5AJ3K

Structure of the small subunit of the mammalian mitoribosome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
136
structure length
136
Chain Sequence
SFSIYPPIPGQENSLRWAGKKFEEIPIAHIKASYNNTQIQVVSAAHQPLAHASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHVRVVVKGLGPGRLSAIKGLTMGGLEVISITDNTPIPHNGCRPRKARRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords MITORIBOSOMAL 12S RRNA
total genus 27
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2015-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5aj3K00
4JI5K 5LL6Z 4DR5K 5BR8K 3T1YK 4JI7K 4JI1K 2UXCK 4DV4K 1N34K 4DR7K 4LF8K 4AQYK 1N33K 1HR0K 4LFBK 3T1HK 4CVNE 4DV1K 4DV2K 1N36K 1XMOK 4B3RK 3J7YP 1IBLK 4JI0K 4LF7K 4LFAK 4JI2K 2UXDK 4DR3K 5IT9O 4OX9K 4JI8K 4JI3K 4LFCK 5IWAK 1XMQK 5LMNK 4JYAK 2UUCK 4NXNK 4LF4K 4V19S 4X65K 1N32K 4B3TK 1I94K 2UXBK 2UUAK 3J81O 1IBMK 4NXMK 3JAMO 1FJGK 3J7AP 4B3MK 4LF5K 1HNXK 5FLXO 5AJ3K 5A2QO 4JI6K 1J5EK 3J80O 4CW7B 4LF6K 4DV5K 4JI4K 4DR1K 2VQFK 4GKKK 1XNRK 4X66K 2ZM6K 4B3SK 4KHPK 4DUYK 2E5LK 4YY3K 4X62K 4DV0K 4YHHK 4DR6K 2UU9K 4JV5K 2F4VK 1HNWK 4DV3K 4DV6K 2VQEK 4LF9K 4DR2K 2HHHK 2UUBK 4DUZK 1IBKK 4GKJK 3OTOK 4X64K 4K0KK 1XNQK 5LMUK 4DR4K 4DV7K 1HNZK
chains in the Genus database with same CATH superfamily
3EO3A 5D3GA 4FYDA 1ESVA 5FDLA 1VSFA 1NGCA 2YCHA 4Z4GA 3DRRA 4DR7K 3HVRA 1X1PA 4AQYK 1YTUA 3HM8A 3ATUA 4K42A 3KLHA 1HPMA 4BRQA 1CXQA 4HUEA 4B3RK 3M8QA 5C2DA 1TK8A 4QCLA 4W5NA 1E4GT 3O4NA 3SJHA 3THXB 4BRNA 3KLEA 4JI8K 3DXMA 2O8BB 4DTPA 1EX4A 5EVZA 1NGJA 3U3YA 2XY8A 2HBKA 2QI2A 1TK0A 3QEWA 5AR0A 3RMDA 2AP1A 3IMXA 1P90A 3HBTA 2KTQA 1NWKA 3DLGA 4B9NA 2NRVA 3SUNA 1WAJA 3O9UA 2HF3A 3QMLA 2O8EA 5J1EA 1JLBA 1QVFM 1U2VA 2RN2A 3AA4A 3A8YA 4FJLA 3V1QA 3AO3A 3NBPA 3EZWA 4FW1A 3VEVA 3FGUA 4KHUA 3HOSA 3J80O 4JI4K 4IKFA 3NAEA 3WQUA 5LJWA 5HBMA 3QNOA 2G8IA 4FJ8A 2P9NB 4YDUA 3O9QA 1Q7YO 4YY3K 4JS4A 4GVMA 4DF8A 2WONA 2F4VK 5BN8A 1ZBIA 3Q7BA 2PBDA 4CGIA 3WEEA 2PY5A 1RT1A 1G15A 4IOXA 5M1PA 1YF5L 3MCAB 4FZYA 3CCRN 1ASUA 4I2QA 3WXJA 4BVOA 5F1XA 4JLHA 4LH5A 5C42A 4MDBA 1SS6A 5GINA 3I8BA 4OPJA 3K2PA 4LF8K 1KD1O 2W40A 4CCHA 1BQMA 3DM2A 3ZT4A 3GDQA 4XH4A 2O8DA 4LC9B 3MXIA 1RNHA 4NB4A 4OX9K 1WSIA 3V4IA 1T6CA 4IEEA 4BG9A 2HHUA 2YNFA 4CJ7A 4Z0UA 5E84A 1UA1A 4DLEA 2CGJA 5KRTA 2WTUA 1C1BA 5CYMA 1VRTA 3DXKA 5FPEA 1WSHA 3MX5A 1IH7A 2IDOA 4Q5VA 3J7AP 2I7NA 4A2BA 3BGRA 3LWMA 4WCEL 3TSQA 2NRTA 3CIPA 1SL1A 4GNIA 2RF2A 1NG9A 4WE1A 4EP5A 4KTWA 5JS1A 1UAXA 3DWLA 3KIOA 2E6MA 4H5RA 2BTFA 4HTUA 3THYA 2XY5A 5HROA 4BRFA 3QNNA 3RMCA 4MDAA 5C10A 4I9QA 3KK7A 3P83D 3LPUA 4W5TA 3BZKA 4FXDA 2XY6A 2YHAA 5AQIA 4K8ZA 4CGJA 1SAZA 4CFAA 3QFPA 4BR4A 1QTMA 4FJIA 1CZBA 4HHTA 4IDKA 1IJJA 2Q2RA 4YHHK 3L0QA 2W6LA 4ILJA 2E2PA 4B8AB 4CJSA 1RT2A 3MN7A 3CPWM 4KH4A 3U3GA 3V9XA 2E1YA 3VQQA 4JKFA 4RW9A 3K59A 1JL1A 3OYJA 1IBKK 2P5OA 3O8MA 1RGIA 3CM5A 3LDPA 3QEIA 2V7YA 3LDQA 4H0XB 3LAKA 4CJTA 1VQ7N 5AQOA 3ISNC 5CZ2A 4BDPA 3RRHA 3MK6A 5M1OA 3ULDA 3SQ1A 4JI7K 1NK5A 1RT6A 1ATRA 4BQZA 3EZ5A 3BDPA 4IJNA 4PUOA 3U4LA 3VTHA 1N36K 4C8KA 4BGAA 4FJ5A 4H4MA 1JXBA 3CI5A 4LFAK 2ZD1A 3O08A 2OTLN 4CECA 1X9SA 2RHKA 3LP2A 3L2UA 4E1JA 3K5LA 3LP1A 5C25A 1YJWN 4H4OA 1W2BM 1MWMA 5I3UA 1KVAA 2DFEA 1DEJA 3OYMA 4FK0A 4JK7A 3MN5A 1C0UA 3PIOL 1KFSA 1QQCA 2AA4A 1BWFO 4EZ6A 1RT4A 3CJCA 3AV9A 2Q3SA 3NGYA 4O0JA 4FJMA 1JL2A 3TTDA 1C0TA 5DM6L 3VA0A 2P9UA 4DTOA 2YKMA 4CJVA 1S6PA 3VQ6A 4BE1A 3JS6A 1L3TA 4DFPA 2JLEA 4BRCA 3ZCMA 3O5BA 1QS4A 1FK9A 2ZQBA 1V4SA 4DV5K 3HZ6A 4M42A 1RDUA 1S9GA 1RTDA 1KC8O 1NGFA 1BU6O 4E7JA 4FJ7A 2BE2A 1YT3A 3R1XA 4FK2A 3WXKA 5E41A 3ZX2A 1W0HA 1U45A 4KHWA 1OH6A 4RCHA 3AAQA 4ILGB 1X3MA 3V1RA 1SL0A 1TUYA 2P9LA 3F5TA 4CIFA 4I6MA 4XH5A 5C12A 3S3MA 3SI6A 2J4RA 5GIPA 3K0SA 4DTSA 3VETA 3E01A 4YORA 3O1BA 3QEPA 4FL9A 3QBXA 4FVUA 2GV9A 3J7ZO 3CERA 4PKHA 3SQ0A 2FSKA 4BREA 3UKUB 1HNVA 5AQRA 2Y1IA 3CCEN 1JJ2M 3PUFA 3WT0A 4CI6A 3KK1A 4KFBA 4WQ4A 1K8KA 4F4KA 4CK2A 2Q0UA 3ENHA 1NJYA 1YVUA 3DRPA 4E1NA 2X6SA 4JD2A 2YNIA 2G8HA 4JNEA 5KPZA 1Q9YA 2XHBA 4F9OA 4IWVA 4CJFA 4GV3A 1YXQA 3AVIA 2FBTA 1OH8A 3ZSZA 3OYDA 3GBTA 4N41A 4DQIA 5GAEP 3NGIA 1XMQK 3CF5L 4CHYA 3AVCA 3OS1A 4M41A 3H08A 1NGBA 4CFBA 1SV5A 2G8UA 2HBJA 3T69A 1BGXT 3VQBA 4F2SA 5HRSA 2QEXN 1LOTB 2P5GA 1WUAA 5AZJA 1T8EA 4B3MK 1LAWA 4BROA 2H3GX 3CMAN 4JK9A 4DTUA 1DTQA 3HO1A 5AJ3K 2ASMA 2HHWA 4DSLA 4B9VA 3DLBA 2HMIA 1FW6A 3E9LA 1S9EA 3AVFA 4FWRA 1LW2A 3DLHA 3P31A 4J2AA 3H45C 1IO2A 3EKSA 1MA9B 2PYLA 1RFQA 4CD3A 4L8RB 4G9ZA 3VF6A 3ATVA 3NCIA 4B9UA 1BCOA 1MWKA 4PKGA 1NLVA 2PFUA 3H3OB 4BRDA 2A5XA 4FJJA 2OTJN 4N56A 2FBXA 4JV5K 1VQKN 4B1ZA 5BPMA 4Z4IA 4DTNA 4DHYA 3D2FA 4CFDA 4KHSA 3MEDA 1LWFA 2HHHK 3T3FA 1L3SA 4CBWA 4H0YB 3CFRA 4FWKA 1NGAA 1G99A 4CZKA 2FBVA 3DLRA 3L4QA 1JCEA 4NCGA 3WNHA 4KTQA 3B6OA 3I8DA 4JHDB 3WNEA 2NUBA 1O13A 5KTQA 3QEVA 2EX3A 2QKKA 1J9AA 4ELUA 1GLEG 4CZIA 3QO9A 5BR8K 3IKMA 3VEXA 1IKYA 4A5BA 3MMVA 1HKGA 2BUPA 3WXMB 3BP8A 3PSFA 3CQXA 4M3XA 3K9KA 4AHVA 4B1UB 2WOMA 4H0VB 1JLCA 4JI2K 1NK9A 2CGKA 3C6UA 4CEEA 1TGOA 4CE9A 1RDBA 1M90O 1ZBFA 3D2EB 1NK6A 3NH0A 2OA8A 3TAMA 5LMNK 1GLJO 3SZ2A 3AARA 4NCAA 5M1KA 4FJGA 4H5NA 3AAPA 2HNZA 5AQHA 1S1TA 1C6VA 4K41A 1MDUB 3KLGA 4KHQA 2UUAK 3SNNA 4RW4A 2W41A 4FM0A 4FWNA 3V9ZA 2G8VA 4E3SA 4DQPA 2P9IA 4C8OA 2HBLA 4KHYA 3I0SA 1RBUA 3VF2A 4CW7B 3MECA 3MCPA 2O8EB 5BRHA 1XUPO 1DKGD 1S1XA 2ZJQL 4C8MA 3WQTA 3TR8A 1DTTA 3SCXA 4KAZA 3L2VA 4BQLA 4GVEA 3DXKB 1TKDA 3B6PA 3O9SA 5SZTA 2F8SA 1I39A 3IRXA 4CFCA 2HHXA 1KAYA 3FZKA 4CEOA 2E5LK 3MXJA 4OVLA 3LP0A 5M1QA 1TKXA 1SKWA 2P9LB 3V1OA 4IG3A 4CF2A 4DSJA 2F7TA 3ID6A 3TABA 3IFRA 2HOEA 4DR2K 3S41A 3DLKA 3HM9A 1WOQA 3VQ4A 2QWLA 4AH9A 4GKJK 3OTOK 4CF1A 2ETJA 4CZLA 1QZ5A 1FXXA 3CYMA 3TTCA 3SJJA 4EIAA 3FE1A 2BDPA 3AA2A 5LL6Z 1DGKN 1U49A 4IJAA 4ELVA 1RT7A 3P5JA 4KV8A 1A5WA 1VSHA 2A6AA 4KTZA 2E8AA 3D6RA 4HCBA 2HSTA 4BRHA 4JKGA 1NMDA 2E2QA 4LFBK 1TKZA 2Q0RA 3EN9A 1BG3A 4YFUA 1ZXOA 1W97L 1N6QA 5KGXA 1JKHA 4A57A 5HP1A 2O8FB 3QETA 1JCFA 3AA3A 3CCMN 5EY4A 4GMJB 2HMPA 1VQ9N 2ZGYA 2VCPA 2QWOA 4QS7A 3EEQA 5IWAK 4RG8A 3VQCA 3OYEA 4CGHA 3TU5A 2P9KA 4FZZA 3M8SA 1MU2A 2Z1HA 1I94K 3NDKA 2WFBA 5SWMA 3VA3A 3NE6A 1QQOA 3JAMO 3QICA 3KK3A 2VWKA 2FC0A 4WYBA 5FRNA 1KAZA 2HW3A 4BC4A 2KLAA 5FLXO 1GLAG 4Z4EA 4IOAL 4CGFA 4CZMA 3MEEA 4EFHA 4KO0A 4O4GA 3THVA 1J5EK 1Z6RA 1S6QA 2Q1NA 3OYFA 3DRSA 4LF6K 3ITHA 2ZGZA 3TTFA 3O4QA 5AQMA 3ZT1A 4NYNA 3PSIA 1JLGA 2YNGA 4B3SK 2P9PA 3FZLA 4DG1A 1NJWA 5AFUH 3LZIA 4CEAA 1IG8A 2E2NA 4B9LA 3ZEUB 5LJVA 3NVMA 4CGDA 1CZ9A 4AHCA 4JKAA 4ILHA 5HLFA 3KHYA 4CERA 2UUBK 3OVNA 3OBYA 1ASVA 4JK8A 1WSEA 3NH2A 3LWLA 3ID8A 1N5YA 4DR4K 4KBOA 4AM6A 5EXWA 5BRDA 2A41A 3E1YA 1VQON 3G25A 4CHZA 5EOYA 1BDGA 4M3ZA 1SZ2A 2OPQA 1J6ZA 1VSLA 3OHRA 4YOWA 1T3VA 5MLCQ 3VPZA 3AVGA 4DCHA 3HYFA 1WAFA 3HT3A 4W5OA 5DM7L 4O0IA 5KGWA 4O8KA 4YOUA 4BR0A 4OLAA 1BO5O 3K57A 3MWPA 4CVNE 3M8RA 4E7IA 1Z05A 1HUXA 2D1KA 5ELZA 4IBNA 3J7YP 1D9DA 3L2WA 5C0YA 3KK2A 1VHXA 3TANA 2GEMA 1KLMA 4IFEA 4LY7A 3DOKA 4PKIA 4ISGA 2NRRA 3BZCA 3QBWA 3SUQA 2OANA 3QDKA 4IFVA 1N32K 3FFKB 2IOCA 1T7PA 1X9JA 4C23A 4BRPA 4LF5K 1NJIO 3ZSWA 3SUPA 2P9IB 4KREA 4IZ9A 4FW2A 3SUOA 3CG7A 3VEOA 3VF4A 1E4FT 5M1FA 3A5NC 4X66K 3WXIA 3FFIA 1RCHA 2OZMA 5ADXH 3TAGA 3GG4A 1J53A 1UWBA 1OH5A 4DR6K 3AVLA 1EP4A 4BR9A 1IKVA 1IKWA 3AVBA 4FVMA 5I42A 3VOVA 5AQYA 2QKBA 3HP6A 3AVKA 4FZXC 5HRPA 1TVRA 3GL1A 4JHDA 4BE2A 4DLGA 3NH1A 1C1AA 1VSKA 4DQRA 1YIJN 1L3VA 1NKCA 4FWMA 4ID5A 1TL1A 3KD1E 1C0FA 1TYQA 1RDCA 1VSMA 4CEZA 1W9HA 1HKBA 1OVQA 3AO4A 4MQ3A 5LY3A 4M7YA 1BA0A 4JKGB 2DY4A 3D0PA 1GLCG 3SAHA 2G8WA 4N76A 3FLCO 2IC3A 3OYAA 3LDSA 2WC9A 1EKEA 1F21A 1OKJA 3N4PA 3SLCA 4IO8A 3TPQA 4OKEA 5C24A 4DS4A 1KAXA 3WNFA 4CEFA 3OYNA 3CJBA 3LDNA 1HNIA 3CCJN 3L3VA 2QK9A 3CFOA 3KWGA 3VMFB 3C95A 4X65K 1SKSA 1ZBHA 2HHVA 3QLHA 1NBWA 2FSNA 2QXLA 4A61A 4B3TK 1U2VB 1EWRA 3ZT3A 3SPYA 4KRFA 2D0PA 3PIPL 3SPZA 3T1AA 3O4WA 4NLBA 4U7BA 1XI1A 4AILC 4FWOA 4GV6A 2IVOA 2Z1GA 3L6QA 2BGGA 3SAFA 2Q31A 1T44A 3MWTA 1C0MA 4M3UA 4JI6K 2O8CA 1HRHA 3C6HA 3HL8A 4BACA 1KSPA 1EWQA 3C6TA 1Q82O 1ITGA 4N5SA 5AQQA 4FJ9A 4DU3A 3NGZA 3LDLA 2HNYA 2P51A 2NRHA 1TV6A 1KTQA 3O1WA 1NOYA 2ITGA 1CLQA 2HF4A 3G71N 1JCGA 4K25A 3HVTA 3I0RA 3OYLA 4DTMA 1VSEA 3CM6A 5FROA 4MLHA 2KZZA 1BI4A 4OJRA 4B1VA 1GLBG 1TYQB 4K0KK 3C7NA 5T7BA 2A42A 4B9QA 3HOTA 3PLAA 4E7HA 1NKEA 1QSSA 3VEWA 4DR5K 1TAUA 1VAZA 4HWIA 4CK1A 2V52B 2X74A 2LSNA 4AF1A 3AGKA 4HUFA 3UB5A 3AO1A 1NNEA 2VGNA 4H5VA 4WFAL 2O8FA 2FXUA 5CYQA 4LF7K 1R59O 4L3QA 2ZJRL 4TSXA 1NGEA 1EETA 3DXMB 2O8BA 1K8KB 4CJWA 2IVPA 3QERA 1NJXA 2HHTA 1VRUA 4BR2A 3U6FA 1ZC6A 3WXLA 2KFNA 4C1NK 2Z1IA 4BE0A 4YOVA 1D9FA 4KKOA 4F3TA 3SAGA 3DMJA 1TAQA 2F96A 3R6MA 4NXMK 2IS3A 2O4IA 4JRQA 3CQ8A 4FM2A 2CGLA 2ZJPL 1T05A 3HSCA 2FBYA 4DTRA 1YTAA 2ZWHA 3HPHA 3SQ2A 1B9FA 3NF8A 3C6AA 4OKJA 5KPTA 3LZJA 3U9DA 3VQEA 3V9UA 4BY9C 4I7FA 1B92A 3DYAA 3O3FA 3KWIA 3V9WA 4K8XA 4PL8A 1D5AA 2EHGA 4CJEA 4XH1A 1GLLO 2YX6A 1RBTA 4FCYA 3GOIA 5AQUA 3WUHA 3WNGA 3CJAA 1GOCA 3ZSVA 2FF3B 4CESA 1JLQA 2E1ZA 1BIZA 3CFPA 2CH6A 4B9TA 2W42A 1VSJA 3OYGA 3HXMA 2NLXA 4QOZB 1NJZA 3P39A 3EE9A 3ZSOA 3KD5E 1IV0A 3PV8A 4LSNA 3U9ZA 2EWSA 3HPOA 3OY9A 1L5UA 5AQSA 3RVCA 2UXCK 1ASWA 1WSJA 4C8NA 1N34K 3G10A 4C8LA 2VG5A 4K43A 5FPDA 3CPEA 5HL7L 3ZSQA 1J5OA 4OGEA 4NLCA 2NNWA 1JXEA 4ZTFA 1UA0A 4EHTA 3CQYA 1SUQA 2HBMA 4G1QA 4DR3K 5TKWA 1XWLA 3DAWA 2OPPA 4NYFA 3DLEA 4B9SA 4M63C 3OW2M 4BG8A 1NGDA 4Z4HA 3RTVA 4KHNA 3VQDA 1FKPA 2Q36A 2GX9A 4Z4FA 2I5JA 3ENOA 4H0OA 4CEDA 5KPRA 3OJSA 4FLUA 1HLUA 3HK2A 1QZ6A 3VN5A 3HJFA 1WBBA 4E0DA 4YDUC 1LV5A 3M5RA 1U4BA 1HNXK 3A5LC 1EO1A 1RILA 3VQPA 5J2PA 1OH7A 3NVKA 3EL2A 4OLBA 3NMUA 4FM1A 4YOXA 2VGMA 4B1WB 4BRMA 3CC7N 3BEXA 2GBZA 1VQ4N 2Y1JA 4E89A 5AQLA 3NF9A 4BRKA 4WFBL 1SL2A 4HCCA 4M3TA 2GWKA 4UQGA 5AQVA 3TSPA 3SV3A 1YJ9N 4IXCA 2QXFA 3KKRA 3BF1A 4RWTA 4LF9K 4C1NI 4F2RA 3UKUA 1BHLA 4CJ3A 1RTJA 3DI6A 4BC5A 2W6KA 4BRGA 3H46O 4CBUA 2D0AA 1HJOA 1HQEA 5AQNA 2E6LA 4O5BA 4BVPA 5CHIA 3EY1A 1QQNA 3SV4A 2B4JA 1KVCA 2X6NA 4E19A 1CXUA 4IDHA 3MN9A 3QFUA 2IAJA 1B9DA 3ASMA 4ICLA 5HRRA 2FF6A 3T1HK 2OYQA 5TKYA 4DWIA 1S22A 3KZBA 2JGUA 2A1SA 1U6ZA 1XHXA 4PY5A 1VQ5N 4KPYA 4MLEA 2VWBA 4IG0A 2KFZA 3TAQA 4IO9L 3RMAA 3R8EA 3MX2A 1RT5A 3K9JA 1ZBLA 1EQYA 4RW8A 3NHGA 3CMEN 3KJVA 1V4TA 2D4WA 1LW0A 2UXBK 1IBMK 5CZ1A 3OYCA 2B6AA 4BDZA 4CBXA 3SBGA 2GUIA 3UKRA 3P4IA 4J2DA 3KTQA 5JS2A 1O1WA 3FZFA 1T6DA 3ZETB 1YVNA 2D0OA 2NZTA 2QTDA 5BPNA 3D2FB 5J2MA 4CJUA 3ZYYX 1NMNA 2HVHA 3OS0A 2QWPA 3H1QA 2E2OA 5BPLA 4GKKK 3PX0A 2YNHA 4FWLA 5DMRA 3H3NO 4DFKA 1NGIA 4DKWA 1RTIA 5DK5A 1FKOA 3VENA 4E1MA 3AY9A 4F8RA 2P1JA 2XO7A 3MXMA 1R0AA 2Z1JA 2DTUA 3OBWA 4PL7A 1ZBSA 2BANA 3FZHA 4DU1A 4A5AA 4B3OA 1NGGA 3NF7A 2VG6A 1HPZA 3U8XA 3VQ8A 4FOIA 3TAEA 3L2RA 5C2FA 5FPMA 1YJNN 4NO7A 3V81A 1XC9A 4J8FA 3O9TA 4Y1CA 3ZSYA 5AQKA 3VQ9A 4J2BA 4E7KA 3TWHA 1VK0A 4YNQA 5JVHL 1LAVA 4IOCL 2VG7A 1GOAA 3SK3A 1LWEA 5KQ8A 1QVGM 3CJ7A 4AHRA 5AQFA 4F3OA 4H5WA 4FWSA 1D8YA 3L3UA 1BA1A 1A5VA 1QSLA 4B9MA 5J2NA 3AVNA 4CJPA 1HYSA 1EXQA 2UYTA 1NK0A 1LCUA 3F9KA 5FRMA 3D45A 3T7ZA 4FK4A 4JKDA 3CCQN 1BCMA 3ZT2A 4CZHA 4UY8O 4JKHA 2RPIA 4CZGA 1KLNA 4CJ4A 4CEBA 1YUWA 1T03A 3A5OC 4CHQA 5FPNA 2D0BA 3L4IA 2G8KA 3MN6A 5JMVA 4U67L 5BREA 3CCVN 3F9MA 2KKZA 1NGHA 4B8CA 3E9PA 2D5RA 1BL3A 4LH4A 2WUSA 4ISEA 2ZM6K 1YITN 3HRGA 3HTVA 1S1UA 4KHPK 3SMPA 1IKXA 4M3WA 4JN4A 3ALYA 1BQNA 4FOEA 5AQGA 2ITMA 3ENBA 4BGBA 2ZF5O 5M1NA 1Q18A 1C0GA 5AZIB 2KZMA 3O3HA 4CJ5A 3LANA 4CGGA 4CIGA 4A59A 3THWB 2QWQA 2JWLA 2FLOA 3OYIA 2WBNA 4CZFA 3ULEA 4PHTX 5LMUK 2QWRA 4FPBA 3EE8A 3I33A 4DF4A 5AQWA 4WFNL 2QA4N 2HNDA 3M3ZA 4IFYA 1RT3A 1XHZA 4N47A 4WF9L 4KB1A 3BUZB 4ZHRA 4DSFA 1BI4B 2PZSA 1BISA 4QS9A 4MFBA 3A2FA 4DV4K 3NFAA 4B1XB 3CD6N 4CK3A 3F2KA 3MAQA 1RBVA 3M6GA 4DQ8A 2F8TA 2NRXA 2IIRA 3HI0A 3MDQA 4Y1DA 4DMNA 3G4SN 1VQ6N 5KQDA 5J2QA 1IBLK 4DSKA 3OJUA 3NF6A 4KH5A 3AO5A 1NM1A 3THXA 5ADXA 2YI1A 2VWJA 4MO4A 2XRIA 4O8UA 4JKCA 4KB0A 3CCLN 3OA9A 3VTIA 3PX4A 1RTHA 3TAFA 4HUGA 4EZ9A 4FLWA 3VGKA 2GELA 3J81O 1DLOA 1YI2N 3UKRB 2PAVA 4BWMA 2IVNA 5EU7A 2YKNA 1VQPN 3VGLA 3A5MC 5KRSA 1SQKA 1E3MA 5F2RA 4M3RA 1QSYA 1QHAA 1HQUA 2ZE2A 1WBDA 4J2EA 3CCUN 3QESA 1P8ZA 3GE1A 4M7XA 3TARA 4CHOA 5GIOA 4EHUA 2QM1A 3O9RA 4DFJA 1VQLN 3H6EA 1ATNA 3OYKA 4CHPA 1OVYA 4FLVA 3DJCA 2P9NA 5CE3A 1KXPA 1GLFO 2BH1A 2GTDA 1WSGA 3AVJA 3QB0A 1ZBUA 3S3NA 3AVHA 5AQXA 2X78A 1H1VA 4DV3K 3G6EN 2NRZA 3S9HA 4JRPA 2JWKA 1HYVA 1X3NA 3KKSA 2KW4A 3VQ5A 2E4LA 2YHWA 1NKBA 4RW6A 3VQAA 1S1WA 4XEIA 4ZTJA 3UIQA 2DFFA 1Z25A 1VQNN 5BR9A 3RRGA 4PA1A 3JYTA 1HKCA 1TKTA 1JLFA 3N4QA 1CZAN 4FPAA 3VESA 3BF3A 2RE2A 3T1YK 4DSIA 3SQ4A 1RDDA 4KH6A 3G0ZA 3ZX3A 3CETA 1U47A 1N33K 1YAGA 5JVGL 4OPAA 4M3YA 3M8PA 4JI0K 2RKIA 1Q81O 1IG9A 1K6YA 4HVJA 2YHBA 5IT9O 3TSUA 1J54A 3VQ7A 4JI3K 3C0BA 4Q0BA 4LFCK 4A62A 1S3XA 1DT9A 3FR0A 4B08A 1QHTA 4H5TA 2HHQA 2GWJA 1K9MO 1BIUA 3LM2A 4CZJA 5AQJA 2P9KB 4FLZA 3QIOA 2AJQA 4H03B 3E66A 3RR7A 2ASOA 4W5QA 3CXCM 3J8AA 5BRFA 4O55A 4JKEA 2A40A 2QW9A 4GW6A 3KLFA 3RR8A 3LALA 4CJKA 3FZMA 4W5RA 1BUPA 4ELTA 5A2QO 3OS2A 3AVMA 4FWPA 4AHTA 3AGRA 3S3OA 4CJQA 2F9WA 2YJEA 3SBTA 4QS8A 3EKUA 5AZIA 5JLHA 5AZJB 2VQFK 1S1VA 1NK7A 3LL3A 4CJLA 1XNRK 3P38A 2XY7A 2PYJA 2E88A 1A5XA 1N8RO 3VEZA 2ATQA 3BY5A 1QQMA 3VEYA 4YOTA 1Q8IA 4ID1A 4M45A 3WEEB 1ATSA 4O44A 3ZEUA 4CF9A 1NK4A 1Q9XA 2VQEK 3IAYA 3OYHA 4BC2A 4EAHD 2P9PB 5GADP 4OO1J 4JS5A 1NOZA 1XC3A 3DLLL 3ULEB 4DUZK 2D0CA 4R5PA 1XNQK 3K5OA 2P9SA 3ZLJA 1KFDA 3LM9A 4FLXA 2O8DB 4RTFD 5K14A 1HNZK 4CZEA 5E26A 1M1KO 4AHSA 1WN7A 3CJ1A 4A2AA 1KVBA 2OZSA 1W7AA 1K73O 3R3LA 3PO4A 5F0XA 4FWQA 4JI1K 3RSEB 1QE1A 1LWCA 2OPSA 2A1RA 3JXUA 1NU0A 1WB9A 2Q97A 3KLIA 2OPRA 4OKKA 1ILYA 2OCEA 3QEXA 3ZT0A 3IG1A 2O4GA 2V51B 4DV2K 3PX6A 4NCBA 4BR5A 4R79A 5C15A 3H1VX 2UXDK 4JEPA 4HTLA 5CY4A 4Z94A 3JSMA 2NRWA 1L3UA 4YOYA 4IEIA 3C94A 3M1FA 2P9UB 3DOLA 2FSJA 2R7YA 4LF4K 3IUCA 3HP9A 2HHSA 3F73A 5EX5A 4CIEA 1SKRA 4V19S 4BWJA 4DQQA 4BRLA 4JKBA 4PQUA 3OYBA 2KHOA 3K5NA 4FLYA 5KI6A 1Z26A 1NK8A 1I3AA 1KRPA 4DSEA 1TK5A 1VSDA 2DPNA 4EP4A 5B8HA 3PY8A 4DFMA 3W3DA 3AA5X 3ZETA 3TI0A 4OPKA 4FJNA 2IGIA 1HJRA 3P1GA 1JLEA 1ZYQA 1U04A 1RBSA 4WQ4C 3V6DA 4H0PA 3O80A 4AM7A 3L8BA 4DQSA 4H8KA 4BC3A 3A0IX 5I9EB 4DS5A 3K58A 3HPGA 3IS9A 3AVAA 5AQZA 3VGMA 1WLJA 3CJ9A 1RDAA 3CHWA 4JAXA 3O6WA 4DV0K 1KCFA 1HMVA 2UU9K 3THWA 3KVGA 5AQTA 4FLTA 4QAGA 1YHQN 4DU4A 3LAMA 3TAPA 1C1CA 4WQ5C 3RSEA 3C65A 5HRNA 5JLFA 4LD0A 3Q7CA 1WSFA 3T19A 5HOOA 1BOTO 4FJXA 2CH5A 2YJFA 1VQMN 5CR4A 4CF8A 2KQ2A 5BN9A 4DV7K 2QWNA 1GLDG 2QWMA 3K5MA 5GAGP 2HVIA 2GUPA 3SYZA 3R9PA 2YHYA 3D2EA 4JI5K 5GAHP 4PWDA 4LSLA 1X9WA 5H1SQ 1HYZA 4H0TB 5AFUA 4Z4CA 3W0LA 5AQPA 1K8AO 4GV9A 4MO5A 3LP3A 3CC4N 3UE5A 3SMSA 1GOBA 1HR0K 4DV1K 3AO2A 1XMOK 3QIPA 1TUUA 1JLAA 4WQ5A 1X9MA 3EYZA 4DB3A 2B5JA 1HX1A 4I2PA 1S5JA 4JYAK 4AHUA 2VYPA 4BRAA 4RW7A 2UUCK 4BR7A 4NXNK 1D4XA 4OPHA 3L2QA 1XQSC 4DTJA 4O5FA 1VQ8N 4KI4A 2V7ZA 1UOCA 3MEGA 4KI6A 2HB5A 4I9LA 3ZX0A 1FJGK 2DFHA 3I56N 1RDWX 4FSVA 3PO5A 3IDHA 1WNSA 3D7EO 4Y0WA 3QINA 2G8FA 2F9TA 3THYB 4CF0A 4DTXA 1Y97A 4OGCA 2YHXA 4CHNA 3V9SA 2YV0X 4DR1K 4B1YB 4CEQA 4XIUA 3ZSRA 4BRIA 4E7LA 3CC2N 3I55N 4GY2B 1Q86O 4CD1A 4DUYK 3LPTA 1REVA 2O8CB 5JICA 4X62K 4ISFA 1TL3A 1U48A 2P9SB 3LDOA 3B8AX 3HSTB 3E9OA 4FJKA 2ASPA 1HNWK 2A3ZA 4DV6K 1RBRA 3RWUA 3O3GA 4FJHA 4CJRA 3RMBA 3CCSN 4FO0A 1S72N 1VSIA 4JD2B 3ZSXA 4I6MB 4X64K 3VERA 1KQSM 1Y64A 2E20A 4BDYA 3C7NB 2I7PA
chains in the Genus database with same CATH topology
4JI5K 5LL6Z 4DR5K 5BR8K 3T1YK 4JI7K 4JI1K 2UXCK 4DV4K 1N34K 4DR7K 4LF8K 4AQYK 1N33K 1HR0K 4LFBK 3T1HK 4CVNE 4DV1K 4DV2K 1N36K 1XMOK 4B3RK 3J7YP 1IBLK 4JI0K 4LF7K 4LFAK 4JI2K 2UXDK 4DR3K 5IT9O 4OX9K 4JI8K 4JI3K 4LFCK 5IWAK 1XMQK 5LMNK 4JYAK 2UUCK 4NXNK 4LF4K 4V19S 4X65K 1N32K 4B3TK 1I94K 2UXBK 2UUAK 3J81O 1IBMK 4NXMK 3JAMO 1FJGK 3J7AP 4B3MK 4LF5K 1HNXK 5FLXO 5AJ3K 5A2QO 4JI6K 1J5EK 3J80O 4CW7B 4LF6K 4DV5K 4JI4K 4DR1K 2VQFK 4GKKK 1XNRK 4X66K 2ZM6K 4B3SK 4KHPK 4DUYK 2E5LK 4YY3K 4X62K 4DV0K 4YHHK 4DR6K 2UU9K 4JV5K 2F4VK 1HNWK 4DV3K 4DV6K 2VQEK 4LF9K 4DR2K 2HHHK 2UUBK 4DUZK 1IBKK 4GKJK 3OTOK 4X64K 4K0KK 1XNQK 5LMUK 4DR4K 4DV7K 1HNZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 K;  5LL6 Z;  4DR5 K;  5BR8 K;  3T1Y K;  4JI7 K;  4JI1 K;  2UXC K;  4DV4 K;  1N34 K;  4DR7 K;  4LF8 K;  4AQY K;  1N33 K;  1HR0 K;  4LFB K;  3T1H K;  4CVN E;  4DV1 K;  4DV2 K;  1N36 K;  1XMO K;  4B3R K;  3J7Y P;  1IBL K;  4JI0 K;  4LF7 K;  4LFA K;  4JI2 K;  2UXD K;  4DR3 K;  5IT9 O;  4OX9 K;  4JI8 K;  4JI3 K;  4LFC K;  5IWA K;  1XMQ K;  5LMN K;  4JYA K;  2UUC K;  4NXN K;  4LF4 K;  4V19 S;  4X65 K;  1N32 K;  4B3T K;  1I94 K;  2UXB K;  2UUA K;  3J81 O;  1IBM K;  4NXM K;  3JAM O;  1FJG K;  3J7A P;  4B3M K;  4LF5 K;  1HNX K;  5FLX O;  5AJ3 K;  5A2Q O;  4JI6 K;  1J5E K;  3J80 O;  4CW7 B;  4LF6 K;  4DV5 K;  4JI4 K;  4DR1 K;  2VQF K;  4GKK K;  1XNR K;  4X66 K;  2ZM6 K;  4B3S K;  4KHP K;  4DUY K;  2E5L K;  4YY3 K;  4X62 K;  4DV0 K;  4YHH K;  4DR6 K;  2UU9 K;  4JV5 K;  2F4V K;  1HNW K;  4DV3 K;  4DV6 K;  2VQE K;  4LF9 K;  4DR2 K;  2HHH K;  2UUB K;  4DUZ K;  1IBK K;  4GKJ K;  3OTO K;  4X64 K;  4K0K K;  1XNQ K;  5LMU K;  4DR4 K;  4DV7 K;  1HNZ K; 
#chains in the Genus database with same CATH topology
 3EO3 A;  5D3G A;  4FYD A;  1ESV A;  5FDL A;  1VSF A;  1NGC A;  2YCH A;  4Z4G A;  3DRR A;  4DR7 K;  3HVR A;  1X1P A;  4AQY K;  1YTU A;  3HM8 A;  3ATU A;  4K42 A;  3KLH A;  1HPM A;  4BRQ A;  1CXQ A;  4HUE A;  4B3R K;  3M8Q A;  5C2D A;  1TK8 A;  4QCL A;  4W5N A;  1E4G T;  3O4N A;  3SJH A;  3THX B;  4BRN A;  3KLE A;  4JI8 K;  3DXM A;  2O8B B;  4DTP A;  1EX4 A;  5EVZ A;  1NGJ A;  3U3Y A;  2XY8 A;  2HBK A;  2QI2 A;  1TK0 A;  3QEW A;  5AR0 A;  3RMD A;  2AP1 A;  3IMX A;  1P90 A;  3HBT A;  2KTQ A;  1NWK A;  3DLG A;  4B9N A;  2NRV A;  3SUN A;  1WAJ A;  3O9U A;  2HF3 A;  3QML A;  2O8E A;  5J1E A;  1JLB A;  1QVF M;  1U2V A;  2RN2 A;  3AA4 A;  3A8Y A;  4FJL A;  3V1Q A;  3AO3 A;  3NBP A;  3EZW A;  4FW1 A;  3VEV A;  3FGU A;  4KHU A;  3HOS A;  3J80 O;  4JI4 K;  4IKF A;  3NAE A;  3WQU A;  5LJW A;  5HBM A;  3QNO A;  2G8I A;  4FJ8 A;  2P9N B;  4YDU A;  3O9Q A;  1Q7Y O;  4YY3 K;  4JS4 A;  4GVM A;  4DF8 A;  2WON A;  2F4V K;  5BN8 A;  1ZBI A;  3Q7B A;  2PBD A;  4CGI A;  3WEE A;  2PY5 A;  1RT1 A;  1G15 A;  4IOX A;  5M1P A;  1YF5 L;  3MCA B;  4FZY A;  3CCR N;  1ASU A;  4I2Q A;  3WXJ A;  4BVO A;  5F1X A;  4JLH A;  4LH5 A;  5C42 A;  4MDB A;  1SS6 A;  5GIN A;  3I8B A;  4OPJ A;  3K2P A;  4LF8 K;  1KD1 O;  2W40 A;  4CCH A;  1BQM A;  3DM2 A;  3ZT4 A;  3GDQ A;  4XH4 A;  2O8D A;  4LC9 B;  3MXI A;  1RNH A;  4NB4 A;  4OX9 K;  1WSI A;  3V4I A;  1T6C A;  4IEE A;  4BG9 A;  2HHU A;  2YNF A;  4CJ7 A;  4Z0U A;  5E84 A;  1UA1 A;  4DLE A;  2CGJ A;  5KRT A;  2WTU A;  1C1B A;  5CYM A;  1VRT A;  3DXK A;  5FPE A;  1WSH A;  3MX5 A;  1IH7 A;  2IDO A;  4Q5V A;  3J7A P;  2I7N A;  4A2B A;  3BGR A;  3LWM A;  4WCE L;  3TSQ A;  2NRT A;  3CIP A;  1SL1 A;  4GNI A;  2RF2 A;  1NG9 A;  4WE1 A;  4EP5 A;  4KTW A;  5JS1 A;  1UAX A;  3DWL A;  3KIO A;  2E6M A;  4H5R A;  2BTF A;  4HTU A;  3THY A;  2XY5 A;  5HRO A;  4BRF A;  3QNN A;  3RMC A;  4MDA A;  5C10 A;  4I9Q A;  3KK7 A;  3P83 D;  3LPU A;  4W5T A;  3BZK A;  4FXD A;  2XY6 A;  2YHA A;  5AQI A;  4K8Z A;  4CGJ A;  1SAZ A;  4CFA A;  3QFP A;  4BR4 A;  1QTM A;  4FJI A;  1CZB A;  4HHT A;  4IDK A;  1IJJ A;  2Q2R A;  4YHH K;  3L0Q A;  2W6L A;  4ILJ A;  2E2P A;  4B8A B;  4CJS A;  1RT2 A;  3MN7 A;  3CPW M;  4KH4 A;  3U3G A;  3V9X A;  2E1Y A;  3VQQ A;  4JKF A;  4RW9 A;  3K59 A;  1JL1 A;  3OYJ A;  1IBK K;  2P5O A;  3O8M A;  1RGI A;  3CM5 A;  3LDP A;  3QEI A;  2V7Y A;  3LDQ A;  4H0X B;  3LAK A;  4CJT A;  1VQ7 N;  5AQO A;  3ISN C;  5CZ2 A;  4BDP A;  3RRH A;  3MK6 A;  5M1O A;  3ULD A;  3SQ1 A;  4JI7 K;  1NK5 A;  1RT6 A;  1ATR A;  4BQZ A;  3EZ5 A;  3BDP A;  4IJN A;  4PUO A;  3U4L A;  3VTH A;  1N36 K;  4C8K A;  4BGA A;  4FJ5 A;  4H4M A;  1JXB A;  3CI5 A;  4LFA K;  2ZD1 A;  3O08 A;  2OTL N;  4CEC A;  1X9S A;  2RHK A;  3LP2 A;  3L2U A;  4E1J A;  3K5L A;  3LP1 A;  5C25 A;  1YJW N;  4H4O A;  1W2B M;  1MWM A;  5I3U A;  1KVA A;  2DFE A;  1DEJ A;  3OYM A;  4FK0 A;  4JK7 A;  3MN5 A;  1C0U A;  3PIO L;  1KFS A;  1QQC A;  2AA4 A;  1BWF O;  4EZ6 A;  1RT4 A;  3CJC A;  3AV9 A;  2Q3S A;  3NGY A;  4O0J A;  4FJM A;  1JL2 A;  3TTD A;  1C0T A;  5DM6 L;  3VA0 A;  2P9U A;  4DTO A;  2YKM A;  4CJV A;  1S6P A;  3VQ6 A;  4BE1 A;  3JS6 A;  1L3T A;  4DFP A;  2JLE A;  4BRC A;  3ZCM A;  3O5B A;  1QS4 A;  1FK9 A;  2ZQB A;  1V4S A;  4DV5 K;  3HZ6 A;  4M42 A;  1RDU A;  1S9G A;  1RTD A;  1KC8 O;  1NGF A;  1BU6 O;  4E7J A;  4FJ7 A;  2BE2 A;  1YT3 A;  3R1X A;  4FK2 A;  3WXK A;  5E41 A;  3ZX2 A;  1W0H A;  1U45 A;  4KHW A;  1OH6 A;  4RCH A;  3AAQ A;  4ILG B;  1X3M A;  3V1R A;  1SL0 A;  1TUY A;  2P9L A;  3F5T A;  4CIF A;  4I6M A;  4XH5 A;  5C12 A;  3S3M A;  3SI6 A;  2J4R A;  5GIP A;  3K0S A;  4DTS A;  3VET A;  3E01 A;  4YOR A;  3O1B A;  3QEP A;  4FL9 A;  3QBX A;  4FVU A;  2GV9 A;  3J7Z O;  3CER A;  4PKH A;  3SQ0 A;  2FSK A;  4BRE A;  3UKU B;  1HNV A;  5AQR A;  2Y1I A;  3CCE N;  1JJ2 M;  3PUF A;  3WT0 A;  4CI6 A;  3KK1 A;  4KFB A;  4WQ4 A;  1K8K A;  4F4K A;  4CK2 A;  2Q0U A;  3ENH A;  1NJY A;  1YVU A;  3DRP A;  4E1N A;  2X6S A;  4JD2 A;  2YNI A;  2G8H A;  4JNE A;  5KPZ A;  1Q9Y A;  2XHB A;  4F9O A;  4IWV A;  4CJF A;  4GV3 A;  1YXQ A;  3AVI A;  2FBT A;  1OH8 A;  3ZSZ A;  3OYD A;  3GBT A;  4N41 A;  4DQI A;  5GAE P;  3NGI A;  1XMQ K;  3CF5 L;  4CHY A;  3AVC A;  3OS1 A;  4M41 A;  3H08 A;  1NGB A;  4CFB A;  1SV5 A;  2G8U A;  2HBJ A;  3T69 A;  1BGX T;  3VQB A;  4F2S A;  5HRS A;  2QEX N;  1LOT B;  2P5G A;  1WUA A;  5AZJ A;  1T8E A;  4B3M K;  1LAW A;  4BRO A;  2H3G X;  3CMA N;  4JK9 A;  4DTU A;  1DTQ A;  3HO1 A;  5AJ3 K;  2ASM A;  2HHW A;  4DSL A;  4B9V A;  3DLB A;  2HMI A;  1FW6 A;  3E9L A;  1S9E A;  3AVF A;  4FWR A;  1LW2 A;  3DLH A;  3P31 A;  4J2A A;  3H45 C;  1IO2 A;  3EKS A;  1MA9 B;  2PYL A;  1RFQ A;  4CD3 A;  4L8R B;  4G9Z A;  3VF6 A;  3ATV A;  3NCI A;  4B9U A;  1BCO A;  1MWK A;  4PKG A;  1NLV A;  2PFU A;  3H3O B;  4BRD A;  2A5X A;  4FJJ A;  2OTJ N;  4N56 A;  2FBX A;  4JV5 K;  1VQK N;  4B1Z A;  5BPM A;  4Z4I A;  4DTN A;  4DHY A;  3D2F A;  4CFD A;  4KHS A;  3MED A;  1LWF A;  2HHH K;  3T3F A;  1L3S A;  4CBW A;  4H0Y B;  3CFR A;  4FWK A;  1NGA A;  1G99 A;  4CZK A;  2FBV A;  3DLR A;  3L4Q A;  1JCE A;  4NCG A;  3WNH A;  4KTQ A;  3B6O A;  3I8D A;  4JHD B;  3WNE A;  2NUB A;  1O13 A;  5KTQ A;  3QEV A;  2EX3 A;  2QKK A;  1J9A A;  4ELU A;  1GLE G;  4CZI A;  3QO9 A;  5BR8 K;  3IKM A;  3VEX A;  1IKY A;  4A5B A;  3MMV A;  1HKG A;  2BUP A;  3WXM B;  3BP8 A;  3PSF A;  3CQX A;  4M3X A;  3K9K A;  4AHV A;  4B1U B;  2WOM A;  4H0V B;  1JLC A;  4JI2 K;  1NK9 A;  2CGK A;  3C6U A;  4CEE A;  1TGO A;  4CE9 A;  1RDB A;  1M90 O;  1ZBF A;  3D2E B;  1NK6 A;  3NH0 A;  2OA8 A;  3TAM A;  5LMN K;  1GLJ O;  3SZ2 A;  3AAR A;  4NCA A;  5M1K A;  4FJG A;  4H5N A;  3AAP A;  2HNZ A;  5AQH A;  1S1T A;  1C6V A;  4K41 A;  1MDU B;  3KLG A;  4KHQ A;  2UUA K;  3SNN A;  4RW4 A;  2W41 A;  4FM0 A;  4FWN A;  3V9Z A;  2G8V A;  4E3S A;  4DQP A;  2P9I A;  4C8O A;  2HBL A;  4KHY A;  3I0S A;  1RBU A;  3VF2 A;  4CW7 B;  3MEC A;  3MCP A;  2O8E B;  5BRH A;  1XUP O;  1DKG D;  1S1X A;  2ZJQ L;  4C8M A;  3WQT A;  3TR8 A;  1DTT A;  3SCX A;  4KAZ A;  3L2V A;  4BQL A;  4GVE A;  3DXK B;  1TKD A;  3B6P A;  3O9S A;  5SZT A;  2F8S A;  1I39 A;  3IRX A;  4CFC A;  2HHX A;  1KAY A;  3FZK A;  4CEO A;  2E5L K;  3MXJ A;  4OVL A;  3LP0 A;  5M1Q A;  1TKX A;  1SKW A;  2P9L B;  3V1O A;  4IG3 A;  4CF2 A;  4DSJ A;  2F7T A;  3ID6 A;  3TAB A;  3IFR A;  2HOE A;  4DR2 K;  3S41 A;  3DLK A;  3HM9 A;  1WOQ A;  3VQ4 A;  2QWL A;  4AH9 A;  4GKJ K;  3OTO K;  4CF1 A;  2ETJ A;  4CZL A;  1QZ5 A;  1FXX A;  3CYM A;  3TTC A;  3SJJ A;  4EIA A;  3FE1 A;  2BDP A;  3AA2 A;  5LL6 Z;  1DGK N;  1U49 A;  4IJA A;  4ELV A;  1RT7 A;  3P5J A;  4KV8 A;  1A5W A;  1VSH A;  2A6A A;  4KTZ A;  2E8A A;  3D6R A;  4HCB A;  2HST A;  4BRH A;  4JKG A;  1NMD A;  2E2Q A;  4LFB K;  1TKZ A;  2Q0R A;  3EN9 A;  1BG3 A;  4YFU A;  1ZXO A;  1W97 L;  1N6Q A;  5KGX A;  1JKH A;  4A57 A;  5HP1 A;  2O8F B;  3QET A;  1JCF A;  3AA3 A;  3CCM N;  5EY4 A;  4GMJ B;  2HMP A;  1VQ9 N;  2ZGY A;  2VCP A;  2QWO A;  4QS7 A;  3EEQ A;  5IWA K;  4RG8 A;  3VQC A;  3OYE A;  4CGH A;  3TU5 A;  2P9K A;  4FZZ A;  3M8S A;  1MU2 A;  2Z1H A;  1I94 K;  3NDK A;  2WFB A;  5SWM A;  3VA3 A;  3NE6 A;  1QQO A;  3JAM O;  3QIC A;  3KK3 A;  2VWK A;  2FC0 A;  4WYB A;  5FRN A;  1KAZ A;  2HW3 A;  4BC4 A;  2KLA A;  5FLX O;  1GLA G;  4Z4E A;  4IOA L;  4CGF A;  4CZM A;  3MEE A;  4EFH A;  4KO0 A;  4O4G A;  3THV A;  1J5E K;  1Z6R A;  1S6Q A;  2Q1N A;  3OYF A;  3DRS A;  4LF6 K;  3ITH A;  2ZGZ A;  3TTF A;  3O4Q A;  5AQM A;  3ZT1 A;  4NYN A;  3PSI A;  1JLG A;  2YNG A;  4B3S K;  2P9P A;  3FZL A;  4DG1 A;  1NJW A;  5AFU H;  3LZI A;  4CEA A;  1IG8 A;  2E2N A;  4B9L A;  3ZEU B;  5LJV A;  3NVM A;  4CGD A;  1CZ9 A;  4AHC A;  4JKA A;  4ILH A;  5HLF A;  3KHY A;  4CER A;  2UUB K;  3OVN A;  3OBY A;  1ASV A;  4JK8 A;  1WSE A;  3NH2 A;  3LWL A;  3ID8 A;  1N5Y A;  4DR4 K;  4KBO A;  4AM6 A;  5EXW A;  5BRD A;  2A41 A;  3E1Y A;  1VQO N;  3G25 A;  4CHZ A;  5EOY A;  1BDG A;  4M3Z A;  1SZ2 A;  2OPQ A;  1J6Z A;  1VSL A;  3OHR A;  4YOW A;  1T3V A;  5MLC Q;  3VPZ A;  3AVG A;  4DCH A;  3HYF A;  1WAF A;  3HT3 A;  4W5O A;  5DM7 L;  4O0I A;  5KGW A;  4O8K A;  4YOU A;  4BR0 A;  4OLA A;  1BO5 O;  3K57 A;  3MWP A;  4CVN E;  3M8R A;  4E7I A;  1Z05 A;  1HUX A;  2D1K A;  5ELZ A;  4IBN A;  3J7Y P;  1D9D A;  3L2W A;  5C0Y A;  3KK2 A;  1VHX A;  3TAN A;  2GEM A;  1KLM A;  4IFE A;  4LY7 A;  3DOK A;  4PKI A;  4ISG A;  2NRR A;  3BZC A;  3QBW A;  3SUQ A;  2OAN A;  3QDK A;  4IFV A;  1N32 K;  3FFK B;  2IOC A;  1T7P A;  1X9J A;  4C23 A;  4BRP A;  4LF5 K;  1NJI O;  3ZSW A;  3SUP A;  2P9I B;  4KRE A;  4IZ9 A;  4FW2 A;  3SUO A;  3CG7 A;  3VEO A;  3VF4 A;  1E4F T;  5M1F A;  3A5N C;  4X66 K;  3WXI A;  3FFI A;  1RCH A;  2OZM A;  5ADX H;  3TAG A;  3GG4 A;  1J53 A;  1UWB A;  1OH5 A;  4DR6 K;  3AVL A;  1EP4 A;  4BR9 A;  1IKV A;  1IKW A;  3AVB A;  4FVM A;  5I42 A;  3VOV A;  5AQY A;  2QKB A;  3HP6 A;  3AVK A;  4FZX C;  5HRP A;  1TVR A;  3GL1 A;  4JHD A;  4BE2 A;  4DLG A;  3NH1 A;  1C1A A;  1VSK A;  4DQR A;  1YIJ N;  1L3V A;  1NKC A;  4FWM A;  4ID5 A;  1TL1 A;  3KD1 E;  1C0F A;  1TYQ A;  1RDC A;  1VSM A;  4CEZ A;  1W9H A;  1HKB A;  1OVQ A;  3AO4 A;  4MQ3 A;  5LY3 A;  4M7Y A;  1BA0 A;  4JKG B;  2DY4 A;  3D0P A;  1GLC G;  3SAH A;  2G8W A;  4N76 A;  3FLC O;  2IC3 A;  3OYA A;  3LDS A;  2WC9 A;  1EKE A;  1F21 A;  1OKJ A;  3N4P A;  3SLC A;  4IO8 A;  3TPQ A;  4OKE A;  5C24 A;  4DS4 A;  1KAX A;  3WNF A;  4CEF A;  3OYN A;  3CJB A;  3LDN A;  1HNI A;  3CCJ N;  3L3V A;  2QK9 A;  3CFO A;  3KWG A;  3VMF B;  3C95 A;  4X65 K;  1SKS A;  1ZBH A;  2HHV A;  3QLH A;  1NBW A;  2FSN A;  2QXL A;  4A61 A;  4B3T K;  1U2V B;  1EWR A;  3ZT3 A;  3SPY A;  4KRF A;  2D0P A;  3PIP L;  3SPZ A;  3T1A A;  3O4W A;  4NLB A;  4U7B A;  1XI1 A;  4AIL C;  4FWO A;  4GV6 A;  2IVO A;  2Z1G A;  3L6Q A;  2BGG A;  3SAF A;  2Q31 A;  1T44 A;  3MWT A;  1C0M A;  4M3U A;  4JI6 K;  2O8C A;  1HRH A;  3C6H A;  3HL8 A;  4BAC A;  1KSP A;  1EWQ A;  3C6T A;  1Q82 O;  1ITG A;  4N5S A;  5AQQ A;  4FJ9 A;  4DU3 A;  3NGZ A;  3LDL A;  2HNY A;  2P51 A;  2NRH A;  1TV6 A;  1KTQ A;  3O1W A;  1NOY A;  2ITG A;  1CLQ A;  2HF4 A;  3G71 N;  1JCG A;  4K25 A;  3HVT A;  3I0R A;  3OYL A;  4DTM A;  1VSE A;  3CM6 A;  5FRO A;  4MLH A;  2KZZ A;  1BI4 A;  4OJR A;  4B1V A;  1GLB G;  1TYQ B;  4K0K K;  3C7N A;  5T7B A;  2A42 A;  4B9Q A;  3HOT A;  3PLA A;  4E7H A;  1NKE A;  1QSS A;  3VEW A;  4DR5 K;  1TAU A;  1VAZ A;  4HWI A;  4CK1 A;  2V52 B;  2X74 A;  2LSN A;  4AF1 A;  3AGK A;  4HUF A;  3UB5 A;  3AO1 A;  1NNE A;  2VGN A;  4H5V A;  4WFA L;  2O8F A;  2FXU A;  5CYQ A;  4LF7 K;  1R59 O;  4L3Q A;  2ZJR L;  4TSX A;  1NGE A;  1EET A;  3DXM B;  2O8B A;  1K8K B;  4CJW A;  2IVP A;  3QER A;  1NJX A;  2HHT A;  1VRU A;  4BR2 A;  3U6F A;  1ZC6 A;  3WXL A;  2KFN A;  4C1N K;  2Z1I A;  4BE0 A;  4YOV A;  1D9F A;  4KKO A;  4F3T A;  3SAG A;  3DMJ A;  1TAQ A;  2F96 A;  3R6M A;  4NXM K;  2IS3 A;  2O4I A;  4JRQ A;  3CQ8 A;  4FM2 A;  2CGL A;  2ZJP L;  1T05 A;  3HSC A;  2FBY A;  4DTR A;  1YTA A;  2ZWH A;  3HPH A;  3SQ2 A;  1B9F A;  3NF8 A;  3C6A A;  4OKJ A;  5KPT A;  3LZJ A;  3U9D A;  3VQE A;  3V9U A;  4BY9 C;  4I7F A;  1B92 A;  3DYA A;  3O3F A;  3KWI A;  3V9W A;  4K8X A;  4PL8 A;  1D5A A;  2EHG A;  4CJE A;  4XH1 A;  1GLL O;  2YX6 A;  1RBT A;  4FCY A;  3GOI A;  5AQU A;  3WUH A;  3WNG A;  3CJA A;  1GOC A;  3ZSV A;  2FF3 B;  4CES A;  1JLQ A;  2E1Z A;  1BIZ A;  3CFP A;  2CH6 A;  4B9T A;  2W42 A;  1VSJ A;  3OYG A;  3HXM A;  2NLX A;  4QOZ B;  1NJZ A;  3P39 A;  3EE9 A;  3ZSO A;  3KD5 E;  1IV0 A;  3PV8 A;  4LSN A;  3U9Z A;  2EWS A;  3HPO A;  3OY9 A;  1L5U A;  5AQS A;  3RVC A;  2UXC K;  1ASW A;  1WSJ A;  4C8N A;  1N34 K;  3G10 A;  4C8L A;  2VG5 A;  4K43 A;  5FPD A;  3CPE A;  5HL7 L;  3ZSQ A;  1J5O A;  4OGE A;  4NLC A;  2NNW A;  1JXE A;  4ZTF A;  1UA0 A;  4EHT A;  3CQY A;  1SUQ A;  2HBM A;  4G1Q A;  4DR3 K;  5TKW A;  1XWL A;  3DAW A;  2OPP A;  4NYF A;  3DLE A;  4B9S A;  4M63 C;  3OW2 M;  4BG8 A;  1NGD A;  4Z4H A;  3RTV A;  4KHN A;  3VQD A;  1FKP A;  2Q36 A;  2GX9 A;  4Z4F A;  2I5J A;  3ENO A;  4H0O A;  4CED A;  5KPR A;  3OJS A;  4FLU A;  1HLU A;  3HK2 A;  1QZ6 A;  3VN5 A;  3HJF A;  1WBB A;  4E0D A;  4YDU C;  1LV5 A;  3M5R A;  1U4B A;  1HNX K;  3A5L C;  1EO1 A;  1RIL A;  3VQP A;  5J2P A;  1OH7 A;  3NVK A;  3EL2 A;  4OLB A;  3NMU A;  4FM1 A;  4YOX A;  2VGM A;  4B1W B;  4BRM A;  3CC7 N;  3BEX A;  2GBZ A;  1VQ4 N;  2Y1J A;  4E89 A;  5AQL A;  3NF9 A;  4BRK A;  4WFB L;  1SL2 A;  4HCC A;  4M3T A;  2GWK A;  4UQG A;  5AQV A;  3TSP A;  3SV3 A;  1YJ9 N;  4IXC A;  2QXF A;  3KKR A;  3BF1 A;  4RWT A;  4LF9 K;  4C1N I;  4F2R A;  3UKU A;  1BHL A;  4CJ3 A;  1RTJ A;  3DI6 A;  4BC5 A;  2W6K A;  4BRG A;  3H46 O;  4CBU A;  2D0A A;  1HJO A;  1HQE A;  5AQN A;  2E6L A;  4O5B A;  4BVP A;  5CHI A;  3EY1 A;  1QQN A;  3SV4 A;  2B4J A;  1KVC A;  2X6N A;  4E19 A;  1CXU A;  4IDH A;  3MN9 A;  3QFU A;  2IAJ A;  1B9D A;  3ASM A;  4ICL A;  5HRR A;  2FF6 A;  3T1H K;  2OYQ A;  5TKY A;  4DWI A;  1S22 A;  3KZB A;  2JGU A;  2A1S A;  1U6Z A;  1XHX A;  4PY5 A;  1VQ5 N;  4KPY A;  4MLE A;  2VWB A;  4IG0 A;  2KFZ A;  3TAQ A;  4IO9 L;  3RMA A;  3R8E A;  3MX2 A;  1RT5 A;  3K9J A;  1ZBL A;  1EQY A;  4RW8 A;  3NHG A;  3CME N;  3KJV A;  1V4T A;  2D4W A;  1LW0 A;  2UXB K;  1IBM K;  5CZ1 A;  3OYC A;  2B6A A;  4BDZ A;  4CBX A;  3SBG A;  2GUI A;  3UKR A;  3P4I A;  4J2D A;  3KTQ A;  5JS2 A;  1O1W A;  3FZF A;  1T6D A;  3ZET B;  1YVN A;  2D0O A;  2NZT A;  2QTD A;  5BPN A;  3D2F B;  5J2M A;  4CJU A;  3ZYY X;  1NMN A;  2HVH A;  3OS0 A;  2QWP A;  3H1Q A;  2E2O A;  5BPL A;  4GKK K;  3PX0 A;  2YNH A;  4FWL A;  5DMR A;  3H3N O;  4DFK A;  1NGI A;  4DKW A;  1RTI A;  5DK5 A;  1FKO A;  3VEN A;  4E1M A;  3AY9 A;  4F8R A;  2P1J A;  2XO7 A;  3MXM A;  1R0A A;  2Z1J A;  2DTU A;  3OBW A;  4PL7 A;  1ZBS A;  2BAN A;  3FZH A;  4DU1 A;  4A5A A;  4B3O A;  1NGG A;  3NF7 A;  2VG6 A;  1HPZ A;  3U8X A;  3VQ8 A;  4FOI A;  3TAE A;  3L2R A;  5C2F A;  5FPM A;  1YJN N;  4NO7 A;  3V81 A;  1XC9 A;  4J8F A;  3O9T A;  4Y1C A;  3ZSY A;  5AQK A;  3VQ9 A;  4J2B A;  4E7K A;  3TWH A;  1VK0 A;  4YNQ A;  5JVH L;  1LAV A;  4IOC L;  2VG7 A;  1GOA A;  3SK3 A;  1LWE A;  5KQ8 A;  1QVG M;  3CJ7 A;  4AHR A;  5AQF A;  4F3O A;  4H5W A;  4FWS A;  1D8Y A;  3L3U A;  1BA1 A;  1A5V A;  1QSL A;  4B9M A;  5J2N A;  3AVN A;  4CJP A;  1HYS A;  1EXQ A;  2UYT A;  1NK0 A;  1LCU A;  3F9K A;  5FRM A;  3D45 A;  3T7Z A;  4FK4 A;  4JKD A;  3CCQ N;  1BCM A;  3ZT2 A;  4CZH A;  4UY8 O;  4JKH A;  2RPI A;  4CZG A;  1KLN A;  4CJ4 A;  4CEB A;  1YUW A;  1T03 A;  3A5O C;  4CHQ A;  5FPN A;  2D0B A;  3L4I A;  2G8K A;  3MN6 A;  5JMV A;  4U67 L;  5BRE A;  3CCV N;  3F9M A;  2KKZ A;  1NGH A;  4B8C A;  3E9P A;  2D5R A;  1BL3 A;  4LH4 A;  2WUS A;  4ISE A;  2ZM6 K;  1YIT N;  3HRG A;  3HTV A;  1S1U A;  4KHP K;  3SMP A;  1IKX A;  4M3W A;  4JN4 A;  3ALY A;  1BQN A;  4FOE A;  5AQG A;  2ITM A;  3ENB A;  4BGB A;  2ZF5 O;  5M1N A;  1Q18 A;  1C0G A;  5AZI B;  2KZM A;  3O3H A;  4CJ5 A;  3LAN A;  4CGG A;  4CIG A;  4A59 A;  3THW B;  2QWQ A;  2JWL A;  2FLO A;  3OYI A;  2WBN A;  4CZF A;  3ULE A;  4PHT X;  5LMU K;  2QWR A;  4FPB A;  3EE8 A;  3I33 A;  4DF4 A;  5AQW A;  4WFN L;  2QA4 N;  2HND A;  3M3Z A;  4IFY A;  1RT3 A;  1XHZ A;  4N47 A;  4WF9 L;  4KB1 A;  3BUZ B;  4ZHR A;  4DSF A;  1BI4 B;  2PZS A;  1BIS A;  4QS9 A;  4MFB A;  3A2F A;  4DV4 K;  3NFA A;  4B1X B;  3CD6 N;  4CK3 A;  3F2K A;  3MAQ A;  1RBV A;  3M6G A;  4DQ8 A;  2F8T A;  2NRX A;  2IIR A;  3HI0 A;  3MDQ A;  4Y1D A;  4DMN A;  3G4S N;  1VQ6 N;  5KQD A;  5J2Q A;  1IBL K;  4DSK A;  3OJU A;  3NF6 A;  4KH5 A;  3AO5 A;  1NM1 A;  3THX A;  5ADX A;  2YI1 A;  2VWJ A;  4MO4 A;  2XRI A;  4O8U A;  4JKC A;  4KB0 A;  3CCL N;  3OA9 A;  3VTI A;  3PX4 A;  1RTH A;  3TAF A;  4HUG A;  4EZ9 A;  4FLW A;  3VGK A;  2GEL A;  3J81 O;  1DLO A;  1YI2 N;  3UKR B;  2PAV A;  4BWM A;  2IVN A;  5EU7 A;  2YKN A;  1VQP N;  3VGL A;  3A5M C;  5KRS A;  1SQK A;  1E3M A;  5F2R A;  4M3R A;  1QSY A;  1QHA A;  1HQU A;  2ZE2 A;  1WBD A;  4J2E A;  3CCU N;  3QES A;  1P8Z A;  3GE1 A;  4M7X A;  3TAR A;  4CHO A;  5GIO A;  4EHU A;  2QM1 A;  3O9R A;  4DFJ A;  1VQL N;  3H6E A;  1ATN A;  3OYK A;  4CHP A;  1OVY A;  4FLV A;  3DJC A;  2P9N A;  5CE3 A;  1KXP A;  1GLF O;  2BH1 A;  2GTD A;  1WSG A;  3AVJ A;  3QB0 A;  1ZBU A;  3S3N A;  3AVH A;  5AQX A;  2X78 A;  1H1V A;  4DV3 K;  3G6E N;  2NRZ A;  3S9H A;  4JRP A;  2JWK A;  1HYV A;  1X3N A;  3KKS A;  2KW4 A;  3VQ5 A;  2E4L A;  2YHW A;  1NKB A;  4RW6 A;  3VQA A;  1S1W A;  4XEI A;  4ZTJ A;  3UIQ A;  2DFF A;  1Z25 A;  1VQN N;  5BR9 A;  3RRG A;  4PA1 A;  3JYT A;  1HKC A;  1TKT A;  1JLF A;  3N4Q A;  1CZA N;  4FPA A;  3VES A;  3BF3 A;  2RE2 A;  3T1Y K;  4DSI A;  3SQ4 A;  1RDD A;  4KH6 A;  3G0Z A;  3ZX3 A;  3CET A;  1U47 A;  1N33 K;  1YAG A;  5JVG L;  4OPA A;  4M3Y A;  3M8P A;  4JI0 K;  2RKI A;  1Q81 O;  1IG9 A;  1K6Y A;  4HVJ A;  2YHB A;  5IT9 O;  3TSU A;  1J54 A;  3VQ7 A;  4JI3 K;  3C0B A;  4Q0B A;  4LFC K;  4A62 A;  1S3X A;  1DT9 A;  3FR0 A;  4B08 A;  1QHT A;  4H5T A;  2HHQ A;  2GWJ A;  1K9M O;  1BIU A;  3LM2 A;  4CZJ A;  5AQJ A;  2P9K B;  4FLZ A;  3QIO A;  2AJQ A;  4H03 B;  3E66 A;  3RR7 A;  2ASO A;  4W5Q A;  3CXC M;  3J8A A;  5BRF A;  4O55 A;  4JKE A;  2A40 A;  2QW9 A;  4GW6 A;  3KLF A;  3RR8 A;  3LAL A;  4CJK A;  3FZM A;  4W5R A;  1BUP A;  4ELT A;  5A2Q O;  3OS2 A;  3AVM A;  4FWP A;  4AHT A;  3AGR A;  3S3O A;  4CJQ A;  2F9W A;  2YJE A;  3SBT A;  4QS8 A;  3EKU A;  5AZI A;  5JLH A;  5AZJ B;  2VQF K;  1S1V A;  1NK7 A;  3LL3 A;  4CJL A;  1XNR K;  3P38 A;  2XY7 A;  2PYJ A;  2E88 A;  1A5X A;  1N8R O;  3VEZ A;  2ATQ A;  3BY5 A;  1QQM A;  3VEY A;  4YOT A;  1Q8I A;  4ID1 A;  4M45 A;  3WEE B;  1ATS A;  4O44 A;  3ZEU A;  4CF9 A;  1NK4 A;  1Q9X A;  2VQE K;  3IAY A;  3OYH A;  4BC2 A;  4EAH D;  2P9P B;  5GAD P;  4OO1 J;  4JS5 A;  1NOZ A;  1XC3 A;  3DLL L;  3ULE B;  4DUZ K;  2D0C A;  4R5P A;  1XNQ K;  3K5O A;  2P9S A;  3ZLJ A;  1KFD A;  3LM9 A;  4FLX A;  2O8D B;  4RTF D;  5K14 A;  1HNZ K;  4CZE A;  5E26 A;  1M1K O;  4AHS A;  1WN7 A;  3CJ1 A;  4A2A A;  1KVB A;  2OZS A;  1W7A A;  1K73 O;  3R3L A;  3PO4 A;  5F0X A;  4FWQ A;  4JI1 K;  3RSE B;  1QE1 A;  1LWC A;  2OPS A;  2A1R A;  3JXU A;  1NU0 A;  1WB9 A;  2Q97 A;  3KLI A;  2OPR A;  4OKK A;  1ILY A;  2OCE A;  3QEX A;  3ZT0 A;  3IG1 A;  2O4G A;  2V51 B;  4DV2 K;  3PX6 A;  4NCB A;  4BR5 A;  4R79 A;  5C15 A;  3H1V X;  2UXD K;  4JEP A;  4HTL A;  5CY4 A;  4Z94 A;  3JSM A;  2NRW A;  1L3U A;  4YOY A;  4IEI A;  3C94 A;  3M1F A;  2P9U B;  3DOL A;  2FSJ A;  2R7Y A;  4LF4 K;  3IUC A;  3HP9 A;  2HHS A;  3F73 A;  5EX5 A;  4CIE A;  1SKR A;  4V19 S;  4BWJ A;  4DQQ A;  4BRL A;  4JKB A;  4PQU A;  3OYB A;  2KHO A;  3K5N A;  4FLY A;  5KI6 A;  1Z26 A;  1NK8 A;  1I3A A;  1KRP A;  4DSE A;  1TK5 A;  1VSD A;  2DPN A;  4EP4 A;  5B8H A;  3PY8 A;  4DFM A;  3W3D A;  3AA5 X;  3ZET A;  3TI0 A;  4OPK A;  4FJN A;  2IGI A;  1HJR A;  3P1G A;  1JLE A;  1ZYQ A;  1U04 A;  1RBS A;  4WQ4 C;  3V6D A;  4H0P A;  3O80 A;  4AM7 A;  3L8B A;  4DQS A;  4H8K A;  4BC3 A;  3A0I X;  5I9E B;  4DS5 A;  3K58 A;  3HPG A;  3IS9 A;  3AVA A;  5AQZ A;  3VGM A;  1WLJ A;  3CJ9 A;  1RDA A;  3CHW A;  4JAX A;  3O6W A;  4DV0 K;  1KCF A;  1HMV A;  2UU9 K;  3THW A;  3KVG A;  5AQT A;  4FLT A;  4QAG A;  1YHQ N;  4DU4 A;  3LAM A;  3TAP A;  1C1C A;  4WQ5 C;  3RSE A;  3C65 A;  5HRN A;  5JLF A;  4LD0 A;  3Q7C A;  1WSF A;  3T19 A;  5HOO A;  1BOT O;  4FJX A;  2CH5 A;  2YJF A;  1VQM N;  5CR4 A;  4CF8 A;  2KQ2 A;  5BN9 A;  4DV7 K;  2QWN A;  1GLD G;  2QWM A;  3K5M A;  5GAG P;  2HVI A;  2GUP A;  3SYZ A;  3R9P A;  2YHY A;  3D2E A;  4JI5 K;  5GAH P;  4PWD A;  4LSL A;  1X9W A;  5H1S Q;  1HYZ A;  4H0T B;  5AFU A;  4Z4C A;  3W0L A;  5AQP A;  1K8A O;  4GV9 A;  4MO5 A;  3LP3 A;  3CC4 N;  3UE5 A;  3SMS A;  1GOB A;  1HR0 K;  4DV1 K;  3AO2 A;  1XMO K;  3QIP A;  1TUU A;  1JLA A;  4WQ5 A;  1X9M A;  3EYZ A;  4DB3 A;  2B5J A;  1HX1 A;  4I2P A;  1S5J A;  4JYA K;  4AHU A;  2VYP A;  4BRA A;  4RW7 A;  2UUC K;  4BR7 A;  4NXN K;  1D4X A;  4OPH A;  3L2Q A;  1XQS C;  4DTJ A;  4O5F A;  1VQ8 N;  4KI4 A;  2V7Z A;  1UOC A;  3MEG A;  4KI6 A;  2HB5 A;  4I9L A;  3ZX0 A;  1FJG K;  2DFH A;  3I56 N;  1RDW X;  4FSV A;  3PO5 A;  3IDH A;  1WNS A;  3D7E O;  4Y0W A;  3QIN A;  2G8F A;  2F9T A;  3THY B;  4CF0 A;  4DTX A;  1Y97 A;  4OGC A;  2YHX A;  4CHN A;  3V9S A;  2YV0 X;  4DR1 K;  4B1Y B;  4CEQ A;  4XIU A;  3ZSR A;  4BRI A;  4E7L A;  3CC2 N;  3I55 N;  4GY2 B;  1Q86 O;  4CD1 A;  4DUY K;  3LPT A;  1REV A;  2O8C B;  5JIC A;  4X62 K;  4ISF A;  1TL3 A;  1U48 A;  2P9S B;  3LDO A;  3B8A X;  3HST B;  3E9O A;  4FJK A;  2ASP A;  1HNW K;  2A3Z A;  4DV6 K;  1RBR A;  3RWU A;  3O3G A;  4FJH A;  4CJR A;  3RMB A;  3CCS N;  4FO0 A;  1S72 N;  1VSI A;  4JD2 B;  3ZSX A;  4I6M B;  4X64 K;  3VER A;  1KQS M;  1Y64 A;  2E20 A;  4BDY A;  3C7N B;  2I7P A; 
#chains in the Genus database with same CATH homology
 4JI5 K;  5LL6 Z;  4DR5 K;  5BR8 K;  3T1Y K;  4JI7 K;  4JI1 K;  2UXC K;  4DV4 K;  1N34 K;  4DR7 K;  4LF8 K;  4AQY K;  1N33 K;  1HR0 K;  4LFB K;  3T1H K;  4CVN E;  4DV1 K;  4DV2 K;  1N36 K;  1XMO K;  4B3R K;  3J7Y P;  1IBL K;  4JI0 K;  4LF7 K;  4LFA K;  4JI2 K;  2UXD K;  4DR3 K;  5IT9 O;  4OX9 K;  4JI8 K;  4JI3 K;  4LFC K;  5IWA K;  1XMQ K;  5LMN K;  4JYA K;  2UUC K;  4NXN K;  4LF4 K;  4V19 S;  4X65 K;  1N32 K;  4B3T K;  1I94 K;  2UXB K;  2UUA K;  3J81 O;  1IBM K;  4NXM K;  3JAM O;  1FJG K;  3J7A P;  4B3M K;  4LF5 K;  1HNX K;  5FLX O;  5AJ3 K;  5A2Q O;  4JI6 K;  1J5E K;  3J80 O;  4CW7 B;  4LF6 K;  4DV5 K;  4JI4 K;  4DR1 K;  2VQF K;  4GKK K;  1XNR K;  4X66 K;  2ZM6 K;  4B3S K;  4KHP K;  4DUY K;  2E5L K;  4YY3 K;  4X62 K;  4DV0 K;  4YHH K;  4DR6 K;  2UU9 K;  4JV5 K;  2F4V K;  1HNW K;  4DV3 K;  4DV6 K;  2VQE K;  4LF9 K;  4DR2 K;  2HHH K;  2UUB K;  4DUZ K;  1IBK K;  4GKJ K;  3OTO K;  4X64 K;  4K0K K;  1XNQ K;  5LMU K;  4DR4 K;  4DV7 K;  1HNZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...