5AJ3K

Structure of the small subunit of the mammalian mitoribosome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
136
structure length
136
Chain Sequence
b'SFSIYPPIPGQENSLRWAGKKFEEIPIAHIKASYNNTQIQVVSAAHQPLAHASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHVRVVVKGLGPGRLSAIKGLTMGGLEVISITDNTPIPHNGCRPRKARRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2015-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5aj3K00
4LF9K 1IBLK 4DV4K 4LF6K 5LL6Z 3OTOK 4GKKK 4K0KK 4JYAK 1HNWK 4CVNE 4DR2K 4DR4K 4NXMK 4B3TK 4YY3K 1IBMK 1N34K 5BR8K 4JI1K 4DV6K 1HR0K 3J7YP 4DV0K 2ZM6K 2VQFK 4B3SK 4B3RK 4JI4K 3T1YK 4X64K 4JV5K 4DUYK 2VQEK 4YHHK 1N32K 4DUZK 4V19S 3J81O 5LMUK 4DV3K 4DV1K 1HNZK 4DR6K 4JI3K 3T1HK 3J80O 4JI0K 2UUAK 2UXCK 1XMQK 4AQYK 4GKJK 5IT9O 1FJGK 4LF4K 1J5EK 4JI6K 5AJ3K 5LMNK 1XNRK 4DV7K 2UUBK 4DV2K 4LF5K 2UU9K 1I94K 4CW7B 1N33K 5FLXO 4JI2K 4X62K 4JI7K 4LF7K 2UUCK 4DR1K 4DR3K 5A2QO 4JI8K 2UXBK 4LFAK 4LF8K 3J7AP 4JI5K 4DV5K 1XNQK 1N36K 3JAMO 4LFBK 4KHPK 4DR5K 4LFCK 2E5LK 1HNXK 2UXDK 1XMOK 4DR7K 4X65K 4B3MK 5IWAK 2HHHK 2F4VK 4X66K 1IBKK 4NXNK 4OX9K
chains in the Genus database with same CATH superfamily
2PYLA 4RW6A 3QBXA 5EOYA 4DF4A 3E9OA 4JRPA 3NH2A 5E26A 3ISNC 4C8OA 4B3TK 2A1SA 3VEVA 4DCHA 1HR0K 3AO4A 3FLCO 4JKAA 3D6RA 4FK2A 5FROA 3DM2A 3LDQA 1JLAA 5BREA 4KH4A 4CHQA 2ASMA 3H1QA 3ZX3A 3PO4A 2AA4A 1DKGD 5CZ2A 1Q86O 1ZBLA 2B6AA 4DTUA 1TKTA 2O8FB 3O6WA 3SV3A 1WN7A 1DLOA 5GAHP 1XNRK 2E2OA 4CD3A 5C2FA 4BACA 4NO7A 1T05A 2VG5A 3O08A 4RW9A 4BR4A 1HPMA 3MMVA 2P9LA 4O5FA 1W0HA 1T7PA 1Q82O 4DR3K 3SCXA 1YXQA 3VEWA 2UXBK 4OO1J 4YOUA 3RMBA 5M1FA 1VSDA 5EX5A 1J6ZA 3EKSA 4GW6A 2QTDA 1D9FA 1VQMN 2YHYA 3LP2A 5JS1A 3NF6A 3TAQA 1SZ2A 4CJPA 3LDLA 3ID6A 4WQ5C 4IZ9A 1YUWA 3HSTB 3WXJA 3SAFA 3D2FA 3LDPA 3HP6A 1L3SA 4BE0A 5E84A 2FC0A 4GMJB 4B9MA 5D3GA 1VSMA 3H1VX 3TSUA 3KHYA 3QETA 3TARA 1K73O 1NMDA 4OX9K 1WAJA 3KTQA 1NBWA 1BQMA 4L3QA 1QVGM 5CYMA 3VF4A 2VG7A 4Z94A 4IDHA 1U2VB 2CGLA 4IJNA 1HNWK 2P9LB 3OYJA 4DTRA 1TKDA 3AV9A 2IGIA 3NBPA 1VQ8N 3CJ1A 3H3OB 3CMEN 2F8TA 1NM1A 4AM7A 3AO1A 2YJEA 1RDUA 4JI1K 4DV6K 1QTMA 1XHZA 1DTTA 5EVZA 4B3RK 2ZGZA 3CF5L 2X6SA 3M8SA 4M45A 3OYCA 2YKMA 4J2AA 3D2FB 3VQ8A 3CFRA 3CERA 1W2BM 3VPZA 1GLFO 4BR5A 5JMVA 3O3FA 1QHTA 5JS2A 5JLHA 3QEIA 1RFQA 1J5OA 4KB1A 4JKEA 2KFZA 4KHWA 3B6OA 2NRVA 4CE9A 5F1XA 4IFVA 4YORA 5M1NA 3SQ4A 3U4LA 1JXEA 2YX6A 3GOIA 3IS9A 4IEEA 1NJWA 1G15A 3MN7A 2G8WA 4CW7B 3RSEA 1TUYA 1ZBIA 2F7TA 4H03B 1N33K 1NJIO 5GAEP 3SZ2A 2XY7A 3THVA 1LW0A 4BVOA 3NAEA 4M42A 3QINA 4W5QA 2HHWA 3G6EN 1Q8IA 1U4BA 2D5RA 3OJUA 4MDBA 4J2DA 4KO0A 3A5LC 3V9WA 1KXPA 2D4WA 3I0SA 1C0GA 3NDKA 4E7IA 1HQUA 4CZLA 1VSHA 3SMSA 3ZT1A 3M5RA 4CF9A 2YNFA 4BE1A 2XY5A 2D0AA 2Z1GA 3K9KA 1VQKN 1VQLN 4H0YB 5CHIA 1Z26A 5I3UA 1HUXA 1JL1A 1NU0A 3V1RA 4PKIA 4FOEA 3ZSYA 1NK0A 3MDQA 3F73A 1ATRA 5HLFA 4AHCA 4AHVA 4ISEA 1IKWA 4N5SA 3WUHA 2KTQA 4DTOA 3RWUA 4PKHA 4LH4A 3GBTA 1NGCA 3SUQA 2HMPA 5AQQA 3RSEB 3L6QA 2IC3A 3PSIA 2IDOA 1LWFA 2Z1IA 3D2EA 2OA8A 4DF8A 4TSXA 5AQSA 4QS8A 4WFAL 4WCEL 1BCMA 1XC9A 1E3MA 3FZHA 1U6ZA 2CGJA 4A62A 4CIGA 4Y1CA 3U9ZA 3HZ6A 4NXMK 1NJXA 5TKWA 3SJHA 2FLOA 1RT2A 3DJCA 1ASUA 3VERA 2IVPA 2E8AA 1IV0A 3HVRA 4KH5A 3MWTA 1GLEG 3BZCA 4CJ3A 4CFAA 1RBRA 1RDBA 4ISFA 4WF9L 4MDAA 4CK2A 1WBDA 4FJLA 3SUNA 3HJFA 3AVMA 3N4PA 1FJGK 3HXMA 3QIOA 3IMXA 4ELTA 3CCJN 1S9GA 3ITHA 1NK6A 5AQVA 3NMUA 4LF5K 4H0PA 4A57A 4O55A 4WFNL 1CXUA 1BISA 3R3LA 1Q18A 4Z4GA 3K5OA 4I9LA 3UKRB 2G8VA 5JLFA 4X62K 4CJ7A 1NKEA 3CCUN 1V4SA 3OYHA 3DLEA 3ENHA 2G8KA 3G71N 3TTFA 4JI5K 4DTMA 1N5YA 3O8MA 1XHXA 3VGKA 4BRKA 2FBYA 4DQPA 5AZIA 4FLVA 2BE2A 4B9NA 3L4QA 5HRRA 4JS4A 4IEIA 1SKSA 4JKFA 3VQ5A 1HKBA 3E9LA 3SJJA 4DR7K 4B1WB 4KREA 3J7ZO 3OW2M 3CC4N 3OYAA 1YT3A 3FFKB 2I7NA 4IO8A 1BI4A 1XC3A 1NGEA 2VYPA 4LF9K 4B3OA 3HP9A 4FJ5A 5LL6Z 1T6DA 2XY6A 1C6VA 2FSKA 3R9PA 1RNHA 3K5MA 5HL7L 2QKBA 3I33A 1IKYA 5I9EB 4M3YA 4PHTX 4O5BA 1CXQA 4K42A 1NK9A 4IOAL 2KHOA 3I8BA 5C42A 5AZIB 1BA1A 4JK7A 4KH6A 1WOQA 4LY7A 1C0FA 3DRPA 5EU7A 3ZYYX 5DK5A 5KGXA 1BOTO 4K43A 1U45A 3VGLA 4IWVA 4EIAA 1NK8A 4U67L 2A6AA 2YJFA 4CJUA 3SUPA 1GOAA 3G4SN 1LAVA 2GTDA 3MN5A 1NNEA 4JI6K 4CEQA 3K5NA 3OYDA 4BE2A 1NGAA 3GL1A 1HLUA 3WEEA 2UUBK 2FBTA 4CK3A 5I42A 1U47A 4YDUA 3AGKA 2ITMA 4JAXA 5JICA 3KLEA 3L2QA 3JS6A 4Z4HA 4CHYA 2PBDA 3TI0A 2HNYA 3L0QA 1WSEA 4IG0A 2HB5A 3AARA 3CJCA 1JLGA 4DSIA 3CCSN 2ATQA 3HSCA 4CEFA 1KAXA 3EE8A 3VESA 1ZBSA 1TGOA 4FJHA 1TL1A 1BIZA 2RHKA 3EN9A 4E3SA 3LL3A 4KHPK 3LALA 3E1YA 4KHUA 1QQMA 3KLFA 4W5OA 1FXXA 2Q97A 1D9DA 3AO5A 2X6NA 2P9NB 2OZMA 4FCYA 4OKJA 3ZSZA 2ZJPL 3JSMA 3SQ1A 4HVJA 4FXDA 3BUZB 5AZJA 3L2WA 3WT0A 2P9SA 1YHQN 2O8CA 3THYA 1VSEA 3V81A 1NJZA 3OTOK 1H1VA 1KAZA 4GKKK 2F96A 2HHSA 4CHNA 1NGGA 4B08A 2ZF5O 1QQNA 4DR4K 1CLQA 1U48A 4C23A 3HM8A 4CERA 3V9ZA 1VSFA 2P9IB 3TAGA 4FVMA 5LJWA 3ZSXA 4YY3K 4A61A 3Q7BA 4JK9A 3J7YP 4DQRA 4JKGA 4CJ4A 5AQIA 2IVNA 2XHBA 1KTQA 3OBYA 3PSFA 3IKMA 1VRUA 3ID8A 3UKUB 1GLLO 1HMVA 3CCVN 1MWMA 4M3UA 3J80O 4GY2B 1ATSA 4CHZA 1ZXOA 5AQHA 3VN5A 3PX0A 5AZJB 4GKJK 5AFUH 1REVA 2NUBA 3D45A 1TAUA 3AVAA 4DTSA 1NKCA 4FWQA 3OS2A 3RMAA 2O8CB 3K5LA 5C10A 5LMNK 4DB3A 2UU9K 4YFUA 1VK0A 1JCFA 4XH5A 1NG9A 2QWPA 1D4XA 1ZC6A 4CJVA 1ASWA 3TSQA 4N41A 3MX2A 1QSYA 1RT5A 3MX5A 3OHRA 3VTHA 2P1JA 3EL2A 4DSLA 3M6GA 4JKGB 4O8UA 1L3UA 4N56A 4EHUA 4CK1A 4CZEA 3CQXA 1FKPA 3E01A 1X9WA 1QZ5A 2QWOA 3AVHA 1N36K 1EQYA 2I7PA 4BR2A 2VWJA 4WQ4A 3F9KA 1VQ9N 2P9PB 3H46O 2WBNA 3TTCA 4XIUA 4EZ6A 2DPNA 4NCBA 2Q31A 1WBBA 3BGRA 1JLCA 5FRNA 4FLXA 4CJSA 1TL3A 4OLBA 3NFAA 1HKGA 2W40A 2Y1JA 3O4NA 3LPUA 3OYIA 1JKHA 4FM0A 1YJWN 4CEZA 1IG9A 4OPKA 1WUAA 2E6MA 3PO5A 3FR0A 4NLBA 2FF6A 3HRGA 3TSPA 2ZD1A 1M1KO 4JS5A 1P8ZA 1Z25A 1RTDA 3IRXA 4B1XB 5KPZA 4H8KA 3ZT4A 4ZTJA 4F8RA 5BN9A 1SKWA 3M8PA 2W6KA 4BRAA 2W41A 4H0OA 4B9TA 4LSLA 3O3HA 1T44A 1NGDA 3KWGA 2PAVA 2QXLA 5BPLA 5KI6A 4ZHRA 4DQIA 4BDZA 3J81O 2W6LA 1S1VA 4FLZA 3KD1E 2FBXA 3DLKA 3V1OA 4MLEA 1YAGA 1I3AA 2A3ZA 3I8DA 3KK2A 3RRGA 3SAHA 1ZBHA 1S6QA 3HOSA 4GVMA 3TABA 2YHWA 3DLRA 3VEZA 4A59A 3OYFA 4AM6A 3VQDA 3WNFA 2NRXA 1YTUA 2WONA 4CJEA 1LOTB 3NVMA 5LJVA 3OYBA 4I6MA 4LSNA 1K9MO 1SKRA 2RKIA 1EKEA 2OPSA 4A5BA 4B9LA 2P9UB 4YOTA 4FJJA 4F9OA 4E7KA 3L3VA 2ZQBA 3M1FA 3VOVA 4F2SA 3U8XA 3QMLA 2IAJA 3KK3A 3AAQA 3A5NC 1E4FT 3EO3A 4CFDA 4FO0A 3SBTA 1RTJA 4DSFA 1KAYA 4QCLA 2G8HA 1JXBA 2RPIA 5GIPA 4YDUC 4CZKA 3OS1A 3O1WA 4OKKA 1KRPA 5AQXA 3VTIA 5KQ8A 2YHAA 1VRTA 2VGMA 1DEJA 3C6UA 1NGFA 3KLIA 3O9SA 4EAHD 3QEXA 3HPHA 3NE6A 4FM1A 1GLBG 1X9MA 4CJTA 4CESA 2ZJRL 1E4GT 1RDWX 3Q7CA 1YVUA 4H5WA 2OYQA 1NGIA 4C1NK 4FWNA 5DMRA 1S1TA 3KLHA 1XWLA 4DQ8A 1L3TA 4RW7A 4B3SK 1CZBA 3ZT3A 4FJGA 2QWLA 1TK5A 3ALYA 3U3YA 3DXKA 4BR7A 4OPHA 4CIEA 5LMUK 3VQ9A 1OVQA 4CGHA 4MO4A 3SMPA 3MECA 1HNZK 3LZIA 3BDPA 1X3MA 2PFUA 2UXCK 2GV9A 1XMQK 2VWKA 4CF0A 1X3NA 5ADXA 4FLTA 1YTAA 4OGCA 4QAGA 3DLHA 3HPGA 3BP8A 3HBTA 4DV2K 4DLEA 1QHAA 1J54A 3QEWA 1QSLA 2V7ZA 2HHUA 4JKCA 4BRMA 5FLXO 1HNIA 3LM9A 3R1XA 1WNSA 3ZX2A 4BRQA 4PL7A 5KTQA 4CHOA 2GUIA 2QA4N 3CJ9A 3TWHA 4IXCA 3P31A 4DR1K 4LH5A 4YNQA 1L3VA 1CZAN 1TKXA 3CIPA 4H5TA 4DV5K 3WXLA 4KTQA 3SPZA 3M8QA 3T1AA 4BY9C 4FWMA 4IBNA 3QEVA 1CZ9A 3CM5A 3DYAA 2Y1IA 2RN2A 1W97L 3DXKB 4NYFA 1EXQA 3CFPA 5ADXH 2E5LK 2YCHA 3VQEA 3VA3A 1S72N 3VQ4A 1XMOK 5GIOA 3CJAA 1EO1A 1TVRA 3B6PA 1TKZA 1DT9A 2GWKA 2NRWA 2YNHA 1RTIA 2PZSA 2GBZA 4AILC 3DLLL 3KKSA 5AQUA 2E2PA 3QIPA 4FWSA 2D1KA 2AP1A 1RTHA 5BPNA 2F9TA 1C0UA 3V9XA 4YOYA 4HUEA 3IUCA 3D7EO 3DRSA 4H0XB 5HBMA 5FPEA 1NGBA 1N8RO 4E7HA 2EHGA 5C24A 3ZSVA 1KC8O 5AQKA 4DLGA 4GV3A 1LV5A 1RBVA 4KTWA 4BG8A 3K0SA 4WQ4C 2AJQA 2CH5A 3OYEA 3GG4A 3E9PA 1Q9YA 3S3NA 4H4OA 1YI2N 2NRRA 4DWIA 3F5TA 4X64K 3VQ6A 1B92A 5M1KA 3BF3A 3SK3A 2Q2RA 4E1NA 1S5JA 2QM1A 5FPDA 4DR6K 1KQSM 1BGXT 4B8CA 2UUAK 1IH7A 2Q36A 4XH4A 3TAFA 2BDPA 3U9DA 4J2EA 2YNGA 4BRIA 3DI6A 1JJ2M 4UY8O 4AHRA 1W9HA 4FJNA 2O4GA 4GV9A 1VSJA 3ATUA 4KI6A 4DFMA 2IIRA 3ASMA 4DMNA 2UUCK 4YOVA 4FZZA 4QOZB 2DY4A 4JI8K 1NGHA 1HYVA 1X9JA 3PY8A 1IG8A 2O4IA 1BU6O 4IOXA 4CIFA 1RT4A 4CJQA 5GADP 4BC4A 3CJBA 4DU4A 1QQCA 2GELA 3SYZA 2E1ZA 4JD2A 1P90A 3WXMB 4M7XA 1Q9XA 5CYQA 3O80A 2WFBA 2FF3B 3D2EB 1YF5L 4N47A 1HRHA 3QO9A 5AQYA 2UXDK 3MAQA 3VQPA 3VGMA 3UIQA 3G25A 3NH0A 5C0YA 1KFDA 1M90O 1S1WA 3FGUA 2Q3SA 4DSKA 4AHTA 4DS5A 3P4IA 1X1PA 2O8DA 4E19A 2ASPA 4CD1A 5HRNA 1VQPN 1RCHA 3MEEA 5DM7L 3AAPA 4JYAK 1SL1A 1RGIA 5HROA 3C6HA 2H3GX 5MLCQ 1C0TA 2GX9A 5M1QA 3DWLA 5BRFA 3LP1A 2BGGA 3PLAA 1C1BA 3AA3A 3VEYA 3M8RA 2OPQA 2KKZA 3OJSA 4FJKA 4JKHA 5CZ1A 1GOBA 4CFBA 4O0JA 4M3TA 4JI4K 3OBWA 1SL0A 4OPJA 3AVGA 3VQ7A 1N32K 3JYTA 2ZGYA 4DUZK 4KHQA 4NCAA 1UA0A 4B9VA 3L4IA 3GE1A 1WSFA 4A5AA 3HT3A 3AA4A 4JI0K 3TAMA 2E4LA 1WB9A 3FE1A 4Q0BA 1FW6A 2O8DB 4I2QA 3CQ8A 4CGDA 5JVGL 3LM2A 5FPNA 2UYTA 1I94K 5AQPA 1KD1O 1S1UA 3HTVA 1TUUA 3NGYA 2HBJA 2D0OA 4JI2K 2EWSA 5SZTA 4FSVA 1YITN 2ITGA 3L2RA 1B9FA 2HF4A 4LFAK 3J7AP 5HOOA 4E89A 4BGBA 2A5XA 4HUFA 2O8EA 3UB5A 4ZTFA 2F9WA 1LWEA 2QW9A 1BI4B 2XO7A 1OH8A 2OZSA 4IDKA 3C95A 1HJOA 4AH9A 4CEBA 4KTZA 1Q81O 1BQNA 4BRCA 3QLHA 4PY5A 3OA9A 2NNWA 4DR5K 5GAGP 4KHNA 1BL3A 1NLVA 3CCMN 3NF8A 3C94A 1Y64A 4NYNA 4E1MA 3RVCA 4E7LA 4I9QA 4JHDA 5AR0A 4X65K 3C6TA 4PWDA 3ZX0A 4F3OA 4PUOA 4B3MK 5IWAK 4CGGA 4B1ZA 1ZBFA 3DXMA 1R59O 3AVBA 4NLCA 4X66K 1IBKK 4ID1A 4R79A 4FYDA 3P83D 1SQKA 1IBLK 4CJFA 1HYZA 2CH6A 2QI2A 4BRDA 3KIOA 4BQLA 3QEPA 3AGRA 2BH1A 3E66A 2D0CA 3CG7A 3LWMA 4CBWA 2OTJN 3PX6A 4QS9A 4F4KA 3LAMA 1BO5O 2YHXA 2HBKA 3FZLA 2NRTA 1UAXA 1LAWA 4WQ5A 1NK4A 4C8LA 4WFBL 2E1YA 3B8AX 4K8ZA 3WEEB 5KPTA 2KFNA 3ZEUA 2YNIA 2OCEA 3VQCA 4R5PA 4JV5K 2VQEK 4YHHK 1NMNA 5AFUA 4V19S 4KV8A 3VQAA 4CGJA 3SQ2A 1TYQA 2HNZA 3P1GA 1VSLA 3HK2A 2X74A 5AQLA 3JXUA 4CZMA 3UE5A 4O44A 4B8AB 3CMAN 3ULDA 3LANA 3OYNA 4LF4K 1S1XA 1JLQA 1VQ6N 4DQSA 4BR9A 5KPRA 1U04A 4KI4A 1NJYA 3DMJA 5DM6L 1D5AA 4MQ3A 1RBTA 4FLUA 4FJXA 3EYZA 2CGKA 1QVFM 2WUSA 5HRPA 2D0BA 3RMCA 1RT1A 2JWLA 1TAQA 3TU5A 1NK5A 3SI6A 1KSPA 2P9SB 4CZFA 3CCRN 3BY5A 3ZEUB 4CGIA 3ENBA 3THYB 1BHLA 1C0MA 2OPPA 4OGEA 4BQZA 4DU1A 4NB4A 2O8BA 4CZHA 3CHWA 4LFCK 2J4RA 2QWQA 2OANA 2DFFA 4CJLA 2PY5A 2WC9A 2FSNA 1OH5A 2JGUA 4OVLA 1NWKA 1OH6A 1C1AA 4JRQA 3PV8A 3H3NO 1WAFA 2LSNA 3J8AA 3I55N 1SL2A 4BREA 4FW2A 4W5RA 2HNDA 2HVIA 4IOCL 3LAKA 3PIOL 3K57A 1K8AO 5KGWA 4HCCA 4DSJA 5K14A 1GLJO 5C15A 4CVNE 3AVKA 2KZMA 5KQDA 2FXUA 3EY1A 3SPYA 1R0AA 2RE2A 3QB0A 1TV6A 4M3ZA 4WE1A 5AQRA 2IOCA 3K9JA 3FFIA 4IG3A 4HHTA 2NLXA 4H0VB 3ZSRA 4FWOA 3KZBA 3WQUA 2P9KA 1U49A 5BR9A 3O9QA 4Y1DA 2YV0X 2W42A 3VF2A 2KQ2A 4O8KA 3OYKA 3PX4A 3O1BA 3CFOA 4I2PA 4Z4FA 5AJ3K 5M1OA 3QBWA 3CJ7A 4BROA 3NF7A 3DLBA 1A5XA 2FSJA 1BCOA 3LDSA 3RR8A 1VQ5N 1UOCA 1RDDA 1VAZA 3VQBA 4CF8A 4M7YA 1SAZA 3HPOA 4OLAA 4DTNA 1KVAA 3P39A 5AQFA 1RILA 4MO5A 3KK1A 1GLDG 2GUPA 1BUPA 3OS0A 1Q7YO 1ASVA 3WNHA 1UA1A 3THXA 5M1PA 4LF8K 1VHXA 1S9EA 2QEXN 4MFBA 1JL2A 1RBUA 5BRHA 2O8FA 4OKEA 1KVCA 4FK4A 3TANA 4LFBK 1NOYA 4WYBA 3MEGA 3W3DA 1TK8A 4Z4IA 1J9AA 1LW2A 4BRNA 5ELZA 4Q5VA 1Z05A 3CC7N 2A42A 2DFEA 4J2BA 3WQTA 2P9KB 2QK9A 1JLBA 1GLAG 3IDHA 3CQYA 1GOCA 2EX3A 4Z0UA 5C25A 5GINA 3K58A 2P5OA 1A5WA 2X78A 4FOIA 3TPQA 3K2PA 4JK8A 3VENA 3KLGA 4EP4A 2NRHA 4BC5A 4KPYA 3O4WA 4O4GA 2HBLA 2E2NA 3OY9A 3EEQA 2A40A 2NZTA 1VQ7N 3WNEA 3THXB 4KHYA 4BRGA 1WSJA 4FWKA 3S41A 3OYLA 1IBMK 4CCHA 4ISGA 5BR8K 3I56N 1BIUA 1WSHA 3MWPA 4ILJA 3A2FA 4I7FA 1T8EA 2DFHA 3KK7A 5B8HA 3HOTA 4CHPA 4IKFA 3M3ZA 3ZT0A 3NGZA 1U2VA 2RF2A 1IKVA 4BG9A 2P51A 2P5GA 1MDUB 4G1QA 4HUGA 1IKXA 1G99A 3QNNA 3T1HK 2BTFA 4I6MB 1ZYQA 2HOEA 4DFKA 1N6QA 1SUQA 4FM2A 4H0TB 4JLHA 3QICA 1HKCA 2V52B 3KD5E 3O4QA 4FW1A 3QFPA 2G8IA 4B9SA 4DHYA 3IFRA 3CCEN 1A5VA 1SV5A 3NCIA 3WNGA 3RRHA 2Z1HA 5E41A 2HBMA 3FZKA 4ELUA 2GWJA 3LP0A 4XH1A 4A2AA 3PUFA 3ULEA 3WXKA 5SWMA 1DGKN 4C1NI 3L8BA 4L8RB 2FBVA 4FL9A 5FPMA 2Q1NA 2NRZA 4Z4EA 5JVHL 1HPZA 4G9ZA 2HVHA 2KZZA 3P5JA 4IFYA 1FK9A 3PIPL 2VG6A 4ILHA 3NGIA 1QSSA 2HW3A 4DKWA 4FPAA 3LPTA 3LP3A 4OPAA 4C8MA 1NOZA 3L2VA 4A2BA 3U6FA 4H5NA 3MXJA 1S3XA 2G8UA 2IS3A 4NCGA 4LF6K 2KLAA 5AQZA 2WOMA 2G8FA 3QERA 2B4JA 2D0PA 4XEIA 4BWMA 3CETA 3ULEB 3FZFA 2QKKA 4F3TA 1EWQA 3A8YA 1ITGA 3RTVA 1EP4A 3H08A 3ZT2A 1K8KA 2ETJA 4CJKA 3NH1A 1N34K 4RW8A 4YOXA 4DV0K 3WXIA 4M3WA 1XQSC 4HTLA 4FJIA 3S9HA 4IJAA 4RCHA 3BZKA 3VEXA 4CECA 1JLEA 4HCBA 3MN9A 1Z6RA 1FKOA 3MCAB 4DV1K 3O5BA 1V4TA 4FJ7A 5AQGA 4K8XA 3AO3A 3MK6A 1S6PA 3ENOA 3KKRA 4DFJA 4BDPA 3VA0A 2WTUA 5BRDA 2HHTA 4FLWA 4Z4CA 2QXFA 3SUOA 4PA1A 4B9QA 2JWKA 4BRFA 3AVCA 3V9SA 4CBXA 3NHGA 3DRRA 3OVNA 3V6DA 1ZBUA 3BF1A 3MN6A 1K8KB 1W7AA 4LD0A 2HHXA 3ATVA 2V51B 2YKNA 4HWIA 1VSIA 3JAMO 4CF1A 1GLCG 2R7YA 3H45C 5T7BA 1RT3A 2OTLN 4UQGA 3UKRA 1LCUA 1QZ6A 2QWRA 5TKYA 1HNXK 2F8SA 4H4MA 3D0PA 4B1VA 1C1CA 4DSEA 5H1SQ 1J53A 4IO9L 3A0IX 1IO2A 2XRIA 2JLEA 4GNIA 4FJ9A 3FZMA 4YOWA 5J2QA 4ELVA 4ID5A 3L2UA 4DV4K 3C6AA 3EZ5A 2A1RA 4RW4A 4BDYA 3T3FA 1KFSA 1YVNA 4M3XA 4DR2K 4K41A 4CJ5A 3R6MA 2BUPA 3S3MA 2ASOA 1KCFA 4CGFA 5CY4A 4AHUA 4E1JA 3CC2N 5BPMA 4CEOA 3V4IA 2HF3A 4JKDA 3C65A 1IJJA 4CJWA 4KB0A 2VQFK 4JKBA 3HM9A 4ILGB 3AVIA 4FPBA 4O0IA 4BRLA 4E7JA 5AQJA 4FWLA 2PYJA 1KLMA 3DOLA 1VQON 5IT9O 3I0RA 4BWJA 3SLCA 1WSIA 5CE3A 3SAGA 1L5UA 2ZE2A 1MA9B 4MLHA 5AQOA 1XUPO 4JD2B 4E0DA 1JCEA 4KAZA 4KHSA 2QWMA 4K25A 3P38A 1BA0A 3EE9A 5J2MA 2A41A 1RBSA 5EXWA 4CZJA 4LC9B 4B9UA 3AVFA 2Q0UA 3AA2A 5J2PA 3HO1A 3TAEA 3TR8A 4JN4A 3DOKA 5AQMA 1EETA 3C7NA 2VCPA 4CJRA 4BVPA 3T19A 1T3VA 4M41A 3KJVA 3EZWA 5C2DA 4CI6A 3C0BA 4AF1A 2HHHK 3NVKA 2F4VK 3T7ZA 3ZSWA 2HHQA 1UWBA 1T03A 1YIJN 1KVBA 4M63C 3SQ0A 3OYGA 4HTUA 1NK7A 4DFPA 2P9NA 4RTFD 4CZGA 4RWTA 3QESA 3O9UA 3ZSOA 3ZETA 3THWA 1HNVA 5EY4A 4BC2A 3CD6N 3LZJA 3V9UA 4DG1A 3HYFA 1VQ4N 2E6LA 3T1YK 1EX4A 4CEEA 3HVTA 4DTJA 2HHVA 4CBUA 3MXIA 1RT6A 4FZXC 5F0XA 1MWKA 4BC3A 2HMIA 1VSKA 3C7NB 4DV3K 4BR0A 4CEAA 3QNOA 2YHBA 4JI3K 1RDCA 3CI5A 1SS6A 4H5RA 4RG8A 2P9IA 2B5JA 2Q0RA 2XY8A 3VF6A 3A5MC 3HL8A 3F9MA 2O8EB 1S22A 1J5EK 5KRSA 5KRTA 5FRMA 4IFEA 4KRFA 3QFUA 4CFCA 3N4QA 2GEMA 3EKUA 5FDLA 1XI1A 1DTQA 5AQNA 1QE1A 3S3OA 4EP5A 3VQQA 4QS7A 3DLGA 4F2RA 2VWBA 3UKUA 1O13A 3CM6A 4EZ9A 3CPWM 3AVLA 1VQNN 4JNEA 5HRSA 3AVNA 3MXMA 3RMDA 3AO2A 3IAYA 3ZETB 1BWFO 4JHDB 4LF7K 2ZWHA 3THWB 4J8FA 4BRPA 5A2QO 1ATNA 4FWRA 3DXMB 4EFHA 2QWNA 1KLNA 4GVEA 2DTUA 2E20A 4H5VA 3MEDA 5BN8A 4KBOA 1YJNN 1BDGA 4FZYA 3CYMA 3SBGA 1BG3A 3BEXA 3F2KA 3SNNA 3CCLN 3AY9A 3KVGA 3LDOA 5J2NA 4OJRA 4M3RA 4U7BA 3CXCM 5AQTA 3LWLA 4FLYA 3O9TA 2Z1JA 3U3GA 1NGJA 4FJMA 2ZJQL 3HI0A 3ZCMA 2BANA 3O3GA 2E2QA 4K0KK 3G0ZA 1TYQB 4CEDA 2P9PA 3ZSQA 3R8EA 1HX1A 1RDAA 1RT7A 3RR7A 1OH7A 1F21A 3TTDA 5CR4A 1HQEA 2V7YA 4C8KA 4EHTA 4PQUA 4JEPA 1LWCA 2KW4A 2ZM6K 1B9DA 4DUYK 3GDQA 3H6EA 3LDNA 3MCPA 4AHSA 1MU2A 4KFBA 4PKGA 1I39A 3TAPA 4FJ8A 1TK0A 3CPEA 1QS4A 1NKBA 3AVJA 4FVUA 4B1UB 4C8NA 1JCGA 3OYMA 4DTPA 5AQWA 1OKJA 3CCQN 2HSTA 4AQYK 3QDKA 1ILYA 3KWIA 3A5OC 1X9SA 4DV7K 1D8YA 2IVOA 4KKOA 3W0LA 3G10A 3O9RA 4BGAA 1OVYA 2O8BB 3VETA 1WLJA 1QQOA 4N76A 1JLFA 2E88A 4JI7K 2OPRA 3DAWA 4W5NA 1K6YA 1T6CA 1ESVA 2YI1A 3L3UA 4B1YB 3SV4A 3VEOA 3VMFB 4CF2A 1EWRA 5HP1A 1XNQK 1HYSA 2VGNA 3T69A 1YJ9N 4BRHA 5LY3A 1O1WA 5C12A 4DQQA 5J1EA 4GV6A 4FK0A 2I5JA 4PL8A 1WSGA 3IG1A 4W5TA 1Y97A 3NF9A 3K59A 3AA5X 5F2RA 3V1QA 1HJRA 4DU3A 4Y0WA 3ZLJA 2P9UA 4CZIA 4FWPA 4DS4A 4NXNK 4ICLA 4DTXA
chains in the Genus database with same CATH topology
4LF9K 1IBLK 4DV4K 4LF6K 5LL6Z 3OTOK 4GKKK 4K0KK 4JYAK 1HNWK 4CVNE 4DR2K 4DR4K 4NXMK 4B3TK 4YY3K 1IBMK 1N34K 5BR8K 4JI1K 4DV6K 1HR0K 3J7YP 4DV0K 2ZM6K 2VQFK 4B3SK 4B3RK 4JI4K 3T1YK 4X64K 4JV5K 4DUYK 2VQEK 4YHHK 1N32K 4DUZK 4V19S 3J81O 5LMUK 4DV3K 4DV1K 1HNZK 4DR6K 4JI3K 3T1HK 3J80O 4JI0K 2UUAK 2UXCK 1XMQK 4AQYK 4GKJK 5IT9O 1FJGK 4LF4K 1J5EK 4JI6K 5AJ3K 5LMNK 1XNRK 4DV7K 2UUBK 4DV2K 4LF5K 2UU9K 1I94K 4CW7B 1N33K 5FLXO 4JI2K 4X62K 4JI7K 4LF7K 2UUCK 4DR1K 4DR3K 5A2QO 4JI8K 2UXBK 4LFAK 4LF8K 3J7AP 4JI5K 4DV5K 1XNQK 1N36K 3JAMO 4LFBK 4KHPK 4DR5K 4LFCK 2E5LK 1HNXK 2UXDK 1XMOK 4DR7K 4X65K 4B3MK 5IWAK 2HHHK 2F4VK 4X66K 1IBKK 4NXNK 4OX9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 K;  1IBL K;  4DV4 K;  4LF6 K;  5LL6 Z;  3OTO K;  4GKK K;  4K0K K;  4JYA K;  1HNW K;  4CVN E;  4DR2 K;  4DR4 K;  4NXM K;  4B3T K;  4YY3 K;  1IBM K;  1N34 K;  5BR8 K;  4JI1 K;  4DV6 K;  1HR0 K;  3J7Y P;  4DV0 K;  2ZM6 K;  2VQF K;  4B3S K;  4B3R K;  4JI4 K;  3T1Y K;  4X64 K;  4JV5 K;  4DUY K;  2VQE K;  4YHH K;  1N32 K;  4DUZ K;  4V19 S;  3J81 O;  5LMU K;  4DV3 K;  4DV1 K;  1HNZ K;  4DR6 K;  4JI3 K;  3T1H K;  3J80 O;  4JI0 K;  2UUA K;  2UXC K;  1XMQ K;  4AQY K;  4GKJ K;  5IT9 O;  1FJG K;  4LF4 K;  1J5E K;  4JI6 K;  5AJ3 K;  5LMN K;  1XNR K;  4DV7 K;  2UUB K;  4DV2 K;  4LF5 K;  2UU9 K;  1I94 K;  4CW7 B;  1N33 K;  5FLX O;  4JI2 K;  4X62 K;  4JI7 K;  4LF7 K;  2UUC K;  4DR1 K;  4DR3 K;  5A2Q O;  4JI8 K;  2UXB K;  4LFA K;  4LF8 K;  3J7A P;  4JI5 K;  4DV5 K;  1XNQ K;  1N36 K;  3JAM O;  4LFB K;  4KHP K;  4DR5 K;  4LFC K;  2E5L K;  1HNX K;  2UXD K;  1XMO K;  4DR7 K;  4X65 K;  4B3M K;  5IWA K;  2HHH K;  2F4V K;  4X66 K;  1IBK K;  4NXN K;  4OX9 K; 
#chains in the Genus database with same CATH topology
 2PYL A;  4RW6 A;  3QBX A;  5EOY A;  4DF4 A;  3E9O A;  4JRP A;  3NH2 A;  5E26 A;  3ISN C;  4C8O A;  4B3T K;  2A1S A;  3VEV A;  4DCH A;  1HR0 K;  3AO4 A;  3FLC O;  4JKA A;  3D6R A;  4FK2 A;  5FRO A;  3DM2 A;  3LDQ A;  1JLA A;  5BRE A;  4KH4 A;  4CHQ A;  2ASM A;  3H1Q A;  3ZX3 A;  3PO4 A;  2AA4 A;  1DKG D;  5CZ2 A;  1Q86 O;  1ZBL A;  2B6A A;  4DTU A;  1TKT A;  2O8F B;  3O6W A;  3SV3 A;  1WN7 A;  1DLO A;  5GAH P;  1XNR K;  2E2O A;  4CD3 A;  5C2F A;  4BAC A;  4NO7 A;  1T05 A;  2VG5 A;  3O08 A;  4RW9 A;  4BR4 A;  1HPM A;  3MMV A;  2P9L A;  4O5F A;  1W0H A;  1T7P A;  1Q82 O;  4DR3 K;  3SCX A;  1YXQ A;  3VEW A;  2UXB K;  4OO1 J;  4YOU A;  3RMB A;  5M1F A;  1VSD A;  5EX5 A;  1J6Z A;  3EKS A;  4GW6 A;  2QTD A;  1D9F A;  1VQM N;  2YHY A;  3LP2 A;  5JS1 A;  3NF6 A;  3TAQ A;  1SZ2 A;  4CJP A;  3LDL A;  3ID6 A;  4WQ5 C;  4IZ9 A;  1YUW A;  3HST B;  3WXJ A;  3SAF A;  3D2F A;  3LDP A;  3HP6 A;  1L3S A;  4BE0 A;  5E84 A;  2FC0 A;  4GMJ B;  4B9M A;  5D3G A;  1VSM A;  3H1V X;  3TSU A;  3KHY A;  3QET A;  3TAR A;  1K73 O;  1NMD A;  4OX9 K;  1WAJ A;  3KTQ A;  1NBW A;  1BQM A;  4L3Q A;  1QVG M;  5CYM A;  3VF4 A;  2VG7 A;  4Z94 A;  4IDH A;  1U2V B;  2CGL A;  4IJN A;  1HNW K;  2P9L B;  3OYJ A;  4DTR A;  1TKD A;  3AV9 A;  2IGI A;  3NBP A;  1VQ8 N;  3CJ1 A;  3H3O B;  3CME N;  2F8T A;  1NM1 A;  4AM7 A;  3AO1 A;  2YJE A;  1RDU A;  4JI1 K;  4DV6 K;  1QTM A;  1XHZ A;  1DTT A;  5EVZ A;  4B3R K;  2ZGZ A;  3CF5 L;  2X6S A;  3M8S A;  4M45 A;  3OYC A;  2YKM A;  4J2A A;  3D2F B;  3VQ8 A;  3CFR A;  3CER A;  1W2B M;  3VPZ A;  1GLF O;  4BR5 A;  5JMV A;  3O3F A;  1QHT A;  5JS2 A;  5JLH A;  3QEI A;  1RFQ A;  1J5O A;  4KB1 A;  4JKE A;  2KFZ A;  4KHW A;  3B6O A;  2NRV A;  4CE9 A;  5F1X A;  4IFV A;  4YOR A;  5M1N A;  3SQ4 A;  3U4L A;  1JXE A;  2YX6 A;  3GOI A;  3IS9 A;  4IEE A;  1NJW A;  1G15 A;  3MN7 A;  2G8W A;  4CW7 B;  3RSE A;  1TUY A;  1ZBI A;  2F7T A;  4H03 B;  1N33 K;  1NJI O;  5GAE P;  3SZ2 A;  2XY7 A;  3THV A;  1LW0 A;  4BVO A;  3NAE A;  4M42 A;  3QIN A;  4W5Q A;  2HHW A;  3G6E N;  1Q8I A;  1U4B A;  2D5R A;  3OJU A;  4MDB A;  4J2D A;  4KO0 A;  3A5L C;  3V9W A;  1KXP A;  2D4W A;  3I0S A;  1C0G A;  3NDK A;  4E7I A;  1HQU A;  4CZL A;  1VSH A;  3SMS A;  3ZT1 A;  3M5R A;  4CF9 A;  2YNF A;  4BE1 A;  2XY5 A;  2D0A A;  2Z1G A;  3K9K A;  1VQK N;  1VQL N;  4H0Y B;  5CHI A;  1Z26 A;  5I3U A;  1HUX A;  1JL1 A;  1NU0 A;  3V1R A;  4PKI A;  4FOE A;  3ZSY A;  1NK0 A;  3MDQ A;  3F73 A;  1ATR A;  5HLF A;  4AHC A;  4AHV A;  4ISE A;  1IKW A;  4N5S A;  3WUH A;  2KTQ A;  4DTO A;  3RWU A;  4PKH A;  4LH4 A;  3GBT A;  1NGC A;  3SUQ A;  2HMP A;  5AQQ A;  3RSE B;  3L6Q A;  2IC3 A;  3PSI A;  2IDO A;  1LWF A;  2Z1I A;  3D2E A;  2OA8 A;  4DF8 A;  4TSX A;  5AQS A;  4QS8 A;  4WFA L;  4WCE L;  1BCM A;  1XC9 A;  1E3M A;  3FZH A;  1U6Z A;  2CGJ A;  4A62 A;  4CIG A;  4Y1C A;  3U9Z A;  3HZ6 A;  4NXM K;  1NJX A;  5TKW A;  3SJH A;  2FLO A;  1RT2 A;  3DJC A;  1ASU A;  3VER A;  2IVP A;  2E8A A;  1IV0 A;  3HVR A;  4KH5 A;  3MWT A;  1GLE G;  3BZC A;  4CJ3 A;  4CFA A;  1RBR A;  1RDB A;  4ISF A;  4WF9 L;  4MDA A;  4CK2 A;  1WBD A;  4FJL A;  3SUN A;  3HJF A;  3AVM A;  3N4P A;  1FJG K;  3HXM A;  3QIO A;  3IMX A;  4ELT A;  3CCJ N;  1S9G A;  3ITH A;  1NK6 A;  5AQV A;  3NMU A;  4LF5 K;  4H0P A;  4A57 A;  4O55 A;  4WFN L;  1CXU A;  1BIS A;  3R3L A;  1Q18 A;  4Z4G A;  3K5O A;  4I9L A;  3UKR B;  2G8V A;  5JLF A;  4X62 K;  4CJ7 A;  1NKE A;  3CCU N;  1V4S A;  3OYH A;  3DLE A;  3ENH A;  2G8K A;  3G71 N;  3TTF A;  4JI5 K;  4DTM A;  1N5Y A;  3O8M A;  1XHX A;  3VGK A;  4BRK A;  2FBY A;  4DQP A;  5AZI A;  4FLV A;  2BE2 A;  4B9N A;  3L4Q A;  5HRR A;  4JS4 A;  4IEI A;  1SKS A;  4JKF A;  3VQ5 A;  1HKB A;  3E9L A;  3SJJ A;  4DR7 K;  4B1W B;  4KRE A;  3J7Z O;  3OW2 M;  3CC4 N;  3OYA A;  1YT3 A;  3FFK B;  2I7N A;  4IO8 A;  1BI4 A;  1XC3 A;  1NGE A;  2VYP A;  4LF9 K;  4B3O A;  3HP9 A;  4FJ5 A;  5LL6 Z;  1T6D A;  2XY6 A;  1C6V A;  2FSK A;  3R9P A;  1RNH A;  3K5M A;  5HL7 L;  2QKB A;  3I33 A;  1IKY A;  5I9E B;  4M3Y A;  4PHT X;  4O5B A;  1CXQ A;  4K42 A;  1NK9 A;  4IOA L;  2KHO A;  3I8B A;  5C42 A;  5AZI B;  1BA1 A;  4JK7 A;  4KH6 A;  1WOQ A;  4LY7 A;  1C0F A;  3DRP A;  5EU7 A;  3ZYY X;  5DK5 A;  5KGX A;  1BOT O;  4K43 A;  1U45 A;  3VGL A;  4IWV A;  4EIA A;  1NK8 A;  4U67 L;  2A6A A;  2YJF A;  4CJU A;  3SUP A;  1GOA A;  3G4S N;  1LAV A;  2GTD A;  3MN5 A;  1NNE A;  4JI6 K;  4CEQ A;  3K5N A;  3OYD A;  4BE2 A;  1NGA A;  3GL1 A;  1HLU A;  3WEE A;  2UUB K;  2FBT A;  4CK3 A;  5I42 A;  1U47 A;  4YDU A;  3AGK A;  2ITM A;  4JAX A;  5JIC A;  3KLE A;  3L2Q A;  3JS6 A;  4Z4H A;  4CHY A;  2PBD A;  3TI0 A;  2HNY A;  3L0Q A;  1WSE A;  4IG0 A;  2HB5 A;  3AAR A;  3CJC A;  1JLG A;  4DSI A;  3CCS N;  2ATQ A;  3HSC A;  4CEF A;  1KAX A;  3EE8 A;  3VES A;  1ZBS A;  1TGO A;  4FJH A;  1TL1 A;  1BIZ A;  2RHK A;  3EN9 A;  4E3S A;  3LL3 A;  4KHP K;  3LAL A;  3E1Y A;  4KHU A;  1QQM A;  3KLF A;  4W5O A;  1FXX A;  2Q97 A;  1D9D A;  3AO5 A;  2X6N A;  2P9N B;  2OZM A;  4FCY A;  4OKJ A;  3ZSZ A;  2ZJP L;  3JSM A;  3SQ1 A;  4HVJ A;  4FXD A;  3BUZ B;  5AZJ A;  3L2W A;  3WT0 A;  2P9S A;  1YHQ N;  2O8C A;  3THY A;  1VSE A;  3V81 A;  1NJZ A;  3OTO K;  1H1V A;  1KAZ A;  4GKK K;  2F96 A;  2HHS A;  4CHN A;  1NGG A;  4B08 A;  2ZF5 O;  1QQN A;  4DR4 K;  1CLQ A;  1U48 A;  4C23 A;  3HM8 A;  4CER A;  3V9Z A;  1VSF A;  2P9I B;  3TAG A;  4FVM A;  5LJW A;  3ZSX A;  4YY3 K;  4A61 A;  3Q7B A;  4JK9 A;  3J7Y P;  4DQR A;  4JKG A;  4CJ4 A;  5AQI A;  2IVN A;  2XHB A;  1KTQ A;  3OBY A;  3PSF A;  3IKM A;  1VRU A;  3ID8 A;  3UKU B;  1GLL O;  1HMV A;  3CCV N;  1MWM A;  4M3U A;  3J80 O;  4GY2 B;  1ATS A;  4CHZ A;  1ZXO A;  5AQH A;  3VN5 A;  3PX0 A;  5AZJ B;  4GKJ K;  5AFU H;  1REV A;  2NUB A;  3D45 A;  1TAU A;  3AVA A;  4DTS A;  1NKC A;  4FWQ A;  3OS2 A;  3RMA A;  2O8C B;  3K5L A;  5C10 A;  5LMN K;  4DB3 A;  2UU9 K;  4YFU A;  1VK0 A;  1JCF A;  4XH5 A;  1NG9 A;  2QWP A;  1D4X A;  1ZC6 A;  4CJV A;  1ASW A;  3TSQ A;  4N41 A;  3MX2 A;  1QSY A;  1RT5 A;  3MX5 A;  3OHR A;  3VTH A;  2P1J A;  3EL2 A;  4DSL A;  3M6G A;  4JKG B;  4O8U A;  1L3U A;  4N56 A;  4EHU A;  4CK1 A;  4CZE A;  3CQX A;  1FKP A;  3E01 A;  1X9W A;  1QZ5 A;  2QWO A;  3AVH A;  1N36 K;  1EQY A;  2I7P A;  4BR2 A;  2VWJ A;  4WQ4 A;  3F9K A;  1VQ9 N;  2P9P B;  3H46 O;  2WBN A;  3TTC A;  4XIU A;  4EZ6 A;  2DPN A;  4NCB A;  2Q31 A;  1WBB A;  3BGR A;  1JLC A;  5FRN A;  4FLX A;  4CJS A;  1TL3 A;  4OLB A;  3NFA A;  1HKG A;  2W40 A;  2Y1J A;  3O4N A;  3LPU A;  3OYI A;  1JKH A;  4FM0 A;  1YJW N;  4CEZ A;  1IG9 A;  4OPK A;  1WUA A;  2E6M A;  3PO5 A;  3FR0 A;  4NLB A;  2FF6 A;  3HRG A;  3TSP A;  2ZD1 A;  1M1K O;  4JS5 A;  1P8Z A;  1Z25 A;  1RTD A;  3IRX A;  4B1X B;  5KPZ A;  4H8K A;  3ZT4 A;  4ZTJ A;  4F8R A;  5BN9 A;  1SKW A;  3M8P A;  2W6K A;  4BRA A;  2W41 A;  4H0O A;  4B9T A;  4LSL A;  3O3H A;  1T44 A;  1NGD A;  3KWG A;  2PAV A;  2QXL A;  5BPL A;  5KI6 A;  4ZHR A;  4DQI A;  4BDZ A;  3J81 O;  2W6L A;  1S1V A;  4FLZ A;  3KD1 E;  2FBX A;  3DLK A;  3V1O A;  4MLE A;  1YAG A;  1I3A A;  2A3Z A;  3I8D A;  3KK2 A;  3RRG A;  3SAH A;  1ZBH A;  1S6Q A;  3HOS A;  4GVM A;  3TAB A;  2YHW A;  3DLR A;  3VEZ A;  4A59 A;  3OYF A;  4AM6 A;  3VQD A;  3WNF A;  2NRX A;  1YTU A;  2WON A;  4CJE A;  1LOT B;  3NVM A;  5LJV A;  3OYB A;  4I6M A;  4LSN A;  1K9M O;  1SKR A;  2RKI A;  1EKE A;  2OPS A;  4A5B A;  4B9L A;  2P9U B;  4YOT A;  4FJJ A;  4F9O A;  4E7K A;  3L3V A;  2ZQB A;  3M1F A;  3VOV A;  4F2S A;  3U8X A;  3QML A;  2IAJ A;  3KK3 A;  3AAQ A;  3A5N C;  1E4F T;  3EO3 A;  4CFD A;  4FO0 A;  3SBT A;  1RTJ A;  4DSF A;  1KAY A;  4QCL A;  2G8H A;  1JXB A;  2RPI A;  5GIP A;  4YDU C;  4CZK A;  3OS1 A;  3O1W A;  4OKK A;  1KRP A;  5AQX A;  3VTI A;  5KQ8 A;  2YHA A;  1VRT A;  2VGM A;  1DEJ A;  3C6U A;  1NGF A;  3KLI A;  3O9S A;  4EAH D;  3QEX A;  3HPH A;  3NE6 A;  4FM1 A;  1GLB G;  1X9M A;  4CJT A;  4CES A;  2ZJR L;  1E4G T;  1RDW X;  3Q7C A;  1YVU A;  4H5W A;  2OYQ A;  1NGI A;  4C1N K;  4FWN A;  5DMR A;  1S1T A;  3KLH A;  1XWL A;  4DQ8 A;  1L3T A;  4RW7 A;  4B3S K;  1CZB A;  3ZT3 A;  4FJG A;  2QWL A;  1TK5 A;  3ALY A;  3U3Y A;  3DXK A;  4BR7 A;  4OPH A;  4CIE A;  5LMU K;  3VQ9 A;  1OVQ A;  4CGH A;  4MO4 A;  3SMP A;  3MEC A;  1HNZ K;  3LZI A;  3BDP A;  1X3M A;  2PFU A;  2UXC K;  2GV9 A;  1XMQ K;  2VWK A;  4CF0 A;  1X3N A;  5ADX A;  4FLT A;  1YTA A;  4OGC A;  4QAG A;  3DLH A;  3HPG A;  3BP8 A;  3HBT A;  4DV2 K;  4DLE A;  1QHA A;  1J54 A;  3QEW A;  1QSL A;  2V7Z A;  2HHU A;  4JKC A;  4BRM A;  5FLX O;  1HNI A;  3LM9 A;  3R1X A;  1WNS A;  3ZX2 A;  4BRQ A;  4PL7 A;  5KTQ A;  4CHO A;  2GUI A;  2QA4 N;  3CJ9 A;  3TWH A;  4IXC A;  3P31 A;  4DR1 K;  4LH5 A;  4YNQ A;  1L3V A;  1CZA N;  1TKX A;  3CIP A;  4H5T A;  4DV5 K;  3WXL A;  4KTQ A;  3SPZ A;  3M8Q A;  3T1A A;  4BY9 C;  4FWM A;  4IBN A;  3QEV A;  1CZ9 A;  3CM5 A;  3DYA A;  2Y1I A;  2RN2 A;  1W97 L;  3DXK B;  4NYF A;  1EXQ A;  3CFP A;  5ADX H;  2E5L K;  2YCH A;  3VQE A;  3VA3 A;  1S72 N;  3VQ4 A;  1XMO K;  5GIO A;  3CJA A;  1EO1 A;  1TVR A;  3B6P A;  1TKZ A;  1DT9 A;  2GWK A;  2NRW A;  2YNH A;  1RTI A;  2PZS A;  2GBZ A;  4AIL C;  3DLL L;  3KKS A;  5AQU A;  2E2P A;  3QIP A;  4FWS A;  2D1K A;  2AP1 A;  1RTH A;  5BPN A;  2F9T A;  1C0U A;  3V9X A;  4YOY A;  4HUE A;  3IUC A;  3D7E O;  3DRS A;  4H0X B;  5HBM A;  5FPE A;  1NGB A;  1N8R O;  4E7H A;  2EHG A;  5C24 A;  3ZSV A;  1KC8 O;  5AQK A;  4DLG A;  4GV3 A;  1LV5 A;  1RBV A;  4KTW A;  4BG8 A;  3K0S A;  4WQ4 C;  2AJQ A;  2CH5 A;  3OYE A;  3GG4 A;  3E9P A;  1Q9Y A;  3S3N A;  4H4O A;  1YI2 N;  2NRR A;  4DWI A;  3F5T A;  4X64 K;  3VQ6 A;  1B92 A;  5M1K A;  3BF3 A;  3SK3 A;  2Q2R A;  4E1N A;  1S5J A;  2QM1 A;  5FPD A;  4DR6 K;  1KQS M;  1BGX T;  4B8C A;  2UUA K;  1IH7 A;  2Q36 A;  4XH4 A;  3TAF A;  2BDP A;  3U9D A;  4J2E A;  2YNG A;  4BRI A;  3DI6 A;  1JJ2 M;  4UY8 O;  4AHR A;  1W9H A;  4FJN A;  2O4G A;  4GV9 A;  1VSJ A;  3ATU A;  4KI6 A;  4DFM A;  2IIR A;  3ASM A;  4DMN A;  2UUC K;  4YOV A;  4FZZ A;  4QOZ B;  2DY4 A;  4JI8 K;  1NGH A;  1HYV A;  1X9J A;  3PY8 A;  1IG8 A;  2O4I A;  1BU6 O;  4IOX A;  4CIF A;  1RT4 A;  4CJQ A;  5GAD P;  4BC4 A;  3CJB A;  4DU4 A;  1QQC A;  2GEL A;  3SYZ A;  2E1Z A;  4JD2 A;  1P90 A;  3WXM B;  4M7X A;  1Q9X A;  5CYQ A;  3O80 A;  2WFB A;  2FF3 B;  3D2E B;  1YF5 L;  4N47 A;  1HRH A;  3QO9 A;  5AQY A;  2UXD K;  3MAQ A;  3VQP A;  3VGM A;  3UIQ A;  3G25 A;  3NH0 A;  5C0Y A;  1KFD A;  1M90 O;  1S1W A;  3FGU A;  2Q3S A;  4DSK A;  4AHT A;  4DS5 A;  3P4I A;  1X1P A;  2O8D A;  4E19 A;  2ASP A;  4CD1 A;  5HRN A;  1VQP N;  1RCH A;  3MEE A;  5DM7 L;  3AAP A;  4JYA K;  1SL1 A;  1RGI A;  5HRO A;  3C6H A;  2H3G X;  5MLC Q;  1C0T A;  2GX9 A;  5M1Q A;  3DWL A;  5BRF A;  3LP1 A;  2BGG A;  3PLA A;  1C1B A;  3AA3 A;  3VEY A;  3M8R A;  2OPQ A;  2KKZ A;  3OJS A;  4FJK A;  4JKH A;  5CZ1 A;  1GOB A;  4CFB A;  4O0J A;  4M3T A;  4JI4 K;  3OBW A;  1SL0 A;  4OPJ A;  3AVG A;  3VQ7 A;  1N32 K;  3JYT A;  2ZGY A;  4DUZ K;  4KHQ A;  4NCA A;  1UA0 A;  4B9V A;  3L4I A;  3GE1 A;  1WSF A;  4A5A A;  3HT3 A;  3AA4 A;  4JI0 K;  3TAM A;  2E4L A;  1WB9 A;  3FE1 A;  4Q0B A;  1FW6 A;  2O8D B;  4I2Q A;  3CQ8 A;  4CGD A;  5JVG L;  3LM2 A;  5FPN A;  2UYT A;  1I94 K;  5AQP A;  1KD1 O;  1S1U A;  3HTV A;  1TUU A;  3NGY A;  2HBJ A;  2D0O A;  4JI2 K;  2EWS A;  5SZT A;  4FSV A;  1YIT N;  2ITG A;  3L2R A;  1B9F A;  2HF4 A;  4LFA K;  3J7A P;  5HOO A;  4E89 A;  4BGB A;  2A5X A;  4HUF A;  2O8E A;  3UB5 A;  4ZTF A;  2F9W A;  1LWE A;  2QW9 A;  1BI4 B;  2XO7 A;  1OH8 A;  2OZS A;  4IDK A;  3C95 A;  1HJO A;  4AH9 A;  4CEB A;  4KTZ A;  1Q81 O;  1BQN A;  4BRC A;  3QLH A;  4PY5 A;  3OA9 A;  2NNW A;  4DR5 K;  5GAG P;  4KHN A;  1BL3 A;  1NLV A;  3CCM N;  3NF8 A;  3C94 A;  1Y64 A;  4NYN A;  4E1M A;  3RVC A;  4E7L A;  4I9Q A;  4JHD A;  5AR0 A;  4X65 K;  3C6T A;  4PWD A;  3ZX0 A;  4F3O A;  4PUO A;  4B3M K;  5IWA K;  4CGG A;  4B1Z A;  1ZBF A;  3DXM A;  1R59 O;  3AVB A;  4NLC A;  4X66 K;  1IBK K;  4ID1 A;  4R79 A;  4FYD A;  3P83 D;  1SQK A;  1IBL K;  4CJF A;  1HYZ A;  2CH6 A;  2QI2 A;  4BRD A;  3KIO A;  4BQL A;  3QEP A;  3AGR A;  2BH1 A;  3E66 A;  2D0C A;  3CG7 A;  3LWM A;  4CBW A;  2OTJ N;  3PX6 A;  4QS9 A;  4F4K A;  3LAM A;  1BO5 O;  2YHX A;  2HBK A;  3FZL A;  2NRT A;  1UAX A;  1LAW A;  4WQ5 A;  1NK4 A;  4C8L A;  4WFB L;  2E1Y A;  3B8A X;  4K8Z A;  3WEE B;  5KPT A;  2KFN A;  3ZEU A;  2YNI A;  2OCE A;  3VQC A;  4R5P A;  4JV5 K;  2VQE K;  4YHH K;  1NMN A;  5AFU A;  4V19 S;  4KV8 A;  3VQA A;  4CGJ A;  3SQ2 A;  1TYQ A;  2HNZ A;  3P1G A;  1VSL A;  3HK2 A;  2X74 A;  5AQL A;  3JXU A;  4CZM A;  3UE5 A;  4O44 A;  4B8A B;  3CMA N;  3ULD A;  3LAN A;  3OYN A;  4LF4 K;  1S1X A;  1JLQ A;  1VQ6 N;  4DQS A;  4BR9 A;  5KPR A;  1U04 A;  4KI4 A;  1NJY A;  3DMJ A;  5DM6 L;  1D5A A;  4MQ3 A;  1RBT A;  4FLU A;  4FJX A;  3EYZ A;  2CGK A;  1QVF M;  2WUS A;  5HRP A;  2D0B A;  3RMC A;  1RT1 A;  2JWL A;  1TAQ A;  3TU5 A;  1NK5 A;  3SI6 A;  1KSP A;  2P9S B;  4CZF A;  3CCR N;  3BY5 A;  3ZEU B;  4CGI A;  3ENB A;  3THY B;  1BHL A;  1C0M A;  2OPP A;  4OGE A;  4BQZ A;  4DU1 A;  4NB4 A;  2O8B A;  4CZH A;  3CHW A;  4LFC K;  2J4R A;  2QWQ A;  2OAN A;  2DFF A;  4CJL A;  2PY5 A;  2WC9 A;  2FSN A;  1OH5 A;  2JGU A;  4OVL A;  1NWK A;  1OH6 A;  1C1A A;  4JRQ A;  3PV8 A;  3H3N O;  1WAF A;  2LSN A;  3J8A A;  3I55 N;  1SL2 A;  4BRE A;  4FW2 A;  4W5R A;  2HND A;  2HVI A;  4IOC L;  3LAK A;  3PIO L;  3K57 A;  1K8A O;  5KGW A;  4HCC A;  4DSJ A;  5K14 A;  1GLJ O;  5C15 A;  4CVN E;  3AVK A;  2KZM A;  5KQD A;  2FXU A;  3EY1 A;  3SPY A;  1R0A A;  2RE2 A;  3QB0 A;  1TV6 A;  4M3Z A;  4WE1 A;  5AQR A;  2IOC A;  3K9J A;  3FFI A;  4IG3 A;  4HHT A;  2NLX A;  4H0V B;  3ZSR A;  4FWO A;  3KZB A;  3WQU A;  2P9K A;  1U49 A;  5BR9 A;  3O9Q A;  4Y1D A;  2YV0 X;  2W42 A;  3VF2 A;  2KQ2 A;  4O8K A;  3OYK A;  3PX4 A;  3O1B A;  3CFO A;  4I2P A;  4Z4F A;  5AJ3 K;  5M1O A;  3QBW A;  3CJ7 A;  4BRO A;  3NF7 A;  3DLB A;  1A5X A;  2FSJ A;  1BCO A;  3LDS A;  3RR8 A;  1VQ5 N;  1UOC A;  1RDD A;  1VAZ A;  3VQB A;  4CF8 A;  4M7Y A;  1SAZ A;  3HPO A;  4OLA A;  4DTN A;  1KVA A;  3P39 A;  5AQF A;  1RIL A;  4MO5 A;  3KK1 A;  1GLD G;  2GUP A;  1BUP A;  3OS0 A;  1Q7Y O;  1ASV A;  3WNH A;  1UA1 A;  3THX A;  5M1P A;  4LF8 K;  1VHX A;  1S9E A;  2QEX N;  4MFB A;  1JL2 A;  1RBU A;  5BRH A;  2O8F A;  4OKE A;  1KVC A;  4FK4 A;  3TAN A;  4LFB K;  1NOY A;  4WYB A;  3MEG A;  3W3D A;  1TK8 A;  4Z4I A;  1J9A A;  1LW2 A;  4BRN A;  5ELZ A;  4Q5V A;  1Z05 A;  3CC7 N;  2A42 A;  2DFE A;  4J2B A;  3WQT A;  2P9K B;  2QK9 A;  1JLB A;  1GLA G;  3IDH A;  3CQY A;  1GOC A;  2EX3 A;  4Z0U A;  5C25 A;  5GIN A;  3K58 A;  2P5O A;  1A5W A;  2X78 A;  4FOI A;  3TPQ A;  3K2P A;  4JK8 A;  3VEN A;  3KLG A;  4EP4 A;  2NRH A;  4BC5 A;  4KPY A;  3O4W A;  4O4G A;  2HBL A;  2E2N A;  3OY9 A;  3EEQ A;  2A40 A;  2NZT A;  1VQ7 N;  3WNE A;  3THX B;  4KHY A;  4BRG A;  1WSJ A;  4FWK A;  3S41 A;  3OYL A;  1IBM K;  4CCH A;  4ISG A;  5BR8 K;  3I56 N;  1BIU A;  1WSH A;  3MWP A;  4ILJ A;  3A2F A;  4I7F A;  1T8E A;  2DFH A;  3KK7 A;  5B8H A;  3HOT A;  4CHP A;  4IKF A;  3M3Z A;  3ZT0 A;  3NGZ A;  1U2V A;  2RF2 A;  1IKV A;  4BG9 A;  2P51 A;  2P5G A;  1MDU B;  4G1Q A;  4HUG A;  1IKX A;  1G99 A;  3QNN A;  3T1H K;  2BTF A;  4I6M B;  1ZYQ A;  2HOE A;  4DFK A;  1N6Q A;  1SUQ A;  4FM2 A;  4H0T B;  4JLH A;  3QIC A;  1HKC A;  2V52 B;  3KD5 E;  3O4Q A;  4FW1 A;  3QFP A;  2G8I A;  4B9S A;  4DHY A;  3IFR A;  3CCE N;  1A5V A;  1SV5 A;  3NCI A;  3WNG A;  3RRH A;  2Z1H A;  5E41 A;  2HBM A;  3FZK A;  4ELU A;  2GWJ A;  3LP0 A;  4XH1 A;  4A2A A;  3PUF A;  3ULE A;  3WXK A;  5SWM A;  1DGK N;  4C1N I;  3L8B A;  4L8R B;  2FBV A;  4FL9 A;  5FPM A;  2Q1N A;  2NRZ A;  4Z4E A;  5JVH L;  1HPZ A;  4G9Z A;  2HVH A;  2KZZ A;  3P5J A;  4IFY A;  1FK9 A;  3PIP L;  2VG6 A;  4ILH A;  3NGI A;  1QSS A;  2HW3 A;  4DKW A;  4FPA A;  3LPT A;  3LP3 A;  4OPA A;  4C8M A;  1NOZ A;  3L2V A;  4A2B A;  3U6F A;  4H5N A;  3MXJ A;  1S3X A;  2G8U A;  2IS3 A;  4NCG A;  4LF6 K;  2KLA A;  5AQZ A;  2WOM A;  2G8F A;  3QER A;  2B4J A;  2D0P A;  4XEI A;  4BWM A;  3CET A;  3ULE B;  3FZF A;  2QKK A;  4F3T A;  1EWQ A;  3A8Y A;  1ITG A;  3RTV A;  1EP4 A;  3H08 A;  3ZT2 A;  1K8K A;  2ETJ A;  4CJK A;  3NH1 A;  1N34 K;  4RW8 A;  4YOX A;  4DV0 K;  3WXI A;  4M3W A;  1XQS C;  4HTL A;  4FJI A;  3S9H A;  4IJA A;  4RCH A;  3BZK A;  3VEX A;  4CEC A;  1JLE A;  4HCB A;  3MN9 A;  1Z6R A;  1FKO A;  3MCA B;  4DV1 K;  3O5B A;  1V4T A;  4FJ7 A;  5AQG A;  4K8X A;  3AO3 A;  3MK6 A;  1S6P A;  3ENO A;  3KKR A;  4DFJ A;  4BDP A;  3VA0 A;  2WTU A;  5BRD A;  2HHT A;  4FLW A;  4Z4C A;  2QXF A;  3SUO A;  4PA1 A;  4B9Q A;  2JWK A;  4BRF A;  3AVC A;  3V9S A;  4CBX A;  3NHG A;  3DRR A;  3OVN A;  3V6D A;  1ZBU A;  3BF1 A;  3MN6 A;  1K8K B;  1W7A A;  4LD0 A;  2HHX A;  3ATV A;  2V51 B;  2YKN A;  4HWI A;  1VSI A;  3JAM O;  4CF1 A;  1GLC G;  2R7Y A;  3H45 C;  5T7B A;  1RT3 A;  2OTL N;  4UQG A;  3UKR A;  1LCU A;  1QZ6 A;  2QWR A;  5TKY A;  1HNX K;  2F8S A;  4H4M A;  3D0P A;  4B1V A;  1C1C A;  4DSE A;  5H1S Q;  1J53 A;  4IO9 L;  3A0I X;  1IO2 A;  2XRI A;  2JLE A;  4GNI A;  4FJ9 A;  3FZM A;  4YOW A;  5J2Q A;  4ELV A;  4ID5 A;  3L2U A;  4DV4 K;  3C6A A;  3EZ5 A;  2A1R A;  4RW4 A;  4BDY A;  3T3F A;  1KFS A;  1YVN A;  4M3X A;  4DR2 K;  4K41 A;  4CJ5 A;  3R6M A;  2BUP A;  3S3M A;  2ASO A;  1KCF A;  4CGF A;  5CY4 A;  4AHU A;  4E1J A;  3CC2 N;  5BPM A;  4CEO A;  3V4I A;  2HF3 A;  4JKD A;  3C65 A;  1IJJ A;  4CJW A;  4KB0 A;  2VQF K;  4JKB A;  3HM9 A;  4ILG B;  3AVI A;  4FPB A;  4O0I A;  4BRL A;  4E7J A;  5AQJ A;  4FWL A;  2PYJ A;  1KLM A;  3DOL A;  1VQO N;  5IT9 O;  3I0R A;  4BWJ A;  3SLC A;  1WSI A;  5CE3 A;  3SAG A;  1L5U A;  2ZE2 A;  1MA9 B;  4MLH A;  5AQO A;  1XUP O;  4JD2 B;  4E0D A;  1JCE A;  4KAZ A;  4KHS A;  2QWM A;  4K25 A;  3P38 A;  1BA0 A;  3EE9 A;  5J2M A;  2A41 A;  1RBS A;  5EXW A;  4CZJ A;  4LC9 B;  4B9U A;  3AVF A;  2Q0U A;  3AA2 A;  5J2P A;  3HO1 A;  3TAE A;  3TR8 A;  4JN4 A;  3DOK A;  5AQM A;  1EET A;  3C7N A;  2VCP A;  4CJR A;  4BVP A;  3T19 A;  1T3V A;  4M41 A;  3KJV A;  3EZW A;  5C2D A;  4CI6 A;  3C0B A;  4AF1 A;  2HHH K;  3NVK A;  2F4V K;  3T7Z A;  3ZSW A;  2HHQ A;  1UWB A;  1T03 A;  1YIJ N;  1KVB A;  4M63 C;  3SQ0 A;  3OYG A;  4HTU A;  1NK7 A;  4DFP A;  2P9N A;  4RTF D;  4CZG A;  4RWT A;  3QES A;  3O9U A;  3ZSO A;  3ZET A;  3THW A;  1HNV A;  5EY4 A;  4BC2 A;  3CD6 N;  3LZJ A;  3V9U A;  4DG1 A;  3HYF A;  1VQ4 N;  2E6L A;  3T1Y K;  1EX4 A;  4CEE A;  3HVT A;  4DTJ A;  2HHV A;  4CBU A;  3MXI A;  1RT6 A;  4FZX C;  5F0X A;  1MWK A;  4BC3 A;  2HMI A;  1VSK A;  3C7N B;  4DV3 K;  4BR0 A;  4CEA A;  3QNO A;  2YHB A;  4JI3 K;  1RDC A;  3CI5 A;  1SS6 A;  4H5R A;  4RG8 A;  2P9I A;  2B5J A;  2Q0R A;  2XY8 A;  3VF6 A;  3A5M C;  3HL8 A;  3F9M A;  2O8E B;  1S22 A;  1J5E K;  5KRS A;  5KRT A;  5FRM A;  4IFE A;  4KRF A;  3QFU A;  4CFC A;  3N4Q A;  2GEM A;  3EKU A;  5FDL A;  1XI1 A;  1DTQ A;  5AQN A;  1QE1 A;  3S3O A;  4EP5 A;  3VQQ A;  4QS7 A;  3DLG A;  4F2R A;  2VWB A;  3UKU A;  1O13 A;  3CM6 A;  4EZ9 A;  3CPW M;  3AVL A;  1VQN N;  4JNE A;  5HRS A;  3AVN A;  3MXM A;  3RMD A;  3AO2 A;  3IAY A;  3ZET B;  1BWF O;  4JHD B;  4LF7 K;  2ZWH A;  3THW B;  4J8F A;  4BRP A;  5A2Q O;  1ATN A;  4FWR A;  3DXM B;  4EFH A;  2QWN A;  1KLN A;  4GVE A;  2DTU A;  2E20 A;  4H5V A;  3MED A;  5BN8 A;  4KBO A;  1YJN N;  1BDG A;  4FZY A;  3CYM A;  3SBG A;  1BG3 A;  3BEX A;  3F2K A;  3SNN A;  3CCL N;  3AY9 A;  3KVG A;  3LDO A;  5J2N A;  4OJR A;  4M3R A;  4U7B A;  3CXC M;  5AQT A;  3LWL A;  4FLY A;  3O9T A;  2Z1J A;  3U3G A;  1NGJ A;  4FJM A;  2ZJQ L;  3HI0 A;  3ZCM A;  2BAN A;  3O3G A;  2E2Q A;  4K0K K;  3G0Z A;  1TYQ B;  4CED A;  2P9P A;  3ZSQ A;  3R8E A;  1HX1 A;  1RDA A;  1RT7 A;  3RR7 A;  1OH7 A;  1F21 A;  3TTD A;  5CR4 A;  1HQE A;  2V7Y A;  4C8K A;  4EHT A;  4PQU A;  4JEP A;  1LWC A;  2KW4 A;  2ZM6 K;  1B9D A;  4DUY K;  3GDQ A;  3H6E A;  3LDN A;  3MCP A;  4AHS A;  1MU2 A;  4KFB A;  4PKG A;  1I39 A;  3TAP A;  4FJ8 A;  1TK0 A;  3CPE A;  1QS4 A;  1NKB A;  3AVJ A;  4FVU A;  4B1U B;  4C8N A;  1JCG A;  3OYM A;  4DTP A;  5AQW A;  1OKJ A;  3CCQ N;  2HST A;  4AQY K;  3QDK A;  1ILY A;  3KWI A;  3A5O C;  1X9S A;  4DV7 K;  1D8Y A;  2IVO A;  4KKO A;  3W0L A;  3G10 A;  3O9R A;  4BGA A;  1OVY A;  2O8B B;  3VET A;  1WLJ A;  1QQO A;  4N76 A;  1JLF A;  2E88 A;  4JI7 K;  2OPR A;  3DAW A;  4W5N A;  1K6Y A;  1T6C A;  1ESV A;  2YI1 A;  3L3U A;  4B1Y B;  3SV4 A;  3VEO A;  3VMF B;  4CF2 A;  1EWR A;  5HP1 A;  1XNQ K;  1HYS A;  2VGN A;  3T69 A;  1YJ9 N;  4BRH A;  5LY3 A;  1O1W A;  5C12 A;  4DQQ A;  5J1E A;  4GV6 A;  4FK0 A;  2I5J A;  4PL8 A;  1WSG A;  3IG1 A;  4W5T A;  1Y97 A;  3NF9 A;  3K59 A;  3AA5 X;  5F2R A;  3V1Q A;  1HJR A;  4DU3 A;  4Y0W A;  3ZLJ A;  2P9U A;  4CZI A;  4FWP A;  4DS4 A;  4NXN K;  4ICL A;  4DTX A; 
#chains in the Genus database with same CATH homology
 4LF9 K;  1IBL K;  4DV4 K;  4LF6 K;  5LL6 Z;  3OTO K;  4GKK K;  4K0K K;  4JYA K;  1HNW K;  4CVN E;  4DR2 K;  4DR4 K;  4NXM K;  4B3T K;  4YY3 K;  1IBM K;  1N34 K;  5BR8 K;  4JI1 K;  4DV6 K;  1HR0 K;  3J7Y P;  4DV0 K;  2ZM6 K;  2VQF K;  4B3S K;  4B3R K;  4JI4 K;  3T1Y K;  4X64 K;  4JV5 K;  4DUY K;  2VQE K;  4YHH K;  1N32 K;  4DUZ K;  4V19 S;  3J81 O;  5LMU K;  4DV3 K;  4DV1 K;  1HNZ K;  4DR6 K;  4JI3 K;  3T1H K;  3J80 O;  4JI0 K;  2UUA K;  2UXC K;  1XMQ K;  4AQY K;  4GKJ K;  5IT9 O;  1FJG K;  4LF4 K;  1J5E K;  4JI6 K;  5AJ3 K;  5LMN K;  1XNR K;  4DV7 K;  2UUB K;  4DV2 K;  4LF5 K;  2UU9 K;  1I94 K;  4CW7 B;  1N33 K;  5FLX O;  4JI2 K;  4X62 K;  4JI7 K;  4LF7 K;  2UUC K;  4DR1 K;  4DR3 K;  5A2Q O;  4JI8 K;  2UXB K;  4LFA K;  4LF8 K;  3J7A P;  4JI5 K;  4DV5 K;  1XNQ K;  1N36 K;  3JAM O;  4LFB K;  4KHP K;  4DR5 K;  4LFC K;  2E5L K;  1HNX K;  2UXD K;  1XMO K;  4DR7 K;  4X65 K;  4B3M K;  5IWA K;  2HHH K;  2F4V K;  4X66 K;  1IBK K;  4NXN K;  4OX9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...