2G8WA

B. halodurans rnase h catalytic domain e188a mutant in complex with ca2+ and rna/dna hybrid
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
KEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGAIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 39
structure length 134
sequence length 134
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8wA00
3EZ5A 4CHQA 1BISA 4G1QA 5EU7A 2KZZA 3M8SA 3B6OA 1IKYA 2G8IA 3VQEA 3VQDA 3JSMA 4AILC 4CJTA 4B9UA 3LANA 5J2PA 3LP1A 2EHGA 3QNOA 3QNNA 4ZTFA 2B5JA 3SUOA 3D45A 4JRQA 1ASUA 4M3RA 3O3GA 4CGFA 4DTXA 1SKSA 4E7LA 3VQ7A 1UAXA 3V1OA 1LW0A 3VQ5A 2HMIA 1WSIA 1RBVA 2YHAA 3MECA 3C6UA 1LV5A 3DM2A 2Y1IA 1KFSA 4M3YA 4C8NA 1VSKA 1NK8A 1JXEA 4F8RA 4KTQA 4O44A 1EKEA 3P5JA 4PY5A 3SZ2A 3NGZA 2YNIA 3DRPA 1BI4A 3ALYA 1L3TA 5FDLA 4DQQA 3SJJA 2OPRA 4N47A 4CERA 4DTOA 1KLNA 4CHOA 3OY9A 4H4OA 5KGXA 3QINA 1L3UA 1WSJA 4BE0A 3M8QA 3OYEA 3T19A 4DU3A 1GOAA 1HNIA 3KIOA 4FYDA 1FKOA 4F3TA 2DFHA 4DSLA 2P51A 3PO4A 3V9SA 1Q9YA 3HXMA 1JLFA 1HYVA 1YTUA 4KHQA 3DLGA 4DG1A 4TSXA 3ZSOA 1TAUA 3NHGA 3CQ8A 4ELVA 4FJ9A 4J2DA 3LP2A 1RT4A 1XC9A 5C24A 5KGWA 4CEBA 2G8UA 1MU2A 2HNYA 5C25A 3BDPA 2F8SA 3L3VA 2O4GA 4JRPA 2ZE2A 3ZSQA 3K5OA 5HROA 4FJNA 3OYCA 4DTJA 4K8ZA 1NJZA 4DTMA 1D8YA 3L2UA 5CZ1A 2XY6A 1RDCA 4CGJA 1HPZA 3HP6A 3MXMA 2OZMA 4F2SA 4QCLA 1J54A 2FBXA 5K14A 2X78A 3ZT2A 4CK3A 3SV3A 2DTUA 2R7YA 3HYFA 4W5RA 4CIGA 1RNHA 4CJVA 4E7JA 2IDOA 4OJRA 1NK0A 4F3OA 4PWDA 1CLQA 1RT2A 3F9KA 1UA0A 3KKSA 2P5OA 2BE2A 3TI0A 4DS4A 3QERA 3ITHA 3KTQA 2Z1IA 3G10A 2QKBA 4EP4A 4CJFA 3JYTA 3TABA 2YNFA 3KLGA 2YKNA 4M3XA 4KB0A 4IFVA 1BGXT 1RBTA 4CF2A 1QSSA 1LWFA 4CJSA 1VSIA 3OVNA 2X6SA 1K6YA 1W9HA 2BDPA 4F4KA 2HHSA 1NJWA 3TARA 4FJ5A 3VQBA 1BIUA 4QAGA 1U04A 3O3FA 4CHNA 4E7HA 4FVMA 4CGGA 4KRFA 3NF6A 1NOZA 3AVBA 3PV8A 3AVNA 1IH7A 4UQGA 1TGOA 3PO5A 3OYGA 2XRIA 3M8PA 2IS3A 4BDPA 4CJPA 3TAFA 2HHWA 1CXUA 1CXQA 2B6AA 3PX6A 1D9FA 3AVGA 4FJXA 4M3WA 4CFBA 2XY8A 2E6LA 1WSEA 2KQ2A 3QO9A 3OYJA 3SUNA 4KPYA 4FXDA 4IDKA 4DSJA 1GOBA 1HNVA 4DTRA 5HLFA 3L2QA 1NK6A 2OPPA 4YFUA 1SUQA 4H8KA 4BE1A 4E0DA 3HPOA 4HUGA 4FJGA 4Z4GA 3DOLA 4XIUA 1TK8A 3MXJA 5DK5A 4CF9A 4NCBA 1VSFA 3QEWA 3TANA 1T03A 4ELUA 3IAYA 4NCGA 3OYIA 4LSLA 2YHBA 3NH1A 4DTNA 1SL1A 3LWLA 2PY5A 4Q5VA 4W5TA 2A1RA 1QS4A 3DOKA 4DQPA 2HHXA 2JLEA 1QE1A 1SKRA 4B08A 3ASMA 5FROA 4FJMA 3ZSYA 2D0CA 5HRNA 2KFNA 1X9SA 2WOMA 3OYMA 2RF2A 3V6DA 1HJRA 3LZIA 4DFPA 4B9SA 3V9WA 4EP5A 1EP4A 1TAQA 3ZSRA 4DFKA 1RCHA 1S6QA 4Z4HA 5J1EA 3DRRA 4M42A 4Z4EA 3AA4A 1WSHA 4CHZA 1JXBA 3SQ1A 4CJEA 1F21A 5CY4A 2LSNA 3VQ8A 1KCFA 3HP9A 1C0UA 4OKKA 1ZBLA 5I42A 1L3VA 5KTQA 3TAPA 2HNDA 1ZBIA 4FK4A 4CEZA 3HL8A 1QSLA 3NDKA 4CEAA 1TK0A 1D9DA 1FKPA 1HYZA 4AHSA 4CK2A 4QOZB 3QEIA 4FK0A 2FBVA 4M41A 4IKFA 2RN2A 5KRTA 3MEGA 3EY1A 1NK9A 5FRMA 4LH4A 1JLQA 4IG3A 3WNGA 2HW3A 1LW2A 3ZSWA 4CGIA 4O4GA 1ASVA 3AO2A 2W42A 3AVIA 1A5VA 2NUBA 3F73A 2X6NA 2G8WA 4CJ5A 4ID1A 4AHVA 2OZSA 3VQ6A 3U6FA 3ZSZA 3NAEA 3P1GA 4DSIA 3HM9A 1HMVA 1WNSA 4KKOA 3HPHA 3KK1A 2HVIA 4B8CA 4CJQA 5HRRA 3CM5A 1WSFA 3OYAA 1X1PA 1D5AA 3L3UA 4CFDA 3KKRA 3DLKA 3KLEA 1C1BA 3DLEA 4N56A 5HRPA 4J2EA 2YNGA 1RBRA 1JL2A 3CFRA 5JS2A 1X9MA 4CIFA 3LWMA 4DQIA 3H08A 2VG7A 1YVUA 4DSKA 2HB5A 4Y1DA 3AV9A 5J2QA 3RRGA 1XWLA 2YNHA 3AO4A 1TV6A 4DSFA 3RRHA 3V9ZA 3MEDA 3SYZA 3RMCA 1VSDA 1YT3A 1IO2A 3NF9A 3BGRA 4M45A 1WAFA 1RBSA 3TAMA 2OPSA 4RW9A 4CECA 4KHYA 2HHTA 3SQ4A 4FJ7A 3NCIA 1JLEA 4FCYA 3SUPA 4ELTA 1A5WA 4F2RA 2ZQBA 3ZT1A 3ZSXA 4C8KA 4KTWA 1BQNA 3OYKA 3S3NA 2RKIA 1ASWA 1S1XA 3NF7A 4BWJA 3SQ0A 4CJRA 1R0AA 1BL3A 3K59A 3SNNA 3K5LA 3DYAA 3V9UA 1LWEA 4MQ3A 3V1RA 4Q0BA 4MFBA 2AJQA 2GUIA 1NKBA 3O4QA 1VSLA 3AVFA 4IFYA 4CF0A 3CFPA 1C1CA 1NK4A 3RR7A 4DLEA 1TKDA 3RR8A 3VN5A 1RT7A 4C8LA 2VG6A 1JLBA 2D5RA 1KRPA 3PY8A 2KTQA 1RTIA 3NGIA 4HHTA 2JGUA 1N6QA 5HRSA 1Q8IA 1G15A 1O1WA 3KLFA 4PQUA 3TR8A 3L2RA 3ZT3A 3KLIA 4KB1A 3TAGA 3AA5X 1VSMA 4CF8A 3HO1A 5CYMA 3DMJA 2FBTA 1RT5A 4NYFA 1J5OA 1EX4A 3QESA 3QEVA 1S9EA 3RMAA 4KAZA 3SPZA 3D0PA 1LAWA 4BDZA 3VQQA 3MXIA 4RW6A 1J9AA 3OS0A 3K58A 3KLHA 1CZBA 4CEFA 1SL0A 4HCCA 1VSEA 3B6PA 3AO3A 1RDBA 4PUOA 4OKJA 3LPTA 4O55A 1T7PA 3OJUA 3MAQA 4DFJA 1IKVA 3AVKA 1NK7A 1GOCA 1C0TA 4EZ9A 2FBYA 1ZBFA 4DS5A 1SL2A 2ZD1A 5CZ2A 5J2MA 4IBNA 3NBPA 3LAMA 2QXFA 3WNHA 2F96A 3KJVA 4CCHA 1S1TA 2YKMA 1ITGA 3QIPA 4JLHA 2O4IA 4GVMA 4FW2A 1HYSA 2Z1GA 3FFIA 1L3SA 3O4NA 3P83D 2DY4A 1S5JA 3OYLA 1KVAA 4KTZA 4DSEA 3T3FA 3AVHA 4CEDA 4E19A 4E7IA 4CEQA 4FM0A 3WNEA 3QETA 1SV5A 3SCXA 2Z1JA 4KHSA 4FJIA 3LPUA 4DMNA 1FXXA 4GW6A 4BWMA 3ZT4A 4HUEA 4DLGA 4FJKA 5DMRA 3V81A 1X9WA 3VQCA 2G8KA 4Z4IA 4CHPA 4CF1A 4B8AB 1KFDA 4DF4A 3NF8A 3L2WA 4O0IA 3TAQA 1B92A 4AHTA 1NKCA 4FLYA 4FZYA 3VQAA 3AVJA 4CJ3A 4BE2A 4KI4A 4DTPA 1BQMA 4FZZA 3S9HA 5J2NA 3WNFA 3OS1A 2BANA 4I2QA 4KHWA 1BHLA 1Y97A 1RBUA 2GBZA 3ZSVA 3LDSA 2EX3A 3U3GA 1WAJA 4Z0UA 4FLVA 3T1AA 1EXQA 1ZBUA 2XHBA 3LZJA 1U49A 2X74A 3PUFA 4Z4FA 3HK2A 1UA1A 2D0BA 3DLRA 3AO5A 5HBMA 1WN7A 4R5PA 4DQRA 4HCBA 4CK1A 5FRNA 3QLHA 4DU4A 1C0MA 2IOCA 3HJFA 4FJLA 3I8DA 1S9GA 1BCMA 1S1VA 1XHXA 3THVA 2Q3SA 1IG9A 2G8HA 3K57A 1T8EA 2IC3A 5SWMA 1JLAA 2RPIA 4FLZA 1NK5A 1QQCA 1LWCA 5T7BA 1NKEA 4N5SA 4ZHRA 2F8TA 1S1UA 3HPGA 3VQ4A 1TVRA 3K5MA 2XY5A 3U3YA 1BIZA 1FK9A 4RW8A 4OLBA 4OGCA 5SZTA 4DQSA 4M3TA 4M3UA 3OYBA 3SPYA 3S3OA 4OGEA 3KD5E 4KHUA 1UWBA 4W5QA 1KVCA 1I39A 2G8FA 2DFEA 2VWKA 3CM6A 3C6TA 3VQPA 4CGDA 4CJKA 3ZCMA 4OPJA 3RMDA 3KD1E 3IRXA 3E01A 1NOYA 4CFAA 3NH2A 3LP3A 3AO1A 4CE9A 1JL1A 3SQ2A 2HNZA 1YTAA 1HRHA 4AHUA 3AVLA 1DTQA 3I0RA 4JS5A 1U47A 1QSYA 1S6PA 1RT3A 5I3UA 4K8XA 3NGYA 5E41A 1TL1A 4FM1A 4KI6A 4E1NA 1XHZA 2HHUA 4EZ6A 2ATQA 4LSNA 1ZYQA 4LD0A 4RW4A 4CIEA 4N41A 1B9FA 4BDYA 3LAKA 4I9QA 3OYHA 3PX4A 5KRSA 4CEEA 4DU1A 4E7KA 4ID5A 4CJ4A 2IAJA 2PYJA 1QTMA 4C8OA 2GV9A 3LP0A 4DF8A 2XY7A 2P5GA 1RILA 3L8BA 2KW4A 1JLGA 4OLAA 4C8MA 3OS2A 4DWIA 5JS1A 1DTTA 2HVHA 2PYLA 4B9LA 3C95A 3OYNA 3V4IA 4FJJA 4M3ZA 4KFBA 1L5UA 2OYQA 1TL3A 4FM2A 5C42A 1REVA 4L8RB 1RTHA 1Z25A 3HVTA 4B9TA 1XI1A 2QKKA 2FC0A 3AA2A 4FLWA 4B9VA 1KTQA 3AVMA 4NYNA 4Z4CA 1U45A 4W5OA 2BGGA 4B9NA 3PX0A 3DLBA 1WSGA 4W5NA 1T05A 3K2PA 4FW1A 3ZT0A 3HVRA 4KV8A 1JLCA 1VRTA 1RDAA 2IGIA 3CYMA 4DFMA 4KHNA 1C1AA 2E6MA 2Y1JA 3NFAA 4O5BA 3CFOA 4HUFA 3S3MA 2KZMA 1VRUA 1C6VA 1RT6A 3K5NA 1KSPA 1ZBHA 2E4LA 4O0JA 4WE1A 3QIOA 5D3GA 4AHRA 1U4BA 4CHYA 1RTDA 3HSTB 4H4MA 4FJHA 4B3OA 4FK2A 1TK5A 2OPQA 2B4JA 5HP1A 4FJ8A 4OPKA 3HT3A 3OYDA 1Q9XA 4OVLA 3I0SA 4AHCA 3DRSA 1RT1A 4FLUA 1NJXA 3OYFA 3O3HA 4I7FA 4YNQA 4DTSA 2DFFA 4AH9A 4KREA 4CJUA 3C94A 1IKWA 1W0HA 2D0AA 3VA0A 2KFZA 3KK3A 4GMJB 3TAEA 1QHTA 3AVAA 3NH0A 2ETJA 4HVJA 4NCAA 4IG0A 1WLJA 3A2FA 3ULDA 2HHVA 2I5JA 3QEXA 3QEPA 3DI6A 3ISNC 4CGHA 4KO0A 1TKXA 3LALA 4LY7A 4Y1CA 4CJLA 2HHQA 4ZTJA 1NJYA 1CZ9A 4E89A 4CJWA 2G8VA 3M8RA 4B9MA 1BI4B 4N76A 1VSJA 1TKTA 3MEEA 3AVCA 3IG1A 3SI6A 1N5YA 3V1QA 4FZXC 3NE6A 1RTJA 1EETA 1KVBA 4OKEA 3CG7A 4RW7A 1SKWA 2OA8A 3V9XA 1LAVA 1I3AA 2P1JA 1TKZA 4BACA 3RTVA 2QK9A 1DLOA 4PA1A 4J2AA 1J53A 1HQUA 3DLHA 1U48A 4I9LA 3UIQA 3SUQA 4LH5A 3VQ9A 2XO7A 2YV0X 4CEOA 3VA3A 1KLMA 4DTUA 2ITGA 1S1WA 2VWJA 1VSHA 4CFCA 1JKHA 3G0ZA 4ICLA 4E1MA 3AA3A 1RDDA 4I2PA 1HQEA 2PZSA 3IS9A 3RWUA 4HTUA 3SV4A 1Z26A 3RMBA 2VG5A 5KI6A 5CYQA 1BCOA 3KK2A 2WONA 1IKXA 4FLTA 3L2VA 3EYZA 1B9DA 3TWHA 1A5XA 4J2BA 4E3SA 1VK0A 4JS4A 4FLXA 4CESA 4RG8A 2A1SA 3OJSA 2Z1HA 1UOCA
chains in the Genus database with same CATH superfamily
1BISA 5EU7A 1YJWN 4JI2K 2KZZA 1IKYA 1VQ7N 4WYBA 1IJJA 5C2FA 2EHGA 4B1ZA 3QNNA 1NKCA 3D45A 5EY4A 3T7ZA 2HMIA 1UAXA 2YHXA 4BG9A 3CCMN 4M3YA 4PY5A 5ADXH 3L4IA 2E8AA 1BI4A 4QS8A 4A2AA 1L3TA 3SJJA 4JI0K 2E1YA 3LDPA 1HKGA 2QA4N 3A5NC 4H4OA 5KGXA 1Q18A 3M8QA 3OYEA 4DU3A 1GOAA 3HTVA 1FKOA 4FYDA 4B3SK 2QXLA 1U2VA 1BA0A 3CJCA 1ZC6A 1JLFA 1HYVA 5BRDA 3DLGA 4TSXA 4EHUA 4FJ9A 3QMLA 4J2DA 1XC9A 4CD3A 3R9PA 4CEBA 3JAMO 2HNYA 2QTDA 2O4GA 5BR8K 4JI1K 5HROA 5CHIA 1XMQK 4DTJA 4DTMA 1D8YA 1TYQB 2XY6A 4F2SA 4CGJA 2OZMA 3CI5A 4BRNA 3DWLA 2X78A 3HYFA 1RNHA 5AQYA 1NK0A 2IDOA 4OJRA 3A5MC 3KKSA 4KH5A 1ZXOA 2BE2A 3TI0A 4DS4A 3QERA 2Z1IA 3G10A 2QKBA 4EP4A 3TABA 5AQPA 1LWFA 4CJSA 4F4KA 4JYAK 1LOTB 4OPHA 4BC5A 4CGGA 5BN8A 3PO5A 1QQNA 2XRIA 3M8PA 2IS3A 2NRHA 5BPLA 3TAFA 2B6AA 3PX6A 3O08A 2XY8A 3QO9A 4FXDA 1HNVA 4OO1J 4DTRA 4BE1A 3HPOA 4FJGA 3L4QA 4XIUA 5C10A 3MXJA 4CF9A 4LF5K 4EIAA 1NGIA 2HSTA 3IKMA 3T69A 4ELUA 3NH1A 4RCHA 4Q5VA 2A1RA 1TYQA 1QS4A 3R1XA 1QE1A 4AM6A 3ASMA 5FROA 4FJMA 5AFUA 3LZIA 4EP5A 1EP4A 5J1EA 2P9KB 5GAEP 4M7XA 4NXNK 1F21A 2Q2RA 4JEPA 1KCFA 3HP9A 5LJWA 4OKKA 1OVQA 1ZBIA 4EAHD 1S72N 4AHSA 4MO4A 2E5LK 5FRMA 3C7NA 3TTFA 3AO2A 3VMFB 3R6MA 4CJ5A 4ID1A 2OZSA 3P1GA 4B8CA 3HRGA 3IUCA 3CM5A 3VOVA 2FF6A 4CFDA 5HRPA 4J2EA 1RBRA 4DQIA 4FO0A 4DSKA 2HB5A 5J2QA 1XWLA 1VSDA 1IO2A 3BGRA 4M45A 2P9KA 4KH6A 2HF3A 4FCYA 4ELTA 4F2RA 3ZT1A 4BRFA 1RDUA 3NF7A 3DYAA 4MQ3A 3VENA 3CFPA 3RVCA 5H1SQ 4DLEA 1RT7A 3CMAN 2JGUA 1VQ5N 5HRSA 3MCPA 1G15A 3PSIA 1HUXA 4PQUA 3CF5L 3LM2A 2UXBK 3ZT3A 4KB1A 3AGKA 4IOXA 1BU6O 1J5OA 2P9NB 3QEVA 3D0PA 4MO5A 3CCUN 5JLHA 3CMEN 3KLHA 1SL0A 4CEFA 4HCCA 1VSEA 4PUOA 1DKGD 2E20A 3LPTA 3OJUA 4DFJA 3AVKA 4EZ9A 2FBYA 1SL2A 2QXFA 2F7TA 5EX5A 3VERA 1NGGA 4DB3A 1ITGA 4CCHA 3AAQA 3E1YA 2ZWHA 4FW2A 2HMPA 3FFIA 1S5JA 3BZKA 4CVNE 4E19A 4K43A 5KQ8A 1SV5A 3SCXA 1K8KB 3LPUA 5DM6L 3O9QA 3VQCA 4Z4IA 2GTDA 5GIPA 2ZGZA 2JWLA 3L2WA 3SMSA 1WB9A 4FLYA 3LM9A 4DQ8A 1BQMA 4YDUA 5BR9A 2BANA 4KHWA 1HKBA 1Y97A 1YIJN 3ZSVA 2EX3A 3U3GA 4Z0UA 3A5LC 3T1AA 1U49A 3BUZB 2NRZA 1WN7A 2NLXA 3QLHA 5AZJB 4E1JA 2P9NA 4H0OA 2Q3SA 4H0VB 5SWMA 4JKDA 2RPIA 1LWCA 1HJOA 4DR1K 2P9IB 4H0PA 2GEMA 4JAXA 4N5SA 4K0KK 3VQ4A 4JV5K 4LFBK 4B3TK 4CBXA 4DQSA 4JKAA 4M3UA 3OYBA 1J6ZA 1JCEA 4V19S 4KHUA 1NNEA 5AJ3K 2YJEA 3H45C 3SBTA 3EZWA 5MLCQ 2DFEA 3KD1E 3BF3A 2E2OA 5JLFA 4LC9B 3DJCA 3FGUA 3I8BA 3M3ZA 1YTAA 1N32K 4JS5A 4B1XB 1S6PA 1ILYA 1RT3A 4K8XA 3CPWM 4FM1A 2ATQA 4JD2A 1NGBA 1B9FA 4BDYA 3VGMA 3M6GA 3ULEA 1IG8A 5KRSA 4FWNA 3SJHA 1YHQN 2GV9A 2KW4A 5JS1A 3TSUA 4OLAA 4IJNA 3MN7A 1HKCA 3CCVN 4FM2A 5C42A 4B9TA 2QKKA 3MWPA 2BGGA 4BRLA 4W5OA 4CBWA 1LCUA 3ZT0A 1VQPN 1VRTA 3F9MA 2HBMA 2E6MA 3WXKA 4HUFA 3CPEA 3K5NA 4JI7K 5LL6Z 5D3GA 1U4BA 3HSTB 4DV6K 1K9MO 4FK2A 4OPKA 3I0SA 5GADP 4FLUA 3SAFA 5BPMA 2DFFA 4MLEA 4KREA 1XNRK 3HI0A 3C94A 4BRHA 1W0HA 3TAEA 4IG0A 1WLJA 2I5JA 4PL7A 3QEPA 4CGHA 1KAZA 2HHQA 4BY9C 4ZTJA 1NLVA 1NMNA 1NJYA 1VQ8N 2G8VA 5AZIB 4H5TA 2W6LA 4BR7A 2IVOA 4DV0K 1YXQA 3CC2N 4OKEA 3CG7A 4RW7A 1I3AA 1VQ6N 2JWKA 4PA1A 3TPQA 1HQUA 2GWJA 4I9LA 4LH5A 2XO7A 2WC9A 4CEOA 3H46O 2QWNA 4MLHA 4DTUA 4OPAA 2YI1A 1JKHA 3AA3A 1RDDA 4I2PA 1HQEA 3U8XA 3RMBA 4DR3K 5KI6A 5CYQA 2WONA 1J5EK 2VQFK 4DV1K 4E3SA 4FLXA 4JS4A 3CCEN 2Z1HA 3MXIA 2P5GA 3VPZA 4BR2A 4G1QA 1T3VA 2G8IA 3VQDA 3JSMA 2DPNA 2O8BA 4J8FA 4ZTFA 4IOCL 2B5JA 1ASUA 4CGFA 3H6EA 1LW0A 1V4TA 1SAZA 3THXB 1NK8A 4O44A 3P5JA 3R3LA 3P38A 2YNIA 5AZIA 4X64K 4FWPA 4DQQA 4U67L 2NZTA 4CERA 1HNZK 2D0OA 5CR4A 1YAGA 5M1QA 3T19A 3ID8A 4LF6K 4F3TA 2DFHA 2P51A 5AQSA 3PO4A 3V9SA 1Q9YA 5AQHA 5AQNA 2VGMA 3ZSOA 3CQ8A 5F2RA 2PFUA 5C24A 3VEOA 5KGWA 2G8UA 1MU2A 4XH4A 3L3VA 4JRPA 1YUWA 3OYCA 3CCQN 1VQ4N 1KAYA 4CBUA 4K8ZA 3L2UA 1HPZA 3LDLA 1J54A 4CK3A 1N34K 3SV3A 5KPRA 4W5RA 2R7YA 4E7JA 5I9EB 4F3OA 2NRVA 1TUUA 3BF1A 1RT2A 1UA0A 3LL3A 2P5OA 3N4PA 3UE5A 2YKNA 1BGXT 1MDUB 3OVNA 2X6SA 1K6YA 2QWPA 1NJWA 4FJ5A 4QAGA 5M1NA 3FZHA 4CHNA 3CIPA 4FVMA 2KLAA 3CETA 2QM1A 3KWGA 3PV8A 3AVNA 4UQGA 3R8EA 5F0XA 5BPNA 4BDPA 1CXUA 1CXQA 3O5BA 4B1UB 4M3WA 1QQMA 3VESA 4CFBA 1WSEA 4KPYA 4FOEA 4XEIA 4YFUA 2VGNA 3DOLA 1TK8A 3VGLA 5DK5A 4BQLA 3IAYA 4LSLA 4YDUC 2YHBA 4A5AA 4JK7A 4B3RK 3LWLA 3J80O 4DQPA 1SKRA 4BR5A 3WT0A 2HHHK 1OH7A 2WOMA 2RF2A 2ZJRL 3V9WA 4CJ7A 1GLEG 4M42A 3DRRA 1WSHA 4CJEA 3VEZA 1E3MA 2F9TA 2LSNA 3HBTA 3JS6A 5I42A 3TAPA 4FK4A 3PLAA 1Q86O 3WXIA 3NDKA 2UUAK 1HYZA 2RHKA 4BROA 4FK0A 5KRTA 1NM1A 3EY1A 4IG3A 4C1NK 2HW3A 3ID6A 2G8WA 1JCFA 3H3OB 3VEYA 4AHVA 2ITMA 3VQ6A 1NU0A 3NAEA 4DSIA 3HM9A 4KKOA 3AGRA 4H0TB 1WSFA 3E9OA 3KLEA 3DLEA 2YNGA 2Q0RA 1S22A 3LWMA 3WXLA 4CZKA 2VG7A 4Y1DA 1TV6A 3O9RA 4DSFA 3RRHA 3V9ZA 4PKHA 3SYZA 5AQTA 2OPSA 4CECA 3SQ4A 4FJ7A 3NCIA 2ZGYA 5B8HA 3ZSXA 3OYKA 4BWJA 1ASWA 1R0AA 3CC7N 1HPMA 3K5LA 4X62K 3V9UA 1LWEA 4MFBA 2Q36A 3OA9A 1GLBG 3VETA 3AVFA 2YHWA 3ATUA 1C1CA 3RR7A 3U9DA 1HNWK 3RR8A 2VG6A 2D5RA 3BZCA 2CH5A 1Q8IA 3HSCA 3EE8A 2FBTA 2P9PB 3QESA 1OH8A 3RMAA 3SPZA 1NGHA 4JKEA 4RW6A 1ATNA 3C7NB 4QS7A 4OKJA 3MAQA 4YOWA 2A40A 3NBPA 4A57A 2F96A 3G4SN 4YOVA 4JLHA 4GVMA 2E2NA 2V52B 4RWTA 3U4LA 1X3MA 4CEDA 4E7IA 4FM0A 4KHSA 4UY8O 2Z1JA 3M1FA 1YF5L 1NGJA 2UUCK 4DLGA 3DXKB 2G8KA 4DV2K 3SAHA 4CHPA 4CF1A 4DF4A 1XC3A 4H0XB 4O0IA 2V7ZA 3AVJA 4H5VA 4KI4A 3NVKA 4ILJA 2ASPA 4BREA 5TKYA 5J2NA 4I2QA 4K42A 3ENBA 4IXCA 1WAJA 4FLVA 4DR4K 2D0BA 3DLRA 3AO5A 3MWTA 4DQRA 4DU4A 1VAZA 2P9PA 3I8DA 1S1VA 3THVA 2G8HA 3L0QA 2IC3A 1BDGA 4FLZA 1QQCA 3IMXA 2PAVA 3K5MA 4BR4A 1BIZA 1FK9A 5LMUK 3FZKA 2RE2A 4O8UA 4OGEA 1KVCA 1I39A 4A61A 1OH6A 4CGDA 3ZCMA 5AFUH 1NOYA 1XMOK 3W3DA 1JL1A 3SQ2A 2HNZA 4A62A 3SMPA 3Q7BA 2GUPA 5LMNK 1GLJO 2A6AA 3DXKA 2HHUA 4E1NA 5BN9A 5BRHA 4LSNA 1P8ZA 3FLCO 4CIEA 2NRTA 5F1XA 3PX4A 1QQOA 4JKFA 4E7KA 3CJ1A 4ID5A 4GKJK 4CJ4A 1X3NA 2IAJA 2QWRA 3CHWA 2PYJA 1QTMA 4DF8A 4GV9A 3L8BA 4DWIA 2HVHA 3C95A 3OYNA 3V4IA 2QI2A 5FPDA 3VEVA 2Q1NA 4KFBA 2O8FA 1VQKN 4L8RB 1RTHA 1XI1A 2FC0A 2OCEA 4FLWA 4EFHA 1U45A 5HOOA 4B9NA 4W5NA 4FSVA 4R79A 3CYMA 1KAXA 2Y1JA 2CH6A 2AA4A 3GBTA 1VRUA 1RT6A 1XQSC 2E4LA 4WE1A 1X9JA 2OTLN 3PSFA 4AHRA 1IV0A 4H4MA 4FJHA 4NO7A 3IDHA 3AARA 4B1VA 1TK5A 4JKCA 2B4JA 3HT3A 4IDHA 4FWKA 4OX9K 5AQXA 1RT1A 1NJXA 4FVUA 5AQQA 2UYTA 3Q7CA 4AH9A 1IKWA 3TSQA 4YOYA 1QHTA 3NH0A 3ULDA 3QEXA 1C0GA 2KHOA 4KO0A 3O9TA 4Y1CA 1MWKA 2FXUA 5A2QO 3SLCA 4B9MA 4N76A 5E26A 4ISEA 3AVCA 3IG1A 4JD2B 2VCPA 4FZXC 2V51B 3ULEB 1W7AA 1KVBA 2QW9A 2E1ZA 1SKWA 3MN6A 3S41A 2P1JA 4BACA 3VGKA 3E9PA 3DLHA 3FZMA 1SQKA 2ITGA 1N36K 5KPZA 4IO9L 3G0ZA 3IS9A 3TTDA 4Y0WA 3SV4A 1Z26A 3NMUA 3L2VA 4WCEL 3ENOA 2GX9A 5AQZA 4BC4A 1K73O 3G6EN 4RG8A 2QWLA 5T7BA 2WUSA 3M8SA 3B6OA 2E2QA 4LF8K 3VQEA 3EE9A 4ISFA 4AILC 1JCGA 4CJTA 4O8KA 1P90A 3QNOA 3ATVA 4X66K 4DTXA 4M3RA 3O3GA 4DV4K 4DHYA 1HX1A 4E7LA 3VQ7A 3V1OA 5FPMA 1WSIA 1RBVA 2GWKA 3A0IX 1LV5A 3DM2A 2Y1IA 1KFSA 4C8NA 4BC3A 1JXEA 4F8RA 4KTQA 1Q82O 3SZ2A 3NGZA 3DRPA 3ALYA 3P31A 4CHOA 3OY9A 3CQXA 4BE0A 5M1PA 5BRFA 1HNIA 3DXMB 3LDQA 4GV3A 1MWMA 4DSLA 3O1WA 3HXMA 1YTUA 4KHQA 2YHYA 3AY9A 4ELVA 5EOYA 1RT4A 4NLCA 3UB5A 3CJAA 5KPTA 5AQUA 4JI5K 1RDWX 2ZE2A 3K5OA 1V4SA 1BG3A 4BC2A 1VQLN 1NJZA 5CZ1A 3MXMA 2QWQA 5K14A 4BRKA 2DTUA 1CZAN 3D2FB 4CJVA 4PWDA 1CLQA 3EO3A 4AF1A 2J4RA 3WEEB 3QICA 3KTQA 3ITHA 3FZFA 4CJFA 1HLUA 3JYTA 1WUAA 3KLGA 2NRWA 4A2BA 1QSSA 1VSIA 3WXMB 1YVNA 1W9HA 2HHSA 3VQBA 1BIUA 5GINA 4IWVA 1U04A 2O8BB 3HOSA 4E7HA 3ZLJA 1YJ9N 4O5FA 4KRFA 2BH1A 3NF6A 3QB0A 1TGOA 4U7BA 4CZLA 2A5XA 2QWMA 3DXMA 2CGJA 1D9FA 4B3MK 3AVGA 5C15A 3CJ7A 2CGKA 2E6LA 3SUNA 3L2QA 1NK6A 2OPPA 1HR0K 1EWRA 4H8KA 3PIPL 4ISGA 4NXMK 4FWSA 1NGCA 3QEWA 1T03A 4NCGA 3OYIA 4XH1A 4ILHA 1SL1A 2PY5A 5M1FA 3CCSN 2HHXA 2WBNA 3D2FA 4BGBA 4CW7B 5HRNA 5GIOA 1X9SA 5AQWA 3V6DA 1HJRA 1S3XA 4DFPA 2W40A 3WEEA 4IFEA 4WFAL 4Z4HA 5LJVA 4FWQA 4Z4EA 3AA4A 4CHZA 4WF9L 1JXBA 5CY4A 4JHDB 4AQYK 1M1KO 4YOTA 3VQ8A 5C12A 1W2BM 1ZBLA 4BRMA 2HNDA 3HL8A 4BRAA 1KXPA 3MCAB 3SAGA 1QSLA 4FL9A 4CEAA 2NRRA 4QOZB 3RSEA 3QEIA 2FBVA 4M41A 1NK9A 4LH4A 1JLQA 1Q81O 1LW2A 3ZSWA 4CGIA 3CJBA 3FZLA 3U9ZA 3AVIA 1A5VA 2NUBA 3O8MA 2X6NA 3F73A 1E4FT 2ASMA 1VQMN 1E4GT 4BRIA 1WNSA 4JK8A 3HPHA 5GAHP 3MDQA 3OBYA 3KK1A 2F4VK 2HVIA 5HRRA 3CQYA 3LDNA 1X1PA 1BWFO 3L3UA 4DR2K 3KKRA 3DLKA 1JL2A 1EQYA 5JS2A 3QBWA 3H08A 5AR0A 1YVUA 3EKSA 5HL7L 1Z05A 3RRGA 4JI6K 4NLBA 2YNHA 3AO4A 5KQDA 4IOAL 3I55N 3RMCA 1MA9B 4A59A 1WAFA 1RBSA 2HHTA 4RW9A 4KHYA 3NVMA 1SZ2A 1GLLO 3MX5A 1JLEA 1A5WA 1KQSM 2ZQBA 4FWOA 4JHDA 2ASOA 2Q0UA 1BQNA 1M90O 3S3NA 3SQ0A 4BRQA 2P9SB 5AQOA 3SNNA 3WQUA 3V1RA 4Q0BA 2GUIA 1NKBA 3FFKB 4CF0A 1NK4A 4WQ4A 4DCHA 4C8LA 4FPAA 3MK6A 1JLBA 1KRPA 3PY8A 2KTQA 1RTIA 3NGIA 2AP1A 2UXDK 2W41A 1K8AO 3TAGA 3AA5X 4BG8A 1VSMA 2QWOA 4NYFA 3N4QA 1S9EA 4KAZA 3VQQA 3OS0A 4M63C 1CZBA 4BQZA 3B6PA 3AO3A 1RDBA 4O55A 1T7PA 1NK7A 1GOCA 4BGAA 1ZBFA 1EWQA 3OBWA 1NGAA 5CZ2A 5JICA 5J2MA 3W0LA 1S1TA 3QIPA 1HYSA 2Z1GA 4B9QA 3P83D 3OYLA 4KTZA 4DSEA 3T3FA 3E9LA 3AVHA 3VEXA 4KBOA 3QETA 4FJIA 3C0BA 4FJKA 3J81O 5DMRA 3V81A 4I6MA 4DR5K 5TKWA 2P9SA 4L3QA 4B8AB 1KFDA 2O8DB 3TAQA 1B92A 3D7EO 4H03B 4YOXA 3CC4N 4FZYA 3VQAA 1OVYA 5EVZA 4CJ3A 2HBLA 4FZZA 3S9HA 3CJ9A 2GBZA 3LDSA 1RBUA 5C0YA 2X74A 4Z4FA 3UKUB 1UA1A 4HCBA 3KZBA 5ELZA 3EKUA 4CK1A 5JVGL 5FRNA 1QZ5A 3UKRB 1C0MA 3HJFA 1IBMK 1S9GA 1BCMA 4CD1A 3K57A 4YOUA 2GELA 3VTIA 5AQFA 3QFUA 1NKEA 4ZHRA 3HPGA 1TVRA 4OLBA 5SZTA 3VTHA 5FLXO 4LF9K 3S3OA 3KD5E 4W5QA 4CZGA 3GE1A 3CM6A 3VQPA 4CJKA 4NB4A 1HRHA 4AHUA 1DTQA 1U47A 4F9OA 3NGYA 3MN9A 1TL1A 4KI6A 4DUYK 1XHZA 1HNXK 4CZFA 4LD0A 4RW4A 3LAKA 4I9QA 2O8DA 2I7PA 5JVHL 4DU1A 3THWA 1IBLK 4DR6K 4C8OA 2F9WA 1RILA 1JLGA 2ZM6K 4RTFD 3OS2A 2PYLA 4B9LA 4M3ZA 4FJJA 3UKUA 3GDQA 3O4WA 2EWSA 3UKRA 3AA2A 1N8RO 4B9VA 3T1HK 5AQRA 1KTQA 2WFBA 3PX0A 3CCLN 1WSGA 1GLCG 3DLBA 3K2PA 3CXCM 4KV8A 1RDAA 4DFMA 1C1AA 4GV6A 3CFOA 3S3MA 3WUHA 3ZETB 2VYPA 3J7AP 1KSPA 1BOTO 2P9LB 4YHHK 3QIOA 4YORA 4CHYA 1RTDA 4B3OA 1OKJA 2OPQA 3CCRN 3O6WA 4FJ8A 1Q9XA 4GNIA 3O80A 4DTSA 4C23A 4CJUA 3MMVA 5M1KA 2D0AA 3VA0A 1GLFO 2KFZA 3AVAA 4HVJA 5BREA 4PHTX 5AQMA 3TU5A 3ISNC 3GOIA 4FOIA 1TKXA 3J8AA 2D4WA 1N33K 4CJLA 3H3NO 1H1VA 1CZ9A 4E89A 4WQ5A 1VSJA 1TKTA 3MEEA 3V1QA 1BUPA 3NE6A 1RTJA 1LAVA 3RTVA 1TKZA 1G99A 2QK9A 1DLOA 3UIQA 3SUQA 3VQ9A 2YV0X 1KLMA 2O8FB 2VWJA 4CFCA 3OW2M 4ICLA 2O8CB 2PZSA 3RWUA 3ZETA 2P9LA 1DEJA 4YY3K 2A3ZA 4FLTA 1RGIA 3EYZA 4J2BA 4KH4A 3KK7A 4CESA 2A1SA 3OJSA 3GL1A 3THYB 2H3GX 3EZ5A 4CHQA 3P4IA 4B9UA 3LANA 5J2PA 3K9JA 3LP1A 1WOQA 3SUOA 4CZJA 4JRQA 1SKSA 4B1WB 4BVOA 3VQ5A 4WFBL 3G25A 2YHAA 3MECA 3C6UA 1VSKA 1I94K 1EKEA 1ZBSA 1BA1A 3A8YA 5IWAK 5FDLA 2VQEK 2OANA 2OPRA 4N47A 4DTOA 1KLNA 1NMDA 1Y64A 3QINA 1L3UA 1WSJA 4KHPK 1O13A 1NG9A 3KIOA 4G9ZA 1Z6RA 4M7YA 2PBDA 2QEXN 3DAWA 4DG1A 3WQTA 1TAUA 3NHGA 1NGEA 2O8CA 2UXCK 2BTFA 3LP2A 3I56N 4CZIA 4WQ4C 5C25A 3LDOA 3BDPA 2E88A 2UUBK 1XUPO 4FJNA 3ZSQA 2F8SA 1Q7YO 2V7YA 4MDAA 1RDCA 3HP6A 4QCLA 3ZT2A 2FBXA 3THYA 2OTJN 1KD1O 3H1VX 4CIGA 3BY5A 2YX6A 3F9KA 3L6QA 1WBDA 2YNFA 3CERA 4M3XA 4KB0A 4IFVA 1RBTA 4CF2A 3O9UA 3P39A 2BDPA 3TARA 3O3FA 3VF2A 4Z94A 4DV3K 4X65K 1NOZA 3AVBA 5AQGA 1IH7A 3HZ6A 3G71N 3OYGA 4CJPA 1QHAA 4MDBA 2HHWA 3WXJA 4AM7A 4FJXA 4JI4K 2KQ2A 4PL8A 3OYJA 4IDKA 4DSJA 1GOBA 5HLFA 4FWLA 5FPEA 3EL2A 1SUQA 4E0DA 3FE1A 4HUGA 4FPBA 4Z4GA 4WFNL 4NCBA 1VSFA 3TANA 4DTNA 5LY3A 4W5TA 3DOKA 4C1NI 3K9KA 2JLEA 3C6HA 4B08A 4FWRA 3ZSYA 2D0CA 2KFNA 5AQIA 3OYMA 3VF6A 4B9SA 1TAQA 3ZSRA 4DFKA 1RCHA 1S6QA 2HF4A 4JKBA 3VEWA 3SQ1A 2W6KA 1C0UA 2A42A 1L3VA 5KTQA 4CEZA 3AAPA 1QZ6A 4BR9A 2HBKA 1TK0A 2ZF5O 1D9DA 1FKPA 4CK2A 1VQ9N 2I7NA 4IKFA 2RN2A 3MEGA 3WNGA 3O9SA 4O4GA 1ASVA 4LF4K 2W42A 3VF4A 3U6FA 3ZSZA 2FSNA 2NRXA 1HMVA 5FPNA 1NGFA 4CJQA 3K0SA 4DV7K 3OYAA 5M1OA 1D5AA 3MX2A 1R59O 4FWMA 1C1BA 4N56A 1SS6A 4IEIA 3HOTA 1YI2N 1QVGM 1KC8O 2HBJA 3CFRA 2P9UB 1X9MA 4CIFA 1K8KA 4ILGB 1OH5A 4JNEA 3AV9A 3F5TA 3QDKA 3ZX2A 1VQON 3O1BA 4K25A 4QS9A 3MEDA 2VWBA 5AQVA 4EHTA 3NF9A 1YT3A 4K41A 3TAMA 1C0FA 2UU9K 3SUPA 3EN9A 4JN4A 4C8KA 4KTWA 2RKIA 1S1XA 4CZHA 2D1KA 3BEXA 1BL3A 4CJRA 3K59A 1YITN 2AJQA 3O4QA 3T1YK 1VSLA 4IFYA 5AZJA 2FLOA 1TKDA 1FJGK 1T44A 4H0YB 5E84A 3VN5A 4LFCK 4DR7K 4HHTA 1N6QA 4CZMA 1O1WA 3KLFA 5CE3A 3CCJN 3TR8A 3E66A 2P9IA 4JKHA 4B1YB 3KLIA 3L2RA 3QBXA 4CF8A 4IEEA 3HO1A 1D4XA 3DMJA 5CYMA 4H5NA 1RT5A 1EX4A 1LAWA 4BDZA 4HTLA 3RSEB 3K58A 1J9AA 2CGLA 1IKVA 1C0TA 4DS5A 2ZD1A 4IBNA 3WNHA 3LAMA 2P9UA 3KJVA 2IIRA 2YKMA 5C2DA 4WQ5C 2O4IA 5AQLA 3KVGA 2Q31A 2FSJA 1T6DA 1L3SA 3O4NA 2YJFA 2DY4A 1GLDG 4JKGB 1KVAA 4BRDA 3H1QA 2IVPA 4CEQA 3WNEA 1ATSA 3OTOK 4DMNA 3ZX0A 1FXXA 4GW6A 4BWMA 3ZT4A 4HUEA 1X9WA 4DUZK 2WTUA 3OHRA 3J7ZO 3NF8A 4AHTA 4LFAK 4BE2A 4DTPA 4H5WA 3KWIA 3WNFA 1NWKA 4BR0A 3OS1A 1BHLA 3A5OC 5AQJA 2YCHA 2A41A 1EXQA 1ZBUA 2XHBA 3LZJA 2O8EB 3PUFA 4PKGA 3HK2A 3ZEUB 4BVPA 5HBMA 3C6AA 4R5PA 1QVFM 2IOCA 4PKIA 1T6CA 5DM7L 4A5BA 4CZEA 1IG9A 4FJLA 1XHXA 3MN5A 1T8EA 3EEQA 3ZX3A 2KKZA 1JLAA 2BUPA 1NK5A 1IBKK 4HWIA 4DKWA 2F8TA 5GAGP 1S1UA 2XY5A 1DT9A 3U3YA 3TSPA 1JJ2M 4RW8A 4JI3K 3I33A 4OGCA 4M3TA 3JXUA 3SPYA 3SK3A 3CD6N 1UWBA 2G8FA 4OPJA 2VWKA 3HM8A 3C6TA 4JKGA 3RMDA 3SBGA 3IRXA 3E01A 4LF7K 4CFAA 3NH2A 3LP3A 3AO1A 4CE9A 1ESVA 2FSKA 2E2PA 3AVLA 4BRGA 3I0RA 1QSYA 5I3UA 5E41A 2ZJPL 4EZ6A 1ZYQA 4N41A 1YJNN 3OYHA 1FW6A 4DV5K 4CEEA 2D0PA 3D2EB 4BRCA 3DLLL 4JI8K 1VHXA 3LP0A 3QFPA 2XY7A 4JK9A 4I6MB 4GVEA 4CI6A 4C8MA 1DTTA 2O8EA 3C65A 3ZEUA 1L5UA 2OYQA 1TL3A 1REVA 2NNWA 1Z25A 3HVTA 4GKKK 3AVMA 4NYNA 4Z4CA 4GY2B 1T05A 4FW1A 3HVRA 1EO1A 1JLCA 2IGIA 4KHNA 5AQKA 3NFAA 4O5BA 3KHYA 2KZMA 1C6VA 1W97L 1ZBHA 4O0JA 2Q97A 2ZJQL 2FF3B 1TUYA 3M5RA 3BP8A 5HP1A 3OYDA 4OVLA 1NBWA 4AHCA 3DRSA 3PIOL 3OYFA 3THXA 4XH5A 3O3HA 4I7FA 4YNQA 3KK3A 5JMVA 4GMJB 3B8AX 1NJIO 1WBBA 2ETJA 4NCAA 3A2FA 2HHVA 3DI6A 3TTCA 3FR0A 1XNQK 3LALA 3D2EA 4LY7A 1VQNN 1U6ZA 3D6RA 5IT9O 1NGDA 4CJWA 3M8RA 3ZYYX 1BI4B 3J7YP 1ATRA 3SI6A 1N5YA 2HOEA 1EETA 4BRPA 1DGKN 2OA8A 3THWB 3V9XA 4IJAA 5EXWA 4J2AA 1J53A 5ADXA 1U48A 1RFQA 1U2VB 3IFRA 3GG4A 3VA3A 1S1WA 1VSHA 1BO5O 4E1MA 2IVNA 4HTUA 2VG5A 1BCOA 3KK2A 4H5RA 1IKXA 1B9DA 3F2KA 1GLAG 4IZ9A 1A5XA 1VK0A 4IO8A 3TWHA 3ENHA 1UOCA
chains in the Genus database with same CATH topology
3EZ5A 4CHQA 1BISA 4G1QA 5EU7A 2KZZA 3M8SA 3B6OA 1IKYA 2G8IA 3VQEA 3VQDA 3JSMA 4AILC 4CJTA 4B9UA 3LANA 5J2PA 3LP1A 2EHGA 3QNOA 3QNNA 4ZTFA 2B5JA 3SUOA 3D45A 4JRQA 1ASUA 4M3RA 3O3GA 4CGFA 4DTXA 1SKSA 4E7LA 3VQ7A 1UAXA 3V1OA 1LW0A 3VQ5A 2HMIA 1WSIA 1RBVA 2YHAA 3MECA 3C6UA 1LV5A 3DM2A 2Y1IA 1KFSA 4M3YA 4C8NA 1VSKA 1NK8A 1JXEA 4F8RA 4KTQA 4O44A 1EKEA 3P5JA 4PY5A 3SZ2A 3NGZA 2YNIA 3DRPA 1BI4A 3ALYA 1L3TA 5FDLA 4DQQA 3SJJA 2OPRA 4N47A 4CERA 4DTOA 1KLNA 4CHOA 3OY9A 4H4OA 5KGXA 3QINA 1L3UA 1WSJA 4BE0A 3M8QA 3OYEA 3T19A 4DU3A 1GOAA 1HNIA 3KIOA 4FYDA 1FKOA 4F3TA 2DFHA 4DSLA 2P51A 3PO4A 3V9SA 1Q9YA 3HXMA 1JLFA 1HYVA 1YTUA 4KHQA 3DLGA 4DG1A 4TSXA 3ZSOA 1TAUA 3NHGA 3CQ8A 4ELVA 4FJ9A 4J2DA 3LP2A 1RT4A 1XC9A 5C24A 5KGWA 4CEBA 2G8UA 1MU2A 2HNYA 5C25A 3BDPA 2F8SA 3L3VA 2O4GA 4JRPA 2ZE2A 3ZSQA 3K5OA 5HROA 4FJNA 3OYCA 4DTJA 4K8ZA 1NJZA 4DTMA 1D8YA 3L2UA 5CZ1A 2XY6A 1RDCA 4CGJA 1HPZA 3HP6A 3MXMA 2OZMA 4F2SA 4QCLA 1J54A 2FBXA 5K14A 2X78A 3ZT2A 4CK3A 3SV3A 2DTUA 2R7YA 3HYFA 4W5RA 4CIGA 1RNHA 4CJVA 4E7JA 2IDOA 4OJRA 1NK0A 4F3OA 4PWDA 1CLQA 1RT2A 3F9KA 1UA0A 3KKSA 2P5OA 2BE2A 3TI0A 4DS4A 3QERA 3ITHA 3KTQA 2Z1IA 3G10A 2QKBA 4EP4A 4CJFA 3JYTA 3TABA 2YNFA 3KLGA 2YKNA 4M3XA 4KB0A 4IFVA 1BGXT 1RBTA 4CF2A 1QSSA 1LWFA 4CJSA 1VSIA 3OVNA 2X6SA 1K6YA 1W9HA 2BDPA 4F4KA 2HHSA 1NJWA 3TARA 4FJ5A 3VQBA 1BIUA 4QAGA 1U04A 3O3FA 4CHNA 4E7HA 4FVMA 4CGGA 4KRFA 3NF6A 1NOZA 3AVBA 3PV8A 3AVNA 1IH7A 4UQGA 1TGOA 3PO5A 3OYGA 2XRIA 3M8PA 2IS3A 4BDPA 4CJPA 3TAFA 2HHWA 1CXUA 1CXQA 2B6AA 3PX6A 1D9FA 3AVGA 4FJXA 4M3WA 4CFBA 2XY8A 2E6LA 1WSEA 2KQ2A 3QO9A 3OYJA 3SUNA 4KPYA 4FXDA 4IDKA 4DSJA 1GOBA 1HNVA 4DTRA 5HLFA 3L2QA 1NK6A 2OPPA 4YFUA 1SUQA 4H8KA 4BE1A 4E0DA 3HPOA 4HUGA 4FJGA 4Z4GA 3DOLA 4XIUA 1TK8A 3MXJA 5DK5A 4CF9A 4NCBA 1VSFA 3QEWA 3TANA 1T03A 4ELUA 3IAYA 4NCGA 3OYIA 4LSLA 2YHBA 3NH1A 4DTNA 1SL1A 3LWLA 2PY5A 4Q5VA 4W5TA 2A1RA 1QS4A 3DOKA 4DQPA 2HHXA 2JLEA 1QE1A 1SKRA 4B08A 3ASMA 5FROA 4FJMA 3ZSYA 2D0CA 5HRNA 2KFNA 1X9SA 2WOMA 3OYMA 2RF2A 3V6DA 1HJRA 3LZIA 4DFPA 4B9SA 3V9WA 4EP5A 1EP4A 1TAQA 3ZSRA 4DFKA 1RCHA 1S6QA 4Z4HA 5J1EA 3DRRA 4M42A 4Z4EA 3AA4A 1WSHA 4CHZA 1JXBA 3SQ1A 4CJEA 1F21A 5CY4A 2LSNA 3VQ8A 1KCFA 3HP9A 1C0UA 4OKKA 1ZBLA 5I42A 1L3VA 5KTQA 3TAPA 2HNDA 1ZBIA 4FK4A 4CEZA 3HL8A 1QSLA 3NDKA 4CEAA 1TK0A 1D9DA 1FKPA 1HYZA 4AHSA 4CK2A 4QOZB 3QEIA 4FK0A 2FBVA 4M41A 4IKFA 2RN2A 5KRTA 3MEGA 3EY1A 1NK9A 5FRMA 4LH4A 1JLQA 4IG3A 3WNGA 2HW3A 1LW2A 3ZSWA 4CGIA 4O4GA 1ASVA 3AO2A 2W42A 3AVIA 1A5VA 2NUBA 3F73A 2X6NA 2G8WA 4CJ5A 4ID1A 4AHVA 2OZSA 3VQ6A 3U6FA 3ZSZA 3NAEA 3P1GA 4DSIA 3HM9A 1HMVA 1WNSA 4KKOA 3HPHA 3KK1A 2HVIA 4B8CA 4CJQA 5HRRA 3CM5A 1WSFA 3OYAA 1X1PA 1D5AA 3L3UA 4CFDA 3KKRA 3DLKA 3KLEA 1C1BA 3DLEA 4N56A 5HRPA 4J2EA 2YNGA 1RBRA 1JL2A 3CFRA 5JS2A 1X9MA 4CIFA 3LWMA 4DQIA 3H08A 2VG7A 1YVUA 4DSKA 2HB5A 4Y1DA 3AV9A 5J2QA 3RRGA 1XWLA 2YNHA 3AO4A 1TV6A 4DSFA 3RRHA 3V9ZA 3MEDA 3SYZA 3RMCA 1VSDA 1YT3A 1IO2A 3NF9A 3BGRA 4M45A 1WAFA 1RBSA 3TAMA 2OPSA 4RW9A 4CECA 4KHYA 2HHTA 3SQ4A 4FJ7A 3NCIA 1JLEA 4FCYA 3SUPA 4ELTA 1A5WA 4F2RA 2ZQBA 3ZT1A 3ZSXA 4C8KA 4KTWA 1BQNA 3OYKA 3S3NA 2RKIA 1ASWA 1S1XA 3NF7A 4BWJA 3SQ0A 4CJRA 1R0AA 1BL3A 3K59A 3SNNA 3K5LA 3DYAA 3V9UA 1LWEA 4MQ3A 3V1RA 4Q0BA 4MFBA 2AJQA 2GUIA 1NKBA 3O4QA 1VSLA 3AVFA 4IFYA 4CF0A 3CFPA 1C1CA 1NK4A 3RR7A 4DLEA 1TKDA 3RR8A 3VN5A 1RT7A 4C8LA 2VG6A 1JLBA 2D5RA 1KRPA 3PY8A 2KTQA 1RTIA 3NGIA 4HHTA 2JGUA 1N6QA 5HRSA 1Q8IA 1G15A 1O1WA 3KLFA 4PQUA 3TR8A 3L2RA 3ZT3A 3KLIA 4KB1A 3TAGA 3AA5X 1VSMA 4CF8A 3HO1A 5CYMA 3DMJA 2FBTA 1RT5A 4NYFA 1J5OA 1EX4A 3QESA 3QEVA 1S9EA 3RMAA 4KAZA 3SPZA 3D0PA 1LAWA 4BDZA 3VQQA 3MXIA 4RW6A 1J9AA 3OS0A 3K58A 3KLHA 1CZBA 4CEFA 1SL0A 4HCCA 1VSEA 3B6PA 3AO3A 1RDBA 4PUOA 4OKJA 3LPTA 4O55A 1T7PA 3OJUA 3MAQA 4DFJA 1IKVA 3AVKA 1NK7A 1GOCA 1C0TA 4EZ9A 2FBYA 1ZBFA 4DS5A 1SL2A 2ZD1A 5CZ2A 5J2MA 4IBNA 3NBPA 3LAMA 2QXFA 3WNHA 2F96A 3KJVA 4CCHA 1S1TA 2YKMA 1ITGA 3QIPA 4JLHA 2O4IA 4GVMA 4FW2A 1HYSA 2Z1GA 3FFIA 1L3SA 3O4NA 3P83D 2DY4A 1S5JA 3OYLA 1KVAA 4KTZA 4DSEA 3T3FA 3AVHA 4CEDA 4E19A 4E7IA 4CEQA 4FM0A 3WNEA 3QETA 1SV5A 3SCXA 2Z1JA 4KHSA 4FJIA 3LPUA 4DMNA 1FXXA 4GW6A 4BWMA 3ZT4A 4HUEA 4DLGA 4FJKA 5DMRA 3V81A 1X9WA 3VQCA 2G8KA 4Z4IA 4CHPA 4CF1A 4B8AB 1KFDA 4DF4A 3NF8A 3L2WA 4O0IA 3TAQA 1B92A 4AHTA 1NKCA 4FLYA 4FZYA 3VQAA 3AVJA 4CJ3A 4BE2A 4KI4A 4DTPA 1BQMA 4FZZA 3S9HA 5J2NA 3WNFA 3OS1A 2BANA 4I2QA 4KHWA 1BHLA 1Y97A 1RBUA 2GBZA 3ZSVA 3LDSA 2EX3A 3U3GA 1WAJA 4Z0UA 4FLVA 3T1AA 1EXQA 1ZBUA 2XHBA 3LZJA 1U49A 2X74A 3PUFA 4Z4FA 3HK2A 1UA1A 2D0BA 3DLRA 3AO5A 5HBMA 1WN7A 4R5PA 4DQRA 4HCBA 4CK1A 5FRNA 3QLHA 4DU4A 1C0MA 2IOCA 3HJFA 4FJLA 3I8DA 1S9GA 1BCMA 1S1VA 1XHXA 3THVA 2Q3SA 1IG9A 2G8HA 3K57A 1T8EA 2IC3A 5SWMA 1JLAA 2RPIA 4FLZA 1NK5A 1QQCA 1LWCA 5T7BA 1NKEA 4N5SA 4ZHRA 2F8TA 1S1UA 3HPGA 3VQ4A 1TVRA 3K5MA 2XY5A 3U3YA 1BIZA 1FK9A 4RW8A 4OLBA 4OGCA 5SZTA 4DQSA 4M3TA 4M3UA 3OYBA 3SPYA 3S3OA 4OGEA 3KD5E 4KHUA 1UWBA 4W5QA 1KVCA 1I39A 2G8FA 2DFEA 2VWKA 3CM6A 3C6TA 3VQPA 4CGDA 4CJKA 3ZCMA 4OPJA 3RMDA 3KD1E 3IRXA 3E01A 1NOYA 4CFAA 3NH2A 3LP3A 3AO1A 4CE9A 1JL1A 3SQ2A 2HNZA 1YTAA 1HRHA 4AHUA 3AVLA 1DTQA 3I0RA 4JS5A 1U47A 1QSYA 1S6PA 1RT3A 5I3UA 4K8XA 3NGYA 5E41A 1TL1A 4FM1A 4KI6A 4E1NA 1XHZA 2HHUA 4EZ6A 2ATQA 4LSNA 1ZYQA 4LD0A 4RW4A 4CIEA 4N41A 1B9FA 4BDYA 3LAKA 4I9QA 3OYHA 3PX4A 5KRSA 4CEEA 4DU1A 4E7KA 4ID5A 4CJ4A 2IAJA 2PYJA 1QTMA 4C8OA 2GV9A 3LP0A 4DF8A 2XY7A 2P5GA 1RILA 3L8BA 2KW4A 1JLGA 4OLAA 4C8MA 3OS2A 4DWIA 5JS1A 1DTTA 2HVHA 2PYLA 4B9LA 3C95A 3OYNA 3V4IA 4FJJA 4M3ZA 4KFBA 1L5UA 2OYQA 1TL3A 4FM2A 5C42A 1REVA 4L8RB 1RTHA 1Z25A 3HVTA 4B9TA 1XI1A 2QKKA 2FC0A 3AA2A 4FLWA 4B9VA 1KTQA 3AVMA 4NYNA 4Z4CA 1U45A 4W5OA 2BGGA 4B9NA 3PX0A 3DLBA 1WSGA 4W5NA 1T05A 3K2PA 4FW1A 3ZT0A 3HVRA 4KV8A 1JLCA 1VRTA 1RDAA 2IGIA 3CYMA 4DFMA 4KHNA 1C1AA 2E6MA 2Y1JA 3NFAA 4O5BA 3CFOA 4HUFA 3S3MA 2KZMA 1VRUA 1C6VA 1RT6A 3K5NA 1KSPA 1ZBHA 2E4LA 4O0JA 4WE1A 3QIOA 5D3GA 4AHRA 1U4BA 4CHYA 1RTDA 3HSTB 4H4MA 4FJHA 4B3OA 4FK2A 1TK5A 2OPQA 2B4JA 5HP1A 4FJ8A 4OPKA 3HT3A 3OYDA 1Q9XA 4OVLA 3I0SA 4AHCA 3DRSA 1RT1A 4FLUA 1NJXA 3OYFA 3O3HA 4I7FA 4YNQA 4DTSA 2DFFA 4AH9A 4KREA 4CJUA 3C94A 1IKWA 1W0HA 2D0AA 3VA0A 2KFZA 3KK3A 4GMJB 3TAEA 1QHTA 3AVAA 3NH0A 2ETJA 4HVJA 4NCAA 4IG0A 1WLJA 3A2FA 3ULDA 2HHVA 2I5JA 3QEXA 3QEPA 3DI6A 3ISNC 4CGHA 4KO0A 1TKXA 3LALA 4LY7A 4Y1CA 4CJLA 2HHQA 4ZTJA 1NJYA 1CZ9A 4E89A 4CJWA 2G8VA 3M8RA 4B9MA 1BI4B 4N76A 1VSJA 1TKTA 3MEEA 3AVCA 3IG1A 3SI6A 1N5YA 3V1QA 4FZXC 3NE6A 1RTJA 1EETA 1KVBA 4OKEA 3CG7A 4RW7A 1SKWA 2OA8A 3V9XA 1LAVA 1I3AA 2P1JA 1TKZA 4BACA 3RTVA 2QK9A 1DLOA 4PA1A 4J2AA 1J53A 1HQUA 3DLHA 1U48A 4I9LA 3UIQA 3SUQA 4LH5A 3VQ9A 2XO7A 2YV0X 4CEOA 3VA3A 1KLMA 4DTUA 2ITGA 1S1WA 2VWJA 1VSHA 4CFCA 1JKHA 3G0ZA 4ICLA 4E1MA 3AA3A 1RDDA 4I2PA 1HQEA 2PZSA 3IS9A 3RWUA 4HTUA 3SV4A 1Z26A 3RMBA 2VG5A 5KI6A 5CYQA 1BCOA 3KK2A 2WONA 1IKXA 4FLTA 3L2VA 3EYZA 1B9DA 3TWHA 1A5XA 4J2BA 4E3SA 1VK0A 4JS4A 4FLXA 4CESA 4RG8A 2A1SA 3OJSA 2Z1HA 1UOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EZ5 A;  4CHQ A;  1BIS A;  4G1Q A;  5EU7 A;  2KZZ A;  3M8S A;  3B6O A;  1IKY A;  2G8I A;  3VQE A;  3VQD A;  3JSM A;  4AIL C;  4CJT A;  4B9U A;  3LAN A;  5J2P A;  3LP1 A;  2EHG A;  3QNO A;  3QNN A;  4ZTF A;  2B5J A;  3SUO A;  3D45 A;  4JRQ A;  1ASU A;  4M3R A;  3O3G A;  4CGF A;  4DTX A;  1SKS A;  4E7L A;  3VQ7 A;  1UAX A;  3V1O A;  1LW0 A;  3VQ5 A;  2HMI A;  1WSI A;  1RBV A;  2YHA A;  3MEC A;  3C6U A;  1LV5 A;  3DM2 A;  2Y1I A;  1KFS A;  4M3Y A;  4C8N A;  1VSK A;  1NK8 A;  1JXE A;  4F8R A;  4KTQ A;  4O44 A;  1EKE A;  3P5J A;  4PY5 A;  3SZ2 A;  3NGZ A;  2YNI A;  3DRP A;  1BI4 A;  3ALY A;  1L3T A;  5FDL A;  4DQQ A;  3SJJ A;  2OPR A;  4N47 A;  4CER A;  4DTO A;  1KLN A;  4CHO A;  3OY9 A;  4H4O A;  5KGX A;  3QIN A;  1L3U A;  1WSJ A;  4BE0 A;  3M8Q A;  3OYE A;  3T19 A;  4DU3 A;  1GOA A;  1HNI A;  3KIO A;  4FYD A;  1FKO A;  4F3T A;  2DFH A;  4DSL A;  2P51 A;  3PO4 A;  3V9S A;  1Q9Y A;  3HXM A;  1JLF A;  1HYV A;  1YTU A;  4KHQ A;  3DLG A;  4DG1 A;  4TSX A;  3ZSO A;  1TAU A;  3NHG A;  3CQ8 A;  4ELV A;  4FJ9 A;  4J2D A;  3LP2 A;  1RT4 A;  1XC9 A;  5C24 A;  5KGW A;  4CEB A;  2G8U A;  1MU2 A;  2HNY A;  5C25 A;  3BDP A;  2F8S A;  3L3V A;  2O4G A;  4JRP A;  2ZE2 A;  3ZSQ A;  3K5O A;  5HRO A;  4FJN A;  3OYC A;  4DTJ A;  4K8Z A;  1NJZ A;  4DTM A;  1D8Y A;  3L2U A;  5CZ1 A;  2XY6 A;  1RDC A;  4CGJ A;  1HPZ A;  3HP6 A;  3MXM A;  2OZM A;  4F2S A;  4QCL A;  1J54 A;  2FBX A;  5K14 A;  2X78 A;  3ZT2 A;  4CK3 A;  3SV3 A;  2DTU A;  2R7Y A;  3HYF A;  4W5R A;  4CIG A;  1RNH A;  4CJV A;  4E7J A;  2IDO A;  4OJR A;  1NK0 A;  4F3O A;  4PWD A;  1CLQ A;  1RT2 A;  3F9K A;  1UA0 A;  3KKS A;  2P5O A;  2BE2 A;  3TI0 A;  4DS4 A;  3QER A;  3ITH A;  3KTQ A;  2Z1I A;  3G10 A;  2QKB A;  4EP4 A;  4CJF A;  3JYT A;  3TAB A;  2YNF A;  3KLG A;  2YKN A;  4M3X A;  4KB0 A;  4IFV A;  1BGX T;  1RBT A;  4CF2 A;  1QSS A;  1LWF A;  4CJS A;  1VSI A;  3OVN A;  2X6S A;  1K6Y A;  1W9H A;  2BDP A;  4F4K A;  2HHS A;  1NJW A;  3TAR A;  4FJ5 A;  3VQB A;  1BIU A;  4QAG A;  1U04 A;  3O3F A;  4CHN A;  4E7H A;  4FVM A;  4CGG A;  4KRF A;  3NF6 A;  1NOZ A;  3AVB A;  3PV8 A;  3AVN A;  1IH7 A;  4UQG A;  1TGO A;  3PO5 A;  3OYG A;  2XRI A;  3M8P A;  2IS3 A;  4BDP A;  4CJP A;  3TAF A;  2HHW A;  1CXU A;  1CXQ A;  2B6A A;  3PX6 A;  1D9F A;  3AVG A;  4FJX A;  4M3W A;  4CFB A;  2XY8 A;  2E6L A;  1WSE A;  2KQ2 A;  3QO9 A;  3OYJ A;  3SUN A;  4KPY A;  4FXD A;  4IDK A;  4DSJ A;  1GOB A;  1HNV A;  4DTR A;  5HLF A;  3L2Q A;  1NK6 A;  2OPP A;  4YFU A;  1SUQ A;  4H8K A;  4BE1 A;  4E0D A;  3HPO A;  4HUG A;  4FJG A;  4Z4G A;  3DOL A;  4XIU A;  1TK8 A;  3MXJ A;  5DK5 A;  4CF9 A;  4NCB A;  1VSF A;  3QEW A;  3TAN A;  1T03 A;  4ELU A;  3IAY A;  4NCG A;  3OYI A;  4LSL A;  2YHB A;  3NH1 A;  4DTN A;  1SL1 A;  3LWL A;  2PY5 A;  4Q5V A;  4W5T A;  2A1R A;  1QS4 A;  3DOK A;  4DQP A;  2HHX A;  2JLE A;  1QE1 A;  1SKR A;  4B08 A;  3ASM A;  5FRO A;  4FJM A;  3ZSY A;  2D0C A;  5HRN A;  2KFN A;  1X9S A;  2WOM A;  3OYM A;  2RF2 A;  3V6D A;  1HJR A;  3LZI A;  4DFP A;  4B9S A;  3V9W A;  4EP5 A;  1EP4 A;  1TAQ A;  3ZSR A;  4DFK A;  1RCH A;  1S6Q A;  4Z4H A;  5J1E A;  3DRR A;  4M42 A;  4Z4E A;  3AA4 A;  1WSH A;  4CHZ A;  1JXB A;  3SQ1 A;  4CJE A;  1F21 A;  5CY4 A;  2LSN A;  3VQ8 A;  1KCF A;  3HP9 A;  1C0U A;  4OKK A;  1ZBL A;  5I42 A;  1L3V A;  5KTQ A;  3TAP A;  2HND A;  1ZBI A;  4FK4 A;  4CEZ A;  3HL8 A;  1QSL A;  3NDK A;  4CEA A;  1TK0 A;  1D9D A;  1FKP A;  1HYZ A;  4AHS A;  4CK2 A;  4QOZ B;  3QEI A;  4FK0 A;  2FBV A;  4M41 A;  4IKF A;  2RN2 A;  5KRT A;  3MEG A;  3EY1 A;  1NK9 A;  5FRM A;  4LH4 A;  1JLQ A;  4IG3 A;  3WNG A;  2HW3 A;  1LW2 A;  3ZSW A;  4CGI A;  4O4G A;  1ASV A;  3AO2 A;  2W42 A;  3AVI A;  1A5V A;  2NUB A;  3F73 A;  2X6N A;  2G8W A;  4CJ5 A;  4ID1 A;  4AHV A;  2OZS A;  3VQ6 A;  3U6F A;  3ZSZ A;  3NAE A;  3P1G A;  4DSI A;  3HM9 A;  1HMV A;  1WNS A;  4KKO A;  3HPH A;  3KK1 A;  2HVI A;  4B8C A;  4CJQ A;  5HRR A;  3CM5 A;  1WSF A;  3OYA A;  1X1P A;  1D5A A;  3L3U A;  4CFD A;  3KKR A;  3DLK A;  3KLE A;  1C1B A;  3DLE A;  4N56 A;  5HRP A;  4J2E A;  2YNG A;  1RBR A;  1JL2 A;  3CFR A;  5JS2 A;  1X9M A;  4CIF A;  3LWM A;  4DQI A;  3H08 A;  2VG7 A;  1YVU A;  4DSK A;  2HB5 A;  4Y1D A;  3AV9 A;  5J2Q A;  3RRG A;  1XWL A;  2YNH A;  3AO4 A;  1TV6 A;  4DSF A;  3RRH A;  3V9Z A;  3MED A;  3SYZ A;  3RMC A;  1VSD A;  1YT3 A;  1IO2 A;  3NF9 A;  3BGR A;  4M45 A;  1WAF A;  1RBS A;  3TAM A;  2OPS A;  4RW9 A;  4CEC A;  4KHY A;  2HHT A;  3SQ4 A;  4FJ7 A;  3NCI A;  1JLE A;  4FCY A;  3SUP A;  4ELT A;  1A5W A;  4F2R A;  2ZQB A;  3ZT1 A;  3ZSX A;  4C8K A;  4KTW A;  1BQN A;  3OYK A;  3S3N A;  2RKI A;  1ASW A;  1S1X A;  3NF7 A;  4BWJ A;  3SQ0 A;  4CJR A;  1R0A A;  1BL3 A;  3K59 A;  3SNN A;  3K5L A;  3DYA A;  3V9U A;  1LWE A;  4MQ3 A;  3V1R A;  4Q0B A;  4MFB A;  2AJQ A;  2GUI A;  1NKB A;  3O4Q A;  1VSL A;  3AVF A;  4IFY A;  4CF0 A;  3CFP A;  1C1C A;  1NK4 A;  3RR7 A;  4DLE A;  1TKD A;  3RR8 A;  3VN5 A;  1RT7 A;  4C8L A;  2VG6 A;  1JLB A;  2D5R A;  1KRP A;  3PY8 A;  2KTQ A;  1RTI A;  3NGI A;  4HHT A;  2JGU A;  1N6Q A;  5HRS A;  1Q8I A;  1G15 A;  1O1W A;  3KLF A;  4PQU A;  3TR8 A;  3L2R A;  3ZT3 A;  3KLI A;  4KB1 A;  3TAG A;  3AA5 X;  1VSM A;  4CF8 A;  3HO1 A;  5CYM A;  3DMJ A;  2FBT A;  1RT5 A;  4NYF A;  1J5O A;  1EX4 A;  3QES A;  3QEV A;  1S9E A;  3RMA A;  4KAZ A;  3SPZ A;  3D0P A;  1LAW A;  4BDZ A;  3VQQ A;  3MXI A;  4RW6 A;  1J9A A;  3OS0 A;  3K58 A;  3KLH A;  1CZB A;  4CEF A;  1SL0 A;  4HCC A;  1VSE A;  3B6P A;  3AO3 A;  1RDB A;  4PUO A;  4OKJ A;  3LPT A;  4O55 A;  1T7P A;  3OJU A;  3MAQ A;  4DFJ A;  1IKV A;  3AVK A;  1NK7 A;  1GOC A;  1C0T A;  4EZ9 A;  2FBY A;  1ZBF A;  4DS5 A;  1SL2 A;  2ZD1 A;  5CZ2 A;  5J2M A;  4IBN A;  3NBP A;  3LAM A;  2QXF A;  3WNH A;  2F96 A;  3KJV A;  4CCH A;  1S1T A;  2YKM A;  1ITG A;  3QIP A;  4JLH A;  2O4I A;  4GVM A;  4FW2 A;  1HYS A;  2Z1G A;  3FFI A;  1L3S A;  3O4N A;  3P83 D;  2DY4 A;  1S5J A;  3OYL A;  1KVA A;  4KTZ A;  4DSE A;  3T3F A;  3AVH A;  4CED A;  4E19 A;  4E7I A;  4CEQ A;  4FM0 A;  3WNE A;  3QET A;  1SV5 A;  3SCX A;  2Z1J A;  4KHS A;  4FJI A;  3LPU A;  4DMN A;  1FXX A;  4GW6 A;  4BWM A;  3ZT4 A;  4HUE A;  4DLG A;  4FJK A;  5DMR A;  3V81 A;  1X9W A;  3VQC A;  2G8K A;  4Z4I A;  4CHP A;  4CF1 A;  4B8A B;  1KFD A;  4DF4 A;  3NF8 A;  3L2W A;  4O0I A;  3TAQ A;  1B92 A;  4AHT A;  1NKC A;  4FLY A;  4FZY A;  3VQA A;  3AVJ A;  4CJ3 A;  4BE2 A;  4KI4 A;  4DTP A;  1BQM A;  4FZZ A;  3S9H A;  5J2N A;  3WNF A;  3OS1 A;  2BAN A;  4I2Q A;  4KHW A;  1BHL A;  1Y97 A;  1RBU A;  2GBZ A;  3ZSV A;  3LDS A;  2EX3 A;  3U3G A;  1WAJ A;  4Z0U A;  4FLV A;  3T1A A;  1EXQ A;  1ZBU A;  2XHB A;  3LZJ A;  1U49 A;  2X74 A;  3PUF A;  4Z4F A;  3HK2 A;  1UA1 A;  2D0B A;  3DLR A;  3AO5 A;  5HBM A;  1WN7 A;  4R5P A;  4DQR A;  4HCB A;  4CK1 A;  5FRN A;  3QLH A;  4DU4 A;  1C0M A;  2IOC A;  3HJF A;  4FJL A;  3I8D A;  1S9G A;  1BCM A;  1S1V A;  1XHX A;  3THV A;  2Q3S A;  1IG9 A;  2G8H A;  3K57 A;  1T8E A;  2IC3 A;  5SWM A;  1JLA A;  2RPI A;  4FLZ A;  1NK5 A;  1QQC A;  1LWC A;  5T7B A;  1NKE A;  4N5S A;  4ZHR A;  2F8T A;  1S1U A;  3HPG A;  3VQ4 A;  1TVR A;  3K5M A;  2XY5 A;  3U3Y A;  1BIZ A;  1FK9 A;  4RW8 A;  4OLB A;  4OGC A;  5SZT A;  4DQS A;  4M3T A;  4M3U A;  3OYB A;  3SPY A;  3S3O A;  4OGE A;  3KD5 E;  4KHU A;  1UWB A;  4W5Q A;  1KVC A;  1I39 A;  2G8F A;  2DFE A;  2VWK A;  3CM6 A;  3C6T A;  3VQP A;  4CGD A;  4CJK A;  3ZCM A;  4OPJ A;  3RMD A;  3KD1 E;  3IRX A;  3E01 A;  1NOY A;  4CFA A;  3NH2 A;  3LP3 A;  3AO1 A;  4CE9 A;  1JL1 A;  3SQ2 A;  2HNZ A;  1YTA A;  1HRH A;  4AHU A;  3AVL A;  1DTQ A;  3I0R A;  4JS5 A;  1U47 A;  1QSY A;  1S6P A;  1RT3 A;  5I3U A;  4K8X A;  3NGY A;  5E41 A;  1TL1 A;  4FM1 A;  4KI6 A;  4E1N A;  1XHZ A;  2HHU A;  4EZ6 A;  2ATQ A;  4LSN A;  1ZYQ A;  4LD0 A;  4RW4 A;  4CIE A;  4N41 A;  1B9F A;  4BDY A;  3LAK A;  4I9Q A;  3OYH A;  3PX4 A;  5KRS A;  4CEE A;  4DU1 A;  4E7K A;  4ID5 A;  4CJ4 A;  2IAJ A;  2PYJ A;  1QTM A;  4C8O A;  2GV9 A;  3LP0 A;  4DF8 A;  2XY7 A;  2P5G A;  1RIL A;  3L8B A;  2KW4 A;  1JLG A;  4OLA A;  4C8M A;  3OS2 A;  4DWI A;  5JS1 A;  1DTT A;  2HVH A;  2PYL A;  4B9L A;  3C95 A;  3OYN A;  3V4I A;  4FJJ A;  4M3Z A;  4KFB A;  1L5U A;  2OYQ A;  1TL3 A;  4FM2 A;  5C42 A;  1REV A;  4L8R B;  1RTH A;  1Z25 A;  3HVT A;  4B9T A;  1XI1 A;  2QKK A;  2FC0 A;  3AA2 A;  4FLW A;  4B9V A;  1KTQ A;  3AVM A;  4NYN A;  4Z4C A;  1U45 A;  4W5O A;  2BGG A;  4B9N A;  3PX0 A;  3DLB A;  1WSG A;  4W5N A;  1T05 A;  3K2P A;  4FW1 A;  3ZT0 A;  3HVR A;  4KV8 A;  1JLC A;  1VRT A;  1RDA A;  2IGI A;  3CYM A;  4DFM A;  4KHN A;  1C1A A;  2E6M A;  2Y1J A;  3NFA A;  4O5B A;  3CFO A;  4HUF A;  3S3M A;  2KZM A;  1VRU A;  1C6V A;  1RT6 A;  3K5N A;  1KSP A;  1ZBH A;  2E4L A;  4O0J A;  4WE1 A;  3QIO A;  5D3G A;  4AHR A;  1U4B A;  4CHY A;  1RTD A;  3HST B;  4H4M A;  4FJH A;  4B3O A;  4FK2 A;  1TK5 A;  2OPQ A;  2B4J A;  5HP1 A;  4FJ8 A;  4OPK A;  3HT3 A;  3OYD A;  1Q9X A;  4OVL A;  3I0S A;  4AHC A;  3DRS A;  1RT1 A;  4FLU A;  1NJX A;  3OYF A;  3O3H A;  4I7F A;  4YNQ A;  4DTS A;  2DFF A;  4AH9 A;  4KRE A;  4CJU A;  3C94 A;  1IKW A;  1W0H A;  2D0A A;  3VA0 A;  2KFZ A;  3KK3 A;  4GMJ B;  3TAE A;  1QHT A;  3AVA A;  3NH0 A;  2ETJ A;  4HVJ A;  4NCA A;  4IG0 A;  1WLJ A;  3A2F A;  3ULD A;  2HHV A;  2I5J A;  3QEX A;  3QEP A;  3DI6 A;  3ISN C;  4CGH A;  4KO0 A;  1TKX A;  3LAL A;  4LY7 A;  4Y1C A;  4CJL A;  2HHQ A;  4ZTJ A;  1NJY A;  1CZ9 A;  4E89 A;  4CJW A;  2G8V A;  3M8R A;  4B9M A;  1BI4 B;  4N76 A;  1VSJ A;  1TKT A;  3MEE A;  3AVC A;  3IG1 A;  3SI6 A;  1N5Y A;  3V1Q A;  4FZX C;  3NE6 A;  1RTJ A;  1EET A;  1KVB A;  4OKE A;  3CG7 A;  4RW7 A;  1SKW A;  2OA8 A;  3V9X A;  1LAV A;  1I3A A;  2P1J A;  1TKZ A;  4BAC A;  3RTV A;  2QK9 A;  1DLO A;  4PA1 A;  4J2A A;  1J53 A;  1HQU A;  3DLH A;  1U48 A;  4I9L A;  3UIQ A;  3SUQ A;  4LH5 A;  3VQ9 A;  2XO7 A;  2YV0 X;  4CEO A;  3VA3 A;  1KLM A;  4DTU A;  2ITG A;  1S1W A;  2VWJ A;  1VSH A;  4CFC A;  1JKH A;  3G0Z A;  4ICL A;  4E1M A;  3AA3 A;  1RDD A;  4I2P A;  1HQE A;  2PZS A;  3IS9 A;  3RWU A;  4HTU A;  3SV4 A;  1Z26 A;  3RMB A;  2VG5 A;  5KI6 A;  5CYQ A;  1BCO A;  3KK2 A;  2WON A;  1IKX A;  4FLT A;  3L2V A;  3EYZ A;  1B9D A;  3TWH A;  1A5X A;  4J2B A;  4E3S A;  1VK0 A;  4JS4 A;  4FLX A;  4CES A;  4RG8 A;  2A1S A;  3OJS A;  2Z1H A;  1UOC A; 
#chains in the Genus database with same CATH topology
 1BIS A;  5EU7 A;  1YJW N;  4JI2 K;  2KZZ A;  1IKY A;  1VQ7 N;  4WYB A;  1IJJ A;  5C2F A;  2EHG A;  4B1Z A;  3QNN A;  1NKC A;  3D45 A;  5EY4 A;  3T7Z A;  2HMI A;  1UAX A;  2YHX A;  4BG9 A;  3CCM N;  4M3Y A;  4PY5 A;  5ADX H;  3L4I A;  2E8A A;  1BI4 A;  4QS8 A;  4A2A A;  1L3T A;  3SJJ A;  4JI0 K;  2E1Y A;  3LDP A;  1HKG A;  2QA4 N;  3A5N C;  4H4O A;  5KGX A;  1Q18 A;  3M8Q A;  3OYE A;  4DU3 A;  1GOA A;  3HTV A;  1FKO A;  4FYD A;  4B3S K;  2QXL A;  1U2V A;  1BA0 A;  3CJC A;  1ZC6 A;  1JLF A;  1HYV A;  5BRD A;  3DLG A;  4TSX A;  4EHU A;  4FJ9 A;  3QML A;  4J2D A;  1XC9 A;  4CD3 A;  3R9P A;  4CEB A;  3JAM O;  2HNY A;  2QTD A;  2O4G A;  5BR8 K;  4JI1 K;  5HRO A;  5CHI A;  1XMQ K;  4DTJ A;  4DTM A;  1D8Y A;  1TYQ B;  2XY6 A;  4F2S A;  4CGJ A;  2OZM A;  3CI5 A;  4BRN A;  3DWL A;  2X78 A;  3HYF A;  1RNH A;  5AQY A;  1NK0 A;  2IDO A;  4OJR A;  3A5M C;  3KKS A;  4KH5 A;  1ZXO A;  2BE2 A;  3TI0 A;  4DS4 A;  3QER A;  2Z1I A;  3G10 A;  2QKB A;  4EP4 A;  3TAB A;  5AQP A;  1LWF A;  4CJS A;  4F4K A;  4JYA K;  1LOT B;  4OPH A;  4BC5 A;  4CGG A;  5BN8 A;  3PO5 A;  1QQN A;  2XRI A;  3M8P A;  2IS3 A;  2NRH A;  5BPL A;  3TAF A;  2B6A A;  3PX6 A;  3O08 A;  2XY8 A;  3QO9 A;  4FXD A;  1HNV A;  4OO1 J;  4DTR A;  4BE1 A;  3HPO A;  4FJG A;  3L4Q A;  4XIU A;  5C10 A;  3MXJ A;  4CF9 A;  4LF5 K;  4EIA A;  1NGI A;  2HST A;  3IKM A;  3T69 A;  4ELU A;  3NH1 A;  4RCH A;  4Q5V A;  2A1R A;  1TYQ A;  1QS4 A;  3R1X A;  1QE1 A;  4AM6 A;  3ASM A;  5FRO A;  4FJM A;  5AFU A;  3LZI A;  4EP5 A;  1EP4 A;  5J1E A;  2P9K B;  5GAE P;  4M7X A;  4NXN K;  1F21 A;  2Q2R A;  4JEP A;  1KCF A;  3HP9 A;  5LJW A;  4OKK A;  1OVQ A;  1ZBI A;  4EAH D;  1S72 N;  4AHS A;  4MO4 A;  2E5L K;  5FRM A;  3C7N A;  3TTF A;  3AO2 A;  3VMF B;  3R6M A;  4CJ5 A;  4ID1 A;  2OZS A;  3P1G A;  4B8C A;  3HRG A;  3IUC A;  3CM5 A;  3VOV A;  2FF6 A;  4CFD A;  5HRP A;  4J2E A;  1RBR A;  4DQI A;  4FO0 A;  4DSK A;  2HB5 A;  5J2Q A;  1XWL A;  1VSD A;  1IO2 A;  3BGR A;  4M45 A;  2P9K A;  4KH6 A;  2HF3 A;  4FCY A;  4ELT A;  4F2R A;  3ZT1 A;  4BRF A;  1RDU A;  3NF7 A;  3DYA A;  4MQ3 A;  3VEN A;  3CFP A;  3RVC A;  5H1S Q;  4DLE A;  1RT7 A;  3CMA N;  2JGU A;  1VQ5 N;  5HRS A;  3MCP A;  1G15 A;  3PSI A;  1HUX A;  4PQU A;  3CF5 L;  3LM2 A;  2UXB K;  3ZT3 A;  4KB1 A;  3AGK A;  4IOX A;  1BU6 O;  1J5O A;  2P9N B;  3QEV A;  3D0P A;  4MO5 A;  3CCU N;  5JLH A;  3CME N;  3KLH A;  1SL0 A;  4CEF A;  4HCC A;  1VSE A;  4PUO A;  1DKG D;  2E20 A;  3LPT A;  3OJU A;  4DFJ A;  3AVK A;  4EZ9 A;  2FBY A;  1SL2 A;  2QXF A;  2F7T A;  5EX5 A;  3VER A;  1NGG A;  4DB3 A;  1ITG A;  4CCH A;  3AAQ A;  3E1Y A;  2ZWH A;  4FW2 A;  2HMP A;  3FFI A;  1S5J A;  3BZK A;  4CVN E;  4E19 A;  4K43 A;  5KQ8 A;  1SV5 A;  3SCX A;  1K8K B;  3LPU A;  5DM6 L;  3O9Q A;  3VQC A;  4Z4I A;  2GTD A;  5GIP A;  2ZGZ A;  2JWL A;  3L2W A;  3SMS A;  1WB9 A;  4FLY A;  3LM9 A;  4DQ8 A;  1BQM A;  4YDU A;  5BR9 A;  2BAN A;  4KHW A;  1HKB A;  1Y97 A;  1YIJ N;  3ZSV A;  2EX3 A;  3U3G A;  4Z0U A;  3A5L C;  3T1A A;  1U49 A;  3BUZ B;  2NRZ A;  1WN7 A;  2NLX A;  3QLH A;  5AZJ B;  4E1J A;  2P9N A;  4H0O A;  2Q3S A;  4H0V B;  5SWM A;  4JKD A;  2RPI A;  1LWC A;  1HJO A;  4DR1 K;  2P9I B;  4H0P A;  2GEM A;  4JAX A;  4N5S A;  4K0K K;  3VQ4 A;  4JV5 K;  4LFB K;  4B3T K;  4CBX A;  4DQS A;  4JKA A;  4M3U A;  3OYB A;  1J6Z A;  1JCE A;  4V19 S;  4KHU A;  1NNE A;  5AJ3 K;  2YJE A;  3H45 C;  3SBT A;  3EZW A;  5MLC Q;  2DFE A;  3KD1 E;  3BF3 A;  2E2O A;  5JLF A;  4LC9 B;  3DJC A;  3FGU A;  3I8B A;  3M3Z A;  1YTA A;  1N32 K;  4JS5 A;  4B1X B;  1S6P A;  1ILY A;  1RT3 A;  4K8X A;  3CPW M;  4FM1 A;  2ATQ A;  4JD2 A;  1NGB A;  1B9F A;  4BDY A;  3VGM A;  3M6G A;  3ULE A;  1IG8 A;  5KRS A;  4FWN A;  3SJH A;  1YHQ N;  2GV9 A;  2KW4 A;  5JS1 A;  3TSU A;  4OLA A;  4IJN A;  3MN7 A;  1HKC A;  3CCV N;  4FM2 A;  5C42 A;  4B9T A;  2QKK A;  3MWP A;  2BGG A;  4BRL A;  4W5O A;  4CBW A;  1LCU A;  3ZT0 A;  1VQP N;  1VRT A;  3F9M A;  2HBM A;  2E6M A;  3WXK A;  4HUF A;  3CPE A;  3K5N A;  4JI7 K;  5LL6 Z;  5D3G A;  1U4B A;  3HST B;  4DV6 K;  1K9M O;  4FK2 A;  4OPK A;  3I0S A;  5GAD P;  4FLU A;  3SAF A;  5BPM A;  2DFF A;  4MLE A;  4KRE A;  1XNR K;  3HI0 A;  3C94 A;  4BRH A;  1W0H A;  3TAE A;  4IG0 A;  1WLJ A;  2I5J A;  4PL7 A;  3QEP A;  4CGH A;  1KAZ A;  2HHQ A;  4BY9 C;  4ZTJ A;  1NLV A;  1NMN A;  1NJY A;  1VQ8 N;  2G8V A;  5AZI B;  4H5T A;  2W6L A;  4BR7 A;  2IVO A;  4DV0 K;  1YXQ A;  3CC2 N;  4OKE A;  3CG7 A;  4RW7 A;  1I3A A;  1VQ6 N;  2JWK A;  4PA1 A;  3TPQ A;  1HQU A;  2GWJ A;  4I9L A;  4LH5 A;  2XO7 A;  2WC9 A;  4CEO A;  3H46 O;  2QWN A;  4MLH A;  4DTU A;  4OPA A;  2YI1 A;  1JKH A;  3AA3 A;  1RDD A;  4I2P A;  1HQE A;  3U8X A;  3RMB A;  4DR3 K;  5KI6 A;  5CYQ A;  2WON A;  1J5E K;  2VQF K;  4DV1 K;  4E3S A;  4FLX A;  4JS4 A;  3CCE N;  2Z1H A;  3MXI A;  2P5G A;  3VPZ A;  4BR2 A;  4G1Q A;  1T3V A;  2G8I A;  3VQD A;  3JSM A;  2DPN A;  2O8B A;  4J8F A;  4ZTF A;  4IOC L;  2B5J A;  1ASU A;  4CGF A;  3H6E A;  1LW0 A;  1V4T A;  1SAZ A;  3THX B;  1NK8 A;  4O44 A;  3P5J A;  3R3L A;  3P38 A;  2YNI A;  5AZI A;  4X64 K;  4FWP A;  4DQQ A;  4U67 L;  2NZT A;  4CER A;  1HNZ K;  2D0O A;  5CR4 A;  1YAG A;  5M1Q A;  3T19 A;  3ID8 A;  4LF6 K;  4F3T A;  2DFH A;  2P51 A;  5AQS A;  3PO4 A;  3V9S A;  1Q9Y A;  5AQH A;  5AQN A;  2VGM A;  3ZSO A;  3CQ8 A;  5F2R A;  2PFU A;  5C24 A;  3VEO A;  5KGW A;  2G8U A;  1MU2 A;  4XH4 A;  3L3V A;  4JRP A;  1YUW A;  3OYC A;  3CCQ N;  1VQ4 N;  1KAY A;  4CBU A;  4K8Z A;  3L2U A;  1HPZ A;  3LDL A;  1J54 A;  4CK3 A;  1N34 K;  3SV3 A;  5KPR A;  4W5R A;  2R7Y A;  4E7J A;  5I9E B;  4F3O A;  2NRV A;  1TUU A;  3BF1 A;  1RT2 A;  1UA0 A;  3LL3 A;  2P5O A;  3N4P A;  3UE5 A;  2YKN A;  1BGX T;  1MDU B;  3OVN A;  2X6S A;  1K6Y A;  2QWP A;  1NJW A;  4FJ5 A;  4QAG A;  5M1N A;  3FZH A;  4CHN A;  3CIP A;  4FVM A;  2KLA A;  3CET A;  2QM1 A;  3KWG A;  3PV8 A;  3AVN A;  4UQG A;  3R8E A;  5F0X A;  5BPN A;  4BDP A;  1CXU A;  1CXQ A;  3O5B A;  4B1U B;  4M3W A;  1QQM A;  3VES A;  4CFB A;  1WSE A;  4KPY A;  4FOE A;  4XEI A;  4YFU A;  2VGN A;  3DOL A;  1TK8 A;  3VGL A;  5DK5 A;  4BQL A;  3IAY A;  4LSL A;  4YDU C;  2YHB A;  4A5A A;  4JK7 A;  4B3R K;  3LWL A;  3J80 O;  4DQP A;  1SKR A;  4BR5 A;  3WT0 A;  2HHH K;  1OH7 A;  2WOM A;  2RF2 A;  2ZJR L;  3V9W A;  4CJ7 A;  1GLE G;  4M42 A;  3DRR A;  1WSH A;  4CJE A;  3VEZ A;  1E3M A;  2F9T A;  2LSN A;  3HBT A;  3JS6 A;  5I42 A;  3TAP A;  4FK4 A;  3PLA A;  1Q86 O;  3WXI A;  3NDK A;  2UUA K;  1HYZ A;  2RHK A;  4BRO A;  4FK0 A;  5KRT A;  1NM1 A;  3EY1 A;  4IG3 A;  4C1N K;  2HW3 A;  3ID6 A;  2G8W A;  1JCF A;  3H3O B;  3VEY A;  4AHV A;  2ITM A;  3VQ6 A;  1NU0 A;  3NAE A;  4DSI A;  3HM9 A;  4KKO A;  3AGR A;  4H0T B;  1WSF A;  3E9O A;  3KLE A;  3DLE A;  2YNG A;  2Q0R A;  1S22 A;  3LWM A;  3WXL A;  4CZK A;  2VG7 A;  4Y1D A;  1TV6 A;  3O9R A;  4DSF A;  3RRH A;  3V9Z A;  4PKH A;  3SYZ A;  5AQT A;  2OPS A;  4CEC A;  3SQ4 A;  4FJ7 A;  3NCI A;  2ZGY A;  5B8H A;  3ZSX A;  3OYK A;  4BWJ A;  1ASW A;  1R0A A;  3CC7 N;  1HPM A;  3K5L A;  4X62 K;  3V9U A;  1LWE A;  4MFB A;  2Q36 A;  3OA9 A;  1GLB G;  3VET A;  3AVF A;  2YHW A;  3ATU A;  1C1C A;  3RR7 A;  3U9D A;  1HNW K;  3RR8 A;  2VG6 A;  2D5R A;  3BZC A;  2CH5 A;  1Q8I A;  3HSC A;  3EE8 A;  2FBT A;  2P9P B;  3QES A;  1OH8 A;  3RMA A;  3SPZ A;  1NGH A;  4JKE A;  4RW6 A;  1ATN A;  3C7N B;  4QS7 A;  4OKJ A;  3MAQ A;  4YOW A;  2A40 A;  3NBP A;  4A57 A;  2F96 A;  3G4S N;  4YOV A;  4JLH A;  4GVM A;  2E2N A;  2V52 B;  4RWT A;  3U4L A;  1X3M A;  4CED A;  4E7I A;  4FM0 A;  4KHS A;  4UY8 O;  2Z1J A;  3M1F A;  1YF5 L;  1NGJ A;  2UUC K;  4DLG A;  3DXK B;  2G8K A;  4DV2 K;  3SAH A;  4CHP A;  4CF1 A;  4DF4 A;  1XC3 A;  4H0X B;  4O0I A;  2V7Z A;  3AVJ A;  4H5V A;  4KI4 A;  3NVK A;  4ILJ A;  2ASP A;  4BRE A;  5TKY A;  5J2N A;  4I2Q A;  4K42 A;  3ENB A;  4IXC A;  1WAJ A;  4FLV A;  4DR4 K;  2D0B A;  3DLR A;  3AO5 A;  3MWT A;  4DQR A;  4DU4 A;  1VAZ A;  2P9P A;  3I8D A;  1S1V A;  3THV A;  2G8H A;  3L0Q A;  2IC3 A;  1BDG A;  4FLZ A;  1QQC A;  3IMX A;  2PAV A;  3K5M A;  4BR4 A;  1BIZ A;  1FK9 A;  5LMU K;  3FZK A;  2RE2 A;  4O8U A;  4OGE A;  1KVC A;  1I39 A;  4A61 A;  1OH6 A;  4CGD A;  3ZCM A;  5AFU H;  1NOY A;  1XMO K;  3W3D A;  1JL1 A;  3SQ2 A;  2HNZ A;  4A62 A;  3SMP A;  3Q7B A;  2GUP A;  5LMN K;  1GLJ O;  2A6A A;  3DXK A;  2HHU A;  4E1N A;  5BN9 A;  5BRH A;  4LSN A;  1P8Z A;  3FLC O;  4CIE A;  2NRT A;  5F1X A;  3PX4 A;  1QQO A;  4JKF A;  4E7K A;  3CJ1 A;  4ID5 A;  4GKJ K;  4CJ4 A;  1X3N A;  2IAJ A;  2QWR A;  3CHW A;  2PYJ A;  1QTM A;  4DF8 A;  4GV9 A;  3L8B A;  4DWI A;  2HVH A;  3C95 A;  3OYN A;  3V4I A;  2QI2 A;  5FPD A;  3VEV A;  2Q1N A;  4KFB A;  2O8F A;  1VQK N;  4L8R B;  1RTH A;  1XI1 A;  2FC0 A;  2OCE A;  4FLW A;  4EFH A;  1U45 A;  5HOO A;  4B9N A;  4W5N A;  4FSV A;  4R79 A;  3CYM A;  1KAX A;  2Y1J A;  2CH6 A;  2AA4 A;  3GBT A;  1VRU A;  1RT6 A;  1XQS C;  2E4L A;  4WE1 A;  1X9J A;  2OTL N;  3PSF A;  4AHR A;  1IV0 A;  4H4M A;  4FJH A;  4NO7 A;  3IDH A;  3AAR A;  4B1V A;  1TK5 A;  4JKC A;  2B4J A;  3HT3 A;  4IDH A;  4FWK A;  4OX9 K;  5AQX A;  1RT1 A;  1NJX A;  4FVU A;  5AQQ A;  2UYT A;  3Q7C A;  4AH9 A;  1IKW A;  3TSQ A;  4YOY A;  1QHT A;  3NH0 A;  3ULD A;  3QEX A;  1C0G A;  2KHO A;  4KO0 A;  3O9T A;  4Y1C A;  1MWK A;  2FXU A;  5A2Q O;  3SLC A;  4B9M A;  4N76 A;  5E26 A;  4ISE A;  3AVC A;  3IG1 A;  4JD2 B;  2VCP A;  4FZX C;  2V51 B;  3ULE B;  1W7A A;  1KVB A;  2QW9 A;  2E1Z A;  1SKW A;  3MN6 A;  3S41 A;  2P1J A;  4BAC A;  3VGK A;  3E9P A;  3DLH A;  3FZM A;  1SQK A;  2ITG A;  1N36 K;  5KPZ A;  4IO9 L;  3G0Z A;  3IS9 A;  3TTD A;  4Y0W A;  3SV4 A;  1Z26 A;  3NMU A;  3L2V A;  4WCE L;  3ENO A;  2GX9 A;  5AQZ A;  4BC4 A;  1K73 O;  3G6E N;  4RG8 A;  2QWL A;  5T7B A;  2WUS A;  3M8S A;  3B6O A;  2E2Q A;  4LF8 K;  3VQE A;  3EE9 A;  4ISF A;  4AIL C;  1JCG A;  4CJT A;  4O8K A;  1P90 A;  3QNO A;  3ATV A;  4X66 K;  4DTX A;  4M3R A;  3O3G A;  4DV4 K;  4DHY A;  1HX1 A;  4E7L A;  3VQ7 A;  3V1O A;  5FPM A;  1WSI A;  1RBV A;  2GWK A;  3A0I X;  1LV5 A;  3DM2 A;  2Y1I A;  1KFS A;  4C8N A;  4BC3 A;  1JXE A;  4F8R A;  4KTQ A;  1Q82 O;  3SZ2 A;  3NGZ A;  3DRP A;  3ALY A;  3P31 A;  4CHO A;  3OY9 A;  3CQX A;  4BE0 A;  5M1P A;  5BRF A;  1HNI A;  3DXM B;  3LDQ A;  4GV3 A;  1MWM A;  4DSL A;  3O1W A;  3HXM A;  1YTU A;  4KHQ A;  2YHY A;  3AY9 A;  4ELV A;  5EOY A;  1RT4 A;  4NLC A;  3UB5 A;  3CJA A;  5KPT A;  5AQU A;  4JI5 K;  1RDW X;  2ZE2 A;  3K5O A;  1V4S A;  1BG3 A;  4BC2 A;  1VQL N;  1NJZ A;  5CZ1 A;  3MXM A;  2QWQ A;  5K14 A;  4BRK A;  2DTU A;  1CZA N;  3D2F B;  4CJV A;  4PWD A;  1CLQ A;  3EO3 A;  4AF1 A;  2J4R A;  3WEE B;  3QIC A;  3KTQ A;  3ITH A;  3FZF A;  4CJF A;  1HLU A;  3JYT A;  1WUA A;  3KLG A;  2NRW A;  4A2B A;  1QSS A;  1VSI A;  3WXM B;  1YVN A;  1W9H A;  2HHS A;  3VQB A;  1BIU A;  5GIN A;  4IWV A;  1U04 A;  2O8B B;  3HOS A;  4E7H A;  3ZLJ A;  1YJ9 N;  4O5F A;  4KRF A;  2BH1 A;  3NF6 A;  3QB0 A;  1TGO A;  4U7B A;  4CZL A;  2A5X A;  2QWM A;  3DXM A;  2CGJ A;  1D9F A;  4B3M K;  3AVG A;  5C15 A;  3CJ7 A;  2CGK A;  2E6L A;  3SUN A;  3L2Q A;  1NK6 A;  2OPP A;  1HR0 K;  1EWR A;  4H8K A;  3PIP L;  4ISG A;  4NXM K;  4FWS A;  1NGC A;  3QEW A;  1T03 A;  4NCG A;  3OYI A;  4XH1 A;  4ILH A;  1SL1 A;  2PY5 A;  5M1F A;  3CCS N;  2HHX A;  2WBN A;  3D2F A;  4BGB A;  4CW7 B;  5HRN A;  5GIO A;  1X9S A;  5AQW A;  3V6D A;  1HJR A;  1S3X A;  4DFP A;  2W40 A;  3WEE A;  4IFE A;  4WFA L;  4Z4H A;  5LJV A;  4FWQ A;  4Z4E A;  3AA4 A;  4CHZ A;  4WF9 L;  1JXB A;  5CY4 A;  4JHD B;  4AQY K;  1M1K O;  4YOT A;  3VQ8 A;  5C12 A;  1W2B M;  1ZBL A;  4BRM A;  2HND A;  3HL8 A;  4BRA A;  1KXP A;  3MCA B;  3SAG A;  1QSL A;  4FL9 A;  4CEA A;  2NRR A;  4QOZ B;  3RSE A;  3QEI A;  2FBV A;  4M41 A;  1NK9 A;  4LH4 A;  1JLQ A;  1Q81 O;  1LW2 A;  3ZSW A;  4CGI A;  3CJB A;  3FZL A;  3U9Z A;  3AVI A;  1A5V A;  2NUB A;  3O8M A;  2X6N A;  3F73 A;  1E4F T;  2ASM A;  1VQM N;  1E4G T;  4BRI A;  1WNS A;  4JK8 A;  3HPH A;  5GAH P;  3MDQ A;  3OBY A;  3KK1 A;  2F4V K;  2HVI A;  5HRR A;  3CQY A;  3LDN A;  1X1P A;  1BWF O;  3L3U A;  4DR2 K;  3KKR A;  3DLK A;  1JL2 A;  1EQY A;  5JS2 A;  3QBW A;  3H08 A;  5AR0 A;  1YVU A;  3EKS A;  5HL7 L;  1Z05 A;  3RRG A;  4JI6 K;  4NLB A;  2YNH A;  3AO4 A;  5KQD A;  4IOA L;  3I55 N;  3RMC A;  1MA9 B;  4A59 A;  1WAF A;  1RBS A;  2HHT A;  4RW9 A;  4KHY A;  3NVM A;  1SZ2 A;  1GLL O;  3MX5 A;  1JLE A;  1A5W A;  1KQS M;  2ZQB A;  4FWO A;  4JHD A;  2ASO A;  2Q0U A;  1BQN A;  1M90 O;  3S3N A;  3SQ0 A;  4BRQ A;  2P9S B;  5AQO A;  3SNN A;  3WQU A;  3V1R A;  4Q0B A;  2GUI A;  1NKB A;  3FFK B;  4CF0 A;  1NK4 A;  4WQ4 A;  4DCH A;  4C8L A;  4FPA A;  3MK6 A;  1JLB A;  1KRP A;  3PY8 A;  2KTQ A;  1RTI A;  3NGI A;  2AP1 A;  2UXD K;  2W41 A;  1K8A O;  3TAG A;  3AA5 X;  4BG8 A;  1VSM A;  2QWO A;  4NYF A;  3N4Q A;  1S9E A;  4KAZ A;  3VQQ A;  3OS0 A;  4M63 C;  1CZB A;  4BQZ A;  3B6P A;  3AO3 A;  1RDB A;  4O55 A;  1T7P A;  1NK7 A;  1GOC A;  4BGA A;  1ZBF A;  1EWQ A;  3OBW A;  1NGA A;  5CZ2 A;  5JIC A;  5J2M A;  3W0L A;  1S1T A;  3QIP A;  1HYS A;  2Z1G A;  4B9Q A;  3P83 D;  3OYL A;  4KTZ A;  4DSE A;  3T3F A;  3E9L A;  3AVH A;  3VEX A;  4KBO A;  3QET A;  4FJI A;  3C0B A;  4FJK A;  3J81 O;  5DMR A;  3V81 A;  4I6M A;  4DR5 K;  5TKW A;  2P9S A;  4L3Q A;  4B8A B;  1KFD A;  2O8D B;  3TAQ A;  1B92 A;  3D7E O;  4H03 B;  4YOX A;  3CC4 N;  4FZY A;  3VQA A;  1OVY A;  5EVZ A;  4CJ3 A;  2HBL A;  4FZZ A;  3S9H A;  3CJ9 A;  2GBZ A;  3LDS A;  1RBU A;  5C0Y A;  2X74 A;  4Z4F A;  3UKU B;  1UA1 A;  4HCB A;  3KZB A;  5ELZ A;  3EKU A;  4CK1 A;  5JVG L;  5FRN A;  1QZ5 A;  3UKR B;  1C0M A;  3HJF A;  1IBM K;  1S9G A;  1BCM A;  4CD1 A;  3K57 A;  4YOU A;  2GEL A;  3VTI A;  5AQF A;  3QFU A;  1NKE A;  4ZHR A;  3HPG A;  1TVR A;  4OLB A;  5SZT A;  3VTH A;  5FLX O;  4LF9 K;  3S3O A;  3KD5 E;  4W5Q A;  4CZG A;  3GE1 A;  3CM6 A;  3VQP A;  4CJK A;  4NB4 A;  1HRH A;  4AHU A;  1DTQ A;  1U47 A;  4F9O A;  3NGY A;  3MN9 A;  1TL1 A;  4KI6 A;  4DUY K;  1XHZ A;  1HNX K;  4CZF A;  4LD0 A;  4RW4 A;  3LAK A;  4I9Q A;  2O8D A;  2I7P A;  5JVH L;  4DU1 A;  3THW A;  1IBL K;  4DR6 K;  4C8O A;  2F9W A;  1RIL A;  1JLG A;  2ZM6 K;  4RTF D;  3OS2 A;  2PYL A;  4B9L A;  4M3Z A;  4FJJ A;  3UKU A;  3GDQ A;  3O4W A;  2EWS A;  3UKR A;  3AA2 A;  1N8R O;  4B9V A;  3T1H K;  5AQR A;  1KTQ A;  2WFB A;  3PX0 A;  3CCL N;  1WSG A;  1GLC G;  3DLB A;  3K2P A;  3CXC M;  4KV8 A;  1RDA A;  4DFM A;  1C1A A;  4GV6 A;  3CFO A;  3S3M A;  3WUH A;  3ZET B;  2VYP A;  3J7A P;  1KSP A;  1BOT O;  2P9L B;  4YHH K;  3QIO A;  4YOR A;  4CHY A;  1RTD A;  4B3O A;  1OKJ A;  2OPQ A;  3CCR N;  3O6W A;  4FJ8 A;  1Q9X A;  4GNI A;  3O80 A;  4DTS A;  4C23 A;  4CJU A;  3MMV A;  5M1K A;  2D0A A;  3VA0 A;  1GLF O;  2KFZ A;  3AVA A;  4HVJ A;  5BRE A;  4PHT X;  5AQM A;  3TU5 A;  3ISN C;  3GOI A;  4FOI A;  1TKX A;  3J8A A;  2D4W A;  1N33 K;  4CJL A;  3H3N O;  1H1V A;  1CZ9 A;  4E89 A;  4WQ5 A;  1VSJ A;  1TKT A;  3MEE A;  3V1Q A;  1BUP A;  3NE6 A;  1RTJ A;  1LAV A;  3RTV A;  1TKZ A;  1G99 A;  2QK9 A;  1DLO A;  3UIQ A;  3SUQ A;  3VQ9 A;  2YV0 X;  1KLM A;  2O8F B;  2VWJ A;  4CFC A;  3OW2 M;  4ICL A;  2O8C B;  2PZS A;  3RWU A;  3ZET A;  2P9L A;  1DEJ A;  4YY3 K;  2A3Z A;  4FLT A;  1RGI A;  3EYZ A;  4J2B A;  4KH4 A;  3KK7 A;  4CES A;  2A1S A;  3OJS A;  3GL1 A;  3THY B;  2H3G X;  3EZ5 A;  4CHQ A;  3P4I A;  4B9U A;  3LAN A;  5J2P A;  3K9J A;  3LP1 A;  1WOQ A;  3SUO A;  4CZJ A;  4JRQ A;  1SKS A;  4B1W B;  4BVO A;  3VQ5 A;  4WFB L;  3G25 A;  2YHA A;  3MEC A;  3C6U A;  1VSK A;  1I94 K;  1EKE A;  1ZBS A;  1BA1 A;  3A8Y A;  5IWA K;  5FDL A;  2VQE K;  2OAN A;  2OPR A;  4N47 A;  4DTO A;  1KLN A;  1NMD A;  1Y64 A;  3QIN A;  1L3U A;  1WSJ A;  4KHP K;  1O13 A;  1NG9 A;  3KIO A;  4G9Z A;  1Z6R A;  4M7Y A;  2PBD A;  2QEX N;  3DAW A;  4DG1 A;  3WQT A;  1TAU A;  3NHG A;  1NGE A;  2O8C A;  2UXC K;  2BTF A;  3LP2 A;  3I56 N;  4CZI A;  4WQ4 C;  5C25 A;  3LDO A;  3BDP A;  2E88 A;  2UUB K;  1XUP O;  4FJN A;  3ZSQ A;  2F8S A;  1Q7Y O;  2V7Y A;  4MDA A;  1RDC A;  3HP6 A;  4QCL A;  3ZT2 A;  2FBX A;  3THY A;  2OTJ N;  1KD1 O;  3H1V X;  4CIG A;  3BY5 A;  2YX6 A;  3F9K A;  3L6Q A;  1WBD A;  2YNF A;  3CER A;  4M3X A;  4KB0 A;  4IFV A;  1RBT A;  4CF2 A;  3O9U A;  3P39 A;  2BDP A;  3TAR A;  3O3F A;  3VF2 A;  4Z94 A;  4DV3 K;  4X65 K;  1NOZ A;  3AVB A;  5AQG A;  1IH7 A;  3HZ6 A;  3G71 N;  3OYG A;  4CJP A;  1QHA A;  4MDB A;  2HHW A;  3WXJ A;  4AM7 A;  4FJX A;  4JI4 K;  2KQ2 A;  4PL8 A;  3OYJ A;  4IDK A;  4DSJ A;  1GOB A;  5HLF A;  4FWL A;  5FPE A;  3EL2 A;  1SUQ A;  4E0D A;  3FE1 A;  4HUG A;  4FPB A;  4Z4G A;  4WFN L;  4NCB A;  1VSF A;  3TAN A;  4DTN A;  5LY3 A;  4W5T A;  3DOK A;  4C1N I;  3K9K A;  2JLE A;  3C6H A;  4B08 A;  4FWR A;  3ZSY A;  2D0C A;  2KFN A;  5AQI A;  3OYM A;  3VF6 A;  4B9S A;  1TAQ A;  3ZSR A;  4DFK A;  1RCH A;  1S6Q A;  2HF4 A;  4JKB A;  3VEW A;  3SQ1 A;  2W6K A;  1C0U A;  2A42 A;  1L3V A;  5KTQ A;  4CEZ A;  3AAP A;  1QZ6 A;  4BR9 A;  2HBK A;  1TK0 A;  2ZF5 O;  1D9D A;  1FKP A;  4CK2 A;  1VQ9 N;  2I7N A;  4IKF A;  2RN2 A;  3MEG A;  3WNG A;  3O9S A;  4O4G A;  1ASV A;  4LF4 K;  2W42 A;  3VF4 A;  3U6F A;  3ZSZ A;  2FSN A;  2NRX A;  1HMV A;  5FPN A;  1NGF A;  4CJQ A;  3K0S A;  4DV7 K;  3OYA A;  5M1O A;  1D5A A;  3MX2 A;  1R59 O;  4FWM A;  1C1B A;  4N56 A;  1SS6 A;  4IEI A;  3HOT A;  1YI2 N;  1QVG M;  1KC8 O;  2HBJ A;  3CFR A;  2P9U B;  1X9M A;  4CIF A;  1K8K A;  4ILG B;  1OH5 A;  4JNE A;  3AV9 A;  3F5T A;  3QDK A;  3ZX2 A;  1VQO N;  3O1B A;  4K25 A;  4QS9 A;  3MED A;  2VWB A;  5AQV A;  4EHT A;  3NF9 A;  1YT3 A;  4K41 A;  3TAM A;  1C0F A;  2UU9 K;  3SUP A;  3EN9 A;  4JN4 A;  4C8K A;  4KTW A;  2RKI A;  1S1X A;  4CZH A;  2D1K A;  3BEX A;  1BL3 A;  4CJR A;  3K59 A;  1YIT N;  2AJQ A;  3O4Q A;  3T1Y K;  1VSL A;  4IFY A;  5AZJ A;  2FLO A;  1TKD A;  1FJG K;  1T44 A;  4H0Y B;  5E84 A;  3VN5 A;  4LFC K;  4DR7 K;  4HHT A;  1N6Q A;  4CZM A;  1O1W A;  3KLF A;  5CE3 A;  3CCJ N;  3TR8 A;  3E66 A;  2P9I A;  4JKH A;  4B1Y B;  3KLI A;  3L2R A;  3QBX A;  4CF8 A;  4IEE A;  3HO1 A;  1D4X A;  3DMJ A;  5CYM A;  4H5N A;  1RT5 A;  1EX4 A;  1LAW A;  4BDZ A;  4HTL A;  3RSE B;  3K58 A;  1J9A A;  2CGL A;  1IKV A;  1C0T A;  4DS5 A;  2ZD1 A;  4IBN A;  3WNH A;  3LAM A;  2P9U A;  3KJV A;  2IIR A;  2YKM A;  5C2D A;  4WQ5 C;  2O4I A;  5AQL A;  3KVG A;  2Q31 A;  2FSJ A;  1T6D A;  1L3S A;  3O4N A;  2YJF A;  2DY4 A;  1GLD G;  4JKG B;  1KVA A;  4BRD A;  3H1Q A;  2IVP A;  4CEQ A;  3WNE A;  1ATS A;  3OTO K;  4DMN A;  3ZX0 A;  1FXX A;  4GW6 A;  4BWM A;  3ZT4 A;  4HUE A;  1X9W A;  4DUZ K;  2WTU A;  3OHR A;  3J7Z O;  3NF8 A;  4AHT A;  4LFA K;  4BE2 A;  4DTP A;  4H5W A;  3KWI A;  3WNF A;  1NWK A;  4BR0 A;  3OS1 A;  1BHL A;  3A5O C;  5AQJ A;  2YCH A;  2A41 A;  1EXQ A;  1ZBU A;  2XHB A;  3LZJ A;  2O8E B;  3PUF A;  4PKG A;  3HK2 A;  3ZEU B;  4BVP A;  5HBM A;  3C6A A;  4R5P A;  1QVF M;  2IOC A;  4PKI A;  1T6C A;  5DM7 L;  4A5B A;  4CZE A;  1IG9 A;  4FJL A;  1XHX A;  3MN5 A;  1T8E A;  3EEQ A;  3ZX3 A;  2KKZ A;  1JLA A;  2BUP A;  1NK5 A;  1IBK K;  4HWI A;  4DKW A;  2F8T A;  5GAG P;  1S1U A;  2XY5 A;  1DT9 A;  3U3Y A;  3TSP A;  1JJ2 M;  4RW8 A;  4JI3 K;  3I33 A;  4OGC A;  4M3T A;  3JXU A;  3SPY A;  3SK3 A;  3CD6 N;  1UWB A;  2G8F A;  4OPJ A;  2VWK A;  3HM8 A;  3C6T A;  4JKG A;  3RMD A;  3SBG A;  3IRX A;  3E01 A;  4LF7 K;  4CFA A;  3NH2 A;  3LP3 A;  3AO1 A;  4CE9 A;  1ESV A;  2FSK A;  2E2P A;  3AVL A;  4BRG A;  3I0R A;  1QSY A;  5I3U A;  5E41 A;  2ZJP L;  4EZ6 A;  1ZYQ A;  4N41 A;  1YJN N;  3OYH A;  1FW6 A;  4DV5 K;  4CEE A;  2D0P A;  3D2E B;  4BRC A;  3DLL L;  4JI8 K;  1VHX A;  3LP0 A;  3QFP A;  2XY7 A;  4JK9 A;  4I6M B;  4GVE A;  4CI6 A;  4C8M A;  1DTT A;  2O8E A;  3C65 A;  3ZEU A;  1L5U A;  2OYQ A;  1TL3 A;  1REV A;  2NNW A;  1Z25 A;  3HVT A;  4GKK K;  3AVM A;  4NYN A;  4Z4C A;  4GY2 B;  1T05 A;  4FW1 A;  3HVR A;  1EO1 A;  1JLC A;  2IGI A;  4KHN A;  5AQK A;  3NFA A;  4O5B A;  3KHY A;  2KZM A;  1C6V A;  1W97 L;  1ZBH A;  4O0J A;  2Q97 A;  2ZJQ L;  2FF3 B;  1TUY A;  3M5R A;  3BP8 A;  5HP1 A;  3OYD A;  4OVL A;  1NBW A;  4AHC A;  3DRS A;  3PIO L;  3OYF A;  3THX A;  4XH5 A;  3O3H A;  4I7F A;  4YNQ A;  3KK3 A;  5JMV A;  4GMJ B;  3B8A X;  1NJI O;  1WBB A;  2ETJ A;  4NCA A;  3A2F A;  2HHV A;  3DI6 A;  3TTC A;  3FR0 A;  1XNQ K;  3LAL A;  3D2E A;  4LY7 A;  1VQN N;  1U6Z A;  3D6R A;  5IT9 O;  1NGD A;  4CJW A;  3M8R A;  3ZYY X;  1BI4 B;  3J7Y P;  1ATR A;  3SI6 A;  1N5Y A;  2HOE A;  1EET A;  4BRP A;  1DGK N;  2OA8 A;  3THW B;  3V9X A;  4IJA A;  5EXW A;  4J2A A;  1J53 A;  5ADX A;  1U48 A;  1RFQ A;  1U2V B;  3IFR A;  3GG4 A;  3VA3 A;  1S1W A;  1VSH A;  1BO5 O;  4E1M A;  2IVN A;  4HTU A;  2VG5 A;  1BCO A;  3KK2 A;  4H5R A;  1IKX A;  1B9D A;  3F2K A;  1GLA G;  4IZ9 A;  1A5X A;  1VK0 A;  4IO8 A;  3TWH A;  3ENH A;  1UOC A; 
#chains in the Genus database with same CATH homology
 3EZ5 A;  4CHQ A;  1BIS A;  4G1Q A;  5EU7 A;  2KZZ A;  3M8S A;  3B6O A;  1IKY A;  2G8I A;  3VQE A;  3VQD A;  3JSM A;  4AIL C;  4CJT A;  4B9U A;  3LAN A;  5J2P A;  3LP1 A;  2EHG A;  3QNO A;  3QNN A;  4ZTF A;  2B5J A;  3SUO A;  3D45 A;  4JRQ A;  1ASU A;  4M3R A;  3O3G A;  4CGF A;  4DTX A;  1SKS A;  4E7L A;  3VQ7 A;  1UAX A;  3V1O A;  1LW0 A;  3VQ5 A;  2HMI A;  1WSI A;  1RBV A;  2YHA A;  3MEC A;  3C6U A;  1LV5 A;  3DM2 A;  2Y1I A;  1KFS A;  4M3Y A;  4C8N A;  1VSK A;  1NK8 A;  1JXE A;  4F8R A;  4KTQ A;  4O44 A;  1EKE A;  3P5J A;  4PY5 A;  3SZ2 A;  3NGZ A;  2YNI A;  3DRP A;  1BI4 A;  3ALY A;  1L3T A;  5FDL A;  4DQQ A;  3SJJ A;  2OPR A;  4N47 A;  4CER A;  4DTO A;  1KLN A;  4CHO A;  3OY9 A;  4H4O A;  5KGX A;  3QIN A;  1L3U A;  1WSJ A;  4BE0 A;  3M8Q A;  3OYE A;  3T19 A;  4DU3 A;  1GOA A;  1HNI A;  3KIO A;  4FYD A;  1FKO A;  4F3T A;  2DFH A;  4DSL A;  2P51 A;  3PO4 A;  3V9S A;  1Q9Y A;  3HXM A;  1JLF A;  1HYV A;  1YTU A;  4KHQ A;  3DLG A;  4DG1 A;  4TSX A;  3ZSO A;  1TAU A;  3NHG A;  3CQ8 A;  4ELV A;  4FJ9 A;  4J2D A;  3LP2 A;  1RT4 A;  1XC9 A;  5C24 A;  5KGW A;  4CEB A;  2G8U A;  1MU2 A;  2HNY A;  5C25 A;  3BDP A;  2F8S A;  3L3V A;  2O4G A;  4JRP A;  2ZE2 A;  3ZSQ A;  3K5O A;  5HRO A;  4FJN A;  3OYC A;  4DTJ A;  4K8Z A;  1NJZ A;  4DTM A;  1D8Y A;  3L2U A;  5CZ1 A;  2XY6 A;  1RDC A;  4CGJ A;  1HPZ A;  3HP6 A;  3MXM A;  2OZM A;  4F2S A;  4QCL A;  1J54 A;  2FBX A;  5K14 A;  2X78 A;  3ZT2 A;  4CK3 A;  3SV3 A;  2DTU A;  2R7Y A;  3HYF A;  4W5R A;  4CIG A;  1RNH A;  4CJV A;  4E7J A;  2IDO A;  4OJR A;  1NK0 A;  4F3O A;  4PWD A;  1CLQ A;  1RT2 A;  3F9K A;  1UA0 A;  3KKS A;  2P5O A;  2BE2 A;  3TI0 A;  4DS4 A;  3QER A;  3ITH A;  3KTQ A;  2Z1I A;  3G10 A;  2QKB A;  4EP4 A;  4CJF A;  3JYT A;  3TAB A;  2YNF A;  3KLG A;  2YKN A;  4M3X A;  4KB0 A;  4IFV A;  1BGX T;  1RBT A;  4CF2 A;  1QSS A;  1LWF A;  4CJS A;  1VSI A;  3OVN A;  2X6S A;  1K6Y A;  1W9H A;  2BDP A;  4F4K A;  2HHS A;  1NJW A;  3TAR A;  4FJ5 A;  3VQB A;  1BIU A;  4QAG A;  1U04 A;  3O3F A;  4CHN A;  4E7H A;  4FVM A;  4CGG A;  4KRF A;  3NF6 A;  1NOZ A;  3AVB A;  3PV8 A;  3AVN A;  1IH7 A;  4UQG A;  1TGO A;  3PO5 A;  3OYG A;  2XRI A;  3M8P A;  2IS3 A;  4BDP A;  4CJP A;  3TAF A;  2HHW A;  1CXU A;  1CXQ A;  2B6A A;  3PX6 A;  1D9F A;  3AVG A;  4FJX A;  4M3W A;  4CFB A;  2XY8 A;  2E6L A;  1WSE A;  2KQ2 A;  3QO9 A;  3OYJ A;  3SUN A;  4KPY A;  4FXD A;  4IDK A;  4DSJ A;  1GOB A;  1HNV A;  4DTR A;  5HLF A;  3L2Q A;  1NK6 A;  2OPP A;  4YFU A;  1SUQ A;  4H8K A;  4BE1 A;  4E0D A;  3HPO A;  4HUG A;  4FJG A;  4Z4G A;  3DOL A;  4XIU A;  1TK8 A;  3MXJ A;  5DK5 A;  4CF9 A;  4NCB A;  1VSF A;  3QEW A;  3TAN A;  1T03 A;  4ELU A;  3IAY A;  4NCG A;  3OYI A;  4LSL A;  2YHB A;  3NH1 A;  4DTN A;  1SL1 A;  3LWL A;  2PY5 A;  4Q5V A;  4W5T A;  2A1R A;  1QS4 A;  3DOK A;  4DQP A;  2HHX A;  2JLE A;  1QE1 A;  1SKR A;  4B08 A;  3ASM A;  5FRO A;  4FJM A;  3ZSY A;  2D0C A;  5HRN A;  2KFN A;  1X9S A;  2WOM A;  3OYM A;  2RF2 A;  3V6D A;  1HJR A;  3LZI A;  4DFP A;  4B9S A;  3V9W A;  4EP5 A;  1EP4 A;  1TAQ A;  3ZSR A;  4DFK A;  1RCH A;  1S6Q A;  4Z4H A;  5J1E A;  3DRR A;  4M42 A;  4Z4E A;  3AA4 A;  1WSH A;  4CHZ A;  1JXB A;  3SQ1 A;  4CJE A;  1F21 A;  5CY4 A;  2LSN A;  3VQ8 A;  1KCF A;  3HP9 A;  1C0U A;  4OKK A;  1ZBL A;  5I42 A;  1L3V A;  5KTQ A;  3TAP A;  2HND A;  1ZBI A;  4FK4 A;  4CEZ A;  3HL8 A;  1QSL A;  3NDK A;  4CEA A;  1TK0 A;  1D9D A;  1FKP A;  1HYZ A;  4AHS A;  4CK2 A;  4QOZ B;  3QEI A;  4FK0 A;  2FBV A;  4M41 A;  4IKF A;  2RN2 A;  5KRT A;  3MEG A;  3EY1 A;  1NK9 A;  5FRM A;  4LH4 A;  1JLQ A;  4IG3 A;  3WNG A;  2HW3 A;  1LW2 A;  3ZSW A;  4CGI A;  4O4G A;  1ASV A;  3AO2 A;  2W42 A;  3AVI A;  1A5V A;  2NUB A;  3F73 A;  2X6N A;  2G8W A;  4CJ5 A;  4ID1 A;  4AHV A;  2OZS A;  3VQ6 A;  3U6F A;  3ZSZ A;  3NAE A;  3P1G A;  4DSI A;  3HM9 A;  1HMV A;  1WNS A;  4KKO A;  3HPH A;  3KK1 A;  2HVI A;  4B8C A;  4CJQ A;  5HRR A;  3CM5 A;  1WSF A;  3OYA A;  1X1P A;  1D5A A;  3L3U A;  4CFD A;  3KKR A;  3DLK A;  3KLE A;  1C1B A;  3DLE A;  4N56 A;  5HRP A;  4J2E A;  2YNG A;  1RBR A;  1JL2 A;  3CFR A;  5JS2 A;  1X9M A;  4CIF A;  3LWM A;  4DQI A;  3H08 A;  2VG7 A;  1YVU A;  4DSK A;  2HB5 A;  4Y1D A;  3AV9 A;  5J2Q A;  3RRG A;  1XWL A;  2YNH A;  3AO4 A;  1TV6 A;  4DSF A;  3RRH A;  3V9Z A;  3MED A;  3SYZ A;  3RMC A;  1VSD A;  1YT3 A;  1IO2 A;  3NF9 A;  3BGR A;  4M45 A;  1WAF A;  1RBS A;  3TAM A;  2OPS A;  4RW9 A;  4CEC A;  4KHY A;  2HHT A;  3SQ4 A;  4FJ7 A;  3NCI A;  1JLE A;  4FCY A;  3SUP A;  4ELT A;  1A5W A;  4F2R A;  2ZQB A;  3ZT1 A;  3ZSX A;  4C8K A;  4KTW A;  1BQN A;  3OYK A;  3S3N A;  2RKI A;  1ASW A;  1S1X A;  3NF7 A;  4BWJ A;  3SQ0 A;  4CJR A;  1R0A A;  1BL3 A;  3K59 A;  3SNN A;  3K5L A;  3DYA A;  3V9U A;  1LWE A;  4MQ3 A;  3V1R A;  4Q0B A;  4MFB A;  2AJQ A;  2GUI A;  1NKB A;  3O4Q A;  1VSL A;  3AVF A;  4IFY A;  4CF0 A;  3CFP A;  1C1C A;  1NK4 A;  3RR7 A;  4DLE A;  1TKD A;  3RR8 A;  3VN5 A;  1RT7 A;  4C8L A;  2VG6 A;  1JLB A;  2D5R A;  1KRP A;  3PY8 A;  2KTQ A;  1RTI A;  3NGI A;  4HHT A;  2JGU A;  1N6Q A;  5HRS A;  1Q8I A;  1G15 A;  1O1W A;  3KLF A;  4PQU A;  3TR8 A;  3L2R A;  3ZT3 A;  3KLI A;  4KB1 A;  3TAG A;  3AA5 X;  1VSM A;  4CF8 A;  3HO1 A;  5CYM A;  3DMJ A;  2FBT A;  1RT5 A;  4NYF A;  1J5O A;  1EX4 A;  3QES A;  3QEV A;  1S9E A;  3RMA A;  4KAZ A;  3SPZ A;  3D0P A;  1LAW A;  4BDZ A;  3VQQ A;  3MXI A;  4RW6 A;  1J9A A;  3OS0 A;  3K58 A;  3KLH A;  1CZB A;  4CEF A;  1SL0 A;  4HCC A;  1VSE A;  3B6P A;  3AO3 A;  1RDB A;  4PUO A;  4OKJ A;  3LPT A;  4O55 A;  1T7P A;  3OJU A;  3MAQ A;  4DFJ A;  1IKV A;  3AVK A;  1NK7 A;  1GOC A;  1C0T A;  4EZ9 A;  2FBY A;  1ZBF A;  4DS5 A;  1SL2 A;  2ZD1 A;  5CZ2 A;  5J2M A;  4IBN A;  3NBP A;  3LAM A;  2QXF A;  3WNH A;  2F96 A;  3KJV A;  4CCH A;  1S1T A;  2YKM A;  1ITG A;  3QIP A;  4JLH A;  2O4I A;  4GVM A;  4FW2 A;  1HYS A;  2Z1G A;  3FFI A;  1L3S A;  3O4N A;  3P83 D;  2DY4 A;  1S5J A;  3OYL A;  1KVA A;  4KTZ A;  4DSE A;  3T3F A;  3AVH A;  4CED A;  4E19 A;  4E7I A;  4CEQ A;  4FM0 A;  3WNE A;  3QET A;  1SV5 A;  3SCX A;  2Z1J A;  4KHS A;  4FJI A;  3LPU A;  4DMN A;  1FXX A;  4GW6 A;  4BWM A;  3ZT4 A;  4HUE A;  4DLG A;  4FJK A;  5DMR A;  3V81 A;  1X9W A;  3VQC A;  2G8K A;  4Z4I A;  4CHP A;  4CF1 A;  4B8A B;  1KFD A;  4DF4 A;  3NF8 A;  3L2W A;  4O0I A;  3TAQ A;  1B92 A;  4AHT A;  1NKC A;  4FLY A;  4FZY A;  3VQA A;  3AVJ A;  4CJ3 A;  4BE2 A;  4KI4 A;  4DTP A;  1BQM A;  4FZZ A;  3S9H A;  5J2N A;  3WNF A;  3OS1 A;  2BAN A;  4I2Q A;  4KHW A;  1BHL A;  1Y97 A;  1RBU A;  2GBZ A;  3ZSV A;  3LDS A;  2EX3 A;  3U3G A;  1WAJ A;  4Z0U A;  4FLV A;  3T1A A;  1EXQ A;  1ZBU A;  2XHB A;  3LZJ A;  1U49 A;  2X74 A;  3PUF A;  4Z4F A;  3HK2 A;  1UA1 A;  2D0B A;  3DLR A;  3AO5 A;  5HBM A;  1WN7 A;  4R5P A;  4DQR A;  4HCB A;  4CK1 A;  5FRN A;  3QLH A;  4DU4 A;  1C0M A;  2IOC A;  3HJF A;  4FJL A;  3I8D A;  1S9G A;  1BCM A;  1S1V A;  1XHX A;  3THV A;  2Q3S A;  1IG9 A;  2G8H A;  3K57 A;  1T8E A;  2IC3 A;  5SWM A;  1JLA A;  2RPI A;  4FLZ A;  1NK5 A;  1QQC A;  1LWC A;  5T7B A;  1NKE A;  4N5S A;  4ZHR A;  2F8T A;  1S1U A;  3HPG A;  3VQ4 A;  1TVR A;  3K5M A;  2XY5 A;  3U3Y A;  1BIZ A;  1FK9 A;  4RW8 A;  4OLB A;  4OGC A;  5SZT A;  4DQS A;  4M3T A;  4M3U A;  3OYB A;  3SPY A;  3S3O A;  4OGE A;  3KD5 E;  4KHU A;  1UWB A;  4W5Q A;  1KVC A;  1I39 A;  2G8F A;  2DFE A;  2VWK A;  3CM6 A;  3C6T A;  3VQP A;  4CGD A;  4CJK A;  3ZCM A;  4OPJ A;  3RMD A;  3KD1 E;  3IRX A;  3E01 A;  1NOY A;  4CFA A;  3NH2 A;  3LP3 A;  3AO1 A;  4CE9 A;  1JL1 A;  3SQ2 A;  2HNZ A;  1YTA A;  1HRH A;  4AHU A;  3AVL A;  1DTQ A;  3I0R A;  4JS5 A;  1U47 A;  1QSY A;  1S6P A;  1RT3 A;  5I3U A;  4K8X A;  3NGY A;  5E41 A;  1TL1 A;  4FM1 A;  4KI6 A;  4E1N A;  1XHZ A;  2HHU A;  4EZ6 A;  2ATQ A;  4LSN A;  1ZYQ A;  4LD0 A;  4RW4 A;  4CIE A;  4N41 A;  1B9F A;  4BDY A;  3LAK A;  4I9Q A;  3OYH A;  3PX4 A;  5KRS A;  4CEE A;  4DU1 A;  4E7K A;  4ID5 A;  4CJ4 A;  2IAJ A;  2PYJ A;  1QTM A;  4C8O A;  2GV9 A;  3LP0 A;  4DF8 A;  2XY7 A;  2P5G A;  1RIL A;  3L8B A;  2KW4 A;  1JLG A;  4OLA A;  4C8M A;  3OS2 A;  4DWI A;  5JS1 A;  1DTT A;  2HVH A;  2PYL A;  4B9L A;  3C95 A;  3OYN A;  3V4I A;  4FJJ A;  4M3Z A;  4KFB A;  1L5U A;  2OYQ A;  1TL3 A;  4FM2 A;  5C42 A;  1REV A;  4L8R B;  1RTH A;  1Z25 A;  3HVT A;  4B9T A;  1XI1 A;  2QKK A;  2FC0 A;  3AA2 A;  4FLW A;  4B9V A;  1KTQ A;  3AVM A;  4NYN A;  4Z4C A;  1U45 A;  4W5O A;  2BGG A;  4B9N A;  3PX0 A;  3DLB A;  1WSG A;  4W5N A;  1T05 A;  3K2P A;  4FW1 A;  3ZT0 A;  3HVR A;  4KV8 A;  1JLC A;  1VRT A;  1RDA A;  2IGI A;  3CYM A;  4DFM A;  4KHN A;  1C1A A;  2E6M A;  2Y1J A;  3NFA A;  4O5B A;  3CFO A;  4HUF A;  3S3M A;  2KZM A;  1VRU A;  1C6V A;  1RT6 A;  3K5N A;  1KSP A;  1ZBH A;  2E4L A;  4O0J A;  4WE1 A;  3QIO A;  5D3G A;  4AHR A;  1U4B A;  4CHY A;  1RTD A;  3HST B;  4H4M A;  4FJH A;  4B3O A;  4FK2 A;  1TK5 A;  2OPQ A;  2B4J A;  5HP1 A;  4FJ8 A;  4OPK A;  3HT3 A;  3OYD A;  1Q9X A;  4OVL A;  3I0S A;  4AHC A;  3DRS A;  1RT1 A;  4FLU A;  1NJX A;  3OYF A;  3O3H A;  4I7F A;  4YNQ A;  4DTS A;  2DFF A;  4AH9 A;  4KRE A;  4CJU A;  3C94 A;  1IKW A;  1W0H A;  2D0A A;  3VA0 A;  2KFZ A;  3KK3 A;  4GMJ B;  3TAE A;  1QHT A;  3AVA A;  3NH0 A;  2ETJ A;  4HVJ A;  4NCA A;  4IG0 A;  1WLJ A;  3A2F A;  3ULD A;  2HHV A;  2I5J A;  3QEX A;  3QEP A;  3DI6 A;  3ISN C;  4CGH A;  4KO0 A;  1TKX A;  3LAL A;  4LY7 A;  4Y1C A;  4CJL A;  2HHQ A;  4ZTJ A;  1NJY A;  1CZ9 A;  4E89 A;  4CJW A;  2G8V A;  3M8R A;  4B9M A;  1BI4 B;  4N76 A;  1VSJ A;  1TKT A;  3MEE A;  3AVC A;  3IG1 A;  3SI6 A;  1N5Y A;  3V1Q A;  4FZX C;  3NE6 A;  1RTJ A;  1EET A;  1KVB A;  4OKE A;  3CG7 A;  4RW7 A;  1SKW A;  2OA8 A;  3V9X A;  1LAV A;  1I3A A;  2P1J A;  1TKZ A;  4BAC A;  3RTV A;  2QK9 A;  1DLO A;  4PA1 A;  4J2A A;  1J53 A;  1HQU A;  3DLH A;  1U48 A;  4I9L A;  3UIQ A;  3SUQ A;  4LH5 A;  3VQ9 A;  2XO7 A;  2YV0 X;  4CEO A;  3VA3 A;  1KLM A;  4DTU A;  2ITG A;  1S1W A;  2VWJ A;  1VSH A;  4CFC A;  1JKH A;  3G0Z A;  4ICL A;  4E1M A;  3AA3 A;  1RDD A;  4I2P A;  1HQE A;  2PZS A;  3IS9 A;  3RWU A;  4HTU A;  3SV4 A;  1Z26 A;  3RMB A;  2VG5 A;  5KI6 A;  5CYQ A;  1BCO A;  3KK2 A;  2WON A;  1IKX A;  4FLT A;  3L2V A;  3EYZ A;  1B9D A;  3TWH A;  1A5X A;  4J2B A;  4E3S A;  1VK0 A;  4JS4 A;  4FLX A;  4CES A;  4RG8 A;  2A1S A;  3OJS A;  2Z1H A;  1UOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...