2G8FA

B. halodurans rnase h catalytic domain e188a mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGAIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna/dna
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 39
structure length 133
sequence length 133
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8fA00
5CYMA 1NOZA 3VQ4A 1L3VA 4FK2A 2KW4A 2Z1IA 4OLBA 3AVHA 5HRSA 4EZ9A 3VQ8A 3AA4A 1NK6A 3DYAA 4K8ZA 3CM6A 3NAEA 2Y1JA 3TAQA 4DSKA 4KB0A 5FDLA 4M3TA 3LP3A 1KLNA 3K2PA 4CHPA 4AHSA 2P1JA 3L2QA 4HTUA 1MU2A 1K6YA 4LD0A 1C1CA 5CZ2A 3SPYA 1NK9A 1IH7A 3QIOA 4AHTA 1C0UA 4FZYA 3OS1A 4FJKA 2GUIA 1QQCA 1RTHA 3PO4A 3SQ1A 3OS0A 4CGDA 2JGUA 2YHAA 2LSNA 3DLGA 4CEBA 2ITGA 3VQ6A 4FLYA 1HJRA 3OYEA 4DS4A 3SQ2A 4KHQA 3NF6A 1YT3A 3U3GA 3CFPA 4FM2A 4N41A 3IRXA 3OY9A 4M3WA 4E1NA 1IKYA 3KKSA 4CEAA 2HVIA 3QNOA 4DU1A 1S1TA 4BWMA 4E1MA 1NK5A 3KTQA 3DRRA 2KFNA 4DG1A 3D45A 3RMAA 3EY1A 4CE9A 1N6QA 4F4KA 3TAPA 2OPRA 3V4IA 3S9HA 4F2SA 1JLAA 4CF0A 2KQ2A 3C6TA 1O1WA 3RR8A 4DTXA 4W5TA 1C0TA 3MXMA 1WSJA 1VSLA 2HHQA 4K8XA 2QK9A 1WAJA 4CJSA 4CEDA 4O4GA 3O3FA 2WONA 4JS5A 3S3NA 4G1QA 3T1AA 4DFMA 2OZSA 1JLQA 1RILA 3DLKA 4M3ZA 3AVBA 4H4OA 4NCGA 1RBTA 2FBXA 4JLHA 4LSLA 3OJUA 3L2VA 4JRPA 3VQ9A 1LV5A 4M42A 1RDBA 2OPSA 4Z4EA 3UIQA 3RRHA 3VQEA 4O44A 4RW4A 1QSYA 3IS9A 2FC0A 2BGGA 1S1WA 2A1RA 1JL2A 1WLJA 3MEGA 4AHCA 3OYKA 1HMVA 1DLOA 2B6AA 3B6OA 4Z4HA 1LWCA 4KAZA 4B9LA 3K5NA 1IKXA 4B08A 4FJXA 3ZCMA 3JSMA 4CHQA 5KI6A 1TVRA 3VN5A 1TK5A 2HHSA 4DLGA 3LPTA 2ETJA 3KK3A 1TK8A 1T7PA 1D9FA 2F8TA 1JLFA 4N47A 4Q5VA 3MXJA 3QEVA 2Z1HA 3F9KA 2QXFA 1U4BA 3LALA 2BE2A 1SKSA 3NGZA 1W0HA 2E4LA 2HB5A 3ZSYA 4DQRA 3TAGA 4F2RA 3SCXA 3PY8A 4B8AB 2OYQA 1QTMA 3V9XA 1S6PA 2XHBA 3L3VA 4CEOA 4CHNA 1JLEA 1HPZA 4AHRA 5FRNA 3DM2A 1HNIA 4OGEA 3ZT1A 4E19A 4KREA 4I9QA 1S9GA 4FJMA 4OKEA 3TWHA 3LDSA 3S3OA 1RTIA 2HNYA 4KTZA 2YNFA 3ULDA 3U6FA 3RTVA 1WNSA 3DOKA 4CIGA 1TAUA 1VSMA 5KRTA 3LAMA 1C0MA 1C1BA 2VG6A 4NYFA 3F73A 4ELUA 4CGJA 2P51A 3LPUA 4ID1A 3V9UA 3QEIA 1KSPA 1WN7A 1QSSA 1A5WA 4JS4A 1JLBA 4FW2A 3SQ0A 3QEXA 4FYDA 3NF9A 4DQQA 1HYSA 2OPQA 1NKCA 1L3SA 3O4NA 1RT1A 2BANA 1TKZA 3AVLA 3QINA 4NYNA 3S3MA 4MQ3A 3RMDA 3TANA 1IG9A 2P5GA 1HQEA 3HK2A 3NCIA 1G15A 1ASUA 4CEQA 4FJ8A 4FZZA 2KFZA 3ZSXA 2G8UA 1WSFA 4DSEA 1NJWA 1Q9YA 1WSIA 3VQPA 4KHWA 4E7IA 2RPIA 1UWBA 2ZD1A 3RR7A 3RMBA 3SYZA 1UA0A 4RW7A 4NCBA 1VSKA 2G8KA 4J2DA 4HUFA 4M3UA 4FJ7A 5HLFA 5J2MA 3LANA 4B9NA 3ALYA 1S5JA 2X78A 2KZMA 4B3OA 3OYLA 2QKBA 4FK4A 5J2NA 4M41A 1NKEA 1N5YA 1ZBHA 4CJ4A 4CJTA 4DTUA 2DTUA 1KVCA 4CGHA 2VG5A 4DTRA 1JKHA 1EP4A 3VQCA 3SNNA 2G8IA 4LH4A 3ZSWA 3QEPA 4W5QA 3VA0A 3SV3A 3TABA 4FJLA 4OLAA 5I42A 1NJYA 4CFCA 1WSEA 3OYBA 2VWJA 2Q3SA 4RW6A 1TL1A 4IFVA 1EETA 3AVMA 4E7JA 1U45A 2Y1IA 3DOLA 4FW1A 3QEWA 4AILC 1RBRA 3LP2A 5CYQA 2PZSA 3DLBA 4HVJA 1T03A 4C8OA 4J2AA 3AO1A 1LAVA 4BE0A 3G0ZA 1RDAA 4FLWA 3ZT0A 1VSHA 5HRRA 3T19A 3NHGA 4B9UA 3OYJA 4EP5A 4R5PA 4DSFA 5SWMA 3HPOA 4FJIA 1RDDA 1S1VA 4Z4IA 3VQ5A 1DTTA 1QE1A 1UAXA 4CCHA 1QS4A 3HO1A 4AHVA 2D5RA 3O3GA 3H08A 3MAQA 3A2FA 4OPKA 1Y97A 3TAFA 1L3UA 1NJXA 4YNQA 3M8RA 1TKDA 3LZJA 1BIZA 4CJQA 4NCAA 4Z0UA 2YKNA 1RT6A 1GOBA 2YHBA 3KLGA 3SUNA 4M3YA 3D0PA 3HVRA 2YNGA 3AO3A 4C8KA 4CJKA 3K59A 1BHLA 3AA3A 4Z4GA 1TGOA 1U04A 4CFDA 1Z25A 2DFHA 3L2UA 4DLEA 4E3SA 3C6UA 1ZBFA 3CFOA 3OYCA 3T3FA 1SKRA 4MFBA 1RT2A 4H8KA 4O0IA 4DQIA 4KI4A 3AVAA 1BQNA 1RT3A 4PY5A 4E0DA 2VG7A 1LAWA 3ZSRA 4FLZA 3TI0A 2YNHA 3V9ZA 1VSDA 3HL8A 2F8SA 5EU7A 3IG1A 2O4IA 4QOZB 1S1XA 4M3RA 2D0AA 1D8YA 2XO7A 4DTNA 4IG3A 3IAYA 1FK9A 3VQBA 4E7LA 2ZE2A 3OYNA 2RF2A 1RTDA 1ZBIA 3AVGA 5JS1A 3DRPA 1VSJA 1XC9A 1B9DA 4CEEA 2FBYA 4CHOA 4L8RB 4N76A 3CM5A 3VQDA 1W9HA 4Z4FA 1J5OA 2IGIA 4OKKA 1JLCA 3KLIA 4FM1A 1JXBA 2F96A 1J53A 4ID5A 1ASVA 1ITGA 1HYZA 3C95A 5K14A 1TAQA 1I3AA 5SZTA 4ELTA 1J54A 2HNDA 4AH9A 4FJNA 1RCHA 3AO2A 1FXXA 4O0JA 1ZBLA 4J2BA 2X6NA 2EHGA 3KLHA 4F3TA 4FJ9A 4DWIA 2G8HA 4O55A 3KLFA 3TAEA 3E01A 4BE2A 3V1RA 2WOMA 4PQUA 1RTJA 1NK4A 3ZSVA 2XY7A 4LSNA 1BL3A 4B8CA 1NK7A 3PX6A 1C6VA 4C8LA 1JLGA 2XY8A 3U3YA 1CZ9A 3HVTA 3K58A 3QETA 4FJGA 1KLMA 4Y1CA 4OKJA 4XIUA 1Z26A 1LWEA 1LW2A 2HHVA 4CJVA 4IKFA 1KVAA 1ASWA 3AO4A 1S9EA 3AV9A 3AVJA 1VRTA 1X9MA 3RRGA 2HVHA 3HYFA 2RN2A 2YKMA 2GBZA 3LP1A 3AA5X 3MECA 3CG7A 2OA8A 3AVKA 4DTPA 4BACA 4DTMA 4BDPA 4KFBA 3SUQA 3EZ5A 5J2PA 4OGCA 1BCOA 3WNGA 2YNIA 4CF2A 3V1QA 1RBVA 2KTQA 1Q8IA 1YTUA 2IC3A 4CK1A 5T7BA 1D5AA 4CFAA 4KHYA 4KHSA 3OYHA 1X1PA 4FXDA 1R0AA 2AJQA 3HM9A 1TV6A 1WSHA 3P83D 4DU3A 1CLQA 1SUQA 1CXQA 4KKOA 3L2RA 1SKWA 1RNHA 4B9SA 1KFDA 3LP0A 3V6DA 4ELVA 4FLXA 3OYAA 4EP4A 4CFBA 4CK2A 1HQUA 1RBSA 4CJRA 3HXMA 3TAMA 3V81A 4CIEA 3WNEA 4KO0A 2NUBA 4BDZA 3C94A 1QHTA 3LZIA 3NH1A 3TARA 1NKBA 3VQAA 5FRMA 4CERA 3DI6A 4E7HA 3NH0A 1WAFA 3OJSA 1WSGA 2B4JA 1LWFA 3V1OA 4CEZA 3I0RA 1JXEA 3PO5A 2P5OA 4J2EA 4W5NA 4CJ5A 3HT3A 3ZT4A 3OVNA 3P5JA 3BGRA 1ZBUA 4CJLA 3SUPA 1NK0A 2Z1GA 4KV8A 4CJPA 3AVFA 4HUEA 1BIUA 4CF8A 3K5OA 2XY5A 1L5UA 1T8EA 4Z4CA 1L3TA 4JRQA 1VK0A 4FLVA 4C8NA 1HYVA 3SQ4A 4DS5A 4HUGA 4KPYA 4I9LA 1TKXA 5C25A 2HHTA 3DLRA 2W42A 1EXQA 3QERA 1XWLA 3QESA 3DLHA 1BISA 4BWJA 4PUOA 3EYZA 4N56A 2B5JA 1RDCA 4CESA 5HROA 3AO5A 2PY5A 1BI4B 1VRUA 1IKVA 4CGIA 3HPHA 2Z1JA 1I39A 1SV5A 1JL1A 3TR8A 4CHZA 3G10A 3V9SA 4DFKA 2G8WA 4DMNA 1RT4A 1X9WA 3RWUA 3NF8A 3SPZA 4I2PA 2IS3A 4I7FA 4WE1A 4AHUA 4CHYA 3V9WA 3HSTB 3KKRA 4FLUA 1S6QA 2XY6A 2G8FA 3QNNA 3WNFA 4PWDA 1F21A 2GV9A 2X74A 3L3UA 4DFPA 4DU4A 3OS2A 2I5JA 4LY7A 4RW9A 4B9TA 3VA3A 3ZSQA 1FKOA 4DSIA 2X6SA 3WNHA 4ICLA 3PUFA 1IO2A 3SZ2A 3ZSOA 3OYIA 3OYFA 2ATQA 3BDPA 4ZTJA 3KLEA 3P1GA 3SV4A 1TK0A 1BCMA 3K5LA 3DMJA 3THVA 1YTAA 3L2WA 4BDYA 1X9SA 3SUOA 1KCFA 4H4MA 2HNZA 3NBPA 3KJVA 4CJEA 5DK5A 5C42A 4HCBA 3ZT2A 4B9VA 4FZXC 3MEDA 1KRPA 4BE1A 2QKKA 5HBMA 2R7YA 5J1EA 5E41A 1XI1A 4O5BA 3L8BA 1GOCA 4FM0A 2KZZA 3KK2A 3M8QA 1BGXT 1BQMA 3ISNC 1TKTA 4CECA 3I8DA 4YFUA 3HPGA 3O4QA 2HHUA 4IDKA 3QIPA 3SI6A 1RBUA 1U48A 1HRHA 4Y1DA 1UOCA 4CJ3A 1J9AA 5KTQA 2YV0X 3DRSA 4CJFA 1U49A 2E6MA 5J2QA 1S1UA 2OPPA 1LW0A 4OPJA 3NDKA 1QSLA 3AVIA 3LAKA 4KRFA 1EKEA 3ASMA 1Q9XA 4UQGA 5C24A 4W5RA 3ZT3A 3KD1E 4HCCA 1SL1A 1IKWA 3CYMA 4CJWA 4KI6A 4GW6A 4CJUA 4DQSA 1NOYA 1A5VA 3JYTA 4IG0A 2XRIA 3KIOA 5HP1A 4IBNA 4E89A 2FBVA 4FK0A 5HRNA 5HRPA 1SL2A 1YVUA 1KTQA 3AVNA 4PA1A 5KRSA 4DSJA 4CEFA 4GMJB 4W5OA 3KK1A 3LWLA 4DF8A 1U47A 3HJFA 2HW3A 4ZTFA 4QAGA 3FFIA 1C1AA 2D0CA 4DTOA 3VQQA 3SJJA 4FVMA 3NGIA 1NK8A 1T05A 5JS2A 1RT5A 5D3GA 4CIFA 1CXUA 4CGGA 4OJRA 3PX4A 2G8VA 1A5XA 4CF9A 1REVA 4DSLA 1RT7A 3ZSZA 2PYLA 2RKIA 2BDPA 1KVBA 1CZBA 3NGYA 3HP6A 4E7KA 1XHZA 5I3UA 2ZQBA 1VSEA 1VSFA 2HHXA 4IFYA 1UA1A 2DFEA 4DQPA 2IDOA 2PYJA 2OZMA 1HNVA 3K5MA 2HMIA 1XHXA 4C8MA 4KTQA 1KFSA 4B9MA 3B6PA 3OYMA 2A1SA 4KHNA 4CF1A 3CQ8A 1FKPA 1SL0A 1D9DA 3NH2A 2IOCA 2VWKA 4KB1A 3M8SA 4KHUA 5CY4A 1DTQA 1GOAA 2FBTA 4FLTA 3NFAA 3MXIA 3K57A 5KGWA 1VSIA 3RMCA 4M45A 3ITHA 4TSXA 2EX3A 3O3HA 3KD5E 1TL3A 3AA2A 3PX0A 2HHWA 4M3XA 2DFFA 4FJJA 1BI4A 3DLEA 3OYDA 5KGXA 2IAJA 3QLHA 2E6LA 3I0SA 4FJHA 3VQ7A 5DMRA 3HP9A 4DTJA 4CK3A 1B9FA 4I2QA 4RG8A 3OYGA 4RW8A 3LWMA 1EX4A 4ZHRA 4EZ6A 3M8PA 1B92A 2JLEA 4FCYA 4DF4A 4KTWA 2DY4A 3MEEA 4QCLA 3NE6A 4DFJA 5CZ1A 4FJ5A 4N5SA 4GVMA 4DTSA 3AVCA 1NJZA 4LH5A 4Q0BA 3NF7A 2O4GA 4OVLA 2D0BA 4F8RA 3PV8A 4CGFA 1ZYQA 5FROA 3CFRA 4HHTA 3QO9A 4F3OA
chains in the Genus database with same CATH superfamily
4CBXA 3VQ4A 1NOZA 2KW4A 5DM6L 4FOEA 4EZ9A 3F9MA 1DKGD 3VQ8A 3AA4A 4K8ZA 4LC9B 2KKZA 4KB0A 4M3TA 4AHSA 4BREA 3L2QA 2FXUA 4DR5K 3M3ZA 4LD0A 3CIPA 4XH5A 4AHTA 2CH5A 4FZYA 2GUIA 4DKWA 3PO4A 3CJCA 4BG8A 3SQ1A 3FZLA 3VQ6A 4FLYA 1HJRA 3OYEA 4DS4A 3SQ2A 3O9UA 3U9ZA 3NF6A 4MDAA 3U3GA 3CFPA 4N41A 3IRXA 2NRTA 4M3WA 4DV4K 3KKSA 4CEAA 4XEIA 2HVIA 3KTQA 4CE9A 3TAPA 4PKIA 1Z6RA 2O8DA 1JLAA 4NLCA 4CF0A 2KQ2A 1O1WA 2P9UB 2O8EB 4W5TA 4IOAL 3MXMA 2HHQA 1WAJA 2OTLN 3S3NA 4IZ9A 2OZSA 3DLKA 5IWAK 4JRPA 1RBTA 3L2VA 4Z4EA 3VQ9A 1RDBA 2A3ZA 2E20A 4IO9L 3RRHA 3VQEA 4O44A 1WLJA 3O8MA 1JCGA 4Z4HA 1LWCA 4B9LA 1TK5A 4H5TA 4DLGA 1T7PA 2ETJA 2F8TA 2VWBA 5FLXO 2YHXA 5KQDA 1JLFA 1BO5O 4IOCL 3CC4N 4BRDA 3NGZA 4F2RA 4DQRA 5JVHL 1QTMA 1HPZA 3TTCA 4MLHA 3ZT1A 3T69A 4KREA 1S9GA 4CZFA 2HNYA 4KTZA 3ULDA 3U6FA 4JI7K 3RTVA 4IXCA 4CIGA 3VEZA 1XMQK 1C1BA 2VG6A 3O9SA 2P51A 3U4LA 3LPUA 1ATSA 1KSPA 2RHKA 3SQ0A 3QEXA 3NF9A 4DQQA 1HYSA 2PAVA 3O4NA 4H0TB 3AVLA 5AQOA 1NGIA 3HK2A 1G15A 5C2FA 1WSIA 5AQHA 4E7IA 2ZD1A 1UWBA 4CZIA 1YAGA 3RMBA 3IUCA 4BRQA 3SYZA 4NCBA 4A62A 4J2DA 5AQWA 5HLFA 1RDUA 3ALYA 4B3SK 2QKBA 4FK4A 5J2NA 3E1YA 4DTUA 2DTUA 4CGHA 2HMPA 4DTRA 1T6DA 1JKHA 2G8IA 3QEPA 3VA0A 3TABA 4FJLA 2O8BA 2JWLA 4BQLA 2IVOA 5M1PA 2VWJA 4DR6K 3UKUB 1TL1A 2FF6A 1XQSC 2Y1IA 1GLLO 3DOLA 3QEWA 2PZSA 1RBRA 5CYQA 3ZX3A 4Z94A 3AO1A 5M1OA 4FLWA 3ZT0A 4B9UA 4DSFA 4FSVA 5KPZA 4B3MK 1S1VA 2VYPA 4BRLA 1W2BM 1QE1A 3DXKA 3BZCA 5GAEP 2D5RA 3MWPA 3MAQA 4OPKA 1Y97A 3WEEB 3ZETB 4YNQA 1SS6A 1TKDA 3LZJA 4CJQA 4NCAA 4Z0UA 2YHBA 1LCUA 1QVGM 3AO3A 1BHLA 2VGMA 3AA3A 3FFKB 1Q82O 1TGOA 3WXLA 4PHTX 4DLEA 2AA4A 3L2UA 3MMVA 4MFBA 4H8KA 4MLEA 3AVAA 3NMUA 1RT3A 1J6ZA 4PY5A 3TI0A 3PSIA 3NVKA 3IKMA 3IG1A 4X62K 2O4IA 3TSQA 3VQBA 2ZE2A 1VQ9N 3VGLA 1MWMA 1XC9A 5HOOA 4CEEA 2HSTA 3OA9A 3I8BA 1W9HA 2IVNA 1J5OA 2P9IA 5I9EB 3DJCA 1ZC6A 3KLIA 4FM1A 3ID8A 4FL9A 4BQZA 3UKRB 4C1NK 1TAQA 2F9TA 1N36K 2CH6A 2HNDA 1YIJN 4J2BA 3KLHA 4FJ9A 1M90O 2G8HA 4CBWA 4O55A 3KLFA 3V1RA 2UXDK 1EWRA 1NK4A 3ZSVA 1N8RO 1HJOA 2XY8A 3O1WA 1CZ9A 5FPNA 1KLMA 3HI0A 4Y1CA 1Z26A 1QZ5A 4M7XA 1LWEA 4KH4A 1KVAA 3P4IA 1YJNN 2RN2A 3P38A 1GLDG 3ENBA 4OGCA 1RBVA 2P9PB 2IC3A 1D5AA 4KHYA 1TV6A 5GIOA 3HOTA 3L2RA 3M6GA 1HKBA 1EQYA 4CK2A 3HXMA 4JI1K 3V81A 4CIEA 2FSJA 4KO0A 4BDZA 2E8AA 3TARA 1QQMA 3VQAA 5FRMA 3DI6A 4E7HA 1WAFA 2B4JA 4CEZA 1ILYA 3R3LA 3I0RA 3QBWA 2P5OA 4O8UA 2VQEK 4DUZK 3OVNA 3P5JA 3EKSA 1S72N 5LMUK 1NK0A 4KV8A 4JI0K 3PSFA 3C6AA 1BIUA 4GKKK 4CZJA 3H3NO 4HUGA 3HOSA 4LF8K 4WQ5C 4I9LA 3CC2N 3DLRA 4LF7K 3FZMA 4RCHA 3MX2A 4H0VB 3DLHA 1BISA 1VQ7N 2YX6A 4N56A 4U7BA 3OBWA 4JKGA 3HPHA 4H03B 2Z1JA 3M1FA 1SV5A 3TR8A 4BRHA 3G10A 2V52B 1RT4A 5BN8A 3O5BA 3NF8A 3SPZA 1S22A 2IS3A 4JKDA 4AHUA 3V9WA 1T3VA 2G8FA 1X9JA 3WNFA 3R8EA 3L3UA 2I5JA 5AR0A 4RW9A 3CD6N 3PUFA 3ZSOA 4ISFA 3KLEA 1TK0A 2NRRA 3DMJA 1YTAA 4BDYA 4H4MA 4X65K 5DK5A 3FGUA 5AFUA 2OCEA 3D2EB 3MEDA 1KRPA 1BDGA 3VGKA 1XI1A 2UUCK 3L8BA 3M8QA 3ISNC 3ULEB 4IDKA 4DQ8A 5AZJA 1U48A 4Y1DA 4FWKA 4CJ3A 1J9AA 3DRSA 1U49A 4YORA 5J2QA 1LOTB 1CZAN 4OPJA 1QSLA 1EKEA 3DXMA 4UQGA 1WBDA 4HCCA 2CGKA 3CYMA 4CJWA 1SAZA 1NOYA 3CJ7A 4IG0A 1BUPA 3KIOA 4OO1J 4E89A 2FBVA 3CXCM 5AQYA 3KK1A 3H6EA 3HJFA 3FFIA 2D0CA 4U67L 3SJJA 4B3TK 1NK8A 1RT5A 1OH6A 4CIFA 4JI8K 2QWNA 3ZSZA 4BRPA 3NGYA 3C0BA 2E5LK 4IFYA 3MDQA 3I56N 3K5MA 3QBXA 5AQMA 4CW7B 4B9MA 3J7YP 4WFNL 3VEOA 1D9DA 1DTQA 5EX5A 1VSIA 3KD5E 4M3XA 2DFFA 3DLEA 5KGXA 1VQ5N 3I0SA 3VQ7A 4EFHA 3CHWA 4CK3A 2A40A 3OYGA 1RFQA 3HZ6A 3LWMA 1EX4A 2JLEA 4FCYA 3F2KA 2P9LA 3NE6A 3LDQA 4DFJA 4CZGA 1HPMA 4FJ5A 4JKEA 4B1ZA 4Q0BA 4F8RA 4CVNE 3PV8A 4HHTA 3N4PA 3O1BA 4BC3A 1L3VA 4BGAA 3JXUA 3AVHA 2ITMA 5HRSA 3K9KA 2CGJA 1RGIA 3CM6A 4QS7A 1KLNA 4YY3K 4H5WA 3OBYA 1C1CA 3WUHA 3QIOA 3FR0A 4RWTA 3ZLJA 5AQQA 3OS0A 1MA9B 5AZIA 3CCSN 1YT3A 1WOQA 4FM2A 1XNRK 1YHQN 4E1NA 1IKYA 4IFEA 3KWGA 4E1MA 4H0PA 5DM7L 1N6QA 1IBMK 3S9HA 3RSEA 3AY9A 3MN9A 1EWQA 1C0TA 5LMNK 1VSLA 2I7PA 4IO8A 3Q7CA 4CJSA 4CEDA 3QB0A 3T1AA 4JKHA 3J80O 4IWVA 4M42A 3OJUA 1LV5A 2OPSA 3UIQA 4AM6A 4BVOA 4RW4A 3IS9A 3THXA 3J81O 3LDPA 3OYKA 4EAHD 4MO4A 4KAZA 1Q18A 1NM1A 3ID6A 4B08A 4FWQA 3LM2A 2HF4A 5GAGP 4BR5A 4CHQA 5KI6A 2P9KA 3L4QA 3MXJA 3H3OB 2QXFA 1VQNN 1U4BA 3LALA 2BE2A 1SKSA 4AM7A 2F7TA 4EIAA 3V9XA 1S6PA 2VQFK 2HHHK 4CEOA 4CHNA 1JLEA 2E1ZA 5LJWA 5FRNA 4E19A 1MWKA 3M5RA 2E2PA 1BU6O 4GNIA 4I9QA 4FJMA 3S3OA 2YI1A 3LDSA 5BPLA 1TAUA 5EVZA 3LAMA 1C0MA 4IJAA 1WBBA 4ELUA 5C0YA 3QEIA 1WN7A 1KAZA 3AAPA 2OPQA 1L3SA 5AQUA 2WBNA 3S3MA 3RMDA 2P5GA 3I33A 4NXMK 5F2RA 2KFZA 3ZSXA 2G8UA 4JD2A 3BUZB 2RPIA 1V4SA 5LJVA 1UA0A 1VSKA 4HUFA 4M3UA 2A6AA 1OH8A 2F9WA 2ZM6K 2ZJQL 2X78A 2KZMA 3OYLA 3QMLA 1NKEA 1ZBHA 5C12A 3AGRA 3ZSWA 5I42A 4CFCA 3OYBA 3WQTA 4IFVA 4FW1A 4AILC 3KWIA 5IT9O 4HVJA 1T03A 4EHUA 4R79A 3G0ZA 3NHGA 5BRDA 3ZEUA 4DV2K 4Z4IA 4CCHA 1QS4A 3HO1A 4CD1A 3EE8A 3LL3A 3H08A 4M63C 1L3UA 5M1KA 5BRFA 2YKNA 3KLGA 2GEMA 3SUNA 4M3YA 5AQXA 4YDUA 3D0PA 4C8KA 4Z4GA 3C7NB 1JCEA 4L3QA 1U04A 4F9OA 4A61A 3OYCA 4BR7A 3CFOA 3EEQA 3G4SN 4DQIA 3SBGA 1BQNA 4E0DA 3MX5A 3CMAN 1YUWA 2VG7A 3CCUN 3HL8A 2Q2RA 5EU7A 1HKCA 2E88A 4M3RA 1D8YA 2XO7A 4IG3A 3EL2A 2EWSA 3IFRA 3CCEN 1ZBIA 2GX9A 3THWA 2BTFA 2QA4N 2UYTA 1RTDA 4JKGB 5CE3A 5JS1A 3IDHA 1B9DA 2WFBA 4L8RB 4Z4FA 1J53A 3TPQA 1ASVA 3C95A 4ELTA 3SAFA 4FJNA 3GG4A 3AO2A 1FXXA 1ZBLA 1N32K 2X6NA 5GAHP 3LDLA 3TAEA 3E01A 4PQUA 1RTJA 4M7YA 2XY7A 1BL3A 2QWLA 4JHDB 3K58A 4FJGA 4JN4A 4OKJA 4BRMA 4K0KK 4MO5A 3K0SA 1ASWA 3AVJA 1W97L 1VRTA 3P31A 5E84A 3WXMB 2YJEA 2P9SB 2GBZA 3LP1A 2OA8A 3THYA 4YHHK 3UB5A 3CJ9A 5AQTA 2NLXA 4KFBA 1DEJA 3EZ5A 5J2PA 3WNGA 2YNIA 4IEIA 3V1QA 4CZEA 4CF2A 5GADP 2KTQA 1Q8IA 3DXMB 4FXDA 1X1PA 4O5FA 1R0AA 3HM9A 1WSHA 4DU3A 1SUQA 5GIPA 1SKWA 4FWLA 4ELVA 3V6DA 3LP0A 4JKCA 5B8HA 1HNXK 2UXCK 1OKJA 4CFBA 3B8AX 1W7AA 4GV6A 2NRHA 1NKBA 3CJ1A 3T1HK 4JEPA 3WXKA 1OH5A 1XNQK 3NH0A 1WSGA 3V1OA 4FWMA 1Q7YO 4BC2A 5C15A 1E4GT 3FZFA 1NGGA 2W41A 1ZBUA 2O8FB 3SUPA 1BOTO 5FPEA 4HUEA 1IG8A 4CF8A 4XH4A 3K5OA 1L5UA 4Z4CA 3GL1A 1HYVA 3DWLA 4DS5A 3FE1A 3O4WA 4KPYA 1VQMN 2HHTA 2A41A 3QERA 3QESA 4ILHA 4CESA 4ILGB 4CGIA 3VOVA 1GLFO 1X9WA 2GELA 2XY6A 3QNNA 4PWDA 1JJ2M 1F21A 1SQKA 1Q81O 2GTDA 4B9TA 3VA3A 3ZSQA 4DSIA 1IO2A 4DUYK 4BR4A 3NVMA 3OYIA 1K8KA 4K25A 4ZTJA 3P1GA 4IOXA 2HNZA 2V7YA 5EY4A 4CJEA 5C42A 2ZJRL 4HCBA 4FZXC 3JS6A 4CI6A 1GOCA 1K9MO 4V19S 1BGXT 3I8DA 4YFUA 2HHUA 3QIPA 4BVPA 1RBUA 4AQYK 5KTQA 2E6MA 4JK7A 2OPPA 3NDKA 4BC4A 3ASMA 3BEXA 3ZT3A 1VQON 4B1WB 4BRNA 5BPNA 4CJUA 2ZF5O 4IBNA 2YHYA 1KTQA 3AVNA 3RSEB 4PA1A 5KRSA 5JLHA 5AQLA 4CEFA 2GWKA 4ZTFA 1C1AA 5C10A 3CCJN 3NGIA 4CGGA 4OJRA 4CF9A 3OW2M 3O08A 1SZ2A 1QQNA 3HP6A 4E7KA 4JK9A 1VSFA 3CPWM 1IV0A 2HMIA 4C8MA 4GY2B 2BH1A 1FKPA 2VWKA 3CF5L 3M8SA 1GLBG 4X64K 1GOAA 4PKHA 3J8AA 3CI5A 4FLTA 3MXIA 1EO1A 3EO3A 4LFBK 1BWFO 2P9KB 3CCMN 2EX3A 3O3HA 1TL3A 4DV5K 3PX0A 4DV3K 5BR8K 3OYDA 2IAJA 1YJWN 4BG9A 5CHIA 5DMRA 3D7EO 1JCFA 2QWPA 4RW8A 4ZHRA 5EXWA 2PFUA 4DF4A 4QCLA 1R59O 3WXIA 3BY5A 1E4FT 4GVMA 3A8YA 3AVCA 3MWTA 1NJZA 4LH5A 1QZ6A 3NF7A 4OVLA 4CGFA 1ZYQA 4JKBA 2AP1A 1DT9A 3CFRA 3CCLN 1NGBA 4F3OA 1KXPA 1H1VA 3N4QA 4OLBA 4H0XB 2QXLA 3FZHA 1NK6A 3DYAA 1XUPO 5FDLA 1K8AO 1V4TA 2HBKA 3K2PA 3FZKA 4CHPA 5M1QA 2O8EA 5TKWA 1TYQB 1NK9A 1MU2A 1K6YA 5BRHA 4JD2B 1IH7A 1BG3A 1C0UA 3OS1A 4FJKA 3CETA 2LSNA 4KHQA 3R9PA 3GDQA 1NBWA 1HNWK 5F0XA 4DU1A 1S1TA 3DRRA 3D45A 3RMAA 3EY1A 2OPRA 3V4IA 3RR8A 1ZXOA 3D6RA 4DTXA 3GOIA 4HWIA 5BREA 1WSJA 1VQKN 2HBLA 4K8XA 2QK9A 3OHRA 3O3FA 4O4GA 4G1QA 4LFCK 1RILA 3AVBA 5JICA 4LSLA 2QWQA 4G9ZA 1HX1A 1QSYA 2FC0A 4C23A 1S1WA 1YXQA 1NGEA 1JL2A 3MEGA 1HMVA 2NZTA 1DLOA 2BUPA 1G99A 3ZCMA 5F1XA 1BA1A 4WYBA 2O8DB 3ATVA 1TK8A 1VHXA 4JKAA 4N47A 4Q5VA 4JI3K 1OVQA 1KAYA 1W0HA 2E4LA 2HB5A 3ZSYA 3TAGA 3PY8A 1TUYA 1O13A 2D4WA 4B8AB 1QQOA 3L3VA 3ATUA 2NRVA 3DM2A 4DR2K 4OKEA 5E26A 3TWHA 4FWPA 3SMPA 1WNSA 3DOKA 3F73A 3E66A 3VERA 2W6KA 1QSSA 2YJFA 3L6QA 1A5WA 1JLBA 3W3DA 2FSKA 4FYDA 4ISEA 4GV9A 4LF5K 1YF5L 3E9PA 1NKCA 2BANA 1TKZA 4BRCA 4NYNA 3TSUA 4ISGA 1IG9A 1HQEA 2F4VK 1HLUA 1ASUA 4FJ8A 4H5NA 1WSFA 4DSEA 1NJWA 2Q0RA 3OTOK 5AQFA 4IDHA 4FJ7A 2I7NA 3H1QA 3LANA 4B9NA 1S5JA 4FOIA 4DB3A 2KHOA 2WC9A 3THYB 3GE1A 4B3OA 3ZETA 3WEEA 1KC8O 1N5YA 4CJ4A 3D2FA 4JNEA 1FW6A 2VG5A 3WT0A 1EP4A 3VQCA 3SNNA 4LH4A 4W5QA 3SV3A 5AFUH 1NJYA 1WSEA 2Q3SA 4RW6A 3O9TA 1U45A 1S3XA 1IBKK 3LP2A 2P9NA 4C8OA 4J2AA 1LAVA 1OVYA 1VSHA 3T19A 3OYJA 4EP5A 4R5PA 1NMNA 4K43A 3HPOA 4BRGA 3KHYA 4FJIA 1RDDA 1GLJO 3LDNA 3VQ5A 1DTTA 1ATNA 4AHVA 1P8ZA 3A2FA 1NNEA 1NJXA 4FVUA 1NWKA 3MCPA 4MDBA 4FWOA 2O8BB 3HVRA 2YNGA 3ZYYX 4CFDA 1Z25A 2DFHA 4E3SA 1ZBFA 3QFPA 3T3FA 2ASOA 3EZWA 4NO7A 3ZSRA 1LAWA 2YNHA 3PIPL 3V9ZA 4QOZB 1S1XA 4DTNA 3IAYA 1FK9A 3OYNA 2RF2A 3DXKB 3AVGA 3DRPA 1X3MA 1VQ4N 2FBYA 4CHOA 4N76A 3CM5A 3MCAB 1JLCA 5BPMA 2F96A 1ITGA 4ILJA 5SZTA 3VGMA 1J54A 1RDWX 4O0JA 4F3TA 2EHGA 5M1FA 4DWIA 4A2AA 5AQNA 1K8KB 4FPBA 4KHPK 4YDUC 4BE2A 3A5MC 1N34K 4LSNA 1NK7A 4B8CA 3PX6A 1C6VA 5KQ8A 3A5NC 4XIUA 1LW2A 2HHVA 2YHWA 3JAMO 2P9IB 4IKFA 3AO4A 1S9EA 2V7ZA 1X9MA 3HYFA 3AVKA 4DTPA 4BACA 1IJJA 4DTMA 4BDPA 3P39A 3SUQA 3CJBA 3MN5A 3SLCA 3C6HA 1KD1O 3BZKA 5KPTA 4KHSA 3VESA 2Q0UA 5JLFA 4KKOA 3SAGA 1KFDA 4EP4A 4CJRA 4NLBA 2O8CA 3TAMA 3WNEA 4WQ4A 2NUBA 3LZIA 2UU9K 1LWFA 4CJ5A 4WCEL 3ZT4A 3O9RA 1VAZA 1M1KO 4B1UB 4CJLA 2H3GX 3CC7N 3CJAA 2CGLA 5CR4A 1NG9A 2XY5A 5AQJA 1L3TA 1VK0A 4C8NA 4JK8A 4QS8A 3Q7BA 2KLAA 1EXQA 4PUOA 4OPHA 2B5JA 5HROA 3AO5A 1IKVA 4AF1A 4CHZA 4DFKA 1JL1A 5AQVA 1U2VA 3V9SA 3RWUA 1K73O 3D2EA 3FLCO 4H0OA 3T1YK 2QWRA 3HSTB 1YI2N 1ATRA 4FLUA 1S6QA 2FLOA 3AGKA 2GV9A 4KBOA 4DU4A 1N33K 4LY7A 1VQ6N 3ULEA 3VTIA 2X6SA 3SZ2A 4ICLA 3HM8A 2E2OA 4NB4A 3SV4A 3L2WA 4BGBA 3SUOA 1KCFA 1ZBSA 3NBPA 3SAHA 3KJVA 4WF9L 5HL7L 3ZT2A 2Q31A 3TTDA 4BE1A 3TSPA 5HBMA 2QKKA 4Y0WA 5J1EA 5E41A 1YVNA 4O5BA 1XC3A 4KH5A 4FM0A 2KZZA 4JKFA 3KK2A 2OANA 1TKTA 4CECA 3HPGA 3O4QA 3F5TA 3SI6A 3E9LA 4BRAA 1UOCA 4CJFA 4GVEA 1S1UA 1LW0A 5C24A 4YOUA 3KD1E 1SL1A 4OX9K 4KI6A 4GW6A 1A5VA 3R6MA 3JYTA 4FK0A 5HRNA 1YVUA 4H5RA 3LWLA 4GMJB 5KPRA 1HUXA 1TUUA 4BY9C 3VQQA 4FVMA 3EN9A 5D3GA 4JI4K 3PX4A 1A5XA 1REVA 5AZJB 3SJHA 1RT7A 2PYLA 2BDPA 1KVBA 3G25A 2HBMA 2ZQBA 2HHXA 2FF3B 4DQPA 2IDOA 2PYJA 1HNVA 3GBTA 3ZX2A 1XHXA 1KFSA 4DV0K 4KHNA 4YOTA 1GLCG 4I6MA 4BC5A 1Y64A 3J7ZO 3NH2A 4KB1A 4KHUA 4IJNA 4LFAK 4A59A 4CJ7A 5FPDA 3ENHA 3NFAA 3K57A 3HTVA 4IEEA 4M45A 2VGNA 3AA2A 2HHWA 4FJJA 1BI4A 2WUSA 3QLHA 4FJHA 4B1VA 4DTJA 3VEVA 4BR2A 1B9FA 4I2QA 4RG8A 5BR9A 4EZ6A 1B92A 4BROA 3O6WA 3MEEA 4N5SA 4JI2K 2O4GA 2D0BA 2A5XA 2JWKA 4WE1A 3QO9A 4DR1K 5CYMA 4FK2A 2Z1IA 5JMVA 4C1NI 1NMDA 3NAEA 2Y1JA 4HTLA 3TAQA 4DSKA 5LL6Z 3LP3A 4XH1A 1HKGA 2P1JA 3BP8A 4NXNK 4HTUA 5CZ2A 3SPYA 1DGKN 2P9LB 1QQCA 1RTHA 2NNWA 2QEXN 4YOYA 4CGDA 2JGUA 2YHAA 3DLGA 3HSCA 2ITGA 4CEBA 2QWOA 3VEXA 3OY9A 4DR7K 4A5BA 1NLVA 3KZBA 3QNOA 3D2FB 4BWMA 3VEYA 1U6ZA 3LDOA 1NK5A 4CZKA 2IVPA 2KFNA 4DG1A 3AAQA 3G6EN 4F4KA 4QS9A 3EKUA 4F2SA 1WB9A 3C6TA 5ADXA 1P90A 3CERA 4CZMA 4J8FA 2P9NB 3CPEA 5AQIA 4JS5A 2WONA 4DFMA 4M3ZA 1JLQA 1Q86O 3U8XA 4H4OA 4NCGA 5AZIB 2FBXA 4JLHA 2WTUA 5EOYA 3EE9A 4UY8O 2BGGA 2A1RA 3BF3A 4AHCA 4JI5K 2B6AA 3B6OA 2QM1A 3K5NA 1IKXA 4K42A 4FJXA 2W6LA 3JSMA 3H46O 4EHTA 1GLAG 1TVRA 3VN5A 3VF4A 5C2DA 2HHSA 2Q97A 3LPTA 3KK3A 1D9FA 2W40A 3QEVA 2Z1HA 3F9KA 4YOXA 3VTHA 4BRIA 3SCXA 2OYQA 2XHBA 1ESVA 4LF4K 4AHRA 1HNIA 4OGEA 4LF6K 2Q1NA 3THXB 1RTIA 2J4RA 3MN6A 1J5EK 3VF2A 2YNFA 4PL8A 4CZHA 1VSMA 5KRTA 4NYFA 4CGJA 4ID1A 3V9UA 3UE5A 4JS4A 4FW2A 1NGHA 1BA0A 2ZGYA 3E9OA 4OPAA 1GLEG 5H1SQ 1RT1A 2DPNA 3QINA 5JVGL 4MQ3A 2QWMA 5AQPA 3TANA 5FPMA 3NCIA 5TKYA 4CEQA 4FZZA 2NRZA 1Q9YA 5MLCQ 3VQPA 4KHWA 3RR7A 4RW7A 3A0IX 2G8KA 5J2MA 3PLAA 3VMFB 1D4XA 3IMXA 1IBLK 4B1XB 1HR0K 4BRKA 4M41A 2ASMA 4CJTA 3R1XA 1KVCA 3DAWA 1NJIO 4B3RK 4OLAA 1VQ8N 5ADXH 3C7NA 3WXJA 2P9UA 4E7JA 1EETA 3AVMA 4DHYA 3DLBA 3L0QA 1NGAA 2O8CB 3HRGA 4BE0A 2E2NA 4DV1K 1RDAA 5HRRA 2QW9A 3CMEN 1NGJA 2VCPA 5SWMA 2UXBK 2ZJPL 1UAXA 1E3MA 1VQLN 3O3GA 1FJGK 3TAFA 4KH6A 3M8RA 1BIZA 3CCVN 1RT6A 1GOBA 4K41A 1WUAA 4CJKA 3K59A 1VQPN 3A5OC 3C6UA 1SKRA 4KI4A 1RT2A 4O0IA 4FPAA 1QVFM 4DV6K 3VETA 1NGCA 1Z05A 4FLZA 3CQXA 3WQUA 1VSDA 2F8SA 3SMSA 2D0AA 3ZEUB 4FWRA 4DCHA 4E7LA 5AQGA 4JHDA 5ELZA 1VSJA 1U2VB 1NU0A 3I55N 3VQDA 3G71N 2IGIA 2NRXA 4OKKA 1JXBA 4ID5A 1HNZK 2P9SA 3DLLL 1HYZA 5K14A 1I3AA 3O80A 5M1NA 4AH9A 2FSNA 1RCHA 3QFUA 4PL7A 3TU5A 2WOMA 2PBDA 4JV5K 3THWB 2IIRA 4C8LA 1JLGA 3KK7A 5AQZA 3U3YA 3HVTA 3QETA 3HBTA 2QI2A 2ZWHA 4CJVA 4X66K 4RTFD 3AV9A 3RRGA 2HVHA 3MECA 2YKMA 3AA5X 3CG7A 4CBUA 2UUBK 2D0PA 3J7AP 1BCOA 4WQ5A 2O8FA 4PKGA 1YTUA 4CK1A 5T7BA 4JYAK 4CFAA 4A2BA 3BF1A 3OYHA 3H45C 3UKUA 2AJQA 2QTDA 5GINA 3P83D 1OH7A 1CLQA 3ENOA 1CXQA 4FO0A 1RNHA 4B9SA 4FLXA 3OYAA 2A42A 3VPZA 1HQUA 1RBSA 2HF3A 3H1VX 4YOVA 3C94A 1QHTA 2E2QA 3NH1A 4CERA 1QHAA 3OJSA 1XMOK 1JXEA 3TTFA 3PO5A 4J2EA 4W5NA 3C65A 3HT3A 2NRWA 4YOWA 3BGRA 5AJ3K 3KVGA 2Z1GA 4CJPA 3AVFA 4B1YB 4CD3A 2V51B 1T8EA 5AQRA 4JRQA 4I6MB 3L4IA 4FLVA 3SQ4A 2RE2A 1TKXA 1I94K 5C25A 2OTJN 2W42A 1XWLA 3LM9A 1X3NA 4FWNA 4BWJA 4JI6K 3EYZA 4O8KA 2Q36A 1RDCA 4A5AA 2PY5A 1BI4B 1VRUA 1I39A 2G8WA 4DMNA 3K9JA 4I2PA 4I7FA 4CHYA 4WFAL 4WQ4C 3KKRA 1KQSM 3MN7A 3QICA 4GV3A 2X74A 4DFPA 4BR0A 3OS2A 3UKRA 3SK3A 1MDUB 1FKOA 3WNHA 3OYFA 2ATQA 3BDPA 1BCMA 3K5LA 4A57A 2ASPA 3THVA 1NGDA 1X9SA 3W0LA 3CQYA 2HBJA 2HOEA 4LF9K 3ZX0A 4B9VA 4B9QA 3CCQN 2D1KA 2R7YA 3SBTA 1BQMA 3A5LC 3U9DA 1HRHA 2YV0X 4KRFA 3AVIA 3LAKA 2UUAK 2P9PA 1Q9XA 1NGFA 4W5RA 4WFBL 5BN9A 3CCRN 4DR3K 1IKWA 4BRFA 4DQSA 3PIOL 2XRIA 5HP1A 4H0YB 3VENA 5HRPA 1SL2A 2GWJA 4DSJA 3MK6A 1YJ9N 4W5OA 3RVCA 1U47A 4DF8A 2HW3A 4QAGA 2D0OA 4FWSA 4DTOA 1T05A 3O9QA 5JS2A 1T6CA 5LY3A 1CXUA 3VF6A 2G8VA 4DSLA 3S41A 2RKIA 1CZBA 1XHZA 5I3UA 1VSEA 4BR9A 5A2QO 3QDKA 1UA1A 5AQKA 2DFEA 2GUPA 2OZMA 4KTQA 3B6PA 3OYMA 2A1SA 4CF1A 3CQ8A 1SL0A 2IOCA 5CY4A 3VEWA 2FBTA 4DV7K 5KGWA 3T7ZA 3RMCA 3ITHA 4TSXA 4E1JA 4CZLA 4GKJK 2ZGZA 3AARA 2E6LA 4H5VA 1YITN 4DR4K 3HP9A 4JAXA 2YCHA 1TYQA 1C0FA 3M8PA 4KTWA 2DY4A 2E1YA 5CZ1A 4DTSA 1T44A 1KAXA 5AQSA 5FROA 1C0GA
chains in the Genus database with same CATH topology
5CYMA 1NOZA 3VQ4A 1L3VA 4FK2A 2KW4A 2Z1IA 4OLBA 3AVHA 5HRSA 4EZ9A 3VQ8A 3AA4A 1NK6A 3DYAA 4K8ZA 3CM6A 3NAEA 2Y1JA 3TAQA 4DSKA 4KB0A 5FDLA 4M3TA 3LP3A 1KLNA 3K2PA 4CHPA 4AHSA 2P1JA 3L2QA 4HTUA 1MU2A 1K6YA 4LD0A 1C1CA 5CZ2A 3SPYA 1NK9A 1IH7A 3QIOA 4AHTA 1C0UA 4FZYA 3OS1A 4FJKA 2GUIA 1QQCA 1RTHA 3PO4A 3SQ1A 3OS0A 4CGDA 2JGUA 2YHAA 2LSNA 3DLGA 4CEBA 2ITGA 3VQ6A 4FLYA 1HJRA 3OYEA 4DS4A 3SQ2A 4KHQA 3NF6A 1YT3A 3U3GA 3CFPA 4FM2A 4N41A 3IRXA 3OY9A 4M3WA 4E1NA 1IKYA 3KKSA 4CEAA 2HVIA 3QNOA 4DU1A 1S1TA 4BWMA 4E1MA 1NK5A 3KTQA 3DRRA 2KFNA 4DG1A 3D45A 3RMAA 3EY1A 4CE9A 1N6QA 4F4KA 3TAPA 2OPRA 3V4IA 3S9HA 4F2SA 1JLAA 4CF0A 2KQ2A 3C6TA 1O1WA 3RR8A 4DTXA 4W5TA 1C0TA 3MXMA 1WSJA 1VSLA 2HHQA 4K8XA 2QK9A 1WAJA 4CJSA 4CEDA 4O4GA 3O3FA 2WONA 4JS5A 3S3NA 4G1QA 3T1AA 4DFMA 2OZSA 1JLQA 1RILA 3DLKA 4M3ZA 3AVBA 4H4OA 4NCGA 1RBTA 2FBXA 4JLHA 4LSLA 3OJUA 3L2VA 4JRPA 3VQ9A 1LV5A 4M42A 1RDBA 2OPSA 4Z4EA 3UIQA 3RRHA 3VQEA 4O44A 4RW4A 1QSYA 3IS9A 2FC0A 2BGGA 1S1WA 2A1RA 1JL2A 1WLJA 3MEGA 4AHCA 3OYKA 1HMVA 1DLOA 2B6AA 3B6OA 4Z4HA 1LWCA 4KAZA 4B9LA 3K5NA 1IKXA 4B08A 4FJXA 3ZCMA 3JSMA 4CHQA 5KI6A 1TVRA 3VN5A 1TK5A 2HHSA 4DLGA 3LPTA 2ETJA 3KK3A 1TK8A 1T7PA 1D9FA 2F8TA 1JLFA 4N47A 4Q5VA 3MXJA 3QEVA 2Z1HA 3F9KA 2QXFA 1U4BA 3LALA 2BE2A 1SKSA 3NGZA 1W0HA 2E4LA 2HB5A 3ZSYA 4DQRA 3TAGA 4F2RA 3SCXA 3PY8A 4B8AB 2OYQA 1QTMA 3V9XA 1S6PA 2XHBA 3L3VA 4CEOA 4CHNA 1JLEA 1HPZA 4AHRA 5FRNA 3DM2A 1HNIA 4OGEA 3ZT1A 4E19A 4KREA 4I9QA 1S9GA 4FJMA 4OKEA 3TWHA 3LDSA 3S3OA 1RTIA 2HNYA 4KTZA 2YNFA 3ULDA 3U6FA 3RTVA 1WNSA 3DOKA 4CIGA 1TAUA 1VSMA 5KRTA 3LAMA 1C0MA 1C1BA 2VG6A 4NYFA 3F73A 4ELUA 4CGJA 2P51A 3LPUA 4ID1A 3V9UA 3QEIA 1KSPA 1WN7A 1QSSA 1A5WA 4JS4A 1JLBA 4FW2A 3SQ0A 3QEXA 4FYDA 3NF9A 4DQQA 1HYSA 2OPQA 1NKCA 1L3SA 3O4NA 1RT1A 2BANA 1TKZA 3AVLA 3QINA 4NYNA 3S3MA 4MQ3A 3RMDA 3TANA 1IG9A 2P5GA 1HQEA 3HK2A 3NCIA 1G15A 1ASUA 4CEQA 4FJ8A 4FZZA 2KFZA 3ZSXA 2G8UA 1WSFA 4DSEA 1NJWA 1Q9YA 1WSIA 3VQPA 4KHWA 4E7IA 2RPIA 1UWBA 2ZD1A 3RR7A 3RMBA 3SYZA 1UA0A 4RW7A 4NCBA 1VSKA 2G8KA 4J2DA 4HUFA 4M3UA 4FJ7A 5HLFA 5J2MA 3LANA 4B9NA 3ALYA 1S5JA 2X78A 2KZMA 4B3OA 3OYLA 2QKBA 4FK4A 5J2NA 4M41A 1NKEA 1N5YA 1ZBHA 4CJ4A 4CJTA 4DTUA 2DTUA 1KVCA 4CGHA 2VG5A 4DTRA 1JKHA 1EP4A 3VQCA 3SNNA 2G8IA 4LH4A 3ZSWA 3QEPA 4W5QA 3VA0A 3SV3A 3TABA 4FJLA 4OLAA 5I42A 1NJYA 4CFCA 1WSEA 3OYBA 2VWJA 2Q3SA 4RW6A 1TL1A 4IFVA 1EETA 3AVMA 4E7JA 1U45A 2Y1IA 3DOLA 4FW1A 3QEWA 4AILC 1RBRA 3LP2A 5CYQA 2PZSA 3DLBA 4HVJA 1T03A 4C8OA 4J2AA 3AO1A 1LAVA 4BE0A 3G0ZA 1RDAA 4FLWA 3ZT0A 1VSHA 5HRRA 3T19A 3NHGA 4B9UA 3OYJA 4EP5A 4R5PA 4DSFA 5SWMA 3HPOA 4FJIA 1RDDA 1S1VA 4Z4IA 3VQ5A 1DTTA 1QE1A 1UAXA 4CCHA 1QS4A 3HO1A 4AHVA 2D5RA 3O3GA 3H08A 3MAQA 3A2FA 4OPKA 1Y97A 3TAFA 1L3UA 1NJXA 4YNQA 3M8RA 1TKDA 3LZJA 1BIZA 4CJQA 4NCAA 4Z0UA 2YKNA 1RT6A 1GOBA 2YHBA 3KLGA 3SUNA 4M3YA 3D0PA 3HVRA 2YNGA 3AO3A 4C8KA 4CJKA 3K59A 1BHLA 3AA3A 4Z4GA 1TGOA 1U04A 4CFDA 1Z25A 2DFHA 3L2UA 4DLEA 4E3SA 3C6UA 1ZBFA 3CFOA 3OYCA 3T3FA 1SKRA 4MFBA 1RT2A 4H8KA 4O0IA 4DQIA 4KI4A 3AVAA 1BQNA 1RT3A 4PY5A 4E0DA 2VG7A 1LAWA 3ZSRA 4FLZA 3TI0A 2YNHA 3V9ZA 1VSDA 3HL8A 2F8SA 5EU7A 3IG1A 2O4IA 4QOZB 1S1XA 4M3RA 2D0AA 1D8YA 2XO7A 4DTNA 4IG3A 3IAYA 1FK9A 3VQBA 4E7LA 2ZE2A 3OYNA 2RF2A 1RTDA 1ZBIA 3AVGA 5JS1A 3DRPA 1VSJA 1XC9A 1B9DA 4CEEA 2FBYA 4CHOA 4L8RB 4N76A 3CM5A 3VQDA 1W9HA 4Z4FA 1J5OA 2IGIA 4OKKA 1JLCA 3KLIA 4FM1A 1JXBA 2F96A 1J53A 4ID5A 1ASVA 1ITGA 1HYZA 3C95A 5K14A 1TAQA 1I3AA 5SZTA 4ELTA 1J54A 2HNDA 4AH9A 4FJNA 1RCHA 3AO2A 1FXXA 4O0JA 1ZBLA 4J2BA 2X6NA 2EHGA 3KLHA 4F3TA 4FJ9A 4DWIA 2G8HA 4O55A 3KLFA 3TAEA 3E01A 4BE2A 3V1RA 2WOMA 4PQUA 1RTJA 1NK4A 3ZSVA 2XY7A 4LSNA 1BL3A 4B8CA 1NK7A 3PX6A 1C6VA 4C8LA 1JLGA 2XY8A 3U3YA 1CZ9A 3HVTA 3K58A 3QETA 4FJGA 1KLMA 4Y1CA 4OKJA 4XIUA 1Z26A 1LWEA 1LW2A 2HHVA 4CJVA 4IKFA 1KVAA 1ASWA 3AO4A 1S9EA 3AV9A 3AVJA 1VRTA 1X9MA 3RRGA 2HVHA 3HYFA 2RN2A 2YKMA 2GBZA 3LP1A 3AA5X 3MECA 3CG7A 2OA8A 3AVKA 4DTPA 4BACA 4DTMA 4BDPA 4KFBA 3SUQA 3EZ5A 5J2PA 4OGCA 1BCOA 3WNGA 2YNIA 4CF2A 3V1QA 1RBVA 2KTQA 1Q8IA 1YTUA 2IC3A 4CK1A 5T7BA 1D5AA 4CFAA 4KHYA 4KHSA 3OYHA 1X1PA 4FXDA 1R0AA 2AJQA 3HM9A 1TV6A 1WSHA 3P83D 4DU3A 1CLQA 1SUQA 1CXQA 4KKOA 3L2RA 1SKWA 1RNHA 4B9SA 1KFDA 3LP0A 3V6DA 4ELVA 4FLXA 3OYAA 4EP4A 4CFBA 4CK2A 1HQUA 1RBSA 4CJRA 3HXMA 3TAMA 3V81A 4CIEA 3WNEA 4KO0A 2NUBA 4BDZA 3C94A 1QHTA 3LZIA 3NH1A 3TARA 1NKBA 3VQAA 5FRMA 4CERA 3DI6A 4E7HA 3NH0A 1WAFA 3OJSA 1WSGA 2B4JA 1LWFA 3V1OA 4CEZA 3I0RA 1JXEA 3PO5A 2P5OA 4J2EA 4W5NA 4CJ5A 3HT3A 3ZT4A 3OVNA 3P5JA 3BGRA 1ZBUA 4CJLA 3SUPA 1NK0A 2Z1GA 4KV8A 4CJPA 3AVFA 4HUEA 1BIUA 4CF8A 3K5OA 2XY5A 1L5UA 1T8EA 4Z4CA 1L3TA 4JRQA 1VK0A 4FLVA 4C8NA 1HYVA 3SQ4A 4DS5A 4HUGA 4KPYA 4I9LA 1TKXA 5C25A 2HHTA 3DLRA 2W42A 1EXQA 3QERA 1XWLA 3QESA 3DLHA 1BISA 4BWJA 4PUOA 3EYZA 4N56A 2B5JA 1RDCA 4CESA 5HROA 3AO5A 2PY5A 1BI4B 1VRUA 1IKVA 4CGIA 3HPHA 2Z1JA 1I39A 1SV5A 1JL1A 3TR8A 4CHZA 3G10A 3V9SA 4DFKA 2G8WA 4DMNA 1RT4A 1X9WA 3RWUA 3NF8A 3SPZA 4I2PA 2IS3A 4I7FA 4WE1A 4AHUA 4CHYA 3V9WA 3HSTB 3KKRA 4FLUA 1S6QA 2XY6A 2G8FA 3QNNA 3WNFA 4PWDA 1F21A 2GV9A 2X74A 3L3UA 4DFPA 4DU4A 3OS2A 2I5JA 4LY7A 4RW9A 4B9TA 3VA3A 3ZSQA 1FKOA 4DSIA 2X6SA 3WNHA 4ICLA 3PUFA 1IO2A 3SZ2A 3ZSOA 3OYIA 3OYFA 2ATQA 3BDPA 4ZTJA 3KLEA 3P1GA 3SV4A 1TK0A 1BCMA 3K5LA 3DMJA 3THVA 1YTAA 3L2WA 4BDYA 1X9SA 3SUOA 1KCFA 4H4MA 2HNZA 3NBPA 3KJVA 4CJEA 5DK5A 5C42A 4HCBA 3ZT2A 4B9VA 4FZXC 3MEDA 1KRPA 4BE1A 2QKKA 5HBMA 2R7YA 5J1EA 5E41A 1XI1A 4O5BA 3L8BA 1GOCA 4FM0A 2KZZA 3KK2A 3M8QA 1BGXT 1BQMA 3ISNC 1TKTA 4CECA 3I8DA 4YFUA 3HPGA 3O4QA 2HHUA 4IDKA 3QIPA 3SI6A 1RBUA 1U48A 1HRHA 4Y1DA 1UOCA 4CJ3A 1J9AA 5KTQA 2YV0X 3DRSA 4CJFA 1U49A 2E6MA 5J2QA 1S1UA 2OPPA 1LW0A 4OPJA 3NDKA 1QSLA 3AVIA 3LAKA 4KRFA 1EKEA 3ASMA 1Q9XA 4UQGA 5C24A 4W5RA 3ZT3A 3KD1E 4HCCA 1SL1A 1IKWA 3CYMA 4CJWA 4KI6A 4GW6A 4CJUA 4DQSA 1NOYA 1A5VA 3JYTA 4IG0A 2XRIA 3KIOA 5HP1A 4IBNA 4E89A 2FBVA 4FK0A 5HRNA 5HRPA 1SL2A 1YVUA 1KTQA 3AVNA 4PA1A 5KRSA 4DSJA 4CEFA 4GMJB 4W5OA 3KK1A 3LWLA 4DF8A 1U47A 3HJFA 2HW3A 4ZTFA 4QAGA 3FFIA 1C1AA 2D0CA 4DTOA 3VQQA 3SJJA 4FVMA 3NGIA 1NK8A 1T05A 5JS2A 1RT5A 5D3GA 4CIFA 1CXUA 4CGGA 4OJRA 3PX4A 2G8VA 1A5XA 4CF9A 1REVA 4DSLA 1RT7A 3ZSZA 2PYLA 2RKIA 2BDPA 1KVBA 1CZBA 3NGYA 3HP6A 4E7KA 1XHZA 5I3UA 2ZQBA 1VSEA 1VSFA 2HHXA 4IFYA 1UA1A 2DFEA 4DQPA 2IDOA 2PYJA 2OZMA 1HNVA 3K5MA 2HMIA 1XHXA 4C8MA 4KTQA 1KFSA 4B9MA 3B6PA 3OYMA 2A1SA 4KHNA 4CF1A 3CQ8A 1FKPA 1SL0A 1D9DA 3NH2A 2IOCA 2VWKA 4KB1A 3M8SA 4KHUA 5CY4A 1DTQA 1GOAA 2FBTA 4FLTA 3NFAA 3MXIA 3K57A 5KGWA 1VSIA 3RMCA 4M45A 3ITHA 4TSXA 2EX3A 3O3HA 3KD5E 1TL3A 3AA2A 3PX0A 2HHWA 4M3XA 2DFFA 4FJJA 1BI4A 3DLEA 3OYDA 5KGXA 2IAJA 3QLHA 2E6LA 3I0SA 4FJHA 3VQ7A 5DMRA 3HP9A 4DTJA 4CK3A 1B9FA 4I2QA 4RG8A 3OYGA 4RW8A 3LWMA 1EX4A 4ZHRA 4EZ6A 3M8PA 1B92A 2JLEA 4FCYA 4DF4A 4KTWA 2DY4A 3MEEA 4QCLA 3NE6A 4DFJA 5CZ1A 4FJ5A 4N5SA 4GVMA 4DTSA 3AVCA 1NJZA 4LH5A 4Q0BA 3NF7A 2O4GA 4OVLA 2D0BA 4F8RA 3PV8A 4CGFA 1ZYQA 5FROA 3CFRA 4HHTA 3QO9A 4F3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CYM A;  1NOZ A;  3VQ4 A;  1L3V A;  4FK2 A;  2KW4 A;  2Z1I A;  4OLB A;  3AVH A;  5HRS A;  4EZ9 A;  3VQ8 A;  3AA4 A;  1NK6 A;  3DYA A;  4K8Z A;  3CM6 A;  3NAE A;  2Y1J A;  3TAQ A;  4DSK A;  4KB0 A;  5FDL A;  4M3T A;  3LP3 A;  1KLN A;  3K2P A;  4CHP A;  4AHS A;  2P1J A;  3L2Q A;  4HTU A;  1MU2 A;  1K6Y A;  4LD0 A;  1C1C A;  5CZ2 A;  3SPY A;  1NK9 A;  1IH7 A;  3QIO A;  4AHT A;  1C0U A;  4FZY A;  3OS1 A;  4FJK A;  2GUI A;  1QQC A;  1RTH A;  3PO4 A;  3SQ1 A;  3OS0 A;  4CGD A;  2JGU A;  2YHA A;  2LSN A;  3DLG A;  4CEB A;  2ITG A;  3VQ6 A;  4FLY A;  1HJR A;  3OYE A;  4DS4 A;  3SQ2 A;  4KHQ A;  3NF6 A;  1YT3 A;  3U3G A;  3CFP A;  4FM2 A;  4N41 A;  3IRX A;  3OY9 A;  4M3W A;  4E1N A;  1IKY A;  3KKS A;  4CEA A;  2HVI A;  3QNO A;  4DU1 A;  1S1T A;  4BWM A;  4E1M A;  1NK5 A;  3KTQ A;  3DRR A;  2KFN A;  4DG1 A;  3D45 A;  3RMA A;  3EY1 A;  4CE9 A;  1N6Q A;  4F4K A;  3TAP A;  2OPR A;  3V4I A;  3S9H A;  4F2S A;  1JLA A;  4CF0 A;  2KQ2 A;  3C6T A;  1O1W A;  3RR8 A;  4DTX A;  4W5T A;  1C0T A;  3MXM A;  1WSJ A;  1VSL A;  2HHQ A;  4K8X A;  2QK9 A;  1WAJ A;  4CJS A;  4CED A;  4O4G A;  3O3F A;  2WON A;  4JS5 A;  3S3N A;  4G1Q A;  3T1A A;  4DFM A;  2OZS A;  1JLQ A;  1RIL A;  3DLK A;  4M3Z A;  3AVB A;  4H4O A;  4NCG A;  1RBT A;  2FBX A;  4JLH A;  4LSL A;  3OJU A;  3L2V A;  4JRP A;  3VQ9 A;  1LV5 A;  4M42 A;  1RDB A;  2OPS A;  4Z4E A;  3UIQ A;  3RRH A;  3VQE A;  4O44 A;  4RW4 A;  1QSY A;  3IS9 A;  2FC0 A;  2BGG A;  1S1W A;  2A1R A;  1JL2 A;  1WLJ A;  3MEG A;  4AHC A;  3OYK A;  1HMV A;  1DLO A;  2B6A A;  3B6O A;  4Z4H A;  1LWC A;  4KAZ A;  4B9L A;  3K5N A;  1IKX A;  4B08 A;  4FJX A;  3ZCM A;  3JSM A;  4CHQ A;  5KI6 A;  1TVR A;  3VN5 A;  1TK5 A;  2HHS A;  4DLG A;  3LPT A;  2ETJ A;  3KK3 A;  1TK8 A;  1T7P A;  1D9F A;  2F8T A;  1JLF A;  4N47 A;  4Q5V A;  3MXJ A;  3QEV A;  2Z1H A;  3F9K A;  2QXF A;  1U4B A;  3LAL A;  2BE2 A;  1SKS A;  3NGZ A;  1W0H A;  2E4L A;  2HB5 A;  3ZSY A;  4DQR A;  3TAG A;  4F2R A;  3SCX A;  3PY8 A;  4B8A B;  2OYQ A;  1QTM A;  3V9X A;  1S6P A;  2XHB A;  3L3V A;  4CEO A;  4CHN A;  1JLE A;  1HPZ A;  4AHR A;  5FRN A;  3DM2 A;  1HNI A;  4OGE A;  3ZT1 A;  4E19 A;  4KRE A;  4I9Q A;  1S9G A;  4FJM A;  4OKE A;  3TWH A;  3LDS A;  3S3O A;  1RTI A;  2HNY A;  4KTZ A;  2YNF A;  3ULD A;  3U6F A;  3RTV A;  1WNS A;  3DOK A;  4CIG A;  1TAU A;  1VSM A;  5KRT A;  3LAM A;  1C0M A;  1C1B A;  2VG6 A;  4NYF A;  3F73 A;  4ELU A;  4CGJ A;  2P51 A;  3LPU A;  4ID1 A;  3V9U A;  3QEI A;  1KSP A;  1WN7 A;  1QSS A;  1A5W A;  4JS4 A;  1JLB A;  4FW2 A;  3SQ0 A;  3QEX A;  4FYD A;  3NF9 A;  4DQQ A;  1HYS A;  2OPQ A;  1NKC A;  1L3S A;  3O4N A;  1RT1 A;  2BAN A;  1TKZ A;  3AVL A;  3QIN A;  4NYN A;  3S3M A;  4MQ3 A;  3RMD A;  3TAN A;  1IG9 A;  2P5G A;  1HQE A;  3HK2 A;  3NCI A;  1G15 A;  1ASU A;  4CEQ A;  4FJ8 A;  4FZZ A;  2KFZ A;  3ZSX A;  2G8U A;  1WSF A;  4DSE A;  1NJW A;  1Q9Y A;  1WSI A;  3VQP A;  4KHW A;  4E7I A;  2RPI A;  1UWB A;  2ZD1 A;  3RR7 A;  3RMB A;  3SYZ A;  1UA0 A;  4RW7 A;  4NCB A;  1VSK A;  2G8K A;  4J2D A;  4HUF A;  4M3U A;  4FJ7 A;  5HLF A;  5J2M A;  3LAN A;  4B9N A;  3ALY A;  1S5J A;  2X78 A;  2KZM A;  4B3O A;  3OYL A;  2QKB A;  4FK4 A;  5J2N A;  4M41 A;  1NKE A;  1N5Y A;  1ZBH A;  4CJ4 A;  4CJT A;  4DTU A;  2DTU A;  1KVC A;  4CGH A;  2VG5 A;  4DTR A;  1JKH A;  1EP4 A;  3VQC A;  3SNN A;  2G8I A;  4LH4 A;  3ZSW A;  3QEP A;  4W5Q A;  3VA0 A;  3SV3 A;  3TAB A;  4FJL A;  4OLA A;  5I42 A;  1NJY A;  4CFC A;  1WSE A;  3OYB A;  2VWJ A;  2Q3S A;  4RW6 A;  1TL1 A;  4IFV A;  1EET A;  3AVM A;  4E7J A;  1U45 A;  2Y1I A;  3DOL A;  4FW1 A;  3QEW A;  4AIL C;  1RBR A;  3LP2 A;  5CYQ A;  2PZS A;  3DLB A;  4HVJ A;  1T03 A;  4C8O A;  4J2A A;  3AO1 A;  1LAV A;  4BE0 A;  3G0Z A;  1RDA A;  4FLW A;  3ZT0 A;  1VSH A;  5HRR A;  3T19 A;  3NHG A;  4B9U A;  3OYJ A;  4EP5 A;  4R5P A;  4DSF A;  5SWM A;  3HPO A;  4FJI A;  1RDD A;  1S1V A;  4Z4I A;  3VQ5 A;  1DTT A;  1QE1 A;  1UAX A;  4CCH A;  1QS4 A;  3HO1 A;  4AHV A;  2D5R A;  3O3G A;  3H08 A;  3MAQ A;  3A2F A;  4OPK A;  1Y97 A;  3TAF A;  1L3U A;  1NJX A;  4YNQ A;  3M8R A;  1TKD A;  3LZJ A;  1BIZ A;  4CJQ A;  4NCA A;  4Z0U A;  2YKN A;  1RT6 A;  1GOB A;  2YHB A;  3KLG A;  3SUN A;  4M3Y A;  3D0P A;  3HVR A;  2YNG A;  3AO3 A;  4C8K A;  4CJK A;  3K59 A;  1BHL A;  3AA3 A;  4Z4G A;  1TGO A;  1U04 A;  4CFD A;  1Z25 A;  2DFH A;  3L2U A;  4DLE A;  4E3S A;  3C6U A;  1ZBF A;  3CFO A;  3OYC A;  3T3F A;  1SKR A;  4MFB A;  1RT2 A;  4H8K A;  4O0I A;  4DQI A;  4KI4 A;  3AVA A;  1BQN A;  1RT3 A;  4PY5 A;  4E0D A;  2VG7 A;  1LAW A;  3ZSR A;  4FLZ A;  3TI0 A;  2YNH A;  3V9Z A;  1VSD A;  3HL8 A;  2F8S A;  5EU7 A;  3IG1 A;  2O4I A;  4QOZ B;  1S1X A;  4M3R A;  2D0A A;  1D8Y A;  2XO7 A;  4DTN A;  4IG3 A;  3IAY A;  1FK9 A;  3VQB A;  4E7L A;  2ZE2 A;  3OYN A;  2RF2 A;  1RTD A;  1ZBI A;  3AVG A;  5JS1 A;  3DRP A;  1VSJ A;  1XC9 A;  1B9D A;  4CEE A;  2FBY A;  4CHO A;  4L8R B;  4N76 A;  3CM5 A;  3VQD A;  1W9H A;  4Z4F A;  1J5O A;  2IGI A;  4OKK A;  1JLC A;  3KLI A;  4FM1 A;  1JXB A;  2F96 A;  1J53 A;  4ID5 A;  1ASV A;  1ITG A;  1HYZ A;  3C95 A;  5K14 A;  1TAQ A;  1I3A A;  5SZT A;  4ELT A;  1J54 A;  2HND A;  4AH9 A;  4FJN A;  1RCH A;  3AO2 A;  1FXX A;  4O0J A;  1ZBL A;  4J2B A;  2X6N A;  2EHG A;  3KLH A;  4F3T A;  4FJ9 A;  4DWI A;  2G8H A;  4O55 A;  3KLF A;  3TAE A;  3E01 A;  4BE2 A;  3V1R A;  2WOM A;  4PQU A;  1RTJ A;  1NK4 A;  3ZSV A;  2XY7 A;  4LSN A;  1BL3 A;  4B8C A;  1NK7 A;  3PX6 A;  1C6V A;  4C8L A;  1JLG A;  2XY8 A;  3U3Y A;  1CZ9 A;  3HVT A;  3K58 A;  3QET A;  4FJG A;  1KLM A;  4Y1C A;  4OKJ A;  4XIU A;  1Z26 A;  1LWE A;  1LW2 A;  2HHV A;  4CJV A;  4IKF A;  1KVA A;  1ASW A;  3AO4 A;  1S9E A;  3AV9 A;  3AVJ A;  1VRT A;  1X9M A;  3RRG A;  2HVH A;  3HYF A;  2RN2 A;  2YKM A;  2GBZ A;  3LP1 A;  3AA5 X;  3MEC A;  3CG7 A;  2OA8 A;  3AVK A;  4DTP A;  4BAC A;  4DTM A;  4BDP A;  4KFB A;  3SUQ A;  3EZ5 A;  5J2P A;  4OGC A;  1BCO A;  3WNG A;  2YNI A;  4CF2 A;  3V1Q A;  1RBV A;  2KTQ A;  1Q8I A;  1YTU A;  2IC3 A;  4CK1 A;  5T7B A;  1D5A A;  4CFA A;  4KHY A;  4KHS A;  3OYH A;  1X1P A;  4FXD A;  1R0A A;  2AJQ A;  3HM9 A;  1TV6 A;  1WSH A;  3P83 D;  4DU3 A;  1CLQ A;  1SUQ A;  1CXQ A;  4KKO A;  3L2R A;  1SKW A;  1RNH A;  4B9S A;  1KFD A;  3LP0 A;  3V6D A;  4ELV A;  4FLX A;  3OYA A;  4EP4 A;  4CFB A;  4CK2 A;  1HQU A;  1RBS A;  4CJR A;  3HXM A;  3TAM A;  3V81 A;  4CIE A;  3WNE A;  4KO0 A;  2NUB A;  4BDZ A;  3C94 A;  1QHT A;  3LZI A;  3NH1 A;  3TAR A;  1NKB A;  3VQA A;  5FRM A;  4CER A;  3DI6 A;  4E7H A;  3NH0 A;  1WAF A;  3OJS A;  1WSG A;  2B4J A;  1LWF A;  3V1O A;  4CEZ A;  3I0R A;  1JXE A;  3PO5 A;  2P5O A;  4J2E A;  4W5N A;  4CJ5 A;  3HT3 A;  3ZT4 A;  3OVN A;  3P5J A;  3BGR A;  1ZBU A;  4CJL A;  3SUP A;  1NK0 A;  2Z1G A;  4KV8 A;  4CJP A;  3AVF A;  4HUE A;  1BIU A;  4CF8 A;  3K5O A;  2XY5 A;  1L5U A;  1T8E A;  4Z4C A;  1L3T A;  4JRQ A;  1VK0 A;  4FLV A;  4C8N A;  1HYV A;  3SQ4 A;  4DS5 A;  4HUG A;  4KPY A;  4I9L A;  1TKX A;  5C25 A;  2HHT A;  3DLR A;  2W42 A;  1EXQ A;  3QER A;  1XWL A;  3QES A;  3DLH A;  1BIS A;  4BWJ A;  4PUO A;  3EYZ A;  4N56 A;  2B5J A;  1RDC A;  4CES A;  5HRO A;  3AO5 A;  2PY5 A;  1BI4 B;  1VRU A;  1IKV A;  4CGI A;  3HPH A;  2Z1J A;  1I39 A;  1SV5 A;  1JL1 A;  3TR8 A;  4CHZ A;  3G10 A;  3V9S A;  4DFK A;  2G8W A;  4DMN A;  1RT4 A;  1X9W A;  3RWU A;  3NF8 A;  3SPZ A;  4I2P A;  2IS3 A;  4I7F A;  4WE1 A;  4AHU A;  4CHY A;  3V9W A;  3HST B;  3KKR A;  4FLU A;  1S6Q A;  2XY6 A;  2G8F A;  3QNN A;  3WNF A;  4PWD A;  1F21 A;  2GV9 A;  2X74 A;  3L3U A;  4DFP A;  4DU4 A;  3OS2 A;  2I5J A;  4LY7 A;  4RW9 A;  4B9T A;  3VA3 A;  3ZSQ A;  1FKO A;  4DSI A;  2X6S A;  3WNH A;  4ICL A;  3PUF A;  1IO2 A;  3SZ2 A;  3ZSO A;  3OYI A;  3OYF A;  2ATQ A;  3BDP A;  4ZTJ A;  3KLE A;  3P1G A;  3SV4 A;  1TK0 A;  1BCM A;  3K5L A;  3DMJ A;  3THV A;  1YTA A;  3L2W A;  4BDY A;  1X9S A;  3SUO A;  1KCF A;  4H4M A;  2HNZ A;  3NBP A;  3KJV A;  4CJE A;  5DK5 A;  5C42 A;  4HCB A;  3ZT2 A;  4B9V A;  4FZX C;  3MED A;  1KRP A;  4BE1 A;  2QKK A;  5HBM A;  2R7Y A;  5J1E A;  5E41 A;  1XI1 A;  4O5B A;  3L8B A;  1GOC A;  4FM0 A;  2KZZ A;  3KK2 A;  3M8Q A;  1BGX T;  1BQM A;  3ISN C;  1TKT A;  4CEC A;  3I8D A;  4YFU A;  3HPG A;  3O4Q A;  2HHU A;  4IDK A;  3QIP A;  3SI6 A;  1RBU A;  1U48 A;  1HRH A;  4Y1D A;  1UOC A;  4CJ3 A;  1J9A A;  5KTQ A;  2YV0 X;  3DRS A;  4CJF A;  1U49 A;  2E6M A;  5J2Q A;  1S1U A;  2OPP A;  1LW0 A;  4OPJ A;  3NDK A;  1QSL A;  3AVI A;  3LAK A;  4KRF A;  1EKE A;  3ASM A;  1Q9X A;  4UQG A;  5C24 A;  4W5R A;  3ZT3 A;  3KD1 E;  4HCC A;  1SL1 A;  1IKW A;  3CYM A;  4CJW A;  4KI6 A;  4GW6 A;  4CJU A;  4DQS A;  1NOY A;  1A5V A;  3JYT A;  4IG0 A;  2XRI A;  3KIO A;  5HP1 A;  4IBN A;  4E89 A;  2FBV A;  4FK0 A;  5HRN A;  5HRP A;  1SL2 A;  1YVU A;  1KTQ A;  3AVN A;  4PA1 A;  5KRS A;  4DSJ A;  4CEF A;  4GMJ B;  4W5O A;  3KK1 A;  3LWL A;  4DF8 A;  1U47 A;  3HJF A;  2HW3 A;  4ZTF A;  4QAG A;  3FFI A;  1C1A A;  2D0C A;  4DTO A;  3VQQ A;  3SJJ A;  4FVM A;  3NGI A;  1NK8 A;  1T05 A;  5JS2 A;  1RT5 A;  5D3G A;  4CIF A;  1CXU A;  4CGG A;  4OJR A;  3PX4 A;  2G8V A;  1A5X A;  4CF9 A;  1REV A;  4DSL A;  1RT7 A;  3ZSZ A;  2PYL A;  2RKI A;  2BDP A;  1KVB A;  1CZB A;  3NGY A;  3HP6 A;  4E7K A;  1XHZ A;  5I3U A;  2ZQB A;  1VSE A;  1VSF A;  2HHX A;  4IFY A;  1UA1 A;  2DFE A;  4DQP A;  2IDO A;  2PYJ A;  2OZM A;  1HNV A;  3K5M A;  2HMI A;  1XHX A;  4C8M A;  4KTQ A;  1KFS A;  4B9M A;  3B6P A;  3OYM A;  2A1S A;  4KHN A;  4CF1 A;  3CQ8 A;  1FKP A;  1SL0 A;  1D9D A;  3NH2 A;  2IOC A;  2VWK A;  4KB1 A;  3M8S A;  4KHU A;  5CY4 A;  1DTQ A;  1GOA A;  2FBT A;  4FLT A;  3NFA A;  3MXI A;  3K57 A;  5KGW A;  1VSI A;  3RMC A;  4M45 A;  3ITH A;  4TSX A;  2EX3 A;  3O3H A;  3KD5 E;  1TL3 A;  3AA2 A;  3PX0 A;  2HHW A;  4M3X A;  2DFF A;  4FJJ A;  1BI4 A;  3DLE A;  3OYD A;  5KGX A;  2IAJ A;  3QLH A;  2E6L A;  3I0S A;  4FJH A;  3VQ7 A;  5DMR A;  3HP9 A;  4DTJ A;  4CK3 A;  1B9F A;  4I2Q A;  4RG8 A;  3OYG A;  4RW8 A;  3LWM A;  1EX4 A;  4ZHR A;  4EZ6 A;  3M8P A;  1B92 A;  2JLE A;  4FCY A;  4DF4 A;  4KTW A;  2DY4 A;  3MEE A;  4QCL A;  3NE6 A;  4DFJ A;  5CZ1 A;  4FJ5 A;  4N5S A;  4GVM A;  4DTS A;  3AVC A;  1NJZ A;  4LH5 A;  4Q0B A;  3NF7 A;  2O4G A;  4OVL A;  2D0B A;  4F8R A;  3PV8 A;  4CGF A;  1ZYQ A;  5FRO A;  3CFR A;  4HHT A;  3QO9 A;  4F3O A; 
#chains in the Genus database with same CATH topology
 4CBX A;  3VQ4 A;  1NOZ A;  2KW4 A;  5DM6 L;  4FOE A;  4EZ9 A;  3F9M A;  1DKG D;  3VQ8 A;  3AA4 A;  4K8Z A;  4LC9 B;  2KKZ A;  4KB0 A;  4M3T A;  4AHS A;  4BRE A;  3L2Q A;  2FXU A;  4DR5 K;  3M3Z A;  4LD0 A;  3CIP A;  4XH5 A;  4AHT A;  2CH5 A;  4FZY A;  2GUI A;  4DKW A;  3PO4 A;  3CJC A;  4BG8 A;  3SQ1 A;  3FZL A;  3VQ6 A;  4FLY A;  1HJR A;  3OYE A;  4DS4 A;  3SQ2 A;  3O9U A;  3U9Z A;  3NF6 A;  4MDA A;  3U3G A;  3CFP A;  4N41 A;  3IRX A;  2NRT A;  4M3W A;  4DV4 K;  3KKS A;  4CEA A;  4XEI A;  2HVI A;  3KTQ A;  4CE9 A;  3TAP A;  4PKI A;  1Z6R A;  2O8D A;  1JLA A;  4NLC A;  4CF0 A;  2KQ2 A;  1O1W A;  2P9U B;  2O8E B;  4W5T A;  4IOA L;  3MXM A;  2HHQ A;  1WAJ A;  2OTL N;  3S3N A;  4IZ9 A;  2OZS A;  3DLK A;  5IWA K;  4JRP A;  1RBT A;  3L2V A;  4Z4E A;  3VQ9 A;  1RDB A;  2A3Z A;  2E20 A;  4IO9 L;  3RRH A;  3VQE A;  4O44 A;  1WLJ A;  3O8M A;  1JCG A;  4Z4H A;  1LWC A;  4B9L A;  1TK5 A;  4H5T A;  4DLG A;  1T7P A;  2ETJ A;  2F8T A;  2VWB A;  5FLX O;  2YHX A;  5KQD A;  1JLF A;  1BO5 O;  4IOC L;  3CC4 N;  4BRD A;  3NGZ A;  4F2R A;  4DQR A;  5JVH L;  1QTM A;  1HPZ A;  3TTC A;  4MLH A;  3ZT1 A;  3T69 A;  4KRE A;  1S9G A;  4CZF A;  2HNY A;  4KTZ A;  3ULD A;  3U6F A;  4JI7 K;  3RTV A;  4IXC A;  4CIG A;  3VEZ A;  1XMQ K;  1C1B A;  2VG6 A;  3O9S A;  2P51 A;  3U4L A;  3LPU A;  1ATS A;  1KSP A;  2RHK A;  3SQ0 A;  3QEX A;  3NF9 A;  4DQQ A;  1HYS A;  2PAV A;  3O4N A;  4H0T B;  3AVL A;  5AQO A;  1NGI A;  3HK2 A;  1G15 A;  5C2F A;  1WSI A;  5AQH A;  4E7I A;  2ZD1 A;  1UWB A;  4CZI A;  1YAG A;  3RMB A;  3IUC A;  4BRQ A;  3SYZ A;  4NCB A;  4A62 A;  4J2D A;  5AQW A;  5HLF A;  1RDU A;  3ALY A;  4B3S K;  2QKB A;  4FK4 A;  5J2N A;  3E1Y A;  4DTU A;  2DTU A;  4CGH A;  2HMP A;  4DTR A;  1T6D A;  1JKH A;  2G8I A;  3QEP A;  3VA0 A;  3TAB A;  4FJL A;  2O8B A;  2JWL A;  4BQL A;  2IVO A;  5M1P A;  2VWJ A;  4DR6 K;  3UKU B;  1TL1 A;  2FF6 A;  1XQS C;  2Y1I A;  1GLL O;  3DOL A;  3QEW A;  2PZS A;  1RBR A;  5CYQ A;  3ZX3 A;  4Z94 A;  3AO1 A;  5M1O A;  4FLW A;  3ZT0 A;  4B9U A;  4DSF A;  4FSV A;  5KPZ A;  4B3M K;  1S1V A;  2VYP A;  4BRL A;  1W2B M;  1QE1 A;  3DXK A;  3BZC A;  5GAE P;  2D5R A;  3MWP A;  3MAQ A;  4OPK A;  1Y97 A;  3WEE B;  3ZET B;  4YNQ A;  1SS6 A;  1TKD A;  3LZJ A;  4CJQ A;  4NCA A;  4Z0U A;  2YHB A;  1LCU A;  1QVG M;  3AO3 A;  1BHL A;  2VGM A;  3AA3 A;  3FFK B;  1Q82 O;  1TGO A;  3WXL A;  4PHT X;  4DLE A;  2AA4 A;  3L2U A;  3MMV A;  4MFB A;  4H8K A;  4MLE A;  3AVA A;  3NMU A;  1RT3 A;  1J6Z A;  4PY5 A;  3TI0 A;  3PSI A;  3NVK A;  3IKM A;  3IG1 A;  4X62 K;  2O4I A;  3TSQ A;  3VQB A;  2ZE2 A;  1VQ9 N;  3VGL A;  1MWM A;  1XC9 A;  5HOO A;  4CEE A;  2HST A;  3OA9 A;  3I8B A;  1W9H A;  2IVN A;  1J5O A;  2P9I A;  5I9E B;  3DJC A;  1ZC6 A;  3KLI A;  4FM1 A;  3ID8 A;  4FL9 A;  4BQZ A;  3UKR B;  4C1N K;  1TAQ A;  2F9T A;  1N36 K;  2CH6 A;  2HND A;  1YIJ N;  4J2B A;  3KLH A;  4FJ9 A;  1M90 O;  2G8H A;  4CBW A;  4O55 A;  3KLF A;  3V1R A;  2UXD K;  1EWR A;  1NK4 A;  3ZSV A;  1N8R O;  1HJO A;  2XY8 A;  3O1W A;  1CZ9 A;  5FPN A;  1KLM A;  3HI0 A;  4Y1C A;  1Z26 A;  1QZ5 A;  4M7X A;  1LWE A;  4KH4 A;  1KVA A;  3P4I A;  1YJN N;  2RN2 A;  3P38 A;  1GLD G;  3ENB A;  4OGC A;  1RBV A;  2P9P B;  2IC3 A;  1D5A A;  4KHY A;  1TV6 A;  5GIO A;  3HOT A;  3L2R A;  3M6G A;  1HKB A;  1EQY A;  4CK2 A;  3HXM A;  4JI1 K;  3V81 A;  4CIE A;  2FSJ A;  4KO0 A;  4BDZ A;  2E8A A;  3TAR A;  1QQM A;  3VQA A;  5FRM A;  3DI6 A;  4E7H A;  1WAF A;  2B4J A;  4CEZ A;  1ILY A;  3R3L A;  3I0R A;  3QBW A;  2P5O A;  4O8U A;  2VQE K;  4DUZ K;  3OVN A;  3P5J A;  3EKS A;  1S72 N;  5LMU K;  1NK0 A;  4KV8 A;  4JI0 K;  3PSF A;  3C6A A;  1BIU A;  4GKK K;  4CZJ A;  3H3N O;  4HUG A;  3HOS A;  4LF8 K;  4WQ5 C;  4I9L A;  3CC2 N;  3DLR A;  4LF7 K;  3FZM A;  4RCH A;  3MX2 A;  4H0V B;  3DLH A;  1BIS A;  1VQ7 N;  2YX6 A;  4N56 A;  4U7B A;  3OBW A;  4JKG A;  3HPH A;  4H03 B;  2Z1J A;  3M1F A;  1SV5 A;  3TR8 A;  4BRH A;  3G10 A;  2V52 B;  1RT4 A;  5BN8 A;  3O5B A;  3NF8 A;  3SPZ A;  1S22 A;  2IS3 A;  4JKD A;  4AHU A;  3V9W A;  1T3V A;  2G8F A;  1X9J A;  3WNF A;  3R8E A;  3L3U A;  2I5J A;  5AR0 A;  4RW9 A;  3CD6 N;  3PUF A;  3ZSO A;  4ISF A;  3KLE A;  1TK0 A;  2NRR A;  3DMJ A;  1YTA A;  4BDY A;  4H4M A;  4X65 K;  5DK5 A;  3FGU A;  5AFU A;  2OCE A;  3D2E B;  3MED A;  1KRP A;  1BDG A;  3VGK A;  1XI1 A;  2UUC K;  3L8B A;  3M8Q A;  3ISN C;  3ULE B;  4IDK A;  4DQ8 A;  5AZJ A;  1U48 A;  4Y1D A;  4FWK A;  4CJ3 A;  1J9A A;  3DRS A;  1U49 A;  4YOR A;  5J2Q A;  1LOT B;  1CZA N;  4OPJ A;  1QSL A;  1EKE A;  3DXM A;  4UQG A;  1WBD A;  4HCC A;  2CGK A;  3CYM A;  4CJW A;  1SAZ A;  1NOY A;  3CJ7 A;  4IG0 A;  1BUP A;  3KIO A;  4OO1 J;  4E89 A;  2FBV A;  3CXC M;  5AQY A;  3KK1 A;  3H6E A;  3HJF A;  3FFI A;  2D0C A;  4U67 L;  3SJJ A;  4B3T K;  1NK8 A;  1RT5 A;  1OH6 A;  4CIF A;  4JI8 K;  2QWN A;  3ZSZ A;  4BRP A;  3NGY A;  3C0B A;  2E5L K;  4IFY A;  3MDQ A;  3I56 N;  3K5M A;  3QBX A;  5AQM A;  4CW7 B;  4B9M A;  3J7Y P;  4WFN L;  3VEO A;  1D9D A;  1DTQ A;  5EX5 A;  1VSI A;  3KD5 E;  4M3X A;  2DFF A;  3DLE A;  5KGX A;  1VQ5 N;  3I0S A;  3VQ7 A;  4EFH A;  3CHW A;  4CK3 A;  2A40 A;  3OYG A;  1RFQ A;  3HZ6 A;  3LWM A;  1EX4 A;  2JLE A;  4FCY A;  3F2K A;  2P9L A;  3NE6 A;  3LDQ A;  4DFJ A;  4CZG A;  1HPM A;  4FJ5 A;  4JKE A;  4B1Z A;  4Q0B A;  4F8R A;  4CVN E;  3PV8 A;  4HHT A;  3N4P A;  3O1B A;  4BC3 A;  1L3V A;  4BGA A;  3JXU A;  3AVH A;  2ITM A;  5HRS A;  3K9K A;  2CGJ A;  1RGI A;  3CM6 A;  4QS7 A;  1KLN A;  4YY3 K;  4H5W A;  3OBY A;  1C1C A;  3WUH A;  3QIO A;  3FR0 A;  4RWT A;  3ZLJ A;  5AQQ A;  3OS0 A;  1MA9 B;  5AZI A;  3CCS N;  1YT3 A;  1WOQ A;  4FM2 A;  1XNR K;  1YHQ N;  4E1N A;  1IKY A;  4IFE A;  3KWG A;  4E1M A;  4H0P A;  5DM7 L;  1N6Q A;  1IBM K;  3S9H A;  3RSE A;  3AY9 A;  3MN9 A;  1EWQ A;  1C0T A;  5LMN K;  1VSL A;  2I7P A;  4IO8 A;  3Q7C A;  4CJS A;  4CED A;  3QB0 A;  3T1A A;  4JKH A;  3J80 O;  4IWV A;  4M42 A;  3OJU A;  1LV5 A;  2OPS A;  3UIQ A;  4AM6 A;  4BVO A;  4RW4 A;  3IS9 A;  3THX A;  3J81 O;  3LDP A;  3OYK A;  4EAH D;  4MO4 A;  4KAZ A;  1Q18 A;  1NM1 A;  3ID6 A;  4B08 A;  4FWQ A;  3LM2 A;  2HF4 A;  5GAG P;  4BR5 A;  4CHQ A;  5KI6 A;  2P9K A;  3L4Q A;  3MXJ A;  3H3O B;  2QXF A;  1VQN N;  1U4B A;  3LAL A;  2BE2 A;  1SKS A;  4AM7 A;  2F7T A;  4EIA A;  3V9X A;  1S6P A;  2VQF K;  2HHH K;  4CEO A;  4CHN A;  1JLE A;  2E1Z A;  5LJW A;  5FRN A;  4E19 A;  1MWK A;  3M5R A;  2E2P A;  1BU6 O;  4GNI A;  4I9Q A;  4FJM A;  3S3O A;  2YI1 A;  3LDS A;  5BPL A;  1TAU A;  5EVZ A;  3LAM A;  1C0M A;  4IJA A;  1WBB A;  4ELU A;  5C0Y A;  3QEI A;  1WN7 A;  1KAZ A;  3AAP A;  2OPQ A;  1L3S A;  5AQU A;  2WBN A;  3S3M A;  3RMD A;  2P5G A;  3I33 A;  4NXM K;  5F2R A;  2KFZ A;  3ZSX A;  2G8U A;  4JD2 A;  3BUZ B;  2RPI A;  1V4S A;  5LJV A;  1UA0 A;  1VSK A;  4HUF A;  4M3U A;  2A6A A;  1OH8 A;  2F9W A;  2ZM6 K;  2ZJQ L;  2X78 A;  2KZM A;  3OYL A;  3QML A;  1NKE A;  1ZBH A;  5C12 A;  3AGR A;  3ZSW A;  5I42 A;  4CFC A;  3OYB A;  3WQT A;  4IFV A;  4FW1 A;  4AIL C;  3KWI A;  5IT9 O;  4HVJ A;  1T03 A;  4EHU A;  4R79 A;  3G0Z A;  3NHG A;  5BRD A;  3ZEU A;  4DV2 K;  4Z4I A;  4CCH A;  1QS4 A;  3HO1 A;  4CD1 A;  3EE8 A;  3LL3 A;  3H08 A;  4M63 C;  1L3U A;  5M1K A;  5BRF A;  2YKN A;  3KLG A;  2GEM A;  3SUN A;  4M3Y A;  5AQX A;  4YDU A;  3D0P A;  4C8K A;  4Z4G A;  3C7N B;  1JCE A;  4L3Q A;  1U04 A;  4F9O A;  4A61 A;  3OYC A;  4BR7 A;  3CFO A;  3EEQ A;  3G4S N;  4DQI A;  3SBG A;  1BQN A;  4E0D A;  3MX5 A;  3CMA N;  1YUW A;  2VG7 A;  3CCU N;  3HL8 A;  2Q2R A;  5EU7 A;  1HKC A;  2E88 A;  4M3R A;  1D8Y A;  2XO7 A;  4IG3 A;  3EL2 A;  2EWS A;  3IFR A;  3CCE N;  1ZBI A;  2GX9 A;  3THW A;  2BTF A;  2QA4 N;  2UYT A;  1RTD A;  4JKG B;  5CE3 A;  5JS1 A;  3IDH A;  1B9D A;  2WFB A;  4L8R B;  4Z4F A;  1J53 A;  3TPQ A;  1ASV A;  3C95 A;  4ELT A;  3SAF A;  4FJN A;  3GG4 A;  3AO2 A;  1FXX A;  1ZBL A;  1N32 K;  2X6N A;  5GAH P;  3LDL A;  3TAE A;  3E01 A;  4PQU A;  1RTJ A;  4M7Y A;  2XY7 A;  1BL3 A;  2QWL A;  4JHD B;  3K58 A;  4FJG A;  4JN4 A;  4OKJ A;  4BRM A;  4K0K K;  4MO5 A;  3K0S A;  1ASW A;  3AVJ A;  1W97 L;  1VRT A;  3P31 A;  5E84 A;  3WXM B;  2YJE A;  2P9S B;  2GBZ A;  3LP1 A;  2OA8 A;  3THY A;  4YHH K;  3UB5 A;  3CJ9 A;  5AQT A;  2NLX A;  4KFB A;  1DEJ A;  3EZ5 A;  5J2P A;  3WNG A;  2YNI A;  4IEI A;  3V1Q A;  4CZE A;  4CF2 A;  5GAD P;  2KTQ A;  1Q8I A;  3DXM B;  4FXD A;  1X1P A;  4O5F A;  1R0A A;  3HM9 A;  1WSH A;  4DU3 A;  1SUQ A;  5GIP A;  1SKW A;  4FWL A;  4ELV A;  3V6D A;  3LP0 A;  4JKC A;  5B8H A;  1HNX K;  2UXC K;  1OKJ A;  4CFB A;  3B8A X;  1W7A A;  4GV6 A;  2NRH A;  1NKB A;  3CJ1 A;  3T1H K;  4JEP A;  3WXK A;  1OH5 A;  1XNQ K;  3NH0 A;  1WSG A;  3V1O A;  4FWM A;  1Q7Y O;  4BC2 A;  5C15 A;  1E4G T;  3FZF A;  1NGG A;  2W41 A;  1ZBU A;  2O8F B;  3SUP A;  1BOT O;  5FPE A;  4HUE A;  1IG8 A;  4CF8 A;  4XH4 A;  3K5O A;  1L5U A;  4Z4C A;  3GL1 A;  1HYV A;  3DWL A;  4DS5 A;  3FE1 A;  3O4W A;  4KPY A;  1VQM N;  2HHT A;  2A41 A;  3QER A;  3QES A;  4ILH A;  4CES A;  4ILG B;  4CGI A;  3VOV A;  1GLF O;  1X9W A;  2GEL A;  2XY6 A;  3QNN A;  4PWD A;  1JJ2 M;  1F21 A;  1SQK A;  1Q81 O;  2GTD A;  4B9T A;  3VA3 A;  3ZSQ A;  4DSI A;  1IO2 A;  4DUY K;  4BR4 A;  3NVM A;  3OYI A;  1K8K A;  4K25 A;  4ZTJ A;  3P1G A;  4IOX A;  2HNZ A;  2V7Y A;  5EY4 A;  4CJE A;  5C42 A;  2ZJR L;  4HCB A;  4FZX C;  3JS6 A;  4CI6 A;  1GOC A;  1K9M O;  4V19 S;  1BGX T;  3I8D A;  4YFU A;  2HHU A;  3QIP A;  4BVP A;  1RBU A;  4AQY K;  5KTQ A;  2E6M A;  4JK7 A;  2OPP A;  3NDK A;  4BC4 A;  3ASM A;  3BEX A;  3ZT3 A;  1VQO N;  4B1W B;  4BRN A;  5BPN A;  4CJU A;  2ZF5 O;  4IBN A;  2YHY A;  1KTQ A;  3AVN A;  3RSE B;  4PA1 A;  5KRS A;  5JLH A;  5AQL A;  4CEF A;  2GWK A;  4ZTF A;  1C1A A;  5C10 A;  3CCJ N;  3NGI A;  4CGG A;  4OJR A;  4CF9 A;  3OW2 M;  3O08 A;  1SZ2 A;  1QQN A;  3HP6 A;  4E7K A;  4JK9 A;  1VSF A;  3CPW M;  1IV0 A;  2HMI A;  4C8M A;  4GY2 B;  2BH1 A;  1FKP A;  2VWK A;  3CF5 L;  3M8S A;  1GLB G;  4X64 K;  1GOA A;  4PKH A;  3J8A A;  3CI5 A;  4FLT A;  3MXI A;  1EO1 A;  3EO3 A;  4LFB K;  1BWF O;  2P9K B;  3CCM N;  2EX3 A;  3O3H A;  1TL3 A;  4DV5 K;  3PX0 A;  4DV3 K;  5BR8 K;  3OYD A;  2IAJ A;  1YJW N;  4BG9 A;  5CHI A;  5DMR A;  3D7E O;  1JCF A;  2QWP A;  4RW8 A;  4ZHR A;  5EXW A;  2PFU A;  4DF4 A;  4QCL A;  1R59 O;  3WXI A;  3BY5 A;  1E4F T;  4GVM A;  3A8Y A;  3AVC A;  3MWT A;  1NJZ A;  4LH5 A;  1QZ6 A;  3NF7 A;  4OVL A;  4CGF A;  1ZYQ A;  4JKB A;  2AP1 A;  1DT9 A;  3CFR A;  3CCL N;  1NGB A;  4F3O A;  1KXP A;  1H1V A;  3N4Q A;  4OLB A;  4H0X B;  2QXL A;  3FZH A;  1NK6 A;  3DYA A;  1XUP O;  5FDL A;  1K8A O;  1V4T A;  2HBK A;  3K2P A;  3FZK A;  4CHP A;  5M1Q A;  2O8E A;  5TKW A;  1TYQ B;  1NK9 A;  1MU2 A;  1K6Y A;  5BRH A;  4JD2 B;  1IH7 A;  1BG3 A;  1C0U A;  3OS1 A;  4FJK A;  3CET A;  2LSN A;  4KHQ A;  3R9P A;  3GDQ A;  1NBW A;  1HNW K;  5F0X A;  4DU1 A;  1S1T A;  3DRR A;  3D45 A;  3RMA A;  3EY1 A;  2OPR A;  3V4I A;  3RR8 A;  1ZXO A;  3D6R A;  4DTX A;  3GOI A;  4HWI A;  5BRE A;  1WSJ A;  1VQK N;  2HBL A;  4K8X A;  2QK9 A;  3OHR A;  3O3F A;  4O4G A;  4G1Q A;  4LFC K;  1RIL A;  3AVB A;  5JIC A;  4LSL A;  2QWQ A;  4G9Z A;  1HX1 A;  1QSY A;  2FC0 A;  4C23 A;  1S1W A;  1YXQ A;  1NGE A;  1JL2 A;  3MEG A;  1HMV A;  2NZT A;  1DLO A;  2BUP A;  1G99 A;  3ZCM A;  5F1X A;  1BA1 A;  4WYB A;  2O8D B;  3ATV A;  1TK8 A;  1VHX A;  4JKA A;  4N47 A;  4Q5V A;  4JI3 K;  1OVQ A;  1KAY A;  1W0H A;  2E4L A;  2HB5 A;  3ZSY A;  3TAG A;  3PY8 A;  1TUY A;  1O13 A;  2D4W A;  4B8A B;  1QQO A;  3L3V A;  3ATU A;  2NRV A;  3DM2 A;  4DR2 K;  4OKE A;  5E26 A;  3TWH A;  4FWP A;  3SMP A;  1WNS A;  3DOK A;  3F73 A;  3E66 A;  3VER A;  2W6K A;  1QSS A;  2YJF A;  3L6Q A;  1A5W A;  1JLB A;  3W3D A;  2FSK A;  4FYD A;  4ISE A;  4GV9 A;  4LF5 K;  1YF5 L;  3E9P A;  1NKC A;  2BAN A;  1TKZ A;  4BRC A;  4NYN A;  3TSU A;  4ISG A;  1IG9 A;  1HQE A;  2F4V K;  1HLU A;  1ASU A;  4FJ8 A;  4H5N A;  1WSF A;  4DSE A;  1NJW A;  2Q0R A;  3OTO K;  5AQF A;  4IDH A;  4FJ7 A;  2I7N A;  3H1Q A;  3LAN A;  4B9N A;  1S5J A;  4FOI A;  4DB3 A;  2KHO A;  2WC9 A;  3THY B;  3GE1 A;  4B3O A;  3ZET A;  3WEE A;  1KC8 O;  1N5Y A;  4CJ4 A;  3D2F A;  4JNE A;  1FW6 A;  2VG5 A;  3WT0 A;  1EP4 A;  3VQC A;  3SNN A;  4LH4 A;  4W5Q A;  3SV3 A;  5AFU H;  1NJY A;  1WSE A;  2Q3S A;  4RW6 A;  3O9T A;  1U45 A;  1S3X A;  1IBK K;  3LP2 A;  2P9N A;  4C8O A;  4J2A A;  1LAV A;  1OVY A;  1VSH A;  3T19 A;  3OYJ A;  4EP5 A;  4R5P A;  1NMN A;  4K43 A;  3HPO A;  4BRG A;  3KHY A;  4FJI A;  1RDD A;  1GLJ O;  3LDN A;  3VQ5 A;  1DTT A;  1ATN A;  4AHV A;  1P8Z A;  3A2F A;  1NNE A;  1NJX A;  4FVU A;  1NWK A;  3MCP A;  4MDB A;  4FWO A;  2O8B B;  3HVR A;  2YNG A;  3ZYY X;  4CFD A;  1Z25 A;  2DFH A;  4E3S A;  1ZBF A;  3QFP A;  3T3F A;  2ASO A;  3EZW A;  4NO7 A;  3ZSR A;  1LAW A;  2YNH A;  3PIP L;  3V9Z A;  4QOZ B;  1S1X A;  4DTN A;  3IAY A;  1FK9 A;  3OYN A;  2RF2 A;  3DXK B;  3AVG A;  3DRP A;  1X3M A;  1VQ4 N;  2FBY A;  4CHO A;  4N76 A;  3CM5 A;  3MCA B;  1JLC A;  5BPM A;  2F96 A;  1ITG A;  4ILJ A;  5SZT A;  3VGM A;  1J54 A;  1RDW X;  4O0J A;  4F3T A;  2EHG A;  5M1F A;  4DWI A;  4A2A A;  5AQN A;  1K8K B;  4FPB A;  4KHP K;  4YDU C;  4BE2 A;  3A5M C;  1N34 K;  4LSN A;  1NK7 A;  4B8C A;  3PX6 A;  1C6V A;  5KQ8 A;  3A5N C;  4XIU A;  1LW2 A;  2HHV A;  2YHW A;  3JAM O;  2P9I B;  4IKF A;  3AO4 A;  1S9E A;  2V7Z A;  1X9M A;  3HYF A;  3AVK A;  4DTP A;  4BAC A;  1IJJ A;  4DTM A;  4BDP A;  3P39 A;  3SUQ A;  3CJB A;  3MN5 A;  3SLC A;  3C6H A;  1KD1 O;  3BZK A;  5KPT A;  4KHS A;  3VES A;  2Q0U A;  5JLF A;  4KKO A;  3SAG A;  1KFD A;  4EP4 A;  4CJR A;  4NLB A;  2O8C A;  3TAM A;  3WNE A;  4WQ4 A;  2NUB A;  3LZI A;  2UU9 K;  1LWF A;  4CJ5 A;  4WCE L;  3ZT4 A;  3O9R A;  1VAZ A;  1M1K O;  4B1U B;  4CJL A;  2H3G X;  3CC7 N;  3CJA A;  2CGL A;  5CR4 A;  1NG9 A;  2XY5 A;  5AQJ A;  1L3T A;  1VK0 A;  4C8N A;  4JK8 A;  4QS8 A;  3Q7B A;  2KLA A;  1EXQ A;  4PUO A;  4OPH A;  2B5J A;  5HRO A;  3AO5 A;  1IKV A;  4AF1 A;  4CHZ A;  4DFK A;  1JL1 A;  5AQV A;  1U2V A;  3V9S A;  3RWU A;  1K73 O;  3D2E A;  3FLC O;  4H0O A;  3T1Y K;  2QWR A;  3HST B;  1YI2 N;  1ATR A;  4FLU A;  1S6Q A;  2FLO A;  3AGK A;  2GV9 A;  4KBO A;  4DU4 A;  1N33 K;  4LY7 A;  1VQ6 N;  3ULE A;  3VTI A;  2X6S A;  3SZ2 A;  4ICL A;  3HM8 A;  2E2O A;  4NB4 A;  3SV4 A;  3L2W A;  4BGB A;  3SUO A;  1KCF A;  1ZBS A;  3NBP A;  3SAH A;  3KJV A;  4WF9 L;  5HL7 L;  3ZT2 A;  2Q31 A;  3TTD A;  4BE1 A;  3TSP A;  5HBM A;  2QKK A;  4Y0W A;  5J1E A;  5E41 A;  1YVN A;  4O5B A;  1XC3 A;  4KH5 A;  4FM0 A;  2KZZ A;  4JKF A;  3KK2 A;  2OAN A;  1TKT A;  4CEC A;  3HPG A;  3O4Q A;  3F5T A;  3SI6 A;  3E9L A;  4BRA A;  1UOC A;  4CJF A;  4GVE A;  1S1U A;  1LW0 A;  5C24 A;  4YOU A;  3KD1 E;  1SL1 A;  4OX9 K;  4KI6 A;  4GW6 A;  1A5V A;  3R6M A;  3JYT A;  4FK0 A;  5HRN A;  1YVU A;  4H5R A;  3LWL A;  4GMJ B;  5KPR A;  1HUX A;  1TUU A;  4BY9 C;  3VQQ A;  4FVM A;  3EN9 A;  5D3G A;  4JI4 K;  3PX4 A;  1A5X A;  1REV A;  5AZJ B;  3SJH A;  1RT7 A;  2PYL A;  2BDP A;  1KVB A;  3G25 A;  2HBM A;  2ZQB A;  2HHX A;  2FF3 B;  4DQP A;  2IDO A;  2PYJ A;  1HNV A;  3GBT A;  3ZX2 A;  1XHX A;  1KFS A;  4DV0 K;  4KHN A;  4YOT A;  1GLC G;  4I6M A;  4BC5 A;  1Y64 A;  3J7Z O;  3NH2 A;  4KB1 A;  4KHU A;  4IJN A;  4LFA K;  4A59 A;  4CJ7 A;  5FPD A;  3ENH A;  3NFA A;  3K57 A;  3HTV A;  4IEE A;  4M45 A;  2VGN A;  3AA2 A;  2HHW A;  4FJJ A;  1BI4 A;  2WUS A;  3QLH A;  4FJH A;  4B1V A;  4DTJ A;  3VEV A;  4BR2 A;  1B9F A;  4I2Q A;  4RG8 A;  5BR9 A;  4EZ6 A;  1B92 A;  4BRO A;  3O6W A;  3MEE A;  4N5S A;  4JI2 K;  2O4G A;  2D0B A;  2A5X A;  2JWK A;  4WE1 A;  3QO9 A;  4DR1 K;  5CYM A;  4FK2 A;  2Z1I A;  5JMV A;  4C1N I;  1NMD A;  3NAE A;  2Y1J A;  4HTL A;  3TAQ A;  4DSK A;  5LL6 Z;  3LP3 A;  4XH1 A;  1HKG A;  2P1J A;  3BP8 A;  4NXN K;  4HTU A;  5CZ2 A;  3SPY A;  1DGK N;  2P9L B;  1QQC A;  1RTH A;  2NNW A;  2QEX N;  4YOY A;  4CGD A;  2JGU A;  2YHA A;  3DLG A;  3HSC A;  2ITG A;  4CEB A;  2QWO A;  3VEX A;  3OY9 A;  4DR7 K;  4A5B A;  1NLV A;  3KZB A;  3QNO A;  3D2F B;  4BWM A;  3VEY A;  1U6Z A;  3LDO A;  1NK5 A;  4CZK A;  2IVP A;  2KFN A;  4DG1 A;  3AAQ A;  3G6E N;  4F4K A;  4QS9 A;  3EKU A;  4F2S A;  1WB9 A;  3C6T A;  5ADX A;  1P90 A;  3CER A;  4CZM A;  4J8F A;  2P9N B;  3CPE A;  5AQI A;  4JS5 A;  2WON A;  4DFM A;  4M3Z A;  1JLQ A;  1Q86 O;  3U8X A;  4H4O A;  4NCG A;  5AZI B;  2FBX A;  4JLH A;  2WTU A;  5EOY A;  3EE9 A;  4UY8 O;  2BGG A;  2A1R A;  3BF3 A;  4AHC A;  4JI5 K;  2B6A A;  3B6O A;  2QM1 A;  3K5N A;  1IKX A;  4K42 A;  4FJX A;  2W6L A;  3JSM A;  3H46 O;  4EHT A;  1GLA G;  1TVR A;  3VN5 A;  3VF4 A;  5C2D A;  2HHS A;  2Q97 A;  3LPT A;  3KK3 A;  1D9F A;  2W40 A;  3QEV A;  2Z1H A;  3F9K A;  4YOX A;  3VTH A;  4BRI A;  3SCX A;  2OYQ A;  2XHB A;  1ESV A;  4LF4 K;  4AHR A;  1HNI A;  4OGE A;  4LF6 K;  2Q1N A;  3THX B;  1RTI A;  2J4R A;  3MN6 A;  1J5E K;  3VF2 A;  2YNF A;  4PL8 A;  4CZH A;  1VSM A;  5KRT A;  4NYF A;  4CGJ A;  4ID1 A;  3V9U A;  3UE5 A;  4JS4 A;  4FW2 A;  1NGH A;  1BA0 A;  2ZGY A;  3E9O A;  4OPA A;  1GLE G;  5H1S Q;  1RT1 A;  2DPN A;  3QIN A;  5JVG L;  4MQ3 A;  2QWM A;  5AQP A;  3TAN A;  5FPM A;  3NCI A;  5TKY A;  4CEQ A;  4FZZ A;  2NRZ A;  1Q9Y A;  5MLC Q;  3VQP A;  4KHW A;  3RR7 A;  4RW7 A;  3A0I X;  2G8K A;  5J2M A;  3PLA A;  3VMF B;  1D4X A;  3IMX A;  1IBL K;  4B1X B;  1HR0 K;  4BRK A;  4M41 A;  2ASM A;  4CJT A;  3R1X A;  1KVC A;  3DAW A;  1NJI O;  4B3R K;  4OLA A;  1VQ8 N;  5ADX H;  3C7N A;  3WXJ A;  2P9U A;  4E7J A;  1EET A;  3AVM A;  4DHY A;  3DLB A;  3L0Q A;  1NGA A;  2O8C B;  3HRG A;  4BE0 A;  2E2N A;  4DV1 K;  1RDA A;  5HRR A;  2QW9 A;  3CME N;  1NGJ A;  2VCP A;  5SWM A;  2UXB K;  2ZJP L;  1UAX A;  1E3M A;  1VQL N;  3O3G A;  1FJG K;  3TAF A;  4KH6 A;  3M8R A;  1BIZ A;  3CCV N;  1RT6 A;  1GOB A;  4K41 A;  1WUA A;  4CJK A;  3K59 A;  1VQP N;  3A5O C;  3C6U A;  1SKR A;  4KI4 A;  1RT2 A;  4O0I A;  4FPA A;  1QVF M;  4DV6 K;  3VET A;  1NGC A;  1Z05 A;  4FLZ A;  3CQX A;  3WQU A;  1VSD A;  2F8S A;  3SMS A;  2D0A A;  3ZEU B;  4FWR A;  4DCH A;  4E7L A;  5AQG A;  4JHD A;  5ELZ A;  1VSJ A;  1U2V B;  1NU0 A;  3I55 N;  3VQD A;  3G71 N;  2IGI A;  2NRX A;  4OKK A;  1JXB A;  4ID5 A;  1HNZ K;  2P9S A;  3DLL L;  1HYZ A;  5K14 A;  1I3A A;  3O80 A;  5M1N A;  4AH9 A;  2FSN A;  1RCH A;  3QFU A;  4PL7 A;  3TU5 A;  2WOM A;  2PBD A;  4JV5 K;  3THW B;  2IIR A;  4C8L A;  1JLG A;  3KK7 A;  5AQZ A;  3U3Y A;  3HVT A;  3QET A;  3HBT A;  2QI2 A;  2ZWH A;  4CJV A;  4X66 K;  4RTF D;  3AV9 A;  3RRG A;  2HVH A;  3MEC A;  2YKM A;  3AA5 X;  3CG7 A;  4CBU A;  2UUB K;  2D0P A;  3J7A P;  1BCO A;  4WQ5 A;  2O8F A;  4PKG A;  1YTU A;  4CK1 A;  5T7B A;  4JYA K;  4CFA A;  4A2B A;  3BF1 A;  3OYH A;  3H45 C;  3UKU A;  2AJQ A;  2QTD A;  5GIN A;  3P83 D;  1OH7 A;  1CLQ A;  3ENO A;  1CXQ A;  4FO0 A;  1RNH A;  4B9S A;  4FLX A;  3OYA A;  2A42 A;  3VPZ A;  1HQU A;  1RBS A;  2HF3 A;  3H1V X;  4YOV A;  3C94 A;  1QHT A;  2E2Q A;  3NH1 A;  4CER A;  1QHA A;  3OJS A;  1XMO K;  1JXE A;  3TTF A;  3PO5 A;  4J2E A;  4W5N A;  3C65 A;  3HT3 A;  2NRW A;  4YOW A;  3BGR A;  5AJ3 K;  3KVG A;  2Z1G A;  4CJP A;  3AVF A;  4B1Y B;  4CD3 A;  2V51 B;  1T8E A;  5AQR A;  4JRQ A;  4I6M B;  3L4I A;  4FLV A;  3SQ4 A;  2RE2 A;  1TKX A;  1I94 K;  5C25 A;  2OTJ N;  2W42 A;  1XWL A;  3LM9 A;  1X3N A;  4FWN A;  4BWJ A;  4JI6 K;  3EYZ A;  4O8K A;  2Q36 A;  1RDC A;  4A5A A;  2PY5 A;  1BI4 B;  1VRU A;  1I39 A;  2G8W A;  4DMN A;  3K9J A;  4I2P A;  4I7F A;  4CHY A;  4WFA L;  4WQ4 C;  3KKR A;  1KQS M;  3MN7 A;  3QIC A;  4GV3 A;  2X74 A;  4DFP A;  4BR0 A;  3OS2 A;  3UKR A;  3SK3 A;  1MDU B;  1FKO A;  3WNH A;  3OYF A;  2ATQ A;  3BDP A;  1BCM A;  3K5L A;  4A57 A;  2ASP A;  3THV A;  1NGD A;  1X9S A;  3W0L A;  3CQY A;  2HBJ A;  2HOE A;  4LF9 K;  3ZX0 A;  4B9V A;  4B9Q A;  3CCQ N;  2D1K A;  2R7Y A;  3SBT A;  1BQM A;  3A5L C;  3U9D A;  1HRH A;  2YV0 X;  4KRF A;  3AVI A;  3LAK A;  2UUA K;  2P9P A;  1Q9X A;  1NGF A;  4W5R A;  4WFB L;  5BN9 A;  3CCR N;  4DR3 K;  1IKW A;  4BRF A;  4DQS A;  3PIO L;  2XRI A;  5HP1 A;  4H0Y B;  3VEN A;  5HRP A;  1SL2 A;  2GWJ A;  4DSJ A;  3MK6 A;  1YJ9 N;  4W5O A;  3RVC A;  1U47 A;  4DF8 A;  2HW3 A;  4QAG A;  2D0O A;  4FWS A;  4DTO A;  1T05 A;  3O9Q A;  5JS2 A;  1T6C A;  5LY3 A;  1CXU A;  3VF6 A;  2G8V A;  4DSL A;  3S41 A;  2RKI A;  1CZB A;  1XHZ A;  5I3U A;  1VSE A;  4BR9 A;  5A2Q O;  3QDK A;  1UA1 A;  5AQK A;  2DFE A;  2GUP A;  2OZM A;  4KTQ A;  3B6P A;  3OYM A;  2A1S A;  4CF1 A;  3CQ8 A;  1SL0 A;  2IOC A;  5CY4 A;  3VEW A;  2FBT A;  4DV7 K;  5KGW A;  3T7Z A;  3RMC A;  3ITH A;  4TSX A;  4E1J A;  4CZL A;  4GKJ K;  2ZGZ A;  3AAR A;  2E6L A;  4H5V A;  1YIT N;  4DR4 K;  3HP9 A;  4JAX A;  2YCH A;  1TYQ A;  1C0F A;  3M8P A;  4KTW A;  2DY4 A;  2E1Y A;  5CZ1 A;  4DTS A;  1T44 A;  1KAX A;  5AQS A;  5FRO A;  1C0G A; 
#chains in the Genus database with same CATH homology
 5CYM A;  1NOZ A;  3VQ4 A;  1L3V A;  4FK2 A;  2KW4 A;  2Z1I A;  4OLB A;  3AVH A;  5HRS A;  4EZ9 A;  3VQ8 A;  3AA4 A;  1NK6 A;  3DYA A;  4K8Z A;  3CM6 A;  3NAE A;  2Y1J A;  3TAQ A;  4DSK A;  4KB0 A;  5FDL A;  4M3T A;  3LP3 A;  1KLN A;  3K2P A;  4CHP A;  4AHS A;  2P1J A;  3L2Q A;  4HTU A;  1MU2 A;  1K6Y A;  4LD0 A;  1C1C A;  5CZ2 A;  3SPY A;  1NK9 A;  1IH7 A;  3QIO A;  4AHT A;  1C0U A;  4FZY A;  3OS1 A;  4FJK A;  2GUI A;  1QQC A;  1RTH A;  3PO4 A;  3SQ1 A;  3OS0 A;  4CGD A;  2JGU A;  2YHA A;  2LSN A;  3DLG A;  4CEB A;  2ITG A;  3VQ6 A;  4FLY A;  1HJR A;  3OYE A;  4DS4 A;  3SQ2 A;  4KHQ A;  3NF6 A;  1YT3 A;  3U3G A;  3CFP A;  4FM2 A;  4N41 A;  3IRX A;  3OY9 A;  4M3W A;  4E1N A;  1IKY A;  3KKS A;  4CEA A;  2HVI A;  3QNO A;  4DU1 A;  1S1T A;  4BWM A;  4E1M A;  1NK5 A;  3KTQ A;  3DRR A;  2KFN A;  4DG1 A;  3D45 A;  3RMA A;  3EY1 A;  4CE9 A;  1N6Q A;  4F4K A;  3TAP A;  2OPR A;  3V4I A;  3S9H A;  4F2S A;  1JLA A;  4CF0 A;  2KQ2 A;  3C6T A;  1O1W A;  3RR8 A;  4DTX A;  4W5T A;  1C0T A;  3MXM A;  1WSJ A;  1VSL A;  2HHQ A;  4K8X A;  2QK9 A;  1WAJ A;  4CJS A;  4CED A;  4O4G A;  3O3F A;  2WON A;  4JS5 A;  3S3N A;  4G1Q A;  3T1A A;  4DFM A;  2OZS A;  1JLQ A;  1RIL A;  3DLK A;  4M3Z A;  3AVB A;  4H4O A;  4NCG A;  1RBT A;  2FBX A;  4JLH A;  4LSL A;  3OJU A;  3L2V A;  4JRP A;  3VQ9 A;  1LV5 A;  4M42 A;  1RDB A;  2OPS A;  4Z4E A;  3UIQ A;  3RRH A;  3VQE A;  4O44 A;  4RW4 A;  1QSY A;  3IS9 A;  2FC0 A;  2BGG A;  1S1W A;  2A1R A;  1JL2 A;  1WLJ A;  3MEG A;  4AHC A;  3OYK A;  1HMV A;  1DLO A;  2B6A A;  3B6O A;  4Z4H A;  1LWC A;  4KAZ A;  4B9L A;  3K5N A;  1IKX A;  4B08 A;  4FJX A;  3ZCM A;  3JSM A;  4CHQ A;  5KI6 A;  1TVR A;  3VN5 A;  1TK5 A;  2HHS A;  4DLG A;  3LPT A;  2ETJ A;  3KK3 A;  1TK8 A;  1T7P A;  1D9F A;  2F8T A;  1JLF A;  4N47 A;  4Q5V A;  3MXJ A;  3QEV A;  2Z1H A;  3F9K A;  2QXF A;  1U4B A;  3LAL A;  2BE2 A;  1SKS A;  3NGZ A;  1W0H A;  2E4L A;  2HB5 A;  3ZSY A;  4DQR A;  3TAG A;  4F2R A;  3SCX A;  3PY8 A;  4B8A B;  2OYQ A;  1QTM A;  3V9X A;  1S6P A;  2XHB A;  3L3V A;  4CEO A;  4CHN A;  1JLE A;  1HPZ A;  4AHR A;  5FRN A;  3DM2 A;  1HNI A;  4OGE A;  3ZT1 A;  4E19 A;  4KRE A;  4I9Q A;  1S9G A;  4FJM A;  4OKE A;  3TWH A;  3LDS A;  3S3O A;  1RTI A;  2HNY A;  4KTZ A;  2YNF A;  3ULD A;  3U6F A;  3RTV A;  1WNS A;  3DOK A;  4CIG A;  1TAU A;  1VSM A;  5KRT A;  3LAM A;  1C0M A;  1C1B A;  2VG6 A;  4NYF A;  3F73 A;  4ELU A;  4CGJ A;  2P51 A;  3LPU A;  4ID1 A;  3V9U A;  3QEI A;  1KSP A;  1WN7 A;  1QSS A;  1A5W A;  4JS4 A;  1JLB A;  4FW2 A;  3SQ0 A;  3QEX A;  4FYD A;  3NF9 A;  4DQQ A;  1HYS A;  2OPQ A;  1NKC A;  1L3S A;  3O4N A;  1RT1 A;  2BAN A;  1TKZ A;  3AVL A;  3QIN A;  4NYN A;  3S3M A;  4MQ3 A;  3RMD A;  3TAN A;  1IG9 A;  2P5G A;  1HQE A;  3HK2 A;  3NCI A;  1G15 A;  1ASU A;  4CEQ A;  4FJ8 A;  4FZZ A;  2KFZ A;  3ZSX A;  2G8U A;  1WSF A;  4DSE A;  1NJW A;  1Q9Y A;  1WSI A;  3VQP A;  4KHW A;  4E7I A;  2RPI A;  1UWB A;  2ZD1 A;  3RR7 A;  3RMB A;  3SYZ A;  1UA0 A;  4RW7 A;  4NCB A;  1VSK A;  2G8K A;  4J2D A;  4HUF A;  4M3U A;  4FJ7 A;  5HLF A;  5J2M A;  3LAN A;  4B9N A;  3ALY A;  1S5J A;  2X78 A;  2KZM A;  4B3O A;  3OYL A;  2QKB A;  4FK4 A;  5J2N A;  4M41 A;  1NKE A;  1N5Y A;  1ZBH A;  4CJ4 A;  4CJT A;  4DTU A;  2DTU A;  1KVC A;  4CGH A;  2VG5 A;  4DTR A;  1JKH A;  1EP4 A;  3VQC A;  3SNN A;  2G8I A;  4LH4 A;  3ZSW A;  3QEP A;  4W5Q A;  3VA0 A;  3SV3 A;  3TAB A;  4FJL A;  4OLA A;  5I42 A;  1NJY A;  4CFC A;  1WSE A;  3OYB A;  2VWJ A;  2Q3S A;  4RW6 A;  1TL1 A;  4IFV A;  1EET A;  3AVM A;  4E7J A;  1U45 A;  2Y1I A;  3DOL A;  4FW1 A;  3QEW A;  4AIL C;  1RBR A;  3LP2 A;  5CYQ A;  2PZS A;  3DLB A;  4HVJ A;  1T03 A;  4C8O A;  4J2A A;  3AO1 A;  1LAV A;  4BE0 A;  3G0Z A;  1RDA A;  4FLW A;  3ZT0 A;  1VSH A;  5HRR A;  3T19 A;  3NHG A;  4B9U A;  3OYJ A;  4EP5 A;  4R5P A;  4DSF A;  5SWM A;  3HPO A;  4FJI A;  1RDD A;  1S1V A;  4Z4I A;  3VQ5 A;  1DTT A;  1QE1 A;  1UAX A;  4CCH A;  1QS4 A;  3HO1 A;  4AHV A;  2D5R A;  3O3G A;  3H08 A;  3MAQ A;  3A2F A;  4OPK A;  1Y97 A;  3TAF A;  1L3U A;  1NJX A;  4YNQ A;  3M8R A;  1TKD A;  3LZJ A;  1BIZ A;  4CJQ A;  4NCA A;  4Z0U A;  2YKN A;  1RT6 A;  1GOB A;  2YHB A;  3KLG A;  3SUN A;  4M3Y A;  3D0P A;  3HVR A;  2YNG A;  3AO3 A;  4C8K A;  4CJK A;  3K59 A;  1BHL A;  3AA3 A;  4Z4G A;  1TGO A;  1U04 A;  4CFD A;  1Z25 A;  2DFH A;  3L2U A;  4DLE A;  4E3S A;  3C6U A;  1ZBF A;  3CFO A;  3OYC A;  3T3F A;  1SKR A;  4MFB A;  1RT2 A;  4H8K A;  4O0I A;  4DQI A;  4KI4 A;  3AVA A;  1BQN A;  1RT3 A;  4PY5 A;  4E0D A;  2VG7 A;  1LAW A;  3ZSR A;  4FLZ A;  3TI0 A;  2YNH A;  3V9Z A;  1VSD A;  3HL8 A;  2F8S A;  5EU7 A;  3IG1 A;  2O4I A;  4QOZ B;  1S1X A;  4M3R A;  2D0A A;  1D8Y A;  2XO7 A;  4DTN A;  4IG3 A;  3IAY A;  1FK9 A;  3VQB A;  4E7L A;  2ZE2 A;  3OYN A;  2RF2 A;  1RTD A;  1ZBI A;  3AVG A;  5JS1 A;  3DRP A;  1VSJ A;  1XC9 A;  1B9D A;  4CEE A;  2FBY A;  4CHO A;  4L8R B;  4N76 A;  3CM5 A;  3VQD A;  1W9H A;  4Z4F A;  1J5O A;  2IGI A;  4OKK A;  1JLC A;  3KLI A;  4FM1 A;  1JXB A;  2F96 A;  1J53 A;  4ID5 A;  1ASV A;  1ITG A;  1HYZ A;  3C95 A;  5K14 A;  1TAQ A;  1I3A A;  5SZT A;  4ELT A;  1J54 A;  2HND A;  4AH9 A;  4FJN A;  1RCH A;  3AO2 A;  1FXX A;  4O0J A;  1ZBL A;  4J2B A;  2X6N A;  2EHG A;  3KLH A;  4F3T A;  4FJ9 A;  4DWI A;  2G8H A;  4O55 A;  3KLF A;  3TAE A;  3E01 A;  4BE2 A;  3V1R A;  2WOM A;  4PQU A;  1RTJ A;  1NK4 A;  3ZSV A;  2XY7 A;  4LSN A;  1BL3 A;  4B8C A;  1NK7 A;  3PX6 A;  1C6V A;  4C8L A;  1JLG A;  2XY8 A;  3U3Y A;  1CZ9 A;  3HVT A;  3K58 A;  3QET A;  4FJG A;  1KLM A;  4Y1C A;  4OKJ A;  4XIU A;  1Z26 A;  1LWE A;  1LW2 A;  2HHV A;  4CJV A;  4IKF A;  1KVA A;  1ASW A;  3AO4 A;  1S9E A;  3AV9 A;  3AVJ A;  1VRT A;  1X9M A;  3RRG A;  2HVH A;  3HYF A;  2RN2 A;  2YKM A;  2GBZ A;  3LP1 A;  3AA5 X;  3MEC A;  3CG7 A;  2OA8 A;  3AVK A;  4DTP A;  4BAC A;  4DTM A;  4BDP A;  4KFB A;  3SUQ A;  3EZ5 A;  5J2P A;  4OGC A;  1BCO A;  3WNG A;  2YNI A;  4CF2 A;  3V1Q A;  1RBV A;  2KTQ A;  1Q8I A;  1YTU A;  2IC3 A;  4CK1 A;  5T7B A;  1D5A A;  4CFA A;  4KHY A;  4KHS A;  3OYH A;  1X1P A;  4FXD A;  1R0A A;  2AJQ A;  3HM9 A;  1TV6 A;  1WSH A;  3P83 D;  4DU3 A;  1CLQ A;  1SUQ A;  1CXQ A;  4KKO A;  3L2R A;  1SKW A;  1RNH A;  4B9S A;  1KFD A;  3LP0 A;  3V6D A;  4ELV A;  4FLX A;  3OYA A;  4EP4 A;  4CFB A;  4CK2 A;  1HQU A;  1RBS A;  4CJR A;  3HXM A;  3TAM A;  3V81 A;  4CIE A;  3WNE A;  4KO0 A;  2NUB A;  4BDZ A;  3C94 A;  1QHT A;  3LZI A;  3NH1 A;  3TAR A;  1NKB A;  3VQA A;  5FRM A;  4CER A;  3DI6 A;  4E7H A;  3NH0 A;  1WAF A;  3OJS A;  1WSG A;  2B4J A;  1LWF A;  3V1O A;  4CEZ A;  3I0R A;  1JXE A;  3PO5 A;  2P5O A;  4J2E A;  4W5N A;  4CJ5 A;  3HT3 A;  3ZT4 A;  3OVN A;  3P5J A;  3BGR A;  1ZBU A;  4CJL A;  3SUP A;  1NK0 A;  2Z1G A;  4KV8 A;  4CJP A;  3AVF A;  4HUE A;  1BIU A;  4CF8 A;  3K5O A;  2XY5 A;  1L5U A;  1T8E A;  4Z4C A;  1L3T A;  4JRQ A;  1VK0 A;  4FLV A;  4C8N A;  1HYV A;  3SQ4 A;  4DS5 A;  4HUG A;  4KPY A;  4I9L A;  1TKX A;  5C25 A;  2HHT A;  3DLR A;  2W42 A;  1EXQ A;  3QER A;  1XWL A;  3QES A;  3DLH A;  1BIS A;  4BWJ A;  4PUO A;  3EYZ A;  4N56 A;  2B5J A;  1RDC A;  4CES A;  5HRO A;  3AO5 A;  2PY5 A;  1BI4 B;  1VRU A;  1IKV A;  4CGI A;  3HPH A;  2Z1J A;  1I39 A;  1SV5 A;  1JL1 A;  3TR8 A;  4CHZ A;  3G10 A;  3V9S A;  4DFK A;  2G8W A;  4DMN A;  1RT4 A;  1X9W A;  3RWU A;  3NF8 A;  3SPZ A;  4I2P A;  2IS3 A;  4I7F A;  4WE1 A;  4AHU A;  4CHY A;  3V9W A;  3HST B;  3KKR A;  4FLU A;  1S6Q A;  2XY6 A;  2G8F A;  3QNN A;  3WNF A;  4PWD A;  1F21 A;  2GV9 A;  2X74 A;  3L3U A;  4DFP A;  4DU4 A;  3OS2 A;  2I5J A;  4LY7 A;  4RW9 A;  4B9T A;  3VA3 A;  3ZSQ A;  1FKO A;  4DSI A;  2X6S A;  3WNH A;  4ICL A;  3PUF A;  1IO2 A;  3SZ2 A;  3ZSO A;  3OYI A;  3OYF A;  2ATQ A;  3BDP A;  4ZTJ A;  3KLE A;  3P1G A;  3SV4 A;  1TK0 A;  1BCM A;  3K5L A;  3DMJ A;  3THV A;  1YTA A;  3L2W A;  4BDY A;  1X9S A;  3SUO A;  1KCF A;  4H4M A;  2HNZ A;  3NBP A;  3KJV A;  4CJE A;  5DK5 A;  5C42 A;  4HCB A;  3ZT2 A;  4B9V A;  4FZX C;  3MED A;  1KRP A;  4BE1 A;  2QKK A;  5HBM A;  2R7Y A;  5J1E A;  5E41 A;  1XI1 A;  4O5B A;  3L8B A;  1GOC A;  4FM0 A;  2KZZ A;  3KK2 A;  3M8Q A;  1BGX T;  1BQM A;  3ISN C;  1TKT A;  4CEC A;  3I8D A;  4YFU A;  3HPG A;  3O4Q A;  2HHU A;  4IDK A;  3QIP A;  3SI6 A;  1RBU A;  1U48 A;  1HRH A;  4Y1D A;  1UOC A;  4CJ3 A;  1J9A A;  5KTQ A;  2YV0 X;  3DRS A;  4CJF A;  1U49 A;  2E6M A;  5J2Q A;  1S1U A;  2OPP A;  1LW0 A;  4OPJ A;  3NDK A;  1QSL A;  3AVI A;  3LAK A;  4KRF A;  1EKE A;  3ASM A;  1Q9X A;  4UQG A;  5C24 A;  4W5R A;  3ZT3 A;  3KD1 E;  4HCC A;  1SL1 A;  1IKW A;  3CYM A;  4CJW A;  4KI6 A;  4GW6 A;  4CJU A;  4DQS A;  1NOY A;  1A5V A;  3JYT A;  4IG0 A;  2XRI A;  3KIO A;  5HP1 A;  4IBN A;  4E89 A;  2FBV A;  4FK0 A;  5HRN A;  5HRP A;  1SL2 A;  1YVU A;  1KTQ A;  3AVN A;  4PA1 A;  5KRS A;  4DSJ A;  4CEF A;  4GMJ B;  4W5O A;  3KK1 A;  3LWL A;  4DF8 A;  1U47 A;  3HJF A;  2HW3 A;  4ZTF A;  4QAG A;  3FFI A;  1C1A A;  2D0C A;  4DTO A;  3VQQ A;  3SJJ A;  4FVM A;  3NGI A;  1NK8 A;  1T05 A;  5JS2 A;  1RT5 A;  5D3G A;  4CIF A;  1CXU A;  4CGG A;  4OJR A;  3PX4 A;  2G8V A;  1A5X A;  4CF9 A;  1REV A;  4DSL A;  1RT7 A;  3ZSZ A;  2PYL A;  2RKI A;  2BDP A;  1KVB A;  1CZB A;  3NGY A;  3HP6 A;  4E7K A;  1XHZ A;  5I3U A;  2ZQB A;  1VSE A;  1VSF A;  2HHX A;  4IFY A;  1UA1 A;  2DFE A;  4DQP A;  2IDO A;  2PYJ A;  2OZM A;  1HNV A;  3K5M A;  2HMI A;  1XHX A;  4C8M A;  4KTQ A;  1KFS A;  4B9M A;  3B6P A;  3OYM A;  2A1S A;  4KHN A;  4CF1 A;  3CQ8 A;  1FKP A;  1SL0 A;  1D9D A;  3NH2 A;  2IOC A;  2VWK A;  4KB1 A;  3M8S A;  4KHU A;  5CY4 A;  1DTQ A;  1GOA A;  2FBT A;  4FLT A;  3NFA A;  3MXI A;  3K57 A;  5KGW A;  1VSI A;  3RMC A;  4M45 A;  3ITH A;  4TSX A;  2EX3 A;  3O3H A;  3KD5 E;  1TL3 A;  3AA2 A;  3PX0 A;  2HHW A;  4M3X A;  2DFF A;  4FJJ A;  1BI4 A;  3DLE A;  3OYD A;  5KGX A;  2IAJ A;  3QLH A;  2E6L A;  3I0S A;  4FJH A;  3VQ7 A;  5DMR A;  3HP9 A;  4DTJ A;  4CK3 A;  1B9F A;  4I2Q A;  4RG8 A;  3OYG A;  4RW8 A;  3LWM A;  1EX4 A;  4ZHR A;  4EZ6 A;  3M8P A;  1B92 A;  2JLE A;  4FCY A;  4DF4 A;  4KTW A;  2DY4 A;  3MEE A;  4QCL A;  3NE6 A;  4DFJ A;  5CZ1 A;  4FJ5 A;  4N5S A;  4GVM A;  4DTS A;  3AVC A;  1NJZ A;  4LH5 A;  4Q0B A;  3NF7 A;  2O4G A;  4OVL A;  2D0B A;  4F8R A;  3PV8 A;  4CGF A;  1ZYQ A;  5FRO A;  3CFR A;  4HHT A;  3QO9 A;  4F3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...