2G8WA

B. halodurans rnase h catalytic domain e188a mutant in complex with ca2+ and rna/dna hybrid
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
KEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGAIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 39
structure length 134
sequence length 134
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8wA00
1LAWA 5KRSA 4E0DA 4CCHA 4OPJA 1UAXA 1I39A 4IG0A 1SKWA 4OKEA 3ZSQA 4OPKA 4O55A 3RRGA 1YTAA 5FRMA 4GVMA 3KD5E 2KW4A 3AA2A 3EZ5A 4FM2A 3VA0A 4DQRA 3SQ0A 1RT3A 3S3OA 4CK3A 3AA4A 3QETA 3S3MA 3QINA 3KK3A 2DY4A 4R5PA 4LY7A 3OY9A 1TKTA 2VWJA 3ULDA 3HP9A 5JS2A 3HT3A 4BE0A 4FJJA 4CJ3A 1VSHA 4JLHA 1HPZA 1WSEA 3ZT0A 4DTOA 4KAZA 4OGEA 4Y1DA 3V1OA 5CZ1A 4JS5A 1RBSA 2X6SA 2VG7A 4BWMA 4KFBA 4OKKA 4FLTA 3HYFA 1VSIA 3AVKA 3AVMA 2A1SA 4IFYA 4CERA 1HQUA 3OYJA 3ALYA 1S1TA 4DSEA 4PWDA 1WSGA 3DYAA 4CJKA 4KB0A 3V9XA 5KGXA 4HUGA 1TL1A 3LZJA 4KRFA 1SUQA 3O3HA 3K59A 4CJSA 3AVCA 3KD1E 3P1GA 4CEOA 1NKCA 3PUFA 4KREA 1U48A 1L3TA 4MQ3A 5HROA 4FW2A 3ZCMA 3AVGA 3PO4A 1HNVA 4CJWA 3M8PA 3NF8A 2HNZA 5FDLA 1RT5A 3QEWA 2YNFA 2G8HA 3C95A 3NGIA 1FXXA 4TSXA 3OYNA 4DTRA 5J1EA 1HNIA 2IC3A 1VSKA 1HYVA 2P5OA 3DRRA 3TAQA 3I0SA 4CHZA 3AA5X 4O5BA 2D0BA 4CFDA 2R7YA 4DF8A 4G1QA 3SNNA 1RCHA 1C1BA 1RDDA 4M41A 2XHBA 5HLFA 4Z4IA 2JGUA 3LP0A 4CEZA 1Z26A 3TAPA 3P5JA 2HHTA 3LDSA 1XWLA 1LWEA 1X9SA 2JLEA 4CHYA 4KHWA 3OS1A 4B9NA 4CJVA 3KLFA 1XHXA 1CXUA 1KTQA 3QIOA 3V1RA 4B9TA 4DQIA 4H4OA 3O4QA 3QNOA 3OYCA 1NKBA 1T03A 3VQ8A 4LH5A 4J2DA 1ZYQA 2XY6A 3L2UA 4H8KA 4DSIA 4DFKA 4B08A 4DG1A 4EP4A 3ZT2A 3MEEA 2HHXA 2OYQA 2HHSA 3IAYA 4ELTA 4W5TA 1Q9XA 1IKWA 1S6PA 4ICLA 4DU3A 1EETA 4AHCA 2RF2A 4CGIA 4YFUA 1KFDA 1HYZA 3F9KA 4FLXA 3G0ZA 3AA3A 1S1WA 3O4NA 1WNSA 3QO9A 5FRNA 2QKBA 3DMJA 3B6PA 3SQ1A 4J2AA 2KFNA 1CXQA 1T8EA 1B92A 4FLZA 4NYFA 1D9FA 3HL8A 1S9GA 1JL2A 3ZT1A 2BANA 3SYZA 1X9MA 2VG5A 1MU2A 4CIGA 2PY5A 4FK0A 3LAMA 1U45A 3ZSXA 3OYFA 4E89A 3RMAA 5CYQA 2G8VA 4FXDA 1WSFA 1RTIA 5J2QA 1U49A 1T05A 3VQDA 1KVAA 3EYZA 2EHGA 4FJHA 1UA0A 4DTMA 1QSSA 4AHUA 4Z4EA 4LH4A 1C0MA 1RILA 2QKKA 3MXIA 4OVLA 3L2RA 2QXFA 3NHGA 4FLYA 1UWBA 4KTWA 2DTUA 1SL2A 2OPSA 2HW3A 3CM5A 4OLBA 2Z1IA 4CESA 5JS1A 3K2PA 3TAEA 2RKIA 5HBMA 3RR8A 3NAEA 4CF1A 1SL1A 3KK2A 1TKDA 2Z1JA 1R0AA 3DRSA 3TI0A 3KJVA 5K14A 4I2QA 1YVUA 4LSLA 5C42A 3KLGA 3HVRA 4IBNA 3PY8A 3SUQA 1EX4A 1LV5A 1RDAA 2D0AA 4E1NA 2WOMA 3V9WA 1JXBA 2DFFA 4IG3A 4E3SA 2IOCA 2P51A 4CIFA 4FJLA 4CFBA 4HCBA 3TWHA 3NF6A 3DLHA 4DWIA 1U04A 3OYHA 4DTNA 2OPRA 4C8OA 3OYDA 4JS4A 4IKFA 3MEGA 3L2QA 1SKRA 4RW9A 3OVNA 4DFMA 4Z0UA 4DTSA 3KLIA 3PX4A 2HMIA 4B9SA 2F96A 4M3ZA 4HVJA 4DU1A 1IKXA 4HTUA 3NCIA 2F8TA 4B3OA 1EKEA 1J9AA 3SJJA 4CJFA 3TARA 4FJ7A 4FJ9A 4QOZB 4GW6A 2BGGA 2HVIA 4FYDA 3OYKA 4FZZA 3NGYA 2IDOA 3DLBA 1L3VA 3WNGA 4ID1A 4CIEA 4M3RA 3THVA 3AO3A 4HUFA 2XO7A 3M8RA 2FBTA 2BDPA 4FJNA 3WNHA 4FM1A 4KV8A 3UIQA 1TK5A 1XHZA 3VQ6A 3SCXA 4CJRA 3HPHA 3KIOA 2HHQA 4O0JA 3SV3A 3NDKA 3V9ZA 2G8WA 2I5JA 3S9HA 1JLEA 2XRIA 4B9LA 2Z1GA 3O3GA 4PY5A 1S5JA 5HRPA 2ZQBA 4NCBA 1KRPA 2HHVA 4FJ5A 4FLWA 4PQUA 2G8UA 1ASUA 3FFIA 4E7LA 1ITGA 3C6UA 4O4GA 1CLQA 3HVTA 1NK7A 4C8KA 1BQMA 1Y97A 2ZD1A 3WNEA 1IG9A 2P5GA 3ZSVA 4RW6A 1HMVA 1QE1A 4AHSA 4BDYA 2B4JA 4RG8A 4KHQA 4H4MA 4M3XA 4C8LA 5CY4A 3MECA 3L3VA 4KI4A 2HHWA 2OA8A 3HJFA 1RT4A 4O0IA 4Z4FA 5FROA 3SUPA 4FJXA 1SV5A 4IFVA 1CZ9A 3RTVA 3RWUA 4CJUA 3T1AA 5SWMA 1GOCA 4CF9A 1IH7A 1TAQA 1FKPA 4ZTJA 2G8IA 3C6TA 2BE2A 4NCAA 1RDCA 4BACA 3OYIA 2ATQA 3ZSWA 1NJYA 1N5YA 2E6LA 1RBUA 3VQ5A 1I3AA 4OJRA 3T3FA 3SI6A 4OGCA 4CEDA 2EX3A 3AVLA 3QLHA 1Q9YA 4Z4CA 3V9SA 2GUIA 4E7HA 3JSMA 4KHUA 4Q5VA 3TAGA 3U3YA 1XC9A 5E41A 4N47A 1L5UA 4F2SA 4KB1A 1BQNA 4RW8A 1G15A 1WSJA 4IDKA 4FJKA 3NH0A 4Z4GA 4N5SA 1FKOA 3VQ4A 3CYMA 3LP3A 3PV8A 1NJWA 2NUBA 1JLFA 1ZBHA 4FCYA 3VQBA 3K58A 4DFPA 4JRQA 4J2EA 4KI6A 3B6OA 4DSLA 3VQCA 4E7KA 3QEPA 3DM2A 3I0RA 3D0PA 1LAVA 4UQGA 4I9QA 4KHSA 1J53A 4YNQA 3RMBA 4E1MA 5SZTA 3CG7A 4CF8A 4DLEA 3VN5A 3KLEA 2XY7A 1XI1A 1WAJA 1Q8IA 3LPUA 3ASMA 4FZXC 3CM6A 4OLAA 3HPGA 3IRXA 4FW1A 3AO2A 4OKJA 1REVA 4CJQA 2ETJA 4FJIA 5EU7A 3CFRA 3A2FA 3OYAA 2Z1HA 4KO0A 4CFCA 3V1QA 3OS0A 1QHTA 1VSFA 3QNNA 4O44A 2HB5A 1X1PA 5I3UA 1BI4A 1KFSA 3AVBA 1RNHA 4F4KA 2Y1JA 1VSLA 4FK2A 1S6QA 5KRTA 3VQ9A 4CJPA 3RMCA 1NK4A 3DLGA 3ZT4A 4CGHA 2FBYA 3AVHA 4DQSA 4DTJA 1DTQA 4KKOA 3LWLA 1BISA 2A1RA 4E7IA 4CE9A 2OZSA 1VRTA 3MAQA 2B6AA 4I7FA 3VQPA 2E4LA 5KTQA 1U47A 4DSKA 4DU4A 4BE2A 4KHNA 1BIUA 5DK5A 3KLHA 4DS4A 1JLQA 4CK1A 1NK9A 4CGGA 4FVMA 3L2VA 1WSIA 1UOCA 3IG1A 4CECA 2RPIA 1KLMA 4MFBA 4QAGA 4PA1A 5DMRA 2DFHA 4DMNA 2Q3SA 4C8NA 2YHAA 2YKMA 1WAFA 1KSPA 2X78A 3E01A 4LD0A 3AVJA 1S9EA 4CGDA 2GBZA 4E19A 1C0UA 3RMDA 1VSMA 3QIPA 1ASVA 5HRSA 2W42A 4M3WA 4M3TA 4DF4A 3QERA 3AV9A 2KQ2A 1A5WA 2P1JA 4W5NA 3DLKA 1DTTA 5CYMA 4AH9A 4K8ZA 3NF9A 1RTJA 4DTXA 1JLAA 1HQEA 4DTPA 3G10A 4CJEA 2PYLA 1JLCA 4AHTA 1K6YA 3ZSRA 4EP5A 3SUNA 1W0HA 4ELVA 3HP6A 2E6MA 3CFPA 3U6FA 3TAFA 2FC0A 3IS9A 3LP2A 1C0TA 5KI6A 3V81A 4ELUA 1LWCA 1VSEA 3AO4A 4I9LA 1BCOA 3QEXA 3HSTB 4GMJB 2D0CA 2G8KA 4KHYA 1JLGA 1KVCA 3NF7A 4CGFA 1ZBLA 2XY8A 3SQ2A 3SQ4A 4CHQA 3HPOA 1HYSA 2XY5A 4FK4A 3F73A 1QQCA 4CGJA 3NBPA 3MXMA 3RR7A 2KTQA 3LWMA 1D5AA 2YHBA 4FJGA 1WLJA 3TABA 4E7JA 4FLUA 1LW0A 1TKXA 3LALA 1SL0A 4F3OA 4L8RB 4FJ8A 1D9DA 3HO1A 3CQ8A 1QTMA 1UA1A 3QEIA 3OYEA 3VA3A 1J5OA 3T19A 4M3UA 2AJQA 3SPYA 4CHOA 4B8AB 5CZ2A 2OZMA 1S1VA 4CF2A 1IKVA 1NOYA 3DRPA 4ID5A 2KZZA 3QESA 3KKSA 3NGZA 1Z25A 4CF0A 3TR8A 2VG6A 2VWKA 4B8CA 4HCCA 3D45A 1TV6A 2HNDA 1GOAA 4DQPA 1KCFA 1VK0A 4EZ9A 4CEAA 2ZE2A 1RT6A 1QSLA 2YKNA 3ZSZA 1TAUA 1IO2A 3V6DA 1F21A 2O4GA 4I2PA 3NE6A 1ASWA 3NFAA 4NCGA 3SZ2A 1RT1A 4DSFA 1EP4A 5J2NA 4AHVA 2DFEA 3VQQA 1A5XA 1HJRA 3BGRA 2Y1IA 3BDPA 4F3TA 4AILC 4HUEA 4RW7A 2YV0X 4B9UA 3CFOA 4JRPA 4BE1A 3VQEA 4ZTFA 3MEDA 3DOKA 4Y1CA 1O1WA 4C8MA 3HXMA 3L8BA 3C94A 3PX6A 4FLVA 3KTQA 1J54A 4J2BA 1CZBA 3O3FA 2WONA 4XIUA 1LW2A 5J2MA 3LANA 1T7PA 5D3GA 4RW4A 2IAJA 1W9HA 4CEQA 1QS4A 2YNHA 4W5QA 1WN7A 1IKYA 3M8SA 3S3NA 4Q0BA 1B9DA 3OYMA 3AVIA 1YT3A 3K5OA 3TANA 4LSNA 4CJ5A 1NK6A 4FJMA 3VQ7A 4N41A 3L2WA 4KPYA 2KZMA 1TGOA 5C25A 1NK5A 2FBXA 3M8QA 3SV4A 4DTUA 2YNIA 2QK9A 1NK8A 1DLOA 2OPPA 3AVFA 5J2PA 4CEFA 4NYNA 2OPQA 3V4IA 1NOZA 3AO5A 1C1CA 2G8FA 1FK9A 1RT7A 1BHLA 3DOLA 1RTHA 3ZSYA 3V9UA 1NK0A 3H08A 3P83D 1NJZA 1SKSA 1YTUA 1KVBA 5C24A 2FBVA 1JL1A 1HRHA 3JYTA 5I42A 1ZBUA 4CFAA 5HP1A 1TVRA 3OYGA 4DQQA 1NJXA 4M42A 3LZIA 3WNFA 1L3UA 4QCLA 4CJLA 3K5LA 4CJTA 1QSYA 3AVAA 4CEEA 1C6VA 2F8SA 3AVNA 1JLBA 3QEVA 1U4BA 3OYLA 1S1XA 1RBVA 4KTZA 1KLNA 3OJUA 4DSJA 4KTQA 4FZYA 1RT2A 3KK1A 4DFJA 5HRNA 3NH2A 4B9VA 4W5OA 2IS3A 1VSJA 3DLRA 4W5RA 4BDPA 1GOBA 3HM9A 1RBRA 4DS5A 3OJSA 4F8RA 2GV9A 3DI6A 4CHPA 3SPZA 3ZSOA 3TAMA 3U3GA 4CJ4A 3OS2A 4BDZA 1RTDA 2PYJA 1TKZA 3LP1A 3I8DA 3AO1A 2LSNA 3ISNC 4Z4HA 1ZBFA 2B5JA 1TK8A 3SUOA 2YNGA 5T7BA 4WE1A 1TL3A 2KFZA 3K57A 3MXJA 3HK2A 4F2RA 1ZBIA 4B9MA 1L3SA 2HHUA 1S1UA 1BGXT 1B9FA 1VSDA 1RDBA 4AHRA 3LPTA 4BWJA 1N6QA 1JXEA 3K5MA 4HHTA 4M3YA 3NH1A 4CK2A 1RBTA 2IGIA 4DLGA 4PUOA 4ZHRA 3ITHA 3RRHA 1BCMA 3L3UA 4K8XA 4M45A 1LWFA 3KKRA 1JKHA 4EZ6A 3OYBA 1D8YA 1TK0A 1BL3A 5HRRA 1NKEA 4N76A 3EY1A 1C1AA 1WSHA 2X6NA 2X74A 1VRUA 4CEBA 4N56A 3K5NA 3PX0A 2D5RA 5KGWA 4CHNA 1EXQA 2RN2A 3DLEA 3LAKA 4FM0A 1BIZA 1X9WA 2PZSA 1BI4B 1A5VA 3ZT3A 2HVHA 2HNYA 2ITGA 3VQAA 3PO5A 2O4IA
chains in the Genus database with same CATH superfamily
1LAWA 4WFNL 4OPJA 1I39A 4IG0A 3O1BA 1VQON 2KW4A 3SQ0A 3VA0A 3D7EO 3TPQA 3AA4A 1GLCG 2DY4A 4R5PA 3SAFA 4LY7A 3OY9A 2P9IB 1IV0A 5JS2A 4CJ7A 4CJ3A 1VSHA 4JLHA 1WSEA 3T69A 5CZ1A 1YF5L 2HBMA 1OVYA 3HYFA 3MX2A 4DSEA 3PLAA 3ENBA 1S1TA 4H5WA 3V9XA 5KGXA 4HUGA 3LZJA 4KRFA 2QA4N 5AQNA 4JEPA 3KD1E 3P1GA 4MQ3A 2GTDA 4FW2A 3PO4A 1S3XA 1HNVA 4H0PA 1RT5A 3OYNA 1VSKA 3IDHA 2P5OA 3TAQA 3I0SA 3HM8A 3JAMO 1NU0A 4B3MK 3TAPA 1Z26A 2HHTA 4YOTA 2JWKA 2JLEA 4CHYA 1KXPA 4CJVA 3DXMB 3QIOA 1ZC6A 4PKHA 3VQ8A 4J2DA 4R79A 4LFAK 4H8KA 4DSIA 4B1XB 4FWOA 3ZT2A 2HHXA 3MMVA 1IKWA 1EETA 2RF2A 1KFDA 1HYZA 3E9OA 4JK9A 4FLXA 3AA3A 3QO9A 3Q7CA 2QKBA 4XEIA 2KFNA 3MWTA 3CJAA 1B92A 4FLZA 3SYZA 2HMPA 2VG5A 3ZLJA 4FK0A 1U45A 4CD3A 4A5BA 4OO1J 4FXDA 4K42A 3CD6N 1NGIA 4H0YB 1U49A 4FJHA 4CZEA 4Z4EA 1HNZK 4A61A 3MXIA 4OVLA 4FLYA 2CGLA 2OPSA 4OLBA 2RKIA 1Z6RA 3F5TA 3NAEA 3KK2A 5K14A 4I2QA 3AY9A 5C42A 4IBNA 1WBBA 1RDAA 4E1NA 2DFFA 5M1PA 4CIFA 4WQ4C 3NF6A 2A3ZA 2OPRA 4C8OA 3OYDA 1GLEG 1X9JA 1NGCA 5E84A 4YHHK 1SKRA 1O13A 2ZF5O 4Z0UA 4DTSA 4B9SA 5C10A 5AQPA 1EKEA 4FJ7A 5BRDA 1T6CA 1NJIO 1S72N 2P9SA 3OYKA 4WQ5C 3NGYA 2IDOA 5JMVA 4CIEA 1Q7YO 4HUFA 2XO7A 2BDPA 5LL6Z 3UIQA 1NM1A 2O8BB 2HHQA 3ATVA 3ZETA 3S9HA 2XRIA 4B9LA 4FWNA 4JHDB 5AQJA 4B1VA 5HRPA 2W6LA 1KRPA 4E7LA 5AQLA 4DR6K 1IBLK 4BC3A 1BQMA 2P5GA 3CETA 4IO9L 2E2OA 4BRNA 4BDYA 4M3XA 3CERA 1QVFM 4C8LA 3J7ZO 3ZYYX 3M1FA 4O0IA 2ZGZA 5GADP 4Z4FA 5M1NA 3GG4A 5BN8A 4L3QA 3MN9A 5CR4A 3T1AA 3I56N 4CF9A 3ID6A 1NBWA 4JI6K 4ILHA 5KQDA 1KAYA 4CEDA 2EX3A 3QLHA 3P31A 4DCHA 4KHPK 3V9SA 3CCRN 3ENHA 5E41A 3H1VX 3THXA 1BQNA 1ZXOA 2P9SB 1G15A 1WSJA 3E1YA 4FJKA 3P4IA 3CYMA 3VQ4A 1ZBHA 2NUBA 3VQBA 3K58A 4DFPA 4JRQA 3VEOA 1NGHA 4DSLA 3QEPA 3DM2A 2P9UA 4UQGA 4I9QA 3MK6A 4YNQA 4O8UA 3CHWA 3BF3A 3ZETB 2H3GX 4E1MA 4DLEA 1TUUA 3KLEA 1XI1A 4FZXC 3KVGA 3OYAA 1SQKA 4CFCA 4B1WB 2I7PA 1VSFA 3QNNA 2HB5A 5I3UA 5FPEA 3AVBA 3SAGA 2Y1JA 1VSLA 4FK2A 3A5NC 5KRTA 3RMCA 4CGHA 5A2QO 1YIJN 1BOTO 4FWLA 3CCLN 4J2EA 4JD2B 3P38A 5KQ8A 4DSKA 2PFUA 4X66K 4YOUA 4DU4A 5BPLA 5BREA 3Q7BA 1BIUA 2E20A 1NK9A 3L2VA 1UOCA 4CECA 3I55N 3MCPA 1KLMA 4C8NA 2YKMA 4DUYK 3MX5A 3E01A 3AVJA 1U2VA 1D4XA 4BR0A 1C0UA 2NRRA 1VSMA 5HRSA 2W42A 3QERA 3LDLA 2P9UB 3CPEA 3MN7A 4JI1K 4DR5K 2ZM6K 1K6YA 3HRGA 5KPZA 3VEXA 3TAFA 2VYPA 3V81A 1VSEA 1GLBG 3QEXA 2FSJA 2D0CA 4KHYA 1JLGA 2WBNA 1HPMA 3A0IX 1G99A 3HPOA 4FK4A 1QQCA 3NBPA 2KTQA 1D5AA 4DV6K 3O9UA 3ZX2A 1WOQA 4FJ8A 1Q18A 4OPHA 2O8EB 1CZAN 4CHOA 4A2AA 3O08A 4CF2A 3HZ6A 3DRPA 4ID5A 3QESA 3KKSA 4CF0A 4HCCA 1GOAA 1VK0A 4EZ9A 3ULEB 4GKJK 1TAUA 2Q0UA 3CCSN 4I2PA 3F2KA 1ASWA 4DSFA 3AGKA 1EP4A 1U2VB 1BA1A 5LJVA 2F7TA 3EN9A 4RW7A 1EO1A 2YV0X 1HJOA 3VQEA 4B3TK 1Q82O 3C94A 4HWIA 3QFUA 3O3FA 2D1KA 2WONA 1VQ7N 4BR7A 1QS4A 5KPRA 4Q0BA 1B9DA 3TANA 1YT3A 4FJMA 4LF8K 5EVZA 5JLHA 3MCAB 5C15A 2ZJQL 3L2WA 3CPWM 3SV4A 3A5LC 1NGDA 4CEFA 2G8FA 2OPQA 1C1CA 1FK9A 2Q36A 3T7ZA 3DOLA 4GKKK 3FZFA 3H08A 3P83D 4B1YB 2FBVA 5LMUK 4CFAA 3O80A 4IO8A 1XMOK 4BVOA 1YXQA 3WNFA 3K5LA 4CJTA 1QSYA 4BRIA 1U4BA 3L4IA 3SK3A 5AQTA 1RT2A 3VOVA 4W5OA 1VSJA 5FPDA 1GOBA 4CD1A 3CC2N 4DS5A 4BRDA 1LCUA 3VESA 2QM1A 3TAMA 2E2QA 4M63C 2E2PA 4CJ4A 2NRTA 4BDZA 3LP1A 5HOOA 3AO1A 4Z4HA 1ZBFA 3U9ZA 2BTFA 4EHTA 4H5VA 3OHRA 3HK2A 3THWA 1S1UA 1BGXT 1VSDA 1RDBA 1N6QA 5F0XA 4JAXA 3U4LA 3NH1A 1P90A 1RBTA 4DV7K 4DLGA 1GLFO 3RRHA 3ITHA 4PUOA 4K8XA 1LWFA 4EZ6A 1NWKA 3VTIA 3OYBA 4N76A 1BL3A 1C1AA 3K5NA 1VRUA 4N56A 1EXQA 1X9WA 3LAKA 4WFBL 1BI4B 3GE1A 4IOAL 2ITGA 4F8RA 1U6ZA 5KRSA 3I33A 3FLCO 1UAXA 5EY4A 4OKEA 3ZSQA 4O55A 2QTDA 1YTAA 5FRMA 4GVMA 3KD5E 2O8DA 2YCHA 3ULDA 2VWJA 3HT3A 4FJJA 4H5TA 2QXLA 1MA9B 1HPZA 4KAZA 4Y1DA 3SJHA 4JS5A 2X6SA 2VG7A 4HTLA 3AVKA 3AVMA 4PWDA 5C2DA 1HQUA 3ALYA 2QWOA 3SMPA 3DYAA 3O5BA 1TL1A 3VEYA 3K59A 4CJSA 4NLBA 1KQSM 3PUFA 1L3TA 3WQUA 1JJ2M 1IBKK 2UXCK 4CJWA 3NF8A 3THWB 2BUPA 2Q97A 2ZJPL 4JK8A 1FXXA 3DRRA 4CHZA 4BGAA 4CFDA 2R7YA 3SNNA 2VGMA 1OVQA 1C1BA 1RDDA 4CW7B 4BRKA 4J8FA 4CEZA 4Z4IA 3LDSA 1XWLA 3OS1A 2ASPA 4B9NA 1CXUA 2A41A 3DXKA 3O4QA 3OYCA 1NKBA 1T03A 4GY2B 4LH5A 2PAVA 4RTFD 3IKMA 4CZLA 2OYQA 2HHSA 3IAYA 4DU3A 2HF4A 4AHCA 4YFUA 3F9KA 3L4QA 1WBDA 4C1NK 1WNSA 5AR0A 1JL2A 1EWQA 4GNIA 3LAMA 3FFKB 3OYFA 1ILYA 3N4QA 4E89A 2G8VA 1WSFA 3IFRA 1T05A 1KVAA 2EHGA 1UA0A 4DTMA 1QSSA 4LH4A 1C0MA 3NHGA 1UWBA 3WXJA 2HW3A 5JS1A 2Z1IA 3K2PA 2VCPA 3RR8A 1EQYA 1I94K 1TKDA 4IXCA 2Z1JA 3HVRA 1YVUA 4LSLA 5M1OA 1EX4A 1LV5A 2WOMA 3V9WA 1JXBA 2IOCA 2GUPA 4JI8K 4HCBA 3TWHA 1BA0A 1JCGA 5BRHA 3DXKB 1YAGA 4IKFA 3L2QA 4PKGA 4RW9A 1S22A 3KLIA 2F96A 5TKYA 4B3OA 1J9AA 4CJFA 1ATNA 4GW6A 2BGGA 3ENOA 3CI5A 4FZZA 3DLBA 1L3VA 3WNGA 4M3RA 3THVA 3AO3A 3WEEA 3M8RA 5DM6L 1HX1A 2QW9A 2NLXA 2FF6A 2PBDA 1VQ8N 3VQ6A 4BRHA 3HPHA 3KIOA 2ZGYA 3IMXA 5AZIB 3SV3A 2A40A 3V9ZA 2O8CA 4WFAL 3O3GA 1S5JA 3VERA 4B1ZA 4F9OA 4JI0K 2GX9A 3E9LA 4H5RA 3AAPA 1ITGA 4O4GA 4C8KA 1Y97A 2ZD1A 3THYA 1QE1A 4CBXA 2B4JA 3B8AX 5AQZA 4KI4A 2OA8A 3VF6A 1HUXA 4JI3K 2V7YA 3ZEUA 5AZJB 3EL2A 3RWUA 5SWMA 1IH7A 1FKPA 4ZTJA 3CIPA 5LMNK 1RDCA 4MO4A 4JKEA 4DV3K 3OYIA 2ATQA 1NJYA 1NGAA 2E6LA 1RBUA 3NMUA 3LDOA 1I3AA 4OGCA 1K8KA 3AVLA 1Q9YA 1IG8A 4Z4CA 2GUIA 3JSMA 4Q5VA 1QZ5A 2AP1A 1FKOA 2GELA 4FCYA 2P9LA 4IOXA 3I0RA 2Q1NA 4KHSA 1BDGA 4JKDA 5HL7L 5SZTA 3CG7A 3LPUA 3CJ1A 3IRXA 4JYAK 2P9NA 5EU7A 3CFRA 4KO0A 3V1QA 5AQGA 4JKCA 3H1QA 3VGMA 4O5FA 3JXUA 5BR9A 3EZWA 3VF4A 1BWFO 4MDBA 3VQ9A 3R1XA 4LF4K 3VEVA 4DQSA 3P39A 5AQKA 3G25A 4KKOA 1BISA 2A1RA 2GEMA 1V4TA 3EE9A 4CE9A 2E4LA 5AQYA 3BUZB 5DK5A 5C2FA 1JLQA 1WSIA 2DFHA 2Q3SA 2UUAK 1WAFA 2X78A 5AQRA 1SAZA 1Y64A 2YHXA 1GLDG 2IVNA 2GBZA 1TUYA 4E19A 3AV9A 4V19S 3DLKA 4NXNK 4B1UB 2V7ZA 3H46O 4CJEA 1JCEA 4AHTA 3ZSRA 1W0HA 4I6MA 3HP6A 3U6FA 4IJAA 2YJFA 1C0TA 1RDWX 4BR4A 2G8KA 1KVCA 3NF7A 3T1HK 2XY8A 3SQ4A 4YOYA 1YJNN 2XY5A 4YDUA 3RR7A 3MXMA 3QB0A 4B3SK 4FJGA 2V51B 2E1YA 4JKGA 4FWMA 1OH6A 1LW0A 4L8RB 4IDHA 2O8FA 1D9DA 4U7BA 2RHKA 3QEIA 3R8EA 2W40A 4BRLA 5CZ2A 4BRQA 1S1VA 5AQSA 3ZX0A 2YI1A 2VG6A 4CVNE 2WUSA 2HNDA 4MDAA 4XH4A 3CQXA 1RT6A 2YKNA 3ZSZA 3ATUA 4GVEA 3FZHA 2O4GA 1NGGA 3NFAA 3SZ2A 5J2NA 1YVNA 4AHVA 1A5XA 1E4FT 1HJRA 4F3TA 4HUEA 3SBTA 2E1ZA 4BE1A 5AQFA 3MEDA 4Y1CA 3PX6A 4FLVA 1J54A 4EAHD 3H6EA 4XIUA 2HHVA 1LW2A 5D3GA 2IAJA 2YHWA 4CZIA 1X3MA 4CEQA 4WF9L 5BPNA 3M8SA 2QWPA 1NGFA 1VQNN 3AVIA 4NLCA 1KD1O 4LSNA 4PL7A 2IVOA 2E2NA 5C25A 4X62K 1NK5A 3M8QA 4DTUA 4K0KK 2YNIA 2QK9A 3AVFA 4NYNA 1NOZA 3O8MA 1N32K 1RT7A 1BHLA 1NK0A 1P8ZA 4QS9A 3FGUA 1NJZA 1SKSA 5I42A 1HRHA 1ZBUA 4DQQA 4BR2A 3G71N 4QCLA 3AVAA 1C6VA 3HTVA 1JLBA 3QEVA 3OYLA 3WUHA 4B9VA 1K9MO 4BDPA 2QWNA 4CZFA 3HM9A 5M1FA 3OJSA 2GV9A 5BPMA 1MDUB 3C6AA 5CE3A 4AQYK 3U3GA 4BROA 1TKZA 2LSNA 1VQ4N 3THXB 4MLHA 4RWTA 4LC9B 4WE1A 3QICA 3K57A 4F2RA 1ZBIA 1B9FA 3MN6A 1JXEA 3K5MA 3DWLA 4CK2A 1BCMA 4JNEA 3BF1A 1D8YA 3EY1A 1WSHA 1Q86O 3PX0A 1XUPO 1M1KO 5H1SQ 5GAEP 4LF6K 3UE5A 3EE8A 2HBKA 5F2RA 4FWKA 4M7YA 4DR2K 3VQAA 3HOTA 2O4IA 4JN4A 2NRXA 4AM7A 2GWKA 4CCHA 4QS7A 3CMEN 4OPKA 3EZ5A 4DQRA 1RT3A 3S3OA 4PHTX 4CK3A 3QETA 3KK3A 4BE0A 5AFUA 4K43A 4DR7K 2D4WA 3ZT0A 5I9EB 4OGEA 4BWMA 4KFBA 3K9KA 4OKKA 4FLTA 1VSIA 3L0QA 4OX9K 3OYJA 2FSNA 1WSGA 5ADXA 4DR1K 1SUQA 1ESVA 1NKCA 4KREA 1IJJA 3H3OB 3ZCMA 3AVGA 3WXLA 5EXWA 3M8PA 2HNZA 5FDLA 3QEWA 3NGIA 4MO5A 2ZWHA 4DTRA 5J1EA 1HNIA 2IC3A 3PSFA 4C1NI 4DV1K 3BY5A 3EKSA 2UUBK 5GAHP 3RVCA 4JKFA 4O5BA 5GINA 2D0BA 2UXDK 3CXCM 4DF8A 4G1QA 1RCHA 4M41A 2XHBA 3FZKA 2JGUA 3C6HA 3LP0A 3P5JA 1LWEA 1X9SA 3WXMB 4KHWA 1GLAG 3KLFA 1XHXA 3V1RA 2QWQA 4B9TA 4DQIA 2VWBA 1W2BM 3UB5A 1ZYQA 4BC2A 3J7YP 4CZGA 4DFKA 4G9ZA 4EP4A 4GV3A 1T3VA 3U9DA 4W5TA 2P9PA 4ICLA 4IZ9A 3FZMA 3TSUA 1S1WA 5FRNA 3DMJA 4J2AA 1CXQA 1T8EA 3CMAN 4JI4K 2QWLA 2BANA 2P9KA 1MU2A 5JVGL 2PY5A 3ZSXA 1N8RO 3MN5A 5CYQA 1XMQK 5AQIA 5J2QA 1QHAA 4JKBA 4X65K 4FJLA 1Q81O 2KLAA 1RILA 2QKKA 2D0OA 3L2RA 2QXFA 1K8AO 4CI6A 1SL2A 1E3MA 3CM5A 4CESA 5HBMA 4KBOA 3GL1A 4CF1A 1SL1A 1R0AA 3TI0A 3CC7N 3KJVA 3SUQA 1VHXA 4A5AA 3AGRA 2P51A 3DLHA 2KKZA 4YDUC 4JI7K 3EO3A 3PX4A 2HMIA 3LM2A 4BVPA 2A6AA 4DU1A 1IKXA 4HTUA 2F8TA 4QOZB 4RCHA 3SJJA 3TARA 3OW2M 2P9PB 2HOEA 3EKUA 4FYDA 1ATSA 5JVHL 4FM1A 1TK5A 1XHZA 1RFQA 3SCXA 4BREA 4BR5A 4CJRA 3QMLA 4IFEA 2P9KB 5AQOA 2A5XA 3O9QA 5GIPA 4PY5A 3RSEA 2VQFK 2ZQBA 1TYQA 4FLWA 1ASUA 3FFIA 4H03B 1NK7A 4XH1A 2NZTA 4RW6A 3CCEN 5AQQA 4RG8A 2I7NA 5CY4A 3MECA 1HR0K 4B3RK 4H0XB 1HNXK 1RT4A 1W97L 1R59O 3UKUA 5FROA 3SUPA 4FJXA 3ID8A 2HF3A 3A5OC 2FXUA 2CGJA 3VPZA 3RTVA 2OCEA 3E9PA 3N4PA 3W3DA 3FR0A 3C6TA 2BE2A 3LDQA 2NRZA 4BACA 4CZHA 3ZSWA 5CHIA 3CCUN 4OJRA 3T3FA 4BG9A 3C0BA 1KAZA 4E7HA 4KHUA 3TAGA 1XC9A 4F2SA 4N47A 3CC4N 4RW8A 4Z4GA 3NH0A 4N5SA 1VQKN 1VQ9N 4PKIA 4KH6A 2CGKA 1LAVA 2O8DB 4YOXA 1J53A 4JK7A 3IUCA 4IEIA 2HBJA 1N33K 3NVMA 1XQSC 2XY7A 2E8AA 1Q8IA 5FPNA 2E88A 3CM6A 4OLAA 3HPGA 4FW1A 3AO2A 4K41A 1REVA 3SBGA 4CJQA 5GIOA 4FJIA 3A2FA 2Z1HA 3OS0A 4O44A 1KFSA 1RNHA 3EEQA 1NMDA 1S6QA 4LFCK 5AQVA 4DV0K 4BG8A 3DLGA 1YJ9N 1NK4A 5AQMA 1HNWK 1DTQA 1NLVA 4IEEA 1BO5O 3HSCA 2OZSA 3E66A 3LM9A 5KTQA 2IVPA 3TSPA 3TTFA 4BE2A 4KHNA 5JICA 3OTOK 3QFPA 4CGGA 3PIOL 1QQOA 4O8KA 2RPIA 5DMRA 2UUCK 1KSPA 4XH5A 4WYBA 2J4RA 1S9EA 4CGDA 3RMDA 3QIPA 1ASVA 4DF4A 4BRFA 3T1YK 1NNEA 5CYMA 1DTTA 3NF9A 1RTJA 1HQEA 2PYLA 4EP5A 1HLUA 3SUNA 2AA4A 2E6MA 2VGNA 3CFPA 5B8HA 3IS9A 1J5EK 4ELUA 1VQLN 3AO4A 1BCOA 4BQLA 3HSTB 4GMJB 4EHUA 1GLLO 1HKCA 3DXMA 5LY3A 2QEXN 4CHQA 1HYSA 3F73A 4CGJA 1OH7A 3LWMA 4IWVA 4A57A 2JWLA 2KHOA 4E7JA 4FLUA 3LALA 2ITMA 1SL0A 4F3OA 3HO1A 3CQ8A 1UA1A 4H5NA 5F1XA 1J5OA 1C0FA 4M3UA 2AJQA 4BY9C 3QBXA 4B8AB 2OZMA 1IKVA 1QQMA 2KZZA 3G6EN 4FL9A 3NGZA 3D6RA 3TR8A 2WTUA 5FLXO 1TV6A 3G4SN 4DQPA 2W6KA 3J80O 5AQUA 2ZE2A 1QSLA 3M5RA 2OANA 4OPAA 4Y0WA 3CJ7A 3VQQA 4BRGA 3BGRA 2Y1IA 4IOCL 2ASOA 3CFOA 3H45C 3BEXA 3DOKA 1O1WA 3KTQA 3A5MC 3WEEB 1CZBA 3WQTA 5J2MA 3W0LA 2YNHA 5ELZA 4EIAA 3S3NA 4FOEA 2O8CB 3K5OA 3HOSA 4CJ5A 2OTLN 3VQ7A 4N41A 4KPYA 2KZMA 5AFUH 5EX5A 1NK8A 1DLOA 2HVIA 3V4IA 3LL3A 4JI2K 1RTHA 3ZSYA 3V9UA 3TTCA 3THYB 1X3NA 5C24A 5ADXH 1JL1A 5M1QA 3JYTA 5MLCQ 1TVRA 3OBYA 4M42A 3LZIA 4AF1A 1L3UA 3VENA 5BN9A 3L6QA 3ZEUB 1RBVA 1KLNA 3I8BA 3K9JA 2O8BA 3O9RA 4KH5A 3KK1A 5LJWA 4DFJA 5HRNA 3NH2A 2UXBK 4M7XA 4JHDA 3AAQA 2NRVA 3BP8A 2ZJRL 3TTDA 4CHPA 1K8KB 5FPMA 4JKAA 3OS2A 1RTDA 5E26A 2B5JA 3VEWA 1DT9A 3SUOA 2Q31A 2YNGA 3SLCA 3HI0A 5JLFA 2P9LB 3R9PA 5IWAK 3MXJA 1L3SA 4LF9K 5DM7L 4AHRA 2WFBA 3LPTA 4BWJA 2IGIA 4ZHRA 4LF5K 2EWSA 3MWPA 4M45A 3K0SA 3KKRA 1JKHA 1XC3A 1TK0A 5HRRA 1NKEA 3D2FA 2P9NB 4FM0A 3DLEA 1BIZA 4FVUA 4KH4A 1VQ6N 3PO5A 1W7AA 2E5LK 4E0DA 4ISGA 2NRHA 1SKWA 1YI2N 3RRGA 3FE1A 3AA2A 3DAWA 4FM2A 3S3MA 3QINA 1TKTA 3D2EA 3HP9A 3KZBA 4AM6A 4DTOA 4CBWA 3V1OA 1RBSA 2HSTA 3AARA 2A1SA 2CH6A 4IFYA 4CERA 2Q2RA 4BRMA 4CJKA 4KB0A 4LFBK 3O3HA 1MWKA 3AVCA 2GWJA 4CEOA 5C0YA 1U48A 4DR4K 5HROA 2G8HA 4MLEA 2FLOA 2YNFA 3C95A 1GLJO 4IJNA 3J81O 4TSXA 1HYVA 2D0PA 3OA9A 4FPBA 3AA5X 4JD2A 4DHYA 1VQPN 4I6MB 5HLFA 2YHYA 3D2FB 3CQYA 1H1VA 5AQXA 1DKGD 1DGKN 1KTQA 4GV6A 3M3ZA 3F9MA 4H4OA 3QNOA 4BGBA 2XY6A 3L2UA 3CCMN 4FSVA 4JKGB 4B08A 4DG1A 3MEEA 1NGJA 2O8FB 1VAZA 4ELTA 1Q9XA 1S6PA 3WT0A 4CGIA 3G0ZA 3O4NA 3D2EB 3B6PA 3SQ1A 1VQ5N 4NYFA 1D9FA 3HL8A 1S9GA 1HKGA 3ZT1A 2A42A 1X9MA 4CIGA 2ASMA 3O9SA 2F9WA 3RMAA 1RTIA 2BH1A 4B9QA 3VQDA 3EYZA 4ISEA 1J6ZA 4AHUA 4BR9A 1BUPA 4H0OA 4KTWA 2DTUA 3TAEA 3VGKA 2O8EA 3VF2A 4YORA 3DRSA 4BQZA 3KLGA 3KWGA 3PY8A 2NNWA 2YJEA 4EFHA 4FOIA 2D0AA 2FSKA 3O1WA 3TSQA 3GDQA 4E3SA 4IG3A 1NMNA 4YY3K 2FF3B 4CFBA 4NO7A 3MDQA 4DV4K 4DWIA 1U04A 3OYHA 1BG3A 4NXMK 4DTNA 3ULEA 4JS4A 3MEGA 3GOIA 3OVNA 4DFMA 4DR3K 4M3ZA 4HVJA 3NCIA 1VQMN 4FJ9A 5KPTA 3U8XA 4DUZK 4ID1A 5AQHA 2FBTA 4FJNA 3WNHA 4KV8A 3SMSA 3O4WA 1OKJA 2F9TA 4CZMA 4O0JA 3NDKA 2G8WA 2I5JA 1JLEA 2Z1GA 3WXKA 1N36K 1N34K 4FPAA 2HHHK 4NCBA 5GAGP 4FJ5A 4PQUA 2G8UA 4DV2K 2OTJN 3C6UA 3CF5L 1M90O 1CLQA 3HVTA 3ZX3A 3WNEA 1IG9A 3ZSVA 4AHSA 1HMVA 1DEJA 4KHQA 4H4MA 5BR8K 4DV5K 1FJGK 3L3VA 2HHWA 3HJFA 3O9TA 4PL8A 3R6MA 3H3NO 2Q0RA 3VETA 1IBMK 1QQNA 1SV5A 4IFVA 1CZ9A 4NB4A 4CJUA 3CCQN 1GOCA 1JCFA 1TAQA 2G8IA 4NCAA 1N5YA 3VQ5A 2VQEK 3SI6A 1RGIA 4A59A 1L5UA 3U3YA 1NGBA 3CJBA 4KB1A 4IDKA 1RDUA 3PV8A 3LP3A 1NJWA 1JLFA 3VEZA 4YOWA 4KI6A 3B6OA 5EOYA 3VQCA 4E7KA 1XNQK 3D0PA 4ILGB 5AJ3K 4CZKA 3RMBA 2W41A 1QZ6A 2RE2A 3O6WA 3VN5A 4CF8A 1YJWN 1WAJA 3ASMA 4H0TB 4E1JA 4OKJA 2ETJA 1MWMA 1OH5A 1QHTA 3UKRA 1X1PA 4DQ8A 1BI4A 4F4KA 1K73O 1KAXA 4CJPA 3FZLA 5C12A 1OH8A 3CCJN 3BZKA 3ZT4A 2FBYA 3QDKA 3AVHA 4DTJA 4JV5K 4BRCA 3LWLA 3C7NA 4E7IA 4DB3A 4BRAA 1QVGM 1VRTA 3MAQA 2B6AA 4I7FA 3VQPA 1U47A 1KC8O 3J7AP 3KLHA 4DS4A 4CK1A 2QWMA 2YX6A 3JS6A 4FVMA 3TU5A 3IG1A 2DPNA 2QWRA 4MFBA 4QAGA 4PA1A 1ZBSA 4DKWA 4DMNA 4GV9A 2YHAA 3LDPA 4LD0A 4M3WA 4M3TA 2KQ2A 1A5WA 2P1JA 4W5NA 5IT9O 4K8ZA 4AH9A 4DTXA 1JLAA 4DTPA 2QI2A 3G10A 1JLCA 1T6DA 1FW6A 3S41A 2UYTA 3KHYA 4ELVA 4FWQA 2F4VK 4ISFA 2FC0A 3LDNA 3LP2A 5KI6A 1LWCA 2CH5A 4I9LA 3C65A 3UKRB 1YUWA 4CGFA 1LOTB 1ZBLA 4WQ4A 5M1KA 1SZ2A 3SQ2A 4X64K 4A2BA 3CCVN 1YHQN 3PSIA 2YHBA 1WLJA 3TABA 3J8AA 4UY8O 1TKXA 4BC5A 1QTMA 3DJCA 3C7NB 3OBWA 3OYEA 3VA3A 3DLLL 2WC9A 3T19A 1WB9A 4JI5K 3SPYA 4BRPA 4WQ5A 4Z94A 1NOYA 1C0GA 1Z25A 3KK7A 4B8CA 2V52B 2VWKA 3D45A 4LF7K 4FWPA 3CJ9A 1KCFA 4CEAA 3QBWA 4YOVA 1IO2A 3V6DA 1F21A 1T44A 3NE6A 4NCGA 1RT1A 4CBUA 2DFEA 3BDPA 4AILC 4WCEL 4B9UA 4C23A 4JRPA 4ZTFA 1ATRA 3A8YA 3L8BA 4C8MA 3HXMA 4CZJA 4J2BA 4U67L 1T7PA 3LANA 4RW4A 3SAHA 1W9HA 4W5QA 1WN7A 1IKYA 4ILJA 1SS6A 3OYMA 1NK6A 3RSEB 2NRWA 1TGOA 5TKWA 2FBXA 3CJCA 2UU9K 2OPPA 5J2PA 1TYQB 3AO5A 3KWIA 4K25A 3BZCA 1Z05A 5AQWA 1V4SA 1YTUA 1KVBA 5HP1A 3OYGA 1NJXA 4CJLA 4CEEA 3UKUB 2F8SA 3AVNA 1S1XA 4KTZA 1WUAA 1NGEA 3M6GA 3OJUA 4DSJA 4KTQA 1HKBA 4FZYA 3NVKA 5AZIA 2IS3A 1XNRK 2P9IA 3DLRA 4W5RA 1RBRA 4A62A 3GBTA 3DI6A 3VGLA 1E4GT 3SPZA 3ZSOA 3R3LA 2PYJA 3I8DA 3ISNC 4FWSA 4FO0A 4H0VB 1TK8A 5T7BA 1TL3A 2KFZA 3WXIA 4B9MA 4FWRA 2HHUA 5AZJA 3HBTA 2IIRA 4HHTA 3VTHA 4M3YA 3PIPL 3L3UA 3VMFB 5BRFA 4JKHA 4BC4A 1EWRA 4QS8A 2X6NA 2X74A 4CEBA 2D5RA 5KGWA 4CHNA 2RN2A 2PZSA 1BU6O 1YITN 1A5VA 3ZT3A 2HVHA 2HNYA 2HBLA 1NG9A
chains in the Genus database with same CATH topology
1LAWA 5KRSA 4E0DA 4CCHA 4OPJA 1UAXA 1I39A 4IG0A 1SKWA 4OKEA 3ZSQA 4OPKA 4O55A 3RRGA 1YTAA 5FRMA 4GVMA 3KD5E 2KW4A 3AA2A 3EZ5A 4FM2A 3VA0A 4DQRA 3SQ0A 1RT3A 3S3OA 4CK3A 3AA4A 3QETA 3S3MA 3QINA 3KK3A 2DY4A 4R5PA 4LY7A 3OY9A 1TKTA 2VWJA 3ULDA 3HP9A 5JS2A 3HT3A 4BE0A 4FJJA 4CJ3A 1VSHA 4JLHA 1HPZA 1WSEA 3ZT0A 4DTOA 4KAZA 4OGEA 4Y1DA 3V1OA 5CZ1A 4JS5A 1RBSA 2X6SA 2VG7A 4BWMA 4KFBA 4OKKA 4FLTA 3HYFA 1VSIA 3AVKA 3AVMA 2A1SA 4IFYA 4CERA 1HQUA 3OYJA 3ALYA 1S1TA 4DSEA 4PWDA 1WSGA 3DYAA 4CJKA 4KB0A 3V9XA 5KGXA 4HUGA 1TL1A 3LZJA 4KRFA 1SUQA 3O3HA 3K59A 4CJSA 3AVCA 3KD1E 3P1GA 4CEOA 1NKCA 3PUFA 4KREA 1U48A 1L3TA 4MQ3A 5HROA 4FW2A 3ZCMA 3AVGA 3PO4A 1HNVA 4CJWA 3M8PA 3NF8A 2HNZA 5FDLA 1RT5A 3QEWA 2YNFA 2G8HA 3C95A 3NGIA 1FXXA 4TSXA 3OYNA 4DTRA 5J1EA 1HNIA 2IC3A 1VSKA 1HYVA 2P5OA 3DRRA 3TAQA 3I0SA 4CHZA 3AA5X 4O5BA 2D0BA 4CFDA 2R7YA 4DF8A 4G1QA 3SNNA 1RCHA 1C1BA 1RDDA 4M41A 2XHBA 5HLFA 4Z4IA 2JGUA 3LP0A 4CEZA 1Z26A 3TAPA 3P5JA 2HHTA 3LDSA 1XWLA 1LWEA 1X9SA 2JLEA 4CHYA 4KHWA 3OS1A 4B9NA 4CJVA 3KLFA 1XHXA 1CXUA 1KTQA 3QIOA 3V1RA 4B9TA 4DQIA 4H4OA 3O4QA 3QNOA 3OYCA 1NKBA 1T03A 3VQ8A 4LH5A 4J2DA 1ZYQA 2XY6A 3L2UA 4H8KA 4DSIA 4DFKA 4B08A 4DG1A 4EP4A 3ZT2A 3MEEA 2HHXA 2OYQA 2HHSA 3IAYA 4ELTA 4W5TA 1Q9XA 1IKWA 1S6PA 4ICLA 4DU3A 1EETA 4AHCA 2RF2A 4CGIA 4YFUA 1KFDA 1HYZA 3F9KA 4FLXA 3G0ZA 3AA3A 1S1WA 3O4NA 1WNSA 3QO9A 5FRNA 2QKBA 3DMJA 3B6PA 3SQ1A 4J2AA 2KFNA 1CXQA 1T8EA 1B92A 4FLZA 4NYFA 1D9FA 3HL8A 1S9GA 1JL2A 3ZT1A 2BANA 3SYZA 1X9MA 2VG5A 1MU2A 4CIGA 2PY5A 4FK0A 3LAMA 1U45A 3ZSXA 3OYFA 4E89A 3RMAA 5CYQA 2G8VA 4FXDA 1WSFA 1RTIA 5J2QA 1U49A 1T05A 3VQDA 1KVAA 3EYZA 2EHGA 4FJHA 1UA0A 4DTMA 1QSSA 4AHUA 4Z4EA 4LH4A 1C0MA 1RILA 2QKKA 3MXIA 4OVLA 3L2RA 2QXFA 3NHGA 4FLYA 1UWBA 4KTWA 2DTUA 1SL2A 2OPSA 2HW3A 3CM5A 4OLBA 2Z1IA 4CESA 5JS1A 3K2PA 3TAEA 2RKIA 5HBMA 3RR8A 3NAEA 4CF1A 1SL1A 3KK2A 1TKDA 2Z1JA 1R0AA 3DRSA 3TI0A 3KJVA 5K14A 4I2QA 1YVUA 4LSLA 5C42A 3KLGA 3HVRA 4IBNA 3PY8A 3SUQA 1EX4A 1LV5A 1RDAA 2D0AA 4E1NA 2WOMA 3V9WA 1JXBA 2DFFA 4IG3A 4E3SA 2IOCA 2P51A 4CIFA 4FJLA 4CFBA 4HCBA 3TWHA 3NF6A 3DLHA 4DWIA 1U04A 3OYHA 4DTNA 2OPRA 4C8OA 3OYDA 4JS4A 4IKFA 3MEGA 3L2QA 1SKRA 4RW9A 3OVNA 4DFMA 4Z0UA 4DTSA 3KLIA 3PX4A 2HMIA 4B9SA 2F96A 4M3ZA 4HVJA 4DU1A 1IKXA 4HTUA 3NCIA 2F8TA 4B3OA 1EKEA 1J9AA 3SJJA 4CJFA 3TARA 4FJ7A 4FJ9A 4QOZB 4GW6A 2BGGA 2HVIA 4FYDA 3OYKA 4FZZA 3NGYA 2IDOA 3DLBA 1L3VA 3WNGA 4ID1A 4CIEA 4M3RA 3THVA 3AO3A 4HUFA 2XO7A 3M8RA 2FBTA 2BDPA 4FJNA 3WNHA 4FM1A 4KV8A 3UIQA 1TK5A 1XHZA 3VQ6A 3SCXA 4CJRA 3HPHA 3KIOA 2HHQA 4O0JA 3SV3A 3NDKA 3V9ZA 2G8WA 2I5JA 3S9HA 1JLEA 2XRIA 4B9LA 2Z1GA 3O3GA 4PY5A 1S5JA 5HRPA 2ZQBA 4NCBA 1KRPA 2HHVA 4FJ5A 4FLWA 4PQUA 2G8UA 1ASUA 3FFIA 4E7LA 1ITGA 3C6UA 4O4GA 1CLQA 3HVTA 1NK7A 4C8KA 1BQMA 1Y97A 2ZD1A 3WNEA 1IG9A 2P5GA 3ZSVA 4RW6A 1HMVA 1QE1A 4AHSA 4BDYA 2B4JA 4RG8A 4KHQA 4H4MA 4M3XA 4C8LA 5CY4A 3MECA 3L3VA 4KI4A 2HHWA 2OA8A 3HJFA 1RT4A 4O0IA 4Z4FA 5FROA 3SUPA 4FJXA 1SV5A 4IFVA 1CZ9A 3RTVA 3RWUA 4CJUA 3T1AA 5SWMA 1GOCA 4CF9A 1IH7A 1TAQA 1FKPA 4ZTJA 2G8IA 3C6TA 2BE2A 4NCAA 1RDCA 4BACA 3OYIA 2ATQA 3ZSWA 1NJYA 1N5YA 2E6LA 1RBUA 3VQ5A 1I3AA 4OJRA 3T3FA 3SI6A 4OGCA 4CEDA 2EX3A 3AVLA 3QLHA 1Q9YA 4Z4CA 3V9SA 2GUIA 4E7HA 3JSMA 4KHUA 4Q5VA 3TAGA 3U3YA 1XC9A 5E41A 4N47A 1L5UA 4F2SA 4KB1A 1BQNA 4RW8A 1G15A 1WSJA 4IDKA 4FJKA 3NH0A 4Z4GA 4N5SA 1FKOA 3VQ4A 3CYMA 3LP3A 3PV8A 1NJWA 2NUBA 1JLFA 1ZBHA 4FCYA 3VQBA 3K58A 4DFPA 4JRQA 4J2EA 4KI6A 3B6OA 4DSLA 3VQCA 4E7KA 3QEPA 3DM2A 3I0RA 3D0PA 1LAVA 4UQGA 4I9QA 4KHSA 1J53A 4YNQA 3RMBA 4E1MA 5SZTA 3CG7A 4CF8A 4DLEA 3VN5A 3KLEA 2XY7A 1XI1A 1WAJA 1Q8IA 3LPUA 3ASMA 4FZXC 3CM6A 4OLAA 3HPGA 3IRXA 4FW1A 3AO2A 4OKJA 1REVA 4CJQA 2ETJA 4FJIA 5EU7A 3CFRA 3A2FA 3OYAA 2Z1HA 4KO0A 4CFCA 3V1QA 3OS0A 1QHTA 1VSFA 3QNNA 4O44A 2HB5A 1X1PA 5I3UA 1BI4A 1KFSA 3AVBA 1RNHA 4F4KA 2Y1JA 1VSLA 4FK2A 1S6QA 5KRTA 3VQ9A 4CJPA 3RMCA 1NK4A 3DLGA 3ZT4A 4CGHA 2FBYA 3AVHA 4DQSA 4DTJA 1DTQA 4KKOA 3LWLA 1BISA 2A1RA 4E7IA 4CE9A 2OZSA 1VRTA 3MAQA 2B6AA 4I7FA 3VQPA 2E4LA 5KTQA 1U47A 4DSKA 4DU4A 4BE2A 4KHNA 1BIUA 5DK5A 3KLHA 4DS4A 1JLQA 4CK1A 1NK9A 4CGGA 4FVMA 3L2VA 1WSIA 1UOCA 3IG1A 4CECA 2RPIA 1KLMA 4MFBA 4QAGA 4PA1A 5DMRA 2DFHA 4DMNA 2Q3SA 4C8NA 2YHAA 2YKMA 1WAFA 1KSPA 2X78A 3E01A 4LD0A 3AVJA 1S9EA 4CGDA 2GBZA 4E19A 1C0UA 3RMDA 1VSMA 3QIPA 1ASVA 5HRSA 2W42A 4M3WA 4M3TA 4DF4A 3QERA 3AV9A 2KQ2A 1A5WA 2P1JA 4W5NA 3DLKA 1DTTA 5CYMA 4AH9A 4K8ZA 3NF9A 1RTJA 4DTXA 1JLAA 1HQEA 4DTPA 3G10A 4CJEA 2PYLA 1JLCA 4AHTA 1K6YA 3ZSRA 4EP5A 3SUNA 1W0HA 4ELVA 3HP6A 2E6MA 3CFPA 3U6FA 3TAFA 2FC0A 3IS9A 3LP2A 1C0TA 5KI6A 3V81A 4ELUA 1LWCA 1VSEA 3AO4A 4I9LA 1BCOA 3QEXA 3HSTB 4GMJB 2D0CA 2G8KA 4KHYA 1JLGA 1KVCA 3NF7A 4CGFA 1ZBLA 2XY8A 3SQ2A 3SQ4A 4CHQA 3HPOA 1HYSA 2XY5A 4FK4A 3F73A 1QQCA 4CGJA 3NBPA 3MXMA 3RR7A 2KTQA 3LWMA 1D5AA 2YHBA 4FJGA 1WLJA 3TABA 4E7JA 4FLUA 1LW0A 1TKXA 3LALA 1SL0A 4F3OA 4L8RB 4FJ8A 1D9DA 3HO1A 3CQ8A 1QTMA 1UA1A 3QEIA 3OYEA 3VA3A 1J5OA 3T19A 4M3UA 2AJQA 3SPYA 4CHOA 4B8AB 5CZ2A 2OZMA 1S1VA 4CF2A 1IKVA 1NOYA 3DRPA 4ID5A 2KZZA 3QESA 3KKSA 3NGZA 1Z25A 4CF0A 3TR8A 2VG6A 2VWKA 4B8CA 4HCCA 3D45A 1TV6A 2HNDA 1GOAA 4DQPA 1KCFA 1VK0A 4EZ9A 4CEAA 2ZE2A 1RT6A 1QSLA 2YKNA 3ZSZA 1TAUA 1IO2A 3V6DA 1F21A 2O4GA 4I2PA 3NE6A 1ASWA 3NFAA 4NCGA 3SZ2A 1RT1A 4DSFA 1EP4A 5J2NA 4AHVA 2DFEA 3VQQA 1A5XA 1HJRA 3BGRA 2Y1IA 3BDPA 4F3TA 4AILC 4HUEA 4RW7A 2YV0X 4B9UA 3CFOA 4JRPA 4BE1A 3VQEA 4ZTFA 3MEDA 3DOKA 4Y1CA 1O1WA 4C8MA 3HXMA 3L8BA 3C94A 3PX6A 4FLVA 3KTQA 1J54A 4J2BA 1CZBA 3O3FA 2WONA 4XIUA 1LW2A 5J2MA 3LANA 1T7PA 5D3GA 4RW4A 2IAJA 1W9HA 4CEQA 1QS4A 2YNHA 4W5QA 1WN7A 1IKYA 3M8SA 3S3NA 4Q0BA 1B9DA 3OYMA 3AVIA 1YT3A 3K5OA 3TANA 4LSNA 4CJ5A 1NK6A 4FJMA 3VQ7A 4N41A 3L2WA 4KPYA 2KZMA 1TGOA 5C25A 1NK5A 2FBXA 3M8QA 3SV4A 4DTUA 2YNIA 2QK9A 1NK8A 1DLOA 2OPPA 3AVFA 5J2PA 4CEFA 4NYNA 2OPQA 3V4IA 1NOZA 3AO5A 1C1CA 2G8FA 1FK9A 1RT7A 1BHLA 3DOLA 1RTHA 3ZSYA 3V9UA 1NK0A 3H08A 3P83D 1NJZA 1SKSA 1YTUA 1KVBA 5C24A 2FBVA 1JL1A 1HRHA 3JYTA 5I42A 1ZBUA 4CFAA 5HP1A 1TVRA 3OYGA 4DQQA 1NJXA 4M42A 3LZIA 3WNFA 1L3UA 4QCLA 4CJLA 3K5LA 4CJTA 1QSYA 3AVAA 4CEEA 1C6VA 2F8SA 3AVNA 1JLBA 3QEVA 1U4BA 3OYLA 1S1XA 1RBVA 4KTZA 1KLNA 3OJUA 4DSJA 4KTQA 4FZYA 1RT2A 3KK1A 4DFJA 5HRNA 3NH2A 4B9VA 4W5OA 2IS3A 1VSJA 3DLRA 4W5RA 4BDPA 1GOBA 3HM9A 1RBRA 4DS5A 3OJSA 4F8RA 2GV9A 3DI6A 4CHPA 3SPZA 3ZSOA 3TAMA 3U3GA 4CJ4A 3OS2A 4BDZA 1RTDA 2PYJA 1TKZA 3LP1A 3I8DA 3AO1A 2LSNA 3ISNC 4Z4HA 1ZBFA 2B5JA 1TK8A 3SUOA 2YNGA 5T7BA 4WE1A 1TL3A 2KFZA 3K57A 3MXJA 3HK2A 4F2RA 1ZBIA 4B9MA 1L3SA 2HHUA 1S1UA 1BGXT 1B9FA 1VSDA 1RDBA 4AHRA 3LPTA 4BWJA 1N6QA 1JXEA 3K5MA 4HHTA 4M3YA 3NH1A 4CK2A 1RBTA 2IGIA 4DLGA 4PUOA 4ZHRA 3ITHA 3RRHA 1BCMA 3L3UA 4K8XA 4M45A 1LWFA 3KKRA 1JKHA 4EZ6A 3OYBA 1D8YA 1TK0A 1BL3A 5HRRA 1NKEA 4N76A 3EY1A 1C1AA 1WSHA 2X6NA 2X74A 1VRUA 4CEBA 4N56A 3K5NA 3PX0A 2D5RA 5KGWA 4CHNA 1EXQA 2RN2A 3DLEA 3LAKA 4FM0A 1BIZA 1X9WA 2PZSA 1BI4B 1A5VA 3ZT3A 2HVHA 2HNYA 2ITGA 3VQAA 3PO5A 2O4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAW A;  5KRS A;  4E0D A;  4CCH A;  4OPJ A;  1UAX A;  1I39 A;  4IG0 A;  1SKW A;  4OKE A;  3ZSQ A;  4OPK A;  4O55 A;  3RRG A;  1YTA A;  5FRM A;  4GVM A;  3KD5 E;  2KW4 A;  3AA2 A;  3EZ5 A;  4FM2 A;  3VA0 A;  4DQR A;  3SQ0 A;  1RT3 A;  3S3O A;  4CK3 A;  3AA4 A;  3QET A;  3S3M A;  3QIN A;  3KK3 A;  2DY4 A;  4R5P A;  4LY7 A;  3OY9 A;  1TKT A;  2VWJ A;  3ULD A;  3HP9 A;  5JS2 A;  3HT3 A;  4BE0 A;  4FJJ A;  4CJ3 A;  1VSH A;  4JLH A;  1HPZ A;  1WSE A;  3ZT0 A;  4DTO A;  4KAZ A;  4OGE A;  4Y1D A;  3V1O A;  5CZ1 A;  4JS5 A;  1RBS A;  2X6S A;  2VG7 A;  4BWM A;  4KFB A;  4OKK A;  4FLT A;  3HYF A;  1VSI A;  3AVK A;  3AVM A;  2A1S A;  4IFY A;  4CER A;  1HQU A;  3OYJ A;  3ALY A;  1S1T A;  4DSE A;  4PWD A;  1WSG A;  3DYA A;  4CJK A;  4KB0 A;  3V9X A;  5KGX A;  4HUG A;  1TL1 A;  3LZJ A;  4KRF A;  1SUQ A;  3O3H A;  3K59 A;  4CJS A;  3AVC A;  3KD1 E;  3P1G A;  4CEO A;  1NKC A;  3PUF A;  4KRE A;  1U48 A;  1L3T A;  4MQ3 A;  5HRO A;  4FW2 A;  3ZCM A;  3AVG A;  3PO4 A;  1HNV A;  4CJW A;  3M8P A;  3NF8 A;  2HNZ A;  5FDL A;  1RT5 A;  3QEW A;  2YNF A;  2G8H A;  3C95 A;  3NGI A;  1FXX A;  4TSX A;  3OYN A;  4DTR A;  5J1E A;  1HNI A;  2IC3 A;  1VSK A;  1HYV A;  2P5O A;  3DRR A;  3TAQ A;  3I0S A;  4CHZ A;  3AA5 X;  4O5B A;  2D0B A;  4CFD A;  2R7Y A;  4DF8 A;  4G1Q A;  3SNN A;  1RCH A;  1C1B A;  1RDD A;  4M41 A;  2XHB A;  5HLF A;  4Z4I A;  2JGU A;  3LP0 A;  4CEZ A;  1Z26 A;  3TAP A;  3P5J A;  2HHT A;  3LDS A;  1XWL A;  1LWE A;  1X9S A;  2JLE A;  4CHY A;  4KHW A;  3OS1 A;  4B9N A;  4CJV A;  3KLF A;  1XHX A;  1CXU A;  1KTQ A;  3QIO A;  3V1R A;  4B9T A;  4DQI A;  4H4O A;  3O4Q A;  3QNO A;  3OYC A;  1NKB A;  1T03 A;  3VQ8 A;  4LH5 A;  4J2D A;  1ZYQ A;  2XY6 A;  3L2U A;  4H8K A;  4DSI A;  4DFK A;  4B08 A;  4DG1 A;  4EP4 A;  3ZT2 A;  3MEE A;  2HHX A;  2OYQ A;  2HHS A;  3IAY A;  4ELT A;  4W5T A;  1Q9X A;  1IKW A;  1S6P A;  4ICL A;  4DU3 A;  1EET A;  4AHC A;  2RF2 A;  4CGI A;  4YFU A;  1KFD A;  1HYZ A;  3F9K A;  4FLX A;  3G0Z A;  3AA3 A;  1S1W A;  3O4N A;  1WNS A;  3QO9 A;  5FRN A;  2QKB A;  3DMJ A;  3B6P A;  3SQ1 A;  4J2A A;  2KFN A;  1CXQ A;  1T8E A;  1B92 A;  4FLZ A;  4NYF A;  1D9F A;  3HL8 A;  1S9G A;  1JL2 A;  3ZT1 A;  2BAN A;  3SYZ A;  1X9M A;  2VG5 A;  1MU2 A;  4CIG A;  2PY5 A;  4FK0 A;  3LAM A;  1U45 A;  3ZSX A;  3OYF A;  4E89 A;  3RMA A;  5CYQ A;  2G8V A;  4FXD A;  1WSF A;  1RTI A;  5J2Q A;  1U49 A;  1T05 A;  3VQD A;  1KVA A;  3EYZ A;  2EHG A;  4FJH A;  1UA0 A;  4DTM A;  1QSS A;  4AHU A;  4Z4E A;  4LH4 A;  1C0M A;  1RIL A;  2QKK A;  3MXI A;  4OVL A;  3L2R A;  2QXF A;  3NHG A;  4FLY A;  1UWB A;  4KTW A;  2DTU A;  1SL2 A;  2OPS A;  2HW3 A;  3CM5 A;  4OLB A;  2Z1I A;  4CES A;  5JS1 A;  3K2P A;  3TAE A;  2RKI A;  5HBM A;  3RR8 A;  3NAE A;  4CF1 A;  1SL1 A;  3KK2 A;  1TKD A;  2Z1J A;  1R0A A;  3DRS A;  3TI0 A;  3KJV A;  5K14 A;  4I2Q A;  1YVU A;  4LSL A;  5C42 A;  3KLG A;  3HVR A;  4IBN A;  3PY8 A;  3SUQ A;  1EX4 A;  1LV5 A;  1RDA A;  2D0A A;  4E1N A;  2WOM A;  3V9W A;  1JXB A;  2DFF A;  4IG3 A;  4E3S A;  2IOC A;  2P51 A;  4CIF A;  4FJL A;  4CFB A;  4HCB A;  3TWH A;  3NF6 A;  3DLH A;  4DWI A;  1U04 A;  3OYH A;  4DTN A;  2OPR A;  4C8O A;  3OYD A;  4JS4 A;  4IKF A;  3MEG A;  3L2Q A;  1SKR A;  4RW9 A;  3OVN A;  4DFM A;  4Z0U A;  4DTS A;  3KLI A;  3PX4 A;  2HMI A;  4B9S A;  2F96 A;  4M3Z A;  4HVJ A;  4DU1 A;  1IKX A;  4HTU A;  3NCI A;  2F8T A;  4B3O A;  1EKE A;  1J9A A;  3SJJ A;  4CJF A;  3TAR A;  4FJ7 A;  4FJ9 A;  4QOZ B;  4GW6 A;  2BGG A;  2HVI A;  4FYD A;  3OYK A;  4FZZ A;  3NGY A;  2IDO A;  3DLB A;  1L3V A;  3WNG A;  4ID1 A;  4CIE A;  4M3R A;  3THV A;  3AO3 A;  4HUF A;  2XO7 A;  3M8R A;  2FBT A;  2BDP A;  4FJN A;  3WNH A;  4FM1 A;  4KV8 A;  3UIQ A;  1TK5 A;  1XHZ A;  3VQ6 A;  3SCX A;  4CJR A;  3HPH A;  3KIO A;  2HHQ A;  4O0J A;  3SV3 A;  3NDK A;  3V9Z A;  2G8W A;  2I5J A;  3S9H A;  1JLE A;  2XRI A;  4B9L A;  2Z1G A;  3O3G A;  4PY5 A;  1S5J A;  5HRP A;  2ZQB A;  4NCB A;  1KRP A;  2HHV A;  4FJ5 A;  4FLW A;  4PQU A;  2G8U A;  1ASU A;  3FFI A;  4E7L A;  1ITG A;  3C6U A;  4O4G A;  1CLQ A;  3HVT A;  1NK7 A;  4C8K A;  1BQM A;  1Y97 A;  2ZD1 A;  3WNE A;  1IG9 A;  2P5G A;  3ZSV A;  4RW6 A;  1HMV A;  1QE1 A;  4AHS A;  4BDY A;  2B4J A;  4RG8 A;  4KHQ A;  4H4M A;  4M3X A;  4C8L A;  5CY4 A;  3MEC A;  3L3V A;  4KI4 A;  2HHW A;  2OA8 A;  3HJF A;  1RT4 A;  4O0I A;  4Z4F A;  5FRO A;  3SUP A;  4FJX A;  1SV5 A;  4IFV A;  1CZ9 A;  3RTV A;  3RWU A;  4CJU A;  3T1A A;  5SWM A;  1GOC A;  4CF9 A;  1IH7 A;  1TAQ A;  1FKP A;  4ZTJ A;  2G8I A;  3C6T A;  2BE2 A;  4NCA A;  1RDC A;  4BAC A;  3OYI A;  2ATQ A;  3ZSW A;  1NJY A;  1N5Y A;  2E6L A;  1RBU A;  3VQ5 A;  1I3A A;  4OJR A;  3T3F A;  3SI6 A;  4OGC A;  4CED A;  2EX3 A;  3AVL A;  3QLH A;  1Q9Y A;  4Z4C A;  3V9S A;  2GUI A;  4E7H A;  3JSM A;  4KHU A;  4Q5V A;  3TAG A;  3U3Y A;  1XC9 A;  5E41 A;  4N47 A;  1L5U A;  4F2S A;  4KB1 A;  1BQN A;  4RW8 A;  1G15 A;  1WSJ A;  4IDK A;  4FJK A;  3NH0 A;  4Z4G A;  4N5S A;  1FKO A;  3VQ4 A;  3CYM A;  3LP3 A;  3PV8 A;  1NJW A;  2NUB A;  1JLF A;  1ZBH A;  4FCY A;  3VQB A;  3K58 A;  4DFP A;  4JRQ A;  4J2E A;  4KI6 A;  3B6O A;  4DSL A;  3VQC A;  4E7K A;  3QEP A;  3DM2 A;  3I0R A;  3D0P A;  1LAV A;  4UQG A;  4I9Q A;  4KHS A;  1J53 A;  4YNQ A;  3RMB A;  4E1M A;  5SZT A;  3CG7 A;  4CF8 A;  4DLE A;  3VN5 A;  3KLE A;  2XY7 A;  1XI1 A;  1WAJ A;  1Q8I A;  3LPU A;  3ASM A;  4FZX C;  3CM6 A;  4OLA A;  3HPG A;  3IRX A;  4FW1 A;  3AO2 A;  4OKJ A;  1REV A;  4CJQ A;  2ETJ A;  4FJI A;  5EU7 A;  3CFR A;  3A2F A;  3OYA A;  2Z1H A;  4KO0 A;  4CFC A;  3V1Q A;  3OS0 A;  1QHT A;  1VSF A;  3QNN A;  4O44 A;  2HB5 A;  1X1P A;  5I3U A;  1BI4 A;  1KFS A;  3AVB A;  1RNH A;  4F4K A;  2Y1J A;  1VSL A;  4FK2 A;  1S6Q A;  5KRT A;  3VQ9 A;  4CJP A;  3RMC A;  1NK4 A;  3DLG A;  3ZT4 A;  4CGH A;  2FBY A;  3AVH A;  4DQS A;  4DTJ A;  1DTQ A;  4KKO A;  3LWL A;  1BIS A;  2A1R A;  4E7I A;  4CE9 A;  2OZS A;  1VRT A;  3MAQ A;  2B6A A;  4I7F A;  3VQP A;  2E4L A;  5KTQ A;  1U47 A;  4DSK A;  4DU4 A;  4BE2 A;  4KHN A;  1BIU A;  5DK5 A;  3KLH A;  4DS4 A;  1JLQ A;  4CK1 A;  1NK9 A;  4CGG A;  4FVM A;  3L2V A;  1WSI A;  1UOC A;  3IG1 A;  4CEC A;  2RPI A;  1KLM A;  4MFB A;  4QAG A;  4PA1 A;  5DMR A;  2DFH A;  4DMN A;  2Q3S A;  4C8N A;  2YHA A;  2YKM A;  1WAF A;  1KSP A;  2X78 A;  3E01 A;  4LD0 A;  3AVJ A;  1S9E A;  4CGD A;  2GBZ A;  4E19 A;  1C0U A;  3RMD A;  1VSM A;  3QIP A;  1ASV A;  5HRS A;  2W42 A;  4M3W A;  4M3T A;  4DF4 A;  3QER A;  3AV9 A;  2KQ2 A;  1A5W A;  2P1J A;  4W5N A;  3DLK A;  1DTT A;  5CYM A;  4AH9 A;  4K8Z A;  3NF9 A;  1RTJ A;  4DTX A;  1JLA A;  1HQE A;  4DTP A;  3G10 A;  4CJE A;  2PYL A;  1JLC A;  4AHT A;  1K6Y A;  3ZSR A;  4EP5 A;  3SUN A;  1W0H A;  4ELV A;  3HP6 A;  2E6M A;  3CFP A;  3U6F A;  3TAF A;  2FC0 A;  3IS9 A;  3LP2 A;  1C0T A;  5KI6 A;  3V81 A;  4ELU A;  1LWC A;  1VSE A;  3AO4 A;  4I9L A;  1BCO A;  3QEX A;  3HST B;  4GMJ B;  2D0C A;  2G8K A;  4KHY A;  1JLG A;  1KVC A;  3NF7 A;  4CGF A;  1ZBL A;  2XY8 A;  3SQ2 A;  3SQ4 A;  4CHQ A;  3HPO A;  1HYS A;  2XY5 A;  4FK4 A;  3F73 A;  1QQC A;  4CGJ A;  3NBP A;  3MXM A;  3RR7 A;  2KTQ A;  3LWM A;  1D5A A;  2YHB A;  4FJG A;  1WLJ A;  3TAB A;  4E7J A;  4FLU A;  1LW0 A;  1TKX A;  3LAL A;  1SL0 A;  4F3O A;  4L8R B;  4FJ8 A;  1D9D A;  3HO1 A;  3CQ8 A;  1QTM A;  1UA1 A;  3QEI A;  3OYE A;  3VA3 A;  1J5O A;  3T19 A;  4M3U A;  2AJQ A;  3SPY A;  4CHO A;  4B8A B;  5CZ2 A;  2OZM A;  1S1V A;  4CF2 A;  1IKV A;  1NOY A;  3DRP A;  4ID5 A;  2KZZ A;  3QES A;  3KKS A;  3NGZ A;  1Z25 A;  4CF0 A;  3TR8 A;  2VG6 A;  2VWK A;  4B8C A;  4HCC A;  3D45 A;  1TV6 A;  2HND A;  1GOA A;  4DQP A;  1KCF A;  1VK0 A;  4EZ9 A;  4CEA A;  2ZE2 A;  1RT6 A;  1QSL A;  2YKN A;  3ZSZ A;  1TAU A;  1IO2 A;  3V6D A;  1F21 A;  2O4G A;  4I2P A;  3NE6 A;  1ASW A;  3NFA A;  4NCG A;  3SZ2 A;  1RT1 A;  4DSF A;  1EP4 A;  5J2N A;  4AHV A;  2DFE A;  3VQQ A;  1A5X A;  1HJR A;  3BGR A;  2Y1I A;  3BDP A;  4F3T A;  4AIL C;  4HUE A;  4RW7 A;  2YV0 X;  4B9U A;  3CFO A;  4JRP A;  4BE1 A;  3VQE A;  4ZTF A;  3MED A;  3DOK A;  4Y1C A;  1O1W A;  4C8M A;  3HXM A;  3L8B A;  3C94 A;  3PX6 A;  4FLV A;  3KTQ A;  1J54 A;  4J2B A;  1CZB A;  3O3F A;  2WON A;  4XIU A;  1LW2 A;  5J2M A;  3LAN A;  1T7P A;  5D3G A;  4RW4 A;  2IAJ A;  1W9H A;  4CEQ A;  1QS4 A;  2YNH A;  4W5Q A;  1WN7 A;  1IKY A;  3M8S A;  3S3N A;  4Q0B A;  1B9D A;  3OYM A;  3AVI A;  1YT3 A;  3K5O A;  3TAN A;  4LSN A;  4CJ5 A;  1NK6 A;  4FJM A;  3VQ7 A;  4N41 A;  3L2W A;  4KPY A;  2KZM A;  1TGO A;  5C25 A;  1NK5 A;  2FBX A;  3M8Q A;  3SV4 A;  4DTU A;  2YNI A;  2QK9 A;  1NK8 A;  1DLO A;  2OPP A;  3AVF A;  5J2P A;  4CEF A;  4NYN A;  2OPQ A;  3V4I A;  1NOZ A;  3AO5 A;  1C1C A;  2G8F A;  1FK9 A;  1RT7 A;  1BHL A;  3DOL A;  1RTH A;  3ZSY A;  3V9U A;  1NK0 A;  3H08 A;  3P83 D;  1NJZ A;  1SKS A;  1YTU A;  1KVB A;  5C24 A;  2FBV A;  1JL1 A;  1HRH A;  3JYT A;  5I42 A;  1ZBU A;  4CFA A;  5HP1 A;  1TVR A;  3OYG A;  4DQQ A;  1NJX A;  4M42 A;  3LZI A;  3WNF A;  1L3U A;  4QCL A;  4CJL A;  3K5L A;  4CJT A;  1QSY A;  3AVA A;  4CEE A;  1C6V A;  2F8S A;  3AVN A;  1JLB A;  3QEV A;  1U4B A;  3OYL A;  1S1X A;  1RBV A;  4KTZ A;  1KLN A;  3OJU A;  4DSJ A;  4KTQ A;  4FZY A;  1RT2 A;  3KK1 A;  4DFJ A;  5HRN A;  3NH2 A;  4B9V A;  4W5O A;  2IS3 A;  1VSJ A;  3DLR A;  4W5R A;  4BDP A;  1GOB A;  3HM9 A;  1RBR A;  4DS5 A;  3OJS A;  4F8R A;  2GV9 A;  3DI6 A;  4CHP A;  3SPZ A;  3ZSO A;  3TAM A;  3U3G A;  4CJ4 A;  3OS2 A;  4BDZ A;  1RTD A;  2PYJ A;  1TKZ A;  3LP1 A;  3I8D A;  3AO1 A;  2LSN A;  3ISN C;  4Z4H A;  1ZBF A;  2B5J A;  1TK8 A;  3SUO A;  2YNG A;  5T7B A;  4WE1 A;  1TL3 A;  2KFZ A;  3K57 A;  3MXJ A;  3HK2 A;  4F2R A;  1ZBI A;  4B9M A;  1L3S A;  2HHU A;  1S1U A;  1BGX T;  1B9F A;  1VSD A;  1RDB A;  4AHR A;  3LPT A;  4BWJ A;  1N6Q A;  1JXE A;  3K5M A;  4HHT A;  4M3Y A;  3NH1 A;  4CK2 A;  1RBT A;  2IGI A;  4DLG A;  4PUO A;  4ZHR A;  3ITH A;  3RRH A;  1BCM A;  3L3U A;  4K8X A;  4M45 A;  1LWF A;  3KKR A;  1JKH A;  4EZ6 A;  3OYB A;  1D8Y A;  1TK0 A;  1BL3 A;  5HRR A;  1NKE A;  4N76 A;  3EY1 A;  1C1A A;  1WSH A;  2X6N A;  2X74 A;  1VRU A;  4CEB A;  4N56 A;  3K5N A;  3PX0 A;  2D5R A;  5KGW A;  4CHN A;  1EXQ A;  2RN2 A;  3DLE A;  3LAK A;  4FM0 A;  1BIZ A;  1X9W A;  2PZS A;  1BI4 B;  1A5V A;  3ZT3 A;  2HVH A;  2HNY A;  2ITG A;  3VQA A;  3PO5 A;  2O4I A; 
#chains in the Genus database with same CATH topology
 1LAW A;  4WFN L;  4OPJ A;  1I39 A;  4IG0 A;  3O1B A;  1VQO N;  2KW4 A;  3SQ0 A;  3VA0 A;  3D7E O;  3TPQ A;  3AA4 A;  1GLC G;  2DY4 A;  4R5P A;  3SAF A;  4LY7 A;  3OY9 A;  2P9I B;  1IV0 A;  5JS2 A;  4CJ7 A;  4CJ3 A;  1VSH A;  4JLH A;  1WSE A;  3T69 A;  5CZ1 A;  1YF5 L;  2HBM A;  1OVY A;  3HYF A;  3MX2 A;  4DSE A;  3PLA A;  3ENB A;  1S1T A;  4H5W A;  3V9X A;  5KGX A;  4HUG A;  3LZJ A;  4KRF A;  2QA4 N;  5AQN A;  4JEP A;  3KD1 E;  3P1G A;  4MQ3 A;  2GTD A;  4FW2 A;  3PO4 A;  1S3X A;  1HNV A;  4H0P A;  1RT5 A;  3OYN A;  1VSK A;  3IDH A;  2P5O A;  3TAQ A;  3I0S A;  3HM8 A;  3JAM O;  1NU0 A;  4B3M K;  3TAP A;  1Z26 A;  2HHT A;  4YOT A;  2JWK A;  2JLE A;  4CHY A;  1KXP A;  4CJV A;  3DXM B;  3QIO A;  1ZC6 A;  4PKH A;  3VQ8 A;  4J2D A;  4R79 A;  4LFA K;  4H8K A;  4DSI A;  4B1X B;  4FWO A;  3ZT2 A;  2HHX A;  3MMV A;  1IKW A;  1EET A;  2RF2 A;  1KFD A;  1HYZ A;  3E9O A;  4JK9 A;  4FLX A;  3AA3 A;  3QO9 A;  3Q7C A;  2QKB A;  4XEI A;  2KFN A;  3MWT A;  3CJA A;  1B92 A;  4FLZ A;  3SYZ A;  2HMP A;  2VG5 A;  3ZLJ A;  4FK0 A;  1U45 A;  4CD3 A;  4A5B A;  4OO1 J;  4FXD A;  4K42 A;  3CD6 N;  1NGI A;  4H0Y B;  1U49 A;  4FJH A;  4CZE A;  4Z4E A;  1HNZ K;  4A61 A;  3MXI A;  4OVL A;  4FLY A;  2CGL A;  2OPS A;  4OLB A;  2RKI A;  1Z6R A;  3F5T A;  3NAE A;  3KK2 A;  5K14 A;  4I2Q A;  3AY9 A;  5C42 A;  4IBN A;  1WBB A;  1RDA A;  4E1N A;  2DFF A;  5M1P A;  4CIF A;  4WQ4 C;  3NF6 A;  2A3Z A;  2OPR A;  4C8O A;  3OYD A;  1GLE G;  1X9J A;  1NGC A;  5E84 A;  4YHH K;  1SKR A;  1O13 A;  2ZF5 O;  4Z0U A;  4DTS A;  4B9S A;  5C10 A;  5AQP A;  1EKE A;  4FJ7 A;  5BRD A;  1T6C A;  1NJI O;  1S72 N;  2P9S A;  3OYK A;  4WQ5 C;  3NGY A;  2IDO A;  5JMV A;  4CIE A;  1Q7Y O;  4HUF A;  2XO7 A;  2BDP A;  5LL6 Z;  3UIQ A;  1NM1 A;  2O8B B;  2HHQ A;  3ATV A;  3ZET A;  3S9H A;  2XRI A;  4B9L A;  4FWN A;  4JHD B;  5AQJ A;  4B1V A;  5HRP A;  2W6L A;  1KRP A;  4E7L A;  5AQL A;  4DR6 K;  1IBL K;  4BC3 A;  1BQM A;  2P5G A;  3CET A;  4IO9 L;  2E2O A;  4BRN A;  4BDY A;  4M3X A;  3CER A;  1QVF M;  4C8L A;  3J7Z O;  3ZYY X;  3M1F A;  4O0I A;  2ZGZ A;  5GAD P;  4Z4F A;  5M1N A;  3GG4 A;  5BN8 A;  4L3Q A;  3MN9 A;  5CR4 A;  3T1A A;  3I56 N;  4CF9 A;  3ID6 A;  1NBW A;  4JI6 K;  4ILH A;  5KQD A;  1KAY A;  4CED A;  2EX3 A;  3QLH A;  3P31 A;  4DCH A;  4KHP K;  3V9S A;  3CCR N;  3ENH A;  5E41 A;  3H1V X;  3THX A;  1BQN A;  1ZXO A;  2P9S B;  1G15 A;  1WSJ A;  3E1Y A;  4FJK A;  3P4I A;  3CYM A;  3VQ4 A;  1ZBH A;  2NUB A;  3VQB A;  3K58 A;  4DFP A;  4JRQ A;  3VEO A;  1NGH A;  4DSL A;  3QEP A;  3DM2 A;  2P9U A;  4UQG A;  4I9Q A;  3MK6 A;  4YNQ A;  4O8U A;  3CHW A;  3BF3 A;  3ZET B;  2H3G X;  4E1M A;  4DLE A;  1TUU A;  3KLE A;  1XI1 A;  4FZX C;  3KVG A;  3OYA A;  1SQK A;  4CFC A;  4B1W B;  2I7P A;  1VSF A;  3QNN A;  2HB5 A;  5I3U A;  5FPE A;  3AVB A;  3SAG A;  2Y1J A;  1VSL A;  4FK2 A;  3A5N C;  5KRT A;  3RMC A;  4CGH A;  5A2Q O;  1YIJ N;  1BOT O;  4FWL A;  3CCL N;  4J2E A;  4JD2 B;  3P38 A;  5KQ8 A;  4DSK A;  2PFU A;  4X66 K;  4YOU A;  4DU4 A;  5BPL A;  5BRE A;  3Q7B A;  1BIU A;  2E20 A;  1NK9 A;  3L2V A;  1UOC A;  4CEC A;  3I55 N;  3MCP A;  1KLM A;  4C8N A;  2YKM A;  4DUY K;  3MX5 A;  3E01 A;  3AVJ A;  1U2V A;  1D4X A;  4BR0 A;  1C0U A;  2NRR A;  1VSM A;  5HRS A;  2W42 A;  3QER A;  3LDL A;  2P9U B;  3CPE A;  3MN7 A;  4JI1 K;  4DR5 K;  2ZM6 K;  1K6Y A;  3HRG A;  5KPZ A;  3VEX A;  3TAF A;  2VYP A;  3V81 A;  1VSE A;  1GLB G;  3QEX A;  2FSJ A;  2D0C A;  4KHY A;  1JLG A;  2WBN A;  1HPM A;  3A0I X;  1G99 A;  3HPO A;  4FK4 A;  1QQC A;  3NBP A;  2KTQ A;  1D5A A;  4DV6 K;  3O9U A;  3ZX2 A;  1WOQ A;  4FJ8 A;  1Q18 A;  4OPH A;  2O8E B;  1CZA N;  4CHO A;  4A2A A;  3O08 A;  4CF2 A;  3HZ6 A;  3DRP A;  4ID5 A;  3QES A;  3KKS A;  4CF0 A;  4HCC A;  1GOA A;  1VK0 A;  4EZ9 A;  3ULE B;  4GKJ K;  1TAU A;  2Q0U A;  3CCS N;  4I2P A;  3F2K A;  1ASW A;  4DSF A;  3AGK A;  1EP4 A;  1U2V B;  1BA1 A;  5LJV A;  2F7T A;  3EN9 A;  4RW7 A;  1EO1 A;  2YV0 X;  1HJO A;  3VQE A;  4B3T K;  1Q82 O;  3C94 A;  4HWI A;  3QFU A;  3O3F A;  2D1K A;  2WON A;  1VQ7 N;  4BR7 A;  1QS4 A;  5KPR A;  4Q0B A;  1B9D A;  3TAN A;  1YT3 A;  4FJM A;  4LF8 K;  5EVZ A;  5JLH A;  3MCA B;  5C15 A;  2ZJQ L;  3L2W A;  3CPW M;  3SV4 A;  3A5L C;  1NGD A;  4CEF A;  2G8F A;  2OPQ A;  1C1C A;  1FK9 A;  2Q36 A;  3T7Z A;  3DOL A;  4GKK K;  3FZF A;  3H08 A;  3P83 D;  4B1Y B;  2FBV A;  5LMU K;  4CFA A;  3O80 A;  4IO8 A;  1XMO K;  4BVO A;  1YXQ A;  3WNF A;  3K5L A;  4CJT A;  1QSY A;  4BRI A;  1U4B A;  3L4I A;  3SK3 A;  5AQT A;  1RT2 A;  3VOV A;  4W5O A;  1VSJ A;  5FPD A;  1GOB A;  4CD1 A;  3CC2 N;  4DS5 A;  4BRD A;  1LCU A;  3VES A;  2QM1 A;  3TAM A;  2E2Q A;  4M63 C;  2E2P A;  4CJ4 A;  2NRT A;  4BDZ A;  3LP1 A;  5HOO A;  3AO1 A;  4Z4H A;  1ZBF A;  3U9Z A;  2BTF A;  4EHT A;  4H5V A;  3OHR A;  3HK2 A;  3THW A;  1S1U A;  1BGX T;  1VSD A;  1RDB A;  1N6Q A;  5F0X A;  4JAX A;  3U4L A;  3NH1 A;  1P90 A;  1RBT A;  4DV7 K;  4DLG A;  1GLF O;  3RRH A;  3ITH A;  4PUO A;  4K8X A;  1LWF A;  4EZ6 A;  1NWK A;  3VTI A;  3OYB A;  4N76 A;  1BL3 A;  1C1A A;  3K5N A;  1VRU A;  4N56 A;  1EXQ A;  1X9W A;  3LAK A;  4WFB L;  1BI4 B;  3GE1 A;  4IOA L;  2ITG A;  4F8R A;  1U6Z A;  5KRS A;  3I33 A;  3FLC O;  1UAX A;  5EY4 A;  4OKE A;  3ZSQ A;  4O55 A;  2QTD A;  1YTA A;  5FRM A;  4GVM A;  3KD5 E;  2O8D A;  2YCH A;  3ULD A;  2VWJ A;  3HT3 A;  4FJJ A;  4H5T A;  2QXL A;  1MA9 B;  1HPZ A;  4KAZ A;  4Y1D A;  3SJH A;  4JS5 A;  2X6S A;  2VG7 A;  4HTL A;  3AVK A;  3AVM A;  4PWD A;  5C2D A;  1HQU A;  3ALY A;  2QWO A;  3SMP A;  3DYA A;  3O5B A;  1TL1 A;  3VEY A;  3K59 A;  4CJS A;  4NLB A;  1KQS M;  3PUF A;  1L3T A;  3WQU A;  1JJ2 M;  1IBK K;  2UXC K;  4CJW A;  3NF8 A;  3THW B;  2BUP A;  2Q97 A;  2ZJP L;  4JK8 A;  1FXX A;  3DRR A;  4CHZ A;  4BGA A;  4CFD A;  2R7Y A;  3SNN A;  2VGM A;  1OVQ A;  1C1B A;  1RDD A;  4CW7 B;  4BRK A;  4J8F A;  4CEZ A;  4Z4I A;  3LDS A;  1XWL A;  3OS1 A;  2ASP A;  4B9N A;  1CXU A;  2A41 A;  3DXK A;  3O4Q A;  3OYC A;  1NKB A;  1T03 A;  4GY2 B;  4LH5 A;  2PAV A;  4RTF D;  3IKM A;  4CZL A;  2OYQ A;  2HHS A;  3IAY A;  4DU3 A;  2HF4 A;  4AHC A;  4YFU A;  3F9K A;  3L4Q A;  1WBD A;  4C1N K;  1WNS A;  5AR0 A;  1JL2 A;  1EWQ A;  4GNI A;  3LAM A;  3FFK B;  3OYF A;  1ILY A;  3N4Q A;  4E89 A;  2G8V A;  1WSF A;  3IFR A;  1T05 A;  1KVA A;  2EHG A;  1UA0 A;  4DTM A;  1QSS A;  4LH4 A;  1C0M A;  3NHG A;  1UWB A;  3WXJ A;  2HW3 A;  5JS1 A;  2Z1I A;  3K2P A;  2VCP A;  3RR8 A;  1EQY A;  1I94 K;  1TKD A;  4IXC A;  2Z1J A;  3HVR A;  1YVU A;  4LSL A;  5M1O A;  1EX4 A;  1LV5 A;  2WOM A;  3V9W A;  1JXB A;  2IOC A;  2GUP A;  4JI8 K;  4HCB A;  3TWH A;  1BA0 A;  1JCG A;  5BRH A;  3DXK B;  1YAG A;  4IKF A;  3L2Q A;  4PKG A;  4RW9 A;  1S22 A;  3KLI A;  2F96 A;  5TKY A;  4B3O A;  1J9A A;  4CJF A;  1ATN A;  4GW6 A;  2BGG A;  3ENO A;  3CI5 A;  4FZZ A;  3DLB A;  1L3V A;  3WNG A;  4M3R A;  3THV A;  3AO3 A;  3WEE A;  3M8R A;  5DM6 L;  1HX1 A;  2QW9 A;  2NLX A;  2FF6 A;  2PBD A;  1VQ8 N;  3VQ6 A;  4BRH A;  3HPH A;  3KIO A;  2ZGY A;  3IMX A;  5AZI B;  3SV3 A;  2A40 A;  3V9Z A;  2O8C A;  4WFA L;  3O3G A;  1S5J A;  3VER A;  4B1Z A;  4F9O A;  4JI0 K;  2GX9 A;  3E9L A;  4H5R A;  3AAP A;  1ITG A;  4O4G A;  4C8K A;  1Y97 A;  2ZD1 A;  3THY A;  1QE1 A;  4CBX A;  2B4J A;  3B8A X;  5AQZ A;  4KI4 A;  2OA8 A;  3VF6 A;  1HUX A;  4JI3 K;  2V7Y A;  3ZEU A;  5AZJ B;  3EL2 A;  3RWU A;  5SWM A;  1IH7 A;  1FKP A;  4ZTJ A;  3CIP A;  5LMN K;  1RDC A;  4MO4 A;  4JKE A;  4DV3 K;  3OYI A;  2ATQ A;  1NJY A;  1NGA A;  2E6L A;  1RBU A;  3NMU A;  3LDO A;  1I3A A;  4OGC A;  1K8K A;  3AVL A;  1Q9Y A;  1IG8 A;  4Z4C A;  2GUI A;  3JSM A;  4Q5V A;  1QZ5 A;  2AP1 A;  1FKO A;  2GEL A;  4FCY A;  2P9L A;  4IOX A;  3I0R A;  2Q1N A;  4KHS A;  1BDG A;  4JKD A;  5HL7 L;  5SZT A;  3CG7 A;  3LPU A;  3CJ1 A;  3IRX A;  4JYA K;  2P9N A;  5EU7 A;  3CFR A;  4KO0 A;  3V1Q A;  5AQG A;  4JKC A;  3H1Q A;  3VGM A;  4O5F A;  3JXU A;  5BR9 A;  3EZW A;  3VF4 A;  1BWF O;  4MDB A;  3VQ9 A;  3R1X A;  4LF4 K;  3VEV A;  4DQS A;  3P39 A;  5AQK A;  3G25 A;  4KKO A;  1BIS A;  2A1R A;  2GEM A;  1V4T A;  3EE9 A;  4CE9 A;  2E4L A;  5AQY A;  3BUZ B;  5DK5 A;  5C2F A;  1JLQ A;  1WSI A;  2DFH A;  2Q3S A;  2UUA K;  1WAF A;  2X78 A;  5AQR A;  1SAZ A;  1Y64 A;  2YHX A;  1GLD G;  2IVN A;  2GBZ A;  1TUY A;  4E19 A;  3AV9 A;  4V19 S;  3DLK A;  4NXN K;  4B1U B;  2V7Z A;  3H46 O;  4CJE A;  1JCE A;  4AHT A;  3ZSR A;  1W0H A;  4I6M A;  3HP6 A;  3U6F A;  4IJA A;  2YJF A;  1C0T A;  1RDW X;  4BR4 A;  2G8K A;  1KVC A;  3NF7 A;  3T1H K;  2XY8 A;  3SQ4 A;  4YOY A;  1YJN N;  2XY5 A;  4YDU A;  3RR7 A;  3MXM A;  3QB0 A;  4B3S K;  4FJG A;  2V51 B;  2E1Y A;  4JKG A;  4FWM A;  1OH6 A;  1LW0 A;  4L8R B;  4IDH A;  2O8F A;  1D9D A;  4U7B A;  2RHK A;  3QEI A;  3R8E A;  2W40 A;  4BRL A;  5CZ2 A;  4BRQ A;  1S1V A;  5AQS A;  3ZX0 A;  2YI1 A;  2VG6 A;  4CVN E;  2WUS A;  2HND A;  4MDA A;  4XH4 A;  3CQX A;  1RT6 A;  2YKN A;  3ZSZ A;  3ATU A;  4GVE A;  3FZH A;  2O4G A;  1NGG A;  3NFA A;  3SZ2 A;  5J2N A;  1YVN A;  4AHV A;  1A5X A;  1E4F T;  1HJR A;  4F3T A;  4HUE A;  3SBT A;  2E1Z A;  4BE1 A;  5AQF A;  3MED A;  4Y1C A;  3PX6 A;  4FLV A;  1J54 A;  4EAH D;  3H6E A;  4XIU A;  2HHV A;  1LW2 A;  5D3G A;  2IAJ A;  2YHW A;  4CZI A;  1X3M A;  4CEQ A;  4WF9 L;  5BPN A;  3M8S A;  2QWP A;  1NGF A;  1VQN N;  3AVI A;  4NLC A;  1KD1 O;  4LSN A;  4PL7 A;  2IVO A;  2E2N A;  5C25 A;  4X62 K;  1NK5 A;  3M8Q A;  4DTU A;  4K0K K;  2YNI A;  2QK9 A;  3AVF A;  4NYN A;  1NOZ A;  3O8M A;  1N32 K;  1RT7 A;  1BHL A;  1NK0 A;  1P8Z A;  4QS9 A;  3FGU A;  1NJZ A;  1SKS A;  5I42 A;  1HRH A;  1ZBU A;  4DQQ A;  4BR2 A;  3G71 N;  4QCL A;  3AVA A;  1C6V A;  3HTV A;  1JLB A;  3QEV A;  3OYL A;  3WUH A;  4B9V A;  1K9M O;  4BDP A;  2QWN A;  4CZF A;  3HM9 A;  5M1F A;  3OJS A;  2GV9 A;  5BPM A;  1MDU B;  3C6A A;  5CE3 A;  4AQY K;  3U3G A;  4BRO A;  1TKZ A;  2LSN A;  1VQ4 N;  3THX B;  4MLH A;  4RWT A;  4LC9 B;  4WE1 A;  3QIC A;  3K57 A;  4F2R A;  1ZBI A;  1B9F A;  3MN6 A;  1JXE A;  3K5M A;  3DWL A;  4CK2 A;  1BCM A;  4JNE A;  3BF1 A;  1D8Y A;  3EY1 A;  1WSH A;  1Q86 O;  3PX0 A;  1XUP O;  1M1K O;  5H1S Q;  5GAE P;  4LF6 K;  3UE5 A;  3EE8 A;  2HBK A;  5F2R A;  4FWK A;  4M7Y A;  4DR2 K;  3VQA A;  3HOT A;  2O4I A;  4JN4 A;  2NRX A;  4AM7 A;  2GWK A;  4CCH A;  4QS7 A;  3CME N;  4OPK A;  3EZ5 A;  4DQR A;  1RT3 A;  3S3O A;  4PHT X;  4CK3 A;  3QET A;  3KK3 A;  4BE0 A;  5AFU A;  4K43 A;  4DR7 K;  2D4W A;  3ZT0 A;  5I9E B;  4OGE A;  4BWM A;  4KFB A;  3K9K A;  4OKK A;  4FLT A;  1VSI A;  3L0Q A;  4OX9 K;  3OYJ A;  2FSN A;  1WSG A;  5ADX A;  4DR1 K;  1SUQ A;  1ESV A;  1NKC A;  4KRE A;  1IJJ A;  3H3O B;  3ZCM A;  3AVG A;  3WXL A;  5EXW A;  3M8P A;  2HNZ A;  5FDL A;  3QEW A;  3NGI A;  4MO5 A;  2ZWH A;  4DTR A;  5J1E A;  1HNI A;  2IC3 A;  3PSF A;  4C1N I;  4DV1 K;  3BY5 A;  3EKS A;  2UUB K;  5GAH P;  3RVC A;  4JKF A;  4O5B A;  5GIN A;  2D0B A;  2UXD K;  3CXC M;  4DF8 A;  4G1Q A;  1RCH A;  4M41 A;  2XHB A;  3FZK A;  2JGU A;  3C6H A;  3LP0 A;  3P5J A;  1LWE A;  1X9S A;  3WXM B;  4KHW A;  1GLA G;  3KLF A;  1XHX A;  3V1R A;  2QWQ A;  4B9T A;  4DQI A;  2VWB A;  1W2B M;  3UB5 A;  1ZYQ A;  4BC2 A;  3J7Y P;  4CZG A;  4DFK A;  4G9Z A;  4EP4 A;  4GV3 A;  1T3V A;  3U9D A;  4W5T A;  2P9P A;  4ICL A;  4IZ9 A;  3FZM A;  3TSU A;  1S1W A;  5FRN A;  3DMJ A;  4J2A A;  1CXQ A;  1T8E A;  3CMA N;  4JI4 K;  2QWL A;  2BAN A;  2P9K A;  1MU2 A;  5JVG L;  2PY5 A;  3ZSX A;  1N8R O;  3MN5 A;  5CYQ A;  1XMQ K;  5AQI A;  5J2Q A;  1QHA A;  4JKB A;  4X65 K;  4FJL A;  1Q81 O;  2KLA A;  1RIL A;  2QKK A;  2D0O A;  3L2R A;  2QXF A;  1K8A O;  4CI6 A;  1SL2 A;  1E3M A;  3CM5 A;  4CES A;  5HBM A;  4KBO A;  3GL1 A;  4CF1 A;  1SL1 A;  1R0A A;  3TI0 A;  3CC7 N;  3KJV A;  3SUQ A;  1VHX A;  4A5A A;  3AGR A;  2P51 A;  3DLH A;  2KKZ A;  4YDU C;  4JI7 K;  3EO3 A;  3PX4 A;  2HMI A;  3LM2 A;  4BVP A;  2A6A A;  4DU1 A;  1IKX A;  4HTU A;  2F8T A;  4QOZ B;  4RCH A;  3SJJ A;  3TAR A;  3OW2 M;  2P9P B;  2HOE A;  3EKU A;  4FYD A;  1ATS A;  5JVH L;  4FM1 A;  1TK5 A;  1XHZ A;  1RFQ A;  3SCX A;  4BRE A;  4BR5 A;  4CJR A;  3QML A;  4IFE A;  2P9K B;  5AQO A;  2A5X A;  3O9Q A;  5GIP A;  4PY5 A;  3RSE A;  2VQF K;  2ZQB A;  1TYQ A;  4FLW A;  1ASU A;  3FFI A;  4H03 B;  1NK7 A;  4XH1 A;  2NZT A;  4RW6 A;  3CCE N;  5AQQ A;  4RG8 A;  2I7N A;  5CY4 A;  3MEC A;  1HR0 K;  4B3R K;  4H0X B;  1HNX K;  1RT4 A;  1W97 L;  1R59 O;  3UKU A;  5FRO A;  3SUP A;  4FJX A;  3ID8 A;  2HF3 A;  3A5O C;  2FXU A;  2CGJ A;  3VPZ A;  3RTV A;  2OCE A;  3E9P A;  3N4P A;  3W3D A;  3FR0 A;  3C6T A;  2BE2 A;  3LDQ A;  2NRZ A;  4BAC A;  4CZH A;  3ZSW A;  5CHI A;  3CCU N;  4OJR A;  3T3F A;  4BG9 A;  3C0B A;  1KAZ A;  4E7H A;  4KHU A;  3TAG A;  1XC9 A;  4F2S A;  4N47 A;  3CC4 N;  4RW8 A;  4Z4G A;  3NH0 A;  4N5S A;  1VQK N;  1VQ9 N;  4PKI A;  4KH6 A;  2CGK A;  1LAV A;  2O8D B;  4YOX A;  1J53 A;  4JK7 A;  3IUC A;  4IEI A;  2HBJ A;  1N33 K;  3NVM A;  1XQS C;  2XY7 A;  2E8A A;  1Q8I A;  5FPN A;  2E88 A;  3CM6 A;  4OLA A;  3HPG A;  4FW1 A;  3AO2 A;  4K41 A;  1REV A;  3SBG A;  4CJQ A;  5GIO A;  4FJI A;  3A2F A;  2Z1H A;  3OS0 A;  4O44 A;  1KFS A;  1RNH A;  3EEQ A;  1NMD A;  1S6Q A;  4LFC K;  5AQV A;  4DV0 K;  4BG8 A;  3DLG A;  1YJ9 N;  1NK4 A;  5AQM A;  1HNW K;  1DTQ A;  1NLV A;  4IEE A;  1BO5 O;  3HSC A;  2OZS A;  3E66 A;  3LM9 A;  5KTQ A;  2IVP A;  3TSP A;  3TTF A;  4BE2 A;  4KHN A;  5JIC A;  3OTO K;  3QFP A;  4CGG A;  3PIO L;  1QQO A;  4O8K A;  2RPI A;  5DMR A;  2UUC K;  1KSP A;  4XH5 A;  4WYB A;  2J4R A;  1S9E A;  4CGD A;  3RMD A;  3QIP A;  1ASV A;  4DF4 A;  4BRF A;  3T1Y K;  1NNE A;  5CYM A;  1DTT A;  3NF9 A;  1RTJ A;  1HQE A;  2PYL A;  4EP5 A;  1HLU A;  3SUN A;  2AA4 A;  2E6M A;  2VGN A;  3CFP A;  5B8H A;  3IS9 A;  1J5E K;  4ELU A;  1VQL N;  3AO4 A;  1BCO A;  4BQL A;  3HST B;  4GMJ B;  4EHU A;  1GLL O;  1HKC A;  3DXM A;  5LY3 A;  2QEX N;  4CHQ A;  1HYS A;  3F73 A;  4CGJ A;  1OH7 A;  3LWM A;  4IWV A;  4A57 A;  2JWL A;  2KHO A;  4E7J A;  4FLU A;  3LAL A;  2ITM A;  1SL0 A;  4F3O A;  3HO1 A;  3CQ8 A;  1UA1 A;  4H5N A;  5F1X A;  1J5O A;  1C0F A;  4M3U A;  2AJQ A;  4BY9 C;  3QBX A;  4B8A B;  2OZM A;  1IKV A;  1QQM A;  2KZZ A;  3G6E N;  4FL9 A;  3NGZ A;  3D6R A;  3TR8 A;  2WTU A;  5FLX O;  1TV6 A;  3G4S N;  4DQP A;  2W6K A;  3J80 O;  5AQU A;  2ZE2 A;  1QSL A;  3M5R A;  2OAN A;  4OPA A;  4Y0W A;  3CJ7 A;  3VQQ A;  4BRG A;  3BGR A;  2Y1I A;  4IOC L;  2ASO A;  3CFO A;  3H45 C;  3BEX A;  3DOK A;  1O1W A;  3KTQ A;  3A5M C;  3WEE B;  1CZB A;  3WQT A;  5J2M A;  3W0L A;  2YNH A;  5ELZ A;  4EIA A;  3S3N A;  4FOE A;  2O8C B;  3K5O A;  3HOS A;  4CJ5 A;  2OTL N;  3VQ7 A;  4N41 A;  4KPY A;  2KZM A;  5AFU H;  5EX5 A;  1NK8 A;  1DLO A;  2HVI A;  3V4I A;  3LL3 A;  4JI2 K;  1RTH A;  3ZSY A;  3V9U A;  3TTC A;  3THY B;  1X3N A;  5C24 A;  5ADX H;  1JL1 A;  5M1Q A;  3JYT A;  5MLC Q;  1TVR A;  3OBY A;  4M42 A;  3LZI A;  4AF1 A;  1L3U A;  3VEN A;  5BN9 A;  3L6Q A;  3ZEU B;  1RBV A;  1KLN A;  3I8B A;  3K9J A;  2O8B A;  3O9R A;  4KH5 A;  3KK1 A;  5LJW A;  4DFJ A;  5HRN A;  3NH2 A;  2UXB K;  4M7X A;  4JHD A;  3AAQ A;  2NRV A;  3BP8 A;  2ZJR L;  3TTD A;  4CHP A;  1K8K B;  5FPM A;  4JKA A;  3OS2 A;  1RTD A;  5E26 A;  2B5J A;  3VEW A;  1DT9 A;  3SUO A;  2Q31 A;  2YNG A;  3SLC A;  3HI0 A;  5JLF A;  2P9L B;  3R9P A;  5IWA K;  3MXJ A;  1L3S A;  4LF9 K;  5DM7 L;  4AHR A;  2WFB A;  3LPT A;  4BWJ A;  2IGI A;  4ZHR A;  4LF5 K;  2EWS A;  3MWP A;  4M45 A;  3K0S A;  3KKR A;  1JKH A;  1XC3 A;  1TK0 A;  5HRR A;  1NKE A;  3D2F A;  2P9N B;  4FM0 A;  3DLE A;  1BIZ A;  4FVU A;  4KH4 A;  1VQ6 N;  3PO5 A;  1W7A A;  2E5L K;  4E0D A;  4ISG A;  2NRH A;  1SKW A;  1YI2 N;  3RRG A;  3FE1 A;  3AA2 A;  3DAW A;  4FM2 A;  3S3M A;  3QIN A;  1TKT A;  3D2E A;  3HP9 A;  3KZB A;  4AM6 A;  4DTO A;  4CBW A;  3V1O A;  1RBS A;  2HST A;  3AAR A;  2A1S A;  2CH6 A;  4IFY A;  4CER A;  2Q2R A;  4BRM A;  4CJK A;  4KB0 A;  4LFB K;  3O3H A;  1MWK A;  3AVC A;  2GWJ A;  4CEO A;  5C0Y A;  1U48 A;  4DR4 K;  5HRO A;  2G8H A;  4MLE A;  2FLO A;  2YNF A;  3C95 A;  1GLJ O;  4IJN A;  3J81 O;  4TSX A;  1HYV A;  2D0P A;  3OA9 A;  4FPB A;  3AA5 X;  4JD2 A;  4DHY A;  1VQP N;  4I6M B;  5HLF A;  2YHY A;  3D2F B;  3CQY A;  1H1V A;  5AQX A;  1DKG D;  1DGK N;  1KTQ A;  4GV6 A;  3M3Z A;  3F9M A;  4H4O A;  3QNO A;  4BGB A;  2XY6 A;  3L2U A;  3CCM N;  4FSV A;  4JKG B;  4B08 A;  4DG1 A;  3MEE A;  1NGJ A;  2O8F B;  1VAZ A;  4ELT A;  1Q9X A;  1S6P A;  3WT0 A;  4CGI A;  3G0Z A;  3O4N A;  3D2E B;  3B6P A;  3SQ1 A;  1VQ5 N;  4NYF A;  1D9F A;  3HL8 A;  1S9G A;  1HKG A;  3ZT1 A;  2A42 A;  1X9M A;  4CIG A;  2ASM A;  3O9S A;  2F9W A;  3RMA A;  1RTI A;  2BH1 A;  4B9Q A;  3VQD A;  3EYZ A;  4ISE A;  1J6Z A;  4AHU A;  4BR9 A;  1BUP A;  4H0O A;  4KTW A;  2DTU A;  3TAE A;  3VGK A;  2O8E A;  3VF2 A;  4YOR A;  3DRS A;  4BQZ A;  3KLG A;  3KWG A;  3PY8 A;  2NNW A;  2YJE A;  4EFH A;  4FOI A;  2D0A A;  2FSK A;  3O1W A;  3TSQ A;  3GDQ A;  4E3S A;  4IG3 A;  1NMN A;  4YY3 K;  2FF3 B;  4CFB A;  4NO7 A;  3MDQ A;  4DV4 K;  4DWI A;  1U04 A;  3OYH A;  1BG3 A;  4NXM K;  4DTN A;  3ULE A;  4JS4 A;  3MEG A;  3GOI A;  3OVN A;  4DFM A;  4DR3 K;  4M3Z A;  4HVJ A;  3NCI A;  1VQM N;  4FJ9 A;  5KPT A;  3U8X A;  4DUZ K;  4ID1 A;  5AQH A;  2FBT A;  4FJN A;  3WNH A;  4KV8 A;  3SMS A;  3O4W A;  1OKJ A;  2F9T A;  4CZM A;  4O0J A;  3NDK A;  2G8W A;  2I5J A;  1JLE A;  2Z1G A;  3WXK A;  1N36 K;  1N34 K;  4FPA A;  2HHH K;  4NCB A;  5GAG P;  4FJ5 A;  4PQU A;  2G8U A;  4DV2 K;  2OTJ N;  3C6U A;  3CF5 L;  1M90 O;  1CLQ A;  3HVT A;  3ZX3 A;  3WNE A;  1IG9 A;  3ZSV A;  4AHS A;  1HMV A;  1DEJ A;  4KHQ A;  4H4M A;  5BR8 K;  4DV5 K;  1FJG K;  3L3V A;  2HHW A;  3HJF A;  3O9T A;  4PL8 A;  3R6M A;  3H3N O;  2Q0R A;  3VET A;  1IBM K;  1QQN A;  1SV5 A;  4IFV A;  1CZ9 A;  4NB4 A;  4CJU A;  3CCQ N;  1GOC A;  1JCF A;  1TAQ A;  2G8I A;  4NCA A;  1N5Y A;  3VQ5 A;  2VQE K;  3SI6 A;  1RGI A;  4A59 A;  1L5U A;  3U3Y A;  1NGB A;  3CJB A;  4KB1 A;  4IDK A;  1RDU A;  3PV8 A;  3LP3 A;  1NJW A;  1JLF A;  3VEZ A;  4YOW A;  4KI6 A;  3B6O A;  5EOY A;  3VQC A;  4E7K A;  1XNQ K;  3D0P A;  4ILG B;  5AJ3 K;  4CZK A;  3RMB A;  2W41 A;  1QZ6 A;  2RE2 A;  3O6W A;  3VN5 A;  4CF8 A;  1YJW N;  1WAJ A;  3ASM A;  4H0T B;  4E1J A;  4OKJ A;  2ETJ A;  1MWM A;  1OH5 A;  1QHT A;  3UKR A;  1X1P A;  4DQ8 A;  1BI4 A;  4F4K A;  1K73 O;  1KAX A;  4CJP A;  3FZL A;  5C12 A;  1OH8 A;  3CCJ N;  3BZK A;  3ZT4 A;  2FBY A;  3QDK A;  3AVH A;  4DTJ A;  4JV5 K;  4BRC A;  3LWL A;  3C7N A;  4E7I A;  4DB3 A;  4BRA A;  1QVG M;  1VRT A;  3MAQ A;  2B6A A;  4I7F A;  3VQP A;  1U47 A;  1KC8 O;  3J7A P;  3KLH A;  4DS4 A;  4CK1 A;  2QWM A;  2YX6 A;  3JS6 A;  4FVM A;  3TU5 A;  3IG1 A;  2DPN A;  2QWR A;  4MFB A;  4QAG A;  4PA1 A;  1ZBS A;  4DKW A;  4DMN A;  4GV9 A;  2YHA A;  3LDP A;  4LD0 A;  4M3W A;  4M3T A;  2KQ2 A;  1A5W A;  2P1J A;  4W5N A;  5IT9 O;  4K8Z A;  4AH9 A;  4DTX A;  1JLA A;  4DTP A;  2QI2 A;  3G10 A;  1JLC A;  1T6D A;  1FW6 A;  3S41 A;  2UYT A;  3KHY A;  4ELV A;  4FWQ A;  2F4V K;  4ISF A;  2FC0 A;  3LDN A;  3LP2 A;  5KI6 A;  1LWC A;  2CH5 A;  4I9L A;  3C65 A;  3UKR B;  1YUW A;  4CGF A;  1LOT B;  1ZBL A;  4WQ4 A;  5M1K A;  1SZ2 A;  3SQ2 A;  4X64 K;  4A2B A;  3CCV N;  1YHQ N;  3PSI A;  2YHB A;  1WLJ A;  3TAB A;  3J8A A;  4UY8 O;  1TKX A;  4BC5 A;  1QTM A;  3DJC A;  3C7N B;  3OBW A;  3OYE A;  3VA3 A;  3DLL L;  2WC9 A;  3T19 A;  1WB9 A;  4JI5 K;  3SPY A;  4BRP A;  4WQ5 A;  4Z94 A;  1NOY A;  1C0G A;  1Z25 A;  3KK7 A;  4B8C A;  2V52 B;  2VWK A;  3D45 A;  4LF7 K;  4FWP A;  3CJ9 A;  1KCF A;  4CEA A;  3QBW A;  4YOV A;  1IO2 A;  3V6D A;  1F21 A;  1T44 A;  3NE6 A;  4NCG A;  1RT1 A;  4CBU A;  2DFE A;  3BDP A;  4AIL C;  4WCE L;  4B9U A;  4C23 A;  4JRP A;  4ZTF A;  1ATR A;  3A8Y A;  3L8B A;  4C8M A;  3HXM A;  4CZJ A;  4J2B A;  4U67 L;  1T7P A;  3LAN A;  4RW4 A;  3SAH A;  1W9H A;  4W5Q A;  1WN7 A;  1IKY A;  4ILJ A;  1SS6 A;  3OYM A;  1NK6 A;  3RSE B;  2NRW A;  1TGO A;  5TKW A;  2FBX A;  3CJC A;  2UU9 K;  2OPP A;  5J2P A;  1TYQ B;  3AO5 A;  3KWI A;  4K25 A;  3BZC A;  1Z05 A;  5AQW A;  1V4S A;  1YTU A;  1KVB A;  5HP1 A;  3OYG A;  1NJX A;  4CJL A;  4CEE A;  3UKU B;  2F8S A;  3AVN A;  1S1X A;  4KTZ A;  1WUA A;  1NGE A;  3M6G A;  3OJU A;  4DSJ A;  4KTQ A;  1HKB A;  4FZY A;  3NVK A;  5AZI A;  2IS3 A;  1XNR K;  2P9I A;  3DLR A;  4W5R A;  1RBR A;  4A62 A;  3GBT A;  3DI6 A;  3VGL A;  1E4G T;  3SPZ A;  3ZSO A;  3R3L A;  2PYJ A;  3I8D A;  3ISN C;  4FWS A;  4FO0 A;  4H0V B;  1TK8 A;  5T7B A;  1TL3 A;  2KFZ A;  3WXI A;  4B9M A;  4FWR A;  2HHU A;  5AZJ A;  3HBT A;  2IIR A;  4HHT A;  3VTH A;  4M3Y A;  3PIP L;  3L3U A;  3VMF B;  5BRF A;  4JKH A;  4BC4 A;  1EWR A;  4QS8 A;  2X6N A;  2X74 A;  4CEB A;  2D5R A;  5KGW A;  4CHN A;  2RN2 A;  2PZS A;  1BU6 O;  1YIT N;  1A5V A;  3ZT3 A;  2HVH A;  2HNY A;  2HBL A;  1NG9 A; 
#chains in the Genus database with same CATH homology
 1LAW A;  5KRS A;  4E0D A;  4CCH A;  4OPJ A;  1UAX A;  1I39 A;  4IG0 A;  1SKW A;  4OKE A;  3ZSQ A;  4OPK A;  4O55 A;  3RRG A;  1YTA A;  5FRM A;  4GVM A;  3KD5 E;  2KW4 A;  3AA2 A;  3EZ5 A;  4FM2 A;  3VA0 A;  4DQR A;  3SQ0 A;  1RT3 A;  3S3O A;  4CK3 A;  3AA4 A;  3QET A;  3S3M A;  3QIN A;  3KK3 A;  2DY4 A;  4R5P A;  4LY7 A;  3OY9 A;  1TKT A;  2VWJ A;  3ULD A;  3HP9 A;  5JS2 A;  3HT3 A;  4BE0 A;  4FJJ A;  4CJ3 A;  1VSH A;  4JLH A;  1HPZ A;  1WSE A;  3ZT0 A;  4DTO A;  4KAZ A;  4OGE A;  4Y1D A;  3V1O A;  5CZ1 A;  4JS5 A;  1RBS A;  2X6S A;  2VG7 A;  4BWM A;  4KFB A;  4OKK A;  4FLT A;  3HYF A;  1VSI A;  3AVK A;  3AVM A;  2A1S A;  4IFY A;  4CER A;  1HQU A;  3OYJ A;  3ALY A;  1S1T A;  4DSE A;  4PWD A;  1WSG A;  3DYA A;  4CJK A;  4KB0 A;  3V9X A;  5KGX A;  4HUG A;  1TL1 A;  3LZJ A;  4KRF A;  1SUQ A;  3O3H A;  3K59 A;  4CJS A;  3AVC A;  3KD1 E;  3P1G A;  4CEO A;  1NKC A;  3PUF A;  4KRE A;  1U48 A;  1L3T A;  4MQ3 A;  5HRO A;  4FW2 A;  3ZCM A;  3AVG A;  3PO4 A;  1HNV A;  4CJW A;  3M8P A;  3NF8 A;  2HNZ A;  5FDL A;  1RT5 A;  3QEW A;  2YNF A;  2G8H A;  3C95 A;  3NGI A;  1FXX A;  4TSX A;  3OYN A;  4DTR A;  5J1E A;  1HNI A;  2IC3 A;  1VSK A;  1HYV A;  2P5O A;  3DRR A;  3TAQ A;  3I0S A;  4CHZ A;  3AA5 X;  4O5B A;  2D0B A;  4CFD A;  2R7Y A;  4DF8 A;  4G1Q A;  3SNN A;  1RCH A;  1C1B A;  1RDD A;  4M41 A;  2XHB A;  5HLF A;  4Z4I A;  2JGU A;  3LP0 A;  4CEZ A;  1Z26 A;  3TAP A;  3P5J A;  2HHT A;  3LDS A;  1XWL A;  1LWE A;  1X9S A;  2JLE A;  4CHY A;  4KHW A;  3OS1 A;  4B9N A;  4CJV A;  3KLF A;  1XHX A;  1CXU A;  1KTQ A;  3QIO A;  3V1R A;  4B9T A;  4DQI A;  4H4O A;  3O4Q A;  3QNO A;  3OYC A;  1NKB A;  1T03 A;  3VQ8 A;  4LH5 A;  4J2D A;  1ZYQ A;  2XY6 A;  3L2U A;  4H8K A;  4DSI A;  4DFK A;  4B08 A;  4DG1 A;  4EP4 A;  3ZT2 A;  3MEE A;  2HHX A;  2OYQ A;  2HHS A;  3IAY A;  4ELT A;  4W5T A;  1Q9X A;  1IKW A;  1S6P A;  4ICL A;  4DU3 A;  1EET A;  4AHC A;  2RF2 A;  4CGI A;  4YFU A;  1KFD A;  1HYZ A;  3F9K A;  4FLX A;  3G0Z A;  3AA3 A;  1S1W A;  3O4N A;  1WNS A;  3QO9 A;  5FRN A;  2QKB A;  3DMJ A;  3B6P A;  3SQ1 A;  4J2A A;  2KFN A;  1CXQ A;  1T8E A;  1B92 A;  4FLZ A;  4NYF A;  1D9F A;  3HL8 A;  1S9G A;  1JL2 A;  3ZT1 A;  2BAN A;  3SYZ A;  1X9M A;  2VG5 A;  1MU2 A;  4CIG A;  2PY5 A;  4FK0 A;  3LAM A;  1U45 A;  3ZSX A;  3OYF A;  4E89 A;  3RMA A;  5CYQ A;  2G8V A;  4FXD A;  1WSF A;  1RTI A;  5J2Q A;  1U49 A;  1T05 A;  3VQD A;  1KVA A;  3EYZ A;  2EHG A;  4FJH A;  1UA0 A;  4DTM A;  1QSS A;  4AHU A;  4Z4E A;  4LH4 A;  1C0M A;  1RIL A;  2QKK A;  3MXI A;  4OVL A;  3L2R A;  2QXF A;  3NHG A;  4FLY A;  1UWB A;  4KTW A;  2DTU A;  1SL2 A;  2OPS A;  2HW3 A;  3CM5 A;  4OLB A;  2Z1I A;  4CES A;  5JS1 A;  3K2P A;  3TAE A;  2RKI A;  5HBM A;  3RR8 A;  3NAE A;  4CF1 A;  1SL1 A;  3KK2 A;  1TKD A;  2Z1J A;  1R0A A;  3DRS A;  3TI0 A;  3KJV A;  5K14 A;  4I2Q A;  1YVU A;  4LSL A;  5C42 A;  3KLG A;  3HVR A;  4IBN A;  3PY8 A;  3SUQ A;  1EX4 A;  1LV5 A;  1RDA A;  2D0A A;  4E1N A;  2WOM A;  3V9W A;  1JXB A;  2DFF A;  4IG3 A;  4E3S A;  2IOC A;  2P51 A;  4CIF A;  4FJL A;  4CFB A;  4HCB A;  3TWH A;  3NF6 A;  3DLH A;  4DWI A;  1U04 A;  3OYH A;  4DTN A;  2OPR A;  4C8O A;  3OYD A;  4JS4 A;  4IKF A;  3MEG A;  3L2Q A;  1SKR A;  4RW9 A;  3OVN A;  4DFM A;  4Z0U A;  4DTS A;  3KLI A;  3PX4 A;  2HMI A;  4B9S A;  2F96 A;  4M3Z A;  4HVJ A;  4DU1 A;  1IKX A;  4HTU A;  3NCI A;  2F8T A;  4B3O A;  1EKE A;  1J9A A;  3SJJ A;  4CJF A;  3TAR A;  4FJ7 A;  4FJ9 A;  4QOZ B;  4GW6 A;  2BGG A;  2HVI A;  4FYD A;  3OYK A;  4FZZ A;  3NGY A;  2IDO A;  3DLB A;  1L3V A;  3WNG A;  4ID1 A;  4CIE A;  4M3R A;  3THV A;  3AO3 A;  4HUF A;  2XO7 A;  3M8R A;  2FBT A;  2BDP A;  4FJN A;  3WNH A;  4FM1 A;  4KV8 A;  3UIQ A;  1TK5 A;  1XHZ A;  3VQ6 A;  3SCX A;  4CJR A;  3HPH A;  3KIO A;  2HHQ A;  4O0J A;  3SV3 A;  3NDK A;  3V9Z A;  2G8W A;  2I5J A;  3S9H A;  1JLE A;  2XRI A;  4B9L A;  2Z1G A;  3O3G A;  4PY5 A;  1S5J A;  5HRP A;  2ZQB A;  4NCB A;  1KRP A;  2HHV A;  4FJ5 A;  4FLW A;  4PQU A;  2G8U A;  1ASU A;  3FFI A;  4E7L A;  1ITG A;  3C6U A;  4O4G A;  1CLQ A;  3HVT A;  1NK7 A;  4C8K A;  1BQM A;  1Y97 A;  2ZD1 A;  3WNE A;  1IG9 A;  2P5G A;  3ZSV A;  4RW6 A;  1HMV A;  1QE1 A;  4AHS A;  4BDY A;  2B4J A;  4RG8 A;  4KHQ A;  4H4M A;  4M3X A;  4C8L A;  5CY4 A;  3MEC A;  3L3V A;  4KI4 A;  2HHW A;  2OA8 A;  3HJF A;  1RT4 A;  4O0I A;  4Z4F A;  5FRO A;  3SUP A;  4FJX A;  1SV5 A;  4IFV A;  1CZ9 A;  3RTV A;  3RWU A;  4CJU A;  3T1A A;  5SWM A;  1GOC A;  4CF9 A;  1IH7 A;  1TAQ A;  1FKP A;  4ZTJ A;  2G8I A;  3C6T A;  2BE2 A;  4NCA A;  1RDC A;  4BAC A;  3OYI A;  2ATQ A;  3ZSW A;  1NJY A;  1N5Y A;  2E6L A;  1RBU A;  3VQ5 A;  1I3A A;  4OJR A;  3T3F A;  3SI6 A;  4OGC A;  4CED A;  2EX3 A;  3AVL A;  3QLH A;  1Q9Y A;  4Z4C A;  3V9S A;  2GUI A;  4E7H A;  3JSM A;  4KHU A;  4Q5V A;  3TAG A;  3U3Y A;  1XC9 A;  5E41 A;  4N47 A;  1L5U A;  4F2S A;  4KB1 A;  1BQN A;  4RW8 A;  1G15 A;  1WSJ A;  4IDK A;  4FJK A;  3NH0 A;  4Z4G A;  4N5S A;  1FKO A;  3VQ4 A;  3CYM A;  3LP3 A;  3PV8 A;  1NJW A;  2NUB A;  1JLF A;  1ZBH A;  4FCY A;  3VQB A;  3K58 A;  4DFP A;  4JRQ A;  4J2E A;  4KI6 A;  3B6O A;  4DSL A;  3VQC A;  4E7K A;  3QEP A;  3DM2 A;  3I0R A;  3D0P A;  1LAV A;  4UQG A;  4I9Q A;  4KHS A;  1J53 A;  4YNQ A;  3RMB A;  4E1M A;  5SZT A;  3CG7 A;  4CF8 A;  4DLE A;  3VN5 A;  3KLE A;  2XY7 A;  1XI1 A;  1WAJ A;  1Q8I A;  3LPU A;  3ASM A;  4FZX C;  3CM6 A;  4OLA A;  3HPG A;  3IRX A;  4FW1 A;  3AO2 A;  4OKJ A;  1REV A;  4CJQ A;  2ETJ A;  4FJI A;  5EU7 A;  3CFR A;  3A2F A;  3OYA A;  2Z1H A;  4KO0 A;  4CFC A;  3V1Q A;  3OS0 A;  1QHT A;  1VSF A;  3QNN A;  4O44 A;  2HB5 A;  1X1P A;  5I3U A;  1BI4 A;  1KFS A;  3AVB A;  1RNH A;  4F4K A;  2Y1J A;  1VSL A;  4FK2 A;  1S6Q A;  5KRT A;  3VQ9 A;  4CJP A;  3RMC A;  1NK4 A;  3DLG A;  3ZT4 A;  4CGH A;  2FBY A;  3AVH A;  4DQS A;  4DTJ A;  1DTQ A;  4KKO A;  3LWL A;  1BIS A;  2A1R A;  4E7I A;  4CE9 A;  2OZS A;  1VRT A;  3MAQ A;  2B6A A;  4I7F A;  3VQP A;  2E4L A;  5KTQ A;  1U47 A;  4DSK A;  4DU4 A;  4BE2 A;  4KHN A;  1BIU A;  5DK5 A;  3KLH A;  4DS4 A;  1JLQ A;  4CK1 A;  1NK9 A;  4CGG A;  4FVM A;  3L2V A;  1WSI A;  1UOC A;  3IG1 A;  4CEC A;  2RPI A;  1KLM A;  4MFB A;  4QAG A;  4PA1 A;  5DMR A;  2DFH A;  4DMN A;  2Q3S A;  4C8N A;  2YHA A;  2YKM A;  1WAF A;  1KSP A;  2X78 A;  3E01 A;  4LD0 A;  3AVJ A;  1S9E A;  4CGD A;  2GBZ A;  4E19 A;  1C0U A;  3RMD A;  1VSM A;  3QIP A;  1ASV A;  5HRS A;  2W42 A;  4M3W A;  4M3T A;  4DF4 A;  3QER A;  3AV9 A;  2KQ2 A;  1A5W A;  2P1J A;  4W5N A;  3DLK A;  1DTT A;  5CYM A;  4AH9 A;  4K8Z A;  3NF9 A;  1RTJ A;  4DTX A;  1JLA A;  1HQE A;  4DTP A;  3G10 A;  4CJE A;  2PYL A;  1JLC A;  4AHT A;  1K6Y A;  3ZSR A;  4EP5 A;  3SUN A;  1W0H A;  4ELV A;  3HP6 A;  2E6M A;  3CFP A;  3U6F A;  3TAF A;  2FC0 A;  3IS9 A;  3LP2 A;  1C0T A;  5KI6 A;  3V81 A;  4ELU A;  1LWC A;  1VSE A;  3AO4 A;  4I9L A;  1BCO A;  3QEX A;  3HST B;  4GMJ B;  2D0C A;  2G8K A;  4KHY A;  1JLG A;  1KVC A;  3NF7 A;  4CGF A;  1ZBL A;  2XY8 A;  3SQ2 A;  3SQ4 A;  4CHQ A;  3HPO A;  1HYS A;  2XY5 A;  4FK4 A;  3F73 A;  1QQC A;  4CGJ A;  3NBP A;  3MXM A;  3RR7 A;  2KTQ A;  3LWM A;  1D5A A;  2YHB A;  4FJG A;  1WLJ A;  3TAB A;  4E7J A;  4FLU A;  1LW0 A;  1TKX A;  3LAL A;  1SL0 A;  4F3O A;  4L8R B;  4FJ8 A;  1D9D A;  3HO1 A;  3CQ8 A;  1QTM A;  1UA1 A;  3QEI A;  3OYE A;  3VA3 A;  1J5O A;  3T19 A;  4M3U A;  2AJQ A;  3SPY A;  4CHO A;  4B8A B;  5CZ2 A;  2OZM A;  1S1V A;  4CF2 A;  1IKV A;  1NOY A;  3DRP A;  4ID5 A;  2KZZ A;  3QES A;  3KKS A;  3NGZ A;  1Z25 A;  4CF0 A;  3TR8 A;  2VG6 A;  2VWK A;  4B8C A;  4HCC A;  3D45 A;  1TV6 A;  2HND A;  1GOA A;  4DQP A;  1KCF A;  1VK0 A;  4EZ9 A;  4CEA A;  2ZE2 A;  1RT6 A;  1QSL A;  2YKN A;  3ZSZ A;  1TAU A;  1IO2 A;  3V6D A;  1F21 A;  2O4G A;  4I2P A;  3NE6 A;  1ASW A;  3NFA A;  4NCG A;  3SZ2 A;  1RT1 A;  4DSF A;  1EP4 A;  5J2N A;  4AHV A;  2DFE A;  3VQQ A;  1A5X A;  1HJR A;  3BGR A;  2Y1I A;  3BDP A;  4F3T A;  4AIL C;  4HUE A;  4RW7 A;  2YV0 X;  4B9U A;  3CFO A;  4JRP A;  4BE1 A;  3VQE A;  4ZTF A;  3MED A;  3DOK A;  4Y1C A;  1O1W A;  4C8M A;  3HXM A;  3L8B A;  3C94 A;  3PX6 A;  4FLV A;  3KTQ A;  1J54 A;  4J2B A;  1CZB A;  3O3F A;  2WON A;  4XIU A;  1LW2 A;  5J2M A;  3LAN A;  1T7P A;  5D3G A;  4RW4 A;  2IAJ A;  1W9H A;  4CEQ A;  1QS4 A;  2YNH A;  4W5Q A;  1WN7 A;  1IKY A;  3M8S A;  3S3N A;  4Q0B A;  1B9D A;  3OYM A;  3AVI A;  1YT3 A;  3K5O A;  3TAN A;  4LSN A;  4CJ5 A;  1NK6 A;  4FJM A;  3VQ7 A;  4N41 A;  3L2W A;  4KPY A;  2KZM A;  1TGO A;  5C25 A;  1NK5 A;  2FBX A;  3M8Q A;  3SV4 A;  4DTU A;  2YNI A;  2QK9 A;  1NK8 A;  1DLO A;  2OPP A;  3AVF A;  5J2P A;  4CEF A;  4NYN A;  2OPQ A;  3V4I A;  1NOZ A;  3AO5 A;  1C1C A;  2G8F A;  1FK9 A;  1RT7 A;  1BHL A;  3DOL A;  1RTH A;  3ZSY A;  3V9U A;  1NK0 A;  3H08 A;  3P83 D;  1NJZ A;  1SKS A;  1YTU A;  1KVB A;  5C24 A;  2FBV A;  1JL1 A;  1HRH A;  3JYT A;  5I42 A;  1ZBU A;  4CFA A;  5HP1 A;  1TVR A;  3OYG A;  4DQQ A;  1NJX A;  4M42 A;  3LZI A;  3WNF A;  1L3U A;  4QCL A;  4CJL A;  3K5L A;  4CJT A;  1QSY A;  3AVA A;  4CEE A;  1C6V A;  2F8S A;  3AVN A;  1JLB A;  3QEV A;  1U4B A;  3OYL A;  1S1X A;  1RBV A;  4KTZ A;  1KLN A;  3OJU A;  4DSJ A;  4KTQ A;  4FZY A;  1RT2 A;  3KK1 A;  4DFJ A;  5HRN A;  3NH2 A;  4B9V A;  4W5O A;  2IS3 A;  1VSJ A;  3DLR A;  4W5R A;  4BDP A;  1GOB A;  3HM9 A;  1RBR A;  4DS5 A;  3OJS A;  4F8R A;  2GV9 A;  3DI6 A;  4CHP A;  3SPZ A;  3ZSO A;  3TAM A;  3U3G A;  4CJ4 A;  3OS2 A;  4BDZ A;  1RTD A;  2PYJ A;  1TKZ A;  3LP1 A;  3I8D A;  3AO1 A;  2LSN A;  3ISN C;  4Z4H A;  1ZBF A;  2B5J A;  1TK8 A;  3SUO A;  2YNG A;  5T7B A;  4WE1 A;  1TL3 A;  2KFZ A;  3K57 A;  3MXJ A;  3HK2 A;  4F2R A;  1ZBI A;  4B9M A;  1L3S A;  2HHU A;  1S1U A;  1BGX T;  1B9F A;  1VSD A;  1RDB A;  4AHR A;  3LPT A;  4BWJ A;  1N6Q A;  1JXE A;  3K5M A;  4HHT A;  4M3Y A;  3NH1 A;  4CK2 A;  1RBT A;  2IGI A;  4DLG A;  4PUO A;  4ZHR A;  3ITH A;  3RRH A;  1BCM A;  3L3U A;  4K8X A;  4M45 A;  1LWF A;  3KKR A;  1JKH A;  4EZ6 A;  3OYB A;  1D8Y A;  1TK0 A;  1BL3 A;  5HRR A;  1NKE A;  4N76 A;  3EY1 A;  1C1A A;  1WSH A;  2X6N A;  2X74 A;  1VRU A;  4CEB A;  4N56 A;  3K5N A;  3PX0 A;  2D5R A;  5KGW A;  4CHN A;  1EXQ A;  2RN2 A;  3DLE A;  3LAK A;  4FM0 A;  1BIZ A;  1X9W A;  2PZS A;  1BI4 B;  1A5V A;  3ZT3 A;  2HVH A;  2HNY A;  2ITG A;  3VQA A;  3PO5 A;  2O4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...