2G8FA

B. halodurans rnase h catalytic domain e188a mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
b'EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGAIKADY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 39
structure length 133
sequence length 133
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8fA00
4KFBA 4CJLA 1N6QA 3NCIA 1XWLA 4KREA 2P5OA 3LZIA 3NGZA 3DRSA 5JS2A 4O4GA 3AO2A 2RPIA 3ZSYA 4CGIA 4XIUA 4O55A 1S6PA 1TK0A 1TKDA 1LW0A 1RBUA 4E1NA 1EKEA 4ZTFA 4F2RA 3JSMA 4NCBA 3KLFA 3WNGA 2ATQA 3D45A 3K58A 3V81A 1GOBA 1HYSA 4PUOA 4C8MA 1Q9XA 2OPPA 4CGHA 3OYJA 2HVHA 1C0UA 1JLEA 1HNVA 4LH5A 4B8CA 2VG6A 4FW1A 5HROA 4RW9A 4CHPA 5J2QA 5I42A 1B9FA 1L5UA 3OYNA 3ZSZA 4AHCA 2G8WA 3OYLA 2HNZA 3ZSOA 1JLCA 3SUQA 5CZ2A 4IG0A 4CFBA 4KHUA 1RT6A 4OLAA 3OYHA 3QEPA 4DF4A 4KV8A 1IH7A 2IOCA 3AO3A 1TL3A 3V1RA 3PUFA 3VQDA 4AHVA 4EP5A 3OYEA 1JXBA 3NGIA 3TANA 5KRSA 4DTOA 4CE9A 2HVIA 1JKHA 3KK2A 1VSHA 2Z1GA 5J2NA 3HP9A 4DTMA 1LAWA 2JGUA 2YNIA 3AVJA 3K5NA 1IKWA 5D3GA 4J2AA 5K14A 4AHUA 1S9EA 4TSXA 2X6NA 3KIOA 3KKSA 4CF1A 5HRSA 5T7BA 3DLEA 3V9ZA 4CEQA 1NK5A 3OYBA 2KTQA 3ZCMA 1HPZA 4CGGA 3AVKA 1ASUA 4KTQA 3DLKA 3HM9A 4FLUA 2YNGA 1BCOA 4BACA 4M45A 3NH1A 4FLTA 3I0RA 3LP2A 3AVLA 1Y97A 3V9SA 3KKRA 1DTQA 1RDAA 1D5AA 1I39A 1S1XA 1Z25A 4BE2A 3SQ4A 1MU2A 1WNSA 2OPRA 2VG7A 3S3MA 3DLRA 4F2SA 4RW4A 1WAJA 4FM1A 1N5YA 4NYNA 4FLYA 3LPUA 4M3TA 2P1JA 1WLJA 4BE1A 2OZSA 4HCCA 4FZXC 2FC0A 3P1GA 1BIUA 3PX6A 3VQ7A 2DFFA 4IDKA 5HRNA 3L3VA 3VQ8A 4DTJA 1KFSA 1TV6A 2KQ2A 4B8AB 3TAQA 1D8YA 4FJLA 2KFZA 4E0DA 1S5JA 1T05A 1LV5A 2OPSA 5SWMA 1KCFA 4E7KA 5DMRA 2I5JA 1U45A 3L2WA 3VQQA 2OPQA 4E19A 3L3UA 2D0BA 3DOLA 4CJQA 3SPYA 1NK0A 1SKRA 3AA5X 1ZBHA 3LP0A 4CJSA 1NJWA 2HHQA 1VSIA 3SPZA 4DTXA 2HHTA 1JLAA 3O3HA 5KGWA 1RDBA 1RILA 1LWCA 4CJKA 4DQPA 4CHZA 3BGRA 3K5OA 1C1AA 4FM2A 3QETA 1U4BA 1EETA 4OVLA 2HNDA 3HVTA 4DLEA 3TR8A 4DTUA 4N76A 5J2PA 4QCLA 3MEGA 3KLHA 1SKSA 4K8ZA 1Q8IA 4E7JA 3MXMA 4OPKA 1SKWA 1QSLA 4RG8A 3ALYA 4EP4A 3DLHA 4PA1A 5HBMA 3L2QA 2IDOA 3TI0A 1S9GA 1VK0A 2AJQA 5C24A 4DQQA 2XY5A 1FKPA 1RT3A 2B5JA 4FM0A 3CQ8A 1S1WA 3NHGA 4KTZA 4IFVA 4KHSA 2B6AA 4ICLA 2VG5A 3DRPA 1TVRA 1RTHA 4B9SA 2KZZA 4DSEA 1JL1A 1HQEA 3M8PA 4H4MA 3AA3A 2IGIA 4ID5A 1BI4A 3MECA 4OGCA 3KD5E 3KK3A 1EXQA 2YHBA 4FXDA 4CHNA 4DS4A 3O3GA 1BQMA 3UIQA 3ZSXA 4Z4FA 4AHTA 3L2VA 2KFNA 3ASMA 1ZBUA 2HHXA 2RKIA 1RDDA 4CIGA 1C1BA 5KGXA 4O0IA 3HT3A 4DQSA 4DU4A 4N41A 1NKEA 1JLBA 1DLOA 1WSGA 1L3SA 5CY4A 3SZ2A 5CZ1A 1C0TA 1RT1A 3M8SA 2HMIA 3QEIA 3LZJA 4M3XA 4WE1A 1ASVA 1CXUA 2F8TA 4CF9A 4J2BA 3AO4A 3OJSA 3AV9A 3HPHA 1SV5A 5FROA 1UAXA 3CFPA 4J2EA 2OA8A 2D5RA 1FXXA 2E6MA 2PZSA 1HMVA 4FZZA 4CK3A 4B08A 5HRRA 1LWEA 4Q5VA 5FDLA 4CGFA 4CEEA 2XO7A 3RMAA 3KLEA 3MEDA 1X9MA 1TK8A 3ULDA 4RW6A 3SCXA 4DSKA 4DTPA 3QINA 5FRNA 4CK2A 4DFJA 3PO5A 4ZHRA 1T03A 3T3FA 3OS2A 4DFMA 1WSEA 4E1MA 2HHWA 4CHYA 1SUQA 4FLXA 3LALA 4KB1A 2F96A 4LSLA 3K2PA 1YTAA 1RT2A 2EHGA 2GV9A 1RTJA 4O0JA 4FLWA 4MQ3A 3LP3A 3LPTA 3LDSA 3QERA 3SI6A 4CIFA 1NK8A 1A5WA 3OYGA 4DTSA 5C42A 2XY6A 2PY5A 2PYJA 3VQAA 3AVAA 1HJRA 4YFUA 1R0AA 1L3UA 4M3YA 2A1RA 2RN2A 2DFEA 3CM6A 1UA1A 1UWBA 4AHRA 1QQCA 1FK9A 2BE2A 4CEAA 1JLGA 3HSTB 1C6VA 1BHLA 3ZSQA 4IKFA 4M42A 4CFAA 2R7YA 4MFBA 3SQ0A 1ZYQA 1C0MA 3CFRA 1JXEA 2YNFA 4HHTA 2O4IA 2DTUA 4W5NA 3ZT2A 4FYDA 3QEVA 4KTWA 1DTTA 3EY1A 3SJJA 2NUBA 4N47A 3ZT3A 4CJRA 4FJIA 3HJFA 3LWMA 4Z4CA 1VRUA 2DFHA 4FVMA 4JS4A 3SYZA 3KD1E 3QIPA 1G15A 3DLGA 1L3TA 1S6QA 1TL1A 3LAKA 3T19A 4O44A 4DQIA 4PQUA 1RT4A 3QIOA 1EP4A 5KTQA 1BQNA 3RRHA 4F3OA 1WSIA 1KSPA 4E7HA 3JYTA 4CGDA 4Z4IA 2LSNA 3S9HA 3ITHA 4FW2A 1HYZA 1GOCA 4DG1A 3G0ZA 1A5VA 1LW2A 4FJJA 4LSNA 3HYFA 3NAEA 3NGYA 2DY4A 4DTNA 1X9SA 4DWIA 3PX4A 3K5LA 1U48A 2F8SA 1LWFA 1X1PA 3AVGA 2P5GA 1ZBIA 3IAYA 4B9TA 4DS5A 2BDPA 4B9UA 1IG9A 2HW3A 3VQ5A 4FK0A 4UQGA 4KI6A 3DOKA 4OKKA 3RMCA 4B9NA 1J54A 4M3UA 4KRFA 3OYIA 4CEFA 2G8IA 4ID1A 2ITGA 3TAGA 2RF2A 2QK9A 1W9HA 3DMJA 3KK1A 1NKBA 2P51A 2X6SA 3DI6A 3LP1A 1GOAA 3ZSRA 3OYKA 2Z1HA 3HP6A 3HVRA 1T8EA 1TKXA 4R5PA 2G8VA 1KVAA 3QEXA 3VQBA 3NH2A 4DF8A 4CF0A 4CHQA 1KFDA 3AVBA 2VWJA 3AVNA 3RTVA 2WONA 4KHYA 3WNHA 3VQ9A 3D0PA 4Z4HA 1QSYA 3OYFA 1TAUA 4DSIA 4FJ8A 1XHZA 3AVFA 4IFYA 4DMNA 1RCHA 2YNHA 2G8UA 4L8RB 2WOMA 3KLGA 3AO1A 3CYMA 2ZE2A 4KHQA 2OYQA 1BCMA 1JL2A 3E01A 2HNYA 4FJNA 3F73A 1B9DA 2HB5A 4KO0A 3IS9A 3ZSVA 3PY8A 2PYLA 1YVUA 2IAJA 1KTQA 2X74A 2Z1JA 3ZSWA 3HXMA 4FJ9A 1F21A 3SQ2A 4C8KA 4H8KA 1CZBA 1T7PA 4W5OA 4Y1CA 3V6DA 1NJYA 3B6PA 4OKJA 4CEZA 3OJUA 4DU3A 2OZMA 1TKTA 1S1VA 3OYDA 3L8BA 3HK2A 4CCHA 4GW6A 3VA0A 3AA4A 4FLVA 5KRTA 4KI4A 4CJFA 3TAEA 4CJ5A 2Y1JA 3SQ1A 3LWLA 3MAQA 1BGXT 1WSFA 2B4JA 1IKYA 4JLHA 5C25A 1VSDA 4LH4A 1NK9A 3HPGA 3KTQA 4B9VA 1ZBFA 3M8RA 4W5TA 3QESA 4F3TA 4AHSA 4RW8A 3NFAA 4CERA 4YNQA 4E7IA 4OPJA 1CLQA 3O3FA 3VQEA 3OYCA 1UA0A 1J9AA 1JLQA 1QE1A 4FLZA 3CFOA 4I9QA 4KHWA 4I9LA 3AVIA 3VQ4A 1C1CA 5I3UA 3O4NA 4BWMA 1TAQA 3MEEA 2BGGA 4DFPA 1VSMA 2YV0X 1U47A 2FBVA 1D9FA 5DK5A 1U49A 4PWDA 2D0CA 2IC3A 2EX3A 2BANA 4IG3A 3L2UA 2G8HA 3A2FA 3K59A 4CJ4A 4Z4GA 4M3WA 4CEOA 1HRHA 4B9LA 1L3VA 1A5XA 3AA2A 4Q0BA 1XI1A 5J1EA 3OVNA 4BDPA 4RW7A 1BIZA 3QNOA 3VQPA 4ELVA 2HHVA 2FBYA 4F4KA 1BISA 4CJEA 5SZTA 3THVA 4E89A 1NK4A 3KLIA 4CJPA 1RTIA 3HO1A 2YHAA 1CXQA 1TGOA 1NK7A 2VWKA 1HYVA 4CESA 3TAFA 5HP1A 1VRTA 3P83D 4NCGA 1J53A 3KJVA 4C8OA 2FBXA 1U04A 3SUOA 4FJMA 1JLFA 2D0AA 4DSFA 1RBTA 3I0SA 4OKEA 3C6UA 2KW4A 3T1AA 4GMJB 4AILC 4KKOA 3F9KA 3LANA 1D9DA 4NYFA 1NJXA 2ZD1A 3RWUA 3K57A 5KI6A 1RBVA 3NF9A 4FZYA 2GUIA 3V9XA 2XHBA 4LD0A 4M41A 3ZT1A 4CF2A 4HUFA 3V9WA 4M3RA 4AH9A 1XC9A 3DLBA 3NDKA 2Q3SA 3NE6A 3IG1A 5FRMA 3L2RA 4I2QA 1VSLA 4PY5A 1S1UA 4CF8A 3RMBA 4FK4A 4Z0UA 1VSJA 1YT3A 1FKOA 3VN5A 1NJZA 1X9WA 4DSJA 2XY8A 4OJRA 3WNEA 4K8XA 2E6LA 3M8QA 4W5RA 1VSEA 4HCBA 2Z1IA 3AVHA 1IKVA 3ZT0A 4KPYA 5HRPA 4HTUA 4CEDA 4DLGA 1NOZA 1KVCA 4BWJA 1SL2A 1NK6A 3SV4A 1HNIA 4J2DA 4NCAA 4EZ6A 4DFKA 1K6YA 1VSKA 3VQ6A 1WSJA 4CIEA 1O1WA 4E3SA 1Z26A 3RMDA 5HLFA 1NKCA 1RDCA 4JS5A 1RBRA 2JLEA 3AVCA 4FJGA 4CJTA 3OYMA 3P5JA 4CGJA 4CJWA 3C94A 3QEWA 4F8RA 3SUPA 3PO4A 3PX0A 3CM5A 4DU1A 4FJXA 3V9UA 4QAGA 1QTMA 4CK1A 4HUEA 1IKXA 1W0HA 1SL1A 4CHOA 3RR7A 5J2MA 3TARA 4N5SA 1KLMA 2O4GA 2G8KA 4KAZA 3C95A 3QLHA 2HHSA 2X78A 4HUGA 3QO9A 3V4IA 4ELUA 2XY7A 4KB0A 5EU7A 1RNHA 1RT5A 1I3AA 4IBNA 1ASWA 3AVMA 4H4OA 4BDYA 3U3YA 1QHTA 1QS4A 3RR8A 4OLBA 2GBZA 2E4LA 2QKKA 3NF7A 4FCYA 1TK5A 4CECA 3SNNA 4FJKA 4FJ5A 5JS1A 3SUNA 1RT7A 4M3ZA 2FBTA 3K5MA 4O5BA 3AO5A 3OS0A 4N56A 3IRXA 1EX4A 1XHXA 3CG7A 3ZT4A 3I8DA 2HHUA 4DSLA 1IO2A 4BE0A 3EYZA 3O4QA 4B3OA 3MXJA 1BI4B 1VSFA 2YKMA 2W42A 2QXFA 2Y1IA 1NOYA 1RTDA 3B6OA 3H08A 3VA3A 4CJUA 3MXIA 4QOZB 5E41A 1SL0A 1WSHA 3ISNC 4I2PA 5CYMA 3S3OA 2YKNA 3TWHA 4DQRA 3TABA 4DTRA 3U3GA 3SV3A 2G8FA 4OGEA 4E7LA 4BDZA 1REVA 4Y1DA 4CFDA 4JRPA 4FJHA 2A1SA 3C6TA 3NBPA 1UOCA 2KZMA 3EZ5A 3U6FA 4LY7A 3V1OA 2QKBA 4CFCA 1KLNA 1ITGA 4ELTA 3G10A 4ZTJA 1J5OA 4FK2A 4CEBA 3V1QA 1BL3A 1ZBLA 1B92A 3HL8A 1KRPA 4HVJA 2ETJA 3NF8A 5CYQA 3OYAA 3TAPA 3FFIA 3OY9A 1YTUA 3DM2A 1QSSA 2ZQBA 1TKZA 4GVMA 1S1TA 4CJ3A 4FJ7A 1RBSA 3WNFA 1KVBA 3OS1A 4KHNA 1WAFA 1LAVA 4I7FA 3NF6A 3VQCA 3DYAA 4G1QA 3PV8A 4C8NA 3TAMA 4Z4EA 4C8LA 3LAMA 3NH0A 4W5QA 4JRQA 1CZ9A 3BDPA 4CJVA 3S3NA 3HPOA 3RRGA 2IS3A 3DRRA 3QNNA 4EZ9A 1HQUA 2XRIA 4B9MA 1Q9YA 1WN7A
chains in the Genus database with same CATH superfamily
3NCIA 4KREA 3LZIA 1JJ2M 5AJ3K 4BVOA 5JS2A 3GG4A 3ZSYA 2RPIA 3CCMN 1EKEA 4F2RA 4NCBA 5DM7L 3WNGA 4LC9B 2QWQA 1GOBA 3OBWA 4CGHA 3OYJA 2WFBA 2HVHA 3PSFA 2AA4A 4RW9A 4CHPA 5JLHA 5J2QA 5I42A 3Q7BA 1NGDA 1BOTO 4AHCA 3OYLA 2HNZA 4CFBA 2J4RA 3QEPA 1GLAG 4KV8A 3QICA 3V1RA 1NK4A 1ILYA 5KRSA 1E3MA 2HHHK 3LDLA 5M1QA 1HR0K 4M7XA 3C6HA 3MCAB 2YJFA 2O8FB 5JVGL 1VQPN 1S9EA 2X6NA 2O8DA 3DLEA 3TU5A 3F2KA 3ZCMA 1KC8O 4CGGA 3E9LA 4FLUA 2GEMA 1BCOA 2P9SA 4BACA 1ATRA 3AVLA 3PIPL 3KKRA 3CMAN 1S1XA 4BE2A 1NGCA 2VWBA 1WNSA 4JKGB 1QVFM 3DLRA 4F2SA 2A3ZA 4RW4A 2OZSA 4BE1A 4FZXC 4YOWA 3KWGA 5AQZA 2KQ2A 3TAQA 1K8KB 1VQ4N 2KFZA 4E0DA 3CJAA 2ITMA 1BWFO 5DMRA 1U45A 4E19A 3L3UA 2O8CA 4CJQA 3SPYA 1ZBHA 3QFPA 4X65K 3A5MC 1VSIA 3SPZA 2HHTA 1JLAA 3O3HA 4CJKA 2CH5A 4IFEA 3K5OA 3CIPA 4XEIA 1U4BA 4H5TA 2W6LA 3ZX0A 3O1WA 1Q8IA 1SKWA 4RG8A 1XNQK 4PKGA 5DM6L 4EP4A 1Y64A 3ZEUB 4GVEA 1VQ8N 2AJQA 3VTHA 1RDUA 4FM0A 2A6AA 3CQ8A 4BRNA 2QWNA 4IFVA 2B6AA 3K9JA 3DRPA 1RTHA 4DV3K 4B9SA 3TTFA 3MN5A 2UXBK 3VOVA 4DSEA 3WXMB 4H4MA 4ID5A 3LM9A 4LF6K 5AQLA 2IVOA 2YHBA 3I55N 2P9LA 3UIQA 2KFNA 2RKIA 2OTJN 4O0IA 4N41A 1NKEA 3VENA 1JLBA 3VGMA 3WXJA 3ZLJA 3S41A 3W3DA 1N8RO 1C0TA 2FF3B 1SAZA 3LM2A 2DPNA 5FROA 5AQVA 2D5RA 1FXXA 2E6MA 4BR9A 4CK3A 4B08A 2UU9K 1C0FA 2QI2A 4BC3A 2NRXA 4CEEA 2XO7A 3MEDA 1V4TA 3SCXA 4ZHRA 4BG9A 3OS2A 4DFMA 1WUAA 1TUYA 3LALA 3ULEB 4LSLA 4A61A 5KQ8A 1YTAA 4FLWA 4MQ3A 3LDSA 4CIFA 2XY6A 4YFUA 1L3UA 3CMEN 5AZIB 2E1ZA 4BR5A 3I8BA 2NRRA 2HOEA 5AQFA 3I33A 4IKFA 2HBKA 4CFAA 2R7YA 1C0MA 3CFRA 4KHPK 4B3SK 4KTWA 1DTTA 4A2AA 3U4LA 4BR4A 3ZT3A 4U7BA 3MX2A 4J8FA 4DUYK 4JI7K 1NBWA 4YOTA 1S6QA 4PQUA 4C23A 3QIOA 1EP4A 3RRHA 1KSPA 2F7TA 4FWLA 3S9HA 4FW2A 1WOQA 5EX5A 3G0ZA 1DGKN 2E1YA 4DTNA 1X9SA 2F8SA 1U48A 1X1PA 3CC2N 3SAHA 4JN4A 4DS5A 2BDPA 3VQ5A 4KI6A 2W41A 4KRFA 4NLCA 2NRTA 4BRKA 3TAGA 2E5LK 4MDBA 1W9HA 3DMJA 4YORA 2P51A 4FZYA 3LP1A 1GOAA 1T8EA 2G8VA 4R5PA 2HBLA 3AAPA 1KVAA 1K73O 4CF0A 3E9PA 2WONA 3MX5A 1ATSA 2FSJA 4Z4HA 4DSIA 4ISFA 4DMNA 4JK7A 2ZE2A 3R8EA 1BCMA 2HNYA 4BRQA 4AM7A 1B9DA 1NMNA 2HB5A 4KO0A 3CJ1A 5BN8A 2IAJA 3VEZA 2Z1JA 4FJ9A 1F21A 3SQ2A 1T7PA 4Y1CA 4CEZA 4DU3A 3N4PA 4CCHA 2ZF5O 5KQDA 2UUBK 5LY3A 4DB3A 3TAEA 3LDQA 4CJ5A 4O5FA 5GAGP 3CJ9A 2B4JA 4JLHA 5AQUA 1HLUA 5C25A 1NGAA 4W5TA 3QESA 4AHSA 3ZX3A 4OPJA 4B9QA 1UA0A 4AM6A 4FLZA 4I9QA 2I7NA 2HMPA 3ATVA 3VQ4A 5C12A 3FLCO 4K0KK 3CPEA 4H5RA 3MWPA 2FBVA 1U49A 2BANA 4CZEA 3FR0A 3O1BA 4CEOA 1HRHA 1MWKA 1XI1A 2O8DB 3GL1A 3OVNA 4BDPA 5CE3A 4RW7A 3QNOA 3ZX2A 4ELVA 3KK7A 4CJEA 5IWAK 3THVA 4E89A 3TSQA 1RTIA 2YHAA 1TGOA 3NVMA 2VWKA 1HYVA 1NK7A 2P9SB 4BRGA 3P83D 4DR1K 4BRIA 1JLFA 4BG8A 3VETA 3C6UA 4KKOA 3AGKA 5GAHP 4BC2A 1VQKN 3K57A 2HBJA 2QWPA 1EWQA 3MN7A 3EKSA 4JKBA 3CCSN 3ZT1A 3WQTA 3RMBA 4DV1K 3VN5A 1X9WA 4DSJA 3IUCA 4OJRA 2E6LA 4W5RA 3DJCA 4PKHA 2Z1IA 3FZFA 4NXMK 1IKVA 3SAGA 4NCAA 2O8CB 3OHRA 4DFKA 3TSUA 3VQ6A 4EZ6A 4EHTA 4JS5A 1XMQK 1RBRA 4EIAA 4CGJA 4CJWA 3C94A 3QEWA 4F8RA 3DXKA 3SUPA 4YHHK 2QW9A 5CR4A 4N5SA 1KLMA 2NRVA 2KLAA 1T6DA 3C95A 5LJWA 2HHSA 4HUGA 2A40A 4JEPA 3V4IA 4DCHA 4IBNA 1ESVA 4CJ7A 3U3YA 1QS4A 1SS6A 2GBZA 1N33K 3NF7A 2V52B 1TK5A 4CECA 3SNNA 2HF4A 1OH7A 3K5MA 4FOEA 4DTPA 1IBKK 1NWKA 1XHXA 4FWOA 2CGLA 4B3OA 1XNRK 3D7EO 1VHXA 3M1FA 1NOYA 3B6OA 3GOIA 2P9LB 3QMLA 4DQRA 4H0YB 3TABA 4E7LA 1REVA 4JRPA 3O5BA 4FJHA 3NBPA 3U6FA 4LY7A 5LMUK 1KLNA 1IJJA 3G10A 3O80A 4OO1J 2ETJA 3N4QA 3A5OC 3DM2A 2ZQBA 1TKZA 4FJ7A 2FLOA 1RBSA 1Z05A 4C8NA 3TAMA 4Z4EA 2A5XA 4CZLA 1BO5O 1H1VA 3NH0A 4W5QA 1YI2N 1I94K 3HPOA 3RRGA 4GNIA 3RSEA 2XRIA 4B9MA 2HHXA 1WN7A 4KFBA 2P5OA 4B3TK 4JI8K 4BC4A 4QS7A 1TKDA 4CGIA 1TK0A 5AQTA 3R3LA 3BZKA 3DAWA 2NNWA 5AQWA 3HTVA 4PUOA 4DR4K 5KPTA 3PSIA 1JLEA 4LH5A 2VG6A 3HZ6A 4IOXA 3EE8A 5AQJA 1L5UA 1KAXA 3OYNA 1KAYA 2G8WA 4IG0A 1RT6A 3OYHA 3OYEA 3TANA 2UXDK 2HVIA 4IOAL 2Z1GA 3FZKA 2JGUA 2QWRA 3K5NA 1IKWA 5D3GA 3CF5L 3V9ZA 4CEQA 5AQSA 3H1QA 4FWSA 1NK5A 1T44A 1ASUA 3DLKA 3HM9A 3CCUN 4FLTA 4LF4K 2F9WA 1Y97A 3V9SA 4H0TB 2UYTA 1Z25A 1MU2A 2QWLA 1NMDA 2VG7A 5GINA 1WAJA 4PHTX 1N5YA 4FLYA 4HCCA 1DT9A 3PX6A 3VQ7A 4IDKA 3EE9A 3L3VA 3QDKA 3ENOA 3FZHA 3LDNA 4B8AB 4BQZA 3CCJN 2ZWHA 1NJIO 3TTCA 4G9ZA 1LV5A 5B8HA 1GLDG 4JK8A 4E7KA 2YHYA 4GV6A 2I5JA 3ZYYX 3K9KA 1NK0A 2OPQA 4IZ9A 2D0BA 3DOLA 3LP0A 5F1XA 1NJWA 2HHQA 1Q82O 3P39A 2HSTA 1LWCA 4DQPA 5HL7L 3U9ZA 1NM1A 4N76A 2HNDA 3HVTA 4DR6K 3FZLA 4E7JA 1QSLA 3ALYA 4PA1A 5HBMA 4RCHA 3L2QA 2IDOA 2FSNA 1S9GA 5AQPA 2XY5A 1FKPA 1RT3A 1YJNN 3NHGA 3QB0A 4KTZA 4KHSA 4DKWA 2VG5A 4IWVA 1TVRA 4JI5K 4H5WA 4WQ4A 5TKYA 3BEXA 1HQEA 3CC7N 3AA3A 3KD5E 1EXQA 3MMVA 3ZSXA 4Z4FA 4AHTA 3L2VA 3ASMA 3P31A 4HTLA 4IJAA 3VF6A 4YOXA 4CIGA 5KGXA 1HJOA 5EOYA 5CY4A 4LF8K 3QFUA 5CZ1A 5ADXH 2HMIA 3QEIA 3LZJA 4M3XA 4WE1A 1ASVA 4CF9A 1U6ZA 4J2BA 3AO4A 3OJSA 3HPHA 3CFPA 3BF1A 4Q5VA 3H6EA 3MN9A 4B1WB 1TK8A 4RW6A 3QINA 5FRNA 3MN6A 4DFJA 3T3FA 2Q97A 4CHYA 1SUQA 3FFKB 2F96A 3CETA 4CZGA 1RT2A 2GV9A 4JNEA 1RTJA 1VQLN 3SI6A 3LPTA 2UXCK 2PY5A 1YJ9N 3DLLL 2E8AA 1S72N 3AVAA 3OA9A 2A1RA 1UA1A 4AHRA 1QQCA 4DV2K 1YVNA 1BHLA 3ZSQA 1ZYQA 3H46O 2IVPA 2DTUA 3CI5A 1XQSC 4BGBA 3HJFA 4FJIA 4DHYA 3LWMA 5CHIA 3DXKB 1G99A 3G6EN 3DLGA 3T19A 5HOOA 1RT4A 1FJGK 3C0BA 3IDHA 5KTQA 4F3OA 1WSIA 5I9EB 3VEWA 4CGDA 4Z4IA 1J5EK 3ITHA 1GOCA 5M1NA 1NGEA 1A5VA 1C0GA 4FJJA 1IG8A 4DWIA 3K5LA 2FSKA 3VEVA 1QQMA 3AVGA 2P5GA 5BREA 3IAYA 4CW7B 5AQRA 3SBGA 2HW3A 4UQGA 3DOKA 3RMCA 4B9NA 3OYIA 4ID1A 2ITGA 2RF2A 2QK9A 3A8YA 1VQON 1NKBA 4BQLA 1M90O 5AR0A 1TYQA 3HP6A 4JHDA 1TKXA 5M1FA 3QEXA 4CHQA 5KPRA 2Q1NA 3AVNA 1HNWK 3KVGA 4JAXA 3WNHA 3VQ9A 3F9MA 3OYFA 1TAUA 4FJ8A 3CJBA 2YNHA 4KHQA 5M1OA 2OYQA 4FJNA 2ZJRL 1WB9A 3F73A 2CGJA 2D0PA 3PY8A 3RSEB 3ZSWA 1OKJA 1CZBA 5BN9A 3B6PA 2OZMA 1N34K 2VGMA 5LJVA 3KHYA 2EWSA 5AFUH 1BU6O 3AA4A 5KRTA 3HI0A 4ILHA 5AQNA 2ASMA 4CJFA 2Y1JA 3LWLA 3MAQA 1BGXT 1WSFA 2QEXN 4DR2K 3DWLA 1VQ6N 4BRPA 1IKYA 3HPGA 3KTQA 4B9VA 1ZBFA 3M8RA 1NU0A 4RW8A 1CLQA 3VQEA 1J9AA 1OH6A 3CFOA 4BWMA 3D2EA 3WEEA 5DK5A 2NZTA 4PWDA 2IC3A 3THXB 4IG3A 3L2UA 3A2FA 4CJ4A 3O8MA 4M3WA 4I6MA 3THWA 4C1NK 4B9LA 2ZJQL 1L3VA 3BY5A 4IEEA 3T1HK 1BIZA 2HHVA 2FBYA 3TPQA 1BISA 2E88A 2P9KA 1ZC6A 2VQFK 1VRTA 1BA0A 1J53A 3KJVA 4FJMA 3I0SA 2NRZA 5C0YA 2KHOA 3CPWM 2RHKA 1NJXA 4PKIA 1KD1O 5KI6A 2QTDA 2E2OA 2E20A 3NF9A 2XHBA 3V9WA 4AH9A 4NLBA 2WTUA 1S1UA 4Z0UA 1YT3A 4NO7A 4YOUA 1FW6A 1DKGD 3EKUA 2GELA 1VSEA 1T6CA 3ZT0A 2Q2RA 5HRPA 4HTUA 4KPYA 1SL2A 1KVCA 1NK6A 3WXKA 3SV4A 1VSKA 3M6GA 1WSJA 1NKCA 1Z26A 4RWTA 2JLEA 1MA9B 3OYMA 1HUXA 1OH8A 4B1YB 3L4IA 1CZAN 4XH5A 4IXCA 1YIJN 3PX0A 1VQ7N 3V9UA 4QAGA 4HUEA 1W0HA 1SL1A 2ZGZA 5J2MA 3TARA 3J7ZO 2G8KA 5EVZA 4ELUA 1HNXK 1QHTA 2PBDA 4A57A 1X3MA 4DV0K 3UKUA 2FBTA 4RTFD 1EX4A 5AQYA 3CJCA 3I8DA 1WBBA 4BE0A 3U9DA 4CD3A 3O4QA 3MXJA 2YKMA 2W42A 2QXFA 2Q36A 3VA3A 1M1KO 3MXIA 5E41A 4I2PA 3S3OA 2YKNA 3TWHA 3GE1A 4BDZA 4Y1DA 2A1SA 3P38A 2JWKA 3V1OA 2A42A 3IMXA 3O9TA 4FK2A 1BL3A 3SMSA 3HL8A 4MLEA 4HVJA 5CYQA 3MDQA 3NF8A 3TAPA 3FFIA 3OY9A 1YTUA 3FE1A 1QSSA 2QWOA 4GVMA 4CJ3A 1MDUB 3H3OB 3WNFA 1KVBA 3OS1A 1Q86O 1WAFA 4DV7K 4I7FA 3VMFB 2H3GX 2WUSA 3LAMA 2YCHA 3G4SN 3BDPA 4CJVA 3H3NO 2V7ZA 2YHWA 3EZWA 4LF7K 4XIUA 3AO2A 1GLBG 3LDPA 1RBUA 3NMUA 1O13A 3K58A 4C8MA 3IKMA 4R79A 2OPPA 1Q9XA 2NRWA 1Q81O 1C0UA 1HNVA 4B8CA 4FW1A 3ZSZA 3LL3A 3SUQA 3ZSOA 1JLCA 1R59O 2QA4N 5LMNK 3DXMA 1U2VA 4OLAA 5JMVA 2OANA 3O9SA 3THYA 5AQHA 1D8YA 4AHVA 5JICA 1JXBA 3NGIA 4H5VA 3HP9A 3AVJA 1K9MO 4YOVA 3KIOA 3KKSA 4C1NI 2GUPA 3HOSA 1LCUA 3SMPA 2KTQA 3TSPA 1HPZA 3AVKA 4KTQA 5FPDA 2YNGA 3LDOA 3NH1A 3AAQA 5F2RA 3I0RA 5JVHL 1D5AA 1I39A 2OPRA 1YXQA 3H1VX 4B1UB 2P1JA 2P9IA 4WCEL 1QQNA 3P1GA 1BIUA 2O8FA 2DFFA 5HRNA 1TYQB 4JHDB 4FJLA 1NG9A 4BRCA 3K0SA 4CVNE 1KCFA 2VGNA 2F4VK 1JCFA 2BTFA 2AP1A 3VQQA 1YITN 2CGKA 1P8ZA 1SKRA 1P90A 3AA5X 4CZIA 4OPHA 4CJSA 3JAMO 3J7AP 4JI1K 4DTXA 4HWIA 1RILA 4CHZA 3BGRA 4ILGB 1C1AA 4FM2A 3QETA 1EETA 4OVLA 3M5RA 4DLEA 4DTUA 5ADXA 5J2PA 4QCLA 3KLHA 1SKSA 4K8ZA 5BPMA 5M1PA 2FXUA 1K8KA 2I7PA 1RGIA 4IOCL 5IT9O 4BR2A 4JD2A 4B1ZA 1KXPA 1JL1A 1Z6RA 2IGIA 1BI4A 4FXDA 1W97L 3D2EB 3WEEB 1RDDA 4GKKK 3HT3A 1DLOA 1WSGA 3VTIA 3THWB 1L3SA 2OTLN 3M8SA 4LF5K 1RT1A 1QVGM 4FSVA 2F8TA 3AV9A 1UAXA 2OA8A 5EXWA 2PZSA 2P9KB 1IBMK 3VF4A 5HRRA 3CCVN 4CGFA 3KLEA 1XMOK 1X9MA 3ULDA 3ENBA 4DSKA 3J81O 1YJWN 3PO5A 1S22A 2V51B 5KPZA 4A2BA 3D6RA 4KB1A 1E4FT 2EHGA 4O0JA 1GLEG 3LP3A 1A5WA 3OYGA 4Y0WA 5C42A 5AQGA 3VQAA 1R0AA 2RN2A 2DFEA 3CM6A 1BA1A 1FK9A 4CEAA 1S3XA 3HSTB 3P4IA 1C6VA 4MFBA 3SQ0A 2YNFA 2O4IA 3T69A 4HHTA 4W5NA 4FYDA 3QEVA 3HOTA 4JI4K 2HF3A 4CZJA 3SJJA 2NUBA 4Z4CA 1VRUA 1NLVA 2DFHA 4FVMA 4BR0A 3HSCA 3SYZA 1G15A 1TL1A 1HPMA 4O44A 1BQNA 4MO4A 3BP8A 3JYTA 2LSNA 3CC4N 3RVCA 1HYZA 3O9UA 4PL8A 3GDQA 3CQYA 4JKEA 4K43A 1LW2A 3HYFA 2BH1A 1XUPO 1Q9YA 4DR7K 3UKUB 3NGYA 2DY4A 2FF6A 3WT0A 3PX4A 3ID8A 4ILJA 4B9TA 4B9UA 2YHXA 1IG9A 3EO3A 4OKKA 2ZJPL 5AFUA 3SAFA 1VQNN 3O9RA 3ID6A 3GBTA 3KK1A 2X6SA 3DI6A 3OYKA 3ENHA 3VQBA 2Q0UA 4DF8A 1KFDA 3R9PA 4DV4K 3PLAA 3CD6N 4YDUA 1HKCA 4XH4A 3D0PA 3KWIA 1QSYA 3AVFA 2G8UA 2WOMA 3KLGA 3AO1A 3CYMA 2QWMA 4MDAA 2CH6A 1JL2A 3E01A 3ZSVA 3IS9A 5AQKA 2PYLA 3CCLN 1KTQA 1NGHA 3AGRA 4EHUA 4H8KA 4W5OA 1NJYA 4OKJA 3OJUA 1TKTA 1S1VA 3L8BA 3HK2A 3EEQA 4WFBL 4FLVA 4JI6K 4KI4A 3H45C 3SQ1A 4FO0A 4KH4A 1BDGA 2Q0RA 3CJ7A 3ZETA 3O6WA 4LH4A 5GAEP 1NK9A 5C15A 3OTOK 4JKCA 3VGLA 5H1SQ 4E7IA 4FOIA 4FWRA 3OYCA 1JLQA 1QE1A 3CCRN 2IIRA 2PFUA 1U2VB 4X62K 3THYB 3MEEA 1LOTB 5BPLA 1QZ5A 1D9FA 2YV0X 4FPBA 1U47A 4JKFA 1RFQA 3NVKA 2EX3A 3K59A 4Z4GA 3E1YA 1OH5A 1A5XA 3AA2A 5J1EA 4U67L 4CZMA 3VQPA 1JCEA 4JV5K 3HO1A 3KLIA 1CXQA 4CESA 3TAFA 4C8OA 2FBXA 1Q18A 3J8AA 4ISGA 4CD1A 3ATUA 3F9KA 4QS9A 3LANA 4H0PA 2ZD1A 3RWUA 5BRHA 2GX9A 2GUIA 3OW2M 2P9IB 1XC9A 4M41A 3A5NC 5AZJA 4CF2A 4HUFA 1EWRA 2Q3SA 5GADP 3NE6A 3IG1A 4WYBA 4I2QA 4DV5K 4PY5A 4FK4A 1VSJA 2UUAK 4BR7A 4EFHA 3WNEA 4K8XA 3M8QA 4FWQA 4HCBA 3AVHA 5TKWA 4BWJA 1D4XA 4J2DA 3EL2A 1K6YA 4CIEA 5HLFA 3D2FA 4FJGA 4CJTA 4EAHD 1BUPA 3A5LC 3CM5A 3EN9A 4FJXA 5E84A 4CK1A 3L0QA 2E2QA 4CHOA 3C65A 5A2QO 2O4GA 2YX6A 4JKDA 2X78A 3QO9A 4O8UA 3JXUA 5EU7A 1RNHA 1RT5A 2RE2A 1NGFA 1ASWA 4BDYA 3RR8A 4A62A 2NLXA 2VYPA 2QKKA 4WF9L 4FJKA 2V7YA 4FJ5A 5JS1A 3OBYA 1RT7A 4JD2B 4O5BA 3AO5A 3OS0A 4N56A 2HHUA 3VEYA 4DSLA 1IO2A 3Q7CA 1BI4B 2Y1IA 3QBXA 4B1VA 1RTDA 2UUCK 3VESA 4KH5A 3C7NA 1W7AA 3ISNC 2ZGYA 5ELZA 5AQQA 2A41A 3SV3A 3A0IX 4OGEA 4CFDA 5C2DA 3C6TA 1UOCA 3E66A 5GIPA 2KZMA 3B8AX 3EZ5A 4BY9C 2QKBA 1ITGA 5BRFA 4ZTJA 1J5OA 4CEBA 3V1QA 1ZBLA 4O8KA 1KRPA 3OYAA 4BRFA 1VQ9N 3CERA 4BRMA 4KHNA 1LAVA 3VQCA 3R1XA 4G1QA 1NGGA 2P9UA 1CZ9A 4JRQA 3S3NA 3F5TA 2IS3A 4YDUC 1V4SA 1QZ6A 4CJLA 1N6QA 1XWLA 3NGZA 3DRSA 1RDWX 4O4GA 4WQ4C 4O55A 1S6PA 4YY3K 4BRLA 1LW0A 4E1NA 4ZTFA 3MCPA 3JSMA 1GLLO 3KLFA 2ATQA 3D45A 4FWPA 3V81A 1HYSA 4JYAK 4H0XB 2GTDA 5HROA 1B9FA 1YAGA 3BZCA 4KHUA 5CZ2A 3AY9A 4DF4A 2ASOA 1IH7A 2IOCA 3AO3A 1TL3A 4IEIA 3PUFA 3VQDA 4EP5A 4DTOA 3CCEN 4CE9A 1JKHA 3KK2A 1VSHA 2QXLA 5FLXO 5J2NA 4GV9A 4DTMA 1LAWA 2YNIA 3U8XA 4J2AA 5K14A 4IJNA 4AHUA 2O8EA 4TSXA 4CF1A 5HRSA 4FL9A 5T7BA 3O9QA 3OYBA 3UB5A 4JK9A 4DR5K 4BREA 1HKGA 3SLCA 4M45A 1X3NA 4AQYK 3LP2A 1DTQA 1RDAA 3SQ4A 3CHWA 3S3MA 4K42A 4FM1A 4NYNA 3J7YP 3LPUA 2PAVA 2ZM6K 3FGUA 1WLJA 4M3TA 2FC0A 1YUWA 3VQ8A 4DTJA 1KFSA 5EY4A 1TV6A 5FPNA 5FPEA 1S5JA 1NGIA 4FWKA 1T05A 2ASPA 2OPSA 5SWMA 1QHAA 3J80O 4FWMA 3L2WA 2D1KA 5KGWA 1RDBA 1OVQA 2WBNA 3VGKA 1W2BM 5C10A 4H5NA 1JCGA 3TR8A 3MEGA 3SBTA 1YHQN 3MXMA 4OPKA 3BF3A 3VF2A 1WBDA 3DLHA 1SQKA 4KBOA 2W40A 3TI0A 1VK0A 4KH6A 5C24A 4DQQA 2B5JA 3CCQN 4YOYA 1QQOA 3ZETB 3WXLA 1S1WA 2O8BA 4ICLA 2KZZA 2VQEK 3WUHA 4A5AA 2P9PA 4WQ5A 4LFAK 3M8PA 4WFAL 4H0VB 1N36K 1IV0A 3MECA 4OGCA 3KK3A 5AQXA 3L4QA 4CHNA 5M1KA 2P9NA 3O3GA 4DS4A 1BQMA 1EO1A 2NRHA 3UKRA 1ZBUA 4DQSA 1C1BA 4DU4A 4FPAA 2BUPA 4BRHA 3SZ2A 2GWJA 1CXUA 2IVNA 1SV5A 4MLHA 2YJEA 4J2EA 1X9JA 1HMVA 4CBXA 4H0OA 1BG3A 5LL6Z 1LWEA 5FDLA 3RMAA 3VERA 1EQYA 3I56N 4CK2A 1T03A 1WSEA 4E1MA 3VEOA 2HHWA 4FLXA 2JWLA 5AZJB 3K2PA 3BUZB 3QERA 4KHYA 3KD1E 1NK8A 2PYJA 4FWNA 4DTSA 4OX9K 4LFCK 4Z94A 5BR8K 1HJRA 4M63C 4M3YA 2F9TA 1UWBA 5BRDA 2BE2A 3W0LA 4GV3A 1JLGA 4M42A 3CQXA 1JXEA 3D2FB 3ZT2A 4DQ8A 3EY1A 4N47A 4CJRA 5MLCQ 3SJHA 4JI0K 4JS4A 1N32K 4QS8A 3QIPA 1L3TA 3LAKA 4DQIA 1KQSM 4JI2K 3MWTA 3T7ZA 4E7HA 4ISEA 4DG1A 3HBTA 3FZMA 4E1JA 1VAZA 4LSNA 3NAEA 3SK3A 5FPMA 1LWFA 4K25A 3L6QA 1YF5L 4A5BA 1ZBIA 1HX1A 3WXIA 4CZFA 2E2PA 4FK0A 3QBWA 3C7NB 1J54A 4M3UA 4JKGA 2VCPA 4CEFA 2G8IA 3T1YK 1NGBA 3M3ZA 3VPZA 3ZSRA 3HVRA 2Z1HA 4F9OA 3PIOL 1HNZK 3NH2A 4BVPA 3AVBA 2VWJA 3RTVA 4CI6A 4LF9K 3JS6A 1VQ5N 4CZHA 1XHZA 4IFYA 1RCHA 4L8RB 4L3QA 2E2NA 1HKBA 1TUUA 2P9UB 3AARA 5JLFA 1YVUA 3R6MA 2X74A 1T3VA 3E9OA 5BPNA 3HXMA 1SZ2A 4BC5A 4C8KA 4BRDA 4UY8O 3G25A 3V6DA 3OYDA 1GLCG 4X64K 4GW6A 3VA0A 3KZBA 3ZEUA 4I6MB 2D0OA 4K41A 3IFRA 1VSDA 4IDHA 4DR3K 3O08A 5AQIA 4IO8A 4F3TA 4YNQA 3NFAA 4CERA 3O3FA 4KHWA 4I9LA 3AVIA 1C1CA 5I3UA 3O4NA 1TAQA 2BGGA 4PL7A 4DFPA 1VSMA 1NGJA 3G71N 2D0CA 4GKJK 2G8HA 4WQ5C 1GLFO 2O8EB 3HM8A 4Q0BA 4JKAA 4A59A 4F4KA 5SZTA 4CJPA 5HP1A 4NCGA 1U04A 3SUOA 2D0AA 4DSFA 1RBTA 4OKEA 1DEJA 3MK6A 3T1AA 2KW4A 4GMJB 4AILC 4NB4A 3O4WA 1D9DA 4NYFA 4B3RK 1RBVA 5BR9A 3THXA 3V9XA 3ULEA 4LD0A 4B1XB 4M3RA 3DLBA 3NDKA 4LFBK 5FRMA 3HRGA 3L2RA 1VSLA 3TTDA 4CF8A 1NJZA 1FKOA 4JI3K 1J6ZA 2XY8A 5AZIA 4CBWA 4DUZK 4NXNK 4CEDA 4DLGA 1NOZA 4H03B 3CXCM 1HNIA 2Q31A 4E3SA 2GWKA 1O1WA 3RMDA 4B3MK 1RDCA 4MO5A 1Q7YO 3AVCA 3WQUA 1ZBSA 3P5JA 3PO4A 2OCEA 4DU1A 1QTMA 1IBLK 5GIOA 1IKXA 3RR7A 4XH1A 4KAZA 3QLHA 4WFNL 2YI1A 4V19S 4KB0A 2XY7A 4FZZA 1I3AA 2QM1A 3AVMA 4H4OA 4OLBA 4OPAA 2E4LA 4BGAA 4X66K 4FCYA 2O8BB 4CBUA 3SUNA 4M3ZA 4JKHA 2P9PB 5C2FA 3UE5A 3IRXA 1XC3A 3CG7A 3C6AA 3ZT4A 3EYZA 1VSFA 2WC9A 1OVYA 3H08A 2P9NB 4M7YA 1E4GT 4CJUA 2KKZA 4IO9L 3UKRB 4QOZB 4FVUA 1SL0A 1WSHA 5CYMA 4DTRA 3U3GA 2G8FA 4DV6K 5E26A 1MWMA 1VQMN 4CFCA 4ELTA 1K8AO 5AQMA 1ATNA 1B92A 1KAZA 1NNEA 2W6KA 1S1TA 2D4WA 3NF6A 3DYAA 4AF1A 5AQOA 5F0XA 3PV8A 4CZKA 4C8LA 1GLJO 2HBMA 3VEXA 3DXMB 4BROA 3DRRA 4BRAA 3QNNA 1HQUA 4EZ9A 1ZXOA 4GY2B
chains in the Genus database with same CATH topology
4KFBA 4CJLA 1N6QA 3NCIA 1XWLA 4KREA 2P5OA 3LZIA 3NGZA 3DRSA 5JS2A 4O4GA 3AO2A 2RPIA 3ZSYA 4CGIA 4XIUA 4O55A 1S6PA 1TK0A 1TKDA 1LW0A 1RBUA 4E1NA 1EKEA 4ZTFA 4F2RA 3JSMA 4NCBA 3KLFA 3WNGA 2ATQA 3D45A 3K58A 3V81A 1GOBA 1HYSA 4PUOA 4C8MA 1Q9XA 2OPPA 4CGHA 3OYJA 2HVHA 1C0UA 1JLEA 1HNVA 4LH5A 4B8CA 2VG6A 4FW1A 5HROA 4RW9A 4CHPA 5J2QA 5I42A 1B9FA 1L5UA 3OYNA 3ZSZA 4AHCA 2G8WA 3OYLA 2HNZA 3ZSOA 1JLCA 3SUQA 5CZ2A 4IG0A 4CFBA 4KHUA 1RT6A 4OLAA 3OYHA 3QEPA 4DF4A 4KV8A 1IH7A 2IOCA 3AO3A 1TL3A 3V1RA 3PUFA 3VQDA 4AHVA 4EP5A 3OYEA 1JXBA 3NGIA 3TANA 5KRSA 4DTOA 4CE9A 2HVIA 1JKHA 3KK2A 1VSHA 2Z1GA 5J2NA 3HP9A 4DTMA 1LAWA 2JGUA 2YNIA 3AVJA 3K5NA 1IKWA 5D3GA 4J2AA 5K14A 4AHUA 1S9EA 4TSXA 2X6NA 3KIOA 3KKSA 4CF1A 5HRSA 5T7BA 3DLEA 3V9ZA 4CEQA 1NK5A 3OYBA 2KTQA 3ZCMA 1HPZA 4CGGA 3AVKA 1ASUA 4KTQA 3DLKA 3HM9A 4FLUA 2YNGA 1BCOA 4BACA 4M45A 3NH1A 4FLTA 3I0RA 3LP2A 3AVLA 1Y97A 3V9SA 3KKRA 1DTQA 1RDAA 1D5AA 1I39A 1S1XA 1Z25A 4BE2A 3SQ4A 1MU2A 1WNSA 2OPRA 2VG7A 3S3MA 3DLRA 4F2SA 4RW4A 1WAJA 4FM1A 1N5YA 4NYNA 4FLYA 3LPUA 4M3TA 2P1JA 1WLJA 4BE1A 2OZSA 4HCCA 4FZXC 2FC0A 3P1GA 1BIUA 3PX6A 3VQ7A 2DFFA 4IDKA 5HRNA 3L3VA 3VQ8A 4DTJA 1KFSA 1TV6A 2KQ2A 4B8AB 3TAQA 1D8YA 4FJLA 2KFZA 4E0DA 1S5JA 1T05A 1LV5A 2OPSA 5SWMA 1KCFA 4E7KA 5DMRA 2I5JA 1U45A 3L2WA 3VQQA 2OPQA 4E19A 3L3UA 2D0BA 3DOLA 4CJQA 3SPYA 1NK0A 1SKRA 3AA5X 1ZBHA 3LP0A 4CJSA 1NJWA 2HHQA 1VSIA 3SPZA 4DTXA 2HHTA 1JLAA 3O3HA 5KGWA 1RDBA 1RILA 1LWCA 4CJKA 4DQPA 4CHZA 3BGRA 3K5OA 1C1AA 4FM2A 3QETA 1U4BA 1EETA 4OVLA 2HNDA 3HVTA 4DLEA 3TR8A 4DTUA 4N76A 5J2PA 4QCLA 3MEGA 3KLHA 1SKSA 4K8ZA 1Q8IA 4E7JA 3MXMA 4OPKA 1SKWA 1QSLA 4RG8A 3ALYA 4EP4A 3DLHA 4PA1A 5HBMA 3L2QA 2IDOA 3TI0A 1S9GA 1VK0A 2AJQA 5C24A 4DQQA 2XY5A 1FKPA 1RT3A 2B5JA 4FM0A 3CQ8A 1S1WA 3NHGA 4KTZA 4IFVA 4KHSA 2B6AA 4ICLA 2VG5A 3DRPA 1TVRA 1RTHA 4B9SA 2KZZA 4DSEA 1JL1A 1HQEA 3M8PA 4H4MA 3AA3A 2IGIA 4ID5A 1BI4A 3MECA 4OGCA 3KD5E 3KK3A 1EXQA 2YHBA 4FXDA 4CHNA 4DS4A 3O3GA 1BQMA 3UIQA 3ZSXA 4Z4FA 4AHTA 3L2VA 2KFNA 3ASMA 1ZBUA 2HHXA 2RKIA 1RDDA 4CIGA 1C1BA 5KGXA 4O0IA 3HT3A 4DQSA 4DU4A 4N41A 1NKEA 1JLBA 1DLOA 1WSGA 1L3SA 5CY4A 3SZ2A 5CZ1A 1C0TA 1RT1A 3M8SA 2HMIA 3QEIA 3LZJA 4M3XA 4WE1A 1ASVA 1CXUA 2F8TA 4CF9A 4J2BA 3AO4A 3OJSA 3AV9A 3HPHA 1SV5A 5FROA 1UAXA 3CFPA 4J2EA 2OA8A 2D5RA 1FXXA 2E6MA 2PZSA 1HMVA 4FZZA 4CK3A 4B08A 5HRRA 1LWEA 4Q5VA 5FDLA 4CGFA 4CEEA 2XO7A 3RMAA 3KLEA 3MEDA 1X9MA 1TK8A 3ULDA 4RW6A 3SCXA 4DSKA 4DTPA 3QINA 5FRNA 4CK2A 4DFJA 3PO5A 4ZHRA 1T03A 3T3FA 3OS2A 4DFMA 1WSEA 4E1MA 2HHWA 4CHYA 1SUQA 4FLXA 3LALA 4KB1A 2F96A 4LSLA 3K2PA 1YTAA 1RT2A 2EHGA 2GV9A 1RTJA 4O0JA 4FLWA 4MQ3A 3LP3A 3LPTA 3LDSA 3QERA 3SI6A 4CIFA 1NK8A 1A5WA 3OYGA 4DTSA 5C42A 2XY6A 2PY5A 2PYJA 3VQAA 3AVAA 1HJRA 4YFUA 1R0AA 1L3UA 4M3YA 2A1RA 2RN2A 2DFEA 3CM6A 1UA1A 1UWBA 4AHRA 1QQCA 1FK9A 2BE2A 4CEAA 1JLGA 3HSTB 1C6VA 1BHLA 3ZSQA 4IKFA 4M42A 4CFAA 2R7YA 4MFBA 3SQ0A 1ZYQA 1C0MA 3CFRA 1JXEA 2YNFA 4HHTA 2O4IA 2DTUA 4W5NA 3ZT2A 4FYDA 3QEVA 4KTWA 1DTTA 3EY1A 3SJJA 2NUBA 4N47A 3ZT3A 4CJRA 4FJIA 3HJFA 3LWMA 4Z4CA 1VRUA 2DFHA 4FVMA 4JS4A 3SYZA 3KD1E 3QIPA 1G15A 3DLGA 1L3TA 1S6QA 1TL1A 3LAKA 3T19A 4O44A 4DQIA 4PQUA 1RT4A 3QIOA 1EP4A 5KTQA 1BQNA 3RRHA 4F3OA 1WSIA 1KSPA 4E7HA 3JYTA 4CGDA 4Z4IA 2LSNA 3S9HA 3ITHA 4FW2A 1HYZA 1GOCA 4DG1A 3G0ZA 1A5VA 1LW2A 4FJJA 4LSNA 3HYFA 3NAEA 3NGYA 2DY4A 4DTNA 1X9SA 4DWIA 3PX4A 3K5LA 1U48A 2F8SA 1LWFA 1X1PA 3AVGA 2P5GA 1ZBIA 3IAYA 4B9TA 4DS5A 2BDPA 4B9UA 1IG9A 2HW3A 3VQ5A 4FK0A 4UQGA 4KI6A 3DOKA 4OKKA 3RMCA 4B9NA 1J54A 4M3UA 4KRFA 3OYIA 4CEFA 2G8IA 4ID1A 2ITGA 3TAGA 2RF2A 2QK9A 1W9HA 3DMJA 3KK1A 1NKBA 2P51A 2X6SA 3DI6A 3LP1A 1GOAA 3ZSRA 3OYKA 2Z1HA 3HP6A 3HVRA 1T8EA 1TKXA 4R5PA 2G8VA 1KVAA 3QEXA 3VQBA 3NH2A 4DF8A 4CF0A 4CHQA 1KFDA 3AVBA 2VWJA 3AVNA 3RTVA 2WONA 4KHYA 3WNHA 3VQ9A 3D0PA 4Z4HA 1QSYA 3OYFA 1TAUA 4DSIA 4FJ8A 1XHZA 3AVFA 4IFYA 4DMNA 1RCHA 2YNHA 2G8UA 4L8RB 2WOMA 3KLGA 3AO1A 3CYMA 2ZE2A 4KHQA 2OYQA 1BCMA 1JL2A 3E01A 2HNYA 4FJNA 3F73A 1B9DA 2HB5A 4KO0A 3IS9A 3ZSVA 3PY8A 2PYLA 1YVUA 2IAJA 1KTQA 2X74A 2Z1JA 3ZSWA 3HXMA 4FJ9A 1F21A 3SQ2A 4C8KA 4H8KA 1CZBA 1T7PA 4W5OA 4Y1CA 3V6DA 1NJYA 3B6PA 4OKJA 4CEZA 3OJUA 4DU3A 2OZMA 1TKTA 1S1VA 3OYDA 3L8BA 3HK2A 4CCHA 4GW6A 3VA0A 3AA4A 4FLVA 5KRTA 4KI4A 4CJFA 3TAEA 4CJ5A 2Y1JA 3SQ1A 3LWLA 3MAQA 1BGXT 1WSFA 2B4JA 1IKYA 4JLHA 5C25A 1VSDA 4LH4A 1NK9A 3HPGA 3KTQA 4B9VA 1ZBFA 3M8RA 4W5TA 3QESA 4F3TA 4AHSA 4RW8A 3NFAA 4CERA 4YNQA 4E7IA 4OPJA 1CLQA 3O3FA 3VQEA 3OYCA 1UA0A 1J9AA 1JLQA 1QE1A 4FLZA 3CFOA 4I9QA 4KHWA 4I9LA 3AVIA 3VQ4A 1C1CA 5I3UA 3O4NA 4BWMA 1TAQA 3MEEA 2BGGA 4DFPA 1VSMA 2YV0X 1U47A 2FBVA 1D9FA 5DK5A 1U49A 4PWDA 2D0CA 2IC3A 2EX3A 2BANA 4IG3A 3L2UA 2G8HA 3A2FA 3K59A 4CJ4A 4Z4GA 4M3WA 4CEOA 1HRHA 4B9LA 1L3VA 1A5XA 3AA2A 4Q0BA 1XI1A 5J1EA 3OVNA 4BDPA 4RW7A 1BIZA 3QNOA 3VQPA 4ELVA 2HHVA 2FBYA 4F4KA 1BISA 4CJEA 5SZTA 3THVA 4E89A 1NK4A 3KLIA 4CJPA 1RTIA 3HO1A 2YHAA 1CXQA 1TGOA 1NK7A 2VWKA 1HYVA 4CESA 3TAFA 5HP1A 1VRTA 3P83D 4NCGA 1J53A 3KJVA 4C8OA 2FBXA 1U04A 3SUOA 4FJMA 1JLFA 2D0AA 4DSFA 1RBTA 3I0SA 4OKEA 3C6UA 2KW4A 3T1AA 4GMJB 4AILC 4KKOA 3F9KA 3LANA 1D9DA 4NYFA 1NJXA 2ZD1A 3RWUA 3K57A 5KI6A 1RBVA 3NF9A 4FZYA 2GUIA 3V9XA 2XHBA 4LD0A 4M41A 3ZT1A 4CF2A 4HUFA 3V9WA 4M3RA 4AH9A 1XC9A 3DLBA 3NDKA 2Q3SA 3NE6A 3IG1A 5FRMA 3L2RA 4I2QA 1VSLA 4PY5A 1S1UA 4CF8A 3RMBA 4FK4A 4Z0UA 1VSJA 1YT3A 1FKOA 3VN5A 1NJZA 1X9WA 4DSJA 2XY8A 4OJRA 3WNEA 4K8XA 2E6LA 3M8QA 4W5RA 1VSEA 4HCBA 2Z1IA 3AVHA 1IKVA 3ZT0A 4KPYA 5HRPA 4HTUA 4CEDA 4DLGA 1NOZA 1KVCA 4BWJA 1SL2A 1NK6A 3SV4A 1HNIA 4J2DA 4NCAA 4EZ6A 4DFKA 1K6YA 1VSKA 3VQ6A 1WSJA 4CIEA 1O1WA 4E3SA 1Z26A 3RMDA 5HLFA 1NKCA 1RDCA 4JS5A 1RBRA 2JLEA 3AVCA 4FJGA 4CJTA 3OYMA 3P5JA 4CGJA 4CJWA 3C94A 3QEWA 4F8RA 3SUPA 3PO4A 3PX0A 3CM5A 4DU1A 4FJXA 3V9UA 4QAGA 1QTMA 4CK1A 4HUEA 1IKXA 1W0HA 1SL1A 4CHOA 3RR7A 5J2MA 3TARA 4N5SA 1KLMA 2O4GA 2G8KA 4KAZA 3C95A 3QLHA 2HHSA 2X78A 4HUGA 3QO9A 3V4IA 4ELUA 2XY7A 4KB0A 5EU7A 1RNHA 1RT5A 1I3AA 4IBNA 1ASWA 3AVMA 4H4OA 4BDYA 3U3YA 1QHTA 1QS4A 3RR8A 4OLBA 2GBZA 2E4LA 2QKKA 3NF7A 4FCYA 1TK5A 4CECA 3SNNA 4FJKA 4FJ5A 5JS1A 3SUNA 1RT7A 4M3ZA 2FBTA 3K5MA 4O5BA 3AO5A 3OS0A 4N56A 3IRXA 1EX4A 1XHXA 3CG7A 3ZT4A 3I8DA 2HHUA 4DSLA 1IO2A 4BE0A 3EYZA 3O4QA 4B3OA 3MXJA 1BI4B 1VSFA 2YKMA 2W42A 2QXFA 2Y1IA 1NOYA 1RTDA 3B6OA 3H08A 3VA3A 4CJUA 3MXIA 4QOZB 5E41A 1SL0A 1WSHA 3ISNC 4I2PA 5CYMA 3S3OA 2YKNA 3TWHA 4DQRA 3TABA 4DTRA 3U3GA 3SV3A 2G8FA 4OGEA 4E7LA 4BDZA 1REVA 4Y1DA 4CFDA 4JRPA 4FJHA 2A1SA 3C6TA 3NBPA 1UOCA 2KZMA 3EZ5A 3U6FA 4LY7A 3V1OA 2QKBA 4CFCA 1KLNA 1ITGA 4ELTA 3G10A 4ZTJA 1J5OA 4FK2A 4CEBA 3V1QA 1BL3A 1ZBLA 1B92A 3HL8A 1KRPA 4HVJA 2ETJA 3NF8A 5CYQA 3OYAA 3TAPA 3FFIA 3OY9A 1YTUA 3DM2A 1QSSA 2ZQBA 1TKZA 4GVMA 1S1TA 4CJ3A 4FJ7A 1RBSA 3WNFA 1KVBA 3OS1A 4KHNA 1WAFA 1LAVA 4I7FA 3NF6A 3VQCA 3DYAA 4G1QA 3PV8A 4C8NA 3TAMA 4Z4EA 4C8LA 3LAMA 3NH0A 4W5QA 4JRQA 1CZ9A 3BDPA 4CJVA 3S3NA 3HPOA 3RRGA 2IS3A 3DRRA 3QNNA 4EZ9A 1HQUA 2XRIA 4B9MA 1Q9YA 1WN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KFB A;  4CJL A;  1N6Q A;  3NCI A;  1XWL A;  4KRE A;  2P5O A;  3LZI A;  3NGZ A;  3DRS A;  5JS2 A;  4O4G A;  3AO2 A;  2RPI A;  3ZSY A;  4CGI A;  4XIU A;  4O55 A;  1S6P A;  1TK0 A;  1TKD A;  1LW0 A;  1RBU A;  4E1N A;  1EKE A;  4ZTF A;  4F2R A;  3JSM A;  4NCB A;  3KLF A;  3WNG A;  2ATQ A;  3D45 A;  3K58 A;  3V81 A;  1GOB A;  1HYS A;  4PUO A;  4C8M A;  1Q9X A;  2OPP A;  4CGH A;  3OYJ A;  2HVH A;  1C0U A;  1JLE A;  1HNV A;  4LH5 A;  4B8C A;  2VG6 A;  4FW1 A;  5HRO A;  4RW9 A;  4CHP A;  5J2Q A;  5I42 A;  1B9F A;  1L5U A;  3OYN A;  3ZSZ A;  4AHC A;  2G8W A;  3OYL A;  2HNZ A;  3ZSO A;  1JLC A;  3SUQ A;  5CZ2 A;  4IG0 A;  4CFB A;  4KHU A;  1RT6 A;  4OLA A;  3OYH A;  3QEP A;  4DF4 A;  4KV8 A;  1IH7 A;  2IOC A;  3AO3 A;  1TL3 A;  3V1R A;  3PUF A;  3VQD A;  4AHV A;  4EP5 A;  3OYE A;  1JXB A;  3NGI A;  3TAN A;  5KRS A;  4DTO A;  4CE9 A;  2HVI A;  1JKH A;  3KK2 A;  1VSH A;  2Z1G A;  5J2N A;  3HP9 A;  4DTM A;  1LAW A;  2JGU A;  2YNI A;  3AVJ A;  3K5N A;  1IKW A;  5D3G A;  4J2A A;  5K14 A;  4AHU A;  1S9E A;  4TSX A;  2X6N A;  3KIO A;  3KKS A;  4CF1 A;  5HRS A;  5T7B A;  3DLE A;  3V9Z A;  4CEQ A;  1NK5 A;  3OYB A;  2KTQ A;  3ZCM A;  1HPZ A;  4CGG A;  3AVK A;  1ASU A;  4KTQ A;  3DLK A;  3HM9 A;  4FLU A;  2YNG A;  1BCO A;  4BAC A;  4M45 A;  3NH1 A;  4FLT A;  3I0R A;  3LP2 A;  3AVL A;  1Y97 A;  3V9S A;  3KKR A;  1DTQ A;  1RDA A;  1D5A A;  1I39 A;  1S1X A;  1Z25 A;  4BE2 A;  3SQ4 A;  1MU2 A;  1WNS A;  2OPR A;  2VG7 A;  3S3M A;  3DLR A;  4F2S A;  4RW4 A;  1WAJ A;  4FM1 A;  1N5Y A;  4NYN A;  4FLY A;  3LPU A;  4M3T A;  2P1J A;  1WLJ A;  4BE1 A;  2OZS A;  4HCC A;  4FZX C;  2FC0 A;  3P1G A;  1BIU A;  3PX6 A;  3VQ7 A;  2DFF A;  4IDK A;  5HRN A;  3L3V A;  3VQ8 A;  4DTJ A;  1KFS A;  1TV6 A;  2KQ2 A;  4B8A B;  3TAQ A;  1D8Y A;  4FJL A;  2KFZ A;  4E0D A;  1S5J A;  1T05 A;  1LV5 A;  2OPS A;  5SWM A;  1KCF A;  4E7K A;  5DMR A;  2I5J A;  1U45 A;  3L2W A;  3VQQ A;  2OPQ A;  4E19 A;  3L3U A;  2D0B A;  3DOL A;  4CJQ A;  3SPY A;  1NK0 A;  1SKR A;  3AA5 X;  1ZBH A;  3LP0 A;  4CJS A;  1NJW A;  2HHQ A;  1VSI A;  3SPZ A;  4DTX A;  2HHT A;  1JLA A;  3O3H A;  5KGW A;  1RDB A;  1RIL A;  1LWC A;  4CJK A;  4DQP A;  4CHZ A;  3BGR A;  3K5O A;  1C1A A;  4FM2 A;  3QET A;  1U4B A;  1EET A;  4OVL A;  2HND A;  3HVT A;  4DLE A;  3TR8 A;  4DTU A;  4N76 A;  5J2P A;  4QCL A;  3MEG A;  3KLH A;  1SKS A;  4K8Z A;  1Q8I A;  4E7J A;  3MXM A;  4OPK A;  1SKW A;  1QSL A;  4RG8 A;  3ALY A;  4EP4 A;  3DLH A;  4PA1 A;  5HBM A;  3L2Q A;  2IDO A;  3TI0 A;  1S9G A;  1VK0 A;  2AJQ A;  5C24 A;  4DQQ A;  2XY5 A;  1FKP A;  1RT3 A;  2B5J A;  4FM0 A;  3CQ8 A;  1S1W A;  3NHG A;  4KTZ A;  4IFV A;  4KHS A;  2B6A A;  4ICL A;  2VG5 A;  3DRP A;  1TVR A;  1RTH A;  4B9S A;  2KZZ A;  4DSE A;  1JL1 A;  1HQE A;  3M8P A;  4H4M A;  3AA3 A;  2IGI A;  4ID5 A;  1BI4 A;  3MEC A;  4OGC A;  3KD5 E;  3KK3 A;  1EXQ A;  2YHB A;  4FXD A;  4CHN A;  4DS4 A;  3O3G A;  1BQM A;  3UIQ A;  3ZSX A;  4Z4F A;  4AHT A;  3L2V A;  2KFN A;  3ASM A;  1ZBU A;  2HHX A;  2RKI A;  1RDD A;  4CIG A;  1C1B A;  5KGX A;  4O0I A;  3HT3 A;  4DQS A;  4DU4 A;  4N41 A;  1NKE A;  1JLB A;  1DLO A;  1WSG A;  1L3S A;  5CY4 A;  3SZ2 A;  5CZ1 A;  1C0T A;  1RT1 A;  3M8S A;  2HMI A;  3QEI A;  3LZJ A;  4M3X A;  4WE1 A;  1ASV A;  1CXU A;  2F8T A;  4CF9 A;  4J2B A;  3AO4 A;  3OJS A;  3AV9 A;  3HPH A;  1SV5 A;  5FRO A;  1UAX A;  3CFP A;  4J2E A;  2OA8 A;  2D5R A;  1FXX A;  2E6M A;  2PZS A;  1HMV A;  4FZZ A;  4CK3 A;  4B08 A;  5HRR A;  1LWE A;  4Q5V A;  5FDL A;  4CGF A;  4CEE A;  2XO7 A;  3RMA A;  3KLE A;  3MED A;  1X9M A;  1TK8 A;  3ULD A;  4RW6 A;  3SCX A;  4DSK A;  4DTP A;  3QIN A;  5FRN A;  4CK2 A;  4DFJ A;  3PO5 A;  4ZHR A;  1T03 A;  3T3F A;  3OS2 A;  4DFM A;  1WSE A;  4E1M A;  2HHW A;  4CHY A;  1SUQ A;  4FLX A;  3LAL A;  4KB1 A;  2F96 A;  4LSL A;  3K2P A;  1YTA A;  1RT2 A;  2EHG A;  2GV9 A;  1RTJ A;  4O0J A;  4FLW A;  4MQ3 A;  3LP3 A;  3LPT A;  3LDS A;  3QER A;  3SI6 A;  4CIF A;  1NK8 A;  1A5W A;  3OYG A;  4DTS A;  5C42 A;  2XY6 A;  2PY5 A;  2PYJ A;  3VQA A;  3AVA A;  1HJR A;  4YFU A;  1R0A A;  1L3U A;  4M3Y A;  2A1R A;  2RN2 A;  2DFE A;  3CM6 A;  1UA1 A;  1UWB A;  4AHR A;  1QQC A;  1FK9 A;  2BE2 A;  4CEA A;  1JLG A;  3HST B;  1C6V A;  1BHL A;  3ZSQ A;  4IKF A;  4M42 A;  4CFA A;  2R7Y A;  4MFB A;  3SQ0 A;  1ZYQ A;  1C0M A;  3CFR A;  1JXE A;  2YNF A;  4HHT A;  2O4I A;  2DTU A;  4W5N A;  3ZT2 A;  4FYD A;  3QEV A;  4KTW A;  1DTT A;  3EY1 A;  3SJJ A;  2NUB A;  4N47 A;  3ZT3 A;  4CJR A;  4FJI A;  3HJF A;  3LWM A;  4Z4C A;  1VRU A;  2DFH A;  4FVM A;  4JS4 A;  3SYZ A;  3KD1 E;  3QIP A;  1G15 A;  3DLG A;  1L3T A;  1S6Q A;  1TL1 A;  3LAK A;  3T19 A;  4O44 A;  4DQI A;  4PQU A;  1RT4 A;  3QIO A;  1EP4 A;  5KTQ A;  1BQN A;  3RRH A;  4F3O A;  1WSI A;  1KSP A;  4E7H A;  3JYT A;  4CGD A;  4Z4I A;  2LSN A;  3S9H A;  3ITH A;  4FW2 A;  1HYZ A;  1GOC A;  4DG1 A;  3G0Z A;  1A5V A;  1LW2 A;  4FJJ A;  4LSN A;  3HYF A;  3NAE A;  3NGY A;  2DY4 A;  4DTN A;  1X9S A;  4DWI A;  3PX4 A;  3K5L A;  1U48 A;  2F8S A;  1LWF A;  1X1P A;  3AVG A;  2P5G A;  1ZBI A;  3IAY A;  4B9T A;  4DS5 A;  2BDP A;  4B9U A;  1IG9 A;  2HW3 A;  3VQ5 A;  4FK0 A;  4UQG A;  4KI6 A;  3DOK A;  4OKK A;  3RMC A;  4B9N A;  1J54 A;  4M3U A;  4KRF A;  3OYI A;  4CEF A;  2G8I A;  4ID1 A;  2ITG A;  3TAG A;  2RF2 A;  2QK9 A;  1W9H A;  3DMJ A;  3KK1 A;  1NKB A;  2P51 A;  2X6S A;  3DI6 A;  3LP1 A;  1GOA A;  3ZSR A;  3OYK A;  2Z1H A;  3HP6 A;  3HVR A;  1T8E A;  1TKX A;  4R5P A;  2G8V A;  1KVA A;  3QEX A;  3VQB A;  3NH2 A;  4DF8 A;  4CF0 A;  4CHQ A;  1KFD A;  3AVB A;  2VWJ A;  3AVN A;  3RTV A;  2WON A;  4KHY A;  3WNH A;  3VQ9 A;  3D0P A;  4Z4H A;  1QSY A;  3OYF A;  1TAU A;  4DSI A;  4FJ8 A;  1XHZ A;  3AVF A;  4IFY A;  4DMN A;  1RCH A;  2YNH A;  2G8U A;  4L8R B;  2WOM A;  3KLG A;  3AO1 A;  3CYM A;  2ZE2 A;  4KHQ A;  2OYQ A;  1BCM A;  1JL2 A;  3E01 A;  2HNY A;  4FJN A;  3F73 A;  1B9D A;  2HB5 A;  4KO0 A;  3IS9 A;  3ZSV A;  3PY8 A;  2PYL A;  1YVU A;  2IAJ A;  1KTQ A;  2X74 A;  2Z1J A;  3ZSW A;  3HXM A;  4FJ9 A;  1F21 A;  3SQ2 A;  4C8K A;  4H8K A;  1CZB A;  1T7P A;  4W5O A;  4Y1C A;  3V6D A;  1NJY A;  3B6P A;  4OKJ A;  4CEZ A;  3OJU A;  4DU3 A;  2OZM A;  1TKT A;  1S1V A;  3OYD A;  3L8B A;  3HK2 A;  4CCH A;  4GW6 A;  3VA0 A;  3AA4 A;  4FLV A;  5KRT A;  4KI4 A;  4CJF A;  3TAE A;  4CJ5 A;  2Y1J A;  3SQ1 A;  3LWL A;  3MAQ A;  1BGX T;  1WSF A;  2B4J A;  1IKY A;  4JLH A;  5C25 A;  1VSD A;  4LH4 A;  1NK9 A;  3HPG A;  3KTQ A;  4B9V A;  1ZBF A;  3M8R A;  4W5T A;  3QES A;  4F3T A;  4AHS A;  4RW8 A;  3NFA A;  4CER A;  4YNQ A;  4E7I A;  4OPJ A;  1CLQ A;  3O3F A;  3VQE A;  3OYC A;  1UA0 A;  1J9A A;  1JLQ A;  1QE1 A;  4FLZ A;  3CFO A;  4I9Q A;  4KHW A;  4I9L A;  3AVI A;  3VQ4 A;  1C1C A;  5I3U A;  3O4N A;  4BWM A;  1TAQ A;  3MEE A;  2BGG A;  4DFP A;  1VSM A;  2YV0 X;  1U47 A;  2FBV A;  1D9F A;  5DK5 A;  1U49 A;  4PWD A;  2D0C A;  2IC3 A;  2EX3 A;  2BAN A;  4IG3 A;  3L2U A;  2G8H A;  3A2F A;  3K59 A;  4CJ4 A;  4Z4G A;  4M3W A;  4CEO A;  1HRH A;  4B9L A;  1L3V A;  1A5X A;  3AA2 A;  4Q0B A;  1XI1 A;  5J1E A;  3OVN A;  4BDP A;  4RW7 A;  1BIZ A;  3QNO A;  3VQP A;  4ELV A;  2HHV A;  2FBY A;  4F4K A;  1BIS A;  4CJE A;  5SZT A;  3THV A;  4E89 A;  1NK4 A;  3KLI A;  4CJP A;  1RTI A;  3HO1 A;  2YHA A;  1CXQ A;  1TGO A;  1NK7 A;  2VWK A;  1HYV A;  4CES A;  3TAF A;  5HP1 A;  1VRT A;  3P83 D;  4NCG A;  1J53 A;  3KJV A;  4C8O A;  2FBX A;  1U04 A;  3SUO A;  4FJM A;  1JLF A;  2D0A A;  4DSF A;  1RBT A;  3I0S A;  4OKE A;  3C6U A;  2KW4 A;  3T1A A;  4GMJ B;  4AIL C;  4KKO A;  3F9K A;  3LAN A;  1D9D A;  4NYF A;  1NJX A;  2ZD1 A;  3RWU A;  3K57 A;  5KI6 A;  1RBV A;  3NF9 A;  4FZY A;  2GUI A;  3V9X A;  2XHB A;  4LD0 A;  4M41 A;  3ZT1 A;  4CF2 A;  4HUF A;  3V9W A;  4M3R A;  4AH9 A;  1XC9 A;  3DLB A;  3NDK A;  2Q3S A;  3NE6 A;  3IG1 A;  5FRM A;  3L2R A;  4I2Q A;  1VSL A;  4PY5 A;  1S1U A;  4CF8 A;  3RMB A;  4FK4 A;  4Z0U A;  1VSJ A;  1YT3 A;  1FKO A;  3VN5 A;  1NJZ A;  1X9W A;  4DSJ A;  2XY8 A;  4OJR A;  3WNE A;  4K8X A;  2E6L A;  3M8Q A;  4W5R A;  1VSE A;  4HCB A;  2Z1I A;  3AVH A;  1IKV A;  3ZT0 A;  4KPY A;  5HRP A;  4HTU A;  4CED A;  4DLG A;  1NOZ A;  1KVC A;  4BWJ A;  1SL2 A;  1NK6 A;  3SV4 A;  1HNI A;  4J2D A;  4NCA A;  4EZ6 A;  4DFK A;  1K6Y A;  1VSK A;  3VQ6 A;  1WSJ A;  4CIE A;  1O1W A;  4E3S A;  1Z26 A;  3RMD A;  5HLF A;  1NKC A;  1RDC A;  4JS5 A;  1RBR A;  2JLE A;  3AVC A;  4FJG A;  4CJT A;  3OYM A;  3P5J A;  4CGJ A;  4CJW A;  3C94 A;  3QEW A;  4F8R A;  3SUP A;  3PO4 A;  3PX0 A;  3CM5 A;  4DU1 A;  4FJX A;  3V9U A;  4QAG A;  1QTM A;  4CK1 A;  4HUE A;  1IKX A;  1W0H A;  1SL1 A;  4CHO A;  3RR7 A;  5J2M A;  3TAR A;  4N5S A;  1KLM A;  2O4G A;  2G8K A;  4KAZ A;  3C95 A;  3QLH A;  2HHS A;  2X78 A;  4HUG A;  3QO9 A;  3V4I A;  4ELU A;  2XY7 A;  4KB0 A;  5EU7 A;  1RNH A;  1RT5 A;  1I3A A;  4IBN A;  1ASW A;  3AVM A;  4H4O A;  4BDY A;  3U3Y A;  1QHT A;  1QS4 A;  3RR8 A;  4OLB A;  2GBZ A;  2E4L A;  2QKK A;  3NF7 A;  4FCY A;  1TK5 A;  4CEC A;  3SNN A;  4FJK A;  4FJ5 A;  5JS1 A;  3SUN A;  1RT7 A;  4M3Z A;  2FBT A;  3K5M A;  4O5B A;  3AO5 A;  3OS0 A;  4N56 A;  3IRX A;  1EX4 A;  1XHX A;  3CG7 A;  3ZT4 A;  3I8D A;  2HHU A;  4DSL A;  1IO2 A;  4BE0 A;  3EYZ A;  3O4Q A;  4B3O A;  3MXJ A;  1BI4 B;  1VSF A;  2YKM A;  2W42 A;  2QXF A;  2Y1I A;  1NOY A;  1RTD A;  3B6O A;  3H08 A;  3VA3 A;  4CJU A;  3MXI A;  4QOZ B;  5E41 A;  1SL0 A;  1WSH A;  3ISN C;  4I2P A;  5CYM A;  3S3O A;  2YKN A;  3TWH A;  4DQR A;  3TAB A;  4DTR A;  3U3G A;  3SV3 A;  2G8F A;  4OGE A;  4E7L A;  4BDZ A;  1REV A;  4Y1D A;  4CFD A;  4JRP A;  4FJH A;  2A1S A;  3C6T A;  3NBP A;  1UOC A;  2KZM A;  3EZ5 A;  3U6F A;  4LY7 A;  3V1O A;  2QKB A;  4CFC A;  1KLN A;  1ITG A;  4ELT A;  3G10 A;  4ZTJ A;  1J5O A;  4FK2 A;  4CEB A;  3V1Q A;  1BL3 A;  1ZBL A;  1B92 A;  3HL8 A;  1KRP A;  4HVJ A;  2ETJ A;  3NF8 A;  5CYQ A;  3OYA A;  3TAP A;  3FFI A;  3OY9 A;  1YTU A;  3DM2 A;  1QSS A;  2ZQB A;  1TKZ A;  4GVM A;  1S1T A;  4CJ3 A;  4FJ7 A;  1RBS A;  3WNF A;  1KVB A;  3OS1 A;  4KHN A;  1WAF A;  1LAV A;  4I7F A;  3NF6 A;  3VQC A;  3DYA A;  4G1Q A;  3PV8 A;  4C8N A;  3TAM A;  4Z4E A;  4C8L A;  3LAM A;  3NH0 A;  4W5Q A;  4JRQ A;  1CZ9 A;  3BDP A;  4CJV A;  3S3N A;  3HPO A;  3RRG A;  2IS3 A;  3DRR A;  3QNN A;  4EZ9 A;  1HQU A;  2XRI A;  4B9M A;  1Q9Y A;  1WN7 A; 
#chains in the Genus database with same CATH topology
 3NCI A;  4KRE A;  3LZI A;  1JJ2 M;  5AJ3 K;  4BVO A;  5JS2 A;  3GG4 A;  3ZSY A;  2RPI A;  3CCM N;  1EKE A;  4F2R A;  4NCB A;  5DM7 L;  3WNG A;  4LC9 B;  2QWQ A;  1GOB A;  3OBW A;  4CGH A;  3OYJ A;  2WFB A;  2HVH A;  3PSF A;  2AA4 A;  4RW9 A;  4CHP A;  5JLH A;  5J2Q A;  5I42 A;  3Q7B A;  1NGD A;  1BOT O;  4AHC A;  3OYL A;  2HNZ A;  4CFB A;  2J4R A;  3QEP A;  1GLA G;  4KV8 A;  3QIC A;  3V1R A;  1NK4 A;  1ILY A;  5KRS A;  1E3M A;  2HHH K;  3LDL A;  5M1Q A;  1HR0 K;  4M7X A;  3C6H A;  3MCA B;  2YJF A;  2O8F B;  5JVG L;  1VQP N;  1S9E A;  2X6N A;  2O8D A;  3DLE A;  3TU5 A;  3F2K A;  3ZCM A;  1KC8 O;  4CGG A;  3E9L A;  4FLU A;  2GEM A;  1BCO A;  2P9S A;  4BAC A;  1ATR A;  3AVL A;  3PIP L;  3KKR A;  3CMA N;  1S1X A;  4BE2 A;  1NGC A;  2VWB A;  1WNS A;  4JKG B;  1QVF M;  3DLR A;  4F2S A;  2A3Z A;  4RW4 A;  2OZS A;  4BE1 A;  4FZX C;  4YOW A;  3KWG A;  5AQZ A;  2KQ2 A;  3TAQ A;  1K8K B;  1VQ4 N;  2KFZ A;  4E0D A;  3CJA A;  2ITM A;  1BWF O;  5DMR A;  1U45 A;  4E19 A;  3L3U A;  2O8C A;  4CJQ A;  3SPY A;  1ZBH A;  3QFP A;  4X65 K;  3A5M C;  1VSI A;  3SPZ A;  2HHT A;  1JLA A;  3O3H A;  4CJK A;  2CH5 A;  4IFE A;  3K5O A;  3CIP A;  4XEI A;  1U4B A;  4H5T A;  2W6L A;  3ZX0 A;  3O1W A;  1Q8I A;  1SKW A;  4RG8 A;  1XNQ K;  4PKG A;  5DM6 L;  4EP4 A;  1Y64 A;  3ZEU B;  4GVE A;  1VQ8 N;  2AJQ A;  3VTH A;  1RDU A;  4FM0 A;  2A6A A;  3CQ8 A;  4BRN A;  2QWN A;  4IFV A;  2B6A A;  3K9J A;  3DRP A;  1RTH A;  4DV3 K;  4B9S A;  3TTF A;  3MN5 A;  2UXB K;  3VOV A;  4DSE A;  3WXM B;  4H4M A;  4ID5 A;  3LM9 A;  4LF6 K;  5AQL A;  2IVO A;  2YHB A;  3I55 N;  2P9L A;  3UIQ A;  2KFN A;  2RKI A;  2OTJ N;  4O0I A;  4N41 A;  1NKE A;  3VEN A;  1JLB A;  3VGM A;  3WXJ A;  3ZLJ A;  3S41 A;  3W3D A;  1N8R O;  1C0T A;  2FF3 B;  1SAZ A;  3LM2 A;  2DPN A;  5FRO A;  5AQV A;  2D5R A;  1FXX A;  2E6M A;  4BR9 A;  4CK3 A;  4B08 A;  2UU9 K;  1C0F A;  2QI2 A;  4BC3 A;  2NRX A;  4CEE A;  2XO7 A;  3MED A;  1V4T A;  3SCX A;  4ZHR A;  4BG9 A;  3OS2 A;  4DFM A;  1WUA A;  1TUY A;  3LAL A;  3ULE B;  4LSL A;  4A61 A;  5KQ8 A;  1YTA A;  4FLW A;  4MQ3 A;  3LDS A;  4CIF A;  2XY6 A;  4YFU A;  1L3U A;  3CME N;  5AZI B;  2E1Z A;  4BR5 A;  3I8B A;  2NRR A;  2HOE A;  5AQF A;  3I33 A;  4IKF A;  2HBK A;  4CFA A;  2R7Y A;  1C0M A;  3CFR A;  4KHP K;  4B3S K;  4KTW A;  1DTT A;  4A2A A;  3U4L A;  4BR4 A;  3ZT3 A;  4U7B A;  3MX2 A;  4J8F A;  4DUY K;  4JI7 K;  1NBW A;  4YOT A;  1S6Q A;  4PQU A;  4C23 A;  3QIO A;  1EP4 A;  3RRH A;  1KSP A;  2F7T A;  4FWL A;  3S9H A;  4FW2 A;  1WOQ A;  5EX5 A;  3G0Z A;  1DGK N;  2E1Y A;  4DTN A;  1X9S A;  2F8S A;  1U48 A;  1X1P A;  3CC2 N;  3SAH A;  4JN4 A;  4DS5 A;  2BDP A;  3VQ5 A;  4KI6 A;  2W41 A;  4KRF A;  4NLC A;  2NRT A;  4BRK A;  3TAG A;  2E5L K;  4MDB A;  1W9H A;  3DMJ A;  4YOR A;  2P51 A;  4FZY A;  3LP1 A;  1GOA A;  1T8E A;  2G8V A;  4R5P A;  2HBL A;  3AAP A;  1KVA A;  1K73 O;  4CF0 A;  3E9P A;  2WON A;  3MX5 A;  1ATS A;  2FSJ A;  4Z4H A;  4DSI A;  4ISF A;  4DMN A;  4JK7 A;  2ZE2 A;  3R8E A;  1BCM A;  2HNY A;  4BRQ A;  4AM7 A;  1B9D A;  1NMN A;  2HB5 A;  4KO0 A;  3CJ1 A;  5BN8 A;  2IAJ A;  3VEZ A;  2Z1J A;  4FJ9 A;  1F21 A;  3SQ2 A;  1T7P A;  4Y1C A;  4CEZ A;  4DU3 A;  3N4P A;  4CCH A;  2ZF5 O;  5KQD A;  2UUB K;  5LY3 A;  4DB3 A;  3TAE A;  3LDQ A;  4CJ5 A;  4O5F A;  5GAG P;  3CJ9 A;  2B4J A;  4JLH A;  5AQU A;  1HLU A;  5C25 A;  1NGA A;  4W5T A;  3QES A;  4AHS A;  3ZX3 A;  4OPJ A;  4B9Q A;  1UA0 A;  4AM6 A;  4FLZ A;  4I9Q A;  2I7N A;  2HMP A;  3ATV A;  3VQ4 A;  5C12 A;  3FLC O;  4K0K K;  3CPE A;  4H5R A;  3MWP A;  2FBV A;  1U49 A;  2BAN A;  4CZE A;  3FR0 A;  3O1B A;  4CEO A;  1HRH A;  1MWK A;  1XI1 A;  2O8D B;  3GL1 A;  3OVN A;  4BDP A;  5CE3 A;  4RW7 A;  3QNO A;  3ZX2 A;  4ELV A;  3KK7 A;  4CJE A;  5IWA K;  3THV A;  4E89 A;  3TSQ A;  1RTI A;  2YHA A;  1TGO A;  3NVM A;  2VWK A;  1HYV A;  1NK7 A;  2P9S B;  4BRG A;  3P83 D;  4DR1 K;  4BRI A;  1JLF A;  4BG8 A;  3VET A;  3C6U A;  4KKO A;  3AGK A;  5GAH P;  4BC2 A;  1VQK N;  3K57 A;  2HBJ A;  2QWP A;  1EWQ A;  3MN7 A;  3EKS A;  4JKB A;  3CCS N;  3ZT1 A;  3WQT A;  3RMB A;  4DV1 K;  3VN5 A;  1X9W A;  4DSJ A;  3IUC A;  4OJR A;  2E6L A;  4W5R A;  3DJC A;  4PKH A;  2Z1I A;  3FZF A;  4NXM K;  1IKV A;  3SAG A;  4NCA A;  2O8C B;  3OHR A;  4DFK A;  3TSU A;  3VQ6 A;  4EZ6 A;  4EHT A;  4JS5 A;  1XMQ K;  1RBR A;  4EIA A;  4CGJ A;  4CJW A;  3C94 A;  3QEW A;  4F8R A;  3DXK A;  3SUP A;  4YHH K;  2QW9 A;  5CR4 A;  4N5S A;  1KLM A;  2NRV A;  2KLA A;  1T6D A;  3C95 A;  5LJW A;  2HHS A;  4HUG A;  2A40 A;  4JEP A;  3V4I A;  4DCH A;  4IBN A;  1ESV A;  4CJ7 A;  3U3Y A;  1QS4 A;  1SS6 A;  2GBZ A;  1N33 K;  3NF7 A;  2V52 B;  1TK5 A;  4CEC A;  3SNN A;  2HF4 A;  1OH7 A;  3K5M A;  4FOE A;  4DTP A;  1IBK K;  1NWK A;  1XHX A;  4FWO A;  2CGL A;  4B3O A;  1XNR K;  3D7E O;  1VHX A;  3M1F A;  1NOY A;  3B6O A;  3GOI A;  2P9L B;  3QML A;  4DQR A;  4H0Y B;  3TAB A;  4E7L A;  1REV A;  4JRP A;  3O5B A;  4FJH A;  3NBP A;  3U6F A;  4LY7 A;  5LMU K;  1KLN A;  1IJJ A;  3G10 A;  3O80 A;  4OO1 J;  2ETJ A;  3N4Q A;  3A5O C;  3DM2 A;  2ZQB A;  1TKZ A;  4FJ7 A;  2FLO A;  1RBS A;  1Z05 A;  4C8N A;  3TAM A;  4Z4E A;  2A5X A;  4CZL A;  1BO5 O;  1H1V A;  3NH0 A;  4W5Q A;  1YI2 N;  1I94 K;  3HPO A;  3RRG A;  4GNI A;  3RSE A;  2XRI A;  4B9M A;  2HHX A;  1WN7 A;  4KFB A;  2P5O A;  4B3T K;  4JI8 K;  4BC4 A;  4QS7 A;  1TKD A;  4CGI A;  1TK0 A;  5AQT A;  3R3L A;  3BZK A;  3DAW A;  2NNW A;  5AQW A;  3HTV A;  4PUO A;  4DR4 K;  5KPT A;  3PSI A;  1JLE A;  4LH5 A;  2VG6 A;  3HZ6 A;  4IOX A;  3EE8 A;  5AQJ A;  1L5U A;  1KAX A;  3OYN A;  1KAY A;  2G8W A;  4IG0 A;  1RT6 A;  3OYH A;  3OYE A;  3TAN A;  2UXD K;  2HVI A;  4IOA L;  2Z1G A;  3FZK A;  2JGU A;  2QWR A;  3K5N A;  1IKW A;  5D3G A;  3CF5 L;  3V9Z A;  4CEQ A;  5AQS A;  3H1Q A;  4FWS A;  1NK5 A;  1T44 A;  1ASU A;  3DLK A;  3HM9 A;  3CCU N;  4FLT A;  4LF4 K;  2F9W A;  1Y97 A;  3V9S A;  4H0T B;  2UYT A;  1Z25 A;  1MU2 A;  2QWL A;  1NMD A;  2VG7 A;  5GIN A;  1WAJ A;  4PHT X;  1N5Y A;  4FLY A;  4HCC A;  1DT9 A;  3PX6 A;  3VQ7 A;  4IDK A;  3EE9 A;  3L3V A;  3QDK A;  3ENO A;  3FZH A;  3LDN A;  4B8A B;  4BQZ A;  3CCJ N;  2ZWH A;  1NJI O;  3TTC A;  4G9Z A;  1LV5 A;  5B8H A;  1GLD G;  4JK8 A;  4E7K A;  2YHY A;  4GV6 A;  2I5J A;  3ZYY X;  3K9K A;  1NK0 A;  2OPQ A;  4IZ9 A;  2D0B A;  3DOL A;  3LP0 A;  5F1X A;  1NJW A;  2HHQ A;  1Q82 O;  3P39 A;  2HST A;  1LWC A;  4DQP A;  5HL7 L;  3U9Z A;  1NM1 A;  4N76 A;  2HND A;  3HVT A;  4DR6 K;  3FZL A;  4E7J A;  1QSL A;  3ALY A;  4PA1 A;  5HBM A;  4RCH A;  3L2Q A;  2IDO A;  2FSN A;  1S9G A;  5AQP A;  2XY5 A;  1FKP A;  1RT3 A;  1YJN N;  3NHG A;  3QB0 A;  4KTZ A;  4KHS A;  4DKW A;  2VG5 A;  4IWV A;  1TVR A;  4JI5 K;  4H5W A;  4WQ4 A;  5TKY A;  3BEX A;  1HQE A;  3CC7 N;  3AA3 A;  3KD5 E;  1EXQ A;  3MMV A;  3ZSX A;  4Z4F A;  4AHT A;  3L2V A;  3ASM A;  3P31 A;  4HTL A;  4IJA A;  3VF6 A;  4YOX A;  4CIG A;  5KGX A;  1HJO A;  5EOY A;  5CY4 A;  4LF8 K;  3QFU A;  5CZ1 A;  5ADX H;  2HMI A;  3QEI A;  3LZJ A;  4M3X A;  4WE1 A;  1ASV A;  4CF9 A;  1U6Z A;  4J2B A;  3AO4 A;  3OJS A;  3HPH A;  3CFP A;  3BF1 A;  4Q5V A;  3H6E A;  3MN9 A;  4B1W B;  1TK8 A;  4RW6 A;  3QIN A;  5FRN A;  3MN6 A;  4DFJ A;  3T3F A;  2Q97 A;  4CHY A;  1SUQ A;  3FFK B;  2F96 A;  3CET A;  4CZG A;  1RT2 A;  2GV9 A;  4JNE A;  1RTJ A;  1VQL N;  3SI6 A;  3LPT A;  2UXC K;  2PY5 A;  1YJ9 N;  3DLL L;  2E8A A;  1S72 N;  3AVA A;  3OA9 A;  2A1R A;  1UA1 A;  4AHR A;  1QQC A;  4DV2 K;  1YVN A;  1BHL A;  3ZSQ A;  1ZYQ A;  3H46 O;  2IVP A;  2DTU A;  3CI5 A;  1XQS C;  4BGB A;  3HJF A;  4FJI A;  4DHY A;  3LWM A;  5CHI A;  3DXK B;  1G99 A;  3G6E N;  3DLG A;  3T19 A;  5HOO A;  1RT4 A;  1FJG K;  3C0B A;  3IDH A;  5KTQ A;  4F3O A;  1WSI A;  5I9E B;  3VEW A;  4CGD A;  4Z4I A;  1J5E K;  3ITH A;  1GOC A;  5M1N A;  1NGE A;  1A5V A;  1C0G A;  4FJJ A;  1IG8 A;  4DWI A;  3K5L A;  2FSK A;  3VEV A;  1QQM A;  3AVG A;  2P5G A;  5BRE A;  3IAY A;  4CW7 B;  5AQR A;  3SBG A;  2HW3 A;  4UQG A;  3DOK A;  3RMC A;  4B9N A;  3OYI A;  4ID1 A;  2ITG A;  2RF2 A;  2QK9 A;  3A8Y A;  1VQO N;  1NKB A;  4BQL A;  1M90 O;  5AR0 A;  1TYQ A;  3HP6 A;  4JHD A;  1TKX A;  5M1F A;  3QEX A;  4CHQ A;  5KPR A;  2Q1N A;  3AVN A;  1HNW K;  3KVG A;  4JAX A;  3WNH A;  3VQ9 A;  3F9M A;  3OYF A;  1TAU A;  4FJ8 A;  3CJB A;  2YNH A;  4KHQ A;  5M1O A;  2OYQ A;  4FJN A;  2ZJR L;  1WB9 A;  3F73 A;  2CGJ A;  2D0P A;  3PY8 A;  3RSE B;  3ZSW A;  1OKJ A;  1CZB A;  5BN9 A;  3B6P A;  2OZM A;  1N34 K;  2VGM A;  5LJV A;  3KHY A;  2EWS A;  5AFU H;  1BU6 O;  3AA4 A;  5KRT A;  3HI0 A;  4ILH A;  5AQN A;  2ASM A;  4CJF A;  2Y1J A;  3LWL A;  3MAQ A;  1BGX T;  1WSF A;  2QEX N;  4DR2 K;  3DWL A;  1VQ6 N;  4BRP A;  1IKY A;  3HPG A;  3KTQ A;  4B9V A;  1ZBF A;  3M8R A;  1NU0 A;  4RW8 A;  1CLQ A;  3VQE A;  1J9A A;  1OH6 A;  3CFO A;  4BWM A;  3D2E A;  3WEE A;  5DK5 A;  2NZT A;  4PWD A;  2IC3 A;  3THX B;  4IG3 A;  3L2U A;  3A2F A;  4CJ4 A;  3O8M A;  4M3W A;  4I6M A;  3THW A;  4C1N K;  4B9L A;  2ZJQ L;  1L3V A;  3BY5 A;  4IEE A;  3T1H K;  1BIZ A;  2HHV A;  2FBY A;  3TPQ A;  1BIS A;  2E88 A;  2P9K A;  1ZC6 A;  2VQF K;  1VRT A;  1BA0 A;  1J53 A;  3KJV A;  4FJM A;  3I0S A;  2NRZ A;  5C0Y A;  2KHO A;  3CPW M;  2RHK A;  1NJX A;  4PKI A;  1KD1 O;  5KI6 A;  2QTD A;  2E2O A;  2E20 A;  3NF9 A;  2XHB A;  3V9W A;  4AH9 A;  4NLB A;  2WTU A;  1S1U A;  4Z0U A;  1YT3 A;  4NO7 A;  4YOU A;  1FW6 A;  1DKG D;  3EKU A;  2GEL A;  1VSE A;  1T6C A;  3ZT0 A;  2Q2R A;  5HRP A;  4HTU A;  4KPY A;  1SL2 A;  1KVC A;  1NK6 A;  3WXK A;  3SV4 A;  1VSK A;  3M6G A;  1WSJ A;  1NKC A;  1Z26 A;  4RWT A;  2JLE A;  1MA9 B;  3OYM A;  1HUX A;  1OH8 A;  4B1Y B;  3L4I A;  1CZA N;  4XH5 A;  4IXC A;  1YIJ N;  3PX0 A;  1VQ7 N;  3V9U A;  4QAG A;  4HUE A;  1W0H A;  1SL1 A;  2ZGZ A;  5J2M A;  3TAR A;  3J7Z O;  2G8K A;  5EVZ A;  4ELU A;  1HNX K;  1QHT A;  2PBD A;  4A57 A;  1X3M A;  4DV0 K;  3UKU A;  2FBT A;  4RTF D;  1EX4 A;  5AQY A;  3CJC A;  3I8D A;  1WBB A;  4BE0 A;  3U9D A;  4CD3 A;  3O4Q A;  3MXJ A;  2YKM A;  2W42 A;  2QXF A;  2Q36 A;  3VA3 A;  1M1K O;  3MXI A;  5E41 A;  4I2P A;  3S3O A;  2YKN A;  3TWH A;  3GE1 A;  4BDZ A;  4Y1D A;  2A1S A;  3P38 A;  2JWK A;  3V1O A;  2A42 A;  3IMX A;  3O9T A;  4FK2 A;  1BL3 A;  3SMS A;  3HL8 A;  4MLE A;  4HVJ A;  5CYQ A;  3MDQ A;  3NF8 A;  3TAP A;  3FFI A;  3OY9 A;  1YTU A;  3FE1 A;  1QSS A;  2QWO A;  4GVM A;  4CJ3 A;  1MDU B;  3H3O B;  3WNF A;  1KVB A;  3OS1 A;  1Q86 O;  1WAF A;  4DV7 K;  4I7F A;  3VMF B;  2H3G X;  2WUS A;  3LAM A;  2YCH A;  3G4S N;  3BDP A;  4CJV A;  3H3N O;  2V7Z A;  2YHW A;  3EZW A;  4LF7 K;  4XIU A;  3AO2 A;  1GLB G;  3LDP A;  1RBU A;  3NMU A;  1O13 A;  3K58 A;  4C8M A;  3IKM A;  4R79 A;  2OPP A;  1Q9X A;  2NRW A;  1Q81 O;  1C0U A;  1HNV A;  4B8C A;  4FW1 A;  3ZSZ A;  3LL3 A;  3SUQ A;  3ZSO A;  1JLC A;  1R59 O;  2QA4 N;  5LMN K;  3DXM A;  1U2V A;  4OLA A;  5JMV A;  2OAN A;  3O9S A;  3THY A;  5AQH A;  1D8Y A;  4AHV A;  5JIC A;  1JXB A;  3NGI A;  4H5V A;  3HP9 A;  3AVJ A;  1K9M O;  4YOV A;  3KIO A;  3KKS A;  4C1N I;  2GUP A;  3HOS A;  1LCU A;  3SMP A;  2KTQ A;  3TSP A;  1HPZ A;  3AVK A;  4KTQ A;  5FPD A;  2YNG A;  3LDO A;  3NH1 A;  3AAQ A;  5F2R A;  3I0R A;  5JVH L;  1D5A A;  1I39 A;  2OPR A;  1YXQ A;  3H1V X;  4B1U B;  2P1J A;  2P9I A;  4WCE L;  1QQN A;  3P1G A;  1BIU A;  2O8F A;  2DFF A;  5HRN A;  1TYQ B;  4JHD B;  4FJL A;  1NG9 A;  4BRC A;  3K0S A;  4CVN E;  1KCF A;  2VGN A;  2F4V K;  1JCF A;  2BTF A;  2AP1 A;  3VQQ A;  1YIT N;  2CGK A;  1P8Z A;  1SKR A;  1P90 A;  3AA5 X;  4CZI A;  4OPH A;  4CJS A;  3JAM O;  3J7A P;  4JI1 K;  4DTX A;  4HWI A;  1RIL A;  4CHZ A;  3BGR A;  4ILG B;  1C1A A;  4FM2 A;  3QET A;  1EET A;  4OVL A;  3M5R A;  4DLE A;  4DTU A;  5ADX A;  5J2P A;  4QCL A;  3KLH A;  1SKS A;  4K8Z A;  5BPM A;  5M1P A;  2FXU A;  1K8K A;  2I7P A;  1RGI A;  4IOC L;  5IT9 O;  4BR2 A;  4JD2 A;  4B1Z A;  1KXP A;  1JL1 A;  1Z6R A;  2IGI A;  1BI4 A;  4FXD A;  1W97 L;  3D2E B;  3WEE B;  1RDD A;  4GKK K;  3HT3 A;  1DLO A;  1WSG A;  3VTI A;  3THW B;  1L3S A;  2OTL N;  3M8S A;  4LF5 K;  1RT1 A;  1QVG M;  4FSV A;  2F8T A;  3AV9 A;  1UAX A;  2OA8 A;  5EXW A;  2PZS A;  2P9K B;  1IBM K;  3VF4 A;  5HRR A;  3CCV N;  4CGF A;  3KLE A;  1XMO K;  1X9M A;  3ULD A;  3ENB A;  4DSK A;  3J81 O;  1YJW N;  3PO5 A;  1S22 A;  2V51 B;  5KPZ A;  4A2B A;  3D6R A;  4KB1 A;  1E4F T;  2EHG A;  4O0J A;  1GLE G;  3LP3 A;  1A5W A;  3OYG A;  4Y0W A;  5C42 A;  5AQG A;  3VQA A;  1R0A A;  2RN2 A;  2DFE A;  3CM6 A;  1BA1 A;  1FK9 A;  4CEA A;  1S3X A;  3HST B;  3P4I A;  1C6V A;  4MFB A;  3SQ0 A;  2YNF A;  2O4I A;  3T69 A;  4HHT A;  4W5N A;  4FYD A;  3QEV A;  3HOT A;  4JI4 K;  2HF3 A;  4CZJ A;  3SJJ A;  2NUB A;  4Z4C A;  1VRU A;  1NLV A;  2DFH A;  4FVM A;  4BR0 A;  3HSC A;  3SYZ A;  1G15 A;  1TL1 A;  1HPM A;  4O44 A;  1BQN A;  4MO4 A;  3BP8 A;  3JYT A;  2LSN A;  3CC4 N;  3RVC A;  1HYZ A;  3O9U A;  4PL8 A;  3GDQ A;  3CQY A;  4JKE A;  4K43 A;  1LW2 A;  3HYF A;  2BH1 A;  1XUP O;  1Q9Y A;  4DR7 K;  3UKU B;  3NGY A;  2DY4 A;  2FF6 A;  3WT0 A;  3PX4 A;  3ID8 A;  4ILJ A;  4B9T A;  4B9U A;  2YHX A;  1IG9 A;  3EO3 A;  4OKK A;  2ZJP L;  5AFU A;  3SAF A;  1VQN N;  3O9R A;  3ID6 A;  3GBT A;  3KK1 A;  2X6S A;  3DI6 A;  3OYK A;  3ENH A;  3VQB A;  2Q0U A;  4DF8 A;  1KFD A;  3R9P A;  4DV4 K;  3PLA A;  3CD6 N;  4YDU A;  1HKC A;  4XH4 A;  3D0P A;  3KWI A;  1QSY A;  3AVF A;  2G8U A;  2WOM A;  3KLG A;  3AO1 A;  3CYM A;  2QWM A;  4MDA A;  2CH6 A;  1JL2 A;  3E01 A;  3ZSV A;  3IS9 A;  5AQK A;  2PYL A;  3CCL N;  1KTQ A;  1NGH A;  3AGR A;  4EHU A;  4H8K A;  4W5O A;  1NJY A;  4OKJ A;  3OJU A;  1TKT A;  1S1V A;  3L8B A;  3HK2 A;  3EEQ A;  4WFB L;  4FLV A;  4JI6 K;  4KI4 A;  3H45 C;  3SQ1 A;  4FO0 A;  4KH4 A;  1BDG A;  2Q0R A;  3CJ7 A;  3ZET A;  3O6W A;  4LH4 A;  5GAE P;  1NK9 A;  5C15 A;  3OTO K;  4JKC A;  3VGL A;  5H1S Q;  4E7I A;  4FOI A;  4FWR A;  3OYC A;  1JLQ A;  1QE1 A;  3CCR N;  2IIR A;  2PFU A;  1U2V B;  4X62 K;  3THY B;  3MEE A;  1LOT B;  5BPL A;  1QZ5 A;  1D9F A;  2YV0 X;  4FPB A;  1U47 A;  4JKF A;  1RFQ A;  3NVK A;  2EX3 A;  3K59 A;  4Z4G A;  3E1Y A;  1OH5 A;  1A5X A;  3AA2 A;  5J1E A;  4U67 L;  4CZM A;  3VQP A;  1JCE A;  4JV5 K;  3HO1 A;  3KLI A;  1CXQ A;  4CES A;  3TAF A;  4C8O A;  2FBX A;  1Q18 A;  3J8A A;  4ISG A;  4CD1 A;  3ATU A;  3F9K A;  4QS9 A;  3LAN A;  4H0P A;  2ZD1 A;  3RWU A;  5BRH A;  2GX9 A;  2GUI A;  3OW2 M;  2P9I B;  1XC9 A;  4M41 A;  3A5N C;  5AZJ A;  4CF2 A;  4HUF A;  1EWR A;  2Q3S A;  5GAD P;  3NE6 A;  3IG1 A;  4WYB A;  4I2Q A;  4DV5 K;  4PY5 A;  4FK4 A;  1VSJ A;  2UUA K;  4BR7 A;  4EFH A;  3WNE A;  4K8X A;  3M8Q A;  4FWQ A;  4HCB A;  3AVH A;  5TKW A;  4BWJ A;  1D4X A;  4J2D A;  3EL2 A;  1K6Y A;  4CIE A;  5HLF A;  3D2F A;  4FJG A;  4CJT A;  4EAH D;  1BUP A;  3A5L C;  3CM5 A;  3EN9 A;  4FJX A;  5E84 A;  4CK1 A;  3L0Q A;  2E2Q A;  4CHO A;  3C65 A;  5A2Q O;  2O4G A;  2YX6 A;  4JKD A;  2X78 A;  3QO9 A;  4O8U A;  3JXU A;  5EU7 A;  1RNH A;  1RT5 A;  2RE2 A;  1NGF A;  1ASW A;  4BDY A;  3RR8 A;  4A62 A;  2NLX A;  2VYP A;  2QKK A;  4WF9 L;  4FJK A;  2V7Y A;  4FJ5 A;  5JS1 A;  3OBY A;  1RT7 A;  4JD2 B;  4O5B A;  3AO5 A;  3OS0 A;  4N56 A;  2HHU A;  3VEY A;  4DSL A;  1IO2 A;  3Q7C A;  1BI4 B;  2Y1I A;  3QBX A;  4B1V A;  1RTD A;  2UUC K;  3VES A;  4KH5 A;  3C7N A;  1W7A A;  3ISN C;  2ZGY A;  5ELZ A;  5AQQ A;  2A41 A;  3SV3 A;  3A0I X;  4OGE A;  4CFD A;  5C2D A;  3C6T A;  1UOC A;  3E66 A;  5GIP A;  2KZM A;  3B8A X;  3EZ5 A;  4BY9 C;  2QKB A;  1ITG A;  5BRF A;  4ZTJ A;  1J5O A;  4CEB A;  3V1Q A;  1ZBL A;  4O8K A;  1KRP A;  3OYA A;  4BRF A;  1VQ9 N;  3CER A;  4BRM A;  4KHN A;  1LAV A;  3VQC A;  3R1X A;  4G1Q A;  1NGG A;  2P9U A;  1CZ9 A;  4JRQ A;  3S3N A;  3F5T A;  2IS3 A;  4YDU C;  1V4S A;  1QZ6 A;  4CJL A;  1N6Q A;  1XWL A;  3NGZ A;  3DRS A;  1RDW X;  4O4G A;  4WQ4 C;  4O55 A;  1S6P A;  4YY3 K;  4BRL A;  1LW0 A;  4E1N A;  4ZTF A;  3MCP A;  3JSM A;  1GLL O;  3KLF A;  2ATQ A;  3D45 A;  4FWP A;  3V81 A;  1HYS A;  4JYA K;  4H0X B;  2GTD A;  5HRO A;  1B9F A;  1YAG A;  3BZC A;  4KHU A;  5CZ2 A;  3AY9 A;  4DF4 A;  2ASO A;  1IH7 A;  2IOC A;  3AO3 A;  1TL3 A;  4IEI A;  3PUF A;  3VQD A;  4EP5 A;  4DTO A;  3CCE N;  4CE9 A;  1JKH A;  3KK2 A;  1VSH A;  2QXL A;  5FLX O;  5J2N A;  4GV9 A;  4DTM A;  1LAW A;  2YNI A;  3U8X A;  4J2A A;  5K14 A;  4IJN A;  4AHU A;  2O8E A;  4TSX A;  4CF1 A;  5HRS A;  4FL9 A;  5T7B A;  3O9Q A;  3OYB A;  3UB5 A;  4JK9 A;  4DR5 K;  4BRE A;  1HKG A;  3SLC A;  4M45 A;  1X3N A;  4AQY K;  3LP2 A;  1DTQ A;  1RDA A;  3SQ4 A;  3CHW A;  3S3M A;  4K42 A;  4FM1 A;  4NYN A;  3J7Y P;  3LPU A;  2PAV A;  2ZM6 K;  3FGU A;  1WLJ A;  4M3T A;  2FC0 A;  1YUW A;  3VQ8 A;  4DTJ A;  1KFS A;  5EY4 A;  1TV6 A;  5FPN A;  5FPE A;  1S5J A;  1NGI A;  4FWK A;  1T05 A;  2ASP A;  2OPS A;  5SWM A;  1QHA A;  3J80 O;  4FWM A;  3L2W A;  2D1K A;  5KGW A;  1RDB A;  1OVQ A;  2WBN A;  3VGK A;  1W2B M;  5C10 A;  4H5N A;  1JCG A;  3TR8 A;  3MEG A;  3SBT A;  1YHQ N;  3MXM A;  4OPK A;  3BF3 A;  3VF2 A;  1WBD A;  3DLH A;  1SQK A;  4KBO A;  2W40 A;  3TI0 A;  1VK0 A;  4KH6 A;  5C24 A;  4DQQ A;  2B5J A;  3CCQ N;  4YOY A;  1QQO A;  3ZET B;  3WXL A;  1S1W A;  2O8B A;  4ICL A;  2KZZ A;  2VQE K;  3WUH A;  4A5A A;  2P9P A;  4WQ5 A;  4LFA K;  3M8P A;  4WFA L;  4H0V B;  1N36 K;  1IV0 A;  3MEC A;  4OGC A;  3KK3 A;  5AQX A;  3L4Q A;  4CHN A;  5M1K A;  2P9N A;  3O3G A;  4DS4 A;  1BQM A;  1EO1 A;  2NRH A;  3UKR A;  1ZBU A;  4DQS A;  1C1B A;  4DU4 A;  4FPA A;  2BUP A;  4BRH A;  3SZ2 A;  2GWJ A;  1CXU A;  2IVN A;  1SV5 A;  4MLH A;  2YJE A;  4J2E A;  1X9J A;  1HMV A;  4CBX A;  4H0O A;  1BG3 A;  5LL6 Z;  1LWE A;  5FDL A;  3RMA A;  3VER A;  1EQY A;  3I56 N;  4CK2 A;  1T03 A;  1WSE A;  4E1M A;  3VEO A;  2HHW A;  4FLX A;  2JWL A;  5AZJ B;  3K2P A;  3BUZ B;  3QER A;  4KHY A;  3KD1 E;  1NK8 A;  2PYJ A;  4FWN A;  4DTS A;  4OX9 K;  4LFC K;  4Z94 A;  5BR8 K;  1HJR A;  4M63 C;  4M3Y A;  2F9T A;  1UWB A;  5BRD A;  2BE2 A;  3W0L A;  4GV3 A;  1JLG A;  4M42 A;  3CQX A;  1JXE A;  3D2F B;  3ZT2 A;  4DQ8 A;  3EY1 A;  4N47 A;  4CJR A;  5MLC Q;  3SJH A;  4JI0 K;  4JS4 A;  1N32 K;  4QS8 A;  3QIP A;  1L3T A;  3LAK A;  4DQI A;  1KQS M;  4JI2 K;  3MWT A;  3T7Z A;  4E7H A;  4ISE A;  4DG1 A;  3HBT A;  3FZM A;  4E1J A;  1VAZ A;  4LSN A;  3NAE A;  3SK3 A;  5FPM A;  1LWF A;  4K25 A;  3L6Q A;  1YF5 L;  4A5B A;  1ZBI A;  1HX1 A;  3WXI A;  4CZF A;  2E2P A;  4FK0 A;  3QBW A;  3C7N B;  1J54 A;  4M3U A;  4JKG A;  2VCP A;  4CEF A;  2G8I A;  3T1Y K;  1NGB A;  3M3Z A;  3VPZ A;  3ZSR A;  3HVR A;  2Z1H A;  4F9O A;  3PIO L;  1HNZ K;  3NH2 A;  4BVP A;  3AVB A;  2VWJ A;  3RTV A;  4CI6 A;  4LF9 K;  3JS6 A;  1VQ5 N;  4CZH A;  1XHZ A;  4IFY A;  1RCH A;  4L8R B;  4L3Q A;  2E2N A;  1HKB A;  1TUU A;  2P9U B;  3AAR A;  5JLF A;  1YVU A;  3R6M A;  2X74 A;  1T3V A;  3E9O A;  5BPN A;  3HXM A;  1SZ2 A;  4BC5 A;  4C8K A;  4BRD A;  4UY8 O;  3G25 A;  3V6D A;  3OYD A;  1GLC G;  4X64 K;  4GW6 A;  3VA0 A;  3KZB A;  3ZEU A;  4I6M B;  2D0O A;  4K41 A;  3IFR A;  1VSD A;  4IDH A;  4DR3 K;  3O08 A;  5AQI A;  4IO8 A;  4F3T A;  4YNQ A;  3NFA A;  4CER A;  3O3F A;  4KHW A;  4I9L A;  3AVI A;  1C1C A;  5I3U A;  3O4N A;  1TAQ A;  2BGG A;  4PL7 A;  4DFP A;  1VSM A;  1NGJ A;  3G71 N;  2D0C A;  4GKJ K;  2G8H A;  4WQ5 C;  1GLF O;  2O8E B;  3HM8 A;  4Q0B A;  4JKA A;  4A59 A;  4F4K A;  5SZT A;  4CJP A;  5HP1 A;  4NCG A;  1U04 A;  3SUO A;  2D0A A;  4DSF A;  1RBT A;  4OKE A;  1DEJ A;  3MK6 A;  3T1A A;  2KW4 A;  4GMJ B;  4AIL C;  4NB4 A;  3O4W A;  1D9D A;  4NYF A;  4B3R K;  1RBV A;  5BR9 A;  3THX A;  3V9X A;  3ULE A;  4LD0 A;  4B1X B;  4M3R A;  3DLB A;  3NDK A;  4LFB K;  5FRM A;  3HRG A;  3L2R A;  1VSL A;  3TTD A;  4CF8 A;  1NJZ A;  1FKO A;  4JI3 K;  1J6Z A;  2XY8 A;  5AZI A;  4CBW A;  4DUZ K;  4NXN K;  4CED A;  4DLG A;  1NOZ A;  4H03 B;  3CXC M;  1HNI A;  2Q31 A;  4E3S A;  2GWK A;  1O1W A;  3RMD A;  4B3M K;  1RDC A;  4MO5 A;  1Q7Y O;  3AVC A;  3WQU A;  1ZBS A;  3P5J A;  3PO4 A;  2OCE A;  4DU1 A;  1QTM A;  1IBL K;  5GIO A;  1IKX A;  3RR7 A;  4XH1 A;  4KAZ A;  3QLH A;  4WFN L;  2YI1 A;  4V19 S;  4KB0 A;  2XY7 A;  4FZZ A;  1I3A A;  2QM1 A;  3AVM A;  4H4O A;  4OLB A;  4OPA A;  2E4L A;  4BGA A;  4X66 K;  4FCY A;  2O8B B;  4CBU A;  3SUN A;  4M3Z A;  4JKH A;  2P9P B;  5C2F A;  3UE5 A;  3IRX A;  1XC3 A;  3CG7 A;  3C6A A;  3ZT4 A;  3EYZ A;  1VSF A;  2WC9 A;  1OVY A;  3H08 A;  2P9N B;  4M7Y A;  1E4G T;  4CJU A;  2KKZ A;  4IO9 L;  3UKR B;  4QOZ B;  4FVU A;  1SL0 A;  1WSH A;  5CYM A;  4DTR A;  3U3G A;  2G8F A;  4DV6 K;  5E26 A;  1MWM A;  1VQM N;  4CFC A;  4ELT A;  1K8A O;  5AQM A;  1ATN A;  1B92 A;  1KAZ A;  1NNE A;  2W6K A;  1S1T A;  2D4W A;  3NF6 A;  3DYA A;  4AF1 A;  5AQO A;  5F0X A;  3PV8 A;  4CZK A;  4C8L A;  1GLJ O;  2HBM A;  3VEX A;  3DXM B;  4BRO A;  3DRR A;  4BRA A;  3QNN A;  1HQU A;  4EZ9 A;  1ZXO A;  4GY2 B; 
#chains in the Genus database with same CATH homology
 4KFB A;  4CJL A;  1N6Q A;  3NCI A;  1XWL A;  4KRE A;  2P5O A;  3LZI A;  3NGZ A;  3DRS A;  5JS2 A;  4O4G A;  3AO2 A;  2RPI A;  3ZSY A;  4CGI A;  4XIU A;  4O55 A;  1S6P A;  1TK0 A;  1TKD A;  1LW0 A;  1RBU A;  4E1N A;  1EKE A;  4ZTF A;  4F2R A;  3JSM A;  4NCB A;  3KLF A;  3WNG A;  2ATQ A;  3D45 A;  3K58 A;  3V81 A;  1GOB A;  1HYS A;  4PUO A;  4C8M A;  1Q9X A;  2OPP A;  4CGH A;  3OYJ A;  2HVH A;  1C0U A;  1JLE A;  1HNV A;  4LH5 A;  4B8C A;  2VG6 A;  4FW1 A;  5HRO A;  4RW9 A;  4CHP A;  5J2Q A;  5I42 A;  1B9F A;  1L5U A;  3OYN A;  3ZSZ A;  4AHC A;  2G8W A;  3OYL A;  2HNZ A;  3ZSO A;  1JLC A;  3SUQ A;  5CZ2 A;  4IG0 A;  4CFB A;  4KHU A;  1RT6 A;  4OLA A;  3OYH A;  3QEP A;  4DF4 A;  4KV8 A;  1IH7 A;  2IOC A;  3AO3 A;  1TL3 A;  3V1R A;  3PUF A;  3VQD A;  4AHV A;  4EP5 A;  3OYE A;  1JXB A;  3NGI A;  3TAN A;  5KRS A;  4DTO A;  4CE9 A;  2HVI A;  1JKH A;  3KK2 A;  1VSH A;  2Z1G A;  5J2N A;  3HP9 A;  4DTM A;  1LAW A;  2JGU A;  2YNI A;  3AVJ A;  3K5N A;  1IKW A;  5D3G A;  4J2A A;  5K14 A;  4AHU A;  1S9E A;  4TSX A;  2X6N A;  3KIO A;  3KKS A;  4CF1 A;  5HRS A;  5T7B A;  3DLE A;  3V9Z A;  4CEQ A;  1NK5 A;  3OYB A;  2KTQ A;  3ZCM A;  1HPZ A;  4CGG A;  3AVK A;  1ASU A;  4KTQ A;  3DLK A;  3HM9 A;  4FLU A;  2YNG A;  1BCO A;  4BAC A;  4M45 A;  3NH1 A;  4FLT A;  3I0R A;  3LP2 A;  3AVL A;  1Y97 A;  3V9S A;  3KKR A;  1DTQ A;  1RDA A;  1D5A A;  1I39 A;  1S1X A;  1Z25 A;  4BE2 A;  3SQ4 A;  1MU2 A;  1WNS A;  2OPR A;  2VG7 A;  3S3M A;  3DLR A;  4F2S A;  4RW4 A;  1WAJ A;  4FM1 A;  1N5Y A;  4NYN A;  4FLY A;  3LPU A;  4M3T A;  2P1J A;  1WLJ A;  4BE1 A;  2OZS A;  4HCC A;  4FZX C;  2FC0 A;  3P1G A;  1BIU A;  3PX6 A;  3VQ7 A;  2DFF A;  4IDK A;  5HRN A;  3L3V A;  3VQ8 A;  4DTJ A;  1KFS A;  1TV6 A;  2KQ2 A;  4B8A B;  3TAQ A;  1D8Y A;  4FJL A;  2KFZ A;  4E0D A;  1S5J A;  1T05 A;  1LV5 A;  2OPS A;  5SWM A;  1KCF A;  4E7K A;  5DMR A;  2I5J A;  1U45 A;  3L2W A;  3VQQ A;  2OPQ A;  4E19 A;  3L3U A;  2D0B A;  3DOL A;  4CJQ A;  3SPY A;  1NK0 A;  1SKR A;  3AA5 X;  1ZBH A;  3LP0 A;  4CJS A;  1NJW A;  2HHQ A;  1VSI A;  3SPZ A;  4DTX A;  2HHT A;  1JLA A;  3O3H A;  5KGW A;  1RDB A;  1RIL A;  1LWC A;  4CJK A;  4DQP A;  4CHZ A;  3BGR A;  3K5O A;  1C1A A;  4FM2 A;  3QET A;  1U4B A;  1EET A;  4OVL A;  2HND A;  3HVT A;  4DLE A;  3TR8 A;  4DTU A;  4N76 A;  5J2P A;  4QCL A;  3MEG A;  3KLH A;  1SKS A;  4K8Z A;  1Q8I A;  4E7J A;  3MXM A;  4OPK A;  1SKW A;  1QSL A;  4RG8 A;  3ALY A;  4EP4 A;  3DLH A;  4PA1 A;  5HBM A;  3L2Q A;  2IDO A;  3TI0 A;  1S9G A;  1VK0 A;  2AJQ A;  5C24 A;  4DQQ A;  2XY5 A;  1FKP A;  1RT3 A;  2B5J A;  4FM0 A;  3CQ8 A;  1S1W A;  3NHG A;  4KTZ A;  4IFV A;  4KHS A;  2B6A A;  4ICL A;  2VG5 A;  3DRP A;  1TVR A;  1RTH A;  4B9S A;  2KZZ A;  4DSE A;  1JL1 A;  1HQE A;  3M8P A;  4H4M A;  3AA3 A;  2IGI A;  4ID5 A;  1BI4 A;  3MEC A;  4OGC A;  3KD5 E;  3KK3 A;  1EXQ A;  2YHB A;  4FXD A;  4CHN A;  4DS4 A;  3O3G A;  1BQM A;  3UIQ A;  3ZSX A;  4Z4F A;  4AHT A;  3L2V A;  2KFN A;  3ASM A;  1ZBU A;  2HHX A;  2RKI A;  1RDD A;  4CIG A;  1C1B A;  5KGX A;  4O0I A;  3HT3 A;  4DQS A;  4DU4 A;  4N41 A;  1NKE A;  1JLB A;  1DLO A;  1WSG A;  1L3S A;  5CY4 A;  3SZ2 A;  5CZ1 A;  1C0T A;  1RT1 A;  3M8S A;  2HMI A;  3QEI A;  3LZJ A;  4M3X A;  4WE1 A;  1ASV A;  1CXU A;  2F8T A;  4CF9 A;  4J2B A;  3AO4 A;  3OJS A;  3AV9 A;  3HPH A;  1SV5 A;  5FRO A;  1UAX A;  3CFP A;  4J2E A;  2OA8 A;  2D5R A;  1FXX A;  2E6M A;  2PZS A;  1HMV A;  4FZZ A;  4CK3 A;  4B08 A;  5HRR A;  1LWE A;  4Q5V A;  5FDL A;  4CGF A;  4CEE A;  2XO7 A;  3RMA A;  3KLE A;  3MED A;  1X9M A;  1TK8 A;  3ULD A;  4RW6 A;  3SCX A;  4DSK A;  4DTP A;  3QIN A;  5FRN A;  4CK2 A;  4DFJ A;  3PO5 A;  4ZHR A;  1T03 A;  3T3F A;  3OS2 A;  4DFM A;  1WSE A;  4E1M A;  2HHW A;  4CHY A;  1SUQ A;  4FLX A;  3LAL A;  4KB1 A;  2F96 A;  4LSL A;  3K2P A;  1YTA A;  1RT2 A;  2EHG A;  2GV9 A;  1RTJ A;  4O0J A;  4FLW A;  4MQ3 A;  3LP3 A;  3LPT A;  3LDS A;  3QER A;  3SI6 A;  4CIF A;  1NK8 A;  1A5W A;  3OYG A;  4DTS A;  5C42 A;  2XY6 A;  2PY5 A;  2PYJ A;  3VQA A;  3AVA A;  1HJR A;  4YFU A;  1R0A A;  1L3U A;  4M3Y A;  2A1R A;  2RN2 A;  2DFE A;  3CM6 A;  1UA1 A;  1UWB A;  4AHR A;  1QQC A;  1FK9 A;  2BE2 A;  4CEA A;  1JLG A;  3HST B;  1C6V A;  1BHL A;  3ZSQ A;  4IKF A;  4M42 A;  4CFA A;  2R7Y A;  4MFB A;  3SQ0 A;  1ZYQ A;  1C0M A;  3CFR A;  1JXE A;  2YNF A;  4HHT A;  2O4I A;  2DTU A;  4W5N A;  3ZT2 A;  4FYD A;  3QEV A;  4KTW A;  1DTT A;  3EY1 A;  3SJJ A;  2NUB A;  4N47 A;  3ZT3 A;  4CJR A;  4FJI A;  3HJF A;  3LWM A;  4Z4C A;  1VRU A;  2DFH A;  4FVM A;  4JS4 A;  3SYZ A;  3KD1 E;  3QIP A;  1G15 A;  3DLG A;  1L3T A;  1S6Q A;  1TL1 A;  3LAK A;  3T19 A;  4O44 A;  4DQI A;  4PQU A;  1RT4 A;  3QIO A;  1EP4 A;  5KTQ A;  1BQN A;  3RRH A;  4F3O A;  1WSI A;  1KSP A;  4E7H A;  3JYT A;  4CGD A;  4Z4I A;  2LSN A;  3S9H A;  3ITH A;  4FW2 A;  1HYZ A;  1GOC A;  4DG1 A;  3G0Z A;  1A5V A;  1LW2 A;  4FJJ A;  4LSN A;  3HYF A;  3NAE A;  3NGY A;  2DY4 A;  4DTN A;  1X9S A;  4DWI A;  3PX4 A;  3K5L A;  1U48 A;  2F8S A;  1LWF A;  1X1P A;  3AVG A;  2P5G A;  1ZBI A;  3IAY A;  4B9T A;  4DS5 A;  2BDP A;  4B9U A;  1IG9 A;  2HW3 A;  3VQ5 A;  4FK0 A;  4UQG A;  4KI6 A;  3DOK A;  4OKK A;  3RMC A;  4B9N A;  1J54 A;  4M3U A;  4KRF A;  3OYI A;  4CEF A;  2G8I A;  4ID1 A;  2ITG A;  3TAG A;  2RF2 A;  2QK9 A;  1W9H A;  3DMJ A;  3KK1 A;  1NKB A;  2P51 A;  2X6S A;  3DI6 A;  3LP1 A;  1GOA A;  3ZSR A;  3OYK A;  2Z1H A;  3HP6 A;  3HVR A;  1T8E A;  1TKX A;  4R5P A;  2G8V A;  1KVA A;  3QEX A;  3VQB A;  3NH2 A;  4DF8 A;  4CF0 A;  4CHQ A;  1KFD A;  3AVB A;  2VWJ A;  3AVN A;  3RTV A;  2WON A;  4KHY A;  3WNH A;  3VQ9 A;  3D0P A;  4Z4H A;  1QSY A;  3OYF A;  1TAU A;  4DSI A;  4FJ8 A;  1XHZ A;  3AVF A;  4IFY A;  4DMN A;  1RCH A;  2YNH A;  2G8U A;  4L8R B;  2WOM A;  3KLG A;  3AO1 A;  3CYM A;  2ZE2 A;  4KHQ A;  2OYQ A;  1BCM A;  1JL2 A;  3E01 A;  2HNY A;  4FJN A;  3F73 A;  1B9D A;  2HB5 A;  4KO0 A;  3IS9 A;  3ZSV A;  3PY8 A;  2PYL A;  1YVU A;  2IAJ A;  1KTQ A;  2X74 A;  2Z1J A;  3ZSW A;  3HXM A;  4FJ9 A;  1F21 A;  3SQ2 A;  4C8K A;  4H8K A;  1CZB A;  1T7P A;  4W5O A;  4Y1C A;  3V6D A;  1NJY A;  3B6P A;  4OKJ A;  4CEZ A;  3OJU A;  4DU3 A;  2OZM A;  1TKT A;  1S1V A;  3OYD A;  3L8B A;  3HK2 A;  4CCH A;  4GW6 A;  3VA0 A;  3AA4 A;  4FLV A;  5KRT A;  4KI4 A;  4CJF A;  3TAE A;  4CJ5 A;  2Y1J A;  3SQ1 A;  3LWL A;  3MAQ A;  1BGX T;  1WSF A;  2B4J A;  1IKY A;  4JLH A;  5C25 A;  1VSD A;  4LH4 A;  1NK9 A;  3HPG A;  3KTQ A;  4B9V A;  1ZBF A;  3M8R A;  4W5T A;  3QES A;  4F3T A;  4AHS A;  4RW8 A;  3NFA A;  4CER A;  4YNQ A;  4E7I A;  4OPJ A;  1CLQ A;  3O3F A;  3VQE A;  3OYC A;  1UA0 A;  1J9A A;  1JLQ A;  1QE1 A;  4FLZ A;  3CFO A;  4I9Q A;  4KHW A;  4I9L A;  3AVI A;  3VQ4 A;  1C1C A;  5I3U A;  3O4N A;  4BWM A;  1TAQ A;  3MEE A;  2BGG A;  4DFP A;  1VSM A;  2YV0 X;  1U47 A;  2FBV A;  1D9F A;  5DK5 A;  1U49 A;  4PWD A;  2D0C A;  2IC3 A;  2EX3 A;  2BAN A;  4IG3 A;  3L2U A;  2G8H A;  3A2F A;  3K59 A;  4CJ4 A;  4Z4G A;  4M3W A;  4CEO A;  1HRH A;  4B9L A;  1L3V A;  1A5X A;  3AA2 A;  4Q0B A;  1XI1 A;  5J1E A;  3OVN A;  4BDP A;  4RW7 A;  1BIZ A;  3QNO A;  3VQP A;  4ELV A;  2HHV A;  2FBY A;  4F4K A;  1BIS A;  4CJE A;  5SZT A;  3THV A;  4E89 A;  1NK4 A;  3KLI A;  4CJP A;  1RTI A;  3HO1 A;  2YHA A;  1CXQ A;  1TGO A;  1NK7 A;  2VWK A;  1HYV A;  4CES A;  3TAF A;  5HP1 A;  1VRT A;  3P83 D;  4NCG A;  1J53 A;  3KJV A;  4C8O A;  2FBX A;  1U04 A;  3SUO A;  4FJM A;  1JLF A;  2D0A A;  4DSF A;  1RBT A;  3I0S A;  4OKE A;  3C6U A;  2KW4 A;  3T1A A;  4GMJ B;  4AIL C;  4KKO A;  3F9K A;  3LAN A;  1D9D A;  4NYF A;  1NJX A;  2ZD1 A;  3RWU A;  3K57 A;  5KI6 A;  1RBV A;  3NF9 A;  4FZY A;  2GUI A;  3V9X A;  2XHB A;  4LD0 A;  4M41 A;  3ZT1 A;  4CF2 A;  4HUF A;  3V9W A;  4M3R A;  4AH9 A;  1XC9 A;  3DLB A;  3NDK A;  2Q3S A;  3NE6 A;  3IG1 A;  5FRM A;  3L2R A;  4I2Q A;  1VSL A;  4PY5 A;  1S1U A;  4CF8 A;  3RMB A;  4FK4 A;  4Z0U A;  1VSJ A;  1YT3 A;  1FKO A;  3VN5 A;  1NJZ A;  1X9W A;  4DSJ A;  2XY8 A;  4OJR A;  3WNE A;  4K8X A;  2E6L A;  3M8Q A;  4W5R A;  1VSE A;  4HCB A;  2Z1I A;  3AVH A;  1IKV A;  3ZT0 A;  4KPY A;  5HRP A;  4HTU A;  4CED A;  4DLG A;  1NOZ A;  1KVC A;  4BWJ A;  1SL2 A;  1NK6 A;  3SV4 A;  1HNI A;  4J2D A;  4NCA A;  4EZ6 A;  4DFK A;  1K6Y A;  1VSK A;  3VQ6 A;  1WSJ A;  4CIE A;  1O1W A;  4E3S A;  1Z26 A;  3RMD A;  5HLF A;  1NKC A;  1RDC A;  4JS5 A;  1RBR A;  2JLE A;  3AVC A;  4FJG A;  4CJT A;  3OYM A;  3P5J A;  4CGJ A;  4CJW A;  3C94 A;  3QEW A;  4F8R A;  3SUP A;  3PO4 A;  3PX0 A;  3CM5 A;  4DU1 A;  4FJX A;  3V9U A;  4QAG A;  1QTM A;  4CK1 A;  4HUE A;  1IKX A;  1W0H A;  1SL1 A;  4CHO A;  3RR7 A;  5J2M A;  3TAR A;  4N5S A;  1KLM A;  2O4G A;  2G8K A;  4KAZ A;  3C95 A;  3QLH A;  2HHS A;  2X78 A;  4HUG A;  3QO9 A;  3V4I A;  4ELU A;  2XY7 A;  4KB0 A;  5EU7 A;  1RNH A;  1RT5 A;  1I3A A;  4IBN A;  1ASW A;  3AVM A;  4H4O A;  4BDY A;  3U3Y A;  1QHT A;  1QS4 A;  3RR8 A;  4OLB A;  2GBZ A;  2E4L A;  2QKK A;  3NF7 A;  4FCY A;  1TK5 A;  4CEC A;  3SNN A;  4FJK A;  4FJ5 A;  5JS1 A;  3SUN A;  1RT7 A;  4M3Z A;  2FBT A;  3K5M A;  4O5B A;  3AO5 A;  3OS0 A;  4N56 A;  3IRX A;  1EX4 A;  1XHX A;  3CG7 A;  3ZT4 A;  3I8D A;  2HHU A;  4DSL A;  1IO2 A;  4BE0 A;  3EYZ A;  3O4Q A;  4B3O A;  3MXJ A;  1BI4 B;  1VSF A;  2YKM A;  2W42 A;  2QXF A;  2Y1I A;  1NOY A;  1RTD A;  3B6O A;  3H08 A;  3VA3 A;  4CJU A;  3MXI A;  4QOZ B;  5E41 A;  1SL0 A;  1WSH A;  3ISN C;  4I2P A;  5CYM A;  3S3O A;  2YKN A;  3TWH A;  4DQR A;  3TAB A;  4DTR A;  3U3G A;  3SV3 A;  2G8F A;  4OGE A;  4E7L A;  4BDZ A;  1REV A;  4Y1D A;  4CFD A;  4JRP A;  4FJH A;  2A1S A;  3C6T A;  3NBP A;  1UOC A;  2KZM A;  3EZ5 A;  3U6F A;  4LY7 A;  3V1O A;  2QKB A;  4CFC A;  1KLN A;  1ITG A;  4ELT A;  3G10 A;  4ZTJ A;  1J5O A;  4FK2 A;  4CEB A;  3V1Q A;  1BL3 A;  1ZBL A;  1B92 A;  3HL8 A;  1KRP A;  4HVJ A;  2ETJ A;  3NF8 A;  5CYQ A;  3OYA A;  3TAP A;  3FFI A;  3OY9 A;  1YTU A;  3DM2 A;  1QSS A;  2ZQB A;  1TKZ A;  4GVM A;  1S1T A;  4CJ3 A;  4FJ7 A;  1RBS A;  3WNF A;  1KVB A;  3OS1 A;  4KHN A;  1WAF A;  1LAV A;  4I7F A;  3NF6 A;  3VQC A;  3DYA A;  4G1Q A;  3PV8 A;  4C8N A;  3TAM A;  4Z4E A;  4C8L A;  3LAM A;  3NH0 A;  4W5Q A;  4JRQ A;  1CZ9 A;  3BDP A;  4CJV A;  3S3N A;  3HPO A;  3RRG A;  2IS3 A;  3DRR A;  3QNN A;  4EZ9 A;  1HQU A;  2XRI A;  4B9M A;  1Q9Y A;  1WN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...