4H0OA

Crystal structure of acetate kinase from entamoeba histolytica
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
391
structure length
383
Chain Sequence
SNVLIFNVGSSSLTYKVFCSDNIVCSGKSNKPFIEHHLNGQIIKIETPILNHPQAAKLIIQFLKENHISIAFVGHRFVHGGSYFKKSAVIDEVVLKELKECLPLAPIHNPSSFGVIEISMKELPTTRQYVAIDTAFHSTISQAERTYAIPQPYQSQYLKFGFHGLSYEYVINSLKNVIDVSHSKIIACHLGTGGSSCCGIVNGKSFDTSMGNSTLAGLVMSTRCGDIDPTIPIDMIQQVGIEKVVDILNKKSGLLGVSELSSDMRDILHEIETRGPKAKTCQLAFDVYIKQLAKTIGGLMVEIGGLDLLVFTDQMGLEVWQVRKAICDKMKFLGIELDDSLNEKSMGKKIEFLTMPSSKVQVCVAPNDEELVILQKGKELFQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetate kinase
publication title Crystal structures of acetate kinases from the eukaryotic pathogens Entamoeba histolytica and Cryptococcus neoformans.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Transferase
total genus 126
structure length 383
sequence length 391
chains with identical sequence B
ec nomenclature ec 2.7.2.12: Acetate kinase (diphosphate).
pdb deposition date 2012-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4h0oA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4h0oA02
1SQKA 3CETA 4FSVA 1NGIA 3SK3A 2HOEA 1NGBA 2IIRA 5E26A 3HBTA 4GNIA 5F0XA 1RDWX 1E4GT 1GLAG 2NZTA 3VEZA 1U6ZA 5AQKA 3A5OC 2ASPA 1T6CA 3QB0A 2P9SB 4NB4A 5JLHA 4QS8A 2E8AA 3J8AA 5LY3A 1NGGA 5AQVA 1BO5O 1NGAA 4PKGA 3MK6A 2ASMA 1R59O 4BR7A 4H0VB 1QZ6A 4PL8A 3UKRA 4JD2A 5AQTA 4QS7A 1GLCG 1GLJO 3M6GA 1NGJA 3M3ZA 4FL9A 4A2AA 1HUXA 1TYQA 4H0TB 1ATSA 3U4LA 5CE3A 3WEEA 5LJWA 1BUPA 2F9TA 3CHWA 5ELZA 4BRQA 1P8ZA 3WUHA 3H45C 4Z94A 4A61A 4BGBA 4BROA 4B1WB 2KHOA 4BC5A 2CGKA 2IVOA 2BUPA 2A3ZA 1BU6O 4DB3A 4CZEA 4CBXA 3ZEUB 2P9PA 1HJOA 4BRNA 4BR0A 1QHAA 4F9OA 3M1FA 3LL3A 4CZHA 2IVNA 3UB5A 4XEIA 1RFQA 3ZETA 1LCUA 2E2PA 3DXKA 4RTFD 3UKUB 3U8XA 3LDNA 4ISFA 1D4XA 1U2VA 2QM1A 1ESVA 1MWKA 3DWLA 5B8HA 2NRHA 5FPMA 2V7YA 2YJFA 1BG3A 1TUYA 5JICA 1YXQA 3GG4A 3ATVA 1Z05A 4I6MB 5AQMA 5AQJA 5BPNA 4WQ4C 4A2BA 1JCGA 3GDQA 1NGFA 4IZ9A 2D0PA 3AAPA 3A8YA 3WQTA 1GLDG 1T6DA 4NO7A 4XH5A 1HPMA 2A40A 3D2EA 4JN4A 4B1UB 3VETA 3VEXA 3WQUA 2GUPA 4CBUA 1K8KA 1NGCA 3CJCA 4BR2A 5BR9A 3LM2A 4BRHA 3WXJA 2P9UB 4H5NA 5FPDA 1BOTO 3HI0A 2FSNA 2V52B 5AQZA 3L4IA 1C0GA 2Q97A 2W40A 3ATUA 3FFKB 4FWKA 4BGAA 3R8EA 1CZAN 3W0LA 2I7NA 1MWMA 2GELA 2F9WA 5F2RA 3GOIA 2QW9A 5AQRA 3O8MA 4CZMA 2P9IA 3QBWA 2FF3B 1XUPO 2Q0UA 2Q0RA 3EN9A 5KQDA 3WXLA 1U2VB 5BRFA 3AAQA 3VGKA 2QWRA 3VENA 4FO0A 3DJCA 3ZX3A 3O1WA 3MCPA 5ADXH 2ASOA 4EIAA 5AZIB 3CJAA 1OKJA 1HKCA 2Q1NA 2GWJA 3VF2A 1Q18A 5FPNA 4FPBA 4IXCA 3VEYA 3R9PA 3O4WA 4DHYA 1NWKA 3MN5A 1S3XA 1NM1A 4WQ4A 1G99A 3VEOA 2P9NB 4IJAA 2E20A 1Z6RA 3HM8A 2VWBA 1WOQA 4DCHA 4PKIA 5JMVA 1BA0A 3MDQA 5EOYA 2UYTA 3WXIA 4C23A 1KAZA 4RWTA 3BUZB 4JNEA 3WT0A 3VEVA 2ZGYA 2YJEA 4K43A 3MN6A 5AQXA 2CH6A 4BRPA 2E1ZA 4YDUC 3KHYA 3FZHA 1H1VA 3CI5A 2HF3A 5AQQA 4FWQA 3HTVA 2FF6A 5BRDA 3FR0A 3D2FB 4H0PA 3QICA 3ENHA 4LC9B 2P9LA 3H3OB 4BR9A 4EFHA 5BPMA 4RCHA 2IVPA 3ID8A 4MLHA 2BTFA 1IG8A 3VOVA 3EO3A 4H0YB 4K42A 5BREA 1E4FT 5AZJA 2I7PA 2CGJA 3P4IA 3O1BA 2CGLA 4M63C 5EY4A 1GLLO 2OANA 3DXMB 4H0OA 3A5LC 3ZX0A 4EHTA 4JHDA 1SAZA 2QWOA 1QQOA 5AQOA 4CBWA 1HX1A 3FLCO 4M7XA 3C7NA 3I8BA 1ZXOA 3CJ1A 3A5NC 4CZIA 2ZGZA 3U9ZA 4M7YA 4B1XB 3KVGA 1NMDA 4FOIA 4HTLA 5E84A 5ADXA 5AQNA 4EHUA 1DEJA 5AFUH 2H3GX 5BRHA 1J6ZA 4K41A 3JXUA 3ULEA 2HF4A 3LDPA 5AQLA 2A42A 1JCEA 4BRCA 4B1ZA 5EXWA 2E2OA 1V4TA 3UKRB 3BF3A 4JD2B 3EKUA 3VF6A 3VERA 4IO8A 4K25A 3CJ7A 4WQ5C 3IFRA 3C0BA 1TYQB 2EWSA 2QWPA 2Q31A 4CI6A 3W3DA 1QQMA 5AQYA 3WEEB 3H6EA 1S22A 1X3MA 4BC3A 3MN7A 3VF4A 3FZLA 1LOTB 2YHWA 4YDUA 2VCPA 1T44A 3OHRA 1BA1A 4BRLA 4CZGA 1BWFO 1GLFO 2A6AA 4B1YB 3CQXA 3O5BA 4BRAA 3EZWA 1NGEA 2P9PB 4BRFA 4BVOA 2E1YA 3SMSA 2ZF5O 3VESA 4BREA 5AQWA 3ZETB 3SJHA 3DXKB 3VGLA 1DGKN 2AP1A 4JAXA 4KBOA 3D7EO 3HSCA 4XH4A 1KXPA 3FE1A 3GE1A 2E88A 3QBXA 4H0XB 3VPZA 1KAYA 1HKBA 3CJ9A 2E2NA 4BG9A 1NGDA 2QWMA 1HKGA 3FZKA 3LDOA 4FPAA 4AM7A 5KPZA 1YAGA 1NBWA 1Y64A 3FGUA 2V51B 1RGIA 5AQFA 1ZBSA 3CIPA 5AQUA 2D4WA 4MLEA 4IJNA 4FWPA 3ULEB 4WYBA 4BC4A 4B9QA 4E1JA 1MA9B 3LDLA 4BRDA 3B8AX 5LJVA 4XH1A 5AQGA 4O5FA 4CZJA 3D2EB 4H03B 1ATNA 3SMPA 4FWNA 1K8KB 2FXUA 1ATRA 2AA4A 4WQ5A 3VGMA 4CZLA 4DQ8A 5JLFA 3QFUA 3BF1A 3JS6A 1GLEG 5AQPA 5TKYA 4H5RA 3GBTA 3LDQA 3A0IX 2PAVA 4HWIA 4I6MA 1DKGD 4BVPA 3BP8A 4FOEA 2A5XA 3ENOA 3TU5A 1NGHA 3DAWA 2FLOA 3IDHA 2P9IB 2QWQA 3CJBA 1BDGA 4J8FA 3U9DA 3S41A 4H5TA 2CH5A 3H46O 5EVZA 5AQIA 1YUWA 1QZ5A 2PBDA 1NLVA 2WUSA 5KQ8A 4EAHD 4MO5A 4FWOA 2Q36A 3CQYA 3IUCA 3R6MA 4BRMA 3H1QA 4CD3A 1KAXA 4QS9A 5FPEA 2P9UA 2GTDA 3RSEA 3HZ6A 1ZC6A 4BG8A 2FSJA 3MMVA 3O08A 3KZBA 3L0QA 4BRKA 3GL1A 3O6WA 2FSKA 2W41A 3G25A 3I33A 5KPTA 1SZ2A 5I9EB 3CERA 2Q2RA 3A5MC 3QMLA 2P9KA 3ZX2A 5BN9A 5F1XA 3H1VX 4GY2B 2E2QA 3TPQA 1X3NA 3WXKA 4PL7A 1MDUB 4B1VA 2NLXA 2D0OA 2ZWHA 3O80A 3FZFA 5AQHA 4CJ7A 5AZIA 2ITMA 5EX5A 5AR0A 1WUAA 3MN9A 2VYPA 1GLBG 2QWNA 4CZFA 5AQSA 2YHYA 2GEMA 4BRIA 1IJJA 1X9JA 2P9LB 4BR5A 2P9NA 5AZJB 3IMXA 2P9SA 1QQNA 3QDKA 5BPLA 4ISEA 4Y0WA 4JHDB 3F9MA 3QFPA 1C0FA 1HLUA 3VEWA 3LM9A 2HMPA 2V7ZA 4FWLA 3RSEB 3C7NB 2QWLA 1YVNA 2DPNA 4BQZA 4PKHA 2YCHA 4O8KA 4A62A 3UE5A 1JCFA 4H5VA 4BRGA 1V4SA 1XQSC 3FZMA 3AY9A 4BR4A 4H5WA 4FWMA 4ISGA 2D1KA 4BQLA 3D2FA 2P9KB 3EKSA 2GWKA 5BN8A 4CD1A 2A41A 5KPRA 3L6QA 4IWVA 3H3NO 4FWSA 2J4RA 1EQYA 3SLCA 4CZKA 1XC3A 3EL2A 4MO4A 4BC2A 1TUUA 3ZEUA 3DXMA 4AM6A 5AFUA 3UKUA 2YHXA 3BEXA 4FWRA 4L3QA 2QXLA 3AARA 2YI1A
chains in the Genus database with same CATH superfamily
1NGIA 4QAGA 1NJIO 1NGBA 2QA4N 3SV4A 5E26A 3AO5A 1NJXA 3ZSWA 4GNIA 5F0XA 2B4JA 5GADP 2ASPA 4LSNA 1EKEA 4A5BA 3NCIA 4M3YA 3VQ8A 5LY3A 4DV0K 1NGGA 3QNOA 1VSKA 1BGXT 4LD0A 1MU2A 3MK6A 3ZLJA 4J2BA 1R59O 2WC9A 4YFUA 2HBJA 4BR7A 4H0VB 3UKRA 4I7FA 4MQ3A 4HTUA 1W7AA 1GLJO 3SUOA 1HUXA 1TYQA 1ATSA 3U4LA 3B6OA 1ZBFA 4KH4A 4FJIA 4B9LA 3CHWA 1N36K 1BL3A 5ELZA 4CEAA 4RW6A 4BROA 4BC5A 3CCRN 4OPJA 2BANA 5C2DA 4J2EA 4E19A 1LAVA 5CHIA 1RFQA 3ZETA 1LCUA 4RTFD 4B9NA 3JSMA 3U8XA 3LDNA 1YF5L 4ISFA 4LH5A 3HYFA 4B3SK 2QK9A 2QM1A 1MWKA 4DU1A 1ZBUA 3LP0A 4WF9L 2Q3SA 1CLQA 3NGYA 4DSJA 1KQSM 5JVGL 1FK9A 4L8RB 4RW8A 1Q7YO 2O4IA 4QCLA 5M1NA 3K9JA 2HBMA 4IZ9A 3PO5A 4Z4IA 3ISNC 4FLUA 2KW4A 3VQ6A 4IG0A 3S3NA 2PYLA 1M1KO 2UUBK 1RBTA 4FJGA 5GAEP 3M8SA 4DQPA 1D9DA 1RCHA 1HNIA 4B1UB 3VEXA 1NGCA 4GV9A 5I3UA 1E3MA 4PY5A 3TSQA 1VQ8N 1JLAA 4CHNA 3V9ZA 1Q86O 4IKFA 4JI6K 1EO1A 3L4IA 4Q0BA 3PUFA 3FFKB 3W0LA 3E01A 4DMNA 4X64K 4B8AB 4F4KA 2KFZA 2QXFA 2FF3B 1DLOA 3NF9A 3EN9A 5KQDA 1RTHA 3WXLA 1U2VB 3RWUA 3AAQA 2AJQA 3T1YK 3ZX3A 3V81A 3O1WA 2ZQBA 3KLIA 4FW1A 3U3GA 4BY9C 5ADXH 1WB9A 4EIAA 3AVHA 1OKJA 1HKCA 4GVEA 3WXMB 4EZ6A 4IEEA 5TKWA 4X65K 4M3WA 3VF2A 1FXXA 1Q18A 3DLEA 3VQCA 3V9WA 1TL3A 1NWKA 3THVA 4FK2A 1NM1A 1NOYA 3TI0A 3VEOA 4FZZA 2P9NB 3VQ4A 3O3HA 3HM8A 3IKMA 4JI7K 2VWBA 4DV1K 1WOQA 1TKTA 3KD1E 3MEGA 1LV5A 1TKZA 3QIOA 3WT0A 4C8OA 1XNQK 4JKGA 1VK0A 4CFAA 5AQXA 3LWMA 3RRHA 1JXEA 3NF7A 4A57A 1J53A 5HOOA 2YNIA 4YY3K 2VG6A 3ZSQA 4CHQA 5D3GA 3D2FB 3CFPA 2VGMA 3O4NA 3CCJN 3ZSZA 4RW9A 3H3OB 1NK8A 5CZ1A 1QTMA 3O9QA 4EZ9A 4JKAA 4K42A 4PUOA 1E4FT 1LWCA 2I7PA 3L3UA 4DQQA 1VSIA 3A5LC 3MXJA 4H0OA 3ZX0A 4JHDA 3NF8A 4F2RA 1SAZA 4KV8A 3HT3A 1HX1A 3FLCO 4M7XA 3I8BA 2HBLA 3C6TA 4CJUA 3C6HA 4FOIA 3CFRA 2OPSA 4EHUA 1DEJA 4TSXA 1NK9A 4KTQA 1CXUA 2H3GX 3AVKA 4ILGB 1QVGM 1JCEA 4BRCA 1J9AA 2E2OA 4JD2B 4C8KA 4IOXA 4IO8A 4GKKK 3C65A 3DYAA 3C0BA 2QKKA 1FW6A 3P1GA 1C0MA 3J80O 3W3DA 1BCOA 3QEVA 4WE1A 3H6EA 1QVFM 2BH1A 3FZLA 4CJQA 2O8DB 1T44A 4CZGA 4AQYK 1S1XA 3O5BA 4KI4A 3ASMA 4OX9K 1RT4A 1EWRA 4B9MA 3KLEA 4BRFA 2WOMA 4O0JA 1N8RO 4W5NA 3VGLA 3DXKB 1DGKN 4KBOA 1KVBA 1FJGK 3KWGA 4XH4A 3MWTA 4AH9A 3MCAB 1SKSA 2G8IA 4OKKA 3AVJA 1HKBA 3QNNA 3KWIA 3A2FA 1NGDA 1HKGA 2G8HA 3B6PA 5HL7L 4CESA 5MLCQ 4C8MA 3FGUA 4BDZA 1NKEA 4DUZK 4CJRA 3V1QA 2G8WA 4MLEA 2HNZA 3RR7A 1C0UA 4DKWA 3G71N 4X62K 3SPYA 3KK3A 3JAMO 1Y97A 3D0PA 1KSPA 4J2AA 5KGXA 1XI1A 3VGMA 3WNFA 4DQ8A 3NFAA 2HHVA 4DWIA 4FYDA 1RTJA 3HPGA 4KHWA 1GLEG 5AQPA 1UOCA 2D0AA 2X74A 5IWAK 3LDQA 2PAVA 5C24A 4FCYA 3ENOA 3TU5A 1I39A 1NGHA 2NRVA 2FLOA 1D8YA 2P9IB 1BI4B 4E1NA 1BDGA 1YJ9N 3AVNA 1T7PA 5EVZA 5AQIA 4KH5A 4KFBA 4DU4A 4OPKA 1OVQA 4CIGA 2WUSA 4YOXA 2O8FB 3AVLA 3AO1A 3DOKA 5HBMA 4DTUA 4MO5A 4CK3A 3CMEN 4BRMA 3OYMA 4E7JA 4O4GA 1ZC6A 4BG8A 2F8TA 4I2PA 3MMVA 1Q82O 4BRKA 1UWBA 4HCBA 4CJWA 2OTJN 1YTAA 1IBKK 2DTUA 3CERA 4A5AA 4YOWA 1IO2A 3DOLA 5HRRA 3CQ8A 5BN9A 5F1XA 3H1VX 1W97L 3MEEA 1CZBA 2BGGA 1LW0A 3OA9A 3WXKA 4PL7A 3G4SN 2NLXA 4FLWA 1VAZA 3AO3A 3CPEA 4YOTA 3O80A 3FZFA 4CJ7A 4QOZB 2QI2A 3CCEN 5AR0A 4CGFA 2HMIA 3T3FA 1VQPN 1IJJA 1X9JA 4DQRA 3PIOL 1JKHA 3ZSVA 1TK0A 2O8EA 4CEBA 3IMXA 4DR6K 4UY8O 3QDKA 1J5EK 3HSTB 3QESA 3C94A 5M1FA 2Z1IA 4ISEA 1TAUA 4Y0WA 3QFPA 3CCSN 3PSFA 1C0FA 1LW2A 1HLUA 2HMPA 2V7ZA 3DRPA 4FLTA 4E7HA 3KKSA 4BQZA 4IOAL 1WSGA 4CEFA 4CHZA 1NKBA 1VSHA 2RE2A 2ZE2A 4N56A 5DM7L 2RN2A 3H08A 4ISGA 3WNHA 4LF9K 4LF6K 4CEEA 2A41A 3IS9A 5KPRA 4IWVA 4DS5A 3H3NO 4FWSA 1HNVA 1XC3A 3HP6A 3ZEUA 3T69A 3THXA 1RDBA 2RHKA 3BEXA 1QHTA 1C1AA 4JI4K 2QXLA 1EX4A 3CETA 4Y1DA 4YHHK 3CC7N 3PLAA 2IIRA 1RDWX 4ZTJA 3VEZA 2G8KA 1L3TA 3A5OC 1T6CA 1VSEA 2P9SB 5AQVA 5HLFA 1BO5O 1X9WA 3IG1A 4E89A 2A1RA 3VQDA 3TAGA 1Q9XA 4YOYA 3SQ0A 1KD1O 4DQIA 5AQTA 4NCAA 1GLCG 1KLMA 2WTUA 1NK0A 3M3ZA 1VSJA 4M3UA 4PWDA 4CIFA 1I3AA 3O9SA 3VTIA 3WEEA 4DV2K 5LJWA 4DLGA 4B3OA 1K73O 5I42A 2NRXA 3RTVA 4B9SA 3PX0A 1QSLA 2VGNA 4M3XA 4BE2A 4B1WB 2KHOA 2CGKA 3PX6A 4DB3A 4JK7A 4HVJA 3AGKA 1S9GA 4KREA 4IFYA 4F9OA 4K8ZA 4CZHA 3TAFA 5DMRA 3UKUB 2XHBA 1ESVA 1A5VA 5B8HA 4RW4A 3CCQN 1BG3A 4FW2A 3HVTA 3E9OA 1NOZA 1XHXA 5JICA 3AGRA 1WBBA 4PA1A 1Z05A 4M45A 1NGFA 4M42A 3WQTA 3G6EN 4W5QA 2NRZA 4LF7K 3SNNA 4DTNA 1GLDG 1S1TA 3T7ZA 2F7TA 3KK7A 1L5UA 4FJ7A 1VQ6N 4Z4EA 4OVLA 4FVMA 3WQUA 2WFBA 1RT5A 1NJZA 4CBUA 1K8KA 4JS4A 1WSJA 4BRHA 4H8KA 4H5NA 5FPDA 1BOTO 4NCBA 2P51A 3NVMA 3OYDA 3UIQA 4KHPK 3S3MA 4KHYA 2ZJQL 3CCVN 3R8EA 4CHOA 3ZYYX 1MWMA 4A59A 1EETA 2F9WA 3LAMA 3O8MA 1W9HA 4CZMA 3MEDA 2Q0RA 1XUPO 3QERA 2YV0X 4H4OA 3THWA 1B9DA 4DR7K 3VA3A 4FZXC 4FJHA 3AVBA 3VTHA 3V1RA 2ASOA 1S6QA 4CJPA 2Q1NA 4JS5A 4CJ3A 3SBTA 1C1CA 4JEPA 4FPBA 2O8BB 4IXCA 2HHXA 1S3XA 3LP3A 1KC8O 1OH5A 3M8PA 3IAYA 1YJWN 1P90A 2O8CA 3VQ9A 2GV9A 4IJAA 3SAFA 1N5YA 4PQUA 4PKIA 4WFNL 1BA0A 4DF4A 4NCGA 1HNWK 2JWLA 5FRMA 3J81O 4JNEA 4K43A 3MN6A 3PIPL 4KB0A 4BACA 3SI6A 2YX6A 4BRPA 1KFDA 1J5OA 5GIPA 4KTZA 1VQLN 1H1VA 2HF3A 3Q7BA 4FWQA 5AQQA 4FJNA 5E41A 1RBRA 2UXDK 1UA0A 4LC9B 1VSDA 3I0SA 4BR9A 3AVAA 2BE2A 4LY7A 4IOCL 2XY5A 2IVPA 3ID8A 3OBYA 2BTFA 1JJ2M 3EO3A 1VQKN 5AZJA 4MFBA 3P4IA 3O1BA 2CGLA 5EY4A 3M5RA 3PV8A 3DXMB 2KKZA 3OYGA 4DSKA 5AQOA 3OBWA 2OTLN 2NRTA 3C7NA 3CJ1A 1T03A 4B1XB 3K0SA 4HTLA 5E84A 3P38A 5AQNA 4JV5K 1J6ZA 3OVNA 3KTQA 3JXUA 3ULEA 4FJ8A 3ZSOA 2A42A 1CXQA 1J54A 4IBNA 4B1ZA 3ZT2A 1V4TA 4CJ4A 4FJXA 2HHUA 1HPZA 3VF6A 4K25A 4JI2K 3QEWA 3CJ7A 3DM2A 4WQ5C 4DV3K 1VSLA 2Q31A 5C10A 3SAGA 4CI6A 5CYMA 3AVFA 2EHGA 1S22A 4FLZA 2OPQA 3LANA 2W6LA 3OHRA 1BA1A 1BIUA 4CE9A 3OS2A 1HNXK 5FRNA 3HVRA 3OYNA 2KTQA 2P9PB 1N34K 1NK5A 3AA3A 3SMSA 3VESA 4BREA 3SJHA 4Z4CA 2AP1A 3HSCA 4CEZA 4OJRA 1KXPA 1Z25A 3GE1A 3TAPA 1XNRK 3SUNA 2E2NA 3SUPA 2B5JA 3LDOA 4FPAA 3OJSA 4JKHA 3SUQA 1RBUA 4DV4K 5H1SQ 4BDPA 1RGIA 5AQFA 3CIPA 2D4WA 1HMVA 4FWPA 4JKBA 4WYBA 1Q81O 3ZT4A 3SQ4A 4BRDA 3NH0A 1NNEA 3T1HK 1K6YA 4XH1A 4JKEA 1D5AA 3ZCMA 3D2EB 4CCHA 1UAXA 1R0AA 3D6RA 3DLGA 4CZLA 4DUYK 1ASVA 3RMDA 3BF1A 1IH7A 4B08A 3EY1A 4U67L 1RDAA 3TABA 1U04A 4CEQA 3M8QA 5TKYA 3GBTA 2OA8A 2F96A 3FFIA 3A0IX 4HWIA 2HB5A 4BVPA 3BP8A 4LFBK 3C6UA 2IGIA 3KK1A 2QWQA 5FDLA 3RR8A 3ZSXA 3U9DA 4O55A 4JK9A 3K9KA 4KHUA 4H5TA 1U49A 4KKOA 5JS2A 1YUWA 3Q7CA 2PBDA 1NLVA 4W5OA 3S3OA 3HP9A 3PSIA 3O3GA 3NHGA 4MDAA 4YNQA 1BQMA 4CERA 1KAXA 3IRXA 4QS9A 3C95A 2HNYA 3EZ5A 4O44A 1CZ9A 1KFSA 2FSJA 2OZMA 2Z1JA 2X6SA 3O08A 3L0QA 3GL1A 5M1QA 2FSKA 4HHTA 1L3VA 3G25A 1YTUA 2GX9A 1K9MO 2RKIA 1WN7A 2Q2RA 3A5MC 2P9KA 4GY2B 4DLEA 1X3NA 3QINA 4PHTX 1IV0A 4CFDA 4E1MA 4AHCA 4KRFA 3SCXA 1YJNN 2ZWHA 3VA0A 4FM0A 1T3VA 4DV7K 1WUAA 3MN9A 2OCEA 4NLBA 2VYPA 3EEQA 4KPYA 4CW7B 2GEMA 2P9LB 4BR5A 4LF4K 4I9QA 2VG5A 4FZYA 2P9NA 3EE9A 5J2QA 1QQNA 3HRGA 4O0IA 5BPLA 4ID5A 5GAGP 5SZTA 3RMBA 1Q9YA 1RTIA 4OPAA 5J2NA 4FWLA 1JLQA 4N47A 1YVNA 4O8KA 4A62A 3UE5A 1V4SA 3L2VA 1XQSC 2KFNA 2HHHK 3TARA 3R3LA 2OYQA 3D2FA 2KZZA 3I0RA 5BN8A 2G8FA 4CD1A 3THYB 1NU0A 3P5JA 3CC4N 2J4RA 4I9LA 4CF1A 3EL2A 4EP4A 3LPTA 4R5PA 4F2SA 4KO0A 3T1AA 2ZM6K 4L3QA 3PY8A 3MECA 5C12A 3L8BA 1SQKA 3SK3A 3NBPA 4WFAL 1IG9A 2HOEA 2FBVA 2O8EB 2FBTA 1E4GT 1GLAG 4OLBA 3QB0A 5JLHA 4NB4A 4QS8A 2E8AA 3CF5L 5JVHL 1IKYA 3OYJA 1SL0A 1NGAA 2ASMA 4U7BA 4DFPA 4PL8A 3T19A 4JD2A 1RTDA 3K57A 4QS7A 3CC2N 3DRSA 1NMNA 3M6GA 3ZSRA 1BCMA 3K59A 1OH7A 4JI1K 4H0TB 4A2AA 3L2QA 4FJLA 2JLEA 1NG9A 1TVRA 5CE3A 1BUPA 2F9TA 4CJKA 1ZBLA 3K5LA 1O13A 2O8DA 4KHSA 1P8ZA 3WUHA 4OKJA 3H45C 4Z94A 4AF1A 4A61A 4BGBA 5C25A 2ITGA 2BUPA 4Z4FA 4CZEA 3P83D 3ZEUB 4BR0A 1HJOA 5KTQA 4V19S 3M1FA 3UB5A 4XEIA 2E2PA 3DXKA 5HRNA 3OS0A 3THXB 5M1KA 4DG1A 3TSUA 1D4XA 4B3MK 2GUIA 2NRHA 3O9TA 5FPMA 3HOTA 2YJFA 1O1WA 1ZBIA 3HL8A 1TUYA 3QIPA 1YXQA 4ID1A 1EP4A 4OO1J 3GG4A 4I6MB 4KTWA 5AQJA 5AQMA 5BPNA 4WQ4C 2OPRA 3AO2A 2YHBA 4FK4A 1JCGA 4CJVA 3A8YA 4DQSA 1HNZK 1WLJA 4NO7A 4XH5A 1HPMA 4DSFA 4M41A 4DFMA 2A40A 4JN4A 1Q8IA 3SQ1A 4FJMA 2GUPA 1N32K 3CJCA 4BR2A 3LM2A 3RVCA 4MDBA 2P9UB 4I2QA 3ITHA 3HI0A 4F3TA 1ITGA 2V52B 5T7BA 5AQZA 4RG8A 3DLKA 1CZAN 2I7NA 4Q5VA 1XHZA 3GOIA 2QW9A 1W0HA 1DT9A 2P9IA 1OH6A 1BI4A 2Q0UA 4EP5A 4CF2A 4W5RA 3L4QA 2LSNA 3L2WA 3VENA 2O8FA 3CFOA 4J2DA 3L2RA 3LDSA 5AZIB 3CJAA 5LL6Z 4BWMA 2GWJA 3NH1A 1SL1A 3HK2A 1JXBA 1VQ4N 3R9PA 4DHYA 4B9VA 2UXCK 4E7LA 1VRTA 3VQQA 5KGWA 5CR4A 3OTOK 4KHNA 2E20A 1Z6RA 1QS4A 3D45A 3KKRA 1D9FA 1NK7A 4DU3A 2ZJRL 2FBXA 5JMVA 3WXIA 3BZKA 1U47A 4RWTA 4LH4A 2NRRA 2YJEA 2P5OA 2YNFA 2PYJA 2E1ZA 3NVKA 2Z1GA 3CXCM 4YDUC 4GVMA 5IT9O 3HTVA 2FF6A 3G0ZA 1S5JA 5BRDA 4DTMA 3FR0A 3VQBA 1DTQA 3P31A 3U6FA 3AVIA 3ENHA 4BE1A 5BPMA 4HUEA 4OPHA 1IG8A 2FBYA 3VOVA 5BREA 4NXMK 3NE6A 2W42A 1GLLO 3NDKA 4CFBA 2QWOA 4CF0A 4KAZA 4IO9L 3O9RA 4CBWA 3MWPA 1SV5A 3CYMA 4NYFA 1WSHA 2IS3A 1S1VA 2DFEA 4DSLA 1LWEA 3A5NC 4CZIA 3E1YA 4CK1A 4JYAK 3U9ZA 4ILHA 3AA4A 2QTDA 1NMDA 1TK5A 4DFKA 3U3YA 2DY4A 1VQON 4E7KA 1W2BM 3HPHA 1XC9A 4FJ5A 1BQNA 3LDPA 4CJ5A 5AQLA 1VHXA 5EXWA 4CK2A 4CHYA 3ULDA 3UKRB 3BF3A 4B9UA 3LZJA 2VG7A 4XIUA 1U45A 4KHQA 3IFRA 4BE0A 1NKCA 1TYQB 4C8LA 2QWPA 1QQMA 2NNWA 1RT6A 4BC3A 3KIOA 3K2PA 3VF4A 4GKJK 3DI6A 1LOTB 2YHWA 4DR2K 2F8SA 4DSIA 4FK0A 1HQEA 1UA1A 2IDOA 4K0KK 1TK8A 4BRLA 3K58A 1BWFO 2E6LA 2A6AA 4IDHA 4B1YB 1C0TA 3RMCA 4BRAA 3EZWA 4E3SA 4AHVA 4CJSA 3ZETB 4JAXA 2O4GA 4BWJA 4DV6K 2UU9K 3QBXA 4M3TA 1KTQA 2E88A 5KI6A 4JI8K 4H0XB 3VPZA 2VWJA 3QEXA 5DM6L 2QWMA 4E7IA 2R7YA 2HHQA 1Y64A 3ENBA 3S9HA 2IAJA 4B9QA 3ULEB 4IJNA 1Z26A 4E1JA 3TWHA 1N33K 1MA9B 3LDLA 3B8AX 5CY4A 4FLYA 3OYLA 4M3ZA 4H03B 4M3RA 1ATNA 3V9SA 2JWKA 1ATRA 4WQ5A 3V6DA 1L3SA 2HHTA 3R1XA 4IFVA 2XRIA 4CGIA 4Y1CA 4O8UA 3TSPA 4X66K 1TKXA 3CD6N 1TAQA 3ALYA 3V9UA 2G8VA 4FOEA 2A5XA 3QLHA 4C1NK 3DAWA 3IDHA 5GINA 3TTDA 5JS1A 4J8FA 3S41A 1G15A 3HJFA 1RNHA 3H46O 1C1BA 3VQPA 3L2UA 1WSFA 3MX5A 1KLNA 5LMNK 4KI6A 3NF6A 4FWOA 2Q36A 3R6MA 4CD3A 5J1EA 5FPEA 2GTDA 3RSEA 3HZ6A 4FM2A 4DR5K 1X9MA 3DLHA 1BHLA 2X6NA 1YI2N 1WAFA 1A5WA 3O6WA 2ZJPL 3I33A 2HVHA 1RT3A 1SZ2A 1VQ5N 3OS1A 5I9EB 1DTTA 3QMLA 3C6AA 2YKNA 4Z4HA 4Z0UA 2E2QA 4O5BA 4CJFA 3BGRA 3QEPA 4JKGB 4DTSA 3LALA 1MDUB 1KRPA 2F4VK 1VQMN 4JRPA 4G9ZA 5AQHA 2VQEK 1REVA 2ITMA 4KH6A 5EX5A 5K14A 3EYZA 1IBLK 5HRSA 3LP2A 4B9TA 4GV6A 2B6AA 1VRUA 1GLBG 2O8BA 2QWNA 3P39A 4CZFA 2YHYA 4CHPA 2QEXN 4CF8A 1JLFA 3BDPA 3LAKA 3K5MA 3TANA 2OPPA 5FLXO 1K8AO 1XMOK 1GOAA 4JHDB 2HBKA 2UUAK 3LM9A 2KLAA 5C0YA 1I94K 2PY5A 2QWLA 1VQ7N 5GIOA 1NJYA 3E9LA 4PKHA 2YCHA 3ID6A 1SL2A 1JCFA 1IKVA 3MAQA 4CJEA 3QO9A 3AY9A 4FWMA 4CGDA 2D1KA 4BQLA 2P9KB 4JKCA 2GWKA 1RDCA 4CF9A 3L6QA 3TR8A 1EQYA 1SUQA 3VQEA 3J7AP 3OYIA 1A5XA 4BC2A 4ILJA 4DR1K 1VQ9N 4WFBL 3DXMA 1BIZA 4CGHA 4ELUA 2YHAA 1JL2A 4DFJA 3AARA 3N4QA 2YI1A 4FSVA 4UQGA 1C6VA 1L3UA 2EX3A 1XMQK 5M1PA 3HBTA 2E4LA 3TTCA 4CGGA 2NZTA 3HPOA 2P5GA 1U6ZA 5AQKA 3J8AA 4IG3A 3N4PA 4JLHA 2FC0A 4PKGA 1TGOA 1VSMA 1S6PA 4G1QA 3OYCA 1QZ6A 1RBVA 3DLRA 3G10A 1NGJA 4FL9A 1VQNN 1S9EA 1XWLA 3EE8A 1S1UA 4C1NI 3HXMA 3VQ5A 1HJRA 1HYSA 4BDYA 4BRQA 4CJLA 3LPUA 5C2FA 3CMAN 1RDUA 1X9SA 2IVOA 2A3ZA 1BU6O 3O9UA 4CBXA 4BRNA 2P9PA 1QHAA 3LL3A 2IVNA 1JL1A 3KLFA 1JLGA 5DK5A 1QSSA 4DTJA 4N41A 1U2VA 3DWLA 3O4QA 3F2KA 5C15A 4IFEA 1IKXA 4IDKA 2V7YA 3WNGA 4HCCA 2HHSA 3DRRA 1QSYA 1WBDA 2YNGA 2D0BA 3ATVA 2X78A 1FKOA 3LWLA 1TL1A 1U4BA 1YVUA 4A2BA 3GDQA 4JI3K 1GOBA 2D0PA 3CCMN 3AAPA 1RBSA 3MX2A 4AILC 1T6DA 1QE1A 3BZCA 3ZT0A 4WCEL 4LFAK 3D2EA 2E5LK 3TAEA 3VETA 1YHQN 3F9KA 3OW2M 5BR9A 4CGJA 4FVUA 4CEOA 1WSIA 5BR8K 1T05A 3WXJA 4B8CA 4C8NA 2FSNA 4DTXA 2BDPA 1GOCA 4ICLA 1C0GA 2Q97A 2W40A 3ATUA 5KRSA 1IBMK 4FWKA 4BGAA 1LWFA 2GELA 5F2RA 3DMJA 5AQRA 4CVNE 3CM6A 3OJUA 3QBWA 3NGIA 4CEDA 3OYKA 5BRFA 4LF8K 3VGKA 2QWRA 3I8DA 4FO0A 3AVGA 3DJCA 3KK2A 4FLXA 1HR0K 3MCPA 2KQ2A 2D0CA 3RMAA 4NLCA 4YOVA 3NAEA 5M1OA 1M90O 5FPNA 3LZIA 5HRPA 4DSEA 4LFCK 3VEYA 3O4WA 1N6QA 3MN5A 3CG7A 3KLGA 4CFCA 4WQ4A 1G99A 3CCUN 1RT1A 2YKMA 4OGEA 4DCHA 1SKWA 3MDQA 5EOYA 2UYTA 4C23A 2HSTA 4ZHRA 1KAZA 5SWMA 3BUZB 1OH8A 4ELTA 1NJWA 3VEVA 2ZGYA 1RT2A 4CIEA 1EWQA 2Y1IA 2CH6A 2I5JA 2JGUA 4GV3A 3RRGA 3KHYA 3FZHA 3CI5A 1KVAA 3ZSYA 4OLAA 3MXMA 4DTOA 3NGZA 3OYFA 3MXIA 2YNHA 2Z1HA 4H0PA 3QICA 5C42A 2P9LA 4ZTFA 1JLEA 4EFHA 3SPZA 1RDDA 4RCHA 4DR3K 4MLHA 4H0YB 2CGJA 4M63C 3M8RA 4NXNK 2OANA 4LSLA 3AVMA 4EHTA 1QQOA 3OYEA 1SS6A 1VSFA 1ZXOA 4CECA 2ZGZA 1ZYQA 3VQAA 4YORA 3NMUA 4M7YA 2ATQA 3KVGA 4F3OA 5ADXA 1ILYA 5AFUH 2NRWA 5BRHA 4Z4GA 4K41A 3HM9A 2HF4A 3OYHA 3THYA 4DTRA 1S72N 3EKUA 1ZBHA 3VERA 4F8RA 4DR4K 1X1PA 2EWSA 3WEEB 5AQYA 4DS4A 2XY6A 2RPIA 1X3MA 1NK4A 3MN7A 4YDUA 4N5SA 1LAWA 5FROA 2VCPA 4B3RK 3AVCA 4AHSA 1GLFO 3O3FA 4KB1A 3CQXA 3WNEA 1WAJA 1NGEA 2NUBA 2UXBK 4AHUA 4BVOA 2E1YA 4JKFA 3J7YP 2ZF5O 3JYTA 2A1SA 5AQWA 3D7EO 2DFFA 4LF5K 3FE1A 3SZ2A 1KAYA 3K5OA 3CJ9A 4BG9A 1BISA 3FZKA 1RILA 2ZD1A 4AM7A 5KPZA 5GAHP 2OZSA 1YAGA 2IC3A 1NBWA 1U48A 2V51B 4DTPA 3SAHA 1ZBSA 5AQUA 3V9XA 4BC4A 5LJVA 4N76A 5AQGA 4O5FA 1F21A 2XY8A 4CZJA 1JLBA 3QETA 2HW3A 2KZMA 3SMPA 4FWNA 1HQUA 1K8KB 2FXUA 4JRQA 2AA4A 5A2QO 5JLFA 3QFUA 1T8EA 2HVIA 4JKDA 5HP1A 4FJKA 3ZT3A 2HNDA 2P1JA 1HYVA 3JS6A 4FLVA 1YT3A 2VQFK 4H5RA 2ETJA 4I6MA 1DKGD 1OVYA 3V1OA 3CJBA 2PZSA 1KCFA 1HRHA 5KRTA 3THWB 2CH5A 3SJJA 1JLCA 1QZ5A 5EU7A 3DLLL 1FKPA 4DF8A 2QKBA 4JI0K 3SQ2A 3PO4A 4B3TK 5KQ8A 2W6KA 4EAHD 4ELVA 1ASUA 3CQYA 3IUCA 3H1QA 1TKDA 1NK6A 4HUGA 2D5RA 2P9UA 3HOSA 2VWKA 2XO7A 4GW6A 3BY5A 2WBNA 3KJVA 2G8UA 3QEIA 3LP1A 3KZBA 2O8CB 1EXQA 5J2MA 2E6MA 2W41A 5KPTA 1QQCA 1B9FA 4W5TA 3NH2A 3ZX2A 3AO4A 5HROA 4OGCA 3TPQA 4FM1A 1RT7A 4NYNA 2RF2A 3I55N 4B1VA 2D0OA 2UUCK 1YITN 4HUFA 3TAQA 2HHWA 4DV5K 3CPWM 3F5TA 4JK8A 3OYBA 5AZIA 4GMJB 3SV3A 3CCLN 3OY9A 4CJTA 3ZT1A 1YIJN 5AQSA 3TTFA 4BRIA 4R79A 3KD5E 2GBZA 1KVCA 2WONA 4H4MA 3HO1A 5AZJB 3VQ7A 3DLBA 2XY7A 2P9SA 3AA2A 4JI5K 1B92A 3F9MA 4AHRA 3V4IA 5J2PA 1SKRA 3VEWA 2PFUA 3L3VA 3RSEB 1ASWA 3C7NB 3E9PA 1WSEA 4FJ9A 2DPNA 3E66A 4YOUA 2IOCA 3K5NA 4BRGA 4H5VA 3AA5X 4IEIA 5CZ2A 3FZMA 5CYQA 3VN5A 4AHTA 4BR4A 4H5WA 3KLHA 4RW7A 3SBGA 3EKSA 5LMUK 3TAMA 3OYAA 4FXDA 2Y1JA 5AJ3K 1TV6A 1S1WA 3I56N 1HYZA 1WNSA 3CM5A 4OKEA 3SLCA 3F73A 1IKWA 4CZKA 3SYZA 4MO4A 1TUUA 3VMFB 3J7ZO 4E0DA 4AM6A 5AFUA 3UKUA 3AV9A 4K8XA 2YHXA 3PX4A 4FWRA 2DFHA 4FJJA
chains in the Genus database with same CATH topology
1SQKA 3CETA 4FSVA 1NGIA 3SK3A 1NJIO 4WFAL 3CC7N 2HOEA 3PLAA 1NGBA 2IIRA 2QA4N 5E26A 5M1PA 3HBTA 4GNIA 5F0XA 3TTCA 1RDWX 1E4GT 1GLAG 2NZTA 3VEZA 1U6ZA 5AQKA 3A5OC 5GADP 2ASPA 1T6CA 3QB0A 2P9SB 4NB4A 4A5BA 5JLHA 4QS8A 2E8AA 3J8AA 3N4PA 1NGGA 5AQVA 5LY3A 3CF5L 5JVHL 1BO5O 1NGAA 4PKGA 3MK6A 2ASMA 1R59O 2WC9A 4U7BA 2HBJA 4BR7A 4H0VB 1QZ6A 4PL8A 3UKRA 4YOYA 1KD1O 4JD2A 5AQTA 4QS7A 1GLCG 3CC2N 1GLJO 3M6GA 1NGJA 3M3ZA 4FL9A 1VQNN 4A2AA 1HUXA 1TYQA 3O9SA 4H0TB 1ATSA 3U4LA 4KH4A 5CE3A 3VTIA 3EE8A 3WEEA 5LJWA 4C1NI 1BUPA 2F9TA 3CHWA 1K73O 5ELZA 2NRXA 1O13A 2VGNA 1P8ZA 3WUHA 4BRQA 3H45C 4Z94A 5C2FA 4AF1A 4A61A 4BGBA 3CMAN 4BROA 4B1WB 2KHOA 4BC5A 1RDUA 2CGKA 3CCRN 2IVOA 2BUPA 2A3ZA 1BU6O 3O9UA 4JK7A 4CZEA 4DB3A 3AGKA 5C2DA 4CBXA 3ZEUB 2P9PA 1HJOA 4BRNA 4BR0A 1QHAA 4F9OA 3M1FA 3LL3A 4CZHA 2IVNA 3UB5A 4XEIA 1RFQA 3ZETA 1LCUA 2E2PA 3DXKA 4RTFD 3UKUB 5CHIA 3U8XA 5M1KA 3LDNA 1YF5L 4ISFA 3TSUA 1D4XA 1U2VA 2QM1A 1ESVA 1MWKA 3DWLA 3F2KA 5C15A 5B8HA 2NRHA 4WF9L 4IFEA 3O9TA 5FPMA 2V7YA 3HOTA 2YJFA 3CCQN 1BG3A 3E9OA 1TUYA 5JVGL 5JICA 3AGRA 1KQSM 1YXQA 4OO1J 3GG4A 3ATVA 1Z05A 4I6MB 5AQMA 5AQJA 1Q7YO 5BPNA 5M1NA 4WQ4C 3K9JA 4A2BA 1JCGA 3GDQA 2HBMA 1NGFA 4IZ9A 2D0PA 3CCMN 3AAPA 3A8YA 3WQTA 3G6EN 2NRZA 3MX2A 1GLDG 1T6DA 4NO7A 4XH5A 1HPMA 1M1KO 5GAEP 3T7ZA 2F7TA 3KK7A 4WCEL 2A40A 1VQ6N 3D2EA 4JN4A 4B1UB 3VETA 3VEXA 2WFBA 3WQUA 2GUPA 1YHQN 3OW2M 4CBUA 1K8KA 1NGCA 3CJCA 4BR2A 5BR9A 4GV9A 3LM2A 4FVUA 3RVCA 4BRHA 4MDBA 3WXJA 2P9UB 3TSQA 1VQ8N 4H5NA 5FPDA 1BOTO 1Q86O 3HI0A 2FSNA 3NVMA 2V52B 1EO1A 5AQZA 3L4IA 1C0GA 2Q97A 2W40A 3ATUA 2ZJQL 3FFKB 4FWKA 3CCVN 4BGAA 3R8EA 1CZAN 3W0LA 2I7NA 1MWMA 4A59A 3ZYYX 2GELA 2F9WA 5F2RA 3GOIA 2QW9A 5AQRA 3O8MA 1DT9A 4CZMA 2P9IA 3QBWA 2FF3B 1XUPO 2Q0UA 2Q0RA 3EN9A 5KQDA 3WXLA 1U2VB 5BRFA 3AAQA 3VGKA 2QWRA 3L4QA 3VENA 4FO0A 3DJCA 3ZX3A 3O1WA 3VTHA 3MCPA 5ADXH 2ASOA 4BY9C 4EIAA 5AZIB 3CJAA 1OKJA 1HKCA 4GVEA 4NLCA 2Q1NA 2GWJA 4IEEA 5TKWA 3WXMB 4YOVA 3VF2A 5M1OA 1Q18A 3SBTA 1M90O 4JEPA 5FPNA 4FPBA 4IXCA 3VEYA 1VQ4N 3R9PA 3O4WA 4DHYA 1NWKA 3MN5A 1S3XA 1NM1A 5CR4A 1KC8O 4WQ4A 1YJWN 1P90A 1G99A 3VEOA 3CCUN 2P9NB 4IJAA 2E20A 1Z6RA 3HM8A 3IKMA 2VWBA 3SAFA 1WOQA 2ZJRL 4DCHA 4PKIA 5JMVA 1BA0A 4WFNL 3MDQA 5EOYA 2UYTA 3WXIA 2HSTA 4C23A 2JWLA 1KAZA 4RWTA 3BUZB 4JNEA 2NRRA 3WT0A 3VEVA 2ZGYA 2YJEA 4K43A 3MN6A 4JKGA 3PIPL 5AQXA 2YX6A 2CH6A 4BRPA 3NVKA 2E1ZA 3CXCM 4GV3A 4YDUC 3KHYA 3FZHA 4A57A 5GIPA 5HOOA 1VQLN 1H1VA 3CI5A 2HF3A 3Q7BA 4FWQA 5AQQA 3HTVA 2FF6A 5BRDA 3FR0A 3D2FB 3P31A 4H0PA 2VGMA 3QICA 3ENHA 3CCJN 4LC9B 2P9LA 3H3OB 4BR9A 4EFHA 5BPMA 4OPHA 4IOCL 4RCHA 2IVPA 3ID8A 3O9QA 3OBYA 4MLHA 2BTFA 1IG8A 1JJ2M 3VOVA 3EO3A 4H0YB 4JKAA 4K42A 5BREA 1E4FT 5AZJA 1VQKN 2I7PA 2CGJA 3P4IA 3O1BA 2CGLA 4M63C 5EY4A 1GLLO 2OANA 3M5RA 3DXMB 2KKZA 4H0OA 3A5LC 3ZX0A 4EHTA 4JHDA 1SAZA 2QWOA 1QQOA 4IO9L 5AQOA 3O9RA 3OBWA 3MWPA 4CBWA 2OTLN 2NRTA 1HX1A 3FLCO 4M7XA 3C7NA 1SS6A 3I8BA 1ZXOA 2HBLA 3CJ1A 3A5NC 4CZIA 2ZGZA 3E1YA 3U9ZA 4YORA 3NMUA 4ILHA 4M7YA 3C6HA 4B1XB 3KVGA 2QTDA 1NMDA 4FOIA 4HTLA 5E84A 5ADXA 3P38A 5AQNA 4EHUA 1ILYA 1DEJA 1VQON 5AFUH 2NRWA 1W2BM 2H3GX 5BRHA 4ILGB 1J6ZA 4K41A 3JXUA 3ULEA 2HF4A 1QVGM 3LDPA 5AQLA 2A42A 1JCEA 4BRCA 4B1ZA 5EXWA 1S72N 2E2OA 1V4TA 3UKRB 3BF3A 4JD2B 3EKUA 4IOXA 3VF6A 3VERA 4IO8A 4K25A 3C65A 3CJ7A 4WQ5C 3IFRA 3C0BA 1TYQB 2EWSA 2QWPA 2Q31A 5C10A 3SAGA 4CI6A 3W3DA 1QQMA 2NNWA 5AQYA 3WEEB 3H6EA 1S22A 1X3MA 4BC3A 1QVFM 2BH1A 3MN7A 3VF4A 3FZLA 1LOTB 2YHWA 4YDUA 2VCPA 1T44A 3OHRA 1BA1A 4BRLA 4CZGA 1BWFO 1GLFO 2A6AA 4IDHA 4B1YB 3CQXA 3O5BA 4BRAA 3EZWA 1NGEA 2P9PB 4BRFA 4BVOA 2E1YA 3SMSA 4JKFA 2ZF5O 3VESA 4BREA 5AQWA 3ZETB 3SJHA 3DXKB 3VGLA 1DGKN 1N8RO 2AP1A 4JAXA 4KBOA 3D7EO 3KWGA 3HSCA 4XH4A 3MWTA 3MCAB 1KXPA 3FE1A 3GE1A 2E88A 3QBXA 4H0XB 3VPZA 1KAYA 1HKBA 3KWIA 3CJ9A 2E2NA 4BG9A 5DM6L 1NGDA 2QWMA 1HKGA 3FZKA 3LDOA 4FPAA 4AM7A 5GAHP 5KPZA 4JKHA 1YAGA 5HL7L 5MLCQ 1NBWA 1Y64A 3FGUA 5H1SQ 2V51B 3ENBA 1RGIA 5AQFA 3SAHA 1ZBSA 3CIPA 5AQUA 2D4WA 4MLEA 4IJNA 4FWPA 3ULEB 4JKBA 4WYBA 4BC4A 4B9QA 4E1JA 1Q81O 1MA9B 3LDLA 4BRDA 3B8AX 5LJVA 4XH1A 4DKWA 5AQGA 3G71N 4JKEA 4O5FA 4CZJA 3D2EB 4H03B 1ATNA 2JWKA 3SMPA 4FWNA 1K8KB 2FXUA 3D6RA 1ATRA 2AA4A 4WQ5A 3VGMA 4CZLA 4DQ8A 5JLFA 3QFUA 3BF1A 4JKDA 4U67L 3R1XA 3JS6A 1GLEG 5AQPA 5TKYA 4O8UA 4H5RA 3TSPA 3GBTA 3LDQA 3A0IX 3CD6N 2PAVA 4HWIA 4I6MA 1DKGD 4BVPA 1OVYA 3BP8A 4FOEA 2A5XA 3ENOA 3TU5A 1NGHA 2NRVA 3DAWA 2FLOA 3IDHA 4C1NK 5GINA 2P9IB 2QWQA 3CJBA 3TTDA 1BDGA 4J8FA 3U9DA 4JK9A 3K9KA 3S41A 1YJ9N 4H5TA 2CH5A 3H46O 5EVZA 5AQIA 1YUWA 3Q7CA 4KH5A 1QZ5A 2PBDA 1NLVA 2WUSA 4YOXA 3MX5A 3DLLL 5KQ8A 4EAHD 4MO5A 4FWOA 2Q36A 3CQYA 3IUCA 3R6MA 4MDAA 4BRMA 3H1QA 4CD3A 3CMEN 1KAXA 4QS9A 5FPEA 2P9UA 2GTDA 3RSEA 3HOSA 3HZ6A 1ZC6A 4BG8A 2FSJA 3MMVA 2WBNA 3O08A 1YI2N 1Q82O 3KZBA 3L0QA 4BRKA 3GL1A 5M1QA 3O6WA 2FSKA 2ZJPL 2W41A 3G25A 3I33A 5KPTA 2GX9A 1K9MO 1SZ2A 2OTJN 1VQ5N 5I9EB 3CERA 2Q2RA 4A5AA 4YOWA 3A5MC 3C6AA 2P9KA 3QMLA 3ZX2A 5BN9A 5F1XA 3H1VX 1W97L 2E2QA 4GY2B 3TPQA 1X3NA 3OA9A 3WXKA 3I55N 4JKGB 4PL7A 3G4SN 1MDUB 4B1VA 2NLXA 4PHTX 2D0OA 1YITN 1VAZA 1VQMN 3CPEA 4YOTA 3CPWM 1YJNN 2ZWHA 4G9ZA 3O80A 3F5TA 3FZFA 4JK8A 5AQHA 4CJ7A 2QI2A 3CCEN 5AZIA 2ITMA 4KH6A 5EX5A 1T3VA 5AR0A 1WUAA 3MN9A 4NLBA 3CCLN 2VYPA 4GV6A 1GLBG 2QWNA 3P39A 4CZFA 1YIJN 5AQSA 2YHYA 2GEMA 1VQPN 3TTFA 1IJJA 1X9JA 2P9LB 4BRIA 2QEXN 4R79A 3PIOL 4BR5A 2P9NA 5AZJB 3IMXA 3EE9A 4UY8O 2P9SA 1QQNA 3HRGA 3QDKA 5BPLA 5M1FA 1K8AO 4ISEA 4Y0WA 4JHDB 3F9MA 3QFPA 3CCSN 2HBKA 1C0FA 5GAGP 1HLUA 3VEWA 3LM9A 2HMPA 2KLAA 5C0YA 4OPAA 2PFUA 2V7ZA 4FWLA 3RSEB 3C7NB 3E9PA 2QWLA 1VQ7N 5GIOA 1YVNA 2DPNA 3E9LA 3E66A 4PKHA 2YCHA 4O8KA 4YOUA 4BQZA 4A62A 3ID6A 4IOAL 3UE5A 1JCFA 4H5VA 4BRGA 4IEIA 1V4SA 1XQSC 3FZMA 2RE2A 3AY9A 4BR4A 4H5WA 4FWMA 3R3LA 4ISGA 5DM7L 2D1KA 4BQLA 3SBGA 3D2FA 2P9KB 3EKSA 4JKCA 2GWKA 5BN8A 4CD1A 2A41A 5KPRA 3L6QA 4IWVA 3CC4N 3H3NO 4FWSA 3I56N 2J4RA 1EQYA 3SLCA 4CZKA 1XC3A 3EL2A 4MO4A 4BC2A 1TUUA 3ZEUA 3T69A 3VMFB 4ILJA 3J7ZO 1VQ9N 4WFBL 3DXMA 4AM6A 5AFUA 3UKUA 2YHXA 2RHKA 3BEXA 4FWRA 4L3QA 2QXLA 5C12A 3AARA 3N4QA 2YI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQK A;  3CET A;  4FSV A;  1NGI A;  3SK3 A;  2HOE A;  1NGB A;  2IIR A;  5E26 A;  3HBT A;  4GNI A;  5F0X A;  1RDW X;  1E4G T;  1GLA G;  2NZT A;  3VEZ A;  1U6Z A;  5AQK A;  3A5O C;  2ASP A;  1T6C A;  3QB0 A;  2P9S B;  4NB4 A;  5JLH A;  4QS8 A;  2E8A A;  3J8A A;  5LY3 A;  1NGG A;  5AQV A;  1BO5 O;  1NGA A;  4PKG A;  3MK6 A;  2ASM A;  1R59 O;  4BR7 A;  4H0V B;  1QZ6 A;  4PL8 A;  3UKR A;  4JD2 A;  5AQT A;  4QS7 A;  1GLC G;  1GLJ O;  3M6G A;  1NGJ A;  3M3Z A;  4FL9 A;  4A2A A;  1HUX A;  1TYQ A;  4H0T B;  1ATS A;  3U4L A;  5CE3 A;  3WEE A;  5LJW A;  1BUP A;  2F9T A;  3CHW A;  5ELZ A;  4BRQ A;  1P8Z A;  3WUH A;  3H45 C;  4Z94 A;  4A61 A;  4BGB A;  4BRO A;  4B1W B;  2KHO A;  4BC5 A;  2CGK A;  2IVO A;  2BUP A;  2A3Z A;  1BU6 O;  4DB3 A;  4CZE A;  4CBX A;  3ZEU B;  2P9P A;  1HJO A;  4BRN A;  4BR0 A;  1QHA A;  4F9O A;  3M1F A;  3LL3 A;  4CZH A;  2IVN A;  3UB5 A;  4XEI A;  1RFQ A;  3ZET A;  1LCU A;  2E2P A;  3DXK A;  4RTF D;  3UKU B;  3U8X A;  3LDN A;  4ISF A;  1D4X A;  1U2V A;  2QM1 A;  1ESV A;  1MWK A;  3DWL A;  5B8H A;  2NRH A;  5FPM A;  2V7Y A;  2YJF A;  1BG3 A;  1TUY A;  5JIC A;  1YXQ A;  3GG4 A;  3ATV A;  1Z05 A;  4I6M B;  5AQM A;  5AQJ A;  5BPN A;  4WQ4 C;  4A2B A;  1JCG A;  3GDQ A;  1NGF A;  4IZ9 A;  2D0P A;  3AAP A;  3A8Y A;  3WQT A;  1GLD G;  1T6D A;  4NO7 A;  4XH5 A;  1HPM A;  2A40 A;  3D2E A;  4JN4 A;  4B1U B;  3VET A;  3VEX A;  3WQU A;  2GUP A;  4CBU A;  1K8K A;  1NGC A;  3CJC A;  4BR2 A;  5BR9 A;  3LM2 A;  4BRH A;  3WXJ A;  2P9U B;  4H5N A;  5FPD A;  1BOT O;  3HI0 A;  2FSN A;  2V52 B;  5AQZ A;  3L4I A;  1C0G A;  2Q97 A;  2W40 A;  3ATU A;  3FFK B;  4FWK A;  4BGA A;  3R8E A;  1CZA N;  3W0L A;  2I7N A;  1MWM A;  2GEL A;  2F9W A;  5F2R A;  3GOI A;  2QW9 A;  5AQR A;  3O8M A;  4CZM A;  2P9I A;  3QBW A;  2FF3 B;  1XUP O;  2Q0U A;  2Q0R A;  3EN9 A;  5KQD A;  3WXL A;  1U2V B;  5BRF A;  3AAQ A;  3VGK A;  2QWR A;  3VEN A;  4FO0 A;  3DJC A;  3ZX3 A;  3O1W A;  3MCP A;  5ADX H;  2ASO A;  4EIA A;  5AZI B;  3CJA A;  1OKJ A;  1HKC A;  2Q1N A;  2GWJ A;  3VF2 A;  1Q18 A;  5FPN A;  4FPB A;  4IXC A;  3VEY A;  3R9P A;  3O4W A;  4DHY A;  1NWK A;  3MN5 A;  1S3X A;  1NM1 A;  4WQ4 A;  1G99 A;  3VEO A;  2P9N B;  4IJA A;  2E20 A;  1Z6R A;  3HM8 A;  2VWB A;  1WOQ A;  4DCH A;  4PKI A;  5JMV A;  1BA0 A;  3MDQ A;  5EOY A;  2UYT A;  3WXI A;  4C23 A;  1KAZ A;  4RWT A;  3BUZ B;  4JNE A;  3WT0 A;  3VEV A;  2ZGY A;  2YJE A;  4K43 A;  3MN6 A;  5AQX A;  2CH6 A;  4BRP A;  2E1Z A;  4YDU C;  3KHY A;  3FZH A;  1H1V A;  3CI5 A;  2HF3 A;  5AQQ A;  4FWQ A;  3HTV A;  2FF6 A;  5BRD A;  3FR0 A;  3D2F B;  4H0P A;  3QIC A;  3ENH A;  4LC9 B;  2P9L A;  3H3O B;  4BR9 A;  4EFH A;  5BPM A;  4RCH A;  2IVP A;  3ID8 A;  4MLH A;  2BTF A;  1IG8 A;  3VOV A;  3EO3 A;  4H0Y B;  4K42 A;  5BRE A;  1E4F T;  5AZJ A;  2I7P A;  2CGJ A;  3P4I A;  3O1B A;  2CGL A;  4M63 C;  5EY4 A;  1GLL O;  2OAN A;  3DXM B;  4H0O A;  3A5L C;  3ZX0 A;  4EHT A;  4JHD A;  1SAZ A;  2QWO A;  1QQO A;  5AQO A;  4CBW A;  1HX1 A;  3FLC O;  4M7X A;  3C7N A;  3I8B A;  1ZXO A;  3CJ1 A;  3A5N C;  4CZI A;  2ZGZ A;  3U9Z A;  4M7Y A;  4B1X B;  3KVG A;  1NMD A;  4FOI A;  4HTL A;  5E84 A;  5ADX A;  5AQN A;  4EHU A;  1DEJ A;  5AFU H;  2H3G X;  5BRH A;  1J6Z A;  4K41 A;  3JXU A;  3ULE A;  2HF4 A;  3LDP A;  5AQL A;  2A42 A;  1JCE A;  4BRC A;  4B1Z A;  5EXW A;  2E2O A;  1V4T A;  3UKR B;  3BF3 A;  4JD2 B;  3EKU A;  3VF6 A;  3VER A;  4IO8 A;  4K25 A;  3CJ7 A;  4WQ5 C;  3IFR A;  3C0B A;  1TYQ B;  2EWS A;  2QWP A;  2Q31 A;  4CI6 A;  3W3D A;  1QQM A;  5AQY A;  3WEE B;  3H6E A;  1S22 A;  1X3M A;  4BC3 A;  3MN7 A;  3VF4 A;  3FZL A;  1LOT B;  2YHW A;  4YDU A;  2VCP A;  1T44 A;  3OHR A;  1BA1 A;  4BRL A;  4CZG A;  1BWF O;  1GLF O;  2A6A A;  4B1Y B;  3CQX A;  3O5B A;  4BRA A;  3EZW A;  1NGE A;  2P9P B;  4BRF A;  4BVO A;  2E1Y A;  3SMS A;  2ZF5 O;  3VES A;  4BRE A;  5AQW A;  3ZET B;  3SJH A;  3DXK B;  3VGL A;  1DGK N;  2AP1 A;  4JAX A;  4KBO A;  3D7E O;  3HSC A;  4XH4 A;  1KXP A;  3FE1 A;  3GE1 A;  2E88 A;  3QBX A;  4H0X B;  3VPZ A;  1KAY A;  1HKB A;  3CJ9 A;  2E2N A;  4BG9 A;  1NGD A;  2QWM A;  1HKG A;  3FZK A;  3LDO A;  4FPA A;  4AM7 A;  5KPZ A;  1YAG A;  1NBW A;  1Y64 A;  3FGU A;  2V51 B;  1RGI A;  5AQF A;  1ZBS A;  3CIP A;  5AQU A;  2D4W A;  4MLE A;  4IJN A;  4FWP A;  3ULE B;  4WYB A;  4BC4 A;  4B9Q A;  4E1J A;  1MA9 B;  3LDL A;  4BRD A;  3B8A X;  5LJV A;  4XH1 A;  5AQG A;  4O5F A;  4CZJ A;  3D2E B;  4H03 B;  1ATN A;  3SMP A;  4FWN A;  1K8K B;  2FXU A;  1ATR A;  2AA4 A;  4WQ5 A;  3VGM A;  4CZL A;  4DQ8 A;  5JLF A;  3QFU A;  3BF1 A;  3JS6 A;  1GLE G;  5AQP A;  5TKY A;  4H5R A;  3GBT A;  3LDQ A;  3A0I X;  2PAV A;  4HWI A;  4I6M A;  1DKG D;  4BVP A;  3BP8 A;  4FOE A;  2A5X A;  3ENO A;  3TU5 A;  1NGH A;  3DAW A;  2FLO A;  3IDH A;  2P9I B;  2QWQ A;  3CJB A;  1BDG A;  4J8F A;  3U9D A;  3S41 A;  4H5T A;  2CH5 A;  3H46 O;  5EVZ A;  5AQI A;  1YUW A;  1QZ5 A;  2PBD A;  1NLV A;  2WUS A;  5KQ8 A;  4EAH D;  4MO5 A;  4FWO A;  2Q36 A;  3CQY A;  3IUC A;  3R6M A;  4BRM A;  3H1Q A;  4CD3 A;  1KAX A;  4QS9 A;  5FPE A;  2P9U A;  2GTD A;  3RSE A;  3HZ6 A;  1ZC6 A;  4BG8 A;  2FSJ A;  3MMV A;  3O08 A;  3KZB A;  3L0Q A;  4BRK A;  3GL1 A;  3O6W A;  2FSK A;  2W41 A;  3G25 A;  3I33 A;  5KPT A;  1SZ2 A;  5I9E B;  3CER A;  2Q2R A;  3A5M C;  3QML A;  2P9K A;  3ZX2 A;  5BN9 A;  5F1X A;  3H1V X;  4GY2 B;  2E2Q A;  3TPQ A;  1X3N A;  3WXK A;  4PL7 A;  1MDU B;  4B1V A;  2NLX A;  2D0O A;  2ZWH A;  3O80 A;  3FZF A;  5AQH A;  4CJ7 A;  5AZI A;  2ITM A;  5EX5 A;  5AR0 A;  1WUA A;  3MN9 A;  2VYP A;  1GLB G;  2QWN A;  4CZF A;  5AQS A;  2YHY A;  2GEM A;  4BRI A;  1IJJ A;  1X9J A;  2P9L B;  4BR5 A;  2P9N A;  5AZJ B;  3IMX A;  2P9S A;  1QQN A;  3QDK A;  5BPL A;  4ISE A;  4Y0W A;  4JHD B;  3F9M A;  3QFP A;  1C0F A;  1HLU A;  3VEW A;  3LM9 A;  2HMP A;  2V7Z A;  4FWL A;  3RSE B;  3C7N B;  2QWL A;  1YVN A;  2DPN A;  4BQZ A;  4PKH A;  2YCH A;  4O8K A;  4A62 A;  3UE5 A;  1JCF A;  4H5V A;  4BRG A;  1V4S A;  1XQS C;  3FZM A;  3AY9 A;  4BR4 A;  4H5W A;  4FWM A;  4ISG A;  2D1K A;  4BQL A;  3D2F A;  2P9K B;  3EKS A;  2GWK A;  5BN8 A;  4CD1 A;  2A41 A;  5KPR A;  3L6Q A;  4IWV A;  3H3N O;  4FWS A;  2J4R A;  1EQY A;  3SLC A;  4CZK A;  1XC3 A;  3EL2 A;  4MO4 A;  4BC2 A;  1TUU A;  3ZEU A;  3DXM A;  4AM6 A;  5AFU A;  3UKU A;  2YHX A;  3BEX A;  4FWR A;  4L3Q A;  2QXL A;  3AAR A;  2YI1 A; 
#chains in the Genus database with same CATH topology
 1NGI A;  4QAG A;  1NJI O;  1NGB A;  2QA4 N;  3SV4 A;  5E26 A;  3AO5 A;  1NJX A;  3ZSW A;  4GNI A;  5F0X A;  2B4J A;  5GAD P;  2ASP A;  4LSN A;  1EKE A;  4A5B A;  3NCI A;  4M3Y A;  3VQ8 A;  5LY3 A;  4DV0 K;  1NGG A;  3QNO A;  1VSK A;  1BGX T;  4LD0 A;  1MU2 A;  3MK6 A;  3ZLJ A;  4J2B A;  1R59 O;  2WC9 A;  4YFU A;  2HBJ A;  4BR7 A;  4H0V B;  3UKR A;  4I7F A;  4MQ3 A;  4HTU A;  1W7A A;  1GLJ O;  3SUO A;  1HUX A;  1TYQ A;  1ATS A;  3U4L A;  3B6O A;  1ZBF A;  4KH4 A;  4FJI A;  4B9L A;  3CHW A;  1N36 K;  1BL3 A;  5ELZ A;  4CEA A;  4RW6 A;  4BRO A;  4BC5 A;  3CCR N;  4OPJ A;  2BAN A;  5C2D A;  4J2E A;  4E19 A;  1LAV A;  5CHI A;  1RFQ A;  3ZET A;  1LCU A;  4RTF D;  4B9N A;  3JSM A;  3U8X A;  3LDN A;  1YF5 L;  4ISF A;  4LH5 A;  3HYF A;  4B3S K;  2QK9 A;  2QM1 A;  1MWK A;  4DU1 A;  1ZBU A;  3LP0 A;  4WF9 L;  2Q3S A;  1CLQ A;  3NGY A;  4DSJ A;  1KQS M;  5JVG L;  1FK9 A;  4L8R B;  4RW8 A;  1Q7Y O;  2O4I A;  4QCL A;  5M1N A;  3K9J A;  2HBM A;  4IZ9 A;  3PO5 A;  4Z4I A;  3ISN C;  4FLU A;  2KW4 A;  3VQ6 A;  4IG0 A;  3S3N A;  2PYL A;  1M1K O;  2UUB K;  1RBT A;  4FJG A;  5GAE P;  3M8S A;  4DQP A;  1D9D A;  1RCH A;  1HNI A;  4B1U B;  3VEX A;  1NGC A;  4GV9 A;  5I3U A;  1E3M A;  4PY5 A;  3TSQ A;  1VQ8 N;  1JLA A;  4CHN A;  3V9Z A;  1Q86 O;  4IKF A;  4JI6 K;  1EO1 A;  3L4I A;  4Q0B A;  3PUF A;  3FFK B;  3W0L A;  3E01 A;  4DMN A;  4X64 K;  4B8A B;  4F4K A;  2KFZ A;  2QXF A;  2FF3 B;  1DLO A;  3NF9 A;  3EN9 A;  5KQD A;  1RTH A;  3WXL A;  1U2V B;  3RWU A;  3AAQ A;  2AJQ A;  3T1Y K;  3ZX3 A;  3V81 A;  3O1W A;  2ZQB A;  3KLI A;  4FW1 A;  3U3G A;  4BY9 C;  5ADX H;  1WB9 A;  4EIA A;  3AVH A;  1OKJ A;  1HKC A;  4GVE A;  3WXM B;  4EZ6 A;  4IEE A;  5TKW A;  4X65 K;  4M3W A;  3VF2 A;  1FXX A;  1Q18 A;  3DLE A;  3VQC A;  3V9W A;  1TL3 A;  1NWK A;  3THV A;  4FK2 A;  1NM1 A;  1NOY A;  3TI0 A;  3VEO A;  4FZZ A;  2P9N B;  3VQ4 A;  3O3H A;  3HM8 A;  3IKM A;  4JI7 K;  2VWB A;  4DV1 K;  1WOQ A;  1TKT A;  3KD1 E;  3MEG A;  1LV5 A;  1TKZ A;  3QIO A;  3WT0 A;  4C8O A;  1XNQ K;  4JKG A;  1VK0 A;  4CFA A;  5AQX A;  3LWM A;  3RRH A;  1JXE A;  3NF7 A;  4A57 A;  1J53 A;  5HOO A;  2YNI A;  4YY3 K;  2VG6 A;  3ZSQ A;  4CHQ A;  5D3G A;  3D2F B;  3CFP A;  2VGM A;  3O4N A;  3CCJ N;  3ZSZ A;  4RW9 A;  3H3O B;  1NK8 A;  5CZ1 A;  1QTM A;  3O9Q A;  4EZ9 A;  4JKA A;  4K42 A;  4PUO A;  1E4F T;  1LWC A;  2I7P A;  3L3U A;  4DQQ A;  1VSI A;  3A5L C;  3MXJ A;  4H0O A;  3ZX0 A;  4JHD A;  3NF8 A;  4F2R A;  1SAZ A;  4KV8 A;  3HT3 A;  1HX1 A;  3FLC O;  4M7X A;  3I8B A;  2HBL A;  3C6T A;  4CJU A;  3C6H A;  4FOI A;  3CFR A;  2OPS A;  4EHU A;  1DEJ A;  4TSX A;  1NK9 A;  4KTQ A;  1CXU A;  2H3G X;  3AVK A;  4ILG B;  1QVG M;  1JCE A;  4BRC A;  1J9A A;  2E2O A;  4JD2 B;  4C8K A;  4IOX A;  4IO8 A;  4GKK K;  3C65 A;  3DYA A;  3C0B A;  2QKK A;  1FW6 A;  3P1G A;  1C0M A;  3J80 O;  3W3D A;  1BCO A;  3QEV A;  4WE1 A;  3H6E A;  1QVF M;  2BH1 A;  3FZL A;  4CJQ A;  2O8D B;  1T44 A;  4CZG A;  4AQY K;  1S1X A;  3O5B A;  4KI4 A;  3ASM A;  4OX9 K;  1RT4 A;  1EWR A;  4B9M A;  3KLE A;  4BRF A;  2WOM A;  4O0J A;  1N8R O;  4W5N A;  3VGL A;  3DXK B;  1DGK N;  4KBO A;  1KVB A;  1FJG K;  3KWG A;  4XH4 A;  3MWT A;  4AH9 A;  3MCA B;  1SKS A;  2G8I A;  4OKK A;  3AVJ A;  1HKB A;  3QNN A;  3KWI A;  3A2F A;  1NGD A;  1HKG A;  2G8H A;  3B6P A;  5HL7 L;  4CES A;  5MLC Q;  4C8M A;  3FGU A;  4BDZ A;  1NKE A;  4DUZ K;  4CJR A;  3V1Q A;  2G8W A;  4MLE A;  2HNZ A;  3RR7 A;  1C0U A;  4DKW A;  3G71 N;  4X62 K;  3SPY A;  3KK3 A;  3JAM O;  1Y97 A;  3D0P A;  1KSP A;  4J2A A;  5KGX A;  1XI1 A;  3VGM A;  3WNF A;  4DQ8 A;  3NFA A;  2HHV A;  4DWI A;  4FYD A;  1RTJ A;  3HPG A;  4KHW A;  1GLE G;  5AQP A;  1UOC A;  2D0A A;  2X74 A;  5IWA K;  3LDQ A;  2PAV A;  5C24 A;  4FCY A;  3ENO A;  3TU5 A;  1I39 A;  1NGH A;  2NRV A;  2FLO A;  1D8Y A;  2P9I B;  1BI4 B;  4E1N A;  1BDG A;  1YJ9 N;  3AVN A;  1T7P A;  5EVZ A;  5AQI A;  4KH5 A;  4KFB A;  4DU4 A;  4OPK A;  1OVQ A;  4CIG A;  2WUS A;  4YOX A;  2O8F B;  3AVL A;  3AO1 A;  3DOK A;  5HBM A;  4DTU A;  4MO5 A;  4CK3 A;  3CME N;  4BRM A;  3OYM A;  4E7J A;  4O4G A;  1ZC6 A;  4BG8 A;  2F8T A;  4I2P A;  3MMV A;  1Q82 O;  4BRK A;  1UWB A;  4HCB A;  4CJW A;  2OTJ N;  1YTA A;  1IBK K;  2DTU A;  3CER A;  4A5A A;  4YOW A;  1IO2 A;  3DOL A;  5HRR A;  3CQ8 A;  5BN9 A;  5F1X A;  3H1V X;  1W97 L;  3MEE A;  1CZB A;  2BGG A;  1LW0 A;  3OA9 A;  3WXK A;  4PL7 A;  3G4S N;  2NLX A;  4FLW A;  1VAZ A;  3AO3 A;  3CPE A;  4YOT A;  3O80 A;  3FZF A;  4CJ7 A;  4QOZ B;  2QI2 A;  3CCE N;  5AR0 A;  4CGF A;  2HMI A;  3T3F A;  1VQP N;  1IJJ A;  1X9J A;  4DQR A;  3PIO L;  1JKH A;  3ZSV A;  1TK0 A;  2O8E A;  4CEB A;  3IMX A;  4DR6 K;  4UY8 O;  3QDK A;  1J5E K;  3HST B;  3QES A;  3C94 A;  5M1F A;  2Z1I A;  4ISE A;  1TAU A;  4Y0W A;  3QFP A;  3CCS N;  3PSF A;  1C0F A;  1LW2 A;  1HLU A;  2HMP A;  2V7Z A;  3DRP A;  4FLT A;  4E7H A;  3KKS A;  4BQZ A;  4IOA L;  1WSG A;  4CEF A;  4CHZ A;  1NKB A;  1VSH A;  2RE2 A;  2ZE2 A;  4N56 A;  5DM7 L;  2RN2 A;  3H08 A;  4ISG A;  3WNH A;  4LF9 K;  4LF6 K;  4CEE A;  2A41 A;  3IS9 A;  5KPR A;  4IWV A;  4DS5 A;  3H3N O;  4FWS A;  1HNV A;  1XC3 A;  3HP6 A;  3ZEU A;  3T69 A;  3THX A;  1RDB A;  2RHK A;  3BEX A;  1QHT A;  1C1A A;  4JI4 K;  2QXL A;  1EX4 A;  3CET A;  4Y1D A;  4YHH K;  3CC7 N;  3PLA A;  2IIR A;  1RDW X;  4ZTJ A;  3VEZ A;  2G8K A;  1L3T A;  3A5O C;  1T6C A;  1VSE A;  2P9S B;  5AQV A;  5HLF A;  1BO5 O;  1X9W A;  3IG1 A;  4E89 A;  2A1R A;  3VQD A;  3TAG A;  1Q9X A;  4YOY A;  3SQ0 A;  1KD1 O;  4DQI A;  5AQT A;  4NCA A;  1GLC G;  1KLM A;  2WTU A;  1NK0 A;  3M3Z A;  1VSJ A;  4M3U A;  4PWD A;  4CIF A;  1I3A A;  3O9S A;  3VTI A;  3WEE A;  4DV2 K;  5LJW A;  4DLG A;  4B3O A;  1K73 O;  5I42 A;  2NRX A;  3RTV A;  4B9S A;  3PX0 A;  1QSL A;  2VGN A;  4M3X A;  4BE2 A;  4B1W B;  2KHO A;  2CGK A;  3PX6 A;  4DB3 A;  4JK7 A;  4HVJ A;  3AGK A;  1S9G A;  4KRE A;  4IFY A;  4F9O A;  4K8Z A;  4CZH A;  3TAF A;  5DMR A;  3UKU B;  2XHB A;  1ESV A;  1A5V A;  5B8H A;  4RW4 A;  3CCQ N;  1BG3 A;  4FW2 A;  3HVT A;  3E9O A;  1NOZ A;  1XHX A;  5JIC A;  3AGR A;  1WBB A;  4PA1 A;  1Z05 A;  4M45 A;  1NGF A;  4M42 A;  3WQT A;  3G6E N;  4W5Q A;  2NRZ A;  4LF7 K;  3SNN A;  4DTN A;  1GLD G;  1S1T A;  3T7Z A;  2F7T A;  3KK7 A;  1L5U A;  4FJ7 A;  1VQ6 N;  4Z4E A;  4OVL A;  4FVM A;  3WQU A;  2WFB A;  1RT5 A;  1NJZ A;  4CBU A;  1K8K A;  4JS4 A;  1WSJ A;  4BRH A;  4H8K A;  4H5N A;  5FPD A;  1BOT O;  4NCB A;  2P51 A;  3NVM A;  3OYD A;  3UIQ A;  4KHP K;  3S3M A;  4KHY A;  2ZJQ L;  3CCV N;  3R8E A;  4CHO A;  3ZYY X;  1MWM A;  4A59 A;  1EET A;  2F9W A;  3LAM A;  3O8M A;  1W9H A;  4CZM A;  3MED A;  2Q0R A;  1XUP O;  3QER A;  2YV0 X;  4H4O A;  3THW A;  1B9D A;  4DR7 K;  3VA3 A;  4FZX C;  4FJH A;  3AVB A;  3VTH A;  3V1R A;  2ASO A;  1S6Q A;  4CJP A;  2Q1N A;  4JS5 A;  4CJ3 A;  3SBT A;  1C1C A;  4JEP A;  4FPB A;  2O8B B;  4IXC A;  2HHX A;  1S3X A;  3LP3 A;  1KC8 O;  1OH5 A;  3M8P A;  3IAY A;  1YJW N;  1P90 A;  2O8C A;  3VQ9 A;  2GV9 A;  4IJA A;  3SAF A;  1N5Y A;  4PQU A;  4PKI A;  4WFN L;  1BA0 A;  4DF4 A;  4NCG A;  1HNW K;  2JWL A;  5FRM A;  3J81 O;  4JNE A;  4K43 A;  3MN6 A;  3PIP L;  4KB0 A;  4BAC A;  3SI6 A;  2YX6 A;  4BRP A;  1KFD A;  1J5O A;  5GIP A;  4KTZ A;  1VQL N;  1H1V A;  2HF3 A;  3Q7B A;  4FWQ A;  5AQQ A;  4FJN A;  5E41 A;  1RBR A;  2UXD K;  1UA0 A;  4LC9 B;  1VSD A;  3I0S A;  4BR9 A;  3AVA A;  2BE2 A;  4LY7 A;  4IOC L;  2XY5 A;  2IVP A;  3ID8 A;  3OBY A;  2BTF A;  1JJ2 M;  3EO3 A;  1VQK N;  5AZJ A;  4MFB A;  3P4I A;  3O1B A;  2CGL A;  5EY4 A;  3M5R A;  3PV8 A;  3DXM B;  2KKZ A;  3OYG A;  4DSK A;  5AQO A;  3OBW A;  2OTL N;  2NRT A;  3C7N A;  3CJ1 A;  1T03 A;  4B1X B;  3K0S A;  4HTL A;  5E84 A;  3P38 A;  5AQN A;  4JV5 K;  1J6Z A;  3OVN A;  3KTQ A;  3JXU A;  3ULE A;  4FJ8 A;  3ZSO A;  2A42 A;  1CXQ A;  1J54 A;  4IBN A;  4B1Z A;  3ZT2 A;  1V4T A;  4CJ4 A;  4FJX A;  2HHU A;  1HPZ A;  3VF6 A;  4K25 A;  4JI2 K;  3QEW A;  3CJ7 A;  3DM2 A;  4WQ5 C;  4DV3 K;  1VSL A;  2Q31 A;  5C10 A;  3SAG A;  4CI6 A;  5CYM A;  3AVF A;  2EHG A;  1S22 A;  4FLZ A;  2OPQ A;  3LAN A;  2W6L A;  3OHR A;  1BA1 A;  1BIU A;  4CE9 A;  3OS2 A;  1HNX K;  5FRN A;  3HVR A;  3OYN A;  2KTQ A;  2P9P B;  1N34 K;  1NK5 A;  3AA3 A;  3SMS A;  3VES A;  4BRE A;  3SJH A;  4Z4C A;  2AP1 A;  3HSC A;  4CEZ A;  4OJR A;  1KXP A;  1Z25 A;  3GE1 A;  3TAP A;  1XNR K;  3SUN A;  2E2N A;  3SUP A;  2B5J A;  3LDO A;  4FPA A;  3OJS A;  4JKH A;  3SUQ A;  1RBU A;  4DV4 K;  5H1S Q;  4BDP A;  1RGI A;  5AQF A;  3CIP A;  2D4W A;  1HMV A;  4FWP A;  4JKB A;  4WYB A;  1Q81 O;  3ZT4 A;  3SQ4 A;  4BRD A;  3NH0 A;  1NNE A;  3T1H K;  1K6Y A;  4XH1 A;  4JKE A;  1D5A A;  3ZCM A;  3D2E B;  4CCH A;  1UAX A;  1R0A A;  3D6R A;  3DLG A;  4CZL A;  4DUY K;  1ASV A;  3RMD A;  3BF1 A;  1IH7 A;  4B08 A;  3EY1 A;  4U67 L;  1RDA A;  3TAB A;  1U04 A;  4CEQ A;  3M8Q A;  5TKY A;  3GBT A;  2OA8 A;  2F96 A;  3FFI A;  3A0I X;  4HWI A;  2HB5 A;  4BVP A;  3BP8 A;  4LFB K;  3C6U A;  2IGI A;  3KK1 A;  2QWQ A;  5FDL A;  3RR8 A;  3ZSX A;  3U9D A;  4O55 A;  4JK9 A;  3K9K A;  4KHU A;  4H5T A;  1U49 A;  4KKO A;  5JS2 A;  1YUW A;  3Q7C A;  2PBD A;  1NLV A;  4W5O A;  3S3O A;  3HP9 A;  3PSI A;  3O3G A;  3NHG A;  4MDA A;  4YNQ A;  1BQM A;  4CER A;  1KAX A;  3IRX A;  4QS9 A;  3C95 A;  2HNY A;  3EZ5 A;  4O44 A;  1CZ9 A;  1KFS A;  2FSJ A;  2OZM A;  2Z1J A;  2X6S A;  3O08 A;  3L0Q A;  3GL1 A;  5M1Q A;  2FSK A;  4HHT A;  1L3V A;  3G25 A;  1YTU A;  2GX9 A;  1K9M O;  2RKI A;  1WN7 A;  2Q2R A;  3A5M C;  2P9K A;  4GY2 B;  4DLE A;  1X3N A;  3QIN A;  4PHT X;  1IV0 A;  4CFD A;  4E1M A;  4AHC A;  4KRF A;  3SCX A;  1YJN N;  2ZWH A;  3VA0 A;  4FM0 A;  1T3V A;  4DV7 K;  1WUA A;  3MN9 A;  2OCE A;  4NLB A;  2VYP A;  3EEQ A;  4KPY A;  4CW7 B;  2GEM A;  2P9L B;  4BR5 A;  4LF4 K;  4I9Q A;  2VG5 A;  4FZY A;  2P9N A;  3EE9 A;  5J2Q A;  1QQN A;  3HRG A;  4O0I A;  5BPL A;  4ID5 A;  5GAG P;  5SZT A;  3RMB A;  1Q9Y A;  1RTI A;  4OPA A;  5J2N A;  4FWL A;  1JLQ A;  4N47 A;  1YVN A;  4O8K A;  4A62 A;  3UE5 A;  1V4S A;  3L2V A;  1XQS C;  2KFN A;  2HHH K;  3TAR A;  3R3L A;  2OYQ A;  3D2F A;  2KZZ A;  3I0R A;  5BN8 A;  2G8F A;  4CD1 A;  3THY B;  1NU0 A;  3P5J A;  3CC4 N;  2J4R A;  4I9L A;  4CF1 A;  3EL2 A;  4EP4 A;  3LPT A;  4R5P A;  4F2S A;  4KO0 A;  3T1A A;  2ZM6 K;  4L3Q A;  3PY8 A;  3MEC A;  5C12 A;  3L8B A;  1SQK A;  3SK3 A;  3NBP A;  4WFA L;  1IG9 A;  2HOE A;  2FBV A;  2O8E B;  2FBT A;  1E4G T;  1GLA G;  4OLB A;  3QB0 A;  5JLH A;  4NB4 A;  4QS8 A;  2E8A A;  3CF5 L;  5JVH L;  1IKY A;  3OYJ A;  1SL0 A;  1NGA A;  2ASM A;  4U7B A;  4DFP A;  4PL8 A;  3T19 A;  4JD2 A;  1RTD A;  3K57 A;  4QS7 A;  3CC2 N;  3DRS A;  1NMN A;  3M6G A;  3ZSR A;  1BCM A;  3K59 A;  1OH7 A;  4JI1 K;  4H0T B;  4A2A A;  3L2Q A;  4FJL A;  2JLE A;  1NG9 A;  1TVR A;  5CE3 A;  1BUP A;  2F9T A;  4CJK A;  1ZBL A;  3K5L A;  1O13 A;  2O8D A;  4KHS A;  1P8Z A;  3WUH A;  4OKJ A;  3H45 C;  4Z94 A;  4AF1 A;  4A61 A;  4BGB A;  5C25 A;  2ITG A;  2BUP A;  4Z4F A;  4CZE A;  3P83 D;  3ZEU B;  4BR0 A;  1HJO A;  5KTQ A;  4V19 S;  3M1F A;  3UB5 A;  4XEI A;  2E2P A;  3DXK A;  5HRN A;  3OS0 A;  3THX B;  5M1K A;  4DG1 A;  3TSU A;  1D4X A;  4B3M K;  2GUI A;  2NRH A;  3O9T A;  5FPM A;  3HOT A;  2YJF A;  1O1W A;  1ZBI A;  3HL8 A;  1TUY A;  3QIP A;  1YXQ A;  4ID1 A;  1EP4 A;  4OO1 J;  3GG4 A;  4I6M B;  4KTW A;  5AQJ A;  5AQM A;  5BPN A;  4WQ4 C;  2OPR A;  3AO2 A;  2YHB A;  4FK4 A;  1JCG A;  4CJV A;  3A8Y A;  4DQS A;  1HNZ K;  1WLJ A;  4NO7 A;  4XH5 A;  1HPM A;  4DSF A;  4M41 A;  4DFM A;  2A40 A;  4JN4 A;  1Q8I A;  3SQ1 A;  4FJM A;  2GUP A;  1N32 K;  3CJC A;  4BR2 A;  3LM2 A;  3RVC A;  4MDB A;  2P9U B;  4I2Q A;  3ITH A;  3HI0 A;  4F3T A;  1ITG A;  2V52 B;  5T7B A;  5AQZ A;  4RG8 A;  3DLK A;  1CZA N;  2I7N A;  4Q5V A;  1XHZ A;  3GOI A;  2QW9 A;  1W0H A;  1DT9 A;  2P9I A;  1OH6 A;  1BI4 A;  2Q0U A;  4EP5 A;  4CF2 A;  4W5R A;  3L4Q A;  2LSN A;  3L2W A;  3VEN A;  2O8F A;  3CFO A;  4J2D A;  3L2R A;  3LDS A;  5AZI B;  3CJA A;  5LL6 Z;  4BWM A;  2GWJ A;  3NH1 A;  1SL1 A;  3HK2 A;  1JXB A;  1VQ4 N;  3R9P A;  4DHY A;  4B9V A;  2UXC K;  4E7L A;  1VRT A;  3VQQ A;  5KGW A;  5CR4 A;  3OTO K;  4KHN A;  2E20 A;  1Z6R A;  1QS4 A;  3D45 A;  3KKR A;  1D9F A;  1NK7 A;  4DU3 A;  2ZJR L;  2FBX A;  5JMV A;  3WXI A;  3BZK A;  1U47 A;  4RWT A;  4LH4 A;  2NRR A;  2YJE A;  2P5O A;  2YNF A;  2PYJ A;  2E1Z A;  3NVK A;  2Z1G A;  3CXC M;  4YDU C;  4GVM A;  5IT9 O;  3HTV A;  2FF6 A;  3G0Z A;  1S5J A;  5BRD A;  4DTM A;  3FR0 A;  3VQB A;  1DTQ A;  3P31 A;  3U6F A;  3AVI A;  3ENH A;  4BE1 A;  5BPM A;  4HUE A;  4OPH A;  1IG8 A;  2FBY A;  3VOV A;  5BRE A;  4NXM K;  3NE6 A;  2W42 A;  1GLL O;  3NDK A;  4CFB A;  2QWO A;  4CF0 A;  4KAZ A;  4IO9 L;  3O9R A;  4CBW A;  3MWP A;  1SV5 A;  3CYM A;  4NYF A;  1WSH A;  2IS3 A;  1S1V A;  2DFE A;  4DSL A;  1LWE A;  3A5N C;  4CZI A;  3E1Y A;  4CK1 A;  4JYA K;  3U9Z A;  4ILH A;  3AA4 A;  2QTD A;  1NMD A;  1TK5 A;  4DFK A;  3U3Y A;  2DY4 A;  1VQO N;  4E7K A;  1W2B M;  3HPH A;  1XC9 A;  4FJ5 A;  1BQN A;  3LDP A;  4CJ5 A;  5AQL A;  1VHX A;  5EXW A;  4CK2 A;  4CHY A;  3ULD A;  3UKR B;  3BF3 A;  4B9U A;  3LZJ A;  2VG7 A;  4XIU A;  1U45 A;  4KHQ A;  3IFR A;  4BE0 A;  1NKC A;  1TYQ B;  4C8L A;  2QWP A;  1QQM A;  2NNW A;  1RT6 A;  4BC3 A;  3KIO A;  3K2P A;  3VF4 A;  4GKJ K;  3DI6 A;  1LOT B;  2YHW A;  4DR2 K;  2F8S A;  4DSI A;  4FK0 A;  1HQE A;  1UA1 A;  2IDO A;  4K0K K;  1TK8 A;  4BRL A;  3K58 A;  1BWF O;  2E6L A;  2A6A A;  4IDH A;  4B1Y B;  1C0T A;  3RMC A;  4BRA A;  3EZW A;  4E3S A;  4AHV A;  4CJS A;  3ZET B;  4JAX A;  2O4G A;  4BWJ A;  4DV6 K;  2UU9 K;  3QBX A;  4M3T A;  1KTQ A;  2E88 A;  5KI6 A;  4JI8 K;  4H0X B;  3VPZ A;  2VWJ A;  3QEX A;  5DM6 L;  2QWM A;  4E7I A;  2R7Y A;  2HHQ A;  1Y64 A;  3ENB A;  3S9H A;  2IAJ A;  4B9Q A;  3ULE B;  4IJN A;  1Z26 A;  4E1J A;  3TWH A;  1N33 K;  1MA9 B;  3LDL A;  3B8A X;  5CY4 A;  4FLY A;  3OYL A;  4M3Z A;  4H03 B;  4M3R A;  1ATN A;  3V9S A;  2JWK A;  1ATR A;  4WQ5 A;  3V6D A;  1L3S A;  2HHT A;  3R1X A;  4IFV A;  2XRI A;  4CGI A;  4Y1C A;  4O8U A;  3TSP A;  4X66 K;  1TKX A;  3CD6 N;  1TAQ A;  3ALY A;  3V9U A;  2G8V A;  4FOE A;  2A5X A;  3QLH A;  4C1N K;  3DAW A;  3IDH A;  5GIN A;  3TTD A;  5JS1 A;  4J8F A;  3S41 A;  1G15 A;  3HJF A;  1RNH A;  3H46 O;  1C1B A;  3VQP A;  3L2U A;  1WSF A;  3MX5 A;  1KLN A;  5LMN K;  4KI6 A;  3NF6 A;  4FWO A;  2Q36 A;  3R6M A;  4CD3 A;  5J1E A;  5FPE A;  2GTD A;  3RSE A;  3HZ6 A;  4FM2 A;  4DR5 K;  1X9M A;  3DLH A;  1BHL A;  2X6N A;  1YI2 N;  1WAF A;  1A5W A;  3O6W A;  2ZJP L;  3I33 A;  2HVH A;  1RT3 A;  1SZ2 A;  1VQ5 N;  3OS1 A;  5I9E B;  1DTT A;  3QML A;  3C6A A;  2YKN A;  4Z4H A;  4Z0U A;  2E2Q A;  4O5B A;  4CJF A;  3BGR A;  3QEP A;  4JKG B;  4DTS A;  3LAL A;  1MDU B;  1KRP A;  2F4V K;  1VQM N;  4JRP A;  4G9Z A;  5AQH A;  2VQE K;  1REV A;  2ITM A;  4KH6 A;  5EX5 A;  5K14 A;  3EYZ A;  1IBL K;  5HRS A;  3LP2 A;  4B9T A;  4GV6 A;  2B6A A;  1VRU A;  1GLB G;  2O8B A;  2QWN A;  3P39 A;  4CZF A;  2YHY A;  4CHP A;  2QEX N;  4CF8 A;  1JLF A;  3BDP A;  3LAK A;  3K5M A;  3TAN A;  2OPP A;  5FLX O;  1K8A O;  1XMO K;  1GOA A;  4JHD B;  2HBK A;  2UUA K;  3LM9 A;  2KLA A;  5C0Y A;  1I94 K;  2PY5 A;  2QWL A;  1VQ7 N;  5GIO A;  1NJY A;  3E9L A;  4PKH A;  2YCH A;  3ID6 A;  1SL2 A;  1JCF A;  1IKV A;  3MAQ A;  4CJE A;  3QO9 A;  3AY9 A;  4FWM A;  4CGD A;  2D1K A;  4BQL A;  2P9K B;  4JKC A;  2GWK A;  1RDC A;  4CF9 A;  3L6Q A;  3TR8 A;  1EQY A;  1SUQ A;  3VQE A;  3J7A P;  3OYI A;  1A5X A;  4BC2 A;  4ILJ A;  4DR1 K;  1VQ9 N;  4WFB L;  3DXM A;  1BIZ A;  4CGH A;  4ELU A;  2YHA A;  1JL2 A;  4DFJ A;  3AAR A;  3N4Q A;  2YI1 A;  4FSV A;  4UQG A;  1C6V A;  1L3U A;  2EX3 A;  1XMQ K;  5M1P A;  3HBT A;  2E4L A;  3TTC A;  4CGG A;  2NZT A;  3HPO A;  2P5G A;  1U6Z A;  5AQK A;  3J8A A;  4IG3 A;  3N4P A;  4JLH A;  2FC0 A;  4PKG A;  1TGO A;  1VSM A;  1S6P A;  4G1Q A;  3OYC A;  1QZ6 A;  1RBV A;  3DLR A;  3G10 A;  1NGJ A;  4FL9 A;  1VQN N;  1S9E A;  1XWL A;  3EE8 A;  1S1U A;  4C1N I;  3HXM A;  3VQ5 A;  1HJR A;  1HYS A;  4BDY A;  4BRQ A;  4CJL A;  3LPU A;  5C2F A;  3CMA N;  1RDU A;  1X9S A;  2IVO A;  2A3Z A;  1BU6 O;  3O9U A;  4CBX A;  4BRN A;  2P9P A;  1QHA A;  3LL3 A;  2IVN A;  1JL1 A;  3KLF A;  1JLG A;  5DK5 A;  1QSS A;  4DTJ A;  4N41 A;  1U2V A;  3DWL A;  3O4Q A;  3F2K A;  5C15 A;  4IFE A;  1IKX A;  4IDK A;  2V7Y A;  3WNG A;  4HCC A;  2HHS A;  3DRR A;  1QSY A;  1WBD A;  2YNG A;  2D0B A;  3ATV A;  2X78 A;  1FKO A;  3LWL A;  1TL1 A;  1U4B A;  1YVU A;  4A2B A;  3GDQ A;  4JI3 K;  1GOB A;  2D0P A;  3CCM N;  3AAP A;  1RBS A;  3MX2 A;  4AIL C;  1T6D A;  1QE1 A;  3BZC A;  3ZT0 A;  4WCE L;  4LFA K;  3D2E A;  2E5L K;  3TAE A;  3VET A;  1YHQ N;  3F9K A;  3OW2 M;  5BR9 A;  4CGJ A;  4FVU A;  4CEO A;  1WSI A;  5BR8 K;  1T05 A;  3WXJ A;  4B8C A;  4C8N A;  2FSN A;  4DTX A;  2BDP A;  1GOC A;  4ICL A;  1C0G A;  2Q97 A;  2W40 A;  3ATU A;  5KRS A;  1IBM K;  4FWK A;  4BGA A;  1LWF A;  2GEL A;  5F2R A;  3DMJ A;  5AQR A;  4CVN E;  3CM6 A;  3OJU A;  3QBW A;  3NGI A;  4CED A;  3OYK A;  5BRF A;  4LF8 K;  3VGK A;  2QWR A;  3I8D A;  4FO0 A;  3AVG A;  3DJC A;  3KK2 A;  4FLX A;  1HR0 K;  3MCP A;  2KQ2 A;  2D0C A;  3RMA A;  4NLC A;  4YOV A;  3NAE A;  5M1O A;  1M90 O;  5FPN A;  3LZI A;  5HRP A;  4DSE A;  4LFC K;  3VEY A;  3O4W A;  1N6Q A;  3MN5 A;  3CG7 A;  3KLG A;  4CFC A;  4WQ4 A;  1G99 A;  3CCU N;  1RT1 A;  2YKM A;  4OGE A;  4DCH A;  1SKW A;  3MDQ A;  5EOY A;  2UYT A;  4C23 A;  2HST A;  4ZHR A;  1KAZ A;  5SWM A;  3BUZ B;  1OH8 A;  4ELT A;  1NJW A;  3VEV A;  2ZGY A;  1RT2 A;  4CIE A;  1EWQ A;  2Y1I A;  2CH6 A;  2I5J A;  2JGU A;  4GV3 A;  3RRG A;  3KHY A;  3FZH A;  3CI5 A;  1KVA A;  3ZSY A;  4OLA A;  3MXM A;  4DTO A;  3NGZ A;  3OYF A;  3MXI A;  2YNH A;  2Z1H A;  4H0P A;  3QIC A;  5C42 A;  2P9L A;  4ZTF A;  1JLE A;  4EFH A;  3SPZ A;  1RDD A;  4RCH A;  4DR3 K;  4MLH A;  4H0Y B;  2CGJ A;  4M63 C;  3M8R A;  4NXN K;  2OAN A;  4LSL A;  3AVM A;  4EHT A;  1QQO A;  3OYE A;  1SS6 A;  1VSF A;  1ZXO A;  4CEC A;  2ZGZ A;  1ZYQ A;  3VQA A;  4YOR A;  3NMU A;  4M7Y A;  2ATQ A;  3KVG A;  4F3O A;  5ADX A;  1ILY A;  5AFU H;  2NRW A;  5BRH A;  4Z4G A;  4K41 A;  3HM9 A;  2HF4 A;  3OYH A;  3THY A;  4DTR A;  1S72 N;  3EKU A;  1ZBH A;  3VER A;  4F8R A;  4DR4 K;  1X1P A;  2EWS A;  3WEE B;  5AQY A;  4DS4 A;  2XY6 A;  2RPI A;  1X3M A;  1NK4 A;  3MN7 A;  4YDU A;  4N5S A;  1LAW A;  5FRO A;  2VCP A;  4B3R K;  3AVC A;  4AHS A;  1GLF O;  3O3F A;  4KB1 A;  3CQX A;  3WNE A;  1WAJ A;  1NGE A;  2NUB A;  2UXB K;  4AHU A;  4BVO A;  2E1Y A;  4JKF A;  3J7Y P;  2ZF5 O;  3JYT A;  2A1S A;  5AQW A;  3D7E O;  2DFF A;  4LF5 K;  3FE1 A;  3SZ2 A;  1KAY A;  3K5O A;  3CJ9 A;  4BG9 A;  1BIS A;  3FZK A;  1RIL A;  2ZD1 A;  4AM7 A;  5KPZ A;  5GAH P;  2OZS A;  1YAG A;  2IC3 A;  1NBW A;  1U48 A;  2V51 B;  4DTP A;  3SAH A;  1ZBS A;  5AQU A;  3V9X A;  4BC4 A;  5LJV A;  4N76 A;  5AQG A;  4O5F A;  1F21 A;  2XY8 A;  4CZJ A;  1JLB A;  3QET A;  2HW3 A;  2KZM A;  3SMP A;  4FWN A;  1HQU A;  1K8K B;  2FXU A;  4JRQ A;  2AA4 A;  5A2Q O;  5JLF A;  3QFU A;  1T8E A;  2HVI A;  4JKD A;  5HP1 A;  4FJK A;  3ZT3 A;  2HND A;  2P1J A;  1HYV A;  3JS6 A;  4FLV A;  1YT3 A;  2VQF K;  4H5R A;  2ETJ A;  4I6M A;  1DKG D;  1OVY A;  3V1O A;  3CJB A;  2PZS A;  1KCF A;  1HRH A;  5KRT A;  3THW B;  2CH5 A;  3SJJ A;  1JLC A;  1QZ5 A;  5EU7 A;  3DLL L;  1FKP A;  4DF8 A;  2QKB A;  4JI0 K;  3SQ2 A;  3PO4 A;  4B3T K;  5KQ8 A;  2W6K A;  4EAH D;  4ELV A;  1ASU A;  3CQY A;  3IUC A;  3H1Q A;  1TKD A;  1NK6 A;  4HUG A;  2D5R A;  2P9U A;  3HOS A;  2VWK A;  2XO7 A;  4GW6 A;  3BY5 A;  2WBN A;  3KJV A;  2G8U A;  3QEI A;  3LP1 A;  3KZB A;  2O8C B;  1EXQ A;  5J2M A;  2E6M A;  2W41 A;  5KPT A;  1QQC A;  1B9F A;  4W5T A;  3NH2 A;  3ZX2 A;  3AO4 A;  5HRO A;  4OGC A;  3TPQ A;  4FM1 A;  1RT7 A;  4NYN A;  2RF2 A;  3I55 N;  4B1V A;  2D0O A;  2UUC K;  1YIT N;  4HUF A;  3TAQ A;  2HHW A;  4DV5 K;  3CPW M;  3F5T A;  4JK8 A;  3OYB A;  5AZI A;  4GMJ B;  3SV3 A;  3CCL N;  3OY9 A;  4CJT A;  3ZT1 A;  1YIJ N;  5AQS A;  3TTF A;  4BRI A;  4R79 A;  3KD5 E;  2GBZ A;  1KVC A;  2WON A;  4H4M A;  3HO1 A;  5AZJ B;  3VQ7 A;  3DLB A;  2XY7 A;  2P9S A;  3AA2 A;  4JI5 K;  1B92 A;  3F9M A;  4AHR A;  3V4I A;  5J2P A;  1SKR A;  3VEW A;  2PFU A;  3L3V A;  3RSE B;  1ASW A;  3C7N B;  3E9P A;  1WSE A;  4FJ9 A;  2DPN A;  3E66 A;  4YOU A;  2IOC A;  3K5N A;  4BRG A;  4H5V A;  3AA5 X;  4IEI A;  5CZ2 A;  3FZM A;  5CYQ A;  3VN5 A;  4AHT A;  4BR4 A;  4H5W A;  3KLH A;  4RW7 A;  3SBG A;  3EKS A;  5LMU K;  3TAM A;  3OYA A;  4FXD A;  2Y1J A;  5AJ3 K;  1TV6 A;  1S1W A;  3I56 N;  1HYZ A;  1WNS A;  3CM5 A;  4OKE A;  3SLC A;  3F73 A;  1IKW A;  4CZK A;  3SYZ A;  4MO4 A;  1TUU A;  3VMF B;  3J7Z O;  4E0D A;  4AM6 A;  5AFU A;  3UKU A;  3AV9 A;  4K8X A;  2YHX A;  3PX4 A;  4FWR A;  2DFH A;  4FJJ A; 
#chains in the Genus database with same CATH homology
 1SQK A;  3CET A;  4FSV A;  1NGI A;  3SK3 A;  1NJI O;  4WFA L;  3CC7 N;  2HOE A;  3PLA A;  1NGB A;  2IIR A;  2QA4 N;  5E26 A;  5M1P A;  3HBT A;  4GNI A;  5F0X A;  3TTC A;  1RDW X;  1E4G T;  1GLA G;  2NZT A;  3VEZ A;  1U6Z A;  5AQK A;  3A5O C;  5GAD P;  2ASP A;  1T6C A;  3QB0 A;  2P9S B;  4NB4 A;  4A5B A;  5JLH A;  4QS8 A;  2E8A A;  3J8A A;  3N4P A;  1NGG A;  5AQV A;  5LY3 A;  3CF5 L;  5JVH L;  1BO5 O;  1NGA A;  4PKG A;  3MK6 A;  2ASM A;  1R59 O;  2WC9 A;  4U7B A;  2HBJ A;  4BR7 A;  4H0V B;  1QZ6 A;  4PL8 A;  3UKR A;  4YOY A;  1KD1 O;  4JD2 A;  5AQT A;  4QS7 A;  1GLC G;  3CC2 N;  1GLJ O;  3M6G A;  1NGJ A;  3M3Z A;  4FL9 A;  1VQN N;  4A2A A;  1HUX A;  1TYQ A;  3O9S A;  4H0T B;  1ATS A;  3U4L A;  4KH4 A;  5CE3 A;  3VTI A;  3EE8 A;  3WEE A;  5LJW A;  4C1N I;  1BUP A;  2F9T A;  3CHW A;  1K73 O;  5ELZ A;  2NRX A;  1O13 A;  2VGN A;  1P8Z A;  3WUH A;  4BRQ A;  3H45 C;  4Z94 A;  5C2F A;  4AF1 A;  4A61 A;  4BGB A;  3CMA N;  4BRO A;  4B1W B;  2KHO A;  4BC5 A;  1RDU A;  2CGK A;  3CCR N;  2IVO A;  2BUP A;  2A3Z A;  1BU6 O;  3O9U A;  4JK7 A;  4CZE A;  4DB3 A;  3AGK A;  5C2D A;  4CBX A;  3ZEU B;  2P9P A;  1HJO A;  4BRN A;  4BR0 A;  1QHA A;  4F9O A;  3M1F A;  3LL3 A;  4CZH A;  2IVN A;  3UB5 A;  4XEI A;  1RFQ A;  3ZET A;  1LCU A;  2E2P A;  3DXK A;  4RTF D;  3UKU B;  5CHI A;  3U8X A;  5M1K A;  3LDN A;  1YF5 L;  4ISF A;  3TSU A;  1D4X A;  1U2V A;  2QM1 A;  1ESV A;  1MWK A;  3DWL A;  3F2K A;  5C15 A;  5B8H A;  2NRH A;  4WF9 L;  4IFE A;  3O9T A;  5FPM A;  2V7Y A;  3HOT A;  2YJF A;  3CCQ N;  1BG3 A;  3E9O A;  1TUY A;  5JVG L;  5JIC A;  3AGR A;  1KQS M;  1YXQ A;  4OO1 J;  3GG4 A;  3ATV A;  1Z05 A;  4I6M B;  5AQM A;  5AQJ A;  1Q7Y O;  5BPN A;  5M1N A;  4WQ4 C;  3K9J A;  4A2B A;  1JCG A;  3GDQ A;  2HBM A;  1NGF A;  4IZ9 A;  2D0P A;  3CCM N;  3AAP A;  3A8Y A;  3WQT A;  3G6E N;  2NRZ A;  3MX2 A;  1GLD G;  1T6D A;  4NO7 A;  4XH5 A;  1HPM A;  1M1K O;  5GAE P;  3T7Z A;  2F7T A;  3KK7 A;  4WCE L;  2A40 A;  1VQ6 N;  3D2E A;  4JN4 A;  4B1U B;  3VET A;  3VEX A;  2WFB A;  3WQU A;  2GUP A;  1YHQ N;  3OW2 M;  4CBU A;  1K8K A;  1NGC A;  3CJC A;  4BR2 A;  5BR9 A;  4GV9 A;  3LM2 A;  4FVU A;  3RVC A;  4BRH A;  4MDB A;  3WXJ A;  2P9U B;  3TSQ A;  1VQ8 N;  4H5N A;  5FPD A;  1BOT O;  1Q86 O;  3HI0 A;  2FSN A;  3NVM A;  2V52 B;  1EO1 A;  5AQZ A;  3L4I A;  1C0G A;  2Q97 A;  2W40 A;  3ATU A;  2ZJQ L;  3FFK B;  4FWK A;  3CCV N;  4BGA A;  3R8E A;  1CZA N;  3W0L A;  2I7N A;  1MWM A;  4A59 A;  3ZYY X;  2GEL A;  2F9W A;  5F2R A;  3GOI A;  2QW9 A;  5AQR A;  3O8M A;  1DT9 A;  4CZM A;  2P9I A;  3QBW A;  2FF3 B;  1XUP O;  2Q0U A;  2Q0R A;  3EN9 A;  5KQD A;  3WXL A;  1U2V B;  5BRF A;  3AAQ A;  3VGK A;  2QWR A;  3L4Q A;  3VEN A;  4FO0 A;  3DJC A;  3ZX3 A;  3O1W A;  3VTH A;  3MCP A;  5ADX H;  2ASO A;  4BY9 C;  4EIA A;  5AZI B;  3CJA A;  1OKJ A;  1HKC A;  4GVE A;  4NLC A;  2Q1N A;  2GWJ A;  4IEE A;  5TKW A;  3WXM B;  4YOV A;  3VF2 A;  5M1O A;  1Q18 A;  3SBT A;  1M90 O;  4JEP A;  5FPN A;  4FPB A;  4IXC A;  3VEY A;  1VQ4 N;  3R9P A;  3O4W A;  4DHY A;  1NWK A;  3MN5 A;  1S3X A;  1NM1 A;  5CR4 A;  1KC8 O;  4WQ4 A;  1YJW N;  1P90 A;  1G99 A;  3VEO A;  3CCU N;  2P9N B;  4IJA A;  2E20 A;  1Z6R A;  3HM8 A;  3IKM A;  2VWB A;  3SAF A;  1WOQ A;  2ZJR L;  4DCH A;  4PKI A;  5JMV A;  1BA0 A;  4WFN L;  3MDQ A;  5EOY A;  2UYT A;  3WXI A;  2HST A;  4C23 A;  2JWL A;  1KAZ A;  4RWT A;  3BUZ B;  4JNE A;  2NRR A;  3WT0 A;  3VEV A;  2ZGY A;  2YJE A;  4K43 A;  3MN6 A;  4JKG A;  3PIP L;  5AQX A;  2YX6 A;  2CH6 A;  4BRP A;  3NVK A;  2E1Z A;  3CXC M;  4GV3 A;  4YDU C;  3KHY A;  3FZH A;  4A57 A;  5GIP A;  5HOO A;  1VQL N;  1H1V A;  3CI5 A;  2HF3 A;  3Q7B A;  4FWQ A;  5AQQ A;  3HTV A;  2FF6 A;  5BRD A;  3FR0 A;  3D2F B;  3P31 A;  4H0P A;  2VGM A;  3QIC A;  3ENH A;  3CCJ N;  4LC9 B;  2P9L A;  3H3O B;  4BR9 A;  4EFH A;  5BPM A;  4OPH A;  4IOC L;  4RCH A;  2IVP A;  3ID8 A;  3O9Q A;  3OBY A;  4MLH A;  2BTF A;  1IG8 A;  1JJ2 M;  3VOV A;  3EO3 A;  4H0Y B;  4JKA A;  4K42 A;  5BRE A;  1E4F T;  5AZJ A;  1VQK N;  2I7P A;  2CGJ A;  3P4I A;  3O1B A;  2CGL A;  4M63 C;  5EY4 A;  1GLL O;  2OAN A;  3M5R A;  3DXM B;  2KKZ A;  4H0O A;  3A5L C;  3ZX0 A;  4EHT A;  4JHD A;  1SAZ A;  2QWO A;  1QQO A;  4IO9 L;  5AQO A;  3O9R A;  3OBW A;  3MWP A;  4CBW A;  2OTL N;  2NRT A;  1HX1 A;  3FLC O;  4M7X A;  3C7N A;  1SS6 A;  3I8B A;  1ZXO A;  2HBL A;  3CJ1 A;  3A5N C;  4CZI A;  2ZGZ A;  3E1Y A;  3U9Z A;  4YOR A;  3NMU A;  4ILH A;  4M7Y A;  3C6H A;  4B1X B;  3KVG A;  2QTD A;  1NMD A;  4FOI A;  4HTL A;  5E84 A;  5ADX A;  3P38 A;  5AQN A;  4EHU A;  1ILY A;  1DEJ A;  1VQO N;  5AFU H;  2NRW A;  1W2B M;  2H3G X;  5BRH A;  4ILG B;  1J6Z A;  4K41 A;  3JXU A;  3ULE A;  2HF4 A;  1QVG M;  3LDP A;  5AQL A;  2A42 A;  1JCE A;  4BRC A;  4B1Z A;  5EXW A;  1S72 N;  2E2O A;  1V4T A;  3UKR B;  3BF3 A;  4JD2 B;  3EKU A;  4IOX A;  3VF6 A;  3VER A;  4IO8 A;  4K25 A;  3C65 A;  3CJ7 A;  4WQ5 C;  3IFR A;  3C0B A;  1TYQ B;  2EWS A;  2QWP A;  2Q31 A;  5C10 A;  3SAG A;  4CI6 A;  3W3D A;  1QQM A;  2NNW A;  5AQY A;  3WEE B;  3H6E A;  1S22 A;  1X3M A;  4BC3 A;  1QVF M;  2BH1 A;  3MN7 A;  3VF4 A;  3FZL A;  1LOT B;  2YHW A;  4YDU A;  2VCP A;  1T44 A;  3OHR A;  1BA1 A;  4BRL A;  4CZG A;  1BWF O;  1GLF O;  2A6A A;  4IDH A;  4B1Y B;  3CQX A;  3O5B A;  4BRA A;  3EZW A;  1NGE A;  2P9P B;  4BRF A;  4BVO A;  2E1Y A;  3SMS A;  4JKF A;  2ZF5 O;  3VES A;  4BRE A;  5AQW A;  3ZET B;  3SJH A;  3DXK B;  3VGL A;  1DGK N;  1N8R O;  2AP1 A;  4JAX A;  4KBO A;  3D7E O;  3KWG A;  3HSC A;  4XH4 A;  3MWT A;  3MCA B;  1KXP A;  3FE1 A;  3GE1 A;  2E88 A;  3QBX A;  4H0X B;  3VPZ A;  1KAY A;  1HKB A;  3KWI A;  3CJ9 A;  2E2N A;  4BG9 A;  5DM6 L;  1NGD A;  2QWM A;  1HKG A;  3FZK A;  3LDO A;  4FPA A;  4AM7 A;  5GAH P;  5KPZ A;  4JKH A;  1YAG A;  5HL7 L;  5MLC Q;  1NBW A;  1Y64 A;  3FGU A;  5H1S Q;  2V51 B;  3ENB A;  1RGI A;  5AQF A;  3SAH A;  1ZBS A;  3CIP A;  5AQU A;  2D4W A;  4MLE A;  4IJN A;  4FWP A;  3ULE B;  4JKB A;  4WYB A;  4BC4 A;  4B9Q A;  4E1J A;  1Q81 O;  1MA9 B;  3LDL A;  4BRD A;  3B8A X;  5LJV A;  4XH1 A;  4DKW A;  5AQG A;  3G71 N;  4JKE A;  4O5F A;  4CZJ A;  3D2E B;  4H03 B;  1ATN A;  2JWK A;  3SMP A;  4FWN A;  1K8K B;  2FXU A;  3D6R A;  1ATR A;  2AA4 A;  4WQ5 A;  3VGM A;  4CZL A;  4DQ8 A;  5JLF A;  3QFU A;  3BF1 A;  4JKD A;  4U67 L;  3R1X A;  3JS6 A;  1GLE G;  5AQP A;  5TKY A;  4O8U A;  4H5R A;  3TSP A;  3GBT A;  3LDQ A;  3A0I X;  3CD6 N;  2PAV A;  4HWI A;  4I6M A;  1DKG D;  4BVP A;  1OVY A;  3BP8 A;  4FOE A;  2A5X A;  3ENO A;  3TU5 A;  1NGH A;  2NRV A;  3DAW A;  2FLO A;  3IDH A;  4C1N K;  5GIN A;  2P9I B;  2QWQ A;  3CJB A;  3TTD A;  1BDG A;  4J8F A;  3U9D A;  4JK9 A;  3K9K A;  3S41 A;  1YJ9 N;  4H5T A;  2CH5 A;  3H46 O;  5EVZ A;  5AQI A;  1YUW A;  3Q7C A;  4KH5 A;  1QZ5 A;  2PBD A;  1NLV A;  2WUS A;  4YOX A;  3MX5 A;  3DLL L;  5KQ8 A;  4EAH D;  4MO5 A;  4FWO A;  2Q36 A;  3CQY A;  3IUC A;  3R6M A;  4MDA A;  4BRM A;  3H1Q A;  4CD3 A;  3CME N;  1KAX A;  4QS9 A;  5FPE A;  2P9U A;  2GTD A;  3RSE A;  3HOS A;  3HZ6 A;  1ZC6 A;  4BG8 A;  2FSJ A;  3MMV A;  2WBN A;  3O08 A;  1YI2 N;  1Q82 O;  3KZB A;  3L0Q A;  4BRK A;  3GL1 A;  5M1Q A;  3O6W A;  2FSK A;  2ZJP L;  2W41 A;  3G25 A;  3I33 A;  5KPT A;  2GX9 A;  1K9M O;  1SZ2 A;  2OTJ N;  1VQ5 N;  5I9E B;  3CER A;  2Q2R A;  4A5A A;  4YOW A;  3A5M C;  3C6A A;  2P9K A;  3QML A;  3ZX2 A;  5BN9 A;  5F1X A;  3H1V X;  1W97 L;  2E2Q A;  4GY2 B;  3TPQ A;  1X3N A;  3OA9 A;  3WXK A;  3I55 N;  4JKG B;  4PL7 A;  3G4S N;  1MDU B;  4B1V A;  2NLX A;  4PHT X;  2D0O A;  1YIT N;  1VAZ A;  1VQM N;  3CPE A;  4YOT A;  3CPW M;  1YJN N;  2ZWH A;  4G9Z A;  3O80 A;  3F5T A;  3FZF A;  4JK8 A;  5AQH A;  4CJ7 A;  2QI2 A;  3CCE N;  5AZI A;  2ITM A;  4KH6 A;  5EX5 A;  1T3V A;  5AR0 A;  1WUA A;  3MN9 A;  4NLB A;  3CCL N;  2VYP A;  4GV6 A;  1GLB G;  2QWN A;  3P39 A;  4CZF A;  1YIJ N;  5AQS A;  2YHY A;  2GEM A;  1VQP N;  3TTF A;  1IJJ A;  1X9J A;  2P9L B;  4BRI A;  2QEX N;  4R79 A;  3PIO L;  4BR5 A;  2P9N A;  5AZJ B;  3IMX A;  3EE9 A;  4UY8 O;  2P9S A;  1QQN A;  3HRG A;  3QDK A;  5BPL A;  5M1F A;  1K8A O;  4ISE A;  4Y0W A;  4JHD B;  3F9M A;  3QFP A;  3CCS N;  2HBK A;  1C0F A;  5GAG P;  1HLU A;  3VEW A;  3LM9 A;  2HMP A;  2KLA A;  5C0Y A;  4OPA A;  2PFU A;  2V7Z A;  4FWL A;  3RSE B;  3C7N B;  3E9P A;  2QWL A;  1VQ7 N;  5GIO A;  1YVN A;  2DPN A;  3E9L A;  3E66 A;  4PKH A;  2YCH A;  4O8K A;  4YOU A;  4BQZ A;  4A62 A;  3ID6 A;  4IOA L;  3UE5 A;  1JCF A;  4H5V A;  4BRG A;  4IEI A;  1V4S A;  1XQS C;  3FZM A;  2RE2 A;  3AY9 A;  4BR4 A;  4H5W A;  4FWM A;  3R3L A;  4ISG A;  5DM7 L;  2D1K A;  4BQL A;  3SBG A;  3D2F A;  2P9K B;  3EKS A;  4JKC A;  2GWK A;  5BN8 A;  4CD1 A;  2A41 A;  5KPR A;  3L6Q A;  4IWV A;  3CC4 N;  3H3N O;  4FWS A;  3I56 N;  2J4R A;  1EQY A;  3SLC A;  4CZK A;  1XC3 A;  3EL2 A;  4MO4 A;  4BC2 A;  1TUU A;  3ZEU A;  3T69 A;  3VMF B;  4ILJ A;  3J7Z O;  1VQ9 N;  4WFB L;  3DXM A;  4AM6 A;  5AFU A;  3UKU A;  2YHX A;  2RHK A;  3BEX A;  4FWR A;  4L3Q A;  2QXL A;  5C12 A;  3AAR A;  3N4Q A;  2YI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...