4H0OA

Crystal structure of acetate kinase from entamoeba histolytica
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
391
structure length
383
Chain Sequence
SNVLIFNVGSSSLTYKVFCSDNIVCSGKSNKPFIEHHLNGQIIKIETPILNHPQAAKLIIQFLKENHISIAFVGHRFVHGGSYFKKSAVIDEVVLKELKECLPLAPIHNPSSFGVIEISMKELPTTRQYVAIDTAFHSTISQAERTYAIPQPYQSQYLKFGFHGLSYEYVINSLKNVIDVSHSKIIACHLGTGGSSCCGIVNGKSFDTSMGNSTLAGLVMSTRCGDIDPTIPIDMIQQVGIEKVVDILNKKSGLLGVSELSSDMRDILHEIETRGPKAKTCQLAFDVYIKQLAKTIGGLMVEIGGLDLLVFTDQMGLEVWQVRKAICDKMKFLGIELDDSLNEKSMGKKIEFLTMPSSKVQVCVAPNDEELVILQKGKELFQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetate kinase
publication title Crystal structures of acetate kinases from the eukaryotic pathogens Entamoeba histolytica and Cryptococcus neoformans.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Transferase
total genus 126
structure length 383
sequence length 391
chains with identical sequence B
ec nomenclature ec 2.7.2.12: Acetate kinase (diphosphate).
pdb deposition date 2012-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4h0oA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4h0oA02
3WQUA 2E2PA 2P9UB 3VEZA 3DXKA 3ZETA 3MN9A 4O5FA 1GLAG 3DAWA 2YCHA 4J8FA 2P9KB 5ADXA 2GUPA 4BGAA 4B1WB 2Q0RA 3VEOA 3D2FA 5AQMA 1HJOA 3EN9A 2HOEA 3VF2A 3HM8A 5AQJA 5LJWA 4WQ4C 1V4TA 4EIAA 4BR4A 3D2FB 1X3MA 4FWLA 3BF1A 4DHYA 4Z94A 2P9PA 2V52B 1ZXOA 1NGIA 3FE1A 3VEYA 4RWTA 4BG8A 2P9SA 1T44A 2FSKA 2P9PB 2E1YA 4H5TA 2CGKA 2P9SB 2A3ZA 3FZHA 3I33A 5JMVA 4H03B 2CGLA 2FSNA 5AQTA 4K42A 2Q2RA 4F9OA 1WUAA 2DPNA 2A40A 3L4IA 5JLHA 2ASPA 1RDWX 4PL8A 3VESA 3O08A 3WXJA 3ULEA 4EAHD 5AQHA 3WQTA 3A5MC 4BR5A 1CZAN 3O8MA 2UYTA 3ULEB 5KQDA 4XEIA 2QWNA 3B8AX 3M1FA 4FO0A 4WQ4A 4BR2A 4H0YB 5F1XA 4Y0WA 5ADXH 1LCUA 5AFUA 1BO5O 3MMVA 3R9PA 3EO3A 4O8KA 3VOVA 1LOTB 2D0OA 1MWKA 3CIPA 2VYPA 3CQYA 2BUPA 3CJ7A 4ISGA 3WXKA 2HMPA 4BQLA 3HI0A 4K43A 2E20A 3U9DA 3ZEUB 3O1WA 3GG4A 2ASOA 5KPTA 4FWQA 2YI1A 1GLJO 3CQXA 4BG9A 1NGJA 4BRNA 3M3ZA 5F0XA 3GL1A 3VETA 4CBUA 2E88A 5FPEA 3O5BA 3J8AA 3FZKA 3MCPA 3A0IX 4FWSA 2P9NB 4NB4A 5KQ8A 1DGKN 3C0BA 2A6AA 4BRLA 3CJCA 4H5WA 1HKBA 2GWKA 2V51B 3JS6A 5AQXA 2CH5A 4AM6A 3QFUA 3VPZA 4XH4A 3UKUB 5FPMA 4BRFA 1HKCA 3ATVA 3A8YA 4NO7A 1QQMA 1T6DA 5FPNA 2IVOA 2D0PA 4ISEA 4PKGA 4BR0A 1RFQA 4A62A 1MDUB 1BA0A 2Q0UA 2KHOA 5TKYA 3ENHA 5AQYA 2QWOA 3WEEA 4M7YA 4DQ8A 3FLCO 2P9IB 4QS7A 2E1ZA 1QZ6A 3U9ZA 1XUPO 5EX5A 4BC3A 4BRDA 5KPRA 3QDKA 2CGJA 4CZJA 4DCHA 3LDNA 4BC5A 2E2OA 3UKRB 1C0FA 2Q36A 1NGAA 2P9KA 5CE3A 1C0GA 3TPQA 4CD3A 4BRPA 5AQGA 4AM7A 1GLCG 3LL3A 5AZJB 5AQVA 4FL9A 3IFRA 4IZ9A 4MLEA 1YAGA 3AARA 4B1UB 3UB5A 2ZWHA 4H5VA 3ZX3A 5AQWA 4RCHA 2ASMA 3FFKB 1HUXA 1NGBA 1H1VA 1GLDG 1G99A 2A42A 3WT0A 2W41A 1T6CA 1KAYA 3CJBA 2D4WA 1GLEG 3VENA 3BF3A 4GY2B 4BROA 1BDGA 4A61A 3FZMA 3JXUA 1NGHA 2FSJA 2ZGZA 2ZGYA 1V4SA 4FSVA 4XH5A 1JCFA 3L6QA 3VF6A 1S3XA 1ESVA 1BG3A 3TU5A 5AR0A 4IWVA 3W3DA 1IJJA 4EHUA 1DEJA 5ELZA 3IMXA 4H5NA 4BVOA 4FOEA 3SLCA 3KZBA 2QM1A 1U2VB 2WUSA 1R59O 4H5RA 4LC9B 3CJ9A 1BUPA 4HWIA 3LDQA 1YUWA 4M7XA 2ITMA 3S41A 3L0QA 4FOIA 4B1VA 4IJAA 1KXPA 1JCEA 3D2EA 4CZHA 3AAPA 5JLFA 4B1ZA 1S22A 5AQIA 2I7PA 5AQFA 2H3GX 2VWBA 1TUUA 2AA4A 3ZEUA 4CZEA 3D2EB 1Z05A 3ID8A 1QQOA 4KBOA 3H1VX 3O1BA 3R6MA 4HTLA 2HF4A 4MLHA 3CHWA 3U4LA 5EOYA 4BQZA 4CBWA 5F2RA 1KAZA 2D1KA 1BWFO 4EHTA 5KPZA 2F9WA 3ZX2A 4YDUC 2F9TA 4BRHA 5I9EB 3VGLA 3A5LC 2P9NA 1SZ2A 2E8AA 3ATUA 5LJVA 4WQ5C 1HLUA 2QWQA 2J4RA 1GLBG 2CH6A 5E26A 1DKGD 3R8EA 4B9QA 4CZFA 4K25A 4FWRA 2IVPA 2AP1A 5AZIA 3UKUA 2FXUA 5BPMA 5E84A 2I7NA 3QBWA 5AZIB 4BRQA 2GELA 1P8ZA 1TYQB 3H6EA 4I6MA 4BRMA 4H0OA 3QICA 4H0TB 4BREA 3UE5A 3KVGA 3ZX0A 3VF4A 5AFUH 4XH1A 1ZC6A 3C7NA 4I6MB 3O6WA 5BPLA 1MWMA 3BUZB 2P9IA 3WXIA 3M6GA 3FR0A 3HTVA 3C7NB 1X3NA 1SQKA 4BRKA 2YHWA 4WYBA 3HSCA 4JNEA 4YDUA 1NWKA 3AY9A 3LM9A 1Q18A 3UKRA 1HKGA 2GWJA 2QW9A 2EWSA 4WQ5A 3BP8A 1QHAA 3GOIA 5BRDA 3DJCA 5AQQA 1MA9B 3GE1A 3HBTA 5BN9A 2YHXA 3FZFA 5BR9A 4CZMA 3EKUA 1YVNA 5AZJA 2PAVA 3MDQA 4L3QA 5AQKA 1TUYA 5FPDA 3OHRA 1GLLO 3SJHA 5AQSA 5BRFA 1RGIA 3KHYA 3F9MA 1JCGA 3H1QA 4MO4A 1ATRA 1HPMA 1Z6RA 4RTFD 3HZ6A 4GNIA 4K41A 4JD2A 4B1XB 5AQPA 4CBXA 5AQRA 2E2NA 3QMLA 1NGEA 5B8HA 1QQNA 1QZ5A 2P9LB 1E4GT 4JD2B 4PKIA 2NZTA 3DXMB 1HX1A 1ZBSA 2YHYA 3MN5A 3DXKB 3ZETB 3LDOA 1YXQA 2QXLA 3U8XA 2E2QA 3CJ1A 2QWMA 1E4FT 3H45C 3WUHA 1ATSA 1U2VA 1BOTO 3BEXA 5AQNA 4IJNA 1KAXA 3VGKA 4A2BA 2NRHA 3SK3A 1BU6O 1NGDA 3SMSA 2QWLA 5EVZA 2BTFA 5AQZA 4BR9A 1NBWA 3FZLA 4BR7A 4BC4A 3FGUA 3QB0A 2OANA 3CETA 4BGBA 4H0XB 3H3NO 4BRIA 1WOQA 3D7EO 3QFPA 5AQUA 2FF3B 1NLVA 3VGMA 1EQYA 3WXLA 4A2AA 1Y64A 3DWLA 3GDQA 2A5XA 2Q31A 4QS9A 3MN6A 3A5NC 2V7ZA 4FWNA 2GTDA 4EFHA 5BRHA 2W40A 3EKSA 3LDPA 4BRCA 4FWMA 4H0PA 5AQOA 3LDLA 4CD1A 1OKJA 1IG8A 4PL7A 5AQLA 4FWOA 3VEVA 4C23A 3IDHA 3CI5A 1NM1A 5BREA 3H3OB 5BPNA 3W0LA 1SAZA 2YJEA 2NLXA 3EZWA 1BA1A 4CZIA 3QBXA 1U6ZA 3RSEA 4BRAA 3AAQA 4BC2A 4FPBA 1TYQA 1GLFO 4PKHA 3RSEB 2GEMA 3SMPA 4DB3A 1K8KA 1NMDA 3GBTA 4JHDA 3MN7A 4ISFA 2FF6A 5LY3A 3A5OC 1K8KB 5JICA 1XQSC 3EL2A 3G25A 4MO5A 4JHDB 1NGFA 2V7YA 2PBDA 3IUCA 4FPAA 2HF3A 2VCPA 1J6ZA 3CERA 1D4XA 5EY4A 4FWPA 4CZGA 1NGGA 4JAXA 4BVPA 1ATNA 3VERA 4CJ7A 3O4WA 1XC3A 3MK6A 3O80A 3H46O 2Q1NA 5BN8A 4IXCA 4BRGA 2ZF5O 4CZKA 3CJAA 3VEWA 4CI6A 4IO8A 4E1JA 3LM2A 4M63C 2FLOA 1X9JA 2QWRA 2IIRA 4CZLA 4B1YB 2IVNA 3ENOA 1NGCA 4QS8A 4H0VB 3P4IA 3I8BA 2YJFA 2Q97A 4FWKA 3WEEB 2P9UA 2A41A 2P9LA 4JN4A 5EXWA 3VEXA 3DXMA 2QWPA
chains in the Genus database with same CATH superfamily
1JLBA 2E2PA 2P9UB 1EP4A 4BWJA 3ZETA 1IO2A 4Y1CA 3DLLL 2P9KB 2PZSA 1TAUA 4DSIA 3EEQA 2Q0RA 3SV3A 3AVIA 4LSNA 4DSKA 3EN9A 2O8DB 3VF2A 3V9SA 4I2QA 5LJWA 3QEVA 1VQON 4WQ4C 1V4TA 1K9MO 3L2WA 3C6HA 5FROA 1A5WA 5C24A 4HCBA 4KHUA 4JI4K 2P9SA 2P9PB 1TKXA 1S6QA 1HR0K 1RDCA 1RT6A 2CGKA 1Q86O 2UU9K 4PWDA 3HK2A 3IS9A 5AQTA 2QA4N 4F9OA 2DPNA 3VQPA 3OYCA 3AO5A 3VESA 4PL8A 3IG1A 3WXJA 4EAHD 3PIPL 4FJXA 3WQTA 1S1WA 1CZAN 3O8MA 1S9GA 4CK2A 4XEIA 5M1NA 2QWNA 3B8AX 4BR2A 4WQ4A 5F1XA 1KD1O 4W5NA 1LCUA 1NK6A 1BO5O 1HJRA 3MMVA 3QNOA 1U48A 3KJVA 3S9HA 1S1VA 1MWKA 1F21A 2Z1GA 1SV5A 3WXKA 2HMPA 4K43A 1BL3A 4KAZA 3GG4A 2ASOA 4CIFA 5CYMA 1GLJO 4DV4K 2HW3A 1NGJA 1VAZA 4Z4EA 1L5UA 3OYHA 4CJEA 2E88A 3EZ5A 3J8AA 1BCOA 2A1RA 4CHPA 4LF9K 3ZT1A 2RKIA 3A0IX 4CECA 4E1NA 4XIUA 4FWSA 4NB4A 3O9UA 5GAGP 1DGKN 3ZSOA 2A6AA 4LD0A 3PSIA 1VQ9N 2V51B 3VQBA 2G8KA 5AQXA 2QKBA 4AM6A 3VPZA 1W7AA 4XH4A 3HP9A 1LWFA 4BR0A 4A62A 4JS5A 3VMFB 1FKPA 4CF0A 1VQ7N 3I8DA 3O3GA 3ENHA 4FJ8A 3TAEA 1NJXA 4DQ8A 4CJUA 1JL2A 1D5AA 3U9ZA 4BC3A 5EX5A 5KPRA 3KLEA 1SKRA 4BC5A 1J54A 3IAYA 1ZBIA 1DTQA 3UKRB 2Q36A 5GINA 4CJ4A 3L2UA 4B9LA 1GOBA 3TPQA 3KK7A 4BRPA 1KC8O 3ZSXA 1GLCG 4B3SK 1S5JA 5M1QA 3NFAA 3R1XA 5AQVA 1N33K 3AARA 4H5VA 2OA8A 4DWIA 5AQWA 3NGIA 2ASMA 5M1OA 1HUXA 4F2RA 2W41A 1KAYA 3BZCA 3M5RA 1U45A 4A5BA 4EZ9A 1KVCA 3VQ8A 2F7TA 2FSJA 2ZGYA 4QOZB 4OKEA 2I5JA 4M45A 1ESVA 3TARA 1BG3A 2D0AA 2IDOA 1E3MA 4EHUA 4BVOA 4FM1A 4LY7A 4FOEA 4KRFA 3VQEA 3V1QA 4H5RA 4DUZK 4RW6A 4Z0UA 3WNHA 4M7XA 1TL3A 5JVHL 1HNWK 1KXPA 3D2EA 4CZHA 2WONA 5AQIA 3L8BA 2I7PA 1TUUA 2AA4A 2BE2A 1NG9A 3AVHA 1QQOA 1FJGK 3ZCMA 4HTLA 2HF4A 3CHWA 5F2RA 4PA1A 1BWFO 3PIOL 4LSLA 1T3VA 4CF1A 3MECA 3V81A 3ID6A 3M8PA 3P83D 4CJ5A 4WQ5C 1GLBG 3NGZA 3CYMA 1CZ9A 4YOWA 1Q9XA 3AVGA 1QE1A 4K25A 5AZIA 3UKUA 2FBTA 4DQIA 3V4IA 4ZHRA 2P51A 3F73A 1OH6A 3AO2A 1P8ZA 1HQUA 1TYQB 1TK8A 1K73O 3TSUA 1NMNA 3L4QA 2UUBK 5GAEP 1NJIO 3ZX0A 2R7YA 1FW6A 4BE1A 2IGIA 2ZJPL 4QCLA 3M6GA 3PUFA 4BRKA 2YHWA 4CF2A 4WYBA 1WN7A 4JNEA 1CXUA 1Q18A 4BE2A 3OYIA 2QW9A 2EWSA 4WQ5A 3BP8A 2NRVA 3DJCA 1XWLA 3GE1A 3HBTA 4FXDA 5BR9A 1D9DA 4FLWA 1YVUA 4DLEA 2PAVA 5FPDA 4FVMA 3DRPA 3KWIA 3OVNA 3CCLN 1NKCA 5HRSA 4DR3K 4FJHA 4F3TA 2ETJA 3HPHA 1ATRA 2HSTA 4DFJA 3S3NA 4GNIA 4JD2A 4B1XB 3MX5A 3VA0A 5AQRA 3OYLA 1QQNA 1QZ5A 1RTHA 2E6MA 4KFBA 4JEPA 1HX1A 2IS3A 3NF6A 3V9WA 1OVYA 1YXQA 2QXLA 5I3UA 4JI3K 2VWKA 1S72N 4L8RB 4R79A 4CFAA 3CJ1A 3T69A 3F9KA 4WE1A 1KAXA 3CQ8A 1EETA 2IOCA 2BTFA 3V9XA 4M3TA 4AQYK 5AQZA 4BR9A 1NBWA 5GIOA 3U6FA 1C1AA 1VHXA 4BGBA 3CM5A 2FBXA 3HO1A 3QFPA 4LF4K 2FF3B 1NLVA 3VGMA 2BGGA 2O8CB 3C6UA 3ZYYX 4Z4FA 3P39A 4HCCA 3OYMA 3HPGA 4DSFA 1WSFA 4JKHA 3KK3A 4DQRA 2YNGA 4G1QA 1YI2N 4H0PA 1T7PA 3I0RA 3LDLA 4CJQA 4PL7A 5AQLA 4X66K 1QSLA 2YKNA 3SJJA 3AVBA 3CCJN 3K9KA 2YJEA 4JK9A 2NLXA 1BA1A 4Q5VA 1NKEA 4GV6A 4DQSA 2KLAA 4FJ7A 4BRAA 4PKHA 1K8KA 2ZJRL 3GBTA 4IEEA 3K2PA 3DM2A 4E19A 1EXQA 2YNFA 5JICA 1XQSC 3G25A 4FK4A 4JHDB 1NGFA 4N5SA 1GOCA 1TK0A 4C8NA 5C10A 3G71N 4M42A 4DU4A 3AA3A 1D4XA 1XI1A 4CZGA 1HNZK 4OPHA 2OZMA 3VERA 3VTHA 4CJ7A 3O4WA 2BH1A 1RTJA 4OJRA 4BRGA 3SUQA 4KO0A 4CZKA 3AGKA 3VEWA 4CI6A 4DU1A 1YIJN 4DQPA 4FZXC 4ILHA 1KQSM 1WSIA 4KH5A 4HHTA 2OZSA 4Q0BA 2AJQA 3H08A 4M3YA 4KHNA 2HBMA 5CYQA 4CCHA 3BY5A 4AF1A 2Q97A 5J2PA 2P9UA 3LP1A 4FK0A 4GKKK 3ZSYA 5EXWA 3VEXA 4W5OA 2UXCK 4YOTA 5JS2A 1B9DA 3VQ7A 1YITN 4WFNL 1GLAG 3DAWA 4IDHA 1SUQA 3L3UA 2O8DA 2QKKA 5ADXA 2GUPA 1RBTA 3KKSA 2WTUA 5AQMA 1HJOA 4ELUA 2HOEA 1N34K 4GV3A 3C65A 5AQJA 3U3GA 3DLBA 4CJKA 5J1EA 4BR4A 3PX6A 4FWLA 2QK9A 3RWUA 5AJ3K 4Z94A 2P9PA 4DR2K 4DTXA 4CFDA 3VQ4A 5HL7L 3KK1A 1FXXA 4KI4A 1I94K 4FW2A 5JMVA 3LPTA 4BDYA 4BY9C 2CGLA 1WBBA 4LFBK 3AVFA 4AILC 2A1SA 1LAVA 3TAQA 2A40A 5JLHA 2XY7A 2VWJA 1K8AO 3A5MC 4KHYA 4BR5A 4J2DA 1VQ8N 1YT3A 4FJJA 2UYTA 4GVMA 3Q7CA 2G8WA 4FO0A 3G6EN 4H0YB 1WAJA 2VGNA 1CZBA 3AGRA 2RHKA 4O8KA 4NCBA 1NK0A 3CCUN 1RDAA 4OKKA 2D0OA 5SWMA 4JKFA 4O5BA 4GVEA 1YJWN 5MLCQ 4JS4A 4JKAA 3HI0A 3U9DA 1UOCA 3ZEUB 2OPPA 4OX9K 3R3LA 3SBTA 5KPTA 2VG7A 4MDBA 2Z1JA 2PYJA 3M3ZA 5HRRA 4CEQA 2IC3A 3ZSRA 5F0XA 1N5YA 3THXA 3KK2A 3O5BA 1VSHA 3OBWA 3MCPA 2E4LA 4I9LA 4CGFA 3C95A 4H5WA 3AVLA 3P31A 2GWKA 5LMNK 3JS6A 1YJ9N 3OYGA 4NO7A 3CF5L 4I2PA 1QQMA 1T6DA 5FPNA 2IVOA 5J2QA 2GBZA 3AO4A 5DMRA 1BA0A 2Q0UA 1LW0A 1WAFA 4CFBA 4W5RA 1FKOA 3AVMA 5AQYA 3SAGA 4N47A 3MXMA 3O3FA 3TAPA 4C8OA 3HL8A 2P9IB 5J2MA 3VQCA 1QZ6A 5FRMA 3OYAA 2Q3SA 4DCHA 2Z1IA 2E2OA 1C0FA 4C1NK 3OYDA 1XHXA 3OS1A 3I0SA 4U7BA 4FJGA 3ZT0A 5AQGA 2DY4A 2WFBA 3QINA 3KLHA 4LF6K 3C6AA 2HBKA 5AZJB 1X9WA 4QAGA 3CM6A 4V19S 4DTJA 1YAGA 3TAMA 2ZWHA 4DF8A 3FFKB 1KLMA 3LZJA 4J2AA 2O4GA 4CJRA 2O8FB 4H4OA 3I56N 3JAMO 1L3SA 1T6CA 2D4WA 1GLEG 2VG6A 3QESA 3BF3A 1UA0A 3NHGA 3CCQN 1NK7A 3O9TA 1BDGA 4A61A 1U4BA 3VA3A 1V4SA 1JCFA 1O1WA 4NLCA 3L6QA 4DMNA 3KD1E 1S3XA 1JXEA 3W3DA 5IWAK 1BI4A 4H5NA 1Q7YO 1IKWA 4DTMA 3KZBA 4CF8A 1EX4A 4HWIA 4JI2K 4F3OA 3B6OA 1WSHA 4MQ3A 1NK4A 2ITMA 3L0QA 1W97L 4FOIA 4B1VA 1RILA 2YHAA 4IOXA 5KRSA 3CCSN 1JCEA 3AAPA 5JLFA 4U67L 4B1ZA 4FLUA 1S22A 2H3GX 1Z05A 3ID8A 1IV0A 4DV3K 4IEIA 3F2KA 4FJMA 3R6MA 4BQZA 2YV0X 1O13A 4EHTA 3KLIA 4CEAA 2GV9A 3QEWA 4CJVA 4NYFA 4IFEA 5KPZA 3PX4A 3HM9A 3VGLA 4CEDA 3HJFA 3A5LC 2P9NA 3VQDA 2W42A 2HMIA 2IAJA 2Z1HA 3J7YP 2CH6A 3VQAA 2XO7A 1DKGD 4CVNE 3FFIA 1UWBA 4CZFA 1XNRK 1VRTA 2AP1A 2RF2A 1XNQK 3TTCA 5E84A 4JK8A 4FJKA 4NCGA 3QNNA 2GELA 3UE5A 3EYZA 1ITGA 4B9VA 5AFUH 4XH1A 5T7BA 1ZBHA 4I7FA 2E6LA 1D9FA 3PSFA 1MWMA 4YORA 4M3RA 3BUZB 3WXIA 2FBYA 3HTVA 1X3NA 3C7NB 2OCEA 1HKGA 3V9ZA 4B9MA 1N6QA 1QHAA 5BRDA 4IKFA 2OTJN 5AQQA 1X9SA 1MA9B 5BN9A 1VQNN 4CJLA 3FZFA 3P5JA 1RBSA 4CEFA 4CZMA 4L3QA 2HHHK 1XHZA 1TUYA 1NOZA 3T3FA 3N4QA 2VG5A 1WBDA 3NH1A 1S1XA 4OGEA 1IBMK 1UA1A 3CFOA 4OLAA 4F4KA 3L2VA 4MO4A 3LDSA 3LP0A 1HPMA 1B92A 3DYAA 4C1NI 4O0JA 1CXQA 4W5QA 3HZ6A 4O8UA 2WC9A 3VQ6A 1T03A 3E9LA 4H8KA 2P9LB 2X74A 3NH2A 4CJTA 1W9HA 3JSMA 1NJYA 3ZETB 4BWMA 2E2QA 1KLNA 4JV5K 4DV5K 2X6NA 3WUHA 1RTDA 1U2VA 3BEXA 4JKDA 1HYSA 3VGKA 3JYTA 1BU6O 1NGDA 1XMQK 5EVZA 3DLKA 1HQEA 3FZLA 4KTZA 4BR7A 4BC4A 3DLEA 3FGUA 3QB0A 1EKEA 2FC0A 4H0XB 2O8CA 3S3MA 3NBPA 1UAXA 4UQGA 1EQYA 1Y97A 1FK9A 2A5XA 4E1MA 3OTOK 1IBKK 4X65K 2V7ZA 2GTDA 5BRHA 3T1HK 3QEXA 3MXIA 4LFCK 1LWEA 4RW9A 3LDPA 1ZBLA 3C94A 4FWMA 3F5TA 5AQOA 4EP5A 2G8FA 1OKJA 3ASMA 1IG8A 4LF5K 1JKHA 3NF9A 2EX3A 3EY1A 4AHVA 3CI5A 3RR8A 1Z26A 1NM1A 2ZQBA 5BREA 1SAZA 4LH4A 4M41A 3SQ1A 4Z4CA 3SUOA 3OJUA 3ISNC 5E41A 4FPBA 4B9TA 1HNIA 3RSEB 4DFPA 4O0IA 1YHQN 1JLQA 1QVFM 1NMDA 4NCAA 4ID1A 3P38A 3OBYA 4J2EA 4JHDA 4ISFA 1HRHA 3KKRA 3E66A 5LY3A 3A5OC 4CHYA 4WF9L 3EL2A 3HP6A 2W6LA 2O8BB 4HUEA 1SL1A 1KSPA 1KCFA 2PBDA 3SPYA 4FPAA 4OGCA 1NNEA 2WBNA 4JK7A 1Z25A 1VQKN 4BVPA 4DSJA 4DS4A 1W0HA 1VSJA 5C42A 2QEXN 3O80A 1TGOA 5BN8A 4HUFA 1I3AA 4IDKA 2O8EA 5C2DA 5FRNA 2NRXA 2FLOA 4B1YB 1JL1A 3OW2M 4QS8A 3J7AP 3P4IA 4IG0A 4DKWA 3Q7BA 5JVGL 1EWQA 1ZYQA 4JN4A 1WNSA 4NLBA 4FLXA 3DXMA 1R59O 2QWPA 3WQUA 2XY8A 3VEZA 4FLTA 3ZT4A 4CIGA 1SKWA 4B9SA 3EE8A 3DXKA 1HNXK 5GAHP 1HYVA 3MWTA 3CC2N 1U47A 2YCHA 3IKMA 3I55N 4HUGA 4E7HA 1ZBUA 3DRRA 4B1WB 1KTQA 1WSEA 3LAKA 2QTDA 3AVKA 1DLOA 1IKXA 3MCAB 3D2FB 3ZLJA 3BF1A 3E9PA 4DHYA 5HLFA 4KH4A 1IKYA 1NGIA 3FE1A 1S9EA 4O55A 2G8IA 3VEYA 4RWTA 5DM6L 4BG8A 4OVLA 1T44A 2FSKA 4DTUA 2A3ZA 2P5GA 2OPSA 3NMUA 3HOTA 1WUAA 2XY6A 1TK5A 2ASPA 3RMAA 3O08A 1RT7A 1YTAA 2ZD1A 3HYFA 4UY8O 2D0BA 4KKOA 3ULEB 3VN5A 5KQDA 3TANA 3TSQA 3CMAN 4ZTFA 5ADXH 5GADP 1RTIA 3S3OA 1RBVA 1LW2A 1KFSA 3OY9A 4PY5A 5GIPA 3CIPA 2VYPA 3CQYA 2BUPA 4ISGA 1IBLK 2E20A 4FJIA 3O1WA 1JLCA 5KGXA 1IG9A 1YJNN 5FLXO 2HHXA 4FWQA 2YI1A 4AHUA 3PY8A 3AA5X 4CF9A 4BG9A 3LWLA 1KRPA 3GL1A 4CBUA 5FPEA 3O4NA 1L3VA 1TL1A 4OPAA 4F8RA 3RR7A 4CJ3A 3SQ2A 3C0BA 5M1KA 4KREA 4BRLA 3CJCA 4K0KK 2F96A 3MWPA 4PQUA 1RDDA 2CH5A 3UKUB 1BISA 5FPMA 4BRFA 1HKCA 3ATVA 3A8YA 4PKGA 1MDUB 4AHSA 2P5OA 2KHOA 5TKYA 3ITHA 4JKEA 3SQ0A 5FDLA 2GX9A 2YHBA 3WEEA 3NH0A 1QSSA 1N32K 4M7YA 3CCEN 3FLCO 4AHRA 4QS7A 4E3SA 1S6PA 4EZ6A 1XUPO 2NRTA 3IRXA 3LDNA 3V6DA 4FZZA 1NGAA 1G15A 1JXBA 2DFEA 1BCMA 2P9KA 1C0GA 4KTWA 4A59A 2JWLA 4CK3A 3THWB 3MEDA 4AM7A 1GOAA 1RDUA 3IFRA 4ICLA 3L2RA 2UXBK 3UB5A 3LALA 3SUPA 2XHBA 4RCHA 3K58A 3O9SA 4WFAL 1NGBA 1H1VA 1GLDG 4IG3A 3EE9A 1G99A 3WT0A 3NGYA 1IKVA 3CJBA 4CJWA 3L3VA 4JYAK 4DV7K 1C0TA 3DRSA 4GY2B 3FZMA 1NGHA 2P1JA 4XH5A 3OS2A 3KLGA 4FZYA 3VF6A 3TU5A 5AR0A 2JWKA 4IFYA 4IFVA 3IMXA 3CFRA 3SUNA 1VSLA 3SLCA 3MXJA 1TKZA 2QM1A 3WNGA 4LC9B 3ZT3A 3CJ9A 1BUPA 3OYEA 1VSMA 5C12A 3S41A 4G9ZA 2BANA 3ALYA 3LWMA 1WSGA 4K8ZA 4OLBA 3QLHA 1QS4A 4FJNA 4E7KA 4EP4A 3QETA 4CZEA 4CEEA 3V1OA 2OPRA 1J5EK 4F2SA 4CW7B 4PUOA 3O1BA 4MLHA 2DFFA 3RMDA 1KAZA 2D1KA 4HTUA 4CGDA 1TAQA 3HPOA 4MDAA 1TKDA 4LH5A 2F9WA 3TAGA 2F9TA 5I9EB 4FLYA 5LJVA 1JJ2M 3BDPA 2KZZA 1HLUA 2J4RA 2KZMA 4CEBA 5E26A 3SPZA 4TSXA 3R8EA 4FWRA 3AVAA 3K57A 4IOCL 2FXUA 5BPMA 3AVJA 2I7NA 3QBWA 4CGGA 4BRQA 2HHVA 3H6EA 3QICA 1WB9A 3A2FA 4BREA 4OPKA 4C8KA 3TTFA 2HHUA 3VF4A 3C7NA 4I6MB 3O6WA 3CXCM 1C1BA 1TV6A 4KH6A 2FBVA 1XMOK 1M1KO 3FR0A 3HVRA 1NWKA 3K5NA 4BDPA 3LM9A 4YHHK 2E5LK 3UKRA 3P1GA 2GWJA 3GOIA 3THYB 4KV8A 1DTTA 3SQ4A 1IH7A 3EKUA 4YFUA 1YVNA 2W6KA 3MDQA 5AQKA 3CCRN 3DLHA 3K9JA 3OYFA 3SJHA 4CJPA 3SZ2A 5BRFA 3HOSA 3HXMA 1T8EA 4B3TK 3V9UA 1RGIA 1RT5A 3LP3A 3KHYA 5SZTA 3F9MA 3VTIA 1J5OA 3K5OA 3QO9A 3TABA 1M90O 2XRIA 4NYNA 3VQQA 5B8HA 1LWCA 1E4GT 2NZTA 4CK1A 4JI8K 4JI1K 3LPUA 4DTOA 1ZBSA 4CGHA 4WFBL 3T1AA 1NJZA 1VSKA 4CEZA 4O44A 3K59A 1E4FT 3H45C 4E7JA 1ATSA 3CPWM 5AQNA 4N56A 3O9QA 2KQ2A 2NRHA 3SK3A 4A2BA 4JKGB 4IO9L 3AO3A 3SMSA 2QWLA 3CG7A 2ZE2A 3CD6N 3SNNA 3G0ZA 4A57A 4X62K 3CPEA 2NNWA 3UIQA 4B08A 1SS6A 4DV0K 1TVRA 3NE6A 4JI6K 2F4VK 4BE0A 4JRQA 4BRIA 1WOQA 1ASWA 5AQUA 2PYLA 3WXLA 1Y64A 4I9QA 3GDQA 2Q31A 3AA2A 3SBGA 1VSEA 4FWNA 2HHSA 2RPIA 4KHQA 3THVA 3DI6A 5BR8K 4B9UA 1C1CA 4NXMK 5JS1A 3OYNA 1VRUA 3VEVA 4E7IA 4C8LA 2YKMA 2HBLA 3KLFA 3PV8A 4ILJA 3HRGA 3W0LA 4B8AB 3SCXA 2OYQA 5HRNA 4CZIA 1U6ZA 3RSEA 1ZBFA 1TYQA 1BGXT 3AVCA 1OH8A 3HSTB 4M3ZA 2GEMA 4DB3A 4DV2K 3O4QA 5C2FA 2KFZA 3T7ZA 2O8BA 4CHNA 3MN7A 2FF6A 5C25A 1OVQA 4MO5A 1BQMA 2HNZA 4GW6A 2ITGA 3THXB 2V7YA 1JLFA 1CLQA 2HF3A 3ZT2A 1J6ZA 3CERA 5KGWA 4FWPA 2NRZA 4RW8A 3CCVN 1XC3A 3MK6A 3QIPA 1VQMN 3H46O 4FJ5A 2Q1NA 3NF8A 1K6YA 3OA9A 4JKBA 3NVKA 3VQ9A 1YF5L 2ZF5O 3PLAA 3CJAA 3MEGA 4M3XA 1RT2A 3LM2A 4M63C 2QI2A 4DG1A 4CZLA 1VQLN 3NCIA 3KD5E 4ELTA 4H0VB 3OYBA 1NU0A 3I8BA 2YJFA 3G10A 1C0UA 1P90A 3WNFA 3LP2A 3MN9A 4O5FA 4RW7A 2VQFK 4CIEA 4J8FA 1S1TA 2BDPA 1NK8A 4Y1DA 4BGAA 3TI0A 5CY4A 4N41A 3VEOA 4JKCA 4JLHA 3D2FA 1C0MA 1ASVA 3HM8A 4FYDA 2YNHA 4EIAA 3WXMB 1X3MA 3LANA 2O4IA 2B4JA 1NOYA 2V52B 1ZXOA 4GMJB 3U3YA 5D3GA 4LFAK 4AH9A 4R5PA 5HBMA 1EWRA 1RCHA 2E1YA 1LV5A 4H5TA 2P9SB 3AVNA 3FZHA 3I33A 5CZ1A 4H03B 3DMJA 1ILYA 1L3TA 2FSNA 1VQ6N 4Z4HA 4K42A 2Q2RA 4KB0A 3L4IA 1RDWX 1N36K 1BI4B 3ULEA 5AQHA 3DOLA 3SV4A 4DSEA 2D5RA 4C8MA 4Z4GA 3NAEA 3M1FA 4LF8K 4Y0WA 1Q82O 5AFUA 3R9PA 3EO3A 1U49A 3VOVA 1LOTB 1TKTA 4FW1A 3CJ7A 3QEPA 4BQLA 4DR5K 4CHOA 4DTRA 4FLZA 4CE9A 3ZSZA 3OS0A 1W2BM 4YY3K 4DR1K 3J81O 3CQXA 3MEEA 4H4MA 4FVUA 4B9NA 4BRNA 1HPZA 5HOOA 3VETA 5HRPA 2HNYA 3ENBA 4WCEL 3FZKA 5HP1A 4N76A 4CJSA 2KW4A 2P9NB 4JRPA 1KVAA 5KQ8A 3BZKA 3AO1A 5M1FA 1D8YA 1HKBA 5M1PA 2RE2A 4GV9A 4YNQA 5KRTA 3TAFA 3QFUA 2DTUA 4BDZA 1RT3A 2D0PA 4ISEA 4DR7K 2X78A 1RFQA 4DTSA 4DFMA 1QVGM 3TSPA 5DM7L 2G8HA 5IT9O 4KHSA 3B6PA 2QWOA 4YOVA 1XC9A 2E1ZA 1WSJA 2VQEK 4CGIA 4KHWA 3CCMN 3RRHA 5LL6Z 4BRDA 3QDKA 2CGJA 4CZJA 4Z4IA 3ZSVA 4YOXA 3QEIA 2YX6A 3D6RA 4AHCA 1VQPN 1JLEA 3AV9A 4X64K 1Q9YA 3THWA 3DOKA 3AA4A 5CE3A 4CD3A 3LL3A 3RMCA 4DTNA 4GKJK 2Y1JA 4FL9A 5CZ2A 2NRWA 4IZ9A 4MLEA 4B1UB 3ZX3A 5J2NA 1BHLA 1KFDA 4DLGA 2X6SA 2KKZA 2A42A 2HB5A 2HHTA 4RW4A 3VENA 3KWGA 3M8QA 1LAWA 1SL2A 4BROA 1NKBA 1A5XA 3NVMA 3V1RA 3JXUA 2ZGZA 1RNHA 3RTVA 4FSVA 3TWHA 1Q8IA 1NK9A 4NXNK 3SYZA 3E9OA 4IWVA 1QTMA 1IJJA 1DEJA 5ELZA 5C15A 3O9RA 4KPYA 1U2VB 2WUSA 1DT9A 2PFUA 4OO1J 4FK2A 3SI6A 2NUBA 5EU7A 1QSYA 3HVTA 3LDQA 4ID5A 1YUWA 3D0PA 4M3UA 1REVA 4B8CA 3KTQA 1RDBA 2HVHA 1VSDA 5DK5A 4IJAA 4O4GA 3WNEA 1A5VA 1OH5A 3O3HA 4KB1A 5CHIA 4IBNA 4CJFA 5AQFA 3CFPA 4B3OA 1X1PA 2VWBA 3ZEUA 4DU3A 2PY5A 3D2EB 2QXFA 1Q81O 1J9AA 4IOAL 4KBOA 3H1VX 3M8RA 1N8RO 3QIOA 4DFKA 2HNDA 4CEOA 4FM2A 4CBWA 3U4LA 5EOYA 3RRGA 3MX2A 1RBRA 3C6TA 5I42A 2WOMA 4E7LA 3G4SN 4KI6A 3ZX2A 4YDUC 4BRHA 3T19A 3ATUA 1SZ2A 2E8AA 4A5AA 3L2QA 1VSIA 2QWQA 1S1UA 3VQ5A 2D0CA 4AHTA 3K5MA 2OPQA 4DV1K 4CHQA 4B9QA 2JGUA 4KHPK 2IVPA 1BIUA 2YNIA 4JI5K 1YTUA 3SAHA 4OKJA 4DR6K 1OH7A 5AZIB 1SKSA 4ILGB 4DUYK 4I6MA 4BRMA 4H0OA 2XY5A 4H0TB 5HROA 3KVGA 3DLGA 1ZC6A 5BPLA 3MAQA 3HT3A 1T05A 2P9IA 1QHTA 4DS5A 1NJWA 1SQKA 3PX0A 3HSCA 4YDUA 3THYA 4DV6K 3AY9A 1EO1A 2RN2A 5KTQA 1C6VA 5K14A 3KIOA 3K5LA 2UUCK 4DF4A 3OJSA 3J80O 2VGMA 2YHXA 2B6AA 5AZJA 3E01A 1VQ5N 1VK0A 3OHRA 1GLLO 4DTPA 1HNVA 3TTDA 1NK5A 5AQSA 1X9MA 2O8EB 2F8SA 2G8UA 5TKWA 2KFNA 1HMVA 3J7ZO 1JCGA 3H1QA 2O8FA 4B3MK 1Z6RA 4RTFD 4K41A 1JLGA 1I39A 5AQPA 4CBXA 1JLAA 2E2NA 2GUIA 3QMLA 1NGEA 3N4PA 5CR4A 4K8XA 4JD2B 4PKIA 1VQ4N 3DXMB 2HHQA 2HHWA 2YHYA 3MN5A 1BIZA 3DXKB 3LDOA 3U8XA 4CGJA 4JKGA 2QWMA 3LAMA 1VSFA 2ZM6K 3DLRA 1BOTO 4FJ9A 4IJNA 2NRRA 3LZIA 2HVIA 3M8SA 2G8VA 4DQQA 3RMBA 4PHTX 3CMEN 2OANA 2OTLN 3CETA 3H3NO 5KI6A 1WLJA 4E89A 1KVBA 3D7EO 1RT4A 1J53A 4KTQA 3ULDA 4A2AA 3DWLA 2Y1IA 4QS9A 4CERA 3MN6A 4FCYA 3A5NC 4DSLA 4M3WA 4EFHA 4ELVA 2W40A 3EKSA 1RBUA 2ZJQL 4ZTJA 4BRCA 4B3RK 1B9FA 1SL0A 4CD1A 3CC4N 4CFCA 1U04A 4FWOA 4C23A 3IDHA 3D45A 4JI7K 1HYZA 4E0DA 4FM0A 3H3OB 5BPNA 4MFBA 4YOUA 4OPJA 2UUAK 1R0AA 3EZWA 4CHZA 5H1SQ 3ZSWA 3QBXA 3OYKA 2ATQA 3AAQA 4BC2A 1GLFO 2EHGA 2B5JA 1MU2A 3NF7A 3SMPA 1L3UA 2KTQA 4FLVA 2LSNA 3ZSQA 1K8KB 3PO4A 3NDKA 2DFHA 2JLEA 1QQCA 3TR8A 3IUCA 3CC7N 3PO5A 2VCPA 4YOYA 4RG8A 5EY4A 3BGRA 1NGGA 4J2BA 4JAXA 1ATNA 3RVCA 2UXDK 5C0YA 1ASUA 4CESA 3T1YK 3QERA 3K0SA 4IXCA 1RT1A 2F8TA 4LF7K 4IO8A 4E1JA 5A2QO 3OYJA 1X9JA 2QWRA 2IIRA 2HBJA 4W5TA 5LMUK 4JI0K 4FJLA 3SAFA 4DR4K 4BACA 2IVNA 1NGCA 3ENOA 4FWKA 3WEEB 3E1YA 4HVJA 2A41A 2P9LA 1BQNA
chains in the Genus database with same CATH topology
3WQUA 2E2PA 2P9UB 4YOTA 3VEZA 3EE8A 1YITN 3DXKA 3ZETA 3MN9A 4WFNL 4O5FA 5GAHP 1GLAG 3DAWA 3MWTA 2YCHA 4IDHA 3IKMA 3CC2N 4J8FA 3I55N 3DLLL 2P9KB 5ADXA 2GUPA 4BGAA 4B1WB 2Q0RA 3VEOA 4JKCA 3D2FA 5AQMA 1HJOA 3EN9A 2HOEA 3VF2A 3HM8A 4GV3A 2QTDA 3C65A 5AQJA 5LJWA 1VQON 4WQ4C 1V4TA 1K9MO 4EIAA 3C6HA 4BR4A 3MCAB 3D2FB 3WXMB 1X3MA 4FWLA 3BF1A 3E9PA 4DHYA 4Z94A 2P9PA 4KH4A 2V52B 1ZXOA 1NGIA 3FE1A 3VEYA 4RWTA 5HL7L 5DM6L 4BG8A 2P9SA 1T44A 2FSKA 2P9PB 2E1YA 4H5TA 2CGKA 2P9SB 2A3ZA 3FZHA 3I33A 5JMVA 1Q86O 4BY9C 4H03B 1ILYA 3NMUA 2CGLA 3HOTA 2FSNA 1VQ6N 2QA4N 5AQTA 4K42A 2Q2RA 4F9OA 1WUAA 2DPNA 2A40A 3L4IA 5JLHA 2ASPA 1RDWX 4PL8A 3VESA 3O08A 3WXJA 3ULEA 4EAHD 3PIPL 5AQHA 3WQTA 1K8AO 3A5MC 4BR5A 1CZAN 4UY8O 1VQ8N 3O8MA 2UYTA 3ULEB 5KQDA 3Q7CA 4XEIA 5M1NA 3TSQA 2QWNA 3B8AX 3M1FA 4FO0A 4WQ4A 4BR2A 4H0YB 3G6EN 3CMAN 5F1XA 2VGNA 4Y0WA 3AGRA 1KD1O 2RHKA 1LCUA 5ADXH 1BO5O 5AFUA 3MMVA 5GADP 1Q82O 3R9PA 3EO3A 4O8KA 3VOVA 3CCUN 1LOTB 2D0OA 5GIPA 1MWKA 4JKFA 3CIPA 2VYPA 4GVEA 1YJWN 3CQYA 2BUPA 3CJ7A 4ISGA 5MLCQ 3WXKA 2HMPA 4JKAA 4BQLA 3HI0A 4K43A 2E20A 3U9DA 3ZEUB 3O1WA 3DXMA 3GG4A 2ASOA 1YJNN 3R3LA 1W2BM 3SBTA 5KPTA 4FWQA 2YI1A 1GLJO 4MDBA 3CQXA 4BG9A 4FVUA 1NGJA 4BRNA 3M3ZA 5F0XA 1VAZA 3GL1A 3VETA 5HOOA 4CBUA 2E88A 5FPEA 3O5BA 3ENBA 3J8AA 4WCEL 4OPAA 3FZKA 3OBWA 3MCPA 3A0IX 4FWSA 2P9NB 4NB4A 5KQ8A 3O9UA 5GAGP 1DGKN 3C0BA 2A6AA 5M1FA 4BRLA 3CJCA 3P31A 4H5WA 5M1KA 1HKBA 1VQ9N 2GWKA 5M1PA 2V51B 2RE2A 4GV9A 3MWPA 3JS6A 1YJ9N 5AQXA 2CH5A 4AM6A 3QFUA 3VPZA 4XH4A 3UKUB 5FPMA 4BRFA 1HKCA 3ATVA 3A8YA 4NO7A 3CF5L 1QQMA 1T6DA 5FPNA 2IVOA 2D0PA 4ISEA 4PKGA 4BR0A 1RFQA 4A62A 1MDUB 1QVGM 1BA0A 2Q0UA 3TSPA 3VMFB 2KHOA 5DM7L 1VQ7N 5TKYA 4JKEA 3ENHA 5AQYA 3SAGA 2GX9A 2QWOA 3WEEA 4M7YA 4DQ8A 4YOVA 3CCEN 3FLCO 2P9IB 4QS7A 2E1ZA 1QZ6A 3CCMN 3U9ZA 1XUPO 5EX5A 2NRTA 4BC3A 4BRDA 5KPRA 3QDKA 2CGJA 4CZJA 4DCHA 3LDNA 4BC5A 4YOXA 2YX6A 2E2OA 3UKRB 3D6RA 1C0FA 2Q36A 1VQPN 4C1NK 1NGAA 5GINA 2P9KA 4A59A 5CE3A 1C0GA 4U7BA 2JWLA 3TPQA 4CD3A 3KK7A 4BRPA 5AQGA 2WFBA 4AM7A 1KC8O 1GLCG 3LL3A 5M1QA 3C6AA 2HBKA 5AZJB 3R1XA 4FL9A 5AQVA 1RDUA 2NRWA 3IFRA 4IZ9A 4MLEA 1YAGA 3AARA 4B1UB 3UB5A 2ZWHA 4H5VA 3ZX3A 5AQWA 4RCHA 2ASMA 3FFKB 3O9SA 5M1OA 1HUXA 1NGBA 1H1VA 4WFAL 1GLDG 3EE9A 2KKZA 1G99A 2A42A 3WT0A 2W41A 3I56N 1T6CA 1KAYA 3M5RA 3CJBA 2D4WA 1GLEG 4A5BA 3VENA 3KWGA 3BF3A 4GY2B 3CCQN 3O9TA 1BDGA 4A61A 4BROA 3NVMA 2F7TA 3FZMA 1NGHA 2FSJA 2ZGZA 2ZGYA 3JXUA 1V4SA 4FSVA 4XH5A 1JCFA 4NLCA 3L6QA 3VF6A 1S3XA 1ESVA 3E9OA 1BG3A 3TU5A 5AR0A 4IWVA 3W3DA 1IJJA 2JWKA 4EHUA 1DEJA 5ELZA 5C15A 3IMXA 4H5NA 4BVOA 1Q7YO 3O9RA 4FOEA 3SLCA 3KZBA 2QM1A 1U2VB 2WUSA 4H5RA 1DT9A 2PFUA 4LC9B 4OO1J 3CJ9A 1BUPA 4HWIA 3LDQA 1YUWA 4M7XA 5C12A 2ITMA 3S41A 3L0QA 5JVHL 4G9ZA 1W97L 4FOIA 4B1VA 4IOXA 4IJAA 1KXPA 3CCSN 1JCEA 3D2EA 4CZHA 3AAPA 5JLFA 4U67L 5CHIA 4B1ZA 1S22A 5AQIA 2I7PA 5AQFA 2H3GX 2VWBA 1TUUA 2AA4A 3ZEUA 4CZEA 3D2EB 1Q81O 1Z05A 3ID8A 4IOAL 1QQOA 4IEIA 4KBOA 3F2KA 3H1VX 3O1BA 1N8RO 3R6MA 4HTLA 2HF4A 4MLHA 3CHWA 3U4LA 5EOYA 4BQZA 4CBWA 1O13A 5F2RA 1KAZA 2D1KA 3MX2A 1BWFO 3PIOL 4EHTA 1T3VA 4MDAA 3G4SN 4IFEA 5KPZA 2F9WA 3ZX2A 3ID6A 4YDUC 2F9TA 4BRHA 5I9EB 3VGLA 3A5LC 2P9NA 1SZ2A 2E8AA 3ATUA 4A5AA 5LJVA 4WQ5C 1HLUA 1JJ2M 2QWQA 2J4RA 1GLBG 2CH6A 5E26A 1DKGD 4YOWA 3R8EA 4B9QA 4CZFA 4K25A 4FWRA 2IVPA 2AP1A 5AZIA 3TTCA 3UKUA 4IOCL 3SAHA 2FXUA 5BPMA 5E84A 4JK8A 2I7NA 3QBWA 5AZIB 4BRQA 2GELA 1P8ZA 1TYQB 1K73O 4ILGB 3H6EA 4I6MA 3TSUA 4BRMA 3L4QA 3QICA 4H0OA 5GAEP 4H0TB 4BREA 1NJIO 3UE5A 3KVGA 3TTFA 3ZX0A 3VF4A 5AFUH 4XH1A 1ZC6A 3C7NA 4I6MB 3O6WA 5BPLA 1MWMA 4YORA 3CXCM 2ZJPL 3BUZB 2P9IA 3WXIA 4KH6A 3M6GA 1M1KO 3FR0A 3HTVA 3C7NB 1X3NA 1SQKA 4BRKA 2YHWA 4WYBA 3HSCA 4JNEA 4YDUA 1NWKA 3AY9A 3LM9A 1EO1A 1Q18A 3UKRA 1HKGA 2GWJA 2QW9A 2EWSA 4WQ5A 3BP8A 1QHAA 2NRVA 3GOIA 5BRDA 2OTJN 3DJCA 5AQQA 1MA9B 3GE1A 3HBTA 5BN9A 1VQNN 2VGMA 2YHXA 3FZFA 5BR9A 4CZMA 3EKUA 1YVNA 5AZJA 2PAVA 3MDQA 4L3QA 1VQ5N 5AQKA 1TUYA 5FPDA 3KWIA 3CCRN 3OHRA 1GLLO 3K9JA 3N4QA 3CCLN 3SJHA 3TTDA 5AQSA 5BRFA 3HOSA 5TKWA 1RGIA 3J7ZO 3KHYA 3F9MA 1JCGA 3H1QA 4MO4A 1ATRA 1HPMA 3VTIA 1Z6RA 2HSTA 4RTFD 4C1NI 3HZ6A 4GNIA 4K41A 4JD2A 4O8UA 1M90O 2WC9A 3MX5A 5AQPA 4B1XB 4CBXA 5AQRA 2E2NA 3QMLA 1NGEA 5B8HA 3E9LA 1QQNA 1QZ5A 2P9LB 1E4GT 3N4PA 4JD2B 4PKIA 2NZTA 5CR4A 1VQ4N 3DXMB 4JEPA 1HX1A 1ZBSA 2YHYA 3MN5A 1OVYA 3DXKB 4WFBL 3ZETB 3LDOA 1YXQA 2QXLA 3U8XA 2E2QA 1S72N 4R79A 4JKGA 2QWMA 3CJ1A 1E4FT 3H45C 3T69A 3WUHA 1ATSA 3CPWM 1U2VA 1BOTO 3BEXA 4JKDA 4IJNA 1KAXA 3O9QA 5AQNA 3VGKA 4A2BA 2NRHA 2NRRA 3SK3A 1BU6O 4JKGB 4IO9L 1NGDA 3SMSA 2QWLA 5EVZA 2BTFA 3CD6N 4A57A 5AQZA 4BR9A 1NBWA 5GIOA 3FZLA 3CPEA 2NNWA 4BR7A 4PHTX 1SS6A 4BC4A 3FGUA 3QB0A 3CMEN 2OANA 2OTLN 3CETA 4BGBA 4H0XB 3H3NO 4BRIA 1WOQA 3D7EO 3QFPA 5AQUA 2FF3B 1NLVA 3VGMA 1EQYA 3WXLA 4A2AA 1Y64A 3DWLA 3ZYYX 3GDQA 2A5XA 2Q31A 4QS9A 3MN6A 3A5NC 3P39A 3SBGA 2V7ZA 4FWNA 2GTDA 4EFHA 5BRHA 4JKHA 2W40A 3EKSA 2ZJQL 3LDPA 1YI2N 4BRCA 4FWMA 4H0PA 3F5TA 5AQOA 3LDLA 4CD1A 1OKJA 1IG8A 3CC4N 4PL7A 5AQLA 4FWOA 3VEVA 4C23A 3IDHA 2HBLA 3CI5A 1NM1A 5BREA 3H3OB 4ILJA 3HRGA 4YOUA 1SAZA 3W0LA 5BPNA 3CCJN 3K9KA 2YJEA 4JK9A 2NLXA 3EZWA 1BA1A 4CZIA 5H1SQ 4GV6A 3QBXA 1U6ZA 2KLAA 3RSEA 4BRAA 3AAQA 4BC2A 4FPBA 1TYQA 1GLFO 4PKHA 3RSEB 2GEMA 3SMPA 4DB3A 1YHQN 1K8KA 1NMDA 1QVFM 2ZJRL 3GBTA 4IEEA 5C2FA 3P38A 3OBYA 3T7ZA 4JHDA 3MN7A 4ISFA 2FF6A 3E66A 5LY3A 3A5OC 1K8KB 5JICA 4WF9L 1XQSC 3EL2A 3G25A 4MO5A 4JHDB 1NGFA 2V7YA 2PBDA 3IUCA 5C10A 3G71N 4FPAA 3CC7N 2HF3A 2VCPA 1J6ZA 4YOYA 2WBNA 3CERA 1D4XA 5EY4A 4FWPA 4CZGA 4JK7A 1VQKN 1NGGA 2NRZA 4JAXA 4OPHA 4BVPA 1ATNA 3RVCA 3VERA 3VTHA 3O4WA 4CJ7A 3CCVN 1XC3A 2BH1A 3MK6A 2QEXN 5C0YA 3O80A 1VQMN 3H46O 2Q1NA 5BN8A 3OA9A 4JKBA 3NVKA 4IXCA 4BRGA 1YF5L 2ZF5O 3PLAA 4CZKA 3AGKA 3CJAA 3VEWA 4CI6A 4IO8A 5C2DA 1YIJN 4E1JA 2NRXA 3LM2A 4M63C 2QI2A 4ILHA 1KQSM 2FLOA 1X9JA 2QWRA 2IIRA 2HBJA 4KH5A 4B1YB 4CZLA 1VQLN 3SAFA 3OW2M 2IVNA 1NGCA 2HBMA 3ENOA 4QS8A 4H0VB 3P4IA 3I8BA 4AF1A 2YJFA 2Q97A 4DKWA 4FWKA 3Q7BA 3WEEB 2P9UA 3E1YA 2A41A 5JVGL 2P9LA 1P90A 4JN4A 4NLBA 5EXWA 3VEXA 1R59O 2QWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WQU A;  2E2P A;  2P9U B;  3VEZ A;  3DXK A;  3ZET A;  3MN9 A;  4O5F A;  1GLA G;  3DAW A;  2YCH A;  4J8F A;  2P9K B;  5ADX A;  2GUP A;  4BGA A;  4B1W B;  2Q0R A;  3VEO A;  3D2F A;  5AQM A;  1HJO A;  3EN9 A;  2HOE A;  3VF2 A;  3HM8 A;  5AQJ A;  5LJW A;  4WQ4 C;  1V4T A;  4EIA A;  4BR4 A;  3D2F B;  1X3M A;  4FWL A;  3BF1 A;  4DHY A;  4Z94 A;  2P9P A;  2V52 B;  1ZXO A;  1NGI A;  3FE1 A;  3VEY A;  4RWT A;  4BG8 A;  2P9S A;  1T44 A;  2FSK A;  2P9P B;  2E1Y A;  4H5T A;  2CGK A;  2P9S B;  2A3Z A;  3FZH A;  3I33 A;  5JMV A;  4H03 B;  2CGL A;  2FSN A;  5AQT A;  4K42 A;  2Q2R A;  4F9O A;  1WUA A;  2DPN A;  2A40 A;  3L4I A;  5JLH A;  2ASP A;  1RDW X;  4PL8 A;  3VES A;  3O08 A;  3WXJ A;  3ULE A;  4EAH D;  5AQH A;  3WQT A;  3A5M C;  4BR5 A;  1CZA N;  3O8M A;  2UYT A;  3ULE B;  5KQD A;  4XEI A;  2QWN A;  3B8A X;  3M1F A;  4FO0 A;  4WQ4 A;  4BR2 A;  4H0Y B;  5F1X A;  4Y0W A;  5ADX H;  1LCU A;  5AFU A;  1BO5 O;  3MMV A;  3R9P A;  3EO3 A;  4O8K A;  3VOV A;  1LOT B;  2D0O A;  1MWK A;  3CIP A;  2VYP A;  3CQY A;  2BUP A;  3CJ7 A;  4ISG A;  3WXK A;  2HMP A;  4BQL A;  3HI0 A;  4K43 A;  2E20 A;  3U9D A;  3ZEU B;  3O1W A;  3GG4 A;  2ASO A;  5KPT A;  4FWQ A;  2YI1 A;  1GLJ O;  3CQX A;  4BG9 A;  1NGJ A;  4BRN A;  3M3Z A;  5F0X A;  3GL1 A;  3VET A;  4CBU A;  2E88 A;  5FPE A;  3O5B A;  3J8A A;  3FZK A;  3MCP A;  3A0I X;  4FWS A;  2P9N B;  4NB4 A;  5KQ8 A;  1DGK N;  3C0B A;  2A6A A;  4BRL A;  3CJC A;  4H5W A;  1HKB A;  2GWK A;  2V51 B;  3JS6 A;  5AQX A;  2CH5 A;  4AM6 A;  3QFU A;  3VPZ A;  4XH4 A;  3UKU B;  5FPM A;  4BRF A;  1HKC A;  3ATV A;  3A8Y A;  4NO7 A;  1QQM A;  1T6D A;  5FPN A;  2IVO A;  2D0P A;  4ISE A;  4PKG A;  4BR0 A;  1RFQ A;  4A62 A;  1MDU B;  1BA0 A;  2Q0U A;  2KHO A;  5TKY A;  3ENH A;  5AQY A;  2QWO A;  3WEE A;  4M7Y A;  4DQ8 A;  3FLC O;  2P9I B;  4QS7 A;  2E1Z A;  1QZ6 A;  3U9Z A;  1XUP O;  5EX5 A;  4BC3 A;  4BRD A;  5KPR A;  3QDK A;  2CGJ A;  4CZJ A;  4DCH A;  3LDN A;  4BC5 A;  2E2O A;  3UKR B;  1C0F A;  2Q36 A;  1NGA A;  2P9K A;  5CE3 A;  1C0G A;  3TPQ A;  4CD3 A;  4BRP A;  5AQG A;  4AM7 A;  1GLC G;  3LL3 A;  5AZJ B;  5AQV A;  4FL9 A;  3IFR A;  4IZ9 A;  4MLE A;  1YAG A;  3AAR A;  4B1U B;  3UB5 A;  2ZWH A;  4H5V A;  3ZX3 A;  5AQW A;  4RCH A;  2ASM A;  3FFK B;  1HUX A;  1NGB A;  1H1V A;  1GLD G;  1G99 A;  2A42 A;  3WT0 A;  2W41 A;  1T6C A;  1KAY A;  3CJB A;  2D4W A;  1GLE G;  3VEN A;  3BF3 A;  4GY2 B;  4BRO A;  1BDG A;  4A61 A;  3FZM A;  3JXU A;  1NGH A;  2FSJ A;  2ZGZ A;  2ZGY A;  1V4S A;  4FSV A;  4XH5 A;  1JCF A;  3L6Q A;  3VF6 A;  1S3X A;  1ESV A;  1BG3 A;  3TU5 A;  5AR0 A;  4IWV A;  3W3D A;  1IJJ A;  4EHU A;  1DEJ A;  5ELZ A;  3IMX A;  4H5N A;  4BVO A;  4FOE A;  3SLC A;  3KZB A;  2QM1 A;  1U2V B;  2WUS A;  1R59 O;  4H5R A;  4LC9 B;  3CJ9 A;  1BUP A;  4HWI A;  3LDQ A;  1YUW A;  4M7X A;  2ITM A;  3S41 A;  3L0Q A;  4FOI A;  4B1V A;  4IJA A;  1KXP A;  1JCE A;  3D2E A;  4CZH A;  3AAP A;  5JLF A;  4B1Z A;  1S22 A;  5AQI A;  2I7P A;  5AQF A;  2H3G X;  2VWB A;  1TUU A;  2AA4 A;  3ZEU A;  4CZE A;  3D2E B;  1Z05 A;  3ID8 A;  1QQO A;  4KBO A;  3H1V X;  3O1B A;  3R6M A;  4HTL A;  2HF4 A;  4MLH A;  3CHW A;  3U4L A;  5EOY A;  4BQZ A;  4CBW A;  5F2R A;  1KAZ A;  2D1K A;  1BWF O;  4EHT A;  5KPZ A;  2F9W A;  3ZX2 A;  4YDU C;  2F9T A;  4BRH A;  5I9E B;  3VGL A;  3A5L C;  2P9N A;  1SZ2 A;  2E8A A;  3ATU A;  5LJV A;  4WQ5 C;  1HLU A;  2QWQ A;  2J4R A;  1GLB G;  2CH6 A;  5E26 A;  1DKG D;  3R8E A;  4B9Q A;  4CZF A;  4K25 A;  4FWR A;  2IVP A;  2AP1 A;  5AZI A;  3UKU A;  2FXU A;  5BPM A;  5E84 A;  2I7N A;  3QBW A;  5AZI B;  4BRQ A;  2GEL A;  1P8Z A;  1TYQ B;  3H6E A;  4I6M A;  4BRM A;  4H0O A;  3QIC A;  4H0T B;  4BRE A;  3UE5 A;  3KVG A;  3ZX0 A;  3VF4 A;  5AFU H;  4XH1 A;  1ZC6 A;  3C7N A;  4I6M B;  3O6W A;  5BPL A;  1MWM A;  3BUZ B;  2P9I A;  3WXI A;  3M6G A;  3FR0 A;  3HTV A;  3C7N B;  1X3N A;  1SQK A;  4BRK A;  2YHW A;  4WYB A;  3HSC A;  4JNE A;  4YDU A;  1NWK A;  3AY9 A;  3LM9 A;  1Q18 A;  3UKR A;  1HKG A;  2GWJ A;  2QW9 A;  2EWS A;  4WQ5 A;  3BP8 A;  1QHA A;  3GOI A;  5BRD A;  3DJC A;  5AQQ A;  1MA9 B;  3GE1 A;  3HBT A;  5BN9 A;  2YHX A;  3FZF A;  5BR9 A;  4CZM A;  3EKU A;  1YVN A;  5AZJ A;  2PAV A;  3MDQ A;  4L3Q A;  5AQK A;  1TUY A;  5FPD A;  3OHR A;  1GLL O;  3SJH A;  5AQS A;  5BRF A;  1RGI A;  3KHY A;  3F9M A;  1JCG A;  3H1Q A;  4MO4 A;  1ATR A;  1HPM A;  1Z6R A;  4RTF D;  3HZ6 A;  4GNI A;  4K41 A;  4JD2 A;  4B1X B;  5AQP A;  4CBX A;  5AQR A;  2E2N A;  3QML A;  1NGE A;  5B8H A;  1QQN A;  1QZ5 A;  2P9L B;  1E4G T;  4JD2 B;  4PKI A;  2NZT A;  3DXM B;  1HX1 A;  1ZBS A;  2YHY A;  3MN5 A;  3DXK B;  3ZET B;  3LDO A;  1YXQ A;  2QXL A;  3U8X A;  2E2Q A;  3CJ1 A;  2QWM A;  1E4F T;  3H45 C;  3WUH A;  1ATS A;  1U2V A;  1BOT O;  3BEX A;  5AQN A;  4IJN A;  1KAX A;  3VGK A;  4A2B A;  2NRH A;  3SK3 A;  1BU6 O;  1NGD A;  3SMS A;  2QWL A;  5EVZ A;  2BTF A;  5AQZ A;  4BR9 A;  1NBW A;  3FZL A;  4BR7 A;  4BC4 A;  3FGU A;  3QB0 A;  2OAN A;  3CET A;  4BGB A;  4H0X B;  3H3N O;  4BRI A;  1WOQ A;  3D7E O;  3QFP A;  5AQU A;  2FF3 B;  1NLV A;  3VGM A;  1EQY A;  3WXL A;  4A2A A;  1Y64 A;  3DWL A;  3GDQ A;  2A5X A;  2Q31 A;  4QS9 A;  3MN6 A;  3A5N C;  2V7Z A;  4FWN A;  2GTD A;  4EFH A;  5BRH A;  2W40 A;  3EKS A;  3LDP A;  4BRC A;  4FWM A;  4H0P A;  5AQO A;  3LDL A;  4CD1 A;  1OKJ A;  1IG8 A;  4PL7 A;  5AQL A;  4FWO A;  3VEV A;  4C23 A;  3IDH A;  3CI5 A;  1NM1 A;  5BRE A;  3H3O B;  5BPN A;  3W0L A;  1SAZ A;  2YJE A;  2NLX A;  3EZW A;  1BA1 A;  4CZI A;  3QBX A;  1U6Z A;  3RSE A;  4BRA A;  3AAQ A;  4BC2 A;  4FPB A;  1TYQ A;  1GLF O;  4PKH A;  3RSE B;  2GEM A;  3SMP A;  4DB3 A;  1K8K A;  1NMD A;  3GBT A;  4JHD A;  3MN7 A;  4ISF A;  2FF6 A;  5LY3 A;  3A5O C;  1K8K B;  5JIC A;  1XQS C;  3EL2 A;  3G25 A;  4MO5 A;  4JHD B;  1NGF A;  2V7Y A;  2PBD A;  3IUC A;  4FPA A;  2HF3 A;  2VCP A;  1J6Z A;  3CER A;  1D4X A;  5EY4 A;  4FWP A;  4CZG A;  1NGG A;  4JAX A;  4BVP A;  1ATN A;  3VER A;  4CJ7 A;  3O4W A;  1XC3 A;  3MK6 A;  3O80 A;  3H46 O;  2Q1N A;  5BN8 A;  4IXC A;  4BRG A;  2ZF5 O;  4CZK A;  3CJA A;  3VEW A;  4CI6 A;  4IO8 A;  4E1J A;  3LM2 A;  4M63 C;  2FLO A;  1X9J A;  2QWR A;  2IIR A;  4CZL A;  4B1Y B;  2IVN A;  3ENO A;  1NGC A;  4QS8 A;  4H0V B;  3P4I A;  3I8B A;  2YJF A;  2Q97 A;  4FWK A;  3WEE B;  2P9U A;  2A41 A;  2P9L A;  4JN4 A;  5EXW A;  3VEX A;  3DXM A;  2QWP A; 
#chains in the Genus database with same CATH topology
 1JLB A;  2E2P A;  2P9U B;  1EP4 A;  4BWJ A;  3ZET A;  1IO2 A;  4Y1C A;  3DLL L;  2P9K B;  2PZS A;  1TAU A;  4DSI A;  3EEQ A;  2Q0R A;  3SV3 A;  3AVI A;  4LSN A;  4DSK A;  3EN9 A;  2O8D B;  3VF2 A;  3V9S A;  4I2Q A;  5LJW A;  3QEV A;  1VQO N;  4WQ4 C;  1V4T A;  1K9M O;  3L2W A;  3C6H A;  5FRO A;  1A5W A;  5C24 A;  4HCB A;  4KHU A;  4JI4 K;  2P9S A;  2P9P B;  1TKX A;  1S6Q A;  1HR0 K;  1RDC A;  1RT6 A;  2CGK A;  1Q86 O;  2UU9 K;  4PWD A;  3HK2 A;  3IS9 A;  5AQT A;  2QA4 N;  4F9O A;  2DPN A;  3VQP A;  3OYC A;  3AO5 A;  3VES A;  4PL8 A;  3IG1 A;  3WXJ A;  4EAH D;  3PIP L;  4FJX A;  3WQT A;  1S1W A;  1CZA N;  3O8M A;  1S9G A;  4CK2 A;  4XEI A;  5M1N A;  2QWN A;  3B8A X;  4BR2 A;  4WQ4 A;  5F1X A;  1KD1 O;  4W5N A;  1LCU A;  1NK6 A;  1BO5 O;  1HJR A;  3MMV A;  3QNO A;  1U48 A;  3KJV A;  3S9H A;  1S1V A;  1MWK A;  1F21 A;  2Z1G A;  1SV5 A;  3WXK A;  2HMP A;  4K43 A;  1BL3 A;  4KAZ A;  3GG4 A;  2ASO A;  4CIF A;  5CYM A;  1GLJ O;  4DV4 K;  2HW3 A;  1NGJ A;  1VAZ A;  4Z4E A;  1L5U A;  3OYH A;  4CJE A;  2E88 A;  3EZ5 A;  3J8A A;  1BCO A;  2A1R A;  4CHP A;  4LF9 K;  3ZT1 A;  2RKI A;  3A0I X;  4CEC A;  4E1N A;  4XIU A;  4FWS A;  4NB4 A;  3O9U A;  5GAG P;  1DGK N;  3ZSO A;  2A6A A;  4LD0 A;  3PSI A;  1VQ9 N;  2V51 B;  3VQB A;  2G8K A;  5AQX A;  2QKB A;  4AM6 A;  3VPZ A;  1W7A A;  4XH4 A;  3HP9 A;  1LWF A;  4BR0 A;  4A62 A;  4JS5 A;  3VMF B;  1FKP A;  4CF0 A;  1VQ7 N;  3I8D A;  3O3G A;  3ENH A;  4FJ8 A;  3TAE A;  1NJX A;  4DQ8 A;  4CJU A;  1JL2 A;  1D5A A;  3U9Z A;  4BC3 A;  5EX5 A;  5KPR A;  3KLE A;  1SKR A;  4BC5 A;  1J54 A;  3IAY A;  1ZBI A;  1DTQ A;  3UKR B;  2Q36 A;  5GIN A;  4CJ4 A;  3L2U A;  4B9L A;  1GOB A;  3TPQ A;  3KK7 A;  4BRP A;  1KC8 O;  3ZSX A;  1GLC G;  4B3S K;  1S5J A;  5M1Q A;  3NFA A;  3R1X A;  5AQV A;  1N33 K;  3AAR A;  4H5V A;  2OA8 A;  4DWI A;  5AQW A;  3NGI A;  2ASM A;  5M1O A;  1HUX A;  4F2R A;  2W41 A;  1KAY A;  3BZC A;  3M5R A;  1U45 A;  4A5B A;  4EZ9 A;  1KVC A;  3VQ8 A;  2F7T A;  2FSJ A;  2ZGY A;  4QOZ B;  4OKE A;  2I5J A;  4M45 A;  1ESV A;  3TAR A;  1BG3 A;  2D0A A;  2IDO A;  1E3M A;  4EHU A;  4BVO A;  4FM1 A;  4LY7 A;  4FOE A;  4KRF A;  3VQE A;  3V1Q A;  4H5R A;  4DUZ K;  4RW6 A;  4Z0U A;  3WNH A;  4M7X A;  1TL3 A;  5JVH L;  1HNW K;  1KXP A;  3D2E A;  4CZH A;  2WON A;  5AQI A;  3L8B A;  2I7P A;  1TUU A;  2AA4 A;  2BE2 A;  1NG9 A;  3AVH A;  1QQO A;  1FJG K;  3ZCM A;  4HTL A;  2HF4 A;  3CHW A;  5F2R A;  4PA1 A;  1BWF O;  3PIO L;  4LSL A;  1T3V A;  4CF1 A;  3MEC A;  3V81 A;  3ID6 A;  3M8P A;  3P83 D;  4CJ5 A;  4WQ5 C;  1GLB G;  3NGZ A;  3CYM A;  1CZ9 A;  4YOW A;  1Q9X A;  3AVG A;  1QE1 A;  4K25 A;  5AZI A;  3UKU A;  2FBT A;  4DQI A;  3V4I A;  4ZHR A;  2P51 A;  3F73 A;  1OH6 A;  3AO2 A;  1P8Z A;  1HQU A;  1TYQ B;  1TK8 A;  1K73 O;  3TSU A;  1NMN A;  3L4Q A;  2UUB K;  5GAE P;  1NJI O;  3ZX0 A;  2R7Y A;  1FW6 A;  4BE1 A;  2IGI A;  2ZJP L;  4QCL A;  3M6G A;  3PUF A;  4BRK A;  2YHW A;  4CF2 A;  4WYB A;  1WN7 A;  4JNE A;  1CXU A;  1Q18 A;  4BE2 A;  3OYI A;  2QW9 A;  2EWS A;  4WQ5 A;  3BP8 A;  2NRV A;  3DJC A;  1XWL A;  3GE1 A;  3HBT A;  4FXD A;  5BR9 A;  1D9D A;  4FLW A;  1YVU A;  4DLE A;  2PAV A;  5FPD A;  4FVM A;  3DRP A;  3KWI A;  3OVN A;  3CCL N;  1NKC A;  5HRS A;  4DR3 K;  4FJH A;  4F3T A;  2ETJ A;  3HPH A;  1ATR A;  2HST A;  4DFJ A;  3S3N A;  4GNI A;  4JD2 A;  4B1X B;  3MX5 A;  3VA0 A;  5AQR A;  3OYL A;  1QQN A;  1QZ5 A;  1RTH A;  2E6M A;  4KFB A;  4JEP A;  1HX1 A;  2IS3 A;  3NF6 A;  3V9W A;  1OVY A;  1YXQ A;  2QXL A;  5I3U A;  4JI3 K;  2VWK A;  1S72 N;  4L8R B;  4R79 A;  4CFA A;  3CJ1 A;  3T69 A;  3F9K A;  4WE1 A;  1KAX A;  3CQ8 A;  1EET A;  2IOC A;  2BTF A;  3V9X A;  4M3T A;  4AQY K;  5AQZ A;  4BR9 A;  1NBW A;  5GIO A;  3U6F A;  1C1A A;  1VHX A;  4BGB A;  3CM5 A;  2FBX A;  3HO1 A;  3QFP A;  4LF4 K;  2FF3 B;  1NLV A;  3VGM A;  2BGG A;  2O8C B;  3C6U A;  3ZYY X;  4Z4F A;  3P39 A;  4HCC A;  3OYM A;  3HPG A;  4DSF A;  1WSF A;  4JKH A;  3KK3 A;  4DQR A;  2YNG A;  4G1Q A;  1YI2 N;  4H0P A;  1T7P A;  3I0R A;  3LDL A;  4CJQ A;  4PL7 A;  5AQL A;  4X66 K;  1QSL A;  2YKN A;  3SJJ A;  3AVB A;  3CCJ N;  3K9K A;  2YJE A;  4JK9 A;  2NLX A;  1BA1 A;  4Q5V A;  1NKE A;  4GV6 A;  4DQS A;  2KLA A;  4FJ7 A;  4BRA A;  4PKH A;  1K8K A;  2ZJR L;  3GBT A;  4IEE A;  3K2P A;  3DM2 A;  4E19 A;  1EXQ A;  2YNF A;  5JIC A;  1XQS C;  3G25 A;  4FK4 A;  4JHD B;  1NGF A;  4N5S A;  1GOC A;  1TK0 A;  4C8N A;  5C10 A;  3G71 N;  4M42 A;  4DU4 A;  3AA3 A;  1D4X A;  1XI1 A;  4CZG A;  1HNZ K;  4OPH A;  2OZM A;  3VER A;  3VTH A;  4CJ7 A;  3O4W A;  2BH1 A;  1RTJ A;  4OJR A;  4BRG A;  3SUQ A;  4KO0 A;  4CZK A;  3AGK A;  3VEW A;  4CI6 A;  4DU1 A;  1YIJ N;  4DQP A;  4FZX C;  4ILH A;  1KQS M;  1WSI A;  4KH5 A;  4HHT A;  2OZS A;  4Q0B A;  2AJQ A;  3H08 A;  4M3Y A;  4KHN A;  2HBM A;  5CYQ A;  4CCH A;  3BY5 A;  4AF1 A;  2Q97 A;  5J2P A;  2P9U A;  3LP1 A;  4FK0 A;  4GKK K;  3ZSY A;  5EXW A;  3VEX A;  4W5O A;  2UXC K;  4YOT A;  5JS2 A;  1B9D A;  3VQ7 A;  1YIT N;  4WFN L;  1GLA G;  3DAW A;  4IDH A;  1SUQ A;  3L3U A;  2O8D A;  2QKK A;  5ADX A;  2GUP A;  1RBT A;  3KKS A;  2WTU A;  5AQM A;  1HJO A;  4ELU A;  2HOE A;  1N34 K;  4GV3 A;  3C65 A;  5AQJ A;  3U3G A;  3DLB A;  4CJK A;  5J1E A;  4BR4 A;  3PX6 A;  4FWL A;  2QK9 A;  3RWU A;  5AJ3 K;  4Z94 A;  2P9P A;  4DR2 K;  4DTX A;  4CFD A;  3VQ4 A;  5HL7 L;  3KK1 A;  1FXX A;  4KI4 A;  1I94 K;  4FW2 A;  5JMV A;  3LPT A;  4BDY A;  4BY9 C;  2CGL A;  1WBB A;  4LFB K;  3AVF A;  4AIL C;  2A1S A;  1LAV A;  3TAQ A;  2A40 A;  5JLH A;  2XY7 A;  2VWJ A;  1K8A O;  3A5M C;  4KHY A;  4BR5 A;  4J2D A;  1VQ8 N;  1YT3 A;  4FJJ A;  2UYT A;  4GVM A;  3Q7C A;  2G8W A;  4FO0 A;  3G6E N;  4H0Y B;  1WAJ A;  2VGN A;  1CZB A;  3AGR A;  2RHK A;  4O8K A;  4NCB A;  1NK0 A;  3CCU N;  1RDA A;  4OKK A;  2D0O A;  5SWM A;  4JKF A;  4O5B A;  4GVE A;  1YJW N;  5MLC Q;  4JS4 A;  4JKA A;  3HI0 A;  3U9D A;  1UOC A;  3ZEU B;  2OPP A;  4OX9 K;  3R3L A;  3SBT A;  5KPT A;  2VG7 A;  4MDB A;  2Z1J A;  2PYJ A;  3M3Z A;  5HRR A;  4CEQ A;  2IC3 A;  3ZSR A;  5F0X A;  1N5Y A;  3THX A;  3KK2 A;  3O5B A;  1VSH A;  3OBW A;  3MCP A;  2E4L A;  4I9L A;  4CGF A;  3C95 A;  4H5W A;  3AVL A;  3P31 A;  2GWK A;  5LMN K;  3JS6 A;  1YJ9 N;  3OYG A;  4NO7 A;  3CF5 L;  4I2P A;  1QQM A;  1T6D A;  5FPN A;  2IVO A;  5J2Q A;  2GBZ A;  3AO4 A;  5DMR A;  1BA0 A;  2Q0U A;  1LW0 A;  1WAF A;  4CFB A;  4W5R A;  1FKO A;  3AVM A;  5AQY A;  3SAG A;  4N47 A;  3MXM A;  3O3F A;  3TAP A;  4C8O A;  3HL8 A;  2P9I B;  5J2M A;  3VQC A;  1QZ6 A;  5FRM A;  3OYA A;  2Q3S A;  4DCH A;  2Z1I A;  2E2O A;  1C0F A;  4C1N K;  3OYD A;  1XHX A;  3OS1 A;  3I0S A;  4U7B A;  4FJG A;  3ZT0 A;  5AQG A;  2DY4 A;  2WFB A;  3QIN A;  3KLH A;  4LF6 K;  3C6A A;  2HBK A;  5AZJ B;  1X9W A;  4QAG A;  3CM6 A;  4V19 S;  4DTJ A;  1YAG A;  3TAM A;  2ZWH A;  4DF8 A;  3FFK B;  1KLM A;  3LZJ A;  4J2A A;  2O4G A;  4CJR A;  2O8F B;  4H4O A;  3I56 N;  3JAM O;  1L3S A;  1T6C A;  2D4W A;  1GLE G;  2VG6 A;  3QES A;  3BF3 A;  1UA0 A;  3NHG A;  3CCQ N;  1NK7 A;  3O9T A;  1BDG A;  4A61 A;  1U4B A;  3VA3 A;  1V4S A;  1JCF A;  1O1W A;  4NLC A;  3L6Q A;  4DMN A;  3KD1 E;  1S3X A;  1JXE A;  3W3D A;  5IWA K;  1BI4 A;  4H5N A;  1Q7Y O;  1IKW A;  4DTM A;  3KZB A;  4CF8 A;  1EX4 A;  4HWI A;  4JI2 K;  4F3O A;  3B6O A;  1WSH A;  4MQ3 A;  1NK4 A;  2ITM A;  3L0Q A;  1W97 L;  4FOI A;  4B1V A;  1RIL A;  2YHA A;  4IOX A;  5KRS A;  3CCS N;  1JCE A;  3AAP A;  5JLF A;  4U67 L;  4B1Z A;  4FLU A;  1S22 A;  2H3G X;  1Z05 A;  3ID8 A;  1IV0 A;  4DV3 K;  4IEI A;  3F2K A;  4FJM A;  3R6M A;  4BQZ A;  2YV0 X;  1O13 A;  4EHT A;  3KLI A;  4CEA A;  2GV9 A;  3QEW A;  4CJV A;  4NYF A;  4IFE A;  5KPZ A;  3PX4 A;  3HM9 A;  3VGL A;  4CED A;  3HJF A;  3A5L C;  2P9N A;  3VQD A;  2W42 A;  2HMI A;  2IAJ A;  2Z1H A;  3J7Y P;  2CH6 A;  3VQA A;  2XO7 A;  1DKG D;  4CVN E;  3FFI A;  1UWB A;  4CZF A;  1XNR K;  1VRT A;  2AP1 A;  2RF2 A;  1XNQ K;  3TTC A;  5E84 A;  4JK8 A;  4FJK A;  4NCG A;  3QNN A;  2GEL A;  3UE5 A;  3EYZ A;  1ITG A;  4B9V A;  5AFU H;  4XH1 A;  5T7B A;  1ZBH A;  4I7F A;  2E6L A;  1D9F A;  3PSF A;  1MWM A;  4YOR A;  4M3R A;  3BUZ B;  3WXI A;  2FBY A;  3HTV A;  1X3N A;  3C7N B;  2OCE A;  1HKG A;  3V9Z A;  4B9M A;  1N6Q A;  1QHA A;  5BRD A;  4IKF A;  2OTJ N;  5AQQ A;  1X9S A;  1MA9 B;  5BN9 A;  1VQN N;  4CJL A;  3FZF A;  3P5J A;  1RBS A;  4CEF A;  4CZM A;  4L3Q A;  2HHH K;  1XHZ A;  1TUY A;  1NOZ A;  3T3F A;  3N4Q A;  2VG5 A;  1WBD A;  3NH1 A;  1S1X A;  4OGE A;  1IBM K;  1UA1 A;  3CFO A;  4OLA A;  4F4K A;  3L2V A;  4MO4 A;  3LDS A;  3LP0 A;  1HPM A;  1B92 A;  3DYA A;  4C1N I;  4O0J A;  1CXQ A;  4W5Q A;  3HZ6 A;  4O8U A;  2WC9 A;  3VQ6 A;  1T03 A;  3E9L A;  4H8K A;  2P9L B;  2X74 A;  3NH2 A;  4CJT A;  1W9H A;  3JSM A;  1NJY A;  3ZET B;  4BWM A;  2E2Q A;  1KLN A;  4JV5 K;  4DV5 K;  2X6N A;  3WUH A;  1RTD A;  1U2V A;  3BEX A;  4JKD A;  1HYS A;  3VGK A;  3JYT A;  1BU6 O;  1NGD A;  1XMQ K;  5EVZ A;  3DLK A;  1HQE A;  3FZL A;  4KTZ A;  4BR7 A;  4BC4 A;  3DLE A;  3FGU A;  3QB0 A;  1EKE A;  2FC0 A;  4H0X B;  2O8C A;  3S3M A;  3NBP A;  1UAX A;  4UQG A;  1EQY A;  1Y97 A;  1FK9 A;  2A5X A;  4E1M A;  3OTO K;  1IBK K;  4X65 K;  2V7Z A;  2GTD A;  5BRH A;  3T1H K;  3QEX A;  3MXI A;  4LFC K;  1LWE A;  4RW9 A;  3LDP A;  1ZBL A;  3C94 A;  4FWM A;  3F5T A;  5AQO A;  4EP5 A;  2G8F A;  1OKJ A;  3ASM A;  1IG8 A;  4LF5 K;  1JKH A;  3NF9 A;  2EX3 A;  3EY1 A;  4AHV A;  3CI5 A;  3RR8 A;  1Z26 A;  1NM1 A;  2ZQB A;  5BRE A;  1SAZ A;  4LH4 A;  4M41 A;  3SQ1 A;  4Z4C A;  3SUO A;  3OJU A;  3ISN C;  5E41 A;  4FPB A;  4B9T A;  1HNI A;  3RSE B;  4DFP A;  4O0I A;  1YHQ N;  1JLQ A;  1QVF M;  1NMD A;  4NCA A;  4ID1 A;  3P38 A;  3OBY A;  4J2E A;  4JHD A;  4ISF A;  1HRH A;  3KKR A;  3E66 A;  5LY3 A;  3A5O C;  4CHY A;  4WF9 L;  3EL2 A;  3HP6 A;  2W6L A;  2O8B B;  4HUE A;  1SL1 A;  1KSP A;  1KCF A;  2PBD A;  3SPY A;  4FPA A;  4OGC A;  1NNE A;  2WBN A;  4JK7 A;  1Z25 A;  1VQK N;  4BVP A;  4DSJ A;  4DS4 A;  1W0H A;  1VSJ A;  5C42 A;  2QEX N;  3O80 A;  1TGO A;  5BN8 A;  4HUF A;  1I3A A;  4IDK A;  2O8E A;  5C2D A;  5FRN A;  2NRX A;  2FLO A;  4B1Y B;  1JL1 A;  3OW2 M;  4QS8 A;  3J7A P;  3P4I A;  4IG0 A;  4DKW A;  3Q7B A;  5JVG L;  1EWQ A;  1ZYQ A;  4JN4 A;  1WNS A;  4NLB A;  4FLX A;  3DXM A;  1R59 O;  2QWP A;  3WQU A;  2XY8 A;  3VEZ A;  4FLT A;  3ZT4 A;  4CIG A;  1SKW A;  4B9S A;  3EE8 A;  3DXK A;  1HNX K;  5GAH P;  1HYV A;  3MWT A;  3CC2 N;  1U47 A;  2YCH A;  3IKM A;  3I55 N;  4HUG A;  4E7H A;  1ZBU A;  3DRR A;  4B1W B;  1KTQ A;  1WSE A;  3LAK A;  2QTD A;  3AVK A;  1DLO A;  1IKX A;  3MCA B;  3D2F B;  3ZLJ A;  3BF1 A;  3E9P A;  4DHY A;  5HLF A;  4KH4 A;  1IKY A;  1NGI A;  3FE1 A;  1S9E A;  4O55 A;  2G8I A;  3VEY A;  4RWT A;  5DM6 L;  4BG8 A;  4OVL A;  1T44 A;  2FSK A;  4DTU A;  2A3Z A;  2P5G A;  2OPS A;  3NMU A;  3HOT A;  1WUA A;  2XY6 A;  1TK5 A;  2ASP A;  3RMA A;  3O08 A;  1RT7 A;  1YTA A;  2ZD1 A;  3HYF A;  4UY8 O;  2D0B A;  4KKO A;  3ULE B;  3VN5 A;  5KQD A;  3TAN A;  3TSQ A;  3CMA N;  4ZTF A;  5ADX H;  5GAD P;  1RTI A;  3S3O A;  1RBV A;  1LW2 A;  1KFS A;  3OY9 A;  4PY5 A;  5GIP A;  3CIP A;  2VYP A;  3CQY A;  2BUP A;  4ISG A;  1IBL K;  2E20 A;  4FJI A;  3O1W A;  1JLC A;  5KGX A;  1IG9 A;  1YJN N;  5FLX O;  2HHX A;  4FWQ A;  2YI1 A;  4AHU A;  3PY8 A;  3AA5 X;  4CF9 A;  4BG9 A;  3LWL A;  1KRP A;  3GL1 A;  4CBU A;  5FPE A;  3O4N A;  1L3V A;  1TL1 A;  4OPA A;  4F8R A;  3RR7 A;  4CJ3 A;  3SQ2 A;  3C0B A;  5M1K A;  4KRE A;  4BRL A;  3CJC A;  4K0K K;  2F96 A;  3MWP A;  4PQU A;  1RDD A;  2CH5 A;  3UKU B;  1BIS A;  5FPM A;  4BRF A;  1HKC A;  3ATV A;  3A8Y A;  4PKG A;  1MDU B;  4AHS A;  2P5O A;  2KHO A;  5TKY A;  3ITH A;  4JKE A;  3SQ0 A;  5FDL A;  2GX9 A;  2YHB A;  3WEE A;  3NH0 A;  1QSS A;  1N32 K;  4M7Y A;  3CCE N;  3FLC O;  4AHR A;  4QS7 A;  4E3S A;  1S6P A;  4EZ6 A;  1XUP O;  2NRT A;  3IRX A;  3LDN A;  3V6D A;  4FZZ A;  1NGA A;  1G15 A;  1JXB A;  2DFE A;  1BCM A;  2P9K A;  1C0G A;  4KTW A;  4A59 A;  2JWL A;  4CK3 A;  3THW B;  3MED A;  4AM7 A;  1GOA A;  1RDU A;  3IFR A;  4ICL A;  3L2R A;  2UXB K;  3UB5 A;  3LAL A;  3SUP A;  2XHB A;  4RCH A;  3K58 A;  3O9S A;  4WFA L;  1NGB A;  1H1V A;  1GLD G;  4IG3 A;  3EE9 A;  1G99 A;  3WT0 A;  3NGY A;  1IKV A;  3CJB A;  4CJW A;  3L3V A;  4JYA K;  4DV7 K;  1C0T A;  3DRS A;  4GY2 B;  3FZM A;  1NGH A;  2P1J A;  4XH5 A;  3OS2 A;  3KLG A;  4FZY A;  3VF6 A;  3TU5 A;  5AR0 A;  2JWK A;  4IFY A;  4IFV A;  3IMX A;  3CFR A;  3SUN A;  1VSL A;  3SLC A;  3MXJ A;  1TKZ A;  2QM1 A;  3WNG A;  4LC9 B;  3ZT3 A;  3CJ9 A;  1BUP A;  3OYE A;  1VSM A;  5C12 A;  3S41 A;  4G9Z A;  2BAN A;  3ALY A;  3LWM A;  1WSG A;  4K8Z A;  4OLB A;  3QLH A;  1QS4 A;  4FJN A;  4E7K A;  4EP4 A;  3QET A;  4CZE A;  4CEE A;  3V1O A;  2OPR A;  1J5E K;  4F2S A;  4CW7 B;  4PUO A;  3O1B A;  4MLH A;  2DFF A;  3RMD A;  1KAZ A;  2D1K A;  4HTU A;  4CGD A;  1TAQ A;  3HPO A;  4MDA A;  1TKD A;  4LH5 A;  2F9W A;  3TAG A;  2F9T A;  5I9E B;  4FLY A;  5LJV A;  1JJ2 M;  3BDP A;  2KZZ A;  1HLU A;  2J4R A;  2KZM A;  4CEB A;  5E26 A;  3SPZ A;  4TSX A;  3R8E A;  4FWR A;  3AVA A;  3K57 A;  4IOC L;  2FXU A;  5BPM A;  3AVJ A;  2I7N A;  3QBW A;  4CGG A;  4BRQ A;  2HHV A;  3H6E A;  3QIC A;  1WB9 A;  3A2F A;  4BRE A;  4OPK A;  4C8K A;  3TTF A;  2HHU A;  3VF4 A;  3C7N A;  4I6M B;  3O6W A;  3CXC M;  1C1B A;  1TV6 A;  4KH6 A;  2FBV A;  1XMO K;  1M1K O;  3FR0 A;  3HVR A;  1NWK A;  3K5N A;  4BDP A;  3LM9 A;  4YHH K;  2E5L K;  3UKR A;  3P1G A;  2GWJ A;  3GOI A;  3THY B;  4KV8 A;  1DTT A;  3SQ4 A;  1IH7 A;  3EKU A;  4YFU A;  1YVN A;  2W6K A;  3MDQ A;  5AQK A;  3CCR N;  3DLH A;  3K9J A;  3OYF A;  3SJH A;  4CJP A;  3SZ2 A;  5BRF A;  3HOS A;  3HXM A;  1T8E A;  4B3T K;  3V9U A;  1RGI A;  1RT5 A;  3LP3 A;  3KHY A;  5SZT A;  3F9M A;  3VTI A;  1J5O A;  3K5O A;  3QO9 A;  3TAB A;  1M90 O;  2XRI A;  4NYN A;  3VQQ A;  5B8H A;  1LWC A;  1E4G T;  2NZT A;  4CK1 A;  4JI8 K;  4JI1 K;  3LPU A;  4DTO A;  1ZBS A;  4CGH A;  4WFB L;  3T1A A;  1NJZ A;  1VSK A;  4CEZ A;  4O44 A;  3K59 A;  1E4F T;  3H45 C;  4E7J A;  1ATS A;  3CPW M;  5AQN A;  4N56 A;  3O9Q A;  2KQ2 A;  2NRH A;  3SK3 A;  4A2B A;  4JKG B;  4IO9 L;  3AO3 A;  3SMS A;  2QWL A;  3CG7 A;  2ZE2 A;  3CD6 N;  3SNN A;  3G0Z A;  4A57 A;  4X62 K;  3CPE A;  2NNW A;  3UIQ A;  4B08 A;  1SS6 A;  4DV0 K;  1TVR A;  3NE6 A;  4JI6 K;  2F4V K;  4BE0 A;  4JRQ A;  4BRI A;  1WOQ A;  1ASW A;  5AQU A;  2PYL A;  3WXL A;  1Y64 A;  4I9Q A;  3GDQ A;  2Q31 A;  3AA2 A;  3SBG A;  1VSE A;  4FWN A;  2HHS A;  2RPI A;  4KHQ A;  3THV A;  3DI6 A;  5BR8 K;  4B9U A;  1C1C A;  4NXM K;  5JS1 A;  3OYN A;  1VRU A;  3VEV A;  4E7I A;  4C8L A;  2YKM A;  2HBL A;  3KLF A;  3PV8 A;  4ILJ A;  3HRG A;  3W0L A;  4B8A B;  3SCX A;  2OYQ A;  5HRN A;  4CZI A;  1U6Z A;  3RSE A;  1ZBF A;  1TYQ A;  1BGX T;  3AVC A;  1OH8 A;  3HST B;  4M3Z A;  2GEM A;  4DB3 A;  4DV2 K;  3O4Q A;  5C2F A;  2KFZ A;  3T7Z A;  2O8B A;  4CHN A;  3MN7 A;  2FF6 A;  5C25 A;  1OVQ A;  4MO5 A;  1BQM A;  2HNZ A;  4GW6 A;  2ITG A;  3THX B;  2V7Y A;  1JLF A;  1CLQ A;  2HF3 A;  3ZT2 A;  1J6Z A;  3CER A;  5KGW A;  4FWP A;  2NRZ A;  4RW8 A;  3CCV N;  1XC3 A;  3MK6 A;  3QIP A;  1VQM N;  3H46 O;  4FJ5 A;  2Q1N A;  3NF8 A;  1K6Y A;  3OA9 A;  4JKB A;  3NVK A;  3VQ9 A;  1YF5 L;  2ZF5 O;  3PLA A;  3CJA A;  3MEG A;  4M3X A;  1RT2 A;  3LM2 A;  4M63 C;  2QI2 A;  4DG1 A;  4CZL A;  1VQL N;  3NCI A;  3KD5 E;  4ELT A;  4H0V B;  3OYB A;  1NU0 A;  3I8B A;  2YJF A;  3G10 A;  1C0U A;  1P90 A;  3WNF A;  3LP2 A;  3MN9 A;  4O5F A;  4RW7 A;  2VQF K;  4CIE A;  4J8F A;  1S1T A;  2BDP A;  1NK8 A;  4Y1D A;  4BGA A;  3TI0 A;  5CY4 A;  4N41 A;  3VEO A;  4JKC A;  4JLH A;  3D2F A;  1C0M A;  1ASV A;  3HM8 A;  4FYD A;  2YNH A;  4EIA A;  3WXM B;  1X3M A;  3LAN A;  2O4I A;  2B4J A;  1NOY A;  2V52 B;  1ZXO A;  4GMJ B;  3U3Y A;  5D3G A;  4LFA K;  4AH9 A;  4R5P A;  5HBM A;  1EWR A;  1RCH A;  2E1Y A;  1LV5 A;  4H5T A;  2P9S B;  3AVN A;  3FZH A;  3I33 A;  5CZ1 A;  4H03 B;  3DMJ A;  1ILY A;  1L3T A;  2FSN A;  1VQ6 N;  4Z4H A;  4K42 A;  2Q2R A;  4KB0 A;  3L4I A;  1RDW X;  1N36 K;  1BI4 B;  3ULE A;  5AQH A;  3DOL A;  3SV4 A;  4DSE A;  2D5R A;  4C8M A;  4Z4G A;  3NAE A;  3M1F A;  4LF8 K;  4Y0W A;  1Q82 O;  5AFU A;  3R9P A;  3EO3 A;  1U49 A;  3VOV A;  1LOT B;  1TKT A;  4FW1 A;  3CJ7 A;  3QEP A;  4BQL A;  4DR5 K;  4CHO A;  4DTR A;  4FLZ A;  4CE9 A;  3ZSZ A;  3OS0 A;  1W2B M;  4YY3 K;  4DR1 K;  3J81 O;  3CQX A;  3MEE A;  4H4M A;  4FVU A;  4B9N A;  4BRN A;  1HPZ A;  5HOO A;  3VET A;  5HRP A;  2HNY A;  3ENB A;  4WCE L;  3FZK A;  5HP1 A;  4N76 A;  4CJS A;  2KW4 A;  2P9N B;  4JRP A;  1KVA A;  5KQ8 A;  3BZK A;  3AO1 A;  5M1F A;  1D8Y A;  1HKB A;  5M1P A;  2RE2 A;  4GV9 A;  4YNQ A;  5KRT A;  3TAF A;  3QFU A;  2DTU A;  4BDZ A;  1RT3 A;  2D0P A;  4ISE A;  4DR7 K;  2X78 A;  1RFQ A;  4DTS A;  4DFM A;  1QVG M;  3TSP A;  5DM7 L;  2G8H A;  5IT9 O;  4KHS A;  3B6P A;  2QWO A;  4YOV A;  1XC9 A;  2E1Z A;  1WSJ A;  2VQE K;  4CGI A;  4KHW A;  3CCM N;  3RRH A;  5LL6 Z;  4BRD A;  3QDK A;  2CGJ A;  4CZJ A;  4Z4I A;  3ZSV A;  4YOX A;  3QEI A;  2YX6 A;  3D6R A;  4AHC A;  1VQP N;  1JLE A;  3AV9 A;  4X64 K;  1Q9Y A;  3THW A;  3DOK A;  3AA4 A;  5CE3 A;  4CD3 A;  3LL3 A;  3RMC A;  4DTN A;  4GKJ K;  2Y1J A;  4FL9 A;  5CZ2 A;  2NRW A;  4IZ9 A;  4MLE A;  4B1U B;  3ZX3 A;  5J2N A;  1BHL A;  1KFD A;  4DLG A;  2X6S A;  2KKZ A;  2A42 A;  2HB5 A;  2HHT A;  4RW4 A;  3VEN A;  3KWG A;  3M8Q A;  1LAW A;  1SL2 A;  4BRO A;  1NKB A;  1A5X A;  3NVM A;  3V1R A;  3JXU A;  2ZGZ A;  1RNH A;  3RTV A;  4FSV A;  3TWH A;  1Q8I A;  1NK9 A;  4NXN K;  3SYZ A;  3E9O A;  4IWV A;  1QTM A;  1IJJ A;  1DEJ A;  5ELZ A;  5C15 A;  3O9R A;  4KPY A;  1U2V B;  2WUS A;  1DT9 A;  2PFU A;  4OO1 J;  4FK2 A;  3SI6 A;  2NUB A;  5EU7 A;  1QSY A;  3HVT A;  3LDQ A;  4ID5 A;  1YUW A;  3D0P A;  4M3U A;  1REV A;  4B8C A;  3KTQ A;  1RDB A;  2HVH A;  1VSD A;  5DK5 A;  4IJA A;  4O4G A;  3WNE A;  1A5V A;  1OH5 A;  3O3H A;  4KB1 A;  5CHI A;  4IBN A;  4CJF A;  5AQF A;  3CFP A;  4B3O A;  1X1P A;  2VWB A;  3ZEU A;  4DU3 A;  2PY5 A;  3D2E B;  2QXF A;  1Q81 O;  1J9A A;  4IOA L;  4KBO A;  3H1V X;  3M8R A;  1N8R O;  3QIO A;  4DFK A;  2HND A;  4CEO A;  4FM2 A;  4CBW A;  3U4L A;  5EOY A;  3RRG A;  3MX2 A;  1RBR A;  3C6T A;  5I42 A;  2WOM A;  4E7L A;  3G4S N;  4KI6 A;  3ZX2 A;  4YDU C;  4BRH A;  3T19 A;  3ATU A;  1SZ2 A;  2E8A A;  4A5A A;  3L2Q A;  1VSI A;  2QWQ A;  1S1U A;  3VQ5 A;  2D0C A;  4AHT A;  3K5M A;  2OPQ A;  4DV1 K;  4CHQ A;  4B9Q A;  2JGU A;  4KHP K;  2IVP A;  1BIU A;  2YNI A;  4JI5 K;  1YTU A;  3SAH A;  4OKJ A;  4DR6 K;  1OH7 A;  5AZI B;  1SKS A;  4ILG B;  4DUY K;  4I6M A;  4BRM A;  4H0O A;  2XY5 A;  4H0T B;  5HRO A;  3KVG A;  3DLG A;  1ZC6 A;  5BPL A;  3MAQ A;  3HT3 A;  1T05 A;  2P9I A;  1QHT A;  4DS5 A;  1NJW A;  1SQK A;  3PX0 A;  3HSC A;  4YDU A;  3THY A;  4DV6 K;  3AY9 A;  1EO1 A;  2RN2 A;  5KTQ A;  1C6V A;  5K14 A;  3KIO A;  3K5L A;  2UUC K;  4DF4 A;  3OJS A;  3J80 O;  2VGM A;  2YHX A;  2B6A A;  5AZJ A;  3E01 A;  1VQ5 N;  1VK0 A;  3OHR A;  1GLL O;  4DTP A;  1HNV A;  3TTD A;  1NK5 A;  5AQS A;  1X9M A;  2O8E B;  2F8S A;  2G8U A;  5TKW A;  2KFN A;  1HMV A;  3J7Z O;  1JCG A;  3H1Q A;  2O8F A;  4B3M K;  1Z6R A;  4RTF D;  4K41 A;  1JLG A;  1I39 A;  5AQP A;  4CBX A;  1JLA A;  2E2N A;  2GUI A;  3QML A;  1NGE A;  3N4P A;  5CR4 A;  4K8X A;  4JD2 B;  4PKI A;  1VQ4 N;  3DXM B;  2HHQ A;  2HHW A;  2YHY A;  3MN5 A;  1BIZ A;  3DXK B;  3LDO A;  3U8X A;  4CGJ A;  4JKG A;  2QWM A;  3LAM A;  1VSF A;  2ZM6 K;  3DLR A;  1BOT O;  4FJ9 A;  4IJN A;  2NRR A;  3LZI A;  2HVI A;  3M8S A;  2G8V A;  4DQQ A;  3RMB A;  4PHT X;  3CME N;  2OAN A;  2OTL N;  3CET A;  3H3N O;  5KI6 A;  1WLJ A;  4E89 A;  1KVB A;  3D7E O;  1RT4 A;  1J53 A;  4KTQ A;  3ULD A;  4A2A A;  3DWL A;  2Y1I A;  4QS9 A;  4CER A;  3MN6 A;  4FCY A;  3A5N C;  4DSL A;  4M3W A;  4EFH A;  4ELV A;  2W40 A;  3EKS A;  1RBU A;  2ZJQ L;  4ZTJ A;  4BRC A;  4B3R K;  1B9F A;  1SL0 A;  4CD1 A;  3CC4 N;  4CFC A;  1U04 A;  4FWO A;  4C23 A;  3IDH A;  3D45 A;  4JI7 K;  1HYZ A;  4E0D A;  4FM0 A;  3H3O B;  5BPN A;  4MFB A;  4YOU A;  4OPJ A;  2UUA K;  1R0A A;  3EZW A;  4CHZ A;  5H1S Q;  3ZSW A;  3QBX A;  3OYK A;  2ATQ A;  3AAQ A;  4BC2 A;  1GLF O;  2EHG A;  2B5J A;  1MU2 A;  3NF7 A;  3SMP A;  1L3U A;  2KTQ A;  4FLV A;  2LSN A;  3ZSQ A;  1K8K B;  3PO4 A;  3NDK A;  2DFH A;  2JLE A;  1QQC A;  3TR8 A;  3IUC A;  3CC7 N;  3PO5 A;  2VCP A;  4YOY A;  4RG8 A;  5EY4 A;  3BGR A;  1NGG A;  4J2B A;  4JAX A;  1ATN A;  3RVC A;  2UXD K;  5C0Y A;  1ASU A;  4CES A;  3T1Y K;  3QER A;  3K0S A;  4IXC A;  1RT1 A;  2F8T A;  4LF7 K;  4IO8 A;  4E1J A;  5A2Q O;  3OYJ A;  1X9J A;  2QWR A;  2IIR A;  2HBJ A;  4W5T A;  5LMU K;  4JI0 K;  4FJL A;  3SAF A;  4DR4 K;  4BAC A;  2IVN A;  1NGC A;  3ENO A;  4FWK A;  3WEE B;  3E1Y A;  4HVJ A;  2A41 A;  2P9L A;  1BQN A; 
#chains in the Genus database with same CATH homology
 3WQU A;  2E2P A;  2P9U B;  4YOT A;  3VEZ A;  3EE8 A;  1YIT N;  3DXK A;  3ZET A;  3MN9 A;  4WFN L;  4O5F A;  5GAH P;  1GLA G;  3DAW A;  3MWT A;  2YCH A;  4IDH A;  3IKM A;  3CC2 N;  4J8F A;  3I55 N;  3DLL L;  2P9K B;  5ADX A;  2GUP A;  4BGA A;  4B1W B;  2Q0R A;  3VEO A;  4JKC A;  3D2F A;  5AQM A;  1HJO A;  3EN9 A;  2HOE A;  3VF2 A;  3HM8 A;  4GV3 A;  2QTD A;  3C65 A;  5AQJ A;  5LJW A;  1VQO N;  4WQ4 C;  1V4T A;  1K9M O;  4EIA A;  3C6H A;  4BR4 A;  3MCA B;  3D2F B;  3WXM B;  1X3M A;  4FWL A;  3BF1 A;  3E9P A;  4DHY A;  4Z94 A;  2P9P A;  4KH4 A;  2V52 B;  1ZXO A;  1NGI A;  3FE1 A;  3VEY A;  4RWT A;  5HL7 L;  5DM6 L;  4BG8 A;  2P9S A;  1T44 A;  2FSK A;  2P9P B;  2E1Y A;  4H5T A;  2CGK A;  2P9S B;  2A3Z A;  3FZH A;  3I33 A;  5JMV A;  1Q86 O;  4BY9 C;  4H03 B;  1ILY A;  3NMU A;  2CGL A;  3HOT A;  2FSN A;  1VQ6 N;  2QA4 N;  5AQT A;  4K42 A;  2Q2R A;  4F9O A;  1WUA A;  2DPN A;  2A40 A;  3L4I A;  5JLH A;  2ASP A;  1RDW X;  4PL8 A;  3VES A;  3O08 A;  3WXJ A;  3ULE A;  4EAH D;  3PIP L;  5AQH A;  3WQT A;  1K8A O;  3A5M C;  4BR5 A;  1CZA N;  4UY8 O;  1VQ8 N;  3O8M A;  2UYT A;  3ULE B;  5KQD A;  3Q7C A;  4XEI A;  5M1N A;  3TSQ A;  2QWN A;  3B8A X;  3M1F A;  4FO0 A;  4WQ4 A;  4BR2 A;  4H0Y B;  3G6E N;  3CMA N;  5F1X A;  2VGN A;  4Y0W A;  3AGR A;  1KD1 O;  2RHK A;  1LCU A;  5ADX H;  1BO5 O;  5AFU A;  3MMV A;  5GAD P;  1Q82 O;  3R9P A;  3EO3 A;  4O8K A;  3VOV A;  3CCU N;  1LOT B;  2D0O A;  5GIP A;  1MWK A;  4JKF A;  3CIP A;  2VYP A;  4GVE A;  1YJW N;  3CQY A;  2BUP A;  3CJ7 A;  4ISG A;  5MLC Q;  3WXK A;  2HMP A;  4JKA A;  4BQL A;  3HI0 A;  4K43 A;  2E20 A;  3U9D A;  3ZEU B;  3O1W A;  3DXM A;  3GG4 A;  2ASO A;  1YJN N;  3R3L A;  1W2B M;  3SBT A;  5KPT A;  4FWQ A;  2YI1 A;  1GLJ O;  4MDB A;  3CQX A;  4BG9 A;  4FVU A;  1NGJ A;  4BRN A;  3M3Z A;  5F0X A;  1VAZ A;  3GL1 A;  3VET A;  5HOO A;  4CBU A;  2E88 A;  5FPE A;  3O5B A;  3ENB A;  3J8A A;  4WCE L;  4OPA A;  3FZK A;  3OBW A;  3MCP A;  3A0I X;  4FWS A;  2P9N B;  4NB4 A;  5KQ8 A;  3O9U A;  5GAG P;  1DGK N;  3C0B A;  2A6A A;  5M1F A;  4BRL A;  3CJC A;  3P31 A;  4H5W A;  5M1K A;  1HKB A;  1VQ9 N;  2GWK A;  5M1P A;  2V51 B;  2RE2 A;  4GV9 A;  3MWP A;  3JS6 A;  1YJ9 N;  5AQX A;  2CH5 A;  4AM6 A;  3QFU A;  3VPZ A;  4XH4 A;  3UKU B;  5FPM A;  4BRF A;  1HKC A;  3ATV A;  3A8Y A;  4NO7 A;  3CF5 L;  1QQM A;  1T6D A;  5FPN A;  2IVO A;  2D0P A;  4ISE A;  4PKG A;  4BR0 A;  1RFQ A;  4A62 A;  1MDU B;  1QVG M;  1BA0 A;  2Q0U A;  3TSP A;  3VMF B;  2KHO A;  5DM7 L;  1VQ7 N;  5TKY A;  4JKE A;  3ENH A;  5AQY A;  3SAG A;  2GX9 A;  2QWO A;  3WEE A;  4M7Y A;  4DQ8 A;  4YOV A;  3CCE N;  3FLC O;  2P9I B;  4QS7 A;  2E1Z A;  1QZ6 A;  3CCM N;  3U9Z A;  1XUP O;  5EX5 A;  2NRT A;  4BC3 A;  4BRD A;  5KPR A;  3QDK A;  2CGJ A;  4CZJ A;  4DCH A;  3LDN A;  4BC5 A;  4YOX A;  2YX6 A;  2E2O A;  3UKR B;  3D6R A;  1C0F A;  2Q36 A;  1VQP N;  4C1N K;  1NGA A;  5GIN A;  2P9K A;  4A59 A;  5CE3 A;  1C0G A;  4U7B A;  2JWL A;  3TPQ A;  4CD3 A;  3KK7 A;  4BRP A;  5AQG A;  2WFB A;  4AM7 A;  1KC8 O;  1GLC G;  3LL3 A;  5M1Q A;  3C6A A;  2HBK A;  5AZJ B;  3R1X A;  4FL9 A;  5AQV A;  1RDU A;  2NRW A;  3IFR A;  4IZ9 A;  4MLE A;  1YAG A;  3AAR A;  4B1U B;  3UB5 A;  2ZWH A;  4H5V A;  3ZX3 A;  5AQW A;  4RCH A;  2ASM A;  3FFK B;  3O9S A;  5M1O A;  1HUX A;  1NGB A;  1H1V A;  4WFA L;  1GLD G;  3EE9 A;  2KKZ A;  1G99 A;  2A42 A;  3WT0 A;  2W41 A;  3I56 N;  1T6C A;  1KAY A;  3M5R A;  3CJB A;  2D4W A;  1GLE G;  4A5B A;  3VEN A;  3KWG A;  3BF3 A;  4GY2 B;  3CCQ N;  3O9T A;  1BDG A;  4A61 A;  4BRO A;  3NVM A;  2F7T A;  3FZM A;  1NGH A;  2FSJ A;  2ZGZ A;  2ZGY A;  3JXU A;  1V4S A;  4FSV A;  4XH5 A;  1JCF A;  4NLC A;  3L6Q A;  3VF6 A;  1S3X A;  1ESV A;  3E9O A;  1BG3 A;  3TU5 A;  5AR0 A;  4IWV A;  3W3D A;  1IJJ A;  2JWK A;  4EHU A;  1DEJ A;  5ELZ A;  5C15 A;  3IMX A;  4H5N A;  4BVO A;  1Q7Y O;  3O9R A;  4FOE A;  3SLC A;  3KZB A;  2QM1 A;  1U2V B;  2WUS A;  4H5R A;  1DT9 A;  2PFU A;  4LC9 B;  4OO1 J;  3CJ9 A;  1BUP A;  4HWI A;  3LDQ A;  1YUW A;  4M7X A;  5C12 A;  2ITM A;  3S41 A;  3L0Q A;  5JVH L;  4G9Z A;  1W97 L;  4FOI A;  4B1V A;  4IOX A;  4IJA A;  1KXP A;  3CCS N;  1JCE A;  3D2E A;  4CZH A;  3AAP A;  5JLF A;  4U67 L;  5CHI A;  4B1Z A;  1S22 A;  5AQI A;  2I7P A;  5AQF A;  2H3G X;  2VWB A;  1TUU A;  2AA4 A;  3ZEU A;  4CZE A;  3D2E B;  1Q81 O;  1Z05 A;  3ID8 A;  4IOA L;  1QQO A;  4IEI A;  4KBO A;  3F2K A;  3H1V X;  3O1B A;  1N8R O;  3R6M A;  4HTL A;  2HF4 A;  4MLH A;  3CHW A;  3U4L A;  5EOY A;  4BQZ A;  4CBW A;  1O13 A;  5F2R A;  1KAZ A;  2D1K A;  3MX2 A;  1BWF O;  3PIO L;  4EHT A;  1T3V A;  4MDA A;  3G4S N;  4IFE A;  5KPZ A;  2F9W A;  3ZX2 A;  3ID6 A;  4YDU C;  2F9T A;  4BRH A;  5I9E B;  3VGL A;  3A5L C;  2P9N A;  1SZ2 A;  2E8A A;  3ATU A;  4A5A A;  5LJV A;  4WQ5 C;  1HLU A;  1JJ2 M;  2QWQ A;  2J4R A;  1GLB G;  2CH6 A;  5E26 A;  1DKG D;  4YOW A;  3R8E A;  4B9Q A;  4CZF A;  4K25 A;  4FWR A;  2IVP A;  2AP1 A;  5AZI A;  3TTC A;  3UKU A;  4IOC L;  3SAH A;  2FXU A;  5BPM A;  5E84 A;  4JK8 A;  2I7N A;  3QBW A;  5AZI B;  4BRQ A;  2GEL A;  1P8Z A;  1TYQ B;  1K73 O;  4ILG B;  3H6E A;  4I6M A;  3TSU A;  4BRM A;  3L4Q A;  3QIC A;  4H0O A;  5GAE P;  4H0T B;  4BRE A;  1NJI O;  3UE5 A;  3KVG A;  3TTF A;  3ZX0 A;  3VF4 A;  5AFU H;  4XH1 A;  1ZC6 A;  3C7N A;  4I6M B;  3O6W A;  5BPL A;  1MWM A;  4YOR A;  3CXC M;  2ZJP L;  3BUZ B;  2P9I A;  3WXI A;  4KH6 A;  3M6G A;  1M1K O;  3FR0 A;  3HTV A;  3C7N B;  1X3N A;  1SQK A;  4BRK A;  2YHW A;  4WYB A;  3HSC A;  4JNE A;  4YDU A;  1NWK A;  3AY9 A;  3LM9 A;  1EO1 A;  1Q18 A;  3UKR A;  1HKG A;  2GWJ A;  2QW9 A;  2EWS A;  4WQ5 A;  3BP8 A;  1QHA A;  2NRV A;  3GOI A;  5BRD A;  2OTJ N;  3DJC A;  5AQQ A;  1MA9 B;  3GE1 A;  3HBT A;  5BN9 A;  1VQN N;  2VGM A;  2YHX A;  3FZF A;  5BR9 A;  4CZM A;  3EKU A;  1YVN A;  5AZJ A;  2PAV A;  3MDQ A;  4L3Q A;  1VQ5 N;  5AQK A;  1TUY A;  5FPD A;  3KWI A;  3CCR N;  3OHR A;  1GLL O;  3K9J A;  3N4Q A;  3CCL N;  3SJH A;  3TTD A;  5AQS A;  5BRF A;  3HOS A;  5TKW A;  1RGI A;  3J7Z O;  3KHY A;  3F9M A;  1JCG A;  3H1Q A;  4MO4 A;  1ATR A;  1HPM A;  3VTI A;  1Z6R A;  2HST A;  4RTF D;  4C1N I;  3HZ6 A;  4GNI A;  4K41 A;  4JD2 A;  4O8U A;  1M90 O;  2WC9 A;  3MX5 A;  5AQP A;  4B1X B;  4CBX A;  5AQR A;  2E2N A;  3QML A;  1NGE A;  5B8H A;  3E9L A;  1QQN A;  1QZ5 A;  2P9L B;  1E4G T;  3N4P A;  4JD2 B;  4PKI A;  2NZT A;  5CR4 A;  1VQ4 N;  3DXM B;  4JEP A;  1HX1 A;  1ZBS A;  2YHY A;  3MN5 A;  1OVY A;  3DXK B;  4WFB L;  3ZET B;  3LDO A;  1YXQ A;  2QXL A;  3U8X A;  2E2Q A;  1S72 N;  4R79 A;  4JKG A;  2QWM A;  3CJ1 A;  1E4F T;  3H45 C;  3T69 A;  3WUH A;  1ATS A;  3CPW M;  1U2V A;  1BOT O;  3BEX A;  4JKD A;  4IJN A;  1KAX A;  3O9Q A;  5AQN A;  3VGK A;  4A2B A;  2NRH A;  2NRR A;  3SK3 A;  1BU6 O;  4JKG B;  4IO9 L;  1NGD A;  3SMS A;  2QWL A;  5EVZ A;  2BTF A;  3CD6 N;  4A57 A;  5AQZ A;  4BR9 A;  1NBW A;  5GIO A;  3FZL A;  3CPE A;  2NNW A;  4BR7 A;  4PHT X;  1SS6 A;  4BC4 A;  3FGU A;  3QB0 A;  3CME N;  2OAN A;  2OTL N;  3CET A;  4BGB A;  4H0X B;  3H3N O;  4BRI A;  1WOQ A;  3D7E O;  3QFP A;  5AQU A;  2FF3 B;  1NLV A;  3VGM A;  1EQY A;  3WXL A;  4A2A A;  1Y64 A;  3DWL A;  3ZYY X;  3GDQ A;  2A5X A;  2Q31 A;  4QS9 A;  3MN6 A;  3A5N C;  3P39 A;  3SBG A;  2V7Z A;  4FWN A;  2GTD A;  4EFH A;  5BRH A;  4JKH A;  2W40 A;  3EKS A;  2ZJQ L;  3LDP A;  1YI2 N;  4BRC A;  4FWM A;  4H0P A;  3F5T A;  5AQO A;  3LDL A;  4CD1 A;  1OKJ A;  1IG8 A;  3CC4 N;  4PL7 A;  5AQL A;  4FWO A;  3VEV A;  4C23 A;  3IDH A;  2HBL A;  3CI5 A;  1NM1 A;  5BRE A;  3H3O B;  4ILJ A;  3HRG A;  4YOU A;  1SAZ A;  3W0L A;  5BPN A;  3CCJ N;  3K9K A;  2YJE A;  4JK9 A;  2NLX A;  3EZW A;  1BA1 A;  4CZI A;  5H1S Q;  4GV6 A;  3QBX A;  1U6Z A;  2KLA A;  3RSE A;  4BRA A;  3AAQ A;  4BC2 A;  4FPB A;  1TYQ A;  1GLF O;  4PKH A;  3RSE B;  2GEM A;  3SMP A;  4DB3 A;  1YHQ N;  1K8K A;  1NMD A;  1QVF M;  2ZJR L;  3GBT A;  4IEE A;  5C2F A;  3P38 A;  3OBY A;  3T7Z A;  4JHD A;  3MN7 A;  4ISF A;  2FF6 A;  3E66 A;  5LY3 A;  3A5O C;  1K8K B;  5JIC A;  4WF9 L;  1XQS C;  3EL2 A;  3G25 A;  4MO5 A;  4JHD B;  1NGF A;  2V7Y A;  2PBD A;  3IUC A;  5C10 A;  3G71 N;  4FPA A;  3CC7 N;  2HF3 A;  2VCP A;  1J6Z A;  4YOY A;  2WBN A;  3CER A;  1D4X A;  5EY4 A;  4FWP A;  4CZG A;  4JK7 A;  1VQK N;  1NGG A;  2NRZ A;  4JAX A;  4OPH A;  4BVP A;  1ATN A;  3RVC A;  3VER A;  3VTH A;  3O4W A;  4CJ7 A;  3CCV N;  1XC3 A;  2BH1 A;  3MK6 A;  2QEX N;  5C0Y A;  3O80 A;  1VQM N;  3H46 O;  2Q1N A;  5BN8 A;  3OA9 A;  4JKB A;  3NVK A;  4IXC A;  4BRG A;  1YF5 L;  2ZF5 O;  3PLA A;  4CZK A;  3AGK A;  3CJA A;  3VEW A;  4CI6 A;  4IO8 A;  5C2D A;  1YIJ N;  4E1J A;  2NRX A;  3LM2 A;  4M63 C;  2QI2 A;  4ILH A;  1KQS M;  2FLO A;  1X9J A;  2QWR A;  2IIR A;  2HBJ A;  4KH5 A;  4B1Y B;  4CZL A;  1VQL N;  3SAF A;  3OW2 M;  2IVN A;  1NGC A;  2HBM A;  3ENO A;  4QS8 A;  4H0V B;  3P4I A;  3I8B A;  4AF1 A;  2YJF A;  2Q97 A;  4DKW A;  4FWK A;  3Q7B A;  3WEE B;  2P9U A;  3E1Y A;  2A41 A;  5JVG L;  2P9L A;  1P90 A;  4JN4 A;  4NLB A;  5EXW A;  3VEX A;  1R59 O;  2QWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...