3ZT2A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt2A00
3L2UA 4H8KA 1I39A 1EX4A 1WSJA 1HRHA 3CM5A 4BE1A 4FLVA 1JLEA 3BDPA 4PQUA 1VSKA 4CJFA 3NGZA 1LW0A 3NH0A 2ZQBA 4DF8A 1D9FA 3OYBA 1DTQA 1D9DA 5SWMA 3RMBA 4RW8A 3DLBA 3ZT1A 3ITHA 4M3ZA 2Z1GA 2B5JA 1QSYA 3K59A 4KPYA 1T7PA 4CGDA 4FJMA 2IGIA 4PY5A 1U04A 1LAWA 3HSTB 3P5JA 5KGWA 5JS2A 3ZSQA 4CEBA 4CIEA 1JLGA 1WSIA 4Z0UA 4CHQA 2G8KA 4DFPA 1BIZA 4O44A 3K2PA 4DTXA 4IG0A 3TR8A 2VG6A 4J2DA 3AVJA 1SKRA 4ELVA 1ZBFA 3V81A 4GW6A 1L3VA 3I0RA 2W42A 3RR8A 4C8KA 3OYNA 2HNDA 4M45A 3PO4A 4KRFA 4CJSA 4KHQA 1HNIA 2QKKA 2RF2A 1WAJA 4CGHA 1SL1A 1FXXA 2OPRA 1VSJA 4KTZA 4B9SA 1ASWA 3ZT2A 5J1EA 3OJSA 3O4NA 3VQPA 4M3XA 2IAJA 1KVCA 3OYGA 4QOZB 4BACA 4CJQA 3VQEA 3DLKA 4CFDA 4FM1A 4FXDA 1W9HA 2X74A 3CFPA 3QNOA 4EZ6A 4BE2A 1RBVA 1RT2A 3NFAA 4IBNA 1LV5A 1VSFA 4E1NA 5HP1A 4E7IA 4GMJB 4E7KA 4CCHA 3VQQA 5D3GA 3P83D 5C24A 3S3NA 4DU3A 2HHXA 4CJRA 4K8XA 1TKXA 3VQ7A 4E1MA 1ASUA 1BIUA 3E01A 4OVLA 1XWLA 1L3UA 3OYDA 3HP6A 4F2RA 3B6OA 4CF8A 2BE2A 3SUQA 4FJGA 4CIGA 4FZXC 1NJYA 1FKPA 4LH4A 3SPYA 1L3SA 1RBSA 3HO1A 2VWKA 3OYMA 1R0AA 4CJWA 3KIOA 1JXBA 3HT3A 1XI1A 1U49A 2JGUA 2X78A 4OKEA 4FYDA 4W5QA 1XC9A 4PA1A 3NDKA 1HYZA 3VA0A 4FJNA 5KRTA 4CJ3A 1UA0A 3DI6A 4O0JA 4FJ9A 4MFBA 4DU4A 4CGFA 2XY7A 4Z4FA 1ZBHA 3ZT4A 4KB1A 3MEEA 3NF9A 1VSIA 3NGYA 3AVIA 2BANA 3SUNA 2O4IA 3MXJA 4CK1A 3LDSA 1NJXA 4B9UA 4FZZA 4KHYA 1B9DA 4AHRA 3AO1A 1TGOA 1JLFA 1IO2A 3OS2A 2VWJA 4DTSA 1N5YA 4N76A 1L3TA 1HJRA 1YT3A 3HVTA 2XHBA 5KGXA 3HJFA 3NHGA 1HYVA 2WONA 4CEQA 4RW7A 1QHTA 4DQRA 4DF4A 3V6DA 4CHNA 1KRPA 4FJ7A 4DSLA 1RILA 4ELTA 2HNZA 4FJXA 1YTUA 1ZBUA 4O5BA 1TAUA 2OZSA 1BCMA 2ZE2A 3G10A 1SKSA 1JLCA 4L8RB 3QETA 3LP0A 1SL2A 3AO5A 2R7YA 2F8SA 2D0BA 3HP9A 3LPUA 4O55A 3TAEA 3RRHA 5DMRA 3AA5X 2RPIA 3HYFA 5CZ2A 4CHZA 3RWUA 1IKVA 5EU7A 1LWEA 3PX6A 1XHZA 4HVJA 2RN2A 3OY9A 4CERA 4DLGA 4I9QA 4OPJA 3ZCMA 4CF9A 3ULDA 3LALA 2Z1HA 1TAQA 3NF8A 4ID1A 2QXFA 5T7BA 3KLFA 3DLHA 4M3WA 2KFZA 3O3HA 3AVKA 4FJJA 3U3GA 1VSDA 3OYJA 3MEGA 4JS4A 3PO5A 1GOBA 3RR7A 4FM2A 3HM9A 4QCLA 1S1TA 4FLYA 3AVBA 2KZMA 1B92A 3WNHA 2XO7A 4DTRA 5JS1A 2Z1IA 4O0IA 4K8ZA 4KKOA 4J2AA 1RDAA 2D5RA 4CIFA 4W5NA 2O4GA 4OGEA 1A5XA 1U4BA 1WLJA 1CZ9A 3VQDA 1K6YA 4FLXA 3HPOA 1RT5A 1HYSA 3TWHA 3LANA 4DFKA 3TAGA 3V9XA 3KJVA 3OVNA 3LWMA 3MECA 4FJIA 2PYJA 3B6PA 4Q0BA 1C0MA 4CF2A 5J2NA 4TSXA 2IDOA 2HHVA 1C0TA 2G8VA 1TVRA 1EXQA 3VN5A 1B9FA 4E0DA 3IS9A 1BGXT 1S6PA 3C95A 4Z4CA 1LWFA 4NCGA 4CJ5A 3HXMA 3QEIA 4FK4A 2XY5A 1TKDA 2HB5A 3LWLA 3KLIA 4HUGA 3BGRA 3SI6A 2OZMA 3OYKA 2PY5A 4HTUA 2P5OA 1RTHA 3V1QA 1NK4A 1NKEA 1FK9A 2FBYA 1BHLA 3VQCA 4AHVA 4KHNA 3CFRA 4DFMA 4NCAA 3SUOA 3LPTA 4NYFA 1CXQA 3OYHA 1NK9A 4OPKA 4JRQA 1NJZA 3TANA 1TL3A 5DK5A 2GV9A 3ZT3A 4N47A 4AH9A 3V1OA 1JLQA 1EETA 3C94A 3H08A 3WNGA 1GOAA 3V9UA 3TAQA 4E19A 3NH1A 4M3YA 3L3UA 3P1GA 4CJVA 1C1BA 4FW2A 4FJ8A 4B9VA 4E89A 4DTJA 4QAGA 4GVMA 2WOMA 3QEXA 2ETJA 1YVUA 3QLHA 3RRGA 1VRTA 4CJUA 4DSEA 4FJLA 1JLAA 1X9SA 3L2QA 1VSHA 3L2RA 3L8BA 3SV4A 4FCYA 2GBZA 4Y1CA 1UWBA 1RNHA 4H4MA 4AHTA 4AILC 1WNSA 4B8CA 5K14A 3F73A 3DRSA 2HMIA 1T8EA 3AVNA 1TK8A 4HUFA 2YNFA 3ASMA 1W0HA 1BI4B 1SUQA 3L3VA 4C8LA 3HPHA 4CF1A 4ZHRA 3RMAA 3ISNC 3L2WA 1S1UA 4RW9A 4CJLA 2PZSA 3V1RA 1ITGA 1TV6A 4CJTA 3O3GA 1O1WA 2AJQA 3AO3A 4RG8A 4MQ3A 2YNGA 3HVRA 2A1RA 3PX0A 2G8HA 2YKNA 2EX3A 1C6VA 3AV9A 2FBTA 1NJWA 5KRSA 1REVA 1TK0A 1RDBA 4CHPA 2G8FA 3VQAA 3M8SA 4M41A 4KI4A 3PY8A 2YKMA 4O4GA 2BGGA 4CGJA 4I2PA 1FKOA 1Z25A 2VG5A 1S1WA 1TKZA 1S1VA 1JKHA 4M3UA 4F3TA 4CK2A 3KK1A 1XHXA 3PUFA 3KLHA 1BQNA 4E7LA 4CESA 4FJHA 4E7JA 3JSMA 1J5OA 4ID5A 3TAMA 3MAQA 5HRNA 3L2VA 4Z4EA 1KVAA 1SL0A 3CQ8A 2Y1JA 5CYMA 4CEZA 2PYLA 2OYQA 1QS4A 1NOZA 4CFAA 3U3YA 1RT6A 3CYMA 1MU2A 4FM0A 4DTNA 2XRIA 1QTMA 5C42A 3NF6A 1LWCA 4DSJA 4JS5A 4CJEA 4KHUA 2KTQA 1RT3A 1C1AA 4HUEA 1BI4A 4IFVA 1KTQA 1RT1A 4CFCA 3ZSOA 3D0PA 1TKTA 2Q3SA 3VQ8A 3LZIA 3KTQA 3AVGA 4KTWA 4BWJA 1KLNA 1JL1A 1IH7A 2HHWA 2X6NA 1U45A 5HBMA 3M8QA 4RW6A 5HRRA 3HK2A 1DLOA 3NBPA 4CFBA 2KQ2A 4IFYA 2Z1JA 4KHWA 3NE6A 2IC3A 4DTOA 5HRPA 3KK3A 3MXMA 3OYCA 1TK5A 4BE0A 3UIQA 1RTIA 4FLWA 4J2BA 1ZBIA 3ZSRA 3SQ4A 4ZTJA 2OA8A 3DLGA 2IS3A 1JL2A 3K5OA 1T05A 2DFHA 5CY4A 4KREA 2E4LA 3VQ6A 3SQ0A 1NK7A 1WAFA 4OGCA 3NH2A 4CEEA 2HVIA 1X1PA 2F96A 4I9LA 4CEDA 4W5OA 4DQIA 1QSSA 3DMJA 3LP2A 4LD0A 3KD1E 4AHCA 4DSIA 4CEFA 1KVBA 4N56A 3NCIA 5J2PA 4DSKA 1RTDA 5CYQA 4B9TA 3KKRA 1Q9YA 4DQSA 3AVMA 4BDZA 1NK8A 4DWIA 1Z26A 1U48A 4CECA 1WSEA 3DOLA 1RT4A 3IG1A 5KI6A 1CLQA 1D8YA 3NF7A 3ZSXA 3AVFA 4CEAA 4C8OA 2FBXA 3ZSWA 3QEWA 1VSEA 4LH5A 1U47A 4ZTFA 3KD5E 3ALYA 1RBRA 1WSHA 3LAMA 4CEOA 3MXIA 1SKWA 1G15A 1WSFA 3DRPA 3S3OA 1Y97A 3S3MA 1YTAA 4G1QA 1X9MA 1KSPA 4DQPA 1T03A 1X9WA 4HCBA 1S9EA 4I2QA 4F2SA 1NK5A 4BDYA 4E7HA 3HPGA 4FJ5A 4KI6A 3VA3A 2P5GA 1ASVA 2XY8A 3AA2A 2YHBA 4CHOA 4XIUA 2G8WA 4EP4A 1UAXA 3WNEA 3EY1A 2OPSA 3SZ2A 1NK0A 4B3OA 1I3AA 4JRPA 4W5TA 3OYEA 2D0AA 4IDKA 3ZSZA 1CXUA 3M8PA 4CJKA 4DTPA 3JYTA 1J53A 3D45A 3OJUA 1TL1A 2KW4A 1KFDA 1VSLA 4DTUA 3LZJA 3QEVA 3SUPA 1S9GA 4DS4A 3T19A 3K58A 4DQQA 1ZBLA 1KLMA 4B9NA 2LSNA 1Q9XA 4JLHA 3KK2A 3HL8A 2HW3A 2KZZA 1IKWA 1NKBA 3A2FA 3C6TA 1QSLA 2GUIA 2DTUA 3ZT0A 1UA1A 3CG7A 3OYIA 3VQBA 3IRXA 3OS0A 1QQCA 4AHSA 4PWDA 4KO0A 3AA4A 3DRRA 4FVMA 3QIPA 4RW4A 3NGIA 2DY4A 4C8MA 4E3SA 3AVAA 3QERA 5KTQA 3ZSVA 4Y1DA 3DLEA 3MEDA 1EP4A 2I5JA 1J9AA 3I8DA 2VG7A 3I0SA 3KLGA 4CJPA 2FC0A 3K5NA 4KB0A 4CK3A 2OPPA 1BCOA 2YNHA 3KLEA 4EP5A 4FLZA 2DFFA 5FDLA 4M42A 4DU1A 2B4JA 4IG3A 3V9ZA 1KFSA 2QKBA 3V9WA 3AVCA 4OJRA 3VQ5A 3NAEA 1NK6A 4CE9A 4UQGA 3SPZA 1HQUA 3SV3A 1BISA 3RMCA 4N41A 4KFBA 5C25A 4CHYA 4OLAA 1LW2A 3SQ2A 3LP3A 1RBUA 4FW1A 3CFOA 4YNQA 3KKSA 3EYZA 5I42A 4DS5A 3RTVA 3SCXA 1RT7A 3VQ9A 3ZSYA 3THVA 4HCCA 1S5JA 1NOYA 1RDDA 1EKEA 1VRUA 4DG1A 2E6MA 1IKXA 4I7FA 2BDPA 4J2EA 4Z4HA 2ZD1A 2HHTA 1VSMA 2NUBA 2YHAA 5FROA 2ATQA 4LSLA 3IAYA 3OYAA 4Q5VA 3T3FA 2G8UA 4FLUA 3RMDA 4F8RA 4PUOA 4ICLA 4YFUA 2DFEA 1RCHA 4H4OA 3K57A 1NKCA 1CZBA 5E41A 5HLFA 3TI0A 1IKYA 3QINA 3TAFA 4FK2A 1WN7A 4BWMA 3T1AA 2HNYA 2A1SA 2FBVA 3O4QA 4NCBA 3SNNA 2P51A 2ITGA 3CM6A 1HMVA 5SZTA 1C0UA 4DSFA 3QNNA 4Z4GA 1HPZA 3FFIA 5FRNA 1RDCA 2G8IA 2HVHA 3EZ5A 2JLEA 2RKIA 1S1XA 2HHSA 3LP1A 1A5WA 2X6SA 3DM2A 1C1CA 1UOCA 1GOCA 2EHGA 3AO2A 4FJKA 1QE1A 1KCFA 3VQ4A 1JLBA 1L5UA 5HROA 3QEPA 3G0ZA 4FK0A 2D0CA 3C6UA 1BQMA 3DYAA 4LSNA 4M3RA 3QESA 1D5AA 2YV0X 1JXEA 3AA3A 1RBTA 4OKKA 5J2MA 2XY6A 1N6QA 1IG9A 2QK9A 4CJ4A 3WNFA 3TABA 4LY7A 4B08A 4CGIA 4W5RA 2P1JA 4B8AB 5J2QA 4OLBA 2HHUA 2HHQA 3QIOA 3SQ1A 1F21A 2YNIA 1LAVA 4F3OA 3OYFA 1WSGA 4WE1A 5CZ1A 4DTMA 3V4IA 4IKFA 1VK0A 4NYNA 3OS1A 5HRSA 1RTJA 4DLEA 4Z4IA 1SV5A 4KTQA 4KHSA 1HNVA 3LAKA 4EZ9A 4M3TA 3QO9A 2KFNA 1S6QA 4OKJA 1J54A 1ZYQA 4FZYA 3SJJA 2B6AA 2F8TA 4C8NA 4B9LA 5FRMA 4KV8A 1Q8IA 3OYLA 4R5PA 3M8RA 4DMNA 3DLRA 3AVHA 4AHUA 3PV8A 4ELUA 2Y1IA 3U6FA 1BL3A 3K5MA 4F4KA 4DFJA 3SYZA 3PX4A 3S9HA 4CGGA 3TARA 4KAZA 1HQEA 4BDPA 4HHTA 1DTTA 3AO4A 3DOKA 2OPQA 4FLTA 3V9SA 4B9MA 3TAPA 4N5SA 3K5LA 1A5VA 2E6LA 3AVLA 2IOCA 3F9KA 4CF0A 5I3UA 3O3FA
chains in the Genus database with same CATH superfamily
3L2UA 5GINA 5JVGL 3CM5A 4FLVA 4PQUA 4CJFA 3RMBA 4WFAL 4DV2K 5BPNA 2B5JA 1NGIA 2NRTA 5JS2A 3ZSQA 5B8HA 4DFPA 1BIZA 4O44A 4DTXA 4IG0A 4HTLA 3AVJA 1SKRA 4GW6A 3EZWA 3TTFA 4MO5A 3QBWA 1SZ2A 4C8KA 3OYNA 4KRFA 2YI1A 4B9SA 2OPRA 5J1EA 3O4NA 2Q0UA 4BACA 3VQEA 3DLKA 4FM1A 1W9HA 3CFPA 1VQNN 3SAHA 3O1BA 1LV5A 1VSFA 4IEEA 4CCHA 5D3GA 2QWMA 2YJEA 4DV7K 1M1KO 2YJFA 3EEQA 3B6OA 4O8KA 4FJGA 4FZXC 1FKPA 4LH4A 3OYMA 4CJWA 1JXBA 2JGUA 1XC9A 3VA0A 4FJNA 4CJ3A 4PHTX 3HZ6A 4DU4A 1ZBHA 5FPEA 2HF3A 3MEEA 3NGYA 2BANA 3F9MA 3SUNA 4FPAA 4CK1A 4FZZA 5GIOA 3TTCA 1JLFA 3WQTA 3UB5A 4DCHA 4V19S 4H5RA 4WFNL 1VQKN 5JICA 2HNZA 3BZCA 5FLXO 2OZSA 1SKSA 2BTFA 2ITMA 2FXUA 3VOVA 3FZKA 2F7TA 5AQRA 4QS9A 5EU7A 4DLGA 1IBKK 4OPJA 3ZCMA 1XUPO 3LALA 4ID1A 2KFZA 3AVKA 2FF6A 3BY5A 3U3GA 1VSDA 4JS4A 3PO5A 1GOBA 1S1TA 4H5WA 2KZMA 5EY4A 1B92A 2A42A 1ZXOA 2Z1IA 4MLEA 1RDAA 1HNWK 1A5XA 1CZ9A 4OO1J 4FLXA 3LANA 4GV3A 5M1FA 1YJWN 2PBDA 3MECA 1T44A 2Q36A 3BF1A 5J2NA 5CE3A 2G8VA 4WFBL 4E0DA 5AQZA 5BRHA 4HWIA 4FWRA 3A5MC 3KLIA 3LWLA 3CC7N 3SI6A 3EE9A 4HTUA 2P5OA 3EN9A 1RTHA 3EE8A 1NK4A 3THWB 1HNXK 4X64K 1YITN 3H1VX 2W6LA 3LPTA 3A5NC 1E3MA 3ULEB 4JRQA 2GUPA 3TANA 1TL3A 4N47A 3V1OA 3C94A 3WNGA 1GOAA 2D1KA 3P1GA 3M6GA 4FW2A 2WOMA 3QEXA 1YVUA 3QLHA 5H1SQ 4DSEA 3L6QA 3L2QA 2IIRA 1VSHA 3RVCA 3L8BA 4FCYA 4Y1CA 4H4MA 2P9PB 3DRSA 5AZIB 4EHTA 2HMIA 4HUFA 3A5LC 2BH1A 2YNFA 3ASMA 1SUQA 3IFRA 3L3VA 3TSUA 2P9UB 3ISNC 4FWOA 4CJLA 2CGKA 4H5TA 3I56N 1ITGA 1TV6A 1KQSM 3J7ZO 1DKGD 2A1RA 3SMPA 2O8EB 2YHXA 3AV9A 3CF5L 1REVA 5C2DA 2V51B 4O4GA 5C0YA 1Z25A 1TKZA 5KQ8A 4DR3K 4OX9K 4E7LA 1BQNA 1OH5A 4CESA 4FJHA 1GLDG 3JSMA 4DV3K 4M63C 3L2VA 2P9KB 3CQ8A 5CYMA 2OYQA 1NOZA 4CFAA 3CYMA 1Q86O 1U6ZA 1S72N 1LWCA 4DSJA 5LJWA 4U7BA 4CJEA 4X62K 1RT3A 1NGDA 3WEEA 1BI4A 4IFVA 1KTQA 1HUXA 1TKTA 3LZIA 5AQJA 3AVGA 1JL1A 1NBWA 2I7PA 4EFHA 2WUSA 2HF4A 3DJCA 3T1HK 3M8QA 4PKGA 3HK2A 3BP8A 3NBPA 3DXMB 4KHWA 3NE6A 5C2FA 4AQYK 1VQMN 3KK3A 3MXMA 3ZX2A 4BE0A 4FLWA 4J2BA 1QQNA 1HLUA 3DLGA 4BRAA 1T05A 2ASMA 2E4LA 4H0YB 3VQ6A 1NK7A 4OGCA 4CEEA 1X1PA 3CCMN 4NXNK 1QSSA 3ENBA 1NWKA 4FWNA 3NCIA 5J2PA 1RTDA 3PLAA 5CYQA 1NK8A 4BDZA 1Z26A 1U48A 3VGMA 3C6AA 3CIPA 3IG1A 1CLQA 3ZSWA 2NNWA 4LH5A 4A5BA 3KD5E 3ZLJA 4CEOA 3J7YP 2W40A 4DV0K 1MA9B 1WSFA 4HCBA 3I33A 4FOIA 4LFBK 4BDYA 5AQUA 3HPGA 4FJ5A 3VA3A 2P5GA 1ASVA 3MX2A 4CHOA 4EP4A 2P9NB 2OPSA 1I3AA 1VQ8N 5AQKA 2D0AA 1CXUA 4DTPA 4DR7K 3AAPA 2ASPA 3D45A 2YHWA 3OJUA 4DUZK 1TL1A 3D2FB 1VSLA 5TKYA 3T19A 4DQQA 1S22A 1KLMA 1Q9XA 2HW3A 5AQVA 1NKBA 3C6TA 1QSLA 5I9EB 4WQ5C 3OHRA 3OS0A 4FVMA 4JK8A 4RW4A 2DY4A 3J80O 4C8MA 2O8FA 4E3SA 1GLEG 4FO0A 5M1PA 3ZETB 4BY9C 3C0BA 4B1YB 1J9AA 1K9MO 3I0SA 5AQYA 3SBGA 4A2AA 4CJPA 2E2NA 2OPPA 3TPQA 3UKRA 4FLZA 1HNZK 2B4JA 2A40A 1K8KA 1IG8A 2VCPA 4OJRA 4CE9A 3U8XA 4UQGA 4N41A 1ZC6A 4JEPA 3VQ9A 1NOYA 1EKEA 1VRUA 3Q7BA 4J2EA 1IKXA 5LJVA 4Z4HA 2NUBA 5FROA 4ISEA 2ATQA 4LSLA 4BRDA 3CCLN 3R8EA 2Q1NA 4ICLA 4A5AA 3FE1A 1NKCA 1CZBA 3FZFA 4YOWA 4BWMA 4GKJK 1NGBA 3Q7CA 3BF3A 4DR4K 2P51A 2ITGA 2UU9K 3CM6A 1HMVA 1C0UA 4DSFA 1HPZA 5FRNA 1RDUA 2G8IA 2HVHA 3EZ5A 2JLEA 2RKIA 4JKHA 3LP1A 4J8FA 2X6SA 4FJKA 1C1CA 1HR0K 3VQ4A 3G0ZA 4CZIA 1N6QA 1IG9A 5J2MA 4CJ4A 2FSNA 3WNFA 4LY7A 4B08A 4W5RA 2AJQA 2HHUA 2YNIA 3R3LA 4F3OA 1XC3A 4WE1A 3E9PA 1BA0A 3L0QA 1S6QA 1VQON 1KAYA 4C23A 4C8NA 4B9LA 5FRMA 1TUYA 4CBXA 3AVHA 4IZ9A 3TTDA 4ELUA 1BA1A 4CGGA 4KAZA 1HQEA 4BGAA 3TAPA 4JKAA 4JI8K 3AVLA 2O8CA 3O9RA 4ILJA 1BWFO 1GLAG 4DV4K 4ISGA 1I39A 1EX4A 1WSJA 1HRHA 4BE1A 3BDPA 1JLEA 4QS7A 4JHDA 1QVFM 2ZQBA 3U9ZA 3OBWA 3CCQN 3OYBA 1DTQA 5SWMA 3ZT1A 4LF8K 4M3ZA 4IXCA 3FR0A 3O9TA 3EKSA 3QBXA 3KK7A 4KPYA 4CZEA 4DKWA 4CGDA 4PY5A 3DXKA 4OPHA 4CIEA 5HP1A 4CEBA 5AQPA 4BRLA 4H0PA 3HOTA 4CD3A 4BC3A 3TR8A 4IOCL 4KHPK 1V4SA 1ZBFA 2A5XA 4MO4A 3I0RA 2W42A 2VQFK 3RR8A 3PO4A 2HNDA 4M45A 2RF2A 1SL1A 4JI6K 1FXXA 4KTZA 1J5EK 1ASWA 3ZT2A 4BRQA 4M3XA 5BR8K 4YOXA 1P90A 2NZTA 4FSVA 4FXDA 1VHXA 3QNOA 3VESA 4EZ6A 1RBVA 5IT9O 4E1NA 4E7IA 3P83D 5C24A 4DU3A 2HHXA 4K8XA 1X3MA 3VQ7A 4E1MA 5HL7L 1BIUA 4OVLA 1C0GA 1XWLA 3GDQA 3OYDA 3HP6A 3SLCA 3SUQA 4UY8O 4B3RK 3SPYA 4XH5A 1L3SA 4JK7A 3KIOA 1XI1A 1U49A 1UA0A 1YUWA 4O0JA 4MFBA 4WQ5A 4JKGA 2P9IA 2P9SA 1VSIA 1I94K 1RGIA 3MXJA 4KHYA 4CZLA 4AHRA 3AO1A 1TGOA 1W7AA 4CVNE 3OS2A 4DTSA 1N5YA 4N76A 3W0LA 3NHGA 4GVEA 4CHNA 4DSLA 1RILA 4FWPA 4LFCK 1ZBUA 1TAUA 1BCMA 1NGJA 3G10A 1JLCA 2YHYA 3QETA 2J4RA 3K0SA 3GBTA 3LDOA 3P38A 1SL2A 2R7YA 2QWLA 1QQMA 3O4WA 2D0BA 4EIAA 4O55A 2UXBK 3HYFA 3RWUA 1IKVA 2RN2A 4CERA 2OTLN 4I9QA 1BOTO 3QMLA 3ULDA 2Z1HA 1TAQA 3DLHA 2QXFA 3KLFA 3VF2A 4BR9A 5LMNK 3O3HA 3THYA 3OYJA 3WXLA 1Q18A 1E4GT 4FLYA 3H3OB 4C1NK 2XO7A 3WNHA 4DTRA 3MN9A 4O0IA 4K8ZA 4KKOA 4IEIA 4PL7A 4LF4K 2O4GA 3CQYA 1U4BA 1H1VA 3HPOA 4WQ4C 3V9XA 3H45C 2PYJA 5F0XA 4TSXA 4MDAA 3OW2M 3R6MA 5ADXA 5KQDA 2O8BA 3VN5A 3ATUA 4Z4CA 1LWFA 4NCGA 3QEIA 3L4IA 3QB0A 4FK4A 3VEWA 4HUGA 1G99A 3UKRB 4CW7B 4LF5K 1FK9A 1K8KB 1BHLA 1FJGK 4AHVA 5LMUK 3CFRA 4BROA 4B1ZA 4CZHA 1ESVA 2GWKA 2QWRA 3SMSA 3OYHA 5AFUH 1NJZA 3AAQA 1OH6A 3E66A 1YHQN 1JLQA 1EETA 3H08A 2IVOA 3V9UA 1OVQA 3TAQA 3ATVA 4M7YA 4DTJA 3CCVN 2ETJA 3RRGA 1UWBA 3CCSN 1RNHA 4IOAL 4B8CA 1NLVA 3LDQA 1W0HA 4JNEA 1IBMK 3L2WA 1S1UA 4LFAK 1O1WA 1ILYA 4RG8A 4MQ3A 3HVRA 2QEXN 2P9LB 1C6VA 3AGKA 2EWSA 2E2PA 3P31A 1NGAA 1JCGA 3C7NA 2YKMA 4IO9L 4I2PA 1FKOA 1S1WA 1S1VA 1JKHA 1NJIO 3D2EA 4R79A 3PUFA 5GIPA 1OKJA 4E7JA 3KZBA 1J5OA 5HRNA 1X3NA 3P4IA 1SL0A 2E2OA 5JLFA 3GL1A 2Y1JA 4CEZA 3J8AA 1JCEA 5EOYA 1QHAA 3U3YA 4BRIA 3LDLA 5M1QA 1MU2A 4GKKK 1NGGA 5C10A 4JS5A 4JK9A 5JLHA 2VGMA 4CBWA 4BG9A 4JI3K 2Q3SA 3VQ8A 1OVYA 1KLNA 1IH7A 4X66K 3UKUA 3CJAA 4JHDB 4RW6A 1NMNA 4CFBA 3O6WA 4IFYA 4B3SK 2Z1JA 2HHHK 1XNRK 4DB3A 1M90O 2OA8A 1HKCA 1JL2A 3K5OA 1QVGM 2F96A 4CEDA 4DQIA 1TYQA 3DMJA 3LP2A 4DSIA 1KVBA 3DAWA 4JAXA 2HBLA 1WBDA 2OTJN 4DWIA 3E9OA 3DOLA 1RT4A 2E1ZA 4PKIA 4YOUA 3BZKA 3ZSXA 4CEAA 1U47A 2KLAA 1WSHA 3LDPA 4H5VA 3MXIA 2ZGYA 4JD2A 3S3MA 4RTFD 4RWTA 1X9WA 1S9EA 4F2SA 2FSJA 1NK5A 3EY1A 3SZ2A 2ZWHA 1NK0A 5MLCQ 4IDKA 3PSIA 1EO1A 1SAZA 1KFDA 3LZJA 3HRGA 2D0PA 3K58A 2LSNA 4BGBA 4JLHA 2A3ZA 4CZFA 3KK2A 3HL8A 3A2FA 3MWTA 2DTUA 1UA1A 3ZYYX 3VQBA 1QQCA 5AQFA 3NGIA 4WQ4A 1OH8A 4EAHD 2A6AA 2QWOA 1KXPA 4CZMA 2P9SB 1EWRA 1HX1A 2ZGZA 3ZSVA 3O5BA 1XMOK 1W2BM 2FC0A 3THXA 3VTIA 4GV6A 5FDLA 4M42A 3V9ZA 3V9WA 2WTUA 4FWLA 2UXCK 1LW2A 1E4FT 3SQ2A 3LP3A 4FW1A 3CQXA 4HCCA 3ZSYA 3O9SA 1S5JA 5AQHA 4DG1A 1S3XA 2HHTA 3HOSA 2YHAA 3IAYA 4XH4A 3T3FA 4FLUA 3RMDA 2OCEA 3HI0A 4PUOA 1Z6RA 4BVPA 5AZJB 5HLFA 3THYB 5JVHL 3QINA 2KKZA 1WN7A 2ZJQL 2A1SA 2GELA 5LL6Z 3QNNA 2F9WA 4YHHK 3FFIA 4IWVA 1KC8O 1A5WA 2EHGA 1GOCA 1IV0A 1L5UA 2NRRA 2ASOA 5HROA 3QEPA 3C65A 4FK0A 4M3RA 4ILGB 3LL3A 1RBTA 2XY6A 5EX5A 2HHQA 2W41A 3VEXA 4OLBA 3QIOA 3SQ1A 1NGFA 1LAVA 3CCEN 1IJJA 2O8BB 5CZ1A 4IKFA 3OS1A 5M1KA 5HRSA 4Z4IA 4KTQA 4M3TA 2BUPA 4EZ9A 3QO9A 1J54A 4DR1K 3OYLA 3M8RA 3PV8A 4A61A 4AHUA 4K43A 4FOEA 3U6FA 3K5MA 4DFJA 3SYZA 3G25A 3PX4A 5AQOA 2QXLA 4BDPA 2FSKA 5AQIA 3DOKA 1FW6A 4FLTA 4B9MA 3DWLA 2IOCA 1KD1O 4NO7A 5I3UA 3O3FA 1C0FA 4H0TB 4H8KA 3NGZA 5C15A 4IJNA 3NH0A 4DF8A 1D9FA 3CD6N 1D9DA 2E88A 3DLBA 2Z1GA 1QSYA 5JMVA 1T7PA 3A8YA 1KAZA 3JXUA 3P5JA 1LAWA 3HSTB 5CR4A 3KD1E 4CHQA 4NCAA 4Z0UA 4GV9A 3K2PA 4J2DA 3QFPA 4ELVA 3V81A 5AQMA 5BR9A 4KHQA 1HNIA 3VEVA 1OH7A 5FPNA 3FZLA 1VSJA 4JI5K 3C7NB 1T6DA 5AQTA 2IAJA 1KVCA 3OYGA 2UUBK 4CJQA 2X74A 3EL2A 3L4QA 4BE2A 1RT2A 4IBNA 3HTVA 3U9DA 4GMJB 4E7KA 2IVPA 3MN7A 4ILHA 3E9LA 4CJRA 5GADP 1ASUA 3E01A 1L3UA 4LF6K 1EQYA 4JN4A 2BE2A 3ZEUA 5C12A 4PKHA 4JKCA 2PFUA 3CCRN 3I8BA 1RBSA 3MK6A 2PAVA 1R0AA 2YX6A 1TUUA 3PIOL 2X78A 4OKEA 3J7AP 4W5QA 4PA1A 5GAHP 5KRTA 1YAGA 3DI6A 4FJ9A 1GLLO 3VMFB 4CGFA 3CCUN 4KB1A 1YIJN 3AVIA 2NLXA 4B9UA 4NLCA 4BC5A 2V7YA 2VWJA 4H0XB 1L3TA 1YT3A 2KHOA 3HVTA 4BC4A 3HJFA 1HYVA 4CEQA 4RW7A 1QHTA 4DQRA 4DF4A 3V6DA 1KRPA 3ZX3A 1YTUA 2ZE2A 4L8RB 5EVZA 3LP0A 2YCHA 2Q97A 3AO5A 2F8SA 3HP9A 5AFUA 3TAEA 2UUAK 1Q82O 3RRHA 3WXIA 2RPIA 5CZ2A 2CGJA 3PX6A 3P39A 4YOTA 4HVJA 3OY9A 3AARA 4JI7K 4JD2B 3CC4N 3ID8A 3NF8A 1YVNA 4M3WA 3LDNA 2ZJPL 1HPMA 3RR7A 4FM2A 3HM9A 4QCLA 4L3QA 2QA4N 2D5RA 4CIFA 1WLJA 3VQDA 1GLBG 1HYSA 3SK3A 3TWHA 4DFKA 5FPMA 3OVNA 3LWMA 4FJIA 3WQUA 3B6PA 4Q0BA 4BQLA 1C0MA 4CF2A 2I7NA 2OANA 1ATRA 3C95A 1YF5L 3HXMA 2HB5A 3THXB 2OZMA 3OYKA 2PY5A 2FF3B 3WUHA 3V1QA 4F9OA 4BRHA 2FBYA 4PL8A 3QFUA 2VQEK 4WF9L 1CXQA 3TSQA 1NK9A 4OPKA 5E84A 3KVGA 2GV9A 4DQ8A 3KHYA 4X65K 3CJ7A 2UUCK 4E19A 3NH1A 4M3YA 3L3UA 4CJVA 4BRPA 4QAGA 4XH1A 4GVMA 1Z05A 2JWLA 5AQNA 3O1WA 1QZ5A 1VRTA 4CJUA 3SAFA 4FJLA 1JLAA 2DPNA 1X9SA 2ZJRL 3MN6A 2ZM6K 3SV4A 3M3ZA 3F5TA 3LM9A 5K14A 3GG4A 3CXCM 1T8EA 3WEEB 2JWKA 1BI4B 3IUCA 4CF1A 4ZHRA 3RMAA 4I6MA 3THWA 3H3NO 2PZSA 2RHKA 3O3GA 3DLLL 3WT0A 3PX0A 2G8HA 2YKNA 2EX3A 5BPMA 2FBTA 1TK0A 5KRSA 2G8FA 4KH4A 3ID6A 1VQLN 4M41A 5AQLA 3PY8A 2BGGA 1N34K 2VG5A 3IKMA 1D4XA 3TAMA 4Z4EA 1KVAA 3O9UA 5CHIA 4GY2B 1GLCG 2PYLA 4OPAA 1QS4A 3OTOK 2NRWA 1RT6A 1GLJO 4FM0A 4DTNA 2XRIA 1QTMA 2P9PA 3CPWM 4BREA 4KHUA 1Y64A 2RE2A 1Q7YO 4H0VB 1RT1A 2P9UA 1YJ9N 4KTWA 4BWJA 2HHWA 2X6NA 5HRRA 2O8EA 1DEJA 3R1XA 2IC3A 4DTOA 1XNQK 1RTIA 3O9QA 1ZBIA 3SQ4A 4KREA 5CY4A 2QWNA 1WAFA 4I9LA 4W5OA 2WFBA 4AHCA 2P9KA 5LY3A 4CEFA 4N56A 4JKFA 4B9TA 4DQSA 3AVMA 2Q0RA 3NVMA 3MCPA 2NRVA 5KI6A 2O8FB 3E1YA 3NF7A 3AVFA 3QEWA 1HKBA 4ZTFA 4MLHA 3LAMA 3MDQA 2VWBA 1CZAN 1SKWA 3S3OA 3DRPA 1Y97A 1YTAA 4G1QA 4IFEA 4DQPA 1T03A 2QI2A 4I2QA 5HOOA 4E7HA 2XY8A 3AA2A 4NB4A 2YHBA 3DXMA 2G8WA 2HMPA 3TSPA 2UXDK 1UAXA 3WNEA 1NM1A 4W5TA 3OYEA 3ZSZA 5KPZA 3BEXA 1J53A 3SJHA 4H5NA 1ZBSA 3ZEUB 3QEVA 4CZJA 4DS4A 1QZ6A 1ZBLA 2E5LK 3ZX0A 2KZZA 1IKWA 3W3DA 4U67L 3FZHA 3OYIA 4PWDA 4KO0A 3AA4A 3DRRA 1T6CA 3N4PA 3AVAA 1NGEA 5KTQA 4JYAK 2QM1A 3KLGA 3K5NA 4KB0A 3ENOA 3VTHA 1BCOA 3AY9A 2YNHA 3VEYA 4A62A 1RDWX 2QKBA 1SQKA 3I55N 1MDUB 3AVCA 4H03B 5BREA 1XQSC 1BISA 2P9NA 4KFBA 4OLAA 1N33K 3KKSA 5I42A 3D2FA 4DS5A 3SCXA 4LF9K 5BPLA 2GX9A 1MWMA 1VSMA 2HBKA 4Q5VA 2NRXA 5GAGP 2G8UA 4WYBA 1RCHA 2O8DA 5E41A 3TI0A 4K25A 3CMEN 1IKYA 3T1AA 3ZETA 4KH6A 2HNYA 1WBBA 3VGLA 4IOXA 3O4QA 4NCBA 1X9JA 3SNNA 5SZTA 4AM6A 1T3VA 4A59A 2O8CB 1KAXA 2CGLA 2A41A 3AO2A 1QE1A 1KCFA 5GAEP 1JLBA 1BG3A 1NGHA 3C6UA 3DYAA 4LSNA 3QESA 1VQ7N 1D5AA 2YV0X 3AA3A 4BRFA 3CJ1A 4BQZA 3VEZA 5J2QA 2P1JA 3ENHA 4B8AB 3KWGA 3OYFA 4YDUC 1Q81O 2GEMA 3M1FA 4DTMA 3V4IA 1VK0A 3DXKB 4NYNA 4IJAA 4Y0WA 1RTJA 3CERA 4DLEA 1HNVA 2KFNA 4FZYA 4A2BA 3SJJA 2F8TA 4BR4A 3EO3A 1Q8IA 3DLRA 2Y1IA 3K9KA 1K73O 4F4KA 1O13A 3S9HA 3T69A 3HBTA 1DTTA 3K5LA 1RFQA 2QWPA 3MX5A 3RSEA 4YOVA 4CF0A 3QICA 3CJCA 1VSKA 1LW0A 3FZMA 4KH5A 4B1XB 4MDBA 4RW8A 4FWKA 3ITHA 1NNEA 2V7ZA 3K59A 4B1UB 4O8UA 3H1QA 3G4SN 4FJMA 2IGIA 1U04A 5KGWA 1JLGA 1WSIA 2G8KA 3KWIA 2VG6A 4I6MB 1L3VA 4FWSA 4CJSA 2QKKA 4JKGB 2P9IB 1VQ4N 1WAJA 4CGHA 4A57A 3OJSA 3VGKA 3VQPA 1V4TA 1NG9A 4QOZB 4CFDA 3NFAA 3VQQA 2E2QA 3S3NA 1TKXA 2WBNA 4F2RA 3M5RA 3LM2A 3HSCA 4CF8A 4CIGA 4DV1K 1NJYA 3AGRA 1SS6A 5EXWA 3VERA 1YI2N 3HO1A 2E8AA 2VWKA 1U2VA 4RCHA 3R9PA 3HT3A 1HJOA 1W97L 2NRZA 4FYDA 3NDKA 1HYZA 2GWJA 2F9TA 2XY7A 5AQWA 4Z4FA 4BRGA 3ZT4A 1DT9A 2W6KA 3NF9A 4BR5A 2O4IA 3LDSA 1NJXA 4BR0A 1B9DA 1IO2A 5ADXH 1JCFA 1HJRA 4CBUA 2XHBA 5KGXA 2WONA 3CETA 3OA9A 4FJ7A 3NVKA 4ELTA 4FJXA 4O5BA 4YY3K 4JI0K 1ATSA 4BR7A 2D0OA 3LPUA 3WXMB 5DMRA 3AA5X 3MMVA 4CHZA 3F2KA 1LWEA 1XHZA 3VEOA 3B8AX 4CF9A 3GOIA 5M1NA 5T7BA 4JI4K 5E26A 4FJJA 3MEGA 3H46O 2Q2RA 4FL9A 3AVBA 5JS1A 2V52B 4J2AA 3QDKA 4OGEA 3U4LA 1K6YA 1RT5A 4DUYK 3TAGA 3KJVA 4JV5K 1VQ6N 4QS8A 4DHYA 4G9ZA 2AP1A 2IDOA 2HHVA 1C0TA 2WC9A 1TVRA 1EXQA 3N4QA 1B9FA 3IS9A 1BGXT 1S6PA 4CJ5A 2XY5A 1TKDA 4YDUA 3BGRA 1NKEA 2E1YA 3VQCA 3NMUA 4E1JA 4KHNA 1JJ2M 3CJBA 4JKDA 4DFMA 3SUOA 4NYFA 5DK5A 3ZT3A 4AH9A 1N8RO 4JKBA 3D2EB 2CH5A 5AQSA 1C1BA 4FJ8A 4B9VA 4E89A 4AM7A 4B9QA 5ELZA 4B3MK 3PIPL 1BO5O 4B1WB 1N32K 2O8DB 3O8MA 3L2RA 2GBZA 1WUAA 1R59O 3CPEA 4AHTA 4AILC 1WNSA 4DR6K 3F73A 2FLOA 3AVNA 1TK8A 4K0KK 4C8LA 3HPHA 3MN5A 5AR0A 4RW9A 3OBYA 3V1RA 2NRHA 5F2RA 4CJTA 3T1YK 5KPRA 3UKUB 3CMAN 3AO3A 4M7XA 2YNGA 4JKEA 3CCJN 1BUPA 1NJWA 4O5FA 1RDBA 4CHPA 3VQAA 3M8SA 2HBJA 4DR2K 4KI4A 1ATNA 4GNIA 4CGJA 3CHWA 2CH6A 4M3UA 4F3TA 4CK2A 5BN8A 3KK1A 1XHXA 5BN9A 4CJ7A 4XEIA 3KLHA 3D7EO 3FLCO 4ID5A 1TYQB 3MAQA 1BU6O 1K8AO 4FVUA 5C42A 3NF6A 4NXMK 3O80A 4BRCA 5A2QO 2KTQA 3PSFA 1C1AA 4HUEA 2Q31A 4IDHA 4CFCA 3ZSOA 4CD1A 3D0PA 3RSEB 3KTQA 3G71N 3VF6A 1U45A 5HBMA 4WCEL 1DLOA 4AF1A 2HBMA 2P9LA 2KQ2A 2VGNA 5DM6L 4CZGA 3IMXA 5HRPA 3OYCA 1TK5A 4DV5K 3UIQA 4CZKA 1DGKN 5AJ3K 3ZSRA 3FGUA 4EHUA 4ZTJA 2IS3A 4BR2A 2DFHA 3SQ0A 3NH2A 2HVIA 3T7ZA 4LC9B 4LD0A 1VQ5N 4DSKA 5AQGA 4BC2A 3KKRA 5AQQA 1Q9YA 4CECA 1WOQA 1NU0A 1WSEA 5F1XA 3VF4A 3GE1A 3A0IX 3J81O 1D8YA 1NGCA 4C8OA 4W5NA 2FBXA 1VSEA 3ALYA 1NMDA 1RBRA 3MWPA 4FPBA 1IBLK 1G15A 1KSPA 4B1VA 1X9MA 4BRNA 1MWKA 3SAGA 3BUZB 3S41A 4KI6A 4XIUA 4FWQA 2UYTA 2D4WA 3UE5A 4B3OA 4JRPA 1LOTB 3IDHA 4JI1K 1VQ9N 4B3TK 4CJKA 3M8PA 3JYTA 2KW4A 4DTUA 4YORA 3SUPA 1S9GA 3O08A 1LCUA 3G6EN 2QW9A 4B9NA 5TKWA 4CI6A 1U2VB 2GUIA 3ZT0A 3CG7A 3IRXA 1YXQA 4AHSA 1WB9A 2VYPA 3QIPA 4Z94A 3K9JA 3QERA 4Y1DA 2HSTA 3SBTA 3DLEA 4BRMA 1P8ZA 1EP4A 2QWQA 3MEDA 2I5JA 3I8DA 2IVNA 2VG7A 5FPDA 2AA4A 5BRFA 4CK3A 3KLEA 4EP5A 2DFFA 3EKUA 4DU1A 4IG3A 3HM8A 1KFSA 3FFKB 3VQ5A 3NAEA 4ISFA 1NK6A 3SPZA 1HQUA 3SV3A 3RMCA 5C25A 4CHYA 3CI5A 2F4VK 4DR5K 2H3GX 4YNQA 1RBUA 3CFOA 3VENA 1EWQA 3EYZA 3ULEA 4K42A 3RTVA 1RT7A 3THVA 1RDDA 5BRDA 2BDPA 2E6MA 2ZF5O 4I7FA 2ZD1A 5M1OA 3OYAA 3H6EA 4KBOA 5DM7L 3CJ9A 4F8RA 1VQPN 2GTDA 4YFUA 2DFEA 4H4OA 3K57A 3JS6A 4YOYA 3TAFA 4FK2A 5KPTA 4JI2K 4C1NI 2FBVA 1VAZA 5AQXA 5AZIA 4Z4GA 1RDCA 3VETA 1J6ZA 1S1XA 2HHSA 3DM2A 1UOCA 5IWAK 4DV6K 2D0CA 1BQMA 3VPZA 1JXEA 4OKKA 2QK9A 1N36K 3TABA 4CGIA 3WXKA 1F21A 4FWMA 1WSGA 4K41A 4BG8A 3CC2N 4BVOA 3D6RA 1SV5A 4KHSA 3C6HA 3LAKA 1QQOA 4OKJA 1ZYQA 4LF7K 4IO8A 4H0OA 3WXJA 2B6AA 4BRKA 5AZJA 4KV8A 4R5PA 4DMNA 1BDGA 3TU5A 4NLBA 1BL3A 2E20A 3MCAB 1GLFO 1HKGA 3JAMO 3TARA 4HHTA 3AO4A 2OPQA 3V9SA 4N5SA 1XMQK 3A5OC 1A5VA 2E6LA 3F9KA 2HOEA 1YJNN 2QTDA
chains in the Genus database with same CATH topology
3L2UA 4H8KA 1I39A 1EX4A 1WSJA 1HRHA 3CM5A 4BE1A 4FLVA 1JLEA 3BDPA 4PQUA 1VSKA 4CJFA 3NGZA 1LW0A 3NH0A 2ZQBA 4DF8A 1D9FA 3OYBA 1DTQA 1D9DA 5SWMA 3RMBA 4RW8A 3DLBA 3ZT1A 3ITHA 4M3ZA 2Z1GA 2B5JA 1QSYA 3K59A 4KPYA 1T7PA 4CGDA 4FJMA 2IGIA 4PY5A 1U04A 1LAWA 3HSTB 3P5JA 5KGWA 5JS2A 3ZSQA 4CEBA 4CIEA 1JLGA 1WSIA 4Z0UA 4CHQA 2G8KA 4DFPA 1BIZA 4O44A 3K2PA 4DTXA 4IG0A 3TR8A 2VG6A 4J2DA 3AVJA 1SKRA 4ELVA 1ZBFA 3V81A 4GW6A 1L3VA 3I0RA 2W42A 3RR8A 4C8KA 3OYNA 2HNDA 4M45A 3PO4A 4KRFA 4CJSA 4KHQA 1HNIA 2QKKA 2RF2A 1WAJA 4CGHA 1SL1A 1FXXA 2OPRA 1VSJA 4KTZA 4B9SA 1ASWA 3ZT2A 5J1EA 3OJSA 3O4NA 3VQPA 4M3XA 2IAJA 1KVCA 3OYGA 4QOZB 4BACA 4CJQA 3VQEA 3DLKA 4CFDA 4FM1A 4FXDA 1W9HA 2X74A 3CFPA 3QNOA 4EZ6A 4BE2A 1RBVA 1RT2A 3NFAA 4IBNA 1LV5A 1VSFA 4E1NA 5HP1A 4E7IA 4GMJB 4E7KA 4CCHA 3VQQA 5D3GA 3P83D 5C24A 3S3NA 4DU3A 2HHXA 4CJRA 4K8XA 1TKXA 3VQ7A 4E1MA 1ASUA 1BIUA 3E01A 4OVLA 1XWLA 1L3UA 3OYDA 3HP6A 4F2RA 3B6OA 4CF8A 2BE2A 3SUQA 4FJGA 4CIGA 4FZXC 1NJYA 1FKPA 4LH4A 3SPYA 1L3SA 1RBSA 3HO1A 2VWKA 3OYMA 1R0AA 4CJWA 3KIOA 1JXBA 3HT3A 1XI1A 1U49A 2JGUA 2X78A 4OKEA 4FYDA 4W5QA 1XC9A 4PA1A 3NDKA 1HYZA 3VA0A 4FJNA 5KRTA 4CJ3A 1UA0A 3DI6A 4O0JA 4FJ9A 4MFBA 4DU4A 4CGFA 2XY7A 4Z4FA 1ZBHA 3ZT4A 4KB1A 3MEEA 3NF9A 1VSIA 3NGYA 3AVIA 2BANA 3SUNA 2O4IA 3MXJA 4CK1A 3LDSA 1NJXA 4B9UA 4FZZA 4KHYA 1B9DA 4AHRA 3AO1A 1TGOA 1JLFA 1IO2A 3OS2A 2VWJA 4DTSA 1N5YA 4N76A 1L3TA 1HJRA 1YT3A 3HVTA 2XHBA 5KGXA 3HJFA 3NHGA 1HYVA 2WONA 4CEQA 4RW7A 1QHTA 4DQRA 4DF4A 3V6DA 4CHNA 1KRPA 4FJ7A 4DSLA 1RILA 4ELTA 2HNZA 4FJXA 1YTUA 1ZBUA 4O5BA 1TAUA 2OZSA 1BCMA 2ZE2A 3G10A 1SKSA 1JLCA 4L8RB 3QETA 3LP0A 1SL2A 3AO5A 2R7YA 2F8SA 2D0BA 3HP9A 3LPUA 4O55A 3TAEA 3RRHA 5DMRA 3AA5X 2RPIA 3HYFA 5CZ2A 4CHZA 3RWUA 1IKVA 5EU7A 1LWEA 3PX6A 1XHZA 4HVJA 2RN2A 3OY9A 4CERA 4DLGA 4I9QA 4OPJA 3ZCMA 4CF9A 3ULDA 3LALA 2Z1HA 1TAQA 3NF8A 4ID1A 2QXFA 5T7BA 3KLFA 3DLHA 4M3WA 2KFZA 3O3HA 3AVKA 4FJJA 3U3GA 1VSDA 3OYJA 3MEGA 4JS4A 3PO5A 1GOBA 3RR7A 4FM2A 3HM9A 4QCLA 1S1TA 4FLYA 3AVBA 2KZMA 1B92A 3WNHA 2XO7A 4DTRA 5JS1A 2Z1IA 4O0IA 4K8ZA 4KKOA 4J2AA 1RDAA 2D5RA 4CIFA 4W5NA 2O4GA 4OGEA 1A5XA 1U4BA 1WLJA 1CZ9A 3VQDA 1K6YA 4FLXA 3HPOA 1RT5A 1HYSA 3TWHA 3LANA 4DFKA 3TAGA 3V9XA 3KJVA 3OVNA 3LWMA 3MECA 4FJIA 2PYJA 3B6PA 4Q0BA 1C0MA 4CF2A 5J2NA 4TSXA 2IDOA 2HHVA 1C0TA 2G8VA 1TVRA 1EXQA 3VN5A 1B9FA 4E0DA 3IS9A 1BGXT 1S6PA 3C95A 4Z4CA 1LWFA 4NCGA 4CJ5A 3HXMA 3QEIA 4FK4A 2XY5A 1TKDA 2HB5A 3LWLA 3KLIA 4HUGA 3BGRA 3SI6A 2OZMA 3OYKA 2PY5A 4HTUA 2P5OA 1RTHA 3V1QA 1NK4A 1NKEA 1FK9A 2FBYA 1BHLA 3VQCA 4AHVA 4KHNA 3CFRA 4DFMA 4NCAA 3SUOA 3LPTA 4NYFA 1CXQA 3OYHA 1NK9A 4OPKA 4JRQA 1NJZA 3TANA 1TL3A 5DK5A 2GV9A 3ZT3A 4N47A 4AH9A 3V1OA 1JLQA 1EETA 3C94A 3H08A 3WNGA 1GOAA 3V9UA 3TAQA 4E19A 3NH1A 4M3YA 3L3UA 3P1GA 4CJVA 1C1BA 4FW2A 4FJ8A 4B9VA 4E89A 4DTJA 4QAGA 4GVMA 2WOMA 3QEXA 2ETJA 1YVUA 3QLHA 3RRGA 1VRTA 4CJUA 4DSEA 4FJLA 1JLAA 1X9SA 3L2QA 1VSHA 3L2RA 3L8BA 3SV4A 4FCYA 2GBZA 4Y1CA 1UWBA 1RNHA 4H4MA 4AHTA 4AILC 1WNSA 4B8CA 5K14A 3F73A 3DRSA 2HMIA 1T8EA 3AVNA 1TK8A 4HUFA 2YNFA 3ASMA 1W0HA 1BI4B 1SUQA 3L3VA 4C8LA 3HPHA 4CF1A 4ZHRA 3RMAA 3ISNC 3L2WA 1S1UA 4RW9A 4CJLA 2PZSA 3V1RA 1ITGA 1TV6A 4CJTA 3O3GA 1O1WA 2AJQA 3AO3A 4RG8A 4MQ3A 2YNGA 3HVRA 2A1RA 3PX0A 2G8HA 2YKNA 2EX3A 1C6VA 3AV9A 2FBTA 1NJWA 5KRSA 1REVA 1TK0A 1RDBA 4CHPA 2G8FA 3VQAA 3M8SA 4M41A 4KI4A 3PY8A 2YKMA 4O4GA 2BGGA 4CGJA 4I2PA 1FKOA 1Z25A 2VG5A 1S1WA 1TKZA 1S1VA 1JKHA 4M3UA 4F3TA 4CK2A 3KK1A 1XHXA 3PUFA 3KLHA 1BQNA 4E7LA 4CESA 4FJHA 4E7JA 3JSMA 1J5OA 4ID5A 3TAMA 3MAQA 5HRNA 3L2VA 4Z4EA 1KVAA 1SL0A 3CQ8A 2Y1JA 5CYMA 4CEZA 2PYLA 2OYQA 1QS4A 1NOZA 4CFAA 3U3YA 1RT6A 3CYMA 1MU2A 4FM0A 4DTNA 2XRIA 1QTMA 5C42A 3NF6A 1LWCA 4DSJA 4JS5A 4CJEA 4KHUA 2KTQA 1RT3A 1C1AA 4HUEA 1BI4A 4IFVA 1KTQA 1RT1A 4CFCA 3ZSOA 3D0PA 1TKTA 2Q3SA 3VQ8A 3LZIA 3KTQA 3AVGA 4KTWA 4BWJA 1KLNA 1JL1A 1IH7A 2HHWA 2X6NA 1U45A 5HBMA 3M8QA 4RW6A 5HRRA 3HK2A 1DLOA 3NBPA 4CFBA 2KQ2A 4IFYA 2Z1JA 4KHWA 3NE6A 2IC3A 4DTOA 5HRPA 3KK3A 3MXMA 3OYCA 1TK5A 4BE0A 3UIQA 1RTIA 4FLWA 4J2BA 1ZBIA 3ZSRA 3SQ4A 4ZTJA 2OA8A 3DLGA 2IS3A 1JL2A 3K5OA 1T05A 2DFHA 5CY4A 4KREA 2E4LA 3VQ6A 3SQ0A 1NK7A 1WAFA 4OGCA 3NH2A 4CEEA 2HVIA 1X1PA 2F96A 4I9LA 4CEDA 4W5OA 4DQIA 1QSSA 3DMJA 3LP2A 4LD0A 3KD1E 4AHCA 4DSIA 4CEFA 1KVBA 4N56A 3NCIA 5J2PA 4DSKA 1RTDA 5CYQA 4B9TA 3KKRA 1Q9YA 4DQSA 3AVMA 4BDZA 1NK8A 4DWIA 1Z26A 1U48A 4CECA 1WSEA 3DOLA 1RT4A 3IG1A 5KI6A 1CLQA 1D8YA 3NF7A 3ZSXA 3AVFA 4CEAA 4C8OA 2FBXA 3ZSWA 3QEWA 1VSEA 4LH5A 1U47A 4ZTFA 3KD5E 3ALYA 1RBRA 1WSHA 3LAMA 4CEOA 3MXIA 1SKWA 1G15A 1WSFA 3DRPA 3S3OA 1Y97A 3S3MA 1YTAA 4G1QA 1X9MA 1KSPA 4DQPA 1T03A 1X9WA 4HCBA 1S9EA 4I2QA 4F2SA 1NK5A 4BDYA 4E7HA 3HPGA 4FJ5A 4KI6A 3VA3A 2P5GA 1ASVA 2XY8A 3AA2A 2YHBA 4CHOA 4XIUA 2G8WA 4EP4A 1UAXA 3WNEA 3EY1A 2OPSA 3SZ2A 1NK0A 4B3OA 1I3AA 4JRPA 4W5TA 3OYEA 2D0AA 4IDKA 3ZSZA 1CXUA 3M8PA 4CJKA 4DTPA 3JYTA 1J53A 3D45A 3OJUA 1TL1A 2KW4A 1KFDA 1VSLA 4DTUA 3LZJA 3QEVA 3SUPA 1S9GA 4DS4A 3T19A 3K58A 4DQQA 1ZBLA 1KLMA 4B9NA 2LSNA 1Q9XA 4JLHA 3KK2A 3HL8A 2HW3A 2KZZA 1IKWA 1NKBA 3A2FA 3C6TA 1QSLA 2GUIA 2DTUA 3ZT0A 1UA1A 3CG7A 3OYIA 3VQBA 3IRXA 3OS0A 1QQCA 4AHSA 4PWDA 4KO0A 3AA4A 3DRRA 4FVMA 3QIPA 4RW4A 3NGIA 2DY4A 4C8MA 4E3SA 3AVAA 3QERA 5KTQA 3ZSVA 4Y1DA 3DLEA 3MEDA 1EP4A 2I5JA 1J9AA 3I8DA 2VG7A 3I0SA 3KLGA 4CJPA 2FC0A 3K5NA 4KB0A 4CK3A 2OPPA 1BCOA 2YNHA 3KLEA 4EP5A 4FLZA 2DFFA 5FDLA 4M42A 4DU1A 2B4JA 4IG3A 3V9ZA 1KFSA 2QKBA 3V9WA 3AVCA 4OJRA 3VQ5A 3NAEA 1NK6A 4CE9A 4UQGA 3SPZA 1HQUA 3SV3A 1BISA 3RMCA 4N41A 4KFBA 5C25A 4CHYA 4OLAA 1LW2A 3SQ2A 3LP3A 1RBUA 4FW1A 3CFOA 4YNQA 3KKSA 3EYZA 5I42A 4DS5A 3RTVA 3SCXA 1RT7A 3VQ9A 3ZSYA 3THVA 4HCCA 1S5JA 1NOYA 1RDDA 1EKEA 1VRUA 4DG1A 2E6MA 1IKXA 4I7FA 2BDPA 4J2EA 4Z4HA 2ZD1A 2HHTA 1VSMA 2NUBA 2YHAA 5FROA 2ATQA 4LSLA 3IAYA 3OYAA 4Q5VA 3T3FA 2G8UA 4FLUA 3RMDA 4F8RA 4PUOA 4ICLA 4YFUA 2DFEA 1RCHA 4H4OA 3K57A 1NKCA 1CZBA 5E41A 5HLFA 3TI0A 1IKYA 3QINA 3TAFA 4FK2A 1WN7A 4BWMA 3T1AA 2HNYA 2A1SA 2FBVA 3O4QA 4NCBA 3SNNA 2P51A 2ITGA 3CM6A 1HMVA 5SZTA 1C0UA 4DSFA 3QNNA 4Z4GA 1HPZA 3FFIA 5FRNA 1RDCA 2G8IA 2HVHA 3EZ5A 2JLEA 2RKIA 1S1XA 2HHSA 3LP1A 1A5WA 2X6SA 3DM2A 1C1CA 1UOCA 1GOCA 2EHGA 3AO2A 4FJKA 1QE1A 1KCFA 3VQ4A 1JLBA 1L5UA 5HROA 3QEPA 3G0ZA 4FK0A 2D0CA 3C6UA 1BQMA 3DYAA 4LSNA 4M3RA 3QESA 1D5AA 2YV0X 1JXEA 3AA3A 1RBTA 4OKKA 5J2MA 2XY6A 1N6QA 1IG9A 2QK9A 4CJ4A 3WNFA 3TABA 4LY7A 4B08A 4CGIA 4W5RA 2P1JA 4B8AB 5J2QA 4OLBA 2HHUA 2HHQA 3QIOA 3SQ1A 1F21A 2YNIA 1LAVA 4F3OA 3OYFA 1WSGA 4WE1A 5CZ1A 4DTMA 3V4IA 4IKFA 1VK0A 4NYNA 3OS1A 5HRSA 1RTJA 4DLEA 4Z4IA 1SV5A 4KTQA 4KHSA 1HNVA 3LAKA 4EZ9A 4M3TA 3QO9A 2KFNA 1S6QA 4OKJA 1J54A 1ZYQA 4FZYA 3SJJA 2B6AA 2F8TA 4C8NA 4B9LA 5FRMA 4KV8A 1Q8IA 3OYLA 4R5PA 3M8RA 4DMNA 3DLRA 3AVHA 4AHUA 3PV8A 4ELUA 2Y1IA 3U6FA 1BL3A 3K5MA 4F4KA 4DFJA 3SYZA 3PX4A 3S9HA 4CGGA 3TARA 4KAZA 1HQEA 4BDPA 4HHTA 1DTTA 3AO4A 3DOKA 2OPQA 4FLTA 3V9SA 4B9MA 3TAPA 4N5SA 3K5LA 1A5VA 2E6LA 3AVLA 2IOCA 3F9KA 4CF0A 5I3UA 3O3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2U A;  4H8K A;  1I39 A;  1EX4 A;  1WSJ A;  1HRH A;  3CM5 A;  4BE1 A;  4FLV A;  1JLE A;  3BDP A;  4PQU A;  1VSK A;  4CJF A;  3NGZ A;  1LW0 A;  3NH0 A;  2ZQB A;  4DF8 A;  1D9F A;  3OYB A;  1DTQ A;  1D9D A;  5SWM A;  3RMB A;  4RW8 A;  3DLB A;  3ZT1 A;  3ITH A;  4M3Z A;  2Z1G A;  2B5J A;  1QSY A;  3K59 A;  4KPY A;  1T7P A;  4CGD A;  4FJM A;  2IGI A;  4PY5 A;  1U04 A;  1LAW A;  3HST B;  3P5J A;  5KGW A;  5JS2 A;  3ZSQ A;  4CEB A;  4CIE A;  1JLG A;  1WSI A;  4Z0U A;  4CHQ A;  2G8K A;  4DFP A;  1BIZ A;  4O44 A;  3K2P A;  4DTX A;  4IG0 A;  3TR8 A;  2VG6 A;  4J2D A;  3AVJ A;  1SKR A;  4ELV A;  1ZBF A;  3V81 A;  4GW6 A;  1L3V A;  3I0R A;  2W42 A;  3RR8 A;  4C8K A;  3OYN A;  2HND A;  4M45 A;  3PO4 A;  4KRF A;  4CJS A;  4KHQ A;  1HNI A;  2QKK A;  2RF2 A;  1WAJ A;  4CGH A;  1SL1 A;  1FXX A;  2OPR A;  1VSJ A;  4KTZ A;  4B9S A;  1ASW A;  3ZT2 A;  5J1E A;  3OJS A;  3O4N A;  3VQP A;  4M3X A;  2IAJ A;  1KVC A;  3OYG A;  4QOZ B;  4BAC A;  4CJQ A;  3VQE A;  3DLK A;  4CFD A;  4FM1 A;  4FXD A;  1W9H A;  2X74 A;  3CFP A;  3QNO A;  4EZ6 A;  4BE2 A;  1RBV A;  1RT2 A;  3NFA A;  4IBN A;  1LV5 A;  1VSF A;  4E1N A;  5HP1 A;  4E7I A;  4GMJ B;  4E7K A;  4CCH A;  3VQQ A;  5D3G A;  3P83 D;  5C24 A;  3S3N A;  4DU3 A;  2HHX A;  4CJR A;  4K8X A;  1TKX A;  3VQ7 A;  4E1M A;  1ASU A;  1BIU A;  3E01 A;  4OVL A;  1XWL A;  1L3U A;  3OYD A;  3HP6 A;  4F2R A;  3B6O A;  4CF8 A;  2BE2 A;  3SUQ A;  4FJG A;  4CIG A;  4FZX C;  1NJY A;  1FKP A;  4LH4 A;  3SPY A;  1L3S A;  1RBS A;  3HO1 A;  2VWK A;  3OYM A;  1R0A A;  4CJW A;  3KIO A;  1JXB A;  3HT3 A;  1XI1 A;  1U49 A;  2JGU A;  2X78 A;  4OKE A;  4FYD A;  4W5Q A;  1XC9 A;  4PA1 A;  3NDK A;  1HYZ A;  3VA0 A;  4FJN A;  5KRT A;  4CJ3 A;  1UA0 A;  3DI6 A;  4O0J A;  4FJ9 A;  4MFB A;  4DU4 A;  4CGF A;  2XY7 A;  4Z4F A;  1ZBH A;  3ZT4 A;  4KB1 A;  3MEE A;  3NF9 A;  1VSI A;  3NGY A;  3AVI A;  2BAN A;  3SUN A;  2O4I A;  3MXJ A;  4CK1 A;  3LDS A;  1NJX A;  4B9U A;  4FZZ A;  4KHY A;  1B9D A;  4AHR A;  3AO1 A;  1TGO A;  1JLF A;  1IO2 A;  3OS2 A;  2VWJ A;  4DTS A;  1N5Y A;  4N76 A;  1L3T A;  1HJR A;  1YT3 A;  3HVT A;  2XHB A;  5KGX A;  3HJF A;  3NHG A;  1HYV A;  2WON A;  4CEQ A;  4RW7 A;  1QHT A;  4DQR A;  4DF4 A;  3V6D A;  4CHN A;  1KRP A;  4FJ7 A;  4DSL A;  1RIL A;  4ELT A;  2HNZ A;  4FJX A;  1YTU A;  1ZBU A;  4O5B A;  1TAU A;  2OZS A;  1BCM A;  2ZE2 A;  3G10 A;  1SKS A;  1JLC A;  4L8R B;  3QET A;  3LP0 A;  1SL2 A;  3AO5 A;  2R7Y A;  2F8S A;  2D0B A;  3HP9 A;  3LPU A;  4O55 A;  3TAE A;  3RRH A;  5DMR A;  3AA5 X;  2RPI A;  3HYF A;  5CZ2 A;  4CHZ A;  3RWU A;  1IKV A;  5EU7 A;  1LWE A;  3PX6 A;  1XHZ A;  4HVJ A;  2RN2 A;  3OY9 A;  4CER A;  4DLG A;  4I9Q A;  4OPJ A;  3ZCM A;  4CF9 A;  3ULD A;  3LAL A;  2Z1H A;  1TAQ A;  3NF8 A;  4ID1 A;  2QXF A;  5T7B A;  3KLF A;  3DLH A;  4M3W A;  2KFZ A;  3O3H A;  3AVK A;  4FJJ A;  3U3G A;  1VSD A;  3OYJ A;  3MEG A;  4JS4 A;  3PO5 A;  1GOB A;  3RR7 A;  4FM2 A;  3HM9 A;  4QCL A;  1S1T A;  4FLY A;  3AVB A;  2KZM A;  1B92 A;  3WNH A;  2XO7 A;  4DTR A;  5JS1 A;  2Z1I A;  4O0I A;  4K8Z A;  4KKO A;  4J2A A;  1RDA A;  2D5R A;  4CIF A;  4W5N A;  2O4G A;  4OGE A;  1A5X A;  1U4B A;  1WLJ A;  1CZ9 A;  3VQD A;  1K6Y A;  4FLX A;  3HPO A;  1RT5 A;  1HYS A;  3TWH A;  3LAN A;  4DFK A;  3TAG A;  3V9X A;  3KJV A;  3OVN A;  3LWM A;  3MEC A;  4FJI A;  2PYJ A;  3B6P A;  4Q0B A;  1C0M A;  4CF2 A;  5J2N A;  4TSX A;  2IDO A;  2HHV A;  1C0T A;  2G8V A;  1TVR A;  1EXQ A;  3VN5 A;  1B9F A;  4E0D A;  3IS9 A;  1BGX T;  1S6P A;  3C95 A;  4Z4C A;  1LWF A;  4NCG A;  4CJ5 A;  3HXM A;  3QEI A;  4FK4 A;  2XY5 A;  1TKD A;  2HB5 A;  3LWL A;  3KLI A;  4HUG A;  3BGR A;  3SI6 A;  2OZM A;  3OYK A;  2PY5 A;  4HTU A;  2P5O A;  1RTH A;  3V1Q A;  1NK4 A;  1NKE A;  1FK9 A;  2FBY A;  1BHL A;  3VQC A;  4AHV A;  4KHN A;  3CFR A;  4DFM A;  4NCA A;  3SUO A;  3LPT A;  4NYF A;  1CXQ A;  3OYH A;  1NK9 A;  4OPK A;  4JRQ A;  1NJZ A;  3TAN A;  1TL3 A;  5DK5 A;  2GV9 A;  3ZT3 A;  4N47 A;  4AH9 A;  3V1O A;  1JLQ A;  1EET A;  3C94 A;  3H08 A;  3WNG A;  1GOA A;  3V9U A;  3TAQ A;  4E19 A;  3NH1 A;  4M3Y A;  3L3U A;  3P1G A;  4CJV A;  1C1B A;  4FW2 A;  4FJ8 A;  4B9V A;  4E89 A;  4DTJ A;  4QAG A;  4GVM A;  2WOM A;  3QEX A;  2ETJ A;  1YVU A;  3QLH A;  3RRG A;  1VRT A;  4CJU A;  4DSE A;  4FJL A;  1JLA A;  1X9S A;  3L2Q A;  1VSH A;  3L2R A;  3L8B A;  3SV4 A;  4FCY A;  2GBZ A;  4Y1C A;  1UWB A;  1RNH A;  4H4M A;  4AHT A;  4AIL C;  1WNS A;  4B8C A;  5K14 A;  3F73 A;  3DRS A;  2HMI A;  1T8E A;  3AVN A;  1TK8 A;  4HUF A;  2YNF A;  3ASM A;  1W0H A;  1BI4 B;  1SUQ A;  3L3V A;  4C8L A;  3HPH A;  4CF1 A;  4ZHR A;  3RMA A;  3ISN C;  3L2W A;  1S1U A;  4RW9 A;  4CJL A;  2PZS A;  3V1R A;  1ITG A;  1TV6 A;  4CJT A;  3O3G A;  1O1W A;  2AJQ A;  3AO3 A;  4RG8 A;  4MQ3 A;  2YNG A;  3HVR A;  2A1R A;  3PX0 A;  2G8H A;  2YKN A;  2EX3 A;  1C6V A;  3AV9 A;  2FBT A;  1NJW A;  5KRS A;  1REV A;  1TK0 A;  1RDB A;  4CHP A;  2G8F A;  3VQA A;  3M8S A;  4M41 A;  4KI4 A;  3PY8 A;  2YKM A;  4O4G A;  2BGG A;  4CGJ A;  4I2P A;  1FKO A;  1Z25 A;  2VG5 A;  1S1W A;  1TKZ A;  1S1V A;  1JKH A;  4M3U A;  4F3T A;  4CK2 A;  3KK1 A;  1XHX A;  3PUF A;  3KLH A;  1BQN A;  4E7L A;  4CES A;  4FJH A;  4E7J A;  3JSM A;  1J5O A;  4ID5 A;  3TAM A;  3MAQ A;  5HRN A;  3L2V A;  4Z4E A;  1KVA A;  1SL0 A;  3CQ8 A;  2Y1J A;  5CYM A;  4CEZ A;  2PYL A;  2OYQ A;  1QS4 A;  1NOZ A;  4CFA A;  3U3Y A;  1RT6 A;  3CYM A;  1MU2 A;  4FM0 A;  4DTN A;  2XRI A;  1QTM A;  5C42 A;  3NF6 A;  1LWC A;  4DSJ A;  4JS5 A;  4CJE A;  4KHU A;  2KTQ A;  1RT3 A;  1C1A A;  4HUE A;  1BI4 A;  4IFV A;  1KTQ A;  1RT1 A;  4CFC A;  3ZSO A;  3D0P A;  1TKT A;  2Q3S A;  3VQ8 A;  3LZI A;  3KTQ A;  3AVG A;  4KTW A;  4BWJ A;  1KLN A;  1JL1 A;  1IH7 A;  2HHW A;  2X6N A;  1U45 A;  5HBM A;  3M8Q A;  4RW6 A;  5HRR A;  3HK2 A;  1DLO A;  3NBP A;  4CFB A;  2KQ2 A;  4IFY A;  2Z1J A;  4KHW A;  3NE6 A;  2IC3 A;  4DTO A;  5HRP A;  3KK3 A;  3MXM A;  3OYC A;  1TK5 A;  4BE0 A;  3UIQ A;  1RTI A;  4FLW A;  4J2B A;  1ZBI A;  3ZSR A;  3SQ4 A;  4ZTJ A;  2OA8 A;  3DLG A;  2IS3 A;  1JL2 A;  3K5O A;  1T05 A;  2DFH A;  5CY4 A;  4KRE A;  2E4L A;  3VQ6 A;  3SQ0 A;  1NK7 A;  1WAF A;  4OGC A;  3NH2 A;  4CEE A;  2HVI A;  1X1P A;  2F96 A;  4I9L A;  4CED A;  4W5O A;  4DQI A;  1QSS A;  3DMJ A;  3LP2 A;  4LD0 A;  3KD1 E;  4AHC A;  4DSI A;  4CEF A;  1KVB A;  4N56 A;  3NCI A;  5J2P A;  4DSK A;  1RTD A;  5CYQ A;  4B9T A;  3KKR A;  1Q9Y A;  4DQS A;  3AVM A;  4BDZ A;  1NK8 A;  4DWI A;  1Z26 A;  1U48 A;  4CEC A;  1WSE A;  3DOL A;  1RT4 A;  3IG1 A;  5KI6 A;  1CLQ A;  1D8Y A;  3NF7 A;  3ZSX A;  3AVF A;  4CEA A;  4C8O A;  2FBX A;  3ZSW A;  3QEW A;  1VSE A;  4LH5 A;  1U47 A;  4ZTF A;  3KD5 E;  3ALY A;  1RBR A;  1WSH A;  3LAM A;  4CEO A;  3MXI A;  1SKW A;  1G15 A;  1WSF A;  3DRP A;  3S3O A;  1Y97 A;  3S3M A;  1YTA A;  4G1Q A;  1X9M A;  1KSP A;  4DQP A;  1T03 A;  1X9W A;  4HCB A;  1S9E A;  4I2Q A;  4F2S A;  1NK5 A;  4BDY A;  4E7H A;  3HPG A;  4FJ5 A;  4KI6 A;  3VA3 A;  2P5G A;  1ASV A;  2XY8 A;  3AA2 A;  2YHB A;  4CHO A;  4XIU A;  2G8W A;  4EP4 A;  1UAX A;  3WNE A;  3EY1 A;  2OPS A;  3SZ2 A;  1NK0 A;  4B3O A;  1I3A A;  4JRP A;  4W5T A;  3OYE A;  2D0A A;  4IDK A;  3ZSZ A;  1CXU A;  3M8P A;  4CJK A;  4DTP A;  3JYT A;  1J53 A;  3D45 A;  3OJU A;  1TL1 A;  2KW4 A;  1KFD A;  1VSL A;  4DTU A;  3LZJ A;  3QEV A;  3SUP A;  1S9G A;  4DS4 A;  3T19 A;  3K58 A;  4DQQ A;  1ZBL A;  1KLM A;  4B9N A;  2LSN A;  1Q9X A;  4JLH A;  3KK2 A;  3HL8 A;  2HW3 A;  2KZZ A;  1IKW A;  1NKB A;  3A2F A;  3C6T A;  1QSL A;  2GUI A;  2DTU A;  3ZT0 A;  1UA1 A;  3CG7 A;  3OYI A;  3VQB A;  3IRX A;  3OS0 A;  1QQC A;  4AHS A;  4PWD A;  4KO0 A;  3AA4 A;  3DRR A;  4FVM A;  3QIP A;  4RW4 A;  3NGI A;  2DY4 A;  4C8M A;  4E3S A;  3AVA A;  3QER A;  5KTQ A;  3ZSV A;  4Y1D A;  3DLE A;  3MED A;  1EP4 A;  2I5J A;  1J9A A;  3I8D A;  2VG7 A;  3I0S A;  3KLG A;  4CJP A;  2FC0 A;  3K5N A;  4KB0 A;  4CK3 A;  2OPP A;  1BCO A;  2YNH A;  3KLE A;  4EP5 A;  4FLZ A;  2DFF A;  5FDL A;  4M42 A;  4DU1 A;  2B4J A;  4IG3 A;  3V9Z A;  1KFS A;  2QKB A;  3V9W A;  3AVC A;  4OJR A;  3VQ5 A;  3NAE A;  1NK6 A;  4CE9 A;  4UQG A;  3SPZ A;  1HQU A;  3SV3 A;  1BIS A;  3RMC A;  4N41 A;  4KFB A;  5C25 A;  4CHY A;  4OLA A;  1LW2 A;  3SQ2 A;  3LP3 A;  1RBU A;  4FW1 A;  3CFO A;  4YNQ A;  3KKS A;  3EYZ A;  5I42 A;  4DS5 A;  3RTV A;  3SCX A;  1RT7 A;  3VQ9 A;  3ZSY A;  3THV A;  4HCC A;  1S5J A;  1NOY A;  1RDD A;  1EKE A;  1VRU A;  4DG1 A;  2E6M A;  1IKX A;  4I7F A;  2BDP A;  4J2E A;  4Z4H A;  2ZD1 A;  2HHT A;  1VSM A;  2NUB A;  2YHA A;  5FRO A;  2ATQ A;  4LSL A;  3IAY A;  3OYA A;  4Q5V A;  3T3F A;  2G8U A;  4FLU A;  3RMD A;  4F8R A;  4PUO A;  4ICL A;  4YFU A;  2DFE A;  1RCH A;  4H4O A;  3K57 A;  1NKC A;  1CZB A;  5E41 A;  5HLF A;  3TI0 A;  1IKY A;  3QIN A;  3TAF A;  4FK2 A;  1WN7 A;  4BWM A;  3T1A A;  2HNY A;  2A1S A;  2FBV A;  3O4Q A;  4NCB A;  3SNN A;  2P51 A;  2ITG A;  3CM6 A;  1HMV A;  5SZT A;  1C0U A;  4DSF A;  3QNN A;  4Z4G A;  1HPZ A;  3FFI A;  5FRN A;  1RDC A;  2G8I A;  2HVH A;  3EZ5 A;  2JLE A;  2RKI A;  1S1X A;  2HHS A;  3LP1 A;  1A5W A;  2X6S A;  3DM2 A;  1C1C A;  1UOC A;  1GOC A;  2EHG A;  3AO2 A;  4FJK A;  1QE1 A;  1KCF A;  3VQ4 A;  1JLB A;  1L5U A;  5HRO A;  3QEP A;  3G0Z A;  4FK0 A;  2D0C A;  3C6U A;  1BQM A;  3DYA A;  4LSN A;  4M3R A;  3QES A;  1D5A A;  2YV0 X;  1JXE A;  3AA3 A;  1RBT A;  4OKK A;  5J2M A;  2XY6 A;  1N6Q A;  1IG9 A;  2QK9 A;  4CJ4 A;  3WNF A;  3TAB A;  4LY7 A;  4B08 A;  4CGI A;  4W5R A;  2P1J A;  4B8A B;  5J2Q A;  4OLB A;  2HHU A;  2HHQ A;  3QIO A;  3SQ1 A;  1F21 A;  2YNI A;  1LAV A;  4F3O A;  3OYF A;  1WSG A;  4WE1 A;  5CZ1 A;  4DTM A;  3V4I A;  4IKF A;  1VK0 A;  4NYN A;  3OS1 A;  5HRS A;  1RTJ A;  4DLE A;  4Z4I A;  1SV5 A;  4KTQ A;  4KHS A;  1HNV A;  3LAK A;  4EZ9 A;  4M3T A;  3QO9 A;  2KFN A;  1S6Q A;  4OKJ A;  1J54 A;  1ZYQ A;  4FZY A;  3SJJ A;  2B6A A;  2F8T A;  4C8N A;  4B9L A;  5FRM A;  4KV8 A;  1Q8I A;  3OYL A;  4R5P A;  3M8R A;  4DMN A;  3DLR A;  3AVH A;  4AHU A;  3PV8 A;  4ELU A;  2Y1I A;  3U6F A;  1BL3 A;  3K5M A;  4F4K A;  4DFJ A;  3SYZ A;  3PX4 A;  3S9H A;  4CGG A;  3TAR A;  4KAZ A;  1HQE A;  4BDP A;  4HHT A;  1DTT A;  3AO4 A;  3DOK A;  2OPQ A;  4FLT A;  3V9S A;  4B9M A;  3TAP A;  4N5S A;  3K5L A;  1A5V A;  2E6L A;  3AVL A;  2IOC A;  3F9K A;  4CF0 A;  5I3U A;  3O3F A; 
#chains in the Genus database with same CATH topology
 3L2U A;  5GIN A;  5JVG L;  3CM5 A;  4FLV A;  4PQU A;  4CJF A;  3RMB A;  4WFA L;  4DV2 K;  5BPN A;  2B5J A;  1NGI A;  2NRT A;  5JS2 A;  3ZSQ A;  5B8H A;  4DFP A;  1BIZ A;  4O44 A;  4DTX A;  4IG0 A;  4HTL A;  3AVJ A;  1SKR A;  4GW6 A;  3EZW A;  3TTF A;  4MO5 A;  3QBW A;  1SZ2 A;  4C8K A;  3OYN A;  4KRF A;  2YI1 A;  4B9S A;  2OPR A;  5J1E A;  3O4N A;  2Q0U A;  4BAC A;  3VQE A;  3DLK A;  4FM1 A;  1W9H A;  3CFP A;  1VQN N;  3SAH A;  3O1B A;  1LV5 A;  1VSF A;  4IEE A;  4CCH A;  5D3G A;  2QWM A;  2YJE A;  4DV7 K;  1M1K O;  2YJF A;  3EEQ A;  3B6O A;  4O8K A;  4FJG A;  4FZX C;  1FKP A;  4LH4 A;  3OYM A;  4CJW A;  1JXB A;  2JGU A;  1XC9 A;  3VA0 A;  4FJN A;  4CJ3 A;  4PHT X;  3HZ6 A;  4DU4 A;  1ZBH A;  5FPE A;  2HF3 A;  3MEE A;  3NGY A;  2BAN A;  3F9M A;  3SUN A;  4FPA A;  4CK1 A;  4FZZ A;  5GIO A;  3TTC A;  1JLF A;  3WQT A;  3UB5 A;  4DCH A;  4V19 S;  4H5R A;  4WFN L;  1VQK N;  5JIC A;  2HNZ A;  3BZC A;  5FLX O;  2OZS A;  1SKS A;  2BTF A;  2ITM A;  2FXU A;  3VOV A;  3FZK A;  2F7T A;  5AQR A;  4QS9 A;  5EU7 A;  4DLG A;  1IBK K;  4OPJ A;  3ZCM A;  1XUP O;  3LAL A;  4ID1 A;  2KFZ A;  3AVK A;  2FF6 A;  3BY5 A;  3U3G A;  1VSD A;  4JS4 A;  3PO5 A;  1GOB A;  1S1T A;  4H5W A;  2KZM A;  5EY4 A;  1B92 A;  2A42 A;  1ZXO A;  2Z1I A;  4MLE A;  1RDA A;  1HNW K;  1A5X A;  1CZ9 A;  4OO1 J;  4FLX A;  3LAN A;  4GV3 A;  5M1F A;  1YJW N;  2PBD A;  3MEC A;  1T44 A;  2Q36 A;  3BF1 A;  5J2N A;  5CE3 A;  2G8V A;  4WFB L;  4E0D A;  5AQZ A;  5BRH A;  4HWI A;  4FWR A;  3A5M C;  3KLI A;  3LWL A;  3CC7 N;  3SI6 A;  3EE9 A;  4HTU A;  2P5O A;  3EN9 A;  1RTH A;  3EE8 A;  1NK4 A;  3THW B;  1HNX K;  4X64 K;  1YIT N;  3H1V X;  2W6L A;  3LPT A;  3A5N C;  1E3M A;  3ULE B;  4JRQ A;  2GUP A;  3TAN A;  1TL3 A;  4N47 A;  3V1O A;  3C94 A;  3WNG A;  1GOA A;  2D1K A;  3P1G A;  3M6G A;  4FW2 A;  2WOM A;  3QEX A;  1YVU A;  3QLH A;  5H1S Q;  4DSE A;  3L6Q A;  3L2Q A;  2IIR A;  1VSH A;  3RVC A;  3L8B A;  4FCY A;  4Y1C A;  4H4M A;  2P9P B;  3DRS A;  5AZI B;  4EHT A;  2HMI A;  4HUF A;  3A5L C;  2BH1 A;  2YNF A;  3ASM A;  1SUQ A;  3IFR A;  3L3V A;  3TSU A;  2P9U B;  3ISN C;  4FWO A;  4CJL A;  2CGK A;  4H5T A;  3I56 N;  1ITG A;  1TV6 A;  1KQS M;  3J7Z O;  1DKG D;  2A1R A;  3SMP A;  2O8E B;  2YHX A;  3AV9 A;  3CF5 L;  1REV A;  5C2D A;  2V51 B;  4O4G A;  5C0Y A;  1Z25 A;  1TKZ A;  5KQ8 A;  4DR3 K;  4OX9 K;  4E7L A;  1BQN A;  1OH5 A;  4CES A;  4FJH A;  1GLD G;  3JSM A;  4DV3 K;  4M63 C;  3L2V A;  2P9K B;  3CQ8 A;  5CYM A;  2OYQ A;  1NOZ A;  4CFA A;  3CYM A;  1Q86 O;  1U6Z A;  1S72 N;  1LWC A;  4DSJ A;  5LJW A;  4U7B A;  4CJE A;  4X62 K;  1RT3 A;  1NGD A;  3WEE A;  1BI4 A;  4IFV A;  1KTQ A;  1HUX A;  1TKT A;  3LZI A;  5AQJ A;  3AVG A;  1JL1 A;  1NBW A;  2I7P A;  4EFH A;  2WUS A;  2HF4 A;  3DJC A;  3T1H K;  3M8Q A;  4PKG A;  3HK2 A;  3BP8 A;  3NBP A;  3DXM B;  4KHW A;  3NE6 A;  5C2F A;  4AQY K;  1VQM N;  3KK3 A;  3MXM A;  3ZX2 A;  4BE0 A;  4FLW A;  4J2B A;  1QQN A;  1HLU A;  3DLG A;  4BRA A;  1T05 A;  2ASM A;  2E4L A;  4H0Y B;  3VQ6 A;  1NK7 A;  4OGC A;  4CEE A;  1X1P A;  3CCM N;  4NXN K;  1QSS A;  3ENB A;  1NWK A;  4FWN A;  3NCI A;  5J2P A;  1RTD A;  3PLA A;  5CYQ A;  1NK8 A;  4BDZ A;  1Z26 A;  1U48 A;  3VGM A;  3C6A A;  3CIP A;  3IG1 A;  1CLQ A;  3ZSW A;  2NNW A;  4LH5 A;  4A5B A;  3KD5 E;  3ZLJ A;  4CEO A;  3J7Y P;  2W40 A;  4DV0 K;  1MA9 B;  1WSF A;  4HCB A;  3I33 A;  4FOI A;  4LFB K;  4BDY A;  5AQU A;  3HPG A;  4FJ5 A;  3VA3 A;  2P5G A;  1ASV A;  3MX2 A;  4CHO A;  4EP4 A;  2P9N B;  2OPS A;  1I3A A;  1VQ8 N;  5AQK A;  2D0A A;  1CXU A;  4DTP A;  4DR7 K;  3AAP A;  2ASP A;  3D45 A;  2YHW A;  3OJU A;  4DUZ K;  1TL1 A;  3D2F B;  1VSL A;  5TKY A;  3T19 A;  4DQQ A;  1S22 A;  1KLM A;  1Q9X A;  2HW3 A;  5AQV A;  1NKB A;  3C6T A;  1QSL A;  5I9E B;  4WQ5 C;  3OHR A;  3OS0 A;  4FVM A;  4JK8 A;  4RW4 A;  2DY4 A;  3J80 O;  4C8M A;  2O8F A;  4E3S A;  1GLE G;  4FO0 A;  5M1P A;  3ZET B;  4BY9 C;  3C0B A;  4B1Y B;  1J9A A;  1K9M O;  3I0S A;  5AQY A;  3SBG A;  4A2A A;  4CJP A;  2E2N A;  2OPP A;  3TPQ A;  3UKR A;  4FLZ A;  1HNZ K;  2B4J A;  2A40 A;  1K8K A;  1IG8 A;  2VCP A;  4OJR A;  4CE9 A;  3U8X A;  4UQG A;  4N41 A;  1ZC6 A;  4JEP A;  3VQ9 A;  1NOY A;  1EKE A;  1VRU A;  3Q7B A;  4J2E A;  1IKX A;  5LJV A;  4Z4H A;  2NUB A;  5FRO A;  4ISE A;  2ATQ A;  4LSL A;  4BRD A;  3CCL N;  3R8E A;  2Q1N A;  4ICL A;  4A5A A;  3FE1 A;  1NKC A;  1CZB A;  3FZF A;  4YOW A;  4BWM A;  4GKJ K;  1NGB A;  3Q7C A;  3BF3 A;  4DR4 K;  2P51 A;  2ITG A;  2UU9 K;  3CM6 A;  1HMV A;  1C0U A;  4DSF A;  1HPZ A;  5FRN A;  1RDU A;  2G8I A;  2HVH A;  3EZ5 A;  2JLE A;  2RKI A;  4JKH A;  3LP1 A;  4J8F A;  2X6S A;  4FJK A;  1C1C A;  1HR0 K;  3VQ4 A;  3G0Z A;  4CZI A;  1N6Q A;  1IG9 A;  5J2M A;  4CJ4 A;  2FSN A;  3WNF A;  4LY7 A;  4B08 A;  4W5R A;  2AJQ A;  2HHU A;  2YNI A;  3R3L A;  4F3O A;  1XC3 A;  4WE1 A;  3E9P A;  1BA0 A;  3L0Q A;  1S6Q A;  1VQO N;  1KAY A;  4C23 A;  4C8N A;  4B9L A;  5FRM A;  1TUY A;  4CBX A;  3AVH A;  4IZ9 A;  3TTD A;  4ELU A;  1BA1 A;  4CGG A;  4KAZ A;  1HQE A;  4BGA A;  3TAP A;  4JKA A;  4JI8 K;  3AVL A;  2O8C A;  3O9R A;  4ILJ A;  1BWF O;  1GLA G;  4DV4 K;  4ISG A;  1I39 A;  1EX4 A;  1WSJ A;  1HRH A;  4BE1 A;  3BDP A;  1JLE A;  4QS7 A;  4JHD A;  1QVF M;  2ZQB A;  3U9Z A;  3OBW A;  3CCQ N;  3OYB A;  1DTQ A;  5SWM A;  3ZT1 A;  4LF8 K;  4M3Z A;  4IXC A;  3FR0 A;  3O9T A;  3EKS A;  3QBX A;  3KK7 A;  4KPY A;  4CZE A;  4DKW A;  4CGD A;  4PY5 A;  3DXK A;  4OPH A;  4CIE A;  5HP1 A;  4CEB A;  5AQP A;  4BRL A;  4H0P A;  3HOT A;  4CD3 A;  4BC3 A;  3TR8 A;  4IOC L;  4KHP K;  1V4S A;  1ZBF A;  2A5X A;  4MO4 A;  3I0R A;  2W42 A;  2VQF K;  3RR8 A;  3PO4 A;  2HND A;  4M45 A;  2RF2 A;  1SL1 A;  4JI6 K;  1FXX A;  4KTZ A;  1J5E K;  1ASW A;  3ZT2 A;  4BRQ A;  4M3X A;  5BR8 K;  4YOX A;  1P90 A;  2NZT A;  4FSV A;  4FXD A;  1VHX A;  3QNO A;  3VES A;  4EZ6 A;  1RBV A;  5IT9 O;  4E1N A;  4E7I A;  3P83 D;  5C24 A;  4DU3 A;  2HHX A;  4K8X A;  1X3M A;  3VQ7 A;  4E1M A;  5HL7 L;  1BIU A;  4OVL A;  1C0G A;  1XWL A;  3GDQ A;  3OYD A;  3HP6 A;  3SLC A;  3SUQ A;  4UY8 O;  4B3R K;  3SPY A;  4XH5 A;  1L3S A;  4JK7 A;  3KIO A;  1XI1 A;  1U49 A;  1UA0 A;  1YUW A;  4O0J A;  4MFB A;  4WQ5 A;  4JKG A;  2P9I A;  2P9S A;  1VSI A;  1I94 K;  1RGI A;  3MXJ A;  4KHY A;  4CZL A;  4AHR A;  3AO1 A;  1TGO A;  1W7A A;  4CVN E;  3OS2 A;  4DTS A;  1N5Y A;  4N76 A;  3W0L A;  3NHG A;  4GVE A;  4CHN A;  4DSL A;  1RIL A;  4FWP A;  4LFC K;  1ZBU A;  1TAU A;  1BCM A;  1NGJ A;  3G10 A;  1JLC A;  2YHY A;  3QET A;  2J4R A;  3K0S A;  3GBT A;  3LDO A;  3P38 A;  1SL2 A;  2R7Y A;  2QWL A;  1QQM A;  3O4W A;  2D0B A;  4EIA A;  4O55 A;  2UXB K;  3HYF A;  3RWU A;  1IKV A;  2RN2 A;  4CER A;  2OTL N;  4I9Q A;  1BOT O;  3QML A;  3ULD A;  2Z1H A;  1TAQ A;  3DLH A;  2QXF A;  3KLF A;  3VF2 A;  4BR9 A;  5LMN K;  3O3H A;  3THY A;  3OYJ A;  3WXL A;  1Q18 A;  1E4G T;  4FLY A;  3H3O B;  4C1N K;  2XO7 A;  3WNH A;  4DTR A;  3MN9 A;  4O0I A;  4K8Z A;  4KKO A;  4IEI A;  4PL7 A;  4LF4 K;  2O4G A;  3CQY A;  1U4B A;  1H1V A;  3HPO A;  4WQ4 C;  3V9X A;  3H45 C;  2PYJ A;  5F0X A;  4TSX A;  4MDA A;  3OW2 M;  3R6M A;  5ADX A;  5KQD A;  2O8B A;  3VN5 A;  3ATU A;  4Z4C A;  1LWF A;  4NCG A;  3QEI A;  3L4I A;  3QB0 A;  4FK4 A;  3VEW A;  4HUG A;  1G99 A;  3UKR B;  4CW7 B;  4LF5 K;  1FK9 A;  1K8K B;  1BHL A;  1FJG K;  4AHV A;  5LMU K;  3CFR A;  4BRO A;  4B1Z A;  4CZH A;  1ESV A;  2GWK A;  2QWR A;  3SMS A;  3OYH A;  5AFU H;  1NJZ A;  3AAQ A;  1OH6 A;  3E66 A;  1YHQ N;  1JLQ A;  1EET A;  3H08 A;  2IVO A;  3V9U A;  1OVQ A;  3TAQ A;  3ATV A;  4M7Y A;  4DTJ A;  3CCV N;  2ETJ A;  3RRG A;  1UWB A;  3CCS N;  1RNH A;  4IOA L;  4B8C A;  1NLV A;  3LDQ A;  1W0H A;  4JNE A;  1IBM K;  3L2W A;  1S1U A;  4LFA K;  1O1W A;  1ILY A;  4RG8 A;  4MQ3 A;  3HVR A;  2QEX N;  2P9L B;  1C6V A;  3AGK A;  2EWS A;  2E2P A;  3P31 A;  1NGA A;  1JCG A;  3C7N A;  2YKM A;  4IO9 L;  4I2P A;  1FKO A;  1S1W A;  1S1V A;  1JKH A;  1NJI O;  3D2E A;  4R79 A;  3PUF A;  5GIP A;  1OKJ A;  4E7J A;  3KZB A;  1J5O A;  5HRN A;  1X3N A;  3P4I A;  1SL0 A;  2E2O A;  5JLF A;  3GL1 A;  2Y1J A;  4CEZ A;  3J8A A;  1JCE A;  5EOY A;  1QHA A;  3U3Y A;  4BRI A;  3LDL A;  5M1Q A;  1MU2 A;  4GKK K;  1NGG A;  5C10 A;  4JS5 A;  4JK9 A;  5JLH A;  2VGM A;  4CBW A;  4BG9 A;  4JI3 K;  2Q3S A;  3VQ8 A;  1OVY A;  1KLN A;  1IH7 A;  4X66 K;  3UKU A;  3CJA A;  4JHD B;  4RW6 A;  1NMN A;  4CFB A;  3O6W A;  4IFY A;  4B3S K;  2Z1J A;  2HHH K;  1XNR K;  4DB3 A;  1M90 O;  2OA8 A;  1HKC A;  1JL2 A;  3K5O A;  1QVG M;  2F96 A;  4CED A;  4DQI A;  1TYQ A;  3DMJ A;  3LP2 A;  4DSI A;  1KVB A;  3DAW A;  4JAX A;  2HBL A;  1WBD A;  2OTJ N;  4DWI A;  3E9O A;  3DOL A;  1RT4 A;  2E1Z A;  4PKI A;  4YOU A;  3BZK A;  3ZSX A;  4CEA A;  1U47 A;  2KLA A;  1WSH A;  3LDP A;  4H5V A;  3MXI A;  2ZGY A;  4JD2 A;  3S3M A;  4RTF D;  4RWT A;  1X9W A;  1S9E A;  4F2S A;  2FSJ A;  1NK5 A;  3EY1 A;  3SZ2 A;  2ZWH A;  1NK0 A;  5MLC Q;  4IDK A;  3PSI A;  1EO1 A;  1SAZ A;  1KFD A;  3LZJ A;  3HRG A;  2D0P A;  3K58 A;  2LSN A;  4BGB A;  4JLH A;  2A3Z A;  4CZF A;  3KK2 A;  3HL8 A;  3A2F A;  3MWT A;  2DTU A;  1UA1 A;  3ZYY X;  3VQB A;  1QQC A;  5AQF A;  3NGI A;  4WQ4 A;  1OH8 A;  4EAH D;  2A6A A;  2QWO A;  1KXP A;  4CZM A;  2P9S B;  1EWR A;  1HX1 A;  2ZGZ A;  3ZSV A;  3O5B A;  1XMO K;  1W2B M;  2FC0 A;  3THX A;  3VTI A;  4GV6 A;  5FDL A;  4M42 A;  3V9Z A;  3V9W A;  2WTU A;  4FWL A;  2UXC K;  1LW2 A;  1E4F T;  3SQ2 A;  3LP3 A;  4FW1 A;  3CQX A;  4HCC A;  3ZSY A;  3O9S A;  1S5J A;  5AQH A;  4DG1 A;  1S3X A;  2HHT A;  3HOS A;  2YHA A;  3IAY A;  4XH4 A;  3T3F A;  4FLU A;  3RMD A;  2OCE A;  3HI0 A;  4PUO A;  1Z6R A;  4BVP A;  5AZJ B;  5HLF A;  3THY B;  5JVH L;  3QIN A;  2KKZ A;  1WN7 A;  2ZJQ L;  2A1S A;  2GEL A;  5LL6 Z;  3QNN A;  2F9W A;  4YHH K;  3FFI A;  4IWV A;  1KC8 O;  1A5W A;  2EHG A;  1GOC A;  1IV0 A;  1L5U A;  2NRR A;  2ASO A;  5HRO A;  3QEP A;  3C65 A;  4FK0 A;  4M3R A;  4ILG B;  3LL3 A;  1RBT A;  2XY6 A;  5EX5 A;  2HHQ A;  2W41 A;  3VEX A;  4OLB A;  3QIO A;  3SQ1 A;  1NGF A;  1LAV A;  3CCE N;  1IJJ A;  2O8B B;  5CZ1 A;  4IKF A;  3OS1 A;  5M1K A;  5HRS A;  4Z4I A;  4KTQ A;  4M3T A;  2BUP A;  4EZ9 A;  3QO9 A;  1J54 A;  4DR1 K;  3OYL A;  3M8R A;  3PV8 A;  4A61 A;  4AHU A;  4K43 A;  4FOE A;  3U6F A;  3K5M A;  4DFJ A;  3SYZ A;  3G25 A;  3PX4 A;  5AQO A;  2QXL A;  4BDP A;  2FSK A;  5AQI A;  3DOK A;  1FW6 A;  4FLT A;  4B9M A;  3DWL A;  2IOC A;  1KD1 O;  4NO7 A;  5I3U A;  3O3F A;  1C0F A;  4H0T B;  4H8K A;  3NGZ A;  5C15 A;  4IJN A;  3NH0 A;  4DF8 A;  1D9F A;  3CD6 N;  1D9D A;  2E88 A;  3DLB A;  2Z1G A;  1QSY A;  5JMV A;  1T7P A;  3A8Y A;  1KAZ A;  3JXU A;  3P5J A;  1LAW A;  3HST B;  5CR4 A;  3KD1 E;  4CHQ A;  4NCA A;  4Z0U A;  4GV9 A;  3K2P A;  4J2D A;  3QFP A;  4ELV A;  3V81 A;  5AQM A;  5BR9 A;  4KHQ A;  1HNI A;  3VEV A;  1OH7 A;  5FPN A;  3FZL A;  1VSJ A;  4JI5 K;  3C7N B;  1T6D A;  5AQT A;  2IAJ A;  1KVC A;  3OYG A;  2UUB K;  4CJQ A;  2X74 A;  3EL2 A;  3L4Q A;  4BE2 A;  1RT2 A;  4IBN A;  3HTV A;  3U9D A;  4GMJ B;  4E7K A;  2IVP A;  3MN7 A;  4ILH A;  3E9L A;  4CJR A;  5GAD P;  1ASU A;  3E01 A;  1L3U A;  4LF6 K;  1EQY A;  4JN4 A;  2BE2 A;  3ZEU A;  5C12 A;  4PKH A;  4JKC A;  2PFU A;  3CCR N;  3I8B A;  1RBS A;  3MK6 A;  2PAV A;  1R0A A;  2YX6 A;  1TUU A;  3PIO L;  2X78 A;  4OKE A;  3J7A P;  4W5Q A;  4PA1 A;  5GAH P;  5KRT A;  1YAG A;  3DI6 A;  4FJ9 A;  1GLL O;  3VMF B;  4CGF A;  3CCU N;  4KB1 A;  1YIJ N;  3AVI A;  2NLX A;  4B9U A;  4NLC A;  4BC5 A;  2V7Y A;  2VWJ A;  4H0X B;  1L3T A;  1YT3 A;  2KHO A;  3HVT A;  4BC4 A;  3HJF A;  1HYV A;  4CEQ A;  4RW7 A;  1QHT A;  4DQR A;  4DF4 A;  3V6D A;  1KRP A;  3ZX3 A;  1YTU A;  2ZE2 A;  4L8R B;  5EVZ A;  3LP0 A;  2YCH A;  2Q97 A;  3AO5 A;  2F8S A;  3HP9 A;  5AFU A;  3TAE A;  2UUA K;  1Q82 O;  3RRH A;  3WXI A;  2RPI A;  5CZ2 A;  2CGJ A;  3PX6 A;  3P39 A;  4YOT A;  4HVJ A;  3OY9 A;  3AAR A;  4JI7 K;  4JD2 B;  3CC4 N;  3ID8 A;  3NF8 A;  1YVN A;  4M3W A;  3LDN A;  2ZJP L;  1HPM A;  3RR7 A;  4FM2 A;  3HM9 A;  4QCL A;  4L3Q A;  2QA4 N;  2D5R A;  4CIF A;  1WLJ A;  3VQD A;  1GLB G;  1HYS A;  3SK3 A;  3TWH A;  4DFK A;  5FPM A;  3OVN A;  3LWM A;  4FJI A;  3WQU A;  3B6P A;  4Q0B A;  4BQL A;  1C0M A;  4CF2 A;  2I7N A;  2OAN A;  1ATR A;  3C95 A;  1YF5 L;  3HXM A;  2HB5 A;  3THX B;  2OZM A;  3OYK A;  2PY5 A;  2FF3 B;  3WUH A;  3V1Q A;  4F9O A;  4BRH A;  2FBY A;  4PL8 A;  3QFU A;  2VQE K;  4WF9 L;  1CXQ A;  3TSQ A;  1NK9 A;  4OPK A;  5E84 A;  3KVG A;  2GV9 A;  4DQ8 A;  3KHY A;  4X65 K;  3CJ7 A;  2UUC K;  4E19 A;  3NH1 A;  4M3Y A;  3L3U A;  4CJV A;  4BRP A;  4QAG A;  4XH1 A;  4GVM A;  1Z05 A;  2JWL A;  5AQN A;  3O1W A;  1QZ5 A;  1VRT A;  4CJU A;  3SAF A;  4FJL A;  1JLA A;  2DPN A;  1X9S A;  2ZJR L;  3MN6 A;  2ZM6 K;  3SV4 A;  3M3Z A;  3F5T A;  3LM9 A;  5K14 A;  3GG4 A;  3CXC M;  1T8E A;  3WEE B;  2JWK A;  1BI4 B;  3IUC A;  4CF1 A;  4ZHR A;  3RMA A;  4I6M A;  3THW A;  3H3N O;  2PZS A;  2RHK A;  3O3G A;  3DLL L;  3WT0 A;  3PX0 A;  2G8H A;  2YKN A;  2EX3 A;  5BPM A;  2FBT A;  1TK0 A;  5KRS A;  2G8F A;  4KH4 A;  3ID6 A;  1VQL N;  4M41 A;  5AQL A;  3PY8 A;  2BGG A;  1N34 K;  2VG5 A;  3IKM A;  1D4X A;  3TAM A;  4Z4E A;  1KVA A;  3O9U A;  5CHI A;  4GY2 B;  1GLC G;  2PYL A;  4OPA A;  1QS4 A;  3OTO K;  2NRW A;  1RT6 A;  1GLJ O;  4FM0 A;  4DTN A;  2XRI A;  1QTM A;  2P9P A;  3CPW M;  4BRE A;  4KHU A;  1Y64 A;  2RE2 A;  1Q7Y O;  4H0V B;  1RT1 A;  2P9U A;  1YJ9 N;  4KTW A;  4BWJ A;  2HHW A;  2X6N A;  5HRR A;  2O8E A;  1DEJ A;  3R1X A;  2IC3 A;  4DTO A;  1XNQ K;  1RTI A;  3O9Q A;  1ZBI A;  3SQ4 A;  4KRE A;  5CY4 A;  2QWN A;  1WAF A;  4I9L A;  4W5O A;  2WFB A;  4AHC A;  2P9K A;  5LY3 A;  4CEF A;  4N56 A;  4JKF A;  4B9T A;  4DQS A;  3AVM A;  2Q0R A;  3NVM A;  3MCP A;  2NRV A;  5KI6 A;  2O8F B;  3E1Y A;  3NF7 A;  3AVF A;  3QEW A;  1HKB A;  4ZTF A;  4MLH A;  3LAM A;  3MDQ A;  2VWB A;  1CZA N;  1SKW A;  3S3O A;  3DRP A;  1Y97 A;  1YTA A;  4G1Q A;  4IFE A;  4DQP A;  1T03 A;  2QI2 A;  4I2Q A;  5HOO A;  4E7H A;  2XY8 A;  3AA2 A;  4NB4 A;  2YHB A;  3DXM A;  2G8W A;  2HMP A;  3TSP A;  2UXD K;  1UAX A;  3WNE A;  1NM1 A;  4W5T A;  3OYE A;  3ZSZ A;  5KPZ A;  3BEX A;  1J53 A;  3SJH A;  4H5N A;  1ZBS A;  3ZEU B;  3QEV A;  4CZJ A;  4DS4 A;  1QZ6 A;  1ZBL A;  2E5L K;  3ZX0 A;  2KZZ A;  1IKW A;  3W3D A;  4U67 L;  3FZH A;  3OYI A;  4PWD A;  4KO0 A;  3AA4 A;  3DRR A;  1T6C A;  3N4P A;  3AVA A;  1NGE A;  5KTQ A;  4JYA K;  2QM1 A;  3KLG A;  3K5N A;  4KB0 A;  3ENO A;  3VTH A;  1BCO A;  3AY9 A;  2YNH A;  3VEY A;  4A62 A;  1RDW X;  2QKB A;  1SQK A;  3I55 N;  1MDU B;  3AVC A;  4H03 B;  5BRE A;  1XQS C;  1BIS A;  2P9N A;  4KFB A;  4OLA A;  1N33 K;  3KKS A;  5I42 A;  3D2F A;  4DS5 A;  3SCX A;  4LF9 K;  5BPL A;  2GX9 A;  1MWM A;  1VSM A;  2HBK A;  4Q5V A;  2NRX A;  5GAG P;  2G8U A;  4WYB A;  1RCH A;  2O8D A;  5E41 A;  3TI0 A;  4K25 A;  3CME N;  1IKY A;  3T1A A;  3ZET A;  4KH6 A;  2HNY A;  1WBB A;  3VGL A;  4IOX A;  3O4Q A;  4NCB A;  1X9J A;  3SNN A;  5SZT A;  4AM6 A;  1T3V A;  4A59 A;  2O8C B;  1KAX A;  2CGL A;  2A41 A;  3AO2 A;  1QE1 A;  1KCF A;  5GAE P;  1JLB A;  1BG3 A;  1NGH A;  3C6U A;  3DYA A;  4LSN A;  3QES A;  1VQ7 N;  1D5A A;  2YV0 X;  3AA3 A;  4BRF A;  3CJ1 A;  4BQZ A;  3VEZ A;  5J2Q A;  2P1J A;  3ENH A;  4B8A B;  3KWG A;  3OYF A;  4YDU C;  1Q81 O;  2GEM A;  3M1F A;  4DTM A;  3V4I A;  1VK0 A;  3DXK B;  4NYN A;  4IJA A;  4Y0W A;  1RTJ A;  3CER A;  4DLE A;  1HNV A;  2KFN A;  4FZY A;  4A2B A;  3SJJ A;  2F8T A;  4BR4 A;  3EO3 A;  1Q8I A;  3DLR A;  2Y1I A;  3K9K A;  1K73 O;  4F4K A;  1O13 A;  3S9H A;  3T69 A;  3HBT A;  1DTT A;  3K5L A;  1RFQ A;  2QWP A;  3MX5 A;  3RSE A;  4YOV A;  4CF0 A;  3QIC A;  3CJC A;  1VSK A;  1LW0 A;  3FZM A;  4KH5 A;  4B1X B;  4MDB A;  4RW8 A;  4FWK A;  3ITH A;  1NNE A;  2V7Z A;  3K59 A;  4B1U B;  4O8U A;  3H1Q A;  3G4S N;  4FJM A;  2IGI A;  1U04 A;  5KGW A;  1JLG A;  1WSI A;  2G8K A;  3KWI A;  2VG6 A;  4I6M B;  1L3V A;  4FWS A;  4CJS A;  2QKK A;  4JKG B;  2P9I B;  1VQ4 N;  1WAJ A;  4CGH A;  4A57 A;  3OJS A;  3VGK A;  3VQP A;  1V4T A;  1NG9 A;  4QOZ B;  4CFD A;  3NFA A;  3VQQ A;  2E2Q A;  3S3N A;  1TKX A;  2WBN A;  4F2R A;  3M5R A;  3LM2 A;  3HSC A;  4CF8 A;  4CIG A;  4DV1 K;  1NJY A;  3AGR A;  1SS6 A;  5EXW A;  3VER A;  1YI2 N;  3HO1 A;  2E8A A;  2VWK A;  1U2V A;  4RCH A;  3R9P A;  3HT3 A;  1HJO A;  1W97 L;  2NRZ A;  4FYD A;  3NDK A;  1HYZ A;  2GWJ A;  2F9T A;  2XY7 A;  5AQW A;  4Z4F A;  4BRG A;  3ZT4 A;  1DT9 A;  2W6K A;  3NF9 A;  4BR5 A;  2O4I A;  3LDS A;  1NJX A;  4BR0 A;  1B9D A;  1IO2 A;  5ADX H;  1JCF A;  1HJR A;  4CBU A;  2XHB A;  5KGX A;  2WON A;  3CET A;  3OA9 A;  4FJ7 A;  3NVK A;  4ELT A;  4FJX A;  4O5B A;  4YY3 K;  4JI0 K;  1ATS A;  4BR7 A;  2D0O A;  3LPU A;  3WXM B;  5DMR A;  3AA5 X;  3MMV A;  4CHZ A;  3F2K A;  1LWE A;  1XHZ A;  3VEO A;  3B8A X;  4CF9 A;  3GOI A;  5M1N A;  5T7B A;  4JI4 K;  5E26 A;  4FJJ A;  3MEG A;  3H46 O;  2Q2R A;  4FL9 A;  3AVB A;  5JS1 A;  2V52 B;  4J2A A;  3QDK A;  4OGE A;  3U4L A;  1K6Y A;  1RT5 A;  4DUY K;  3TAG A;  3KJV A;  4JV5 K;  1VQ6 N;  4QS8 A;  4DHY A;  4G9Z A;  2AP1 A;  2IDO A;  2HHV A;  1C0T A;  2WC9 A;  1TVR A;  1EXQ A;  3N4Q A;  1B9F A;  3IS9 A;  1BGX T;  1S6P A;  4CJ5 A;  2XY5 A;  1TKD A;  4YDU A;  3BGR A;  1NKE A;  2E1Y A;  3VQC A;  3NMU A;  4E1J A;  4KHN A;  1JJ2 M;  3CJB A;  4JKD A;  4DFM A;  3SUO A;  4NYF A;  5DK5 A;  3ZT3 A;  4AH9 A;  1N8R O;  4JKB A;  3D2E B;  2CH5 A;  5AQS A;  1C1B A;  4FJ8 A;  4B9V A;  4E89 A;  4AM7 A;  4B9Q A;  5ELZ A;  4B3M K;  3PIP L;  1BO5 O;  4B1W B;  1N32 K;  2O8D B;  3O8M A;  3L2R A;  2GBZ A;  1WUA A;  1R59 O;  3CPE A;  4AHT A;  4AIL C;  1WNS A;  4DR6 K;  3F73 A;  2FLO A;  3AVN A;  1TK8 A;  4K0K K;  4C8L A;  3HPH A;  3MN5 A;  5AR0 A;  4RW9 A;  3OBY A;  3V1R A;  2NRH A;  5F2R A;  4CJT A;  3T1Y K;  5KPR A;  3UKU B;  3CMA N;  3AO3 A;  4M7X A;  2YNG A;  4JKE A;  3CCJ N;  1BUP A;  1NJW A;  4O5F A;  1RDB A;  4CHP A;  3VQA A;  3M8S A;  2HBJ A;  4DR2 K;  4KI4 A;  1ATN A;  4GNI A;  4CGJ A;  3CHW A;  2CH6 A;  4M3U A;  4F3T A;  4CK2 A;  5BN8 A;  3KK1 A;  1XHX A;  5BN9 A;  4CJ7 A;  4XEI A;  3KLH A;  3D7E O;  3FLC O;  4ID5 A;  1TYQ B;  3MAQ A;  1BU6 O;  1K8A O;  4FVU A;  5C42 A;  3NF6 A;  4NXM K;  3O80 A;  4BRC A;  5A2Q O;  2KTQ A;  3PSF A;  1C1A A;  4HUE A;  2Q31 A;  4IDH A;  4CFC A;  3ZSO A;  4CD1 A;  3D0P A;  3RSE B;  3KTQ A;  3G71 N;  3VF6 A;  1U45 A;  5HBM A;  4WCE L;  1DLO A;  4AF1 A;  2HBM A;  2P9L A;  2KQ2 A;  2VGN A;  5DM6 L;  4CZG A;  3IMX A;  5HRP A;  3OYC A;  1TK5 A;  4DV5 K;  3UIQ A;  4CZK A;  1DGK N;  5AJ3 K;  3ZSR A;  3FGU A;  4EHU A;  4ZTJ A;  2IS3 A;  4BR2 A;  2DFH A;  3SQ0 A;  3NH2 A;  2HVI A;  3T7Z A;  4LC9 B;  4LD0 A;  1VQ5 N;  4DSK A;  5AQG A;  4BC2 A;  3KKR A;  5AQQ A;  1Q9Y A;  4CEC A;  1WOQ A;  1NU0 A;  1WSE A;  5F1X A;  3VF4 A;  3GE1 A;  3A0I X;  3J81 O;  1D8Y A;  1NGC A;  4C8O A;  4W5N A;  2FBX A;  1VSE A;  3ALY A;  1NMD A;  1RBR A;  3MWP A;  4FPB A;  1IBL K;  1G15 A;  1KSP A;  4B1V A;  1X9M A;  4BRN A;  1MWK A;  3SAG A;  3BUZ B;  3S41 A;  4KI6 A;  4XIU A;  4FWQ A;  2UYT A;  2D4W A;  3UE5 A;  4B3O A;  4JRP A;  1LOT B;  3IDH A;  4JI1 K;  1VQ9 N;  4B3T K;  4CJK A;  3M8P A;  3JYT A;  2KW4 A;  4DTU A;  4YOR A;  3SUP A;  1S9G A;  3O08 A;  1LCU A;  3G6E N;  2QW9 A;  4B9N A;  5TKW A;  4CI6 A;  1U2V B;  2GUI A;  3ZT0 A;  3CG7 A;  3IRX A;  1YXQ A;  4AHS A;  1WB9 A;  2VYP A;  3QIP A;  4Z94 A;  3K9J A;  3QER A;  4Y1D A;  2HST A;  3SBT A;  3DLE A;  4BRM A;  1P8Z A;  1EP4 A;  2QWQ A;  3MED A;  2I5J A;  3I8D A;  2IVN A;  2VG7 A;  5FPD A;  2AA4 A;  5BRF A;  4CK3 A;  3KLE A;  4EP5 A;  2DFF A;  3EKU A;  4DU1 A;  4IG3 A;  3HM8 A;  1KFS A;  3FFK B;  3VQ5 A;  3NAE A;  4ISF A;  1NK6 A;  3SPZ A;  1HQU A;  3SV3 A;  3RMC A;  5C25 A;  4CHY A;  3CI5 A;  2F4V K;  4DR5 K;  2H3G X;  4YNQ A;  1RBU A;  3CFO A;  3VEN A;  1EWQ A;  3EYZ A;  3ULE A;  4K42 A;  3RTV A;  1RT7 A;  3THV A;  1RDD A;  5BRD A;  2BDP A;  2E6M A;  2ZF5 O;  4I7F A;  2ZD1 A;  5M1O A;  3OYA A;  3H6E A;  4KBO A;  5DM7 L;  3CJ9 A;  4F8R A;  1VQP N;  2GTD A;  4YFU A;  2DFE A;  4H4O A;  3K57 A;  3JS6 A;  4YOY A;  3TAF A;  4FK2 A;  5KPT A;  4JI2 K;  4C1N I;  2FBV A;  1VAZ A;  5AQX A;  5AZI A;  4Z4G A;  1RDC A;  3VET A;  1J6Z A;  1S1X A;  2HHS A;  3DM2 A;  1UOC A;  5IWA K;  4DV6 K;  2D0C A;  1BQM A;  3VPZ A;  1JXE A;  4OKK A;  2QK9 A;  1N36 K;  3TAB A;  4CGI A;  3WXK A;  1F21 A;  4FWM A;  1WSG A;  4K41 A;  4BG8 A;  3CC2 N;  4BVO A;  3D6R A;  1SV5 A;  4KHS A;  3C6H A;  3LAK A;  1QQO A;  4OKJ A;  1ZYQ A;  4LF7 K;  4IO8 A;  4H0O A;  3WXJ A;  2B6A A;  4BRK A;  5AZJ A;  4KV8 A;  4R5P A;  4DMN A;  1BDG A;  3TU5 A;  4NLB A;  1BL3 A;  2E20 A;  3MCA B;  1GLF O;  1HKG A;  3JAM O;  3TAR A;  4HHT A;  3AO4 A;  2OPQ A;  3V9S A;  4N5S A;  1XMQ K;  3A5O C;  1A5V A;  2E6L A;  3F9K A;  2HOE A;  1YJN N;  2QTD A; 
#chains in the Genus database with same CATH homology
 3L2U A;  4H8K A;  1I39 A;  1EX4 A;  1WSJ A;  1HRH A;  3CM5 A;  4BE1 A;  4FLV A;  1JLE A;  3BDP A;  4PQU A;  1VSK A;  4CJF A;  3NGZ A;  1LW0 A;  3NH0 A;  2ZQB A;  4DF8 A;  1D9F A;  3OYB A;  1DTQ A;  1D9D A;  5SWM A;  3RMB A;  4RW8 A;  3DLB A;  3ZT1 A;  3ITH A;  4M3Z A;  2Z1G A;  2B5J A;  1QSY A;  3K59 A;  4KPY A;  1T7P A;  4CGD A;  4FJM A;  2IGI A;  4PY5 A;  1U04 A;  1LAW A;  3HST B;  3P5J A;  5KGW A;  5JS2 A;  3ZSQ A;  4CEB A;  4CIE A;  1JLG A;  1WSI A;  4Z0U A;  4CHQ A;  2G8K A;  4DFP A;  1BIZ A;  4O44 A;  3K2P A;  4DTX A;  4IG0 A;  3TR8 A;  2VG6 A;  4J2D A;  3AVJ A;  1SKR A;  4ELV A;  1ZBF A;  3V81 A;  4GW6 A;  1L3V A;  3I0R A;  2W42 A;  3RR8 A;  4C8K A;  3OYN A;  2HND A;  4M45 A;  3PO4 A;  4KRF A;  4CJS A;  4KHQ A;  1HNI A;  2QKK A;  2RF2 A;  1WAJ A;  4CGH A;  1SL1 A;  1FXX A;  2OPR A;  1VSJ A;  4KTZ A;  4B9S A;  1ASW A;  3ZT2 A;  5J1E A;  3OJS A;  3O4N A;  3VQP A;  4M3X A;  2IAJ A;  1KVC A;  3OYG A;  4QOZ B;  4BAC A;  4CJQ A;  3VQE A;  3DLK A;  4CFD A;  4FM1 A;  4FXD A;  1W9H A;  2X74 A;  3CFP A;  3QNO A;  4EZ6 A;  4BE2 A;  1RBV A;  1RT2 A;  3NFA A;  4IBN A;  1LV5 A;  1VSF A;  4E1N A;  5HP1 A;  4E7I A;  4GMJ B;  4E7K A;  4CCH A;  3VQQ A;  5D3G A;  3P83 D;  5C24 A;  3S3N A;  4DU3 A;  2HHX A;  4CJR A;  4K8X A;  1TKX A;  3VQ7 A;  4E1M A;  1ASU A;  1BIU A;  3E01 A;  4OVL A;  1XWL A;  1L3U A;  3OYD A;  3HP6 A;  4F2R A;  3B6O A;  4CF8 A;  2BE2 A;  3SUQ A;  4FJG A;  4CIG A;  4FZX C;  1NJY A;  1FKP A;  4LH4 A;  3SPY A;  1L3S A;  1RBS A;  3HO1 A;  2VWK A;  3OYM A;  1R0A A;  4CJW A;  3KIO A;  1JXB A;  3HT3 A;  1XI1 A;  1U49 A;  2JGU A;  2X78 A;  4OKE A;  4FYD A;  4W5Q A;  1XC9 A;  4PA1 A;  3NDK A;  1HYZ A;  3VA0 A;  4FJN A;  5KRT A;  4CJ3 A;  1UA0 A;  3DI6 A;  4O0J A;  4FJ9 A;  4MFB A;  4DU4 A;  4CGF A;  2XY7 A;  4Z4F A;  1ZBH A;  3ZT4 A;  4KB1 A;  3MEE A;  3NF9 A;  1VSI A;  3NGY A;  3AVI A;  2BAN A;  3SUN A;  2O4I A;  3MXJ A;  4CK1 A;  3LDS A;  1NJX A;  4B9U A;  4FZZ A;  4KHY A;  1B9D A;  4AHR A;  3AO1 A;  1TGO A;  1JLF A;  1IO2 A;  3OS2 A;  2VWJ A;  4DTS A;  1N5Y A;  4N76 A;  1L3T A;  1HJR A;  1YT3 A;  3HVT A;  2XHB A;  5KGX A;  3HJF A;  3NHG A;  1HYV A;  2WON A;  4CEQ A;  4RW7 A;  1QHT A;  4DQR A;  4DF4 A;  3V6D A;  4CHN A;  1KRP A;  4FJ7 A;  4DSL A;  1RIL A;  4ELT A;  2HNZ A;  4FJX A;  1YTU A;  1ZBU A;  4O5B A;  1TAU A;  2OZS A;  1BCM A;  2ZE2 A;  3G10 A;  1SKS A;  1JLC A;  4L8R B;  3QET A;  3LP0 A;  1SL2 A;  3AO5 A;  2R7Y A;  2F8S A;  2D0B A;  3HP9 A;  3LPU A;  4O55 A;  3TAE A;  3RRH A;  5DMR A;  3AA5 X;  2RPI A;  3HYF A;  5CZ2 A;  4CHZ A;  3RWU A;  1IKV A;  5EU7 A;  1LWE A;  3PX6 A;  1XHZ A;  4HVJ A;  2RN2 A;  3OY9 A;  4CER A;  4DLG A;  4I9Q A;  4OPJ A;  3ZCM A;  4CF9 A;  3ULD A;  3LAL A;  2Z1H A;  1TAQ A;  3NF8 A;  4ID1 A;  2QXF A;  5T7B A;  3KLF A;  3DLH A;  4M3W A;  2KFZ A;  3O3H A;  3AVK A;  4FJJ A;  3U3G A;  1VSD A;  3OYJ A;  3MEG A;  4JS4 A;  3PO5 A;  1GOB A;  3RR7 A;  4FM2 A;  3HM9 A;  4QCL A;  1S1T A;  4FLY A;  3AVB A;  2KZM A;  1B92 A;  3WNH A;  2XO7 A;  4DTR A;  5JS1 A;  2Z1I A;  4O0I A;  4K8Z A;  4KKO A;  4J2A A;  1RDA A;  2D5R A;  4CIF A;  4W5N A;  2O4G A;  4OGE A;  1A5X A;  1U4B A;  1WLJ A;  1CZ9 A;  3VQD A;  1K6Y A;  4FLX A;  3HPO A;  1RT5 A;  1HYS A;  3TWH A;  3LAN A;  4DFK A;  3TAG A;  3V9X A;  3KJV A;  3OVN A;  3LWM A;  3MEC A;  4FJI A;  2PYJ A;  3B6P A;  4Q0B A;  1C0M A;  4CF2 A;  5J2N A;  4TSX A;  2IDO A;  2HHV A;  1C0T A;  2G8V A;  1TVR A;  1EXQ A;  3VN5 A;  1B9F A;  4E0D A;  3IS9 A;  1BGX T;  1S6P A;  3C95 A;  4Z4C A;  1LWF A;  4NCG A;  4CJ5 A;  3HXM A;  3QEI A;  4FK4 A;  2XY5 A;  1TKD A;  2HB5 A;  3LWL A;  3KLI A;  4HUG A;  3BGR A;  3SI6 A;  2OZM A;  3OYK A;  2PY5 A;  4HTU A;  2P5O A;  1RTH A;  3V1Q A;  1NK4 A;  1NKE A;  1FK9 A;  2FBY A;  1BHL A;  3VQC A;  4AHV A;  4KHN A;  3CFR A;  4DFM A;  4NCA A;  3SUO A;  3LPT A;  4NYF A;  1CXQ A;  3OYH A;  1NK9 A;  4OPK A;  4JRQ A;  1NJZ A;  3TAN A;  1TL3 A;  5DK5 A;  2GV9 A;  3ZT3 A;  4N47 A;  4AH9 A;  3V1O A;  1JLQ A;  1EET A;  3C94 A;  3H08 A;  3WNG A;  1GOA A;  3V9U A;  3TAQ A;  4E19 A;  3NH1 A;  4M3Y A;  3L3U A;  3P1G A;  4CJV A;  1C1B A;  4FW2 A;  4FJ8 A;  4B9V A;  4E89 A;  4DTJ A;  4QAG A;  4GVM A;  2WOM A;  3QEX A;  2ETJ A;  1YVU A;  3QLH A;  3RRG A;  1VRT A;  4CJU A;  4DSE A;  4FJL A;  1JLA A;  1X9S A;  3L2Q A;  1VSH A;  3L2R A;  3L8B A;  3SV4 A;  4FCY A;  2GBZ A;  4Y1C A;  1UWB A;  1RNH A;  4H4M A;  4AHT A;  4AIL C;  1WNS A;  4B8C A;  5K14 A;  3F73 A;  3DRS A;  2HMI A;  1T8E A;  3AVN A;  1TK8 A;  4HUF A;  2YNF A;  3ASM A;  1W0H A;  1BI4 B;  1SUQ A;  3L3V A;  4C8L A;  3HPH A;  4CF1 A;  4ZHR A;  3RMA A;  3ISN C;  3L2W A;  1S1U A;  4RW9 A;  4CJL A;  2PZS A;  3V1R A;  1ITG A;  1TV6 A;  4CJT A;  3O3G A;  1O1W A;  2AJQ A;  3AO3 A;  4RG8 A;  4MQ3 A;  2YNG A;  3HVR A;  2A1R A;  3PX0 A;  2G8H A;  2YKN A;  2EX3 A;  1C6V A;  3AV9 A;  2FBT A;  1NJW A;  5KRS A;  1REV A;  1TK0 A;  1RDB A;  4CHP A;  2G8F A;  3VQA A;  3M8S A;  4M41 A;  4KI4 A;  3PY8 A;  2YKM A;  4O4G A;  2BGG A;  4CGJ A;  4I2P A;  1FKO A;  1Z25 A;  2VG5 A;  1S1W A;  1TKZ A;  1S1V A;  1JKH A;  4M3U A;  4F3T A;  4CK2 A;  3KK1 A;  1XHX A;  3PUF A;  3KLH A;  1BQN A;  4E7L A;  4CES A;  4FJH A;  4E7J A;  3JSM A;  1J5O A;  4ID5 A;  3TAM A;  3MAQ A;  5HRN A;  3L2V A;  4Z4E A;  1KVA A;  1SL0 A;  3CQ8 A;  2Y1J A;  5CYM A;  4CEZ A;  2PYL A;  2OYQ A;  1QS4 A;  1NOZ A;  4CFA A;  3U3Y A;  1RT6 A;  3CYM A;  1MU2 A;  4FM0 A;  4DTN A;  2XRI A;  1QTM A;  5C42 A;  3NF6 A;  1LWC A;  4DSJ A;  4JS5 A;  4CJE A;  4KHU A;  2KTQ A;  1RT3 A;  1C1A A;  4HUE A;  1BI4 A;  4IFV A;  1KTQ A;  1RT1 A;  4CFC A;  3ZSO A;  3D0P A;  1TKT A;  2Q3S A;  3VQ8 A;  3LZI A;  3KTQ A;  3AVG A;  4KTW A;  4BWJ A;  1KLN A;  1JL1 A;  1IH7 A;  2HHW A;  2X6N A;  1U45 A;  5HBM A;  3M8Q A;  4RW6 A;  5HRR A;  3HK2 A;  1DLO A;  3NBP A;  4CFB A;  2KQ2 A;  4IFY A;  2Z1J A;  4KHW A;  3NE6 A;  2IC3 A;  4DTO A;  5HRP A;  3KK3 A;  3MXM A;  3OYC A;  1TK5 A;  4BE0 A;  3UIQ A;  1RTI A;  4FLW A;  4J2B A;  1ZBI A;  3ZSR A;  3SQ4 A;  4ZTJ A;  2OA8 A;  3DLG A;  2IS3 A;  1JL2 A;  3K5O A;  1T05 A;  2DFH A;  5CY4 A;  4KRE A;  2E4L A;  3VQ6 A;  3SQ0 A;  1NK7 A;  1WAF A;  4OGC A;  3NH2 A;  4CEE A;  2HVI A;  1X1P A;  2F96 A;  4I9L A;  4CED A;  4W5O A;  4DQI A;  1QSS A;  3DMJ A;  3LP2 A;  4LD0 A;  3KD1 E;  4AHC A;  4DSI A;  4CEF A;  1KVB A;  4N56 A;  3NCI A;  5J2P A;  4DSK A;  1RTD A;  5CYQ A;  4B9T A;  3KKR A;  1Q9Y A;  4DQS A;  3AVM A;  4BDZ A;  1NK8 A;  4DWI A;  1Z26 A;  1U48 A;  4CEC A;  1WSE A;  3DOL A;  1RT4 A;  3IG1 A;  5KI6 A;  1CLQ A;  1D8Y A;  3NF7 A;  3ZSX A;  3AVF A;  4CEA A;  4C8O A;  2FBX A;  3ZSW A;  3QEW A;  1VSE A;  4LH5 A;  1U47 A;  4ZTF A;  3KD5 E;  3ALY A;  1RBR A;  1WSH A;  3LAM A;  4CEO A;  3MXI A;  1SKW A;  1G15 A;  1WSF A;  3DRP A;  3S3O A;  1Y97 A;  3S3M A;  1YTA A;  4G1Q A;  1X9M A;  1KSP A;  4DQP A;  1T03 A;  1X9W A;  4HCB A;  1S9E A;  4I2Q A;  4F2S A;  1NK5 A;  4BDY A;  4E7H A;  3HPG A;  4FJ5 A;  4KI6 A;  3VA3 A;  2P5G A;  1ASV A;  2XY8 A;  3AA2 A;  2YHB A;  4CHO A;  4XIU A;  2G8W A;  4EP4 A;  1UAX A;  3WNE A;  3EY1 A;  2OPS A;  3SZ2 A;  1NK0 A;  4B3O A;  1I3A A;  4JRP A;  4W5T A;  3OYE A;  2D0A A;  4IDK A;  3ZSZ A;  1CXU A;  3M8P A;  4CJK A;  4DTP A;  3JYT A;  1J53 A;  3D45 A;  3OJU A;  1TL1 A;  2KW4 A;  1KFD A;  1VSL A;  4DTU A;  3LZJ A;  3QEV A;  3SUP A;  1S9G A;  4DS4 A;  3T19 A;  3K58 A;  4DQQ A;  1ZBL A;  1KLM A;  4B9N A;  2LSN A;  1Q9X A;  4JLH A;  3KK2 A;  3HL8 A;  2HW3 A;  2KZZ A;  1IKW A;  1NKB A;  3A2F A;  3C6T A;  1QSL A;  2GUI A;  2DTU A;  3ZT0 A;  1UA1 A;  3CG7 A;  3OYI A;  3VQB A;  3IRX A;  3OS0 A;  1QQC A;  4AHS A;  4PWD A;  4KO0 A;  3AA4 A;  3DRR A;  4FVM A;  3QIP A;  4RW4 A;  3NGI A;  2DY4 A;  4C8M A;  4E3S A;  3AVA A;  3QER A;  5KTQ A;  3ZSV A;  4Y1D A;  3DLE A;  3MED A;  1EP4 A;  2I5J A;  1J9A A;  3I8D A;  2VG7 A;  3I0S A;  3KLG A;  4CJP A;  2FC0 A;  3K5N A;  4KB0 A;  4CK3 A;  2OPP A;  1BCO A;  2YNH A;  3KLE A;  4EP5 A;  4FLZ A;  2DFF A;  5FDL A;  4M42 A;  4DU1 A;  2B4J A;  4IG3 A;  3V9Z A;  1KFS A;  2QKB A;  3V9W A;  3AVC A;  4OJR A;  3VQ5 A;  3NAE A;  1NK6 A;  4CE9 A;  4UQG A;  3SPZ A;  1HQU A;  3SV3 A;  1BIS A;  3RMC A;  4N41 A;  4KFB A;  5C25 A;  4CHY A;  4OLA A;  1LW2 A;  3SQ2 A;  3LP3 A;  1RBU A;  4FW1 A;  3CFO A;  4YNQ A;  3KKS A;  3EYZ A;  5I42 A;  4DS5 A;  3RTV A;  3SCX A;  1RT7 A;  3VQ9 A;  3ZSY A;  3THV A;  4HCC A;  1S5J A;  1NOY A;  1RDD A;  1EKE A;  1VRU A;  4DG1 A;  2E6M A;  1IKX A;  4I7F A;  2BDP A;  4J2E A;  4Z4H A;  2ZD1 A;  2HHT A;  1VSM A;  2NUB A;  2YHA A;  5FRO A;  2ATQ A;  4LSL A;  3IAY A;  3OYA A;  4Q5V A;  3T3F A;  2G8U A;  4FLU A;  3RMD A;  4F8R A;  4PUO A;  4ICL A;  4YFU A;  2DFE A;  1RCH A;  4H4O A;  3K57 A;  1NKC A;  1CZB A;  5E41 A;  5HLF A;  3TI0 A;  1IKY A;  3QIN A;  3TAF A;  4FK2 A;  1WN7 A;  4BWM A;  3T1A A;  2HNY A;  2A1S A;  2FBV A;  3O4Q A;  4NCB A;  3SNN A;  2P51 A;  2ITG A;  3CM6 A;  1HMV A;  5SZT A;  1C0U A;  4DSF A;  3QNN A;  4Z4G A;  1HPZ A;  3FFI A;  5FRN A;  1RDC A;  2G8I A;  2HVH A;  3EZ5 A;  2JLE A;  2RKI A;  1S1X A;  2HHS A;  3LP1 A;  1A5W A;  2X6S A;  3DM2 A;  1C1C A;  1UOC A;  1GOC A;  2EHG A;  3AO2 A;  4FJK A;  1QE1 A;  1KCF A;  3VQ4 A;  1JLB A;  1L5U A;  5HRO A;  3QEP A;  3G0Z A;  4FK0 A;  2D0C A;  3C6U A;  1BQM A;  3DYA A;  4LSN A;  4M3R A;  3QES A;  1D5A A;  2YV0 X;  1JXE A;  3AA3 A;  1RBT A;  4OKK A;  5J2M A;  2XY6 A;  1N6Q A;  1IG9 A;  2QK9 A;  4CJ4 A;  3WNF A;  3TAB A;  4LY7 A;  4B08 A;  4CGI A;  4W5R A;  2P1J A;  4B8A B;  5J2Q A;  4OLB A;  2HHU A;  2HHQ A;  3QIO A;  3SQ1 A;  1F21 A;  2YNI A;  1LAV A;  4F3O A;  3OYF A;  1WSG A;  4WE1 A;  5CZ1 A;  4DTM A;  3V4I A;  4IKF A;  1VK0 A;  4NYN A;  3OS1 A;  5HRS A;  1RTJ A;  4DLE A;  4Z4I A;  1SV5 A;  4KTQ A;  4KHS A;  1HNV A;  3LAK A;  4EZ9 A;  4M3T A;  3QO9 A;  2KFN A;  1S6Q A;  4OKJ A;  1J54 A;  1ZYQ A;  4FZY A;  3SJJ A;  2B6A A;  2F8T A;  4C8N A;  4B9L A;  5FRM A;  4KV8 A;  1Q8I A;  3OYL A;  4R5P A;  3M8R A;  4DMN A;  3DLR A;  3AVH A;  4AHU A;  3PV8 A;  4ELU A;  2Y1I A;  3U6F A;  1BL3 A;  3K5M A;  4F4K A;  4DFJ A;  3SYZ A;  3PX4 A;  3S9H A;  4CGG A;  3TAR A;  4KAZ A;  1HQE A;  4BDP A;  4HHT A;  1DTT A;  3AO4 A;  3DOK A;  2OPQ A;  4FLT A;  3V9S A;  4B9M A;  3TAP A;  4N5S A;  3K5L A;  1A5V A;  2E6L A;  3AVL A;  2IOC A;  3F9K A;  4CF0 A;  5I3U A;  3O3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...