1VAZA

Solution structures of the p47 sep domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
76
structure length
76
Chain Sequence
ERRRHSGQDVHVVLKLWKTGFSLDNGDLRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NSFL1 cofactor p47
publication title Structure, dynamics and interactions of p47, a major adaptor of the AAA ATPase, p97.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lipid binding protein
total genus 10
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.210 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1vazA01
1VAZA 1SS6A
chains in the Genus database with same CATH superfamily
3VEZA 5AQHA 4BRHA 3CMAN 3CMEN 3O9UA 1D8YA 4LH5A 3PO5A 1YVUA 3EKSA 5FROA 5JVGL 4DLEA 4G9ZA 3AO1A 4MDAA 2F96A 5C12A 3SAHA 4QS9A 1TGOA 4JKEA 3SZ2A 1KVAA 4NCGA 4FWMA 4G1QA 1E3MA 4H5WA 2FLOA 4PQUA 4NO7A 3DRRA 2P51A 4JI3K 3WNFA 4DUZK 3CD6N 4FYDA 1OH6A 1M1KO 3CPEA 3K5NA 3DLKA 1S1XA 4B3TK 4JAXA 1T6DA 4CGGA 1LWFA 3CG7A 1C0GA 3MN5A 5AQTA 3CJ9A 4B3OA 5DM6L 1TYQB 1BDGA 4F9OA 1DTTA 4WFNL 3QERA 1ZBUA 4DSKA 4E0DA 1TL3A 4CHQA 2ZGYA 3MWPA 4FWRA 3D2EA 3TAFA 3RSEB 3WXKA 4L3QA 3T19A 2NUBA 2HBLA 2GTDA 5FPEA 4Y1DA 3VENA 1KAYA 1DEJA 2D0CA 1JLEA 4FWKA 3SQ1A 3NGYA 3VEXA 1C0FA 3OYKA 1HX1A 4WF9L 2P1JA 1N34K 2V51B 3T7ZA 4BRMA 3SUOA 4CBUA 2CH6A 2A1RA 3VETA 1YT3A 1SKSA 3CHWA 1B9FA 4NB4A 3L2QA 3VQAA 2X6SA 2P9IA 3GL1A 5SWMA 1ILYA 1HJRA 1EETA 1I3AA 3F9KA 5GINA 4B9MA 4AQYK 5CYQA 4DF8A 4BDZA 2P9LB 3GOIA 4H0YB 2X78A 3CQXA 4K25A 4O0JA 4RW7A 2LSNA 2P5GA 1RFQA 2P9KA 3J7AP 1LWEA 1LOTB 1XNRK 3VQ9A 2E20A 3CXCM 4U67L 4FJLA 1VSDA 4DG1A 3B8AX 3M8RA 1VSLA 1BA1A 2O8EB 4WQ4C 4BR4A 1RBRA 3A5OC 4CGDA 3AVGA 3SJJA 4HHTA 4UQGA 3SV3A 2YJFA 4ID1A 3UKRB 4BE2A 3IDHA 2IVPA 4JI6K 4DSJA 1QHAA 5TKYA 3G25A 1SL1A 1RBVA 2F8TA 1BI4A 2FF3B 1N6QA 5AQPA 3U3GA 1C0UA 1TAUA 1T44A 3CJBA 3HYFA 5KQDA 3HJFA 1IKWA 5K14A 5AZJA 4C8KA 3H1VX 5C15A 1RBSA 4M3RA 2O8DA 4KHQA 2QWLA 4HTUA 3LL3A 4R5PA 4JI7K 4FJKA 1J53A 1ZBLA 5M1KA 4O55A 1JL2A 3MXMA 2UUAK 1XC3A 4IO9L 4N41A 3K0SA 5KGWA 3SYZA 3OYDA 2F4VK 4A61A 1K8AO 2P9NA 4KRFA 2ZGZA 2CH5A 3B6PA 4F4KA 1YHQN 1QTMA 1E4GT 1VQNN 3OYFA 3NF8A 4CESA 4CGHA 4ISGA 2OCEA 2E6LA 3QLHA 2KFZA 4JK7A 1MU2A 1DGKN 2ZM6K 2VG5A 1S72N 5EOYA 2YHWA 3JSMA 4M3XA 4PKHA 1HKCA 4H5RA 2Q36A 3G6EN 3T1YK 3VN5A 3HVRA 2VWJA 2UUBK 3HZ6A 3V4IA 1MDUB 3TTFA 4OJRA 3BP8A 3C6UA 1VQPN 4MQ3A 4DWIA 3VF2A 3CFRA 2YJEA 2QWNA 3O1BA 1BQMA 1JKHA 4A59A 4FZZA 4BC5A 4CZIA 4NCAA 3OTOK 4ELTA 1S1VA 1X3NA 4LSNA 2FBTA 4I6MA 4YDUA 1U47A 1BUPA 3JYTA 1SZ2A 2W40A 1S22A 2PZSA 3VQEA 3C7NB 3C0BA 3LZJA 4KHSA 3KVGA 4HVJA 3S41A 1C1CA 4B9SA 5IT9O 5GAGP 5AQJA 4DMNA 3SAGA 3MEGA 5AQZA 3VTIA 5CY4A 1ESVA 1NGHA 4GMJB 2HMIA 5HBMA 4BROA 5JICA 3SBTA 1NK4A 4EFHA 3DRPA 3OS0A 4ISFA 4I2PA 4E19A 1WUAA 4O5FA 4FZXC 4LSLA 1T3VA 4CE9A 4CHZA 2KHOA 2YNFA 2IVOA 4CJKA 3KK1A 1X9JA 3VQQA 3KLIA 4YFUA 2Q0UA 2WOMA 4H0TB 3C95A 3TAGA 4WFAL 2AP1A 3O6WA 2D5RA 5AQRA 1LAWA 4K0KK 1WAFA 4JI1K 4TSXA 4BC4A 4KREA 2F8SA 1GOBA 4DR1K 1UWBA 2WC9A 3NFAA 3VF4A 3S3MA 4L8RB 2QM1A 3HL8A 3L3VA 4N5SA 4LH4A 4BQLA 3QIPA 4LC9B 1CZBA 3HRGA 4ILHA 4J2DA 2O8BA 1RGIA 1O13A 2QWQA 1S9EA 3LAKA 3OBYA 2OANA 5EXWA 3O3FA 1P90A 3ZSVA 5BR8K 4FXDA 4JKGB 4RW6A 3CETA 4M3WA 3CCMN 2ZF5O 2FBYA 3QBWA 1NOZA 3NF6A 3VEOA 1WSJA 3O3HA 4QCLA 2ASOA 4E7LA 3HT3A 5J2QA 4DS5A 4BRQA 3S3OA 3SAFA 1LWCA 1VQKN 3LM2A 1NM1A 4XH1A 3IFRA 1TKXA 1Q9XA 3NVMA 5LJWA 4B1XB 5H1SQ 1KAZA 4LF4K 3VQ4A 3CQYA 4IOXA 4Z94A 2XO7A 2HB5A 5HOOA 1YJWN 2GX9A 2PBDA 4AH9A 5I9EB 3I0RA 3SCXA 1HLUA 5BRHA 3THYB 4JRPA 4XIUA 2FSKA 2HBKA 3CYMA 5F1XA 2OTLN 2HBMA 3ENHA 3LP2A 3DLBA 1ASUA 1VSKA 1WSHA 3K9JA 4OPHA 4F8RA 2A40A 1XC9A 3WXLA 4H5TA 2Q1NA 3I55N 4DV6K 5BREA 3TAEA 1DT9A 4NXNK 2EHGA 1NOYA 4IG3A 4U7BA 4CIEA 3SQ2A 4DSFA 3ZSZA 4YOUA 3WUHA 4CCHA 4CEOA 4F2SA 3MMVA 4CJRA 2JGUA 4M3UA 5CYMA 3GDQA 4JHDB 3SV4A 3F2KA 3WEEB 2W6LA 4CGIA 1RDUA 1BO5O 4HCBA 4DQPA 3NHGA 2YNIA 4DV7K 2IOCA 4KI6A 1YIJN 2RKIA 1Y64A 3NVKA 4CBXA 3HXMA 4B1UB 4B9VA 4B3RK 4ZHRA 3MCAB 2HHWA 4AM7A 3L2RA 3DOLA 2W41A 4NXMK 3ATVA 2CGKA 3HI0A 5JLFA 2ITMA 2UXBK 4BGBA 1HRHA 4XEIA 2GELA 3BEXA 3KK7A 5BR9A 1JLFA 4LY7A 4I9LA 3FLCO 4JYAK 2DY4A 4CFCA 3MX5A 4CJUA 1WAJA 3MX2A 5F0XA 3OVNA 4YOVA 4DFJA 1UAXA 1U2VA 3VQBA 1NK6A 4BVOA 4R79A 4N56A 4JRQA 3TTDA 1HNZK 3W3DA 4BWJA 3H45C 4JKBA 3UIQA 1DLOA 3TPQA 3SUNA 2DPNA 3TANA 4FOIA 4FCYA 4FW2A 3G10A 1BU6O 5J2MA 2F9WA 5LMUK 4KH5A 1WSEA 4JN4A 3ULEA 4CFBA 4CEQA 1Z26A 1BISA 4JI2K 3WNEA 4WQ5C 1T7PA 2A5XA 4BRCA 3U6FA 3BDPA 1HJOA 2Y1IA 5JLHA 4BRDA 2OZMA 3FZHA 4BVPA 2Z1JA 4DR5K 4CZKA 1H1VA 4CJVA 1Q86O 5GIPA 3RRHA 1GLCG 4F3TA 3AVNA 3TABA 3KWIA 4JD2A 2VGNA 3ZEUA 2X6NA 1REVA 4PY5A 1VQ8N 1RDDA 1VQ5N 2QWRA 1J9AA 4DSEA 1VQMN 3AVJA 3BF3A 3J7ZO 1GLLO 1BG3A 2ZWHA 4B8AB 4ELVA 3OYMA 5FPNA 4JEPA 1D9DA 4DHYA 4CJQA 1EP4A 3AVAA 1S5JA 3ENOA 4C8MA 5HRNA 4CJ4A 4FK2A 3QNNA 4CW7B 1VQLN 4FLVA 1QQOA 2Z1GA 4ZTFA 1NK0A 1KAXA 3H3NO 4I2QA 1RTDA 3EN9A 1P8ZA 4WYBA 5ELZA 2VQEK 3R1XA 3O9QA 1DKGD 3FE1A 2FSNA 3ENBA 5B8HA 2BE2A 2ETJA 4KHNA 1KLMA 4M3ZA 2QXFA 1J54A 4CJ7A 2PYJA 3MN7A 4A5AA 4M3TA 2ASMA 1VRTA 3LDOA 1BHLA 3VQCA 4YOYA 3L2VA 2KZZA 4FWQA 3IRXA 3DAWA 4JKDA 2WFBA 4KHWA 5AQIA 1T8EA 3QNOA 1VQ4N 4DUYK 4DQIA 1VSFA 4DQRA 3LM9A 2OZSA 4J2AA 1ZXOA 1L5UA 4O8KA 3QMLA 2NLXA 1GLJO 1HQUA 1RCHA 3F5TA 3M1FA 4DKWA 3DXMB 2QA4N 3S9HA 4CEAA 3UKUA 1QQNA 2ITGA 3UE5A 1VHXA 3ZT0A 3MAQA 1ZYQA 1C0TA 1C6VA 1JLAA 4AILC 2A3ZA 1RTHA 3DRSA 4WFBL 4O44A 2P9SB 3OHRA 3CCUN 1W7AA 5AQKA 4FWOA 3AO2A 4AHCA 4A57A 2VG6A 3FZFA 4DTXA 3ZLJA 3DMJA 1QVFM 2Q2RA 1EWQA 5C24A 3EZWA 3HK2A 4FJJA 3E66A 3P5JA 4KPYA 4O8UA 2I7PA 4BGAA 3T3FA 4K43A 4JKCA 4AHRA 4E7HA 3OBWA 5EX5A 2WONA 2QTDA 4JV5K 3RMAA 1K8KA 4IO8A 4FK4A 4K42A 1EQYA 3TTCA 2HMPA 2YI1A 1NMDA 1QZ6A 3H46O 3OYJA 4OPJA 1BOTO 3ZETA 4KFBA 3VEWA 3NMUA 4V19S 2P9PB 1NLVA 2EX3A 5HLFA 4DTSA 3KHYA 5E26A 4OGEA 3CC7N 4GV3A 2H3GX 2A42A 4DQ8A 5J2PA 3VESA 4CECA 1QQCA 5GIOA 1SL2A 1UA0A 3AAPA 1JLCA 2JWLA 1L3SA 2HHVA 3HP9A 4QOZB 2D1KA 1XWLA 2X74A 2VWBA 4FWNA 3PIPL 2KZMA 4ZTJA 4CF1A 2I7NA 4IEIA 4IOAL 4PKIA 4IWVA 3MEDA 4BG9A 1OH8A 3DOKA 3UKRA 3HPHA 3JS6A 4NYNA 2KLAA 3H3OB 1C1BA 4E1NA 3L4QA 2O8CA 4CJ3A 4FJ5A 4CBWA 4GKKK 3FFKB 4KO0A 2O4IA 4HTLA 4FPAA 3QEVA 5AQVA 2FSJA 2W42A 3OYIA 2DFEA 2QWPA 4I7FA 3VGKA 3OYCA 4KV8A 3AV9A 3A5MC 4DTJA 4PUOA 1EO1A 4N47A 3N4PA 5KRSA 2IGIA 4CVNE 4W5OA 3CFOA 3EKUA 3K9KA 3ASMA 3TU5A 5AQGA 1O1WA 3QDKA 5M1NA 2P9UA 1ASWA 4PHTX 4CD3A 1ATRA 1C1AA 2NRXA 3H08A 4FLXA 4M7XA 2E5LK 1U6ZA 1ZBHA 5MLCQ 3CQ8A 3D2EB 4K8ZA 3OS2A 4AHVA 1NGGA 4EZ9A 4LF6K 3VA0A 2QKBA 3PLAA 2Q3SA 4YOWA 5C42A 3OJUA 1NU0A 2NRWA 4X64K 3GBTA 1TVRA 4CFDA 4FM0A 4A2BA 4PWDA 3OYHA 4E1MA 2KQ2A 5AR0A 4FM1A 4DTOA 4FLWA 1QSYA 1HKBA 4H0VB 1Q82O 3PO4A 3UB5A 4WQ4A 4OLBA 3NBPA 3HPOA 1TKTA 3PIOL 3VPZA 4BR7A 1VQ9N 3LDSA 2E88A 3BUZB 1NMNA 2P9KB 3ZSOA 5AQWA 3CERA 4CZHA 2HBJA 1IG8A 1IKVA 3SPYA 1GOAA 3WXJA 1W97L 3VQ5A 5EU7A 3AVCA 2G8UA 3IMXA 3MDQA 1V4SA 4CZEA 4KKOA 5GAEP 5KPRA 1W2BM 3KIOA 5CZ2A 4CIGA 4EZ6A 2O4GA 1DTQA 3U4LA 4CIFA 3RMCA 1KFSA 3G4SN 1KQSM 4IJAA 3WNHA 4YDUC 1GLDG 3PX6A 1Z05A 2NRZA 1XNQK 4BE1A 4CFAA 3TAMA 3AAQA 3CCVN 1BI4B 3HM8A 3VGLA 2HHTA 3SK3A 1RT3A 5C10A 3AVKA 4DTPA 2FBVA 3DXKB 3CJ1A 4RWTA 1KRPA 5AZJB 1VSJA 3CM5A 1ATSA 1JL1A 4CD1A 3AVBA 3WXMB 3TSUA 3KLEA 4M3YA 1QSSA 4KHUA 2G8IA 2O8DB 1VAZA 3CI5A 1WSIA 3OA9A 3THXA 4OLAA 1NJXA 4CJEA 4JI8K 4BACA 4E7KA 3GG4A 2B5JA 4A2AA 1L3UA 1NGIA 5CE3A 3EYZA 3CCRN 2ZQBA 3THWA 3IG1A 4W5NA 3R6MA 4JKHA 3VMFB 1HMVA 4DLGA 2VCPA 5JS2A 2P9NB 3MK6A 4MDBA 4KHYA 2UU9K 4JKGA 1RT1A 3NH1A 1XMQK 3VQ6A 5KQ8A 3O9SA 4BDYA 3THVA 1NK5A 2O8FA 4BRAA 4FJXA 1L3VA 3BGRA 3NAEA 4DTUA 3HTVA 3BF1A 1TKDA 2NRHA 4QS8A 4K41A 1ZC6A 3ZYYX 5BRFA 4B08A 4DU4A 5KGXA 1YITN 4Z4GA 4YHHK 3NH2A 3KLHA 3LP1A 3AY9A 3AGRA 3D2FA 4FZYA 4W5QA 2YHXA 4DV1K 2Q0RA 2OYQA 3M8SA 2WUSA 4DSIA 4OKEA 4I9QA 1D5AA 5AQXA 3TAQA 4H03B 4DSLA 1RDAA 2RF2A 3GE1A 2QXLA 5LMNK 4FWLA 3S3NA 3RMBA 4CEDA 3E9PA 1N32K 3SMSA 4I6MB 4FLUA 3PX4A 3SLCA 2AJQA 5M1OA 4OPKA 2GUIA 4CEFA 1Q9YA 3IKMA 3AA5X 2YHBA 5DK5A 2RE2A 1YXQA 3M8QA 5M1FA 4CJSA 1NBWA 4BR5A 2OA8A 4FJNA 2FF6A 1HYSA 1VSIA 4DQSA 5JMVA 1U48A 3TSQA 2A41A 3NDKA 4B3MK 4FJ8A 3E9OA 3AVFA 3L4IA 5FDLA 1SKRA 2GWKA 1B9DA 3WEEA 2IC3A 3LPTA 4GY2B 3QEXA 1Q7YO 3RR7A 1G15A 4CZGA 2E2QA 3M5RA 3T1AA 3LPUA 2NZTA 3I33A 3TWHA 4FM2A 3RMDA 4OGCA 3AO3A 4O4GA 2PAVA 4HCCA 4F2RA 4CK1A 4KTZA 3JAMO 4IKFA 4B9QA 4UY8O 2DFFA 3P38A 1YJNN 5TKWA 3ID8A 3QFUA 2OPPA 4B1YB 4NLBA 2O8BB 3SBGA 4JK9A 5BPLA 3O5BA 1WB9A 1X9SA 3LANA 3L0QA 3R8EA 3D6RA 4IBNA 5AQMA 3LP0A 2D0AA 4FO0A 4EAHD 3K5OA 1BQNA 4IG0A 3PUFA 1NWKA 1SL0A 3J80O 2HHSA 4CK3A 1NGDA 4BR9A 3J8AA 4CGJA 2QKKA 4NCBA 4LFBK 3CM6A 3CCQN 5JVHL 3AVMA 2ZD1A 2QW9A 2BANA 3V1QA 1HNXK 4CZFA 2YX6A 2HHUA 4O5BA 4A5BA 2NRRA 4Y1CA 4FLYA 2GEMA 3O4NA 4GNIA 4HUGA 2HHQA 1LCUA 3LWMA 4KH4A 1R0AA 1OKJA 4BDPA 1IKXA 3PX0A 4IFEA 1BWFO 1Q18A 1RDBA 1X1PA 2E6MA 1BIZA 3W0LA 4CHPA 4DF4A 3OYLA 3FGUA 2V7YA 1CXQA 4BRLA 1HQEA 1LW2A 3HPGA 4BG8A 3O4QA 3AGKA 4BC2A 1RTIA 3N4QA 2YCHA 4AM6A 1U4BA 1U04A 3DLRA 1QE1A 4JS5A 2G8WA 2A1SA 4H4MA 2YKMA 4FJIA 1HUXA 3SMPA 1QHTA 4RTFD 2Q31A 3KJVA 1QVGM 3TAPA 2VG7A 3J7YP 3FZLA 1VQ7N 1BL3A 3WNGA 3RR8A 4AF1A 5T7BA 4MO5A 2XY8A 1B92A 1HNIA 1NGEA 2Y1JA 5AQQA 3WXIA 3L8BA 1KCFA 3LAMA 4IFVA 1MWKA 4FK0A 3VF6A 3O9RA 5BPMA 3AVHA 5HRRA 4DR6K 1OVQA 1XQSC 3J81O 3U3YA 2YV0X 4JI4K 5AQUA 2G8KA 2NRVA 2ZE2A 4BRGA 2G8VA 1YTAA 5FRNA 1ASVA 1KXPA 3RRGA 3P83D 3WQTA 3NF7A 5AQNA 4BQZA 3CCLN 2YHYA 1I39A 5ADXA 5FRMA 2HNZA 1JXBA 3ZX0A 3K59A 1SV5A 3SUQA 4RG8A 1HPZA 3Q7CA 3O3GA 1U2VB 2GBZA 5FPDA 3HM9A 1D9FA 3VQ8A 4LF7K 2HHHK 4FJMA 1XHZA 1VSEA 4A62A 3R9PA 3P31A 1KLNA 5M1QA 4RW8A 1NGJA 1YI2N 4CF9A 3OJSA 4JS4A 4FJ7A 2OPRA 3FFIA 3F73A 2HF3A 1BCMA 3ULEB 3NE6A 2UUCK 4FVUA 3E1YA 1NJWA 2QK9A 1NKBA 1A5WA 4EHUA 4YY3K 3K57A 1WSGA 3MXJA 1K73O 1FKOA 4J2EA 4FVMA 3QEIA 5EY4A 1NGFA 3CCSN 4DV4K 4J8FA 4DV5K 3CF5L 3CPWM 4JD2B 4DFPA 1NKCA 1S3XA 3ZEUB 3ALYA 3VA3A 1TYQA 4J2BA 2YKNA 3EL2A 1UOCA 2RHKA 3ZX2A 4QS7A 1FJGK 2KTQA 2DTUA 5HRPA 4BRNA 1A5XA 4BRKA 4ILGB 1I94K 2KKZA 3RSEA 1K6YA 4PA1A 3SNNA 4Z4CA 4Z4EA 1A5VA 4YOXA 1VSHA 2XY7A 1TUUA 3A8YA 4CEZA 4YNQA 1ZBFA 3ZSRA 4FLZA 4E1JA 3OYBA 3MN9A 2XRIA 4LFCK 3MEEA 5AZIB 5KI6A 1KD1O 1WNSA 3QETA 3OW2M 2HF4A 5BPNA 4LF8K 4DTMA 4DV0K 3QEPA 3HBTA 3FZKA 4E7JA 4GKJK 1J5EK 5I42A 4BWMA 4BRFA 5EVZA 2E8AA 2ATQA 4DU1A 1RT5A 4M45A 2QWOA 3C94A 2P9LA 1IBKK 1R59O 1OH7A 1TUYA 4FOEA 4Z4FA 5HL7L 4FPBA 2DFHA 5AQLA 5IWAK 3RWUA 1VK0A 4PKGA 4PL7A 3V9WA 4FWPA 4CJWA 1OVYA 1GLEG 1YUWA 3UKUB 4DTNA 3K58A 3E9LA 3ZSWA 4B1VA 1S1TA 2EWSA 3CJAA 1NK8A 1RILA 1U49A 2O8EA 4GV9A 2HVIA 4B9UA 4B8CA 3C6HA 4DS4A 1IG9A 3OY9A 4GVMA 3AO5A 4CGFA 3I56N 1NJYA 3QINA 2UXDK 1N36K 3CCEN 4KB1A 1X9MA 1JCGA 3KKSA 3SPZA 5F2RA 3ULDA 3RTVA 5DMRA 1D4XA 5C2FA 3ATUA 4CZJA 3TI0A 3EY1A 2OPSA 3T69A 2XY5A 3LDNA 4JNEA 4Z0UA 4HWIA 1RT7A 1MA9B 4JKFA 4BR0A 3TSPA 1K8KB 2V52B 1QS4A 3OYEA 3DLHA 1TV6A 3WT0A 4IXCA 3D7EO 3ITHA 4OKKA 1GLFO 4QAGA 4EIAA 1JLBA 4HUEA 4FW1A 1VRUA 1JLQA 3ZETB 1S1WA 3ZT1A 3FZMA 2VGMA 3DM2A 2IAJA 4HUFA 1OH5A 4W5TA 2FC0A 2IVNA 3DYAA 2HNDA 3IUCA 4DQQA 2J4RA 1ATNA 3QIOA 4CF0A 5ADXH 2QEXN 1KSPA 3ZT3A 2WTUA 4Z4IA 3P1GA 2JWKA 5AQYA 1CZ9A 1LW0A 1FK9A 3DLEA 1BIUA 4GV6A 2HNYA 4ISEA 4KH6A 3KZBA 5C25A 5LL6Z 2F7TA 4BRPA 4FLTA 4YORA 4CHNA 3SQ4A 4B1ZA 3KWGA 4FJHA 1IBMK 3DLGA 2A6AA 4CEBA 1IV0A 1WLJA 1NKEA 4KI4A 2P9IB 4WE1A 4IZ9A 4DFMA 2HSTA 2B4JA 3FR0A 2HVHA 4CJLA 3QICA 1N8RO 2O8CB 4DR2K 2PYLA 2E1ZA 2AA4A 3SUPA 2BGGA 1ITGA 5KPZA 4KTWA 1JXEA 1S6QA 3DXKA 4MFBA 1QZ5A 3TARA 4JK8A 3AA4A 1T6CA 4IDHA 1KFDA 3HSCA 4MLEA 3D45A 3IAYA 1LAVA 5GAHP 1V4TA 3SQ0A 2P9UB 5A2QO 5D3GA 3C7NA 2ASPA 3V1OA 4BC3A 2XY6A 5HRSA 5I3UA 1SS6A 1X9WA 3H6EA 4FJ9A 3DJCA 3M6GA 1NG9A 4OO1J 3PSIA 3U8XA 4CJPA 1IBLK 1M90O 4WCEL 3SJHA 4JKAA 3L6QA 3K5LA 4H4OA 1QSLA 3U9ZA 3TR8A 1EKEA 2KFNA 3VGMA 4DV2K 5HP1A 4K8XA 1CZAN 2ZJPL 4DV3K 3V9SA 1WN7A 2NRTA 2IS3A 1RT6A 2VWKA 4X62K 2BH1A 1HR0K 1JCFA 3V6DA 1NGBA 1U45A 2RPIA 3LDLA 2Z1HA 4IFYA 3CC2N 1HKGA 3A5LC 4FL9A 3VERA 1KC8O 3VTHA 3I0SA 4XH5A 5DM7L 2VQFK 3O9TA 4E89A 5M1PA 3ZX3A 1SUQA 2GV9A 1K9MO 1FKPA 4DU3A 5BRDA 4CHOA 2QI2A 2OTJN 3T1HK 3U9DA 1J5OA 4H0OA 2D4WA 2BDPA 2YNHA 5AQSA 1XI1A 2ZJRL 1UA1A 1NJZA 4W5RA 1N33K 5AFUA 1Y97A 3AARA 4Y0WA 2V7ZA 4H5NA 4E7IA 1S1UA 1GOCA 3M8PA 4Q5VA 2I5JA 2FXUA 3SI6A 3OYGA 3P39A 1MWMA 3LALA 4DR3K 1VSMA 3OYNA 1JJ2M 1TK8A 5GADP 2VYPA 3NF9A 2JLEA 3E01A 1BGXT 4DB3A 5LY3A 3ZSYA 1S6PA 4M41A 1QQMA 4JI0K 3LZIA 2HHXA 1T03A 4JI5K 5AQFA 3WQUA 3CIPA 1WSFA 3CJCA 4C1NK 3HO1A 1W9HA 3DI6A 4B9LA 3THYA 4M63C 3DWLA 2PY5A 4DFKA 5AQOA 3AVIA 3CJ7A 3THXB 3HOSA 3A0IX 4ELUA 2D0BA 2BTFA 1CXUA 4CJTA 1IKYA 4LF9K 4M7YA 1Z6RA 1RBTA 2XHBA 1RT4A 2CGJA 3A5NC 3THWB 3KD5E 4KAZA 3QBXA 3ZSQA 5BN8A 1SKWA 1EWRA 2WBNA 1JLGA 4B9NA 1RNHA 4LFAK 4IEEA 1IJJA 1NGAA 1YVNA 1WBBA 4CF8A 1RDWX 1XMOK 4CK2A 4C8NA 4O0IA 2O8FB 3D0PA 1JCEA 4ID5A 4OPAA 4GW6A 3VEVA 2P5OA 1J6ZA 2QWMA 1GLAG 4JHDA 2OPQA 4X66K 4Q0BA 3D2FB 2E2PA 4H8KA 3RVCA 4NYFA 2UYTA 4X65K 4BRIA 1TAQA 3QB0A 4YOTA 3OS1A 4AHTA 1Z25A 4AHSA 3LWLA 1VQON 4CF2A 1YF5L 2YHAA 4IDKA 1X3MA 3CCJN 1NGCA 3ZT4A 4H0XB 4MLHA 1RDCA 4XH4A 3QFPA 4B3SK 3KTQA 3K5MA 3KK2A 3AA3A 1HPMA 5FPMA 1T05A 1RT2A 3C6AA 5LJVA 4H5VA 4IOCL 3ID6A 3DLLL 3I8DA 1HNVA 5BN9A 1SQKA 3EO3A 3CC4N 2CGLA 1TK5A 1NJIO 3ZCMA 1ZBIA 2E4LA 1NK9A 1KTQA 1VQ6N 3L2WA 4FSVA 3ZT2A 1SAZA 4PL8A 5J2NA 3MN6A 3LDQA 2B6AA 4CEEA 4EP5A 4CERA 4KB0A 3O08A 3KD1E 1IH7A 4AHUA 4DR4K 1HYZA 4BREA 4GVEA 4KTQA 2D0OA 4DTRA 4Z4HA 3EE9A 1YJ9N 2RN2A 4LF5K 2PFUA 1YTUA 5J1EA 1YAGA 4H0PA 2E2OA 3PV8A 1LV5A 5C0YA 4FWSA 5CZ1A 4M42A 5CHIA 3BY5A 4DCHA 3C65A 2W6KA 3V9UA 3HOTA 5SZTA 1Q8IA 4OX9K 4EHTA 1KVBA 2GUPA 5CR4A 1E4FT 2ZJQL 1CLQA 1GLBG 3VEYA 4ICLA 4OVLA 1F21A 4CI6A 1KVCA 5AFUH 1HNWK 3L3UA 1EX4A 3JXUA 5HROA 3QEWA 2Q97A 3IS9A 1HYVA 1XUPO 4RW4A 3VQPA 4KBOA 5C2DA 3VOVA 2BUPA 2E2NA 3LP3A 5KPTA 3EZ5A 1FW6A 4F3OA 4BE0A 2G8HA 1C0MA 2HOEA 3MCPA 3V9XA 2UXCK 3BZKA 5E84A 3C6TA 4C1NI 3HVTA 4E3SA 4KHPK 1BA0A 4B1WB 3MECA 3EE8A 4FJGA 4CHYA 3V9ZA 3VQDA 2HW3A 3O80A 5KTQA 3KLGA 2YNGA 3QESA 4C8OA 4MO4A 3DXMA 4C8LA 3PSFA 3KK3A 4B9TA 1S9GA 3B6OA 4C23A 3H1QA 1Q81O 4OKJA 4WQ5A 3G71N 2P9SA 4CZLA 3HP6A 2FBXA 3V1RA 3R3LA 4JLHA 4NLCA 1FXXA 4BR2A 1XHXA 3O1WA 3NCIA 3PY8A 3I8BA 3M3ZA 3OYAA 3Q7BA 3AA2A 3NH0A 3LDPA 4CJFA 1L3TA 2F9TA 1NK7A 3V81A 3HSTB 2D0PA 2KW4A 1RTJA 2IIRA 1W0HA 3G0ZA 3NGZA 3KLFA 3NGIA 4IJNA 4BY9C 5AZIA 4N76A 4CJ5A 3K2PA 1TK0A 1WBDA 5JS1A 5KRTA 3ZSXA 3A2FA 3MXIA 3F9MA 3O8MA 4EP4A 3ISNC 3AVLA 3P4IA 2NNWA 2G8FA 2E1YA 2Z1IA 3EEQA 3O4WA 5AJ3K 2R7YA 3MWTA 4RW9A 2IDOA 4ILJA 3VQ7A 2P9PA 3KKRA 1NNEA 1EXQA 1G99A 3AO4A 3L2UA 2GWJA 1RBUA 1ZBSA 4CZMA 4LD0A 1TKZA 5E41A 4DR7K 1BCOA 1IO2A 1N5YA 3CFPA 5FLXO 1WOQA 3BZCA 3QO9A 1TL1A 4RCHA
chains in the Genus database with same CATH topology
4B1ZA 2WUSA 3FLCO 3KWGA 3VEZA 5AQHA 4BRHA 2A6AA 3CMAN 3CMEN 3O9UA 2P9IB 3MX5A 5AQXA 4IZ9A 5F0XA 3MX2A 4H03B 2HSTA 4YOVA 3FR0A 3EKSA 3QICA 1N8RO 5JVGL 1U2VA 3GE1A 4G9ZA 2QXLA 4MDAA 2E1ZA 4BVOA 5C12A 3SAHA 2AA4A 4QS9A 4R79A 4FWLA 3TTDA 4JKEA 3W3DA 5KPZA 3CC2N 3E9PA 4FWMA 3SMSA 3DXKA 4H5WA 3H45C 4I6MB 1QZ5A 4JK8A 2FLOA 4NO7A 4JKBA 3SLCA 3TPQA 2DPNA 5M1OA 4FOIA 1T6CA 4IDHA 4MLEA 3HSCA 1BU6O 3IKMA 3CD6N 2F9WA 4KH5A 1M1KO 3CPEA 2RE2A 1YXQA 4JN4A 3ULEA 5M1FA 5GAHP 1NBWA 1V4TA 4BR5A 2P9UB 3C7NA 2ASPA 4BC3A 4JAXA 4WQ5C 1T6DA 2A5XA 2FF6A 1SS6A 4BRCA 5JMVA 1C0GA 1HJOA 3MN5A 5AQTA 3CJ9A 3H6EA 4BRDA 5JLHA 3FZHA 3DJCA 3TSQA 3M6GA 4BVPA 5DM6L 1TYQB 4OO1J 4CZKA 2A41A 1H1VA 3E9OA 3U8XA 1Q86O 3L4IA 1BDGA 4F9OA 4WCEL 1M90O 5GIPA 2GWKA 4WFNL 1GLCG 3SJHA 3WEEA 3KWIA 4GY2B 4JD2A 2VGNA 2ZGYA 4JKAA 3L6QA 3ZEUA 1Q7YO 3MWPA 4FWRA 3U9ZA 4CZGA 3D2EA 1VQ5N 1VQ8N 2E2QA 3RSEB 3WXKA 4L3QA 3M5RA 2QWRA 3VGMA 1VQMN 2HBLA 2GTDA 3BF3A 2NZTA 3I33A 1GLLO 1BG3A 5FPEA 3J7ZO 1CZAN 3VENA 2ZWHA 1KAYA 2ZJPL 1DEJA 2PAVA 5FPNA 4JEPA 2NRTA 4DHYA 4FWKA 3VEXA 1C0FA 3ENOA 1HX1A 2BH1A 4B9QA 4WF9L 4UY8O 1JCFA 1NGBA 2V51B 3LDLA 3P38A 3T7ZA 1YJNN 5TKWA 3ID8A 1VQLN 3QFUA 1HKGA 3A5LC 4FL9A 3VERA 4BRMA 4B1YB 4NLBA 4CBUA 1QQOA 2CH6A 3VTHA 3VETA 1KAXA 4XH5A 5DM7L 3H3NO 3SBGA 3O9TA 3CHWA 4JK9A 3O5BA 5M1PA 3ZX3A 5BPLA 3EN9A 3L0QA 1P8ZA 4NB4A 4WYBA 3D6RA 3R8EA 1K9MO 5ELZA 2P9IA 3R1XA 5AQMA 5BRDA 3GL1A 1ILYA 3O9QA 2QI2A 4FO0A 4EAHD 5GINA 1DKGD 3FE1A 2FSNA 2OTJN 3ENBA 1NWKA 3U9DA 5B8HA 4H0OA 2D4WA 1NGDA 4BR9A 2P9LB 3J8AA 4CJ7A 3GOIA 3MN7A 5AQSA 4H0YB 3CQXA 4A5AA 4K25A 2ZJRL 3CCQN 5JVHL 2ASMA 2QW9A 3LDOA 4CZFA 2YX6A 4YOYA 5AFUA 3AARA 4Y0WA 2V7ZA 1RFQA 2P9KA 4FWQA 4H5NA 4A5BA 3DAWA 4JKDA 2WFBA 2NRRA 5AQIA 1LOTB 2GEMA 1VQ4N 4GNIA 2FXUA 2E20A 3CXCM 1LCUA 3LM9A 3P39A 1MWMA 4U67L 1ZXOA 4KH4A 3B8AX 1OKJA 4O8KA 3QMLA 4IFEA 2NLXA 1BA1A 1BWFO 1GLJO 4WQ4C 3F5TA 4BR4A 3A5OC 3M1FA 3DXMB 4DKWA 1Q18A 2QA4N 1JJ2M 3UKUA 1QQNA 3UE5A 5GADP 2VYPA 3W0LA 2A3ZA 4DB3A 5LY3A 3FGUA 4WFBL 2P9SB 2YJFA 3OHRA 3UKRB 3CCUN 5AQKA 1QQMA 3IDHA 2IVPA 4FWOA 2V7YA 4BRLA 4A57A 1QHAA 5TKYA 3FZFA 3G25A 5AQFA 3WQUA 3CIPA 4BG8A 3CJCA 4C1NK 3AGKA 2FF3B 4BC2A 5AQPA 3N4QA 4M63C 3DWLA 2YCHA 4AM6A 1QVFM 2Q2RA 5AQOA 1T44A 3CJBA 5KQDA 3CJ7A 3EZWA 3HOSA 3A0IX 5AZJA 1HUXA 3H1VX 3SMPA 5C15A 2BTFA 4RTFD 3E66A 4M7YA 1Z6RA 2Q31A 4O8UA 1QVGM 2CGJA 3A5NC 2I7PA 4BGAA 3FZLA 4K43A 2QWLA 4JKCA 3OBWA 3QBXA 1VQ7N 3LL3A 5BN8A 4AF1A 5EX5A 4MO5A 2WBNA 5M1KA 2QTDA 1K8KA 1NGEA 4IO8A 1XC3A 4IO9L 4IEEA 1IJJA 4K42A 1EQYA 3TTCA 1NGAA 1YVNA 1NMDA 2HMPA 2YI1A 5AQQA 3WXIA 1QZ6A 1RDWX 3H46O 4A61A 1K8AO 1BOTO 3ZETA 2P9NA 1MWKA 1JCEA 4OPAA 2ZGZA 3VEVA 2CH5A 3VEWA 3VF6A 1YHQN 1J6ZA 3NMUA 2QWMA 1GLAG 1NLVA 2P9PB 3O9RA 4JHDA 5BPMA 1E4GT 1VQNN 3KHYA 1XQSC 5E26A 3CC7N 3D2FB 4GV3A 4ISGA 2H3GX 2E2PA 2A42A 4DQ8A 3RVCA 5AQUA 2UYTA 3VESA 4BRIA 2NRVA 5GIOA 4BRGA 3AAPA 3QB0A 2JWLA 4YOTA 1KXPA 4JK7A 1VQON 3WQTA 1DGKN 1YF5L 5AQNA 2YHYA 4BQZA 1S72N 5EOYA 3CCLN 1X3MA 5ADXA 2YHWA 3CCJN 1NGCA 4PKHA 2D1KA 3ZX0A 1HKCA 4H5RA 4H0XB 4MLHA 2VWBA 4FWNA 4XH4A 2Q36A 3PIPL 3QFPA 3G6EN 4XEIA 3Q7CA 3HZ6A 1U2VB 1MDUB 5FPDA 3TTFA 2I7NA 3BP8A 4IEIA 4IOAL 4PKIA 4IWVA 4BG9A 1VQPN 3UKRA 3VF2A 2YJEA 2QWNA 1HPMA 3JS6A 5FPMA 2KLAA 3O1BA 3C6AA 3H3OB 4A62A 5LJVA 3L4QA 4H5VA 3P31A 3R9PA 4A59A 4IOCL 3ID6A 5M1QA 4BC5A 4CBWA 4CZIA 3DLLL 3FFKB 1NGJA 5BN9A 1SQKA 1X3NA 3EO3A 3CC4N 4HTLA 1YI2N 4FPAA 2CGLA 5AQVA 2FSJA 1NJIO 4I6MA 4YDUA 1BUPA 2HF3A 3ULEB 1SZ2A 2QWPA 2W40A 1S22A 3VGKA 4FVUA 3C7NB 1VQ6N 3C0BA 3A5MC 4FSVA 3E1YA 3KVGA 1EO1A 1SAZA 4PL8A 3S41A 3N4PA 5GAGP 3MN6A 5AQJA 4EHUA 3EKUA 3SAGA 3LDQA 3K9KA 3TU5A 5AQGA 5AQZA 3QDKA 1K73O 5M1NA 2P9UA 3O08A 3VTIA 4PHTX 1ESVA 1NGHA 4CD3A 1ATRA 2NRXA 4BROA 5EY4A 5JICA 1NGFA 3CCSN 4J8FA 4M7XA 3CF5L 3SBTA 3CPWM 4JD2B 1S3XA 1U6ZA 3ZEUB 4EFHA 5MLCQ 4BREA 1TYQA 4GVEA 3D2EB 2D0OA 4ISFA 1WUAA 3EE9A 3EL2A 4O5FA 1YJ9N 1T3VA 2RHKA 3ZX2A 4QS7A 2KHOA 1NGGA 2PFUA 4BRNA 2IVOA 1X9JA 4BRKA 4ILGB 1YAGA 4H0PA 2E2OA 3PLAA 2Q0UA 2KKZA 4H0TB 5C0YA 4YOWA 3RSEA 4FWSA 5CHIA 4WFAL 2AP1A 2NRWA 4DCHA 3C65A 3O6WA 5AQRA 1KC8O 4YOXA 3GBTA 3HOTA 1TUUA 4A2BA 3A8YA 4EHTA 4BC4A 2GUPA 5CR4A 4E1JA 3VF4A 2WC9A 3MN9A 1E4FT 2QM1A 5AR0A 2ZJQL 1GLBG 3VEYA 4BQLA 4LC9B 5AZIB 1KD1O 4CI6A 3HRGA 4ILHA 5AFUH 2HF4A 5BPNA 3OW2M 1RGIA 1O13A 2QWQA 1HKBA 3JXUA 4H0VB 1Q82O 3UB5A 3OBYA 4WQ4A 2OANA 5EXWA 3HBTA 3FZKA 2Q97A 3PIOL 1P90A 1XUPO 4JKGB 3VPZA 4BR7A 3CETA 1VQ9N 4KBOA 4BRFA 3CCMN 2E88A 3BUZB 5EVZA 2ZF5O 5C2DA 2P9KB 2E2NA 2E8AA 2BUPA 3QBWA 3VOVA 5KPTA 2QWOA 5AQWA 3VEOA 2P9LA 2ASOA 1R59O 3CERA 4CZHA 2HBJA 1IG8A 1TUYA 4FOEA 2HOEA 3MCPA 3WXJA 1W97L 5HL7L 4FPBA 5AQLA 5E84A 4BRQA 4PKGA 3SAFA 1VQKN 3IMXA 4PL7A 3MDQA 1V4SA 3LM2A 1NM1A 4FWPA 4C1NI 4CZEA 1OVYA 4XH1A 1GLEG 5GAEP 3IFRA 1YUWA 5KPRA 1BA0A 1W2BM 4B1WB 3UKUB 3NVMA 3E9LA 3EE8A 4B1VA 4B1XB 5LJWA 5H1SQ 1KAZA 2EWSA 3CJAA 3O80A 3CQYA 3U4LA 4GV9A 4IOXA 4MO4A 3DXMA 3G4SN 1KQSM 4Z94A 4IJAA 4YDUC 1GLDG 3C6HA 1Z05A 2NRZA 5HOOA 1YJWN 2GX9A 2PBDA 3AAQA 3CCVN 4C23A 3H1QA 5I9EB 3I56N 1Q81O 1HLUA 5BRHA 3HM8A 3VGLA 4WQ5A 3G71N 2P9SA 3SK3A 4CZLA 3CCEN 2FSKA 5C10A 2HBKA 5F1XA 1JCGA 2OTLN 2HBMA 3R3LA 5F2RA 3DXKB 3CJ1A 4NLCA 4RWTA 3ENHA 5AZJB 4BR2A 1ATSA 1D4XA 5C2FA 3ATUA 3O1WA 4CD1A 4CZJA 3I8BA 3K9JA 3M3ZA 4OPHA 2A40A 3WXMB 3TSUA 3Q7BA 3WXLA 1VAZA 3LDPA 3CI5A 4H5TA 3OA9A 2Q1NA 3T69A 3I55N 2F9TA 3LDNA 5BREA 4JNEA 1DT9A 4HWIA 1MA9B 2D0PA 4JKFA 2IIRA 3TSPA 3GG4A 1K8KB 2V52B 4A2AA 4BR0A 4U7BA 1NGIA 5CE3A 3CCRN 4IJNA 4BY9C 3WT0A 4IXCA 3D7EO 5AZIA 4YOUA 3WUHA 1GLFO 3R6MA 4JKHA 3VMFB 4EIAA 2VCPA 3MMVA 3ZETB 2P9NB 3FZMA 3MK6A 4MDBA 2VGMA 3GDQA 4JHDB 4JKGA 3F9MA 3F2KA 3O8MA 3WEEB 3P4IA 5KQ8A 2IVNA 2NNWA 3O9SA 1RDUA 1BO5O 4BRAA 3IUCA 2E1YA 2J4RA 1ATNA 3O4WA 5ADXH 3HTVA 3MWTA 3BF1A 2QEXN 2NRHA 1YIJN 4ILJA 4QS8A 4K41A 1ZC6A 2P9PA 1Y64A 3ZYYX 3NVKA 1G99A 2JWKA 4CBXA 5BRFA 4B1UB 1YITN 5AQYA 2GWJA 3MCAB 1ZBSA 4CZMA 3AY9A 3AGRA 4AM7A 3D2FA 2W41A 4GV6A 3ATVA 4ISEA 3KZBA 4KH6A 2YHXA 2CGKA 1WOQA 3HI0A 5JLFA 2F7TA 2ITMA 4BRPA 4BGBA 2Q0RA 4YORA 2GELA 3KK7A 3BEXA 4RCHA 5BR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAZ A;  1SS6 A; 
#chains in the Genus database with same CATH topology
 3VEZ A;  5AQH A;  4BRH A;  3CMA N;  3CME N;  3O9U A;  1D8Y A;  4LH5 A;  3PO5 A;  1YVU A;  3EKS A;  5FRO A;  5JVG L;  4DLE A;  4G9Z A;  3AO1 A;  4MDA A;  2F96 A;  5C12 A;  3SAH A;  4QS9 A;  1TGO A;  4JKE A;  3SZ2 A;  1KVA A;  4NCG A;  4FWM A;  4G1Q A;  1E3M A;  4H5W A;  2FLO A;  4PQU A;  4NO7 A;  3DRR A;  2P51 A;  4JI3 K;  3WNF A;  4DUZ K;  3CD6 N;  4FYD A;  1OH6 A;  1M1K O;  3CPE A;  3K5N A;  3DLK A;  1S1X A;  4B3T K;  4JAX A;  1T6D A;  4CGG A;  1LWF A;  3CG7 A;  1C0G A;  3MN5 A;  5AQT A;  3CJ9 A;  4B3O A;  5DM6 L;  1TYQ B;  1BDG A;  4F9O A;  1DTT A;  4WFN L;  3QER A;  1ZBU A;  4DSK A;  4E0D A;  1TL3 A;  4CHQ A;  2ZGY A;  3MWP A;  4FWR A;  3D2E A;  3TAF A;  3RSE B;  3WXK A;  4L3Q A;  3T19 A;  2NUB A;  2HBL A;  2GTD A;  5FPE A;  4Y1D A;  3VEN A;  1KAY A;  1DEJ A;  2D0C A;  1JLE A;  4FWK A;  3SQ1 A;  3NGY A;  3VEX A;  1C0F A;  3OYK A;  1HX1 A;  4WF9 L;  2P1J A;  1N34 K;  2V51 B;  3T7Z A;  4BRM A;  3SUO A;  4CBU A;  2CH6 A;  2A1R A;  3VET A;  1YT3 A;  1SKS A;  3CHW A;  1B9F A;  4NB4 A;  3L2Q A;  3VQA A;  2X6S A;  2P9I A;  3GL1 A;  5SWM A;  1ILY A;  1HJR A;  1EET A;  1I3A A;  3F9K A;  5GIN A;  4B9M A;  4AQY K;  5CYQ A;  4DF8 A;  4BDZ A;  2P9L B;  3GOI A;  4H0Y B;  2X78 A;  3CQX A;  4K25 A;  4O0J A;  4RW7 A;  2LSN A;  2P5G A;  1RFQ A;  2P9K A;  3J7A P;  1LWE A;  1LOT B;  1XNR K;  3VQ9 A;  2E20 A;  3CXC M;  4U67 L;  4FJL A;  1VSD A;  4DG1 A;  3B8A X;  3M8R A;  1VSL A;  1BA1 A;  2O8E B;  4WQ4 C;  4BR4 A;  1RBR A;  3A5O C;  4CGD A;  3AVG A;  3SJJ A;  4HHT A;  4UQG A;  3SV3 A;  2YJF A;  4ID1 A;  3UKR B;  4BE2 A;  3IDH A;  2IVP A;  4JI6 K;  4DSJ A;  1QHA A;  5TKY A;  3G25 A;  1SL1 A;  1RBV A;  2F8T A;  1BI4 A;  2FF3 B;  1N6Q A;  5AQP A;  3U3G A;  1C0U A;  1TAU A;  1T44 A;  3CJB A;  3HYF A;  5KQD A;  3HJF A;  1IKW A;  5K14 A;  5AZJ A;  4C8K A;  3H1V X;  5C15 A;  1RBS A;  4M3R A;  2O8D A;  4KHQ A;  2QWL A;  4HTU A;  3LL3 A;  4R5P A;  4JI7 K;  4FJK A;  1J53 A;  1ZBL A;  5M1K A;  4O55 A;  1JL2 A;  3MXM A;  2UUA K;  1XC3 A;  4IO9 L;  4N41 A;  3K0S A;  5KGW A;  3SYZ A;  3OYD A;  2F4V K;  4A61 A;  1K8A O;  2P9N A;  4KRF A;  2ZGZ A;  2CH5 A;  3B6P A;  4F4K A;  1YHQ N;  1QTM A;  1E4G T;  1VQN N;  3OYF A;  3NF8 A;  4CES A;  4CGH A;  4ISG A;  2OCE A;  2E6L A;  3QLH A;  2KFZ A;  4JK7 A;  1MU2 A;  1DGK N;  2ZM6 K;  2VG5 A;  1S72 N;  5EOY A;  2YHW A;  3JSM A;  4M3X A;  4PKH A;  1HKC A;  4H5R A;  2Q36 A;  3G6E N;  3T1Y K;  3VN5 A;  3HVR A;  2VWJ A;  2UUB K;  3HZ6 A;  3V4I A;  1MDU B;  3TTF A;  4OJR A;  3BP8 A;  3C6U A;  1VQP N;  4MQ3 A;  4DWI A;  3VF2 A;  3CFR A;  2YJE A;  2QWN A;  3O1B A;  1BQM A;  1JKH A;  4A59 A;  4FZZ A;  4BC5 A;  4CZI A;  4NCA A;  3OTO K;  4ELT A;  1S1V A;  1X3N A;  4LSN A;  2FBT A;  4I6M A;  4YDU A;  1U47 A;  1BUP A;  3JYT A;  1SZ2 A;  2W40 A;  1S22 A;  2PZS A;  3VQE A;  3C7N B;  3C0B A;  3LZJ A;  4KHS A;  3KVG A;  4HVJ A;  3S41 A;  1C1C A;  4B9S A;  5IT9 O;  5GAG P;  5AQJ A;  4DMN A;  3SAG A;  3MEG A;  5AQZ A;  3VTI A;  5CY4 A;  1ESV A;  1NGH A;  4GMJ B;  2HMI A;  5HBM A;  4BRO A;  5JIC A;  3SBT A;  1NK4 A;  4EFH A;  3DRP A;  3OS0 A;  4ISF A;  4I2P A;  4E19 A;  1WUA A;  4O5F A;  4FZX C;  4LSL A;  1T3V A;  4CE9 A;  4CHZ A;  2KHO A;  2YNF A;  2IVO A;  4CJK A;  3KK1 A;  1X9J A;  3VQQ A;  3KLI A;  4YFU A;  2Q0U A;  2WOM A;  4H0T B;  3C95 A;  3TAG A;  4WFA L;  2AP1 A;  3O6W A;  2D5R A;  5AQR A;  1LAW A;  4K0K K;  1WAF A;  4JI1 K;  4TSX A;  4BC4 A;  4KRE A;  2F8S A;  1GOB A;  4DR1 K;  1UWB A;  2WC9 A;  3NFA A;  3VF4 A;  3S3M A;  4L8R B;  2QM1 A;  3HL8 A;  3L3V A;  4N5S A;  4LH4 A;  4BQL A;  3QIP A;  4LC9 B;  1CZB A;  3HRG A;  4ILH A;  4J2D A;  2O8B A;  1RGI A;  1O13 A;  2QWQ A;  1S9E A;  3LAK A;  3OBY A;  2OAN A;  5EXW A;  3O3F A;  1P90 A;  3ZSV A;  5BR8 K;  4FXD A;  4JKG B;  4RW6 A;  3CET A;  4M3W A;  3CCM N;  2ZF5 O;  2FBY A;  3QBW A;  1NOZ A;  3NF6 A;  3VEO A;  1WSJ A;  3O3H A;  4QCL A;  2ASO A;  4E7L A;  3HT3 A;  5J2Q A;  4DS5 A;  4BRQ A;  3S3O A;  3SAF A;  1LWC A;  1VQK N;  3LM2 A;  1NM1 A;  4XH1 A;  3IFR A;  1TKX A;  1Q9X A;  3NVM A;  5LJW A;  4B1X B;  5H1S Q;  1KAZ A;  4LF4 K;  3VQ4 A;  3CQY A;  4IOX A;  4Z94 A;  2XO7 A;  2HB5 A;  5HOO A;  1YJW N;  2GX9 A;  2PBD A;  4AH9 A;  5I9E B;  3I0R A;  3SCX A;  1HLU A;  5BRH A;  3THY B;  4JRP A;  4XIU A;  2FSK A;  2HBK A;  3CYM A;  5F1X A;  2OTL N;  2HBM A;  3ENH A;  3LP2 A;  3DLB A;  1ASU A;  1VSK A;  1WSH A;  3K9J A;  4OPH A;  4F8R A;  2A40 A;  1XC9 A;  3WXL A;  4H5T A;  2Q1N A;  3I55 N;  4DV6 K;  5BRE A;  3TAE A;  1DT9 A;  4NXN K;  2EHG A;  1NOY A;  4IG3 A;  4U7B A;  4CIE A;  3SQ2 A;  4DSF A;  3ZSZ A;  4YOU A;  3WUH A;  4CCH A;  4CEO A;  4F2S A;  3MMV A;  4CJR A;  2JGU A;  4M3U A;  5CYM A;  3GDQ A;  4JHD B;  3SV4 A;  3F2K A;  3WEE B;  2W6L A;  4CGI A;  1RDU A;  1BO5 O;  4HCB A;  4DQP A;  3NHG A;  2YNI A;  4DV7 K;  2IOC A;  4KI6 A;  1YIJ N;  2RKI A;  1Y64 A;  3NVK A;  4CBX A;  3HXM A;  4B1U B;  4B9V A;  4B3R K;  4ZHR A;  3MCA B;  2HHW A;  4AM7 A;  3L2R A;  3DOL A;  2W41 A;  4NXM K;  3ATV A;  2CGK A;  3HI0 A;  5JLF A;  2ITM A;  2UXB K;  4BGB A;  1HRH A;  4XEI A;  2GEL A;  3BEX A;  3KK7 A;  5BR9 A;  1JLF A;  4LY7 A;  4I9L A;  3FLC O;  4JYA K;  2DY4 A;  4CFC A;  3MX5 A;  4CJU A;  1WAJ A;  3MX2 A;  5F0X A;  3OVN A;  4YOV A;  4DFJ A;  1UAX A;  1U2V A;  3VQB A;  1NK6 A;  4BVO A;  4R79 A;  4N56 A;  4JRQ A;  3TTD A;  1HNZ K;  3W3D A;  4BWJ A;  3H45 C;  4JKB A;  3UIQ A;  1DLO A;  3TPQ A;  3SUN A;  2DPN A;  3TAN A;  4FOI A;  4FCY A;  4FW2 A;  3G10 A;  1BU6 O;  5J2M A;  2F9W A;  5LMU K;  4KH5 A;  1WSE A;  4JN4 A;  3ULE A;  4CFB A;  4CEQ A;  1Z26 A;  1BIS A;  4JI2 K;  3WNE A;  4WQ5 C;  1T7P A;  2A5X A;  4BRC A;  3U6F A;  3BDP A;  1HJO A;  2Y1I A;  5JLH A;  4BRD A;  2OZM A;  3FZH A;  4BVP A;  2Z1J A;  4DR5 K;  4CZK A;  1H1V A;  4CJV A;  1Q86 O;  5GIP A;  3RRH A;  1GLC G;  4F3T A;  3AVN A;  3TAB A;  3KWI A;  4JD2 A;  2VGN A;  3ZEU A;  2X6N A;  1REV A;  4PY5 A;  1VQ8 N;  1RDD A;  1VQ5 N;  2QWR A;  1J9A A;  4DSE A;  1VQM N;  3AVJ A;  3BF3 A;  3J7Z O;  1GLL O;  1BG3 A;  2ZWH A;  4B8A B;  4ELV A;  3OYM A;  5FPN A;  4JEP A;  1D9D A;  4DHY A;  4CJQ A;  1EP4 A;  3AVA A;  1S5J A;  3ENO A;  4C8M A;  5HRN A;  4CJ4 A;  4FK2 A;  3QNN A;  4CW7 B;  1VQL N;  4FLV A;  1QQO A;  2Z1G A;  4ZTF A;  1NK0 A;  1KAX A;  3H3N O;  4I2Q A;  1RTD A;  3EN9 A;  1P8Z A;  4WYB A;  5ELZ A;  2VQE K;  3R1X A;  3O9Q A;  1DKG D;  3FE1 A;  2FSN A;  3ENB A;  5B8H A;  2BE2 A;  2ETJ A;  4KHN A;  1KLM A;  4M3Z A;  2QXF A;  1J54 A;  4CJ7 A;  2PYJ A;  3MN7 A;  4A5A A;  4M3T A;  2ASM A;  1VRT A;  3LDO A;  1BHL A;  3VQC A;  4YOY A;  3L2V A;  2KZZ A;  4FWQ A;  3IRX A;  3DAW A;  4JKD A;  2WFB A;  4KHW A;  5AQI A;  1T8E A;  3QNO A;  1VQ4 N;  4DUY K;  4DQI A;  1VSF A;  4DQR A;  3LM9 A;  2OZS A;  4J2A A;  1ZXO A;  1L5U A;  4O8K A;  3QML A;  2NLX A;  1GLJ O;  1HQU A;  1RCH A;  3F5T A;  3M1F A;  4DKW A;  3DXM B;  2QA4 N;  3S9H A;  4CEA A;  3UKU A;  1QQN A;  2ITG A;  3UE5 A;  1VHX A;  3ZT0 A;  3MAQ A;  1ZYQ A;  1C0T A;  1C6V A;  1JLA A;  4AIL C;  2A3Z A;  1RTH A;  3DRS A;  4WFB L;  4O44 A;  2P9S B;  3OHR A;  3CCU N;  1W7A A;  5AQK A;  4FWO A;  3AO2 A;  4AHC A;  4A57 A;  2VG6 A;  3FZF A;  4DTX A;  3ZLJ A;  3DMJ A;  1QVF M;  2Q2R A;  1EWQ A;  5C24 A;  3EZW A;  3HK2 A;  4FJJ A;  3E66 A;  3P5J A;  4KPY A;  4O8U A;  2I7P A;  4BGA A;  3T3F A;  4K43 A;  4JKC A;  4AHR A;  4E7H A;  3OBW A;  5EX5 A;  2WON A;  2QTD A;  4JV5 K;  3RMA A;  1K8K A;  4IO8 A;  4FK4 A;  4K42 A;  1EQY A;  3TTC A;  2HMP A;  2YI1 A;  1NMD A;  1QZ6 A;  3H46 O;  3OYJ A;  4OPJ A;  1BOT O;  3ZET A;  4KFB A;  3VEW A;  3NMU A;  4V19 S;  2P9P B;  1NLV A;  2EX3 A;  5HLF A;  4DTS A;  3KHY A;  5E26 A;  4OGE A;  3CC7 N;  4GV3 A;  2H3G X;  2A42 A;  4DQ8 A;  5J2P A;  3VES A;  4CEC A;  1QQC A;  5GIO A;  1SL2 A;  1UA0 A;  3AAP A;  1JLC A;  2JWL A;  1L3S A;  2HHV A;  3HP9 A;  4QOZ B;  2D1K A;  1XWL A;  2X74 A;  2VWB A;  4FWN A;  3PIP L;  2KZM A;  4ZTJ A;  4CF1 A;  2I7N A;  4IEI A;  4IOA L;  4PKI A;  4IWV A;  3MED A;  4BG9 A;  1OH8 A;  3DOK A;  3UKR A;  3HPH A;  3JS6 A;  4NYN A;  2KLA A;  3H3O B;  1C1B A;  4E1N A;  3L4Q A;  2O8C A;  4CJ3 A;  4FJ5 A;  4CBW A;  4GKK K;  3FFK B;  4KO0 A;  2O4I A;  4HTL A;  4FPA A;  3QEV A;  5AQV A;  2FSJ A;  2W42 A;  3OYI A;  2DFE A;  2QWP A;  4I7F A;  3VGK A;  3OYC A;  4KV8 A;  3AV9 A;  3A5M C;  4DTJ A;  4PUO A;  1EO1 A;  4N47 A;  3N4P A;  5KRS A;  2IGI A;  4CVN E;  4W5O A;  3CFO A;  3EKU A;  3K9K A;  3ASM A;  3TU5 A;  5AQG A;  1O1W A;  3QDK A;  5M1N A;  2P9U A;  1ASW A;  4PHT X;  4CD3 A;  1ATR A;  1C1A A;  2NRX A;  3H08 A;  4FLX A;  4M7X A;  2E5L K;  1U6Z A;  1ZBH A;  5MLC Q;  3CQ8 A;  3D2E B;  4K8Z A;  3OS2 A;  4AHV A;  1NGG A;  4EZ9 A;  4LF6 K;  3VA0 A;  2QKB A;  3PLA A;  2Q3S A;  4YOW A;  5C42 A;  3OJU A;  1NU0 A;  2NRW A;  4X64 K;  3GBT A;  1TVR A;  4CFD A;  4FM0 A;  4A2B A;  4PWD A;  3OYH A;  4E1M A;  2KQ2 A;  5AR0 A;  4FM1 A;  4DTO A;  4FLW A;  1QSY A;  1HKB A;  4H0V B;  1Q82 O;  3PO4 A;  3UB5 A;  4WQ4 A;  4OLB A;  3NBP A;  3HPO A;  1TKT A;  3PIO L;  3VPZ A;  4BR7 A;  1VQ9 N;  3LDS A;  2E88 A;  3BUZ B;  1NMN A;  2P9K B;  3ZSO A;  5AQW A;  3CER A;  4CZH A;  2HBJ A;  1IG8 A;  1IKV A;  3SPY A;  1GOA A;  3WXJ A;  1W97 L;  3VQ5 A;  5EU7 A;  3AVC A;  2G8U A;  3IMX A;  3MDQ A;  1V4S A;  4CZE A;  4KKO A;  5GAE P;  5KPR A;  1W2B M;  3KIO A;  5CZ2 A;  4CIG A;  4EZ6 A;  2O4G A;  1DTQ A;  3U4L A;  4CIF A;  3RMC A;  1KFS A;  3G4S N;  1KQS M;  4IJA A;  3WNH A;  4YDU C;  1GLD G;  3PX6 A;  1Z05 A;  2NRZ A;  1XNQ K;  4BE1 A;  4CFA A;  3TAM A;  3AAQ A;  3CCV N;  1BI4 B;  3HM8 A;  3VGL A;  2HHT A;  3SK3 A;  1RT3 A;  5C10 A;  3AVK A;  4DTP A;  2FBV A;  3DXK B;  3CJ1 A;  4RWT A;  1KRP A;  5AZJ B;  1VSJ A;  3CM5 A;  1ATS A;  1JL1 A;  4CD1 A;  3AVB A;  3WXM B;  3TSU A;  3KLE A;  4M3Y A;  1QSS A;  4KHU A;  2G8I A;  2O8D B;  1VAZ A;  3CI5 A;  1WSI A;  3OA9 A;  3THX A;  4OLA A;  1NJX A;  4CJE A;  4JI8 K;  4BAC A;  4E7K A;  3GG4 A;  2B5J A;  4A2A A;  1L3U A;  1NGI A;  5CE3 A;  3EYZ A;  3CCR N;  2ZQB A;  3THW A;  3IG1 A;  4W5N A;  3R6M A;  4JKH A;  3VMF B;  1HMV A;  4DLG A;  2VCP A;  5JS2 A;  2P9N B;  3MK6 A;  4MDB A;  4KHY A;  2UU9 K;  4JKG A;  1RT1 A;  3NH1 A;  1XMQ K;  3VQ6 A;  5KQ8 A;  3O9S A;  4BDY A;  3THV A;  1NK5 A;  2O8F A;  4BRA A;  4FJX A;  1L3V A;  3BGR A;  3NAE A;  4DTU A;  3HTV A;  3BF1 A;  1TKD A;  2NRH A;  4QS8 A;  4K41 A;  1ZC6 A;  3ZYY X;  5BRF A;  4B08 A;  4DU4 A;  5KGX A;  1YIT N;  4Z4G A;  4YHH K;  3NH2 A;  3KLH A;  3LP1 A;  3AY9 A;  3AGR A;  3D2F A;  4FZY A;  4W5Q A;  2YHX A;  4DV1 K;  2Q0R A;  2OYQ A;  3M8S A;  2WUS A;  4DSI A;  4OKE A;  4I9Q A;  1D5A A;  5AQX A;  3TAQ A;  4H03 B;  4DSL A;  1RDA A;  2RF2 A;  3GE1 A;  2QXL A;  5LMN K;  4FWL A;  3S3N A;  3RMB A;  4CED A;  3E9P A;  1N32 K;  3SMS A;  4I6M B;  4FLU A;  3PX4 A;  3SLC A;  2AJQ A;  5M1O A;  4OPK A;  2GUI A;  4CEF A;  1Q9Y A;  3IKM A;  3AA5 X;  2YHB A;  5DK5 A;  2RE2 A;  1YXQ A;  3M8Q A;  5M1F A;  4CJS A;  1NBW A;  4BR5 A;  2OA8 A;  4FJN A;  2FF6 A;  1HYS A;  1VSI A;  4DQS A;  5JMV A;  1U48 A;  3TSQ A;  2A41 A;  3NDK A;  4B3M K;  4FJ8 A;  3E9O A;  3AVF A;  3L4I A;  5FDL A;  1SKR A;  2GWK A;  1B9D A;  3WEE A;  2IC3 A;  3LPT A;  4GY2 B;  3QEX A;  1Q7Y O;  3RR7 A;  1G15 A;  4CZG A;  2E2Q A;  3M5R A;  3T1A A;  3LPU A;  2NZT A;  3I33 A;  3TWH A;  4FM2 A;  3RMD A;  4OGC A;  3AO3 A;  4O4G A;  2PAV A;  4HCC A;  4F2R A;  4CK1 A;  4KTZ A;  3JAM O;  4IKF A;  4B9Q A;  4UY8 O;  2DFF A;  3P38 A;  1YJN N;  5TKW A;  3ID8 A;  3QFU A;  2OPP A;  4B1Y B;  4NLB A;  2O8B B;  3SBG A;  4JK9 A;  5BPL A;  3O5B A;  1WB9 A;  1X9S A;  3LAN A;  3L0Q A;  3R8E A;  3D6R A;  4IBN A;  5AQM A;  3LP0 A;  2D0A A;  4FO0 A;  4EAH D;  3K5O A;  1BQN A;  4IG0 A;  3PUF A;  1NWK A;  1SL0 A;  3J80 O;  2HHS A;  4CK3 A;  1NGD A;  4BR9 A;  3J8A A;  4CGJ A;  2QKK A;  4NCB A;  4LFB K;  3CM6 A;  3CCQ N;  5JVH L;  3AVM A;  2ZD1 A;  2QW9 A;  2BAN A;  3V1Q A;  1HNX K;  4CZF A;  2YX6 A;  2HHU A;  4O5B A;  4A5B A;  2NRR A;  4Y1C A;  4FLY A;  2GEM A;  3O4N A;  4GNI A;  4HUG A;  2HHQ A;  1LCU A;  3LWM A;  4KH4 A;  1R0A A;  1OKJ A;  4BDP A;  1IKX A;  3PX0 A;  4IFE A;  1BWF O;  1Q18 A;  1RDB A;  1X1P A;  2E6M A;  1BIZ A;  3W0L A;  4CHP A;  4DF4 A;  3OYL A;  3FGU A;  2V7Y A;  1CXQ A;  4BRL A;  1HQE A;  1LW2 A;  3HPG A;  4BG8 A;  3O4Q A;  3AGK A;  4BC2 A;  1RTI A;  3N4Q A;  2YCH A;  4AM6 A;  1U4B A;  1U04 A;  3DLR A;  1QE1 A;  4JS5 A;  2G8W A;  2A1S A;  4H4M A;  2YKM A;  4FJI A;  1HUX A;  3SMP A;  1QHT A;  4RTF D;  2Q31 A;  3KJV A;  1QVG M;  3TAP A;  2VG7 A;  3J7Y P;  3FZL A;  1VQ7 N;  1BL3 A;  3WNG A;  3RR8 A;  4AF1 A;  5T7B A;  4MO5 A;  2XY8 A;  1B92 A;  1HNI A;  1NGE A;  2Y1J A;  5AQQ A;  3WXI A;  3L8B A;  1KCF A;  3LAM A;  4IFV A;  1MWK A;  4FK0 A;  3VF6 A;  3O9R A;  5BPM A;  3AVH A;  5HRR A;  4DR6 K;  1OVQ A;  1XQS C;  3J81 O;  3U3Y A;  2YV0 X;  4JI4 K;  5AQU A;  2G8K A;  2NRV A;  2ZE2 A;  4BRG A;  2G8V A;  1YTA A;  5FRN A;  1ASV A;  1KXP A;  3RRG A;  3P83 D;  3WQT A;  3NF7 A;  5AQN A;  4BQZ A;  3CCL N;  2YHY A;  1I39 A;  5ADX A;  5FRM A;  2HNZ A;  1JXB A;  3ZX0 A;  3K59 A;  1SV5 A;  3SUQ A;  4RG8 A;  1HPZ A;  3Q7C A;  3O3G A;  1U2V B;  2GBZ A;  5FPD A;  3HM9 A;  1D9F A;  3VQ8 A;  4LF7 K;  2HHH K;  4FJM A;  1XHZ A;  1VSE A;  4A62 A;  3R9P A;  3P31 A;  1KLN A;  5M1Q A;  4RW8 A;  1NGJ A;  1YI2 N;  4CF9 A;  3OJS A;  4JS4 A;  4FJ7 A;  2OPR A;  3FFI A;  3F73 A;  2HF3 A;  1BCM A;  3ULE B;  3NE6 A;  2UUC K;  4FVU A;  3E1Y A;  1NJW A;  2QK9 A;  1NKB A;  1A5W A;  4EHU A;  4YY3 K;  3K57 A;  1WSG A;  3MXJ A;  1K73 O;  1FKO A;  4J2E A;  4FVM A;  3QEI A;  5EY4 A;  1NGF A;  3CCS N;  4DV4 K;  4J8F A;  4DV5 K;  3CF5 L;  3CPW M;  4JD2 B;  4DFP A;  1NKC A;  1S3X A;  3ZEU B;  3ALY A;  3VA3 A;  1TYQ A;  4J2B A;  2YKN A;  3EL2 A;  1UOC A;  2RHK A;  3ZX2 A;  4QS7 A;  1FJG K;  2KTQ A;  2DTU A;  5HRP A;  4BRN A;  1A5X A;  4BRK A;  4ILG B;  1I94 K;  2KKZ A;  3RSE A;  1K6Y A;  4PA1 A;  3SNN A;  4Z4C A;  4Z4E A;  1A5V A;  4YOX A;  1VSH A;  2XY7 A;  1TUU A;  3A8Y A;  4CEZ A;  4YNQ A;  1ZBF A;  3ZSR A;  4FLZ A;  4E1J A;  3OYB A;  3MN9 A;  2XRI A;  4LFC K;  3MEE A;  5AZI B;  5KI6 A;  1KD1 O;  1WNS A;  3QET A;  3OW2 M;  2HF4 A;  5BPN A;  4LF8 K;  4DTM A;  4DV0 K;  3QEP A;  3HBT A;  3FZK A;  4E7J A;  4GKJ K;  1J5E K;  5I42 A;  4BWM A;  4BRF A;  5EVZ A;  2E8A A;  2ATQ A;  4DU1 A;  1RT5 A;  4M45 A;  2QWO A;  3C94 A;  2P9L A;  1IBK K;  1R59 O;  1OH7 A;  1TUY A;  4FOE A;  4Z4F A;  5HL7 L;  4FPB A;  2DFH A;  5AQL A;  5IWA K;  3RWU A;  1VK0 A;  4PKG A;  4PL7 A;  3V9W A;  4FWP A;  4CJW A;  1OVY A;  1GLE G;  1YUW A;  3UKU B;  4DTN A;  3K58 A;  3E9L A;  3ZSW A;  4B1V A;  1S1T A;  2EWS A;  3CJA A;  1NK8 A;  1RIL A;  1U49 A;  2O8E A;  4GV9 A;  2HVI A;  4B9U A;  4B8C A;  3C6H A;  4DS4 A;  1IG9 A;  3OY9 A;  4GVM A;  3AO5 A;  4CGF A;  3I56 N;  1NJY A;  3QIN A;  2UXD K;  1N36 K;  3CCE N;  4KB1 A;  1X9M A;  1JCG A;  3KKS A;  3SPZ A;  5F2R A;  3ULD A;  3RTV A;  5DMR A;  1D4X A;  5C2F A;  3ATU A;  4CZJ A;  3TI0 A;  3EY1 A;  2OPS A;  3T69 A;  2XY5 A;  3LDN A;  4JNE A;  4Z0U A;  4HWI A;  1RT7 A;  1MA9 B;  4JKF A;  4BR0 A;  3TSP A;  1K8K B;  2V52 B;  1QS4 A;  3OYE A;  3DLH A;  1TV6 A;  3WT0 A;  4IXC A;  3D7E O;  3ITH A;  4OKK A;  1GLF O;  4QAG A;  4EIA A;  1JLB A;  4HUE A;  4FW1 A;  1VRU A;  1JLQ A;  3ZET B;  1S1W A;  3ZT1 A;  3FZM A;  2VGM A;  3DM2 A;  2IAJ A;  4HUF A;  1OH5 A;  4W5T A;  2FC0 A;  2IVN A;  3DYA A;  2HND A;  3IUC A;  4DQQ A;  2J4R A;  1ATN A;  3QIO A;  4CF0 A;  5ADX H;  2QEX N;  1KSP A;  3ZT3 A;  2WTU A;  4Z4I A;  3P1G A;  2JWK A;  5AQY A;  1CZ9 A;  1LW0 A;  1FK9 A;  3DLE A;  1BIU A;  4GV6 A;  2HNY A;  4ISE A;  4KH6 A;  3KZB A;  5C25 A;  5LL6 Z;  2F7T A;  4BRP A;  4FLT A;  4YOR A;  4CHN A;  3SQ4 A;  4B1Z A;  3KWG A;  4FJH A;  1IBM K;  3DLG A;  2A6A A;  4CEB A;  1IV0 A;  1WLJ A;  1NKE A;  4KI4 A;  2P9I B;  4WE1 A;  4IZ9 A;  4DFM A;  2HST A;  2B4J A;  3FR0 A;  2HVH A;  4CJL A;  3QIC A;  1N8R O;  2O8C B;  4DR2 K;  2PYL A;  2E1Z A;  2AA4 A;  3SUP A;  2BGG A;  1ITG A;  5KPZ A;  4KTW A;  1JXE A;  1S6Q A;  3DXK A;  4MFB A;  1QZ5 A;  3TAR A;  4JK8 A;  3AA4 A;  1T6C A;  4IDH A;  1KFD A;  3HSC A;  4MLE A;  3D45 A;  3IAY A;  1LAV A;  5GAH P;  1V4T A;  3SQ0 A;  2P9U B;  5A2Q O;  5D3G A;  3C7N A;  2ASP A;  3V1O A;  4BC3 A;  2XY6 A;  5HRS A;  5I3U A;  1SS6 A;  1X9W A;  3H6E A;  4FJ9 A;  3DJC A;  3M6G A;  1NG9 A;  4OO1 J;  3PSI A;  3U8X A;  4CJP A;  1IBL K;  1M90 O;  4WCE L;  3SJH A;  4JKA A;  3L6Q A;  3K5L A;  4H4O A;  1QSL A;  3U9Z A;  3TR8 A;  1EKE A;  2KFN A;  3VGM A;  4DV2 K;  5HP1 A;  4K8X A;  1CZA N;  2ZJP L;  4DV3 K;  3V9S A;  1WN7 A;  2NRT A;  2IS3 A;  1RT6 A;  2VWK A;  4X62 K;  2BH1 A;  1HR0 K;  1JCF A;  3V6D A;  1NGB A;  1U45 A;  2RPI A;  3LDL A;  2Z1H A;  4IFY A;  3CC2 N;  1HKG A;  3A5L C;  4FL9 A;  3VER A;  1KC8 O;  3VTH A;  3I0S A;  4XH5 A;  5DM7 L;  2VQF K;  3O9T A;  4E89 A;  5M1P A;  3ZX3 A;  1SUQ A;  2GV9 A;  1K9M O;  1FKP A;  4DU3 A;  5BRD A;  4CHO A;  2QI2 A;  2OTJ N;  3T1H K;  3U9D A;  1J5O A;  4H0O A;  2D4W A;  2BDP A;  2YNH A;  5AQS A;  1XI1 A;  2ZJR L;  1UA1 A;  1NJZ A;  4W5R A;  1N33 K;  5AFU A;  1Y97 A;  3AAR A;  4Y0W A;  2V7Z A;  4H5N A;  4E7I A;  1S1U A;  1GOC A;  3M8P A;  4Q5V A;  2I5J A;  2FXU A;  3SI6 A;  3OYG A;  3P39 A;  1MWM A;  3LAL A;  4DR3 K;  1VSM A;  3OYN A;  1JJ2 M;  1TK8 A;  5GAD P;  2VYP A;  3NF9 A;  2JLE A;  3E01 A;  1BGX T;  4DB3 A;  5LY3 A;  3ZSY A;  1S6P A;  4M41 A;  1QQM A;  4JI0 K;  3LZI A;  2HHX A;  1T03 A;  4JI5 K;  5AQF A;  3WQU A;  3CIP A;  1WSF A;  3CJC A;  4C1N K;  3HO1 A;  1W9H A;  3DI6 A;  4B9L A;  3THY A;  4M63 C;  3DWL A;  2PY5 A;  4DFK A;  5AQO A;  3AVI A;  3CJ7 A;  3THX B;  3HOS A;  3A0I X;  4ELU A;  2D0B A;  2BTF A;  1CXU A;  4CJT A;  1IKY A;  4LF9 K;  4M7Y A;  1Z6R A;  1RBT A;  2XHB A;  1RT4 A;  2CGJ A;  3A5N C;  3THW B;  3KD5 E;  4KAZ A;  3QBX A;  3ZSQ A;  5BN8 A;  1SKW A;  1EWR A;  2WBN A;  1JLG A;  4B9N A;  1RNH A;  4LFA K;  4IEE A;  1IJJ A;  1NGA A;  1YVN A;  1WBB A;  4CF8 A;  1RDW X;  1XMO K;  4CK2 A;  4C8N A;  4O0I A;  2O8F B;  3D0P A;  1JCE A;  4ID5 A;  4OPA A;  4GW6 A;  3VEV A;  2P5O A;  1J6Z A;  2QWM A;  1GLA G;  4JHD A;  2OPQ A;  4X66 K;  4Q0B A;  3D2F B;  2E2P A;  4H8K A;  3RVC A;  4NYF A;  2UYT A;  4X65 K;  4BRI A;  1TAQ A;  3QB0 A;  4YOT A;  3OS1 A;  4AHT A;  1Z25 A;  4AHS A;  3LWL A;  1VQO N;  4CF2 A;  1YF5 L;  2YHA A;  4IDK A;  1X3M A;  3CCJ N;  1NGC A;  3ZT4 A;  4H0X B;  4MLH A;  1RDC A;  4XH4 A;  3QFP A;  4B3S K;  3KTQ A;  3K5M A;  3KK2 A;  3AA3 A;  1HPM A;  5FPM A;  1T05 A;  1RT2 A;  3C6A A;  5LJV A;  4H5V A;  4IOC L;  3ID6 A;  3DLL L;  3I8D A;  1HNV A;  5BN9 A;  1SQK A;  3EO3 A;  3CC4 N;  2CGL A;  1TK5 A;  1NJI O;  3ZCM A;  1ZBI A;  2E4L A;  1NK9 A;  1KTQ A;  1VQ6 N;  3L2W A;  4FSV A;  3ZT2 A;  1SAZ A;  4PL8 A;  5J2N A;  3MN6 A;  3LDQ A;  2B6A A;  4CEE A;  4EP5 A;  4CER A;  4KB0 A;  3O08 A;  3KD1 E;  1IH7 A;  4AHU A;  4DR4 K;  1HYZ A;  4BRE A;  4GVE A;  4KTQ A;  2D0O A;  4DTR A;  4Z4H A;  3EE9 A;  1YJ9 N;  2RN2 A;  4LF5 K;  2PFU A;  1YTU A;  5J1E A;  1YAG A;  4H0P A;  2E2O A;  3PV8 A;  1LV5 A;  5C0Y A;  4FWS A;  5CZ1 A;  4M42 A;  5CHI A;  3BY5 A;  4DCH A;  3C65 A;  2W6K A;  3V9U A;  3HOT A;  5SZT A;  1Q8I A;  4OX9 K;  4EHT A;  1KVB A;  2GUP A;  5CR4 A;  1E4F T;  2ZJQ L;  1CLQ A;  1GLB G;  3VEY A;  4ICL A;  4OVL A;  1F21 A;  4CI6 A;  1KVC A;  5AFU H;  1HNW K;  3L3U A;  1EX4 A;  3JXU A;  5HRO A;  3QEW A;  2Q97 A;  3IS9 A;  1HYV A;  1XUP O;  4RW4 A;  3VQP A;  4KBO A;  5C2D A;  3VOV A;  2BUP A;  2E2N A;  3LP3 A;  5KPT A;  3EZ5 A;  1FW6 A;  4F3O A;  4BE0 A;  2G8H A;  1C0M A;  2HOE A;  3MCP A;  3V9X A;  2UXC K;  3BZK A;  5E84 A;  3C6T A;  4C1N I;  3HVT A;  4E3S A;  4KHP K;  1BA0 A;  4B1W B;  3MEC A;  3EE8 A;  4FJG A;  4CHY A;  3V9Z A;  3VQD A;  2HW3 A;  3O80 A;  5KTQ A;  3KLG A;  2YNG A;  3QES A;  4C8O A;  4MO4 A;  3DXM A;  4C8L A;  3PSF A;  3KK3 A;  4B9T A;  1S9G A;  3B6O A;  4C23 A;  3H1Q A;  1Q81 O;  4OKJ A;  4WQ5 A;  3G71 N;  2P9S A;  4CZL A;  3HP6 A;  2FBX A;  3V1R A;  3R3L A;  4JLH A;  4NLC A;  1FXX A;  4BR2 A;  1XHX A;  3O1W A;  3NCI A;  3PY8 A;  3I8B A;  3M3Z A;  3OYA A;  3Q7B A;  3AA2 A;  3NH0 A;  3LDP A;  4CJF A;  1L3T A;  2F9T A;  1NK7 A;  3V81 A;  3HST B;  2D0P A;  2KW4 A;  1RTJ A;  2IIR A;  1W0H A;  3G0Z A;  3NGZ A;  3KLF A;  3NGI A;  4IJN A;  4BY9 C;  5AZI A;  4N76 A;  4CJ5 A;  3K2P A;  1TK0 A;  1WBD A;  5JS1 A;  5KRT A;  3ZSX A;  3A2F A;  3MXI A;  3F9M A;  3O8M A;  4EP4 A;  3ISN C;  3AVL A;  3P4I A;  2NNW A;  2G8F A;  2E1Y A;  2Z1I A;  3EEQ A;  3O4W A;  5AJ3 K;  2R7Y A;  3MWT A;  4RW9 A;  2IDO A;  4ILJ A;  3VQ7 A;  2P9P A;  3KKR A;  1NNE A;  1EXQ A;  1G99 A;  3AO4 A;  3L2U A;  2GWJ A;  1RBU A;  1ZBS A;  4CZM A;  4LD0 A;  1TKZ A;  5E41 A;  4DR7 K;  1BCO A;  1IO2 A;  1N5Y A;  3CFP A;  5FLX O;  1WOQ A;  3BZC A;  3QO9 A;  1TL1 A;  4RCH A; 
#chains in the Genus database with same CATH homology
 4B1Z A;  2WUS A;  3FLC O;  3KWG A;  3VEZ A;  5AQH A;  4BRH A;  2A6A A;  3CMA N;  3CME N;  3O9U A;  2P9I B;  3MX5 A;  5AQX A;  4IZ9 A;  5F0X A;  3MX2 A;  4H03 B;  2HST A;  4YOV A;  3FR0 A;  3EKS A;  3QIC A;  1N8R O;  5JVG L;  1U2V A;  3GE1 A;  4G9Z A;  2QXL A;  4MDA A;  2E1Z A;  4BVO A;  5C12 A;  3SAH A;  2AA4 A;  4QS9 A;  4R79 A;  4FWL A;  3TTD A;  4JKE A;  3W3D A;  5KPZ A;  3CC2 N;  3E9P A;  4FWM A;  3SMS A;  3DXK A;  4H5W A;  3H45 C;  4I6M B;  1QZ5 A;  4JK8 A;  2FLO A;  4NO7 A;  4JKB A;  3SLC A;  3TPQ A;  2DPN A;  5M1O A;  4FOI A;  1T6C A;  4IDH A;  4MLE A;  3HSC A;  1BU6 O;  3IKM A;  3CD6 N;  2F9W A;  4KH5 A;  1M1K O;  3CPE A;  2RE2 A;  1YXQ A;  4JN4 A;  3ULE A;  5M1F A;  5GAH P;  1NBW A;  1V4T A;  4BR5 A;  2P9U B;  3C7N A;  2ASP A;  4BC3 A;  4JAX A;  4WQ5 C;  1T6D A;  2A5X A;  2FF6 A;  1SS6 A;  4BRC A;  5JMV A;  1C0G A;  1HJO A;  3MN5 A;  5AQT A;  3CJ9 A;  3H6E A;  4BRD A;  5JLH A;  3FZH A;  3DJC A;  3TSQ A;  3M6G A;  4BVP A;  5DM6 L;  1TYQ B;  4OO1 J;  4CZK A;  2A41 A;  1H1V A;  3E9O A;  3U8X A;  1Q86 O;  3L4I A;  1BDG A;  4F9O A;  4WCE L;  1M90 O;  5GIP A;  2GWK A;  4WFN L;  1GLC G;  3SJH A;  3WEE A;  3KWI A;  4GY2 B;  4JD2 A;  2VGN A;  2ZGY A;  4JKA A;  3L6Q A;  3ZEU A;  1Q7Y O;  3MWP A;  4FWR A;  3U9Z A;  4CZG A;  3D2E A;  1VQ5 N;  1VQ8 N;  2E2Q A;  3RSE B;  3WXK A;  4L3Q A;  3M5R A;  2QWR A;  3VGM A;  1VQM N;  2HBL A;  2GTD A;  3BF3 A;  2NZT A;  3I33 A;  1GLL O;  1BG3 A;  5FPE A;  3J7Z O;  1CZA N;  3VEN A;  2ZWH A;  1KAY A;  2ZJP L;  1DEJ A;  2PAV A;  5FPN A;  4JEP A;  2NRT A;  4DHY A;  4FWK A;  3VEX A;  1C0F A;  3ENO A;  1HX1 A;  2BH1 A;  4B9Q A;  4WF9 L;  4UY8 O;  1JCF A;  1NGB A;  2V51 B;  3LDL A;  3P38 A;  3T7Z A;  1YJN N;  5TKW A;  3ID8 A;  1VQL N;  3QFU A;  1HKG A;  3A5L C;  4FL9 A;  3VER A;  4BRM A;  4B1Y B;  4NLB A;  4CBU A;  1QQO A;  2CH6 A;  3VTH A;  3VET A;  1KAX A;  4XH5 A;  5DM7 L;  3H3N O;  3SBG A;  3O9T A;  3CHW A;  4JK9 A;  3O5B A;  5M1P A;  3ZX3 A;  5BPL A;  3EN9 A;  3L0Q A;  1P8Z A;  4NB4 A;  4WYB A;  3D6R A;  3R8E A;  1K9M O;  5ELZ A;  2P9I A;  3R1X A;  5AQM A;  5BRD A;  3GL1 A;  1ILY A;  3O9Q A;  2QI2 A;  4FO0 A;  4EAH D;  5GIN A;  1DKG D;  3FE1 A;  2FSN A;  2OTJ N;  3ENB A;  1NWK A;  3U9D A;  5B8H A;  4H0O A;  2D4W A;  1NGD A;  4BR9 A;  2P9L B;  3J8A A;  4CJ7 A;  3GOI A;  3MN7 A;  5AQS A;  4H0Y B;  3CQX A;  4A5A A;  4K25 A;  2ZJR L;  3CCQ N;  5JVH L;  2ASM A;  2QW9 A;  3LDO A;  4CZF A;  2YX6 A;  4YOY A;  5AFU A;  3AAR A;  4Y0W A;  2V7Z A;  1RFQ A;  2P9K A;  4FWQ A;  4H5N A;  4A5B A;  3DAW A;  4JKD A;  2WFB A;  2NRR A;  5AQI A;  1LOT B;  2GEM A;  1VQ4 N;  4GNI A;  2FXU A;  2E20 A;  3CXC M;  1LCU A;  3LM9 A;  3P39 A;  1MWM A;  4U67 L;  1ZXO A;  4KH4 A;  3B8A X;  1OKJ A;  4O8K A;  3QML A;  4IFE A;  2NLX A;  1BA1 A;  1BWF O;  1GLJ O;  4WQ4 C;  3F5T A;  4BR4 A;  3A5O C;  3M1F A;  3DXM B;  4DKW A;  1Q18 A;  2QA4 N;  1JJ2 M;  3UKU A;  1QQN A;  3UE5 A;  5GAD P;  2VYP A;  3W0L A;  2A3Z A;  4DB3 A;  5LY3 A;  3FGU A;  4WFB L;  2P9S B;  2YJF A;  3OHR A;  3UKR B;  3CCU N;  5AQK A;  1QQM A;  3IDH A;  2IVP A;  4FWO A;  2V7Y A;  4BRL A;  4A57 A;  1QHA A;  5TKY A;  3FZF A;  3G25 A;  5AQF A;  3WQU A;  3CIP A;  4BG8 A;  3CJC A;  4C1N K;  3AGK A;  2FF3 B;  4BC2 A;  5AQP A;  3N4Q A;  4M63 C;  3DWL A;  2YCH A;  4AM6 A;  1QVF M;  2Q2R A;  5AQO A;  1T44 A;  3CJB A;  5KQD A;  3CJ7 A;  3EZW A;  3HOS A;  3A0I X;  5AZJ A;  1HUX A;  3H1V X;  3SMP A;  5C15 A;  2BTF A;  4RTF D;  3E66 A;  4M7Y A;  1Z6R A;  2Q31 A;  4O8U A;  1QVG M;  2CGJ A;  3A5N C;  2I7P A;  4BGA A;  3FZL A;  4K43 A;  2QWL A;  4JKC A;  3OBW A;  3QBX A;  1VQ7 N;  3LL3 A;  5BN8 A;  4AF1 A;  5EX5 A;  4MO5 A;  2WBN A;  5M1K A;  2QTD A;  1K8K A;  1NGE A;  4IO8 A;  1XC3 A;  4IO9 L;  4IEE A;  1IJJ A;  4K42 A;  1EQY A;  3TTC A;  1NGA A;  1YVN A;  1NMD A;  2HMP A;  2YI1 A;  5AQQ A;  3WXI A;  1QZ6 A;  1RDW X;  3H46 O;  4A61 A;  1K8A O;  1BOT O;  3ZET A;  2P9N A;  1MWK A;  1JCE A;  4OPA A;  2ZGZ A;  3VEV A;  2CH5 A;  3VEW A;  3VF6 A;  1YHQ N;  1J6Z A;  3NMU A;  2QWM A;  1GLA G;  1NLV A;  2P9P B;  3O9R A;  4JHD A;  5BPM A;  1E4G T;  1VQN N;  3KHY A;  1XQS C;  5E26 A;  3CC7 N;  3D2F B;  4GV3 A;  4ISG A;  2H3G X;  2E2P A;  2A42 A;  4DQ8 A;  3RVC A;  5AQU A;  2UYT A;  3VES A;  4BRI A;  2NRV A;  5GIO A;  4BRG A;  3AAP A;  3QB0 A;  2JWL A;  4YOT A;  1KXP A;  4JK7 A;  1VQO N;  3WQT A;  1DGK N;  1YF5 L;  5AQN A;  2YHY A;  4BQZ A;  1S72 N;  5EOY A;  3CCL N;  1X3M A;  5ADX A;  2YHW A;  3CCJ N;  1NGC A;  4PKH A;  2D1K A;  3ZX0 A;  1HKC A;  4H5R A;  4H0X B;  4MLH A;  2VWB A;  4FWN A;  4XH4 A;  2Q36 A;  3PIP L;  3QFP A;  3G6E N;  4XEI A;  3Q7C A;  3HZ6 A;  1U2V B;  1MDU B;  5FPD A;  3TTF A;  2I7N A;  3BP8 A;  4IEI A;  4IOA L;  4PKI A;  4IWV A;  4BG9 A;  1VQP N;  3UKR A;  3VF2 A;  2YJE A;  2QWN A;  1HPM A;  3JS6 A;  5FPM A;  2KLA A;  3O1B A;  3C6A A;  3H3O B;  4A62 A;  5LJV A;  3L4Q A;  4H5V A;  3P31 A;  3R9P A;  4A59 A;  4IOC L;  3ID6 A;  5M1Q A;  4BC5 A;  4CBW A;  4CZI A;  3DLL L;  3FFK B;  1NGJ A;  5BN9 A;  1SQK A;  1X3N A;  3EO3 A;  3CC4 N;  4HTL A;  1YI2 N;  4FPA A;  2CGL A;  5AQV A;  2FSJ A;  1NJI O;  4I6M A;  4YDU A;  1BUP A;  2HF3 A;  3ULE B;  1SZ2 A;  2QWP A;  2W40 A;  1S22 A;  3VGK A;  4FVU A;  3C7N B;  1VQ6 N;  3C0B A;  3A5M C;  4FSV A;  3E1Y A;  3KVG A;  1EO1 A;  1SAZ A;  4PL8 A;  3S41 A;  3N4P A;  5GAG P;  3MN6 A;  5AQJ A;  4EHU A;  3EKU A;  3SAG A;  3LDQ A;  3K9K A;  3TU5 A;  5AQG A;  5AQZ A;  3QDK A;  1K73 O;  5M1N A;  2P9U A;  3O08 A;  3VTI A;  4PHT X;  1ESV A;  1NGH A;  4CD3 A;  1ATR A;  2NRX A;  4BRO A;  5EY4 A;  5JIC A;  1NGF A;  3CCS N;  4J8F A;  4M7X A;  3CF5 L;  3SBT A;  3CPW M;  4JD2 B;  1S3X A;  1U6Z A;  3ZEU B;  4EFH A;  5MLC Q;  4BRE A;  1TYQ A;  4GVE A;  3D2E B;  2D0O A;  4ISF A;  1WUA A;  3EE9 A;  3EL2 A;  4O5F A;  1YJ9 N;  1T3V A;  2RHK A;  3ZX2 A;  4QS7 A;  2KHO A;  1NGG A;  2PFU A;  4BRN A;  2IVO A;  1X9J A;  4BRK A;  4ILG B;  1YAG A;  4H0P A;  2E2O A;  3PLA A;  2Q0U A;  2KKZ A;  4H0T B;  5C0Y A;  4YOW A;  3RSE A;  4FWS A;  5CHI A;  4WFA L;  2AP1 A;  2NRW A;  4DCH A;  3C65 A;  3O6W A;  5AQR A;  1KC8 O;  4YOX A;  3GBT A;  3HOT A;  1TUU A;  4A2B A;  3A8Y A;  4EHT A;  4BC4 A;  2GUP A;  5CR4 A;  4E1J A;  3VF4 A;  2WC9 A;  3MN9 A;  1E4F T;  2QM1 A;  5AR0 A;  2ZJQ L;  1GLB G;  3VEY A;  4BQL A;  4LC9 B;  5AZI B;  1KD1 O;  4CI6 A;  3HRG A;  4ILH A;  5AFU H;  2HF4 A;  5BPN A;  3OW2 M;  1RGI A;  1O13 A;  2QWQ A;  1HKB A;  3JXU A;  4H0V B;  1Q82 O;  3UB5 A;  3OBY A;  4WQ4 A;  2OAN A;  5EXW A;  3HBT A;  3FZK A;  2Q97 A;  3PIO L;  1P90 A;  1XUP O;  4JKG B;  3VPZ A;  4BR7 A;  3CET A;  1VQ9 N;  4KBO A;  4BRF A;  3CCM N;  2E88 A;  3BUZ B;  5EVZ A;  2ZF5 O;  5C2D A;  2P9K B;  2E2N A;  2E8A A;  2BUP A;  3QBW A;  3VOV A;  5KPT A;  2QWO A;  5AQW A;  3VEO A;  2P9L A;  2ASO A;  1R59 O;  3CER A;  4CZH A;  2HBJ A;  1IG8 A;  1TUY A;  4FOE A;  2HOE A;  3MCP A;  3WXJ A;  1W97 L;  5HL7 L;  4FPB A;  5AQL A;  5E84 A;  4BRQ A;  4PKG A;  3SAF A;  1VQK N;  3IMX A;  4PL7 A;  3MDQ A;  1V4S A;  3LM2 A;  1NM1 A;  4FWP A;  4C1N I;  4CZE A;  1OVY A;  4XH1 A;  1GLE G;  5GAE P;  3IFR A;  1YUW A;  5KPR A;  1BA0 A;  1W2B M;  4B1W B;  3UKU B;  3NVM A;  3E9L A;  3EE8 A;  4B1V A;  4B1X B;  5LJW A;  5H1S Q;  1KAZ A;  2EWS A;  3CJA A;  3O80 A;  3CQY A;  3U4L A;  4GV9 A;  4IOX A;  4MO4 A;  3DXM A;  3G4S N;  1KQS M;  4Z94 A;  4IJA A;  4YDU C;  1GLD G;  3C6H A;  1Z05 A;  2NRZ A;  5HOO A;  1YJW N;  2GX9 A;  2PBD A;  3AAQ A;  3CCV N;  4C23 A;  3H1Q A;  5I9E B;  3I56 N;  1Q81 O;  1HLU A;  5BRH A;  3HM8 A;  3VGL A;  4WQ5 A;  3G71 N;  2P9S A;  3SK3 A;  4CZL A;  3CCE N;  2FSK A;  5C10 A;  2HBK A;  5F1X A;  1JCG A;  2OTL N;  2HBM A;  3R3L A;  5F2R A;  3DXK B;  3CJ1 A;  4NLC A;  4RWT A;  3ENH A;  5AZJ B;  4BR2 A;  1ATS A;  1D4X A;  5C2F A;  3ATU A;  3O1W A;  4CD1 A;  4CZJ A;  3I8B A;  3K9J A;  3M3Z A;  4OPH A;  2A40 A;  3WXM B;  3TSU A;  3Q7B A;  3WXL A;  1VAZ A;  3LDP A;  3CI5 A;  4H5T A;  3OA9 A;  2Q1N A;  3T69 A;  3I55 N;  2F9T A;  3LDN A;  5BRE A;  4JNE A;  1DT9 A;  4HWI A;  1MA9 B;  2D0P A;  4JKF A;  2IIR A;  3TSP A;  3GG4 A;  1K8K B;  2V52 B;  4A2A A;  4BR0 A;  4U7B A;  1NGI A;  5CE3 A;  3CCR N;  4IJN A;  4BY9 C;  3WT0 A;  4IXC A;  3D7E O;  5AZI A;  4YOU A;  3WUH A;  1GLF O;  3R6M A;  4JKH A;  3VMF B;  4EIA A;  2VCP A;  3MMV A;  3ZET B;  2P9N B;  3FZM A;  3MK6 A;  4MDB A;  2VGM A;  3GDQ A;  4JHD B;  4JKG A;  3F9M A;  3F2K A;  3O8M A;  3WEE B;  3P4I A;  5KQ8 A;  2IVN A;  2NNW A;  3O9S A;  1RDU A;  1BO5 O;  4BRA A;  3IUC A;  2E1Y A;  2J4R A;  1ATN A;  3O4W A;  5ADX H;  3HTV A;  3MWT A;  3BF1 A;  2QEX N;  2NRH A;  1YIJ N;  4ILJ A;  4QS8 A;  4K41 A;  1ZC6 A;  2P9P A;  1Y64 A;  3ZYY X;  3NVK A;  1G99 A;  2JWK A;  4CBX A;  5BRF A;  4B1U B;  1YIT N;  5AQY A;  2GWJ A;  3MCA B;  1ZBS A;  4CZM A;  3AY9 A;  3AGR A;  4AM7 A;  3D2F A;  2W41 A;  4GV6 A;  3ATV A;  4ISE A;  3KZB A;  4KH6 A;  2YHX A;  2CGK A;  1WOQ A;  3HI0 A;  5JLF A;  2F7T A;  2ITM A;  4BRP A;  4BGB A;  2Q0R A;  4YOR A;  2GEL A;  3KK7 A;  3BEX A;  4RCH A;  5BR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...