5AJ3K

Structure of the small subunit of the mammalian mitoribosome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
136
structure length
136
Chain Sequence
SFSIYPPIPGQENSLRWAGKKFEEIPIAHIKASYNNTQIQVVSAAHQPLAHASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHVRVVVKGLGPGRLSAIKGLTMGGLEVISITDNTPIPHNGCRPRKARRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 27
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2015-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5aj3K00
4LF7K 4DR2K 4JI0K 4LF9K 4LFBK 2UXBK 5LL6Z 2HHHK 1XNRK 4CW7B 4DR4K 4DR1K 4B3TK 4DR6K 1J5EK 3T1HK 1HNXK 4JI5K 4JI8K 1IBLK 3J81O 4JI4K 1XMOK 4OX9K 4V19S 4X64K 5A2QO 4DR7K 4NXMK 4DUZK 4X65K 1XMQK 4YHHK 4DV2K 2UXDK 4B3RK 3OTOK 4JI1K 4DV1K 4B3SK 5IT9O 4LF4K 4LF6K 4DV6K 3T1YK 4B3MK 2VQFK 1I94K 1XNQK 1N34K 4YY3K 5AJ3K 4LFCK 4DV5K 4DV3K 1FJGK 4GKJK 1N36K 4DV7K 4NXNK 4JI6K 4DV4K 4X66K 1N32K 4K0KK 1HR0K 4JI7K 4JI3K 2UUAK 2E5LK 4LFAK 2UUCK 4GKKK 5IWAK 1IBKK 1IBMK 2VQEK 4DR5K 4DV0K 4JYAK 3JAMO 1HNZK 2F4VK 3J7YP 4JV5K 2UXCK 3J80O 4DUYK 2UUBK 4CVNE 4X62K 5BR8K 5LMNK 4KHPK 1HNWK 4JI2K 4AQYK 4LF5K 4LF8K 4DR3K 1N33K 5FLXO 5LMUK 2ZM6K 3J7AP 2UU9K
chains in the Genus database with same CATH superfamily
1TKTA 4KHWA 4PKIA 4WCEL 1IV0A 3A0IX 3OYMA 4YORA 2RE2A 2XY5A 2WUSA 4ILGB 4FLTA 1S5JA 3NGIA 3ZLJA 4M3UA 1T6CA 4FWMA 5HRNA 1D4XA 3BEXA 3HXMA 1HNXK 2KFZA 4CGIA 3ULEB 1RT3A 4OPHA 4H4MA 4RW8A 3MEDA 4ZTJA 1YTUA 2PYJA 4DF4A 3CCRN 3CMAN 4CEEA 1Q86O 1KAZA 3D6RA 1DKGD 3DLEA 3ZT4A 1EO1A 4N76A 2P51A 5KI6A 2OYQA 2UXDK 4CFCA 2QWNA 1EETA 4RG8A 1S72N 3CPEA 1K8KA 4BWJA 3SJJA 5C25A 4DCHA 3M8SA 4FLYA 2YHBA 2IDOA 1K73O 4XH4A 4ZHRA 3LDQA 2GWKA 2YCHA 1T44A 1VQKN 4BDZA 3PUFA 4FWLA 3KK7A 1QTMA 5EX5A 4BWMA 3CHWA 4XH5A 4H4OA 2F9TA 1DTTA 3DAWA 1XHZA 3FGUA 4E7HA 2HHWA 2B5JA 4RCHA 3G71N 1ESVA 4M3TA 1G15A 2XO7A 1NGCA 3LM2A 3IAYA 3OYDA 2Y1JA 4LFAK 1VQ4N 4IG3A 4RTFD 1NK6A 4J2AA 1VQ8N 1EP4A 4I9QA 2PBDA 3U3YA 2AP1A 2FSJA 5JICA 4YOWA 3DI6A 3WNEA 2DFFA 1Q8IA 4C1NI 2QM1A 4CGDA 3AO4A 3K9KA 2P9LA 3M8QA 1RTHA 4HTLA 4FWNA 1YXQA 4Q0BA 4A5BA 3FZFA 4QAGA 4Z4IA 3ID8A 3G10A 2Z1IA 3NFAA 3WNGA 3U3GA 1IG9A 4FZYA 5LMUK 3LALA 2V7ZA 2GTDA 3QINA 5AQYA 4DFJA 5C42A 4N41A 5AZJA 1Y64A 4H0YB 3VQQA 1NOZA 1UA0A 2ITGA 2HHHK 2OTLN 4CHQA 4PQUA 3WXLA 3ZSXA 4PHTX 3MECA 1REVA 2O4GA 3ZSOA 4DTXA 2G8HA 3J81O 1VQ9N 1JLGA 4BRAA 2ZWHA 2P5GA 3ZEUB 1HKBA 5C10A 4B1WB 3THYA 1V4SA 3DOKA 3OS2A 1BWFO 3NE6A 3K57A 3PIPL 4CZMA 2GWJA 4GY2B 2NZTA 1LCUA 2X6SA 4OPAA 3OTOK 4KTWA 4R79A 4FWKA 1HJRA 3VEYA 4FJ7A 2YX6A 5M1QA 4J8FA 3K9JA 4FJGA 2QW9A 1S1WA 2JLEA 4B9VA 2J4RA 4YY3K 2FXUA 4HCCA 1RT2A 3QEPA 1VSHA 4CI6A 3NH0A 5HLFA 4XIUA 3MXMA 3EKUA 1LW0A 3L2VA 3D7EO 3DLHA 4I7FA 4DU4A 2YHAA 4GKKK 4IZ9A 3HO1A 1ASWA 1BHLA 3CC2N 2YHWA 2P9KA 2P9UB 1TV6A 1VSKA 2D4WA 3LDLA 4CJLA 3OYEA 4OGEA 2NRRA 3ZT3A 3CQ8A 3UKRA 4F3TA 1NKBA 4X62K 4O5BA 4B1VA 4FVUA 3V1QA 4M45A 2QWQA 2O8EA 3OYLA 1WAFA 1S3XA 5AZIA 3QERA 4KPYA 5FPNA 2P9NA 4CJ7A 3RR8A 4HTUA 1JCGA 1RBUA 5BRDA 3HP6A 4WQ5C 1B92A 1C1CA 3P83D 2O8CB 1LOTB 2GBZA 1T7PA 2KKZA 2FBTA 2WOMA 3K2PA 1Z6RA 5CE3A 3NBPA 4Y1CA 1J5OA 4DSLA 1WNSA 4FM1A 5BPLA 4KV8A 4CF9A 4Z94A 3JYTA 1H1VA 3KVGA 3C6HA 4KH6A 4IEEA 4DQIA 1RT1A 5DMRA 4ELVA 4JD2B 4E89A 1XMQK 4DWIA 2ZGZA 4JI1K 3ENOA 3VQCA 4JK8A 5JLFA 3SPYA 1ATNA 4FJJA 3VF6A 4CJ4A 5M1FA 3LDSA 4PWDA 4OKKA 2QK9A 3AO3A 4CIFA 3MWTA 5AJ3K 4CJ3A 3HOTA 3SUNA 2IVPA 1LWEA 3I33A 1V4TA 2HBKA 4BVPA 3T19A 3C7NA 3HM9A 1W7AA 1NMNA 3FZKA 4F2RA 4CF1A 2XY6A 2W6LA 4CZJA 4F2SA 3I55N 4FK0A 4YOYA 2ASMA 3F9KA 2D0AA 4JYAK 1VSFA 2F4VK 1RTJA 2E88A 1N5YA 4JRQA 2A40A 3ID6A 1VSIA 1M1KO 1WOQA 1OH8A 3ENHA 3T7ZA 1BL3A 3L2QA 4JHDA 3Q7CA 3R1XA 2AA4A 3HI0A 3MEEA 4DLEA 4AHSA 1TAQA 4WF9L 3L2UA 3E9OA 3PLAA 1CZBA 2HW3A 1YVNA 3D45A 3ITHA 1BUPA 3MMVA 3KD1E 3DLGA 3RTVA 4KH4A 3RRGA 4YOVA 5CYMA 1KC8O 1FKPA 4CHYA 2IOCA 4JS4A 4FJ5A 3WXKA 2PAVA 1DTQA 3SUOA 3NHGA 3VGKA 2OPPA 1NM1A 4B9NA 3VEOA 3V6DA 4DSIA 4WFAL 4DU1A 2YNIA 4OX9K 2ZQBA 1TL3A 2E6MA 4CJWA 1A5XA 3R9PA 2IIRA 3HZ6A 3DXMB 4O4GA 5A2QO 3AAQA 4IFVA 2P9PA 3I56N 4CZEA 5M1KA 2BH1A 3VQEA 3FFIA 5AQKA 3ZSVA 4Z0UA 4BE0A 1HMVA 3TAEA 3QIPA 1KLNA 2IAJA 4EHTA 1JLCA 2A3ZA 3CCVN 5AQJA 4H0PA 3FZMA 4KHQA 2RN2A 4BQZA 3CCSN 1NK0A 5AFUH 3CCJN 2WBNA 5HOOA 4DV5K 2F7TA 1A5VA 3HYFA 3H1VX 1L3SA 4ISFA 3UE5A 4B1ZA 2HVHA 3LZJA 3VQ4A 3S9HA 3CFPA 5LY3A 4C8LA 1NKCA 1DGKN 2RKIA 1LAWA 1C6VA 4CZKA 4Z4EA 1RTIA 1T3VA 3RSEB 1KFDA 1GOCA 4JKHA 2P9SB 3OW2M 2A1RA 2NRVA 3JAMO 1KD1O 1N8RO 5AQUA 3WT0A 4KTQA 1XC3A 3RMDA 3R6MA 2OCEA 1ZBIA 3THVA 3TAMA 2V7YA 4JKGB 4ID1A 4WQ4A 3THXA 1J54A 3HSCA 5AQOA 4CF8A 4BGAA 3OYFA 2E2QA 1R0AA 4CK2A 2FC0A 1LW2A 1S9GA 1FKOA 1QZ5A 3SAHA 3EZWA 4KI4A 4WFBL 4E3SA 4B9MA 1SKRA 1X9WA 3AA2A 3P4IA 3HK2A 4IJAA 4PL8A 4FSVA 4DR6K 3AVMA 3L3VA 3B6OA 4CZFA 3N4PA 5AQZA 3T3FA 4MLHA 3ZETB 4Z4HA 1U2VA 3ZSWA 2OTJN 1X3MA 4H0OA 4H5NA 1BCOA 2XHBA 4NXMK 2O8FB 1U47A 4DUZK 3V4IA 1U4BA 3ATVA 4W5QA 4DQRA 4H5TA 3LDPA 5AQLA 2HBMA 3AGRA 1NJYA 3LWMA 1S1TA 4FJHA 4LF4K 4OKJA 4NYFA 4GMJB 3LL3A 4LSNA 4OLAA 5CHIA 3LP1A 4CBUA 3KD5E 3SLCA 1QSYA 4BVOA 4DSFA 4Y1DA 2D1KA 2E8AA 1HQUA 2A6AA 4Z4CA 4AH9A 2KFNA 1HR0K 3TSQA 3HM8A 2O8DB 2HBJA 3AA4A 3PSFA 4H5VA 4LY7A 3VF4A 5HBMA 3CYMA 1T03A 2IGIA 4CHOA 4W5NA 1D9FA 2A1SA 4DV0K 2OPRA 3U9ZA 1JXBA 4WFNL 4OPJA 3UKUA 1N6QA 1RDDA 1NJWA 2I7PA 2ZJRL 1ASUA 3O80A 1U49A 3VEZA 3AVBA 1EKEA 3C6UA 4FOEA 3V1OA 4R5PA 4BGBA 3DWLA 3ENBA 3D0PA 4CFAA 3NDKA 3AVCA 1WSHA 4G9ZA 5SWMA 4CJFA 1C0MA 1TL1A 3TAPA 4QS8A 4DR1K 2E2PA 5BPNA 3T1HK 3ZSZA 3S41A 3LWLA 1EWQA 2WC9A 1JCEA 3HOSA 3C65A 4EZ9A 3H1QA 3EZ5A 1BI4A 4JI8K 4NCBA 2X78A 4B08A 1MDUB 3ZSRA 1HKCA 4JK7A 4V19S 3PX0A 5CY4A 1NGHA 5I3UA 3AVAA 3NAEA 2E20A 3EE8A 3CF5L 2EWSA 1NK5A 1NGGA 4DV1K 3TI0A 4PKHA 1KXPA 1QSLA 3PY8A 4KO0A 1NGJA 1RDWX 4RW6A 4BDPA 2F8TA 3EEQA 5HRRA 1ILYA 1QQNA 1XNQK 2XY8A 4B9SA 3E1YA 1QS4A 1S6QA 1RCHA 2HB5A 3HRGA 2BUPA 5C12A 3M8RA 4JEPA 3FZHA 4B9UA 3N4QA 4FM0A 4IO8A 1TKZA 2QTDA 2D0BA 1E4FT 3SBTA 5I42A 4NXNK 4GW6A 5MLCQ 3TTCA 4DV4K 5HL7L 3JSMA 4CGGA 3A2FA 2GELA 4YFUA 3VGLA 4BRLA 4YOXA 1XUPO 3MN7A 3VF2A 3SZ2A 3E01A 3MDQA 2JWKA 1WN7A 3BF1A 1IBKK 1KRPA 4CJKA 4EFHA 2W40A 4HHTA 1RT7A 2BGGA 1JLQA 5FPDA 2Q1NA 4DKWA 2PZSA 4I6MB 1QZ6A 1ITGA 3NF9A 3RMCA 1TGOA 1BIUA 4M3WA 3A5OC 4ILHA 4ILJA 4I2PA 4RW9A 1X3NA 2Q2RA 1SS6A 2GUIA 3PO4A 2HOEA 1WBBA 4CF2A 1KAXA 3C6AA 4CEZA 1K6YA 1XWLA 4JKAA 3VEVA 3D2FB 3O1WA 3NGZA 5J2NA 4DR2K 1WUAA 4F9OA 4JI0K 4LF9K 2O8BA 4CZIA 3SV3A 4A61A 1B9DA 4AHTA 3C95A 4KHYA 4CW7B 3KK3A 4FCYA 4B1UB 1FK9A 2Q3SA 4MLEA 3U4LA 3O9RA 3CJBA 3VQPA 4BRCA 2CH5A 3O4NA 4B8CA 4WQ5A 4ELUA 2LSNA 4BRGA 1KAYA 1TYQA 1XMOK 4KB1A 5AQFA 3WEEB 5JLHA 4L8RB 1FXXA 1C0GA 4CESA 3DLLL 4DU3A 1JL1A 3KHYA 4FWRA 4DF8A 4A62A 2XRIA 3KKRA 1W0HA 1Q9XA 4UY8O 3C94A 2YKMA 1P90A 2W41A 3O3GA 2ZD1A 1D9DA 4HUGA 2DFEA 3SNNA 3QFUA 2VGMA 3IRXA 4U7BA 3KLIA 3NGYA 4BR2A 1NK9A 3NF6A 2FSKA 3ULEA 3C6TA 4MDBA 4FWQA 5C0YA 4O0IA 1I39A 4GKJK 1HNIA 3VEWA 3E9LA 1RT4A 1TK5A 4CEOA 5BPMA 5BREA 5C24A 3O3HA 5AQIA 1N32K 4H0XB 4AHVA 4JI7K 3P38A 4E1NA 1BDGA 3VTHA 1KVCA 3QEXA 3CC4N 3TTFA 4OO1J 3A5LC 2IVNA 3KIOA 3D2EB 5CYQA 4BC5A 1U48A 1SKSA 4HUFA 1Q18A 4PL7A 4EHUA 1CXQA 1ZBUA 3QLHA 1VRTA 5BRHA 4DSKA 3O4QA 3CD6N 1NGEA 2QWLA 2FSNA 4KHPK 1HNWK 1O13A 4PKGA 4JKCA 1OH6A 2GUPA 2ZE2A 2ZJPL 2B6AA 1EXQA 5HP1A 3C7NB 3VQ9A 3SBGA 3S3NA 1EX4A 3AGKA 4KI6A 3J7AP 3H08A 3ZSQA 2HHXA 4PY5A 3DMJA 2F96A 4IKFA 2IC3A 5AQTA 4HVJA 1TKDA 5F0XA 3OBYA 2X6NA 4DMNA 4KBOA 1QVFM 4E7JA 3KLHA 5AQPA 4M3YA 4KRFA 3AAPA 3CQXA 1YI2N 4DTUA 2BTFA 1X1PA 1RDBA 4DTPA 2D0CA 4YNQA 1JCFA 4E7IA 2FBXA 3THWB 4X64K 4AHRA 1VSDA 5TKYA 4DR7K 2YKNA 4YOTA 3OYAA 4FWPA 3ZYYX 4YHHK 2QXLA 2NNWA 3IG1A 4CZGA 1VQON 3QMLA 3WQUA 3TSUA 4B3SK 1SV5A 3DXKA 3FR0A 1MWMA 3B8AX 1S1VA 4CCHA 1YJNN 3MX5A 1ATSA 3QNOA 4IOAL 5J2QA 5AQWA 1RTDA 5KPRA 3NMUA 1HYVA 1W97L 5AQHA 1WSIA 3F5TA 4FZXC 3QEIA 1YAGA 5M1OA 3ZEUA 4GV3A 3R3LA 1MU2A 1RDAA 4K42A 2P9IB 1NMDA 4X66K 2JGUA 4FLUA 3K5LA 4OGCA 2FF3B 1SL2A 1SQKA 2KHOA 3QIOA 2CGKA 3QESA 2HMPA 3TAQA 1OVYA 5J1EA 4ISGA 3VOVA 4KREA 3MK6A 5EVZA 4O8UA 1DEJA 1P8ZA 5AQRA 1J53A 3AO5A 4DR5K 3TAFA 1NK4A 1RBRA 1C0TA 4E1MA 4BR4A 3OBWA 4ELTA 4IXCA 3OYHA 2PY5A 3SUQA 4GV9A 2VCPA 3ZCMA 4NLBA 3DM2A 4QS9A 4AQYK 1HRHA 5FRNA 5J2MA 3SUPA 4LF8K 3ATUA 1O1WA 3ZT1A 3KLGA 1GLDG 3NH2A 3MXIA 1HLUA 4M63C 1S1UA 3PSIA 4FL9A 5M1NA 3CPWM 4CK1A 4LFBK 1D5AA 2G8IA 1HYZA 3VEXA 3TWHA 4CEDA 1Y97A 2P9UA 1QQMA 3LAKA 3GBTA 3LP0A 1BISA 4YDUC 4JKDA 4MO4A 1NLVA 3KK2A 3IUCA 4W5RA 1T8EA 3CFRA 3WNFA 3VA3A 3QEWA 4KH5A 3QICA 3BDPA 3CJ9A 4IG0A 3OJUA 3SK3A 3I8BA 4H5RA 4OPKA 1CZAN 5GAHP 5C2FA 3W3DA 4CGJA 3M6GA 4CD1A 3H3OB 1YVUA 1UA1A 4FLWA 1S6PA 4LF6K 4PA1A 5H1SQ 4CJPA 1IKWA 3A5MC 3T1YK 4LH5A 1ZYQA 5DK5A 2VQFK 2VG6A 1JL2A 1W9HA 3TAGA 3QB0A 1JLFA 5D3GA 4BQLA 1L3TA 4DTMA 3CIPA 3UB5A 1Z26A 1EWRA 3AVNA 3HJFA 1X9SA 3WXIA 3ULDA 3IKMA 1U2VB 1N36K 5AQXA 1WSGA 3VESA 4BR9A 4O0JA 4JD2A 3LM9A 1BU6O 2KTQA 4C23A 3NVMA 2XY7A 4DQPA 4MDAA 3O9UA 4MQ3A 2B4JA 3H6EA 3QBXA 2ITMA 2BE2A 3O4WA 3GG4A 5AQVA 4JV5K 1NJZA 2UXCK 2UUBK 2BDPA 3I0SA 4CEQA 1R59O 2ASPA 4BRMA 3TPQA 3Q7BA 5EXWA 3OYBA 3VTIA 4FJLA 3OS0A 5F2RA 4LF5K 2VWKA 4XH1A 2G8UA 1CLQA 2E2NA 4C8MA 3ZT2A 4CIEA 1C1BA 2ETJA 4GVMA 3ZX3A 2NRWA 4PUOA 2UXBK 1NBWA 3BP8A 5ELZA 5DM7L 1U6ZA 3ALYA 5KQDA 4M3XA 4B1XB 3CCMN 3PX4A 1QVGM 2HNDA 5KQ8A 1VQLN 2G8FA 2GX9A 4JI5K 4CEFA 4FJ8A 1VSMA 3QNNA 4C8KA 4C1NK 2BANA 4AF1A 3TABA 4CJ5A 3O5BA 2IVOA 4L3QA 3K58A 4M41A 1QE1A 2Z1GA 5J2PA 3CERA 3V9XA 4F3OA 2WFBA 2Q0RA 3TARA 4CJRA 3CC7N 3O3FA 5KRSA 2DTUA 4AHCA 1VQMN 4DV6K 4OKEA 3E66A 1T6DA 1J6ZA 3HPHA 1YITN 4CBXA 2F8SA 3KZBA 4J2BA 3OHRA 5AQMA 1NNEA 4LFCK 5GINA 3P39A 5FPMA 3DYAA 1GLLO 3AARA 5GIPA 1CZ9A 2E1YA 3NF7A 3CCLN 3P1GA 4E1JA 3IMXA 3U8XA 4J2EA 5B8HA 4FJKA 4FZZA 2DFHA 3DXMA 1Q81O 3L3UA 3AA5X 4BC4A 4K0KK 1JKHA 2OZMA 2UUAK 1JLBA 4DTSA 1OVQA 4F4KA 5FROA 4CJVA 4GV6A 4BRDA 5FPEA 1GOAA 3KJVA 3CMEN 2YNGA 3RWUA 1IJJA 4LH4A 3TTDA 2E6LA 1GLBG 3J7YP 3ZX2A 1MWKA 4A59A 3J7ZO 1YHQN 4BACA 4FJ9A 1YIJN 4KHNA 3CCEN 3PIOL 1HQEA 1EQYA 5E26A 1QSSA 2QKKA 4CJTA 2G8WA 4TSXA 1L3UA 4H8KA 4BROA 4FJXA 4BRFA 5FLXO 4JAXA 4I2QA 5E84A 2VWJA 1C1AA 2NUBA 1QQCA 3VQ8A 3MXJA 1K8KB 4BRIA 2FBVA 1BA1A 1ZXOA 2IS3A 3BGRA 3VN5A 3NVKA 4H0TB 2HHVA 1VQ7N 3P5JA 3RSEA 2DPNA 3GL1A 3T69A 2P9SA 3MWPA 1G99A 3EYZA 2FBYA 3LZIA 1XI1A 3VA0A 4JI4K 4FWSA 3EY1A 4JKGA 1BCMA 3LPTA 3A8YA 4CJUA 4DQSA 1QQOA 4CJEA 4DFKA 3VENA 4CHPA 5EU7A 4FYDA 3MCAB 1KVAA 4NLCA 3PV8A 1OH5A 5E41A 1CXUA 2ZGYA 4B3RK 5AR0A 1VQ6N 3VQAA 2YJEA 5TKWA 4OVLA 3OA9A 2DY4A 3RVCA 1YT3A 5ADXA 3BUZB 3AVIA 1Q7YO 4N5SA 2P9LB 4JNEA 3OYNA 3JXUA 1WAJA 3F2KA 3ZETA 3IS9A 2VG7A 2G8KA 1FJGK 4EP4A 1TYQB 2CGJA 4O44A 1ATRA 4JI6K 4DTNA 2O8FA 4LC9B 2RPIA 1VAZA 1IKVA 5AZJB 2D5RA 3TR8A 4MFBA 1M90O 4IO9L 3ZT0A 4K43A 1WLJA 4K8XA 1HNZK 3CM6A 1QHTA 4FLZA 1HNVA 3CCQN 1UWBA 2P5OA 4O8KA 1NWKA 3HPGA 1IKYA 1HKGA 4CJQA 3V9UA 1TK0A 3THYB 4FJMA 2QA4N 3LAMA 2QWRA 4H0VB 5JS2A 5JVGL 2P1JA 4JLHA 3VQ7A 1NOYA 2ZM6K 2E1ZA 4B9QA 2O8DA 4DB3A 4AILC 2YI1A 4DFMA 1KFSA 4JS5A 4IDKA 3O1BA 4AHUA 4DQQA 3DJCA 4KKOA 1KQSM 2Q36A 3S3MA 3AA3A 3EN9A 3HVTA 4B8AB 3HT3A 3H3NO 2Y1IA 3VQ5A 1WBDA 1NGAA 2CGLA 4EZ6A 4DTJA 3ISNC 1RBTA 4RWTA 5HROA 4FW2A 3P31A 3OYIA 5KPTA 4BR0A 1RNHA 2KZMA 2GEMA 2V51B 1NGIA 2V52B 4ICLA 3CETA 1KCFA 2KZZA 5EOYA 1L3VA 2P9KB 4W5OA 4B3MK 1I94K 1UOCA 4M7YA 3UKRB 3OYGA 2NRHA 3DRRA 4OLBA 4DV3K 3S3OA 1NK7A 1NJXA 2R7YA 2HSTA 2O8EB 5AQQA 5I9EB 3K5MA 3M3ZA 5AZIB 3SMPA 3OYKA 1KSPA 2P9NB 4FLVA 2G8VA 4JI3K 1TAUA 4IFEA 3NH1A 5HRSA 1BQMA 4CFDA 1OKJA 2HHUA 5GAEP 4EIAA 3GE1A 3CG7A 4FLXA 3DXKB 4B9LA 1RT6A 5AQGA 5DM6L 2WTUA 4CGHA 4IBNA 4DTOA 3J80O 1IO2A 3AV9A 4M3RA 3WNHA 4CVNE 5LMNK 3VPZA 2WONA 4NO7A 3AY9A 3I8DA 4KFBA 1YJ9N 3FLCO 4CHNA 1SAZA 3BY5A 4DG1A 2ATQA 4RW4A 1OH7A 4BRQA 3IFRA 1U04A 3L4IA 5CR4A 1LWCA 4A2AA 2KLAA 3NCIA 3WXMB 4CE9A 4B3TK 1J5EK 2CH6A 4I6MA 1D8YA 3CM5A 4W5TA 4BE2A 1IBLK 1BO5O 5C15A 2HNZA 2VWBA 1HYSA 1ZBFA 2GV9A 4YDUA 1NGDA 4BDYA 2JWLA 3TANA 4E7LA 3G25A 4X65K 3W0LA 4BC3A 3D2FA 1NJIO 4FPBA 4C8OA 5LJWA 4F8RA 4UQGA 4NB4A 4DS4A 3TSPA 5GIOA 2E2OA 3L8BA 3HVRA 3MN6A 3WXJA 3KTQA 1HJOA 3CFOA 4JHDB 2W6KA 4CBWA 4JKBA 3O9TA 3G0ZA 3WEEA 1Z25A 2VG5A 3F73A 1XC9A 1VHXA 4FW1A 4O5FA 4KHSA 4BR5A 4CERA 1L5UA 1LV5A 4K25A 2QEXN 3QFPA 4JN4A 3VGMA 2YHYA 4JK9A 4CHZA 4DSJA 2UUCK 2RHKA 3FE1A 3UIQA 1HUXA 5SZTA 4HCBA 4CEBA 2FLOA 2OA8A 2H3GX 5FRMA 1RT5A 5T7BA 4ISEA 4H5WA 3RMBA 2VQEK 5KGWA 3LDNA 3LP2A 4EAHD 4M42A 5JVHL 4HWIA 2E4LA 5BR8K 1SUQA 4FOIA 2O4IA 4CZHA 4BRNA 3MN5A 3H45C 1DT9A 1TVRA 3E9PA 4JRPA 4E0DA 1TKXA 5CZ2A 3VMFB 3A5NC 1VQPN 2OPSA 4M7XA 2P9PB 4DR3K 4B3OA 3DRPA 1ZC6A 1RBVA 2W42A 3K5OA 1TK8A 3O9QA 1HPMA 1Z05A 2NRTA 3SQ0A 2YNHA 2RF2A 4K41A 1GLJO 3D2EA 1GOBA 1WB9A 4DFPA 2Z1HA 1GLCG 3OJSA 3O9SA 5KGXA 3V9ZA 2PFUA 3LPUA 1K9MO 4GNIA 2F9WA 1ASVA 1JXEA 4AM6A 3LANA 4QCLA 2QWPA 4FK2A 3GOIA 1I3AA 3AVGA 3C0BA 2VGNA 5KTQA 3H46O 1C0UA 3K0SA 4DV2K 3QDKA 1VSJA 5KRTA 4FWOA 4IOXA 1VQ5N 1NK8A 3HSTB 3KWIA 5K14A 3SV4A 1NGBA 1BIZA 1W2BM 1C0FA 3O08A 3L6QA 5JMVA 3KK1A 4A57A 3OVNA 3AVLA 3MX2A 4CECA 4Y0WA 3EO3A 4U67L 4IDHA 3THWA 3THXB 2HF4A 4A2BA 3GDQA 3KKSA 1Q9YA 2Q97A 4DQ8A 2QXFA 4MO5A 5C2DA 1ZBHA 1VRUA 2EHGA 2A5XA 4IWVA 4CEAA 2O8CA 5BN8A 3CJ7A 4LSLA 3DLRA 1MA9B 4BE1A 4A5AA 3T1AA 4FXDA 3QBWA 3HTVA 5HRPA 1IBMK 2QKBA 2HMIA 2ZJQL 3BZCA 4E7KA 1BG3A 4IJNA 2QWOA 4ID5A 3SPZA 4QS7A 3DOLA 1WSJA 2ZF5O 1HPZA 1FW6A 2NLXA 1LAVA 5JS1A 3OYJA 1NGFA 3MAQA 1VSLA 2Q31A 3EE9A 1IKXA 1T05A 4BY9C 2UYTA 4H03B 3PO5A 3ZX0A 3SQ2A 1F21A 3PX6A 5AQNA 4CIGA 1K8AO 2P9IA 3DLBA 4FK4A 4CZLA 4DHYA 5GAGP 2UU9K 4LF7K 4NYNA 2HHQA 4CGFA 1XNRK 3SQ1A 2YHXA 3U9DA 3AVHA 4DR4K 3DLKA 1A5WA 1JLEA 3EKSA 3AO1A 3RR7A 5ADXH 2HF3A 2HVIA 4OJRA 2KQ2A 4KB0A 3ASMA 3M1FA 1SZ2A 3SAGA 2AJQA 4KTZA 4FJNA 3B6PA 1VQNN 4GVEA 3V81A 5AQSA 3L2RA 4BRHA 5BR9A 5LJVA 1GLAG 3LDOA 1E4GT 3JS6A 3K5NA 3CJ1A 3R8EA 1KTQA 4BC2A 4RW7A 4B9TA 4BREA 3FZLA 3WQTA 3U6FA 2YV0X 4Z4FA 2NRXA 4XEIA 3O8MA 4KAZA 2KW4A 4WYBA 1KLMA 3UKUB 1J9AA 4B1YB 2OZSA 1S9EA 2D0PA 2A41A 3ZSYA 4ZTFA 4IFYA 3HBTA 2OANA 2FF6A 4BG8A 1UAXA 3CXCM 3HPOA 3F9MA 4E19A 3SQ4A 4EP5A 3MN9A 1TUUA 3EL2A 1NKEA 1RBSA 1ZBSA 2YJFA 4HUEA 4CF0A 1JLAA 4YOUA 5IWAK 1RFQA 4FO0A 4BRPA 4FVMA 4G1QA 2ASOA 3DRSA 3QEVA 1RGIA 5M1PA 3TU5A 1YF5L 3V1RA 4DUYK 1BI4B 2QWMA 1WSEA 2YNFA 5GADP 3M5RA 4JI2K 3L0QA 4NCGA 3KWGA 3NF8A 5CZ1A 4DSEA 1N33K 4NCAA 3CJAA 1ZBLA 3HP9A 3VQ6A 3QO9A 3QETA 3M8PA 1BQNA 4O55A 2EX3A 4DS5A 1BA0A 3AVJA 4CK3A 1IH7A 5LL6Z 4N47A 3AVKA 4QOZB 2X74A 4N56A 1RDUA 3MEGA 1JJ2M 1SL1A 3BF3A 1RDCA 3OYCA 2I7NA 5F1XA 4AM7A 3CCUN 1U45A 1S22A 4Q5VA 1BOTO 4IOCL 5KPZA 1S1XA 4C8NA 3BZKA 3IDHA 1LWFA 3SAFA 1VK0A 3KLFA 4Z4GA 1KVBA 3SJHA 1HX1A 1NG9A 4CFBA 3AO2A 1SKWA 2HBLA 4WE1A 5BN9A 1BGXT 3SYZA 3VQBA 3I0RA 3SI6A 4DTRA 5IT9O 2D0OA 3K59A 3WUHA 4M3ZA 3O6WA 1NU0A 1X9MA 1YUWA 3SMSA 2HNYA 4K8ZA 4CD3A 3VQDA 2NRZA 1N34K 1E3MA 2Z1JA 1VSEA 1XQSC 4FJIA 4I9LA 2QI2A 3AVFA 1SL0A 3LP3A 3CQYA 3FFKB 4J2DA 3HL8A 2HHTA 2Q0UA 4IEIA 4DLGA 3V9SA 4DV7K 1IG8A 1YJWN 2OPQA 4JKFA 4LD0A 3VERA 3G4SN 2E5LK 4FPAA 3RRHA 2O8BB 3G6EN 2I5JA 2HHSA 1TUYA 3OY9A 1DLOA 3SCXA 3RMAA 1WSFA 2VYPA 3J8AA 4FM2A 3CI5A 5EY4A 1GLEG 4WQ4C 3CJCA 5AFUA 1XHXA 4KHUA 1X9JA 3MCPA 4BRKA 1B9FA 5FDLA 1GLFO 5BRFA 3VETA 4CJSA 3L2WA 2A42A 1RILA 3V9WA 2PYLA 3L4QA 4BR7A 1YTAA 3KLEA 1Q82O 4BG9A 1QHAA 4JKEA 3OS1A
chains in the Genus database with same CATH topology
4LF7K 4DR2K 4JI0K 4LF9K 4LFBK 2UXBK 5LL6Z 2HHHK 1XNRK 4CW7B 4DR4K 4DR1K 4B3TK 4DR6K 1J5EK 3T1HK 1HNXK 4JI5K 4JI8K 1IBLK 3J81O 4JI4K 1XMOK 4OX9K 4V19S 4X64K 5A2QO 4DR7K 4NXMK 4DUZK 4X65K 1XMQK 4YHHK 4DV2K 2UXDK 4B3RK 3OTOK 4JI1K 4DV1K 4B3SK 5IT9O 4LF4K 4LF6K 4DV6K 3T1YK 4B3MK 2VQFK 1I94K 1XNQK 1N34K 4YY3K 5AJ3K 4LFCK 4DV5K 4DV3K 1FJGK 4GKJK 1N36K 4DV7K 4NXNK 4JI6K 4DV4K 4X66K 1N32K 4K0KK 1HR0K 4JI7K 4JI3K 2UUAK 2E5LK 4LFAK 2UUCK 4GKKK 5IWAK 1IBKK 1IBMK 2VQEK 4DR5K 4DV0K 4JYAK 3JAMO 1HNZK 2F4VK 3J7YP 4JV5K 2UXCK 3J80O 4DUYK 2UUBK 4CVNE 4X62K 5BR8K 5LMNK 4KHPK 1HNWK 4JI2K 4AQYK 4LF5K 4LF8K 4DR3K 1N33K 5FLXO 5LMUK 2ZM6K 3J7AP 2UU9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 K;  4DR2 K;  4JI0 K;  4LF9 K;  4LFB K;  2UXB K;  5LL6 Z;  2HHH K;  1XNR K;  4CW7 B;  4DR4 K;  4DR1 K;  4B3T K;  4DR6 K;  1J5E K;  3T1H K;  1HNX K;  4JI5 K;  4JI8 K;  1IBL K;  3J81 O;  4JI4 K;  1XMO K;  4OX9 K;  4V19 S;  4X64 K;  5A2Q O;  4DR7 K;  4NXM K;  4DUZ K;  4X65 K;  1XMQ K;  4YHH K;  4DV2 K;  2UXD K;  4B3R K;  3OTO K;  4JI1 K;  4DV1 K;  4B3S K;  5IT9 O;  4LF4 K;  4LF6 K;  4DV6 K;  3T1Y K;  4B3M K;  2VQF K;  1I94 K;  1XNQ K;  1N34 K;  4YY3 K;  5AJ3 K;  4LFC K;  4DV5 K;  4DV3 K;  1FJG K;  4GKJ K;  1N36 K;  4DV7 K;  4NXN K;  4JI6 K;  4DV4 K;  4X66 K;  1N32 K;  4K0K K;  1HR0 K;  4JI7 K;  4JI3 K;  2UUA K;  2E5L K;  4LFA K;  2UUC K;  4GKK K;  5IWA K;  1IBK K;  1IBM K;  2VQE K;  4DR5 K;  4DV0 K;  4JYA K;  3JAM O;  1HNZ K;  2F4V K;  3J7Y P;  4JV5 K;  2UXC K;  3J80 O;  4DUY K;  2UUB K;  4CVN E;  4X62 K;  5BR8 K;  5LMN K;  4KHP K;  1HNW K;  4JI2 K;  4AQY K;  4LF5 K;  4LF8 K;  4DR3 K;  1N33 K;  5FLX O;  5LMU K;  2ZM6 K;  3J7A P;  2UU9 K; 
#chains in the Genus database with same CATH topology
 1TKT A;  4KHW A;  4PKI A;  4WCE L;  1IV0 A;  3A0I X;  3OYM A;  4YOR A;  2RE2 A;  2XY5 A;  2WUS A;  4ILG B;  4FLT A;  1S5J A;  3NGI A;  3ZLJ A;  4M3U A;  1T6C A;  4FWM A;  5HRN A;  1D4X A;  3BEX A;  3HXM A;  1HNX K;  2KFZ A;  4CGI A;  3ULE B;  1RT3 A;  4OPH A;  4H4M A;  4RW8 A;  3MED A;  4ZTJ A;  1YTU A;  2PYJ A;  4DF4 A;  3CCR N;  3CMA N;  4CEE A;  1Q86 O;  1KAZ A;  3D6R A;  1DKG D;  3DLE A;  3ZT4 A;  1EO1 A;  4N76 A;  2P51 A;  5KI6 A;  2OYQ A;  2UXD K;  4CFC A;  2QWN A;  1EET A;  4RG8 A;  1S72 N;  3CPE A;  1K8K A;  4BWJ A;  3SJJ A;  5C25 A;  4DCH A;  3M8S A;  4FLY A;  2YHB A;  2IDO A;  1K73 O;  4XH4 A;  4ZHR A;  3LDQ A;  2GWK A;  2YCH A;  1T44 A;  1VQK N;  4BDZ A;  3PUF A;  4FWL A;  3KK7 A;  1QTM A;  5EX5 A;  4BWM A;  3CHW A;  4XH5 A;  4H4O A;  2F9T A;  1DTT A;  3DAW A;  1XHZ A;  3FGU A;  4E7H A;  2HHW A;  2B5J A;  4RCH A;  3G71 N;  1ESV A;  4M3T A;  1G15 A;  2XO7 A;  1NGC A;  3LM2 A;  3IAY A;  3OYD A;  2Y1J A;  4LFA K;  1VQ4 N;  4IG3 A;  4RTF D;  1NK6 A;  4J2A A;  1VQ8 N;  1EP4 A;  4I9Q A;  2PBD A;  3U3Y A;  2AP1 A;  2FSJ A;  5JIC A;  4YOW A;  3DI6 A;  3WNE A;  2DFF A;  1Q8I A;  4C1N I;  2QM1 A;  4CGD A;  3AO4 A;  3K9K A;  2P9L A;  3M8Q A;  1RTH A;  4HTL A;  4FWN A;  1YXQ A;  4Q0B A;  4A5B A;  3FZF A;  4QAG A;  4Z4I A;  3ID8 A;  3G10 A;  2Z1I A;  3NFA A;  3WNG A;  3U3G A;  1IG9 A;  4FZY A;  5LMU K;  3LAL A;  2V7Z A;  2GTD A;  3QIN A;  5AQY A;  4DFJ A;  5C42 A;  4N41 A;  5AZJ A;  1Y64 A;  4H0Y B;  3VQQ A;  1NOZ A;  1UA0 A;  2ITG A;  2HHH K;  2OTL N;  4CHQ A;  4PQU A;  3WXL A;  3ZSX A;  4PHT X;  3MEC A;  1REV A;  2O4G A;  3ZSO A;  4DTX A;  2G8H A;  3J81 O;  1VQ9 N;  1JLG A;  4BRA A;  2ZWH A;  2P5G A;  3ZEU B;  1HKB A;  5C10 A;  4B1W B;  3THY A;  1V4S A;  3DOK A;  3OS2 A;  1BWF O;  3NE6 A;  3K57 A;  3PIP L;  4CZM A;  2GWJ A;  4GY2 B;  2NZT A;  1LCU A;  2X6S A;  4OPA A;  3OTO K;  4KTW A;  4R79 A;  4FWK A;  1HJR A;  3VEY A;  4FJ7 A;  2YX6 A;  5M1Q A;  4J8F A;  3K9J A;  4FJG A;  2QW9 A;  1S1W A;  2JLE A;  4B9V A;  2J4R A;  4YY3 K;  2FXU A;  4HCC A;  1RT2 A;  3QEP A;  1VSH A;  4CI6 A;  3NH0 A;  5HLF A;  4XIU A;  3MXM A;  3EKU A;  1LW0 A;  3L2V A;  3D7E O;  3DLH A;  4I7F A;  4DU4 A;  2YHA A;  4GKK K;  4IZ9 A;  3HO1 A;  1ASW A;  1BHL A;  3CC2 N;  2YHW A;  2P9K A;  2P9U B;  1TV6 A;  1VSK A;  2D4W A;  3LDL A;  4CJL A;  3OYE A;  4OGE A;  2NRR A;  3ZT3 A;  3CQ8 A;  3UKR A;  4F3T A;  1NKB A;  4X62 K;  4O5B A;  4B1V A;  4FVU A;  3V1Q A;  4M45 A;  2QWQ A;  2O8E A;  3OYL A;  1WAF A;  1S3X A;  5AZI A;  3QER A;  4KPY A;  5FPN A;  2P9N A;  4CJ7 A;  3RR8 A;  4HTU A;  1JCG A;  1RBU A;  5BRD A;  3HP6 A;  4WQ5 C;  1B92 A;  1C1C A;  3P83 D;  2O8C B;  1LOT B;  2GBZ A;  1T7P A;  2KKZ A;  2FBT A;  2WOM A;  3K2P A;  1Z6R A;  5CE3 A;  3NBP A;  4Y1C A;  1J5O A;  4DSL A;  1WNS A;  4FM1 A;  5BPL A;  4KV8 A;  4CF9 A;  4Z94 A;  3JYT A;  1H1V A;  3KVG A;  3C6H A;  4KH6 A;  4IEE A;  4DQI A;  1RT1 A;  5DMR A;  4ELV A;  4JD2 B;  4E89 A;  1XMQ K;  4DWI A;  2ZGZ A;  4JI1 K;  3ENO A;  3VQC A;  4JK8 A;  5JLF A;  3SPY A;  1ATN A;  4FJJ A;  3VF6 A;  4CJ4 A;  5M1F A;  3LDS A;  4PWD A;  4OKK A;  2QK9 A;  3AO3 A;  4CIF A;  3MWT A;  5AJ3 K;  4CJ3 A;  3HOT A;  3SUN A;  2IVP A;  1LWE A;  3I33 A;  1V4T A;  2HBK A;  4BVP A;  3T19 A;  3C7N A;  3HM9 A;  1W7A A;  1NMN A;  3FZK A;  4F2R A;  4CF1 A;  2XY6 A;  2W6L A;  4CZJ A;  4F2S A;  3I55 N;  4FK0 A;  4YOY A;  2ASM A;  3F9K A;  2D0A A;  4JYA K;  1VSF A;  2F4V K;  1RTJ A;  2E88 A;  1N5Y A;  4JRQ A;  2A40 A;  3ID6 A;  1VSI A;  1M1K O;  1WOQ A;  1OH8 A;  3ENH A;  3T7Z A;  1BL3 A;  3L2Q A;  4JHD A;  3Q7C A;  3R1X A;  2AA4 A;  3HI0 A;  3MEE A;  4DLE A;  4AHS A;  1TAQ A;  4WF9 L;  3L2U A;  3E9O A;  3PLA A;  1CZB A;  2HW3 A;  1YVN A;  3D45 A;  3ITH A;  1BUP A;  3MMV A;  3KD1 E;  3DLG A;  3RTV A;  4KH4 A;  3RRG A;  4YOV A;  5CYM A;  1KC8 O;  1FKP A;  4CHY A;  2IOC A;  4JS4 A;  4FJ5 A;  3WXK A;  2PAV A;  1DTQ A;  3SUO A;  3NHG A;  3VGK A;  2OPP A;  1NM1 A;  4B9N A;  3VEO A;  3V6D A;  4DSI A;  4WFA L;  4DU1 A;  2YNI A;  4OX9 K;  2ZQB A;  1TL3 A;  2E6M A;  4CJW A;  1A5X A;  3R9P A;  2IIR A;  3HZ6 A;  3DXM B;  4O4G A;  5A2Q O;  3AAQ A;  4IFV A;  2P9P A;  3I56 N;  4CZE A;  5M1K A;  2BH1 A;  3VQE A;  3FFI A;  5AQK A;  3ZSV A;  4Z0U A;  4BE0 A;  1HMV A;  3TAE A;  3QIP A;  1KLN A;  2IAJ A;  4EHT A;  1JLC A;  2A3Z A;  3CCV N;  5AQJ A;  4H0P A;  3FZM A;  4KHQ A;  2RN2 A;  4BQZ A;  3CCS N;  1NK0 A;  5AFU H;  3CCJ N;  2WBN A;  5HOO A;  4DV5 K;  2F7T A;  1A5V A;  3HYF A;  3H1V X;  1L3S A;  4ISF A;  3UE5 A;  4B1Z A;  2HVH A;  3LZJ A;  3VQ4 A;  3S9H A;  3CFP A;  5LY3 A;  4C8L A;  1NKC A;  1DGK N;  2RKI A;  1LAW A;  1C6V A;  4CZK A;  4Z4E A;  1RTI A;  1T3V A;  3RSE B;  1KFD A;  1GOC A;  4JKH A;  2P9S B;  3OW2 M;  2A1R A;  2NRV A;  3JAM O;  1KD1 O;  1N8R O;  5AQU A;  3WT0 A;  4KTQ A;  1XC3 A;  3RMD A;  3R6M A;  2OCE A;  1ZBI A;  3THV A;  3TAM A;  2V7Y A;  4JKG B;  4ID1 A;  4WQ4 A;  3THX A;  1J54 A;  3HSC A;  5AQO A;  4CF8 A;  4BGA A;  3OYF A;  2E2Q A;  1R0A A;  4CK2 A;  2FC0 A;  1LW2 A;  1S9G A;  1FKO A;  1QZ5 A;  3SAH A;  3EZW A;  4KI4 A;  4WFB L;  4E3S A;  4B9M A;  1SKR A;  1X9W A;  3AA2 A;  3P4I A;  3HK2 A;  4IJA A;  4PL8 A;  4FSV A;  4DR6 K;  3AVM A;  3L3V A;  3B6O A;  4CZF A;  3N4P A;  5AQZ A;  3T3F A;  4MLH A;  3ZET B;  4Z4H A;  1U2V A;  3ZSW A;  2OTJ N;  1X3M A;  4H0O A;  4H5N A;  1BCO A;  2XHB A;  4NXM K;  2O8F B;  1U47 A;  4DUZ K;  3V4I A;  1U4B A;  3ATV A;  4W5Q A;  4DQR A;  4H5T A;  3LDP A;  5AQL A;  2HBM A;  3AGR A;  1NJY A;  3LWM A;  1S1T A;  4FJH A;  4LF4 K;  4OKJ A;  4NYF A;  4GMJ B;  3LL3 A;  4LSN A;  4OLA A;  5CHI A;  3LP1 A;  4CBU A;  3KD5 E;  3SLC A;  1QSY A;  4BVO A;  4DSF A;  4Y1D A;  2D1K A;  2E8A A;  1HQU A;  2A6A A;  4Z4C A;  4AH9 A;  2KFN A;  1HR0 K;  3TSQ A;  3HM8 A;  2O8D B;  2HBJ A;  3AA4 A;  3PSF A;  4H5V A;  4LY7 A;  3VF4 A;  5HBM A;  3CYM A;  1T03 A;  2IGI A;  4CHO A;  4W5N A;  1D9F A;  2A1S A;  4DV0 K;  2OPR A;  3U9Z A;  1JXB A;  4WFN L;  4OPJ A;  3UKU A;  1N6Q A;  1RDD A;  1NJW A;  2I7P A;  2ZJR L;  1ASU A;  3O80 A;  1U49 A;  3VEZ A;  3AVB A;  1EKE A;  3C6U A;  4FOE A;  3V1O A;  4R5P A;  4BGB A;  3DWL A;  3ENB A;  3D0P A;  4CFA A;  3NDK A;  3AVC A;  1WSH A;  4G9Z A;  5SWM A;  4CJF A;  1C0M A;  1TL1 A;  3TAP A;  4QS8 A;  4DR1 K;  2E2P A;  5BPN A;  3T1H K;  3ZSZ A;  3S41 A;  3LWL A;  1EWQ A;  2WC9 A;  1JCE A;  3HOS A;  3C65 A;  4EZ9 A;  3H1Q A;  3EZ5 A;  1BI4 A;  4JI8 K;  4NCB A;  2X78 A;  4B08 A;  1MDU B;  3ZSR A;  1HKC A;  4JK7 A;  4V19 S;  3PX0 A;  5CY4 A;  1NGH A;  5I3U A;  3AVA A;  3NAE A;  2E20 A;  3EE8 A;  3CF5 L;  2EWS A;  1NK5 A;  1NGG A;  4DV1 K;  3TI0 A;  4PKH A;  1KXP A;  1QSL A;  3PY8 A;  4KO0 A;  1NGJ A;  1RDW X;  4RW6 A;  4BDP A;  2F8T A;  3EEQ A;  5HRR A;  1ILY A;  1QQN A;  1XNQ K;  2XY8 A;  4B9S A;  3E1Y A;  1QS4 A;  1S6Q A;  1RCH A;  2HB5 A;  3HRG A;  2BUP A;  5C12 A;  3M8R A;  4JEP A;  3FZH A;  4B9U A;  3N4Q A;  4FM0 A;  4IO8 A;  1TKZ A;  2QTD A;  2D0B A;  1E4F T;  3SBT A;  5I42 A;  4NXN K;  4GW6 A;  5MLC Q;  3TTC A;  4DV4 K;  5HL7 L;  3JSM A;  4CGG A;  3A2F A;  2GEL A;  4YFU A;  3VGL A;  4BRL A;  4YOX A;  1XUP O;  3MN7 A;  3VF2 A;  3SZ2 A;  3E01 A;  3MDQ A;  2JWK A;  1WN7 A;  3BF1 A;  1IBK K;  1KRP A;  4CJK A;  4EFH A;  2W40 A;  4HHT A;  1RT7 A;  2BGG A;  1JLQ A;  5FPD A;  2Q1N A;  4DKW A;  2PZS A;  4I6M B;  1QZ6 A;  1ITG A;  3NF9 A;  3RMC A;  1TGO A;  1BIU A;  4M3W A;  3A5O C;  4ILH A;  4ILJ A;  4I2P A;  4RW9 A;  1X3N A;  2Q2R A;  1SS6 A;  2GUI A;  3PO4 A;  2HOE A;  1WBB A;  4CF2 A;  1KAX A;  3C6A A;  4CEZ A;  1K6Y A;  1XWL A;  4JKA A;  3VEV A;  3D2F B;  3O1W A;  3NGZ A;  5J2N A;  4DR2 K;  1WUA A;  4F9O A;  4JI0 K;  4LF9 K;  2O8B A;  4CZI A;  3SV3 A;  4A61 A;  1B9D A;  4AHT A;  3C95 A;  4KHY A;  4CW7 B;  3KK3 A;  4FCY A;  4B1U B;  1FK9 A;  2Q3S A;  4MLE A;  3U4L A;  3O9R A;  3CJB A;  3VQP A;  4BRC A;  2CH5 A;  3O4N A;  4B8C A;  4WQ5 A;  4ELU A;  2LSN A;  4BRG A;  1KAY A;  1TYQ A;  1XMO K;  4KB1 A;  5AQF A;  3WEE B;  5JLH A;  4L8R B;  1FXX A;  1C0G A;  4CES A;  3DLL L;  4DU3 A;  1JL1 A;  3KHY A;  4FWR A;  4DF8 A;  4A62 A;  2XRI A;  3KKR A;  1W0H A;  1Q9X A;  4UY8 O;  3C94 A;  2YKM A;  1P90 A;  2W41 A;  3O3G A;  2ZD1 A;  1D9D A;  4HUG A;  2DFE A;  3SNN A;  3QFU A;  2VGM A;  3IRX A;  4U7B A;  3KLI A;  3NGY A;  4BR2 A;  1NK9 A;  3NF6 A;  2FSK A;  3ULE A;  3C6T A;  4MDB A;  4FWQ A;  5C0Y A;  4O0I A;  1I39 A;  4GKJ K;  1HNI A;  3VEW A;  3E9L A;  1RT4 A;  1TK5 A;  4CEO A;  5BPM A;  5BRE A;  5C24 A;  3O3H A;  5AQI A;  1N32 K;  4H0X B;  4AHV A;  4JI7 K;  3P38 A;  4E1N A;  1BDG A;  3VTH A;  1KVC A;  3QEX A;  3CC4 N;  3TTF A;  4OO1 J;  3A5L C;  2IVN A;  3KIO A;  3D2E B;  5CYQ A;  4BC5 A;  1U48 A;  1SKS A;  4HUF A;  1Q18 A;  4PL7 A;  4EHU A;  1CXQ A;  1ZBU A;  3QLH A;  1VRT A;  5BRH A;  4DSK A;  3O4Q A;  3CD6 N;  1NGE A;  2QWL A;  2FSN A;  4KHP K;  1HNW K;  1O13 A;  4PKG A;  4JKC A;  1OH6 A;  2GUP A;  2ZE2 A;  2ZJP L;  2B6A A;  1EXQ A;  5HP1 A;  3C7N B;  3VQ9 A;  3SBG A;  3S3N A;  1EX4 A;  3AGK A;  4KI6 A;  3J7A P;  3H08 A;  3ZSQ A;  2HHX A;  4PY5 A;  3DMJ A;  2F96 A;  4IKF A;  2IC3 A;  5AQT A;  4HVJ A;  1TKD A;  5F0X A;  3OBY A;  2X6N A;  4DMN A;  4KBO A;  1QVF M;  4E7J A;  3KLH A;  5AQP A;  4M3Y A;  4KRF A;  3AAP A;  3CQX A;  1YI2 N;  4DTU A;  2BTF A;  1X1P A;  1RDB A;  4DTP A;  2D0C A;  4YNQ A;  1JCF A;  4E7I A;  2FBX A;  3THW B;  4X64 K;  4AHR A;  1VSD A;  5TKY A;  4DR7 K;  2YKN A;  4YOT A;  3OYA A;  4FWP A;  3ZYY X;  4YHH K;  2QXL A;  2NNW A;  3IG1 A;  4CZG A;  1VQO N;  3QML A;  3WQU A;  3TSU A;  4B3S K;  1SV5 A;  3DXK A;  3FR0 A;  1MWM A;  3B8A X;  1S1V A;  4CCH A;  1YJN N;  3MX5 A;  1ATS A;  3QNO A;  4IOA L;  5J2Q A;  5AQW A;  1RTD A;  5KPR A;  3NMU A;  1HYV A;  1W97 L;  5AQH A;  1WSI A;  3F5T A;  4FZX C;  3QEI A;  1YAG A;  5M1O A;  3ZEU A;  4GV3 A;  3R3L A;  1MU2 A;  1RDA A;  4K42 A;  2P9I B;  1NMD A;  4X66 K;  2JGU A;  4FLU A;  3K5L A;  4OGC A;  2FF3 B;  1SL2 A;  1SQK A;  2KHO A;  3QIO A;  2CGK A;  3QES A;  2HMP A;  3TAQ A;  1OVY A;  5J1E A;  4ISG A;  3VOV A;  4KRE A;  3MK6 A;  5EVZ A;  4O8U A;  1DEJ A;  1P8Z A;  5AQR A;  1J53 A;  3AO5 A;  4DR5 K;  3TAF A;  1NK4 A;  1RBR A;  1C0T A;  4E1M A;  4BR4 A;  3OBW A;  4ELT A;  4IXC A;  3OYH A;  2PY5 A;  3SUQ A;  4GV9 A;  2VCP A;  3ZCM A;  4NLB A;  3DM2 A;  4QS9 A;  4AQY K;  1HRH A;  5FRN A;  5J2M A;  3SUP A;  4LF8 K;  3ATU A;  1O1W A;  3ZT1 A;  3KLG A;  1GLD G;  3NH2 A;  3MXI A;  1HLU A;  4M63 C;  1S1U A;  3PSI A;  4FL9 A;  5M1N A;  3CPW M;  4CK1 A;  4LFB K;  1D5A A;  2G8I A;  1HYZ A;  3VEX A;  3TWH A;  4CED A;  1Y97 A;  2P9U A;  1QQM A;  3LAK A;  3GBT A;  3LP0 A;  1BIS A;  4YDU C;  4JKD A;  4MO4 A;  1NLV A;  3KK2 A;  3IUC A;  4W5R A;  1T8E A;  3CFR A;  3WNF A;  3VA3 A;  3QEW A;  4KH5 A;  3QIC A;  3BDP A;  3CJ9 A;  4IG0 A;  3OJU A;  3SK3 A;  3I8B A;  4H5R A;  4OPK A;  1CZA N;  5GAH P;  5C2F A;  3W3D A;  4CGJ A;  3M6G A;  4CD1 A;  3H3O B;  1YVU A;  1UA1 A;  4FLW A;  1S6P A;  4LF6 K;  4PA1 A;  5H1S Q;  4CJP A;  1IKW A;  3A5M C;  3T1Y K;  4LH5 A;  1ZYQ A;  5DK5 A;  2VQF K;  2VG6 A;  1JL2 A;  1W9H A;  3TAG A;  3QB0 A;  1JLF A;  5D3G A;  4BQL A;  1L3T A;  4DTM A;  3CIP A;  3UB5 A;  1Z26 A;  1EWR A;  3AVN A;  3HJF A;  1X9S A;  3WXI A;  3ULD A;  3IKM A;  1U2V B;  1N36 K;  5AQX A;  1WSG A;  3VES A;  4BR9 A;  4O0J A;  4JD2 A;  3LM9 A;  1BU6 O;  2KTQ A;  4C23 A;  3NVM A;  2XY7 A;  4DQP A;  4MDA A;  3O9U A;  4MQ3 A;  2B4J A;  3H6E A;  3QBX A;  2ITM A;  2BE2 A;  3O4W A;  3GG4 A;  5AQV A;  4JV5 K;  1NJZ A;  2UXC K;  2UUB K;  2BDP A;  3I0S A;  4CEQ A;  1R59 O;  2ASP A;  4BRM A;  3TPQ A;  3Q7B A;  5EXW A;  3OYB A;  3VTI A;  4FJL A;  3OS0 A;  5F2R A;  4LF5 K;  2VWK A;  4XH1 A;  2G8U A;  1CLQ A;  2E2N A;  4C8M A;  3ZT2 A;  4CIE A;  1C1B A;  2ETJ A;  4GVM A;  3ZX3 A;  2NRW A;  4PUO A;  2UXB K;  1NBW A;  3BP8 A;  5ELZ A;  5DM7 L;  1U6Z A;  3ALY A;  5KQD A;  4M3X A;  4B1X B;  3CCM N;  3PX4 A;  1QVG M;  2HND A;  5KQ8 A;  1VQL N;  2G8F A;  2GX9 A;  4JI5 K;  4CEF A;  4FJ8 A;  1VSM A;  3QNN A;  4C8K A;  4C1N K;  2BAN A;  4AF1 A;  3TAB A;  4CJ5 A;  3O5B A;  2IVO A;  4L3Q A;  3K58 A;  4M41 A;  1QE1 A;  2Z1G A;  5J2P A;  3CER A;  3V9X A;  4F3O A;  2WFB A;  2Q0R A;  3TAR A;  4CJR A;  3CC7 N;  3O3F A;  5KRS A;  2DTU A;  4AHC A;  1VQM N;  4DV6 K;  4OKE A;  3E66 A;  1T6D A;  1J6Z A;  3HPH A;  1YIT N;  4CBX A;  2F8S A;  3KZB A;  4J2B A;  3OHR A;  5AQM A;  1NNE A;  4LFC K;  5GIN A;  3P39 A;  5FPM A;  3DYA A;  1GLL O;  3AAR A;  5GIP A;  1CZ9 A;  2E1Y A;  3NF7 A;  3CCL N;  3P1G A;  4E1J A;  3IMX A;  3U8X A;  4J2E A;  5B8H A;  4FJK A;  4FZZ A;  2DFH A;  3DXM A;  1Q81 O;  3L3U A;  3AA5 X;  4BC4 A;  4K0K K;  1JKH A;  2OZM A;  2UUA K;  1JLB A;  4DTS A;  1OVQ A;  4F4K A;  5FRO A;  4CJV A;  4GV6 A;  4BRD A;  5FPE A;  1GOA A;  3KJV A;  3CME N;  2YNG A;  3RWU A;  1IJJ A;  4LH4 A;  3TTD A;  2E6L A;  1GLB G;  3J7Y P;  3ZX2 A;  1MWK A;  4A59 A;  3J7Z O;  1YHQ N;  4BAC A;  4FJ9 A;  1YIJ N;  4KHN A;  3CCE N;  3PIO L;  1HQE A;  1EQY A;  5E26 A;  1QSS A;  2QKK A;  4CJT A;  2G8W A;  4TSX A;  1L3U A;  4H8K A;  4BRO A;  4FJX A;  4BRF A;  5FLX O;  4JAX A;  4I2Q A;  5E84 A;  2VWJ A;  1C1A A;  2NUB A;  1QQC A;  3VQ8 A;  3MXJ A;  1K8K B;  4BRI A;  2FBV A;  1BA1 A;  1ZXO A;  2IS3 A;  3BGR A;  3VN5 A;  3NVK A;  4H0T B;  2HHV A;  1VQ7 N;  3P5J A;  3RSE A;  2DPN A;  3GL1 A;  3T69 A;  2P9S A;  3MWP A;  1G99 A;  3EYZ A;  2FBY A;  3LZI A;  1XI1 A;  3VA0 A;  4JI4 K;  4FWS A;  3EY1 A;  4JKG A;  1BCM A;  3LPT A;  3A8Y A;  4CJU A;  4DQS A;  1QQO A;  4CJE A;  4DFK A;  3VEN A;  4CHP A;  5EU7 A;  4FYD A;  3MCA B;  1KVA A;  4NLC A;  3PV8 A;  1OH5 A;  5E41 A;  1CXU A;  2ZGY A;  4B3R K;  5AR0 A;  1VQ6 N;  3VQA A;  2YJE A;  5TKW A;  4OVL A;  3OA9 A;  2DY4 A;  3RVC A;  1YT3 A;  5ADX A;  3BUZ B;  3AVI A;  1Q7Y O;  4N5S A;  2P9L B;  4JNE A;  3OYN A;  3JXU A;  1WAJ A;  3F2K A;  3ZET A;  3IS9 A;  2VG7 A;  2G8K A;  1FJG K;  4EP4 A;  1TYQ B;  2CGJ A;  4O44 A;  1ATR A;  4JI6 K;  4DTN A;  2O8F A;  4LC9 B;  2RPI A;  1VAZ A;  1IKV A;  5AZJ B;  2D5R A;  3TR8 A;  4MFB A;  1M90 O;  4IO9 L;  3ZT0 A;  4K43 A;  1WLJ A;  4K8X A;  1HNZ K;  3CM6 A;  1QHT A;  4FLZ A;  1HNV A;  3CCQ N;  1UWB A;  2P5O A;  4O8K A;  1NWK A;  3HPG A;  1IKY A;  1HKG A;  4CJQ A;  3V9U A;  1TK0 A;  3THY B;  4FJM A;  2QA4 N;  3LAM A;  2QWR A;  4H0V B;  5JS2 A;  5JVG L;  2P1J A;  4JLH A;  3VQ7 A;  1NOY A;  2ZM6 K;  2E1Z A;  4B9Q A;  2O8D A;  4DB3 A;  4AIL C;  2YI1 A;  4DFM A;  1KFS A;  4JS5 A;  4IDK A;  3O1B A;  4AHU A;  4DQQ A;  3DJC A;  4KKO A;  1KQS M;  2Q36 A;  3S3M A;  3AA3 A;  3EN9 A;  3HVT A;  4B8A B;  3HT3 A;  3H3N O;  2Y1I A;  3VQ5 A;  1WBD A;  1NGA A;  2CGL A;  4EZ6 A;  4DTJ A;  3ISN C;  1RBT A;  4RWT A;  5HRO A;  4FW2 A;  3P31 A;  3OYI A;  5KPT A;  4BR0 A;  1RNH A;  2KZM A;  2GEM A;  2V51 B;  1NGI A;  2V52 B;  4ICL A;  3CET A;  1KCF A;  2KZZ A;  5EOY A;  1L3V A;  2P9K B;  4W5O A;  4B3M K;  1I94 K;  1UOC A;  4M7Y A;  3UKR B;  3OYG A;  2NRH A;  3DRR A;  4OLB A;  4DV3 K;  3S3O A;  1NK7 A;  1NJX A;  2R7Y A;  2HST A;  2O8E B;  5AQQ A;  5I9E B;  3K5M A;  3M3Z A;  5AZI B;  3SMP A;  3OYK A;  1KSP A;  2P9N B;  4FLV A;  2G8V A;  4JI3 K;  1TAU A;  4IFE A;  3NH1 A;  5HRS A;  1BQM A;  4CFD A;  1OKJ A;  2HHU A;  5GAE P;  4EIA A;  3GE1 A;  3CG7 A;  4FLX A;  3DXK B;  4B9L A;  1RT6 A;  5AQG A;  5DM6 L;  2WTU A;  4CGH A;  4IBN A;  4DTO A;  3J80 O;  1IO2 A;  3AV9 A;  4M3R A;  3WNH A;  4CVN E;  5LMN K;  3VPZ A;  2WON A;  4NO7 A;  3AY9 A;  3I8D A;  4KFB A;  1YJ9 N;  3FLC O;  4CHN A;  1SAZ A;  3BY5 A;  4DG1 A;  2ATQ A;  4RW4 A;  1OH7 A;  4BRQ A;  3IFR A;  1U04 A;  3L4I A;  5CR4 A;  1LWC A;  4A2A A;  2KLA A;  3NCI A;  3WXM B;  4CE9 A;  4B3T K;  1J5E K;  2CH6 A;  4I6M A;  1D8Y A;  3CM5 A;  4W5T A;  4BE2 A;  1IBL K;  1BO5 O;  5C15 A;  2HNZ A;  2VWB A;  1HYS A;  1ZBF A;  2GV9 A;  4YDU A;  1NGD A;  4BDY A;  2JWL A;  3TAN A;  4E7L A;  3G25 A;  4X65 K;  3W0L A;  4BC3 A;  3D2F A;  1NJI O;  4FPB A;  4C8O A;  5LJW A;  4F8R A;  4UQG A;  4NB4 A;  4DS4 A;  3TSP A;  5GIO A;  2E2O A;  3L8B A;  3HVR A;  3MN6 A;  3WXJ A;  3KTQ A;  1HJO A;  3CFO A;  4JHD B;  2W6K A;  4CBW A;  4JKB A;  3O9T A;  3G0Z A;  3WEE A;  1Z25 A;  2VG5 A;  3F73 A;  1XC9 A;  1VHX A;  4FW1 A;  4O5F A;  4KHS A;  4BR5 A;  4CER A;  1L5U A;  1LV5 A;  4K25 A;  2QEX N;  3QFP A;  4JN4 A;  3VGM A;  2YHY A;  4JK9 A;  4CHZ A;  4DSJ A;  2UUC K;  2RHK A;  3FE1 A;  3UIQ A;  1HUX A;  5SZT A;  4HCB A;  4CEB A;  2FLO A;  2OA8 A;  2H3G X;  5FRM A;  1RT5 A;  5T7B A;  4ISE A;  4H5W A;  3RMB A;  2VQE K;  5KGW A;  3LDN A;  3LP2 A;  4EAH D;  4M42 A;  5JVH L;  4HWI A;  2E4L A;  5BR8 K;  1SUQ A;  4FOI A;  2O4I A;  4CZH A;  4BRN A;  3MN5 A;  3H45 C;  1DT9 A;  1TVR A;  3E9P A;  4JRP A;  4E0D A;  1TKX A;  5CZ2 A;  3VMF B;  3A5N C;  1VQP N;  2OPS A;  4M7X A;  2P9P B;  4DR3 K;  4B3O A;  3DRP A;  1ZC6 A;  1RBV A;  2W42 A;  3K5O A;  1TK8 A;  3O9Q A;  1HPM A;  1Z05 A;  2NRT A;  3SQ0 A;  2YNH A;  2RF2 A;  4K41 A;  1GLJ O;  3D2E A;  1GOB A;  1WB9 A;  4DFP A;  2Z1H A;  1GLC G;  3OJS A;  3O9S A;  5KGX A;  3V9Z A;  2PFU A;  3LPU A;  1K9M O;  4GNI A;  2F9W A;  1ASV A;  1JXE A;  4AM6 A;  3LAN A;  4QCL A;  2QWP A;  4FK2 A;  3GOI A;  1I3A A;  3AVG A;  3C0B A;  2VGN A;  5KTQ A;  3H46 O;  1C0U A;  3K0S A;  4DV2 K;  3QDK A;  1VSJ A;  5KRT A;  4FWO A;  4IOX A;  1VQ5 N;  1NK8 A;  3HST B;  3KWI A;  5K14 A;  3SV4 A;  1NGB A;  1BIZ A;  1W2B M;  1C0F A;  3O08 A;  3L6Q A;  5JMV A;  3KK1 A;  4A57 A;  3OVN A;  3AVL A;  3MX2 A;  4CEC A;  4Y0W A;  3EO3 A;  4U67 L;  4IDH A;  3THW A;  3THX B;  2HF4 A;  4A2B A;  3GDQ A;  3KKS A;  1Q9Y A;  2Q97 A;  4DQ8 A;  2QXF A;  4MO5 A;  5C2D A;  1ZBH A;  1VRU A;  2EHG A;  2A5X A;  4IWV A;  4CEA A;  2O8C A;  5BN8 A;  3CJ7 A;  4LSL A;  3DLR A;  1MA9 B;  4BE1 A;  4A5A A;  3T1A A;  4FXD A;  3QBW A;  3HTV A;  5HRP A;  1IBM K;  2QKB A;  2HMI A;  2ZJQ L;  3BZC A;  4E7K A;  1BG3 A;  4IJN A;  2QWO A;  4ID5 A;  3SPZ A;  4QS7 A;  3DOL A;  1WSJ A;  2ZF5 O;  1HPZ A;  1FW6 A;  2NLX A;  1LAV A;  5JS1 A;  3OYJ A;  1NGF A;  3MAQ A;  1VSL A;  2Q31 A;  3EE9 A;  1IKX A;  1T05 A;  4BY9 C;  2UYT A;  4H03 B;  3PO5 A;  3ZX0 A;  3SQ2 A;  1F21 A;  3PX6 A;  5AQN A;  4CIG A;  1K8A O;  2P9I A;  3DLB A;  4FK4 A;  4CZL A;  4DHY A;  5GAG P;  2UU9 K;  4LF7 K;  4NYN A;  2HHQ A;  4CGF A;  1XNR K;  3SQ1 A;  2YHX A;  3U9D A;  3AVH A;  4DR4 K;  3DLK A;  1A5W A;  1JLE A;  3EKS A;  3AO1 A;  3RR7 A;  5ADX H;  2HF3 A;  2HVI A;  4OJR A;  2KQ2 A;  4KB0 A;  3ASM A;  3M1F A;  1SZ2 A;  3SAG A;  2AJQ A;  4KTZ A;  4FJN A;  3B6P A;  1VQN N;  4GVE A;  3V81 A;  5AQS A;  3L2R A;  4BRH A;  5BR9 A;  5LJV A;  1GLA G;  3LDO A;  1E4G T;  3JS6 A;  3K5N A;  3CJ1 A;  3R8E A;  1KTQ A;  4BC2 A;  4RW7 A;  4B9T A;  4BRE A;  3FZL A;  3WQT A;  3U6F A;  2YV0 X;  4Z4F A;  2NRX A;  4XEI A;  3O8M A;  4KAZ A;  2KW4 A;  4WYB A;  1KLM A;  3UKU B;  1J9A A;  4B1Y B;  2OZS A;  1S9E A;  2D0P A;  2A41 A;  3ZSY A;  4ZTF A;  4IFY A;  3HBT A;  2OAN A;  2FF6 A;  4BG8 A;  1UAX A;  3CXC M;  3HPO A;  3F9M A;  4E19 A;  3SQ4 A;  4EP5 A;  3MN9 A;  1TUU A;  3EL2 A;  1NKE A;  1RBS A;  1ZBS A;  2YJF A;  4HUE A;  4CF0 A;  1JLA A;  4YOU A;  5IWA K;  1RFQ A;  4FO0 A;  4BRP A;  4FVM A;  4G1Q A;  2ASO A;  3DRS A;  3QEV A;  1RGI A;  5M1P A;  3TU5 A;  1YF5 L;  3V1R A;  4DUY K;  1BI4 B;  2QWM A;  1WSE A;  2YNF A;  5GAD P;  3M5R A;  4JI2 K;  3L0Q A;  4NCG A;  3KWG A;  3NF8 A;  5CZ1 A;  4DSE A;  1N33 K;  4NCA A;  3CJA A;  1ZBL A;  3HP9 A;  3VQ6 A;  3QO9 A;  3QET A;  3M8P A;  1BQN A;  4O55 A;  2EX3 A;  4DS5 A;  1BA0 A;  3AVJ A;  4CK3 A;  1IH7 A;  5LL6 Z;  4N47 A;  3AVK A;  4QOZ B;  2X74 A;  4N56 A;  1RDU A;  3MEG A;  1JJ2 M;  1SL1 A;  3BF3 A;  1RDC A;  3OYC A;  2I7N A;  5F1X A;  4AM7 A;  3CCU N;  1U45 A;  1S22 A;  4Q5V A;  1BOT O;  4IOC L;  5KPZ A;  1S1X A;  4C8N A;  3BZK A;  3IDH A;  1LWF A;  3SAF A;  1VK0 A;  3KLF A;  4Z4G A;  1KVB A;  3SJH A;  1HX1 A;  1NG9 A;  4CFB A;  3AO2 A;  1SKW A;  2HBL A;  4WE1 A;  5BN9 A;  1BGX T;  3SYZ A;  3VQB A;  3I0R A;  3SI6 A;  4DTR A;  5IT9 O;  2D0O A;  3K59 A;  3WUH A;  4M3Z A;  3O6W A;  1NU0 A;  1X9M A;  1YUW A;  3SMS A;  2HNY A;  4K8Z A;  4CD3 A;  3VQD A;  2NRZ A;  1N34 K;  1E3M A;  2Z1J A;  1VSE A;  1XQS C;  4FJI A;  4I9L A;  2QI2 A;  3AVF A;  1SL0 A;  3LP3 A;  3CQY A;  3FFK B;  4J2D A;  3HL8 A;  2HHT A;  2Q0U A;  4IEI A;  4DLG A;  3V9S A;  4DV7 K;  1IG8 A;  1YJW N;  2OPQ A;  4JKF A;  4LD0 A;  3VER A;  3G4S N;  2E5L K;  4FPA A;  3RRH A;  2O8B B;  3G6E N;  2I5J A;  2HHS A;  1TUY A;  3OY9 A;  1DLO A;  3SCX A;  3RMA A;  1WSF A;  2VYP A;  3J8A A;  4FM2 A;  3CI5 A;  5EY4 A;  1GLE G;  4WQ4 C;  3CJC A;  5AFU A;  1XHX A;  4KHU A;  1X9J A;  3MCP A;  4BRK A;  1B9F A;  5FDL A;  1GLF O;  5BRF A;  3VET A;  4CJS A;  3L2W A;  2A42 A;  1RIL A;  3V9W A;  2PYL A;  3L4Q A;  4BR7 A;  1YTA A;  3KLE A;  1Q82 O;  4BG9 A;  1QHA A;  4JKE A;  3OS1 A; 
#chains in the Genus database with same CATH homology
 4LF7 K;  4DR2 K;  4JI0 K;  4LF9 K;  4LFB K;  2UXB K;  5LL6 Z;  2HHH K;  1XNR K;  4CW7 B;  4DR4 K;  4DR1 K;  4B3T K;  4DR6 K;  1J5E K;  3T1H K;  1HNX K;  4JI5 K;  4JI8 K;  1IBL K;  3J81 O;  4JI4 K;  1XMO K;  4OX9 K;  4V19 S;  4X64 K;  5A2Q O;  4DR7 K;  4NXM K;  4DUZ K;  4X65 K;  1XMQ K;  4YHH K;  4DV2 K;  2UXD K;  4B3R K;  3OTO K;  4JI1 K;  4DV1 K;  4B3S K;  5IT9 O;  4LF4 K;  4LF6 K;  4DV6 K;  3T1Y K;  4B3M K;  2VQF K;  1I94 K;  1XNQ K;  1N34 K;  4YY3 K;  5AJ3 K;  4LFC K;  4DV5 K;  4DV3 K;  1FJG K;  4GKJ K;  1N36 K;  4DV7 K;  4NXN K;  4JI6 K;  4DV4 K;  4X66 K;  1N32 K;  4K0K K;  1HR0 K;  4JI7 K;  4JI3 K;  2UUA K;  2E5L K;  4LFA K;  2UUC K;  4GKK K;  5IWA K;  1IBK K;  1IBM K;  2VQE K;  4DR5 K;  4DV0 K;  4JYA K;  3JAM O;  1HNZ K;  2F4V K;  3J7Y P;  4JV5 K;  2UXC K;  3J80 O;  4DUY K;  2UUB K;  4CVN E;  4X62 K;  5BR8 K;  5LMN K;  4KHP K;  1HNW K;  4JI2 K;  4AQY K;  4LF5 K;  4LF8 K;  4DR3 K;  1N33 K;  5FLX O;  5LMU K;  2ZM6 K;  3J7A P;  2UU9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...