2G8WA

B. halodurans rnase h catalytic domain e188a mutant in complex with ca2+ and rna/dna hybrid
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
b'KEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGAIKADY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 39
structure length 134
sequence length 134
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8wA00
3L2QA 1LW2A 3AV9A 3V9XA 3S3MA 4DTXA 5KRSA 1EX4A 1GOCA 1ASWA 4RW9A 4CGJA 3AO2A 3AVHA 3C6UA 3LP3A 3ZSZA 4YNQA 4FLXA 3TI0A 2YNIA 3RR7A 3VQQA 4DWIA 3DM2A 3AVAA 2ZQBA 4O44A 1BQNA 4CFCA 3NF6A 4E7LA 4O0JA 2HB5A 3EY1A 5FDLA 2F96A 3AO5A 4W5TA 1TKDA 1HYZA 4L8RB 1J53A 1REVA 3DLBA 1FKPA 4I2PA 3PX6A 4DQIA 1BGXT 3TAGA 4LH4A 1RDAA 3VQ6A 1NK8A 3L2UA 4AHRA 4M41A 2KTQA 1RBVA 4CF0A 3SQ0A 2HHXA 3V9SA 3ZT1A 1T03A 4JRPA 1RBUA 4KFBA 3LP1A 4Z4GA 3NF9A 3ZSWA 4C8KA 4LD0A 4FZXC 1S6PA 3IS9A 4CFDA 4DTUA 3E01A 1QQCA 1VSJA 1A5VA 1IKVA 1VSMA 1XHXA 1IG9A 4KHSA 2G8UA 2X78A 4FLUA 1NJYA 3JYTA 3IAYA 2FBTA 4FZZA 4G1QA 4KO0A 1RTIA 3SPYA 3M8RA 2KZZA 2AJQA 2HNDA 1Q9YA 1YTAA 1RT3A 1Z25A 2OPQA 3OVNA 4BE2A 4HUFA 4FM2A 3NFAA 4E89A 2PYLA 1R0AA 2GUIA 4FJIA 3F9KA 4YFUA 1S1XA 3HM9A 4Z4EA 1VSFA 3P83D 1N5YA 1RBSA 3KLHA 3K57A 4DU3A 3BGRA 3OYMA 3KK3A 3NH0A 3RMDA 1U49A 4AHTA 3SUOA 2FBVA 4DSLA 4RW4A 4HHTA 2HW3A 2RKIA 3U3GA 1RTJA 4Y1DA 4CK2A 4DFPA 4FJ7A 3M8PA 1SL2A 3DRPA 4CEDA 3T1AA 1BI4B 4FM1A 4ICLA 3DLEA 4CJFA 4HTUA 5J2MA 1WSGA 5HRSA 4FM0A 3VQEA 4CF8A 4E7JA 3LPTA 3SPZA 2P5OA 2G8WA 4OJRA 1WAFA 1RT2A 3RR8A 4DG1A 3SNNA 4FLWA 1TK5A 2HVIA 3SV4A 1SV5A 4FJHA 4DU1A 1IH7A 4DSEA 2D0BA 2B4JA 1CXUA 3ZCMA 1TK0A 1KVAA 4ZTJA 1RNHA 1VSLA 2P51A 4H4MA 1WNSA 3LAKA 1KTQA 3QLHA 4AHSA 4CHOA 3DRSA 4KRFA 4E1NA 5FROA 2W42A 4J2BA 2QKKA 3NF7A 3O3GA 4DTSA 4KTWA 5EU7A 3EZ5A 3DLHA 2PYJA 4KKOA 1BIUA 3ZSVA 4CHPA 1TL3A 2F8SA 4CJ3A 4CHQA 2D0CA 4MQ3A 3RWUA 1D5AA 4QAGA 2BGGA 4FW1A 3OY9A 5CZ2A 1LWCA 3VQPA 4W5OA 1MU2A 4DFMA 4EP4A 4N56A 3KKRA 4CGFA 4LSNA 4ELVA 4W5RA 1NJXA 1A5WA 4OVLA 4WE1A 4OKEA 1NKEA 4PUOA 3SUPA 1WLJA 3DLGA 3L2WA 1TAUA 3PO5A 4FJLA 1HMVA 1C1AA 4DQSA 1BQMA 4DTOA 1T8EA 3K2PA 5J2QA 2G8KA 1HPZA 1L3TA 4RW8A 1C0UA 1YVUA 2WONA 3KD5E 1SKWA 1U4BA 5CY4A 4CK1A 2P5GA 3ZT4A 3HO1A 4GW6A 3V4IA 3ASMA 4DQPA 4KHQA 2X74A 3AO4A 4NYNA 3ZSRA 4AH9A 2YKMA 5KRTA 4FJGA 4CJQA 2LSNA 3HSTB 1S6QA 3VQBA 3SQ4A 5HP1A 1T7PA 4FJXA 4ELTA 2FBXA 4KB1A 1D9DA 4IDKA 4CJWA 3K5LA 1ZBIA 4PY5A 3LWMA 1XI1A 3LP0A 4I2QA 3QESA 4KAZA 3LWLA 4CEFA 4LY7A 3HK2A 3LAMA 1EKEA 1RT1A 3CYMA 3O3HA 3KK2A 1SL0A 4OLBA 1RT4A 3RMBA 2IS3A 3IG1A 4BWMA 2R7YA 3I0RA 3T19A 1JLEA 1DLOA 1I39A 1IKWA 4CIGA 5D3GA 3LPUA 1NK7A 3ZSQA 1LWFA 1LW0A 4UQGA 2XO7A 1X9SA 1TGOA 4BWJA 3AVFA 5I42A 1UA0A 4W5NA 3VQCA 2YKNA 1EXQA 2QK9A 2FBYA 3TAEA 4F3OA 4KTQA 3OYEA 3B6OA 3HXMA 4J2EA 4Q0BA 4ID1A 3CFRA 3ULDA 4ZHRA 3AA4A 2OYQA 4DQQA 1RTHA 2XY8A 1NKCA 4IFVA 5KI6A 3DLKA 3KLFA 1LWEA 2E6LA 3NGZA 3LZIA 5HBMA 5SZTA 3QEVA 2B6AA 3MECA 3O4NA 2P1JA 2HHSA 2DY4A 1VK0A 1J9AA 4O4GA 3NH1A 3NF8A 3OYIA 3AVMA 1VSKA 4HCCA 1K6YA 4I7FA 4CESA 4OKJA 3SJJA 3AVKA 1YTUA 2DFHA 4FK4A 2PY5A 3LALA 4J2AA 1NJWA 3VA0A 4FZYA 1FK9A 1QTMA 4E7KA 5C42A 5KGWA 1KLNA 1QE1A 2XHBA 1TAQA 3NBPA 3CG7A 3NDKA 4B9VA 1S9GA 4ELUA 4Y1CA 5HLFA 3KLIA 3OYHA 3HP9A 4JS5A 1S1WA 4OGCA 1W9HA 1IKXA 4KTZA 2YNFA 5J2PA 4KPYA 3QEPA 4Z4FA 1J54A 4CJKA 3OJSA 1NJZA 4B9NA 4BDZA 3LZJA 4B9MA 2DFEA 4CJTA 1RT7A 4ID5A 3AVBA 4CJEA 4QCLA 1VSDA 3BDPA 3JSMA 4K8ZA 4KREA 3PY8A 4NYFA 1WN7A 2EHGA 1KVCA 2VG5A 2YNHA 2FC0A 4CEOA 4DFJA 4E3SA 3DMJA 4CIEA 1VRTA 2O4IA 4OPKA 1JL2A 2XY5A 1U04A 2D0AA 3VQ5A 3HPGA 3P1GA 4M3RA 1RTDA 4CK3A 2A1SA 1X1PA 2IDOA 1ZBUA 4LSLA 4DF8A 1D8YA 1BISA 3ALYA 4DSIA 2XY6A 4EZ9A 4CGHA 4DF4A 3S3NA 1HYVA 1TVRA 2JLEA 5K14A 4FXDA 3SQ2A 2OPSA 3O3FA 4BDPA 3QEWA 2OA8A 3AVNA 1C1CA 2IGIA 3ZSXA 4MFBA 4KHYA 1Z26A 4JRQA 4FLYA 3AA3A 4DMNA 4I9QA 1U47A 3B6PA 5T7BA 1RT6A 3VQ7A 4EZ6A 3SZ2A 4CJSA 5C25A 4CJRA 4FVMA 1CZ9A 4GVMA 2BANA 3ZT3A 3QETA 1HNIA 3TABA 1TK8A 4B08A 1RCHA 3K5NA 3KD1E 3V6DA 1WSHA 3DLRA 3V1QA 3DOLA 4HVJA 3V9WA 2Z1HA 1RBTA 2VG7A 4M3YA 4CJVA 3NH2A 4ZTFA 3V9UA 3KLEA 4JLHA 4FLVA 1DTTA 4DSKA 3I0SA 4IKFA 1C1BA 2VWJA 4DTJA 1L5UA 4FJKA 4DU4A 1S1UA 1SUQA 3PX0A 3LDSA 4HUEA 4CF2A 1NKBA 4FK2A 3G0ZA 1IKYA 3K59A 3AO3A 3HYFA 5FRNA 3O4QA 5JS2A 3OYFA 3QEXA 1QS4A 3SUQA 3S9HA 4DTRA 4KI6A 3D0PA 2G8VA 1BI4A 3MEEA 1HQEA 4RW6A 4Z4IA 3C95A 4F2RA 3OYJA 2ZD1A 4EP5A 3HJFA 1U45A 4DTMA 4NCGA 4DFKA 1JXBA 3OYDA 1WSJA 1JLGA 3KTQA 3AO1A 4DS5A 3HVRA 1BL3A 3OYBA 4N47A 4O0IA 4M3UA 1KFSA 2HNYA 3NCIA 3WNGA 4CEAA 1QSYA 3RMCA 4C8NA 3ZSOA 2HMIA 3V81A 3NHGA 2YV0X 4CGGA 3SCXA 1HRHA 2Q3SA 1B9DA 5CZ1A 4M3ZA 4XIUA 1XWLA 4E0DA 4J2DA 2YHAA 1BIZA 2OPPA 4KV8A 1SKRA 4Z4CA 1UWBA 4F8RA 4FJJA 2XRIA 5JS1A 3MEGA 3QO9A 1FXXA 1RBRA 1TL1A 3OS1A 1S9EA 1D9FA 2O4GA 3DRRA 4HCBA 4QOZB 4PA1A 3K5OA 1N6QA 1RDDA 2NUBA 3PUFA 1ASVA 4AILC 1C6VA 3HVTA 1C0TA 3HL8A 1UA1A 3MEDA 4KHNA 3H08A 3LANA 2HHTA 3L8BA 1W0HA 1HYSA 4CJLA 1JLFA 3DYAA 1FKOA 1WAJA 3K58A 1NK0A 4I9LA 2Y1IA 5HROA 3QINA 1TKZA 3HPHA 3NE6A 1ZBLA 4CEQA 1NOYA 2OZSA 1TV6A 2Y1JA 4AHCA 5DK5A 5HRRA 4B8AB 1U48A 3CFOA 3V1RA 5CYQA 2WOMA 4RW7A 2HNZA 1NK5A 4IFYA 2RF2A 3M8QA 1NOZA 2BE2A 1ZBHA 3OYGA 3KLGA 4FJ5A 4TSXA 2ZE2A 3CFPA 3I8DA 3V9ZA 3QNOA 2GBZA 2YHBA 2Z1GA 1WSEA 4DLGA 3QERA 4KHWA 3C6TA 1QHTA 1VSIA 2OPRA 3P5JA 4LH5A 1KRPA 4C8OA 4M3XA 1S5JA 3TAPA 1J5OA 1NK9A 5SWMA 4DTNA 4N41A 3CQ8A 4NCBA 3VN5A 4CE9A 1QSLA 4E7HA 4GMJB 3AA5X 4CERA 3TAFA 4B9SA 1ASUA 4CHYA 1T05A 4IG3A 4KI4A 5CYMA 1CZBA 1B9FA 4H8KA 2BDPA 3PO4A 3NAEA 1IO2A 1JLCA 4BE1A 2QXFA 4DTPA 1Q9XA 4Z4HA 4M3WA 2HHUA 3L3VA 1S1TA 3PX4A 1QSSA 2VWKA 4CEBA 4CJPA 3L2RA 2I5JA 3NGIA 4CGDA 4FLZA 3SQ1A 4NCAA 3AVGA 4PQUA 4R5PA 3ZT2A 1B92A 1DTQA 3DOKA 4OPJA 2E6MA 2A1RA 3C94A 3VQ8A 3OS2A 4KHUA 4IBNA 3NGYA 4AHUA 3MXMA 1L3SA 4B9UA 2F8TA 1HJRA 5KGXA 3OYKA 2QKBA 2HHWA 4K8XA 1C0MA 4CJ5A 4B9TA 3KK1A 2IOCA 1A5XA 3OJUA 1KVBA 4W5QA 4FJ9A 3TAQA 3WNHA 3HP6A 1LAWA 2KZMA 2JGUA 1KFDA 3VQ4A 3VQDA 4CHZA 4CJ4A 4AHVA 3TARA 2Z1IA 1L3UA 1JLBA 3KKSA 4BE0A 1RDBA 2IC3A 4CJUA 3HPOA 4HUGA 1XHZA 1UAXA 3IRXA 3MAQA 1KCFA 3U3YA 3LP2A 1NK4A 4KB0A 1GOBA 1YT3A 5C24A 3KJVA 5HRNA 3WNEA 4F3TA 1O1WA 3AVLA 1EP4A 1GOAA 4FCYA 1RDCA 4Z0UA 4CHNA 4DLEA 4E7IA 2G8IA 4O55A 4JS4A 4C8LA 1X9MA 3CM5A 3QEIA 1JLAA 1KSPA 3A2FA 4CEEA 1NK6A 3T3FA 3EYZA 1ITGA 1BCMA 2G8FA 3G10A 3SYZA 3OYCA 4OKKA 4CF9A 1BCOA 3K5MA 1HQUA 2E4LA 1ZYQA 1BHLA 3AVIA 4FYDA 3U6FA 1UOCA 5FRMA 4CGIA 1SKSA 2G8HA 4CIFA 3ZT0A 3ITHA 1VSHA 2ITGA 4DQRA 4IG0A 3THVA 1VSEA 2KW4A 3CM6A 4CEZA 4BACA 3QNNA 4F4KA 1Y97A 1JXEA 4DSJA 4FJ8A 3AA2A 2HHQA 3ZSYA 3L3UA 3MXJA 3F73A 4BDYA 3VQ9A 2YNGA 4F2SA 2KFZA 3OS0A 1I3AA 1CLQA 4FJNA 4CCHA 3ISNC 4FLTA 1Q8IA 2XY7A 4N5SA 4FJMA 2KQ2A 3FFIA 2IAJA 2VG6A 5DMRA 4C8MA 1TKXA 3WNFA 3M8SA 3TAMA 3RTVA 1RILA 3MXIA 5J1EA 1VRUA 1WSIA 1ZBFA 2RPIA 1XC9A 4E19A 2HHVA 1JLQA 1LAVA 3OYLA 2OZMA 3TR8A 3KIOA 2KFNA 4CFAA 2RN2A 4DSFA 1L3VA 3RRHA 2GV9A 4PWDA 2D5RA 1S1VA 2DFFA 1EETA 2Z1JA 5I3UA 2ATQA 3QIOA 3AVJA 1F21A 1CXQA 4DS4A 3SI6A 2EX3A 3SV3A 1JKHA 1WSFA 3V1OA 4E1MA 1LV5A 2PZSA 4N76A 3TANA 4OLAA 3QIPA 2DTUA 1SL1A 4CF1A 4H4OA 3D45A 4CECA 3PV8A 3OYAA 3OYNA 3L2VA 4CFBA 4FK0A 4M3TA 5J2NA 4RG8A 3DI6A 3VA3A 1JL1A 1X9WA 5HRPA 3AVCA 4M42A 1G15A 2X6SA 2ETJA 4B9LA 1KLMA 4B8CA 2X6NA 4O5BA 3HT3A 4OGEA 3VQAA 3SUNA 1RT5A 4M45A 2B5JA 3UIQA 3S3OA 3TWHA 5KTQA 1HNVA 3RMAA 4FW2A 3RRGA 5E41A 2HVHA 4B3OA 1TKTA 4Q5VA
chains in the Genus database with same CATH superfamily
3OBWA 2O8CB 4DTXA 1EX4A 1GOCA 3VGLA 3AO2A 3AVHA 3LP3A 3VQQA 3W3DA 3AVAA 2ZQBA 1BQNA 4JD2A 1GLLO 5ELZA 2HB5A 3EY1A 4W5TA 1TKDA 1BGXT 4KH4A 5LJWA 1NK8A 2KTQA 3D7EO 2O8DB 4FWNA 1RBUA 3BEXA 3M3ZA 4DUZK 4Z4GA 1VQNN 1S6PA 3IMXA 4JKHA 4CFDA 3E01A 2F4VK 1VSJA 1IKVA 2W40A 4KHSA 5JLFA 2X78A 2P9PA 2FBTA 4FZZA 4DR5K 4JHDA 3M8RA 2KZZA 1RT3A 4HUFA 2QTDA 4DB3A 2PYLA 3QFPA 4JI5K 4NO7A 3VETA 3F9KA 4Z4EA 2NRHA 3P83D 3Q7BA 3UB5A 3NH0A 5GAEP 1RTJA 2Q36A 4YORA 4DFPA 2YJEA 3DLEA 3ATUA 1WSGA 4RWTA 2HBMA 4BGBA 4A62A 4CF8A 3CIPA 2P5OA 2G8WA 5HOOA 3BZKA 4FWQA 4FJHA 4DSEA 1CXUA 3CCQN 3IUCA 1VSLA 4CHOA 2P9IB 5FROA 4J2BA 2QKKA 4GV9A 5F2RA 3EZ5A 4X66K 4CHQA 4GV3A 3MN6A 2P9LB 1LWCA 1MU2A 4JKFA 3EEQA 3KKRA 1NJXA 4OVLA 4PUOA 4OKEA 2ASMA 3L2WA 3SUPA 3FZLA 3U9ZA 3PO5A 1HMVA 4DTOA 5J2QA 4BQLA 1HPZA 3KD5E 4FWMA 3ZX3A 1G99A 1Y64A 1X3NA 1HKBA 4FJGA 4CJQA 4OPAA 2QXLA 1S6QA 3SBTA 3VQBA 4ELTA 1D9DA 1ZBIA 3H1QA 3LWMA 4DR1K 5AZJB 4WFNL 4LY7A 3QICA 1EKEA 2O8BB 4EHTA 1FJGK 3VGMA 3CPEA 1JCEA 4PKIA 3T19A 5GINA 1NK7A 1LWFA 2XO7A 4H5NA 4BWJA 1UA0A 4W5NA 2YKNA 1EXQA 2P9LA 4F3OA 4KTQA 1LOTB 3HTVA 3QDKA 1XMOK 3MX5A 5FPNA 2OYQA 2FLOA 3WEEA 2CGLA 2OTJN 1YUWA 2HHSA 4JKBA 3NF8A 4HCCA 3G6EN 1YTUA 2DFHA 2GUPA 2QWQA 3MCAB 1NJWA 3VTHA 1QTMA 5AQOA 5C42A 1KLNA 1QE1A 3CG7A 3NDKA 4ELUA 2GX9A 4Y1CA 3KLIA 3OYHA 1SZ2A 3CCJN 1HNWK 3DXMA 4NXMK 3J7AP 3J81O 1TYQA 5J2PA 4KPYA 1ILYA 4BVOA 5AZJA 3D2EB 3WXKA 3MX2A 5CE3A 3OW2M 3CHWA 3CC2N 3CC4N 1ZC6A 3HSCA 1LCUA 4CEOA 2IVOA 1VRTA 4LF5K 4CI6A 1RTDA 5BPMA 2IDOA 1D8YA 3P4IA 2V7ZA 4CD3A 4CGHA 1P8ZA 3S3NA 5AFUA 5BR8K 3O3FA 2OA8A 3AVNA 3KVGA 2P9SB 3A5NC 2AA4A 2D0OA 4JRQA 4A2AA 3AA3A 3W0LA 4I9QA 2WC9A 3KK7A 3TTCA 4CJSA 4CJRA 1CZ9A 1QVFM 5AQNA 1HNIA 3TABA 4B08A 3V1QA 3MWPA 1RBTA 4K43A 3NH2A 4ZTFA 1Z6RA 5LJVA 3CXCM 1EO1A 2UUCK 2VWJA 4FJKA 1QQNA 3VEZA 2E1ZA 4FK2A 4JN4A 4K42A 3SUQA 4DTRA 2G8VA 3QMLA 4DV2K 3F9MA 2FSJA 3R3LA 4ILJA 4EP5A 1BA0A 2EWSA 4K25A 3OYDA 5AR0A 3I8BA 3KTQA 4H0OA 4DS5A 3SJHA 2P9SA 3OYBA 1ATNA 4JKGA 2P9UA 4C8NA 1HLUA 3ID8A 3UKRB 2VGNA 3SCXA 2Q3SA 4M3ZA 4XIUA 2Q0UA 4E0DA 1BIZA 3EL2A 2OPPA 5KPRA 4Z4CA 1ATRA 4FSVA 1D9FA 1TL1A 4QCLA 3WXIA 1N6QA 1RDDA 4K0KK 3J8AA 4AILC 1C6VA 1UA1A 4BR9A 3SAHA 4QS9A 2E2OA 4B1XB 3K58A 4GVEA 2HSTA 1NK0A 4I9LA 2VQEK 4LF4K 4IO9L 4CEQA 3CCRN 2Y1JA 5HRRA 4CBUA 5CYQA 2WOMA 3UKUB 5LL6Z 4G9ZA 3OYGA 5KPZA 4DLGA 3QERA 4FWOA 1VSIA 4C8OA 1OVYA 2A6AA 4YOWA 4GMJB 3TAFA 4CHYA 1T05A 1B9FA 3M6GA 3PO4A 1JLCA 4X64K 2ZF5O 4BE1A 1Q9XA 2W41A 3O08A 3VEXA 1NBWA 4UY8O 5AQSA 4CEBA 1VQPN 3L2RA 3ZETA 4BROA 2GTDA 5AQXA 1S72N 3VQ8A 3MXMA 2F8TA 2FSNA 4NB4A 5FLXO 2V52B 1KVBA 3TAQA 3K9JA 1LAWA 2KZMA 1XC3A 1KFDA 3VQ4A 3VQDA 4CJ4A 4AHVA 3KKSA 3WXMB 1RDBA 4CJUA 3UKUA 2KLAA 1UAXA 4CZFA 4WF9L 3LP2A 1GOBA 3G71N 1YT3A 3KJVA 4C23A 3WNEA 4F3TA 1EP4A 1RDCA 3O8MA 4YOUA 5AQMA 1YJNN 4JS4A 3QEIA 3CJ7A 2ZWHA 2HF4A 2P9NA 3PSFA 3G10A 3OYCA 4CF9A 3AVIA 3ENOA 2ZJPL 3U6FA 5CHIA 1SKSA 3N4PA 2G8HA 2F7TA 4Z94A 4WQ4C 2ITGA 3G4SN 3FZMA 1VSEA 3WUHA 3DXKA 1QHAA 3OA9A 1NJIO 4F2SA 2KFZA 1I3AA 4CCHA 3ISNC 5BR9A 1Q8IA 1VQ5N 2ITMA 4FJMA 4C8MA 4OPHA 5DMRA 1TKXA 3MXIA 3MN9A 3TAMA 1KD1O 4C1NK 1WSIA 4CZLA 2RPIA 3VEOA 1XC9A 3FZKA 2OZMA 3WXLA 4CFAA 5AFUH 4DSFA 4PWDA 1EETA 2JWLA 4DV1K 4H0XB 3AVJA 1KQSM 3MK6A 4DS4A 4CJ7A 3QIPA 3CF5L 3PV8A 3OYNA 3L2VA 4FK0A 1RFQA 3DI6A 3HOSA 3AVCA 4FO0A 3BUZB 3P39A 2V7YA 2ETJA 5IWAK 4B9LA 2X6NA 1QQOA 3A8YA 4OGEA 3VQAA 3HT3A 1RT5A 2NRZA 3RMAA 3ID6A 4FW2A 5AQRA 2FSKA 5F0XA 3CJ1A 3GG4A 3S3MA 1NGJA 4KBOA 4FPBA 5KRSA 3BY5A 1ASWA 4EIAA 4CGJA 3ZSZA 3TI0A 4DWIA 2YNIA 1EQYA 3DM2A 4PL8A 4EAHD 1SQKA 4E7LA 3NF6A 1Q81O 3AO5A 4XH5A 4L8RB 1HYZA 3CQXA 4BRMA 3PX6A 4DQIA 3O9UA 2O8FB 5FPDA 1RBVA 3SQ0A 2AP1A 2E2QA 4JRPA 3R1XA 4BGAA 3NF9A 3THXB 4BC2A 4FZXC 3IS9A 4AM6A 4DTUA 4WQ4A 4B1ZA 2IIRA 2CGJA 3TSPA 4FLUA 1NJYA 3G25A 4M63C 4G1QA 1VQ7N 4YHHK 1ESVA 3OVNA 2OPQA 3LM9A 2E2PA 1NWKA 3O9SA 4FJIA 1JCGA 3FR0A 4YFUA 4DR4K 4DU3A 3WT0A 3OYMA 1U49A 3SUOA 2HW3A 2KHOA 3JXUA 1VQMN 3U3GA 4CEDA 3QBWA 4K41A 3T1AA 4FM1A 5LY3A 3SLCA 5J2MA 3H45C 5HRSA 3O9RA 1KAXA 3VQEA 1WBBA 2YCHA 1WAFA 4DV3K 4DG1A 4FLWA 1TK5A 3GOIA 1SV5A 4DU1A 1TK0A 2O8FA 1KVAA 4JI2K 1RNHA 4H4MA 2ZJRL 4FL9A 2D0PA 1WBDA 3NF7A 4DTSA 4KKOA 4KH6A 1U6ZA 2D0CA 3RVCA 3RWUA 1D5AA 4ILGB 4QAGA 3SMPA 3S41A 4FW1A 5CZ2A 3VQPA 4W5OA 4N56A 2UUBK 1IBMK 4ELVA 3CJCA 1A5WA 4WE1A 1NKEA 2JWKA 1WLJA 3DLGA 4DR3K 4FJLA 5AQLA 4DQSA 4RTFD 3VERA 4RW8A 1C0UA 1YVUA 5EVZA 4FOEA 1U4BA 1WB9A 2P5GA 1NGEA 3ZT4A 4YOVA 4MLEA 3HO1A 3V4IA 1NGGA 2X74A 3CCSN 1QZ5A 2LSNA 4FPAA 1T7PA 3VENA 2UUAK 2FBXA 3K5LA 3QESA 4KAZA 3HK2A 5EX5A 3LAMA 2BUPA 3O3HA 5AQIA 1RT4A 4BWMA 3I0RA 1RGIA 1IKWA 4JI6K 3ZSQA 4HWIA 1LW0A 1VQ4N 2QK9A 3OYEA 1BA1A 2QW9A 3P31A 3ULDA 1NKCA 4IFVA 3ZX2A 3NGZA 3O4NA 4MLHA 2P1JA 3L4QA 3OYIA 3WXJA 4I7FA 4OKJA 2W6LA 5JVGL 3AVKA 4FK4A 1J6ZA 4BRDA 4J2AA 3VA0A 4E7KA 1TAQA 4E1JA 3NBPA 4B9VA 1S9GA 4H5RA 5HLFA 3HP9A 4I6MB 4JS5A 1MWKA 4OGCA 3R6MA 1IV0A 4Z4FA 1N8RO 4CJKA 3OJSA 4BDZA 3LZJA 4GKKK 3I33A 4FWPA 1RT7A 4ID5A 1BOTO 5BRHA 4K8ZA 3JSMA 4KREA 5BPNA 2UXBK 1WN7A 2EHGA 1N34K 3EZWA 4B9QA 3JAMO 2O8CA 4M3RA 1X1PA 4LSLA 3C6HA 4DSIA 3P38A 3C6AA 1TVRA 5K14A 4YDUC 2YJFA 3C7NB 3SQ2A 3PIPL 2OPSA 2WBNA 3O9QA 3QEWA 4H0VB 4BDPA 1C1CA 4MFBA 1DGKN 1GLAG 4DV7K 1T3VA 1QVGM 1K8AO 1U47A 3CQYA 5AQJA 3B6PA 5AQGA 4LF9K 2O8DA 1BWFO 3SZ2A 4GVMA 3DAWA 1TK8A 3K5NA 3V6DA 1WSHA 1NGIA 3SMSA 4BG8A 3JS6A 4DR7K 4CJVA 2NNWA 3V9UA 4JLHA 1DTTA 3I0SA 4IKFA 4DU4A 5KPTA 3E9LA 2HHHK 3LDSA 4HUEA 1NKBA 1IKYA 1NU0A 3DJCA 5FRNA 4IDHA 5JS2A 3OYFA 3RSEB 4LFAK 1M90O 2PBDA 4ILHA 4B1WB 3K0SA 1HQEA 4RW6A 3OYJA 1U2VB 3K9KA 3HJFA 1U45A 4NCGA 4DFKA 3F2KA 3CCMN 4CBWA 3C7NA 1JLGA 3UE5A 4M3UA 4N47A 1VAZA 3T7ZA 3NCIA 1QSYA 3LL3A 3ZSOA 3NHGA 4PHTX 2YV0X 2P9IA 5AQHA 3THYB 1K73O 4BRKA 1J5EK 3O9TA 1XWLA 3CCLN 2YHAA 1SKRA 1UWBA 4BRHA 3T1HK 1FXXA 1RBRA 1S9EA 4QOZB 2O4GA 3K5OA 2A42A 5GAGP 4KHNA 3H08A 1W0HA 3ZYYX 1JLFA 3DYAA 3OBYA 2Y1IA 4YY3K 1ZBLA 1TKZA 3HPHA 3NE6A 2OZSA 1T44A 3B8AX 4YDUA 2P9KB 5DK5A 1U48A 3V1RA 4IFYA 2PFUA 1NOZA 4FJ5A 4TSXA 3CFPA 3I8DA 4DKWA 2Z1GA 1WSEA 2IVPA 3EE9A 4KHWA 1KRPA 1XMQK 1S5JA 1YXQA 5CR4A 3TAPA 4N41A 1NK9A 4F9OA 2Q1NA 3AA5X 5GIOA 2GELA 5CYMA 1CZBA 5EOYA 4NLCA 1YI2N 3VGKA 4MDAA 3NAEA 1C0FA 2O8BA 2A3ZA 5H1SQ 5BRFA 2ZM6K 1I94K 3DLLL 4Z4HA 5E84A 3PX4A 4DV6K 2VWKA 4FLZA 3SQ1A 5AQWA 4PQUA 4R79A 5A2QO 1B92A 2A1RA 3OS2A 4IBNA 4DV4K 4NLBA 4AHUA 1HJRA 2YHYA 2QKBA 2HHWA 4BR0A 2IOCA 3OJUA 3SAGA 5EY4A 1W97L 2P9KA 5FPMA 3TARA 2Z1IA 1JLBA 3CJ9A 3HPOA 4HUGA 3R8EA 1XHZA 3IRXA 1NK4A 4FOIA 5C24A 5HRNA 2VQFK 2G8IA 4CHNA 2E20A 4O55A 3VOVA 1JLAA 2YHXA 5GADP 2DPNA 2ASOA 4KH5A 3SYZA 4WCEL 2YI1A 1ZYQA 3AGRA 3D2EA 1Q18A 1BUPA 4DV5K 3LM2A 3HZ6A 3O4WA 5TKYA 2KW4A 3WQUA 4BACA 4BC3A 4F4KA 1JXEA 2F9WA 4A57A 2HHQA 3F73A 4BDYA 2NZTA 4PL7A 1CLQA 3KWIA 4FLTA 2XY7A 3L6QA 4N5SA 3O6WA 2KQ2A 3VEYA 3C65A 3M8SA 2YHWA 3RTVA 1K9MO 2HHVA 4E19A 4BR7A 1JLQA 1HNXK 5AQUA 5AQZA 2KFNA 1L3VA 3RRHA 4BRQA 2D5RA 2NRWA 5I3UA 3ZLJA 2EX3A 2WUSA 5ADXA 1WSFA 4E1MA 1LV5A 2PZSA 5M1OA 4WFAL 4JKEA 4CF1A 3SAFA 3D45A 3ULEB 4CECA 5J2NA 4NXNK 4JI7K 1X9WA 4JI3K 1W2BM 4O5BA 3SUNA 4M45A 2B5JA 3S3OA 3QBXA 3TWHA 1HNVA 5E41A 4B3OA 3L2QA 3MN5A 4JNEA 4FLXA 3RR7A 1H1VA 4WYBA 3HBTA 4M7YA 1REVA 3QB0A 2HMPA 3CERA 5BRDA 3TAGA 4LH4A 4BRLA 3VMFB 3VQ6A 3L2UA 4AHRA 4M41A 3TTDA 3ZT1A 3UKRA 1K8KB 4KFBA 3LP1A 1GLJO 3HOTA 3ZSWA 4C8KA 4LF7K 4FVUA 1A5VA 4GKJK 1VSMA 3MWTA 2G8UA 2E88A 1HUXA 3JYTA 1VQON 3VF2A 3IAYA 4GY2B 4KO0A 3ULEA 3SPYA 2AJQA 4A5BA 1Q9YA 1YTAA 5JICA 4JKCA 5E26A 4E89A 1NGCA 1R0AA 2GUIA 4XH4A 4CZEA 3KWGA 1M1KO 4A5AA 4JYAK 3HM9A 1VSFA 2NRTA 1RBSA 3KLHA 3K57A 3BGRA 2A5XA 3ZX0A 3KK3A 4AHTA 2FBVA 4Y0WA 4BRFA 2RKIA 4Y1DA 4CK2A 1BDGA 4FWLA 1OH5A 3DRPA 1BI4B 4ISEA 2FF3B 4CJFA 1E4GT 3LPTA 4XEIA 4B1VA 5EXWA 3SNNA 4PKGA 2QWMA 2HVIA 1IH7A 2I7NA 4L3QA 3ZCMA 4ZTJA 2P51A 1WNSA 3LAKA 3QLHA 2GWKA 3DRSA 4KRFA 2RE2A 1K8KA 4E1NA 2W42A 4KTWA 2PYJA 1BIUA 3AGKA 3ZSVA 2F8SA 3H1VX 2NRRA 3VF4A 2F9TA 3OY9A 1OH7A 1XNRK 4X62K 2VWBA 4DFMA 4EP4A 3CETA 4AM7A 4LSNA 1T8EA 1L3TA 2WONA 4O8KA 5CY4A 4EFHA 3FLCO 4DQPA 4KHQA 3IDHA 3HSTB 3SQ4A 4EHUA 5JVHL 4KB1A 2QWNA 3THWB 4IDKA 4CJWA 4PY5A 1DT9A 3LP0A 1HJOA 3LWLA 4CEFA 3CCEN 3CYMA 2HOEA 5DM6L 1SL0A 1NM1A 3IG1A 2R7YA 1GLCG 1JLEA 1I39A 3H46O 2OCEA 3LPUA 4UQGA 1X9SA 4CZGA 1TGOA 5I42A 4JV5K 2FBYA 3TAEA 3B6OA 3HXMA 4ID1A 1NNEA 4ZHRA 3AA4A 1RTHA 5KI6A 3TSUA 3DLKA 1LWEA 2CH5A 2E6LA 3LZIA 5HBMA 3MECA 1VK0A 1J9AA 4IEEA 4H0YB 4X65K 3NH1A 3AVMA 4A61A 4CESA 3SJJA 1OH8A 3WQTA 5AQKA 3LALA 5KGWA 3HI0A 3Q7CA 1YJ9N 1ZXOA 3GBTA 2HBJA 1S1WA 5ADXH 1W9HA 1IKXA 2E1YA 4KTZA 3QEPA 1J54A 1NJZA 4H03B 4B9NA 4B9MA 2DFEA 3AVBA 2QI2A 3BDPA 3I56N 2VG5A 1HR0K 1VHXA 2YNHA 4DFJA 2NRVA 4CD1A 1JL2A 2XY5A 2D0AA 3VQ5A 1SS6A 3P1GA 3LDQA 4JK7A 2FXUA 1ZBUA 3L0QA 4DF8A 1BISA 1CZAN 3T1YK 2XY6A 4JI4K 3U4LA 1HYVA 2JLEA 3FFKB 1V4SA 2IGIA 3ZSXA 3L4IA 4KHYA 1Z26A 4FLYA 5LMUK 1IBKK 1NG9A 4DMNA 1KXPA 5T7BA 3HM8A 3VQ7A 5AZIB 4DCHA 2BANA 3ZT3A 3QETA 3THXA 5IT9O 3KD1E 1N33K 4ISGA 1RCHA 5C12A 3DOLA 2I7PA 1O13A 3KLEA 4B3RK 4FLVA 2IVNA 1HX1A 4DTJA 2QWRA 1S1UA 4YOXA 4CW7B 1MA9B 5KQDA 4CZJA 4RCHA 4CF2A 2D4WA 3G0ZA 3O4QA 3S9HA 3QEXA 3D0PA 4GNIA 4FWKA 3AAPA 4DTMA 4JD2B 3TTFA 1JXBA 3LDLA 1WSJA 4LC9B 3MCPA 5C2DA 1BL3A 2HNYA 4DQ8A 3EO3A 3CCUN 3WNGA 4CEAA 3RMCA 3J7ZO 3V81A 4CGGA 1IG8A 1HRHA 3ENBA 1B9DA 2GEMA 4JI1K 4KV8A 2NLXA 5JS1A 2XRIA 3QO9A 3OS1A 4H5TA 3H3OB 1ASVA 3HVTA 3HL8A 4JHDB 2HHTA 3MEDA 1S3XA 1NMDA 1S22A 4CJLA 2CGKA 1WAJA 5BN9A 5HROA 4LFBK 3QINA 1NOYA 1GLEG 1TV6A 3FE1A 4AHCA 1Q7YO 1D4XA 4B8AB 3CFOA 4RW7A 1NGFA 2HNZA 1Q86O 1HNZK 3V9ZA 3QNOA 3O1BA 1WOQA 1YITN 1QHTA 2OPRA 3P5JA 3NMUA 4BREA 1DEJA 5SWMA 4DTNA 3CQ8A 4NCBA 3VN5A 4CE9A 4E7HA 4CERA 4B9SA 4IJAA 4KI4A 3TU5A 2BDPA 1T6DA 1YJWN 1IO2A 5BN8A 1IJJA 2UYTA 4M3WA 1QSSA 4NCAA 4CGDA 1VQ8N 4R5PA 3ZT2A 1RDWX 4OPJA 2A40A 3C94A 4KHUA 2Q2RA 5AQQA 3NGYA 4CZHA 3OYKA 3PSIA 4CJ5A 4B9TA 3KK1A 4IFEA 3WNHA 2QWLA 2ASPA 2JGUA 4CHZA 4BE0A 4A59A 3MAQA 3U3YA 1O1WA 1GOAA 4DLEA 4Z0UA 3VPZA 3CM5A 3M5RA 3N4QA 1KSPA 3A2FA 3T3FA 1ZBSA 4JI0K 4I6MA 3KZBA 4WFBL 1BCMA 4IWVA 2G8FA 4OKKA 1BCOA 1HQUA 2E4LA 3AAQA 4BRGA 3VEWA 1UOCA 4CGIA 3ZT0A 1VSHA 3SBGA 4DQRA 3VF6A 3THVA 2D1KA 5GAHP 3CM6A 4CEZA 3QNNA 1Y97A 4MO4A 4DSJA 3AA2A 3CJBA 3ZSYA 3L3UA 2RHKA 3MXJA 1VQ6N 2YNGA 5KQ8A 1P90A 3OS0A 4BC5A 3O5BA 3WEEB 1KC8O 2UU9K 1RILA 4IOXA 1VRUA 1ZBFA 1LAVA 3OYLA 3FZHA 3FGUA 2RN2A 3A5OC 1S1VA 4BRCA 1YHQN 2Z1JA 1XNQK 3EN9A 1F21A 1CXQA 1HKCA 3SI6A 3SV3A 4OLAA 4BRAA 2DTUA 1SL1A 4H4OA 2ZGZA 3GE1A 3OYAA 4OX9K 3DXMB 1TYQB 4RG8A 2WFBA 3VA3A 1G15A 1NGDA 4B8CA 2UXCK 2CH6A 3UIQA 3E66A 2HVHA 4PKHA 1TKTA 3RSEA 4Q5VA 1LW2A 3AV9A 3V9XA 4RW9A 2VYPA 3C6UA 4MO5A 5M1PA 4YNQA 1U2VA 4O44A 4CFCA 3ZEUB 4O0JA 2Q31A 5FDLA 2F96A 5AQVA 1DKGD 1J53A 3DLBA 1FKPA 4I2PA 4CZIA 1RDAA 4O5FA 4M7XA 4LFCK 4CF0A 2HHXA 3V9SA 1T03A 3THYA 4JKDA 3ATVA 3VESA 4LD0A 3BF3A 1QQCA 1XHXA 1IG9A 1RTIA 3GDQA 2HNDA 4DR6K 1Z25A 4BE2A 4FM2A 3NFAA 1Z05A 4BRNA 3PIOL 1S1XA 4O8UA 5I9EB 1N5YA 1GLDG 4FWRA 4BR4A 1V4TA 3RMDA 2QWPA 4DSLA 4RW4A 4HHTA 5HL7L 4DR2K 4FJ7A 3M8PA 2PAVA 1SL2A 1QZ6A 4ICLA 3LDOA 3CPWM 4HTUA 3I55N 3C0BA 4FM0A 4E7JA 3SPZA 4QS7A 4OJRA 1RT2A 2HBKA 3ZEUA 3RR8A 3A5MC 1ATSA 3SV4A 2ZJQL 2D0BA 2B4JA 1OKJA 4JKGB 2P9UB 3J80O 1VQ9N 1X3MA 3CMEN 2BTFA 1KTQA 4AHSA 4BVPA 1QQMA 4JK8A 2J4RA 3DLHA 3O3GA 5EU7A 4J8FA 3CC7N 4CHPA 5M1KA 1TL3A 4CJ3A 4MQ3A 3E9PA 2BGGA 5JLHA 5AQPA 4IOAL 4CGFA 4W5RA 1TAUA 4WQ5C 1C1AA 1BQMA 2G8KA 3K2PA 4GV6A 2O8EB 3F5TA 1SKWA 4HTLA 4CK1A 1MWMA 3MDQA 4GW6A 3ASMA 1EWRA 2QEXN 3AO4A 4NYNA 3ZSRA 4AH9A 2YKMA 5KRTA 3R9PA 4FJXA 5HP1A 3LDPA 3AARA 1XI1A 4I2QA 5GIPA 5DM7L 1RT1A 1GLFO 3KK2A 4OLBA 3RMBA 2HF3A 3ENHA 2IS3A 3EKUA 5D3GA 1DLOA 4CIGA 2Q97A 3ZETB 3PLAA 2ZGYA 3AVFA 3VQCA 5C0YA 3AY9A 2GWJA 5BREA 1FW6A 4A2BA 4J2EA 4Q0BA 3CFRA 3KHYA 2QWOA 2YX6A 4DQQA 2XY8A 3QEVA 3KLFA 5SZTA 2B6AA 4U7BA 2DY4A 4O4GA 2KKZA 1KAYA 1VSKA 1K6YA 3O1WA 2O8EA 4BRIA 2PY5A 4CBXA 4FWSA 4FZYA 1FK9A 4B3SK 5M1QA 1NGAA 2XHBA 4B3TK 5FPEA 5M1FA 4BRPA 3D2FB 2P9NB 3HRGA 4CVNE 2YNFA 1VQKN 4CJTA 4H0PA 1OVQA 1TUYA 4CJEA 1W7AA 4V19S 1VSDA 3PY8A 1HPMA 4NYFA 1KVCA 4WQ5A 4IJNA 1E4FT 2FC0A 4E3SA 3DMJA 4CIEA 4AF1A 2O4IA 4OPKA 1U04A 3HPGA 3H3NO 3DXKB 4CK3A 2A1SA 3VEVA 3DWLA 3ALYA 1BU6O 4EZ9A 5C15A 4DF4A 3BF1A 4FXDA 5M1NA 1SAZA 1WUAA 3SK3A 4DV0K 1XUPO 3CI5A 3E9OA 4JI8K 1RT6A 3O80A 4EZ6A 1T6CA 2Q0RA 2QM1A 1MDUB 5C25A 4FVMA 1BO5O 4BQZA 4JAXA 3DLRA 2HBLA 3D2FA 4HVJA 3V9WA 4LF8K 3BZCA 2Z1HA 2VG7A 4M3YA 3IFRA 4DSKA 5AQTA 1C1BA 2QA4N 1L5UA 1SUQA 3PX0A 4IXCA 2H3GX 4B1YB 2UXDK 4JEPA 3CCVN 3K59A 3AO3A 3HYFA 4OO1J 5JMVA 1BG3A 1QS4A 4YOTA 4KI6A 3CMAN 1BI4A 3MEEA 4KHPK 4B1UB 3J7YP 3C95A 4F2RA 4Z4IA 2ZD1A 3A5LC 3TPQA 3AO1A 3HVRA 1IBLK 4O0IA 1KFSA 1JJ2M 1N32K 4DHYA 2HMIA 4MDBA 1GLBG 3QFUA 5CZ1A 3VTIA 2NRXA 4J2DA 4H5WA 4FJJA 4F8RA 3MMVA 1NMNA 1NLVA 3MEGA 4HCBA 2E8AA 3DRRA 4XH1A 1N36K 4PA1A 2NUBA 3PUFA 4B3MK 4ISFA 1C0TA 4IEIA 3H6EA 3LANA 3L8BA 5C2FA 1HYSA 5MLCQ 1FKOA 3NVKA 1EWQA 1NK5A 2RF2A 3M8QA 2BE2A 1ZBHA 3KLGA 2OANA 2ZE2A 4BY9C 2V51B 2GBZA 4AQYK 2YHBA 3C6TA 1YF5L 4M3XA 4LH5A 5B8HA 1J5OA 1QSLA 2E5LK 1C0GA 3THWA 1ASUA 3LDNA 4IG3A 4IOCL 4H8KA 3OHRA 3U8XA 4DTPA 2QXFA 3CD6N 1NGBA 2HHUA 3L3VA 1S1TA 3NGIA 4CJPA 2I5JA 4BC4A 1HKGA 3AVGA 5LMNK 1DTQA 1NGHA 3DOKA 2E6MA 2A41A 1X9JA 1L3SA 1YIJN 4LF6K 5KGXA 4CZKA 4K8XA 4H5VA 1C0MA 4H0TB 2VGMA 4IO8A 4FJ9A 1A5XA 4W5QA 5BPLA 3HP6A 1KAZA 4JKAA 1L3UA 1E3MA 5AQFA 2IC3A 3A0IX 3FZFA 4QS8A 1KCFA 2BH1A 4KB0A 3EE8A 2OTLN 3U9DA 3AVLA 4FCYA 4YOYA 2WTUA 4E7IA 1YAGA 4C8LA 1X9MA 4CEEA 3IKMA 1NK6A 5F1XA 3EYZA 1ITGA 4IZ9A 4U67L 4BR2A 4BR5A 3K5MA 2FF6A 1BHLA 5AQYA 4FYDA 5FRMA 4CIFA 3ITHA 3BP8A 3CJAA 4IG0A 3NVMA 5C10A 4FJ8A 3VQ9A 1OH6A 2VCPA 4FJNA 3TSQA 3FFIA 5AJ3K 2IAJA 2VG6A 4C1NI 3WNFA 4B9UA 3M1FA 1R59O 5J1EA 2E2NA 4CZMA 3GL1A 1TUUA 3TR8A 3KIOA 4DUYK 2GV9A 2DFFA 3MN7A 5AZIA 1VQLN 2ATQA 3QIOA 1Q82O 1YVNA 3EKSA 1JKHA 3V1OA 4N76A 3TANA 2P9PB 5TKWA 3E1YA 1RDUA 4JK9A 4M3TA 4CFBA 1JL1A 5HRPA 4M42A 2X6SA 1KLMA 3OTOK 5KTQA 1JCFA 4BG9A 2W6KA 3RRGA 3T69A 3D6RA 1XQSC
chains in the Genus database with same CATH topology
3L2QA 1LW2A 3AV9A 3V9XA 3S3MA 4DTXA 5KRSA 1EX4A 1GOCA 1ASWA 4RW9A 4CGJA 3AO2A 3AVHA 3C6UA 3LP3A 3ZSZA 4YNQA 4FLXA 3TI0A 2YNIA 3RR7A 3VQQA 4DWIA 3DM2A 3AVAA 2ZQBA 4O44A 1BQNA 4CFCA 3NF6A 4E7LA 4O0JA 2HB5A 3EY1A 5FDLA 2F96A 3AO5A 4W5TA 1TKDA 1HYZA 4L8RB 1J53A 1REVA 3DLBA 1FKPA 4I2PA 3PX6A 4DQIA 1BGXT 3TAGA 4LH4A 1RDAA 3VQ6A 1NK8A 3L2UA 4AHRA 4M41A 2KTQA 1RBVA 4CF0A 3SQ0A 2HHXA 3V9SA 3ZT1A 1T03A 4JRPA 1RBUA 4KFBA 3LP1A 4Z4GA 3NF9A 3ZSWA 4C8KA 4LD0A 4FZXC 1S6PA 3IS9A 4CFDA 4DTUA 3E01A 1QQCA 1VSJA 1A5VA 1IKVA 1VSMA 1XHXA 1IG9A 4KHSA 2G8UA 2X78A 4FLUA 1NJYA 3JYTA 3IAYA 2FBTA 4FZZA 4G1QA 4KO0A 1RTIA 3SPYA 3M8RA 2KZZA 2AJQA 2HNDA 1Q9YA 1YTAA 1RT3A 1Z25A 2OPQA 3OVNA 4BE2A 4HUFA 4FM2A 3NFAA 4E89A 2PYLA 1R0AA 2GUIA 4FJIA 3F9KA 4YFUA 1S1XA 3HM9A 4Z4EA 1VSFA 3P83D 1N5YA 1RBSA 3KLHA 3K57A 4DU3A 3BGRA 3OYMA 3KK3A 3NH0A 3RMDA 1U49A 4AHTA 3SUOA 2FBVA 4DSLA 4RW4A 4HHTA 2HW3A 2RKIA 3U3GA 1RTJA 4Y1DA 4CK2A 4DFPA 4FJ7A 3M8PA 1SL2A 3DRPA 4CEDA 3T1AA 1BI4B 4FM1A 4ICLA 3DLEA 4CJFA 4HTUA 5J2MA 1WSGA 5HRSA 4FM0A 3VQEA 4CF8A 4E7JA 3LPTA 3SPZA 2P5OA 2G8WA 4OJRA 1WAFA 1RT2A 3RR8A 4DG1A 3SNNA 4FLWA 1TK5A 2HVIA 3SV4A 1SV5A 4FJHA 4DU1A 1IH7A 4DSEA 2D0BA 2B4JA 1CXUA 3ZCMA 1TK0A 1KVAA 4ZTJA 1RNHA 1VSLA 2P51A 4H4MA 1WNSA 3LAKA 1KTQA 3QLHA 4AHSA 4CHOA 3DRSA 4KRFA 4E1NA 5FROA 2W42A 4J2BA 2QKKA 3NF7A 3O3GA 4DTSA 4KTWA 5EU7A 3EZ5A 3DLHA 2PYJA 4KKOA 1BIUA 3ZSVA 4CHPA 1TL3A 2F8SA 4CJ3A 4CHQA 2D0CA 4MQ3A 3RWUA 1D5AA 4QAGA 2BGGA 4FW1A 3OY9A 5CZ2A 1LWCA 3VQPA 4W5OA 1MU2A 4DFMA 4EP4A 4N56A 3KKRA 4CGFA 4LSNA 4ELVA 4W5RA 1NJXA 1A5WA 4OVLA 4WE1A 4OKEA 1NKEA 4PUOA 3SUPA 1WLJA 3DLGA 3L2WA 1TAUA 3PO5A 4FJLA 1HMVA 1C1AA 4DQSA 1BQMA 4DTOA 1T8EA 3K2PA 5J2QA 2G8KA 1HPZA 1L3TA 4RW8A 1C0UA 1YVUA 2WONA 3KD5E 1SKWA 1U4BA 5CY4A 4CK1A 2P5GA 3ZT4A 3HO1A 4GW6A 3V4IA 3ASMA 4DQPA 4KHQA 2X74A 3AO4A 4NYNA 3ZSRA 4AH9A 2YKMA 5KRTA 4FJGA 4CJQA 2LSNA 3HSTB 1S6QA 3VQBA 3SQ4A 5HP1A 1T7PA 4FJXA 4ELTA 2FBXA 4KB1A 1D9DA 4IDKA 4CJWA 3K5LA 1ZBIA 4PY5A 3LWMA 1XI1A 3LP0A 4I2QA 3QESA 4KAZA 3LWLA 4CEFA 4LY7A 3HK2A 3LAMA 1EKEA 1RT1A 3CYMA 3O3HA 3KK2A 1SL0A 4OLBA 1RT4A 3RMBA 2IS3A 3IG1A 4BWMA 2R7YA 3I0RA 3T19A 1JLEA 1DLOA 1I39A 1IKWA 4CIGA 5D3GA 3LPUA 1NK7A 3ZSQA 1LWFA 1LW0A 4UQGA 2XO7A 1X9SA 1TGOA 4BWJA 3AVFA 5I42A 1UA0A 4W5NA 3VQCA 2YKNA 1EXQA 2QK9A 2FBYA 3TAEA 4F3OA 4KTQA 3OYEA 3B6OA 3HXMA 4J2EA 4Q0BA 4ID1A 3CFRA 3ULDA 4ZHRA 3AA4A 2OYQA 4DQQA 1RTHA 2XY8A 1NKCA 4IFVA 5KI6A 3DLKA 3KLFA 1LWEA 2E6LA 3NGZA 3LZIA 5HBMA 5SZTA 3QEVA 2B6AA 3MECA 3O4NA 2P1JA 2HHSA 2DY4A 1VK0A 1J9AA 4O4GA 3NH1A 3NF8A 3OYIA 3AVMA 1VSKA 4HCCA 1K6YA 4I7FA 4CESA 4OKJA 3SJJA 3AVKA 1YTUA 2DFHA 4FK4A 2PY5A 3LALA 4J2AA 1NJWA 3VA0A 4FZYA 1FK9A 1QTMA 4E7KA 5C42A 5KGWA 1KLNA 1QE1A 2XHBA 1TAQA 3NBPA 3CG7A 3NDKA 4B9VA 1S9GA 4ELUA 4Y1CA 5HLFA 3KLIA 3OYHA 3HP9A 4JS5A 1S1WA 4OGCA 1W9HA 1IKXA 4KTZA 2YNFA 5J2PA 4KPYA 3QEPA 4Z4FA 1J54A 4CJKA 3OJSA 1NJZA 4B9NA 4BDZA 3LZJA 4B9MA 2DFEA 4CJTA 1RT7A 4ID5A 3AVBA 4CJEA 4QCLA 1VSDA 3BDPA 3JSMA 4K8ZA 4KREA 3PY8A 4NYFA 1WN7A 2EHGA 1KVCA 2VG5A 2YNHA 2FC0A 4CEOA 4DFJA 4E3SA 3DMJA 4CIEA 1VRTA 2O4IA 4OPKA 1JL2A 2XY5A 1U04A 2D0AA 3VQ5A 3HPGA 3P1GA 4M3RA 1RTDA 4CK3A 2A1SA 1X1PA 2IDOA 1ZBUA 4LSLA 4DF8A 1D8YA 1BISA 3ALYA 4DSIA 2XY6A 4EZ9A 4CGHA 4DF4A 3S3NA 1HYVA 1TVRA 2JLEA 5K14A 4FXDA 3SQ2A 2OPSA 3O3FA 4BDPA 3QEWA 2OA8A 3AVNA 1C1CA 2IGIA 3ZSXA 4MFBA 4KHYA 1Z26A 4JRQA 4FLYA 3AA3A 4DMNA 4I9QA 1U47A 3B6PA 5T7BA 1RT6A 3VQ7A 4EZ6A 3SZ2A 4CJSA 5C25A 4CJRA 4FVMA 1CZ9A 4GVMA 2BANA 3ZT3A 3QETA 1HNIA 3TABA 1TK8A 4B08A 1RCHA 3K5NA 3KD1E 3V6DA 1WSHA 3DLRA 3V1QA 3DOLA 4HVJA 3V9WA 2Z1HA 1RBTA 2VG7A 4M3YA 4CJVA 3NH2A 4ZTFA 3V9UA 3KLEA 4JLHA 4FLVA 1DTTA 4DSKA 3I0SA 4IKFA 1C1BA 2VWJA 4DTJA 1L5UA 4FJKA 4DU4A 1S1UA 1SUQA 3PX0A 3LDSA 4HUEA 4CF2A 1NKBA 4FK2A 3G0ZA 1IKYA 3K59A 3AO3A 3HYFA 5FRNA 3O4QA 5JS2A 3OYFA 3QEXA 1QS4A 3SUQA 3S9HA 4DTRA 4KI6A 3D0PA 2G8VA 1BI4A 3MEEA 1HQEA 4RW6A 4Z4IA 3C95A 4F2RA 3OYJA 2ZD1A 4EP5A 3HJFA 1U45A 4DTMA 4NCGA 4DFKA 1JXBA 3OYDA 1WSJA 1JLGA 3KTQA 3AO1A 4DS5A 3HVRA 1BL3A 3OYBA 4N47A 4O0IA 4M3UA 1KFSA 2HNYA 3NCIA 3WNGA 4CEAA 1QSYA 3RMCA 4C8NA 3ZSOA 2HMIA 3V81A 3NHGA 2YV0X 4CGGA 3SCXA 1HRHA 2Q3SA 1B9DA 5CZ1A 4M3ZA 4XIUA 1XWLA 4E0DA 4J2DA 2YHAA 1BIZA 2OPPA 4KV8A 1SKRA 4Z4CA 1UWBA 4F8RA 4FJJA 2XRIA 5JS1A 3MEGA 3QO9A 1FXXA 1RBRA 1TL1A 3OS1A 1S9EA 1D9FA 2O4GA 3DRRA 4HCBA 4QOZB 4PA1A 3K5OA 1N6QA 1RDDA 2NUBA 3PUFA 1ASVA 4AILC 1C6VA 3HVTA 1C0TA 3HL8A 1UA1A 3MEDA 4KHNA 3H08A 3LANA 2HHTA 3L8BA 1W0HA 1HYSA 4CJLA 1JLFA 3DYAA 1FKOA 1WAJA 3K58A 1NK0A 4I9LA 2Y1IA 5HROA 3QINA 1TKZA 3HPHA 3NE6A 1ZBLA 4CEQA 1NOYA 2OZSA 1TV6A 2Y1JA 4AHCA 5DK5A 5HRRA 4B8AB 1U48A 3CFOA 3V1RA 5CYQA 2WOMA 4RW7A 2HNZA 1NK5A 4IFYA 2RF2A 3M8QA 1NOZA 2BE2A 1ZBHA 3OYGA 3KLGA 4FJ5A 4TSXA 2ZE2A 3CFPA 3I8DA 3V9ZA 3QNOA 2GBZA 2YHBA 2Z1GA 1WSEA 4DLGA 3QERA 4KHWA 3C6TA 1QHTA 1VSIA 2OPRA 3P5JA 4LH5A 1KRPA 4C8OA 4M3XA 1S5JA 3TAPA 1J5OA 1NK9A 5SWMA 4DTNA 4N41A 3CQ8A 4NCBA 3VN5A 4CE9A 1QSLA 4E7HA 4GMJB 3AA5X 4CERA 3TAFA 4B9SA 1ASUA 4CHYA 1T05A 4IG3A 4KI4A 5CYMA 1CZBA 1B9FA 4H8KA 2BDPA 3PO4A 3NAEA 1IO2A 1JLCA 4BE1A 2QXFA 4DTPA 1Q9XA 4Z4HA 4M3WA 2HHUA 3L3VA 1S1TA 3PX4A 1QSSA 2VWKA 4CEBA 4CJPA 3L2RA 2I5JA 3NGIA 4CGDA 4FLZA 3SQ1A 4NCAA 3AVGA 4PQUA 4R5PA 3ZT2A 1B92A 1DTQA 3DOKA 4OPJA 2E6MA 2A1RA 3C94A 3VQ8A 3OS2A 4KHUA 4IBNA 3NGYA 4AHUA 3MXMA 1L3SA 4B9UA 2F8TA 1HJRA 5KGXA 3OYKA 2QKBA 2HHWA 4K8XA 1C0MA 4CJ5A 4B9TA 3KK1A 2IOCA 1A5XA 3OJUA 1KVBA 4W5QA 4FJ9A 3TAQA 3WNHA 3HP6A 1LAWA 2KZMA 2JGUA 1KFDA 3VQ4A 3VQDA 4CHZA 4CJ4A 4AHVA 3TARA 2Z1IA 1L3UA 1JLBA 3KKSA 4BE0A 1RDBA 2IC3A 4CJUA 3HPOA 4HUGA 1XHZA 1UAXA 3IRXA 3MAQA 1KCFA 3U3YA 3LP2A 1NK4A 4KB0A 1GOBA 1YT3A 5C24A 3KJVA 5HRNA 3WNEA 4F3TA 1O1WA 3AVLA 1EP4A 1GOAA 4FCYA 1RDCA 4Z0UA 4CHNA 4DLEA 4E7IA 2G8IA 4O55A 4JS4A 4C8LA 1X9MA 3CM5A 3QEIA 1JLAA 1KSPA 3A2FA 4CEEA 1NK6A 3T3FA 3EYZA 1ITGA 1BCMA 2G8FA 3G10A 3SYZA 3OYCA 4OKKA 4CF9A 1BCOA 3K5MA 1HQUA 2E4LA 1ZYQA 1BHLA 3AVIA 4FYDA 3U6FA 1UOCA 5FRMA 4CGIA 1SKSA 2G8HA 4CIFA 3ZT0A 3ITHA 1VSHA 2ITGA 4DQRA 4IG0A 3THVA 1VSEA 2KW4A 3CM6A 4CEZA 4BACA 3QNNA 4F4KA 1Y97A 1JXEA 4DSJA 4FJ8A 3AA2A 2HHQA 3ZSYA 3L3UA 3MXJA 3F73A 4BDYA 3VQ9A 2YNGA 4F2SA 2KFZA 3OS0A 1I3AA 1CLQA 4FJNA 4CCHA 3ISNC 4FLTA 1Q8IA 2XY7A 4N5SA 4FJMA 2KQ2A 3FFIA 2IAJA 2VG6A 5DMRA 4C8MA 1TKXA 3WNFA 3M8SA 3TAMA 3RTVA 1RILA 3MXIA 5J1EA 1VRUA 1WSIA 1ZBFA 2RPIA 1XC9A 4E19A 2HHVA 1JLQA 1LAVA 3OYLA 2OZMA 3TR8A 3KIOA 2KFNA 4CFAA 2RN2A 4DSFA 1L3VA 3RRHA 2GV9A 4PWDA 2D5RA 1S1VA 2DFFA 1EETA 2Z1JA 5I3UA 2ATQA 3QIOA 3AVJA 1F21A 1CXQA 4DS4A 3SI6A 2EX3A 3SV3A 1JKHA 1WSFA 3V1OA 4E1MA 1LV5A 2PZSA 4N76A 3TANA 4OLAA 3QIPA 2DTUA 1SL1A 4CF1A 4H4OA 3D45A 4CECA 3PV8A 3OYAA 3OYNA 3L2VA 4CFBA 4FK0A 4M3TA 5J2NA 4RG8A 3DI6A 3VA3A 1JL1A 1X9WA 5HRPA 3AVCA 4M42A 1G15A 2X6SA 2ETJA 4B9LA 1KLMA 4B8CA 2X6NA 4O5BA 3HT3A 4OGEA 3VQAA 3SUNA 1RT5A 4M45A 2B5JA 3UIQA 3S3OA 3TWHA 5KTQA 1HNVA 3RMAA 4FW2A 3RRGA 5E41A 2HVHA 4B3OA 1TKTA 4Q5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2Q A;  1LW2 A;  3AV9 A;  3V9X A;  3S3M A;  4DTX A;  5KRS A;  1EX4 A;  1GOC A;  1ASW A;  4RW9 A;  4CGJ A;  3AO2 A;  3AVH A;  3C6U A;  3LP3 A;  3ZSZ A;  4YNQ A;  4FLX A;  3TI0 A;  2YNI A;  3RR7 A;  3VQQ A;  4DWI A;  3DM2 A;  3AVA A;  2ZQB A;  4O44 A;  1BQN A;  4CFC A;  3NF6 A;  4E7L A;  4O0J A;  2HB5 A;  3EY1 A;  5FDL A;  2F96 A;  3AO5 A;  4W5T A;  1TKD A;  1HYZ A;  4L8R B;  1J53 A;  1REV A;  3DLB A;  1FKP A;  4I2P A;  3PX6 A;  4DQI A;  1BGX T;  3TAG A;  4LH4 A;  1RDA A;  3VQ6 A;  1NK8 A;  3L2U A;  4AHR A;  4M41 A;  2KTQ A;  1RBV A;  4CF0 A;  3SQ0 A;  2HHX A;  3V9S A;  3ZT1 A;  1T03 A;  4JRP A;  1RBU A;  4KFB A;  3LP1 A;  4Z4G A;  3NF9 A;  3ZSW A;  4C8K A;  4LD0 A;  4FZX C;  1S6P A;  3IS9 A;  4CFD A;  4DTU A;  3E01 A;  1QQC A;  1VSJ A;  1A5V A;  1IKV A;  1VSM A;  1XHX A;  1IG9 A;  4KHS A;  2G8U A;  2X78 A;  4FLU A;  1NJY A;  3JYT A;  3IAY A;  2FBT A;  4FZZ A;  4G1Q A;  4KO0 A;  1RTI A;  3SPY A;  3M8R A;  2KZZ A;  2AJQ A;  2HND A;  1Q9Y A;  1YTA A;  1RT3 A;  1Z25 A;  2OPQ A;  3OVN A;  4BE2 A;  4HUF A;  4FM2 A;  3NFA A;  4E89 A;  2PYL A;  1R0A A;  2GUI A;  4FJI A;  3F9K A;  4YFU A;  1S1X A;  3HM9 A;  4Z4E A;  1VSF A;  3P83 D;  1N5Y A;  1RBS A;  3KLH A;  3K57 A;  4DU3 A;  3BGR A;  3OYM A;  3KK3 A;  3NH0 A;  3RMD A;  1U49 A;  4AHT A;  3SUO A;  2FBV A;  4DSL A;  4RW4 A;  4HHT A;  2HW3 A;  2RKI A;  3U3G A;  1RTJ A;  4Y1D A;  4CK2 A;  4DFP A;  4FJ7 A;  3M8P A;  1SL2 A;  3DRP A;  4CED A;  3T1A A;  1BI4 B;  4FM1 A;  4ICL A;  3DLE A;  4CJF A;  4HTU A;  5J2M A;  1WSG A;  5HRS A;  4FM0 A;  3VQE A;  4CF8 A;  4E7J A;  3LPT A;  3SPZ A;  2P5O A;  2G8W A;  4OJR A;  1WAF A;  1RT2 A;  3RR8 A;  4DG1 A;  3SNN A;  4FLW A;  1TK5 A;  2HVI A;  3SV4 A;  1SV5 A;  4FJH A;  4DU1 A;  1IH7 A;  4DSE A;  2D0B A;  2B4J A;  1CXU A;  3ZCM A;  1TK0 A;  1KVA A;  4ZTJ A;  1RNH A;  1VSL A;  2P51 A;  4H4M A;  1WNS A;  3LAK A;  1KTQ A;  3QLH A;  4AHS A;  4CHO A;  3DRS A;  4KRF A;  4E1N A;  5FRO A;  2W42 A;  4J2B A;  2QKK A;  3NF7 A;  3O3G A;  4DTS A;  4KTW A;  5EU7 A;  3EZ5 A;  3DLH A;  2PYJ A;  4KKO A;  1BIU A;  3ZSV A;  4CHP A;  1TL3 A;  2F8S A;  4CJ3 A;  4CHQ A;  2D0C A;  4MQ3 A;  3RWU A;  1D5A A;  4QAG A;  2BGG A;  4FW1 A;  3OY9 A;  5CZ2 A;  1LWC A;  3VQP A;  4W5O A;  1MU2 A;  4DFM A;  4EP4 A;  4N56 A;  3KKR A;  4CGF A;  4LSN A;  4ELV A;  4W5R A;  1NJX A;  1A5W A;  4OVL A;  4WE1 A;  4OKE A;  1NKE A;  4PUO A;  3SUP A;  1WLJ A;  3DLG A;  3L2W A;  1TAU A;  3PO5 A;  4FJL A;  1HMV A;  1C1A A;  4DQS A;  1BQM A;  4DTO A;  1T8E A;  3K2P A;  5J2Q A;  2G8K A;  1HPZ A;  1L3T A;  4RW8 A;  1C0U A;  1YVU A;  2WON A;  3KD5 E;  1SKW A;  1U4B A;  5CY4 A;  4CK1 A;  2P5G A;  3ZT4 A;  3HO1 A;  4GW6 A;  3V4I A;  3ASM A;  4DQP A;  4KHQ A;  2X74 A;  3AO4 A;  4NYN A;  3ZSR A;  4AH9 A;  2YKM A;  5KRT A;  4FJG A;  4CJQ A;  2LSN A;  3HST B;  1S6Q A;  3VQB A;  3SQ4 A;  5HP1 A;  1T7P A;  4FJX A;  4ELT A;  2FBX A;  4KB1 A;  1D9D A;  4IDK A;  4CJW A;  3K5L A;  1ZBI A;  4PY5 A;  3LWM A;  1XI1 A;  3LP0 A;  4I2Q A;  3QES A;  4KAZ A;  3LWL A;  4CEF A;  4LY7 A;  3HK2 A;  3LAM A;  1EKE A;  1RT1 A;  3CYM A;  3O3H A;  3KK2 A;  1SL0 A;  4OLB A;  1RT4 A;  3RMB A;  2IS3 A;  3IG1 A;  4BWM A;  2R7Y A;  3I0R A;  3T19 A;  1JLE A;  1DLO A;  1I39 A;  1IKW A;  4CIG A;  5D3G A;  3LPU A;  1NK7 A;  3ZSQ A;  1LWF A;  1LW0 A;  4UQG A;  2XO7 A;  1X9S A;  1TGO A;  4BWJ A;  3AVF A;  5I42 A;  1UA0 A;  4W5N A;  3VQC A;  2YKN A;  1EXQ A;  2QK9 A;  2FBY A;  3TAE A;  4F3O A;  4KTQ A;  3OYE A;  3B6O A;  3HXM A;  4J2E A;  4Q0B A;  4ID1 A;  3CFR A;  3ULD A;  4ZHR A;  3AA4 A;  2OYQ A;  4DQQ A;  1RTH A;  2XY8 A;  1NKC A;  4IFV A;  5KI6 A;  3DLK A;  3KLF A;  1LWE A;  2E6L A;  3NGZ A;  3LZI A;  5HBM A;  5SZT A;  3QEV A;  2B6A A;  3MEC A;  3O4N A;  2P1J A;  2HHS A;  2DY4 A;  1VK0 A;  1J9A A;  4O4G A;  3NH1 A;  3NF8 A;  3OYI A;  3AVM A;  1VSK A;  4HCC A;  1K6Y A;  4I7F A;  4CES A;  4OKJ A;  3SJJ A;  3AVK A;  1YTU A;  2DFH A;  4FK4 A;  2PY5 A;  3LAL A;  4J2A A;  1NJW A;  3VA0 A;  4FZY A;  1FK9 A;  1QTM A;  4E7K A;  5C42 A;  5KGW A;  1KLN A;  1QE1 A;  2XHB A;  1TAQ A;  3NBP A;  3CG7 A;  3NDK A;  4B9V A;  1S9G A;  4ELU A;  4Y1C A;  5HLF A;  3KLI A;  3OYH A;  3HP9 A;  4JS5 A;  1S1W A;  4OGC A;  1W9H A;  1IKX A;  4KTZ A;  2YNF A;  5J2P A;  4KPY A;  3QEP A;  4Z4F A;  1J54 A;  4CJK A;  3OJS A;  1NJZ A;  4B9N A;  4BDZ A;  3LZJ A;  4B9M A;  2DFE A;  4CJT A;  1RT7 A;  4ID5 A;  3AVB A;  4CJE A;  4QCL A;  1VSD A;  3BDP A;  3JSM A;  4K8Z A;  4KRE A;  3PY8 A;  4NYF A;  1WN7 A;  2EHG A;  1KVC A;  2VG5 A;  2YNH A;  2FC0 A;  4CEO A;  4DFJ A;  4E3S A;  3DMJ A;  4CIE A;  1VRT A;  2O4I A;  4OPK A;  1JL2 A;  2XY5 A;  1U04 A;  2D0A A;  3VQ5 A;  3HPG A;  3P1G A;  4M3R A;  1RTD A;  4CK3 A;  2A1S A;  1X1P A;  2IDO A;  1ZBU A;  4LSL A;  4DF8 A;  1D8Y A;  1BIS A;  3ALY A;  4DSI A;  2XY6 A;  4EZ9 A;  4CGH A;  4DF4 A;  3S3N A;  1HYV A;  1TVR A;  2JLE A;  5K14 A;  4FXD A;  3SQ2 A;  2OPS A;  3O3F A;  4BDP A;  3QEW A;  2OA8 A;  3AVN A;  1C1C A;  2IGI A;  3ZSX A;  4MFB A;  4KHY A;  1Z26 A;  4JRQ A;  4FLY A;  3AA3 A;  4DMN A;  4I9Q A;  1U47 A;  3B6P A;  5T7B A;  1RT6 A;  3VQ7 A;  4EZ6 A;  3SZ2 A;  4CJS A;  5C25 A;  4CJR A;  4FVM A;  1CZ9 A;  4GVM A;  2BAN A;  3ZT3 A;  3QET A;  1HNI A;  3TAB A;  1TK8 A;  4B08 A;  1RCH A;  3K5N A;  3KD1 E;  3V6D A;  1WSH A;  3DLR A;  3V1Q A;  3DOL A;  4HVJ A;  3V9W A;  2Z1H A;  1RBT A;  2VG7 A;  4M3Y A;  4CJV A;  3NH2 A;  4ZTF A;  3V9U A;  3KLE A;  4JLH A;  4FLV A;  1DTT A;  4DSK A;  3I0S A;  4IKF A;  1C1B A;  2VWJ A;  4DTJ A;  1L5U A;  4FJK A;  4DU4 A;  1S1U A;  1SUQ A;  3PX0 A;  3LDS A;  4HUE A;  4CF2 A;  1NKB A;  4FK2 A;  3G0Z A;  1IKY A;  3K59 A;  3AO3 A;  3HYF A;  5FRN A;  3O4Q A;  5JS2 A;  3OYF A;  3QEX A;  1QS4 A;  3SUQ A;  3S9H A;  4DTR A;  4KI6 A;  3D0P A;  2G8V A;  1BI4 A;  3MEE A;  1HQE A;  4RW6 A;  4Z4I A;  3C95 A;  4F2R A;  3OYJ A;  2ZD1 A;  4EP5 A;  3HJF A;  1U45 A;  4DTM A;  4NCG A;  4DFK A;  1JXB A;  3OYD A;  1WSJ A;  1JLG A;  3KTQ A;  3AO1 A;  4DS5 A;  3HVR A;  1BL3 A;  3OYB A;  4N47 A;  4O0I A;  4M3U A;  1KFS A;  2HNY A;  3NCI A;  3WNG A;  4CEA A;  1QSY A;  3RMC A;  4C8N A;  3ZSO A;  2HMI A;  3V81 A;  3NHG A;  2YV0 X;  4CGG A;  3SCX A;  1HRH A;  2Q3S A;  1B9D A;  5CZ1 A;  4M3Z A;  4XIU A;  1XWL A;  4E0D A;  4J2D A;  2YHA A;  1BIZ A;  2OPP A;  4KV8 A;  1SKR A;  4Z4C A;  1UWB A;  4F8R A;  4FJJ A;  2XRI A;  5JS1 A;  3MEG A;  3QO9 A;  1FXX A;  1RBR A;  1TL1 A;  3OS1 A;  1S9E A;  1D9F A;  2O4G A;  3DRR A;  4HCB A;  4QOZ B;  4PA1 A;  3K5O A;  1N6Q A;  1RDD A;  2NUB A;  3PUF A;  1ASV A;  4AIL C;  1C6V A;  3HVT A;  1C0T A;  3HL8 A;  1UA1 A;  3MED A;  4KHN A;  3H08 A;  3LAN A;  2HHT A;  3L8B A;  1W0H A;  1HYS A;  4CJL A;  1JLF A;  3DYA A;  1FKO A;  1WAJ A;  3K58 A;  1NK0 A;  4I9L A;  2Y1I A;  5HRO A;  3QIN A;  1TKZ A;  3HPH A;  3NE6 A;  1ZBL A;  4CEQ A;  1NOY A;  2OZS A;  1TV6 A;  2Y1J A;  4AHC A;  5DK5 A;  5HRR A;  4B8A B;  1U48 A;  3CFO A;  3V1R A;  5CYQ A;  2WOM A;  4RW7 A;  2HNZ A;  1NK5 A;  4IFY A;  2RF2 A;  3M8Q A;  1NOZ A;  2BE2 A;  1ZBH A;  3OYG A;  3KLG A;  4FJ5 A;  4TSX A;  2ZE2 A;  3CFP A;  3I8D A;  3V9Z A;  3QNO A;  2GBZ A;  2YHB A;  2Z1G A;  1WSE A;  4DLG A;  3QER A;  4KHW A;  3C6T A;  1QHT A;  1VSI A;  2OPR A;  3P5J A;  4LH5 A;  1KRP A;  4C8O A;  4M3X A;  1S5J A;  3TAP A;  1J5O A;  1NK9 A;  5SWM A;  4DTN A;  4N41 A;  3CQ8 A;  4NCB A;  3VN5 A;  4CE9 A;  1QSL A;  4E7H A;  4GMJ B;  3AA5 X;  4CER A;  3TAF A;  4B9S A;  1ASU A;  4CHY A;  1T05 A;  4IG3 A;  4KI4 A;  5CYM A;  1CZB A;  1B9F A;  4H8K A;  2BDP A;  3PO4 A;  3NAE A;  1IO2 A;  1JLC A;  4BE1 A;  2QXF A;  4DTP A;  1Q9X A;  4Z4H A;  4M3W A;  2HHU A;  3L3V A;  1S1T A;  3PX4 A;  1QSS A;  2VWK A;  4CEB A;  4CJP A;  3L2R A;  2I5J A;  3NGI A;  4CGD A;  4FLZ A;  3SQ1 A;  4NCA A;  3AVG A;  4PQU A;  4R5P A;  3ZT2 A;  1B92 A;  1DTQ A;  3DOK A;  4OPJ A;  2E6M A;  2A1R A;  3C94 A;  3VQ8 A;  3OS2 A;  4KHU A;  4IBN A;  3NGY A;  4AHU A;  3MXM A;  1L3S A;  4B9U A;  2F8T A;  1HJR A;  5KGX A;  3OYK A;  2QKB A;  2HHW A;  4K8X A;  1C0M A;  4CJ5 A;  4B9T A;  3KK1 A;  2IOC A;  1A5X A;  3OJU A;  1KVB A;  4W5Q A;  4FJ9 A;  3TAQ A;  3WNH A;  3HP6 A;  1LAW A;  2KZM A;  2JGU A;  1KFD A;  3VQ4 A;  3VQD A;  4CHZ A;  4CJ4 A;  4AHV A;  3TAR A;  2Z1I A;  1L3U A;  1JLB A;  3KKS A;  4BE0 A;  1RDB A;  2IC3 A;  4CJU A;  3HPO A;  4HUG A;  1XHZ A;  1UAX A;  3IRX A;  3MAQ A;  1KCF A;  3U3Y A;  3LP2 A;  1NK4 A;  4KB0 A;  1GOB A;  1YT3 A;  5C24 A;  3KJV A;  5HRN A;  3WNE A;  4F3T A;  1O1W A;  3AVL A;  1EP4 A;  1GOA A;  4FCY A;  1RDC A;  4Z0U A;  4CHN A;  4DLE A;  4E7I A;  2G8I A;  4O55 A;  4JS4 A;  4C8L A;  1X9M A;  3CM5 A;  3QEI A;  1JLA A;  1KSP A;  3A2F A;  4CEE A;  1NK6 A;  3T3F A;  3EYZ A;  1ITG A;  1BCM A;  2G8F A;  3G10 A;  3SYZ A;  3OYC A;  4OKK A;  4CF9 A;  1BCO A;  3K5M A;  1HQU A;  2E4L A;  1ZYQ A;  1BHL A;  3AVI A;  4FYD A;  3U6F A;  1UOC A;  5FRM A;  4CGI A;  1SKS A;  2G8H A;  4CIF A;  3ZT0 A;  3ITH A;  1VSH A;  2ITG A;  4DQR A;  4IG0 A;  3THV A;  1VSE A;  2KW4 A;  3CM6 A;  4CEZ A;  4BAC A;  3QNN A;  4F4K A;  1Y97 A;  1JXE A;  4DSJ A;  4FJ8 A;  3AA2 A;  2HHQ A;  3ZSY A;  3L3U A;  3MXJ A;  3F73 A;  4BDY A;  3VQ9 A;  2YNG A;  4F2S A;  2KFZ A;  3OS0 A;  1I3A A;  1CLQ A;  4FJN A;  4CCH A;  3ISN C;  4FLT A;  1Q8I A;  2XY7 A;  4N5S A;  4FJM A;  2KQ2 A;  3FFI A;  2IAJ A;  2VG6 A;  5DMR A;  4C8M A;  1TKX A;  3WNF A;  3M8S A;  3TAM A;  3RTV A;  1RIL A;  3MXI A;  5J1E A;  1VRU A;  1WSI A;  1ZBF A;  2RPI A;  1XC9 A;  4E19 A;  2HHV A;  1JLQ A;  1LAV A;  3OYL A;  2OZM A;  3TR8 A;  3KIO A;  2KFN A;  4CFA A;  2RN2 A;  4DSF A;  1L3V A;  3RRH A;  2GV9 A;  4PWD A;  2D5R A;  1S1V A;  2DFF A;  1EET A;  2Z1J A;  5I3U A;  2ATQ A;  3QIO A;  3AVJ A;  1F21 A;  1CXQ A;  4DS4 A;  3SI6 A;  2EX3 A;  3SV3 A;  1JKH A;  1WSF A;  3V1O A;  4E1M A;  1LV5 A;  2PZS A;  4N76 A;  3TAN A;  4OLA A;  3QIP A;  2DTU A;  1SL1 A;  4CF1 A;  4H4O A;  3D45 A;  4CEC A;  3PV8 A;  3OYA A;  3OYN A;  3L2V A;  4CFB A;  4FK0 A;  4M3T A;  5J2N A;  4RG8 A;  3DI6 A;  3VA3 A;  1JL1 A;  1X9W A;  5HRP A;  3AVC A;  4M42 A;  1G15 A;  2X6S A;  2ETJ A;  4B9L A;  1KLM A;  4B8C A;  2X6N A;  4O5B A;  3HT3 A;  4OGE A;  3VQA A;  3SUN A;  1RT5 A;  4M45 A;  2B5J A;  3UIQ A;  3S3O A;  3TWH A;  5KTQ A;  1HNV A;  3RMA A;  4FW2 A;  3RRG A;  5E41 A;  2HVH A;  4B3O A;  1TKT A;  4Q5V A; 
#chains in the Genus database with same CATH topology
 3OBW A;  2O8C B;  4DTX A;  1EX4 A;  1GOC A;  3VGL A;  3AO2 A;  3AVH A;  3LP3 A;  3VQQ A;  3W3D A;  3AVA A;  2ZQB A;  1BQN A;  4JD2 A;  1GLL O;  5ELZ A;  2HB5 A;  3EY1 A;  4W5T A;  1TKD A;  1BGX T;  4KH4 A;  5LJW A;  1NK8 A;  2KTQ A;  3D7E O;  2O8D B;  4FWN A;  1RBU A;  3BEX A;  3M3Z A;  4DUZ K;  4Z4G A;  1VQN N;  1S6P A;  3IMX A;  4JKH A;  4CFD A;  3E01 A;  2F4V K;  1VSJ A;  1IKV A;  2W40 A;  4KHS A;  5JLF A;  2X78 A;  2P9P A;  2FBT A;  4FZZ A;  4DR5 K;  4JHD A;  3M8R A;  2KZZ A;  1RT3 A;  4HUF A;  2QTD A;  4DB3 A;  2PYL A;  3QFP A;  4JI5 K;  4NO7 A;  3VET A;  3F9K A;  4Z4E A;  2NRH A;  3P83 D;  3Q7B A;  3UB5 A;  3NH0 A;  5GAE P;  1RTJ A;  2Q36 A;  4YOR A;  4DFP A;  2YJE A;  3DLE A;  3ATU A;  1WSG A;  4RWT A;  2HBM A;  4BGB A;  4A62 A;  4CF8 A;  3CIP A;  2P5O A;  2G8W A;  5HOO A;  3BZK A;  4FWQ A;  4FJH A;  4DSE A;  1CXU A;  3CCQ N;  3IUC A;  1VSL A;  4CHO A;  2P9I B;  5FRO A;  4J2B A;  2QKK A;  4GV9 A;  5F2R A;  3EZ5 A;  4X66 K;  4CHQ A;  4GV3 A;  3MN6 A;  2P9L B;  1LWC A;  1MU2 A;  4JKF A;  3EEQ A;  3KKR A;  1NJX A;  4OVL A;  4PUO A;  4OKE A;  2ASM A;  3L2W A;  3SUP A;  3FZL A;  3U9Z A;  3PO5 A;  1HMV A;  4DTO A;  5J2Q A;  4BQL A;  1HPZ A;  3KD5 E;  4FWM A;  3ZX3 A;  1G99 A;  1Y64 A;  1X3N A;  1HKB A;  4FJG A;  4CJQ A;  4OPA A;  2QXL A;  1S6Q A;  3SBT A;  3VQB A;  4ELT A;  1D9D A;  1ZBI A;  3H1Q A;  3LWM A;  4DR1 K;  5AZJ B;  4WFN L;  4LY7 A;  3QIC A;  1EKE A;  2O8B B;  4EHT A;  1FJG K;  3VGM A;  3CPE A;  1JCE A;  4PKI A;  3T19 A;  5GIN A;  1NK7 A;  1LWF A;  2XO7 A;  4H5N A;  4BWJ A;  1UA0 A;  4W5N A;  2YKN A;  1EXQ A;  2P9L A;  4F3O A;  4KTQ A;  1LOT B;  3HTV A;  3QDK A;  1XMO K;  3MX5 A;  5FPN A;  2OYQ A;  2FLO A;  3WEE A;  2CGL A;  2OTJ N;  1YUW A;  2HHS A;  4JKB A;  3NF8 A;  4HCC A;  3G6E N;  1YTU A;  2DFH A;  2GUP A;  2QWQ A;  3MCA B;  1NJW A;  3VTH A;  1QTM A;  5AQO A;  5C42 A;  1KLN A;  1QE1 A;  3CG7 A;  3NDK A;  4ELU A;  2GX9 A;  4Y1C A;  3KLI A;  3OYH A;  1SZ2 A;  3CCJ N;  1HNW K;  3DXM A;  4NXM K;  3J7A P;  3J81 O;  1TYQ A;  5J2P A;  4KPY A;  1ILY A;  4BVO A;  5AZJ A;  3D2E B;  3WXK A;  3MX2 A;  5CE3 A;  3OW2 M;  3CHW A;  3CC2 N;  3CC4 N;  1ZC6 A;  3HSC A;  1LCU A;  4CEO A;  2IVO A;  1VRT A;  4LF5 K;  4CI6 A;  1RTD A;  5BPM A;  2IDO A;  1D8Y A;  3P4I A;  2V7Z A;  4CD3 A;  4CGH A;  1P8Z A;  3S3N A;  5AFU A;  5BR8 K;  3O3F A;  2OA8 A;  3AVN A;  3KVG A;  2P9S B;  3A5N C;  2AA4 A;  2D0O A;  4JRQ A;  4A2A A;  3AA3 A;  3W0L A;  4I9Q A;  2WC9 A;  3KK7 A;  3TTC A;  4CJS A;  4CJR A;  1CZ9 A;  1QVF M;  5AQN A;  1HNI A;  3TAB A;  4B08 A;  3V1Q A;  3MWP A;  1RBT A;  4K43 A;  3NH2 A;  4ZTF A;  1Z6R A;  5LJV A;  3CXC M;  1EO1 A;  2UUC K;  2VWJ A;  4FJK A;  1QQN A;  3VEZ A;  2E1Z A;  4FK2 A;  4JN4 A;  4K42 A;  3SUQ A;  4DTR A;  2G8V A;  3QML A;  4DV2 K;  3F9M A;  2FSJ A;  3R3L A;  4ILJ A;  4EP5 A;  1BA0 A;  2EWS A;  4K25 A;  3OYD A;  5AR0 A;  3I8B A;  3KTQ A;  4H0O A;  4DS5 A;  3SJH A;  2P9S A;  3OYB A;  1ATN A;  4JKG A;  2P9U A;  4C8N A;  1HLU A;  3ID8 A;  3UKR B;  2VGN A;  3SCX A;  2Q3S A;  4M3Z A;  4XIU A;  2Q0U A;  4E0D A;  1BIZ A;  3EL2 A;  2OPP A;  5KPR A;  4Z4C A;  1ATR A;  4FSV A;  1D9F A;  1TL1 A;  4QCL A;  3WXI A;  1N6Q A;  1RDD A;  4K0K K;  3J8A A;  4AIL C;  1C6V A;  1UA1 A;  4BR9 A;  3SAH A;  4QS9 A;  2E2O A;  4B1X B;  3K58 A;  4GVE A;  2HST A;  1NK0 A;  4I9L A;  2VQE K;  4LF4 K;  4IO9 L;  4CEQ A;  3CCR N;  2Y1J A;  5HRR A;  4CBU A;  5CYQ A;  2WOM A;  3UKU B;  5LL6 Z;  4G9Z A;  3OYG A;  5KPZ A;  4DLG A;  3QER A;  4FWO A;  1VSI A;  4C8O A;  1OVY A;  2A6A A;  4YOW A;  4GMJ B;  3TAF A;  4CHY A;  1T05 A;  1B9F A;  3M6G A;  3PO4 A;  1JLC A;  4X64 K;  2ZF5 O;  4BE1 A;  1Q9X A;  2W41 A;  3O08 A;  3VEX A;  1NBW A;  4UY8 O;  5AQS A;  4CEB A;  1VQP N;  3L2R A;  3ZET A;  4BRO A;  2GTD A;  5AQX A;  1S72 N;  3VQ8 A;  3MXM A;  2F8T A;  2FSN A;  4NB4 A;  5FLX O;  2V52 B;  1KVB A;  3TAQ A;  3K9J A;  1LAW A;  2KZM A;  1XC3 A;  1KFD A;  3VQ4 A;  3VQD A;  4CJ4 A;  4AHV A;  3KKS A;  3WXM B;  1RDB A;  4CJU A;  3UKU A;  2KLA A;  1UAX A;  4CZF A;  4WF9 L;  3LP2 A;  1GOB A;  3G71 N;  1YT3 A;  3KJV A;  4C23 A;  3WNE A;  4F3T A;  1EP4 A;  1RDC A;  3O8M A;  4YOU A;  5AQM A;  1YJN N;  4JS4 A;  3QEI A;  3CJ7 A;  2ZWH A;  2HF4 A;  2P9N A;  3PSF A;  3G10 A;  3OYC A;  4CF9 A;  3AVI A;  3ENO A;  2ZJP L;  3U6F A;  5CHI A;  1SKS A;  3N4P A;  2G8H A;  2F7T A;  4Z94 A;  4WQ4 C;  2ITG A;  3G4S N;  3FZM A;  1VSE A;  3WUH A;  3DXK A;  1QHA A;  3OA9 A;  1NJI O;  4F2S A;  2KFZ A;  1I3A A;  4CCH A;  3ISN C;  5BR9 A;  1Q8I A;  1VQ5 N;  2ITM A;  4FJM A;  4C8M A;  4OPH A;  5DMR A;  1TKX A;  3MXI A;  3MN9 A;  3TAM A;  1KD1 O;  4C1N K;  1WSI A;  4CZL A;  2RPI A;  3VEO A;  1XC9 A;  3FZK A;  2OZM A;  3WXL A;  4CFA A;  5AFU H;  4DSF A;  4PWD A;  1EET A;  2JWL A;  4DV1 K;  4H0X B;  3AVJ A;  1KQS M;  3MK6 A;  4DS4 A;  4CJ7 A;  3QIP A;  3CF5 L;  3PV8 A;  3OYN A;  3L2V A;  4FK0 A;  1RFQ A;  3DI6 A;  3HOS A;  3AVC A;  4FO0 A;  3BUZ B;  3P39 A;  2V7Y A;  2ETJ A;  5IWA K;  4B9L A;  2X6N A;  1QQO A;  3A8Y A;  4OGE A;  3VQA A;  3HT3 A;  1RT5 A;  2NRZ A;  3RMA A;  3ID6 A;  4FW2 A;  5AQR A;  2FSK A;  5F0X A;  3CJ1 A;  3GG4 A;  3S3M A;  1NGJ A;  4KBO A;  4FPB A;  5KRS A;  3BY5 A;  1ASW A;  4EIA A;  4CGJ A;  3ZSZ A;  3TI0 A;  4DWI A;  2YNI A;  1EQY A;  3DM2 A;  4PL8 A;  4EAH D;  1SQK A;  4E7L A;  3NF6 A;  1Q81 O;  3AO5 A;  4XH5 A;  4L8R B;  1HYZ A;  3CQX A;  4BRM A;  3PX6 A;  4DQI A;  3O9U A;  2O8F B;  5FPD A;  1RBV A;  3SQ0 A;  2AP1 A;  2E2Q A;  4JRP A;  3R1X A;  4BGA A;  3NF9 A;  3THX B;  4BC2 A;  4FZX C;  3IS9 A;  4AM6 A;  4DTU A;  4WQ4 A;  4B1Z A;  2IIR A;  2CGJ A;  3TSP A;  4FLU A;  1NJY A;  3G25 A;  4M63 C;  4G1Q A;  1VQ7 N;  4YHH K;  1ESV A;  3OVN A;  2OPQ A;  3LM9 A;  2E2P A;  1NWK A;  3O9S A;  4FJI A;  1JCG A;  3FR0 A;  4YFU A;  4DR4 K;  4DU3 A;  3WT0 A;  3OYM A;  1U49 A;  3SUO A;  2HW3 A;  2KHO A;  3JXU A;  1VQM N;  3U3G A;  4CED A;  3QBW A;  4K41 A;  3T1A A;  4FM1 A;  5LY3 A;  3SLC A;  5J2M A;  3H45 C;  5HRS A;  3O9R A;  1KAX A;  3VQE A;  1WBB A;  2YCH A;  1WAF A;  4DV3 K;  4DG1 A;  4FLW A;  1TK5 A;  3GOI A;  1SV5 A;  4DU1 A;  1TK0 A;  2O8F A;  1KVA A;  4JI2 K;  1RNH A;  4H4M A;  2ZJR L;  4FL9 A;  2D0P A;  1WBD A;  3NF7 A;  4DTS A;  4KKO A;  4KH6 A;  1U6Z A;  2D0C A;  3RVC A;  3RWU A;  1D5A A;  4ILG B;  4QAG A;  3SMP A;  3S41 A;  4FW1 A;  5CZ2 A;  3VQP A;  4W5O A;  4N56 A;  2UUB K;  1IBM K;  4ELV A;  3CJC A;  1A5W A;  4WE1 A;  1NKE A;  2JWK A;  1WLJ A;  3DLG A;  4DR3 K;  4FJL A;  5AQL A;  4DQS A;  4RTF D;  3VER A;  4RW8 A;  1C0U A;  1YVU A;  5EVZ A;  4FOE A;  1U4B A;  1WB9 A;  2P5G A;  1NGE A;  3ZT4 A;  4YOV A;  4MLE A;  3HO1 A;  3V4I A;  1NGG A;  2X74 A;  3CCS N;  1QZ5 A;  2LSN A;  4FPA A;  1T7P A;  3VEN A;  2UUA K;  2FBX A;  3K5L A;  3QES A;  4KAZ A;  3HK2 A;  5EX5 A;  3LAM A;  2BUP A;  3O3H A;  5AQI A;  1RT4 A;  4BWM A;  3I0R A;  1RGI A;  1IKW A;  4JI6 K;  3ZSQ A;  4HWI A;  1LW0 A;  1VQ4 N;  2QK9 A;  3OYE A;  1BA1 A;  2QW9 A;  3P31 A;  3ULD A;  1NKC A;  4IFV A;  3ZX2 A;  3NGZ A;  3O4N A;  4MLH A;  2P1J A;  3L4Q A;  3OYI A;  3WXJ A;  4I7F A;  4OKJ A;  2W6L A;  5JVG L;  3AVK A;  4FK4 A;  1J6Z A;  4BRD A;  4J2A A;  3VA0 A;  4E7K A;  1TAQ A;  4E1J A;  3NBP A;  4B9V A;  1S9G A;  4H5R A;  5HLF A;  3HP9 A;  4I6M B;  4JS5 A;  1MWK A;  4OGC A;  3R6M A;  1IV0 A;  4Z4F A;  1N8R O;  4CJK A;  3OJS A;  4BDZ A;  3LZJ A;  4GKK K;  3I33 A;  4FWP A;  1RT7 A;  4ID5 A;  1BOT O;  5BRH A;  4K8Z A;  3JSM A;  4KRE A;  5BPN A;  2UXB K;  1WN7 A;  2EHG A;  1N34 K;  3EZW A;  4B9Q A;  3JAM O;  2O8C A;  4M3R A;  1X1P A;  4LSL A;  3C6H A;  4DSI A;  3P38 A;  3C6A A;  1TVR A;  5K14 A;  4YDU C;  2YJF A;  3C7N B;  3SQ2 A;  3PIP L;  2OPS A;  2WBN A;  3O9Q A;  3QEW A;  4H0V B;  4BDP A;  1C1C A;  4MFB A;  1DGK N;  1GLA G;  4DV7 K;  1T3V A;  1QVG M;  1K8A O;  1U47 A;  3CQY A;  5AQJ A;  3B6P A;  5AQG A;  4LF9 K;  2O8D A;  1BWF O;  3SZ2 A;  4GVM A;  3DAW A;  1TK8 A;  3K5N A;  3V6D A;  1WSH A;  1NGI A;  3SMS A;  4BG8 A;  3JS6 A;  4DR7 K;  4CJV A;  2NNW A;  3V9U A;  4JLH A;  1DTT A;  3I0S A;  4IKF A;  4DU4 A;  5KPT A;  3E9L A;  2HHH K;  3LDS A;  4HUE A;  1NKB A;  1IKY A;  1NU0 A;  3DJC A;  5FRN A;  4IDH A;  5JS2 A;  3OYF A;  3RSE B;  4LFA K;  1M90 O;  2PBD A;  4ILH A;  4B1W B;  3K0S A;  1HQE A;  4RW6 A;  3OYJ A;  1U2V B;  3K9K A;  3HJF A;  1U45 A;  4NCG A;  4DFK A;  3F2K A;  3CCM N;  4CBW A;  3C7N A;  1JLG A;  3UE5 A;  4M3U A;  4N47 A;  1VAZ A;  3T7Z A;  3NCI A;  1QSY A;  3LL3 A;  3ZSO A;  3NHG A;  4PHT X;  2YV0 X;  2P9I A;  5AQH A;  3THY B;  1K73 O;  4BRK A;  1J5E K;  3O9T A;  1XWL A;  3CCL N;  2YHA A;  1SKR A;  1UWB A;  4BRH A;  3T1H K;  1FXX A;  1RBR A;  1S9E A;  4QOZ B;  2O4G A;  3K5O A;  2A42 A;  5GAG P;  4KHN A;  3H08 A;  1W0H A;  3ZYY X;  1JLF A;  3DYA A;  3OBY A;  2Y1I A;  4YY3 K;  1ZBL A;  1TKZ A;  3HPH A;  3NE6 A;  2OZS A;  1T44 A;  3B8A X;  4YDU A;  2P9K B;  5DK5 A;  1U48 A;  3V1R A;  4IFY A;  2PFU A;  1NOZ A;  4FJ5 A;  4TSX A;  3CFP A;  3I8D A;  4DKW A;  2Z1G A;  1WSE A;  2IVP A;  3EE9 A;  4KHW A;  1KRP A;  1XMQ K;  1S5J A;  1YXQ A;  5CR4 A;  3TAP A;  4N41 A;  1NK9 A;  4F9O A;  2Q1N A;  3AA5 X;  5GIO A;  2GEL A;  5CYM A;  1CZB A;  5EOY A;  4NLC A;  1YI2 N;  3VGK A;  4MDA A;  3NAE A;  1C0F A;  2O8B A;  2A3Z A;  5H1S Q;  5BRF A;  2ZM6 K;  1I94 K;  3DLL L;  4Z4H A;  5E84 A;  3PX4 A;  4DV6 K;  2VWK A;  4FLZ A;  3SQ1 A;  5AQW A;  4PQU A;  4R79 A;  5A2Q O;  1B92 A;  2A1R A;  3OS2 A;  4IBN A;  4DV4 K;  4NLB A;  4AHU A;  1HJR A;  2YHY A;  2QKB A;  2HHW A;  4BR0 A;  2IOC A;  3OJU A;  3SAG A;  5EY4 A;  1W97 L;  2P9K A;  5FPM A;  3TAR A;  2Z1I A;  1JLB A;  3CJ9 A;  3HPO A;  4HUG A;  3R8E A;  1XHZ A;  3IRX A;  1NK4 A;  4FOI A;  5C24 A;  5HRN A;  2VQF K;  2G8I A;  4CHN A;  2E20 A;  4O55 A;  3VOV A;  1JLA A;  2YHX A;  5GAD P;  2DPN A;  2ASO A;  4KH5 A;  3SYZ A;  4WCE L;  2YI1 A;  1ZYQ A;  3AGR A;  3D2E A;  1Q18 A;  1BUP A;  4DV5 K;  3LM2 A;  3HZ6 A;  3O4W A;  5TKY A;  2KW4 A;  3WQU A;  4BAC A;  4BC3 A;  4F4K A;  1JXE A;  2F9W A;  4A57 A;  2HHQ A;  3F73 A;  4BDY A;  2NZT A;  4PL7 A;  1CLQ A;  3KWI A;  4FLT A;  2XY7 A;  3L6Q A;  4N5S A;  3O6W A;  2KQ2 A;  3VEY A;  3C65 A;  3M8S A;  2YHW A;  3RTV A;  1K9M O;  2HHV A;  4E19 A;  4BR7 A;  1JLQ A;  1HNX K;  5AQU A;  5AQZ A;  2KFN A;  1L3V A;  3RRH A;  4BRQ A;  2D5R A;  2NRW A;  5I3U A;  3ZLJ A;  2EX3 A;  2WUS A;  5ADX A;  1WSF A;  4E1M A;  1LV5 A;  2PZS A;  5M1O A;  4WFA L;  4JKE A;  4CF1 A;  3SAF A;  3D45 A;  3ULE B;  4CEC A;  5J2N A;  4NXN K;  4JI7 K;  1X9W A;  4JI3 K;  1W2B M;  4O5B A;  3SUN A;  4M45 A;  2B5J A;  3S3O A;  3QBX A;  3TWH A;  1HNV A;  5E41 A;  4B3O A;  3L2Q A;  3MN5 A;  4JNE A;  4FLX A;  3RR7 A;  1H1V A;  4WYB A;  3HBT A;  4M7Y A;  1REV A;  3QB0 A;  2HMP A;  3CER A;  5BRD A;  3TAG A;  4LH4 A;  4BRL A;  3VMF B;  3VQ6 A;  3L2U A;  4AHR A;  4M41 A;  3TTD A;  3ZT1 A;  3UKR A;  1K8K B;  4KFB A;  3LP1 A;  1GLJ O;  3HOT A;  3ZSW A;  4C8K A;  4LF7 K;  4FVU A;  1A5V A;  4GKJ K;  1VSM A;  3MWT A;  2G8U A;  2E88 A;  1HUX A;  3JYT A;  1VQO N;  3VF2 A;  3IAY A;  4GY2 B;  4KO0 A;  3ULE A;  3SPY A;  2AJQ A;  4A5B A;  1Q9Y A;  1YTA A;  5JIC A;  4JKC A;  5E26 A;  4E89 A;  1NGC A;  1R0A A;  2GUI A;  4XH4 A;  4CZE A;  3KWG A;  1M1K O;  4A5A A;  4JYA K;  3HM9 A;  1VSF A;  2NRT A;  1RBS A;  3KLH A;  3K57 A;  3BGR A;  2A5X A;  3ZX0 A;  3KK3 A;  4AHT A;  2FBV A;  4Y0W A;  4BRF A;  2RKI A;  4Y1D A;  4CK2 A;  1BDG A;  4FWL A;  1OH5 A;  3DRP A;  1BI4 B;  4ISE A;  2FF3 B;  4CJF A;  1E4G T;  3LPT A;  4XEI A;  4B1V A;  5EXW A;  3SNN A;  4PKG A;  2QWM A;  2HVI A;  1IH7 A;  2I7N A;  4L3Q A;  3ZCM A;  4ZTJ A;  2P51 A;  1WNS A;  3LAK A;  3QLH A;  2GWK A;  3DRS A;  4KRF A;  2RE2 A;  1K8K A;  4E1N A;  2W42 A;  4KTW A;  2PYJ A;  1BIU A;  3AGK A;  3ZSV A;  2F8S A;  3H1V X;  2NRR A;  3VF4 A;  2F9T A;  3OY9 A;  1OH7 A;  1XNR K;  4X62 K;  2VWB A;  4DFM A;  4EP4 A;  3CET A;  4AM7 A;  4LSN A;  1T8E A;  1L3T A;  2WON A;  4O8K A;  5CY4 A;  4EFH A;  3FLC O;  4DQP A;  4KHQ A;  3IDH A;  3HST B;  3SQ4 A;  4EHU A;  5JVH L;  4KB1 A;  2QWN A;  3THW B;  4IDK A;  4CJW A;  4PY5 A;  1DT9 A;  3LP0 A;  1HJO A;  3LWL A;  4CEF A;  3CCE N;  3CYM A;  2HOE A;  5DM6 L;  1SL0 A;  1NM1 A;  3IG1 A;  2R7Y A;  1GLC G;  1JLE A;  1I39 A;  3H46 O;  2OCE A;  3LPU A;  4UQG A;  1X9S A;  4CZG A;  1TGO A;  5I42 A;  4JV5 K;  2FBY A;  3TAE A;  3B6O A;  3HXM A;  4ID1 A;  1NNE A;  4ZHR A;  3AA4 A;  1RTH A;  5KI6 A;  3TSU A;  3DLK A;  1LWE A;  2CH5 A;  2E6L A;  3LZI A;  5HBM A;  3MEC A;  1VK0 A;  1J9A A;  4IEE A;  4H0Y B;  4X65 K;  3NH1 A;  3AVM A;  4A61 A;  4CES A;  3SJJ A;  1OH8 A;  3WQT A;  5AQK A;  3LAL A;  5KGW A;  3HI0 A;  3Q7C A;  1YJ9 N;  1ZXO A;  3GBT A;  2HBJ A;  1S1W A;  5ADX H;  1W9H A;  1IKX A;  2E1Y A;  4KTZ A;  3QEP A;  1J54 A;  1NJZ A;  4H03 B;  4B9N A;  4B9M A;  2DFE A;  3AVB A;  2QI2 A;  3BDP A;  3I56 N;  2VG5 A;  1HR0 K;  1VHX A;  2YNH A;  4DFJ A;  2NRV A;  4CD1 A;  1JL2 A;  2XY5 A;  2D0A A;  3VQ5 A;  1SS6 A;  3P1G A;  3LDQ A;  4JK7 A;  2FXU A;  1ZBU A;  3L0Q A;  4DF8 A;  1BIS A;  1CZA N;  3T1Y K;  2XY6 A;  4JI4 K;  3U4L A;  1HYV A;  2JLE A;  3FFK B;  1V4S A;  2IGI A;  3ZSX A;  3L4I A;  4KHY A;  1Z26 A;  4FLY A;  5LMU K;  1IBK K;  1NG9 A;  4DMN A;  1KXP A;  5T7B A;  3HM8 A;  3VQ7 A;  5AZI B;  4DCH A;  2BAN A;  3ZT3 A;  3QET A;  3THX A;  5IT9 O;  3KD1 E;  1N33 K;  4ISG A;  1RCH A;  5C12 A;  3DOL A;  2I7P A;  1O13 A;  3KLE A;  4B3R K;  4FLV A;  2IVN A;  1HX1 A;  4DTJ A;  2QWR A;  1S1U A;  4YOX A;  4CW7 B;  1MA9 B;  5KQD A;  4CZJ A;  4RCH A;  4CF2 A;  2D4W A;  3G0Z A;  3O4Q A;  3S9H A;  3QEX A;  3D0P A;  4GNI A;  4FWK A;  3AAP A;  4DTM A;  4JD2 B;  3TTF A;  1JXB A;  3LDL A;  1WSJ A;  4LC9 B;  3MCP A;  5C2D A;  1BL3 A;  2HNY A;  4DQ8 A;  3EO3 A;  3CCU N;  3WNG A;  4CEA A;  3RMC A;  3J7Z O;  3V81 A;  4CGG A;  1IG8 A;  1HRH A;  3ENB A;  1B9D A;  2GEM A;  4JI1 K;  4KV8 A;  2NLX A;  5JS1 A;  2XRI A;  3QO9 A;  3OS1 A;  4H5T A;  3H3O B;  1ASV A;  3HVT A;  3HL8 A;  4JHD B;  2HHT A;  3MED A;  1S3X A;  1NMD A;  1S22 A;  4CJL A;  2CGK A;  1WAJ A;  5BN9 A;  5HRO A;  4LFB K;  3QIN A;  1NOY A;  1GLE G;  1TV6 A;  3FE1 A;  4AHC A;  1Q7Y O;  1D4X A;  4B8A B;  3CFO A;  4RW7 A;  1NGF A;  2HNZ A;  1Q86 O;  1HNZ K;  3V9Z A;  3QNO A;  3O1B A;  1WOQ A;  1YIT N;  1QHT A;  2OPR A;  3P5J A;  3NMU A;  4BRE A;  1DEJ A;  5SWM A;  4DTN A;  3CQ8 A;  4NCB A;  3VN5 A;  4CE9 A;  4E7H A;  4CER A;  4B9S A;  4IJA A;  4KI4 A;  3TU5 A;  2BDP A;  1T6D A;  1YJW N;  1IO2 A;  5BN8 A;  1IJJ A;  2UYT A;  4M3W A;  1QSS A;  4NCA A;  4CGD A;  1VQ8 N;  4R5P A;  3ZT2 A;  1RDW X;  4OPJ A;  2A40 A;  3C94 A;  4KHU A;  2Q2R A;  5AQQ A;  3NGY A;  4CZH A;  3OYK A;  3PSI A;  4CJ5 A;  4B9T A;  3KK1 A;  4IFE A;  3WNH A;  2QWL A;  2ASP A;  2JGU A;  4CHZ A;  4BE0 A;  4A59 A;  3MAQ A;  3U3Y A;  1O1W A;  1GOA A;  4DLE A;  4Z0U A;  3VPZ A;  3CM5 A;  3M5R A;  3N4Q A;  1KSP A;  3A2F A;  3T3F A;  1ZBS A;  4JI0 K;  4I6M A;  3KZB A;  4WFB L;  1BCM A;  4IWV A;  2G8F A;  4OKK A;  1BCO A;  1HQU A;  2E4L A;  3AAQ A;  4BRG A;  3VEW A;  1UOC A;  4CGI A;  3ZT0 A;  1VSH A;  3SBG A;  4DQR A;  3VF6 A;  3THV A;  2D1K A;  5GAH P;  3CM6 A;  4CEZ A;  3QNN A;  1Y97 A;  4MO4 A;  4DSJ A;  3AA2 A;  3CJB A;  3ZSY A;  3L3U A;  2RHK A;  3MXJ A;  1VQ6 N;  2YNG A;  5KQ8 A;  1P90 A;  3OS0 A;  4BC5 A;  3O5B A;  3WEE B;  1KC8 O;  2UU9 K;  1RIL A;  4IOX A;  1VRU A;  1ZBF A;  1LAV A;  3OYL A;  3FZH A;  3FGU A;  2RN2 A;  3A5O C;  1S1V A;  4BRC A;  1YHQ N;  2Z1J A;  1XNQ K;  3EN9 A;  1F21 A;  1CXQ A;  1HKC A;  3SI6 A;  3SV3 A;  4OLA A;  4BRA A;  2DTU A;  1SL1 A;  4H4O A;  2ZGZ A;  3GE1 A;  3OYA A;  4OX9 K;  3DXM B;  1TYQ B;  4RG8 A;  2WFB A;  3VA3 A;  1G15 A;  1NGD A;  4B8C A;  2UXC K;  2CH6 A;  3UIQ A;  3E66 A;  2HVH A;  4PKH A;  1TKT A;  3RSE A;  4Q5V A;  1LW2 A;  3AV9 A;  3V9X A;  4RW9 A;  2VYP A;  3C6U A;  4MO5 A;  5M1P A;  4YNQ A;  1U2V A;  4O44 A;  4CFC A;  3ZEU B;  4O0J A;  2Q31 A;  5FDL A;  2F96 A;  5AQV A;  1DKG D;  1J53 A;  3DLB A;  1FKP A;  4I2P A;  4CZI A;  1RDA A;  4O5F A;  4M7X A;  4LFC K;  4CF0 A;  2HHX A;  3V9S A;  1T03 A;  3THY A;  4JKD A;  3ATV A;  3VES A;  4LD0 A;  3BF3 A;  1QQC A;  1XHX A;  1IG9 A;  1RTI A;  3GDQ A;  2HND A;  4DR6 K;  1Z25 A;  4BE2 A;  4FM2 A;  3NFA A;  1Z05 A;  4BRN A;  3PIO L;  1S1X A;  4O8U A;  5I9E B;  1N5Y A;  1GLD G;  4FWR A;  4BR4 A;  1V4T A;  3RMD A;  2QWP A;  4DSL A;  4RW4 A;  4HHT A;  5HL7 L;  4DR2 K;  4FJ7 A;  3M8P A;  2PAV A;  1SL2 A;  1QZ6 A;  4ICL A;  3LDO A;  3CPW M;  4HTU A;  3I55 N;  3C0B A;  4FM0 A;  4E7J A;  3SPZ A;  4QS7 A;  4OJR A;  1RT2 A;  2HBK A;  3ZEU A;  3RR8 A;  3A5M C;  1ATS A;  3SV4 A;  2ZJQ L;  2D0B A;  2B4J A;  1OKJ A;  4JKG B;  2P9U B;  3J80 O;  1VQ9 N;  1X3M A;  3CME N;  2BTF A;  1KTQ A;  4AHS A;  4BVP A;  1QQM A;  4JK8 A;  2J4R A;  3DLH A;  3O3G A;  5EU7 A;  4J8F A;  3CC7 N;  4CHP A;  5M1K A;  1TL3 A;  4CJ3 A;  4MQ3 A;  3E9P A;  2BGG A;  5JLH A;  5AQP A;  4IOA L;  4CGF A;  4W5R A;  1TAU A;  4WQ5 C;  1C1A A;  1BQM A;  2G8K A;  3K2P A;  4GV6 A;  2O8E B;  3F5T A;  1SKW A;  4HTL A;  4CK1 A;  1MWM A;  3MDQ A;  4GW6 A;  3ASM A;  1EWR A;  2QEX N;  3AO4 A;  4NYN A;  3ZSR A;  4AH9 A;  2YKM A;  5KRT A;  3R9P A;  4FJX A;  5HP1 A;  3LDP A;  3AAR A;  1XI1 A;  4I2Q A;  5GIP A;  5DM7 L;  1RT1 A;  1GLF O;  3KK2 A;  4OLB A;  3RMB A;  2HF3 A;  3ENH A;  2IS3 A;  3EKU A;  5D3G A;  1DLO A;  4CIG A;  2Q97 A;  3ZET B;  3PLA A;  2ZGY A;  3AVF A;  3VQC A;  5C0Y A;  3AY9 A;  2GWJ A;  5BRE A;  1FW6 A;  4A2B A;  4J2E A;  4Q0B A;  3CFR A;  3KHY A;  2QWO A;  2YX6 A;  4DQQ A;  2XY8 A;  3QEV A;  3KLF A;  5SZT A;  2B6A A;  4U7B A;  2DY4 A;  4O4G A;  2KKZ A;  1KAY A;  1VSK A;  1K6Y A;  3O1W A;  2O8E A;  4BRI A;  2PY5 A;  4CBX A;  4FWS A;  4FZY A;  1FK9 A;  4B3S K;  5M1Q A;  1NGA A;  2XHB A;  4B3T K;  5FPE A;  5M1F A;  4BRP A;  3D2F B;  2P9N B;  3HRG A;  4CVN E;  2YNF A;  1VQK N;  4CJT A;  4H0P A;  1OVQ A;  1TUY A;  4CJE A;  1W7A A;  4V19 S;  1VSD A;  3PY8 A;  1HPM A;  4NYF A;  1KVC A;  4WQ5 A;  4IJN A;  1E4F T;  2FC0 A;  4E3S A;  3DMJ A;  4CIE A;  4AF1 A;  2O4I A;  4OPK A;  1U04 A;  3HPG A;  3H3N O;  3DXK B;  4CK3 A;  2A1S A;  3VEV A;  3DWL A;  3ALY A;  1BU6 O;  4EZ9 A;  5C15 A;  4DF4 A;  3BF1 A;  4FXD A;  5M1N A;  1SAZ A;  1WUA A;  3SK3 A;  4DV0 K;  1XUP O;  3CI5 A;  3E9O A;  4JI8 K;  1RT6 A;  3O80 A;  4EZ6 A;  1T6C A;  2Q0R A;  2QM1 A;  1MDU B;  5C25 A;  4FVM A;  1BO5 O;  4BQZ A;  4JAX A;  3DLR A;  2HBL A;  3D2F A;  4HVJ A;  3V9W A;  4LF8 K;  3BZC A;  2Z1H A;  2VG7 A;  4M3Y A;  3IFR A;  4DSK A;  5AQT A;  1C1B A;  2QA4 N;  1L5U A;  1SUQ A;  3PX0 A;  4IXC A;  2H3G X;  4B1Y B;  2UXD K;  4JEP A;  3CCV N;  3K59 A;  3AO3 A;  3HYF A;  4OO1 J;  5JMV A;  1BG3 A;  1QS4 A;  4YOT A;  4KI6 A;  3CMA N;  1BI4 A;  3MEE A;  4KHP K;  4B1U B;  3J7Y P;  3C95 A;  4F2R A;  4Z4I A;  2ZD1 A;  3A5L C;  3TPQ A;  3AO1 A;  3HVR A;  1IBL K;  4O0I A;  1KFS A;  1JJ2 M;  1N32 K;  4DHY A;  2HMI A;  4MDB A;  1GLB G;  3QFU A;  5CZ1 A;  3VTI A;  2NRX A;  4J2D A;  4H5W A;  4FJJ A;  4F8R A;  3MMV A;  1NMN A;  1NLV A;  3MEG A;  4HCB A;  2E8A A;  3DRR A;  4XH1 A;  1N36 K;  4PA1 A;  2NUB A;  3PUF A;  4B3M K;  4ISF A;  1C0T A;  4IEI A;  3H6E A;  3LAN A;  3L8B A;  5C2F A;  1HYS A;  5MLC Q;  1FKO A;  3NVK A;  1EWQ A;  1NK5 A;  2RF2 A;  3M8Q A;  2BE2 A;  1ZBH A;  3KLG A;  2OAN A;  2ZE2 A;  4BY9 C;  2V51 B;  2GBZ A;  4AQY K;  2YHB A;  3C6T A;  1YF5 L;  4M3X A;  4LH5 A;  5B8H A;  1J5O A;  1QSL A;  2E5L K;  1C0G A;  3THW A;  1ASU A;  3LDN A;  4IG3 A;  4IOC L;  4H8K A;  3OHR A;  3U8X A;  4DTP A;  2QXF A;  3CD6 N;  1NGB A;  2HHU A;  3L3V A;  1S1T A;  3NGI A;  4CJP A;  2I5J A;  4BC4 A;  1HKG A;  3AVG A;  5LMN K;  1DTQ A;  1NGH A;  3DOK A;  2E6M A;  2A41 A;  1X9J A;  1L3S A;  1YIJ N;  4LF6 K;  5KGX A;  4CZK A;  4K8X A;  4H5V A;  1C0M A;  4H0T B;  2VGM A;  4IO8 A;  4FJ9 A;  1A5X A;  4W5Q A;  5BPL A;  3HP6 A;  1KAZ A;  4JKA A;  1L3U A;  1E3M A;  5AQF A;  2IC3 A;  3A0I X;  3FZF A;  4QS8 A;  1KCF A;  2BH1 A;  4KB0 A;  3EE8 A;  2OTL N;  3U9D A;  3AVL A;  4FCY A;  4YOY A;  2WTU A;  4E7I A;  1YAG A;  4C8L A;  1X9M A;  4CEE A;  3IKM A;  1NK6 A;  5F1X A;  3EYZ A;  1ITG A;  4IZ9 A;  4U67 L;  4BR2 A;  4BR5 A;  3K5M A;  2FF6 A;  1BHL A;  5AQY A;  4FYD A;  5FRM A;  4CIF A;  3ITH A;  3BP8 A;  3CJA A;  4IG0 A;  3NVM A;  5C10 A;  4FJ8 A;  3VQ9 A;  1OH6 A;  2VCP A;  4FJN A;  3TSQ A;  3FFI A;  5AJ3 K;  2IAJ A;  2VG6 A;  4C1N I;  3WNF A;  4B9U A;  3M1F A;  1R59 O;  5J1E A;  2E2N A;  4CZM A;  3GL1 A;  1TUU A;  3TR8 A;  3KIO A;  4DUY K;  2GV9 A;  2DFF A;  3MN7 A;  5AZI A;  1VQL N;  2ATQ A;  3QIO A;  1Q82 O;  1YVN A;  3EKS A;  1JKH A;  3V1O A;  4N76 A;  3TAN A;  2P9P B;  5TKW A;  3E1Y A;  1RDU A;  4JK9 A;  4M3T A;  4CFB A;  1JL1 A;  5HRP A;  4M42 A;  2X6S A;  1KLM A;  3OTO K;  5KTQ A;  1JCF A;  4BG9 A;  2W6K A;  3RRG A;  3T69 A;  3D6R A;  1XQS C; 
#chains in the Genus database with same CATH homology
 3L2Q A;  1LW2 A;  3AV9 A;  3V9X A;  3S3M A;  4DTX A;  5KRS A;  1EX4 A;  1GOC A;  1ASW A;  4RW9 A;  4CGJ A;  3AO2 A;  3AVH A;  3C6U A;  3LP3 A;  3ZSZ A;  4YNQ A;  4FLX A;  3TI0 A;  2YNI A;  3RR7 A;  3VQQ A;  4DWI A;  3DM2 A;  3AVA A;  2ZQB A;  4O44 A;  1BQN A;  4CFC A;  3NF6 A;  4E7L A;  4O0J A;  2HB5 A;  3EY1 A;  5FDL A;  2F96 A;  3AO5 A;  4W5T A;  1TKD A;  1HYZ A;  4L8R B;  1J53 A;  1REV A;  3DLB A;  1FKP A;  4I2P A;  3PX6 A;  4DQI A;  1BGX T;  3TAG A;  4LH4 A;  1RDA A;  3VQ6 A;  1NK8 A;  3L2U A;  4AHR A;  4M41 A;  2KTQ A;  1RBV A;  4CF0 A;  3SQ0 A;  2HHX A;  3V9S A;  3ZT1 A;  1T03 A;  4JRP A;  1RBU A;  4KFB A;  3LP1 A;  4Z4G A;  3NF9 A;  3ZSW A;  4C8K A;  4LD0 A;  4FZX C;  1S6P A;  3IS9 A;  4CFD A;  4DTU A;  3E01 A;  1QQC A;  1VSJ A;  1A5V A;  1IKV A;  1VSM A;  1XHX A;  1IG9 A;  4KHS A;  2G8U A;  2X78 A;  4FLU A;  1NJY A;  3JYT A;  3IAY A;  2FBT A;  4FZZ A;  4G1Q A;  4KO0 A;  1RTI A;  3SPY A;  3M8R A;  2KZZ A;  2AJQ A;  2HND A;  1Q9Y A;  1YTA A;  1RT3 A;  1Z25 A;  2OPQ A;  3OVN A;  4BE2 A;  4HUF A;  4FM2 A;  3NFA A;  4E89 A;  2PYL A;  1R0A A;  2GUI A;  4FJI A;  3F9K A;  4YFU A;  1S1X A;  3HM9 A;  4Z4E A;  1VSF A;  3P83 D;  1N5Y A;  1RBS A;  3KLH A;  3K57 A;  4DU3 A;  3BGR A;  3OYM A;  3KK3 A;  3NH0 A;  3RMD A;  1U49 A;  4AHT A;  3SUO A;  2FBV A;  4DSL A;  4RW4 A;  4HHT A;  2HW3 A;  2RKI A;  3U3G A;  1RTJ A;  4Y1D A;  4CK2 A;  4DFP A;  4FJ7 A;  3M8P A;  1SL2 A;  3DRP A;  4CED A;  3T1A A;  1BI4 B;  4FM1 A;  4ICL A;  3DLE A;  4CJF A;  4HTU A;  5J2M A;  1WSG A;  5HRS A;  4FM0 A;  3VQE A;  4CF8 A;  4E7J A;  3LPT A;  3SPZ A;  2P5O A;  2G8W A;  4OJR A;  1WAF A;  1RT2 A;  3RR8 A;  4DG1 A;  3SNN A;  4FLW A;  1TK5 A;  2HVI A;  3SV4 A;  1SV5 A;  4FJH A;  4DU1 A;  1IH7 A;  4DSE A;  2D0B A;  2B4J A;  1CXU A;  3ZCM A;  1TK0 A;  1KVA A;  4ZTJ A;  1RNH A;  1VSL A;  2P51 A;  4H4M A;  1WNS A;  3LAK A;  1KTQ A;  3QLH A;  4AHS A;  4CHO A;  3DRS A;  4KRF A;  4E1N A;  5FRO A;  2W42 A;  4J2B A;  2QKK A;  3NF7 A;  3O3G A;  4DTS A;  4KTW A;  5EU7 A;  3EZ5 A;  3DLH A;  2PYJ A;  4KKO A;  1BIU A;  3ZSV A;  4CHP A;  1TL3 A;  2F8S A;  4CJ3 A;  4CHQ A;  2D0C A;  4MQ3 A;  3RWU A;  1D5A A;  4QAG A;  2BGG A;  4FW1 A;  3OY9 A;  5CZ2 A;  1LWC A;  3VQP A;  4W5O A;  1MU2 A;  4DFM A;  4EP4 A;  4N56 A;  3KKR A;  4CGF A;  4LSN A;  4ELV A;  4W5R A;  1NJX A;  1A5W A;  4OVL A;  4WE1 A;  4OKE A;  1NKE A;  4PUO A;  3SUP A;  1WLJ A;  3DLG A;  3L2W A;  1TAU A;  3PO5 A;  4FJL A;  1HMV A;  1C1A A;  4DQS A;  1BQM A;  4DTO A;  1T8E A;  3K2P A;  5J2Q A;  2G8K A;  1HPZ A;  1L3T A;  4RW8 A;  1C0U A;  1YVU A;  2WON A;  3KD5 E;  1SKW A;  1U4B A;  5CY4 A;  4CK1 A;  2P5G A;  3ZT4 A;  3HO1 A;  4GW6 A;  3V4I A;  3ASM A;  4DQP A;  4KHQ A;  2X74 A;  3AO4 A;  4NYN A;  3ZSR A;  4AH9 A;  2YKM A;  5KRT A;  4FJG A;  4CJQ A;  2LSN A;  3HST B;  1S6Q A;  3VQB A;  3SQ4 A;  5HP1 A;  1T7P A;  4FJX A;  4ELT A;  2FBX A;  4KB1 A;  1D9D A;  4IDK A;  4CJW A;  3K5L A;  1ZBI A;  4PY5 A;  3LWM A;  1XI1 A;  3LP0 A;  4I2Q A;  3QES A;  4KAZ A;  3LWL A;  4CEF A;  4LY7 A;  3HK2 A;  3LAM A;  1EKE A;  1RT1 A;  3CYM A;  3O3H A;  3KK2 A;  1SL0 A;  4OLB A;  1RT4 A;  3RMB A;  2IS3 A;  3IG1 A;  4BWM A;  2R7Y A;  3I0R A;  3T19 A;  1JLE A;  1DLO A;  1I39 A;  1IKW A;  4CIG A;  5D3G A;  3LPU A;  1NK7 A;  3ZSQ A;  1LWF A;  1LW0 A;  4UQG A;  2XO7 A;  1X9S A;  1TGO A;  4BWJ A;  3AVF A;  5I42 A;  1UA0 A;  4W5N A;  3VQC A;  2YKN A;  1EXQ A;  2QK9 A;  2FBY A;  3TAE A;  4F3O A;  4KTQ A;  3OYE A;  3B6O A;  3HXM A;  4J2E A;  4Q0B A;  4ID1 A;  3CFR A;  3ULD A;  4ZHR A;  3AA4 A;  2OYQ A;  4DQQ A;  1RTH A;  2XY8 A;  1NKC A;  4IFV A;  5KI6 A;  3DLK A;  3KLF A;  1LWE A;  2E6L A;  3NGZ A;  3LZI A;  5HBM A;  5SZT A;  3QEV A;  2B6A A;  3MEC A;  3O4N A;  2P1J A;  2HHS A;  2DY4 A;  1VK0 A;  1J9A A;  4O4G A;  3NH1 A;  3NF8 A;  3OYI A;  3AVM A;  1VSK A;  4HCC A;  1K6Y A;  4I7F A;  4CES A;  4OKJ A;  3SJJ A;  3AVK A;  1YTU A;  2DFH A;  4FK4 A;  2PY5 A;  3LAL A;  4J2A A;  1NJW A;  3VA0 A;  4FZY A;  1FK9 A;  1QTM A;  4E7K A;  5C42 A;  5KGW A;  1KLN A;  1QE1 A;  2XHB A;  1TAQ A;  3NBP A;  3CG7 A;  3NDK A;  4B9V A;  1S9G A;  4ELU A;  4Y1C A;  5HLF A;  3KLI A;  3OYH A;  3HP9 A;  4JS5 A;  1S1W A;  4OGC A;  1W9H A;  1IKX A;  4KTZ A;  2YNF A;  5J2P A;  4KPY A;  3QEP A;  4Z4F A;  1J54 A;  4CJK A;  3OJS A;  1NJZ A;  4B9N A;  4BDZ A;  3LZJ A;  4B9M A;  2DFE A;  4CJT A;  1RT7 A;  4ID5 A;  3AVB A;  4CJE A;  4QCL A;  1VSD A;  3BDP A;  3JSM A;  4K8Z A;  4KRE A;  3PY8 A;  4NYF A;  1WN7 A;  2EHG A;  1KVC A;  2VG5 A;  2YNH A;  2FC0 A;  4CEO A;  4DFJ A;  4E3S A;  3DMJ A;  4CIE A;  1VRT A;  2O4I A;  4OPK A;  1JL2 A;  2XY5 A;  1U04 A;  2D0A A;  3VQ5 A;  3HPG A;  3P1G A;  4M3R A;  1RTD A;  4CK3 A;  2A1S A;  1X1P A;  2IDO A;  1ZBU A;  4LSL A;  4DF8 A;  1D8Y A;  1BIS A;  3ALY A;  4DSI A;  2XY6 A;  4EZ9 A;  4CGH A;  4DF4 A;  3S3N A;  1HYV A;  1TVR A;  2JLE A;  5K14 A;  4FXD A;  3SQ2 A;  2OPS A;  3O3F A;  4BDP A;  3QEW A;  2OA8 A;  3AVN A;  1C1C A;  2IGI A;  3ZSX A;  4MFB A;  4KHY A;  1Z26 A;  4JRQ A;  4FLY A;  3AA3 A;  4DMN A;  4I9Q A;  1U47 A;  3B6P A;  5T7B A;  1RT6 A;  3VQ7 A;  4EZ6 A;  3SZ2 A;  4CJS A;  5C25 A;  4CJR A;  4FVM A;  1CZ9 A;  4GVM A;  2BAN A;  3ZT3 A;  3QET A;  1HNI A;  3TAB A;  1TK8 A;  4B08 A;  1RCH A;  3K5N A;  3KD1 E;  3V6D A;  1WSH A;  3DLR A;  3V1Q A;  3DOL A;  4HVJ A;  3V9W A;  2Z1H A;  1RBT A;  2VG7 A;  4M3Y A;  4CJV A;  3NH2 A;  4ZTF A;  3V9U A;  3KLE A;  4JLH A;  4FLV A;  1DTT A;  4DSK A;  3I0S A;  4IKF A;  1C1B A;  2VWJ A;  4DTJ A;  1L5U A;  4FJK A;  4DU4 A;  1S1U A;  1SUQ A;  3PX0 A;  3LDS A;  4HUE A;  4CF2 A;  1NKB A;  4FK2 A;  3G0Z A;  1IKY A;  3K59 A;  3AO3 A;  3HYF A;  5FRN A;  3O4Q A;  5JS2 A;  3OYF A;  3QEX A;  1QS4 A;  3SUQ A;  3S9H A;  4DTR A;  4KI6 A;  3D0P A;  2G8V A;  1BI4 A;  3MEE A;  1HQE A;  4RW6 A;  4Z4I A;  3C95 A;  4F2R A;  3OYJ A;  2ZD1 A;  4EP5 A;  3HJF A;  1U45 A;  4DTM A;  4NCG A;  4DFK A;  1JXB A;  3OYD A;  1WSJ A;  1JLG A;  3KTQ A;  3AO1 A;  4DS5 A;  3HVR A;  1BL3 A;  3OYB A;  4N47 A;  4O0I A;  4M3U A;  1KFS A;  2HNY A;  3NCI A;  3WNG A;  4CEA A;  1QSY A;  3RMC A;  4C8N A;  3ZSO A;  2HMI A;  3V81 A;  3NHG A;  2YV0 X;  4CGG A;  3SCX A;  1HRH A;  2Q3S A;  1B9D A;  5CZ1 A;  4M3Z A;  4XIU A;  1XWL A;  4E0D A;  4J2D A;  2YHA A;  1BIZ A;  2OPP A;  4KV8 A;  1SKR A;  4Z4C A;  1UWB A;  4F8R A;  4FJJ A;  2XRI A;  5JS1 A;  3MEG A;  3QO9 A;  1FXX A;  1RBR A;  1TL1 A;  3OS1 A;  1S9E A;  1D9F A;  2O4G A;  3DRR A;  4HCB A;  4QOZ B;  4PA1 A;  3K5O A;  1N6Q A;  1RDD A;  2NUB A;  3PUF A;  1ASV A;  4AIL C;  1C6V A;  3HVT A;  1C0T A;  3HL8 A;  1UA1 A;  3MED A;  4KHN A;  3H08 A;  3LAN A;  2HHT A;  3L8B A;  1W0H A;  1HYS A;  4CJL A;  1JLF A;  3DYA A;  1FKO A;  1WAJ A;  3K58 A;  1NK0 A;  4I9L A;  2Y1I A;  5HRO A;  3QIN A;  1TKZ A;  3HPH A;  3NE6 A;  1ZBL A;  4CEQ A;  1NOY A;  2OZS A;  1TV6 A;  2Y1J A;  4AHC A;  5DK5 A;  5HRR A;  4B8A B;  1U48 A;  3CFO A;  3V1R A;  5CYQ A;  2WOM A;  4RW7 A;  2HNZ A;  1NK5 A;  4IFY A;  2RF2 A;  3M8Q A;  1NOZ A;  2BE2 A;  1ZBH A;  3OYG A;  3KLG A;  4FJ5 A;  4TSX A;  2ZE2 A;  3CFP A;  3I8D A;  3V9Z A;  3QNO A;  2GBZ A;  2YHB A;  2Z1G A;  1WSE A;  4DLG A;  3QER A;  4KHW A;  3C6T A;  1QHT A;  1VSI A;  2OPR A;  3P5J A;  4LH5 A;  1KRP A;  4C8O A;  4M3X A;  1S5J A;  3TAP A;  1J5O A;  1NK9 A;  5SWM A;  4DTN A;  4N41 A;  3CQ8 A;  4NCB A;  3VN5 A;  4CE9 A;  1QSL A;  4E7H A;  4GMJ B;  3AA5 X;  4CER A;  3TAF A;  4B9S A;  1ASU A;  4CHY A;  1T05 A;  4IG3 A;  4KI4 A;  5CYM A;  1CZB A;  1B9F A;  4H8K A;  2BDP A;  3PO4 A;  3NAE A;  1IO2 A;  1JLC A;  4BE1 A;  2QXF A;  4DTP A;  1Q9X A;  4Z4H A;  4M3W A;  2HHU A;  3L3V A;  1S1T A;  3PX4 A;  1QSS A;  2VWK A;  4CEB A;  4CJP A;  3L2R A;  2I5J A;  3NGI A;  4CGD A;  4FLZ A;  3SQ1 A;  4NCA A;  3AVG A;  4PQU A;  4R5P A;  3ZT2 A;  1B92 A;  1DTQ A;  3DOK A;  4OPJ A;  2E6M A;  2A1R A;  3C94 A;  3VQ8 A;  3OS2 A;  4KHU A;  4IBN A;  3NGY A;  4AHU A;  3MXM A;  1L3S A;  4B9U A;  2F8T A;  1HJR A;  5KGX A;  3OYK A;  2QKB A;  2HHW A;  4K8X A;  1C0M A;  4CJ5 A;  4B9T A;  3KK1 A;  2IOC A;  1A5X A;  3OJU A;  1KVB A;  4W5Q A;  4FJ9 A;  3TAQ A;  3WNH A;  3HP6 A;  1LAW A;  2KZM A;  2JGU A;  1KFD A;  3VQ4 A;  3VQD A;  4CHZ A;  4CJ4 A;  4AHV A;  3TAR A;  2Z1I A;  1L3U A;  1JLB A;  3KKS A;  4BE0 A;  1RDB A;  2IC3 A;  4CJU A;  3HPO A;  4HUG A;  1XHZ A;  1UAX A;  3IRX A;  3MAQ A;  1KCF A;  3U3Y A;  3LP2 A;  1NK4 A;  4KB0 A;  1GOB A;  1YT3 A;  5C24 A;  3KJV A;  5HRN A;  3WNE A;  4F3T A;  1O1W A;  3AVL A;  1EP4 A;  1GOA A;  4FCY A;  1RDC A;  4Z0U A;  4CHN A;  4DLE A;  4E7I A;  2G8I A;  4O55 A;  4JS4 A;  4C8L A;  1X9M A;  3CM5 A;  3QEI A;  1JLA A;  1KSP A;  3A2F A;  4CEE A;  1NK6 A;  3T3F A;  3EYZ A;  1ITG A;  1BCM A;  2G8F A;  3G10 A;  3SYZ A;  3OYC A;  4OKK A;  4CF9 A;  1BCO A;  3K5M A;  1HQU A;  2E4L A;  1ZYQ A;  1BHL A;  3AVI A;  4FYD A;  3U6F A;  1UOC A;  5FRM A;  4CGI A;  1SKS A;  2G8H A;  4CIF A;  3ZT0 A;  3ITH A;  1VSH A;  2ITG A;  4DQR A;  4IG0 A;  3THV A;  1VSE A;  2KW4 A;  3CM6 A;  4CEZ A;  4BAC A;  3QNN A;  4F4K A;  1Y97 A;  1JXE A;  4DSJ A;  4FJ8 A;  3AA2 A;  2HHQ A;  3ZSY A;  3L3U A;  3MXJ A;  3F73 A;  4BDY A;  3VQ9 A;  2YNG A;  4F2S A;  2KFZ A;  3OS0 A;  1I3A A;  1CLQ A;  4FJN A;  4CCH A;  3ISN C;  4FLT A;  1Q8I A;  2XY7 A;  4N5S A;  4FJM A;  2KQ2 A;  3FFI A;  2IAJ A;  2VG6 A;  5DMR A;  4C8M A;  1TKX A;  3WNF A;  3M8S A;  3TAM A;  3RTV A;  1RIL A;  3MXI A;  5J1E A;  1VRU A;  1WSI A;  1ZBF A;  2RPI A;  1XC9 A;  4E19 A;  2HHV A;  1JLQ A;  1LAV A;  3OYL A;  2OZM A;  3TR8 A;  3KIO A;  2KFN A;  4CFA A;  2RN2 A;  4DSF A;  1L3V A;  3RRH A;  2GV9 A;  4PWD A;  2D5R A;  1S1V A;  2DFF A;  1EET A;  2Z1J A;  5I3U A;  2ATQ A;  3QIO A;  3AVJ A;  1F21 A;  1CXQ A;  4DS4 A;  3SI6 A;  2EX3 A;  3SV3 A;  1JKH A;  1WSF A;  3V1O A;  4E1M A;  1LV5 A;  2PZS A;  4N76 A;  3TAN A;  4OLA A;  3QIP A;  2DTU A;  1SL1 A;  4CF1 A;  4H4O A;  3D45 A;  4CEC A;  3PV8 A;  3OYA A;  3OYN A;  3L2V A;  4CFB A;  4FK0 A;  4M3T A;  5J2N A;  4RG8 A;  3DI6 A;  3VA3 A;  1JL1 A;  1X9W A;  5HRP A;  3AVC A;  4M42 A;  1G15 A;  2X6S A;  2ETJ A;  4B9L A;  1KLM A;  4B8C A;  2X6N A;  4O5B A;  3HT3 A;  4OGE A;  3VQA A;  3SUN A;  1RT5 A;  4M45 A;  2B5J A;  3UIQ A;  3S3O A;  3TWH A;  5KTQ A;  1HNV A;  3RMA A;  4FW2 A;  3RRG A;  5E41 A;  2HVH A;  4B3O A;  1TKT A;  4Q5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...