4H0OA

Crystal structure of acetate kinase from entamoeba histolytica
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
391
structure length
383
Chain Sequence
SNVLIFNVGSSSLTYKVFCSDNIVCSGKSNKPFIEHHLNGQIIKIETPILNHPQAAKLIIQFLKENHISIAFVGHRFVHGGSYFKKSAVIDEVVLKELKECLPLAPIHNPSSFGVIEISMKELPTTRQYVAIDTAFHSTISQAERTYAIPQPYQSQYLKFGFHGLSYEYVINSLKNVIDVSHSKIIACHLGTGGSSCCGIVNGKSFDTSMGNSTLAGLVMSTRCGDIDPTIPIDMIQQVGIEKVVDILNKKSGLLGVSELSSDMRDILHEIETRGPKAKTCQLAFDVYIKQLAKTIGGLMVEIGGLDLLVFTDQMGLEVWQVRKAICDKMKFLGIELDDSLNEKSMGKKIEFLTMPSSKVQVCVAPNDEELVILQKGKELFQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetate kinase
publication title Crystal structures of acetate kinases from the eukaryotic pathogens Entamoeba histolytica and Cryptococcus neoformans.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 126
structure length 383
sequence length 391
chains with identical sequence B
ec nomenclature ec 2.7.2.12: Acetate kinase (diphosphate).
pdb deposition date 2012-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4h0oA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4h0oA02
2IVPA 4LC9B 3H3OB 4QS9A 4K43A 1NGFA 3EO3A 4PL8A 3ZETA 3FZKA 4JD2B 1XUPO 1NGIA 3IDHA 3I33A 4FPBA 3AY9A 1C0FA 1V4TA 3SJHA 2ZF5O 4CBXA 3D2EB 1GLCG 1GLBG 2PBDA 1ZXOA 3U9ZA 3IMXA 4H0OA 2YJFA 1NGAA 4CZIA 1LCUA 4FWMA 3H6EA 3VEXA 3B8AX 2QWMA 5BPLA 2WUSA 2ASMA 3ZX2A 3L6QA 4K25A 1NGDA 4PKHA 4BGBA 4BR9A 2P9SB 5AQYA 2GTDA 3QBXA 2QWNA 3WQUA 2Q0UA 1IG8A 1U2VA 4FWOA 1QQOA 3DJCA 4H0YB 3ENOA 2QM1A 4BRCA 4PKGA 1YVNA 3HZ6A 4MLHA 2GWKA 3FGUA 1NGJA 3ATUA 3HSCA 1R59O 1WUAA 1MDUB 3CJ9A 4BR5A 2IIRA 4CZEA 4EHTA 2FSJA 5AQRA 3VESA 1Y64A 5AZJB 3OHRA 1QHAA 1HKGA 2P9LA 4IJAA 1NLVA 4M7YA 4H03B 1K8KB 4FL9A 3VGKA 2Q31A 4BQLA 2PAVA 3BF3A 5FPMA 3M1FA 3BP8A 3O1BA 3CJ7A 5AQPA 2A40A 1BA0A 1V4SA 4FWPA 3LDPA 1QQMA 1MA9B 1CZAN 3WXLA 4QS7A 1U6ZA 1HPMA 3H45C 3H1QA 4B1XB 5AQOA 4BROA 4BR7A 1TUYA 2E1ZA 4NO7A 2VYPA 2EWSA 2CH6A 1TYQB 4H5VA 2FF3B 3QMLA 4B1WB 5AFUA 3WEEA 4M7XA 5AQIA 2P9KB 2D4WA 4FWRA 2YHWA 3A5OC 2P9NB 3VF6A 1IJJA 3VGLA 1C0GA 3EKUA 4BRFA 1G99A 4MLEA 5FPDA 1KAZA 2FLOA 1S22A 3GDQA 3ZX0A 4DQ8A 3EZWA 4RWTA 2QWOA 2QXLA 3LDQA 4FWNA 5TKYA 4BC5A 5AQFA 3O4WA 4CZKA 3HM8A 4B1VA 2E2PA 3AARA 3QICA 3DXMA 3EN9A 3TU5A 3A5NC 5EXWA 1MWMA 1KAXA 5E26A 3O08A 4BRIA 3A5MC 4BVPA 1GLAG 1DEJA 3C7NA 3CJBA 2QWQA 1E4GT 5EY4A 4WQ4C 5F1XA 3KHYA 5AFUH 3A5LC 3VEVA 4FPAA 2HMPA 1YAGA 4BRPA 2W40A 4NB4A 2E2NA 4IJNA 1KXPA 2E8AA 2H3GX 1JCEA 2YHYA 2E88A 4IXCA 3GL1A 3F9MA 2FF6A 5BRHA 4CBWA 1T6DA 3ULEB 3ZETB 4H5WA 2NRHA 5AQLA 4DB3A 1ZC6A 5AQVA 2I7PA 4BG8A 1T44A 4CD3A 2A41A 3QFPA 2D0PA 4RTFD 5FPNA 4B1YB 3U4LA 1H1VA 3MN7A 3WXIA 3UKRB 5BR9A 4BRGA 4Z94A 3VF2A 1HUXA 5CE3A 3A0IX 5BPNA 1S3XA 1DKGD 4HTLA 3TPQA 4XH4A 3LM9A 3L0QA 1RFQA 4WQ4A 5KQDA 1GLDG 4CZGA 4BC2A 2NZTA 3EL2A 2A5XA 2QWRA 4I6MB 3O8MA 3CQYA 4YDUC 4BRLA 5EX5A 3VETA 3DAWA 3LDOA 3WUHA 1HX1A 2CGKA 1NGEA 5JMVA 2A3ZA 3LL3A 4WQ5C 3EKSA 4JN4A 1ESVA 4O5FA 3P4IA 4JNEA 4FWKA 5AQGA 3LM2A 2ZGYA 4CBUA 3R8EA 2OANA 1SZ2A 4EAHD 5KPZA 3CIPA 3SMSA 2J4RA 4CZFA 1BG3A 3H3NO 2P9SA 1YXQA 2W41A 2A6AA 3L4IA 4C23A 3SK3A 4M63C 2FXUA 5ELZA 2D1KA 3IUCA 1J6ZA 1TUUA 3QDKA 3W0LA 2GWJA 3JS6A 3D2FB 3FZHA 2P9IB 5BN9A 4BRKA 3GOIA 4CZHA 3FZMA 2V52B 3MDQA 4BRQA 4CZLA 4A62A 3FFKB 2ZWHA 4YDUA 2KHOA 5AZJA 2GEMA 3DXKB 4A2AA 1KAYA 3H1VX 3CHWA 1K8KA 2CGJA 2AP1A 3UKUB 5JLFA 5AQMA 1E4FT 1X3MA 4J8FA 4K41A 4PKIA 4FSVA 1NWKA 2HF4A 4WQ5A 2QWPA 3ENHA 4H5RA 1WOQA 3SMPA 2Q2RA 4A2BA 3CI5A 1GLEG 2P9UB 4XH1A 4BVOA 5JICA 5AQKA 3WQTA 1JCGA 4DCHA 3VOVA 5F2RA 3G25A 1BO5O 3SLCA 3CJAA 3LDLA 3O1WA 1RDWX 2V7YA 4FWSA 4HWIA 4DHYA 5LJWA 3W3DA 5KPRA 5BPMA 4B1ZA 3FZFA 5AQHA 3GE1A 2V7ZA 3MN5A 4JHDB 5AQWA 4H0VB 3ZEUB 1XC3A 1YUWA 1SQKA 4ISGA 2P9KA 2QWLA 2IVNA 2CGLA 4BC4A 4PL7A 2P9NA 3R9PA 5AQUA 3BF1A 1HJOA 4IWVA 1BU6O 3WXKA 1NGBA 3UE5A 3RSEB 1P8ZA 4EHUA 4BC3A 3WXJA 3QFUA 3FE1A 2GUPA 4B1UB 4AM6A 4FOIA 4FOEA 1BWFO 1X9JA 5AQJA 2E2OA 3QB0A 4MO5A 2Q0RA 2E20A 2P9PA 2IVOA 2YHXA 1GLJO 5EOYA 2NLXA 1LOTB 3VEYA 5LY3A 3S41A 2HF3A 3D7EO 3VPZA 4KBOA 4Y0WA 3CJ1A 5EVZA 5AZIA 2YJEA 3ID8A 1JCFA 4RCHA 1GLLO 1BA1A 5F0XA 5ADXA 3ULEA 1QZ6A 4BRHA 1D4XA 1U2VB 3MN6A 1ATRA 2VCPA 3KVGA 1NBWA 2DPNA 4JD2A 2E1YA 4BRNA 2VWBA 4K42A 5AQNA 1HKCA 5AQSA 2CH5A 4E1JA 1X3NA 3D2EA 2FSNA 1QZ5A 3ATVA 4L3QA 3UKRA 3C0BA 3U9DA 4QS8A 4MO4A 3M3ZA 2V51B 3KZBA 3ZX3A 2P9LB 3M6GA 4ISFA 2Q36A 4CD1A 4ISEA 4JAXA 4BR0A 3AAPA 2AA4A 2FSKA 1QQNA 4BG9A 4CJ7A 5BRFA 3HI0A 3A8YA 3H46O 4I6MA 1ATNA 2ASPA 4BR4A 4CZMA 3BEXA 3AAQA 2ZGZA 5ADXH 1ATSA 5AQQA 4CZJA 1BOTO 2HOEA 1XQSC 3FR0A 1SAZA 3CJCA 4EFHA 3BUZB 2D0OA 3VEWA 1NMDA 4BRAA 4XH5A 3WEEB 3GG4A 4BR2A 3LDNA 3GBTA 4H0TB 4O8KA 3R6MA 4XEIA 2BUPA 5AQZA 5KQ8A 2YI1A 4GNIA 1MWKA 3HBTA 1T6CA 3MMVA 2F9TA 1EQYA 2Q1NA 3O6WA 2QW9A 5AQXA 2E2QA 4H0XB 5LJVA 4H5TA 3JXUA 4EIAA 1GLFO 4FO0A 3DWLA 3QBWA 3D2FA 3DXMB 2P9IA 3VGMA 2I7NA 2BTFA 3J8AA 4A61A 1Q18A 4BQZA 5AQTA 4CI6A 3C7NB 1OKJA 4BGAA 1TYQA 3DXKA 1BUPA 4H0PA 5FPEA 3UB5A 3UKUA 3CERA 3MN9A 1NM1A 1NGGA 2F9WA 1BDGA 3FLCO 4IZ9A 2YCHA 5AR0A 3FZLA 2Q97A 3O80A 2ITMA 4GY2B 3VENA 3VERA 4WYBA 4FWLA 3VF4A 2P9UA 4BRDA 5BREA 5I9EB 4AM7A 4F9OA 2A42A 1Z05A 3CQXA 4BREA 3CETA 1NGCA 5B8HA 1HKBA 2UYTA 4FWQA 3MCPA 2P9PB 1NGHA 4B9QA 5JLHA 4JHDA 3ZEUA 5BRDA 5E84A 1RGIA 1ZBSA 4H5NA 3MK6A 3VEZA 1DGKN 3IFRA 2GELA 3HTVA 3WT0A 4BRMA 3O5BA 2ASOA 3U8XA 5AZIB 4IO8A 1Z6RA 5BN8A 5KPTA 3I8BA 3VEOA 1HLUA 3RSEA
chains in the Genus database with same CATH superfamily
2IVPA 4LC9B 4Z4GA 4B3MK 3H3OB 1WSFA 1VAZA 3TARA 3QERA 1NGIA 4AHSA 4I2PA 2UUBK 1V4TA 4JS5A 1VQ9N 3D2EB 4OO1J 3IMXA 3H6EA 3B8AX 3EEQA 4CEDA 5BPLA 1R0AA 3F73A 3TAFA 4BGBA 4GV6A 5AQYA 2OZSA 5GAEP 3KJVA 2O8BB 1K6YA 2P1JA 3OY9A 5HOOA 2I5JA 1VQ6N 2AJQA 3NCIA 1YVNA 3FGUA 2G8VA 3ATUA 3HSCA 4OKJA 4BR5A 3D6RA 3O4NA 3QEPA 4AHVA 2JGUA 4IG3A 4K0KK 1BISA 2FSJA 5AQRA 3VESA 4KI4A 4KHYA 4OKEA 1Y64A 4FJIA 1C6VA 1JLBA 4B8CA 5C15A 4JKAA 1VQ4N 2Q3SA 1K8KB 1P90A 3BF3A 1WSIA 3TI0A 1Z26A 3M1FA 2RF2A 3BP8A 2JWLA 1J5EK 5AQPA 4DSIA 3LDPA 2NRTA 4CEAA 3NMUA 1RNHA 1MA9B 4RW8A 4CJ4A 1KFDA 1QTMA 4DQRA 1LWEA 4DSKA 3H1QA 1G15A 4ILJA 4BR7A 1TUYA 2YNFA 4NO7A 4JS4A 3LALA 3MEGA 2KTQA 3RMBA 4LF8K 2CH6A 4CHZA 4YFUA 3DOLA 4W5OA 4H5VA 5AFUA 1ZYQA 5M1NA 5AQIA 3AVBA 3DI6A 2D4WA 4CFAA 3VF6A 4BRFA 4CJ3A 4U7BA 4CHOA 3GDQA 4DQ8A 5FPDA 3TAGA 3LDQA 2O4IA 4HCBA 5TKYA 5AQFA 2NUBA 4FLVA 2O8DB 4B1VA 5KRSA 3S9HA 1OVQA 3AARA 3TU5A 2BGGA 1MWMA 4JI0K 5E26A 3A5MC 4BVPA 1OVYA 1GLAG 3CJBA 2HMIA 2BH1A 5DMRA 4FJ7A 5FRMA 2GX9A 3HVTA 1E4GT 4FK2A 4CFDA 5F1XA 5AFUH 4FPAA 3ZSZA 3NVMA 1U48A 2W40A 3ASMA 1NK8A 4IJNA 3OBWA 2E88A 2HB5A 2ZJQL 2VQFK 1L3TA 1U4BA 3MWPA 4DR5K 3HJFA 4CGIA 4Z4HA 1Q7YO 3KLIA 2I7PA 2BANA 3ZT0A 1T44A 3LAMA 1RDUA 2D0PA 3OYBA 4H8KA 1J53A 4R5PA 3WXIA 3NBPA 3AO5A 1C1CA 2ZQBA 1DTTA 1T8EA 2ETJA 1HMVA 4BRGA 2DY4A 4Z94A 1N6QA 2NRZA 4CERA 4B9LA 4JI5K 1S3XA 4HTLA 1W2BM 2OPSA 4AILC 1JLFA 1IH7A 4WQ4A 2OZMA 3E9OA 4E7KA 3CQYA 3DLBA 2IGIA 4C8KA 3VETA 3DAWA 3LDOA 3RR8A 1HX1A 2E4LA 3HPOA 1NGEA 5JMVA 5KGXA 4DKWA 4WQ5C 4NCAA 4ICLA 3O3GA 2HBJA 4OPHA 3P4IA 4IOCL 4FWKA 1NNEA 4C8LA 3LM2A 1T3VA 4FW2A 1NJWA 3SMSA 5KGWA 3T1YK 5JS2A 4NCBA 2NRWA 3THYB 4IFYA 1BI4A 2A6AA 3G6EN 3L4IA 3L2RA 4DTPA 3SK3A 2D0AA 3MX5A 1HJRA 3VA3A 3QDKA 3AO1A 2YV0X 1S72N 2PY5A 4Z4IA 4ZHRA 1X9SA 3JS6A 3ZSYA 3O4QA 1LWCA 3KD1E 3L2VA 3NE6A 3FZMA 1HNXK 4CZLA 5DM6L 2ZWHA 3CYMA 4YDUA 5AZJA 2ITGA 3DXKB 3L8BA 3H1VX 1SKWA 3CHWA 3J7YP 5HL7L 4Y1DA 4FSVA 1NWKA 2HF4A 1S5JA 3SV3A 3OYFA 1RTHA 3QEXA 2G8WA 1Q9YA 3G0ZA 2XY6A 2P9UB 2VG5A 3WQTA 1BCMA 4PWDA 4FWSA 3VN5A 5LJWA 4DHYA 1REVA 3W3DA 4FJXA 5CHIA 4WCEL 3FZFA 3SQ1A 3GE1A 3MN5A 4JHDB 2F4VK 3ZEUB 5C2FA 1YUWA 1SQKA 4DV3K 3CM5A 2CGLA 3LWLA 1HNZK 4KH5A 2G8HA 1WSGA 3KWGA 3DMJA 4FJNA 4QOZB 1SL1A 2G8FA 3I0SA 1S1VA 4DTMA 1O1WA 1P8ZA 1JLGA 4FM2A 4DSEA 3RTVA 4CVNE 3FE1A 2QKKA 4FOIA 4K8ZA 2F8TA 1D9FA 4YNQA 4X65K 3OJUA 4IO9L 1W7AA 1O13A 5J2QA 1ASWA 1LOTB 4NYNA 1WLJA 1YTUA 1NKEA 5GIPA 1S1XA 3ID8A 1JCFA 1QQCA 4GVMA 1HYVA 1U2VB 1IKXA 4CK2A 5T7BA 1ATRA 3KVGA 4JD2A 2UXDK 3C65A 4K42A 5AQNA 5CZ1A 1NK5A 2CH5A 4DV0K 1QZ5A 2YX6A 3THXA 3TR8A 1VQ8N 3IRXA 4CW7B 3M6GA 5I42A 1NKBA 4BR0A 3AAPA 2AA4A 1BQNA 2FSKA 4BACA 4CJ7A 3A8YA 4JI2K 5LMNK 1ATNA 4DTJA 4B9MA 3ZSVA 1RCHA 3CMEN 4BR4A 1SV5A 1A5XA 3HVRA 1M90O 1FXXA 5FDLA 5HP1A 3ZYYX 1SAZA 1UA1A 3CJCA 2XY5A 3CFPA 5HRSA 3BUZB 3LPUA 4H0TB 2X74A 1U45A 3R6MA 3QEIA 4FJHA 3MX2A 1MWKA 2Q1NA 3E01A 2E2QA 3NFAA 3ZT2A 2HSTA 2ZE2A 3JXUA 4FZXC 4CEZA 4WFBL 3P31A 4ZTFA 2P9IA 3KLGA 4WFNL 4BQZA 3AVHA 3CF5L 1ZBLA 1CZ9A 1RT7A 1NKCA 3Q7BA 3PX4A 4H0PA 4DSFA 3UKUA 4HHTA 4Q5VA 2ITMA 3LP0A 1W9HA 3VENA 1VQ7N 1VSFA 5BREA 3SAFA 4RW6A 3K0SA 3AO4A 3V6DA 4CIGA 4JKGA 4BREA 3CETA 1NGCA 2DTUA 2HBMA 4RW4A 1ZBFA 5JLHA 3O3HA 1XNQK 5CY4A 3ZSWA 4DTRA 3CM6A 2E6MA 1DGKN 4MDBA 1S1TA 4LFCK 3THWB 3VQ6A 3SUPA 4JLHA 4KFBA 1Z6RA 3ZSQA 1WSHA 1I39A 4K43A 4B9UA 1NGFA 1QVGM 3QEVA 4PL8A 3T1HK 3K9KA 3ZETA 4JD2B 4B3RK 4FW1A 4DLGA 3IDHA 1ASVA 2KLAA 4FPBA 1NJXA 4DUYK 1C0FA 1EKEA 1JLAA 4BWJA 3SJHA 2OTJN 4CBXA 4KHUA 1GLBG 4A59A 1ZXOA 1Q8IA 4BE0A 1TK5A 3M8QA 1ZBUA 2RHKA 3QNNA 3AA5X 1UOCA 3JAMO 1RT2A 2ASMA 2P5OA 4E1MA 3QBXA 3WQUA 2UU9K 1DT9A 4IBNA 4DR2K 1IG8A 1HR0K 4H0YB 3O9TA 4M41A 3ENOA 2VGMA 1N5YA 3LPTA 4BY9C 1BGXT 1S1UA 3M8PA 2R7YA 3I56N 4PKGA 4F8RA 4Z0UA 4LSLA 3ZSRA 1NGJA 1R59O 1TK8A 1JXEA 1BCOA 2O4GA 4EHTA 2QKBA 4DS5A 2Z1IA 4MQ3A 3AGRA 3JSMA 3OHRA 4OLAA 1Y97A 4M7YA 5HROA 4EZ6A 4FL9A 3LP1A 4BQLA 2BE2A 4FVUA 3BGRA 3O1BA 3CJ7A 1RTJA 1V4SA 4FWPA 1KSPA 3LP2A 2G8IA 1QQMA 1LAWA 3BDPA 4QS7A 1U6ZA 1HPMA 4DQSA 3SUNA 4PQUA 4B9TA 4BROA 1VK0A 5GADP 3OYHA 2VYPA 3NH0A 3LWMA 4O8UA 4ELVA 2Y1JA 2FBXA 4B1WB 4DR3K 3OJSA 4B08A 2P9KB 4GVEA 1JLQA 2YHWA 4BDPA 2P9NB 1IJJA 5M1QA 1G99A 3EZ5A 1KAZA 3ZX0A 4RWTA 4FLTA 4NYFA 3V1QA 2QXLA 5J1EA 3KD5E 4FWNA 1WSJA 1RT1A 4CZKA 3O3FA 5HBMA 4EP4A 2YNGA 3A5NC 5EXWA 4CGDA 3VQCA 3M8SA 4CHQA 4HUFA 3N4QA 3C7NA 1DEJA 4F4KA 2D5RA 1RT3A 4HUEA 3DRPA 3KWIA 1RBUA 2QWQA 4JK9A 4WE1A 5EY4A 1SS6A 5M1PA 4WQ4C 3RMDA 4OPJA 4WFAL 3VEVA 4OVLA 3S3OA 1YAGA 4BRPA 2NRVA 2E2NA 2KKZA 1KXPA 1JCEA 1JXBA 3GL1A 3F9MA 1IKVA 1K9MO 4CFCA 1WN7A 1T6DA 3ZETB 4B9VA 4H5WA 4M42A 2W42A 1W0HA 4BG8A 4CE9A 3U6FA 3LAKA 3TWHA 3QFPA 4B1YB 4CGFA 4KHQA 3OYCA 3MN7A 3OVNA 3AVNA 1UA0A 3V9SA 3UKRB 2PYLA 5BR9A 5J2PA 1TGOA 4CECA 3U3GA 1HUXA 5DK5A 3A0IX 1T03A 4NLBA 3DM2A 3TPQA 5J2MA 3OYLA 1RFQA 1KRPA 2F96A 4CZGA 1VQPN 3EL2A 3AVLA 3BZKA 4I6MB 4FYDA 4YDUC 4HTUA 3OW2M 3QIPA 3RRGA 3LP3A 3E9LA 4O44A 1RBVA 4CJVA 4DTNA 5JVHL 4I2QA 4O5FA 3HPGA 4JNEA 2ZGYA 5FROA 5KPZA 2OANA 1SZ2A 4CJQA 2NRRA 4JI6K 4CF0A 3J7ZO 3DOKA 2J4RA 4CZFA 1RTDA 4FK4A 2P9SA 3FFIA 3SQ4A 2HBLA 4LF5K 4CJLA 3LZJA 5ELZA 5I3UA 3J80O 4MFBA 3W0LA 1VQMN 4CIFA 1SL0A 5KTQA 3D2FB 3FZHA 4LH5A 3LZIA 5BN9A 4BRKA 4CZHA 2V52B 4FVMA 4GMJB 4C1NK 3LANA 1NG9A 3QETA 1XHZA 2A1RA 1VRUA 3TABA 1HNIA 1RDBA 1E4FT 4J8FA 1C1AA 4K41A 4YORA 1B9DA 1BL3A 1LV5A 4NLCA 3VQDA 1C0TA 4IFEA 3CI5A 3NF8A 1GLEG 4Y1CA 4BVOA 3P5JA 4CJTA 4FJ8A 3VTIA 1LW2A 3HP6A 4DCHA 3AVAA 3VOVA 5FLXO 1OH6A 3OYDA 4CFBA 3SBTA 4HWIA 3DLLL 5KPRA 2OPQA 4B1ZA 4CHPA 5AQHA 4H0VB 4FJGA 4ISGA 1EWRA 2QWLA 4KV8A 2IVNA 4BC4A 5M1FA 3AVMA 2O8CB 3O9RA 1XWLA 1FKPA 4FJMA 3H08A 4KB0A 5IWAK 3PV8A 1BU6O 3SBGA 2OPPA 3UE5A 3RSEB 4KH6A 3M5RA 4KTWA 2DFEA 3HPHA 1YHQN 1OH8A 2B4JA 4DV7K 4DWIA 5AQJA 3CCRN 1S9GA 2E2OA 4DV5K 2Q0RA 3KK3A 4N47A 2IAJA 4DU4A 1GLJO 1KC8O 3G71N 4DUZK 3VEYA 5LY3A 3ENBA 3HRGA 3D7EO 4CJKA 1YIJN 4KBOA 1WAJA 3V9WA 5AZIA 5M1OA 4RCHA 5F0XA 1QSYA 2UUCK 3VQPA 3ULEA 4BRHA 3NH2A 3CCQN 2DPNA 3WNEA 3QLHA 2VWBA 2YHAA 1HKCA 1X3NA 2WOMA 5CYQA 3C0BA 3U9DA 4M3WA 4QS8A 3M3ZA 4F2RA 2HNZA 2QTDA 3SQ0A 1K73O 2Q36A 3MWTA 4MDAA 4N5SA 1FJGK 1YTAA 3DLRA 4CEEA 4NXNK 1HPZA 1QQNA 4BG9A 3HI0A 1T7PA 2G8UA 3PSIA 4ID1A 4I7FA 3AAQA 4JK8A 3IAYA 3CCEN 1ATSA 4GV9A 4KPYA 4FZYA 4LF4K 2KZZA 3V9ZA 3CCJN 1IG9A 4CJPA 1NMDA 2IDOA 4XH5A 4PHTX 4KTZA 4BR2A 3CQ8A 2PZSA 3QIOA 1TKZA 2BUPA 3S3MA 4DTOA 2VG6A 1T6CA 1EQYA 5TKWA 1JJ2M 1SKRA 5LJVA 4EIAA 4FO0A 3QBWA 3PO5A 1EWQA 1U47A 2D0CA 3Q7CA 4CJFA 4B3TK 5HLFA 5JVGL 1XHXA 3RMCA 4BGAA 3OYJA 1VQLN 1TYQA 4AF1A 5DM7L 3L3UA 5FPEA 3F5TA 3CERA 1Q9XA 1NGGA 2HHHK 4DV1K 3CFRA 1VSHA 1GOAA 3DRRA 3K58A 3FZLA 3O80A 1ZBIA 5J2NA 1E3MA 4M3YA 4GY2B 4WYBA 3RRHA 4CF2A 5I9EB 4M3TA 4IKFA 3RR7A 1Z05A 5B8HA 4ZTJA 1HKBA 4FWQA 2ZD1A 5CZ2A 4KKOA 4I9QA 4B9QA 1FKOA 2VG7A 3T19A 1RGIA 3VMFB 4I9LA 2GELA 3WT0A 5GINA 4H4OA 1IKYA 5AZIB 4IO8A 1YITN 4JI3K 3CG7A 3E66A 4LD0A 3V9XA 3AVIA 3EO3A 5LL6Z 1XUPO 3I33A 3IKMA 4CEBA 3DLEA 4PUOA 3OS2A 1GLCG 2PBDA 4GKJK 3U9ZA 3CFOA 3L2WA 4H0OA 4J2DA 1NGAA 1LCUA 4FWMA 4EZ9A 4X64K 1IKWA 2O8EA 4FCYA 4UQGA 3OYMA 3ZX2A 4K25A 3C6AA 1BI4B 2QWNA 1SL2A 2Q0UA 4YOYA 1VRTA 1N33K 4FWOA 1C0MA 5FRNA 4BDZA 3P1GA 3ZLJA 2P5GA 3MXMA 4MLHA 1NJIO 2GWKA 3MAQA 4DFMA 3ID6A 1WUAA 1MDUB 3CJ9A 2QXFA 3SCXA 4DQQA 1TVRA 3K9JA 2GV9A 3VTHA 3RMAA 5AZJB 4DTUA 4N76A 3HT3A 2P9LA 4CESA 4H03B 3VGKA 2Q31A 3C94A 2PAVA 4C8MA 4L8RB 4ELUA 1BA0A 1N32K 3KK2A 3WXLA 1CZAN 1KTQA 4YOXA 4O0JA 4B1XB 4IEEA 2HHQA 5AQOA 3OYEA 2EWSA 1TYQB 1ILYA 1WBDA 4B3SK 2FF3B 4FLYA 3WEEA 4N56A 3CXCM 1KQSM 3NAEA 2XY8A 3A5OC 3CCUN 3E1YA 1RT5A 1C0GA 3EKUA 4OPAA 4AHTA 1Q86O 1S22A 3EZWA 4J2EA 3OS1A 1IBKK 1KD1O 3TTCA 4BC5A 4LF7K 3B6OA 3O4WA 3NDKA 2XHBA 1U49A 5CYMA 4B9NA 3DXMA 1WNSA 3CPEA 3O08A 4IEIA 3HSTB 4NCGA 4E7IA 4CJUA 3PLAA 1IBMK 2X78A 3HYFA 3HP9A 3AO2A 3KHYA 3A5LC 3SPZA 2HMPA 2W6KA 4JRQA 4DQIA 2E8AA 1VQON 2H3GX 2YHYA 4IXCA 4LH4A 3P83D 3TAPA 5BRHA 3E9PA 4CBWA 4Q0BA 2NRXA 2NRHA 5AQLA 4DB3A 1ZC6A 3QO9A 4KHWA 2KFZA 3CC4N 4CD3A 2A41A 1QS4A 4RTFD 5FPNA 5SWMA 3TANA 2X6NA 3U4LA 3NGYA 2KQ2A 1WAFA 1KVCA 3DLHA 3THXB 4FLZA 2VQEK 1QSSA 5CE3A 1DKGD 4DF8A 3KK7A 4XH4A 3LM9A 4CEFA 5KQDA 1GLDG 2W6LA 2NZTA 2A5XA 1UAXA 4DMNA 1EO1A 4BRLA 2O8FA 5IT9O 3WUHA 4W5TA 3VQ7A 3OYKA 2CGKA 4JKDA 2A3ZA 3LL3A 1FW6A 3EKSA 1XMQK 4FXDA 1VSEA 3ISNC 3PY8A 4CF1A 4E89A 5AQGA 3K5OA 4CBUA 1BG3A 3H3NO 5C10A 1RILA 4KREA 1YXQA 1S9EA 4CEOA 2O8BA 5H1SQ 3OTOK 3NGIA 4B9SA 3T69A 2D1KA 4FM0A 3IUCA 4KHSA 3S3NA 1J6ZA 4HCCA 1TUUA 1CXUA 3K57A 2G8KA 2Z1HA 3K59A 2GWJA 1HNWK 4JKCA 1FK9A 2D0BA 1RDCA 4C8NA 2P9IB 4AHUA 1TAUA 4A62A 3FFKB 4GV3A 1W97L 1HQEA 2KHOA 2GEMA 4FJ5A 3O9SA 3D0PA 4CJWA 2RE2A 2DFFA 1K8KA 1Z25A 2CGJA 2VWKA 3UKUB 5JLFA 1X3MA 4PKIA 1ASUA 1TL3A 2QWPA 3ENHA 1JLEA 3SMPA 3G10A 1L3UA 2YKMA 4E0DA 5JICA 4XH1A 3SYZA 4JKGB 1RBRA 3ITHA 3G25A 1BO5O 3K2PA 2ZJRL 3CJAA 3O1WA 1RDWX 3KIOA 5BPMA 1S6QA 1DTQA 1XC3A 4O0IA 3PIPL 2HW3A 4PL7A 2UUAK 3AVGA 2QK9A 1N34K 4N41A 3R9PA 1SUQA 4DFJA 3BF1A 4H4MA 1HJOA 1TV6A 3BY5A 1DLOA 3MCAB 3WXKA 4IDKA 4YOWA 3KKRA 4KO0A 1TKXA 3WXJA 2O8DA 1VSDA 3P38A 2EX3A 3QFUA 3QNOA 4YHHK 2IS3A 2GUPA 4AM6A 1NOZA 4CF9A 1BWFO 1X9JA 4CGGA 3J81O 4OGCA 3T7ZA 2E20A 2IVOA 2GUIA 2PYJA 3NVKA 2YHXA 4A5AA 3BZCA 3L4QA 3KLFA 3V1RA 1LWFA 1YJWN 2NLXA 4NXMK 3OYGA 3ZSOA 3S41A 2HF3A 4JK7A 4FLWA 4CIEA 3AA3A 2UXCK 4KAZA 1QVFM 2A1SA 4IOAL 3CCSN 2GBZA 3EE9A 3HM9A 4W5RA 2YJEA 2F8SA 2IC3A 2E5LK 1VSKA 3HL8A 1GLLO 4DU1A 1BA1A 4BE2A 4DTSA 4DR4K 2KZMA 5ADXA 4X66K 1YVUA 2F7TA 2O8FB 3MN6A 3NHGA 2VCPA 1KLNA 4CF8A 2ATQA 2E1YA 3V1OA 4CK3A 3AVCA 4G9ZA 5AQSA 2YKNA 2FSNA 4KHNA 1NJZA 3ATVA 4L3QA 3K5LA 2Z1GA 5EU7A 1WSEA 3T1AA 3ZX3A 3QESA 4CD1A 4KHPK 4JAXA 3TTFA 1XMOK 2XRIA 3TTDA 1U04A 1YJ9N 3OA9A 3H46O 4E3SA 3I0RA 2ASPA 4CZMA 3BEXA 1J9AA 2B5JA 2ZGZA 5ADXH 4LF6K 3CMAN 1JL2A 1BOTO 3P39A 3QEWA 4LFAK 1XQSC 3FR0A 3J7AP 4ILHA 1RBTA 3SUQA 5GIOA 4DR6K 1MU2A 4IFVA 2D0OA 4OKKA 4E7JA 4BRAA 5BR8K 1RDAA 3LDNA 3THYA 1B9FA 1NU0A 4FJLA 5KQ8A 4GNIA 1NK7A 1QSLA 4JKHA 3DLKA 1L3VA 2F9TA 4KH4A 2QW9A 5AQXA 1KVBA 4K8XA 4W5NA 5AJ3K 4GW6A 2ZJPL 1CZBA 4WF9L 3QINA 4LFBK 4H5TA 1GLFO 1LW0A 1VSLA 1L3SA 1NMNA 3VGMA 2I7NA 2BTFA 3J8AA 3CPWM 4A61A 1EP4A 1HYSA 1XI1A 3C7NB 1OKJA 4R79A 3DXKA 1BUPA 4QAGA 3MN9A 1NM1A 4CJSA 1XC9A 2KW4A 1OH5A 4IZ9A 1Q81O 5SZTA 3SI6A 1D8YA 3PUFA 1Q82O 4J2BA 3LDSA 3KK1A 3V9UA 3ULDA 4PY5A 4A57A 5C2DA 3VF4A 2P9UA 4FK0A 3R1XA 4JEPA 1N36K 4GKKK 4AM7A 2RPIA 4IG0A 4F9OA 3CQXA 4ILGB 1KFSA 2UYTA 3OYIA 3MCPA 4FM1A 3N4PA 5K14A 4W5QA 4E7LA 4JHDA 3ZEUA 1D9DA 2HBKA 2JWKA 4O5BA 4H5NA 2WC9A 1NK6A 3HTVA 3CC2N 4RW9A 4BRMA 1TKTA 4BDYA 4EP5A 2E6LA 2ASOA 3U8XA 2HVHA 3MEDA 4JV5K 5BN8A 3TSUA 3I8BA 3VEOA 5KRTA 1HLUA 5C12A 5C24A 4DLEA 3D45A 4IOXA 4E1NA 4QS9A 3HOSA 3IG1A 3OYAA 3SV4A 3FZKA 1BHLA 4E7HA 3AY9A 1RDDA 3MECA 2OCEA 2ZF5O 2WBNA 4DV2K 4IDHA 4JRPA 3VQEA 4HUGA 1EETA 2YJFA 1HYZA 4CZIA 4AHCA 3TAQA 3VEXA 3EYZA 2QWMA 3CCVN 1VSIA 3PIOL 4YOVA 4DR1K 2WUSA 4FJKA 3L6QA 2YNHA 1TL1A 1NGDA 4TSXA 4PKHA 4BR9A 2P9SB 2GTDA 3PX6A 2UXBK 3PX0A 3OBYA 3KTQA 1U2VA 1QQOA 3DJCA 1EX4A 2QM1A 3CCLN 4BRCA 3HZ6A 3CC7N 2WONA 5CR4A 4CZEA 3RWUA 2IIRA 3CD6N 2HHXA 4RG8A 4JYAK 1VHXA 5HRRA 3AGKA 4JKFA 4CGHA 4Z4CA 1QHAA 1HKGA 4IJAA 1NLVA 3KKSA 4M3UA 3OS0A 1NK0A 4CJEA 2OTLN 1M1KO 5GAHP 2OYQA 3L3VA 5FPMA 4ELTA 2A40A 3NH1A 3CCMN 4CGJA 1WB9A 3H45C 1BIUA 2E1ZA 3R3LA 3ZT1A 1KCFA 3KLHA 4U67L 1VQNN 2HHWA 3QMLA 4C1NI 2HHUA 4XIUA 4M7XA 5GAGP 4FWRA 3ALYA 3C6TA 3VGLA 1NK4A 4MLEA 3UIQA 2FLOA 2QWOA 3B6PA 5C25A 1CLQA 2OA8A 3HM8A 2E2PA 3QICA 1B92A 3EN9A 1KAXA 4BRIA 1JLCA 3KLEA 3ZCMA 1BIZA 2XO7A 4A5BA 4JI8K 4PA1A 4NB4A 3AA4A 3THVA 2FF6A 3OYNA 1N8RO 4CHNA 1S6PA 3M8RA 3ULEB 4Z4EA 1J54A 5AQVA 1IV0A 2IOCA 4LSNA 3NF7A 4CHYA 1NOYA 1IBLK 3VA0A 1RT6A 1RT4A 2XY7A 1H1VA 4M45A 4JI4K 2PFUA 3C95A 1F21A 3K5NA 2QI2A 4FJ9A 3VF2A 3THWA 5BPNA 4DFPA 1XNRK 3C6UA 3L0QA 2RKIA 4JKEA 3L2UA 4BC2A 2QWRA 4CJ5A 3HK2A 3MEEA 3O8MA 1TAQA 1HRHA 5EX5A 1TKDA 4O4GA 1IO2A 5LMUK 5C0YA 3IS9A 3O9QA 3VQ4A 2JLEA 1A5WA 3VQAA 2HNYA 1KVAA 4JN4A 3ZT4A 1ESVA 3K5MA 1GOBA 2QEXN 1A5VA 4V19S 2HVIA 4EAHD 3R8EA 3CIPA 4OLBA 2W41A 3MXJA 4C23A 3PSFA 4M63C 2FXUA 1VSJA 1VQ5N 2FBVA 3NGZA 4UY8O 1BQMA 1KLMA 5D3GA 3U3YA 4ID5A 3GOIA 3MDQA 4BRQA 3NF9A 3AVFA 3SQ2A 4FJJA 1HQUA 1KAYA 4A2AA 4RW7A 3C6HA 2AP1A 5AQMA 1VSMA 3TAMA 4OGEA 2QA4N 1YI2N 4WQ5A 3V4IA 4YOTA 1T05A 4H5RA 1WOQA 1L5UA 3I55N 2Q2RA 4B8AB 5HRPA 4A2BA 4FLUA 5AQKA 2WFBA 4CEQA 1JCGA 1X9WA 5F2RA 3SLCA 3LDLA 4F3OA 2V7YA 4DR7K 3AV9A 4BWMA 2V7ZA 5AQWA 4QCLA 2P9KA 1UWBA 3AA2A 1C0UA 4CCHA 2P9NA 3HO1A 5AQUA 4DS4A 2P51A 4IWVA 2HNDA 4OPKA 2HHTA 1NGBA 4OX9K 2B6AA 4EHUA 3L2QA 4BC3A 4AH9A 1YT3A 3WNHA 1TK0A 4B1UB 2X6SA 4FOEA 1I3AA 1X1PA 5A2QO 2ZM6K 3QB0A 4MO5A 3VQBA 3NF6A 4JI1K 2P9PA 4BE1A 5EOYA 2HHSA 1S1WA 1NJYA 4AHRA 4HVJA 4X62K 4M3ZA 1VQKN 1YF5L 3VPZA 3SUOA 2O8EB 4OJRA 1X9MA 4CJRA 4Y0WA 3CJ1A 4KRFA 5EVZA 2YNIA 3TSPA 3V81A 3AO3A 3ZSXA 3EY1A 1EXQA 1QZ6A 4DFKA 1JL1A 3SNNA 1D4XA 3F2KA 4G1QA 2Z1JA 3VQ8A 4DU3A 1NBWA 2YHBA 1K8AO 3A2FA 4DSJA 3SAHA 4BRNA 5KI6A 5C42A 1QHTA 4AQYK 3G4SN 4E1JA 3D2EA 3WNFA 4LF9K 4F3TA 1QE1A 4FLXA 3HOTA 3UKRA 4DTXA 4YY3K 4MO4A 4Z4FA 2V51B 4DSLA 3KZBA 4LY7A 4C8OA 3JYTA 5HRNA 3AVKA 2P9LB 4ISFA 1SKSA 1ITGA 4FZZA 4ISEA 4JKBA 3TAEA 1OH7A 3SAGA 2EHGA 1RTIA 2VGNA 4DF4A 4DG1A 3PO4A 4DV4K 5BRFA 4I6MA 5M1KA 1WBBA 1ZBHA 3DLGA 3WNGA 5AQQA 3T3FA 2DFHA 4CZJA 2HOEA 1I94K 5E41A 3O9UA 4EFHA 1CXQA 3VEWA 3VQQA 4J2AA 4CK1A 3WEEB 3GG4A 3TSQA 4B3OA 3GBTA 4DQPA 4KTQA 4JI7K 5JS1A 4O8KA 4XEIA 5AQZA 2YI1A 3F9KA 3HBTA 3MMVA 4O55A 3O6WA 2RN2A 4H0XB 2OPRA 3EE8A 4YOUA 1GOCA 4KI6A 3SZ2A 2FBTA 3RVCA 3DWLA 2NNWA 3D2FA 3DXMB 2FBYA 4E19A 5MLCQ 1Q18A 5AQTA 4CI6A 3SPYA 1RBSA 1C1BA 3UB5A 3ZT3A 2Y1IA 2F9WA 1BDGA 3FLCO 4F2SA 2YCHA 5AR0A 2HHVA 4KB1A 2Q97A 2KFNA 1YJNN 1D5AA 2LSNA 3I8DA 1HNVA 2WTUA 3DRSA 3SJJA 3VERA 4BRDA 4FWLA 3VQ5A 1NK9A 2A42A 3WXMB 3AVJA 2FC0A 1NGHA 2P9PB 1JKHA 2BDPA 1LAVA 5BRDA 5E84A 1ZBSA 3MXIA 3DYAA 3MK6A 4DV6K 2O8CA 3VEZA 3IFRA 4M3RA 3VQ9A 2VWJA 3O5BA 3HXMA 4M3XA 1J5OA 5KPTA 3RSEA
chains in the Genus database with same CATH topology
2IVPA 4LC9B 4IOXA 3H3OB 1VAZA 4K43A 4QS9A 1NGFA 1QVGM 3EO3A 4PL8A 3HOSA 3K9KA 3ZETA 3FZKA 4JD2B 1XUPO 1NGIA 3IDHA 2KLAA 3I33A 3AY9A 4FPBA 1C0FA 1V4TA 3IKMA 3SJHA 1VQ9N 2ZF5O 4CBXA 2WBNA 3D2EB 2OTJN 1GLCG 1GLBG 2PBDA 4A59A 1ZXOA 4IDHA 4OO1J 3U9ZA 3IMXA 4H0OA 2YJFA 1NGAA 4CZIA 1LCUA 4FWMA 3H6EA 2RHKA 3VEXA 3B8AX 2QWMA 3CCVN 3PIOL 5BPLA 4YOVA 2WUSA 2ASMA 3ZX2A 3L6QA 4K25A 3C6AA 1NGDA 4PKHA 4BGBA 4BR9A 2P9SB 4GV6A 5AQYA 2GTDA 3QBXA 5GAEP 2QWNA 3WQUA 1DT9A 2Q0UA 3OBYA 1IG8A 1U2VA 4YOYA 4FWOA 1QQOA 3DJCA 5HOOA 4H0YB 3O9TA 1VQ6N 3ENOA 2VGMA 2QM1A 3CCLN 4BY9C 4BRCA 3I56N 4PKGA 1YVNA 3HZ6A 4MLHA 2GWKA 3FGUA 1NJIO 3CC7N 1NGJA 3ATUA 3HSCA 1R59O 1WUAA 1MDUB 3CJ9A 3D6RA 2IIRA 3ID6A 5CR4A 3CD6N 4EHTA 2FSJA 3K9JA 5AQRA 3VESA 3AGRA 1Y64A 3AGKA 4JKFA 3VTHA 5AZJB 3OHRA 1QHAA 1HKGA 2P9LA 4IJAA 1NLVA 4JKAA 4M7YA 5C15A 4H03B 1VQ4N 1K8KB 4FL9A 3VGKA 2Q31A 2OTLN 4BQLA 2PAVA 1P90A 3BF3A 5GAHP 1M1KO 4FVUA 5FPMA 3M1FA 3BP8A 3O1BA 2JWLA 3CJ7A 5AQPA 2A40A 1BA0A 1V4SA 4FWPA 3LDPA 2NRTA 1QQMA 3CCMN 3NMUA 1MA9B 1CZAN 3WXLA 4YOXA 4QS7A 1U6ZA 1HPMA 3H45C 3H1QA 4B1XB 4IEEA 5AQOA 4ILJA 4BROA 4BR7A 1TUYA 2E1ZA 4NO7A 3R3LA 5GADP 2VYPA 2EWSA 4U67L 1VQNN 2CH6A 1TYQB 4O8UA 1ILYA 4H5VA 2FF3B 3QMLA 4B1WB 4C1NI 5AFUA 3WEEA 5M1NA 4M7XA 5AQIA 2P9KB 3CXCM 2D4WA 4GVEA 4FWRA 5GAGP 1KQSM 2YHWA 3A5OC 2P9NB 3VF6A 3CCUN 3E1YA 1IJJA 3VGLA 1C0GA 3EKUA 4OPAA 5M1QA 4BRFA 1G99A 4MLEA 4U7BA 5FPDA 1KAZA 2FLOA 1S22A 3GDQA 3ZX0A 4DQ8A 3EZWA 4RWTA 1Q86O 2QWOA 2QXLA 3LDQA 4FWNA 5TKYA 1KD1O 3TTCA 4BC5A 5AQFA 3RSEA 3O4WA 4CZKA 3HM8A 4B1VA 2E2PA 3AARA 3QICA 3DXMA 3EN9A 3TU5A 3A5NC 5EXWA 1MWMA 1KAXA 3CPEA 5E26A 3O08A 4BRIA 3A5MC 4IEIA 4BVPA 1OVYA 3N4QA 1GLAG 1DEJA 3C7NA 3CJBA 2BH1A 3PLAA 3KWIA 2GX9A 2QWQA 1E4GT 4JK9A 5EY4A 1SS6A 5M1PA 4WQ4C 5F1XA 4WFAL 3KHYA 5AFUH 3A5LC 3VEVA 4FPAA 2HMPA 1YAGA 4A5BA 4BRPA 2NRVA 3NVMA 2W40A 4NB4A 2E2NA 2KKZA 4IJNA 1KXPA 2E8AA 2H3GX 1JCEA 2YHYA 2E88A 3OBWA 3GL1A 4IXCA 2ZJQL 3F9MA 1K9MO 3MWPA 2FF6A 5BRHA 1N8RO 3E9PA 4CBWA 1T6DA 2NRXA 3ULEB 3ZETB 4H5WA 2NRHA 5AQLA 1Q7YO 4DB3A 1ZC6A 5AQVA 2I7PA 3CC4N 4BG8A 1T44A 4CD3A 2A41A 1RDUA 3QFPA 2D0PA 4RTFD 5FPNA 4B1YB 3U4LA 1H1VA 3MN7A 3WXIA 2PFUA 3UKRB 5BR9A 4BRGA 2QI2A 4Z94A 3VF2A 2NRZA 1HUXA 5CE3A 3A0IX 5BPNA 1S3XA 1DKGD 4HTLA 4NLBA 1W2BM 3TPQA 3KK7A 4XH4A 3LM9A 3L0QA 1RFQA 4JKEA 4WQ4A 5KQDA 1GLDG 4CZGA 4BC2A 2NZTA 1VQPN 3EL2A 2A5XA 2QWRA 3E9OA 4I6MB 4BR5A 3O8MA 3CQYA 1EO1A 4YDUC 3OW2M 4BRLA 5EX5A 3VETA 3DAWA 3LDOA 3WUHA 1HX1A 5C0YA 2CGKA 1NGEA 3E9LA 4JKDA 5JMVA 3O9QA 2A3ZA 5JVHL 3LL3A 4DKWA 4WQ5C 3EKSA 2HBJA 4JN4A 4OPHA 1ESVA 4O5FA 3P4IA 2QEXN 4JNEA 4IOCL 4FWKA 5AQGA 3LM2A 1T3VA 2ZGYA 3R8EA 2OANA 1SZ2A 4CBUA 2NRRA 3CIPA 3SMSA 4EAHD 5KPZA 3J7ZO 2J4RA 4CZFA 1BG3A 2NRWA 3H3NO 5C10A 2P9SA 1YXQA 2W41A 2A6AA 3G6EN 3L4IA 5H1SQ 2HBLA 4C23A 3SK3A 4M63C 3T69A 2FXUA 5ELZA 3MX5A 2D1KA 1VQ5N 3IUCA 1J6ZA 1TUUA 4UY8O 3QDKA 1S72N 3W0LA 2GWJA 1VQMN 3JS6A 4JKCA 3D2FB 3FZHA 2P9IB 5BN9A 4BRKA 3GOIA 4CZHA 3FZMA 2V52B 3MDQA 4BRQA 4CZLA 4A62A 3FFKB 5DM6L 2ZWHA 1W97L 4YDUA 4C1NK 4GV3A 2KHOA 5AZJA 2GEMA 3DXKB 4A2AA 1KAYA 3O9SA 3H1VX 2RE2A 3C6HA 1K8KA 2CGJA 2AP1A 3CHWA 3UKUB 5AQMA 1E4FT 1X3MA 4J8FA 4K41A 5JLFA 5HL7L 4PKIA 4FSVA 2QA4N 1YI2N 4YORA 1NWKA 2HF4A 4WQ5A 2QWPA 4YOTA 3ENHA 4H5RA 1WOQA 4NLCA 3SMPA 3I55N 2Q2RA 4A2BA 4IFEA 3CI5A 1GLEG 2P9UB 4XH1A 4BVOA 5JICA 3VTIA 5AQKA 3WQTA 2WFBA 1JCGA 4DCHA 4JKGB 3VOVA 5F2RA 3G25A 1BO5O 3SLCA 2ZJRL 3CJAA 3LDLA 3O1WA 1RDWX 2V7YA 4FWSA 3SBTA 4HWIA 4DHYA 5LJWA 3W3DA 3DLLL 5KPRA 5BPMA 5CHIA 4B1ZA 4WCEL 3FZFA 5AQHA 3GE1A 2V7ZA 3MN5A 4JHDB 5AQWA 4H0VB 3ZEUB 1XC3A 1YUWA 1SQKA 4ISGA 5C2FA 2P9KA 2QWLA 2IVNA 3PIPL 2CGLA 4BC4A 4PL7A 5M1FA 4KH5A 2P9NA 3KWGA 3O9RA 3R9PA 5AQUA 3BF1A 1HJOA 4IWVA 1BU6O 3MCAB 3WXKA 3SBGA 4YOWA 1NGBA 3UE5A 3RSEB 1P8ZA 4KH6A 3M5RA 4EHUA 4BC3A 3WXJA 3P38A 1YHQN 3QFUA 3FE1A 2GUPA 4B1UB 4AM6A 4FOIA 4FOEA 1BWFO 1X9JA 5AQJA 3CCRN 2E2OA 3QB0A 4MO5A 2Q0RA 3T7ZA 2E20A 4IO9L 2P9PA 2IVOA 3NVKA 2YHXA 4A5AA 1O13A 3L4QA 1GLJO 5EOYA 1KC8O 1YJWN 3G71N 2NLXA 1LOTB 3VEYA 5LY3A 1VQKN 3ENBA 3HRGA 1YF5L 3S41A 2HF3A 4JK7A 3D7EO 3VPZA 1YIJN 5GIPA 4KBOA 1QVFM 4Y0WA 3CJ1A 4IOAL 3CCSN 3EE9A 5EVZA 5AZIA 5M1OA 2YJEA 3ID8A 3TSPA 1JCFA 4RCHA 1GLLO 1BA1A 5F0XA 5ADXA 3ULEA 1QZ6A 2F7TA 1D4XA 1U2VB 3F2KA 4BRHA 3CCQN 3MN6A 1ATRA 2VCPA 3KVGA 1NBWA 2DPNA 4JD2A 1K8AO 2E1YA 4BRNA 3SAHA 2VWBA 3C65A 4K42A 5AQNA 1HKCA 4G9ZA 3G4SN 5AQSA 2CH5A 4E1JA 1X3NA 3D2EA 2FSNA 1QZ5A 3HOTA 3ATVA 4L3QA 3UKRA 2YX6A 3C0BA 3U9DA 4QS8A 4MO4A 3M3ZA 2V51B 3KZBA 1VQ8N 2QTDA 1K73O 3ZX3A 2P9LB 3M6GA 4ISFA 2Q36A 3MWTA 4CD1A 4ISEA 4JKBA 4MDAA 3SAGA 4JAXA 3TTFA 2VGNA 4BR0A 3AAPA 2AA4A 2FSKA 3TTDA 1QQNA 4BG9A 4CJ7A 5BRFA 1YJ9N 3OA9A 3HI0A 3A8YA 3H46O 4I6MA 1ATNA 5M1KA 3CMEN 2ASPA 4BR4A 4CZMA 3BEXA 3AAQA 4JK8A 2ZGZA 5ADXH 1ATSA 3CCEN 4GV9A 5AQQA 3CMAN 1M90O 4CZJA 1BOTO 3CCJN 2HOEA 3P39A 3ZYYX 1XQSC 3FR0A 1SAZA 4ILHA 3O9UA 3CJCA 5GIOA 4EFHA 3BUZB 2D0OA 3VEWA 1NMDA 4BRAA 4XH5A 3WEEB 4PHTX 1VQON 3GG4A 3TSQA 4BR2A 3LDNA 3GBTA 4H0TB 4O8KA 3R6MA 4XEIA 2BUPA 5AQZA 5KQ8A 2YI1A 4GNIA 3MX2A 1MWKA 3HBTA 1T6CA 4JKHA 3MMVA 2F9TA 1EQYA 2Q1NA 3O6WA 2QW9A 4KH4A 5AQXA 5TKWA 2E2QA 4H0XB 1JJ2M 2ZJPL 2HSTA 3EE8A 5LJVA 4YOUA 4WF9L 4H5TA 3JXUA 4EIAA 1GLFO 4FO0A 3RVCA 3DWLA 3QBWA 4WFBL 2NNWA 3D2FA 3DXMB 3P31A 2P9IA 3VGMA 2I7NA 5MLCQ 2BTFA 3J8AA 3Q7CA 4A61A 3CPWM 4WFNL 1Q18A 4BQZA 3CF5L 5AQTA 5JVGL 4CI6A 3C7NB 1OKJA 4BGAA 1VQLN 1TYQA 4R79A 4AF1A 3DXKA 3Q7BA 5DM7L 1BUPA 4H0PA 5FPEA 3F5TA 3UB5A 3UKUA 3CERA 3MN9A 1NM1A 1NGGA 2F9WA 1BDGA 3FLCO 4IZ9A 1Q81O 2YCHA 5AR0A 3FZLA 2Q97A 3O80A 1YJNN 1Q82O 2ITMA 4GY2B 3VENA 4A57A 1VQ7N 3VERA 4WYBA 4FWLA 3VF4A 2P9UA 4BRDA 5BREA 5C2DA 3R1XA 4JEPA 3SAFA 5I9EB 4AM7A 4F9OA 2A42A 1Z05A 3CQXA 4JKGA 4BREA 3CETA 1NGCA 5B8HA 2HBMA 4ILGB 3WXMB 1HKBA 2UYTA 4FWQA 3MCPA 2P9PB 1NGHA 3N4PA 4B9QA 5JLHA 4JHDA 3ZEUA 5BRDA 2HBKA 2JWKA 1RGIA 1ZBSA 5E84A 3VMFB 4H5NA 3MK6A 2WC9A 3VEZA 1DGKN 3IFRA 2GELA 4MDBA 3HTVA 3WT0A 5GINA 3CC2N 4BRMA 3O5BA 2ASOA 3U8XA 4CZEA 5AZIB 4IO8A 1Z6RA 5BN8A 3TSUA 3I8BA 3VEOA 5KPTA 1YITN 1HLUA 5C12A 3E66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVP A;  4LC9 B;  3H3O B;  4QS9 A;  4K43 A;  1NGF A;  3EO3 A;  4PL8 A;  3ZET A;  3FZK A;  4JD2 B;  1XUP O;  1NGI A;  3IDH A;  3I33 A;  4FPB A;  3AY9 A;  1C0F A;  1V4T A;  3SJH A;  2ZF5 O;  4CBX A;  3D2E B;  1GLC G;  1GLB G;  2PBD A;  1ZXO A;  3U9Z A;  3IMX A;  4H0O A;  2YJF A;  1NGA A;  4CZI A;  1LCU A;  4FWM A;  3H6E A;  3VEX A;  3B8A X;  2QWM A;  5BPL A;  2WUS A;  2ASM A;  3ZX2 A;  3L6Q A;  4K25 A;  1NGD A;  4PKH A;  4BGB A;  4BR9 A;  2P9S B;  5AQY A;  2GTD A;  3QBX A;  2QWN A;  3WQU A;  2Q0U A;  1IG8 A;  1U2V A;  4FWO A;  1QQO A;  3DJC A;  4H0Y B;  3ENO A;  2QM1 A;  4BRC A;  4PKG A;  1YVN A;  3HZ6 A;  4MLH A;  2GWK A;  3FGU A;  1NGJ A;  3ATU A;  3HSC A;  1R59 O;  1WUA A;  1MDU B;  3CJ9 A;  4BR5 A;  2IIR A;  4CZE A;  4EHT A;  2FSJ A;  5AQR A;  3VES A;  1Y64 A;  5AZJ B;  3OHR A;  1QHA A;  1HKG A;  2P9L A;  4IJA A;  1NLV A;  4M7Y A;  4H03 B;  1K8K B;  4FL9 A;  3VGK A;  2Q31 A;  4BQL A;  2PAV A;  3BF3 A;  5FPM A;  3M1F A;  3BP8 A;  3O1B A;  3CJ7 A;  5AQP A;  2A40 A;  1BA0 A;  1V4S A;  4FWP A;  3LDP A;  1QQM A;  1MA9 B;  1CZA N;  3WXL A;  4QS7 A;  1U6Z A;  1HPM A;  3H45 C;  3H1Q A;  4B1X B;  5AQO A;  4BRO A;  4BR7 A;  1TUY A;  2E1Z A;  4NO7 A;  2VYP A;  2EWS A;  2CH6 A;  1TYQ B;  4H5V A;  2FF3 B;  3QML A;  4B1W B;  5AFU A;  3WEE A;  4M7X A;  5AQI A;  2P9K B;  2D4W A;  4FWR A;  2YHW A;  3A5O C;  2P9N B;  3VF6 A;  1IJJ A;  3VGL A;  1C0G A;  3EKU A;  4BRF A;  1G99 A;  4MLE A;  5FPD A;  1KAZ A;  2FLO A;  1S22 A;  3GDQ A;  3ZX0 A;  4DQ8 A;  3EZW A;  4RWT A;  2QWO A;  2QXL A;  3LDQ A;  4FWN A;  5TKY A;  4BC5 A;  5AQF A;  3O4W A;  4CZK A;  3HM8 A;  4B1V A;  2E2P A;  3AAR A;  3QIC A;  3DXM A;  3EN9 A;  3TU5 A;  3A5N C;  5EXW A;  1MWM A;  1KAX A;  5E26 A;  3O08 A;  4BRI A;  3A5M C;  4BVP A;  1GLA G;  1DEJ A;  3C7N A;  3CJB A;  2QWQ A;  1E4G T;  5EY4 A;  4WQ4 C;  5F1X A;  3KHY A;  5AFU H;  3A5L C;  3VEV A;  4FPA A;  2HMP A;  1YAG A;  4BRP A;  2W40 A;  4NB4 A;  2E2N A;  4IJN A;  1KXP A;  2E8A A;  2H3G X;  1JCE A;  2YHY A;  2E88 A;  4IXC A;  3GL1 A;  3F9M A;  2FF6 A;  5BRH A;  4CBW A;  1T6D A;  3ULE B;  3ZET B;  4H5W A;  2NRH A;  5AQL A;  4DB3 A;  1ZC6 A;  5AQV A;  2I7P A;  4BG8 A;  1T44 A;  4CD3 A;  2A41 A;  3QFP A;  2D0P A;  4RTF D;  5FPN A;  4B1Y B;  3U4L A;  1H1V A;  3MN7 A;  3WXI A;  3UKR B;  5BR9 A;  4BRG A;  4Z94 A;  3VF2 A;  1HUX A;  5CE3 A;  3A0I X;  5BPN A;  1S3X A;  1DKG D;  4HTL A;  3TPQ A;  4XH4 A;  3LM9 A;  3L0Q A;  1RFQ A;  4WQ4 A;  5KQD A;  1GLD G;  4CZG A;  4BC2 A;  2NZT A;  3EL2 A;  2A5X A;  2QWR A;  4I6M B;  3O8M A;  3CQY A;  4YDU C;  4BRL A;  5EX5 A;  3VET A;  3DAW A;  3LDO A;  3WUH A;  1HX1 A;  2CGK A;  1NGE A;  5JMV A;  2A3Z A;  3LL3 A;  4WQ5 C;  3EKS A;  4JN4 A;  1ESV A;  4O5F A;  3P4I A;  4JNE A;  4FWK A;  5AQG A;  3LM2 A;  2ZGY A;  4CBU A;  3R8E A;  2OAN A;  1SZ2 A;  4EAH D;  5KPZ A;  3CIP A;  3SMS A;  2J4R A;  4CZF A;  1BG3 A;  3H3N O;  2P9S A;  1YXQ A;  2W41 A;  2A6A A;  3L4I A;  4C23 A;  3SK3 A;  4M63 C;  2FXU A;  5ELZ A;  2D1K A;  3IUC A;  1J6Z A;  1TUU A;  3QDK A;  3W0L A;  2GWJ A;  3JS6 A;  3D2F B;  3FZH A;  2P9I B;  5BN9 A;  4BRK A;  3GOI A;  4CZH A;  3FZM A;  2V52 B;  3MDQ A;  4BRQ A;  4CZL A;  4A62 A;  3FFK B;  2ZWH A;  4YDU A;  2KHO A;  5AZJ A;  2GEM A;  3DXK B;  4A2A A;  1KAY A;  3H1V X;  3CHW A;  1K8K A;  2CGJ A;  2AP1 A;  3UKU B;  5JLF A;  5AQM A;  1E4F T;  1X3M A;  4J8F A;  4K41 A;  4PKI A;  4FSV A;  1NWK A;  2HF4 A;  4WQ5 A;  2QWP A;  3ENH A;  4H5R A;  1WOQ A;  3SMP A;  2Q2R A;  4A2B A;  3CI5 A;  1GLE G;  2P9U B;  4XH1 A;  4BVO A;  5JIC A;  5AQK A;  3WQT A;  1JCG A;  4DCH A;  3VOV A;  5F2R A;  3G25 A;  1BO5 O;  3SLC A;  3CJA A;  3LDL A;  3O1W A;  1RDW X;  2V7Y A;  4FWS A;  4HWI A;  4DHY A;  5LJW A;  3W3D A;  5KPR A;  5BPM A;  4B1Z A;  3FZF A;  5AQH A;  3GE1 A;  2V7Z A;  3MN5 A;  4JHD B;  5AQW A;  4H0V B;  3ZEU B;  1XC3 A;  1YUW A;  1SQK A;  4ISG A;  2P9K A;  2QWL A;  2IVN A;  2CGL A;  4BC4 A;  4PL7 A;  2P9N A;  3R9P A;  5AQU A;  3BF1 A;  1HJO A;  4IWV A;  1BU6 O;  3WXK A;  1NGB A;  3UE5 A;  3RSE B;  1P8Z A;  4EHU A;  4BC3 A;  3WXJ A;  3QFU A;  3FE1 A;  2GUP A;  4B1U B;  4AM6 A;  4FOI A;  4FOE A;  1BWF O;  1X9J A;  5AQJ A;  2E2O A;  3QB0 A;  4MO5 A;  2Q0R A;  2E20 A;  2P9P A;  2IVO A;  2YHX A;  1GLJ O;  5EOY A;  2NLX A;  1LOT B;  3VEY A;  5LY3 A;  3S41 A;  2HF3 A;  3D7E O;  3VPZ A;  4KBO A;  4Y0W A;  3CJ1 A;  5EVZ A;  5AZI A;  2YJE A;  3ID8 A;  1JCF A;  4RCH A;  1GLL O;  1BA1 A;  5F0X A;  5ADX A;  3ULE A;  1QZ6 A;  4BRH A;  1D4X A;  1U2V B;  3MN6 A;  1ATR A;  2VCP A;  3KVG A;  1NBW A;  2DPN A;  4JD2 A;  2E1Y A;  4BRN A;  2VWB A;  4K42 A;  5AQN A;  1HKC A;  5AQS A;  2CH5 A;  4E1J A;  1X3N A;  3D2E A;  2FSN A;  1QZ5 A;  3ATV A;  4L3Q A;  3UKR A;  3C0B A;  3U9D A;  4QS8 A;  4MO4 A;  3M3Z A;  2V51 B;  3KZB A;  3ZX3 A;  2P9L B;  3M6G A;  4ISF A;  2Q36 A;  4CD1 A;  4ISE A;  4JAX A;  4BR0 A;  3AAP A;  2AA4 A;  2FSK A;  1QQN A;  4BG9 A;  4CJ7 A;  5BRF A;  3HI0 A;  3A8Y A;  3H46 O;  4I6M A;  1ATN A;  2ASP A;  4BR4 A;  4CZM A;  3BEX A;  3AAQ A;  2ZGZ A;  5ADX H;  1ATS A;  5AQQ A;  4CZJ A;  1BOT O;  2HOE A;  1XQS C;  3FR0 A;  1SAZ A;  3CJC A;  4EFH A;  3BUZ B;  2D0O A;  3VEW A;  1NMD A;  4BRA A;  4XH5 A;  3WEE B;  3GG4 A;  4BR2 A;  3LDN A;  3GBT A;  4H0T B;  4O8K A;  3R6M A;  4XEI A;  2BUP A;  5AQZ A;  5KQ8 A;  2YI1 A;  4GNI A;  1MWK A;  3HBT A;  1T6C A;  3MMV A;  2F9T A;  1EQY A;  2Q1N A;  3O6W A;  2QW9 A;  5AQX A;  2E2Q A;  4H0X B;  5LJV A;  4H5T A;  3JXU A;  4EIA A;  1GLF O;  4FO0 A;  3DWL A;  3QBW A;  3D2F A;  3DXM B;  2P9I A;  3VGM A;  2I7N A;  2BTF A;  3J8A A;  4A61 A;  1Q18 A;  4BQZ A;  5AQT A;  4CI6 A;  3C7N B;  1OKJ A;  4BGA A;  1TYQ A;  3DXK A;  1BUP A;  4H0P A;  5FPE A;  3UB5 A;  3UKU A;  3CER A;  3MN9 A;  1NM1 A;  1NGG A;  2F9W A;  1BDG A;  3FLC O;  4IZ9 A;  2YCH A;  5AR0 A;  3FZL A;  2Q97 A;  3O80 A;  2ITM A;  4GY2 B;  3VEN A;  3VER A;  4WYB A;  4FWL A;  3VF4 A;  2P9U A;  4BRD A;  5BRE A;  5I9E B;  4AM7 A;  4F9O A;  2A42 A;  1Z05 A;  3CQX A;  4BRE A;  3CET A;  1NGC A;  5B8H A;  1HKB A;  2UYT A;  4FWQ A;  3MCP A;  2P9P B;  1NGH A;  4B9Q A;  5JLH A;  4JHD A;  3ZEU A;  5BRD A;  5E84 A;  1RGI A;  1ZBS A;  4H5N A;  3MK6 A;  3VEZ A;  1DGK N;  3IFR A;  2GEL A;  3HTV A;  3WT0 A;  4BRM A;  3O5B A;  2ASO A;  3U8X A;  5AZI B;  4IO8 A;  1Z6R A;  5BN8 A;  5KPT A;  3I8B A;  3VEO A;  1HLU A;  3RSE A; 
#chains in the Genus database with same CATH topology
 2IVP A;  4LC9 B;  4Z4G A;  4B3M K;  3H3O B;  1WSF A;  1VAZ A;  3TAR A;  3QER A;  1NGI A;  4AHS A;  4I2P A;  2UUB K;  1V4T A;  4JS5 A;  1VQ9 N;  3D2E B;  4OO1 J;  3IMX A;  3H6E A;  3B8A X;  3EEQ A;  4CED A;  5BPL A;  1R0A A;  3F73 A;  3TAF A;  4BGB A;  4GV6 A;  5AQY A;  2OZS A;  5GAE P;  3KJV A;  2O8B B;  1K6Y A;  2P1J A;  3OY9 A;  5HOO A;  2I5J A;  1VQ6 N;  2AJQ A;  3NCI A;  1YVN A;  3FGU A;  2G8V A;  3ATU A;  3HSC A;  4OKJ A;  4BR5 A;  3D6R A;  3O4N A;  3QEP A;  4AHV A;  2JGU A;  4IG3 A;  4K0K K;  1BIS A;  2FSJ A;  5AQR A;  3VES A;  4KI4 A;  4KHY A;  4OKE A;  1Y64 A;  4FJI A;  1C6V A;  1JLB A;  4B8C A;  5C15 A;  4JKA A;  1VQ4 N;  2Q3S A;  1K8K B;  1P90 A;  3BF3 A;  1WSI A;  3TI0 A;  1Z26 A;  3M1F A;  2RF2 A;  3BP8 A;  2JWL A;  1J5E K;  5AQP A;  4DSI A;  3LDP A;  2NRT A;  4CEA A;  3NMU A;  1RNH A;  1MA9 B;  4RW8 A;  4CJ4 A;  1KFD A;  1QTM A;  4DQR A;  1LWE A;  4DSK A;  3H1Q A;  1G15 A;  4ILJ A;  4BR7 A;  1TUY A;  2YNF A;  4NO7 A;  4JS4 A;  3LAL A;  3MEG A;  2KTQ A;  3RMB A;  4LF8 K;  2CH6 A;  4CHZ A;  4YFU A;  3DOL A;  4W5O A;  4H5V A;  5AFU A;  1ZYQ A;  5M1N A;  5AQI A;  3AVB A;  3DI6 A;  2D4W A;  4CFA A;  3VF6 A;  4BRF A;  4CJ3 A;  4U7B A;  4CHO A;  3GDQ A;  4DQ8 A;  5FPD A;  3TAG A;  3LDQ A;  2O4I A;  4HCB A;  5TKY A;  5AQF A;  2NUB A;  4FLV A;  2O8D B;  4B1V A;  5KRS A;  3S9H A;  1OVQ A;  3AAR A;  3TU5 A;  2BGG A;  1MWM A;  4JI0 K;  5E26 A;  3A5M C;  4BVP A;  1OVY A;  1GLA G;  3CJB A;  2HMI A;  2BH1 A;  5DMR A;  4FJ7 A;  5FRM A;  2GX9 A;  3HVT A;  1E4G T;  4FK2 A;  4CFD A;  5F1X A;  5AFU H;  4FPA A;  3ZSZ A;  3NVM A;  1U48 A;  2W40 A;  3ASM A;  1NK8 A;  4IJN A;  3OBW A;  2E88 A;  2HB5 A;  2ZJQ L;  2VQF K;  1L3T A;  1U4B A;  3MWP A;  4DR5 K;  3HJF A;  4CGI A;  4Z4H A;  1Q7Y O;  3KLI A;  2I7P A;  2BAN A;  3ZT0 A;  1T44 A;  3LAM A;  1RDU A;  2D0P A;  3OYB A;  4H8K A;  1J53 A;  4R5P A;  3WXI A;  3NBP A;  3AO5 A;  1C1C A;  2ZQB A;  1DTT A;  1T8E A;  2ETJ A;  1HMV A;  4BRG A;  2DY4 A;  4Z94 A;  1N6Q A;  2NRZ A;  4CER A;  4B9L A;  4JI5 K;  1S3X A;  4HTL A;  1W2B M;  2OPS A;  4AIL C;  1JLF A;  1IH7 A;  4WQ4 A;  2OZM A;  3E9O A;  4E7K A;  3CQY A;  3DLB A;  2IGI A;  4C8K A;  3VET A;  3DAW A;  3LDO A;  3RR8 A;  1HX1 A;  2E4L A;  3HPO A;  1NGE A;  5JMV A;  5KGX A;  4DKW A;  4WQ5 C;  4NCA A;  4ICL A;  3O3G A;  2HBJ A;  4OPH A;  3P4I A;  4IOC L;  4FWK A;  1NNE A;  4C8L A;  3LM2 A;  1T3V A;  4FW2 A;  1NJW A;  3SMS A;  5KGW A;  3T1Y K;  5JS2 A;  4NCB A;  2NRW A;  3THY B;  4IFY A;  1BI4 A;  2A6A A;  3G6E N;  3L4I A;  3L2R A;  4DTP A;  3SK3 A;  2D0A A;  3MX5 A;  1HJR A;  3VA3 A;  3QDK A;  3AO1 A;  2YV0 X;  1S72 N;  2PY5 A;  4Z4I A;  4ZHR A;  1X9S A;  3JS6 A;  3ZSY A;  3O4Q A;  1LWC A;  3KD1 E;  3L2V A;  3NE6 A;  3FZM A;  1HNX K;  4CZL A;  5DM6 L;  2ZWH A;  3CYM A;  4YDU A;  5AZJ A;  2ITG A;  3DXK B;  3L8B A;  3H1V X;  1SKW A;  3CHW A;  3J7Y P;  5HL7 L;  4Y1D A;  4FSV A;  1NWK A;  2HF4 A;  1S5J A;  3SV3 A;  3OYF A;  1RTH A;  3QEX A;  2G8W A;  1Q9Y A;  3G0Z A;  2XY6 A;  2P9U B;  2VG5 A;  3WQT A;  1BCM A;  4PWD A;  4FWS A;  3VN5 A;  5LJW A;  4DHY A;  1REV A;  3W3D A;  4FJX A;  5CHI A;  4WCE L;  3FZF A;  3SQ1 A;  3GE1 A;  3MN5 A;  4JHD B;  2F4V K;  3ZEU B;  5C2F A;  1YUW A;  1SQK A;  4DV3 K;  3CM5 A;  2CGL A;  3LWL A;  1HNZ K;  4KH5 A;  2G8H A;  1WSG A;  3KWG A;  3DMJ A;  4FJN A;  4QOZ B;  1SL1 A;  2G8F A;  3I0S A;  1S1V A;  4DTM A;  1O1W A;  1P8Z A;  1JLG A;  4FM2 A;  4DSE A;  3RTV A;  4CVN E;  3FE1 A;  2QKK A;  4FOI A;  4K8Z A;  2F8T A;  1D9F A;  4YNQ A;  4X65 K;  3OJU A;  4IO9 L;  1W7A A;  1O13 A;  5J2Q A;  1ASW A;  1LOT B;  4NYN A;  1WLJ A;  1YTU A;  1NKE A;  5GIP A;  1S1X A;  3ID8 A;  1JCF A;  1QQC A;  4GVM A;  1HYV A;  1U2V B;  1IKX A;  4CK2 A;  5T7B A;  1ATR A;  3KVG A;  4JD2 A;  2UXD K;  3C65 A;  4K42 A;  5AQN A;  5CZ1 A;  1NK5 A;  2CH5 A;  4DV0 K;  1QZ5 A;  2YX6 A;  3THX A;  3TR8 A;  1VQ8 N;  3IRX A;  4CW7 B;  3M6G A;  5I42 A;  1NKB A;  4BR0 A;  3AAP A;  2AA4 A;  1BQN A;  2FSK A;  4BAC A;  4CJ7 A;  3A8Y A;  4JI2 K;  5LMN K;  1ATN A;  4DTJ A;  4B9M A;  3ZSV A;  1RCH A;  3CME N;  4BR4 A;  1SV5 A;  1A5X A;  3HVR A;  1M90 O;  1FXX A;  5FDL A;  5HP1 A;  3ZYY X;  1SAZ A;  1UA1 A;  3CJC A;  2XY5 A;  3CFP A;  5HRS A;  3BUZ B;  3LPU A;  4H0T B;  2X74 A;  1U45 A;  3R6M A;  3QEI A;  4FJH A;  3MX2 A;  1MWK A;  2Q1N A;  3E01 A;  2E2Q A;  3NFA A;  3ZT2 A;  2HST A;  2ZE2 A;  3JXU A;  4FZX C;  4CEZ A;  4WFB L;  3P31 A;  4ZTF A;  2P9I A;  3KLG A;  4WFN L;  4BQZ A;  3AVH A;  3CF5 L;  1ZBL A;  1CZ9 A;  1RT7 A;  1NKC A;  3Q7B A;  3PX4 A;  4H0P A;  4DSF A;  3UKU A;  4HHT A;  4Q5V A;  2ITM A;  3LP0 A;  1W9H A;  3VEN A;  1VQ7 N;  1VSF A;  5BRE A;  3SAF A;  4RW6 A;  3K0S A;  3AO4 A;  3V6D A;  4CIG A;  4JKG A;  4BRE A;  3CET A;  1NGC A;  2DTU A;  2HBM A;  4RW4 A;  1ZBF A;  5JLH A;  3O3H A;  1XNQ K;  5CY4 A;  3ZSW A;  4DTR A;  3CM6 A;  2E6M A;  1DGK N;  4MDB A;  1S1T A;  4LFC K;  3THW B;  3VQ6 A;  3SUP A;  4JLH A;  4KFB A;  1Z6R A;  3ZSQ A;  1WSH A;  1I39 A;  4K43 A;  4B9U A;  1NGF A;  1QVG M;  3QEV A;  4PL8 A;  3T1H K;  3K9K A;  3ZET A;  4JD2 B;  4B3R K;  4FW1 A;  4DLG A;  3IDH A;  1ASV A;  2KLA A;  4FPB A;  1NJX A;  4DUY K;  1C0F A;  1EKE A;  1JLA A;  4BWJ A;  3SJH A;  2OTJ N;  4CBX A;  4KHU A;  1GLB G;  4A59 A;  1ZXO A;  1Q8I A;  4BE0 A;  1TK5 A;  3M8Q A;  1ZBU A;  2RHK A;  3QNN A;  3AA5 X;  1UOC A;  3JAM O;  1RT2 A;  2ASM A;  2P5O A;  4E1M A;  3QBX A;  3WQU A;  2UU9 K;  1DT9 A;  4IBN A;  4DR2 K;  1IG8 A;  1HR0 K;  4H0Y B;  3O9T A;  4M41 A;  3ENO A;  2VGM A;  1N5Y A;  3LPT A;  4BY9 C;  1BGX T;  1S1U A;  3M8P A;  2R7Y A;  3I56 N;  4PKG A;  4F8R A;  4Z0U A;  4LSL A;  3ZSR A;  1NGJ A;  1R59 O;  1TK8 A;  1JXE A;  1BCO A;  2O4G A;  4EHT A;  2QKB A;  4DS5 A;  2Z1I A;  4MQ3 A;  3AGR A;  3JSM A;  3OHR A;  4OLA A;  1Y97 A;  4M7Y A;  5HRO A;  4EZ6 A;  4FL9 A;  3LP1 A;  4BQL A;  2BE2 A;  4FVU A;  3BGR A;  3O1B A;  3CJ7 A;  1RTJ A;  1V4S A;  4FWP A;  1KSP A;  3LP2 A;  2G8I A;  1QQM A;  1LAW A;  3BDP A;  4QS7 A;  1U6Z A;  1HPM A;  4DQS A;  3SUN A;  4PQU A;  4B9T A;  4BRO A;  1VK0 A;  5GAD P;  3OYH A;  2VYP A;  3NH0 A;  3LWM A;  4O8U A;  4ELV A;  2Y1J A;  2FBX A;  4B1W B;  4DR3 K;  3OJS A;  4B08 A;  2P9K B;  4GVE A;  1JLQ A;  2YHW A;  4BDP A;  2P9N B;  1IJJ A;  5M1Q A;  1G99 A;  3EZ5 A;  1KAZ A;  3ZX0 A;  4RWT A;  4FLT A;  4NYF A;  3V1Q A;  2QXL A;  5J1E A;  3KD5 E;  4FWN A;  1WSJ A;  1RT1 A;  4CZK A;  3O3F A;  5HBM A;  4EP4 A;  2YNG A;  3A5N C;  5EXW A;  4CGD A;  3VQC A;  3M8S A;  4CHQ A;  4HUF A;  3N4Q A;  3C7N A;  1DEJ A;  4F4K A;  2D5R A;  1RT3 A;  4HUE A;  3DRP A;  3KWI A;  1RBU A;  2QWQ A;  4JK9 A;  4WE1 A;  5EY4 A;  1SS6 A;  5M1P A;  4WQ4 C;  3RMD A;  4OPJ A;  4WFA L;  3VEV A;  4OVL A;  3S3O A;  1YAG A;  4BRP A;  2NRV A;  2E2N A;  2KKZ A;  1KXP A;  1JCE A;  1JXB A;  3GL1 A;  3F9M A;  1IKV A;  1K9M O;  4CFC A;  1WN7 A;  1T6D A;  3ZET B;  4B9V A;  4H5W A;  4M42 A;  2W42 A;  1W0H A;  4BG8 A;  4CE9 A;  3U6F A;  3LAK A;  3TWH A;  3QFP A;  4B1Y B;  4CGF A;  4KHQ A;  3OYC A;  3MN7 A;  3OVN A;  3AVN A;  1UA0 A;  3V9S A;  3UKR B;  2PYL A;  5BR9 A;  5J2P A;  1TGO A;  4CEC A;  3U3G A;  1HUX A;  5DK5 A;  3A0I X;  1T03 A;  4NLB A;  3DM2 A;  3TPQ A;  5J2M A;  3OYL A;  1RFQ A;  1KRP A;  2F96 A;  4CZG A;  1VQP N;  3EL2 A;  3AVL A;  3BZK A;  4I6M B;  4FYD A;  4YDU C;  4HTU A;  3OW2 M;  3QIP A;  3RRG A;  3LP3 A;  3E9L A;  4O44 A;  1RBV A;  4CJV A;  4DTN A;  5JVH L;  4I2Q A;  4O5F A;  3HPG A;  4JNE A;  2ZGY A;  5FRO A;  5KPZ A;  2OAN A;  1SZ2 A;  4CJQ A;  2NRR A;  4JI6 K;  4CF0 A;  3J7Z O;  3DOK A;  2J4R A;  4CZF A;  1RTD A;  4FK4 A;  2P9S A;  3FFI A;  3SQ4 A;  2HBL A;  4LF5 K;  4CJL A;  3LZJ A;  5ELZ A;  5I3U A;  3J80 O;  4MFB A;  3W0L A;  1VQM N;  4CIF A;  1SL0 A;  5KTQ A;  3D2F B;  3FZH A;  4LH5 A;  3LZI A;  5BN9 A;  4BRK A;  4CZH A;  2V52 B;  4FVM A;  4GMJ B;  4C1N K;  3LAN A;  1NG9 A;  3QET A;  1XHZ A;  2A1R A;  1VRU A;  3TAB A;  1HNI A;  1RDB A;  1E4F T;  4J8F A;  1C1A A;  4K41 A;  4YOR A;  1B9D A;  1BL3 A;  1LV5 A;  4NLC A;  3VQD A;  1C0T A;  4IFE A;  3CI5 A;  3NF8 A;  1GLE G;  4Y1C A;  4BVO A;  3P5J A;  4CJT A;  4FJ8 A;  3VTI A;  1LW2 A;  3HP6 A;  4DCH A;  3AVA A;  3VOV A;  5FLX O;  1OH6 A;  3OYD A;  4CFB A;  3SBT A;  4HWI A;  3DLL L;  5KPR A;  2OPQ A;  4B1Z A;  4CHP A;  5AQH A;  4H0V B;  4FJG A;  4ISG A;  1EWR A;  2QWL A;  4KV8 A;  2IVN A;  4BC4 A;  5M1F A;  3AVM A;  2O8C B;  3O9R A;  1XWL A;  1FKP A;  4FJM A;  3H08 A;  4KB0 A;  5IWA K;  3PV8 A;  1BU6 O;  3SBG A;  2OPP A;  3UE5 A;  3RSE B;  4KH6 A;  3M5R A;  4KTW A;  2DFE A;  3HPH A;  1YHQ N;  1OH8 A;  2B4J A;  4DV7 K;  4DWI A;  5AQJ A;  3CCR N;  1S9G A;  2E2O A;  4DV5 K;  2Q0R A;  3KK3 A;  4N47 A;  2IAJ A;  4DU4 A;  1GLJ O;  1KC8 O;  3G71 N;  4DUZ K;  3VEY A;  5LY3 A;  3ENB A;  3HRG A;  3D7E O;  4CJK A;  1YIJ N;  4KBO A;  1WAJ A;  3V9W A;  5AZI A;  5M1O A;  4RCH A;  5F0X A;  1QSY A;  2UUC K;  3VQP A;  3ULE A;  4BRH A;  3NH2 A;  3CCQ N;  2DPN A;  3WNE A;  3QLH A;  2VWB A;  2YHA A;  1HKC A;  1X3N A;  2WOM A;  5CYQ A;  3C0B A;  3U9D A;  4M3W A;  4QS8 A;  3M3Z A;  4F2R A;  2HNZ A;  2QTD A;  3SQ0 A;  1K73 O;  2Q36 A;  3MWT A;  4MDA A;  4N5S A;  1FJG K;  1YTA A;  3DLR A;  4CEE A;  4NXN K;  1HPZ A;  1QQN A;  4BG9 A;  3HI0 A;  1T7P A;  2G8U A;  3PSI A;  4ID1 A;  4I7F A;  3AAQ A;  4JK8 A;  3IAY A;  3CCE N;  1ATS A;  4GV9 A;  4KPY A;  4FZY A;  4LF4 K;  2KZZ A;  3V9Z A;  3CCJ N;  1IG9 A;  4CJP A;  1NMD A;  2IDO A;  4XH5 A;  4PHT X;  4KTZ A;  4BR2 A;  3CQ8 A;  2PZS A;  3QIO A;  1TKZ A;  2BUP A;  3S3M A;  4DTO A;  2VG6 A;  1T6C A;  1EQY A;  5TKW A;  1JJ2 M;  1SKR A;  5LJV A;  4EIA A;  4FO0 A;  3QBW A;  3PO5 A;  1EWQ A;  1U47 A;  2D0C A;  3Q7C A;  4CJF A;  4B3T K;  5HLF A;  5JVG L;  1XHX A;  3RMC A;  4BGA A;  3OYJ A;  1VQL N;  1TYQ A;  4AF1 A;  5DM7 L;  3L3U A;  5FPE A;  3F5T A;  3CER A;  1Q9X A;  1NGG A;  2HHH K;  4DV1 K;  3CFR A;  1VSH A;  1GOA A;  3DRR A;  3K58 A;  3FZL A;  3O80 A;  1ZBI A;  5J2N A;  1E3M A;  4M3Y A;  4GY2 B;  4WYB A;  3RRH A;  4CF2 A;  5I9E B;  4M3T A;  4IKF A;  3RR7 A;  1Z05 A;  5B8H A;  4ZTJ A;  1HKB A;  4FWQ A;  2ZD1 A;  5CZ2 A;  4KKO A;  4I9Q A;  4B9Q A;  1FKO A;  2VG7 A;  3T19 A;  1RGI A;  3VMF B;  4I9L A;  2GEL A;  3WT0 A;  5GIN A;  4H4O A;  1IKY A;  5AZI B;  4IO8 A;  1YIT N;  4JI3 K;  3CG7 A;  3E66 A;  4LD0 A;  3V9X A;  3AVI A;  3EO3 A;  5LL6 Z;  1XUP O;  3I33 A;  3IKM A;  4CEB A;  3DLE A;  4PUO A;  3OS2 A;  1GLC G;  2PBD A;  4GKJ K;  3U9Z A;  3CFO A;  3L2W A;  4H0O A;  4J2D A;  1NGA A;  1LCU A;  4FWM A;  4EZ9 A;  4X64 K;  1IKW A;  2O8E A;  4FCY A;  4UQG A;  3OYM A;  3ZX2 A;  4K25 A;  3C6A A;  1BI4 B;  2QWN A;  1SL2 A;  2Q0U A;  4YOY A;  1VRT A;  1N33 K;  4FWO A;  1C0M A;  5FRN A;  4BDZ A;  3P1G A;  3ZLJ A;  2P5G A;  3MXM A;  4MLH A;  1NJI O;  2GWK A;  3MAQ A;  4DFM A;  3ID6 A;  1WUA A;  1MDU B;  3CJ9 A;  2QXF A;  3SCX A;  4DQQ A;  1TVR A;  3K9J A;  2GV9 A;  3VTH A;  3RMA A;  5AZJ B;  4DTU A;  4N76 A;  3HT3 A;  2P9L A;  4CES A;  4H03 B;  3VGK A;  2Q31 A;  3C94 A;  2PAV A;  4C8M A;  4L8R B;  4ELU A;  1BA0 A;  1N32 K;  3KK2 A;  3WXL A;  1CZA N;  1KTQ A;  4YOX A;  4O0J A;  4B1X B;  4IEE A;  2HHQ A;  5AQO A;  3OYE A;  2EWS A;  1TYQ B;  1ILY A;  1WBD A;  4B3S K;  2FF3 B;  4FLY A;  3WEE A;  4N56 A;  3CXC M;  1KQS M;  3NAE A;  2XY8 A;  3A5O C;  3CCU N;  3E1Y A;  1RT5 A;  1C0G A;  3EKU A;  4OPA A;  4AHT A;  1Q86 O;  1S22 A;  3EZW A;  4J2E A;  3OS1 A;  1IBK K;  1KD1 O;  3TTC A;  4BC5 A;  4LF7 K;  3B6O A;  3O4W A;  3NDK A;  2XHB A;  1U49 A;  5CYM A;  4B9N A;  3DXM A;  1WNS A;  3CPE A;  3O08 A;  4IEI A;  3HST B;  4NCG A;  4E7I A;  4CJU A;  3PLA A;  1IBM K;  2X78 A;  3HYF A;  3HP9 A;  3AO2 A;  3KHY A;  3A5L C;  3SPZ A;  2HMP A;  2W6K A;  4JRQ A;  4DQI A;  2E8A A;  1VQO N;  2H3G X;  2YHY A;  4IXC A;  4LH4 A;  3P83 D;  3TAP A;  5BRH A;  3E9P A;  4CBW A;  4Q0B A;  2NRX A;  2NRH A;  5AQL A;  4DB3 A;  1ZC6 A;  3QO9 A;  4KHW A;  2KFZ A;  3CC4 N;  4CD3 A;  2A41 A;  1QS4 A;  4RTF D;  5FPN A;  5SWM A;  3TAN A;  2X6N A;  3U4L A;  3NGY A;  2KQ2 A;  1WAF A;  1KVC A;  3DLH A;  3THX B;  4FLZ A;  2VQE K;  1QSS A;  5CE3 A;  1DKG D;  4DF8 A;  3KK7 A;  4XH4 A;  3LM9 A;  4CEF A;  5KQD A;  1GLD G;  2W6L A;  2NZT A;  2A5X A;  1UAX A;  4DMN A;  1EO1 A;  4BRL A;  2O8F A;  5IT9 O;  3WUH A;  4W5T A;  3VQ7 A;  3OYK A;  2CGK A;  4JKD A;  2A3Z A;  3LL3 A;  1FW6 A;  3EKS A;  1XMQ K;  4FXD A;  1VSE A;  3ISN C;  3PY8 A;  4CF1 A;  4E89 A;  5AQG A;  3K5O A;  4CBU A;  1BG3 A;  3H3N O;  5C10 A;  1RIL A;  4KRE A;  1YXQ A;  1S9E A;  4CEO A;  2O8B A;  5H1S Q;  3OTO K;  3NGI A;  4B9S A;  3T69 A;  2D1K A;  4FM0 A;  3IUC A;  4KHS A;  3S3N A;  1J6Z A;  4HCC A;  1TUU A;  1CXU A;  3K57 A;  2G8K A;  2Z1H A;  3K59 A;  2GWJ A;  1HNW K;  4JKC A;  1FK9 A;  2D0B A;  1RDC A;  4C8N A;  2P9I B;  4AHU A;  1TAU A;  4A62 A;  3FFK B;  4GV3 A;  1W97 L;  1HQE A;  2KHO A;  2GEM A;  4FJ5 A;  3O9S A;  3D0P A;  4CJW A;  2RE2 A;  2DFF A;  1K8K A;  1Z25 A;  2CGJ A;  2VWK A;  3UKU B;  5JLF A;  1X3M A;  4PKI A;  1ASU A;  1TL3 A;  2QWP A;  3ENH A;  1JLE A;  3SMP A;  3G10 A;  1L3U A;  2YKM A;  4E0D A;  5JIC A;  4XH1 A;  3SYZ A;  4JKG B;  1RBR A;  3ITH A;  3G25 A;  1BO5 O;  3K2P A;  2ZJR L;  3CJA A;  3O1W A;  1RDW X;  3KIO A;  5BPM A;  1S6Q A;  1DTQ A;  1XC3 A;  4O0I A;  3PIP L;  2HW3 A;  4PL7 A;  2UUA K;  3AVG A;  2QK9 A;  1N34 K;  4N41 A;  3R9P A;  1SUQ A;  4DFJ A;  3BF1 A;  4H4M A;  1HJO A;  1TV6 A;  3BY5 A;  1DLO A;  3MCA B;  3WXK A;  4IDK A;  4YOW A;  3KKR A;  4KO0 A;  1TKX A;  3WXJ A;  2O8D A;  1VSD A;  3P38 A;  2EX3 A;  3QFU A;  3QNO A;  4YHH K;  2IS3 A;  2GUP A;  4AM6 A;  1NOZ A;  4CF9 A;  1BWF O;  1X9J A;  4CGG A;  3J81 O;  4OGC A;  3T7Z A;  2E20 A;  2IVO A;  2GUI A;  2PYJ A;  3NVK A;  2YHX A;  4A5A A;  3BZC A;  3L4Q A;  3KLF A;  3V1R A;  1LWF A;  1YJW N;  2NLX A;  4NXM K;  3OYG A;  3ZSO A;  3S41 A;  2HF3 A;  4JK7 A;  4FLW A;  4CIE A;  3AA3 A;  2UXC K;  4KAZ A;  1QVF M;  2A1S A;  4IOA L;  3CCS N;  2GBZ A;  3EE9 A;  3HM9 A;  4W5R A;  2YJE A;  2F8S A;  2IC3 A;  2E5L K;  1VSK A;  3HL8 A;  1GLL O;  4DU1 A;  1BA1 A;  4BE2 A;  4DTS A;  4DR4 K;  2KZM A;  5ADX A;  4X66 K;  1YVU A;  2F7T A;  2O8F B;  3MN6 A;  3NHG A;  2VCP A;  1KLN A;  4CF8 A;  2ATQ A;  2E1Y A;  3V1O A;  4CK3 A;  3AVC A;  4G9Z A;  5AQS A;  2YKN A;  2FSN A;  4KHN A;  1NJZ A;  3ATV A;  4L3Q A;  3K5L A;  2Z1G A;  5EU7 A;  1WSE A;  3T1A A;  3ZX3 A;  3QES A;  4CD1 A;  4KHP K;  4JAX A;  3TTF A;  1XMO K;  2XRI A;  3TTD A;  1U04 A;  1YJ9 N;  3OA9 A;  3H46 O;  4E3S A;  3I0R A;  2ASP A;  4CZM A;  3BEX A;  1J9A A;  2B5J A;  2ZGZ A;  5ADX H;  4LF6 K;  3CMA N;  1JL2 A;  1BOT O;  3P39 A;  3QEW A;  4LFA K;  1XQS C;  3FR0 A;  3J7A P;  4ILH A;  1RBT A;  3SUQ A;  5GIO A;  4DR6 K;  1MU2 A;  4IFV A;  2D0O A;  4OKK A;  4E7J A;  4BRA A;  5BR8 K;  1RDA A;  3LDN A;  3THY A;  1B9F A;  1NU0 A;  4FJL A;  5KQ8 A;  4GNI A;  1NK7 A;  1QSL A;  4JKH A;  3DLK A;  1L3V A;  2F9T A;  4KH4 A;  2QW9 A;  5AQX A;  1KVB A;  4K8X A;  4W5N A;  5AJ3 K;  4GW6 A;  2ZJP L;  1CZB A;  4WF9 L;  3QIN A;  4LFB K;  4H5T A;  1GLF O;  1LW0 A;  1VSL A;  1L3S A;  1NMN A;  3VGM A;  2I7N A;  2BTF A;  3J8A A;  3CPW M;  4A61 A;  1EP4 A;  1HYS A;  1XI1 A;  3C7N B;  1OKJ A;  4R79 A;  3DXK A;  1BUP A;  4QAG A;  3MN9 A;  1NM1 A;  4CJS A;  1XC9 A;  2KW4 A;  1OH5 A;  4IZ9 A;  1Q81 O;  5SZT A;  3SI6 A;  1D8Y A;  3PUF A;  1Q82 O;  4J2B A;  3LDS A;  3KK1 A;  3V9U A;  3ULD A;  4PY5 A;  4A57 A;  5C2D A;  3VF4 A;  2P9U A;  4FK0 A;  3R1X A;  4JEP A;  1N36 K;  4GKK K;  4AM7 A;  2RPI A;  4IG0 A;  4F9O A;  3CQX A;  4ILG B;  1KFS A;  2UYT A;  3OYI A;  3MCP A;  4FM1 A;  3N4P A;  5K14 A;  4W5Q A;  4E7L A;  4JHD A;  3ZEU A;  1D9D A;  2HBK A;  2JWK A;  4O5B A;  4H5N A;  2WC9 A;  1NK6 A;  3HTV A;  3CC2 N;  4RW9 A;  4BRM A;  1TKT A;  4BDY A;  4EP5 A;  2E6L A;  2ASO A;  3U8X A;  2HVH A;  3MED A;  4JV5 K;  5BN8 A;  3TSU A;  3I8B A;  3VEO A;  5KRT A;  1HLU A;  5C12 A;  5C24 A;  4DLE A;  3D45 A;  4IOX A;  4E1N A;  4QS9 A;  3HOS A;  3IG1 A;  3OYA A;  3SV4 A;  3FZK A;  1BHL A;  4E7H A;  3AY9 A;  1RDD A;  3MEC A;  2OCE A;  2ZF5 O;  2WBN A;  4DV2 K;  4IDH A;  4JRP A;  3VQE A;  4HUG A;  1EET A;  2YJF A;  1HYZ A;  4CZI A;  4AHC A;  3TAQ A;  3VEX A;  3EYZ A;  2QWM A;  3CCV N;  1VSI A;  3PIO L;  4YOV A;  4DR1 K;  2WUS A;  4FJK A;  3L6Q A;  2YNH A;  1TL1 A;  1NGD A;  4TSX A;  4PKH A;  4BR9 A;  2P9S B;  2GTD A;  3PX6 A;  2UXB K;  3PX0 A;  3OBY A;  3KTQ A;  1U2V A;  1QQO A;  3DJC A;  1EX4 A;  2QM1 A;  3CCL N;  4BRC A;  3HZ6 A;  3CC7 N;  2WON A;  5CR4 A;  4CZE A;  3RWU A;  2IIR A;  3CD6 N;  2HHX A;  4RG8 A;  4JYA K;  1VHX A;  5HRR A;  3AGK A;  4JKF A;  4CGH A;  4Z4C A;  1QHA A;  1HKG A;  4IJA A;  1NLV A;  3KKS A;  4M3U A;  3OS0 A;  1NK0 A;  4CJE A;  2OTL N;  1M1K O;  5GAH P;  2OYQ A;  3L3V A;  5FPM A;  4ELT A;  2A40 A;  3NH1 A;  3CCM N;  4CGJ A;  1WB9 A;  3H45 C;  1BIU A;  2E1Z A;  3R3L A;  3ZT1 A;  1KCF A;  3KLH A;  4U67 L;  1VQN N;  2HHW A;  3QML A;  4C1N I;  2HHU A;  4XIU A;  4M7X A;  5GAG P;  4FWR A;  3ALY A;  3C6T A;  3VGL A;  1NK4 A;  4MLE A;  3UIQ A;  2FLO A;  2QWO A;  3B6P A;  5C25 A;  1CLQ A;  2OA8 A;  3HM8 A;  2E2P A;  3QIC A;  1B92 A;  3EN9 A;  1KAX A;  4BRI A;  1JLC A;  3KLE A;  3ZCM A;  1BIZ A;  2XO7 A;  4A5B A;  4JI8 K;  4PA1 A;  4NB4 A;  3AA4 A;  3THV A;  2FF6 A;  3OYN A;  1N8R O;  4CHN A;  1S6P A;  3M8R A;  3ULE B;  4Z4E A;  1J54 A;  5AQV A;  1IV0 A;  2IOC A;  4LSN A;  3NF7 A;  4CHY A;  1NOY A;  1IBL K;  3VA0 A;  1RT6 A;  1RT4 A;  2XY7 A;  1H1V A;  4M45 A;  4JI4 K;  2PFU A;  3C95 A;  1F21 A;  3K5N A;  2QI2 A;  4FJ9 A;  3VF2 A;  3THW A;  5BPN A;  4DFP A;  1XNR K;  3C6U A;  3L0Q A;  2RKI A;  4JKE A;  3L2U A;  4BC2 A;  2QWR A;  4CJ5 A;  3HK2 A;  3MEE A;  3O8M A;  1TAQ A;  1HRH A;  5EX5 A;  1TKD A;  4O4G A;  1IO2 A;  5LMU K;  5C0Y A;  3IS9 A;  3O9Q A;  3VQ4 A;  2JLE A;  1A5W A;  3VQA A;  2HNY A;  1KVA A;  4JN4 A;  3ZT4 A;  1ESV A;  3K5M A;  1GOB A;  2QEX N;  1A5V A;  4V19 S;  2HVI A;  4EAH D;  3R8E A;  3CIP A;  4OLB A;  2W41 A;  3MXJ A;  4C23 A;  3PSF A;  4M63 C;  2FXU A;  1VSJ A;  1VQ5 N;  2FBV A;  3NGZ A;  4UY8 O;  1BQM A;  1KLM A;  5D3G A;  3U3Y A;  4ID5 A;  3GOI A;  3MDQ A;  4BRQ A;  3NF9 A;  3AVF A;  3SQ2 A;  4FJJ A;  1HQU A;  1KAY A;  4A2A A;  4RW7 A;  3C6H A;  2AP1 A;  5AQM A;  1VSM A;  3TAM A;  4OGE A;  2QA4 N;  1YI2 N;  4WQ5 A;  3V4I A;  4YOT A;  1T05 A;  4H5R A;  1WOQ A;  1L5U A;  3I55 N;  2Q2R A;  4B8A B;  5HRP A;  4A2B A;  4FLU A;  5AQK A;  2WFB A;  4CEQ A;  1JCG A;  1X9W A;  5F2R A;  3SLC A;  3LDL A;  4F3O A;  2V7Y A;  4DR7 K;  3AV9 A;  4BWM A;  2V7Z A;  5AQW A;  4QCL A;  2P9K A;  1UWB A;  3AA2 A;  1C0U A;  4CCH A;  2P9N A;  3HO1 A;  5AQU A;  4DS4 A;  2P51 A;  4IWV A;  2HND A;  4OPK A;  2HHT A;  1NGB A;  4OX9 K;  2B6A A;  4EHU A;  3L2Q A;  4BC3 A;  4AH9 A;  1YT3 A;  3WNH A;  1TK0 A;  4B1U B;  2X6S A;  4FOE A;  1I3A A;  1X1P A;  5A2Q O;  2ZM6 K;  3QB0 A;  4MO5 A;  3VQB A;  3NF6 A;  4JI1 K;  2P9P A;  4BE1 A;  5EOY A;  2HHS A;  1S1W A;  1NJY A;  4AHR A;  4HVJ A;  4X62 K;  4M3Z A;  1VQK N;  1YF5 L;  3VPZ A;  3SUO A;  2O8E B;  4OJR A;  1X9M A;  4CJR A;  4Y0W A;  3CJ1 A;  4KRF A;  5EVZ A;  2YNI A;  3TSP A;  3V81 A;  3AO3 A;  3ZSX A;  3EY1 A;  1EXQ A;  1QZ6 A;  4DFK A;  1JL1 A;  3SNN A;  1D4X A;  3F2K A;  4G1Q A;  2Z1J A;  3VQ8 A;  4DU3 A;  1NBW A;  2YHB A;  1K8A O;  3A2F A;  4DSJ A;  3SAH A;  4BRN A;  5KI6 A;  5C42 A;  1QHT A;  4AQY K;  3G4S N;  4E1J A;  3D2E A;  3WNF A;  4LF9 K;  4F3T A;  1QE1 A;  4FLX A;  3HOT A;  3UKR A;  4DTX A;  4YY3 K;  4MO4 A;  4Z4F A;  2V51 B;  4DSL A;  3KZB A;  4LY7 A;  4C8O A;  3JYT A;  5HRN A;  3AVK A;  2P9L B;  4ISF A;  1SKS A;  1ITG A;  4FZZ A;  4ISE A;  4JKB A;  3TAE A;  1OH7 A;  3SAG A;  2EHG A;  1RTI A;  2VGN A;  4DF4 A;  4DG1 A;  3PO4 A;  4DV4 K;  5BRF A;  4I6M A;  5M1K A;  1WBB A;  1ZBH A;  3DLG A;  3WNG A;  5AQQ A;  3T3F A;  2DFH A;  4CZJ A;  2HOE A;  1I94 K;  5E41 A;  3O9U A;  4EFH A;  1CXQ A;  3VEW A;  3VQQ A;  4J2A A;  4CK1 A;  3WEE B;  3GG4 A;  3TSQ A;  4B3O A;  3GBT A;  4DQP A;  4KTQ A;  4JI7 K;  5JS1 A;  4O8K A;  4XEI A;  5AQZ A;  2YI1 A;  3F9K A;  3HBT A;  3MMV A;  4O55 A;  3O6W A;  2RN2 A;  4H0X B;  2OPR A;  3EE8 A;  4YOU A;  1GOC A;  4KI6 A;  3SZ2 A;  2FBT A;  3RVC A;  3DWL A;  2NNW A;  3D2F A;  3DXM B;  2FBY A;  4E19 A;  5MLC Q;  1Q18 A;  5AQT A;  4CI6 A;  3SPY A;  1RBS A;  1C1B A;  3UB5 A;  3ZT3 A;  2Y1I A;  2F9W A;  1BDG A;  3FLC O;  4F2S A;  2YCH A;  5AR0 A;  2HHV A;  4KB1 A;  2Q97 A;  2KFN A;  1YJN N;  1D5A A;  2LSN A;  3I8D A;  1HNV A;  2WTU A;  3DRS A;  3SJJ A;  3VER A;  4BRD A;  4FWL A;  3VQ5 A;  1NK9 A;  2A42 A;  3WXM B;  3AVJ A;  2FC0 A;  1NGH A;  2P9P B;  1JKH A;  2BDP A;  1LAV A;  5BRD A;  5E84 A;  1ZBS A;  3MXI A;  3DYA A;  3MK6 A;  4DV6 K;  2O8C A;  3VEZ A;  3IFR A;  4M3R A;  3VQ9 A;  2VWJ A;  3O5B A;  3HXM A;  4M3X A;  1J5O A;  5KPT A;  3RSE A; 
#chains in the Genus database with same CATH homology
 2IVP A;  4LC9 B;  4IOX A;  3H3O B;  1VAZ A;  4K43 A;  4QS9 A;  1NGF A;  1QVG M;  3EO3 A;  4PL8 A;  3HOS A;  3K9K A;  3ZET A;  3FZK A;  4JD2 B;  1XUP O;  1NGI A;  3IDH A;  2KLA A;  3I33 A;  3AY9 A;  4FPB A;  1C0F A;  1V4T A;  3IKM A;  3SJH A;  1VQ9 N;  2ZF5 O;  4CBX A;  2WBN A;  3D2E B;  2OTJ N;  1GLC G;  1GLB G;  2PBD A;  4A59 A;  1ZXO A;  4IDH A;  4OO1 J;  3U9Z A;  3IMX A;  4H0O A;  2YJF A;  1NGA A;  4CZI A;  1LCU A;  4FWM A;  3H6E A;  2RHK A;  3VEX A;  3B8A X;  2QWM A;  3CCV N;  3PIO L;  5BPL A;  4YOV A;  2WUS A;  2ASM A;  3ZX2 A;  3L6Q A;  4K25 A;  3C6A A;  1NGD A;  4PKH A;  4BGB A;  4BR9 A;  2P9S B;  4GV6 A;  5AQY A;  2GTD A;  3QBX A;  5GAE P;  2QWN A;  3WQU A;  1DT9 A;  2Q0U A;  3OBY A;  1IG8 A;  1U2V A;  4YOY A;  4FWO A;  1QQO A;  3DJC A;  5HOO A;  4H0Y B;  3O9T A;  1VQ6 N;  3ENO A;  2VGM A;  2QM1 A;  3CCL N;  4BY9 C;  4BRC A;  3I56 N;  4PKG A;  1YVN A;  3HZ6 A;  4MLH A;  2GWK A;  3FGU A;  1NJI O;  3CC7 N;  1NGJ A;  3ATU A;  3HSC A;  1R59 O;  1WUA A;  1MDU B;  3CJ9 A;  3D6R A;  2IIR A;  3ID6 A;  5CR4 A;  3CD6 N;  4EHT A;  2FSJ A;  3K9J A;  5AQR A;  3VES A;  3AGR A;  1Y64 A;  3AGK A;  4JKF A;  3VTH A;  5AZJ B;  3OHR A;  1QHA A;  1HKG A;  2P9L A;  4IJA A;  1NLV A;  4JKA A;  4M7Y A;  5C15 A;  4H03 B;  1VQ4 N;  1K8K B;  4FL9 A;  3VGK A;  2Q31 A;  2OTL N;  4BQL A;  2PAV A;  1P90 A;  3BF3 A;  5GAH P;  1M1K O;  4FVU A;  5FPM A;  3M1F A;  3BP8 A;  3O1B A;  2JWL A;  3CJ7 A;  5AQP A;  2A40 A;  1BA0 A;  1V4S A;  4FWP A;  3LDP A;  2NRT A;  1QQM A;  3CCM N;  3NMU A;  1MA9 B;  1CZA N;  3WXL A;  4YOX A;  4QS7 A;  1U6Z A;  1HPM A;  3H45 C;  3H1Q A;  4B1X B;  4IEE A;  5AQO A;  4ILJ A;  4BRO A;  4BR7 A;  1TUY A;  2E1Z A;  4NO7 A;  3R3L A;  5GAD P;  2VYP A;  2EWS A;  4U67 L;  1VQN N;  2CH6 A;  1TYQ B;  4O8U A;  1ILY A;  4H5V A;  2FF3 B;  3QML A;  4B1W B;  4C1N I;  5AFU A;  3WEE A;  5M1N A;  4M7X A;  5AQI A;  2P9K B;  3CXC M;  2D4W A;  4GVE A;  4FWR A;  5GAG P;  1KQS M;  2YHW A;  3A5O C;  2P9N B;  3VF6 A;  3CCU N;  3E1Y A;  1IJJ A;  3VGL A;  1C0G A;  3EKU A;  4OPA A;  5M1Q A;  4BRF A;  1G99 A;  4MLE A;  4U7B A;  5FPD A;  1KAZ A;  2FLO A;  1S22 A;  3GDQ A;  3ZX0 A;  4DQ8 A;  3EZW A;  4RWT A;  1Q86 O;  2QWO A;  2QXL A;  3LDQ A;  4FWN A;  5TKY A;  1KD1 O;  3TTC A;  4BC5 A;  5AQF A;  3RSE A;  3O4W A;  4CZK A;  3HM8 A;  4B1V A;  2E2P A;  3AAR A;  3QIC A;  3DXM A;  3EN9 A;  3TU5 A;  3A5N C;  5EXW A;  1MWM A;  1KAX A;  3CPE A;  5E26 A;  3O08 A;  4BRI A;  3A5M C;  4IEI A;  4BVP A;  1OVY A;  3N4Q A;  1GLA G;  1DEJ A;  3C7N A;  3CJB A;  2BH1 A;  3PLA A;  3KWI A;  2GX9 A;  2QWQ A;  1E4G T;  4JK9 A;  5EY4 A;  1SS6 A;  5M1P A;  4WQ4 C;  5F1X A;  4WFA L;  3KHY A;  5AFU H;  3A5L C;  3VEV A;  4FPA A;  2HMP A;  1YAG A;  4A5B A;  4BRP A;  2NRV A;  3NVM A;  2W40 A;  4NB4 A;  2E2N A;  2KKZ A;  4IJN A;  1KXP A;  2E8A A;  2H3G X;  1JCE A;  2YHY A;  2E88 A;  3OBW A;  3GL1 A;  4IXC A;  2ZJQ L;  3F9M A;  1K9M O;  3MWP A;  2FF6 A;  5BRH A;  1N8R O;  3E9P A;  4CBW A;  1T6D A;  2NRX A;  3ULE B;  3ZET B;  4H5W A;  2NRH A;  5AQL A;  1Q7Y O;  4DB3 A;  1ZC6 A;  5AQV A;  2I7P A;  3CC4 N;  4BG8 A;  1T44 A;  4CD3 A;  2A41 A;  1RDU A;  3QFP A;  2D0P A;  4RTF D;  5FPN A;  4B1Y B;  3U4L A;  1H1V A;  3MN7 A;  3WXI A;  2PFU A;  3UKR B;  5BR9 A;  4BRG A;  2QI2 A;  4Z94 A;  3VF2 A;  2NRZ A;  1HUX A;  5CE3 A;  3A0I X;  5BPN A;  1S3X A;  1DKG D;  4HTL A;  4NLB A;  1W2B M;  3TPQ A;  3KK7 A;  4XH4 A;  3LM9 A;  3L0Q A;  1RFQ A;  4JKE A;  4WQ4 A;  5KQD A;  1GLD G;  4CZG A;  4BC2 A;  2NZT A;  1VQP N;  3EL2 A;  2A5X A;  2QWR A;  3E9O A;  4I6M B;  4BR5 A;  3O8M A;  3CQY A;  1EO1 A;  4YDU C;  3OW2 M;  4BRL A;  5EX5 A;  3VET A;  3DAW A;  3LDO A;  3WUH A;  1HX1 A;  5C0Y A;  2CGK A;  1NGE A;  3E9L A;  4JKD A;  5JMV A;  3O9Q A;  2A3Z A;  5JVH L;  3LL3 A;  4DKW A;  4WQ5 C;  3EKS A;  2HBJ A;  4JN4 A;  4OPH A;  1ESV A;  4O5F A;  3P4I A;  2QEX N;  4JNE A;  4IOC L;  4FWK A;  5AQG A;  3LM2 A;  1T3V A;  2ZGY A;  3R8E A;  2OAN A;  1SZ2 A;  4CBU A;  2NRR A;  3CIP A;  3SMS A;  4EAH D;  5KPZ A;  3J7Z O;  2J4R A;  4CZF A;  1BG3 A;  2NRW A;  3H3N O;  5C10 A;  2P9S A;  1YXQ A;  2W41 A;  2A6A A;  3G6E N;  3L4I A;  5H1S Q;  2HBL A;  4C23 A;  3SK3 A;  4M63 C;  3T69 A;  2FXU A;  5ELZ A;  3MX5 A;  2D1K A;  1VQ5 N;  3IUC A;  1J6Z A;  1TUU A;  4UY8 O;  3QDK A;  1S72 N;  3W0L A;  2GWJ A;  1VQM N;  3JS6 A;  4JKC A;  3D2F B;  3FZH A;  2P9I B;  5BN9 A;  4BRK A;  3GOI A;  4CZH A;  3FZM A;  2V52 B;  3MDQ A;  4BRQ A;  4CZL A;  4A62 A;  3FFK B;  5DM6 L;  2ZWH A;  1W97 L;  4YDU A;  4C1N K;  4GV3 A;  2KHO A;  5AZJ A;  2GEM A;  3DXK B;  4A2A A;  1KAY A;  3O9S A;  3H1V X;  2RE2 A;  3C6H A;  1K8K A;  2CGJ A;  2AP1 A;  3CHW A;  3UKU B;  5AQM A;  1E4F T;  1X3M A;  4J8F A;  4K41 A;  5JLF A;  5HL7 L;  4PKI A;  4FSV A;  2QA4 N;  1YI2 N;  4YOR A;  1NWK A;  2HF4 A;  4WQ5 A;  2QWP A;  4YOT A;  3ENH A;  4H5R A;  1WOQ A;  4NLC A;  3SMP A;  3I55 N;  2Q2R A;  4A2B A;  4IFE A;  3CI5 A;  1GLE G;  2P9U B;  4XH1 A;  4BVO A;  5JIC A;  3VTI A;  5AQK A;  3WQT A;  2WFB A;  1JCG A;  4DCH A;  4JKG B;  3VOV A;  5F2R A;  3G25 A;  1BO5 O;  3SLC A;  2ZJR L;  3CJA A;  3LDL A;  3O1W A;  1RDW X;  2V7Y A;  4FWS A;  3SBT A;  4HWI A;  4DHY A;  5LJW A;  3W3D A;  3DLL L;  5KPR A;  5BPM A;  5CHI A;  4B1Z A;  4WCE L;  3FZF A;  5AQH A;  3GE1 A;  2V7Z A;  3MN5 A;  4JHD B;  5AQW A;  4H0V B;  3ZEU B;  1XC3 A;  1YUW A;  1SQK A;  4ISG A;  5C2F A;  2P9K A;  2QWL A;  2IVN A;  3PIP L;  2CGL A;  4BC4 A;  4PL7 A;  5M1F A;  4KH5 A;  2P9N A;  3KWG A;  3O9R A;  3R9P A;  5AQU A;  3BF1 A;  1HJO A;  4IWV A;  1BU6 O;  3MCA B;  3WXK A;  3SBG A;  4YOW A;  1NGB A;  3UE5 A;  3RSE B;  1P8Z A;  4KH6 A;  3M5R A;  4EHU A;  4BC3 A;  3WXJ A;  3P38 A;  1YHQ N;  3QFU A;  3FE1 A;  2GUP A;  4B1U B;  4AM6 A;  4FOI A;  4FOE A;  1BWF O;  1X9J A;  5AQJ A;  3CCR N;  2E2O A;  3QB0 A;  4MO5 A;  2Q0R A;  3T7Z A;  2E20 A;  4IO9 L;  2P9P A;  2IVO A;  3NVK A;  2YHX A;  4A5A A;  1O13 A;  3L4Q A;  1GLJ O;  5EOY A;  1KC8 O;  1YJW N;  3G71 N;  2NLX A;  1LOT B;  3VEY A;  5LY3 A;  1VQK N;  3ENB A;  3HRG A;  1YF5 L;  3S41 A;  2HF3 A;  4JK7 A;  3D7E O;  3VPZ A;  1YIJ N;  5GIP A;  4KBO A;  1QVF M;  4Y0W A;  3CJ1 A;  4IOA L;  3CCS N;  3EE9 A;  5EVZ A;  5AZI A;  5M1O A;  2YJE A;  3ID8 A;  3TSP A;  1JCF A;  4RCH A;  1GLL O;  1BA1 A;  5F0X A;  5ADX A;  3ULE A;  1QZ6 A;  2F7T A;  1D4X A;  1U2V B;  3F2K A;  4BRH A;  3CCQ N;  3MN6 A;  1ATR A;  2VCP A;  3KVG A;  1NBW A;  2DPN A;  4JD2 A;  1K8A O;  2E1Y A;  4BRN A;  3SAH A;  2VWB A;  3C65 A;  4K42 A;  5AQN A;  1HKC A;  4G9Z A;  3G4S N;  5AQS A;  2CH5 A;  4E1J A;  1X3N A;  3D2E A;  2FSN A;  1QZ5 A;  3HOT A;  3ATV A;  4L3Q A;  3UKR A;  2YX6 A;  3C0B A;  3U9D A;  4QS8 A;  4MO4 A;  3M3Z A;  2V51 B;  3KZB A;  1VQ8 N;  2QTD A;  1K73 O;  3ZX3 A;  2P9L B;  3M6G A;  4ISF A;  2Q36 A;  3MWT A;  4CD1 A;  4ISE A;  4JKB A;  4MDA A;  3SAG A;  4JAX A;  3TTF A;  2VGN A;  4BR0 A;  3AAP A;  2AA4 A;  2FSK A;  3TTD A;  1QQN A;  4BG9 A;  4CJ7 A;  5BRF A;  1YJ9 N;  3OA9 A;  3HI0 A;  3A8Y A;  3H46 O;  4I6M A;  1ATN A;  5M1K A;  3CME N;  2ASP A;  4BR4 A;  4CZM A;  3BEX A;  3AAQ A;  4JK8 A;  2ZGZ A;  5ADX H;  1ATS A;  3CCE N;  4GV9 A;  5AQQ A;  3CMA N;  1M90 O;  4CZJ A;  1BOT O;  3CCJ N;  2HOE A;  3P39 A;  3ZYY X;  1XQS C;  3FR0 A;  1SAZ A;  4ILH A;  3O9U A;  3CJC A;  5GIO A;  4EFH A;  3BUZ B;  2D0O A;  3VEW A;  1NMD A;  4BRA A;  4XH5 A;  3WEE B;  4PHT X;  1VQO N;  3GG4 A;  3TSQ A;  4BR2 A;  3LDN A;  3GBT A;  4H0T B;  4O8K A;  3R6M A;  4XEI A;  2BUP A;  5AQZ A;  5KQ8 A;  2YI1 A;  4GNI A;  3MX2 A;  1MWK A;  3HBT A;  1T6C A;  4JKH A;  3MMV A;  2F9T A;  1EQY A;  2Q1N A;  3O6W A;  2QW9 A;  4KH4 A;  5AQX A;  5TKW A;  2E2Q A;  4H0X B;  1JJ2 M;  2ZJP L;  2HST A;  3EE8 A;  5LJV A;  4YOU A;  4WF9 L;  4H5T A;  3JXU A;  4EIA A;  1GLF O;  4FO0 A;  3RVC A;  3DWL A;  3QBW A;  4WFB L;  2NNW A;  3D2F A;  3DXM B;  3P31 A;  2P9I A;  3VGM A;  2I7N A;  5MLC Q;  2BTF A;  3J8A A;  3Q7C A;  4A61 A;  3CPW M;  4WFN L;  1Q18 A;  4BQZ A;  3CF5 L;  5AQT A;  5JVG L;  4CI6 A;  3C7N B;  1OKJ A;  4BGA A;  1VQL N;  1TYQ A;  4R79 A;  4AF1 A;  3DXK A;  3Q7B A;  5DM7 L;  1BUP A;  4H0P A;  5FPE A;  3F5T A;  3UB5 A;  3UKU A;  3CER A;  3MN9 A;  1NM1 A;  1NGG A;  2F9W A;  1BDG A;  3FLC O;  4IZ9 A;  1Q81 O;  2YCH A;  5AR0 A;  3FZL A;  2Q97 A;  3O80 A;  1YJN N;  1Q82 O;  2ITM A;  4GY2 B;  3VEN A;  4A57 A;  1VQ7 N;  3VER A;  4WYB A;  4FWL A;  3VF4 A;  2P9U A;  4BRD A;  5BRE A;  5C2D A;  3R1X A;  4JEP A;  3SAF A;  5I9E B;  4AM7 A;  4F9O A;  2A42 A;  1Z05 A;  3CQX A;  4JKG A;  4BRE A;  3CET A;  1NGC A;  5B8H A;  2HBM A;  4ILG B;  3WXM B;  1HKB A;  2UYT A;  4FWQ A;  3MCP A;  2P9P B;  1NGH A;  3N4P A;  4B9Q A;  5JLH A;  4JHD A;  3ZEU A;  5BRD A;  2HBK A;  2JWK A;  1RGI A;  1ZBS A;  5E84 A;  3VMF B;  4H5N A;  3MK6 A;  2WC9 A;  3VEZ A;  1DGK N;  3IFR A;  2GEL A;  4MDB A;  3HTV A;  3WT0 A;  5GIN A;  3CC2 N;  4BRM A;  3O5B A;  2ASO A;  3U8X A;  4CZE A;  5AZI B;  4IO8 A;  1Z6R A;  5BN8 A;  3TSU A;  3I8B A;  3VEO A;  5KPT A;  1YIT N;  1HLU A;  5C12 A;  3E66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...