2G8FA

B. halodurans rnase h catalytic domain e188a mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGAIKADY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*UP*CP*GP*AP*CP*A)-3'
publication title Stepwise analyses of metal ions in RNase H catalysis from substrate destabilization to product release.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 39
structure length 133
sequence length 133
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2g8fA00
3KLFA 4DLGA 3K58A 4CFCA 1RDBA 2Z1JA 4IFYA 3MAQA 3DRRA 1S1TA 4BDZA 1X1PA 3ZSZA 4ELTA 2GBZA 4FJHA 4FLXA 3DYAA 3LZIA 3CM5A 1RTIA 3ALYA 3WNFA 1HNIA 2DTUA 1LWFA 4JS5A 1JLBA 1WNSA 3AA3A 1IO2A 3DOLA 1LWEA 4HVJA 4DSIA 1JLQA 2ZQBA 1ZBUA 3ZCMA 3LPUA 4EZ6A 2BE2A 1WAFA 1UOCA 2HVIA 2VG7A 3I0RA 3VQ7A 1L3SA 3HL8A 4CJTA 3RRHA 3TAEA 3PO4A 4C8KA 1NOZA 2ZE2A 3T19A 3SQ1A 4PY5A 1TAQA 2O4IA 2OZMA 1UWBA 2FBXA 5HROA 4I9QA 3K59A 4FCYA 4NCBA 1FKOA 2IC3A 3K2PA 4FJJA 3S3MA 1ASUA 4H4MA 3HP6A 1SL2A 4E7KA 4F2RA 1RILA 2HVHA 3JSMA 4KREA 4CHQA 1BQNA 3AVHA 3SUNA 2XY8A 1JL2A 3AO4A 4Z4CA 1RT4A 1RBTA 3HXMA 1EETA 4NYNA 4Z0UA 1JLFA 4HUGA 2DFEA 3RMDA 1T05A 3DLKA 4CJ3A 3OVNA 3OS1A 1BISA 3E01A 3SUOA 3LP2A 1LAWA 4MFBA 4CJKA 1S9GA 3HVRA 4DSFA 4O55A 4C8NA 4WE1A 4IG0A 2W42A 4B9SA 1YTAA 4CF2A 4F2SA 3KTQA 4CFAA 2HMIA 4GW6A 4BDYA 4CFDA 3OYMA 2HB5A 1U04A 4OJRA 3CG7A 1X9MA 2BGGA 4OKJA 4PQUA 4F3OA 4CGHA 3AVKA 3RTVA 3TAFA 1GOCA 1BIZA 4LSNA 1X9WA 4IG3A 3ZSYA 3VQ6A 4CJRA 1RT1A 3L2QA 3V9SA 1ZBFA 1XHXA 4Y1CA 1QSYA 3HJFA 2IOCA 2KFZA 4KKOA 4HUEA 4DQQA 3O4NA 4B9NA 2FBVA 1UA0A 2QKBA 4OKKA 3V9WA 2RN2A 4IDKA 3HT3A 4CCHA 3VQDA 5EU7A 1U45A 1CXUA 1T8EA 2OYQA 3S9HA 1TAUA 4E0DA 2OPRA 2G8KA 3B6OA 1D9DA 2VWJA 1CXQA 4HCBA 1TV6A 1L3TA 4GMJB 3NHGA 4FJLA 1S6PA 4ELUA 4DSLA 1HQEA 1XWLA 4AILC 1DTTA 2B5JA 4CF1A 4FYDA 5D3GA 2YNGA 4DG1A 4KTZA 4FM1A 4CGJA 1JLEA 4E7IA 3QEXA 2G8FA 3PUFA 1BCOA 1J9AA 4QAGA 4CEOA 1O1WA 4CGFA 4CK3A 2YKMA 3KLEA 1Q9YA 4CEZA 1JLGA 3KLHA 1X9SA 4FM0A 4CHNA 1U48A 3CQ8A 1VSDA 3QEVA 3LP1A 5C42A 1VK0A 3DLGA 1ASVA 2XHBA 4OPJA 4JRPA 3K5LA 1W9HA 3TARA 4F4KA 2F8TA 3HK2A 1TL1A 2P5GA 1RTJA 3L2UA 2G8UA 4DQIA 1C0MA 3OYIA 3PV8A 2HHQA 1TK0A 3KD5E 3TAPA 1LV5A 2PYJA 1A5WA 1RT2A 4BWMA 3VQAA 4BE2A 1WSFA 3L8BA 5CYMA 3OYHA 2F96A 1GOAA 4CIGA 5JS2A 3U6FA 1QQCA 3WNHA 4YFUA 2LSNA 1VSMA 2YKNA 1NJXA 4CEFA 3IS9A 4FLZA 1LW2A 3AO1A 2Y1IA 4FJXA 1UA1A 1TKDA 2A1RA 2KTQA 2ITGA 4FW1A 3VQ4A 5HRPA 4DS4A 2Y1JA 3SQ2A 1KFSA 3AVNA 4CESA 3V9UA 1NJYA 4W5NA 3LPTA 1NK9A 1RT6A 4B08A 3CFRA 1IG9A 1TK8A 1FK9A 1BCMA 3EYZA 1NOYA 3U3YA 2HHXA 3P1GA 1KRPA 1NK7A 2P5OA 3TR8A 2VG6A 4I9LA 4CF0A 4FJ7A 1NK6A 3KK1A 3OYFA 3D45A 3V9XA 1YVUA 2D0AA 2WONA 3MEDA 4AHTA 1JL1A 4FJ8A 3OYLA 5J1EA 4DF4A 2YNIA 4CFBA 4ICLA 3KKSA 3IAYA 4KAZA 1QS4A 4DTOA 4HCCA 1JLAA 1N5YA 3K5MA 4KHNA 1VRTA 2RPIA 1HNVA 3ZT0A 5HRNA 4FZZA 2DFHA 2QXFA 3AVAA 4RG8A 3QNOA 4FJMA 5KTQA 3VQQA 2P51A 1HQUA 4CJSA 1VSLA 4FW2A 2E4LA 3AV9A 1DTQA 2X6SA 3KKRA 3MEEA 1VSJA 3O3FA 2GV9A 3AA2A 1TK5A 2B6AA 2KZMA 4CJFA 3KK2A 3K5NA 3QIPA 4FVMA 2HHSA 3QEIA 3HYFA 2O4GA 3CFOA 4DQPA 5CYQA 4ID1A 3O3HA 4QCLA 1RDAA 3LAKA 5FDLA 1HJRA 2YV0X 1HYZA 3LAMA 4M45A 4JS4A 4CHZA 4F3TA 3AVMA 2ZD1A 1L3UA 1IKVA 4DTXA 4KB1A 4NCAA 3ZSWA 3OS2A 4ELVA 2HHUA 1HYVA 1RBVA 1ASWA 1SV5A 1TKZA 4AHCA 3OYEA 3QEPA 1XI1A 1ZBIA 5KGXA 1J54A 4Q5VA 1NJWA 1BIUA 2ATQA 4J2EA 1HYSA 4DQRA 4IFVA 1FKPA 4R5PA 2XY6A 2BANA 2PZSA 3NAEA 2RF2A 5J2PA 4C8LA 5K14A 2P1JA 3NH2A 4KRFA 4N47A 4Z4EA 3OYJA 4N76A 2WOMA 3VQ5A 4H4OA 1Z26A 4DLEA 1HRHA 1F21A 4NCGA 1S1UA 3AVGA 3KLGA 4KB0A 4E19A 1CZBA 4E3SA 4O44A 4CEEA 2HHWA 3AO2A 5CZ2A 3QNNA 4I2QA 3U3GA 4CGGA 4G1QA 4TSXA 1J53A 2YNHA 5E41A 3NCIA 1SKWA 4FLUA 2Z1GA 3MECA 1W0HA 3DRSA 3O4QA 1HMVA 4M41A 5KI6A 4CEAA 1S1VA 4CJQA 3V1OA 4FLVA 3VN5A 4KHQA 1LWCA 3AVCA 2I5JA 1KFDA 3LP0A 1T7PA 5JS1A 1C0TA 1QHTA 3B6PA 1BGXT 3LANA 4B9TA 1R0AA 1KTQA 2YNFA 2XRIA 3CYMA 3SI6A 4DSJA 3BGRA 1NK0A 1WAJA 3TWHA 3ZT1A 1QE1A 4Z4HA 1U4BA 4FJ9A 1KLNA 1JLCA 3AVJA 4K8XA 1BQMA 4DFJA 3MXMA 2QKKA 5HRSA 4Y1DA 3AA4A 5J2MA 1RBRA 1KVCA 4DTUA 1L5UA 3ASMA 3VQ8A 4N5SA 3DLBA 3DRPA 1IKXA 1BL3A 3V9ZA 3RWUA 4W5OA 4HUFA 4KPYA 2FBTA 1S9EA 3DLEA 1QSSA 1T03A 4C8OA 1NK8A 4FXDA 1SKRA 2OPQA 2XY5A 3EY1A 2OPPA 3CFPA 3V1RA 1SL1A 1RT3A 2EHGA 1Z25A 4CF9A 2B4JA 2EX3A 3M8RA 4FLTA 3A2FA 3SPZA 4DU4A 3SUQA 4CJ5A 4FK4A 4AHRA 3AVIA 3SCXA 4FJNA 4JLHA 4DF8A 3ULDA 4BACA 3S3OA 2QK9A 1VSIA 1NKEA 4J2BA 4W5RA 1KCFA 3IRXA 4HTUA 4CJUA 1I39A 3P5JA 4AHVA 1ITGA 3THVA 4DTJA 3V1QA 5FRMA 3DLRA 2G8IA 3G0ZA 4YNQA 1G15A 3SNNA 1C1AA 4NYFA 3T1AA 4E7LA 1ZYQA 1FXXA 1WN7A 5HLFA 3ZT3A 2G8VA 5FRNA 3OYAA 1VSHA 5HP1A 3NH1A 1LAVA 1NK5A 3RR7A 2VG5A 4LSLA 2HNDA 4RW8A 4N41A 5KRSA 3SYZA 4DU3A 1SL0A 4PWDA 4K8ZA 1BHLA 4OGCA 4E89A 4OPKA 3OY9A 4E7HA 2KZZA 1WSEA 3C6TA 4B8CA 3SJJA 4PUOA 3L2WA 1RCHA 4DTRA 1Q8IA 1C0UA 1EX4A 3QIOA 3ZSVA 2G8HA 3AO3A 5SZTA 2GUIA 3C95A 4LH4A 3TAMA 4DQSA 2E6MA 3ZSXA 1EP4A 2KW4A 4B8AB 3S3NA 3VQEA 4M3WA 4KTQA 4LD0A 3MXJA 3V4IA 1MU2A 2RKIA 3ZSOA 1B9DA 3LP3A 3I8DA 3LWLA 3M8QA 1HPZA 4BE0A 4DFMA 3L2RA 4B9VA 4RW9A 3OYBA 3HSTB 4DFKA 4HHTA 1TKXA 1TKTA 3OYDA 2X78A 4E1MA 4CK2A 3ZSQA 4FJIA 4KHWA 1RBSA 4O4GA 1K6YA 2BDPA 2KFNA 1S5JA 1RT7A 4GVMA 3VQCA 4KTWA 3CM6A 4FLWA 3HVTA 3L3VA 3OYCA 2YHAA 3RMCA 3SPYA 2HNYA 4E1NA 4OKEA 1RDCA 3ZSRA 2OPSA 1S6QA 4ZTFA 3JYTA 4DSKA 2AJQA 1B92A 3QEWA 1RT5A 4FJGA 3K5OA 1I3AA 3OJSA 3TAGA 4ZHRA 3NGZA 4DFPA 4LY7A 4M3XA 5FROA 4KHYA 3H08A 2HW3A 4M3RA 1D8YA 2F8SA 1JXEA 4B3OA 3NF6A 3OYNA 4DMNA 4CF8A 3QETA 4AHSA 1WSGA 4CHPA 3OYGA 4CJPA 5CZ1A 4DS5A 4UQGA 4CJWA 4M3ZA 4DTMA 1QSLA 3KD1E 1ZBHA 5SWMA 3KK3A 1VSEA 4KO0A 3V81A 3PY8A 4CGIA 4J2AA 1RNHA 3LDSA 4AHUA 5C24A 3NDKA 4E7JA 3TABA 1BI4B 3DMJA 4OGEA 5J2QA 1REVA 4KI4A 1GOBA 1VSKA 3NBPA 4FK0A 3HP9A 2JGUA 4CJVA 1C1BA 4OLAA 1ZBLA 1XC9A 1KVAA 1VRUA 1KVBA 3PX4A 4DTPA 3PX0A 3MXIA 2XY7A 4CK1A 3VA3A 3NGYA 2NUBA 2PYLA 2HHTA 3ZT2A 3KLIA 4XIUA 3AO5A 1XHZA 3FFIA 4LH5A 1S1WA 2DFFA 2Z1HA 3C94A 3ZT4A 4CJLA 2Z1IA 3RRGA 3NF8A 4B9LA 4ID5A 4B9MA 2G8WA 4DU1A 1A5VA 2HNZA 4Q0BA 1WLJA 1U47A 2PY5A 4DTNA 4KV8A 4PA1A 3M8SA 1YT3A 1EKEA 1QTMA 1C6VA 5T7BA 2D5RA 1KLMA 4FM2A 1JXBA 4EP5A 1L3VA 4QOZB 3LZJA 1LW0A 4FZYA 4AH9A 4N56A 2YHBA 3RMAA 1DLOA 4C8MA 4CHOA 4BDPA 3T3FA 5HBMA 4CHYA 3SUPA 3EZ5A 3QLHA 3TAQA 5I3UA 3HM9A 3HO1A 3SV4A 2X74A 5KGWA 4CGDA 3BDPA 2DY4A 3UIQA 1RDDA 3NF9A 1Y97A 3SV3A 4OLBA 3IG1A 4CECA 4IKFA 3QO9A 4M42A 4H8KA 3NH0A 3OJUA 1Q9XA 2OZSA 4FJKA 1D9FA 4MQ3A 4RW7A 3VQBA 4F8RA 1TL3A 4ZTJA 4EP4A 3AVLA 3NF7A 2IDOA 4CEQA 3KIOA 4O0IA 4BWJA 3VQPA 4CEDA 3F73A 1B9FA 2R7YA 3AA5X 2OA8A 2D0BA 2IGIA 3M8PA 4L8RB 4BE1A 4W5TA 1NJZA 1D5AA 1IKWA 4JRQA 4KFBA 4CERA 3V6DA 1IH7A 3I0SA 4Z4GA 3AVFA 3L3UA 3SQ0A 4CEBA 1J5OA 1CLQA 3HPOA 4RW6A 3RMBA 1NK4A 1WSJA 2X6NA 1U49A 2HHVA 3MEGA 4O5BA 2ETJA 3VQ9A 3OS0A 3ITHA 3NFAA 1TVRA 1WSIA 1S1XA 4O0JA 4DTSA 3DM2A 3PO5A 5KRTA 1RBUA 1YTUA 4KHSA 3LWMA 3VA0A 3HPHA 3P83D 5DMRA 1C1CA 5C25A 2VWKA 3QINA 4B9UA 3DOKA 3RR8A 4OVLA 4CJ4A 3NE6A 4EZ9A 4FJ5A 1VSFA 4CIFA 3SQ4A 3LALA 2A1SA 1CZ9A 3D0PA 3QESA 4J2DA 2Q3SA 3ISNC 5J2NA 2KQ2A 4KI6A 4FK2A 1EXQA 4IBNA 2E6LA 5DK5A 3WNEA 1KSPA 1JKHA 4I7FA 3TANA 2D0CA 4W5QA 3G10A 4FLYA 1WSHA 1NKBA 1SUQA 3WNGA 3PX6A 4Z4FA 5CY4A 4DSEA 1N6QA 1TGOA 4FZXC 2IAJA 2JLEA 3C6UA 3TI0A 4CIEA 4DWIA 4M3YA 1SKSA 2XO7A 1RTDA 4RW4A 4KHUA 3O3GA 2FC0A 2FBYA 1UAXA 5I42A 4M3TA 4I2PA 4Z4IA 4CE9A 1BI4A 3OYKA 2IS3A 3L2VA 3SZ2A 3QERA 3DI6A 3KJVA 1NKCA 3DLHA 1A5XA 5HRRA 3F9KA 1RTHA 4CJEA 3NGIA 3K57A 4M3UA 1IKYA 3HPGA 3AVBA
chains in the Genus database with same CATH superfamily
3LDLA 4DLGA 2Z1JA 5M1FA 4B9QA 5AZJA 4FJHA 4JAXA 2I7PA 4Y0WA 3CM5A 3ALYA 4CD3A 4JS5A 1IO2A 3DOLA 1TYQB 2WTUA 1JLQA 3DJCA 4EZ6A 1WAFA 3GOIA 1DKGD 4CJTA 1NOZA 3SQ1A 2GWJA 2NRXA 4NCBA 4FCYA 1FKOA 1WUAA 3LM2A 3K2PA 3J7ZO 4FJJA 1ASUA 5AQQA 2XY8A 3AO4A 4Z4CA 3HXMA 1IBLK 1RBTA 1NLVA 4HUGA 1O13A 3RMDA 5M1NA 3QBXA 1E3MA 3QMLA 4MFBA 2Q36A 3FLCO 4DSFA 3T1HK 4O55A 1K8AO 4WE1A 2VGMA 2OCEA 4B9SA 4BDYA 3TSUA 1U04A 3FGUA 4FWKA 2D0OA 3CPWM 3TAFA 3CMEN 1NU0A 4LSNA 1X9WA 3ZSYA 4BRKA 1ZBFA 2KFZA 4DQQA 4HUEA 4FVUA 4YOXA 2FBVA 4AF1A 3D2EB 2RN2A 2VYPA 3J8AA 1T8EA 2OYQA 4FWPA 3S9HA 4K25A 4E0DA 2HOEA 3VTHA 4WCEL 4B3SK 4GMJB 4NO7A 1XWLA 4AILC 2B5JA 4CF1A 4FYDA 5D3GA 3CC4N 2YNGA 1KAXA 1RFQA 5E84A 1GLBG 1J9AA 1BCOA 3KLEA 4A2AA 5AQLA 4FM0A 1Q7YO 2UUBK 2Q0RA 1U48A 4OPHA 4YOYA 2F8TA 4DQIA 3L2UA 3OYIA 3D6RA 1OH5A 3NMUA 1Z05A 3LDNA 1QQCA 4YFUA 3ZX3A 2YKNA 5C2DA 4FL9A 1GLDG 1LW2A 3AO1A 2Y1IA 4DS4A 4DV2K 3VTIA 4G9ZA 4W5NA 3LPTA 1IG9A 1TK8A 1FK9A 1BCMA 3U3YA 3TR8A 4I9LA 3OYFA 2WONA 3FFKB 3MEDA 4BROA 5J1EA 1E4GT 2YNIA 1QS4A 4NB4A 1JLAA 3K5MA 5BR8K 3O6WA 4FZZA 2QWNA 2DPNA 3FE1A 3QNOA 3ZEUB 2YI1A 1VSLA 4FW2A 4FWLA 4RWTA 1DTQA 3MN7A 3BZKA 3CJBA 2GV9A 2KZMA 3K5NA 2HHSA 3HYFA 2O4GA 3N4QA 4DQPA 2IVNA 1HNZK 5FDLA 2ZJRL 1HYZA 4F3TA 4AM7A 4CHZA 5LMNK 1IKVA 3HRGA 2P9SB 3OS2A 4AHCA 3OYEA 1XI1A 3HOSA 2ATQA 4KBOA 1HYSA 4DQRA 4R5PA 2RF2A 4X64K 5AQIA 1VQMN 2P1JA 4Z4EA 4HWIA 2AP1A 2NZTA 1Z26A 4A5BA 1HRHA 4DLEA 5BRHA 3THXA 2E1ZA 4NCGA 3KLGA 1CZBA 1EQYA 4O44A 2HHWA 3AO2A 5CZ2A 1YITN 4I2QA 5HL7L 1NGJA 1HUXA 1W0HA 3DRSA 4M41A 3TU5A 1HKGA 3LP0A 4C1NI 1C0TA 1QHTA 3LANA 2XRIA 3CYMA 3SI6A 4PKIA 5IWAK 1WAJA 3A5NC 1QE1A 3VGKA 4Z4HA 4FJ9A 4H0YB 2HF3A 3U4LA 3O4WA 4DFJA 2P9LB 3MXMA 5LY3A 4J8FA 5HRSA 4H0OA 3ASMA 4N5SA 5C15A 3SMPA 3WEEB 4KPYA 3DLEA 1T6DA 1NBWA 3EY1A 3CFPA 3V1RA 1Z25A 2B4JA 3IDHA 4FLTA 3A2FA 3EE9A 3O1WA 4CZJA 4FK4A 3FR0A 5GADP 2PFUA 3AVIA 2E5LK 2FLOA 4JLHA 3S3OA 3LDPA 1NKEA 3MK6A 1KCFA 1NGEA 4CJUA 1SQKA 3VESA 4GNIA 4AHVA 4RTFD 1Q82O 3DLRA 3SAFA 1ZYQA 1C1AA 4NYFA 4E7LA 4CD1A 1LCUA 3CC7N 5AQSA 1FJGK 5HP1A 4JKCA 3MDQA 3RR7A 4FOIA 4RW8A 5KRSA 4LF4K 4V19S 1WOQA 2YCHA 1BHLA 2QM1A 4E7HA 1WSEA 2CGLA 4PUOA 4JKEA 1T6CA 3EEQA 2VQEK 3AO3A 4YDUA 4LC9B 3C95A 4BR4A 4QS7A 4DQSA 2E6MA 1EP4A 3VQEA 1JCFA 4CVNE 3V4IA 1MU2A 3ZSOA 3TSPA 4BE0A 4B9VA 4CJ7A 3HI0A 1J6ZA 3OW2M 3ZSQA 5JVGL 1RBSA 1K8KB 1K6YA 4O4GA 1RT7A 4KTWA 3CM6A 3OYCA 4U7BA 2YHAA 1NGBA 3QDKA 4DQ8A 2WBNA 1W97L 5AQGA 3NF6A 3R8EA 3OYNA 1X3MA 4DMNA 3QETA 1WSGA 3I55N 4CHPA 3OYGA 4DS5A 3O1BA 1YHQN 2O8DB 4BR0A 3A8YA 4CGIA 2ASPA 4E1JA 3TABA 5J2QA 4KI4A 3J81O 1VSKA 2F9WA 3D7EO 2O8BA 1KVAA 4CZHA 2HHHK 3NVMA 4WQ5A 3WEEA 3VA3A 4YDUC 4DR3K 3FFIA 4WFAL 2Z1HA 5M1KA 4CJLA 4IFEA 3RRGA 1ZC6A 2G8WA 1A5VA 4H5VA 2HNZA 1U47A 4FPAA 4IZ9A 4JI6K 2FSKA 4LF9K 4JKAA 4FM2A 3LZJA 3T1YK 4BG9A 1U2VA 5HBMA 4NXMK 4CHYA 3H45C 5JLHA 3LM9A 3E66A 3HM9A 5KQ8A 3SV4A 2X74A 5KGWA 3BF1A 4B3RK 5B8HA 4JI4K 2GELA 1SS6A 2YJEA 2OZSA 2WC9A 4RW7A 3VQBA 3CC2N 1NJIO 3OBYA 1MA9B 3NF7A 2ZJQL 4LF7K 4BWJA 4CEDA 4WFBL 2OA8A 2D0BA 2A3ZA 2BTFA 5M1PA 4W5TA 3WXIA 4JRQA 2RHKA 5M1OA 4CERA 3I0SA 5EOYA 4M63C 5BN8A 3SMSA 3MMVA 2X6NA 1ATSA 3EKSA 4B1ZA 4O5BA 3U8XA 3VQ9A 3OS0A 3NFAA 4WQ5C 3DM2A 1RBUA 5DMRA 4B9UA 2VWKA 5AQPA 4IDHA 3RR8A 3GL1A 1VSFA 5LJVA 3LALA 3QESA 4J2DA 5DM6L 3WNEA 2P9PB 1KAYA 4NLBA 1I94K 2HF4A 3PX6A 4DSEA 2KLAA 4DHYA 2IAJA 3CJAA 1EWQA 3L4QA 1SKSA 5C12A 4KHUA 4RW4A 2FC0A 2FBYA 1UAXA 5JICA 4Z4IA 4CE9A 3QERA 3DLHA 4GV3A 3KJVA 3KHYA 1YI2N 3QICA 4AM6A 4CJEA 2CH6A 3K57A 4M3UA 3PSIA 3KLFA 3K58A 4CFCA 4BDZA 1X1PA 3BP8A 3ZX0A 4NXNK 2GBZA 3WXMB 4FLXA 4B3MK 3WNFA 4JHDA 1HNIA 3HZ6A 1XUPO 2P9UB 4BVOA 4JV5K 3H46O 1G99A 2IVPA 3ZCMA 3O9QA 1ZBUA 2HVIA 3VQ7A 3I0RA 1L3SA 1VAZA 5BN9A 2UUCK 3PO4A 3T19A 2O4IA 3CI5A 3K59A 3HP6A 3JSMA 3MCPA 1BQNA 3AVHA 3MX5A 2A6AA 4Z0UA 4MDBA 3HOTA 3DLKA 4CJ3A 3OVNA 3VMFB 1BISA 1VQ6N 4OO1J 3VERA 3SUOA 3VF4A 3HVRA 3LDOA 4IG0A 2OTJN 2HMIA 4GW6A 4CFDA 4DR6K 2HB5A 4OJRA 2BGGA 4MO5A 3T7ZA 4OKJA 3KZBA 1IV0A 3JS6A 4IG3A 3KVGA 3VQ6A 5FPDA 4CJRA 1NGDA 1QSYA 2IOCA 3V9WA 1QVGM 3CCSN 5EU7A 1CXUA 3E9PA 4K42A 1TAUA 1SAZA 5BPMA 1J5EK 2G8KA 1CXQA 4HCBA 3KWGA 2UXDK 4ELUA 1HQEA 2WUSA 4KH6A 2PAVA 1JLEA 3M1FA 3O9UA 3ID6A 4CK3A 1O1WA 3KLHA 1X9SA 5AQHA 3O80A 2HBJA 3CQ8A 1RDWX 3LP1A 4M7YA 1DEJA 4CBUA 1VK0A 1ASVA 2XHBA 4OPJA 4JRPA 3K5LA 3HK2A 2P5GA 1RTJA 1ZXOA 2G8UA 3MWTA 2HHQA 2FF6A 4JKGB 3KD5E 3TAPA 1A5WA 4BWMA 3VQAA 3ZETB 4C1NK 5CYMA 3FZMA 1GOAA 2UYTA 5TKWA 2LSNA 3P4IA 4FLZA 4FJXA 2KTQA 1TKDA 2A1RA 1M1KO 5HRPA 2Y1JA 3SQ2A 3WXLA 3EL2A 4BGAA 1RT6A 4B08A 3EYZA 4NLCA 2HHXA 3VGLA 3G71N 4I6MA 2VG6A 4CF0A 4MO4A 4BRAA 4CZMA 4FJ8A 3IAYA 4JD2A 4HCCA 1N5YA 1BO5O 4DV6K 4KHNA 2VWBA 3PSFA 4DKWA 4JNEA 2QXFA 3AVAA 1X9JA 1QQMA 1IBKK 3CQXA 2E4LA 3HSCA 1VSJA 3O3FA 3ENHA 1IJJA 2B6AA 1TUUA 3CFOA 5AFUH 5AJ3K 4QCLA 3WUHA 2YV0X 5EXWA 5GINA 3LAMA 1VQ9N 2ZD1A 1L3UA 4PKHA 1S22A 2O8FA 1NMNA 1RBVA 1ASWA 1SV5A 1TKZA 1ZBIA 3M5RA 4Q5VA 2KKZA 1QQNA 3D2FA 4IFVA 1FKPA 2XY6A 2BANA 3NAEA 4KRFA 5AZIB 3VQ5A 4H4OA 1F21A 3CCRN 1CZAN 5AQTA 3AVGA 5C0YA 4H0XB 4BC3A 4WF9L 3U3GA 4G1QA 4TSXA 1J53A 2W41A 5E41A 1BU6O 4R79A 1S72N 3SAHA 3MECA 3O4QA 3C0BA 1HMVA 1S1VA 3MX2A 4YOWA 5EX5A 1U6ZA 3VN5A 4JK8A 3KWIA 4FLVA 4KHQA 2O8CB 1T7PA 2I7NA 5JS1A 5BPNA 3EO3A 1P90A 1IBMK 2O8EB 4B9TA 1DGKN 1SZ2A 1R0AA 1KTQA 3JAMO 3SK3A 3A5OC 4DR2K 2UXBK 1GLJO 3AGRA 5FPNA 1NGGA 1V4TA 1XC3A 3CF5L 2QKKA 3G4SN 3CCMN 4Y1DA 3AA4A 4BC5A 1GLEG 1IKXA 3RWUA 2FBTA 1S9EA 2HMPA 3U9DA 1T03A 2XY5A 4PL7A 5M1QA 4O8UA 3HM8A 3WQUA 1NG9A 4CJ5A 4AHRA 3SCXA 4X65K 4FJNA 2E2OA 4BACA 1VSIA 5BR9A 3P5JA 3THVA 4DTJA 3V1QA 3DAWA 4EIAA 3G0ZA 4YNQA 2G8IA 1G15A 2QEXN 3ZT3A 3OYAA 4WYBA 1LAVA 5AFUA 4DUZK 5AQFA 2HNDA 4N41A 4DU3A 1TYQA 4K8ZA 4E89A 4B8CA 3SJJA 3MN9A 3EKUA 4DTRA 1EX4A 3QIOA 3K9KA 2GUIA 4LH4A 4DR4K 5AQJA 2AA4A 3S3NA 4B1XB 1B9DA 3M8QA 3E9OA 4RW9A 3MWPA 4HHTA 1TKXA 4CZLA 3OYDA 2X78A 4JKFA 1VQ8N 4GVMA 3GG4A 3HVTA 3L3VA 3RMCA 5A2QO 4H5RA 1RDCA 2CGKA 5AZIA 1S6QA 3JYTA 1RT5A 3K5OA 1I3AA 3OJSA 2QW9A 5JLFA 4DFPA 1KC8O 3FZKA 4ILJA 4M3RA 1D8YA 1JXEA 4BR5A 3UB5A 4AHSA 4XH5A 1HKBA 2O8CA 4CJPA 5CZ1A 2CGJA 1N34K 3CCVN 1WBBA 1QSLA 3KD1E 2O8EA 4WFNL 2E2PA 4KH4A 3V81A 3PY8A 4J2AA 3D2EA 4AHUA 4BGBA 4FOEA 3NDKA 5H1SQ 4OGEA 1KQSM 1GOBA 3NBPA 3J80O 4IWVA 4OLAA 1VRUA 2IIRA 5HOOA 1NGAA 4CW7B 1KVBA 4DTPA 3PX0A 1VQ7N 2HHTA 3KLIA 4XIUA 1XHZA 5AQNA 1S1WA 2DFFA 3ZT4A 4B1WB 4DV0K 1QQOA 1EO1A 4A59A 2PY5A 4DTNA 4PA1A 3UKRB 3M8SA 1YT3A 1QTMA 1C6VA 4LFAK 4BY9C 4EP5A 4Z94A 4QOZB 4FZYA 3RMAA 2YHBA 4C8MA 3VPZA 4BDPA 3T3FA 3EZ5A 2QWOA 5I3UA 4CZIA 4BREA 4LF8K 4JN4A 4DV1K 1VQPN 1GLLO 4JI2K 4M42A 3P38A 3NH0A 2UU9K 3OJUA 1Q9XA 3THYB 2ZF5O 1D9FA 4ISFA 3J7AP 5TKYA 4EP4A 4RCHA 3AVLA 2IDOA 3HTVA 1ZBSA 3F73A 3AA5X 3M8PA 1ATNA 1HNWK 1XMOK 1IH7A 4Z4GA 3TTCA 4IEEA 3SQ0A 3ZEUA 1CLQA 1J5OA 2V51B 1NK4A 1YXQA 1WSJA 4BRHA 4DTSA 1WSIA 1S1XA 4GV6A 1YTUA 3LWMA 4BC4A 1C1CA 3AARA 4ILHA 3E1YA 4OVLA 3GBTA 4BRDA 4EZ9A 4FJ5A 4CIFA 1JJ2M 3D0PA 2Q3SA 5J2NA 5E26A 2KQ2A 4KI6A 4EAHD 2E6LA 1KSPA 1JCGA 4BQZA 2P9SA 4I7FA 2D0CA 4Z4FA 3DXKB 1HX1A 5CY4A 4B1VA 1TGOA 4EHUA 2HSTA 4FZXC 3C6UA 2ASOA 4JEPA 4M3YA 2XO7A 3GDQA 1RTDA 1HLUA 1Q18A 3OYKA 2IS3A 3MN5A 1BA1A 3L2VA 5JVHL 4GY2B 5AR0A 3CCJN 4GKKK 1RDBA 3MAQA 2QWRA 3ZSZA 4ELTA 1K73O 3N4PA 1N36K 1RTIA 1NNEA 4DCHA 3NVKA 2DTUA 4BRGA 1JLBA 1WNSA 4YOTA 5F0XA 2E20A 2ZQBA 4FWRA 5GAGP 2BE2A 1UOCA 2VG7A 1X3NA 3HL8A 3P39A 4H0TB 1YUWA 3RRHA 3VF2A 4C8KA 2ZE2A 4FWOA 1TAQA 4XH1A 1UWBA 2FBXA 3CD6N 2P9LA 3FZLA 3S3MA 3R1XA 4H4MA 1W2BM 4E7KA 1SL2A 1RILA 3ENOA 4F2RA 2HVHA 3UE5A 4KREA 1KXPA 4FWMA 5FPEA 3H6EA 1RT4A 4NYNA 2DFEA 1HJOA 1T3VA 1OH7A 1HKCA 3E01A 3LP2A 3VEVA 4ISGA 1OVQA 4CJKA 1OH8A 4C8NA 4F2SA 1YTAA 1NM1A 4IO8A 3BY5A 3OYMA 1X9MA 5AQKA 3CG7A 3SJHA 1YJWN 1GOCA 1BIZA 5I9EB 1VQ5N 1RT1A 2YHWA 3OHRA 4K43A 4BRPA 3BZCA 1XHXA 4Y1CA 5C10A 3HJFA 2Q31A 1UA0A 3HT3A 2E88A 3O08A 5DM7L 4KH5A 4DR1K 2OPRA 3TPQA 2GUPA 1D9DA 3C7NB 3Q7BA 3NHGA 1S6PA 4DSLA 5ADXA 1QZ5A 5AQMA 4KTZA 4FM1A 1XMQK 4CGJA 4E7IA 2G8FA 4QAGA 1YAGA 2J4RA 3PUFA 4CEOA 4C23A 4CEZA 1JLGA 4OPAA 4BRQA 1VSDA 3QEVA 1K8KA 1NMDA 5C42A 4MLEA 4JYAK 1W9HA 3TARA 4F4KA 3VEXA 1QZ6A 5GAEP 3ATVA 3PV8A 1TK0A 1RT2A 2ITMA 4BE2A 1WSFA 4JI7K 3L8BA 3OYHA 4JK9A 2F96A 4CIGA 3U6FA 1VSMA 2NRHA 4H03B 3IS9A 2EWSA 4KHPK 5CHIA 2RE2A 3AVNA 4CESA 5KPZA 3V9UA 1C0FA 3I56N 3CFRA 3VGMA 3P1GA 2P5OA 2O8DA 3A5LC 4FJ7A 3KK1A 3V9XA 3D45A 1YVUA 1JL1A 3K0SA 5MLCQ 4JI0K 4DF4A 4U67L 4ICLA 3KKSA 5AQZA 4A62A 1VRTA 5LMUK 3ZT0A 2DFHA 4FJMA 5KTQA 2Q2RA 3CMAN 1BG3A 1GLAG 3W0LA 2P51A 1HQUA 4CJSA 3AGKA 2YHYA 3THWB 3AV9A 3ZYYX 3KKRA 3MEEA 5IT9O 3UKUB 1VHXA 4CJFA 3KK2A 2KHOA 3QIPA 4FVMA 3QEIA 3RSEB 2D0PA 2YX6A 4M45A 4K0KK 4CI6A 1BOTO 2P9IB 1XNRK 3AAQA 4DTXA 4NCAA 1XNQK 4ELVA 2HHUA 1HYVA 3WT0A 3QEPA 3E9LA 1J54A 1NJWA 4JI5K 4XEIA 2JWKA 4IJAA 3BEXA 3ULEB 4N76A 2FSJA 3VENA 4CZKA 5GAHP 4B1YB 3WXJA 4E19A 3C7NA 3DWLA 1R59O 3QNNA 4CGGA 2ZM6K 1SKWA 4FLUA 4H0VB 5AZJB 2PBDA 4B1UB 4CJQA 3V1OA 2NNWA 1LWCA 3AVCA 1KFDA 3VEOA 1BGXT 2YNFA 3M3ZA 4MLHA 4DSJA 1NK0A 3TWHA 1P8ZA 2QWMA 3ZLJA 5F2RA 3AVJA 4JI3K 4YHHK 1L5UA 1RBRA 4YOUA 3CERA 3DLBA 2P9PA 3DRPA 3CJCA 1BL3A 3V9ZA 4HUFA 2BH1A 2NRWA 4C8OA 1NGFA 4FXDA 1HR0K 4JK7A 2OPQA 1SKRA 1SL1A 2EX3A 3GE1A 3SUQA 2NLXA 4DF8A 3ULDA 4H5NA 1YJNN 4J2BA 4W5RA 3SBTA 5LJWA 3IRXA 4GVEA 4F9OA 1ILYA 5C2FA 1ITGA 4BR9A 3SNNA 4FSVA 2D4WA 3T1AA 1FXXA 5HLFA 4QS8A 2G8VA 4CZEA 1VSHA 1NK5A 4BRLA 2VG5A 3AAPA 2P9UA 3TTFA 4BQLA 4OPKA 3H1QA 3C6TA 1MWMA 3H3OB 3CJ1A 3L2WA 1RCHA 4BG8A 2P9IA 3TAMA 3CCEN 4B8AB 4M3WA 4DV5K 5KPTA 4LF5K 4LD0A 3MXJA 2RKIA 3LP3A 1HPZA 1BUPA 3L2RA 3OYBA 3HSTB 4DFKA 4E1MA 4FJIA 4KHWA 2BDPA 1GLCG 3CCQN 3PLAA 4BR7A 4OKEA 3ZSRA 4DSKA 1B92A 3QEWA 4FJGA 3CETA 3EE8A 1YJ9N 3TAGA 3NGZA 3WQTA 4LY7A 4B3TK 4M3XA 3R9PA 5FROA 3H08A 2F8SA 4K41A 2ASMA 4FO0A 4CF8A 2NRTA 3PIPL 4DB3A 4M3ZA 1ZBHA 5SWMA 3KK3A 4KO0A 3H3NO 4X62K 3CPEA 4BVPA 4E7JA 1BI4B 3DMJA 3A5MC 4HTLA 4JKHA 2Q97A 4FK0A 3HP9A 2JGUA 4CJVA 1C1BA 1ZBLA 5AQWA 3O9RA 2XY7A 2NUBA 2PYLA 5GIPA 4LH5A 3M6GA 3C94A 2ZWHA 4ID5A 4B9MA 3CIPA 4DU1A 2GX9A 4KV8A 1FW6A 2FF3B 1EKEA 3QBWA 2D5RA 3I33A 4JKGA 5GIOA 3ATUA 1L3VA 3ZETA 2F4VK 4AH9A 4N56A 1DLOA 3SUPA 2E1YA 3QLHA 4JI1K 3VF6A 3HO1A 2QWPA 5AQXA 2DY4A 2Q1NA 3UIQA 1RDDA 3RVCA 3NF9A 1Y97A 5AQRA 3SV3A 3IG1A 3TSQA 4CECA 3QO9A 3JXUA 4FJKA 4MQ3A 4F8RA 2ZGYA 4ZTJA 1JCEA 3THXB 5KQDA 4DV4K 1MDUB 3CXCM 4CEQA 4O0IA 1M90O 3VQPA 4BC2A 1B9FA 2R7YA 4L8RB 4JKBA 1NGCA 4BE1A 3LDQA 2A42A 2HBLA 1VQON 3V6DA 3ID8A 3AVFA 4AQYK 3L3UA 3B8AX 3HPOA 1U49A 2HHVA 4LFCK 1TVRA 4O0JA 1KAZA 3PO5A 4OX9K 4KHSA 3HPHA 3P83D 5C25A 3VETA 2E2QA 3QINA 5BREA 3DOKA 1VQNN 4CJ4A 3NE6A 3SQ4A 1CZ9A 3O9SA 4FK2A 4IBNA 5DK5A 1JKHA 3G10A 4FLYA 1WSHA 5F1XA 1BWFO 5BPLA 1TUYA 4DUYK 3TI0A 1XQSC 4CIEA 4CZGA 4UY8O 5I42A 3O8MA 4DR5K 4M3TA 1BI4A 2ZJPL 2A40A 1WBDA 1NKCA 1N32K 2HBKA 1A5XA 5HRRA 4GKJK 3F9KA 1RTHA 4A57A 4B3OA 1IKYA 3HPGA 3F5TA 4QS9A 2IVOA 4IFYA 3DRRA 1S1TA 1OVYA 4H5WA 4IOAL 2GEMA 3DYAA 3LZIA 1NGHA 3L0QA 1LWFA 1E4FT 3AA3A 5EY4A 4HVJA 1LWEA 3C6HA 4DSIA 4LFBK 3LPUA 1EWRA 2WFBA 5FLXO 3TAEA 4PY5A 2OZMA 5HROA 4I9QA 2IC3A 2JWLA 2YHXA 4CHQA 3SUNA 1JL2A 1EETA 1T05A 1JLFA 3FZFA 3OS1A 5AQOA 1LAWA 1S9GA 1Q86O 3CJ9A 2W42A 4CF2A 3KTQA 4CFAA 3MN6A 4H0PA 4PQUA 3MCAB 4F3OA 4CGHA 4IOCL 3AVKA 3RTVA 3DLLL 2A5XA 3L2QA 4LF6K 3F9MA 4XH4A 3OTOK 3IUCA 3V9SA 2OANA 4KKOA 1Y64A 3O4NA 4B9NA 4IEIA 4JKDA 2QKBA 4OKKA 2W6LA 4IDKA 4CCHA 3VQDA 1U45A 2UUAK 3W3DA 1W7AA 3BUZB 4CZFA 3B6OA 2VWJA 3L6QA 1TV6A 4PL8A 1L3TA 4FJLA 4YY3K 1VQ4N 2O8BB 1DTTA 4DG1A 3DXMB 3QEXA 4CGFA 2YKMA 3WXKA 1Q9YA 4EFHA 4DV7K 4CHNA 3U9ZA 3LL3A 3DLGA 1TL1A 4BRNA 1GLFO 1C0GA 1C0MA 1LV5A 3CHWA 2PYJA 3EZWA 1VQKN 2CH5A 5JS2A 3WNHA 1U2VB 1NJXA 4CEFA 1UA1A 1DT9A 2ITGA 4FW1A 2YJFA 4O8KA 3VQ4A 1WB9A 1KFSA 5ADXH 1NJYA 1NK9A 2GWKA 1NOYA 3K9JA 1KRPA 3QB0A 1NK7A 4L3QA 3P31A 1NK6A 2D0AA 4IXCA 2VGNA 4AHTA 3OYLA 4KAZA 4CFBA 4A61A 4DTOA 2RPIA 1HNVA 2FXUA 5HRNA 1RDUA 5BRDA 4RG8A 3VQQA 4DR7K 1T44A 5AQVA 2UXCK 3SBGA 2X6SA 2D1KA 3SAGA 3AA2A 1TK5A 5CE3A 2VCPA 3F2KA 1N33K 5CYQA 1NGIA 4ID1A 3UKRA 3O3HA 1RDAA 3LAKA 1HJRA 3IFRA 3J7YP 4JS4A 3AVMA 2QWLA 4KB1A 4IJNA 3BF3A 3ZSWA 2F9TA 2Q0UA 1ATRA 1IG8A 3O5BA 5KGXA 5JMVA 3AY9A 3KK7A 4WQ4A 1BIUA 4J2EA 3TTDA 3VOVA 2PZSA 5J2PA 4C8LA 5K14A 3NH2A 3QFUA 4N47A 2W6KA 3OYJA 3THYA 2WOMA 1Q81O 4YOVA 1S1UA 4O5FA 4BR2A 4KB0A 2QI2A 4E3SA 2OTLN 3VEWA 4CEEA 2W40A 3S41A 2YNHA 3NCIA 4ILGB 4A5AA 2Z1GA 3DXMA 4CEAA 4MDAA 5KI6A 5AQYA 5LL6Z 4JHDB 1VQLN 1S3XA 5FPMA 2I5JA 2P9NB 3B6PA 4JI8K 3BGRA 4DV3K 3ZT1A 1U4BA 1KLNA 1JLCA 4CBXA 3R6MA 4K8XA 1BQMA 5J2MA 4DTUA 1KVCA 3VQ8A 2ZGZA 1BA0A 4W5OA 1QVFM 1QSSA 3DXKA 1NK8A 4PHTX 3IKMA 5AQUA 1KD1O 2NRRA 2E8AA 2OPPA 4BRIA 1RT3A 2EHGA 3M8RA 4CF9A 1N8RO 5ELZA 3SPZA 4DU4A 2NRVA 4WQ4C 1YVNA 3PIOL 2QK9A 4HTUA 1I39A 3C6AA 3HBTA 4FWQA 1HNXK 5FRMA 3G25A 1WN7A 5FRNA 4M7XA 1MWKA 4YORA 3NH1A 3IMXA 4LSLA 3SYZA 1SL0A 4PWDA 2KZZA 4OGCA 3OY9A 1Q8IA 1C0UA 3ZSVA 2G8HA 5SZTA 1HPMA 3ZSXA 2KW4A 3SLCA 4X66K 4KTQA 2F7TA 3I8DA 3LWLA 4DFMA 2V7ZA 3O9TA 3L4IA 1TKTA 1OKJA 4CK2A 4IO9L 4BRFA 2KFNA 1S5JA 3VQCA 3SPYA 4FLWA 2HNYA 1H1VA 4E1NA 2OPSA 4ZTFA 2AJQA 1OH6A 4ZHRA 2QWQA 3Q7CA 4H5TA 4KHYA 2HW3A 4FWNA 4A2BA 1V4SA 2QXLA 2P9KB 4FPBA 4ISEA 4UQGA 3QFPA 4CJWA 3T69A 4DTMA 2P9NA 4I6MB 1VSEA 1RNHA 3LDSA 5C24A 4JD2B 1REVA 1QHAA 2H3GX 1LOTB 3R3LA 1XC9A 3MXIA 4CBWA 3PX4A 3EN9A 4CK1A 3VEZA 3NGYA 2NRZA 3ZT2A 3I8BA 3AO5A 2Z1IA 2HBMA 3NF8A 4FWSA 4B9LA 1YF5L 3A0IX 5BRFA 4Q0BA 3ENBA 1WLJA 5T7BA 3G6EN 1KLMA 1JXBA 2FSNA 1BDGA 1LW0A 2O8FB 3CCUN 2QA4N 4CHOA 4GV9A 4EHTA 3TAQA 3VEYA 3D2FB 2BUPA 4CGDA 3BDPA 4OLBA 3CJ7A 4IKFA 4H8KA 1TL3A 5CR4A 1Z6RA 3H1VX 2QTDA 3OBWA 3FZHA 3KIOA 1D4XA 2V52B 2IGIA 2GTDA 1NJZA 1D5AA 5KPRA 1IKWA 4KFBA 4IOXA 3CQYA 3ZX2A 3OA9A 4PKGA 4CEBA 4RW6A 3RMBA 2E2NA 2VQFK 3THWA 5EVZA 3MEGA 3UKUA 2ETJA 3ITHA 4BRMA 2V7YA 5KRTA 3VA0A 3RSEA 2A41A 2A1SA 3CCLN 3ISNC 1EXQA 3TANA 1RGIA 4W5QA 1NKBA 1SUQA 3WNGA 1YIJN 2P9KA 1N6QA 1NWKA 2JLEA 3C65A 4DWIA 3O3GA 3ULEA 4I2PA 3SZ2A 3DI6A 4BRCA 1K9MO 3NGIA 1ESVA 3AVBA
chains in the Genus database with same CATH topology
3KLFA 4DLGA 3K58A 4CFCA 1RDBA 2Z1JA 4IFYA 3MAQA 3DRRA 1S1TA 4BDZA 1X1PA 3ZSZA 4ELTA 2GBZA 4FJHA 4FLXA 3DYAA 3LZIA 3CM5A 1RTIA 3ALYA 3WNFA 1HNIA 2DTUA 1LWFA 4JS5A 1JLBA 1WNSA 3AA3A 1IO2A 3DOLA 1LWEA 4HVJA 4DSIA 1JLQA 2ZQBA 1ZBUA 3ZCMA 3LPUA 4EZ6A 2BE2A 1WAFA 1UOCA 2HVIA 2VG7A 3I0RA 3VQ7A 1L3SA 3HL8A 4CJTA 3RRHA 3TAEA 3PO4A 4C8KA 1NOZA 2ZE2A 3T19A 3SQ1A 4PY5A 1TAQA 2O4IA 2OZMA 1UWBA 2FBXA 5HROA 4I9QA 3K59A 4FCYA 4NCBA 1FKOA 2IC3A 3K2PA 4FJJA 3S3MA 1ASUA 4H4MA 3HP6A 1SL2A 4E7KA 4F2RA 1RILA 2HVHA 3JSMA 4KREA 4CHQA 1BQNA 3AVHA 3SUNA 2XY8A 1JL2A 3AO4A 4Z4CA 1RT4A 1RBTA 3HXMA 1EETA 4NYNA 4Z0UA 1JLFA 4HUGA 2DFEA 3RMDA 1T05A 3DLKA 4CJ3A 3OVNA 3OS1A 1BISA 3E01A 3SUOA 3LP2A 1LAWA 4MFBA 4CJKA 1S9GA 3HVRA 4DSFA 4O55A 4C8NA 4WE1A 4IG0A 2W42A 4B9SA 1YTAA 4CF2A 4F2SA 3KTQA 4CFAA 2HMIA 4GW6A 4BDYA 4CFDA 3OYMA 2HB5A 1U04A 4OJRA 3CG7A 1X9MA 2BGGA 4OKJA 4PQUA 4F3OA 4CGHA 3AVKA 3RTVA 3TAFA 1GOCA 1BIZA 4LSNA 1X9WA 4IG3A 3ZSYA 3VQ6A 4CJRA 1RT1A 3L2QA 3V9SA 1ZBFA 1XHXA 4Y1CA 1QSYA 3HJFA 2IOCA 2KFZA 4KKOA 4HUEA 4DQQA 3O4NA 4B9NA 2FBVA 1UA0A 2QKBA 4OKKA 3V9WA 2RN2A 4IDKA 3HT3A 4CCHA 3VQDA 5EU7A 1U45A 1CXUA 1T8EA 2OYQA 3S9HA 1TAUA 4E0DA 2OPRA 2G8KA 3B6OA 1D9DA 2VWJA 1CXQA 4HCBA 1TV6A 1L3TA 4GMJB 3NHGA 4FJLA 1S6PA 4ELUA 4DSLA 1HQEA 1XWLA 4AILC 1DTTA 2B5JA 4CF1A 4FYDA 5D3GA 2YNGA 4DG1A 4KTZA 4FM1A 4CGJA 1JLEA 4E7IA 3QEXA 2G8FA 3PUFA 1BCOA 1J9AA 4QAGA 4CEOA 1O1WA 4CGFA 4CK3A 2YKMA 3KLEA 1Q9YA 4CEZA 1JLGA 3KLHA 1X9SA 4FM0A 4CHNA 1U48A 3CQ8A 1VSDA 3QEVA 3LP1A 5C42A 1VK0A 3DLGA 1ASVA 2XHBA 4OPJA 4JRPA 3K5LA 1W9HA 3TARA 4F4KA 2F8TA 3HK2A 1TL1A 2P5GA 1RTJA 3L2UA 2G8UA 4DQIA 1C0MA 3OYIA 3PV8A 2HHQA 1TK0A 3KD5E 3TAPA 1LV5A 2PYJA 1A5WA 1RT2A 4BWMA 3VQAA 4BE2A 1WSFA 3L8BA 5CYMA 3OYHA 2F96A 1GOAA 4CIGA 5JS2A 3U6FA 1QQCA 3WNHA 4YFUA 2LSNA 1VSMA 2YKNA 1NJXA 4CEFA 3IS9A 4FLZA 1LW2A 3AO1A 2Y1IA 4FJXA 1UA1A 1TKDA 2A1RA 2KTQA 2ITGA 4FW1A 3VQ4A 5HRPA 4DS4A 2Y1JA 3SQ2A 1KFSA 3AVNA 4CESA 3V9UA 1NJYA 4W5NA 3LPTA 1NK9A 1RT6A 4B08A 3CFRA 1IG9A 1TK8A 1FK9A 1BCMA 3EYZA 1NOYA 3U3YA 2HHXA 3P1GA 1KRPA 1NK7A 2P5OA 3TR8A 2VG6A 4I9LA 4CF0A 4FJ7A 1NK6A 3KK1A 3OYFA 3D45A 3V9XA 1YVUA 2D0AA 2WONA 3MEDA 4AHTA 1JL1A 4FJ8A 3OYLA 5J1EA 4DF4A 2YNIA 4CFBA 4ICLA 3KKSA 3IAYA 4KAZA 1QS4A 4DTOA 4HCCA 1JLAA 1N5YA 3K5MA 4KHNA 1VRTA 2RPIA 1HNVA 3ZT0A 5HRNA 4FZZA 2DFHA 2QXFA 3AVAA 4RG8A 3QNOA 4FJMA 5KTQA 3VQQA 2P51A 1HQUA 4CJSA 1VSLA 4FW2A 2E4LA 3AV9A 1DTQA 2X6SA 3KKRA 3MEEA 1VSJA 3O3FA 2GV9A 3AA2A 1TK5A 2B6AA 2KZMA 4CJFA 3KK2A 3K5NA 3QIPA 4FVMA 2HHSA 3QEIA 3HYFA 2O4GA 3CFOA 4DQPA 5CYQA 4ID1A 3O3HA 4QCLA 1RDAA 3LAKA 5FDLA 1HJRA 2YV0X 1HYZA 3LAMA 4M45A 4JS4A 4CHZA 4F3TA 3AVMA 2ZD1A 1L3UA 1IKVA 4DTXA 4KB1A 4NCAA 3ZSWA 3OS2A 4ELVA 2HHUA 1HYVA 1RBVA 1ASWA 1SV5A 1TKZA 4AHCA 3OYEA 3QEPA 1XI1A 1ZBIA 5KGXA 1J54A 4Q5VA 1NJWA 1BIUA 2ATQA 4J2EA 1HYSA 4DQRA 4IFVA 1FKPA 4R5PA 2XY6A 2BANA 2PZSA 3NAEA 2RF2A 5J2PA 4C8LA 5K14A 2P1JA 3NH2A 4KRFA 4N47A 4Z4EA 3OYJA 4N76A 2WOMA 3VQ5A 4H4OA 1Z26A 4DLEA 1HRHA 1F21A 4NCGA 1S1UA 3AVGA 3KLGA 4KB0A 4E19A 1CZBA 4E3SA 4O44A 4CEEA 2HHWA 3AO2A 5CZ2A 3QNNA 4I2QA 3U3GA 4CGGA 4G1QA 4TSXA 1J53A 2YNHA 5E41A 3NCIA 1SKWA 4FLUA 2Z1GA 3MECA 1W0HA 3DRSA 3O4QA 1HMVA 4M41A 5KI6A 4CEAA 1S1VA 4CJQA 3V1OA 4FLVA 3VN5A 4KHQA 1LWCA 3AVCA 2I5JA 1KFDA 3LP0A 1T7PA 5JS1A 1C0TA 1QHTA 3B6PA 1BGXT 3LANA 4B9TA 1R0AA 1KTQA 2YNFA 2XRIA 3CYMA 3SI6A 4DSJA 3BGRA 1NK0A 1WAJA 3TWHA 3ZT1A 1QE1A 4Z4HA 1U4BA 4FJ9A 1KLNA 1JLCA 3AVJA 4K8XA 1BQMA 4DFJA 3MXMA 2QKKA 5HRSA 4Y1DA 3AA4A 5J2MA 1RBRA 1KVCA 4DTUA 1L5UA 3ASMA 3VQ8A 4N5SA 3DLBA 3DRPA 1IKXA 1BL3A 3V9ZA 3RWUA 4W5OA 4HUFA 4KPYA 2FBTA 1S9EA 3DLEA 1QSSA 1T03A 4C8OA 1NK8A 4FXDA 1SKRA 2OPQA 2XY5A 3EY1A 2OPPA 3CFPA 3V1RA 1SL1A 1RT3A 2EHGA 1Z25A 4CF9A 2B4JA 2EX3A 3M8RA 4FLTA 3A2FA 3SPZA 4DU4A 3SUQA 4CJ5A 4FK4A 4AHRA 3AVIA 3SCXA 4FJNA 4JLHA 4DF8A 3ULDA 4BACA 3S3OA 2QK9A 1VSIA 1NKEA 4J2BA 4W5RA 1KCFA 3IRXA 4HTUA 4CJUA 1I39A 3P5JA 4AHVA 1ITGA 3THVA 4DTJA 3V1QA 5FRMA 3DLRA 2G8IA 3G0ZA 4YNQA 1G15A 3SNNA 1C1AA 4NYFA 3T1AA 4E7LA 1ZYQA 1FXXA 1WN7A 5HLFA 3ZT3A 2G8VA 5FRNA 3OYAA 1VSHA 5HP1A 3NH1A 1LAVA 1NK5A 3RR7A 2VG5A 4LSLA 2HNDA 4RW8A 4N41A 5KRSA 3SYZA 4DU3A 1SL0A 4PWDA 4K8ZA 1BHLA 4OGCA 4E89A 4OPKA 3OY9A 4E7HA 2KZZA 1WSEA 3C6TA 4B8CA 3SJJA 4PUOA 3L2WA 1RCHA 4DTRA 1Q8IA 1C0UA 1EX4A 3QIOA 3ZSVA 2G8HA 3AO3A 5SZTA 2GUIA 3C95A 4LH4A 3TAMA 4DQSA 2E6MA 3ZSXA 1EP4A 2KW4A 4B8AB 3S3NA 3VQEA 4M3WA 4KTQA 4LD0A 3MXJA 3V4IA 1MU2A 2RKIA 3ZSOA 1B9DA 3LP3A 3I8DA 3LWLA 3M8QA 1HPZA 4BE0A 4DFMA 3L2RA 4B9VA 4RW9A 3OYBA 3HSTB 4DFKA 4HHTA 1TKXA 1TKTA 3OYDA 2X78A 4E1MA 4CK2A 3ZSQA 4FJIA 4KHWA 1RBSA 4O4GA 1K6YA 2BDPA 2KFNA 1S5JA 1RT7A 4GVMA 3VQCA 4KTWA 3CM6A 4FLWA 3HVTA 3L3VA 3OYCA 2YHAA 3RMCA 3SPYA 2HNYA 4E1NA 4OKEA 1RDCA 3ZSRA 2OPSA 1S6QA 4ZTFA 3JYTA 4DSKA 2AJQA 1B92A 3QEWA 1RT5A 4FJGA 3K5OA 1I3AA 3OJSA 3TAGA 4ZHRA 3NGZA 4DFPA 4LY7A 4M3XA 5FROA 4KHYA 3H08A 2HW3A 4M3RA 1D8YA 2F8SA 1JXEA 4B3OA 3NF6A 3OYNA 4DMNA 4CF8A 3QETA 4AHSA 1WSGA 4CHPA 3OYGA 4CJPA 5CZ1A 4DS5A 4UQGA 4CJWA 4M3ZA 4DTMA 1QSLA 3KD1E 1ZBHA 5SWMA 3KK3A 1VSEA 4KO0A 3V81A 3PY8A 4CGIA 4J2AA 1RNHA 3LDSA 4AHUA 5C24A 3NDKA 4E7JA 3TABA 1BI4B 3DMJA 4OGEA 5J2QA 1REVA 4KI4A 1GOBA 1VSKA 3NBPA 4FK0A 3HP9A 2JGUA 4CJVA 1C1BA 4OLAA 1ZBLA 1XC9A 1KVAA 1VRUA 1KVBA 3PX4A 4DTPA 3PX0A 3MXIA 2XY7A 4CK1A 3VA3A 3NGYA 2NUBA 2PYLA 2HHTA 3ZT2A 3KLIA 4XIUA 3AO5A 1XHZA 3FFIA 4LH5A 1S1WA 2DFFA 2Z1HA 3C94A 3ZT4A 4CJLA 2Z1IA 3RRGA 3NF8A 4B9LA 4ID5A 4B9MA 2G8WA 4DU1A 1A5VA 2HNZA 4Q0BA 1WLJA 1U47A 2PY5A 4DTNA 4KV8A 4PA1A 3M8SA 1YT3A 1EKEA 1QTMA 1C6VA 5T7BA 2D5RA 1KLMA 4FM2A 1JXBA 4EP5A 1L3VA 4QOZB 3LZJA 1LW0A 4FZYA 4AH9A 4N56A 2YHBA 3RMAA 1DLOA 4C8MA 4CHOA 4BDPA 3T3FA 5HBMA 4CHYA 3SUPA 3EZ5A 3QLHA 3TAQA 5I3UA 3HM9A 3HO1A 3SV4A 2X74A 5KGWA 4CGDA 3BDPA 2DY4A 3UIQA 1RDDA 3NF9A 1Y97A 3SV3A 4OLBA 3IG1A 4CECA 4IKFA 3QO9A 4M42A 4H8KA 3NH0A 3OJUA 1Q9XA 2OZSA 4FJKA 1D9FA 4MQ3A 4RW7A 3VQBA 4F8RA 1TL3A 4ZTJA 4EP4A 3AVLA 3NF7A 2IDOA 4CEQA 3KIOA 4O0IA 4BWJA 3VQPA 4CEDA 3F73A 1B9FA 2R7YA 3AA5X 2OA8A 2D0BA 2IGIA 3M8PA 4L8RB 4BE1A 4W5TA 1NJZA 1D5AA 1IKWA 4JRQA 4KFBA 4CERA 3V6DA 1IH7A 3I0SA 4Z4GA 3AVFA 3L3UA 3SQ0A 4CEBA 1J5OA 1CLQA 3HPOA 4RW6A 3RMBA 1NK4A 1WSJA 2X6NA 1U49A 2HHVA 3MEGA 4O5BA 2ETJA 3VQ9A 3OS0A 3ITHA 3NFAA 1TVRA 1WSIA 1S1XA 4O0JA 4DTSA 3DM2A 3PO5A 5KRTA 1RBUA 1YTUA 4KHSA 3LWMA 3VA0A 3HPHA 3P83D 5DMRA 1C1CA 5C25A 2VWKA 3QINA 4B9UA 3DOKA 3RR8A 4OVLA 4CJ4A 3NE6A 4EZ9A 4FJ5A 1VSFA 4CIFA 3SQ4A 3LALA 2A1SA 1CZ9A 3D0PA 3QESA 4J2DA 2Q3SA 3ISNC 5J2NA 2KQ2A 4KI6A 4FK2A 1EXQA 4IBNA 2E6LA 5DK5A 3WNEA 1KSPA 1JKHA 4I7FA 3TANA 2D0CA 4W5QA 3G10A 4FLYA 1WSHA 1NKBA 1SUQA 3WNGA 3PX6A 4Z4FA 5CY4A 4DSEA 1N6QA 1TGOA 4FZXC 2IAJA 2JLEA 3C6UA 3TI0A 4CIEA 4DWIA 4M3YA 1SKSA 2XO7A 1RTDA 4RW4A 4KHUA 3O3GA 2FC0A 2FBYA 1UAXA 5I42A 4M3TA 4I2PA 4Z4IA 4CE9A 1BI4A 3OYKA 2IS3A 3L2VA 3SZ2A 3QERA 3DI6A 3KJVA 1NKCA 3DLHA 1A5XA 5HRRA 3F9KA 1RTHA 4CJEA 3NGIA 3K57A 4M3UA 1IKYA 3HPGA 3AVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLF A;  4DLG A;  3K58 A;  4CFC A;  1RDB A;  2Z1J A;  4IFY A;  3MAQ A;  3DRR A;  1S1T A;  4BDZ A;  1X1P A;  3ZSZ A;  4ELT A;  2GBZ A;  4FJH A;  4FLX A;  3DYA A;  3LZI A;  3CM5 A;  1RTI A;  3ALY A;  3WNF A;  1HNI A;  2DTU A;  1LWF A;  4JS5 A;  1JLB A;  1WNS A;  3AA3 A;  1IO2 A;  3DOL A;  1LWE A;  4HVJ A;  4DSI A;  1JLQ A;  2ZQB A;  1ZBU A;  3ZCM A;  3LPU A;  4EZ6 A;  2BE2 A;  1WAF A;  1UOC A;  2HVI A;  2VG7 A;  3I0R A;  3VQ7 A;  1L3S A;  3HL8 A;  4CJT A;  3RRH A;  3TAE A;  3PO4 A;  4C8K A;  1NOZ A;  2ZE2 A;  3T19 A;  3SQ1 A;  4PY5 A;  1TAQ A;  2O4I A;  2OZM A;  1UWB A;  2FBX A;  5HRO A;  4I9Q A;  3K59 A;  4FCY A;  4NCB A;  1FKO A;  2IC3 A;  3K2P A;  4FJJ A;  3S3M A;  1ASU A;  4H4M A;  3HP6 A;  1SL2 A;  4E7K A;  4F2R A;  1RIL A;  2HVH A;  3JSM A;  4KRE A;  4CHQ A;  1BQN A;  3AVH A;  3SUN A;  2XY8 A;  1JL2 A;  3AO4 A;  4Z4C A;  1RT4 A;  1RBT A;  3HXM A;  1EET A;  4NYN A;  4Z0U A;  1JLF A;  4HUG A;  2DFE A;  3RMD A;  1T05 A;  3DLK A;  4CJ3 A;  3OVN A;  3OS1 A;  1BIS A;  3E01 A;  3SUO A;  3LP2 A;  1LAW A;  4MFB A;  4CJK A;  1S9G A;  3HVR A;  4DSF A;  4O55 A;  4C8N A;  4WE1 A;  4IG0 A;  2W42 A;  4B9S A;  1YTA A;  4CF2 A;  4F2S A;  3KTQ A;  4CFA A;  2HMI A;  4GW6 A;  4BDY A;  4CFD A;  3OYM A;  2HB5 A;  1U04 A;  4OJR A;  3CG7 A;  1X9M A;  2BGG A;  4OKJ A;  4PQU A;  4F3O A;  4CGH A;  3AVK A;  3RTV A;  3TAF A;  1GOC A;  1BIZ A;  4LSN A;  1X9W A;  4IG3 A;  3ZSY A;  3VQ6 A;  4CJR A;  1RT1 A;  3L2Q A;  3V9S A;  1ZBF A;  1XHX A;  4Y1C A;  1QSY A;  3HJF A;  2IOC A;  2KFZ A;  4KKO A;  4HUE A;  4DQQ A;  3O4N A;  4B9N A;  2FBV A;  1UA0 A;  2QKB A;  4OKK A;  3V9W A;  2RN2 A;  4IDK A;  3HT3 A;  4CCH A;  3VQD A;  5EU7 A;  1U45 A;  1CXU A;  1T8E A;  2OYQ A;  3S9H A;  1TAU A;  4E0D A;  2OPR A;  2G8K A;  3B6O A;  1D9D A;  2VWJ A;  1CXQ A;  4HCB A;  1TV6 A;  1L3T A;  4GMJ B;  3NHG A;  4FJL A;  1S6P A;  4ELU A;  4DSL A;  1HQE A;  1XWL A;  4AIL C;  1DTT A;  2B5J A;  4CF1 A;  4FYD A;  5D3G A;  2YNG A;  4DG1 A;  4KTZ A;  4FM1 A;  4CGJ A;  1JLE A;  4E7I A;  3QEX A;  2G8F A;  3PUF A;  1BCO A;  1J9A A;  4QAG A;  4CEO A;  1O1W A;  4CGF A;  4CK3 A;  2YKM A;  3KLE A;  1Q9Y A;  4CEZ A;  1JLG A;  3KLH A;  1X9S A;  4FM0 A;  4CHN A;  1U48 A;  3CQ8 A;  1VSD A;  3QEV A;  3LP1 A;  5C42 A;  1VK0 A;  3DLG A;  1ASV A;  2XHB A;  4OPJ A;  4JRP A;  3K5L A;  1W9H A;  3TAR A;  4F4K A;  2F8T A;  3HK2 A;  1TL1 A;  2P5G A;  1RTJ A;  3L2U A;  2G8U A;  4DQI A;  1C0M A;  3OYI A;  3PV8 A;  2HHQ A;  1TK0 A;  3KD5 E;  3TAP A;  1LV5 A;  2PYJ A;  1A5W A;  1RT2 A;  4BWM A;  3VQA A;  4BE2 A;  1WSF A;  3L8B A;  5CYM A;  3OYH A;  2F96 A;  1GOA A;  4CIG A;  5JS2 A;  3U6F A;  1QQC A;  3WNH A;  4YFU A;  2LSN A;  1VSM A;  2YKN A;  1NJX A;  4CEF A;  3IS9 A;  4FLZ A;  1LW2 A;  3AO1 A;  2Y1I A;  4FJX A;  1UA1 A;  1TKD A;  2A1R A;  2KTQ A;  2ITG A;  4FW1 A;  3VQ4 A;  5HRP A;  4DS4 A;  2Y1J A;  3SQ2 A;  1KFS A;  3AVN A;  4CES A;  3V9U A;  1NJY A;  4W5N A;  3LPT A;  1NK9 A;  1RT6 A;  4B08 A;  3CFR A;  1IG9 A;  1TK8 A;  1FK9 A;  1BCM A;  3EYZ A;  1NOY A;  3U3Y A;  2HHX A;  3P1G A;  1KRP A;  1NK7 A;  2P5O A;  3TR8 A;  2VG6 A;  4I9L A;  4CF0 A;  4FJ7 A;  1NK6 A;  3KK1 A;  3OYF A;  3D45 A;  3V9X A;  1YVU A;  2D0A A;  2WON A;  3MED A;  4AHT A;  1JL1 A;  4FJ8 A;  3OYL A;  5J1E A;  4DF4 A;  2YNI A;  4CFB A;  4ICL A;  3KKS A;  3IAY A;  4KAZ A;  1QS4 A;  4DTO A;  4HCC A;  1JLA A;  1N5Y A;  3K5M A;  4KHN A;  1VRT A;  2RPI A;  1HNV A;  3ZT0 A;  5HRN A;  4FZZ A;  2DFH A;  2QXF A;  3AVA A;  4RG8 A;  3QNO A;  4FJM A;  5KTQ A;  3VQQ A;  2P51 A;  1HQU A;  4CJS A;  1VSL A;  4FW2 A;  2E4L A;  3AV9 A;  1DTQ A;  2X6S A;  3KKR A;  3MEE A;  1VSJ A;  3O3F A;  2GV9 A;  3AA2 A;  1TK5 A;  2B6A A;  2KZM A;  4CJF A;  3KK2 A;  3K5N A;  3QIP A;  4FVM A;  2HHS A;  3QEI A;  3HYF A;  2O4G A;  3CFO A;  4DQP A;  5CYQ A;  4ID1 A;  3O3H A;  4QCL A;  1RDA A;  3LAK A;  5FDL A;  1HJR A;  2YV0 X;  1HYZ A;  3LAM A;  4M45 A;  4JS4 A;  4CHZ A;  4F3T A;  3AVM A;  2ZD1 A;  1L3U A;  1IKV A;  4DTX A;  4KB1 A;  4NCA A;  3ZSW A;  3OS2 A;  4ELV A;  2HHU A;  1HYV A;  1RBV A;  1ASW A;  1SV5 A;  1TKZ A;  4AHC A;  3OYE A;  3QEP A;  1XI1 A;  1ZBI A;  5KGX A;  1J54 A;  4Q5V A;  1NJW A;  1BIU A;  2ATQ A;  4J2E A;  1HYS A;  4DQR A;  4IFV A;  1FKP A;  4R5P A;  2XY6 A;  2BAN A;  2PZS A;  3NAE A;  2RF2 A;  5J2P A;  4C8L A;  5K14 A;  2P1J A;  3NH2 A;  4KRF A;  4N47 A;  4Z4E A;  3OYJ A;  4N76 A;  2WOM A;  3VQ5 A;  4H4O A;  1Z26 A;  4DLE A;  1HRH A;  1F21 A;  4NCG A;  1S1U A;  3AVG A;  3KLG A;  4KB0 A;  4E19 A;  1CZB A;  4E3S A;  4O44 A;  4CEE A;  2HHW A;  3AO2 A;  5CZ2 A;  3QNN A;  4I2Q A;  3U3G A;  4CGG A;  4G1Q A;  4TSX A;  1J53 A;  2YNH A;  5E41 A;  3NCI A;  1SKW A;  4FLU A;  2Z1G A;  3MEC A;  1W0H A;  3DRS A;  3O4Q A;  1HMV A;  4M41 A;  5KI6 A;  4CEA A;  1S1V A;  4CJQ A;  3V1O A;  4FLV A;  3VN5 A;  4KHQ A;  1LWC A;  3AVC A;  2I5J A;  1KFD A;  3LP0 A;  1T7P A;  5JS1 A;  1C0T A;  1QHT A;  3B6P A;  1BGX T;  3LAN A;  4B9T A;  1R0A A;  1KTQ A;  2YNF A;  2XRI A;  3CYM A;  3SI6 A;  4DSJ A;  3BGR A;  1NK0 A;  1WAJ A;  3TWH A;  3ZT1 A;  1QE1 A;  4Z4H A;  1U4B A;  4FJ9 A;  1KLN A;  1JLC A;  3AVJ A;  4K8X A;  1BQM A;  4DFJ A;  3MXM A;  2QKK A;  5HRS A;  4Y1D A;  3AA4 A;  5J2M A;  1RBR A;  1KVC A;  4DTU A;  1L5U A;  3ASM A;  3VQ8 A;  4N5S A;  3DLB A;  3DRP A;  1IKX A;  1BL3 A;  3V9Z A;  3RWU A;  4W5O A;  4HUF A;  4KPY A;  2FBT A;  1S9E A;  3DLE A;  1QSS A;  1T03 A;  4C8O A;  1NK8 A;  4FXD A;  1SKR A;  2OPQ A;  2XY5 A;  3EY1 A;  2OPP A;  3CFP A;  3V1R A;  1SL1 A;  1RT3 A;  2EHG A;  1Z25 A;  4CF9 A;  2B4J A;  2EX3 A;  3M8R A;  4FLT A;  3A2F A;  3SPZ A;  4DU4 A;  3SUQ A;  4CJ5 A;  4FK4 A;  4AHR A;  3AVI A;  3SCX A;  4FJN A;  4JLH A;  4DF8 A;  3ULD A;  4BAC A;  3S3O A;  2QK9 A;  1VSI A;  1NKE A;  4J2B A;  4W5R A;  1KCF A;  3IRX A;  4HTU A;  4CJU A;  1I39 A;  3P5J A;  4AHV A;  1ITG A;  3THV A;  4DTJ A;  3V1Q A;  5FRM A;  3DLR A;  2G8I A;  3G0Z A;  4YNQ A;  1G15 A;  3SNN A;  1C1A A;  4NYF A;  3T1A A;  4E7L A;  1ZYQ A;  1FXX A;  1WN7 A;  5HLF A;  3ZT3 A;  2G8V A;  5FRN A;  3OYA A;  1VSH A;  5HP1 A;  3NH1 A;  1LAV A;  1NK5 A;  3RR7 A;  2VG5 A;  4LSL A;  2HND A;  4RW8 A;  4N41 A;  5KRS A;  3SYZ A;  4DU3 A;  1SL0 A;  4PWD A;  4K8Z A;  1BHL A;  4OGC A;  4E89 A;  4OPK A;  3OY9 A;  4E7H A;  2KZZ A;  1WSE A;  3C6T A;  4B8C A;  3SJJ A;  4PUO A;  3L2W A;  1RCH A;  4DTR A;  1Q8I A;  1C0U A;  1EX4 A;  3QIO A;  3ZSV A;  2G8H A;  3AO3 A;  5SZT A;  2GUI A;  3C95 A;  4LH4 A;  3TAM A;  4DQS A;  2E6M A;  3ZSX A;  1EP4 A;  2KW4 A;  4B8A B;  3S3N A;  3VQE A;  4M3W A;  4KTQ A;  4LD0 A;  3MXJ A;  3V4I A;  1MU2 A;  2RKI A;  3ZSO A;  1B9D A;  3LP3 A;  3I8D A;  3LWL A;  3M8Q A;  1HPZ A;  4BE0 A;  4DFM A;  3L2R A;  4B9V A;  4RW9 A;  3OYB A;  3HST B;  4DFK A;  4HHT A;  1TKX A;  1TKT A;  3OYD A;  2X78 A;  4E1M A;  4CK2 A;  3ZSQ A;  4FJI A;  4KHW A;  1RBS A;  4O4G A;  1K6Y A;  2BDP A;  2KFN A;  1S5J A;  1RT7 A;  4GVM A;  3VQC A;  4KTW A;  3CM6 A;  4FLW A;  3HVT A;  3L3V A;  3OYC A;  2YHA A;  3RMC A;  3SPY A;  2HNY A;  4E1N A;  4OKE A;  1RDC A;  3ZSR A;  2OPS A;  1S6Q A;  4ZTF A;  3JYT A;  4DSK A;  2AJQ A;  1B92 A;  3QEW A;  1RT5 A;  4FJG A;  3K5O A;  1I3A A;  3OJS A;  3TAG A;  4ZHR A;  3NGZ A;  4DFP A;  4LY7 A;  4M3X A;  5FRO A;  4KHY A;  3H08 A;  2HW3 A;  4M3R A;  1D8Y A;  2F8S A;  1JXE A;  4B3O A;  3NF6 A;  3OYN A;  4DMN A;  4CF8 A;  3QET A;  4AHS A;  1WSG A;  4CHP A;  3OYG A;  4CJP A;  5CZ1 A;  4DS5 A;  4UQG A;  4CJW A;  4M3Z A;  4DTM A;  1QSL A;  3KD1 E;  1ZBH A;  5SWM A;  3KK3 A;  1VSE A;  4KO0 A;  3V81 A;  3PY8 A;  4CGI A;  4J2A A;  1RNH A;  3LDS A;  4AHU A;  5C24 A;  3NDK A;  4E7J A;  3TAB A;  1BI4 B;  3DMJ A;  4OGE A;  5J2Q A;  1REV A;  4KI4 A;  1GOB A;  1VSK A;  3NBP A;  4FK0 A;  3HP9 A;  2JGU A;  4CJV A;  1C1B A;  4OLA A;  1ZBL A;  1XC9 A;  1KVA A;  1VRU A;  1KVB A;  3PX4 A;  4DTP A;  3PX0 A;  3MXI A;  2XY7 A;  4CK1 A;  3VA3 A;  3NGY A;  2NUB A;  2PYL A;  2HHT A;  3ZT2 A;  3KLI A;  4XIU A;  3AO5 A;  1XHZ A;  3FFI A;  4LH5 A;  1S1W A;  2DFF A;  2Z1H A;  3C94 A;  3ZT4 A;  4CJL A;  2Z1I A;  3RRG A;  3NF8 A;  4B9L A;  4ID5 A;  4B9M A;  2G8W A;  4DU1 A;  1A5V A;  2HNZ A;  4Q0B A;  1WLJ A;  1U47 A;  2PY5 A;  4DTN A;  4KV8 A;  4PA1 A;  3M8S A;  1YT3 A;  1EKE A;  1QTM A;  1C6V A;  5T7B A;  2D5R A;  1KLM A;  4FM2 A;  1JXB A;  4EP5 A;  1L3V A;  4QOZ B;  3LZJ A;  1LW0 A;  4FZY A;  4AH9 A;  4N56 A;  2YHB A;  3RMA A;  1DLO A;  4C8M A;  4CHO A;  4BDP A;  3T3F A;  5HBM A;  4CHY A;  3SUP A;  3EZ5 A;  3QLH A;  3TAQ A;  5I3U A;  3HM9 A;  3HO1 A;  3SV4 A;  2X74 A;  5KGW A;  4CGD A;  3BDP A;  2DY4 A;  3UIQ A;  1RDD A;  3NF9 A;  1Y97 A;  3SV3 A;  4OLB A;  3IG1 A;  4CEC A;  4IKF A;  3QO9 A;  4M42 A;  4H8K A;  3NH0 A;  3OJU A;  1Q9X A;  2OZS A;  4FJK A;  1D9F A;  4MQ3 A;  4RW7 A;  3VQB A;  4F8R A;  1TL3 A;  4ZTJ A;  4EP4 A;  3AVL A;  3NF7 A;  2IDO A;  4CEQ A;  3KIO A;  4O0I A;  4BWJ A;  3VQP A;  4CED A;  3F73 A;  1B9F A;  2R7Y A;  3AA5 X;  2OA8 A;  2D0B A;  2IGI A;  3M8P A;  4L8R B;  4BE1 A;  4W5T A;  1NJZ A;  1D5A A;  1IKW A;  4JRQ A;  4KFB A;  4CER A;  3V6D A;  1IH7 A;  3I0S A;  4Z4G A;  3AVF A;  3L3U A;  3SQ0 A;  4CEB A;  1J5O A;  1CLQ A;  3HPO A;  4RW6 A;  3RMB A;  1NK4 A;  1WSJ A;  2X6N A;  1U49 A;  2HHV A;  3MEG A;  4O5B A;  2ETJ A;  3VQ9 A;  3OS0 A;  3ITH A;  3NFA A;  1TVR A;  1WSI A;  1S1X A;  4O0J A;  4DTS A;  3DM2 A;  3PO5 A;  5KRT A;  1RBU A;  1YTU A;  4KHS A;  3LWM A;  3VA0 A;  3HPH A;  3P83 D;  5DMR A;  1C1C A;  5C25 A;  2VWK A;  3QIN A;  4B9U A;  3DOK A;  3RR8 A;  4OVL A;  4CJ4 A;  3NE6 A;  4EZ9 A;  4FJ5 A;  1VSF A;  4CIF A;  3SQ4 A;  3LAL A;  2A1S A;  1CZ9 A;  3D0P A;  3QES A;  4J2D A;  2Q3S A;  3ISN C;  5J2N A;  2KQ2 A;  4KI6 A;  4FK2 A;  1EXQ A;  4IBN A;  2E6L A;  5DK5 A;  3WNE A;  1KSP A;  1JKH A;  4I7F A;  3TAN A;  2D0C A;  4W5Q A;  3G10 A;  4FLY A;  1WSH A;  1NKB A;  1SUQ A;  3WNG A;  3PX6 A;  4Z4F A;  5CY4 A;  4DSE A;  1N6Q A;  1TGO A;  4FZX C;  2IAJ A;  2JLE A;  3C6U A;  3TI0 A;  4CIE A;  4DWI A;  4M3Y A;  1SKS A;  2XO7 A;  1RTD A;  4RW4 A;  4KHU A;  3O3G A;  2FC0 A;  2FBY A;  1UAX A;  5I42 A;  4M3T A;  4I2P A;  4Z4I A;  4CE9 A;  1BI4 A;  3OYK A;  2IS3 A;  3L2V A;  3SZ2 A;  3QER A;  3DI6 A;  3KJV A;  1NKC A;  3DLH A;  1A5X A;  5HRR A;  3F9K A;  1RTH A;  4CJE A;  3NGI A;  3K57 A;  4M3U A;  1IKY A;  3HPG A;  3AVB A; 
#chains in the Genus database with same CATH topology
 3LDL A;  4DLG A;  2Z1J A;  5M1F A;  4B9Q A;  5AZJ A;  4FJH A;  4JAX A;  2I7P A;  4Y0W A;  3CM5 A;  3ALY A;  4CD3 A;  4JS5 A;  1IO2 A;  3DOL A;  1TYQ B;  2WTU A;  1JLQ A;  3DJC A;  4EZ6 A;  1WAF A;  3GOI A;  1DKG D;  4CJT A;  1NOZ A;  3SQ1 A;  2GWJ A;  2NRX A;  4NCB A;  4FCY A;  1FKO A;  1WUA A;  3LM2 A;  3K2P A;  3J7Z O;  4FJJ A;  1ASU A;  5AQQ A;  2XY8 A;  3AO4 A;  4Z4C A;  3HXM A;  1IBL K;  1RBT A;  1NLV A;  4HUG A;  1O13 A;  3RMD A;  5M1N A;  3QBX A;  1E3M A;  3QML A;  4MFB A;  2Q36 A;  3FLC O;  4DSF A;  3T1H K;  4O55 A;  1K8A O;  4WE1 A;  2VGM A;  2OCE A;  4B9S A;  4BDY A;  3TSU A;  1U04 A;  3FGU A;  4FWK A;  2D0O A;  3CPW M;  3TAF A;  3CME N;  1NU0 A;  4LSN A;  1X9W A;  3ZSY A;  4BRK A;  1ZBF A;  2KFZ A;  4DQQ A;  4HUE A;  4FVU A;  4YOX A;  2FBV A;  4AF1 A;  3D2E B;  2RN2 A;  2VYP A;  3J8A A;  1T8E A;  2OYQ A;  4FWP A;  3S9H A;  4K25 A;  4E0D A;  2HOE A;  3VTH A;  4WCE L;  4B3S K;  4GMJ B;  4NO7 A;  1XWL A;  4AIL C;  2B5J A;  4CF1 A;  4FYD A;  5D3G A;  3CC4 N;  2YNG A;  1KAX A;  1RFQ A;  5E84 A;  1GLB G;  1J9A A;  1BCO A;  3KLE A;  4A2A A;  5AQL A;  4FM0 A;  1Q7Y O;  2UUB K;  2Q0R A;  1U48 A;  4OPH A;  4YOY A;  2F8T A;  4DQI A;  3L2U A;  3OYI A;  3D6R A;  1OH5 A;  3NMU A;  1Z05 A;  3LDN A;  1QQC A;  4YFU A;  3ZX3 A;  2YKN A;  5C2D A;  4FL9 A;  1GLD G;  1LW2 A;  3AO1 A;  2Y1I A;  4DS4 A;  4DV2 K;  3VTI A;  4G9Z A;  4W5N A;  3LPT A;  1IG9 A;  1TK8 A;  1FK9 A;  1BCM A;  3U3Y A;  3TR8 A;  4I9L A;  3OYF A;  2WON A;  3FFK B;  3MED A;  4BRO A;  5J1E A;  1E4G T;  2YNI A;  1QS4 A;  4NB4 A;  1JLA A;  3K5M A;  5BR8 K;  3O6W A;  4FZZ A;  2QWN A;  2DPN A;  3FE1 A;  3QNO A;  3ZEU B;  2YI1 A;  1VSL A;  4FW2 A;  4FWL A;  4RWT A;  1DTQ A;  3MN7 A;  3BZK A;  3CJB A;  2GV9 A;  2KZM A;  3K5N A;  2HHS A;  3HYF A;  2O4G A;  3N4Q A;  4DQP A;  2IVN A;  1HNZ K;  5FDL A;  2ZJR L;  1HYZ A;  4F3T A;  4AM7 A;  4CHZ A;  5LMN K;  1IKV A;  3HRG A;  2P9S B;  3OS2 A;  4AHC A;  3OYE A;  1XI1 A;  3HOS A;  2ATQ A;  4KBO A;  1HYS A;  4DQR A;  4R5P A;  2RF2 A;  4X64 K;  5AQI A;  1VQM N;  2P1J A;  4Z4E A;  4HWI A;  2AP1 A;  2NZT A;  1Z26 A;  4A5B A;  1HRH A;  4DLE A;  5BRH A;  3THX A;  2E1Z A;  4NCG A;  3KLG A;  1CZB A;  1EQY A;  4O44 A;  2HHW A;  3AO2 A;  5CZ2 A;  1YIT N;  4I2Q A;  5HL7 L;  1NGJ A;  1HUX A;  1W0H A;  3DRS A;  4M41 A;  3TU5 A;  1HKG A;  3LP0 A;  4C1N I;  1C0T A;  1QHT A;  3LAN A;  2XRI A;  3CYM A;  3SI6 A;  4PKI A;  5IWA K;  1WAJ A;  3A5N C;  1QE1 A;  3VGK A;  4Z4H A;  4FJ9 A;  4H0Y B;  2HF3 A;  3U4L A;  3O4W A;  4DFJ A;  2P9L B;  3MXM A;  5LY3 A;  4J8F A;  5HRS A;  4H0O A;  3ASM A;  4N5S A;  5C15 A;  3SMP A;  3WEE B;  4KPY A;  3DLE A;  1T6D A;  1NBW A;  3EY1 A;  3CFP A;  3V1R A;  1Z25 A;  2B4J A;  3IDH A;  4FLT A;  3A2F A;  3EE9 A;  3O1W A;  4CZJ A;  4FK4 A;  3FR0 A;  5GAD P;  2PFU A;  3AVI A;  2E5L K;  2FLO A;  4JLH A;  3S3O A;  3LDP A;  1NKE A;  3MK6 A;  1KCF A;  1NGE A;  4CJU A;  1SQK A;  3VES A;  4GNI A;  4AHV A;  4RTF D;  1Q82 O;  3DLR A;  3SAF A;  1ZYQ A;  1C1A A;  4NYF A;  4E7L A;  4CD1 A;  1LCU A;  3CC7 N;  5AQS A;  1FJG K;  5HP1 A;  4JKC A;  3MDQ A;  3RR7 A;  4FOI A;  4RW8 A;  5KRS A;  4LF4 K;  4V19 S;  1WOQ A;  2YCH A;  1BHL A;  2QM1 A;  4E7H A;  1WSE A;  2CGL A;  4PUO A;  4JKE A;  1T6C A;  3EEQ A;  2VQE K;  3AO3 A;  4YDU A;  4LC9 B;  3C95 A;  4BR4 A;  4QS7 A;  4DQS A;  2E6M A;  1EP4 A;  3VQE A;  1JCF A;  4CVN E;  3V4I A;  1MU2 A;  3ZSO A;  3TSP A;  4BE0 A;  4B9V A;  4CJ7 A;  3HI0 A;  1J6Z A;  3OW2 M;  3ZSQ A;  5JVG L;  1RBS A;  1K8K B;  1K6Y A;  4O4G A;  1RT7 A;  4KTW A;  3CM6 A;  3OYC A;  4U7B A;  2YHA A;  1NGB A;  3QDK A;  4DQ8 A;  2WBN A;  1W97 L;  5AQG A;  3NF6 A;  3R8E A;  3OYN A;  1X3M A;  4DMN A;  3QET A;  1WSG A;  3I55 N;  4CHP A;  3OYG A;  4DS5 A;  3O1B A;  1YHQ N;  2O8D B;  4BR0 A;  3A8Y A;  4CGI A;  2ASP A;  4E1J A;  3TAB A;  5J2Q A;  4KI4 A;  3J81 O;  1VSK A;  2F9W A;  3D7E O;  2O8B A;  1KVA A;  4CZH A;  2HHH K;  3NVM A;  4WQ5 A;  3WEE A;  3VA3 A;  4YDU C;  4DR3 K;  3FFI A;  4WFA L;  2Z1H A;  5M1K A;  4CJL A;  4IFE A;  3RRG A;  1ZC6 A;  2G8W A;  1A5V A;  4H5V A;  2HNZ A;  1U47 A;  4FPA A;  4IZ9 A;  4JI6 K;  2FSK A;  4LF9 K;  4JKA A;  4FM2 A;  3LZJ A;  3T1Y K;  4BG9 A;  1U2V A;  5HBM A;  4NXM K;  4CHY A;  3H45 C;  5JLH A;  3LM9 A;  3E66 A;  3HM9 A;  5KQ8 A;  3SV4 A;  2X74 A;  5KGW A;  3BF1 A;  4B3R K;  5B8H A;  4JI4 K;  2GEL A;  1SS6 A;  2YJE A;  2OZS A;  2WC9 A;  4RW7 A;  3VQB A;  3CC2 N;  1NJI O;  3OBY A;  1MA9 B;  3NF7 A;  2ZJQ L;  4LF7 K;  4BWJ A;  4CED A;  4WFB L;  2OA8 A;  2D0B A;  2A3Z A;  2BTF A;  5M1P A;  4W5T A;  3WXI A;  4JRQ A;  2RHK A;  5M1O A;  4CER A;  3I0S A;  5EOY A;  4M63 C;  5BN8 A;  3SMS A;  3MMV A;  2X6N A;  1ATS A;  3EKS A;  4B1Z A;  4O5B A;  3U8X A;  3VQ9 A;  3OS0 A;  3NFA A;  4WQ5 C;  3DM2 A;  1RBU A;  5DMR A;  4B9U A;  2VWK A;  5AQP A;  4IDH A;  3RR8 A;  3GL1 A;  1VSF A;  5LJV A;  3LAL A;  3QES A;  4J2D A;  5DM6 L;  3WNE A;  2P9P B;  1KAY A;  4NLB A;  1I94 K;  2HF4 A;  3PX6 A;  4DSE A;  2KLA A;  4DHY A;  2IAJ A;  3CJA A;  1EWQ A;  3L4Q A;  1SKS A;  5C12 A;  4KHU A;  4RW4 A;  2FC0 A;  2FBY A;  1UAX A;  5JIC A;  4Z4I A;  4CE9 A;  3QER A;  3DLH A;  4GV3 A;  3KJV A;  3KHY A;  1YI2 N;  3QIC A;  4AM6 A;  4CJE A;  2CH6 A;  3K57 A;  4M3U A;  3PSI A;  3KLF A;  3K58 A;  4CFC A;  4BDZ A;  1X1P A;  3BP8 A;  3ZX0 A;  4NXN K;  2GBZ A;  3WXM B;  4FLX A;  4B3M K;  3WNF A;  4JHD A;  1HNI A;  3HZ6 A;  1XUP O;  2P9U B;  4BVO A;  4JV5 K;  3H46 O;  1G99 A;  2IVP A;  3ZCM A;  3O9Q A;  1ZBU A;  2HVI A;  3VQ7 A;  3I0R A;  1L3S A;  1VAZ A;  5BN9 A;  2UUC K;  3PO4 A;  3T19 A;  2O4I A;  3CI5 A;  3K59 A;  3HP6 A;  3JSM A;  3MCP A;  1BQN A;  3AVH A;  3MX5 A;  2A6A A;  4Z0U A;  4MDB A;  3HOT A;  3DLK A;  4CJ3 A;  3OVN A;  3VMF B;  1BIS A;  1VQ6 N;  4OO1 J;  3VER A;  3SUO A;  3VF4 A;  3HVR A;  3LDO A;  4IG0 A;  2OTJ N;  2HMI A;  4GW6 A;  4CFD A;  4DR6 K;  2HB5 A;  4OJR A;  2BGG A;  4MO5 A;  3T7Z A;  4OKJ A;  3KZB A;  1IV0 A;  3JS6 A;  4IG3 A;  3KVG A;  3VQ6 A;  5FPD A;  4CJR A;  1NGD A;  1QSY A;  2IOC A;  3V9W A;  1QVG M;  3CCS N;  5EU7 A;  1CXU A;  3E9P A;  4K42 A;  1TAU A;  1SAZ A;  5BPM A;  1J5E K;  2G8K A;  1CXQ A;  4HCB A;  3KWG A;  2UXD K;  4ELU A;  1HQE A;  2WUS A;  4KH6 A;  2PAV A;  1JLE A;  3M1F A;  3O9U A;  3ID6 A;  4CK3 A;  1O1W A;  3KLH A;  1X9S A;  5AQH A;  3O80 A;  2HBJ A;  3CQ8 A;  1RDW X;  3LP1 A;  4M7Y A;  1DEJ A;  4CBU A;  1VK0 A;  1ASV A;  2XHB A;  4OPJ A;  4JRP A;  3K5L A;  3HK2 A;  2P5G A;  1RTJ A;  1ZXO A;  2G8U A;  3MWT A;  2HHQ A;  2FF6 A;  4JKG B;  3KD5 E;  3TAP A;  1A5W A;  4BWM A;  3VQA A;  3ZET B;  4C1N K;  5CYM A;  3FZM A;  1GOA A;  2UYT A;  5TKW A;  2LSN A;  3P4I A;  4FLZ A;  4FJX A;  2KTQ A;  1TKD A;  2A1R A;  1M1K O;  5HRP A;  2Y1J A;  3SQ2 A;  3WXL A;  3EL2 A;  4BGA A;  1RT6 A;  4B08 A;  3EYZ A;  4NLC A;  2HHX A;  3VGL A;  3G71 N;  4I6M A;  2VG6 A;  4CF0 A;  4MO4 A;  4BRA A;  4CZM A;  4FJ8 A;  3IAY A;  4JD2 A;  4HCC A;  1N5Y A;  1BO5 O;  4DV6 K;  4KHN A;  2VWB A;  3PSF A;  4DKW A;  4JNE A;  2QXF A;  3AVA A;  1X9J A;  1QQM A;  1IBK K;  3CQX A;  2E4L A;  3HSC A;  1VSJ A;  3O3F A;  3ENH A;  1IJJ A;  2B6A A;  1TUU A;  3CFO A;  5AFU H;  5AJ3 K;  4QCL A;  3WUH A;  2YV0 X;  5EXW A;  5GIN A;  3LAM A;  1VQ9 N;  2ZD1 A;  1L3U A;  4PKH A;  1S22 A;  2O8F A;  1NMN A;  1RBV A;  1ASW A;  1SV5 A;  1TKZ A;  1ZBI A;  3M5R A;  4Q5V A;  2KKZ A;  1QQN A;  3D2F A;  4IFV A;  1FKP A;  2XY6 A;  2BAN A;  3NAE A;  4KRF A;  5AZI B;  3VQ5 A;  4H4O A;  1F21 A;  3CCR N;  1CZA N;  5AQT A;  3AVG A;  5C0Y A;  4H0X B;  4BC3 A;  4WF9 L;  3U3G A;  4G1Q A;  4TSX A;  1J53 A;  2W41 A;  5E41 A;  1BU6 O;  4R79 A;  1S72 N;  3SAH A;  3MEC A;  3O4Q A;  3C0B A;  1HMV A;  1S1V A;  3MX2 A;  4YOW A;  5EX5 A;  1U6Z A;  3VN5 A;  4JK8 A;  3KWI A;  4FLV A;  4KHQ A;  2O8C B;  1T7P A;  2I7N A;  5JS1 A;  5BPN A;  3EO3 A;  1P90 A;  1IBM K;  2O8E B;  4B9T A;  1DGK N;  1SZ2 A;  1R0A A;  1KTQ A;  3JAM O;  3SK3 A;  3A5O C;  4DR2 K;  2UXB K;  1GLJ O;  3AGR A;  5FPN A;  1NGG A;  1V4T A;  1XC3 A;  3CF5 L;  2QKK A;  3G4S N;  3CCM N;  4Y1D A;  3AA4 A;  4BC5 A;  1GLE G;  1IKX A;  3RWU A;  2FBT A;  1S9E A;  2HMP A;  3U9D A;  1T03 A;  2XY5 A;  4PL7 A;  5M1Q A;  4O8U A;  3HM8 A;  3WQU A;  1NG9 A;  4CJ5 A;  4AHR A;  3SCX A;  4X65 K;  4FJN A;  2E2O A;  4BAC A;  1VSI A;  5BR9 A;  3P5J A;  3THV A;  4DTJ A;  3V1Q A;  3DAW A;  4EIA A;  3G0Z A;  4YNQ A;  2G8I A;  1G15 A;  2QEX N;  3ZT3 A;  3OYA A;  4WYB A;  1LAV A;  5AFU A;  4DUZ K;  5AQF A;  2HND A;  4N41 A;  4DU3 A;  1TYQ A;  4K8Z A;  4E89 A;  4B8C A;  3SJJ A;  3MN9 A;  3EKU A;  4DTR A;  1EX4 A;  3QIO A;  3K9K A;  2GUI A;  4LH4 A;  4DR4 K;  5AQJ A;  2AA4 A;  3S3N A;  4B1X B;  1B9D A;  3M8Q A;  3E9O A;  4RW9 A;  3MWP A;  4HHT A;  1TKX A;  4CZL A;  3OYD A;  2X78 A;  4JKF A;  1VQ8 N;  4GVM A;  3GG4 A;  3HVT A;  3L3V A;  3RMC A;  5A2Q O;  4H5R A;  1RDC A;  2CGK A;  5AZI A;  1S6Q A;  3JYT A;  1RT5 A;  3K5O A;  1I3A A;  3OJS A;  2QW9 A;  5JLF A;  4DFP A;  1KC8 O;  3FZK A;  4ILJ A;  4M3R A;  1D8Y A;  1JXE A;  4BR5 A;  3UB5 A;  4AHS A;  4XH5 A;  1HKB A;  2O8C A;  4CJP A;  5CZ1 A;  2CGJ A;  1N34 K;  3CCV N;  1WBB A;  1QSL A;  3KD1 E;  2O8E A;  4WFN L;  2E2P A;  4KH4 A;  3V81 A;  3PY8 A;  4J2A A;  3D2E A;  4AHU A;  4BGB A;  4FOE A;  3NDK A;  5H1S Q;  4OGE A;  1KQS M;  1GOB A;  3NBP A;  3J80 O;  4IWV A;  4OLA A;  1VRU A;  2IIR A;  5HOO A;  1NGA A;  4CW7 B;  1KVB A;  4DTP A;  3PX0 A;  1VQ7 N;  2HHT A;  3KLI A;  4XIU A;  1XHZ A;  5AQN A;  1S1W A;  2DFF A;  3ZT4 A;  4B1W B;  4DV0 K;  1QQO A;  1EO1 A;  4A59 A;  2PY5 A;  4DTN A;  4PA1 A;  3UKR B;  3M8S A;  1YT3 A;  1QTM A;  1C6V A;  4LFA K;  4BY9 C;  4EP5 A;  4Z94 A;  4QOZ B;  4FZY A;  3RMA A;  2YHB A;  4C8M A;  3VPZ A;  4BDP A;  3T3F A;  3EZ5 A;  2QWO A;  5I3U A;  4CZI A;  4BRE A;  4LF8 K;  4JN4 A;  4DV1 K;  1VQP N;  1GLL O;  4JI2 K;  4M42 A;  3P38 A;  3NH0 A;  2UU9 K;  3OJU A;  1Q9X A;  3THY B;  2ZF5 O;  1D9F A;  4ISF A;  3J7A P;  5TKY A;  4EP4 A;  4RCH A;  3AVL A;  2IDO A;  3HTV A;  1ZBS A;  3F73 A;  3AA5 X;  3M8P A;  1ATN A;  1HNW K;  1XMO K;  1IH7 A;  4Z4G A;  3TTC A;  4IEE A;  3SQ0 A;  3ZEU A;  1CLQ A;  1J5O A;  2V51 B;  1NK4 A;  1YXQ A;  1WSJ A;  4BRH A;  4DTS A;  1WSI A;  1S1X A;  4GV6 A;  1YTU A;  3LWM A;  4BC4 A;  1C1C A;  3AAR A;  4ILH A;  3E1Y A;  4OVL A;  3GBT A;  4BRD A;  4EZ9 A;  4FJ5 A;  4CIF A;  1JJ2 M;  3D0P A;  2Q3S A;  5J2N A;  5E26 A;  2KQ2 A;  4KI6 A;  4EAH D;  2E6L A;  1KSP A;  1JCG A;  4BQZ A;  2P9S A;  4I7F A;  2D0C A;  4Z4F A;  3DXK B;  1HX1 A;  5CY4 A;  4B1V A;  1TGO A;  4EHU A;  2HST A;  4FZX C;  3C6U A;  2ASO A;  4JEP A;  4M3Y A;  2XO7 A;  3GDQ A;  1RTD A;  1HLU A;  1Q18 A;  3OYK A;  2IS3 A;  3MN5 A;  1BA1 A;  3L2V A;  5JVH L;  4GY2 B;  5AR0 A;  3CCJ N;  4GKK K;  1RDB A;  3MAQ A;  2QWR A;  3ZSZ A;  4ELT A;  1K73 O;  3N4P A;  1N36 K;  1RTI A;  1NNE A;  4DCH A;  3NVK A;  2DTU A;  4BRG A;  1JLB A;  1WNS A;  4YOT A;  5F0X A;  2E20 A;  2ZQB A;  4FWR A;  5GAG P;  2BE2 A;  1UOC A;  2VG7 A;  1X3N A;  3HL8 A;  3P39 A;  4H0T B;  1YUW A;  3RRH A;  3VF2 A;  4C8K A;  2ZE2 A;  4FWO A;  1TAQ A;  4XH1 A;  1UWB A;  2FBX A;  3CD6 N;  2P9L A;  3FZL A;  3S3M A;  3R1X A;  4H4M A;  1W2B M;  4E7K A;  1SL2 A;  1RIL A;  3ENO A;  4F2R A;  2HVH A;  3UE5 A;  4KRE A;  1KXP A;  4FWM A;  5FPE A;  3H6E A;  1RT4 A;  4NYN A;  2DFE A;  1HJO A;  1T3V A;  1OH7 A;  1HKC A;  3E01 A;  3LP2 A;  3VEV A;  4ISG A;  1OVQ A;  4CJK A;  1OH8 A;  4C8N A;  4F2S A;  1YTA A;  1NM1 A;  4IO8 A;  3BY5 A;  3OYM A;  1X9M A;  5AQK A;  3CG7 A;  3SJH A;  1YJW N;  1GOC A;  1BIZ A;  5I9E B;  1VQ5 N;  1RT1 A;  2YHW A;  3OHR A;  4K43 A;  4BRP A;  3BZC A;  1XHX A;  4Y1C A;  5C10 A;  3HJF A;  2Q31 A;  1UA0 A;  3HT3 A;  2E88 A;  3O08 A;  5DM7 L;  4KH5 A;  4DR1 K;  2OPR A;  3TPQ A;  2GUP A;  1D9D A;  3C7N B;  3Q7B A;  3NHG A;  1S6P A;  4DSL A;  5ADX A;  1QZ5 A;  5AQM A;  4KTZ A;  4FM1 A;  1XMQ K;  4CGJ A;  4E7I A;  2G8F A;  4QAG A;  1YAG A;  2J4R A;  3PUF A;  4CEO A;  4C23 A;  4CEZ A;  1JLG A;  4OPA A;  4BRQ A;  1VSD A;  3QEV A;  1K8K A;  1NMD A;  5C42 A;  4MLE A;  4JYA K;  1W9H A;  3TAR A;  4F4K A;  3VEX A;  1QZ6 A;  5GAE P;  3ATV A;  3PV8 A;  1TK0 A;  1RT2 A;  2ITM A;  4BE2 A;  1WSF A;  4JI7 K;  3L8B A;  3OYH A;  4JK9 A;  2F96 A;  4CIG A;  3U6F A;  1VSM A;  2NRH A;  4H03 B;  3IS9 A;  2EWS A;  4KHP K;  5CHI A;  2RE2 A;  3AVN A;  4CES A;  5KPZ A;  3V9U A;  1C0F A;  3I56 N;  3CFR A;  3VGM A;  3P1G A;  2P5O A;  2O8D A;  3A5L C;  4FJ7 A;  3KK1 A;  3V9X A;  3D45 A;  1YVU A;  1JL1 A;  3K0S A;  5MLC Q;  4JI0 K;  4DF4 A;  4U67 L;  4ICL A;  3KKS A;  5AQZ A;  4A62 A;  1VRT A;  5LMU K;  3ZT0 A;  2DFH A;  4FJM A;  5KTQ A;  2Q2R A;  3CMA N;  1BG3 A;  1GLA G;  3W0L A;  2P51 A;  1HQU A;  4CJS A;  3AGK A;  2YHY A;  3THW B;  3AV9 A;  3ZYY X;  3KKR A;  3MEE A;  5IT9 O;  3UKU B;  1VHX A;  4CJF A;  3KK2 A;  2KHO A;  3QIP A;  4FVM A;  3QEI A;  3RSE B;  2D0P A;  2YX6 A;  4M45 A;  4K0K K;  4CI6 A;  1BOT O;  2P9I B;  1XNR K;  3AAQ A;  4DTX A;  4NCA A;  1XNQ K;  4ELV A;  2HHU A;  1HYV A;  3WT0 A;  3QEP A;  3E9L A;  1J54 A;  1NJW A;  4JI5 K;  4XEI A;  2JWK A;  4IJA A;  3BEX A;  3ULE B;  4N76 A;  2FSJ A;  3VEN A;  4CZK A;  5GAH P;  4B1Y B;  3WXJ A;  4E19 A;  3C7N A;  3DWL A;  1R59 O;  3QNN A;  4CGG A;  2ZM6 K;  1SKW A;  4FLU A;  4H0V B;  5AZJ B;  2PBD A;  4B1U B;  4CJQ A;  3V1O A;  2NNW A;  1LWC A;  3AVC A;  1KFD A;  3VEO A;  1BGX T;  2YNF A;  3M3Z A;  4MLH A;  4DSJ A;  1NK0 A;  3TWH A;  1P8Z A;  2QWM A;  3ZLJ A;  5F2R A;  3AVJ A;  4JI3 K;  4YHH K;  1L5U A;  1RBR A;  4YOU A;  3CER A;  3DLB A;  2P9P A;  3DRP A;  3CJC A;  1BL3 A;  3V9Z A;  4HUF A;  2BH1 A;  2NRW A;  4C8O A;  1NGF A;  4FXD A;  1HR0 K;  4JK7 A;  2OPQ A;  1SKR A;  1SL1 A;  2EX3 A;  3GE1 A;  3SUQ A;  2NLX A;  4DF8 A;  3ULD A;  4H5N A;  1YJN N;  4J2B A;  4W5R A;  3SBT A;  5LJW A;  3IRX A;  4GVE A;  4F9O A;  1ILY A;  5C2F A;  1ITG A;  4BR9 A;  3SNN A;  4FSV A;  2D4W A;  3T1A A;  1FXX A;  5HLF A;  4QS8 A;  2G8V A;  4CZE A;  1VSH A;  1NK5 A;  4BRL A;  2VG5 A;  3AAP A;  2P9U A;  3TTF A;  4BQL A;  4OPK A;  3H1Q A;  3C6T A;  1MWM A;  3H3O B;  3CJ1 A;  3L2W A;  1RCH A;  4BG8 A;  2P9I A;  3TAM A;  3CCE N;  4B8A B;  4M3W A;  4DV5 K;  5KPT A;  4LF5 K;  4LD0 A;  3MXJ A;  2RKI A;  3LP3 A;  1HPZ A;  1BUP A;  3L2R A;  3OYB A;  3HST B;  4DFK A;  4E1M A;  4FJI A;  4KHW A;  2BDP A;  1GLC G;  3CCQ N;  3PLA A;  4BR7 A;  4OKE A;  3ZSR A;  4DSK A;  1B92 A;  3QEW A;  4FJG A;  3CET A;  3EE8 A;  1YJ9 N;  3TAG A;  3NGZ A;  3WQT A;  4LY7 A;  4B3T K;  4M3X A;  3R9P A;  5FRO A;  3H08 A;  2F8S A;  4K41 A;  2ASM A;  4FO0 A;  4CF8 A;  2NRT A;  3PIP L;  4DB3 A;  4M3Z A;  1ZBH A;  5SWM A;  3KK3 A;  4KO0 A;  3H3N O;  4X62 K;  3CPE A;  4BVP A;  4E7J A;  1BI4 B;  3DMJ A;  3A5M C;  4HTL A;  4JKH A;  2Q97 A;  4FK0 A;  3HP9 A;  2JGU A;  4CJV A;  1C1B A;  1ZBL A;  5AQW A;  3O9R A;  2XY7 A;  2NUB A;  2PYL A;  5GIP A;  4LH5 A;  3M6G A;  3C94 A;  2ZWH A;  4ID5 A;  4B9M A;  3CIP A;  4DU1 A;  2GX9 A;  4KV8 A;  1FW6 A;  2FF3 B;  1EKE A;  3QBW A;  2D5R A;  3I33 A;  4JKG A;  5GIO A;  3ATU A;  1L3V A;  3ZET A;  2F4V K;  4AH9 A;  4N56 A;  1DLO A;  3SUP A;  2E1Y A;  3QLH A;  4JI1 K;  3VF6 A;  3HO1 A;  2QWP A;  5AQX A;  2DY4 A;  2Q1N A;  3UIQ A;  1RDD A;  3RVC A;  3NF9 A;  1Y97 A;  5AQR A;  3SV3 A;  3IG1 A;  3TSQ A;  4CEC A;  3QO9 A;  3JXU A;  4FJK A;  4MQ3 A;  4F8R A;  2ZGY A;  4ZTJ A;  1JCE A;  3THX B;  5KQD A;  4DV4 K;  1MDU B;  3CXC M;  4CEQ A;  4O0I A;  1M90 O;  3VQP A;  4BC2 A;  1B9F A;  2R7Y A;  4L8R B;  4JKB A;  1NGC A;  4BE1 A;  3LDQ A;  2A42 A;  2HBL A;  1VQO N;  3V6D A;  3ID8 A;  3AVF A;  4AQY K;  3L3U A;  3B8A X;  3HPO A;  1U49 A;  2HHV A;  4LFC K;  1TVR A;  4O0J A;  1KAZ A;  3PO5 A;  4OX9 K;  4KHS A;  3HPH A;  3P83 D;  5C25 A;  3VET A;  2E2Q A;  3QIN A;  5BRE A;  3DOK A;  1VQN N;  4CJ4 A;  3NE6 A;  3SQ4 A;  1CZ9 A;  3O9S A;  4FK2 A;  4IBN A;  5DK5 A;  1JKH A;  3G10 A;  4FLY A;  1WSH A;  5F1X A;  1BWF O;  5BPL A;  1TUY A;  4DUY K;  3TI0 A;  1XQS C;  4CIE A;  4CZG A;  4UY8 O;  5I42 A;  3O8M A;  4DR5 K;  4M3T A;  1BI4 A;  2ZJP L;  2A40 A;  1WBD A;  1NKC A;  1N32 K;  2HBK A;  1A5X A;  5HRR A;  4GKJ K;  3F9K A;  1RTH A;  4A57 A;  4B3O A;  1IKY A;  3HPG A;  3F5T A;  4QS9 A;  2IVO A;  4IFY A;  3DRR A;  1S1T A;  1OVY A;  4H5W A;  4IOA L;  2GEM A;  3DYA A;  3LZI A;  1NGH A;  3L0Q A;  1LWF A;  1E4F T;  3AA3 A;  5EY4 A;  4HVJ A;  1LWE A;  3C6H A;  4DSI A;  4LFB K;  3LPU A;  1EWR A;  2WFB A;  5FLX O;  3TAE A;  4PY5 A;  2OZM A;  5HRO A;  4I9Q A;  2IC3 A;  2JWL A;  2YHX A;  4CHQ A;  3SUN A;  1JL2 A;  1EET A;  1T05 A;  1JLF A;  3FZF A;  3OS1 A;  5AQO A;  1LAW A;  1S9G A;  1Q86 O;  3CJ9 A;  2W42 A;  4CF2 A;  3KTQ A;  4CFA A;  3MN6 A;  4H0P A;  4PQU A;  3MCA B;  4F3O A;  4CGH A;  4IOC L;  3AVK A;  3RTV A;  3DLL L;  2A5X A;  3L2Q A;  4LF6 K;  3F9M A;  4XH4 A;  3OTO K;  3IUC A;  3V9S A;  2OAN A;  4KKO A;  1Y64 A;  3O4N A;  4B9N A;  4IEI A;  4JKD A;  2QKB A;  4OKK A;  2W6L A;  4IDK A;  4CCH A;  3VQD A;  1U45 A;  2UUA K;  3W3D A;  1W7A A;  3BUZ B;  4CZF A;  3B6O A;  2VWJ A;  3L6Q A;  1TV6 A;  4PL8 A;  1L3T A;  4FJL A;  4YY3 K;  1VQ4 N;  2O8B B;  1DTT A;  4DG1 A;  3DXM B;  3QEX A;  4CGF A;  2YKM A;  3WXK A;  1Q9Y A;  4EFH A;  4DV7 K;  4CHN A;  3U9Z A;  3LL3 A;  3DLG A;  1TL1 A;  4BRN A;  1GLF O;  1C0G A;  1C0M A;  1LV5 A;  3CHW A;  2PYJ A;  3EZW A;  1VQK N;  2CH5 A;  5JS2 A;  3WNH A;  1U2V B;  1NJX A;  4CEF A;  1UA1 A;  1DT9 A;  2ITG A;  4FW1 A;  2YJF A;  4O8K A;  3VQ4 A;  1WB9 A;  1KFS A;  5ADX H;  1NJY A;  1NK9 A;  2GWK A;  1NOY A;  3K9J A;  1KRP A;  3QB0 A;  1NK7 A;  4L3Q A;  3P31 A;  1NK6 A;  2D0A A;  4IXC A;  2VGN A;  4AHT A;  3OYL A;  4KAZ A;  4CFB A;  4A61 A;  4DTO A;  2RPI A;  1HNV A;  2FXU A;  5HRN A;  1RDU A;  5BRD A;  4RG8 A;  3VQQ A;  4DR7 K;  1T44 A;  5AQV A;  2UXC K;  3SBG A;  2X6S A;  2D1K A;  3SAG A;  3AA2 A;  1TK5 A;  5CE3 A;  2VCP A;  3F2K A;  1N33 K;  5CYQ A;  1NGI A;  4ID1 A;  3UKR A;  3O3H A;  1RDA A;  3LAK A;  1HJR A;  3IFR A;  3J7Y P;  4JS4 A;  3AVM A;  2QWL A;  4KB1 A;  4IJN A;  3BF3 A;  3ZSW A;  2F9T A;  2Q0U A;  1ATR A;  1IG8 A;  3O5B A;  5KGX A;  5JMV A;  3AY9 A;  3KK7 A;  4WQ4 A;  1BIU A;  4J2E A;  3TTD A;  3VOV A;  2PZS A;  5J2P A;  4C8L A;  5K14 A;  3NH2 A;  3QFU A;  4N47 A;  2W6K A;  3OYJ A;  3THY A;  2WOM A;  1Q81 O;  4YOV A;  1S1U A;  4O5F A;  4BR2 A;  4KB0 A;  2QI2 A;  4E3S A;  2OTL N;  3VEW A;  4CEE A;  2W40 A;  3S41 A;  2YNH A;  3NCI A;  4ILG B;  4A5A A;  2Z1G A;  3DXM A;  4CEA A;  4MDA A;  5KI6 A;  5AQY A;  5LL6 Z;  4JHD B;  1VQL N;  1S3X A;  5FPM A;  2I5J A;  2P9N B;  3B6P A;  4JI8 K;  3BGR A;  4DV3 K;  3ZT1 A;  1U4B A;  1KLN A;  1JLC A;  4CBX A;  3R6M A;  4K8X A;  1BQM A;  5J2M A;  4DTU A;  1KVC A;  3VQ8 A;  2ZGZ A;  1BA0 A;  4W5O A;  1QVF M;  1QSS A;  3DXK A;  1NK8 A;  4PHT X;  3IKM A;  5AQU A;  1KD1 O;  2NRR A;  2E8A A;  2OPP A;  4BRI A;  1RT3 A;  2EHG A;  3M8R A;  4CF9 A;  1N8R O;  5ELZ A;  3SPZ A;  4DU4 A;  2NRV A;  4WQ4 C;  1YVN A;  3PIO L;  2QK9 A;  4HTU A;  1I39 A;  3C6A A;  3HBT A;  4FWQ A;  1HNX K;  5FRM A;  3G25 A;  1WN7 A;  5FRN A;  4M7X A;  1MWK A;  4YOR A;  3NH1 A;  3IMX A;  4LSL A;  3SYZ A;  1SL0 A;  4PWD A;  2KZZ A;  4OGC A;  3OY9 A;  1Q8I A;  1C0U A;  3ZSV A;  2G8H A;  5SZT A;  1HPM A;  3ZSX A;  2KW4 A;  3SLC A;  4X66 K;  4KTQ A;  2F7T A;  3I8D A;  3LWL A;  4DFM A;  2V7Z A;  3O9T A;  3L4I A;  1TKT A;  1OKJ A;  4CK2 A;  4IO9 L;  4BRF A;  2KFN A;  1S5J A;  3VQC A;  3SPY A;  4FLW A;  2HNY A;  1H1V A;  4E1N A;  2OPS A;  4ZTF A;  2AJQ A;  1OH6 A;  4ZHR A;  2QWQ A;  3Q7C A;  4H5T A;  4KHY A;  2HW3 A;  4FWN A;  4A2B A;  1V4S A;  2QXL A;  2P9K B;  4FPB A;  4ISE A;  4UQG A;  3QFP A;  4CJW A;  3T69 A;  4DTM A;  2P9N A;  4I6M B;  1VSE A;  1RNH A;  3LDS A;  5C24 A;  4JD2 B;  1REV A;  1QHA A;  2H3G X;  1LOT B;  3R3L A;  1XC9 A;  3MXI A;  4CBW A;  3PX4 A;  3EN9 A;  4CK1 A;  3VEZ A;  3NGY A;  2NRZ A;  3ZT2 A;  3I8B A;  3AO5 A;  2Z1I A;  2HBM A;  3NF8 A;  4FWS A;  4B9L A;  1YF5 L;  3A0I X;  5BRF A;  4Q0B A;  3ENB A;  1WLJ A;  5T7B A;  3G6E N;  1KLM A;  1JXB A;  2FSN A;  1BDG A;  1LW0 A;  2O8F B;  3CCU N;  2QA4 N;  4CHO A;  4GV9 A;  4EHT A;  3TAQ A;  3VEY A;  3D2F B;  2BUP A;  4CGD A;  3BDP A;  4OLB A;  3CJ7 A;  4IKF A;  4H8K A;  1TL3 A;  5CR4 A;  1Z6R A;  3H1V X;  2QTD A;  3OBW A;  3FZH A;  3KIO A;  1D4X A;  2V52 B;  2IGI A;  2GTD A;  1NJZ A;  1D5A A;  5KPR A;  1IKW A;  4KFB A;  4IOX A;  3CQY A;  3ZX2 A;  3OA9 A;  4PKG A;  4CEB A;  4RW6 A;  3RMB A;  2E2N A;  2VQF K;  3THW A;  5EVZ A;  3MEG A;  3UKU A;  2ETJ A;  3ITH A;  4BRM A;  2V7Y A;  5KRT A;  3VA0 A;  3RSE A;  2A41 A;  2A1S A;  3CCL N;  3ISN C;  1EXQ A;  3TAN A;  1RGI A;  4W5Q A;  1NKB A;  1SUQ A;  3WNG A;  1YIJ N;  2P9K A;  1N6Q A;  1NWK A;  2JLE A;  3C65 A;  4DWI A;  3O3G A;  3ULE A;  4I2P A;  3SZ2 A;  3DI6 A;  4BRC A;  1K9M O;  3NGI A;  1ESV A;  3AVB A; 
#chains in the Genus database with same CATH homology
 3KLF A;  4DLG A;  3K58 A;  4CFC A;  1RDB A;  2Z1J A;  4IFY A;  3MAQ A;  3DRR A;  1S1T A;  4BDZ A;  1X1P A;  3ZSZ A;  4ELT A;  2GBZ A;  4FJH A;  4FLX A;  3DYA A;  3LZI A;  3CM5 A;  1RTI A;  3ALY A;  3WNF A;  1HNI A;  2DTU A;  1LWF A;  4JS5 A;  1JLB A;  1WNS A;  3AA3 A;  1IO2 A;  3DOL A;  1LWE A;  4HVJ A;  4DSI A;  1JLQ A;  2ZQB A;  1ZBU A;  3ZCM A;  3LPU A;  4EZ6 A;  2BE2 A;  1WAF A;  1UOC A;  2HVI A;  2VG7 A;  3I0R A;  3VQ7 A;  1L3S A;  3HL8 A;  4CJT A;  3RRH A;  3TAE A;  3PO4 A;  4C8K A;  1NOZ A;  2ZE2 A;  3T19 A;  3SQ1 A;  4PY5 A;  1TAQ A;  2O4I A;  2OZM A;  1UWB A;  2FBX A;  5HRO A;  4I9Q A;  3K59 A;  4FCY A;  4NCB A;  1FKO A;  2IC3 A;  3K2P A;  4FJJ A;  3S3M A;  1ASU A;  4H4M A;  3HP6 A;  1SL2 A;  4E7K A;  4F2R A;  1RIL A;  2HVH A;  3JSM A;  4KRE A;  4CHQ A;  1BQN A;  3AVH A;  3SUN A;  2XY8 A;  1JL2 A;  3AO4 A;  4Z4C A;  1RT4 A;  1RBT A;  3HXM A;  1EET A;  4NYN A;  4Z0U A;  1JLF A;  4HUG A;  2DFE A;  3RMD A;  1T05 A;  3DLK A;  4CJ3 A;  3OVN A;  3OS1 A;  1BIS A;  3E01 A;  3SUO A;  3LP2 A;  1LAW A;  4MFB A;  4CJK A;  1S9G A;  3HVR A;  4DSF A;  4O55 A;  4C8N A;  4WE1 A;  4IG0 A;  2W42 A;  4B9S A;  1YTA A;  4CF2 A;  4F2S A;  3KTQ A;  4CFA A;  2HMI A;  4GW6 A;  4BDY A;  4CFD A;  3OYM A;  2HB5 A;  1U04 A;  4OJR A;  3CG7 A;  1X9M A;  2BGG A;  4OKJ A;  4PQU A;  4F3O A;  4CGH A;  3AVK A;  3RTV A;  3TAF A;  1GOC A;  1BIZ A;  4LSN A;  1X9W A;  4IG3 A;  3ZSY A;  3VQ6 A;  4CJR A;  1RT1 A;  3L2Q A;  3V9S A;  1ZBF A;  1XHX A;  4Y1C A;  1QSY A;  3HJF A;  2IOC A;  2KFZ A;  4KKO A;  4HUE A;  4DQQ A;  3O4N A;  4B9N A;  2FBV A;  1UA0 A;  2QKB A;  4OKK A;  3V9W A;  2RN2 A;  4IDK A;  3HT3 A;  4CCH A;  3VQD A;  5EU7 A;  1U45 A;  1CXU A;  1T8E A;  2OYQ A;  3S9H A;  1TAU A;  4E0D A;  2OPR A;  2G8K A;  3B6O A;  1D9D A;  2VWJ A;  1CXQ A;  4HCB A;  1TV6 A;  1L3T A;  4GMJ B;  3NHG A;  4FJL A;  1S6P A;  4ELU A;  4DSL A;  1HQE A;  1XWL A;  4AIL C;  1DTT A;  2B5J A;  4CF1 A;  4FYD A;  5D3G A;  2YNG A;  4DG1 A;  4KTZ A;  4FM1 A;  4CGJ A;  1JLE A;  4E7I A;  3QEX A;  2G8F A;  3PUF A;  1BCO A;  1J9A A;  4QAG A;  4CEO A;  1O1W A;  4CGF A;  4CK3 A;  2YKM A;  3KLE A;  1Q9Y A;  4CEZ A;  1JLG A;  3KLH A;  1X9S A;  4FM0 A;  4CHN A;  1U48 A;  3CQ8 A;  1VSD A;  3QEV A;  3LP1 A;  5C42 A;  1VK0 A;  3DLG A;  1ASV A;  2XHB A;  4OPJ A;  4JRP A;  3K5L A;  1W9H A;  3TAR A;  4F4K A;  2F8T A;  3HK2 A;  1TL1 A;  2P5G A;  1RTJ A;  3L2U A;  2G8U A;  4DQI A;  1C0M A;  3OYI A;  3PV8 A;  2HHQ A;  1TK0 A;  3KD5 E;  3TAP A;  1LV5 A;  2PYJ A;  1A5W A;  1RT2 A;  4BWM A;  3VQA A;  4BE2 A;  1WSF A;  3L8B A;  5CYM A;  3OYH A;  2F96 A;  1GOA A;  4CIG A;  5JS2 A;  3U6F A;  1QQC A;  3WNH A;  4YFU A;  2LSN A;  1VSM A;  2YKN A;  1NJX A;  4CEF A;  3IS9 A;  4FLZ A;  1LW2 A;  3AO1 A;  2Y1I A;  4FJX A;  1UA1 A;  1TKD A;  2A1R A;  2KTQ A;  2ITG A;  4FW1 A;  3VQ4 A;  5HRP A;  4DS4 A;  2Y1J A;  3SQ2 A;  1KFS A;  3AVN A;  4CES A;  3V9U A;  1NJY A;  4W5N A;  3LPT A;  1NK9 A;  1RT6 A;  4B08 A;  3CFR A;  1IG9 A;  1TK8 A;  1FK9 A;  1BCM A;  3EYZ A;  1NOY A;  3U3Y A;  2HHX A;  3P1G A;  1KRP A;  1NK7 A;  2P5O A;  3TR8 A;  2VG6 A;  4I9L A;  4CF0 A;  4FJ7 A;  1NK6 A;  3KK1 A;  3OYF A;  3D45 A;  3V9X A;  1YVU A;  2D0A A;  2WON A;  3MED A;  4AHT A;  1JL1 A;  4FJ8 A;  3OYL A;  5J1E A;  4DF4 A;  2YNI A;  4CFB A;  4ICL A;  3KKS A;  3IAY A;  4KAZ A;  1QS4 A;  4DTO A;  4HCC A;  1JLA A;  1N5Y A;  3K5M A;  4KHN A;  1VRT A;  2RPI A;  1HNV A;  3ZT0 A;  5HRN A;  4FZZ A;  2DFH A;  2QXF A;  3AVA A;  4RG8 A;  3QNO A;  4FJM A;  5KTQ A;  3VQQ A;  2P51 A;  1HQU A;  4CJS A;  1VSL A;  4FW2 A;  2E4L A;  3AV9 A;  1DTQ A;  2X6S A;  3KKR A;  3MEE A;  1VSJ A;  3O3F A;  2GV9 A;  3AA2 A;  1TK5 A;  2B6A A;  2KZM A;  4CJF A;  3KK2 A;  3K5N A;  3QIP A;  4FVM A;  2HHS A;  3QEI A;  3HYF A;  2O4G A;  3CFO A;  4DQP A;  5CYQ A;  4ID1 A;  3O3H A;  4QCL A;  1RDA A;  3LAK A;  5FDL A;  1HJR A;  2YV0 X;  1HYZ A;  3LAM A;  4M45 A;  4JS4 A;  4CHZ A;  4F3T A;  3AVM A;  2ZD1 A;  1L3U A;  1IKV A;  4DTX A;  4KB1 A;  4NCA A;  3ZSW A;  3OS2 A;  4ELV A;  2HHU A;  1HYV A;  1RBV A;  1ASW A;  1SV5 A;  1TKZ A;  4AHC A;  3OYE A;  3QEP A;  1XI1 A;  1ZBI A;  5KGX A;  1J54 A;  4Q5V A;  1NJW A;  1BIU A;  2ATQ A;  4J2E A;  1HYS A;  4DQR A;  4IFV A;  1FKP A;  4R5P A;  2XY6 A;  2BAN A;  2PZS A;  3NAE A;  2RF2 A;  5J2P A;  4C8L A;  5K14 A;  2P1J A;  3NH2 A;  4KRF A;  4N47 A;  4Z4E A;  3OYJ A;  4N76 A;  2WOM A;  3VQ5 A;  4H4O A;  1Z26 A;  4DLE A;  1HRH A;  1F21 A;  4NCG A;  1S1U A;  3AVG A;  3KLG A;  4KB0 A;  4E19 A;  1CZB A;  4E3S A;  4O44 A;  4CEE A;  2HHW A;  3AO2 A;  5CZ2 A;  3QNN A;  4I2Q A;  3U3G A;  4CGG A;  4G1Q A;  4TSX A;  1J53 A;  2YNH A;  5E41 A;  3NCI A;  1SKW A;  4FLU A;  2Z1G A;  3MEC A;  1W0H A;  3DRS A;  3O4Q A;  1HMV A;  4M41 A;  5KI6 A;  4CEA A;  1S1V A;  4CJQ A;  3V1O A;  4FLV A;  3VN5 A;  4KHQ A;  1LWC A;  3AVC A;  2I5J A;  1KFD A;  3LP0 A;  1T7P A;  5JS1 A;  1C0T A;  1QHT A;  3B6P A;  1BGX T;  3LAN A;  4B9T A;  1R0A A;  1KTQ A;  2YNF A;  2XRI A;  3CYM A;  3SI6 A;  4DSJ A;  3BGR A;  1NK0 A;  1WAJ A;  3TWH A;  3ZT1 A;  1QE1 A;  4Z4H A;  1U4B A;  4FJ9 A;  1KLN A;  1JLC A;  3AVJ A;  4K8X A;  1BQM A;  4DFJ A;  3MXM A;  2QKK A;  5HRS A;  4Y1D A;  3AA4 A;  5J2M A;  1RBR A;  1KVC A;  4DTU A;  1L5U A;  3ASM A;  3VQ8 A;  4N5S A;  3DLB A;  3DRP A;  1IKX A;  1BL3 A;  3V9Z A;  3RWU A;  4W5O A;  4HUF A;  4KPY A;  2FBT A;  1S9E A;  3DLE A;  1QSS A;  1T03 A;  4C8O A;  1NK8 A;  4FXD A;  1SKR A;  2OPQ A;  2XY5 A;  3EY1 A;  2OPP A;  3CFP A;  3V1R A;  1SL1 A;  1RT3 A;  2EHG A;  1Z25 A;  4CF9 A;  2B4J A;  2EX3 A;  3M8R A;  4FLT A;  3A2F A;  3SPZ A;  4DU4 A;  3SUQ A;  4CJ5 A;  4FK4 A;  4AHR A;  3AVI A;  3SCX A;  4FJN A;  4JLH A;  4DF8 A;  3ULD A;  4BAC A;  3S3O A;  2QK9 A;  1VSI A;  1NKE A;  4J2B A;  4W5R A;  1KCF A;  3IRX A;  4HTU A;  4CJU A;  1I39 A;  3P5J A;  4AHV A;  1ITG A;  3THV A;  4DTJ A;  3V1Q A;  5FRM A;  3DLR A;  2G8I A;  3G0Z A;  4YNQ A;  1G15 A;  3SNN A;  1C1A A;  4NYF A;  3T1A A;  4E7L A;  1ZYQ A;  1FXX A;  1WN7 A;  5HLF A;  3ZT3 A;  2G8V A;  5FRN A;  3OYA A;  1VSH A;  5HP1 A;  3NH1 A;  1LAV A;  1NK5 A;  3RR7 A;  2VG5 A;  4LSL A;  2HND A;  4RW8 A;  4N41 A;  5KRS A;  3SYZ A;  4DU3 A;  1SL0 A;  4PWD A;  4K8Z A;  1BHL A;  4OGC A;  4E89 A;  4OPK A;  3OY9 A;  4E7H A;  2KZZ A;  1WSE A;  3C6T A;  4B8C A;  3SJJ A;  4PUO A;  3L2W A;  1RCH A;  4DTR A;  1Q8I A;  1C0U A;  1EX4 A;  3QIO A;  3ZSV A;  2G8H A;  3AO3 A;  5SZT A;  2GUI A;  3C95 A;  4LH4 A;  3TAM A;  4DQS A;  2E6M A;  3ZSX A;  1EP4 A;  2KW4 A;  4B8A B;  3S3N A;  3VQE A;  4M3W A;  4KTQ A;  4LD0 A;  3MXJ A;  3V4I A;  1MU2 A;  2RKI A;  3ZSO A;  1B9D A;  3LP3 A;  3I8D A;  3LWL A;  3M8Q A;  1HPZ A;  4BE0 A;  4DFM A;  3L2R A;  4B9V A;  4RW9 A;  3OYB A;  3HST B;  4DFK A;  4HHT A;  1TKX A;  1TKT A;  3OYD A;  2X78 A;  4E1M A;  4CK2 A;  3ZSQ A;  4FJI A;  4KHW A;  1RBS A;  4O4G A;  1K6Y A;  2BDP A;  2KFN A;  1S5J A;  1RT7 A;  4GVM A;  3VQC A;  4KTW A;  3CM6 A;  4FLW A;  3HVT A;  3L3V A;  3OYC A;  2YHA A;  3RMC A;  3SPY A;  2HNY A;  4E1N A;  4OKE A;  1RDC A;  3ZSR A;  2OPS A;  1S6Q A;  4ZTF A;  3JYT A;  4DSK A;  2AJQ A;  1B92 A;  3QEW A;  1RT5 A;  4FJG A;  3K5O A;  1I3A A;  3OJS A;  3TAG A;  4ZHR A;  3NGZ A;  4DFP A;  4LY7 A;  4M3X A;  5FRO A;  4KHY A;  3H08 A;  2HW3 A;  4M3R A;  1D8Y A;  2F8S A;  1JXE A;  4B3O A;  3NF6 A;  3OYN A;  4DMN A;  4CF8 A;  3QET A;  4AHS A;  1WSG A;  4CHP A;  3OYG A;  4CJP A;  5CZ1 A;  4DS5 A;  4UQG A;  4CJW A;  4M3Z A;  4DTM A;  1QSL A;  3KD1 E;  1ZBH A;  5SWM A;  3KK3 A;  1VSE A;  4KO0 A;  3V81 A;  3PY8 A;  4CGI A;  4J2A A;  1RNH A;  3LDS A;  4AHU A;  5C24 A;  3NDK A;  4E7J A;  3TAB A;  1BI4 B;  3DMJ A;  4OGE A;  5J2Q A;  1REV A;  4KI4 A;  1GOB A;  1VSK A;  3NBP A;  4FK0 A;  3HP9 A;  2JGU A;  4CJV A;  1C1B A;  4OLA A;  1ZBL A;  1XC9 A;  1KVA A;  1VRU A;  1KVB A;  3PX4 A;  4DTP A;  3PX0 A;  3MXI A;  2XY7 A;  4CK1 A;  3VA3 A;  3NGY A;  2NUB A;  2PYL A;  2HHT A;  3ZT2 A;  3KLI A;  4XIU A;  3AO5 A;  1XHZ A;  3FFI A;  4LH5 A;  1S1W A;  2DFF A;  2Z1H A;  3C94 A;  3ZT4 A;  4CJL A;  2Z1I A;  3RRG A;  3NF8 A;  4B9L A;  4ID5 A;  4B9M A;  2G8W A;  4DU1 A;  1A5V A;  2HNZ A;  4Q0B A;  1WLJ A;  1U47 A;  2PY5 A;  4DTN A;  4KV8 A;  4PA1 A;  3M8S A;  1YT3 A;  1EKE A;  1QTM A;  1C6V A;  5T7B A;  2D5R A;  1KLM A;  4FM2 A;  1JXB A;  4EP5 A;  1L3V A;  4QOZ B;  3LZJ A;  1LW0 A;  4FZY A;  4AH9 A;  4N56 A;  2YHB A;  3RMA A;  1DLO A;  4C8M A;  4CHO A;  4BDP A;  3T3F A;  5HBM A;  4CHY A;  3SUP A;  3EZ5 A;  3QLH A;  3TAQ A;  5I3U A;  3HM9 A;  3HO1 A;  3SV4 A;  2X74 A;  5KGW A;  4CGD A;  3BDP A;  2DY4 A;  3UIQ A;  1RDD A;  3NF9 A;  1Y97 A;  3SV3 A;  4OLB A;  3IG1 A;  4CEC A;  4IKF A;  3QO9 A;  4M42 A;  4H8K A;  3NH0 A;  3OJU A;  1Q9X A;  2OZS A;  4FJK A;  1D9F A;  4MQ3 A;  4RW7 A;  3VQB A;  4F8R A;  1TL3 A;  4ZTJ A;  4EP4 A;  3AVL A;  3NF7 A;  2IDO A;  4CEQ A;  3KIO A;  4O0I A;  4BWJ A;  3VQP A;  4CED A;  3F73 A;  1B9F A;  2R7Y A;  3AA5 X;  2OA8 A;  2D0B A;  2IGI A;  3M8P A;  4L8R B;  4BE1 A;  4W5T A;  1NJZ A;  1D5A A;  1IKW A;  4JRQ A;  4KFB A;  4CER A;  3V6D A;  1IH7 A;  3I0S A;  4Z4G A;  3AVF A;  3L3U A;  3SQ0 A;  4CEB A;  1J5O A;  1CLQ A;  3HPO A;  4RW6 A;  3RMB A;  1NK4 A;  1WSJ A;  2X6N A;  1U49 A;  2HHV A;  3MEG A;  4O5B A;  2ETJ A;  3VQ9 A;  3OS0 A;  3ITH A;  3NFA A;  1TVR A;  1WSI A;  1S1X A;  4O0J A;  4DTS A;  3DM2 A;  3PO5 A;  5KRT A;  1RBU A;  1YTU A;  4KHS A;  3LWM A;  3VA0 A;  3HPH A;  3P83 D;  5DMR A;  1C1C A;  5C25 A;  2VWK A;  3QIN A;  4B9U A;  3DOK A;  3RR8 A;  4OVL A;  4CJ4 A;  3NE6 A;  4EZ9 A;  4FJ5 A;  1VSF A;  4CIF A;  3SQ4 A;  3LAL A;  2A1S A;  1CZ9 A;  3D0P A;  3QES A;  4J2D A;  2Q3S A;  3ISN C;  5J2N A;  2KQ2 A;  4KI6 A;  4FK2 A;  1EXQ A;  4IBN A;  2E6L A;  5DK5 A;  3WNE A;  1KSP A;  1JKH A;  4I7F A;  3TAN A;  2D0C A;  4W5Q A;  3G10 A;  4FLY A;  1WSH A;  1NKB A;  1SUQ A;  3WNG A;  3PX6 A;  4Z4F A;  5CY4 A;  4DSE A;  1N6Q A;  1TGO A;  4FZX C;  2IAJ A;  2JLE A;  3C6U A;  3TI0 A;  4CIE A;  4DWI A;  4M3Y A;  1SKS A;  2XO7 A;  1RTD A;  4RW4 A;  4KHU A;  3O3G A;  2FC0 A;  2FBY A;  1UAX A;  5I42 A;  4M3T A;  4I2P A;  4Z4I A;  4CE9 A;  1BI4 A;  3OYK A;  2IS3 A;  3L2V A;  3SZ2 A;  3QER A;  3DI6 A;  3KJV A;  1NKC A;  3DLH A;  1A5X A;  5HRR A;  3F9K A;  1RTH A;  4CJE A;  3NGI A;  3K57 A;  4M3U A;  1IKY A;  3HPG A;  3AVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...