5AJ3K

Structure of the small subunit of the mammalian mitoribosome
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
136
structure length
136
Chain Sequence
SFSIYPPIPGQENSLRWAGKKFEEIPIAHIKASYNNTQIQVVSAAHQPLAHASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHVRVVVKGLGPGRLSAIKGLTMGGLEVISITDNTPIPHNGCRPRKARRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
total genus 27
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2015-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5aj3K00
2UUBK 3JAMO 4DR3K 3T1HK 4LFAK 4AQYK 1XNQK 1I94K 5AJ3K 1N32K 4DV4K 2E5LK 2ZM6K 3J7AP 3T1YK 4LF7K 1IBKK 1IBLK 4DR4K 1J5EK 4CW7B 4B3RK 1HNXK 4JI0K 3J80O 4DV3K 4DR7K 4JI6K 5LMUK 4DV1K 2VQEK 4JI5K 4DV5K 4DR2K 2HHHK 2F4VK 3J81O 4OX9K 4GKJK 4LF6K 4DR6K 5LMNK 1IBMK 4JYAK 4DR1K 4X65K 4JV5K 4LF5K 3J7YP 2VQFK 4DV6K 1XNRK 1XMOK 4K0KK 4NXMK 4DV0K 2UU9K 5FLXO 1N34K 4X64K 3OTOK 4JI3K 2UXDK 4X66K 4LF4K 5LL6Z 4B3SK 4LFBK 4B3TK 1HNWK 4DV7K 4CVNE 4JI2K 1HNZK 5BR8K 1FJGK 4GKKK 4NXNK 2UXCK 5IT9O 4JI8K 4YHHK 4JI1K 4DUZK 4B3MK 4DUYK 4V19S 1XMQK 4KHPK 4LF8K 4DR5K 1N36K 2UUCK 1N33K 5A2QO 4LF9K 4X62K 4DV2K 4LFCK 4JI4K 2UUAK 2UXBK 1HR0K 4JI7K 5IWAK 4YY3K
chains in the Genus database with same CATH superfamily
5AQVA 3JAMO 4DS4A 1RBTA 4A57A 4H0XB 3H46O 3OYKA 1VQNN 4WCEL 3AVNA 2A5XA 4BRIA 1CXQA 3NH0A 1NJWA 2NLXA 4AHCA 3SQ4A 3FZHA 4FVMA 3DXMA 4CF1A 3NF7A 3A2FA 4DR4K 3QMLA 3HP6A 3UE5A 4O8KA 5CR4A 4H0YB 3L2VA 2ZJQL 2O4IA 3NGYA 4KHQA 1HQEA 3LWLA 1T05A 3U9ZA 4IKFA 3Q7CA 5AQFA 4H4OA 3ZSOA 4NYFA 3MCAB 4IOCL 4MQ3A 3AVCA 4ISGA 3OY9A 3CCJN 4Q0BA 3GL1A 4PQUA 4WF9L 4RW8A 3V1QA 4AM6A 2HHSA 3GBTA 4DQ8A 5AQYA 3OYFA 2ZJRL 4BR5A 4O0JA 4FLVA 5HL7L 4FO0A 1S1UA 4FJHA 4QCLA 4K42A 5BN8A 5SZTA 1QVFM 3FGUA 5AFUH 3ZYYX 2YHYA 3BUZB 3VESA 4R5PA 4KREA 3HPGA 2QM1A 4IBNA 4CK2A 4CIFA 1RT2A 4CZFA 4ELTA 4MDBA 3EYZA 3LP0A 3CPEA 4B1YB 1TV6A 4JLHA 4FLUA 4E7HA 4BRAA 3RMDA 5BR8K 3AA5X 3QEWA 4IO8A 5F1XA 3O9UA 3ZX0A 1BOTO 5HOOA 3CG7A 5E84A 1DT9A 3VF4A 2NRWA 5EXWA 2O8EB 4ILHA 4FZZA 2RPIA 4DLEA 5ADXA 3R1XA 1GLLO 4E7KA 1K6YA 3P31A 3L3VA 4CJVA 5EY4A 1C0FA 2NRHA 2QWRA 4DTPA 2X74A 3AO1A 2DY4A 4CF8A 3CQ8A 1D9FA 2G8VA 5I9EB 3O1BA 4BG9A 4TSXA 3G0ZA 1VQ7N 3PSFA 2CGLA 3VEOA 4CGIA 3P39A 4DU1A 1TL3A 3SPZA 4EFHA 4YY3K 4F3TA 2HOEA 3O08A 4DTOA 3ID8A 2QA4N 5KPTA 2W6KA 1VQPN 3NVMA 3OYIA 3WNFA 2E4LA 5C25A 1LV5A 1C6VA 5GAEP 2BANA 3OYCA 3HXMA 2ITMA 4M41A 4B3RK 3OYLA 3UB5A 1M90O 1GOCA 3J80O 1QTMA 2NRZA 3WNEA 1S72N 1JJ2M 5KI6A 4IG3A 4M7YA 3C94A 3VTHA 1HPZA 2V52B 1KAZA 4H4MA 3ZSZA 3UKRB 3HSTB 4DFMA 3ZSYA 3WEEB 2PBDA 2WOMA 3NH1A 3NH2A 1Z26A 5FPNA 5M1NA 4JD2B 4O8UA 1BQNA 4HCBA 4RG8A 5AQZA 4DV6K 4DV0K 2NRVA 4CGJA 4Z4FA 4WYBA 3KLHA 4YOYA 4KH6A 2GUIA 3S3NA 4K25A 4FJJA 2Z1IA 4L8RB 3KLIA 4OPJA 4HUEA 3O3GA 3JS6A 1OVQA 3ZT0A 1DLOA 1E3MA 1E4FT 2YJEA 4H8KA 2FLOA 1Q8IA 4CJ5A 2QXLA 2QW9A 1RCHA 1JLCA 3TANA 1L5UA 3CC2N 3P83D 1WUAA 1TKXA 4YORA 4JI8K 2FBXA 3HI0A 1C0UA 2O4GA 4GVEA 3MDQA 3DLRA 3HOSA 4V19S 3U3YA 3ZLJA 4Z4CA 2KFZA 4B1UB 4KRFA 2XY6A 3TWHA 1WSJA 1JCFA 3EEQA 3FFKB 4BRLA 3OVNA 1HR0K 1TKTA 2VWBA 3U3GA 4CGDA 1KVCA 5HRRA 3O80A 4FWRA 3PV8A 1QS4A 1OH7A 2D4WA 3T1HK 3ZETB 3V6DA 5BPNA 3AARA 1ESVA 4LY7A 5J2QA 2E1ZA 2GTDA 4CF2A 3KWIA 1RBRA 2GX9A 1GOBA 4CI6A 4M3YA 4B9QA 4N56A 3OYDA 1NU0A 3D45A 3GE1A 4OKEA 2HHVA 4C8MA 3RMCA 5D3GA 2G8IA 2OPRA 3PLAA 2B4JA 3D7EO 4FM0A 4DQQA 2KTQA 1YTUA 1RT1A 1HUXA 2J4RA 3HK2A 2ITGA 4AM7A 2VWJA 4CJTA 2D1KA 2O8EA 2E2NA 2NZTA 4LH4A 4DKWA 1KAXA 3V9ZA 1T03A 4BRHA 2BE2A 4HVJA 1EP4A 5AQNA 4FK2A 3VEVA 3TTCA 2OTLN 2EHGA 1HKBA 1WAJA 2QKKA 4CGHA 1MA9B 1Y97A 2XO7A 5C2DA 2FSNA 3IG1A 5KTQA 4FYDA 5AQIA 2WONA 1QHTA 1TK8A 4X66K 4KH5A 4CERA 1WBDA 3AVIA 4LFBK 4KB0A 3V4IA 2G8WA 1WLJA 3ZT3A 1L3VA 4O5FA 4AHTA 2ZQBA 3WXLA 2AJQA 1J9AA 1NMNA 4CFAA 1YJWN 1YHQN 4CBXA 3SMSA 4DUZK 3A0IX 1U2VB 4A62A 1X3MA 4I2QA 4Z4HA 3UKRA 2AA4A 1NK0A 4G9ZA 4AHUA 1CLQA 3W3DA 3MN5A 3C65A 3WEEA 4DG1A 3HJFA 3ZT1A 4JD2A 1BI4B 2JWLA 3D0PA 4BWJA 5AQSA 4LH5A 4UY8O 5T7BA 1UWBA 2KHOA 4PKIA 3ID6A 4EZ9A 4CF0A 2FSKA 4KO0A 4IJNA 1IO2A 4H5VA 1QQMA 3MK6A 2FXUA 3T69A 1KXPA 4E19A 4CZHA 3FZLA 3S9HA 1KTQA 4BROA 1HQUA 4FWMA 4JRQA 3O9QA 3RSEB 1L3SA 5K14A 1EKEA 1JXEA 1XC3A 3I33A 3OJSA 2HF4A 2V7ZA 3CCQN 3SBTA 4W5RA 4DV5K 3OS0A 3SJJA 2HHHK 1TAQA 2A3ZA 4FM2A 4QS9A 1LOTB 3TSUA 5MLCQ 3QERA 4CGFA 2DFHA 3C7NB 3T1AA 2FF6A 5GIOA 3OS1A 1JCEA 4MO4A 4X65K 2VGNA 1NM1A 2HNZA 5BN9A 3S3MA 4U67L 4M3WA 1SV5A 5KPZA 3CCRN 1XI1A 3LWMA 3M8SA 3K5NA 1MDUB 4BVOA 3EE9A 3SLCA 2QWQA 2QWNA 2HBJA 4CJ3A 4DF4A 4IWVA 5HROA 4M3XA 4CD3A 5M1PA 5C0YA 1K8KB 4EP4A 2VWKA 2P51A 4JKDA 2HF3A 2NRXA 3OYJA 2HHUA 1B92A 3JXUA 5HLFA 3ENOA 4AH9A 3HBTA 3QIOA 4FK0A 3NCIA 2QEXN 3VQ4A 1RT4A 2E2OA 4I9QA 5HBMA 1EETA 4B3MK 2KW4A 1L3UA 1RBSA 3THWB 1K8AO 1VK0A 1YITN 1WSIA 1D4XA 1JLEA 4H0VB 5AQMA 1N33K 3CHWA 2Z1HA 5FROA 5AFUA 3GOIA 1U47A 1RDBA 4Y0WA 3QEIA 1RFQA 1LW2A 2KZZA 4JI7K 1T44A 1NGAA 3AA4A 5CY4A 2A42A 4BGAA 2HBKA 1HLUA 2ZWHA 3AVMA 5FPMA 3CIPA 3CF5L 5KRTA 2HSTA 1HNVA 5M1KA 2GBZA 2BDPA 3L0QA 1S9EA 3R3LA 3K5MA 4Z94A 3R8EA 1J5EK 1OKJA 3PIPL 4BRMA 1KSPA 5F2RA 5KQ8A 1NGBA 4ICLA 4RCHA 3DXKB 3TTFA 4YOTA 4JI5K 4WFBL 4JHDB 1KFDA 2YJFA 4E0DA 4DCHA 1TVRA 3LDQA 4C1NI 4OVLA 5EX5A 1U2VA 3U6FA 5JS1A 3KK1A 1QSYA 2I7PA 4BRCA 1G15A 4OJRA 3VQPA 3WXKA 3VA3A 3MMVA 4KB1A 2D5RA 4CEOA 3O3FA 1BI4A 3HZ6A 1B9FA 1YUWA 3MWTA 4YNQA 3DRSA 2ZJPL 4MLHA 4LF4K 4Q5VA 1NG9A 1SS6A 3BDPA 4C8OA 1OH5A 5AZJB 3VGMA 2GWJA 1QSSA 1BDGA 2O8CB 1TUUA 4CBWA 3VQ9A 4DWIA 4M3ZA 3ZSVA 3LPTA 4F4KA 1RBUA 4NXNK 2UXCK 2HNYA 3AGRA 3RSEA 1NNEA 3VETA 4DTMA 3P4IA 2IIRA 3M3ZA 2HHTA 4EIAA 5JLHA 3MXJA 1B9DA 3G71N 4XEIA 4CECA 3C7NA 4CEZA 4LFCK 5AQOA 3CERA 3K0SA 4B9UA 4WE1A 3SK3A 2FC0A 3CQYA 3VTIA 4AILC 3VQCA 3IMXA 1C0MA 2UUBK 4LFAK 5DMRA 3M5RA 5H1SQ 3AVFA 2YCHA 3KLGA 3QINA 1WN7A 3ASMA 3V1OA 4DS5A 2GV9A 4CE9A 1C0GA 2DPNA 1NWKA 4KTZA 2GEMA 2YNFA 4WQ5C 5AQWA 3MCPA 4C23A 2FSJA 4JI6K 5EVZA 4RWTA 1X9MA 2V51B 1A5WA 3ULEB 2A40A 4YOWA 2D0BA 1RTHA 4HTUA 2DFEA 2HVIA 4O5BA 4W5QA 3ATVA 4B9NA 1FXXA 4FLXA 3K9KA 3SQ1A 2F8SA 4DFKA 3HL8A 4B8AB 3KJVA 4HUFA 2CGJA 3RR7A 2OPPA 4BRKA 1U04A 5SWMA 3TAFA 1SL0A 3HOTA 1I3AA 2UU9K 5AQTA 4HHTA 3ZEUB 2XY8A 3BZKA 1WSFA 4IEEA 4UQGA 1VRUA 4M3TA 3ISNC 1ATSA 1TK0A 4BQZA 4MLEA 3SV4A 3SNNA 3P5JA 4IDKA 2RE2A 1HX1A 2PFUA 3SUOA 1HNWK 2O8BB 4G1QA 5AQKA 4DLGA 5CZ2A 1XC9A 1OH6A 1HNZK 3MEGA 3THVA 2CH5A 5IT9O 3DRPA 1ATRA 2CGKA 1Z05A 2EWSA 1IG8A 1YTAA 3WNHA 1HKCA 4JHDA 1KFSA 4FJLA 2IS3A 4E1JA 3DAWA 4Z4IA 1NBWA 4RW6A 4PHTX 3LDLA 1TAUA 3K57A 1D9DA 3ZSXA 1U48A 5BR9A 2CH6A 1WSHA 3EY1A 4B9LA 4I6MB 3AVLA 2HVHA 2FBVA 3LZIA 1X9SA 3SAFA 4FW2A 2HHQA 1TL1A 4AQYK 1BGXT 4KI6A 4F3OA 1NK5A 3A5NC 4H0TB 3C6TA 1T8EA 1QZ6A 4CHQA 4A2AA 1N6QA 1SAZA 4IFYA 3AY9A 5CHIA 1IV0A 5AZJA 1BO5O 4LD0A 1VHXA 1O13A 2HBMA 3FR0A 2O8CA 3LDOA 3CCVN 3PO5A 4W5NA 1XHXA 2GWKA 3ALYA 2E2PA 2QWMA 1LWCA 5B8HA 3OA9A 4DR2K 1UAXA 4BC3A 4BREA 3O8MA 4GV6A 1OVYA 1YVUA 3CJCA 4JYAK 3LM2A 2OZMA 3DOLA 2O8DB 4QS7A 2RN2A 3VN5A 3V81A 1RTDA 4OPKA 3TAPA 4K8XA 4LF5K 1D5AA 2X6SA 1TK5A 5HRNA 1HPMA 2YNIA 1VQ8N 4K0KK 5GAGP 3AVAA 4PA1A 1EO1A 4C8NA 3EE8A 1SKRA 1M1KO 4B3SK 4B3TK 1WNSA 4CVNE 4OKJA 4ELUA 3KHYA 1NK7A 5GIPA 3TARA 4QS8A 1O1WA 4JAXA 1BQMA 1V4SA 4ZTFA 3T19A 1KAYA 1HKGA 2OPSA 4KPYA 1ASUA 4B3OA 4N47A 3ULEA 5GAHP 3PUFA 4KTQA 2YHBA 1X1PA 4CEEA 4DSLA 3EN9A 3LANA 1S1WA 1EWQA 1W7AA 3HPHA 3QBXA 5BREA 3TABA 2JLEA 3NF9A 4YOUA 3ZSWA 2D0AA 4DU4A 1VRTA 1Q9XA 4IG0A 3ZEUA 4GV9A 2XY5A 3FLCO 1R59O 4CJPA 4EHTA 3SQ0A 1HJOA 3K9JA 4NLCA 2Q97A 2E20A 2O8BA 5LY3A 4EHUA 4ELVA 4DV3K 1ZYQA 2RHKA 4FZXC 4GNIA 4DV1K 1GLAG 2IVNA 3OYMA 1LAWA 2PY5A 2F4VK 2ZGZA 1BCMA 3DM2A 3CMAN 3ZSQA 1NJYA 1IBMK 1S22A 1RTJA 1ASWA 3E1YA 3JYTA 4DTRA 3K2PA 2OANA 3WXJA 3EZ5A 2DTUA 3F9MA 4K41A 4LC9B 1HJRA 4DQSA 3MXIA 4J2AA 1BISA 3E9LA 4I6MA 3SAHA 3VGLA 3RR8A 5HRPA 1Q81O 3VENA 4CHPA 1Q82O 3MN6A 3QDKA 3EL2A 4BDPA 3M8QA 1QQNA 4U7BA 4NCAA 1TKDA 3V9XA 1QHAA 1S5JA 1XUPO 3THYB 1KC8O 3VQBA 1JLAA 4CFCA 4BG8A 1HNIA 1R0AA 1SZ2A 4YFUA 2QWLA 1HMVA 3AVGA 3BZCA 4I9LA 4BRQA 3LP3A 1XMQK 3QB0A 1S9GA 2V7YA 4DR5K 3LDSA 3LL3A 4PKHA 2P9UB 1GLJO 3EZWA 3RMAA 1ASVA 2ASOA 2F96A 1UA1A 4L3QA 3R9PA 4CFBA 2O8DA 4B1ZA 4CESA 5AQXA 1U45A 1J54A 3MXMA 1NLVA 5E41A 4ZHRA 1RDWX 4IFVA 4JKGB 1X9WA 3VOVA 2IAJA 4IJAA 4AHRA 3BGRA 4F2RA 4ID1A 4FJNA 1I94K 2ATQA 3AO5A 3DI6A 3SYZA 1Y64A 3T1YK 4YDUA 4LF7K 3VQQA 3ZT2A 2Q31A 4CZEA 2E2QA 1JCGA 3ZX2A 4KHNA 2BH1A 3WT0A 2O8FB 4DB3A 2P9PB 1H1VA 4EAHD 5ADXH 3ENHA 2VQEK 2PAVA 2P9LB 1S1TA 3DOKA 2E8AA 3OW2M 4CEQA 2FBTA 1HYZA 4IXCA 3V1RA 1Q18A 4H5NA 4CJFA 5KRSA 2NRRA 5DM7L 5AR0A 4OX9K 3O9SA 4CEAA 3I56N 3CQXA 2Z1GA 4KBOA 4WFNL 4JKAA 1RDAA 4FLYA 3EKUA 1VSIA 3GDQA 1EXQA 2JGUA 4B08A 4AF1A 1G99A 3WNGA 5FDLA 4WQ4A 5JS2A 3M1FA 4DFPA 3C6UA 2VG7A 4CJ7A 3QESA 1XMOK 4J8FA 2E88A 3JSMA 5AQUA 2W42A 1QE1A 3LP1A 3FZFA 3S41A 3G10A 4X64K 1LCUA 1TGOA 2OZSA 3F73A 2GELA 1VSMA 1KVBA 4JK7A 5KQDA 3L4QA 3IRXA 3HT3A 5KGXA 5AQHA 1BL3A 3KLFA 3SCXA 3W0LA 1A5XA 4MDAA 2NUBA 1U6ZA 1SQKA 2PYJA 4E7LA 3DWLA 4BE2A 3HYFA 3VQ5A 1S3XA 1NGEA 3THXB 3PO4A 2P9KB 4CJRA 4W5TA 1DTTA 3VF2A 4PL7A 2X78A 1HYSA 4CIGA 5GADP 3ZETA 1IH7A 3KZBA 2P5GA 4BC4A 3NMUA 4NB4A 5A2QO 4PY5A 4ISEA 2ZGYA 4LF9K 1UA0A 4JKFA 5AQJA 5KGWA 5JICA 2NRTA 3NFAA 1SL1A 3ZCMA 4M3UA 4CZGA 4CHOA 3IDHA 5IWAK 4N5SA 3DLBA 3CCLN 4FSVA 4B9VA 3L2WA 2OCEA 3O4QA 3KTQA 3FZKA 3RWUA 3B8AX 4FWQA 2ZM6K 4BR9A 5DM6L 1P8ZA 4RW7A 2HHXA 4KKOA 4CJKA 3EO3A 4JKHA 1RGIA 3F9KA 4F2SA 4FJGA 3L6QA 4JI0K 1K9MO 2ZE2A 5LMUK 3O4NA 3THYA 4FJ8A 5BRHA 4PUOA 5LJWA 5JVGL 3IAYA 4E7IA 3KK3A 4HWIA 1W2BM 1JLFA 2WUSA 4A5AA 3CETA 4OPAA 4GKJK 1RT3A 3Q7BA 4XH1A 4CEBA 3HSCA 3ENBA 2P9IB 1J6ZA 3BP8A 1CZBA 4ZTJA 2P9UA 4H0OA 5KPRA 4CJLA 1TUYA 3MN9A 1WAFA 4ISFA 3RRHA 1VSKA 4FWLA 4A2BA 2Q2RA 2WTUA 3OTOK 4JKGA 1GLDG 2UXDK 4ILGB 4NYNA 3CJ1A 3M6GA 4DSJA 1JLGA 2QTDA 4OO1J 2IOCA 3KK2A 1LW0A 4OLAA 1ILYA 3J8AA 1WOQA 2G8HA 3E9PA 3KVGA 3G4SN 4FPAA 4BRNA 3VERA 1NGFA 1SUQA 3N4PA 4BVPA 2IGIA 2P9PA 3MAQA 1KCFA 2VG6A 1NOZA 3KWGA 2P9LA 2PYLA 1JKHA 1SL2A 2YKMA 1W0HA 4CIEA 4JKEA 2UUCK 4CZLA 3VEYA 4DV2K 3HM9A 2UUAK 1DKGD 3AA2A 2UXBK 1W97L 4J2EA 4OGEA 2HB5A 3OYEA 3C6HA 3PX4A 2HHWA 3DLHA 1L3TA 3J7ZO 4BC5A 4DSKA 3DJCA 3EKSA 1YVNA 3V9WA 1TYQB 3S3OA 2E6LA 4XH4A 1JXBA 4CEDA 3C6AA 4J2DA 5EU7A 2KFNA 3J7AP 1NK8A 3PY8A 1CXUA 2WBNA 5FRNA 2YI1A 3VEXA 1S1XA 1Q9YA 1YAGA 3O5BA 1QSLA 4PL8A 4H03B 4DSEA 1XWLA 4OPHA 3M8PA 4FLWA 3KD1E 4NLBA 3DLLL 3DYAA 4FWSA 1VQ9N 2OTJN 1C1BA 5DK5A 3THXA 3CI5A 2BTFA 4EP5A 5HP1A 2P9KA 3VPZA 3U9DA 4YOXA 3CM5A 3FE1A 3QFPA 1DTQA 3CD6N 3B6OA 3O4WA 3HVRA 3CC7N 3I0RA 4BQLA 3VQ7A 1ZBUA 3ZX3A 1IKYA 1K8KA 3VQEA 1VSDA 1J5OA 1KD1O 1W9HA 3AAPA 5AQQA 1BIUA 3MX5A 2OA8A 4FJIA 2KLAA 3AO3A 1LAVA 5HRSA 1EWRA 4WQ4C 4E89A 3FFIA 1FK9A 3LPUA 1GLCG 4HCCA 2B5JA 4KFBA 3KD5E 3IS9A 3OS2A 4BE1A 2W6LA 3D2EB 3THWA 1Z25A 3QEVA 2W40A 4FM1A 1QVGM 2XRIA 3AV9A 2QWOA 4Z0UA 2VCPA 2H3GX 3N4QA 4NCBA 3P38A 1S6QA 1C1AA 1J53A 1Q86O 4BR0A 4H5RA 3NAEA 4E3SA 1YIJN 3AO2A 2P5OA 3KLEA 4X62K 4M42A 3CC4N 3RRGA 4J2BA 2P9IA 1NKEA 1P90A 2ETJA 3OYGA 4DSFA 3PX0A 5M1FA 3I8DA 1T3VA 3SUNA 3DRRA 2HNDA 2QKBA 1XNQK 1GLFO 1XQSC 4C1NK 5JVHL 1F21A 3DXKA 3SJHA 2BUPA 2Z1JA 4K8ZA 4CBUA 3SUQA 4FXDA 2G8FA 1U49A 3VGKA 3HVTA 4KHYA 3K58A 3CYMA 5BPLA 1IBLK 4BGBA 3LAKA 3AVKA 2HMPA 1WB9A 1BHLA 1IG9A 1KRPA 2VYPA 3OYBA 3QNNA 1VQKN 4JS5A 4CJ4A 3NF8A 2Q0UA 1VSLA 1VSEA 3J81O 1BWFO 1C1CA 3E66A 4DR1K 2ZF5O 3MECA 4CJUA 2Y1JA 2I5JA 1NGCA 2A6AA 3L3UA 3FZMA 4JV5K 3J7YP 2KQ2A 5CE3A 1NGJA 3O6WA 4CZKA 5J2NA 5JMVA 3L2QA 4BDYA 2XHBA 1TYQA 4KTWA 3CXCM 1FKPA 4FLZA 4MO5A 5C12A 5J2MA 4DV7K 1WSEA 4CK1A 4I7FA 4DQIA 3SBGA 4CZJA 5CYQA 3WUHA 1FJGK 3H1QA 3TAMA 4M3RA 4CK3A 4QOZB 3CFRA 4JS4A 4A61A 2E6MA 1JL2A 3L4IA 3LM9A 4KHUA 1FW6A 5C42A 4KHPK 3TSQA 4LF8K 1ZBSA 3AGKA 2F9TA 4CGGA 2QI2A 3UIQA 5GINA 1HYVA 4LSLA 1EQYA 3G25A 4RW4A 4JI4K 4O44A 1K73O 3TSPA 3QFUA 4IFEA 4H5TA 1VQ5N 4M45A 4KH4A 4FWPA 3CFOA 4JN4A 4DTSA 2G8KA 3I55N 1NKBA 4FVUA 1NJXA 3U4LA 5AJ3K 4FWKA 3LZJA 4E1MA 1ZBIA 3H3OB 4C8LA 4CHNA 3QNOA 3NGIA 4EZ6A 3I8BA 3DMJA 1Q7YO 3D2EA 4FL9A 1HNXK 4GV3A 1LWFA 4DR7K 3WQUA 4XH5A 3QIPA 3NVKA 5I3UA 1RDDA 1KVAA 2ASPA 3F5TA 4B8CA 1HRHA 5C24A 4HTLA 3DLGA 4IEIA 1YXQA 2EX3A 4FJMA 4DR6K 2A41A 5LMNK 3GG4A 1TKZA 5LJVA 3VF6A 3A5LC 3H3NO 3TAQA 4B1WB 1V4TA 3CJ9A 1NGGA 1SKWA 4HUGA 4DFJA 4ILJA 3VQ6A 3O3HA 4R79A 2Y1IA 4JI3K 5JLFA 5LL6Z 4IDHA 1LWEA 3TAEA 4KI4A 2RF2A 1E4GT 3E01A 3QICA 3K59A 4A59A 4CZMA 2PZSA 2HMIA 1RILA 2JWKA 4BRGA 3H45C 1RT5A 2D0OA 1WBBA 1BUPA 4N41A 3TAGA 4CHZA 3HPOA 4RTFD 4JEPA 5AQGA 4GY2B 4BDZA 3TTDA 4DUYK 4DQRA 1CZAN 2KKZA 1RNHA 3U8XA 5AQPA 3RTVA 3SI6A 3OBWA 3AVBA 3G6EN 1T7PA 4CHYA 2QXFA 4FOIA 4DU3A 1BA0A 1NGIA 3ITHA 3QO9A 5TKYA 5AZIB 3HP9A 3T3FA 5M1OA 5AQLA 4OKKA 4Y1DA 1JLQA 3A8YA 1YF5L 4IOXA 4FLTA 1MWMA 4CJEA 4FWNA 4DR3K 1NOYA 3VA0A 3MWPA 1YI2N 2A1SA 2YKNA 2YHXA 3MEEA 3ULDA 4DV4K 4FW1A 1VSJA 5TKWA 1ATNA 3MEDA 4JK9A 4MFBA 1BG3A 3CJAA 3K5OA 5I42A 4DF8A 1JL1A 4E1NA 4FJ9A 1NK9A 2YHWA 4C8KA 3VQDA 4BR7A 4CEFA 2W41A 3NGZA 5BRFA 4IOAL 4DTUA 3AVJA 2P9SB 3LALA 4W5OA 1ITGA 1SKSA 3CM6A 1WSGA 2HW3A 4OGCA 3OJUA 1XNRK 2IC3A 2A1RA 2AP1A 2ZD1A 4NXMK 1N34K 1ZBLA 1N8RO 2Q0RA 3H08A 3NE6A 4PWDA 1ZBFA 3NF6A 3VQ8A 2BGGA 2P9NB 4BWMA 4BE0A 3NDKA 4CJQA 1VAZA 3TR8A 4DTJA 4BACA 4B9TA 3HM8A 1S6PA 1YT3A 4JKCA 2YNHA 4Z4EA 1IJJA 1NJZA 4JKBA 3CJBA 3UKUB 3QBWA 5M1QA 4JI2K 2YHAA 3WXIA 5FRMA 4O55A 3CPWM 5C2FA 2D0CA 4GMJB 4B9SA 4KHWA 5C15A 1IKVA 3MN7A 2IVOA 2D0PA 3R6MA 3AAQA 5EOYA 4WQ5A 3H1VX 4BRDA 3KIOA 1VSFA 3NBPA 4E7JA 2I7NA 1KLMA 3AA3A 4BR2A 2F8TA 2GUPA 2R7YA 1VQLN 3AVHA 4B9MA 4B1XB 3SV3A 4DQPA 3TPQA 3L2UA 4BR4A 2IVPA 4AHVA 1VQMN 1IKWA 2Q1NA 4DTXA 1NK6A 4CJWA 4CF9A 3KK7A 2QWPA 1ZC6A 4PKGA 3LDNA 1OH8A 1BA1A 3ZSRA 4AHSA 1IBKK 1NK4A 4FJ7A 3A5MC 3PX6A 1DEJA 2E1YA 4Z4GA 1CZ9A 3CMEN 4CZIA 3CCMN 2IDOA 4O4GA 3QLHA 3T7ZA 3SPYA 1T6DA 4GW6A 2B6AA 4N76A 4JRPA 3CCEN 3MX2A 2VGMA 3CCSN 3OBYA 5CZ1A 1RDUA 4DSIA 1RTIA 4LF6K 4F8RA 4FZYA 3VMFB 3D2FB 2P1JA 3F2KA 4QAGA 4H5WA 1RDCA 2OYQA 2WFBA 3BEXA 4NO7A 1ZXOA 1RT7A 2G8UA 2VQFK 5AZIA 1VQON 4BRFA 4CD1A 3V9UA 5FLXO 2NNWA 3SZ2A 2ASMA 3M8RA 4KAZA 1YJNN 1A5VA 4CJSA 3DLEA 3DXMB 4YOVA 1KLNA 3QEPA 2YX6A 3OYAA 1EX4A 2OPQA 1UOCA 3CFPA 4FOEA 2F7TA 5J1EA 4O0IA 3HO1A 4GKKK 1YJ9N 1NGHA 3LP2A 1Z6RA 4LSNA 5BRDA 2LSNA 3E9OA 4FK4A 3OHRA 3VQAA 3KKSA 4DMNA 2DFFA 1N36K 1RBVA 2FF3B 4A5BA 3WQTA 3V9SA 2P9SA 2XY7A 3BF1A 4K43A 5CYMA 5E26A 3CCUN 3QETA 1ZBHA 4XIUA 3LAMA 4DTNA 4BRPA 3IKMA 3A5OC 3ZT4A 3L8BA 2YV0X 2YNGA 2HBLA 4M7XA 4BY9C 4ID5A 2O8FA 3QEXA 1REVA 4FJXA 4BC2A 1MWKA 1GOAA 4B1VA 1N32K 2P9NA 2E5LK 1JLBA 1NGDA 4KHSA 4IO9L 3H6EA 3LDPA 1NMDA 3HRGA 4H0PA 3SQ2A 2QK9A 2RKIA 3UKUA 4CW7B 3D6RA 5FPEA 3SAGA 1D8YA 1FKOA 1XHZA 3C95A 3P1GA 4IZ9A 5F0XA 3RMBA 1X3NA 4FWOA 4FPBA 3RVCA 3CJ7A 1IKXA 1GLBG 3SMPA 1DGKN 1C0TA 5C10A 2Q3SA 1VQ6N 2UYTA 4FJ5A 1QQOA 1QQCA 4KV8A 2KZMA 4NCGA 3BY5A 4WFAL 4FCYA 5J2PA 1RT6A 2VG5A 4FJKA 4CFDA 3VEZA 3O9RA 1N5YA 4F9OA 4RW9A 4YDUC 1BCOA 4GVMA 2X6NA 1BU6O 3PSIA 4CCHA 3SUPA 3DLKA 3ATUA 5FPDA 4JK8A 1NKCA 3TU5A 3PIOL 1QZ5A 1I39A 1NJIO 1MU2A 3WXMB 1KQSM 4M63C 1VSHA 3NHGA 3AO4A 3L2RA 3I0SA 1U4BA 3KKRA 4JNEA 1GLEG 5AQRA 3O9TA 3O1WA 3HTVA 3B6PA 4YHHK 4JI1K 4Y1CA 4OLBA 2WC9A 2Q36A 3OYNA 2FBYA 1S1VA 3VEWA 4DHYA 1VQ4N 1X9JA 4I2PA 3BF3A 3IUCA 3TI0A 1T6CA 2F9WA 3D2FA 3C0BA 5BPMA 1BIZA 5ELZA 3IFRA 3OYHA 3K5LA
chains in the Genus database with same CATH topology
2UUBK 3JAMO 4DR3K 3T1HK 4LFAK 4AQYK 1XNQK 1I94K 5AJ3K 1N32K 4DV4K 2E5LK 2ZM6K 3J7AP 3T1YK 4LF7K 1IBKK 1IBLK 4DR4K 1J5EK 4CW7B 4B3RK 1HNXK 4JI0K 3J80O 4DV3K 4DR7K 4JI6K 5LMUK 4DV1K 2VQEK 4JI5K 4DV5K 4DR2K 2HHHK 2F4VK 3J81O 4OX9K 4GKJK 4LF6K 4DR6K 5LMNK 1IBMK 4JYAK 4DR1K 4X65K 4JV5K 4LF5K 3J7YP 2VQFK 4DV6K 1XNRK 1XMOK 4K0KK 4NXMK 4DV0K 2UU9K 5FLXO 1N34K 4X64K 3OTOK 4JI3K 2UXDK 4X66K 4LF4K 5LL6Z 4B3SK 4LFBK 4B3TK 1HNWK 4DV7K 4CVNE 4JI2K 1HNZK 5BR8K 1FJGK 4GKKK 4NXNK 2UXCK 5IT9O 4JI8K 4YHHK 4JI1K 4DUZK 4B3MK 4DUYK 4V19S 1XMQK 4KHPK 4LF8K 4DR5K 1N36K 2UUCK 1N33K 5A2QO 4LF9K 4X62K 4DV2K 4LFCK 4JI4K 2UUAK 2UXBK 1HR0K 4JI7K 5IWAK 4YY3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB K;  3JAM O;  4DR3 K;  3T1H K;  4LFA K;  4AQY K;  1XNQ K;  1I94 K;  5AJ3 K;  1N32 K;  4DV4 K;  2E5L K;  2ZM6 K;  3J7A P;  3T1Y K;  4LF7 K;  1IBK K;  1IBL K;  4DR4 K;  1J5E K;  4CW7 B;  4B3R K;  1HNX K;  4JI0 K;  3J80 O;  4DV3 K;  4DR7 K;  4JI6 K;  5LMU K;  4DV1 K;  2VQE K;  4JI5 K;  4DV5 K;  4DR2 K;  2HHH K;  2F4V K;  3J81 O;  4OX9 K;  4GKJ K;  4LF6 K;  4DR6 K;  5LMN K;  1IBM K;  4JYA K;  4DR1 K;  4X65 K;  4JV5 K;  4LF5 K;  3J7Y P;  2VQF K;  4DV6 K;  1XNR K;  1XMO K;  4K0K K;  4NXM K;  4DV0 K;  2UU9 K;  5FLX O;  1N34 K;  4X64 K;  3OTO K;  4JI3 K;  2UXD K;  4X66 K;  4LF4 K;  5LL6 Z;  4B3S K;  4LFB K;  4B3T K;  1HNW K;  4DV7 K;  4CVN E;  4JI2 K;  1HNZ K;  5BR8 K;  1FJG K;  4GKK K;  4NXN K;  2UXC K;  5IT9 O;  4JI8 K;  4YHH K;  4JI1 K;  4DUZ K;  4B3M K;  4DUY K;  4V19 S;  1XMQ K;  4KHP K;  4LF8 K;  4DR5 K;  1N36 K;  2UUC K;  1N33 K;  5A2Q O;  4LF9 K;  4X62 K;  4DV2 K;  4LFC K;  4JI4 K;  2UUA K;  2UXB K;  1HR0 K;  4JI7 K;  5IWA K;  4YY3 K; 
#chains in the Genus database with same CATH topology
 5AQV A;  3JAM O;  4DS4 A;  1RBT A;  4A57 A;  4H0X B;  3H46 O;  3OYK A;  1VQN N;  4WCE L;  3AVN A;  2A5X A;  4BRI A;  1CXQ A;  3NH0 A;  1NJW A;  2NLX A;  4AHC A;  3SQ4 A;  3FZH A;  4FVM A;  3DXM A;  4CF1 A;  3NF7 A;  3A2F A;  4DR4 K;  3QML A;  3HP6 A;  3UE5 A;  4O8K A;  5CR4 A;  4H0Y B;  3L2V A;  2ZJQ L;  2O4I A;  3NGY A;  4KHQ A;  1HQE A;  3LWL A;  1T05 A;  3U9Z A;  4IKF A;  3Q7C A;  5AQF A;  4H4O A;  3ZSO A;  4NYF A;  3MCA B;  4IOC L;  4MQ3 A;  3AVC A;  4ISG A;  3OY9 A;  3CCJ N;  4Q0B A;  3GL1 A;  4PQU A;  4WF9 L;  4RW8 A;  3V1Q A;  4AM6 A;  2HHS A;  3GBT A;  4DQ8 A;  5AQY A;  3OYF A;  2ZJR L;  4BR5 A;  4O0J A;  4FLV A;  5HL7 L;  4FO0 A;  1S1U A;  4FJH A;  4QCL A;  4K42 A;  5BN8 A;  5SZT A;  1QVF M;  3FGU A;  5AFU H;  3ZYY X;  2YHY A;  3BUZ B;  3VES A;  4R5P A;  4KRE A;  3HPG A;  2QM1 A;  4IBN A;  4CK2 A;  4CIF A;  1RT2 A;  4CZF A;  4ELT A;  4MDB A;  3EYZ A;  3LP0 A;  3CPE A;  4B1Y B;  1TV6 A;  4JLH A;  4FLU A;  4E7H A;  4BRA A;  3RMD A;  5BR8 K;  3AA5 X;  3QEW A;  4IO8 A;  5F1X A;  3O9U A;  3ZX0 A;  1BOT O;  5HOO A;  3CG7 A;  5E84 A;  1DT9 A;  3VF4 A;  2NRW A;  5EXW A;  2O8E B;  4ILH A;  4FZZ A;  2RPI A;  4DLE A;  5ADX A;  3R1X A;  1GLL O;  4E7K A;  1K6Y A;  3P31 A;  3L3V A;  4CJV A;  5EY4 A;  1C0F A;  2NRH A;  2QWR A;  4DTP A;  2X74 A;  3AO1 A;  2DY4 A;  4CF8 A;  3CQ8 A;  1D9F A;  2G8V A;  5I9E B;  3O1B A;  4BG9 A;  4TSX A;  3G0Z A;  1VQ7 N;  3PSF A;  2CGL A;  3VEO A;  4CGI A;  3P39 A;  4DU1 A;  1TL3 A;  3SPZ A;  4EFH A;  4YY3 K;  4F3T A;  2HOE A;  3O08 A;  4DTO A;  3ID8 A;  2QA4 N;  5KPT A;  2W6K A;  1VQP N;  3NVM A;  3OYI A;  3WNF A;  2E4L A;  5C25 A;  1LV5 A;  1C6V A;  5GAE P;  2BAN A;  3OYC A;  3HXM A;  2ITM A;  4M41 A;  4B3R K;  3OYL A;  3UB5 A;  1M90 O;  1GOC A;  3J80 O;  1QTM A;  2NRZ A;  3WNE A;  1S72 N;  1JJ2 M;  5KI6 A;  4IG3 A;  4M7Y A;  3C94 A;  3VTH A;  1HPZ A;  2V52 B;  1KAZ A;  4H4M A;  3ZSZ A;  3UKR B;  3HST B;  4DFM A;  3ZSY A;  3WEE B;  2PBD A;  2WOM A;  3NH1 A;  3NH2 A;  1Z26 A;  5FPN A;  5M1N A;  4JD2 B;  4O8U A;  1BQN A;  4HCB A;  4RG8 A;  5AQZ A;  4DV6 K;  4DV0 K;  2NRV A;  4CGJ A;  4Z4F A;  4WYB A;  3KLH A;  4YOY A;  4KH6 A;  2GUI A;  3S3N A;  4K25 A;  4FJJ A;  2Z1I A;  4L8R B;  3KLI A;  4OPJ A;  4HUE A;  3O3G A;  3JS6 A;  1OVQ A;  3ZT0 A;  1DLO A;  1E3M A;  1E4F T;  2YJE A;  4H8K A;  2FLO A;  1Q8I A;  4CJ5 A;  2QXL A;  2QW9 A;  1RCH A;  1JLC A;  3TAN A;  1L5U A;  3CC2 N;  3P83 D;  1WUA A;  1TKX A;  4YOR A;  4JI8 K;  2FBX A;  3HI0 A;  1C0U A;  2O4G A;  4GVE A;  3MDQ A;  3DLR A;  3HOS A;  4V19 S;  3U3Y A;  3ZLJ A;  4Z4C A;  2KFZ A;  4B1U B;  4KRF A;  2XY6 A;  3TWH A;  1WSJ A;  1JCF A;  3EEQ A;  3FFK B;  4BRL A;  3OVN A;  1HR0 K;  1TKT A;  2VWB A;  3U3G A;  4CGD A;  1KVC A;  5HRR A;  3O80 A;  4FWR A;  3PV8 A;  1QS4 A;  1OH7 A;  2D4W A;  3T1H K;  3ZET B;  3V6D A;  5BPN A;  3AAR A;  1ESV A;  4LY7 A;  5J2Q A;  2E1Z A;  2GTD A;  4CF2 A;  3KWI A;  1RBR A;  2GX9 A;  1GOB A;  4CI6 A;  4M3Y A;  4B9Q A;  4N56 A;  3OYD A;  1NU0 A;  3D45 A;  3GE1 A;  4OKE A;  2HHV A;  4C8M A;  3RMC A;  5D3G A;  2G8I A;  2OPR A;  3PLA A;  2B4J A;  3D7E O;  4FM0 A;  4DQQ A;  2KTQ A;  1YTU A;  1RT1 A;  1HUX A;  2J4R A;  3HK2 A;  2ITG A;  4AM7 A;  2VWJ A;  4CJT A;  2D1K A;  2O8E A;  2E2N A;  2NZT A;  4LH4 A;  4DKW A;  1KAX A;  3V9Z A;  1T03 A;  4BRH A;  2BE2 A;  4HVJ A;  1EP4 A;  5AQN A;  4FK2 A;  3VEV A;  3TTC A;  2OTL N;  2EHG A;  1HKB A;  1WAJ A;  2QKK A;  4CGH A;  1MA9 B;  1Y97 A;  2XO7 A;  5C2D A;  2FSN A;  3IG1 A;  5KTQ A;  4FYD A;  5AQI A;  2WON A;  1QHT A;  1TK8 A;  4X66 K;  4KH5 A;  4CER A;  1WBD A;  3AVI A;  4LFB K;  4KB0 A;  3V4I A;  2G8W A;  1WLJ A;  3ZT3 A;  1L3V A;  4O5F A;  4AHT A;  2ZQB A;  3WXL A;  2AJQ A;  1J9A A;  1NMN A;  4CFA A;  1YJW N;  1YHQ N;  4CBX A;  3SMS A;  4DUZ K;  3A0I X;  1U2V B;  4A62 A;  1X3M A;  4I2Q A;  4Z4H A;  3UKR A;  2AA4 A;  1NK0 A;  4G9Z A;  4AHU A;  1CLQ A;  3W3D A;  3MN5 A;  3C65 A;  3WEE A;  4DG1 A;  3HJF A;  3ZT1 A;  4JD2 A;  1BI4 B;  2JWL A;  3D0P A;  4BWJ A;  5AQS A;  4LH5 A;  4UY8 O;  5T7B A;  1UWB A;  2KHO A;  4PKI A;  3ID6 A;  4EZ9 A;  4CF0 A;  2FSK A;  4KO0 A;  4IJN A;  1IO2 A;  4H5V A;  1QQM A;  3MK6 A;  2FXU A;  3T69 A;  1KXP A;  4E19 A;  4CZH A;  3FZL A;  3S9H A;  1KTQ A;  4BRO A;  1HQU A;  4FWM A;  4JRQ A;  3O9Q A;  3RSE B;  1L3S A;  5K14 A;  1EKE A;  1JXE A;  1XC3 A;  3I33 A;  3OJS A;  2HF4 A;  2V7Z A;  3CCQ N;  3SBT A;  4W5R A;  4DV5 K;  3OS0 A;  3SJJ A;  2HHH K;  1TAQ A;  2A3Z A;  4FM2 A;  4QS9 A;  1LOT B;  3TSU A;  5MLC Q;  3QER A;  4CGF A;  2DFH A;  3C7N B;  3T1A A;  2FF6 A;  5GIO A;  3OS1 A;  1JCE A;  4MO4 A;  4X65 K;  2VGN A;  1NM1 A;  2HNZ A;  5BN9 A;  3S3M A;  4U67 L;  4M3W A;  1SV5 A;  5KPZ A;  3CCR N;  1XI1 A;  3LWM A;  3M8S A;  3K5N A;  1MDU B;  4BVO A;  3EE9 A;  3SLC A;  2QWQ A;  2QWN A;  2HBJ A;  4CJ3 A;  4DF4 A;  4IWV A;  5HRO A;  4M3X A;  4CD3 A;  5M1P A;  5C0Y A;  1K8K B;  4EP4 A;  2VWK A;  2P51 A;  4JKD A;  2HF3 A;  2NRX A;  3OYJ A;  2HHU A;  1B92 A;  3JXU A;  5HLF A;  3ENO A;  4AH9 A;  3HBT A;  3QIO A;  4FK0 A;  3NCI A;  2QEX N;  3VQ4 A;  1RT4 A;  2E2O A;  4I9Q A;  5HBM A;  1EET A;  4B3M K;  2KW4 A;  1L3U A;  1RBS A;  3THW B;  1K8A O;  1VK0 A;  1YIT N;  1WSI A;  1D4X A;  1JLE A;  4H0V B;  5AQM A;  1N33 K;  3CHW A;  2Z1H A;  5FRO A;  5AFU A;  3GOI A;  1U47 A;  1RDB A;  4Y0W A;  3QEI A;  1RFQ A;  1LW2 A;  2KZZ A;  4JI7 K;  1T44 A;  1NGA A;  3AA4 A;  5CY4 A;  2A42 A;  4BGA A;  2HBK A;  1HLU A;  2ZWH A;  3AVM A;  5FPM A;  3CIP A;  3CF5 L;  5KRT A;  2HST A;  1HNV A;  5M1K A;  2GBZ A;  2BDP A;  3L0Q A;  1S9E A;  3R3L A;  3K5M A;  4Z94 A;  3R8E A;  1J5E K;  1OKJ A;  3PIP L;  4BRM A;  1KSP A;  5F2R A;  5KQ8 A;  1NGB A;  4ICL A;  4RCH A;  3DXK B;  3TTF A;  4YOT A;  4JI5 K;  4WFB L;  4JHD B;  1KFD A;  2YJF A;  4E0D A;  4DCH A;  1TVR A;  3LDQ A;  4C1N I;  4OVL A;  5EX5 A;  1U2V A;  3U6F A;  5JS1 A;  3KK1 A;  1QSY A;  2I7P A;  4BRC A;  1G15 A;  4OJR A;  3VQP A;  3WXK A;  3VA3 A;  3MMV A;  4KB1 A;  2D5R A;  4CEO A;  3O3F A;  1BI4 A;  3HZ6 A;  1B9F A;  1YUW A;  3MWT A;  4YNQ A;  3DRS A;  2ZJP L;  4MLH A;  4LF4 K;  4Q5V A;  1NG9 A;  1SS6 A;  3BDP A;  4C8O A;  1OH5 A;  5AZJ B;  3VGM A;  2GWJ A;  1QSS A;  1BDG A;  2O8C B;  1TUU A;  4CBW A;  3VQ9 A;  4DWI A;  4M3Z A;  3ZSV A;  3LPT A;  4F4K A;  1RBU A;  4NXN K;  2UXC K;  2HNY A;  3AGR A;  3RSE A;  1NNE A;  3VET A;  4DTM A;  3P4I A;  2IIR A;  3M3Z A;  2HHT A;  4EIA A;  5JLH A;  3MXJ A;  1B9D A;  3G71 N;  4XEI A;  4CEC A;  3C7N A;  4CEZ A;  4LFC K;  5AQO A;  3CER A;  3K0S A;  4B9U A;  4WE1 A;  3SK3 A;  2FC0 A;  3CQY A;  3VTI A;  4AIL C;  3VQC A;  3IMX A;  1C0M A;  2UUB K;  4LFA K;  5DMR A;  3M5R A;  5H1S Q;  3AVF A;  2YCH A;  3KLG A;  3QIN A;  1WN7 A;  3ASM A;  3V1O A;  4DS5 A;  2GV9 A;  4CE9 A;  1C0G A;  2DPN A;  1NWK A;  4KTZ A;  2GEM A;  2YNF A;  4WQ5 C;  5AQW A;  3MCP A;  4C23 A;  2FSJ A;  4JI6 K;  5EVZ A;  4RWT A;  1X9M A;  2V51 B;  1A5W A;  3ULE B;  2A40 A;  4YOW A;  2D0B A;  1RTH A;  4HTU A;  2DFE A;  2HVI A;  4O5B A;  4W5Q A;  3ATV A;  4B9N A;  1FXX A;  4FLX A;  3K9K A;  3SQ1 A;  2F8S A;  4DFK A;  3HL8 A;  4B8A B;  3KJV A;  4HUF A;  2CGJ A;  3RR7 A;  2OPP A;  4BRK A;  1U04 A;  5SWM A;  3TAF A;  1SL0 A;  3HOT A;  1I3A A;  2UU9 K;  5AQT A;  4HHT A;  3ZEU B;  2XY8 A;  3BZK A;  1WSF A;  4IEE A;  4UQG A;  1VRU A;  4M3T A;  3ISN C;  1ATS A;  1TK0 A;  4BQZ A;  4MLE A;  3SV4 A;  3SNN A;  3P5J A;  4IDK A;  2RE2 A;  1HX1 A;  2PFU A;  3SUO A;  1HNW K;  2O8B B;  4G1Q A;  5AQK A;  4DLG A;  5CZ2 A;  1XC9 A;  1OH6 A;  1HNZ K;  3MEG A;  3THV A;  2CH5 A;  5IT9 O;  3DRP A;  1ATR A;  2CGK A;  1Z05 A;  2EWS A;  1IG8 A;  1YTA A;  3WNH A;  1HKC A;  4JHD A;  1KFS A;  4FJL A;  2IS3 A;  4E1J A;  3DAW A;  4Z4I A;  1NBW A;  4RW6 A;  4PHT X;  3LDL A;  1TAU A;  3K57 A;  1D9D A;  3ZSX A;  1U48 A;  5BR9 A;  2CH6 A;  1WSH A;  3EY1 A;  4B9L A;  4I6M B;  3AVL A;  2HVH A;  2FBV A;  3LZI A;  1X9S A;  3SAF A;  4FW2 A;  2HHQ A;  1TL1 A;  4AQY K;  1BGX T;  4KI6 A;  4F3O A;  1NK5 A;  3A5N C;  4H0T B;  3C6T A;  1T8E A;  1QZ6 A;  4CHQ A;  4A2A A;  1N6Q A;  1SAZ A;  4IFY A;  3AY9 A;  5CHI A;  1IV0 A;  5AZJ A;  1BO5 O;  4LD0 A;  1VHX A;  1O13 A;  2HBM A;  3FR0 A;  2O8C A;  3LDO A;  3CCV N;  3PO5 A;  4W5N A;  1XHX A;  2GWK A;  3ALY A;  2E2P A;  2QWM A;  1LWC A;  5B8H A;  3OA9 A;  4DR2 K;  1UAX A;  4BC3 A;  4BRE A;  3O8M A;  4GV6 A;  1OVY A;  1YVU A;  3CJC A;  4JYA K;  3LM2 A;  2OZM A;  3DOL A;  2O8D B;  4QS7 A;  2RN2 A;  3VN5 A;  3V81 A;  1RTD A;  4OPK A;  3TAP A;  4K8X A;  4LF5 K;  1D5A A;  2X6S A;  1TK5 A;  5HRN A;  1HPM A;  2YNI A;  1VQ8 N;  4K0K K;  5GAG P;  3AVA A;  4PA1 A;  1EO1 A;  4C8N A;  3EE8 A;  1SKR A;  1M1K O;  4B3S K;  4B3T K;  1WNS A;  4CVN E;  4OKJ A;  4ELU A;  3KHY A;  1NK7 A;  5GIP A;  3TAR A;  4QS8 A;  1O1W A;  4JAX A;  1BQM A;  1V4S A;  4ZTF A;  3T19 A;  1KAY A;  1HKG A;  2OPS A;  4KPY A;  1ASU A;  4B3O A;  4N47 A;  3ULE A;  5GAH P;  3PUF A;  4KTQ A;  2YHB A;  1X1P A;  4CEE A;  4DSL A;  3EN9 A;  3LAN A;  1S1W A;  1EWQ A;  1W7A A;  3HPH A;  3QBX A;  5BRE A;  3TAB A;  2JLE A;  3NF9 A;  4YOU A;  3ZSW A;  2D0A A;  4DU4 A;  1VRT A;  1Q9X A;  4IG0 A;  3ZEU A;  4GV9 A;  2XY5 A;  3FLC O;  1R59 O;  4CJP A;  4EHT A;  3SQ0 A;  1HJO A;  3K9J A;  4NLC A;  2Q97 A;  2E20 A;  2O8B A;  5LY3 A;  4EHU A;  4ELV A;  4DV3 K;  1ZYQ A;  2RHK A;  4FZX C;  4GNI A;  4DV1 K;  1GLA G;  2IVN A;  3OYM A;  1LAW A;  2PY5 A;  2F4V K;  2ZGZ A;  1BCM A;  3DM2 A;  3CMA N;  3ZSQ A;  1NJY A;  1IBM K;  1S22 A;  1RTJ A;  1ASW A;  3E1Y A;  3JYT A;  4DTR A;  3K2P A;  2OAN A;  3WXJ A;  3EZ5 A;  2DTU A;  3F9M A;  4K41 A;  4LC9 B;  1HJR A;  4DQS A;  3MXI A;  4J2A A;  1BIS A;  3E9L A;  4I6M A;  3SAH A;  3VGL A;  3RR8 A;  5HRP A;  1Q81 O;  3VEN A;  4CHP A;  1Q82 O;  3MN6 A;  3QDK A;  3EL2 A;  4BDP A;  3M8Q A;  1QQN A;  4U7B A;  4NCA A;  1TKD A;  3V9X A;  1QHA A;  1S5J A;  1XUP O;  3THY B;  1KC8 O;  3VQB A;  1JLA A;  4CFC A;  4BG8 A;  1HNI A;  1R0A A;  1SZ2 A;  4YFU A;  2QWL A;  1HMV A;  3AVG A;  3BZC A;  4I9L A;  4BRQ A;  3LP3 A;  1XMQ K;  3QB0 A;  1S9G A;  2V7Y A;  4DR5 K;  3LDS A;  3LL3 A;  4PKH A;  2P9U B;  1GLJ O;  3EZW A;  3RMA A;  1ASV A;  2ASO A;  2F96 A;  1UA1 A;  4L3Q A;  3R9P A;  4CFB A;  2O8D A;  4B1Z A;  4CES A;  5AQX A;  1U45 A;  1J54 A;  3MXM A;  1NLV A;  5E41 A;  4ZHR A;  1RDW X;  4IFV A;  4JKG B;  1X9W A;  3VOV A;  2IAJ A;  4IJA A;  4AHR A;  3BGR A;  4F2R A;  4ID1 A;  4FJN A;  1I94 K;  2ATQ A;  3AO5 A;  3DI6 A;  3SYZ A;  1Y64 A;  3T1Y K;  4YDU A;  4LF7 K;  3VQQ A;  3ZT2 A;  2Q31 A;  4CZE A;  2E2Q A;  1JCG A;  3ZX2 A;  4KHN A;  2BH1 A;  3WT0 A;  2O8F B;  4DB3 A;  2P9P B;  1H1V A;  4EAH D;  5ADX H;  3ENH A;  2VQE K;  2PAV A;  2P9L B;  1S1T A;  3DOK A;  2E8A A;  3OW2 M;  4CEQ A;  2FBT A;  1HYZ A;  4IXC A;  3V1R A;  1Q18 A;  4H5N A;  4CJF A;  5KRS A;  2NRR A;  5DM7 L;  5AR0 A;  4OX9 K;  3O9S A;  4CEA A;  3I56 N;  3CQX A;  2Z1G A;  4KBO A;  4WFN L;  4JKA A;  1RDA A;  4FLY A;  3EKU A;  1VSI A;  3GDQ A;  1EXQ A;  2JGU A;  4B08 A;  4AF1 A;  1G99 A;  3WNG A;  5FDL A;  4WQ4 A;  5JS2 A;  3M1F A;  4DFP A;  3C6U A;  2VG7 A;  4CJ7 A;  3QES A;  1XMO K;  4J8F A;  2E88 A;  3JSM A;  5AQU A;  2W42 A;  1QE1 A;  3LP1 A;  3FZF A;  3S41 A;  3G10 A;  4X64 K;  1LCU A;  1TGO A;  2OZS A;  3F73 A;  2GEL A;  1VSM A;  1KVB A;  4JK7 A;  5KQD A;  3L4Q A;  3IRX A;  3HT3 A;  5KGX A;  5AQH A;  1BL3 A;  3KLF A;  3SCX A;  3W0L A;  1A5X A;  4MDA A;  2NUB A;  1U6Z A;  1SQK A;  2PYJ A;  4E7L A;  3DWL A;  4BE2 A;  3HYF A;  3VQ5 A;  1S3X A;  1NGE A;  3THX B;  3PO4 A;  2P9K B;  4CJR A;  4W5T A;  1DTT A;  3VF2 A;  4PL7 A;  2X78 A;  1HYS A;  4CIG A;  5GAD P;  3ZET A;  1IH7 A;  3KZB A;  2P5G A;  4BC4 A;  3NMU A;  4NB4 A;  5A2Q O;  4PY5 A;  4ISE A;  2ZGY A;  4LF9 K;  1UA0 A;  4JKF A;  5AQJ A;  5KGW A;  5JIC A;  2NRT A;  3NFA A;  1SL1 A;  3ZCM A;  4M3U A;  4CZG A;  4CHO A;  3IDH A;  5IWA K;  4N5S A;  3DLB A;  3CCL N;  4FSV A;  4B9V A;  3L2W A;  2OCE A;  3O4Q A;  3KTQ A;  3FZK A;  3RWU A;  3B8A X;  4FWQ A;  2ZM6 K;  4BR9 A;  5DM6 L;  1P8Z A;  4RW7 A;  2HHX A;  4KKO A;  4CJK A;  3EO3 A;  4JKH A;  1RGI A;  3F9K A;  4F2S A;  4FJG A;  3L6Q A;  4JI0 K;  1K9M O;  2ZE2 A;  5LMU K;  3O4N A;  3THY A;  4FJ8 A;  5BRH A;  4PUO A;  5LJW A;  5JVG L;  3IAY A;  4E7I A;  3KK3 A;  4HWI A;  1W2B M;  1JLF A;  2WUS A;  4A5A A;  3CET A;  4OPA A;  4GKJ K;  1RT3 A;  3Q7B A;  4XH1 A;  4CEB A;  3HSC A;  3ENB A;  2P9I B;  1J6Z A;  3BP8 A;  1CZB A;  4ZTJ A;  2P9U A;  4H0O A;  5KPR A;  4CJL A;  1TUY A;  3MN9 A;  1WAF A;  4ISF A;  3RRH A;  1VSK A;  4FWL A;  4A2B A;  2Q2R A;  2WTU A;  3OTO K;  4JKG A;  1GLD G;  2UXD K;  4ILG B;  4NYN A;  3CJ1 A;  3M6G A;  4DSJ A;  1JLG A;  2QTD A;  4OO1 J;  2IOC A;  3KK2 A;  1LW0 A;  4OLA A;  1ILY A;  3J8A A;  1WOQ A;  2G8H A;  3E9P A;  3KVG A;  3G4S N;  4FPA A;  4BRN A;  3VER A;  1NGF A;  1SUQ A;  3N4P A;  4BVP A;  2IGI A;  2P9P A;  3MAQ A;  1KCF A;  2VG6 A;  1NOZ A;  3KWG A;  2P9L A;  2PYL A;  1JKH A;  1SL2 A;  2YKM A;  1W0H A;  4CIE A;  4JKE A;  2UUC K;  4CZL A;  3VEY A;  4DV2 K;  3HM9 A;  2UUA K;  1DKG D;  3AA2 A;  2UXB K;  1W97 L;  4J2E A;  4OGE A;  2HB5 A;  3OYE A;  3C6H A;  3PX4 A;  2HHW A;  3DLH A;  1L3T A;  3J7Z O;  4BC5 A;  4DSK A;  3DJC A;  3EKS A;  1YVN A;  3V9W A;  1TYQ B;  3S3O A;  2E6L A;  4XH4 A;  1JXB A;  4CED A;  3C6A A;  4J2D A;  5EU7 A;  2KFN A;  3J7A P;  1NK8 A;  3PY8 A;  1CXU A;  2WBN A;  5FRN A;  2YI1 A;  3VEX A;  1S1X A;  1Q9Y A;  1YAG A;  3O5B A;  1QSL A;  4PL8 A;  4H03 B;  4DSE A;  1XWL A;  4OPH A;  3M8P A;  4FLW A;  3KD1 E;  4NLB A;  3DLL L;  3DYA A;  4FWS A;  1VQ9 N;  2OTJ N;  1C1B A;  5DK5 A;  3THX A;  3CI5 A;  2BTF A;  4EP5 A;  5HP1 A;  2P9K A;  3VPZ A;  3U9D A;  4YOX A;  3CM5 A;  3FE1 A;  3QFP A;  1DTQ A;  3CD6 N;  3B6O A;  3O4W A;  3HVR A;  3CC7 N;  3I0R A;  4BQL A;  3VQ7 A;  1ZBU A;  3ZX3 A;  1IKY A;  1K8K A;  3VQE A;  1VSD A;  1J5O A;  1KD1 O;  1W9H A;  3AAP A;  5AQQ A;  1BIU A;  3MX5 A;  2OA8 A;  4FJI A;  2KLA A;  3AO3 A;  1LAV A;  5HRS A;  1EWR A;  4WQ4 C;  4E89 A;  3FFI A;  1FK9 A;  3LPU A;  1GLC G;  4HCC A;  2B5J A;  4KFB A;  3KD5 E;  3IS9 A;  3OS2 A;  4BE1 A;  2W6L A;  3D2E B;  3THW A;  1Z25 A;  3QEV A;  2W40 A;  4FM1 A;  1QVG M;  2XRI A;  3AV9 A;  2QWO A;  4Z0U A;  2VCP A;  2H3G X;  3N4Q A;  4NCB A;  3P38 A;  1S6Q A;  1C1A A;  1J53 A;  1Q86 O;  4BR0 A;  4H5R A;  3NAE A;  4E3S A;  1YIJ N;  3AO2 A;  2P5O A;  3KLE A;  4X62 K;  4M42 A;  3CC4 N;  3RRG A;  4J2B A;  2P9I A;  1NKE A;  1P90 A;  2ETJ A;  3OYG A;  4DSF A;  3PX0 A;  5M1F A;  3I8D A;  1T3V A;  3SUN A;  3DRR A;  2HND A;  2QKB A;  1XNQ K;  1GLF O;  1XQS C;  4C1N K;  5JVH L;  1F21 A;  3DXK A;  3SJH A;  2BUP A;  2Z1J A;  4K8Z A;  4CBU A;  3SUQ A;  4FXD A;  2G8F A;  1U49 A;  3VGK A;  3HVT A;  4KHY A;  3K58 A;  3CYM A;  5BPL A;  1IBL K;  4BGB A;  3LAK A;  3AVK A;  2HMP A;  1WB9 A;  1BHL A;  1IG9 A;  1KRP A;  2VYP A;  3OYB A;  3QNN A;  1VQK N;  4JS5 A;  4CJ4 A;  3NF8 A;  2Q0U A;  1VSL A;  1VSE A;  3J81 O;  1BWF O;  1C1C A;  3E66 A;  4DR1 K;  2ZF5 O;  3MEC A;  4CJU A;  2Y1J A;  2I5J A;  1NGC A;  2A6A A;  3L3U A;  3FZM A;  4JV5 K;  3J7Y P;  2KQ2 A;  5CE3 A;  1NGJ A;  3O6W A;  4CZK A;  5J2N A;  5JMV A;  3L2Q A;  4BDY A;  2XHB A;  1TYQ A;  4KTW A;  3CXC M;  1FKP A;  4FLZ A;  4MO5 A;  5C12 A;  5J2M A;  4DV7 K;  1WSE A;  4CK1 A;  4I7F A;  4DQI A;  3SBG A;  4CZJ A;  5CYQ A;  3WUH A;  1FJG K;  3H1Q A;  3TAM A;  4M3R A;  4CK3 A;  4QOZ B;  3CFR A;  4JS4 A;  4A61 A;  2E6M A;  1JL2 A;  3L4I A;  3LM9 A;  4KHU A;  1FW6 A;  5C42 A;  4KHP K;  3TSQ A;  4LF8 K;  1ZBS A;  3AGK A;  2F9T A;  4CGG A;  2QI2 A;  3UIQ A;  5GIN A;  1HYV A;  4LSL A;  1EQY A;  3G25 A;  4RW4 A;  4JI4 K;  4O44 A;  1K73 O;  3TSP A;  3QFU A;  4IFE A;  4H5T A;  1VQ5 N;  4M45 A;  4KH4 A;  4FWP A;  3CFO A;  4JN4 A;  4DTS A;  2G8K A;  3I55 N;  1NKB A;  4FVU A;  1NJX A;  3U4L A;  5AJ3 K;  4FWK A;  3LZJ A;  4E1M A;  1ZBI A;  3H3O B;  4C8L A;  4CHN A;  3QNO A;  3NGI A;  4EZ6 A;  3I8B A;  3DMJ A;  1Q7Y O;  3D2E A;  4FL9 A;  1HNX K;  4GV3 A;  1LWF A;  4DR7 K;  3WQU A;  4XH5 A;  3QIP A;  3NVK A;  5I3U A;  1RDD A;  1KVA A;  2ASP A;  3F5T A;  4B8C A;  1HRH A;  5C24 A;  4HTL A;  3DLG A;  4IEI A;  1YXQ A;  2EX3 A;  4FJM A;  4DR6 K;  2A41 A;  5LMN K;  3GG4 A;  1TKZ A;  5LJV A;  3VF6 A;  3A5L C;  3H3N O;  3TAQ A;  4B1W B;  1V4T A;  3CJ9 A;  1NGG A;  1SKW A;  4HUG A;  4DFJ A;  4ILJ A;  3VQ6 A;  3O3H A;  4R79 A;  2Y1I A;  4JI3 K;  5JLF A;  5LL6 Z;  4IDH A;  1LWE A;  3TAE A;  4KI4 A;  2RF2 A;  1E4G T;  3E01 A;  3QIC A;  3K59 A;  4A59 A;  4CZM A;  2PZS A;  2HMI A;  1RIL A;  2JWK A;  4BRG A;  3H45 C;  1RT5 A;  2D0O A;  1WBB A;  1BUP A;  4N41 A;  3TAG A;  4CHZ A;  3HPO A;  4RTF D;  4JEP A;  5AQG A;  4GY2 B;  4BDZ A;  3TTD A;  4DUY K;  4DQR A;  1CZA N;  2KKZ A;  1RNH A;  3U8X A;  5AQP A;  3RTV A;  3SI6 A;  3OBW A;  3AVB A;  3G6E N;  1T7P A;  4CHY A;  2QXF A;  4FOI A;  4DU3 A;  1BA0 A;  1NGI A;  3ITH A;  3QO9 A;  5TKY A;  5AZI B;  3HP9 A;  3T3F A;  5M1O A;  5AQL A;  4OKK A;  4Y1D A;  1JLQ A;  3A8Y A;  1YF5 L;  4IOX A;  4FLT A;  1MWM A;  4CJE A;  4FWN A;  4DR3 K;  1NOY A;  3VA0 A;  3MWP A;  1YI2 N;  2A1S A;  2YKN A;  2YHX A;  3MEE A;  3ULD A;  4DV4 K;  4FW1 A;  1VSJ A;  5TKW A;  1ATN A;  3MED A;  4JK9 A;  4MFB A;  1BG3 A;  3CJA A;  3K5O A;  5I42 A;  4DF8 A;  1JL1 A;  4E1N A;  4FJ9 A;  1NK9 A;  2YHW A;  4C8K A;  3VQD A;  4BR7 A;  4CEF A;  2W41 A;  3NGZ A;  5BRF A;  4IOA L;  4DTU A;  3AVJ A;  2P9S B;  3LAL A;  4W5O A;  1ITG A;  1SKS A;  3CM6 A;  1WSG A;  2HW3 A;  4OGC A;  3OJU A;  1XNR K;  2IC3 A;  2A1R A;  2AP1 A;  2ZD1 A;  4NXM K;  1N34 K;  1ZBL A;  1N8R O;  2Q0R A;  3H08 A;  3NE6 A;  4PWD A;  1ZBF A;  3NF6 A;  3VQ8 A;  2BGG A;  2P9N B;  4BWM A;  4BE0 A;  3NDK A;  4CJQ A;  1VAZ A;  3TR8 A;  4DTJ A;  4BAC A;  4B9T A;  3HM8 A;  1S6P A;  1YT3 A;  4JKC A;  2YNH A;  4Z4E A;  1IJJ A;  1NJZ A;  4JKB A;  3CJB A;  3UKU B;  3QBW A;  5M1Q A;  4JI2 K;  2YHA A;  3WXI A;  5FRM A;  4O55 A;  3CPW M;  5C2F A;  2D0C A;  4GMJ B;  4B9S A;  4KHW A;  5C15 A;  1IKV A;  3MN7 A;  2IVO A;  2D0P A;  3R6M A;  3AAQ A;  5EOY A;  4WQ5 A;  3H1V X;  4BRD A;  3KIO A;  1VSF A;  3NBP A;  4E7J A;  2I7N A;  1KLM A;  3AA3 A;  4BR2 A;  2F8T A;  2GUP A;  2R7Y A;  1VQL N;  3AVH A;  4B9M A;  4B1X B;  3SV3 A;  4DQP A;  3TPQ A;  3L2U A;  4BR4 A;  2IVP A;  4AHV A;  1VQM N;  1IKW A;  2Q1N A;  4DTX A;  1NK6 A;  4CJW A;  4CF9 A;  3KK7 A;  2QWP A;  1ZC6 A;  4PKG A;  3LDN A;  1OH8 A;  1BA1 A;  3ZSR A;  4AHS A;  1IBK K;  1NK4 A;  4FJ7 A;  3A5M C;  3PX6 A;  1DEJ A;  2E1Y A;  4Z4G A;  1CZ9 A;  3CME N;  4CZI A;  3CCM N;  2IDO A;  4O4G A;  3QLH A;  3T7Z A;  3SPY A;  1T6D A;  4GW6 A;  2B6A A;  4N76 A;  4JRP A;  3CCE N;  3MX2 A;  2VGM A;  3CCS N;  3OBY A;  5CZ1 A;  1RDU A;  4DSI A;  1RTI A;  4LF6 K;  4F8R A;  4FZY A;  3VMF B;  3D2F B;  2P1J A;  3F2K A;  4QAG A;  4H5W A;  1RDC A;  2OYQ A;  2WFB A;  3BEX A;  4NO7 A;  1ZXO A;  1RT7 A;  2G8U A;  2VQF K;  5AZI A;  1VQO N;  4BRF A;  4CD1 A;  3V9U A;  5FLX O;  2NNW A;  3SZ2 A;  2ASM A;  3M8R A;  4KAZ A;  1YJN N;  1A5V A;  4CJS A;  3DLE A;  3DXM B;  4YOV A;  1KLN A;  3QEP A;  2YX6 A;  3OYA A;  1EX4 A;  2OPQ A;  1UOC A;  3CFP A;  4FOE A;  2F7T A;  5J1E A;  4O0I A;  3HO1 A;  4GKK K;  1YJ9 N;  1NGH A;  3LP2 A;  1Z6R A;  4LSN A;  5BRD A;  2LSN A;  3E9O A;  4FK4 A;  3OHR A;  3VQA A;  3KKS A;  4DMN A;  2DFF A;  1N36 K;  1RBV A;  2FF3 B;  4A5B A;  3WQT A;  3V9S A;  2P9S A;  2XY7 A;  3BF1 A;  4K43 A;  5CYM A;  5E26 A;  3CCU N;  3QET A;  1ZBH A;  4XIU A;  3LAM A;  4DTN A;  4BRP A;  3IKM A;  3A5O C;  3ZT4 A;  3L8B A;  2YV0 X;  2YNG A;  2HBL A;  4M7X A;  4BY9 C;  4ID5 A;  2O8F A;  3QEX A;  1REV A;  4FJX A;  4BC2 A;  1MWK A;  1GOA A;  4B1V A;  1N32 K;  2P9N A;  2E5L K;  1JLB A;  1NGD A;  4KHS A;  4IO9 L;  3H6E A;  3LDP A;  1NMD A;  3HRG A;  4H0P A;  3SQ2 A;  2QK9 A;  2RKI A;  3UKU A;  4CW7 B;  3D6R A;  5FPE A;  3SAG A;  1D8Y A;  1FKO A;  1XHZ A;  3C95 A;  3P1G A;  4IZ9 A;  5F0X A;  3RMB A;  1X3N A;  4FWO A;  4FPB A;  3RVC A;  3CJ7 A;  1IKX A;  1GLB G;  3SMP A;  1DGK N;  1C0T A;  5C10 A;  2Q3S A;  1VQ6 N;  2UYT A;  4FJ5 A;  1QQO A;  1QQC A;  4KV8 A;  2KZM A;  4NCG A;  3BY5 A;  4WFA L;  4FCY A;  5J2P A;  1RT6 A;  2VG5 A;  4FJK A;  4CFD A;  3VEZ A;  3O9R A;  1N5Y A;  4F9O A;  4RW9 A;  4YDU C;  1BCO A;  4GVM A;  2X6N A;  1BU6 O;  3PSI A;  4CCH A;  3SUP A;  3DLK A;  3ATU A;  5FPD A;  4JK8 A;  1NKC A;  3TU5 A;  3PIO L;  1QZ5 A;  1I39 A;  1NJI O;  1MU2 A;  3WXM B;  1KQS M;  4M63 C;  1VSH A;  3NHG A;  3AO4 A;  3L2R A;  3I0S A;  1U4B A;  3KKR A;  4JNE A;  1GLE G;  5AQR A;  3O9T A;  3O1W A;  3HTV A;  3B6P A;  4YHH K;  4JI1 K;  4Y1C A;  4OLB A;  2WC9 A;  2Q36 A;  3OYN A;  2FBY A;  1S1V A;  3VEW A;  4DHY A;  1VQ4 N;  1X9J A;  4I2P A;  3BF3 A;  3IUC A;  3TI0 A;  1T6C A;  2F9W A;  3D2F A;  3C0B A;  5BPM A;  1BIZ A;  5ELZ A;  3IFR A;  3OYH A;  3K5L A; 
#chains in the Genus database with same CATH homology
 2UUB K;  3JAM O;  4DR3 K;  3T1H K;  4LFA K;  4AQY K;  1XNQ K;  1I94 K;  5AJ3 K;  1N32 K;  4DV4 K;  2E5L K;  2ZM6 K;  3J7A P;  3T1Y K;  4LF7 K;  1IBK K;  1IBL K;  4DR4 K;  1J5E K;  4CW7 B;  4B3R K;  1HNX K;  4JI0 K;  3J80 O;  4DV3 K;  4DR7 K;  4JI6 K;  5LMU K;  4DV1 K;  2VQE K;  4JI5 K;  4DV5 K;  4DR2 K;  2HHH K;  2F4V K;  3J81 O;  4OX9 K;  4GKJ K;  4LF6 K;  4DR6 K;  5LMN K;  1IBM K;  4JYA K;  4DR1 K;  4X65 K;  4JV5 K;  4LF5 K;  3J7Y P;  2VQF K;  4DV6 K;  1XNR K;  1XMO K;  4K0K K;  4NXM K;  4DV0 K;  2UU9 K;  5FLX O;  1N34 K;  4X64 K;  3OTO K;  4JI3 K;  2UXD K;  4X66 K;  4LF4 K;  5LL6 Z;  4B3S K;  4LFB K;  4B3T K;  1HNW K;  4DV7 K;  4CVN E;  4JI2 K;  1HNZ K;  5BR8 K;  1FJG K;  4GKK K;  4NXN K;  2UXC K;  5IT9 O;  4JI8 K;  4YHH K;  4JI1 K;  4DUZ K;  4B3M K;  4DUY K;  4V19 S;  1XMQ K;  4KHP K;  4LF8 K;  4DR5 K;  1N36 K;  2UUC K;  1N33 K;  5A2Q O;  4LF9 K;  4X62 K;  4DV2 K;  4LFC K;  4JI4 K;  2UUA K;  2UXB K;  1HR0 K;  4JI7 K;  5IWA K;  4YY3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...