3ZT2A

Small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2011-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zt2A00
1S9EA 1XHXA 4ICLA 3M8SA 4RW9A 3OYEA 3AA4A 2Z1JA 4KB0A 3HP9A 1VSKA 4CGJA 2XY6A 3V9SA 1KRPA 1SKRA 3THVA 5CY4A 3LDSA 2A1SA 3AVFA 3OJSA 1QTMA 1GOAA 3VQCA 2OA8A 1T8EA 4I9QA 1TKDA 3VQ4A 4DQPA 3OYJA 3RRGA 2HHVA 3HK2A 1IO2A 1IKXA 1VSEA 2HB5A 1ZBUA 3DLKA 1TKXA 2P1JA 1TGOA 3LP2A 4DF4A 4E7LA 2HNZA 2BDPA 4ELUA 3QINA 3CM5A 4B9VA 4N41A 4OKKA 3MXMA 2P5GA 3ZSWA 3M8RA 1VSHA 4CJSA 4YNQA 4I2PA 4LD0A 3IG1A 1TK5A 3NF8A 2YV0X 2OPRA 4FJMA 1LW2A 3NF9A 4JRPA 4H8KA 2G8FA 1NJZA 2P51A 1RT4A 4OPKA 2HVIA 1A5VA 5J2QA 4FLVA 4M3TA 4DTSA 3G0ZA 4DTXA 3HYFA 1RDAA 4AILC 4FJ5A 4LSLA 3M8QA 5I42A 3LWMA 1KVAA 1ZBLA 3RMAA 1XI1A 4DFMA 3OYHA 4HUGA 3V81A 4NYFA 4F3TA 4CJUA 4E3SA 4B9NA 1L3TA 2YNGA 4CFDA 1KLNA 3KD5E 4DSIA 4BWMA 1WAFA 2OPSA 3AV9A 4DMNA 1C1CA 1RTJA 3HSTB 3PO5A 4F2RA 5HRPA 4ID1A 4OPJA 1NK4A 3U3YA 3O4QA 1SL2A 1X9SA 4IBNA 4CJWA 3KTQA 4M3YA 4M41A 3KLIA 2LSNA 4CEAA 3TABA 4FVMA 5JS2A 4CJFA 4K8ZA 4E7KA 1WSEA 2ITGA 2QKBA 3LAMA 3K5NA 2F8TA 4EZ6A 2KTQA 3ZT2A 2PY5A 2HHTA 4NCBA 2VG7A 4JLHA 2O4GA 3PX4A 3NGYA 2XRIA 2D0AA 3AO4A 4E7JA 4Z4EA 1C0MA 1B9FA 4CHQA 1SL0A 4HUFA 4FM0A 5CZ2A 4PUOA 3I0RA 2P5OA 1Q9XA 4QOZB 1WSFA 3AO3A 3MEEA 1CZBA 3HJFA 4FM1A 4DTJA 4CESA 4DU3A 4BDPA 3V1RA 3HPHA 5K14A 3QEXA 4CJQA 3QLHA 5CYQA 3ZT0A 5J2NA 1F21A 1FKOA 3DLEA 4NYNA 4B8AB 1UOCA 1T05A 4KI6A 4KFBA 4M42A 3SV3A 2OPQA 4FLWA 4DTOA 2DY4A 4B3OA 3SZ2A 3RR7A 3DRSA 3NF6A 3HVRA 4CF2A 1JLQA 3V1OA 1XC9A 2IDOA 5CYMA 3NGIA 4W5OA 4M3WA 3ZSVA 2KFNA 3AVLA 3OYAA 4O44A 2XY5A 1Y97A 2ATQA 4QAGA 3OYMA 4B9MA 4RW7A 3OYCA 2ZE2A 4CGDA 2FBTA 4E89A 3RMCA 4CHZA 1HPZA 1A5WA 3ZT1A 4FK2A 3K59A 4FJLA 4M3XA 4CGIA 4CIFA 1ZBFA 4B9LA 1U04A 2YNHA 2OPPA 5DK5A 4CHNA 5FRNA 4DTRA 1TK0A 1IKWA 4CJ4A 3PUFA 1G15A 4CF8A 1SL1A 3KLFA 3P83D 4LY7A 3KLHA 3KLGA 4DLEA 3TAEA 3ZSOA 3RRHA 3KLEA 4KREA 3DOKA 1S1WA 4KO0A 3A2FA 3OYBA 3S9HA 1ZBHA 5KRSA 3SI6A 1X1PA 1RBSA 4FZXC 1HJRA 3DYAA 1TKTA 2XO7A 4CF0A 1C6VA 4PY5A 1HYSA 4H4OA 3F73A 5T7BA 3C94A 4B9TA 3NHGA 3HP6A 1L3VA 3OJUA 1EX4A 4ZTFA 4DQRA 3DLBA 5E41A 3B6OA 5HLFA 2GV9A 1QHTA 3QEIA 1RT6A 3AVMA 3PV8A 4CEQA 1Q8IA 3V4IA 4OKJA 4TSXA 4N56A 4DTNA 1YTUA 4EP5A 3AVCA 4B9UA 1BISA 1EXQA 2X6NA 3UIQA 1IH7A 1Q9YA 1K6YA 3MECA 4CEFA 1GOCA 3AA3A 1CXUA 1JLEA 1JXBA 1BCMA 4CEDA 3SNNA 1DLOA 3RMBA 2PZSA 3CYMA 4E7IA 4FJ9A 1TKZA 1VSLA 4Z4FA 3HO1A 2ETJA 4CJRA 4RW6A 3QNOA 4HVJA 1WSGA 3VQPA 2DTUA 3HT3A 4G1QA 2EX3A 3TR8A 3AVIA 4LH4A 3OS1A 4C8OA 1BIUA 4DWIA 3AVKA 1WSIA 3LP1A 3WNFA 4CERA 5KI6A 1KFSA 4C8MA 1HRHA 3WNHA 4KPYA 1SKSA 3FFIA 3EZ5A 3ZCMA 3ULDA 1NJWA 1S9GA 4CEBA 3SQ0A 2WOMA 1JLBA 1LAWA 3L8BA 5J2PA 3MXIA 4DU4A 3LP3A 3CG7A 3NFAA 4IG0A 4CHOA 4W5NA 1JKHA 1RT5A 2VWKA 1BCOA 3B6PA 1HNIA 3ISNC 4DTPA 1TVRA 1DTQA 1L3SA 3P5JA 3U3GA 1T03A 3LAKA 1TL1A 3OVNA 2Q3SA 3LP0A 4FM2A 2FC0A 4O55A 1MU2A 1QE1A 4KTZA 4OVLA 3ZSXA 4FLTA 1U49A 4O4GA 4H4MA 3NDKA 3TARA 1VSMA 1HQUA 3MXJA 4CK3A 3CQ8A 3SUOA 1L5UA 1JXEA 4DSKA 3QEPA 1ZYQA 1JL1A 5KGWA 5SZTA 4CIGA 3TAFA 2G8VA 4UQGA 1RCHA 1DTTA 1XWLA 1S6PA 4Z0UA 4KTQA 4FJKA 1NOYA 1QQCA 4OGCA 3PX0A 4CF1A 3VQ7A 3BDPA 4CGGA 3KKRA 1N5YA 4F3OA 2HHSA 1IKYA 2D5RA 3OY9A 3QESA 4CHPA 4DQSA 3TAPA 2EHGA 4C8KA 2D0BA 3V9UA 1KCFA 4J2AA 1NJYA 1A5XA 1ASWA 4FW1A 3LWLA 4KAZA 3OYFA 4BE1A 3VQDA 4E19A 1NK5A 4FZZA 4BE0A 3ZSZA 1BI4A 3MAQA 4KKOA 1D8YA 5HP1A 3DOLA 3DMJA 1W0HA 4OJRA 3ZSRA 1NK9A 2YKNA 2WONA 1QSSA 3LPTA 3F9KA 4R5PA 1KSPA 4IFYA 4RW8A 4CGFA 3H08A 5J1EA 4FZYA 5FROA 2NUBA 4FJ8A 2Y1JA 4DQQA 4XIUA 1VRUA 4IG3A 3JSMA 4DFJA 4DU1A 3ZT4A 4FW2A 3HXMA 1BHLA 3VQEA 4E7HA 4DG1A 3RWUA 1JLCA 3DLHA 1NOZA 2B4JA 4FLYA 5HROA 3SPZA 2I5JA 2X78A 4BE2A 1NKEA 4F4KA 3M8PA 2PYLA 2JGUA 4M3ZA 3NH2A 3QNNA 4ZTJA 1S5JA 1N6QA 3OS0A 4MFBA 3V1QA 3U6FA 4ZHRA 1YVUA 3KK2A 2YNIA 2R7YA 3AVHA 3IAYA 1UWBA 2RF2A 3VQAA 3HPGA 4BDYA 4CE9A 3T19A 1KVCA 1JLGA 1L3UA 1BQNA 4EZ9A 4FLZA 4QCLA 5C24A 4CGHA 2XHBA 2VG5A 2QKKA 3AVBA 4ELVA 4FJGA 3EY1A 5C25A 4JRQA 1VRTA 4ID5A 1I39A 3HPOA 4IFVA 3E01A 1C0TA 5KTQA 1IKVA 3MEDA 4DSFA 4CEZA 3DRPA 1NKBA 4FJIA 2QK9A 1J54A 5HRNA 2E4LA 4BDZA 4KB1A 3VQ6A 1RTIA 3DM2A 1BL3A 3S3OA 3OYLA 4F2SA 3K2PA 5FRMA 1UA1A 2OZMA 4OGEA 3KKSA 2OZSA 4OKEA 3L2RA 4CJPA 1S1TA 3SJJA 2BGGA 2KFZA 3TWHA 4FLXA 3ZSYA 3QEWA 2AJQA 1JL2A 4I9LA 3ZT3A 4B9SA 4FYDA 4M3RA 1TL3A 2RPIA 2RKIA 1SUQA 3QERA 3ALYA 4L8RB 1RT3A 4CIEA 3IS9A 1T7PA 3SV4A 4Z4CA 1C1BA 4GW6A 3CM6A 4ELTA 4W5QA 2HHUA 1WN7A 4AHCA 3VA3A 1D9FA 1JLFA 4DF8A 3L2QA 1WAJA 3O3FA 1NK0A 3SCXA 4MQ3A 2VWJA 4PA1A 1S6QA 2X6SA 5HRSA 2IAJA 3KK3A 1KTQA 3CFPA 3AO1A 3OYGA 1BIZA 3K57A 3NCIA 4KI4A 4C8NA 4KHYA 4KHNA 1B92A 2IOCA 4HHTA 2HW3A 2KZZA 3AA2A 1TAUA 2GBZA 1B9DA 2KZMA 3AO5A 3K5MA 4IKFA 1RBVA 2D0CA 4DS5A 1BI4B 4NCGA 4CFAA 1WNSA 2FBYA 4CJ3A 1I3AA 1RBRA 2VG6A 3D0PA 1KLMA 3MEGA 1RBUA 3O3HA 3TAQA 4AHVA 4BACA 1X9WA 3QIOA 4YFUA 2FBXA 4DLGA 4W5RA 4FJJA 3G10A 3LPUA 4LH5A 4KHQA 2YHAA 2PYJA 3V6DA 2DFHA 2IC3A 4EP4A 3CFRA 3NBPA 5SWMA 3DI6A 1ITGA 2HNYA 3I0SA 3T1AA 4B08A 5I3UA 1TK8A 2HNDA 4FK0A 3KD1E 2B5JA 1NK8A 3C6UA 3SUPA 4AHRA 4IDKA 5HBMA 3EYZA 1LV5A 1LWFA 4AHSA 1UAXA 1UA0A 4J2EA 3L2UA 3HM9A 5FDLA 1O1WA 3K58A 1RTHA 4Y1CA 3QETA 2YNFA 1WSHA 4KTWA 4KV8A 3OS2A 3VQ5A 4JS4A 4CK2A 5KGXA 1CZ9A 1NKCA 2OYQA 2HHQA 4F8RA 5J2MA 3VN5A 4JS5A 2G8UA 4K8XA 4CK1A 3CFOA 3SQ1A 1W9HA 3IRXA 1EKEA 5KRTA 4FXDA 4I2QA 2F96A 3BGRA 4AH9A 4HTUA 3VQBA 3C95A 4NCAA 4PWDA 2X74A 2DFFA 1U48A 3HL8A 1LWEA 4AHTA 1ZBIA 2W42A 2G8IA 2HHXA 4GMJB 3SPYA 1KVBA 2O4IA 4DS4A 2HMIA 1FXXA 1HQEA 2ZQBA 4CHYA 3SUQA 1RTDA 1BQMA 1RDCA 3DLGA 3KIOA 3NF7A 3TANA 5DMRA 2HHWA 4N76A 4DQIA 2E6LA 4CJKA 2Z1IA 3T3FA 1RBTA 3L2VA 4E1NA 2E6MA 2BE2A 4LSNA 3HVTA 4OLBA 3K5OA 2DFEA 4CF9A 3ZSQA 5C42A 3OYNA 1HYZA 4DTMA 4Z4HA 1XHZA 1SKWA 4FCYA 2F8SA 3LZIA 4CEEA 2QXFA 1RILA 2XY8A 4DFPA 4HUEA 2Z1HA 3AVNA 3O4NA 4CFBA 4DFKA 1VK0A 3DLRA 2G8WA 4CEOA 4DSLA 4OLAA 1WLJA 3K5LA 3NGZA 4AHUA 3SYZA 4GVMA 4Q5VA 1CLQA 2G8KA 3RR8A 3NE6A 4RG8A 2ZD1A 3VQQA 2JLEA 1RT2A 3WNGA 4CJ5A 4N47A 4KHUA 3OYKA 1Z25A 3V9ZA 1D5AA 4Q0BA 1QSLA 4DTUA 2YKMA 3V9XA 2HVHA 3TI0A 1C0UA 4Z4GA 3VA0A 3LANA 3TAMA 1WSJA 1R0AA 2YHBA 2IS3A 3L3VA 3KJVA 1EETA 1J9AA 1HYVA 1RDBA 3DRRA 1NJXA 1NK6A 4M3UA 4KHWA 5JS1A 5EU7A 1JLAA 3AVAA 3LALA 4M45A 3P1GA 3PX6A 1SV5A 4CFCA 4O5BA 1YTAA 4W5TA 3JYTA 1U47A 4KRFA 4CJTA 3AA5X 3ITHA 3SQ2A 2BANA 3RTVA 4FJNA 1QSYA 4FJXA 4N5SA 4FJHA 3O3GA 3QIPA 3AO2A 4BWJA 4HCBA 4J2BA 3NH0A 4CJLA 1EP4A 3D45A 1NK7A 2RN2A 5HRRA 1LWCA 3SQ4A 2KQ2A 1ASVA 1HNVA 4O0JA 3QEVA 4E0DA 1FKPA 3PO4A 1LAVA 4C8LA 1KFDA 4PQUA 3AVJA 4B8CA 3KK1A 3VQ8A 4HCCA 3PY8A 1RDDA 3S3MA 4FJ7A 1S1UA 1RT1A 1RT7A 1Z26A 1TV6A 4DSJA 1TAQA 1LW0A 4CJEA 1VSIA 3V9WA 4CJVA 3S3NA 4Z4IA 3I8DA 1VSJA 4WE1A 1HMVA 4CECA 3OYIA 4FLUA 1BGXT 2GUIA 3NH1A 1U45A 3RMDA 1VSDA 1RNHA 5CZ1A 1VSFA 4CCHA 5D3GA 1S1XA 1REVA 2Z1GA 4FK4A 2IGIA 1J53A 4I7FA 2FBVA 3TAGA 1J5OA 1ASUA 3AVGA 1C1AA 1S1VA 3L3UA 4DSEA 3VQ9A 3L2WA 1IG9A 3QO9A 4E1MA 2B6AA 4KHSA 4Y1DA 1QS4A 1U4BA 1D9DA 1CXQA 2Y1IA 1X9MA 4O0IA 2KW4A 1GOBA 3ASMA 4J2DA 3WNEA 3OYDA 3SUNA 1YT3A 3LZJA 2G8HA 2A1RA 3C6TA 4RW4A 1FK9A 3NAEA 2XY7A
chains in the Genus database with same CATH superfamily
1XHXA 4RW9A 5F0XA 4CGJA 3LL3A 2XY6A 4UY8O 3THVA 3GL1A 3OJSA 4YOUA 3VF6A 4DQPA 3TSUA 2WBNA 1IO2A 1VSEA 1JJ2M 1FJGK 4JI3K 1TKXA 1N36K 2W41A 2BDPA 2QWRA 3W3DA 1K73O 1NNEA 4N41A 2P9IA 2P9SA 3ZSWA 3M8RA 4YY3K 1Z6RA 4LD0A 1TK5A 1ATNA 1NJZA 2HVIA 4DTSA 5AQHA 4FJ5A 1RDAA 4XH5A 1TUYA 4LSLA 2HBJA 5I42A 2O8BA 3RMAA 3M1FA 3OYHA 4HUGA 5TKWA 2NRWA 4CJUA 1L3TA 4LF7K 4XH1A 4CZGA 1WAFA 5EY4A 3E9PA 2VQFK 4OPJA 1NK4A 3IUCA 3U3YA 1RFQA 2HBLA 3EKUA 4CJWA 4CVNE 3FZKA 3JAMO 2QKBA 2P9LB 5KPRA 2KTQA 2PY5A 2HHTA 2VG7A 1MA9B 1KXPA 1C0MA 4PUOA 3SMSA 2P5OA 4QOZB 3MEEA 3HJFA 4FM1A 2AP1A 1VAZA 4BDPA 4JD2A 4JI5K 1Z05A 4BR7A 4NYNA 1UOCA 5EXWA 4KI6A 4KFBA 4M42A 5I9EB 4CJ7A 1VQPN 3RR7A 3V1OA 3WQTA 4W5OA 3K9KA 4M3WA 3VGKA 4O44A 3CJ1A 3G4SN 4CBUA 3OYMA 3PSFA 3P38A 2ZE2A 2QWQA 3O08A 2FBTA 3ZEUA 4E89A 4CHZA 1HPZA 4FJLA 1M90O 4DKWA 1ZBFA 1U04A 4CHNA 4CZHA 3IDHA 4CJ4A 3KLFA 3WT0A 4LY7A 3KLHA 4A2BA 4DLEA 4KREA 3DOKA 1S1WA 2P9KA 3PIPL 1X1PA 1RBSA 3VTIA 4CZEA 1C6VA 5BRHA 2E2PA 1C0GA 1W97L 3O5BA 3HP6A 3BUZB 3OJUA 5LL6Z 4GKJK 3DLBA 3T1HK 2V7YA 5AZIA 3V4IA 4OKJA 4N56A 4BC5A 3AVCA 2YX6A 1BISA 1NWKA 5FPEA 3EKSA 3UIQA 1E4GT 4GV6A 2WC9A 4CEFA 1CXUA 1YJNN 2RE2A 2PZSA 4H5TA 3CYMA 3HO1A 1NGIA 4RW6A 4HVJA 3VQPA 3HT3A 2EX3A 4C8OA 1BIUA 3DXMB 4C8MA 1HRHA 2O8EA 1SKSA 1P90A 3C0BA 4CEBA 1TYQB 4DU4A 2Q36A 5AQZA 1RT5A 3TTDA 3ISNC 4DTPA 1VQ8N 3L0QA 2FF6A 3ENOA 3OVNA 3H46O 4FM2A 1N34K 4KTZA 1OVYA 3R3LA 3RSEA 1VSMA 3LM9A 1JXEA 3EE9A 3QEPA 1ZYQA 4LFAK 3MDQA 5KGWA 5C10A 3TAFA 5BN9A 3E1YA 4UQGA 1RCHA 1NOYA 2O8FA 1N5YA 2NRXA 3OY9A 3TAPA 1NMNA 1KCFA 1ASWA 3VEZA 3OYFA 4YORA 3VERA 1NK5A 4KKOA 4PL8A 1W0HA 1NK9A 1MDUB 3J7AP 3H45C 4R5PA 4KHPK 1H1VA 4CGFA 3VEYA 1VRUA 4DFJA 3WXJA 3UE5A 4DU1A 2F7TA 4FW2A 4LFCK 4C1NK 4DG1A 4BQZA 3RWUA 4FJ8A 1OVQA 4F4KA 4H0PA 2JGUA 3CC2N 3MMVA 3V1QA 4U7BA 3KK2A 2YNIA 3IAYA 2RF2A 4CD3A 4BDYA 4CE9A 4C23A 1JLGA 1BQNA 4G9ZA 1K8KA 4CGHA 4A57A 2VG5A 5ELZA 3VETA 4WQ5C 1I39A 4IFVA 3VMFB 3W0LA 4EFHA 5E84A 4DSFA 4H5WA 2QA4N 3DRPA 1NKBA 2QK9A 1NGFA 1J54A 3BY5A 1OH5A 3DM2A 3S3OA 1BL3A 5AQPA 1UA1A 1CZAN 4M63C 3MN9A 3L2RA 4CJPA 4WQ5A 2AJQA 1HNXK 1TL3A 2UXCK 3ALYA 3MN7A 4L8RB 3TSQA 4PHTX 4K0KK 3H1QA 2Q31A 3VA3A 3MWTA 1JLFA 4PL7A 4BVPA 1NK0A 4C1NI 4MQ3A 4E1JA 1S6QA 4A5BA 3CFPA 4KHYA 1BIZA 4KI4A 1TAUA 4KHNA 2IOCA 5ADXH 3AA2A 3K5MA 4IKFA 1BI4B 2FBYA 1I3AA 4AM7A 4IJAA 4KHQA 2YHAA 4BRLA 2IVNA 1Q86O 3V6DA 2O8DB 3CFRA 3WEEB 1ITGA 3T1AA 2HNDA 3FR0A 3C6UA 4AHRA 1LWFA 1UAXA 3UKRA 4I6MA 1UA0A 1R59O 4K42A 3CHWA 4DR3K 1WSHA 4KTWA 1NKCA 4GVEA 4A59A 1IV0A 4JS5A 3M3ZA 4JK9A 4FXDA 4AM6A 3BGRA 2NLXA 4HTUA 1NG9A 5LJVA 4PWDA 2DFFA 3ZYYX 1U48A 4AHTA 2W42A 4GMJB 3ENHA 2HMIA 4CHYA 1RDCA 4IWVA 4N76A 2JWLA 1DKGD 2Z1IA 3N4PA 4FWQA 3L2VA 1KD1O 1ZBSA 4LSNA 3ZSQA 5C42A 1HYZA 1SKWA 4FCYA 2QXLA 2XY8A 4JKGB 3PSIA 2Z1HA 3AVNA 3ATVA 3DLRA 2OCEA 4OLAA 1BA1A 1WLJA 4AHUA 4BVOA 4Q5VA 3RR8A 2HOEA 3VQQA 2JLEA 3WNGA 2P9NA 4KHUA 4N47A 1D5AA 1QSLA 4BRAA 4DQ8A 3P39A 4Z4GA 3ID6A 3TAMA 1JCFA 2YHBA 2IS3A 3K9JA 3L3VA 5M1FA 3KJVA 1R0AA 2G8IA 3VGLA 1N8RO 1JLAA 3AVAA 3LALA 3P1GA 1YTAA 4KRFA 1YF5L 5F2RA 4FJXA 4H0OA 4BGAA 5FPNA 2Q1NA 4HCBA 2HMPA 4X62K 5HRRA 1HNVA 1LAVA 2CGKA 1KFDA 5BREA 1XC3A 3H3OB 1Z26A 1TV6A 1BWFO 1LW0A 3J7ZO 1VSIA 3BZKA 4CJVA 3V9WA 3S3NA 3OYIA 1HMVA 3CJAA 4FLUA 2GUIA 1KQSM 3RMDA 1VSDA 5CZ1A 1S1XA 5AQVA 3P4IA 3ULEB 2IGIA 2D1KA 4I7FA 2ZGYA 1IBMK 1ASUA 2F9TA 2E88A 3THWA 3L3UA 4JI4K 4KHSA 4Y1DA 2NRRA 2KW4A 4J2DA 3WNEA 3OYDA 4V19S 1YT3A 3WXKA 3VF4A 1FK9A 4YOXA 1VQMN 5GIPA 1S9EA 4ICLA 3CXCM 5CY4A 2A1SA 4GNIA 4BC3A 1GOAA 3CCSN 1QTMA 3O80A 3OYJA 3RRGA 3HK2A 1HNWK 4HWIA 3DLKA 5AQTA 2QEXN 2OANA 4DF4A 4WFNL 1GLCG 4E7LA 1T44A 2VWBA 4ELUA 3CPEA 3CM5A 2HSTA 4FWOA 4OKKA 3HRGA 3D2EB 2GELA 1VQ5N 3NF8A 2YV0X 5AZJB 2V51B 4JRPA 2G8FA 5EX5A 4AILC 3DLLL 4H5VA 1KVAA 5F1XA 5GADP 5KPZA 2ZJPL 4DFMA 4NYFA 4E3SA 4B9NA 1BO5O 2YNGA 4CFDA 1S22A 2I7NA 2ZM6K 1RTJA 3HSTB 4ID1A 3O4QA 4J8FA 3KTQA 4M41A 3GG4A 5AR0A 4DV0K 5JS2A 4FOEA 2ITGA 3LAMA 3VPZA 3K5NA 3K0SA 1KC8O 4B1UB 1FW6A 4A62A 4NCBA 4JLHA 1IBKK 1O13A 3PX4A 2XRIA 1VQLN 2Q97A 4HUFA 2A41A 4LF9K 1QZ5A 5LMNK 3CCQN 4DTJA 4CESA 3V1RA 3HPHA 5K14A 5GAEP 3PIOL 5FPMA 3LDQA 3QLHA 3SAFA 5J2NA 1YVNA 4B8AB 2WUSA 5ADXA 3NVKA 4NXNK 4HTLA 1G99A 4FLWA 4DTOA 5AFUH 3MN6A 3HTVA 5LY3A 3NF6A 4FWPA 4JHDB 1NM1A 4CF2A 2IDOA 3NGIA 3ZSVA 2KFNA 3OYAA 5BPMA 1Y97A 3WXMB 4B9MA 4RW7A 3OYCA 2UUCK 4CGDA 4BC2A 1A5WA 4DR1K 3ZT1A 4FK2A 3K59A 4CGIA 1WBBA 4DV5K 4BRHA 2YNHA 5FRNA 3DJCA 1KAXA 3CJBA 3SLCA 1IKWA 3PUFA 5M1QA 1SL1A 4H5NA 3A8YA 3P83D 3ZSOA 3M6GA 3C7NA 3KLEA 4DV6K 3A2FA 3OYBA 3OHRA 4CZKA 5KRSA 3KK7A 4MO4A 2JWKA 3DYAA 1TKTA 3I56N 2NRTA 3F73A 3DAWA 5T7BA 3C94A 4B9TA 5HLFA 1HKCA 2GV9A 4DR4K 1YIJN 1RT6A 1X3NA 2F4VK 1Y64A 4QS8A 4TSXA 3CCEN 4B9UA 1LCUA 2WTUA 5HL7L 1Q9YA 3CCVN 2E5LK 3NVMA 3AA3A 1XNRK 1JLEA 2GX9A 1SZ2A 1JXBA 3FZMA 4IFEA 4CEDA 3RMBA 3O4WA 1SQKA 2AA4A 4IZ9A 1VSLA 4IXCA 4FJ9A 2DTUA 3BP8A 2DPNA 3F5TA 3AVIA 3ID8A 2ITMA 3WNFA 1WSIA 3VEOA 3CCLN 5KI6A 4KPYA 3O1BA 3ULDA 3ZCMA 1S9GA 1LAWA 3CG7A 3NFAA 4YOYA 2GWJA 1JKHA 3D2FA 3P5JA 2UUBK 1W2BM 2Q3SA 3LP0A 2FC0A 3VOVA 4H4MA 4JKFA 1HQUA 1IG8A 4CK3A 3CQ8A 1L5UA 4DSKA 1JL1A 5SZTA 4ILGB 4KTQA 5DM6L 1S6PA 4WF9L 1YHQN 1QQCA 1M1KO 1V4SA 4BRIA 1HR0K 3I33A 3VQ7A 4MLEA 4CGGA 1N32K 3CPWM 3KKRA 2D4WA 4IO9L 2HHSA 3VTHA 1IKYA 3FZHA 3A5MC 5AQKA 3G25A 3CF5L 3BEXA 2EHGA 2D0BA 4DV7K 4BE1A 1J5EK 3TU5A 5HP1A 3DMJA 5DM7L 4OJRA 2YKNA 2WONA 1QSSA 1U2VA 3LPTA 3F9KA 4RW8A 4FO0A 5JVHL 2E8AA 4WQ4C 4FZYA 4DQQA 4IG3A 3O1WA 3JSMA 3ZT4A 3HXMA 1BHLA 4E7HA 1JLCA 5HROA 3SPZA 2I5JA 4BE2A 3M8PA 2PYLA 1IBLK 4ZTJA 3QNNA 1S5JA 3THYB 4ZHRA 5LJWA 3S41A 1UWBA 2OTJN 1GLLO 1KVCA 4WQ4A 3SJHA 2W6LA 1L3UA 4QCLA 3AVBA 3EY1A 4JRQA 4ID5A 5AQLA 5KTQA 3MEDA 4CEZA 2YCHA 4JK8A 4BRNA 2KHOA 3K2PA 2OZSA 3SJJA 1DT9A 4K25A 4AF1A 2BGGA 4FLXA 4NLCA 2H3GX 1JL2A 4B3SK 2RPIA 2RKIA 4B1VA 1RT3A 1NGBA 1OH8A 3IS9A 1T7PA 1SAZA 4O5FA 4MDAA 3DXKA 1WAJA 3O3FA 3SCXA 3HM8A 3U9DA 4CZMA 1KTQA 3NCIA 1EWRA 2HW3A 2Q0UA 5AQSA 2FXUA 2KZMA 4DUZK 3SAHA 1SS6A 4AHVA 1EO1A 1ATSA 3QIOA 4FJJA 1NLVA 2VCPA 3G10A 3LPUA 2PYJA 5AFUA 2DFHA 3KZBA 4B08A 2HNYA 2O8CB 1TK8A 3AARA 2B5JA 1NK8A 3SUPA 4IDKA 5HBMA 1LV5A 4AHSA 1Q82O 2GUPA 4J2EA 3L2UA 3HM9A 2NRHA 2P9PA 5FDLA 1RTHA 4Y1CA 3QETA 3UKUA 2YNFA 4FWRA 4KV8A 3OS2A 2OYQA 3VQ5A 1U6ZA 2IVPA 1BOTO 3O8MA 3KWGA 1NGDA 3CD6N 4I2QA 2F96A 4JK7A 2EWSA 1YJ9N 1YJWN 3C95A 2GWKA 2X74A 2HHXA 1QQOA 3SPYA 2P9UA 2O4IA 1BA0A 1FXXA 3SUQA 2ZQBA 1BQMA 3KIOA 5CE3A 3T3FA 2VQEK 2QWMA 2BE2A 4DR5K 3JS6A 5AQIA 4DTMA 1XHZA 4R79A 3SBTA 3H6EA 4M7YA 4HUEA 2CGJA 4QS9A 4DFKA 4DSLA 3CI5A 1S72N 3NGZA 1YXQA 1CLQA 2G8KA 2QM1A 1VHXA 1NGEA 1RT2A 4CJ5A 4A2AA 1Z25A 4DTUA 2HVHA 1WSJA 4M3UA 1HYVA 1NJXA 3DRRA 4ISGA 3FZLA 4CFCA 4O5BA 1U47A 3SMPA 3I55N 3MX2A 3ITHA 4FJNA 1QSYA 4N5SA 4U67L 3O3GA 1NBWA 2FSKA 1YITN 3NH0A 4H0XB 3D45A 5BRFA 1NK7A 2KQ2A 4O0JA 2FSJA 1P8ZA 4C8LA 3ZX3A 4B8CA 4HCCA 1RDDA 4JAXA 1S1UA 3LM2A 4F9OA 2VYPA 1TAQA 4Z4IA 2PBDA 3THXB 5FLXO 3AAPA 3TTFA 1U45A 2V52B 2P9LA 4CCHA 5D3GA 3QMLA 2Z1GA 1RGIA 3VEXA 2GEMA 1WB9A 3TAGA 4DV2K 3O9QA 5AQQA 1IG9A 4B9QA 3QO9A 1QS4A 3FE1A 1CXQA 4B1ZA 2KKZA 1NGJA 2G8HA 2A1RA 3C6TA 4RW4A 4H03B 2XY7A 4DV4K 4DR2K 3OYEA 3AA4A 2Z1JA 1VSKA 1WBDA 3ZETB 5AQXA 3J81O 2I7PA 5JLHA 4ISFA 1T8EA 4I9QA 2HHVA 2UXDK 4AQYK 1IKXA 2HHHK 4H0TB 4JKDA 4JYAK 2P1JA 2HNZA 3IKMA 3QINA 1OKJA 2P5GA 1VSHA 2HF3A 2OPRA 4PKHA 1LW2A 1XUPO 2P51A 4OPKA 1EQYA 4M3TA 5J2QA 4DTXA 3HYFA 2HF4A 3M8QA 1ZC6A 1GLAG 3N4QA 4OO1J 3V81A 3A5OC 1KAZA 1KLNA 4DSIA 4BWMA 3AV9A 4DMNA 1QVGM 1SL2A 4M3YA 4IBNA 4CEAA 2LSNA 3QB0A 4FVMA 4CJFA 2F8TA 2QTDA 4EZ6A 3ZT2A 2FLOA 3CIPA 3NGYA 3AO4A 4E7JA 4IO8A 4Z4EA 1B9FA 5TKYA 5CZ2A 3I0RA 4YOTA 1CZBA 4FWNA 5GAGP 3DXMA 1DEJA 3QEXA 2ASOA 4CJQA 5CYQA 3ZT0A 3DLEA 1T05A 3SV3A 1RDWX 3VEVA 4LFBK 3SZ2A 1TYQA 3DRSA 1VQKN 1NGCA 1XC9A 1VQNN 3AVLA 4KH6A 1XMQK 1ESVA 2XY5A 2ATQA 4EHTA 2HBKA 2W40A 4CW7B 4M7XA 1LOTB 1K9MO 5JLFA 4M3XA 1BDGA 5DK5A 2P9IB 2OTLN 5HOOA 2QW9A 2CH5A 1G15A 4JI7K 3KLGA 3TAEA 5C2DA 1HKGA 4KO0A 4JKCA 1ZBHA 3CCMN 4FZXC 1HJRA 2O8BB 3HSCA 2XO7A 4CF0A 4RCHA 4PY5A 4H4OA 3A5LC 3NHGA 1L3VA 1EX4A 4ZTFA 3VF2A 5B8HA 2IIRA 3B6OA 5E41A 1XNQK 3QEIA 3AVMA 4A5AA 2ZWHA 5BPLA 1YTUA 4BY9C 5A2QO 1EXQA 4MO5A 2X6NA 5KPTA 1IH7A 1K6YA 1GOCA 4E7IA 2Q0RA 1TKZA 4FPAA 3BF1A 4CJRA 2VGMA 3VESA 4IOXA 1WSGA 4G1QA 4LH4A 3AVKA 3LP1A 4JD2B 1KFSA 3WNHA 3O9UA 3R1XA 3C6AA 3CC4N 3FFIA 3EZ5A 1NJWA 1BG3A 4A61A 4LF4K 1QHAA 2WOMA 1JLBA 5J2PA 3A5NC 3LP3A 4IG0A 4CHOA 3B6PA 1BCOA 4EIAA 1L3SA 2A40A 1TVRA 1DTQA 4IJNA 3R9PA 1T03A 4BRGA 3J8AA 4O55A 1MU2A 2E20A 3ZSXA 1U49A 4O4GA 1JCGA 3U8XA 3MXJA 3ZEUB 1HPMA 3G6EN 2QWNA 1VQ4N 2G8VA 4Z0UA 3PLAA 3D6RA 5AQGA 3PX0A 4CF1A 4BR2A 2YJFA 4CHPA 4DQSA 2P9KB 4C8KA 2UUAK 4BGBA 4ILJA 1NJYA 4FW1A 4ILHA 4BROA 4CZIA 1BI4A 3MAQA 1D8YA 3DOLA 1GLDG 5MLCQ 3ZSRA 1QVFM 5AQYA 1KSPA 5AZIB 5J1EA 3R8EA 2KLAA 3Q7BA 3VQEA 2O8DA 4BG8A 1NOZA 3WEEA 3GE1A 5M1KA 1NKEA 3CMAN 5AQNA 5GAHP 4CD1A 4QS7A 4BQLA 3OS0A 4MFBA 5JVGL 1YVUA 3VQAA 3T19A 4EZ9A 3OA9A 5C24A 2XHBA 1C0FA 4ELVA 4FJGA 5C25A 2O8EB 2UYTA 1HLUA 5M1OA 5IT9O 1OH6A 4BDZA 3VQ6A 1V4TA 2QI2A 4JI0K 4FPBA 2KFZA 3TWHA 3ZSYA 3QEWA 3RSEB 4B9SA 5C12A 2UU9K 1HJOA 3SK3A 3QERA 4O8UA 4DV1K 4JKGA 3FFKB 1C1BA 2ASMA 4ELTA 1WN7A 2O8FB 4FWSA 1D9FA 1T3VA 4DF8A 5M1PA 1I94K 2CH6A 3CQYA 1S3XA 2VWJA 3T69A 5AQJA 2A42A 3Q7CA 3OYGA 1B92A 4HHTA 2KZZA 2GBZA 1RBVA 4DS5A 4NCGA 4IDHA 1WNSA 1RBRA 3D0PA 3MEGA 3SBGA 3TAQA 2YJEA 4BACA 1HNZK 3OBWA 4DUYK 4Z94A 2IC3A 3NBPA 3DI6A 2GTDA 1VQ7N 3T7ZA 2VGNA 3EYZA 4FWKA 3T1YK 3K58A 1O1WA 4FOIA 1K8KB 4JS4A 4CK2A 1CZ9A 4WCEL 5J2MA 3VN5A 1QZ6A 2G8UA 3QICA 3ULEA 3SQ1A 2E1ZA 4LF8K 3IRXA 3O9SA 5KRTA 1N33K 3HL8A 1ZBIA 3MCPA 4DS4A 1RTDA 3NF7A 3A0IX 2HHWA 3TANA 4DQIA 2E6LA 4CJKA 5AJ3K 3J80O 2E6MA 5FPDA 4OLBA 2DFEA 4YOWA 4Z4HA 4BRMA 3LZIA 3L4QA 4CEEA 3O4NA 4CFBA 1VK0A 3U9ZA 3I8BA 3TSPA 4LF6K 3K5LA 3SYZA 3GBTA 3NE6A 4RG8A 3AAQA 4CZFA 3OYKA 3V9ZA 3MWPA 1GLBG 3V9XA 1C0UA 3D2EA 3CJ7A 4DR6K 4DV3K 4BRDA 1NK6A 1EETA 1J9AA 4EHUA 1RDBA 5AZJA 5EU7A 4M45A 4L3QA 2QWPA 4W5TA 1E3MA 3AA5X 4FJHA 4BWJA 4J2BA 4DCHA 2F9WA 4CJLA 1EP4A 4DR7K 2RN2A 3AGKA 1X9JA 1ASVA 1FKPA 1HKBA 3AVJA 2BUPA 3VQ8A 3PY8A 4FJ7A 1RT7A 3AY9A 4DSJA 4CJEA 4DB3A 3WXIA 4JKBA 3UKRB 4I6MB 3I8DA 2YHYA 3MN5A 1RNHA 1BUPA 2NZTA 3O6WA 3E9OA 1REVA 2E2OA 4DHYA 4JI1K 3D7EO 1YUWA 4YOVA 1C1AA 1YAGA 4DSEA 4BRPA 3VQ9A 1TUUA 2B6AA 4NB4A 1GOBA 3ENBA 4JV5K 3NAEA 4LC9B 4IOCL 3M8SA 4KB0A 3HP9A 2ZJQL 1ILYA 4K41A 1KRPA 3V9SA 4JHDA 2WFBA 3EL2A 4BR4A 1SKRA 3LDSA 3AVFA 3CQXA 3VQCA 2OA8A 4B1WB 1TKDA 3VQ4A 4JI6K 3BF3A 2HB5A 4CI6A 1ZBUA 5IWAK 3LP2A 1TGOA 3L4IA 1VQON 2P9NB 4B9VA 3MXMA 5AQMA 5E26A 5BRDA 4CJSA 4YNQA 4I2PA 3IG1A 2RHKA 1Q81O 4FJMA 3F9MA 2YHWA 3NF9A 4H8KA 1RT4A 4BRKA 1A5VA 4FLVA 3G0ZA 4JEPA 5EVZA 3LWMA 1ZBLA 1XI1A 3KHYA 5C2FA 4NLBA 4B3RK 4F3TA 3G71N 3FLCO 3KD5E 3M5RA 2OPSA 1YI2N 1C1CA 5KQDA 3PO5A 4WYBA 5HRPA 1NJIO 4F2RA 3CERA 3KVGA 1X9SA 1XMOK 2NNWA 3KLIA 4BR0A 4JKEA 3TABA 3O9RA 4K8ZA 4E7KA 1WSEA 1J6ZA 4MLHA 2O4GA 2D0AA 3IMXA 4CHQA 1SL0A 4FM0A 3THWB 4X66K 3QDKA 3E9LA 1Q9XA 1WSFA 3AO3A 4DU3A 2QWOA 3CMEN 1F21A 1FKOA 5KQ8A 2OPQA 2DY4A 3C6HA 4B3OA 5JMVA 4RTFD 1VQ9N 3HVRA 2QWLA 1JLQA 5CYMA 1MWKA 2BH1A 4QAGA 3NMUA 5AQFA 2ZF5O 3C65A 2NRZA 4PKGA 3RMCA 4CIFA 4B9LA 2OPPA 5LMUK 4DTRA 4H5RA 1TK0A 2Q2RA 3ZLJA 4X64K 4CF8A 1D4XA 2J4RA 3RRHA 4FSVA 3S9HA 3QBXA 3SI6A 1NU0A 1HYSA 3B8AX 4FL9A 4DQRA 1QHTA 2YI1A 3PV8A 4CEQA 1NMDA 1Q8IA 4YDUC 4DTNA 4EP5A 1NGAA 2BTFA 4H0YB 3MECA 3EO3A 3EE8A 4GY2B 1BCMA 3THYA 3TTCA 3SNNA 1DLOA 2YHXA 4CBWA 4Z4FA 3QFUA 2ETJA 3QNOA 2FF3B 4YDUA 3RVCA 4KH5A 3TR8A 3OS1A 4BC4A 3EN9A 4DWIA 4CERA 1GLFO 5BR9A 1GLJO 3MK6A 1IJJA 3OW2M 3LDPA 3VENA 3SQ0A 3L8BA 3JXUA 3MXIA 4OX9K 3J7YP 4W5NA 2HBMA 4EAHD 2VWKA 1HNIA 3E66A 4MDBA 4O8KA 3U3GA 3LAKA 1TL1A 3KWIA 1RDUA 1QE1A 4XH4A 4OVLA 4FLTA 5C0YA 3NDKA 3TARA 3SUOA 3WUHA 1BU6O 4GKKK 3OTOK 3DWLA 4CIGA 4CZLA 1DTTA 1XWLA 1NGHA 4GV3A 4FJKA 1QQMA 4OGCA 3BDPA 4F3OA 3HZ6A 2D5RA 3C7NB 3QESA 3V9UA 4J2AA 5GINA 3CCRN 1A5XA 3LWLA 4KAZA 3VQDA 4E19A 4FZZA 4KBOA 3MX5A 4BE0A 3ZSZA 3ZX0A 4OPHA 3LDLA 4B3MK 5BPNA 3H3NO 4IFYA 4BR9A 2NRVA 3WXLA 3H08A 3FGUA 5FROA 2NUBA 2Y1JA 4XIUA 3P31A 3AGRA 3ATUA 3HBTA 3DLHA 2B4JA 4FLYA 2O8CA 2X78A 1X3MA 4M3ZA 3NH2A 4CBXA 1N6QA 3CCUN 3O9TA 3U6FA 5BR8K 2R7YA 3AVHA 1QQNA 3HPGA 1Q18A 4FLZA 3MCAB 4JI2K 4BRCA 2W6KA 2QKKA 2P9SB 2ASPA 2D0PA 1VRTA 4PKIA 2PFUA 3HPOA 3E01A 1C0TA 4FWLA 1IKVA 4FJIA 1WUAA 4B3TK 5HRNA 2E4LA 4KB1A 1RTIA 4RWTA 3OYLA 4F2SA 3D2FB 5FRMA 2A6AA 3BZCA 2OZMA 4OGEA 3KKSA 4OKEA 2CGLA 1S1TA 4GV9A 4H0VB 2E2QA 4Y0WA 5CR4A 4I9LA 3ZT3A 4WFBL 4FYDA 1NGGA 4M3RA 1SUQA 3CETA 4BRFA 4CIEA 5JICA 3GDQA 3SV4A 4Z4CA 4GW6A 1VQ6N 3CM6A 3F2KA 4W5QA 2HHUA 4AHCA 3L2QA 2IVOA 1EWQA 4PA1A 2E2NA 2X6SA 5HRSA 2IAJA 5AQRA 3KK3A 3AO1A 3K57A 3LDNA 4LF5K 4C8NA 5C15A 4YHHK 1B9DA 3AO5A 2D0CA 4CFAA 4JKAA 3IFRA 4CJ3A 2VG6A 1KLMA 3UB5A 1RBUA 1U2VB 2V7ZA 4XEIA 1HUXA 3O3HA 1X9WA 4NXMK 4YFUA 2FBXA 3HI0A 4W5RA 3QFPA 3HOSA 4DLGA 4X65K 4LH5A 4EP4A 5GIOA 3GOIA 5SWMA 3I0SA 4ISEA 5I3UA 2A3ZA 5AQWA 4FK0A 3KD1E 1Q7YO 3THXA 3EEQA 4FVUA 4B1XB 3CC7N 4NO7A 2PAVA 5KGXA 4IEEA 2HHQA 4F8RA 4K8XA 4CK1A 3CFOA 1W9HA 1MWMA 1EKEA 1T6CA 4AH9A 3VQBA 1T6DA 1DGKN 4NCAA 1LWEA 3LDOA 1KVBA 4CZJA 1KAYA 3L6QA 1HQEA 5CHIA 4IOAL 3DLGA 3WQUA 5DMRA 1GLEG 3CCJN 1RBTA 4E1NA 3QBWA 2UXBK 3CJCA 3HVTA 3K5OA 3ZETA 4CF9A 4KH4A 3OYNA 2E1YA 5EOYA 2F8SA 2QXFA 1RILA 4JN4A 4DFPA 3R6MA 2A5XA 2G8WA 4FWMA 4CEOA 1K8AO 4JNEA 4GVMA 3DXKB 2ZD1A 4BG9A 1JCEA 4Q0BA 2YKMA 3CJ9A 5M1NA 5H1SQ 3TI0A 4OPAA 3VA0A 1XQSC 3LANA 3U4LA 5JS1A 4JI8K 4KHWA 3PX6A 2ZJRL 3OBYA 1SV5A 1E4FT 4JKHA 1HX1A 3EZWA 4BRQA 5BN8A 3JYTA 4CJTA 3SAGA 3SQ2A 2BANA 3RTVA 4BREA 1OH7A 3QIPA 3AO2A 5AQUA 3SQ4A 1LWCA 4E0DA 4BR5A 3QEVA 4PQUA 3PO4A 5AQOA 3KK1A 3S3MA 1RT1A 4K43A 3H1VX 1VSJA 2ZGZA 4WE1A 4CECA 1BGXT 2D0OA 2P9PB 3NH1A 3UKUB 3VGMA 2FSNA 1VSFA 4WFAL 4FK4A 1J53A 2FBVA 1J5OA 3VEWA 4B1YB 3AVGA 1WOQA 1S1VA 3L2WA 4E1MA 3FZFA 1U4BA 1D9DA 1ZXOA 4IEIA 2P9UB 2Y1IA 4O0IA 1X9MA 3ASMA 1ATRA 3SUNA 3LZJA 3HOTA 3TPQA 3ZX2A 1W7AA
chains in the Genus database with same CATH topology
1S9EA 1XHXA 4ICLA 3M8SA 4RW9A 3OYEA 3AA4A 2Z1JA 4KB0A 3HP9A 1VSKA 4CGJA 2XY6A 3V9SA 1KRPA 1SKRA 3THVA 5CY4A 3LDSA 2A1SA 3AVFA 3OJSA 1QTMA 1GOAA 3VQCA 2OA8A 1T8EA 4I9QA 1TKDA 3VQ4A 4DQPA 3OYJA 3RRGA 2HHVA 3HK2A 1IO2A 1IKXA 1VSEA 2HB5A 1ZBUA 3DLKA 1TKXA 2P1JA 1TGOA 3LP2A 4DF4A 4E7LA 2HNZA 2BDPA 4ELUA 3QINA 3CM5A 4B9VA 4N41A 4OKKA 3MXMA 2P5GA 3ZSWA 3M8RA 1VSHA 4CJSA 4YNQA 4I2PA 4LD0A 3IG1A 1TK5A 3NF8A 2YV0X 2OPRA 4FJMA 1LW2A 3NF9A 4JRPA 4H8KA 2G8FA 1NJZA 2P51A 1RT4A 4OPKA 2HVIA 1A5VA 5J2QA 4FLVA 4M3TA 4DTSA 3G0ZA 4DTXA 3HYFA 1RDAA 4AILC 4FJ5A 4LSLA 3M8QA 5I42A 3LWMA 1KVAA 1ZBLA 3RMAA 1XI1A 4DFMA 3OYHA 4HUGA 3V81A 4NYFA 4F3TA 4CJUA 4E3SA 4B9NA 1L3TA 2YNGA 4CFDA 1KLNA 3KD5E 4DSIA 4BWMA 1WAFA 2OPSA 3AV9A 4DMNA 1C1CA 1RTJA 3HSTB 3PO5A 4F2RA 5HRPA 4ID1A 4OPJA 1NK4A 3U3YA 3O4QA 1SL2A 1X9SA 4IBNA 4CJWA 3KTQA 4M3YA 4M41A 3KLIA 2LSNA 4CEAA 3TABA 4FVMA 5JS2A 4CJFA 4K8ZA 4E7KA 1WSEA 2ITGA 2QKBA 3LAMA 3K5NA 2F8TA 4EZ6A 2KTQA 3ZT2A 2PY5A 2HHTA 4NCBA 2VG7A 4JLHA 2O4GA 3PX4A 3NGYA 2XRIA 2D0AA 3AO4A 4E7JA 4Z4EA 1C0MA 1B9FA 4CHQA 1SL0A 4HUFA 4FM0A 5CZ2A 4PUOA 3I0RA 2P5OA 1Q9XA 4QOZB 1WSFA 3AO3A 3MEEA 1CZBA 3HJFA 4FM1A 4DTJA 4CESA 4DU3A 4BDPA 3V1RA 3HPHA 5K14A 3QEXA 4CJQA 3QLHA 5CYQA 3ZT0A 5J2NA 1F21A 1FKOA 3DLEA 4NYNA 4B8AB 1UOCA 1T05A 4KI6A 4KFBA 4M42A 3SV3A 2OPQA 4FLWA 4DTOA 2DY4A 4B3OA 3SZ2A 3RR7A 3DRSA 3NF6A 3HVRA 4CF2A 1JLQA 3V1OA 1XC9A 2IDOA 5CYMA 3NGIA 4W5OA 4M3WA 3ZSVA 2KFNA 3AVLA 3OYAA 4O44A 2XY5A 1Y97A 2ATQA 4QAGA 3OYMA 4B9MA 4RW7A 3OYCA 2ZE2A 4CGDA 2FBTA 4E89A 3RMCA 4CHZA 1HPZA 1A5WA 3ZT1A 4FK2A 3K59A 4FJLA 4M3XA 4CGIA 4CIFA 1ZBFA 4B9LA 1U04A 2YNHA 2OPPA 5DK5A 4CHNA 5FRNA 4DTRA 1TK0A 1IKWA 4CJ4A 3PUFA 1G15A 4CF8A 1SL1A 3KLFA 3P83D 4LY7A 3KLHA 3KLGA 4DLEA 3TAEA 3ZSOA 3RRHA 3KLEA 4KREA 3DOKA 1S1WA 4KO0A 3A2FA 3OYBA 3S9HA 1ZBHA 5KRSA 3SI6A 1X1PA 1RBSA 4FZXC 1HJRA 3DYAA 1TKTA 2XO7A 4CF0A 1C6VA 4PY5A 1HYSA 4H4OA 3F73A 5T7BA 3C94A 4B9TA 3NHGA 3HP6A 1L3VA 3OJUA 1EX4A 4ZTFA 4DQRA 3DLBA 5E41A 3B6OA 5HLFA 2GV9A 1QHTA 3QEIA 1RT6A 3AVMA 3PV8A 4CEQA 1Q8IA 3V4IA 4OKJA 4TSXA 4N56A 4DTNA 1YTUA 4EP5A 3AVCA 4B9UA 1BISA 1EXQA 2X6NA 3UIQA 1IH7A 1Q9YA 1K6YA 3MECA 4CEFA 1GOCA 3AA3A 1CXUA 1JLEA 1JXBA 1BCMA 4CEDA 3SNNA 1DLOA 3RMBA 2PZSA 3CYMA 4E7IA 4FJ9A 1TKZA 1VSLA 4Z4FA 3HO1A 2ETJA 4CJRA 4RW6A 3QNOA 4HVJA 1WSGA 3VQPA 2DTUA 3HT3A 4G1QA 2EX3A 3TR8A 3AVIA 4LH4A 3OS1A 4C8OA 1BIUA 4DWIA 3AVKA 1WSIA 3LP1A 3WNFA 4CERA 5KI6A 1KFSA 4C8MA 1HRHA 3WNHA 4KPYA 1SKSA 3FFIA 3EZ5A 3ZCMA 3ULDA 1NJWA 1S9GA 4CEBA 3SQ0A 2WOMA 1JLBA 1LAWA 3L8BA 5J2PA 3MXIA 4DU4A 3LP3A 3CG7A 3NFAA 4IG0A 4CHOA 4W5NA 1JKHA 1RT5A 2VWKA 1BCOA 3B6PA 1HNIA 3ISNC 4DTPA 1TVRA 1DTQA 1L3SA 3P5JA 3U3GA 1T03A 3LAKA 1TL1A 3OVNA 2Q3SA 3LP0A 4FM2A 2FC0A 4O55A 1MU2A 1QE1A 4KTZA 4OVLA 3ZSXA 4FLTA 1U49A 4O4GA 4H4MA 3NDKA 3TARA 1VSMA 1HQUA 3MXJA 4CK3A 3CQ8A 3SUOA 1L5UA 1JXEA 4DSKA 3QEPA 1ZYQA 1JL1A 5KGWA 5SZTA 4CIGA 3TAFA 2G8VA 4UQGA 1RCHA 1DTTA 1XWLA 1S6PA 4Z0UA 4KTQA 4FJKA 1NOYA 1QQCA 4OGCA 3PX0A 4CF1A 3VQ7A 3BDPA 4CGGA 3KKRA 1N5YA 4F3OA 2HHSA 1IKYA 2D5RA 3OY9A 3QESA 4CHPA 4DQSA 3TAPA 2EHGA 4C8KA 2D0BA 3V9UA 1KCFA 4J2AA 1NJYA 1A5XA 1ASWA 4FW1A 3LWLA 4KAZA 3OYFA 4BE1A 3VQDA 4E19A 1NK5A 4FZZA 4BE0A 3ZSZA 1BI4A 3MAQA 4KKOA 1D8YA 5HP1A 3DOLA 3DMJA 1W0HA 4OJRA 3ZSRA 1NK9A 2YKNA 2WONA 1QSSA 3LPTA 3F9KA 4R5PA 1KSPA 4IFYA 4RW8A 4CGFA 3H08A 5J1EA 4FZYA 5FROA 2NUBA 4FJ8A 2Y1JA 4DQQA 4XIUA 1VRUA 4IG3A 3JSMA 4DFJA 4DU1A 3ZT4A 4FW2A 3HXMA 1BHLA 3VQEA 4E7HA 4DG1A 3RWUA 1JLCA 3DLHA 1NOZA 2B4JA 4FLYA 5HROA 3SPZA 2I5JA 2X78A 4BE2A 1NKEA 4F4KA 3M8PA 2PYLA 2JGUA 4M3ZA 3NH2A 3QNNA 4ZTJA 1S5JA 1N6QA 3OS0A 4MFBA 3V1QA 3U6FA 4ZHRA 1YVUA 3KK2A 2YNIA 2R7YA 3AVHA 3IAYA 1UWBA 2RF2A 3VQAA 3HPGA 4BDYA 4CE9A 3T19A 1KVCA 1JLGA 1L3UA 1BQNA 4EZ9A 4FLZA 4QCLA 5C24A 4CGHA 2XHBA 2VG5A 2QKKA 3AVBA 4ELVA 4FJGA 3EY1A 5C25A 4JRQA 1VRTA 4ID5A 1I39A 3HPOA 4IFVA 3E01A 1C0TA 5KTQA 1IKVA 3MEDA 4DSFA 4CEZA 3DRPA 1NKBA 4FJIA 2QK9A 1J54A 5HRNA 2E4LA 4BDZA 4KB1A 3VQ6A 1RTIA 3DM2A 1BL3A 3S3OA 3OYLA 4F2SA 3K2PA 5FRMA 1UA1A 2OZMA 4OGEA 3KKSA 2OZSA 4OKEA 3L2RA 4CJPA 1S1TA 3SJJA 2BGGA 2KFZA 3TWHA 4FLXA 3ZSYA 3QEWA 2AJQA 1JL2A 4I9LA 3ZT3A 4B9SA 4FYDA 4M3RA 1TL3A 2RPIA 2RKIA 1SUQA 3QERA 3ALYA 4L8RB 1RT3A 4CIEA 3IS9A 1T7PA 3SV4A 4Z4CA 1C1BA 4GW6A 3CM6A 4ELTA 4W5QA 2HHUA 1WN7A 4AHCA 3VA3A 1D9FA 1JLFA 4DF8A 3L2QA 1WAJA 3O3FA 1NK0A 3SCXA 4MQ3A 2VWJA 4PA1A 1S6QA 2X6SA 5HRSA 2IAJA 3KK3A 1KTQA 3CFPA 3AO1A 3OYGA 1BIZA 3K57A 3NCIA 4KI4A 4C8NA 4KHYA 4KHNA 1B92A 2IOCA 4HHTA 2HW3A 2KZZA 3AA2A 1TAUA 2GBZA 1B9DA 2KZMA 3AO5A 3K5MA 4IKFA 1RBVA 2D0CA 4DS5A 1BI4B 4NCGA 4CFAA 1WNSA 2FBYA 4CJ3A 1I3AA 1RBRA 2VG6A 3D0PA 1KLMA 3MEGA 1RBUA 3O3HA 3TAQA 4AHVA 4BACA 1X9WA 3QIOA 4YFUA 2FBXA 4DLGA 4W5RA 4FJJA 3G10A 3LPUA 4LH5A 4KHQA 2YHAA 2PYJA 3V6DA 2DFHA 2IC3A 4EP4A 3CFRA 3NBPA 5SWMA 3DI6A 1ITGA 2HNYA 3I0SA 3T1AA 4B08A 5I3UA 1TK8A 2HNDA 4FK0A 3KD1E 2B5JA 1NK8A 3C6UA 3SUPA 4AHRA 4IDKA 5HBMA 3EYZA 1LV5A 1LWFA 4AHSA 1UAXA 1UA0A 4J2EA 3L2UA 3HM9A 5FDLA 1O1WA 3K58A 1RTHA 4Y1CA 3QETA 2YNFA 1WSHA 4KTWA 4KV8A 3OS2A 3VQ5A 4JS4A 4CK2A 5KGXA 1CZ9A 1NKCA 2OYQA 2HHQA 4F8RA 5J2MA 3VN5A 4JS5A 2G8UA 4K8XA 4CK1A 3CFOA 3SQ1A 1W9HA 3IRXA 1EKEA 5KRTA 4FXDA 4I2QA 2F96A 3BGRA 4AH9A 4HTUA 3VQBA 3C95A 4NCAA 4PWDA 2X74A 2DFFA 1U48A 3HL8A 1LWEA 4AHTA 1ZBIA 2W42A 2G8IA 2HHXA 4GMJB 3SPYA 1KVBA 2O4IA 4DS4A 2HMIA 1FXXA 1HQEA 2ZQBA 4CHYA 3SUQA 1RTDA 1BQMA 1RDCA 3DLGA 3KIOA 3NF7A 3TANA 5DMRA 2HHWA 4N76A 4DQIA 2E6LA 4CJKA 2Z1IA 3T3FA 1RBTA 3L2VA 4E1NA 2E6MA 2BE2A 4LSNA 3HVTA 4OLBA 3K5OA 2DFEA 4CF9A 3ZSQA 5C42A 3OYNA 1HYZA 4DTMA 4Z4HA 1XHZA 1SKWA 4FCYA 2F8SA 3LZIA 4CEEA 2QXFA 1RILA 2XY8A 4DFPA 4HUEA 2Z1HA 3AVNA 3O4NA 4CFBA 4DFKA 1VK0A 3DLRA 2G8WA 4CEOA 4DSLA 4OLAA 1WLJA 3K5LA 3NGZA 4AHUA 3SYZA 4GVMA 4Q5VA 1CLQA 2G8KA 3RR8A 3NE6A 4RG8A 2ZD1A 3VQQA 2JLEA 1RT2A 3WNGA 4CJ5A 4N47A 4KHUA 3OYKA 1Z25A 3V9ZA 1D5AA 4Q0BA 1QSLA 4DTUA 2YKMA 3V9XA 2HVHA 3TI0A 1C0UA 4Z4GA 3VA0A 3LANA 3TAMA 1WSJA 1R0AA 2YHBA 2IS3A 3L3VA 3KJVA 1EETA 1J9AA 1HYVA 1RDBA 3DRRA 1NJXA 1NK6A 4M3UA 4KHWA 5JS1A 5EU7A 1JLAA 3AVAA 3LALA 4M45A 3P1GA 3PX6A 1SV5A 4CFCA 4O5BA 1YTAA 4W5TA 3JYTA 1U47A 4KRFA 4CJTA 3AA5X 3ITHA 3SQ2A 2BANA 3RTVA 4FJNA 1QSYA 4FJXA 4N5SA 4FJHA 3O3GA 3QIPA 3AO2A 4BWJA 4HCBA 4J2BA 3NH0A 4CJLA 1EP4A 3D45A 1NK7A 2RN2A 5HRRA 1LWCA 3SQ4A 2KQ2A 1ASVA 1HNVA 4O0JA 3QEVA 4E0DA 1FKPA 3PO4A 1LAVA 4C8LA 1KFDA 4PQUA 3AVJA 4B8CA 3KK1A 3VQ8A 4HCCA 3PY8A 1RDDA 3S3MA 4FJ7A 1S1UA 1RT1A 1RT7A 1Z26A 1TV6A 4DSJA 1TAQA 1LW0A 4CJEA 1VSIA 3V9WA 4CJVA 3S3NA 4Z4IA 3I8DA 1VSJA 4WE1A 1HMVA 4CECA 3OYIA 4FLUA 1BGXT 2GUIA 3NH1A 1U45A 3RMDA 1VSDA 1RNHA 5CZ1A 1VSFA 4CCHA 5D3GA 1S1XA 1REVA 2Z1GA 4FK4A 2IGIA 1J53A 4I7FA 2FBVA 3TAGA 1J5OA 1ASUA 3AVGA 1C1AA 1S1VA 3L3UA 4DSEA 3VQ9A 3L2WA 1IG9A 3QO9A 4E1MA 2B6AA 4KHSA 4Y1DA 1QS4A 1U4BA 1D9DA 1CXQA 2Y1IA 1X9MA 4O0IA 2KW4A 1GOBA 3ASMA 4J2DA 3WNEA 3OYDA 3SUNA 1YT3A 3LZJA 2G8HA 2A1RA 3C6TA 4RW4A 1FK9A 3NAEA 2XY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S9E A;  1XHX A;  4ICL A;  3M8S A;  4RW9 A;  3OYE A;  3AA4 A;  2Z1J A;  4KB0 A;  3HP9 A;  1VSK A;  4CGJ A;  2XY6 A;  3V9S A;  1KRP A;  1SKR A;  3THV A;  5CY4 A;  3LDS A;  2A1S A;  3AVF A;  3OJS A;  1QTM A;  1GOA A;  3VQC A;  2OA8 A;  1T8E A;  4I9Q A;  1TKD A;  3VQ4 A;  4DQP A;  3OYJ A;  3RRG A;  2HHV A;  3HK2 A;  1IO2 A;  1IKX A;  1VSE A;  2HB5 A;  1ZBU A;  3DLK A;  1TKX A;  2P1J A;  1TGO A;  3LP2 A;  4DF4 A;  4E7L A;  2HNZ A;  2BDP A;  4ELU A;  3QIN A;  3CM5 A;  4B9V A;  4N41 A;  4OKK A;  3MXM A;  2P5G A;  3ZSW A;  3M8R A;  1VSH A;  4CJS A;  4YNQ A;  4I2P A;  4LD0 A;  3IG1 A;  1TK5 A;  3NF8 A;  2YV0 X;  2OPR A;  4FJM A;  1LW2 A;  3NF9 A;  4JRP A;  4H8K A;  2G8F A;  1NJZ A;  2P51 A;  1RT4 A;  4OPK A;  2HVI A;  1A5V A;  5J2Q A;  4FLV A;  4M3T A;  4DTS A;  3G0Z A;  4DTX A;  3HYF A;  1RDA A;  4AIL C;  4FJ5 A;  4LSL A;  3M8Q A;  5I42 A;  3LWM A;  1KVA A;  1ZBL A;  3RMA A;  1XI1 A;  4DFM A;  3OYH A;  4HUG A;  3V81 A;  4NYF A;  4F3T A;  4CJU A;  4E3S A;  4B9N A;  1L3T A;  2YNG A;  4CFD A;  1KLN A;  3KD5 E;  4DSI A;  4BWM A;  1WAF A;  2OPS A;  3AV9 A;  4DMN A;  1C1C A;  1RTJ A;  3HST B;  3PO5 A;  4F2R A;  5HRP A;  4ID1 A;  4OPJ A;  1NK4 A;  3U3Y A;  3O4Q A;  1SL2 A;  1X9S A;  4IBN A;  4CJW A;  3KTQ A;  4M3Y A;  4M41 A;  3KLI A;  2LSN A;  4CEA A;  3TAB A;  4FVM A;  5JS2 A;  4CJF A;  4K8Z A;  4E7K A;  1WSE A;  2ITG A;  2QKB A;  3LAM A;  3K5N A;  2F8T A;  4EZ6 A;  2KTQ A;  3ZT2 A;  2PY5 A;  2HHT A;  4NCB A;  2VG7 A;  4JLH A;  2O4G A;  3PX4 A;  3NGY A;  2XRI A;  2D0A A;  3AO4 A;  4E7J A;  4Z4E A;  1C0M A;  1B9F A;  4CHQ A;  1SL0 A;  4HUF A;  4FM0 A;  5CZ2 A;  4PUO A;  3I0R A;  2P5O A;  1Q9X A;  4QOZ B;  1WSF A;  3AO3 A;  3MEE A;  1CZB A;  3HJF A;  4FM1 A;  4DTJ A;  4CES A;  4DU3 A;  4BDP A;  3V1R A;  3HPH A;  5K14 A;  3QEX A;  4CJQ A;  3QLH A;  5CYQ A;  3ZT0 A;  5J2N A;  1F21 A;  1FKO A;  3DLE A;  4NYN A;  4B8A B;  1UOC A;  1T05 A;  4KI6 A;  4KFB A;  4M42 A;  3SV3 A;  2OPQ A;  4FLW A;  4DTO A;  2DY4 A;  4B3O A;  3SZ2 A;  3RR7 A;  3DRS A;  3NF6 A;  3HVR A;  4CF2 A;  1JLQ A;  3V1O A;  1XC9 A;  2IDO A;  5CYM A;  3NGI A;  4W5O A;  4M3W A;  3ZSV A;  2KFN A;  3AVL A;  3OYA A;  4O44 A;  2XY5 A;  1Y97 A;  2ATQ A;  4QAG A;  3OYM A;  4B9M A;  4RW7 A;  3OYC A;  2ZE2 A;  4CGD A;  2FBT A;  4E89 A;  3RMC A;  4CHZ A;  1HPZ A;  1A5W A;  3ZT1 A;  4FK2 A;  3K59 A;  4FJL A;  4M3X A;  4CGI A;  4CIF A;  1ZBF A;  4B9L A;  1U04 A;  2YNH A;  2OPP A;  5DK5 A;  4CHN A;  5FRN A;  4DTR A;  1TK0 A;  1IKW A;  4CJ4 A;  3PUF A;  1G15 A;  4CF8 A;  1SL1 A;  3KLF A;  3P83 D;  4LY7 A;  3KLH A;  3KLG A;  4DLE A;  3TAE A;  3ZSO A;  3RRH A;  3KLE A;  4KRE A;  3DOK A;  1S1W A;  4KO0 A;  3A2F A;  3OYB A;  3S9H A;  1ZBH A;  5KRS A;  3SI6 A;  1X1P A;  1RBS A;  4FZX C;  1HJR A;  3DYA A;  1TKT A;  2XO7 A;  4CF0 A;  1C6V A;  4PY5 A;  1HYS A;  4H4O A;  3F73 A;  5T7B A;  3C94 A;  4B9T A;  3NHG A;  3HP6 A;  1L3V A;  3OJU A;  1EX4 A;  4ZTF A;  4DQR A;  3DLB A;  5E41 A;  3B6O A;  5HLF A;  2GV9 A;  1QHT A;  3QEI A;  1RT6 A;  3AVM A;  3PV8 A;  4CEQ A;  1Q8I A;  3V4I A;  4OKJ A;  4TSX A;  4N56 A;  4DTN A;  1YTU A;  4EP5 A;  3AVC A;  4B9U A;  1BIS A;  1EXQ A;  2X6N A;  3UIQ A;  1IH7 A;  1Q9Y A;  1K6Y A;  3MEC A;  4CEF A;  1GOC A;  3AA3 A;  1CXU A;  1JLE A;  1JXB A;  1BCM A;  4CED A;  3SNN A;  1DLO A;  3RMB A;  2PZS A;  3CYM A;  4E7I A;  4FJ9 A;  1TKZ A;  1VSL A;  4Z4F A;  3HO1 A;  2ETJ A;  4CJR A;  4RW6 A;  3QNO A;  4HVJ A;  1WSG A;  3VQP A;  2DTU A;  3HT3 A;  4G1Q A;  2EX3 A;  3TR8 A;  3AVI A;  4LH4 A;  3OS1 A;  4C8O A;  1BIU A;  4DWI A;  3AVK A;  1WSI A;  3LP1 A;  3WNF A;  4CER A;  5KI6 A;  1KFS A;  4C8M A;  1HRH A;  3WNH A;  4KPY A;  1SKS A;  3FFI A;  3EZ5 A;  3ZCM A;  3ULD A;  1NJW A;  1S9G A;  4CEB A;  3SQ0 A;  2WOM A;  1JLB A;  1LAW A;  3L8B A;  5J2P A;  3MXI A;  4DU4 A;  3LP3 A;  3CG7 A;  3NFA A;  4IG0 A;  4CHO A;  4W5N A;  1JKH A;  1RT5 A;  2VWK A;  1BCO A;  3B6P A;  1HNI A;  3ISN C;  4DTP A;  1TVR A;  1DTQ A;  1L3S A;  3P5J A;  3U3G A;  1T03 A;  3LAK A;  1TL1 A;  3OVN A;  2Q3S A;  3LP0 A;  4FM2 A;  2FC0 A;  4O55 A;  1MU2 A;  1QE1 A;  4KTZ A;  4OVL A;  3ZSX A;  4FLT A;  1U49 A;  4O4G A;  4H4M A;  3NDK A;  3TAR A;  1VSM A;  1HQU A;  3MXJ A;  4CK3 A;  3CQ8 A;  3SUO A;  1L5U A;  1JXE A;  4DSK A;  3QEP A;  1ZYQ A;  1JL1 A;  5KGW A;  5SZT A;  4CIG A;  3TAF A;  2G8V A;  4UQG A;  1RCH A;  1DTT A;  1XWL A;  1S6P A;  4Z0U A;  4KTQ A;  4FJK A;  1NOY A;  1QQC A;  4OGC A;  3PX0 A;  4CF1 A;  3VQ7 A;  3BDP A;  4CGG A;  3KKR A;  1N5Y A;  4F3O A;  2HHS A;  1IKY A;  2D5R A;  3OY9 A;  3QES A;  4CHP A;  4DQS A;  3TAP A;  2EHG A;  4C8K A;  2D0B A;  3V9U A;  1KCF A;  4J2A A;  1NJY A;  1A5X A;  1ASW A;  4FW1 A;  3LWL A;  4KAZ A;  3OYF A;  4BE1 A;  3VQD A;  4E19 A;  1NK5 A;  4FZZ A;  4BE0 A;  3ZSZ A;  1BI4 A;  3MAQ A;  4KKO A;  1D8Y A;  5HP1 A;  3DOL A;  3DMJ A;  1W0H A;  4OJR A;  3ZSR A;  1NK9 A;  2YKN A;  2WON A;  1QSS A;  3LPT A;  3F9K A;  4R5P A;  1KSP A;  4IFY A;  4RW8 A;  4CGF A;  3H08 A;  5J1E A;  4FZY A;  5FRO A;  2NUB A;  4FJ8 A;  2Y1J A;  4DQQ A;  4XIU A;  1VRU A;  4IG3 A;  3JSM A;  4DFJ A;  4DU1 A;  3ZT4 A;  4FW2 A;  3HXM A;  1BHL A;  3VQE A;  4E7H A;  4DG1 A;  3RWU A;  1JLC A;  3DLH A;  1NOZ A;  2B4J A;  4FLY A;  5HRO A;  3SPZ A;  2I5J A;  2X78 A;  4BE2 A;  1NKE A;  4F4K A;  3M8P A;  2PYL A;  2JGU A;  4M3Z A;  3NH2 A;  3QNN A;  4ZTJ A;  1S5J A;  1N6Q A;  3OS0 A;  4MFB A;  3V1Q A;  3U6F A;  4ZHR A;  1YVU A;  3KK2 A;  2YNI A;  2R7Y A;  3AVH A;  3IAY A;  1UWB A;  2RF2 A;  3VQA A;  3HPG A;  4BDY A;  4CE9 A;  3T19 A;  1KVC A;  1JLG A;  1L3U A;  1BQN A;  4EZ9 A;  4FLZ A;  4QCL A;  5C24 A;  4CGH A;  2XHB A;  2VG5 A;  2QKK A;  3AVB A;  4ELV A;  4FJG A;  3EY1 A;  5C25 A;  4JRQ A;  1VRT A;  4ID5 A;  1I39 A;  3HPO A;  4IFV A;  3E01 A;  1C0T A;  5KTQ A;  1IKV A;  3MED A;  4DSF A;  4CEZ A;  3DRP A;  1NKB A;  4FJI A;  2QK9 A;  1J54 A;  5HRN A;  2E4L A;  4BDZ A;  4KB1 A;  3VQ6 A;  1RTI A;  3DM2 A;  1BL3 A;  3S3O A;  3OYL A;  4F2S A;  3K2P A;  5FRM A;  1UA1 A;  2OZM A;  4OGE A;  3KKS A;  2OZS A;  4OKE A;  3L2R A;  4CJP A;  1S1T A;  3SJJ A;  2BGG A;  2KFZ A;  3TWH A;  4FLX A;  3ZSY A;  3QEW A;  2AJQ A;  1JL2 A;  4I9L A;  3ZT3 A;  4B9S A;  4FYD A;  4M3R A;  1TL3 A;  2RPI A;  2RKI A;  1SUQ A;  3QER A;  3ALY A;  4L8R B;  1RT3 A;  4CIE A;  3IS9 A;  1T7P A;  3SV4 A;  4Z4C A;  1C1B A;  4GW6 A;  3CM6 A;  4ELT A;  4W5Q A;  2HHU A;  1WN7 A;  4AHC A;  3VA3 A;  1D9F A;  1JLF A;  4DF8 A;  3L2Q A;  1WAJ A;  3O3F A;  1NK0 A;  3SCX A;  4MQ3 A;  2VWJ A;  4PA1 A;  1S6Q A;  2X6S A;  5HRS A;  2IAJ A;  3KK3 A;  1KTQ A;  3CFP A;  3AO1 A;  3OYG A;  1BIZ A;  3K57 A;  3NCI A;  4KI4 A;  4C8N A;  4KHY A;  4KHN A;  1B92 A;  2IOC A;  4HHT A;  2HW3 A;  2KZZ A;  3AA2 A;  1TAU A;  2GBZ A;  1B9D A;  2KZM A;  3AO5 A;  3K5M A;  4IKF A;  1RBV A;  2D0C A;  4DS5 A;  1BI4 B;  4NCG A;  4CFA A;  1WNS A;  2FBY A;  4CJ3 A;  1I3A A;  1RBR A;  2VG6 A;  3D0P A;  1KLM A;  3MEG A;  1RBU A;  3O3H A;  3TAQ A;  4AHV A;  4BAC A;  1X9W A;  3QIO A;  4YFU A;  2FBX A;  4DLG A;  4W5R A;  4FJJ A;  3G10 A;  3LPU A;  4LH5 A;  4KHQ A;  2YHA A;  2PYJ A;  3V6D A;  2DFH A;  2IC3 A;  4EP4 A;  3CFR A;  3NBP A;  5SWM A;  3DI6 A;  1ITG A;  2HNY A;  3I0S A;  3T1A A;  4B08 A;  5I3U A;  1TK8 A;  2HND A;  4FK0 A;  3KD1 E;  2B5J A;  1NK8 A;  3C6U A;  3SUP A;  4AHR A;  4IDK A;  5HBM A;  3EYZ A;  1LV5 A;  1LWF A;  4AHS A;  1UAX A;  1UA0 A;  4J2E A;  3L2U A;  3HM9 A;  5FDL A;  1O1W A;  3K58 A;  1RTH A;  4Y1C A;  3QET A;  2YNF A;  1WSH A;  4KTW A;  4KV8 A;  3OS2 A;  3VQ5 A;  4JS4 A;  4CK2 A;  5KGX A;  1CZ9 A;  1NKC A;  2OYQ A;  2HHQ A;  4F8R A;  5J2M A;  3VN5 A;  4JS5 A;  2G8U A;  4K8X A;  4CK1 A;  3CFO A;  3SQ1 A;  1W9H A;  3IRX A;  1EKE A;  5KRT A;  4FXD A;  4I2Q A;  2F96 A;  3BGR A;  4AH9 A;  4HTU A;  3VQB A;  3C95 A;  4NCA A;  4PWD A;  2X74 A;  2DFF A;  1U48 A;  3HL8 A;  1LWE A;  4AHT A;  1ZBI A;  2W42 A;  2G8I A;  2HHX A;  4GMJ B;  3SPY A;  1KVB A;  2O4I A;  4DS4 A;  2HMI A;  1FXX A;  1HQE A;  2ZQB A;  4CHY A;  3SUQ A;  1RTD A;  1BQM A;  1RDC A;  3DLG A;  3KIO A;  3NF7 A;  3TAN A;  5DMR A;  2HHW A;  4N76 A;  4DQI A;  2E6L A;  4CJK A;  2Z1I A;  3T3F A;  1RBT A;  3L2V A;  4E1N A;  2E6M A;  2BE2 A;  4LSN A;  3HVT A;  4OLB A;  3K5O A;  2DFE A;  4CF9 A;  3ZSQ A;  5C42 A;  3OYN A;  1HYZ A;  4DTM A;  4Z4H A;  1XHZ A;  1SKW A;  4FCY A;  2F8S A;  3LZI A;  4CEE A;  2QXF A;  1RIL A;  2XY8 A;  4DFP A;  4HUE A;  2Z1H A;  3AVN A;  3O4N A;  4CFB A;  4DFK A;  1VK0 A;  3DLR A;  2G8W A;  4CEO A;  4DSL A;  4OLA A;  1WLJ A;  3K5L A;  3NGZ A;  4AHU A;  3SYZ A;  4GVM A;  4Q5V A;  1CLQ A;  2G8K A;  3RR8 A;  3NE6 A;  4RG8 A;  2ZD1 A;  3VQQ A;  2JLE A;  1RT2 A;  3WNG A;  4CJ5 A;  4N47 A;  4KHU A;  3OYK A;  1Z25 A;  3V9Z A;  1D5A A;  4Q0B A;  1QSL A;  4DTU A;  2YKM A;  3V9X A;  2HVH A;  3TI0 A;  1C0U A;  4Z4G A;  3VA0 A;  3LAN A;  3TAM A;  1WSJ A;  1R0A A;  2YHB A;  2IS3 A;  3L3V A;  3KJV A;  1EET A;  1J9A A;  1HYV A;  1RDB A;  3DRR A;  1NJX A;  1NK6 A;  4M3U A;  4KHW A;  5JS1 A;  5EU7 A;  1JLA A;  3AVA A;  3LAL A;  4M45 A;  3P1G A;  3PX6 A;  1SV5 A;  4CFC A;  4O5B A;  1YTA A;  4W5T A;  3JYT A;  1U47 A;  4KRF A;  4CJT A;  3AA5 X;  3ITH A;  3SQ2 A;  2BAN A;  3RTV A;  4FJN A;  1QSY A;  4FJX A;  4N5S A;  4FJH A;  3O3G A;  3QIP A;  3AO2 A;  4BWJ A;  4HCB A;  4J2B A;  3NH0 A;  4CJL A;  1EP4 A;  3D45 A;  1NK7 A;  2RN2 A;  5HRR A;  1LWC A;  3SQ4 A;  2KQ2 A;  1ASV A;  1HNV A;  4O0J A;  3QEV A;  4E0D A;  1FKP A;  3PO4 A;  1LAV A;  4C8L A;  1KFD A;  4PQU A;  3AVJ A;  4B8C A;  3KK1 A;  3VQ8 A;  4HCC A;  3PY8 A;  1RDD A;  3S3M A;  4FJ7 A;  1S1U A;  1RT1 A;  1RT7 A;  1Z26 A;  1TV6 A;  4DSJ A;  1TAQ A;  1LW0 A;  4CJE A;  1VSI A;  3V9W A;  4CJV A;  3S3N A;  4Z4I A;  3I8D A;  1VSJ A;  4WE1 A;  1HMV A;  4CEC A;  3OYI A;  4FLU A;  1BGX T;  2GUI A;  3NH1 A;  1U45 A;  3RMD A;  1VSD A;  1RNH A;  5CZ1 A;  1VSF A;  4CCH A;  5D3G A;  1S1X A;  1REV A;  2Z1G A;  4FK4 A;  2IGI A;  1J53 A;  4I7F A;  2FBV A;  3TAG A;  1J5O A;  1ASU A;  3AVG A;  1C1A A;  1S1V A;  3L3U A;  4DSE A;  3VQ9 A;  3L2W A;  1IG9 A;  3QO9 A;  4E1M A;  2B6A A;  4KHS A;  4Y1D A;  1QS4 A;  1U4B A;  1D9D A;  1CXQ A;  2Y1I A;  1X9M A;  4O0I A;  2KW4 A;  1GOB A;  3ASM A;  4J2D A;  3WNE A;  3OYD A;  3SUN A;  1YT3 A;  3LZJ A;  2G8H A;  2A1R A;  3C6T A;  4RW4 A;  1FK9 A;  3NAE A;  2XY7 A; 
#chains in the Genus database with same CATH topology
 1XHX A;  4RW9 A;  5F0X A;  4CGJ A;  3LL3 A;  2XY6 A;  4UY8 O;  3THV A;  3GL1 A;  3OJS A;  4YOU A;  3VF6 A;  4DQP A;  3TSU A;  2WBN A;  1IO2 A;  1VSE A;  1JJ2 M;  1FJG K;  4JI3 K;  1TKX A;  1N36 K;  2W41 A;  2BDP A;  2QWR A;  3W3D A;  1K73 O;  1NNE A;  4N41 A;  2P9I A;  2P9S A;  3ZSW A;  3M8R A;  4YY3 K;  1Z6R A;  4LD0 A;  1TK5 A;  1ATN A;  1NJZ A;  2HVI A;  4DTS A;  5AQH A;  4FJ5 A;  1RDA A;  4XH5 A;  1TUY A;  4LSL A;  2HBJ A;  5I42 A;  2O8B A;  3RMA A;  3M1F A;  3OYH A;  4HUG A;  5TKW A;  2NRW A;  4CJU A;  1L3T A;  4LF7 K;  4XH1 A;  4CZG A;  1WAF A;  5EY4 A;  3E9P A;  2VQF K;  4OPJ A;  1NK4 A;  3IUC A;  3U3Y A;  1RFQ A;  2HBL A;  3EKU A;  4CJW A;  4CVN E;  3FZK A;  3JAM O;  2QKB A;  2P9L B;  5KPR A;  2KTQ A;  2PY5 A;  2HHT A;  2VG7 A;  1MA9 B;  1KXP A;  1C0M A;  4PUO A;  3SMS A;  2P5O A;  4QOZ B;  3MEE A;  3HJF A;  4FM1 A;  2AP1 A;  1VAZ A;  4BDP A;  4JD2 A;  4JI5 K;  1Z05 A;  4BR7 A;  4NYN A;  1UOC A;  5EXW A;  4KI6 A;  4KFB A;  4M42 A;  5I9E B;  4CJ7 A;  1VQP N;  3RR7 A;  3V1O A;  3WQT A;  4W5O A;  3K9K A;  4M3W A;  3VGK A;  4O44 A;  3CJ1 A;  3G4S N;  4CBU A;  3OYM A;  3PSF A;  3P38 A;  2ZE2 A;  2QWQ A;  3O08 A;  2FBT A;  3ZEU A;  4E89 A;  4CHZ A;  1HPZ A;  4FJL A;  1M90 O;  4DKW A;  1ZBF A;  1U04 A;  4CHN A;  4CZH A;  3IDH A;  4CJ4 A;  3KLF A;  3WT0 A;  4LY7 A;  3KLH A;  4A2B A;  4DLE A;  4KRE A;  3DOK A;  1S1W A;  2P9K A;  3PIP L;  1X1P A;  1RBS A;  3VTI A;  4CZE A;  1C6V A;  5BRH A;  2E2P A;  1C0G A;  1W97 L;  3O5B A;  3HP6 A;  3BUZ B;  3OJU A;  5LL6 Z;  4GKJ K;  3DLB A;  3T1H K;  2V7Y A;  5AZI A;  3V4I A;  4OKJ A;  4N56 A;  4BC5 A;  3AVC A;  2YX6 A;  1BIS A;  1NWK A;  5FPE A;  3EKS A;  3UIQ A;  1E4G T;  4GV6 A;  2WC9 A;  4CEF A;  1CXU A;  1YJN N;  2RE2 A;  2PZS A;  4H5T A;  3CYM A;  3HO1 A;  1NGI A;  4RW6 A;  4HVJ A;  3VQP A;  3HT3 A;  2EX3 A;  4C8O A;  1BIU A;  3DXM B;  4C8M A;  1HRH A;  2O8E A;  1SKS A;  1P90 A;  3C0B A;  4CEB A;  1TYQ B;  4DU4 A;  2Q36 A;  5AQZ A;  1RT5 A;  3TTD A;  3ISN C;  4DTP A;  1VQ8 N;  3L0Q A;  2FF6 A;  3ENO A;  3OVN A;  3H46 O;  4FM2 A;  1N34 K;  4KTZ A;  1OVY A;  3R3L A;  3RSE A;  1VSM A;  3LM9 A;  1JXE A;  3EE9 A;  3QEP A;  1ZYQ A;  4LFA K;  3MDQ A;  5KGW A;  5C10 A;  3TAF A;  5BN9 A;  3E1Y A;  4UQG A;  1RCH A;  1NOY A;  2O8F A;  1N5Y A;  2NRX A;  3OY9 A;  3TAP A;  1NMN A;  1KCF A;  1ASW A;  3VEZ A;  3OYF A;  4YOR A;  3VER A;  1NK5 A;  4KKO A;  4PL8 A;  1W0H A;  1NK9 A;  1MDU B;  3J7A P;  3H45 C;  4R5P A;  4KHP K;  1H1V A;  4CGF A;  3VEY A;  1VRU A;  4DFJ A;  3WXJ A;  3UE5 A;  4DU1 A;  2F7T A;  4FW2 A;  4LFC K;  4C1N K;  4DG1 A;  4BQZ A;  3RWU A;  4FJ8 A;  1OVQ A;  4F4K A;  4H0P A;  2JGU A;  3CC2 N;  3MMV A;  3V1Q A;  4U7B A;  3KK2 A;  2YNI A;  3IAY A;  2RF2 A;  4CD3 A;  4BDY A;  4CE9 A;  4C23 A;  1JLG A;  1BQN A;  4G9Z A;  1K8K A;  4CGH A;  4A57 A;  2VG5 A;  5ELZ A;  3VET A;  4WQ5 C;  1I39 A;  4IFV A;  3VMF B;  3W0L A;  4EFH A;  5E84 A;  4DSF A;  4H5W A;  2QA4 N;  3DRP A;  1NKB A;  2QK9 A;  1NGF A;  1J54 A;  3BY5 A;  1OH5 A;  3DM2 A;  3S3O A;  1BL3 A;  5AQP A;  1UA1 A;  1CZA N;  4M63 C;  3MN9 A;  3L2R A;  4CJP A;  4WQ5 A;  2AJQ A;  1HNX K;  1TL3 A;  2UXC K;  3ALY A;  3MN7 A;  4L8R B;  3TSQ A;  4PHT X;  4K0K K;  3H1Q A;  2Q31 A;  3VA3 A;  3MWT A;  1JLF A;  4PL7 A;  4BVP A;  1NK0 A;  4C1N I;  4MQ3 A;  4E1J A;  1S6Q A;  4A5B A;  3CFP A;  4KHY A;  1BIZ A;  4KI4 A;  1TAU A;  4KHN A;  2IOC A;  5ADX H;  3AA2 A;  3K5M A;  4IKF A;  1BI4 B;  2FBY A;  1I3A A;  4AM7 A;  4IJA A;  4KHQ A;  2YHA A;  4BRL A;  2IVN A;  1Q86 O;  3V6D A;  2O8D B;  3CFR A;  3WEE B;  1ITG A;  3T1A A;  2HND A;  3FR0 A;  3C6U A;  4AHR A;  1LWF A;  1UAX A;  3UKR A;  4I6M A;  1UA0 A;  1R59 O;  4K42 A;  3CHW A;  4DR3 K;  1WSH A;  4KTW A;  1NKC A;  4GVE A;  4A59 A;  1IV0 A;  4JS5 A;  3M3Z A;  4JK9 A;  4FXD A;  4AM6 A;  3BGR A;  2NLX A;  4HTU A;  1NG9 A;  5LJV A;  4PWD A;  2DFF A;  3ZYY X;  1U48 A;  4AHT A;  2W42 A;  4GMJ B;  3ENH A;  2HMI A;  4CHY A;  1RDC A;  4IWV A;  4N76 A;  2JWL A;  1DKG D;  2Z1I A;  3N4P A;  4FWQ A;  3L2V A;  1KD1 O;  1ZBS A;  4LSN A;  3ZSQ A;  5C42 A;  1HYZ A;  1SKW A;  4FCY A;  2QXL A;  2XY8 A;  4JKG B;  3PSI A;  2Z1H A;  3AVN A;  3ATV A;  3DLR A;  2OCE A;  4OLA A;  1BA1 A;  1WLJ A;  4AHU A;  4BVO A;  4Q5V A;  3RR8 A;  2HOE A;  3VQQ A;  2JLE A;  3WNG A;  2P9N A;  4KHU A;  4N47 A;  1D5A A;  1QSL A;  4BRA A;  4DQ8 A;  3P39 A;  4Z4G A;  3ID6 A;  3TAM A;  1JCF A;  2YHB A;  2IS3 A;  3K9J A;  3L3V A;  5M1F A;  3KJV A;  1R0A A;  2G8I A;  3VGL A;  1N8R O;  1JLA A;  3AVA A;  3LAL A;  3P1G A;  1YTA A;  4KRF A;  1YF5 L;  5F2R A;  4FJX A;  4H0O A;  4BGA A;  5FPN A;  2Q1N A;  4HCB A;  2HMP A;  4X62 K;  5HRR A;  1HNV A;  1LAV A;  2CGK A;  1KFD A;  5BRE A;  1XC3 A;  3H3O B;  1Z26 A;  1TV6 A;  1BWF O;  1LW0 A;  3J7Z O;  1VSI A;  3BZK A;  4CJV A;  3V9W A;  3S3N A;  3OYI A;  1HMV A;  3CJA A;  4FLU A;  2GUI A;  1KQS M;  3RMD A;  1VSD A;  5CZ1 A;  1S1X A;  5AQV A;  3P4I A;  3ULE B;  2IGI A;  2D1K A;  4I7F A;  2ZGY A;  1IBM K;  1ASU A;  2F9T A;  2E88 A;  3THW A;  3L3U A;  4JI4 K;  4KHS A;  4Y1D A;  2NRR A;  2KW4 A;  4J2D A;  3WNE A;  3OYD A;  4V19 S;  1YT3 A;  3WXK A;  3VF4 A;  1FK9 A;  4YOX A;  1VQM N;  5GIP A;  1S9E A;  4ICL A;  3CXC M;  5CY4 A;  2A1S A;  4GNI A;  4BC3 A;  1GOA A;  3CCS N;  1QTM A;  3O80 A;  3OYJ A;  3RRG A;  3HK2 A;  1HNW K;  4HWI A;  3DLK A;  5AQT A;  2QEX N;  2OAN A;  4DF4 A;  4WFN L;  1GLC G;  4E7L A;  1T44 A;  2VWB A;  4ELU A;  3CPE A;  3CM5 A;  2HST A;  4FWO A;  4OKK A;  3HRG A;  3D2E B;  2GEL A;  1VQ5 N;  3NF8 A;  2YV0 X;  5AZJ B;  2V51 B;  4JRP A;  2G8F A;  5EX5 A;  4AIL C;  3DLL L;  4H5V A;  1KVA A;  5F1X A;  5GAD P;  5KPZ A;  2ZJP L;  4DFM A;  4NYF A;  4E3S A;  4B9N A;  1BO5 O;  2YNG A;  4CFD A;  1S22 A;  2I7N A;  2ZM6 K;  1RTJ A;  3HST B;  4ID1 A;  3O4Q A;  4J8F A;  3KTQ A;  4M41 A;  3GG4 A;  5AR0 A;  4DV0 K;  5JS2 A;  4FOE A;  2ITG A;  3LAM A;  3VPZ A;  3K5N A;  3K0S A;  1KC8 O;  4B1U B;  1FW6 A;  4A62 A;  4NCB A;  4JLH A;  1IBK K;  1O13 A;  3PX4 A;  2XRI A;  1VQL N;  2Q97 A;  4HUF A;  2A41 A;  4LF9 K;  1QZ5 A;  5LMN K;  3CCQ N;  4DTJ A;  4CES A;  3V1R A;  3HPH A;  5K14 A;  5GAE P;  3PIO L;  5FPM A;  3LDQ A;  3QLH A;  3SAF A;  5J2N A;  1YVN A;  4B8A B;  2WUS A;  5ADX A;  3NVK A;  4NXN K;  4HTL A;  1G99 A;  4FLW A;  4DTO A;  5AFU H;  3MN6 A;  3HTV A;  5LY3 A;  3NF6 A;  4FWP A;  4JHD B;  1NM1 A;  4CF2 A;  2IDO A;  3NGI A;  3ZSV A;  2KFN A;  3OYA A;  5BPM A;  1Y97 A;  3WXM B;  4B9M A;  4RW7 A;  3OYC A;  2UUC K;  4CGD A;  4BC2 A;  1A5W A;  4DR1 K;  3ZT1 A;  4FK2 A;  3K59 A;  4CGI A;  1WBB A;  4DV5 K;  4BRH A;  2YNH A;  5FRN A;  3DJC A;  1KAX A;  3CJB A;  3SLC A;  1IKW A;  3PUF A;  5M1Q A;  1SL1 A;  4H5N A;  3A8Y A;  3P83 D;  3ZSO A;  3M6G A;  3C7N A;  3KLE A;  4DV6 K;  3A2F A;  3OYB A;  3OHR A;  4CZK A;  5KRS A;  3KK7 A;  4MO4 A;  2JWK A;  3DYA A;  1TKT A;  3I56 N;  2NRT A;  3F73 A;  3DAW A;  5T7B A;  3C94 A;  4B9T A;  5HLF A;  1HKC A;  2GV9 A;  4DR4 K;  1YIJ N;  1RT6 A;  1X3N A;  2F4V K;  1Y64 A;  4QS8 A;  4TSX A;  3CCE N;  4B9U A;  1LCU A;  2WTU A;  5HL7 L;  1Q9Y A;  3CCV N;  2E5L K;  3NVM A;  3AA3 A;  1XNR K;  1JLE A;  2GX9 A;  1SZ2 A;  1JXB A;  3FZM A;  4IFE A;  4CED A;  3RMB A;  3O4W A;  1SQK A;  2AA4 A;  4IZ9 A;  1VSL A;  4IXC A;  4FJ9 A;  2DTU A;  3BP8 A;  2DPN A;  3F5T A;  3AVI A;  3ID8 A;  2ITM A;  3WNF A;  1WSI A;  3VEO A;  3CCL N;  5KI6 A;  4KPY A;  3O1B A;  3ULD A;  3ZCM A;  1S9G A;  1LAW A;  3CG7 A;  3NFA A;  4YOY A;  2GWJ A;  1JKH A;  3D2F A;  3P5J A;  2UUB K;  1W2B M;  2Q3S A;  3LP0 A;  2FC0 A;  3VOV A;  4H4M A;  4JKF A;  1HQU A;  1IG8 A;  4CK3 A;  3CQ8 A;  1L5U A;  4DSK A;  1JL1 A;  5SZT A;  4ILG B;  4KTQ A;  5DM6 L;  1S6P A;  4WF9 L;  1YHQ N;  1QQC A;  1M1K O;  1V4S A;  4BRI A;  1HR0 K;  3I33 A;  3VQ7 A;  4MLE A;  4CGG A;  1N32 K;  3CPW M;  3KKR A;  2D4W A;  4IO9 L;  2HHS A;  3VTH A;  1IKY A;  3FZH A;  3A5M C;  5AQK A;  3G25 A;  3CF5 L;  3BEX A;  2EHG A;  2D0B A;  4DV7 K;  4BE1 A;  1J5E K;  3TU5 A;  5HP1 A;  3DMJ A;  5DM7 L;  4OJR A;  2YKN A;  2WON A;  1QSS A;  1U2V A;  3LPT A;  3F9K A;  4RW8 A;  4FO0 A;  5JVH L;  2E8A A;  4WQ4 C;  4FZY A;  4DQQ A;  4IG3 A;  3O1W A;  3JSM A;  3ZT4 A;  3HXM A;  1BHL A;  4E7H A;  1JLC A;  5HRO A;  3SPZ A;  2I5J A;  4BE2 A;  3M8P A;  2PYL A;  1IBL K;  4ZTJ A;  3QNN A;  1S5J A;  3THY B;  4ZHR A;  5LJW A;  3S41 A;  1UWB A;  2OTJ N;  1GLL O;  1KVC A;  4WQ4 A;  3SJH A;  2W6L A;  1L3U A;  4QCL A;  3AVB A;  3EY1 A;  4JRQ A;  4ID5 A;  5AQL A;  5KTQ A;  3MED A;  4CEZ A;  2YCH A;  4JK8 A;  4BRN A;  2KHO A;  3K2P A;  2OZS A;  3SJJ A;  1DT9 A;  4K25 A;  4AF1 A;  2BGG A;  4FLX A;  4NLC A;  2H3G X;  1JL2 A;  4B3S K;  2RPI A;  2RKI A;  4B1V A;  1RT3 A;  1NGB A;  1OH8 A;  3IS9 A;  1T7P A;  1SAZ A;  4O5F A;  4MDA A;  3DXK A;  1WAJ A;  3O3F A;  3SCX A;  3HM8 A;  3U9D A;  4CZM A;  1KTQ A;  3NCI A;  1EWR A;  2HW3 A;  2Q0U A;  5AQS A;  2FXU A;  2KZM A;  4DUZ K;  3SAH A;  1SS6 A;  4AHV A;  1EO1 A;  1ATS A;  3QIO A;  4FJJ A;  1NLV A;  2VCP A;  3G10 A;  3LPU A;  2PYJ A;  5AFU A;  2DFH A;  3KZB A;  4B08 A;  2HNY A;  2O8C B;  1TK8 A;  3AAR A;  2B5J A;  1NK8 A;  3SUP A;  4IDK A;  5HBM A;  1LV5 A;  4AHS A;  1Q82 O;  2GUP A;  4J2E A;  3L2U A;  3HM9 A;  2NRH A;  2P9P A;  5FDL A;  1RTH A;  4Y1C A;  3QET A;  3UKU A;  2YNF A;  4FWR A;  4KV8 A;  3OS2 A;  2OYQ A;  3VQ5 A;  1U6Z A;  2IVP A;  1BOT O;  3O8M A;  3KWG A;  1NGD A;  3CD6 N;  4I2Q A;  2F96 A;  4JK7 A;  2EWS A;  1YJ9 N;  1YJW N;  3C95 A;  2GWK A;  2X74 A;  2HHX A;  1QQO A;  3SPY A;  2P9U A;  2O4I A;  1BA0 A;  1FXX A;  3SUQ A;  2ZQB A;  1BQM A;  3KIO A;  5CE3 A;  3T3F A;  2VQE K;  2QWM A;  2BE2 A;  4DR5 K;  3JS6 A;  5AQI A;  4DTM A;  1XHZ A;  4R79 A;  3SBT A;  3H6E A;  4M7Y A;  4HUE A;  2CGJ A;  4QS9 A;  4DFK A;  4DSL A;  3CI5 A;  1S72 N;  3NGZ A;  1YXQ A;  1CLQ A;  2G8K A;  2QM1 A;  1VHX A;  1NGE A;  1RT2 A;  4CJ5 A;  4A2A A;  1Z25 A;  4DTU A;  2HVH A;  1WSJ A;  4M3U A;  1HYV A;  1NJX A;  3DRR A;  4ISG A;  3FZL A;  4CFC A;  4O5B A;  1U47 A;  3SMP A;  3I55 N;  3MX2 A;  3ITH A;  4FJN A;  1QSY A;  4N5S A;  4U67 L;  3O3G A;  1NBW A;  2FSK A;  1YIT N;  3NH0 A;  4H0X B;  3D45 A;  5BRF A;  1NK7 A;  2KQ2 A;  4O0J A;  2FSJ A;  1P8Z A;  4C8L A;  3ZX3 A;  4B8C A;  4HCC A;  1RDD A;  4JAX A;  1S1U A;  3LM2 A;  4F9O A;  2VYP A;  1TAQ A;  4Z4I A;  2PBD A;  3THX B;  5FLX O;  3AAP A;  3TTF A;  1U45 A;  2V52 B;  2P9L A;  4CCH A;  5D3G A;  3QML A;  2Z1G A;  1RGI A;  3VEX A;  2GEM A;  1WB9 A;  3TAG A;  4DV2 K;  3O9Q A;  5AQQ A;  1IG9 A;  4B9Q A;  3QO9 A;  1QS4 A;  3FE1 A;  1CXQ A;  4B1Z A;  2KKZ A;  1NGJ A;  2G8H A;  2A1R A;  3C6T A;  4RW4 A;  4H03 B;  2XY7 A;  4DV4 K;  4DR2 K;  3OYE A;  3AA4 A;  2Z1J A;  1VSK A;  1WBD A;  3ZET B;  5AQX A;  3J81 O;  2I7P A;  5JLH A;  4ISF A;  1T8E A;  4I9Q A;  2HHV A;  2UXD K;  4AQY K;  1IKX A;  2HHH K;  4H0T B;  4JKD A;  4JYA K;  2P1J A;  2HNZ A;  3IKM A;  3QIN A;  1OKJ A;  2P5G A;  1VSH A;  2HF3 A;  2OPR A;  4PKH A;  1LW2 A;  1XUP O;  2P51 A;  4OPK A;  1EQY A;  4M3T A;  5J2Q A;  4DTX A;  3HYF A;  2HF4 A;  3M8Q A;  1ZC6 A;  1GLA G;  3N4Q A;  4OO1 J;  3V81 A;  3A5O C;  1KAZ A;  1KLN A;  4DSI A;  4BWM A;  3AV9 A;  4DMN A;  1QVG M;  1SL2 A;  4M3Y A;  4IBN A;  4CEA A;  2LSN A;  3QB0 A;  4FVM A;  4CJF A;  2F8T A;  2QTD A;  4EZ6 A;  3ZT2 A;  2FLO A;  3CIP A;  3NGY A;  3AO4 A;  4E7J A;  4IO8 A;  4Z4E A;  1B9F A;  5TKY A;  5CZ2 A;  3I0R A;  4YOT A;  1CZB A;  4FWN A;  5GAG P;  3DXM A;  1DEJ A;  3QEX A;  2ASO A;  4CJQ A;  5CYQ A;  3ZT0 A;  3DLE A;  1T05 A;  3SV3 A;  1RDW X;  3VEV A;  4LFB K;  3SZ2 A;  1TYQ A;  3DRS A;  1VQK N;  1NGC A;  1XC9 A;  1VQN N;  3AVL A;  4KH6 A;  1XMQ K;  1ESV A;  2XY5 A;  2ATQ A;  4EHT A;  2HBK A;  2W40 A;  4CW7 B;  4M7X A;  1LOT B;  1K9M O;  5JLF A;  4M3X A;  1BDG A;  5DK5 A;  2P9I B;  2OTL N;  5HOO A;  2QW9 A;  2CH5 A;  1G15 A;  4JI7 K;  3KLG A;  3TAE A;  5C2D A;  1HKG A;  4KO0 A;  4JKC A;  1ZBH A;  3CCM N;  4FZX C;  1HJR A;  2O8B B;  3HSC A;  2XO7 A;  4CF0 A;  4RCH A;  4PY5 A;  4H4O A;  3A5L C;  3NHG A;  1L3V A;  1EX4 A;  4ZTF A;  3VF2 A;  5B8H A;  2IIR A;  3B6O A;  5E41 A;  1XNQ K;  3QEI A;  3AVM A;  4A5A A;  2ZWH A;  5BPL A;  1YTU A;  4BY9 C;  5A2Q O;  1EXQ A;  4MO5 A;  2X6N A;  5KPT A;  1IH7 A;  1K6Y A;  1GOC A;  4E7I A;  2Q0R A;  1TKZ A;  4FPA A;  3BF1 A;  4CJR A;  2VGM A;  3VES A;  4IOX A;  1WSG A;  4G1Q A;  4LH4 A;  3AVK A;  3LP1 A;  4JD2 B;  1KFS A;  3WNH A;  3O9U A;  3R1X A;  3C6A A;  3CC4 N;  3FFI A;  3EZ5 A;  1NJW A;  1BG3 A;  4A61 A;  4LF4 K;  1QHA A;  2WOM A;  1JLB A;  5J2P A;  3A5N C;  3LP3 A;  4IG0 A;  4CHO A;  3B6P A;  1BCO A;  4EIA A;  1L3S A;  2A40 A;  1TVR A;  1DTQ A;  4IJN A;  3R9P A;  1T03 A;  4BRG A;  3J8A A;  4O55 A;  1MU2 A;  2E20 A;  3ZSX A;  1U49 A;  4O4G A;  1JCG A;  3U8X A;  3MXJ A;  3ZEU B;  1HPM A;  3G6E N;  2QWN A;  1VQ4 N;  2G8V A;  4Z0U A;  3PLA A;  3D6R A;  5AQG A;  3PX0 A;  4CF1 A;  4BR2 A;  2YJF A;  4CHP A;  4DQS A;  2P9K B;  4C8K A;  2UUA K;  4BGB A;  4ILJ A;  1NJY A;  4FW1 A;  4ILH A;  4BRO A;  4CZI A;  1BI4 A;  3MAQ A;  1D8Y A;  3DOL A;  1GLD G;  5MLC Q;  3ZSR A;  1QVF M;  5AQY A;  1KSP A;  5AZI B;  5J1E A;  3R8E A;  2KLA A;  3Q7B A;  3VQE A;  2O8D A;  4BG8 A;  1NOZ A;  3WEE A;  3GE1 A;  5M1K A;  1NKE A;  3CMA N;  5AQN A;  5GAH P;  4CD1 A;  4QS7 A;  4BQL A;  3OS0 A;  4MFB A;  5JVG L;  1YVU A;  3VQA A;  3T19 A;  4EZ9 A;  3OA9 A;  5C24 A;  2XHB A;  1C0F A;  4ELV A;  4FJG A;  5C25 A;  2O8E B;  2UYT A;  1HLU A;  5M1O A;  5IT9 O;  1OH6 A;  4BDZ A;  3VQ6 A;  1V4T A;  2QI2 A;  4JI0 K;  4FPB A;  2KFZ A;  3TWH A;  3ZSY A;  3QEW A;  3RSE B;  4B9S A;  5C12 A;  2UU9 K;  1HJO A;  3SK3 A;  3QER A;  4O8U A;  4DV1 K;  4JKG A;  3FFK B;  1C1B A;  2ASM A;  4ELT A;  1WN7 A;  2O8F B;  4FWS A;  1D9F A;  1T3V A;  4DF8 A;  5M1P A;  1I94 K;  2CH6 A;  3CQY A;  1S3X A;  2VWJ A;  3T69 A;  5AQJ A;  2A42 A;  3Q7C A;  3OYG A;  1B92 A;  4HHT A;  2KZZ A;  2GBZ A;  1RBV A;  4DS5 A;  4NCG A;  4IDH A;  1WNS A;  1RBR A;  3D0P A;  3MEG A;  3SBG A;  3TAQ A;  2YJE A;  4BAC A;  1HNZ K;  3OBW A;  4DUY K;  4Z94 A;  2IC3 A;  3NBP A;  3DI6 A;  2GTD A;  1VQ7 N;  3T7Z A;  2VGN A;  3EYZ A;  4FWK A;  3T1Y K;  3K58 A;  1O1W A;  4FOI A;  1K8K B;  4JS4 A;  4CK2 A;  1CZ9 A;  4WCE L;  5J2M A;  3VN5 A;  1QZ6 A;  2G8U A;  3QIC A;  3ULE A;  3SQ1 A;  2E1Z A;  4LF8 K;  3IRX A;  3O9S A;  5KRT A;  1N33 K;  3HL8 A;  1ZBI A;  3MCP A;  4DS4 A;  1RTD A;  3NF7 A;  3A0I X;  2HHW A;  3TAN A;  4DQI A;  2E6L A;  4CJK A;  5AJ3 K;  3J80 O;  2E6M A;  5FPD A;  4OLB A;  2DFE A;  4YOW A;  4Z4H A;  4BRM A;  3LZI A;  3L4Q A;  4CEE A;  3O4N A;  4CFB A;  1VK0 A;  3U9Z A;  3I8B A;  3TSP A;  4LF6 K;  3K5L A;  3SYZ A;  3GBT A;  3NE6 A;  4RG8 A;  3AAQ A;  4CZF A;  3OYK A;  3V9Z A;  3MWP A;  1GLB G;  3V9X A;  1C0U A;  3D2E A;  3CJ7 A;  4DR6 K;  4DV3 K;  4BRD A;  1NK6 A;  1EET A;  1J9A A;  4EHU A;  1RDB A;  5AZJ A;  5EU7 A;  4M45 A;  4L3Q A;  2QWP A;  4W5T A;  1E3M A;  3AA5 X;  4FJH A;  4BWJ A;  4J2B A;  4DCH A;  2F9W A;  4CJL A;  1EP4 A;  4DR7 K;  2RN2 A;  3AGK A;  1X9J A;  1ASV A;  1FKP A;  1HKB A;  3AVJ A;  2BUP A;  3VQ8 A;  3PY8 A;  4FJ7 A;  1RT7 A;  3AY9 A;  4DSJ A;  4CJE A;  4DB3 A;  3WXI A;  4JKB A;  3UKR B;  4I6M B;  3I8D A;  2YHY A;  3MN5 A;  1RNH A;  1BUP A;  2NZT A;  3O6W A;  3E9O A;  1REV A;  2E2O A;  4DHY A;  4JI1 K;  3D7E O;  1YUW A;  4YOV A;  1C1A A;  1YAG A;  4DSE A;  4BRP A;  3VQ9 A;  1TUU A;  2B6A A;  4NB4 A;  1GOB A;  3ENB A;  4JV5 K;  3NAE A;  4LC9 B;  4IOC L;  3M8S A;  4KB0 A;  3HP9 A;  2ZJQ L;  1ILY A;  4K41 A;  1KRP A;  3V9S A;  4JHD A;  2WFB A;  3EL2 A;  4BR4 A;  1SKR A;  3LDS A;  3AVF A;  3CQX A;  3VQC A;  2OA8 A;  4B1W B;  1TKD A;  3VQ4 A;  4JI6 K;  3BF3 A;  2HB5 A;  4CI6 A;  1ZBU A;  5IWA K;  3LP2 A;  1TGO A;  3L4I A;  1VQO N;  2P9N B;  4B9V A;  3MXM A;  5AQM A;  5E26 A;  5BRD A;  4CJS A;  4YNQ A;  4I2P A;  3IG1 A;  2RHK A;  1Q81 O;  4FJM A;  3F9M A;  2YHW A;  3NF9 A;  4H8K A;  1RT4 A;  4BRK A;  1A5V A;  4FLV A;  3G0Z A;  4JEP A;  5EVZ A;  3LWM A;  1ZBL A;  1XI1 A;  3KHY A;  5C2F A;  4NLB A;  4B3R K;  4F3T A;  3G71 N;  3FLC O;  3KD5 E;  3M5R A;  2OPS A;  1YI2 N;  1C1C A;  5KQD A;  3PO5 A;  4WYB A;  5HRP A;  1NJI O;  4F2R A;  3CER A;  3KVG A;  1X9S A;  1XMO K;  2NNW A;  3KLI A;  4BR0 A;  4JKE A;  3TAB A;  3O9R A;  4K8Z A;  4E7K A;  1WSE A;  1J6Z A;  4MLH A;  2O4G A;  2D0A A;  3IMX A;  4CHQ A;  1SL0 A;  4FM0 A;  3THW B;  4X66 K;  3QDK A;  3E9L A;  1Q9X A;  1WSF A;  3AO3 A;  4DU3 A;  2QWO A;  3CME N;  1F21 A;  1FKO A;  5KQ8 A;  2OPQ A;  2DY4 A;  3C6H A;  4B3O A;  5JMV A;  4RTF D;  1VQ9 N;  3HVR A;  2QWL A;  1JLQ A;  5CYM A;  1MWK A;  2BH1 A;  4QAG A;  3NMU A;  5AQF A;  2ZF5 O;  3C65 A;  2NRZ A;  4PKG A;  3RMC A;  4CIF A;  4B9L A;  2OPP A;  5LMU K;  4DTR A;  4H5R A;  1TK0 A;  2Q2R A;  3ZLJ A;  4X64 K;  4CF8 A;  1D4X A;  2J4R A;  3RRH A;  4FSV A;  3S9H A;  3QBX A;  3SI6 A;  1NU0 A;  1HYS A;  3B8A X;  4FL9 A;  4DQR A;  1QHT A;  2YI1 A;  3PV8 A;  4CEQ A;  1NMD A;  1Q8I A;  4YDU C;  4DTN A;  4EP5 A;  1NGA A;  2BTF A;  4H0Y B;  3MEC A;  3EO3 A;  3EE8 A;  4GY2 B;  1BCM A;  3THY A;  3TTC A;  3SNN A;  1DLO A;  2YHX A;  4CBW A;  4Z4F A;  3QFU A;  2ETJ A;  3QNO A;  2FF3 B;  4YDU A;  3RVC A;  4KH5 A;  3TR8 A;  3OS1 A;  4BC4 A;  3EN9 A;  4DWI A;  4CER A;  1GLF O;  5BR9 A;  1GLJ O;  3MK6 A;  1IJJ A;  3OW2 M;  3LDP A;  3VEN A;  3SQ0 A;  3L8B A;  3JXU A;  3MXI A;  4OX9 K;  3J7Y P;  4W5N A;  2HBM A;  4EAH D;  2VWK A;  1HNI A;  3E66 A;  4MDB A;  4O8K A;  3U3G A;  3LAK A;  1TL1 A;  3KWI A;  1RDU A;  1QE1 A;  4XH4 A;  4OVL A;  4FLT A;  5C0Y A;  3NDK A;  3TAR A;  3SUO A;  3WUH A;  1BU6 O;  4GKK K;  3OTO K;  3DWL A;  4CIG A;  4CZL A;  1DTT A;  1XWL A;  1NGH A;  4GV3 A;  4FJK A;  1QQM A;  4OGC A;  3BDP A;  4F3O A;  3HZ6 A;  2D5R A;  3C7N B;  3QES A;  3V9U A;  4J2A A;  5GIN A;  3CCR N;  1A5X A;  3LWL A;  4KAZ A;  3VQD A;  4E19 A;  4FZZ A;  4KBO A;  3MX5 A;  4BE0 A;  3ZSZ A;  3ZX0 A;  4OPH A;  3LDL A;  4B3M K;  5BPN A;  3H3N O;  4IFY A;  4BR9 A;  2NRV A;  3WXL A;  3H08 A;  3FGU A;  5FRO A;  2NUB A;  2Y1J A;  4XIU A;  3P31 A;  3AGR A;  3ATU A;  3HBT A;  3DLH A;  2B4J A;  4FLY A;  2O8C A;  2X78 A;  1X3M A;  4M3Z A;  3NH2 A;  4CBX A;  1N6Q A;  3CCU N;  3O9T A;  3U6F A;  5BR8 K;  2R7Y A;  3AVH A;  1QQN A;  3HPG A;  1Q18 A;  4FLZ A;  3MCA B;  4JI2 K;  4BRC A;  2W6K A;  2QKK A;  2P9S B;  2ASP A;  2D0P A;  1VRT A;  4PKI A;  2PFU A;  3HPO A;  3E01 A;  1C0T A;  4FWL A;  1IKV A;  4FJI A;  1WUA A;  4B3T K;  5HRN A;  2E4L A;  4KB1 A;  1RTI A;  4RWT A;  3OYL A;  4F2S A;  3D2F B;  5FRM A;  2A6A A;  3BZC A;  2OZM A;  4OGE A;  3KKS A;  4OKE A;  2CGL A;  1S1T A;  4GV9 A;  4H0V B;  2E2Q A;  4Y0W A;  5CR4 A;  4I9L A;  3ZT3 A;  4WFB L;  4FYD A;  1NGG A;  4M3R A;  1SUQ A;  3CET A;  4BRF A;  4CIE A;  5JIC A;  3GDQ A;  3SV4 A;  4Z4C A;  4GW6 A;  1VQ6 N;  3CM6 A;  3F2K A;  4W5Q A;  2HHU A;  4AHC A;  3L2Q A;  2IVO A;  1EWQ A;  4PA1 A;  2E2N A;  2X6S A;  5HRS A;  2IAJ A;  5AQR A;  3KK3 A;  3AO1 A;  3K57 A;  3LDN A;  4LF5 K;  4C8N A;  5C15 A;  4YHH K;  1B9D A;  3AO5 A;  2D0C A;  4CFA A;  4JKA A;  3IFR A;  4CJ3 A;  2VG6 A;  1KLM A;  3UB5 A;  1RBU A;  1U2V B;  2V7Z A;  4XEI A;  1HUX A;  3O3H A;  1X9W A;  4NXM K;  4YFU A;  2FBX A;  3HI0 A;  4W5R A;  3QFP A;  3HOS A;  4DLG A;  4X65 K;  4LH5 A;  4EP4 A;  5GIO A;  3GOI A;  5SWM A;  3I0S A;  4ISE A;  5I3U A;  2A3Z A;  5AQW A;  4FK0 A;  3KD1 E;  1Q7Y O;  3THX A;  3EEQ A;  4FVU A;  4B1X B;  3CC7 N;  4NO7 A;  2PAV A;  5KGX A;  4IEE A;  2HHQ A;  4F8R A;  4K8X A;  4CK1 A;  3CFO A;  1W9H A;  1MWM A;  1EKE A;  1T6C A;  4AH9 A;  3VQB A;  1T6D A;  1DGK N;  4NCA A;  1LWE A;  3LDO A;  1KVB A;  4CZJ A;  1KAY A;  3L6Q A;  1HQE A;  5CHI A;  4IOA L;  3DLG A;  3WQU A;  5DMR A;  1GLE G;  3CCJ N;  1RBT A;  4E1N A;  3QBW A;  2UXB K;  3CJC A;  3HVT A;  3K5O A;  3ZET A;  4CF9 A;  4KH4 A;  3OYN A;  2E1Y A;  5EOY A;  2F8S A;  2QXF A;  1RIL A;  4JN4 A;  4DFP A;  3R6M A;  2A5X A;  2G8W A;  4FWM A;  4CEO A;  1K8A O;  4JNE A;  4GVM A;  3DXK B;  2ZD1 A;  4BG9 A;  1JCE A;  4Q0B A;  2YKM A;  3CJ9 A;  5M1N A;  5H1S Q;  3TI0 A;  4OPA A;  3VA0 A;  1XQS C;  3LAN A;  3U4L A;  5JS1 A;  4JI8 K;  4KHW A;  3PX6 A;  2ZJR L;  3OBY A;  1SV5 A;  1E4F T;  4JKH A;  1HX1 A;  3EZW A;  4BRQ A;  5BN8 A;  3JYT A;  4CJT A;  3SAG A;  3SQ2 A;  2BAN A;  3RTV A;  4BRE A;  1OH7 A;  3QIP A;  3AO2 A;  5AQU A;  3SQ4 A;  1LWC A;  4E0D A;  4BR5 A;  3QEV A;  4PQU A;  3PO4 A;  5AQO A;  3KK1 A;  3S3M A;  1RT1 A;  4K43 A;  3H1V X;  1VSJ A;  2ZGZ A;  4WE1 A;  4CEC A;  1BGX T;  2D0O A;  2P9P B;  3NH1 A;  3UKU B;  3VGM A;  2FSN A;  1VSF A;  4WFA L;  4FK4 A;  1J53 A;  2FBV A;  1J5O A;  3VEW A;  4B1Y B;  3AVG A;  1WOQ A;  1S1V A;  3L2W A;  4E1M A;  3FZF A;  1U4B A;  1D9D A;  1ZXO A;  4IEI A;  2P9U B;  2Y1I A;  4O0I A;  1X9M A;  3ASM A;  1ATR A;  3SUN A;  3LZJ A;  3HOT A;  3TPQ A;  3ZX2 A;  1W7A A; 
#chains in the Genus database with same CATH homology
 1S9E A;  1XHX A;  4ICL A;  3M8S A;  4RW9 A;  3OYE A;  3AA4 A;  2Z1J A;  4KB0 A;  3HP9 A;  1VSK A;  4CGJ A;  2XY6 A;  3V9S A;  1KRP A;  1SKR A;  3THV A;  5CY4 A;  3LDS A;  2A1S A;  3AVF A;  3OJS A;  1QTM A;  1GOA A;  3VQC A;  2OA8 A;  1T8E A;  4I9Q A;  1TKD A;  3VQ4 A;  4DQP A;  3OYJ A;  3RRG A;  2HHV A;  3HK2 A;  1IO2 A;  1IKX A;  1VSE A;  2HB5 A;  1ZBU A;  3DLK A;  1TKX A;  2P1J A;  1TGO A;  3LP2 A;  4DF4 A;  4E7L A;  2HNZ A;  2BDP A;  4ELU A;  3QIN A;  3CM5 A;  4B9V A;  4N41 A;  4OKK A;  3MXM A;  2P5G A;  3ZSW A;  3M8R A;  1VSH A;  4CJS A;  4YNQ A;  4I2P A;  4LD0 A;  3IG1 A;  1TK5 A;  3NF8 A;  2YV0 X;  2OPR A;  4FJM A;  1LW2 A;  3NF9 A;  4JRP A;  4H8K A;  2G8F A;  1NJZ A;  2P51 A;  1RT4 A;  4OPK A;  2HVI A;  1A5V A;  5J2Q A;  4FLV A;  4M3T A;  4DTS A;  3G0Z A;  4DTX A;  3HYF A;  1RDA A;  4AIL C;  4FJ5 A;  4LSL A;  3M8Q A;  5I42 A;  3LWM A;  1KVA A;  1ZBL A;  3RMA A;  1XI1 A;  4DFM A;  3OYH A;  4HUG A;  3V81 A;  4NYF A;  4F3T A;  4CJU A;  4E3S A;  4B9N A;  1L3T A;  2YNG A;  4CFD A;  1KLN A;  3KD5 E;  4DSI A;  4BWM A;  1WAF A;  2OPS A;  3AV9 A;  4DMN A;  1C1C A;  1RTJ A;  3HST B;  3PO5 A;  4F2R A;  5HRP A;  4ID1 A;  4OPJ A;  1NK4 A;  3U3Y A;  3O4Q A;  1SL2 A;  1X9S A;  4IBN A;  4CJW A;  3KTQ A;  4M3Y A;  4M41 A;  3KLI A;  2LSN A;  4CEA A;  3TAB A;  4FVM A;  5JS2 A;  4CJF A;  4K8Z A;  4E7K A;  1WSE A;  2ITG A;  2QKB A;  3LAM A;  3K5N A;  2F8T A;  4EZ6 A;  2KTQ A;  3ZT2 A;  2PY5 A;  2HHT A;  4NCB A;  2VG7 A;  4JLH A;  2O4G A;  3PX4 A;  3NGY A;  2XRI A;  2D0A A;  3AO4 A;  4E7J A;  4Z4E A;  1C0M A;  1B9F A;  4CHQ A;  1SL0 A;  4HUF A;  4FM0 A;  5CZ2 A;  4PUO A;  3I0R A;  2P5O A;  1Q9X A;  4QOZ B;  1WSF A;  3AO3 A;  3MEE A;  1CZB A;  3HJF A;  4FM1 A;  4DTJ A;  4CES A;  4DU3 A;  4BDP A;  3V1R A;  3HPH A;  5K14 A;  3QEX A;  4CJQ A;  3QLH A;  5CYQ A;  3ZT0 A;  5J2N A;  1F21 A;  1FKO A;  3DLE A;  4NYN A;  4B8A B;  1UOC A;  1T05 A;  4KI6 A;  4KFB A;  4M42 A;  3SV3 A;  2OPQ A;  4FLW A;  4DTO A;  2DY4 A;  4B3O A;  3SZ2 A;  3RR7 A;  3DRS A;  3NF6 A;  3HVR A;  4CF2 A;  1JLQ A;  3V1O A;  1XC9 A;  2IDO A;  5CYM A;  3NGI A;  4W5O A;  4M3W A;  3ZSV A;  2KFN A;  3AVL A;  3OYA A;  4O44 A;  2XY5 A;  1Y97 A;  2ATQ A;  4QAG A;  3OYM A;  4B9M A;  4RW7 A;  3OYC A;  2ZE2 A;  4CGD A;  2FBT A;  4E89 A;  3RMC A;  4CHZ A;  1HPZ A;  1A5W A;  3ZT1 A;  4FK2 A;  3K59 A;  4FJL A;  4M3X A;  4CGI A;  4CIF A;  1ZBF A;  4B9L A;  1U04 A;  2YNH A;  2OPP A;  5DK5 A;  4CHN A;  5FRN A;  4DTR A;  1TK0 A;  1IKW A;  4CJ4 A;  3PUF A;  1G15 A;  4CF8 A;  1SL1 A;  3KLF A;  3P83 D;  4LY7 A;  3KLH A;  3KLG A;  4DLE A;  3TAE A;  3ZSO A;  3RRH A;  3KLE A;  4KRE A;  3DOK A;  1S1W A;  4KO0 A;  3A2F A;  3OYB A;  3S9H A;  1ZBH A;  5KRS A;  3SI6 A;  1X1P A;  1RBS A;  4FZX C;  1HJR A;  3DYA A;  1TKT A;  2XO7 A;  4CF0 A;  1C6V A;  4PY5 A;  1HYS A;  4H4O A;  3F73 A;  5T7B A;  3C94 A;  4B9T A;  3NHG A;  3HP6 A;  1L3V A;  3OJU A;  1EX4 A;  4ZTF A;  4DQR A;  3DLB A;  5E41 A;  3B6O A;  5HLF A;  2GV9 A;  1QHT A;  3QEI A;  1RT6 A;  3AVM A;  3PV8 A;  4CEQ A;  1Q8I A;  3V4I A;  4OKJ A;  4TSX A;  4N56 A;  4DTN A;  1YTU A;  4EP5 A;  3AVC A;  4B9U A;  1BIS A;  1EXQ A;  2X6N A;  3UIQ A;  1IH7 A;  1Q9Y A;  1K6Y A;  3MEC A;  4CEF A;  1GOC A;  3AA3 A;  1CXU A;  1JLE A;  1JXB A;  1BCM A;  4CED A;  3SNN A;  1DLO A;  3RMB A;  2PZS A;  3CYM A;  4E7I A;  4FJ9 A;  1TKZ A;  1VSL A;  4Z4F A;  3HO1 A;  2ETJ A;  4CJR A;  4RW6 A;  3QNO A;  4HVJ A;  1WSG A;  3VQP A;  2DTU A;  3HT3 A;  4G1Q A;  2EX3 A;  3TR8 A;  3AVI A;  4LH4 A;  3OS1 A;  4C8O A;  1BIU A;  4DWI A;  3AVK A;  1WSI A;  3LP1 A;  3WNF A;  4CER A;  5KI6 A;  1KFS A;  4C8M A;  1HRH A;  3WNH A;  4KPY A;  1SKS A;  3FFI A;  3EZ5 A;  3ZCM A;  3ULD A;  1NJW A;  1S9G A;  4CEB A;  3SQ0 A;  2WOM A;  1JLB A;  1LAW A;  3L8B A;  5J2P A;  3MXI A;  4DU4 A;  3LP3 A;  3CG7 A;  3NFA A;  4IG0 A;  4CHO A;  4W5N A;  1JKH A;  1RT5 A;  2VWK A;  1BCO A;  3B6P A;  1HNI A;  3ISN C;  4DTP A;  1TVR A;  1DTQ A;  1L3S A;  3P5J A;  3U3G A;  1T03 A;  3LAK A;  1TL1 A;  3OVN A;  2Q3S A;  3LP0 A;  4FM2 A;  2FC0 A;  4O55 A;  1MU2 A;  1QE1 A;  4KTZ A;  4OVL A;  3ZSX A;  4FLT A;  1U49 A;  4O4G A;  4H4M A;  3NDK A;  3TAR A;  1VSM A;  1HQU A;  3MXJ A;  4CK3 A;  3CQ8 A;  3SUO A;  1L5U A;  1JXE A;  4DSK A;  3QEP A;  1ZYQ A;  1JL1 A;  5KGW A;  5SZT A;  4CIG A;  3TAF A;  2G8V A;  4UQG A;  1RCH A;  1DTT A;  1XWL A;  1S6P A;  4Z0U A;  4KTQ A;  4FJK A;  1NOY A;  1QQC A;  4OGC A;  3PX0 A;  4CF1 A;  3VQ7 A;  3BDP A;  4CGG A;  3KKR A;  1N5Y A;  4F3O A;  2HHS A;  1IKY A;  2D5R A;  3OY9 A;  3QES A;  4CHP A;  4DQS A;  3TAP A;  2EHG A;  4C8K A;  2D0B A;  3V9U A;  1KCF A;  4J2A A;  1NJY A;  1A5X A;  1ASW A;  4FW1 A;  3LWL A;  4KAZ A;  3OYF A;  4BE1 A;  3VQD A;  4E19 A;  1NK5 A;  4FZZ A;  4BE0 A;  3ZSZ A;  1BI4 A;  3MAQ A;  4KKO A;  1D8Y A;  5HP1 A;  3DOL A;  3DMJ A;  1W0H A;  4OJR A;  3ZSR A;  1NK9 A;  2YKN A;  2WON A;  1QSS A;  3LPT A;  3F9K A;  4R5P A;  1KSP A;  4IFY A;  4RW8 A;  4CGF A;  3H08 A;  5J1E A;  4FZY A;  5FRO A;  2NUB A;  4FJ8 A;  2Y1J A;  4DQQ A;  4XIU A;  1VRU A;  4IG3 A;  3JSM A;  4DFJ A;  4DU1 A;  3ZT4 A;  4FW2 A;  3HXM A;  1BHL A;  3VQE A;  4E7H A;  4DG1 A;  3RWU A;  1JLC A;  3DLH A;  1NOZ A;  2B4J A;  4FLY A;  5HRO A;  3SPZ A;  2I5J A;  2X78 A;  4BE2 A;  1NKE A;  4F4K A;  3M8P A;  2PYL A;  2JGU A;  4M3Z A;  3NH2 A;  3QNN A;  4ZTJ A;  1S5J A;  1N6Q A;  3OS0 A;  4MFB A;  3V1Q A;  3U6F A;  4ZHR A;  1YVU A;  3KK2 A;  2YNI A;  2R7Y A;  3AVH A;  3IAY A;  1UWB A;  2RF2 A;  3VQA A;  3HPG A;  4BDY A;  4CE9 A;  3T19 A;  1KVC A;  1JLG A;  1L3U A;  1BQN A;  4EZ9 A;  4FLZ A;  4QCL A;  5C24 A;  4CGH A;  2XHB A;  2VG5 A;  2QKK A;  3AVB A;  4ELV A;  4FJG A;  3EY1 A;  5C25 A;  4JRQ A;  1VRT A;  4ID5 A;  1I39 A;  3HPO A;  4IFV A;  3E01 A;  1C0T A;  5KTQ A;  1IKV A;  3MED A;  4DSF A;  4CEZ A;  3DRP A;  1NKB A;  4FJI A;  2QK9 A;  1J54 A;  5HRN A;  2E4L A;  4BDZ A;  4KB1 A;  3VQ6 A;  1RTI A;  3DM2 A;  1BL3 A;  3S3O A;  3OYL A;  4F2S A;  3K2P A;  5FRM A;  1UA1 A;  2OZM A;  4OGE A;  3KKS A;  2OZS A;  4OKE A;  3L2R A;  4CJP A;  1S1T A;  3SJJ A;  2BGG A;  2KFZ A;  3TWH A;  4FLX A;  3ZSY A;  3QEW A;  2AJQ A;  1JL2 A;  4I9L A;  3ZT3 A;  4B9S A;  4FYD A;  4M3R A;  1TL3 A;  2RPI A;  2RKI A;  1SUQ A;  3QER A;  3ALY A;  4L8R B;  1RT3 A;  4CIE A;  3IS9 A;  1T7P A;  3SV4 A;  4Z4C A;  1C1B A;  4GW6 A;  3CM6 A;  4ELT A;  4W5Q A;  2HHU A;  1WN7 A;  4AHC A;  3VA3 A;  1D9F A;  1JLF A;  4DF8 A;  3L2Q A;  1WAJ A;  3O3F A;  1NK0 A;  3SCX A;  4MQ3 A;  2VWJ A;  4PA1 A;  1S6Q A;  2X6S A;  5HRS A;  2IAJ A;  3KK3 A;  1KTQ A;  3CFP A;  3AO1 A;  3OYG A;  1BIZ A;  3K57 A;  3NCI A;  4KI4 A;  4C8N A;  4KHY A;  4KHN A;  1B92 A;  2IOC A;  4HHT A;  2HW3 A;  2KZZ A;  3AA2 A;  1TAU A;  2GBZ A;  1B9D A;  2KZM A;  3AO5 A;  3K5M A;  4IKF A;  1RBV A;  2D0C A;  4DS5 A;  1BI4 B;  4NCG A;  4CFA A;  1WNS A;  2FBY A;  4CJ3 A;  1I3A A;  1RBR A;  2VG6 A;  3D0P A;  1KLM A;  3MEG A;  1RBU A;  3O3H A;  3TAQ A;  4AHV A;  4BAC A;  1X9W A;  3QIO A;  4YFU A;  2FBX A;  4DLG A;  4W5R A;  4FJJ A;  3G10 A;  3LPU A;  4LH5 A;  4KHQ A;  2YHA A;  2PYJ A;  3V6D A;  2DFH A;  2IC3 A;  4EP4 A;  3CFR A;  3NBP A;  5SWM A;  3DI6 A;  1ITG A;  2HNY A;  3I0S A;  3T1A A;  4B08 A;  5I3U A;  1TK8 A;  2HND A;  4FK0 A;  3KD1 E;  2B5J A;  1NK8 A;  3C6U A;  3SUP A;  4AHR A;  4IDK A;  5HBM A;  3EYZ A;  1LV5 A;  1LWF A;  4AHS A;  1UAX A;  1UA0 A;  4J2E A;  3L2U A;  3HM9 A;  5FDL A;  1O1W A;  3K58 A;  1RTH A;  4Y1C A;  3QET A;  2YNF A;  1WSH A;  4KTW A;  4KV8 A;  3OS2 A;  3VQ5 A;  4JS4 A;  4CK2 A;  5KGX A;  1CZ9 A;  1NKC A;  2OYQ A;  2HHQ A;  4F8R A;  5J2M A;  3VN5 A;  4JS5 A;  2G8U A;  4K8X A;  4CK1 A;  3CFO A;  3SQ1 A;  1W9H A;  3IRX A;  1EKE A;  5KRT A;  4FXD A;  4I2Q A;  2F96 A;  3BGR A;  4AH9 A;  4HTU A;  3VQB A;  3C95 A;  4NCA A;  4PWD A;  2X74 A;  2DFF A;  1U48 A;  3HL8 A;  1LWE A;  4AHT A;  1ZBI A;  2W42 A;  2G8I A;  2HHX A;  4GMJ B;  3SPY A;  1KVB A;  2O4I A;  4DS4 A;  2HMI A;  1FXX A;  1HQE A;  2ZQB A;  4CHY A;  3SUQ A;  1RTD A;  1BQM A;  1RDC A;  3DLG A;  3KIO A;  3NF7 A;  3TAN A;  5DMR A;  2HHW A;  4N76 A;  4DQI A;  2E6L A;  4CJK A;  2Z1I A;  3T3F A;  1RBT A;  3L2V A;  4E1N A;  2E6M A;  2BE2 A;  4LSN A;  3HVT A;  4OLB A;  3K5O A;  2DFE A;  4CF9 A;  3ZSQ A;  5C42 A;  3OYN A;  1HYZ A;  4DTM A;  4Z4H A;  1XHZ A;  1SKW A;  4FCY A;  2F8S A;  3LZI A;  4CEE A;  2QXF A;  1RIL A;  2XY8 A;  4DFP A;  4HUE A;  2Z1H A;  3AVN A;  3O4N A;  4CFB A;  4DFK A;  1VK0 A;  3DLR A;  2G8W A;  4CEO A;  4DSL A;  4OLA A;  1WLJ A;  3K5L A;  3NGZ A;  4AHU A;  3SYZ A;  4GVM A;  4Q5V A;  1CLQ A;  2G8K A;  3RR8 A;  3NE6 A;  4RG8 A;  2ZD1 A;  3VQQ A;  2JLE A;  1RT2 A;  3WNG A;  4CJ5 A;  4N47 A;  4KHU A;  3OYK A;  1Z25 A;  3V9Z A;  1D5A A;  4Q0B A;  1QSL A;  4DTU A;  2YKM A;  3V9X A;  2HVH A;  3TI0 A;  1C0U A;  4Z4G A;  3VA0 A;  3LAN A;  3TAM A;  1WSJ A;  1R0A A;  2YHB A;  2IS3 A;  3L3V A;  3KJV A;  1EET A;  1J9A A;  1HYV A;  1RDB A;  3DRR A;  1NJX A;  1NK6 A;  4M3U A;  4KHW A;  5JS1 A;  5EU7 A;  1JLA A;  3AVA A;  3LAL A;  4M45 A;  3P1G A;  3PX6 A;  1SV5 A;  4CFC A;  4O5B A;  1YTA A;  4W5T A;  3JYT A;  1U47 A;  4KRF A;  4CJT A;  3AA5 X;  3ITH A;  3SQ2 A;  2BAN A;  3RTV A;  4FJN A;  1QSY A;  4FJX A;  4N5S A;  4FJH A;  3O3G A;  3QIP A;  3AO2 A;  4BWJ A;  4HCB A;  4J2B A;  3NH0 A;  4CJL A;  1EP4 A;  3D45 A;  1NK7 A;  2RN2 A;  5HRR A;  1LWC A;  3SQ4 A;  2KQ2 A;  1ASV A;  1HNV A;  4O0J A;  3QEV A;  4E0D A;  1FKP A;  3PO4 A;  1LAV A;  4C8L A;  1KFD A;  4PQU A;  3AVJ A;  4B8C A;  3KK1 A;  3VQ8 A;  4HCC A;  3PY8 A;  1RDD A;  3S3M A;  4FJ7 A;  1S1U A;  1RT1 A;  1RT7 A;  1Z26 A;  1TV6 A;  4DSJ A;  1TAQ A;  1LW0 A;  4CJE A;  1VSI A;  3V9W A;  4CJV A;  3S3N A;  4Z4I A;  3I8D A;  1VSJ A;  4WE1 A;  1HMV A;  4CEC A;  3OYI A;  4FLU A;  1BGX T;  2GUI A;  3NH1 A;  1U45 A;  3RMD A;  1VSD A;  1RNH A;  5CZ1 A;  1VSF A;  4CCH A;  5D3G A;  1S1X A;  1REV A;  2Z1G A;  4FK4 A;  2IGI A;  1J53 A;  4I7F A;  2FBV A;  3TAG A;  1J5O A;  1ASU A;  3AVG A;  1C1A A;  1S1V A;  3L3U A;  4DSE A;  3VQ9 A;  3L2W A;  1IG9 A;  3QO9 A;  4E1M A;  2B6A A;  4KHS A;  4Y1D A;  1QS4 A;  1U4B A;  1D9D A;  1CXQ A;  2Y1I A;  1X9M A;  4O0I A;  2KW4 A;  1GOB A;  3ASM A;  4J2D A;  3WNE A;  3OYD A;  3SUN A;  1YT3 A;  3LZJ A;  2G8H A;  2A1R A;  3C6T A;  4RW4 A;  1FK9 A;  3NAE A;  2XY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...