A;  2B4J A;  5JLF A;  3Q7C A;  4GKK K;  2ZJQ L;  3UIQ A;  1EET A;  2WFB A;  2VYP A;  1WSF A;  1S1U A;  3TU5 A;  3DYA A;  2O4G A;  1YVU A;  2VGM A;  4FWK A;  4UQG A;  4IDH A;  1GLE G;  4A59 A;  3J81 O;  2RPI A;  3OBY A;  5GAH P;  3MXJ A;  3ENH A;  1BIU A;  2CGJ A;  4CZK A;  4DQP A;  4CD1 A;  1FKP A;  4IEE A;  3HYF A;  2P9I A;  2ZWH A;  3V9U A;  3F5T A;  1N33 K;  4FZZ A;  4I2Q A;  1NOZ A;  4M7Y A;  4H5V A;  4AIL C;  4CJV A;  3CCE N;  5EU7 A;  1HNZ K;  2QWR A;  3U4L A;  4B9Q A;  3HSC A;  1S22 A;  2ZJR L;  4MFB A;  3LWM A;  4CJR A;  3TAG A;  3SQ4 A;  3CER A;  2OTJ N;  3T1H K;  5AFU A;  3C6H A;  5AZJ A;  3MCA B;  2O8D B;  3PY8 A;  2EWS A;  4BWJ A;  4AHU A;  2P51 A;  3LZI A;  5IT9 O;  5AQI A;  4FJK A;  5J2P A;  5DMR A;  1NKE A;  4PUO A;  3NF6 A;  4E1J A;  1J53 A;  4GNI A;  1SL0 A;  3CFO A;  4PKH A;  2KQ2 A;  1IJJ A;  1ZBS A;  4CEO A;  3R3L A;  1NJX A;  2WOM A;  1HUX A;  3LWL A;  1NGI A;  1VSJ A;  2OA8 A;  1L3U A;  1JL2 A;  3KLH A;  3I56 N;  3QNO A;  3MDQ A;  1HQE A;  1ASU A;  3LAN A;  4YOX A;  4AHV A;  4KTQ A;  4LF6 K;  4H5N A;  3WQU A;  1KCF A;  3A8Y A;  3TTD A;  1JCG A;  5C24 A;  3L8B A;  3DWL A;  3ZSO A;  2P9K A;  1YJN N;  3K58 A;  4X64 K;  1DLO A;  1BWF O;  1WN7 A;  4CIG A;  3LPU A;  4GMJ B;  3O3G A;  1WB9 A;  3T3F A;  3B6O A; 
#chains in the Genus database with same CATH homology
 4OJR A;  3ZT1 A;  2HNZ A;  3OYG A;  4N5S A;  3V81 A;  5T7B A;  4DG1 A;  3IAY A;  4KRE A;  5FRO A;  3TR8 A;  1Q9Y A;  2BGG A;  3THV A;  2FBV A;  3TAN A;  1KFD A;  3ISN C;  3DOL A;  3NF7 A;  3DLH A;  2G8V A;  4FZY A;  2YHA A;  3LP2 A;  1VSD A;  1NK7 A;  3QEW A;  2HHW A;  5KGX A;  3PO4 A;  4RW8 A;  2D0B A;  4FLV A;  5HP1 A;  3LAK A;  4O0J A;  3CG7 A;  1G15 A;  4OKE A;  3AVG A;  1WAF A;  3ZT4 A;  1SKS A;  4B9S A;  3ZSV A;  2OZM A;  1RBT A;  1RDC A;  2Y1I A;  1XHZ A;  4HUE A;  3L2W A;  1JLC A;  1RTJ A;  3NF8 A;  4IG3 A;  3O3F A;  5I3U A;  1U48 A;  3ASM A;  4B9V A;  1BI4 A;  1EKE A;  3AVI A;  1IKW A;  3AA5 X;  4CJ3 A;  3P5J A;  2A1R A;  1RIL A;  3V9Z A;  2HMI A;  3D45 A;  1T03 A;  1YTA A;  2X74 A;  4CGH A;  4J2D A;  4YNQ A;  4KHS A;  4OKK A;  4DSI A;  5HLF A;  3OYF A;  4ID1 A;  2IOC A;  4CFA A;  4ELV A;  3DRR A;  4FW2 A;  4BE2 A;  4KHN A;  1HNI A;  1UWB A;  4G1Q A;  2I5J A;  5FDL A;  4DTP A;  4KI6 A;  2IAJ A;  2YNH A;  1LAV A;  4CEA A;  3MAQ A;  4KO0 A;  3RMD A;  1KFS A;  4B9L A;  3OYD A;  2Z1H A;  2X6N A;  1TK8 A;  2FBT A;  1NKB A;  4DQS A;  1K6Y A;  4FZX C;  1RT7 A;  1KVC A;  5CYM A;  3M8R A;  1XI1 A;  3ALY A;  3NE6 A;  1S1X A;  5HRP A;  2EHG A;  3V1Q A;  4C8N A;  4E7J A;  1QE1 A;  3AVC A;  3RR8 A;  4AHR A;  1UOC A;  4KTZ A;  3HXM A;  4FK4 A;  1TV6 A;  2D5R A;  4I7F A;  1XHX A;  4E1N A;  3HVR A;  2HW3 A;  1EP4 A;  4BAC A;  5J2M A;  4CJU A;  3ZSW A;  3RRH A;  4OKJ A;  3MED A;  4FCY A;  1D9F A;  4KI4 A;  4LD0 A;  3SV3 A;  4CJ5 A;  1KVA A;  4DU4 A;  1NK5 A;  2G8K A;  1IKY A;  2BDP A;  4CEQ A;  2HHX A;  4WE1 A;  1GOA A;  1RT4 A;  1TKX A;  2E4L A;  3ZT3 A;  4F2R A;  4Q0B A;  3A2F A;  2RF2 A;  2RKI A;  1HJR A;  2F96 A;  4ICL A;  2XO7 A;  1VSK A;  3V4I A;  4CEF A;  3OYB A;  2HHV A;  5J2N A;  4I9L A;  1JLB A;  2P5G A;  4E7I A;  4M3X A;  1BCM A;  4EZ9 A;  1NJY A;  1FKO A;  1W0H A;  2HB5 A;  1REV A;  4ZHR A;  1T7P A;  3I0R A;  1C0U A;  1S9E A;  3LDS A;  4M3Z A;  1N5Y A;  4H4O A;  1J54 A;  2VG6 A;  3AA3 A;  3AO1 A;  3AVM A;  1RBR A;  1RTH A;  3KLF A;  4Z4G A;  4HUG A;  4C8M A;  5KGW A;  4EZ6 A;  2DY4 A;  1KLM A;  1L3V A;  4CJW A;  4CFC A;  3DRP A;  3VQ4 A;  2QKB A;  3SNN A;  2HVI A;  1HRH A;  3SUO A;  3KLG A;  3TAP A;  1XC9 A;  3KLI A;  1TL3 A;  1MU2 A;  4FLY A;  2YNF A;  3WNE A;  1ITG A;  3KKS A;  4DQR A;  1WAJ A;  1HYZ A;  3HVT A;  3KK2 A;  4DS4 A;  4W5T A;  4JS4 A;  3QNN A;  4FK2 A;  5FRN A;  1ZBL A;  3VQ7 A;  4EP4 A;  3OS1 A;  4CEZ A;  4H4M A;  3WNG A;  4CF2 A;  1HPZ A;  4PY5 A;  4Y1D A;  4DFJ A;  1TKT A;  1BI4 B;  3S9H A;  1IH7 A;  5KRT A;  1SL2 A;  1RDD A;  1DTT A;  2DFF A;  3S3M A;  2FBX A;  4FJI A;  4CER A;  1JLE A;  3O3H A;  3CQ8 A;  4HTU A;  1RTD A;  4CGJ A;  1TK5 A;  1Q8I A;  3MEG A;  4KHQ A;  1IG9 A;  4K8X A;  4DTX A;  3JSM A;  3VA0 A;  5SZT A;  1A5W A;  4B8C A;  4FYD A;  1Z26 A;  3OYA A;  1TAU A;  3O4N A;  1T8E A;  2KFZ A;  3AA4 A;  2IGI A;  2Q3S A;  3PV8 A;  1UA0 A;  3NF9 A;  1KRP A;  2W42 A;  3SPY A;  3JYT A;  1BIS A;  3K5L A;  2F8S A;  1ASV A;  3DI6 A;  5CZ2 A;  3ZT2 A;  3OYK A;  3S3O A;  2DFH A;  3KLE A;  3K2P A;  4KHY A;  1QSY A;  3VQ9 A;  4CJQ A;  4W5N A;  4ELT A;  1VSI A;  4R5P A;  3OYC A;  3VQA A;  4CEC A;  4E7L A;  1KLN A;  1QSL A;  5KRS A;  1VSM A;  3KK1 A;  1NK8 A;  1D5A A;  2DTU A;  4CIF A;  4L8R B;  4F3O A;  1C0M A;  3VN5 A;  4N47 A;  3SI6 A;  4FJ9 A;  1WNS A;  1ZBH A;  1JXB A;  1JLQ A;  3T1A A;  1C6V A;  1EX4 A;  3P1G A;  4ZTJ A;  3HPH A;  3KK3 A;  3HM9 A;  2FBY A;  4KFB A;  3ZCM A;  3LP0 A;  2OZS A;  4CK1 A;  3HL8 A;  2P1J A;  4BWM A;  4CJL A;  3SV4 A;  1A5V A;  4CGG A;  3MXM A;  4YFU A;  4CGD A;  3HP9 A;  3TAM A;  4LY7 A;  3NGZ A;  3TAE A;  4E0D A;  4DWI A;  1ASW A;  1S1W A;  4B8A B;  3HT3 A;  3V6D A;  1NJW A;  2QKK A;  3LP1 A;  2XRI A;  3KJV A;  3VA3 A;  2B5J A;  1LWC A;  1QQC A;  4CE9 A;  4OGE A;  3DLE A;  3MEC A;  4DTO A;  2OPS A;  2GV9 A;  3OY9 A;  1JLF A;  4CK3 A;  4IFV A;  4IDK A;  4CJ4 A;  1CLQ A;  3AVF A;  4CHZ A;  4OVL A;  5C42 A;  4LH4 A;  3CYM A;  1C1A A;  4Z4H A;  3EZ5 A;  3C95 A;  4NCB A;  2YKM A;  4B3O A;  3OYI A;  4DTR A;  3QEI A;  3VQE A;  2HHS A;  1YTU A;  4F2S A;  4IG0 A;  4DF4 A;  4FJH A;  3P83 D;  4N56 A;  4DFK A;  1RTI A;  3PUF A;  4CEE A;  2XY5 A;  4CES A;  3NH2 A;  1RT3 A;  4FJ8 A;  1RT1 A;  2QXF A;  1VRU A;  3DLK A;  3O4Q A;  4PA1 A;  5DK5 A;  4Z4F A;  4W5R A;  3QES A;  1S9G A;  4AHS A;  1S6Q A;  2Z1J A;  2D0A A;  3LP3 A;  4CHP A;  4FLT A;  1NK6 A;  1LWF A;  4DTJ A;  4E19 A;  4Q5V A;  3OYL A;  4DSF A;  3PX0 A;  1I39 A;  3KTQ A;  3AO3 A;  3CFR A;  1KSP A;  4TSX A;  1LW0 A;  1KVB A;  2HND A;  2ZQB A;  3NDK A;  3AA2 A;  3K5M A;  4O5B A;  1WSG A;  4CF0 A;  1ZBU A;  5HRR A;  3SJJ A;  1T05 A;  1J9A A;  4DU3 A;  1SUQ A;  4OLA A;  1QHT A;  3ZSX A;  3ULD A;  2Z1G A;  4M3W A;  4F3T A;  4IFY A;  2KW4 A;  3NBP A;  1HYS A;  3RR7 A;  4FJM A;  3QEV A;  4HVJ A;  4FW1 A;  4QCL A;  5J1E A;  1YT3 A;  4CF1 A;  2YNI A;  5JS2 A;  3OYN A;  4DQQ A;  4CHO A;  1WSE A;  3RMC A;  2JLE A;  3SQ0 A;  1X9S A;  4C8K A;  3L3U A;  4AHT A;  4CJT A;  4JRQ A;  3DLB A;  2YNG A;  1O1W A;  3V1O A;  3RMB A;  1L3S A;  3AVA A;  4B9U A;  3DMJ A;  5HRN A;  4M3U A;  2HVH A;  4HHT A;  1JKH A;  3K59 A;  3F9K A;  2G8U A;  2OYQ A;  4N76 A;  4F8R A;  4RW6 A;  3SUN A;  2KZZ A;  3AVH A;  4CF8 A;  4AHC A;  4DLG A;  4CJF A;  3VQ6 A;  3SZ2 A;  3G0Z A;  4O55 A;  1RDA A;  2BE2 A;  4EP5 A;  1BIZ A;  4E3S A;  4DFM A;  3TAQ A;  1SL1 A;  2PYJ A;  4LSL A;  1WLJ A;  4RG8 A;  4CED A;  1TKD A;  1RBS A;  5HRS A;  1ZBI A;  4DU1 A;  4DMN A;  1TGO A;  3KKR A;  3U6F A;  1LV5 A;  4BDP A;  4M41 A;  4KV8 A;  1I3A A;  2RN2 A;  4DFP A;  4JS5 A;  2PZS A;  1NKC A;  4M45 A;  3M8Q A;  3VQB A;  3V9S A;  1QS4 A;  3VQ8 A;  1SKR A;  4FXD A;  4Z0U A;  4CGI A;  2PY5 A;  4FJ5 A;  3NGI A;  3NAE A;  4QOZ B;  3L3V A;  1S6P A;  1UAX A;  3OYH A;  4DTM A;  3L2R A;  4BE1 A;  2OPP A;  3AV9 A;  1RNH A;  4FM1 A;  3S3N A;  3AVJ A;  4ZTF A;  1X9M A;  4I9Q A;  1HMV A;  3IG1 A;  1FK9 A;  1D8Y A;  1WSH A;  3DLR A;  4RW9 A;  2ETJ A;  4ID5 A;  1B9F A;  2NUB A;  4OGC A;  4DS5 A;  2VWJ A;  3QET A;  4O0I A;  2X6S A;  3C6T A;  4E7H A;  2G8W A;  1VSH A;  4IKF A;  1B92 A;  4NCA A;  3DRS A;  4M42 A;  4OLB A;  2AJQ A;  4BDY A;  2ITG A;  2P5O A;  3MXI A;  2KTQ A;  1XWL A;  4OPJ A;  1VSF A;  1LW2 A;  4CEB A;  3BDP A;  3ZSQ A;  4E89 A;  1R0A A;  3TAR A;  1RCH A;  3I0S A;  4Y1C A;  4DSL A;  4FK0 A;  3LAL A;  3V9X A;  2GBZ A;  1C1B A;  4RW4 A;  3LAM A;  2VG7 A;  4CF9 A;  4CHQ A;  5I42 A;  4FVM A;  2HHU A;  3F73 A;  4K8Z A;  1HNV A;  3RTV A;  3VQP A;  3VQD A;  3NHG A;  1QTM A;  4FJN A;  4KB0 A;  1X9W A;  3I8D A;  1TK0 A;  4CHN A;  1WSI A;  3AO5 A;  3HPO A;  4J2E A;  4PWD A;  1RBU A;  1Q9X A;  3E01 A;  4LH5 A;  4O4G A;  2B6A A;  3VQQ A;  5CYQ A;  5J2Q A;  1CXU A;  3OS0 A;  3HST B;  3AO4 A;  2VG5 A;  1S5J A;  1KTQ A;  3AO2 A;  3ZT0 A;  4CHY A;  1RT6 A;  3NFA A;  1ZYQ A;  1VSL A;  3QIP A;  4J2B A;  1U4B A;  3HP6 A;  3WNH A;  3V1R A;  3AVL A;  3L2U A;  3BGR A;  3G10 A;  4KKO A;  1BL3 A;  2A1S A;  3U3G A;  4CFB A;  3QER A;  3OJS A;  2XY7 A;  3C94 A;  1RT2 A;  3SPZ A;  2KFN A;  1BQN A;  2E6M A;  1L3T A;  4DSK A;  1NK4 A;  2HNY A;  3ZSZ A;  2HHQ A;  1F21 A;  1JLG A;  3SUP A;  4Z4I A;  4FM0 A;  3K5N A;  1C0T A;  1CXQ A;  2OPQ A;  4CJK A;  4KHW A;  2O4I A;  4DLE A;  4OPK A;  1U45 A;  4HUF A;  1JL1 A;  3ZSY A;  4FLU A;  3EYZ A;  4XIU A;  4O44 A;  2D0C A;  3KD5 E;  4RW7 A;  3CM6 A;  3SQ2 A;  5HRO A;  4M3R A;  3D0P A;  1S1V A;  2Z1I A;  4KTW A;  5E41 A;  4DTN A;  4KAZ A;  4DF8 A;  2B4J A;  4CJS A;  3HO1 A;  3QIO A;  4CJP A;  4F4K A;  3NGY A;  1FXX A;  1BCO A;  4CK2 A;  4CCH A;  2XY8 A;  5HBM A;  4AH9 A;  3UIQ A;  4FJJ A;  1EET A;  1LWE A;  2G8F A;  2ZD1 A;  1VK0 A;  1WSF A;  1S1U A;  2FC0 A;  3DYA A;  3PX4 A;  3RWU A;  2O4G A;  1RT5 A;  3LZJ A;  1YVU A;  1QSS A;  4UQG A;  3RMA A;  4B9T A;  3B6P A;  2YHB A;  1U47 A;  4B9M A;  2WON A;  2XY6 A;  2RPI A;  4Z4E A;  3MXJ A;  3DLG A;  4LSN A;  1BIU A;  1TL1 A;  2DFE A;  3TWH A;  1UA1 A;  4FJG A;  3HK2 A;  3HJF A;  3L2Q A;  1N6Q A;  4DQP A;  1TKZ A;  4N41 A;  1FKP A;  4JLH A;  5KI6 A;  5KTQ A;  3OYM A;  3IRX A;  2GUI A;  4JRP A;  1U04 A;  1TVR A;  5SWM A;  3HYF A;  1U49 A;  3V9U A;  3QEX A;  4PQU A;  2YKN A;  2YV0 X;  3SQ1 A;  4FZZ A;  3QLH A;  2X78 A;  3C6U A;  4NYF A;  1CZ9 A;  4BDZ A;  4I2Q A;  4FLX A;  2JGU A;  4HCB A;  1SKW A;  1NOZ A;  1W9H A;  1SV5 A;  4FJ7 A;  3WNF A;  3H08 A;  3EY1 A;  4AIL C;  1RBV A;  3KIO A;  2G8I A;  4CJV A;  3OYE A;  2G8H A;  1CZB A;  3LPT A;  4CIE A;  5CY4 A;  5EU7 A;  4C8O A;  1GOC A;  2HHT A;  3L2V A;  3QO9 A;  1IKX A;  4IBN A;  4KHU A;  3T19 A;  3OJU A;  4KRF A;  2IC3 A;  4M3Y A;  5JS1 A;  3ZSR A;  4MFB A;  3LWM A;  4FM2 A;  2IS3 A;  3M8S A;  2Y1J A;  1X1P A;  4KB1 A;  1IKV A;  1LAW A;  2ATQ A;  2OPR A;  4CJR A;  4MQ3 A;  2VWK A;  3TAG A;  3SQ4 A;  4HCC A;  4J2A A;  2KZM A;  4GW6 A;  3NCI A;  1L5U A;  3PX6 A;  5FRM A;  4E1M A;  2R7Y A;  4CJE A;  3CM5 A;  3PY8 A;  2IDO A;  4BWJ A;  4GVM A;  4AHU A;  4I2P A;  2QK9 A;  2P51 A;  5CZ1 A;  3LZI A;  4E7K A;  4FJK A;  5D3G A;  5J2P A;  5DMR A;  1NKE A;  3IS9 A;  4PUO A;  3NF6 A;  4Z4C A;  1J53 A;  4FLZ A;  4FJL A;  1NK9 A;  2XHB A;  3VQC A;  1SL0 A;  1RDB A;  1NOY A;  3CFO A;  2KQ2 A;  3DOK A;  4CEO A;  1NJX A;  3AVN A;  4DTU A;  3SUQ A;  4FJX A;  1VRT A;  1IO2 A;  2WOM A;  3OS2 A;  4W5O A;  3HPG A;  3SYZ A;  3NH1 A;  1B9D A;  4B08 A;  3QEP A;  1HQU A;  3M8P A;  5C25 A;  4ELU A;  1JXE A;  2ZE2 A;  1BHL A;  3LWL A;  1VSJ A;  1J5O A;  3QIN A;  3FFI A;  3TI0 A;  1L3U A;  2OA8 A;  3RRG A;  1JL2 A;  4M3T A;  4DSE A;  3KLH A;  1S1T A;  4CFD A;  1C1C A;  5K14 A;  3QNO A;  3PO5 A;  3OVN A;  3SCX A;  1HQE A;  3MEE A;  1ASU A;  3AVK A;  1VSE A;  4DQI A;  3LAN A;  4NCG A;  1TAQ A;  1NK0 A;  4CGF A;  4AHV A;  1BGX T;  1BQM A;  1GOB A;  1Z25 A;  4KTQ A;  2E6L A;  4C8L A;  3ITH A;  2LSN A;  4H8K A;  1DTQ A;  3KD1 E;  3VQ5 A;  1A5X A;  1WSJ A;  4BE0 A;  4KPY A;  3TAF A;  3V9W A;  4B9N A;  1EXQ A;  1KCF A;  1HYV A;  2PYL A;  3CFP A;  5C24 A;  3K5O A;  3L8B A;  3AVB A;  4FLW A;  1Y97 A;  1D9D A;  3U3Y A;  3ZSO A;  1ZBF A;  4W5Q A;  1JLA A;  4DTS A;  2F8T A;  3K58 A;  3DM2 A;  1DLO A;  1WN7 A;  4CIG A;  4DSJ A;  1NJZ A;  3OYJ A;  4QAG A;  3NH0 A;  2BAN A;  3LPU A;  4NYN A;  4GMJ B;  3O3G A;  3T3F A;  3TAB A;  3K57 A;  2EX3 A;  3B6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...