1VAZA

Solution structures of the p47 sep domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
76
structure length
76
Chain Sequence
ERRRHSGQDVHVVLKLWKTGFSLDNGDLRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords NSFL1 cofactor p47
publication title Structure, dynamics and interactions of p47, a major adaptor of the AAA ATPase, p97.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 10
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2004-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.210 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1vazA01
1SS6A 1VAZA
chains in the Genus database with same CATH superfamily
4JHDB 1LW2A 2OCEA 4EFHA 2GUIA 3LDOA 1VAZA 1CZBA 2GWKA 4DS5A 4YHHK 2HHSA 2FXUA 3QNNA 3CC2N 1KXPA 4IXCA 3V9SA 3NDKA 3ZX0A 4A57A 4CJWA 4GMJB 4C8NA 3FZMA 3AGKA 3VA0A 4DR6K 3WXMB 5LJWA 4KTQA 1ESVA 4LFCK 4K8ZA 5JLHA 3O4WA 5C42A 5C10A 3TANA 2A1SA 4FWRA 4NB4A 2O8BA 1QS4A 4B9SA 4PWDA 1WN7A 3TAEA 1CZ9A 4IO9L 1YTUA 2QWLA 1NKEA 3DRSA 1XUPO 3RMBA 2ASOA 3CC4N 3B6PA 3AARA 3TAQA 4OX9K 4CECA 4JKGB 3A8YA 2QA4N 1QSLA 2XY8A 3THXA 2HHWA 3QEXA 1YVUA 2E1ZA 3H08A 1UA1A 4YDUA 1MWKA 3MK6A 2ZJRL 1VSJA 3VEYA 4JI7K 4B9MA 2KTQA 3HPHA 1TKZA 4CEOA 4NLCA 3O9RA 3P39A 3CCLN 3ZX3A 4CEQA 5JLFA 3K5OA 1ZBUA 3C95A 2EHGA 2A6AA 2X6SA 5AQVA 5J2MA 1HNIA 4FWMA 5FDLA 4AHVA 1TUUA 2Q97A 2AP1A 3MWPA 2O8DB 2FSNA 2VQFK 4FJ7A 3K58A 4HWIA 4DHYA 1JCFA 3LAKA 4E7JA 4NYFA 3A5OC 4Q0BA 1GOCA 2IOCA 5KTQA 4M3YA 2F9TA 4AHRA 4PL8A 4L3QA 1WSHA 1NGGA 3I33A 1DT9A 4I2PA 3WXKA 1BA0A 4DSLA 1WUAA 3DYAA 3ZT2A 4DB3A 4ISFA 4AHUA 4X64K 4M7XA 4DV1K 4ELTA 1ATRA 2B6AA 1NNEA 1HNZK 3PIOL 5AQJA 2VWBA 3CMAN 1W0HA 1C1AA 3CM6A 1N6QA 3NH2A 4BRDA 2JLEA 1HR0K 3HSTB 3NCIA 3K5NA 4LF6K 3S3OA 1P8ZA 4OPHA 5AQFA 2EWSA 5AQMA 2HNZA 3O6WA 1RBVA 2KZMA 3U3YA 1BU6O 3L2WA 4F8RA 1VRTA 3UE5A 4PKGA 1EKEA 3C0BA 4FOEA 3DLLL 2ASMA 3A5LC 4FYDA 4HUEA 4BRCA 3C6AA 4GV3A 2XY6A 2E88A 3ZSQA 4YOTA 3WQTA 3NMUA 3G25A 4CK2A 1WLJA 4RW8A 4J8FA 4O55A 1D5AA 3QIPA 1MA9B 1I94K 3J81O 4F2RA 3EYZA 4DFMA 4DV4K 2QW9A 3KKRA 4ZTFA 4JK7A 5GADP 3HOSA 1C0MA 1G15A 3UKRA 2VG5A 1GLJO 3OYJA 3ZT0A 4QS7A 4EP5A 5KGWA 1X9SA 4FXDA 5BRFA 5ADXH 2ITMA 4CZMA 5HRSA 4YY3K 4H0XB 4B8AB 2HVHA 3ZX2A 4ILGB 4EZ6A 1IG8A 2BH1A 3SV3A 4U7BA 3QINA 3NH1A 5KQ8A 1L3TA 4I6MA 4JLHA 1YF5L 1XWLA 1HQUA 4LSNA 3VF2A 4A2AA 2WUSA 3CCEN 2QK9A 4OO1J 3AVBA 4H0VB 3H3NO 4E1NA 1RDCA 3NE6A 1BA1A 4FWQA 3OYFA 4C8OA 2RKIA 4DFJA 2F96A 3ASMA 4LH4A 4FLUA 1A5WA 3BGRA 5FPEA 4W5RA 4AILC 1YI2N 4CJEA 1BCOA 1HQEA 4DSIA 2HBKA 4FWSA 2G8IA 4CHYA 1LOTB 5KPTA 4BR2A 1F21A 3LAMA 4FJ5A 1VSDA 3HOTA 2G8WA 4G9ZA 1ZBFA 4IEIA 1LW0A 1JL1A 4JRPA 1HKCA 1VQ5N 1BI4A 3UKUA 3V1QA 5CHIA 4IOAL 3TU5A 4BRGA 3O3GA 1TAQA 1RT4A 2O8CB 4BE0A 4CI6A 5LMUK 1Y64A 3MN6A 1NMNA 3LZJA 4B9LA 3B8AX 3SQ1A 1JCGA 3OYLA 3L4IA 3IG1A 3ULEA 1ILYA 4BC5A 3MMVA 3O8MA 4BDPA 5BRDA 3TTFA 3NGZA 2O8EB 2KFNA 2JWLA 3ZSWA 1S72N 1YITN 3S9HA 1MWMA 3NGYA 2BDPA 3QERA 2F8TA 3CJBA 2VG7A 1GLDG 3U6FA 3MWTA 2ZM6K 3K2PA 4N5SA 1MDUB 4WYBA 2CGJA 1TKDA 4JKAA 1ZBHA 2WFBA 3VEWA 3T19A 2HHVA 4FJLA 1X1PA 4BRNA 1X9WA 5JS2A 2LSNA 2OZMA 3SV4A 1WAJA 4C8MA 1TK5A 2BTFA 3I8DA 4PA1A 5JVGL 4BGBA 3TR8A 3DOKA 4EHTA 4CD1A 3QO9A 4JK8A 4LFBK 4MFBA 5GAGP 1RDWX 2DFFA 3VGKA 3T1AA 1IKXA 1FKPA 3UIQA 1RCHA 2NRRA 1K73O 2ZQBA 3LWLA 1RT6A 2HMPA 4B1WB 3JSMA 3EE9A 2OANA 4F4KA 2X6NA 3MXMA 3VTHA 2OA8A 3CD6N 4CIFA 1QSSA 3OYAA 4KBOA 4E7HA 1R59O 5I9EB 3PO5A 3D2EB 3L2UA 4BREA 1VSHA 4CGDA 1KC8O 2HOEA 3D6RA 4CZHA 4ISEA 1OH5A 5SWMA 4WQ5A 4CGGA 3CCSN 1C0UA 4DQSA 3M8SA 4X66K 3O3HA 2P9KA 1B92A 3V1OA 3AO3A 1L3UA 4LF8K 3U9ZA 3TSUA 3SJJA 2GWJA 3WNHA 4A5AA 3LDPA 4L8RB 2HHQA 3NH0A 3SUNA 1JLEA 4JNEA 4CJSA 4O0IA 4BRKA 3HBTA 4FJGA 4B1VA 3MN9A 1NMDA 4YORA 2P9LA 4CEEA 5TKYA 3QLHA 1WSFA 3KZBA 3AO1A 4CHNA 1NGJA 4DU3A 5HL7L 1S22A 4K41A 3PX0A 4RW9A 4KHYA 5C25A 3OYCA 4BRFA 5HROA 3HK2A 1YXQA 4JKBA 4CJVA 1B9DA 2QWQA 4CHZA 2PAVA 4CHPA 4GKJK 3ZSYA 2OZSA 3LANA 4IWVA 3THWA 3H3OB 4CJQA 3VQ9A 1NK4A 4IKFA 4B8CA 3FR0A 1XC3A 1TV6A 3HZ6A 3F2KA 1OH6A 4YOUA 5HRNA 4A61A 4Q5VA 1RTJA 3AGRA 3H45C 2HVIA 4IDHA 2IVNA 3P31A 1NBWA 4HHTA 1HKBA 1I3AA 1NGDA 3MX2A 3AVIA 4KB0A 3IAYA 4H0PA 3AO4A 1NOYA 2HF4A 3RVCA 5T7BA 1HPMA 1LWCA 3J8AA 1XMQK 4B3SK 4B3RK 4CEDA 3SUPA 5AQXA 2V51B 4AHSA 4CZEA 3KK2A 1S5JA 2GELA 1U4BA 2NNWA 5LY3A 2HNYA 3J7AP 4H0OA 2KLAA 3OYMA 3SQ2A 1N8RO 5DM6L 1J5EK 3SYZA 2P1JA 4CZGA 2JGUA 2HHHK 3SAGA 4RW7A 2GEMA 2YI1A 4WFAL 3O5BA 5AQZA 2BUPA 3AVFA 2I7NA 1DKGD 1HYVA 4H5NA 4FVUA 2GBZA 1Q9XA 3NHGA 4CF9A 4DR1K 1ASWA 2XHBA 2VYPA 2NRHA 2F9WA 5AJ3K 4M3WA 4H5WA 3QEVA 3OYNA 1BL3A 1U6ZA 4DR2K 2P9UA 4W5TA 1OVYA 3RR8A 4CGFA 4H5RA 4KI6A 3KK3A 2KFZA 2FF6A 2ZWHA 1QZ6A 4FLYA 1Z6RA 4DFPA 3QETA 3SCXA 3U3GA 5AQKA 1ASUA 2V52B 4ZTJA 5EVZA 2YJEA 3CFOA 5ADXA 2CGLA 2HNDA 4QS8A 3OBWA 1M90O 3LPTA 4KHNA 1GLCG 1K8KB 4JI8K 4CFDA 5FRMA 2OPPA 3T69A 2D0BA 1KTQA 3DAWA 3ZLJA 4IG3A 3V9WA 1BI4B 1RT5A 1L5UA 1N32K 3ITHA 3UKUB 1KFSA 3OBYA 1NJZA 2FSJA 3HVRA 1ZXOA 5BPMA 4MO5A 3HTVA 4BGAA 1EXQA 2V7YA 4LF9K 2E2QA 4N41A 1VQMN 4E7IA 2HBMA 3KLGA 1X9MA 2F4VK 3EEQA 3NAEA 3OA9A 1KSPA 1WSJA 2G8KA 4LFAK 2E20A 3ULEB 1YUWA 4FPBA 2QXFA 3L4QA 4DFKA 3HJFA 4MDAA 2VGNA 1D9FA 5BRHA 4ID5A 3IMXA 1VQ4N 3A5MC 4NXNK 3ATVA 3QFUA 4JS4A 4FZZA 1TGOA 2ZD1A 1S1XA 4LSLA 1KAZA 1BWFO 2R7YA 3LP3A 4BC4A 5I3UA 4OKEA 1JXEA 4XH1A 4YDUC 4DF4A 3L6QA 1IO2A 1WOQA 3OYDA 4YNQA 3DOLA 1LWFA 3DJCA 3IKMA 3O9QA 4OPAA 5KI6A 1VSEA 3I0SA 4M3TA 2E2PA 2E6MA 4OLAA 5ELZA 4RCHA 3ENHA 5KPRA 2HB5A 1TYQB 1NWKA 4PKHA 3E01A 4F3TA 4DTJA 4JS5A 5E41A 3TARA 3QEPA 1WBDA 2DY4A 2KKZA 3AAPA 2VG6A 5GAEP 4NCAA 3AAQA 3NF6A 3QFPA 2P9IB 1X3NA 3LDSA 1XMOK 4M3ZA 4NLBA 3ALYA 3HP9A 3J80O 4LD0A 4AF1A 4FLXA 2NLXA 1L3SA 3RWUA 5CYQA 1N33K 4X62K 4BR5A 1LV5A 5BN9A 3CXCM 5EX5A 1MU2A 3HSCA 4CZKA 4CVNE 3PX6A 4JV5K 3TAFA 3CJ9A 2GX9A 4DU1A 2P9KB 3F9MA 4HUFA 4KHWA 1FKOA 4YOYA 4NXMK 1KRPA 5M1FA 2E8AA 1YIJN 2HHUA 1IJJA 5D3GA 1U2VA 5M1QA 1S1UA 3PLAA 4U67L 1RBUA 1VSMA 1RT1A 2Q0RA 3ENBA 1NKBA 2IAJA 4B1XB 4YOWA 3JYTA 3CFPA 1U48A 3CMEN 4E89A 5GAHP 4IJNA 2P9LB 3Q7CA 4JN4A 4LF4K 3VEVA 1NJXA 2G8HA 3SBGA 3WNEA 1D4XA 3QESA 3HL8A 5KRTA 4F2SA 1QZ5A 1K8AO 4RW4A 2YNFA 4PUOA 4ID1A 1NK9A 1W7AA 2UU9K 3WEEB 4HTUA 4E19A 3G0ZA 1KAYA 1WSGA 4BRPA 4CJTA 3SMSA 4FPAA 1W9HA 4PY5A 1A5XA 1SL1A 1U45A 2O4GA 3CG7A 2PBDA 4FWPA 1U49A 4M42A 2YNHA 5LL6Z 3CCJN 4WFNL 1EWQA 2D0CA 4LC9B 4GKKK 3OS2A 3EL2A 3RSEA 3LZIA 4E1JA 3E9PA 1SKRA 3QIOA 4CGIA 4OPJA 1JJ2M 3SMPA 3NF9A 3FE1A 2XRIA 3DLEA 4Z4CA 2NRWA 4A2BA 2QWOA 3IUCA 3C6UA 4CFBA 1JKHA 1NK8A 3JS6A 1WNSA 4JAXA 5DK5A 1HLUA 1EO1A 1NG9A 3VQ5A 3MCPA 4EIAA 4FWKA 2KZZA 1DEJA 3PSIA 2Q3SA 4UY8O 2KQ2A 4IO8A 2PFUA 3AA5X 3M8PA 4KB1A 1T6CA 3MECA 3QEIA 2XO7A 1UWBA 1VQKN 1BOTO 1OKJA 3GG4A 1JLGA 5C15A 3T1YK 1Z05A 4FJHA 1NLVA 2WC9A 4R79A 1BIUA 2P9UB 1RDDA 1NGAA 2YNGA 3DXMA 1S1WA 4DSEA 4CFAA 3DLKA 5HOOA 3B6OA 1NK6A 1EETA 4O5FA 4B08A 1BGXT 5KRSA 4DTNA 3J7YP 1Q7YO 3ATUA 3H1QA 5E84A 4C8LA 2ZGZA 3NVMA 3VQPA 5AQPA 1X9JA 1DGKN 4CJRA 3RRGA 3LPUA 3DLGA 5EXWA 2PY5A 3VMFB 3A2FA 3KLIA 1GOAA 2XY7A 1FJGK 1RFQA 3TI0A 3EKSA 4M63C 3ZCMA 2P9NA 4ILHA 3QNOA 2ZJQL 5C0YA 1IG9A 4DWIA 5GINA 1L3VA 3ZSRA 4IJAA 3VETA 2HHTA 4CK3A 3M5RA 2YHXA 3TSQA 2J4RA 2Z1HA 5M1OA 4XIUA 3NBPA 3RR7A 1EQYA 4H4MA 2W41A 1HNWK 4CEAA 1IKYA 1I39A 3V9XA 4C23A 3AVGA 3DXKA 4XH4A 2QI2A 3O9TA 1KQSM 4H5VA 3ZSOA 3BF1A 4ILJA 1NGHA 4DTUA 4FVMA 2BE2A 3CCUN 5JS1A 1QHTA 3CJ7A 4JKEA 1FXXA 2HSTA 4BDZA 1OVQA 4G1QA 2JWKA 1SQKA 1CXQA 2E4LA 1HUXA 4Y1CA 3DI6A 4FJNA 4DR4K 4RW6A 4DLGA 3CI5A 4Z0UA 1BUPA 3WUHA 2Q0UA 3VQQA 2FBXA 3EE8A 3GL1A 1NM1A 3HM9A 1HNVA 3EN9A 5KPZA 1X3MA 3BEXA 2Z1IA 4CGJA 3LP0A 1KVAA 1YJ9N 3HVTA 4CJLA 3OYBA 2VWJA 2IIRA 4FLTA 4WQ5C 4CEBA 5C2DA 3CETA 4RG8A 1VQON 4Z4IA 2NUBA 1NJYA 1VSFA 5DMRA 4JI0K 3VQDA 4MLEA 2P9SA 3TSPA 4B9QA 3VOVA 1BDGA 3MEGA 4FLZA 1NJIO 2O8BB 4CBUA 4KRFA 3C94A 5LJVA 4K8XA 3A0IX 1WAFA 4CJ7A 3VQAA 1VQ7N 4KTZA 5GIPA 4JI4K 4BR4A 3M3ZA 3KKSA 1RTDA 3TAGA 3THXB 3VQ4A 3DRRA 5H1SQ 5AQNA 3DWLA 3IRXA 4K42A 5AQLA 3K0SA 1RT3A 4F3OA 1U2VB 4AHCA 4YOVA 3THYA 1SKSA 3KTQA 3OTOK 4JKDA 4JHDA 3RTVA 4FK2A 2ASPA 3G10A 2UXCK 4CJ3A 3AA4A 3FZFA 1JL2A 3SUOA 1YHQN 2DFHA 4CJFA 3ZT1A 1OH8A 2EX3A 4CJUA 3HPOA 4RTFD 4CZFA 4BRIA 1JLBA 3Q7BA 1Y97A 4HTLA 2E6LA 3P4IA 2FBVA 4PL7A 4IBNA 3KWGA 2WONA 2B4JA 4FJXA 1QQOA 1NGIA 3RMAA 4ELVA 1BQNA 5HRRA 3AVLA 1R0AA 5EU7A 3KJVA 3SI6A 3GBTA 1VQ8N 4KH5A 3M6GA 3QEWA 3PUFA 5AQUA 3E1YA 1RDAA 4NYNA 4JKFA 3QB0A 2E2NA 1S9EA 4JKGA 3IFRA 2CH6A 1S1TA 3KK7A 3RSEB 3CFRA 3DLBA 4KHPK 1HNXK 1REVA 1NKCA 4CERA 5BPLA 3EZ5A 5F1XA 4KKOA 2YHWA 1T03A 1QHAA 4BWMA 4M45A 5EOYA 4HVJA 1C1BA 4PKIA 4LY7A 3ZETA 3F9KA 2NRVA 1C0FA 2B5JA 3R6MA 4EP4A 4YOXA 2A40A 3BF3A 1QQMA 4B3TK 4CJ4A 4FJIA 4FZXC 3FGUA 1WSEA 4W5QA 2ZF5O 4BVPA 4H0YB 4CESA 2RE2A 4DTMA 1LWEA 3KLFA 2HBJA 3MDQA 3V6DA 2CGKA 4DMNA 3G6EN 4FZYA 1E3MA 1YAGA 3DXMB 4HUGA 4BG8A 3UKRB 4IOXA 3VQ6A 3KLEA 3OJUA 4BACA 3P5JA 4CIEA 2UUAK 4CEZA 3M1FA 3V9ZA 4FJ8A 1XI1A 3O1BA 1SZ2A 3WXLA 1VQNN 2ZE2A 5F0XA 1D8YA 4BC2A 5AFUH 4I6MB 1JLQA 1NOZA 2GV9A 3MAQA 4FL9A 2QEXN 3I56N 4AQYK 1TK8A 4BC3A 5AZJA 5J2PA 3O3FA 1JLFA 2P9NB 4KO0A 1N34K 3TPQA 3O4QA 1LAWA 3VESA 3VEXA 2VQEK 4H4OA 4ISGA 3O80A 2VCPA 5M1KA 4A5BA 1JLCA 2RPIA 5SZTA 2F7TA 2W6KA 4DSJA 3HT3A 4DCHA 4IZ9A 1JLAA 4GV9A 3IDHA 4IOCL 3DXKB 1CLQA 3MN5A 4CK1A 3CCMN 4BR9A 3DMJA 5JMVA 1FK9A 5JICA 3LL3A 3HYFA 3CYMA 3CQ8A 1ASVA 4Z4GA 3E9LA 1GOBA 4CGHA 4K25A 2Z1JA 3LDLA 4CHOA 1XHXA 4WQ4A 4I2QA 3TWHA 4DTOA 5AQHA 4RWTA 1VK0A 1V4SA 2OTLN 3OYKA 3QBWA 3BZKA 4DUYK 2IVPA 4FWOA 1ZYQA 4CE9A 1Q81O 3QMLA 4WF9L 3CM5A 4CZIA 4CF0A 1Q18A 1TKTA 1FW6A 3MCAB 1DTTA 4F9OA 1Q82O 4N76A 1XNRK 2QWNA 4FW2A 4CIGA 1HPZA 5I42A 1Q8IA 4GVEA 1E4GT 3S3MA 4JI5K 3ZT4A 3M8QA 1O1WA 2ATQA 2YCHA 3CPWM 1T05A 3AO2A 1GLAG 3SBTA 3D2FA 4EAHD 3FZKA 3PV8A 4JD2A 1NK7A 4QS9A 4BRHA 3ENOA 3AA2A 4FM2A 1TAUA 1EP4A 3OJSA 4DV5K 2G8FA 2QXLA 4I7FA 4C8KA 2V7ZA 4K0KK 2KHOA 4JRQA 4Y1DA 2Y1IA 4FLWA 4DSKA 3TTCA 5MLCQ 3LP1A 4WCEL 5E26A 1DLOA 1JXBA 4BR0A 1BIZA 3OY9A 2D4WA 3MX5A 3L3VA 1VHXA 3MXJA 3T1HK 4ELUA 1ZBIA 3W0LA 4DUZK 3VA3A 1YJNN 5BN8A 4E3SA 4DV6K 2D0OA 4H03B 2YV0X 4KH6A 3AVCA 3OS0A 3OYHA 3CF5L 4M3RA 3VGMA 1DTQA 3M8RA 3V4IA 3O9UA 3WT0A 2NRZA 4DTPA 3WNFA 2O8EA 5BR8K 4CHQA 1WBBA 2Y1JA 3J7ZO 1SKWA 4OKKA 4QCLA 3TTDA 3G4SN 1RDUA 3D0PA 2O4IA 3ZSXA 1VSLA 3V1RA 2IVOA 4N47A 1GLEG 3S3NA 2ZJPL 3OS1A 3CJAA 5AR0A 4AM6A 4KI4A 4DQQA 4GV6A 5CY4A 2X78A 3LP2A 2Q2RA 4BROA 4I9LA 5A2QO 4H5TA 4DR3K 4KV8A 4KPYA 1W97L 3JAMO 5AQQA 2YX6A 1IKVA 2W40A 2H3GX 1IBKK 2UUBK 3P38A 4WE1A 4KAZA 2FBYA 1C0TA 1T7PA 3PIPL 4J2BA 1SV5A 3VGLA 4I9QA 4OJRA 1Z25A 4BWJA 3CHWA 4YFUA 3VPZA 2X74A 4CF1A 3T3FA 3VENA 4DV3K 4OLBA 3K5LA 4OGEA 3ZETB 2Q1NA 4OGCA 1VSIA 3THWB 2RN2A 2D5RA 3MEEA 1CZAN 4JI3K 4NO7A 3KD1E 1SL0A 5DM7L 2QKBA 3F73A 3D2EA 1T8EA 4PHTX 2I5JA 1UOCA 1BG3A 3G71N 5GIOA 5AQIA 5J1EA 1J6ZA 4CW7B 2A1RA 2Q36A 4DG1A 3EKUA 3CCVN 3SUQA 2O8FA 1S6QA 3F5TA 3R8EA 3AVMA 3VTIA 4N56A 4FLVA 3CJ1A 1SL2A 4H0TB 1Q86O 1SUQA 3KWIA 3R1XA 3SJHA 1A5VA 3MN7A 1HX1A 4BG9A 4O8KA 3LM9A 1U47A 4DQ8A 5CZ2A 4CZJA 4LF7K 3K9JA 1S1VA 1KLNA 4FJJA 3NF7A 2ZGYA 4BE2A 4PQUA 2YNIA 3KVGA 1W2BM 1BO5O 2ITGA 3LDQA 3K59A 2UUCK 3I8BA 3HPGA 2YJFA 3KLHA 3TAMA 4AM7A 5M1NA 4B9UA 2P5OA 5IWAK 1SS6A 4HCBA 5FRNA 5AZJB 1TUYA 1RGIA 4WFBL 1T44A 3SQ0A 4DU4A 4E7LA 2Z1GA 4IFVA 3AVAA 5EY4A 4FCYA 4DSFA 1P90A 4DV0K 3VQBA 1OH7A 3HO1A 4IEEA 4J2AA 3K9KA 5CR4A 4X65K 4MDBA 5HLFA 4B3MK 4DLEA 4NCGA 3HRGA 1IKWA 4DV7K 3O1WA 3VF6A 5C12A 3O4NA 4O4GA 3V9UA 3TABA 2HF3A 2YHAA 1WSIA 3SNNA 2IDOA 5AFUA 4FM1A 4FWLA 5M1PA 4BQLA 4B1UB 3ZT3A 1YVNA 5FPMA 3OYIA 1WB9A 2WBNA 5FLXO 1ATNA 2OPSA 2OTJN 2DFEA 1TL1A 3AVJA 4O8UA 3L3UA 3THVA 2FBTA 1KLMA 3AO5A 3K5MA 3AVKA 4E7KA 3WXIA 3LM2A 3QDKA 4Y0WA 1G99A 2A3ZA 4XH5A 3EO3A 2P9PA 1CXUA 2D0AA 2DPNA 4LF5K 2A41A 3NFAA 4CFCA 1VQ9N 1RT7A 4DS4A 1E4FT 4IFYA 2QTDA 4BRMA 4FSVA 2I7PA 4R5PA 3D2FB 1ZBSA 4DF8A 4NCBA 3H46O 4JD2B 3VQ8A 1IH7A 3A5NC 1QSYA 1BHLA 1HJRA 4IDKA 4DQRA 3QBXA 3PSFA 1HKGA 5BPNA 4DV2K 3SPYA 1QE1A 1YT3A 4W5OA 1NJWA 4MO4A 2G8UA 2BGGA 4Z4EA 1RNHA 5AZIA 3BY5A 2W42A 1RILA 4FK4A 3CPEA 1K8KA 1S9GA 2AA4A 2BANA 3UB5A 1VRUA 2CH5A 5C24A 3WXJA 1YJWN 3VQEA 4ZHRA 1IBLK 3I55N 1RBRA 1XC9A 5B8HA 2A42A 3LDNA 4MLHA 3RRHA 1TL3A 5AQSA 4KREA 3HM8A 4EZ9A 1K6YA 4J2DA 2D1KA 4JKHA 3AV9A 2RF2A 4GY2B 3U8XA 2E1YA 3AVNA 4B9VA 4B1YB 3FFKB 4BRLA 4CJ5A 2PYLA 3KK1A 4EHUA 3L2RA 1H1VA 3CQYA 3AA3A 4DR5K 3L2VA 3RMDA 5FROA 4CF2A 2A5XA 1QVGM 3C7NA 2FF3B 5J2QA 2PYJA 5CE3A 3AVHA 1LAVA 3VF4A 3ZEUA 3WNGA 1NU0A 4OKJA 3T7ZA 3HXMA 3ZSVA 3L2QA 3ISNC 3LALA 3LWMA 2QWRA 3CCRN 5CZ1A 1M1KO 3CERA 4OPKA 3O9SA 1QQNA 1VQLN 4DTXA 1KVCA 4CEFA 4FJMA 3ID6A 1TK0A 1IBMK 2WTUA 1XQSC 4DTSA 1T6DA 3BDPA 1SAZA 1S3XA 3VN5A 4FOIA 4CJKA 1EWRA 2RHKA 4FW1A 1BCMA 5TKWA 2FC0A 4K43A 1QTMA 2IGIA 4KHSA 3AY9A 1TYQA 5LMNK 5FPNA 4JEPA 5AQOA 3MEDA 1NGBA 4LH5A 3P1GA 3OYEA 1C1CA 4CZLA 2HHXA 3QICA 4JI6K 1T3VA 1C0GA 2QWMA 5BREA 3IS9A 3C65A 1RTIA 4GW6A 2UXDK 2P9IA 3HP6A 5AQTA 1QQCA 4CJPA 3N4PA 2NRXA 4UQGA 1ZBLA 1O13A 3OYGA 3JXUA 3KD5E 2F8SA 4DQIA 2YKNA 4V19S 2O8FB 4H8KA 4O0JA 1TKXA 4CBXA 1HJOA 4Z4FA 1NGEA 5AQRA 5AQYA 4BRQA 3NVKA 4FK0A 1U04A 2P5GA 3OW2M 3D45A 4DTRA 3U9DA 1QVFM 5C2FA 2O8DA 2VGMA 4B9NA 1LCUA 3L8BA 1XHZA 4FJ9A 2UXBK 2HW3A 3PY8A 1KAXA 1VQPN 5HP1A 3C6HA 1GLBG 1K9MO 4M3XA 3R9PA 4BR7A 2IC3A 3VEZA 5F2RA 3WEEA 1J54A 1V4TA 2OPQA 4Z94A 4QOZB 2D0PA 4W5NA 1ITGA 1UA0A 4FJKA 1J9AA 1KD1O 2GTDA 1D9DA 4B9TA 2Q31A 3SK3A 2FLOA 4JKCA 1YTAA 2YHBA 3TAPA 4KH4A 1KCFA 3D7EO 4HCCA 3BUZB 3P83D 5IT9O 2FSKA 3VQ7A 5CYMA 4JYAK 2XY5A 3KHYA 3PX4A 4M7YA 4WQ4C 1VSKA 4O5BA 3W3DA 2HMIA 2ETJA 3VQCA 2PZSA 3EY1A 3CIPA 4BRAA 1NGCA 4KFBA 3CQXA 4M41A 5BR9A 1J5OA 1C6VA 2GUPA 4JI1K 1KFDA 4JI2K 4A59A 1EX4A 3N4QA 1XNQK 3SAHA 1NK0A 4CBWA 3DLRA 4CD3A 1IV0A 1VQ6N 4KHQA 3VERA 2DTUA 4FO0A 2G8VA 3SQ4A 3FZLA 3GDQA 4QAGA 3NGIA 3E9OA 1HYSA 2YKMA 4E1MA 4C1NK 2QWPA 4AH9A 2UYTA 4IG0A 1ZC6A 3U4LA 4KHUA 3NF8A 4FWNA 1HMVA 2IS3A 2P9PB 4KTWA 1N36K 3GE1A 1JCEA 3BP8A 3SPZA 3CC7N 1RTHA 3SAFA 5KGXA 1HYZA 5KQDA 4JK9A 3EZWA 5AQGA 2YHYA 4MQ3A 4J2EA 4A62A 4DKWA 3HI0A 1Z26A 3H6EA 3WQUA 2W6LA 2E2OA 3R3LA 1NGFA 3CJCA 5K14A 4BE1A 3ZYYX 3KIOA 2QM1A 1TVRA 2P51A 5J2NA 3VEOA 5AZIB 4TSXA 4BQZA 1N5YA 1RBSA 3MXIA 3V81A 3DM2A 1B9FA 4CCHA 4IFEA 4DR7K 2WOMA 3DRPA 3FFIA 1KVBA 1RBTA 2VWKA 1J53A 3PO4A 5HBMA 2OYQA 3OHRA 5JVHL 4GNIA 5FPDA 2NRTA 1S6PA 3L0QA 4GVMA 1UAXA 4ICLA 5AQWA 3ID8A 2P9SB 3ULDA 4CF8A 4AHTA 3E66A 2QKKA 4O44A 4XEIA 4DQPA 3CCQN 2KW4A 4E0DA 3BZCA 3GOIA 3SLCA 3DLHA 3SZ2A 1GLLO 3S41A 3C7NB 1BQMA 5HRPA 2OPRA 4BDYA 4C1NI 1GLFO 1HRHA 3C6TA 4OVLA 3ZEUB 4B1ZA 3ZSZA 3OVNA 4Z4HA 4FM0A 2HBLA 2NZTA 4BY9C 2AJQA 4B3OA 1RT2A 1BISA 3H1VX 1Q9YA 3K57A 4BVOA 3FLCO 3RMCA 2E5LK 2O8CA 3O08A 1ATSA 1NK5A 1RDBA 3I0RA 4M3UA 3THYB 3FZHA
chains in the Genus database with same CATH topology
4JHDB 4AM7A 5M1NA 1NJIO 2GELA 2NNWA 4CBUA 4EFHA 5LY3A 3LDOA 1SS6A 1VAZA 5AZJB 1TUYA 4H0OA 5LJVA 1RGIA 4WFBL 1T44A 2GWKA 3A0IX 2KLAA 2FXUA 4CJ7A 1N8RO 3CC2N 5DM6L 1VQ7N 1KXPA 4IXCA 5GIPA 3ZX0A 4A57A 4BR4A 3M3ZA 4CZGA 3FZMA 3AGKA 3SAGA 2GEMA 2YI1A 5EY4A 3O5BA 5AQNA 3DWLA 4WFAL 5AQZA 1P90A 2BUPA 3WXMB 5LJWA 4K42A 5AQLA 4IEEA 1ESVA 2I7NA 3K9KA 3O4WA 1U2VB 5CR4A 1DKGD 5C10A 5JLHA 4YOVA 4MDBA 4FWRA 4H5NA 4JKDA 4FVUA 4JHDA 3HRGA 4NB4A 2ASPA 3O1WA 3VF6A 5C12A 4IO9L 2VYPA 5H1SQ 2QWLA 2HF3A 2NRHA 2F9WA 4H5WA 1XUPO 1YHQN 3FZFA 5AFUA 2ASOA 4FWLA 5M1PA 4BQLA 3CC4N 3AARA 4B1UB 1U6ZA 1YVNA 5FPMA 2P9UA 4JKGB 3A8YA 1OVYA 2WBNA 2QA4N 4RTFD 1ATNA 4CZFA 4BRIA 3Q7BA 4H5RA 2FF6A 2ZWHA 4HTLA 3P4IA 1QZ6A 4PL7A 1Z6RA 2OTJN 2E1ZA 4O8UA 3KWGA 5AQKA 2V52B 1MWKA 4YDUA 1QQOA 3MK6A 2ZJRL 5EVZA 1NGIA 3WXIA 2YJEA 3LM2A 3VEYA 3QDKA 5ADXA 2CGLA 4Y0WA 1G99A 4NLCA 3O9RA 2A3ZA 4XH5A 3EO3A 2P9PA 3P39A 3OBWA 4QS8A 3CCLN 3GBTA 3ZX3A 1M90O 4KH5A 1VQ8N 2DPNA 3M6GA 5JLFA 2A41A 2A6AA 1GLCG 1K8KB 5AQVA 3E1YA 5AQUA 4FWMA 1VQ9N 4JKFA 1E4FT 3QB0A 1TUUA 2Q97A 2AP1A 3T69A 3DAWA 2E2NA 3MWPA 2QTDA 2FSNA 4JKGA 4BRMA 4FSVA 3UKUB 2I7PA 3OBYA 3IFRA 2FSJA 2CH6A 3D2FB 1ZXOA 1ZBSA 5BPMA 4MO5A 3HTVA 3KK7A 4HWIA 3RSEB 1JCFA 4BGAA 2V7YA 3H46O 4JD2B 4DHYA 2E2QA 3A5NC 1VQMN 3A5OC 2HBMA 5BPLA 3QBXA 3OA9A 5F1XA 1HKGA 2F9TA 2YHWA 5BPNA 1QHAA 4PL8A 4L3QA 1NGGA 4MO4A 5EOYA 2E20A 3I33A 1DT9A 3ULEB 3WXKA 5AZIA 1YUWA 1BA0A 4PKIA 4FPBA 3ZETA 1WUAA 3L4QA 3CPEA 1K8KA 4MDAA 2VGNA 2AA4A 2NRVA 3UB5A 4DB3A 4ISFA 2CH5A 5BRHA 1C0FA 4M7XA 3WXJA 1YJWN 3IMXA 1VQ4N 3A5MC 3ATVA 3QFUA 1ATRA 3R6MA 4YOXA 3PIOL 5AQJA 2VWBA 3CMAN 3I55N 4BRDA 1KAZA 1BWFO 2A40A 1QQMA 3BF3A 5B8HA 2A42A 3LDNA 3FGUA 4MLHA 4BC4A 2ZF5O 4BVPA 4H0YB 5AQSA 3HM8A 1P8ZA 4OPHA 2RE2A 4XH1A 4YDUC 5AQFA 2EWSA 3L6QA 5AQMA 1WOQA 2D1KA 4JKHA 2HBJA 3O6WA 3MDQA 4GY2B 3U8XA 2E1YA 4B1YB 1BU6O 3FFKB 4BRLA 2CGKA 4EHUA 3DJCA 3G6EN 3IKMA 3UE5A 1H1VA 3O9QA 4OPAA 3CQYA 4PKGA 1YAGA 5KPZA 3C0BA 4FOEA 2E2PA 5ELZA 2A5XA 1QVGM 3DXMB 3C7NA 4RCHA 2ASMA 3DLLL 3A5LC 2FF3B 3ENHA 3UKRB 4IOXA 4BG8A 5CE3A 4BRCA 5KPRA 3C6AA 3VF4A 3ZEUA 1TYQB 4GV3A 1NWKA 4PKHA 3T7ZA 2E88A 4YOTA 3WQTA 3M1FA 2QWRA 3NMUA 3G25A 3O1BA 1SZ2A 3CCRN 1M1KO 3WXLA 1VQNN 2KKZA 3CERA 3O9SA 1QQNA 4J8FA 5F0XA 1VQLN 4BC2A 3AAPA 5AFUH 4I6MB 3ID6A 1MA9B 1XQSC 5GAEP 1T6DA 3AAQA 3QFPA 1SAZA 1S3XA 2P9IB 4FL9A 1X3NA 2QW9A 4FOIA 4NLBA 3I56N 2RHKA 4JK7A 2QEXN 4AF1A 5GADP 3HOSA 5TKWA 4K43A 4BC3A 5AZJA 3UKRA 2NLXA 1GLJO 2P9NB 4QS7A 3AY9A 3TPQA 1TYQA 4BR5A 3VESA 5FPNA 3VEXA 5BRFA 4JEPA 5ADXH 5AQOA 2ITMA 5BN9A 4CZMA 4H0XB 3CXCM 5EX5A 4ISGA 3O80A 1NGBA 3HSCA 3ZX2A 4CZKA 2VCPA 5M1KA 4ILGB 3CJ9A 4CZLA 2GX9A 1IG8A 4A5BA 2P9KB 3F9MA 2BH1A 3QICA 4U7BA 4YOYA 5M1FA 2E8AA 5KQ8A 2F7TA 1YIJN 4I6MA 1IJJA 1T3VA 5BREA 1C0GA 1U2VA 1YF5L 2QWMA 5M1QA 3PLAA 4U67L 3C65A 4DCHA 4IZ9A 2P9IA 3VF2A 2Q0RA 3ENBA 4GV9A 3IDHA 2WUSA 4A2AA 5AQTA 4B1XB 3DXKB 4YOWA 4IOCL 3CCEN 3CMEN 3N4PA 3MN5A 5GAHP 3CCMN 4IJNA 4BR9A 4OO1J 2P9LB 3Q7CA 4JN4A 5JMVA 5JICA 4H0VB 3VEVA 2NRXA 3H3NO 3LL3A 3SBGA 1O13A 1BA1A 4FWQA 3JXUA 3E9LA 4K25A 3LDLA 4WQ4A 1D4XA 5AQHA 4RWTA 1V4SA 1QZ5A 5FPEA 1K8AO 2OTLN 3QBWA 1YI2N 3WEEB 2IVPA 4FWOA 4CBXA 1HJOA 1NGEA 1Q81O 3QMLA 5AQYA 5AQRA 1KAYA 2HBKA 4FWSA 4BRQA 4WF9L 4CZIA 4BRPA 3NVKA 1LOTB 1Q18A 3SMSA 4BR2A 5KPTA 4FPAA 3MCAB 4F9OA 1Q82O 3OW2M 2QWNA 4GVEA 2PBDA 3HOTA 4FWPA 1E4GT 4G9ZA 4IEIA 3CCJN 4WFNL 3U9DA 1HKCA 1QVFM 1VQ5N 5C2FA 2YCHA 3CPWM 3UKUA 1GLAG 2VGMA 4LC9B 3SBTA 5CHIA 3TU5A 4BRGA 3D2FA 1LCUA 4EAHD 4IOAL 3FZKA 3EL2A 3RSEA 1KAXA 1VQPN 4JD2A 4E1JA 3C6HA 1GLBG 4CI6A 1K9MO 3E9PA 4QS9A 3R9PA 1Y64A 4BR7A 3WEEA 3MN6A 5F2RA 3VEZA 1V4TA 4BRHA 4Z94A 2D0PA 3SMPA 1JJ2M 3FE1A 3B8AX 3ENOA 2NRWA 4A2BA 1KD1O 2GTDA 1JCGA 2QWOA 3L4IA 2QXLA 2Q31A 3IUCA 3SK3A 2V7ZA 2KHOA 2FLOA 4JKCA 3ULEA 4KH4A 3JS6A 3D7EO 4JAXA 1HLUA 3BUZB 4CZEA 1ILYA 1EO1A 2FSKA 4BC5A 3MCPA 3MMVA 3O8MA 4FWKA 1DEJA 4EIAA 3TTFA 3TTCA 5BRDA 5MLCQ 4WCEL 5E26A 3KHYA 2JWLA 4M7YA 4WQ4C 1S72N 1YITN 4BR0A 4UY8O 1MWMA 4IO8A 3W3DA 2PFUA 2D4WA 3MX5A 3CJBA 1GLDG 3MWTA 3W0LA 1T6CA 3CIPA 1MDUB 4WYBA 2CGJA 4BRAA 1NGCA 4JKAA 1YJNN 5BN8A 3CQXA 2D0OA 2WFBA 4H03B 4KH6A 3VEWA 1VQKN 1BOTO 5BR9A 1OKJA 3GG4A 4BRNA 5C15A 2GUPA 1Z05A 3CF5L 1NLVA 2WC9A 4R79A 4A59A 2P9UB 3VGMA 3N4QA 3SAHA 1NGAA 3O9UA 3WT0A 2NRZA 4CBWA 3DXMA 2BTFA 5JVGL 5HOOA 4CD3A 1VQ6N 3J7ZO 4BGBA 4EHTA 4O5FA 3VERA 4CD1A 4JK8A 4FO0A 3TTDA 3G4SN 1RDUA 3FZLA 5GAGP 3GDQA 1RDWX 1Q7YO 2IVOA 3ATUA 3E9OA 1GLEG 3H1QA 5E84A 3VGKA 2ZJPL 3CJAA 2QWPA 2ZGZA 4C1NK 2NRRA 2UYTA 1K73O 1ZC6A 3U4LA 5AR0A 2HMPA 3NVMA 4FWNA 2P9PB 4AM6A 4B1WB 5AQPA 4GV6A 1X9JA 3EE9A 1DGKN 2OANA 2Q2RA 3GE1A 1JCEA 3CD6N 3BP8A 3VTHA 4BROA 4H5TA 1W97L 4KBOA 5EXWA 3CC7N 5AQQA 1R59O 3VMFB 2YX6A 3SAFA 2W40A 5I9EB 3D2EB 2H3GX 4BREA 1RFQA 3VOVA 3EKSA 5KQDA 4M63C 3P38A 4JK9A 3EZWA 2P9NA 1KC8O 2HOEA 3D6RA 4ILHA 4ISEA 5AQGA 4CZHA 3PIPL 2ZJQL 2YHYA 4WQ5A 5C0YA 4A62A 4DKWA 3HI0A 3VGLA 3CCSN 5GINA 3H6EA 3WQUA 2E2OA 3R3LA 1NGFA 3CHWA 4IJAA 3M5RA 2P9KA 2YHXA 3CJCA 3VETA 3VPZA 3TSQA 3ZYYX 2J4RA 2QM1A 5M1OA 3U9ZA 3TSUA 3VENA 3VEOA 5AZIB 2GWJA 4BQZA 3ZETB 2Q1NA 1EQYA 4A5AA 3LDPA 2W41A 4JNEA 1CZAN 4BRKA 3HBTA 4NO7A 4C23A 3DXKA 4XH4A 2QI2A 3O9TA 4B1VA 1KQSM 5DM7L 3MN9A 1NMDA 3D2EA 4IFEA 2P9LA 4YORA 4PHTX 5TKYA 4H5VA 5AQXA 3BF1A 1NGHA 3KZBA 4ILJA 1BG3A 3G71N 1NGJA 3OHRA 5GIOA 5AQIA 5HL7L 3CCUN 1S22A 4K41A 5JVHL 4GNIA 5FPDA 2NRTA 1J6ZA 3CJ7A 2Q36A 4BRFA 4JKEA 3L0QA 1YXQA 4JKBA 3EKUA 2QWQA 3CCVN 5AQWA 2HSTA 3F5TA 3ID8A 2P9SB 2PAVA 3R8EA 3VTIA 2JWKA 1SQKA 3E66A 3CJ1A 4H0TB 4IWVA 4B9QA 1HUXA 4XEIA 1Q86O 3CCQN 3KWIA 3R1XA 3SJHA 3GOIA 3SLCA 3CI5A 3H3OB 1BUPA 1GLLO 3MN7A 3FR0A 3S41A 2Q0UA 3C7NB 1XC3A 3WUHA 3EE8A 1HX1A 1NM1A 3GL1A 3HZ6A 4O8KA 3LM9A 3F2KA 4BG9A 3EN9A 4C1NI 1X3MA 3BEXA 1GLFO 4YOUA 3ZEUB 4CZJA 4DQ8A 4B1ZA 4A61A 3AGRA 3H45C 3K9JA 4IDHA 2IVNA 3P31A 1YJ9N 2ZGYA 1NBWA 2HBLA 1HKBA 1NGDA 3MX2A 2IIRA 2NZTA 4BY9C 3H1VX 4H0PA 4WQ5C 3KVGA 4BVOA 5C2DA 3FLCO 1W2BM 2HF4A 3CETA 3RVCA 1VQON 1HPMA 3O08A 1BO5O 3J8AA 3LDQA 1ATSA 4MLEA 3I8BA 2P9SA 2V51B 2YJFA 3FZHA 3TSPA 1BDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS6 A;  1VAZ A; 
#chains in the Genus database with same CATH topology
 4JHD B;  1LW2 A;  2OCE A;  4EFH A;  2GUI A;  3LDO A;  1VAZ A;  1CZB A;  2GWK A;  4DS5 A;  4YHH K;  2HHS A;  2FXU A;  3QNN A;  3CC2 N;  1KXP A;  4IXC A;  3V9S A;  3NDK A;  3ZX0 A;  4A57 A;  4CJW A;  4GMJ B;  4C8N A;  3FZM A;  3AGK A;  3VA0 A;  4DR6 K;  3WXM B;  5LJW A;  4KTQ A;  1ESV A;  4LFC K;  4K8Z A;  5JLH A;  3O4W A;  5C42 A;  5C10 A;  3TAN A;  2A1S A;  4FWR A;  4NB4 A;  2O8B A;  1QS4 A;  4B9S A;  4PWD A;  1WN7 A;  3TAE A;  1CZ9 A;  4IO9 L;  1YTU A;  2QWL A;  1NKE A;  3DRS A;  1XUP O;  3RMB A;  2ASO A;  3CC4 N;  3B6P A;  3AAR A;  3TAQ A;  4OX9 K;  4CEC A;  4JKG B;  3A8Y A;  2QA4 N;  1QSL A;  2XY8 A;  3THX A;  2HHW A;  3QEX A;  1YVU A;  2E1Z A;  3H08 A;  1UA1 A;  4YDU A;  1MWK A;  3MK6 A;  2ZJR L;  1VSJ A;  3VEY A;  4JI7 K;  4B9M A;  2KTQ A;  3HPH A;  1TKZ A;  4CEO A;  4NLC A;  3O9R A;  3P39 A;  3CCL N;  3ZX3 A;  4CEQ A;  5JLF A;  3K5O A;  1ZBU A;  3C95 A;  2EHG A;  2A6A A;  2X6S A;  5AQV A;  5J2M A;  1HNI A;  4FWM A;  5FDL A;  4AHV A;  1TUU A;  2Q97 A;  2AP1 A;  3MWP A;  2O8D B;  2FSN A;  2VQF K;  4FJ7 A;  3K58 A;  4HWI A;  4DHY A;  1JCF A;  3LAK A;  4E7J A;  4NYF A;  3A5O C;  4Q0B A;  1GOC A;  2IOC A;  5KTQ A;  4M3Y A;  2F9T A;  4AHR A;  4PL8 A;  4L3Q A;  1WSH A;  1NGG A;  3I33 A;  1DT9 A;  4I2P A;  3WXK A;  1BA0 A;  4DSL A;  1WUA A;  3DYA A;  3ZT2 A;  4DB3 A;  4ISF A;  4AHU A;  4X64 K;  4M7X A;  4DV1 K;  4ELT A;  1ATR A;  2B6A A;  1NNE A;  1HNZ K;  3PIO L;  5AQJ A;  2VWB A;  3CMA N;  1W0H A;  1C1A A;  3CM6 A;  1N6Q A;  3NH2 A;  4BRD A;  2JLE A;  1HR0 K;  3HST B;  3NCI A;  3K5N A;  4LF6 K;  3S3O A;  1P8Z A;  4OPH A;  5AQF A;  2EWS A;  5AQM A;  2HNZ A;  3O6W A;  1RBV A;  2KZM A;  3U3Y A;  1BU6 O;  3L2W A;  4F8R A;  1VRT A;  3UE5 A;  4PKG A;  1EKE A;  3C0B A;  4FOE A;  3DLL L;  2ASM A;  3A5L C;  4FYD A;  4HUE A;  4BRC A;  3C6A A;  4GV3 A;  2XY6 A;  2E88 A;  3ZSQ A;  4YOT A;  3WQT A;  3NMU A;  3G25 A;  4CK2 A;  1WLJ A;  4RW8 A;  4J8F A;  4O55 A;  1D5A A;  3QIP A;  1MA9 B;  1I94 K;  3J81 O;  4F2R A;  3EYZ A;  4DFM A;  4DV4 K;  2QW9 A;  3KKR A;  4ZTF A;  4JK7 A;  5GAD P;  3HOS A;  1C0M A;  1G15 A;  3UKR A;  2VG5 A;  1GLJ O;  3OYJ A;  3ZT0 A;  4QS7 A;  4EP5 A;  5KGW A;  1X9S A;  4FXD A;  5BRF A;  5ADX H;  2ITM A;  4CZM A;  5HRS A;  4YY3 K;  4H0X B;  4B8A B;  2HVH A;  3ZX2 A;  4ILG B;  4EZ6 A;  1IG8 A;  2BH1 A;  3SV3 A;  4U7B A;  3QIN A;  3NH1 A;  5KQ8 A;  1L3T A;  4I6M A;  4JLH A;  1YF5 L;  1XWL A;  1HQU A;  4LSN A;  3VF2 A;  4A2A A;  2WUS A;  3CCE N;  2QK9 A;  4OO1 J;  3AVB A;  4H0V B;  3H3N O;  4E1N A;  1RDC A;  3NE6 A;  1BA1 A;  4FWQ A;  3OYF A;  4C8O A;  2RKI A;  4DFJ A;  2F96 A;  3ASM A;  4LH4 A;  4FLU A;  1A5W A;  3BGR A;  5FPE A;  4W5R A;  4AIL C;  1YI2 N;  4CJE A;  1BCO A;  1HQE A;  4DSI A;  2HBK A;  4FWS A;  2G8I A;  4CHY A;  1LOT B;  5KPT A;  4BR2 A;  1F21 A;  3LAM A;  4FJ5 A;  1VSD A;  3HOT A;  2G8W A;  4G9Z A;  1ZBF A;  4IEI A;  1LW0 A;  1JL1 A;  4JRP A;  1HKC A;  1VQ5 N;  1BI4 A;  3UKU A;  3V1Q A;  5CHI A;  4IOA L;  3TU5 A;  4BRG A;  3O3G A;  1TAQ A;  1RT4 A;  2O8C B;  4BE0 A;  4CI6 A;  5LMU K;  1Y64 A;  3MN6 A;  1NMN A;  3LZJ A;  4B9L A;  3B8A X;  3SQ1 A;  1JCG A;  3OYL A;  3L4I A;  3IG1 A;  3ULE A;  1ILY A;  4BC5 A;  3MMV A;  3O8M A;  4BDP A;  5BRD A;  3TTF A;  3NGZ A;  2O8E B;  2KFN A;  2JWL A;  3ZSW A;  1S72 N;  1YIT N;  3S9H A;  1MWM A;  3NGY A;  2BDP A;  3QER A;  2F8T A;  3CJB A;  2VG7 A;  1GLD G;  3U6F A;  3MWT A;  2ZM6 K;  3K2P A;  4N5S A;  1MDU B;  4WYB A;  2CGJ A;  1TKD A;  4JKA A;  1ZBH A;  2WFB A;  3VEW A;  3T19 A;  2HHV A;  4FJL A;  1X1P A;  4BRN A;  1X9W A;  5JS2 A;  2LSN A;  2OZM A;  3SV4 A;  1WAJ A;  4C8M A;  1TK5 A;  2BTF A;  3I8D A;  4PA1 A;  5JVG L;  4BGB A;  3TR8 A;  3DOK A;  4EHT A;  4CD1 A;  3QO9 A;  4JK8 A;  4LFB K;  4MFB A;  5GAG P;  1RDW X;  2DFF A;  3VGK A;  3T1A A;  1IKX A;  1FKP A;  3UIQ A;  1RCH A;  2NRR A;  1K73 O;  2ZQB A;  3LWL A;  1RT6 A;  2HMP A;  4B1W B;  3JSM A;  3EE9 A;  2OAN A;  4F4K A;  2X6N A;  3MXM A;  3VTH A;  2OA8 A;  3CD6 N;  4CIF A;  1QSS A;  3OYA A;  4KBO A;  4E7H A;  1R59 O;  5I9E B;  3PO5 A;  3D2E B;  3L2U A;  4BRE A;  1VSH A;  4CGD A;  1KC8 O;  2HOE A;  3D6R A;  4CZH A;  4ISE A;  1OH5 A;  5SWM A;  4WQ5 A;  4CGG A;  3CCS N;  1C0U A;  4DQS A;  3M8S A;  4X66 K;  3O3H A;  2P9K A;  1B92 A;  3V1O A;  3AO3 A;  1L3U A;  4LF8 K;  3U9Z A;  3TSU A;  3SJJ A;  2GWJ A;  3WNH A;  4A5A A;  3LDP A;  4L8R B;  2HHQ A;  3NH0 A;  3SUN A;  1JLE A;  4JNE A;  4CJS A;  4O0I A;  4BRK A;  3HBT A;  4FJG A;  4B1V A;  3MN9 A;  1NMD A;  4YOR A;  2P9L A;  4CEE A;  5TKY A;  3QLH A;  1WSF A;  3KZB A;  3AO1 A;  4CHN A;  1NGJ A;  4DU3 A;  5HL7 L;  1S22 A;  4K41 A;  3PX0 A;  4RW9 A;  4KHY A;  5C25 A;  3OYC A;  4BRF A;  5HRO A;  3HK2 A;  1YXQ A;  4JKB A;  4CJV A;  1B9D A;  2QWQ A;  4CHZ A;  2PAV A;  4CHP A;  4GKJ K;  3ZSY A;  2OZS A;  3LAN A;  4IWV A;  3THW A;  3H3O B;  4CJQ A;  3VQ9 A;  1NK4 A;  4IKF A;  4B8C A;  3FR0 A;  1XC3 A;  1TV6 A;  3HZ6 A;  3F2K A;  1OH6 A;  4YOU A;  5HRN A;  4A61 A;  4Q5V A;  1RTJ A;  3AGR A;  3H45 C;  2HVI A;  4IDH A;  2IVN A;  3P31 A;  1NBW A;  4HHT A;  1HKB A;  1I3A A;  1NGD A;  3MX2 A;  3AVI A;  4KB0 A;  3IAY A;  4H0P A;  3AO4 A;  1NOY A;  2HF4 A;  3RVC A;  5T7B A;  1HPM A;  1LWC A;  3J8A A;  1XMQ K;  4B3S K;  4B3R K;  4CED A;  3SUP A;  5AQX A;  2V51 B;  4AHS A;  4CZE A;  3KK2 A;  1S5J A;  2GEL A;  1U4B A;  2NNW A;  5LY3 A;  2HNY A;  3J7A P;  4H0O A;  2KLA A;  3OYM A;  3SQ2 A;  1N8R O;  5DM6 L;  1J5E K;  3SYZ A;  2P1J A;  4CZG A;  2JGU A;  2HHH K;  3SAG A;  4RW7 A;  2GEM A;  2YI1 A;  4WFA L;  3O5B A;  5AQZ A;  2BUP A;  3AVF A;  2I7N A;  1DKG D;  1HYV A;  4H5N A;  4FVU A;  2GBZ A;  1Q9X A;  3NHG A;  4CF9 A;  4DR1 K;  1ASW A;  2XHB A;  2VYP A;  2NRH A;  2F9W A;  5AJ3 K;  4M3W A;  4H5W A;  3QEV A;  3OYN A;  1BL3 A;  1U6Z A;  4DR2 K;  2P9U A;  4W5T A;  1OVY A;  3RR8 A;  4CGF A;  4H5R A;  4KI6 A;  3KK3 A;  2KFZ A;  2FF6 A;  2ZWH A;  1QZ6 A;  4FLY A;  1Z6R A;  4DFP A;  3QET A;  3SCX A;  3U3G A;  5AQK A;  1ASU A;  2V52 B;  4ZTJ A;  5EVZ A;  2YJE A;  3CFO A;  5ADX A;  2CGL A;  2HND A;  4QS8 A;  3OBW A;  1M90 O;  3LPT A;  4KHN A;  1GLC G;  1K8K B;  4JI8 K;  4CFD A;  5FRM A;  2OPP A;  3T69 A;  2D0B A;  1KTQ A;  3DAW A;  3ZLJ A;  4IG3 A;  3V9W A;  1BI4 B;  1RT5 A;  1L5U A;  1N32 K;  3ITH A;  3UKU B;  1KFS A;  3OBY A;  1NJZ A;  2FSJ A;  3HVR A;  1ZXO A;  5BPM A;  4MO5 A;  3HTV A;  4BGA A;  1EXQ A;  2V7Y A;  4LF9 K;  2E2Q A;  4N41 A;  1VQM N;  4E7I A;  2HBM A;  3KLG A;  1X9M A;  2F4V K;  3EEQ A;  3NAE A;  3OA9 A;  1KSP A;  1WSJ A;  2G8K A;  4LFA K;  2E20 A;  3ULE B;  1YUW A;  4FPB A;  2QXF A;  3L4Q A;  4DFK A;  3HJF A;  4MDA A;  2VGN A;  1D9F A;  5BRH A;  4ID5 A;  3IMX A;  1VQ4 N;  3A5M C;  4NXN K;  3ATV A;  3QFU A;  4JS4 A;  4FZZ A;  1TGO A;  2ZD1 A;  1S1X A;  4LSL A;  1KAZ A;  1BWF O;  2R7Y A;  3LP3 A;  4BC4 A;  5I3U A;  4OKE A;  1JXE A;  4XH1 A;  4YDU C;  4DF4 A;  3L6Q A;  1IO2 A;  1WOQ A;  3OYD A;  4YNQ A;  3DOL A;  1LWF A;  3DJC A;  3IKM A;  3O9Q A;  4OPA A;  5KI6 A;  1VSE A;  3I0S A;  4M3T A;  2E2P A;  2E6M A;  4OLA A;  5ELZ A;  4RCH A;  3ENH A;  5KPR A;  2HB5 A;  1TYQ B;  1NWK A;  4PKH A;  3E01 A;  4F3T A;  4DTJ A;  4JS5 A;  5E41 A;  3TAR A;  3QEP A;  1WBD A;  2DY4 A;  2KKZ A;  3AAP A;  2VG6 A;  5GAE P;  4NCA A;  3AAQ A;  3NF6 A;  3QFP A;  2P9I B;  1X3N A;  3LDS A;  1XMO K;  4M3Z A;  4NLB A;  3ALY A;  3HP9 A;  3J80 O;  4LD0 A;  4AF1 A;  4FLX A;  2NLX A;  1L3S A;  3RWU A;  5CYQ A;  1N33 K;  4X62 K;  4BR5 A;  1LV5 A;  5BN9 A;  3CXC M;  5EX5 A;  1MU2 A;  3HSC A;  4CZK A;  4CVN E;  3PX6 A;  4JV5 K;  3TAF A;  3CJ9 A;  2GX9 A;  4DU1 A;  2P9K B;  3F9M A;  4HUF A;  4KHW A;  1FKO A;  4YOY A;  4NXM K;  1KRP A;  5M1F A;  2E8A A;  1YIJ N;  2HHU A;  1IJJ A;  5D3G A;  1U2V A;  5M1Q A;  1S1U A;  3PLA A;  4U67 L;  1RBU A;  1VSM A;  1RT1 A;  2Q0R A;  3ENB A;  1NKB A;  2IAJ A;  4B1X B;  4YOW A;  3JYT A;  3CFP A;  1U48 A;  3CME N;  4E89 A;  5GAH P;  4IJN A;  2P9L B;  3Q7C A;  4JN4 A;  4LF4 K;  3VEV A;  1NJX A;  2G8H A;  3SBG A;  3WNE A;  1D4X A;  3QES A;  3HL8 A;  5KRT A;  4F2S A;  1QZ5 A;  1K8A O;  4RW4 A;  2YNF A;  4PUO A;  4ID1 A;  1NK9 A;  1W7A A;  2UU9 K;  3WEE B;  4HTU A;  4E19 A;  3G0Z A;  1KAY A;  1WSG A;  4BRP A;  4CJT A;  3SMS A;  4FPA A;  1W9H A;  4PY5 A;  1A5X A;  1SL1 A;  1U45 A;  2O4G A;  3CG7 A;  2PBD A;  4FWP A;  1U49 A;  4M42 A;  2YNH A;  5LL6 Z;  3CCJ N;  4WFN L;  1EWQ A;  2D0C A;  4LC9 B;  4GKK K;  3OS2 A;  3EL2 A;  3RSE A;  3LZI A;  4E1J A;  3E9P A;  1SKR A;  3QIO A;  4CGI A;  4OPJ A;  1JJ2 M;  3SMP A;  3NF9 A;  3FE1 A;  2XRI A;  3DLE A;  4Z4C A;  2NRW A;  4A2B A;  2QWO A;  3IUC A;  3C6U A;  4CFB A;  1JKH A;  1NK8 A;  3JS6 A;  1WNS A;  4JAX A;  5DK5 A;  1HLU A;  1EO1 A;  1NG9 A;  3VQ5 A;  3MCP A;  4EIA A;  4FWK A;  2KZZ A;  1DEJ A;  3PSI A;  2Q3S A;  4UY8 O;  2KQ2 A;  4IO8 A;  2PFU A;  3AA5 X;  3M8P A;  4KB1 A;  1T6C A;  3MEC A;  3QEI A;  2XO7 A;  1UWB A;  1VQK N;  1BOT O;  1OKJ A;  3GG4 A;  1JLG A;  5C15 A;  3T1Y K;  1Z05 A;  4FJH A;  1NLV A;  2WC9 A;  4R79 A;  1BIU A;  2P9U B;  1RDD A;  1NGA A;  2YNG A;  3DXM A;  1S1W A;  4DSE A;  4CFA A;  3DLK A;  5HOO A;  3B6O A;  1NK6 A;  1EET A;  4O5F A;  4B08 A;  1BGX T;  5KRS A;  4DTN A;  3J7Y P;  1Q7Y O;  3ATU A;  3H1Q A;  5E84 A;  4C8L A;  2ZGZ A;  3NVM A;  3VQP A;  5AQP A;  1X9J A;  1DGK N;  4CJR A;  3RRG A;  3LPU A;  3DLG A;  5EXW A;  2PY5 A;  3VMF B;  3A2F A;  3KLI A;  1GOA A;  2XY7 A;  1FJG K;  1RFQ A;  3TI0 A;  3EKS A;  4M63 C;  3ZCM A;  2P9N A;  4ILH A;  3QNO A;  2ZJQ L;  5C0Y A;  1IG9 A;  4DWI A;  5GIN A;  1L3V A;  3ZSR A;  4IJA A;  3VET A;  2HHT A;  4CK3 A;  3M5R A;  2YHX A;  3TSQ A;  2J4R A;  2Z1H A;  5M1O A;  4XIU A;  3NBP A;  3RR7 A;  1EQY A;  4H4M A;  2W41 A;  1HNW K;  4CEA A;  1IKY A;  1I39 A;  3V9X A;  4C23 A;  3AVG A;  3DXK A;  4XH4 A;  2QI2 A;  3O9T A;  1KQS M;  4H5V A;  3ZSO A;  3BF1 A;  4ILJ A;  1NGH A;  4DTU A;  4FVM A;  2BE2 A;  3CCU N;  5JS1 A;  1QHT A;  3CJ7 A;  4JKE A;  1FXX A;  2HST A;  4BDZ A;  1OVQ A;  4G1Q A;  2JWK A;  1SQK A;  1CXQ A;  2E4L A;  1HUX A;  4Y1C A;  3DI6 A;  4FJN A;  4DR4 K;  4RW6 A;  4DLG A;  3CI5 A;  4Z0U A;  1BUP A;  3WUH A;  2Q0U A;  3VQQ A;  2FBX A;  3EE8 A;  3GL1 A;  1NM1 A;  3HM9 A;  1HNV A;  3EN9 A;  5KPZ A;  1X3M A;  3BEX A;  2Z1I A;  4CGJ A;  3LP0 A;  1KVA A;  1YJ9 N;  3HVT A;  4CJL A;  3OYB A;  2VWJ A;  2IIR A;  4FLT A;  4WQ5 C;  4CEB A;  5C2D A;  3CET A;  4RG8 A;  1VQO N;  4Z4I A;  2NUB A;  1NJY A;  1VSF A;  5DMR A;  4JI0 K;  3VQD A;  4MLE A;  2P9S A;  3TSP A;  4B9Q A;  3VOV A;  1BDG A;  3MEG A;  4FLZ A;  1NJI O;  2O8B B;  4CBU A;  4KRF A;  3C94 A;  5LJV A;  4K8X A;  3A0I X;  1WAF A;  4CJ7 A;  3VQA A;  1VQ7 N;  4KTZ A;  5GIP A;  4JI4 K;  4BR4 A;  3M3Z A;  3KKS A;  1RTD A;  3TAG A;  3THX B;  3VQ4 A;  3DRR A;  5H1S Q;  5AQN A;  3DWL A;  3IRX A;  4K42 A;  5AQL A;  3K0S A;  1RT3 A;  4F3O A;  1U2V B;  4AHC A;  4YOV A;  3THY A;  1SKS A;  3KTQ A;  3OTO K;  4JKD A;  4JHD A;  3RTV A;  4FK2 A;  2ASP A;  3G10 A;  2UXC K;  4CJ3 A;  3AA4 A;  3FZF A;  1JL2 A;  3SUO A;  1YHQ N;  2DFH A;  4CJF A;  3ZT1 A;  1OH8 A;  2EX3 A;  4CJU A;  3HPO A;  4RTF D;  4CZF A;  4BRI A;  1JLB A;  3Q7B A;  1Y97 A;  4HTL A;  2E6L A;  3P4I A;  2FBV A;  4PL7 A;  4IBN A;  3KWG A;  2WON A;  2B4J A;  4FJX A;  1QQO A;  1NGI A;  3RMA A;  4ELV A;  1BQN A;  5HRR A;  3AVL A;  1R0A A;  5EU7 A;  3KJV A;  3SI6 A;  3GBT A;  1VQ8 N;  4KH5 A;  3M6G A;  3QEW A;  3PUF A;  5AQU A;  3E1Y A;  1RDA A;  4NYN A;  4JKF A;  3QB0 A;  2E2N A;  1S9E A;  4JKG A;  3IFR A;  2CH6 A;  1S1T A;  3KK7 A;  3RSE B;  3CFR A;  3DLB A;  4KHP K;  1HNX K;  1REV A;  1NKC A;  4CER A;  5BPL A;  3EZ5 A;  5F1X A;  4KKO A;  2YHW A;  1T03 A;  1QHA A;  4BWM A;  4M45 A;  5EOY A;  4HVJ A;  1C1B A;  4PKI A;  4LY7 A;  3ZET A;  3F9K A;  2NRV A;  1C0F A;  2B5J A;  3R6M A;  4EP4 A;  4YOX A;  2A40 A;  3BF3 A;  1QQM A;  4B3T K;  4CJ4 A;  4FJI A;  4FZX C;  3FGU A;  1WSE A;  4W5Q A;  2ZF5 O;  4BVP A;  4H0Y B;  4CES A;  2RE2 A;  4DTM A;  1LWE A;  3KLF A;  2HBJ A;  3MDQ A;  3V6D A;  2CGK A;  4DMN A;  3G6E N;  4FZY A;  1E3M A;  1YAG A;  3DXM B;  4HUG A;  4BG8 A;  3UKR B;  4IOX A;  3VQ6 A;  3KLE A;  3OJU A;  4BAC A;  3P5J A;  4CIE A;  2UUA K;  4CEZ A;  3M1F A;  3V9Z A;  4FJ8 A;  1XI1 A;  3O1B A;  1SZ2 A;  3WXL A;  1VQN N;  2ZE2 A;  5F0X A;  1D8Y A;  4BC2 A;  5AFU H;  4I6M B;  1JLQ A;  1NOZ A;  2GV9 A;  3MAQ A;  4FL9 A;  2QEX N;  3I56 N;  4AQY K;  1TK8 A;  4BC3 A;  5AZJ A;  5J2P A;  3O3F A;  1JLF A;  2P9N B;  4KO0 A;  1N34 K;  3TPQ A;  3O4Q A;  1LAW A;  3VES A;  3VEX A;  2VQE K;  4H4O A;  4ISG A;  3O80 A;  2VCP A;  5M1K A;  4A5B A;  1JLC A;  2RPI A;  5SZT A;  2F7T A;  2W6K A;  4DSJ A;  3HT3 A;  4DCH A;  4IZ9 A;  1JLA A;  4GV9 A;  3IDH A;  4IOC L;  3DXK B;  1CLQ A;  3MN5 A;  4CK1 A;  3CCM N;  4BR9 A;  3DMJ A;  5JMV A;  1FK9 A;  5JIC A;  3LL3 A;  3HYF A;  3CYM A;  3CQ8 A;  1ASV A;  4Z4G A;  3E9L A;  1GOB A;  4CGH A;  4K25 A;  2Z1J A;  3LDL A;  4CHO A;  1XHX A;  4WQ4 A;  4I2Q A;  3TWH A;  4DTO A;  5AQH A;  4RWT A;  1VK0 A;  1V4S A;  2OTL N;  3OYK A;  3QBW A;  3BZK A;  4DUY K;  2IVP A;  4FWO A;  1ZYQ A;  4CE9 A;  1Q81 O;  3QML A;  4WF9 L;  3CM5 A;  4CZI A;  4CF0 A;  1Q18 A;  1TKT A;  1FW6 A;  3MCA B;  1DTT A;  4F9O A;  1Q82 O;  4N76 A;  1XNR K;  2QWN A;  4FW2 A;  4CIG A;  1HPZ A;  5I42 A;  1Q8I A;  4GVE A;  1E4G T;  3S3M A;  4JI5 K;  3ZT4 A;  3M8Q A;  1O1W A;  2ATQ A;  2YCH A;  3CPW M;  1T05 A;  3AO2 A;  1GLA G;  3SBT A;  3D2F A;  4EAH D;  3FZK A;  3PV8 A;  4JD2 A;  1NK7 A;  4QS9 A;  4BRH A;  3ENO A;  3AA2 A;  4FM2 A;  1TAU A;  1EP4 A;  3OJS A;  4DV5 K;  2G8F A;  2QXL A;  4I7F A;  4C8K A;  2V7Z A;  4K0K K;  2KHO A;  4JRQ A;  4Y1D A;  2Y1I A;  4FLW A;  4DSK A;  3TTC A;  5MLC Q;  3LP1 A;  4WCE L;  5E26 A;  1DLO A;  1JXB A;  4BR0 A;  1BIZ A;  3OY9 A;  2D4W A;  3MX5 A;  3L3V A;  1VHX A;  3MXJ A;  3T1H K;  4ELU A;  1ZBI A;  3W0L A;  4DUZ K;  3VA3 A;  1YJN N;  5BN8 A;  4E3S A;  4DV6 K;  2D0O A;  4H03 B;  2YV0 X;  4KH6 A;  3AVC A;  3OS0 A;  3OYH A;  3CF5 L;  4M3R A;  3VGM A;  1DTQ A;  3M8R A;  3V4I A;  3O9U A;  3WT0 A;  2NRZ A;  4DTP A;  3WNF A;  2O8E A;  5BR8 K;  4CHQ A;  1WBB A;  2Y1J A;  3J7Z O;  1SKW A;  4OKK A;  4QCL A;  3TTD A;  3G4S N;  1RDU A;  3D0P A;  2O4I A;  3ZSX A;  1VSL A;  3V1R A;  2IVO A;  4N47 A;  1GLE G;  3S3N A;  2ZJP L;  3OS1 A;  3CJA A;  5AR0 A;  4AM6 A;  4KI4 A;  4DQQ A;  4GV6 A;  5CY4 A;  2X78 A;  3LP2 A;  2Q2R A;  4BRO A;  4I9L A;  5A2Q O;  4H5T A;  4DR3 K;  4KV8 A;  4KPY A;  1W97 L;  3JAM O;  5AQQ A;  2YX6 A;  1IKV A;  2W40 A;  2H3G X;  1IBK K;  2UUB K;  3P38 A;  4WE1 A;  4KAZ A;  2FBY A;  1C0T A;  1T7P A;  3PIP L;  4J2B A;  1SV5 A;  3VGL A;  4I9Q A;  4OJR A;  1Z25 A;  4BWJ A;  3CHW A;  4YFU A;  3VPZ A;  2X74 A;  4CF1 A;  3T3F A;  3VEN A;  4DV3 K;  4OLB A;  3K5L A;  4OGE A;  3ZET B;  2Q1N A;  4OGC A;  1VSI A;  3THW B;  2RN2 A;  2D5R A;  3MEE A;  1CZA N;  4JI3 K;  4NO7 A;  3KD1 E;  1SL0 A;  5DM7 L;  2QKB A;  3F73 A;  3D2E A;  1T8E A;  4PHT X;  2I5J A;  1UOC A;  1BG3 A;  3G71 N;  5GIO A;  5AQI A;  5J1E A;  1J6Z A;  4CW7 B;  2A1R A;  2Q36 A;  4DG1 A;  3EKU A;  3CCV N;  3SUQ A;  2O8F A;  1S6Q A;  3F5T A;  3R8E A;  3AVM A;  3VTI A;  4N56 A;  4FLV A;  3CJ1 A;  1SL2 A;  4H0T B;  1Q86 O;  1SUQ A;  3KWI A;  3R1X A;  3SJH A;  1A5V A;  3MN7 A;  1HX1 A;  4BG9 A;  4O8K A;  3LM9 A;  1U47 A;  4DQ8 A;  5CZ2 A;  4CZJ A;  4LF7 K;  3K9J A;  1S1V A;  1KLN A;  4FJJ A;  3NF7 A;  2ZGY A;  4BE2 A;  4PQU A;  2YNI A;  3KVG A;  1W2B M;  1BO5 O;  2ITG A;  3LDQ A;  3K59 A;  2UUC K;  3I8B A;  3HPG A;  2YJF A;  3KLH A;  3TAM A;  4AM7 A;  5M1N A;  4B9U A;  2P5O A;  5IWA K;  1SS6 A;  4HCB A;  5FRN A;  5AZJ B;  1TUY A;  1RGI A;  4WFB L;  1T44 A;  3SQ0 A;  4DU4 A;  4E7L A;  2Z1G A;  4IFV A;  3AVA A;  5EY4 A;  4FCY A;  4DSF A;  1P90 A;  4DV0 K;  3VQB A;  1OH7 A;  3HO1 A;  4IEE A;  4J2A A;  3K9K A;  5CR4 A;  4X65 K;  4MDB A;  5HLF A;  4B3M K;  4DLE A;  4NCG A;  3HRG A;  1IKW A;  4DV7 K;  3O1W A;  3VF6 A;  5C12 A;  3O4N A;  4O4G A;  3V9U A;  3TAB A;  2HF3 A;  2YHA A;  1WSI A;  3SNN A;  2IDO A;  5AFU A;  4FM1 A;  4FWL A;  5M1P A;  4BQL A;  4B1U B;  3ZT3 A;  1YVN A;  5FPM A;  3OYI A;  1WB9 A;  2WBN A;  5FLX O;  1ATN A;  2OPS A;  2OTJ N;  2DFE A;  1TL1 A;  3AVJ A;  4O8U A;  3L3U A;  3THV A;  2FBT A;  1KLM A;  3AO5 A;  3K5M A;  3AVK A;  4E7K A;  3WXI A;  3LM2 A;  3QDK A;  4Y0W A;  1G99 A;  2A3Z A;  4XH5 A;  3EO3 A;  2P9P A;  1CXU A;  2D0A A;  2DPN A;  4LF5 K;  2A41 A;  3NFA A;  4CFC A;  1VQ9 N;  1RT7 A;  4DS4 A;  1E4F T;  4IFY A;  2QTD A;  4BRM A;  4FSV A;  2I7P A;  4R5P A;  3D2F B;  1ZBS A;  4DF8 A;  4NCB A;  3H46 O;  4JD2 B;  3VQ8 A;  1IH7 A;  3A5N C;  1QSY A;  1BHL A;  1HJR A;  4IDK A;  4DQR A;  3QBX A;  3PSF A;  1HKG A;  5BPN A;  4DV2 K;  3SPY A;  1QE1 A;  1YT3 A;  4W5O A;  1NJW A;  4MO4 A;  2G8U A;  2BGG A;  4Z4E A;  1RNH A;  5AZI A;  3BY5 A;  2W42 A;  1RIL A;  4FK4 A;  3CPE A;  1K8K A;  1S9G A;  2AA4 A;  2BAN A;  3UB5 A;  1VRU A;  2CH5 A;  5C24 A;  3WXJ A;  1YJW N;  3VQE A;  4ZHR A;  1IBL K;  3I55 N;  1RBR A;  1XC9 A;  5B8H A;  2A42 A;  3LDN A;  4MLH A;  3RRH A;  1TL3 A;  5AQS A;  4KRE A;  3HM8 A;  4EZ9 A;  1K6Y A;  4J2D A;  2D1K A;  4JKH A;  3AV9 A;  2RF2 A;  4GY2 B;  3U8X A;  2E1Y A;  3AVN A;  4B9V A;  4B1Y B;  3FFK B;  4BRL A;  4CJ5 A;  2PYL A;  3KK1 A;  4EHU A;  3L2R A;  1H1V A;  3CQY A;  3AA3 A;  4DR5 K;  3L2V A;  3RMD A;  5FRO A;  4CF2 A;  2A5X A;  1QVG M;  3C7N A;  2FF3 B;  5J2Q A;  2PYJ A;  5CE3 A;  3AVH A;  1LAV A;  3VF4 A;  3ZEU A;  3WNG A;  1NU0 A;  4OKJ A;  3T7Z A;  3HXM A;  3ZSV A;  3L2Q A;  3ISN C;  3LAL A;  3LWM A;  2QWR A;  3CCR N;  5CZ1 A;  1M1K O;  3CER A;  4OPK A;  3O9S A;  1QQN A;  1VQL N;  4DTX A;  1KVC A;  4CEF A;  4FJM A;  3ID6 A;  1TK0 A;  1IBM K;  2WTU A;  1XQS C;  4DTS A;  1T6D A;  3BDP A;  1SAZ A;  1S3X A;  3VN5 A;  4FOI A;  4CJK A;  1EWR A;  2RHK A;  4FW1 A;  1BCM A;  5TKW A;  2FC0 A;  4K43 A;  1QTM A;  2IGI A;  4KHS A;  3AY9 A;  1TYQ A;  5LMN K;  5FPN A;  4JEP A;  5AQO A;  3MED A;  1NGB A;  4LH5 A;  3P1G A;  3OYE A;  1C1C A;  4CZL A;  2HHX A;  3QIC A;  4JI6 K;  1T3V A;  1C0G A;  2QWM A;  5BRE A;  3IS9 A;  3C65 A;  1RTI A;  4GW6 A;  2UXD K;  2P9I A;  3HP6 A;  5AQT A;  1QQC A;  4CJP A;  3N4P A;  2NRX A;  4UQG A;  1ZBL A;  1O13 A;  3OYG A;  3JXU A;  3KD5 E;  2F8S A;  4DQI A;  2YKN A;  4V19 S;  2O8F B;  4H8K A;  4O0J A;  1TKX A;  4CBX A;  1HJO A;  4Z4F A;  1NGE A;  5AQR A;  5AQY A;  4BRQ A;  3NVK A;  4FK0 A;  1U04 A;  2P5G A;  3OW2 M;  3D45 A;  4DTR A;  3U9D A;  1QVF M;  5C2F A;  2O8D A;  2VGM A;  4B9N A;  1LCU A;  3L8B A;  1XHZ A;  4FJ9 A;  2UXB K;  2HW3 A;  3PY8 A;  1KAX A;  1VQP N;  5HP1 A;  3C6H A;  1GLB G;  1K9M O;  4M3X A;  3R9P A;  4BR7 A;  2IC3 A;  3VEZ A;  5F2R A;  3WEE A;  1J54 A;  1V4T A;  2OPQ A;  4Z94 A;  4QOZ B;  2D0P A;  4W5N A;  1ITG A;  1UA0 A;  4FJK A;  1J9A A;  1KD1 O;  2GTD A;  1D9D A;  4B9T A;  2Q31 A;  3SK3 A;  2FLO A;  4JKC A;  1YTA A;  2YHB A;  3TAP A;  4KH4 A;  1KCF A;  3D7E O;  4HCC A;  3BUZ B;  3P83 D;  5IT9 O;  2FSK A;  3VQ7 A;  5CYM A;  4JYA K;  2XY5 A;  3KHY A;  3PX4 A;  4M7Y A;  4WQ4 C;  1VSK A;  4O5B A;  3W3D A;  2HMI A;  2ETJ A;  3VQC A;  2PZS A;  3EY1 A;  3CIP A;  4BRA A;  1NGC A;  4KFB A;  3CQX A;  4M41 A;  5BR9 A;  1J5O A;  1C6V A;  2GUP A;  4JI1 K;  1KFD A;  4JI2 K;  4A59 A;  1EX4 A;  3N4Q A;  1XNQ K;  3SAH A;  1NK0 A;  4CBW A;  3DLR A;  4CD3 A;  1IV0 A;  1VQ6 N;  4KHQ A;  3VER A;  2DTU A;  4FO0 A;  2G8V A;  3SQ4 A;  3FZL A;  3GDQ A;  4QAG A;  3NGI A;  3E9O A;  1HYS A;  2YKM A;  4E1M A;  4C1N K;  2QWP A;  4AH9 A;  2UYT A;  4IG0 A;  1ZC6 A;  3U4L A;  4KHU A;  3NF8 A;  4FWN A;  1HMV A;  2IS3 A;  2P9P B;  4KTW A;  1N36 K;  3GE1 A;  1JCE A;  3BP8 A;  3SPZ A;  3CC7 N;  1RTH A;  3SAF A;  5KGX A;  1HYZ A;  5KQD A;  4JK9 A;  3EZW A;  5AQG A;  2YHY A;  4MQ3 A;  4J2E A;  4A62 A;  4DKW A;  3HI0 A;  1Z26 A;  3H6E A;  3WQU A;  2W6L A;  2E2O A;  3R3L A;  1NGF A;  3CJC A;  5K14 A;  4BE1 A;  3ZYY X;  3KIO A;  2QM1 A;  1TVR A;  2P51 A;  5J2N A;  3VEO A;  5AZI B;  4TSX A;  4BQZ A;  1N5Y A;  1RBS A;  3MXI A;  3V81 A;  3DM2 A;  1B9F A;  4CCH A;  4IFE A;  4DR7 K;  2WOM A;  3DRP A;  3FFI A;  1KVB A;  1RBT A;  2VWK A;  1J53 A;  3PO4 A;  5HBM A;  2OYQ A;  3OHR A;  5JVH L;  4GNI A;  5FPD A;  2NRT A;  1S6P A;  3L0Q A;  4GVM A;  1UAX A;  4ICL A;  5AQW A;  3ID8 A;  2P9S B;  3ULD A;  4CF8 A;  4AHT A;  3E66 A;  2QKK A;  4O44 A;  4XEI A;  4DQP A;  3CCQ N;  2KW4 A;  4E0D A;  3BZC A;  3GOI A;  3SLC A;  3DLH A;  3SZ2 A;  1GLL O;  3S41 A;  3C7N B;  1BQM A;  5HRP A;  2OPR A;  4BDY A;  4C1N I;  1GLF O;  1HRH A;  3C6T A;  4OVL A;  3ZEU B;  4B1Z A;  3ZSZ A;  3OVN A;  4Z4H A;  4FM0 A;  2HBL A;  2NZT A;  4BY9 C;  2AJQ A;  4B3O A;  1RT2 A;  1BIS A;  3H1V X;  1Q9Y A;  3K57 A;  4BVO A;  3FLC O;  3RMC A;  2E5L K;  2O8C A;  3O08 A;  1ATS A;  1NK5 A;  1RDB A;  3I0R A;  4M3U A;  3THY B;  3FZH A; 
#chains in the Genus database with same CATH homology
 4JHD B;  4AM7 A;  5M1N A;  1NJI O;  2GEL A;  2NNW A;  4CBU A;  4EFH A;  5LY3 A;  3LDO A;  1SS6 A;  1VAZ A;  5AZJ B;  1TUY A;  4H0O A;  5LJV A;  1RGI A;  4WFB L;  1T44 A;  2GWK A;  3A0I X;  2KLA A;  2FXU A;  4CJ7 A;  1N8R O;  3CC2 N;  5DM6 L;  1VQ7 N;  1KXP A;  4IXC A;  5GIP A;  3ZX0 A;  4A57 A;  4BR4 A;  3M3Z A;  4CZG A;  3FZM A;  3AGK A;  3SAG A;  2GEM A;  2YI1 A;  5EY4 A;  3O5B A;  5AQN A;  3DWL A;  4WFA L;  5AQZ A;  1P90 A;  2BUP A;  3WXM B;  5LJW A;  4K42 A;  5AQL A;  4IEE A;  1ESV A;  2I7N A;  3K9K A;  3O4W A;  1U2V B;  5CR4 A;  1DKG D;  5C10 A;  5JLH A;  4YOV A;  4MDB A;  4FWR A;  4H5N A;  4JKD A;  4FVU A;  4JHD A;  3HRG A;  4NB4 A;  2ASP A;  3O1W A;  3VF6 A;  5C12 A;  4IO9 L;  2VYP A;  5H1S Q;  2QWL A;  2HF3 A;  2NRH A;  2F9W A;  4H5W A;  1XUP O;  1YHQ N;  3FZF A;  5AFU A;  2ASO A;  4FWL A;  5M1P A;  4BQL A;  3CC4 N;  3AAR A;  4B1U B;  1U6Z A;  1YVN A;  5FPM A;  2P9U A;  4JKG B;  3A8Y A;  1OVY A;  2WBN A;  2QA4 N;  4RTF D;  1ATN A;  4CZF A;  4BRI A;  3Q7B A;  4H5R A;  2FF6 A;  2ZWH A;  4HTL A;  3P4I A;  1QZ6 A;  4PL7 A;  1Z6R A;  2OTJ N;  2E1Z A;  4O8U A;  3KWG A;  5AQK A;  2V52 B;  1MWK A;  4YDU A;  1QQO A;  3MK6 A;  2ZJR L;  5EVZ A;  1NGI A;  3WXI A;  2YJE A;  3LM2 A;  3VEY A;  3QDK A;  5ADX A;  2CGL A;  4Y0W A;  1G99 A;  4NLC A;  3O9R A;  2A3Z A;  4XH5 A;  3EO3 A;  2P9P A;  3P39 A;  3OBW A;  4QS8 A;  3CCL N;  3GBT A;  3ZX3 A;  1M90 O;  4KH5 A;  1VQ8 N;  2DPN A;  3M6G A;  5JLF A;  2A41 A;  2A6A A;  1GLC G;  1K8K B;  5AQV A;  3E1Y A;  5AQU A;  4FWM A;  1VQ9 N;  4JKF A;  1E4F T;  3QB0 A;  1TUU A;  2Q97 A;  2AP1 A;  3T69 A;  3DAW A;  2E2N A;  3MWP A;  2QTD A;  2FSN A;  4JKG A;  4BRM A;  4FSV A;  3UKU B;  2I7P A;  3OBY A;  3IFR A;  2FSJ A;  2CH6 A;  3D2F B;  1ZXO A;  1ZBS A;  5BPM A;  4MO5 A;  3HTV A;  3KK7 A;  4HWI A;  3RSE B;  1JCF A;  4BGA A;  2V7Y A;  3H46 O;  4JD2 B;  4DHY A;  2E2Q A;  3A5N C;  1VQM N;  3A5O C;  2HBM A;  5BPL A;  3QBX A;  3OA9 A;  5F1X A;  1HKG A;  2F9T A;  2YHW A;  5BPN A;  1QHA A;  4PL8 A;  4L3Q A;  1NGG A;  4MO4 A;  5EOY A;  2E20 A;  3I33 A;  1DT9 A;  3ULE B;  3WXK A;  5AZI A;  1YUW A;  1BA0 A;  4PKI A;  4FPB A;  3ZET A;  1WUA A;  3L4Q A;  3CPE A;  1K8K A;  4MDA A;  2VGN A;  2AA4 A;  2NRV A;  3UB5 A;  4DB3 A;  4ISF A;  2CH5 A;  5BRH A;  1C0F A;  4M7X A;  3WXJ A;  1YJW N;  3IMX A;  1VQ4 N;  3A5M C;  3ATV A;  3QFU A;  1ATR A;  3R6M A;  4YOX A;  3PIO L;  5AQJ A;  2VWB A;  3CMA N;  3I55 N;  4BRD A;  1KAZ A;  1BWF O;  2A40 A;  1QQM A;  3BF3 A;  5B8H A;  2A42 A;  3LDN A;  3FGU A;  4MLH A;  4BC4 A;  2ZF5 O;  4BVP A;  4H0Y B;  5AQS A;  3HM8 A;  1P8Z A;  4OPH A;  2RE2 A;  4XH1 A;  4YDU C;  5AQF A;  2EWS A;  3L6Q A;  5AQM A;  1WOQ A;  2D1K A;  4JKH A;  2HBJ A;  3O6W A;  3MDQ A;  4GY2 B;  3U8X A;  2E1Y A;  4B1Y B;  1BU6 O;  3FFK B;  4BRL A;  2CGK A;  4EHU A;  3DJC A;  3G6E N;  3IKM A;  3UE5 A;  1H1V A;  3O9Q A;  4OPA A;  3CQY A;  4PKG A;  1YAG A;  5KPZ A;  3C0B A;  4FOE A;  2E2P A;  5ELZ A;  2A5X A;  1QVG M;  3DXM B;  3C7N A;  4RCH A;  2ASM A;  3DLL L;  3A5L C;  2FF3 B;  3ENH A;  3UKR B;  4IOX A;  4BG8 A;  5CE3 A;  4BRC A;  5KPR A;  3C6A A;  3VF4 A;  3ZEU A;  1TYQ B;  4GV3 A;  1NWK A;  4PKH A;  3T7Z A;  2E88 A;  4YOT A;  3WQT A;  3M1F A;  2QWR A;  3NMU A;  3G25 A;  3O1B A;  1SZ2 A;  3CCR N;  1M1K O;  3WXL A;  1VQN N;  2KKZ A;  3CER A;  3O9S A;  1QQN A;  4J8F A;  5F0X A;  1VQL N;  4BC2 A;  3AAP A;  5AFU H;  4I6M B;  3ID6 A;  1MA9 B;  1XQS C;  5GAE P;  1T6D A;  3AAQ A;  3QFP A;  1SAZ A;  1S3X A;  2P9I B;  4FL9 A;  1X3N A;  2QW9 A;  4FOI A;  4NLB A;  3I56 N;  2RHK A;  4JK7 A;  2QEX N;  4AF1 A;  5GAD P;  3HOS A;  5TKW A;  4K43 A;  4BC3 A;  5AZJ A;  3UKR A;  2NLX A;  1GLJ O;  2P9N B;  4QS7 A;  3AY9 A;  3TPQ A;  1TYQ A;  4BR5 A;  3VES A;  5FPN A;  3VEX A;  5BRF A;  4JEP A;  5ADX H;  5AQO A;  2ITM A;  5BN9 A;  4CZM A;  4H0X B;  3CXC M;  5EX5 A;  4ISG A;  3O80 A;  1NGB A;  3HSC A;  3ZX2 A;  4CZK A;  2VCP A;  5M1K A;  4ILG B;  3CJ9 A;  4CZL A;  2GX9 A;  1IG8 A;  4A5B A;  2P9K B;  3F9M A;  2BH1 A;  3QIC A;  4U7B A;  4YOY A;  5M1F A;  2E8A A;  5KQ8 A;  2F7T A;  1YIJ N;  4I6M A;  1IJJ A;  1T3V A;  5BRE A;  1C0G A;  1U2V A;  1YF5 L;  2QWM A;  5M1Q A;  3PLA A;  4U67 L;  3C65 A;  4DCH A;  4IZ9 A;  2P9I A;  3VF2 A;  2Q0R A;  3ENB A;  4GV9 A;  3IDH A;  2WUS A;  4A2A A;  5AQT A;  4B1X B;  3DXK B;  4YOW A;  4IOC L;  3CCE N;  3CME N;  3N4P A;  3MN5 A;  5GAH P;  3CCM N;  4IJN A;  4BR9 A;  4OO1 J;  2P9L B;  3Q7C A;  4JN4 A;  5JMV A;  5JIC A;  4H0V B;  3VEV A;  2NRX A;  3H3N O;  3LL3 A;  3SBG A;  1O13 A;  1BA1 A;  4FWQ A;  3JXU A;  3E9L A;  4K25 A;  3LDL A;  4WQ4 A;  1D4X A;  5AQH A;  4RWT A;  1V4S A;  1QZ5 A;  5FPE A;  1K8A O;  2OTL N;  3QBW A;  1YI2 N;  3WEE B;  2IVP A;  4FWO A;  4CBX A;  1HJO A;  1NGE A;  1Q81 O;  3QML A;  5AQY A;  5AQR A;  1KAY A;  2HBK A;  4FWS A;  4BRQ A;  4WF9 L;  4CZI A;  4BRP A;  3NVK A;  1LOT B;  1Q18 A;  3SMS A;  4BR2 A;  5KPT A;  4FPA A;  3MCA B;  4F9O A;  1Q82 O;  3OW2 M;  2QWN A;  4GVE A;  2PBD A;  3HOT A;  4FWP A;  1E4G T;  4G9Z A;  4IEI A;  3CCJ N;  4WFN L;  3U9D A;  1HKC A;  1QVF M;  1VQ5 N;  5C2F A;  2YCH A;  3CPW M;  3UKU A;  1GLA G;  2VGM A;  4LC9 B;  3SBT A;  5CHI A;  3TU5 A;  4BRG A;  3D2F A;  1LCU A;  4EAH D;  4IOA L;  3FZK A;  3EL2 A;  3RSE A;  1KAX A;  1VQP N;  4JD2 A;  4E1J A;  3C6H A;  1GLB G;  4CI6 A;  1K9M O;  3E9P A;  4QS9 A;  3R9P A;  1Y64 A;  4BR7 A;  3WEE A;  3MN6 A;  5F2R A;  3VEZ A;  1V4T A;  4BRH A;  4Z94 A;  2D0P A;  3SMP A;  1JJ2 M;  3FE1 A;  3B8A X;  3ENO A;  2NRW A;  4A2B A;  1KD1 O;  2GTD A;  1JCG A;  2QWO A;  3L4I A;  2QXL A;  2Q31 A;  3IUC A;  3SK3 A;  2V7Z A;  2KHO A;  2FLO A;  4JKC A;  3ULE A;  4KH4 A;  3JS6 A;  3D7E O;  4JAX A;  1HLU A;  3BUZ B;  4CZE A;  1ILY A;  1EO1 A;  2FSK A;  4BC5 A;  3MCP A;  3MMV A;  3O8M A;  4FWK A;  1DEJ A;  4EIA A;  3TTF A;  3TTC A;  5BRD A;  5MLC Q;  4WCE L;  5E26 A;  3KHY A;  2JWL A;  4M7Y A;  4WQ4 C;  1S72 N;  1YIT N;  4BR0 A;  4UY8 O;  1MWM A;  4IO8 A;  3W3D A;  2PFU A;  2D4W A;  3MX5 A;  3CJB A;  1GLD G;  3MWT A;  3W0L A;  1T6C A;  3CIP A;  1MDU B;  4WYB A;  2CGJ A;  4BRA A;  1NGC A;  4JKA A;  1YJN N;  5BN8 A;  3CQX A;  2D0O A;  2WFB A;  4H03 B;  4KH6 A;  3VEW A;  1VQK N;  1BOT O;  5BR9 A;  1OKJ A;  3GG4 A;  4BRN A;  5C15 A;  2GUP A;  1Z05 A;  3CF5 L;  1NLV A;  2WC9 A;  4R79 A;  4A59 A;  2P9U B;  3VGM A;  3N4Q A;  3SAH A;  1NGA A;  3O9U A;  3WT0 A;  2NRZ A;  4CBW A;  3DXM A;  2BTF A;  5JVG L;  5HOO A;  4CD3 A;  1VQ6 N;  3J7Z O;  4BGB A;  4EHT A;  4O5F A;  3VER A;  4CD1 A;  4JK8 A;  4FO0 A;  3TTD A;  3G4S N;  1RDU A;  3FZL A;  5GAG P;  3GDQ A;  1RDW X;  1Q7Y O;  2IVO A;  3ATU A;  3E9O A;  1GLE G;  3H1Q A;  5E84 A;  3VGK A;  2ZJP L;  3CJA A;  2QWP A;  2ZGZ A;  4C1N K;  2NRR A;  2UYT A;  1K73 O;  1ZC6 A;  3U4L A;  5AR0 A;  2HMP A;  3NVM A;  4FWN A;  2P9P B;  4AM6 A;  4B1W B;  5AQP A;  4GV6 A;  1X9J A;  3EE9 A;  1DGK N;  2OAN A;  2Q2R A;  3GE1 A;  1JCE A;  3CD6 N;  3BP8 A;  3VTH A;  4BRO A;  4H5T A;  1W97 L;  4KBO A;  5EXW A;  3CC7 N;  5AQQ A;  1R59 O;  3VMF B;  2YX6 A;  3SAF A;  2W40 A;  5I9E B;  3D2E B;  2H3G X;  4BRE A;  1RFQ A;  3VOV A;  3EKS A;  5KQD A;  4M63 C;  3P38 A;  4JK9 A;  3EZW A;  2P9N A;  1KC8 O;  2HOE A;  3D6R A;  4ILH A;  4ISE A;  5AQG A;  4CZH A;  3PIP L;  2ZJQ L;  2YHY A;  4WQ5 A;  5C0Y A;  4A62 A;  4DKW A;  3HI0 A;  3VGL A;  3CCS N;  5GIN A;  3H6E A;  3WQU A;  2E2O A;  3R3L A;  1NGF A;  3CHW A;  4IJA A;  3M5R A;  2P9K A;  2YHX A;  3CJC A;  3VET A;  3VPZ A;  3TSQ A;  3ZYY X;  2J4R A;  2QM1 A;  5M1O A;  3U9Z A;  3TSU A;  3VEN A;  3VEO A;  5AZI B;  2GWJ A;  4BQZ A;  3ZET B;  2Q1N A;  1EQY A;  4A5A A;  3LDP A;  2W41 A;  4JNE A;  1CZA N;  4BRK A;  3HBT A;  4NO7 A;  4C23 A;  3DXK A;  4XH4 A;  2QI2 A;  3O9T A;  4B1V A;  1KQS M;  5DM7 L;  3MN9 A;  1NMD A;  3D2E A;  4IFE A;  2P9L A;  4YOR A;  4PHT X;  5TKY A;  4H5V A;  5AQX A;  3BF1 A;  1NGH A;  3KZB A;  4ILJ A;  1BG3 A;  3G71 N;  1NGJ A;  3OHR A;  5GIO A;  5AQI A;  5HL7 L;  3CCU N;  1S22 A;  4K41 A;  5JVH L;  4GNI A;  5FPD A;  2NRT A;  1J6Z A;  3CJ7 A;  2Q36 A;  4BRF A;  4JKE A;  3L0Q A;  1YXQ A;  4JKB A;  3EKU A;  2QWQ A;  3CCV N;  5AQW A;  2HST A;  3F5T A;  3ID8 A;  2P9S B;  2PAV A;  3R8E A;  3VTI A;  2JWK A;  1SQK A;  3E66 A;  3CJ1 A;  4H0T B;  4IWV A;  4B9Q A;  1HUX A;  4XEI A;  1Q86 O;  3CCQ N;  3KWI A;  3R1X A;  3SJH A;  3GOI A;  3SLC A;  3CI5 A;  3H3O B;  1BUP A;  1GLL O;  3MN7 A;  3FR0 A;  3S41 A;  2Q0U A;  3C7N B;  1XC3 A;  3WUH A;  3EE8 A;  1HX1 A;  1NM1 A;  3GL1 A;  3HZ6 A;  4O8K A;  3LM9 A;  3F2K A;  4BG9 A;  3EN9 A;  4C1N I;  1X3M A;  3BEX A;  1GLF O;  4YOU A;  3ZEU B;  4CZJ A;  4DQ8 A;  4B1Z A;  4A61 A;  3AGR A;  3H45 C;  3K9J A;  4IDH A;  2IVN A;  3P31 A;  1YJ9 N;  2ZGY A;  1NBW A;  2HBL A;  1HKB A;  1NGD A;  3MX2 A;  2IIR A;  2NZT A;  4BY9 C;  3H1V X;  4H0P A;  4WQ5 C;  3KVG A;  4BVO A;  5C2D A;  3FLC O;  1W2B M;  2HF4 A;  3CET A;  3RVC A;  1VQO N;  1HPM A;  3O08 A;  1BO5 O;  3J8A A;  3LDQ A;  1ATS A;  4MLE A;  3I8B A;  2P9S A;  2V51 B;  2YJF A;  3FZH A;  3TSP A;  1BDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...