4H0OA

Crystal structure of acetate kinase from entamoeba histolytica
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
391
structure length
383
Chain Sequence
SNVLIFNVGSSSLTYKVFCSDNIVCSGKSNKPFIEHHLNGQIIKIETPILNHPQAAKLIIQFLKENHISIAFVGHRFVHGGSYFKKSAVIDEVVLKELKECLPLAPIHNPSSFGVIEISMKELPTTRQYVAIDTAFHSTISQAERTYAIPQPYQSQYLKFGFHGLSYEYVINSLKNVIDVSHSKIIACHLGTGGSSCCGIVNGKSFDTSMGNSTLAGLVMSTRCGDIDPTIPIDMIQQVGIEKVVDILNKKSGLLGVSELSSDMRDILHEIETRGPKAKTCQLAFDVYIKQLAKTIGGLMVEIGGLDLLVFTDQMGLEVWQVRKAICDKMKFLGIELDDSLNEKSMGKKIEFLTMPSSKVQVCVAPNDEELVILQKGKELFQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of acetate kinases from the eukaryotic pathogens Entamoeba histolytica and Cryptococcus neoformans.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Transferase
molecule keywords Acetate kinase
total genus 126
structure length 383
sequence length 391
chains with identical sequence B
ec nomenclature ec 2.7.2.12: Acetate kinase (diphosphate).
pdb deposition date 2012-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4h0oA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4h0oA02
4CZFA 3QBWA 5AQOA 4FPBA 1X3NA 1ESVA 2YHYA 1T44A 1QZ5A 3CI5A 1ATSA 2E2QA 3VETA 3ZEUA 3UB5A 4H5VA 2QXLA 2IIRA 1NGAA 3BUZB 3DXMA 2FSKA 3C7NB 4FWQA 4FWSA 5JICA 3HZ6A 4DB3A 1ZC6A 2ASPA 3WEEB 2A42A 3H46O 4JNEA 1WOQA 3L0QA 4B1UB 4XH4A 4WQ5A 4QS8A 3EN9A 4CZJA 1NGGA 2E88A 3VF6A 3H6EA 2A6AA 4H0TB 4B1YB 2W40A 4O5FA 4J8FA 1BA1A 1XQSC 1LCUA 4FO0A 2ASMA 3VEWA 4O8KA 1NGBA 2AP1A 4BRGA 3QFUA 3CIPA 5KPTA 5AQHA 3BF1A 3M1FA 1BO5O 3GBTA 4BC2A 5E84A 4YDUC 4BRCA 3VERA 5BREA 1BWFO 4CZLA 1GLJO 4BC4A 4H5RA 2YJFA 5AQUA 5LJWA 5AQMA 2ASOA 4HTLA 3MN9A 3ULEB 1H1VA 3M3ZA 1YXQA 3LDOA 1OKJA 2YHXA 5EOYA 2NZTA 4DCHA 4GY2B 3A0IX 2Q1NA 2DPNA 1GLDG 2PBDA 3TPQA 1ZXOA 5AQFA 4EAHD 4F9OA 1KAYA 2E1ZA 2D1KA 2GELA 2VWBA 3VGLA 3L4IA 3LM2A 5LY3A 1JCFA 5FPMA 2D0OA 2QWLA 3QDKA 3RSEA 2YI1A 1NBWA 2CGJA 3FZKA 3DXKB 3H3NO 2FSJA 3HSCA 4A2BA 1X9JA 4BR0A 4H5TA 1U2VA 2P9PA 1RFQA 3UKUB 4BQLA 3GE1A 3CETA 5BR9A 4MO5A 1NGCA 4BRLA 5AQKA 2CH5A 3A8YA 3TU5A 2P9KA 1GLFO 1YVNA 1XC3A 5JMVA 4JD2B 3CJ9A 4BGBA 4BRKA 2H3GX 2E8AA 1SZ2A 5CE3A 3LDQA 1K8KA 1NGFA 4JD2A 3SMSA 3VGKA 3JS6A 1QQMA 5AFUH 2A40A 2P9KB 5BPMA 2P9LB 3LM9A 1JCGA 5AQYA 2KHOA 3VF4A 2WUSA 5JLHA 2P9PB 1U2VB 3UKUA 1J6ZA 3WXKA 5AQWA 4BR9A 5AZJB 2D4WA 2OANA 4AM6A 3FZLA 3KHYA 3DXKA 4BC5A 2J4RA 2PAVA 3MN7A 4CD1A 4M7YA 3D7EO 4BVPA 3VENA 4CZEA 5AQGA 4H0VB 4H5WA 2FXUA 4FSVA 4FWRA 4IZ9A 5ADXA 3GG4A 3U9ZA 3FZMA 4H0PA 2YCHA 5KQDA 3VEYA 4Y0WA 1NLVA 5BRFA 4KBOA 3CJ7A 1Q18A 3VEVA 3ZETB 4Z94A 4M7XA 5ELZA 2P9NA 3M6GA 4EHUA 5JLFA 1G99A 1NGEA 1GLBG 3U4LA 3P4IA 1HJOA 3J8AA 3ULEA 2Q36A 3VESA 4CZKA 3AARA 3H1QA 2P9NB 4BRAA 3ZETA 4WQ4A 1C0GA 1HX1A 4QS7A 2E20A 2IVOA 4L3QA 1LOTB 1MWMA 1HLUA 1YUWA 3LDNA 4QS9A 1NGJA 2D0PA 4PKIA 3BF3A 4DQ8A 3FR0A 2Q2RA 2QWRA 3LL3A 4AM7A 1NGDA 4IXCA 1MA9B 2CH6A 1NWKA 1ATNA 5AZJA 3LDLA 1MWKA 3S41A 4CD3A 3KVGA 2QWQA 1E4FT 3O80A 4CZGA 4C23A 4NB4A 4PL7A 4BRFA 4B1WB 1BOTO 1T6CA 4CZMA 3O1BA 2Q31A 2ZF5O 2GEMA 5EX5A 1YAGA 3EKUA 3A5LC 4FWMA 2P9LA 3FGUA 1QHAA 4ISEA 4CBWA 3IDHA 3IUCA 4HWIA 2HF4A 1K8KB 3G25A 3H1VX 2EWSA 4PKGA 1IG8A 3WEEA 1HUXA 2I7NA 4H0YB 3QB0A 3EO3A 1DEJA 5AQTA 4BVOA 3QICA 4XEIA 4K25A 2YHWA 3C7NA 4A62A 2BUPA 3DXMB 1XUPO 3ATUA 3GL1A 3H3OB 4WYBA 4B9QA 5F1XA 1SAZA 4RTFD 3O08A 4BG8A 5TKYA 1IJJA 5AQJA 4RWTA 1GLLO 1QZ6A 3UE5A 2V7YA 4BGAA 4BR2A 2IVNA 1GLAG 2AA4A 2CGKA 3W0LA 5AQQA 3EL2A 4B1ZA 1KXPA 4IJNA 4B1VA 4A2AA 3CQXA 3RSEB 2YJEA 4LC9B 2ZGZA 3FE1A 5FPNA 1RDWX 1NGHA 5BN9A 5AQXA 4EFHA 2P9UA 2BTFA 4ISGA 1R59O 3ZX3A 3R6MA 3DJCA 4A61A 3VEZA 1BDGA 5AQRA 5AQPA 2VCPA 4BR7A 1TUUA 3MDQA 4I6MB 1Y64A 4FPAA 4CI6A 4K43A 3BP8A 2P9IA 3W3DA 1Z6RA 5AQIA 2F9TA 4FWLA 5AQNA 5F2RA 3VEXA 3ID8A 3U9DA 1MDUB 5AZIA 4EIAA 4BR4A 3VGMA 3D2EB 3ZX2A 4BROA 3CJ1A 3R9PA 3A5NC 4CBXA 3HI0A 4WQ5C 3DWLA 4JHDA 2F9WA 2HF3A 4YDUA 5BRDA 5E26A 3O4WA 1TYQA 2E1YA 4CZIA 1QQOA 3R8EA 2Q0RA 3IMXA 4CBUA 2QWNA 5AR0A 1HKCA 3AAQA 1EQYA 5BN8A 3CJBA 4H0XB 3HM8A 1WUAA 3O1WA 4H03B 4RCHA 3KZBA 3A5OC 5LJVA 4MLHA 2Q97A 3MK6A 4GNIA 1D4XA 3O5BA 3LDPA 4PL8A 4IO8A 4K42A 4H0OA 1X3MA 1HPMA 1V4TA 4XH1A 4IJAA 4E1JA 4BRNA 3WXLA 5AQLA 2E2PA 4BRMA 4IWVA 2GWJA 2Q0UA 3WT0A 3MN5A 5EVZA 2NLXA 2ITMA 2A41A 3O6WA 3SJHA 3FLCO 4FWOA 3AY9A 2CGLA 3F9MA 4FL9A 4EHTA 3WXJA 4MLEA 4XH5A 4FOEA 3AAPA 2HOEA 5BRHA 3ZEUB 3D2FB 2UYTA 2QWMA 1ATRA 4M63C 4MO4A 5AQSA 2FLOA 3CQYA 3EKSA 3B8AX 3ATVA 3ENOA 3WQUA 2V7ZA 4BC3A 1BU6O 4CZHA 5FPEA 5AQVA 4ISFA 1P8ZA 4PKHA 1BG3A 3FZHA 2ZGYA 4BRPA 2A3ZA 1JCEA 3D2FA 1Z05A 4FWNA 4B1XB 1NGIA 3C0BA 4BR5A 5B8HA 1DGKN 1S22A 3GOIA 3MCPA 3DAWA 1KAZA 2HMPA 2E2OA 3FFKB 2I7PA 2P9SA 2QWOA 3MN6A 2IVPA 2QW9A 4FWKA 2FF3B 1GLEG 3QMLA 4BRDA 5F0XA 4FOIA 3U8XA 3EZWA 3HBTA 1NM1A 2NRHA 1QQNA 1BA0A 1S3XA 1HKGA 2GWKA 1SQKA 3UKRA 2E2NA 3VEOA 4DHYA 5EY4A 5BPNA 3CERA 2V51B 4FWPA 4JAXA 3SK3A 4JN4A 1HKBA 2GUPA 3CHWA 1TUYA 1ZBSA 3CJAA 1NMDA 2QM1A 3ZX0A 3SLCA 1TYQB 3L6QA 3JXUA 3QBXA 4JHDB 3I33A 1E4GT 4BG9A 1T6DA 1BUPA 5ADXH 5KQ8A 1V4SA 4CJ7A 2A5XA 4BRHA 3D2EA 3WUHA 5I9EB 5AZIB 3UKRB 5KPZA 4BREA 5FPDA 3CJCA 3SMPA 3BEXA 3VPZA 4K41A 5BPLA 1CZAN 3HTVA 5KPRA 2V52B 2P9IB 3WQTA 1GLCG 2QWPA 4I6MA 3H45C 1KAXA 5EXWA 3GDQA 3ENHA 2P9SB 1C0FA 3IFRA 2W41A 5AQZA 2GTDA 3I8BA 3VOVA 3A5MC 3OHRA 5AFUA 4NO7A 1U6ZA 3QFPA 1RGIA 2P9UB 3MMVA 4BQZA 4BRQA 1DKGD 3VF2A 4H5NA 2FF6A 2FSNA 3FZFA 3O8MA 4WQ4C 3WXIA 2VYPA 2ZWHA 4BRIA
chains in the Genus database with same CATH superfamily
4FJMA 4M3XA 2ZD1A 4DFMA 1X3NA 2IC3A 3SZ2A 1T44A 3PIOL 4PHTX 4AILC 4CJVA 3VETA 1RT2A 1T7PA 3ZEUA 2NRRA 4ILJA 1T8EA 4FW1A 4EP5A 1FW6A 1DLOA 3DXMA 3RTVA 3T69A 2FSKA 4FZZA 3SAFA 5JICA 4FJXA 4HCBA 4DB3A 3DM2A 2YNGA 1S1XA 3QIOA 3TAMA 4DG1A 1WOQA 4O8UA 3P1GA 2NRXA 4XH4A 3EN9A 2FBXA 1KCFA 4CFAA 3VF6A 4KTQA 3EE9A 4H0TB 2E5LK 4B1YB 3I8DA 4J8FA 5LMNK 4B08A 1LCUA 3TTDA 2YHBA 3VEWA 4O5BA 1NGBA 5M1PA 2AP1A 3CFOA 3BF1A 4DTSA 2ZJRL 1ZBUA 4DLGA 1Q8IA 2EHGA 1VSDA 3BY5A 3VERA 4YNQA 3OY9A 1YIJN 3AV9A 1BWFO 1KC8O 2A1SA 1C0TA 3WNHA 4G1QA 4IG3A 2ASOA 1NJYA 1SKRA 2HBMA 2NRWA 3KWGA 4E7JA 3M3ZA 3LDOA 2VWKA 2YHXA 1QVGM 2X78A 4GY2B 2DPNA 2IGIA 5AQFA 4FK0A 1HYZA 3NMUA 1Q86O 2VWBA 1X9SA 3O3FA 5LY3A 4OLAA 3TTFA 3CCMN 1VQ7N 2F8TA 2VG7A 4JI0K 1LWCA 4JV5K 4R5PA 5HRNA 4H5TA 3TAPA 2P9PA 1RDBA 2BDPA 3S3OA 2UXBK 1TKZA 4C1NK 1HR0K 4BRLA 4IEIA 3TU5A 4LF5K 1EWRA 2KZMA 4GV3A 4FK2A 4JK7A 4JD2B 2D0CA 1UAXA 2KFNA 2G8FA 3SAHA 1TL1A 3SMSA 3VGKA 3JS6A 2QKKA 1VSLA 3OA9A 1WLJA 2P9KB 3VQPA 5KGXA 2YKNA 3LM9A 3VF4A 1C0MA 2WUSA 4GVMA 2P9PB 1J6ZA 1TGOA 3AVGA 3ZT2A 2D4WA 3FZLA 1XI1A 2J4RA 4FJIA 3D7EO 4CZEA 1IG9A 4CEEA 4M3RA 3KLIA 2B6AA 4KHPK 1RT5A 1EWQA 1LV5A 1RBUA 1A5WA 3MWTA 4K0KK 5BRFA 1NLVA 2GV9A 4X62K 1K73O 1ASVA 4KBOA 2ZJQL 3THVA 4CESA 3CCLN 2P9NA 3MWPA 3VTHA 4EHUA 3QNOA 5C2FA 1NOZA 3L2UA 2P51A 3ULEA 5FRMA 1CLQA 1VQ8N 1HJRA 1NKCA 3VESA 3AARA 3H1QA 4CFDA 3R3LA 3AA2A 1C0GA 1HX1A 4EZ6A 4CJFA 4LFBK 3NHGA 4E7KA 2EX3A 4LFCK 1J5OA 5IT9O 4L3QA 1MWMA 1YUWA 3LDNA 4QS9A 4CIEA 1FJGK 1REVA 3V6DA 1NGJA 1J5EK 2D0PA 4PKIA 3BF3A 1QE1A 3FR0A 1M90O 2X6NA 3SUNA 2NNWA 3T3FA 2CH6A 1NJIO 3CG7A 2ITGA 5AZJA 4DV5K 2QWQA 1E4FT 2E4LA 4AHVA 3K5MA 1BOTO 2ETJA 4CZMA 3SUQA 4F4KA 3THWA 4K8XA 3EKUA 4NCGA 4A59A 1U45A 3TSQA 3ZSYA 2P9LA 1QHAA 4QOZB 4CJPA 3F2KA 3IUCA 2Z1GA 1U48A 3HL8A 3N4QA 1HUXA 3G4SN 4H0YB 3EO3A 3LWLA 3NGIA 1TK0A 4H8KA 4DV1K 1IO2A 1CZ9A 4JKCA 4WYBA 4K8ZA 2ZM6K 1CXQA 3RMBA 3OW2M 4BG8A 5TKYA 5AQJA 3UE5A 4FW2A 1HYSA 4BACA 2AA4A 4JKAA 1U04A 4TSXA 3OYKA 2CGKA 3EL2A 4KFBA 3TTCA 4B1VA 4F3OA 3L3VA 4DV2K 5BR8K 1IKWA 4WCEL 3FE1A 5AQXA 4EFHA 3EEQA 1YVUA 3R6MA 3ZX3A 2KW4A 2W42A 1IKXA 4A61A 3VEZA 4KV8A 3AA4A 5AQRA 3S3MA 4BR7A 3HRGA 3MDQA 3BP8A 2HMIA 2HNYA 3W3DA 2QKBA 2HHUA 3BZKA 4WFAL 4KTZA 2F9TA 4JLHA 1R0AA 5F2RA 3U9DA 3LP0A 3HJFA 3VGMA 3D2EB 2G8WA 2F9WA 2X74A 4YDUA 3NF7A 5CY4A 2E1YA 4CZIA 1VRTA 4CJLA 1QQOA 4YORA 4DWIA 3CYMA 2AJQA 4HUGA 3SBTA 3CJBA 3LDSA 4H03B 4Z4HA 4EZ9A 3KZBA 4GW6A 4N56A 5LJVA 4MLHA 3MK6A 4E1MA 1S6PA 4CHPA 4K42A 1L3VA 1HPMA 4IJAA 4BRNA 4BRMA 2GWJA 4KTWA 4DSEA 2Q0UA 3WT0A 4ELTA 3MN5A 5EVZA 5D3GA 4FWOA 4AH9A 4BDPA 4JI3K 4EHTA 3WXJA 4MLEA 4XH5A 3E01A 2HHWA 5GAEP 4DQPA 3ZSZA 3AO5A 3E9PA 1ATRA 1SL2A 3ZLJA 3CQYA 3SUPA 3AVIA 3B8AX 4CJKA 1ASWA 2V7ZA 3TSUA 3CCRN 1BU6O 1NJWA 3CCJN 4FYDA 3KK2A 1HNIA 5FPEA 2YX6A 2WC9A 2OA8A 1BG3A 3IS9A 4LSNA 4UY8O 5SWMA 3BGRA 3D2FA 4FWNA 3LPUA 1NGIA 3C0BA 5B8HA 1S22A 3CC2N 3ZSVA 2HMPA 3RMCA 3FFKB 2O8FA 2P9SA 2QWOA 1BIUA 1NG9A 2F7TA 4CJ3A 3KLFA 3B6OA 3AVCA 4CEDA 5M1OA 5F0XA 3J7YP 1O1WA 3VN5A 4ICLA 1SUQA 1QQNA 1S6QA 5SZTA 4YOVA 1HNWK 2YKMA 4IBNA 1SQKA 3CERA 3OYHA 4CJRA 2V51B 3WNGA 3SK3A 1VSMA 1RTHA 1HKBA 3C6UA 3CHWA 1TUYA 4CVNE 3OS0A 4F8RA 1NMDA 3DOKA 3L6QA 1OH5A 3QBXA 3THXB 4JKHA 4B9VA 1NKEA 2F8SA 4CJ7A 2A5XA 3ZCMA 4CJ4A 1TK8A 1RTDA 3HPOA 3K2PA 5AZIB 1JL2A 4BREA 3LWMA 3CJCA 4K41A 2X6SA 3HTVA 2G8VA 4JKFA 5KPRA 4KAZA 2V52B 3HK2A 2XY8A 2HHHK 1VSKA 2IAJA 4DUYK 3B6PA 3ENHA 3SV3A 1FXXA 1W0HA 4C8NA 3NDKA 3C94A 3OBYA 3ZSRA 3I8BA 3OHRA 4NO7A 3QFPA 4E7IA 3CCQN 4BQZA 4BRQA 3J80O 4C8MA 4H5NA 2FSNA 3FZFA 5CZ1A 3WXIA 4FVMA 4BDZA 2D0AA 2XY7A 1VQ4N 4ELUA 2Z1JA 4CZFA 3QBWA 5AQOA 1YI2N 4M41A 1NK6A 4XIUA 2O4IA 3D45A 2YHYA 1QZ5A 3CI5A 3PY8A 4M3TA 5C24A 3VQ6A 1J9AA 1L3SA 4CGGA 2NRTA 3QNNA 3HXMA 3BUZB 3QESA 3C7NB 4CJ5A 1K6YA 2PY5A 4AHRA 3HZ6A 3G71N 1ZC6A 3WEEB 4CFBA 2RHKA 2O8DB 3PSIA 1KSPA 2OPQA 4QS8A 1NGGA 1JLFA 2E88A 3SCXA 3OYDA 5I3UA 3H6EA 2A6AA 3LZIA 4GV9A 1RBVA 1VQ9N 4I2QA 1BA1A 4YFUA 3L4QA 1OVYA 2ASMA 4Z4GA 4GMJB 4WE1A 5M1NA 3QFUA 2QEXN 3THYB 3OYAA 3CCSN 3M8PA 4YOWA 1NK0A 4N76A 1J54A 1Q9XA 3CD6N 3E9OA 1XNQK 2WFBA 2GBZA 2UUCK 4BRCA 1GLJO 2JWKA 4H5RA 1KVCA 2HSTA 5DM6L 5HOOA 4M3ZA 3TSPA 3TAEA 3K5OA 1S1TA 5EU7A 3A0IX 4E0DA 1GLDG 1EX4A 1RDCA 1JLCA 5T7BA 2PBDA 3OJSA 4F9OA 4UQGA 1KAYA 2O8BA 3LM2A 4JS4A 1S72N 1QSYA 4PUOA 2DFHA 2QWLA 3QDKA 3RSEA 5KRSA 4U7BA 3SPYA 3FZKA 1Z26A 1WSFA 3T1HK 3KLHA 4A2BA 1LAWA 3CFRA 3ZYYX 4E3SA 1U2VA 3UKUB 4BQLA 4JRQA 4MO5A 1W7AA 4FJ8A 4QAGA 3A8YA 3KKSA 1QSLA 4NCAA 2H3GX 4FJ9A 4DSKA 1ZBHA 3KTQA 2NRZA 4IG0A 2P9LB 3TWHA 2RN2A 2HBJA 1JCGA 4N47A 3PX0A 3AO4A 3THWB 2KHOA 5JLHA 3Q7CA 4FJ7A 4CEQA 3K5NA 2BANA 4Z4FA 5AZJB 4JI2K 4KB1A 3MEGA 2LSNA 3KHYA 4CF2A 3DXKA 4BC5A 2QA4N 3P31A 2PAVA 3ZSQA 4M7YA 3PUFA 5HL7L 3VENA 4H0VB 1QVFM 3VQ7A 3RMDA 3MXIA 2RKIA 1G15A 2OPSA 1W9HA 4H0PA 4KH4A 5KQDA 3VEYA 4WFNL 3O4QA 1Q18A 3VEVA 3ZETB 4Z94A 5GIPA 1O13A 5JLFA 3DLBA 1QQCA 4AF1A 4DR4K 1UOCA 4ZHRA 3VQAA 2P9NB 4BRAA 3DLRA 3Q7BA 4WQ4A 3AVFA 1DTTA 4JKGB 4W5NA 3VQ9A 1RTIA 1NK8A 4DR6K 2IVOA 1LOTB 4HTUA 4AQYK 4IOAL 1HLUA 2Q2RA 2QWRA 3E9LA 4AM7A 1JLEA 1TL3A 3LP2A 4A57A 2ZJPL 4MQ3A 4CJUA 3U3YA 2VWJA 2JWLA 3TARA 1NWKA 4GV6A 2Z1HA 1DT9A 4NB4A 4DR1K 4BRFA 3V9WA 3L3UA 3PO4A 3SJJA 1NOYA 3I55N 1YAGA 3NAEA 3A5LC 4FWMA 3P5JA 4MDAA 3OYJA 3CFPA 2OCEA 3C6TA 4BWMA 4CEOA 4PKGA 4FM0A 1IG8A 4YY3K 4W5TA 1KFDA 3QB0A 5AQTA 1KQSM 1RBSA 3QICA 4XEIA 1S5JA 2YHWA 4A62A 1RDUA 1Y97A 4OLBA 3WXMB 4OO1J 5J1EA 3J81O 5F1XA 4ILGB 4RTFD 2GX9A 1D5AA 5JVHL 4RWTA 1OVQA 3IKMA 3LANA 1HQUA 5J2PA 3I0RA 4B1ZA 4CJEA 3F9KA 2R7YA 4CIFA 4RW8A 2YJEA 1BGXT 4LSLA 1WBDA 5HRSA 4M42A 3QIPA 3PIPL 3DJCA 4JKBA 4O55A 2HBLA 4W5OA 4RW4A 4CJSA 3HVRA 1TVRA 3LALA 4DU4A 1Y64A 1BL3A 2P9IA 3ISNC 1Z6RA 5AQIA 3I56N 4B3RK 1LW2A 4OPAA 3PV8A 2KFZA 4CK1A 4IFYA 3ID8A 3PO5A 2RF2A 4NYNA 4EIAA 3FFIA 4B9MA 1C0UA 1RBTA 2HHVA 5BRDA 4YOUA 5E26A 1KD1O 3O4WA 4DR2K 4CECA 1TV6A 1OH7A 4DF4A 2YHAA 5FLXO 3IMXA 1RILA 4CBUA 3L2WA 2QWNA 3MXJA 1HKCA 2PFUA 5BN8A 1A5VA 3HM8A 1WUAA 3O1WA 3H08A 4RCHA 1JXEA 4CIGA 2W6LA 4DTXA 5J2NA 1L3TA 3A5OC 4NCBA 3O5BA 4PL8A 2JLEA 3T19A 4H0OA 1V4TA 4E1JA 1N8RO 1XWLA 3WXLA 1NNEA 5AQLA 2E2PA 4IWVA 3DRPA 2NLXA 3AO1A 3SJHA 1ZBLA 1HPZA 4E19A 3OYGA 2E6LA 4FLUA 4JKEA 3DLGA 1KTQA 3VQCA 3OJUA 5BRHA 3RMAA 4KH5A 4Z4IA 3ASMA 3ZEUB 4NLBA 3NF6A 3RR8A 3S9HA 4MO4A 5AQSA 1N36K 2FLOA 1WB9A 1WAFA 3EKSA 4C8LA 4AHSA 4CZHA 3AGRA 4ISFA 2B4JA 3K0SA 4ID5A 2A3ZA 3NGZA 1Z05A 2KZZA 4BR5A 2HHXA 4DV6K 1XMQK 1DGKN 3GOIA 4DQIA 1VK0A 1WSEA 3MCAB 3SQ4A 1VQ5N 3MN6A 2IVPA 4FWKA 5M1QA 4DR3K 1GLEG 3OYCA 3G10A 1FKOA 2Y1JA 3EZWA 3HBTA 3ID6A 2BE2A 2NRHA 4AHUA 1RDAA 4FLWA 1XMOK 1HKGA 3SPZA 1A5XA 1KVAA 5BPNA 3UKRA 2E6MA 3KK7A 3VEOA 3I0SA 4RW9A 4NLCA 3AVAA 4ID1A 4JN4A 3P83D 3HOSA 3TABA 4O44A 1ZBSA 4IDHA 4DR7K 3F5TA 1RDDA 2QM1A 3SLCA 4WF9L 4CHYA 1BUPA 5ADXH 5KQ8A 1V4SA 3HYFA 4BRHA 2G8HA 4CHNA 3KIOA 1S9EA 5FPDA 3MEDA 2F96A 5K14A 1HNVA 1OH6A 1NK5A 1EKEA 4ILHA 2QWPA 4KI6A 3HP6A 2FBVA 1B9DA 4C1NI 2D0BA 2VQEK 4GKJK 4CGIA 3V9UA 1C0FA 3IFRA 5HROA 4M3WA 3VOVA 5AFUA 1YJ9N 1UA1A 2P9UB 5C2DA 1DKGD 1ILYA 2O8CA 4CF9A 4WQ4C 3SI6A 3AVLA 3PSFA 4Z0UA 4OJRA 4H4MA 4MFBA 1ESVA 3VQEA 1BI4A 4B9SA 2E2QA 3VTIA 2Z1IA 1VSJA 3UB5A 4H5VA 2QXLA 4IFEA 3C95A 4HHTA 1UA0A 1NGAA 2IS3A 4NYFA 5J2QA 4FWSA 4B8CA 1IBKK 1CZBA 3ZT0A 2ASPA 4FJJA 1SV5A 4JK9A 5DM7L 3D0PA 1EETA 5JVGL 4B1UB 4FJKA 4WQ5A 4CGDA 1I94K 3BDPA 3O9UA 3K9JA 3L8BA 4E7LA 3VA0A 2P5GA 4DF8A 1WNSA 4YOYA 4O5FA 1YTUA 2XY6A 4FO0A 3HVTA 1C1CA 1KVBA 4PY5A 1E3MA 4I9LA 4CGJA 5GINA 1EP4A 3L2QA 3CIPA 2G8UA 5KPTA 3MEEA 2Y1IA 3QEPA 4ELVA 4DR5K 1MU2A 4X66K 5CYMA 3DMJA 1NJZA 3KLEA 1WSGA 4YDUC 3NGYA 2HHQA 3JAMO 4CZLA 1JKHA 5AQUA 4OKKA 3AVJA 3LZJA 4B8AB 4E89A 4Q0BA 4DCHA 1TKTA 2OTJN 3CPWM 2Q1NA 2IOCA 3OYLA 1ZXOA 4EAHD 2E1ZA 2GELA 3TANA 4IEEA 3VGLA 3L4IA 3RRGA 4N41A 4JYAK 1VQKN 4DSJA 1JCFA 2YV0X 1W97L 3DLKA 1NBWA 2CGJA 4A5AA 1J53A 3AGKA 4R79A 4NXNK 3H3NO 3LAKA 3EYZA 2FSJA 4F3TA 4KHYA 1Q9YA 5DMRA 1VAZA 1RFQA 4E7HA 3RWUA 1JL1A 3E1YA 1VQ6N 2CH5A 3AO2A 2VQFK 1X1PA 1XC3A 4KHNA 3CF5L 1S9GA 3CM6A 4BGBA 5M1KA 1BCOA 2I5JA 2VG6A 1SZ2A 4OPKA 3JYTA 1VQON 3LDQA 1QQMA 3VQ8A 2A40A 4CF0A 1RBRA 3O9TA 2HW3A 1Z25A 1IBMK 4I7FA 4PQUA 4FZYA 3WXKA 4BR9A 3J7ZO 4PWDA 4LFAK 4JKDA 4AM6A 3MN7A 4CD1A 3CCVN 2QK9A 4BVPA 3OBWA 5AQGA 2FXUA 3O4NA 4FSVA 3NVKA 4OKJA 4IZ9A 3GG4A 3U9ZA 1VQPN 4PA1A 4BY9C 3T7ZA 3CJ7A 2VG5A 4OPJA 3WNEA 4JI8K 4M7XA 4DQRA 1G99A 1K8AO 1GLBG 3P4IA 1HJOA 5IWAK 2Q36A 2HNZA 5C10A 3T1AA 3TAFA 4QS7A 1X9MA 3KD5E 4YHHK 3P39A 4FJ5A 4C8OA 1KFSA 4FK4A 1VHXA 3ALYA 1RT1A 4B3SK 4DUZK 3DLEA 1WSHA 1NGDA 4KHQA 3SV4A 1MA9B 1NK7A 1ATNA 3LDLA 1MWKA 1WAJA 3S41A 1VQLN 3O80A 4FLVA 1GOCA 3JSMA 3E66A 4C23A 2RE2A 4M3UA 4PL7A 3OS2A 1T6CA 3O1BA 1CXUA 2GEMA 5EX5A 4OPHA 1TKXA 3OYBA 1NJXA 3SBGA 1FKPA 3IDHA 4HCCA 3HO1A 2HF4A 1K8KB 2EWSA 4DU1A 3TI0A 4JI6K 4KHSA 4K25A 3C7NA 4DMNA 3KKRA 1XUPO 3ATUA 3GL1A 1N33K 5C25A 3O08A 1TKDA 4RG8A 4BGAA 1QZ6A 4BR2A 2IVNA 4I9QA 4B9UA 3KLGA 4OX9K 3W0LA 1KXPA 4IJNA 3AA5X 3V9ZA 4C8KA 2OPRA 2ZGZA 5C12A 1RDWX 3A2FA 2P9UA 2BTFA 4CFCA 3KK3A 1BQMA 1Q81O 2VCPA 4K43A 1QTMA 3VQDA 4CK2A 1WSJA 2UXDK 3DLHA 4IOXA 3ZT4A 1L3UA 3AVHA 3VEXA 1MDUB 5A2QO 4FCYA 4BR4A 3LAMA 4BROA 3AA3A 3A5NC 3ZSOA 3TAQA 4CBXA 4WQ5C 3DWLA 5KGWA 2P5OA 3R8EA 2FBTA 4KKOA 5AR0A 1RT3A 3AAQA 1Q82O 1EQYA 1LWFA 1HRHA 4YOTA 3K58A 4H0XB 4CEFA 2DY4A 4Y1DA 3KWIA 2HHTA 4CHZA 1LAVA 4IO8A 2UUAK 4XH1A 4DU3A 1YHQN 2A41A 3FLCO 3AY9A 4JK8A 2O8FB 3F9MA 3N4PA 4N5SA 4QCLA 4B3MK 4FOEA 2G8KA 4CEAA 2HOEA 2OTLN 5H1SQ 1BHLA 3D2FB 5E41A 2UYTA 2QWMA 1BI4B 3OYFA 4L8RB 3ATVA 3ENOA 1VSIA 3WQUA 3QERA 1IH7A 1P8ZA 2HHSA 4FJNA 4BRPA 3RVCA 1U47A 4B1XB 3DI6A 4M3YA 3CXCM 3MCPA 3DAWA 3CM5A 3AVKA 1FK9A 2I7PA 5GADP 3CCEN 4M45A 2FF3B 3QMLA 4BRDA 3U8XA 4DKWA 1KRPA 2W6KA 1ASUA 1NU0A 2HNDA 3R1XA 4FJHA 3OYNA 2GWKA 4DHYA 1N34K 1HYVA 4FWPA 4JAXA 4Z4CA 1RT7A 2GUPA 4KI4A 1SL0A 3MX5A 4DTMA 1N6QA 3NBPA 1QS4A 3I33A 1E4GT 4BG9A 1HMVA 3U3GA 3QETA 2ZE2A 3D2EA 3QEWA 3M8SA 5I9EB 3V9XA 4FJGA 4NXMK 4DS5A 3MXMA 2FC0A 1RT4A 5CHIA 3UIQA 2PYLA 3BEXA 1CZAN 2JGUA 1GOAA 2P9IB 3CMEN 5HP1A 3NE6A 3PLAA 4B9NA 4CF8A 2QI2A 5EXWA 3GDQA 4O0JA 1X9WA 4DV7K 2W41A 5AQZA 1S1WA 2GTDA 4FLYA 3F73A 1U6ZA 5GAHP 1JLAA 4CF1A 3C65A 1KLNA 2FF6A 3KK1A 3L2RA 4DFJA 2B5JA 4IFVA 4O0IA 4BRIA 4CJWA 4RW7A 2QTDA 2VGNA 4FPBA 4MDBA 5CYQA 3K57A 1YJWN 3PX4A 1RT6A 3QEXA 1ATSA 4AHTA 3NFAA 3NH0A 1WSIA 2YNHA 1LW0A 3EZ5A 3LPTA 2IIRA 4H4OA 2KTQA 4FWQA 3NVMA 3VMFB 4KRFA 2A42A 3V1QA 3H46O 2WTUA 1N32K 4JI7K 5C15A 4JNEA 4AHCA 3L0QA 1TAUA 3O3HA 3J7AP 4CZJA 1KLMA 3ZT3A 1N5YA 2BH1A 4GKKK 1UWBA 1WBBA 1T05A 2W40A 5M1FA 5HLFA 1XQSC 3VQ5A 5HRRA 4O8KA 4BRGA 1JLBA 1GOBA 5AQHA 3M1FA 1HQEA 1BO5O 3GBTA 1NKBA 4BC2A 5E84A 3SAGA 4J2DA 5BREA 4JKGA 1T03A 2G8IA 4LF7K 4BC4A 1TK5A 2YJFA 5LJWA 1RCHA 1SKSA 5AQMA 3WNFA 4HTLA 3MN9A 3ULEB 5KI6A 1H1VA 4FLXA 1YXQA 1OKJA 4KH6A 3NCIA 3MAQA 4CCHA 5EOYA 2NZTA 1L5UA 4CGHA 1JLQA 3VQ4A 3KD1E 4DS4A 3TPQA 2PYJA 2D1KA 4DSFA 2YNIA 4J2EA 3M8RA 5FPMA 2D0OA 3M5RA 3OS1A 2YI1A 3ITHA 1T3VA 3DXKB 2FBYA 4CHQA 3HSCA 1X9JA 5HBMA 4BR0A 3QO9A 4CERA 1B92A 1QHTA 3GE1A 3LP3A 4W5RA 1YJNN 4OGEA 4LF8K 3CETA 5BR9A 4HUEA 1NGCA 5AQKA 2P9KA 1GLFO 1YVNA 4CHOA 3HM9A 4FM2A 3HSTB 3PX6A 5JMVA 3CJ9A 1BIZA 2XRIA 4I2PA 4BRKA 4FXDA 3NH1A 2E8AA 2HVIA 5CE3A 1K8KA 5KTQA 1NGFA 3G0ZA 4JD2A 3NH2A 2ZQBA 5C0YA 5AFUH 1C1AA 1XHXA 5BPMA 4BWJA 1HNZK 4WFBL 3P38A 5AQYA 4ZTFA 3UKUA 1U2VB 3QINA 5AQWA 4CJTA 2IDOA 5FDLA 4YOXA 4BDYA 3VQQA 2OANA 4W5QA 3OYIA 3K59A 4LY7A 5GIOA 3CMAN 2OYQA 4H5WA 1YITN 1BISA 1YT3A 4JEPA 4FWRA 4LH5A 1YF5L 5ADXA 2O8BB 3FZMA 5CZ2A 2YCHA 4A5BA 3ULDA 1SKWA 4Y0WA 3MECA 3SQ2A 1S1UA 2YNFA 3V9SA 5ELZA 3M6GA 3AVBA 2XY5A 1NGEA 2D5RA 3U4LA 5C42A 4LF6K 3J8AA 4CZKA 5HRPA 3U6FA 3ZETA 5LMUK 1U4BA 3SNNA 5I42A 1EO1A 2E20A 2OPPA 3HT3A 1ZBFA 5FROA 1ITGA 4X65K 3NF9A 2Q3SA 4DQ8A 2OZSA 3LL3A 4DV0K 3T1YK 4IXCA 1TAQA 4Y1CA 4B9TA 4KHWA 4BE0A 4CEBA 2HBKA 4FLZA 3SYZA 1RTJA 4CD3A 3KVGA 4CZGA 2P1JA 4B1WB 4OKEA 2Q31A 1I3AA 2ZF5O 4DSLA 2NUBA 4E1NA 1S1VA 1U49A 2A1RA 3O3GA 3FGUA 3CC7N 4ISEA 4CBWA 4B9LA 4HWIA 3LP1A 1IV0A 4HVJA 4JI5K 3G25A 3H1VX 3WEEA 4OVLA 2I7NA 1DEJA 4FM1A 4BVOA 1SL1A 2KKZA 2XHBA 2BUPA 3DXMB 3HPGA 1WN7A 3SQ0A 1JLGA 3H3OB 4B9QA 4LF9K 2KQ2A 1SAZA 1IJJA 4JS5A 1GLLO 1JXBA 1VRUA 2V7YA 1LWEA 1P90A 4DFKA 1GLAG 1JJ2M 4IKFA 4DV3K 4KREA 3IG1A 5AQQA 1EXQA 1VQMN 3OVNA 4A2AA 4DQQA 3RSEB 3CQXA 4LC9B 1BCMA 5FPNA 2WONA 1M1KO 1VSEA 5BN9A 1NGHA 4ZTJA 4ISGA 4X64K 1R59O 4JRPA 3S3NA 4J2AA 4V19S 3AO3A 4DFPA 4Q5VA 2DFEA 1BDGA 5AQPA 3HOTA 1XHZA 3DOLA 1HNXK 1TUUA 4I6MB 4JI1K 3G6EN 5CR4A 4FPAA 4CI6A 3QEIA 3HPHA 2UXCK 2WBNA 3L2VA 2DFFA 4FWLA 5AQNA 3EY1A 4IDKA 4KHUA 5AZIA 3ZX2A 4CJQA 4DV4K 1D8YA 4KB0A 1XC9A 3CJ1A 3R9PA 3VQBA 1NK4A 3HI0A 4JHDA 4IOCL 2HF3A 4DLEA 2VGMA 3THXA 4LF4K 3C6HA 3OYMA 4OGCA 1C6VA 2NRVA 1TYQA 4DTNA 3THYA 2Q0RA 4CE9A 2UUBK 4B3OA 3SUOA 3ZSWA 1XNRK 2ATQA 3QEVA 4Z4EA 3C6AA 2Q97A 4GNIA 1D4XA 3LDPA 5JS2A 3V4IA 3ZT1A 4DSIA 1X3MA 1DTQA 3IAYA 1IKYA 3BZCA 2UU9K 2O8DA 3NF8A 1SS6A 5GAGP 3M8QA 4BE1A 2ITMA 3O6WA 1ZYQA 1QSSA 3RRHA 3HP9A 3O9SA 2CGLA 2O8EA 4FL9A 1BQNA 2BGGA 4B3TK 3AAPA 3V1OA 5J2MA 1D9FA 3OYEA 2XO7A 4G9ZA 1I39A 1C1BA 4CK3A 2RPIA 4DTUA 1D9DA 1W2BM 3O9QA 4FZXC 4M63C 4RW6A 4FJLA 4BC3A 5TKWA 1IBLK 4DQSA 5AQVA 4F2SA 2HB5A 4PKHA 1VSFA 3FZHA 1B9FA 2ZGYA 1IKVA 1JCEA 3VA3A 4LH4A 4CEZA 2O8CB 3SQ1A 3ENBA 3KJVA 1F21A 1KAZA 3MX2A 3DLLL 2E2OA 2O8EB 3CPEA 1OH8A 4LD0A 2QW9A 3CCUN 4FVUA 4FOIA 1YTAA 4KPYA 3K5LA 4DTJA 1NM1A 2O4GA 1Q7YO 4U67L 4DTPA 1BA0A 1S3XA 3DYAA 1NMNA 5JS1A 2E2NA 5EY4A 3OTOK 2QXFA 3DRSA 3EE8A 3TAGA 3V81A 4FLTA 4CW7B 1VSHA 3CJAA 2F4VK 3V1RA 5MLCQ 3ZX0A 4GVEA 4DTOA 1TYQB 4KO0A 3JXUA 4DTRA 3D6RA 3O9RA 4JHDB 5AJ3K 1T6DA 3QLHA 4CGFA 4HUFA 4JI4K 2OZMA 1RNHA 5LL6Z 4IO9L 3WUHA 2DTUA 3IRXA 3UKRB 5KPZA 5KRTA 1K9MO 3SMPA 3VPZA 3DRRA 5BPLA 2GUIA 1ZBIA 3WQTA 2HVHA 1GLCG 4F2RA 4I6MA 3H45C 4J2BA 3K9KA 3CC4N 4BE2A 1KAXA 1NK9A 2P9SB 3AVMA 4EP4A 2PZSA 3A5MC 1VQNN 1RGIA 2KLAA 3MMVA 5DK5A 3ZSXA 3RR7A 3VF2A 3AVNA 5FRNA 3TR8A 3O8MA 3CQ8A 4O4GA 2VYPA 2WOMA 2ZWHA
chains in the Genus database with same CATH topology
1VQ4N 2QTDA 4CZFA 3QBWA 2VGNA 4FPBA 4MDBA 5AQOA 1YI2N 1X3NA 1ESVA 2YHYA 1YJWN 1T44A 1QZ5A 4PHTX 3PIOL 3CI5A 1ATSA 2E2QA 3VETA 3VTIA 3ZEUA 3UB5A 4H5VA 2NRRA 2QXLA 4IFEA 4ILJA 2NRTA 2IIRA 1NGAA 3BUZB 3DXMA 3T69A 2FSKA 3C7NB 4FWQA 3NVMA 3SAFA 4FWSA 5JICA 3VMFB 3HZ6A 3G71N 4DB3A 1ZC6A 2ASPA 3WEEB 4JK9A 2A42A 3H46O 5C15A 4JNEA 5DM7L 1WOQA 4O8UA 2RHKA 2NRXA 3L0QA 4XH4A 4B1UB 5JVGL 4WQ5A 4QS8A 3EN9A 4CZJA 3O9UA 1NGGA 2E88A 3K9JA 3VF6A 3EE9A 2BH1A 2A6AA 3H6EA 4H0TB 4B1YB 4YOYA 4GV9A 2W40A 5M1FA 4O5FA 4J8FA 1BA1A 1XQSC 1VQ9N 1LCUA 3L4QA 3TTDA 1OVYA 4FO0A 2ASMA 3VEWA 4O8KA 1NGBA 5GINA 5M1PA 2AP1A 4BRGA 5M1NA 3QFUA 3CIPA 2QEXN 5KPTA 5AQHA 3BF1A 3M1FA 3CCSN 1BO5O 2ZJRL 4YOWA 3GBTA 4BC2A 3CD6N 3E9OA 2WFBA 5E84A 3SAGA 4YDUC 4BRCA 3VERA 1YIJN 5BREA 1BWFO 4JKGA 1KC8O 4CZLA 1GLJO 2JWKA 4BC4A 4H5RA 2YJFA 2HSTA 5AQUA 5LJWA 5DM6L 5AQMA 5HOOA 2ASOA 4HTLA 2HBMA 2NRWA 3KWGA 3MN9A 3TSPA 1H1VA 3M3ZA 3ULEB 1YXQA 3LDOA 1OKJA 4KH6A 2YHXA 5EOYA 2NZTA 4DCHA 1QVGM 4GY2B 2OTJN 3CPWM 3A0IX 2Q1NA 2DPNA 1GLDG 2PBDA 3TPQA 1ZXOA 5AQFA 4EAHD 4F9OA 3NMUA 1KAYA 1Q86O 2E1ZA 2D1KA 2GELA 2VWBA 4IEEA 3VGLA 3L4IA 3LM2A 1VQKN 5LY3A 1JCFA 1S72N 5FPMA 2D0OA 2QWLA 3QDKA 3M5RA 1W97L 2YI1A 3RSEA 1NBWA 3TTFA 3CCMN 1VQ7N 2CGJA 4A5AA 1T3VA 4U7BA 3FZKA 3DXKB 3AGKA 4R79A 3H3NO 2FSJA 3HSCA 4A2BA 1X9JA 4BR0A 1VQNN 3ZYYX 1VAZA 4H5TA 1U2VA 2P9PA 1RFQA 3UKUB 4BQLA 3GE1A 1YJNN 3CETA 5BR9A 4C1NK 4MO5A 1NGCA 3E1YA 4IEIA 4BRLA 5AQKA 2CH5A 1VQ6N 3A8YA 3TU5A 2P9KA 1GLFO 1YVNA 4GV3A 1XC3A 4JK7A 4JD2B 3CJ9A 4BGBA 4BRKA 5JMVA 5M1KA 2H3GX 3CF5L 2E8AA 1SZ2A 1VQON 5CE3A 3LDQA 1K8KA 1NGFA 4JD2A 3SAHA 5C0YA 3SMSA 3VGKA 3JS6A 1QQMA 3OA9A 5AFUH 2A40A 2NRZA 2P9KB 2P9LB 5BPMA 3LM9A 4WFBL 3P38A 3O9TA 2HBJA 1JCGA 5AQYA 2KHOA 3VF4A 2WUSA 5JLHA 2P9PB 1U2VB 3Q7CA 3UKUA 1J6ZA 3WXKA 5AQWA 4BR9A 5AZJB 3J7ZO 4YOXA 2D4WA 2OANA 4JKDA 4AM6A 3FZLA 3KHYA 3DXKA 4BC5A 2J4RA 3P31A 2PAVA 2QA4N 3MN7A 4CD1A 3CCVN 4M7YA 3D7EO 4BVPA 5GIOA 3CMAN 5HL7L 3OBWA 3VENA 4CZEA 5AQGA 4H0VB 4H5WA 1QVFM 2FXUA 1YITN 4FSVA 4JEPA 3NVKA 4FWRA 4IZ9A 1YF5L 5ADXA 3GG4A 3U9ZA 1VQPN 3FZMA 4H0PA 4KH4A 2YCHA 4A5BA 5KQDA 3MWTA 3VEYA 4Y0WA 1NLVA 5BRFA 4WFNL 1K73O 4BY9C 4KBOA 3T7ZA 3CJ7A 2ZJQL 1Q18A 3VEVA 3ZETB 4Z94A 3CCLN 4M7XA 5ELZA 2P9NA 3M6GA 3MWPA 3VTHA 4EHUA 1O13A 5JLFA 5C2FA 1G99A 5GIPA 4AF1A 1NGEA 1GLBG 3U4LA 3P4IA 1K8AO 1HJOA 3J8AA 3ULEA 2Q36A 1VQ8N 3VESA 4CZKA 3AARA 3H1QA 2P9NB 4BRAA 5C10A 3ZETA 3R3LA 3Q7BA 4WQ4A 1C0GA 1HX1A 4JKGB 4QS7A 1EO1A 2E20A 3P39A 2IVOA 4L3QA 1LOTB 4IOAL 1MWMA 1HLUA 1YUWA 3LDNA 4QS9A 1NGJA 2D0PA 4PKIA 3BF3A 4DQ8A 3FR0A 1M90O 2Q2RA 2QWRA 3E9LA 3LL3A 4AM7A 1NGDA 4A57A 4IXCA 2ZJPL 2NNWA 2HBKA 1MA9B 2CH6A 2JWLA 1NJIO 1NWKA 1ATNA 5AZJA 3LDLA 1MWKA 4GV6A 3S41A 4CD3A 2QWQA 3KVGA 1DT9A 1E4FT 3O80A 4CZGA 3E66A 4C23A 1VQLN 2RE2A 4NB4A 4PL7A 4BRFA 4B1WB 1BOTO 1T6CA 4CZMA 3O1BA 2Q31A 2ZF5O 2GEMA 5EX5A 1YAGA 3EKUA 3I55N 4OPHA 4A59A 3A5LC 3TSQA 4FWMA 2P9LA 3FGUA 1QHAA 4MDAA 3CC7N 4ISEA 3SBGA 3IDHA 4CBWA 3F2KA 3IUCA 4HWIA 2HF4A 1K8KB 3G25A 2EWSA 3H1VX 4PKGA 1IG8A 3WEEA 3N4QA 1HUXA 2I7NA 4H0YB 3QB0A 3EO3A 1DEJA 5AQTA 3G4SN 1KQSM 4BVOA 3QICA 2KKZA 4XEIA 4K25A 2YHWA 3C7NA 4A62A 1RDUA 2BUPA 3DXMB 3WXMB 1XUPO 4OO1J 3ATUA 3GL1A 4JKCA 3H3OB 4WYBA 4B9QA 5F1XA 4ILGB 1SAZA 4RTFD 2GX9A 3O08A 3OW2M 4BG8A 5JVHL 5TKYA 1IJJA 5AQJA 4RWTA 1GLLO 1QZ6A 3UE5A 2V7YA 4BGAA 1P90A 3IKMA 4BR2A 2IVNA 1GLAG 1JJ2M 2AA4A 4JKAA 2CGKA 3W0LA 5AQQA 3EL2A 1VQMN 3TTCA 1KXPA 4IJNA 4B1ZA 4B1VA 4A2AA 3CQXA 3RSEB 2YJEA 4LC9B 2ZGZA 3FE1A 5FPNA 4WCEL 5C12A 1M1KO 1RDWX 1NGHA 5BN9A 5AQXA 4EFHA 2P9UA 2BTFA 3PIPL 4ISGA 1R59O 3ZX3A 3R6MA 3DJCA 4JKBA 4A61A 2HBLA 3VEZA 1Q81O 1BDGA 5AQRA 5AQPA 2VCPA 3HOTA 4BR7A 3HRGA 1TUUA 3MDQA 4I6MB 3G6EN 1Y64A 5CR4A 4FPAA 4CI6A 4K43A 3BP8A 2P9IA 3W3DA 1Z6RA 2WBNA 4WFAL 5AQIA 3I56N 2F9TA 4FWLA 4IOXA 4OPAA 5AQNA 5F2RA 3VEXA 3ID8A 3U9DA 1MDUB 5AZIA 4EIAA 4BR4A 3VGMA 3D2EB 3ZX2A 4BROA 3CJ1A 3R9PA 3A5NC 4CBXA 3HI0A 4WQ5C 3DWLA 4JHDA 2F9WA 2HF3A 4IOCL 2VGMA 4YDUA 5BRDA 3C6HA 4YOUA 5E26A 1KD1O 2NRVA 3O4WA 1TYQA 2E1YA 4CZIA 1QQOA 4YORA 2Q0RA 3R8EA 3IMXA 4CBUA 2QWNA 5AR0A 1HKCA 2PFUA 3AAQA 1EQYA 4YOTA 3SBTA 5BN8A 1Q82O 3CJBA 4H0XB 3HM8A 1WUAA 3O1WA 4H03B 4RCHA 3KZBA 3A5OC 5LJVA 3C6AA 2Q97A 4MLHA 3KWIA 3MK6A 4GNIA 1D4XA 3O5BA 3LDPA 4PL8A 4IO8A 4K42A 4H0OA 1X3MA 1HPMA 1V4TA 4XH1A 4IJAA 4E1JA 4BRNA 3WXLA 1N8RO 5AQLA 2E2PA 4BRMA 4IWVA 2GWJA 1YHQN 2Q0UA 3WT0A 1SS6A 3MN5A 5EVZA 2NLXA 5GAGP 2ITMA 2A41A 3O6WA 3SJHA 3FLCO 4FWOA 3AY9A 3O9SA 4JK8A 2CGLA 4JKEA 3F9MA 3N4PA 4FL9A 3WXJA 4EHTA 4MLEA 4XH5A 4FOEA 3AAPA 2HOEA 5BRHA 2OTLN 4KH5A 5H1SQ 5GAEP 4G9ZA 3ZEUB 4NLBA 3D2FB 2UYTA 2QWMA 3O9QA 1W2BM 3E9PA 1ATRA 4M63C 4MO4A 5AQSA 2FLOA 3CQYA 3EKSA 3B8AX 3ATVA 3ENOA 3WQUA 2V7ZA 4BC3A 5TKWA 3TSUA 1BU6O 3CCRN 3CCJN 4CZHA 3AGRA 5FPEA 2YX6A 2WC9A 1P8ZA 4ISFA 5AQVA 4PKHA 1BG3A 3FZHA 2ZGYA 4UY8O 4BRPA 2A3ZA 1JCEA 3D2FA 1Z05A 3RVCA 4FWNA 4B1XB 1NGIA 3C0BA 4BR5A 5B8HA 1DGKN 1S22A 3CXCM 3GOIA 3CC2N 3MCPA 3ENBA 3DAWA 1KAZA 2HMPA 3MX2A 2E2OA 3FFKB 3CPEA 3MCAB 2I7PA 5GADP 3DLLL 3CCEN 2P9SA 2QWOA 1VQ5N 3MN6A 2IVPA 2QW9A 4FWKA 2FF3B 5M1QA 1GLEG 2F7TA 3CCUN 3QMLA 4BRDA 5F0XA 4FVUA 5M1OA 4FOIA 3U8XA 4DKWA 3EZWA 3HBTA 3ID6A 1NM1A 1Q7YO 2NRHA 4U67L 1QQNA 1BA0A 1S3XA 3R1XA 4YOVA 1HKGA 2GWKA 1SQKA 3UKRA 2E2NA 3KK7A 3VEOA 5EY4A 4DHYA 5BPNA 3CERA 3EE8A 2V51B 4FWPA 4JAXA 4NLCA 3SK3A 4JN4A 1HKBA 2GUPA 3HOSA 3CHWA 1TUYA 1ZBSA 3CJAA 4IDHA 1NMDA 3F5TA 5MLCQ 2QM1A 3ZX0A 3SLCA 4GVEA 3MX5A 1TYQB 4WF9L 3L6QA 3JXUA 3QBXA 3D6RA 3O9RA 4JHDB 3I33A 1E4GT 4JKHA 4BG9A 1T6DA 1BUPA 5ADXH 5KQ8A 1V4SA 4CJ7A 2A5XA 4BRHA 3D2EA 4IO9L 3WUHA 5I9EB 5AZIB 3UKRB 5KPZA 4BREA 5FPDA 1K9MO 5CHIA 3CJCA 3SMPA 3BEXA 3VPZA 4K41A 5BPLA 1CZAN 3HTVA 4JKFA 5KPRA 2V52B 2P9IB 3WQTA 1GLCG 3CMEN 4ILHA 2QWPA 4I6MA 3H45C 3PLAA 4C1NI 3K9KA 3CC4N 1KAXA 2QI2A 5EXWA 3ENHA 3GDQA 2P9SB 1C0FA 3IFRA 2W41A 3OBYA 2GTDA 5AQZA 3I8BA 3VOVA 3A5MC 3OHRA 5AFUA 4NO7A 1U6ZA 3QFPA 5GAHP 1YJ9N 1RGIA 2KLAA 2P9UB 3MMVA 4BQZA 4BRQA 5C2DA 1DKGD 3CCQN 3C65A 1ILYA 3VF2A 4H5NA 2FF6A 2FSNA 3FZFA 3O8MA 4WQ4C 3WXIA 2VYPA 2ZWHA 4BRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZF A;  3QBW A;  5AQO A;  4FPB A;  1X3N A;  1ESV A;  2YHY A;  1T44 A;  1QZ5 A;  3CI5 A;  1ATS A;  2E2Q A;  3VET A;  3ZEU A;  3UB5 A;  4H5V A;  2QXL A;  2IIR A;  1NGA A;  3BUZ B;  3DXM A;  2FSK A;  3C7N B;  4FWQ A;  4FWS A;  5JIC A;  3HZ6 A;  4DB3 A;  1ZC6 A;  2ASP A;  3WEE B;  2A42 A;  3H46 O;  4JNE A;  1WOQ A;  3L0Q A;  4B1U B;  4XH4 A;  4WQ5 A;  4QS8 A;  3EN9 A;  4CZJ A;  1NGG A;  2E88 A;  3VF6 A;  3H6E A;  2A6A A;  4H0T B;  4B1Y B;  2W40 A;  4O5F A;  4J8F A;  1BA1 A;  1XQS C;  1LCU A;  4FO0 A;  2ASM A;  3VEW A;  4O8K A;  1NGB A;  2AP1 A;  4BRG A;  3QFU A;  3CIP A;  5KPT A;  5AQH A;  3BF1 A;  3M1F A;  1BO5 O;  3GBT A;  4BC2 A;  5E84 A;  4YDU C;  4BRC A;  3VER A;  5BRE A;  1BWF O;  4CZL A;  1GLJ O;  4BC4 A;  4H5R A;  2YJF A;  5AQU A;  5LJW A;  5AQM A;  2ASO A;  4HTL A;  3MN9 A;  3ULE B;  1H1V A;  3M3Z A;  1YXQ A;  3LDO A;  1OKJ A;  2YHX A;  5EOY A;  2NZT A;  4DCH A;  4GY2 B;  3A0I X;  2Q1N A;  2DPN A;  1GLD G;  2PBD A;  3TPQ A;  1ZXO A;  5AQF A;  4EAH D;  4F9O A;  1KAY A;  2E1Z A;  2D1K A;  2GEL A;  2VWB A;  3VGL A;  3L4I A;  3LM2 A;  5LY3 A;  1JCF A;  5FPM A;  2D0O A;  2QWL A;  3QDK A;  3RSE A;  2YI1 A;  1NBW A;  2CGJ A;  3FZK A;  3DXK B;  3H3N O;  2FSJ A;  3HSC A;  4A2B A;  1X9J A;  4BR0 A;  4H5T A;  1U2V A;  2P9P A;  1RFQ A;  3UKU B;  4BQL A;  3GE1 A;  3CET A;  5BR9 A;  4MO5 A;  1NGC A;  4BRL A;  5AQK A;  2CH5 A;  3A8Y A;  3TU5 A;  2P9K A;  1GLF O;  1YVN A;  1XC3 A;  5JMV A;  4JD2 B;  3CJ9 A;  4BGB A;  4BRK A;  2H3G X;  2E8A A;  1SZ2 A;  5CE3 A;  3LDQ A;  1K8K A;  1NGF A;  4JD2 A;  3SMS A;  3VGK A;  3JS6 A;  1QQM A;  5AFU H;  2A40 A;  2P9K B;  5BPM A;  2P9L B;  3LM9 A;  1JCG A;  5AQY A;  2KHO A;  3VF4 A;  2WUS A;  5JLH A;  2P9P B;  1U2V B;  3UKU A;  1J6Z A;  3WXK A;  5AQW A;  4BR9 A;  5AZJ B;  2D4W A;  2OAN A;  4AM6 A;  3FZL A;  3KHY A;  3DXK A;  4BC5 A;  2J4R A;  2PAV A;  3MN7 A;  4CD1 A;  4M7Y A;  3D7E O;  4BVP A;  3VEN A;  4CZE A;  5AQG A;  4H0V B;  4H5W A;  2FXU A;  4FSV A;  4FWR A;  4IZ9 A;  5ADX A;  3GG4 A;  3U9Z A;  3FZM A;  4H0P A;  2YCH A;  5KQD A;  3VEY A;  4Y0W A;  1NLV A;  5BRF A;  4KBO A;  3CJ7 A;  1Q18 A;  3VEV A;  3ZET B;  4Z94 A;  4M7X A;  5ELZ A;  2P9N A;  3M6G A;  4EHU A;  5JLF A;  1G99 A;  1NGE A;  1GLB G;  3U4L A;  3P4I A;  1HJO A;  3J8A A;  3ULE A;  2Q36 A;  3VES A;  4CZK A;  3AAR A;  3H1Q A;  2P9N B;  4BRA A;  3ZET A;  4WQ4 A;  1C0G A;  1HX1 A;  4QS7 A;  2E20 A;  2IVO A;  4L3Q A;  1LOT B;  1MWM A;  1HLU A;  1YUW A;  3LDN A;  4QS9 A;  1NGJ A;  2D0P A;  4PKI A;  3BF3 A;  4DQ8 A;  3FR0 A;  2Q2R A;  2QWR A;  3LL3 A;  4AM7 A;  1NGD A;  4IXC A;  1MA9 B;  2CH6 A;  1NWK A;  1ATN A;  5AZJ A;  3LDL A;  1MWK A;  3S41 A;  4CD3 A;  3KVG A;  2QWQ A;  1E4F T;  3O80 A;  4CZG A;  4C23 A;  4NB4 A;  4PL7 A;  4BRF A;  4B1W B;  1BOT O;  1T6C A;  4CZM A;  3O1B A;  2Q31 A;  2ZF5 O;  2GEM A;  5EX5 A;  1YAG A;  3EKU A;  3A5L C;  4FWM A;  2P9L A;  3FGU A;  1QHA A;  4ISE A;  4CBW A;  3IDH A;  3IUC A;  4HWI A;  2HF4 A;  1K8K B;  3G25 A;  3H1V X;  2EWS A;  4PKG A;  1IG8 A;  3WEE A;  1HUX A;  2I7N A;  4H0Y B;  3QB0 A;  3EO3 A;  1DEJ A;  5AQT A;  4BVO A;  3QIC A;  4XEI A;  4K25 A;  2YHW A;  3C7N A;  4A62 A;  2BUP A;  3DXM B;  1XUP O;  3ATU A;  3GL1 A;  3H3O B;  4WYB A;  4B9Q A;  5F1X A;  1SAZ A;  4RTF D;  3O08 A;  4BG8 A;  5TKY A;  1IJJ A;  5AQJ A;  4RWT A;  1GLL O;  1QZ6 A;  3UE5 A;  2V7Y A;  4BGA A;  4BR2 A;  2IVN A;  1GLA G;  2AA4 A;  2CGK A;  3W0L A;  5AQQ A;  3EL2 A;  4B1Z A;  1KXP A;  4IJN A;  4B1V A;  4A2A A;  3CQX A;  3RSE B;  2YJE A;  4LC9 B;  2ZGZ A;  3FE1 A;  5FPN A;  1RDW X;  1NGH A;  5BN9 A;  5AQX A;  4EFH A;  2P9U A;  2BTF A;  4ISG A;  1R59 O;  3ZX3 A;  3R6M A;  3DJC A;  4A61 A;  3VEZ A;  1BDG A;  5AQR A;  5AQP A;  2VCP A;  4BR7 A;  1TUU A;  3MDQ A;  4I6M B;  1Y64 A;  4FPA A;  4CI6 A;  4K43 A;  3BP8 A;  2P9I A;  3W3D A;  1Z6R A;  5AQI A;  2F9T A;  4FWL A;  5AQN A;  5F2R A;  3VEX A;  3ID8 A;  3U9D A;  1MDU B;  5AZI A;  4EIA A;  4BR4 A;  3VGM A;  3D2E B;  3ZX2 A;  4BRO A;  3CJ1 A;  3R9P A;  3A5N C;  4CBX A;  3HI0 A;  4WQ5 C;  3DWL A;  4JHD A;  2F9W A;  2HF3 A;  4YDU A;  5BRD A;  5E26 A;  3O4W A;  1TYQ A;  2E1Y A;  4CZI A;  1QQO A;  3R8E A;  2Q0R A;  3IMX A;  4CBU A;  2QWN A;  5AR0 A;  1HKC A;  3AAQ A;  1EQY A;  5BN8 A;  3CJB A;  4H0X B;  3HM8 A;  1WUA A;  3O1W A;  4H03 B;  4RCH A;  3KZB A;  3A5O C;  5LJV A;  4MLH A;  2Q97 A;  3MK6 A;  4GNI A;  1D4X A;  3O5B A;  3LDP A;  4PL8 A;  4IO8 A;  4K42 A;  4H0O A;  1X3M A;  1HPM A;  1V4T A;  4XH1 A;  4IJA A;  4E1J A;  4BRN A;  3WXL A;  5AQL A;  2E2P A;  4BRM A;  4IWV A;  2GWJ A;  2Q0U A;  3WT0 A;  3MN5 A;  5EVZ A;  2NLX A;  2ITM A;  2A41 A;  3O6W A;  3SJH A;  3FLC O;  4FWO A;  3AY9 A;  2CGL A;  3F9M A;  4FL9 A;  4EHT A;  3WXJ A;  4MLE A;  4XH5 A;  4FOE A;  3AAP A;  2HOE A;  5BRH A;  3ZEU B;  3D2F B;  2UYT A;  2QWM A;  1ATR A;  4M63 C;  4MO4 A;  5AQS A;  2FLO A;  3CQY A;  3EKS A;  3B8A X;  3ATV A;  3ENO A;  3WQU A;  2V7Z A;  4BC3 A;  1BU6 O;  4CZH A;  5FPE A;  5AQV A;  4ISF A;  1P8Z A;  4PKH A;  1BG3 A;  3FZH A;  2ZGY A;  4BRP A;  2A3Z A;  1JCE A;  3D2F A;  1Z05 A;  4FWN A;  4B1X B;  1NGI A;  3C0B A;  4BR5 A;  5B8H A;  1DGK N;  1S22 A;  3GOI A;  3MCP A;  3DAW A;  1KAZ A;  2HMP A;  2E2O A;  3FFK B;  2I7P A;  2P9S A;  2QWO A;  3MN6 A;  2IVP A;  2QW9 A;  4FWK A;  2FF3 B;  1GLE G;  3QML A;  4BRD A;  5F0X A;  4FOI A;  3U8X A;  3EZW A;  3HBT A;  1NM1 A;  2NRH A;  1QQN A;  1BA0 A;  1S3X A;  1HKG A;  2GWK A;  1SQK A;  3UKR A;  2E2N A;  3VEO A;  4DHY A;  5EY4 A;  5BPN A;  3CER A;  2V51 B;  4FWP A;  4JAX A;  3SK3 A;  4JN4 A;  1HKB A;  2GUP A;  3CHW A;  1TUY A;  1ZBS A;  3CJA A;  1NMD A;  2QM1 A;  3ZX0 A;  3SLC A;  1TYQ B;  3L6Q A;  3JXU A;  3QBX A;  4JHD B;  3I33 A;  1E4G T;  4BG9 A;  1T6D A;  1BUP A;  5ADX H;  5KQ8 A;  1V4S A;  4CJ7 A;  2A5X A;  4BRH A;  3D2E A;  3WUH A;  5I9E B;  5AZI B;  3UKR B;  5KPZ A;  4BRE A;  5FPD A;  3CJC A;  3SMP A;  3BEX A;  3VPZ A;  4K41 A;  5BPL A;  1CZA N;  3HTV A;  5KPR A;  2V52 B;  2P9I B;  3WQT A;  1GLC G;  2QWP A;  4I6M A;  3H45 C;  1KAX A;  5EXW A;  3GDQ A;  3ENH A;  2P9S B;  1C0F A;  3IFR A;  2W41 A;  5AQZ A;  2GTD A;  3I8B A;  3VOV A;  3A5M C;  3OHR A;  5AFU A;  4NO7 A;  1U6Z A;  3QFP A;  1RGI A;  2P9U B;  3MMV A;  4BQZ A;  4BRQ A;  1DKG D;  3VF2 A;  4H5N A;  2FF6 A;  2FSN A;  3FZF A;  3O8M A;  4WQ4 C;  3WXI A;  2VYP A;  2ZWH A;  4BRI A; 
#chains in the Genus database with same CATH topology
 4FJM A;  4M3X A;  2ZD1 A;  4DFM A;  1X3N A;  2IC3 A;  3SZ2 A;  1T44 A;  3PIO L;  4PHT X;  4AIL C;  4CJV A;  3VET A;  1RT2 A;  1T7P A;  3ZEU A;  2NRR A;  4ILJ A;  1T8E A;  4FW1 A;  4EP5 A;  1FW6 A;  1DLO A;  3DXM A;  3RTV A;  3T69 A;  2FSK A;  4FZZ A;  3SAF A;  5JIC A;  4FJX A;  4HCB A;  4DB3 A;  3DM2 A;  2YNG A;  1S1X A;  3QIO A;  3TAM A;  4DG1 A;  1WOQ A;  4O8U A;  3P1G A;  2NRX A;  4XH4 A;  3EN9 A;  2FBX A;  1KCF A;  4CFA A;  3VF6 A;  4KTQ A;  3EE9 A;  4H0T B;  2E5L K;  4B1Y B;  3I8D A;  4J8F A;  5LMN K;  4B08 A;  1LCU A;  3TTD A;  2YHB A;  3VEW A;  4O5B A;  1NGB A;  5M1P A;  2AP1 A;  3CFO A;  3BF1 A;  4DTS A;  2ZJR L;  1ZBU A;  4DLG A;  1Q8I A;  2EHG A;  1VSD A;  3BY5 A;  3VER A;  4YNQ A;  3OY9 A;  1YIJ N;  3AV9 A;  1BWF O;  1KC8 O;  2A1S A;  1C0T A;  3WNH A;  4G1Q A;  4IG3 A;  2ASO A;  1NJY A;  1SKR A;  2HBM A;  2NRW A;  3KWG A;  4E7J A;  3M3Z A;  3LDO A;  2VWK A;  2YHX A;  1QVG M;  2X78 A;  4GY2 B;  2DPN A;  2IGI A;  5AQF A;  4FK0 A;  1HYZ A;  3NMU A;  1Q86 O;  2VWB A;  1X9S A;  3O3F A;  5LY3 A;  4OLA A;  3TTF A;  3CCM N;  1VQ7 N;  2F8T A;  2VG7 A;  4JI0 K;  1LWC A;  4JV5 K;  4R5P A;  5HRN A;  4H5T A;  3TAP A;  2P9P A;  1RDB A;  2BDP A;  3S3O A;  2UXB K;  1TKZ A;  4C1N K;  1HR0 K;  4BRL A;  4IEI A;  3TU5 A;  4LF5 K;  1EWR A;  2KZM A;  4GV3 A;  4FK2 A;  4JK7 A;  4JD2 B;  2D0C A;  1UAX A;  2KFN A;  2G8F A;  3SAH A;  1TL1 A;  3SMS A;  3VGK A;  3JS6 A;  2QKK A;  1VSL A;  3OA9 A;  1WLJ A;  2P9K B;  3VQP A;  5KGX A;  2YKN A;  3LM9 A;  3VF4 A;  1C0M A;  2WUS A;  4GVM A;  2P9P B;  1J6Z A;  1TGO A;  3AVG A;  3ZT2 A;  2D4W A;  3FZL A;  1XI1 A;  2J4R A;  4FJI A;  3D7E O;  4CZE A;  1IG9 A;  4CEE A;  4M3R A;  3KLI A;  2B6A A;  4KHP K;  1RT5 A;  1EWQ A;  1LV5 A;  1RBU A;  1A5W A;  3MWT A;  4K0K K;  5BRF A;  1NLV A;  2GV9 A;  4X62 K;  1K73 O;  1ASV A;  4KBO A;  2ZJQ L;  3THV A;  4CES A;  3CCL N;  2P9N A;  3MWP A;  3VTH A;  4EHU A;  3QNO A;  5C2F A;  1NOZ A;  3L2U A;  2P51 A;  3ULE A;  5FRM A;  1CLQ A;  1VQ8 N;  1HJR A;  1NKC A;  3VES A;  3AAR A;  3H1Q A;  4CFD A;  3R3L A;  3AA2 A;  1C0G A;  1HX1 A;  4EZ6 A;  4CJF A;  4LFB K;  3NHG A;  4E7K A;  2EX3 A;  4LFC K;  1J5O A;  5IT9 O;  4L3Q A;  1MWM A;  1YUW A;  3LDN A;  4QS9 A;  4CIE A;  1FJG K;  1REV A;  3V6D A;  1NGJ A;  1J5E K;  2D0P A;  4PKI A;  3BF3 A;  1QE1 A;  3FR0 A;  1M90 O;  2X6N A;  3SUN A;  2NNW A;  3T3F A;  2CH6 A;  1NJI O;  3CG7 A;  2ITG A;  5AZJ A;  4DV5 K;  2QWQ A;  1E4F T;  2E4L A;  4AHV A;  3K5M A;  1BOT O;  2ETJ A;  4CZM A;  3SUQ A;  4F4K A;  3THW A;  4K8X A;  3EKU A;  4NCG A;  4A59 A;  1U45 A;  3TSQ A;  3ZSY A;  2P9L A;  1QHA A;  4QOZ B;  4CJP A;  3F2K A;  3IUC A;  2Z1G A;  1U48 A;  3HL8 A;  3N4Q A;  1HUX A;  3G4S N;  4H0Y B;  3EO3 A;  3LWL A;  3NGI A;  1TK0 A;  4H8K A;  4DV1 K;  1IO2 A;  1CZ9 A;  4JKC A;  4WYB A;  4K8Z A;  2ZM6 K;  1CXQ A;  3RMB A;  3OW2 M;  4BG8 A;  5TKY A;  5AQJ A;  3UE5 A;  4FW2 A;  1HYS A;  4BAC A;  2AA4 A;  4JKA A;  1U04 A;  4TSX A;  3OYK A;  2CGK A;  3EL2 A;  4KFB A;  3TTC A;  4B1V A;  4F3O A;  3L3V A;  4DV2 K;  5BR8 K;  1IKW A;  4WCE L;  3FE1 A;  5AQX A;  4EFH A;  3EEQ A;  1YVU A;  3R6M A;  3ZX3 A;  2KW4 A;  2W42 A;  1IKX A;  4A61 A;  3VEZ A;  4KV8 A;  3AA4 A;  5AQR A;  3S3M A;  4BR7 A;  3HRG A;  3MDQ A;  3BP8 A;  2HMI A;  2HNY A;  3W3D A;  2QKB A;  2HHU A;  3BZK A;  4WFA L;  4KTZ A;  2F9T A;  4JLH A;  1R0A A;  5F2R A;  3U9D A;  3LP0 A;  3HJF A;  3VGM A;  3D2E B;  2G8W A;  2F9W A;  2X74 A;  4YDU A;  3NF7 A;  5CY4 A;  2E1Y A;  4CZI A;  1VRT A;  4CJL A;  1QQO A;  4YOR A;  4DWI A;  3CYM A;  2AJQ A;  4HUG A;  3SBT A;  3CJB A;  3LDS A;  4H03 B;  4Z4H A;  4EZ9 A;  3KZB A;  4GW6 A;  4N56 A;  5LJV A;  4MLH A;  3MK6 A;  4E1M A;  1S6P A;  4CHP A;  4K42 A;  1L3V A;  1HPM A;  4IJA A;  4BRN A;  4BRM A;  2GWJ A;  4KTW A;  4DSE A;  2Q0U A;  3WT0 A;  4ELT A;  3MN5 A;  5EVZ A;  5D3G A;  4FWO A;  4AH9 A;  4BDP A;  4JI3 K;  4EHT A;  3WXJ A;  4MLE A;  4XH5 A;  3E01 A;  2HHW A;  5GAE P;  4DQP A;  3ZSZ A;  3AO5 A;  3E9P A;  1ATR A;  1SL2 A;  3ZLJ A;  3CQY A;  3SUP A;  3AVI A;  3B8A X;  4CJK A;  1ASW A;  2V7Z A;  3TSU A;  3CCR N;  1BU6 O;  1NJW A;  3CCJ N;  4FYD A;  3KK2 A;  1HNI A;  5FPE A;  2YX6 A;  2WC9 A;  2OA8 A;  1BG3 A;  3IS9 A;  4LSN A;  4UY8 O;  5SWM A;  3BGR A;  3D2F A;  4FWN A;  3LPU A;  1NGI A;  3C0B A;  5B8H A;  1S22 A;  3CC2 N;  3ZSV A;  2HMP A;  3RMC A;  3FFK B;  2O8F A;  2P9S A;  2QWO A;  1BIU A;  1NG9 A;  2F7T A;  4CJ3 A;  3KLF A;  3B6O A;  3AVC A;  4CED A;  5M1O A;  5F0X A;  3J7Y P;  1O1W A;  3VN5 A;  4ICL A;  1SUQ A;  1QQN A;  1S6Q A;  5SZT A;  4YOV A;  1HNW K;  2YKM A;  4IBN A;  1SQK A;  3CER A;  3OYH A;  4CJR A;  2V51 B;  3WNG A;  3SK3 A;  1VSM A;  1RTH A;  1HKB A;  3C6U A;  3CHW A;  1TUY A;  4CVN E;  3OS0 A;  4F8R A;  1NMD A;  3DOK A;  3L6Q A;  1OH5 A;  3QBX A;  3THX B;  4JKH A;  4B9V A;  1NKE A;  2F8S A;  4CJ7 A;  2A5X A;  3ZCM A;  4CJ4 A;  1TK8 A;  1RTD A;  3HPO A;  3K2P A;  5AZI B;  1JL2 A;  4BRE A;  3LWM A;  3CJC A;  4K41 A;  2X6S A;  3HTV A;  2G8V A;  4JKF A;  5KPR A;  4KAZ A;  2V52 B;  3HK2 A;  2XY8 A;  2HHH K;  1VSK A;  2IAJ A;  4DUY K;  3B6P A;  3ENH A;  3SV3 A;  1FXX A;  1W0H A;  4C8N A;  3NDK A;  3C94 A;  3OBY A;  3ZSR A;  3I8B A;  3OHR A;  4NO7 A;  3QFP A;  4E7I A;  3CCQ N;  4BQZ A;  4BRQ A;  3J80 O;  4C8M A;  4H5N A;  2FSN A;  3FZF A;  5CZ1 A;  3WXI A;  4FVM A;  4BDZ A;  2D0A A;  2XY7 A;  1VQ4 N;  4ELU A;  2Z1J A;  4CZF A;  3QBW A;  5AQO A;  1YI2 N;  4M41 A;  1NK6 A;  4XIU A;  2O4I A;  3D45 A;  2YHY A;  1QZ5 A;  3CI5 A;  3PY8 A;  4M3T A;  5C24 A;  3VQ6 A;  1J9A A;  1L3S A;  4CGG A;  2NRT A;  3QNN A;  3HXM A;  3BUZ B;  3QES A;  3C7N B;  4CJ5 A;  1K6Y A;  2PY5 A;  4AHR A;  3HZ6 A;  3G71 N;  1ZC6 A;  3WEE B;  4CFB A;  2RHK A;  2O8D B;  3PSI A;  1KSP A;  2OPQ A;  4QS8 A;  1NGG A;  1JLF A;  2E88 A;  3SCX A;  3OYD A;  5I3U A;  3H6E A;  2A6A A;  3LZI A;  4GV9 A;  1RBV A;  1VQ9 N;  4I2Q A;  1BA1 A;  4YFU A;  3L4Q A;  1OVY A;  2ASM A;  4Z4G A;  4GMJ B;  4WE1 A;  5M1N A;  3QFU A;  2QEX N;  3THY B;  3OYA A;  3CCS N;  3M8P A;  4YOW A;  1NK0 A;  4N76 A;  1J54 A;  1Q9X A;  3CD6 N;  3E9O A;  1XNQ K;  2WFB A;  2GBZ A;  2UUC K;  4BRC A;  1GLJ O;  2JWK A;  4H5R A;  1KVC A;  2HST A;  5DM6 L;  5HOO A;  4M3Z A;  3TSP A;  3TAE A;  3K5O A;  1S1T A;  5EU7 A;  3A0I X;  4E0D A;  1GLD G;  1EX4 A;  1RDC A;  1JLC A;  5T7B A;  2PBD A;  3OJS A;  4F9O A;  4UQG A;  1KAY A;  2O8B A;  3LM2 A;  4JS4 A;  1S72 N;  1QSY A;  4PUO A;  2DFH A;  2QWL A;  3QDK A;  3RSE A;  5KRS A;  4U7B A;  3SPY A;  3FZK A;  1Z26 A;  1WSF A;  3T1H K;  3KLH A;  4A2B A;  1LAW A;  3CFR A;  3ZYY X;  4E3S A;  1U2V A;  3UKU B;  4BQL A;  4JRQ A;  4MO5 A;  1W7A A;  4FJ8 A;  4QAG A;  3A8Y A;  3KKS A;  1QSL A;  4NCA A;  2H3G X;  4FJ9 A;  4DSK A;  1ZBH A;  3KTQ A;  2NRZ A;  4IG0 A;  2P9L B;  3TWH A;  2RN2 A;  2HBJ A;  1JCG A;  4N47 A;  3PX0 A;  3AO4 A;  3THW B;  2KHO A;  5JLH A;  3Q7C A;  4FJ7 A;  4CEQ A;  3K5N A;  2BAN A;  4Z4F A;  5AZJ B;  4JI2 K;  4KB1 A;  3MEG A;  2LSN A;  3KHY A;  4CF2 A;  3DXK A;  4BC5 A;  2QA4 N;  3P31 A;  2PAV A;  3ZSQ A;  4M7Y A;  3PUF A;  5HL7 L;  3VEN A;  4H0V B;  1QVF M;  3VQ7 A;  3RMD A;  3MXI A;  2RKI A;  1G15 A;  2OPS A;  1W9H A;  4H0P A;  4KH4 A;  5KQD A;  3VEY A;  4WFN L;  3O4Q A;  1Q18 A;  3VEV A;  3ZET B;  4Z94 A;  5GIP A;  1O13 A;  5JLF A;  3DLB A;  1QQC A;  4AF1 A;  4DR4 K;  1UOC A;  4ZHR A;  3VQA A;  2P9N B;  4BRA A;  3DLR A;  3Q7B A;  4WQ4 A;  3AVF A;  1DTT A;  4JKG B;  4W5N A;  3VQ9 A;  1RTI A;  1NK8 A;  4DR6 K;  2IVO A;  1LOT B;  4HTU A;  4AQY K;  4IOA L;  1HLU A;  2Q2R A;  2QWR A;  3E9L A;  4AM7 A;  1JLE A;  1TL3 A;  3LP2 A;  4A57 A;  2ZJP L;  4MQ3 A;  4CJU A;  3U3Y A;  2VWJ A;  2JWL A;  3TAR A;  1NWK A;  4GV6 A;  2Z1H A;  1DT9 A;  4NB4 A;  4DR1 K;  4BRF A;  3V9W A;  3L3U A;  3PO4 A;  3SJJ A;  1NOY A;  3I55 N;  1YAG A;  3NAE A;  3A5L C;  4FWM A;  3P5J A;  4MDA A;  3OYJ A;  3CFP A;  2OCE A;  3C6T A;  4BWM A;  4CEO A;  4PKG A;  4FM0 A;  1IG8 A;  4YY3 K;  4W5T A;  1KFD A;  3QB0 A;  5AQT A;  1KQS M;  1RBS A;  3QIC A;  4XEI A;  1S5J A;  2YHW A;  4A62 A;  1RDU A;  1Y97 A;  4OLB A;  3WXM B;  4OO1 J;  5J1E A;  3J81 O;  5F1X A;  4ILG B;  4RTF D;  2GX9 A;  1D5A A;  5JVH L;  4RWT A;  1OVQ A;  3IKM A;  3LAN A;  1HQU A;  5J2P A;  3I0R A;  4B1Z A;  4CJE A;  3F9K A;  2R7Y A;  4CIF A;  4RW8 A;  2YJE A;  1BGX T;  4LSL A;  1WBD A;  5HRS A;  4M42 A;  3QIP A;  3PIP L;  3DJC A;  4JKB A;  4O55 A;  2HBL A;  4W5O A;  4RW4 A;  4CJS A;  3HVR A;  1TVR A;  3LAL A;  4DU4 A;  1Y64 A;  1BL3 A;  2P9I A;  3ISN C;  1Z6R A;  5AQI A;  3I56 N;  4B3R K;  1LW2 A;  4OPA A;  3PV8 A;  2KFZ A;  4CK1 A;  4IFY A;  3ID8 A;  3PO5 A;  2RF2 A;  4NYN A;  4EIA A;  3FFI A;  4B9M A;  1C0U A;  1RBT A;  2HHV A;  5BRD A;  4YOU A;  5E26 A;  1KD1 O;  3O4W A;  4DR2 K;  4CEC A;  1TV6 A;  1OH7 A;  4DF4 A;  2YHA A;  5FLX O;  3IMX A;  1RIL A;  4CBU A;  3L2W A;  2QWN A;  3MXJ A;  1HKC A;  2PFU A;  5BN8 A;  1A5V A;  3HM8 A;  1WUA A;  3O1W A;  3H08 A;  4RCH A;  1JXE A;  4CIG A;  2W6L A;  4DTX A;  5J2N A;  1L3T A;  3A5O C;  4NCB A;  3O5B A;  4PL8 A;  2JLE A;  3T19 A;  4H0O A;  1V4T A;  4E1J A;  1N8R O;  1XWL A;  3WXL A;  1NNE A;  5AQL A;  2E2P A;  4IWV A;  3DRP A;  2NLX A;  3AO1 A;  3SJH A;  1ZBL A;  1HPZ A;  4E19 A;  3OYG A;  2E6L A;  4FLU A;  4JKE A;  3DLG A;  1KTQ A;  3VQC A;  3OJU A;  5BRH A;  3RMA A;  4KH5 A;  4Z4I A;  3ASM A;  3ZEU B;  4NLB A;  3NF6 A;  3RR8 A;  3S9H A;  4MO4 A;  5AQS A;  1N36 K;  2FLO A;  1WB9 A;  1WAF A;  3EKS A;  4C8L A;  4AHS A;  4CZH A;  3AGR A;  4ISF A;  2B4J A;  3K0S A;  4ID5 A;  2A3Z A;  3NGZ A;  1Z05 A;  2KZZ A;  4BR5 A;  2HHX A;  4DV6 K;  1XMQ K;  1DGK N;  3GOI A;  4DQI A;  1VK0 A;  1WSE A;  3MCA B;  3SQ4 A;  1VQ5 N;  3MN6 A;  2IVP A;  4FWK A;  5M1Q A;  4DR3 K;  1GLE G;  3OYC A;  3G10 A;  1FKO A;  2Y1J A;  3EZW A;  3HBT A;  3ID6 A;  2BE2 A;  2NRH A;  4AHU A;  1RDA A;  4FLW A;  1XMO K;  1HKG A;  3SPZ A;  1A5X A;  1KVA A;  5BPN A;  3UKR A;  2E6M A;  3KK7 A;  3VEO A;  3I0S A;  4RW9 A;  4NLC A;  3AVA A;  4ID1 A;  4JN4 A;  3P83 D;  3HOS A;  3TAB A;  4O44 A;  1ZBS A;  4IDH A;  4DR7 K;  3F5T A;  1RDD A;  2QM1 A;  3SLC A;  4WF9 L;  4CHY A;  1BUP A;  5ADX H;  5KQ8 A;  1V4S A;  3HYF A;  4BRH A;  2G8H A;  4CHN A;  3KIO A;  1S9E A;  5FPD A;  3MED A;  2F96 A;  5K14 A;  1HNV A;  1OH6 A;  1NK5 A;  1EKE A;  4ILH A;  2QWP A;  4KI6 A;  3HP6 A;  2FBV A;  1B9D A;  4C1N I;  2D0B A;  2VQE K;  4GKJ K;  4CGI A;  3V9U A;  1C0F A;  3IFR A;  5HRO A;  4M3W A;  3VOV A;  5AFU A;  1YJ9 N;  1UA1 A;  2P9U B;  5C2D A;  1DKG D;  1ILY A;  2O8C A;  4CF9 A;  4WQ4 C;  3SI6 A;  3AVL A;  3PSF A;  4Z0U A;  4OJR A;  4H4M A;  4MFB A;  1ESV A;  3VQE A;  1BI4 A;  4B9S A;  2E2Q A;  3VTI A;  2Z1I A;  1VSJ A;  3UB5 A;  4H5V A;  2QXL A;  4IFE A;  3C95 A;  4HHT A;  1UA0 A;  1NGA A;  2IS3 A;  4NYF A;  5J2Q A;  4FWS A;  4B8C A;  1IBK K;  1CZB A;  3ZT0 A;  2ASP A;  4FJJ A;  1SV5 A;  4JK9 A;  5DM7 L;  3D0P A;  1EET A;  5JVG L;  4B1U B;  4FJK A;  4WQ5 A;  4CGD A;  1I94 K;  3BDP A;  3O9U A;  3K9J A;  3L8B A;  4E7L A;  3VA0 A;  2P5G A;  4DF8 A;  1WNS A;  4YOY A;  4O5F A;  1YTU A;  2XY6 A;  4FO0 A;  3HVT A;  1C1C A;  1KVB A;  4PY5 A;  1E3M A;  4I9L A;  4CGJ A;  5GIN A;  1EP4 A;  3L2Q A;  3CIP A;  2G8U A;  5KPT A;  3MEE A;  2Y1I A;  3QEP A;  4ELV A;  4DR5 K;  1MU2 A;  4X66 K;  5CYM A;  3DMJ A;  1NJZ A;  3KLE A;  1WSG A;  4YDU C;  3NGY A;  2HHQ A;  3JAM O;  4CZL A;  1JKH A;  5AQU A;  4OKK A;  3AVJ A;  3LZJ A;  4B8A B;  4E89 A;  4Q0B A;  4DCH A;  1TKT A;  2OTJ N;  3CPW M;  2Q1N A;  2IOC A;  3OYL A;  1ZXO A;  4EAH D;  2E1Z A;  2GEL A;  3TAN A;  4IEE A;  3VGL A;  3L4I A;  3RRG A;  4N41 A;  4JYA K;  1VQK N;  4DSJ A;  1JCF A;  2YV0 X;  1W97 L;  3DLK A;  1NBW A;  2CGJ A;  4A5A A;  1J53 A;  3AGK A;  4R79 A;  4NXN K;  3H3N O;  3LAK A;  3EYZ A;  2FSJ A;  4F3T A;  4KHY A;  1Q9Y A;  5DMR A;  1VAZ A;  1RFQ A;  4E7H A;  3RWU A;  1JL1 A;  3E1Y A;  1VQ6 N;  2CH5 A;  3AO2 A;  2VQF K;  1X1P A;  1XC3 A;  4KHN A;  3CF5 L;  1S9G A;  3CM6 A;  4BGB A;  5M1K A;  1BCO A;  2I5J A;  2VG6 A;  1SZ2 A;  4OPK A;  3JYT A;  1VQO N;  3LDQ A;  1QQM A;  3VQ8 A;  2A40 A;  4CF0 A;  1RBR A;  3O9T A;  2HW3 A;  1Z25 A;  1IBM K;  4I7F A;  4PQU A;  4FZY A;  3WXK A;  4BR9 A;  3J7Z O;  4PWD A;  4LFA K;  4JKD A;  4AM6 A;  3MN7 A;  4CD1 A;  3CCV N;  2QK9 A;  4BVP A;  3OBW A;  5AQG A;  2FXU A;  3O4N A;  4FSV A;  3NVK A;  4OKJ A;  4IZ9 A;  3GG4 A;  3U9Z A;  1VQP N;  4PA1 A;  4BY9 C;  3T7Z A;  3CJ7 A;  2VG5 A;  4OPJ A;  3WNE A;  4JI8 K;  4M7X A;  4DQR A;  1G99 A;  1K8A O;  1GLB G;  3P4I A;  1HJO A;  5IWA K;  2Q36 A;  2HNZ A;  5C10 A;  3T1A A;  3TAF A;  4QS7 A;  1X9M A;  3KD5 E;  4YHH K;  3P39 A;  4FJ5 A;  4C8O A;  1KFS A;  4FK4 A;  1VHX A;  3ALY A;  1RT1 A;  4B3S K;  4DUZ K;  3DLE A;  1WSH A;  1NGD A;  4KHQ A;  3SV4 A;  1MA9 B;  1NK7 A;  1ATN A;  3LDL A;  1MWK A;  1WAJ A;  3S41 A;  1VQL N;  3O80 A;  4FLV A;  1GOC A;  3JSM A;  3E66 A;  4C23 A;  2RE2 A;  4M3U A;  4PL7 A;  3OS2 A;  1T6C A;  3O1B A;  1CXU A;  2GEM A;  5EX5 A;  4OPH A;  1TKX A;  3OYB A;  1NJX A;  3SBG A;  1FKP A;  3IDH A;  4HCC A;  3HO1 A;  2HF4 A;  1K8K B;  2EWS A;  4DU1 A;  3TI0 A;  4JI6 K;  4KHS A;  4K25 A;  3C7N A;  4DMN A;  3KKR A;  1XUP O;  3ATU A;  3GL1 A;  1N33 K;  5C25 A;  3O08 A;  1TKD A;  4RG8 A;  4BGA A;  1QZ6 A;  4BR2 A;  2IVN A;  4I9Q A;  4B9U A;  3KLG A;  4OX9 K;  3W0L A;  1KXP A;  4IJN A;  3AA5 X;  3V9Z A;  4C8K A;  2OPR A;  2ZGZ A;  5C12 A;  1RDW X;  3A2F A;  2P9U A;  2BTF A;  4CFC A;  3KK3 A;  1BQM A;  1Q81 O;  2VCP A;  4K43 A;  1QTM A;  3VQD A;  4CK2 A;  1WSJ A;  2UXD K;  3DLH A;  4IOX A;  3ZT4 A;  1L3U A;  3AVH A;  3VEX A;  1MDU B;  5A2Q O;  4FCY A;  4BR4 A;  3LAM A;  4BRO A;  3AA3 A;  3A5N C;  3ZSO A;  3TAQ A;  4CBX A;  4WQ5 C;  3DWL A;  5KGW A;  2P5O A;  3R8E A;  2FBT A;  4KKO A;  5AR0 A;  1RT3 A;  3AAQ A;  1Q82 O;  1EQY A;  1LWF A;  1HRH A;  4YOT A;  3K58 A;  4H0X B;  4CEF A;  2DY4 A;  4Y1D A;  3KWI A;  2HHT A;  4CHZ A;  1LAV A;  4IO8 A;  2UUA K;  4XH1 A;  4DU3 A;  1YHQ N;  2A41 A;  3FLC O;  3AY9 A;  4JK8 A;  2O8F B;  3F9M A;  3N4P A;  4N5S A;  4QCL A;  4B3M K;  4FOE A;  2G8K A;  4CEA A;  2HOE A;  2OTL N;  5H1S Q;  1BHL A;  3D2F B;  5E41 A;  2UYT A;  2QWM A;  1BI4 B;  3OYF A;  4L8R B;  3ATV A;  3ENO A;  1VSI A;  3WQU A;  3QER A;  1IH7 A;  1P8Z A;  2HHS A;  4FJN A;  4BRP A;  3RVC A;  1U47 A;  4B1X B;  3DI6 A;  4M3Y A;  3CXC M;  3MCP A;  3DAW A;  3CM5 A;  3AVK A;  1FK9 A;  2I7P A;  5GAD P;  3CCE N;  4M45 A;  2FF3 B;  3QML A;  4BRD A;  3U8X A;  4DKW A;  1KRP A;  2W6K A;  1ASU A;  1NU0 A;  2HND A;  3R1X A;  4FJH A;  3OYN A;  2GWK A;  4DHY A;  1N34 K;  1HYV A;  4FWP A;  4JAX A;  4Z4C A;  1RT7 A;  2GUP A;  4KI4 A;  1SL0 A;  3MX5 A;  4DTM A;  1N6Q A;  3NBP A;  1QS4 A;  3I33 A;  1E4G T;  4BG9 A;  1HMV A;  3U3G A;  3QET A;  2ZE2 A;  3D2E A;  3QEW A;  3M8S A;  5I9E B;  3V9X A;  4FJG A;  4NXM K;  4DS5 A;  3MXM A;  2FC0 A;  1RT4 A;  5CHI A;  3UIQ A;  2PYL A;  3BEX A;  1CZA N;  2JGU A;  1GOA A;  2P9I B;  3CME N;  5HP1 A;  3NE6 A;  3PLA A;  4B9N A;  4CF8 A;  2QI2 A;  5EXW A;  3GDQ A;  4O0J A;  1X9W A;  4DV7 K;  2W41 A;  5AQZ A;  1S1W A;  2GTD A;  4FLY A;  3F73 A;  1U6Z A;  5GAH P;  1JLA A;  4CF1 A;  3C65 A;  1KLN A;  2FF6 A;  3KK1 A;  3L2R A;  4DFJ A;  2B5J A;  4IFV A;  4O0I A;  4BRI A;  4CJW A;  4RW7 A;  2QTD A;  2VGN A;  4FPB A;  4MDB A;  5CYQ A;  3K57 A;  1YJW N;  3PX4 A;  1RT6 A;  3QEX A;  1ATS A;  4AHT A;  3NFA A;  3NH0 A;  1WSI A;  2YNH A;  1LW0 A;  3EZ5 A;  3LPT A;  2IIR A;  4H4O A;  2KTQ A;  4FWQ A;  3NVM A;  3VMF B;  4KRF A;  2A42 A;  3V1Q A;  3H46 O;  2WTU A;  1N32 K;  4JI7 K;  5C15 A;  4JNE A;  4AHC A;  3L0Q A;  1TAU A;  3O3H A;  3J7A P;  4CZJ A;  1KLM A;  3ZT3 A;  1N5Y A;  2BH1 A;  4GKK K;  1UWB A;  1WBB A;  1T05 A;  2W40 A;  5M1F A;  5HLF A;  1XQS C;  3VQ5 A;  5HRR A;  4O8K A;  4BRG A;  1JLB A;  1GOB A;  5AQH A;  3M1F A;  1HQE A;  1BO5 O;  3GBT A;  1NKB A;  4BC2 A;  5E84 A;  3SAG A;  4J2D A;  5BRE A;  4JKG A;  1T03 A;  2G8I A;  4LF7 K;  4BC4 A;  1TK5 A;  2YJF A;  5LJW A;  1RCH A;  1SKS A;  5AQM A;  3WNF A;  4HTL A;  3MN9 A;  3ULE B;  5KI6 A;  1H1V A;  4FLX A;  1YXQ A;  1OKJ A;  4KH6 A;  3NCI A;  3MAQ A;  4CCH A;  5EOY A;  2NZT A;  1L5U A;  4CGH A;  1JLQ A;  3VQ4 A;  3KD1 E;  4DS4 A;  3TPQ A;  2PYJ A;  2D1K A;  4DSF A;  2YNI A;  4J2E A;  3M8R A;  5FPM A;  2D0O A;  3M5R A;  3OS1 A;  2YI1 A;  3ITH A;  1T3V A;  3DXK B;  2FBY A;  4CHQ A;  3HSC A;  1X9J A;  5HBM A;  4BR0 A;  3QO9 A;  4CER A;  1B92 A;  1QHT A;  3GE1 A;  3LP3 A;  4W5R A;  1YJN N;  4OGE A;  4LF8 K;  3CET A;  5BR9 A;  4HUE A;  1NGC A;  5AQK A;  2P9K A;  1GLF O;  1YVN A;  4CHO A;  3HM9 A;  4FM2 A;  3HST B;  3PX6 A;  5JMV A;  3CJ9 A;  1BIZ A;  2XRI A;  4I2P A;  4BRK A;  4FXD A;  3NH1 A;  2E8A A;  2HVI A;  5CE3 A;  1K8K A;  5KTQ A;  1NGF A;  3G0Z A;  4JD2 A;  3NH2 A;  2ZQB A;  5C0Y A;  5AFU H;  1C1A A;  1XHX A;  5BPM A;  4BWJ A;  1HNZ K;  4WFB L;  3P38 A;  5AQY A;  4ZTF A;  3UKU A;  1U2V B;  3QIN A;  5AQW A;  4CJT A;  2IDO A;  5FDL A;  4YOX A;  4BDY A;  3VQQ A;  2OAN A;  4W5Q A;  3OYI A;  3K59 A;  4LY7 A;  5GIO A;  3CMA N;  2OYQ A;  4H5W A;  1YIT N;  1BIS A;  1YT3 A;  4JEP A;  4FWR A;  4LH5 A;  1YF5 L;  5ADX A;  2O8B B;  3FZM A;  5CZ2 A;  2YCH A;  4A5B A;  3ULD A;  1SKW A;  4Y0W A;  3MEC A;  3SQ2 A;  1S1U A;  2YNF A;  3V9S A;  5ELZ A;  3M6G A;  3AVB A;  2XY5 A;  1NGE A;  2D5R A;  3U4L A;  5C42 A;  4LF6 K;  3J8A A;  4CZK A;  5HRP A;  3U6F A;  3ZET A;  5LMU K;  1U4B A;  3SNN A;  5I42 A;  1EO1 A;  2E20 A;  2OPP A;  3HT3 A;  1ZBF A;  5FRO A;  1ITG A;  4X65 K;  3NF9 A;  2Q3S A;  4DQ8 A;  2OZS A;  3LL3 A;  4DV0 K;  3T1Y K;  4IXC A;  1TAQ A;  4Y1C A;  4B9T A;  4KHW A;  4BE0 A;  4CEB A;  2HBK A;  4FLZ A;  3SYZ A;  1RTJ A;  4CD3 A;  3KVG A;  4CZG A;  2P1J A;  4B1W B;  4OKE A;  2Q31 A;  1I3A A;  2ZF5 O;  4DSL A;  2NUB A;  4E1N A;  1S1V A;  1U49 A;  2A1R A;  3O3G A;  3FGU A;  3CC7 N;  4ISE A;  4CBW A;  4B9L A;  4HWI A;  3LP1 A;  1IV0 A;  4HVJ A;  4JI5 K;  3G25 A;  3H1V X;  3WEE A;  4OVL A;  2I7N A;  1DEJ A;  4FM1 A;  4BVO A;  1SL1 A;  2KKZ A;  2XHB A;  2BUP A;  3DXM B;  3HPG A;  1WN7 A;  3SQ0 A;  1JLG A;  3H3O B;  4B9Q A;  4LF9 K;  2KQ2 A;  1SAZ A;  1IJJ A;  4JS5 A;  1GLL O;  1JXB A;  1VRU A;  2V7Y A;  1LWE A;  1P90 A;  4DFK A;  1GLA G;  1JJ2 M;  4IKF A;  4DV3 K;  4KRE A;  3IG1 A;  5AQQ A;  1EXQ A;  1VQM N;  3OVN A;  4A2A A;  4DQQ A;  3RSE B;  3CQX A;  4LC9 B;  1BCM A;  5FPN A;  2WON A;  1M1K O;  1VSE A;  5BN9 A;  1NGH A;  4ZTJ A;  4ISG A;  4X64 K;  1R59 O;  4JRP A;  3S3N A;  4J2A A;  4V19 S;  3AO3 A;  4DFP A;  4Q5V A;  2DFE A;  1BDG A;  5AQP A;  3HOT A;  1XHZ A;  3DOL A;  1HNX K;  1TUU A;  4I6M B;  4JI1 K;  3G6E N;  5CR4 A;  4FPA A;  4CI6 A;  3QEI A;  3HPH A;  2UXC K;  2WBN A;  3L2V A;  2DFF A;  4FWL A;  5AQN A;  3EY1 A;  4IDK A;  4KHU A;  5AZI A;  3ZX2 A;  4CJQ A;  4DV4 K;  1D8Y A;  4KB0 A;  1XC9 A;  3CJ1 A;  3R9P A;  3VQB A;  1NK4 A;  3HI0 A;  4JHD A;  4IOC L;  2HF3 A;  4DLE A;  2VGM A;  3THX A;  4LF4 K;  3C6H A;  3OYM A;  4OGC A;  1C6V A;  2NRV A;  1TYQ A;  4DTN A;  3THY A;  2Q0R A;  4CE9 A;  2UUB K;  4B3O A;  3SUO A;  3ZSW A;  1XNR K;  2ATQ A;  3QEV A;  4Z4E A;  3C6A A;  2Q97 A;  4GNI A;  1D4X A;  3LDP A;  5JS2 A;  3V4I A;  3ZT1 A;  4DSI A;  1X3M A;  1DTQ A;  3IAY A;  1IKY A;  3BZC A;  2UU9 K;  2O8D A;  3NF8 A;  1SS6 A;  5GAG P;  3M8Q A;  4BE1 A;  2ITM A;  3O6W A;  1ZYQ A;  1QSS A;  3RRH A;  3HP9 A;  3O9S A;  2CGL A;  2O8E A;  4FL9 A;  1BQN A;  2BGG A;  4B3T K;  3AAP A;  3V1O A;  5J2M A;  1D9F A;  3OYE A;  2XO7 A;  4G9Z A;  1I39 A;  1C1B A;  4CK3 A;  2RPI A;  4DTU A;  1D9D A;  1W2B M;  3O9Q A;  4FZX C;  4M63 C;  4RW6 A;  4FJL A;  4BC3 A;  5TKW A;  1IBL K;  4DQS A;  5AQV A;  4F2S A;  2HB5 A;  4PKH A;  1VSF A;  3FZH A;  1B9F A;  2ZGY A;  1IKV A;  1JCE A;  3VA3 A;  4LH4 A;  4CEZ A;  2O8C B;  3SQ1 A;  3ENB A;  3KJV A;  1F21 A;  1KAZ A;  3MX2 A;  3DLL L;  2E2O A;  2O8E B;  3CPE A;  1OH8 A;  4LD0 A;  2QW9 A;  3CCU N;  4FVU A;  4FOI A;  1YTA A;  4KPY A;  3K5L A;  4DTJ A;  1NM1 A;  2O4G A;  1Q7Y O;  4U67 L;  4DTP A;  1BA0 A;  1S3X A;  3DYA A;  1NMN A;  5JS1 A;  2E2N A;  5EY4 A;  3OTO K;  2QXF A;  3DRS A;  3EE8 A;  3TAG A;  3V81 A;  4FLT A;  4CW7 B;  1VSH A;  3CJA A;  2F4V K;  3V1R A;  5MLC Q;  3ZX0 A;  4GVE A;  4DTO A;  1TYQ B;  4KO0 A;  3JXU A;  4DTR A;  3D6R A;  3O9R A;  4JHD B;  5AJ3 K;  1T6D A;  3QLH A;  4CGF A;  4HUF A;  4JI4 K;  2OZM A;  1RNH A;  5LL6 Z;  4IO9 L;  3WUH A;  2DTU A;  3IRX A;  3UKR B;  5KPZ A;  5KRT A;  1K9M O;  3SMP A;  3VPZ A;  3DRR A;  5BPL A;  2GUI A;  1ZBI A;  3WQT A;  2HVH A;  1GLC G;  4F2R A;  4I6M A;  3H45 C;  4J2B A;  3K9K A;  3CC4 N;  4BE2 A;  1KAX A;  1NK9 A;  2P9S B;  3AVM A;  4EP4 A;  2PZS A;  3A5M C;  1VQN N;  1RGI A;  2KLA A;  3MMV A;  5DK5 A;  3ZSX A;  3RR7 A;  3VF2 A;  3AVN A;  5FRN A;  3TR8 A;  3O8M A;  3CQ8 A;  4O4G A;  2VYP A;  2WOM A;  2ZWH A; 
#chains in the Genus database with same CATH homology
 1VQ4 N;  2QTD A;  4CZF A;  3QBW A;  2VGN A;  4FPB A;  4MDB A;  5AQO A;  1YI2 N;  1X3N A;  1ESV A;  2YHY A;  1YJW N;  1T44 A;  1QZ5 A;  4PHT X;  3PIO L;  3CI5 A;  1ATS A;  2E2Q A;  3VET A;  3VTI A;  3ZEU A;  3UB5 A;  4H5V A;  2NRR A;  2QXL A;  4IFE A;  4ILJ A;  2NRT A;  2IIR A;  1NGA A;  3BUZ B;  3DXM A;  3T69 A;  2FSK A;  3C7N B;  4FWQ A;  3NVM A;  3SAF A;  4FWS A;  5JIC A;  3VMF B;  3HZ6 A;  3G71 N;  4DB3 A;  1ZC6 A;  2ASP A;  3WEE B;  4JK9 A;  2A42 A;  3H46 O;  5C15 A;  4JNE A;  5DM7 L;  1WOQ A;  4O8U A;  2RHK A;  2NRX A;  3L0Q A;  4XH4 A;  4B1U B;  5JVG L;  4WQ5 A;  4QS8 A;  3EN9 A;  4CZJ A;  3O9U A;  1NGG A;  2E88 A;  3K9J A;  3VF6 A;  3EE9 A;  2BH1 A;  2A6A A;  3H6E A;  4H0T B;  4B1Y B;  4YOY A;  4GV9 A;  2W40 A;  5M1F A;  4O5F A;  4J8F A;  1BA1 A;  1XQS C;  1VQ9 N;  1LCU A;  3L4Q A;  3TTD A;  1OVY A;  4FO0 A;  2ASM A;  3VEW A;  4O8K A;  1NGB A;  5GIN A;  5M1P A;  2AP1 A;  4BRG A;  5M1N A;  3QFU A;  3CIP A;  2QEX N;  5KPT A;  5AQH A;  3BF1 A;  3M1F A;  3CCS N;  1BO5 O;  2ZJR L;  4YOW A;  3GBT A;  4BC2 A;  3CD6 N;  3E9O A;  2WFB A;  5E84 A;  3SAG A;  4YDU C;  4BRC A;  3VER A;  1YIJ N;  5BRE A;  1BWF O;  4JKG A;  1KC8 O;  4CZL A;  1GLJ O;  2JWK A;  4BC4 A;  4H5R A;  2YJF A;  2HST A;  5AQU A;  5LJW A;  5DM6 L;  5AQM A;  5HOO A;  2ASO A;  4HTL A;  2HBM A;  2NRW A;  3KWG A;  3MN9 A;  3TSP A;  1H1V A;  3M3Z A;  3ULE B;  1YXQ A;  3LDO A;  1OKJ A;  4KH6 A;  2YHX A;  5EOY A;  2NZT A;  4DCH A;  1QVG M;  4GY2 B;  2OTJ N;  3CPW M;  3A0I X;  2Q1N A;  2DPN A;  1GLD G;  2PBD A;  3TPQ A;  1ZXO A;  5AQF A;  4EAH D;  4F9O A;  3NMU A;  1KAY A;  1Q86 O;  2E1Z A;  2D1K A;  2GEL A;  2VWB A;  4IEE A;  3VGL A;  3L4I A;  3LM2 A;  1VQK N;  5LY3 A;  1JCF A;  1S72 N;  5FPM A;  2D0O A;  2QWL A;  3QDK A;  3M5R A;  1W97 L;  2YI1 A;  3RSE A;  1NBW A;  3TTF A;  3CCM N;  1VQ7 N;  2CGJ A;  4A5A A;  1T3V A;  4U7B A;  3FZK A;  3DXK B;  3AGK A;  4R79 A;  3H3N O;  2FSJ A;  3HSC A;  4A2B A;  1X9J A;  4BR0 A;  1VQN N;  3ZYY X;  1VAZ A;  4H5T A;  1U2V A;  2P9P A;  1RFQ A;  3UKU B;  4BQL A;  3GE1 A;  1YJN N;  3CET A;  5BR9 A;  4C1N K;  4MO5 A;  1NGC A;  3E1Y A;  4IEI A;  4BRL A;  5AQK A;  2CH5 A;  1VQ6 N;  3A8Y A;  3TU5 A;  2P9K A;  1GLF O;  1YVN A;  4GV3 A;  1XC3 A;  4JK7 A;  4JD2 B;  3CJ9 A;  4BGB A;  4BRK A;  5JMV A;  5M1K A;  2H3G X;  3CF5 L;  2E8A A;  1SZ2 A;  1VQO N;  5CE3 A;  3LDQ A;  1K8K A;  1NGF A;  4JD2 A;  3SAH A;  5C0Y A;  3SMS A;  3VGK A;  3JS6 A;  1QQM A;  3OA9 A;  5AFU H;  2A40 A;  2NRZ A;  2P9K B;  2P9L B;  5BPM A;  3LM9 A;  4WFB L;  3P38 A;  3O9T A;  2HBJ A;  1JCG A;  5AQY A;  2KHO A;  3VF4 A;  2WUS A;  5JLH A;  2P9P B;  1U2V B;  3Q7C A;  3UKU A;  1J6Z A;  3WXK A;  5AQW A;  4BR9 A;  5AZJ B;  3J7Z O;  4YOX A;  2D4W A;  2OAN A;  4JKD A;  4AM6 A;  3FZL A;  3KHY A;  3DXK A;  4BC5 A;  2J4R A;  3P31 A;  2PAV A;  2QA4 N;  3MN7 A;  4CD1 A;  3CCV N;  4M7Y A;  3D7E O;  4BVP A;  5GIO A;  3CMA N;  5HL7 L;  3OBW A;  3VEN A;  4CZE A;  5AQG A;  4H0V B;  4H5W A;  1QVF M;  2FXU A;  1YIT N;  4FSV A;  4JEP A;  3NVK A;  4FWR A;  4IZ9 A;  1YF5 L;  5ADX A;  3GG4 A;  3U9Z A;  1VQP N;  3FZM A;  4H0P A;  4KH4 A;  2YCH A;  4A5B A;  5KQD A;  3MWT A;  3VEY A;  4Y0W A;  1NLV A;  5BRF A;  4WFN L;  1K73 O;  4BY9 C;  4KBO A;  3T7Z A;  3CJ7 A;  2ZJQ L;  1Q18 A;  3VEV A;  3ZET B;  4Z94 A;  3CCL N;  4M7X A;  5ELZ A;  2P9N A;  3M6G A;  3MWP A;  3VTH A;  4EHU A;  1O13 A;  5JLF A;  5C2F A;  1G99 A;  5GIP A;  4AF1 A;  1NGE A;  1GLB G;  3U4L A;  3P4I A;  1K8A O;  1HJO A;  3J8A A;  3ULE A;  2Q36 A;  1VQ8 N;  3VES A;  4CZK A;  3AAR A;  3H1Q A;  2P9N B;  4BRA A;  5C10 A;  3ZET A;  3R3L A;  3Q7B A;  4WQ4 A;  1C0G A;  1HX1 A;  4JKG B;  4QS7 A;  1EO1 A;  2E20 A;  3P39 A;  2IVO A;  4L3Q A;  1LOT B;  4IOA L;  1MWM A;  1HLU A;  1YUW A;  3LDN A;  4QS9 A;  1NGJ A;  2D0P A;  4PKI A;  3BF3 A;  4DQ8 A;  3FR0 A;  1M90 O;  2Q2R A;  2QWR A;  3E9L A;  3LL3 A;  4AM7 A;  1NGD A;  4A57 A;  4IXC A;  2ZJP L;  2NNW A;  2HBK A;  1MA9 B;  2CH6 A;  2JWL A;  1NJI O;  1NWK A;  1ATN A;  5AZJ A;  3LDL A;  1MWK A;  4GV6 A;  3S41 A;  4CD3 A;  2QWQ A;  3KVG A;  1DT9 A;  1E4F T;  3O80 A;  4CZG A;  3E66 A;  4C23 A;  1VQL N;  2RE2 A;  4NB4 A;  4PL7 A;  4BRF A;  4B1W B;  1BOT O;  1T6C A;  4CZM A;  3O1B A;  2Q31 A;  2ZF5 O;  2GEM A;  5EX5 A;  1YAG A;  3EKU A;  3I55 N;  4OPH A;  4A59 A;  3A5L C;  3TSQ A;  4FWM A;  2P9L A;  3FGU A;  1QHA A;  4MDA A;  3CC7 N;  4ISE A;  3SBG A;  3IDH A;  4CBW A;  3F2K A;  3IUC A;  4HWI A;  2HF4 A;  1K8K B;  3G25 A;  2EWS A;  3H1V X;  4PKG A;  1IG8 A;  3WEE A;  3N4Q A;  1HUX A;  2I7N A;  4H0Y B;  3QB0 A;  3EO3 A;  1DEJ A;  5AQT A;  3G4S N;  1KQS M;  4BVO A;  3QIC A;  2KKZ A;  4XEI A;  4K25 A;  2YHW A;  3C7N A;  4A62 A;  1RDU A;  2BUP A;  3DXM B;  3WXM B;  1XUP O;  4OO1 J;  3ATU A;  3GL1 A;  4JKC A;  3H3O B;  4WYB A;  4B9Q A;  5F1X A;  4ILG B;  1SAZ A;  4RTF D;  2GX9 A;  3O08 A;  3OW2 M;  4BG8 A;  5JVH L;  5TKY A;  1IJJ A;  5AQJ A;  4RWT A;  1GLL O;  1QZ6 A;  3UE5 A;  2V7Y A;  4BGA A;  1P90 A;  3IKM A;  4BR2 A;  2IVN A;  1GLA G;  1JJ2 M;  2AA4 A;  4JKA A;  2CGK A;  3W0L A;  5AQQ A;  3EL2 A;  1VQM N;  3TTC A;  1KXP A;  4IJN A;  4B1Z A;  4B1V A;  4A2A A;  3CQX A;  3RSE B;  2YJE A;  4LC9 B;  2ZGZ A;  3FE1 A;  5FPN A;  4WCE L;  5C12 A;  1M1K O;  1RDW X;  1NGH A;  5BN9 A;  5AQX A;  4EFH A;  2P9U A;  2BTF A;  3PIP L;  4ISG A;  1R59 O;  3ZX3 A;  3R6M A;  3DJC A;  4JKB A;  4A61 A;  2HBL A;  3VEZ A;  1Q81 O;  1BDG A;  5AQR A;  5AQP A;  2VCP A;  3HOT A;  4BR7 A;  3HRG A;  1TUU A;  3MDQ A;  4I6M B;  3G6E N;  1Y64 A;  5CR4 A;  4FPA A;  4CI6 A;  4K43 A;  3BP8 A;  2P9I A;  3W3D A;  1Z6R A;  2WBN A;  4WFA L;  5AQI A;  3I56 N;  2F9T A;  4FWL A;  4IOX A;  4OPA A;  5AQN A;  5F2R A;  3VEX A;  3ID8 A;  3U9D A;  1MDU B;  5AZI A;  4EIA A;  4BR4 A;  3VGM A;  3D2E B;  3ZX2 A;  4BRO A;  3CJ1 A;  3R9P A;  3A5N C;  4CBX A;  3HI0 A;  4WQ5 C;  3DWL A;  4JHD A;  2F9W A;  2HF3 A;  4IOC L;  2VGM A;  4YDU A;  5BRD A;  3C6H A;  4YOU A;  5E26 A;  1KD1 O;  2NRV A;  3O4W A;  1TYQ A;  2E1Y A;  4CZI A;  1QQO A;  4YOR A;  2Q0R A;  3R8E A;  3IMX A;  4CBU A;  2QWN A;  5AR0 A;  1HKC A;  2PFU A;  3AAQ A;  1EQY A;  4YOT A;  3SBT A;  5BN8 A;  1Q82 O;  3CJB A;  4H0X B;  3HM8 A;  1WUA A;  3O1W A;  4H03 B;  4RCH A;  3KZB A;  3A5O C;  5LJV A;  3C6A A;  2Q97 A;  4MLH A;  3KWI A;  3MK6 A;  4GNI A;  1D4X A;  3O5B A;  3LDP A;  4PL8 A;  4IO8 A;  4K42 A;  4H0O A;  1X3M A;  1HPM A;  1V4T A;  4XH1 A;  4IJA A;  4E1J A;  4BRN A;  3WXL A;  1N8R O;  5AQL A;  2E2P A;  4BRM A;  4IWV A;  2GWJ A;  1YHQ N;  2Q0U A;  3WT0 A;  1SS6 A;  3MN5 A;  5EVZ A;  2NLX A;  5GAG P;  2ITM A;  2A41 A;  3O6W A;  3SJH A;  3FLC O;  4FWO A;  3AY9 A;  3O9S A;  4JK8 A;  2CGL A;  4JKE A;  3F9M A;  3N4P A;  4FL9 A;  3WXJ A;  4EHT A;  4MLE A;  4XH5 A;  4FOE A;  3AAP A;  2HOE A;  5BRH A;  2OTL N;  4KH5 A;  5H1S Q;  5GAE P;  4G9Z A;  3ZEU B;  4NLB A;  3D2F B;  2UYT A;  2QWM A;  3O9Q A;  1W2B M;  3E9P A;  1ATR A;  4M63 C;  4MO4 A;  5AQS A;  2FLO A;  3CQY A;  3EKS A;  3B8A X;  3ATV A;  3ENO A;  3WQU A;  2V7Z A;  4BC3 A;  5TKW A;  3TSU A;  1BU6 O;  3CCR N;  3CCJ N;  4CZH A;  3AGR A;  5FPE A;  2YX6 A;  2WC9 A;  1P8Z A;  4ISF A;  5AQV A;  4PKH A;  1BG3 A;  3FZH A;  2ZGY A;  4UY8 O;  4BRP A;  2A3Z A;  1JCE A;  3D2F A;  1Z05 A;  3RVC A;  4FWN A;  4B1X B;  1NGI A;  3C0B A;  4BR5 A;  5B8H A;  1DGK N;  1S22 A;  3CXC M;  3GOI A;  3CC2 N;  3MCP A;  3ENB A;  3DAW A;  1KAZ A;  2HMP A;  3MX2 A;  2E2O A;  3FFK B;  3CPE A;  3MCA B;  2I7P A;  5GAD P;  3DLL L;  3CCE N;  2P9S A;  2QWO A;  1VQ5 N;  3MN6 A;  2IVP A;  2QW9 A;  4FWK A;  2FF3 B;  5M1Q A;  1GLE G;  2F7T A;  3CCU N;  3QML A;  4BRD A;  5F0X A;  4FVU A;  5M1O A;  4FOI A;  3U8X A;  4DKW A;  3EZW A;  3HBT A;  3ID6 A;  1NM1 A;  1Q7Y O;  2NRH A;  4U67 L;  1QQN A;  1BA0 A;  1S3X A;  3R1X A;  4YOV A;  1HKG A;  2GWK A;  1SQK A;  3UKR A;  2E2N A;  3KK7 A;  3VEO A;  5EY4 A;  4DHY A;  5BPN A;  3CER A;  3EE8 A;  2V51 B;  4FWP A;  4JAX A;  4NLC A;  3SK3 A;  4JN4 A;  1HKB A;  2GUP A;  3HOS A;  3CHW A;  1TUY A;  1ZBS A;  3CJA A;  4IDH A;  1NMD A;  3F5T A;  5MLC Q;  2QM1 A;  3ZX0 A;  3SLC A;  4GVE A;  3MX5 A;  1TYQ B;  4WF9 L;  3L6Q A;  3JXU A;  3QBX A;  3D6R A;  3O9R A;  4JHD B;  3I33 A;  1E4G T;  4JKH A;  4BG9 A;  1T6D A;  1BUP A;  5ADX H;  5KQ8 A;  1V4S A;  4CJ7 A;  2A5X A;  4BRH A;  3D2E A;  4IO9 L;  3WUH A;  5I9E B;  5AZI B;  3UKR B;  5KPZ A;  4BRE A;  5FPD A;  1K9M O;  5CHI A;  3CJC A;  3SMP A;  3BEX A;  3VPZ A;  4K41 A;  5BPL A;  1CZA N;  3HTV A;  4JKF A;  5KPR A;  2V52 B;  2P9I B;  3WQT A;  1GLC G;  3CME N;  4ILH A;  2QWP A;  4I6M A;  3H45 C;  3PLA A;  4C1N I;  3K9K A;  3CC4 N;  1KAX A;  2QI2 A;  5EXW A;  3ENH A;  3GDQ A;  2P9S B;  1C0F A;  3IFR A;  2W41 A;  3OBY A;  2GTD A;  5AQZ A;  3I8B A;  3VOV A;  3A5M C;  3OHR A;  5AFU A;  4NO7 A;  1U6Z A;  3QFP A;  5GAH P;  1YJ9 N;  1RGI A;  2KLA A;  2P9U B;  3MMV A;  4BQZ A;  4BRQ A;  5C2D A;  1DKG D;  3CCQ N;  3C65 A;  1ILY A;  3VF2 A;  4H5N A;  2FF6 A;  2FSN A;  3FZF A;  3O8M A;  4WQ4 C;  3WXI A;  2VYP A;  2ZWH A;  4BRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...